5KVRA

X-ray crystal structure of a fragment (1-75) of a transcriptional regulator pdhr from escherichia coli cft073
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
NAMAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Pyruvate dehydrogenase complex repressor
publication title X-Ray Crystal Structure of a Fragment (1-75) of a Transcriptional Regulator PdhR from Escherichia coli CFT073
rcsb
source organism Escherichia coli o6:h1 (strain cft073 / atcc 700928 / upec)
total genus 21
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5kvrA00
4HF2A 2EFQA 1ZLKA 4ZYGA 3T0YA 4CDGA 5CLSA 4G7ZF 4IXAA 4L9JA 2X0LA 1TQIA 3GLXA 2H09A 4XRFA 2NNNA 4JQFA 4EVIA 2JPCA 1ZN2A 2VN2A 1DDNA 1H0MA 4HA8A 3D5LA 3GYHX 4OIOF 1WQ2A 1F4KA 1YW7A 4HLYA 4B8XA 3I59A 1XMAA 1MZBA 1LVAA 4S04A 4KNYA 3R0AA 3ML6A 4M9ZA 2JT1A 1IXSB 3M8EA 1BN5A 5J8FA 5DUKA 1IRFA 1W7PA 4OMYA 3FZVA 3PFIA 3J80Z 4Q47A 3OOPA 5CYVA 2W57A 1GHCA 3WODF 3GUDA 4OOIA 2TDXA 2V1DA 2L4MA 2KJCA 2Y0MA 2WTEA 3JW4A 3O6BB 1FYKA 4LG0A 5D6EA 4KN7X 2FMLA 4OINF 3K0LA 1QQIA 1XGOA 2F5CA 1J9IA 5E17F 4H0EA 1YS7A 2OQGA 1Z9CA 5HLIA 2ISZA 5CJ9A 5JFRA 2KIFA 1FP2A 3CO7C 2Y48A 3HSRA 4MTDA 2FA5A 1XDSA 3KEQA 2D45A 3V7RA 3V8JA 3WU0A 4MQ9F 3QU6A 3RYRA 2GZWA 4HQEA 1FSHA 3WGGA 2NAZA 3CUQB 4AVPA 1LDDA 2P6TA 5HDGA 2FBHA 5DD4A 4HDUA 4U0VA 1Z1DA 4GGGA 3PQKA 3QPTA 2PI0A 2XAFA 3SXYA 1DUXC 2HQRA 3ZMVA 2L4AA 1SMTA 2DAOA 1FC3A 4BXUA 4LJZF 3GVAA 3ECHA 1HW2A 3Q9VA 1D8JA 4A0YA 3KZYA 3W6KB 1Z05A 2QENA 3GZ5A 3WGHA 4ENNA 3KFWX 3BDDA 4P96A 3KZZA 2EB7A 4G94A 4AIKA 4IRIA 3RTRA 1ZG3A 2IA2A 2FBKA 5HS9A 2STWA 1T98A 1K79A 2XUBA 2OD5A 3L2CA 1IXCA 2HKXA 1H9TA 3EQLF 2FQ3A 2GAUA 2YR2A 1LDKB 2AS5F 1W4MA 3DKWA 2RDPA 3FMSA 4LK1F 2LSOA 5LRSA 4M9XA 4ON0A 1ON1A 3TKYA 3F8FA 4CGZA 1B59A 2CYYA 4L0ZB 3HIFA 5DEQA 4I09A 1KU9A 4F7ZA 2K86A 4PCQA 1XGNA 2CO5A 2A3SA 3J81Z 2MH9A 4D0PA 2QZ8A 4KFCA 2ZKZA 1U78A 5L3GA 2P6SA 2VONA 1OPCA 2WWYA 1WWXA 4IHTA 3K1PA 1TLHB 4UV8A 2ZO4A 3DXJF 3H3UA 5K5QA 3RYPA 1QO0D 2IP2A 3VFZA 2QQBA 4UV9A 1OYYA 2VBZA 3T5XA 4HZFA 4RGUA 4U88A 3JTGA 2FU4A 2ZMEA 3BZ6A 3J81K 3I59B 5D5UB 3HYIA 4G9YA 4BQAA 2O0YA 5L3DA 1FLIA 2ADUA 2VBWA 1J7KA 1KU7A 2NS0A 2WC2A 1G6NA 2DPDA 2MLKA 3TO9A 3WE3A 4OIRF 5LBQA 3HRMA 3ZP5A 1YO5C 2FNAA 3RPUA 1D5VA 3R60A 1IAWA 3F6OA 4U0WA 1PP8F 4ASNA 2UXXA 2E1NA 1R00A 1KQ9A 5IT9Z 5LHIA 2Z5UA 1USSA 2HS5A 2L01A 5ICCA 1CGPA 4RS8A 3NEUA 5HOOA 5F6FA 1KA8A 1YG2A 2F5EA 5CVJA 3FM5A 2H6BA 4Y15A 3IL2A 2ESHA 2QWWA 2K02A 3U1DA 3DQVC 4KN4X 3HTUA 3GX4X 2HTJA 3QPHA 4BAYA 2IJLA 3BJ6A 3DEUA 4HLXA 1I6XA 5CVRA 5HS7A 2ZCWA 5BMZA 1T6SA 1XN7A 1V3FA 1RI7A 2ZNYA 4G6QA 4QLCU 3E6BA 2HQNA 2CGPA 3I4PA 2PEXA 4ZYHA 1T39A 2VE9A 3HHGA 2ZJ2A 4KMFA 3SZPA 5JR3A 1WRJA 1ZARA 1UCRA 1HQCA 2P7VB 2D1VA 5HLHA 4AWXB 2F5DA 3TO7A 2R7FA 1ONVA 3MAJA 1FNNA 3KP4A 2XKOA 4BH9A 5E18F 3CDHA 4A6EA 2VC1A 4DNCA 1ZLJA 2HTSA 4WXCA 4PDKA 3ZQ7A 5DV5A 4Y17A 1KU2A 3I54A 1K7AA 2QBYB 2FXAA 3R6SA 3MCZA 2WV0A 3O3KA 1O57A 1P4WA 2ISYA 2HR3A 1HKSA 4KICA 4EGYA 1DPUA 1YIOA 4EJUA 3V7CA 1EH6A 1E2XA 2E7WA 2K4BA 1QBJA 4L9NA 4Y13A 3GXOA 4ETSA 2QQ9A 3CUQA 2YX7A 2DTRA 4EQQA 4EGZA 1MJBA 5A2QK 4HX4A 1FBSA 4CHUA 4CZZA 1WI9A 2M30A 5CVVA 2GQQA 3BOQA 4JBAA 1W5TA 3DFGA 4YFKF 3F22A 1O3QA 3RIRA 2ZMEB 4N9HA 2XRNA 5E20A 2XHKA 4Z2YA 4WX9A 2CSOA 1S7AA 3ROUA 1XMKA 1IN7A 5LLQA 3C18A 2FMYA 2M87A 1A04A 2P5VA 2W24A 4UVBA 4KIGA 3L00A 4MNUA 3IKVA 2K27A 4BHBA 1IRGA 1HXDA 2VOPA 4LB5A 2W25A 4ZYDA 4RAZA 4XLPF 3N97A 3TOAA 5D4RA 4BNCA 5ILSA 3H92A 1JE8A 3AAFA 2D2WA 4O6JA 3SHFA 3CO6C 1IN4A 3BJAA 1B6AA 3HRUA 1D8KA 1T2KA 2J5PA 2JPBA 5ICEA 2V9VA 1JHHA 4P5OA 5K1YA 2PQ8A 1B9MA 2M1BA 3ZN0A 3CJNA 3WE2A 3TGNA 3E5XA 3WTWC 4MEYF 1EH8A 4HF1A 3U9GA 1KYWA 1XGSA 4L5IA 4KMUX 2EA2A 2HEOA 5FLXZ 5LHGA 4LK0F 3TDZC 2EFNA 1GVJA 2XAQA 2VBXA 1U6GA 2P5KA 2QM3A 5D6FA 3COAC 4RGRA 4L0YB 2FF4A 4GXOA 4HAMA 4EJVA 1YYVA 1ZGAA 3IHUA 3ELKA 5FLXK 3HTSB 3WTTC 1K6OA 1MD0A 3I0TA 3LFKA 1U8RA 1SFUA 2PMHA 5BQTA 2BE5F 4NQWA 3ULQB 1I5ZA 4TV7A 4EM0B 1BOAA 2IT0A 2P5LC 2DQRA 3FF5A 3C7JA 5K5OA 1J2XA 1WSUA 2HFHA 1H9GA 2V79A 5LEKA 3KEOA 1IN6A 4ESBA 1TBXA 1KYZA 1SFEA 2G9WA 2Z3YA 5LRRA 2RV8A 5BOXA 1U5TC 3KLOA 4XLNF 1MKMA 1LDJA 1IUYA 3E6MA 2BYVE 3J80K 4P9FA 4WCGA 4XBFA 3L9FA 4EM1A 2M8EA 3R61A 2LNBA 3HSFA 1FZPB 4LD5A 3B73A 1P6RA 1D3YA 5FO5A 1MDMA 1G3WA 3IWZA 3LAPA 2DT5A 1LNWA 1V4RA 1GXPA 2M5WA 2JTVA 1GXQA 3BY6A 3C1DA 4B09A 3CUOA 4PGHA 2EFWA 1BC8C 3M9AA 3V4GA 3Q5FA 5LGTA 3ISPA 3G73A 2LDUA 3WU1B 5DD8A 3KE2A 4WWCA 2EV0A 1UHWA 2BV6A 4KUMA 3O2PE 3LWFA 4I7HA 1JHFA 4EJWA 1HBXG 5L3EA 3ZMTA 4EJOA 4A6DA 1XCVA 1IN5A 1G3TA 3ZMDA 4KIBA 3H3ZA 3IWFA 4I0AA 4FX4A 4FT8A 3FMQA 2PN6A 2YSRA 3WTXC 2X4HA 2VODA 2CQKA 2RNJA 2QBYA 4HX8A 5HVQC 3VODA 2HGCA 2C6YA 5E8GA 1DP7P 3FMRA 4YFXF 2DPUA 4HQMA 1IF1A 4U7BA 3CTAA 4I0BA 1PDNC 2DK5A 3OV8A 1ULYA 2P8TA 2DQLA 3WGIA 3WTZA 3DF8A 3L7WA 1SAXA 2XKPA 3KCCA 2STTA 2A68F 5FGMA 2V1XA 2IVMA 5D5XB 2PBIA 1FWZA 2JSCA 2XROA 3VB2A 3F8CA 3JAMZ 2VE8A 4G6DA 5AIPA 1ZRFA 2F5FA 3EDPA 3ABTA 5ILUA 2OBPA 1EH7A 5ED4A 1UB9A 4A2UA 1UFMA 5E1XA 1I27A 3I5UA 3G3ZA 1FYMA 1BIAA 1TQPA 4GYGA 3IC7A 3EETA 3R4KA 4LLLA 3JSOA 1RIOH 3TOBA 2NRAC 4GCVA 5ICGA 3QAHA 2FRHA 2MH2A 4YFNF 3MQ0A 4BHCA 2A69F 3DP7A 1FY7A 2KIUA 3GF2A 2YU3A 1O3TA 1P2FA 1K78B 3RI4A 1SMYF 4EJTA 4Q48A 4OIQF 3V7SA 4G8XA 2HWVA 4HYEA 1XSDA 4ENMA 2H6CA 5F1RA 2L3DA 1P4AA 1G3SA 1SD4A 1LJ9A 1CF7A 1JGSA 5L3FA 2O03A 2VC0A 4HV5A 2XV4S 1XB4A 4LB6B 5IT9K 3MWMA 2XAGA 2RVCA 3BPVA 1R23A 2BGCA 1OR7A 5J8CA 1MDMB 4S05A 5H6RA 2HKOA 2R7DA 2V6CA 3P9KA 4RGSA 1MJAA 4UVCA 2LKPA 5TJJA 2CFXA 2IA1A 2A6HF 2G7HA 4PZJA 3BP8A 2OAZA 1OMIA 4YIIA 3F8NA 1B1BA 1ZHFA 1BI3A 4EMSA 4LGWA 4OIPF 2MBFA 1YS6A 3EYYA 1FP1D 3F72A 3FXRA 5E1WA 4I01A 1OKRA 2UWMA 4L9TA 4BHPA 2GWRA 4CXFA 4ESJA 4IRGA 1FOKA 2IRFG 2PFBA 3E5UA 1QNTA 1R5HA 1HW5A 4AIJA 1U2WA 3F6VA 5E1ZB 4RAYA 1TTYA 5FB2A 3RDIA 1J5YA 4QWQA 2VBYA 4HF0A 4N0BA 3I53A 3GZ6A 1S3JA 3TDUC 1O7FA 1S7OA 3EYIA 2HYGD 2A6EF 4R1HA 1LQ1A 5JI6A 3KLNA 5D5WB 2ETHA 1FPQA 2BEOA 3D0SA 1XDUA 5DCFA 1NHAA 2OA4A 5BS6A 4O5VA 3DV8A 4FHTA 1XD7A 3K2ZA 2KKOA 2XIGA 1L0OC 4WF2A 3RKXA 5KVRA 1R22A 3HUGA 5KK1A 1P4XA 2EJRA 4UXNA 2OQRA 2AXLA 2UXNA 3K1NA 4UUVA 2YPRA 1R5GA 1YW8A 5HDNA 1TQMA 4M72A 5FFZA 5L3CA 3E6CC 1MJ9A 1I1SA 2JZYA 1FYLA 2CWEA 4XSZF 3L09A 5DYMA 3IRQA 3RKYA 1SD5A 2Z99A 1PUEE 4A0XA 3MFKA 3QOPA 4KYWA 4HDVA 4ESFA 1U3EM 1L3LA 1TNTA 2R3SA 3M8FA 5DUIA 4R8HA 3JSPA 4HW0A 1O3RA 5ICFA 3IKTA 1OYWA 3Q9SA 4U0YA 1S6LA 4ZZLA 2H27A 1LEAA 4G7HF 2COMA 2OZUA 2GXGA 2P4WA 4RB3C 4I98B 1IW7F 1Z91A 3E3VA 3B02A 2P7CB 4M74A 5D4SA 1KQ0A 1QPMA 3ZMSA 4LFUA 2F2EA 3FHZA 4RB0A 3WTSC 2QLZA 1CF7B 1J59A 3SQNA 1HSTA 4EV0A 1BI1A 5D5VB 2XAHA 1RNLA 1BI0A 4HBLA 3RPQA 2HDCA 3BROA 3F23A 2J5OA 1J0RA 3LA3A 1W7PD 3LSTA 5LGNA 3T1BA 5ILVA 2K4JA 1PP7U 4MQVA 1Q1HA 1TW3A 4DQ2A 2PG4A 2FBIA 4A12A 3SZTA 4FX0A 4L9VA 1G4DA 1ZG5A 2D1HA 5H6QA 1FBQA 2QYOA 2MD5A 2DU9A 1C0WA 2EV6A 5DCMB 1TW2A 1ZAOA 3RKWA 5ERIA 2W85A 3LA2A 2O6GE 2M45A 1KGSA 3HRTA 1R36A 2XGXA 3CUQC 5EEGA 2A5YB 3K1MA 1IN8A 5FFXA 3M7GA 3WTVC 2KRFA 3P7NA 2Q2EA 2GA2A 2ZFWA 4M9SA 2H94A 1E17A 3MZHA 1K78A 4IF4A 2IA0A 4N9IA 1BIBA 1XGMA 2JRTA 4CICA 4RGXA 1T38A 4HV6A 5H20A 4KT5C 2IPQX 2UZKA 4CO8A 1IXRC 3ERED 2OZ6A 3I58A 2EFPA 2W84A 1B4AA 4MHGA 2XAJA 1ZG1A 3IRRA 3HOTA 2LF7A 3GO5A 5HS8A 2E7XA 3GFMA 3W6JB 4IPAA 2MA3A 1UHMA 2QVOA 4L18B 5JHUA 2LF8A 3E6DA 2YX4A 2ZXJA 2GXBA 4RB1A 3ZMUA 3GEZA 2EFOA 6PAXA 3ABUA 1P92A 3KP5A 4IJAA 2VOOA 5IT3A 3ZMZA 3KETA 4WXDA 3P9CA 1R58A 2QUFA 3VEPA 5HLGA 2PMUA 1XSVA 2HOEA 1W5SA 3KP6A 1RUNA 3K9TA 3KP2A 1KQ8A 2XVCA 1F1ZA 1BC7C 3F8BA 4LMYA 3HOSA 1R1TA 3HRSA 4U7DA 1S8NA 1B9NA 4YG2F 1OYIA 4MGRA 4P55A 1U5TB 2OU2A 3PQJA 3N4MA 1R7JA 1S29A 5CVUA 4MEXF 5D8LB 3WG9A 4WXHA 2DO7A 2DK8A 2KIMA 4O3MA 3GFJA 3TO6A 2EV5A 3QU3A 3C3WA 4NB5A 4GO1A 2IW5A 1QZYA 4Q4ZF 4M6YA 1QZZA 5L3BA 1ODDA 1BBYA 1HKTA 3MEXA 2G7UA 4YIFA 2VT3A 2NNYA 1SD6A 3BWGA 1VTNC 1WKMA 4UVAA 4GYIA 2VXZA 4ZH4F 3VOEA 4CYDA 1ON2A 4IVNA 1BM9A 1YQAA 1LEBA 1YTYA 3M1EA 1AWCA 3DPTA 5LHHA 3SFZA 1IZ1A 2FSWA 4UHTA 3EUHA 3GFLA 2EA4A 2RC4A 3LAJA 3MZYA 1Y0UA 2ACJA 