5KVRA

X-ray crystal structure of a fragment (1-75) of a transcriptional regulator pdhr from escherichia coli cft073
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
NAMAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyruvate dehydrogenase complex repressor
publication title X-Ray Crystal Structure of a Fragment (1-75) of a Transcriptional Regulator PdhR from Escherichia coli CFT073
rcsb
source organism Escherichia coli o6:h1 (strain cft073 / atcc 700928 / upec)
molecule tags Translation
total genus 21
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5kvrA00
5J8CA 1J75A 4YFKF 4OIPF 4HF0A 4P9FA 4RS8A 1MJ9A 1FPQA 1B9MA 1ZAOA 2YX7A 1QNTA 2ESNA 4NB5A 3JW4A 1IN8A 2EK5A 3ML6A 1I27A 4AIKA 4IHTA 5H6RA 3LAJA 3K1PA 4LB6B 2KIUA 2RKHA 3BPVA 2DBBA 5HS8A 2V79A 1WI9A 2GQQA 3GFMA 2EV6A 2ZMEB 3I64A 1U78A 4L0ZB 1S29A 4O5VA 3SZPA 1SFUA 2O3FA 2V1DA 4UNOA 3IKVA 2FF4A 2XV4S 5ERIA 5DCMA 3EYIA 2PEXA 3HUGA 3GEZA 4KFCA 5E1ZB 2GXBA 2QBYA 2HOEA 1OYIA 1IXCA 1IAWA 1SD4A 1HW2A 1MJBA 1XCVA 4M73A 5HS7A 2GXGA 1K79A 4IRGA 3QAHA 5J8FA 4L5IA 5ICCA 2HR3A 4OIQF 2FEZA 3JSPA 2VBZA 3BJ6A 2FOKA 2QBYB 4M9XA 1UCRA 4G94A 2IA0A 3KCCA 3ZMSA 4N9HA 3CUQC 2PMUA 2YR2A 2DQLA 5D5VB 1XD7A 4HV6A 1U5TC 2QYOA 2TDXA 1S7AA 4ENNA 1SFEA 1FNNA 5JI6A 5BQTA 1HSTA 5JR3A 2DTRA 5D4SA 4XSZF 2EFNA 3P9KA 1FP2A 2FBHA 2M30A 4RGXA 2D1HA 2IA2A 3N4MA 2HEOA 3C1DA 4ON0A 4PGHA 4LK0F 1J0RA 1BI3A 4OIOF 5FD6A 4L5JA 2WC2A 3KP2A 4LMYA 4OOIA 3FM5A 1PP8F 1E2XA 3R0AA 1YW9A 2XKOA 1MKMA 4A2UA 4WX9A 1LDKB 3MFKA 2EV5A 3WTTC 1HKSA 5IT9Z 2P5LC 4NHJA 4CGZA 2JPBA 2PLYA 3WTWC 2MLKA 3U1DA 2GWRA 1HBXG 2XAQA 4UVCA 2K4JA 4G9YA 3BROA 3IRRA 3WGHA 2ESHA 3QPTA 3KP5A 3DV8A 1FYKA 4LK1F 1LEBA 4WXCA 1BN5A 2FBKA 3F72A 2K02A 1YS6A 3KP4A 1UFMA 2OU2A 4ASNA 5DUKA 3I59B 1O3QA 1MZBA 1LB2A 1Z6TA 4RB0A 5CYVA 4UHTA 5CVIA 1TTYA 2MLGA 5A2QK 3ECOA 2CW0F 3HSEA 1EH7A 4HAMA 4N0BA 3C3WA 4Q47A 2STWA 2ZFWA 2ZNZA 1T6SA 3HYIA 5F64A 3DF8A 3T1BA 2X4HA 2XVCA 3QPHA 2KJCA 3CO6C 3VODA 4A0ZA 3FXUA 3T0YA 3L2CA 3RYPA 2E7XA 2DFIA 3CUQA 2V1UA 2VOOA 5IT3A 3F8MA 3HTUA 2DAOA 1R5HA 2DI3A 5ICEA 2QM3A 2IJLA 1O3TA 1BC7C 4LLGF 2XAHA 4MEYF 4GO1A 3HHHA 2LNBA 5FFZA 3R60A 1TQIA 2H6BA 1XGMA 4R8HA 4EM0B 2VT3A 4MNUA 2ISZA 3K69A 4HYEA 2K27A 1YTYA 1LDDA 3SXYA 3CLOA 5D4RA 4EGZA 4EJVA 1R1UA 5DD8A 4KIBA 5BPIA 3E6BA 2QZ8A 2MH2A 2QENA 2XAGA 1RZ4A 3OOPA 4I01A 3R4KA 1MJAA 2NYXA 1FSHA 3ZMDA 2FMYA 4KN4X 4OMYA 3EDPA 3IHUA 1CGPA 1MGTA 2D1VA 5ILUA 2L01A 2R7DA 1XGNA 3I5UA 2Z9OA 2RN7A 3FWEA 4HQEA 3ELKA 5KK1A 1D3YA 1ZGAA 4I0AA 1P6RA 4I2OA 1KYZA 1XSXA 2FNAA 4WWCA 4OINF 1UB9A 3R61A 2XRNA 2L54A 4LGWA 3JAMZ 4PZJA 1ZGJA 4L9JA 4MGRA 2YU3A 5CVVA 4EQQA 1BJAA 5EEGA 4OMZA 3DEUA 1HKQA 2BBYA 3FX3A 4KN7X 4A5NA 3GZ5A 1FBQA 4HOBA 1TW2A 5ICFA 3W6JB 5CVUA 3F8FA 4G6DA 2DO7A 3GUDA 4CICA 2MH9A 4P55A 4QLCU 4GYGA 3E5QA 3GFLA 5DV5A 3DFGA 3O2PE 5HS9A 3K1NA 1J2XA 1HKTA 2W57A 1P4WA 1YG2A 4HLYA 2DT5A 3TOAA 3TGNA 4F7ZA 4EV0A 3KLNA 2E1CA 2F2EA 3W6KB 3FF5A 2EWNA 2Z3YA 1G3SA 3OV8A 1W5SA 2ETHA 1I1GA 2CO5A 4ZH4F 5AIQA 2Z99A 2WV0A 4YIFA 4U7BA 2F5EA 3GZ6A 1R23A 3GWZA 5ILSA 3T8RA 1USSA 1D5VA 5E8GA 3F22A 1YO5C 3I4PA 2B0LA 3M9AA 1Z6RA 2QWWA 1OYWA 2WTEA 4UVBA 1K78B 1RIOH 4WXDA 2O8XA 2QLZA 4ETSA 1BC8C 5DD4A 2G9WA 3VOEA 3P7NA 4KYWA 1XSVA 3WTUC 3GX4X 1HW1A 5FB2A 3KETA 3FXQA 3HOTA 3ROUA 2FE3A 3J81K 1TNTA 1B9NA 2VOPA 3KZYA 2UXNA 2M5WA 1CF7B 1F5TA 2KRFA 3F6VA 1X3UA 1W4MA 3D0SA 2VBXA 5D6EA 2PFBA 1O57A 3HRMA 3WODF 5J6XA 5HVQC 2DLLA 3TDUC 4L18B 2DW4A 1W5TA 4BAYA 4IRHA 4AIHA 2UZKA 2F5FA 4FX0A 4YG2F 4U88A 3FMSA 1GHCA 3SQNA 4KA4A 4FX4A 1FT9A 3V7RA 4KMFA 4NQWA 3S2WA 1FWZA 4ESJA 4A6DA 2HKOA 1YYVA 5D5UB 4G7ZF 1HXDA 1R1VA 4LG0B 2VONA 1G6NA 1K6OA 3MQ0A 2KKOA 2ZNYA 1R58A 3ZMVA 4M72A 4ZYGA 3ZPLA 5KVRA 3HOSA 2M1BA 1G4DA 4MQVA 3V8KA 2VE9A 1S8NA 1QPMA 3V7SA 3J80K 1FBUA 1ODDA 2P6SA 5HLGA 3NEUA 4MEXF 3GXOA 5LGNA 4QWQA 4EM2A 3GFJA 3H3UA 1TNSA 3F3XA 3BDDA 3WTYC 2CYYA 1XCBA 1AWCA 1DPUA 1T38A 2A68F 1ZHFA 3REOA 4A6EA 3F21A 3BJAA 2A5YB 2QQBA 2FMLA 1YFHA 1R7JA 5DCMB 2W25A 1ULYA 2ACJA 2QQAA 3O6BB 4HLXA 2JTVA 1XMAA 3QP6A 4TV7A 1RUOA 1IF1A 2H09A 5L3FA 2BGCA 2ZO4A 5JHUA 2NS0A 3CO7C 1RUNA 2FQ3A 3WG9A 1UHWA 2Q8KA 1U2WA 4A12A 2ZXJA 3QU3A 1RI7A 3SHFA 3Q9VA 3WGIA 2A6EF 1U8RA 1DPRA 3E6MA 2HWVA 2E7WA 4FHTA 2W24A 2YSRA 3CJNA 4JQFA 5BOXA 5A2QZ 1YLFA 3RDIA 4CHUA 1HW5A 3PQKA 1YIOA 2J5OA 4HBLA 3DPLC 3GVAA 4P96A 4WCGA 4KDPA 4Y15A 4I09A 4HW0A 2M45A 4XSXF 1DDNA 3F8BA 3FHZA 3C7JA 1FX7A 3ZMTA 4WF2A 4A0XA 1QBJA 2EV0A 1ZYRF 2VC0A 1YQAA 3RJPA 5LBQA 1V4RA 1SD5A 3GYHX 3AAFA 2Y0MA 2HZTA 1KQ8A 1FOKA 1TLHB 1R22A 3DPTA 1BOAA 3KE2A 4YFNF 4HX8A 4P9UA 4RGSA 1TBXA 4CO8A 3E6DA 2D2WA 2FBIA 1ON2A 3CUOA 3IRQA 4BH9A 3T5XA 6PAXA 4I0BA 1ZREA 1LDJA 1LVAA 3KZZA 2P6TA 2BEOA 2VN2A 2ZKZA 2RQPA 1TQPA 1SD6A 2FA5A 4CDGA 2NRAC 3RKXA 1FC3A 1T98A 2OA4A 2WWYA 4EJTA 4KNYA 1BBYA 1KQ0A 5E17F 4Q4ZF 1NHAA 2ZBKA 1Z7UA 3IWFA 1QO0D 1BIBA 5CVRA 5D5WB 1FLIA 1O7FA 3ABUA 2CGPA 3U9GA 3M7GA 4HV5A 2OAZA 4B09A 2FRHA 2PMHA 3L7WA 2IW5A 2Z5UA 5JVTA 4Z2YA 2KIFA 1XDSA 3RPUA 2E1NA 1V3FA 3KFWX 2EFPA 2XROA 1U5TA 2ISYA 3L09A 3I54A 3NQOA 3HHGA 4Q5SF 2EA4A 4IPAA 1G3WA 4OIRF 3K2ZA 1S3JA 3ZN1A 5HDNA 5DUIA 1A04A 2AXLA 4JBAA 3TDZC 5L3EA 4UV9A 4XBFA 1IRGA 4H0EA 3CUQB 3V4GA 1W7PD 3N97A 1ZG1A 1U5TB 1I1SA 3MEXA 1B6AA 1DUXC 1QZZA 5ED4A 4HF1A 1BI2A 1LEAA 2MBFA 4BYYA 4AD9A 2JSCA 4DNCA 2P5KA 5EEHA 2XIGA 4GGGA 1J5YA 3IC7A 4U7DA 2ELHA 2VT2A 5HLHA 4Y17A 1LNWA 3TKYA 4KIFA 2G7HA 3L9FA 4LLLA 2RV8A 3LA2A 3ZP5A 3WTVC 4PGGA 3IL2A 2LSOA 3KP7A 2L4AA 3TO6A 1ZN2A 5K5OA 3ZN0A 3VEPA 4HA8A 4IJAA 5ILVA 3HTSB 1Q1HA 5ICGA 2HGCA 5LEJA 2IVMA 5FLXK 3WTSC 1SD7A 2H6CA 2JZYA 1ON1A 4K2EA 1U3EM 4G7OF 4LJZF 1FBSA 3IWZA 4XLPF 3SZTA 5L3DA 1Z05A 3FMRA 3TO7A 4R79A 3RI4A 4CZZA 4M9SA 4Q48A 3RPQA 4ZYHA 1OYYA 3V8LA 1REPC 1BI1A 1BM9A 3L00A 3E5UA 4S04A 1SAXA 3H3ZA 1P4AA 3P9CA 4ZZDA 2Y48A 2YX4A 1MD0A 3KP3A 4AWXB 5FD5A 2ADUA 2PQ8A 1Z1DA 3HRSA 2Q2EA 3F8NA 5DCFA 2HYGD 4MTDA 1RNLA 2M87A 1SFXA 1KA8A 4PDKA 2LKPA 5LRRA 4AIJA 3DQVC 2GAUA 2A69F 5FO5A 2LDUA 4XLNF 4L9VA 2VODA 1B4AA 3CTAA 2LF7A 1GVJA 4BHCA 2IT0A 3BWGA 3DKWA 2KIMA 3TOBA 2VXZA 3R0JA 1H0MA 3WE3A 1KU3A 1XGOA 4KMUX 2CG4A 3FZVA 5H6QA 4EJWA 4R1HA 2XKPA 1OMIA 3FXRA 5LHHA 2VBWA 5HDKA 4WXHA 4Y13A 3DXJF 2EJRA 1IZ1A 3JSOA 3ERED 2A6HF 2OD5A 1MDMA 2CWEA 1WSUA 5D5XB 2GIVA 3V8JA 3LQRA 2RDPA 4WK8F 4L0YB 1ZH5A 3ABTA 2GA1A 1ZLKA 2OQGA 2XAFA 2W85A 3FMQA 1ZLJA 1PP7U 4CYDA 1IUYA 3E6CC 1P92A 4LD5A 2XUBA 3RKYA 1USTA 1O3RA 1OKRA 5HLIA 4S05A 2FNPA 2YPRA 5LGUA 3ZMUA 1MDMB 1J9IA 2V1XA 1LJ9A 1L3LA 3LA3A 1ZRCA 5K5RA 1KU7A 5CJ9A 3COAC 4P5OA 4ENMA 4YFXF 4LB5A 4JK1X 1H9TA 4RGRA 1Z91A 5K5QA 5HDGA 2FXAA 4HF2A 4KT5C 3KEQA 4LFUA 3KEOA 2LF8A 2ZMEA 3K9TA 4UV8A 4UVAA 3T8TA 2P7CB 1SMTA 4MQ9F 2PBIA 3WE2A 2IRFG 3WTXC 1G3YA 4I02A 2L3DA 4ZYEA 5JFRA 3Q5FA 4YIIA 3P9IA 4ENJA 3ZMZA 2K86A 2D45A 2HTSA 2DPDA 4IRIA 2DQRA 1P4XA 1HQCA 3HRTA 2QVOA 2X0LA 4HX4A 1OPCA 1TQMA 1HSJA 4BHBA 3WU1B 2EFQA 3B73A 1S7OA 1ZG3A 1BI0A 3BY6A 1FY7A 2FSWA 1GXQA 2HDCA 1EH6A 2EB7A 3JTHA 3ZQ7A 2R7FA 1J59A 2BV6A 1KQ9A 1IN7A 4EJUA 3SFZA 2FU4A 3E97A 2J5PA 2NNYA 1IN4A 4RAYA 1R5GA 2VBYA 4G7HF 3B02A 3H92A 3O3KA 4ZYDA 4RAZA 4IHSA 4ZZLA 3RYRA 1JGSA 2HQRA 1C0WA 1DP7P 5L3GA 3I0TA 4RB3C 2VE8A 3U2RA 2RVCA 5FFXA 2CSOA 1KYWA 3NRVA 2P5VA 2V6CA 4A0YA 1EV7A 1H9GA 1L0OC 1R1TA 2COMA 3TQNA 2AS5F 2HFHA 4HQMA 2RGVA 4EJOA 1XB4A 2XAJA 5AIPA 3EYYA 1F1ZA 4M74A 5H20A 2P7VB 3QU6A 3BZ6A 3EQLF 1JHFA 1XGSA 4E70A 1B59A 3QRFF 4UUVA 3HIFA 5AONA 3VB2A 2Q0OA 4U0WA 4BQAA 3MCZA 1VTNC 3I71A 2IP2A 3DP7A 2UWMA 4U0VA 2CFXA 2ZCWA 3G73A 2HYFA 3KLOA 3I59A 4M6XA 3G3ZA 5LHGA 4EMSA 2PG4A 3LWFA 2F5DA 4GXOA 3LQQA 4D0PA 2DK5A 4IVNA 3BPXA 2Z33A 1T39A 4M6YA 1F9NA 5BMZA 2HKXA 4AVPA 3TO9A 1XN7A 5F1RA 3MZHA 3BJOA 5LRSA 1PDNC 3FM3A 3JTGA 1QGPA 3GO5A 2OQRA 1E17A 3GF2A 3F6OA 2HS5A 2QUFA 4IXAA 2O03A 3K1MA 1KGSA 3MZYA 1F4KA 1IXRC 3V7CA 3M1EA 5E1WA 1K7AA 1UHMA 5IT9K 5FLXZ 3LSTA 3WTZA 5D6FA 1FYMA 4DQ2A 4CXFA 3E3VA 4KICA 4MTEA 3LA7A 2O6GE 5D8LB 2ZJ2A 2A07F 5TJJA 4RB1A 3WGGA 1R00A 3GLXA 4G6QA 1JHHA 3HSRA 1QQIA 1WWXA 2PI0A 1QZYA 2BE5F 2K4BA 5CLSA 1IN5A 2XGXA 1IXSB 1U6GA 2W84A 1JE8A 4BXUA 2H94A 1WKMA 2BYVE 2V9VA 5HOOA 1STZA 2EFOA 2MD5A 3C18A 5DDGA 2DPUA 5LHIA 2M8EA 2L4MA 1OR7A 4N9IA 3QOPA 5BPDA 4ESFA 5BS6A 2O61A 2XASA 3LFKA 2JPCA 4KIGA 4I98B 2IA1A 2MC3A 1W7PA 4EM1A 2OZUA 1EH8A 1ZARA 3BOQA 1WQ2A 3IKTA 2PN6A 4BHPA 1I6XA 4M9ZA 1IW7F 3KP6A 2QQ9A 2Y75A 3I53A 4XRFA 3LAPA 4HX7A 4L9TA 2RNJA 5LEKA 3EETA 1LQ1A 1KU2A 2GA2A 3HSFA 1KU9A 5F6FA 2UXXA 1W7PB 3PFIA 2JRTA 2DU9A 2NNNA 3GW2A 2P4WA 4A5MA 1O3SA 2P8TA 4M71A 3PQJA 4HDUA 1SMYF 5L3CA 3BP8A 2HQNA 3F8CA 3WU0A 3J81Z 4BNCA 3R6SA 4O6JA 2JT1A 1D8JA 4O3MA 3F23A 4ESBA 2HTJA 1BIAA 2IPQX 2G7UA 1T2KA 1TW3A 2K7LA 2RC4A 1Y0UA 4EVIA 1XDUA 4HZFA 5E8IA 5LGTA 2OZ6A 2CQKA 1IN6A 3VFZA 2C6YA 3Q9SA 4G8XA 4EGYA 4GCVA 3EUHA 3RTRA 2OBPA 1GXPA 3HRUA 2EA2A 3I58A 4I7HA 2KJBA 1T0FA 5DEQA 4L9NA 1YW7A 2F5CA 5LLQA 5E18F 3MWMA 5D8KB 5FGMA 1XSDA 5TRDA 1K78A 3ECHA 4LLNA 2XHKA 1G3TA 4RGUA 4U0YA 3D5LA 3JAMK 1S6LA 2DK8A 3GFIA 1O7LA 3K0LA 1Z9CA 3E5XA 1ZRFA 2PJPA 1D8KA 3M8FA 1IRFA 5E20A 1P2FA 2A3SA 1ONVA 4B8XA 1FP1D 2L02A 4GYIA 3QP5A 4OU0A 1CF7A 1WRJA 2EFWA 1XMKA 2MA3A 4RB2C 1FYLA 3RIRA 5K1YA 3J80Z 1YS7A 3ISPA 1JXSA 4MHGA 1J7KA 1FSEA 2H27A 4FT8A 3CDHA 4PCQA 4HDVA 1ZG5A 2R3SA 3RKWA 3J7AO 5DYMA 3ULQB 1ZRDA 1YW8A 5E1XA 1B1BA 5CVJA 4KUMA 2VC1A 1R36A 1PUEE 3MAJA 1I5ZA 2GZWA 1FZPB 2A61A 4ENKA 4LG0A 5L3BA 2NAZA 4UXNA 2O0YA 4IF4A 1AOYA 2STTA 3M8EA
chains in the Genus database with same CATH superfamily
4NBQA 5J8CA 1J75A 4YFKF 4OIPF 4HF0A 4BKXA 3CD6I 3ZQHA 4P9FA 4F55A 1JKQC 2ELJA 4RS8A 1HF0A 1MJ9A 1IO2A 1FPQA 1B9MA 1MNMC 3MN2A 2QA4I 1ZAOA 2YX7A 1QNTA 2ESNA 4NB5A 3JW4A 1IN8A 4S0HB 2EK5A 2IAIA 3ML6A 3VSLA 5E3MA 1I27A 4AIKA 1OFCX 4IHTA 5H6RA 1MMAA 2IGOA 3LAJA 5J4VA 3LSIA 4G6TB 1T95A 1WJDA 3K1PA 4LB6B 2KIUA 2RKHA 2WB1A 3BPVA 1U0JA 4JOMA 2DBBA 2Y9YA 5HS8A 1HLVA 1YX5A 2V79A 1WI9A 3TBIA 2GQQA 3D1NI 3GFMA 2EV6A 2ZMEB 2E1MB 3I64A 1U78A 3FISA 4L0ZB 3CJRB 1S29A 4O5VA 4DJAA 1GV2A 1XG1A 4D5FA 3S14J 3SZPA 2O5RA 3Q0WA 2BVLA 5B66C 3OYBA 4IKFA 4XQFA 3HOXJ 3LSJA 1SFUA 4MIMA 3ZR8X 2O3FA 2CQXA 2V1DA 3EUAA 1WJEA 4QPOA 4UNOA 3IKVA 1V5EA 3GTQJ 3BTCA 4Y4RA 4HG2A 2FF4A 2DA2A 2XV4S 5ERIA 5DCMA 1YRNA 5EGOA 2M7AA 2E71A 2MYSA 2PEXA 3HUGA 4JX6A 3EYIA 5C4XJ 3GEZA 5KCMA 4KFCA 5F0FA 5E1ZB 2GXBA 2QBYA 2L9NA 2R92J 2HOEA 4E6KG 3QOEA 1OYIA 1IXCA 3QYFA 5M5XJ 1WCMJ 5B5EC 1HC8A 1IAWA 3L1PA 1SD4A 1HW2A 2K85A 1MJBA 2DYSH 2HI3A 1E3PA 1XCVA 2BY0A 4M73A 5HS7A 1VFCA 2GXGA 1JKPC 1K79A 4IRGA 2M3AA 3HKZA 3ZOBA 3QAHA 5J8FA 5JLXA 3CMAI 4L5IA 1YRNB 5EGOB 1K6YA 1U8BA 5ICCA 5J40A 2HR3A 1S7EA 4C3HJ 2WY7Q 4OIQF 2FEZA 4ABZA 3DTIA 3LNQA 1WFXA 3JSPA 2VBZA 3DBHB 2XB0X 3BJ6A 2FOKA 2QBYB 4BY1J 2HVSA 2L9VA 2CU7A 4PJ0C 4M9XA 1UCRA 3BG3A 1UZCA 4G94A 4V19K 2IA0A 3CCJI 3H9QA 3KCCA 3ZMSA 4A3MJ 1FTTA 4N9HA 3CUQC 5GAHJ 2PMUA 2YR2A 2DQLA 5D5VB 3BC8A 1XD7A 2NOGA 1XPXA 4HV6A 1U5TC 2QYOA 2TDXA 1TL8A 1MBKA 3L2WA 3ONQA 1S7AA 2V26A 4ENNA 1SFEA 1FNNA 2AXTC 5JI6A 4LIVA 5BQTA 1HSTA 3HDDA 5JR3A 2DTRA 3OL4A 5D4SA 4E7IA 4XSZF 4U87A 2EFNA 3P9KA 3GTJJ 1APLC 2BHYA 1FP2A 2FBHA 2M30A 4RGXA 2D1HA 2IA2A 3N4MA 1SVMA 2HEOA 2VJIA 3C1DA 4ON0A 4PGHA 5EG0B 4A3KJ 3AL0B 1JT6A 4LK0F 1J0RA 4CZCA 2KRHA 2LBFB 2LR8A 1BI3A 5TISC 4OIOF 5FD6A 4L5JA 2NS7A 4E7HA 1GV5A 2WC2A 1IUFA 3KP2A 2HVQA 4HPQA 1Y39A 4LMYA 2DMNA 3FM5A 4OOIA 3VYTB 1PP8F 4UY8I 1E2XA 2YS9A 2JA7J 3R0AA 2NXNB 3W2WA 3K7AJ 2HQ5A 3L2UA 3S1RJ 3HGYA 3OYEA 1YW9A 4F92B 2XKOA 1MKMA 3ZQGA 4A2UA 4WX9A 1TT5B 5HNHA 1LDKB 3MFKA 2EV5A 4BE0A 2KDOA 1VQOI 5FKMA 3WG7H 3WTTC 1HKSA 5IT9Z 4Y33A 2P5LC 