5KVRA

X-ray crystal structure of a fragment (1-75) of a transcriptional regulator pdhr from escherichia coli cft073
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
NAMAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Crystal Structure of a Fragment (1-75) of a Transcriptional Regulator PdhR from Escherichia coli CFT073
rcsb
source organism Escherichia coli o6:h1 (strain cft073 / atcc 700928 / upec)
molecule tags Translation
molecule keywords Pyruvate dehydrogenase complex repressor
total genus 21
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5kvrA00
5FFXA 4RGUA 3E5UA 1FSHA 3HTUA 1ODDA 1FP1D 5H20A 2BV6A 1G3SA 3G73A 1H9TA 3W6KB 2F5EA 1FT9A 2LSOA 4LJZF 4IJAA 3M1EA 4ZH4F 1Q1HA 3T1BA 2P5VA 1EV7A 5L3CA 4WXHA 5CVUA 2RV8A 2FA5A 3MCZA 1Z7UA 5A2QK 4RB2C 2VXZA 1GHCA 3AAFA 1P4XA 1D8KA 2XAJA 3GO5A 3MWMA 4BQAA 4MQVA 3T8RA 3P9IA 1B6AA 5A2QZ 1XDUA 2E7WA 3PFIA 4M9SA 2HQNA 1AOYA 2F5FA 5ICEA 4LLNA 3ECHA 2F2EA 3C18A 2UXXA 1SD5A 1OYWA 4UVAA 1ZLKA 1IUYA 3GYHX 3QRFF 2V1UA 3ECOA 2M8EA 3E5QA 3HSRA 4GGGA 1XN7A 2CG4A 2RKHA 3P9CA 3K1NA 2IA1A 3ZN1A 5DV5A 5DCMA 2K4JA 4ESFA 2G9WA 4AD9A 2HGCA 4KN7X 4G94A 1HSTA 4KYWA 3V4GA 2BEOA 5JFRA 2DO7A 3E6BA 4MNUA 1H9GA 1XB4A 4BHBA 4A0XA 3F6OA 1R23A 4Y15A 4F7ZA 1FBSA 1EH7A 4BAYA 4HAMA 1R5HA 3NRVA 4EMSA 4ENNA 5ERIA 4UVCA 3WTXC 4Q4ZF 2VBXA 1S7OA 4CHUA 1PP8F 1SMYF 3GW2A 3Q9VA 3D5LA 5LGTA 2P5LC 1K7AA 1C0WA 3SFZA 4BH9A 4LGWA 3QU6A 3RYRA 3KP7A 2YX7A 1ZG3A 1FNNA 3F6VA 3E6DA 2K27A 1LDJA 3RJPA 3R60A 1HW2A 2P7CB 2DT5A 1UHWA 3LA2A 4N0BA 2V1XA 2L3DA 2X4HA 2FQ3A 4O6JA 1SFEA 2M45A 4LMYA 3BJAA 1S6LA 5CVJA 3ZMDA 3GFLA 3W6JB 2K02A 5ED4A 1F1ZA 2O03A 3HSFA 4PGGA 3HTSB 1OR7A 4EJOA 3KETA 2X0LA 5F1RA 2FBIA 2YU3A 4ESJA 3KZZA 4RB0A 2P4WA 2VT3A 1ZGAA 1BM9A 1G3YA 2KIFA 1SD6A 3HIFA 1O3QA 1QBJA 2ZNZA 1PUEE 3J80Z 1YG2A 2LDUA 2XGXA 5J8FA 3E97A 2CWEA 1G6NA 2XASA 1T39A 1ZAOA 4LFUA 1YIOA 2JTVA 1V3FA 2PI0A 1XMAA 3DKWA 4ENJA 4G9YA 2ZBKA 2XIGA 4XLNF 2YSRA 3LQRA 5EEHA 4JQFA 2O8XA 2BGCA 3V8KA 2GAUA 1FYKA 2LF7A 5J6XA 2FXAA 4JK1X 4LG0B 2IW5A 3I4PA 3U9GA 5TJJA 3R6SA 5LHGA 4OIOF 3C7JA 3K2ZA 3LQQA 2Q2EA 3TDUC 4WXCA 3DP7A 4FX0A 1USTA 2QYOA 2PJPA 2E1CA 2FBKA 1WQ2A 2P7VB 5K5RA 1KU7A 4KA4A 1LDKB 4I0AA 5E1XA 5HS9A 3F8BA 4Q48A 5BOXA 2ISZA 3R0JA 1ZRDA 5H6QA 3IRRA 3N4MA 2EFOA 3FHZA 4AVPA 2MLGA 4FHTA 2A68F 4RAZA 1P4WA 3IC7A 1UFMA 4ZYDA 3GVAA 5CLSA 3TOBA 2KRFA 3WODF 2DI3A 3K1PA 3DF8A 3L7WA 4BNCA 2DPUA 2ZNYA 1J5YA 4UXNA 2BBYA 2EFWA 3KLOA 2XHKA 5E1WA 3ZPLA 3KCCA 4Q5SF 3EDPA 4L0ZB 3CDHA 4IPAA 4HF0A 2DTRA 1HKSA 2OU2A 4UV9A 3KP6A 1KU2A 4P96A 3V8JA 1R5GA 4IRHA 3WTUC 4HZFA 2EFNA 1OYYA 3F8MA 2VBZA 1F9NA 4KMFA 5JR3A 3O3KA 3M7GA 5D5XB 4EGYA 4NB5A 5DD8A 3GFIA 2DFIA 2Q0OA 3ZMVA 3F8NA 2VBWA 4L5IA 2VBYA 3FM5A 4ASNA 3K1MA 3VB2A 5KVRA 2JPCA 1FBQA 2DW4A 4A6DA 3DEUA 4HW0A 1O3TA 1TNTA 1XGNA 1IXCA 2UXNA 4KFCA 3WTVC 4XSZF 2W85A 1CF7B 3F8FA 4HF1A 1YS7A 1BC7C 2RVCA 3DFGA 5K5OA 2Z33A 2FBHA 1BI2A 3DV8A 5CYVA 4FX4A 3SZTA 4OINF 3CJNA 5E1ZB 3SQNA 3TDZC 1K78A 3FXQA 2A6HF 3H3ZA 2V1DA 3ERED 4RGRA 4KT5C 2HOEA 3R61A 4MGRA 1L0OC 3HSEA 2FNPA 2JT1A 4G6DA 2YPRA 5IT9Z 2V6CA 3I58A 3RI4A 1I5ZA 1JHFA 4AIJA 2UZKA 5ICFA 3I54A 1BI0A 1YYVA 5D6EA 2R7DA 1XDSA 2HKOA 3DPTA 4EJUA 3QOPA 1F4KA 4OIRF 3RKWA 1G3TA 2L02A 5BPIA 2Y0MA 4KMUX 4LB5A 2STTA 4L5JA 2IA0A 4S04A 1T2KA 1BIBA 4ZYHA 4P9FA 5LEJA 2DQLA 1BBYA 2MH9A 3CTAA 3FMSA 1KQ9A 5HS7A 4OMYA 4PCQA 2QBYA 2COMA 5L3DA 1IXRC 4Q47A 1RI7A 4ON0A 3I59A 3PQKA 1GXPA 2E1NA 1OPCA 1VTNC 1WI9A 5DYMA 5LBQA 2QQBA 3MQ0A 4YIIA 2VOPA 1XCBA 2H09A 1KGSA 3HOSA 4YIFA 3BDDA 4EQQA 2F5DA 5HLHA 3J81K 3ABTA 2O6GE 1QPMA 4XBFA 4BHPA 4ZZLA 1IXSB 1EH6A 5F64A 5L3GA 3KP3A 1P92A 4P55A 4EM2A 2Y48A 1KYWA 2Z5UA 1EH8A 2RC4A 2CGPA 1YO5C 3TQNA 1ZRFA 2QZ8A 4WXDA 3L00A 4AIKA 2O3FA 2XROA 5LGUA 1FPQA 1HKTA 3R4KA 1S3JA 4XRFA 4R79A 1FX7A 3ISPA 4LK1F 1LNWA 1T98A 2NNNA 4Y13A 1R7JA 1Z6TA 2IRFG 3KP4A 2GXBA 4UVBA 3DQVC 3IHUA 2HZTA 2J5OA 1SD7A 1SAXA 3QPTA 3I71A 1O3SA 3IKTA 1TBXA 4M71A 5ILVA 4N9IA 3WGHA 2XKPA 2ZCWA 4HBLA 3KP2A 3V7RA 3H92A 1WKMA 2ZXJA 4OMZA 4WWCA 1FYMA 5DD4A 2VC0A 2KJCA 3KZYA 2L54A 2VE8A 5DDGA 1YW7A 4U0WA 4HV5A 2D1HA 1BN5A 3TOAA 3I5UA 1U5TB 2WC2A 2QBYB 3PQJA 1KYZA 1TQMA 1D3YA 1XSXA 3EQLF 2OAZA 2PBIA 2KKOA 4I0BA 2OBPA 5J8CA 4A0YA 3S2WA 4KIFA 4L18B 2DU9A 2MBFA 2EA2A 5E18F 1HW5A 1IZ1A 1P6RA 2PN6A 1USSA 2QLZA 2MA3A 4GYIA 5HDNA 1Z05A 2RQPA 4I01A 1YQAA 1HBXG 5D5UB 1XSVA 2BYVE 3KLNA 2EA4A 2HEOA 2XRNA 3LA7A 4P9UA 4LLLA 3GWZA 1OKRA 3RKXA 1IW7F 2ZFWA 3O6BB 2KIMA 1U2WA 4KUMA 5HS8A 5AIPA 1QZZA 3FM3A 3P7NA 4IVNA 1XGMA 5D4RA 4LLGF 4HLYA 3EETA 1K6OA 4D0PA 5FD6A 3B73A 2HTJA 1J59A 1BC8C 1REPC 2M87A 2VODA 2ZMEA 5FB2A 5HLGA 4CDGA 5LHHA 3ROUA 1MJ9A 3HOTA 3E3VA 2R7FA 4OIPF 3RPUA 2CFXA 1DP7P 3KP5A 1R36A 2XUBA 3VODA 4WCGA 3VFZA 1MDMA 4A5MA 1BIAA 4GO1A 3LAJA 3QP5A 2QQAA 3T8TA 1BOAA 3JAMZ 2PEXA 2XAQA 2O61A 3IRQA 2R3SA 1B9NA 1ZH5A 1MZBA 3WGIA 1S29A 2TDXA 5IT9K 3C1DA 3WGGA 3QAHA 2FMLA 3ZMUA 2XVCA 2L4AA 4YFKF 4AIHA 4RS8A 2PFBA 5TRDA 3RYPA 1LQ1A 2CO5A 1J7KA 1I6XA 3FXRA 4B8XA 5K5QA 5E20A 2LF8A 1B1BA 4EVIA 1ZREA 4NHJA 4Z2YA 4HQEA 1E17A 4HV6A 1LDDA 2HR3A 3RDIA 1RNLA 3GLXA 3LA3A 5ICCA 4PZJA 1QQIA 2PMUA 3MZHA 4ZYGA 4EM1A 4R8HA 4GXOA 1R1VA 1MKMA 2J5PA 3BROA 1WRJA 2M30A 4XSXF 1TW2A 4OIQF 4IXAA 2Y75A 2ZKZA 3FX3A 2VOOA 5DCMB 4EGZA 2JPBA 5ILSA 3DXJF 2XKOA 5D8KB 4A12A 2HWVA 3HRUA 2G7HA 3VOEA 3WG9A 1K78B 1IF1A 4R1HA 1KU9A 3RIRA 3FMQA 1I1GA 5L3FA 3HRMA 3E6CC 4Y17A 2QM3A 2FMYA 1V4RA 2W84A 3T0YA 1BI3A 4ZYEA 2B0LA 5D8LB 4LG0A 2A61A 2HFHA 4ZZDA 4KIBA 5CJ9A 4DNCA 2EV5A 1HXDA 4G7ZF 1E2XA 2ESNA 4KNYA 1YW8A 2K4BA 2G7UA 1P4AA 2LKPA 3K0LA 4PGHA 4EJVA 1UCRA 1DDNA 2FEZA 5LRRA 3BJ6A 4HDVA 3CLOA 1IAWA 2W25A 1F5TA 2AXLA 1I1SA 1XSDA 2HDCA 2DLLA 3FWEA 4G8XA 1ULYA 2GZWA 4FT8A 5FLXZ 3HHHA 5LEKA 5IT3A 3J81Z 4LK0F 5L3BA 4HLXA 2NNYA 1O57A 5HLIA 4MQ9F 2MC3A 1J0RA 4EV0A 4A5NA 2K86A 2VE9A 3I53A 3I0TA 1IN4A 1W7PA 2EV0A 1X3UA 3JW4A 4I2OA 2MD5A 1HSJA 1U6GA 2KIUA 3QU3A 1MD0A 3WU0A 4EJWA 3MFKA 1LJ9A 1DUXC 4JBAA 1FC3A 1ON1A 2YR2A 2P5KA 4IHSA 1FLIA 2Q8KA 3K9TA 5D5VB 3NQOA 1HKQA 4CGZA 1KQ8A 2AS5F 2F5CA 2XAFA 3DPLC 1LB2A 3KE2A 5LHIA 4L9NA 3M8FA 3M9AA 1HQCA 1T38A 1IRFA 2WTEA 3BY6A 3GF2A 3HRSA 3ELKA 1TQPA 5LRSA 2GA2A 1OMIA 1DPUA 4G7OF 3BPXA 2JSCA 1ZRCA 3BZ6A 3NEUA 3Q9SA 3SXYA 3FF5A 2IT0A 2OA4A 4AWXB 2GQQA 4HOBA 1ONVA 2NAZA 1ON2A 1J2XA 1JE8A 3CO7C 2CQKA 2VONA 1NHAA 5FGMA 5KK1A 3J80K 3BPVA 2W57A 3WTWC 1FZPB 2HQRA 3B02A 1H0MA 1W4MA 1O7LA 3WTTC 1T6SA 2QUFA 1RIOH 3RKYA 4ENMA 2A07F 1RUOA 1WSUA 5JI6A 4ENKA 1R1UA 2RNJA 1B9MA 4L0YB 4QWQA 2IVMA 1RUNA 3F23A 5FLXK 2IJLA 3VEPA 1JGSA 4HA8A 3REOA 3V7SA 1S7AA 4M73A 4IHTA 2DQRA 2IP2A 1TW3A 1HW1A 4YFXF 2L01A 1R58A 2DK5A 1FYLA 1DPRA 1O7FA 1LEAA 5K1YA 1Z1DA 6PAXA 1UHMA 3EYYA 1A04A 3F72A 2Z99A 2NS0A 3V7CA 1Z6RA 2P8TA 3QP6A 4M72A 2O0YA 2FOKA 3JSPA 4U7DA 2EFPA 3RPQA 3ZP5A 1U3EM 3F22A 1XMKA 4MHGA 2H27A 2ETHA 2Z9OA 1W7PB 5FD5A 3GEZA 4KIGA 1STZA 2A69F 4BYYA 1AWCA 3I64A 4LD5A 1IN6A 2P6TA 2FRHA 1QNTA 2EJRA 4CXFA 1IRGA 2OD5A 4M6XA 1Z9CA 4O5VA 1ZG5A 5D4SA 1ZLJA 1SFUA 1W5SA 2E7XA 3TO6A 1CF7A 5FO5A 2D45A 2EV6A 4HX4A 1XGOA 2DBBA 2ZMEB 1Y0UA 2NRAC 1Z91A 4G6QA 5AIQA 5EEGA 1ZGJA 3TO7A 4CICA 2FU4A 2RN7A 3R0AA 3EYIA 2PG4A 1YTYA 2RGVA 1KU3A 1YLFA 3E5XA 5CVVA 2P6SA 1R22A 1MDMB 1CGPA 5HDKA 1ZHFA 2HTSA 1MGTA 3JAMK 1U8RA 4O3MA 3TO9A 2WWYA 5L3EA 4CO8A 3LWFA 2PLYA 4MTDA 1TTYA 1GVJA 2Z3YA 2FE3A 1QO0D 2ZJ2A 3WTZA 3SHFA 4DQ2A 3EUHA 4RAYA 4G7HF 1SFXA 3GX4X 1LVAA 2LNBA 3COAC 4I09A 1XGSA 3BOQA 2H6BA 3IWFA 5CVRA 1FOKA 4EM0B 2EFQA 2A6EF 1D5VA 4RGXA 1LEBA 2FNAA 4UHTA 1MJBA 5CVIA 1FY7A 4UUVA 3K69A 3HHGA 2GXGA 5FFZA 2MH2A 2QQ9A 4YFNF 4GYGA 4U0YA 5E17F 4A0ZA 2NYXA 2FF4A 1GXQA 2DPDA 4HF2A 4YG2F 4HX8A 3ZQ7A 3TKYA 3FXUA 4IF4A 2ELHA 3MEXA 3U2RA 1YFHA 2CSOA 3TGNA 4TV7A 3LSTA 5DCFA 2IA2A 4I98B 3U1DA 3WE3A 5F6FA 4HYEA 1J9IA 4UV8A 2HYFA 2OQGA 3IWZA 1FWZA 4IRGA 4L9TA 2GIVA 1FP2A 3BP8A 4WX9A 3BWGA 3WTSC 3GFJA 1YW9A 2QENA 3ZMZA 1P2FA 2EB7A 3SZPA 1SD4A 1IN8A 2JRTA 2D1VA 3H3UA 4EJTA 4KDPA 2ADUA 3WE2A 5LLQA 2PMHA 1BI1A 3ABUA 1ZN2A 3F8CA 2K7LA 4B09A 2QWWA 2M5WA 3HRTA 2GA1A 4I02A 1PDNC 2IPQX 2VC1A 4ETSA 4H0EA 2ZO4A 3OV8A 1BJAA 3G3ZA 3LAPA 5E8GA 5BQTA 2XAHA 1FSEA 2XV4S 3JSOA 1MJAA 2JZYA 4M6YA 4NQWA 4U0VA 4OOIA 3WU1B 3WTYC 5ILUA 1R1TA 1QZYA 1D8JA 4L9JA 2M1BA 5D5WB 1U78A 4N9HA 3CUOA 1U5TC 1IN5A 4HQMA 4ESBA 4IRIA 4KICA 3L09A 4XLPF 1UB9A 2OQRA 3FMRA 3L9FA 5DUIA 2HS5A 5AONA 2C6YA 3KFWX 4CYDA 1ZYRF 1YS6A 2ISYA 3ULQB 1KQ0A 2H94A 1U5TA 2ACJA 5H6RA 5JHUA 1J75A 5LGNA 1K79A 4OU0A 1ZARA 4QLCU 3ZMSA 3OOPA 3T5XA 2STWA 3JTGA 4A6EA 2BE5F 5DUKA 4LB6B 4CZZA 2VN2A 4HX7A 2HKXA 4BHCA 1W7PD 3GXOA 2V79A 5BMZA 1PP7U 1TQIA 4M9XA 3CO6C 4M74A 3O2PE 4RGSA 2GWRA 3GFMA 5HDGA 5JVTA 3I59B 5ICGA 3Q5FA 5BPDA 4MTEA 3L2CA 2ESHA 2OZUA 4WF2A 3CUQB 3F21A 2RDPA 3HYIA 1KA8A 3C3WA 1S8NA 2EWNA 4L9VA 2W24A 1JXSA 1WWXA 1I27A 5E8IA 2EK5A 2OZ6A 2H6CA 3CUQC 4A2UA 5BS6A 2A5YB 1TNSA 1XD7A 2DK8A 2HYGD 3KEOA 3MAJA 1W5TA 2A3SA 4RB1A 4WK8F 4GCVA 3IKVA 3ZN0A 4UNOA 3GZ5A 1RZ4A 4KN4X 2CW0F 3E6MA 1QGPA 5HOOA 4I7HA 3CUQA 1B59A 4MEYF 1B4AA 3JTHA 2MLKA 1ZG1A 3MZYA 3IL2A 3ML6A 3F3XA 1G4DA 2YX4A 2CYYA 1O3RA 1SMTA 4MEXF 4P5OA 3N97A 4U7BA 1XCVA 1FBUA 3FZVA 1G3WA 5DEQA 4BXUA 5HVQC 2DAOA 3P9KA 4PDKA 1JHHA 4K2EA 3GZ6A 4U88A 1R00A 3QPHA 3D0SA 3RTRA 1IN7A 2VT2A 5D6FA 3KEQA 2D2WA 4HDUA 2UWMA 4E70A 2KJBA 2XAGA 3V8LA 2L4MA 3ZMTA 2WV0A 3GUDA 3HUGA 1L3LA 1TLHB 1OYIA 4S05A 4RB3C 2QVOA 3LFKA 3M8EA 3BJOA 3J7AO 4M9ZA 1T0FA 2V9VA 2PQ8A 2FSWA
chains in the Genus database with same CATH superfamily
5FFXA 4RGUA 1D0YA 3E5UA 2YU9J 1MBHA 3HTUA 4ZDPA 1FSHA 1ODDA 1FP1D 3PNVA 5H20A 2BV6A 1G3SA 4OAZA 3GMEA 3G73A 4C2MJ 5FKNA 2VQCA 1H9TA 1FTZA 3PM1A 3W6KB 3ZQFA 2F5EA 1FT9A 2LSOA 4LJZF 3K70C 3HOYJ 4IJAA 2M7AA 2NS7A 1BW5A 1JUMA 1YRNB 5DM7F 4C2TA 1DU0A 3M1EA 2KLOA 4DW6A 4ZH4F 1Q1HA 2XAUA 3T1BA 2P5VA 4G12A 1EV7A 1T0FC 3CLQA 5L3CA 1T8IA 4PJ0C 5FKLA 3BTLA 4WXHA 4KISA 2Y9YA 5CVUA 2RV8A 2R7TA 1DP3A 2FA5A 1VQ5I 3OL3A 3MCZA 1GVDA 1Z7UA 5A2QK 3DCFA 1V54H 4RB2C 4DIQA 2VXZA 1GHCA 3AAFA 1P4XA 5C4XJ 1D8KA 2XAJA 1W0UA 3GO5A 3MWMA 4BQAA 5B1BH 1N78A 4MQVA 3T8RA 2CS3A 1VQOI 3P9IA 3D5SC 1B6AA 5A2QZ 1XDUA 2E7WA 3PFIA 4M9SA 2HQNA 2X85A 2N8GA 1AOYA 1A31A 4QTRA 2F5FA 5ICEA 1POGA 1XMXA 4PJJA 4LLNA 3ECHA 3SYTA 2IGKA 2JUGA 2JA8J 2F2EA 2VJIA 2L5QA 3PO3J 3C18A 1JJ6C 2UXXA 2R4GA 1FMVA 1SD5A 1OYWA 4UVAA 1ZLKA 3A2KA 1IUYA 2B7EA 2RQQA 3CJTB 5CQGA 3GYHX 3QRFF 2V1UA 2Q1ZB 1WI3A 3ECOA 3AL0B 3OYFA 1IRXA 5IP7J 3JRHA 2Z2SB 2M8EA 3A1YA 3ONQA 2ZJPF 3E5QA 3HSRA 1B72B 5B5EC 1K4SA 1OFCX 1ETYA 2KIQA 1WHUA 3H5NA 3Q0UA 3B6CA 4GGGA 1YX3A 2M9HA 1XN7A 2R7VA 2CG4A 4CYCA 2RKHA 3P9CA 3K1NA 2IA1A 4RA2A 3OS0A 1K61A 1SC7A 3ZN1A 2XSJC 5DV5A 2Y30A 5DCMA 2K4JA 4JYKA 4ESFA 4ZJZA 1SAUA 2G9WA 2ECBA 4AD9A 2F5VA 2HGCA 4KN7X 1W1WE 1LFPA 4G94A 4HRIA 1HSTA 4KYWA 1G8XA 1Y1WJ 3V4GA 2BEOA 2E19A 5JFRA 2DO7A 3E6BA 3CCEI 2MYSA 3MN2A 4MNUA 1H9GA 1XB4A 4BHBA 1SVLA 2X48A 3BQZA 4A0XA 1G2HA 1QHHD 3F6OA 4F92B 2HU9A 1R23A 4Y15A 2JN6A 4F7ZA 1F43A 1FBSA 1OCPA 1EH7A 1BOBA 1UG0A 4HAMA 4BAYA 1R5HA 2K3FA 4DBQA 3NRVA 4HNVA 4M3DA 4EMSA 4ENNA 3ABKH 2JA6J 5ERIA 4UVCA 3WTXC 4Q4ZF 2VBXA 1S7OA 4CHUA 1PP8F 4A3GJ 1SMYF 3L2RA 3GW2A 2DOFA 3HOUJ 3Q9VA 3D5LA 5GTHC 2K40A 2WV1A 5LGTA 2P5LC 1QU3A 1K7AA 2W7NA 1MNEA 1C0WA 1ZQ3P 3SFZA 4BH9A 2H8WA 3ZOBA 4LGWA 4LG3A 4LIVA 3QU6A 5J1RA 3RYRA 3KP7A 2YX7A 1T33A 1ZG3A 1FNNA 2WAQN 3DTIA 3F6VA 3G71I 2OTJI 3E6DA 2K27A 2XSDC 1ITYA 3KIOA 1LDJA 4F55A 3RJPA 3R60A 1HW2A 3BG6A 2JA7J 4PFOA 3G1LA 1X2MA 2P7CB 4BQQA 3E1SA 2DT5A 1UHWA 3LA2A 9ANTA 3K4JA 4N0BA 2BW3B 4A3MJ 2V1XA 2L3DA 3CCYA 2X4HA 1UHSA 3GZNB 1U9OA 2QF7A 