1ITYA

Solution structure of the dna binding domain of human trf1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
EKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRF1
publication title Solution structure of a telomeric DNA complex of human TRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2002-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ityA00
1IC8A 1LE8B 5IOZA 1MBGA 4Y52J 3CCYA 1GVDA 2XB5A 5GP9A 4A3MJ 1WGXA 3BR0A 2ZB9A 1CQTA 3HGGA 5F1JA 1ZTRA 3RZOJ 1DU6A 3K2AA 1JKRC 2XGCA 4G12A 2N8GA 3NAUA 5IPAA 5FKMA 1IGNA 2ME0A 1I3QJ 3BR5A 5FKNA 2HXIA 1TC3C 1ETQA 1Z77A 4BKXA 1UHSA 2DA4A 3CMYA 5C4XJ 5FKLA 1IDZA 4UUTA 1JT0A 3PM1A 1JKPC 2M2EA 4JX5A 4JX4A 3LSRA 3JRGA 1FIAA 3FK6A 1HCRA 5EGOA 1ZKGA 3JRFA 1JUPA 1JKOC 2HOTA 3BG3A 4J19A 1D5YA 1WI3A 2L7ZA 1SANA 2CRGA 3WHBA 2O9LA 1RKTA 4B1RA 3S1MJ 2Y2ZA 3IH4A 4CYCA 4X6AJ 3CDLA 3FK7A 1U8BA 3BR6A 3FIWA 4A3JJ 1A6IA 2K40A 2L9RA 1NTCA 4XK4A 4AC0A 3NARA 1RKWA 1Y1WJ 2GM4A 4D7NA 1RPWA 4M3BA 2E2JJ 3ZQHA 3ZQGA 2CJJA 2E19A 3GBGA 3UKGA 1HDPA 5M5YJ 3B6AA 3IH2A 4DYQA 1IDYA 3MVPA 1LFUP 3FISA 1ENHA 1ETKA 3TP3A 4C2MJ 3L1PA 5JLWA 3OSGA 1BA5A 2R5YA 4FCYA 4BBSJ 1MBEA 2JJ7A 3GTMJ 2OPTA 2YU9J 3LSJA 3JRCA 4A3GJ 2Y9ZA 1JTXA 1FJLA 2M9HA 4IHVA 2LR8A 2E1OA 3HOXJ 3LSPA 1OCTC 1JUMA 1BW6A 3A01A 5EG0A 3H3VK 4D7MA 4C3IJ 4A3LJ 2G0EA 1HDDC 2IEKA 2X48A 3OIOA 4NDLA 5FKOA 2R5ZB 4JP0A 1BL0A 2ELKA 4A3KJ 1W0UA 1MBFA 5E3MA 4L5EA 4DYRA 2ECBA 2HOAA 2WAQN 2R93J 4M3EA 2NVYJ 3RQIA 1QVTA 4XRSA 3HOYJ 2AHQA 5JLXA 4IHWA 2DA3A 1GV2A 2IBDA 1JJ8C 3SDGA 2LY9A 1X2NA 3QQAA 2ECCA 2NS8A 3JRAA 3BG9A 5C4JJ 5E3NA 1XC5A 3SJMA 2DMNA 3HB9A 4QIWN 4D5FA 2JA8J 1VF9A 1WPKA 2CU7A 3HGYA 2L7MP 2HOSA 1VFCA 1TWFJ 2EBIA 2XGEA 4A3EJ 4C3JJ 5IYBJ 1FEXA 1U9OA 1IRZA 2JK3A 1ZR4A 1GDTA 3RZDJ 1HLVA 9ANTA 3BQZA 2IAIA 1BW5A 2JA7J 1K61A 2JWTA 2WB1N 3BTCA 2R0QC 1NK3P 4DZPA 5F0FA 1MSEC 1RR7A 1LE8A 2DJNA 2M8GX 2NVTJ 2CQQA 5DTDA 1I6HJ 1RESA 5F04A 2LKXA 1LFBA 4DZJA 1TWAJ 5EDNA 3HOUJ 4JX6A 2PMZN 2NVQJ 3JRDA 1APLC 1F43A 5IP6A 1UMQA 2VUMJ 2L7FP 3TP0A 3H0GJ 3GTJJ 5IYDJ 5M5XJ 4CYCB 4MFEA 2HYJA 3Q0WA 4BY1J 4C3HJ 2TRTA 2Y31A 3PO2J 3MKLA 3BR2A 3M3YJ 5FKKA 2HXOA 2HI3A 2KT0A 3BG5A 3GTOJ 1FIPA 1UG2A 3ZQIA 3GTQJ 2EZLA 1K83J 2FD5A 5EZGA 5F08A 2VKEA 2O7OA 5F0CA 1H88C 1WH7A 3I4MJ 3HKZN 1TWGJ 4LOCA 3W6VA 3BTIA 1PUFA 5IP9J 1VNDA 2DMUA 1JT6A 3F0CA 4BBRJ 2VI6A 4BY7J 5K7HA 1AKHA 2LD5A 2QF7A 1ETWA 2DA5A 5M3FJ 1MBKA 1EF4A 5K7ZA 2XSDC 3S15J 3Q0VA 2R5YB 1E3OC 2M34A 3Q0UA 5J1RA 1TWCJ 4MLOA 1G2HA 1ZK8A 2YS9A 1VI0A 1IJWC 2MW8A 3BTLA 1QVUA 4DW6A 3A01B 1W0TA 5EG0B 1S7EA 2CUFA 1H89C 2DMPA 2R7ZJ 1GT0C 1JTYA 4RDUA 1ETYA 3HOVJ 2MGQA 2LFBA 3D1NI 1MBJA 4A3FJ 3LNQA 1T33A 4MO7A 4FTHA 2NVXJ 2XB0X 1YRNA 5F0HA 4UUSA 3BTJA 2JA5J 4AYBN 1B72A 3LOCA 4IEJA 4ABZA 1IUFA 4MFDA 3GTGJ 1POGA 1Z0XA 1MSFC 3HDDA 2TCTA 4XRMA 2CQXA 5K7FA 2DMTA 2ID3A 3VPRA 5FLMJ 3G1MA 4GFBA 3S16J 1FTZA 1P7IA 1JGGA 4I76A 3IH3A 1QPIA 2DTZA 5C44J 4X1EA 3TW6A 1ZQ3P 3JR9A 1JJ6C 2XGDA 3S2DJ 2DA7A 4JYKA 3BR1A 1B8IA 3I4NJ 3S1RJ 3OSFA 2LLKA 3A02A 5GPAA 2EQRA 1IV6A 4A3IJ 4XRSG 3ZQFA 3DEWA 5EEAA 1U9NA 2NS7A 3TW7A 2R92J 1NK2P 2JMWA 1ETXA 3HM5A 3A03A 4AUXA 2EZKA 1U78A 1Y1VJ 2EZHA 2LP0A 2VPRA 4V2GA 3SFIA 2EH3A 1OCPA 2AO9A 1ZGWA 2X6OA 3MN2A 4W1UA 1R9TJ 1O4XA 1ZR2A 4D5CA 3O8GA 1MBHA 4A3CJ 4M3DA 2LK2A 2M0CA 2K9SA 2DA6A 2D5VA 3OOUA 2K9NA 3JREA 1ITYA 2COBA 2XPVA 5EGOB 4S0HB 5DS9A 5FLVA 5M3MJ 3RKQA 2K9QA 3JRBA 3B6CA 5EZHA 1IG7A 1H8AC 3FKIJ 5J1UA 3GTKJ 5IYCJ 2B63J 1P7JA 1HOMA 4QSHA 2FQ4A 2DN0A 1DU0A 2DA2A 3BR3A 3K7AJ 4W97A 3ZQCA 1RETA 2EZIA 2ME6A 5BNGA 5GPCA 1JUSA 1XS9A 1WH5A 1PUFB 5EYRA 1AKHB 3E7LA 3HOZJ 1TWHJ 2O8KA 1HF0A 1F36A 5F27A 1FTTA 2VKVA 3PO3J 2W48A 2ID6A 3S2HJ 2OF7A 3GTPJ 2P81A 5IOYA 2NOGA 1Q1VA 2H1KA 4B4CA 3LSGA 5EF6A 1T56A 3M4OJ 3S1NJ 5C3EJ 2KDZA 2XRLA 2GLOA 4EEFG 4M3GA 3S14J 4RBOA 3IV5A 4M3FA 1MH3A 5M5WJ 4FISA 2DMQA 2FX0A 2WV1A 2X9DA 3S17J 2Y9YA 1ORKA 1I50J 3QPLA 1ETOA 1AU7A 2LTPA 2HDDA 4DYCA 4M6VA 1YRNB 4UUSB 5HODA 1B72B 1OJLA 2JN6A 2E2HJ 1X2MA 1JKQC 1QRYA 2XPUA 5J1YA 4FE4A 3HEFA 3BT9A 3BQYA 2L0KA 3GTLJ 4HNVA 3WHCA 4XIDA 2LVSA 2QCOA 5E3LA 3TEDA 3G1OA 4B3AA 1OFCX 3C2BA 2Y0SN 1AHDP 3DCFA 1A5JA 2DA1A 2HQ5A 3JRHA 3HBLA 4IHXA 2RAEA 1X58A 4XICA 1GV5A 1XG1A 4A69C 1B8IB 5E3OA 3Q3SA 5J3LA 2FJ1A 3CQZJ 1SFOJ 2JA6J 4BXXJ 1MNMC 4V2FA 3JRIA 2GBYA 2MG4A 4I6ZA 1MH4A 1BJZA 2XPWA 4QTRA 3HOWJ 1ETVA 1GUUA 3QPSA 5IP7J 2I10A 5FJ8J 2YUSA 4A3BJ 3S1QJ 4A3DJ 2R5ZA 4FE7A 4IHYA 2E2IJ 2CUEA 2Y30A 3O8HA 4MIMA 4A93J 3G1LA 2MSYA 1WCMJ 4Y7NJ 2H8RA 3ZQLA 3ZOBA
chains in the Genus database with same CATH superfamily
3LFUA 1LE8B 4NNJA 2FEZA 4QWQA 4U0WA 2EV5A 2PEXA 1WRJA 1J7KA 2KKOA 2C6YA 1D5VA 2D2WA 4GGGA 2IXSA 2F5DA 5GP9A 4IQ4A 3WTZA 2OCCH 1O7FA 1DGWY 5LHGA 1T6SA 3Q5FA 4XN3A 2M4GA 1CQTA 1MJ9A 4BEHA 1DU6A 4R1HA 4KITB 1MKMA 5D6EA 3NAUA 3D5SC 3U1KA 5ICFA 2QBYB 3HHHA 2ME0A 2W57A 1ZARA 3BR5A 5FKNA 3M9AA 1TC3C 4OIOF 1Z77A 2W00A 1UHSA 2DA4A 2IS4A 1ULYA 5C4XJ 4LK1F 5FKLA 4ZTJA 1LKXA 2V9PA 3OR2C 3J81K 3E5QA 1JT0A 4I01A 3CLOA 3P9KA 3H0DA 3R61A 2GIZA 2GA1A 2XF5A 4YRVA 4JX5A 2E1MB 5CKTA 3LSRA 1L0OC 1XDUA 2CFXA 2W1OA 4G6QA 1FBUA 2ZMEB 4A5NA 5IT3A 3FWEA 5A2QZ 3JRFA 3F8MA 2Z16A 3CCUI 1LNWA 1D5YA 2JSCA 1WI3A 2L7ZA 2DPUA 3S8PA 2R7FA 1RKTA 4Y3OA 4NBQA 3RYRA 3VDXA 4AVPA 3IH4A 2VJ5A 4BXUA 3FK7A 1U8BA 2LNBA 4ZYGA 3I3LA 3BR6A 3CJTB 3FIWA 2L9RA 1NTCA 3P7NA 3RKYA 2QLZA 2K4JA 1Y1WJ 1U5TB 4D7NA 2Z5UA 2BVMA 2E2JJ 4BJTA 1TQIA 4U88A 4I02A 2OZ6A 5ILSA 2ZJRF 5FB2A 1IRFA 2DFFA 1MMNA 3HRSA 2P7VB 5M5YJ 1FOWA 3B6AA 1WHUA 3IH2A 3CCRI 2XKOA 1QHHD 4PFOA 2LC2A 3W3CA 3WTWC 3K6GA 4C2MJ 3SZTA 1MDMA 5JLWA 1D0XA 2GXGA 1BA5A 2R5YA 2GZWA 3QYEA 2OQRA 4LB5A 2OPTA 3B02A 2XRNA 3PFYA 5LBQA 2Y9ZA 4HSRA 4PJJA 4LLLA 4EJWA 2W4SA 1FJLA 3VYTB 1I5ZA 1FBSA 1LVKA 3LAPA 4AWXB 3ASNH 2QUFA 2VQGA 4KIFA 4WWCA 3LSPA 3QU6A 2PFBA 3KCCA 1BW6A 1E3PA 3DEEA 3H3VK 4C3IJ 4A3LJ 4HLXA 5J47A 5FO5A 4CO8A 2FBKA 4WXDA 4NDLA 1O7LA 1G3TA 3FMQA 2BBYA 3DU5A 4JP0A 2X51A 1BL0A 2GIVA 4CZZA 4A3KJ 1K6YA 1W0UA 2KLOA 3DKXA 3CF2A 2K4BA 2L54A 3HUGB 3SHFA 4EJVA 1T08B 1X1DA 1R71A 3RQIA 4FX4A 5IY5H 2JUGA 2DA3A 2MD5A 4IHSA 4PFPA 1J9IA 2WY8Q 3SDGA 1D8JA 2UUZA 3ZMZA 1UFMA 1Z7LA 3A4CA 5LGUA 2ECCA 2L3DA 4CCNA 3ROUA 1F4KA 1DUXC 3Q9VA 2BY3A 4M9XA 4QIWN 4ZZLA 2K02A 2JSPA 3OYGA 3C2HA 2QSFX 4LJZF 2HOSA 4Q48A 4C3JJ 1BR4A 3CP2A 2AS5F 3H92A 3K69A 2VQLA 3ABKH 3VFZA 5LD2C 4A2UA 1GDTA 3RZDJ 3GFIA 2FUG2 1HLVA 9ANTA 3BQZA 2JA7J 1U2WA 3IRQA 1FOYA 2JWTA 2WB1N 4F55A 2BHYA 1FLIA 5J8CA 5F0FA 1MSEC 1RR7A 1W7PD 2COMA 5BMZA 3WE3A 2KJBA 2NVTJ 2M8GX 2RC4A 4IQJA 5F04A 3AL0C 3ZXSA 3NQOA 4BE1A 4RA2A 1YJWI 2ZJPF 3U1DA 4XOTA 3QRFF 1TWAJ 2D45A 4HAMA 2WWYA 3HSRA 4U0YA 1LQ1A 2NVQJ 1KQ0A 1Y6IA 5IP6A 1UMQA 2L4AA 2V1XA 1QBJA 2L7FP 3FXOA 3OIQA 4GRIA 4CZCA 3GTJJ 3IAS2 4CYCB 2STWA 2R7TA 2QEXI 3M3YJ 3DBLB 4HG2A 1P9QC 2CV0A 1UG2A 3IAM2 5F08A 3TDZC 3MZYA 4XL9A 4ZYHA 1TZLA 3I4MJ 3R6SA 3ZMSA 3LSMA 4LOCA 3BTIA 5HS9A 2VXDA 3VYSB 1PUFA 2LMDA 1VNDA 2DMUA 1T95A 4LMYA 1AKHA 2MYSA 2X6WA 2A69F 2VE8A 1BC7C 1EF4A 1ZHFA 3GUDA 5K7ZA 4XKWA 2RVCA 2JPBA 1E3OC 4MGRA 2M34A 3Q0UA 3AAFA 3KP3A 1G2HA 2XKPA 1IXRC 3PIOF 1ZK8A 1Z21A 2MW8A 1UELB 1WJDA 4DIQA 5LGTA 1I27A 4HF2A 4DW6A 3EYYA 2DFIA 3OV8A 3U21A 5FD5A 3A01B 1W7PA 3HSEA 5B3SH 4BDZA 1Y8QB 2DOFA 2CUFA 4PGHA 2BXZA 2X6XA 1GT0C 4RDUA 3E6BA 3D1NI 3FKJA 3OOPA 1YTYA 4MO7A 2EPFA 5AONA 2XB0X 2I8DA 3IP4B 5F0HA 3BTJA 3PL8A 2JRMA 2FOKA 3WU1B 3BJ6A 3CC7I 3LOCA 4LITA 4DOZA 4IEJA 1TNSA 3H35A 4B47A 2M87A 1LFPA 2AQEA 3GTGJ 1Z0XA 3CDHA 3HDDA 3OY9A 1X19A 2BVLA 1B9MA 4NC8A 4GFBA 1IXSB 5DDGA 1P7IA 3KE2A 3M1EA 5LEKA 3I71A 5AIPA 4ENKA 2F5FA 4X1EA 3H5NA 3JR9A 1HQCA 3W6JB 1JJ6C 2BZTA 2XGDA 3F8CA 3S2DJ 1LB2A 2DA7A 1U0JA 4BQAA 2XAGA 2M3AA 5L3FA 2VQHA 2YPRA 5JR3A 1B8IA 1FBQA 1FSEA 3S1RJ 2VC0A 3A02A 2P6SA 5FRMA 1T8IA 3E0JB 4M71A 1J5YA 4XRSG 3ZQFA 2ESNA 3DEWA 1BIAA 1U9NA 2PI0A 2DXIA 4B44A 4XN0A 3HOTA 4BL0B 1SVMA 1ETXA 2HQAA 3HM5A 3NRVA 3PNTA 1I3AA 3RTRA 4UVCA 1W36D 2VPRA 3K9TA 3SFIA 5KAFC 1DGRM 3FX3A 1OCPA 4RB1A 2WV0A 2AO9A 1FOXA 1ZGWA 1W36C 1B59A 3OYNA 1LEBA 1R5HA 4W1UA 3BG7A 3HOSA 2Y69H 1K7AA 4A3CJ 2W25A 2K9SA 5TRDA 2EFWA 1U5TC 1V5GA 3GVAA 2UWMA 2K9NA 4RAFA 3BP8A 2COBA 2BHZA 1OCCH 3JRBA 3WTVC 3B6CA 4UHTA 4S05A 3MZ8A 5EZHA 3ECHA 4DQ2A 1IG7A 2QWWA 2QBYA 1BI1A 4O3MA 5J1UA 1YHQI 1W5CC 3GTKJ 4BAYA 4H4KC 1OLTA 1IRXA 3DWLE 2KL4A 3M1CA 4MNUA 1I6XA 1UHWA 4HOBA 2X4HA 1SVOA 5J8FA 4P5OA 3OL3A 4ESJA 2J5OA 1MZBA 2A5YB 4GCVA 2ME6A 5HLHA 1JUSA 5L3EA 4EM2A 2R7VA 1Z6TA 3P5JA 3MZHA 2NYXA 4CXFA 1XN7A 3NEUA 4ZC3A 3WTSC 4KT5C 3DPLC 3HTSB 3HOZJ 2VASA 2R7UA 2ZMEA 4UB8C 2GA2A 1OR7C 1HF0A 1W5SA 1FTTA 3QP5A 3S2HJ 2OF7A 2LSOA 1YW7A 1UHMA 