3KEYA 3VYRB 4NHJA 4CGZA 2JPBA 4KT6A 2PLYA 1IDYA 3WTWC 1B72B 5IP6A 2DMUA 2ZFUA 2MLKA 3U1DA 1TWHJ 2GWRA 3CCSI 1HBXG 2XAQA 4UVCA 4F93B 1N77A 5E3OA 2L0KA 2OC6A 3H9JA 4B4CA 4HSRA 3AG3H 1BJZA 2K4JA 1BR4A 4G9YA 3BROA 3BR3A 4FE4A 3OYMA 3IRRA 1FOYA 3JRHA 2MW8A 3WGHA 2ESHA 2HYJA 3QPTA 1MMNA 5FLVA 5CQGA 4CCLA 3V42A 3KP5A 3DV8A 1FYKA 4LK1F 3DU5A 3DKYA 1LEBA 5J47A 2JA8J 4WXCA 3SFIA 1BN5A 2LP0A 2FBKA 3F72A 4X6AJ 3RPUD 4DIQA 3KX2A 2L7KA 2K02A 2DA1A 1YS6A 1X4OA 3UKGA 3KP4A 1UFMA 2OU2A 3B6AA 4ASNA 3C2BA 5DUKA 3I59B 1O3QA 2GLOA 2DJIA 1MZBA 1LB2A 5IYCJ 1Z6TA 4RB0A 5CYVA 4CYCB 3Q0VA 4UHTA 5CVIA 1TTYA 2MLGA 5A2QK 2R7RA 3ECOA 2EQRA 3BTLA 2CW0F 3HSEA 5J4YA 3RQ4A 2EIMH 1EH7A 2P0WA 4HAMA 4N0BA 3C3WA 4Q47A 2MG4A 2STWA 1HCRA 3HGGA 2LG4A 2ZFWA 2ZNZA 2CV2A 2AQEA 3DU6A 1T6SA 2OV7A 3HYIA 2X1CA 5F64A 2YU9J 3DF8A 3T1BA 2X4HA 2XVCA 5E79C 1F43A 3OWTA 3QPHA 2KJCA 3CO6C 3VODA 4A0ZA 3FXUA 1OISA 2KRCA 3T0YA 3L2CA 3DCFA 3RYPA 1ETQA 2E7XA 2DFIA 1FEXA 2FUG2 4XLHA 3CUQA 2V1UA 3B6CA 1QHGA 3AG2H 2VOOA 2VKHA 3CQZJ 5IT3A 3RSNA 2K3FA 3F8MA 3HTUA 2DAOA 1R5HA 2DI3A 2KISA 5B1AH 5ICEA 4YRVA 1NG7A 2QM3A 2IJLA 5HLTA 4XM3A 1VQ5I 2V9PA 1O3TA 2ELKA 1BC7C 1DU6A 4LLGF 1JUSA 2QKLB 4NC7A 4DYQA 2E2IJ 3PL8A 1RR7A 2DN0A 3QWLA 1HDDC 2XAHA 4MEYF 4GO1A 3HHHA 2LNBA 2VJ4A 2HOAA 5FFZA 3R60A 1TQIA 2H6BA 1XGMA 4R8HA 4EM0B 3PSFA 3S15J 3K4BA 2VT3A 4MNUA 1XTAA 3CZ6A 2ISZA 3K69A 4HYEA 4HNUA 3OYLA 2K27A 1YTYA 1MIJA 1LDDA 2UUZA 3SXYA 1AHDP 1X58A 3BR6A 3CLOA 5D4RA 4EGZA 4EJVA 1R1UA 2JSPA 1JUPA 1E3HA 5DD8A 4KIBA 1K4TA 1QVUA 5BPIA 3E6BA 2QZ8A 2MH2A 2QENA 2XAGA 2QCOA 1RZ4A 2OTLI 2KZVA 4CCKA 3OOPA 2DA5A 1VI0A 2EPFA 3H36A 2CW8A 4I01A 3R4KA 1MJAA 1SFOJ 2W82A 2NYXA 2BVMA 1FMVA 3MZ8A 1FSHA 3ZMDA 2FMYA 4KN4X 4OMYA 3EDPA 3OS1A 3IHUA 1CGPA 2E5NA 3GTKJ 3FK6A 1MGTA 1QHHD 2D1VA 3D5RC 5ILUA 2L01A 2R7DA 4HNTA 2X9DA 1XGNA 3I5UA 4E7LA 2Z9OA 2E5ZA 2RN7A 3FWEA 3W3CA 3BR2A 4HQEA 3ELKA 1Z7LA 5KK1A 1UAAA 3AFHA 1YE9A 1D3YA 1ZGAA 4I0AA 1P6RA 4I2OA 2QSHX 1KYZA 1WJFA 3CC4I 1XSXA 2F5VA 2FNAA 2OTJI 4WWCA 4OINF 1UB9A 3R61A 3G2BA 4ZC3A 2R7WA 1VQKI 2LFBA 2XRNA 2VKVA 3CMMA 2L54A 4LGWA 3JAMZ 4PZJA 3S16J 1ZGJA 4L9JA 4MGRA 2XAUA 1MMDA 2JA5J 1GUUA 2TRTA 2YU3A 5CVVA 4EQQA 4XN0A 1BJAA 1Y8RB 4M3FA 2HZDA 4OMZA 5EEGA 3K4NA 4DZPA 3DEUA 1HKQA 2BBYA 3FX3A 3S32A 2VPRA 4KN7X 1NH3A 4A5NA 3GZ5A 1FBQA 4HOBA 1TW2A 4N4NB 5ICFA 3OSGA 3W6JB 1CQTA 5CVUA 5FROA 3F8FA 4G6DA 1LKXA 1HOMA 2DO7A 4CA0A 3GUDA 4XK4A 2A5WA 1VF9A 2LYCA 2Y0SA 2E35A 3F9KA 1A6QA 2H8WA 3BR0A 3JRCA 2QKMB 4CICA 4L5EA 2H8RA 2MH9A 1WHUA 4P55A 2E36A 3FKIJ 1I6HJ 3I55I 1ZR2A 4QLCU 4GYGA 3E5QA 1Z3YA 3GFLA 4YELA 2X6WA 2UV1A 3RZDJ 3JRBA 3L2RA 5DV5A 1X4PA 2JWTA 3DFGA 3O2PE 5HS9A 3K1NA 5TGTA 1J2XA 1HKTA 2W57A 4XR6A 1P4WA 1YG2A 3SDBA 1A6IA 4HLYA 2W1OA 2DT5A 5GPAA 3TOAA 4I6ZA 2NVQJ 1QZEA 1B8IA 1KZHA 3TGNA 4F7ZA 1PYVA 1V5GA 4EV0A 1G2HA 3A2KA 3KLNA 2E1CA 2F2EA 3W6KB 3FF5A 4XRMA 2EWNA 1ETYA 4CCOA 2Z3YA 2ECCA 1G3SA 3OV8A 1W5SA 1YOVB 1PUFB 3FBNB 3I56I 4A3DJ 2ETHA 1HDPA 3CDIA 4I76A 1JKOC 4DOZA 1G59A 1I1GA 3A4CA 2XSDC 2CO5A 4ZH4F 4B3XA 5AIQA 2Z99A 2WV0A 4YIFA 4U7BA 2F5EA 3GTLJ 3C2HA 3GZ6A 1BW5A 1Z3XA 2ZJQF 2IGKA 1R23A 3GWZA 2KQRA 5ILSA 2V4JC 1RC9A 3T8RA 1USSA 1D5VA 2B9SA 5E8GA 4XRSG 3DEEA 2XGDA 3F22A 1YO5C 2XPVA 1B8IB 1U9OA 2DFEA 2KMUA 5C44J 3I4PA 2B0LA 2BZTA 3M9AA 2Z1DA 1Z6RA 4IX7A 2ZXWH 3CJTB 1DGRM 4H4KC 2KP6A 2QWWA 1OYWA 3Q0UA 4AM3A 1RRJA 2WTEA 4UVBA 4C30A 4B48A 1K78B 1RIOH 4ZDLA 2H1KA 4WXDA 1HA8A 1MBEA 2O8XA 4IL6C 5M3FJ 4ZTJA 3LOCA 2QLZA 4ETSA 1Q1VA 1BR2A 3IP4B 1BC8C 4B1RA 5DD4A 1V5FA 2K9LA 1K83J 2G9WA 2RQQA 4PJJA 4XKVA 3P7NA 2BW3A 3VOEA 2ZC2A 4KYWA 4AVZA 2HQAA 2RAEA 1LE8B 3BQZA 1XSVA 5F0CA 3WTUC 3VYUB 4BEHB 3A1YA 3GX4X 4J00A 1HW1A 5FB2A 1DU0A 3MKZA 3KETA 3FXQA 3HOTA 3ROUA 1JI8A 1DQUA 2FE3A 1ENHA 3J81K 1TNTA 1B9NA 2VOPA 2A05A 3KZYA 2DA7A 2UXNA 2M5WA 5KNLA 1CF7B 1F5TA 3BR5A 2KRFA 2RREA 3F6VA 3JR9A 4E4HA 2AQFA 1WJAA 1X3UA 1W4MA 3D0SA 2VBXA 2KFDA 5D6EA 3DKXA 2PFBA 1O57A 3HRMA 3WODF 3K4LA 2P81A 1IJWC 5J6XA 1ITYA 5HVQC 4QSHA 2DLLA 3TDUC 4XOTA 4UUSA 3FKJA 2F48A 2XSJC 2DW4A 3I9V2 4L18B 1W5TA 4BAYA 4IRHA 4AIHA 2UZKA 2F5FA 4FX0A 1WVRA 1W0UA 4YG2F 3ZRGA 2ZXHA 4U88A 3FMSA 5JLWA 1GHCA 3SQNA 1IDZA 4B43A 1SFKA 3CCQI 4KA4A 4FX4A 1FT9A 4B44A 3S3OA 4IEJA 3V7RA 4CSWA 4KMFA 4NQWA 5GTIC 5C3EJ 3S2WA 1FWZA 3BTIA 3ASOH 4ESJA 4NNJA 4A6DA 4JP0A 4F3QA 2L7ZA 3DEWA 2HKOA 1YYVA 5D5UB 3CF5F 2R5ZA 4G7ZF 1HXDA 1R1VA 1ACIA 4LG0B 2VONA 4A3EJ 3QPSA 1G6NA 1K6OA 3MQ0A 2KKOA 2ZNYA 1R58A 3ZMVA 4RA2A 3BLYA 4M72A 1J09A 4ZYGA 3ZPLA 2K9NA 1MSEC 2V6EA 5KVRA 3K4MA 3HOSA 1D1CA 2M1BA 1S72I 4MQVA 3V8KA 2VE9A 1S8NA 1G4DA 4CUGA 1QPMA 1NK2P 2F4OB 4BU2A 3QQAA 3V7SA 4XICA 1ETOA 1FIPA 3CCYA 5DTDA 2E60A 3J80K 1FBUA 3BG6A 1ODDA 3KYCB 3PNVA 2P6SA 5HLGA 1PJRA 3CP2A 3NEUA 2R5ZB 4MEXF 4QPQA 3GXOA 5LGNA 1Y1WJ 4QWQA 4N4OB 2LH9A 4EM2A 1BW6A 2QEXI 2VASA 2PJRA 3OR2C 3GFJA 3H3UA 3K2AA 1D5YA 2HPIA 1TNSA 1SEUA 3F3XA 1S9HA 3OY9A 3BDDA 3WTYC 2ID3A 3DLLF 2CYYA 1XCBA 4ITVA 1AWCA 2HDWA 2L7MP 2QQ8A 1DPUA 1T38A 3S1NJ 2A68F 1ZHFA 1MNDA 2XGCA 3REOA 4A6EA 4BQQA 3F21A 2DMQA 2K3PA 3BJAA 1IRXA 1ZQ3P 3LSPA 1MMSA 1W36D 1D0ZA 2A5YB 1LPQA 2VJ5A 5FLMJ 4BE2A 2IBDA 2QQBA 3H0GJ 5IYDJ 2FMLA 4CCMA 2FJ1A 1YFHA 1R7JA 5DCMB 3HUGB 4GRIA 5C4JJ 2W25A 1ULYA 2ACJA 2QQAA 1X1CA 3O6BB 4HLXA 2JTVA 4FQGA 1XMAA 3QP6A 4TV7A 2XPUA 1RUOA 1IF1A 1P7IA 2H09A 1XC5A 5L3FA 1KONA 5EDNA 1VZ0A 1VQ9I 1I39A 3BCBA 1I3QJ 2DA6A 2LKSA 2BGCA 2ZO4A 5JHUA 3IAM2 2NS0A 3CO7C 2XRLA 4M3EA 1RUNA 3IAS2 3CCUI 2BXYA 2FQ3A 3WG9A 1UHWA 1R9TJ 2Q8KA 1U2WA 1OCPA 1X1BA 4BXXJ 4A12A 3PJRA 2ZXJA 3A0BC 3A01A 3QU3A 1RI7A 1T33A 3SHFA 1EF4A 2VPLA 3Q9VA 3WGIA 2L2OA 2A6EF 1U8RA 1DPRA 3E6MA 3D5SC 2HPMA 4BE1A 1SANA 3ASNH 2HWVA 2E7WA 4FHTA 2W24A 4E7ZA 2QSFX 2YSRA 1ZTRA 4IQJA 2JUGA 3CJNA 4FE7A 1R4MB 1ZK8A 4FISA 4JQFA 5BOXA 5A2QZ 4BDYA 1YLFA 3CJQB 4OAYA 1LFBA 3RDIA 1S5LC 4CHUA 4AC0A 2MGQA 1HW5A 3PQKA 4HNVA 1YIOA 2J5OA 1ZKGA 3OYGA 4HBLA 3DPLC 3GVAA 4P96A 4MLOA 4WCGA 4KDPA 1X1AA 4I09A 4Y15A 4HW0A 2X6XA 2M45A 2EIJH 2W7NA 4XSXF 3FBIB 1DDNA 3F8BA 3FHZA 1EA3A 3LSGA 3C7JA 1FX7A 3IH4A 3ZMTA 4WF2A 3HL2A 4RMNA 4A0XA 5GTHC 4XIDA 1QBJA 2EV0A 1ZYRF 2VC0A 2XC7A 3TEDA 5LFAA 1YQAA 3RJPA 3JRFA 1UG2A 2O8KA 5LBQA 1V4RA 2LKXA 2CQ7A 2JN6A 1SD5A 2PMZN 4I99C 4XRSA 2JA2A 3GYHX 3AAFA 2ZXIA 1WH7A 4D9JA 2Y0MA 1UELB 2HZTA 1WPKA 3DLAA 1A5JA 4OAZA 1KQ8A 1FOKA 1OR7C 1TLHB 1R22A 3N05A 3HBLA 3PNYA 2WY8Q 2E2JJ 3OMYA 3DPTA 1BOAA 1R5ID 3KE2A 3SEZA 4B47A 4YFNF 4HX8A 4P9UA 3E7LA 4RGSA 3HOVJ 1TBXA 4CO8A 3IV5A 3ZQQA 2FX0A 4AYBN 2OF7A 2NVXJ 2DA4A 4IOCF 5IY5H 3E6DA 2D2WA 4RM2A 2WBMA 2FBIA 2M8GX 3QYEA 2JMWA 1ON2A 3OSFA 3CUOA 2GOXB 3IRQA 4W1UA 4BH9A 3T5XA 6PAXA 2MD0A 4I0BA 1Y56A 1ZREA 1RKTA 1LDJA 1LVAA 5M3MJ 5DM7F 1ETXA 3KZZA 2P6TA 2BEOA 2VN2A 2ZKZA 4II3A 1W0TA 3ZQFA 2RQPA 1TQPA 2JVHA 4EEFG 4RAFA 1SD6A 2FA5A 4CDGA 1N78A 2CUZA 3P5JA 2NRAC 3RKXA 1FC3A 4CH7A 1T98A 4AUXA 2OA4A 4UUTA 2WWYA 4EJTA 4KNYA 4XORA 1BBYA 2R7SA 3FXLA 1KQ0A 5E17F 4Q4ZF 2VI6A 1DP3A 1NHAA 2ZBKA 4HRIA 3BQYA 1Z7UA 5CKTA 2HDDA 1WJBA 3IWFA 4X0GA 1K4SA 1QO0D 1BIBA 5CVRA 5D5WB 1FLIA 1O7FA 4A3FJ 3ABUA 2FOWA 2CGPA 3U9GA 3M7GA 4HV5A 2OAZA 4DBQA 4B09A 2FRHA 1T56A 4PJNA 1X2NA 2PMHA 2W00A 1XX5A 2IW5A 2Z5UA 3L7WA 5JVTA 4Z2YA 2KIFA 1XDSA 3RPUA 2E1NA 5EYRA 3DPUA 1V3FA 3KFWX 3A03A 2EFPA 4PFPA 1IRZA 2XROA 1U5TA 2ISYA 3L09A 2ZJPF 3I54A 5K7FA 2CQQA 3NQOA 3HHGA 4Q5SF 2EA4A 1A35A 4IPAA 1G3WA 4OIRF 3CCRI 2Y30A 3K2ZA 2OPTA 4BJ5C 1S3JA 3HPHA 1I50J 4YIRX 3ZN1A 4D1QA 4PK4A 1M1EB 3LL7A 1LFUP 5HDNA 5DUIA 2WAFA 2XB5A 3CF2A 1A04A 2AXLA 3EUHC 4FCYA 4JBAA 3TDZC 5L3EA 3TW7A 4UV9A 2W48A 1T8IA 2R5YA 2V7FA 4LIUA 4XBFA 2R7XA 1IRGA 4H0EA 3CUQB 3V4GA 1W7PD 3N97A 1F36A 1VQMI 1ZG1A 3K70D 1U5TB 1I1SA 3MEXA 1B6AA 1DUXC 1QZZA 3IH2A 5ED4A 4HF1A 1BI2A 2VJJA 1LEAA 1FTZA 2I10A 1SVOA 4DBRA 2MBFA 4BYYA 3DBRB 1TWCJ 4AD9A 3H9GA 2GXAA 2JSCA 3ZQLA 1GVDA 4DNCA 2P5KA 3OYAA 3OYKA 1NG6A 4RDUA 1WH5A 3OYJA 5EEHA 1SAUA 3ABMH 2XIGA 4GGGA 3X2QH 2WAQN 1J5YA 3IC7A 4U7DA 2ELHA 2VT2A 5HLHA 2Y2ZA 3FDYA 3TP0A 1Z21A 2XDVA 2Y9ZA 4Y17A 1ETVA 1LNWA 3TKYA 2JA6J 4KIFA 2G7HA 2G0EA 3L9FA 3CC7I 2COBA 4LLLA 3CMYA 2RV8A 2R93J 2JUCA 4Y52J 4EATA 2QSGX 3LA2A 2WADA 3ZP5A 3NWTA 3WTVC 4PGGA 3IL2A 2LSOA 3KP7A 2L4AA 3TO6A 1ZN2A 2X6YA 5K5OA 5KAIC 3M8JA 2B63J 3ZN0A 3VEPA 3MKWB 1YHQI 4HA8A 4LITA 1JJ8C 4MFDA 4IJAA 5ILVA 3HTSB 2HOTA 1Q1HA 5ICGA 1VQNI 2HGCA 4BBRJ 3PFYA 5LEJA 2IVMA 5FLXK 3WTSC 1SD7A 4ZDOA 1YJWI 2H6CA 2JZYA 1ON1A 4K2EA 1X3ZB 3JREA 1UMQA 3DWLE 1Y8QB 5DM6F 2CV1A 2BY2A 1U3EM 5IOZA 4XKCA 4G7OF 2K9SA 4LJZF 4BQOA 3CMEI 1FBSA 3IWZA 3NWSA 3O8HA 4XLPF 3UNGC 3SZTA 5L3DA 2DMPA 1Z05A 2E19A 3FMRA 3TO7A 4R79A 3VPRA 2WB1N 2VUMJ 3RI4A 4CZZA 4M9SA 4C2TA 1MBFA 4Q48A 3RPQA 1R49A 4ZYHA 1OYYA 3V8LA 1REPC 5E3NA 1BI1A 1BM9A 3L00A 3E5UA 4D7NA 3QPLA 2M4GA 4S04A 3S3MA 1SAXA 2AHQA 2R0QC 3H3ZA 4LG3A 1P4AA 3P9CA 2E2HJ 4ZZDA 2KHMA 2Y48A 4XLCA 2DFHA 2ZSHB 4HSTA 2IS1A 5F27A 1UG0A 3J7AY 1BOBA 2YX4A 1MD0A 3HOUJ 3KP3A 3I3LA 4AWXB 1MSFC 2WA0A 3TMOA 3FK7A 3AKZA 5FD5A 3GTPJ 2ADUA 2ZMEC 2PQ8A 4PSXA 2E1MC 1R71A 4A3BJ 1Z1DA 4BGDA 2NOJB 3HRSA 2Q2EA 2QGUA 3ZGKA 2OUMA 1LVKA 3F8NA 4XMYA 3LFUA 1A36A 5DCFA 1TZLA 2HYGD 3WHCA 4MTDA 2OJED 1RNLA 3CCVI 3I4NJ 2M87A 4BXFA 1IC8A 2MFZA 4KISA 1OCOH 2W4SA 2K40A 1TWGJ 1SFXA 1KA8A 4XKBA 4PDKA 2LKPA 5LRRA 3BG9A 4AIJA 2LY2A 3SJMA 1OLTA 3DQVC 1ERDA 3J7ZI 2GAUA 2A69F 3HKZN 5FO5A 2LDUA 3IUOA 3K4JA 2FD5A 4L9VA 4XLNF 2VODA 1B4AA 4A93J 3CTAA 2LF7A 1GVJA 3A02A 5GAEJ 3FXJA 5GP9A 4ZTFA 2VKDA 5J1UA 4BHCA 5IPAA 2IT0A 3BWGA 3DKWA 4W97A 2KIMA 4XLFA 3TOBA 4C2MJ 4XONA 2VXZA 4IQ4A 4PUSA 3R0JA 3SYTA 3RKQA 3PNTA 4YEJA 1H0MA 1G8XA 2M2EA 3WE3A 1KU3A 1XGOA 2JVGA 4KMUX 2CG4A 2VLAA 2K5CA 3FZVA 5H6QA 1R6RA 4FTHA 4EJWA 2R7TA 3FXKA 1YIJI 2DYRH 4R1HA 2XKPA 1OMIA 2M9HA 9ANTA 3FXRA 4IHVA 5LHHA 2XF5A 2VBWA 5HDKA 1E0EA 4WXHA 1E3OC 4Y13A 1RETA 3OS2A 1X1PA 3DXJF 2EJRA 1IZ1A 3JSOA 2K9MA 3DTKA 3ERED 2M0MA 3S8PA 5IP7J 3S2HJ 2A6HF 2OD5A 5M5WJ 1MBHA 1MDMA 4C2UA 2CWEA 5FRNA 1WSUA 4A3IJ 5D5XB 2GIVA 2V1NA 3M1CA 3V8JA 3ZQIA 5FRMA 3E0JB 2BW3B 2DT7B 3LQRA 1JUMA 2RDPA 4WK8F 4L0YB 1ZH5A 3PIOF 3G6EI 3ABTA 3HM5A 2GA1A 3AL0C 1ZLKA 2OQGA 2XAFA 3ZQCA 2W85A 3FMQA 1JJ6C 2EILH 1OQYA 5BNGA 3G1LA 1ZLJA 1PP7U 4CYDA 3OIOA 1W36C 1IUYA 2GBYA 3E6CC 2LREA 3PO3J 1P92A 3PUBA 5GPCA 4LD5A 2XUBA 2BXZA 1USTA 1JTYA 3GLLA 3RKYA 3FXMA 2O7OA 3BR1A 4E7SA 5HODA 1O3RA 3BTJA 4BJTA 1OKRA 4D5CA 2KLOA 5HLIA 4S05A 2FNPA 1BL0A 2YPRA 5LGUA 3ZMUA 3CCEI 1MDMB 1VQLI 1FJLA 1J9IA 2I8DA 2V1XA 2NS8A 1LJ9A 1L3LA 3GTGJ 3LA3A 5CPRB 1P9QC 3CC2I 1ZRCA 1BA5A 1TC3C 5K5RA 2M7BA 3MVPA 4AIDA 1KU7A 1JTXA 5CJ9A 3OL3A 3OIPA 4P5OA 3COAC 2R4GA 4ENMA 3VWBA 2NVYJ 1DGWY 4YFXF 5IP9J 3CCMI 2LY1A 4JX4A 4UUSB 4LB5A 1PVEA 3H5NA 4JK1X 3U21A 1H9TA 3PIPF 2E1OA 4RGRA 1Z91A 5K5QA 5HDGA 1X2MA 2FXAA 2ICWG 5DS9A 4HF2A 4KT5C 1R4NB 3KEQA 4LFUA 3H5AA 3KEOA 2LF8A 2ZMEA 3K9TA 4UV8A 4UVAA 5EEAA 4JYKA 4FETA 3T8TA 2P7CB 4NQWB 2DOEA 5CQEA 4Z6YA 2DOFA 1SMTA 2IEKA 4II2A 1D0XA 3NAUA 4MQ9F 2PBIA 3GTMJ 3HXLA 5KAFC 3WE2A 2IRFG 3EPZA 2ME6A 1Y1VJ 2GOMA 3WTXC 1G3YA 4I02A 4B3AA 2L3DA 4ZYEA 5JFRA 1YITI 3DTEA 2EIKH 3Q5FA 1TWFJ 3MKLA 4YIIA 4A3JJ 3P9IA 3ABKH 4ENJA 3ZMZA 3GCMA 1ORKA 2CV0A 2K86A 3FXOA 2R7ZJ 4NUBA 2HTSA 2D45A 2H1LA 5GAGJ 1ZELA 1QU3A 1YJ9I 2DPDA 2JJ7A 3CCLI 3GMEA 4IRIA 2DQRA 1P4XA 5IYBJ 2VQGA 1P7JA 1HQCA 2VIXA 3HRTA 3SEQA 3EUKL 3WHBA 2NVUB 3S93A 3BT9A 2CJJA 3HOZJ 4RAGA 2QVOA 2KPMA 2X0LA 4HX4A 2PJRB 3H1CA 1AA7A 1OPCA 1TQMA 1HSJA 1O4XA 2TCTA 3WU2C 4BHBA 1UJ8A 2CUEA 3WU1B 2EFQA 2M4KA 3B73A 1D0YA 1S7OA 1ZG3A 4BDZA 3S1QJ 1BI0A 3BY6A 2CQNA 1FY7A 2FSWA 1GXQA 2HDCA 1EH6A 1IV6A 2FQ4A 2EB7A 3G71I 2VXDA 3OYFA 3JTHA 3ZCOA 