1ITYA

Solution structure of the dna binding domain of human trf1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
EKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of a telomeric DNA complex of human TRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords TRF1
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2002-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ityA00
5F0FA 1P7IA 3FK7A 5JLWA 3GTKJ 3RZOJ 1T33A 1WI3A 5IYDJ 3I4NJ 3UKGA 2WV1A 4D5FA 4D7NA 1FIPA 2EBIA 2YS9A 4JX6A 3GTPJ 3FK6A 3BTLA 5IP9J 2X6OA 2EZHA 2DMQA 3G1LA 5IP7J 3H3VK 1VNDA 1JUSA 3OSGA 1MSEC 1QVUA 2DMTA 5M5YJ 1JT0A 3S17J 1TC3C 4NDLA 1YRNA 4M3DA 1OCTC 3BR5A 4A3KJ 4JYKA 4A69C 2M34A 1B72A 1WH7A 1HDDC 2X48A 3ZQLA 1X2MA 5FLMJ 1UMQA 1LE8B 1ZTRA 4S0HB 3E7LA 3B6CA 2YUSA 3HB9A 4MLOA 1JKRC 4CYCB 3I4MJ 4QSHA 5IYCJ 2FD5A 5C3EJ 1ZR2A 3Q3SA 2WB1N 3DEWA 1ITYA 4XK4A 2XPWA 2MW8A 3GTOJ 2GM4A 1WPKA 3HBLA 3LSRA 4XIDA 2VPRA 4AC0A 1ORKA 4FTHA 5EG0A 4XRSG 3BG5A 3HKZN 3M4OJ 1B8IA 1W0UA 3F0CA 2DMNA 2L9RA 3ZOBA 2CU7A 1Q1VA 1ETWA 1I3QJ 3WHBA 2D5VA 3BG9A 1JGGA 4C3JJ 5J3LA 1ETOA 5K7ZA 3VPRA 2JK3A 3HOZJ 3JRGA 3GTQJ 5EGOB 1RESA 3S15J 2M2EA 3NARA 5EG0B 3CQZJ 4JP0A 1ENHA 2MGQA 2L7FP 4DYCA 4A93J 4A3GJ 5FKMA 2COBA 2OPTA 3BR6A 1IUFA 4RBOA 3RKQA 3ZQCA 2JJ7A 1IJWC 3OOUA 2HOAA 4JX4A 4L5EA 1PUFA 2IEKA 3LOCA 1MBFA 2NVTJ 1QVTA 2NS7A 2PMZN 3JRCA 2LKXA 2JA8J 1Z77A 2Y9YA 5EGOA 1TWHJ 2M8GX 3BR0A 3ZQHA 5IYBJ 2CJJA 2KT0A 1S7EA 2LY9A 4XICA 2IAIA 5GPCA 1POGA 3PM1A 3HOYJ 2DA5A 2XSDC 1FEXA 4D7MA 3RZDJ 1W0TA 3MN2A 2R0QC 1RR7A 2EZIA 2M0CA 1ETKA 2MG4A 1OJLA 3CCYA 4C3HJ 2I10A 3GTGJ 5FKLA 4A3JJ 1Y1VJ 2XPUA 2ID6A 4HNVA 3GTLJ 1BW5A 2DA1A 4B4CA 1LFUP 1TWAJ 1WH5A 4IHVA 3HGYA 1JTYA 2LD5A 2ME6A 4FISA 3GBGA 5GP9A 2DMPA 1TWGJ 3B6AA 1AKHB 1EF4A 4UUTA 2O7OA 3TP3A 4W1UA 4MFEA 1FIAA 1DU6A 2KDZA 4FCYA 3S1QJ 1ZGWA 2B63J 3BQZA 5F0HA 5M5XJ 5DS9A 3S1NJ 5BNGA 2VKVA 5C4JJ 1WCMJ 5F08A 2HXIA 3S1MJ 4IEJA 5FKOA 1A6IA 1GUUA 2MSYA 1U9NA 4BY7J 5K7HA 4A3CJ 4QIWN 2NVXJ 3JRFA 2R5ZB 4M3GA 3FIWA 5C4XJ 1PUFB 1MBGA 4B3AA 3D1NI 3BR1A 3JREA 1JT6A 1APLC 2E19A 1GDTA 4FE7A 2FJ1A 2K40A 1JJ8C 3WHCA 1R9TJ 1XS9A 5EEAA 2R7ZJ 4MIMA 2ME0A 1F36A 3BT9A 4LOCA 1MNMC 3K2AA 3G1MA 3L1PA 4JX5A 1D5YA 5K7FA 3JRDA 3O8HA 1FTTA 1VF9A 2HDDA 2X9DA 3A01A 3GTMJ 5J1UA 3IH2A 2E2HJ 1B72B 2HYJA 1A5JA 3HM5A 2N8GA 2ECBA 3HOUJ 1I50J 1QRYA 1JJ6C 5IOYA 5E3MA 3ZQGA 4XRSA 4A3EJ 1T56A 2JA5J 1AHDP 2R5ZA 4W97A 2G0EA 4B1RA 1NTCA 3CMYA 3Q0UA 4V2GA 2W48A 1XC5A 3FKIJ 2LR8A 5EZGA 4C2MJ 3ZQFA 2Y30A 5IP6A 4IHYA 2VKEA 1JUMA 1JUPA 1X2NA 3H0GJ 4DYRA 1ETXA 3A02A 3CDLA 2QF7A 1BL0A 5EZHA 2H1KA 3QQAA 4ABZA 1X58A 1MH3A 3IV5A 2LLKA 2NS8A 3Q0VA 2EZKA 2DN0A 2FX0A 2Y31A 3LSJA 5M5WJ 1QPIA 2K9NA 4A3FJ 1MBEA 1ETYA 1FJLA 3ZQIA 2E1OA 2NVYJ 2DA3A 4A3DJ 4I6ZA 2R92J 2DA6A 3FISA 4DZPA 2XB0X 3HEFA 1CQTA 1H89C 3SFIA 2GBYA 4UUSA 5DTDA 3DCFA 5E3LA 3QPLA 1U78A 2R5YB 2EH3A 3Q0WA 1AKHA 1LFBA 5FKKA 5HODA 2Y2ZA 2TRTA 3W6VA 2IBDA 2NOGA 3IH3A 2QCOA 2P81A 2K9QA 1AU7A 1ZKGA 2JWTA 3LSGA 3QPSA 1JKQC 1GVDA 2DA4A 3JRBA 1B8IB 2HOSA 3MKLA 1MBHA 1ZR4A 1YRNB 5GPAA 4V2FA 4A3MJ 5F27A 2HXOA 1BA5A 2AHQA 3NAUA 1E3OC 5F0CA 2RAEA 1IDYA 4M3EA 4D5CA 1HF0A 2O9LA 4IHWA 2DJNA 2ELKA 2DTZA 3GTJJ 5IPAA 1RPWA 2AO9A 5FLVA 1GV2A 2CUFA 2GLOA 3BQYA 1GV5A 1K61A 1ETQA 1IRZA 3OIOA 3S14J 3OSFA 4EEFG 1UHSA 1DU0A 1FTZA 5J1RA 5F04A 3TEDA 2H8RA 2L7ZA 2XB5A 5EDNA 4Y7NJ 1JKPC 1VI0A 5FKNA 3A01B 3BTCA 1NK2P 3PO2J 2HOTA 2XGCA 3TW6A 1IG7A 1I6HJ 1HDPA 5E3OA 4M6VA 1H8AC 4G12A 2L0KA 3O8GA 5JLXA 2VI6A 4BBRJ 4M3FA 2K9SA 4X1EA 1HOMA 2Y9ZA 2JN6A 3PO3J 2XGEA 4BXXJ 9ANTA 1OCPA 3G1OA 4BY1J 2LFBA 2JA6J 5M3MJ 1RKTA 1UG2A 2CQXA 3IH4A 3HDDA 1LE8A 1MBKA 4BBSJ 4QTRA 1XG1A 2ID3A 2WAQN 5EYRA 3HOWJ 3TW7A 2ECCA 3HOVJ 1U8BA 2LP0A 1U9OA 2EZLA 4J19A 5C44J 5FJ8J 1BW6A 4X6AJ 2ZB9A 3RQIA 5F1JA 1RKWA 1NK3P 1HCRA 4Y52J 1IDZA 3S2DJ 2XPVA 2FQ4A 3LSPA 3HGGA 1SFOJ 5EF6A 1JKOC 2JMWA 4AUXA 1P7JA 1TWCJ 1IV6A 5IOZA 2CQQA 4DZJA 4GFBA 1OFCX 1Z0XA 3S1RJ 3S16J 2YU9J 1BJZA 2LK2A 2CRGA 3BG3A 3JRHA 2LTPA 2TCTA 3JRIA 2VUMJ 3JRAA 1VFCA 1ETVA 1ZQ3P 1IGNA 3HOXJ 2CUEA 4DYQA 4FE4A 5J1YA 4A3LJ 1F43A 3BR2A 1JTXA 2HQ5A 1RETA 3A03A 2NVQJ 4A3IJ 4RDUA 1K83J 2EQRA 4A3BJ 4XRMA 2E2IJ 3TP0A 3MVPA 1GT0C 3C2BA 1Y1WJ 3BR3A 3K7AJ 4MFDA 2OF7A 4MO7A 4BKXA 2DMUA 2M9HA 2Y0SN 1MSFC 2R5YA 1G2HA 4AYBN 2R93J 4C3IJ 2XRLA 1SANA 3LNQA 1WGXA 2L7MP 1IC8A 2E2JJ 2XGDA 1MBJA 1TWFJ 4I76A 3S2HJ 3SDGA 4UUSB 2O8KA 3M3YJ 1ZK8A 3BTIA 4IHXA 3JR9A 4DW6A 1O4XA 1H88C 1HLVA 2DA2A 2HI3A 3BTJA 5E3NA 2LVSA 4CYCA 2JA7J 4M3BA 1MH4A 5M3FJ 2DA7A 3SJMA
chains in the Genus database with same CATH superfamily
2HVRA 4BNCA 3K4JA 1T33A 3I4NJ 5GAHJ 3UKGA 1IN6A 5BS6A 3J81K 1WI9A 1W5CC 3E6BA 1FIPA 3PNYA 4N0BA 3A2KA 3J80K 1EV7A 2VN2A 3WU2C 5IP9J 3K10A 1LNWA 3FBIB 1B59A 4C30A 1MJBA 2JUCA 2EZHA 1QU3A 2D45A 3S3OA 2VOPA 4JOMA 1LJ9A 3H3VK 2K86A 3WTVC 3KLNA 4IOCF 1JUSA 2OCEA 4S04A 4O3MA 1HSTA 3DTIA 1U5TA 1R1UA 2DMTA 2WA0A 4YFKF 2XROA 3GO5A 1S72I 2GXGA 2XGXA 1R58A 1VQOI 3X2QH 2LKSA 5JVTA 1YRNA 5DUKA 3FM3A 3V7RA 2A07F 2O61A 1R5HA 2DPDA 4PFPA 2IPQX 1V55H 2M4KA 3LSKA 3PFYA 3LFKA 4XLNF 4IQ4A 3VB2A 4F52A 2X6XA 1BM9A 3VYSB 1D0XA 2PMZA 4FHTA 4L9JA 4L5IA 3N05A 3HC7A 4XN3A 2K9MA 1UCRA 1DPRA 3W6JB 5C3EJ 2L02A 2CMPA 2WB1N 2DT5A 3DEWA 1FBSA 2KRCA 3GTOJ 1X3ZB 4GGGA 1WPKA 3HBLA 5KCMA 3JAMK 2DI3A 3VSLA 3RYRA 1ZAOA 2E71A 5K5RA 4EJUA 5LLQA 2K9LA 3T5XA 4AU7A 1Y0NA 2O5RA 2PJPA 1IXSB 2DMNA 2KJCA 2L9RA 3DBHB 3IRQA 4PGGA 3ZOBA 3CJRB 1PJRA 1TQPA 2ZJPF 4HNTA 2K4BA 2DCEA 2XAGA 3LSMA 3WHBA 4ZYHA 1OMIA 1B9MA 2BY2A 4UB8C 5K7ZA 1YJ9I 1UFMA 4HX8A 3H3ZA 3LFUA 4G6TB 1G3YA 4PSWA 3R61A 3SZPA 2JK3A 5DEQA 3JRGA 4B3XA 1Z3YA 3HOSA 4M72A 2DU9A 3S15J 4PFOA 2ZXWH 1J5YA 1XMAA 3QODA 4JP0A 3AKZA 3AAFA 2FBKA 4A6EA 2ETHA 3CUOA 3K4MA 2XUBA 2COBA 3KP7A 3GFJA 2A6EF 2IA0A 2M5WA 4E7JA 2Y69H 3OOUA 2HOAA 4JX4A 1PUFA 1IRXA 3C7JA 4MTDA 3JRCA 2LKXA 1SVLA 2Y9YA 4L0YB 3U2RA 4F92B 1STZA 1XSVA 2CJJA 3B02A 1NG7A 2W85A 1S7EA 5TRDA 3TOBA 2IAIA 1Y0UA 3W2AA 4ITVA 4NC8A 1TQIA 5KHDA 4YIFA 4LLLA 4BQOA 4WF2A 4YIIA 3IAM2 3MN2A 5IT9K 4YIRX 2MG4A 2BGCA 3CCYA 1WRJA 3MZYA 4OAYA 4RB0A 3D5LA 5FKLA 5FD6A 2HQRA 3CTAA 1Y1VJ 4BU2A 1BR2A 1HKSA 2VE8A 2PX9A 2VASA 3KEQA 4HNVA 1OYYA 4B4CA 4D9JA 2FUG2 1KA8A 2X1DA 1TWAJ 3ERMA 2WAEA 5E1ZB 2DFEA 3NRVA 2DMPA 1TWGJ 1U2WA 3SDBA 1HXDA 3LWFA 2DLLA 2BBYA 2XAQA 4FCYA 1B9NA 3S1QJ 1BOBA 1DQUA 4FX0A 2B63J 4XN0A 2R7QA 2MC3A 2NAZA 5M5XJ 1BN5A 2VC1A 2WTEA 4IRHA 1WCMJ 5A2QK 3P9KA 2KZVA 2UUZA 2FF4A 4G7OF 3L2WA 1A6IA 3T0YA 2MSYA 3HSRA 2QUFA 3U1KA 4A3CJ 4QIWN 2NVXJ 2R5ZB 2BZTA 2RKHA 3FIWA 1R7JA 2XF6A 3IAS2 3ABLH 3KP6A 2R3SA 1IZ1A 4I09A 5H2FC 5LD2C 2VPLA 5C4XJ 2LY1A 4XONA 3QPHA 3F6OA 3MZ8A 1JT6A 2OBPA 5E8IA 3CJNA 2W7NA 4Y13A 2FJ1A 1G3TA 4PSXA 4P9FA 2MH9A 3G3ZA 5EEAA 2F2EA 3K2AA 2V9PA 5LEJA 3L1PA 2W4SA 2E34A 4PUSA 1KYWA 3JRDA 1FTTA 3M8JA 1OQYA 3DPLC 3CF2A 3J7YJ 3A01A 2L9VA 3DP7A 5HDKA 1PP8F 2F4OB 1IO2A 2BE5F 4CUGA 2WB1A 1BC8C 5IT9Z 3V8JA 5TISC 3KLOA 4MQ9F 2A6HF 3JCUC 4AM3A 3ZQGA 4XRSA 5E79C 2R5ZA 4B1RA 3HTSB 2L3DA 2ZJRF 1V5FA 1XC5A 2LR8A 4G94A 5EZGA 3ZQFA 3JSPA 2E1CA 1YE9A 2Y0MA 2F6CA 3OYBA 5DDGA 1ETXA 3A02A 3CDLA 3M07A 3CCMI 5EZHA 4AIKA 4XSZF 1O3QA 3PQKA 2QSHX 2NXNB 4OINF 2LLKA 1R1VA 4C2TA 4RAGA 4D1QA 3E5XA 3KEOA 2FX0A 4WXCA 2L4MA 3FF5A 4RGRA 1QPIA 2K9NA 1MBEA 1ETYA 3TDUC 2H94A 2E1MB 2FOWA 4UXNA 3G71I 5D5UB 2VONA 3DEUA 2DT6A 3ECOA 3I54A 3FISA 4KT6A 3K6GA 4DZPA 2XB0X 3HEFA 1CQTA 1H89C 1D8JA 1C0WA 2GBYA 3QWLA 4A12A 3E3VA 3DPUA 5E3LA 4GYIA 1I1GA 2A5WA 5HLHA 4HDUA 3Q0WA 2A5YB 1V54H 1AKHA 5HODA 2Y2ZA 2UXNA 5ILUA 4BQAA 2TRTA 3RQ4A 1A6QA 1WWXA 1I5ZA 2DODA 4B8XA 5IT3A 2JWTA 3LSGA 3TOAA 3F9KA 3ML6A 3GFMA 5JI6A 2EIJH 2GA2A 3JRBA 1B8IB 2HOSA 2CUJA 2IA2A 4GYGA 1VZ0A 2H1LA 2LG4A 3PNTA 2EJRA 5CLSA 4A3MJ 3WG9A 2XDVA 2AXLA 3NQOA 1LVAA 3KE2A 3VWBA 2V4JC 2E5NA 5D8LB 1SFKA 1Z21A 2H6BA 3NAUA 4M3EA 4KN7X 4D5CA 3V8LA 1SD6A 4IL6C 3OS1A 5LGUA 3D5RC 2L01A 1SFEA 1ZHFA 3M1CA 2AO9A 2CUFA 2GLOA 4PCQA 1FY7A 1O7FA 4BQNA 1K61A 1ETQA 1XMXA 2ZSHB 3OIOA 5CQGA 3S14J 1IRZA 1QA6A 4HF2A 1B6AA 2KQRA 4EJVA 2BY3A 4BACA 2K4JA 5LRRA 4E7HA 3F8CA 2O6GE 4B47A 3I9V2 4XKWA 2H8RA 3L7WA 5EDNA 1YIOA 2MC4A 4ZDPA 3F8MA 1A04A 2WADA 3KCCA 1TL8A 3PO2J 2IGOA 2PMHA 3OYMA 2HOTA 2XGCA 4KUMA 2M87A 4M6VA 1H8AC 1A36A 2F5VA 3OYFA 1WHUA 2P5VA 1XB4A 3CCUI 3DKXA 4UUVA 2DXIA 1N78A 4X1EA 2LNBA 3IP4B 1S29A 3W2VA 3QPTA 4BJTA 4BS9A 3ERED 2R7DA 1P6RA 3KP2A 1IRGA 2DQLA 2LFBA 2JA6J 2XHKA 1PDNC 3CJQB 1WJFA 1UG2A 1M1EB 2QQ9A 1I39A 1VQKI 2PEXA 1RNLA 2K85A 3F23A 2LDUA 2K3PA 1PVEA 3CC7I 1MNEA 3BROA 2WAQN 2L54A 1VQNI 2DTRA 3QRFF 5K5OA 1U8BA 1FBQA 2DYRH 5LEKA 2B0LA 4E7ZA 1W36C 4E6KG 1RUOA 2ZXIA 