4XKCA 1T56A 2KZGA 4EJUA 3S1NJ 1S7OA 5C3EJ 1Q1HA 2V6EA 4EEFG 4M3GA 4AYBA 1B1BA 1A35A 4M3FA 3J7ZI 3CF5F 4FISA 2KFDA 3H36A 4XRFA 2X9DA 1D1AA 2Y0SA 1U5TA 2KRCA 2RQQA 5JI6A 2OD5A 3TBIA 4M6YA 1QZZA 2QGUA 5CLSA 3H5AA 2OU2A 5HODA 2EV6A 4OAYA 5K5RA 2JN6A 5H6QA 1KQ9A 3QOPA 3V8LA 1BBYA 1QRYA 5J1YA 2PX9A 5GADJ 3HEFA 2K3FA 1FT9A 3FXQA 3WG7H 2H27A 1Y8RB 3WHCA 4BQOA 2VT2A 2FF4A 3DPUA 4BDYA 2NVUB 3C2BA 2Y0SN 4U7DA 2P6TA 2UZKA 2KIFA 4E7IA 3LSTA 3OYMA 3JRHA 4N9IA 3E97A 1TTYA 1R1VA 4MQVA 3MKZA 2R7SA 2L4MA 2F48A 3DPTA 3TO6A 3M8FA 2QSGX 2JA6J 1MNMC 3H9JA 2FBIA 2H1LA 3JRIA 4QTRA 1IV8A 1OR7A 1ETVA 2EWNA 1GUUA 2XF7A 2YUSA 3I5UA 2R7QA 2H8WA 4HNUA 1SC7A 2Y75A 4HDVA 1R1TA 2CUEA 5HS7A 3K4JA 3CCQI 1A36A 3HUGA 3GYHX 1VQKI 1RUNA 2CG4A 1D0ZA 3ZOBA 2LRDA 3ERED 4BHPA 2XSJC 2DFEA 4E7JA 4I98B 5IOZA 2V7FA 4AVZA 2EJRA 2L5QA 2L9NA 5DUIA 2XB5A 3F3XA 4A3MJ 4OOIA 2ZB9A 1OYIA 3QPTA 3F22A 4G9YA 4P9UA 1WKMA 4HV5A 4G12A 4GO1A 2QYOA 2L01A 5BPDA 4RM3A 1D3YA 5FKMA 4WX9A 4BHBA 1RIOH 2FRHA 1BOBA 1P4AA 3HZJA 3JTGA 1T38A 2ACJA 1ETQA 1YX3A 3BDDA 2DK5A 2QQBA 3C18A 4E70A 4CH7A 3CMEI 1P92A 1IDZA 2Z9OA 1E0EA 2IA1A 4NC6A 4HA8A 1R58A 3PM1A 5E1XA 2NAZA 4LGWA 4YFXF 1Y39A 3BZCA 4BYYA 3FHZA 1EV7A 1G59A 2JTVA 3BOQA 5K1YA 1FIAA 2AQFA 3FK6A 3K4NA 2BW3B 1HCRA 5EGOA 1PP8F 1MNDA 2KISA 1ZKGA 1JUPA 1RI7A 1JKOC 1ZG5A 2JVHA 3HPGA 1VQ6I 1V5FA 2BE5F 5KHDA 3RPUD 2K9MA 3HRTA 3WHBA 1ACIA 1FMWA 2O9LA 1PVEA 3ERMA 2OBPA 4YEJA 3WU0A 4B1RA 2L9VA 5D5UB 1WJ5A 4CYCA 3S1MJ 5FGMA 4OU0A 1BOAA 1QNTA 1GXQA 2K40A 3R60A 4AC0A 2CFOA 3JTHA 3NARA 1RKWA 4HPQA 3V4GA 1YFHA 1MMDA 3AL0B 2E19A 3GBGA 5F64A 4DJAA 3J7AO 2G7HA 2MLKA 2FU4A 3BPXA 2EIJH 1FZPB 1IDYA 2XAFA 1TLHB 4C9YA 1S72I 3MVPA 2ZCWA 4IF4A 1BI0A 1H9TA 1ETKA 3L1PA 2VC1A 3DTEA 1VQ8I 2IT0A 3FDYA 2FMYA 5KVRA 4WXHA 2QKMB 3AFHA 2B0LA 1IF1A 3OYBA 2W82A 1KU9A 3LSJA 3ZPLA 4M9ZA 4LLNA 1HXDA 5LEJA 1MGTA 2HGCA 4P55A 5BOXA 2DYRH 1Z7UA 3HOXJ 2CS3A 3A01A 4Z6YA 3CCLI 4G7ZF 3F72A 2MC4A 3RKXA 3CMMA 3KP5A 1HDDC 2LKPA 2F2EA 2X48A 3S3NA 4BS9A 1MD0A 4I09A 4P1WA 1BM9A 2CV2A 1KGSA 2ELKA 4HX8A 1BR2A 1R22A 3FXJA 3EQLF 2MABA 3WGGA 1FX7A 2HVRA 2NVYJ 4UB6C 4XLCA 1Z9CA 3A2KA 1QVTA 1R23A 4XRSA 3HOYJ 4IHWA 4OMYA 2IGOA 2MLGA 3CJQB 1NG7A 3I9V2 1IN5A 1W4MA 2OCEA 5B66C 2R3SA 1YJNI 3S2WA 2FNAA 3T8TA 5C4JJ 4HF0A 1KZHA 1R5GA 5ILUA 4D9JA 2DMNA 1YW9A 3L2VA 2IVMA 3REOA 5FFZA 4D5FA 1Z3YA 1VF9A 3LL7A 3S3OA 2VT3A 3V7RA 1Z05A 1VFCA 3DLLF 2EV0A 2DQLA 1RC9A 2JK3A 2E7WA 5TGTA 2MH9A 1OYWA 4A5MA 1OPCA 3KLOA 2X85A 1EH8A 3DLAA 3RDIA 4ESBA 3BTCA 4A0YA 4HDUA 1K61A 2KIQA 3X2QH 1TP4A 3CESA 2VBWA 4DZPA 2W7NA 1GLNA 1JXSA 2FQ3A 3IC7A 3KYDB 2CQQA 3ECOA 1I6HJ 3G6EI 2LKXA 4YFKF 2HTSA 3GMEA 4DZJA 3MQ0A 5EDNA 3HIFA 5L3GA 2X1DA 1SAUA 1YLFA 1L3LA 3JRDA 1APLC 4D1QA 3J7YJ 3QP6A 5IYDJ 1XCBA 1FOKA 1FPQA 3UNGC 1SEUA 2KRFA 1ERDA 4BY1J 4CYDA 2OTJI 1QU3A 3J7AY 1F1ZA 1YIOA 2KT0A 2WAFA 2Z1DA 2BOLA 1HKQA 1YOVB 2IP2A 3ZQIA 2XAJA 2FD5A 3IWFA 4XLPF 4BE0A 2DOAA 2XAUA 3PSIA 4LLGF 5D6FA 5F0CA 1H88C 1WH7A 1YYVA 1TWGJ 3W6VA 5IP9J 1TT5B 2R7WA 2GQQA 1WJEA 3N4MA 4BBRJ 5K7HA 4BY7J 1V5EA 2LD5A 3BWGA 2QF7A 1ETWA 2XSDC 4ENMA 2VJJA 5CVJA 1V4RA 3GX4X 1TWCJ 4MLOA 1WVRA 2NNNA 2YS9A 3BC8A 1IJWC 2HPIA 1KONA 4WF2A 3CJNA 3GLLA 3BCBA 2DYSH 1W0TA 5EG0B 1WWXA 3A0HC 1S7EA 5D8LB 3OMYA 1JTYA 3QPHA 2MGQA 2LFBA 4CCJA 1MBJA 2ZBKA 4A3FJ 1SFUA 3VSKA 1T33A 2NVXJ 4U0VA 1VQ4I 2JA5J 2CMPA 5K5QA 3QODA 4ZZDA 4ABZA 1IUFA 4KA4A 4MFDA 4CA0A 2V26A 1POGA 1I1GA 2QQ8A 2EINH 5K7FA 2ID3A 4UXNA 5FLMJ 4XSZF 3S16J 1FTZA 1NHAA 2F5CA 1YE9A 1REPC 3KP7A 5B5EC 1ZYRF 2DTZA 2M8EA 4IRHA 3TW6A 2IRFG 4RGXA 1T2KA 2ZFUA 4EGYA 2A6HF 3L2UA 3H9GA 4XMYA 2JVGA 1OCZH 1QQIA 3FXRA 3L00A 5CJ9A 4M6XA 1FYMA 2WB1A 3OYKA 1PYVA 2OV7A 3DXJF 3K10A 3GZNB 1D1BA 1Z6RA 2EQRA 5KNLA 4A3IJ 1SFEA 4R8HA 2NS7A 3KEYA 3FHNA 1Z1DA 3D0SA 3KPHA 2R92J 1NK2P 2JMWA 2PJPA 3QU3A 2ISYA 2EZHA 2VB6A 1ON1A 4I0BA 1KQ8A 2GOMA 3EUAA 2VJIA 4XSXF 4EM1A 3H9QA 3MN2A 1R9TJ 1B9NA 3PIPF 1O4XA 3PNVA 4G8XA 2A6TA 3SEZA 1XSXA 2HR3A 4D5CA 4JK1X 1CGPA 1S9HA 2E35A 3GEZA 3O8GA 1MBHA 4M74A 2O03A 1LDDA 2V4JC 3F8NA 3DU6A 4KMFA 2M5WA 3T8RA 2JQ7A 3V42A 3CUOA 4ZDLA 4LK0F 3Q9SA 5EGOB 1MW7A 2EIKH 5DS9A 1PDNC 5M3MJ 4L5IA 2K9QA 1N75A 2V9VA 3KIOA 4PK4A 3I59B 3B73A 4U7BA 1H8AC 2QVOA 4NQWB 2PMUA 2XUBA 1XSVA 3HXLA 3SXYA 5F1RA 3LAJA 2ZO4A 5IYCJ 4J00A 3L2RA 2K7LA 1HOMA 4QSHA 2DN0A 1HKTA 2Z33A 3U9GA 1E17A 4IX7A 2Q0OA 4L9NA 3GO5A 2EA2A 2M7BA 4DNCA 2VBZA 1FNNA 2EB7A 2M4KA 2ZKZA 3VB2A 1UAAA 2HKOA 2BW3A 1D8KA 1XGNA 1F36A 5F27A 2X0LA 4I2OA 2VKVA 1QZYA 1ZG3A 2ID6A 2YX4A 3GTPJ 3LA2A 1ZG1A 1ZRFA 5EF6A 4IPAA 3M4OJ 1RR8C 2DODA 2EILH 2KDZA 2FNPA 2W24A 5HNFA 5DCMB 1ZREA 5B1AH 2D1HA 3S14J 2HQNA 2ADUA 4RBOA 3NWSA 1MH3A 5M5WJ 1ZAOA 2CQ7A 2DCEA 2WV1A 4YIFA 4PJMA 4XBFA 2Y9YA 4RAGA 5LLQA 1AU7A 5GTIC 3HRUA 2YSRA 4PZJA 4DYCA 2P5VA 2VL8A 4HZFA 1YRNB 1S7AA 1B72B 1UCRA 2K85A 2LY1A 1DP7P 1YX5A 1OJLA 2IS2A 1X2MA 1JKQC 3SFZA 1WSUA 3DKYA 1W1WE 3BJOA 3TO7A 1K78B 3BQYA 2L0KA 4CUGA 3EYIA 4XIDA 2LVSA 2QCOA 5E3LA 2ZXHA 1S8NA 3WTYC 3TEDA 5DD8A 2K86A 3HJEA 4B3AA 3LQQA 1Z67A 3N05A 3C2GA 1HC8A 4PSXA 3DCFA 1JI8A 1A5JA 1P6RA 2QENA 3KP4A 2NXNB 1XTAA 5CYVA 3CC4I 3ESWB 4A69C 3Q3SA 1T0FC 3D5LA 3O2PE 4CCKA 3CD6I 4NUBA 1NG6A 2JUCA 4CSWA 4G7HF 3NWTA 3SZPA 4FASD 4I6ZA 2XPWA 1BJZA 2V1NA 1BIBA 1F9NA 1ZELA 2RN7A 2XIGA 2I10A 5FJ8J 1IAWA 2VIXA 1R5ID 4A3BJ 5HDNA 1WQ2A 5DM7F 1VQNI 2DQRA 4FE7A 4A0ZA 4F3QA 2BEOA 2Y30A 1O57A 2G7UA 2NOJB 3I0TA 3R0JA 3L2QA 1WCMJ 5J4VA 3S93A 5JVGF 1IC8A 1QA6A 3ZQ7A 2DFHA 3V8KA 1N77A 2QZ8A 3KEQA 2UXNA 5TISC 4Y52J 2BV6A 1X3WB 1GVDA 3CCYA 3CC2I 2B7EA 1C0WA 1SFXA 4HQMA 3FMRA 2BY2A 1WGXA 4QPOA 1W5TA 2K9LA 2TDXA 3CUQB 1ZTRA 3KP2A 4RMNA 5F1JA 1ODDA 3K2AA 2XGCA 2XHKA 2ZJ2A 2HZDA 5IPAA 4A0XA 4RB2C 1IGNA 4MQ9F 1QZEA 2WTEA 3TOBA 4OMZA 1BI3A 2HXIA 2LYCA 4M73A 4XM3A 4ZYAA 2HFHA 1JHFA 5E1WA 3N97A 3TL4X 3QYBA 3FBIB 4UUTA 3F8FA 3SYTA 3TO9A 3AKZA 2EIMH 4CCLA 1KU3A 1JKPC 3ZMUA 1T0FA 2CW7A 4RB3C 1OYYA 4JOMA 4RLQA 4RGUA 1UB9A 4AM3A 3I4PA 3AG4H 4JX4A 1KA8A 4E7HA 1YO5C 3DFGA 1HW5A 3VYUB 1M1EB 3P9CA 4PJ0C 3ZMVA 1X3ZB 1A6QA 1SMYF 2P5LC 2HOTA 1ZRCA 2KIMA 2ZNZA 4J19A 4F91B 1SANA 1G8XA 4ITVA 3R4KA 2IGNA 2ZC2A 4IKFA 5HDKA 3CDLA 2E7XA 5HNHA 3IKTA 4DBRA 1SD7A 4KIGA 2Z3YA 4A3JJ 6PAXA 1R00A 4MEYF 4KICA 4Y13A 4M3BA 2O6GE 4I7HA 4PSWA 4G6DA 3M8EA 2B9SA 2F6CA 4GDFA 2WC2A 2V79A 3UKGA 5J4YA 5DUKA 3H5RA 3CTAA 5H2FC 5B1BH 4OWRB 3LSHA 5JVTA 4GYIA 4XONA 4BUPA 4WK8F 2DW4A 4EM0B 3KLNA 1ENHA 3C7JA 2CQNA 2OUMA 3HL2A 2F4MB 1E3HA 4BJ5C 1B4AA 3KZZA 4IO9F 1S5LC 4KN4X 5ERIA 3GWZA 3ZGKA 2XROA 3AG3H 4BE2A 1MBEA 3PUBA 1WJCA 3VYRB 2YU9J 3K70D 1D1CA 5GAHJ 2WAQA 1JTXA 4L18B 2VKDA 2M9HA 2H94A 3IHUA 5LRRA 4IHVA 2LKSA 3D5RC 5BQTA 3MMYB 1FYKA 1BC8C 3K70C 4P96A 2HYGD 1XSDA 5EG0A 3RKWA 3QAHA 4KNYA 3WE2A 4D7MA 4V19K 2WBMA 2IEKA 1X1CA 3RCOA 2KJCA 2LBFB 1I39A 4Y4RA 4IOCF 1R36A 5L3DA 3BLYA 4QPQA 3GCMA 1VQPI 5KAIC 2CW0F 2IJLA 2Q2EB 2CQKA 4BGDA 4ANJA 2WAQN 4H0EA 3HPHA 3J81Z 3WTUC 4BU2A 1XD7A 1MMAA 4UVAA 2VOOA 4XQFA 2IBDA 3OWTA 1XGSA 3PQKA 2LY9A 1X2NA 4L9JA 3G71I 1RUOA 3VWBA 1VQ5I 3QQAA 2X6YA 3F21A 1F5TA 2IA2A 3BG9A 4G7OF 4UUVA 1MIJA 5E3NA 3WU2C 2H6BA 2L7KA 3HB9A 1IN6A 1LJ9A 2JA8J 1R1UA 3K4LA 2CU7A 1DQUA 5E79C 3FM3A 2XGEA 3QWLA 4A3EJ 3FBNB 1QHGA 4UV9A 5E8IA 1TNTA 1U9OA 2RGVA 3OYCA 4NHJA 1IRZA 1ZR4A 1Y0UA 3GFMA 1OCOH 2O0YA 3FM5A 3W2WA 4ZYDA 1TL8A 1BW5A 2IAIA 1HW1A 1J59A 3K2ZA 4Q47A 3TQNA 1X1PA 2BY0A 1NK3P 3TDUC 1MJAA 1H9GA 2DK8A 2DDAA 2DJNA 4N0BA 1RESA 1LFBA 3ASOH 3ULQB 3R0AA 2FBHA 1YS6A 1ZGAA 2DT6A 4KT6A 2E1NA 2DT7B 5CVIA 3HOUJ 4L5JA 4ZYEA 4A6DA 2PMZN 3MKYB 4OIQF 4BACA 3PJRA 1UZCA 2DDBA 4GYGA 4WXCA 2ZSIB 2VUMJ 5M5XJ 3I59A 2CYYA 3M07A 4E4HA 4MFEA 2HWVA 2BGCA 3GW2A 3PSFA 4C3HJ 3LFKA 4NQWA 2EFNA 3BR2A 4HF1A 1V54H 2EFPA 4OIPF 3BG5A 1JGSA 4RAZA 3GTOJ 1FIPA 1B6AA 4IZZA 1ZGJA 2P0WA 5ED4A 1STZA 5EZGA 1IW7F 1USSA 4ENJA 2VKEA 2O7OA 1EA3A 4AU7A 4YIRX 2WADA 1Z3XA 3RI4A 4BH9A 2AXTC 3HKZN 1BJAA 2VN2A 2F4OB 4IL6C 1MMSA 1R6RA 4RGRA 2MFZA 1TBXA 2JPCA 4HV6A 3ZP5A 2E1CA 2VI6A 3OYEA 2H6CA 1FC3A 3OYFA 3QOEA 1X4PA 2G9WA 5M3FJ 2E71A 1FWZA 4HX4A 5CQEA 3KZYA 1FSHA 5J1RA 3COAC 4E7ZA 1XCVA 3MEXA 2AXLA 1O3TA 5DCMA 2VJ4A 1KU7A 3BTLA 5HLIA 2HDWA 5FLXK 2OZUA 3ML6A 4KN7X 1U8RA 1H89C 2IGKA 3F6VA 3IUOA 1OQYA 2HS5A 2EA4A 1YRNA 1X1BA 2XAHA 3T1BA 1B72A 3WGHA 3CUQC 4MEXF 2EK5A 3W2VA 1LDJA 2YU3A 2DU9A 3PUFA 3ZR8X 3OYJA 1K78A 2TCTA 2CO5A 3A1YA 5DV5A 1O3SA 5DM6F 3VPRA 2XGXA 4LB6B 2RREA 3RPUA 4EJOA 2KPMA 1GXPA 2DPDA 2KDOA 1ZQ3P 3CZ6A 5JHUA 4B8XA 2GWRA 1G3WA 4XLEA 3ZN1A 2I5UA 3K0LA 4JYKA 2HEOA 2PN6A 1LVAA 3BROA 2GOXB 1HKSA 3OYIA 3T5XA 4RAYA 3JAMK 1U3EM 1J75A 3I4NJ 4XLAA 4IXAA 2FE3A 2R7DA 2NNYA 3GFJA 1IV6A 