1ITYA

Solution structure of the dna binding domain of human trf1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
b'EKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRF1
publication title Solution structure of a telomeric DNA complex of human TRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2002-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ityA00
3G1MA 3Q0VA 5FKMA 1WH7A 1IDZA 2CQQA 4W97A 3MVPA 2X48A 1MNMC 2K9QA 5IOYA 3O8GA 3IH3A 5FKOA 5GPCA 1UG2A 2KT0A 2VI6A 1GVDA 1F36A 4DZPA 3UKGA 3M3YJ 5DTDA 3O8HA 1RKWA 2XPWA 3GTPJ 9ANTA 1ITYA 3ZOBA 2M34A 1QPIA 4W1UA 3S1NJ 3BG3A 1Y1VJ 3SFIA 2ECCA 1ETOA 2IEKA 2JN6A 5K7HA 3GBGA 3OSFA 3JRFA 1WI3A 2EZKA 3H3VK 1XC5A 1WPKA 2HXIA 4G12A 2GM4A 2E2HJ 5JLXA 5FLVA 3HDDA 4ABZA 2G0EA 2B63J 5IYCJ 2DA7A 1U8BA 1MBJA 3S16J 1APLC 3FISA 3LOCA 4B4CA 1RESA 4BKXA 2LLKA 4A3GJ 2JA5J 5F04A 1JT0A 3BTCA 2FJ1A 2VKVA 4M3EA 4MO7A 3JRCA 1Q1VA 3SJMA 1XG1A 3FK6A 3BR0A 2CJJA 2JA6J 1JUPA 1Z0XA 3OSGA 1XS9A 1WH5A 5EZGA 5EG0A 1T56A 4A3EJ 3HOWJ 2RAEA 4I76A 4JYKA 3WHCA 1RR7A 1U9NA 2NS7A 1U78A 3GTKJ 3DCFA 5EEAA 1ORKA 3NARA 1MBHA 1ZTRA 3GTQJ 3BG9A 2HQ5A 5FKNA 1E3OC 1TWFJ 2ELKA 3CMYA 3SDGA 2K9SA 1W0TA 3LSGA 1MH4A 2PMZN 2R5YA 1JKRC 1A6IA 1OFCX 2XPUA 2DJNA 2E19A 2TRTA 1DU0A 4J19A 3ZQIA 3I4NJ 1TWCJ 4Y7NJ 2HOAA 2R5ZA 4RDUA 2R5ZB 3HKZN 2NOGA 2EZHA 1D5YA 2EH3A 3FIWA 1IDYA 2DA4A 5J1UA 2DA2A 3BR5A 1H89C 2MG4A 5EF6A 2CU7A 4AUXA 2HDDA 2I10A 1ZK8A 4M3GA 1JKOC 3S17J 2HI3A 4A3FJ 2HOSA 2VPRA 5FLMJ 1SFOJ 3S15J 3D1NI 1JUMA 1I3QJ 3BTIA 1YRNB 3GTLJ 5GPAA 2LFBA 1BL0A 1FTTA 2DA5A 3ZQGA 2FX0A 3OOUA 1GT0C 1RPWA 3RZOJ 5M3FJ 4A3DJ 1TWAJ 1X2NA 2DA3A 2ID3A 4EEFG 2TCTA 3FKIJ 2DTZA 2D5VA 3GTGJ 5EZHA 5E3LA 3JR9A 2L7ZA 1O4XA 2ID6A 1I50J 5HODA 4AYBN 3A03A 3LSJA 1NK2P 4I6ZA 2O9LA 4X1EA 5C44J 3JRHA 1MBFA 1GDTA 2VUMJ 5IPAA 1ZR4A 1R9TJ 2M8GX 2XGCA 4IEJA 1FJLA 2GLOA 3IH4A 1I6HJ 2HYJA 2LD5A 4FTHA 3JRGA 4A93J 3HOVJ 3TW7A 1WCMJ 2LK2A 4V2FA 2O8KA 3S1QJ 3JREA 2XB5A 4A3CJ 2LP0A 5IP9J 4A3JJ 4XRSA 4MLOA 4DZJA 3BR1A 5IYBJ 2L7FP 2LY9A 4M6VA 2K40A 1P7JA 4QIWN 2R92J 2DMNA 2E1OA 4UUTA 2JK3A 1POGA 4DW6A 1X2MA 3BT9A 3GTOJ 1MBGA 5J1YA 4AC0A 4BY1J 4C2MJ 5IP6A 1FEXA 1B72B 1W0UA 4M3FA 4XICA 1JUSA 2LVSA 2P81A 3RQIA 1JKQC 3S1MJ 4B1RA 3MN2A 1NK3P 3M4OJ 2KDZA 1DU6A 2NVYJ 2JMWA 2ME6A 1SANA 5FKKA 3BR3A 2R0QC 1BA5A 3PM1A 1HOMA 3G1OA 3ZQFA 3HB9A 2L0KA 5M5YJ 4D5FA 2E2IJ 4BY7J 4A3IJ 3ZQLA 4IHYA 2Y0SN 5F1JA 1F43A 1IRZA 1IC8A 3IH2A 1BW6A 5M5WJ 4DYQA 3TEDA 1UMQA 1BJZA 2AO9A 2Y30A 4XK4A 1OJLA 2IAIA 2HXOA 1VNDA 2X6OA 3CQZJ 3HEFA 1P7IA 1B8IB 5EGOA 3S14J 2DMUA 1S7EA 5EGOB 2DA6A 1X58A 1GUUA 2LR8A 3DEWA 2OPTA 2X9DA 1EF4A 5F0FA 4DYRA 4M3BA 3BTLA 1QRYA 1PUFB 2O7OA 3B6CA 1MSFC 1A5JA 3BQYA 2YU9J 5M3MJ 2ZB9A 3BTJA 3A01B 3IV5A 1H8AC 1ETYA 4BBRJ 1VFCA 5K7ZA 5C3EJ 4RBOA 2ME0A 4D5CA 4JP0A 3CCYA 3PO2J 2YUSA 3GTMJ 4A69C 1TC3C 2NVXJ 1BW5A 2NVTJ 3RKQA 3Q3SA 2CUEA 2JWTA 3ZQHA 1JTYA 1RETA 3E7LA 2ECBA 1YRNA 1VF9A 1ENHA 1Y1WJ 2M0CA 3S1RJ 2Y2ZA 3HGGA 1MBEA 2EZLA 1FIAA 1NTCA 2XPVA 2EBIA 3QQAA 5E3NA 1LFUP 4M3DA 1TWGJ 5F08A 4HNVA 2EZIA 1JGGA 4A3KJ 2MSYA 1OCPA 2Y9YA 1H88C 2NVQJ 2HOTA 2W48A 4FE4A 1UHSA 5IYDJ 4V2GA 3JRBA 1QVTA 4A3BJ 4D7NA 2H1KA 5J3LA 4D7MA 1HF0A 2EQRA 2LTPA 4B3AA 5K7FA 5C4JJ 2Y31A 2WV1A 4CYCB 5EYRA 4XRMA 1U9OA 4L5EA 4MIMA 3VPRA 3GTJJ 5GP9A 2XGDA 1ETVA 1HLVA 3HOUJ 3S2HJ 1JT6A 4MFDA 4QSHA 4C3HJ 2H8RA 2JA8J 2XRLA 2XSDC 4JX5A 1IUFA 3L1PA 1ETQA 3LNQA 1MH3A 3RZDJ 3MKLA 1HDDC 4Y52J 3BR6A 2AHQA 5IP7J 1ETXA 1HDPA 1AKHA 3HM5A 3Q0UA 4NDLA 1AKHB 1B72A 2DMTA 3TW6A 3Q0WA 1QVUA 2R93J 2OF7A 1AU7A 2VKEA 5IOZA 1FTZA 1ZKGA 4BBSJ 5BNGA 4LOCA 3JRDA 3QPLA 2QCOA 3K7AJ 3B6AA 2NS8A 3G1LA 5E3OA 1AHDP 1OCTC 1ZGWA 2YS9A 4BXXJ 2M2EA 3NAUA 3BQZA 3H0GJ 5J1RA 3FK7A 3F0CA 5FJ8J 4IHWA 1HCRA 2DMPA 3HBLA 4QTRA 3HGYA 4IHVA 3CDLA 1ZR2A 1GV5A 4A3LJ 1ETKA 5FKLA 1B8IA 3W6VA 3K2AA 4DYCA 1WGXA 1FIPA 3BR2A 3A02A 5DS9A 5EDNA 2COBA 2L7MP 4FISA 4S0HB 5EG0B 3HOXJ 4FCYA 4C3JJ 4JX6A 1PUFA 2E2JJ 2WAQN 1JJ6C 1GV2A 1K83J 4C3IJ 3S2DJ 1LFBA 3TP3A 3A01A 3LSPA 2CQXA 1G2HA 4MFEA 1IG7A 2FD5A 3JRAA 2FQ4A 2MW8A 3PO3J 3BG5A 5E3MA 1MSEC 1IJWC 3HOZJ 2DN0A 5F0HA 2XB0X 2CUFA 2WB1N 2XGEA 2R5YB 1JKPC 3QPSA 2DA1A 3TP0A 2QF7A 1JJ8C 1MBKA 3ZQCA 5C4XJ 3LSRA 5F27A 2R7ZJ 5JLWA 1VI0A 1T33A 4FE7A 3HOYJ 3WHBA 2JA7J 3OIOA 1Z77A 2L9RA 5F0CA 4IHXA 2DMQA 5M5XJ 2CRGA 2IBDA 3C2BA 4GFBA 1CQTA 3JRIA 2M9HA 4XIDA 2MGQA 2GBYA 4XRSG 1IGNA 1ETWA 2LKXA 1ZQ3P 1TWHJ 2JJ7A 1LE8A 2K9NA 4UUSA 1LE8B 2N8GA 4UUSB 4CYCA 1K61A 2Y9ZA 3I4MJ 1JTXA 4JX4A 4A3MJ 1RKTA 1IV6A 4X6AJ
chains in the Genus database with same CATH superfamily
2RGVA 2VQGA 2H8WA 3SQNA 2CQQA 2Z5UA 2X48A 1WVRA 3K0LA 3DKXA 1MNMC 2K9QA 2ZCWA 2PBIA 1D1CA 1UG2A 2KT0A 2VI6A 4LK1F 4ASNA 1J5YA 1FYMA 2KIUA 1QZZA 1RRJA 1D0ZA 4HF2A 5KAIC 3HHGA 4EGYA 4L0YB 1TNTA 2AXTC 1G3TA 2V1XA 4MQVA 1ON2A 2XPWA 3OY9A 4PJMA 4LLLA 3K4KA 3ZOBA 2M34A 1VQOI 1QPIA 4DNCA 1CF7A 4Y3OA 1Y1VJ 4L9VA 2ELHA 3I5UA 4KN4X 5DCMA 3REOA 2IEKA 2JN6A 4WXCA 1W36D 1W36C 3M7GA 3GEZA 5L3GA 1IV8A 4G7HF 2L54A 3R6SA 1WI3A 1MMSA 1ZRCA 3KCCA 1KYZA 2QVOA 1BR1A 5FLVA 3HDDA 4FETA 3OL3A 5IYCJ 3H0DA 3QOPA 3WGGA 5CVIA 1Y8RB 3S16J 1APLC 3FISA 4XNFA 2ZKZA 4Q4ZF 4B4CA 4YIIA 3F21A 2JA5J 1ZREA 1OCCH 4UY8I 3BTCA 5KK1A 4HF1A 4LG3A 2P5LC 1OPCA 3E6CC 3KP4A 4HV6A 4NUBA 4XSXF 2CJJA 4AU7A 2JA6J 5TJJA 1JUPA 1Z0XA 2E36A 2VKDA 3OSGA 2XAUA 2RNGA 4FX0A 5EZGA 1IF1A 2EFQA 3FMSA 3HOWJ 4XKWA 4XLAA 2ESNA 1XMXA 1YIOA 1XGSA 1LPQA 3K10A 4BJTA 3ASNH 1U9NA 3U1KA 2XF5A 1U78A 3H3UA 2A6EF 3I64A 1YITI 2MABA 2JUCA 2EIMH 3NARA 1Q1HA 4KITB 3CUQB 3G2BA 3LQQA 3MD2A 3T1BA 3GTQJ 3BG9A 5FKNA 1H9GA 4BJ6C 4OAYA 4ENJA 2Z99A 1OQYA 1E17A 3KYLA 1QZEA 1Z6TA 4BDZA 2KZVA 2PMZN 1PJRA 1JKRC 4DBQA 1OFCX 1YYVA 3HXLA 3K1PA 2DJNA 5J6XA 5JI6A 4ENMA 2ZJQF 1DU0A 4J19A 3JAMK 1O57A 4E7SA 1F4KA 2WY8Q 3W2WA 4R79A 4KISA 2CW8A 1HSTA 4I7HA 4IXAA 2KJBA 4UB8C 3OMYA 5JHFA 2BW3A 4HSRA 2UV1A 1ZELA 5J1UA 3T0YA 2DA2A 1GVJA 1LJ9A 4XKBA 1RUNA 1R1VA 2MG4A 3CDIA 3CUOA 2BZTA 4AUXA 2IGNA 1FMVA 5DCFA 2QENA 2HI3A 1ZLKA 5FLMJ 3L2WA 3F6OA 3S15J 2HPIA 1A31A 3BTIA 1FTTA 3CMEI 4NHJA 3RZOJ 2FX0A 1XGMA 5M3FJ 1REPC 4RAZA 1X2NA 2DA3A 2BE5F 2R7VA 2TCTA 3FKIJ 2BXZA 3BZ6A 4PGGA 3DPLC 2PJRB 2EV5A 1E2XA 1OR7A 2E5ZA 5EZHA 3VYSB 1SC7A 2HZTA 1LUJB 1TZLA 2ID6A 2E1MC 5HODA 4AYBN 4LB6B 1J09A 4P9UA 2Y69H 4P9FA 4CUGA 1NK2P 2KMUA 4X1EA 5C44J 3JRHA 2F2EA 4HBLA 3ABUA 2M8GX 3FXUA 4BEHB 3L9FA 2O3FA 2HYJA 4RGSA 1B6AA 2DJIA 2DFEA 2VJ4A 1UB9A 4HOBA 3NEUA 4FTHA 3LQRA 2XAJA 3AG4H 3EETA 3HSEA 3QODA 1WWXA 2O8KA 3RCOA 2HNHA 4LG0B 5BPDA 2XB5A 3D5SC 2LP0A 3EUAA 4XN0A 1WFXA 4XRSA 4MLOA 4CCNA 3C2GA 2H1LA 3QOEA 5IYBJ 1MD0A 2LY9A 5HVQC 5JR3A 1S9HA 1Y39A 4XKVA 4UUTA 2WWYA 3CCSI 3L2UA 1LEAA 4DW6A 1SD7A 3GTOJ 4C2MJ 2LDUA 2ZNZA 1FEXA 1W0UA 2R4GA 1K7AA 2LVSA 3RQIA 3CC2I 1MMNA 1W7PA 3RQ4A 4UUVA 5LGTA 4XLFA 3ZQLA 2Y0SN 3OYFA 3N05A 4ZTJA 3ZR8X 5LHIA 1MJAA 1IRZA 4ZDPA 1TTYA 2VKHA 1FBUA 1S7OA 1F43A 4BJ5C 4PSXA 4NC7A 3RI4A 4PJNA 2X1DA 4DYQA 4GXOA 1T08B 2NNYA 2E1NA 1BI2A 2Y30A 3LSIA 1OJLA 2EFWA 5FO5A 4E7HA 3KZIC 1O3TA 1VZ0A 3WTVC 1W5SA 2EA4A 2LBFA 1VNDA 3DLLF 4ZYGA 2L02A 3CUQA 1LB2A 3I59B 2M7BA 1B8IB 4CCLA 1MNEA 5HOOA 5EGOA 2VOOA 4BQQA 4LITA 2GIVA 3DU5A 1OLTA 2DA6A 1OYWA 2EV6A 5ICGA 4ZYAA 1KU3A 2KIFA 2V1UA 2Z9OA 1O3SA 2OAZA 1WQ2A 2KZGA 4DYRA 3QP5A 1U5TB 3TDUC 2VJIA 2BHZA 1YJNI 4YFKF 3V8JA 2MFZA 3DTKA 4OWRB 4E7KA 2O7OA 4ENNA 4M6YA 3P9IA 5M3MJ 4UB6C 2HVRA 4BHCA 3A01B 1W1WE 2K7LA 4AWXB 3IV5A 1H8AC 4BBRJ 1SFUA 3MCZA 5C3EJ 1A6QA 2VPLA 3CCYA 3A0HC 1I39A 3P7NA 4M6XA 2NVXJ 4Z6YA 1T39A 3RKQA 2IGMA 3Q3SA 2CUEA 4EM1A 1AWCA 4HX8A 2PI0A 5J47A 4DJAA 5FD5A 1ENHA 2E7XA 1Y1WJ 2DK5A 3PIOF 4OIOF 3HGGA 4S05A 5ICFA 1IXRC 2PMUA 5K5QA 1DQUA 3V4GA 2CWEA 2FRHA 2PJRA 2R7DA 3ASOH 4KFCA 3WG9A 3QQAA 3OYIA 3BCBA 5E3NA 2QQ9A 1JGGA 3H36A 1ODDA 1HKTA 3KZZA 2FEZA 2KIMA 4MGRA 4LLGF 5BOXA 5IYDJ 4RLQA 2E7WA 3T5XA 2Z33A 4BEHA 5C4JJ 4UVCA 2XAGA 2DW4A 2WV1A 2Y31A 4UV8A 6PAXA 3QAHA 2FF4A 2DBBA 3KEOA 1U9OA 4HDUA 1YTYA 3QWLA 3H1CA 1ZG3A 5GP9A 2EJRA 4B8XA 4HPQA 1B59A 1DGWY 3CLOA 4KT6A 3I54A 3S2HJ 1JT6A 4LG0A 2XAQA 2JA8J 3N4MA 2XSDC 1D5VA 1ZRFA 1ETQA 3OYBA 3RZDJ 3MKLA 1HDDC 3OIQA 3DBLB 4BL0B 3BR6A 4D0PA 2IGKA 2OTLI 4DGWB 4ZDLA 5IP7J 3E3VA 2F4OB 1HDPA 2A61A 1AKHA 2ADUA 4NDLA 2EV0A 3BPXA 1IUYA 2GZWA 3EDPA 1YOVB 2F5EA 4WXHA 1EA3A 2ESHA 1MIJA 2I8DA 1IO2A 3RYRA 3DKYA 5TISC 1QGPA 2PX9A 3BZKA 2ZXIA 4XLCA 2L2OA 2M7AA 4C30A 2XROA 3DFGA 2XF7A 3CCVI 1U3EM 3ABTA 3RPQA 4OMZA 5GAGJ 2YX7A 1LVAA 5IOZA 4LOCA 1O7LA 3JRDA 3L2VA 1EV7A 4ZYDA 2F5VA 2X0LA 2QCOA 3KP3A 3K7AJ 3Q9VA 1ZYRF 4ZDOA 2RREA 4KMFA 1T6SA 1XSXA 5KVRA 5E3OA 1P4AA 2PMHA 1ZGWA 2C6YA 1YI2I 3RKYA 3NAUA 2J5OA 