1ITYA

Solution structure of the dna binding domain of human trf1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
EKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords TRF1
publication title Solution structure of a telomeric DNA complex of human TRF1
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2002-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ityA00
3HOYJ 4JP0A 4A93J 2IEKA 3LSGA 1U9OA 3RKQA 1I3QJ 3WHBA 2B63J 3BG3A 4DZPA 1JT6A 1OFCX 4QIWN 1PUFB 1F36A 2XGDA 1WPKA 3RZOJ 2CU7A 2P81A 1NK3P 2IBDA 2VPRA 1QVUA 1W0UA 3HOZJ 2X48A 2L7FP 3FK6A 2JA6J 2ID6A 4IHVA 1VF9A 2K9SA 3TW7A 4JYKA 5FKKA 3F0CA 3MN2A 1JUPA 4FE4A 2NVTJ 3HGYA 1MSEC 1S7EA 3QPLA 1RESA 3FK7A 4I76A 4G12A 2XSDC 2X9DA 1OCTC 1PUFA 5EYRA 1ETYA 2NOGA 1JKPC 2JA7J 3HEFA 3Q3SA 3W6VA 3IH4A 1DU6A 1HF0A 3O8GA 1ETXA 1W0TA 4IHYA 1MSFC 1FTTA 1K61A 3H0GJ 2VKVA 1RR7A 2E2HJ 3OSFA 4MIMA 2FJ1A 1JUMA 1ETKA 3HOWJ 2EQRA 4M3FA 4QSHA 3TW6A 1LFUP 1QPIA 5E3OA 3SFIA 2XPWA 2DMTA 3CDLA 3E7LA 3HB9A 2TRTA 3NARA 3JRIA 1JJ8C 1ETVA 3IH2A 3JRHA 4IEJA 4XK4A 1DU0A 1I6HJ 4D7NA 5M3FJ 2Y31A 5IP7J 1Z77A 4M3EA 2R7ZJ 1WH5A 2LR8A 3G1MA 2DA1A 3PM1A 3JR9A 3BQZA 3B6AA 1MH3A 2LP0A 3VPRA 2XGCA 5IOYA 3G1LA 1HDDC 1OJLA 5J1RA 2QCOA 3HDDA 2M8GX 2KDZA 5DS9A 2LY9A 3Q0UA 1JKQC 4W1UA 4I6ZA 2MW8A 5J1UA 3I4MJ 2M0CA 2O7OA 3BR3A 2HOSA 1P7JA 3RZDJ 5HODA 4FTHA 5FKMA 2CRGA 3S1RJ 3JRGA 1CQTA 3GTPJ 2R0QC 1LE8A 2Y9ZA 4DYRA 3BT9A 5FKNA 2O8KA 2DMUA 2EZLA 3LSRA 5K7ZA 1AU7A 1MBHA 2MGQA 1YRNB 1AHDP 2ECCA 3TP3A 2R92J 5M5YJ 1TWGJ 4RDUA 4BKXA 4M3DA 1P7IA 5F0FA 2H1KA 4XRSG 1Y1WJ 2HXIA 2L7MP 1RKTA 4XIDA 4JX5A 5EG0B 4UUSB 1FIAA 5DTDA 4D5FA 4A3LJ 3S2DJ 2ME6A 1QRYA 3FKIJ 2O9LA 1UMQA 2DA6A 2R5ZB 5EEAA 4A3DJ 1U9NA 5K7HA 1IUFA 1TWAJ 1A6IA 1IG7A 5FJ8J 1YRNA 1LFBA 4HNVA 5GPCA 1MBEA 2DN0A 2Y2ZA 2ID3A 3C2BA 3SJMA 3BTIA 1H8AC 1FTZA 1FJLA 4W97A 5K7FA 4M6VA 4FCYA 2M2EA 2YU9J 3A01A 3GTGJ 5IYDJ 1K83J 2L7ZA 3OOUA 1TWCJ 4UUSA 2FD5A 2Y9YA 1R9TJ 5FKOA 1GVDA 5FLVA 3CMYA 1JT0A 5F0CA 1ZGWA 1JGGA 1APLC 1ZQ3P 2R5ZA 9ANTA 5JLWA 3BR5A 3S1MJ 2Y30A 3DEWA 2LTPA 3MVPA 2DMQA 3S2HJ 5BNGA 2NVXJ 1SFOJ 3HOXJ 3NAUA 2ELKA 3BTCA 4A3CJ 3ZOBA 2QF7A 4XRMA 2LD5A 5EF6A 1FEXA 2HDDA 5IYCJ 1GDTA 4C3JJ 2DA5A 3A03A 2E19A 1Y1VJ 4J19A 1GT0C 1X2MA 5IP6A 1BL0A 1HOMA 5F0HA 4A69C 4IHXA 2WAQN 1ZR4A 3JRBA 3B6CA 2H8RA 2JK3A 2MSYA 2Y0SN 4DZJA 1F43A 2X6OA 4C2MJ 2WB1N 4AC0A 1HLVA 2R5YB 2XPUA 1FIPA 2HOTA 3TP0A 4RBOA 1JKRC 3GTOJ 3ZQCA 4IHWA 1ZKGA 3H3VK 3LSPA 2JA5J 1H89C 3K2AA 1POGA 2XGEA 1XS9A 1WCMJ 2CUEA 5C44J 5F27A 4BY1J 4MFDA 1SANA 1NK2P 5GPAA 4AUXA 1H88C 1ETOA 3FISA 2E1OA 4B4CA 2NVQJ 3PO3J 4BBRJ 2DJNA 2ME0A 1X58A 2M9HA 3IV5A 1WGXA 1XC5A 2VI6A 1NTCA 4M3GA 1MBGA 2XB5A 3FIWA 2OPTA 3OSGA 1B72B 2JN6A 3IH3A 2HI3A 1JKOC 4CYCB 3QPSA 1ZK8A 1D5YA 5EZGA 5E3MA 2HXOA 3JRCA 2HOAA 3A02A 3LNQA 2MG4A 3ZQHA 2LLKA 2NS8A 3BR1A 4D7MA 5EGOB 2R93J 3HOVJ 3M3YJ 1ZTRA 3GTLJ 1X2NA 3OIOA 1JTYA 3SDGA 5EZHA 3BR2A 3BR0A 4BXXJ 5IOZA 2LK2A 4MO7A 3PO2J 3BQYA 1B72A 4A3KJ 3S17J 1MH4A 2DA3A 4CYCA 2XRLA 1I50J 4BY7J 1IDYA 4S0HB 1ENHA 1QVTA 1OCPA 2IAIA 2K9QA 3Q0WA 4C3IJ 1IJWC 2NVYJ 2GM4A 1TWHJ 2HYJA 5EDNA 2W48A 2DTZA 2AHQA 4ABZA 3K7AJ 2OF7A 2PMZN 2K9NA 1G2HA 2DMPA 3BTLA 2HQ5A 3BTJA 4BBSJ 1BA5A 3S15J 2GBYA 2L0KA 3BG9A 5JLXA 3HBLA 1O4XA 4B1RA 5EG0A 3O8HA 3ZQIA 2I10A 1EF4A 2YS9A 2CJJA 4LOCA 2NS7A 5IP9J 1GV5A 1JTXA 1UG2A 4AYBN 4JX6A 4A3MJ 1ITYA 5J1YA 5FLMJ 1GUUA 1WH7A 1IC8A 1RPWA 1U78A 1TWFJ 1JJ6C 2DA7A 2EH3A 4Y7NJ 4MLOA 4NDLA 2JA8J 2K40A 4Y52J 3S14J 3UKGA 1U8BA 1JUSA 1MBFA 1Q1VA 3GTJJ 3MKLA 4C3HJ 2DA4A 3JRFA 2N8GA 3S16J 2E2JJ 3D1NI 5GP9A 4GFBA 1MBJA 5IPAA 4QTRA 2G0EA 3GTKJ 2EZKA 1E3OC 1IDZA 2FX0A 1B8IB 3DCFA 3S1QJ 5IYBJ 1ETQA 1ETWA 2KT0A 1BW6A 1BJZA 2CUFA 4M3BA 2WV1A 3LOCA 1IGNA 4A3JJ 1XG1A 3RQIA 1WI3A 2EZIA 2LKXA 4DYCA 3LSJA 3GBGA 5F1JA 1GV2A 3HGGA 2M34A 5C4XJ 3CQZJ 2FQ4A 3ZQGA 3BG5A 3QQAA 2L9RA 4FE7A 3HKZN 2D5VA 1UHSA 1T33A 2LVSA 4A3IJ 3TEDA 2LFBA 1T56A 3BR6A 4X1EA 1Z0XA 4B3AA 5M3MJ 1MBKA 3CCYA 4V2GA 4DYQA 3I4NJ 3S1NJ 1AKHB 4FISA 1B8IA 2R5YA 3M4OJ 4DW6A 5J3LA 1LE8B 1BW5A 2DMNA 1VNDA 3JREA 1HCRA 1IV6A 5F08A 2CQQA 4JX4A 3HOUJ 2DA2A 4UUTA 2E2IJ 4V2FA 3ZQFA 2ZB9A 2YUSA 1IRZA 2JJ7A 1ZR2A 3GTMJ 1RKWA 1HDPA 2ECBA 3L1PA 4EEFG 4A3BJ 2XPVA 4MFEA 3GTQJ 1TC3C 5M5WJ 2EBIA 1MNMC 1AKHA 2GLOA 3G1OA 4A3EJ 1RETA 2AO9A 3ZQLA 2TCTA 5F04A 4A3GJ 4A3FJ 3Q0VA 5E3NA 1A5JA 2XB0X 2VKEA 1VI0A 4L5EA 1VFCA 4XRSA 1ORKA 2COBA 5C4JJ 3WHCA 2JWTA 4XICA 3HM5A 2EZHA 3JRAA 5M5XJ 2JMWA 4D5CA 5FKLA 5EGOA 2RAEA 5C3EJ 2CQXA 3JRDA 3A01B 4X6AJ 5E3LA 2VUMJ
chains in the Genus database with same CATH superfamily
2WTEA 2Y0MA 3GLXA 3DF8A 2ELJA 1I3QJ 3H5AA 2ZC2A 5IT3A 2P4WA 4BJ5C 1LEAA 1JT6A 4FQGA 3K1PA 3RZOJ 1WPKA 4XKWA 3HOSA 1K78B 1SD4A 1P4AA 3BY6A 1UG0A 1Z67A 2O61A 4MHGA 1ZLKA 4R79A 1O57A 3FMSA 4UY8I 2L7FP 1D1AA 1I1SA 1VF9A 2K9SA 4NB5A 3CUQC 4MTEA 3JAMK 3WE3A 4BQAA 2L5QA 2H6CA 3C18A 2NVTJ 2XKPA 3K2ZA 5FRNA 2DPUA 5ICCA 3HRTA 3FK7A 3LSKA 3VYTB 5JVGF 5F64A 4G12A 3EYIA 2X9DA 3COAC 4HYEA 2FNPA 4GCVA 2F6CA 5EYRA 5D5WB 2VBZA 3C2HA 1VQMI 1HF0A 4HF2A 4M73A 1TQIA 2ZJ2A 2OZ6A 3H0GJ 4RAFA 1EH8A 5DUIA 3OSFA 5B3SH 4HX8A 5KHDA 1WZ2A 1RUOA 1X1PA 2M7BA 3EUKL 3ULQB 1SFXA 4QSHA 1FBUA 2WAEA 3TW6A 4B44A 1W5TA 3S3OA 4HDUA 2XPWA 2DMTA 1YW8A 3CDLA 3HB9A 5HLGA 2TDXA 3V7RA 2L02A 2TRTA 2L01A 2M8EA 2AXLA 1ZRCA 2OA4A 2CW8A 4IEJA 4LG0A 4DJAA 1OCRH 3OYLA 2QENA 2Y31A 3ABTA 1Y0NA 3HSEA 4M3EA 1BC8C 1WH5A 3G1MA 1IRGA 2DA1A 3PM1A 2WY8Q 2Q8KA 3BQZA 4RB0A 3B6AA 5KAFC 1MH3A 1IZ1A 1TTYA 1YJWI 3VPRA 2DT6A 2XGCA 3OIQA 3GX4X 1SVOA 2KRHA 3G1LA 5J1RA 2QCOA 3VSKA 2VC0A 3DBRB 3WE2A 2MFZA 4BH9A 3OYBA 2UV1A 2KDZA 3C2GA 4IF4A 4BXUA 1JI8A 1X4PA 1R6RA 1G3TA 3I4MJ 2O7OA 2HVSA 1FBSA 2RGVA 2XASA 1P7JA 2KP6A 3VEPA 2W00A 3RZDJ 4PJLA 2E1CA 4EM1A 2V1UA 1XMKA 4HW0A 5ILUA 4G94A 4KA4A 1CQTA 3GTPJ 1FSEA 1L3LA 1LE8A 5CLSA 3H35A 3OYKA 5CQGA 4DYRA 3BT9A 4P96A 5FKNA 3VSLA 2DMUA 2CS3A 4BHPA 3K9TA 1AU7A 4YG2F 2R92J 2WWYA 4RDUA 2K02A 1MDMA 1K7AA 5KK1A 4BKXA 4ENNA 2GXAA 1I1GA 3C1DA 3J7AO 5GAHJ 2E1MC 2A61A 2HEOA 3KEOA 1LFPA 2CSOA 2IS1A 4AD9A 5DYMA 1S8NA 1WJ5A 5EG0B 3U21A 3QODA 3HIFA 2KKOA 5DTDA 1EH6A 2ME6A 2V9PA 3FKIJ 2JVGA 3GFLA 3AG1H 2QWWA 2O9LA 2GOMA 3CCJI 2BHZA 4L9NA 4E7IA 2DA6A 3IKVA 3KP2A 2HQNA 1TWAJ 5K7HA 4A3DJ 1W4MA 1IG7A 1J2XA 1KQ9A 3VODA 1LFBA 3CJQB 1QQIA 5BQTA 3AL0C 5EJCA 5GPCA 1MBEA 1VQ8I 3CF5F 3PFIA 2ZJPF 5HLHA 1J0RA 1H8AC 1V5FA 1FTZA 4RM3A 1U0JA 4IRGA 2R7DA 3OWTA 3DKXA 5L3GA 3A01A 3CMMA 4EJTA 2BEOA 3W3CA 4I09A 4ENKA 1HSTA 1TWCJ 3ECHA 5BPDA 3TQNA 3QP6A 1X3UA 2FD5A 5D5XB 2FXAA 5FKOA 2CV0A 1GVDA 1R58A 1MZBA 2HDWA 2LRDA 5E1XA 5D8KB 1JT0A 5F0CA 4ON0A 2BY3A 1JGGA 1ZQ3P 1QNTA 3KLNA 2R5ZA 3LFKA 2G7UA 3S1MJ 2Y30A 1ZG3A 2FE3A 4OIQF 2LBFB 3M8FA 1D3YA 1MJ9A 4IQ4A 2XAHA 3HRSA 3F21A 4KJZA 4IO9F 3BTCA 2OTJI 2Y75A 4NC6A 2VPLA 3TO9A 3TKYA 1KA8A 1SEUA 2CUZA 2VT3A 3LQRA 4U0WA 4BE2A 1MMSA 3K1NA 2CV1A 1HOMA 4BDZA 1V55H 2HVRA 4ZYHA 1O3RA 3KZZA 3FX3A 4A5NA 4IHXA 4DQ2A 2ZJRF 1ZR4A 3JRBA 3B6CA 2M7AA 2YR2A 4C9YA 5H6RA 2Z2SB 4NQWB 5L3CA 3IRQA 3EYYA 3V7SA 2MLGA 3NQOA 5E8GA 2FEZA 2IA1A 3G73A 5CVIA 4YELA 3AFHA 3CJTB 3S8PA 1GXQA 2BXZA 2BY0A 3HXLA 2HOTA 3D5LA 3LAJA 2L9NA 3ASOH 1WSUA 3CC7I 2VKHA 3BCAA 5E20A 4CO8A 2X4HA 1YW7A 3K2AA 2I8DA 1STZA 4A0YA 1Z3XA 2DT7B 1W7PB 3ISPA 4CDGA 1PUEE 1RZ4A 1SAXA 3CESA 5F27A 2FUG2 1YX5A 4LB6B 4C2TA 4LGWA 1ETOA 2E1OA 3D5SC 4BHCA 3P9IA 3U1KA 4OU0A 1V4RA 1NTCA 3LWFA 1H0MA 3FM3A 4CCNA 1MBGA 3ABLH 1I39A 2XB5A 3KZIC 1SAUA 1XB4A 4XLHA 3C3WA 2CW0F 4LG3A 1YYVA 2FU4A 3R0AA 3M7GA 3QPSA 4F93B 4XM3A 2CMPA 5E3MA 5A2QK 1Y8QB 1UHWA 5J8CA 2HOAA 2QKLB 1R5HA 2XAGA 1YS7A 3EDPA 1KU7A 4BAYA 4D0PA 2R93J 3M3YJ 2ZFUA 3MKWB 3GTLJ 2MC4A 3SDGA 1R00A 3BR2A 4BXXJ 4DIQA 3H5RA 1JGSA 3EETA 1HQCA 5HLIA 2HPMA 4FX0A 2GAUA 1XTAA 4D9JA 4ENMA 2IS4A 2DA3A 4CYCA 3DPUA 1IDYA 2K9QA 1OCPA 3PQKA 4EQQA 1BR4A 3MMYB 1TWHJ 3RPUD 3SDBA 3TDUC 4AIHA 4RB2C 1VQ6I 1X1DA 2DQLA 2P7CB 3ZMVA 3WTUC 2MABA 3GLLA 4MTDA 2HQ5A 2ELHA 1BA5A 4BGDA 2H1LA 5HDKA 2BXYA 3HBLA 1VQLI 2KRFA 3SEZA 3O8HA 1R71A 3ZQIA 3WTVC 1J9IA 1O3QA 2CJJA 2KQRA 1ZGJA 4EJUA 2W4SA 2X6XA 4AYBN 3L9FA 2M45A 2CQKA 4A3MJ 3R60A 3HUGA 2JTVA 3I59B 1RPWA 2A6TA 1TWFJ 1IN8A 2EV6A 4BDYA 2EH3A 2MYSA 3GVAA 3O2PE 4MLOA 2VQLA 1LB2A 2X6YA 5CVRA 2L54A 2JA8J 2W57A 3CJRB 2XAJA 3S14J 2DCEA 3H36A 5D4SA 3UKGA 1LDDA 1K4TA 1MBFA 2VQGA 2OV7A 3B73A 1BOBA 3GTJJ 2YX7A 2R7UA 1XSXA 2K7LA 2FBKA 4ZJZA 3D1NI 5GP9A 3OYEA 1MKMA 1MBJA 4AYBA 1D8JA 2HWVA 4BS9A 1BJAA 2FX0A 3S1QJ 1QZZA 4ESFA 3J80K 1X3WB 3KE2A 2KT0A 4Q48A 3GXOA 3RKXA 1XSVA 2BW3B 3P9CA 5F6FA 1RI7A 3LOCA 3CCLI 3M8EA 3CCVI 4A3JJ 1WI3A 5JVTA 3I55I 3HGGA 4XORA 3CQZJ 5L3BA 3BG5A 3V8LA 3GCMA 