4R79A 4UVBA 3AG2H 5EEAA 2CUZA 4XR6A 3HSFA 5JHFA 3TW7A 1LPQA 3KZIC 5IT9K 2CW8A 2V6CA 5E17F 4AUXA 2PJRA 3F9KA 4V2GA 2A61A 4B43A 2EH3A 1XB4A 2RKHA 2VXZA 2OA4A 4YG2F 2O8XA 4HBLA 1SD6A 2OQGA 2DBBA 3ISPA 3L9FA 3QYFA 5LFAA 1K6OA 1SD5A 4ZDOA 4UNOA 1IXCA 1K79A 2FA5A 5AIQA 2FOWA 4M3DA 2LK2A 2FXAA 4F92B 3DTIA 2DA6A 5ICEA 3L7WA 4MTEA 4B3XA 5CVUA 3JREA 3IWZA 2ISZA 4MTDA 4L0ZB 1X3UA 4HLYA 3RKQA 4HNTA 5DCFA 4F93B 3L2WA 2L9SA 3CUQA 5ICGA 3WODF 3RJPA 1OCRH 2CUJA 3GLXA 5FFXA 1MJBA 4PJNA 4PUSA 1R4MB 1HBXG 1BR1A 3GXOA 4AIJA 5D5WB 3J80K 1J09A 2FQ4A 2ICWG 3K7AJ 4W97A 2KZVA 1EJ9A 5EJCA 3LA3A 3I56I 4Q5SF 3GF2A 2WAEA 2ETHA 1R4NB 2DT5A 2LREA 5BNGA 1XS9A 1AWCA 1ZLKA 2V1UA 2IPQX 1WH5A 5FD6A 3TMOA 2V1DA 3EPZA 4L9TA 1E2XA 1TWHJ 4CGZA 1ZN2A 3RPQA 3FF5A 5IOYA 4TV7A 3G2BA 1TW2A 2NOGA 3EUHC 2W84A 4B4CA 3LSGA 1U6GA 5E18F 5D5VB 2XRLA 4XORA 2W85A 3LWFA 4C2UA 5BPIA 4E7SA 4AIDA 2P4WA 2FX0A 3BY6A 3S17J 4F52A 3EUKL 3KX2A 1ORKA 1I50J 3QPLA 4HSTA 2KRHA 1ETOA 1IN4A 1USTA 2WA0A 4UY8I 2M45A 2LF8A 2LTPA 2XDVA 2UXXA 2HDDA 4M6VA 4N4NB 4UUSB 2BXYA 1ONVA 5H6RA 1YG2A 3E5XA 4Q4ZF 1HA8A 1G3YA 2PMHA 2M0MA 1ZLJA 3KFWX 3SEQA 1T39A 1VQMI 1P2FA 4OAZA 3DTKA 3L09A 1HSTA 2VQCA 3OS1A 4DBQA 1IO2A 4FQGA 1AHDP 2P7CB 2M30A 2DA1A 2QM3A 4IHXA 4GXOA 4HW0A 4S04A 1X58A 3GZ6A 4XICA 1GV5A 3CP8A 3IL2A 3ZQQA 1A04A 2HQRA 2FJ1A 3H1CA 4BXXJ 4I99C 2VPLA 1GHCA 2Q8KA 3DF8A 4ENNA 4RB0A 1JE8A 3PFIA 3FXUA 5K5OA 4LIUA 4BJ6C 2HTJA 2GBYA 1YI2I 4BNCA 5EEGA 4MHGA 5GAGJ 5CPRB 1XGMA 2LBFA 3EUHA 3S1QJ 2HOEA 1AOYA 4ESFA 1G4DA 2ESHA 4M72A 4PGGA 2Q1ZB 2HYFA 4B48A 4IHYA 2RNGA 1T98A 3LA7A 2Q2EA 2CV1A 3G1LA 3SZGA 2ELHA 4FHTA 4Y7NJ 3ZN0A 3G73A 2K27A 1S3JA 5E20A 4LG0B 4BXFA 3KYLA 3WTTC 2DLLA 1MBGA 2R4GA 3F8BA 2JA2A 3BR0A 1FP2A 2VBYA 3HGGA 3I64A 3OR1C 4LIVA 3RZOJ 3K4BA 1JKRC 4G6TB 2N8GA 1AA7A 4AD9A 1MMGA 4HYEA 2L02A 1XMXA 2DO7A 2KHMA 4KDPA 1I3QJ 4YELA 4ETSA 2JZYA 2RQPA 3C3WA 4BKXA 5J6XA 1DPUA 3CMYA 4IJAA 2KQRA 1QO0D 4XLFA 3K1PA 1DDNA 1XDSA 2ELJA 1J0RA 5LHIA 2M2EA 2XVCA 2XC7A 2DOEA 4E7KA 3W2AA 4LD5A 3JRGA 2FMLA 1YW8A 4IRGA 2A3SA 3SQNA 2ZXWH 1PP7U 2HKXA 1FP1D 1D0YA 5DYMA 1RNLA 1XGOA 3BG3A 2L2OA 4K2EA 4L0YB 3E3VA 1VQOI 2CRGA 5LHHA 1WZ2A 2Y2ZA 4X6AJ 3LSKA 4YFNF 1A31A 4I0AA 2M1BA 1A6IA 4XK4A 2HPMA 3HHGA 2ZXIA 2R7OA 1OKRA 3UR3C 4KYWA 2IGMA 2MH2A 2CH0A 3CJRB 2GM4A 1RPWA 3K4CA 3ZQHA 4EATA 3ZQGA 2CJJA 4AIHA 4XKVA 1BN5A 1CF7B 3U2RA 1HDPA 4EMSA 4F7ZA 2WY7Q 3OL4A 4DYQA 4PJLA 2DAOA 3K1NA 4FETA 4NC7A 3OYAA 1R49A 1LFUP 1KYWA 3FISA 3F6OA 4HEA2 3TP3A 4N4OB 5A2QK 3V7SA 3OSGA 3L2CA 2DJIA 1SAXA 3V8JA 2KP6A 2X1CA 4FCYA 4PCQA 4BBSJ 2JJ7A 3KYCB 3GTMJ 3HRMA 5HDGA 3JRCA 4PDKA 4A3GJ 2O61A 5HLGA 3GZ5A 2LR8A 2E1OA 3A0BC 5KK1A 1OCTC 1JUMA 3I58A 2MC3A 1VQ7I 1VQ9I 2VKHA 2MA3A 3DKWA 1IN8A 2G0EA 4RGSA 2IA0A 4BHCA 3I53A 2FSWA 3DBHB 3OIOA 1BI2A 2A68F 3GFLA 5H20A 3ELKA 5FKOA 2R5ZB 4L9VA 2PJRB 3JSOA 1MBFA 1JHHA 5E3MA 4L5EA 4DYRA 2ECBA 2HOAA 1ZRDA 4LG3A 3I55I 4G94A 4UV8A 2R93J 4M3EA 4ON0A 2VE9A 2BYVE 3H3UA 4Y33A 1VZ0A 4J01A 3WG9A 2AHQA 5JLXA 1LEAA 2HDCA 1IUYA 1GV2A 1PUEE 1K4SA 3S32A 3CCVI 3MKWB 1JJ8C 2A07F 3HC7A 4CICA 2NS8A 2E1MC 3H3ZA 1UG0A 3JRAA 1IN7A 1XC5A 3SJMA 4BEHB 2VODA 1H0MA 5L3CA 2ZMEC 3E1SA 3PQJA 2MD0A 5DEQA 2CWEA 2LY2A 1WPKA 5CVRA 2OC6A 1G6NA 2L7MP 3HGYA 1TWFJ 2EBIA 3MAJA 1YIJI 1FEXA 5IYBJ 4Y15A 3DEUA 2BY1A 1TQMA 4HRIA 2OAZA 1SVLA 4O6JA 3JSPA 4ZDPA 4D0PA 5HVQC 2F4IA 2H09A 1FMVA 2R0QC 2ZFWA 2E34A 2M7AA 4A12A 1I1SA 2EFQA 2KMUA 5LGNA 5L3BA 1LE8A 2PG4A 5DTDA 2QQ9A 1KU2A 2IS6A 1QGPA 5CQGA 2NS0A 3OYLA 4M9SA 2IS1A 2E60A 2VBXA 4IVNA 3HTUA 3V7CA 4JX6A 3BCAA 1F43A 4JQFA 1TT0A 3E6CC 2GXAA 2LH9A 3H0GJ 3TP0A 1G3SA 3ABLH 5FROA 1XMAA 2HYJA 3Q0WA 2ZXJA 2TRTA 3EDPA 2Y31A 4KISA 4NB5A 3PO2J 3MKLA 4CDGA 5FKKA 2HXOA 2HI3A 5FLXZ 3KEOA 3DQVC 3FXMA 3VEPA 3CMAI 2RDPA 2E5NA 3WGIA 3GTQJ 3VOEA 2EZLA 1K83J 1N78A 1Y0NA 4KMUX 2F5VA 4C2TA 3LSIA 2ZNYA 3G4SI 3BPVA 1WJAA 4B09A 3BZKA 3ABTA 2LF7A 2VLAA 4II2A 3M7GA 4P9FA 1VQLI 3RIRA 4ASNA 5J40A 4BQQA 1O3RA 3F0CA 1JT6A 1ON2A 1MDMB 1J2XA 3LMMA 3ZMTA 1X1AA 4DGWB 2DA5A 5F6FA 1MBKA 1X4OA 3G3ZA 1WJBA 4N9HA 3Q0VA 3ZCOA 5LRSA 2R5YB 4IHTA 3S15J 4HX7A 2XASA 2E5ZA 4CCOA 1KYZA 3JAMZ 1VI0A 2GXBA 1QVUA 1S6LA 1PJRA 2V9KA 5D8KB 2HNHA 1GVJA 2J5PA 1LDKB 2LG4A 2D1VA 3SDBA 2R7ZJ 2DMPA 4E6KG 5IT9Z 3IRRA 2CSOA 1FYLA 1ETYA 1NH3A 3BG6A 4Z2YA 4IRIA 3HOVJ 3AG1H 3VODA 3LNQA 2K3PA 2VONA 5BS6A 2QA4I 3ONQA 4FTHA 3VSLA 2E36A 1P4XA 3F23A 4UUSA 3CO7C 3FZVA 4AYBN 3FXKA 4OINF 1IZ1A 2HU9A 1MSFC 5TJJA 1WI9A 5ICCA 4XRMA 2CQXA 2DMTA 3CCSI 3OIPA 4RM2A 3G1MA 2A5WA 3OYDA 3CDIA 1TQPA 2F5EA 1JGGA 4I76A 3IH3A 4RLFA 1QPIA 3CCEI 5C44J 3TOAA 2XV4S 3W6KB 4U87A 2Z2SB 1QPMA 3DP7A 1HSJA 1YQAA 4EVIA 1YITI 1DP3A 3BR1A 3M8JA 3OSFA 2PQ8A 2LLKA 1WJFA 5GPAA 2O3FA 2YX7A 5KCMA 2OJED 2A6EF 1Y56A 2A05A 2HVQA 4O5VA 1Z91A 3WTXC 4LFUA 3K1MA 1XX5A 3K4MA 3HYIA 3A03A 2EZKA 1U78A 1Y1VJ 2LP0A 3J80Z 4YIIA 5HLTA 2PMZA 2JRTA 2HZTA 4KJZA 1XPXA 2X6OA 1K4TA 5E1ZB 5ILVA 3S3MA 3JW4A 2PLYA 1ZR2A 1XMKA 4X0GA 3BJAA 1V3FA 3E5UA 3HG9A 3RQ4A 4LG0A 4RS8A 2YR2A 2JT1A 2M0CA 4FX0A 4XOPA 1IRGA 2D5VA 1EKEA 1EH6A 2R7XA 3OOUA 1ITYA 4CHUA 3CLQA 2XPVA 1DPRA 4IOAF 2PBIA 4S0HB 5FLVA 1ZH5A 5D5XB 3CCJI 3HKZA 2XAQA 3E6DA 1WFXA 3ZMDA 4ZJZA 3K4KA 2DTRA 3FKIJ 4EJTA 4QLCU 1TW3A 5CVVA 2MBFA 3IKVA 4KIBA 2B63J 1P7JA 4WCGA 1YS7A 1DU0A 2DA2A 3BR3A 4Y17A 2QSHX 3ZQCA 3CO6C 1O3QA 1RETA 2EZIA 3E6MA 4BQNA 2OTLI 5GPCA 4CCMA 3PNYA 3KETA 1PUFB 1P4WA 4XKBA 5D4RA 5EYRA 3O3KA 1YJ9I 1AKHB 3E7LA 2O8KA 3DV8A 4EGZA 3PO3J 2W48A 3EETA 4KUMA 2RV8A 1N25A 2P81A 3ZRGA 1Q1VA 3ABMH 2H1KA 3O6BB 2VOPA 2UV1A 4FT8A 3OS0A 1OMIA 2GLOA 2NRAC 4XLNF 3RSNA 1LUJB 4ZTFA 3IV5A 3DBRB 2QKLB 4EQQA 2STTA 3CCMI 5DD4A 2DMQA 2R7RA 3KP6A 1OISA 4C30A 1W7PB 1FY7A 2RNJA 2LOOA 3T0YA 1VTNC 5HOOA 3JCUC 1CF7A 3BZ6A 2GAUA 1EH7A 5E8GA 1SMTA 5FRNA 2E2HJ 4EV0A 2QQAA 2XPUA 4FE4A 2ZJQF 3BT9A 1RRJA 4ZH4F 4II3A 3GTLJ 4HNVA 3MCZA 1RZ4A 3OYHA 1HW2A 3TKYA 2O5RA 2CGPA 2P5KA 3LQRA 2EFOA 3G1OA 1OFCX 4E7LA 3P9IA 3MWMA 1R7JA 4A6EA 2HQ5A 1S29A 3HBLA 1SFKA 2RAEA 2ZSHB 2Y48A 1XG1A 1B8IB 5E3OA 5D4SA 2Z99A 5J3LA 1V55H 3CQZJ 1SFOJ 2X1EA 1MNEA 4V2FA 4HQEA 4KFCA 2MG4A 3OS2A 1MH4A 4XNFA 3HOWJ 1UJ8A 1SD4A 2XF6A 3QPSA 5IP7J 2IW5A 3C1DA 4XLHA 2K5CA 4A3DJ 4JBAA 2R5ZA 3FMSA 2E2IJ 5EEHA 5JFRA 3ABUA 4AIKA 3FXLA 3I54A 3O8HA 4MIMA 4OIRF 4A93J 2KIUA 2LDUA 5GAEJ 2P8TA 2MSYA 3MD2A 5HS8A 3MFKA 2Y0MA 5GTHC 3RYPA 3TGNA 3ZQLA 2DI3A 2H8RA 2HVSA
chains in the Genus database with same CATH topology
1IC8A 1LE8B 5IOZA 1MBGA 4Y52J 3CCYA 1GVDA 2XB5A 5GP9A 4A3MJ 1WGXA 3BR0A 2ZB9A 1CQTA 3HGGA 5F1JA 1ZTRA 3RZOJ 1DU6A 3K2AA 1JKRC 2XGCA 4G12A 2N8GA 3NAUA 5IPAA 5FKMA 1IGNA 2ME0A 1I3QJ 3BR5A 5FKNA 2HXIA 1TC3C 1ETQA 1Z77A 4BKXA 1UHSA 2DA4A 3CMYA 5C4XJ 5FKLA 1IDZA 4UUTA 1JT0A 3PM1A 1JKPC 2M2EA 4JX5A 4JX4A 3LSRA 3JRGA 1FIAA 3FK6A 1HCRA 5EGOA 1ZKGA 3JRFA 1JUPA 1JKOC 2HOTA 3BG3A 4J19A 1D5YA 1WI3A 2L7ZA 1SANA 2CRGA 3WHBA 2O9LA 1RKTA 4B1RA 3S1MJ 2Y2ZA 3IH4A 4CYCA 4X6AJ 3CDLA 3FK7A 1U8BA 3BR6A 3FIWA 4A3JJ 1A6IA 2K40A 2L9RA 1NTCA 4XK4A 4AC0A 3NARA 1RKWA 1Y1WJ 2GM4A 4D7NA 1RPWA 4M3BA 2E2JJ 3ZQHA 3ZQGA 2CJJA 2E19A 3GBGA 3UKGA 1HDPA 5M5YJ 3B6AA 3IH2A 4DYQA 1IDYA 3MVPA 1LFUP 3FISA 1ENHA 1ETKA 3TP3A 4C2MJ 3L1PA 5JLWA 3OSGA 1BA5A 2R5YA 4FCYA 4BBSJ 1MBEA 2JJ7A 3GTMJ 2OPTA 2YU9J 3LSJA 3JRCA 4A3GJ 2Y9ZA 1JTXA 1FJLA 2M9HA 4IHVA 2LR8A 2E1OA 3HOXJ 3LSPA 1OCTC 1JUMA 1BW6A 3A01A 5EG0A 3H3VK 4D7MA 4C3IJ 4A3LJ 2G0EA 1HDDC 2IEKA 2X48A 3OIOA 4NDLA 5FKOA 2R5ZB 4JP0A 1BL0A 2ELKA 4A3KJ 1W0UA 1MBFA 5E3MA 4L5EA 4DYRA 2ECBA 2HOAA 2WAQN 2R93J 4M3EA 2NVYJ 3RQIA 1QVTA 4XRSA 3HOYJ 2AHQA 5JLXA 4IHWA 2DA3A 1GV2A 2IBDA 1JJ8C 3SDGA 2LY9A 1X2NA 3QQAA 2ECCA 2NS8A 3JRAA 3BG9A 5C4JJ 5E3NA 1XC5A 3SJMA 2DMNA 3HB9A 4QIWN 4D5FA 2JA8J 1VF9A 1WPKA 2CU7A 3HGYA 2L7MP 2HOSA 1VFCA 1TWFJ 2EBIA 2XGEA 4A3EJ 4C3JJ 5IYBJ 1FEXA 1U9OA 1IRZA 2JK3A 1ZR4A 1GDTA 3RZDJ 1HLVA 9ANTA 3BQZA 2IAIA 1BW5A 2JA7J 1K61A 2JWTA 2WB1N 3BTCA 2R0QC 1NK3P 4DZPA 5F0FA 1MSEC 1RR7A 1LE8A 2DJNA 2M8GX 2NVTJ 2CQQA 5DTDA 1I6HJ 1RESA 5F04A 2LKXA 1LFBA 4DZJA 1TWAJ 5EDNA 3HOUJ 4JX6A 2PMZN 2NVQJ 3JRDA 1APLC 1F43A 5IP6A 1UMQA 2VUMJ 2L7FP 3TP0A 3H0GJ 3GTJJ 5IYDJ 5M5XJ 4CYCB 4MFEA 2HYJA 3Q0WA 4BY1J 4C3HJ 2TRTA 2Y31A 3PO2J 3MKLA 3BR2A 3M3YJ 5FKKA 2HXOA 2HI3A 2KT0A 3BG5A 3GTOJ 1FIPA 1UG2A 3ZQIA 3GTQJ 2EZLA 1K83J 2FD5A 5EZGA 5F08A 2VKEA 2O7OA 5F0CA 1H88C 1WH7A 3I4MJ 3HKZN 1TWGJ 4LOCA 3W6VA 3BTIA 1PUFA 5IP9J 1VNDA 2DMUA 1JT6A 3F0CA 4BBRJ 2VI6A 4BY7J 5K7HA 1AKHA 2LD5A 2QF7A 1ETWA 2DA5A 5M3FJ 1MBKA 1EF4A 5K7ZA 2XSDC 3S15J 3Q0VA 2R5YB 1E3OC 2M34A 3Q0UA 5J1RA 1TWCJ 4MLOA 1G2HA 1ZK8A 2YS9A 1VI0A 1IJWC 2MW8A 3BTLA 1QVUA 4DW6A 3A01B 1W0TA 5EG0B 1S7EA 