3H0GJ 2IGOA 1FOKA 2CFOA 2I5UA 4CZZA 1WJEA 4IHVA 1ZR2A 1ETKA 2RQPA 3M07A 1BR2A 5J4YA 1B8IA 4KT5C 1XSVA 3HUGA 3RTRA 1HKQA 4Q5SF 1B1BA 1WGXA 3BR2A 3IAM2 2XRNA 4KNYA 3V42A 4E6KG 5EDNA 2OQRA 1MDMB 4S0HB 5EG0B 1U5TA 3HOXJ 4CCMA 4WF2A 2IA2A 4C3JJ 3PUFA 2E2JJ 3V7SA 2HOEA 3T8RA 4RGXA 2W24A 2QKMB 2PG4A 1P6RA 4M72A 2IS4A 5E79C 3BY6A 1JXSA 2L4AA 3TP3A 3A01A 2CS3A 4XSZF 3V7RA 2JVGA 1DUXC 3ECHA 3K4CA 4MFEA 2FD5A 1IG7A 1I5ZA 1G2HA 1ZGJA 1TT5B 2G7UA 4Z2YA 5E3MA 1KU7A 2DN0A 2E60A 5ILSA 1PDNC 4BE1A 3KP6A 4NBQA 2R5YB 2ZXJA 2ETHA 4CHUA 4ZZLA 2VC0A 1JJ8C 2HS5A 4U87A 1BOBA 2NAZA 3FXQA 2JA7J 3DBRB 2L9RA 3OIOA 3QPTA 3ZMUA 1R36A 5CKTA 4UVAA 5B1BH 3WGIA 2V26A 2JSPA 2L01A 2EFPA 4GFBA 2XSJC 2CV1A 3BJAA 5H6QA 3ZPLA 1TWHJ 4C2TA 1V54H 2W84A 1PP8F 2K9NA 3OR2C 1J59A 1U8RA 3E0JB 2FBKA 4KJZA 4LMYA 2VN2A 1UFMA 4JX4A 1RKTA 2DODA 3GZ5A 4LLNA 1R1TA 2Z2SB 3Q0VA 4M73A 1YFHA 4B44A 4W97A 4KIFA 2R7QA 5F64A 2XIGA 3HRMA 5GPCA 2IS1A 4BYYA 1FOXA 2HR3A 2YSRA 3F9KA 1N78A 4ZZDA 2OQGA 4MQ9F 4R8HA 2QSHX 4DZPA 3UKGA 3TO7A 3JTGA 3J7YJ 3CCQI 4BUPA 1GLNA 1HBXG 1OR7C 3LWFA 4XM3A 9ANTA 1Z7UA 4W1UA 4OU0A 3SFIA 1CF7B 4NB5A 2ECCA 3WTTC 2DT7B 3MFKA 3HPGA 1HA8A 2DI3A 4XLNF 2DFFA 3COAC 4FX4A 3ZMSA 2K02A 3FXKA 4G12A 1B4AA 1NG6A 2P6SA 2E2HJ 5JVGF 1G3SA 1X1CA 4IHSA 4ABZA 3GX4X 1BR4A 1FC3A 4F91B 2ELJA 1HW5A 3TKYA 3E97A 2X85A 2LG4A 4IJAA 1Z21A 1MBJA 3K69A 4II3A 2D1HA 4P5OA 1TL8A 1RESA 1VQMI 2LLKA 4A3GJ 1D3YA 3OS0A 3GZNB 2IXSA 3DTEA 4AD9A 1JT0A 4XN3A 1XDSA 5FRNA 2J5PA 2F5FA 1MNDA 2EA2A 1J2XA 3FK6A 3FMQA 4AIKA 2JRMA 1LNWA 3BR0A 3CZ6A 4HSTA 3HHHA 1R7JA 1IN4A 3TOAA 2DFIA 5EG0A 1T56A 3GYHX 3K4JA 2RAEA 3MQ0A 2YX4A 2DXIA 1FWZA 3M8FA 2NS7A 1MMDA 4PJ0C 3GTKJ 4J01A 3K4BA 2A69F 1ORKA 1DDNA 1MBHA 1ZTRA 3ZMTA 3P5JA 2ZO4A 2K4JA 1E3OC 1DGRM 1IN8A 4N4OB 1X3ZB 3LSGA 1VQ5I 2ISYA 2R5YA 4OOIA 1A6IA 2E19A 2ZMEB 3ZQIA 3I4NJ 1AA7A 4U0WA 3OYHA 3CUQC 2COMA 2CUJA 2R5ZA 1WJAA 2IS6A 4RDUA 1QPMA 3PSIA 1JGSA 3OR1C 3QYFA 3F22A 1QNTA 2EZHA 1UELB 1S29A 1D5YA 5BPIA 3ISPA 4YELA 4IKFA 4R1HA 3A2KA 1JKOC 3S17J 4A3FJ 1RIOH 3CP8A 1SFOJ 2CMPA 5HLIA 4I2OA 3DPTA 3U21A 2H6CA 2MC3A 1YRNB 3GTLJ 5GPAA 4F52A 3J80Z 4F55A 2W7NA 1GT0C 3A4CA 3OOUA 5L3DA 4EM2A 4EEFG 5CVJA 1VTNC 4Y4RA 1D8JA 2HDWA 3M1CA 2V6CA 2XKOA 4XLPF 5E3LA 4EVIA 3GFIA 4BE0A 3GTGJ 1JI8A 2A6TA 2W57A 5CLSA 1NHAA 3DPUA 1P4XA 1R1UA 5DD4A 2LF8A 2AS5F 5D5WB 1V55H 2Q8KA 2WAEA 2NVUB 1ZR4A 4NNJA 2UWMA 2OU2A 2G7HA 1I6HJ 1BM9A 3ZMDA 5L3CA 2LD5A 4QPOA 2D2WA 2R3SA 3JRGA 4C9YA 1Y8QB 3CF5F 3H35A 5FLXZ 3HOVJ 3TW7A 1XN7A 4WX9A 1R22A 3S1QJ 1ZG5A 5CVVA 4A3JJ 1WZ2A 1JHFA 4IOCF 3P9KA 1RZ4A 3AG2H 3JCUC 3C7JA 4M6VA 4EM0B 2K40A 1P7JA 3DP7A 4G7OF 4QIWN 2R92J 3X2QH 1Z05A 1XSDA 2JK3A 1KZHA 1X2MA 3I4PA 3CJNA 4BQAA 4BY1J 1IRXA 5IP6A 1JHHA 1UZCA 3TOBA 3W3CA 4KUMA 4HYEA 4EJOA 2CUZA 2FA5A 3IAS2 1WJ5A 1FZPB 1LQ1A 1MW7A 5J40A 4DOZA 2KDZA 1DU6A 2JMWA 1W7PB 3BR3A 3BG7A 2R0QC 1BA5A 3GFMA 3PM1A 3G1OA 5HDNA 2PLYA 4A5NA 4D5FA 4BY7J 4HA8A 2R7UA 3F23A 4IHYA 1TLHB 2QYOA 4F92B 5F1JA 4Y17A 1YJWI 1WKMA 2WBMA 4A5MA 3TQNA 3WODF 1BW6A 1ZAOA 1UMQA 4BGDA 4ZYHA 4ZH4F 4ETSA 2AO9A 1X4OA 3E5UA 1XPXA 4U0VA 4XONA 2O61A 4XR6A 3BDDA 4I01A 2X6OA 4HG2A 4MNUA 2LBFB 1P7IA 3FHNA 3S14J 1S7EA 5EGOB 3DU6A 4LK0F 2EIKH 1LFPA 1WHUA 3MAJA 2NNNA 2X9DA 2R7RA 1EF4A 2ZMEA 1E3HA 4AM3A 3J7AO 4MEXF 2DO7A 4HEA2 1I27A 3OS1A 1J9IA 1QRYA 2CYYA 2K85A 1SEUA 1BI0A 3AG1H 1KQ9A 3LFUA 1ZG1A 5IT9K 3NQOA 4LD5A 2FNPA 4KA4A 1USTA 3J80K 2DTRA 4O6JA 2P7VB 1W5TA 3VYUB 5DEQA 1U5TC 1VFCA 1RR8C 2WADA 5K7ZA 2VJJA 2ME0A 2MH9A 4D5CA 4JP0A 5B5EC 5LEKA 3GTMJ 4GYGA 4A69C 3L2RA 4BDYA 1JE8A 1XDUA 1W4MA 3NWTA 2ECBA 5D6FA 1YRNA 3LL7A 1VF9A 1ZARA 3S1RJ 5LGNA 4DBRA 2X4HA 1FIAA 5CVRA 1VQ4I 1SD4A 2BY2A 2O5RA 2IW5A 1LFUP 4M3DA 5FLXK 5F08A 2EZIA 1R5GA 3SZGA 4F93B 1K4TA 2NVQJ 1R6RA 3BP8A 2A6HF 3DWLE 1ZRDA 2W48A 2OTJI 3M1EA 4O5VA 2H27A 3KLNA 4JBAA 2XAFA 4V2GA 2DYSH 1Z6RA 4A3BJ 4D7NA 3TL4X 1YS6A 2EQRA 2LTPA 1IN5A 4PZJA 5B1AH 1HXDA 3LFKA 2QSFX 2LC2A 1FPQA 4RGUA 4L5EA 3QPHA 1SVOA 1KONA 3WTWC 4Y13A 3IKVA 1R5ID 3KYCB 1ETVA 3VODA 2VQCA 2HKOA 5D5UB 5ERIA 2H8RA 2O0YA 4A0YA 5KHDA 3CCMI 4JX5A 4A0XA 3SEZA 3ULQB 3L1PA 3BC8A 3CP2A 3LNQA 2IT0A 2DK8A 4Y52J 1I6XA 2AHQA 4BAYA 3AFHA 1ETXA 4M9ZA 3HM5A 3Q0UA 4XLEA 3BWGA 5B66C 1AKHB 1I3AA 1MKMA 2DMTA 4AVPA 3K2ZA 3Q0WA 2L3DA 2LY1A 3UNGC 4CCKA 2DOFA 2OF7A 3RPUA 2BY0A 2VKEA 2DU9A 5ILVA 4U88A 3CF2A 3HKZA 3V8KA 2UZKA 1OISA 1P4WA 2CQNA 2ZSHB 2EILH 3OYNA 3ESWB 2W00A 2MYSA 2HFHA 1R71A 2H09A 3WTXC 4IRGA 3EUHA 4EATA 1QHGA 3LA7A 2HQNA 1AHDP 2W25A 2V1DA 1NG7A 1UAAA 2YS9A 4CICA 5E1XA 3FK7A 2RVCA 1HCRA 2DMPA 4UV9A 5CJ9A 1IRGA 2ZBKA 2JA2A 3HZJA 1RNLA 2CW7A 4A3LJ 2D45A 3FWEA 1Z9CA 2KFDA 1N75A 1BIAA 2HWVA 2P5VA 3OL4A 4LJZF 5E1WA 4CCOA 3HUGB 2A05A 1FIPA 1H9TA 5K5RA 3LSHA 2COBA 1SMTA 3I58A 4HW0A 3RYPA 3ABLH 2H94A 1KA8A 3KLOA 5GTHC 3R60A 4FCYA 1ULYA 2X51A 1ZN2A 2WV0A 2BVLA 3F8MA 3MZHA 1T0FC 1A04A 4HLXA 3ZCOA 2CGPA 1DP3A 2KJCA 1GV2A 5HLTA 3E6MA 4RB0A 1EJ9A 3DTIA 3LSPA 2JRTA 3H5NA 2RN7A 4KICA 3JRAA 2FQ4A 1FBSA 4UNOA 1OCOH 3FBNB 1MSEC 4PK4A 5HDGA 1J75A 2M4KA 4E4HA 3ZP5A 1JKPC 4LB5A 1PUEE 1IZ1A 4XBFA 2G9WA 1QO0D 5LBQA 2DA1A 2QF7A 3C2HA 2LSOA 1WSUA 1MBKA 3ZQCA 2UXNA 3LSRA 2DPDA 2BHYA 3ONQA 1X1PA 1PVEA 1G3YA 2BXYA 3PQKA 3HOYJ 3W2AA 1Z77A 5D4SA 5EJCA 4HAMA 2XASA 2B0LA 2V4JC 3G73A 2DMQA 3PL8A 1F9NA 2VOPA 5D8LB 2IBDA 3S3MA 2VQLA 3L00A 4ON0A 2M9HA 4XIDA 2MGQA 4XRSG 1GXQA 3ZQ7A 1ZLJA 4IZZA 1IGNA 2K4BA 2FMLA 1YE9A 1LE8A 4UUSA 1K4SA 4E7JA 2N8GA 3V8LA 2A5YB 4A2UA 3B73A 3OYKA 5HNFA 2M30A 4ESJA 2DT6A 4ITVA 3VFZA 4ESBA 1DP7P 3M9AA 4HQMA 2ZFWA 2FBHA 4M9XA 3N97A 4RAYA 1IV6A 2FU4A 2ACJA 4P96A 1XMKA 1K78A 2P5KA 1SAXA 3CC7I 3DEEA 5IOYA 3W6KB 3IH3A 5FKOA 3G71I 2KLOA 2V79A 2BGCA 3AL0B 1WI9A 2BEOA 1R4NB 2QGUA 5DYMA 2DPUA 1GVDA 1F36A 5CQEA 4U7BA 3I55I 2GA2A 2HTJA 4IHTA 3CD6I 3G4SI 2IA1A 5JVTA 3O8HA 1CGPA 2K86A 3M8JA 2A5WA 4EV0A 3V7CA 2VQHA 3GTPJ 1LDKB 1HSJA 1OYIA 1RI7A 4ZJZA 3BG3A 1TQIA 3MEXA 4XKCA 1T95A 5HS8A 5K7HA 2LRDA 3VYRB 4AIDA 1T38A 3S8PA 2XUBA 3JRFA 3WU1B 2EZKA 3H3VK 1XC5A 2HTSA 2HXIA 1Y56A 3HPHA 2FUG2 2FBIA 1R4MB 3LSTA 5JLXA 4A12A 1GHCA 5GTIC 1IXSB 2G0EA 4GDFA 1IRFA 2DA7A 2VJ5A 1USSA 5D5XB 5FRMA 4EJVA 4ZC3A 2Q1ZB 4BKXA 3ABMH 2XC7A 2BOLA 3ELKA 4CCJA 3WE3A 4V19K 4H4KC 4Q47A 5F04A 4YFXF 3BOQA 2CG4A 2AXLA 4XOPA 4MO7A 3JRCA 1Q1VA 3PFIA 3LA2A 1XG1A 3FXJA 3K4MA 4KDPA 4FASD 3CDHA 2ZJ2A 4B09A 2CQ7A 1S6LA 3D5LA 2KPMA 4B48A 3VWBA 5BMZA 4JK1X 1XS9A 2QUFA 3TBIA 3R61A 3FM3A 2P7CB 4G94A 2R7OA 1O7FA 4I76A 5LEJA 3SZPA 1UCRA 2BVMA 3T8TA 3CCJI 2VBZA 2FXAA 3CESA 1RR7A 2RNJA 3HRSA 2BBYA 3DCFA 3DQVC 3KP7A 2VBWA 1D1AA 2LH9A 2QQ8A 4IRIA 2NXNB 4CDGA 3CO7C 1TWFJ 1A36A 3ECOA 3S2WA 3SDGA 2K9SA 1ERDA 2DT5A 3CO6C 1K6OA 2YPRA 4KMUX 1O3RA 3ZXSA 3OYJA 4KYWA 2TRTA 2OV7A 4L5JA 2IRFG 4CYDA 3CTAA 1TWCJ 4Y7NJ 5BQTA 2DAOA 3FKJA 2R5ZB 1GXPA 3B02A 5LLQA 3GFLA 3HKZN 5H6RA 2NOGA 2V9PA 2E1CA 2Y48A 2DA4A 2LY2A 1MZBA 5L3BA 2ZMEC 5LGUA 1K6YA 4HX4A 3BR5A 3OYCA 1IXCA 4FQGA 1SMYF 5EF6A 2CU7A 2HDDA 4BQOA 2KRCA 3C18A 3QU3A 5KCMA 2KKOA 5AIPA 1KU2A 1TP4A 2VPRA 4Q48A 2GOMA 3MKWB 1OYYA 4NC6A 1MMAA 1JUMA 3D1NI 2O6GE 3PQJA 3LAPA 3IC7A 4EJWA 5ICEA 3TDZC 1BL0A 1BJAA 4A6DA 2DA5A 2FNAA 2L9SA 4A3DJ 2ID3A 2GWRA 1BIBA 2X1CA 3RIRA 1V5EA 2XGXA 4CO8A 4EJUA 2D5VA 2VT2A 3FF5A 3IP4B 2L7ZA 3OYDA 2HYFA 3C3WA 1I50J 2OJED 4IPAA 4PDKA 1S8NA 3LSJA 2GOXB 2RDPA 5KAFC 2O9LA 1FOWA 2M4GA 1MBFA 1GDTA 1XX5A 2VUMJ 2CH0A 5IPAA 1R9TJ 1IAWA 1I1SA 3ZQQA 3QYEA 1FJLA 2GLOA 2XKPA 1EKEA 2VIXA 3NRVA 5K1YA 2UXXA 2XDVA 2LF7A 4CH7A 1TQMA 4DQ2A 3NWSA 4KIGA 3K9TA 3CCLI 2LK2A 3RJPA 3RKXA 4M9SA 2L9VA 4I0BA 4KIBA 4XL9A 2F5DA 2K3PA 2R7FA 1XGOA 4B47A 5D5VB 5IP9J 3J7AY 2FE3A 1YIJI 4DZJA 3GMEA 2Z16A 3PIPF 2HU9A 3U1DA 1D1BA 1FSHA 2PFBA 2VASA 2E1OA 2RQQA 1POGA 2DQRA 2CQKA 3ABKH 3FZVA 3BT9A 3PNTA 4YRVA 4AC0A 3U2RA 2WB1A 4L5IA 1Y6IA 2X1EA 3F72A 4XICA 1JUSA 4PJJA 3DLAA 4ZYEA 1JKQC 2V1NA 3MN2A 2NRAC 2ZJPF 3PNYA 4HNTA 1NH3A 1RUOA 2DOAA 2NVYJ 2IA0A 2QZ8A 2ME6A 2DLLA 3TO6A 3TO9A 3CCEI 2KDOA 5LFAA 3ZQFA 2K9MA 2XV4S 2KP6A 3I9V2 5FGMA 5M5YJ 2KL4A 4A3IJ 3H5RA 1YW8A 1FX7A 1S7AA 2QQBA 3BLYA 5CQGA 3RPUD 3VEPA 2HZDA 5E8IA 4L0ZB 1W7PD 1T2KA 4G6DA 5M5WJ 1YG2A 1PYVA 1LDJA 1R5HA 1FY7A 5HDKA 3KIOA 4XK4A 2W85A 5HNHA 3PJRA 2NYXA 3ML6A 2IAIA 4HF0A 1J0RA 1FSEA 4N9IA 3GO5A 2V7FA 3EUHC 3K70D 4GYIA 3HEFA 3K70C 2M45A 1TW2A 1S5LC 4EQQA 1X58A 2MLKA 4K2EA 1YW7A 1G59A 3DEWA 3F8CA 1B9MA 2OPTA 3SYTA 3BPVA 1SFEA 4Y15A 1XMAA 3I71A 2VODA 5F0FA 1OCRH 4IQ4A 3IHUA 3BTLA 3CJRB 2QEXI 2MLGA 1X3WB 5HLGA 1PUFB 2M1BA 2GAUA 4H0EA 4BXUA 2JT1A 2E5NA 1MSFC 2M87A 4MEYF 3BQYA 5HS9A 3EYIA 3FDYA 4M74A 3BTJA 5LHGA 3P9CA 1ETYA 3JSPA 1G6NA 3KYDB 3MWMA 3EYYA 