1OQYA 2H1KA 2R7UA 2FQ3A 4O6JA 1SFEA 2DA7A 2M45A 2V1NA 4LMYA 3BJAA 1S6LA 1V5FA 5CVJA 3ZMDA 2DXIA 2K9LA 3GFLA 1ETOA 3W6JB 2K02A 5ED4A 1WH5A 3VSKA 2X51A 3SDGA 3JRIA 3CCLI 1W5CC 1F1ZA 2O03A 3HSFA 4PGGA 5M3FJ 4E6KG 3HTSB 1OR7A 5M5YJ 3LNQA 4EJOA 3KETA 2HI3A 2X0LA 2R5YB 5F1RA 3OS1A 2HXOA 3ERMA 5J47A 2FBIA 2YU3A 4ESJA 1ZELA 2AXTC 3KZZA 4RB0A 2P4WA 2VT3A 1ZGAA 1BM9A 1G3YA 2KIFA 1SD6A 3HIFA 3PNYA 4MLOA 1H89C 1O3QA 1QBJA 4MFEA 2O9LA 4Z6YA 1UZCA 2ZNZA 1PUEE 3J80Z 1YG2A 2CQXA 2LDUA 2XGXA 4ABZA 3HOVJ 2WADA 4XQFA 3FXMA 2M4KA 2IXSA 5KNLA 5J8FA 3SFIA 2EIJH 2VXDA 1Y8RB 3HGYA 1WJDA 3OYGA 3E97A 3MKLA 4NNJA 2CWEA 1G6NA 2XASA 3Q3SA 2FOWA 2A05A 4H4KC 3KEYA 3CZ6A 5CPRB 1T39A 3ZQCA 1SFOJ 1GV2A 3DTKA 1ZAOA 2JVHA 4LFUA 1R5ID 1YIOA 3PUFA 5F0FA 1HDPA 2XPUA 2JTVA 1V3FA 2TCTA 2PI0A 1XMAA 3GTJJ 1AKHB 1QVUA 3VYTB 3DKWA 3FHNA 2E34A 3FDYA 1I39A 4ENJA 4G9YA 1ETKA 4AC0A 2ZBKA 2XGEA 2XIGA 4XLNF 2YSRA 2LP0A 3LQRA 5EEHA 4JQFA 2O8XA 5J1YA 3VDXA 4BY7J 2Y69H 2BGCA 3SEZA 3V8KA 1MMSA 2R7SA 2XRLA 1WCMJ 3MKYB 2CRGA 2GAUA 1FYKA 1JUPA 2LF7A 3A01B 4QIWN 5J6XA 2IAIA 2FXAA 4JK1X 2IW5A 4LG0B 4BXXJ 3I4PA 2IS2A 2R7QA 3U9GA 5TJJA 1VQPI 1PUFB 4II2A 3R6SA 5LHGA 5GAGJ 4OIOF 1R4MB 3DBHB 2ELJA 1TT5B 3DLLF 3C7JA 3DKXA 2KPMA 3K2ZA 3LQQA 3JRDA 2DODA 2VJ4A 1LKXA 2QKLB 2Q2EA 3TDUC 3FBNB 2YUSA 4WXCA 4II3A 4PJLA 2L9SA 3UNGC 2LLKA 3DP7A 4FX0A 1USTA 4HEA2 2QYOA 2DYSH 3C2BA 3KYLA 2VKDA 2PJPA 1WH7A 5J3LA 3F9KA 2FX0A 2GIZA 2WAFA 4E4HA 2E1CA 2XGCA 4RLQA 3L2QA 2FBKA 1ZTRA 1O4XA 1WQ2A 1F36A 2P7VB 5K5RA 3BCBA 1KU7A 4KA4A 1S7EA 1LDKB 4I0AA 5E1XA 3AL0C 5HS9A 3EUHC 4BU2A 2HXIA 4BE2A 2E1OA 2LREA 3F8BA 4Q48A 5F1JA 1ETWA 5BOXA 2ISZA 1VQ8I 2G0EA 3R0JA 1ZRDA 1JKRC 5H6QA 3IRRA 3N4MA 1BR2A 3QWLA 1K4TA 2EFOA 1LPQA 3FHZA 4AVPA 4BBRJ 2MLGA 3E0JB 2P0WA 3CMAI 2XGDA 3ZQQA 2AQFA 4FHTA 2A68F 2MG4A 4RAZA 2QSGX 2CV1A 1P4WA 2V26A 3GCMA 1Y8QB 3IC7A 4C3IJ 1UFMA 1ENHA 4ZYDA 4HPQA 2DYRH 2ZB9A 3GVAA 1VFCA 3ZQLA 2VPRA 5CLSA 4D5FA 2LKXA 3TOBA 1Y0NA 2KRFA 1E0EA 3WODF 2DI3A 3K1PA 3DF8A 3L7WA 4BNCA 2FQ4A 2DPUA 2ZNYA 2M0CA 3JCUC 1J5YA 1MBGA 4UXNA 2BBYA 3BTJA 2EQRA 1XPXA 3VYRB 2EFWA 5FROA 3S3MA 2OCCH 3KLOA 3PFYA 4BDYA 2DOAA 2XHKA 3HG9A 5E1WA 3ZPLA 3KCCA 2BY3A 3HPHA 4Q5SF 3CC2I 5B3SH 3EDPA 2CQNA 3I4MJ 2VKHA 1EKEA 1S5LC 4L0ZB 3DEWA 2EZKA 3CDHA 4IPAA 2HOSA 3ZXSA 1IV6A 4HF0A 2DTRA 1HKSA 2OU2A 4UV9A 3CCSI 4D7MA 2MW8A 3DKYA 1S72I 3KP6A 1KU2A 4P96A 3TP3A 3V8JA 4AUXA 1R5GA 2ICWG 4RMNA 3W2AA 1MMNA 4IRHA 3WTUC 1TC3C 4HZFA 3I3LA 2KQRA 2EFNA 4JP0A 1P7JA 2KISA 1D1CA 1OYYA 1Z3YA 2VBZA 3F8MA 2CUFA 3NAUA 4XLEA 1F9NA 2L9NA 4KMFA 1E3PA 5JR3A 3O3KA 1QRYA 3GBGA 3M7GA 4FE4A 4DZPA 5D5XB 5F04A 1X1DA 4EGYA 2H1LA 4NB5A 1AHDP 2EILH 3ZCOA 3DBRB 5DD8A 4FCYA 3MKZA 3GFIA 3SZGA 2DFIA 3J7AY 2Q0OA 5CKTA 3ZMVA 3F8NA 2VBWA 4L5IA 4FTHA 2VBYA 3FM5A 1NTCA 4XKBA 2O8KA 2CQQA 4ASNA 3K1MA 2OF7A 5KVRA 1JT6A 3VB2A 2JPCA 1FBQA 2JMWA 4IHYA 1GDTA 1SVOA 2DW4A 2NVUB 4A6DA 2IGOA 2AHQA 2HOAA 3DEUA 4HW0A 1O3TA 4BUPA 1TNTA 1HCRA 1XGNA 2ZXIA 4J19A 1IXCA 2UXNA 4KFCA 3WTVC 4A3EJ 3HOWJ 4C2UA 2W48A 4XSZF 2W85A 3FIWA 1D5YA 1CF7B 2B63J 2ID6A 4JX5A 3H3VK 4DZJA 1H8AC 2GOXB 3BR2A 3IUOA 3F8FA 4HF1A 1YS7A 5GAEJ 1BC7C 4CZCA 4BJ5C 2BY2A 2RVCA 2X6XA 3DFGA 5K5OA 1DQUA 2Z33A 1IO2A 2FBHA 1BI2A 2WY7Q 5IY5H 3DV8A 3S2DJ 1MMGA 5CYVA 2ZJRF 2M8GX 4FX4A 3SZTA 2VJ5A 4D5CA 4OINF 2EZHA 4BDZA 3CJNA 5E1ZB 3SQNA 3TDZC 1K78A 4ZTJA 4IX7A 3FXQA 2A6HF 3H3ZA 2L7FP 1TWGJ 2V1DA 3L2UA 4RGRA 3ERED 1UAAA 4KT5C 2HOEA 3R61A 4MGRA 3V42A 2LTPA 1L0OC 1I6HJ 2V9KA 3A02A 2RAEA 1OCZH 4X6AJ 3HSEA 2FNPA 1QZEA 2JT1A 2YPRA 4G6DA 2CV0A 3RKQA 4IQJA 2IS1A 5IT9Z 1AA7A 4DJAA 3A0HC 2V6CA 2DJIA 3I58A 5EG0B 1I5ZA 3RI4A 1N77A 3J7YJ 3G6EI 1JHFA 2E60A 4AIJA 2UZKA 5ICFA 3H9QA 5JLXA 1HA8A 3I54A 3M3YJ 5F0CA 1BI0A 1MBJA 1YYVA 2WBMA 1WVRA 5D6EA 2R7DA 2QSHX 1XDSA 2HKOA 1FJLA 1S9HA 3K4NA 2EINH 1KZHA 3FXOA 3DPTA 4EJUA 1UMQA 3QOPA 1XX5A 2NVYJ 1F4KA 4HSRA 3HOZJ 1EA3A 4OIRF 3RKWA 1G3TA 1XG1A 2L02A 5BPIA 3D1NI 2KZGA 2Y0MA 5FLVA 3EUKL 4KMUX 2MABA 4LB5A 2STTA 4L5JA 2IA0A 2P81A 4BS9A 2VIXA 4S04A 1T2KA 1BIBA 4ZYHA 4P9FA 5LEJA 2DQLA 1BBYA 3GTLJ 2MH9A 3CTAA 2VL8A 3FMSA 1KQ9A 2LOOA 5HS7A 4OMYA 2DA1A 4PCQA 3EUAA 3ZRGA 1YE9A 4CCNA 3I56I 1Z7LA 2QBYA 2COMA 5L3DA 1IXRC 4Q47A 4F91B 3LSMA 1EJ9A 2K9MA 2BXZA 4PUSA 4MIMA 1RI7A 4DYRA 2GLOA 4ON0A 4OAYA 3I59A 3PQKA 2HOTA 3K2AA 1GXPA 1Q1VA 2E1NA 4XOTA 4YELA 1OPCA 3BG5A 2HPMA 1JKQC 1WJAA 1VTNC 1WI9A 3IV5A 1JTYA 5DYMA 1SANA 5LBQA 2QQBA 3BZCA 3OYEA 3MQ0A 4YIIA 2VOPA 1XCBA 2CJJA 2H09A 3S8PA 2VUMJ 2AO9A 1KGSA 1TT0A 3HOSA 2E2HJ 4DGWB 4KJZA 3HEFA 4YIFA 3BDDA 2GOMA 3HC7A 4EQQA 2F5DA 2L7MP 3OOUA 5HLHA 1MW7A 3ABTA 3J81K 2XB5A 2O6GE 2CU7A 1QPMA 4XBFA 1KONA 3QPLA 4BHPA 4ZZLA 1IXSB 1EH6A 2E36A 5F64A 1MBKA 3G2BA 5L3GA 3KP3A 1P92A 4P55A 4EM2A 1CQTA 1NK3P 1R49A 2Y48A 2XPWA 3TEDA 1KYWA 3DTEA 2Z5UA 4D9JA 4XICA 1EH8A 2RC4A 2CGPA 4CA0A 1YO5C 3TQNA 1ZRFA 2QZ8A 2Z16A 3BTCA 3KX2A 1Z0XA 3RPUD 3ASNH 4WXDA 3L00A 4AIKA 2KP6A 4Y7NJ 2O3FA 4FASD 2XROA 4CCKA 2VKVA 5LGUA 1FPQA 1HKTA 3R4KA 1S3JA 1MNDA 4XRFA 1FX7A 3ISPA 4R79A 4LK1F 1LNWA 1ZK8A 1T98A 3BLYA 1ZR4A 2NNNA 4Y13A 4BACA 3BR5A 1R7JA 2WB1A 1Z6TA 1B72A 2IRFG 2ELKA 4UB8C 2LMDA 5CQEA 3UR3C 3KP4A 3RSNA 2GXBA 4UVBA 3DQVC 2I10A 3IHUA 2HZTA 4IL6C 2E71A 2J5OA 3JR9A 1SD7A 1PUFA 1SAXA 1MMDA 3QPTA 3I71A 3LSPA 5E3MA 3OR1C 4Y52J 1O3SA 3IKTA 1TBXA 4M71A 5EJCA 4BJTA 4AYBN 5ILVA 2DMQA 4N9IA 1VQ9I 2LY9A 4XK4A 1LVKA 3K4LA 3CMMA 3WGHA 2XKPA 4XKVA 2ZCWA 1IGNA 4HBLA 5M5WJ 3KP2A 1D0ZA 3V7RA 3H92A 1WKMA 5EEAA 3OYCA 3KYCB 2ZXJA 1VQLI 4OMZA 2PJRA 4WWCA 4UUSA 3H0GJ 2V9PA 1FYMA 2VQHA 5DD4A 2VC0A 2JWTA 5GP9A 2VLAA 3OYDA 3S3NA 2H8RA 2KJCA 3I9V2 2L54A 3KZYA 3W2VA 4B4CA 4FE7A 4OWRB 1RESA 3RZDJ 2VE8A 5DDGA 1YW7A 4BE0A 4U0WA 5IYDJ 4XRSG 1VQNI 4IOCF 1OCTC 4HV5A 3OYLA 2D1HA 2Y0SN 1BN5A 1ETVA 3TBIA 3TOAA 4IO9F 3I5UA 1U5TB 2WC2A 2QBYB 3PQJA 4XIDA 4M3EA 1KYZA 1TQMA 1D3YA 4V2GA 1IRZA 2UV1A 3LSRA 3GTPJ 2NOJB 1XSXA 3EQLF 2OAZA 2PBIA 2Z1DA 2BVLA 2KKOA 4I0BA 2BXYA 2R93J 2OBPA 2IGNA 1ORKA 5J8CA 3KYDB 3OYJA 4A3FJ 1OCCH 3N05A 3S2WA 3CQZJ 4KIFA 2DU9A 4A0YA 4L18B 3LSHA 2MBFA 2EA2A 3ABMH 3QOEA 5E18F 4AM3A 4NC8A 2NOGA 1HW5A 3OL4A 1IZ1A 1SVMA 3RQ4A 1P6RA 2PN6A 1USSA 3LSIA 2QLZA 2MA3A 2XDVA 4YIRX 4LITA 2JQ7A 2BOLA 3OYNA 4BQOA 4E7LA 4GYIA 5HDNA 4ANJA 1Z05A 2RQPA 4I01A 1YQAA 1HBXG 2HPIA 5E79C 2K9QA 5D5UB 1XSVA 2BYVE 5C3EJ 3HL2A 3KLNA 4DYCA 3DEEA 2EA4A 3CCRI 3H0DA 2R7XA 2B9SA 2BY1A 2W00A 2HEOA 3IH2A 2XRNA 3LA7A 4P9UA 3S1NJ 1HF0A 4LLLA 1D1AA 3BR0A 3M8JA 3I4NJ 4M6VA 3GWZA 1OKRA 3RKXA 1WJ5A 1IW7F 2ZFWA 3O6BB 1Z77A 3PJRA 2KIMA 2K85A 1U2WA 4KUMA 3SEQA 5HS8A 5AIPA 1QZZA 3FM3A 3ZGKA 1WJBA 3P7NA 1FTTA 1ZGWA 4UB6C 2LBFA 1A6IA 4IVNA 3PSFA 1XGMA 4A3CJ 5D4RA 4LLGF 4HLYA 3EETA 1K6OA 4NUBA 4D0PA 2DJNA 2EPFA 1W36C 5FD6A 3B73A 2FJ1A 2HTJA 1J59A 2BHZA 1BC8C 2M87A 4D7NA 1REPC 2VODA 2ZMEA 4IOAF 3KPHA 3IP4B 5FB2A 5HLGA 4CDGA 5KAFC 5LHHA 3G4SI 4PFPA 2ZSHB 3RCOA 1WJFA 3ROUA 1MJ9A 2E35A 2L7KA 4RAFA 5M3MJ 4X0GA 3HOTA 3E3VA 2R7FA 4HNUA 4OIPF 4E7KA 3LL7A 3RPUA 4HNTA 2CFXA 3PO2J 3AKZA 3DPUA 3ASOH 1DP7P 3S17J 4BY1J 3AG2H 4I99C 3TP0A 3B6AA 3KP5A 2FD5A 1R36A 2XUBA 4W97A 3VODA 5IP6A 4WCGA 3VFZA 1MDMA 4GFBA 1MBEA 4A5MA 4ZYAA 1BIAA 3JRAA 4GO1A 4XR6A 3LAJA 1H88C 3QP5A 2QQAA 3HJEA 3T8TA 2KDZA 1BOAA 3JAMZ 2PEXA 4BEHB 2XAQA 3HGGA 2O61A 3IRQA 2R3SA 1B9NA 1ZH5A 1MZBA 2E1MB 2KMUA 3MD2A 1JKPC 1X1BA 1QPIA 3WGIA 1S29A 4YEJA 3Q0WA 2TDXA 5IT9K 2F48A 1ZKGA 2EIKH 1YIJI 4XL9A 3MVPA 3C1DA 3NWTA 2IS4A 3WGGA 1R9TJ 2KDOA 4E7IA 1VQ4I 2MD0A 3QAHA 4XORA 2FMLA 3ZMUA 4IZZA 3OYAA 2XVCA 2L4AA 1IDZA 4YFKF 1RETA 3TL4X 4AIHA 4RS8A 1Z21A 3OS2A 5FJ8J 2PFBA 4CCOA 5TRDA 4ZTFA 3RYPA 1LQ1A 2CO5A 1J7KA 1I6XA 5IPAA 3FXRA 4B8XA 5K5QA 1VNDA 3FXKA 2XF7A 1NH3A 3PNTA 4F3QA 5E20A 2F4OB 3PL8A 3QODA 2LF8A 1B1BA 3U1KA 4EVIA 1DU6A 1FMWA 1ZREA 2KFDA 4NHJA 1MH4A 4Z2YA 1A35A 4S0HB 2X1DA 4HQEA 5EG0A 2IBDA 1ACIA 1E17A 1OR7C 1U8BA 4A3JJ 4HV6A 4AU7A 1LDDA 3H1CA 2HR3A 3RDIA 3CDIA 1RNLA 3GLXA 3LA3A 2R7WA 3H36A 5ICCA 4BQNA 1XTAA 1N75A 3MKWB 4PZJA 1NK2P 1QQIA 1FOYA 2PMUA 3MZHA 1E3HA 4ZYGA 4EM1A 4R8HA 4GXOA 1R1VA 2LH9A 2XF6A 1ZR2A 2DFHA 5GPAA 1Y6IA 2BY0A 1MKMA 3OYBA 2J5PA 3BROA 5HNFA 1WRJA 2M30A 4XSXF 1TW2A 4NQWB 4OIQF 4IXAA 2DT7B 4PSWA 2Y75A 3H9JA 3OIOA 3Q0VA 2ZKZA 3FX3A 2NVQJ 2MFZA 3K4CA 5DCMB 2VOOA 4ZDOA 4EGZA 3HBLA 2JPBA 3FK7A 5ILSA 2VJJA 3JREA 3DXJF 3EPZA 4PK4A 2XKOA 2LY1A 3DU6A 4RLFA 5D8KB 2CQ7A 4A12A 3WHCA 3PSIA 2HWVA 3HRUA 2G7HA 3VOEA 3TW7A 4J01A 1Y56A 2V6EA 3FXJA 3WG9A 1IC8A 1K78B 1IF1A 4R1HA 3ZQHA 1KU9A 3RIRA 3FMQA 1ETQA 3HKZN 4GRIA 4PSXA 1I1GA 5L3FA 2EZIA 1TWHJ 3HRMA 3J7ZI 3K70D 3CJRB 2DCEA 2M4GA 3E6CC 1LFUP 4Y3OA 4BKXA 2ME0A 4Y17A 3LOCA 4AVZA 2CV2A 1X3ZB 1V4RA 1X1AA 2FMYA 2QM3A 2W84A 4IQ4A 3T0YA 3VSLA 4P1WA 1BI3A 5J40A 4ZYEA 2B0LA 5IOZA 5D8LB 1V55H 4LG0A 2A61A 2HFHA 1ERDA 4BEHA 3HUGB 4ZDLA 4ZZDA 1M1EB 4KIBA 5CJ9A 4E7ZA 2Y31A 4DNCA 3GTGJ 2EV5A 1HXDA 4G7ZF 1E2XA 2ESNA 4XM3A 4KNYA 2HDWA 3BR3A 4MFDA 1YW8A 2HVQA 4C9YA 3OIQA 2K4BA 2LY2A 1V5GA 2G7UA 1P4AA 2LKPA 4V19K 2R5ZA 2OV7A 3QPSA 3HB9A 5E3NA 3K0LA 4PGHA 4N4NB 3G1OA 4EJVA 1UCRA 1DDNA 1Y39A 5HODA 2FEZA 5LRRA 3BJ6A 4HDVA 4BGDA 1RR8C 3CLOA 3L2VA 1IAWA 2W25A 1YX5A 3D5RC 4F52A 1JKOC 1OLTA 1F5TA 2AXLA 1I1SA 3S1MJ 2VQGA 4IKFA 1XSDA 2HDCA 4E7JA 2DLLA 4I6ZA 4CCJA 2JRMA 3FWEA 3L2WA 4G8XA 1ULYA 2GZWA 4FT8A 3HHHA 5FLXZ 5LEKA 5IT3A 3J81Z 4LK0F 5HLTA 5L3BA 4HLXA 2M2EA 2NNYA 4M3BA 5IYBJ 5EGOA 3LSKA 1O57A 5HLIA 4MQ9F 2MC3A 1J0RA 2X6OA 4EV0A 5BNGA 4A5NA 3S16J 2K86A 2BVMA 2VE9A 3I53A 3I0TA 1IN4A 1W7PA 5J4VA 2DTZA 2AQEA 2UUZA 2EV0A 1X3UA 1AKHA 3L1PA 3JW4A 2HQ5A 4I2OA 2JVGA 2MD5A 1HSJA 4B43A 3SJMA 1U6GA 1BW6A 1QVTA 4Y4RA 2KIUA 2VB6A 2RREA 5B1AH 3S14J 3QU3A 4CSWA 3W6VA 2LYCA 1MD0A 3IAM2 3WU0A 1W36D 4EJWA 4NBQA 3MFKA 1GT0C 1LJ9A 3X2QH 2F4IA 4NDLA 1DUXC 4JBAA 2DMPA 3FISA 1FC3A 1ON1A 5FKMA 4UY8I 1LFBA 2DMTA 2YR2A 2DOEA 2P5KA 2IEKA 1WJCA 4IHSA 1FLIA 3BG3A 1X58A 2Q8KA 4YRVA 4QPQA 4ZC3A 2ZXHA 2X1EA 3C2GA 3QQAA 2KRCA 2HDDA 1FIAA 1PVEA 2MSYA 3K9TA 5D5VB 3NQOA 3O8GA 2BHYA 2M3AA 1HKQA 1T56A 4CGZA 1KQ8A 4E7SA 2L9RA 1OJLA 1HLVA 2AS5F 2F5CA 2XAFA 3DPLC 3M1CA 1LB2A 3KE2A 5LHIA 3TW6A 4L9NA 1WGXA 2CH0A 3M8FA 3M9AA 4BXFA 2JA2A 3S2HJ 1HQCA 1T38A 3GF2A 3HRSA 1IRFA 2WTEA 3BY6A 2LKSA 3QYFA 3ELKA 1TQPA 5LRSA 5M5XJ 1JI8A 4JOMA 2GA2A 5TISC 1OMIA 2KZVA 3BZKA 1TP4A 3DWLE 4XKCA 2KL4A 1DPUA 1JT0A 3NWSA 4G7OF 3BPXA 2JSCA 1ZRCA 3BZ6A 4RAGA 3UKGA 2DFFA 3NEUA 3Q9SA 1D1BA 2WB1N 1VZ0A 1APLC 2VASA 3MZ8A 5KAIC 3FF5A 3SXYA 2ZFUA 5GADJ 5DS9A 2IT0A 2OA4A 3OWTA 4AWXB 2GQQA 4HOBA 1ONVA 2NAZA 3BR6A 3M4OJ 1ON2A 2NXNB 1J2XA 4B44A 2JK3A 1JE8A 3CO7C 1PYVA 2QQ8A 3VYSB 2LG4A 4XONA 1Z3XA 3OYMA 2CQKA 2PMZA 2VONA 2D5VA 2VKEA 2CUZA 4AYBA 1NHAA 5FGMA 5KK1A 1RC9A 3J80K 3BPVA 2W57A 2R5ZB 2GM4A 2LD5A 4XLFA 3IH4A 3WTWC 1FZPB 1X2NA 2HQRA 3B02A 1H0MA 1W4MA 1O7LA 3WTTC 1T6SA 1EF4A 2QSFX 2NVXJ 2QUFA 1RIOH 3RKYA 4XRSA 4ENMA 2A07F 2L0KA 1RUOA 1WSUA 3QYBA 4QSHA 1X1PA 1NG7A 5JI6A 3A01A 4ENKA 1R1UA 2RNJA 1B9MA 2GBYA 1LE8A 4CCLA 4L0YB 2WAQA 4QWQA 3IAS2 3OMYA 2IVMA 2JJ7A 4BL0B 1RUNA 3F23A 5FLXK 3WU2C 3K4BA 4HSTA 5IP9J 2IJLA 3VEPA 2R0QC 2YS9A 4XRMA 1JGSA 4HA8A 3SDBA 3REOA 3V7SA 1S7AA 4M73A 4F93B 4IHTA 3BR1A 2DQRA 2IP2A 2BZTA 2CFOA 3F0CA 4IEJA 3A03A 2PX9A 1FEXA 1U0JA 4XKWA 1TW3A 1HW1A 4YFXF 2Y9ZA 3GLLA 2L01A 1R58A 2DK5A 1FYLA 1DPRA 3OYKA 1O7FA 1LEAA 3CP8A 5K1YA 4W1UA 1Z1DA 3CP2A 6PAXA 1UHMA 1X4OA 3EYYA 4A3BJ 1A04A 1HDDC 3F72A 1BJZA 2Z99A 2NS0A 3V7CA 1Z6RA 2P8TA 1X1CA 3QP6A 4M72A 2ECCA 4G6TB 1I50J 5EYRA 2O0YA 2FOKA 3JSPA 2BW3A 4U7DA 1LE8B 2EFPA 3RPQA 1RKWA 3OYHA 3ZP5A 3F22A 1U3EM 1VQMI 1XMKA 4MHGA 4LOCA 2EBIA 5K7FA 4A93J 2OC6A 2H27A 2ETHA 2Z9OA 