3JAMK 1RUOA 1Z6TA 2BBYA 2O3FA 2Q0OA 4K2EA 1J75A 3S2WA 3V8LA 3DPLC 3T8TA 1ZRDA 3I64A 3FX3A 4JK1X 2B0LA 5TRDA 2RQPA 1HW1A 1W7PB 1FBUA 5HDKA 1ZRCA 1Z6RA 2DI3A 1HKQA 2CW0F 2O8XA 4OU0A 4M71A 2Z33A 3LA7A 5F64A 1AOYA 5LGUA 5BPDA 2DLLA 1T0FA 4HX7A 3TQNA 2V1UA 4LG0B 1JXSA 4KA4A 3NRVA 2GIVA 4E70A 5LEJA 4HOBA 1YW9A 3FWEA 2DBBA 1F5TA 1YFHA 2CG4A 4RB2C 3LQQA 2EK5A 3LQRA 3V8KA 4BYYA 1HSJA 3I71A 4AD9A 2ESNA 4IRHA 5FD6A 1MGTA 3BJOA 5EEHA 4R79A 3R0JA 4OMZA 3P9IA 2PJPA 2FEZA 3K69A 3ZN1A 2K7LA 2L02A 4LLGF 5DCMA 5FD5A 3QP6A 4EM2A 4Q5SF 4NHJA 2ELHA 2HZTA 1DPRA 4P9UA 2RGVA 3CLOA 4L5JA 3FM3A 4M6XA 3QRFF 3U2RA 4MTEA 2XASA 1ZREA 4IHSA 1XCBA 3QP5A 5J6XA 4M73A 5JVTA 2EWNA 4ZYEA 1KU3A 5AIQA 2VT2A 1R1VA 2FOKA 3T8RA 2HYFA 2MC3A 5K5RA 5CVIA 3FXUA 2DFIA 3F3XA 4A5MA 3F8MA 1REPC 2QQAA 1Z7UA 5E8IA 1FT9A 1I1GA 4I2OA 1STZA 4PGGA 2Y75A 1BI2A 5A2QZ 1LB2A 1O3SA 2RN7A 3GFIA 2A07F 2FE3A 2NYXA 4ZZDA 2Z9OA 3REOA 2DW4A 4UNOA 2MLGA 4I02A 3E97A 3J7AO 4ENJA 2O61A 2GA1A 3JTHA 5BPIA 4XSXF 1QGPA 2L54A 4G7OF 1BJAA 1F9NA 1X3UA 5DDGA 2Q8KA 4LLNA 3GW2A 1O7LA 3KP7A 1ZH5A 3ECOA 1XSXA 1G3YA 1U5TA 1RZ4A 1YLFA 2PLYA 5D8KB 1USTA 2E1CA 3ZPLA 1R1UA 5AONA 1EV7A 3F21A 4ENKA 2A61A 4KIFA 3KP3A 2KJBA 3WTYC 1TNSA 3GWZA 3BPXA 3WTUC 2FNPA 4KDPA 1FSEA 2RKHA 2ZBKA 4WK8F 4A5NA 1ZYRF 3HHHA 3RJPA 3E5QA 1SD7A 3NQOA 1SFXA 1ZGJA 3HSEA 1FX7A 4A0ZA 2ZNZA 3FXQA 4AIHA
chains in the Genus database with same CATH superfamily
3BZKA 4KITB 4HF2A 2EFQA 1RR8C 1ZLKA 4ZYGA 3T0YA 4CDGA 5CLSA 4IX7A 4G7ZF 2LD5A 4IXAA 2BXZA 3A0HC 3FHNA 3VPRA 4L9JA 3ZCOA 3H0DA 1K83J 3BQYA 4J19A 2X0LA 3S8PA 1TQIA 4M3EA 2KPMA 3ZQHA 4XKBA 3GLXA 2H09A 4XLAA 4XRFA 2NNNA 2PMZA 4JQFA 2Y0SA 4EVIA 1BR4A 3SEQA 2DOEA 1U9NA 5GPAA 3ZQLA 2JPCA 1YRNB 1ZN2A 5M5WJ 4DYCA 3H3VK 2DA6A 1I3QJ 2VN2A 2DJNA 2DFEA 1DDNA 1P9QC 3SYTA 1H0MA 1VQ4I 4HA8A 2DA3A 1X3WB 2K9NA 3VSKA 3D5LA 2RAEA 5KAIC 3GYHX 4OIOF 3OS1A 1UAAA 1WQ2A 1F4KA 5B5EC 2HVSA 1AKHA 1YW7A 4HLYA 1FIAA 4B8XA 3S1MJ 2HQAA 3I59A 2R4GA 1XMAA 3Q0VA 3GTPJ 3DEWA 5EZHA 1MZBA 1POGA 1LVAA 4S04A 2LFBA 1RR7A 2M0MA 4KNYA 3R0AA 4D7NA 3ML6A 1H88C 1I39A 4M9ZA 2JT1A 1IXSB 3M8EA 1ITYA 5BNGA 5FRNA 1BN5A 4A3DJ 3WU2C 4IZZA 3FKIJ 1GDTA 5J8FA 1MMGA 5DUKA 1IRFA 5C4XJ 1W7PA 4OMYA 3FZVA 3HKZN 3PFIA 3J80Z 4Q47A 5F08A 1N25A 3OOPA 5CYVA 2W57A 1GHCA 3WODF 3GUDA 2OF7A 2W48A 4OOIA 2TDXA 2V1DA 2L4MA 2KJCA 5F04A 4DIQA 2Y0MA 2VPRA 2DT6A 2WTEA 4BUPA 3JW4A 2XPVA 1NH3A 3CDIA 1XS9A 3O6BB 1FYKA 3OYFA 2OTJI 3GTMJ 4LG0A 3PFYA 5D6EA 2LVSA 2FMLA 4KN7X 4OINF 3K0LA 3BTIA 1QQIA 5FKKA 1XGOA 3W2VA 4B48A 2F5CA 2X6OA 1J9IA 5E17F 3OYHA 4H0EA 1YS7A 2FQ4A 2VIXA 2OQGA 3DBRB 2UV1A 1Z9CA 5HLIA 2ISZA 5CJ9A 4XKCA 1JJ6C 3DTIA 5JFRA 1LFUP 3HC7A 2KIFA 1FP2A 2L9RA 4IEJA 4HNUA 3CO7C 4E7IA 3S1NJ 2Y48A 3HSRA 4MTDA 2FA5A 3CD6I 4BL0B 1XDSA 3KEQA 1SVLA 2D45A 3V7RA 3KEYA 3V8JA 3WU0A 4MQ9F 3QU6A 3D5RC 3RYRA 3CF2A 2EZIA 1BW5A 2GZWA 3EUAA 4HQEA 3OYGA 1FSHA 3WGGA 2ME6A 2NAZA 3CUQB 5EG0A 2LBFB 4AVPA 1LDDA 3VYTB 4GDFA 5JHFA 4MIMA 2P6TA 5HDGA 2FBHA 3K70D 4ITVA 1DU0A 4FTHA 5DD4A 3S3MA 4RA2A 4HDUA 1JTYA 1Z1DA 4U0VA 3WHCA 1LPQA 4GGGA 3TMOA 3PQKA 4Y7NJ 2R5ZA 4A3BJ 1T56A 3QPLA 3QPTA 4DW6A 2ID3A 2PI0A 3DKYA 3JREA 2XAFA 3SXYA 3S3OA 1DUXC 2JA7J 2K3FA 2HQRA 3ZMVA 2L4AA 3PNVA 1SMTA 2DAOA 1FC3A 2CS3A 4BXUA 3FK7A 4LJZF 4DYRA 2W1OA 3GVAA 3ECHA 1HW2A 3Q9VA 4PJMA 1X58A 3B6AA 2JA8J 1D8JA 4A0YA 3KZYA 3H0GJ 4JX4A 4Y4RA 2BY3A 3W6KB 1WJCA 1Z05A 4AIDA 2QENA 3GZ5A 3WGHA 3H5RA 2K5CA 4ENNA 3KFWX 2L7ZA 2K3PA 3BDDA 4P96A 3KZZA 2BVMA 3IV5A 1JT6A 2EB7A 3A4CA 4G94A 2M3AA 2YU9J 4XRSG 2E5NA 4E4HA 4AIKA 2JSPA 2JVGA 4IRIA 3RTRA 2DMUA 3IH3A 2K40A 3CC2I 1ZG3A 2IA2A 4JYKA 2FBKA 1K4TA 2MD0A 2F4OB 5HS9A 2STWA 3W3CA 1T98A 1K79A 2E1MC 4DJAA 4CUGA 1MBHA 2OD5A 2XUBA 2DTZA 3L2CA 2ZSHB 1IXCA 2HKXA 2R7ZJ 1H9TA 3EQLF 1JUMA 3OL4A 1NG7A 2BZTA 2FQ3A 2GAUA 3CCSI 1SAUA 2YR2A 1LDKB 2AS5F 3PUFA 1W4MA 3DKWA 2KT0A 2RDPA 2VL8A 3FMSA 4LK1F 3FDYA 2LSOA 5LRSA 4M9XA 4QPOA 4ON0A 3ZGKA 1ON1A 3TKYA 4XR6A 3F8FA 1BR2A 4CGZA 2X1DA 1B59A 2CYYA 1CQTA 4L0ZB 3N05A 3HIFA 2H8WA 2UUZA 4I09A 5DEQA 1KU9A 2VASA 4PJ0C 4F7ZA 2K86A 4PCQA 1XGNA 2CO5A 3RPUD 2A3SA 3C2BA 2JMWA 5FKOA 3J81Z 3LMMA 2MH9A 4D0PA 4CCKA 2QZ8A 4KFCA 2ZKZA 1U78A 5L3GA 2P6SA 2TCTA 3BCBA 2X1CA 2VONA 1OPCA 2WWYA 5EEAA 1WWXA 4IHTA 4CCMA 3K1PA 3TP3A 1HC8A 1TLHB 4UV8A 2ZO4A 1JT0A 3X2QH 4C2TA 1XG1A 4E7KA 1U0JA 3GBGA 4XM3A 3DXJF 2MC4A 2WB1N 3CCVI 3H3UA 1MNDA 5K5QA 3S2HJ 2MSYA 1QO0D 2IP2A 3RYPA 3VFZA 4MO7A 2QQBA 2JN6A 4UV9A 1OYYA 1A6QA 2VBZA 3OIPA 3T5XA 4HZFA 4RGUA 4U88A 3MKWB 3MN2A 3JTGA 1T95A 1WGXA 2E35A 2FU4A 2Z16A 5IOYA 1QA6A 2ZMEA 1B72A 3BZ6A 4BJ6C 4I76A 4IHWA 4D5FA 4ZDPA 3J81K 1AKHB 3K2AA 1JKOC 2IGKA 4BEHA 2BY0A 3I59B 5GP9A 4XQFA 4FCYA 5D5UB 3JRIA 3HYIA 3K10A 5F0CA 3CMYA 2DN0A 4G9YA 2COBA 4BQAA 2O0YA 2HOSA 5L3DA 2KIQA 2W4SA 2ADUA 2VBWA 1FLIA 3QODA 3C2HA 1J7KA 1WFXA 1KU7A 2NS0A 2WC2A 4JP0A 5B1AH 1G6NA 2DPDA 2L2OA 2MLKA 3TO9A 3WE3A 4DGWB 3NWTA 4OIRF 5LBQA 3HRMA 3ZP5A 1YO5C 2FNAA 3OIQA 3RPUA 1VQOI 1D5VA 3R60A 1IAWA 3I3LA 5K7FA 2LY9A 2GBYA 5KHDA 2NVXJ 3F6OA 1MSEC 4U0WA 4CZCA 2VQGA 4ASNA 4IL6C 1VQMI 1PP8F 1TL8A 2UXXA 1Z67A 2E1NA 1R00A 5J3LA 1KQ9A 1S5LC 5IT9Z 4GRIA 5LHIA 2NVTJ 2Z5UA 1USSA 2F5VA 2HS5A 2L01A 1X1AA 5ICCA 4A3CJ 5JVGF 1CGPA 3K4MA 4RS8A 4BY7J 3NEUA 2KRCA 5HOOA 5F6FA 3PUBA 3OL3A 1KA8A 1YG2A 2F5EA 5CVJA 3FM5A 2H6BA 4Y15A 3K4BA 2JVHA 3I4MJ 3IL2A 2ESHA 2CW8A 3OWTA 3L2UA 2QWWA 2K02A 4LITA 1W36C 1EKEA 5KAFC 2VKVA 1ETXA 2XGEA 3DQVC 3U1DA 1OCCH 4KN4X 1W5CC 3H5AA 3HTUA 2JJ7A 3GX4X 2HTJA 2R7SA 3FKJA 2WY7Q 3QPHA 4IHXA 3LFUA 4BAYA 2IJLA 1X2MA 3BJ6A 2L9NA 2WB1A 3DEUA 2NVYJ 4HLXA 4E7HA 4NC8A 3QYEA 3QWLA 2Y9YA 4E6KG 1I6XA 3RSNA 2ECBA 5CVRA 3LSHA 5HS7A 5J47A 1G2HA 2ZCWA 5BMZA 1AHDP 1T6SA 1XN7A 5C4JJ 1EF4A 4PJJA 2ZJQF 3L2QA 1HCRA 1V3FA 1I6HJ 3PSFA 1RI7A 3LL7A 2ZNYA 4G6QA 4QLCU 1SC7A 2W7NA 1WJAA 3E6BA 2L9VA 2HQNA 2L9SA 2CGPA 1BOBA 3I4PA 2R5ZB 4RDUA 5J1UA 1Z7LA 2PEXA 2RNGA 4XOPA 2Z2SB 4ZYHA 1VZ0A 1T39A 3DTKA 3OYLA 2VE9A 3HHGA 3CP8A 1ACIA 3O8GA 2ZJ2A 1VQ8I 3SZPA 4KMFA 3HGGA 4F93B 1WRJA 5JR3A 3OIOA 1ZARA 1UCRA 1HQCA 2P7VB 2D1VA 5HLHA 4AWXB 3FXJA 1ZTRA 2AQEA 4M3DA 4NDLA 2IS2A 2F5DA 3TO7A 3CCMI 4PSWA 1RRJA 2R7FA 1AA7A 2IGOA 2X85A 5E3OA 4BY1J 3AG3H 1ONVA 4XRSA 3MAJA 1JGGA 3IH2A 4UY8I 2HVQA 1FNNA 3KP4A 4D5CA 2MW8A 4IHVA 2XKOA 1XX5A 4BH9A 5E18F 3CDHA 1NK3P 4A6EA 2VC1A 2FD5A 1V55H 4DNCA 1ZLJA 9ANTA 2M7BA 2HTSA 2YUSA 4WXCA 4PDKA 3ZQ7A 5DV5A 4Y17A 1KU2A 3I54A 5EYRA 1K7AA 2BHYA 2KQRA 2QBYB 2FXAA 3R6SA 3MCZA 2WV0A 3O3KA 2V7FA 2KL4A 1O57A 2F4MB 1P4WA 4LOCA 1Z21A 3W2AA 2ISYA 2HR3A 1HKSA 4KICA 4EGYA 1DPUA 4NNJA 1F36A 2IGNA 1QU3A 2CUZA 1YIOA 4EJUA 3BTCA 4A93J 3V7CA 1EH6A 1E2XA 4RM2A 2E7WA 4XIDA 2K4BA 2Z1DA 1QBJA 3LNQA 4L9NA 3HJEA 3CDLA 4Y13A 4HNTA 3GXOA 2L7KA 5M3MJ 5HODA 1V5FA 1VQ5I 2BY1A 4ETSA 2LMDA 4D7MA 2QQ9A 3U21A 2WY8Q 3CUQA 2YX7A 2DTRA 2ID6A 4BQQA 4EQQA 4CCOA 4EGZA 1K4SA 3DLAA 1MJBA 1GV2A 2F48A 2VQHA 1SVOA 5C3EJ 1MBFA 5A2QK 1BA5A 4HX4A 1FBSA 3G4SI 1ZGWA 4CHUA 4CZZA 1WI9A 2M30A 3PL8A 5CVVA 2GQQA 3BOQA 4JBAA 5TGTA 1W5TA 3DFGA 4G12A 4YFKF 3F22A 1O3QA 3RIRA 2ZMEB 1B72B 1A36A 4Z6YA 3SFIA 2WA0A 4N9HA 1IJWC 2XRNA 4D9JA 1H8AC 3L2WA 3HZJA 4JOMA 5E20A 2XHKA 4Z2YA 2WBMA 1OR7C 3HOYJ 1R9TJ 2DMQA 1FOXA 4WX9A 2OJED 2LC2A 3S17J 2CSOA 1S7AA 3EPZA 3ROUA 1XMKA 1IN7A 2G0EA 5LLQA 3OS2A 2HPIA 3JRHA 2ZSIB 3C18A 2FMYA 3W2WA 2M87A 4LIUA 1A04A 4XONA 1G8XA 2P5VA 5FKMA 3JRBA 3QPSA 1SFKA 1V54H 2W24A 4UVBA 4KIGA 3L00A 4MNUA 1E3HA 4F3QA 3IKVA 2K27A 4BHBA 1SEUA 1IRGA 1HXDA 2VOPA 3A0BC 3M3YJ 4LB5A 3QQAA 2W25A 2CV0A 4ZYDA 4HRIA 4RAZA 3P5JA 4XLPF 3N97A 4FE4A 4ANJA 3TOAA 5D4RA 1D1AA 2EZHA 4BNCA 5ILSA 3H92A 1JE8A 1W1WE 4NBQA 3AAFA 2D2WA 1IGNA 2DODA 3FXOA 3DPUA 4O6JA 3SHFA 3IH4A 3CO6C 1IN4A 3BJAA 2IS4A 1B6AA 3HRUA 1D8KA 4CH7A 1T2KA 1K6YA 1D5YA 2J5PA 2BW3A 1W0UA 4NC6A 2HXOA 2GLOA 3HGYA 4HPQA 2JPBA 3AG4H 4CCLA 2V9VA 1T33A 1YOVB 5ICEA 5M5YJ 1JHHA 3S16J 4P5OA 5K1YA 2PQ8A 1B9MA 2M1BA 3ZN0A 2R7RA 3CJNA 1FMWA 3WE2A 2JK3A 3ZQQA 3TGNA 2P81A 3E5XA 3WTWC 4MEYF 2VLAA 4I99C 1EH8A 3ABMH 3ABLH 3RQIA 3U9GA 4HF1A 1KYWA 2LLKA 1XGSA 4L5IA 