2EV5A 3VYRB 1KQ8A 3GZ5A 4Y52J 1YOVB 3ECHA 4ENJA 1IDZA 3S2DJ 3K4BA 1SFOJ 5EF6A 4ESJA 4Q47A 1I6XA 4BDZA 2XASA 1R6RA 5IOZA 2CQQA 4HQMA 4N9HA 3CF5F 3L00A 1OFCX 4ESFA 5K1YA 1BJZA 4IJAA 5HVQC 3GVAA 1QZZA 2IJLA 3CD6I 2BEOA 3G6EI 1OCZH 2ZBKA 3BLYA 1J9IA 1ON2A 2GZWA 1XCBA 1ZARA 1IGNA 2CUEA 1KGSA 5IY5H 4JQFA 3P7NA 1FSEA 3DBLB 3FXRA 2W84A 1K79A 4FE4A 4NQWB 3BR2A 1JTXA 1LKXA 3P5JA 2HQ5A 1MMGA 5HDNA 4HPQA 1MDMB 3HKZA 2EWNA 3T8TA 2XRNA 2EA4A 2BVLA 5J4YA 3OOPA 1H9GA 3TP0A 5J8CA 1KZHA 1R23A 3K7AJ 4MFDA 4PJNA 2UWMA 1WJEA 2M7AA 4L9NA 3KFWX 3F3XA 3V42A 2QSGX 1G2HA 2O3FA 2A69F 4BHCA 4AYBN 3LNQA 3S3MA 4CDGA 2E2JJ 4YEJA 5D4SA 2ZMEA 4II3A 1S3JA 1W5SA 1MBJA 2MFZA 1Z6TA 2R7SA 1R4MB 3DFGA 4B44A 5F1RA 3VODA 2O8KA 4RLQA 2ZMEC 2BYVE 3CO6C 2HI3A 5BOXA 5HS8A 4CYCA 3ZMDA 2FNAA 5L3FA 1BI3A 3ZRGA 1MH4A 1XX5A 3F72A 2OUMA 5LGTA 1IUYA 3SJMA 3MEXA 3E5QA 3QP5A 3MZHA 5JLWA 5HDGA 1N75A 2QQBA 4R1HA 1WI3A 4EV0A 4FETA 3FHZA 3CCQI 1X1AA 2WV1A 4D5FA 1FOKA 1IN4A 1WJAA 2KIQA 2V9VA 3K9TA 4JX6A 3GTPJ 4JK1X 2KMUA 4EQQA 2HVQA 1OR7C 4MTEA 2PJRA 2JA2A 2DMQA 3G1LA 2IW5A 1BOAA 3K4NA 3JTHA 1CF7B 2VKDA 4Y33A 3HTUA 3W3CA 1VNDA 3J80Z 4F91B 1X1CA 3L9FA 1MSEC 5E1WA 2BXYA 3HUGA 5KAIC 1LDKB 1QVUA 1HA8A 2GXAA 2X1EA 5LRSA 3LSIA 5E17F 4FT8A 3K1NA 3U1DA 2M45A 2HNHA 1T98A 5LHGA 4NDLA 2P4WA 4CYDA 2I5UA 1OCTC 3BR5A 3R0JA 5FGMA 2D1HA 4ZC3A 3ZMZA 4H4KC 3S8PA 4HQEA 2QLZA 1K4TA 3PL8A 4RLFA 5CPRB 4V19K 4R8HA 3S93A 5GAEJ 3WTTC 1LE8B 1ZTRA 4S0HB 4XLPF 1SD4A 5FD5A 1X1DA 3CLOA 4C2UA 1D0ZA 3SYTA 4LB5A 3I4MJ 2ZO4A 2FD5A 1Y39A 3Q3SA 1WJDA 2WAFA 3H9GA 3CMAI 3EETA 4CCJA 1KU3A 2R7TA 4XK4A 3GEZA 4F93B 3LA7A 1U5TB 2QQAA 4F7ZA 3LSRA 3CC2I 4E7IA 2JZYA 1MMDA 4QPQA 5FB2A 3AG1H 3IWFA 4XRSG 5EG0A 3BG5A 2HPIA 2QENA 3M4OJ 1B8IA 3F0CA 4R79A 3EYYA 1W7PD 2CU7A 3RPUD 5DCMA 2R7UA 1T6SA 2HZTA 2F5DA 3AL0B 3O3KA 2IGMA 2OTLI 3CJTB 1GLNA 5D4RA 4IO9F 3G73A 3FXJA 1DDNA 3HPGA 1XDSA 2KIMA 4BJ6C 1VQ8I 1R5ID 4M71A 5ICCA 4KISA 4YFNF 3K0LA 3AG3H 3CQZJ 3SXYA 1F9NA 2MGQA 1T8IA 4DYCA 4A93J 4A3GJ 1L3LA 3OY9A 3LSTA 4MEYF 5FKMA 1IUFA 3RKQA 4A5NA 3H1CA 3ZQCA 2JJ7A 1IJWC 2HOEA 5DD8A 4L5EA 5CKTA 4WXDA 1XSDA 1QVTA 1T0FC 2JA8J 1Z77A 5HLIA 3QYEA 1LEBA 1TWHJ 2VC0A 4ZDLA 3OYCA 1Y8RB 3ABMH 3K69A 2KT0A 2KFDA 4RM2A 1HKTA 2HKXA 4ON0A 1HKQA 1POGA 2DA5A 3RTRA 2XSDC 1LPQA 2X0LA 1TW2A 3WTUC 2TDXA 1YS6A 3IWZA 3RZDJ 1W0TA 1SEUA 2HTJA 2KRHA 2R0QC 3CC4I 2EZIA 2YSRA 1OJLA 2BW3A 2JPBA 2HDCA 1KU2A 2Z16A 4HX7A 2OCCH 1YW7A 2I10A 3QAHA 1IXRC 3H9JA 5E8GA 3H36A 3WTXC 2KHMA 2ID6A 4KNYA 3GTLJ 1BW5A 2DA1A 1ZRDA 1LFUP 2LY2A 3GFLA 4U87A 4BE2A 2WY8Q 3TQNA 1JTYA 2ISZA 4J00A 3E1SA 2ME6A 4FISA 4HSTA 5KVRA 3GBGA 1SC7A 3B6AA 4RGXA 1EF4A 3IL2A 1JXSA 2VJ4A 4MFEA 1FIAA 3FXOA 5J40A 1DU6A 3KYCB 2HU9A 1T38A 3OR2C 4ZYGA 1ZGWA 1X3WB 3DQVC 2F5CA 2WAQA 4PJ0C 3S1NJ 2PMUA 1IN7A 5F08A 1TNSA 5FKOA 2VQLA 3I3LA 3I0TA 4Y4RA 1V4RA 1T95A 5DM7F 3KYLA 3GXOA 4UHTA 3OR1C 1SAXA 3DLAA 3DU5A 4CCLA 4OU0A 2MA3A 1NG6A 1PUFB 3JW4A 4B3AA 3EQLF 3Q9VA 1APLC 5H6QA 1X4PA 4FE7A 4CSWA 1JJ8C 1R9TJ 4OIPF 2LH9A 1RIOH 2ME0A 1P2FA 5CVUA 3IC7A 2LREA 2JVHA 3DEEA 5K7FA 4LJZF 2F48A 2X9DA 3GTMJ 1ONVA 3BG6A 4IVNA 5H6RA 3VYTB 3U21A 1B72B 2HYJA 4KMFA 1R5GA 4PJJA 3HOUJ 4XL9A 1YS7A 4G9YA 4HF1A 1I50J 2G7UA 2L4AA 1JJ6C 5E3MA 1EH6A 2H8WA 2QQ8A 1PUEE 1T56A 2JA5J 1WZ2A 2HQAA 4W97A 2G0EA 3LQQA 1NTCA 1U6GA 3NEUA 4HV6A 4IPAA 3V7CA 3Q0UA 5BPDA 4V2GA 2W48A 4OOIA 1W36D 5LBQA 4BYYA 2ZXHA 2Y30A 5IP6A 4IHYA 4M6XA 3RPUA 1JUMA 1X2NA 1TW3A 3H0GJ 2OZUA 1BL0A 4ASNA 4ESBA 3QQAA 1MH3A 3Q0VA 2EZKA 1BBYA 2IXSA 3RJPA 2Y31A 3LSJA 5M5WJ 2J5PA 1K7AA 2EIKH 2BHYA 1R71A 3LAPA 1KU7A 2OTJI 1FZPB 1D1CA 1G3SA 3LAJA 2DA3A 2R92J 3I53A 1HBXG 1RZ4A 2NNNA 3H5RA 3SFIA 4RAFA 5HOOA 1Z9CA 3EUAA 3L2QA 4M73A 4CCNA 2R5YB 1BI0A 3WGIA 5FKKA 2NNYA 2JT1A 2YR2A 2JSCA 2GA1A 2IBDA 3IH3A 1SFUA 3L09A 4P1WA 2K9QA 1EH7A 4ETSA 3PIPF 1D1BA 4O6JA 3GLXA 4AIHA 4CZCA 1YW8A 2FBIA 1SD7A 1JKQC 2B9SA 3P9CA 2DA4A 3GCMA 2R7RA 1ZR4A 4HF0A 1OCCH 2GWRA 3HRUA 4IHTA 2HXOA 5J8FA 5DV5A 1BA5A 1W7PA 2DW4A 2AHQA 5E20A 1IRFA 3T8RA 2EFQA 2IS4A 2DFFA 5LHIA 2RQQA 4L5JA 1RC9A 1Z05A 2LRDA 2D1VA 3BQYA 1LDDA 5CVIA 2AQFA 1ZGJA 3I5UA 1FP2A 4Q5SF 4UB6C 2NOJB 3DU6A 2O0YA 1DU0A 4N4OB 4BUPA 1V5GA 3ZR8X 3KP3A 5F04A 1MNDA 2WY7Q 3TEDA 1LDJA 2P0WA 1W4MA 1X1BA 2HGCA 1SMYF 4IF4A 2ZJQF 4OIOF 1EJ9A 3LSHA 3PIOF 2STWA 1P4XA 4OWRB 3MKYB 1S9HA 2L9SA 2HEOA 3PFIA 3K1PA 4U7BA 1IG7A 1I6HJ 5E3OA 2ZFWA 2BY1A 4ZJZA 4UV9A 2QGUA 3DWLE 2BOLA 5JR3A 2VI6A 4BBRJ 2FEZA 4KIGA 4M3FA 4IKFA 2K9SA 1HOMA 2Y9ZA 2MBFA 3KP5A 1GXPA 3OWTA 9ANTA 3G1OA 5CVVA 2RN7A 1YLFA 1ZG5A 2EINH 2Y48A 3R0AA 5J4VA 3RKYA 3R60A 4EM2A 3K4LA 1LE8A 4WCGA 1T0FA 1YX5A 4IHSA 4CGZA 1XCVA 3O6BB 5LGNA 1VQ9I 2EK5A 2IA1A 3COAC 4RM3A 4LG3A 4Z2YA 3CDHA 4J19A 5C44J 3OV8A 3QP6A 4N9IA 4BE0A 1BW6A 3IKVA 2ZB9A 4KFCA 2OZ6A 4CH7A 2QA4I 2DT7B 2EFWA 4UY8I 2P6SA 3LSPA 1B4AA 3GWZA 1K6OA 3HGGA 1WJ5A 1JKOC 1R1TA 4AUXA 1P7JA 1IV6A 1DP3A 2Z3YA 4P55A 2HYFA 1W5TA 1XGNA 2HZDA 1J0RA 5CVRA 5D5WB 1Z0XA 2KP6A 1BC7C 1HQCA 4XLCA 2LK2A 1OISA 3BG3A 3JRHA 2RDPA 3TGNA 2IRFG 2PJRB 1ULYA 4F3QA 4KITB 3EDPA 2VUMJ 3JTGA 4EMSA 5J6XA 1ETVA 2V6EA 2OQRA 3WODF 3OS2A 2PBIA 3ESWB 5JHFA 3CCSI 2P6TA 1UJ8A 2GOMA 5J1YA 1F43A 1CGPA 2XAUA 2VT3A 3CESA 4HNUA 4BDYA 4LK1F 4S05A 2NVQJ 4A3IJ 3A0HC 1VQMI 4UVCA 4RDUA 2V79A 4HV5A 1G3WA 2LBFA 5CQEA 4AIDA 1Z7LA 3ZMSA 3QOEA 4A3BJ 1TT5B 2E2IJ 2GAUA 4NHJA 1Y1WJ 2X4HA 4XNFA 2M0MA 4II2A 4WX9A 2ICWG 2DMUA 2M9HA 3D5SC 3NWTA 5BMZA 1O3SA 1VQ6I 2MH2A 3LMMA 3NWSA 1SANA 2Z9OA 1IC8A 2XIGA 2XGDA 4FQGA 1TWFJ 1E3PA 2O03A 3S2HJ 3SDGA 4UUSB 1Y8QB 3ABKH 1FMWA 4IHXA 2K5CA 1ACIA 4DW6A 1H88C 1E3HA 3BCAA 2DA2A 2Y75A 3BTJA 4YELA 2V7FA 5H20A 5B1BH 5KK1A 5FROA 4AVZA 3ZQ7A 4LK0F 4CCOA 3BPVA 2JA7J 2X6YA 1RRJA 2EILH 3UNGC 5F0FA 3RDIA 3FK7A 3RKXA 3GTKJ 2L2OA 3H35A 4HAMA 4G7HF 4MQVA 3BJAA 4D7NA 1ZLJA 3PUFA 2EBIA 2YS9A 2X51A 4L9TA 4E7LA 2X6OA 4A0YA 2AS5F 2CS3A 2VODA 3KYDB 2MD5A 1ZG1A 1D8KA 4PK4A 4DBQA 3OSGA 4ZYDA 4B09A 2Q2EA 2OJED 3DBRB 4IOAF 4ENNA 3U9GA 2V1NA 1HW5A 4LGWA 1TBXA 5CVJA 2YPRA 1WJCA 2GIZA 3OYGA 5FLXZ 1TC3C 1VQ7I 3S17J 5TGTA 5FLXK 3OYLA 1Z91A 5DCFA 1ZRFA 4M3DA 4A3KJ 4JYKA 2LOOA 1IN8A 4A69C 2M34A 1VQLI 2CW8A 3BP8A 3F6VA 3L2RA 4XLHA 5ED4A 3CUQB 2Q2EB 4L0ZB 1SAUA 2JVGA 4I98B 4DQ2A 2RQPA 3LA3A 4RGSA 4UVAA 2E35A 1H0MA 3DXJF 3HHHA 3E0JB 1K4SA 3QU3A 2MLGA 5IYCJ 2B7EA 1ZR2A 1R00A 3M1EA 3CCVI 1YO5C 1ITYA 1REPC 3SZTA 4KICA 4M9SA 4U88A 2GM4A 2CV1A 2DJIA 4XIDA 3ZQQA 2K02A 2X1CA 1ORKA 4LIUA 1I27A 2W1OA 2CUZA 2JUGA 3HKZN 3AFHA 2RREA 2FRHA 3BCBA 2PQ8A 4KJZA 4PGHA 5L3BA 4LD5A 3WU0A 4X0GA 1LVKA 4NBQA 1MIJA 4Y17A 1ETWA 4HLXA 2D5VA 1JGGA 1E0EA 4C3JJ 3AG2H 5FFXA 5J3LA 3I59A 2BY0A 1VQ5I 1P92A 5L3EA 3QU6A 2VJ5A 2E5ZA 5JHUA 2IVMA 2XC7A 4EJTA 3GTQJ 2QKMB 2FMYA 5EGOB 1KQ0A 4BQQA 5ICEA 4K2EA 3ZP5A 2PFBA 1ZN2A 5HS7A 1OLTA 4E4HA 5EG0B 3PNVA 1ENHA 4RS8A 2XAFA 1KU9A 2DBBA 2L5QA 3K4CA 2H6CA 1HW2A 4RBOA 1B1BA 4TV7A 5JFRA 4LG0A 2DOAA 4HLYA 1MDMA 2IEKA 3OS0A 2NVTJ 1TZLA 2PMZN 3CCEI 3H5NA 5EGOA 3BR0A 3ZQHA 5IYBJ 1I1SA 2LY9A 4XICA 5F64A 3QYFA 1JHFA 4Q48A 4XRFA 1K78A 4ZDOA 4D7MA 3RIRA 1RR7A 2M0CA 4C3HJ 1A35A 1TQMA 4HW0A 3GMEA 4RMNA 5EEHA 4A0ZA 1WH5A 2M30A 3HGYA 1XTAA 1WFXA 2MLKA 4HEA2 1O3TA 2EPFA 5AONA 3EPZA 2ACJA 3CMMA 1UZCA 5GP9A 1X4OA 4Q4ZF 2VBZA 4UUTA 2O7OA 3TP3A 4W1UA 3TO7A 1KQ9A 2ZNZA 2YX7A 4PJLA 4XMYA 5BNGA 2VKVA 1MKMA 2PLYA 1GUUA 2CYYA 3FMQA 4P9UA 1R36A 3GUDA 1U9NA 3ONQA 4PDKA 4BY7J 5A2QZ 4A2UA 4EM0B 4AD9A 3GF2A 5K7HA 3JSOA 2CQNA 4M3GA 4GO1A 1P9QC 3JAMZ 1LEAA 3BG7A 2BW3B 3DPTA 4ENMA 3BR1A 3JREA 1ZYRF 2P7CB 2EFPA 2YX4A 2CQKA 2E19A 2K40A 2F4MB 1BJAA 1F36A 3BT9A 4LOCA 4E70A 1MNMC 2IP2A 4QPOA 5CYVA 1J2XA 3MWMA 3ZPLA 5D6FA 3TO9A 1D1AA 1D5YA 1DP7P 3FWEA 1V3FA 1XN7A 3O8HA 2R7XA 4Z6YA 1FOYA 1IW7F 1W1WE 4WXHA 3RI4A 4ZZLA 3K70D 1RUNA 3IH2A 3M7GA 2GOXB 5ERIA 2E2HJ 5B1AH 3HSFA 5GTIC 2N8GA 2ECBA 4B43A 3J7AY 2OA4A 5D6EA 1QRYA 1YJNI 5CJ9A 2RNGA 2KLOA 4HSRA 4KT5C 4RAZA 4A3EJ 2HYGD 4YRVA 3CP2A 3MKZA 3V8KA 1IN5A 2ZJ2A 3E5UA 4KN4X 2VQCA 4B48A 3OYIA 2JQ7A 3FKIJ 1BR1A 3F8NA 1OYIA 4RGUA 4CCMA 1GHCA 1JUPA 4DYRA 1N25A 1R4NB 4CCKA 4XM3A 3BPXA 3HZJA 3S3NA 3WTYC 2OC6A 3FKJA 3KZIC 4AVPA 3IV5A 2NS8A 1TLHB 1USTA 2KL4A 2DYSH 2A68F 2VB6A 4A3FJ 2DFIA 1TP4A 3ZQIA 1Z1DA 1AA7A 4HZFA 3BDDA 3FXMA 1NH3A 1YG2A 2NVYJ 2KPMA 4I6ZA 4MNUA 4H0EA 3ASOH 3M8FA 1MW7A 4XSXF 2VJJA 3HRTA 5DTDA 2E7XA 2G9WA 1U78A 2EH3A 3KEYA 1LFBA 3IUOA 3ZN0A 3IHUA 3W6VA 2NOGA 2QCOA 2P81A 4DGWB 2KJBA 1JGSA 2HVSA 3J7ZI 3QPSA 2OV7A 4CHUA 4UV8A 3C1DA 2W57A 4WWCA 4XKCA 3MKLA 3K70C 2CH0A 3EUKL 3C2HA 1QHHD 5GPAA 2XVCA 1UAAA 2DPUA 3HXLA 2KIFA 3TBIA 4HG2A 2A6TA 5F27A 3OYKA 4NUBA 4A5MA 5F0CA 1TT0A 2RAEA 1IDYA 1HF0A 3PJRA 2X85A 