2CUFA 1H89C 2DMPA 2R7ZJ 1GT0C 1JTYA 4RDUA 1ETYA 3HOVJ 2MGQA 2LFBA 3D1NI 1MBJA 4A3FJ 3LNQA 1T33A 4MO7A 4FTHA 2NVXJ 2XB0X 1YRNA 5F0HA 4UUSA 3BTJA 2JA5J 4AYBN 1B72A 3LOCA 4IEJA 4ABZA 1IUFA 4MFDA 3GTGJ 1POGA 1Z0XA 1MSFC 3HDDA 2TCTA 4XRMA 2CQXA 5K7FA 2DMTA 2ID3A 3VPRA 5FLMJ 3G1MA 4GFBA 3S16J 1FTZA 1P7IA 1JGGA 4I76A 3IH3A 1QPIA 2DTZA 5C44J 4X1EA 3TW6A 1ZQ3P 3JR9A 1JJ6C 2XGDA 3S2DJ 2DA7A 4JYKA 3BR1A 1B8IA 3I4NJ 3S1RJ 3OSFA 2LLKA 3A02A 5GPAA 2EQRA 1IV6A 4A3IJ 4XRSG 3ZQFA 3DEWA 5EEAA 1U9NA 2NS7A 3TW7A 2R92J 1NK2P 2JMWA 1ETXA 3HM5A 3A03A 4AUXA 2EZKA 1U78A 1Y1VJ 2EZHA 2LP0A 2VPRA 4V2GA 3SFIA 2EH3A 1OCPA 2AO9A 1ZGWA 2X6OA 3MN2A 4W1UA 1R9TJ 1O4XA 1ZR2A 4D5CA 3O8GA 1MBHA 4A3CJ 4M3DA 2LK2A 2M0CA 2K9SA 2DA6A 2D5VA 3OOUA 2K9NA 3JREA 1ITYA 2COBA 2XPVA 5EGOB 4S0HB 5DS9A 5FLVA 5M3MJ 3RKQA 2K9QA 3JRBA 3B6CA 5EZHA 1IG7A 1H8AC 3FKIJ 5J1UA 3GTKJ 5IYCJ 2B63J 1P7JA 1HOMA 4QSHA 2FQ4A 2DN0A 1DU0A 2DA2A 3BR3A 3K7AJ 4W97A 3ZQCA 1RETA 2EZIA 2ME6A 5BNGA 5GPCA 1JUSA 1XS9A 1WH5A 1PUFB 5EYRA 1AKHB 3E7LA 3HOZJ 1TWHJ 2O8KA 1HF0A 1F36A 5F27A 1FTTA 2VKVA 3PO3J 2W48A 2ID6A 3S2HJ 2OF7A 3GTPJ 2P81A 5IOYA 2NOGA 1Q1VA 2H1KA 4B4CA 3LSGA 5EF6A 1T56A 3M4OJ 3S1NJ 5C3EJ 2KDZA 2XRLA 2GLOA 4EEFG 4M3GA 3S14J 4RBOA 3IV5A 4M3FA 1MH3A 5M5WJ 4FISA 2DMQA 2FX0A 2WV1A 2X9DA 3S17J 2Y9YA 1ORKA 1I50J 3QPLA 1ETOA 1AU7A 2LTPA 2HDDA 4DYCA 4M6VA 1YRNB 4UUSB 5HODA 1B72B 1OJLA 2JN6A 2E2HJ 1X2MA 1JKQC 1QRYA 2XPUA 5J1YA 4FE4A 3HEFA 3BT9A 3BQYA 2L0KA 3GTLJ 4HNVA 3WHCA 4XIDA 2LVSA 2QCOA 5E3LA 3TEDA 3G1OA 4B3AA 1OFCX 3C2BA 2Y0SN 1AHDP 3DCFA 1A5JA 2DA1A 2HQ5A 3JRHA 3HBLA 4IHXA 2RAEA 1X58A 4XICA 1GV5A 1XG1A 4A69C 1B8IB 5E3OA 3Q3SA 5J3LA 2FJ1A 3CQZJ 1SFOJ 2JA6J 4BXXJ 1MNMC 4V2FA 3JRIA 2GBYA 2MG4A 4I6ZA 1MH4A 1BJZA 2XPWA 4QTRA 3HOWJ 1ETVA 1GUUA 3QPSA 5IP7J 2I10A 5FJ8J 2YUSA 4A3BJ 3S1QJ 4A3DJ 2R5ZA 4FE7A 4IHYA 2E2IJ 2CUEA 2Y30A 3O8HA 4MIMA 4A93J 3G1LA 2MSYA 1WCMJ 4Y7NJ 2H8RA 3ZQLA 3ZOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IC8 A;  1LE8 B;  5IOZ A;  1MBG A;  4Y52 J;  3CCY A;  1GVD A;  2XB5 A;  5GP9 A;  4A3M J;  1WGX A;  3BR0 A;  2ZB9 A;  1CQT A;  3HGG A;  5F1J A;  1ZTR A;  3RZO J;  1DU6 A;  3K2A A;  1JKR C;  2XGC A;  4G12 A;  2N8G A;  3NAU A;  5IPA A;  5FKM A;  1IGN A;  2ME0 A;  1I3Q J;  3BR5 A;  5FKN A;  2HXI A;  1TC3 C;  1ETQ A;  1Z77 A;  4BKX A;  1UHS A;  2DA4 A;  3CMY A;  5C4X J;  5FKL A;  1IDZ A;  4UUT A;  1JT0 A;  3PM1 A;  1JKP C;  2M2E A;  4JX5 A;  4JX4 A;  3LSR A;  3JRG A;  1FIA A;  3FK6 A;  1HCR A;  5EGO A;  1ZKG A;  3JRF A;  1JUP A;  1JKO C;  2HOT A;  3BG3 A;  4J19 A;  1D5Y A;  1WI3 A;  2L7Z A;  1SAN A;  2CRG A;  3WHB A;  2O9L A;  1RKT A;  4B1R A;  3S1M J;  2Y2Z A;  3IH4 A;  4CYC A;  4X6A J;  3CDL A;  3FK7 A;  1U8B A;  3BR6 A;  3FIW A;  4A3J J;  1A6I A;  2K40 A;  2L9R A;  1NTC A;  4XK4 A;  4AC0 A;  3NAR A;  1RKW A;  1Y1W J;  2GM4 A;  4D7N A;  1RPW A;  4M3B A;  2E2J J;  3ZQH A;  3ZQG A;  2CJJ A;  2E19 A;  3GBG A;  3UKG A;  1HDP A;  5M5Y J;  3B6A A;  3IH2 A;  4DYQ A;  1IDY A;  3MVP A;  1LFU P;  3FIS A;  1ENH A;  1ETK A;  3TP3 A;  4C2M J;  3L1P A;  5JLW A;  3OSG A;  1BA5 A;  2R5Y A;  4FCY A;  4BBS J;  1MBE A;  2JJ7 A;  3GTM J;  2OPT A;  2YU9 J;  3LSJ A;  3JRC A;  4A3G J;  2Y9Z A;  1JTX A;  1FJL A;  2M9H A;  4IHV A;  2LR8 A;  2E1O A;  3HOX J;  3LSP A;  1OCT C;  1JUM A;  1BW6 A;  3A01 A;  5EG0 A;  3H3V K;  4D7M A;  4C3I J;  4A3L J;  2G0E A;  1HDD C;  2IEK A;  2X48 A;  3OIO A;  4NDL A;  5FKO A;  2R5Z B;  4JP0 A;  1BL0 A;  2ELK A;  4A3K J;  1W0U A;  1MBF A;  5E3M A;  4L5E A;  4DYR A;  2ECB A;  2HOA A;  2WAQ N;  2R93 J;  4M3E A;  2NVY J;  3RQI A;  1QVT A;  4XRS A;  3HOY J;  2AHQ A;  5JLX A;  4IHW A;  2DA3 A;  1GV2 A;  2IBD A;  1JJ8 C;  3SDG A;  2LY9 A;  1X2N A;  3QQA A;  2ECC A;  2NS8 A;  3JRA A;  3BG9 A;  5C4J J;  5E3N A;  1XC5 A;  3SJM A;  2DMN A;  3HB9 A;  4QIW N;  4D5F A;  2JA8 J;  1VF9 A;  1WPK A;  2CU7 A;  3HGY A;  2L7M P;  2HOS A;  1VFC A;  1TWF J;  2EBI A;  2XGE A;  4A3E J;  4C3J J;  5IYB J;  1FEX A;  1U9O A;  1IRZ A;  2JK3 A;  1ZR4 A;  1GDT A;  3RZD J;  1HLV A;  9ANT A;  3BQZ A;  2IAI A;  1BW5 A;  2JA7 J;  1K61 A;  2JWT A;  2WB1 N;  3BTC A;  2R0Q C;  1NK3 P;  4DZP A;  5F0F A;  1MSE C;  1RR7 A;  1LE8 A;  2DJN A;  2M8G X;  2NVT J;  2CQQ A;  5DTD A;  1I6H J;  1RES A;  5F04 A;  2LKX A;  1LFB A;  4DZJ A;  1TWA J;  5EDN A;  3HOU J;  4JX6 A;  2PMZ N;  2NVQ J;  3JRD A;  1APL C;  1F43 A;  5IP6 A;  1UMQ A;  2VUM J;  2L7F P;  3TP0 A;  3H0G J;  3GTJ J;  5IYD J;  5M5X J;  4CYC B;  4MFE A;  2HYJ A;  3Q0W A;  4BY1 J;  4C3H J;  2TRT A;  2Y31 A;  3PO2 J;  3MKL A;  3BR2 A;  3M3Y J;  5FKK A;  2HXO A;  2HI3 A;  2KT0 A;  3BG5 A;  3GTO J;  1FIP A;  1UG2 A;  3ZQI A;  3GTQ J;  2EZL A;  1K83 J;  2FD5 A;  5EZG A;  5F08 A;  2VKE A;  2O7O A;  5F0C A;  1H88 C;  1WH7 A;  3I4M J;  3HKZ N;  1TWG J;  4LOC A;  3W6V A;  3BTI A;  1PUF A;  5IP9 J;  1VND A;  2DMU A;  1JT6 A;  3F0C A;  4BBR J;  2VI6 A;  4BY7 J;  5K7H A;  1AKH A;  2LD5 A;  2QF7 A;  1ETW A;  2DA5 A;  5M3F J;  1MBK A;  1EF4 A;  5K7Z A;  2XSD C;  3S15 J;  3Q0V A;  2R5Y B;  1E3O C;  2M34 A;  3Q0U A;  5J1R A;  1TWC J;  4MLO A;  1G2H A;  1ZK8 A;  2YS9 A;  1VI0 A;  1IJW C;  2MW8 A;  3BTL A;  1QVU A;  4DW6 A;  3A01 B;  1W0T A;  5EG0 B;  1S7E A;  2CUF A;  1H89 C;  2DMP A;  2R7Z J;  1GT0 C;  1JTY A;  4RDU A;  1ETY A;  3HOV J;  2MGQ A;  2LFB A;  3D1N I;  1MBJ A;  4A3F J;  3LNQ A;  1T33 A;  4MO7 A;  4FTH A;  2NVX J;  2XB0 X;  1YRN A;  5F0H A;  4UUS A;  3BTJ A;  2JA5 J;  4AYB N;  1B72 A;  3LOC A;  4IEJ A;  4ABZ A;  1IUF A;  4MFD A;  3GTG J;  1POG A;  1Z0X A;  1MSF C;  3HDD A;  2TCT A;  4XRM A;  2CQX A;  5K7F A;  2DMT A;  2ID3 A;  3VPR A;  5FLM J;  3G1M A;  4GFB A;  3S16 J;  1FTZ A;  1P7I A;  1JGG A;  4I76 A;  3IH3 A;  1QPI A;  2DTZ A;  5C44 J;  4X1E A;  3TW6 A;  1ZQ3 P;  3JR9 A;  1JJ6 C;  2XGD A;  3S2D J;  2DA7 A;  4JYK A;  3BR1 A;  1B8I A;  3I4N J;  3S1R J;  3OSF A;  2LLK A;  3A02 A;  5GPA A;  2EQR A;  1IV6 A;  4A3I J;  4XRS G;  3ZQF A;  3DEW A;  5EEA A;  1U9N A;  2NS7 A;  3TW7 A;  2R92 J;  1NK2 P;  2JMW A;  1ETX A;  3HM5 A;  3A03 A;  4AUX A;  2EZK A;  1U78 A;  1Y1V J;  2EZH A;  2LP0 A;  2VPR A;  4V2G A;  3SFI A;  2EH3 A;  1OCP A;  2AO9 A;  1ZGW A;  2X6O A;  3MN2 A;  4W1U A;  1R9T J;  1O4X A;  1ZR2 A;  4D5C A;  3O8G A;  1MBH A;  4A3C J;  4M3D A;  2LK2 A;  2M0C A;  2K9S A;  2DA6 A;  2D5V A;  3OOU A;  2K9N A;  3JRE A;  1ITY A;  2COB A;  2XPV A;  5EGO B;  4S0H B;  5DS9 A;  5FLV A;  5M3M J;  3RKQ A;  2K9Q A;  3JRB A;  3B6C A;  5EZH A;  1IG7 A;  1H8A C;  3FKI J;  5J1U A;  3GTK J;  5IYC J;  2B63 J;  1P7J A;  1HOM A;  4QSH A;  2FQ4 A;  2DN0 A;  1DU0 A;  2DA2 A;  3BR3 A;  3K7A J;  4W97 A;  3ZQC A;  1RET A;  2EZI A;  2ME6 A;  5BNG A;  5GPC A;  1JUS A;  1XS9 A;  1WH5 A;  1PUF B;  5EYR A;  1AKH B;  3E7L A;  3HOZ J;  1TWH J;  2O8K A;  1HF0 A;  1F36 A;  5F27 A;  1FTT A;  2VKV A;  3PO3 J;  2W48 A;  2ID6 A;  3S2H J;  2OF7 A;  3GTP J;  2P81 A;  5IOY A;  2NOG A;  1Q1V A;  2H1K A;  4B4C A;  3LSG A;  5EF6 A;  1T56 A;  3M4O J;  3S1N J;  5C3E J;  2KDZ A;  2XRL A;  2GLO A;  4EEF G;  4M3G A;  3S14 J;  4RBO A;  3IV5 A;  4M3F A;  1MH3 A;  5M5W J;  4FIS A;  2DMQ A;  2FX0 A;  2WV1 A;  2X9D A;  3S17 J;  2Y9Y A;  1ORK A;  1I50 J;  3QPL A;  1ETO A;  1AU7 A;  2LTP A;  2HDD A;  4DYC A;  4M6V A;  1YRN B;  4UUS B;  5HOD A;  1B72 B;  1OJL A;  2JN6 A;  2E2H J;  1X2M A;  1JKQ C;  1QRY A;  2XPU A;  5J1Y A;  4FE4 A;  3HEF A;  3BT9 A;  3BQY A;  2L0K A;  3GTL J;  4HNV A;  3WHC A;  4XID A;  2LVS A;  2QCO A;  5E3L A;  3TED A;  3G1O A;  4B3A A;  1OFC X;  3C2B A;  2Y0S N;  1AHD P;  3DCF A;  1A5J A;  2DA1 A;  2HQ5 A;  3JRH A;  3HBL A;  4IHX A;  2RAE A;  1X58 A;  4XIC A;  1GV5 A;  1XG1 A;  4A69 C;  1B8I B;  5E3O A;  3Q3S A;  5J3L A;  2FJ1 A;  3CQZ J;  1SFO J;  2JA6 J;  4BXX J;  1MNM C;  4V2F A;  3JRI A;  2GBY A;  2MG4 A;  4I6Z A;  1MH4 A;  1BJZ A;  2XPW A;  4QTR A;  3HOW J;  1ETV A;  1GUU A;  3QPS A;  5IP7 J;  2I10 A;  5FJ8 J;  2YUS A;  4A3B J;  3S1Q J;  4A3D J;  2R5Z A;  4FE7 A;  4IHY A;  2E2I J;  2CUE A;  2Y30 A;  3O8H A;  4MIM A;  4A93 J;  3G1L A;  2MSY A;  1WCM J;  4Y7N J;  2H8R A;  3ZQL A;  3ZOB A; 
#chains in the Genus database with same CATH topology