4KMUX 2EA2A 3IAS2 2HEOA 1U9OA 3ZQIA 5FLXZ 1ZQ3P 3NWSA 5LHGA 4LK0F 3TDZC 2H1LA 2EFNA 2NS8A 1GVJA 2XAQA 2VBXA 2K9QA 1N75A 3TEDA 1UMQA 2V9KA 1U6GA 2P5KA 3IUOA 1QZEA 1MW7A 4MLOA 2QM3A 1Q1VA 1WH5A 5D6FA 3COAC 2LY2A 3SDBA 4RGRA 2PX9A 4L0YB 1ZK8A 1ZKGA 3G1LA 2L0KA 3PO2J 2FF4A 4GXOA 4HAMA 4EJVA 1VNDA 1YYVA 1ZGAA 3IHUA 3ELKA 2O8KA 3A1YA 1VFCA 2MFZA 5FLXK 2CRGA 1YE9A 3ZQFA 4UUSA 3HTSB 2Y31A 3EUKL 1A6IA 4A69C 3WTTC 3ZR8X 3L2VA 2NOGA 2ECCA 2TRTA 3OYIA 5GTHC 1K6OA 2CW7A 1MD0A 3I0TA 3TP0A 3HDDA 3LFKA 1U8RA 1SFUA 1K61A 2PMHA 5BQTA 2BE5F 4ZDLA 4NQWA 3ULQB 3ONQA 3OSGA 1I5ZA 4TV7A 3L2RA 4EM0B 2QSHX 3PJRA 1BOAA 1X4OA 2IT0A 2P5LC 2DQRA 3FF5A 4F92B 4IQJA 3C7JA 5K5OA 1J2XA 1WSUA 2HFHA 1H9GA 1FJLA 1MNEA 2V79A 5LEKA 2DJIA 3KEOA 4P1WA 1IN6A 2EIMH 4ESBA 3CF5F 1QHHD 4RLQA 3LSRA 1TBXA 1KYZA 1SFEA 2G9WA 3S32A 2Z3YA 2CQNA 5LRRA 2RV8A 5FLMJ 5BOXA 1U5TC 1GUUA 3KLOA 4XLNF 1MKMA 1LDJA 1IUYA 3E6MA 4XORA 2BYVE 4HG2A 4YEJA 1E0EA 4A3JJ 3J80K 2EPFA 4P9FA 5H2FC 4WCGA 4XBFA 2LK2A 3L9FA 4EM1A 2M8EA 4AUXA 3M8JA 3FK6A 3R61A 5DTDA 2LNBA 3HSFA 2R7VA 2DYSH 1FZPB 4LD5A 1I3AA 3PNYA 3B73A 5FLVA 4FQGA 1W36D 2HU9A 4KISA 3CP2A 1P6RA 1D3YA 1XMXA 5FO5A 3HUGB 1MDMA 1G3WA 4XL9A 4M3GA 3IWZA 5DS9A 3LAPA 2DT5A 1LNWA 1V4RA 1GXPA 1IG7A 2M5WA 1MMAA 2JTVA 1P7IA 3HOZJ 4HSRA 1GXQA 5EGOA 3BY6A 3C1DA 3PSIA 4B09A 3CUOA 2ZC2A 4PGHA 4J00A 1R49A 2VQCA 2EFWA 2R92J 1HDPA 1BC8C 2RQQA 3M9AA 3V4GA 3BG9A 3Q5FA 1OISA 3FBIB 2LYCA 2VJ5A 5LGTA 3ISPA 2XF6A 1MMNA 2LDUA 3G73A 3WU1B 4RMNA 3RCOA 2XF5A 5DD8A 1SANA 1VF9A 2VB6A 4XRMA 1NK2P 3KE2A 2XPWA 1YX3A 4UB6C 2EV0A 4WWCA 3S15J 1UHWA 1Y8QB 4PSXA 2BV6A 4KUMA 3O2PE 1OCTC 3LWFA 2KMUA 2IBDA 4I7HA 1JHFA 1OCZH 4HSTA 2EH3A 1MBGA 4EJWA 1HBXG 5L3EA 1X3ZB 3ZMTA 4EJOA 4BJTA 4IQ4A 2W00A 4A6DA 1XCVA 1IN5A 1G3TA 3HKZA 2CMPA 3ZMDA 2AXTC 4KIBA 2VPLA 3H3ZA 1Y1VJ 5E3NA 5C44J 3IWFA 2NXNB 4I0AA 3BG3A 5HNHA 3A01B 2XB0X 4C3HJ 1ETYA 4FX4A 1OQYA 2LOOA 3FMQA 4FT8A 5FRMA 3LSIA 2PN6A 2YSRA 3WTXC 2X51A 2XSJC 2X4HA 2VODA 2CQKA 2RNJA 2B9SA 3MKLA 3PM1A 2QBYA 1YJNI 2DMPA 4HX8A 3BG6A 5HVQC 5IP7J 3VODA 2HGCA 4ZYAA 2C6YA 3M4OJ 2RREA 5E8GA 1HLVA 1DP7P 2JA5J 3FMRA 4RAFA 2NVUB 4YFXF 2VKEA 2DPUA 4HQMA 1RKTA 3S93A 3SZGA 1IF1A 4U7BA 4DYQA 2BW3B 3CTAA 1OCRH 4I0BA 1PDNC 2DK5A 2VKDA 5JLXA 3GTLJ 2K9LA 3OV8A 3BG5A 1ULYA 2E2JJ 2P8TA 2DQLA 3WGIA 3WTZA 2WADA 3DF8A 3L7WA 4CYCA 1SAXA 2HI3A 2XKPA 3KCCA 2JWTA 3TBIA 2STTA 2DA7A 2DYRH 4OAZA 1Y39A 2A68F 5FGMA 3OYKA 3AL0C 2O5RA 5E3LA 2V1XA 3D5SC 2IVMA 4XLFA 3KX2A 5D5XB 2PBIA 1FWZA 2R7QA 3CC7I 1KONA 2NVQJ 2JSCA 2XROA 1WZ2A 1OJLA 1VQLI 1UJ8A 2HDDA 3VB2A 3F8CA 1RETA 2VE8A 4G6DA 5AIPA 3JAMZ 1ZRFA 2F5FA 2I8DA 2MABA 1LFBA 3EDPA 1B8IA 2A6TA 2X6YA 3ABTA 5ILUA 2OBPA 4N4NB 3PNTA 2D5VA 2R7UA 2QKLB 1EH7A 5ED4A 2FJ1A 1UB9A 1JJ8C 4A3KJ 5J4YA 3OYDA 3K4LA 2ELJA 2DFHA 4A2UA 4BE0A 1UFMA 5E1XA 1I27A 3I5UA 3G3ZA 4PUSA 1FYMA 1RPWA 2LR8A 1BIAA 2ZXIA 1TQPA 4GYGA 3IC7A 3EETA 3R4KA 4LLLA 4UUSB 3JSOA 3TOBA 1RIOH 2NRAC 2CQQA 2E1MB 4GCVA 3OR2C 5ICGA 2M9HA 5CQEA 1JTXA 2E5ZA 4M6VA 3QAHA 1YI2I 1EJ9A 2FRHA 5E3MA 2MH2A 3CCLI 2BHZA 4YFNF 3MQ0A 4BHCA 1D0XA 2Y9ZA 1LKXA 4NQWB 2A69F 1WJFA 3DP7A 1FY7A 1O4XA 1OLTA 2Y2ZA 4XOTA 2KIUA 2LH9A 1TT5B 1D0YA 3GF2A 1YHQI 4W97A 2YU3A 1O3TA 1ERDA 1P2FA 2F4IA 3CCRI 1R4MB 1K78B 3RI4A 2HOAA 3I55I 1SVMA 2IS1A 1SMYF 4DZJA 4Q48A 4EJTA 3OYJA 5FROA 3V7SA 4OIQF 4G8XA 2HWVA 5GAGJ 5IYCJ 4HYEA 1XSDA 4BU2A 4ENMA 2H6CA 1IUFA 1FOWA 2M2EA 5F1RA 2L3DA 3M07A 1SD4A 1ETWA 1G3SA 1P4AA 3I56I 5J4VA 4BE2A 1LJ9A 1U8BA 1CF7A 1JGSA 5L3FA 2ZB9A 2O03A 1TT0A 2VC0A 2MYSA 2OCCH 4HV5A 2XV4S 3I4NJ 1XB4A 3DU5A 1WJ5A 2QKMB 2VJIA 4LB6B 5IT9K 4C9YA 2A5WA 1HOMA 3DWLE 3MWMA 1X4PA 2VQLA 3TW7A 2OV7A 4B3XA 5IPAA 1OCPA 2XAGA 2RVCA 3BPVA 1R23A 1FMVA 4B43A 5LFAA 1XC5A 2BGCA 4HNVA 3ZQGA 1OR7A 5J8CA 1MDMB 4S05A 2X1EA 5H6RA 1MH3A 2A05A 4BBRJ 3E0JB 2HKOA 3MVPA 2E19A 2R7DA 3QYFA 1PUFB 1VQ9I 2V6CA 3P9KA 1VQ6I 4RGSA 2R93J 4IO9F 1MJAA 4UVCA 4EEFG 2LKPA 5TJJA 4DBRA 5EGOB 2CFXA 2IA1A 2A6HF 1WH7A 5IYBJ 3OS0A 1SFOJ 1XTAA 2G7HA 4PZJA 1W0TA 3BP8A 2OAZA 1OMIA 2VXDA 4YIIA 2DA2A 3K7AJ 1QVTA 1TP4A 3F8NA 1B1BA 1ZHFA 1WPKA 3ERMA 1BI3A 1I50J 4A3FJ 2KDZA 5JLWA 3MMYB 2BXYA 4EMSA 3J7AY 1T08B 4LGWA 4OIPF 1JUPA 2DMNA 2MBFA 1YS6A 3EYYA 1FP1D 3F72A 3HBLA 1FEXA 3BCAA 3H5NA 4A3LJ 3BC8A 3FXRA 5E1WA 4I01A 1OKRA 2UWMA 4L9TA 4OAYA 4BHPA 2VI6A 2GWRA 4CXFA 4ESJA 2DT7B 1MBEA 2I5UA 2X6WA 4IRGA 2CH0A 2ZXHA 1FOKA 2KDOA 2IRFG 2PFBA 1MBJA 2CU7A 3E5UA 1QNTA 1R5HA 1HW5A 4AIJA 1U2WA 2BY2A 3F6VA 3EUHC 5E1ZB 4F91B 1HDDC 4Y52J 4ZTJA 1V5EA 4RAYA 2LREA 3K4KA 5TISC 1TWCJ 2H1KA 4PK4A 1TC3C 1TTYA 2X48A 2AO9A 5FB2A 3RDIA 5LD2C 1J5YA 3CJRB 4QWQA 2QEXI 2HQ5A 2VBYA 2LKSA 1BL0A 4HF0A 1DQUA 1WVRA 2ELKA 4BQNA 1Z3XA 2QSGX 3NAUA 4N0BA 3I53A 2DCEA 3GZ6A 2LTPA 1S3JA 3TDUC 1O7FA 1S7OA 4Y33A 3W6VA 3EYIA 2HYGD 3K4JA 2A6EF 4R1HA 1LQ1A 2B63J 4X6AJ 3BR5A 3M1CA 5JI6A 1Y8RB 1ETVA 2XAUA 5M3FJ 2DDBA 3KLNA 5D5WB 2ETHA 3KIOA 3FBNB 1FPQA 5FKNA 3C2GA 1YX5A 2BEOA 1XDUA 3D0SA 4XLCA 4CYCB 5DCFA 1JKPC 1NHAA 2OA4A 2DA4A 5BS6A 4BXFA 1MMSA 3LSGA 4O5VA 1APLC 2E2HJ 3DV8A 4FHTA 1XD7A 3S14J 3K2ZA 2KKOA 2XIGA 1L0OC 4WF2A 3RKXA 5KVRA 1ENHA 1R22A 3HUGA 5KK1A 1P4XA 2VKHA 3Q0WA 2EJRA 4UXNA 2M7AA 2OQRA 1JKQC 3DEEA 2AXLA 3VDXA 3ZRGA 1X2NA 2QSFX 3SJMA 2UXNA 3K1NA 1B8IB 1T0FC 2LY1A 4UUVA 2YS9A 2YPRA 1R5GA 1YW8A 5HDNA 1TQMA 4M72A 5FFZA 5L3CA 3E6CC 1MJ9A 1Z0XA 4UB8C 1I1SA 2JZYA 1GVDA 1WCMJ 1FYLA 2PJRA 2CWEA 3U1KA 3SDGA 4XSZF 3G71I 1TWFJ 2PMZN 2DOFA 3L09A 5DYMA 3IRQA 2GOXB 3RKYA 1SD5A 2Z99A 1GV5A 3BR1A 2V6EA 1PUEE 4A0XA 3J7YJ 5EDNA 3MFKA 3QOPA 4KYWA 3BG7A 1X1CA 3H1CA 2R7WA 4HDVA 2JA6J 4ESFA 1U3EM 1R71A 2MG4A 3WG7H 1L3LA 1TNTA 2R3SA 4KJZA 3M8FA 4E7ZA 5DUIA 4R8HA 3JSPA 4HW0A 2ZJRF 1O3RA 1LE8B 5ICFA 4DOZA 5J1YA 4IOCF 3GTGJ 3IKTA 1N77A 3A01A 1OCOH 4M3FA 4B3AA 2GM4A 1OYWA 3Q9SA 5DM7F 3RQ4A 2KLOA 1S6LA 4U0YA 2AHQA 2VUMJ 4DZPA 4ZZLA 2H27A 1LEAA 1VQNI 4G7HF 2COMA 2OZUA 3GCMA 3VYUB 1NG6A 2GXGA 2P4WA 3CJTB 4V19K 2VJ4A 4RB3C 2LRDA 2WAFA 1BW6A 4I98B 3PO3J 1IW7F 3K4NA 2CV2A 2H8RA 1Z91A 2X6XA 3E3VA 3UR3C 3B02A 2P7CB 4M74A 5D4SA 1Y1WJ 1KQ0A 4E7JA 1QPMA 2EZLA 2XGDA 3ZMSA 3CCQI 1G59A 4LFUA 2F2EA 3FHZA 4C2MJ 4RB0A 3KYLA 4CCJA 3WTSC 3BT9A 1MNMC 2QLZA 3HB9A 1CF7B 1J59A 3SQNA 1YJ9I 1HSTA 1P7JA 4EV0A 1F43A 3ASOH 5F1JA 3DKXA 1BI1A 1RKWA 5D5VB 2XAHA 3GLLA 1RNLA 4X1EA 5IP6A 3JR9A 2LKXA 1S72I 4NUBA 5B1BH 4JX5A 5M5XJ 1BI0A 1MIJA 4HBLA 3RPQA 3RZDJ 4Y3OA 2HDCA 3BROA 2EQRA 2GXAA 3ABKH 4A3GJ 3F23A 2J5OA 1IO2A 1J0RA 1ETQA 2MGQA 2N8GA 4DBQA 2KFDA 3LA3A 1W7PD 2Y30A 4OWRB 5IOZA 3LSTA 5LGNA 1TWGJ 4RBOA 4QTRA 3T1BA 5ILVA 2K4JA 2QGUA 2XF7A 5GADJ 4MQVA 3BR0A 1PP7U 1Q1HA 1TW3A 2WAQN 4DQ2A 2PG4A 1OFCX 2DDAA 1JKRC 2FBIA 4XNFA 4A12A 3SZTA 4F52A 4JX6A 2HOTA 2NS7A 1X19A 3ASNH 4FX0A 4L9VA 2K85A 2FUG2 1G4DA 1ZG5A 2D1HA 2V26A 5H6QA 5EZGA 4PJNA 1FBQA 2QYOA 2MD5A 2GIZA 1V5GA 2DU9A 3CMEI 1C0WA 3L1PA 5FJ8J 3BLYA 1IDYA 2EV6A 5DCMB 1RC9A 2Q1ZB 4RLFA 1AU7A 3DBHB 1UELB 1TW2A 1MH4A 4M3BA 1ZAOA 3RKWA 3S1RJ 5ERIA 3ZXSA 2W85A 4A3IJ 3LA2A 2L5QA 3J7ZI 2O6GE 2M45A 1ETKA 1A5JA 1KGSA 5GPCA 3HRTA 1R36A 2EINH 2XGXA 3A02A 3CUQC 3GMEA 2A5YB 3K1MA 5EEGA 5J40A 1D1BA 1JI8A 1IN8A 5FFXA 5HNFA 3M7GA 3WTVC 1DGWY 5EJCA 5B66C 2KRFA 3ESWB 3P7NA 2Q2EA 2GA2A 2ZFWA 4FISA 4M9SA 2H94A 1E17A 3MZHA 1K78A 4IF4A 2IA0A 3O8HA 4N9IA 1BIBA 1XGMA 5IY5H 2JRTA 1JUSA 2KZVA 3G2BA 3KYDB 3G1MA 4B4CA 2VJJA 2DA5A 4MFDA 4CICA 2E60A 4RGXA 2IEKA 1HA8A 3BTLA 3CLQA 1T38A 3G6EI 4HV6A 5H20A 4BDZA 4KT5C 2IPQX 2K9MA 2OCEA 3FIWA 4II3A 2UZKA 4J01A 4CO8A 3VYRB 4BBSJ 1IXRC 5F0FA 4A3EJ 3ERED 2DOAA 3BTJA 2OZ6A 3I58A 3HOXJ 1IRZA 3QYBA 2EFPA 3MZ8A 2W84A 1B4AA 4MHGA 2XAJA 4E7SA 1ZG1A 3IRRA 3HOTA 2LF7A 3GO5A 5HS8A 4B44A 3S2DJ 2R7XA 2E7XA 3GFMA 2QA4I 1UG0A 3W6JB 1R6RA 1TZLA 4IPAA 2L7MP 3BQZA 2MA3A 4BQOA 1UHMA 1MBKA 2QVOA 1PUFA 4L18B 5JHUA 2LF8A 3E6DA 2YX4A 2ZXJA 4E7LA 2GXBA 3ZOBA 4RB1A 2WAQA 3ZMUA 3HXLA 3GEZA 1FTZA 2EFOA 4B47A 6PAXA 3ABUA 1MSFC 1P92A 3CMAI 5GTIC 3KP5A 4IJAA 3GTOJ 2VOOA 1X1DA 2V9PA 4AU7A 3ZMZA 5IT3A 2EIKH 3UKGA 4XKWA 3KETA 2XGCA 3K4CA 3P9CA 4WXDA 1R58A 1FTTA 2QUFA 3VEPA 5HLGA 2PMUA 