3ZQ7A 2R7FA 4F52A 4ZYAA 1OCZH 1J59A 2BV6A 4C3IJ 4BBSJ 1KQ9A 3BG7A 1IN7A 2O9LA 4EJUA 2CMPA 2LY9A 3SFZA 2FU4A 3JRGA 3E97A 2J5PA 2NNYA 1IN4A 3TL4X 4RAYA 1OCCH 3S3NA 1R5GA 2DCEA 2VBYA 4G7HF 2VQCA 3OOUA 2XF6A 4IZZA 3B02A 5EG0A 4E7KA 3H92A 3O3KA 4ZYDA 3ABLH 4RAZA 3H3VK 2LBFA 4ZZLA 4IHSA 2R7VA 2DA3A 2DTZA 3RYRA 3KIOA 2HXOA 5FKNA 1JGSA 3HZJA 2HQRA 1C0WA 3CESA 3E1SA 2ZB9A 4QTRA 4DYCA 2LVSA 1DP7P 2OCCH 2VQHA 5L3GA 1WGXA 3I0TA 4CCNA 4RB3C 2VE8A 2DT6A 3U2RA 4RLFA 2RVCA 5FFXA 2V9KA 1VQ6I 2CSOA 1KYWA 4BS9A 3NRVA 2P5VA 3M07A 2V6CA 4A0YA 1EV7A 1H9GA 1L0OC 1R1TA 2COMA 3TQNA 1OCRH 2AS5F 2HFHA 3OS0A 3A01B 2KDZA 4HQMA 2RGVA 4EJOA 3J7YJ 1XB4A 2XAJA 5AIPA 3RZOJ 3EYYA 2ME0A 1F1ZA 4M74A 1VNDA 4UB8C 5H20A 1UHSA 3CP8A 1YX3A 2EZLA 4PSWA 4PFOA 3M4OJ 2P7VB 1QPIA 1IV8A 1B72A 2BOLA 2R7OA 1ETKA 3QU6A 3HOWJ 3BZ6A 2WAEA 3EQLF 2JRMA 2LRDA 4DW6A 1JHFA 1XGSA 4E70A 2IGNA 5F1JA 1B59A 3QRFF 4GDFA 4M3DA 3ERMA 3KYLA 1V55H 4UUVA 3HIFA 5AONA 1H89C 3VB2A 1N75A 3TW6A 2Q0OA 4A69C 2KIQA 3MMYB 4U0WA 4AU7A 4BQAA 1RR8C 3MCZA 2CUJA 1D1BA 1VTNC 2GIZA 3I71A 2IP2A 2IXSA 3DP7A 1W5CC 2VB6A 2UWMA 2IS2A 4KJZA 4U0VA 2CFXA 5KHDA 3HC7A 2ZCWA 3G73A 2HYFA 2LLKA 2L7FP 2Y0SN 3K70C 1IGNA 2YUSA 3KLOA 3I59A 3LSMA 5JHFA 3HG9A 2M34A 4CYCA 1N25A 2MC4A 2CS3A 1Z0XA 4M3GA 3GBGA 4M6XA 5FKKA 3G3ZA 2WV1A 4NC6A 3UR3C 4IO9F 5LHGA 4EMSA 2PG4A 3VDXA 2F6CA 1EKEA 3K4KA 3LWFA 3OYIA 2F5DA 2EZHA 3FHNA 4GXOA 3LQQA 4D0PA 2DK5A 2DMTA 4IVNA 3BPXA 3BZCA 3IH3A 3JRIA 2Z33A 2IGMA 4BQNA 2DXIA 3JRAA 5K7ZA 1MW7A 1T39A 4M6YA 1TP4A 1F9NA 5EZGA 5BMZA 2HKXA 4AVPA 3TO9A 3GTOJ 1XN7A 1Y0NA 1JT0A 2EZKA 4XN3A 2DDBA 5F1RA 3AG4H 3S2DJ 2Z16A 4RBOA 3MZHA 3M3YJ 3BJOA 1WI3A 5LRSA 2X85A 2L9RA 1PDNC 4PJMA 3FM3A 2R7QA 3JTGA 1QGPA 3GO5A 4ZDPA 2OQRA 1EJ9A 1YI2I 1T08B 5F0HA 2VQLA 1D1AA 3FIWA 1E17A 3GF2A 1V54H 2DFFA 2HS5A 2QUFA 3F6OA 1ZGWA 4IXAA 3AG1H 1XMXA 2O03A 3K1MA 1GLNA 4X1EA 1H8AC 1KGSA 3MZYA 1F4KA 1IXRC 3V7CA 3M1EA 5E1WA 1K7AA 1UHMA 3JCUC 5IT9K 2ZSIB 1FOWA 1SVLA 5FLXZ 2ZJRF 2E34A 3LSTA 1VQ4I 2ECBA 3KPHA 3WTZA 5HNFA 3KZIC 5D6FA 4DQ2A 1FYMA 2DOAA 3E3VA 4CXFA 1RKWA 2HU9A 1MBJA 4KICA 4MTEA 5JVGF 3LA7A 4RLQA 2DODA 2LK2A 5B1BH 5D8LB 5K7HA 2O6GE 2ZJ2A 1T0FC 2A07F 5TJJA 4RB1A 3WGGA 1R00A 3GLXA 5FKOA 2LD5A 4G6QA 3L2QA 1JHHA 1K61A 4XL9A 3HSRA 4IHYA 1QQIA 4MFEA 1WWXA 2HNHA 3CLQA 1JKRC 2PI0A 1QZYA 2RNGA 4ANJA 3H5RA 4F91B 2PX9A 3RCOA 2BE5F 2K4BA 3NARA 5CLSA 1FIAA 1MNEA 1QRYA 2LTPA 1IN5A 4BL0B 3DBLB 1NTCA 2XGXA 1IXSB 1U6GA 2W84A 1RPWA 1JE8A 1TWAJ 4BXUA 2EBIA 2IS6A 2B7EA 2NVTJ 2H94A 2HOSA 5J3LA 1WKMA 2BYVE 3Q3SA 2R5YB 2V9VA 2CH0A 5HOOA 1AKHA 3ESWB 1STZA 2JK3A 2EFOA 2MD5A 1WJCA 3TP3A 3W6VA 4IHWA 3SZGA 3C18A 3HEFA 5DDGA 2DPUA 5LHIA 2M8EA 2L4MA 4KITB 3S1MJ 2F4MB 3VSKA 1I3AA 1OR7A 4N9IA 3QOPA 5EJCA 5BPDA 4ESFA 5BS6A 2O61A 2XASA 4E7JA 4M3BA 3LFKA 3F0CA 2A6TA 2JPCA 4FASD 2CRGA 4KIGA 3HJEA 2HVRA 4I98B 2IA1A 2MC3A 1W7PA 4EM1A 2GM4A 2XGEA 2MSYA 2LOOA 2OZUA 2DDAA 1EH8A 1ZARA 3BOQA 1BR1A 1WQ2A 2M0CA 1ETWA 3IKTA 4ZJZA 1AKHB 4PJLA 2PN6A 3W2VA 4BHPA 1I6XA 1POGA 4M9ZA 1IW7F 4QIWN 5EZHA 3KP6A 5GADJ 2QQ9A 2Y75A 3MKYB 4A3GJ 3I53A 1W1WE 4XRFA 4Y3OA 4M6VA 4HX7A 3LAPA 4L9TA 1NK3P 1LFPA 2RNJA 5LEKA 3EETA 3BCAA 1LQ1A 4XOPA 3OYHA 2F4IA 5FJ8J 1KU2A 2GA2A 4XKWA 3HSFA 2X1DA 1KU9A 5F6FA 2PMZA 2UXXA 2EINH 1W7PB 2L9SA 3PFIA 1WZ2A 2JRTA 5J1RA 2EH3A 2DU9A 2MABA 2NNNA 1QVTA 3GW2A 2P4WA 1U9NA 4A5MA 1O3SA 4J01A 2P8TA 4M71A 3PQJA 2LMDA 4HDUA 3S17J 2DJNA 2Y31A 2LC2A 1SMYF 3U1KA 4XLEA 2KT0A 5L3CA 3PSIA 3BP8A 4AYBA 2HQNA 3F8CA 3WU0A 1Y6IA 2IS4A 3LSHA 3QODA 2L5QA 3J81Z 3JRDA 5E3LA 4BNCA 3A0HC 3HB9A 3R6SA 4O6JA 1VQ8I 2JT1A 3BG5A 3KYDB 1D8JA 4O3MA 2AO9A 1VQPI 3F23A 4ESBA 1PUFA 2HTJA 3QYBA 1BIAA 3G4SI 2IPQX 1MMGA 2G7UA 5LD2C 1T2KA 3W2AA 2D5VA 1TW3A 4JX5A 2N8GA 1YJNI 2K7LA 2RC4A 2CUFA 1Y0UA 4EVIA 1XDUA 3BZKA 3OR1C 4HZFA 3H35A 5E8IA 5LGTA 2VKEA 1GT0C 3K4CA 2OZ6A 4NDLA 2CQKA 1H88C 1IN6A 1FMWA 1MBGA 1MH4A 5H2FC 3VFZA 2C6YA 3OYCA 3Q9SA 4Y7NJ 1A31A 1WJ5A 1X19A 4G8XA 4EGYA 4GCVA 3EUHA 3RTRA 2OBPA 3HOYJ 1GXPA 3HRUA 2EA2A 2Z2SB 3I58A 4I7HA 3OYNA 2KJBA 3G1MA 2HXIA 1T0FA 3MD2A 5DEQA 4L9NA 4DGWB 1YW7A 2F5CA 3C2GA 2XF7A 5LLQA 5E18F 4A3CJ 1LUJB 2KL4A 3MWMA 1ZR4A 5D8KB 5FGMA 1GDTA 1XSDA 5TRDA 1K78A 3I4MJ 2Q2EB 3ECHA 4IHXA 1OJLA 2QF7A 2BY3A 2X51A 4LLNA 3PUFA 2XHKA 4UB6C 1G3TA 4RGUA 5M5YJ 4U0YA 3D5LA 1Z77A 3JAMK 1S6LA 2DK8A 3GFIA 2JQ7A 1O7LA 3K0LA 1Z9CA 2VL8A 3PM1A 3E5XA 1ZRFA 3L2VA 3ZXSA 2PJPA 4BUPA 3K10A 5F04A 4BY7J 1D8KA 3M8FA 1IRFA 1LE8A 5E20A 1P2FA 2A3SA 2KZGA 4A3LJ 4BEHA 1ONVA 2I5UA 4B8XA 1OCTC 1FP1D 2L02A 4V2GA 4GYIA 4DYRA 3LSRA 1Z67A 3SDGA 3QP5A 5IOYA 4OU0A 1CF7A 1WRJA 2EFWA 1XMKA 2MA3A 4RB2C 1FYLA 1MH3A 3RIRA 4J19A 5K1YA 2CFOA 1YS7A 3J80Z 3ISPA 1JXSA 5F08A 3HPGA 4MHGA 3OYDA 1J7KA 1FSEA 2H27A 4FT8A 3CDHA 4PCQA 2BY1A 3PO2J 4HDVA 1ZG5A 2X1EA 1FOXA 2R3SA 2Q1ZB 4HEA2 3RKWA 1X1DA 3CDLA 3J7AO 5DYMA 3VYSB 2ID6A 1SC7A 3LSKA 3ULQB 3LMMA 1YW8A 1ZRDA 4LOCA 5E1XA 1B1BA 5CVJA 1XS9A 4P1WA 4GFBA 4KUMA 3K6GA 4C3JJ 2VC1A 3RQIA 4OWRB 2CW7A 2EZIA 1R36A 1PUEE 2Y69H 3MAJA 1I5ZA 2GZWA 5EF6A 2WAQA 1FZPB 2A61A 4XLAA 5B3SH 4V2FA 2R7UA 4RM3A 3H0DA 4MO7A 4BACA 1AU7A 2X6OA 3O8GA 4ENKA 3GZNB 4C9YA 4LG0A 1X3WB 1JGGA 4D7MA 4XNFA 3OIQA 5L3BA 4NC8A 1TT0A 4BJ6C 2NAZA 2XPWA 2BHZA 2OCEA 5FKLA 4CCJA 4DZJA 1QA6A 4G12A 4UXNA 2O0YA 5J1YA 1RESA 4IF4A 4IOAF 2X48A 1IG7A 3G1OA 1AOYA 2K9QA 1VQ7I 2STTA 3M8EA
chains in the Genus database with same CATH topology
5J8CA 1J75A 4YFKF 4OIPF 4HF0A 4P9FA 4RS8A 1MJ9A 1FPQA 1B9MA 1ZAOA 2YX7A 1QNTA 2ESNA 4NB5A 3JW4A 1IN8A 2EK5A 3ML6A 1I27A 4AIKA 4IHTA 5H6RA 3LAJA 3K1PA 4LB6B 2KIUA 2RKHA 3BPVA 2DBBA 5HS8A 2V79A 1WI9A 2GQQA 3GFMA 2EV6A 2ZMEB 3I64A 1U78A 4L0ZB 1S29A 4O5VA 3SZPA 1SFUA 2O3FA 2V1DA 4UNOA 3IKVA 2FF4A 2XV4S 5ERIA 5DCMA 3EYIA 2PEXA 3HUGA 3GEZA 4KFCA 5E1ZB 2GXBA 2QBYA 2HOEA 1OYIA 1IXCA 1IAWA 1SD4A 1HW2A 1MJBA 1XCVA 4M73A 5HS7A 2GXGA 1K79A 4IRGA 3QAHA 5J8FA 4L5IA 5ICCA 2HR3A 4OIQF 2FEZA 3JSPA 2VBZA 3BJ6A 2FOKA 2QBYB 4M9XA 1UCRA 4G94A 2IA0A 3KCCA 3ZMSA 4N9HA 3CUQC 2PMUA 2YR2A 2DQLA 5D5VB 1XD7A 4HV6A 1U5TC 2QYOA 2TDXA 1S7AA 4ENNA 1SFEA 1FNNA 5JI6A 5BQTA 1HSTA 5JR3A 2DTRA 5D4SA 4XSZF 2EFNA 3P9KA 1FP2A 2FBHA 2M30A 4RGXA 2D1HA 2IA2A 3N4MA 2HEOA 3C1DA 4ON0A 4PGHA 4LK0F 1J0RA 1BI3A 4OIOF 5FD6A 4L5JA 2WC2A 3KP2A 4LMYA 4OOIA 3FM5A 1PP8F 1E2XA 3R0AA 1YW9A 2XKOA 1MKMA 4A2UA 4WX9A 1LDKB 3MFKA 2EV5A 3WTTC 1HKSA 5IT9Z 2P5LC 4NHJA 4CGZA 2JPBA 2PLYA 3WTWC 2MLKA 3U1DA 2GWRA 1HBXG 2XAQA 4UVCA 2K4JA 4G9YA 3BROA 3IRRA 3WGHA 2ESHA 3QPTA 3KP5A 3DV8A 1FYKA 4LK1F 1LEBA 4WXCA 1BN5A 2FBKA 3F72A 2K02A 1YS6A 3KP4A 1UFMA 2OU2A 4ASNA 5DUKA 3I59B 1O3QA 1MZBA 1LB2A 1Z6TA 4RB0A 5CYVA 4UHTA 5CVIA 1TTYA 2MLGA 5A2QK 3ECOA 2CW0F 3HSEA 1EH7A 4HAMA 4N0BA 3C3WA 4Q47A 2STWA 2ZFWA 2ZNZA 1T6SA 3HYIA 5F64A 3DF8A 3T1BA 2X4HA 2XVCA 3QPHA 2KJCA 3CO6C 3VODA 4A0ZA 3FXUA 3T0YA 3L2CA 3RYPA 2E7XA 2DFIA 3CUQA 2V1UA 2VOOA 5IT3A 3F8MA 3HTUA 2DAOA 1R5HA 2DI3A 5ICEA 2QM3A 2IJLA 1O3TA 1BC7C 4LLGF 2XAHA 4MEYF 4GO1A 3HHHA 2LNBA 5FFZA 3R60A 1TQIA 2H6BA 1XGMA 4R8HA 4EM0B 2VT3A 4MNUA 2ISZA 3K69A 4HYEA 2K27A 1YTYA 1LDDA 3SXYA 3CLOA 5D4RA 4EGZA 4EJVA 1R1UA 5DD8A 4KIBA 5BPIA 3E6BA 2QZ8A 2MH2A 2QENA 2XAGA 1RZ4A 3OOPA 4I01A 3R4KA 1MJAA 2NYXA 1FSHA 3ZMDA 2FMYA 4KN4X 4OMYA 3EDPA 3IHUA 1CGPA 1MGTA 2D1VA 5ILUA 2L01A 2R7DA 1XGNA 3I5UA 2Z9OA 2RN7A 3FWEA 4HQEA 3ELKA 5KK1A 1D3YA 1ZGAA 4I0AA 1P6RA 4I2OA 1KYZA 1XSXA 2FNAA 4WWCA 4OINF 1UB9A 3R61A 2XRNA 2L54A 4LGWA 3JAMZ 4PZJA 1ZGJA 4L9JA 4MGRA 2YU3A 5CVVA 4EQQA 1BJAA 5EEGA 4OMZA 3DEUA 1HKQA 2BBYA 3FX3A 4KN7X 4A5NA 3GZ5A 1FBQA 4HOBA 1TW2A 5ICFA 3W6JB 5CVUA 3F8FA 4G6DA 2DO7A 3GUDA 4CICA 2MH9A 4P55A 4QLCU 4GYGA 3E5QA 3GFLA 5DV5A 3DFGA 3O2PE 5HS9A 3K1NA 1J2XA 1HKTA 2W57A 1P4WA 1YG2A 4HLYA 2DT5A 3TOAA 3TGNA 4F7ZA 4EV0A 3KLNA 2E1CA 2F2EA 3W6KB 3FF5A 2EWNA 2Z3YA 1G3SA 3OV8A 1W5SA 2ETHA 1I1GA 2CO5A 4ZH4F 5AIQA 2Z99A 2WV0A 4YIFA 4U7BA 2F5EA 3GZ6A 1R23A 3GWZA 5ILSA 3T8RA 1USSA 1D5VA 5E8GA 3F22A 1YO5C 3I4PA 2B0LA 3M9AA 1Z6RA 2QWWA 1OYWA 2WTEA 4UVBA 1K78B 1RIOH 4WXDA 2O8XA 2QLZA 4ETSA 1BC8C 5DD4A 2G9WA 3VOEA 3P7NA 4KYWA 1XSVA 3WTUC 3GX4X 1HW1A 5FB2A 3KETA 3FXQA 3HOTA 3ROUA 2FE3A 3J81K 1TNTA 1B9NA 2VOPA 3KZYA 2UXNA 2M5WA 1CF7B 1F5TA 2KRFA 3F6VA 1X3UA 1W4MA 3D0SA 2VBXA 5D6EA 2PFBA 1O57A 3HRMA 3WODF 5J6XA 5HVQC 2DLLA 3TDUC 4L18B 2DW4A 1W5TA 4BAYA 4IRHA 4AIHA 2UZKA 2F5FA 4FX0A 4YG2F 4U88A 3FMSA 1GHCA 3SQNA 4KA4A 4FX4A 1FT9A 3V7RA 4KMFA 4NQWA 3S2WA 1FWZA 4ESJA 4A6DA 2HKOA 1YYVA 5D5UB 4G7ZF 1HXDA 1R1VA 4LG0B 2VONA 1G6NA 1K6OA 3MQ0A 2KKOA 2ZNYA 1R58A 3ZMVA 4M72A 4ZYGA 3ZPLA 5KVRA 3HOSA 2M1BA 1G4DA 4MQVA 3V8KA 2VE9A 1S8NA 1QPMA 3V7SA 3J80K 1FBUA 1ODDA 2P6SA 5HLGA 3NEUA 4MEXF 3GXOA 5LGNA 4QWQA 4EM2A 3GFJA 3H3UA 1TNSA 3F3XA 3BDDA 3WTYC 2CYYA 1XCBA 1AWCA 1DPUA 1T38A 2A68F 1ZHFA 3REOA 4A6EA 3F21A 3BJAA 2A5YB 2QQBA 2FMLA 1YFHA 1R7JA 5DCMB 2W25A 1ULYA 2ACJA 2QQAA 3O6BB 4HLXA 2JTVA 1XMAA 3QP6A 4TV7A 1RUOA 1IF1A 2H09A 5L3FA 2BGCA 2ZO4A 5JHUA 2NS0A 3CO7C 1RUNA 2FQ3A 3WG9A 1UHWA 2Q8KA 1U2WA 4A12A 2ZXJA 3QU3A 1RI7A 3SHFA 3Q9VA 3WGIA 2A6EF 1U8RA 1DPRA 3E6MA 2HWVA 2E7WA 4FHTA 2W24A 2YSRA 3CJNA 4JQFA 5BOXA 5A2QZ 1YLFA 3RDIA 4CHUA 1HW5A 3PQKA 1YIOA 2J5OA 4HBLA 3DPLC 3GVAA 4P96A 4WCGA 4KDPA 4Y15A 4I09A 4HW0A 2M45A 4XSXF 1DDNA 3F8BA 3FHZA 3C7JA 1FX7A 3ZMTA 4WF2A 4A0XA 1QBJA 2EV0A 1ZYRF 2VC0A 1YQAA 3RJPA 5LBQA 1V4RA 1SD5A 3GYHX 3AAFA 2Y0MA 2HZTA 1KQ8A 1FOKA 1TLHB 1R22A 3DPTA 1BOAA 3KE2A 4YFNF 4HX8A 4P9UA 4RGSA 1TBXA 4CO8A 3E6DA 2D2WA 2FBIA 1ON2A 3CUOA 3IRQA 4BH9A 3T5XA 6PAXA 4I0BA 1ZREA 1LDJA 1LVAA 3KZZA 2P6TA 2BEOA 2VN2A 2ZKZA 2RQPA 1TQPA 1SD6A 2FA5A 4CDGA 2NRAC 3RKXA 1FC3A 1T98A 2OA4A 2WWYA 4EJTA 4KNYA 1BBYA 1KQ0A 5E17F 4Q4ZF 1NHAA 2ZBKA 1Z7UA 3IWFA 1QO0D 1BIBA 5CVRA 5D5WB 1FLIA 1O7FA 3ABUA 2CGPA 3U9GA 3M7GA 4HV5A 2OAZA 4B09A 2FRHA 2PMHA 3L7WA 2IW5A 2Z5UA 5JVTA 4Z2YA 2KIFA 1XDSA 3RPUA 2E1NA 1V3FA 3KFWX 2EFPA 2XROA 1U5TA 2ISYA 3L09A 3I54A 3NQOA 3HHGA 4Q5SF 2EA4A 4IPAA 1G3WA 4OIRF 3K2ZA 1S3JA 3ZN1A 5HDNA 5DUIA 1A04A 2AXLA 4JBAA 3TDZC 5L3EA 4UV9A 4XBFA 1IRGA 4H0EA 3CUQB 3V4GA 1W7PD 3N97A 1ZG1A 1U5TB 1I1SA 3MEXA 1B6AA 1DUXC 1QZZA 5ED4A 4HF1A 1BI2A 1LEAA 2MBFA 4BYYA 4AD9A 2JSCA 4DNCA 2P5KA 5EEHA 2XIGA 4GGGA 1J5YA 3IC7A 4U7DA 2ELHA 2VT2A 5HLHA 4Y17A 1LNWA 3TKYA 4KIFA 2G7HA 3L9FA 4LLLA 2RV8A 3LA2A 3ZP5A 3WTVC 4PGGA 3IL2A 2LSOA 3KP7A 2L4AA 3TO6A 1ZN2A 5K5OA 3ZN0A 3VEPA 4HA8A 4IJAA 5ILVA 3HTSB 1Q1HA 5ICGA 2HGCA 5LEJA 2IVMA 5FLXK 3WTSC 1SD7A 2H6CA 2JZYA 1ON1A 4K2EA 1U3EM 4G7OF 4LJZF 1FBSA 3IWZA 4XLPF 3SZTA 5L3DA 1Z05A 3FMRA 3TO7A 4R79A 3RI4A 4CZZA 4M9SA 4Q48A 3RPQA 4ZYHA 1OYYA 3V8LA 1REPC 1BI1A 1BM9A 3L00A 3E5UA 4S04A 1SAXA 3H3ZA 1P4AA 3P9CA 4ZZDA 2Y48A 2YX4A 1MD0A 3KP3A 4AWXB 5FD5A 2ADUA 2PQ8A 1Z1DA 3HRSA 2Q2EA 3F8NA 5DCFA 2HYGD 4MTDA 1RNLA 2M87A 1SFXA 1KA8A 4PDKA 2LKPA 5LRRA 4AIJA 3DQVC 2GAUA 2A69F 5FO5A 2LDUA 4XLNF 4L9VA 2VODA 1B4AA 3CTAA 2LF7A 1GVJA 4BHCA 2IT0A 3BWGA 3DKWA 2KIMA 3TOBA 2VXZA 3R0JA 1H0MA 3WE3A 1KU3A 1XGOA 4KMUX 2CG4A 3FZVA 5H6QA 4EJWA 4R1HA 2XKPA 1OMIA 3FXRA 5LHHA 2VBWA 5HDKA 4WXHA 4Y13A 3DXJF 2EJRA 1IZ1A 3JSOA 3ERED 2A6HF 2OD5A 1MDMA 2CWEA 1WSUA 5D5XB 2GIVA 3V8JA 3LQRA 2RDPA 4WK8F 4L0YB 1ZH5A 3ABTA 2GA1A 1ZLKA 2OQGA 2XAFA 2W85A 3FMQA 1ZLJA 1PP7U 4CYDA 1IUYA 3E6CC 1P92A 4LD5A 2XUBA 3RKYA 1USTA 1O3RA 1OKRA 5HLIA 4S05A 2FNPA 2YPRA 5LGUA 3ZMUA 1MDMB 1J9IA 2V1XA 1LJ9A 1L3LA 3LA3A 1ZRCA 5K5RA 1KU7A 5CJ9A 3COAC 4P5OA 4ENMA 4YFXF 4LB5A 4JK1X 1H9TA 4RGRA 1Z91A 5K5QA 5HDGA 2FXAA 4HF2A 4KT5C 3KEQA 4LFUA 3KEOA 2LF8A 2ZMEA 3K9TA 4UV8A 4UVAA 3T8TA 2P7CB 1SMTA 4MQ9F 2PBIA 3WE2A 2IRFG 3WTXC 1G3YA 4I02A 2L3DA 4ZYEA 5JFRA 3Q5FA 4YIIA 