3BJ6A 2HQRA 5GAEJ 1EH7A 1G8XA 1T98A 1MGTA 3PSFA 2QWWA 2GXBA 3KE2A 2QLZA 4YIFA 1I1GA 3DKWA 3ZRGA 3QRFF 2NVTJ 3ZQHA 1ON1A 2JWTA 4RS8A 1RETA 3E7LA 4N0BA 2W1OA 3HG9A 1LEBA 1ZHFA 5DM7F 2Y2ZA 1MBEA 2EZLA 5JHUA 3BROA 2ZC2A 2VXDA 3HSRA 4ANJA 3AAFA 4AIHA 3DV8A 1DPUA 2XVCA 2MSYA 1OCPA 2Y9YA 3FXOA 3H5AA 1H88C 2HOTA 3KPHA 2F5CA 2VE8A 3L2CA 3ROUA 3KFWX 2QBYB 2OA4A 1EH8A 3WU0A 3CCRI 1Z67A 1UHSA 1QVTA 1LKXA 3IL2A 3WE2A 1HF0A 2MA3A 2AQFA 5LRRA 2VXZA 4B3AA 5K7FA 2LKSA 5EYRA 4XRMA 1TT0A 2K27A 3IUOA 2V9VA 2Z1DA 2VONA 1QA6A 1HLVA 2HVQA 4MFDA 3WG7H 1ONVA 5GADJ 3WTUC 5J4VA 1LDDA 4C2UA 5DD8A 1F5TA 3MKZA 3HTUA 5HS7A 1ZGAA 3R0AA 4NC8A 4BXFA 1VQLI 3FMRA 1FP2A 3FM5A 4DIQA 5ED4A 4CXFA 1BI1A 2IVMA 2WA0A 3TW6A 4Y33A 2DYRH 2EPFA 2R93J 2WY7Q 5DM6F 1S72I 4OMYA 2KHMA 5D8KB 3O2PE 5CYVA 3PNVA 1YHQI 4OIQF 1FTZA 1ZKGA 3HRUA 1HC8A 5BNGA 4RB1A 1IN6A 3W2VA 2EK5A 1HQCA 3QPLA 1SAUA 3DBHB 4A0ZA 1OCTC 1YX3A 1O3QA 1MJBA 4BXXJ 5FFXA 3K4LA 2M2EA 5J1RA 3BQZA 3BJOA 3F0CA 4FT8A 4I09A 4HQEA 2HYGD 3WGHA 2JQ7A 3HBLA 3F3XA 3HGYA 1UJ8A 3CDLA 3ZN0A 1GV5A 4BHBA 1DPRA 1XCBA 3OYMA 1V5GA 5FKLA 4BE2A 3W6VA 4ESFA 1X1BA 4YEJA 3EQLF 4DYCA 4WWCA 2STTA 1V3FA 1YLFA 4RB2C 1KQ8A 1SD5A 3LSMA 1WJDA 4L9JA 3VSKA 1L3LA 4P1WA 5DS9A 1P2FA 2CSOA 4PGHA 5DV5A 2L7MP 1VQNI 3GUDA 4JX6A 1T8IA 1PUFA 3HTSB 1TW3A 3H9JA 4F7ZA 3EUKL 3OYLA 4U7DA 1FYLA 1BOAA 2YU3A 1K83J 2OBPA 3PFYA 3ZN1A 2KISA 2X6XA 1LFBA 4CZCA 3S2DJ 5L3FA 2GIZA 2IJLA 5BS6A 1W5CC 3KETA 2Z3YA 1SFKA 4LIVA 2XB0X 4ZTFA 4HRIA 4PFOA 2WB1N 2XGEA 4F3QA 2KIQA 4NQWA 5DDGA 3QPSA 4YG2F 5LHHA 4GRIA 4P55A 4WK8F 1XCVA 5CVUA 4RMNA 5C4XJ 2JZYA 3WU2C 4KN7X 5JLWA 1VI0A 4OINF 1R58A 1T33A 4FE7A 3CMMA 3WHBA 4S04A 5F0CA 5A2QZ 3J7ZI 2LREA 2IPQX 3R0JA 1VQ9I 2GXGA 3H92A 3C2BA 2QBYA 2PJPA 2K5CA 4MHGA 1CQTA 1ACIA 2Y75A 1UHWA 2GBYA 3OV8A 1ETWA 4QLCU 2LKXA 2JJ7A 2LMDA 4IL6C 4A6EA 1LE8B 4UUSB 2Q2EB 4L18B 4G9YA 1IW7F 1Z7LA 4X0GA 2Y9ZA 4XOTA 3I4MJ 2DQLA 3MKYB 3IWFA 1JTXA 2H6BA 4I99C 3KEYA 4JQFA 3I56I 4X6AJ 3G1MA 4MTEA 5DUIA 4ENKA 5FKMA 1WH7A 1IDZA 3MVPA 3FXMA 1K78B 2R7SA 3O8GA 4PCQA 2B7EA 2JVHA 3S32A 4OIRF 3M3YJ 3BZCA 5DTDA 1R49A 2D1VA 3M8EA 2VBYA 1RKWA 3E1SA 2QA4I 2CW0F 1A35A 2VBXA 2E35A 2V9KA 2GA1A 3AL0C 1ITYA 2DCEA 4II2A 3S1NJ 2BV6A 3S3OA 1ETOA 3GLXA 3C1DA 3CMAI 2O8XA 2MH2A 3GBGA 3F8FA 3VOEA 2PEXA 2R7WA 3OSFA 1IN7A 2BY3A 4HLYA 1Z3XA 1WPKA 4LIUA 2GM4A 3K1NA 4PJLA 5E17F 1SFXA 2M3AA 4G6TB 2LOOA 5AIQA 2L9NA 2P4WA 3GVAA 4PSWA 3SZTA 2B63J 1G4DA 3OYEA 1U8BA 3H3ZA 4JOMA 1MMGA 3HYIA 3OWTA 4UHTA 1B9NA 1SD6A 3LOCA 3LSKA 2ZNYA 3GXOA 3JW4A 4BACA 5B3SH 1D0XA 4BNCA 4BQNA 2JUGA 4FHTA 2FJ1A 2VKVA 4M3EA 3D5RC 2CV2A 5D6EA 4BS9A 3SJMA 1F1ZA 3OYGA 1WH5A 4BHPA 3FX3A 3AKZA 4XMYA 4XLHA 2F4MB 5FD6A 4A3EJ 3A1YA 1FT9A 4JYKA 3TMOA 3WHCA 5F1RA 5FB2A 3E6DA 3VSLA 1YQAA 5CPRB 3ZGKA 1U2WA 3IKTA 3GCMA 3Q5FA 3IWZA 2MC4A 2VT3A 5EEAA 3RKWA 1QBJA 2NOJB 2EB7A 3WTZA 4TV7A 2ZFUA 2ICWG 1KQ0A 2HQ5A 3LMMA 4RAFA 4OAZA 4YIRX 4N4NB 3LA3A 3A0BC 1OMIA 1FBQA 2ELKA 3GFJA 2FSWA 3OIPA 3SFZA 5A2QK 3HOSA 3CMYA 1W0TA 2HPMA 2MD0A 1MH4A 1XGNA 3FBIB 3BCAA 2BY1A 2XPUA 5GAHJ 2WAFA 4E7IA 2EFNA 2A68F 4IVNA 2HOAA 5KNLA 1QHHD 2DFHA 2L4MA 1SVLA 3KP2A 3KX2A 2EH3A 5E18F 4GCVA 2F6CA 3FIWA 1IDYA 4QPQA 2JTVA 1R00A 1U6GA 4XQFA 5LRSA 1H89C 3HJEA 1TNSA 2I10A 1ZK8A 4M3GA 4RB3C 2HOSA 4G6QA 1PP7U 1P9QC 2ZJRF 5F6FA 1SVMA 2E1MB 2Q2EA 1HW2A 4G8XA 1I3QJ 2OD5A 2LFBA 2DDAA 2CFXA 3ZQGA 2F48A 1RPWA 1TWAJ 2DOEA 1BI3A 2DTZA 4GO1A 3JR9A 1TBXA 2QQAA 2W82A 1O4XA 4CSWA 3A03A 3E5QA 3L09A 1QQIA 4I6ZA 1HW1A 3EPZA 3FXRA 3VB2A 2XGCA 4IEJA 4G7ZF 4CA0A 3IH4A 3KZYA 3TGNA 3L7WA 2IP2A 5E1ZB 5J8CA 3K6GA 4A93J 5L3EA 3CCUI 1WCMJ 3QYBA 3AG3H 4N9HA 1X4PA 2MD5A 2OUMA 2RC4A 2WAQA 4V2FA 2QSGX 3JREA 1YX5A 2QM3A 1C0WA 4A3CJ 3GZ6A 1OCZH 1FP1D 3BR1A 4J00A 2L7FP 5JFRA 3OYAA 3MZ8A 2OCCH 2GXAA 2DMNA 3VDXA 3Q9SA 1V5FA 1X19A 1MBGA 5J1YA 5EEGA 1B72B 4M3FA 2P81A 3S1MJ 2NS0A 4B1RA 1OKRA 1M1EB 3HC7A 4UVBA 1QU3A 2WTEA 1BN5A 5D4RA 1NK3P 3M4OJ 4HDVA 1BC8C 3HOTA 1SANA 4HV5A 2JPBA 5FKKA 2IS2A 4I02A 4E7LA 1HOMA 2PN6A 3HB9A 3DEUA 2L0KA 3LAJA 2PQ8A 2HEOA 4HNUA 2E2IJ 2STWA 2M8EA 3J81Z 4GGGA 2HKXA 4XORA 1IC8A 1UHMA 3SHFA 3IH2A 4CGZA 3TEDA 1FYKA 3SDBA 1BJZA 3R4KA 2JSCA 2XHKA 1HKSA 1Z1DA 2HXOA 2ZXHA 4AIJA 1N25A 2VB6A 1YO5C 3CQZJ 1H0MA 3I59A 3QU6A 2K3FA 2OCEA 2DMUA 3DXJF 3KEQA 2DDBA 2LNBA 1GUUA 2VLAA 2LR8A 2MBFA 4RM2A 3ZMZA 5AONA 4M3BA 3OS2A 5DUKA 3F8NA 2HQAA 4RM3A 1Y0UA 3CLQA 3G3ZA 3B6CA 2XAHA 3CJTB 1A5JA 2YU9J 2E71A 4O3MA 2KQRA 2ZB9A 1N77A 2YR2A 1X1AA 1Z91A 1MJ9A 2JPCA 2P0WA 4RBOA 2FOWA 3PO2J 2YUSA 1KYWA 2E34A 1TC3C 1BW5A 3BG6A 2A3SA 1JTYA 1AOYA 2M0MA 2FMYA 2F4IA 3HL2A 1TQPA 1VQ7I 2M0CA 3L2QA 3SEQA 2HDCA 4IF4A 3ERMA 1NTCA 2XPVA 2EBIA 1E0EA 3K4NA 2EFOA 3GW2A 3G6EI 3W6JB 3O6BB 2EWNA 1TWGJ 4HNVA 4A3KJ 1KU9A 3F6VA 4IRHA 3ERED 1S3JA 1KGSA 4B3XA 4FE4A 1G3WA 1J7KA 3JRBA 3QP6A 2W4SA 5J3LA 3FHZA 4D7MA 2H1KA 2KRFA 1XB4A 4CYCB 4HZFA 4PUSA 3S93A 5TRDA 4MIMA 1WJCA 3VPRA 3GTJJ 2LKPA 3D0SA 2XGDA 2AQEA 3O3KA 3SXYA 3HOUJ 2QKLB 3S3NA 2VE9A 4QSHA 4C3HJ 2XRLA 5J8FA 1QZYA 5IY5H 2EIJH 2L7KA 1IUFA 2WC2A 3FXLA 5EEHA 3UR3C 4E7ZA 2R7TA 1MH3A 4MTDA 3JSOA 5LD2C 3PUBA 5TGTA 1U0JA 1WJFA 3GWZA 3RSNA 3GLLA 5IT3A 4LGWA 2P6TA 2PMZA 4M71A 1FLIA 4QWQA 3J81K 2UUZA 1B72A 2OZUA 1QVUA 2R7XA 4RAGA 1WRJA 3I53A 1AU7A 4YFNF 1X1DA 5DCMB 3DF8A 2LYCA 3MMYB 3HSFA 4BBSJ 1X3UA 2ISZA 2B9SA 4XRFA 3E5XA 1Y0NA 4AVZA 1VQ8I 4IQJA 3B6AA 2NS8A 3G1LA 2VL8A 3RDIA 1Z3YA 4LFUA 1FOYA 4EMSA 4IHWA 1FMWA 5FJ8J 1XTAA 1K79A 2ZSIB 3E6BA 3ZMVA 1EH6A 4QTRA 3WTSC 4UXNA 3MZYA 1T0FA 3K2AA 1WJBA 4BU2A 2Y0MA 4EJTA 4RGRA 2RV8A 4AYBA 4HX7A 1E3PA 1L0OC 3GF2A 4E70A 3A02A 1MDMA 2V6EA 2O03A 4FISA 3KP5A 1P92A 5FROA 4B43A 2WAQN 5HLHA 1D8KA 1XD7A 3OOPA 1R23A 1JJ6C 5H2FC 1YW9A 3HRTA 4PFPA 1BBYA 4BH9A 2HVSA 2X6WA 4C3IJ 3IRQA 1FNNA 2A07F 4I98B 2Q0OA 2HGCA 3I0TA 3I3LA 2CQXA 4D1QA 4IX7A 1ZH5A 2MW8A 1VQKI 3PO3J 3BG5A 1IJWC 4IO9F 3HOZJ 5F0HA 2M5WA 2GQQA 2CUFA 3H9GA 5FFZA 4I0AA 3K1MA 2K9LA 2KRHA 2EINH 3TP0A 2L5QA 1STZA 1V4RA 4NQWB 3VYTB 3F8BA 1BC7C 1RC9A 2ZXWH 4EGZA 2R7ZJ 4RLFA 5F27A 4WCGA 1LVKA 4L9TA 3CC4I 2XF6A 5E20A 1D0YA 2P8TA 4WXDA 3WTYC 2CO5A 4IHXA 2BW3B 2RKHA 5M5XJ 2CRGA 2BYVE 2CV0A 5K5OA 4RA2A 3JRIA 3JTHA 5H20A 2FQ3A 2OC6A 2X6YA 3JAMZ 1VQ6I 2OZ6A 1ZQ3P 4OIPF 3IRRA 2FOKA 1VQPI 3HIFA 5IT9Z 2Y0SA 3CJQB 4IOAF 2TDXA 4L9NA 4CYCA 4U0YA 3H9QA 1K61A 1YS7A 1UG0A 5E8GA 4A3MJ 1YJ9I 4D9JA 5ILUA 3U9GA 5ICCA 2VC1A
chains in the Genus database with same CATH topology
3G1MA 3Q0VA 5FKMA 1WH7A 1IDZA 2CQQA 4W97A 3MVPA 2X48A 1MNMC 2K9QA 5IOYA 3O8GA 3IH3A 5FKOA 5GPCA 1UG2A 2KT0A 2VI6A 1GVDA 1F36A 4DZPA 3UKGA 3M3YJ 5DTDA 3O8HA 1RKWA 2XPWA 3GTPJ 9ANTA 1ITYA 3ZOBA 2M34A 1QPIA 4W1UA 3S1NJ 3BG3A 1Y1VJ 3SFIA 2ECCA 1ETOA 2IEKA 2JN6A 5K7HA 3GBGA 3OSFA 3JRFA 1WI3A 2EZKA 3H3VK 1XC5A 1WPKA 2HXIA 4G12A 2GM4A 2E2HJ 5JLXA 5FLVA 3HDDA 4ABZA 2G0EA 2B63J 5IYCJ 2DA7A 1U8BA 1MBJA 3S16J 1APLC 3FISA 3LOCA 4B4CA 1RESA 4BKXA 2LLKA 4A3GJ 2JA5J 5F04A 1JT0A 3BTCA 2FJ1A 2VKVA 4M3EA 4MO7A 3JRCA 1Q1VA 3SJMA 1XG1A 3FK6A 3BR0A 2CJJA 2JA6J 1JUPA 1Z0XA 3OSGA 1XS9A 1WH5A 5EZGA 5EG0A 1T56A 4A3EJ 3HOWJ 2RAEA 4I76A 4JYKA 3WHCA 1RR7A 1U9NA 2NS7A 1U78A 3GTKJ 3DCFA 5EEAA 1ORKA 3NARA 1MBHA 1ZTRA 3GTQJ 3BG9A 2HQ5A 5FKNA 1E3OC 1TWFJ 2ELKA 3CMYA 3SDGA 2K9SA 1W0TA 3LSGA 1MH4A 2PMZN 2R5YA 1JKRC 1A6IA 1OFCX 2XPUA 2DJNA 2E19A 2TRTA 1DU0A 4J19A 3ZQIA 3I4NJ 1TWCJ 4Y7NJ 2HOAA 2R5ZA 4RDUA 2R5ZB 3HKZN 2NOGA 2EZHA 1D5YA 2EH3A 3FIWA 1IDYA 2DA4A 5J1UA 2DA2A 3BR5A 1H89C 2MG4A 5EF6A 2CU7A 4AUXA 2HDDA 2I10A 1ZK8A 4M3GA 1JKOC 3S17J 2HI3A 4A3FJ 2HOSA 2VPRA 5FLMJ 1SFOJ 3S15J 3D1NI 1JUMA 1I3QJ 3BTIA 1YRNB 3GTLJ 5GPAA 2LFBA 1BL0A 1FTTA 2DA5A 3ZQGA 2FX0A 3OOUA 1GT0C 1RPWA 3RZOJ 5M3FJ 4A3DJ 1TWAJ 1X2NA 2DA3A 2ID3A 4EEFG 2TCTA 3FKIJ 2DTZA 2D5VA 3GTGJ 5EZHA 5E3LA 3JR9A 2L7ZA 1O4XA 2ID6A 1I50J 5HODA 4AYBN 3A03A 3LSJA 1NK2P 4I6ZA 2O9LA 4X1EA 5C44J 3JRHA 1MBFA 1GDTA 2VUMJ 5IPAA 1ZR4A 1R9TJ 2M8GX 2XGCA 4IEJA 1FJLA 2GLOA 3IH4A 1I6HJ 2HYJA 2LD5A 4FTHA 3JRGA 4A93J 3HOVJ 3TW7A 1WCMJ 2LK2A 4V2FA 2O8KA 3S1QJ 3JREA 2XB5A 4A3CJ 2LP0A 5IP9J 4A3JJ 4XRSA 4MLOA 4DZJA 3BR1A 5IYBJ 2L7FP 2LY9A 4M6VA 2K40A 1P7JA 4QIWN 2R92J 2DMNA 2E1OA 4UUTA 2JK3A 1POGA 4DW6A 1X2MA 3BT9A 3GTOJ 1MBGA 5J1YA 4AC0A 4BY1J 4C2MJ 5IP6A 1FEXA 1B72B 1W0UA 4M3FA 4XICA 1JUSA 2LVSA 2P81A 3RQIA 1JKQC 3S1MJ 4B1RA 3MN2A 1NK3P 3M4OJ 2KDZA 1DU6A 2NVYJ 2JMWA 2ME6A 1SANA 5FKKA 3BR3A 2R0QC 1BA5A 3PM1A 1HOMA 3G1OA 3ZQFA 3HB9A 2L0KA 5M5YJ 4D5FA 2E2IJ 4BY7J 4A3IJ 3ZQLA 4IHYA 2Y0SN 5F1JA 1F43A 1IRZA 1IC8A 3IH2A 1BW6A 5M5WJ 4DYQA 3TEDA 1UMQA 1BJZA 2AO9A 2Y30A 4XK4A 1OJLA 2IAIA 2HXOA 1VNDA 2X6OA 3CQZJ 3HEFA 1P7IA 1B8IB 5EGOA 3S14J 2DMUA 