1XSVA 2KHMA 2HOEA 1W5SA 2CUFA 3KP6A 1RUNA 1QRYA 3K9TA 3KP2A 4BGDA 2PJRB 2IGMA 1HF0A 1KQ8A 4UUTA 2XVCA 5K7HA 1F1ZA 2JUCA 1YIJI 2KZGA 1BC7C 4FE7A 3BR6A 1ORKA 1VQKI 3F8BA 4LMYA 3LSMA 3HOSA 1R1TA 3HRSA 4U7DA 1S8NA 1B9NA 4LIVA 1OYIA 4ZC3A 4C3JJ 4YG2F 4XN3A 4MGRA 4P55A 4XKVA 4CSWA 1GT0C 1U5TB 2OU2A 4NC7A 3UNGC 3PQJA 2KRHA 2WAEA 4ZDOA 3N4MA 3CCUI 2HPMA 1R7JA 3H9JA 3FXMA 3HOVJ 1S29A 2XDVA 5CVUA 2ZJPF 5KCMA 4MEXF 5D8LB 3WG9A 4WXHA 2DO7A 2DK8A 2KIMA 4AC0A 3DCFA 4O3MA 3GFJA 3TO6A 2EV5A 3QU3A 3C3WA 4NB5A 2EIJH 4GO1A 2B7EA 2XB5A 1LFPA 2V1NA 2K9SA 2OTLI 2IW5A 2NOJB 1PJRA 1QZYA 4Q4ZF 4M6YA 3VYSB 2CJJA 5E79C 3A2KA 1DU6A 2LG4A 2IXSA 5IYDJ 1QZZA 5L3BA 4A3MJ 1ODDA 1QHGA 2DA1A 3HPHA 1BBYA 1HKTA 3MEXA 1PYVA 2G7UA 4EATA 2VT3A 4YIFA 2HNHA 2NNYA 1SD6A 3BWGA 2I10A 1VTNC 4XICA 2KP6A 3JCUC 3PIPF 2R5YA 1WKMA 5FKLA 4UVAA 4C30A 4GYIA 3HL2A 5EF6A 3HPGA 1BJZA 3HOWJ 2VXZA 3RZOJ 2CUJA 2FX0A 1BR1A 3MKYB 5F27A 3K6GA 2FOWA 4ZH4F 3VOEA 1E3OC 2DMTA 4I6ZA 4XMYA 4CYDA 1ON2A 4IVNA 2E1OA 4U87A 2CUEA 1BM9A 4AM3A 1YQAA 5DM6F 5KNLA 3S3NA 1YTYA 1LEBA 3Q3SA 3DU6A 4X0GA 3M1EA 1AWCA 3CCEI 1S9HA 3DPTA 3CC4I 5LHHA 3SFZA 4BACA 4V2GA 3MKZA 1IZ1A 3HEFA 2FSWA 4AVZA 4UHTA 3DTEA 2OPTA 3AG1H 3EUHA 3GFLA 2EA4A 1YITI 2RC4A 2ICWG 3B6CA 3LAJA 1UZCA 3MZYA 1Y0UA 1IC8A 2ACJA 3JAMK 4D1QA 1Z77A 5K7ZA 1RUOA 1Z6TA 2BBYA 2O3FA 4HEA2 4C2UA 3LOCA 2Q0OA 3LSPA 1LE8A 3BR2A 3FXLA 3VWBA 4K2EA 1J75A 3S2WA 5J1RA 3V8LA 2DXIA 3DPLC 3T8TA 3JRCA 1ZRDA 5CKTA 4BJ5C 3I64A 3DBLB 4PJLA 3FX3A 4JK1X 2B0LA 1WJBA 2O9LA 4IHYA 4ZTFA 2Q2EB 3S1QJ 1D1CA 4YRVA 5TRDA 3JRAA 2XRLA 3AL0B 3OYCA 2RQPA 5B3SH 3GTQJ 1HW1A 2Y69H 1W7PB 1FBUA 2M34A 3LSKA 5HDKA 1ZRCA 1Z6RA 2DI3A 1HKQA 2CW0F 2O8XA 4OU0A 4YIRX 2DFFA 4M71A 3NARA 2Z33A 3SEZA 3LA7A 1IRXA 4YELA 5F64A 1AOYA 5LGUA 5BPDA 2DLLA 2EILH 1T0FA 4AYBN 4HX7A 3TQNA 2JQ7A 2V1UA 3D1NI 3JRDA 4LG0B 1JXSA 4KA4A 3RKQA 2XSDC 3NRVA 3OYEA 1WJEA 2E34A 2GIVA 4E70A 5LEJA 1KZHA 4HOBA 5CQGA 1YW9A 3FWEA 2DBBA 1A35A 2QF7A 1F5TA 2XPUA 1YFHA 3QOEA 2CG4A 2O7OA 2CV1A 3H35A 2HDWA 4RB2C 3LQQA 2ZFUA 3PIOF 2EK5A 1QPIA 4IKFA 1R5ID 3LQRA 3V8KA 1TWAJ 3KPHA 2QCOA 4BYYA 3JRFA 4QIWN 2OUMA 1HSJA 3I71A 1FIPA 1QVUA 4AD9A 2ESNA 5GAHJ 4IRHA 2E71A 1VQPI 5FD6A 1MGTA 3BJOA 1WHUA 5EEHA 4R79A 5CPRB 1X1PA 2KISA 3R0JA 2CQXA 3V42A 4OMZA 3K70C 1H89C 2E2IJ 3P9IA 2PJPA 1YRNA 2BOLA 2FEZA 3K69A 3ZN1A 2K7LA 2L02A 2ZXWH 4XLEA 5EG0B 4LLGF 3F9KA 2JRMA 3AFHA 5HLTA 4GFBA 5DCMA 4XLHA 4KT6A 5FD5A 4BDYA 2M8GX 1Z3YA 3QP6A 4BKXA 2GOMA 2M4GA 4EM2A 3OYAA 1Y0NA 2L7FP 4CA0A 4Q5SF 4NHJA 2ELHA 1WJDA 4QSHA 2HZTA 1DPRA 3IP4B 4B1RA 3OMYA 4P9UA 2M0CA 1Y56A 2RGVA 5IP9J 3CLOA 4F55A 4L5JA 3AG2H 3FM3A 4M6XA 3OYBA 4QPQA 3QRFF 3U2RA 2HYJA 4MTEA 2XASA 1Y6IA 4FETA 1ZREA 1X1BA 4IHSA 1XCBA 3QP5A 2R7TA 4N4OB 3IAM2 5J6XA 4L5EA 3BZCA 1M1EB 4M73A 2ZMEC 5JVTA 2HVRA 2EWNA 4ZYEA 1VQ7I 3FXKA 1KU3A 3FISA 1ZELA 1E3PA 5AIQA 2BVLA 3OY9A 3Q0UA 2JUGA 3CCJI 1IV6A 2VT2A 3HG9A 4MFEA 1R1VA 2FOKA 3T8RA 3OR1C 4AYBA 2HYFA 4IOAF 2MC3A 4ABZA 1YJWI 5K5RA 5CVIA 3FXUA 3VSLA 2DFIA 1MMDA 3F3XA 2W82A 4A5MA 3F8MA 4ZJZA 1REPC 2QQAA 1Z7UA 5E8IA 1FT9A 1LVKA 3JRGA 1A31A 4PFPA 1I1GA 4BXXJ 4I2OA 4PFOA 1STZA 2R5YB 4PGGA 2Y75A 2ME0A 1EA3A 1BI2A 2AQFA 3E7LA 5A2QZ 1LB2A 4BE1A 4V2FA 1O3SA 2RN7A 3GFIA 1UHSA 4G6TB 2P0WA 1UG2A 2A07F 3OSFA 2FE3A 2NYXA 4ZZDA 2Z9OA 3CQZJ 3REOA 1ETOA 3DLLF 2DW4A 3ZQCA 2QQ8A 1R4NB 4UNOA 2MLGA 1XPXA 5F0HA 3KYCB 4I02A 4LG3A 3AKZA 1NTCA 3E97A 3J7AO 2E36A 4ENJA 1N78A 3HOUJ 4RM3A 2O61A 2LBFA 3H9QA 2Y0SN 2GA1A 3LSJA 3JTHA 2M4KA 2R0QC 5BPIA 4XSXF 1QGPA 3F0CA 4II2A 2L54A 2IAIA 4G7OF 1BJAA 1F9NA 1PVEA 2IS6A 2R7OA 1X3UA 3MD2A 5DDGA 2Q8KA 3GZNB 4LLNA 3GW2A 3KZIC 1O7LA 3KP7A 1ZH5A 3ECOA 1XSXA 1DP3A 3H9GA 1G3YA 1U5TA 1FOYA 1S7EA 1RZ4A 2OC6A 4H4KC 1YLFA 2PLYA 2EBIA 3E1SA 3OYNA 4BEHB 4W1UA 2F6CA 2WV1A 3A03A 5D8KB 2V4JC 1USTA 3WHBA 3BR3A 3GTJJ 2E1CA 3ZPLA 1R1UA 5AONA 1EV7A 1GLNA 3TW6A 4CCNA 3F21A 4ENKA 1LUJB 1RESA 2LP0A 3GTKJ 4BS9A 2A61A 2CQ7A 4KIFA 3KP3A 2KJBA 3WTYC 2HZDA 1J09A 1TNSA 1IDZA 3GWZA 3BPXA 4XN0A 3WTUC 5GAEJ 2FNPA 3OOUA 4KDPA 1FSEA 2RKHA 2ZBKA 4WK8F 3OYMA 3CJQB 4A5NA 1ZYRF 3HHHA 3CESA 3H36A 1T8IA 3CZ6A 3RJPA 3E5QA 1SD7A 2X9DA 3CCYA 1IV8A 1ZR2A 3NQOA 2EZKA 1DGRM 2HXIA 4FASD 2XC7A 3G1OA 3TL4X 1SFXA 1D0ZA 1WI3A 2CFOA 4C3IJ 1TWHJ 3I9V2 1ZGJA 1ZR4A 3HSEA 2JA2A 3HM5A 1FX7A 4RAGA 4A0ZA 4S0HB 2ZNZA 3FXQA 4XK4A 1VI0A 4AIHA 3CMMA
chains in the Genus database with same CATH topology
4HF2A 2EFQA 1ZLKA 4ZYGA 3T0YA 4CDGA 5CLSA 4G7ZF 4IXAA 4L9JA 2X0LA 1TQIA 3GLXA 2H09A 4XRFA 2NNNA 4JQFA 4EVIA 2JPCA 1ZN2A 2VN2A 1DDNA 1H0MA 4HA8A 3D5LA 3GYHX 4OIOF 1WQ2A 1F4KA 1YW7A 4HLYA 4B8XA 3I59A 1XMAA 1MZBA 1LVAA 4S04A 4KNYA 3R0AA 3ML6A 4M9ZA 2JT1A 1IXSB 3M8EA 1BN5A 5J8FA 5DUKA 1IRFA 1W7PA 4OMYA 3FZVA 3PFIA 3J80Z 4Q47A 3OOPA 5CYVA 2W57A 1GHCA 3WODF 3GUDA 4OOIA 2TDXA 2V1DA 2L4MA 2KJCA 2Y0MA 2WTEA 3JW4A 3O6BB 1FYKA 4LG0A 5D6EA 4KN7X 2FMLA 4OINF 3K0LA 1QQIA 1XGOA 2F5CA 1J9IA 5E17F 4H0EA 1YS7A 2OQGA 1Z9CA 5HLIA 2ISZA 5CJ9A 5JFRA 2KIFA 1FP2A 3CO7C 2Y48A 3HSRA 4MTDA 2FA5A 1XDSA 3KEQA 2D45A 3V7RA 3V8JA 3WU0A 4MQ9F 3QU6A 3RYRA 2GZWA 4HQEA 1FSHA 3WGGA 2NAZA 3CUQB 4AVPA 1LDDA 2P6TA 5HDGA 2FBHA 5DD4A 4HDUA 4U0VA 1Z1DA 4GGGA 3PQKA 3QPTA 2PI0A 2XAFA 3SXYA 1DUXC 2HQRA 3ZMVA 2L4AA 1SMTA 2DAOA 1FC3A 4BXUA 4LJZF 3GVAA 3ECHA 1HW2A 3Q9VA 1D8JA 4A0YA 3KZYA 3W6KB 1Z05A 2QENA 3GZ5A 3WGHA 4ENNA 3KFWX 3BDDA 4P96A 3KZZA 2EB7A 4G94A 4AIKA 4IRIA 3RTRA 1ZG3A 2IA2A 2FBKA 5HS9A 2STWA 1T98A 1K79A 2XUBA 2OD5A 3L2CA 1IXCA 2HKXA 1H9TA 3EQLF 2FQ3A 2GAUA 2YR2A 1LDKB 2AS5F 1W4MA 3DKWA 2RDPA 3FMSA 4LK1F 2LSOA 5LRSA 4M9XA 4ON0A 1ON1A 3TKYA 3F8FA 4CGZA 1B59A 2CYYA 4L0ZB 3HIFA 5DEQA 4I09A 1KU9A 4F7ZA 2K86A 4PCQA 1XGNA 2CO5A 2A3SA 3J81Z 2MH9A 4D0PA 2QZ8A 4KFCA 2ZKZA 1U78A 5L3GA 2P6SA 2VONA 1OPCA 2WWYA 1WWXA 4IHTA 3K1PA 1TLHB 4UV8A 2ZO4A 3DXJF 3H3UA 5K5QA 3RYPA 1QO0D 2IP2A 3VFZA 2QQBA 4UV9A 1OYYA 2VBZA 3T5XA 4HZFA 4RGUA 4U88A 3JTGA 2FU4A 2ZMEA 3BZ6A 3J81K 3I59B 5D5UB 3HYIA 4G9YA 4BQAA 2O0YA 5L3DA 1FLIA 2ADUA 2VBWA 1J7KA 1KU7A 2NS0A 2WC2A 1G6NA 2DPDA 2MLKA 3TO9A 3WE3A 4OIRF 5LBQA 3HRMA 3ZP5A 1YO5C 2FNAA 3RPUA 1D5VA 3R60A 1IAWA 3F6OA 4U0WA 1PP8F 4ASNA 2UXXA 2E1NA 1R00A 1KQ9A 5IT9Z 5LHIA 2Z5UA 1USSA 2HS5A 2L01A 5ICCA 1CGPA 4RS8A 3NEUA 5HOOA 5F6FA 1KA8A 1YG2A 2F5EA 5CVJA 3FM5A 2H6BA 4Y15A 3IL2A 2ESHA 2QWWA 2K02A 3U1DA 3DQVC 4KN4X 3HTUA 3GX4X 2HTJA 3QPHA 4BAYA 2IJLA 3BJ6A 3DEUA 4HLXA 1I6XA 5CVRA 5HS7A 2ZCWA 5BMZA 1T6SA 1XN7A 1V3FA 1RI7A 2ZNYA 4G6QA 4QLCU 3E6BA 2HQNA 2CGPA 3I4PA 2PEXA 4ZYHA 1T39A 2VE9A 3HHGA 2ZJ2A 4KMFA 3SZPA 5JR3A 1WRJA 1ZARA 1UCRA 1HQCA 2P7VB 2D1VA 5HLHA 4AWXB 2F5DA 3TO7A 2R7FA 1ONVA 3MAJA 1FNNA 3KP4A 2XKOA 4BH9A 5E18F 3CDHA 4A6EA 2VC1A 4DNCA 1ZLJA 2HTSA 4WXCA 4PDKA 3ZQ7A 5DV5A 4Y17A 1KU2A 3I54A 1K7AA 2QBYB 2FXAA 3R6SA 3MCZA 2WV0A 3O3KA 1O57A 1P4WA 2ISYA 2HR3A 1HKSA 4KICA 4EGYA 1DPUA 1YIOA 4EJUA 3V7CA 1EH6A 1E2XA 2E7WA 2K4BA 1QBJA 4L9NA 4Y13A 3GXOA 4ETSA 2QQ9A 3CUQA 2YX7A 2DTRA 4EQQA 4EGZA 1MJBA 5A2QK 4HX4A 1FBSA 4CHUA 4CZZA 1WI9A 2M30A 5CVVA 2GQQA 3BOQA 4JBAA 1W5TA 3DFGA 4YFKF 3F22A 1O3QA 3RIRA 2ZMEB 4N9HA 2XRNA 5E20A 2XHKA 4Z2YA 4WX9A 2CSOA 1S7AA 3ROUA 1XMKA 1IN7A 5LLQA 3C18A 2FMYA 2M87A 1A04A 2P5VA 2W24A 4UVBA 4KIGA 3L00A 4MNUA 3IKVA 2K27A 4BHBA 1IRGA 1HXDA 2VOPA 4LB5A 2W25A 4ZYDA 4RAZA 4XLPF 3N97A 3TOAA 5D4RA 4BNCA 5ILSA 3H92A 1JE8A 3AAFA 2D2WA 4O6JA 3SHFA 3CO6C 1IN4A 3BJAA 1B6AA 3HRUA 1D8KA 1T2KA 2J5PA 2JPBA 5ICEA 2V9VA 1JHHA 4P5OA 5K1YA 2PQ8A 1B9MA 2M1BA 3ZN0A 3CJNA 3WE2A 3TGNA 3E5XA 3WTWC 4MEYF 1EH8A 4HF1A 3U9GA 1KYWA 1XGSA 4L5IA 4KMUX 2EA2A 2HEOA 5FLXZ 5LHGA 4LK0F 3TDZC 2EFNA 1GVJA 2XAQA 2VBXA 1U6GA 2P5KA 2QM3A 5D6FA 3COAC 4RGRA 4L0YB 2FF4A 4GXOA 4HAMA 4EJVA 1YYVA 1ZGAA 3IHUA 3ELKA 5FLXK 3HTSB 3WTTC 1K6OA 1MD0A 3I0TA 3LFKA 1U8RA 1SFUA 2PMHA 5BQTA 2BE5F 4NQWA 3ULQB 1I5ZA 4TV7A 4EM0B 1BOAA 2IT0A 2P5LC 2DQRA 3FF5A 3C7JA 5K5OA 1J2XA 1WSUA 2HFHA 1H9GA 2V79A 5LEKA 3KEOA 1IN6A 4ESBA 1TBXA 1KYZA 1SFEA 2G9WA 2Z3YA 5LRRA 2RV8A 5BOXA 1U5TC 3KLOA 4XLNF 1MKMA 1LDJA 1IUYA 3E6MA 2BYVE 3J80K 4P9FA 4WCGA 4XBFA 3L9FA 4EM1A 