2ZNYA 2A5YB 2F5EA 4WCGA 1OQYA 2LFBA 3E1SA 4B3AA 1IW7F 3I9V2 1HC8A 1MBKA 3CCYA 4V2GA 3IWZA 3L00A 4U87A 5B1AH 3HTSB 4DW6A 1LE8B 1O3SA 5FD6A 3E6MA 3JREA 1HCRA 3ESWB 5F08A 2CQQA 4MNUA 5EEHA 5GAEJ 3K70C 1DP7P 4EJOA 3EPZA 1MDMB 1K6OA 2K5CA 3WTYC 2D45A 1B6AA 2EPFA 2OCCH 3GTQJ 3ZN1A 2W25A 1SC7A 1MD0A 5M5WJ 1KYWA 1MNMC 2JVHA 3ZN0A 2GLOA 1R4NB 1RETA 2AO9A 3W2WA 3ZMZA 3ZQLA 2R7QA 1FYMA 4A3GJ 1J7KA 3I0TA 4NNJA 2GXBA 2HGCA 3Q0VA 5E3NA 3VYUB 2JUCA 4PJMA 1DDNA 2YSRA 3J7AY 1QHGA 5TISC 4XRSA 1ORKA 2HYFA 1W5CC 1O7LA 2DOFA 1JE8A 3QAHA 3WHCA 4BJTA 2PLYA 4GGGA 4CH7A 4ITVA 2XVCA 4OMZA 3K4MA 1P9QC 4YIFA 3HM5A 3JRAA 4F3QA 2JMWA 4D5CA 4LFUA 5FKLA 3JRDA 3A01B 1FLIA 3GUDA 4KIBA 4ZYGA 2EFNA 3W2AA 3HOYJ 5DD8A 2DJIA 4A93J 1OYYA 1U9OA 5KCMA 3FXMA 4A12A 3ML6A 4DZPA 2XAFA 1XGOA 3LL7A 1OFCX 3G2BA 5AIQA 5AIPA 4QIWN 4KFCA 2HKOA 2F5DA 2XGDA 1LJ9A 2CU7A 2HTJA 2VJIA 1NK3P 1N75A 2IBDA 3W6KB 2VPRA 2R7RA 4E7JA 1QVUA 3CP8A 5E8IA 4XR6A 2X48A 2HR3A 3F8CA 3KFWX 3FXQA 4UB8C 3QU6A 4IHVA 3TW7A 3EUAA 3F0CA 4C2UA 2RKHA 4EGZA 3MN2A 1FX7A 1IN6A 1MSEC 1SD5A 4OINF 3MKZA 4I76A 4ZDOA 2NOJB 3O6BB 3BWGA 3MD2A 1A31A 4XLPF 2IA0A 1OCTC 3DEEA 1PUFA 3KP7A 1KONA 3F8BA 3CO6C 3MZYA 4CCMA 4KITB 3W6VA 1DU6A 4UVBA 2XROA 3O8GA 2J5PA 2F4IA 3WGHA 4P9UA 2L9SA 2OQGA 2EFWA 1MSFC 2PJRA 1FTTA 5CQEA 2VJ4A 2AQFA 2FJ1A 5D6EA 1WJBA 4AIKA 3V4GA 4PUSA 2RV8A 2QVOA 3I64A 1QHHD 4XKVA 2LKSA 4M6YA 5CVUA 4HDVA 1FC3A 2WY7Q 3I4PA 4IRIA 2MA3A 1OISA 3SFIA 2VOOA 3ZXSA 1NG6A 3E7LA 1TP4A 4Y13A 4Q5SF 2KIFA 3LA7A 2PMHA 1VQKI 3K4LA 4M71A 1BI2A 3E97A 1FP1D 4XK4A 4BQQA 1ZARA 1WI9A 2HU9A 5M3FJ 1Z7LA 1Z77A 2CGPA 2R7ZJ 3JW4A 1OCZH 1U2WA 4ZH4F 3M1EA 1B59A 2LP0A 4E7SA 1P92A 5IOYA 2QM3A 3K6GA 1HDDC 1XGNA 3D5RC 4XSXF 2M8GX 3HDDA 1JKQC 3Q0UA 3E0JB 5K5QA 4YFXF 3CCRI 4W1UA 4I6ZA 3IP4B 2MW8A 3BC8A 2QA4I 1IXCA 3GZ6A 3ZP5A 4IJAA 4XMYA 1XDUA 2JPBA 3S3NA 4PSXA 1Z7UA 5H6QA 3HL2A 4QPQA 5HODA 3F8FA 4IHSA 1T08B 5FFXA 4PJ0C 1FYLA 5FKMA 3KP5A 1TQPA 3M9AA 2VN2A 4M9ZA 4G7HF 3CP2A 3KEYA 3S1RJ 2FQ3A 2R0QC 1ZAOA 2X1DA 4E70A 4I0AA 2OTLI 4L0YB 2RC4A 2VBXA 1UB9A 2E7WA 4L9VA 5AONA 1T95A 5K7ZA 2LYCA 4DBQA 2ZMEC 1WJCA 1AHDP 2ETHA 2WADA 3TP3A 1YS6A 3TGNA 2F48A 2WC2A 3S3MA 4M3DA 4KICA 1H9GA 1FY7A 2QYOA 2DXIA 2E5ZA 4BXFA 5F0FA 2X85A 3LMMA 4EVIA 1Y1WJ 2L7MP 4XLNF 1RKTA 1E3PA 4UUSB 4BE0A 4A3LJ 3KPHA 3BZ6A 4XOPA 3CTAA 1QRYA 1IAWA 4MEXF 2BVMA 4II2A 4MGRA 3W2VA 5K1YA 2CO5A 5DCMB 4F91B 4HV6A 1UAAA 2K3PA 1IUFA 4KYWA 1A6IA 2EILH 1YRNA 2LF8A 4XOTA 5ILVA 2EA4A 4CSWA 3F22A 2Y2ZA 1V3FA 1IUYA 2BVLA 1FJLA 4W97A 2BBYA 5K7FA 2KMUA 3I56I 3FXOA 3DEUA 2YU9J 3E5QA 1HKTA 1MJAA 4PZJA 2M87A 1OLTA 2VKDA 1CF7A 4AVPA 2HZTA 2QQ8A 2STWA 3E5XA 1DPUA 3BZKA 3B02A 1XGMA 4AWXB 4F55A 9ANTA 1WVRA 2ISYA 3BR5A 5LBQA 1QPMA 3IUOA 3MEXA 3DEWA 2XIGA 3OYCA 2LTPA 4A0XA 3S2HJ 4V19K 2KRCA 3HOXJ 4M74A 4PCQA 2IGKA 2QKMB 5LD2C 3RQ4A 2G7HA 5FO5A 1D1CA 1SMYF 4KUMA 4M72A 5EEGA 2LD5A 1X1AA 2OZUA 3WGGA 1FEXA 4A5MA 5IYCJ 1OCCH 4D1QA 3NEUA 2DA5A 2BOLA 3A03A 3FKJA 1Y1VJ 1GT0C 4HPQA 1N78A 4OAYA 1S6LA 1USTA 1J75A 1S9HA 4H0EA 2H8RA 1REPC 1UCRA 3ELKA 3TOAA 4DZJA 3T8RA 4AC0A 1HLVA 1T8IA 4R8HA 3WU0A 2XPUA 2K27A 2DK8A 6PAXA 1TW2A 4PGHA 1YFHA 4B09A 1FZPB 2STTA 2XF7A 4H4KC 5LLQA 3OL4A 2JA5J 2DFHA 4NC8A 2XGEA 1XS9A 5FD5A 4AIJA 3LQQA 4BEHB 4BY1J 1WJFA 5FRMA 4AUXA 4E7ZA 1S7OA 3H1CA 3DTEA 3PO3J 4FHTA 2YX4A 4LITA 3CUQB 2M9HA 1WGXA 2FSWA 1XD7A 3CCMI 1J59A 3OMYA 5JI6A 2XGXA 2LF7A 3RPUA 4JBAA 3F9KA 3ECOA 3AG2H 1OMIA 3OSGA 2VL8A 4XRFA 1B72B 1BN5A 3IH3A 2HI3A 3RKWA 2I5UA 4GXOA 3A2KA 1JKOC 2AQEA 2IA2A 3OYHA 1YX3A 3P7NA 3JSPA 2V9KA 2EB7A 1LUJB 2A5WA 2JUGA 2O0YA 2XRNA 2LOOA 3ERED 1ZLJA 1QZEA 1XCVA 2KZGA 1QZYA 2LLKA 2QSGX 2F4OB 4JK1X 3BR1A 2EJRA 3H9GA 4WXHA 1B9MA 3OIOA 3R0JA 1JTYA 1WWXA 1G4DA 5EZHA 5IOZA 2LK2A 4MO7A 2EIKH 2HPIA 3BQYA 4OWRB 1VQ4I 4U7DA 3FWEA 3LA3A 2HZDA 2FNAA 5B5EC 5LGTA 1O3TA 3QYFA 3QPTA 3TBIA 3OIPA 1ZELA 3H9JA 1I50J 4BY7J 2IAIA 3Q0WA 5HDGA 4M9SA 3CMAI 1VQOI 1IJWC 1SVMA 2HYJA 3ABUA 1OR7A 1Z1DA 5EDNA 4KMUX 3I71A 2DTZA 1V54H 2OBPA 2AHQA 4F7ZA 3K7AJ 2VODA 2RQQA 3QYBA 1FMVA 2Q2EA 4E7HA 1U5TA 4MQ9F 5DM7F 2PMZN 4UHTA 2K9NA 2XDVA 5CVVA 3JTGA 5D8LB 3GMEA 2B9SA 1LQ1A 2R4GA 3BTJA 4BBSJ 4Q4ZF 2R7FA 1LKXA 2X0LA 2W1OA 1O4XA 1W7PD 3HHGA 4B1RA 2BYVE 2NAZA 3U1DA 1EF4A 1GV5A 3M8JA 1JTXA 1ON2A 3QYEA 1ITYA 2ZXJA 1H9TA 1GUUA 1ZRDA 3SYTA 4L0ZB 4XLAA 3CD6I 1U78A 2VLAA 5ICEA 2PMZA 3FXJA 4JOMA 1MMAA 4ASNA 3BJOA 2DFEA 3KIOA 2Y69H 1Y39A 2RQPA 1USSA 5HS7A 1SVLA 3AAFA 4QLCU 4IVNA 1U8BA 3ZMDA 2DW4A 2DOAA 3L2VA 4YRVA 3FBIB 4C3HJ 3SZGA 2DA4A 2N8GA 2P5KA 4ZDPA 2LMDA 5BS6A 4ZZLA 2OUMA 2BY2A 2E36A 5IPAA 4QTRA 1EV7A 3GTKJ 2E1MB 4WF2A 4HNTA 2E5NA 4ZYEA 4HA8A 1B8IB 3GFMA 2JA2A 4XLCA 5IYBJ 2X1CA 2JSCA 1MMGA 5DDGA 3OYAA 1BJZA 4EM2A 1RC9A 1IGNA 3RQIA 1E3HA 2Z33A 2PX9A 4DYCA 2IGMA 3GBGA 4FETA 5F1JA 2ZO4A 2M34A 2FQ4A 3ZQGA 3QQAA 3H92A 3HKZN 3OYGA 3AL0B 2LVSA 1R7JA 4RA2A 4X1EA 2QSFX 1DP3A 2ZNZA 4N4NB 5J4YA 3ZCOA 3OR2C 1TNTA 3I4NJ 3S1NJ 1BI3A 3KYDB 2V1NA 3M4OJ 4KT6A 3I54A 1M1EB 4GYIA 4IXAA 3TL4X 1FOYA 3CC2I 3K1MA 4QWQA 2DMNA 4KMFA 3F3XA 5J6XA 2NNYA 2KL4A 2DA2A 2F4MB 4UUTA 2R7WA 5FLXK 1YQAA 2ZB9A 3ABMH 4RLFA 2YUSA 2NYXA 4KN4X 2LREA 3HKZA 1ZR2A 4NBQA 3GTMJ 4HBLA 3DV8A 3GWZA 4A2UA 3CUOA 1TC3C 3FHZA 4IQJA 2EBIA 2DFFA 1AKHA 4IHTA 1G6NA 4EM0B 2TCTA 3M1CA 2A68F 4A3FJ 1UJ8A 3DPLC 3RYPA 1VQPI 1FNNA 2XB0X 2GIZA 5HS8A 3KYCB 4RS8A 1HA8A 4L9JA 3NWTA 3K10A 2C6YA 1VFCA 2COBA 3CCSI 2Q1ZB 5A2QZ 1FPQA 3DBHB 3CDHA 3SEQA 4WXCA 1W5SA 1SFEA 2FBHA 4BU2A 1YIJI 5EGOA 1LPQA 1G59A 1TZLA 2GWRA 2COMA 5E3LA 5E79C 3PQJA 4PFOA 4JP0A 3FZVA 2Z3YA 2IEKA 3LSGA 3RKQA 1CF7B 1RIOH 1B4AA 3WHBA 2B63J 3BG3A 3OY9A 2QQBA 4CXFA 4Y33A 1A6QA 2VE8A 1TT5B 3DP7A 2CQNA 1Z6TA 2GXGA 4HQEA 4II3A 1PP8F 3NRVA 4BQNA 4O5VA 1EKEA 2OAZA 3DLAA 3FK6A 2JA6J 4I0BA 3L2UA 4JYKA 5JFRA 3HRMA 4JQFA 3HGYA 1HSJA 1RESA 2CQ7A 2LSOA 3ERMA 3V7CA 3RYRA 1X1CA 3IRRA 1FMWA 2W7NA 1FOXA 2KIQA 2M4KA 3BLYA 2QBYA 4YFNF 2KZVA 4UVCA 1MNEA 2LNBA 2NOGA 3CO7C 1K78A 4LG0B 2JA7J 1ZN2A 3Q3SA 5HVQC 3IH4A 2VXDA 4LK1F 1ETXA 2LG4A 4IHYA 1X19A 4LK0F 1OR7C 2VKVA 1RR7A 4BE1A 2E2HJ 4MIMA 5ILSA 5H2FC 1FSHA 1U5TC 4OMYA 1JUMA 1ETKA 2EQRA 1SD7A 2DDAA 3TO7A 2K4JA 2DODA 1IRFA 3RCOA 1LFUP 2BZTA 1QPIA 3FMQA 2P7VB 4WK8F 1ZHFA 2FRHA 2ZBKA 2A69F 2BGCA 3DKYA 1PP7U 3QOEA 4XONA 5GTHC 3SZPA 3LFUA 3PUBA 4J01A 1T38A 4BNCA 1JJ8C 4K2EA 3IH2A 3JRHA 2ZMEA 2PI0A 4KNYA 3EUHC 1K6YA 3DFGA 1WFXA 4YFKF 1I6HJ 1Z05A 2UXNA 5L3DA 1KZHA 4J00A 2L2OA 2KJCA 4D7NA 2Q0OA 5ERIA 3DWLE 5IP7J 5K5RA 2OCEA 2B7EA 2LR8A 2ESNA 3J80Z 1Z91A 2M4GA 1ONVA 3R4KA 4DOZA 2L4AA 2GZWA 1OJLA 5DCFA 2HQRA 5GADJ 2LH9A 5DS9A 2LY9A 1PDNC 3J81Z 3ZGKA 1P4WA 1E17A 4KISA 2VIXA 5J1UA 2W24A 1WJAA 1K4SA 2CWEA 3GZNB 4LD5A 5CKTA 3PFYA 2X1EA 4LLLA 4FASD 1RRJA 2JSPA 1BOAA 2HKXA 3CF2A 3R61A 4FTHA 4HEA2 2CRGA 2XV4S 3BJAA 3JRGA 2HS5A 4ESJA 1FP2A 4HLXA 2VOPA 5DD4A 2Y9ZA 2QLZA 3HPGA 5KAIC 3W6JB 2JZYA 4WWCA 4CYDA 4YIRX 1TT0A 1MBHA 2MGQA 4L5JA 4GDFA 1ZH5A 1YHQI 1TWGJ 2BE5F 5LGNA 3WU2C 5BMZA 2Z9OA 1BIBA 2CH0A 2H1KA 2HXIA 1IN5A 4G8XA 4EJVA 3DPTA 1HKSA 1KU2A 4GRIA 4JX5A 3H3UA 1MIJA 4D5FA 3BROA 4UXNA 3Q9VA 2HDCA 3NWSA 2E34A 2VJ5A 1YJNI 1UMQA 2DQRA 2R5ZB 5TJJA 2PEXA 5EEAA 1S29A 3OL3A 1U9NA 5LEKA 3WTSC 1IN7A 4RB3C 1VZ0A 3DKWA 5DV5A 2AS5F 2DN0A 2WAFA 1DUXC 4HX7A 3C2BA 2HQAA 1MW7A 3BTIA 1DPRA 2DTRA 2CV2A 2NS0A 4M6VA 2R7XA 5D6FA 5HOOA 5D5VB 1S72I 4XQFA 2DU9A 3GTGJ 3CCUI 5IYDJ 1K83J 3MZHA 3OOUA 5FGMA 3PL8A 1UELB 4LLGF 2HVQA 4MEYF 4HF1A 2DDBA 4G9YA 2PG4A 3ZMTA 3DXJF 2Y9YA 4OIPF 2M3AA 3M07A 5LRSA 5FLVA 3OYFA 1ZGWA 3LAPA 4KT5C 2FOKA 3FMRA 2ZFWA 3UNGC 4RGSA 1TLHB 4Y3OA 3VOEA 4O3MA 2DMQA 3E6BA 3N05A 4RLQA 4XKCA 4Y15A 3LSMA 3H9QA 4U7BA 2H09A 5IT9K 3RIRA 2JT1A 2NVXJ 1SFOJ 2Z99A 1KQ8A 4I99C 3NAUA 4A3CJ 3WGIA 2QF7A 3T5XA 1AWCA 3JCUC 4EMSA 1X1BA 1G3WA 4UV9A 2OJED 4OIRF 1V5GA 3RI4A 2LY2A 2CG4A 4RGUA 3MFKA 4P55A 2FF4A 4NUBA 4PJJA 4J19A 2F2EA 5IP6A 3Q5FA 5F0HA 4XN3A 4A69C 3PSFA 2JK3A 4KIFA 2MSYA 4N9IA 5GAGJ 2K86A 1XPXA 1F43A 2X6OA 1Z6RA 1N25A 1T98A 1FIPA 5CVJA 4RBOA 3A0HC 1JKRC 1VQ5I 3ZQCA 2CUJA 2AXTC 3VWBA 1H89C 1POGA 2NXNB 3PNYA 4AVZA 4HNUA 1WCMJ 3FM5A 2CUEA 1RNLA 2HOEA 1ZG5A 4XLFA 1H88C 3IC7A 2NVQJ 2P0WA 1DQUA 3I5UA 4BBRJ 2DJNA 2EWNA 1X58A 4NQWA 3ZMUA 3IV5A 4M9XA 3OOPA 4R1HA 4UB6C 1XC5A 3ONQA 3F8NA 1Y56A 3P5JA 5J40A 2VC1A 1XDSA 1YTYA 1XCBA 1T0FA 1AOYA 2JN6A 4HX4A 5TRDA 4Z2YA 3EQLF 1I3AA 2B0LA 1P4XA 4CYCB 3MCZA 1ZK8A 1D5YA 3T1BA 4U88A 5EZGA 2HXOA 2GOXB 1W7PA 3PIOF 4NHJA 3FXKA 3LNQA 2ZSHB 3S2WA 1YW9A 2MBFA 3ZQHA 1YI2I 3LSHA 1FT9A 4XN0A 4BACA 1QBJA 3A0BC 2DT5A 4D7MA 5EGOB 4Y4RA 4S04A 1OCOH 1GLNA 1UZCA 3WTZA 3HOVJ 2J5OA 2RDPA 3PIPF 1Z21A 1X2NA 4BQOA 4HQMA 5HLTA 