1S7EA 5EGOB 2DA6A 1X58A 1GUUA 2LR8A 3DEWA 2OPTA 2X9DA 1EF4A 5F0FA 4DYRA 4M3BA 3BTLA 1QRYA 1PUFB 2O7OA 3B6CA 1MSFC 1A5JA 3BQYA 2YU9J 5M3MJ 2ZB9A 3BTJA 3A01B 3IV5A 1H8AC 1ETYA 4BBRJ 1VFCA 5K7ZA 5C3EJ 4RBOA 2ME0A 4D5CA 4JP0A 3CCYA 3PO2J 2YUSA 3GTMJ 4A69C 1TC3C 2NVXJ 1BW5A 2NVTJ 3RKQA 3Q3SA 2CUEA 2JWTA 3ZQHA 1JTYA 1RETA 3E7LA 2ECBA 1YRNA 1VF9A 1ENHA 1Y1WJ 2M0CA 3S1RJ 2Y2ZA 3HGGA 1MBEA 2EZLA 1FIAA 1NTCA 2XPVA 2EBIA 3QQAA 5E3NA 1LFUP 4M3DA 1TWGJ 5F08A 4HNVA 2EZIA 1JGGA 4A3KJ 2MSYA 1OCPA 2Y9YA 1H88C 2NVQJ 2HOTA 2W48A 4FE4A 1UHSA 5IYDJ 4V2GA 3JRBA 1QVTA 4A3BJ 4D7NA 2H1KA 5J3LA 4D7MA 1HF0A 2EQRA 2LTPA 4B3AA 5K7FA 5C4JJ 2Y31A 2WV1A 4CYCB 5EYRA 4XRMA 1U9OA 4L5EA 4MIMA 3VPRA 3GTJJ 5GP9A 2XGDA 1ETVA 1HLVA 3HOUJ 3S2HJ 1JT6A 4MFDA 4QSHA 4C3HJ 2H8RA 2JA8J 2XRLA 2XSDC 4JX5A 1IUFA 3L1PA 1ETQA 3LNQA 1MH3A 3RZDJ 3MKLA 1HDDC 4Y52J 3BR6A 2AHQA 5IP7J 1ETXA 1HDPA 1AKHA 3HM5A 3Q0UA 4NDLA 1AKHB 1B72A 2DMTA 3TW6A 3Q0WA 1QVUA 2R93J 2OF7A 1AU7A 2VKEA 5IOZA 1FTZA 1ZKGA 4BBSJ 5BNGA 4LOCA 3JRDA 3QPLA 2QCOA 3K7AJ 3B6AA 2NS8A 3G1LA 5E3OA 1AHDP 1OCTC 1ZGWA 2YS9A 4BXXJ 2M2EA 3NAUA 3BQZA 3H0GJ 5J1RA 3FK7A 3F0CA 5FJ8J 4IHWA 1HCRA 2DMPA 3HBLA 4QTRA 3HGYA 4IHVA 3CDLA 1ZR2A 1GV5A 4A3LJ 1ETKA 5FKLA 1B8IA 3W6VA 3K2AA 4DYCA 1WGXA 1FIPA 3BR2A 3A02A 5DS9A 5EDNA 2COBA 2L7MP 4FISA 4S0HB 5EG0B 3HOXJ 4FCYA 4C3JJ 4JX6A 1PUFA 2E2JJ 2WAQN 1JJ6C 1GV2A 1K83J 4C3IJ 3S2DJ 1LFBA 3TP3A 3A01A 3LSPA 2CQXA 1G2HA 4MFEA 1IG7A 2FD5A 3JRAA 2FQ4A 2MW8A 3PO3J 3BG5A 5E3MA 1MSEC 1IJWC 3HOZJ 2DN0A 5F0HA 2XB0X 2CUFA 2WB1N 2XGEA 2R5YB 1JKPC 3QPSA 2DA1A 3TP0A 2QF7A 1JJ8C 1MBKA 3ZQCA 5C4XJ 3LSRA 5F27A 2R7ZJ 5JLWA 1VI0A 1T33A 4FE7A 3HOYJ 3WHBA 2JA7J 3OIOA 1Z77A 2L9RA 5F0CA 4IHXA 2DMQA 5M5XJ 2CRGA 2IBDA 3C2BA 4GFBA 1CQTA 3JRIA 2M9HA 4XIDA 2MGQA 2GBYA 4XRSG 1IGNA 1ETWA 2LKXA 1ZQ3P 1TWHJ 2JJ7A 1LE8A 2K9NA 4UUSA 1LE8B 2N8GA 4UUSB 4CYCA 1K61A 2Y9ZA 3I4MJ 1JTXA 4JX4A 4A3MJ 1RKTA 1IV6A 4X6AJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1M A;  3Q0V A;  5FKM A;  1WH7 A;  1IDZ A;  2CQQ A;  4W97 A;  3MVP A;  2X48 A;  1MNM C;  2K9Q A;  5IOY A;  3O8G A;  3IH3 A;  5FKO A;  5GPC A;  1UG2 A;  2KT0 A;  2VI6 A;  1GVD A;  1F36 A;  4DZP A;  3UKG A;  3M3Y J;  5DTD A;  3O8H A;  1RKW A;  2XPW A;  3GTP J;  9ANT A;  1ITY A;  3ZOB A;  2M34 A;  1QPI A;  4W1U A;  3S1N J;  3BG3 A;  1Y1V J;  3SFI A;  2ECC A;  1ETO A;  2IEK A;  2JN6 A;  5K7H A;  3GBG A;  3OSF A;  3JRF A;  1WI3 A;  2EZK A;  3H3V K;  1XC5 A;  1WPK A;  2HXI A;  4G12 A;  2GM4 A;  2E2H J;  5JLX A;  5FLV A;  3HDD A;  4ABZ A;  2G0E A;  2B63 J;  5IYC J;  2DA7 A;  1U8B A;  1MBJ A;  3S16 J;  1APL C;  3FIS A;  3LOC A;  4B4C A;  1RES A;  4BKX A;  2LLK A;  4A3G J;  2JA5 J;  5F04 A;  1JT0 A;  3BTC A;  2FJ1 A;  2VKV A;  4M3E A;  4MO7 A;  3JRC A;  1Q1V A;  3SJM A;  1XG1 A;  3FK6 A;  3BR0 A;  2CJJ A;  2JA6 J;  1JUP A;  1Z0X A;  3OSG A;  1XS9 A;  1WH5 A;  5EZG A;  5EG0 A;  1T56 A;  4A3E J;  3HOW J;  2RAE A;  4I76 A;  4JYK A;  3WHC A;  1RR7 A;  1U9N A;  2NS7 A;  1U78 A;  3GTK J;  3DCF A;  5EEA A;  1ORK A;  3NAR A;  1MBH A;  1ZTR A;  3GTQ J;  3BG9 A;  2HQ5 A;  5FKN A;  1E3O C;  1TWF J;  2ELK A;  3CMY A;  3SDG A;  2K9S A;  1W0T A;  3LSG A;  1MH4 A;  2PMZ N;  2R5Y A;  1JKR C;  1A6I A;  1OFC X;  2XPU A;  2DJN A;  2E19 A;  2TRT A;  1DU0 A;  4J19 A;  3ZQI A;  3I4N J;  1TWC J;  4Y7N J;  2HOA A;  2R5Z A;  4RDU A;  2R5Z B;  3HKZ N;  2NOG A;  2EZH A;  1D5Y A;  2EH3 A;  3FIW A;  1IDY A;  2DA4 A;  5J1U A;  2DA2 A;  3BR5 A;  1H89 C;  2MG4 A;  5EF6 A;  2CU7 A;  4AUX A;  2HDD A;  2I10 A;  1ZK8 A;  4M3G A;  1JKO C;  3S17 J;  2HI3 A;  4A3F J;  2HOS A;  2VPR A;  5FLM J;  1SFO J;  3S15 J;  3D1N I;  1JUM A;  1I3Q J;  3BTI A;  1YRN B;  3GTL J;  5GPA A;  2LFB A;  1BL0 A;  1FTT A;  2DA5 A;  3ZQG A;  2FX0 A;  3OOU A;  1GT0 C;  1RPW A;  3RZO J;  5M3F J;  4A3D J;  1TWA J;  1X2N A;  2DA3 A;  2ID3 A;  4EEF G;  2TCT A;  3FKI J;  2DTZ A;  2D5V A;  3GTG J;  5EZH A;  5E3L A;  3JR9 A;  2L7Z A;  1O4X A;  2ID6 A;  1I50 J;  5HOD A;  4AYB N;  3A03 A;  3LSJ A;  1NK2 P;  4I6Z A;  2O9L A;  4X1E A;  5C44 J;  3JRH A;  1MBF A;  1GDT A;  2VUM J;  5IPA A;  1ZR4 A;  1R9T J;  2M8G X;  2XGC A;  4IEJ A;  1FJL A;  2GLO A;  3IH4 A;  1I6H J;  2HYJ A;  2LD5 A;  4FTH A;  3JRG A;  4A93 J;  3HOV J;  3TW7 A;  1WCM J;  2LK2 A;  4V2F A;  2O8K A;  3S1Q J;  3JRE A;  2XB5 A;  4A3C J;  2LP0 A;  5IP9 J;  4A3J J;  4XRS A;  4MLO A;  4DZJ A;  3BR1 A;  5IYB J;  2L7F P;  2LY9 A;  4M6V A;  2K40 A;  1P7J A;  4QIW N;  2R92 J;  2DMN A;  2E1O A;  4UUT A;  2JK3 A;  1POG A;  4DW6 A;  1X2M A;  3BT9 A;  3GTO J;  1MBG A;  5J1Y A;  4AC0 A;  4BY1 J;  4C2M J;  5IP6 A;  1FEX A;  1B72 B;  1W0U A;  4M3F A;  4XIC A;  1JUS A;  2LVS A;  2P81 A;  3RQI A;  1JKQ C;  3S1M J;  4B1R A;  3MN2 A;  1NK3 P;  3M4O J;  2KDZ A;  1DU6 A;  2NVY J;  2JMW A;  2ME6 A;  1SAN A;  5FKK A;  3BR3 A;  2R0Q C;  1BA5 A;  3PM1 A;  1HOM A;  3G1O A;  3ZQF A;  3HB9 A;  2L0K A;  5M5Y J;  4D5F A;  2E2I J;  4BY7 J;  4A3I J;  3ZQL A;  4IHY A;  2Y0S N;  5F1J A;  1F43 A;  1IRZ A;  1IC8 A;  3IH2 A;  1BW6 A;  5M5W J;  4DYQ A;  3TED A;  1UMQ A;  1BJZ A;  2AO9 A;  2Y30 A;  4XK4 A;  1OJL A;  2IAI A;  2HXO A;  1VND A;  2X6O A;  3CQZ J;  3HEF A;  1P7I A;  1B8I B;  5EGO A;  3S14 J;  2DMU A;  1S7E A;  5EGO B;  2DA6 A;  1X58 A;  1GUU A;  2LR8 A;  3DEW A;  2OPT A;  2X9D A;  1EF4 A;  5F0F A;  4DYR A;  4M3B A;  3BTL A;  1QRY A;  1PUF B;  2O7O A;  3B6C A;  1MSF C;  1A5J A;  3BQY A;  2YU9 J;  5M3M J;  2ZB9 A;  3BTJ A;  3A01 B;  3IV5 A;  1H8A C;  1ETY A;  4BBR J;  1VFC A;  5K7Z A;  5C3E J;  4RBO A;  2ME0 A;  4D5C A;  4JP0 A;  3CCY A;  3PO2 J;  2YUS A;  3GTM J;  4A69 C;  1TC3 C;  2NVX J;  1BW5 A;  2NVT J;  3RKQ A;  3Q3S A;  2CUE A;  2JWT A;  3ZQH A;  1JTY A;  1RET A;  3E7L A;  2ECB A;  1YRN A;  1VF9 A;  1ENH A;  1Y1W J;  2M0C A;  3S1R J;  2Y2Z A;  3HGG A;  1MBE A;  2EZL A;  1FIA A;  1NTC A;  2XPV A;  2EBI A;  3QQA A;  5E3N A;  1LFU P;  4M3D A;  1TWG J;  5F08 A;  4HNV A;  2EZI A;  1JGG A;  4A3K J;  2MSY A;  1OCP A;  2Y9Y A;  1H88 C;  2NVQ J;  2HOT A;  2W48 A;  4FE4 A;  1UHS A;  5IYD J;  4V2G A;  3JRB A;  1QVT A;  4A3B J;  4D7N A;  2H1K A;  5J3L A;  4D7M A;  1HF0 A;  2EQR A;  2LTP A;  4B3A A;  5K7F A;  5C4J J;  2Y31 A;  2WV1 A;  4CYC B;  5EYR A;  4XRM A;  1U9O A;  4L5E A;  4MIM A;  3VPR A;  3GTJ J;  5GP9 A;  2XGD A;  1ETV A;  1HLV A;  3HOU J;  3S2H J;  1JT6 A;  4MFD A;  4QSH A;  4C3H J;  2H8R A;  2JA8 J;  2XRL A;  2XSD C;  4JX5 A;  1IUF A;  3L1P A;  1ETQ A;  3LNQ A;  1MH3 A;  3RZD J;  3MKL A;  1HDD C;  4Y52 J;  3BR6 A;  2AHQ A;  5IP7 J;  1ETX A;  1HDP A;  1AKH A;  3HM5 A;  3Q0U A;  4NDL A;  1AKH B;  1B72 A;  2DMT A;  3TW6 A;  3Q0W A;  1QVU A;  2R93 J;  2OF7 A;  1AU7 A;  2VKE A;  5IOZ A;  1FTZ A;  1ZKG A;  4BBS J;  5BNG A;  4LOC A;  3JRD A;  3QPL A;  2QCO A;  3K7A J;  3B6A A;  2NS8 A;  3G1L A;  5E3O A;  1AHD P;  1OCT C;  1ZGW A;  2YS9 A;  4BXX J;  2M2E A;  3NAU A;  3BQZ A;  3H0G J;  5J1R A;  3FK7 A;  3F0C A;  5FJ8 J;  4IHW A;  1HCR A;  2DMP A;  3HBL A;  4QTR A;  3HGY A;  4IHV A;  3CDL A;  1ZR2 A;  1GV5 A;  4A3L J;  1ETK A;  5FKL A;  1B8I A;  3W6V A;  3K2A A;  4DYC A;  1WGX A;  1FIP A;  3BR2 A;  3A02 A;  5DS9 A;  5EDN A;  2COB A;  2L7M P;  4FIS A;  4S0H B;  5EG0 B;  3HOX J;  4FCY A;  4C3J J;  4JX6 A;  1PUF A;  2E2J J;  2WAQ N;  1JJ6 C;  1GV2 A;  1K83 J;  4C3I J;  3S2D J;  1LFB A;  3TP3 A;  3A01 A;  3LSP A;  2CQX A;  1G2H A;  4MFE A;  1IG7 A;  2FD5 A;  3JRA A;  2FQ4 A;  2MW8 A;  3PO3 J;  3BG5 A;  5E3M A;  1MSE C;  1IJW C;  3HOZ J;  2DN0 A;  5F0H A;  2XB0 X;  2CUF A;  2WB1 N;  2XGE A;  2R5Y B;  1JKP C;  3QPS A;  2DA1 A;  3TP0 A;  2QF7 A;  1JJ8 C;  1MBK A;  3ZQC A;  5C4X J;  3LSR A;  5F27 A;  2R7Z J;  5JLW A;  1VI0 A;  1T33 A;  4FE7 A;  3HOY J;  3WHB A;  2JA7 J;  3OIO A;  1Z77 A;  2L9R A;  5F0C A;  4IHX A;  2DMQ A;  5M5X J;  2CRG A;  2IBD A;  3C2B A;  4GFB A;  1CQT A;  3JRI A;  2M9H A;  4XID A;  2MGQ A;  2GBY A;  4XRS G;  1IGN A;  1ETW A;  2LKX A;  1ZQ3 P;  1TWH J;  2JJ7 A;  1LE8 A;  2K9N A;  4UUS A;  1LE8 B;  2N8G A;  4UUS B;  4CYC A;  1K61 A;  2Y9Z A;  3I4M J;  1JTX A;  4JX4 A;  4A3M J;  1RKT A;  1IV6 A;  4X6A J; 
#chains in the Genus database with same CATH topology