4U0VA 4XKVA 2M8EA 2DTZA 5FRNA 3PSFA 2HDWA 4KDPA 3I4PA 3T1BA 5FLVA 4GCVA 2CO5A 3RYPA 3F21A 4GDFA 2Q0OA 1QGPA 3E6DA 2HR3A 2C6YA 3OSFA 1J59A 1FLIA 2RGVA 1UHSA 2P7VB 3H92A 3I59B 4CXFA 3Q5FA 5GADJ 1SFXA 2FNPA 1FTZA 2CV0A 4IRGA 2ADUA 3K1MA 3N97A 5GAGJ 1JKPC 1VI0A 3A01B 1EKEA 3BTCA 2OD5A 2VBYA 4I02A 1UG0A 3IRRA 2P5KA 3M8EA 2XKPA 3ABUA 4LIVA 3F8BA 2MABA 3OYDA 3TW6A 2E1MC 2XF7A 1OYWA 1HDPA 2R7VA 4G12A 2W24A 5LFAA 5D8KB 2DDAA 1FBUA 2QYOA 1XD7A 4BAYA 2GQQA 1WJBA 2JN6A 1P4WA 5AIPA 3PO3J 2XGEA 3A1YA 1ZH5A 1PP7U 1FNNA 1ZELA 1XPXA 2O8XA 2R7OA 2RC4A 5M3MJ 1J09A 1RKTA 1D0YA 2CQXA 3IH4A 3OIQA 3HDDA 2FMLA 4F55A 1S8NA 1FP1D 1MMNA 1S7AA 4QTRA 3ISPA 1XG1A 4UVBA 4EGYA 3HSEA 2HFHA 5EYRA 2ZSIB 1SVMA 4L9VA 3ULQB 3TW7A 1E17A 2V26A 4E7SA 1XGSA 2LP0A 3HOVJ 2ZNYA 4X6AJ 1EA3A 2HWVA 3RQIA 5F1JA 2KZGA 3OYNA 1K6YA 1S7OA 3W2WA 4AIJA 5B3SH 2FQ4A 3FXQA 1PYVA 1VQ4I 2JMWA 3MFKA 3G2BA 2VOOA 2E1NA 3FXUA 1QPMA 3D0SA 5ILSA 2ISYA 2VIXA 4EVIA 3S1RJ 4ZYEA 3S16J 1LQ1A 1QQIA 1S6LA 3A4CA 3M9AA 1USSA 2TCTA 1FMVA 4ANJA 3QYBA 2EIMH 3I58A 1R49A 1MD0A 1U0JA 4BEHB 4M9XA 2UV1A 4CZZA 1A31A 2H27A 4IQJA 5EJCA 1JHHA 2VQHA 1ZQ3P 4RAYA 1OPCA 3HUGB 4RB1A 2OU2A 3GYHX 3HOTA 5DCMB 1V5EA 3HHGA 4DYQA 1HSJA 2CFOA 4BL0B 5HLGA 4A3LJ 2EA2A 2DO7A 3KZZA 4I2OA 4KIBA 4PZJA 1TTYA 3VFZA 2QSFX 2QWWA 3MD2A 3VSKA 4BXFA 1K83J 1MMAA 5KAFC 1TNTA 1XGMA 3I64A 3GW2A 3MVPA 1GT0C 3C2BA 5HNFA 4EM1A 1IAWA 1O7LA 4RB3C 2OF7A 2NYXA 1T2KA 1MSFC 2Y0SN 1FOXA 2R5YA 1YITI 4XQFA 1ZRCA 2R93J 1ZG3A 1NHAA 2XRLA 2JSPA 1WGXA 1T39A 2COMA 4OMZA 1UB9A 2QM3A 2L7KA 3FBNB 3WE2A 1VQPI 2VXDA 1ZK8A 3BTIA 3BY6A 3K2ZA 4LLNA 3FXLA 2CW7A 2LVSA 3C3WA 2W00A 4M3BA 3TMOA 3E97A 1JE8A 5ILVA 4HX4A 1P7IA 3RZOJ 3H3UA 5IYDJ 2M3AA 1ON1A 2M4GA 2WWYA 1YI2I 4BHBA 3E6MA 3ROUA 1QZYA 1OR7A 1MGTA 1O3RA 3GFIA 4I99C 1IXCA 3OL3A 2VXZA 3OIPA 4G7ZF 1Z67A 3FK6A 3BTLA 1YTYA 4BXUA 4NQWA 5IP7J 1N77A 4ENKA 2E7WA 2CWEA 5DD4A 1WKMA 4XLFA 1FYMA 3J7AO 1FC3A 5ICFA 4G8XA 4XLEA 1MJAA 2WV0A 3LQRA 4U0YA 3PQJA 1FYKA 4I01A 4BEHA 5M5YJ 1JI8A 4A0XA 1JT0A 1OCOH 2CFXA 1BI1A 3S32A 2HPMA 4QWQA 2LMDA 4L18B 1R22A 2HS5A 3MMYB 4M74A 5E1XA 2Z2SB 3H0DA 1B72A 1WH7A 1GVJA 1HDDC 2X48A 2M7BA 3ZMUA 4IX7A 3VDXA 3ZQLA 1X2MA 2XKOA 5FLMJ 1UMQA 1G4DA 2G7HA 1YW9A 1P4AA 1QBJA 1DGRM 1Y56A 4YFXF 1Y6IA 3RKWA 2CW0F 3WG7H 2JRTA 3E7LA 3B6CA 4CO8A 3REOA 3R6SA 3I55I 2YUSA 3V4GA 3HB9A 4MLOA 3BZKA 4CYCB 1JKRC 3BC8A 3N4MA 4QSHA 4NC7A 4LITA 4XKBA 4LLGF 4DNCA 2XPWA 2MW8A 2VPRA 2CQ7A 4AC0A 1F1ZA 4G6QA 4E7KA 2MYSA 2YU3A 1D5VA 4FTHA 3DF8A 3B73A 3QOPA 1W0UA 1F4KA 2IS1A 4M9ZA 2HQNA 2WBMA 3C2GA 4IZZA 3ASNH 1Q1VA 3R4KA 1Q1HA 2VBXA 1OKRA 3C18A 1I3QJ 3BG9A 4I0AA 3F22A 1ETOA 2XAJA 3HJEA 3TKYA 5E18F 3DKWA 3GLLA 3VPRA 3PSIA 4OMYA 2E60A 3HOZJ 1I3AA 3K4KA 4KA4A 2Q8KA 1X3UA 1H9TA 5LHHA 1RESA 2WC2A 2M2EA 3NARA 2UZKA 2I8DA 3H9QA 2QVOA 4NB5A 5HLTA 3WTWC 1YHQI 3FDYA 2L7FP 1FOWA 1XMKA 1KYZA 1YJWI 2DOEA 1QNTA 3FHNA 2OPTA 3BR6A 4EJOA 2F5FA 2FSWA 2DQRA 3LOCA 1MBFA 2NS7A 4HA8A 2M8GX 1ZGAA 4XBFA 4EATA 4P5OA 4ZH4F 3MCZA 4RB2C 1FX7A 3DKYA 2VJIA 2Z1DA 1UHWA 2FU4A 4ZTFA 5GPCA 3PM1A 3HOYJ 1Z3XA 2ELJA 3RPQA 2ESNA 2VE9A 1FEXA 1HC8A 4ZYAA 4OAZA 5ICGA 2QZ8A 2NS0A 4GXOA 1BI2A 1ETKA 1J75A 1FPQA 1WQ2A 2IS2A 3HYIA 3GTGJ 4A3JJ 2XPUA 3VEPA 4YG2F 3CP8A 2CSOA 2PN6A 4IHVA 2ESHA 3BJ6A 2LD5A 1G6NA 3G4SI 3SQNA 5BPIA 2V6CA 1CF7A 3ZGKA 2ELHA 1AKHB 2EFNA 2D2WA 3KZYA 2CG4A 4CA0A 2KDZA 1O57A 1SD5A 4BJ5C 2LF8A 3BQZA 5F0HA 5DS9A 4CICA 3MKWB 5FFZA 5C4JJ 1K78B 2HXIA 3S2WA 3WGGA 4IEJA 3S1MJ 1BIAA 1YYVA 4DBRA 3WU1B 1E2XA 4XR6A 4A6DA 3JRFA 2VKHA 1QO0D 2QKLB 4LG0B 1MBGA 1J7KA 3D1NI 4EJWA 4BGDA 2Z33A 1DUXC 1MMSA 5HNHA 6PAXA 2UXXA 1GDTA 3P9IA 2DK5A 3WHCA 1XS9A 5TJJA 5B66C 2R7ZJ 4M6YA 4MIMA 3VOEA 3ZMTA 3CDIA 4C9YA 4HOBA 3G1MA 3H5AA 3RSNA 3CO7C 4JX5A 1UELB 2MD0A 3FMRA 2NVUB 3FM5A 3LL7A 3RCOA 4NNJA 2Z5UA 3OYEA 1ZREA 1VF9A 5B5EC 2HDDA 5DYMA 5J1UA 5L3DA 2RV8A 1LB2A 2HTSA 3KX2A 2R4GA 1FT9A 2FA5A 3HM5A 2HKOA 3VYUB 4DIQA 4U7DA 2NRAC 1A5JA 2R7FA 1YFHA 5IOYA 1KONA 3TO6A 5J47A 1ZLKA 1XGOA 1AHDP 2KISA 3BJOA 2P8TA 2X6WA 1FWZA 2QEXI 3CMYA 4OIRF 2M1BA 3W6KB 3ABTA 1RR8C 2OQGA 2DAOA 1ERDA 4C2MJ 3SHFA 1YX3A 2JTVA 2VKEA 2DK8A 2H09A 2QF7A 3KIOA 2H1KA 5D5XB 4ABZA 1X58A 2R7WA 1IF1A 2DN0A 1FYLA 4XLAA 3KP4A 2DOFA 5FRMA 2BHZA 2L9NA 3J81Z 5JVGF 1FJLA 2E1OA 3WE3A 3HRSA 1F5TA 4O5VA 4XOTA 3CLQA 2IS6A 2VQGA 4A3DJ 2DA6A 2ZXJA 2V9KA 1QHGA 4GRIA 2BXZA 1Z6RA 2K3FA 3OL4A 4QLCU 3WTSC 4UUSA 3DCFA 4HYEA 3OYAA 3QPLA 2XSJC 2KDOA 2DDBA 5L3GA 4AWXB 3CCJI 4MEXF 3PUBA 2XF5A 2VT2A 5GTHC 3DLLF 1AU7A 3IKTA 1RI7A 3GX4X 1ZKGA 3SZGA 4IXAA 1GVDA 5BQTA 2RNJA 4BH9A 1MBHA 1YRNB 3AL0C 4V2FA 4J01A 3HPHA 4HDVA 2ZC2A 1XDUA 2QBYA 2JPCA 2Z99A 3ELKA 2LF7A 2CV2A 3AG4H 1E3OC 2O9LA 2FQ3A 4BHPA 2VBWA 3ZN1A 2DJNA 2ELKA 4IHWA 4KYWA 1U8RA 1SMTA 3GTJJ 5IPAA 3E6CC 1RPWA 2DFHA 2ZCWA 3EYIA 1HW1A 1S5LC 3WTZA 1GV2A 3GZ6A 1U5TC 2XV4S 1GV5A 2EV6A 4LB6B 1IV8A 4EEFG 1T08B 4KMUX 3CCRI 4MGRA 4LFUA 2QBYB 5J1RA 3DV8A 2AXTC 2A3SA 2GXBA 1Z7UA 2L7ZA 2XB5A 5FO5A 3ZCOA 4Y7NJ 3GZNB 2F4IA 5FKNA 4FASD 1NK2P 2RVCA 5EEGA 1L0OC 1GXQA 4XORA 1G59A 2Q1ZB 3DTKA 3FMSA 2CGPA 4Y15A 1UHMA 1QZEA 2PG4A 5D5VB 2LKPA 2E36A 5F6FA 3UR3C 3HIFA 2ZKZA 2L0KA 3O8GA 5JLXA 3BZCA 3SEZA 1W7PB 1MJ9A 4PJMA 3L2VA 4KIFA 4BXXJ 1OCPA 2LBFB 1WSUA 1YQAA 2IGKA 4N4NB 1XSXA 1AWCA 4BY1J 2IGNA 3O2PE 3L2CA 1MBKA 4FX4A 4BBSJ 4LMYA 2FE3A 4U0WA 4XOPA 3OYHA 2GIVA 3KETA 3I56I 2ID3A 2EFOA 2VL8A 2F5EA 3CCLI 3HRMA 3HOWJ 2W25A 2P5LC 2ECCA 2IT0A 3FZVA 1U9OA 2EZLA 2K27A 3CZ6A 5HS9A 2EB7A 5FJ8J 3BZ6A 1RKWA 3ZXSA 1NK3P 3I71A 1HCRA 2V1DA 4HBLA 2XPVA 3LA2A 1MZBA 2BVMA 1DGWY 1TWCJ 3A0BC 3Q9SA 4DZJA 4GFBA 2FBHA 4DJAA 2KRFA 2A61A 1X1PA 1DPUA 2YU9J 1LFPA 1OCRH 2CRGA 2ZMEB 2LTPA 2OAZA 2FOKA 2Y0SA 4IRIA 1SVOA 3JRIA 4NC6A 4Y3OA 3JRAA 1VFCA 4I7HA 1FSHA 3CMEI 3FX3A 1BIBA 3HOXJ 4D0PA 5DUIA 2BV6A 4BE1A 2LYCA 1BR4A 5DM6F 3DTEA 2LC2A 1G8XA 1RETA 3OYJA 3HL2A 1YIJI 3A03A 5AIQA 2W82A 2J5OA 3L2UA 4JBAA 2K7LA 2EQRA 3WGHA 4P96A 4XRMA 2VLAA 2KKOA 4ZTJA 4RA2A 3BR3A 3V7SA 4OIQF 3CUQA 1EH8A 5KNLA 3OMYA 3BWGA 4MO7A 3TDZC 2JRMA 3ZMVA 4DOZA 4BKXA 3EUHA 1X19A 5K5QA 4WK8F 1AOYA 3MAJA 1WVRA 3CUQC 1LUJB 1ODDA 4C3IJ 4HRIA 1U3EM 2AQEA 1VTNC 2L7MP 3EUHC 4ZZDA 3MQ0A 4EGZA 3SEQA 4I76A 2V1XA 5L3CA 2KIUA 2EV0A 3SFZA 3M3YJ 3TL4X 4AYBA 3F8FA 3HG9A 3KPHA 2A05A 1D3YA 4MHGA 3JR9A 1O4XA 1HLVA 4UNOA 2XAHA 3BOQA 5E3NA 3FXKA 4I0BA 4G6DA 2FXAA 2PI0A 2V1UA 2ZFUA 5M3FJ 2LSOA 2STTA 2DA7A
chains in the Genus database with same CATH topology
5F0FA 1P7IA 3FK7A 5JLWA 3GTKJ 3RZOJ 1T33A 1WI3A 5IYDJ 3I4NJ 3UKGA 2WV1A 4D5FA 4D7NA 1FIPA 2EBIA 2YS9A 4JX6A 3GTPJ 3FK6A 3BTLA 5IP9J 2X6OA 2EZHA 2DMQA 3G1LA 5IP7J 3H3VK 1VNDA 1JUSA 3OSGA 1MSEC 1QVUA 2DMTA 5M5YJ 1JT0A 3S17J 1TC3C 4NDLA 1YRNA 4M3DA 1OCTC 3BR5A 4A3KJ 4JYKA 4A69C 2M34A 1B72A 1WH7A 1HDDC 2X48A 3ZQLA 1X2MA 5FLMJ 1UMQA 1LE8B 1ZTRA 4S0HB 3E7LA 3B6CA 2YUSA 3HB9A 4MLOA 1JKRC 4CYCB 3I4MJ 4QSHA 5IYCJ 2FD5A 5C3EJ 1ZR2A 3Q3SA 2WB1N 3DEWA 1ITYA 4XK4A 2XPWA 2MW8A 3GTOJ 2GM4A 1WPKA 3HBLA 3LSRA 4XIDA 2VPRA 4AC0A 1ORKA 4FTHA 5EG0A 4XRSG 3BG5A 3HKZN 3M4OJ 1B8IA 1W0UA 3F0CA 2DMNA 2L9RA 3ZOBA 2CU7A 1Q1VA 1ETWA 1I3QJ 3WHBA 2D5VA 3BG9A 1JGGA 4C3JJ 5J3LA 1ETOA 5K7ZA 3VPRA 2JK3A 3HOZJ 3JRGA 3GTQJ 5EGOB 1RESA 3S15J 2M2EA 3NARA 5EG0B 3CQZJ 4JP0A 1ENHA 2MGQA 2L7FP 4DYCA 4A93J 4A3GJ 5FKMA 2COBA 2OPTA 3BR6A 1IUFA 4RBOA 3RKQA 3ZQCA 2JJ7A 1IJWC 3OOUA 2HOAA 4JX4A 4L5EA 1PUFA 2IEKA 3LOCA 1MBFA 2NVTJ 1QVTA 2NS7A 2PMZN 3JRCA 2LKXA 2JA8J 1Z77A 2Y9YA 5EGOA 1TWHJ 2M8GX 3BR0A 3ZQHA 5IYBJ 2CJJA 2KT0A 1S7EA 2LY9A 4XICA 2IAIA 5GPCA 1POGA 3PM1A 3HOYJ 2DA5A 2XSDC 1FEXA 4D7MA 3RZDJ 1W0TA 3MN2A 2R0QC 1RR7A 2EZIA 2M0CA 1ETKA 2MG4A 1OJLA 3CCYA 4C3HJ 2I10A 3GTGJ 5FKLA 4A3JJ 1Y1VJ 2XPUA 2ID6A 4HNVA 3GTLJ 1BW5A 2DA1A 4B4CA 1LFUP 1TWAJ 1WH5A 4IHVA 3HGYA 1JTYA 2LD5A 2ME6A 4FISA 3GBGA 5GP9A 2DMPA 1TWGJ 3B6AA 1AKHB 1EF4A 4UUTA 2O7OA 3TP3A 4W1UA 4MFEA 1FIAA 1DU6A 2KDZA 4FCYA 3S1QJ 1ZGWA 2B63J 3BQZA 5F0HA 5M5XJ 5DS9A 3S1NJ 5BNGA 2VKVA 5C4JJ 1WCMJ 5F08A 2HXIA 3S1MJ 4IEJA 5FKOA 1A6IA 1GUUA 2MSYA 1U9NA 4BY7J 5K7HA 4A3CJ 4QIWN 2NVXJ 3JRFA 2R5ZB 4M3GA 3FIWA 5C4XJ 1PUFB 1MBGA 4B3AA 3D1NI 3BR1A 3JREA 1JT6A 1APLC 2E19A 1GDTA 4FE7A 2FJ1A 2K40A 1JJ8C 3WHCA 1R9TJ 1XS9A 5EEAA 2R7ZJ 4MIMA 2ME0A 1F36A 3BT9A 4LOCA 1MNMC 3K2AA 3G1MA 3L1PA 4JX5A 1D5YA 5K7FA 3JRDA 3O8HA 1FTTA 1VF9A 2HDDA 2X9DA 3A01A 3GTMJ 5J1UA 3IH2A 2E2HJ 1B72B 2HYJA 1A5JA 3HM5A 2N8GA 2ECBA 3HOUJ 1I50J 1QRYA 1JJ6C 5IOYA 5E3MA 3ZQGA 4XRSA 4A3EJ 1T56A 2JA5J 1AHDP 2R5ZA 4W97A 2G0EA 4B1RA 1NTCA 3CMYA 3Q0UA 4V2GA 2W48A 1XC5A 3FKIJ 2LR8A 5EZGA 4C2MJ 3ZQFA 2Y30A 5IP6A 4IHYA 2VKEA 1JUMA 1JUPA 1X2NA 3H0GJ 4DYRA 1ETXA 3A02A 3CDLA 