1W7PB 5FD5A 3GEZA 2LVSA 4NC6A 2EH3A 3H5AA 4KIGA 3VPRA 1STZA 2A69F 4BYYA 3K6GA 5H2FC 4XNFA 2DT6A 2HZDA 1AWCA 3I64A 4LD5A 4DBRA 1IN6A 1BR1A 2P6TA 5E3LA 2FRHA 1QNTA 2EJRA 4CXFA 1IRGA 2OD5A 4M6XA 1Z9CA 4O5VA 3M07A 2TRTA 1ZG5A 2OTLI 5D4SA 1ZLJA 3CD6I 1SFUA 1W5SA 5C44J 4EEFG 2E7XA 3CCUI 2WY8Q 3TO6A 1CF7A 3ZR8X 5GTIC 5FO5A 2D45A 5C4JJ 2EV6A 4HX4A 1XGOA 2DBBA 2X6WA 2ZMEB 2QKMB 3S1RJ 1Y0UA 2E2IJ 4XN0A 2NRAC 1RR7A 2M7BA 3LSGA 1IJWC 1HC8A 3E7LA 1Z91A 2DA6A 4G6QA 5AIQA 5EZHA 1WPKA 5EEGA 4X1EA 4PJNA 2I8DA 3HKZA 3GTOJ 1ZGJA 3TO7A 4CICA 4BBSJ 4FQGA 2PMZN 5J1UA 2FU4A 2EIMH 2RN7A 3R0AA 3EYIA 1AU7A 2DMUA 4PJMA 2PG4A 1YTYA 2RGVA 1R71A 1KU3A 2QA4I 3LFUA 1YLFA 3E5XA 5CVVA 2P6SA 2HYJA 1R22A 1MDMB 1CGPA 3BC8A 4EATA 4XMYA 5HDKA 1ZHFA 2HTSA 1MGTA 3JAMK 1U8RA 4O3MA 3TO9A 1OISA 5E3OA 2WWYA 5L3EA 1K83J 4CO8A 3LWFA 2X1CA 2PLYA 4MTDA 1TTYA 1SEUA 4B3XA 4AIDA 1GVJA 2MC4A 3CF5F 2Z3YA 2FE3A 2MGQA 1UELB 3S93A 1B8IB 4J00A 1QO0D 1G59A 2ZJ2A 3U21A 3WTZA 3SHFA 5B66C 4DQ2A 3EUHA 4RAYA 4G7HF 2XC7A 1SFXA 3GX4X 1MMAA 1LVAA 3OSFA 2LNBA 1TZLA 1D0XA 1YOVB 3COAC 2R92J 4I09A 5DTDA 1XGSA 4A3LJ 3BOQA 2H6BA 3IWFA 3FK6A 3MMYB 5CVRA 1FOKA 4EM0B 2EFQA 2KHMA 2A6EF 1D5VA 2R7OA 3FKJA 2E5NA 1QHGA 2NS8A 4RGXA 1Y1VJ 1LEBA 2FNAA 4UHTA 1MJBA 4HG2A 5CVIA 3CF2A 1FY7A 4UUVA 3K69A 5HNHA 3VYUB 3HHGA 2GXGA 5FFZA 3H35A 5FKOA 2MH2A 2QQ9A 3BT9A 4YFNF 4B3AA 2W1OA 4GYGA 4U0YA 5F08A 1VI0A 4FISA 5E17F 4A0ZA 2NYXA 2X9DA 4RDUA 2FF4A 1GXQA 2DPDA 4B47A 4U87A 4HF2A 3FXLA 2NVTJ 4YG2F 4HX8A 3ZQ7A 1R6RA 3TKYA 3FXUA 4IF4A 2ELHA 3S1QJ 3MEXA 3CC4I 4M3FA 3U2RA 1YFHA 5FRNA 2CSOA 3GTQJ 3TGNA 2I5UA 4JX6A 4TV7A 3LSTA 4ITVA 4XLAA 5DCFA 2IA2A 4I98B 5KCMA 3AG1H 5GAHJ 3U1DA 3O8HA 3WE3A 5F6FA 1DGRM 4HYEA 3GTMJ 1J9IA 4UV8A 3FKIJ 1N25A 1IV8A 2HYFA 2OQGA 3IWZA 1FWZA 2QCOA 3ZQGA 2ME6A 4IRGA 4L9TA 3OR2C 2GIVA 1FP2A 3BP8A 5K7ZA 2E2JJ 2WAEA 3W3CA 4WX9A 5TGTA 2XPVA 2O7OA 3BWGA 3OIPA 3WTSC 2A5WA 3GFJA 4CUGA 1UJ8A 3AFHA 1YW9A 4FETA 4RBOA 3I55I 2QENA 1YHQI 3ZMZA 1FIPA 1P2FA 2EB7A 4V2FA 3SZPA 1SD4A 3LMMA 5IOYA 1IN8A 5DM6F 3CMEI 2JRTA 1MSFC 2D1VA 4IHXA 3H3UA 3JRGA 2PJRB 3HPGA 2VQLA 4EJTA 1TWFJ 4KDPA 1A6QA 2ADUA 3TMOA 1YI2I 3C2HA 2WA0A 3BCAA 3AG4H 3WE2A 3DLAA 1NG6A 4L5EA 5LLQA 2PMHA 1HOMA 1GUUA 2Q2EB 1BI1A 3ABUA 1ZN2A 2LK2A 2R5YA 3F8CA 2K7LA 4B09A 3K4MA 2QWWA 4LIUA 2M5WA 1X19A 2Y2ZA 3HRTA 5LD2C 2GA1A 4DOZA 1IUFA 2XF5A 4I02A 3K7AJ 3CCJI 1PDNC 2IPQX 2M0MA 2VC1A 4ETSA 1LUJB 5IYCJ 1A5JA 4H0EA 1VQ7I 2ZO4A 3OV8A 2LRDA 4UUTA 1BJAA 1I3AA 5JHFA 3CMYA 3ESWB 2CUJA 4XLCA 3RZOJ 3GTKJ 2JA5J 3G3ZA 4D1QA 3LAPA 5E8GA 5BQTA 2CMPA 5LFAA 2XAHA 1FSEA 2XV4S 4GDFA 3JSOA 3QYEA 1RKTA 1MJAA 2DDAA 3H9GA 2JZYA 1J09A 1QA6A 4M6YA 1BL0A 4XOPA 3WG7H 1X4PA 4NQWA 4BE1A 1A36A 4KITB 4U0VA 4OOIA 2RNGA 3WU1B 3WTYC 5ILUA 2M34A 2W4SA 2DMNA 1R1TA 1BR4A 3LSJA 1ETXA 2ZMEC 1OCRH 1QZYA 4A69C 1D8JA 2DA5A 1JGGA 4L9JA 3HZJA 2M1BA 5D5WB 1U78A 4N9HA 1JJ8C 3CUOA 1U5TC 1WZ2A 3K10A 3BG9A 1IN5A 2DA4A 1FOWA 4HQMA 4ESBA 1MH3A 4IRIA 2OPTA 4KICA 2LR8A 3NARA 2FUG2 1BA5A 3L09A 3KZIC 4CYCB 2F4MB 1GLNA 2V4JC 5EDNA 4XLPF 2X6YA 4KT6A 1UB9A 2OQRA 3FMRA 3L9FA 1P9QC 5DUIA 2HS5A 5AONA 3CESA 3S32A 1P7IA 5FRMA 2C6YA 3KFWX 4CYDA 3S15J 1ZYRF 2K9NA 1YS6A 3BQYA 2ISYA 1E3OC 1IG7A 3ULQB 1KQ0A 2H94A 1U5TA 4QPOA 2ACJA 5H6RA 1MSEC 5JHUA 2OJED 1J75A 5LGNA 1K79A 4OU0A 1ZARA 1B8IA 3W2WA 1TWAJ 4QLCU 3ZMSA 2ZXWH 3AG3H 3OOPA 3T5XA 2STWA 2JUCA 3JTGA 4A6EA 5J4YA 2BE5F 4Y33A 2E5ZA 2R7ZJ 5DUKA 4LB6B 2LFBA 4CZZA 3PIPF 5FKKA 4IHWA 4JX4A 2VN2A 3HDDA 4HX7A 2HKXA 1SFKA 2L9VA 4BHCA 3WHBA 1YJNI 1W7PD 3GXOA 2IGMA 2V79A 1XC5A 5BMZA 1PP7U 4M3GA 1TQIA 4M9XA 3CO6C 1JUSA 4M74A 3O2PE 4RGSA 1XS9A 2GWRA 3GFMA 3CDLA 5HDGA 5JVTA 3I59B 5ICGA 3OYIA 3Q5FA 5BPDA 4MTEA 3L2CA 2ESHA 2OZUA 2L2OA 4WF2A 3CUQB 1MNMC 1VQKI 2DA2A 3F21A 2RDPA 3HYIA 1KA8A 4IHVA 2ZC2A 3C3WA 5EGOB 1U9NA 1S8NA 1VF9A 2EWNA 3CCQI 2HVSA 1RPWA 2E1MC 4L9VA 2W24A 2XB0X 3G1MA 3RQIA 2HQAA 2DFEA 4B1RA 2VPLA 1JXSA 4RM2A 1WWXA 2KT0A 1UG2A 2L7ZA 1I27A 5E8IA 2DA3A 2EK5A 2OZ6A 2KRHA 2H6CA 5K7HA 3CUQC 4A2UA 5BS6A 3BG7A 2A5YB 3HXLA 4C3JJ 1TNSA 2CW7A 4DYQA 3HOXJ 1XD7A 5JVGF 2DDBA 2DK8A 2HYGD 3KEOA 3JRFA 3MAJA 3PIOF 4A3KJ 3A4CA 1W5TA 3JRBA 4C30A 2A3SA 4RB1A 4WK8F 4GCVA 3IKVA 5EF6A 3ZN0A 4UNOA 3GZ5A 1WFXA 4CCMA 4MO7A 1VQ6I 1RZ4A 4KN4X 2CW0F 3E6MA 1QGPA 1TWCJ 4A3IJ 4NC7A 2HNHA 5HOOA 4I7HA 5KHDA 3CUQA 3DU5A 1B59A 3H5RA 3JRCA 4MEYF 1YJ9I 2R7RA 4RM3A 1B4AA 1MIJA 2K9SA 3JTHA 1W0TA 2MLKA 1ZG1A 3MZYA 2IS6A 3IL2A 3PUBA 1JTXA 3ML6A 4B48A 4UUSB 5FLMJ 3F3XA 5F0HA 1G4DA 2K3PA 4BJ6C 3BTIA 2YX4A 3CC7I 5GPCA 2CYYA 5JLWA 1V5EA 2JSPA 1O3RA 1SMTA 4MEXF 3A0BC 4P5OA 2ZSIB 3OY9A 2CUEA 4XLHA 1XCVA 4U7BA 1FBUA 3N97A 3FZVA 2EZLA 1G3WA 5DEQA 3HM5A 4BXUA 2OUMA 5HVQC 3OSGA 2DAOA 2Y0SA 3CJQB 2HVRA 3P9KA 4PDKA 2QGUA 2W82A 1JHHA 2F6CA 1K6YA 1WJEA 1YITI 4I76A 4K2EA 3ABLH 3GZ6A 4U88A 5F27A 2V7FA 4E7HA 2QEXI 1R00A 3QPHA 1GV5A 4XN3A 2ZJQF 1YJWI 3D0SA 4A3DJ 1T08B 2CW8A 1R4NB 3FBIB 1I3QJ 3RTRA 1IN7A 2COBA 2VT2A 4CH7A 1FOXA 5D6FA 3K4KA 3KEQA 2D2WA 4HDUA 3VWBA 2LBFB 2UWMA 4E70A 1YRNA 2KJBA 2GXAA 2XAGA 3V8LA 2L4MA 3ZMTA 2ID3A 2WV0A 3IH3A 3GUDA 3HUGA 1DGWY 1PJRA 4C3HJ 3ZQIA 2LC2A 1OCOH 1L3LA 1TLHB 1OYIA 2O5RA 1MBFA 1RRJA 3DBLB 5EZGA 4S05A 4RB3C 2K5CA 2QVOA 4N4OB 3LFKA 3M8EA 3CCVI 1T95A 2A6TA 3CCMI 2DN0A 2VI6A 1Z67A 3BJOA 1IDYA 3J7AO 1X3WB 4M9ZA 3P5JA 1TL8A 1T0FA 3S3OA 2V9VA 2PQ8A 2FSWA 2OCEA
chains in the Genus database with same CATH topology
5FFXA 4RGUA 3E5UA 1FSHA 3HTUA 1ODDA 1FP1D 5H20A 2BV6A 1G3SA 3G73A 1H9TA 3W6KB 2F5EA 1FT9A 2LSOA 4LJZF 4IJAA 3M1EA 4ZH4F 1Q1HA 3T1BA 2P5VA 1EV7A 5L3CA 4WXHA 5CVUA 2RV8A 2FA5A 3MCZA 1Z7UA 5A2QK 4RB2C 2VXZA 1GHCA 3AAFA 1P4XA 1D8KA 2XAJA 3GO5A 3MWMA 4BQAA 4MQVA 3T8RA 3P9IA 1B6AA 5A2QZ 1XDUA 2E7WA 3PFIA 4M9SA 2HQNA 1AOYA 2F5FA 5ICEA 4LLNA 3ECHA 2F2EA 3C18A 2UXXA 1SD5A 1OYWA 4UVAA 1ZLKA 1IUYA 3GYHX 3QRFF 2V1UA 3ECOA 2M8EA 3E5QA 3HSRA 4GGGA 1XN7A 2CG4A 2RKHA 3P9CA 3K1NA 2IA1A 3ZN1A 5DV5A 5DCMA 2K4JA 4ESFA 2G9WA 4AD9A 2HGCA 4KN7X 4G94A 1HSTA 4KYWA 3V4GA 2BEOA 5JFRA 2DO7A 3E6BA 4MNUA 1H9GA 1XB4A 4BHBA 4A0XA 3F6OA 1R23A 4Y15A 4F7ZA 1FBSA 1EH7A 4BAYA 4HAMA 1R5HA 3NRVA 4EMSA 4ENNA 5ERIA 4UVCA 3WTXC 4Q4ZF 2VBXA 1S7OA 4CHUA 1PP8F 1SMYF 3GW2A 3Q9VA 3D5LA 5LGTA 2P5LC 1K7AA 1C0WA 3SFZA 4BH9A 4LGWA 3QU6A 3RYRA 3KP7A 2YX7A 1ZG3A 1FNNA 3F6VA 3E6DA 2K27A 1LDJA 3RJPA 3R60A 1HW2A 2P7CB 2DT5A 1UHWA 3LA2A 4N0BA 2V1XA 2L3DA 2X4HA 2FQ3A 4O6JA 1SFEA 2M45A 4LMYA 3BJAA 1S6LA 5CVJA 3ZMDA 3GFLA 3W6JB 2K02A 5ED4A 1F1ZA 2O03A 3HSFA 4PGGA 3HTSB 1OR7A 4EJOA 3KETA 2X0LA 5F1RA 2FBIA 2YU3A 4ESJA 3KZZA 4RB0A 2P4WA 2VT3A 1ZGAA 1BM9A 1G3YA 2KIFA 1SD6A 3HIFA 1O3QA 1QBJA 2ZNZA 1PUEE 3J80Z 1YG2A 2LDUA 2XGXA 5J8FA 3E97A 2CWEA 1G6NA 2XASA 1T39A 1ZAOA 4LFUA 1YIOA 2JTVA 1V3FA 2PI0A 1XMAA 3DKWA 4ENJA 4G9YA 2ZBKA 2XIGA 4XLNF 2YSRA 3LQRA 5EEHA 4JQFA 2O8XA 2BGCA 3V8KA 2GAUA 1FYKA 2LF7A 5J6XA 2FXAA 4JK1X 4LG0B 2IW5A 3I4PA 3U9GA 5TJJA 3R6SA 5LHGA 4OIOF 3C7JA 3K2ZA 3LQQA 2Q2EA 3TDUC 4WXCA 3DP7A 4FX0A 1USTA 2QYOA 2PJPA 2E1CA 2FBKA 1WQ2A 2P7VB 5K5RA 1KU7A 4KA4A 1LDKB 4I0AA 5E1XA 5HS9A 3F8BA 4Q48A 5BOXA 2ISZA 3R0JA 1ZRDA 5H6QA 3IRRA 3N4MA 2EFOA 3FHZA 4AVPA 2MLGA 4FHTA 2A68F 4RAZA 1P4WA 3IC7A 1UFMA 4ZYDA 3GVAA 5CLSA 3TOBA 2KRFA 3WODF 2DI3A 3K1PA 3DF8A 3L7WA 4BNCA 2DPUA 2ZNYA 1J5YA 4UXNA 2BBYA 2EFWA 3KLOA 2XHKA 5E1WA 3ZPLA 3KCCA 4Q5SF 3EDPA 4L0ZB 3CDHA 4IPAA 4HF0A 2DTRA 1HKSA 2OU2A 4UV9A 3KP6A 1KU2A 4P96A 3V8JA 1R5GA 4IRHA 3WTUC 4HZFA 2EFNA 1OYYA 3F8MA 2VBZA 1F9NA 4KMFA 5JR3A 3O3KA 3M7GA 5D5XB 4EGYA 4NB5A 5DD8A 3GFIA 2DFIA 2Q0OA 3ZMVA 3F8NA 2VBWA 4L5IA 2VBYA 3FM5A 4ASNA 3K1MA 3VB2A 5KVRA 2JPCA 1FBQA 2DW4A 4A6DA 3DEUA 4HW0A 1O3TA 1TNTA 1XGNA 1IXCA 2UXNA 4KFCA 3WTVC 4XSZF 2W85A 1CF7B 3F8FA 4HF1A 1YS7A 1BC7C 2RVCA 3DFGA 5K5OA 2Z33A 2FBHA 1BI2A 3DV8A 5CYVA 4FX4A 3SZTA 4OINF 3CJNA 5E1ZB 3SQNA 3TDZC 1K78A 3FXQA 2A6HF 3H3ZA 2V1DA 3ERED 4RGRA 4KT5C 2HOEA 3R61A 4MGRA 1L0OC 3HSEA 2FNPA 2JT1A 4G6DA 2YPRA 5IT9Z 2V6CA 3I58A 3RI4A 1I5ZA 1JHFA 4AIJA 2UZKA 5ICFA 3I54A 1BI0A 1YYVA 5D6EA 2R7DA 1XDSA 2HKOA 3DPTA 4EJUA 3QOPA 1F4KA 4OIRF 3RKWA 1G3TA 2L02A 5BPIA 2Y0MA 4KMUX 4LB5A 2STTA 4L5JA 2IA0A 4S04A 1T2KA 1BIBA 4ZYHA 4P9FA 5LEJA 2DQLA 1BBYA 2MH9A 3CTAA 3FMSA 1KQ9A 5HS7A 4OMYA 4PCQA 2QBYA 2COMA 5L3DA 1IXRC 4Q47A 1RI7A 4ON0A 3I59A 3PQKA 1GXPA 2E1NA 1OPCA 1VTNC 1WI9A 5DYMA 5LBQA 2QQBA 3MQ0A 4YIIA 2VOPA 1XCBA 2H09A 1KGSA 3HOSA 4YIFA 3BDDA 4EQQA 2F5DA 5HLHA 3J81K 3ABTA 2O6GE 1QPMA 4XBFA 4BHPA 4ZZLA 1IXSB 1EH6A 5F64A 5L3GA 3KP3A 1P92A 4P55A 4EM2A 2Y48A 1KYWA 2Z5UA 1EH8A 2RC4A 2CGPA 1YO5C 3TQNA 1ZRFA 2QZ8A 4WXDA 3L00A 4AIKA 2O3FA 2XROA 5LGUA 1FPQA 1HKTA 3R4KA 1S3JA 4XRFA 4R79A 1FX7A 3ISPA 4LK1F 1LNWA 1T98A 2NNNA 4Y13A 1R7JA 1Z6TA 2IRFG 3KP4A 2GXBA 4UVBA 3DQVC 3IHUA 2HZTA 2J5OA 1SD7A 1SAXA 3QPTA 3I71A 1O3SA 3IKTA 1TBXA 4M71A 5ILVA 4N9IA 3WGHA 2XKPA 2ZCWA 4HBLA 3KP2A 3V7RA 3H92A 1WKMA 2ZXJA 4OMZA 4WWCA 1FYMA 5DD4A 2VC0A 2KJCA 3KZYA 2L54A 2VE8A 5DDGA 1YW7A 4U0WA 4HV5A 2D1HA 1BN5A 3TOAA 3I5UA 1U5TB 2WC2A 2QBYB 3PQJA 1KYZA 1TQMA 1D3YA 1XSXA 3EQLF 2OAZA 2PBIA 2KKOA 4I0BA 2OBPA 5J8CA 4A0YA 3S2WA 4KIFA 4L18B 2DU9A 2MBFA 2EA2A 5E18F 1HW5A 1IZ1A 1P6RA 2PN6A 1USSA 2QLZA 2MA3A 4GYIA 5HDNA 1Z05A 2RQPA 4I01A 1YQAA 1HBXG 5D5UB 1XSVA 2BYVE 3KLNA 2EA4A 2HEOA 2XRNA 3LA7A 4P9UA 4LLLA 3GWZA 1OKRA 3RKXA 1IW7F 2ZFWA 3O6BB 2KIMA 1U2WA 4KUMA 5HS8A 5AIPA 1QZZA 3FM3A 3P7NA 4IVNA 1XGMA 5D4RA 4LLGF 4HLYA 3EETA 1K6OA 4D0PA 5FD6A 3B73A 2HTJA 1J59A 1BC8C 1REPC 2M87A 2VODA 2ZMEA 5FB2A 5HLGA 4CDGA 5LHHA 3ROUA 1MJ9A 3HOTA 3E3VA 2R7FA 4OIPF 3RPUA 2CFXA 1DP7P 3KP5A 1R36A 2XUBA 3VODA 4WCGA 3VFZA 1MDMA 4A5MA 1BIAA 4GO1A 3LAJA 3QP5A 2QQAA 3T8TA 1BOAA 3JAMZ 2PEXA 2XAQA 2O61A 3IRQA 2R3SA 1B9NA 1ZH5A 1MZBA 3WGIA 1S29A 2TDXA 5IT9K 3C1DA 3WGGA 3QAHA 2FMLA 3ZMUA 2XVCA 2L4AA 4YFKF 4AIHA 4RS8A 2PFBA 5TRDA 3RYPA 1LQ1A 2CO5A 1J7KA 1I6XA 3FXRA 4B8XA 5K5QA 5E20A 2LF8A 1B1BA 4EVIA 1ZREA 4NHJA 4Z2YA 4HQEA 1E17A 4HV6A 1LDDA 2HR3A 3RDIA 1RNLA 3GLXA 3LA3A 5ICCA 4PZJA 1QQIA 2PMUA 3MZHA 4ZYGA 4EM1A 4R8HA 4GXOA 1R1VA 1MKMA 2J5PA 3BROA 1WRJA 2M30A 4XSXF 1TW2A 4OIQF 4IXAA 2Y75A 2ZKZA 3FX3A 2VOOA 5DCMB 4EGZA 2JPBA 5ILSA 3DXJF 2XKOA 5D8KB 4A12A 2HWVA 3HRUA 2G7HA 3VOEA 3WG9A 1K78B 1IF1A 4R1HA 1KU9A 3RIRA 3FMQA 1I1GA 5L3FA 3HRMA 3E6CC 4Y17A 2QM3A 2FMYA 1V4RA 2W84A 3T0YA 1BI3A 4ZYEA 2B0LA 5D8LB 4LG0A 2A61A 2HFHA 4ZZDA 4KIBA 5CJ9A 4DNCA 2EV5A 1HXDA 4G7ZF 1E2XA 2ESNA 4KNYA 1YW8A 2K4BA 2G7UA 1P4AA 2LKPA 3K0LA 4PGHA 4EJVA 1UCRA 1DDNA 2FEZA 5LRRA 3BJ6A 4HDVA 3CLOA 1IAWA 2W25A 1F5TA 2AXLA 1I1SA 1XSDA 2HDCA 2DLLA 3FWEA 4G8XA 1ULYA 2GZWA 4FT8A 5FLXZ 3HHHA 5LEKA 5IT3A 3J81Z 4LK0F 5L3BA 4HLXA 2NNYA 1O57A 5HLIA 4MQ9F 2MC3A 1J0RA 4EV0A 4A5NA 2K86A 2VE9A 3I53A 3I0TA 1IN4A 1W7PA 2EV0A 1X3UA 3JW4A 4I2OA 2MD5A 1HSJA 1U6GA 2KIUA 3QU3A 1MD0A 3WU0A 4EJWA 3MFKA 1LJ9A 1DUXC 4JBAA 1FC3A 1ON1A 2YR2A 2P5KA 4IHSA 1FLIA 2Q8KA 3K9TA 5D5VB 3NQOA 1HKQA 4CGZA 1KQ8A 2AS5F 2F5CA 2XAFA 3DPLC 1LB2A 3KE2A 5LHIA 4L9NA 3M8FA 3M9AA 1HQCA 1T38A 1IRFA 2WTEA 3BY6A 3GF2A 3HRSA 3ELKA 1TQPA 5LRSA 2GA2A 1OMIA 1DPUA 4G7OF 3BPXA 2JSCA 1ZRCA 3BZ6A 3NEUA 3Q9SA 3SXYA 3FF5A 2IT0A 2OA4A 4AWXB 2GQQA 4HOBA 1ONVA 2NAZA 1ON2A 1J2XA 1JE8A 3CO7C 2CQKA 2VONA 1NHAA 5FGMA 5KK1A 3J80K 3BPVA 2W57A 3WTWC 1FZPB 2HQRA 3B02A 1H0MA 1W4MA 1O7LA 3WTTC 1T6SA 2QUFA 1RIOH 3RKYA 4ENMA 2A07F 1RUOA 1WSUA 5JI6A 4ENKA 1R1UA 2RNJA 1B9MA 4L0YB 4QWQA 2IVMA 1RUNA 3F23A 5FLXK 2IJLA 3VEPA 1JGSA 4HA8A 3REOA 3V7SA 1S7AA 4M73A 4IHTA 2DQRA 2IP2A 1TW3A 1HW1A 4YFXF 2L01A 1R58A 2DK5A 1FYLA 1DPRA 1O7FA 1LEAA 5K1YA 1Z1DA 6PAXA 1UHMA 3EYYA 1A04A 3F72A 2Z99A 2NS0A 3V7CA 1Z6RA 2P8TA 3QP6A 4M72A 2O0YA 