 2RGV A;  2VQG A;  2H8W A;  3SQN A;  2CQQ A;  2Z5U A;  2X48 A;  1WVR A;  3K0L A;  3DKX A;  1MNM C;  2K9Q A;  2ZCW A;  2PBI A;  1D1C A;  1UG2 A;  2KT0 A;  2VI6 A;  4LK1 F;  4ASN A;  1J5Y A;  1FYM A;  2KIU A;  1QZZ A;  1RRJ A;  1D0Z A;  4HF2 A;  5KAI C;  3HHG A;  4EGY A;  4L0Y B;  1TNT A;  2AXT C;  1G3T A;  2V1X A;  4MQV A;  1ON2 A;  2XPW A;  3OY9 A;  4PJM A;  4LLL A;  3K4K A;  3ZOB A;  2M34 A;  1VQO I;  1QPI A;  4DNC A;  1CF7 A;  4Y3O A;  1Y1V J;  4L9V A;  2ELH A;  3I5U A;  4KN4 X;  5DCM A;  3REO A;  2IEK A;  2JN6 A;  4WXC A;  1W36 D;  1W36 C;  3M7G A;  3GEZ A;  5L3G A;  1IV8 A;  4G7H F;  2L54 A;  3R6S A;  1WI3 A;  1MMS A;  1ZRC A;  3KCC A;  1KYZ A;  2QVO A;  1BR1 A;  5FLV A;  3HDD A;  4FET A;  3OL3 A;  5IYC J;  3H0D A;  3QOP A;  3WGG A;  5CVI A;  1Y8R B;  3S16 J;  1APL C;  3FIS A;  4XNF A;  2ZKZ A;  4Q4Z F;  4B4C A;  4YII A;  3F21 A;  2JA5 J;  1ZRE A;  1OCC H;  4UY8 I;  3BTC A;  5KK1 A;  4HF1 A;  4LG3 A;  2P5L C;  1OPC A;  3E6C C;  3KP4 A;  4HV6 A;  4NUB A;  4XSX F;  2CJJ A;  4AU7 A;  2JA6 J;  5TJJ A;  1JUP A;  1Z0X A;  2E36 A;  2VKD A;  3OSG A;  2XAU A;  2RNG A;  4FX0 A;  5EZG A;  1IF1 A;  2EFQ A;  3FMS A;  3HOW J;  4XKW A;  4XLA A;  2ESN A;  1XMX A;  1YIO A;  1XGS A;  1LPQ A;  3K10 A;  4BJT A;  3ASN H;  1U9N A;  3U1K A;  2XF5 A;  1U78 A;  3H3U A;  2A6E F;  3I64 A;  1YIT I;  2MAB A;  2JUC A;  2EIM H;  3NAR A;  1Q1H A;  4KIT B;  3CUQ B;  3G2B A;  3LQQ A;  3MD2 A;  3T1B A;  3GTQ J;  3BG9 A;  5FKN A;  1H9G A;  4BJ6 C;  4OAY A;  4ENJ A;  2Z99 A;  1OQY A;  1E17 A;  3KYL A;  1QZE A;  1Z6T A;  4BDZ A;  2KZV A;  2PMZ N;  1PJR A;  1JKR C;  4DBQ A;  1OFC X;  1YYV A;  3HXL A;  3K1P A;  2DJN A;  5J6X A;  5JI6 A;  4ENM A;  2ZJQ F;  1DU0 A;  4J19 A;  3JAM K;  1O57 A;  4E7S A;  1F4K A;  2WY8 Q;  3W2W A;  4R79 A;  4KIS A;  2CW8 A;  1HST A;  4I7H A;  4IXA A;  2KJB A;  4UB8 C;  3OMY A;  5JHF A;  2BW3 A;  4HSR A;  2UV1 A;  1ZEL A;  5J1U A;  3T0Y A;  2DA2 A;  1GVJ A;  1LJ9 A;  4XKB A;  1RUN A;  1R1V A;  2MG4 A;  3CDI A;  3CUO A;  2BZT A;  4AUX A;  2IGN A;  1FMV A;  5DCF A;  2QEN A;  2HI3 A;  1ZLK A;  5FLM J;  3L2W A;  3F6O A;  3S15 J;  2HPI A;  1A31 A;  3BTI A;  1FTT A;  3CME I;  4NHJ A;  3RZO J;  2FX0 A;  1XGM A;  5M3F J;  1REP C;  4RAZ A;  1X2N A;  2DA3 A;  2BE5 F;  2R7V A;  2TCT A;  3FKI J;  2BXZ A;  3BZ6 A;  4PGG A;  3DPL C;  2PJR B;  2EV5 A;  1E2X A;  1OR7 A;  2E5Z A;  5EZH A;  3VYS B;  1SC7 A;  2HZT A;  1LUJ B;  1TZL A;  2ID6 A;  2E1M C;  5HOD A;  4AYB N;  4LB6 B;  1J09 A;  4P9U A;  2Y69 H;  4P9F A;  4CUG A;  1NK2 P;  2KMU A;  4X1E A;  5C44 J;  3JRH A;  2F2E A;  4HBL A;  3ABU A;  2M8G X;  3FXU A;  4BEH B;  3L9F A;  2O3F A;  2HYJ A;  4RGS A;  1B6A A;  2DJI A;  2DFE A;  2VJ4 A;  1UB9 A;  4HOB A;  3NEU A;  4FTH A;  3LQR A;  2XAJ A;  3AG4 H;  3EET A;  3HSE A;  3QOD A;  1WWX A;  2O8K A;  3RCO A;  2HNH A;  4LG0 B;  5BPD A;  2XB5 A;  3D5S C;  2LP0 A;  3EUA A;  4XN0 A;  1WFX A;  4XRS A;  4MLO A;  4CCN A;  3C2G A;  2H1L A;  3QOE A;  5IYB J;  1MD0 A;  2LY9 A;  5HVQ C;  5JR3 A;  1S9H A;  1Y39 A;  4XKV A;  4UUT A;  2WWY A;  3CCS I;  3L2U A;  1LEA A;  4DW6 A;  1SD7 A;  3GTO J;  4C2M J;  2LDU A;  2ZNZ A;  1FEX A;  1W0U A;  2R4G A;  1K7A A;  2LVS A;  3RQI A;  3CC2 I;  1MMN A;  1W7P A;  3RQ4 A;  4UUV A;  5LGT A;  4XLF A;  3ZQL A;  2Y0S N;  3OYF A;  3N05 A;  4ZTJ A;  3ZR8 X;  5LHI A;  1MJA A;  1IRZ A;  4ZDP A;  1TTY A;  2VKH A;  1FBU A;  1S7O A;  1F43 A;  4BJ5 C;  4PSX A;  4NC7 A;  3RI4 A;  4PJN A;  2X1D A;  4DYQ A;  4GXO A;  1T08 B;  2NNY A;  2E1N A;  1BI2 A;  2Y30 A;  3LSI A;  1OJL A;  2EFW A;  5FO5 A;  4E7H A;  3KZI C;  1O3T A;  1VZ0 A;  3WTV C;  1W5S A;  2EA4 A;  2LBF A;  1VND A;  3DLL F;  4ZYG A;  2L02 A;  3CUQ A;  1LB2 A;  3I59 B;  2M7B A;  1B8I B;  4CCL A;  1MNE A;  5HOO A;  5EGO A;  2VOO A;  4BQQ A;  4LIT A;  2GIV A;  3DU5 A;  1OLT A;  2DA6 A;  1OYW A;  2EV6 A;  5ICG A;  4ZYA A;  1KU3 A;  2KIF A;  2V1U A;  2Z9O A;  1O3S A;  2OAZ A;  1WQ2 A;  2KZG A;  4DYR A;  3QP5 A;  1U5T B;  3TDU C;  2VJI A;  2BHZ A;  1YJN I;  4YFK F;  3V8J A;  2MFZ A;  3DTK A;  4OWR B;  4E7K A;  2O7O A;  4ENN A;  4M6Y A;  3P9I A;  5M3M J;  4UB6 C;  2HVR A;  4BHC A;  3A01 B;  1W1W E;  2K7L A;  4AWX B;  3IV5 A;  1H8A C;  4BBR J;  1SFU A;  3MCZ A;  5C3E J;  1A6Q A;  2VPL A;  3CCY A;  3A0H C;  1I39 A;  3P7N A;  4M6X A;  2NVX J;  4Z6Y A;  1T39 A;  3RKQ A;  2IGM A;  3Q3S A;  2CUE A;  4EM1 A;  1AWC A;  4HX8 A;  2PI0 A;  5J47 A;  4DJA A;  5FD5 A;  1ENH A;  2E7X A;  1Y1W J;  2DK5 A;  3PIO F;  4OIO F;  3HGG A;  4S05 A;  5ICF A;  1IXR C;  2PMU A;  5K5Q A;  1DQU A;  3V4G A;  2CWE A;  2FRH A;  2PJR A;  2R7D A;  3ASO H;  4KFC A;  3WG9 A;  3QQA A;  3OYI A;  3BCB A;  5E3N A;  2QQ9 A;  1JGG A;  3H36 A;  1ODD A;  1HKT A;  3KZZ A;  2FEZ A;  2KIM A;  4MGR A;  4LLG F;  5BOX A;  5IYD J;  4RLQ A;  2E7W A;  3T5X A;  2Z33 A;  4BEH A;  5C4J J;  4UVC A;  2XAG A;  2DW4 A;  2WV1 A;  2Y31 A;  4UV8 A;  6PAX A;  3QAH A;  2FF4 A;  2DBB A;  3KEO A;  1U9O A;  4HDU A;  1YTY A;  3QWL A;  3H1C A;  1ZG3 A;  5GP9 A;  2EJR A;  4B8X A;  4HPQ A;  1B59 A;  1DGW Y;  3CLO A;  4KT6 A;  3I54 A;  3S2H J;  1JT6 A;  4LG0 A;  2XAQ A;  2JA8 J;  3N4M A;  2XSD C;  1D5V A;  1ZRF A;  1ETQ A;  3OYB A;  3RZD J;  3MKL A;  1HDD C;  3OIQ A;  3DBL B;  4BL0 B;  3BR6 A;  4D0P A;  2IGK A;  2OTL I;  4DGW B;  4ZDL A;  5IP7 J;  3E3V A;  2F4O B;  1HDP A;  2A61 A;  1AKH A;  2ADU A;  4NDL A;  2EV0 A;  3BPX A;  1IUY A;  2GZW A;  3EDP A;  1YOV B;  2F5E A;  4WXH A;  1EA3 A;  2ESH A;  1MIJ A;  2I8D A;  1IO2 A;  3RYR A;  3DKY A;  5TIS C;  1QGP A;  2PX9 A;  3BZK A;  2ZXI A;  4XLC A;  2L2O A;  2M7A A;  4C30 A;  2XRO A;  3DFG A;  2XF7 A;  3CCV I;  1U3E M;  3ABT A;  3RPQ A;  4OMZ A;  5GAG J;  2YX7 A;  1LVA A;  5IOZ A;  4LOC A;  1O7L A;  3JRD A;  3L2V A;  1EV7 A;  4ZYD A;  2F5V A;  2X0L A;  2QCO A;  3KP3 A;  3K7A J;  3Q9V A;  1ZYR F;  4ZDO A;  2RRE A;  4KMF A;  1T6S A;  1XSX A;  5KVR A;  5E3O A;  1P4A A;  2PMH A;  1ZGW A;  2C6Y A;  1YI2 I;  3RKY A;  3NAU A;  2J5O A;  3H0G J;  2IGO A;  1FOK A;  2CFO A;  2I5U A;  4CZZ A;  1WJE A;  4IHV A;  1ZR2 A;  1ETK A;  2RQP A;  3M07 A;  1BR2 A;  5J4Y A;  1B8I A;  4KT5 C;  1XSV A;  3HUG A;  3RTR A;  1HKQ A;  4Q5S F;  1B1B A;  1WGX A;  3BR2 A;  3IAM 2;  2XRN A;  4KNY A;  3V42 A;  4E6K G;  5EDN A;  2OQR A;  1MDM B;  4S0H B;  5EG0 B;  1U5T A;  3HOX J;  4CCM A;  4WF2 A;  2IA2 A;  4C3J J;  3PUF A;  2E2J J;  3V7S A;  2HOE A;  3T8R A;  4RGX A;  2W24 A;  2QKM B;  2PG4 A;  1P6R A;  4M72 A;  2IS4 A;  5E79 C;  3BY6 A;  1JXS A;  2L4A A;  3TP3 A;  3A01 A;  2CS3 A;  4XSZ F;  3V7R A;  2JVG A;  1DUX C;  3ECH A;  3K4C A;  4MFE A;  2FD5 A;  1IG7 A;  1I5Z A;  1G2H A;  1ZGJ A;  1TT5 B;  2G7U A;  4Z2Y A;  5E3M A;  1KU7 A;  2DN0 A;  2E60 A;  5ILS A;  1PDN C;  4BE1 A;  3KP6 A;  4NBQ A;  2R5Y B;  2ZXJ A;  2ETH A;  4CHU A;  4ZZL A;  2VC0 A;  1JJ8 C;  2HS5 A;  4U87 A;  1BOB A;  2NAZ A;  3FXQ A;  2JA7 J;  3DBR B;  2L9R A;  3OIO A;  3QPT A;  3ZMU A;  1R36 A;  5CKT A;  4UVA A;  5B1B H;  3WGI A;  2V26 A;  2JSP A;  2L01 A;  2EFP A;  4GFB A;  2XSJ C;  2CV1 A;  3BJA A;  5H6Q A;  3ZPL A;  1TWH J;  4C2T A;  1V54 H;  2W84 A;  1PP8 F;  2K9N A;  3OR2 C;  1J59 A;  1U8R A;  3E0J B;  2FBK A;  4KJZ A;  4LMY A;  2VN2 A;  1UFM A;  4JX4 A;  1RKT A;  2DOD A;  3GZ5 A;  4LLN A;  1R1T A;  2Z2S B;  3Q0V A;  4M73 A;  1YFH A;  4B44 A;  4W97 A;  4KIF A;  2R7Q A;  5F64 A;  2XIG A;  3HRM A;  5GPC A;  2IS1 A;  4BYY A;  1FOX A;  2HR3 A;  2YSR A;  3F9K A;  1N78 A;  4ZZD A;  2OQG A;  4MQ9 F;  4R8H A;  2QSH X;  4DZP A;  3UKG A;  3TO7 A;  3JTG A;  3J7Y J;  3CCQ I;  4BUP A;  1GLN A;  1HBX G;  1OR7 C;  3LWF A;  4XM3 A;  9ANT A;  1Z7U A;  4W1U A;  4OU0 A;  3SFI A;  1CF7 B;  4NB5 A;  2ECC A;  3WTT C;  2DT7 B;  3MFK A;  3HPG A;  1HA8 A;  2DI3 A;  4XLN F;  2DFF A;  3COA C;  4FX4 A;  3ZMS A;  2K02 A;  3FXK A;  4G12 A;  1B4A A;  1NG6 A;  2P6S A;  2E2H J;  5JVG F;  1G3S A;  1X1C A;  4IHS A;  4ABZ A;  3GX4 X;  1BR4 A;  1FC3 A;  4F91 B;  2ELJ A;  1HW5 A;  3TKY A;  3E97 A;  2X85 A;  2LG4 A;  4IJA A;  1Z21 A;  1MBJ A;  3K69 A;  4II3 A;  2D1H A;  4P5O A;  1TL8 A;  1RES A;  1VQM I;  2LLK A;  4A3G J;  1D3Y A;  3OS0 A;  3GZN B;  2IXS A;  3DTE A;  4AD9 A;  1JT0 A;  4XN3 A;  1XDS A;  5FRN A;  2J5P A;  2F5F A;  1MND A;  2EA2 A;  1J2X A;  3FK6 A;  3FMQ A;  4AIK A;  2JRM A;  1LNW A;  3BR0 A;  3CZ6 A;  4HST A;  3HHH A;  1R7J A;  1IN4 A;  3TOA A;  2DFI A;  5EG0 A;  1T56 A;  3GYH X;  3K4J A;  2RAE A;  3MQ0 A;  2YX4 A;  2DXI A;  1FWZ A;  3M8F A;  2NS7 A;  1MMD A;  4PJ0 C;  3GTK J;  4J01 A;  3K4B A;  2A69 F;  1ORK A;  1DDN A;  1MBH A;  1ZTR A;  3ZMT A;  3P5J A;  2ZO4 A;  2K4J A;  1E3O C;  1DGR M;  1IN8 A;  4N4O B;  1X3Z B;  3LSG A;  1VQ5 I;  2ISY A;  2R5Y A;  4OOI A;  1A6I A;  2E19 A;  2ZME B;  3ZQI A;  3I4N J;  1AA7 A;  4U0W A;  3OYH A;  3CUQ C;  2COM A;  2CUJ A;  2R5Z A;  1WJA A;  2IS6 A;  4RDU A;  1QPM A;  3PSI A;  1JGS A;  3OR1 C;  3QYF A;  3F22 A;  