2VASA 3BR0A 2QQ9A 4G7ZF 3ZR8X 2L4MA 4WXDA 2A6EF 4ZTJA 2V26A 4A3KJ 3S17J 3I3LA 5JHFA 1ON1A 3SHFA 1OYWA 2XRLA 4S0HB 1ENHA 1Y0UA 1QVTA 5L3EA 3BZCA 2R7TA 1W1WE 2ZXWH 2NVYJ 2GM4A 1WRJA 2HYGD 3HTUA 1D0YA 3HUGB 5DUKA 4F52A 3WTWC 3KYLA 3PNTA 4OAZA 1KQ0A 3REOA 4RB1A 3FXRA 3CMEI 2PN6A 3OYDA 1G2HA 5KVRA 2PFBA 3BTLA 1UHMA 4UNOA 3IAS2 3S15J 2L0KA 3BG9A 3RKYA 1B9NA 3U9GA 2OU2A 3DU6A 1XX5A 2QBYB 4I7HA 4IRHA 4N9HA 3JSOA 4E7LA 3ZQ7A 2NS7A 2CW7A 2DBBA 3DQVC 5FB2A 3BG7A 4O6JA 5BPIA 2VE9A 1UG2A 1N77A 2V6EA 1QU3A 2E35A 2BY1A 2P8TA 3HSRA 3HG9A 5TGTA 1VQ7I 1V5EA 3GYHX 2G9WA 3Q9SA 5FLMJ 1R49A 3F72A 4A6EA 1EJ9A 1FOKA 1JJ6C 2DA7A 1HW2A 3N97A 3QPHA 1F1ZA 1BIAA 3JAMZ 3KCCA 3L7WA 4BHBA 2K40A 1YJ9I 3VFZA 4N4OB 2ACJA 1R1UA 1JUSA 3F6OA 5L3FA 1A36A 5LRRA 2ZMEB 4XNFA 2MD0A 2NNNA 2QGUA 3HZJA 2DYSH 4HOBA 2V7FA 4XSZF 2EZKA 1DGRM 1E3OC 2EFQA 3I59A 1IDZA 3DCFA 2VQHA 3TMOA 3G4SI 2MD5A 1ETWA 2CUFA 3PUFA 4M3BA 1IV8A 3CCQI 1R5ID 1HBXG 2X51A 5FROA 5C4XJ 2ADUA 3V8KA 1R1TA 2XUBA 2L9RA 3CZ6A 4FE7A 4LIVA 1VQNI 4ANJA 2D5VA 1UHSA 2QEXI 1T33A 4IOCF 3N4MA 1BBYA 4A3IJ 3TEDA 2CFXA 4HF0A 1T56A 3BR6A 1I5ZA 3QP5A 4ENJA 5M3MJ 3L09A 2YPRA 4XLEA 1YO5C 2Y48A 3CLOA 1BC7C 1I6XA 4ESBA 2F5VA 1U6GA 3FXUA 3RPQA 2R5YA 4KDPA 1T2KA 1XGSA 1HW1A 5J3LA 2KHMA 3FF5A 3K4CA 2BHYA 4TV7A 2BW3A 2QQAA 2W84A 1VNDA 1LDKB 1R4MB 2QZ8A 2KIUA 2IXSA 4JX4A 2E2IJ 3GFIA 4V2FA 3S93A 3U2RA 3O3KA 1ZREA 3HHHA 3A4CA 1BI1A 3K4NA 4FT8A 1RKWA 2ECBA 4I01A 1FOWA 5CYVA 3BJ6A 4MFEA 4MQVA 1J5YA 4Y17A 3VYSB 2UXXA 1WJEA 3A1YA 1E2XA 2IS2A 5KNLA 3F6VA 4A3EJ 2JPCA 2P6TA 4N0BA 3S32A 4ZZDA 1A5JA 3SXYA 4XKBA 4IOAF 2VT2A 1T39A 1WHUA 3GO5A 1ODDA 1CGPA 1O7FA 1IN4A 4B8XA 2XHKA 2PQ8A 2KDOA 4UV8A 1VQ9I 2DAOA 1IF1A 3ZMSA 3BPVA 4IL6C 2KJBA 2MH2A 4XICA 4M6XA 2EZHA 4U0YA 1FWZA 4KIGA 2RAEA 5C3EJ 2CQXA 4X6AJ 1W36D 5E17F 2VUMJ 2XF5A 3DU5A 5JR3A 1G3YA 1MNDA 1W36C 1T0FC 4UVAA 1PUFB 1F36A 5ED4A 2P81A 3J7ZI 2WV0A 5LEJA 4ZTFA 1R5GA 3EUHA 1W0UA 1U3EM 2PJRB 2FMYA 3HOZJ 2LC2A 1Y6IA 3P9KA 1JHFA 1YG2A 2ID6A 2K4BA 2H27A 4BUPA 5FKKA 2V6CA 1D0XA 4F92B 4UUVA 1JUPA 3FHNA 4FE4A 5FFZA 3V42A 2DOEA 2UUZA 2ISZA 1ACIA 3BOQA 2XKOA 1S7EA 2M5WA 3GFJA 3QPLA 3WTXC 2RNJA 3BPXA 1KU3A 1ULYA 3K69A 5D4RA 2ZCWA 2NVUB 4DBRA 4HV5A 3TO6A 3QRFF 2XSDC 3RJPA 1BR2A 4P5OA 4EJWA 2XSJC 1ETYA 3E3VA 1JKPC 4EV0A 2BV6A 3HYIA 2ZSIB 3HEFA 4BYYA 1ZRFA 2A3SA 1W0TA 3V8JA 2IGOA 1TNSA 3MWMA 3L2CA 3OV8A 1K61A 4OIOF 5HNHA 3GZ5A 2IPQX 4PDKA 1A04A 4RM2A 3HOWJ 5E18F 3CCEI 2KFDA 1GVJA 3MZ8A 4M3FA 3F23A 4CCKA 2X6WA 5E3OA 1MMDA 4CCOA 4GO1A 1ERDA 3NARA 1EA3A 1NH3A 3JRIA 1WQ2A 2W85A 3FDYA 5D5UB 2FBIA 1ETVA 3SQNA 4RAYA 3OS0A 4YIIA 1DU0A 3MKYB 1XMAA 1UFMA 4I98B 1YE9A 3KP3A 1Z3YA 1G3SA 2D1HA 4ZYDA 2V79A 3IKTA 3JR9A 1TQMA 2ESHA 2LDUA 4B43A 3H3ZA 4B47A 2ZJQF 2DK5A 4IX7A 2K9LA 2JQ7A 4CZZA 3DTKA 1YOVB 5CJ9A 3CC4I 3H5NA 2FA5A 1NHAA 3AG4H 3CJNA 2K3FA 3QWLA 1RR8C 2M0CA 4XL9A 4CHUA 3DBLB 1LDJA 3T0YA 3KETA 3BR3A 4HSTA 2HOSA 1TL8A 3CDIA 1VTNC 3RTRA 3I58A 1SMTA 4U0VA 5CPRB 3OS2A 5LHGA 2D1VA 4AU7A 1QGPA 3J7YJ 1WKMA 3QU3A 2O8KA 2EZLA 2IJLA 3WU1B 3LSRA 2P6SA 5FLXZ 2RVCA 1MMNA 2ZXIA 3BG6A 2M30A 2E71A 2ECCA 3L2QA 1YRNB 2KPMA 5M5YJ 2H94A 3VDXA 2RREA 1F9NA 4B48A 4S05A 1P7IA 4ZC3A 3TOBA 1U8RA 3ZPLA 2EFOA 4XRSG 1Z9CA 2XAQA 4XIDA 1TW3A 3MAJA 1FIAA 3S2DJ 4LLNA 2W82A 2PBIA 2GA1A 2H6BA 2DI3A 2VONA 3RSNA 2GA2A 5GTIC 3OS1A 2RNGA 4HSRA 5FJ8J 1R1VA 1HW5A 1KYZA 2IT0A 1D1BA 4HNVA 1OYIA 4E7KA 2ID3A 3SJMA 2FMLA 4IZZA 2L7KA 2UZKA 4L18B 4IPAA 2VXZA 4G6DA 1OPCA 2V4JC 4FCYA 2M2EA 4CCJA 1BM9A 2XAUA 3AKZA 2L7ZA 5HNFA 2KISA 2WBMA 4UUSA 2EV5A 3K0LA 1GHCA 2DO7A 2CFOA 1R9TJ 2Z16A 2EV0A 2EA2A 1S3JA 5DCMA 2L9VA 2D2WA 3CMYA 1APLC 1E0EA 5HS9A 5DM6F 1ZG1A 5JLWA 5H20A 4P9FA 2GIVA 2DFIA 1XN7A 2RN7A 1PYVA 1KU9A 4NC7A 3MVPA 5BNGA 4BJ6C 1F5TA 1GXPA 2HNHA 3SFZA 4LIUA 5IY5H 2PJPA 2ZKZA 5B1BH 2O6GE 2DPDA 2ELKA 1SD6A 2PMUA 4RMNA 4C30A 3SZTA 3ZOBA 3GF2A 4XRMA 2HFHA 5J8FA 5EF6A 3IL2A 2HDDA 3CLQA 1DGWY 4HG2A 4L9TA 2JRTA 1GDTA 4C3JJ 1HKQA 2E19A 1BL0A 1X2MA 2KLOA 2Z1DA 4GYGA 1R22A 2VB6A 4CCLA 3KLOA 3L2WA 2OC6A 3DLLF 1EH7A 1S7AA 2WAQN 4ETSA 3WODF 3HRUA 2Y0SN 3QOPA 4C2MJ 2OQRA 2WB1N 1S5LC 2ZXHA 2R5YB 1RUNA 1FYKA 2V1XA 3R6SA 3L2RA 1WJDA 3IHUA 2R3SA 2R7VA 3TP0A 1C0WA 2E7XA 3VB2A 3GTOJ 3J81K 3KZYA 4LMYA 1KGSA 1LNWA 1ZKGA 4G6TB 3ZRGA 3LSPA 4IHWA 2MH9A 3WG7H 3H3VK 2DYRH 1IRXA 2JRMA 5C44J 4AIDA 4MFDA 3WG9A 1SANA 2O5RA 4P1WA 5GPAA 1NK2P 4EGYA 2A07F 1P2FA 3FISA 3PNVA 4B4CA 4HZFA 2UWMA 2IVMA 2WAQA 4PJNA 2ME0A 3BP8A 3PSIA 4DGWB 2GQQA 2Y0SA 3K4KA 2LKPA 2VI6A 2WB1A 1X4OA 4M3GA 2O8XA 4RGXA 2O03A 2NRAC 2V1DA 5LHIA 3FIWA 3K70D 2OPTA 2VBWA 1IO2A 3OYNA 2VQCA 4RAGA 4ZYAA 3AG3H 1F4KA 4CA0A 2CYYA 4LB5A 3JRCA 5E1ZB 3A02A 4PK4A 2IS6A 2P5VA 4BEHA 3HC7A 2MG4A 2LY1A 3ZQQA 2NS8A 4EATA 3K4JA 3CUQA 2Q2EB 5JHUA 1U5TB 4G6QA 1ZTRA 3IWFA 1PJRA 2KIMA 4RAZA 5B66C 3LSIA 4CGZA 3PO2J 1P6RA 1JHHA 2ICWG 1QO0D 1LEBA 1B72A 1BR1A 3TDZC 1MH4A 1Q1HA 1XSDA 1D0ZA 3UR3C 1T6SA 4C3IJ 1QA6A 1R23A 4A6DA 2F5CA 4ZDLA 2WA0A 2W48A 2E1NA 4X0GA 3GEZA 4ABZA 4AM3A 3HPHA 2OF7A 1YITI 4Q47A 2DLLA 2DMPA 2F5FA 5HDNA 1MJBA 4YEJA 1I27A 2GBYA 4B3XA 4CUGA 4E6KG 5JLXA 4HLYA 3ABKH 3ASNH 5EG0A 1PVEA 5ICFA 2I10A 1ZGAA 3FBNB 2YS9A 4LOCA 5IP9J 4Z6YA 3E5UA 4I2OA 5LGUA 4IKFA 4JX6A 5J4VA 2K9MA 1D5VA 5J1YA 4PGGA 1WH7A 1G8XA 3KEQA 1IC8A 2EIJH 3E6CC 5LFAA 4Y7NJ 2MLKA 3OYMA 2QSHX 4NDLA 5DEQA 2FOWA 1X3ZB 3FXLA 4Y52J 2E60A 2XF6A 2IRFG 3C7JA 2R7SA 1Q1VA 3GW2A 3G71I 5ICGA 1B1BA 3MKLA 4FX4A 3JRFA 3S16J 1LVKA 4RGRA 1MGTA 2E2JJ 1YIOA 1IXRC 4GFBA 2G0EA 2A05A 4PSWA 2HTSA 2LBFA 1Y8RB 1SFKA 3D0SA 1ETQA 1YLFA 5IT9Z 4QPOA 1BW6A 2IGNA 2EFPA 2WV1A 1XG1A 2EZIA 2LKXA 2EK5A 3RDIA 3ROUA 3LSJA 4PFPA 1K79A 4LJZF 1GV2A 4BL0B 4WX9A 1J09A 4A0ZA 2MC3A 3LSTA 1XMXA 3HJEA 1ZYRF 5F1RA 5K5OA 2IW5A 1Z0XA 1NG7A 4HRIA 3KP4A 3HSFA 1L0OC 4OOIA 3OYIA 1SFUA 2R7OA 4DYQA 1AKHB 4FISA 3PJRA 1B8IA 3VYRB 3I53A 2OD5A 1BW5A 5LHHA 2H8WA 3MQ0A 1IV6A 3K4BA 2EIMH 3HOUJ 3WTTC 3DTIA 4I02A 3ZQFA 2VBYA 1IRZA 2IP2A 2JJ7A 4L5IA 3H0DA 5E1WA 3L1PA 1HDPA 4A3BJ 2VJJA 4EEFG 4CZCA 2YU3A 2XPVA 2V9VA 2M0MA 1BI0A 1OKRA 2QUFA 2XC7A 1FBQA 1R36A 3G1OA 3OR1C 1A35A 1AA7A 3JTHA 4CICA 2M1BA 3F8MA 2A6HF 5F04A 4HAMA 1TBXA 2VKEA 2L3DA 1D8KA 3G6EI 1VI0A 4G7OF 3KP6A 4DNCA 3HOTA 5BOXA 3T8TA 4L5EA 1LVAA 3KX2A 3LA2A 4XBFA 5J47A 1HXDA 5C4JJ 3E6DA 3OYJA 2EINH 2K85A 2JWTA 2Z5UA 3X2QH 3BCBA 2O3FA 3IAM2 4KN7X 5M5XJ 4E4HA 1IXSB 3G3ZA 3BDDA 2P5LC 1JXSA
chains in the Genus database with same CATH topology
3HOYJ 4JP0A 4A93J 2IEKA 3LSGA 1U9OA 3RKQA 1I3QJ 3WHBA 2B63J 3BG3A 4DZPA 1JT6A 1OFCX 4QIWN 1PUFB 1F36A 2XGDA 1WPKA 3RZOJ 2CU7A 2P81A 1NK3P 2IBDA 2VPRA 1QVUA 1W0UA 3HOZJ 2X48A 2L7FP 3FK6A 2JA6J 2ID6A 4IHVA 1VF9A 2K9SA 3TW7A 4JYKA 5FKKA 3F0CA 3MN2A 1JUPA 4FE4A 2NVTJ 3HGYA 1MSEC 1S7EA 3QPLA 1RESA 3FK7A 4I76A 4G12A 2XSDC 2X9DA 1OCTC 1PUFA 5EYRA 1ETYA 2NOGA 1JKPC 2JA7J 3HEFA 3Q3SA 3W6VA 3IH4A 1DU6A 1HF0A 3O8GA 1ETXA 1W0TA 4IHYA 1MSFC 1FTTA 1K61A 3H0GJ 2VKVA 1RR7A 2E2HJ 3OSFA 4MIMA 2FJ1A 1JUMA 1ETKA 3HOWJ 2EQRA 4M3FA 4QSHA 3TW6A 1LFUP 1QPIA 5E3OA 3SFIA 2XPWA 2DMTA 3CDLA 3E7LA 3HB9A 2TRTA 3NARA 3JRIA 1JJ8C 1ETVA 3IH2A 3JRHA 4IEJA 4XK4A 1DU0A 1I6HJ 4D7NA 5M3FJ 2Y31A 5IP7J 1Z77A 4M3EA 2R7ZJ 1WH5A 2LR8A 3G1MA 2DA1A 3PM1A 3JR9A 3BQZA 3B6AA 1MH3A 2LP0A 3VPRA 2XGCA 5IOYA 3G1LA 1HDDC 1OJLA 5J1RA 2QCOA 3HDDA 2M8GX 2KDZA 5DS9A 2LY9A 3Q0UA 1JKQC 4W1UA 4I6ZA 2MW8A 5J1UA 3I4MJ 2M0CA 2O7OA 3BR3A 2HOSA 1P7JA 3RZDJ 5HODA 4FTHA 5FKMA 2CRGA 3S1RJ 3JRGA 1CQTA 3GTPJ 2R0QC 1LE8A 2Y9ZA 4DYRA 3BT9A 5FKNA 2O8KA 2DMUA 2EZLA 3LSRA 5K7ZA 1AU7A 1MBHA 2MGQA 1YRNB 1AHDP 2ECCA 3TP3A 2R92J 5M5YJ 1TWGJ 4RDUA 4BKXA 4M3DA 1P7IA 5F0FA 2H1KA 4XRSG 1Y1WJ 2HXIA 2L7MP 1RKTA 4XIDA 4JX5A 5EG0B 4UUSB 1FIAA 5DTDA 4D5FA 4A3LJ 3S2DJ 2ME6A 1QRYA 3FKIJ 2O9LA 1UMQA 2DA6A 2R5ZB 5EEAA 4A3DJ 1U9NA 5K7HA 1IUFA 1TWAJ 1A6IA 1IG7A 5FJ8J 1YRNA 1LFBA 4HNVA 5GPCA 1MBEA 2DN0A 2Y2ZA 2ID3A 3C2BA 3SJMA 3BTIA 1H8AC 1FTZA 1FJLA 4W97A 5K7FA 4M6VA 4FCYA 2M2EA 2YU9J 3A01A 3GTGJ 5IYDJ 1K83J 2L7ZA 3OOUA 1TWCJ 4UUSA 2FD5A 2Y9YA 1R9TJ 5FKOA 1GVDA 5FLVA 3CMYA 1JT0A 5F0CA 1ZGWA 1JGGA 1APLC 1ZQ3P 2R5ZA 9ANTA 5JLWA 3BR5A 3S1MJ 2Y30A 3DEWA 2LTPA 3MVPA 2DMQA 3S2HJ 5BNGA 2NVXJ 1SFOJ 3HOXJ 3NAUA 2ELKA 3BTCA 4A3CJ 3ZOBA 2QF7A 4XRMA 2LD5A 5EF6A 1FEXA 2HDDA 5IYCJ 1GDTA 4C3JJ 2DA5A 3A03A 2E19A 1Y1VJ 4J19A 1GT0C 1X2MA 5IP6A 1BL0A 1HOMA 5F0HA 4A69C 4IHXA 2WAQN 1ZR4A 3JRBA 3B6CA 2H8RA 2JK3A 2MSYA 2Y0SN 4DZJA 1F43A 2X6OA 4C2MJ 2WB1N 4AC0A 1HLVA 2R5YB 2XPUA 1FIPA 2HOTA 3TP0A 4RBOA 1JKRC 3GTOJ 3ZQCA 4IHWA 1ZKGA 3H3VK 3LSPA 2JA5J 1H89C 3K2AA 1POGA 2XGEA 1XS9A 1WCMJ 2CUEA 5C44J 5F27A 4BY1J 4MFDA 1SANA 1NK2P 5GPAA 4AUXA 1H88C 1ETOA 3FISA 2E1OA 4B4CA 2NVQJ 3PO3J 4BBRJ 2DJNA 2ME0A 1X58A 2M9HA 3IV5A 1WGXA 1XC5A 2VI6A 1NTCA 4M3GA 1MBGA 2XB5A 3FIWA 2OPTA 3OSGA 1B72B 2JN6A 3IH3A 2HI3A 1JKOC 4CYCB 3QPSA 1ZK8A 1D5YA 5EZGA 5E3MA 2HXOA 3JRCA 2HOAA 3A02A 3LNQA 2MG4A 3ZQHA 2LLKA 2NS8A 3BR1A 4D7MA 5EGOB 2R93J 3HOVJ 3M3YJ 1ZTRA 3GTLJ 1X2NA 3OIOA 1JTYA 3SDGA 5EZHA 3BR2A 3BR0A 4BXXJ 5IOZA 2LK2A 4MO7A 3PO2J 3BQYA 1B72A 4A3KJ 3S17J 1MH4A 2DA3A 4CYCA 2XRLA 1I50J 4BY7J 1IDYA 4S0HB 1ENHA 1QVTA 1OCPA 2IAIA 2K9QA 3Q0WA 4C3IJ 1IJWC 2NVYJ 2GM4A 1TWHJ 2HYJA 5EDNA 2W48A 2DTZA 2AHQA 4ABZA 3K7AJ 2OF7A 2PMZN 2K9NA 1G2HA 2DMPA 3BTLA 2HQ5A 3BTJA 4BBSJ 1BA5A 3S15J 2GBYA 2L0KA 3BG9A 5JLXA 3HBLA 1O4XA 4B1RA 5EG0A 3O8HA 3ZQIA 2I10A 1EF4A 2YS9A 2CJJA 4LOCA 2NS7A 5IP9J 1GV5A 1JTXA 1UG2A 4AYBN 4JX6A 4A3MJ 1ITYA 5J1YA 5FLMJ 1GUUA 1WH7A 1IC8A 1RPWA 1U78A 1TWFJ 1JJ6C 2DA7A 2EH3A 4Y7NJ 4MLOA 4NDLA 2JA8J 2K40A 4Y52J 3S14J 3UKGA 1U8BA 1JUSA 1MBFA 1Q1VA 3GTJJ 3MKLA 4C3HJ 2DA4A 3JRFA 2N8GA 3S16J 2E2JJ 3D1NI 5GP9A 4GFBA 1MBJA 5IPAA 4QTRA 2G0EA 3GTKJ 2EZKA 1E3OC 1IDZA 2FX0A 1B8IB 3DCFA 3S1QJ 5IYBJ 1ETQA 1ETWA 2KT0A 1BW6A 1BJZA 2CUFA 4M3BA 2WV1A 3LOCA 1IGNA 4A3JJ 1XG1A 3RQIA 1WI3A 2EZIA 2LKXA 4DYCA 3LSJA 3GBGA 5F1JA 1GV2A 3HGGA 2M34A 5C4XJ 3CQZJ 2FQ4A 3ZQGA 3BG5A 3QQAA 2L9RA 4FE7A 3HKZN 2D5VA 1UHSA 1T33A 2LVSA 4A3IJ 3TEDA 2LFBA 1T56A 3BR6A 4X1EA 1Z0XA 4B3AA 5M3MJ 1MBKA 3CCYA 4V2GA 4DYQA 3I4NJ 3S1NJ 1AKHB 4FISA 1B8IA 2R5YA 3M4OJ 4DW6A 5J3LA 1LE8B 1BW5A 2DMNA 1VNDA 3JREA 1HCRA 1IV6A 5F08A 2CQQA 4JX4A 3HOUJ 2DA2A 4UUTA 2E2IJ 4V2FA 3ZQFA 2ZB9A 2YUSA 1IRZA 2JJ7A 1ZR2A 3GTMJ 1RKWA 1HDPA 2ECBA 3L1PA 4EEFG 4A3BJ 2XPVA 4MFEA 3GTQJ 1TC3C 5M5WJ 2EBIA 1MNMC 1AKHA 2GLOA 3G1OA 4A3EJ 1RETA 2AO9A 3ZQLA 2TCTA 5F04A 4A3GJ 4A3FJ 3Q0VA 5E3NA 1A5JA 2XB0X 2VKEA 1VI0A 4L5EA 1VFCA 4XRSA 1ORKA 2COBA 5C4JJ 3WHCA 2JWTA 4XICA 3HM5A 2EZHA 3JRAA 5M5XJ 2JMWA 4D5CA 5FKLA 5EGOA 2RAEA 5C3EJ 2CQXA 3JRDA 3A01B 4X6AJ 5E3LA 2VUMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY J;  4JP0 A;  4A93 J;  2IEK A;  3LSG A;  1U9O A;  3RKQ A;  1I3Q J;  3WHB A;  2B63 J;  3BG3 A;  4DZP A;  1JT6 A;  1OFC X;  4QIW N;  1PUF B;  1F36 A;  2XGD A;  1WPK A;  3RZO J;  2CU7 A;  2P81 A;  1NK3 P;  2IBD A;  2VPR A;  1QVU A;  1W0U A;  3HOZ J;  2X48 A;  2L7F P;  3FK6 A;  2JA6 J;  2ID6 A;  4IHV A;  1VF9 A;  2K9S A;  3TW7 A;  4JYK A;  5FKK A;  3F0C A;  3MN2 A;  1JUP A;  4FE4 A;  2NVT J;  3HGY A;  1MSE C;  1S7E A;  3QPL A;  1RES A;  3FK7 A;  4I76 A;  4G12 A;  2XSD C;  2X9D A;  1OCT C;  1PUF A;  5EYR A;  1ETY A;  2NOG A;  1JKP C;  2JA7 J;  3HEF A;  3Q3S A;  3W6V A;  3IH4 A;  1DU6 A;  1HF0 A;  3O8G A;  1ETX A;  1W0T A;  4IHY A;  1MSF C;  1FTT A;  1K61 A;  3H0G J;  2VKV A;  1RR7 A;  2E2H J;  3OSF A;  4MIM A;  2FJ1 A;  1JUM A;  1ETK A;  3HOW J;  2EQR A;  4M3F A;  4QSH A;  3TW6 A;  1LFU P;  1QPI A;  5E3O A;  3SFI A;  2XPW A;  2DMT A;  3CDL A;  3E7L A;  3HB9 A;  2TRT A;  3NAR A;  3JRI A;  1JJ8 C;  1ETV A;  3IH2 A;  3JRH A;  4IEJ A;  4XK4 A;  1DU0 A;  1I6H J;  4D7N A;  5M3F J;  2Y31 A;  5IP7 J;  1Z77 A;  4M3E A;  2R7Z J;  1WH5 A;  2LR8 A;  3G1M A;  2DA1 A;  3PM1 A;  3JR9 A;  3BQZ A;  3B6A A;  1MH3 A;  2LP0 A;  3VPR A;  2XGC A;  5IOY A;  3G1L A;  1HDD C;  1OJL A;  5J1R A;  2QCO A;  3HDD A;  2M8G X;  2KDZ A;  5DS9 A;  2LY9 A;  3Q0U A;  1JKQ C;  4W1U A;  4I6Z A;  2MW8 A;  5J1U A;  3I4M J;  2M0C A;  2O7O A;  3BR3 A;  2HOS A;  1P7J A;  3RZD J;  5HOD A;  4FTH A;  5FKM A;  2CRG A;  3S1R J;  3JRG A;  1CQT A;  3GTP J;  2R0Q C;  1LE8 A;  2Y9Z A;  4DYR A;  3BT9 A;  5FKN A;  2O8K A;  2DMU A;  2EZL A;  3LSR A;  5K7Z A;  1AU7 A;  1MBH A;  2MGQ A;  1YRN B;  1AHD P;  2ECC A;  3TP3 A;  2R92 J;  5M5Y J;  1TWG J;  4RDU A;  4BKX A;  4M3D A;  1P7I A;  5F0F A;  2H1K A;  4XRS G;  1Y1W J;  2HXI A;  2L7M P;  1RKT A;  4XID A;  4JX5 A;  5EG0 B;  4UUS B;  1FIA A;  5DTD A;  4D5F A;  4A3L J;  3S2D J;  2ME6 A;  1QRY A;  3FKI J;  2O9L A;  1UMQ A;  2DA6 A;  2R5Z B;  5EEA A;  4A3D J;  1U9N A;  5K7H A;  1IUF A;  1TWA J;  1A6I A;  1IG7 A;  5FJ8 J;  1YRN A;  1LFB A;  4HNV A;  5GPC A;  1MBE A;  2DN0 A;  2Y2Z A;  2ID3 A;  3C2B A;  3SJM A;  3BTI A;  1H8A C;  1FTZ A;  1FJL A;  4W97 A;  5K7F A;  4M6V A;  4FCY A;  2M2E A;  2YU9 J;  3A01 A;  3GTG J;  5IYD J;  1K83 J;  2L7Z A;  3OOU A;  1TWC J;  4UUS A;  2FD5 A;  2Y9Y A;  1R9T J;  5FKO A;  1GVD A;  5FLV A;  3CMY A;  1JT0 A;  5F0C A;  1ZGW A;  1JGG A;  1APL C;  1ZQ3 P;  2R5Z A;  9ANT A;  5JLW A;  3BR5 A;  3S1M J;  2Y30 A;  3DEW A;  2LTP A;  3MVP A;  2DMQ A;  3S2H J;  5BNG A;  2NVX J;  1SFO J;  3HOX J;  3NAU A;  2ELK A;  3BTC A;  4A3C J;  3ZOB A;  2QF7 A;  4XRM A;  2LD5 A;  5EF6 A;  1FEX A;  2HDD A;  5IYC J;  1GDT A;  4C3J J;  2DA5 A;  3A03 A;  2E19 A;  1Y1V J;  4J19 A;  1GT0 C;  1X2M A;  5IP6 A;  1BL0 A;  1HOM A;  5F0H A;  4A69 C;  4IHX A;  2WAQ N;  1ZR4 A;  3JRB A;  3B6C A;  2H8R A;  2JK3 A;  2MSY A;  2Y0S N;  4DZJ A;  1F43 A;  2X6O A;  4C2M J;  2WB1 N;  4AC0 A;  1HLV A;  2R5Y B;  2XPU A;  1FIP A;  2HOT A;  3TP0 A;  4RBO A;  1JKR C;  3GTO J;  3ZQC A;  4IHW A;  1ZKG A;  3H3V K;  3LSP A;  2JA5 J;  1H89 C;  3K2A A;  1POG A;  2XGE A;  1XS9 A;  1WCM J;  2CUE A;  5C44 J;  5F27 A;  4BY1 J;  4MFD A;  1SAN A;  1NK2 P;  5GPA A;  4AUX A;  1H88 C;  1ETO A;  3FIS A;  2E1O A;  4B4C A;  2NVQ J;  3PO3 J;  4BBR J;  2DJN A;  2ME0 A;  1X58 A;  2M9H A;  3IV5 A;  1WGX A;  1XC5 A;  2VI6 A;  1NTC A;  4M3G A;  1MBG A;  2XB5 A;  3FIW A;  2OPT A;  3OSG A;  1B72 B;  2JN6 A;  3IH3 A;  2HI3 A;  1JKO C;  4CYC B;  3QPS A;  1ZK8 A;  1D5Y A;  5EZG A;  5E3M A;  2HXO A;  3JRC A;  2HOA A;  3A02 A;  3LNQ A;  2MG4 A;  3ZQH A;  2LLK A;  2NS8 A;  3BR1 A;  4D7M A;  5EGO B;  2R93 J;  3HOV J;  3M3Y J;  1ZTR A;  3GTL J;  1X2N A;  3OIO A;  1JTY A;  3SDG A;  5EZH A;  3BR2 A;  3BR0 A;  4BXX J;  5IOZ A;  2LK2 A;  4MO7 A;  3PO2 J;  3BQY A;  1B72 A;  4A3K J;  3S17 J;  1MH4 A;  2DA3 A;  4CYC A;  2XRL A;  1I50 J;  4BY7 J;  1IDY A;  4S0H B;  1ENH A;  1QVT A;  1OCP A;  2IAI A;  2K9Q A;  3Q0W A;  4C3I J;  1IJW C;  2NVY J;  2GM4 A;  1TWH J;  2HYJ A;  5EDN A;  2W48 A;  2DTZ A;  2AHQ A;  4ABZ A;  3K7A J;  2OF7 A;  2PMZ N;  2K9N A;  1G2H A;  2DMP A;  3BTL A;  2HQ5 A;  3BTJ A;  4BBS J;  1BA5 A;  3S15 J;  2GBY A;  2L0K A;  3BG9 A;  5JLX A;  3HBL A;  1O4X A;  4B1R A;  5EG0 A;  3O8H A;  3ZQI A;  2I10 A;  1EF4 A;  2YS9 A;  2CJJ A;  4LOC A;  2NS7 A;  5IP9 J;  1GV5 A;  1JTX A;  1UG2 A;  4AYB N;  4JX6 A;  4A3M J;  1ITY A;  5J1Y A;  5FLM J;  1GUU A;  1WH7 A;  1IC8 A;  1RPW A;  1U78 A;  1TWF J;  1JJ6 C;  2DA7 A;  2EH3 A;  4Y7N J;  4MLO A;  4NDL A;  2JA8 J;  2K40 A;  4Y52 J;  3S14 J;  3UKG A;  1U8B A;  1JUS A;  1MBF A;  1Q1V A;  3GTJ J;  3MKL A;  4C3H J;  2DA4 A;  3JRF A;  2N8G A;  3S16 J;  2E2J J;  3D1N I;  5GP9 A;  4GFB A;  1MBJ A;  5IPA A;  4QTR A;  2G0E A;  3GTK J;  2EZK A;  1E3O C;  1IDZ A;  2FX0 A;  1B8I B;  3DCF A;  3S1Q J;  5IYB J;  1ETQ A;  1ETW A;  2KT0 A;  1BW6 A;  1BJZ A;  2CUF A;  4M3B A;  2WV1 A;  3LOC A;  1IGN A;  4A3J J;  1XG1 A;  3RQI A;  1WI3 A;  2EZI A;  2LKX A;  4DYC A;  3LSJ A;  3GBG A;  5F1J A;  1GV2 A;  3HGG A;  2M34 A;  5C4X J;  3CQZ J;  2FQ4 A;  3ZQG A;  3BG5 A;  3QQA A;  2L9R A;  4FE7 A;  3HKZ N;  2D5V A;  1UHS A;  1T33 A;  2LVS A;  4A3I J;  3TED A;  2LFB A;  1T56 A;  3BR6 A;  4X1E A;  1Z0X A;  4B3A A;  5M3M J;  1MBK A;  3CCY A;  4V2G A;  4DYQ A;  3I4N J;  3S1N J;  1AKH B;  4FIS A;  1B8I A;  2R5Y A;  3M4O J;  4DW6 A;  5J3L A;  1LE8 B;  1BW5 A;  2DMN A;  1VND A;  3JRE A;  1HCR A;  1IV6 A;  5F08 A;  2CQQ A;  4JX4 A;  3HOU J;  2DA2 A;  4UUT A;  2E2I J;  4V2F A;  3ZQF A;  2ZB9 A;  2YUS A;  1IRZ A;  2JJ7 A;  1ZR2 A;  3GTM J;  1RKW A;  1HDP A;  2ECB A;  3L1P A;  4EEF G;  4A3B J;  2XPV A;  4MFE A;  3GTQ J;  1TC3 C;  5M5W J;  2EBI A;  1MNM C;  1AKH A;  2GLO A;  3G1O A;  4A3E J;  1RET A;  2AO9 A;  3ZQL A;  2TCT A;  5F04 A;  4A3G J;  4A3F J;  3Q0V A;  5E3N A;  1A5J A;  2XB0 X;  2VKE A;  1VI0 A;  4L5E A;  1VFC A;  4XRS A;  1ORK A;  2COB A;  5C4J J;  3WHC A;  2JWT A;  4XIC A;  3HM5 A;  2EZH A;  3JRA A;  5M5X J;  2JMW A;  4D5C A;  5FKL A;  5EGO A;  2RAE A;  5C3E J;  2CQX A;  3JRD A;  3A01 B;  4X6A J;  5E3L A;  2VUM J; 
#chains in the Genus database with same CATH topology