2FOKA 3JSPA 4U7DA 2EFPA 3RPQA 3ZP5A 1U3EM 3F22A 1XMKA 4MHGA 2H27A 2ETHA 2Z9OA 1W7PB 5FD5A 3GEZA 4KIGA 1STZA 2A69F 4BYYA 1AWCA 3I64A 4LD5A 1IN6A 2P6TA 2FRHA 1QNTA 2EJRA 4CXFA 1IRGA 2OD5A 4M6XA 1Z9CA 4O5VA 1ZG5A 5D4SA 1ZLJA 1SFUA 1W5SA 2E7XA 3TO6A 1CF7A 5FO5A 2D45A 2EV6A 4HX4A 1XGOA 2DBBA 2ZMEB 1Y0UA 2NRAC 1Z91A 4G6QA 5AIQA 5EEGA 1ZGJA 3TO7A 4CICA 2FU4A 2RN7A 3R0AA 3EYIA 2PG4A 1YTYA 2RGVA 1KU3A 1YLFA 3E5XA 5CVVA 2P6SA 1R22A 1MDMB 1CGPA 5HDKA 1ZHFA 2HTSA 1MGTA 3JAMK 1U8RA 4O3MA 3TO9A 2WWYA 5L3EA 4CO8A 3LWFA 2PLYA 4MTDA 1TTYA 1GVJA 2Z3YA 2FE3A 1QO0D 2ZJ2A 3WTZA 3SHFA 4DQ2A 3EUHA 4RAYA 4G7HF 1SFXA 3GX4X 1LVAA 2LNBA 3COAC 4I09A 1XGSA 3BOQA 2H6BA 3IWFA 5CVRA 1FOKA 4EM0B 2EFQA 2A6EF 1D5VA 4RGXA 1LEBA 2FNAA 4UHTA 1MJBA 5CVIA 1FY7A 4UUVA 3K69A 3HHGA 2GXGA 5FFZA 2MH2A 2QQ9A 4YFNF 4GYGA 4U0YA 5E17F 4A0ZA 2NYXA 2FF4A 1GXQA 2DPDA 4HF2A 4YG2F 4HX8A 3ZQ7A 3TKYA 3FXUA 4IF4A 2ELHA 3MEXA 3U2RA 1YFHA 2CSOA 3TGNA 4TV7A 3LSTA 5DCFA 2IA2A 4I98B 3U1DA 3WE3A 5F6FA 4HYEA 1J9IA 4UV8A 2HYFA 2OQGA 3IWZA 1FWZA 4IRGA 4L9TA 2GIVA 1FP2A 3BP8A 4WX9A 3BWGA 3WTSC 3GFJA 1YW9A 2QENA 3ZMZA 1P2FA 2EB7A 3SZPA 1SD4A 1IN8A 2JRTA 2D1VA 3H3UA 4EJTA 4KDPA 2ADUA 3WE2A 5LLQA 2PMHA 1BI1A 3ABUA 1ZN2A 3F8CA 2K7LA 4B09A 2QWWA 2M5WA 3HRTA 2GA1A 4I02A 1PDNC 2IPQX 2VC1A 4ETSA 4H0EA 2ZO4A 3OV8A 1BJAA 3G3ZA 3LAPA 5E8GA 5BQTA 2XAHA 1FSEA 2XV4S 3JSOA 1MJAA 2JZYA 4M6YA 4NQWA 4U0VA 4OOIA 3WU1B 3WTYC 5ILUA 1R1TA 1QZYA 1D8JA 4L9JA 2M1BA 5D5WB 1U78A 4N9HA 3CUOA 1U5TC 1IN5A 4HQMA 4ESBA 4IRIA 4KICA 3L09A 4XLPF 1UB9A 2OQRA 3FMRA 3L9FA 5DUIA 2HS5A 5AONA 2C6YA 3KFWX 4CYDA 1ZYRF 1YS6A 2ISYA 3ULQB 1KQ0A 2H94A 1U5TA 2ACJA 5H6RA 5JHUA 1J75A 5LGNA 1K79A 4OU0A 1ZARA 4QLCU 3ZMSA 3OOPA 3T5XA 2STWA 3JTGA 4A6EA 2BE5F 5DUKA 4LB6B 4CZZA 2VN2A 4HX7A 2HKXA 4BHCA 1W7PD 3GXOA 2V79A 5BMZA 1PP7U 1TQIA 4M9XA 3CO6C 4M74A 3O2PE 4RGSA 2GWRA 3GFMA 5HDGA 5JVTA 3I59B 5ICGA 3Q5FA 5BPDA 4MTEA 3L2CA 2ESHA 2OZUA 4WF2A 3CUQB 3F21A 2RDPA 3HYIA 1KA8A 3C3WA 1S8NA 2EWNA 4L9VA 2W24A 1JXSA 1WWXA 1I27A 5E8IA 2EK5A 2OZ6A 2H6CA 3CUQC 4A2UA 5BS6A 2A5YB 1TNSA 1XD7A 2DK8A 2HYGD 3KEOA 3MAJA 1W5TA 2A3SA 4RB1A 4WK8F 4GCVA 3IKVA 3ZN0A 4UNOA 3GZ5A 1RZ4A 4KN4X 2CW0F 3E6MA 1QGPA 5HOOA 4I7HA 3CUQA 1B59A 4MEYF 1B4AA 3JTHA 2MLKA 1ZG1A 3MZYA 3IL2A 3ML6A 3F3XA 1G4DA 2YX4A 2CYYA 1O3RA 1SMTA 4MEXF 4P5OA 3N97A 4U7BA 1XCVA 1FBUA 3FZVA 1G3WA 5DEQA 4BXUA 5HVQC 2DAOA 3P9KA 4PDKA 1JHHA 4K2EA 3GZ6A 4U88A 1R00A 3QPHA 3D0SA 3RTRA 1IN7A 2VT2A 5D6FA 3KEQA 2D2WA 4HDUA 2UWMA 4E70A 2KJBA 2XAGA 3V8LA 2L4MA 3ZMTA 2WV0A 3GUDA 3HUGA 1L3LA 1TLHB 1OYIA 4S05A 4RB3C 2QVOA 3LFKA 3M8EA 3BJOA 3J7AO 4M9ZA 1T0FA 2V9VA 2PQ8A 2FSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFX A;  4RGU A;  3E5U A;  1FSH A;  3HTU A;  1ODD A;  1FP1 D;  5H20 A;  2BV6 A;  1G3S A;  3G73 A;  1H9T A;  3W6K B;  2F5E A;  1FT9 A;  2LSO A;  4LJZ F;  4IJA A;  3M1E A;  4ZH4 F;  1Q1H A;  3T1B A;  2P5V A;  1EV7 A;  5L3C A;  4WXH A;  5CVU A;  2RV8 A;  2FA5 A;  3MCZ A;  1Z7U A;  5A2Q K;  4RB2 C;  2VXZ A;  1GHC A;  3AAF A;  1P4X A;  1D8K A;  2XAJ A;  3GO5 A;  3MWM A;  4BQA A;  4MQV A;  3T8R A;  3P9I A;  1B6A A;  5A2Q Z;  1XDU A;  2E7W A;  3PFI A;  4M9S A;  2HQN A;  1AOY A;  2F5F A;  5ICE A;  4LLN A;  3ECH A;  2F2E A;  3C18 A;  2UXX A;  1SD5 A;  1OYW A;  4UVA A;  1ZLK A;  1IUY A;  3GYH X;  3QRF F;  2V1U A;  3ECO A;  2M8E A;  3E5Q A;  3HSR A;  4GGG A;  1XN7 A;  2CG4 A;  2RKH A;  3P9C A;  3K1N A;  2IA1 A;  3ZN1 A;  5DV5 A;  5DCM A;  2K4J A;  4ESF A;  2G9W A;  4AD9 A;  2HGC A;  4KN7 X;  4G94 A;  1HST A;  4KYW A;  3V4G A;  2BEO A;  5JFR A;  2DO7 A;  3E6B A;  4MNU A;  1H9G A;  1XB4 A;  4BHB A;  4A0X A;  3F6O A;  1R23 A;  4Y15 A;  4F7Z A;  1FBS A;  1EH7 A;  4BAY A;  4HAM A;  1R5H A;  3NRV A;  4EMS A;  4ENN A;  5ERI A;  4UVC A;  3WTX C;  4Q4Z F;  2VBX A;  1S7O A;  4CHU A;  1PP8 F;  1SMY F;  3GW2 A;  3Q9V A;  3D5L A;  5LGT A;  2P5L C;  1K7A A;  1C0W A;  3SFZ A;  4BH9 A;  4LGW A;  3QU6 A;  3RYR A;  3KP7 A;  2YX7 A;  1ZG3 A;  1FNN A;  3F6V A;  3E6D A;  2K27 A;  1LDJ A;  3RJP A;  3R60 A;  1HW2 A;  2P7C B;  2DT5 A;  1UHW A;  3LA2 A;  4N0B A;  2V1X A;  2L3D A;  2X4H A;  2FQ3 A;  4O6J A;  1SFE A;  2M45 A;  4LMY A;  3BJA A;  1S6L A;  5CVJ A;  3ZMD A;  3GFL A;  3W6J B;  2K02 A;  5ED4 A;  1F1Z A;  2O03 A;  3HSF A;  4PGG A;  3HTS B;  1OR7 A;  4EJO A;  3KET A;  2X0L A;  5F1R A;  2FBI A;  2YU3 A;  4ESJ A;  3KZZ A;  4RB0 A;  2P4W A;  2VT3 A;  1ZGA A;  1BM9 A;  1G3Y A;  2KIF A;  1SD6 A;  3HIF A;  1O3Q A;  1QBJ A;  2ZNZ A;  1PUE E;  3J80 Z;  1YG2 A;  2LDU A;  2XGX A;  5J8F A;  3E97 A;  2CWE A;  1G6N A;  2XAS A;  1T39 A;  1ZAO A;  4LFU A;  1YIO A;  2JTV A;  1V3F A;  2PI0 A;  1XMA A;  3DKW A;  4ENJ A;  4G9Y A;  2ZBK A;  2XIG A;  4XLN F;  2YSR A;  3LQR A;  5EEH A;  4JQF A;  2O8X A;  2BGC A;  3V8K A;  2GAU A;  1FYK A;  2LF7 A;  5J6X A;  2FXA A;  4JK1 X;  4LG0 B;  2IW5 A;  3I4P A;  3U9G A;  5TJJ A;  3R6S A;  5LHG A;  4OIO F;  3C7J A;  3K2Z A;  3LQQ A;  2Q2E A;  3TDU C;  4WXC A;  3DP7 A;  4FX0 A;  1UST A;  2QYO A;  2PJP A;  2E1C A;  2FBK A;  1WQ2 A;  2P7V B;  5K5R A;  1KU7 A;  4KA4 A;  1LDK B;  4I0A A;  5E1X A;  5HS9 A;  3F8B A;  4Q48 A;  5BOX A;  2ISZ A;  3R0J A;  1ZRD A;  5H6Q A;  3IRR A;  3N4M A;  2EFO A;  3FHZ A;  4AVP A;  2MLG A;  4FHT A;  2A68 F;  4RAZ A;  1P4W A;  3IC7 A;  1UFM A;  4ZYD A;  3GVA A;  5CLS A;  3TOB A;  2KRF A;  3WOD F;  2DI3 A;  3K1P A;  3DF8 A;  3L7W A;  4BNC A;  2DPU A;  2ZNY A;  1J5Y A;  4UXN A;  2BBY A;  2EFW A;  3KLO A;  2XHK A;  5E1W A;  3ZPL A;  3KCC A;  4Q5S F;  3EDP A;  4L0Z B;  3CDH A;  4IPA A;  4HF0 A;  2DTR A;  1HKS A;  2OU2 A;  4UV9 A;  3KP6 A;  1KU2 A;  4P96 A;  3V8J A;  1R5G A;  4IRH A;  3WTU C;  4HZF A;  2EFN A;  1OYY A;  3F8M A;  2VBZ A;  1F9N A;  4KMF A;  5JR3 A;  3O3K A;  3M7G A;  5D5X B;  4EGY A;  4NB5 A;  5DD8 A;  3GFI A;  2DFI A;  2Q0O A;  3ZMV A;  3F8N A;  2VBW A;  4L5I A;  2VBY A;  3FM5 A;  4ASN A;  3K1M A;  3VB2 A;  5KVR A;  2JPC A;  1FBQ A;  2DW4 A;  4A6D A;  3DEU A;  4HW0 A;  1O3T A;  1TNT A;  1XGN A;  1IXC A;  2UXN A;  4KFC A;  3WTV C;  4XSZ F;  2W85 A;  1CF7 B;  3F8F A;  4HF1 A;  1YS7 A;  1BC7 C;  2RVC A;  3DFG A;  5K5O A;  2Z33 A;  2FBH A;  1BI2 A;  3DV8 A;  5CYV A;  4FX4 A;  3SZT A;  4OIN F;  3CJN A;  5E1Z B;  3SQN A;  3TDZ C;  1K78 A;  3FXQ A;  2A6H F;  3H3Z A;  2V1D A;  3ERE D;  4RGR A;  4KT5 C;  2HOE A;  3R61 A;  4MGR A;  1L0O C;  3HSE A;  2FNP A;  2JT1 A;  4G6D A;  2YPR A;  5IT9 Z;  2V6C A;  3I58 A;  3RI4 A;  1I5Z A;  1JHF A;  4AIJ A;  2UZK A;  5ICF A;  3I54 A;  1BI0 A;  1YYV A;  5D6E A;  2R7D A;  1XDS A;  2HKO A;  3DPT A;  4EJU A;  3QOP A;  1F4K A;  4OIR F;  3RKW A;  1G3T A;  2L02 A;  5BPI A;  2Y0M A;  4KMU X;  4LB5 A;  2STT A;  4L5J A;  2IA0 A;  4S04 A;  1T2K A;  1BIB A;  4ZYH A;  4P9F A;  5LEJ A;  2DQL A;  1BBY A;  2MH9 A;  3CTA A;  3FMS A;  1KQ9 A;  5HS7 A;  4OMY A;  4PCQ A;  2QBY A;  2COM A;  5L3D A;  1IXR C;  4Q47 A;  1RI7 A;  4ON0 A;  3I59 A;  3PQK A;  1GXP A;  2E1N A;  1OPC A;  1VTN C;  1WI9 A;  5DYM A;  5LBQ A;  2QQB A;  3MQ0 A;  4YII A;  2VOP A;  1XCB A;  2H09 A;  1KGS A;  3HOS A;  4YIF A;  3BDD A;  4EQQ A;  2F5D A;  5HLH A;  3J81 K;  3ABT A;  2O6G E;  1QPM A;  4XBF A;  4BHP A;  4ZZL A;  1IXS B;  1EH6 A;  5F64 A;  5L3G A;  3KP3 A;  1P92 A;  4P55 A;  4EM2 A;  2Y48 A;  1KYW A;  2Z5U A;  1EH8 A;  2RC4 A;  2CGP A;  1YO5 C;  3TQN A;  1ZRF A;  2QZ8 A;  4WXD A;  3L00 A;  4AIK A;  2O3F A;  2XRO A;  5LGU A;  1FPQ A;  1HKT A;  3R4K A;  1S3J A;  4XRF A;  4R79 A;  1FX7 A;  3ISP A;  4LK1 F;  1LNW A;  1T98 A;  2NNN A;  4Y13 A;  1R7J A;  1Z6T A;  2IRF G;  3KP4 A;  2GXB A;  4UVB A;  3DQV C;  3IHU A;  2HZT A;  2J5O A;  1SD7 A;  1SAX A;  3QPT A;  3I71 A;  1O3S A;  3IKT A;  1TBX A;  4M71 A;  5ILV A;  4N9I A;  3WGH A;  2XKP A;  2ZCW A;  4HBL A;  3KP2 A;  3V7R A;  3H92 A;  1WKM A;  2ZXJ A;  4OMZ A;  4WWC A;  1FYM A;  5DD4 A;  2VC0 A;  2KJC A;  3KZY A;  2L54 A;  2VE8 A;  5DDG A;  1YW7 A;  4U0W A;  4HV5 A;  2D1H A;  1BN5 A;  3TOA A;  3I5U A;  1U5T B;  2WC2 A;  2QBY B;  3PQJ A;  1KYZ A;  1TQM A;  1D3Y A;  1XSX A;  3EQL F;  2OAZ A;  2PBI A;  2KKO A;  4I0B A;  2OBP A;  5J8C A;  4A0Y A;  3S2W A;  4KIF A;  4L18 B;  2DU9 A;  2MBF A;  2EA2 A;  5E18 F;  1HW5 A;  1IZ1 A;  1P6R A;  2PN6 A;  1USS A;  2QLZ A;  2MA3 A;  4GYI A;  5HDN A;  1Z05 A;  2RQP A;  4I01 A;  1YQA A;  1HBX G;  5D5U B;  1XSV A;  2BYV E;  3KLN A;  2EA4 A;  2HEO A;  2XRN A;  3LA7 A;  4P9U A;  4LLL A;  3GWZ A;  1OKR A;  3RKX A;  1IW7 F;  2ZFW A;  3O6B B;  2KIM A;  1U2W A;  4KUM A;  5HS8 A;  5AIP A;  1QZZ A;  3FM3 A;  3P7N A;  4IVN A;  1XGM A;  5D4R A;  4LLG F;  4HLY A;  3EET A;  1K6O A;  4D0P A;  5FD6 A;  3B73 A;  2HTJ A;  1J59 A;  1BC8 C;  1REP C;  2M87 A;  2VOD A;  2ZME A;  5FB2 A;  5HLG A;  4CDG A;  5LHH A;  3ROU A;  1MJ9 A;  3HOT A;  3E3V A;  2R7F A;  4OIP F;  3RPU A;  2CFX A;  1DP7 P;  3KP5 A;  1R36 A;  2XUB A;  3VOD A;  4WCG A;  3VFZ A;  1MDM A;  4A5M A;  1BIA A;  4GO1 A;  3LAJ A;  3QP5 A;  2QQA A;  3T8T A;  1BOA A;  3JAM Z;  2PEX A;  2XAQ A;  2O61 A;  3IRQ A;  2R3S A;  1B9N A;  1ZH5 A;  1MZB A;  3WGI A;  1S29 A;  2TDX A;  5IT9 K;  3C1D A;  3WGG A;  3QAH A;  2FML A;  3ZMU A;  2XVC A;  2L4A A;  4YFK F;  4AIH A;  4RS8 A;  2PFB A;  5TRD A;  3RYP A;  1LQ1 A;  2CO5 A;  1J7K A;  1I6X A;  3FXR A;  4B8X A;  5K5Q A;  5E20 A;  2LF8 A;  1B1B A;  4EVI A;  1ZRE A;  4NHJ A;  4Z2Y A;  4HQE A;  1E17 A;  4HV6 A;  1LDD A;  2HR3 A;  3RDI A;  1RNL A;  3GLX A;  3LA3 A;  5ICC A;  4PZJ A;  1QQI A;  2PMU A;  3MZH A;  4ZYG A;  4EM1 A;  4R8H A;  4GXO A;  1R1V A;  1MKM A;  2J5P A;  3BRO A;  1WRJ A;  2M30 A;  4XSX F;  1TW2 A;  4OIQ F;  4IXA A;  2Y75 A;  2ZKZ A;  3FX3 A;  2VOO A;  5DCM B;  4EGZ A;  2JPB A;  5ILS A;  3DXJ F;  2XKO A;  5D8K B;  4A12 A;  2HWV A;  3HRU A;  2G7H A;  3VOE A;  3WG9 A;  1K78 B;  1IF1 A;  4R1H A;  1KU9 A;  3RIR A;  3FMQ A;  1I1G A;  5L3F A;  3HRM A;  3E6C C;  4Y17 A;  2QM3 A;  2FMY A;  1V4R A;  2W84 A;  3T0Y A;  1BI3 A;  4ZYE A;  2B0L A;  5D8L B;  4LG0 A;  2A61 A;  2HFH A;  4ZZD A;  4KIB A;  5CJ9 A;  4DNC A;  2EV5 A;  1HXD A;  4G7Z F;  1E2X A;  2ESN A;  4KNY A;  1YW8 A;  2K4B A;  2G7U A;  1P4A A;  2LKP A;  3K0L A;  4PGH A;  4EJV A;  1UCR A;  1DDN A;  2FEZ A;  5LRR A;  3BJ6 A;  4HDV A;  3CLO A;  1IAW A;  2W25 A;  1F5T A;  2AXL A;  1I1S A;  1XSD A;  2HDC A;  2DLL A;  3FWE A;  4G8X A;  1ULY A;  2GZW A;  4FT8 A;  5FLX Z;  3HHH A;  5LEK A;  5IT3 A;  3J81 Z;  4LK0 F;  5L3B A;  4HLX A;  2NNY A;  1O57 A;  5HLI A;  4MQ9 F;  2MC3 A;  1J0R A;  4EV0 A;  4A5N A;  2K86 A;  2VE9 A;  3I53 A;  3I0T A;  1IN4 A;  1W7P A;  2EV0 A;  1X3U A;  3JW4 A;  4I2O A;  2MD5 A;  1HSJ A;  1U6G A;  2KIU A;  3QU3 A;  1MD0 A;  3WU0 A;  4EJW A;  3MFK A;  1LJ9 A;  1DUX C;  4JBA A;  1FC3 A;  1ON1 A;  2YR2 A;  2P5K A;  4IHS A;  1FLI A;  2Q8K A;  3K9T A;  5D5V B;  3NQO A;  1HKQ A;  4CGZ A;  1KQ8 A;  2AS5 F;  2F5C A;  2XAF A;  3DPL C;  1LB2 A;  3KE2 A;  5LHI A;  4L9N A;  3M8F A;  3M9A A;  1HQC A;  1T38 A;  1IRF A;  2WTE A;  3BY6 A;  3GF2 A;  3HRS A;  3ELK A;  1TQP A;  5LRS A;  2GA2 A;  1OMI A;  1DPU A;  4G7O F;  3BPX A;  2JSC A;  1ZRC A;  3BZ6 A;  3NEU A;  3Q9S A;  3SXY A;  3FF5 A;  2IT0 A;  2OA4 A;  4AWX B;  2GQQ A;  4HOB A;  1ONV A;  2NAZ A;  1ON2 A;  1J2X A;  1JE8 A;  3CO7 C;  2CQK A;  2VON A;  1NHA A;  5FGM A;  5KK1 A;  3J80 K;  3BPV A;  2W57 A;  3WTW C;  1FZP B;  2HQR A;  3B02 A;  1H0M A;  1W4M A;  1O7L A;  3WTT C;  1T6S A;  2QUF A;  1RIO H;  3RKY A;  4ENM A;  2A07 F;  1RUO A;  1WSU A;  5JI6 A;  4ENK A;  1R1U A;  2RNJ A;  1B9M A;  4L0Y B;  4QWQ A;  2IVM A;  1RUN A;  3F23 A;  5FLX K;  2IJL A;  3VEP A;  1JGS A;  4HA8 A;  3REO A;  3V7S A;  1S7A A;  4M73 A;  4IHT A;  2DQR A;  2IP2 A;  1TW3 A;  1HW1 A;  4YFX F;  2L01 A;  1R58 A;  2DK5 A;  1FYL A;  1DPR A;  1O7F A;  1LEA A;  5K1Y A;  1Z1D A;  6PAX A;  1UHM A;  3EYY A;  1A04 A;  3F72 A;  2Z99 A;  2NS0 A;  3V7C A;  1Z6R A;  2P8T A;  3QP6 A;  4M72 A;  2O0Y A;  2FOK A;  3JSP A;  4U7D A;  2EFP A;  3RPQ A;  3ZP5 A;  1U3E M;  3F22 A;  1XMK A;  4MHG A;  2H27 A;  2ETH A;  2Z9O A;  1W7P B;  5FD5 A;  3GEZ A;  4KIG A;  1STZ A;  2A69 F;  4BYY A;  1AWC A;  3I64 A;  4LD5 A;  1IN6 A;  2P6T A;  2FRH A;  1QNT A;  2EJR A;  4CXF A;  1IRG A;  2OD5 A;  4M6X A;  1Z9C A;  4O5V A;  1ZG5 A;  5D4S A;  1ZLJ A;  1SFU A;  1W5S A;  2E7X A;  3TO6 A;  1CF7 A;  5FO5 A;  2D45 A;  2EV6 A;  4HX4 A;  1XGO A;  2DBB A;  2ZME B;  1Y0U A;  2NRA C;  1Z91 A;  4G6Q A;  5AIQ A;  5EEG A;  1ZGJ A;  3TO7 A;  4CIC A;  2FU4 A;  2RN7 A;  3R0A A;  3EYI A;  2PG4 A;  1YTY A;  2RGV A;  1KU3 A;  1YLF A;  3E5X A;  5CVV A;  2P6S A;  1R22 A;  1MDM B;  1CGP A;  5HDK A;  1ZHF A;  2HTS A;  1MGT A;  3JAM K;  1U8R A;  4O3M A;  3TO9 A;  2WWY A;  5L3E A;  4CO8 A;  3LWF A;  2PLY A;  4MTD A;  1TTY A;  1GVJ A;  2Z3Y A;  2FE3 A;  1QO0 D;  2ZJ2 A;  3WTZ A;  3SHF A;  4DQ2 A;  3EUH A;  4RAY A;  4G7H F;  1SFX A;  3GX4 X;  1LVA A;  2LNB A;  3COA C;  4I09 A;  1XGS A;  3BOQ A;  2H6B A;  3IWF A;  5CVR A;  1FOK A;  4EM0 B;  2EFQ A;  2A6E F;  1D5V A;  4RGX A;  1LEB A;  2FNA A;  4UHT A;  1MJB A;  5CVI A;  1FY7 A;  4UUV A;  3K69 A;  3HHG A;  2GXG A;  5FFZ A;  2MH2 A;  2QQ9 A;  4YFN F;  4GYG A;  4U0Y A;  5E17 F;  4A0Z A;  2NYX A;  2FF4 A;  1GXQ A;  2DPD A;  4HF2 A;  4YG2 F;  4HX8 A;  3ZQ7 A;  3TKY A;  3FXU A;  4IF4 A;  2ELH A;  3MEX A;  3U2R A;  1YFH A;  2CSO A;  3TGN A;  4TV7 A;  3LST A;  5DCF A;  2IA2 A;  4I98 B;  3U1D A;  3WE3 A;  5F6F A;  4HYE A;  1J9I A;  4UV8 A;  2HYF A;  2OQG A;  3IWZ A;  1FWZ A;  4IRG A;  4L9T A;  2GIV A;  1FP2 A;  3BP8 A;  4WX9 A;  3BWG A;  3WTS C;  3GFJ A;  1YW9 A;  2QEN A;  3ZMZ A;  1P2F A;  2EB7 A;  3SZP A;  1SD4 A;  1IN8 A;  2JRT A;  2D1V A;  3H3U A;  4EJT A;  4KDP A;  2ADU A;  3WE2 A;  5LLQ A;  2PMH A;  1BI1 A;  3ABU A;  1ZN2 A;  3F8C A;  2K7L A;  4B09 A;  2QWW A;  2M5W A;  3HRT A;  2GA1 A;  4I02 A;  1PDN C;  2IPQ X;  2VC1 A;  4ETS A;  4H0E A;  2ZO4 A;  3OV8 A;  1BJA A;  3G3Z A;  3LAP A;  5E8G A;  5BQT A;  2XAH A;  1FSE A;  2XV4 S;  3JSO A;  1MJA A;  2JZY A;  4M6Y A;  4NQW A;  4U0V A;  4OOI A;  3WU1 B;  3WTY C;  5ILU A;  1R1T A;  1QZY A;  1D8J A;  4L9J A;  2M1B A;  5D5W B;  1U78 A;  4N9H A;  3CUO A;  1U5T C;  1IN5 A;  4HQM A;  4ESB A;  4IRI A;  4KIC A;  3L09 A;  4XLP F;  1UB9 A;  2OQR A;  3FMR A;  3L9F A;  5DUI A;  2HS5 A;  5AON A;  2C6Y A;  3KFW X;  4CYD A;  1ZYR F;  1YS6 A;  2ISY A;  3ULQ B;  1KQ0 A;  2H94 A;  1U5T A;  2ACJ A;  5H6R A;  5JHU A;  1J75 A;  5LGN A;  1K79 A;  4OU0 A;  1ZAR A;  4QLC U;  3ZMS A;  3OOP A;  3T5X A;  2STW A;  3JTG A;  4A6E A;  2BE5 F;  5DUK A;  4LB6 B;  4CZZ A;  2VN2 A;  4HX7 A;  2HKX A;  4BHC A;  1W7P D;  3GXO A;  2V79 A;  5BMZ A;  1PP7 U;  1TQI A;  4M9X A;  3CO6 C;  4M74 A;  3O2P E;  4RGS A;  2GWR A;  3GFM A;  5HDG A;  5JVT A;  3I59 B;  5ICG A;  3Q5F A;  5BPD A;  4MTE A;  3L2C A;  2ESH A;  2OZU A;  4WF2 A;  3CUQ B;  3F21 A;  2RDP A;  3HYI A;  1KA8 A;  3C3W A;  1S8N A;  2EWN A;  4L9V A;  2W24 A;  1JXS A;  1WWX A;  1I27 A;  5E8I A;  2EK5 A;  2OZ6 A;  2H6C A;  3CUQ C;  4A2U A;  5BS6 A;  2A5Y B;  1TNS A;  1XD7 A;  2DK8 A;  2HYG D;  3KEO A;  3MAJ A;  1W5T A;  2A3S A;  4RB1 A;  4WK8 F;  4GCV A;  3IKV A;  3ZN0 A;  4UNO A;  3GZ5 A;  1RZ4 A;  4KN4 X;  2CW0 F;  3E6M A;  1QGP A;  5HOO A;  4I7H A;  3CUQ A;  1B59 A;  4MEY F;  1B4A A;  3JTH A;  2MLK A;  1ZG1 A;  3MZY A;  3IL2 A;  3ML6 A;  3F3X A;  1G4D A;  2YX4 A;  2CYY A;  1O3R A;  1SMT A;  4MEX F;  4P5O A;  3N97 A;  4U7B A;  1XCV A;  1FBU A;  3FZV A;  1G3W A;  5DEQ A;  4BXU A;  5HVQ C;  2DAO A;  3P9K A;  4PDK A;  1JHH A;  4K2E A;  3GZ6 A;  4U88 A;  1R00 A;  3QPH A;  3D0S A;  3RTR A;  1IN7 A;  2VT2 A;  5D6F A;  3KEQ A;  2D2W A;  4HDU A;  2UWM A;  4E70 A;  2KJB A;  2XAG A;  3V8L A;  2L4M A;  3ZMT A;  2WV0 A;  3GUD A;  3HUG A;  1L3L A;  1TLH B;  1OYI A;  4S05 A;  4RB3 C;  2QVO A;  3LFK A;  3M8E A;  3BJO A;  3J7A O;  4M9Z A;  1T0F A;  2V9V A;  2PQ8 A;  2FSW A; 
#chains in the Genus database with same CATH topology
 5FFX A;  4RGU A;  1D0Y A;  3E5U A;  2YU9 J;  1MBH A;  3HTU A;  4ZDP A;  1FSH A;  1ODD A;  1FP1 D;  3PNV A;  5H20 A;  2BV6 A;  1G3S A;  4OAZ A;  3GME A;  3G73 A;  4C2M J;  5FKN A;  2VQC A;  1H9T A;  1FTZ A;  3PM1 A;  3W6K B;  3ZQF A;  2F5E A;  1FT9 A;  2LSO A;  4LJZ F;  3K70 C;  3HOY J;  4IJA A;  2M7A A;  2NS7 A;  1BW5 A;  1JUM A;  1YRN B;  5DM7 F;  4C2T A;  1DU0 A;  3M1E A;  2KLO A;  4DW6 A;  4ZH4 F;  1Q1H A;  2XAU A;  3T1B A;  2P5V A;  4G12 A;  1EV7 A;  1T0F C;  3CLQ A;  5L3C A;  1T8I A;  4PJ0 C;  5FKL A;  3BTL A;  4WXH A;  4KIS A;  2Y9Y A;  5CVU A;  2RV8 A;  2R7T A;  1DP3 A;  2FA5 A;  1VQ5 I;  3OL3 A;  3MCZ A;  1GVD A;  1Z7U A;  5A2Q K;  3DCF A;  1V54 H;  4RB2 C;  4DIQ A;  2VXZ A;  1GHC A;  3AAF A;  1P4X A;  5C4X J;  1D8K A;  2XAJ A;  1W0U A;  3GO5 A;  3MWM A;  4BQA A;  5B1B H;  1N78 A;  4MQV A;  3T8R A;  2CS3 A;  1VQO I;  3P9I A;  3D5S C;  1B6A A;  5A2Q Z;  1XDU A;  2E7W A;  3PFI A;  4M9S A;  2HQN A;  2X85 A;  2N8G A;  1AOY A;  1A31 A;  4QTR A;  2F5F A;  5ICE A;  1POG A;  1XMX A;  4PJJ A;  4LLN A;  3ECH A;  3SYT A;  2IGK A;  2JUG A;  2JA8 J;  2F2E A;  2VJI A;  2L5Q A;  3PO3 J;  3C18 A;  1JJ6 C;  2UXX A;  2R4G A;  1FMV A;  1SD5 A;  1OYW A;  4UVA A;  1ZLK A;  3A2K A;  1IUY A;  2B7E A;  2RQQ A;  3CJT B;  5CQG A;  3GYH X;  3QRF F;  2V1U A;  2Q1Z B;  1WI3 A;  3ECO A;  3AL0 B;  3OYF A;  1IRX A;  5IP7 J;  3JRH A;  2Z2S B;  2M8E A;  3A1Y A;  3ONQ A;  2ZJP F;  3E5Q A;  3HSR A;  1B72 B;  5B5E C;  1K4S A;  1OFC X;  1ETY A;  2KIQ A;  1WHU A;  3H5N A;  3Q0U A;  3B6C A;  4GGG A;  1YX3 A;  2M9H A;  1XN7 A;  2R7V A;  2CG4 A;  4CYC A;  2RKH A;  3P9C A;  3K1N A;  2IA1 A;  4RA2 A;  3OS0 A;  1K61 A;  1SC7 A;  3ZN1 A;  2XSJ C;  5DV5 A;  2Y30 A;  5DCM A;  2K4J A;  4JYK A;  4ESF A;  4ZJZ A;  1SAU A;  2G9W A;  2ECB A;  4AD9 A;  2F5V A;  2HGC A;  4KN7 X;  1W1W E;  1LFP A;  4G94 A;  4HRI A;  1HST A;  4KYW A;  1G8X A;  1Y1W J;  3V4G A;  2BEO A;  2E19 A;  5JFR A;  2DO7 A;  3E6B A;  3CCE I;  2MYS A;  3MN2 A;  4MNU A;  1H9G A;  1XB4 A;  4BHB A;  1SVL A;  2X48 A;  3BQZ A;  4A0X A;  1G2H A;  1QHH D;  3F6O A;  4F92 B;  2HU9 A;  1R23 A;  4Y15 A;  2JN6 A;  4F7Z A;  1F43 A;  1FBS A;  1OCP A;  1EH7 A;  1BOB A;  1UG0 A;  4HAM A;  4BAY A;  1R5H A;  2K3F A;  4DBQ A;  3NRV A;  4HNV A;  4M3D A;  4EMS A;  4ENN A;  3ABK H;  2JA6 J;  5ERI A;  4UVC A;  3WTX C;  4Q4Z F;  2VBX A;  1S7O A;  4CHU A;  1PP8 F;  4A3G J;  1SMY F;  3L2R A;  3GW2 A;  2DOF A;  3HOU J;  3Q9V A;  3D5L A;  5GTH C;  2K40 A;  2WV1 A;  5LGT A;  2P5L C;  1QU3 A;  1K7A A;  2W7N A;  1MNE A;  1C0W A;  1ZQ3 P;  3SFZ A;  4BH9 A;  2H8W A;  3ZOB A;  4LGW A;  4LG3 A;  4LIV A;  3QU6 A;  5J1R A;  3RYR A;  3KP7 A;  2YX7 A;  1T33 A;  1ZG3 A;  1FNN A;  2WAQ N;  3DTI A;  3F6V A;  3G71 I;  2OTJ I;  3E6D A;  2K27 A;  2XSD C;  1ITY A;  3KIO A;  1LDJ A;  4F55 A;  3RJP A;  3R60 A;  1HW2 A;  3BG6 A;  2JA7 J;  4PFO A;  3G1L A;  1X2M A;  2P7C B;  4BQQ A;  3E1S A;  2DT5 A;  1UHW A;  3LA2 A;  9ANT A;  3K4J A;  4N0B A;  2BW3 B;  4A3M J;  2V1X A;  2L3D A;  3CCY A;  2X4H A;  1UHS A;  3GZN B;  1U9O A;  2QF7 A;  1OQY A;  2H1K A;  2R7U A;  2FQ3 A;  4O6J A;  1SFE A;  2DA7 A;  2M45 A;  2V1N A;  4LMY A;  3BJA A;  1S6L A;  1V5F A;  5CVJ A;  3ZMD A;  2DXI A;  2K9L A;  3GFL A;  1ETO A;  3W6J B;  2K02 A;  5ED4 A;  1WH5 A;  3VSK A;  2X51 A;  3SDG A;  3JRI A;  3CCL I;  1W5C C;  1F1Z A;  2O03 A;  3HSF A;  4PGG A;  5M3F J;  4E6K G;  3HTS B;  1OR7 A;  5M5Y J;  3LNQ A;  4EJO A;  3KET A;  2HI3 A;  2X0L A;  2R5Y B;  5F1R A;  3OS1 A;  2HXO A;  3ERM A;  5J47 A;  2FBI A;  2YU3 A;  4ESJ A;  1ZEL A;  2AXT C;  3KZZ A;  4RB0 A;  2P4W A;  2VT3 A;  1ZGA A;  1BM9 A;  1G3Y A;  2KIF A;  1SD6 A;  3HIF A;  3PNY A;  4MLO A;  1H89 C;  1O3Q A;  1QBJ A;  4MFE A;  2O9L A;  4Z6Y A;  1UZC A;  2ZNZ A;  1PUE E;  3J80 Z;  1YG2 A;  2CQX A;  2LDU A;  2XGX A;  4ABZ A;  3HOV J;  2WAD A;  4XQF A;  3FXM A;  2M4K A;  2IXS A;  5KNL A;  5J8F A;  3SFI A;  2EIJ H;  2VXD A;  1Y8R B;  3HGY A;  1WJD A;  3OYG A;  3E97 A;  3MKL A;  4NNJ A;  2CWE A;  1G6N A;  2XAS A;  3Q3S A;  2FOW A;  2A05 A;  4H4K C;  3KEY A;  3CZ6 A;  5CPR B;  1T39 A;  3ZQC A;  1SFO J;  1GV2 A;  3DTK A;  1ZAO A;  2JVH A;  4LFU A;  1R5I D;  1YIO A;  3PUF A;  5F0F A;  1HDP A;  2XPU A;  2JTV A;  1V3F A;  2TCT A;  2PI0 A;  1XMA A;  3GTJ J;  1AKH B;  1QVU A;  3VYT B;  3DKW A;  3FHN A;  2E34 A;  3FDY A;  1I39 A;  4ENJ A;  4G9Y A;  1ETK A;  4AC0 A;  2ZBK A;  2XGE A;  2XIG A;  4XLN F;  2YSR A;  2LP0 A;  3LQR A;  5EEH A;  4JQF A;  2O8X A;  5J1Y A;  3VDX A;  4BY7 J;  2Y69 H;  2BGC A;  3SEZ A;  3V8K A;  1MMS A;  2R7S A;  2XRL A;  1WCM J;  3MKY B;  2CRG A;  2GAU A;  1FYK A;  1JUP A;  2LF7 A;  3A01 B;  4QIW N;  5J6X A;  2IAI A;  2FXA A;  4JK1 X;  2IW5 A;  4LG0 B;  4BXX J;  3I4P A;  2IS2 A;  2R7Q A;  3U9G A;  5TJJ A;  1VQP I;  1PUF B;  4II2 A;  3R6S A;  5LHG A;  5GAG J;  4OIO F;  1R4M B;  3DBH B;  2ELJ A;  1TT5 B;  3DLL F;  3C7J A;  3DKX A;  2KPM A;  3K2Z A;  3LQQ A;  3JRD A;  2DOD A;  2VJ4 A;  1LKX A;  2QKL B;  2Q2E A;  3TDU C;  3FBN B;  2YUS A;  4WXC A;  4II3 A;  4PJL A;  2L9S A;  3UNG C;  2LLK A;  3DP7 A;  4FX0 A;  1UST A;  4HEA 2;  2QYO A;  2DYS H;  3C2B A;  3KYL A;  2VKD A;  2PJP A;  1WH7 A;  5J3L A;  3F9K A;  2FX0 A;  2GIZ A;  2WAF A;  4E4H A;  2E1C A;  2XGC A;  4RLQ A;  3L2Q A;  2FBK A;  1ZTR A;  1O4X A;  1WQ2 A;  1F36 A;  2P7V B;  5K5R A;  3BCB A;  1KU7 A;  4KA4 A;  1S7E A;  1LDK B;  4I0A A;  5E1X A;  3AL0 C;  5HS9 A;  3EUH C;  4BU2 A;  2HXI A;  4BE2 A;  2E1O A;  2LRE A;  3F8B A;  4Q48 A;  5F1J A;  1ETW A;  5BOX A;  2ISZ A;  1VQ8 I;  2G0E A;  3R0J A;  1ZRD A;  1JKR C;  5H6Q A;  3IRR A;  3N4M A;  1BR2 A;  3QWL A;  1K4T A;  2EFO A;  1LPQ A;  3FHZ A;  4AVP A;  4BBR J;  2MLG A;  3E0J B;  2P0W A;  3CMA I;  2XGD A;  3ZQQ A;  2AQF A;  4FHT A;  2A68 F;  2MG4 A;  4RAZ A;  2QSG X;  2CV1 A;  1P4W A;  2V26 A;  3GCM A;  1Y8Q B;  3IC7 A;  4C3I J;  1UFM A;  1ENH A;  4ZYD A;  4HPQ A;  2DYR H;  2ZB9 A;  3GVA A;  1VFC A;  3ZQL A;  2VPR A;  5CLS A;  4D5F A;  2LKX A;  3TOB A;  1Y0N A;  2KRF A;  1E0E A;  3WOD F;  2DI3 A;  3K1P A;  3DF8 A;  3L7W A;  4BNC A;  2FQ4 A;  2DPU A;  2ZNY A;  2M0C A;  3JCU C;  1J5Y A;  1MBG A;  4UXN A;  2BBY A;  3BTJ A;  2EQR A;  1XPX A;  3VYR B;  2EFW A;  5FRO A;  3S3M A;  2OCC H;  3KLO A;  3PFY A;  4BDY A;  2DOA A;  2XHK A;  3HG9 A;  5E1W A;  3ZPL A;  3KCC A;  2BY3 A;  3HPH A;  4Q5S F;  3CC2 I;  5B3S H;  3EDP A;  2CQN A;  3I4M J;  2VKH A;  1EKE A;  1S5L C;  4L0Z B;  3DEW A;  2EZK A;  3CDH A;  4IPA A;  2HOS A;  3ZXS A;  1IV6 A;  4HF0 A;  2DTR A;  1HKS A;  2OU2 A;  4UV9 A;  3CCS I;  4D7M A;  2MW8 A;  3DKY A;  1S72 I;  3KP6 A;  1KU2 A;  4P96 A;  3TP3 A;  3V8J A;  4AUX A;  1R5G A;  2ICW G;  4RMN A;  3W2A A;  1MMN A;  4IRH A;  3WTU C;  1TC3 C;  4HZF A;  3I3L A;  2KQR A;  2EFN A;  4JP0 A;  1P7J A;  2KIS A;  1D1C A;  1OYY A;  1Z3Y A;  2VBZ A;  3F8M A;  2CUF A;  3NAU A;  4XLE A;  1F9N A;  2L9N A;  4KMF A;  1E3P A;  5JR3 A;  3O3K A;  1QRY A;  3GBG A;  3M7G A;  4FE4 A;  4DZP A;  5D5X B;  5F04 A;  1X1D A;  4EGY A;  2H1L A;  4NB5 A;  1AHD P;  2EIL H;  