2QF7A 1BL0A 5EZHA 2H1KA 3QQAA 4ABZA 1X58A 1MH3A 3IV5A 2LLKA 2NS8A 3Q0VA 2EZKA 2DN0A 2FX0A 2Y31A 3LSJA 5M5WJ 1QPIA 2K9NA 4A3FJ 1MBEA 1ETYA 1FJLA 3ZQIA 2E1OA 2NVYJ 2DA3A 4A3DJ 4I6ZA 2R92J 2DA6A 3FISA 4DZPA 2XB0X 3HEFA 1CQTA 1H89C 3SFIA 2GBYA 4UUSA 5DTDA 3DCFA 5E3LA 3QPLA 1U78A 2R5YB 2EH3A 3Q0WA 1AKHA 1LFBA 5FKKA 5HODA 2Y2ZA 2TRTA 3W6VA 2IBDA 2NOGA 3IH3A 2QCOA 2P81A 2K9QA 1AU7A 1ZKGA 2JWTA 3LSGA 3QPSA 1JKQC 1GVDA 2DA4A 3JRBA 1B8IB 2HOSA 3MKLA 1MBHA 1ZR4A 1YRNB 5GPAA 4V2FA 4A3MJ 5F27A 2HXOA 1BA5A 2AHQA 3NAUA 1E3OC 5F0CA 2RAEA 1IDYA 4M3EA 4D5CA 1HF0A 2O9LA 4IHWA 2DJNA 2ELKA 2DTZA 3GTJJ 5IPAA 1RPWA 2AO9A 5FLVA 1GV2A 2CUFA 2GLOA 3BQYA 1GV5A 1K61A 1ETQA 1IRZA 3OIOA 3S14J 3OSFA 4EEFG 1UHSA 1DU0A 1FTZA 5J1RA 5F04A 3TEDA 2H8RA 2L7ZA 2XB5A 5EDNA 4Y7NJ 1JKPC 1VI0A 5FKNA 3A01B 3BTCA 1NK2P 3PO2J 2HOTA 2XGCA 3TW6A 1IG7A 1I6HJ 1HDPA 5E3OA 4M6VA 1H8AC 4G12A 2L0KA 3O8GA 5JLXA 2VI6A 4BBRJ 4M3FA 2K9SA 4X1EA 1HOMA 2Y9ZA 2JN6A 3PO3J 2XGEA 4BXXJ 9ANTA 1OCPA 3G1OA 4BY1J 2LFBA 2JA6J 5M3MJ 1RKTA 1UG2A 2CQXA 3IH4A 3HDDA 1LE8A 1MBKA 4BBSJ 4QTRA 1XG1A 2ID3A 2WAQN 5EYRA 3HOWJ 3TW7A 2ECCA 3HOVJ 1U8BA 2LP0A 1U9OA 2EZLA 4J19A 5C44J 5FJ8J 1BW6A 4X6AJ 2ZB9A 3RQIA 5F1JA 1RKWA 1NK3P 1HCRA 4Y52J 1IDZA 3S2DJ 2XPVA 2FQ4A 3LSPA 3HGGA 1SFOJ 5EF6A 1JKOC 2JMWA 4AUXA 1P7JA 1TWCJ 1IV6A 5IOZA 2CQQA 4DZJA 4GFBA 1OFCX 1Z0XA 3S1RJ 3S16J 2YU9J 1BJZA 2LK2A 2CRGA 3BG3A 3JRHA 2LTPA 2TCTA 3JRIA 2VUMJ 3JRAA 1VFCA 1ETVA 1ZQ3P 1IGNA 3HOXJ 2CUEA 4DYQA 4FE4A 5J1YA 4A3LJ 1F43A 3BR2A 1JTXA 2HQ5A 1RETA 3A03A 2NVQJ 4A3IJ 4RDUA 1K83J 2EQRA 4A3BJ 4XRMA 2E2IJ 3TP0A 3MVPA 1GT0C 3C2BA 1Y1WJ 3BR3A 3K7AJ 4MFDA 2OF7A 4MO7A 4BKXA 2DMUA 2M9HA 2Y0SN 1MSFC 2R5YA 1G2HA 4AYBN 2R93J 4C3IJ 2XRLA 1SANA 3LNQA 1WGXA 2L7MP 1IC8A 2E2JJ 2XGDA 1MBJA 1TWFJ 4I76A 3S2HJ 3SDGA 4UUSB 2O8KA 3M3YJ 1ZK8A 3BTIA 4IHXA 3JR9A 4DW6A 1O4XA 1H88C 1HLVA 2DA2A 2HI3A 3BTJA 5E3NA 2LVSA 4CYCA 2JA7J 4M3BA 1MH4A 5M3FJ 2DA7A 3SJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0F A;  1P7I A;  3FK7 A;  5JLW A;  3GTK J;  3RZO J;  1T33 A;  1WI3 A;  5IYD J;  3I4N J;  3UKG A;  2WV1 A;  4D5F A;  4D7N A;  1FIP A;  2EBI A;  2YS9 A;  4JX6 A;  3GTP J;  3FK6 A;  3BTL A;  5IP9 J;  2X6O A;  2EZH A;  2DMQ A;  3G1L A;  5IP7 J;  3H3V K;  1VND A;  1JUS A;  3OSG A;  1MSE C;  1QVU A;  2DMT A;  5M5Y J;  1JT0 A;  3S17 J;  1TC3 C;  4NDL A;  1YRN A;  4M3D A;  1OCT C;  3BR5 A;  4A3K J;  4JYK A;  4A69 C;  2M34 A;  1B72 A;  1WH7 A;  1HDD C;  2X48 A;  3ZQL A;  1X2M A;  5FLM J;  1UMQ A;  1LE8 B;  1ZTR A;  4S0H B;  3E7L A;  3B6C A;  2YUS A;  3HB9 A;  4MLO A;  1JKR C;  4CYC B;  3I4M J;  4QSH A;  5IYC J;  2FD5 A;  5C3E J;  1ZR2 A;  3Q3S A;  2WB1 N;  3DEW A;  1ITY A;  4XK4 A;  2XPW A;  2MW8 A;  3GTO J;  2GM4 A;  1WPK A;  3HBL A;  3LSR A;  4XID A;  2VPR A;  4AC0 A;  1ORK A;  4FTH A;  5EG0 A;  4XRS G;  3BG5 A;  3HKZ N;  3M4O J;  1B8I A;  1W0U A;  3F0C A;  2DMN A;  2L9R A;  3ZOB A;  2CU7 A;  1Q1V A;  1ETW A;  1I3Q J;  3WHB A;  2D5V A;  3BG9 A;  1JGG A;  4C3J J;  5J3L A;  1ETO A;  5K7Z A;  3VPR A;  2JK3 A;  3HOZ J;  3JRG A;  3GTQ J;  5EGO B;  1RES A;  3S15 J;  2M2E A;  3NAR A;  5EG0 B;  3CQZ J;  4JP0 A;  1ENH A;  2MGQ A;  2L7F P;  4DYC A;  4A93 J;  4A3G J;  5FKM A;  2COB A;  2OPT A;  3BR6 A;  1IUF A;  4RBO A;  3RKQ A;  3ZQC A;  2JJ7 A;  1IJW C;  3OOU A;  2HOA A;  4JX4 A;  4L5E A;  1PUF A;  2IEK A;  3LOC A;  1MBF A;  2NVT J;  1QVT A;  2NS7 A;  2PMZ N;  3JRC A;  2LKX A;  2JA8 J;  1Z77 A;  2Y9Y A;  5EGO A;  1TWH J;  2M8G X;  3BR0 A;  3ZQH A;  5IYB J;  2CJJ A;  2KT0 A;  1S7E A;  2LY9 A;  4XIC A;  2IAI A;  5GPC A;  1POG A;  3PM1 A;  3HOY J;  2DA5 A;  2XSD C;  1FEX A;  4D7M A;  3RZD J;  1W0T A;  3MN2 A;  2R0Q C;  1RR7 A;  2EZI A;  2M0C A;  1ETK A;  2MG4 A;  1OJL A;  3CCY A;  4C3H J;  2I10 A;  3GTG J;  5FKL A;  4A3J J;  1Y1V J;  2XPU A;  2ID6 A;  4HNV A;  3GTL J;  1BW5 A;  2DA1 A;  4B4C A;  1LFU P;  1TWA J;  1WH5 A;  4IHV A;  3HGY A;  1JTY A;  2LD5 A;  2ME6 A;  4FIS A;  3GBG A;  5GP9 A;  2DMP A;  1TWG J;  3B6A A;  1AKH B;  1EF4 A;  4UUT A;  2O7O A;  3TP3 A;  4W1U A;  4MFE A;  1FIA A;  1DU6 A;  2KDZ A;  4FCY A;  3S1Q J;  1ZGW A;  2B63 J;  3BQZ A;  5F0H A;  5M5X J;  5DS9 A;  3S1N J;  5BNG A;  2VKV A;  5C4J J;  1WCM J;  5F08 A;  2HXI A;  3S1M J;  4IEJ A;  5FKO A;  1A6I A;  1GUU A;  2MSY A;  1U9N A;  4BY7 J;  5K7H A;  4A3C J;  4QIW N;  2NVX J;  3JRF A;  2R5Z B;  4M3G A;  3FIW A;  5C4X J;  1PUF B;  1MBG A;  4B3A A;  3D1N I;  3BR1 A;  3JRE A;  1JT6 A;  1APL C;  2E19 A;  1GDT A;  4FE7 A;  2FJ1 A;  2K40 A;  1JJ8 C;  3WHC A;  1R9T J;  1XS9 A;  5EEA A;  2R7Z J;  4MIM A;  2ME0 A;  1F36 A;  3BT9 A;  4LOC A;  1MNM C;  3K2A A;  3G1M A;  3L1P A;  4JX5 A;  1D5Y A;  5K7F A;  3JRD A;  3O8H A;  1FTT A;  1VF9 A;  2HDD A;  2X9D A;  3A01 A;  3GTM J;  5J1U A;  3IH2 A;  2E2H J;  1B72 B;  2HYJ A;  1A5J A;  3HM5 A;  2N8G A;  2ECB A;  3HOU J;  1I50 J;  1QRY A;  1JJ6 C;  5IOY A;  5E3M A;  3ZQG A;  4XRS A;  4A3E J;  1T56 A;  2JA5 J;  1AHD P;  2R5Z A;  4W97 A;  2G0E A;  4B1R A;  1NTC A;  3CMY A;  3Q0U A;  4V2G A;  2W48 A;  1XC5 A;  3FKI J;  2LR8 A;  5EZG A;  4C2M J;  3ZQF A;  2Y30 A;  5IP6 A;  4IHY A;  2VKE A;  1JUM A;  1JUP A;  1X2N A;  3H0G J;  4DYR A;  1ETX A;  3A02 A;  3CDL A;  2QF7 A;  1BL0 A;  5EZH A;  2H1K A;  3QQA A;  4ABZ A;  1X58 A;  1MH3 A;  3IV5 A;  2LLK A;  2NS8 A;  3Q0V A;  2EZK A;  2DN0 A;  2FX0 A;  2Y31 A;  3LSJ A;  5M5W J;  1QPI A;  2K9N A;  4A3F J;  1MBE A;  1ETY A;  1FJL A;  3ZQI A;  2E1O A;  2NVY J;  2DA3 A;  4A3D J;  4I6Z A;  2R92 J;  2DA6 A;  3FIS A;  4DZP A;  2XB0 X;  3HEF A;  1CQT A;  1H89 C;  3SFI A;  2GBY A;  4UUS A;  5DTD A;  3DCF A;  5E3L A;  3QPL A;  1U78 A;  2R5Y B;  2EH3 A;  3Q0W A;  1AKH A;  1LFB A;  5FKK A;  5HOD A;  2Y2Z A;  2TRT A;  3W6V A;  2IBD A;  2NOG A;  3IH3 A;  2QCO A;  2P81 A;  2K9Q A;  1AU7 A;  1ZKG A;  2JWT A;  3LSG A;  3QPS A;  1JKQ C;  1GVD A;  2DA4 A;  3JRB A;  1B8I B;  2HOS A;  3MKL A;  1MBH A;  1ZR4 A;  1YRN B;  5GPA A;  4V2F A;  4A3M J;  5F27 A;  2HXO A;  1BA5 A;  2AHQ A;  3NAU A;  1E3O C;  5F0C A;  2RAE A;  1IDY A;  4M3E A;  4D5C A;  1HF0 A;  2O9L A;  4IHW A;  2DJN A;  2ELK A;  2DTZ A;  3GTJ J;  5IPA A;  1RPW A;  2AO9 A;  5FLV A;  1GV2 A;  2CUF A;  2GLO A;  3BQY A;  1GV5 A;  1K61 A;  1ETQ A;  1IRZ A;  3OIO A;  3S14 J;  3OSF A;  4EEF G;  1UHS A;  1DU0 A;  1FTZ A;  5J1R A;  5F04 A;  3TED A;  2H8R A;  2L7Z A;  2XB5 A;  5EDN A;  4Y7N J;  1JKP C;  1VI0 A;  5FKN A;  3A01 B;  3BTC A;  1NK2 P;  3PO2 J;  2HOT A;  2XGC A;  3TW6 A;  1IG7 A;  1I6H J;  1HDP A;  5E3O A;  4M6V A;  1H8A C;  4G12 A;  2L0K A;  3O8G A;  5JLX A;  2VI6 A;  4BBR J;  4M3F A;  2K9S A;  4X1E A;  1HOM A;  2Y9Z A;  2JN6 A;  3PO3 J;  2XGE A;  4BXX J;  9ANT A;  1OCP A;  3G1O A;  4BY1 J;  2LFB A;  2JA6 J;  5M3M J;  1RKT A;  1UG2 A;  2CQX A;  3IH4 A;  3HDD A;  1LE8 A;  1MBK A;  4BBS J;  4QTR A;  1XG1 A;  2ID3 A;  2WAQ N;  5EYR A;  3HOW J;  3TW7 A;  2ECC A;  3HOV J;  1U8B A;  2LP0 A;  1U9O A;  2EZL A;  4J19 A;  5C44 J;  5FJ8 J;  1BW6 A;  4X6A J;  2ZB9 A;  3RQI A;  5F1J A;  1RKW A;  1NK3 P;  1HCR A;  4Y52 J;  1IDZ A;  3S2D J;  2XPV A;  2FQ4 A;  3LSP A;  3HGG A;  1SFO J;  5EF6 A;  1JKO C;  2JMW A;  4AUX A;  1P7J A;  1TWC J;  1IV6 A;  5IOZ A;  2CQQ A;  4DZJ A;  4GFB A;  1OFC X;  1Z0X A;  3S1R J;  3S16 J;  2YU9 J;  1BJZ A;  2LK2 A;  2CRG A;  3BG3 A;  3JRH A;  2LTP A;  2TCT A;  3JRI A;  2VUM J;  3JRA A;  1VFC A;  1ETV A;  1ZQ3 P;  1IGN A;  3HOX J;  2CUE A;  4DYQ A;  4FE4 A;  5J1Y A;  4A3L J;  1F43 A;  3BR2 A;  1JTX A;  2HQ5 A;  1RET A;  3A03 A;  2NVQ J;  4A3I J;  4RDU A;  1K83 J;  2EQR A;  4A3B J;  4XRM A;  2E2I J;  3TP0 A;  3MVP A;  1GT0 C;  3C2B A;  1Y1W J;  3BR3 A;  3K7A J;  4MFD A;  2OF7 A;  4MO7 A;  4BKX A;  2DMU A;  2M9H A;  2Y0S N;  1MSF C;  2R5Y A;  1G2H A;  4AYB N;  2R93 J;  4C3I J;  2XRL A;  1SAN A;  3LNQ A;  1WGX A;  2L7M P;  1IC8 A;  2E2J J;  2XGD A;  1MBJ A;  1TWF J;  4I76 A;  3S2H J;  3SDG A;  4UUS B;  2O8K A;  3M3Y J;  1ZK8 A;  3BTI A;  4IHX A;  3JR9 A;  4DW6 A;  1O4X A;  1H88 C;  1HLV A;  2DA2 A;  2HI3 A;  3BTJ A;  5E3N A;  2LVS A;  4CYC A;  2JA7 J;  4M3B A;  1MH4 A;  5M3F J;  2DA7 A;  3SJM A; 
#chains in the Genus database with same CATH topology