2M8EA 3R61A 2LNBA 3HSFA 1FZPB 4LD5A 3B73A 1P6RA 1D3YA 5FO5A 1MDMA 1G3WA 3IWZA 3LAPA 2DT5A 1LNWA 1V4RA 1GXPA 2M5WA 2JTVA 1GXQA 3BY6A 3C1DA 4B09A 3CUOA 4PGHA 2EFWA 1BC8C 3M9AA 3V4GA 3Q5FA 5LGTA 3ISPA 3G73A 2LDUA 3WU1B 5DD8A 3KE2A 4WWCA 2EV0A 1UHWA 2BV6A 4KUMA 3O2PE 3LWFA 4I7HA 1JHFA 4EJWA 1HBXG 5L3EA 3ZMTA 4EJOA 4A6DA 1XCVA 1IN5A 1G3TA 3ZMDA 4KIBA 3H3ZA 3IWFA 4I0AA 4FX4A 4FT8A 3FMQA 2PN6A 2YSRA 3WTXC 2X4HA 2VODA 2CQKA 2RNJA 2QBYA 4HX8A 5HVQC 3VODA 2HGCA 2C6YA 5E8GA 1DP7P 3FMRA 4YFXF 2DPUA 4HQMA 1IF1A 4U7BA 3CTAA 4I0BA 1PDNC 2DK5A 3OV8A 1ULYA 2P8TA 2DQLA 3WGIA 3WTZA 3DF8A 3L7WA 1SAXA 2XKPA 3KCCA 2STTA 2A68F 5FGMA 2V1XA 2IVMA 5D5XB 2PBIA 1FWZA 2JSCA 2XROA 3VB2A 3F8CA 3JAMZ 2VE8A 4G6DA 5AIPA 1ZRFA 2F5FA 3EDPA 3ABTA 5ILUA 2OBPA 1EH7A 5ED4A 1UB9A 4A2UA 1UFMA 5E1XA 1I27A 3I5UA 3G3ZA 1FYMA 1BIAA 1TQPA 4GYGA 3IC7A 3EETA 3R4KA 4LLLA 3JSOA 1RIOH 3TOBA 2NRAC 4GCVA 5ICGA 3QAHA 2FRHA 2MH2A 4YFNF 3MQ0A 4BHCA 2A69F 3DP7A 1FY7A 2KIUA 3GF2A 2YU3A 1O3TA 1P2FA 1K78B 3RI4A 1SMYF 4EJTA 4Q48A 4OIQF 3V7SA 4G8XA 2HWVA 4HYEA 1XSDA 4ENMA 2H6CA 5F1RA 2L3DA 1P4AA 1G3SA 1SD4A 1LJ9A 1CF7A 1JGSA 5L3FA 2O03A 2VC0A 4HV5A 2XV4S 1XB4A 4LB6B 5IT9K 3MWMA 2XAGA 2RVCA 3BPVA 1R23A 2BGCA 1OR7A 5J8CA 1MDMB 4S05A 5H6RA 2HKOA 2R7DA 2V6CA 3P9KA 4RGSA 1MJAA 4UVCA 2LKPA 5TJJA 2CFXA 2IA1A 2A6HF 2G7HA 4PZJA 3BP8A 2OAZA 1OMIA 4YIIA 3F8NA 1B1BA 1ZHFA 1BI3A 4EMSA 4LGWA 4OIPF 2MBFA 1YS6A 3EYYA 1FP1D 3F72A 3FXRA 5E1WA 4I01A 1OKRA 2UWMA 4L9TA 4BHPA 2GWRA 4CXFA 4ESJA 4IRGA 1FOKA 2IRFG 2PFBA 3E5UA 1QNTA 1R5HA 1HW5A 4AIJA 1U2WA 3F6VA 5E1ZB 4RAYA 1TTYA 5FB2A 3RDIA 1J5YA 4QWQA 2VBYA 4HF0A 4N0BA 3I53A 3GZ6A 1S3JA 3TDUC 1O7FA 1S7OA 3EYIA 2HYGD 2A6EF 4R1HA 1LQ1A 5JI6A 3KLNA 5D5WB 2ETHA 1FPQA 2BEOA 3D0SA 1XDUA 5DCFA 1NHAA 2OA4A 5BS6A 4O5VA 3DV8A 4FHTA 1XD7A 3K2ZA 2KKOA 2XIGA 1L0OC 4WF2A 3RKXA 5KVRA 1R22A 3HUGA 5KK1A 1P4XA 2EJRA 4UXNA 2OQRA 2AXLA 2UXNA 3K1NA 4UUVA 2YPRA 1R5GA 1YW8A 5HDNA 1TQMA 4M72A 5FFZA 5L3CA 3E6CC 1MJ9A 1I1SA 2JZYA 1FYLA 2CWEA 4XSZF 3L09A 5DYMA 3IRQA 3RKYA 1SD5A 2Z99A 1PUEE 4A0XA 3MFKA 3QOPA 4KYWA 4HDVA 4ESFA 1U3EM 1L3LA 1TNTA 2R3SA 3M8FA 5DUIA 4R8HA 3JSPA 4HW0A 1O3RA 5ICFA 3IKTA 1OYWA 3Q9SA 4U0YA 1S6LA 4ZZLA 2H27A 1LEAA 4G7HF 2COMA 2OZUA 2GXGA 2P4WA 4RB3C 4I98B 1IW7F 1Z91A 3E3VA 3B02A 2P7CB 4M74A 5D4SA 1KQ0A 1QPMA 3ZMSA 4LFUA 2F2EA 3FHZA 4RB0A 3WTSC 2QLZA 1CF7B 1J59A 3SQNA 1HSTA 4EV0A 1BI1A 5D5VB 2XAHA 1RNLA 1BI0A 4HBLA 3RPQA 2HDCA 3BROA 3F23A 2J5OA 1J0RA 3LA3A 1W7PD 3LSTA 5LGNA 3T1BA 5ILVA 2K4JA 1PP7U 4MQVA 1Q1HA 1TW3A 4DQ2A 2PG4A 2FBIA 4A12A 3SZTA 4FX0A 4L9VA 1G4DA 1ZG5A 2D1HA 5H6QA 1FBQA 2QYOA 2MD5A 2DU9A 1C0WA 2EV6A 5DCMB 1TW2A 1ZAOA 3RKWA 5ERIA 2W85A 3LA2A 2O6GE 2M45A 1KGSA 3HRTA 1R36A 2XGXA 3CUQC 5EEGA 2A5YB 3K1MA 1IN8A 5FFXA 3M7GA 3WTVC 2KRFA 3P7NA 2Q2EA 2GA2A 2ZFWA 4M9SA 2H94A 1E17A 3MZHA 1K78A 4IF4A 2IA0A 4N9IA 1BIBA 1XGMA 2JRTA 4CICA 4RGXA 1T38A 4HV6A 5H20A 4KT5C 2IPQX 2UZKA 4CO8A 1IXRC 3ERED 2OZ6A 3I58A 2EFPA 2W84A 1B4AA 4MHGA 2XAJA 1ZG1A 3IRRA 3HOTA 2LF7A 3GO5A 5HS8A 2E7XA 3GFMA 3W6JB 4IPAA 2MA3A 1UHMA 2QVOA 4L18B 5JHUA 2LF8A 3E6DA 2YX4A 2ZXJA 2GXBA 4RB1A 3ZMUA 3GEZA 2EFOA 6PAXA 3ABUA 1P92A 3KP5A 4IJAA 2VOOA 5IT3A 3ZMZA 3KETA 4WXDA 3P9CA 1R58A 2QUFA 3VEPA 5HLGA 2PMUA 1XSVA 2HOEA 1W5SA 3KP6A 1RUNA 3K9TA 3KP2A 1KQ8A 2XVCA 1F1ZA 1BC7C 3F8BA 4LMYA 3HOSA 1R1TA 3HRSA 4U7DA 1S8NA 1B9NA 4YG2F 1OYIA 4MGRA 4P55A 1U5TB 2OU2A 3PQJA 3N4MA 1R7JA 1S29A 5CVUA 4MEXF 5D8LB 3WG9A 4WXHA 2DO7A 2DK8A 2KIMA 4O3MA 3GFJA 3TO6A 2EV5A 3QU3A 3C3WA 4NB5A 4GO1A 2IW5A 1QZYA 4Q4ZF 4M6YA 1QZZA 5L3BA 1ODDA 1BBYA 1HKTA 3MEXA 2G7UA 4YIFA 2VT3A 2NNYA 1SD6A 3BWGA 1VTNC 1WKMA 4UVAA 4GYIA 2VXZA 4ZH4F 3VOEA 4CYDA 1ON2A 4IVNA 1BM9A 1YQAA 1LEBA 1YTYA 3M1EA 1AWCA 3DPTA 5LHHA 3SFZA 1IZ1A 2FSWA 4UHTA 3EUHA 3GFLA 2EA4A 2RC4A 3LAJA 3MZYA 1Y0UA 2ACJA 3JAMK 1RUOA 1Z6TA 2BBYA 2O3FA 2Q0OA 4K2EA 1J75A 3S2WA 3V8LA 3DPLC 3T8TA 1ZRDA 3I64A 3FX3A 4JK1X 2B0LA 5TRDA 2RQPA 1HW1A 1W7PB 1FBUA 5HDKA 1ZRCA 1Z6RA 2DI3A 1HKQA 2CW0F 2O8XA 4OU0A 4M71A 2Z33A 3LA7A 5F64A 1AOYA 5LGUA 5BPDA 2DLLA 1T0FA 4HX7A 3TQNA 2V1UA 4LG0B 1JXSA 4KA4A 3NRVA 2GIVA 4E70A 5LEJA 4HOBA 1YW9A 3FWEA 2DBBA 1F5TA 1YFHA 2CG4A 4RB2C 3LQQA 2EK5A 3LQRA 3V8KA 4BYYA 1HSJA 3I71A 4AD9A 2ESNA 4IRHA 5FD6A 1MGTA 3BJOA 5EEHA 4R79A 3R0JA 4OMZA 3P9IA 2PJPA 2FEZA 3K69A 3ZN1A 2K7LA 2L02A 4LLGF 5DCMA 5FD5A 3QP6A 4EM2A 4Q5SF 4NHJA 2ELHA 2HZTA 1DPRA 4P9UA 2RGVA 3CLOA 4L5JA 3FM3A 4M6XA 3QRFF 3U2RA 4MTEA 2XASA 1ZREA 4IHSA 1XCBA 3QP5A 5J6XA 4M73A 5JVTA 2EWNA 4ZYEA 1KU3A 5AIQA 2VT2A 1R1VA 2FOKA 3T8RA 2HYFA 2MC3A 5K5RA 5CVIA 3FXUA 2DFIA 3F3XA 4A5MA 3F8MA 1REPC 2QQAA 1Z7UA 5E8IA 1FT9A 1I1GA 4I2OA 1STZA 4PGGA 2Y75A 1BI2A 5A2QZ 1LB2A 1O3SA 2RN7A 3GFIA 2A07F 2FE3A 2NYXA 4ZZDA 2Z9OA 3REOA 2DW4A 4UNOA 2MLGA 4I02A 3E97A 3J7AO 4ENJA 2O61A 2GA1A 3JTHA 5BPIA 4XSXF 1QGPA 2L54A 4G7OF 1BJAA 1F9NA 1X3UA 5DDGA 2Q8KA 4LLNA 3GW2A 1O7LA 3KP7A 1ZH5A 3ECOA 1XSXA 1G3YA 1U5TA 1RZ4A 1YLFA 2PLYA 5D8KB 1USTA 2E1CA 3ZPLA 1R1UA 5AONA 1EV7A 3F21A 4ENKA 2A61A 4KIFA 3KP3A 2KJBA 3WTYC 1TNSA 3GWZA 3BPXA 3WTUC 2FNPA 4KDPA 1FSEA 2RKHA 2ZBKA 4WK8F 4A5NA 1ZYRF 3HHHA 3RJPA 3E5QA 1SD7A 3NQOA 1SFXA 1ZGJA 3HSEA 1FX7A 4A0ZA 2ZNZA 3FXQA 4AIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HF2 A;  2EFQ A;  1ZLK A;  4ZYG A;  3T0Y A;  4CDG A;  5CLS A;  4G7Z F;  4IXA A;  4L9J A;  2X0L A;  1TQI A;  3GLX A;  2H09 A;  4XRF A;  2NNN A;  4JQF A;  4EVI A;  2JPC A;  1ZN2 A;  2VN2 A;  1DDN A;  1H0M A;  4HA8 A;  3D5L A;  3GYH X;  4OIO F;  1WQ2 A;  1F4K A;  1YW7 A;  4HLY A;  4B8X A;  3I59 A;  1XMA A;  1MZB A;  1LVA A;  4S04 A;  4KNY A;  3R0A A;  3ML6 A;  4M9Z A;  2JT1 A;  1IXS B;  3M8E A;  1BN5 A;  5J8F A;  5DUK A;  1IRF A;  1W7P A;  4OMY A;  3FZV A;  3PFI A;  3J80 Z;  4Q47 A;  3OOP A;  5CYV A;  2W57 A;  1GHC A;  3WOD F;  3GUD A;  4OOI A;  2TDX A;  2V1D A;  2L4M A;  2KJC A;  2Y0M A;  2WTE A;  3JW4 A;  3O6B B;  1FYK A;  4LG0 A;  5D6E A;  4KN7 X;  2FML A;  4OIN F;  3K0L A;  1QQI A;  1XGO A;  2F5C A;  1J9I A;  5E17 F;  4H0E A;  1YS7 A;  2OQG A;  1Z9C A;  5HLI A;  2ISZ A;  5CJ9 A;  5JFR A;  2KIF A;  1FP2 A;  3CO7 C;  2Y48 A;  3HSR A;  4MTD A;  2FA5 A;  1XDS A;  3KEQ A;  2D45 A;  3V7R A;  3V8J A;  3WU0 A;  4MQ9 F;  3QU6 A;  3RYR A;  2GZW A;  4HQE A;  1FSH A;  3WGG A;  2NAZ A;  3CUQ B;  4AVP A;  1LDD A;  2P6T A;  5HDG A;  2FBH A;  5DD4 A;  4HDU A;  4U0V A;  1Z1D A;  4GGG A;  3PQK A;  3QPT A;  2PI0 A;  2XAF A;  3SXY A;  1DUX C;  2HQR A;  3ZMV A;  2L4A A;  1SMT A;  2DAO A;  1FC3 A;  4BXU A;  4LJZ F;  3GVA A;  3ECH A;  1HW2 A;  3Q9V A;  1D8J A;  4A0Y A;  3KZY A;  3W6K B;  1Z05 A;  2QEN A;  3GZ5 A;  3WGH A;  4ENN A;  3KFW X;  3BDD A;  4P96 A;  3KZZ A;  2EB7 A;  4G94 A;  4AIK A;  4IRI A;  3RTR A;  1ZG3 A;  2IA2 A;  2FBK A;  5HS9 A;  2STW A;  1T98 A;  1K79 A;  2XUB A;  2OD5 A;  3L2C A;  1IXC A;  2HKX A;  1H9T A;  3EQL F;  2FQ3 A;  2GAU A;  2YR2 A;  1LDK B;  2AS5 F;  1W4M A;  3DKW A;  2RDP A;  3FMS A;  4LK1 F;  2LSO A;  5LRS A;  4M9X A;  4ON0 A;  1ON1 A;  3TKY A;  3F8F A;  4CGZ A;  1B59 A;  2CYY A;  4L0Z B;  3HIF A;  5DEQ A;  4I09 A;  1KU9 A;  4F7Z A;  2K86 A;  4PCQ A;  1XGN A;  2CO5 A;  2A3S A;  3J81 Z;  2MH9 A;  4D0P A;  2QZ8 A;  4KFC A;  2ZKZ A;  1U78 A;  5L3G A;  2P6S A;  2VON A;  1OPC A;  2WWY A;  1WWX A;  4IHT A;  3K1P A;  1TLH B;  4UV8 A;  2ZO4 A;  3DXJ F;  3H3U A;  5K5Q A;  3RYP A;  1QO0 D;  2IP2 A;  3VFZ A;  2QQB A;  4UV9 A;  1OYY A;  2VBZ A;  3T5X A;  4HZF A;  4RGU A;  4U88 A;  3JTG A;  2FU4 A;  2ZME A;  3BZ6 A;  3J81 K;  3I59 B;  5D5U B;  3HYI A;  4G9Y A;  4BQA A;  2O0Y A;  5L3D A;  1FLI A;  2ADU A;  2VBW A;  1J7K A;  1KU7 A;  2NS0 A;  2WC2 A;  1G6N A;  2DPD A;  2MLK A;  3TO9 A;  3WE3 A;  4OIR F;  5LBQ A;  3HRM A;  3ZP5 A;  1YO5 C;  2FNA A;  3RPU A;  1D5V A;  3R60 A;  1IAW A;  3F6O A;  4U0W A;  1PP8 F;  4ASN A;  2UXX A;  2E1N A;  1R00 A;  1KQ9 A;  5IT9 Z;  5LHI A;  2Z5U A;  1USS A;  2HS5 A;  2L01 A;  5ICC A;  1CGP A;  4RS8 A;  3NEU A;  5HOO A;  5F6F A;  1KA8 A;  1YG2 A;  2F5E A;  5CVJ A;  3FM5 A;  