3P9IA 4ENJA 3ZMZA 2K86A 2D45A 2HTSA 2DPDA 4IRIA 2DQRA 1P4XA 1HQCA 3HRTA 2QVOA 2X0LA 4HX4A 1OPCA 1TQMA 1HSJA 4BHBA 3WU1B 2EFQA 3B73A 1S7OA 1ZG3A 1BI0A 3BY6A 1FY7A 2FSWA 1GXQA 2HDCA 1EH6A 2EB7A 3JTHA 3ZQ7A 2R7FA 1J59A 2BV6A 1KQ9A 1IN7A 4EJUA 3SFZA 2FU4A 3E97A 2J5PA 2NNYA 1IN4A 4RAYA 1R5GA 2VBYA 4G7HF 3B02A 3H92A 3O3KA 4ZYDA 4RAZA 4IHSA 4ZZLA 3RYRA 1JGSA 2HQRA 1C0WA 1DP7P 5L3GA 3I0TA 4RB3C 2VE8A 3U2RA 2RVCA 5FFXA 2CSOA 1KYWA 3NRVA 2P5VA 2V6CA 4A0YA 1EV7A 1H9GA 1L0OC 1R1TA 2COMA 3TQNA 2AS5F 2HFHA 4HQMA 2RGVA 4EJOA 1XB4A 2XAJA 5AIPA 3EYYA 1F1ZA 4M74A 5H20A 2P7VB 3QU6A 3BZ6A 3EQLF 1JHFA 1XGSA 4E70A 1B59A 3QRFF 4UUVA 3HIFA 5AONA 3VB2A 2Q0OA 4U0WA 4BQAA 3MCZA 1VTNC 3I71A 2IP2A 3DP7A 2UWMA 4U0VA 2CFXA 2ZCWA 3G73A 2HYFA 3KLOA 3I59A 4M6XA 3G3ZA 5LHGA 4EMSA 2PG4A 3LWFA 2F5DA 4GXOA 3LQQA 4D0PA 2DK5A 4IVNA 3BPXA 2Z33A 1T39A 4M6YA 1F9NA 5BMZA 2HKXA 4AVPA 3TO9A 1XN7A 5F1RA 3MZHA 3BJOA 5LRSA 1PDNC 3FM3A 3JTGA 1QGPA 3GO5A 2OQRA 1E17A 3GF2A 3F6OA 2HS5A 2QUFA 4IXAA 2O03A 3K1MA 1KGSA 3MZYA 1F4KA 1IXRC 3V7CA 3M1EA 5E1WA 1K7AA 1UHMA 5IT9K 5FLXZ 3LSTA 3WTZA 5D6FA 1FYMA 4DQ2A 4CXFA 3E3VA 4KICA 4MTEA 3LA7A 2O6GE 5D8LB 2ZJ2A 2A07F 5TJJA 4RB1A 3WGGA 1R00A 3GLXA 4G6QA 1JHHA 3HSRA 1QQIA 1WWXA 2PI0A 1QZYA 2BE5F 2K4BA 5CLSA 1IN5A 2XGXA 1IXSB 1U6GA 2W84A 1JE8A 4BXUA 2H94A 1WKMA 2BYVE 2V9VA 5HOOA 1STZA 2EFOA 2MD5A 3C18A 5DDGA 2DPUA 5LHIA 2M8EA 2L4MA 1OR7A 4N9IA 3QOPA 5BPDA 4ESFA 5BS6A 2O61A 2XASA 3LFKA 2JPCA 4KIGA 4I98B 2IA1A 2MC3A 1W7PA 4EM1A 2OZUA 1EH8A 1ZARA 3BOQA 1WQ2A 3IKTA 2PN6A 4BHPA 1I6XA 4M9ZA 1IW7F 3KP6A 2QQ9A 2Y75A 3I53A 4XRFA 3LAPA 4HX7A 4L9TA 2RNJA 5LEKA 3EETA 1LQ1A 1KU2A 2GA2A 3HSFA 1KU9A 5F6FA 2UXXA 1W7PB 3PFIA 2JRTA 2DU9A 2NNNA 3GW2A 2P4WA 4A5MA 1O3SA 2P8TA 4M71A 3PQJA 4HDUA 1SMYF 5L3CA 3BP8A 2HQNA 3F8CA 3WU0A 3J81Z 4BNCA 3R6SA 4O6JA 2JT1A 1D8JA 4O3MA 3F23A 4ESBA 2HTJA 1BIAA 2IPQX 2G7UA 1T2KA 1TW3A 2K7LA 2RC4A 1Y0UA 4EVIA 1XDUA 4HZFA 5E8IA 5LGTA 2OZ6A 2CQKA 1IN6A 3VFZA 2C6YA 3Q9SA 4G8XA 4EGYA 4GCVA 3EUHA 3RTRA 2OBPA 1GXPA 3HRUA 2EA2A 3I58A 4I7HA 2KJBA 1T0FA 5DEQA 4L9NA 1YW7A 2F5CA 5LLQA 5E18F 3MWMA 5D8KB 5FGMA 1XSDA 5TRDA 1K78A 3ECHA 4LLNA 2XHKA 1G3TA 4RGUA 4U0YA 3D5LA 3JAMK 1S6LA 2DK8A 3GFIA 1O7LA 3K0LA 1Z9CA 3E5XA 1ZRFA 2PJPA 1D8KA 3M8FA 1IRFA 5E20A 1P2FA 2A3SA 1ONVA 4B8XA 1FP1D 2L02A 4GYIA 3QP5A 4OU0A 1CF7A 1WRJA 2EFWA 1XMKA 2MA3A 4RB2C 1FYLA 3RIRA 5K1YA 3J80Z 1YS7A 3ISPA 1JXSA 4MHGA 1J7KA 1FSEA 2H27A 4FT8A 3CDHA 4PCQA 4HDVA 1ZG5A 2R3SA 3RKWA 3J7AO 5DYMA 3ULQB 1ZRDA 1YW8A 5E1XA 1B1BA 5CVJA 4KUMA 2VC1A 1R36A 1PUEE 3MAJA 1I5ZA 2GZWA 1FZPB 2A61A 4ENKA 4LG0A 5L3BA 2NAZA 4UXNA 2O0YA 4IF4A 1AOYA 2STTA 3M8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8C A;  1J75 A;  4YFK F;  4OIP F;  4HF0 A;  4P9F A;  4RS8 A;  1MJ9 A;  1FPQ A;  1B9M A;  1ZAO A;  2YX7 A;  1QNT A;  2ESN A;  4NB5 A;  3JW4 A;  1IN8 A;  2EK5 A;  3ML6 A;  1I27 A;  4AIK A;  4IHT A;  5H6R A;  3LAJ A;  3K1P A;  4LB6 B;  2KIU A;  2RKH A;  3BPV A;  2DBB A;  5HS8 A;  2V79 A;  1WI9 A;  2GQQ A;  3GFM A;  2EV6 A;  2ZME B;  3I64 A;  1U78 A;  4L0Z B;  1S29 A;  4O5V A;  3SZP A;  1SFU A;  2O3F A;  2V1D A;  4UNO A;  3IKV A;  2FF4 A;  2XV4 S;  5ERI A;  5DCM A;  3EYI A;  2PEX A;  3HUG A;  3GEZ A;  4KFC A;  5E1Z B;  2GXB A;  2QBY A;  2HOE A;  1OYI A;  1IXC A;  1IAW A;  1SD4 A;  1HW2 A;  1MJB A;  1XCV A;  4M73 A;  5HS7 A;  2GXG A;  1K79 A;  4IRG A;  3QAH A;  5J8F A;  4L5I A;  5ICC A;  2HR3 A;  4OIQ F;  2FEZ A;  3JSP A;  2VBZ A;  3BJ6 A;  2FOK A;  2QBY B;  4M9X A;  1UCR A;  4G94 A;  2IA0 A;  3KCC A;  3ZMS A;  4N9H A;  3CUQ C;  2PMU A;  2YR2 A;  2DQL A;  5D5V B;  1XD7 A;  4HV6 A;  1U5T C;  2QYO A;  2TDX A;  1S7A A;  4ENN A;  1SFE A;  1FNN A;  5JI6 A;  5BQT A;  1HST A;  5JR3 A;  2DTR A;  5D4S A;  4XSZ F;  2EFN A;  3P9K A;  1FP2 A;  2FBH A;  2M30 A;  4RGX A;  2D1H A;  2IA2 A;  3N4M A;  2HEO A;  3C1D A;  4ON0 A;  4PGH A;  4LK0 F;  1J0R A;  1BI3 A;  4OIO F;  5FD6 A;  4L5J A;  2WC2 A;  3KP2 A;  4LMY A;  4OOI A;  3FM5 A;  1PP8 F;  1E2X A;  3R0A A;  1YW9 A;  2XKO A;  1MKM A;  4A2U A;  4WX9 A;  1LDK B;  3MFK A;  2EV5 A;  3WTT C;  1HKS A;  5IT9 Z;  2P5L C;  4NHJ A;  4CGZ A;  2JPB A;  2PLY A;  3WTW C;  2MLK A;  3U1D A;  2GWR A;  1HBX G;  2XAQ A;  4UVC A;  2K4J A;  4G9Y A;  3BRO A;  3IRR A;  3WGH A;  2ESH A;  3QPT A;  3KP5 A;  3DV8 A;  1FYK A;  4LK1 F;  1LEB A;  4WXC A;  1BN5 A;  2FBK A;  3F72 A;  2K02 A;  1YS6 A;  3KP4 A;  1UFM A;  2OU2 A;  4ASN A;  5DUK A;  3I59 B;  1O3Q A;  1MZB A;  1LB2 A;  1Z6T A;  4RB0 A;  5CYV A;  4UHT A;  5CVI A;  1TTY A;  2MLG A;  5A2Q K;  3ECO A;  2CW0 F;  3HSE A;  1EH7 A;  4HAM A;  4N0B A;  3C3W A;  4Q47 A;  2STW A;  2ZFW A;  2ZNZ A;  1T6S A;  3HYI A;  5F64 A;  3DF8 A;  3T1B A;  2X4H A;  2XVC A;  3QPH A;  2KJC A;  3CO6 C;  3VOD A;  4A0Z A;  3FXU A;  3T0Y A;  3L2C A;  3RYP A;  2E7X A;  2DFI A;  3CUQ A;  2V1U A;  2VOO A;  5IT3 A;  3F8M A;  3HTU A;  2DAO A;  1R5H A;  2DI3 A;  5ICE A;  2QM3 A;  2IJL A;  1O3T A;  1BC7 C;  4LLG F;  2XAH A;  4MEY F;  4GO1 A;  3HHH A;  2LNB A;  5FFZ A;  3R60 A;  1TQI A;  2H6B A;  1XGM A;  4R8H A;  4EM0 B;  2VT3 A;  4MNU A;  2ISZ A;  3K69 A;  4HYE A;  2K27 A;  1YTY A;  1LDD A;  3SXY A;  3CLO A;  5D4R A;  4EGZ A;  4EJV A;  1R1U A;  5DD8 A;  4KIB A;  5BPI A;  3E6B A;  2QZ8 A;  2MH2 A;  2QEN A;  2XAG A;  1RZ4 A;  3OOP A;  4I01 A;  3R4K A;  1MJA A;  2NYX A;  1FSH A;  3ZMD A;  2FMY A;  4KN4 X;  4OMY A;  3EDP A;  3IHU A;  1CGP A;  1MGT A;  2D1V A;  5ILU A;  2L01 A;  2R7D A;  1XGN A;  3I5U A;  2Z9O A;  2RN7 A;  3FWE A;  4HQE A;  3ELK A;  5KK1 A;  1D3Y A;  1ZGA A;  4I0A A;  1P6R A;  4I2O A;  1KYZ A;  1XSX A;  2FNA A;  4WWC A;  4OIN F;  1UB9 A;  3R61 A;  2XRN A;  2L54 A;  4LGW A;  3JAM Z;  4PZJ A;  1ZGJ A;  4L9J A;  4MGR A;  2YU3 A;  5CVV A;  4EQQ A;  1BJA A;  5EEG A;  4OMZ A;  3DEU A;  1HKQ A;  2BBY A;  3FX3 A;  4KN7 X;  4A5N A;  3GZ5 A;  1FBQ A;  4HOB A;  1TW2 A;  5ICF A;  3W6J B;  5CVU A;  3F8F A;  4G6D A;  2DO7 A;  3GUD A;  4CIC A;  2MH9 A;  4P55 A;  4QLC U;  4GYG A;  3E5Q A;  3GFL A;  5DV5 A;  3DFG A;  3O2P E;  5HS9 A;  3K1N A;  1J2X A;  1HKT A;  2W57 A;  1P4W A;  1YG2 A;  4HLY A;  2DT5 A;  3TOA A;  3TGN A;  4F7Z A;  4EV0 A;  3KLN A;  2E1C A;  2F2E A;  3W6K B;  3FF5 A;  2EWN A;  2Z3Y A;  1G3S A;  3OV8 A;  1W5S A;  2ETH A;  1I1G A;  2CO5 A;  4ZH4 F;  5AIQ A;  2Z99 A;  2WV0 A;  4YIF A;  4U7B A;  2F5E A;  3GZ6 A;  1R23 A;  3GWZ A;  5ILS A;  3T8R A;  1USS A;  1D5V A;  5E8G A;  3F22 A;  1YO5 C;  3I4P A;  2B0L A;  3M9A A;  1Z6R A;  2QWW A;  1OYW A;  2WTE A;  4UVB A;  1K78 B;  1RIO H;  4WXD A;  2O8X A;  2QLZ A;  4ETS A;  1BC8 C;  5DD4 A;  2G9W A;  3VOE A;  3P7N A;  4KYW A;  1XSV A;  3WTU C;  3GX4 X;  1HW1 A;  5FB2 A;  3KET A;  3FXQ A;  3HOT A;  3ROU A;  2FE3 A;  3J81 K;  1TNT A;  1B9N A;  2VOP A;  3KZY A;  2UXN A;  2M5W A;  1CF7 B;  1F5T A;  2KRF A;  3F6V A;  1X3U A;  1W4M A;  3D0S A;  2VBX A;  5D6E A;  2PFB A;  1O57 A;  3HRM A;  3WOD F;  5J6X A;  5HVQ C;  2DLL A;  3TDU C;  4L18 B;  2DW4 A;  1W5T A;  4BAY A;  4IRH A;  4AIH A;  2UZK A;  2F5F A;  4FX0 A;  4YG2 F;  4U88 A;  3FMS A;  1GHC A;  3SQN A;  4KA4 A;  4FX4 A;  1FT9 A;  3V7R A;  4KMF A;  4NQW A;  3S2W A;  1FWZ A;  4ESJ A;  4A6D A;  2HKO A;  1YYV A;  5D5U B;  4G7Z F;  1HXD A;  1R1V A;  4LG0 B;  2VON A;  1G6N A;  1K6O A;  3MQ0 A;  2KKO A;  2ZNY A;  1R58 A;  3ZMV A;  4M72 A;  4ZYG A;  3ZPL A;  5KVR A;  3HOS A;  2M1B A;  1G4D A;  4MQV A;  3V8K A;  2VE9 A;  1S8N A;  1QPM A;  3V7S A;  3J80 K;  1FBU A;  1ODD A;  2P6S A;  5HLG A;  3NEU A;  4MEX F;  3GXO A;  5LGN A;  4QWQ A;  4EM2 A;  3GFJ A;  3H3U A;  1TNS A;  3F3X A;  3BDD A;  3WTY C;  2CYY A;  1XCB A;  1AWC A;  1DPU A;  1T38 A;  2A68 F;  1ZHF A;  3REO A;  4A6E A;  3F21 A;  3BJA A;  2A5Y B;  2QQB A;  2FML A;  1YFH A;  1R7J A;  5DCM B;  2W25 A;  1ULY A;  2ACJ A;  2QQA A;  3O6B B;  4HLX A;  2JTV A;  1XMA A;  3QP6 A;  4TV7 A;  1RUO A;  1IF1 A;  2H09 A;  5L3F A;  2BGC A;  2ZO4 A;  5JHU A;  2NS0 A;  3CO7 C;  1RUN A;  2FQ3 A;  3WG9 A;  1UHW A;  2Q8K A;  1U2W A;  4A12 A;  2ZXJ A;  3QU3 A;  1RI7 A;  3SHF A;  3Q9V A;  3WGI A;  2A6E F;  1U8R A;  1DPR A;  3E6M A;  2HWV A;  2E7W A;  4FHT A;  2W24 A;  2YSR A;  3CJN A;  4JQF A;  5BOX A;  5A2Q Z;  1YLF A;  3RDI A;  4CHU A;  1HW5 A;  3PQK A;  1YIO A;  2J5O A;  4HBL A;  3DPL C;  3GVA A;  4P96 A;  4WCG A;  4KDP A;  4Y15 A;  4I09 A;  4HW0 A;  2M45 A;  4XSX F;  1DDN A;  3F8B A;  3FHZ A;  3C7J A;  1FX7 A;  3ZMT A;  4WF2 A;  4A0X A;  1QBJ A;  2EV0 A;  1ZYR F;  2VC0 A;  1YQA A;  3RJP A;  5LBQ A;  1V4R A;  1SD5 A;  3GYH X;  3AAF A;  2Y0M A;  2HZT A;  1KQ8 A;  1FOK A;  1TLH B;  1R22 A;  3DPT A;  1BOA A;  3KE2 A;  4YFN F;  4HX8 A;  4P9U A;  4RGS A;  1TBX A;  4CO8 A;  3E6D A;  2D2W A;  2FBI A;  1ON2 A;  3CUO A;  3IRQ A;  4BH9 A;  3T5X A;  6PAX A;  4I0B A;  1ZRE A;  1LDJ A;  1LVA A;  3KZZ A;  2P6T A;  2BEO A;  2VN2 A;  2ZKZ A;  2RQP A;  1TQP A;  1SD6 A;  2FA5 A;  4CDG A;  2NRA C;  3RKX A;  1FC3 A;  1T98 A;  2OA4 A;  2WWY A;  4EJT A;  4KNY A;  1BBY A;  1KQ0 A;  5E17 F;  4Q4Z F;  1NHA A;  2ZBK A;  1Z7U A;  3IWF A;  1QO0 D;  1BIB A;  5CVR A;  5D5W B;  1FLI A;  1O7F A;  3ABU A;  2CGP A;  3U9G A;  3M7G A;  4HV5 A;  2OAZ A;  4B09 A;  2FRH A;  2PMH A;  3L7W A;  2IW5 A;  2Z5U A;  5JVT A;  4Z2Y A;  2KIF A;  1XDS A;  3RPU A;  2E1N A;  1V3F A;  3KFW X;  2EFP A;  2XRO A;  1U5T A;  2ISY A;  3L09 A;  3I54 A;  3NQO A;  3HHG A;  4Q5S F;  2EA4 A;  4IPA A;  1G3W A;  4OIR F;  3K2Z A;  1S3J A;  3ZN1 A;  5HDN A;  5DUI A;  1A04 A;  2AXL A;  4JBA A;  3TDZ C;  5L3E A;  4UV9 A;  4XBF A;  1IRG A;  4H0E A;  3CUQ B;  3V4G A;  1W7P D;  3N97 A;  1ZG1 A;  1U5T B;  1I1S A;  3MEX A;  1B6A A;  1DUX C;  1QZZ A;  5ED4 A;  4HF1 A;  1BI2 A;  1LEA A;  2MBF A;  4BYY A;  4AD9 A;  2JSC A;  4DNC A;  2P5K A;  5EEH A;  2XIG A;  4GGG A;  1J5Y A;  3IC7 A;  4U7D A;  2ELH A;  2VT2 A;  5HLH A;  4Y17 A;  1LNW A;  3TKY A;  4KIF A;  2G7H A;  3L9F A;  4LLL A;  2RV8 A;  3LA2 A;  3ZP5 A;  3WTV C;  4PGG A;  3IL2 A;  2LSO A;  3KP7 A;  2L4A A;  3TO6 A;  1ZN2 A;  5K5O A;  3ZN0 A;  3VEP A;  4HA8 A;  4IJA A;  5ILV A;  3HTS B;  1Q1H A;  5ICG A;  2HGC A;  5LEJ A;  2IVM A;  5FLX K;  3WTS C;  1SD7 A;  2H6C A;  2JZY A;  1ON1 A;  4K2E A;  1U3E M;  4G7O F;  4LJZ F;  1FBS A;  3IWZ A;  4XLP F;  3SZT A;  5L3D A;  1Z05 A;  3FMR A;  3TO7 A;  4R79 A;  3RI4 A;  4CZZ A;  4M9S A;  4Q48 A;  3RPQ A;  4ZYH A;  1OYY A;  3V8L A;  1REP C;  1BI1 A;  1BM9 A;  3L00 A;  3E5U A;  4S04 A;  1SAX A;  3H3Z A;  1P4A A;  3P9C A;  4ZZD A;  2Y48 A;  2YX4 A;  1MD0 A;  3KP3 A;  4AWX B;  5FD5 A;  2ADU A;  2PQ8 A;  1Z1D A;  3HRS A;  2Q2E A;  3F8N A;  5DCF A;  2HYG D;  4MTD A;  1RNL A;  2M87 A;  1SFX A;  1KA8 A;  4PDK A;  2LKP A;  5LRR A;  4AIJ A;  3DQV C;  2GAU A;  2A69 F;  5FO5 A;  2LDU A;  4XLN F;  4L9V A;  2VOD A;  1B4A A;  3CTA A;  2LF7 A;  1GVJ A;  4BHC A;  2IT0 A;  3BWG A;  3DKW A;  2KIM A;  3TOB A;  2VXZ A;  3R0J A;  1H0M A;  3WE3 A;  1KU3 A;  1XGO A;  4KMU X;  2CG4 A;  3FZV A;  5H6Q A;  4EJW A;  4R1H A;  2XKP A;  1OMI A;  3FXR A;  5LHH A;  2VBW A;  5HDK A;  4WXH A;  4Y13 A;  3DXJ F;  2EJR A;  1IZ1 A;  3JSO A;  3ERE D;  2A6H F;  2OD5 A;  1MDM A;  2CWE A;  1WSU A;  5D5X B;  2GIV A;  3V8J A;  3LQR A;  2RDP A;  4WK8 F;  4L0Y B;  1ZH5 A;  3ABT A;  2GA1 A;  1ZLK A;  2OQG A;  2XAF A;  2W85 A;  3FMQ A;  1ZLJ A;  1PP7 U;  4CYD A;  1IUY A;  3E6C C;  1P92 A;  4LD5 A;  2XUB A;  3RKY A;  1UST A;  1O3R A;  1OKR A;  5HLI A;  4S05 A;  2FNP A;  2YPR A;  5LGU A;  3ZMU A;  1MDM B;  1J9I A;  2V1X A;  1LJ9 A;  1L3L A;  3LA3 A;  