 2HVR A;  4BNC A;  3K4J A;  1T33 A;  3I4N J;  5GAH J;  3UKG A;  1IN6 A;  5BS6 A;  3J81 K;  1WI9 A;  1W5C C;  3E6B A;  1FIP A;  3PNY A;  4N0B A;  3A2K A;  3J80 K;  1EV7 A;  2VN2 A;  3WU2 C;  5IP9 J;  3K10 A;  1LNW A;  3FBI B;  1B59 A;  4C30 A;  1MJB A;  2JUC A;  2EZH A;  1QU3 A;  2D45 A;  3S3O A;  2VOP A;  4JOM A;  1LJ9 A;  3H3V K;  2K86 A;  3WTV C;  3KLN A;  4IOC F;  1JUS A;  2OCE A;  4S04 A;  4O3M A;  1HST A;  3DTI A;  1U5T A;  1R1U A;  2DMT A;  2WA0 A;  4YFK F;  2XRO A;  3GO5 A;  1S72 I;  2GXG A;  2XGX A;  1R58 A;  1VQO I;  3X2Q H;  2LKS A;  5JVT A;  1YRN A;  5DUK A;  3FM3 A;  3V7R A;  2A07 F;  2O61 A;  1R5H A;  2DPD A;  4PFP A;  2IPQ X;  1V55 H;  2M4K A;  3LSK A;  3PFY A;  3LFK A;  4XLN F;  4IQ4 A;  3VB2 A;  4F52 A;  2X6X A;  1BM9 A;  3VYS B;  1D0X A;  2PMZ A;  4FHT A;  4L9J A;  4L5I A;  3N05 A;  3HC7 A;  4XN3 A;  2K9M A;  1UCR A;  1DPR A;  3W6J B;  5C3E J;  2L02 A;  2CMP A;  2WB1 N;  2DT5 A;  3DEW A;  1FBS A;  2KRC A;  3GTO J;  1X3Z B;  4GGG A;  1WPK A;  3HBL A;  5KCM A;  3JAM K;  2DI3 A;  3VSL A;  3RYR A;  1ZAO A;  2E71 A;  5K5R A;  4EJU A;  5LLQ A;  2K9L A;  3T5X A;  4AU7 A;  1Y0N A;  2O5R A;  2PJP A;  1IXS B;  2DMN A;  2KJC A;  2L9R A;  3DBH B;  3IRQ A;  4PGG A;  3ZOB A;  3CJR B;  1PJR A;  1TQP A;  2ZJP F;  4HNT A;  2K4B A;  2DCE A;  2XAG A;  3LSM A;  3WHB A;  4ZYH A;  1OMI A;  1B9M A;  2BY2 A;  4UB8 C;  5K7Z A;  1YJ9 I;  1UFM A;  4HX8 A;  3H3Z A;  3LFU A;  4G6T B;  1G3Y A;  4PSW A;  3R61 A;  3SZP A;  2JK3 A;  5DEQ A;  3JRG A;  4B3X A;  1Z3Y A;  3HOS A;  4M72 A;  2DU9 A;  3S15 J;  4PFO A;  2ZXW H;  1J5Y A;  1XMA A;  3QOD A;  4JP0 A;  3AKZ A;  3AAF A;  2FBK A;  4A6E A;  2ETH A;  3CUO A;  3K4M A;  2XUB A;  2COB A;  3KP7 A;  3GFJ A;  2A6E F;  2IA0 A;  2M5W A;  4E7J A;  2Y69 H;  3OOU A;  2HOA A;  4JX4 A;  1PUF A;  1IRX A;  3C7J A;  4MTD A;  3JRC A;  2LKX A;  1SVL A;  2Y9Y A;  4L0Y B;  3U2R A;  4F92 B;  1STZ A;  1XSV A;  2CJJ A;  3B02 A;  1NG7 A;  2W85 A;  1S7E A;  5TRD A;  3TOB A;  2IAI A;  1Y0U A;  3W2A A;  4ITV A;  4NC8 A;  1TQI A;  5KHD A;  4YIF A;  4LLL A;  4BQO A;  4WF2 A;  4YII A;  3IAM 2;  3MN2 A;  5IT9 K;  4YIR X;  2MG4 A;  2BGC A;  3CCY A;  1WRJ A;  3MZY A;  4OAY A;  4RB0 A;  3D5L A;  5FKL A;  5FD6 A;  2HQR A;  3CTA A;  1Y1V J;  4BU2 A;  1BR2 A;  1HKS A;  2VE8 A;  2PX9 A;  2VAS A;  3KEQ A;  4HNV A;  1OYY A;  4B4C A;  4D9J A;  2FUG 2;  1KA8 A;  2X1D A;  1TWA J;  3ERM A;  2WAE A;  5E1Z B;  2DFE A;  3NRV A;  2DMP A;  1TWG J;  1U2W A;  3SDB A;  1HXD A;  3LWF A;  2DLL A;  2BBY A;  2XAQ A;  4FCY A;  1B9N A;  3S1Q J;  1BOB A;  1DQU A;  4FX0 A;  2B63 J;  4XN0 A;  2R7Q A;  2MC3 A;  2NAZ A;  5M5X J;  1BN5 A;  2VC1 A;  2WTE A;  4IRH A;  1WCM J;  5A2Q K;  3P9K A;  2KZV A;  2UUZ A;  2FF4 A;  4G7O F;  3L2W A;  1A6I A;  3T0Y A;  2MSY A;  3HSR A;  2QUF A;  3U1K A;  4A3C J;  4QIW N;  2NVX J;  2R5Z B;  2BZT A;  2RKH A;  3FIW A;  1R7J A;  2XF6 A;  3IAS 2;  3ABL H;  3KP6 A;  2R3S A;  1IZ1 A;  4I09 A;  5H2F C;  5LD2 C;  2VPL A;  5C4X J;  2LY1 A;  4XON A;  3QPH A;  3F6O A;  3MZ8 A;  1JT6 A;  2OBP A;  5E8I A;  3CJN A;  2W7N A;  4Y13 A;  2FJ1 A;  1G3T A;  4PSX A;  4P9F A;  2MH9 A;  3G3Z A;  5EEA A;  2F2E A;  3K2A A;  2V9P A;  5LEJ A;  3L1P A;  2W4S A;  2E34 A;  4PUS A;  1KYW A;  3JRD A;  1FTT A;  3M8J A;  1OQY A;  3DPL C;  3CF2 A;  3J7Y J;  3A01 A;  2L9V A;  3DP7 A;  5HDK A;  1PP8 F;  2F4O B;  1IO2 A;  2BE5 F;  4CUG A;  2WB1 A;  1BC8 C;  5IT9 Z;  3V8J A;  5TIS C;  3KLO A;  4MQ9 F;  2A6H F;  3JCU C;  4AM3 A;  3ZQG A;  4XRS A;  5E79 C;  2R5Z A;  4B1R A;  3HTS B;  2L3D A;  2ZJR F;  1V5F A;  1XC5 A;  2LR8 A;  4G94 A;  5EZG A;  3ZQF A;  3JSP A;  2E1C A;  1YE9 A;  2Y0M A;  2F6C A;  3OYB A;  5DDG A;  1ETX A;  3A02 A;  3CDL A;  3M07 A;  3CCM I;  5EZH A;  4AIK A;  4XSZ F;  1O3Q A;  3PQK A;  2QSH X;  2NXN B;  4OIN F;  2LLK A;  1R1V A;  4C2T A;  4RAG A;  4D1Q A;  3E5X A;  3KEO A;  2FX0 A;  4WXC A;  2L4M A;  3FF5 A;  4RGR A;  1QPI A;  2K9N A;  1MBE A;  1ETY A;  3TDU C;  2H94 A;  2E1M B;  2FOW A;  4UXN A;  3G71 I;  5D5U B;  2VON A;  3DEU A;  2DT6 A;  3ECO A;  3I54 A;  3FIS A;  4KT6 A;  3K6G A;  4DZP A;  2XB0 X;  3HEF A;  1CQT A;  1H89 C;  1D8J A;  1C0W A;  2GBY A;  3QWL A;  4A12 A;  3E3V A;  3DPU A;  5E3L A;  4GYI A;  1I1G A;  2A5W A;  5HLH A;  4HDU A;  3Q0W A;  2A5Y B;  1V54 H;  1AKH A;  5HOD A;  2Y2Z A;  2UXN A;  5ILU A;  4BQA A;  2TRT A;  3RQ4 A;  1A6Q A;  1WWX A;  1I5Z A;  2DOD A;  4B8X A;  5IT3 A;  2JWT A;  3LSG A;  3TOA A;  3F9K A;  3ML6 A;  3GFM A;  5JI6 A;  2EIJ H;  2GA2 A;  3JRB A;  1B8I B;  2HOS A;  2CUJ A;  2IA2 A;  4GYG A;  1VZ0 A;  2H1L A;  2LG4 A;  3PNT A;  2EJR A;  5CLS A;  4A3M J;  3WG9 A;  2XDV A;  2AXL A;  3NQO A;  1LVA A;  3KE2 A;  3VWB A;  2V4J C;  2E5N A;  5D8L B;  1SFK A;  1Z21 A;  2H6B A;  3NAU A;  4M3E A;  4KN7 X;  4D5C A;  3V8L A;  1SD6 A;  4IL6 C;  3OS1 A;  5LGU A;  3D5R C;  2L01 A;  1SFE A;  1ZHF A;  3M1C A;  2AO9 A;  2CUF A;  2GLO A;  4PCQ A;  1FY7 A;  1O7F A;  4BQN A;  1K61 A;  1ETQ A;  1XMX A;  2ZSH B;  3OIO A;  5CQG A;  3S14 J;  1IRZ A;  1QA6 A;  4HF2 A;  1B6A A;  2KQR A;  4EJV A;  2BY3 A;  4BAC A;  2K4J A;  5LRR A;  4E7H A;  3F8C A;  2O6G E;  4B47 A;  3I9V 2;  4XKW A;  2H8R A;  3L7W A;  5EDN A;  1YIO A;  2MC4 A;  4ZDP A;  3F8M A;  1A04 A;  2WAD A;  3KCC A;  1TL8 A;  3PO2 J;  2IGO A;  2PMH A;  3OYM A;  2HOT A;  2XGC A;  4KUM A;  2M87 A;  4M6V A;  1H8A C;  1A36 A;  2F5V A;  3OYF A;  1WHU A;  2P5V A;  1XB4 A;  3CCU I;  3DKX A;  4UUV A;  2DXI A;  1N78 A;  4X1E A;  2LNB A;  3IP4 B;  1S29 A;  3W2V A;  3QPT A;  4BJT A;  4BS9 A;  3ERE D;  2R7D A;  1P6R A;  3KP2 A;  1IRG A;  2DQL A;  2LFB A;  2JA6 J;  2XHK A;  1PDN C;  3CJQ B;  1WJF A;  1UG2 A;  1M1E B;  2QQ9 A;  1I39 A;  1VQK I;  2PEX A;  1RNL A;  2K85 A;  3F23 A;  2LDU A;  2K3P A;  1PVE A;  3CC7 I;  1MNE A;  3BRO A;  2WAQ N;  2L54 A;  1VQN I;  2DTR A;  3QRF F;  5K5O A;  1U8B A;  1FBQ A;  2DYR H;  5LEK A;  2B0L A;  4E7Z A;  1W36 C;  4E6K G;  1RUO A;  2ZXI A;  2EV5 A;  3VYR B;  1KQ8 A;  3GZ5 A;  4Y52 J;  1YOV B;  3ECH A;  4ENJ A;  1IDZ A;  3S2D J;  3K4B A;  1SFO J;  5EF6 A;  4ESJ A;  4Q47 A;  1I6X A;  4BDZ A;  2XAS A;  1R6R A;  5IOZ A;  2CQQ A;  4HQM A;  4N9H A;  3CF5 F;  3L00 A;  1OFC X;  4ESF A;  5K1Y A;  1BJZ A;  4IJA A;  5HVQ C;  3GVA A;  1QZZ A;  2IJL A;  3CD6 I;  2BEO A;  3G6E I;  1OCZ H;  2ZBK A;  3BLY A;  1J9I A;  1ON2 A;  2GZW A;  1XCB A;  1ZAR A;  1IGN A;  2CUE A;  1KGS A;  5IY5 H;  4JQF A;  3P7N A;  1FSE A;  3DBL B;  3FXR A;  2W84 A;  1K79 A;  4FE4 A;  4NQW B;  3BR2 A;  1JTX A;  1LKX A;  3P5J A;  2HQ5 A;  1MMG A;  5HDN A;  4HPQ A;  1MDM B;  3HKZ A;  2EWN A;  3T8T A;  2XRN A;  2EA4 A;  2BVL A;  5J4Y A;  3OOP A;  1H9G A;  3TP0 A;  5J8C A;  1KZH A;  1R23 A;  3K7A J;  4MFD A;  4PJN A;  2UWM A;  1WJE A;  2M7A A;  4L9N A;  3KFW X;  3F3X A;  3V42 A;  2QSG X;  1G2H A;  2O3F A;  2A69 F;  4BHC A;  4AYB N;  3LNQ A;  3S3M A;  4CDG A;  2E2J J;  4YEJ A;  5D4S A;  2ZME A;  4II3 A;  1S3J A;  1W5S A;  1MBJ A;  2MFZ A;  1Z6T A;  2R7S A;  1R4M B;  3DFG A;  4B44 A;  5F1R A;  3VOD A;  2O8K A;  4RLQ A;  2ZME C;  2BYV E;  3CO6 C;  2HI3 A;  5BOX A;  5HS8 A;  4CYC A;  3ZMD A;  2FNA A;  5L3F A;  1BI3 A;  3ZRG A;  1MH4 A;  1XX5 A;  3F72 A;  2OUM A;  5LGT A;  1IUY A;  3SJM A;  3MEX A;  3E5Q A;  3QP5 A;  3MZH A;  5JLW A;  5HDG A;  1N75 A;  2QQB A;  4R1H A;  1WI3 A;  4EV0 A;  4FET A;  3FHZ A;  3CCQ I;  1X1A A;  2WV1 A;  4D5F A;  1FOK A;  1IN4 A;  1WJA A;  2KIQ A;  2V9V A;  3K9T A;  4JX6 A;  3GTP J;  4JK1 X;  2KMU A;  4EQQ A;  2HVQ A;  1OR7 C;  4MTE A;  2PJR A;  2JA2 A;  2DMQ A;  3G1L A;  2IW5 A;  1BOA A;  3K4N A;  3JTH A;  1CF7 B;  2VKD A;  4Y33 A;  3HTU A;  3W3C A;  1VND A;  3J80 Z;  4F91 B;  1X1C A;  3L9F A;  1MSE C;  5E1W A;  2BXY A;  3HUG A;  5KAI C;  1LDK B;  1QVU A;  1HA8 A;  2GXA A;  2X1E A;  5LRS A;  3LSI A;  5E17 F;  4FT8 A;  3K1N A;  3U1D A;  2M45 A;  2HNH A;  1T98 A;  5LHG A;  4NDL A;  2P4W A;  4CYD A;  2I5U A;  1OCT C;  3BR5 A;  3R0J A;  5FGM A;  2D1H A;  4ZC3 A;  3ZMZ A;  4H4K C;  3S8P A;  4HQE A;  2QLZ A;  1K4T A;  3PL8 A;  4RLF A;  5CPR B;  4V19 K;  4R8H A;  3S93 A;  5GAE J;  3WTT C;  1LE8 B;  1ZTR A;  4S0H B;  4XLP F;  1SD4 A;  5FD5 A;  1X1D A;  3CLO A;  4C2U A;  1D0Z A;  3SYT A;  4LB5 A;  3I4M J;  2ZO4 A;  2FD5 A;  1Y39 A;  3Q3S A;  1WJD A;  2WAF A;  3H9G A;  3CMA I;  3EET A;  4CCJ A;  1KU3 A;  2R7T A;  4XK4 A;  3GEZ A;  4F93 B;  3LA7 A;  1U5T B;  2QQA A;  4F7Z A;  3LSR A;  3CC2 I;  4E7I A;  2JZY A;  1MMD A;  4QPQ A;  5FB2 A;  3AG1 H;  3IWF A;  4XRS G;  5EG0 A;  3BG5 A;  2HPI A;  2QEN A;  3M4O J;  1B8I A;  3F0C A;  4R79 A;  3EYY A;  1W7P D;  2CU7 A;  3RPU D;  5DCM A;  2R7U A;  1T6S A;  2HZT A;  2F5D A;  3AL0 B;  3O3K A;  2IGM A;  2OTL I;  3CJT B;  1GLN A;  5D4R A;  4IO9 F;  3G73 A;  3FXJ A;  1DDN A;  3HPG A;  1XDS A;  2KIM A;  4BJ6 C;  1VQ8 I;  1R5I D;  4M71 A;  5ICC A;  4KIS A;  4YFN F;  3K0L A;  3AG3 H;  3CQZ J;  