 2WTE A;  2Y0M A;  3GLX A;  3DF8 A;  2ELJ A;  1I3Q J;  3H5A A;  2ZC2 A;  5IT3 A;  2P4W A;  4BJ5 C;  1LEA A;  1JT6 A;  4FQG A;  3K1P A;  3RZO J;  1WPK A;  4XKW A;  3HOS A;  1K78 B;  1SD4 A;  1P4A A;  3BY6 A;  1UG0 A;  1Z67 A;  2O61 A;  4MHG A;  1ZLK A;  4R79 A;  1O57 A;  3FMS A;  4UY8 I;  2L7F P;  1D1A A;  1I1S A;  1VF9 A;  2K9S A;  4NB5 A;  3CUQ C;  4MTE A;  3JAM K;  3WE3 A;  4BQA A;  2L5Q A;  2H6C A;  3C18 A;  2NVT J;  2XKP A;  3K2Z A;  5FRN A;  2DPU A;  5ICC A;  3HRT A;  3FK7 A;  3LSK A;  3VYT B;  5JVG F;  5F64 A;  4G12 A;  3EYI A;  2X9D A;  3COA C;  4HYE A;  2FNP A;  4GCV A;  2F6C A;  5EYR A;  5D5W B;  2VBZ A;  3C2H A;  1VQM I;  1HF0 A;  4HF2 A;  4M73 A;  1TQI A;  2ZJ2 A;  2OZ6 A;  3H0G J;  4RAF A;  1EH8 A;  5DUI A;  3OSF A;  5B3S H;  4HX8 A;  5KHD A;  1WZ2 A;  1RUO A;  1X1P A;  2M7B A;  3EUK L;  3ULQ B;  1SFX A;  4QSH A;  1FBU A;  2WAE A;  3TW6 A;  4B44 A;  1W5T A;  3S3O A;  4HDU A;  2XPW A;  2DMT A;  1YW8 A;  3CDL A;  3HB9 A;  5HLG A;  2TDX A;  3V7R A;  2L02 A;  2TRT A;  2L01 A;  2M8E A;  2AXL A;  1ZRC A;  2OA4 A;  2CW8 A;  4IEJ A;  4LG0 A;  4DJA A;  1OCR H;  3OYL A;  2QEN A;  2Y31 A;  3ABT A;  1Y0N A;  3HSE A;  4M3E A;  1BC8 C;  1WH5 A;  3G1M A;  1IRG A;  2DA1 A;  3PM1 A;  2WY8 Q;  2Q8K A;  3BQZ A;  4RB0 A;  3B6A A;  5KAF C;  1MH3 A;  1IZ1 A;  1TTY A;  1YJW I;  3VPR A;  2DT6 A;  2XGC A;  3OIQ A;  3GX4 X;  1SVO A;  2KRH A;  3G1L A;  5J1R A;  2QCO A;  3VSK A;  2VC0 A;  3DBR B;  3WE2 A;  2MFZ A;  4BH9 A;  3OYB A;  2UV1 A;  2KDZ A;  3C2G A;  4IF4 A;  4BXU A;  1JI8 A;  1X4P A;  1R6R A;  1G3T A;  3I4M J;  2O7O A;  2HVS A;  1FBS A;  2RGV A;  2XAS A;  1P7J A;  2KP6 A;  3VEP A;  2W00 A;  3RZD J;  4PJL A;  2E1C A;  4EM1 A;  2V1U A;  1XMK A;  4HW0 A;  5ILU A;  4G94 A;  4KA4 A;  1CQT A;  3GTP J;  1FSE A;  1L3L A;  1LE8 A;  5CLS A;  3H35 A;  3OYK A;  5CQG A;  4DYR A;  3BT9 A;  4P96 A;  5FKN A;  3VSL A;  2DMU A;  2CS3 A;  4BHP A;  3K9T A;  1AU7 A;  4YG2 F;  2R92 J;  2WWY A;  4RDU A;  2K02 A;  1MDM A;  1K7A A;  5KK1 A;  4BKX A;  4ENN A;  2GXA A;  1I1G A;  3C1D A;  3J7A O;  5GAH J;  2E1M C;  2A61 A;  2HEO A;  3KEO A;  1LFP A;  2CSO A;  2IS1 A;  4AD9 A;  5DYM A;  1S8N A;  1WJ5 A;  5EG0 B;  3U21 A;  3QOD A;  3HIF A;  2KKO A;  5DTD A;  1EH6 A;  2ME6 A;  2V9P A;  3FKI J;  2JVG A;  3GFL A;  3AG1 H;  2QWW A;  2O9L A;  2GOM A;  3CCJ I;  2BHZ A;  4L9N A;  4E7I A;  2DA6 A;  3IKV A;  3KP2 A;  2HQN A;  1TWA J;  5K7H A;  4A3D J;  1W4M A;  1IG7 A;  1J2X A;  1KQ9 A;  3VOD A;  1LFB A;  3CJQ B;  1QQI A;  5BQT A;  3AL0 C;  5EJC A;  5GPC A;  1MBE A;  1VQ8 I;  3CF5 F;  3PFI A;  2ZJP F;  5HLH A;  1J0R A;  1H8A C;  1V5F A;  1FTZ A;  4RM3 A;  1U0J A;  4IRG A;  2R7D A;  3OWT A;  3DKX A;  5L3G A;  3A01 A;  3CMM A;  4EJT A;  2BEO A;  3W3C A;  4I09 A;  4ENK A;  1HST A;  1TWC J;  3ECH A;  5BPD A;  3TQN A;  3QP6 A;  1X3U A;  2FD5 A;  5D5X B;  2FXA A;  5FKO A;  2CV0 A;  1GVD A;  1R58 A;  1MZB A;  2HDW A;  2LRD A;  5E1X A;  5D8K B;  1JT0 A;  5F0C A;  4ON0 A;  2BY3 A;  1JGG A;  1ZQ3 P;  1QNT A;  3KLN A;  2R5Z A;  3LFK A;  2G7U A;  3S1M J;  2Y30 A;  1ZG3 A;  2FE3 A;  4OIQ F;  2LBF B;  3M8F A;  1D3Y A;  1MJ9 A;  4IQ4 A;  2XAH A;  3HRS A;  3F21 A;  4KJZ A;  4IO9 F;  3BTC A;  2OTJ I;  2Y75 A;  4NC6 A;  2VPL A;  3TO9 A;  3TKY A;  1KA8 A;  1SEU A;  2CUZ A;  2VT3 A;  3LQR A;  4U0W A;  4BE2 A;  1MMS A;  3K1N A;  2CV1 A;  1HOM A;  4BDZ A;  1V55 H;  2HVR A;  4ZYH A;  1O3R A;  3KZZ A;  3FX3 A;  4A5N A;  4IHX A;  4DQ2 A;  2ZJR F;  1ZR4 A;  3JRB A;  3B6C A;  2M7A A;  2YR2 A;  4C9Y A;  5H6R A;  2Z2S B;  4NQW B;  5L3C A;  3IRQ A;  3EYY A;  3V7S A;  2MLG A;  3NQO A;  5E8G A;  2FEZ A;  2IA1 A;  3G73 A;  5CVI A;  4YEL A;  3AFH A;  3CJT B;  3S8P A;  1GXQ A;  2BXZ A;  2BY0 A;  3HXL A;  2HOT A;  3D5L A;  3LAJ A;  2L9N A;  3ASO H;  1WSU A;  3CC7 I;  2VKH A;  3BCA A;  5E20 A;  4CO8 A;  2X4H A;  1YW7 A;  3K2A A;  2I8D A;  1STZ A;  4A0Y A;  1Z3X A;  2DT7 B;  1W7P B;  3ISP A;  4CDG A;  1PUE E;  1RZ4 A;  1SAX A;  3CES A;  5F27 A;  2FUG 2;  1YX5 A;  4LB6 B;  4C2T A;  4LGW A;  1ETO A;  2E1O A;  3D5S C;  4BHC A;  3P9I A;  3U1K A;  4OU0 A;  1V4R A;  1NTC A;  3LWF A;  1H0M A;  3FM3 A;  4CCN A;  1MBG A;  3ABL H;  1I39 A;  2XB5 A;  3KZI C;  1SAU A;  1XB4 A;  4XLH A;  3C3W A;  2CW0 F;  4LG3 A;  1YYV A;  2FU4 A;  3R0A A;  3M7G A;  3QPS A;  4F93 B;  4XM3 A;  2CMP A;  5E3M A;  5A2Q K;  1Y8Q B;  1UHW A;  5J8C A;  2HOA A;  2QKL B;  1R5H A;  2XAG A;  1YS7 A;  3EDP A;  1KU7 A;  4BAY A;  4D0P A;  2R93 J;  3M3Y J;  2ZFU A;  3MKW B;  3GTL J;  2MC4 A;  3SDG A;  1R00 A;  3BR2 A;  4BXX J;  4DIQ A;  3H5R A;  1JGS A;  3EET A;  1HQC A;  5HLI A;  2HPM A;  4FX0 A;  2GAU A;  1XTA A;  4D9J A;  4ENM A;  2IS4 A;  2DA3 A;  4CYC A;  3DPU A;  1IDY A;  2K9Q A;  1OCP A;  3PQK A;  4EQQ A;  1BR4 A;  3MMY B;  1TWH J;  3RPU D;  3SDB A;  3TDU C;  4AIH A;  4RB2 C;  1VQ6 I;  1X1D A;  2DQL A;  2P7C B;  3ZMV A;  3WTU C;  2MAB A;  3GLL A;  4MTD A;  2HQ5 A;  2ELH A;  1BA5 A;  4BGD A;  2H1L A;  5HDK A;  2BXY A;  3HBL A;  1VQL I;  2KRF A;  3SEZ A;  3O8H A;  1R71 A;  3ZQI A;  3WTV C;  1J9I A;  1O3Q A;  2CJJ A;  2KQR A;  1ZGJ A;  4EJU A;  2W4S A;  2X6X A;  4AYB N;  3L9F A;  2M45 A;  2CQK A;  4A3M J;  3R60 A;  3HUG A;  2JTV A;  3I59 B;  1RPW A;  2A6T A;  1TWF J;  1IN8 A;  2EV6 A;  4BDY A;  2EH3 A;  2MYS A;  3GVA A;  3O2P E;  4MLO A;  2VQL A;  1LB2 A;  2X6Y A;  5CVR A;  2L54 A;  2JA8 J;  2W57 A;  3CJR B;  2XAJ A;  3S14 J;  2DCE A;  3H36 A;  5D4S A;  3UKG A;  1LDD A;  1K4T A;  1MBF A;  2VQG A;  2OV7 A;  3B73 A;  1BOB A;  3GTJ J;  2YX7 A;  2R7U A;  1XSX A;  2K7L A;  2FBK A;  4ZJZ A;  3D1N I;  5GP9 A;  3OYE A;  1MKM A;  1MBJ A;  4AYB A;  1D8J A;  2HWV A;  4BS9 A;  1BJA A;  2FX0 A;  3S1Q J;  1QZZ A;  4ESF A;  3J80 K;  1X3W B;  3KE2 A;  2KT0 A;  4Q48 A;  3GXO A;  3RKX A;  1XSV A;  2BW3 B;  3P9C A;  5F6F A;  1RI7 A;  3LOC A;  3CCL I;  3M8E A;  3CCV I;  4A3J J;  1WI3 A;  5JVT A;  3I55 I;  3HGG A;  4XOR A;  3CQZ J;  5L3B A;  3BG5 A;  3V8L A;  3GCM A;  2ZNY A;  2A5Y B;  2F5E A;  4WCG A;  1OQY A;  2LFB A;  3E1S A;  4B3A A;  1IW7 F;  3I9V 2;  1HC8 A;  1MBK A;  3CCY A;  4V2G A;  3IWZ A;  3L00 A;  4U87 A;  5B1A H;  3HTS B;  4DW6 A;  1LE8 B;  1O3S A;  5FD6 A;  3E6M A;  3JRE A;  1HCR A;  3ESW B;  5F08 A;  2CQQ A;  4MNU A;  5EEH A;  5GAE J;  3K70 C;  1DP7 P;  4EJO A;  3EPZ A;  1MDM B;  1K6O A;  2K5C A;  3WTY C;  2D45 A;  1B6A A;  2EPF A;  2OCC H;  3GTQ J;  3ZN1 A;  2W25 A;  1SC7 A;  1MD0 A;  5M5W J;  1KYW A;  1MNM C;  2JVH A;  3ZN0 A;  2GLO A;  1R4N B;  1RET A;  2AO9 A;  3W2W A;  3ZMZ A;  3ZQL A;  2R7Q A;  1FYM A;  4A3G J;  1J7K A;  3I0T A;  4NNJ A;  2GXB A;  2HGC A;  3Q0V A;  5E3N A;  3VYU B;  2JUC A;  4PJM A;  1DDN A;  2YSR A;  3J7A Y;  1QHG A;  5TIS C;  4XRS A;  1ORK A;  2HYF A;  1W5C C;  1O7L A;  2DOF A;  1JE8 A;  3QAH A;  3WHC A;  4BJT A;  2PLY A;  4GGG A;  4CH7 A;  4ITV A;  2XVC A;  4OMZ A;  3K4M A;  1P9Q C;  4YIF A;  3HM5 A;  3JRA A;  4F3Q A;  2JMW A;  4D5C A;  4LFU A;  5FKL A;  3JRD A;  3A01 B;  1FLI A;  3GUD A;  4KIB A;  4ZYG A;  2EFN A;  3W2A A;  3HOY J;  5DD8 A;  2DJI A;  4A93 J;  1OYY A;  1U9O A;  5KCM A;  3FXM A;  4A12 A;  3ML6 A;  4DZP A;  2XAF A;  1XGO A;  3LL7 A;  1OFC X;  3G2B A;  5AIQ A;  5AIP A;  4QIW N;  4KFC A;  2HKO A;  2F5D A;  2XGD A;  1LJ9 A;  2CU7 A;  2HTJ A;  2VJI A;  1NK3 P;  1N75 A;  2IBD A;  3W6K B;  2VPR A;  2R7R A;  4E7J A;  1QVU A;  3CP8 A;  5E8I A;  4XR6 A;  2X48 A;  2HR3 A;  3F8C A;  3KFW X;  3FXQ A;  4UB8 C;  3QU6 A;  4IHV A;  3TW7 A;  3EUA A;  3F0C A;  4C2U A;  2RKH A;  4EGZ A;  3MN2 A;  1FX7 A;  1IN6 A;  1MSE C;  1SD5 A;  4OIN F;  3MKZ A;  4I76 A;  4ZDO A;  2NOJ B;  3O6B B;  3BWG A;  3MD2 A;  1A31 A;  4XLP F;  2IA0 A;  1OCT C;  3DEE A;  1PUF A;  3KP7 A;  1KON A;  3F8B A;  3CO6 C;  3MZY A;  4CCM A;  4KIT B;  3W6V A;  1DU6 A;  4UVB A;  2XRO A;  3O8G A;  2J5P A;  2F4I A;  3WGH A;  4P9U A;  2L9S A;  2OQG A;  2EFW A;  1MSF C;  2PJR A;  1FTT A;  5CQE A;  2VJ4 A;  2AQF A;  2FJ1 A;  5D6E A;  1WJB A;  4AIK A;  3V4G A;  4PUS A;  2RV8 A;  2QVO A;  3I64 A;  1QHH D;  4XKV A;  2LKS A;  4M6Y A;  5CVU A;  4HDV A;  1FC3 A;  2WY7 Q;  3I4P A;  4IRI A;  2MA3 A;  1OIS A;  3SFI A;  2VOO A;  3ZXS A;  1NG6 A;  3E7L A;  1TP4 A;  4Y13 A;  4Q5S F;  2KIF A;  3LA7 A;  2PMH A;  1VQK I;  3K4L A;  4M71 A;  1BI2 A;  3E97 A;  1FP1 D;  4XK4 A;  4BQQ A;  1ZAR A;  1WI9 A;  2HU9 A;  5M3F J;  1Z7L A;  1Z77 A;  2CGP A;  2R7Z J;  3JW4 A;  1OCZ H;  1U2W A;  4ZH4 F;  3M1E A;  1B59 A;  2LP0 A;  4E7S A;  1P92 A;  5IOY A;  2QM3 A;  3K6G A;  1HDD C;  1XGN A;  3D5R C;  4XSX F;  2M8G X;  3HDD A;  1JKQ C;  3Q0U A;  3E0J B;  5K5Q A;  4YFX F;  3CCR I;  4W1U A;  4I6Z A;  3IP4 B;  2MW8 A;  3BC8 A;  2QA4 I;  1IXC A;  3GZ6 A;  3ZP5 A;  4IJA A;  4XMY A;  1XDU A;  2JPB A;  3S3N A;  4PSX A;  1Z7U A;  5H6Q A;  3HL2 A;  4QPQ A;  5HOD A;  3F8F A;  4IHS A;  1T08 B;  5FFX A;  4PJ0 C;  1FYL A;  5FKM A;  3KP5 A;  1TQP A;  3M9A A;  