1ZRC A;  5K5R A;  1KU7 A;  5CJ9 A;  3COA C;  4P5O A;  4ENM A;  4YFX F;  4LB5 A;  4JK1 X;  1H9T A;  4RGR A;  1Z91 A;  5K5Q A;  5HDG A;  2FXA A;  4HF2 A;  4KT5 C;  3KEQ A;  4LFU A;  3KEO A;  2LF8 A;  2ZME A;  3K9T A;  4UV8 A;  4UVA A;  3T8T A;  2P7C B;  1SMT A;  4MQ9 F;  2PBI A;  3WE2 A;  2IRF G;  3WTX C;  1G3Y A;  4I02 A;  2L3D A;  4ZYE A;  5JFR A;  3Q5F A;  4YII A;  3P9I A;  4ENJ A;  3ZMZ A;  2K86 A;  2D45 A;  2HTS A;  2DPD A;  4IRI A;  2DQR A;  1P4X A;  1HQC A;  3HRT A;  2QVO A;  2X0L A;  4HX4 A;  1OPC A;  1TQM A;  1HSJ A;  4BHB A;  3WU1 B;  2EFQ A;  3B73 A;  1S7O A;  1ZG3 A;  1BI0 A;  3BY6 A;  1FY7 A;  2FSW A;  1GXQ A;  2HDC A;  1EH6 A;  2EB7 A;  3JTH A;  3ZQ7 A;  2R7F A;  1J59 A;  2BV6 A;  1KQ9 A;  1IN7 A;  4EJU A;  3SFZ A;  2FU4 A;  3E97 A;  2J5P A;  2NNY A;  1IN4 A;  4RAY A;  1R5G A;  2VBY A;  4G7H F;  3B02 A;  3H92 A;  3O3K A;  4ZYD A;  4RAZ A;  4IHS A;  4ZZL A;  3RYR A;  1JGS A;  2HQR A;  1C0W A;  1DP7 P;  5L3G A;  3I0T A;  4RB3 C;  2VE8 A;  3U2R A;  2RVC A;  5FFX A;  2CSO A;  1KYW A;  3NRV A;  2P5V A;  2V6C A;  4A0Y A;  1EV7 A;  1H9G A;  1L0O C;  1R1T A;  2COM A;  3TQN A;  2AS5 F;  2HFH A;  4HQM A;  2RGV A;  4EJO A;  1XB4 A;  2XAJ A;  5AIP A;  3EYY A;  1F1Z A;  4M74 A;  5H20 A;  2P7V B;  3QU6 A;  3BZ6 A;  3EQL F;  1JHF A;  1XGS A;  4E70 A;  1B59 A;  3QRF F;  4UUV A;  3HIF A;  5AON A;  3VB2 A;  2Q0O A;  4U0W A;  4BQA A;  3MCZ A;  1VTN C;  3I71 A;  2IP2 A;  3DP7 A;  2UWM A;  4U0V A;  2CFX A;  2ZCW A;  3G73 A;  2HYF A;  3KLO A;  3I59 A;  4M6X A;  3G3Z A;  5LHG A;  4EMS A;  2PG4 A;  3LWF A;  2F5D A;  4GXO A;  3LQQ A;  4D0P A;  2DK5 A;  4IVN A;  3BPX A;  2Z33 A;  1T39 A;  4M6Y A;  1F9N A;  5BMZ A;  2HKX A;  4AVP A;  3TO9 A;  1XN7 A;  5F1R A;  3MZH A;  3BJO A;  5LRS A;  1PDN C;  3FM3 A;  3JTG A;  1QGP A;  3GO5 A;  2OQR A;  1E17 A;  3GF2 A;  3F6O A;  2HS5 A;  2QUF A;  4IXA A;  2O03 A;  3K1M A;  1KGS A;  3MZY A;  1F4K A;  1IXR C;  3V7C A;  3M1E A;  5E1W A;  1K7A A;  1UHM A;  5IT9 K;  5FLX Z;  3LST A;  3WTZ A;  5D6F A;  1FYM A;  4DQ2 A;  4CXF A;  3E3V A;  4KIC A;  4MTE A;  3LA7 A;  2O6G E;  5D8L B;  2ZJ2 A;  2A07 F;  5TJJ A;  4RB1 A;  3WGG A;  1R00 A;  3GLX A;  4G6Q A;  1JHH A;  3HSR A;  1QQI A;  1WWX A;  2PI0 A;  1QZY A;  2BE5 F;  2K4B A;  5CLS A;  1IN5 A;  2XGX A;  1IXS B;  1U6G A;  2W84 A;  1JE8 A;  4BXU A;  2H94 A;  1WKM A;  2BYV E;  2V9V A;  5HOO A;  1STZ A;  2EFO A;  2MD5 A;  3C18 A;  5DDG A;  2DPU A;  5LHI A;  2M8E A;  2L4M A;  1OR7 A;  4N9I A;  3QOP A;  5BPD A;  4ESF A;  5BS6 A;  2O61 A;  2XAS A;  3LFK A;  2JPC A;  4KIG A;  4I98 B;  2IA1 A;  2MC3 A;  1W7P A;  4EM1 A;  2OZU A;  1EH8 A;  1ZAR A;  3BOQ A;  1WQ2 A;  3IKT A;  2PN6 A;  4BHP A;  1I6X A;  4M9Z A;  1IW7 F;  3KP6 A;  2QQ9 A;  2Y75 A;  3I53 A;  4XRF A;  3LAP A;  4HX7 A;  4L9T A;  2RNJ A;  5LEK A;  3EET A;  1LQ1 A;  1KU2 A;  2GA2 A;  3HSF A;  1KU9 A;  5F6F A;  2UXX A;  1W7P B;  3PFI A;  2JRT A;  2DU9 A;  2NNN A;  3GW2 A;  2P4W A;  4A5M A;  1O3S A;  2P8T A;  4M71 A;  3PQJ A;  4HDU A;  1SMY F;  5L3C A;  3BP8 A;  2HQN A;  3F8C A;  3WU0 A;  3J81 Z;  4BNC A;  3R6S A;  4O6J A;  2JT1 A;  1D8J A;  4O3M A;  3F23 A;  4ESB A;  2HTJ A;  1BIA A;  2IPQ X;  2G7U A;  1T2K A;  1TW3 A;  2K7L A;  2RC4 A;  1Y0U A;  4EVI A;  1XDU A;  4HZF A;  5E8I A;  5LGT A;  2OZ6 A;  2CQK A;  1IN6 A;  3VFZ A;  2C6Y A;  3Q9S A;  4G8X A;  4EGY A;  4GCV A;  3EUH A;  3RTR A;  2OBP A;  1GXP A;  3HRU A;  2EA2 A;  3I58 A;  4I7H A;  2KJB A;  1T0F A;  5DEQ A;  4L9N A;  1YW7 A;  2F5C A;  5LLQ A;  5E18 F;  3MWM A;  5D8K B;  5FGM A;  1XSD A;  5TRD A;  1K78 A;  3ECH A;  4LLN A;  2XHK A;  1G3T A;  4RGU A;  4U0Y A;  3D5L A;  3JAM K;  1S6L A;  2DK8 A;  3GFI A;  1O7L A;  3K0L A;  1Z9C A;  3E5X A;  1ZRF A;  2PJP A;  1D8K A;  3M8F A;  1IRF A;  5E20 A;  1P2F A;  2A3S A;  1ONV A;  4B8X A;  1FP1 D;  2L02 A;  4GYI A;  3QP5 A;  4OU0 A;  1CF7 A;  1WRJ A;  2EFW A;  1XMK A;  2MA3 A;  4RB2 C;  1FYL A;  3RIR A;  5K1Y A;  3J80 Z;  1YS7 A;  3ISP A;  1JXS A;  4MHG A;  1J7K A;  1FSE A;  2H27 A;  4FT8 A;  3CDH A;  4PCQ A;  4HDV A;  1ZG5 A;  2R3S A;  3RKW A;  3J7A O;  5DYM A;  3ULQ B;  1ZRD A;  1YW8 A;  5E1X A;  1B1B A;  5CVJ A;  4KUM A;  2VC1 A;  1R36 A;  1PUE E;  3MAJ A;  1I5Z A;  2GZW A;  1FZP B;  2A61 A;  4ENK A;  4LG0 A;  5L3B A;  2NAZ A;  4UXN A;  2O0Y A;  4IF4 A;  1AOY A;  2STT A;  3M8E A; 
#chains in the Genus database with same CATH topology
 4NBQ A;  5J8C A;  1J75 A;  4YFK F;  4OIP F;  4HF0 A;  4BKX A;  3CD6 I;  3ZQH A;  4P9F A;  4F55 A;  1JKQ C;  2ELJ A;  4RS8 A;  1HF0 A;  1MJ9 A;  1IO2 A;  1FPQ A;  1B9M A;  1MNM C;  3MN2 A;  2QA4 I;  1ZAO A;  2YX7 A;  1QNT A;  2ESN A;  4NB5 A;  3JW4 A;  1IN8 A;  4S0H B;  2EK5 A;  2IAI A;  3ML6 A;  3VSL A;  5E3M A;  1I27 A;  4AIK A;  1OFC X;  4IHT A;  5H6R A;  1MMA A;  2IGO A;  3LAJ A;  5J4V A;  3LSI A;  4G6T B;  1T95 A;  1WJD A;  3K1P A;  4LB6 B;  2KIU A;  2RKH A;  2WB1 A;  3BPV A;  1U0J A;  4JOM A;  2DBB A;  2Y9Y A;  5HS8 A;  1HLV A;  1YX5 A;  2V79 A;  1WI9 A;  3TBI A;  2GQQ A;  3D1N I;  3GFM A;  2EV6 A;  2ZME B;  2E1M B;  3I64 A;  1U78 A;  3FIS A;  4L0Z B;  3CJR B;  1S29 A;  4O5V A;  4DJA A;  1GV2 A;  1XG1 A;  4D5F A;  3S14 J;  3SZP A;  2O5R A;  3Q0W A;  2BVL A;  5B66 C;  3OYB A;  4IKF A;  4XQF A;  3HOX J;  3LSJ A;  1SFU A;  4MIM A;  3ZR8 X;  2O3F A;  2CQX A;  2V1D A;  3EUA A;  1WJE A;  4QPO A;  4UNO A;  3IKV A;  1V5E A;  3GTQ J;  3BTC A;  4Y4R A;  4HG2 A;  2FF4 A;  2DA2 A;  2XV4 S;  5ERI A;  5DCM A;  1YRN A;  5EGO A;  2M7A A;  2E71 A;  2MYS A;  2PEX A;  3HUG A;  4JX6 A;  3EYI A;  5C4X J;  3GEZ A;  5KCM A;  4KFC A;  5F0F A;  5E1Z B;  2GXB A;  2QBY A;  2L9N A;  2R92 J;  2HOE A;  4E6K G;  3QOE A;  1OYI A;  1IXC A;  3QYF A;  5M5X J;  1WCM J;  5B5E C;  1HC8 A;  1IAW A;  3L1P A;  1SD4 A;  1HW2 A;  2K85 A;  1MJB A;  2DYS H;  2HI3 A;  1E3P A;  1XCV A;  2BY0 A;  4M73 A;  5HS7 A;  1VFC A;  2GXG A;  1JKP C;  1K79 A;  4IRG A;  2M3A A;  3HKZ A;  3ZOB A;  3QAH A;  5J8F A;  5JLX A;  3CMA I;  4L5I A;  1YRN B;  5EGO B;  1K6Y A;  1U8B A;  5ICC A;  5J40 A;  2HR3 A;  1S7E A;  4C3H J;  2WY7 Q;  4OIQ F;  2FEZ A;  4ABZ A;  3DTI A;  3LNQ A;  1WFX A;  3JSP A;  2VBZ A;  3DBH B;  2XB0 X;  3BJ6 A;  2FOK A;  2QBY B;  4BY1 J;  2HVS A;  2L9V A;  2CU7 A;  4PJ0 C;  4M9X A;  1UCR A;  3BG3 A;  1UZC A;  4G94 A;  4V19 K;  2IA0 A;  3CCJ I;  3H9Q A;  3KCC A;  3ZMS A;  4A3M J;  1FTT A;  4N9H A;  3CUQ C;  5GAH J;  2PMU A;  2YR2 A;  2DQL A;  5D5V B;  3BC8 A;  1XD7 A;  2NOG A;  1XPX A;  4HV6 A;  1U5T C;  2QYO A;  2TDX A;  1TL8 A;  1MBK A;  3L2W A;  3ONQ A;  1S7A A;  2V26 A;  4ENN A;  1SFE A;  1FNN A;  2AXT C;  5JI6 A;  4LIV A;  5BQT A;  1HST A;  3HDD A;  5JR3 A;  2DTR A;  3OL4 A;  5D4S A;  4E7I A;  4XSZ F;  4U87 A;  2EFN A;  3P9K A;  3GTJ J;  1APL C;  2BHY A;  1FP2 A;  2FBH A;  2M30 A;  4RGX A;  2D1H A;  2IA2 A;  3N4M A;  1SVM A;  2HEO A;  2VJI A;  3C1D A;  4ON0 A;  4PGH A;  5EG0 B;  4A3K J;  3AL0 B;  1JT6 A;  4LK0 F;  1J0R A;  4CZC A;  2KRH A;  2LBF B;  2LR8 A;  1BI3 A;  5TIS C;  4OIO F;  5FD6 A;  4L5J A;  2NS7 A;  4E7H A;  1GV5 A;  2WC2 A;  1IUF A;  3KP2 A;  2HVQ A;  4HPQ A;  1Y39 A;  4LMY A;  2DMN A;  3FM5 A;  4OOI A;  3VYT B;  1PP8 F;  4UY8 I;  1E2X A;  2YS9 A;  2JA7 J;  3R0A A;  2NXN B;  3W2W A;  3K7A J;  2HQ5 A;  3L2U A;  3S1R J;  3HGY A;  3OYE A;  1YW9 A;  4F92 B;  2XKO A;  1MKM A;  3ZQG A;  4A2U A;  4WX9 A;  1TT5 B;  5HNH A;  1LDK B;  3MFK A;  2EV5 A;  4BE0 A;  2KDO A;  1VQO I;  5FKM A;  3WG7 H;  3WTT C;  1HKS A;  5IT9 Z;  4Y33 A;  2P5L C;  3KEY A;  3VYR B;  4NHJ A;  4CGZ A;  2JPB A;  4KT6 A;  2PLY A;  1IDY A;  3WTW C;  1B72 B;  5IP6 A;  2DMU A;  2ZFU A;  2MLK A;  3U1D A;  1TWH J;  2GWR A;  3CCS I;  1HBX G;  2XAQ A;  4UVC A;  4F93 B;  1N77 A;  5E3O A;  2L0K A;  2OC6 A;  3H9J A;  4B4C A;  4HSR A;  3AG3 H;  1BJZ A;  2K4J A;  1BR4 A;  4G9Y A;  3BRO A;  3BR3 A;  4FE4 A;  3OYM A;  3IRR A;  1FOY A;  3JRH A;  2MW8 A;  3WGH A;  2ESH A;  2HYJ A;  3QPT A;  1MMN A;  5FLV A;  5CQG A;  4CCL A;  3V42 A;  3KP5 A;  3DV8 A;  1FYK A;  4LK1 F;  3DU5 A;  3DKY A;  1LEB A;  5J47 A;  2JA8 J;  4WXC A;  3SFI A;  1BN5 A;  2LP0 A;  2FBK A;  3F72 A;  4X6A J;  3RPU D;  4DIQ A;  3KX2 A;  2L7K A;  2K02 A;  2DA1 A;  1YS6 A;  1X4O A;  3UKG A;  3KP4 A;  1UFM A;  2OU2 A;  3B6A A;  4ASN A;  3C2B A;  5DUK A;  3I59 B;  1O3Q A;  2GLO A;  2DJI A;  1MZB A;  1LB2 A;  5IYC J;  1Z6T A;  4RB0 A;  5CYV A;  4CYC B;  3Q0V A;  4UHT A;  5CVI A;  1TTY A;  2MLG A;  5A2Q K;  2R7R A;  3ECO A;  2EQR A;  3BTL A;  2CW0 F;  3HSE A;  5J4Y A;  3RQ4 A;  2EIM H;  1EH7 A;  2P0W A;  4HAM A;  4N0B A;  3C3W A;  4Q47 A;  2MG4 A;  2STW A;  1HCR A;  3HGG A;  2LG4 A;  2ZFW A;  2ZNZ A;  2CV2 A;  2AQE A;  3DU6 A;  1T6S A;  2OV7 A;  3HYI A;  2X1C A;  5F64 A;  2YU9 J;  3DF8 A;  3T1B A;  2X4H A;  2XVC A;  5E79 C;  1F43 A;  3OWT A;  3QPH A;  2KJC A;  3CO6 C;  3VOD A;  4A0Z A;  3FXU A;  1OIS A;  2KRC A;  3T0Y A;  3L2C A;  3DCF A;  3RYP A;  1ETQ A;  2E7X A;  2DFI A;  1FEX A;  2FUG 2;  4XLH A;  3CUQ A;  2V1U A;  3B6C A;  1QHG A;  3AG2 H;  2VOO A;  2VKH A;  3CQZ J;  5IT3 A;  3RSN A;  2K3F A;  3F8M A;  3HTU A;  2DAO A;  1R5H A;  2DI3 A;  2KIS A;  5B1A H;  5ICE A;  4YRV A;  1NG7 A;  2QM3 A;  2IJL A;  5HLT A;  4XM3 A;  1VQ5 I;  2V9P A;  1O3T A;  2ELK A;  1BC7 C;  1DU6 A;  4LLG F;  1JUS A;  2QKL B;  4NC7 A;  4DYQ A;  2E2I J;  3PL8 A;  1RR7 A;  2DN0 A;  3QWL A;  1HDD C;  2XAH A;  4MEY F;  4GO1 A;  3HHH A;  2LNB A;  2VJ4 A;  2HOA A;  5FFZ A;  3R60 A;  1TQI A;  2H6B A;  1XGM A;  4R8H A;  4EM0 B;  3PSF A;  3S15 J;  3K4B A;  2VT3 A;  4MNU A;  1XTA A;  3CZ6 A;  2ISZ A;  3K69 A;  4HYE A;  4HNU A;  3OYL A;  2K27 A;  1YTY A;  1MIJ A;  1LDD A;  2UUZ A;  3SXY A;  1AHD P;  1X58 A;  3BR6 A;  3CLO A;  5D4R A;  4EGZ A;  4EJV A;  1R1U A;  2JSP A;  1JUP A;  1E3H A;  5DD8 A;  4KIB A;  1K4T A;  1QVU A;  5BPI A;  3E6B A;  2QZ8 A;  2MH2 A;  2QEN A;  2XAG A;  2QCO A;  1RZ4 A;  2OTL I;  2KZV A;  4CCK A;  3OOP A;  2DA5 A;  1VI0 A;  2EPF A;  3H36 A;  2CW8 A;  4I01 A;  3R4K A;  1MJA A;  1SFO J;  2W82 A;  2NYX A;  2BVM A;  1FMV A;  3MZ8 A;  1FSH A;  3ZMD A;  2FMY A;  4KN4 X;  4OMY A;  3EDP A;  3OS1 A;  3IHU A;  1CGP A;  2E5N A;  3GTK J;  3FK6 A;  1MGT A;  1QHH D;  2D1V A;  3D5R C;  5ILU A;  2L01 A;  2R7D A;  4HNT A;  2X9D A;  1XGN A;  3I5U A;  4E7L A;  2Z9O A;  2E5Z A;  2RN7 A;  3FWE A;  3W3C A;  3BR2 A;  4HQE A;  3ELK A;  1Z7L A;  5KK1 A;  1UAA A;  3AFH A;  1YE9 A;  1D3Y A;  1ZGA A;  4I0A A;  1P6R A;  4I2O A;  2QSH X;  1KYZ A;  1WJF A;  3CC4 I;  1XSX A;  2F5V A;  2FNA A;  2OTJ I;  4WWC A;  4OIN F;  1UB9 A;  3R61 A;  3G2B A;  4ZC3 A;  2R7W A;  1VQK I;  2LFB A;  2XRN A;  2VKV A;  3CMM A;  2L54 A;  4LGW A;  3JAM Z;  4PZJ A;  3S16 J;  1ZGJ A;  4L9J A;  4MGR A;  2XAU A;  1MMD A;  2JA5 J;  1GUU A;  2TRT A;  2YU3 A;  5CVV A;  4EQQ A;  4XN0 A;  1BJA A;  1Y8R B;  4M3F A;  2HZD A;  4OMZ A;  5EEG A;  3K4N A;  4DZP A;  3DEU A;  1HKQ A;  2BBY A;  3FX3 A;  3S32 A;  2VPR A;  4KN7 X;  1NH3 A;  4A5N A;  3GZ5 A;  1FBQ A;  4HOB A;  1TW2 A;  4N4N B;  5ICF A;  3OSG A;  3W6J B;  1CQT A;  5CVU A;  5FRO A;  3F8F A;  4G6D A;  1LKX A;  1HOM A;  2DO7 A;  4CA0 A;  3GUD A;  4XK4 A;  2A5W A;  1VF9 A;  2LYC A;  2Y0S A;  2E35 A;  3F9K A;  1A6Q A;  2H8W A;  3BR0 A;  3JRC A;  2QKM B;  4CIC A;  4L5E A;  2H8R A;  2MH9 A;  1WHU A;  4P55 A;  2E36 A;  3FKI J;  1I6H J;  3I55 I;  1ZR2 A;  4QLC U;  4GYG A;  3E5Q A;  1Z3Y A;  3GFL A;  4YEL A;  2X6W A;  2UV1 A;  3RZD J;  3JRB A;  3L2R A;  5DV5 A;  1X4P A;  2JWT A;  3DFG A;  3O2P E;  