3SXY A;  1F9N A;  2MGQ A;  1T8I A;  4DYC A;  4A93 J;  4A3G J;  1L3L A;  3OY9 A;  3LST A;  4MEY F;  5FKM A;  1IUF A;  3RKQ A;  4A5N A;  3H1C A;  3ZQC A;  2JJ7 A;  1IJW C;  2HOE A;  5DD8 A;  4L5E A;  5CKT A;  4WXD A;  1XSD A;  1QVT A;  1T0F C;  2JA8 J;  1Z77 A;  5HLI A;  3QYE A;  1LEB A;  1TWH J;  2VC0 A;  4ZDL A;  3OYC A;  1Y8R B;  3ABM H;  3K69 A;  2KT0 A;  2KFD A;  4RM2 A;  1HKT A;  2HKX A;  4ON0 A;  1HKQ A;  1POG A;  2DA5 A;  3RTR A;  2XSD C;  1LPQ A;  2X0L A;  1TW2 A;  3WTU C;  2TDX A;  1YS6 A;  3IWZ A;  3RZD J;  1W0T A;  1SEU A;  2HTJ A;  2KRH A;  2R0Q C;  3CC4 I;  2EZI A;  2YSR A;  1OJL A;  2BW3 A;  2JPB A;  2HDC A;  1KU2 A;  2Z16 A;  4HX7 A;  2OCC H;  1YW7 A;  2I10 A;  3QAH A;  1IXR C;  3H9J A;  5E8G A;  3H36 A;  3WTX C;  2KHM A;  2ID6 A;  4KNY A;  3GTL J;  1BW5 A;  2DA1 A;  1ZRD A;  1LFU P;  2LY2 A;  3GFL A;  4U87 A;  4BE2 A;  2WY8 Q;  3TQN A;  1JTY A;  2ISZ A;  4J00 A;  3E1S A;  2ME6 A;  4FIS A;  4HST A;  5KVR A;  3GBG A;  1SC7 A;  3B6A A;  4RGX A;  1EF4 A;  3IL2 A;  1JXS A;  2VJ4 A;  4MFE A;  1FIA A;  3FXO A;  5J40 A;  1DU6 A;  3KYC B;  2HU9 A;  1T38 A;  3OR2 C;  4ZYG A;  1ZGW A;  1X3W B;  3DQV C;  2F5C A;  2WAQ A;  4PJ0 C;  3S1N J;  2PMU A;  1IN7 A;  5F08 A;  1TNS A;  5FKO A;  2VQL A;  3I3L A;  3I0T A;  4Y4R A;  1V4R A;  1T95 A;  5DM7 F;  3KYL A;  3GXO A;  4UHT A;  3OR1 C;  1SAX A;  3DLA A;  3DU5 A;  4CCL A;  4OU0 A;  2MA3 A;  1NG6 A;  1PUF B;  3JW4 A;  4B3A A;  3EQL F;  3Q9V A;  1APL C;  5H6Q A;  1X4P A;  4FE7 A;  4CSW A;  1JJ8 C;  1R9T J;  4OIP F;  2LH9 A;  1RIO H;  2ME0 A;  1P2F A;  5CVU A;  3IC7 A;  2LRE A;  2JVH A;  3DEE A;  5K7F A;  4LJZ F;  2F48 A;  2X9D A;  3GTM J;  1ONV A;  3BG6 A;  4IVN A;  5H6R A;  3VYT B;  3U21 A;  1B72 B;  2HYJ A;  4KMF A;  1R5G A;  4PJJ A;  3HOU J;  4XL9 A;  1YS7 A;  4G9Y A;  4HF1 A;  1I50 J;  2G7U A;  2L4A A;  1JJ6 C;  5E3M A;  1EH6 A;  2H8W A;  2QQ8 A;  1PUE E;  1T56 A;  2JA5 J;  1WZ2 A;  2HQA A;  4W97 A;  2G0E A;  3LQQ A;  1NTC A;  1U6G A;  3NEU A;  4HV6 A;  4IPA A;  3V7C A;  3Q0U A;  5BPD A;  4V2G A;  2W48 A;  4OOI A;  1W36 D;  5LBQ A;  4BYY A;  2ZXH A;  2Y30 A;  5IP6 A;  4IHY A;  4M6X A;  3RPU A;  1JUM A;  1X2N A;  1TW3 A;  3H0G J;  2OZU A;  1BL0 A;  4ASN A;  4ESB A;  3QQA A;  1MH3 A;  3Q0V A;  2EZK A;  1BBY A;  2IXS A;  3RJP A;  2Y31 A;  3LSJ A;  5M5W J;  2J5P A;  1K7A A;  2EIK H;  2BHY A;  1R71 A;  3LAP A;  1KU7 A;  2OTJ I;  1FZP B;  1D1C A;  1G3S A;  3LAJ A;  2DA3 A;  2R92 J;  3I53 A;  1HBX G;  1RZ4 A;  2NNN A;  3H5R A;  3SFI A;  4RAF A;  5HOO A;  1Z9C A;  3EUA A;  3L2Q A;  4M73 A;  4CCN A;  2R5Y B;  1BI0 A;  3WGI A;  5FKK A;  2NNY A;  2JT1 A;  2YR2 A;  2JSC A;  2GA1 A;  2IBD A;  3IH3 A;  1SFU A;  3L09 A;  4P1W A;  2K9Q A;  1EH7 A;  4ETS A;  3PIP F;  1D1B A;  4O6J A;  3GLX A;  4AIH A;  4CZC A;  1YW8 A;  2FBI A;  1SD7 A;  1JKQ C;  2B9S A;  3P9C A;  2DA4 A;  3GCM A;  2R7R A;  1ZR4 A;  4HF0 A;  1OCC H;  2GWR A;  3HRU A;  4IHT A;  2HXO A;  5J8F A;  5DV5 A;  1BA5 A;  1W7P A;  2DW4 A;  2AHQ A;  5E20 A;  1IRF A;  3T8R A;  2EFQ A;  2IS4 A;  2DFF A;  5LHI A;  2RQQ A;  4L5J A;  1RC9 A;  1Z05 A;  2LRD A;  2D1V A;  3BQY A;  1LDD A;  5CVI A;  2AQF A;  1ZGJ A;  3I5U A;  1FP2 A;  4Q5S F;  4UB6 C;  2NOJ B;  3DU6 A;  2O0Y A;  1DU0 A;  4N4O B;  4BUP A;  1V5G A;  3ZR8 X;  3KP3 A;  5F04 A;  1MND A;  2WY7 Q;  3TED A;  1LDJ A;  2P0W A;  1W4M A;  1X1B A;  2HGC A;  1SMY F;  4IF4 A;  2ZJQ F;  4OIO F;  1EJ9 A;  3LSH A;  3PIO F;  2STW A;  1P4X A;  4OWR B;  3MKY B;  1S9H A;  2L9S A;  2HEO A;  3PFI A;  3K1P A;  4U7B A;  1IG7 A;  1I6H J;  5E3O A;  2ZFW A;  2BY1 A;  4ZJZ A;  4UV9 A;  2QGU A;  3DWL E;  2BOL A;  5JR3 A;  2VI6 A;  4BBR J;  2FEZ A;  4KIG A;  4M3F A;  4IKF A;  2K9S A;  1HOM A;  2Y9Z A;  2MBF A;  3KP5 A;  1GXP A;  3OWT A;  9ANT A;  3G1O A;  5CVV A;  2RN7 A;  1YLF A;  1ZG5 A;  2EIN H;  2Y48 A;  3R0A A;  5J4V A;  3RKY A;  3R60 A;  4EM2 A;  3K4L A;  1LE8 A;  4WCG A;  1T0F A;  1YX5 A;  4IHS A;  4CGZ A;  1XCV A;  3O6B B;  5LGN A;  1VQ9 I;  2EK5 A;  2IA1 A;  3COA C;  4RM3 A;  4LG3 A;  4Z2Y A;  3CDH A;  4J19 A;  5C44 J;  3OV8 A;  3QP6 A;  4N9I A;  4BE0 A;  1BW6 A;  3IKV A;  2ZB9 A;  4KFC A;  2OZ6 A;  4CH7 A;  2QA4 I;  2DT7 B;  2EFW A;  4UY8 I;  2P6S A;  3LSP A;  1B4A A;  3GWZ A;  1K6O A;  3HGG A;  1WJ5 A;  1JKO C;  1R1T A;  4AUX A;  1P7J A;  1IV6 A;  1DP3 A;  2Z3Y A;  4P55 A;  2HYF A;  1W5T A;  1XGN A;  2HZD A;  1J0R A;  5CVR A;  5D5W B;  1Z0X A;  2KP6 A;  1BC7 C;  1HQC A;  4XLC A;  2LK2 A;  1OIS A;  3BG3 A;  3JRH A;  2RDP A;  3TGN A;  2IRF G;  2PJR B;  1ULY A;  4F3Q A;  4KIT B;  3EDP A;  2VUM J;  3JTG A;  4EMS A;  5J6X A;  1ETV A;  2V6E A;  2OQR A;  3WOD F;  3OS2 A;  2PBI A;  3ESW B;  5JHF A;  3CCS I;  2P6T A;  1UJ8 A;  2GOM A;  5J1Y A;  1F43 A;  1CGP A;  2XAU A;  2VT3 A;  3CES A;  4HNU A;  4BDY A;  4LK1 F;  4S05 A;  2NVQ J;  4A3I J;  3A0H C;  1VQM I;  4UVC A;  4RDU A;  2V79 A;  4HV5 A;  1G3W A;  2LBF A;  5CQE A;  4AID A;  1Z7L A;  3ZMS A;  3QOE A;  4A3B J;  1TT5 B;  2E2I J;  2GAU A;  4NHJ A;  1Y1W J;  2X4H A;  4XNF A;  2M0M A;  4II2 A;  4WX9 A;  2ICW G;  2DMU A;  2M9H A;  3D5S C;  3NWT A;  5BMZ A;  1O3S A;  1VQ6 I;  2MH2 A;  3LMM A;  3NWS A;  1SAN A;  2Z9O A;  1IC8 A;  2XIG A;  2XGD A;  4FQG A;  1TWF J;  1E3P A;  2O03 A;  3S2H J;  3SDG A;  4UUS B;  1Y8Q B;  3ABK H;  1FMW A;  4IHX A;  2K5C A;  1ACI A;  4DW6 A;  1H88 C;  1E3H A;  3BCA A;  2DA2 A;  2Y75 A;  3BTJ A;  4YEL A;  2V7F A;  5H20 A;  5B1B H;  5KK1 A;  5FRO A;  4AVZ A;  3ZQ7 A;  4LK0 F;  4CCO A;  3BPV A;  2JA7 J;  2X6Y A;  1RRJ A;  2EIL H;  3UNG C;  5F0F A;  3RDI A;  3FK7 A;  3RKX A;  3GTK J;  2L2O A;  3H35 A;  4HAM A;  4G7H F;  4MQV A;  3BJA A;  4D7N A;  1ZLJ A;  3PUF A;  2EBI A;  2YS9 A;  2X51 A;  4L9T A;  4E7L A;  2X6O A;  4A0Y A;  2AS5 F;  2CS3 A;  2VOD A;  3KYD B;  2MD5 A;  1ZG1 A;  1D8K A;  4PK4 A;  4DBQ A;  3OSG A;  4ZYD A;  4B09 A;  2Q2E A;  2OJE D;  3DBR B;  4IOA F;  4ENN A;  3U9G A;  2V1N A;  1HW5 A;  4LGW A;  1TBX A;  5CVJ A;  2YPR A;  1WJC A;  2GIZ A;  3OYG A;  5FLX Z;  1TC3 C;  1VQ7 I;  3S17 J;  5TGT A;  5FLX K;  3OYL A;  1Z91 A;  5DCF A;  1ZRF A;  4M3D A;  4A3K J;  4JYK A;  2LOO A;  1IN8 A;  4A69 C;  2M34 A;  1VQL I;  2CW8 A;  3BP8 A;  3F6V A;  3L2R A;  4XLH A;  5ED4 A;  3CUQ B;  2Q2E B;  4L0Z B;  1SAU A;  2JVG A;  4I98 B;  4DQ2 A;  2RQP A;  3LA3 A;  4RGS A;  4UVA A;  2E35 A;  1H0M A;  3DXJ F;  3HHH A;  3E0J B;  1K4S A;  3QU3 A;  2MLG A;  5IYC J;  2B7E A;  1ZR2 A;  1R00 A;  3M1E A;  3CCV I;  1YO5 C;  1ITY A;  1REP C;  3SZT A;  4KIC A;  4M9S A;  4U88 A;  2GM4 A;  2CV1 A;  2DJI A;  4XID A;  3ZQQ A;  2K02 A;  2X1C A;  1ORK A;  4LIU A;  1I27 A;  2W1O A;  2CUZ A;  2JUG A;  3HKZ N;  3AFH A;  2RRE A;  2FRH A;  3BCB A;  2PQ8 A;  4KJZ A;  4PGH A;  5L3B A;  4LD5 A;  3WU0 A;  4X0G A;  1LVK A;  4NBQ A;  1MIJ A;  4Y17 A;  1ETW A;  4HLX A;  2D5V A;  1JGG A;  1E0E A;  4C3J J;  3AG2 H;  5FFX A;  5J3L A;  3I59 A;  2BY0 A;  1VQ5 I;  1P92 A;  5L3E A;  3QU6 A;  2VJ5 A;  2E5Z A;  5JHU A;  2IVM A;  2XC7 A;  4EJT A;  3GTQ J;  2QKM B;  2FMY A;  5EGO B;  1KQ0 A;  4BQQ A;  5ICE A;  4K2E A;  3ZP5 A;  2PFB A;  1ZN2 A;  5HS7 A;  1OLT A;  4E4H A;  5EG0 B;  3PNV A;  1ENH A;  4RS8 A;  2XAF A;  1KU9 A;  2DBB A;  2L5Q A;  3K4C A;  2H6C A;  1HW2 A;  4RBO A;  1B1B A;  4TV7 A;  5JFR A;  4LG0 A;  2DOA A;  4HLY A;  1MDM A;  2IEK A;  3OS0 A;  2NVT J;  1TZL A;  2PMZ N;  3CCE I;  3H5N A;  5EGO A;  3BR0 A;  3ZQH A;  5IYB J;  1I1S A;  2LY9 A;  4XIC A;  5F64 A;  3QYF A;  1JHF A;  4Q48 A;  4XRF A;  1K78 A;  4ZDO A;  4D7M A;  3RIR A;  1RR7 A;  2M0C A;  4C3H J;  1A35 A;  1TQM A;  4HW0 A;  3GME A;  4RMN A;  5EEH A;  4A0Z A;  1WH5 A;  2M30 A;  3HGY A;  1XTA A;  1WFX A;  2MLK A;  4HEA 2;  1O3T A;  2EPF A;  5AON A;  3EPZ A;  2ACJ A;  3CMM A;  1UZC A;  5GP9 A;  1X4O A;  4Q4Z F;  2VBZ A;  4UUT A;  2O7O A;  3TP3 A;  4W1U A;  3TO7 A;  1KQ9 A;  2ZNZ A;  2YX7 A;  4PJL A;  4XMY A;  5BNG A;  2VKV A;  1MKM A;  2PLY A;  1GUU A;  2CYY A;  3FMQ A;  4P9U A;  1R36 A;  3GUD A;  1U9N A;  3ONQ A;  4PDK A;  4BY7 J;  5A2Q Z;  4A2U A;  4EM0 B;  4AD9 A;  3GF2 A;  5K7H A;  3JSO A;  2CQN A;  4M3G A;  4GO1 A;  1P9Q C;  3JAM Z;  1LEA A;  3BG7 A;  2BW3 B;  3DPT A;  4ENM A;  3BR1 A;  3JRE A;  1ZYR F;  2P7C B;  2EFP A;  2YX4 A;  2CQK A;  2E19 A;  2K40 A;  2F4M B;  1BJA A;  1F36 A;  3BT9 A;  4LOC A;  4E70 A;  1MNM C;  2IP2 A;  4QPO A;  5CYV A;  1J2X A;  3MWM A;  3ZPL A;  5D6F A;  3TO9 A;  1D1A A;  1D5Y A;  1DP7 P;  3FWE A;  1V3F A;  1XN7 A;  3O8H A;  2R7X A;  4Z6Y A;  1FOY A;  1IW7 F;  1W1W E;  4WXH A;  3RI4 A;  