2H6B A;  4Y15 A;  3IL2 A;  2ESH A;  2QWW A;  2K02 A;  3U1D A;  3DQV C;  4KN4 X;  3HTU A;  3GX4 X;  2HTJ A;  3QPH A;  4BAY A;  2IJL A;  3BJ6 A;  3DEU A;  4HLX A;  1I6X A;  5CVR A;  5HS7 A;  2ZCW A;  5BMZ A;  1T6S A;  1XN7 A;  1V3F A;  1RI7 A;  2ZNY A;  4G6Q A;  4QLC U;  3E6B A;  2HQN A;  2CGP A;  3I4P A;  2PEX A;  4ZYH A;  1T39 A;  2VE9 A;  3HHG A;  2ZJ2 A;  4KMF A;  3SZP A;  5JR3 A;  1WRJ A;  1ZAR A;  1UCR A;  1HQC A;  2P7V B;  2D1V A;  5HLH A;  4AWX B;  2F5D A;  3TO7 A;  2R7F A;  1ONV A;  3MAJ A;  1FNN A;  3KP4 A;  2XKO A;  4BH9 A;  5E18 F;  3CDH A;  4A6E A;  2VC1 A;  4DNC A;  1ZLJ A;  2HTS A;  4WXC A;  4PDK A;  3ZQ7 A;  5DV5 A;  4Y17 A;  1KU2 A;  3I54 A;  1K7A A;  2QBY B;  2FXA A;  3R6S A;  3MCZ A;  2WV0 A;  3O3K A;  1O57 A;  1P4W A;  2ISY A;  2HR3 A;  1HKS A;  4KIC A;  4EGY A;  1DPU A;  1YIO A;  4EJU A;  3V7C A;  1EH6 A;  1E2X A;  2E7W A;  2K4B A;  1QBJ A;  4L9N A;  4Y13 A;  3GXO A;  4ETS A;  2QQ9 A;  3CUQ A;  2YX7 A;  2DTR A;  4EQQ A;  4EGZ A;  1MJB A;  5A2Q K;  4HX4 A;  1FBS A;  4CHU A;  4CZZ A;  1WI9 A;  2M30 A;  5CVV A;  2GQQ A;  3BOQ A;  4JBA A;  1W5T A;  3DFG A;  4YFK F;  3F22 A;  1O3Q A;  3RIR A;  2ZME B;  4N9H A;  2XRN A;  5E20 A;  2XHK A;  4Z2Y A;  4WX9 A;  2CSO A;  1S7A A;  3ROU A;  1XMK A;  1IN7 A;  5LLQ A;  3C18 A;  2FMY A;  2M87 A;  1A04 A;  2P5V A;  2W24 A;  4UVB A;  4KIG A;  3L00 A;  4MNU A;  3IKV A;  2K27 A;  4BHB A;  1IRG A;  1HXD A;  2VOP A;  4LB5 A;  2W25 A;  4ZYD A;  4RAZ A;  4XLP F;  3N97 A;  3TOA A;  5D4R A;  4BNC A;  5ILS A;  3H92 A;  1JE8 A;  3AAF A;  2D2W A;  4O6J A;  3SHF A;  3CO6 C;  1IN4 A;  3BJA A;  1B6A A;  3HRU A;  1D8K A;  1T2K A;  2J5P A;  2JPB A;  5ICE A;  2V9V A;  1JHH A;  4P5O A;  5K1Y A;  2PQ8 A;  1B9M A;  2M1B A;  3ZN0 A;  3CJN A;  3WE2 A;  3TGN A;  3E5X A;  3WTW C;  4MEY F;  1EH8 A;  4HF1 A;  3U9G A;  1KYW A;  1XGS A;  4L5I A;  4KMU X;  2EA2 A;  2HEO A;  5FLX Z;  5LHG A;  4LK0 F;  3TDZ C;  2EFN A;  1GVJ A;  2XAQ A;  2VBX A;  1U6G A;  2P5K A;  2QM3 A;  5D6F A;  3COA C;  4RGR A;  4L0Y B;  2FF4 A;  4GXO A;  4HAM A;  4EJV A;  1YYV A;  1ZGA A;  3IHU A;  3ELK A;  5FLX K;  3HTS B;  3WTT C;  1K6O A;  1MD0 A;  3I0T A;  3LFK A;  1U8R A;  1SFU A;  2PMH A;  5BQT A;  2BE5 F;  4NQW A;  3ULQ B;  1I5Z A;  4TV7 A;  4EM0 B;  1BOA A;  2IT0 A;  2P5L C;  2DQR A;  3FF5 A;  3C7J A;  5K5O A;  1J2X A;  1WSU A;  2HFH A;  1H9G A;  2V79 A;  5LEK A;  3KEO A;  1IN6 A;  4ESB A;  1TBX A;  1KYZ A;  1SFE A;  2G9W A;  2Z3Y A;  5LRR A;  2RV8 A;  5BOX A;  1U5T C;  3KLO A;  4XLN F;  1MKM A;  1LDJ A;  1IUY A;  3E6M A;  2BYV E;  3J80 K;  4P9F A;  4WCG A;  4XBF A;  3L9F A;  4EM1 A;  2M8E A;  3R61 A;  2LNB A;  3HSF A;  1FZP B;  4LD5 A;  3B73 A;  1P6R A;  1D3Y A;  5FO5 A;  1MDM A;  1G3W A;  3IWZ A;  3LAP A;  2DT5 A;  1LNW A;  1V4R A;  1GXP A;  2M5W A;  2JTV A;  1GXQ A;  3BY6 A;  3C1D A;  4B09 A;  3CUO A;  4PGH A;  2EFW A;  1BC8 C;  3M9A A;  3V4G A;  3Q5F A;  5LGT A;  3ISP A;  3G73 A;  2LDU A;  3WU1 B;  5DD8 A;  3KE2 A;  4WWC A;  2EV0 A;  1UHW A;  2BV6 A;  4KUM A;  3O2P E;  3LWF A;  4I7H A;  1JHF A;  4EJW A;  1HBX G;  5L3E A;  3ZMT A;  4EJO A;  4A6D A;  1XCV A;  1IN5 A;  1G3T A;  3ZMD A;  4KIB A;  3H3Z A;  3IWF A;  4I0A A;  4FX4 A;  4FT8 A;  3FMQ A;  2PN6 A;  2YSR A;  3WTX C;  2X4H A;  2VOD A;  2CQK A;  2RNJ A;  2QBY A;  4HX8 A;  5HVQ C;  3VOD A;  2HGC A;  2C6Y A;  5E8G A;  1DP7 P;  3FMR A;  4YFX F;  2DPU A;  4HQM A;  1IF1 A;  4U7B A;  3CTA A;  4I0B A;  1PDN C;  2DK5 A;  3OV8 A;  1ULY A;  2P8T A;  2DQL A;  3WGI A;  3WTZ A;  3DF8 A;  3L7W A;  1SAX A;  2XKP A;  3KCC A;  2STT A;  2A68 F;  5FGM A;  2V1X A;  2IVM A;  5D5X B;  2PBI A;  1FWZ A;  2JSC A;  2XRO A;  3VB2 A;  3F8C A;  3JAM Z;  2VE8 A;  4G6D A;  5AIP A;  1ZRF A;  2F5F A;  3EDP A;  3ABT A;  5ILU A;  2OBP A;  1EH7 A;  5ED4 A;  1UB9 A;  4A2U A;  1UFM A;  5E1X A;  1I27 A;  3I5U A;  3G3Z A;  1FYM A;  1BIA A;  1TQP A;  4GYG A;  3IC7 A;  3EET A;  3R4K A;  4LLL A;  3JSO A;  1RIO H;  3TOB A;  2NRA C;  4GCV A;  5ICG A;  3QAH A;  2FRH A;  2MH2 A;  4YFN F;  3MQ0 A;  4BHC A;  2A69 F;  3DP7 A;  1FY7 A;  2KIU A;  3GF2 A;  2YU3 A;  1O3T A;  1P2F A;  1K78 B;  3RI4 A;  1SMY F;  4EJT A;  4Q48 A;  4OIQ F;  3V7S A;  4G8X A;  2HWV A;  4HYE A;  1XSD A;  4ENM A;  2H6C A;  5F1R A;  2L3D A;  1P4A A;  1G3S A;  1SD4 A;  1LJ9 A;  1CF7 A;  1JGS A;  5L3F A;  2O03 A;  2VC0 A;  4HV5 A;  2XV4 S;  1XB4 A;  4LB6 B;  5IT9 K;  3MWM A;  2XAG A;  2RVC A;  3BPV A;  1R23 A;  2BGC A;  1OR7 A;  5J8C A;  1MDM B;  4S05 A;  5H6R A;  2HKO A;  2R7D A;  2V6C A;  3P9K A;  4RGS A;  1MJA A;  4UVC A;  2LKP A;  5TJJ A;  2CFX A;  2IA1 A;  2A6H F;  2G7H A;  4PZJ A;  3BP8 A;  2OAZ A;  1OMI A;  4YII A;  3F8N A;  1B1B A;  1ZHF A;  1BI3 A;  4EMS A;  4LGW A;  4OIP F;  2MBF A;  1YS6 A;  3EYY A;  1FP1 D;  3F72 A;  3FXR A;  5E1W A;  4I01 A;  1OKR A;  2UWM A;  4L9T A;  4BHP A;  2GWR A;  4CXF A;  4ESJ A;  4IRG A;  1FOK A;  2IRF G;  2PFB A;  3E5U A;  1QNT A;  1R5H A;  1HW5 A;  4AIJ A;  1U2W A;  3F6V A;  5E1Z B;  4RAY A;  1TTY A;  5FB2 A;  3RDI A;  1J5Y A;  4QWQ A;  2VBY A;  4HF0 A;  4N0B A;  3I53 A;  3GZ6 A;  1S3J A;  3TDU C;  1O7F A;  1S7O A;  3EYI A;  2HYG D;  2A6E F;  4R1H A;  1LQ1 A;  5JI6 A;  3KLN A;  5D5W B;  2ETH A;  1FPQ A;  2BEO A;  3D0S A;  1XDU A;  5DCF A;  1NHA A;  2OA4 A;  5BS6 A;  4O5V A;  3DV8 A;  4FHT A;  1XD7 A;  3K2Z A;  2KKO A;  2XIG A;  1L0O C;  4WF2 A;  3RKX A;  5KVR A;  1R22 A;  3HUG A;  5KK1 A;  1P4X A;  2EJR A;  4UXN A;  2OQR A;  2AXL A;  2UXN A;  3K1N A;  4UUV A;  2YPR A;  1R5G A;  1YW8 A;  5HDN A;  1TQM A;  4M72 A;  5FFZ A;  5L3C A;  3E6C C;  1MJ9 A;  1I1S A;  2JZY A;  1FYL A;  2CWE A;  4XSZ F;  3L09 A;  5DYM A;  3IRQ A;  3RKY A;  1SD5 A;  2Z99 A;  1PUE E;  4A0X A;  3MFK A;  3QOP A;  4KYW A;  4HDV A;  4ESF A;  1U3E M;  1L3L A;  1TNT A;  2R3S A;  3M8F A;  5DUI A;  4R8H A;  3JSP A;  4HW0 A;  1O3R A;  5ICF A;  3IKT A;  1OYW A;  3Q9S A;  4U0Y A;  1S6L A;  4ZZL A;  2H27 A;  1LEA A;  4G7H F;  2COM A;  2OZU A;  2GXG A;  2P4W A;  4RB3 C;  4I98 B;  1IW7 F;  1Z91 A;  3E3V A;  3B02 A;  2P7C B;  4M74 A;  5D4S A;  1KQ0 A;  1QPM A;  3ZMS A;  4LFU A;  2F2E A;  3FHZ A;  4RB0 A;  3WTS C;  2QLZ A;  1CF7 B;  1J59 A;  3SQN A;  1HST A;  4EV0 A;  1BI1 A;  5D5V B;  2XAH A;  1RNL A;  1BI0 A;  4HBL A;  3RPQ A;  2HDC A;  3BRO A;  3F23 A;  2J5O A;  1J0R A;  3LA3 A;  1W7P D;  3LST A;  5LGN A;  3T1B A;  5ILV A;  2K4J A;  1PP7 U;  4MQV A;  1Q1H A;  1TW3 A;  4DQ2 A;  2PG4 A;  2FBI A;  4A12 A;  3SZT A;  4FX0 A;  4L9V A;  1G4D A;  1ZG5 A;  2D1H A;  5H6Q A;  1FBQ A;  2QYO A;  2MD5 A;  2DU9 A;  1C0W A;  2EV6 A;  5DCM B;  1TW2 A;  1ZAO A;  3RKW A;  5ERI A;  2W85 A;  3LA2 A;  2O6G E;  2M45 A;  1KGS A;  3HRT A;  1R36 A;  2XGX A;  3CUQ C;  5EEG A;  2A5Y B;  3K1M A;  1IN8 A;  5FFX A;  3M7G A;  3WTV C;  2KRF A;  3P7N A;  2Q2E A;  2GA2 A;  2ZFW A;  4M9S A;  2H94 A;  1E17 A;  3MZH A;  1K78 A;  4IF4 A;  2IA0 A;  4N9I A;  1BIB A;  1XGM A;  2JRT A;  4CIC A;  4RGX A;  1T38 A;  4HV6 A;  5H20 A;  4KT5 C;  2IPQ X;  2UZK A;  4CO8 A;  1IXR C;  3ERE D;  2OZ6 A;  3I58 A;  2EFP A;  2W84 A;  1B4A A;  4MHG A;  2XAJ A;  1ZG1 A;  3IRR A;  3HOT A;  2LF7 A;  3GO5 A;  5HS8 A;  2E7X A;  3GFM A;  3W6J B;  4IPA A;  2MA3 A;  1UHM A;  2QVO A;  4L18 B;  5JHU A;  2LF8 A;  3E6D A;  2YX4 A;  2ZXJ A;  2GXB A;  4RB1 A;  3ZMU A;  3GEZ A;  2EFO A;  6PAX A;  3ABU A;  1P92 A;  3KP5 A;  4IJA A;  2VOO A;  5IT3 A;  3ZMZ A;  3KET A;  4WXD A;  3P9C A;  1R58 A;  2QUF A;  3VEP A;  5HLG A;  2PMU A;  1XSV A;  2HOE A;  1W5S A;  3KP6 A;  1RUN A;  3K9T A;  3KP2 A;  1KQ8 A;  2XVC A;  1F1Z A;  1BC7 C;  3F8B A;  4LMY A;  3HOS A;  1R1T A;  3HRS A;  4U7D A;  1S8N A;  1B9N A;  4YG2 F;  1OYI A;  4MGR A;  4P55 A;  1U5T B;  2OU2 A;  3PQJ A;  3N4M A;  1R7J A;  1S29 A;  5CVU A;  4MEX F;  5D8L B;  3WG9 A;  4WXH A;  2DO7 A;  2DK8 A;  2KIM A;  4O3M A;  3GFJ A;  3TO6 A;  2EV5 A;  3QU3 A;  3C3W A;  4NB5 A;  4GO1 A;  2IW5 A;  1QZY A;  4Q4Z F;  4M6Y A;  1QZZ A;  5L3B A;  1ODD A;  1BBY A;  