5HS9 A;  3K1N A;  5TGT A;  1J2X A;  1HKT A;  2W57 A;  4XR6 A;  1P4W A;  1YG2 A;  3SDB A;  1A6I A;  4HLY A;  2W1O A;  2DT5 A;  5GPA A;  3TOA A;  4I6Z A;  2NVQ J;  1QZE A;  1B8I A;  1KZH A;  3TGN A;  4F7Z A;  1PYV A;  1V5G A;  4EV0 A;  1G2H A;  3A2K A;  3KLN A;  2E1C A;  2F2E A;  3W6K B;  3FF5 A;  4XRM A;  2EWN A;  1ETY A;  4CCO A;  2Z3Y A;  2ECC A;  1G3S A;  3OV8 A;  1W5S A;  1YOV B;  1PUF B;  3FBN B;  3I56 I;  4A3D J;  2ETH A;  1HDP A;  3CDI A;  4I76 A;  1JKO C;  4DOZ A;  1G59 A;  1I1G A;  3A4C A;  2XSD C;  2CO5 A;  4ZH4 F;  4B3X A;  5AIQ A;  2Z99 A;  2WV0 A;  4YIF A;  4U7B A;  2F5E A;  3GTL J;  3C2H A;  3GZ6 A;  1BW5 A;  1Z3X A;  2ZJQ F;  2IGK A;  1R23 A;  3GWZ A;  2KQR A;  5ILS A;  2V4J C;  1RC9 A;  3T8R A;  1USS A;  1D5V A;  2B9S A;  5E8G A;  4XRS G;  3DEE A;  2XGD A;  3F22 A;  1YO5 C;  2XPV A;  1B8I B;  1U9O A;  2DFE A;  2KMU A;  5C44 J;  3I4P A;  2B0L A;  2BZT A;  3M9A A;  2Z1D A;  1Z6R A;  4IX7 A;  2ZXW H;  3CJT B;  1DGR M;  4H4K C;  2KP6 A;  2QWW A;  1OYW A;  3Q0U A;  4AM3 A;  1RRJ A;  2WTE A;  4UVB A;  4C30 A;  4B48 A;  1K78 B;  1RIO H;  4ZDL A;  2H1K A;  4WXD A;  1HA8 A;  1MBE A;  2O8X A;  4IL6 C;  5M3F J;  4ZTJ A;  3LOC A;  2QLZ A;  4ETS A;  1Q1V A;  1BR2 A;  3IP4 B;  1BC8 C;  4B1R A;  5DD4 A;  1V5F A;  2K9L A;  1K83 J;  2G9W A;  2RQQ A;  4PJJ A;  4XKV A;  3P7N A;  2BW3 A;  3VOE A;  2ZC2 A;  4KYW A;  4AVZ A;  2HQA A;  2RAE A;  1LE8 B;  3BQZ A;  1XSV A;  5F0C A;  3WTU C;  3VYU B;  4BEH B;  3A1Y A;  3GX4 X;  4J00 A;  1HW1 A;  5FB2 A;  1DU0 A;  3MKZ A;  3KET A;  3FXQ A;  3HOT A;  3ROU A;  1JI8 A;  1DQU A;  2FE3 A;  1ENH A;  3J81 K;  1TNT A;  1B9N A;  2VOP A;  2A05 A;  3KZY A;  2DA7 A;  2UXN A;  2M5W A;  5KNL A;  1CF7 B;  1F5T A;  3BR5 A;  2KRF A;  2RRE A;  3F6V A;  3JR9 A;  4E4H A;  2AQF A;  1WJA A;  1X3U A;  1W4M A;  3D0S A;  2VBX A;  2KFD A;  5D6E A;  3DKX A;  2PFB A;  1O57 A;  3HRM A;  3WOD F;  3K4L A;  2P81 A;  1IJW C;  5J6X A;  1ITY A;  5HVQ C;  4QSH A;  2DLL A;  3TDU C;  4XOT A;  4UUS A;  3FKJ A;  2F48 A;  2XSJ C;  2DW4 A;  3I9V 2;  4L18 B;  1W5T A;  4BAY A;  4IRH A;  4AIH A;  2UZK A;  2F5F A;  4FX0 A;  1WVR A;  1W0U A;  4YG2 F;  3ZRG A;  2ZXH A;  4U88 A;  3FMS A;  5JLW A;  1GHC A;  3SQN A;  1IDZ A;  4B43 A;  1SFK A;  3CCQ I;  4KA4 A;  4FX4 A;  1FT9 A;  4B44 A;  3S3O A;  4IEJ A;  3V7R A;  4CSW A;  4KMF A;  4NQW A;  5GTI C;  5C3E J;  3S2W A;  1FWZ A;  3BTI A;  3ASO H;  4ESJ A;  4NNJ A;  4A6D A;  4JP0 A;  4F3Q A;  2L7Z A;  3DEW A;  2HKO A;  1YYV A;  5D5U B;  3CF5 F;  2R5Z A;  4G7Z F;  1HXD A;  1R1V A;  1ACI A;  4LG0 B;  2VON A;  4A3E J;  3QPS A;  1G6N A;  1K6O A;  3MQ0 A;  2KKO A;  2ZNY A;  1R58 A;  3ZMV A;  4RA2 A;  3BLY A;  4M72 A;  1J09 A;  4ZYG A;  3ZPL A;  2K9N A;  1MSE C;  2V6E A;  5KVR A;  3K4M A;  3HOS A;  1D1C A;  2M1B A;  1S72 I;  4MQV A;  3V8K A;  2VE9 A;  1S8N A;  1G4D A;  4CUG A;  1QPM A;  1NK2 P;  2F4O B;  4BU2 A;  3QQA A;  3V7S A;  4XIC A;  1ETO A;  1FIP A;  3CCY A;  5DTD A;  2E60 A;  3J80 K;  1FBU A;  3BG6 A;  1ODD A;  3KYC B;  3PNV A;  2P6S A;  5HLG A;  1PJR A;  3CP2 A;  3NEU A;  2R5Z B;  4MEX F;  4QPQ A;  3GXO A;  5LGN A;  1Y1W J;  4QWQ A;  4N4O B;  2LH9 A;  4EM2 A;  1BW6 A;  2QEX I;  2VAS A;  2PJR A;  3OR2 C;  3GFJ A;  3H3U A;  3K2A A;  1D5Y A;  2HPI A;  1TNS A;  1SEU A;  3F3X A;  1S9H A;  3OY9 A;  3BDD A;  3WTY C;  2ID3 A;  3DLL F;  2CYY A;  1XCB A;  4ITV A;  1AWC A;  2HDW A;  2L7M P;  2QQ8 A;  1DPU A;  1T38 A;  3S1N J;  2A68 F;  1ZHF A;  1MND A;  2XGC A;  3REO A;  4A6E A;  4BQQ A;  3F21 A;  2DMQ A;  2K3P A;  3BJA A;  1IRX A;  1ZQ3 P;  3LSP A;  1MMS A;  1W36 D;  1D0Z A;  2A5Y B;  1LPQ A;  2VJ5 A;  5FLM J;  4BE2 A;  2IBD A;  2QQB A;  3H0G J;  5IYD J;  2FML A;  4CCM A;  2FJ1 A;  1YFH A;  1R7J A;  5DCM B;  3HUG B;  4GRI A;  5C4J J;  2W25 A;  1ULY A;  2ACJ A;  2QQA A;  1X1C A;  3O6B B;  4HLX A;  2JTV A;  4FQG A;  1XMA A;  3QP6 A;  4TV7 A;  2XPU A;  1RUO A;  1IF1 A;  1P7I A;  2H09 A;  1XC5 A;  5L3F A;  1KON A;  5EDN A;  1VZ0 A;  1VQ9 I;  1I39 A;  3BCB A;  1I3Q J;  2DA6 A;  2LKS A;  2BGC A;  2ZO4 A;  5JHU A;  3IAM 2;  2NS0 A;  3CO7 C;  2XRL A;  4M3E A;  1RUN A;  3IAS 2;  3CCU I;  2BXY A;  2FQ3 A;  3WG9 A;  1UHW A;  1R9T J;  2Q8K A;  1U2W A;  1OCP A;  1X1B A;  4BXX J;  4A12 A;  3PJR A;  2ZXJ A;  3A0B C;  3A01 A;  3QU3 A;  1RI7 A;  1T33 A;  3SHF A;  1EF4 A;  2VPL A;  3Q9V A;  3WGI A;  2L2O A;  2A6E F;  1U8R A;  1DPR A;  3E6M A;  3D5S C;  2HPM A;  4BE1 A;  1SAN A;  3ASN H;  2HWV A;  2E7W A;  4FHT A;  2W24 A;  4E7Z A;  2QSF X;  2YSR A;  1ZTR A;  4IQJ A;  2JUG A;  3CJN A;  4FE7 A;  1R4M B;  1ZK8 A;  4FIS A;  4JQF A;  5BOX A;  5A2Q Z;  4BDY A;  1YLF A;  3CJQ B;  4OAY A;  1LFB A;  3RDI A;  1S5L C;  4CHU A;  4AC0 A;  2MGQ A;  1HW5 A;  3PQK A;  4HNV A;  1YIO A;  2J5O A;  1ZKG A;  3OYG A;  4HBL A;  3DPL C;  3GVA A;  4P96 A;  4MLO A;  4WCG A;  4KDP A;  1X1A A;  4I09 A;  4Y15 A;  4HW0 A;  2X6X A;  2M45 A;  2EIJ H;  2W7N A;  4XSX F;  3FBI B;  1DDN A;  3F8B A;  3FHZ A;  1EA3 A;  3LSG A;  3C7J A;  1FX7 A;  3IH4 A;  3ZMT A;  4WF2 A;  3HL2 A;  4RMN A;  4A0X A;  5GTH C;  4XID A;  1QBJ A;  2EV0 A;  1ZYR F;  2VC0 A;  2XC7 A;  3TED A;  5LFA A;  1YQA A;  3RJP A;  3JRF A;  1UG2 A;  2O8K A;  5LBQ A;  1V4R A;  2LKX A;  2CQ7 A;  2JN6 A;  1SD5 A;  2PMZ N;  4I99 C;  4XRS A;  2JA2 A;  3GYH X;  3AAF A;  2ZXI A;  1WH7 A;  4D9J A;  2Y0M A;  1UEL B;  2HZT A;  1WPK A;  3DLA A;  1A5J A;  4OAZ A;  1KQ8 A;  1FOK A;  1OR7 C;  1TLH B;  1R22 A;  3N05 A;  3HBL A;  3PNY A;  2WY8 Q;  2E2J J;  3OMY A;  3DPT A;  1BOA A;  1R5I D;  3KE2 A;  3SEZ A;  4B47 A;  4YFN F;  4HX8 A;  4P9U A;  3E7L A;  4RGS A;  3HOV J;  1TBX A;  4CO8 A;  3IV5 A;  3ZQQ A;  2FX0 A;  4AYB N;  2OF7 A;  2NVX J;  2DA4 A;  4IOC F;  5IY5 H;  3E6D A;  2D2W A;  4RM2 A;  2WBM A;  2FBI A;  2M8G X;  3QYE A;  2JMW A;  1ON2 A;  3OSF A;  3CUO A;  2GOX B;  3IRQ A;  4W1U A;  4BH9 A;  3T5X A;  6PAX A;  2MD0 A;  4I0B A;  1Y56 A;  1ZRE A;  1RKT A;  1LDJ A;  1LVA A;  5M3M J;  5DM7 F;  1ETX A;  3KZZ A;  2P6T A;  2BEO A;  2VN2 A;  2ZKZ A;  4II3 A;  1W0T A;  3ZQF A;  2RQP A;  1TQP A;  2JVH A;  4EEF G;  4RAF A;  1SD6 A;  2FA5 A;  4CDG A;  1N78 A;  2CUZ A;  3P5J A;  2NRA C;  3RKX A;  1FC3 A;  4CH7 A;  1T98 A;  4AUX A;  2OA4 A;  4UUT A;  2WWY A;  4EJT A;  4KNY A;  4XOR A;  1BBY A;  2R7S A;  3FXL A;  1KQ0 A;  5E17 F;  4Q4Z F;  2VI6 A;  1DP3 A;  1NHA A;  2ZBK A;  4HRI A;  3BQY A;  1Z7U A;  5CKT A;  2HDD A;  1WJB A;  3IWF A;  4X0G A;  1K4S A;  1QO0 D;  1BIB A;  5CVR A;  5D5W B;  1FLI A;  1O7F A;  4A3F J;  3ABU A;  2FOW A;  2CGP A;  3U9G A;  3M7G A;  4HV5 A;  2OAZ A;  4DBQ A;  4B09 A;  2FRH A;  1T56 A;  4PJN A;  1X2N A;  2PMH A;  2W00 A;  1XX5 A;  2IW5 A;  2Z5U A;  3L7W A;  5JVT A;  4Z2Y A;  2KIF A;  1XDS A;  3RPU A;  2E1N A;  5EYR A;  3DPU A;  1V3F A;  3KFW X;  3A03 A;  2EFP A;  4PFP A;  1IRZ A;  2XRO A;  1U5T A;  2ISY A;  3L09 A;  2ZJP F;  3I54 A;  5K7F A;  2CQQ A;  3NQO A;  3HHG A;  4Q5S F;  2EA4 A;  1A35 A;  4IPA A;  1G3W A;  4OIR F;  3CCR I;  2Y30 A;  3K2Z A;  2OPT A;  4BJ5 C;  1S3J A;  3HPH A;  1I50 J;  4YIR X;  3ZN1 A;  4D1Q A;  4PK4 A;  1M1E B;  3LL7 A;  1LFU P;  5HDN A;  5DUI A;  2WAF A;  2XB5 A;  3CF2 A;  1A04 A;  2AXL A;  3EUH C;  4FCY A;  4JBA A;  3TDZ C;  5L3E A;  3TW7 A;  4UV9 A;  2W48 A;  1T8I A;  2R5Y A;  2V7F A;  4LIU A;  4XBF A;  2R7X A;  1IRG A;  4H0E A;  3CUQ B;  3V4G A;  1W7P D;  3N97 A;  1F36 A;  1VQM I;  1ZG1 A;  3K70 D;  1U5T B;  1I1S A;  3MEX A;  1B6A A;  1DUX C;  1QZZ A;  3IH2 A;  5ED4 A;  4HF1 A;  1BI2 A;  2VJJ A;  1LEA A;  1FTZ A;  2I10 A;  1SVO A;  4DBR A;  2MBF A;  4BYY A;  3DBR B;  1TWC J;  4AD9 A;  3H9G A;  2GXA A;  2JSC A;  3ZQL A;  1GVD A;  4DNC A;  2P5K A;  3OYA A;  3OYK A;  1NG6 A;  4RDU A;  1WH5 A;  3OYJ A;  5EEH A;  1SAU A;  3ABM H;  2XIG A;  4GGG A;  3X2Q H;  2WAQ N;  1J5Y A;  3IC7 A;  4U7D A;  2ELH A;  2VT2 A;  5HLH A;  2Y2Z A;  3FDY A;  3TP0 A;  1Z21 A;  2XDV A;  2Y9Z A;  4Y17 A;  1ETV A;  1LNW A;  3TKY A;  2JA6 J;  4KIF A;  2G7H A;  2G0E A;  3L9F A;  3CC7 I;  2COB A;  4LLL A;  3CMY A;  2RV8 A;  2R93 J;  2JUC A;  4Y52 J;  4EAT A;  2QSG X;  3LA2 A;  2WAD A;  3ZP5 A;  3NWT A;  3WTV C;  4PGG A;  3IL2 A;  2LSO A;  3KP7 A;  2L4A A;  3TO6 A;  1ZN2 A;  2X6Y A;  5K5O A;  5KAI C;  3M8J A;  2B63 J;  3ZN0 A;  3VEP A;  3MKW B;  1YHQ I;  4HA8 A;  4LIT A;  1JJ8 C;  4MFD A;  4IJA A;  5ILV A;  3HTS B;  2HOT A;  1Q1H A;  5ICG A;  1VQN I;  2HGC A;  4BBR J;  3PFY A;  5LEJ A;  2IVM A;  5FLX K;  3WTS C;  1SD7 A;  4ZDO A;  1YJW I;  2H6C A;  2JZY A;  1ON1 A;  4K2E A;  1X3Z B;  3JRE A;  1UMQ A;  3DWL E;  1Y8Q B;  5DM6 F;  2CV1 A;  2BY2 A;  1U3E M;  5IOZ A;  4XKC A;  4G7O F;  2K9S A;  4LJZ F;  4BQO A;  3CME I;  1FBS A;  3IWZ A;  3NWS A;  3O8H A;  4XLP F;  3UNG C;  3SZT A;  5L3D A;  2DMP A;  1Z05 A;  2E19 A;  3FMR A;  3TO7 A;  4R79 A;  3VPR A;  2WB1 N;  2VUM J;  3RI4 A;  4CZZ A;  4M9S A;  4C2T A;  1MBF A;  4Q48 A;  3RPQ A;  1R49 A;  4ZYH A;  1OYY A;  3V8L A;  1REP C;  5E3N A;  1BI1 A;  1BM9 A;  3L00 A;  3E5U A;  4D7N A;  3QPL A;  2M4G A;  4S04 A;  3S3M A;  1SAX A;  2AHQ A;  2R0Q C;  3H3Z A;  4LG3 A;  1P4A A;  3P9C A;  2E2H J;  4ZZD A;  2KHM A;  2Y48 A;  4XLC A;  2DFH A;  2ZSH B;  4HST A;  2IS1 A;  5F27 A;  1UG0 A;  3J7A Y;  1BOB A;  2YX4 A;  1MD0 A;  3HOU J;  3KP3 A;  3I3L A;  4AWX B;  1MSF C;  2WA0 A;  3TMO A;  3FK7 A;  3AKZ A;  5FD5 A;  3GTP J;  2ADU A;  2ZME C;  2PQ8 A;  4PSX A;  2E1M C;  1R71 A;  4A3B J;  1Z1D A;  4BGD A;  2NOJ B;  3HRS A;  2Q2E A;  2QGU A;  3ZGK A;  2OUM A;  1LVK A;  3F8N A;  4XMY A;  3LFU A;  1A36 A;  5DCF A;  1TZL A;  2HYG D;  3WHC A;  4MTD A;  2OJE D;  1RNL A;  3CCV I;  3I4N J;  2M87 A;  4BXF A;  1IC8 A;  2MFZ A;  4KIS A;  1OCO H;  2W4S A;  2K40 A;  1TWG J;  1SFX A;  1KA8 A;  4XKB A;  4PDK A;  2LKP A;  5LRR A;  3BG9 A;  4AIJ A;  2LY2 A;  3SJM A;  1OLT A;  3DQV C;  1ERD A;  3J7Z I;  2GAU A;  2A69 F;  3HKZ N;  5FO5 A;  2LDU A;  3IUO A;  3K4J A;  2FD5 A;  4L9V A;  4XLN F;  2VOD A;  1B4A A;  4A93 J;  3CTA A;  2LF7 A;  1GVJ A;  3A02 A;  5GAE J;  3FXJ A;  5GP9 A;  4ZTF A;  2VKD A;  5J1U A;  4BHC A;  5IPA A;  2IT0 A;  3BWG A;  3DKW A;  4W97 A;  2KIM A;  4XLF A;  3TOB A;  4C2M J;  4XON A;  2VXZ A;  4IQ4 A;  4PUS A;  3R0J A;  3SYT A;  3RKQ A;  3PNT A;  4YEJ A;  1H0M A;  1G8X A;  2M2E A;  3WE3 A;  1KU3 A;  1XGO A;  2JVG A;  4KMU X;  2CG4 A;  2VLA A;  2K5C A;  3FZV A;  5H6Q A;  1R6R A;  4FTH A;  4EJW A;  2R7T A;  3FXK A;  1YIJ I;  2DYR H;  4R1H A;  2XKP A;  1OMI A;  2M9H A;  9ANT A;  3FXR A;  4IHV A;  5LHH A;  2XF5 A;  2VBW A;  5HDK A;  1E0E A;  4WXH A;  1E3O C;  4Y13 A;  1RET A;  3OS2 A;  1X1P A;  3DXJ F;  2EJR A;  1IZ1 A;  3JSO A;  2K9M A;  3DTK A;  3ERE D;  2M0M A;  3S8P A;  5IP7 J;  3S2H J;  2A6H F;  2OD5 A;  5M5W J;  1MBH A;  1MDM A;  4C2U A;  2CWE A;  5FRN A;  1WSU A;  4A3I J;  5D5X B;  2GIV A;  2V1N A;  3M1C A;  3V8J A;  3ZQI A;  5FRM A;  3E0J B;  2BW3 B;  2DT7 B;  3LQR A;  1JUM A;  2RDP A;  4WK8 F;  4L0Y B;  1ZH5 A;  3PIO F;  3G6E I;  3ABT A;  3HM5 A;  2GA1 A;  3AL0 C;  1ZLK A;  2OQG A;  2XAF A;  3ZQC A;  2W85 A;  3FMQ A;  1JJ6 C;  2EIL H;  1OQY A;  5BNG A;  3G1L A;  1ZLJ A;  1PP7 U;  4CYD A;  3OIO A;  1W36 C;  1IUY A;  2GBY A;  3E6C C;  2LRE A;  3PO3 J;  1P92 A;  3PUB A;  5GPC A;  4LD5 A;  2XUB A;  2BXZ A;  1UST A;  1JTY A;  3GLL A;  3RKY A;  3FXM A;  2O7O A;  3BR1 A;  4E7S A;  5HOD A;  1O3R A;  3BTJ A;  4BJT A;  1OKR A;  4D5C A;  2KLO A;  5HLI A;  4S05 A;  2FNP A;  1BL0 A;  2YPR A;  5LGU A;  3ZMU A;  3CCE I;  1MDM B;  1VQL I;  