2VN2 A;  4M9Z A;  4G7H F;  3CP2 A;  3KEY A;  3S1R J;  2FQ3 A;  2R0Q C;  1ZAO A;  2X1D A;  4E70 A;  4I0A A;  2OTL I;  4L0Y B;  2RC4 A;  2VBX A;  1UB9 A;  2E7W A;  4L9V A;  5AON A;  1T95 A;  5K7Z A;  2LYC A;  4DBQ A;  2ZME C;  1WJC A;  1AHD P;  2ETH A;  2WAD A;  3TP3 A;  1YS6 A;  3TGN A;  2F48 A;  2WC2 A;  3S3M A;  4M3D A;  4KIC A;  1H9G A;  1FY7 A;  2QYO A;  2DXI A;  2E5Z A;  4BXF A;  5F0F A;  2X85 A;  3LMM A;  4EVI A;  1Y1W J;  2L7M P;  4XLN F;  1RKT A;  1E3P A;  4UUS B;  4BE0 A;  4A3L J;  3KPH A;  3BZ6 A;  4XOP A;  3CTA A;  1QRY A;  1IAW A;  4MEX F;  2BVM A;  4II2 A;  4MGR A;  3W2V A;  5K1Y A;  2CO5 A;  5DCM B;  4F91 B;  4HV6 A;  1UAA A;  2K3P A;  1IUF A;  4KYW A;  1A6I A;  2EIL H;  1YRN A;  2LF8 A;  4XOT A;  5ILV A;  2EA4 A;  4CSW A;  3F22 A;  2Y2Z A;  1V3F A;  1IUY A;  2BVL A;  1FJL A;  4W97 A;  2BBY A;  5K7F A;  2KMU A;  3I56 I;  3FXO A;  3DEU A;  2YU9 J;  3E5Q A;  1HKT A;  1MJA A;  4PZJ A;  2M87 A;  1OLT A;  2VKD A;  1CF7 A;  4AVP A;  2HZT A;  2QQ8 A;  2STW A;  3E5X A;  1DPU A;  3BZK A;  3B02 A;  1XGM A;  4AWX B;  4F55 A;  9ANT A;  1WVR A;  2ISY A;  3BR5 A;  5LBQ A;  1QPM A;  3IUO A;  3MEX A;  3DEW A;  2XIG A;  3OYC A;  2LTP A;  4A0X A;  3S2H J;  4V19 K;  2KRC A;  3HOX J;  4M74 A;  4PCQ A;  2IGK A;  2QKM B;  5LD2 C;  3RQ4 A;  2G7H A;  5FO5 A;  1D1C A;  1SMY F;  4KUM A;  4M72 A;  5EEG A;  2LD5 A;  1X1A A;  2OZU A;  3WGG A;  1FEX A;  4A5M A;  5IYC J;  1OCC H;  4D1Q A;  3NEU A;  2DA5 A;  2BOL A;  3A03 A;  3FKJ A;  1Y1V J;  1GT0 C;  4HPQ A;  1N78 A;  4OAY A;  1S6L A;  1UST A;  1J75 A;  1S9H A;  4H0E A;  2H8R A;  1REP C;  1UCR A;  3ELK A;  3TOA A;  4DZJ A;  3T8R A;  4AC0 A;  1HLV A;  1T8I A;  4R8H A;  3WU0 A;  2XPU A;  2K27 A;  2DK8 A;  6PAX A;  1TW2 A;  4PGH A;  1YFH A;  4B09 A;  1FZP B;  2STT A;  2XF7 A;  4H4K C;  5LLQ A;  3OL4 A;  2JA5 J;  2DFH A;  4NC8 A;  2XGE A;  1XS9 A;  5FD5 A;  4AIJ A;  3LQQ A;  4BEH B;  4BY1 J;  1WJF A;  5FRM A;  4AUX A;  4E7Z A;  1S7O A;  3H1C A;  3DTE A;  3PO3 J;  4FHT A;  2YX4 A;  4LIT A;  3CUQ B;  2M9H A;  1WGX A;  2FSW A;  1XD7 A;  3CCM I;  1J59 A;  3OMY A;  5JI6 A;  2XGX A;  2LF7 A;  3RPU A;  4JBA A;  3F9K A;  3ECO A;  3AG2 H;  1OMI A;  3OSG A;  2VL8 A;  4XRF A;  1B72 B;  1BN5 A;  3IH3 A;  2HI3 A;  3RKW A;  2I5U A;  4GXO A;  3A2K A;  1JKO C;  2AQE A;  2IA2 A;  3OYH A;  1YX3 A;  3P7N A;  3JSP A;  2V9K A;  2EB7 A;  1LUJ B;  2A5W A;  2JUG A;  2O0Y A;  2XRN A;  2LOO A;  3ERE D;  1ZLJ A;  1QZE A;  1XCV A;  2KZG A;  1QZY A;  2LLK A;  2QSG X;  2F4O B;  4JK1 X;  3BR1 A;  2EJR A;  3H9G A;  4WXH A;  1B9M A;  3OIO A;  3R0J A;  1JTY A;  1WWX A;  1G4D A;  5EZH A;  5IOZ A;  2LK2 A;  4MO7 A;  2EIK H;  2HPI A;  3BQY A;  4OWR B;  1VQ4 I;  4U7D A;  3FWE A;  3LA3 A;  2HZD A;  2FNA A;  5B5E C;  5LGT A;  1O3T A;  3QYF A;  3QPT A;  3TBI A;  3OIP A;  1ZEL A;  3H9J A;  1I50 J;  4BY7 J;  2IAI A;  3Q0W A;  5HDG A;  4M9S A;  3CMA I;  1VQO I;  1IJW C;  1SVM A;  2HYJ A;  3ABU A;  1OR7 A;  1Z1D A;  5EDN A;  4KMU X;  3I71 A;  2DTZ A;  1V54 H;  2OBP A;  2AHQ A;  4F7Z A;  3K7A J;  2VOD A;  2RQQ A;  3QYB A;  1FMV A;  2Q2E A;  4E7H A;  1U5T A;  4MQ9 F;  5DM7 F;  2PMZ N;  4UHT A;  2K9N A;  2XDV A;  5CVV A;  3JTG A;  5D8L B;  3GME A;  2B9S A;  1LQ1 A;  2R4G A;  3BTJ A;  4BBS J;  4Q4Z F;  2R7F A;  1LKX A;  2X0L A;  2W1O A;  1O4X A;  1W7P D;  3HHG A;  4B1R A;  2BYV E;  2NAZ A;  3U1D A;  1EF4 A;  1GV5 A;  3M8J A;  1JTX A;  1ON2 A;  3QYE A;  1ITY A;  2ZXJ A;  1H9T A;  1GUU A;  1ZRD A;  3SYT A;  4L0Z B;  4XLA A;  3CD6 I;  1U78 A;  2VLA A;  5ICE A;  2PMZ A;  3FXJ A;  4JOM A;  1MMA A;  4ASN A;  3BJO A;  2DFE A;  3KIO A;  2Y69 H;  1Y39 A;  2RQP A;  1USS A;  5HS7 A;  1SVL A;  3AAF A;  4QLC U;  4IVN A;  1U8B A;  3ZMD A;  2DW4 A;  2DOA A;  3L2V A;  4YRV A;  3FBI B;  4C3H J;  3SZG A;  2DA4 A;  2N8G A;  2P5K A;  4ZDP A;  2LMD A;  5BS6 A;  4ZZL A;  2OUM A;  2BY2 A;  2E36 A;  5IPA A;  4QTR A;  1EV7 A;  3GTK J;  2E1M B;  4WF2 A;  4HNT A;  2E5N A;  4ZYE A;  4HA8 A;  1B8I B;  3GFM A;  2JA2 A;  4XLC A;  5IYB J;  2X1C A;  2JSC A;  1MMG A;  5DDG A;  3OYA A;  1BJZ A;  4EM2 A;  1RC9 A;  1IGN A;  3RQI A;  1E3H A;  2Z33 A;  2PX9 A;  4DYC A;  2IGM A;  3GBG A;  4FET A;  5F1J A;  2ZO4 A;  2M34 A;  2FQ4 A;  3ZQG A;  3QQA A;  3H92 A;  3HKZ N;  3OYG A;  3AL0 B;  2LVS A;  1R7J A;  4RA2 A;  4X1E A;  2QSF X;  1DP3 A;  2ZNZ A;  4N4N B;  5J4Y A;  3ZCO A;  3OR2 C;  1TNT A;  3I4N J;  3S1N J;  1BI3 A;  3KYD B;  2V1N A;  3M4O J;  4KT6 A;  3I54 A;  1M1E B;  4GYI A;  4IXA A;  3TL4 X;  1FOY A;  3CC2 I;  3K1M A;  4QWQ A;  2DMN A;  4KMF A;  3F3X A;  5J6X A;  2NNY A;  2KL4 A;  2DA2 A;  2F4M B;  4UUT A;  2R7W A;  5FLX K;  1YQA A;  2ZB9 A;  3ABM H;  4RLF A;  2YUS A;  2NYX A;  4KN4 X;  2LRE A;  3HKZ A;  1ZR2 A;  4NBQ A;  3GTM J;  4HBL A;  3DV8 A;  3GWZ A;  4A2U A;  3CUO A;  1TC3 C;  3FHZ A;  4IQJ A;  2EBI A;  2DFF A;  1AKH A;  4IHT A;  1G6N A;  4EM0 B;  2TCT A;  3M1C A;  2A68 F;  4A3F J;  1UJ8 A;  3DPL C;  3RYP A;  1VQP I;  1FNN A;  2XB0 X;  2GIZ A;  5HS8 A;  3KYC B;  4RS8 A;  1HA8 A;  4L9J A;  3NWT A;  3K10 A;  2C6Y A;  1VFC A;  2COB A;  3CCS I;  2Q1Z B;  5A2Q Z;  1FPQ A;  3DBH B;  3CDH A;  3SEQ A;  4WXC A;  1W5S A;  1SFE A;  2FBH A;  4BU2 A;  1YIJ I;  5EGO A;  1LPQ A;  1G59 A;  1TZL A;  2GWR A;  2COM A;  5E3L A;  5E79 C;  3PQJ A;  4PFO A;  4JP0 A;  3FZV A;  2Z3Y A;  2IEK A;  3LSG A;  3RKQ A;  1CF7 B;  1RIO H;  1B4A A;  3WHB A;  2B63 J;  3BG3 A;  3OY9 A;  2QQB A;  4CXF A;  4Y33 A;  1A6Q A;  2VE8 A;  1TT5 B;  3DP7 A;  2CQN A;  1Z6T A;  2GXG A;  4HQE A;  4II3 A;  1PP8 F;  3NRV A;  4BQN A;  4O5V A;  1EKE A;  2OAZ A;  3DLA A;  3FK6 A;  2JA6 J;  4I0B A;  3L2U A;  4JYK A;  5JFR A;  3HRM A;  4JQF A;  3HGY A;  1HSJ A;  1RES A;  2CQ7 A;  2LSO A;  3ERM A;  3V7C A;  3RYR A;  1X1C A;  3IRR A;  1FMW A;  2W7N A;  1FOX A;  2KIQ A;  2M4K A;  3BLY A;  2QBY A;  4YFN F;  2KZV A;  4UVC A;  1MNE A;  2LNB A;  2NOG A;  3CO7 C;  1K78 A;  4LG0 B;  2JA7 J;  1ZN2 A;  3Q3S A;  5HVQ C;  3IH4 A;  2VXD A;  4LK1 F;  1ETX A;  2LG4 A;  4IHY A;  1X19 A;  4LK0 F;  1OR7 C;  2VKV A;  1RR7 A;  4BE1 A;  2E2H J;  4MIM A;  5ILS A;  5H2F C;  1FSH A;  1U5T C;  4OMY A;  1JUM A;  1ETK A;  2EQR A;  1SD7 A;  2DDA A;  3TO7 A;  2K4J A;  2DOD A;  1IRF A;  3RCO A;  1LFU P;  2BZT A;  1QPI A;  3FMQ A;  2P7V B;  4WK8 F;  1ZHF A;  2FRH A;  2ZBK A;  2A69 F;  2BGC A;  3DKY A;  1PP7 U;  3QOE A;  4XON A;  5GTH C;  3SZP A;  3LFU A;  3PUB A;  4J01 A;  1T38 A;  4BNC A;  1JJ8 C;  4K2E A;  3IH2 A;  3JRH A;  2ZME A;  2PI0 A;  4KNY A;  3EUH C;  1K6Y A;  3DFG A;  1WFX A;  4YFK F;  1I6H J;  1Z05 A;  2UXN A;  5L3D A;  1KZH A;  4J00 A;  2L2O A;  2KJC A;  4D7N A;  2Q0O A;  5ERI A;  3DWL E;  5IP7 J;  5K5R A;  2OCE A;  2B7E A;  2LR8 A;  2ESN A;  3J80 Z;  1Z91 A;  2M4G A;  1ONV A;  3R4K A;  4DOZ A;  2L4A A;  2GZW A;  1OJL A;  5DCF A;  2HQR A;  5GAD J;  2LH9 A;  5DS9 A;  2LY9 A;  1PDN C;  3J81 Z;  3ZGK A;  1P4W A;  1E17 A;  4KIS A;  2VIX A;  5J1U A;  2W24 A;  1WJA A;  1K4S A;  2CWE A;  3GZN B;  4LD5 A;  5CKT A;  3PFY A;  2X1E A;  4LLL A;  4FAS D;  1RRJ A;  2JSP A;  1BOA A;  2HKX A;  3CF2 A;  3R61 A;  4FTH A;  4HEA 2;  2CRG A;  2XV4 S;  3BJA A;  3JRG A;  2HS5 A;  4ESJ A;  1FP2 A;  4HLX A;  2VOP A;  5DD4 A;  2Y9Z A;  2QLZ A;  3HPG A;  5KAI C;  3W6J B;  2JZY A;  4WWC A;  4CYD A;  4YIR X;  1TT0 A;  1MBH A;  2MGQ A;  4L5J A;  4GDF A;  1ZH5 A;  1YHQ I;  1TWG J;  2BE5 F;  5LGN A;  3WU2 C;  5BMZ A;  2Z9O A;  1BIB A;  2CH0 A;  2H1K A;  2HXI A;  1IN5 A;  4G8X A;  4EJV A;  3DPT A;  1HKS A;  1KU2 A;  4GRI A;  4JX5 A;  3H3U A;  1MIJ A;  4D5F A;  3BRO A;  4UXN A;  3Q9V A;  2HDC A;  3NWS A;  2E34 A;  2VJ5 A;  1YJN I;  1UMQ A;  2DQR A;  2R5Z B;  5TJJ A;  2PEX A;  5EEA A;  1S29 A;  3OL3 A;  1U9N A;  5LEK A;  3WTS C;  1IN7 A;  4RB3 C;  1VZ0 A;  3DKW A;  5DV5 A;  2AS5 F;  2DN0 A;  2WAF A;  1DUX C;  4HX7 A;  3C2B A;  2HQA A;  1MW7 A;  3BTI A;  1DPR A;  2DTR A;  2CV2 A;  2NS0 A;  4M6V A;  2R7X A;  5D6F A;  5HOO A;  5D5V B;  1S72 I;  4XQF A;  2DU9 A;  3GTG J;  3CCU I;  5IYD J;  1K83 J;  3MZH A;  3OOU A;  5FGM A;  3PL8 A;  1UEL B;  4LLG F;  2HVQ A;  4MEY F;  4HF1 A;  2DDB A;  4G9Y A;  2PG4 A;  3ZMT A;  3DXJ F;  2Y9Y A;  4OIP F;  2M3A A;  3M07 A;  5LRS A;  5FLV A;  3OYF A;  1ZGW A;  3LAP A;  4KT5 C;  2FOK A;  3FMR A;  2ZFW A;  3UNG C;  4RGS A;  1TLH B;  4Y3O A;  3VOE A;  4O3M A;  2DMQ A;  3E6B A;  3N05 A;  4RLQ A;  4XKC A;  4Y15 A;  3LSM A;  3H9Q A;  4U7B A;  2H09 A;  5IT9 K;  3RIR A;  2JT1 A;  2NVX J;  1SFO J;  2Z99 A;  1KQ8 A;  4I99 C;  3NAU A;  4A3C J;  3WGI A;  2QF7 