 3LFU A;  1LE8 B;  4NNJ A;  2FEZ A;  4QWQ A;  4U0W A;  2EV5 A;  2PEX A;  1WRJ A;  1J7K A;  2KKO A;  2C6Y A;  1D5V A;  2D2W A;  4GGG A;  2IXS A;  2F5D A;  5GP9 A;  4IQ4 A;  3WTZ A;  2OCC H;  1O7F A;  1DGW Y;  5LHG A;  1T6S A;  3Q5F A;  4XN3 A;  2M4G A;  1CQT A;  1MJ9 A;  4BEH A;  1DU6 A;  4R1H A;  4KIT B;  1MKM A;  5D6E A;  3NAU A;  3D5S C;  3U1K A;  5ICF A;  2QBY B;  3HHH A;  2ME0 A;  2W57 A;  1ZAR A;  3BR5 A;  5FKN A;  3M9A A;  1TC3 C;  4OIO F;  1Z77 A;  2W00 A;  1UHS A;  2DA4 A;  2IS4 A;  1ULY A;  5C4X J;  4LK1 F;  5FKL A;  4ZTJ A;  1LKX A;  2V9P A;  3OR2 C;  3J81 K;  3E5Q A;  1JT0 A;  4I01 A;  3CLO A;  3P9K A;  3H0D A;  3R61 A;  2GIZ A;  2GA1 A;  2XF5 A;  4YRV A;  4JX5 A;  2E1M B;  5CKT A;  3LSR A;  1L0O C;  1XDU A;  2CFX A;  2W1O A;  4G6Q A;  1FBU A;  2ZME B;  4A5N A;  5IT3 A;  3FWE A;  5A2Q Z;  3JRF A;  3F8M A;  2Z16 A;  3CCU I;  1LNW A;  1D5Y A;  2JSC A;  1WI3 A;  2L7Z A;  2DPU A;  3S8P A;  2R7F A;  1RKT A;  4Y3O A;  4NBQ A;  3RYR A;  3VDX A;  4AVP A;  3IH4 A;  2VJ5 A;  4BXU A;  3FK7 A;  1U8B A;  2LNB A;  4ZYG A;  3I3L A;  3BR6 A;  3CJT B;  3FIW A;  2L9R A;  1NTC A;  3P7N A;  3RKY A;  2QLZ A;  2K4J A;  1Y1W J;  1U5T B;  4D7N A;  2Z5U A;  2BVM A;  2E2J J;  4BJT A;  1TQI A;  4U88 A;  4I02 A;  2OZ6 A;  5ILS A;  2ZJR F;  5FB2 A;  1IRF A;  2DFF A;  1MMN A;  3HRS A;  2P7V B;  5M5Y J;  1FOW A;  3B6A A;  1WHU A;  3IH2 A;  3CCR I;  2XKO A;  1QHH D;  4PFO A;  2LC2 A;  3W3C A;  3WTW C;  3K6G A;  4C2M J;  3SZT A;  1MDM A;  5JLW A;  1D0X A;  2GXG A;  1BA5 A;  2R5Y A;  2GZW A;  3QYE A;  2OQR A;  4LB5 A;  2OPT A;  3B02 A;  2XRN A;  3PFY A;  5LBQ A;  2Y9Z A;  4HSR A;  4PJJ A;  4LLL A;  4EJW A;  2W4S A;  1FJL A;  3VYT B;  1I5Z A;  1FBS A;  1LVK A;  3LAP A;  4AWX B;  3ASN H;  2QUF A;  2VQG A;  4KIF A;  4WWC A;  3LSP A;  3QU6 A;  2PFB A;  3KCC A;  1BW6 A;  1E3P A;  3DEE A;  3H3V K;  4C3I J;  4A3L J;  4HLX A;  5J47 A;  5FO5 A;  4CO8 A;  2FBK A;  4WXD A;  4NDL A;  1O7L A;  1G3T A;  3FMQ A;  2BBY A;  3DU5 A;  4JP0 A;  2X51 A;  1BL0 A;  2GIV A;  4CZZ A;  4A3K J;  1K6Y A;  1W0U A;  2KLO A;  3DKX A;  3CF2 A;  2K4B A;  2L54 A;  3HUG B;  3SHF A;  4EJV A;  1T08 B;  1X1D A;  1R71 A;  3RQI A;  4FX4 A;  5IY5 H;  2JUG A;  2DA3 A;  2MD5 A;  4IHS A;  4PFP A;  1J9I A;  2WY8 Q;  3SDG A;  1D8J A;  2UUZ A;  3ZMZ A;  1UFM A;  1Z7L A;  3A4C A;  5LGU A;  2ECC A;  2L3D A;  4CCN A;  3ROU A;  1F4K A;  1DUX C;  3Q9V A;  2BY3 A;  4M9X A;  4QIW N;  4ZZL A;  2K02 A;  2JSP A;  3OYG A;  3C2H A;  2QSF X;  4LJZ F;  2HOS A;  4Q48 A;  4C3J J;  1BR4 A;  3CP2 A;  2AS5 F;  3H92 A;  3K69 A;  2VQL A;  3ABK H;  3VFZ A;  5LD2 C;  4A2U A;  1GDT A;  3RZD J;  3GFI A;  2FUG 2;  1HLV A;  9ANT A;  3BQZ A;  2JA7 J;  1U2W A;  3IRQ A;  1FOY A;  2JWT A;  2WB1 N;  4F55 A;  2BHY A;  1FLI A;  5J8C A;  5F0F A;  1MSE C;  1RR7 A;  1W7P D;  2COM A;  5BMZ A;  3WE3 A;  2KJB A;  2NVT J;  2M8G X;  2RC4 A;  4IQJ A;  5F04 A;  3AL0 C;  3ZXS A;  3NQO A;  4BE1 A;  4RA2 A;  1YJW I;  2ZJP F;  3U1D A;  4XOT A;  3QRF F;  1TWA J;  2D45 A;  4HAM A;  2WWY A;  3HSR A;  4U0Y A;  1LQ1 A;  2NVQ J;  1KQ0 A;  1Y6I A;  5IP6 A;  1UMQ A;  2L4A A;  2V1X A;  1QBJ A;  2L7F P;  3FXO A;  3OIQ A;  4GRI A;  4CZC A;  3GTJ J;  3IAS 2;  4CYC B;  2STW A;  2R7T A;  2QEX I;  3M3Y J;  3DBL B;  4HG2 A;  1P9Q C;  2CV0 A;  1UG2 A;  3IAM 2;  5F08 A;  3TDZ C;  3MZY A;  4XL9 A;  4ZYH A;  1TZL A;  3I4M J;  3R6S A;  3ZMS A;  3LSM A;  4LOC A;  3BTI A;  5HS9 A;  2VXD A;  3VYS B;  1PUF A;  2LMD A;  1VND A;  2DMU A;  1T95 A;  4LMY A;  1AKH A;  2MYS A;  2X6W A;  2A69 F;  2VE8 A;  1BC7 C;  1EF4 A;  1ZHF A;  3GUD A;  5K7Z A;  4XKW A;  2RVC A;  2JPB A;  1E3O C;  4MGR A;  2M34 A;  3Q0U A;  3AAF A;  3KP3 A;  1G2H A;  2XKP A;  1IXR C;  3PIO F;  1ZK8 A;  1Z21 A;  2MW8 A;  1UEL B;  1WJD A;  4DIQ A;  5LGT A;  1I27 A;  4HF2 A;  4DW6 A;  3EYY A;  2DFI A;  3OV8 A;  3U21 A;  5FD5 A;  3A01 B;  1W7P A;  3HSE A;  5B3S H;  4BDZ A;  1Y8Q B;  2DOF A;  2CUF A;  4PGH A;  2BXZ A;  2X6X A;  1GT0 C;  4RDU A;  3E6B A;  3D1N I;  3FKJ A;  3OOP A;  1YTY A;  4MO7 A;  2EPF A;  5AON A;  2XB0 X;  2I8D A;  3IP4 B;  5F0H A;  3BTJ A;  3PL8 A;  2JRM A;  2FOK A;  3WU1 B;  3BJ6 A;  3CC7 I;  3LOC A;  4LIT A;  4DOZ A;  4IEJ A;  1TNS A;  3H35 A;  4B47 A;  2M87 A;  1LFP A;  2AQE A;  3GTG J;  1Z0X A;  3CDH A;  3HDD A;  3OY9 A;  1X19 A;  2BVL A;  1B9M A;  4NC8 A;  4GFB A;  1IXS B;  5DDG A;  1P7I A;  3KE2 A;  3M1E A;  5LEK A;  3I71 A;  5AIP A;  4ENK A;  2F5F A;  4X1E A;  3H5N A;  3JR9 A;  1HQC A;  3W6J B;  1JJ6 C;  2BZT A;  2XGD A;  3F8C A;  3S2D J;  1LB2 A;  2DA7 A;  1U0J A;  4BQA A;  2XAG A;  2M3A A;  5L3F A;  2VQH A;  2YPR A;  5JR3 A;  1B8I A;  1FBQ A;  1FSE A;  3S1R J;  2VC0 A;  3A02 A;  2P6S A;  5FRM A;  1T8I A;  3E0J B;  4M71 A;  1J5Y A;  4XRS G;  3ZQF A;  2ESN A;  3DEW A;  1BIA A;  1U9N A;  2PI0 A;  2DXI A;  4B44 A;  4XN0 A;  3HOT A;  4BL0 B;  1SVM A;  1ETX A;  2HQA A;  3HM5 A;  3NRV A;  3PNT A;  1I3A A;  3RTR A;  4UVC A;  1W36 D;  2VPR A;  3K9T A;  3SFI A;  5KAF C;  1DGR M;  3FX3 A;  1OCP A;  4RB1 A;  2WV0 A;  2AO9 A;  1FOX A;  1ZGW A;  1W36 C;  1B59 A;  3OYN A;  1LEB A;  1R5H A;  4W1U A;  3BG7 A;  3HOS A;  2Y69 H;  1K7A A;  4A3C J;  2W25 A;  2K9S A;  5TRD A;  2EFW A;  1U5T C;  1V5G A;  3GVA A;  2UWM A;  2K9N A;  4RAF A;  3BP8 A;  2COB A;  2BHZ A;  1OCC H;  3JRB A;  3WTV C;  3B6C A;  4UHT A;  4S05 A;  3MZ8 A;  5EZH A;  3ECH A;  4DQ2 A;  1IG7 A;  2QWW A;  2QBY A;  1BI1 A;  4O3M A;  5J1U A;  1YHQ I;  1W5C C;  3GTK J;  4BAY A;  4H4K C;  1OLT A;  1IRX A;  3DWL E;  2KL4 A;  3M1C A;  4MNU A;  1I6X A;  1UHW A;  4HOB A;  2X4H A;  1SVO A;  5J8F A;  4P5O A;  3OL3 A;  4ESJ A;  2J5O A;  1MZB A;  2A5Y B;  4GCV A;  2ME6 A;  5HLH A;  1JUS A;  5L3E A;  4EM2 A;  2R7V A;  1Z6T A;  3P5J A;  3MZH A;  2NYX A;  4CXF A;  1XN7 A;  3NEU A;  4ZC3 A;  3WTS C;  4KT5 C;  3DPL C;  3HTS B;  3HOZ J;  2VAS A;  2R7U A;  2ZME A;  4UB8 C;  2GA2 A;  1OR7 C;  1HF0 A;  1W5S A;  1FTT A;  3QP5 A;  3S2H J;  2OF7 A;  2LSO A;  1YW7 A;  1UHM A;  4XKC A;  1T56 A;  2KZG A;  4EJU A;  3S1N J;  1S7O A;  5C3E J;  1Q1H A;  2V6E A;  4EEF G;  4M3G A;  4AYB A;  1B1B A;  1A35 A;  4M3F A;  3J7Z I;  3CF5 F;  4FIS A;  2KFD A;  3H36 A;  4XRF A;  2X9D A;  1D1A A;  2Y0S A;  1U5T A;  2KRC A;  2RQQ A;  5JI6 A;  2OD5 A;  3TBI A;  4M6Y A;  1QZZ A;  2QGU A;  5CLS A;  3H5A A;  2OU2 A;  5HOD A;  2EV6 A;  4OAY A;  5K5R A;  2JN6 A;  5H6Q A;  1KQ9 A;  3QOP A;  3V8L A;  1BBY A;  1QRY A;  5J1Y A;  2PX9 A;  5GAD J;  3HEF A;  2K3F A;  1FT9 A;  3FXQ A;  3WG7 H;  2H27 A;  1Y8R B;  3WHC A;  4BQO A;  2VT2 A;  2FF4 A;  3DPU A;  4BDY A;  2NVU B;  3C2B A;  2Y0S N;  4U7D A;  2P6T A;  2UZK A;  2KIF A;  4E7I A;  3LST A;  3OYM A;  3JRH A;  4N9I A;  3E97 A;  1TTY A;  1R1V A;  4MQV A;  3MKZ A;  2R7S A;  2L4M A;  2F48 A;  3DPT A;  3TO6 A;  3M8F A;  2QSG X;  2JA6 J;  1MNM C;  3H9J A;  2FBI A;  2H1L A;  3JRI A;  4QTR A;  1IV8 A;  1OR7 A;  1ETV A;  2EWN A;  1GUU A;  2XF7 A;  2YUS A;  3I5U A;  2R7Q A;  2H8W A;  4HNU A;  1SC7 A;  2Y75 A;  4HDV A;  1R1T A;  2CUE A;  5HS7 A;  3K4J A;  3CCQ I;  1A36 A;  3HUG A;  3GYH X;  1VQK I;  1RUN A;  2CG4 A;  1D0Z A;  3ZOB A;  2LRD A;  3ERE D;  4BHP A;  2XSJ C;  2DFE A;  4E7J A;  4I98 B;  5IOZ A;  2V7F A;  4AVZ A;  2EJR A;  2L5Q A;  2L9N A;  5DUI A;  2XB5 A;  3F3X A;  4A3M J;  4OOI A;  2ZB9 A;  1OYI A;  3QPT A;  3F22 A;  4G9Y A;  4P9U A;  1WKM A;  4HV5 A;  4G12 A;  4GO1 A;  2QYO A;  2L01 A;  5BPD A;  4RM3 A;  1D3Y A;  5FKM A;  4WX9 A;  4BHB A;  1RIO H;  2FRH A;  1BOB A;  1P4A A;  3HZJ A;  3JTG A;  1T38 A;  2ACJ A;  1ETQ A;  1YX3 A;  3BDD A;  2DK5 A;  2QQB A;  3C18 A;  4E70 A;  4CH7 A;  3CME I;  1P92 A;  1IDZ A;  2Z9O A;  1E0E A;  2IA1 A;  4NC6 A;  4HA8 A;  1R58 A;  3PM1 A;  5E1X A;  2NAZ A;  4LGW A;  4YFX F;  1Y39 A;  3BZC A;  4BYY A;  3FHZ A;  1EV7 A;  1G59 A;  2JTV A;  3BOQ A;  5K1Y A;  1FIA A;  2AQF A;  3FK6 A;  3K4N A;  2BW3 B;  1HCR A;  5EGO A;  1PP8 F;  1MND A;  2KIS A;  1ZKG A;  1JUP A;  1RI7 A;  1JKO C;  1ZG5 A;  2JVH A;  3HPG A;  1VQ6 I;  1V5F A;  2BE5 F;  5KHD A;  3RPU D;  2K9M A;  3HRT A;  3WHB A;  1ACI A;  1FMW A;  2O9L A;  1PVE A;  3ERM A;  2OBP A;  4YEJ A;  3WU0 A;  4B1R A;  2L9V A;  5D5U B;  1WJ5 A;  4CYC A;  3S1M J;  5FGM A;  4OU0 A;  1BOA A;  1QNT A;  1GXQ A;  2K40 A;  3R60 A;  4AC0 A;  2CFO A;  3JTH A;  3NAR A;  1RKW A;  4HPQ A;  3V4G A;  1YFH A;  1MMD A;  3AL0 B;  2E19 A;  3GBG A;  5F64 A;  4DJA A;  3J7A O;  2G7H A;  2MLK A;  2FU4 A;  3BPX A;  2EIJ H;  1FZP B;  1IDY A;  2XAF A;  1TLH B;  4C9Y A;  1S72 I;  3MVP A;  2ZCW A;  4IF4 A;  1BI0 A;  1H9T A;  1ETK A;  3L1P A;  2VC1 A;  3DTE A;  1VQ8 I;  2IT0 A;  3FDY A;  2FMY A;  5KVR A;  4WXH A;  2QKM B;  3AFH A;  2B0L A;  1IF1 A;  3OYB A;  2W82 A;  1KU9 A;  3LSJ A;  3ZPL A;  4M9Z A;  4LLN A;  1HXD A;  5LEJ A;  1MGT A;  2HGC A;  4P55 A;  5BOX A;  2DYR H;  1Z7U A;  3HOX J;  2CS3 A;  3A01 A;  4Z6Y A;  3CCL I;  4G7Z F;  3F72 A;  