1HKT A;  3MEX A;  2G7U A;  4YIF A;  2VT3 A;  2NNY A;  1SD6 A;  3BWG A;  1VTN C;  1WKM A;  4UVA A;  4GYI A;  2VXZ A;  4ZH4 F;  3VOE A;  4CYD A;  1ON2 A;  4IVN A;  1BM9 A;  1YQA A;  1LEB A;  1YTY A;  3M1E A;  1AWC A;  3DPT A;  5LHH A;  3SFZ A;  1IZ1 A;  2FSW A;  4UHT A;  3EUH A;  3GFL A;  2EA4 A;  2RC4 A;  3LAJ A;  3MZY A;  1Y0U A;  2ACJ A;  3JAM K;  1RUO A;  1Z6T A;  2BBY A;  2O3F A;  2Q0O A;  4K2E A;  1J75 A;  3S2W A;  3V8L A;  3DPL C;  3T8T A;  1ZRD A;  3I64 A;  3FX3 A;  4JK1 X;  2B0L A;  5TRD A;  2RQP A;  1HW1 A;  1W7P B;  1FBU A;  5HDK A;  1ZRC A;  1Z6R A;  2DI3 A;  1HKQ A;  2CW0 F;  2O8X A;  4OU0 A;  4M71 A;  2Z33 A;  3LA7 A;  5F64 A;  1AOY A;  5LGU A;  5BPD A;  2DLL A;  1T0F A;  4HX7 A;  3TQN A;  2V1U A;  4LG0 B;  1JXS A;  4KA4 A;  3NRV A;  2GIV A;  4E70 A;  5LEJ A;  4HOB A;  1YW9 A;  3FWE A;  2DBB A;  1F5T A;  1YFH A;  2CG4 A;  4RB2 C;  3LQQ A;  2EK5 A;  3LQR A;  3V8K A;  4BYY A;  1HSJ A;  3I71 A;  4AD9 A;  2ESN A;  4IRH A;  5FD6 A;  1MGT A;  3BJO A;  5EEH A;  4R79 A;  3R0J A;  4OMZ A;  3P9I A;  2PJP A;  2FEZ A;  3K69 A;  3ZN1 A;  2K7L A;  2L02 A;  4LLG F;  5DCM A;  5FD5 A;  3QP6 A;  4EM2 A;  4Q5S F;  4NHJ A;  2ELH A;  2HZT A;  1DPR A;  4P9U A;  2RGV A;  3CLO A;  4L5J A;  3FM3 A;  4M6X A;  3QRF F;  3U2R A;  4MTE A;  2XAS A;  1ZRE A;  4IHS A;  1XCB A;  3QP5 A;  5J6X A;  4M73 A;  5JVT A;  2EWN A;  4ZYE A;  1KU3 A;  5AIQ A;  2VT2 A;  1R1V A;  2FOK A;  3T8R A;  2HYF A;  2MC3 A;  5K5R A;  5CVI A;  3FXU A;  2DFI A;  3F3X A;  4A5M A;  3F8M A;  1REP C;  2QQA A;  1Z7U A;  5E8I A;  1FT9 A;  1I1G A;  4I2O A;  1STZ A;  4PGG A;  2Y75 A;  1BI2 A;  5A2Q Z;  1LB2 A;  1O3S A;  2RN7 A;  3GFI A;  2A07 F;  2FE3 A;  2NYX A;  4ZZD A;  2Z9O A;  3REO A;  2DW4 A;  4UNO A;  2MLG A;  4I02 A;  3E97 A;  3J7A O;  4ENJ A;  2O61 A;  2GA1 A;  3JTH A;  5BPI A;  4XSX F;  1QGP A;  2L54 A;  4G7O F;  1BJA A;  1F9N A;  1X3U A;  5DDG A;  2Q8K A;  4LLN A;  3GW2 A;  1O7L A;  3KP7 A;  1ZH5 A;  3ECO A;  1XSX A;  1G3Y A;  1U5T A;  1RZ4 A;  1YLF A;  2PLY A;  5D8K B;  1UST A;  2E1C A;  3ZPL A;  1R1U A;  5AON A;  1EV7 A;  3F21 A;  4ENK A;  2A61 A;  4KIF A;  3KP3 A;  2KJB A;  3WTY C;  1TNS A;  3GWZ A;  3BPX A;  3WTU C;  2FNP A;  4KDP A;  1FSE A;  2RKH A;  2ZBK A;  4WK8 F;  4A5N A;  1ZYR F;  3HHH A;  3RJP A;  3E5Q A;  1SD7 A;  3NQO A;  1SFX A;  1ZGJ A;  3HSE A;  1FX7 A;  4A0Z A;  2ZNZ A;  3FXQ A;  4AIH A; 
#chains in the Genus database with same CATH topology
 3BZK A;  4KIT B;  4HF2 A;  2EFQ A;  1RR8 C;  1ZLK A;  4ZYG A;  3T0Y A;  4CDG A;  5CLS A;  4IX7 A;  4G7Z F;  2LD5 A;  4IXA A;  2BXZ A;  3A0H C;  3FHN A;  3VPR A;  4L9J A;  3ZCO A;  3H0D A;  1K83 J;  3BQY A;  4J19 A;  2X0L A;  3S8P A;  1TQI A;  4M3E A;  2KPM A;  3ZQH A;  4XKB A;  3GLX A;  2H09 A;  4XLA A;  4XRF A;  2NNN A;  2PMZ A;  4JQF A;  2Y0S A;  4EVI A;  1BR4 A;  3SEQ A;  2DOE A;  1U9N A;  5GPA A;  3ZQL A;  2JPC A;  1YRN B;  1ZN2 A;  5M5W J;  4DYC A;  3H3V K;  2DA6 A;  1I3Q J;  2VN2 A;  2DJN A;  2DFE A;  1DDN A;  1P9Q C;  3SYT A;  1H0M A;  1VQ4 I;  4HA8 A;  2DA3 A;  1X3W B;  2K9N A;  3VSK A;  3D5L A;  2RAE A;  5KAI C;  3GYH X;  4OIO F;  3OS1 A;  1UAA A;  1WQ2 A;  1F4K A;  5B5E C;  2HVS A;  1AKH A;  1YW7 A;  4HLY A;  1FIA A;  4B8X A;  3S1M J;  2HQA A;  3I59 A;  2R4G A;  1XMA A;  3Q0V A;  3GTP J;  3DEW A;  5EZH A;  1MZB A;  1POG A;  1LVA A;  4S04 A;  2LFB A;  1RR7 A;  2M0M A;  4KNY A;  3R0A A;  4D7N A;  3ML6 A;  1H88 C;  1I39 A;  4M9Z A;  2JT1 A;  1IXS B;  3M8E A;  1ITY A;  5BNG A;  5FRN A;  1BN5 A;  4A3D J;  3WU2 C;  4IZZ A;  3FKI J;  1GDT A;  5J8F A;  1MMG A;  5DUK A;  1IRF A;  5C4X J;  1W7P A;  4OMY A;  3FZV A;  3HKZ N;  3PFI A;  3J80 Z;  4Q47 A;  5F08 A;  1N25 A;  3OOP A;  5CYV A;  2W57 A;  1GHC A;  3WOD F;  3GUD A;  2OF7 A;  2W48 A;  4OOI A;  2TDX A;  2V1D A;  2L4M A;  2KJC A;  5F04 A;  4DIQ A;  2Y0M A;  2VPR A;  2DT6 A;  2WTE A;  4BUP A;  3JW4 A;  2XPV A;  1NH3 A;  3CDI A;  1XS9 A;  3O6B B;  1FYK A;  3OYF A;  2OTJ I;  3GTM J;  4LG0 A;  3PFY A;  5D6E A;  2LVS A;  2FML A;  4KN7 X;  4OIN F;  3K0L A;  3BTI A;  1QQI A;  5FKK A;  1XGO A;  3W2V A;  4B48 A;  2F5C A;  2X6O A;  1J9I A;  5E17 F;  3OYH A;  4H0E A;  1YS7 A;  2FQ4 A;  2VIX A;  2OQG A;  3DBR B;  2UV1 A;  1Z9C A;  5HLI A;  2ISZ A;  5CJ9 A;  4XKC A;  1JJ6 C;  3DTI A;  5JFR A;  1LFU P;  3HC7 A;  2KIF A;  1FP2 A;  2L9R A;  4IEJ A;  4HNU A;  3CO7 C;  4E7I A;  3S1N J;  2Y48 A;  3HSR A;  4MTD A;  2FA5 A;  3CD6 I;  4BL0 B;  1XDS A;  3KEQ A;  1SVL A;  2D45 A;  3V7R A;  3KEY A;  3V8J A;  3WU0 A;  4MQ9 F;  3QU6 A;  3D5R C;  3RYR A;  3CF2 A;  2EZI A;  1BW5 A;  2GZW A;  3EUA A;  4HQE A;  3OYG A;  1FSH A;  3WGG A;  2ME6 A;  2NAZ A;  3CUQ B;  5EG0 A;  2LBF B;  4AVP A;  1LDD A;  3VYT B;  4GDF A;  5JHF A;  4MIM A;  2P6T A;  5HDG A;  2FBH A;  3K70 D;  4ITV A;  1DU0 A;  4FTH A;  5DD4 A;  3S3M A;  4RA2 A;  4HDU A;  1JTY A;  1Z1D A;  4U0V A;  3WHC A;  1LPQ A;  4GGG A;  3TMO A;  3PQK A;  4Y7N J;  2R5Z A;  4A3B J;  1T56 A;  3QPL A;  3QPT A;  4DW6 A;  2ID3 A;  2PI0 A;  3DKY A;  3JRE A;  2XAF A;  3SXY A;  3S3O A;  1DUX C;  2JA7 J;  2K3F A;  2HQR A;  3ZMV A;  2L4A A;  3PNV A;  1SMT A;  2DAO A;  1FC3 A;  2CS3 A;  4BXU A;  3FK7 A;  4LJZ F;  4DYR A;  2W1O A;  3GVA A;  3ECH A;  1HW2 A;  3Q9V A;  4PJM A;  1X58 A;  3B6A A;  2JA8 J;  1D8J A;  4A0Y A;  3KZY A;  3H0G J;  4JX4 A;  4Y4R A;  2BY3 A;  3W6K B;  1WJC A;  1Z05 A;  4AID A;  2QEN A;  3GZ5 A;  3WGH A;  3H5R A;  2K5C A;  4ENN A;  3KFW X;  2L7Z A;  2K3P A;  3BDD A;  4P96 A;  3KZZ A;  2BVM A;  3IV5 A;  1JT6 A;  2EB7 A;  3A4C A;  4G94 A;  2M3A A;  2YU9 J;  4XRS G;  2E5N A;  4E4H A;  4AIK A;  2JSP A;  2JVG A;  4IRI A;  3RTR A;  2DMU A;  3IH3 A;  2K40 A;  3CC2 I;  1ZG3 A;  2IA2 A;  4JYK A;  2FBK A;  1K4T A;  2MD0 A;  2F4O B;  5HS9 A;  2STW A;  3W3C A;  1T98 A;  1K79 A;  2E1M C;  4DJA A;  4CUG A;  1MBH A;  2OD5 A;  2XUB A;  2DTZ A;  3L2C A;  2ZSH B;  1IXC A;  2HKX A;  2R7Z J;  1H9T A;  3EQL F;  1JUM A;  3OL4 A;  1NG7 A;  2BZT A;  2FQ3 A;  2GAU A;  3CCS I;  1SAU A;  2YR2 A;  1LDK B;  2AS5 F;  3PUF A;  1W4M A;  3DKW A;  2KT0 A;  2RDP A;  2VL8 A;  3FMS A;  4LK1 F;  3FDY A;  2LSO A;  5LRS A;  4M9X A;  4QPO A;  4ON0 A;  3ZGK A;  1ON1 A;  3TKY A;  4XR6 A;  3F8F A;  1BR2 A;  4CGZ A;  2X1D A;  1B59 A;  2CYY A;  1CQT A;  4L0Z B;  3N05 A;  3HIF A;  2H8W A;  2UUZ A;  4I09 A;  5DEQ A;  1KU9 A;  2VAS A;  4PJ0 C;  4F7Z A;  2K86 A;  4PCQ A;  1XGN A;  2CO5 A;  3RPU D;  2A3S A;  3C2B A;  2JMW A;  5FKO A;  3J81 Z;  3LMM A;  2MH9 A;  4D0P A;  4CCK A;  2QZ8 A;  4KFC A;  2ZKZ A;  1U78 A;  5L3G A;  2P6S A;  2TCT A;  3BCB A;  2X1C A;  2VON A;  1OPC A;  2WWY A;  5EEA A;  1WWX A;  4IHT A;  4CCM A;  3K1P A;  3TP3 A;  1HC8 A;  1TLH B;  4UV8 A;  2ZO4 A;  1JT0 A;  3X2Q H;  4C2T A;  1XG1 A;  4E7K A;  1U0J A;  3GBG A;  4XM3 A;  3DXJ F;  2MC4 A;  2WB1 N;  3CCV I;  3H3U A;  1MND A;  5K5Q A;  3S2H J;  2MSY A;  1QO0 D;  2IP2 A;  3RYP A;  3VFZ A;  4MO7 A;  2QQB A;  2JN6 A;  4UV9 A;  1OYY A;  1A6Q A;  2VBZ A;  3OIP A;  3T5X A;  4HZF A;  4RGU A;  4U88 A;  3MKW B;  3MN2 A;  3JTG A;  1T95 A;  1WGX A;  2E35 A;  2FU4 A;  2Z16 A;  5IOY A;  1QA6 A;  2ZME A;  1B72 A;  3BZ6 A;  4BJ6 C;  4I76 A;  4IHW A;  4D5F A;  4ZDP A;  3J81 K;  1AKH B;  3K2A A;  1JKO C;  2IGK A;  4BEH A;  2BY0 A;  3I59 B;  5GP9 A;  4XQF A;  4FCY A;  5D5U B;  3JRI A;  3HYI A;  3K10 A;  5F0C A;  3CMY A;  2DN0 A;  4G9Y A;  2COB A;  4BQA A;  2O0Y A;  2HOS A;  5L3D A;  2KIQ A;  2W4S A;  2ADU A;  2VBW A;  1FLI A;  3QOD A;  3C2H A;  1J7K A;  1WFX A;  1KU7 A;  2NS0 A;  2WC2 A;  4JP0 A;  5B1A H;  1G6N A;  2DPD A;  2L2O A;  2MLK A;  3TO9 A;  3WE3 A;  4DGW B;  3NWT A;  4OIR F;  5LBQ A;  3HRM A;  3ZP5 A;  1YO5 C;  2FNA A;  3OIQ A;  3RPU A;  1VQO I;  1D5V A;  3R60 A;  1IAW A;  3I3L A;  5K7F A;  2LY9 A;  2GBY A;  5KHD A;  2NVX J;  3F6O A;  1MSE C;  4U0W A;  4CZC A;  2VQG A;  4ASN A;  4IL6 C;  1VQM I;  1PP8 F;  1TL8 A;  2UXX A;  1Z67 A;  2E1N A;  1R00 A;  5J3L A;  1KQ9 A;  1S5L C;  5IT9 Z;  4GRI