A;  3T5X A;  1AWC A;  3JCU C;  4EMS A;  1X1B A;  1G3W A;  4UV9 A;  2OJE D;  4OIR F;  1V5G A;  3RI4 A;  2LY2 A;  2CG4 A;  4RGU A;  3MFK A;  4P55 A;  2FF4 A;  4NUB A;  4PJJ A;  4J19 A;  2F2E A;  5IP6 A;  3Q5F A;  5F0H A;  4XN3 A;  4A69 C;  3PSF A;  2JK3 A;  4KIF A;  2MSY A;  4N9I A;  5GAG J;  2K86 A;  1XPX A;  1F43 A;  2X6O A;  1Z6R A;  1N25 A;  1T98 A;  1FIP A;  5CVJ A;  4RBO A;  3A0H C;  1JKR C;  1VQ5 I;  3ZQC A;  2CUJ A;  2AXT C;  3VWB A;  1H89 C;  1POG A;  2NXN B;  3PNY A;  4AVZ A;  4HNU A;  1WCM J;  3FM5 A;  2CUE A;  1RNL A;  2HOE A;  1ZG5 A;  4XLF A;  1H88 C;  3IC7 A;  2NVQ J;  2P0W A;  1DQU A;  3I5U A;  4BBR J;  2DJN A;  2EWN A;  1X58 A;  4NQW A;  3ZMU A;  3IV5 A;  4M9X A;  3OOP A;  4R1H A;  4UB6 C;  1XC5 A;  3ONQ A;  3F8N A;  1Y56 A;  3P5J A;  5J40 A;  2VC1 A;  1XDS A;  1YTY A;  1XCB A;  1T0F A;  1AOY A;  2JN6 A;  4HX4 A;  5TRD A;  4Z2Y A;  3EQL F;  1I3A A;  2B0L A;  1P4X A;  4CYC B;  3MCZ A;  1ZK8 A;  1D5Y A;  3T1B A;  4U88 A;  5EZG A;  2HXO A;  2GOX B;  1W7P A;  3PIO F;  4NHJ A;  3FXK A;  3LNQ A;  2ZSH B;  3S2W A;  1YW9 A;  2MBF A;  3ZQH A;  1YI2 I;  3LSH A;  1FT9 A;  4XN0 A;  4BAC A;  1QBJ A;  3A0B C;  2DT5 A;  4D7M A;  5EGO B;  4Y4R A;  4S04 A;  1OCO H;  1GLN A;  1UZC A;  3WTZ A;  3HOV J;  2J5O A;  2RDP A;  3PIP F;  1Z21 A;  1X2N A;  4BQO A;  4HQM A;  5HLT A;  2VAS A;  3BR0 A;  2QQ9 A;  4G7Z F;  3ZR8 X;  2L4M A;  4WXD A;  2A6E F;  4ZTJ A;  2V26 A;  4A3K J;  3S17 J;  3I3L A;  5JHF A;  1ON1 A;  3SHF A;  1OYW A;  2XRL A;  4S0H B;  1ENH A;  1Y0U A;  1QVT A;  5L3E A;  3BZC A;  2R7T A;  1W1W E;  2ZXW H;  2NVY J;  2GM4 A;  1WRJ A;  2HYG D;  3HTU A;  1D0Y A;  3HUG B;  5DUK A;  4F52 A;  3WTW C;  3KYL A;  3PNT A;  4OAZ A;  1KQ0 A;  3REO A;  4RB1 A;  3FXR A;  3CME I;  2PN6 A;  3OYD A;  1G2H A;  5KVR A;  2PFB A;  3BTL A;  1UHM A;  4UNO A;  3IAS 2;  3S15 J;  2L0K A;  3BG9 A;  3RKY A;  1B9N A;  3U9G A;  2OU2 A;  3DU6 A;  1XX5 A;  2QBY B;  4I7H A;  4IRH A;  4N9H A;  3JSO A;  4E7L A;  3ZQ7 A;  2NS7 A;  2CW7 A;  2DBB A;  3DQV C;  5FB2 A;  3BG7 A;  4O6J A;  5BPI A;  2VE9 A;  1UG2 A;  1N77 A;  2V6E A;  1QU3 A;  2E35 A;  2BY1 A;  2P8T A;  3HSR A;  3HG9 A;  5TGT A;  1VQ7 I;  1V5E A;  3GYH X;  2G9W A;  3Q9S A;  5FLM J;  1R49 A;  3F72 A;  4A6E A;  1EJ9 A;  1FOK A;  1JJ6 C;  2DA7 A;  1HW2 A;  3N97 A;  3QPH A;  1F1Z A;  1BIA A;  3JAM Z;  3KCC A;  3L7W A;  4BHB A;  2K40 A;  1YJ9 I;  3VFZ A;  4N4O B;  2ACJ A;  1R1U A;  1JUS A;  3F6O A;  5L3F A;  1A36 A;  5LRR A;  2ZME B;  4XNF A;  2MD0 A;  2NNN A;  2QGU A;  3HZJ A;  2DYS H;  4HOB A;  2V7F A;  4XSZ F;  2EZK A;  1DGR M;  1E3O C;  2EFQ A;  3I59 A;  1IDZ A;  3DCF A;  2VQH A;  3TMO A;  3G4S I;  2MD5 A;  1ETW A;  2CUF A;  3PUF A;  4M3B A;  1IV8 A;  3CCQ I;  1R5I D;  1HBX G;  2X51 A;  5FRO A;  5C4X J;  2ADU A;  3V8K A;  1R1T A;  2XUB A;  2L9R A;  3CZ6 A;  4FE7 A;  4LIV A;  1VQN I;  4ANJ A;  2D5V A;  1UHS A;  2QEX I;  1T33 A;  4IOC F;  3N4M A;  1BBY A;  4A3I J;  3TED A;  2CFX A;  4HF0 A;  1T56 A;  3BR6 A;  1I5Z A;  3QP5 A;  4ENJ A;  5M3M J;  3L09 A;  2YPR A;  4XLE A;  1YO5 C;  2Y48 A;  3CLO A;  1BC7 C;  1I6X A;  4ESB A;  2F5V A;  1U6G A;  3FXU A;  3RPQ A;  2R5Y A;  4KDP A;  1T2K A;  1XGS A;  1HW1 A;  5J3L A;  2KHM A;  3FF5 A;  3K4C A;  2BHY A;  4TV7 A;  2BW3 A;  2QQA A;  2W84 A;  1VND A;  1LDK B;  1R4M B;  2QZ8 A;  2KIU A;  2IXS A;  4JX4 A;  2E2I J;  3GFI A;  4V2F A;  3S93 A;  3U2R A;  3O3K A;  1ZRE A;  3HHH A;  3A4C A;  1BI1 A;  3K4N A;  4FT8 A;  1RKW A;  2ECB A;  4I01 A;  1FOW A;  5CYV A;  3BJ6 A;  4MFE A;  4MQV A;  1J5Y A;  4Y17 A;  3VYS B;  2UXX A;  1WJE A;  3A1Y A;  1E2X A;  2IS2 A;  5KNL A;  3F6V A;  4A3E J;  2JPC A;  2P6T A;  4N0B A;  3S32 A;  4ZZD A;  1A5J A;  3SXY A;  4XKB A;  4IOA F;  2VT2 A;  1T39 A;  1WHU A;  3GO5 A;  1ODD A;  1CGP A;  1O7F A;  1IN4 A;  4B8X A;  2XHK A;  2PQ8 A;  2KDO A;  4UV8 A;  1VQ9 I;  2DAO A;  1IF1 A;  3ZMS A;  3BPV A;  4IL6 C;  2KJB A;  2MH2 A;  4XIC A;  4M6X A;  2EZH A;  4U0Y A;  1FWZ A;  4KIG A;  2RAE A;  5C3E J;  2CQX A;  4X6A J;  1W36 D;  5E17 F;  2VUM J;  2XF5 A;  3DU5 A;  5JR3 A;  1G3Y A;  1MND A;  1W36 C;  1T0F C;  4UVA A;  1PUF B;  1F36 A;  5ED4 A;  2P81 A;  3J7Z I;  2WV0 A;  5LEJ A;  4ZTF A;  1R5G A;  3EUH A;  1W0U A;  1U3E M;  2PJR B;  2FMY A;  3HOZ J;  2LC2 A;  1Y6I A;  3P9K A;  1JHF A;  1YG2 A;  2ID6 A;  2K4B A;  2H27 A;  4BUP A;  5FKK A;  2V6C A;  1D0X A;  4F92 B;  4UUV A;  1JUP A;  3FHN A;  4FE4 A;  5FFZ A;  3V42 A;  2DOE A;  2UUZ A;  2ISZ A;  1ACI A;  3BOQ A;  2XKO A;  1S7E A;  2M5W A;  3GFJ A;  3QPL A;  3WTX C;  2RNJ A;  3BPX A;  1KU3 A;  1ULY A;  3K69 A;  5D4R A;  2ZCW A;  2NVU B;  4DBR A;  4HV5 A;  3TO6 A;  3QRF F;  2XSD C;  3RJP A;  1BR2 A;  4P5O A;  4EJW A;  2XSJ C;  1ETY A;  3E3V A;  1JKP C;  4EV0 A;  2BV6 A;  3HYI A;  2ZSI B;  3HEF A;  4BYY A;  1ZRF A;  2A3S A;  1W0T A;  3V8J A;  2IGO A;  1TNS A;  3MWM A;  3L2C A;  3OV8 A;  1K61 A;  4OIO F;  5HNH A;  3GZ5 A;  2IPQ X;  4PDK A;  1A04 A;  4RM2 A;  3HOW J;  5E18 F;  3CCE I;  2KFD A;  1GVJ A;  3MZ8 A;  4M3F A;  3F23 A;  4CCK A;  2X6W A;  5E3O A;  1MMD A;  4CCO A;  4GO1 A;  1ERD A;  3NAR A;  1EA3 A;  1NH3 A;  3JRI A;  1WQ2 A;  2W85 A;  3FDY A;  5D5U B;  2FBI A;  1ETV A;  3SQN A;  4RAY A;  3OS0 A;  4YII A;  1DU0 A;  3MKY B;  1XMA A;  1UFM A;  4I98 B;  1YE9 A;  3KP3 A;  1Z3Y A;  1G3S A;  2D1H A;  4ZYD A;  2V79 A;  3IKT A;  3JR9 A;  1TQM A;  2ESH A;  2LDU A;  4B43 A;  3H3Z A;  4B47 A;  2ZJQ F;  2DK5 A;  4IX7 A;  2K9L A;  2JQ7 A;  4CZZ A;  3DTK A;  1YOV B;  5CJ9 A;  3CC4 I;  3H5N A;  2FA5 A;  1NHA A;  3AG4 H;  3CJN A;  2K3F A;  3QWL A;  1RR8 C;  2M0C A;  4XL9 A;  4CHU A;  3DBL B;  1LDJ A;  3T0Y A;  3KET A;  3BR3 A;  4HST A;  2HOS A;  1TL8 A;  3CDI A;  1VTN C;  3RTR A;  3I58 A;  1SMT A;  4U0V A;  5CPR B;  3OS2 A;  5LHG A;  2D1V A;  4AU7 A;  1QGP A;  3J7Y J;  1WKM A;  3QU3 A;  2O8K A;  2EZL A;  2IJL A;  3WU1 B;  3LSR A;  2P6S A;  5FLX Z;  2RVC A;  1MMN A;  2ZXI A;  3BG6 A;  2M30 A;  2E71 A;  2ECC A;  3L2Q A;  1YRN B;  2KPM A;  5M5Y J;  2H94 A;  3VDX A;  2RRE A;  1F9N A;  4B48 A;  4S05 A;  1P7I A;  4ZC3 A;  3TOB A;  1U8R A;  3ZPL A;  2EFO A;  4XRS G;  1Z9C A;  2XAQ A;  4XID A;  1TW3 A;  3MAJ A;  1FIA A;  3S2D J;  4LLN A;  2W82 A;  2PBI A;  2GA1 A;  2H6B A;  2DI3 A;  2VON A;  3RSN A;  2GA2 A;  5GTI C;  3OS1 A;  2RNG A;  4HSR A;  5FJ8 J;  1R1V A;  1HW5 A;  1KYZ A;  2IT0 A;  1D1B A;  4HNV A;  1OYI A;  4E7K A;  2ID3 A;  3SJM A;  2FML A;  4IZZ A;  2L7K A;  2UZK A;  4L18 B;  4IPA A;  2VXZ A;  4G6D A;  1OPC A;  2V4J C;  4FCY A;  2M2E A;  4CCJ A;  1BM9 A;  2XAU A;  3AKZ A;  2L7Z A;  5HNF A;  2KIS A;  2WBM A;  4UUS A;  2EV5 A;  3K0L A;  1GHC A;  2DO7 A;  2CFO A;  1R9T J;  2Z16 A;  2EV0 A;  2EA2 A;  1S3J A;  5DCM A;  2L9V A;  2D2W A;  3CMY A;  1APL C;  1E0E A;  5HS9 A;  5DM6 F;  1ZG1 A;  5JLW A;  5H20 A;  4P9F A;  2GIV A;  2DFI A;  1XN7 A;  2RN7 A;  1PYV A;  1KU9 A;  4NC7 A;  3MVP A;  5BNG A;  4BJ6 C;  1F5T A;  1GXP A;  2HNH A;  3SFZ A;  4LIU A;  5IY5 H;  2PJP A;  2ZKZ A;  5B1B H;  2O6G E;  2DPD A;  2ELK A;  1SD6 A;  2PMU A;  4RMN A;  4C30 A;  3SZT A;  3ZOB A;  3GF2 A;  4XRM A;  2HFH A;  5J8F A;  5EF6 A;  3IL2 A;  2HDD A;  3CLQ A;  1DGW Y;  4HG2 A;  4L9T A;  2JRT A;  1GDT A;  4C3J J;  1HKQ A;  2E19 A;  1BL0 A;  1X2M A;  2KLO A;  2Z1D A;  4GYG A;  1R22 A;  2VB6 A;  4CCL A;  3KLO A;  3L2W A;  2OC6 A;  3DLL F;  1EH7 A;  1S7A A;  2WAQ N;  4ETS A;  3WOD F;  3HRU A;  2Y0S N;  3QOP A;  4C2M J;  2OQR A;  2WB1 N;  1S5L C;  2ZXH A;  2R5Y B;  1RUN A;  1FYK A;  2V1X A;  3R6S A;  3L2R A;  1WJD A;  3IHU A;  2R3S A;  2R7V A;  3TP0 A;  1C0W A;  2E7X A;  3VB2 A;  3GTO J;  3J81 K;  3KZY A;  4LMY A;  1KGS A;  1LNW A;  1ZKG A;  4G6T B;  3ZRG A;  3LSP A;  4IHW A;  2MH9 A;  3WG7 H;  3H3V K;  2DYR H;  1IRX A;  2JRM A;  5C44 J;  4AID A;  4MFD A;  3WG9 A;  1SAN A;  2O5R A;  4P1W A;  5GPA A;  1NK2 P;  4EGY A;  2A07 F;  1P2F A;  3FIS A;  3PNV A;  4B4C A;  4HZF A;  2UWM A;  2IVM A;  2WAQ A;  4PJN A;  2ME0 A;  3BP8 A;  3PSI A;  4DGW B;  2GQQ A;  2Y0S A;  3K4K A;  2LKP A;  2VI6 A;  2WB1 A;  1X4O A;  4M3G A;  2O8X A;  4RGX A;  2O03 A;  2NRA C;  2V1D A;  5LHI A;  3FIW A;  3K70 D;  2OPT A;  2VBW A;  1IO2 A;  3OYN A;  2VQC A;  4RAG A;  4ZYA A;  3AG3 H;  1F4K A;  4CA0 A;  2CYY A;  4LB5 A;  3JRC A;  5E1Z B;  3A02 A;  4PK4 A;  2IS6 A;  2P5V A;  4BEH A;  3HC7 A;  2MG4 A;  2LY1 A;  3ZQQ A;  2NS8 A;  4EAT A;  3K4J A;  3CUQ A;  2Q2E B;  5JHU A;  1U5T B;  4G6Q A;  1ZTR A;  3IWF A;  1PJR A;  2KIM A;  4RAZ A;  5B66 C;  3LSI A;  4CGZ A;  3PO2 J;  1P6R A;  