2MC4 A;  3RKX A;  3CMM A;  3KP5 A;  1HDD C;  2LKP A;  2F2E A;  2X48 A;  3S3N A;  4BS9 A;  1MD0 A;  4I09 A;  4P1W A;  1BM9 A;  2CV2 A;  1KGS A;  2ELK A;  4HX8 A;  1BR2 A;  1R22 A;  3FXJ A;  3EQL F;  2MAB A;  3WGG A;  1FX7 A;  2HVR A;  2NVY J;  4UB6 C;  4XLC A;  1Z9C A;  3A2K A;  1QVT A;  1R23 A;  4XRS A;  3HOY J;  4IHW A;  4OMY A;  2IGO A;  2MLG A;  3CJQ B;  1NG7 A;  3I9V 2;  1IN5 A;  1W4M A;  2OCE A;  5B66 C;  2R3S A;  1YJN I;  3S2W A;  2FNA A;  3T8T A;  5C4J J;  4HF0 A;  1KZH A;  1R5G A;  5ILU A;  4D9J A;  2DMN A;  1YW9 A;  3L2V A;  2IVM A;  3REO A;  5FFZ A;  4D5F A;  1Z3Y A;  1VF9 A;  3LL7 A;  3S3O A;  2VT3 A;  3V7R A;  1Z05 A;  1VFC A;  3DLL F;  2EV0 A;  2DQL A;  1RC9 A;  2JK3 A;  2E7W A;  5TGT A;  2MH9 A;  1OYW A;  4A5M A;  1OPC A;  3KLO A;  2X85 A;  1EH8 A;  3DLA A;  3RDI A;  4ESB A;  3BTC A;  4A0Y A;  4HDU A;  1K61 A;  2KIQ A;  3X2Q H;  1TP4 A;  3CES A;  2VBW A;  4DZP A;  2W7N A;  1GLN A;  1JXS A;  2FQ3 A;  3IC7 A;  3KYD B;  2CQQ A;  3ECO A;  1I6H J;  3G6E I;  2LKX A;  4YFK F;  2HTS A;  3GME A;  4DZJ A;  3MQ0 A;  5EDN A;  3HIF A;  5L3G A;  2X1D A;  1SAU A;  1YLF A;  1L3L A;  3JRD A;  1APL C;  4D1Q A;  3J7Y J;  3QP6 A;  5IYD J;  1XCB A;  1FOK A;  1FPQ A;  3UNG C;  1SEU A;  2KRF A;  1ERD A;  4BY1 J;  4CYD A;  2OTJ I;  1QU3 A;  3J7A Y;  1F1Z A;  1YIO A;  2KT0 A;  2WAF A;  2Z1D A;  2BOL A;  1HKQ A;  1YOV B;  2IP2 A;  3ZQI A;  2XAJ A;  2FD5 A;  3IWF A;  4XLP F;  4BE0 A;  2DOA A;  2XAU A;  3PSI A;  4LLG F;  5D6F A;  5F0C A;  1H88 C;  1WH7 A;  1YYV A;  1TWG J;  3W6V A;  5IP9 J;  1TT5 B;  2R7W A;  2GQQ A;  1WJE A;  3N4M A;  4BBR J;  5K7H A;  4BY7 J;  1V5E A;  2LD5 A;  3BWG A;  2QF7 A;  1ETW A;  2XSD C;  4ENM A;  2VJJ A;  5CVJ A;  1V4R A;  3GX4 X;  1TWC J;  4MLO A;  1WVR A;  2NNN A;  2YS9 A;  3BC8 A;  1IJW C;  2HPI A;  1KON A;  4WF2 A;  3CJN A;  3GLL A;  3BCB A;  2DYS H;  1W0T A;  5EG0 B;  1WWX A;  3A0H C;  1S7E A;  5D8L B;  3OMY A;  1JTY A;  3QPH A;  2MGQ A;  2LFB A;  4CCJ A;  1MBJ A;  2ZBK A;  4A3F J;  1SFU A;  3VSK A;  1T33 A;  2NVX J;  4U0V A;  1VQ4 I;  2JA5 J;  2CMP A;  5K5Q A;  3QOD A;  4ZZD A;  4ABZ A;  1IUF A;  4KA4 A;  4MFD A;  4CA0 A;  2V26 A;  1POG A;  1I1G A;  2QQ8 A;  2EIN H;  5K7F A;  2ID3 A;  4UXN A;  5FLM J;  4XSZ F;  3S16 J;  1FTZ A;  1NHA A;  2F5C A;  1YE9 A;  1REP C;  3KP7 A;  5B5E C;  1ZYR F;  2DTZ A;  2M8E A;  4IRH A;  3TW6 A;  2IRF G;  4RGX A;  1T2K A;  2ZFU A;  4EGY A;  2A6H F;  3L2U A;  3H9G A;  4XMY A;  2JVG A;  1OCZ H;  1QQI A;  3FXR A;  3L00 A;  5CJ9 A;  4M6X A;  1FYM A;  2WB1 A;  3OYK A;  1PYV A;  2OV7 A;  3DXJ F;  3K10 A;  3GZN B;  1D1B A;  1Z6R A;  2EQR A;  5KNL A;  4A3I J;  1SFE A;  4R8H A;  2NS7 A;  3KEY A;  3FHN A;  1Z1D A;  3D0S A;  3KPH A;  2R92 J;  1NK2 P;  2JMW A;  2PJP A;  3QU3 A;  2ISY A;  2EZH A;  2VB6 A;  1ON1 A;  4I0B A;  1KQ8 A;  2GOM A;  3EUA A;  2VJI A;  4XSX F;  4EM1 A;  3H9Q A;  3MN2 A;  1R9T J;  1B9N A;  3PIP F;  1O4X A;  3PNV A;  4G8X A;  2A6T A;  3SEZ A;  1XSX A;  2HR3 A;  4D5C A;  4JK1 X;  1CGP A;  1S9H A;  2E35 A;  3GEZ A;  3O8G A;  1MBH A;  4M74 A;  2O03 A;  1LDD A;  2V4J C;  3F8N A;  3DU6 A;  4KMF A;  2M5W A;  3T8R A;  2JQ7 A;  3V42 A;  3CUO A;  4ZDL A;  4LK0 F;  3Q9S A;  5EGO B;  1MW7 A;  2EIK H;  5DS9 A;  1PDN C;  5M3M J;  4L5I A;  2K9Q A;  1N75 A;  2V9V A;  3KIO A;  4PK4 A;  3I59 B;  3B73 A;  4U7B A;  1H8A C;  2QVO A;  4NQW B;  2PMU A;  2XUB A;  1XSV A;  3HXL A;  3SXY A;  5F1R A;  3LAJ A;  2ZO4 A;  5IYC J;  4J00 A;  3L2R A;  2K7L A;  1HOM A;  4QSH A;  2DN0 A;  1HKT A;  2Z33 A;  3U9G A;  1E17 A;  4IX7 A;  2Q0O A;  4L9N A;  3GO5 A;  2EA2 A;  2M7B A;  4DNC A;  2VBZ A;  1FNN A;  2EB7 A;  2M4K A;  2ZKZ A;  3VB2 A;  1UAA A;  2HKO A;  2BW3 A;  1D8K A;  1XGN A;  1F36 A;  5F27 A;  2X0L A;  4I2O A;  2VKV A;  1QZY A;  1ZG3 A;  2ID6 A;  2YX4 A;  3GTP J;  3LA2 A;  1ZG1 A;  1ZRF A;  5EF6 A;  4IPA A;  3M4O J;  1RR8 C;  2DOD A;  2EIL H;  2KDZ A;  2FNP A;  2W24 A;  5HNF A;  5DCM B;  1ZRE A;  5B1A H;  2D1H A;  3S14 J;  2HQN A;  2ADU A;  4RBO A;  3NWS A;  1MH3 A;  5M5W J;  1ZAO A;  2CQ7 A;  2DCE A;  2WV1 A;  4YIF A;  4PJM A;  4XBF A;  2Y9Y A;  4RAG A;  5LLQ A;  1AU7 A;  5GTI C;  3HRU A;  2YSR A;  4PZJ A;  4DYC A;  2P5V A;  2VL8 A;  4HZF A;  1YRN B;  1S7A A;  1B72 B;  1UCR A;  2K85 A;  2LY1 A;  1DP7 P;  1YX5 A;  1OJL A;  2IS2 A;  1X2M A;  1JKQ C;  3SFZ A;  1WSU A;  3DKY A;  1W1W E;  3BJO A;  3TO7 A;  1K78 B;  3BQY A;  2L0K A;  4CUG A;  3EYI A;  4XID A;  2LVS A;  2QCO A;  5E3L A;  2ZXH A;  1S8N A;  3WTY C;  3TED A;  5DD8 A;  2K86 A;  3HJE A;  4B3A A;  3LQQ A;  1Z67 A;  3N05 A;  3C2G A;  1HC8 A;  4PSX A;  3DCF A;  1JI8 A;  1A5J A;  1P6R A;  2QEN A;  3KP4 A;  2NXN B;  1XTA A;  5CYV A;  3CC4 I;  3ESW B;  4A69 C;  3Q3S A;  1T0F C;  3D5L A;  3O2P E;  4CCK A;  3CD6 I;  4NUB A;  1NG6 A;  2JUC A;  4CSW A;  4G7H F;  3NWT A;  3SZP A;  4FAS D;  4I6Z A;  2XPW A;  1BJZ A;  2V1N A;  1BIB A;  1F9N A;  1ZEL A;  2RN7 A;  2XIG A;  2I10 A;  5FJ8 J;  1IAW A;  2VIX A;  1R5I D;  4A3B J;  5HDN A;  1WQ2 A;  5DM7 F;  1VQN I;  2DQR A;  4FE7 A;  4A0Z A;  4F3Q A;  2BEO A;  2Y30 A;  1O57 A;  2G7U A;  2NOJ B;  3I0T A;  3R0J A;  3L2Q A;  1WCM J;  5J4V A;  3S93 A;  5JVG F;  1IC8 A;  1QA6 A;  3ZQ7 A;  2DFH A;  3V8K A;  1N77 A;  2QZ8 A;  3KEQ A;  2UXN A;  5TIS C;  4Y52 J;  2BV6 A;  1X3W B;  1GVD A;  3CCY A;  3CC2 I;  2B7E A;  1C0W A;  1SFX A;  4HQM A;  3FMR A;  2BY2 A;  1WGX A;  4QPO A;  1W5T A;  2K9L A;  2TDX A;  3CUQ B;  1ZTR A;  3KP2 A;  4RMN A;  5F1J A;  1ODD A;  3K2A A;  2XGC A;  2XHK A;  2ZJ2 A;  2HZD A;  5IPA A;  4A0X A;  4RB2 C;  1IGN A;  4MQ9 F;  1QZE A;  2WTE A;  3TOB A;  4OMZ A;  1BI3 A;  2HXI A;  2LYC A;  4M73 A;  4XM3 A;  4ZYA A;  2HFH A;  1JHF A;  5E1W A;  3N97 A;  3TL4 X;  3QYB A;  3FBI B;  4UUT A;  3F8F A;  3SYT A;  3TO9 A;  3AKZ A;  2EIM H;  4CCL A;  1KU3 A;  1JKP C;  3ZMU A;  1T0F A;  2CW7 A;  4RB3 C;  1OYY A;  4JOM A;  4RLQ A;  4RGU A;  1UB9 A;  4AM3 A;  3I4P A;  3AG4 H;  4JX4 A;  1KA8 A;  4E7H A;  1YO5 C;  3DFG A;  1HW5 A;  3VYU B;  1M1E B;  3P9C A;  4PJ0 C;  3ZMV A;  1X3Z B;  1A6Q A;  1SMY F;  2P5L C;  2HOT A;  1ZRC A;  2KIM A;  2ZNZ A;  4J19 A;  4F91 B;  1SAN A;  1G8X A;  4ITV A;  3R4K A;  2IGN A;  2ZC2 A;  4IKF A;  5HDK A;  3CDL A;  2E7X A;  5HNH A;  3IKT A;  4DBR A;  1SD7 A;  4KIG A;  2Z3Y A;  4A3J J;  6PAX A;  1R00 A;  4MEY F;  4KIC A;  4Y13 A;  4M3B A;  2O6G E;  4I7H A;  4PSW A;  4G6D A;  3M8E A;  2B9S A;  2F6C A;  4GDF A;  2WC2 A;  2V79 A;  3UKG A;  5J4Y A;  5DUK A;  3H5R A;  3CTA A;  5H2F C;  5B1B H;  4OWR B;  3LSH A;  5JVT A;  4GYI A;  4XON A;  4BUP A;  4WK8 F;  2DW4 A;  4EM0 B;  3KLN A;  1ENH A;  3C7J A;  2CQN A;  2OUM A;  3HL2 A;  2F4M B;  1E3H A;  4BJ5 C;  1B4A A;  3KZZ A;  4IO9 F;  1S5L C;  4KN4 X;  5ERI A;  3GWZ A;  3ZGK A;  2XRO A;  3AG3 H;  4BE2 A;  1MBE A;  3PUB A;  1WJC A;  3VYR B;  2YU9 J;  3K70 D;  1D1C A;  5GAH J;  2WAQ A;  1JTX A;  4L18 B;  2VKD A;  2M9H A;  2H94 A;  3IHU A;  5LRR A;  4IHV A;  2LKS A;  3D5R C;  5BQT A;  3MMY B;  1FYK A;  1BC8 C;  3K70 C;  4P96 A;  2HYG D;  1XSD A;  5EG0 A;  3RKW A;  3QAH A;  4KNY A;  3WE2 A;  4D7M A;  4V19 K;  2WBM A;  2IEK A;  1X1C A;  3RCO A;  2KJC A;  2LBF B;  1I39 A;  4Y4R A;  4IOC F;  1R36 A;  5L3D A;  3BLY A;  4QPQ A;  3GCM A;  1VQP I;  5KAI C;  2CW0 F;  2IJL A;  2Q2E B;  2CQK A;  4BGD A;  4ANJ A;  2WAQ N;  4H0E A;  3HPH A;  3J81 Z;  3WTU C;  4BU2 A;  1XD7 A;  1MMA A;  4UVA A;  2VOO A;  4XQF A;  2IBD A;  3OWT A;  1XGS A;  3PQK A;  2LY9 A;  1X2N A;  4L9J A;  3G71 I;  1RUO A;  3VWB A;  1VQ5 I;  3QQA A;  2X6Y A;  3F21 A;  1F5T A;  2IA2 A;  3BG9 A;  4G7O F;  4UUV A;  1MIJ A;  5E3N A;  3WU2 C;  2H6B A;  2L7K A;  3HB9 A;  1IN6 A;  1LJ9 A;  2JA8 J;  1R1U A;  3K4L A;  2CU7 A;  1DQU A;  5E79 C;  3FM3 A;  2XGE A;  3QWL A;  4A3E J;  3FBN B;  1QHG A;  4UV9 A;  5E8I A;  1TNT A;  1U9O A;  2RGV A;  3OYC A;  4NHJ A;  1IRZ A;  1ZR4 A;  1Y0U A;  3GFM A;  1OCO H;  2O0Y A;  3FM5 A;  3W2W A;  4ZYD A;  1TL8 A;  1BW5 A;  2IAI A;  1HW1 A;  1J59 A;  3K2Z A;  4Q47 A;  3TQN A;  1X1P A;  2BY0 A;  1NK3 P;  3TDU C;  1MJA A;  1H9G A;  2DK8 A;  2DDA A;  2DJN A;  4N0B A;  1RES A;  1LFB A;  3ASO H;  3ULQ B;  3R0A A;  2FBH A;  1YS6 A;  1ZGA A;  2DT6 A;  4KT6 A;  2E1N A;  2DT7 B;  5CVI A;  3HOU J;  4L5J A;  4ZYE A;  4A6D A;  2PMZ N;  3MKY B;  4OIQ F;  4BAC A;  3PJR A;  1UZC A;  2DDB A;  4GYG A;  4WXC A;  2ZSI B;  2VUM J;  5M5X J;  3I59 A;  2CYY A;  3M07 A;  4E4H A;  4MFE A;  2HWV A;  2BGC A;  3GW2 A;  3PSF A;  4C3H J;  3LFK A;  4NQW A;  2EFN A;  3BR2 A;  4HF1 A;  1V54 H;  2EFP