1QNT A;  2EZH A;  1UEL B;  1S29 A;  1D5Y A;  5BPI A;  3ISP A;  4YEL A;  4IKF A;  4R1H A;  3A2K A;  1JKO C;  3S17 J;  4A3F J;  1RIO H;  3CP8 A;  1SFO J;  2CMP A;  5HLI A;  4I2O A;  3DPT A;  3U21 A;  2H6C A;  2MC3 A;  1YRN B;  3GTL J;  5GPA A;  4F52 A;  3J80 Z;  4F55 A;  2W7N A;  1GT0 C;  3A4C A;  3OOU A;  5L3D A;  4EM2 A;  4EEF G;  5CVJ A;  1VTN C;  4Y4R A;  1D8J A;  2HDW A;  3M1C A;  2V6C A;  2XKO A;  4XLP F;  5E3L A;  4EVI A;  3GFI A;  4BE0 A;  3GTG J;  1JI8 A;  2A6T A;  2W57 A;  5CLS A;  1NHA A;  3DPU A;  1P4X A;  1R1U A;  5DD4 A;  2LF8 A;  2AS5 F;  5D5W B;  1V55 H;  2Q8K A;  2WAE A;  2NVU B;  1ZR4 A;  4NNJ A;  2UWM A;  2OU2 A;  2G7H A;  1I6H J;  1BM9 A;  3ZMD A;  5L3C A;  2LD5 A;  4QPO A;  2D2W A;  2R3S A;  3JRG A;  4C9Y A;  1Y8Q B;  3CF5 F;  3H35 A;  5FLX Z;  3HOV J;  3TW7 A;  1XN7 A;  4WX9 A;  1R22 A;  3S1Q J;  1ZG5 A;  5CVV A;  4A3J J;  1WZ2 A;  1JHF A;  4IOC F;  3P9K A;  1RZ4 A;  3AG2 H;  3JCU C;  3C7J A;  4M6V A;  4EM0 B;  2K40 A;  1P7J A;  3DP7 A;  4G7O F;  4QIW N;  2R92 J;  3X2Q H;  1Z05 A;  1XSD A;  2JK3 A;  1KZH A;  1X2M A;  3I4P A;  3CJN A;  4BQA A;  4BY1 J;  1IRX A;  5IP6 A;  1JHH A;  1UZC A;  3TOB A;  3W3C A;  4KUM A;  4HYE A;  4EJO A;  2CUZ A;  2FA5 A;  3IAS 2;  1WJ5 A;  1FZP B;  1LQ1 A;  1MW7 A;  5J40 A;  4DOZ A;  2KDZ A;  1DU6 A;  2JMW A;  1W7P B;  3BR3 A;  3BG7 A;  2R0Q C;  1BA5 A;  3GFM A;  3PM1 A;  3G1O A;  5HDN A;  2PLY A;  4A5N A;  4D5F A;  4BY7 J;  4HA8 A;  2R7U A;  3F23 A;  4IHY A;  1TLH B;  2QYO A;  4F92 B;  5F1J A;  4Y17 A;  1YJW I;  1WKM A;  2WBM A;  4A5M A;  3TQN A;  3WOD F;  1BW6 A;  1ZAO A;  1UMQ A;  4BGD A;  4ZYH A;  4ZH4 F;  4ETS A;  2AO9 A;  1X4O A;  3E5U A;  1XPX A;  4U0V A;  4XON A;  2O61 A;  4XR6 A;  3BDD A;  4I01 A;  2X6O A;  4HG2 A;  4MNU A;  2LBF B;  1P7I A;  3FHN A;  3S14 J;  1S7E A;  5EGO B;  3DU6 A;  4LK0 F;  2EIK H;  1LFP A;  1WHU A;  3MAJ A;  2NNN A;  2X9D A;  2R7R A;  1EF4 A;  2ZME A;  1E3H A;  4AM3 A;  3J7A O;  4MEX F;  2DO7 A;  4HEA 2;  1I27 A;  3OS1 A;  1J9I A;  1QRY A;  2CYY A;  2K85 A;  1SEU A;  1BI0 A;  3AG1 H;  1KQ9 A;  3LFU A;  1ZG1 A;  5IT9 K;  3NQO A;  4LD5 A;  2FNP A;  4KA4 A;  1UST A;  3J80 K;  2DTR A;  4O6J A;  2P7V B;  1W5T A;  3VYU B;  5DEQ A;  1U5T C;  1VFC A;  1RR8 C;  2WAD A;  5K7Z A;  2VJJ A;  2ME0 A;  2MH9 A;  4D5C A;  4JP0 A;  5B5E C;  5LEK A;  3GTM J;  4GYG A;  4A69 C;  3L2R A;  4BDY A;  1JE8 A;  1XDU A;  1W4M A;  3NWT A;  2ECB A;  5D6F A;  1YRN A;  3LL7 A;  1VF9 A;  1ZAR A;  3S1R J;  5LGN A;  4DBR A;  2X4H A;  1FIA A;  5CVR A;  1VQ4 I;  1SD4 A;  2BY2 A;  2O5R A;  2IW5 A;  1LFU P;  4M3D A;  5FLX K;  5F08 A;  2EZI A;  1R5G A;  3SZG A;  4F93 B;  1K4T A;  2NVQ J;  1R6R A;  3BP8 A;  2A6H F;  3DWL E;  1ZRD A;  2W48 A;  2OTJ I;  3M1E A;  4O5V A;  2H27 A;  3KLN A;  4JBA A;  2XAF A;  4V2G A;  2DYS H;  1Z6R A;  4A3B J;  4D7N A;  3TL4 X;  1YS6 A;  2EQR A;  2LTP A;  1IN5 A;  4PZJ A;  5B1A H;  1HXD A;  3LFK A;  2QSF X;  2LC2 A;  1FPQ A;  4RGU A;  4L5E A;  3QPH A;  1SVO A;  1KON A;  3WTW C;  4Y13 A;  3IKV A;  1R5I D;  3KYC B;  1ETV A;  3VOD A;  2VQC A;  2HKO A;  5D5U B;  5ERI A;  2H8R A;  2O0Y A;  4A0Y A;  5KHD A;  3CCM I;  4JX5 A;  4A0X A;  3SEZ A;  3ULQ B;  3L1P A;  3BC8 A;  3CP2 A;  3LNQ A;  2IT0 A;  2DK8 A;  4Y52 J;  1I6X A;  2AHQ A;  4BAY A;  3AFH A;  1ETX A;  4M9Z A;  3HM5 A;  3Q0U A;  4XLE A;  3BWG A;  5B66 C;  1AKH B;  1I3A A;  1MKM A;  2DMT A;  4AVP A;  3K2Z A;  3Q0W A;  2L3D A;  2LY1 A;  3UNG C;  4CCK A;  2DOF A;  2OF7 A;  3RPU A;  2BY0 A;  2VKE A;  2DU9 A;  5ILV A;  4U88 A;  3CF2 A;  3HKZ A;  3V8K A;  2UZK A;  1OIS A;  1P4W A;  2CQN A;  2ZSH B;  2EIL H;  3OYN A;  3ESW B;  2W00 A;  2MYS A;  2HFH A;  1R71 A;  2H09 A;  3WTX C;  4IRG A;  3EUH A;  4EAT A;  1QHG A;  3LA7 A;  2HQN A;  1AHD P;  2W25 A;  2V1D A;  1NG7 A;  1UAA A;  2YS9 A;  4CIC A;  5E1X A;  3FK7 A;  2RVC A;  1HCR A;  2DMP A;  4UV9 A;  5CJ9 A;  1IRG A;  2ZBK A;  2JA2 A;  3HZJ A;  1RNL A;  2CW7 A;  4A3L J;  2D45 A;  3FWE A;  1Z9C A;  2KFD A;  1N75 A;  1BIA A;  2HWV A;  2P5V A;  3OL4 A;  4LJZ F;  5E1W A;  4CCO A;  3HUG B;  2A05 A;  1FIP A;  1H9T A;  5K5R A;  3LSH A;  2COB A;  1SMT A;  3I58 A;  4HW0 A;  3RYP A;  3ABL H;  2H94 A;  1KA8 A;  3KLO A;  5GTH C;  3R60 A;  4FCY A;  1ULY A;  2X51 A;  1ZN2 A;  2WV0 A;  2BVL A;  3F8M A;  3MZH A;  1T0F C;  1A04 A;  4HLX A;  3ZCO A;  2CGP A;  1DP3 A;  2KJC A;  1GV2 A;  5HLT A;  3E6M A;  4RB0 A;  1EJ9 A;  3DTI A;  3LSP A;  2JRT A;  3H5N A;  2RN7 A;  4KIC A;  3JRA A;  2FQ4 A;  1FBS A;  4UNO A;  1OCO H;  3FBN B;  1MSE C;  4PK4 A;  5HDG A;  1J75 A;  2M4K A;  4E4H A;  3ZP5 A;  1JKP C;  4LB5 A;  1PUE E;  1IZ1 A;  4XBF A;  2G9W A;  1QO0 D;  5LBQ A;  2DA1 A;  2QF7 A;  3C2H A;  2LSO A;  1WSU A;  1MBK A;  3ZQC A;  2UXN A;  3LSR A;  2DPD A;  2BHY A;  3ONQ A;  1X1P A;  1PVE A;  1G3Y A;  2BXY A;  3PQK A;  3HOY J;  3W2A A;  1Z77 A;  5D4S A;  5EJC A;  4HAM A;  2XAS A;  2B0L A;  2V4J C;  3G73 A;  2DMQ A;  3PL8 A;  1F9N A;  2VOP A;  5D8L B;  2IBD A;  3S3M A;  2VQL A;  3L00 A;  4ON0 A;  2M9H A;  4XID A;  2MGQ A;  4XRS G;  1GXQ A;  3ZQ7 A;  1ZLJ A;  4IZZ A;  1IGN A;  2K4B A;  2FML A;  1YE9 A;  1LE8 A;  4UUS A;  1K4S A;  4E7J A;  2N8G A;  3V8L A;  2A5Y B;  4A2U A;  3B73 A;  3OYK A;  5HNF A;  2M30 A;  4ESJ A;  2DT6 A;  4ITV A;  3VFZ A;  4ESB A;  1DP7 P;  3M9A A;  4HQM A;  2ZFW A;  2FBH A;  4M9X A;  3N97 A;  4RAY A;  1IV6 A;  2FU4 A;  2ACJ A;  4P96 A;  1XMK A;  1K78 A;  2P5K A;  1SAX A;  3CC7 I;  3DEE A;  5IOY A;  3W6K B;  3IH3 A;  5FKO A;  3G71 I;  2KLO A;  2V79 A;  2BGC A;  3AL0 B;  1WI9 A;  2BEO A;  1R4N B;  2QGU A;  5DYM A;  2DPU A;  1GVD A;  1F36 A;  5CQE A;  4U7B A;  3I55 I;  2GA2 A;  2HTJ A;  4IHT A;  3CD6 I;  3G4S I;  2IA1 A;  5JVT A;  3O8H A;  1CGP A;  2K86 A;  3M8J A;  2A5W A;  4EV0 A;  3V7C A;  2VQH A;  3GTP J;  1LDK B;  1HSJ A;  1OYI A;  1RI7 A;  4ZJZ A;  3BG3 A;  1TQI A;  3MEX A;  4XKC A;  1T95 A;  5HS8 A;  5K7H A;  2LRD A;  3VYR B;  4AID A;  1T38 A;  3S8P A;  2XUB A;  3JRF A;  3WU1 B;  2EZK A;  3H3V K;  1XC5 A;  2HTS A;  2HXI A;  1Y56 A;  3HPH A;  2FUG 2;  2FBI A;  1R4M B;  3LST A;  5JLX A;  4A12 A;  1GHC A;  5GTI C;  1IXS B;  2G0E A;  4GDF A;  1IRF A;  2DA7 A;  2VJ5 A;  1USS A;  5D5X B;  5FRM A;  4EJV A;  4ZC3 A;  2Q1Z B;  4BKX A;  3ABM H;  2XC7 A;  2BOL A;  3ELK A;  4CCJ A;  3WE3 A;  4V19 K;  4H4K C;  4Q47 A;  5F04 A;  4YFX F;  3BOQ A;  2CG4 A;  2AXL A;  4XOP A;  4MO7 A;  3JRC A;  1Q1V A;  3PFI A;  3LA2 A;  1XG1 A;  3FXJ A;  3K4M A;  4KDP A;  4FAS D;  3CDH A;  2ZJ2 A;  4B09 A;  2CQ7 A;  1S6L A;  3D5L A;  2KPM A;  4B48 A;  3VWB A;  5BMZ A;  4JK1 X;  1XS9 A;  2QUF A;  3TBI A;  3R61 A;  3FM3 A;  2P7C B;  4G94 A;  2R7O A;  1O7F A;  4I76 A;  5LEJ A;  3SZP A;  1UCR A;  2BVM A;  3T8T A;  3CCJ I;  2VBZ A;  2FXA A;  3CES A;  1RR7 A;  2RNJ A;  3HRS A;  2BBY A;  3DCF A;  3DQV C;  3KP7 A;  2VBW A;  1D1A A;  2LH9 A;  2QQ8 A;  4IRI A;  2NXN B;  4CDG A;  3CO7 C;  1TWF J;  1A36 A;  3ECO A;  3S2W A;  3SDG A;  2K9S A;  1ERD A;  2DT5 A;  3CO6 C;  1K6O A;  2YPR A;  4KMU X;  1O3R A;  3ZXS A;  3OYJ A;  4KYW A;  2TRT A;  2OV7 A;  4L5J A;  2IRF G;  4CYD A;  3CTA A;  1TWC J;  4Y7N J;  5BQT A;  2DAO A;  3FKJ A;  2R5Z B;  1GXP A;  3B02 A;  5LLQ A;  3GFL A;  3HKZ N;  5H6R A;  2NOG A;  2V9P A;  2E1C A;  2Y48 A;  2DA4 A;  2LY2 A;  1MZB A;  5L3B A;  2ZME C;  5LGU A;  1K6Y A;  4HX4 A;  3BR5 A;  3OYC A;  1IXC A;  4FQG A;  1SMY F;  5EF6 A;  2CU7 A;  2HDD A;  4BQO A;  2KRC A;  3C18 A;  3QU3 A;  5KCM A;  2KKO A;  5AIP A;  1KU2 A;  1TP4 A;  2VPR A;  4Q48 A;  2GOM A;  3MKW B;  1OYY A;  4NC6 A;  1MMA A;  1JUM A;  3D1N I;  2O6G E;  3PQJ A;  3LAP A;  3IC7 A;  4EJW A;  5ICE A;  3TDZ C;  1BL0 A;  1BJA A;  4A6D A;  2DA5 A;  2FNA A;  2L9S A;  4A3D J;  2ID3 A;  2GWR A;  1BIB A;  2X1C A;  3RIR A;  1V5E A;  2XGX A;  4CO8 A;  4EJU A;  2D5V A;  2VT2 A;  3FF5 A;  3IP4 B;  2L7Z A;  3OYD A;  2HYF A;  3C3W A;  1I50 J;  2OJE D;  4IPA A;  4PDK A;  1S8N A;  3LSJ A;  2GOX B;  2RDP A;  5KAF C;  2O9L A;  1FOW A;  2M4G A;  1MBF A;  1GDT A;  1XX5 A;  2VUM J;  2CH0 A;  5IPA A;  1R9T J;  1IAW A;  1I1S A;  3ZQQ A;  3QYE A;  1FJL A;  2GLO A;  2XKP A;  1EKE A;  2VIX A;  3NRV A;  5K1Y A;  2UXX A;  2XDV A;  2LF7 A;  4CH7 A;  1TQM A;  4DQ2 A;  3NWS A;  4KIG A;  3K9T A;  3CCL I;  2LK2 A;  3RJP A;  3RKX A;  4M9S A;  2L9V A;  4I0B A;  4KIB A;  4XL9 A;  2F5D A;  2K3P A;  2R7F A;  1XGO A;  4B47 A;  5D5V B;  5IP9 J;  3J7A Y;  2FE3 A;  1YIJ I;  4DZJ A;  3GME A;  2Z16 A;  3PIP F;  2HU9 A;  3U1D A;  1D1B A;  1FSH A;  2PFB A;  2VAS A;  2E1O A;  2RQQ A;  1POG A;  2DQR A;  2CQK A;  3ABK H;  3FZV A;  3BT9 A;  3PNT A;  4YRV A;  4AC0 A;  3U2R A;  2WB1 A;  4L5I A;  1Y6I A;  2X1E A;  3F72 A;  4XIC A;  1JUS A;  4PJJ A;  3DLA A;  4ZYE A;  1JKQ C;  2V1N A;  3MN2 A;  2NRA C;  2ZJP F;  3PNY A;  4HNT A;  1NH3 A;  1RUO A;  2DOA A;  2NVY J;  2IA0 A;  2QZ8 A;  2ME6 A;  2DLL A;  3TO6 A;  3TO9 A;  3CCE I;  2KDO A;  5LFA A;  3ZQF A;  2K9M A;  2XV4 S;  2KP6 A;  3I9V 2;  5FGM A;  5M5Y J;  2KL4 A;  4A3I J;  3H5R A;  1YW8 A;  1FX7 A;  1S7A A;  2QQB A;  3BLY A;  5CQG A;  3RPU D;  3VEP A;  2HZD A;  5E8I A;  4L0Z B;  1W7P D;  1T2K A;  4G6D A;  5M5W J;  1YG2 A;  1PYV A;  1LDJ A;  1R5H A;  1FY7 A;  5HDK A;  3KIO A;  4XK4 A;  2W85 A;  5HNH A;  3PJR A;  2NYX A;  3ML6 A;  2IAI A;  4HF0 A;  1J0R A;  1FSE A;  4N9I A;  3GO5 A;  2V7F A;  3EUH C;  3K70 D;  4GYI A;  3HEF A;  3K70 C;  2M45 A;  1TW2 A;  1S5L C;  4EQQ A;  1X58 A;  2MLK A;  4K2E A;  1YW7 A;  1G59 A;  3DEW A;  3F8C A;  1B9M A;  2OPT A;  3SYT A;  3BPV A;  1SFE A;  4Y15 A;  1XMA A;  3I71 A;  2VOD A;  5F0F A;  1OCR H;  4IQ4 A;  3IHU A;  3BTL A;  3CJR B;  2QEX I;  2MLG A;  1X3W B;  5HLG A;  1PUF B;  2M1B A;  2GAU A;  4H0E A;  4BXU A;  2JT1 A;  2E5N A;  1MSF C;  2M87 A;  4MEY F;  3BQY A;  5HS9 A;  3EYI A;  3FDY A;  4M74 A;  3BTJ A;  5LHG A;  3P9C A;  1ETY A;  3JSP A;  1G6N A;  3KYD B;  3MWM A;  3EYY A;  3BJ6 A;  2HQR A;  5GAE J;  1EH7 A;  1G8X A;  1T98 A;  1MGT A;  3PSF A;  2QWW A;  2GXB A;  3KE2 A;  2QLZ A;  4YIF A;  1I1G A;  3DKW A;  3ZRG A;  3QRF F;  2NVT J;  3ZQH A;  1ON1 A;  2JWT A;  4RS8 A;  1RET A;  3E7L A;  4N0B A;  2W1O A;  3HG9 A;  1LEB A;  1ZHF A;  5DM7 F;  2Y2Z A;  1MBE A;  2EZL A;  5JHU A;  3BRO A;  2ZC2 A;  2VXD A;  3HSR A;  4ANJ A;  3AAF A;  4AIH A;  3DV8 A;  1DPU A;  2XVC A;  2MSY A;  1OCP A;  2Y9Y A;  3FXO A;  3H5A A;  1H88 C;  2HOT A;  3KPH A;  2F5C A;  2VE8 A;  3L2C A;  3ROU A;  3KFW X;  2QBY B;  2OA4 A;  1EH8 A;  3WU0 A;  3CCR I;  1Z67 A;  1UHS A;  1QVT A;  1LKX A;  3IL2 A;  3WE2 A;  1HF0 A;  2MA3 A;  2AQF A;  5LRR A;  2VXZ A;  4B3A A;  5K7F A;  2LKS A;  5EYR A;  4XRM A;  1TT0 A;  2K27 A;  3IUO A;  2V9V A;  2Z1D A;  2VON A;  1QA6 A;  1HLV A;  2HVQ A;  4MFD A;  3WG7 H;  1ONV A;  5GAD J;  3WTU C;  5J4V A;  1LDD A;  4C2U A;  5DD8 A;  1F5T A;  3MKZ A;  3HTU A;  5HS7 A;  1ZGA A;  3R0A A;  4NC8 A;  4BXF A;  1VQL I;  3FMR A;  1FP2 A;  3FM5 A;  4DIQ A;  5ED4 A;  4CXF A;  1BI1 A;  2IVM A;  2WA0 A;  3TW6 A;  4Y33 A;  2DYR H;  2EPF A;  2R93 J;  2WY7 Q;  5DM6 F;  1S72 I;  4OMY A;  2KHM A;  5D8K B;  3O2P E;  5CYV A;  3PNV A;  1YHQ I;  4OIQ F;  1FTZ A;  1ZKG A;  3HRU A;  1HC8 A;  5BNG A;  4RB1 A;  1IN6 A;  3W2V A;  2EK5 A;  1HQC A;  3QPL A;  1SAU A;  3DBH B;  4A0Z A;  1OCT C;  1YX3 A;  1O3Q A;  1MJB A;  4BXX J;  5FFX A;  3K4L A;  2M2E A;  5J1R A;  3BQZ A;  3BJO A;  3F0C A;  4FT8 A;  4I09 A;  4HQE A;  2HYG D;  3WGH A;  2JQ7 A;  3HBL A;  3F3X A;  3HGY A;  1UJ8 A;  3CDL A;  3ZN0 A;  1GV5 A;  4BHB A;  1DPR A;  1XCB A;  3OYM A;  1V5G A;  5FKL A;  4BE2 A;  3W6V A;  4ESF A;  1X1B A;  4YEJ A;  3EQL F;  4DYC A;  4WWC A;  2STT A;  1V3F A;  1YLF A;  4RB2 C;  1KQ8 A;  1SD5 A;  3LSM A;  1WJD A;  4L9J A;  3VSK A;  1L3L A;  4P1W A;  5DS9 A;  1P2F A;  2CSO A;  4PGH A;  5DV5 A;  2L7M P;  1VQN I;  3GUD A;  4JX6 A;  1T8I A;  1PUF A;  3HTS B;  1TW3 A;  3H9J A;  4F7Z A;  3EUK L;  3OYL A;  4U7D A;  1FYL A;  1BOA A;  2YU3 A;  1K83 J;  2OBP A;  3PFY A;  3ZN1 A;  2KIS A;  2X6X A;  1LFB A;  4CZC A;  3S2D J;  5L3F A;  2GIZ A;  2IJL A;  5BS6 A;  1W5C C;  3KET A;  2Z3Y A;  1SFK A;  4LIV A;  2XB0 X;  4ZTF A;  4HRI A;  4PFO A;  2WB1 N;  2XGE A;  4F3Q A;  2KIQ A;  4NQW A;  5DDG A;  3QPS A;  4YG2 F;  5LHH A;  4GRI A;  4P55 A;  4WK8 F;  1XCV A;  5CVU A;  4RMN A;  5C4X J;  2JZY A;  3WU2 C;  4KN7 X;  5JLW A;  1VI0 A;  4OIN F;  1R58 A;  1T33 A;  4FE7 A;  3CMM A;  3WHB A;  4S04 A;  5F0C A;  5A2Q Z;  3J7Z I;  2LRE A;  2IPQ X;  3R0J A;  1VQ9 I;  2GXG A;  3H92 A;  3C2B A;  2QBY A;  2PJP A;  2K5C A;  4MHG A;  1CQT A;  1ACI A;  2Y75 A;  1UHW A;  2GBY A;  3OV8 A;  1ETW A;  4QLC U;  2LKX A;  2JJ7 A;  2LMD A;  4IL6 C;  4A6E A;  1LE8 B;  4UUS B;  2Q2E B;  4L18 B;  4G9Y A;  1IW7 F;  1Z7L A;  4X0G A;  2Y9Z A;  4XOT A;  3I4M J;  2DQL A;  3MKY B;  3IWF A;  1JTX A;  2H6B A;  4I99 C;  3KEY A;  4JQF A;  3I56 I;  4X6A J;  3G1M A;  4MTE A;  5DUI A;  4ENK A;  5FKM A;  1WH7 A;  1IDZ A;  3MVP A;  3FXM A;  1K78 B;  2R7S A;  3O8G A;  4PCQ A;  2B7E A;  2JVH A;  3S32 A;  4OIR F;  3M3Y J;  3BZC A;  5DTD A;  1R49 A;  2D1V A;  3M8E A;  2VBY A;  1RKW A;  3E1S A;  2QA4 I;  2CW0 F;  1A35 A;  2VBX A;  2E35 A;  2V9K A;  2GA1 A;  3AL0 C;  1ITY A;  2DCE A;  4II2 A;  3S1N J;  2BV6 A;  3S3O A;  1ETO A;  3GLX A;  3C1D A;  3CMA I;  2O8X A;  2MH2 A;  3GBG A;  3F8F A;  3VOE A;  2PEX A;  2R7W A;  3OSF A;  1IN7 A;  2BY3 A;  4HLY A;  1Z3X A;  1WPK A;  4LIU A;  2GM4 A;  3K1N A;  4PJL A;  5E17 F;  1SFX A;  2M3A A;  4G6T B;  2LOO A;  5AIQ A;  2L9N A;  2P4W A;  3GVA A;  4PSW A;  3SZT A;  2B63 J;  1G4D A;  3OYE A;  1U8B A;  3H3Z A;  4JOM A;  1MMG A;  3HYI A;  3OWT A;  4UHT A;  1B9N A;  1SD6 A;  3LOC A;  3LSK A;  2ZNY A;  3GXO A;  3JW4 A;  4BAC A;  5B3S H;  1D0X A;  4BNC A;  4BQN A;  2JUG A;  4FHT A;  2FJ1 A;  2VKV A;  4M3E A;  3D5R C;  2CV2 A;  5D6E A;  4BS9 A;  3SJM A;  1F1Z A;  3OYG A;  1WH5 A;  4BHP A;  3FX3 A;  3AKZ A;  4XMY A;  4XLH A;  2F4M B;  5FD6 A;  4A3E J;  3A1Y A;  1FT9 A;  4JYK A;  3TMO A;  3WHC A;  5F1R A;  5FB2 A;  3E6D A;  3VSL A;  1YQA A;  5CPR B;  3ZGK A;  1U2W A;  3IKT A;  3GCM A;  3Q5F A;  3IWZ A;  2MC4 A;  2VT3 A;  5EEA A;  3RKW A;  1QBJ A;  2NOJ B;  2EB7 A;  3WTZ A;  4TV7 A;  2ZFU A;  2ICW G;  1KQ0 A;  2HQ5 A;  3LMM A;  4RAF A;  4OAZ A;  4YIR X;  4N4N B;  3LA3 A;  3A0B C;  1OMI A;  1FBQ A;  2ELK A;  3GFJ A;  2FSW A;  3OIP A;  3SFZ A;  5A2Q K;  3HOS A;  3CMY A;  1W0T A;  2HPM A;  2MD0 A;  1MH4 A;  1XGN A;  3FBI B;  3BCA A;  2BY1 A;  2XPU A;  5GAH J;  2WAF A;  4E7I A;  2EFN A;  2A68 F;  4IVN A;  2HOA A;  5KNL A;  1QHH D;  2DFH A;  2L4M A;  1SVL A;  3KP2 A;  3KX2 A;  2EH3 A;  5E18 F;  4GCV A;  2F6C A;  3FIW A;  1IDY A;  4QPQ A;  2JTV A;  1R00 A;  1U6G A;  4XQF A;  5LRS A;  1H89 C;  3HJE A;  1TNS A;  2I10 A;  1ZK8 A;  4M3G A;  4RB3 C;  2HOS A;  4G6Q A;  1PP7 U;  1P9Q C;  2ZJR F;  5F6F A;  1SVM A;  2E1M B;  2Q2E A;  1HW2 A;  4G8X A;  1I3Q J;  2OD5 A;  2LFB A;  2DDA A;  2CFX A;  3ZQG A;  2F48 A;  1RPW A;  1TWA J;  2DOE A;  1BI3 A;  2DTZ A;  4GO1 A;  3JR9 A;  1TBX A;  2QQA A;  2W82 A;  1O4X A;  4CSW A;  3A03 A;  3E5Q A;  3L09 A;  1QQI A;  4I6Z A;  1HW1 A;  3EPZ A;  3FXR A;  3VB2 A;  2XGC A;  4IEJ A;  4G7Z F;  4CA0 A;  3IH4 A;  3KZY A;  3TGN A;  3L7W A;  2IP2 A;  5E1Z B;  5J8C A;  3K6G A;  4A93 J;  5L3E A;  3CCU I;  1WCM J;  3QYB A;  3AG3 H;  4N9H A;  1X4P A;  2MD5 A;  2OUM A;  2RC4 A;  2WAQ A;  4V2F A;  2QSG X;  3JRE A;  1YX5 A;  2QM3 A;  1C0W A;  4A3C J;  3GZ6 A;  1OCZ H;  1FP1 D;  3BR1 A;  4J00 A;  2L7F P;  5JFR A;  3OYA A;  3MZ8 A;  2OCC H;  2GXA A;  2DMN A;  3VDX A;  3Q9S A;  1V5F A;  1X19 A;  1MBG A;  5J1Y A;  5EEG A;  1B72 B;  4M3F A;  2P81 A;  3S1M J;  2NS0 A;  4B1R A;  1OKR A;  1M1E B;  3HC7 A;  4UVB A;  1QU3 A;  2WTE A;  1BN5 A;  5D4R A;  1NK3 P;  3M4O J;  4HDV A;  1BC8 C;  3HOT A;  1SAN A;  4HV5 A;  2JPB A;  5FKK A;  2IS2 A;  4I02 A;  4E7L A;  1HOM A;  2PN6 A;  3HB9 A;  3DEU A;  2L0K A;  3LAJ A;  2PQ8 A;  2HEO A;  4HNU A;  2E2I J;  2STW A;  2M8E A;  3J81 Z;  4GGG A;  2HKX A;  4XOR A;  1IC8 A;  1UHM A;  3SHF A;  3IH2 A;  4CGZ A;  3TED A;  1FYK A;  3SDB A;  1BJZ A;  3R4K A;  2JSC A;  2XHK A;  1HKS A;  1Z1D A;  2HXO A;  2ZXH A;  4AIJ A;  1N25 A;  2VB6 A;  1YO5 C;  3CQZ J;  1H0M A;  3I59 A;  3QU6 A;  2K3F A;  2OCE A;  2DMU A;  3DXJ F;  3KEQ A;  2DDB A;  2LNB A;  1GUU A;  2VLA A;  2LR8 A;  2MBF A;  4RM2 A;  3ZMZ A;  5AON A;  4M3B A;  3OS2 A;  5DUK A;  3F8N A;  2HQA A;  4RM3 A;  1Y0U A;  3CLQ A;  3G3Z A;  3B6C A;  2XAH A;  3CJT B;  1A5J A;  2YU9 J;  2E71 A;  4O3M A;  2KQR A;  2ZB9 A;  1N77 A;  2YR2 A;  1X1A A;  1Z91 A;  1MJ9 A;  2JPC A;  2P0W A;  4RBO A;  2FOW A;  3PO2 J;  2YUS A;  1KYW A;  2E34 A;  1TC3 C;  1BW5 A;  3BG6 A;  2A3S A;  1JTY A;  1AOY A;  2M0M A;  2FMY A;  2F4I A;  3HL2 A;  1TQP A;  1VQ7 I;  2M0C A;  3L2Q A;  3SEQ A;  2HDC A;  4IF4 A;  3ERM A;  1NTC A;  2XPV A;  2EBI A;  1E0E A;  3K4N A;  2EFO A;  3GW2 A;  3G6E I;  3W6J B;  3O6B B;  2EWN A;  1TWG J;  4HNV A;  4A3K J;  1KU9 A;  3F6V A;  4IRH A;  3ERE D;  1S3J A;  1KGS A;  4B3X A;  4FE4 A;  1G3W A;  1J7K A;  3JRB A;  3QP6 A;  2W4S A;  5J3L A;  3FHZ A;  4D7M A;  2H1K A;  2KRF A;  1XB4 A;  4CYC B;  4HZF A;  4PUS A;  3S93 A;  5TRD A;  4MIM A;  1WJC A;  3VPR A;  3GTJ J;  2LKP A;  3D0S A;  2XGD A;  2AQE A;  3O3K A;  3SXY A;  3HOU J;  2QKL B;  3S3N A;  2VE9 A;  4QSH A;  4C3H J;  2XRL A;  5J8F A;  1QZY A;  5IY5 H;  2EIJ H;  2L7K A;  1IUF A;  2WC2 A;  3FXL A;  5EEH A;  3UR3 C;  4E7Z A;  2R7T A;  1MH3 A;  4MTD A;  3JSO A;  5LD2 C;  3PUB A;  5TGT A;  1U0J A;  1WJF A;  3GWZ A;  3RSN A;  3GLL A;  5IT3 A;  4LGW A;  2P6T A;  2PMZ A;  4M71 A;  1FLI A;  4QWQ A;  3J81 K;  2UUZ A;  1B72 A;  2OZU A;  1QVU A;  2R7X A;  4RAG A;  1WRJ A;  3I53 A;  1AU7 A;  4YFN F;  1X1D A;  5DCM B;  3DF8 A;  2LYC A;  3MMY B;  3HSF A;  4BBS J;  1X3U A;  2ISZ A;  2B9S A;  4XRF A;  3E5X A;  1Y0N A;  4AVZ A;  1VQ8 I;  4IQJ A;  3B6A A;  2NS8 A;  3G1L A;  2VL8 A;  3RDI A;  1Z3Y A;  4LFU A;  1FOY A;  4EMS A;  4IHW A;  1FMW A;  5FJ8 J;  1XTA A;  1K79 A;  2ZSI B;  3E6B A;  3ZMV A;  1EH6 A;  4QTR A;  3WTS C;  4UXN A;  3MZY A;  1T0F A;  3K2A A;  1WJB A;  4BU2 A;  2Y0M A;  4EJT A;  4RGR A;  2RV8 A;  4AYB A;  4HX7 A;  1E3P A;  1L0O C;  3GF2 A;  4E70 A;  3A02 A;  1MDM A;  2V6E A;  2O03 A;  4FIS A;  3KP5 A;  1P92 A;  5FRO A;  4B43 A;  2WAQ N;  5HLH A;  1D8K A;  1XD7 A;  3OOP A;  1R23 A;  1JJ6 C;  5H2F C;  1YW9 A;  3HRT A;  4PFP A;  1BBY A;  4BH9 A;  2HVS A;  2X6W A;  4C3I J;  3IRQ A;  1FNN A;  2A07 F;  4I98 B;  2Q0O A;  2HGC A;  3I0T A;  3I3L A;  2CQX A;  4D1Q A;  4IX7 A;  1ZH5 A;  2MW8 A;  1VQK I;  3PO3 J;  3BG5 A;  1IJW C;  4IO9 F;  3HOZ J;  5F0H A;  2M5W A;  2GQQ A;  2CUF A;  3H9G A;  5FFZ A;  4I0A A;  3K1M A;  2K9L A;  2KRH A;  2EIN H;  3TP0 A;  2L5Q A;  1STZ A;  1V4R A;  4NQW B;  3VYT B;  3F8B A;  1BC7 C;  1RC9 A;  2ZXW H;  4EGZ A;  2R7Z J;  4RLF A;  5F27 A;  4WCG A;  1LVK A;  4L9T A;  3CC4 I;  2XF6 A;  5E20 A;  1D0Y A;  2P8T A;  4WXD A;  3WTY C;  2CO5 A;  4IHX A;  2BW3 B;  2RKH A;  5M5X J;  2CRG A;  2BYV E;  2CV0 A;  5K5O A;  4RA2 A;  3JRI A;  3JTH A;  5H20 A;  2FQ3 A;  2OC6 A;  2X6Y A;  3JAM Z;  1VQ6 I;  2OZ6 A;  1ZQ3 P;  4OIP F;  3IRR A;  2FOK A;  1VQP I;  3HIF A;  5IT9 Z;  2Y0S A;  3CJQ B;  4IOA F;  2TDX A;  4L9N A;  4CYC A;  4U0Y A;  3H9Q A;  1K61 A;  1YS7 A;  1UG0 A;  5E8G A;  4A3M J;  1YJ9 I;  4D9J A;  5ILU A;  3U9G A;  5ICC A;  2VC1 A; 
#chains in the Genus database with same CATH homology
 3G1M A;  3Q0V A;  5FKM A;  1WH7 A;  1IDZ A;  2CQQ A;  4W97 A;  3MVP A;  2X48 A;  1MNM C;  2K9Q A;  5IOY A;  3O8G A;  3IH3 A;  5FKO A;  5GPC A;  1UG2 A;  2KT0 A;  2VI6 A;  1GVD A;  1F36 A;  4DZP A;  3UKG A;  3M3Y J;  5DTD A;  3O8H A;  1RKW A;  2XPW A;  3GTP J;  9ANT A;  1ITY A;  3ZOB A;  2M34 A;  1QPI A;  4W1U A;  3S1N J;  3BG3 A;  1Y1V J;  3SFI A;  2ECC A;  1ETO A;  2IEK A;  2JN6 A;  5K7H A;  3GBG A;  3OSF A;  3JRF A;  1WI3 A;  2EZK A;  3H3V K;  1XC5 A;  1WPK A;  2HXI A;  4G12 A;  2GM4 A;  2E2H J;  5JLX A;  5FLV A;  3HDD A;  4ABZ A;  2G0E A;  2B63 J;  5IYC J;  2DA7 A;  1U8B A;  1MBJ A;  3S16 J;  1APL C;  3FIS A;  3LOC A;  4B4C A;  1RES A;  4BKX A;  2LLK A;  4A3G J;  2JA5 J;  5F04 A;  1JT0 A;  3BTC A;  2FJ1 A;  2VKV A;  4M3E A;  4MO7 A;  3JRC A;  1Q1V A;  3SJM A;  1XG1 A;  3FK6 A;  3BR0 A;  2CJJ A;  2JA6 J;  1JUP A;  1Z0X A;  3OSG A;  1XS9 A;  1WH5 A;  5EZG A;  5EG0 A;  1T56 A;  4A3E J;  3HOW J;  2RAE A;  4I76 A;  4JYK A;  3WHC A;  1RR7 A;  1U9N A;  2NS7 A;  1U78 A;  3GTK J;  3DCF A;  5EEA A;  1ORK A;  3NAR A;  1MBH A;  1ZTR A;  3GTQ J;  3BG9 A;  2HQ5 A;  5FKN A;  1E3O C;  1TWF J;  2ELK A;  3CMY A;  3SDG A;  2K9S A;  1W0T A;  3LSG A;  1MH4 A;  2PMZ N;  2R5Y A;  1JKR C;  1A6I A;  1OFC X;  2XPU A;  2DJN A;  2E19 A;  2TRT A;  1DU0 A;  4J19 A;  3ZQI A;  3I4N J;  1TWC J;  4Y7N J;  2HOA A;  2R5Z A;  4RDU A;  2R5Z B;  3HKZ N;  2NOG A;  2EZH A;  1D5Y A;  2EH3 A;  3FIW A;  1IDY A;  2DA4 A;  5J1U A;  2DA2 A;  3BR5 A;  1H89 C;  2MG4 A;  5EF6 A;  2CU7 A;  4AUX A;  2HDD A;  2I10 A;  1ZK8 A;  4M3G A;  1JKO C;  3S17 J;  2HI3 A;  4A3F J;  2HOS A;  2VPR A;  5FLM J;  1SFO J;  3S15 J;  3D1N I;  1JUM A;  1I3Q J;  3BTI A;  1YRN B;  3GTL J;  5GPA A;  2LFB A;  1BL0 A;  1FTT A;  2DA5 A;  3ZQG A;  2FX0 A;  3OOU A;  1GT0 C;  1RPW A;  3RZO J;  5M3F J;  4A3D J;  1TWA J;  1X2N A;  2DA3 A;  2ID3 A;  4EEF G;  2TCT A;  3FKI J;  2DTZ A;  2D5V A;  3GTG J;  5EZH A;  5E3L A;  3JR9 A;  2L7Z A;  1O4X A;  2ID6 A;  1I50 J;  5HOD A;  4AYB N;  3A03 A;  3LSJ A;  1NK2 P;  4I6Z A;  2O9L A;  4X1E A;  5C44 J;  3JRH A;  1MBF A;  1GDT A;  2VUM J;  5IPA A;  1ZR4 A;  1R9T J;  2M8G X;  2XGC A;  4IEJ A;  1FJL A;  2GLO A;  3IH4 A;  1I6H J;  2HYJ A;  2LD5 A;  4FTH A;  3JRG A;  4A93 J;  3HOV J;  3TW7 A;  1WCM J;  2LK2 A;  4V2F A;  2O8K A;  3S1Q J;  3JRE A;  2XB5 A;  4A3C J;  2LP0 A;  5IP9 J;  4A3J J;  4XRS A;  4MLO A;  4DZJ A;  3BR1 A;  5IYB J;  2L7F P;  2LY9 A;  4M6V A;  2K40 A;  1P7J A;  4QIW N;  2R92 J;  2DMN A;  2E1O A;  4UUT A;  2JK3 A;  1POG A;  4DW6 A;  1X2M A;  3BT9 A;  3GTO J;  1MBG A;  5J1Y A;  4AC0 A;  4BY1 J;  4C2M J;  5IP6 A;  1FEX A;  1B72 B;  1W0U A;  4M3F A;  4XIC A;  1JUS A;  2LVS A;  2P81 A;  3RQI A;  1JKQ C;  3S1M J;  4B1R A;  3MN2 A;  1NK3 P;  3M4O J;  2KDZ A;  1DU6 A;  2NVY J;  2JMW A;  2ME6 A;  1SAN A;  5FKK A;  3BR3 A;  2R0Q C;  1BA5 A;  3PM1 A;  1HOM A;  3G1O A;  3ZQF A;  3HB9 A;  2L0K A;  5M5Y J;  4D5F A;  2E2I J;  4BY7 J;  4A3I J;  3ZQL A;  4IHY A;  2Y0S N;  5F1J A;  1F43 A;  1IRZ A;  1IC8 A;  3IH2 A;  1BW6 A;  5M5W J;  4DYQ A;  3TED A;  1UMQ A;  1BJZ A;  2AO9 A;  2Y30 A;  4XK4 A;  1OJL A;  2IAI A;  2HXO A;  1VND A;  2X6O A;  3CQZ J;  3HEF A;  1P7I A;  1B8I B;  5EGO A;  3S14 J;  2DMU A;  1S7E A;  5EGO B;  2DA6 A;  1X58 A;  1GUU A;  2LR8 A;  3DEW A;  2OPT A;  2X9D A;  1EF4 A;  5F0F A;  4DYR A;  4M3B A;  3BTL A;  1QRY A;  1PUF B;  2O7O A;  3B6C A;  1MSF C;  1A5J A;  3BQY A;  2YU9 J;  5M3M J;  2ZB9 A;  3BTJ A;  3A01 B;  3IV5 A;  1H8A C;  1ETY A;  4BBR J;  1VFC A;  5K7Z A;  5C3E J;  4RBO A;  2ME0 A;  4D5C A;  4JP0 A;  3CCY A;  3PO2 J;  2YUS A;  3GTM J;  4A69 C;  1TC3 C;  2NVX J;  1BW5 A;  2NVT J;  3RKQ A;  3Q3S A;  2CUE A;  2JWT A;  3ZQH A;  1JTY A;  1RET A;  3E7L A;  2ECB A;  1YRN A;  1VF9 A;  1ENH A;  1Y1W J;  2M0C A;  3S1R J;  2Y2Z A;  3HGG A;  1MBE A;  2EZL A;  1FIA A;  1NTC A;  2XPV A;  2EBI A;  3QQA A;  5E3N A;  1LFU P;  4M3D A;  1TWG J;  5F08 A;  4HNV A;  2EZI A;  1JGG A;  4A3K J;  2MSY A;  1OCP A;  2Y9Y A;  1H88 C;  2NVQ J;  2HOT A;  2W48 A;  4FE4 A;  1UHS A;  5IYD J;  4V2G A;  3JRB A;  1QVT A;  4A3B J;  4D7N A;  2H1K A;  5J3L A;  4D7M A;  1HF0 A;  2EQR A;  2LTP A;  4B3A A;  5K7F A;  5C4J J;  2Y31 A;  2WV1 A;  4CYC B;  5EYR A;  4XRM A;  1U9O A;  4L5E A;  4MIM A;  3VPR A;  3GTJ J;  5GP9 A;  2XGD A;  1ETV A;  1HLV A;  3HOU J;  3S2H J;  1JT6 A;  4MFD A;  4QSH A;  4C3H J;  2H8R A;  2JA8 J;  2XRL A;  2XSD C;  4JX5 A;  1IUF A;  3L1P A;  1ETQ A;  3LNQ A;  1MH3 A;  3RZD J;  3MKL A;  1HDD C;  4Y52 J;  3BR6 A;  2AHQ A;  5IP7 J;  1ETX A;  1HDP A;  1AKH A;  3HM5 A;  3Q0U A;  4NDL A;  1AKH B;  1B72 A;  2DMT A;  3TW6 A;  3Q0W A;  1QVU A;  2R93 J;  2OF7 A;  1AU7 A;  2VKE A;  5IOZ A;  1FTZ A;  1ZKG A;  4BBS J;  5BNG A;  4LOC A;  3JRD A;  3QPL A;  2QCO A;  3K7A J;  3B6A A;  2NS8 A;  3G1L A;  5E3O A;  1AHD P;  1OCT C;  1ZGW A;  2YS9 A;  4BXX J;  2M2E A;  3NAU A;  3BQZ A;  3H0G J;  5J1R A;  3FK7 A;  3F0C A;  5FJ8 J;  4IHW A;  1HCR A;  2DMP A;  3HBL A;  4QTR A;  3HGY A;  4IHV A;  3CDL A;  1ZR2 A;  1GV5 A;  4A3L J;  1ETK A;  5FKL A;  1B8I A;  3W6V A;  3K2A A;  4DYC A;  1WGX A;  1FIP A;  3BR2 A;  3A02 A;  5DS9 A;  5EDN A;  2COB A;  2L7M P;  4FIS A;  4S0H B;  5EG0 B;  3HOX J;  4FCY A;  4C3J J;  4JX6 A;  1PUF A;  2E2J J;  2WAQ N;  1JJ6 C;  1GV2 A;  1K83 J;  4C3I J;  3S2D J;  1LFB A;  3TP3 A;  3A01 A;  3LSP A;  2CQX A;  1G2H A;  4MFE A;  1IG7 A;  2FD5 A;  3JRA A;  2FQ4 A;  2MW8 A;  3PO3 J;  3BG5 A;  5E3M A;  1MSE C;  1IJW C;  3HOZ J;  2DN0 A;  5F0H A;  2XB0 X;  2CUF A;  2WB1 N;  2XGE A;  2R5Y B;  1JKP C;  3QPS A;  2DA1 A;  3TP0 A;  2QF7 A;  1JJ8 C;  1MBK A;  3ZQC A;  5C4X J;  3LSR A;  5F27 A;  2R7Z J;  5JLW A;  1VI0 A;  1T33 A;  4FE7 A;  3HOY J;  3WHB A;  2JA7 J;  3OIO A;  1Z77 A;  2L9R A;  5F0C A;  4IHX A;  2DMQ A;  5M5X J;  2CRG A;  2IBD A;  3C2B A;  4GFB A;  1CQT A;  3JRI A;  2M9H A;  4XID A;  2MGQ A;  2GBY A;  4XRS G;  1IGN A;  1ETW A;  2LKX A;  1ZQ3 P;  1TWH J;  2JJ7 A;  1LE8 A;  2K9N A;  4UUS A;  1LE8 B;  2N8G A;  4UUS B;  4CYC A;  1K61 A;  2Y9Z A;  3I4M J;  1JTX A;  4JX4 A;  4A3M J;  1RKT A;  1IV6 A;  4X6A J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...