1JHH A;  2ICW G;  1QO0 D;  1LEB A;  1B72 A;  1BR1 A;  3TDZ C;  1MH4 A;  1Q1H A;  1XSD A;  1D0Z A;  3UR3 C;  1T6S A;  4C3I J;  1QA6 A;  1R23 A;  4A6D A;  2F5C A;  4ZDL A;  2WA0 A;  2W48 A;  2E1N A;  4X0G A;  3GEZ A;  4ABZ A;  4AM3 A;  3HPH A;  2OF7 A;  1YIT I;  4Q47 A;  2DLL A;  2DMP A;  2F5F A;  5HDN A;  1MJB A;  4YEJ A;  1I27 A;  2GBY A;  4B3X A;  4CUG A;  4E6K G;  5JLX A;  4HLY A;  3ABK H;  3ASN H;  5EG0 A;  1PVE A;  5ICF A;  2I10 A;  1ZGA A;  3FBN B;  2YS9 A;  4LOC A;  5IP9 J;  4Z6Y A;  3E5U A;  4I2O A;  5LGU A;  4IKF A;  4JX6 A;  5J4V A;  2K9M A;  1D5V A;  5J1Y A;  4PGG A;  1WH7 A;  1G8X A;  3KEQ A;  1IC8 A;  2EIJ H;  3E6C C;  5LFA A;  4Y7N J;  2MLK A;  3OYM A;  2QSH X;  4NDL A;  5DEQ A;  2FOW A;  1X3Z B;  3FXL A;  4Y52 J;  2E60 A;  2XF6 A;  2IRF G;  3C7J A;  2R7S A;  1Q1V A;  3GW2 A;  3G71 I;  5ICG A;  1B1B A;  3MKL A;  4FX4 A;  3JRF A;  3S16 J;  1LVK A;  4RGR A;  1MGT A;  2E2J J;  1YIO A;  1IXR C;  4GFB A;  2G0E A;  2A05 A;  4PSW A;  2HTS A;  2LBF A;  1Y8R B;  1SFK A;  3D0S A;  1ETQ A;  1YLF A;  5IT9 Z;  4QPO A;  1BW6 A;  2IGN A;  2EFP A;  2WV1 A;  1XG1 A;  2EZI A;  2LKX A;  2EK5 A;  3RDI A;  3ROU A;  3LSJ A;  4PFP A;  1K79 A;  4LJZ F;  1GV2 A;  4BL0 B;  4WX9 A;  1J09 A;  4A0Z A;  2MC3 A;  3LST A;  1XMX A;  3HJE A;  1ZYR F;  5F1R A;  5K5O A;  2IW5 A;  1Z0X A;  1NG7 A;  4HRI A;  3KP4 A;  3HSF A;  1L0O C;  4OOI A;  3OYI A;  1SFU A;  2R7O A;  4DYQ A;  1AKH B;  4FIS A;  3PJR A;  1B8I A;  3VYR B;  3I53 A;  2OD5 A;  1BW5 A;  5LHH A;  2H8W A;  3MQ0 A;  1IV6 A;  3K4B A;  2EIM H;  3HOU J;  3WTT C;  3DTI A;  4I02 A;  3ZQF A;  2VBY A;  1IRZ A;  2IP2 A;  2JJ7 A;  4L5I A;  3H0D A;  5E1W A;  3L1P A;  1HDP A;  4A3B J;  2VJJ A;  4EEF G;  4CZC A;  2YU3 A;  2XPV A;  2V9V A;  2M0M A;  1BI0 A;  1OKR A;  2QUF A;  2XC7 A;  1FBQ A;  1R36 A;  3G1O A;  3OR1 C;  1A35 A;  1AA7 A;  3JTH A;  4CIC A;  2M1B A;  3F8M A;  2A6H F;  5F04 A;  4HAM A;  1TBX A;  2VKE A;  2L3D A;  1D8K A;  3G6E I;  1VI0 A;  4G7O F;  3KP6 A;  4DNC A;  3HOT A;  5BOX A;  3T8T A;  4L5E A;  1LVA A;  3KX2 A;  3LA2 A;  4XBF A;  5J47 A;  1HXD A;  5C4J J;  3E6D A;  3OYJ A;  2EIN H;  2K85 A;  2JWT A;  2Z5U A;  3X2Q H;  3BCB A;  2O3F A;  3IAM 2;  4KN7 X;  5M5X J;  4E4H A;  1IXS B;  3G3Z A;  3BDD A;  2P5L C;  1JXS A; 
#chains in the Genus database with same CATH homology
 3HOY J;  4JP0 A;  4A93 J;  2IEK A;  3LSG A;  1U9O A;  3RKQ A;  1I3Q J;  3WHB A;  2B63 J;  3BG3 A;  4DZP A;  1JT6 A;  1OFC X;  4QIW N;  1PUF B;  1F36 A;  2XGD A;  1WPK A;  3RZO J;  2CU7 A;  2P81 A;  1NK3 P;  2IBD A;  2VPR A;  1QVU A;  1W0U A;  3HOZ J;  2X48 A;  2L7F P;  3FK6 A;  2JA6 J;  2ID6 A;  4IHV A;  1VF9 A;  2K9S A;  3TW7 A;  4JYK A;  5FKK A;  3F0C A;  3MN2 A;  1JUP A;  4FE4 A;  2NVT J;  3HGY A;  1MSE C;  1S7E A;  3QPL A;  1RES A;  3FK7 A;  4I76 A;  4G12 A;  2XSD C;  2X9D A;  1OCT C;  1PUF A;  5EYR A;  1ETY A;  2NOG A;  1JKP C;  2JA7 J;  3HEF A;  3Q3S A;  3W6V A;  3IH4 A;  1DU6 A;  1HF0 A;  3O8G A;  1ETX A;  1W0T A;  4IHY A;  1MSF C;  1FTT A;  1K61 A;  3H0G J;  2VKV A;  1RR7 A;  2E2H J;  3OSF A;  4MIM A;  2FJ1 A;  1JUM A;  1ETK A;  3HOW J;  2EQR A;  4M3F A;  4QSH A;  3TW6 A;  1LFU P;  1QPI A;  5E3O A;  3SFI A;  2XPW A;  2DMT A;  3CDL A;  3E7L A;  3HB9 A;  2TRT A;  3NAR A;  3JRI A;  1JJ8 C;  1ETV A;  3IH2 A;  3JRH A;  4IEJ A;  4XK4 A;  1DU0 A;  1I6H J;  4D7N A;  5M3F J;  2Y31 A;  5IP7 J;  1Z77 A;  4M3E A;  2R7Z J;  1WH5 A;  2LR8 A;  3G1M A;  2DA1 A;  3PM1 A;  3JR9 A;  3BQZ A;  3B6A A;  1MH3 A;  2LP0 A;  3VPR A;  2XGC A;  5IOY A;  3G1L A;  1HDD C;  1OJL A;  5J1R A;  2QCO A;  3HDD A;  2M8G X;  2KDZ A;  5DS9 A;  2LY9 A;  3Q0U A;  1JKQ C;  4W1U A;  4I6Z A;  2MW8 A;  5J1U A;  3I4M J;  2M0C A;  2O7O A;  3BR3 A;  2HOS A;  1P7J A;  3RZD J;  5HOD A;  4FTH A;  5FKM A;  2CRG A;  3S1R J;  3JRG A;  1CQT A;  3GTP J;  2R0Q C;  1LE8 A;  2Y9Z A;  4DYR A;  3BT9 A;  5FKN A;  2O8K A;  2DMU A;  2EZL A;  3LSR A;  5K7Z A;  1AU7 A;  1MBH A;  2MGQ A;  1YRN B;  1AHD P;  2ECC A;  3TP3 A;  2R92 J;  5M5Y J;  1TWG J;  4RDU A;  4BKX A;  4M3D A;  1P7I A;  5F0F A;  2H1K A;  4XRS G;  1Y1W J;  2HXI A;  2L7M P;  1RKT A;  4XID A;  4JX5 A;  5EG0 B;  4UUS B;  1FIA A;  5DTD A;  4D5F A;  4A3L J;  3S2D J;  2ME6 A;  1QRY A;  3FKI J;  2O9L A;  1UMQ A;  2DA6 A;  2R5Z B;  5EEA A;  4A3D J;  1U9N A;  5K7H A;  1IUF A;  1TWA J;  1A6I A;  1IG7 A;  5FJ8 J;  1YRN A;  1LFB A;  4HNV A;  5GPC A;  1MBE A;  2DN0 A;  2Y2Z A;  2ID3 A;  3C2B A;  3SJM A;  3BTI A;  1H8A C;  1FTZ A;  1FJL A;  4W97 A;  5K7F A;  4M6V A;  4FCY A;  2M2E A;  2YU9 J;  3A01 A;  3GTG J;  5IYD J;  1K83 J;  2L7Z A;  3OOU A;  1TWC J;  4UUS A;  2FD5 A;  2Y9Y A;  1R9T J;  5FKO A;  1GVD A;  5FLV A;  3CMY A;  1JT0 A;  5F0C A;  1ZGW A;  1JGG A;  1APL C;  1ZQ3 P;  2R5Z A;  9ANT A;  5JLW A;  3BR5 A;  3S1M J;  2Y30 A;  3DEW A;  2LTP A;  3MVP A;  2DMQ A;  3S2H J;  5BNG A;  2NVX J;  1SFO J;  3HOX J;  3NAU A;  2ELK A;  3BTC A;  4A3C J;  3ZOB A;  2QF7 A;  4XRM A;  2LD5 A;  5EF6 A;  1FEX A;  2HDD A;  5IYC J;  1GDT A;  4C3J J;  2DA5 A;  3A03 A;  2E19 A;  1Y1V J;  4J19 A;  1GT0 C;  1X2M A;  5IP6 A;  1BL0 A;  1HOM A;  5F0H A;  4A69 C;  4IHX A;  2WAQ N;  1ZR4 A;  3JRB A;  3B6C A;  2H8R A;  2JK3 A;  2MSY A;  2Y0S N;  4DZJ A;  1F43 A;  2X6O A;  4C2M J;  2WB1 N;  4AC0 A;  1HLV A;  2R5Y B;  2XPU A;  1FIP A;  2HOT A;  3TP0 A;  4RBO A;  1JKR C;  3GTO J;  3ZQC A;  4IHW A;  1ZKG A;  3H3V K;  3LSP A;  2JA5 J;  1H89 C;  3K2A A;  1POG A;  2XGE A;  1XS9 A;  1WCM J;  2CUE A;  5C44 J;  5F27 A;  4BY1 J;  4MFD A;  1SAN A;  1NK2 P;  5GPA A;  4AUX A;  1H88 C;  1ETO A;  3FIS A;  2E1O A;  4B4C A;  2NVQ J;  3PO3 J;  4BBR J;  2DJN A;  2ME0 A;  1X58 A;  2M9H A;  3IV5 A;  1WGX A;  1XC5 A;  2VI6 A;  1NTC A;  4M3G A;  1MBG A;  2XB5 A;  3FIW A;  2OPT A;  3OSG A;  1B72 B;  2JN6 A;  3IH3 A;  2HI3 A;  1JKO C;  4CYC B;  3QPS A;  1ZK8 A;  1D5Y A;  5EZG A;  5E3M A;  2HXO A;  3JRC A;  2HOA A;  3A02 A;  3LNQ A;  2MG4 A;  3ZQH A;  2LLK A;  2NS8 A;  3BR1 A;  4D7M A;  5EGO B;  2R93 J;  3HOV J;  3M3Y J;  1ZTR A;  3GTL J;  1X2N A;  3OIO A;  1JTY A;  3SDG A;  5EZH A;  3BR2 A;  3BR0 A;  4BXX J;  5IOZ A;  2LK2 A;  4MO7 A;  3PO2 J;  3BQY A;  1B72 A;  4A3K J;  3S17 J;  1MH4 A;  2DA3 A;  4CYC A;  2XRL A;  1I50 J;  4BY7 J;  1IDY A;  4S0H B;  1ENH A;  1QVT A;  1OCP A;  2IAI A;  2K9Q A;  3Q0W A;  4C3I J;  1IJW C;  2NVY J;  2GM4 A;  1TWH J;  2HYJ A;  5EDN A;  2W48 A;  2DTZ A;  2AHQ A;  4ABZ A;  3K7A J;  2OF7 A;  2PMZ N;  2K9N A;  1G2H A;  2DMP A;  3BTL A;  2HQ5 A;  3BTJ A;  4BBS J;  1BA5 A;  3S15 J;  2GBY A;  2L0K A;  3BG9 A;  5JLX A;  3HBL A;  1O4X A;  4B1R A;  5EG0 A;  3O8H A;  3ZQI A;  2I10 A;  1EF4 A;  2YS9 A;  2CJJ A;  4LOC A;  2NS7 A;  5IP9 J;  1GV5 A;  1JTX A;  1UG2 A;  4AYB N;  4JX6 A;  4A3M J;  1ITY A;  5J1Y A;  5FLM J;  1GUU A;  1WH7 A;  1IC8 A;  1RPW A;  1U78 A;  1TWF J;  1JJ6 C;  2DA7 A;  2EH3 A;  4Y7N J;  4MLO A;  4NDL A;  2JA8 J;  2K40 A;  4Y52 J;  3S14 J;  3UKG A;  1U8B A;  1JUS A;  1MBF A;  1Q1V A;  3GTJ J;  3MKL A;  4C3H J;  2DA4 A;  3JRF A;  2N8G A;  3S16 J;  2E2J J;  3D1N I;  5GP9 A;  4GFB A;  1MBJ A;  5IPA A;  4QTR A;  2G0E A;  3GTK J;  2EZK A;  1E3O C;  1IDZ A;  2FX0 A;  1B8I B;  3DCF A;  3S1Q J;  5IYB J;  1ETQ A;  1ETW A;  2KT0 A;  1BW6 A;  1BJZ A;  2CUF A;  4M3B A;  2WV1 A;  3LOC A;  1IGN A;  4A3J J;  1XG1 A;  3RQI A;  1WI3 A;  2EZI A;  2LKX A;  4DYC A;  3LSJ A;  3GBG A;  5F1J A;  1GV2 A;  3HGG A;  2M34 A;  5C4X J;  3CQZ J;  2FQ4 A;  3ZQG A;  3BG5 A;  3QQA A;  2L9R A;  4FE7 A;  3HKZ N;  2D5V A;  1UHS A;  1T33 A;  2LVS A;  4A3I J;  3TED A;  2LFB A;  1T56 A;  3BR6 A;  4X1E A;  1Z0X A;  4B3A A;  5M3M J;  1MBK A;  3CCY A;  4V2G A;  4DYQ A;  3I4N J;  3S1N J;  1AKH B;  4FIS A;  1B8I A;  2R5Y A;  3M4O J;  4DW6 A;  5J3L A;  1LE8 B;  1BW5 A;  2DMN A;  1VND A;  3JRE A;  1HCR A;  1IV6 A;  5F08 A;  2CQQ A;  4JX4 A;  3HOU J;  2DA2 A;  4UUT A;  2E2I J;  4V2F A;  3ZQF A;  2ZB9 A;  2YUS A;  1IRZ A;  2JJ7 A;  1ZR2 A;  3GTM J;  1RKW A;  1HDP A;  2ECB A;  3L1P A;  4EEF G;  4A3B J;  2XPV A;  4MFE A;  3GTQ J;  1TC3 C;  5M5W J;  2EBI A;  1MNM C;  1AKH A;  2GLO A;  3G1O A;  4A3E J;  1RET A;  2AO9 A;  3ZQL A;  2TCT A;  5F04 A;  4A3G J;  4A3F J;  3Q0V A;  5E3N A;  1A5J A;  2XB0 X;  2VKE A;  1VI0 A;  4L5E A;  1VFC A;  4XRS A;  1ORK A;  2COB A;  5C4J J;  3WHC A;  2JWT A;  4XIC A;  3HM5 A;  2EZH A;  3JRA A;  5M5X J;  2JMW A;  4D5C A;  5FKL A;  5EGO A;  2RAE A;  5C3E J;  2CQX A;  3JRD A;  3A01 B;  4X6A J;  5E3L A;  2VUM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...