3ZCO A;  3DBR B;  5DD8 A;  4FCY A;  3MKZ A;  3GFI A;  3SZG A;  2DFI A;  3J7A Y;  2Q0O A;  5CKT A;  3ZMV A;  3F8N A;  2VBW A;  4L5I A;  4FTH A;  2VBY A;  3FM5 A;  1NTC A;  4XKB A;  2O8K A;  2CQQ A;  4ASN A;  3K1M A;  2OF7 A;  5KVR A;  1JT6 A;  3VB2 A;  2JPC A;  1FBQ A;  2JMW A;  4IHY A;  1GDT A;  1SVO A;  2DW4 A;  2NVU B;  4A6D A;  2IGO A;  2AHQ A;  2HOA A;  3DEU A;  4HW0 A;  1O3T A;  4BUP A;  1TNT A;  1HCR A;  1XGN A;  2ZXI A;  4J19 A;  1IXC A;  2UXN A;  4KFC A;  3WTV C;  4A3E J;  3HOW J;  4C2U A;  2W48 A;  4XSZ F;  2W85 A;  3FIW A;  1D5Y A;  1CF7 B;  2B63 J;  2ID6 A;  4JX5 A;  3H3V K;  4DZJ A;  1H8A C;  2GOX B;  3BR2 A;  3IUO A;  3F8F A;  4HF1 A;  1YS7 A;  5GAE J;  1BC7 C;  4CZC A;  4BJ5 C;  2BY2 A;  2RVC A;  2X6X A;  3DFG A;  5K5O A;  1DQU A;  2Z33 A;  1IO2 A;  2FBH A;  1BI2 A;  2WY7 Q;  5IY5 H;  3DV8 A;  3S2D J;  1MMG A;  5CYV A;  2ZJR F;  2M8G X;  4FX4 A;  3SZT A;  2VJ5 A;  4D5C A;  4OIN F;  2EZH A;  4BDZ A;  3CJN A;  5E1Z B;  3SQN A;  3TDZ C;  1K78 A;  4ZTJ A;  4IX7 A;  3FXQ A;  2A6H F;  3H3Z A;  2L7F P;  1TWG J;  2V1D A;  3L2U A;  4RGR A;  3ERE D;  1UAA A;  4KT5 C;  2HOE A;  3R61 A;  4MGR A;  3V42 A;  2LTP A;  1L0O C;  1I6H J;  2V9K A;  3A02 A;  2RAE A;  1OCZ H;  4X6A J;  3HSE A;  2FNP A;  1QZE A;  2JT1 A;  2YPR A;  4G6D A;  2CV0 A;  3RKQ A;  4IQJ A;  2IS1 A;  5IT9 Z;  1AA7 A;  4DJA A;  3A0H C;  2V6C A;  2DJI A;  3I58 A;  5EG0 B;  1I5Z A;  3RI4 A;  1N77 A;  3J7Y J;  3G6E I;  1JHF A;  2E60 A;  4AIJ A;  2UZK A;  5ICF A;  3H9Q A;  5JLX A;  1HA8 A;  3I54 A;  3M3Y J;  5F0C A;  1BI0 A;  1MBJ A;  1YYV A;  2WBM A;  1WVR A;  5D6E A;  2R7D A;  2QSH X;  1XDS A;  2HKO A;  1FJL A;  1S9H A;  3K4N A;  2EIN H;  1KZH A;  3FXO A;  3DPT A;  4EJU A;  1UMQ A;  3QOP A;  1XX5 A;  2NVY J;  1F4K A;  4HSR A;  3HOZ J;  1EA3 A;  4OIR F;  3RKW A;  1G3T A;  1XG1 A;  2L02 A;  5BPI A;  3D1N I;  2KZG A;  2Y0M A;  5FLV A;  3EUK L;  4KMU X;  2MAB A;  4LB5 A;  2STT A;  4L5J A;  2IA0 A;  2P81 A;  4BS9 A;  2VIX A;  4S04 A;  1T2K A;  1BIB A;  4ZYH A;  4P9F A;  5LEJ A;  2DQL A;  1BBY A;  3GTL J;  2MH9 A;  3CTA A;  2VL8 A;  3FMS A;  1KQ9 A;  2LOO A;  5HS7 A;  4OMY A;  2DA1 A;  4PCQ A;  3EUA A;  3ZRG A;  1YE9 A;  4CCN A;  3I56 I;  1Z7L A;  2QBY A;  2COM A;  5L3D A;  1IXR C;  4Q47 A;  4F91 B;  3LSM A;  1EJ9 A;  2K9M A;  2BXZ A;  4PUS A;  4MIM A;  1RI7 A;  4DYR A;  2GLO A;  4ON0 A;  4OAY A;  3I59 A;  3PQK A;  2HOT A;  3K2A A;  1GXP A;  1Q1V A;  2E1N A;  4XOT A;  4YEL A;  1OPC A;  3BG5 A;  2HPM A;  1JKQ C;  1WJA A;  1VTN C;  1WI9 A;  3IV5 A;  1JTY A;  5DYM A;  1SAN A;  5LBQ A;  2QQB A;  3BZC A;  3OYE A;  3MQ0 A;  4YII A;  2VOP A;  1XCB A;  2CJJ A;  2H09 A;  3S8P A;  2VUM J;  2AO9 A;  1KGS A;  1TT0 A;  3HOS A;  2E2H J;  4DGW B;  4KJZ A;  3HEF A;  4YIF A;  3BDD A;  2GOM A;  3HC7 A;  4EQQ A;  2F5D A;  2L7M P;  3OOU A;  5HLH A;  1MW7 A;  3ABT A;  3J81 K;  2XB5 A;  2O6G E;  2CU7 A;  1QPM A;  4XBF A;  1KON A;  3QPL A;  4BHP A;  4ZZL A;  1IXS B;  1EH6 A;  2E36 A;  5F64 A;  1MBK A;  3G2B A;  5L3G A;  3KP3 A;  1P92 A;  4P55 A;  4EM2 A;  1CQT A;  1NK3 P;  1R49 A;  2Y48 A;  2XPW A;  3TED A;  1KYW A;  3DTE A;  2Z5U A;  4D9J A;  4XIC A;  1EH8 A;  2RC4 A;  2CGP A;  4CA0 A;  1YO5 C;  3TQN A;  1ZRF A;  2QZ8 A;  2Z16 A;  3BTC A;  3KX2 A;  1Z0X A;  3RPU D;  3ASN H;  4WXD A;  3L00 A;  4AIK A;  2KP6 A;  4Y7N J;  2O3F A;  4FAS D;  2XRO A;  4CCK A;  2VKV A;  5LGU A;  1FPQ A;  1HKT A;  3R4K A;  1S3J A;  1MND A;  4XRF A;  1FX7 A;  3ISP A;  4R79 A;  4LK1 F;  1LNW A;  1ZK8 A;  1T98 A;  3BLY A;  1ZR4 A;  2NNN A;  4Y13 A;  4BAC A;  3BR5 A;  1R7J A;  2WB1 A;  1Z6T A;  1B72 A;  2IRF G;  2ELK A;  4UB8 C;  2LMD A;  5CQE A;  3UR3 C;  3KP4 A;  3RSN A;  2GXB A;  4UVB A;  3DQV C;  2I10 A;  3IHU A;  2HZT A;  4IL6 C;  2E71 A;  2J5O A;  3JR9 A;  1SD7 A;  1PUF A;  1SAX A;  1MMD A;  3QPT A;  3I71 A;  3LSP A;  5E3M A;  3OR1 C;  4Y52 J;  1O3S A;  3IKT A;  1TBX A;  4M71 A;  5EJC A;  4BJT A;  4AYB N;  5ILV A;  2DMQ A;  4N9I A;  1VQ9 I;  2LY9 A;  4XK4 A;  1LVK A;  3K4L A;  3CMM A;  3WGH A;  2XKP A;  4XKV A;  2ZCW A;  1IGN A;  4HBL A;  5M5W J;  3KP2 A;  1D0Z A;  3V7R A;  3H92 A;  1WKM A;  5EEA A;  3OYC A;  3KYC B;  2ZXJ A;  1VQL I;  4OMZ A;  2PJR A;  4WWC A;  4UUS A;  3H0G J;  2V9P A;  1FYM A;  2VQH A;  5DD4 A;  2VC0 A;  2JWT A;  5GP9 A;  2VLA A;  3OYD A;  3S3N A;  2H8R A;  2KJC A;  3I9V 2;  2L54 A;  3KZY A;  3W2V A;  4B4C A;  4FE7 A;  4OWR B;  1RES A;  3RZD J;  2VE8 A;  5DDG A;  1YW7 A;  4BE0 A;  4U0W A;  5IYD J;  4XRS G;  1VQN I;  4IOC F;  1OCT C;  4HV5 A;  3OYL A;  2D1H A;  2Y0S N;  1BN5 A;  1ETV A;  3TBI A;  3TOA A;  4IO9 F;  3I5U A;  1U5T B;  2WC2 A;  2QBY B;  3PQJ A;  4XID A;  4M3E A;  1KYZ A;  1TQM A;  1D3Y A;  4V2G A;  1IRZ A;  2UV1 A;  3LSR A;  3GTP J;  2NOJ B;  1XSX A;  3EQL F;  2OAZ A;  2PBI A;  2Z1D A;  2BVL A;  2KKO A;  4I0B A;  2BXY A;  2R93 J;  2OBP A;  2IGN A;  1ORK A;  5J8C A;  3KYD B;  3OYJ A;  4A3F J;  1OCC H;  3N05 A;  3S2W A;  3CQZ J;  4KIF A;  2DU9 A;  4A0Y A;  4L18 B;  3LSH A;  2MBF A;  2EA2 A;  3ABM H;  3QOE A;  5E18 F;  4AM3 A;  4NC8 A;  2NOG A;  1HW5 A;  3OL4 A;  1IZ1 A;  1SVM A;  3RQ4 A;  1P6R A;  2PN6 A;  1USS A;  3LSI A;  2QLZ A;  2MA3 A;  2XDV A;  4YIR X;  4LIT A;  2JQ7 A;  2BOL A;  3OYN A;  4BQO A;  4E7L A;  4GYI A;  5HDN A;  4ANJ A;  1Z05 A;  2RQP A;  4I01 A;  1YQA A;  1HBX G;  2HPI A;  5E79 C;  2K9Q A;  5D5U B;  1XSV A;  2BYV E;  5C3E J;  3HL2 A;  3KLN A;  4DYC A;  3DEE A;  2EA4 A;  3CCR I;  3H0D A;  2R7X A;  2B9S A;  2BY1 A;  2W00 A;  2HEO A;  3IH2 A;  2XRN A;  3LA7 A;  4P9U A;  3S1N J;  1HF0 A;  4LLL A;  1D1A A;  3BR0 A;  3M8J A;  3I4N J;  4M6V A;  3GWZ A;  1OKR A;  3RKX A;  1WJ5 A;  1IW7 F;  2ZFW A;  3O6B B;  1Z77 A;  3PJR A;  2KIM A;  2K85 A;  1U2W A;  4KUM A;  3SEQ A;  5HS8 A;  5AIP A;  1QZZ A;  3FM3 A;  3ZGK A;  1WJB A;  3P7N A;  1FTT A;  1ZGW A;  4UB6 C;  2LBF A;  1A6I A;  4IVN A;  3PSF A;  1XGM A;  4A3C J;  5D4R A;  4LLG F;  4HLY A;  3EET A;  1K6O A;  4NUB A;  4D0P A;  2DJN A;  2EPF A;  1W36 C;  5FD6 A;  3B73 A;  2FJ1 A;  2HTJ A;  1J59 A;  2BHZ A;  1BC8 C;  2M87 A;  4D7N A;  1REP C;  2VOD A;  2ZME A;  4IOA F;  3KPH A;  3IP4 B;  5FB2 A;  5HLG A;  4CDG A;  5KAF C;  5LHH A;  3G4S I;  4PFP A;  2ZSH B;  3RCO A;  1WJF A;  3ROU A;  1MJ9 A;  2E35 A;  2L7K A;  4RAF A;  5M3M J;  4X0G A;  3HOT A;  3E3V A;  2R7F A;  4HNU A;  4OIP F;  4E7K A;  3LL7 A;  3RPU A;  4HNT A;  2CFX A;  3PO2 J;  3AKZ A;  3DPU A;  3ASO H;  1DP7 P;  3S17 J;  4BY1 J;  3AG2 H;  4I99 C;  3TP0 A;  3B6A A;  3KP5 A;  2FD5 A;  1R36 A;  2XUB A;  4W97 A;  3VOD A;  5IP6 A;  4WCG A;  3VFZ A;  1MDM A;  4GFB A;  1MBE A;  4A5M A;  4ZYA A;  1BIA A;  3JRA A;  4GO1 A;  4XR6 A;  3LAJ A;  1H88 C;  3QP5 A;  2QQA A;  3HJE A;  3T8T A;  2KDZ A;  1BOA A;  3JAM Z;  2PEX A;  4BEH B;  2XAQ A;  3HGG A;  2O61 A;  3IRQ A;  2R3S A;  1B9N A;  1ZH5 A;  1MZB A;  2E1M B;  2KMU A;  3MD2 A;  1JKP C;  1X1B A;  1QPI A;  3WGI A;  1S29 A;  4YEJ A;  3Q0W A;  2TDX A;  5IT9 K;  2F48 A;  1ZKG A;  2EIK H;  1YIJ I;  4XL9 A;  3MVP A;  3C1D A;  3NWT A;  2IS4 A;  3WGG A;  1R9T J;  2KDO A;  4E7I A;  1VQ4 I;  2MD0 A;  3QAH A;  4XOR A;  2FML A;  3ZMU A;  4IZZ A;  3OYA A;  2XVC A;  2L4A A;  1IDZ A;  4YFK F;  1RET A;  3TL4 X;  4AIH A;  4RS8 A;  1Z21 A;  3OS2 A;  5FJ8 J;  2PFB A;  4CCO A;  5TRD A;  4ZTF A;  3RYP A;  1LQ1 A;  2CO5 A;  1J7K A;  1I6X A;  5IPA A;  3FXR A;  4B8X A;  5K5Q A;  1VND A;  3FXK A;  2XF7 A;  1NH3 A;  3PNT A;  4F3Q A;  5E20 A;  2F4O B;  3PL8 A;  3QOD A;  2LF8 A;  1B1B A;  3U1K A;  4EVI A;  1DU6 A;  1FMW A;  1ZRE A;  2KFD A;  4NHJ A;  1MH4 A;  4Z2Y A;  1A35 A;  4S0H B;  2X1D A;  4HQE A;  5EG0 A;  2IBD A;  1ACI A;  1E17 A;  1OR7 C;  1U8B A;  4A3J J;  4HV6 A;  4AU7 A;  1LDD A;  3H1C A;  2HR3 A;  3RDI A;  3CDI A;  1RNL A;  3GLX A;  3LA3 A;  2R7W A;  3H36 A;  5ICC A;  4BQN A;  1XTA A;  1N75 A;  3MKW B;  4PZJ A;  1NK2 P;  1QQI A;  1FOY A;  2PMU A;  3MZH A;  1E3H A;  4ZYG A;  4EM1 A;  4R8H A;  4GXO A;  1R1V A;  2LH9 A;  2XF6 A;  1ZR2 A;  2DFH A;  5GPA A;  1Y6I A;  2BY0 A;  1MKM A;  3OYB A;  2J5P A;  3BRO A;  5HNF A;  1WRJ A;  2M30 A;  4XSX F;  1TW2 A;  4NQW B;  4OIQ F;  4IXA A;  2DT7 B;  4PSW A;  2Y75 A;  3H9J A;  3OIO A;  3Q0V A;  2ZKZ A;  3FX3 A;  2NVQ J;  2MFZ A;  3K4C A;  5DCM B;  2VOO A;  4ZDO A;  4EGZ A;  3HBL A;  2JPB A;  3FK7 A;  5ILS A;  2VJJ A;  3JRE A;  3DXJ F;  3EPZ A;  4PK4 A;  2XKO A;  2LY1 A;  3DU6 A;  4RLF A;  5D8K B;  2CQ7 A;  4A12 A;  3WHC A;  3PSI A;  2HWV A;  3HRU A;  2G7H A;  3VOE A;  3TW7 A;  4J01 A;  1Y56 A;  2V6E A;  3FXJ A;  3WG9 A;  1IC8 A;  1K78 B;  1IF1 A;  4R1H A;  3ZQH A;  1KU9 A;  3RIR A;  3FMQ A;  1ETQ A;  3HKZ N;  4GRI A;  4PSX A;  1I1G A;  5L3F A;  2EZI A;  1TWH J;  3HRM A;  3J7Z I;  3K70 D;  3CJR B;  2DCE A;  2M4G A;  3E6C C;  1LFU P;  4Y3O A;  4BKX A;  2ME0 A;  4Y17 A;  3LOC A;  4AVZ A;  2CV2 A;  1X3Z B;  1V4R A;  1X1A A;  2FMY A;  2QM3 A;  2W84 A;  4IQ4 A;  3T0Y A;  3VSL A;  4P1W A;  1BI3 A;  5J40 A;  4ZYE A;  2B0L A;  5IOZ A;  5D8L B;  1V55 H;  4LG0 A;  2A61 A;  2HFH A;  1ERD A;  4BEH A;  3HUG B;  4ZDL A;  4ZZD A;  1M1E B;  4KIB A;  5CJ9 A;  4E7Z A;  2Y31 A;  4DNC A;  3GTG J;  2EV5 A;  1HXD A;  4G7Z F;  1E2X A;  2ESN A;  4XM3 A;  4KNY A;  2HDW A;  3BR3 A;  4MFD A;  1YW8 A;  2HVQ A;  4C9Y A;  3OIQ A;  2K4B A;  2LY2 A;  1V5G A;  2G7U A;  1P4A A;  2LKP A;  4V19 K;  2R5Z A;  2OV7 A;  3QPS A;  3HB9 A;  5E3N A;  3K0L A;  4PGH A;  4N4N B;  3G1O A;  4EJV A;  1UCR A;  1DDN A;  1Y39 A;  5HOD A;  2FEZ A;  5LRR A;  3BJ6 A;  4HDV A;  4BGD A;  1RR8 C;  3CLO A;  3L2V A;  1IAW A;  2W25 A;  1YX5 A;  3D5R C;  4F52 A;  1JKO C;  1OLT A;  1F5T A;  2AXL A;  1I1S A;  3S1M J;  2VQG A;  4IKF A;  1XSD A;  2HDC A;  4E7J A;  2DLL A;  4I6Z A;  4CCJ A;  2JRM A;  3FWE A;  3L2W A;  4G8X A;  1ULY A;  2GZW A;  4FT8 A;  3HHH A;  5FLX Z;  5LEK A;  5IT3 A;  3J81 Z;  4LK0 F;  5HLT A;  5L3B A;  4HLX A;  2M2E A;  2NNY A;  4M3B A;  5IYB J;  5EGO A;  3LSK A;  1O57 A;  5HLI A;  4MQ9 F;  2MC3 A;  1J0R A;  2X6O A;  4EV0 A;  5BNG A;  4A5N A;  3S16 J;  2K86 A;  2BVM A;  2VE9 A;  3I53 A;  3I0T A;  1IN4 A;  1W7P A;  5J4V A;  2DTZ A;  2AQE A;  2UUZ A;  2EV0 A;  1X3U A;  1AKH A;  3L1P A;  3JW4 A;  2HQ5 A;  4I2O A;  2JVG A;  2MD5 A;  1HSJ A;  4B43 A;  3SJM A;  1U6G A;  1BW6 A;  1QVT A;  4Y4R A;  2KIU A;  2VB6 A;  2RRE A;  5B1A H;  3S14 J;  3QU3 A;  4CSW A;  3W6V A;  2LYC A;  1MD0 A;  3IAM 2;  3WU0 A;  1W36 D;  4EJW A;  4NBQ A;  3MFK A;  1GT0 C;  1LJ9 A;  3X2Q H;  2F4I A;  4NDL A;  1DUX C;  4JBA A;  2DMP A;  3FIS A;  1FC3 A;  1ON1 A;  5FKM A;  4UY8 I;  1LFB A;  2DMT A;  2YR2 A;  2DOE A;  2P5K A;  2IEK A;  1WJC A;  4IHS A;  1FLI A;  3BG3 A;  1X58 A;  2Q8K A;  4YRV A;  4QPQ A;  4ZC3 A;  2ZXH A;  2X1E A;  3C2G A;  3QQA A;  2KRC A;  2HDD A;  1FIA A;  1PVE A;  2MSY A;  3K9T A;  5D5V B;  3NQO A;  3O8G A;  2BHY A;  2M3A A;  1HKQ A;  1T56 A;  4CGZ A;  1KQ8 A;  4E7S A;  2L9R A;  1OJL A;  1HLV A;  2AS5 F;  2F5C A;  2XAF A;  3DPL C;  3M1C A;  1LB2 A;  3KE2 A;  5LHI A;  3TW6 A;  4L9N A;  1WGX A;  2CH0 A;  3M8F A;  3M9A A;  4BXF A;  2JA2 A;  3S2H J;  1HQC A;  1T38 A;  3GF2 A;  3HRS A;  1IRF A;  2WTE A;  3BY6 A;  2LKS A;  3QYF A;  3ELK A;  1TQP A;  5LRS A;  5M5X J;  1JI8 A;  4JOM A;  2GA2 A;  5TIS C;  1OMI A;  2KZV A;  3BZK A;  1TP4 A;  3DWL E;  4XKC A;  2KL4 A;  1DPU A;  1JT0 A;  3NWS A;  4G7O F;  3BPX A;  2JSC A;  1ZRC A;  3BZ6 A;  4RAG A;  3UKG A;  2DFF A;  3NEU A;  3Q9S A;  1D1B A;  2WB1 N;  1VZ0 A;  1APL C;  2VAS A;  3MZ8 A;  5KAI C;  3FF5 