4ZZL A;  3K70 D;  1RUN A;  3IH2 A;  3M7G A;  2GOX B;  5ERI A;  2E2H J;  5B1A H;  3HSF A;  5GTI C;  2N8G A;  2ECB A;  4B43 A;  3J7A Y;  2OA4 A;  5D6E A;  1QRY A;  1YJN I;  5CJ9 A;  2RNG A;  2KLO A;  4HSR A;  4KT5 C;  4RAZ A;  4A3E J;  2HYG D;  4YRV A;  3CP2 A;  3MKZ A;  3V8K A;  1IN5 A;  2ZJ2 A;  3E5U A;  4KN4 X;  2VQC A;  4B48 A;  3OYI A;  2JQ7 A;  3FKI J;  1BR1 A;  3F8N A;  1OYI A;  4RGU A;  4CCM A;  1GHC A;  1JUP A;  4DYR A;  1N25 A;  1R4N B;  4CCK A;  4XM3 A;  3BPX A;  3HZJ A;  3S3N A;  3WTY C;  2OC6 A;  3FKJ A;  3KZI C;  4AVP A;  3IV5 A;  2NS8 A;  1TLH B;  1UST A;  2KL4 A;  2DYS H;  2A68 F;  2VB6 A;  4A3F J;  2DFI A;  1TP4 A;  3ZQI A;  1Z1D A;  1AA7 A;  4HZF A;  3BDD A;  3FXM A;  1NH3 A;  1YG2 A;  2NVY J;  2KPM A;  4I6Z A;  4MNU A;  4H0E A;  3ASO H;  3M8F A;  1MW7 A;  4XSX F;  2VJJ A;  3HRT A;  5DTD A;  2E7X A;  2G9W A;  1U78 A;  2EH3 A;  3KEY A;  1LFB A;  3IUO A;  3ZN0 A;  3IHU A;  3W6V A;  2NOG A;  2QCO A;  2P81 A;  4DGW B;  2KJB A;  1JGS A;  2HVS A;  3J7Z I;  3QPS A;  2OV7 A;  4CHU A;  4UV8 A;  3C1D A;  2W57 A;  4WWC A;  4XKC A;  3MKL A;  3K70 C;  2CH0 A;  3EUK L;  3C2H A;  1QHH D;  5GPA A;  2XVC A;  1UAA A;  2DPU A;  3HXL A;  2KIF A;  3TBI A;  4HG2 A;  2A6T A;  5F27 A;  3OYK A;  4NUB A;  4A5M A;  5F0C A;  1TT0 A;  2RAE A;  1IDY A;  1HF0 A;  3PJR A;  2X85 A;  4U0V A;  4XKV A;  2M8E A;  2DTZ A;  5FRN A;  3PSF A;  2HDW A;  4KDP A;  3I4P A;  3T1B A;  5FLV A;  4GCV A;  2CO5 A;  3RYP A;  3F21 A;  4GDF A;  2Q0O A;  1QGP A;  3E6D A;  2HR3 A;  2C6Y A;  3OSF A;  1J59 A;  1FLI A;  2RGV A;  1UHS A;  2P7V B;  3H92 A;  3I59 B;  4CXF A;  3Q5F A;  5GAD J;  1SFX A;  2FNP A;  1FTZ A;  2CV0 A;  4IRG A;  2ADU A;  3K1M A;  3N97 A;  5GAG J;  1JKP C;  1VI0 A;  3A01 B;  1EKE A;  3BTC A;  2OD5 A;  2VBY A;  4I02 A;  1UG0 A;  3IRR A;  2P5K A;  3M8E A;  2XKP A;  3ABU A;  4LIV A;  3F8B A;  2MAB A;  3OYD A;  3TW6 A;  2E1M C;  2XF7 A;  1OYW A;  1HDP A;  2R7V A;  4G12 A;  2W24 A;  5LFA A;  5D8K B;  2DDA A;  1FBU A;  2QYO A;  1XD7 A;  4BAY A;  2GQQ A;  1WJB A;  2JN6 A;  1P4W A;  5AIP A;  3PO3 J;  2XGE A;  3A1Y A;  1ZH5 A;  1PP7 U;  1FNN A;  1ZEL A;  1XPX A;  2O8X A;  2R7O A;  2RC4 A;  5M3M J;  1J09 A;  1RKT A;  1D0Y A;  2CQX A;  3IH4 A;  3OIQ A;  3HDD A;  2FML A;  4F55 A;  1S8N A;  1FP1 D;  1MMN A;  1S7A A;  4QTR A;  3ISP A;  1XG1 A;  4UVB A;  4EGY A;  3HSE A;  2HFH A;  5EYR A;  2ZSI B;  1SVM A;  4L9V A;  3ULQ B;  3TW7 A;  1E17 A;  2V26 A;  4E7S A;  1XGS A;  2LP0 A;  3HOV J;  2ZNY A;  4X6A J;  1EA3 A;  2HWV A;  3RQI A;  5F1J A;  2KZG A;  3OYN A;  1K6Y A;  1S7O A;  3W2W A;  4AIJ A;  5B3S H;  2FQ4 A;  3FXQ A;  1PYV A;  1VQ4 I;  2JMW A;  3MFK A;  3G2B A;  2VOO A;  2E1N A;  3FXU A;  1QPM A;  3D0S A;  5ILS A;  2ISY A;  2VIX A;  4EVI A;  3S1R J;  4ZYE A;  3S16 J;  1LQ1 A;  1QQI A;  1S6L A;  3A4C A;  3M9A A;  1USS A;  2TCT A;  1FMV A;  4ANJ A;  3QYB A;  2EIM H;  3I58 A;  1R49 A;  1MD0 A;  1U0J A;  4BEH B;  4M9X A;  2UV1 A;  4CZZ A;  1A31 A;  2H27 A;  4IQJ A;  5EJC A;  1JHH A;  2VQH A;  1ZQ3 P;  4RAY A;  1OPC A;  3HUG B;  4RB1 A;  2OU2 A;  3GYH X;  3HOT A;  5DCM B;  1V5E A;  3HHG A;  4DYQ A;  1HSJ A;  2CFO A;  4BL0 B;  5HLG A;  4A3L J;  2EA2 A;  2DO7 A;  3KZZ A;  4I2O A;  4KIB A;  4PZJ A;  1TTY A;  3VFZ A;  2QSF X;  2QWW A;  3MD2 A;  3VSK A;  4BXF A;  1K83 J;  1MMA A;  5KAF C;  1TNT A;  1XGM A;  3I64 A;  3GW2 A;  3MVP A;  1GT0 C;  3C2B A;  5HNF A;  4EM1 A;  1IAW A;  1O7L A;  4RB3 C;  2OF7 A;  2NYX A;  1T2K A;  1MSF C;  2Y0S N;  1FOX A;  2R5Y A;  1YIT I;  4XQF A;  1ZRC A;  2R93 J;  1ZG3 A;  1NHA A;  2XRL A;  2JSP A;  1WGX A;  1T39 A;  2COM A;  4OMZ A;  1UB9 A;  2QM3 A;  2L7K A;  3FBN B;  3WE2 A;  1VQP I;  2VXD A;  1ZK8 A;  3BTI A;  3BY6 A;  3K2Z A;  4LLN A;  3FXL A;  2CW7 A;  2LVS A;  3C3W A;  2W00 A;  4M3B A;  3TMO A;  3E97 A;  1JE8 A;  5ILV A;  4HX4 A;  1P7I A;  3RZO J;  3H3U A;  5IYD J;  2M3A A;  1ON1 A;  2M4G A;  2WWY A;  1YI2 I;  4BHB A;  3E6M A;  3ROU A;  1QZY A;  1OR7 A;  1MGT A;  1O3R A;  3GFI A;  4I99 C;  1IXC A;  3OL3 A;  2VXZ A;  3OIP A;  4G7Z F;  1Z67 A;  3FK6 A;  3BTL A;  1YTY A;  4BXU A;  4NQW A;  5IP7 J;  1N77 A;  4ENK A;  2E7W A;  2CWE A;  5DD4 A;  1WKM A;  4XLF A;  1FYM A;  3J7A O;  1FC3 A;  5ICF A;  4G8X A;  4XLE A;  1MJA A;  2WV0 A;  3LQR A;  4U0Y A;  3PQJ A;  1FYK A;  4I01 A;  4BEH A;  5M5Y J;  1JI8 A;  4A0X A;  1JT0 A;  1OCO H;  2CFX A;  1BI1 A;  3S32 A;  2HPM A;  4QWQ A;  2LMD A;  4L18 B;  1R22 A;  2HS5 A;  3MMY B;  4M74 A;  5E1X A;  2Z2S B;  3H0D A;  1B72 A;  1WH7 A;  1GVJ A;  1HDD C;  2X48 A;  2M7B A;  3ZMU A;  4IX7 A;  3VDX A;  3ZQL A;  1X2M A;  2XKO A;  5FLM J;  1UMQ A;  1G4D A;  2G7H A;  1YW9 A;  1P4A A;  1QBJ A;  1DGR M;  1Y56 A;  4YFX F;  1Y6I A;  3RKW A;  2CW0 F;  3WG7 H;  2JRT A;  3E7L A;  3B6C A;  4CO8 A;  3REO A;  3R6S A;  3I55 I;  2YUS A;  3V4G A;  3HB9 A;  4MLO A;  3BZK A;  4CYC B;  1JKR C;  3BC8 A;  3N4M A;  4QSH A;  4NC7 A;  4LIT A;  4XKB A;  4LLG F;  4DNC A;  2XPW A;  2MW8 A;  2VPR A;  2CQ7 A;  4AC0 A;  1F1Z A;  4G6Q A;  4E7K A;  2MYS A;  2YU3 A;  1D5V A;  4FTH A;  3DF8 A;  3B73 A;  3QOP A;  1W0U A;  1F4K A;  2IS1 A;  4M9Z A;  2HQN A;  2WBM A;  3C2G A;  4IZZ A;  3ASN H;  1Q1V A;  3R4K A;  1Q1H A;  2VBX A;  1OKR A;  3C18 A;  1I3Q J;  3BG9 A;  4I0A A;  3F22 A;  1ETO A;  2XAJ A;  3HJE A;  3TKY A;  5E18 F;  3DKW A;  3GLL A;  3VPR A;  3PSI A;  4OMY A;  2E60 A;  3HOZ J;  1I3A A;  3K4K A;  4KA4 A;  2Q8K A;  1X3U A;  1H9T A;  5LHH A;  1RES A;  2WC2 A;  2M2E A;  3NAR A;  2UZK A;  2I8D A;  3H9Q A;  2QVO A;  4NB5 A;  5HLT A;  3WTW C;  1YHQ I;  3FDY A;  2L7F P;  1FOW A;  1XMK A;  1KYZ A;  1YJW I;  2DOE A;  1QNT A;  3FHN A;  2OPT A;  3BR6 A;  4EJO A;  2F5F A;  2FSW A;  2DQR A;  3LOC A;  1MBF A;  2NS7 A;  4HA8 A;  2M8G X;  1ZGA A;  4XBF A;  4EAT A;  4P5O A;  4ZH4 F;  3MCZ A;  4RB2 C;  1FX7 A;  3DKY A;  2VJI A;  2Z1D A;  1UHW A;  2FU4 A;  4ZTF A;  5GPC A;  3PM1 A;  3HOY J;  1Z3X A;  2ELJ A;  3RPQ A;  2ESN A;  2VE9 A;  1FEX A;  1HC8 A;  4ZYA A;  4OAZ A;  5ICG A;  2QZ8 A;  2NS0 A;  4GXO A;  1BI2 A;  1ETK A;  1J75 A;  1FPQ A;  1WQ2 A;  2IS2 A;  3HYI A;  3GTG J;  4A3J J;  2XPU A;  3VEP A;  4YG2 F;  3CP8 A;  2CSO A;  2PN6 A;  4IHV A;  2ESH A;  3BJ6 A;  2LD5 A;  1G6N A;  3G4S I;  3SQN A;  5BPI A;  2V6C A;  1CF7 A;  3ZGK A;  2ELH A;  1AKH B;  2EFN A;  2D2W A;  3KZY A;  2CG4 A;  4CA0 A;  2KDZ A;  1O57 A;  1SD5 A;  4BJ5 C;  2LF8 A;  3BQZ A;  5F0H A;  5DS9 A;  4CIC A;  3MKW B;  5FFZ A;  5C4J J;  1K78 B;  2HXI A;  3S2W A;  3WGG A;  4IEJ A;  3S1M J;  1BIA A;  1YYV A;  4DBR A;  3WU1 B;  1E2X A;  4XR6 A;  4A6D A;  3JRF A;  2VKH A;  1QO0 D;  2QKL B;  4LG0 B;  1MBG A;  1J7K A;  3D1N I;  4EJW A;  4BGD A;  2Z33 A;  1DUX C;  1MMS A;  5HNH A;  6PAX A;  2UXX A;  1GDT A;  3P9I A;  2DK5 A;  3WHC A;  1XS9 A;  5TJJ A;  5B66 C;  2R7Z J;  4M6Y A;  4MIM A;  3VOE A;  3ZMT A;  3CDI A;  4C9Y A;  4HOB A;  3G1M A;  3H5A A;  3RSN A;  3CO7 C;  4JX5 A;  1UEL B;  2MD0 A;  3FMR A;  2NVU B;  3FM5 A;  3LL7 A;  3RCO A;  4NNJ A;  2Z5U A;  3OYE A;  1ZRE A;  1VF9 A;  5B5E C;  2HDD A;  5DYM A;  5J1U A;  5L3D A;  2RV8 A;  1LB2 A;  2HTS A;  3KX2 A;  2R4G A;  1FT9 A;  2FA5 A;  3HM5 A;  2HKO A;  3VYU B;  4DIQ A;  4U7D A;  2NRA C;  1A5J A;  2R7F A;  1YFH A;  5IOY A;  1KON A;  3TO6 A;  5J47 A;  1ZLK A;  1XGO A;  1AHD P;  2KIS A;  3BJO A;  2P8T A;  2X6W A;  1FWZ A;  2QEX I;  3CMY A;  4OIR F;  2M1B A;  3W6K B;  3ABT A;  1RR8 C;  2OQG A;  2DAO A;  1ERD A;  4C2M J;  3SHF A;  1YX3 A;  2JTV A;  2VKE A;  2DK8 A;  2H09 A;  2QF7 A;  3KIO A;  2H1K A;  5D5X B;  4ABZ A;  1X58 A;  2R7W A;  1IF1 A;  2DN0 A;  1FYL A;  4XLA A;  3KP4 A;  2DOF A;  5FRM A;  2BHZ A;  2L9N A;  3J81 Z;  5JVG F;  1FJL A;  2E1O A;  3WE3 A;  3HRS A;  1F5T A;  4O5V A;  4XOT A;  3CLQ A;  2IS6 A;  2VQG A;  4A3D J;  2DA6 A;  2ZXJ A;  2V9K A;  1QHG A;  4GRI A;  2BXZ A;  1Z6R A;  2K3F A;  3OL4 A;  4QLC U;  3WTS C;  4UUS A;  3DCF A;  4HYE A;  3OYA A;  3QPL A;  2XSJ C;  2KDO A;  2DDB A;  5L3G A;  4AWX B;  3CCJ I;  4MEX F;  3PUB A;  2XF5 A;  2VT2 A;  5GTH C;  3DLL F;  1AU7 A;  3IKT A;  1RI7 A;  3GX4 X;  1ZKG A;  3SZG A;  4IXA A;  1GVD A;  5BQT A;  2RNJ A;  4BH9 A;  1MBH A;  1YRN B;  3AL0 C;  4V2F A;  4J01 A;  3HPH A;  4HDV A;  2ZC2 A;  1XDU A;  2QBY A;  2JPC A;  2Z99 A;  3ELK A;  2LF7 A;  2CV2 A;  3AG4 H;  1E3O C;  2O9L A;  2FQ3 A;  4BHP A;  2VBW A;  3ZN1 A;  2DJN A;  2ELK A;  4IHW A;  4KYW A;  1U8R A;  1SMT A;  3GTJ J;  5IPA A;  3E6C C;  1RPW A;  2DFH A;  2ZCW A;  3EYI A;  1HW1 A;  1S5L C;  3WTZ A;  1GV2 A;  3GZ6 A;  1U5T C;  2XV4 S;  