1FJL A;  1J9I A;  2I8D A;  2V1X A;  2NS8 A;  1LJ9 A;  1L3L A;  3GTG J;  3LA3 A;  5CPR B;  1P9Q C;  3CC2 I;  1ZRC A;  1BA5 A;  1TC3 C;  5K5R A;  2M7B A;  3MVP A;  4AID A;  1KU7 A;  1JTX A;  5CJ9 A;  3OL3 A;  3OIP A;  4P5O A;  3COA C;  2R4G A;  4ENM A;  3VWB A;  2NVY J;  1DGW Y;  4YFX F;  5IP9 J;  3CCM I;  2LY1 A;  4JX4 A;  4UUS B;  4LB5 A;  1PVE A;  3H5N A;  4JK1 X;  3U21 A;  1H9T A;  3PIP F;  2E1O A;  4RGR A;  1Z91 A;  5K5Q A;  5HDG A;  1X2M A;  2FXA A;  2ICW G;  5DS9 A;  4HF2 A;  4KT5 C;  1R4N B;  3KEQ A;  4LFU A;  3H5A A;  3KEO A;  2LF8 A;  2ZME A;  3K9T A;  4UV8 A;  4UVA A;  5EEA A;  4JYK A;  4FET A;  3T8T A;  2P7C B;  4NQW B;  2DOE A;  5CQE A;  4Z6Y A;  2DOF A;  1SMT A;  2IEK A;  4II2 A;  1D0X A;  3NAU A;  4MQ9 F;  2PBI A;  3GTM J;  3HXL A;  5KAF C;  3WE2 A;  2IRF G;  3EPZ A;  2ME6 A;  1Y1V J;  2GOM A;  3WTX C;  1G3Y A;  4I02 A;  4B3A A;  2L3D A;  4ZYE A;  5JFR A;  1YIT I;  3DTE A;  2EIK H;  3Q5F A;  1TWF J;  3MKL A;  4YII A;  4A3J J;  3P9I A;  3ABK H;  4ENJ A;  3ZMZ A;  3GCM A;  1ORK A;  2CV0 A;  2K86 A;  3FXO A;  2R7Z J;  4NUB A;  2HTS A;  2D45 A;  2H1L A;  5GAG J;  1ZEL A;  1QU3 A;  1YJ9 I;  2DPD A;  2JJ7 A;  3CCL I;  3GME A;  4IRI A;  2DQR A;  1P4X A;  5IYB J;  2VQG A;  1P7J A;  1HQC A;  2VIX A;  3HRT A;  3SEQ A;  3EUK L;  3WHB A;  2NVU B;  3S93 A;  3BT9 A;  2CJJ A;  3HOZ J;  4RAG A;  2QVO A;  2KPM A;  2X0L A;  4HX4 A;  2PJR B;  3H1C A;  1AA7 A;  1OPC A;  1TQM A;  1HSJ A;  1O4X A;  2TCT A;  3WU2 C;  4BHB A;  1UJ8 A;  2CUE A;  3WU1 B;  2EFQ A;  2M4K A;  3B73 A;  1D0Y A;  1S7O A;  1ZG3 A;  4BDZ A;  3S1Q J;  1BI0 A;  3BY6 A;  2CQN A;  1FY7 A;  2FSW A;  1GXQ A;  2HDC A;  1EH6 A;  1IV6 A;  2FQ4 A;  2EB7 A;  3G71 I;  2VXD A;  3OYF A;  3JTH A;  3ZCO A;  3ZQ7 A;  2R7F A;  4F52 A;  4ZYA A;  1OCZ H;  1J59 A;  2BV6 A;  4C3I J;  4BBS J;  1KQ9 A;  3BG7 A;  1IN7 A;  2O9L A;  4EJU A;  2CMP A;  2LY9 A;  3SFZ A;  2FU4 A;  3JRG A;  3E97 A;  2J5P A;  2NNY A;  1IN4 A;  3TL4 X;  4RAY A;  1OCC H;  3S3N A;  1R5G A;  2DCE A;  2VBY A;  4G7H F;  2VQC A;  3OOU A;  2XF6 A;  4IZZ A;  3B02 A;  5EG0 A;  4E7K A;  3H92 A;  3O3K A;  4ZYD A;  3ABL H;  4RAZ A;  3H3V K;  2LBF A;  4ZZL A;  4IHS A;  2R7V A;  2DA3 A;  2DTZ A;  3RYR A;  3KIO A;  2HXO A;  5FKN A;  1JGS A;  3HZJ A;  2HQR A;  1C0W A;  3CES A;  3E1S A;  2ZB9 A;  4QTR A;  4DYC A;  2LVS A;  1DP7 P;  2OCC H;  2VQH A;  5L3G A;  1WGX A;  3I0T A;  4CCN A;  4RB3 C;  2VE8 A;  2DT6 A;  3U2R A;  4RLF A;  2RVC A;  5FFX A;  2V9K A;  1VQ6 I;  2CSO A;  1KYW A;  4BS9 A;  3NRV A;  2P5V A;  3M07 A;  2V6C A;  4A0Y A;  1EV7 A;  1H9G A;  1L0O C;  1R1T A;  2COM A;  3TQN A;  1OCR H;  2AS5 F;  2HFH A;  3OS0 A;  3A01 B;  2KDZ A;  4HQM A;  2RGV A;  4EJO A;  3J7Y J;  1XB4 A;  2XAJ A;  5AIP A;  3RZO J;  3EYY A;  2ME0 A;  1F1Z A;  4M74 A;  1VND A;  4UB8 C;  5H20 A;  1UHS A;  3CP8 A;  1YX3 A;  2EZL A;  4PSW A;  4PFO A;  3M4O J;  2P7V B;  1QPI A;  1IV8 A;  1B72 A;  2BOL A;  2R7O A;  1ETK A;  3QU6 A;  3HOW J;  3BZ6 A;  2WAE A;  3EQL F;  2JRM A;  2LRD A;  4DW6 A;  1JHF A;  1XGS A;  4E70 A;  2IGN A;  5F1J A;  1B59 A;  3QRF F;  4GDF A;  4M3D A;  3ERM A;  3KYL A;  1V55 H;  4UUV A;  3HIF A;  5AON A;  1H89 C;  3VB2 A;  1N75 A;  3TW6 A;  2Q0O A;  4A69 C;  2KIQ A;  3MMY B;  4U0W A;  4AU7 A;  4BQA A;  1RR8 C;  3MCZ A;  2CUJ A;  1D1B A;  1VTN C;  2GIZ A;  3I71 A;  2IP2 A;  2IXS A;  3DP7 A;  1W5C C;  2VB6 A;  2UWM A;  2IS2 A;  4KJZ A;  4U0V A;  2CFX A;  5KHD A;  3HC7 A;  2ZCW A;  3G73 A;  2HYF A;  2LLK A;  2L7F P;  2Y0S N;  3K70 C;  1IGN A;  2YUS A;  3KLO A;  3I59 A;  3LSM A;  5JHF A;  3HG9 A;  2M34 A;  4CYC A;  1N25 A;  2MC4 A;  2CS3 A;  1Z0X A;  4M3G A;  3GBG A;  4M6X A;  5FKK A;  3G3Z A;  2WV1 A;  4NC6 A;  3UR3 C;  4IO9 F;  5LHG A;  4EMS A;  2PG4 A;  3VDX A;  2F6C A;  1EKE A;  3K4K A;  3LWF A;  3OYI A;  2F5D A;  2EZH A;  3FHN A;  4GXO A;  3LQQ A;  4D0P A;  2DK5 A;  2DMT A;  4IVN A;  3BPX A;  3BZC A;  3IH3 A;  3JRI A;  2Z33 A;  2IGM A;  4BQN A;  2DXI A;  3JRA A;  5K7Z A;  1MW7 A;  1T39 A;  4M6Y A;  1TP4 A;  1F9N A;  5EZG A;  5BMZ A;  2HKX A;  4AVP A;  3TO9 A;  3GTO J;  1XN7 A;  1Y0N A;  1JT0 A;  2EZK A;  4XN3 A;  2DDB A;  5F1R A;  3AG4 H;  3S2D J;  2Z16 A;  4RBO A;  3MZH A;  3M3Y J;  3BJO A;  1WI3 A;  5LRS A;  2X85 A;  2L9R A;  1PDN C;  4PJM A;  3FM3 A;  2R7Q A;  3JTG A;  1QGP A;  3GO5 A;  4ZDP A;  2OQR A;  1EJ9 A;  1YI2 I;  1T08 B;  5F0H A;  2VQL A;  1D1A A;  3FIW A;  1E17 A;  3GF2 A;  1V54 H;  2DFF A;  2HS5 A;  2QUF A;  3F6O A;  1ZGW A;  4IXA A;  3AG1 H;  1XMX A;  2O03 A;  3K1M A;  1GLN A;  4X1E A;  1H8A C;  1KGS A;  3MZY A;  1F4K A;  1IXR C;  3V7C A;  3M1E A;  5E1W A;  1K7A A;  1UHM A;  3JCU C;  5IT9 K;  2ZSI B;  1FOW A;  1SVL A;  5FLX Z;  2ZJR F;  2E34 A;  3LST A;  1VQ4 I;  2ECB A;  3KPH A;  3WTZ A;  5HNF A;  3KZI C;  5D6F A;  4DQ2 A;  1FYM A;  2DOA A;  3E3V A;  4CXF A;  1RKW A;  2HU9 A;  1MBJ A;  4KIC A;  4MTE A;  5JVG F;  3LA7 A;  4RLQ A;  2DOD A;  2LK2 A;  5B1B H;  5D8L B;  5K7H A;  2O6G E;  2ZJ2 A;  1T0F C;  2A07 F;  5TJJ A;  4RB1 A;  3WGG A;  1R00 A;  3GLX A;  5FKO A;  2LD5 A;  4G6Q A;  3L2Q A;  1JHH A;  1K61 A;  4XL9 A;  3HSR A;  4IHY A;  1QQI A;  4MFE A;  1WWX A;  2HNH A;  3CLQ A;  1JKR C;  2PI0 A;  1QZY A;  2RNG A;  4ANJ A;  3H5R A;  4F91 B;  2PX9 A;  3RCO A;  2BE5 F;  2K4B A;  3NAR A;  5CLS A;  1FIA A;  1MNE A;  1QRY A;  2LTP A;  1IN5 A;  4BL0 B;  3DBL B;  1NTC A;  2XGX A;  1IXS B;  1U6G A;  2W84 A;  1RPW A;  1JE8 A;  1TWA J;  4BXU A;  2EBI A;  2IS6 A;  2B7E A;  2NVT J;  2H94 A;  2HOS A;  5J3L A;  1WKM A;  2BYV E;  3Q3S A;  2R5Y B;  2V9V A;  2CH0 A;  5HOO A;  1AKH A;  3ESW B;  1STZ A;  2JK3 A;  2EFO A;  2MD5 A;  1WJC A;  3TP3 A;  3W6V A;  4IHW A;  3SZG A;  3C18 A;  3HEF A;  5DDG A;  2DPU A;  5LHI A;  2M8E A;  2L4M A;  4KIT B;  3S1M J;  2F4M B;  3VSK A;  1I3A A;  1OR7 A;  4N9I A;  3QOP A;  5EJC A;  5BPD A;  4ESF A;  5BS6 A;  2O61 A;  2XAS A;  4E7J A;  4M3B A;  3LFK A;  3F0C A;  2A6T A;  2JPC A;  4FAS D;  2CRG A;  4KIG A;  3HJE A;  2HVR A;  4I98 B;  2IA1 A;  2MC3 A;  1W7P A;  4EM1 A;  2GM4 A;  2XGE A;  2MSY A;  2LOO A;  2OZU A;  2DDA A;  1EH8 A;  1ZAR A;  3BOQ A;  1BR1 A;  1WQ2 A;  2M0C A;  1ETW A;  3IKT A;  4ZJZ A;  1AKH B;  4PJL A;  2PN6 A;  3W2V A;  4BHP A;  1I6X A;  1POG A;  4M9Z A;  1IW7 F;  4QIW N;  5EZH A;  3KP6 A;  5GAD J;  2QQ9 A;  2Y75 A;  3MKY B;  4A3G J;  3I53 A;  1W1W E;  4XRF A;  4Y3O A;  4M6V A;  4HX7 A;  3LAP A;  4L9T A;  1NK3 P;  1LFP A;  2RNJ A;  5LEK A;  3EET A;  3BCA A;  1LQ1 A;  4XOP A;  3OYH A;  2F4I A;  5FJ8 J;  1KU2 A;  2GA2 A;  4XKW A;  3HSF A;  2X1D A;  1KU9 A;  5F6F A;  2PMZ A;  2UXX A;  2EIN H;  1W7P B;  2L9S A;  3PFI A;  1WZ2 A;  2JRT A;  5J1R A;  2EH3 A;  2DU9 A;  2MAB A;  2NNN A;  1QVT A;  3GW2 A;  2P4W A;  1U9N A;  4A5M A;  1O3S A;  4J01 A;  2P8T A;  4M71 A;  3PQJ A;  2LMD A;  4HDU A;  3S17 J;  2DJN A;  2Y31 A;  2LC2 A;  1SMY F;  3U1K A;  4XLE A;  2KT0 A;  5L3C A;  3PSI A;  3BP8 A;  4AYB A;  2HQN A;  3F8C A;  3WU0 A;  1Y6I A;  2IS4 A;  3LSH A;  3QOD A;  2L5Q A;  3J81 Z;  3JRD A;  5E3L A;  4BNC A;  3A0H C;  3HB9 A;  3R6S A;  4O6J A;  1VQ8 I;  2JT1 A;  3BG5 A;  3KYD B;  1D8J A;  4O3M A;  2AO9 A;  1VQP I;  3F23 A;  4ESB A;  1PUF A;  2HTJ A;  3QYB A;  1BIA A;  3G4S I;  2IPQ X;  1MMG A;  2G7U A;  5LD2 C;  1T2K A;  3W2A A;  2D5V A;  1TW3 A;  4JX5 A;  2N8G A;  1YJN I;  2K7L A;  2RC4 A;  2CUF A;  1Y0U A;  4EVI A;  1XDU A;  3BZK A;  3OR1 C;  4HZF A;  3H35 A;  5E8I A;  5LGT A;  2VKE A;  1GT0 C;  3K4C A;  2OZ6 A;  4NDL A;  2CQK A;  1H88 C;  1IN6 A;  1FMW A;  1MBG A;  1MH4 A;  5H2F C;  3VFZ A;  2C6Y A;  3OYC A;  3Q9S A;  4Y7N J;  1A31 A;  1WJ5 A;  1X19 A;  4G8X A;  4EGY A;  4GCV A;  3EUH A;  3RTR A;  2OBP A;  3HOY J;  1GXP A;  3HRU A;  2EA2 A;  2Z2S B;  3I58 A;  4I7H A;  3OYN A;  2KJB A;  3G1M A;  2HXI A;  1T0F A;  3MD2 A;  5DEQ A;  4L9N A;  4DGW B;  1YW7 A;  2F5C A;  3C2G A;  2XF7 A;  5LLQ A;  5E18 F;  4A3C J;  1LUJ B;  2KL4 A;  3MWM A;  1ZR4 A;  5D8K B;  5FGM A;  1GDT A;  1XSD A;  5TRD A;  1K78 A;  3I4M J;  2Q2E B;  3ECH A;  4IHX A;  1OJL A;  2QF7 A;  2BY3 A;  2X51 A;  4LLN A;  3PUF A;  2XHK A;  4UB6 C;  1G3T A;  4RGU A;  5M5Y J;  4U0Y A;  3D5L A;  1Z77 A;  3JAM K;  1S6L A;  2DK8 A;  3GFI A;  2JQ7 A;  1O7L A;  3K0L A;  1Z9C A;  2VL8 A;  3PM1 A;  3E5X A;  1ZRF A;  3L2V A;  3ZXS A;  2PJP A;  4BUP A;  3K10 A;  5F04 A;  4BY7 J;  1D8K A;  3M8F A;  1IRF A;  1LE8 A;  5E20 A;  1P2F A;  2A3S A;  2KZG A;  4A3L J;  4BEH A;  1ONV A;  2I5U A;  4B8X A;  1OCT C;  1FP1 D;  2L02 A;  4V2G A;  4GYI A;  4DYR A;  3LSR A;  1Z67 A;  3SDG A;  3QP5 A;  5IOY A;  4OU0 A;  1CF7 A;  1WRJ A;  2EFW A;  1XMK A;  2MA3 A;  4RB2 C;  1FYL A;  1MH3 A;  3RIR A;  4J19 A;  5K1Y A;  2CFO A;  1YS7 A;  3J80 Z;  3ISP A;  1JXS A;  5F08 A;  3HPG A;  4MHG A;  3OYD A;  1J7K A;  1FSE A;  2H27 A;  4FT8 A;  3CDH A;  4PCQ A;  2BY1 A;  3PO2 J;  4HDV A;  1ZG5 A;  2X1E A;  1FOX A;  2R3S A;  2Q1Z B;  4HEA 2;  3RKW A;  1X1D A;  3CDL A;  3J7A O;  5DYM A;  3VYS B;  2ID6 A;  1SC7 A;  3LSK A;  3ULQ B;  3LMM A;  1YW8 A;  1ZRD A;  4LOC A;  5E1X A;  1B1B A;  5CVJ A;  1XS9 A;  4P1W A;  4GFB A;  4KUM A;  3K6G A;  4C3J J;  2VC1 A;  3RQI A;  4OWR B;  2CW7 A;  2EZI A;  1R36 A;  1PUE E;  2Y69 H;  3MAJ A;  1I5Z A;  2GZW A;  5EF6 A;  2WAQ A;  1FZP B;  2A61 A;  4XLA A;  5B3S H;  4V2F A;  2R7U A;  4RM3 A;  3H0D A;  4MO7 A;  4BAC A;  1AU7 A;  2X6O A;  3O8G A;  4ENK A;  3GZN B;  4C9Y A;  4LG0 A;  1X3W B;  1JGG A;  4D7M A;  4XNF A;  3OIQ A;  5L3B A;  4NC8 A;  1TT0 A;  4BJ6 C;  2NAZ A;  2XPW A;  2BHZ A;  2OCE A;  5FKL A;  4CCJ A;  4DZJ A;  1QA6 A;  4G12 A;  4UXN A;  2O0Y A;  5J1Y A;  1RES A;  4IF4 A;  4IOA F;  2X48 A;  1IG7 A;  3G1O A;  1AOY A;  2K9Q A;  1VQ7 I;  2STT A;  3M8E A; 
#chains in the Genus database with same CATH homology