A;  3SXY A;  2ZFU A;  5GAD J;  5DS9 A;  2IT0 A;  2OA4 A;  3OWT A;  4AWX B;  2GQQ A;  4HOB A;  1ONV A;  2NAZ A;  3BR6 A;  3M4O J;  1ON2 A;  2NXN B;  1J2X A;  4B44 A;  2JK3 A;  1JE8 A;  3CO7 C;  1PYV A;  2QQ8 A;  3VYS B;  2LG4 A;  4XON A;  1Z3X A;  3OYM A;  2CQK A;  2PMZ A;  2VON A;  2D5V A;  2VKE A;  2CUZ A;  4AYB A;  1NHA A;  5FGM A;  5KK1 A;  1RC9 A;  3J80 K;  3BPV A;  2W57 A;  2R5Z B;  2GM4 A;  2LD5 A;  4XLF A;  3IH4 A;  3WTW C;  1FZP B;  1X2N A;  2HQR A;  3B02 A;  1H0M A;  1W4M A;  1O7L A;  3WTT C;  1T6S A;  1EF4 A;  2QSF X;  2NVX J;  2QUF A;  1RIO H;  3RKY A;  4XRS A;  4ENM A;  2A07 F;  2L0K A;  1RUO A;  1WSU A;  3QYB A;  4QSH A;  1X1P A;  1NG7 A;  5JI6 A;  3A01 A;  4ENK A;  1R1U A;  2RNJ A;  1B9M A;  2GBY A;  1LE8 A;  4CCL A;  4L0Y B;  2WAQ A;  4QWQ A;  3IAS 2;  3OMY A;  2IVM A;  2JJ7 A;  4BL0 B;  1RUN A;  3F23 A;  5FLX K;  3WU2 C;  3K4B A;  4HST A;  5IP9 J;  2IJL A;  3VEP A;  2R0Q C;  2YS9 A;  4XRM A;  1JGS A;  4HA8 A;  3SDB A;  3REO A;  3V7S A;  1S7A A;  4M73 A;  4F93 B;  4IHT A;  3BR1 A;  2DQR A;  2IP2 A;  2BZT A;  2CFO A;  3F0C A;  4IEJ A;  3A03 A;  2PX9 A;  1FEX A;  1U0J A;  4XKW A;  1TW3 A;  1HW1 A;  4YFX F;  2Y9Z A;  3GLL A;  2L01 A;  1R58 A;  2DK5 A;  1FYL A;  1DPR A;  3OYK A;  1O7F A;  1LEA A;  3CP8 A;  5K1Y A;  4W1U A;  1Z1D A;  3CP2 A;  6PAX A;  1UHM A;  1X4O A;  3EYY A;  4A3B J;  1A04 A;  1HDD C;  3F72 A;  1BJZ A;  2Z99 A;  2NS0 A;  3V7C A;  1Z6R A;  2P8T A;  1X1C A;  3QP6 A;  4M72 A;  2ECC A;  4G6T B;  1I50 J;  5EYR A;  2O0Y A;  2FOK A;  3JSP A;  2BW3 A;  4U7D A;  1LE8 B;  2EFP A;  3RPQ A;  1RKW A;  3OYH A;  3ZP5 A;  3F22 A;  1U3E M;  1VQM I;  1XMK A;  4MHG A;  4LOC A;  2EBI A;  5K7F A;  4A93 J;  2OC6 A;  2H27 A;  2ETH A;  2Z9O A;  1W7P B;  5FD5 A;  3GEZ A;  2LVS A;  4NC6 A;  2EH3 A;  3H5A A;  4KIG A;  3VPR A;  1STZ A;  2A69 F;  4BYY A;  3K6G A;  5H2F C;  4XNF A;  2DT6 A;  2HZD A;  1AWC A;  3I64 A;  4LD5 A;  4DBR A;  1IN6 A;  1BR1 A;  2P6T A;  5E3L A;  2FRH A;  1QNT A;  2EJR A;  4CXF A;  1IRG A;  2OD5 A;  4M6X A;  1Z9C A;  4O5V A;  3M07 A;  2TRT A;  1ZG5 A;  2OTL I;  5D4S A;  1ZLJ A;  3CD6 I;  1SFU A;  1W5S A;  5C44 J;  4EEF G;  2E7X A;  3CCU I;  2WY8 Q;  3TO6 A;  1CF7 A;  3ZR8 X;  5GTI C;  5FO5 A;  2D45 A;  5C4J J;  2EV6 A;  4HX4 A;  1XGO A;  2DBB A;  2X6W A;  2ZME B;  2QKM B;  3S1R J;  1Y0U A;  2E2I J;  4XN0 A;  2NRA C;  1RR7 A;  2M7B A;  3LSG A;  1IJW C;  1HC8 A;  3E7L A;  1Z91 A;  2DA6 A;  4G6Q A;  5AIQ A;  5EZH A;  1WPK A;  5EEG A;  4X1E A;  4PJN A;  2I8D A;  3HKZ A;  3GTO J;  1ZGJ A;  3TO7 A;  4CIC A;  4BBS J;  4FQG A;  2PMZ N;  5J1U A;  2FU4 A;  2EIM H;  2RN7 A;  3R0A A;  3EYI A;  1AU7 A;  2DMU A;  4PJM A;  2PG4 A;  1YTY A;  2RGV A;  1R71 A;  1KU3 A;  2QA4 I;  3LFU A;  1YLF A;  3E5X A;  5CVV A;  2P6S A;  2HYJ A;  1R22 A;  1MDM B;  1CGP A;  3BC8 A;  4EAT A;  4XMY A;  5HDK A;  1ZHF A;  2HTS A;  1MGT A;  3JAM K;  1U8R A;  4O3M A;  3TO9 A;  1OIS A;  5E3O A;  2WWY A;  5L3E A;  1K83 J;  4CO8 A;  3LWF A;  2X1C A;  2PLY A;  4MTD A;  1TTY A;  1SEU A;  4B3X A;  4AID A;  1GVJ A;  2MC4 A;  3CF5 F;  2Z3Y A;  2FE3 A;  2MGQ A;  1UEL B;  3S93 A;  1B8I B;  4J00 A;  1QO0 D;  1G59 A;  2ZJ2 A;  3U21 A;  3WTZ A;  3SHF A;  5B66 C;  4DQ2 A;  3EUH A;  4RAY A;  4G7H F;  2XC7 A;  1SFX A;  3GX4 X;  1MMA A;  1LVA A;  3OSF A;  2LNB A;  1TZL A;  1D0X A;  1YOV B;  3COA C;  2R92 J;  4I09 A;  5DTD A;  1XGS A;  4A3L J;  3BOQ A;  2H6B A;  3IWF A;  3FK6 A;  3MMY B;  5CVR A;  1FOK A;  4EM0 B;  2EFQ A;  2KHM A;  2A6E F;  1D5V A;  2R7O A;  3FKJ A;  2E5N A;  1QHG A;  2NS8 A;  4RGX A;  1Y1V J;  1LEB A;  2FNA A;  4UHT A;  1MJB A;  4HG2 A;  5CVI A;  3CF2 A;  1FY7 A;  4UUV A;  3K69 A;  5HNH A;  3VYU B;  3HHG A;  2GXG A;  5FFZ A;  3H35 A;  5FKO A;  2MH2 A;  2QQ9 A;  3BT9 A;  4YFN F;  4B3A A;  2W1O A;  4GYG A;  4U0Y A;  5F08 A;  1VI0 A;  4FIS A;  5E17 F;  4A0Z A;  2NYX A;  2X9D A;  4RDU A;  2FF4 A;  1GXQ A;  2DPD A;  4B47 A;  4U87 A;  4HF2 A;  3FXL A;  2NVT J;  4YG2 F;  4HX8 A;  3ZQ7 A;  1R6R A;  3TKY A;  3FXU A;  4IF4 A;  2ELH A;  3S1Q J;  3MEX A;  3CC4 I;  4M3F A;  3U2R A;  1YFH A;  5FRN A;  2CSO A;  3GTQ J;  3TGN A;  2I5U A;  4JX6 A;  4TV7 A;  3LST A;  4ITV A;  4XLA A;  5DCF A;  2IA2 A;  4I98 B;  5KCM A;  3AG1 H;  5GAH J;  3U1D A;  3O8H A;  3WE3 A;  5F6F A;  1DGR M;  4HYE A;  3GTM J;  1J9I A;  4UV8 A;  3FKI J;  1N25 A;  1IV8 A;  2HYF A;  2OQG A;  3IWZ A;  1FWZ A;  2QCO A;  3ZQG A;  2ME6 A;  4IRG A;  4L9T A;  3OR2 C;  2GIV A;  1FP2 A;  3BP8 A;  5K7Z A;  2E2J J;  2WAE A;  3W3C A;  4WX9 A;  5TGT A;  2XPV A;  2O7O A;  3BWG A;  3OIP A;  3WTS C;  2A5W A;  3GFJ A;  4CUG A;  1UJ8 A;  3AFH A;  1YW9 A;  4FET A;  4RBO A;  3I55 I;  2QEN A;  1YHQ I;  3ZMZ A;  1FIP A;  1P2F A;  2EB7 A;  4V2F A;  3SZP A;  1SD4 A;  3LMM A;  5IOY A;  1IN8 A;  5DM6 F;  3CME I;  2JRT A;  1MSF C;  2D1V A;  4IHX A;  3H3U A;  3JRG A;  2PJR B;  3HPG A;  2VQL A;  4EJT A;  1TWF J;  4KDP A;  1A6Q A;  2ADU A;  3TMO A;  1YI2 I;  3C2H A;  2WA0 A;  3BCA A;  3AG4 H;  3WE2 A;  3DLA A;  1NG6 A;  4L5E A;  5LLQ A;  2PMH A;  1HOM A;  1GUU A;  2Q2E B;  1BI1 A;  3ABU A;  1ZN2 A;  2LK2 A;  2R5Y A;  3F8C A;  2K7L A;  4B09 A;  3K4M A;  2QWW A;  4LIU A;  2M5W A;  1X19 A;  2Y2Z A;  3HRT A;  5LD2 C;  2GA1 A;  4DOZ A;  1IUF A;  2XF5 A;  4I02 A;  3K7A J;  3CCJ I;  1PDN C;  2IPQ X;  2M0M A;  2VC1 A;  4ETS A;  1LUJ B;  5IYC J;  1A5J A;  4H0E A;  1VQ7 I;  2ZO4 A;  3OV8 A;  2LRD A;  4UUT A;  1BJA A;  1I3A A;  5JHF A;  3CMY A;  3ESW B;  2CUJ A;  4XLC A;  3RZO J;  3GTK J;  2JA5 J;  3G3Z A;  4D1Q A;  3LAP A;  5E8G A;  5BQT A;  2CMP A;  5LFA A;  2XAH A;  1FSE A;  2XV4 S;  4GDF A;  3JSO A;  3QYE A;  1RKT A;  1MJA A;  2DDA A;  3H9G A;  2JZY A;  1J09 A;  1QA6 A;  4M6Y A;  1BL0 A;  4XOP A;  3WG7 H;  1X4P A;  4NQW A;  4BE1 A;  1A36 A;  4KIT B;  4U0V A;  4OOI A;  2RNG A;  3WU1 B;  3WTY C;  5ILU A;  2M34 A;  2W4S A;  2DMN A;  1R1T A;  1BR4 A;  3LSJ A;  1ETX A;  2ZME C;  1OCR H;  1QZY A;  4A69 C;  1D8J A;  2DA5 A;  1JGG A;  4L9J A;  3HZJ A;  2M1B A;  5D5W B;  1U78 A;  4N9H A;  1JJ8 C;  3CUO A;  1U5T C;  1WZ2 A;  3K10 A;  3BG9 A;  1IN5 A;  2DA4 A;  1FOW A;  4HQM A;  4ESB A;  1MH3 A;  4IRI A;  2OPT A;  4KIC A;  2LR8 A;  3NAR A;  2FUG 2;  1BA5 A;  3L09 A;  3KZI C;  4CYC B;  2F4M B;  1GLN A;  2V4J C;  5EDN A;  4XLP F;  2X6Y A;  4KT6 A;  1UB9 A;  2OQR A;  3FMR A;  3L9F A;  1P9Q C;  5DUI A;  2HS5 A;  5AON A;  3CES A;  3S32 A;  1P7I A;  5FRM A;  2C6Y A;  3KFW X;  4CYD A;  3S15 J;  1ZYR F;  2K9N A;  1YS6 A;  3BQY A;  2ISY A;  1E3O C;  1IG7 A;  3ULQ B;  1KQ0 A;  2H94 A;  1U5T A;  4QPO A;  2ACJ A;  5H6R A;  1MSE C;  5JHU A;  2OJE D;  1J75 A;  5LGN A;  1K79 A;  4OU0 A;  1ZAR A;  1B8I A;  3W2W A;  1TWA J;  4QLC U;  3ZMS A;  2ZXW H;  3AG3 H;  3OOP A;  3T5X A;  2STW A;  2JUC A;  3JTG A;  4A6E A;  5J4Y A;  2BE5 F;  4Y33 A;  2E5Z A;  2R7Z J;  5DUK A;  4LB6 B;  2LFB A;  4CZZ A;  3PIP F;  5FKK A;  4IHW A;  4JX4 A;  2VN2 A;  3HDD A;  4HX7 A;  2HKX A;  1SFK A;  2L9V A;  4BHC A;  3WHB A;  1YJN I;  1W7P D;  3GXO A;  2IGM A;  2V79 A;  1XC5 A;  5BMZ A;  1PP7 U;  4M3G A;  1TQI A;  4M9X A;  3CO6 C;  1JUS A;  4M74 A;  3O2P E;  4RGS A;  1XS9 A;  2GWR A;  3GFM A;  3CDL A;  5HDG A;  5JVT A;  3I59 B;  5ICG A;  3OYI A;  3Q5F A;  5BPD A;  4MTE A;  3L2C A;  2ESH A;  2OZU A;  2L2O A;  4WF2 A;  3CUQ B;  1MNM C;  1VQK I;  2DA2 A;  3F21 A;  2RDP A;  3HYI A;  1KA8 A;  4IHV A;  2ZC2 A;  3C3W A;  5EGO B;  1U9N A;  1S8N A;  1VF9 A;  2EWN A;  3CCQ I;  2HVS A;  1RPW A;  2E1M C;  4L9V A;  2W24 A;  2XB0 X;  3G1M A;  3RQI A;  2HQA A;  2DFE A;  4B1R A;  2VPL A;  1JXS A;  4RM2 A;  1WWX A;  2KT0 A;  1UG2 A;  2L7Z A;  1I27 A;  5E8I A;  2DA3 A;  2EK5 A;  2OZ6 A;  2KRH A;  2H6C A;  5K7H A;  3CUQ C;  4A2U A;  5BS6 A;  3BG7 A;  2A5Y B;  3HXL A;  4C3J J;  1TNS A;  2CW7 A;  4DYQ A;  3HOX J;  1XD7 A;  5JVG F;  2DDB A;  2DK8 A;  2HYG D;  3KEO A;  3JRF A;  3MAJ A;  3PIO F;  4A3K J;  3A4C A;  1W5T A;  3JRB A;  4C30 A;  2A3S A;  4RB1 A;  4WK8 F;  4GCV A;  3IKV A;  5EF6 A;  3ZN0 A;  4UNO A;  3GZ5 A;  1WFX A;  4CCM A;  4MO7 A;  1VQ6 I;  1RZ4 A;  4KN4 X;  2CW0 F;  3E6M A;  1QGP A;  1TWC J;  4A3I J;  4NC7 A;  2HNH A;  5HOO A;  4I7H A;  5KHD A;  3CUQ A;  3DU5 A;  1B59 A;  3H5R A;  3JRC A;  4MEY F;  1YJ9 I;  2R7R A;  4RM3 A;  1B4A A;  1MIJ A;  2K9S A;  3JTH A;  1W0T A;  2MLK A;  1ZG1 A;  3MZY A;  2IS6 A;  3IL2 A;  3PUB A;  1JTX A;  3ML6 A;  4B48 A;  4UUS B;  5FLM J;  3F3X A;  5F0H A;  1G4D A;  2K3P A;  4BJ6 C;  3BTI A;  2YX4 A;  3CC7 I;  5GPC A;  2CYY A;  5JLW A;  1V5E A;  2JSP A;  1O3R A;  1SMT A;  4MEX F;  3A0B C;  4P5O A;  2ZSI B;  3OY9 A;  2CUE A;  4XLH A;  1XCV A;  4U7B A;  1FBU A;  3N97 A;  3FZV A;  2EZL A;  1G3W A;  5DEQ A;  3HM5 A;  4BXU A;  2OUM A;  5HVQ C;  3OSG A;  2DAO A;  2Y0S A;  3CJQ B;  2HVR A;  3P9K A;  4PDK A;  2QGU A;  2W82 A;  1JHH A;  2F6C A;  1K6Y A;  1WJE A;  1YIT I;  4I76 A;  4K2E A;  3ABL H;  3GZ6 A;  4U88 A;  5F27 A;  2V7F A;  4E7H A;  2QEX I;  1R00 A;  3QPH A;  1GV5 A;  4XN3 A;  2ZJQ F;  1YJW I;  3D0S A;  4A3D J;  1T08 B;  2CW8 A;  1R4N B;  3FBI B;  1I3Q J;  3RTR A;  1IN7 A;  2COB A;  2VT2 A;  4CH7 A;  1FOX A;  5D6F A;  3K4K A;  3KEQ A;  2D2W A;  4HDU A;  3VWB A;  2LBF B;  2UWM A;  4E70 A;  1YRN A;  2KJB A;  2GXA A;  2XAG A;  3V8L A;  2L4M A;  3ZMT A;  2ID3 A;  2WV0 A;  3IH3 A;  3GUD A;  3HUG A;  1DGW Y;  1PJR A;  4C3H J;  3ZQI A;  2LC2 A;  1OCO H;  1L3L A;  1TLH B;  1OYI A;  2O5R A;  1MBF A;  1RRJ A;  3DBL B;  5EZG A;  4S05 A;  4RB3 C;  2K5C A;  2QVO A;  4N4O B;  3LFK A;  3M8E A;  3CCV I;  1T95 A;  2A6T A;  3CCM I;  2DN0 A;  2VI6 A;  1Z67 A;  3BJO A;  1IDY A;  3J7A O;  1X3W B;  4M9Z A;  3P5J A;  1TL8 A;  1T0F A;  3S3O A;  2V9V A;  2PQ8 A;  2FSW A;  2OCE A; 
#chains in the Genus database with same CATH homology