A;  4OIP F;  3BG5 A;  1JGS A;  4RAZ A;  3GTO J;  1FIP A;  1B6A A;  4IZZ A;  1ZGJ A;  2P0W A;  5ED4 A;  1STZ A;  5EZG A;  1IW7 F;  1USS A;  4ENJ A;  2VKE A;  2O7O A;  1EA3 A;  4AU7 A;  4YIR X;  2WAD A;  1Z3X A;  3RI4 A;  4BH9 A;  2AXT C;  3HKZ N;  1BJA A;  2VN2 A;  2F4O B;  4IL6 C;  1MMS A;  1R6R A;  4RGR A;  2MFZ A;  1TBX A;  2JPC A;  4HV6 A;  3ZP5 A;  2E1C A;  2VI6 A;  3OYE A;  2H6C A;  1FC3 A;  3OYF A;  3QOE A;  1X4P A;  2G9W A;  5M3F J;  2E71 A;  1FWZ A;  4HX4 A;  5CQE A;  3KZY A;  1FSH A;  5J1R A;  3COA C;  4E7Z A;  1XCV A;  3MEX A;  2AXL A;  1O3T A;  5DCM A;  2VJ4 A;  1KU7 A;  3BTL A;  5HLI A;  2HDW A;  5FLX K;  2OZU A;  3ML6 A;  4KN7 X;  1U8R A;  1H89 C;  2IGK A;  3F6V A;  3IUO A;  1OQY A;  2HS5 A;  2EA4 A;  1YRN A;  1X1B A;  2XAH A;  3T1B A;  1B72 A;  3WGH A;  3CUQ C;  4MEX F;  2EK5 A;  3W2V A;  1LDJ A;  2YU3 A;  2DU9 A;  3PUF A;  3ZR8 X;  3OYJ A;  1K78 A;  2TCT A;  2CO5 A;  3A1Y A;  5DV5 A;  1O3S A;  5DM6 F;  3VPR A;  2XGX A;  4LB6 B;  2RRE A;  3RPU A;  4EJO A;  2KPM A;  1GXP A;  2DPD A;  2KDO A;  1ZQ3 P;  3CZ6 A;  5JHU A;  4B8X A;  2GWR A;  1G3W A;  4XLE A;  3ZN1 A;  2I5U A;  3K0L A;  4JYK A;  2HEO A;  2PN6 A;  1LVA A;  3BRO A;  2GOX B;  1HKS A;  3OYI A;  3T5X A;  4RAY A;  3JAM K;  1U3E M;  1J75 A;  3I4N J;  4XLA A;  4IXA A;  2FE3 A;  2R7D A;  2NNY A;  3GFJ A;  1IV6 A;  4R79 A;  4UVB A;  3AG2 H;  5EEA A;  2CUZ A;  4XR6 A;  3HSF A;  5JHF A;  3TW7 A;  1LPQ A;  3KZI C;  5IT9 K;  2CW8 A;  2V6C A;  5E17 F;  4AUX A;  2PJR A;  3F9K A;  4V2G A;  2A61 A;  4B43 A;  2EH3 A;  1XB4 A;  2RKH A;  2VXZ A;  2OA4 A;  4YG2 F;  2O8X A;  4HBL A;  1SD6 A;  2OQG A;  2DBB A;  3ISP A;  3L9F A;  3QYF A;  5LFA A;  1K6O A;  1SD5 A;  4ZDO A;  4UNO A;  1IXC A;  1K79 A;  2FA5 A;  5AIQ A;  2FOW A;  4M3D A;  2LK2 A;  2FXA A;  4F92 B;  3DTI A;  2DA6 A;  5ICE A;  3L7W A;  4MTE A;  4B3X A;  5CVU A;  3JRE A;  3IWZ A;  2ISZ A;  4MTD A;  4L0Z B;  1X3U A;  4HLY A;  3RKQ A;  4HNT A;  5DCF A;  4F93 B;  3L2W A;  2L9S A;  3CUQ A;  5ICG A;  3WOD F;  3RJP A;  1OCR H;  2CUJ A;  3GLX A;  5FFX A;  1MJB A;  4PJN A;  4PUS A;  1R4M B;  1HBX G;  1BR1 A;  3GXO A;  4AIJ A;  5D5W B;  3J80 K;  1J09 A;  2FQ4 A;  2ICW G;  3K7A J;  4W97 A;  2KZV A;  1EJ9 A;  5EJC A;  3LA3 A;  3I56 I;  4Q5S F;  3GF2 A;  2WAE A;  2ETH A;  1R4N B;  2DT5 A;  2LRE A;  5BNG A;  1XS9 A;  1AWC A;  1ZLK A;  2V1U A;  2IPQ X;  1WH5 A;  5FD6 A;  3TMO A;  2V1D A;  3EPZ A;  4L9T A;  1E2X A;  1TWH J;  4CGZ A;  1ZN2 A;  3RPQ A;  3FF5 A;  5IOY A;  4TV7 A;  3G2B A;  1TW2 A;  2NOG A;  3EUH C;  2W84 A;  4B4C A;  3LSG A;  1U6G A;  5E18 F;  5D5V B;  2XRL A;  4XOR A;  2W85 A;  3LWF A;  4C2U A;  5BPI A;  4E7S A;  4AID A;  2P4W A;  2FX0 A;  3BY6 A;  3S17 J;  4F52 A;  3EUK L;  3KX2 A;  1ORK A;  1I50 J;  3QPL A;  4HST A;  2KRH A;  1ETO A;  1IN4 A;  1UST A;  2WA0 A;  4UY8 I;  2M45 A;  2LF8 A;  2LTP A;  2XDV A;  2UXX A;  2HDD A;  4M6V A;  4N4N B;  4UUS B;  2BXY A;  1ONV A;  5H6R A;  1YG2 A;  3E5X A;  4Q4Z F;  1HA8 A;  1G3Y A;  2PMH A;  2M0M A;  1ZLJ A;  3KFW X;  3SEQ A;  1T39 A;  1VQM I;  1P2F A;  4OAZ A;  3DTK A;  3L09 A;  1HST A;  2VQC A;  3OS1 A;  4DBQ A;  1IO2 A;  4FQG A;  1AHD P;  2P7C B;  2M30 A;  2DA1 A;  2QM3 A;  4IHX A;  4GXO A;  4HW0 A;  4S04 A;  1X58 A;  3GZ6 A;  4XIC A;  1GV5 A;  3CP8 A;  3IL2 A;  3ZQQ A;  1A04 A;  2HQR A;  2FJ1 A;  3H1C A;  4BXX J;  4I99 C;  2VPL A;  1GHC A;  2Q8K A;  3DF8 A;  4ENN A;  4RB0 A;  1JE8 A;  3PFI A;  3FXU A;  5K5O A;  4LIU A;  4BJ6 C;  2HTJ A;  2GBY A;  1YI2 I;  4BNC A;  5EEG A;  4MHG A;  5GAG J;  5CPR B;  1XGM A;  2LBF A;  3EUH A;  3S1Q J;  2HOE A;  1AOY A;  4ESF A;  1G4D A;  2ESH A;  4M72 A;  4PGG A;  2Q1Z B;  2HYF A;  4B48 A;  4IHY A;  2RNG A;  1T98 A;  3LA7 A;  2Q2E A;  2CV1 A;  3G1L A;  3SZG A;  2ELH A;  4FHT A;  4Y7N J;  3ZN0 A;  3G73 A;  2K27 A;  1S3J A;  5E20 A;  4LG0 B;  4BXF A;  3KYL A;  3WTT C;  2DLL A;  1MBG A;  2R4G A;  3F8B A;  2JA2 A;  3BR0 A;  1FP2 A;  2VBY A;  3HGG A;  3I64 A;  3OR1 C;  4LIV A;  3RZO J;  3K4B A;  1JKR C;  4G6T B;  2N8G A;  1AA7 A;  4AD9 A;  1MMG A;  4HYE A;  2L02 A;  1XMX A;  2DO7 A;  2KHM A;  4KDP A;  1I3Q J;  4YEL A;  4ETS A;  2JZY A;  2RQP A;  3C3W A;  4BKX A;  5J6X A;  1DPU A;  3CMY A;  4IJA A;  2KQR A;  1QO0 D;  4XLF A;  3K1P A;  1DDN A;  1XDS A;  2ELJ A;  1J0R A;  5LHI A;  2M2E A;  2XVC A;  2XC7 A;  2DOE A;  4E7K A;  3W2A A;  4LD5 A;  3JRG A;  2FML A;  1YW8 A;  4IRG A;  2A3S A;  3SQN A;  2ZXW H;  1PP7 U;  2HKX A;  1FP1 D;  1D0Y A;  5DYM A;  1RNL A;  1XGO A;  3BG3 A;  2L2O A;  4K2E A;  4L0Y B;  3E3V A;  1VQO I;  2CRG A;  5LHH A;  1WZ2 A;  2Y2Z A;  4X6A J;  3LSK A;  4YFN F;  1A31 A;  4I0A A;  2M1B A;  1A6I A;  4XK4 A;  2HPM A;  3HHG A;  2ZXI A;  2R7O A;  1OKR A;  3UR3 C;  4KYW A;  2IGM A;  2MH2 A;  2CH0 A;  3CJR B;  2GM4 A;  1RPW A;  3K4C A;  3ZQH A;  4EAT A;  3ZQG A;  2CJJ A;  4AIH A;  4XKV A;  1BN5 A;  1CF7 B;  3U2R A;  1HDP A;  4EMS A;  4F7Z A;  2WY7 Q;  3OL4 A;  4DYQ A;  4PJL A;  2DAO A;  3K1N A;  4FET A;  4NC7 A;  3OYA A;  1R49 A;  1LFU P;  1KYW A;  3FIS A;  3F6O A;  4HEA 2;  3TP3 A;  4N4O B;  5A2Q K;  3V7S A;  3OSG A;  3L2C A;  2DJI A;  1SAX A;  3V8J A;  2KP6 A;  2X1C A;  4FCY A;  4PCQ A;  4BBS J;  2JJ7 A;  3KYC B;  3GTM J;  3HRM A;  5HDG A;  3JRC A;  4PDK A;  4A3G J;  2O61 A;  5HLG A;  3GZ5 A;  2LR8 A;  2E1O A;  3A0B C;  5KK1 A;  1OCT C;  1JUM A;  3I58 A;  2MC3 A;  1VQ7 I;  1VQ9 I;  2VKH A;  2MA3 A;  3DKW A;  1IN8 A;  2G0E A;  4RGS A;  2IA0 A;  4BHC A;  3I53 A;  2FSW A;  3DBH B;  3OIO A;  1BI2 A;  2A68 F;  3GFL A;  5H20 A;  3ELK A;  5FKO A;  2R5Z B;  4L9V A;  2PJR B;  3JSO A;  1MBF A;  1JHH A;  5E3M A;  4L5E A;  4DYR A;  2ECB A;  2HOA A;  1ZRD A;  4LG3 A;  3I55 I;  4G94 A;  4UV8 A;  2R93 J;  4M3E A;  4ON0 A;  2VE9 A;  2BYV E;  3H3U A;  4Y33 A;  1VZ0 A;  4J01 A;  3WG9 A;  2AHQ A;  5JLX A;  1LEA A;  2HDC A;  1IUY A;  1GV2 A;  1PUE E;  1K4S A;  3S32 A;  3CCV I;  3MKW B;  1JJ8 C;  2A07 F;  3HC7 A;  4CIC A;  2NS8 A;  2E1M C;  3H3Z A;  1UG0 A;  3JRA A;  1IN7 A;  1XC5 A;  3SJM A;  4BEH B;  2VOD A;  1H0M A;  5L3C A;  2ZME C;  3E1S A;  3PQJ A;  2MD0 A;  5DEQ A;  2CWE A;  2LY2 A;  1WPK A;  5CVR A;  2OC6 A;  1G6N A;  2L7M P;  3HGY A;  1TWF J;  2EBI A;  3MAJ A;  1YIJ I;  1FEX A;  5IYB J;  4Y15 A;  3DEU A;  2BY1 A;  1TQM A;  4HRI A;  2OAZ A;  1SVL A;  4O6J A;  3JSP A;  4ZDP A;  4D0P A;  5HVQ C;  2F4I A;  2H09 A;  1FMV A;  2R0Q C;  2ZFW A;  2E34 A;  2M7A A;  4A12 A;  1I1S A;  2EFQ A;  2KMU A;  5LGN A;  5L3B A;  1LE8 A;  2PG4 A;  5DTD A;  2QQ9 A;  1KU2 A;  2IS6 A;  1QGP A;  5CQG A;  2NS0 A;  3OYL A;  4M9S A;  2IS1 A;  2E60 A;  2VBX A;  4IVN A;  3HTU A;  3V7C A;  4JX6 A;  3BCA A;  1F43 A;  4JQF A;  1TT0 A;  3E6C C;  2GXA A;  2LH9 A;  3H0G J;  3TP0 A;  1G3S A;  3ABL H;  5FRO A;  1XMA A;  2HYJ A;  3Q0W A;  2ZXJ A;  2TRT A;  3EDP A;  2Y31 A;  4KIS A;  4NB5 A;  3PO2 J;  3MKL A;  4CDG A;  5FKK A;  2HXO A;  2HI3 A;  5FLX Z;  3KEO A;  3DQV C;  3FXM A;  3VEP A;  3CMA I;  2RDP A;  2E5N A;  3WGI A;  3GTQ J;  3VOE A;  2EZL A;  1K83 J;  1N78 A;  1Y0N A;  4KMU X;  2F5V A;  4C2T A;  3LSI A;  2ZNY A;  3G4S I;  3BPV A;  1WJA A;  4B09 A;  3BZK A;  3ABT A;  2LF7 A;  2VLA A;  4II2 A;  3M7G A;  4P9F A;  1VQL I;  3RIR A;  4ASN A;  5J40 A;  4BQQ A;  1O3R A;  3F0C A;  1JT6 A;  1ON2 A;  1MDM B;  1J2X A;  3LMM A;  3ZMT A;  1X1A A;  4DGW B;  2DA5 A;  5F6F A;  1MBK A;  1X4O A;  3G3Z A;  1WJB A;  4N9H A;  3Q0V A;  3ZCO A;  5LRS A;  2R5Y B;  4IHT A;  3S15 J;  4HX7 A;  2XAS A;  2E5Z A;  4CCO A;  1KYZ A;  3JAM Z;  1VI0 A;  2GXB A;  1QVU A;  1S6L A;  1PJR A;  2V9K A;  5D8K B;  2HNH A;  1GVJ A;  2J5P A;  1LDK B;  2LG4 A;  2D1V A;  3SDB A;  2R7Z J;  2DMP A;  4E6K G;  5IT9 Z;  3IRR A;  2CSO A;  1FYL A;  1ETY A;  1NH3 A;  3BG6 A;  4Z2Y A;  4IRI A;  3HOV J;  3AG1 H;  3VOD A;  3LNQ A;  2K3P A;  2VON A;  5BS6 A;  2QA4 I;  3ONQ A;  4FTH A;  3VSL A;  2E36 A;  1P4X A;  3F23 A;  4UUS A;  3CO7 C;  3FZV A;  4AYB N;  3FXK A;  4OIN F;  1IZ1 A;  2HU9 A;  1MSF C;  5TJJ A;  1WI9 A;  5ICC A;  4XRM A;  2CQX A;  2DMT A;  3CCS I;  3OIP A;  4RM2 A;  3G1M A;  2A5W A;  3OYD A;  3CDI A;  1TQP A;  2F5E A;  1JGG A;  4I76 A;  3IH3 A;  4RLF A;  1QPI A;  3CCE I;  5C44 J;  3TOA A;  2XV4 S;  3W6K B;  4U87 A;  2Z2S B;  1QPM A;  3DP7 A;  1HSJ A;  1YQA A;  4EVI A;  1YIT I;  1DP3 A;  3BR1 A;  3M8J A;  3OSF A;  2PQ8 A;  2LLK A;  1WJF A;  5GPA A;  2O3F A;  2YX7 A;  5KCM A;  2OJE D;  2A6E F;  1Y56 A;  2A05 A;  2HVQ A;  4O5V A;  1Z91 A;  3WTX C;  4LFU A;  3K1M A;  1XX5 A;  3K4M A;  3HYI A;  3A03 A;  2EZK A;  1U78 A;  