 5J8C A;  1J75 A;  4YFK F;  4OIP F;  4HF0 A;  4P9F A;  4RS8 A;  1MJ9 A;  1FPQ A;  1B9M A;  1ZAO A;  2YX7 A;  1QNT A;  2ESN A;  4NB5 A;  3JW4 A;  1IN8 A;  2EK5 A;  3ML6 A;  1I27 A;  4AIK A;  4IHT A;  5H6R A;  3LAJ A;  3K1P A;  4LB6 B;  2KIU A;  2RKH A;  3BPV A;  2DBB A;  5HS8 A;  2V79 A;  1WI9 A;  2GQQ A;  3GFM A;  2EV6 A;  2ZME B;  3I64 A;  1U78 A;  4L0Z B;  1S29 A;  4O5V A;  3SZP A;  1SFU A;  2O3F A;  2V1D A;  4UNO A;  3IKV A;  2FF4 A;  2XV4 S;  5ERI A;  5DCM A;  3EYI A;  2PEX A;  3HUG A;  3GEZ A;  4KFC A;  5E1Z B;  2GXB A;  2QBY A;  2HOE A;  1OYI A;  1IXC A;  1IAW A;  1SD4 A;  1HW2 A;  1MJB A;  1XCV A;  4M73 A;  5HS7 A;  2GXG A;  1K79 A;  4IRG A;  3QAH A;  5J8F A;  4L5I A;  5ICC A;  2HR3 A;  4OIQ F;  2FEZ A;  3JSP A;  2VBZ A;  3BJ6 A;  2FOK A;  2QBY B;  4M9X A;  1UCR A;  4G94 A;  2IA0 A;  3KCC A;  3ZMS A;  4N9H A;  3CUQ C;  2PMU A;  2YR2 A;  2DQL A;  5D5V B;  1XD7 A;  4HV6 A;  1U5T C;  2QYO A;  2TDX A;  1S7A A;  4ENN A;  1SFE A;  1FNN A;  5JI6 A;  5BQT A;  1HST A;  5JR3 A;  2DTR A;  5D4S A;  4XSZ F;  2EFN A;  3P9K A;  1FP2 A;  2FBH A;  2M30 A;  4RGX A;  2D1H A;  2IA2 A;  3N4M A;  2HEO A;  3C1D A;  4ON0 A;  4PGH A;  4LK0 F;  1J0R A;  1BI3 A;  4OIO F;  5FD6 A;  4L5J A;  2WC2 A;  3KP2 A;  4LMY A;  4OOI A;  3FM5 A;  1PP8 F;  1E2X A;  3R0A A;  1YW9 A;  2XKO A;  1MKM A;  4A2U A;  4WX9 A;  1LDK B;  3MFK A;  2EV5 A;  3WTT C;  1HKS A;  5IT9 Z;  2P5L C;  4NHJ A;  4CGZ A;  2JPB A;  2PLY A;  3WTW C;  2MLK A;  3U1D A;  2GWR A;  1HBX G;  2XAQ A;  4UVC A;  2K4J A;  4G9Y A;  3BRO A;  3IRR A;  3WGH A;  2ESH A;  3QPT A;  3KP5 A;  3DV8 A;  1FYK A;  4LK1 F;  1LEB A;  4WXC A;  1BN5 A;  2FBK A;  3F72 A;  2K02 A;  1YS6 A;  3KP4 A;  1UFM A;  2OU2 A;  4ASN A;  5DUK A;  3I59 B;  1O3Q A;  1MZB A;  1LB2 A;  1Z6T A;  4RB0 A;  5CYV A;  4UHT A;  5CVI A;  1TTY A;  2MLG A;  5A2Q K;  3ECO A;  2CW0 F;  3HSE A;  1EH7 A;  4HAM A;  4N0B A;  3C3W A;  4Q47 A;  2STW A;  2ZFW A;  2ZNZ A;  1T6S A;  3HYI A;  5F64 A;  3DF8 A;  3T1B A;  2X4H A;  2XVC A;  3QPH A;  2KJC A;  3CO6 C;  3VOD A;  4A0Z A;  3FXU A;  3T0Y A;  3L2C A;  3RYP A;  2E7X A;  2DFI A;  3CUQ A;  2V1U A;  2VOO A;  5IT3 A;  3F8M A;  3HTU A;  2DAO A;  1R5H A;  2DI3 A;  5ICE A;  2QM3 A;  2IJL A;  1O3T A;  1BC7 C;  4LLG F;  2XAH A;  4MEY F;  4GO1 A;  3HHH A;  2LNB A;  5FFZ A;  3R60 A;  1TQI A;  2H6B A;  1XGM A;  4R8H A;  4EM0 B;  2VT3 A;  4MNU A;  2ISZ A;  3K69 A;  4HYE A;  2K27 A;  1YTY A;  1LDD A;  3SXY A;  3CLO A;  5D4R A;  4EGZ A;  4EJV A;  1R1U A;  5DD8 A;  4KIB A;  5BPI A;  3E6B A;  2QZ8 A;  2MH2 A;  2QEN A;  2XAG A;  1RZ4 A;  3OOP A;  4I01 A;  3R4K A;  1MJA A;  2NYX A;  1FSH A;  3ZMD A;  2FMY A;  4KN4 X;  4OMY A;  3EDP A;  3IHU A;  1CGP A;  1MGT A;  2D1V A;  5ILU A;  2L01 A;  2R7D A;  1XGN A;  3I5U A;  2Z9O A;  2RN7 A;  3FWE A;  4HQE A;  3ELK A;  5KK1 A;  1D3Y A;  1ZGA A;  4I0A A;  1P6R A;  4I2O A;  1KYZ A;  1XSX A;  2FNA A;  4WWC A;  4OIN F;  1UB9 A;  3R61 A;  2XRN A;  2L54 A;  4LGW A;  3JAM Z;  4PZJ A;  1ZGJ A;  4L9J A;  4MGR A;  2YU3 A;  5CVV A;  4EQQ A;  1BJA A;  5EEG A;  4OMZ A;  3DEU A;  1HKQ A;  2BBY A;  3FX3 A;  4KN7 X;  4A5N A;  3GZ5 A;  1FBQ A;  4HOB A;  1TW2 A;  5ICF A;  3W6J B;  5CVU A;  3F8F A;  4G6D A;  2DO7 A;  3GUD A;  4CIC A;  2MH9 A;  4P55 A;  4QLC U;  4GYG A;  3E5Q A;  3GFL A;  5DV5 A;  3DFG A;  3O2P E;  5HS9 A;  3K1N A;  1J2X A;  1HKT A;  2W57 A;  1P4W A;  1YG2 A;  4HLY A;  2DT5 A;  3TOA A;  3TGN A;  4F7Z A;  4EV0 A;  3KLN A;  2E1C A;  2F2E A;  3W6K B;  3FF5 A;  2EWN A;  2Z3Y A;  1G3S A;  3OV8 A;  1W5S A;  2ETH A;  1I1G A;  2CO5 A;  4ZH4 F;  5AIQ A;  2Z99 A;  2WV0 A;  4YIF A;  4U7B A;  2F5E A;  3GZ6 A;  1R23 A;  3GWZ A;  5ILS A;  3T8R A;  1USS A;  1D5V A;  5E8G A;  3F22 A;  1YO5 C;  3I4P A;  2B0L A;  3M9A A;  1Z6R A;  2QWW A;  1OYW A;  2WTE A;  4UVB A;  1K78 B;  1RIO H;  4WXD A;  2O8X A;  2QLZ A;  4ETS A;  1BC8 C;  5DD4 A;  2G9W A;  3VOE A;  3P7N A;  4KYW A;  1XSV A;  3WTU C;  3GX4 X;  1HW1 A;  5FB2 A;  3KET A;  3FXQ A;  3HOT A;  3ROU A;  2FE3 A;  3J81 K;  1TNT A;  1B9N A;  2VOP A;  3KZY A;  2UXN A;  2M5W A;  1CF7 B;  1F5T A;  2KRF A;  3F6V A;  1X3U A;  1W4M A;  3D0S A;  2VBX A;  5D6E A;  2PFB A;  1O57 A;  3HRM A;  3WOD F;  5J6X A;  5HVQ C;  2DLL A;  3TDU C;  4L18 B;  2DW4 A;  1W5T A;  4BAY A;  4IRH A;  4AIH A;  2UZK A;  2F5F A;  4FX0 A;  4YG2 F;  4U88 A;  3FMS A;  1GHC A;  3SQN A;  4KA4 A;  4FX4 A;  1FT9 A;  3V7R A;  4KMF A;  4NQW A;  3S2W A;  1FWZ A;  4ESJ A;  4A6D A;  2HKO A;  1YYV A;  5D5U B;  4G7Z F;  1HXD A;  1R1V A;  4LG0 B;  2VON A;  1G6N A;  1K6O A;  3MQ0 A;  2KKO A;  2ZNY A;  1R58 A;  3ZMV A;  4M72 A;  4ZYG A;  3ZPL A;  5KVR A;  3HOS A;  2M1B A;  1G4D A;  4MQV A;  3V8K A;  2VE9 A;  1S8N A;  1QPM A;  3V7S A;  3J80 K;  1FBU A;  1ODD A;  2P6S A;  5HLG A;  3NEU A;  4MEX F;  3GXO A;  5LGN A;  4QWQ A;  4EM2 A;  3GFJ A;  3H3U A;  1TNS A;  3F3X A;  3BDD A;  3WTY C;  2CYY A;  1XCB A;  1AWC A;  1DPU A;  1T38 A;  2A68 F;  1ZHF A;  3REO A;  4A6E A;  3F21 A;  3BJA A;  2A5Y B;  2QQB A;  2FML A;  1YFH A;  1R7J A;  5DCM B;  2W25 A;  1ULY A;  2ACJ A;  2QQA A;  3O6B B;  4HLX A;  2JTV A;  1XMA A;  3QP6 A;  4TV7 A;  1RUO A;  1IF1 A;  2H09 A;  5L3F A;  2BGC A;  2ZO4 A;  5JHU A;  2NS0 A;  3CO7 C;  1RUN A;  2FQ3 A;  3WG9 A;  1UHW A;  2Q8K A;  1U2W A;  4A12 A;  2ZXJ A;  3QU3 A;  1RI7 A;  3SHF A;  3Q9V A;  3WGI A;  2A6E F;  1U8R A;  1DPR A;  3E6M A;  2HWV A;  2E7W A;  4FHT A;  2W24 A;  2YSR A;  3CJN A;  4JQF A;  5BOX A;  5A2Q Z;  1YLF A;  3RDI A;  4CHU A;  1HW5 A;  3PQK A;  1YIO A;  2J5O A;  4HBL A;  3DPL C;  3GVA A;  4P96 A;  4WCG A;  4KDP A;  4Y15 A;  4I09 A;  4HW0 A;  2M45 A;  4XSX F;  1DDN A;  3F8B A;  3FHZ A;  3C7J A;  1FX7 A;  3ZMT A;  4WF2 A;  4A0X A;  1QBJ A;  2EV0 A;  1ZYR F;  2VC0 A;  1YQA A;  3RJP A;  5LBQ A;  1V4R A;  1SD5 A;  3GYH X;  3AAF A;  2Y0M A;  2HZT A;  1KQ8 A;  1FOK A;  1TLH B;  1R22 A;  3DPT A;  1BOA A;  3KE2 A;  4YFN F;  4HX8 A;  4P9U A;  4RGS A;  1TBX A;  4CO8 A;  3E6D A;  2D2W A;  2FBI A;  1ON2 A;  3CUO A;  3IRQ A;  4BH9 A;  3T5X A;  6PAX A;  4I0B A;  1ZRE A;  1LDJ A;  1LVA A;  3KZZ A;  2P6T A;  2BEO A;  2VN2 A;  2ZKZ A;  2RQP A;  1TQP A;  1SD6 A;  2FA5 A;  4CDG A;  2NRA C;  3RKX A;  1FC3 A;  1T98 A;  2OA4 A;  2WWY A;  4EJT A;  4KNY A;  1BBY A;  1KQ0 A;  5E17 F;  4Q4Z F;  1NHA A;  2ZBK A;  1Z7U A;  3IWF A;  1QO0 D;  1BIB A;  5CVR A;  5D5W B;  1FLI A;  1O7F A;  3ABU A;  2CGP A;  3U9G A;  3M7G A;  4HV5 A;  2OAZ A;  4B09 A;  2FRH A;  2PMH A;  3L7W A;  2IW5 A;  2Z5U A;  5JVT A;  4Z2Y A;  2KIF A;  1XDS A;  3RPU A;  2E1N A;  1V3F A;  3KFW X;  2EFP A;  2XRO A;  1U5T A;  2ISY A;  3L09 A;  3I54 A;  3NQO A;  3HHG A;  4Q5S F;  2EA4 A;  4IPA A;  1G3W A;  4OIR F;  3K2Z A;  1S3J A;  3ZN1 A;  5HDN A;  5DUI A;  1A04 A;  2AXL A;  4JBA A;  3TDZ C;  5L3E A;  4UV9 A;  4XBF A;  1IRG A;  4H0E A;  3CUQ B;  3V4G A;  1W7P D;  3N97 A;  1ZG1 A;  1U5T B;  1I1S A;  3MEX A;  1B6A A;  1DUX C;  1QZZ A;  5ED4 A;  4HF1 A;  1BI2 A;  1LEA A;  2MBF A;  4BYY A;  4AD9 A;  2JSC A;  4DNC A;  2P5K A;  5EEH A;  2XIG A;  4GGG A;  1J5Y A;  3IC7 A;  4U7D A;  2ELH A;  2VT2 A;  5HLH A;  4Y17 A;  1LNW A;  3TKY A;  4KIF A;  2G7H A;  3L9F A;  4LLL A;  2RV8 A;  3LA2 A;  3ZP5 A;  3WTV C;  4PGG A;  3IL2 A;  2LSO A;  3KP7 A;  2L4A A;  3TO6 A;  1ZN2 A;  5K5O A;  3ZN0 A;  3VEP A;  4HA8 A;  4IJA A;  5ILV A;  3HTS B;  1Q1H A;  5ICG A;  2HGC A;  5LEJ A;  2IVM A;  5FLX K;  3WTS C;  1SD7 A;  2H6C A;  2JZY A;  1ON1 A;  4K2E A;  1U3E M;  4G7O F;  4LJZ F;  1FBS A;  3IWZ A;  4XLP F;  3SZT A;  5L3D A;  1Z05 A;  3FMR A;  3TO7 A;  4R79 A;  3RI4 A;  4CZZ A;  4M9S A;  4Q48 A;  3RPQ A;  4ZYH A;  1OYY A;  3V8L A;  1REP C;  1BI1 A;  1BM9 A;  3L00 A;  3E5U A;  4S04 A;  1SAX A;  3H3Z A;  1P4A A;  3P9C A;  4ZZD A;  2Y48 A;  2YX4 A;  1MD0 A;  3KP3 A;  4AWX B;  5FD5 A;  2ADU A;  2PQ8 A;  1Z1D A;  3HRS A;  2Q2E A;  3F8N A;  5DCF A;  2HYG D;  4MTD A;  1RNL A;  2M87 A;  1SFX A;  1KA8 A;  4PDK A;  2LKP A;  5LRR A;  4AIJ A;  3DQV C;  2GAU A;  2A69 F;  5FO5 A;  2LDU A;  4XLN F;  4L9V A;  2VOD A;  1B4A A;  3CTA A;  2LF7 A;  1GVJ A;  4BHC A;  2IT0 A;  3BWG A;  3DKW A;  2KIM A;  3TOB A;  2VXZ A;  3R0J A;  1H0M A;  3WE3 A;  1KU3 A;  1XGO A;  4KMU X;  2CG4 A;  3FZV A;  5H6Q A;  4EJW A;  4R1H A;  2XKP A;  1OMI A;  3FXR A;  5LHH A;  2VBW A;  5HDK A;  4WXH A;  4Y13 A;  3DXJ F;  2EJR A;  1IZ1 A;  3JSO A;  3ERE D;  2A6H F;  2OD5 A;  1MDM A;  2CWE A;  1WSU A;  5D5X B;  2GIV A;  3V8J A;  3LQR A;  2RDP A;  4WK8 F;  4L0Y B;  1ZH5 A;  3ABT A;  2GA1 A;  1ZLK A;  2OQG A;  2XAF A;  2W85 A;  3FMQ A;  1ZLJ A;  1PP7 U;  4CYD A;  1IUY A;  3E6C C;  1P92 A;  4LD5 A;  2XUB A;  3RKY A;  1UST A;  1O3R A;  1OKR A;  5HLI A;  4S05 A;  2FNP A;  2YPR A;  5LGU A;  3ZMU A;  1MDM B;  1J9I A;  2V1X A;  1LJ9 A;  1L3L A;  3LA3 A;  1ZRC A;  5K5R A;  1KU7 A;  5CJ9 A;  3COA C;  4P5O A;  4ENM A;  4YFX F;  4LB5 A;  4JK1 X;  1H9T A;  4RGR A;  1Z91 A;  5K5Q A;  5HDG A;  2FXA A;  4HF2 A;  4KT5 C;  3KEQ A;  4LFU A;  3KEO A;  2LF8 A;  2ZME A;  3K9T A;  4UV8 A;  4UVA A;  3T8T A;  2P7C B;  1SMT A;  4MQ9 F;  2PBI A;  3WE2 A;  2IRF G;  3WTX C;  1G3Y A;  4I02 A;  2L3D A;  4ZYE A;  5JFR A;  3Q5F A;  4YII A;  3P9I A;  4ENJ A;  3ZMZ A;  2K86 A;  2D45 A;  2HTS A;  2DPD A;  4IRI A;  2DQR A;  1P4X A;  1HQC A;  3HRT A;  2QVO A;  2X0L A;  4HX4 A;  1OPC A;  1TQM A;  1HSJ A;  4BHB A;  3WU1 B;  2EFQ A;  3B73 A;  1S7O A;  1ZG3 A;  1BI0 A;  3BY6 A;  1FY7 A;  2FSW A;  1GXQ A;  2HDC A;  1EH6 A;  2EB7 A;  3JTH A;  3ZQ7 A;  2R7F A;  1J59 A;  2BV6 A;  1KQ9 A;  1IN7 A;  4EJU A;  3SFZ A;  2FU4 A;  3E97 A;  2J5P A;  2NNY A;  1IN4 A;  4RAY A;  1R5G A;  2VBY A;  4G7H F;  3B02 A;  3H92 A;  3O3K A;  4ZYD A;  4RAZ A;  4IHS A;  4ZZL A;  3RYR A;  1JGS A;  2HQR A;  1C0W A;  1DP7 P;  5L3G A;  3I0T A;  4RB3 C;  2VE8 A;  3U2R A;  2RVC A;  5FFX A;  2CSO A;  1KYW A;  3NRV A;  2P5V A;  2V6C A;  4A0Y A;  1EV7 A;  1H9G A;  1L0O C;  1R1T A;  2COM A;  3TQN A;  2AS5 F;  2HFH A;  4HQM A;  2RGV A;  4EJO A;  1XB4 A;  2XAJ A;  5AIP A;  3EYY A;  1F1Z A;  4M74 A;  5H20 A;  2P7V B;  3QU6 A;  3BZ6 A;  3EQL F;  1JHF A;  1XGS A;  4E70 A;  1B59 A;  3QRF F;  4UUV A;  3HIF A;  5AON A;  3VB2 A;  2Q0O A;  4U0W A;  4BQA A;  3MCZ A;  1VTN C;  3I71 A;  2IP2 A;  3DP7 A;  2UWM A;  4U0V A;  2CFX A;  2ZCW A;  3G73 A;  2HYF A;  3KLO A;  3I59 A;  4M6X A;  3G3Z A;  5LHG A;  4EMS A;  2PG4 A;  3LWF A;  2F5D A;  4GXO A;  3LQQ A;  4D0P A;  2DK5 A;  4IVN A;  3BPX A;  2Z33 A;  1T39 A;  4M6Y A;  1F9N A;  5BMZ A;  2HKX A;  4AVP A;  3TO9 A;  1XN7 A;  5F1R A;  3MZH A;  3BJO A;  5LRS A;  1PDN C;  3FM3 A;  3JTG A;  1QGP A;  3GO5 A;  2OQR A;  1E17 A;  3GF2 A;  3F6O A;  2HS5 A;  2QUF A;  4IXA A;  2O03 A;  3K1M A;  1KGS A;  3MZY A;  1F4K A;  1IXR C;  3V7C A;  3M1E A;  5E1W A;  1K7A A;  1UHM A;  5IT9 K;  5FLX Z;  3LST A;  3WTZ A;  5D6F A;  1FYM A;  4DQ2 A;  4CXF A;  3E3V A;  4KIC A;  4MTE A;  3LA7 A;  2O6G E;  5D8L B;  2ZJ2 A;  2A07 F;  5TJJ A;  4RB1 A;  3WGG A;  1R00 A;  3GLX A;  4G6Q A;  1JHH A;  3HSR A;  1QQI A;  1WWX A;  2PI0 A;  1QZY A;  2BE5 F;  2K4B A;  5CLS A;  1IN5 A;  2XGX A;  1IXS B;  1U6G A;  2W84 A;  1JE8 A;  4BXU A;  2H94 A;  1WKM A;  2BYV E;  2V9V A;  5HOO A;  1STZ A;  2EFO A;  2MD5 A;  3C18 A;  5DDG A;  2DPU A;  5LHI A;  2M8E A;  2L4M A;  1OR7 A;  4N9I A;  3QOP A;  5BPD A;  4ESF A;  5BS6 A;  2O61 A;  2XAS A;  3LFK A;  2JPC A;  4KIG A;  4I98 B;  2IA1 A;  2MC3 A;  1W7P A;  4EM1 A;  2OZU A;  1EH8 A;  1ZAR A;  3BOQ A;  1WQ2 A;  3IKT A;  2PN6 A;  4BHP A;  1I6X A;  4M9Z A;  1IW7 F;  3KP6 A;  2QQ9 A;  2Y75 A;  3I53 A;  4XRF A;  3LAP A;  4HX7 A;  4L9T A;  2RNJ A;  5LEK A;  3EET A;  1LQ1 A;  1KU2 A;  2GA2 A;  3HSF A;  1KU9 A;  5F6F A;  2UXX A;  1W7P B;  3PFI A;  2JRT A;  2DU9 A;  2NNN A;  3GW2 A;  2P4W A;  4A5M A;  1O3S A;  2P8T A;  4M71 A;  3PQJ A;  4HDU A;  1SMY F;  5L3C A;  3BP8 A;  2HQN A;  3F8C A;  3WU0 A;  3J81 Z;  4BNC A;  3R6S A;  4O6J A;  2JT1 A;  1D8J A;  4O3M A;  3F23 A;  4ESB A;  2HTJ A;  1BIA A;  2IPQ X;  2G7U A;  1T2K A;  1TW3 A;  2K7L A;  2RC4 A;  1Y0U A;  4EVI A;  1XDU A;  4HZF A;  5E8I A;  5LGT A;  2OZ6 A;  2CQK A;  1IN6 A;  3VFZ A;  2C6Y A;  3Q9S A;  4G8X A;  4EGY A;  4GCV A;  3EUH A;  3RTR A;  2OBP A;  1GXP A;  3HRU A;  2EA2 A;  3I58 A;  4I7H A;  2KJB A;  1T0F A;  5DEQ A;  4L9N A;  1YW7 A;  2F5C A;  5LLQ A;  5E18 F;  3MWM A;  5D8K B;  5FGM A;  1XSD A;  5TRD A;  1K78 A;  3ECH A;  4LLN A;  2XHK A;  1G3T A;  4RGU A;  4U0Y A;  3D5L A;  3JAM K;  1S6L A;  2DK8 A;  3GFI A;  1O7L A;  3K0L A;  1Z9C A;  3E5X A;  1ZRF A;  2PJP A;  1D8K A;  3M8F A;  1IRF A;  5E20 A;  1P2F A;  2A3S A;  1ONV A;  4B8X A;  1FP1 D;  2L02 A;  4GYI A;  3QP5 A;  4OU0 A;  1CF7 A;  1WRJ A;  2EFW A;  1XMK A;  2MA3 A;  4RB2 C;  1FYL A;  3RIR A;  5K1Y A;  3J80 Z;  1YS7 A;  3ISP A;  1JXS A;  4MHG A;  1J7K A;  1FSE A;  2H27 A;  4FT8 A;  3CDH A;  4PCQ A;  4HDV A;  1ZG5 A;  2R3S A;  3RKW A;  3J7A O;  5DYM A;  3ULQ B;  1ZRD A;  1YW8 A;  5E1X A;  1B1B A;  5CVJ A;  4KUM A;  2VC1 A;  1R36 A;  1PUE E;  3MAJ A;  1I5Z A;  2GZW A;  1FZP B;  2A61 A;  4ENK A;  4LG0 A;  5L3B A;  2NAZ A;  4UXN A;  2O0Y A;  4IF4 A;  1AOY A;  2STT A;  3M8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...