 5FFX A;  4RGU A;  3E5U A;  1FSH A;  3HTU A;  1ODD A;  1FP1 D;  5H20 A;  2BV6 A;  1G3S A;  3G73 A;  1H9T A;  3W6K B;  2F5E A;  1FT9 A;  2LSO A;  4LJZ F;  4IJA A;  3M1E A;  4ZH4 F;  1Q1H A;  3T1B A;  2P5V A;  1EV7 A;  5L3C A;  4WXH A;  5CVU A;  2RV8 A;  2FA5 A;  3MCZ A;  1Z7U A;  5A2Q K;  4RB2 C;  2VXZ A;  1GHC A;  3AAF A;  1P4X A;  1D8K A;  2XAJ A;  3GO5 A;  3MWM A;  4BQA A;  4MQV A;  3T8R A;  3P9I A;  1B6A A;  5A2Q Z;  1XDU A;  2E7W A;  3PFI A;  4M9S A;  2HQN A;  1AOY A;  2F5F A;  5ICE A;  4LLN A;  3ECH A;  2F2E A;  3C18 A;  2UXX A;  1SD5 A;  1OYW A;  4UVA A;  1ZLK A;  1IUY A;  3GYH X;  3QRF F;  2V1U A;  3ECO A;  2M8E A;  3E5Q A;  3HSR A;  4GGG A;  1XN7 A;  2CG4 A;  2RKH A;  3P9C A;  3K1N A;  2IA1 A;  3ZN1 A;  5DV5 A;  5DCM A;  2K4J A;  4ESF A;  2G9W A;  4AD9 A;  2HGC A;  4KN7 X;  4G94 A;  1HST A;  4KYW A;  3V4G A;  2BEO A;  5JFR A;  2DO7 A;  3E6B A;  4MNU A;  1H9G A;  1XB4 A;  4BHB A;  4A0X A;  3F6O A;  1R23 A;  4Y15 A;  4F7Z A;  1FBS A;  1EH7 A;  4BAY A;  4HAM A;  1R5H A;  3NRV A;  4EMS A;  4ENN A;  5ERI A;  4UVC A;  3WTX C;  4Q4Z F;  2VBX A;  1S7O A;  4CHU A;  1PP8 F;  1SMY F;  3GW2 A;  3Q9V A;  3D5L A;  5LGT A;  2P5L C;  1K7A A;  1C0W A;  3SFZ A;  4BH9 A;  4LGW A;  3QU6 A;  3RYR A;  3KP7 A;  2YX7 A;  1ZG3 A;  1FNN A;  3F6V A;  3E6D A;  2K27 A;  1LDJ A;  3RJP A;  3R60 A;  1HW2 A;  2P7C B;  2DT5 A;  1UHW A;  3LA2 A;  4N0B A;  2V1X A;  2L3D A;  2X4H A;  2FQ3 A;  4O6J A;  1SFE A;  2M45 A;  4LMY A;  3BJA A;  1S6L A;  5CVJ A;  3ZMD A;  3GFL A;  3W6J B;  2K02 A;  5ED4 A;  1F1Z A;  2O03 A;  3HSF A;  4PGG A;  3HTS B;  1OR7 A;  4EJO A;  3KET A;  2X0L A;  5F1R A;  2FBI A;  2YU3 A;  4ESJ A;  3KZZ A;  4RB0 A;  2P4W A;  2VT3 A;  1ZGA A;  1BM9 A;  1G3Y A;  2KIF A;  1SD6 A;  3HIF A;  1O3Q A;  1QBJ A;  2ZNZ A;  1PUE E;  3J80 Z;  1YG2 A;  2LDU A;  2XGX A;  5J8F A;  3E97 A;  2CWE A;  1G6N A;  2XAS A;  1T39 A;  1ZAO A;  4LFU A;  1YIO A;  2JTV A;  1V3F A;  2PI0 A;  1XMA A;  3DKW A;  4ENJ A;  4G9Y A;  2ZBK A;  2XIG A;  4XLN F;  2YSR A;  3LQR A;  5EEH A;  4JQF A;  2O8X A;  2BGC A;  3V8K A;  2GAU A;  1FYK A;  2LF7 A;  5J6X A;  2FXA A;  4JK1 X;  4LG0 B;  2IW5 A;  3I4P A;  3U9G A;  5TJJ A;  3R6S A;  5LHG A;  4OIO F;  3C7J A;  3K2Z A;  3LQQ A;  2Q2E A;  3TDU C;  4WXC A;  3DP7 A;  4FX0 A;  1UST A;  2QYO A;  2PJP A;  2E1C A;  2FBK A;  1WQ2 A;  2P7V B;  5K5R A;  1KU7 A;  4KA4 A;  1LDK B;  4I0A A;  5E1X A;  5HS9 A;  3F8B A;  4Q48 A;  5BOX A;  2ISZ A;  3R0J A;  1ZRD A;  5H6Q A;  3IRR A;  3N4M A;  2EFO A;  3FHZ A;  4AVP A;  2MLG A;  4FHT A;  2A68 F;  4RAZ A;  1P4W A;  3IC7 A;  1UFM A;  4ZYD A;  3GVA A;  5CLS A;  3TOB A;  2KRF A;  3WOD F;  2DI3 A;  3K1P A;  3DF8 A;  3L7W A;  4BNC A;  2DPU A;  2ZNY A;  1J5Y A;  4UXN A;  2BBY A;  2EFW A;  3KLO A;  2XHK A;  5E1W A;  3ZPL A;  3KCC A;  4Q5S F;  3EDP A;  4L0Z B;  3CDH A;  4IPA A;  4HF0 A;  2DTR A;  1HKS A;  2OU2 A;  4UV9 A;  3KP6 A;  1KU2 A;  4P96 A;  3V8J A;  1R5G A;  4IRH A;  3WTU C;  4HZF A;  2EFN A;  1OYY A;  3F8M A;  2VBZ A;  1F9N A;  4KMF A;  5JR3 A;  3O3K A;  3M7G A;  5D5X B;  4EGY A;  4NB5 A;  5DD8 A;  3GFI A;  2DFI A;  2Q0O A;  3ZMV A;  3F8N A;  2VBW A;  4L5I A;  2VBY A;  3FM5 A;  4ASN A;  3K1M A;  3VB2 A;  5KVR A;  2JPC A;  1FBQ A;  2DW4 A;  4A6D A;  3DEU A;  4HW0 A;  1O3T A;  1TNT A;  1XGN A;  1IXC A;  2UXN A;  4KFC A;  3WTV C;  4XSZ F;  2W85 A;  1CF7 B;  3F8F A;  4HF1 A;  1YS7 A;  1BC7 C;  2RVC A;  3DFG A;  5K5O A;  2Z33 A;  2FBH A;  1BI2 A;  3DV8 A;  5CYV A;  4FX4 A;  3SZT A;  4OIN F;  3CJN A;  5E1Z B;  3SQN A;  3TDZ C;  1K78 A;  3FXQ A;  2A6H F;  3H3Z A;  2V1D A;  3ERE D;  4RGR A;  4KT5 C;  2HOE A;  3R61 A;  4MGR A;  1L0O C;  3HSE A;  2FNP A;  2JT1 A;  4G6D A;  2YPR A;  5IT9 Z;  2V6C A;  3I58 A;  3RI4 A;  1I5Z A;  1JHF A;  4AIJ A;  2UZK A;  5ICF A;  3I54 A;  1BI0 A;  1YYV A;  5D6E A;  2R7D A;  1XDS A;  2HKO A;  3DPT A;  4EJU A;  3QOP A;  1F4K A;  4OIR F;  3RKW A;  1G3T A;  2L02 A;  5BPI A;  2Y0M A;  4KMU X;  4LB5 A;  2STT A;  4L5J A;  2IA0 A;  4S04 A;  1T2K A;  1BIB A;  4ZYH A;  4P9F A;  5LEJ A;  2DQL A;  1BBY A;  2MH9 A;  3CTA A;  3FMS A;  1KQ9 A;  5HS7 A;  4OMY A;  4PCQ A;  2QBY A;  2COM A;  5L3D A;  1IXR C;  4Q47 A;  1RI7 A;  4ON0 A;  3I59 A;  3PQK A;  1GXP A;  2E1N A;  1OPC A;  1VTN C;  1WI9 A;  5DYM A;  5LBQ A;  2QQB A;  3MQ0 A;  4YII A;  2VOP A;  1XCB A;  2H09 A;  1KGS A;  3HOS A;  4YIF A;  3BDD A;  4EQQ A;  2F5D A;  5HLH A;  3J81 K;  3ABT A;  2O6G E;  1QPM A;  4XBF A;  4BHP A;  4ZZL A;  1IXS B;  1EH6 A;  5F64 A;  5L3G A;  3KP3 A;  1P92 A;  4P55 A;  4EM2 A;  2Y48 A;  1KYW A;  2Z5U A;  1EH8 A;  2RC4 A;  2CGP A;  1YO5 C;  3TQN A;  1ZRF A;  2QZ8 A;  4WXD A;  3L00 A;  4AIK A;  2O3F A;  2XRO A;  5LGU A;  1FPQ A;  1HKT A;  3R4K A;  1S3J A;  4XRF A;  4R79 A;  1FX7 A;  3ISP A;  4LK1 F;  1LNW A;  1T98 A;  2NNN A;  4Y13 A;  1R7J A;  1Z6T A;  2IRF G;  3KP4 A;  2GXB A;  4UVB A;  3DQV C;  3IHU A;  2HZT A;  2J5O A;  1SD7 A;  1SAX A;  3QPT A;  3I71 A;  1O3S A;  3IKT A;  1TBX A;  4M71 A;  5ILV A;  4N9I A;  3WGH A;  2XKP A;  2ZCW A;  4HBL A;  3KP2 A;  3V7R A;  3H92 A;  1WKM A;  2ZXJ A;  4OMZ A;  4WWC A;  1FYM A;  5DD4 A;  2VC0 A;  2KJC A;  3KZY A;  2L54 A;  2VE8 A;  5DDG A;  1YW7 A;  4U0W A;  4HV5 A;  2D1H A;  1BN5 A;  3TOA A;  3I5U A;  1U5T B;  2WC2 A;  2QBY B;  3PQJ A;  1KYZ A;  1TQM A;  1D3Y A;  1XSX A;  3EQL F;  2OAZ A;  2PBI A;  2KKO A;  4I0B A;  2OBP A;  5J8C A;  4A0Y A;  3S2W A;  4KIF A;  4L18 B;  2DU9 A;  2MBF A;  2EA2 A;  5E18 F;  1HW5 A;  1IZ1 A;  1P6R A;  2PN6 A;  1USS A;  2QLZ A;  2MA3 A;  4GYI A;  5HDN A;  1Z05 A;  2RQP A;  4I01 A;  1YQA A;  1HBX G;  5D5U B;  1XSV A;  2BYV E;  3KLN A;  2EA4 A;  2HEO A;  2XRN A;  3LA7 A;  4P9U A;  4LLL A;  3GWZ A;  1OKR A;  3RKX A;  1IW7 F;  2ZFW A;  3O6B B;  2KIM A;  1U2W A;  4KUM A;  5HS8 A;  5AIP A;  1QZZ A;  3FM3 A;  3P7N A;  4IVN A;  1XGM A;  5D4R A;  4LLG F;  4HLY A;  3EET A;  1K6O A;  4D0P A;  5FD6 A;  3B73 A;  2HTJ A;  1J59 A;  1BC8 C;  1REP C;  2M87 A;  2VOD A;  2ZME A;  5FB2 A;  5HLG A;  4CDG A;  5LHH A;  3ROU A;  1MJ9 A;  3HOT A;  3E3V A;  2R7F A;  4OIP F;  3RPU A;  2CFX A;  1DP7 P;  3KP5 A;  1R36 A;  2XUB A;  3VOD A;  4WCG A;  3VFZ A;  1MDM A;  4A5M A;  1BIA A;  4GO1 A;  3LAJ A;  3QP5 A;  2QQA A;  3T8T A;  1BOA A;  3JAM Z;  2PEX A;  2XAQ A;  2O61 A;  3IRQ A;  2R3S A;  1B9N A;  1ZH5 A;  1MZB A;  3WGI A;  1S29 A;  2TDX A;  5IT9 K;  3C1D A;  3WGG A;  3QAH A;  2FML A;  3ZMU A;  2XVC A;  2L4A A;  4YFK F;  4AIH A;  4RS8 A;  2PFB A;  5TRD A;  3RYP A;  1LQ1 A;  2CO5 A;  1J7K A;  1I6X A;  3FXR A;  4B8X A;  5K5Q A;  5E20 A;  2LF8 A;  1B1B A;  4EVI A;  1ZRE A;  4NHJ A;  4Z2Y A;  4HQE A;  1E17 A;  4HV6 A;  1LDD A;  2HR3 A;  3RDI A;  1RNL A;  3GLX A;  3LA3 A;  5ICC A;  4PZJ A;  1QQI A;  2PMU A;  3MZH A;  4ZYG A;  4EM1 A;  4R8H A;  4GXO A;  1R1V A;  1MKM A;  2J5P A;  3BRO A;  1WRJ A;  2M30 A;  4XSX F;  1TW2 A;  4OIQ F;  4IXA A;  2Y75 A;  2ZKZ A;  3FX3 A;  2VOO A;  5DCM B;  4EGZ A;  2JPB A;  5ILS A;  3DXJ F;  2XKO A;  5D8K B;  4A12 A;  2HWV A;  3HRU A;  2G7H A;  3VOE A;  3WG9 A;  1K78 B;  1IF1 A;  4R1H A;  1KU9 A;  3RIR A;  3FMQ A;  1I1G A;  5L3F A;  3HRM A;  3E6C C;  4Y17 A;  2QM3 A;  2FMY A;  1V4R A;  2W84 A;  3T0Y A;  1BI3 A;  4ZYE A;  2B0L A;  5D8L B;  4LG0 A;  2A61 A;  2HFH A;  4ZZD A;  4KIB A;  5CJ9 A;  4DNC A;  2EV5 A;  1HXD A;  4G7Z F;  1E2X A;  2ESN A;  4KNY A;  1YW8 A;  2K4B A;  2G7U A;  1P4A A;  2LKP A;  3K0L A;  4PGH A;  4EJV A;  1UCR A;  1DDN A;  2FEZ A;  5LRR A;  3BJ6 A;  4HDV A;  3CLO A;  1IAW A;  2W25 A;  1F5T A;  2AXL A;  1I1S A;  1XSD A;  2HDC A;  2DLL A;  3FWE A;  4G8X A;  1ULY A;  2GZW A;  4FT8 A;  5FLX Z;  3HHH A;  5LEK A;  5IT3 A;  3J81 Z;  4LK0 F;  5L3B A;  4HLX A;  2NNY A;  1O57 A;  5HLI A;  4MQ9 F;  2MC3 A;  1J0R A;  4EV0 A;  4A5N A;  2K86 A;  2VE9 A;  3I53 A;  3I0T A;  1IN4 A;  1W7P A;  2EV0 A;  1X3U A;  3JW4 A;  4I2O A;  2MD5 A;  1HSJ A;  1U6G A;  2KIU A;  3QU3 A;  1MD0 A;  3WU0 A;  4EJW A;  3MFK A;  1LJ9 A;  1DUX C;  4JBA A;  1FC3 A;  1ON1 A;  2YR2 A;  2P5K A;  4IHS A;  1FLI A;  2Q8K A;  3K9T A;  5D5V B;  3NQO A;  1HKQ A;  4CGZ A;  1KQ8 A;  2AS5 F;  2F5C A;  2XAF A;  3DPL C;  1LB2 A;  3KE2 A;  5LHI A;  4L9N A;  3M8F A;  3M9A A;  1HQC A;  1T38 A;  1IRF A;  2WTE A;  3BY6 A;  3GF2 A;  3HRS A;  3ELK A;  1TQP A;  5LRS A;  2GA2 A;  1OMI A;  1DPU A;  4G7O F;  3BPX A;  2JSC A;  1ZRC A;  3BZ6 A;  3NEU A;  3Q9S A;  3SXY A;  3FF5 A;  2IT0 A;  2OA4 A;  4AWX B;  2GQQ A;  4HOB A;  1ONV A;  2NAZ A;  1ON2 A;  1J2X A;  1JE8 A;  3CO7 C;  2CQK A;  2VON A;  1NHA A;  5FGM A;  5KK1 A;  3J80 K;  3BPV A;  2W57 A;  3WTW C;  1FZP B;  2HQR A;  3B02 A;  1H0M A;  1W4M A;  1O7L A;  3WTT C;  1T6S A;  2QUF A;  1RIO H;  3RKY A;  4ENM A;  2A07 F;  1RUO A;  1WSU A;  5JI6 A;  4ENK A;  1R1U A;  2RNJ A;  1B9M A;  4L0Y B;  4QWQ A;  2IVM A;  1RUN A;  3F23 A;  5FLX K;  2IJL A;  3VEP A;  1JGS A;  4HA8 A;  3REO A;  3V7S A;  1S7A A;  4M73 A;  4IHT A;  2DQR A;  2IP2 A;  1TW3 A;  1HW1 A;  4YFX F;  2L01 A;  1R58 A;  2DK5 A;  1FYL A;  1DPR A;  1O7F A;  1LEA A;  5K1Y A;  1Z1D A;  6PAX A;  1UHM A;  3EYY A;  1A04 A;  3F72 A;  2Z99 A;  2NS0 A;  3V7C A;  1Z6R A;  2P8T A;  3QP6 A;  4M72 A;  2O0Y A;  2FOK A;  3JSP A;  4U7D A;  2EFP A;  3RPQ A;  3ZP5 A;  1U3E M;  3F22 A;  1XMK A;  4MHG A;  2H27 A;  2ETH A;  2Z9O A;  1W7P B;  5FD5 A;  3GEZ A;  4KIG A;  1STZ A;  2A69 F;  4BYY A;  1AWC A;  3I64 A;  4LD5 A;  1IN6 A;  2P6T A;  2FRH A;  1QNT A;  2EJR A;  4CXF A;  1IRG A;  2OD5 A;  4M6X A;  1Z9C A;  4O5V A;  1ZG5 A;  5D4S A;  1ZLJ A;  1SFU A;  1W5S A;  2E7X A;  3TO6 A;  1CF7 A;  5FO5 A;  2D45 A;  2EV6 A;  4HX4 A;  1XGO A;  2DBB A;  2ZME B;  1Y0U A;  2NRA C;  1Z91 A;  4G6Q A;  5AIQ A;  5EEG A;  1ZGJ A;  3TO7 A;  4CIC A;  2FU4 A;  2RN7 A;  3R0A A;  3EYI A;  2PG4 A;  1YTY A;  2RGV A;  1KU3 A;  1YLF A;  3E5X A;  5CVV A;  2P6S A;  1R22 A;  1MDM B;  1CGP A;  5HDK A;  1ZHF A;  2HTS A;  1MGT A;  3JAM K;  1U8R A;  4O3M A;  3TO9 A;  2WWY A;  5L3E A;  4CO8 A;  3LWF A;  2PLY A;  4MTD A;  1TTY A;  1GVJ A;  2Z3Y A;  2FE3 A;  1QO0 D;  2ZJ2 A;  3WTZ A;  3SHF A;  4DQ2 A;  3EUH A;  4RAY A;  4G7H F;  1SFX A;  3GX4 X;  1LVA A;  2LNB A;  3COA C;  4I09 A;  1XGS A;  3BOQ A;  2H6B A;  3IWF A;  5CVR A;  1FOK A;  4EM0 B;  2EFQ A;  2A6E F;  1D5V A;  4RGX A;  1LEB A;  2FNA A;  4UHT A;  1MJB A;  5CVI A;  1FY7 A;  4UUV A;  3K69 A;  3HHG A;  2GXG A;  5FFZ A;  2MH2 A;  2QQ9 A;  4YFN F;  4GYG A;  4U0Y A;  5E17 F;  4A0Z A;  2NYX A;  2FF4 A;  1GXQ A;  2DPD A;  4HF2 A;  4YG2 F;  4HX8 A;  3ZQ7 A;  3TKY A;  3FXU A;  4IF4 A;  2ELH A;  3MEX A;  3U2R A;  1YFH A;  2CSO A;  3TGN A;  4TV7 A;  3LST A;  5DCF A;  2IA2 A;  4I98 B;  3U1D A;  3WE3 A;  5F6F A;  4HYE A;  1J9I A;  4UV8 A;  2HYF A;  2OQG A;  3IWZ A;  1FWZ A;  4IRG A;  4L9T A;  2GIV A;  1FP2 A;  3BP8 A;  4WX9 A;  3BWG A;  3WTS C;  3GFJ A;  1YW9 A;  2QEN A;  3ZMZ A;  1P2F A;  2EB7 A;  3SZP A;  1SD4 A;  1IN8 A;  2JRT A;  2D1V A;  3H3U A;  4EJT A;  4KDP A;  2ADU A;  3WE2 A;  5LLQ A;  2PMH A;  1BI1 A;  3ABU A;  1ZN2 A;  3F8C A;  2K7L A;  4B09 A;  2QWW A;  2M5W A;  3HRT A;  2GA1 A;  4I02 A;  1PDN C;  2IPQ X;  2VC1 A;  4ETS A;  4H0E A;  2ZO4 A;  3OV8 A;  1BJA A;  3G3Z A;  3LAP A;  5E8G A;  5BQT A;  2XAH A;  1FSE A;  2XV4 S;  3JSO A;  1MJA A;  2JZY A;  4M6Y A;  4NQW A;  4U0V A;  4OOI A;  3WU1 B;  3WTY C;  5ILU A;  1R1T A;  1QZY A;  1D8J A;  4L9J A;  2M1B A;  5D5W B;  1U78 A;  4N9H A;  3CUO A;  1U5T C;  1IN5 A;  4HQM A;  4ESB A;  4IRI A;  4KIC A;  3L09 A;  4XLP F;  1UB9 A;  2OQR A;  3FMR A;  3L9F A;  5DUI A;  2HS5 A;  5AON A;  2C6Y A;  3KFW X;  4CYD A;  1ZYR F;  1YS6 A;  2ISY A;  3ULQ B;  1KQ0 A;  2H94 A;  1U5T A;  2ACJ A;  5H6R A;  5JHU A;  1J75 A;  5LGN A;  1K79 A;  4OU0 A;  1ZAR A;  4QLC U;  3ZMS A;  3OOP A;  3T5X A;  2STW A;  3JTG A;  4A6E A;  2BE5 F;  5DUK A;  4LB6 B;  4CZZ A;  2VN2 A;  4HX7 A;  2HKX A;  4BHC A;  1W7P D;  3GXO A;  2V79 A;  5BMZ A;  1PP7 U;  1TQI A;  4M9X A;  3CO6 C;  4M74 A;  3O2P E;  4RGS A;  2GWR A;  3GFM A;  5HDG A;  5JVT A;  3I59 B;  5ICG A;  3Q5F A;  5BPD A;  4MTE A;  3L2C A;  2ESH A;  2OZU A;  4WF2 A;  3CUQ B;  3F21 A;  2RDP A;  3HYI A;  1KA8 A;  3C3W A;  1S8N A;  2EWN A;  4L9V A;  2W24 A;  1JXS A;  1WWX A;  1I27 A;  5E8I A;  2EK5 A;  2OZ6 A;  2H6C A;  3CUQ C;  4A2U A;  5BS6 A;  2A5Y B;  1TNS A;  1XD7 A;  2DK8 A;  2HYG D;  3KEO A;  3MAJ A;  1W5T A;  2A3S A;  4RB1 A;  4WK8 F;  4GCV A;  3IKV A;  3ZN0 A;  4UNO A;  3GZ5 A;  1RZ4 A;  4KN4 X;  2CW0 F;  3E6M A;  1QGP A;  5HOO A;  4I7H A;  3CUQ A;  1B59 A;  4MEY F;  1B4A A;  3JTH A;  2MLK A;  1ZG1 A;  3MZY A;  3IL2 A;  3ML6 A;  3F3X A;  1G4D A;  2YX4 A;  2CYY A;  1O3R A;  1SMT A;  4MEX F;  4P5O A;  3N97 A;  4U7B A;  1XCV A;  1FBU A;  3FZV A;  1G3W A;  5DEQ A;  4BXU A;  5HVQ C;  2DAO A;  3P9K A;  4PDK A;  1JHH A;  4K2E A;  3GZ6 A;  4U88 A;  1R00 A;  3QPH A;  3D0S A;  3RTR A;  1IN7 A;  2VT2 A;  5D6F A;  3KEQ A;  2D2W A;  4HDU A;  2UWM A;  4E70 A;  2KJB A;  2XAG A;  3V8L A;  2L4M A;  3ZMT A;  2WV0 A;  3GUD A;  3HUG A;  1L3L A;  1TLH B;  1OYI A;  4S05 A;  4RB3 C;  2QVO A;  3LFK A;  3M8E A;  3BJO A;  3J7A O;  4M9Z A;  1T0F A;  2V9V A;  2PQ8 A;  2FSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...