1Y1V J;  2LP0 A;  3J80 Z;  4YII A;  5HLT A;  2PMZ A;  2JRT A;  2HZT A;  4KJZ A;  1XPX A;  2X6O A;  1K4T A;  5E1Z B;  5ILV A;  3S3M A;  3JW4 A;  2PLY A;  1ZR2 A;  1XMK A;  4X0G A;  3BJA A;  1V3F A;  3E5U A;  3HG9 A;  3RQ4 A;  4LG0 A;  4RS8 A;  2YR2 A;  2JT1 A;  2M0C A;  4FX0 A;  4XOP A;  1IRG A;  2D5V A;  1EKE A;  1EH6 A;  2R7X A;  3OOU A;  1ITY A;  4CHU A;  3CLQ A;  2XPV A;  1DPR A;  4IOA F;  2PBI A;  4S0H B;  5FLV A;  1ZH5 A;  5D5X B;  3CCJ I;  3HKZ A;  2XAQ A;  3E6D A;  1WFX A;  3ZMD A;  4ZJZ A;  3K4K A;  2DTR A;  3FKI J;  4EJT A;  4QLC U;  1TW3 A;  5CVV A;  2MBF A;  3IKV A;  4KIB A;  2B63 J;  1P7J A;  4WCG A;  1YS7 A;  1DU0 A;  2DA2 A;  3BR3 A;  4Y17 A;  2QSH X;  3ZQC A;  3CO6 C;  1O3Q A;  1RET A;  2EZI A;  3E6M A;  4BQN A;  2OTL I;  5GPC A;  4CCM A;  3PNY A;  3KET A;  1PUF B;  1P4W A;  4XKB A;  5D4R A;  5EYR A;  3O3K A;  1YJ9 I;  1AKH B;  3E7L A;  2O8K A;  3DV8 A;  4EGZ A;  3PO3 J;  2W48 A;  3EET A;  4KUM A;  2RV8 A;  1N25 A;  2P81 A;  3ZRG A;  1Q1V A;  3ABM H;  2H1K A;  3O6B B;  2VOP A;  2UV1 A;  4FT8 A;  3OS0 A;  1OMI A;  2GLO A;  2NRA C;  4XLN F;  3RSN A;  1LUJ B;  4ZTF A;  3IV5 A;  3DBR B;  2QKL B;  4EQQ A;  2STT A;  3CCM I;  5DD4 A;  2DMQ A;  2R7R A;  3KP6 A;  1OIS A;  4C30 A;  1W7P B;  1FY7 A;  2RNJ A;  2LOO A;  3T0Y A;  1VTN C;  5HOO A;  3JCU C;  1CF7 A;  3BZ6 A;  2GAU A;  1EH7 A;  5E8G A;  1SMT A;  5FRN A;  2E2H J;  4EV0 A;  2QQA A;  2XPU A;  4FE4 A;  2ZJQ F;  3BT9 A;  1RRJ A;  4ZH4 F;  4II3 A;  3GTL J;  4HNV A;  3MCZ A;  1RZ4 A;  3OYH A;  1HW2 A;  3TKY A;  2O5R A;  2CGP A;  2P5K A;  3LQR A;  2EFO A;  3G1O A;  1OFC X;  4E7L A;  3P9I A;  3MWM A;  1R7J A;  4A6E A;  2HQ5 A;  1S29 A;  3HBL A;  1SFK A;  2RAE A;  2ZSH B;  2Y48 A;  1XG1 A;  1B8I B;  5E3O A;  5D4S A;  2Z99 A;  5J3L A;  1V55 H;  3CQZ J;  1SFO J;  2X1E A;  1MNE A;  4V2F A;  4HQE A;  4KFC A;  2MG4 A;  3OS2 A;  1MH4 A;  4XNF A;  3HOW J;  1UJ8 A;  1SD4 A;  2XF6 A;  3QPS A;  5IP7 J;  2IW5 A;  3C1D A;  4XLH A;  2K5C A;  4A3D J;  4JBA A;  2R5Z A;  3FMS A;  2E2I J;  5EEH A;  5JFR A;  3ABU A;  4AIK A;  3FXL A;  3I54 A;  3O8H A;  4MIM A;  4OIR F;  4A93 J;  2KIU A;  2LDU A;  5GAE J;  2P8T A;  2MSY A;  3MD2 A;  5HS8 A;  3MFK A;  2Y0M A;  5GTH C;  3RYP A;  3TGN A;  3ZQL A;  2DI3 A;  2H8R A;  2HVS A; 
#chains in the Genus database with same CATH homology
 1IC8 A;  1LE8 B;  5IOZ A;  1MBG A;  4Y52 J;  3CCY A;  1GVD A;  2XB5 A;  5GP9 A;  4A3M J;  1WGX A;  3BR0 A;  2ZB9 A;  1CQT A;  3HGG A;  5F1J A;  1ZTR A;  3RZO J;  1DU6 A;  3K2A A;  1JKR C;  2XGC A;  4G12 A;  2N8G A;  3NAU A;  5IPA A;  5FKM A;  1IGN A;  2ME0 A;  1I3Q J;  3BR5 A;  5FKN A;  2HXI A;  1TC3 C;  1ETQ A;  1Z77 A;  4BKX A;  1UHS A;  2DA4 A;  3CMY A;  5C4X J;  5FKL A;  1IDZ A;  4UUT A;  1JT0 A;  3PM1 A;  1JKP C;  2M2E A;  4JX5 A;  4JX4 A;  3LSR A;  3JRG A;  1FIA A;  3FK6 A;  1HCR A;  5EGO A;  1ZKG A;  3JRF A;  1JUP A;  1JKO C;  2HOT A;  3BG3 A;  4J19 A;  1D5Y A;  1WI3 A;  2L7Z A;  1SAN A;  2CRG A;  3WHB A;  2O9L A;  1RKT A;  4B1R A;  3S1M J;  2Y2Z A;  3IH4 A;  4CYC A;  4X6A J;  3CDL A;  3FK7 A;  1U8B A;  3BR6 A;  3FIW A;  4A3J J;  1A6I A;  2K40 A;  2L9R A;  1NTC A;  4XK4 A;  4AC0 A;  3NAR A;  1RKW A;  1Y1W J;  2GM4 A;  4D7N A;  1RPW A;  4M3B A;  2E2J J;  3ZQH A;  3ZQG A;  2CJJ A;  2E19 A;  3GBG A;  3UKG A;  1HDP A;  5M5Y J;  3B6A A;  3IH2 A;  4DYQ A;  1IDY A;  3MVP A;  1LFU P;  3FIS A;  1ENH A;  1ETK A;  3TP3 A;  4C2M J;  3L1P A;  5JLW A;  3OSG A;  1BA5 A;  2R5Y A;  4FCY A;  4BBS J;  1MBE A;  2JJ7 A;  3GTM J;  2OPT A;  2YU9 J;  3LSJ A;  3JRC A;  4A3G J;  2Y9Z A;  1JTX A;  1FJL A;  2M9H A;  4IHV A;  2LR8 A;  2E1O A;  3HOX J;  3LSP A;  1OCT C;  1JUM A;  1BW6 A;  3A01 A;  5EG0 A;  3H3V K;  4D7M A;  4C3I J;  4A3L J;  2G0E A;  1HDD C;  2IEK A;  2X48 A;  3OIO A;  4NDL A;  5FKO A;  2R5Z B;  4JP0 A;  1BL0 A;  2ELK A;  4A3K J;  1W0U A;  1MBF A;  5E3M A;  4L5E A;  4DYR A;  2ECB A;  2HOA A;  2WAQ N;  2R93 J;  4M3E A;  2NVY J;  3RQI A;  1QVT A;  4XRS A;  3HOY J;  2AHQ A;  5JLX A;  4IHW A;  2DA3 A;  1GV2 A;  2IBD A;  1JJ8 C;  3SDG A;  2LY9 A;  1X2N A;  3QQA A;  2ECC A;  2NS8 A;  3JRA A;  3BG9 A;  5C4J J;  5E3N A;  1XC5 A;  3SJM A;  2DMN A;  3HB9 A;  4QIW N;  4D5F A;  2JA8 J;  1VF9 A;  1WPK A;  2CU7 A;  3HGY A;  2L7M P;  2HOS A;  1VFC A;  1TWF J;  2EBI A;  2XGE A;  4A3E J;  4C3J J;  5IYB J;  1FEX A;  1U9O A;  1IRZ A;  2JK3 A;  1ZR4 A;  1GDT A;  3RZD J;  1HLV A;  9ANT A;  3BQZ A;  2IAI A;  1BW5 A;  2JA7 J;  1K61 A;  2JWT A;  2WB1 N;  3BTC A;  2R0Q C;  1NK3 P;  4DZP A;  5F0F A;  1MSE C;  1RR7 A;  1LE8 A;  2DJN A;  2M8G X;  2NVT J;  2CQQ A;  5DTD A;  1I6H J;  1RES A;  5F04 A;  2LKX A;  1LFB A;  4DZJ A;  1TWA J;  5EDN A;  3HOU J;  4JX6 A;  2PMZ N;  2NVQ J;  3JRD A;  1APL C;  1F43 A;  5IP6 A;  1UMQ A;  2VUM J;  2L7F P;  3TP0 A;  3H0G J;  3GTJ J;  5IYD J;  5M5X J;  4CYC B;  4MFE A;  2HYJ A;  3Q0W A;  4BY1 J;  4C3H J;  2TRT A;  2Y31 A;  3PO2 J;  3MKL A;  3BR2 A;  3M3Y J;  5FKK A;  2HXO A;  2HI3 A;  2KT0 A;  3BG5 A;  3GTO J;  1FIP A;  1UG2 A;  3ZQI A;  3GTQ J;  2EZL A;  1K83 J;  2FD5 A;  5EZG A;  5F08 A;  2VKE A;  2O7O A;  5F0C A;  1H88 C;  1WH7 A;  3I4M J;  3HKZ N;  1TWG J;  4LOC A;  3W6V A;  3BTI A;  1PUF A;  5IP9 J;  1VND A;  2DMU A;  1JT6 A;  3F0C A;  4BBR J;  2VI6 A;  4BY7 J;  5K7H A;  1AKH A;  2LD5 A;  2QF7 A;  1ETW A;  2DA5 A;  5M3F J;  1MBK A;  1EF4 A;  5K7Z A;  2XSD C;  3S15 J;  3Q0V A;  2R5Y B;  1E3O C;  2M34 A;  3Q0U A;  5J1R A;  1TWC J;  4MLO A;  1G2H A;  1ZK8 A;  2YS9 A;  1VI0 A;  1IJW C;  2MW8 A;  3BTL A;  1QVU A;  4DW6 A;  3A01 B;  1W0T A;  5EG0 B;  1S7E A;  2CUF A;  1H89 C;  2DMP A;  2R7Z J;  1GT0 C;  1JTY A;  4RDU A;  1ETY A;  3HOV J;  2MGQ A;  2LFB A;  3D1N I;  1MBJ A;  4A3F J;  3LNQ A;  1T33 A;  4MO7 A;  4FTH A;  2NVX J;  2XB0 X;  1YRN A;  5F0H A;  4UUS A;  3BTJ A;  2JA5 J;  4AYB N;  1B72 A;  3LOC A;  4IEJ A;  4ABZ A;  1IUF A;  4MFD A;  3GTG J;  1POG A;  1Z0X A;  1MSF C;  3HDD A;  2TCT A;  4XRM A;  2CQX A;  5K7F A;  2DMT A;  2ID3 A;  3VPR A;  5FLM J;  3G1M A;  4GFB A;  3S16 J;  1FTZ A;  1P7I A;  1JGG A;  4I76 A;  3IH3 A;  1QPI A;  2DTZ A;  5C44 J;  4X1E A;  3TW6 A;  1ZQ3 P;  3JR9 A;  1JJ6 C;  2XGD A;  3S2D J;  2DA7 A;  4JYK A;  3BR1 A;  1B8I A;  3I4N J;  3S1R J;  3OSF A;  2LLK A;  3A02 A;  5GPA A;  2EQR A;  1IV6 A;  4A3I J;  4XRS G;  3ZQF A;  3DEW A;  5EEA A;  1U9N A;  2NS7 A;  3TW7 A;  2R92 J;  1NK2 P;  2JMW A;  1ETX A;  3HM5 A;  3A03 A;  4AUX A;  2EZK A;  1U78 A;  1Y1V J;  2EZH A;  2LP0 A;  2VPR A;  4V2G A;  3SFI A;  2EH3 A;  1OCP A;  2AO9 A;  1ZGW A;  2X6O A;  3MN2 A;  4W1U A;  1R9T J;  1O4X A;  1ZR2 A;  4D5C A;  3O8G A;  1MBH A;  4A3C J;  4M3D A;  2LK2 A;  2M0C A;  2K9S A;  2DA6 A;  2D5V A;  3OOU A;  2K9N A;  3JRE A;  1ITY A;  2COB A;  2XPV A;  5EGO B;  4S0H B;  5DS9 A;  5FLV A;  5M3M J;  3RKQ A;  2K9Q A;  3JRB A;  3B6C A;  5EZH A;  1IG7 A;  1H8A C;  3FKI J;  5J1U A;  3GTK J;  5IYC J;  2B63 J;  1P7J A;  1HOM A;  4QSH A;  2FQ4 A;  2DN0 A;  1DU0 A;  2DA2 A;  3BR3 A;  3K7A J;  4W97 A;  3ZQC A;  1RET A;  2EZI A;  2ME6 A;  5BNG A;  5GPC A;  1JUS A;  1XS9 A;  1WH5 A;  1PUF B;  5EYR A;  1AKH B;  3E7L A;  3HOZ J;  1TWH J;  2O8K A;  1HF0 A;  1F36 A;  5F27 A;  1FTT A;  2VKV A;  3PO3 J;  2W48 A;  2ID6 A;  3S2H J;  2OF7 A;  3GTP J;  2P81 A;  5IOY A;  2NOG A;  1Q1V A;  2H1K A;  4B4C A;  3LSG A;  5EF6 A;  1T56 A;  3M4O J;  3S1N J;  5C3E J;  2KDZ A;  2XRL A;  2GLO A;  4EEF G;  4M3G A;  3S14 J;  4RBO A;  3IV5 A;  4M3F A;  1MH3 A;  5M5W J;  4FIS A;  2DMQ A;  2FX0 A;  2WV1 A;  2X9D A;  3S17 J;  2Y9Y A;  1ORK A;  1I50 J;  3QPL A;  1ETO A;  1AU7 A;  2LTP A;  2HDD A;  4DYC A;  4M6V A;  1YRN B;  4UUS B;  5HOD A;  1B72 B;  1OJL A;  2JN6 A;  2E2H J;  1X2M A;  1JKQ C;  1QRY A;  2XPU A;  5J1Y A;  4FE4 A;  3HEF A;  3BT9 A;  3BQY A;  2L0K A;  3GTL J;  4HNV A;  3WHC A;  4XID A;  2LVS A;  2QCO A;  5E3L A;  3TED A;  3G1O A;  4B3A A;  1OFC X;  3C2B A;  2Y0S N;  1AHD P;  3DCF A;  1A5J A;  2DA1 A;  2HQ5 A;  3JRH A;  3HBL A;  4IHX A;  2RAE A;  1X58 A;  4XIC A;  1GV5 A;  1XG1 A;  4A69 C;  1B8I B;  5E3O A;  3Q3S A;  5J3L A;  2FJ1 A;  3CQZ J;  1SFO J;  2JA6 J;  4BXX J;  1MNM C;  4V2F A;  3JRI A;  2GBY A;  2MG4 A;  4I6Z A;  1MH4 A;  1BJZ A;  2XPW A;  4QTR A;  3HOW J;  1ETV A;  1GUU A;  3QPS A;  5IP7 J;  2I10 A;  5FJ8 J;  2YUS A;  4A3B J;  3S1Q J;  4A3D J;  2R5Z A;  4FE7 A;  4IHY A;  2E2I J;  2CUE A;  2Y30 A;  3O8H A;  4MIM A;  4A93 J;  3G1L A;  2MSY A;  1WCM J;  4Y7N J;  2H8R A;  3ZQL A;  3ZOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...