1GV5 A;  2EV6 A;  4LB6 B;  1IV8 A;  4EEF G;  1T08 B;  4KMU X;  3CCR I;  4MGR A;  4LFU A;  2QBY B;  5J1R A;  3DV8 A;  2AXT C;  2A3S A;  2GXB A;  1Z7U A;  2L7Z A;  2XB5 A;  5FO5 A;  3ZCO A;  4Y7N J;  3GZN B;  2F4I A;  5FKN A;  4FAS D;  1NK2 P;  2RVC A;  5EEG A;  1L0O C;  1GXQ A;  4XOR A;  1G59 A;  2Q1Z B;  3DTK A;  3FMS A;  2CGP A;  4Y15 A;  1UHM A;  1QZE A;  2PG4 A;  5D5V B;  2LKP A;  2E36 A;  5F6F A;  3UR3 C;  3HIF A;  2ZKZ A;  2L0K A;  3O8G A;  5JLX A;  3BZC A;  3SEZ A;  1W7P B;  1MJ9 A;  4PJM A;  3L2V A;  4KIF A;  4BXX J;  1OCP A;  2LBF B;  1WSU A;  1YQA A;  2IGK A;  4N4N B;  1XSX A;  1AWC A;  4BY1 J;  2IGN A;  3O2P E;  3L2C A;  1MBK A;  4FX4 A;  4BBS J;  4LMY A;  2FE3 A;  4U0W A;  4XOP A;  3OYH A;  2GIV A;  3KET A;  3I56 I;  2ID3 A;  2EFO A;  2VL8 A;  2F5E A;  3CCL I;  3HRM A;  3HOW J;  2W25 A;  2P5L C;  2ECC A;  2IT0 A;  3FZV A;  1U9O A;  2EZL A;  2K27 A;  3CZ6 A;  5HS9 A;  2EB7 A;  5FJ8 J;  3BZ6 A;  1RKW A;  3ZXS A;  1NK3 P;  3I71 A;  1HCR A;  2V1D A;  4HBL A;  2XPV A;  3LA2 A;  1MZB A;  2BVM A;  1DGW Y;  1TWC J;  3A0B C;  3Q9S A;  4DZJ A;  4GFB A;  2FBH A;  4DJA A;  2KRF A;  2A61 A;  1X1P A;  1DPU A;  2YU9 J;  1LFP A;  1OCR H;  2CRG A;  2ZME B;  2LTP A;  2OAZ A;  2FOK A;  2Y0S A;  4IRI A;  1SVO A;  3JRI A;  4NC6 A;  4Y3O A;  3JRA A;  1VFC A;  4I7H A;  1FSH A;  3CME I;  3FX3 A;  1BIB A;  3HOX J;  4D0P A;  5DUI A;  2BV6 A;  4BE1 A;  2LYC A;  1BR4 A;  5DM6 F;  3DTE A;  2LC2 A;  1G8X A;  1RET A;  3OYJ A;  3HL2 A;  1YIJ I;  3A03 A;  5AIQ A;  2W82 A;  2J5O A;  3L2U A;  4JBA A;  2K7L A;  2EQR A;  3WGH A;  4P96 A;  4XRM A;  2VLA A;  2KKO A;  4ZTJ A;  4RA2 A;  3BR3 A;  3V7S A;  4OIQ F;  3CUQ A;  1EH8 A;  5KNL A;  3OMY A;  3BWG A;  4MO7 A;  3TDZ C;  2JRM A;  3ZMV A;  4DOZ A;  4BKX A;  3EUH A;  1X19 A;  5K5Q A;  4WK8 F;  1AOY A;  3MAJ A;  1WVR A;  3CUQ C;  1LUJ B;  1ODD A;  4C3I J;  4HRI A;  1U3E M;  2AQE A;  1VTN C;  2L7M P;  3EUH C;  4ZZD A;  3MQ0 A;  4EGZ A;  3SEQ A;  4I76 A;  2V1X A;  5L3C A;  2KIU A;  2EV0 A;  3SFZ A;  3M3Y J;  3TL4 X;  4AYB A;  3F8F A;  3HG9 A;  3KPH A;  2A05 A;  1D3Y A;  4MHG A;  3JR9 A;  1O4X A;  1HLV A;  4UNO A;  2XAH A;  3BOQ A;  5E3N A;  3FXK A;  4I0B A;  4G6D A;  2FXA A;  2PI0 A;  2V1U A;  2ZFU A;  5M3F J;  2LSO A;  2STT A;  2DA7 A; 
#chains in the Genus database with same CATH homology
 5F0F A;  1P7I A;  3FK7 A;  5JLW A;  3GTK J;  3RZO J;  1T33 A;  1WI3 A;  5IYD J;  3I4N J;  3UKG A;  2WV1 A;  4D5F A;  4D7N A;  1FIP A;  2EBI A;  2YS9 A;  4JX6 A;  3GTP J;  3FK6 A;  3BTL A;  5IP9 J;  2X6O A;  2EZH A;  2DMQ A;  3G1L A;  5IP7 J;  3H3V K;  1VND A;  1JUS A;  3OSG A;  1MSE C;  1QVU A;  2DMT A;  5M5Y J;  1JT0 A;  3S17 J;  1TC3 C;  4NDL A;  1YRN A;  4M3D A;  1OCT C;  3BR5 A;  4A3K J;  4JYK A;  4A69 C;  2M34 A;  1B72 A;  1WH7 A;  1HDD C;  2X48 A;  3ZQL A;  1X2M A;  5FLM J;  1UMQ A;  1LE8 B;  1ZTR A;  4S0H B;  3E7L A;  3B6C A;  2YUS A;  3HB9 A;  4MLO A;  1JKR C;  4CYC B;  3I4M J;  4QSH A;  5IYC J;  2FD5 A;  5C3E J;  1ZR2 A;  3Q3S A;  2WB1 N;  3DEW A;  1ITY A;  4XK4 A;  2XPW A;  2MW8 A;  3GTO J;  2GM4 A;  1WPK A;  3HBL A;  3LSR A;  4XID A;  2VPR A;  4AC0 A;  1ORK A;  4FTH A;  5EG0 A;  4XRS G;  3BG5 A;  3HKZ N;  3M4O J;  1B8I A;  1W0U A;  3F0C A;  2DMN A;  2L9R A;  3ZOB A;  2CU7 A;  1Q1V A;  1ETW A;  1I3Q J;  3WHB A;  2D5V A;  3BG9 A;  1JGG A;  4C3J J;  5J3L A;  1ETO A;  5K7Z A;  3VPR A;  2JK3 A;  3HOZ J;  3JRG A;  3GTQ J;  5EGO B;  1RES A;  3S15 J;  2M2E A;  3NAR A;  5EG0 B;  3CQZ J;  4JP0 A;  1ENH A;  2MGQ A;  2L7F P;  4DYC A;  4A93 J;  4A3G J;  5FKM A;  2COB A;  2OPT A;  3BR6 A;  1IUF A;  4RBO A;  3RKQ A;  3ZQC A;  2JJ7 A;  1IJW C;  3OOU A;  2HOA A;  4JX4 A;  4L5E A;  1PUF A;  2IEK A;  3LOC A;  1MBF A;  2NVT J;  1QVT A;  2NS7 A;  2PMZ N;  3JRC A;  2LKX A;  2JA8 J;  1Z77 A;  2Y9Y A;  5EGO A;  1TWH J;  2M8G X;  3BR0 A;  3ZQH A;  5IYB J;  2CJJ A;  2KT0 A;  1S7E A;  2LY9 A;  4XIC A;  2IAI A;  5GPC A;  1POG A;  3PM1 A;  3HOY J;  2DA5 A;  2XSD C;  1FEX A;  4D7M A;  3RZD J;  1W0T A;  3MN2 A;  2R0Q C;  1RR7 A;  2EZI A;  2M0C A;  1ETK A;  2MG4 A;  1OJL A;  3CCY A;  4C3H J;  2I10 A;  3GTG J;  5FKL A;  4A3J J;  1Y1V J;  2XPU A;  2ID6 A;  4HNV A;  3GTL J;  1BW5 A;  2DA1 A;  4B4C A;  1LFU P;  1TWA J;  1WH5 A;  4IHV A;  3HGY A;  1JTY A;  2LD5 A;  2ME6 A;  4FIS A;  3GBG A;  5GP9 A;  2DMP A;  1TWG J;  3B6A A;  1AKH B;  1EF4 A;  4UUT A;  2O7O A;  3TP3 A;  4W1U A;  4MFE A;  1FIA A;  1DU6 A;  2KDZ A;  4FCY A;  3S1Q J;  1ZGW A;  2B63 J;  3BQZ A;  5F0H A;  5M5X J;  5DS9 A;  3S1N J;  5BNG A;  2VKV A;  5C4J J;  1WCM J;  5F08 A;  2HXI A;  3S1M J;  4IEJ A;  5FKO A;  1A6I A;  1GUU A;  2MSY A;  1U9N A;  4BY7 J;  5K7H A;  4A3C J;  4QIW N;  2NVX J;  3JRF A;  2R5Z B;  4M3G A;  3FIW A;  5C4X J;  1PUF B;  1MBG A;  4B3A A;  3D1N I;  3BR1 A;  3JRE A;  1JT6 A;  1APL C;  2E19 A;  1GDT A;  4FE7 A;  2FJ1 A;  2K40 A;  1JJ8 C;  3WHC A;  1R9T J;  1XS9 A;  5EEA A;  2R7Z J;  4MIM A;  2ME0 A;  1F36 A;  3BT9 A;  4LOC A;  1MNM C;  3K2A A;  3G1M A;  3L1P A;  4JX5 A;  1D5Y A;  5K7F A;  3JRD A;  3O8H A;  1FTT A;  1VF9 A;  2HDD A;  2X9D A;  3A01 A;  3GTM J;  5J1U A;  3IH2 A;  2E2H J;  1B72 B;  2HYJ A;  1A5J A;  3HM5 A;  2N8G A;  2ECB A;  3HOU J;  1I50 J;  1QRY A;  1JJ6 C;  5IOY A;  5E3M A;  3ZQG A;  4XRS A;  4A3E J;  1T56 A;  2JA5 J;  1AHD P;  2R5Z A;  4W97 A;  2G0E A;  4B1R A;  1NTC A;  3CMY A;  3Q0U A;  4V2G A;  2W48 A;  1XC5 A;  3FKI J;  2LR8 A;  5EZG A;  4C2M J;  3ZQF A;  2Y30 A;  5IP6 A;  4IHY A;  2VKE A;  1JUM A;  1JUP A;  1X2N A;  3H0G J;  4DYR A;  1ETX A;  3A02 A;  3CDL A;  2QF7 A;  1BL0 A;  5EZH A;  2H1K A;  3QQA A;  4ABZ A;  1X58 A;  1MH3 A;  3IV5 A;  2LLK A;  2NS8 A;  3Q0V A;  2EZK A;  2DN0 A;  2FX0 A;  2Y31 A;  3LSJ A;  5M5W J;  1QPI A;  2K9N A;  4A3F J;  1MBE A;  1ETY A;  1FJL A;  3ZQI A;  2E1O A;  2NVY J;  2DA3 A;  4A3D J;  4I6Z A;  2R92 J;  2DA6 A;  3FIS A;  4DZP A;  2XB0 X;  3HEF A;  1CQT A;  1H89 C;  3SFI A;  2GBY A;  4UUS A;  5DTD A;  3DCF A;  5E3L A;  3QPL A;  1U78 A;  2R5Y B;  2EH3 A;  3Q0W A;  1AKH A;  1LFB A;  5FKK A;  5HOD A;  2Y2Z A;  2TRT A;  3W6V A;  2IBD A;  2NOG A;  3IH3 A;  2QCO A;  2P81 A;  2K9Q A;  1AU7 A;  1ZKG A;  2JWT A;  3LSG A;  3QPS A;  1JKQ C;  1GVD A;  2DA4 A;  3JRB A;  1B8I B;  2HOS A;  3MKL A;  1MBH A;  1ZR4 A;  1YRN B;  5GPA A;  4V2F A;  4A3M J;  5F27 A;  2HXO A;  1BA5 A;  2AHQ A;  3NAU A;  1E3O C;  5F0C A;  2RAE A;  1IDY A;  4M3E A;  4D5C A;  1HF0 A;  2O9L A;  4IHW A;  2DJN A;  2ELK A;  2DTZ A;  3GTJ J;  5IPA A;  1RPW A;  2AO9 A;  5FLV A;  1GV2 A;  2CUF A;  2GLO A;  3BQY A;  1GV5 A;  1K61 A;  1ETQ A;  1IRZ A;  3OIO A;  3S14 J;  3OSF A;  4EEF G;  1UHS A;  1DU0 A;  1FTZ A;  5J1R A;  5F04 A;  3TED A;  2H8R A;  2L7Z A;  2XB5 A;  5EDN A;  4Y7N J;  1JKP C;  1VI0 A;  5FKN A;  3A01 B;  3BTC A;  1NK2 P;  3PO2 J;  2HOT A;  2XGC A;  3TW6 A;  1IG7 A;  1I6H J;  1HDP A;  5E3O A;  4M6V A;  1H8A C;  4G12 A;  2L0K A;  3O8G A;  5JLX A;  2VI6 A;  4BBR J;  4M3F A;  2K9S A;  4X1E A;  1HOM A;  2Y9Z A;  2JN6 A;  3PO3 J;  2XGE A;  4BXX J;  9ANT A;  1OCP A;  3G1O A;  4BY1 J;  2LFB A;  2JA6 J;  5M3M J;  1RKT A;  1UG2 A;  2CQX A;  3IH4 A;  3HDD A;  1LE8 A;  1MBK A;  4BBS J;  4QTR A;  1XG1 A;  2ID3 A;  2WAQ N;  5EYR A;  3HOW J;  3TW7 A;  2ECC A;  3HOV J;  1U8B A;  2LP0 A;  1U9O A;  2EZL A;  4J19 A;  5C44 J;  5FJ8 J;  1BW6 A;  4X6A J;  2ZB9 A;  3RQI A;  5F1J A;  1RKW A;  1NK3 P;  1HCR A;  4Y52 J;  1IDZ A;  3S2D J;  2XPV A;  2FQ4 A;  3LSP A;  3HGG A;  1SFO J;  5EF6 A;  1JKO C;  2JMW A;  4AUX A;  1P7J A;  1TWC J;  1IV6 A;  5IOZ A;  2CQQ A;  4DZJ A;  4GFB A;  1OFC X;  1Z0X A;  3S1R J;  3S16 J;  2YU9 J;  1BJZ A;  2LK2 A;  2CRG A;  3BG3 A;  3JRH A;  2LTP A;  2TCT A;  3JRI A;  2VUM J;  3JRA A;  1VFC A;  1ETV A;  1ZQ3 P;  1IGN A;  3HOX J;  2CUE A;  4DYQ A;  4FE4 A;  5J1Y A;  4A3L J;  1F43 A;  3BR2 A;  1JTX A;  2HQ5 A;  1RET A;  3A03 A;  2NVQ J;  4A3I J;  4RDU A;  1K83 J;  2EQR A;  4A3B J;  4XRM A;  2E2I J;  3TP0 A;  3MVP A;  1GT0 C;  3C2B A;  1Y1W J;  3BR3 A;  3K7A J;  4MFD A;  2OF7 A;  4MO7 A;  4BKX A;  2DMU A;  2M9H A;  2Y0S N;  1MSF C;  2R5Y A;  1G2H A;  4AYB N;  2R93 J;  4C3I J;  2XRL A;  1SAN A;  3LNQ A;  1WGX A;  2L7M P;  1IC8 A;  2E2J J;  2XGD A;  1MBJ A;  1TWF J;  4I76 A;  3S2H J;  3SDG A;  4UUS B;  2O8K A;  3M3Y J;  1ZK8 A;  3BTI A;  4IHX A;  3JR9 A;  4DW6 A;  1O4X A;  1H88 C;  1HLV A;  2DA2 A;  2HI3 A;  3BTJ A;  5E3N A;  2LVS A;  4CYC A;  2JA7 J;  4M3B A;  1MH4 A;  5M3F J;  2DA7 A;  3SJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...