A;  5LHI A;  2NVT J;  2Z5U A;  1USS A;  2F5V A;  2HS5 A;  2L01 A;  1X1A A;  5ICC A;  4A3C J;  5JVG F;  1CGP A;  3K4M A;  4RS8 A;  4BY7 J;  3NEU A;  2KRC A;  5HOO A;  5F6F A;  3PUB A;  3OL3 A;  1KA8 A;  1YG2 A;  2F5E A;  5CVJ A;  3FM5 A;  2H6B A;  4Y15 A;  3K4B A;  2JVH A;  3I4M J;  3IL2 A;  2ESH A;  2CW8 A;  3OWT A;  3L2U A;  2QWW A;  2K02 A;  4LIT A;  1W36 C;  1EKE A;  5KAF C;  2VKV A;  1ETX A;  2XGE A;  3DQV C;  3U1D A;  1OCC H;  4KN4 X;  1W5C C;  3H5A A;  3HTU A;  2JJ7 A;  3GX4 X;  2HTJ A;  2R7S A;  3FKJ A;  2WY7 Q;  3QPH A;  4IHX A;  3LFU A;  4BAY A;  2IJL A;  1X2M A;  3BJ6 A;  2L9N A;  2WB1 A;  3DEU A;  2NVY J;  4HLX A;  4E7H A;  4NC8 A;  3QYE A;  3QWL A;  2Y9Y A;  4E6K G;  1I6X A;  3RSN A;  2ECB A;  5CVR A;  3LSH A;  5HS7 A;  5J47 A;  1G2H A;  2ZCW A;  5BMZ A;  1AHD P;  1T6S A;  1XN7 A;  5C4J J;  1EF4 A;  4PJJ A;  2ZJQ F;  3L2Q A;  1HCR A;  1V3F A;  1I6H J;  3PSF A;  1RI7 A;  3LL7 A;  2ZNY A;  4G6Q A;  4QLC U;  1SC7 A;  2W7N A;  1WJA A;  3E6B A;  2L9V A;  2HQN A;  2L9S A;  2CGP A;  1BOB A;  3I4P A;  2R5Z B;  4RDU A;  5J1U A;  1Z7L A;  2PEX A;  2RNG A;  4XOP A;  2Z2S B;  4ZYH A;  1VZ0 A;  1T39 A;  3DTK A;  3OYL A;  2VE9 A;  3HHG A;  3CP8 A;  1ACI A;  3O8G A;  2ZJ2 A;  1VQ8 I;  3SZP A;  4KMF A;  3HGG A;  4F93 B;  1WRJ A;  5JR3 A;  3OIO A;  1ZAR A;  1UCR A;  1HQC A;  2P7V B;  2D1V A;  5HLH A;  4AWX B;  3FXJ A;  1ZTR A;  2AQE A;  4M3D A;  4NDL A;  2IS2 A;  2F5D A;  3TO7 A;  3CCM I;  4PSW A;  1RRJ A;  2R7F A;  1AA7 A;  2IGO A;  2X85 A;  5E3O A;  4BY1 J;  3AG3 H;  1ONV A;  4XRS A;  3MAJ A;  1JGG A;  3IH2 A;  4UY8 I;  2HVQ A;  1FNN A;  3KP4 A;  4D5C A;  2MW8 A;  4IHV A;  2XKO A;  1XX5 A;  4BH9 A;  5E18 F;  3CDH A;  1NK3 P;  4A6E A;  2VC1 A;  2FD5 A;  1V55 H;  4DNC A;  1ZLJ A;  9ANT A;  2M7B A;  2HTS A;  2YUS A;  4WXC A;  4PDK A;  3ZQ7 A;  5DV5 A;  4Y17 A;  1KU2 A;  3I54 A;  5EYR A;  1K7A A;  2BHY A;  2KQR A;  2QBY B;  2FXA A;  3R6S A;  3MCZ A;  2WV0 A;  3O3K A;  2V7F A;  2KL4 A;  1O57 A;  2F4M B;  1P4W A;  4LOC A;  1Z21 A;  3W2A A;  2ISY A;  2HR3 A;  1HKS A;  4KIC A;  4EGY A;  1DPU A;  4NNJ A;  1F36 A;  2IGN A;  1QU3 A;  2CUZ A;  1YIO A;  4EJU A;  3BTC A;  4A93 J;  3V7C A;  1EH6 A;  1E2X A;  4RM2 A;  2E7W A;  4XID A;  2K4B A;  2Z1D A;  1QBJ A;  3LNQ A;  4L9N A;  3HJE A;  3CDL A;  4Y13 A;  4HNT A;  3GXO A;  2L7K A;  5M3M J;  5HOD A;  1V5F A;  1VQ5 I;  2BY1 A;  4ETS A;  2LMD A;  4D7M A;  2QQ9 A;  3U21 A;  2WY8 Q;  3CUQ A;  2YX7 A;  2DTR A;  2ID6 A;  4BQQ A;  4EQQ A;  4CCO A;  4EGZ A;  1K4S A;  3DLA A;  1MJB A;  1GV2 A;  2F48 A;  2VQH A;  1SVO A;  5C3E J;  1MBF A;  5A2Q K;  1BA5 A;  4HX4 A;  1FBS A;  3G4S I;  1ZGW A;  4CHU A;  4CZZ A;  1WI9 A;  2M30 A;  3PL8 A;  5CVV A;  2GQQ A;  3BOQ A;  4JBA A;  5TGT A;  1W5T A;  3DFG A;  4G12 A;  4YFK F;  3F22 A;  1O3Q A;  3RIR A;  2ZME B;  1B72 B;  1A36 A;  4Z6Y A;  3SFI A;  2WA0 A;  4N9H A;  1IJW C;  2XRN A;  4D9J A;  1H8A C;  3L2W A;  3HZJ A;  4JOM A;  5E20 A;  2XHK A;  4Z2Y A;  2WBM A;  1OR7 C;  3HOY J;  1R9T J;  2DMQ A;  1FOX A;  4WX9 A;  2OJE D;  2LC2 A;  3S17 J;  2CSO A;  1S7A A;  3EPZ A;  3ROU A;  1XMK A;  1IN7 A;  2G0E A;  5LLQ A;  3OS2 A;  2HPI A;  3JRH A;  2ZSI B;  3C18 A;  2FMY A;  3W2W A;  2M87 A;  4LIU A;  1A04 A;  4XON A;  1G8X A;  2P5V A;  5FKM A;  3JRB A;  3QPS A;  1SFK A;  1V54 H;  2W24 A;  4UVB A;  4KIG A;  3L00 A;  4MNU A;  1E3H A;  4F3Q A;  3IKV A;  2K27 A;  4BHB A;  1SEU A;  1IRG A;  1HXD A;  2VOP A;  3A0B C;  3M3Y J;  4LB5 A;  3QQA A;  2W25 A;  2CV0 A;  4ZYD A;  4HRI A;  4RAZ A;  3P5J A;  4XLP F;  3N97 A;  4FE4 A;  4ANJ A;  3TOA A;  5D4R A;  1D1A A;  2EZH A;  4BNC A;  5ILS A;  3H92 A;  1JE8 A;  1W1W E;  4NBQ A;  3AAF A;  2D2W A;  1IGN A;  2DOD A;  3FXO A;  3DPU A;  4O6J A;  3SHF A;  3IH4 A;  3CO6 C;  1IN4 A;  3BJA A;  2IS4 A;  1B6A A;  3HRU A;  1D8K A;  4CH7 A;  1T2K A;  1K6Y A;  1D5Y A;  2J5P A;  2BW3 A;  1W0U A;  4NC6 A;  2HXO A;  2GLO A;  3HGY A;  4HPQ A;  2JPB A;  3AG4 H;  4CCL A;  2V9V A;  1T33 A;  1YOV B;  5ICE A;  5M5Y J;  1JHH A;  3S16 J;  4P5O A;  5K1Y A;  2PQ8 A;  1B9M A;  2M1B A;  3ZN0 A;  2R7R A;  3CJN A;  1FMW A;  3WE2 A;  2JK3 A;  3ZQQ A;  3TGN A;  2P81 A;  3E5X A;  3WTW C;  4MEY F;  2VLA A;  4I99 C;  1EH8 A;  3ABM H;  3ABL H;  3RQI A;  3U9G A;  4HF1 A;  1KYW A;  2LLK A;  1XGS A;  4L5I A;  4KMU X;  2EA2 A;  3IAS 2;  2HEO A;  1U9O A;  3ZQI A;  5FLX Z;  1ZQ3 P;  3NWS A;  5LHG A;  4LK0 F;  3TDZ C;  2H1L A;  2EFN A;  2NS8 A;  1GVJ A;  2XAQ A;  2VBX A;  2K9Q A;  1N75 A;  3TED A;  1UMQ A;  2V9K A;  1U6G A;  2P5K A;  3IUO A;  1QZE A;  1MW7 A;  4MLO A;  2QM3 A;  1Q1V A;  1WH5 A;  5D6F A;  3COA C;  2LY2 A;  3SDB A;  4RGR A;  2PX9 A;  4L0Y B;  1ZK8 A;  1ZKG A;  3G1L A;  2L0K A;  3PO2 J;  2FF4 A;  4GXO A;  4HAM A;  4EJV A;  1VND A;  1YYV A;  1ZGA A;  3IHU A;  3ELK A;  2O8K A;  3A1Y A;  1VFC A;  2MFZ A;  5FLX K;  2CRG A;  1YE9 A;  3ZQF A;  4UUS A;  3HTS B;  2Y31 A;  3EUK L;  1A6I A;  4A69 C;  3WTT C;  3ZR8 X;  3L2V A;  2NOG A;  2ECC A;  2TRT A;  3OYI A;  5GTH C;  1K6O A;  2CW7 A;  1MD0 A;  3I0T A;  3TP0 A;  3HDD A;  3LFK A;  1U8R A;  1SFU A;  1K61 A;  2PMH A;  5BQT A;  2BE5 F;  4ZDL A;  4NQW A;  3ULQ B;  3ONQ A;  3OSG A;  1I5Z A;  4TV7 A;  3L2R A;  4EM0 B;  2QSH X;  3PJR A;  1BOA A;  1X4O A;  2IT0 A;  2P5L C;  2DQR A;  3FF5 A;  4F92 B;  4IQJ A;  3C7J A;  5K5O A;  1J2X A;  1WSU A;  2HFH A;  1H9G A;  1FJL A;  1MNE A;  2V79 A;  5LEK A;  2DJI A;  3KEO A;  4P1W A;  1IN6 A;  2EIM H;  4ESB A;  3CF5 F;  1QHH D;  4RLQ A;  3LSR A;  1TBX A;  1KYZ A;  1SFE A;  2G9W A;  3S32 A;  2Z3Y A;  2CQN A;  5LRR A;  2RV8 A;  5FLM J;  5BOX A;  1U5T C;  1GUU A;  3KLO A;  4XLN F;  1MKM A;  1LDJ A;  1IUY A;  3E6M A;  4XOR A;  2BYV E;  4HG2 A;  4YEJ A;  1E0E A;  4A3J J;  3J80 K;  2EPF A;  4P9F A;  5H2F C;  4WCG A;  4XBF A;  2LK2 A;  3L9F A;  4EM1 A;  2M8E A;  4AUX A;  3M8J A;  3FK6 A;  3R61 A;  5DTD A;  2LNB A;  3HSF A;  2R7V A;  2DYS H;  1FZP B;  4LD5 A;  1I3A A;  3PNY A;  3B73 A;  5FLV A;  4FQG A;  1W36 D;  2HU9 A;  4KIS A;  3CP2 A;  1P6R A;  1D3Y A;  1XMX A;  5FO5 A;  3HUG B;  1MDM A;  1G3W A;  4XL9 A;  4M3G A;  3IWZ A;  5DS9 A;  3LAP A;  2DT5 A;  1LNW A;  1V4R A;  1GXP A;  1IG7 A;  2M5W A;  1MMA A;  2JTV A;  1P7I A;  3HOZ J;  4HSR A;  1GXQ A;  5EGO A;  3BY6 A;  3C1D A;  3PSI A;  4B09 A;  3CUO A;  2ZC2 A;  4PGH A;  4J00 A;  1R49 A;  2VQC A;  2EFW A;  2R92 J;  1HDP A;  1BC8 C;  2RQQ A;  3M9A A;  3V4G A;  3BG9 A;  3Q5F A;  1OIS A;  3FBI B;  2LYC A;  2VJ5 A;  5LGT A;  3ISP A;  2XF6 A;  1MMN A;  2LDU A;  3G73 A;  3WU1 B;  4RMN A;  3RCO A;  2XF5 A;  5DD8 A;  1SAN A;  1VF9 A;  2VB6 A;  4XRM A;  1NK2 P;  3KE2 A;  2XPW A;  1YX3 A;  4UB6 C;  2EV0 A;  4WWC A;  3S15 J;  1UHW A;  1Y8Q B;  4PSX A;  2BV6 A;  4KUM A;  3O2P E;  1OCT C;  3LWF A;  2KMU A;  2IBD A;  4I7H A;  1JHF A;  1OCZ H;  4HST A;  2EH3 A;  1MBG A;  4EJW A;  1HBX G;  5L3E A;  1X3Z B;  3ZMT A;  4EJO A;  4BJT A;  4IQ4 A;  2W00 A;  4A6D A;  1XCV A;  1IN5 A;  1G3T A;  3HKZ A;  2CMP A;  3ZMD A;  2AXT C;  4KIB A;  2VPL A;  3H3Z A;  1Y1V J;  5E3N A;  5C44 J;  3IWF A;  2NXN B;  4I0A A;  3BG3 A;  5HNH A;  3A01 B;  2XB0 X;  4C3H J;  1ETY A;  4FX4 A;  1OQY A;  2LOO A;  3FMQ A;  4FT8 A;  5FRM A;  3LSI A;  2PN6 A;  2YSR A;  3WTX C;  2X51 A;  2XSJ C;  2X4H A;  2VOD A;  2CQK A;  2RNJ A;  2B9S A;  3MKL A;  3PM1 A;  2QBY A;  1YJN I;  2DMP A;  4HX8 A;  3BG6 A;  5HVQ C;  5IP7 J;  3VOD A;  2HGC A;  4ZYA A;  2C6Y A;  3M4O J;  2RRE A;  5E8G A;  1HLV A;  1DP7 P;  2JA5 J;  3FMR A;  4RAF A;  2NVU B;  4YFX F;  2VKE A;  2DPU A;  4HQM A;  1RKT A;  3S93 A;  3SZG A;  1IF1 A;  4U7B A;  4DYQ A;  2BW3 B;  3CTA A;  1OCR H;  4I0B A;  1PDN C;  2DK5 A;  2VKD A;  5JLX A;  3GTL J;  2K9L A;  3OV8 A;  3BG5 A;  1ULY A;  2E2J J;  2P8T A;  2DQL A;  3WGI A;  3WTZ A;  2WAD A;  3DF8 A;  3L7W A;  4CYC A;  1SAX A;  2HI3 A;  2XKP A;  3KCC A;  2JWT A;  3TBI A;  2STT A;  2DA7 A;  2DYR H;  4OAZ A;  1Y39 A;  2A68 F;  5FGM A;  3OYK A;  3AL0 C;  2O5R A;  5E3L A;  2V1X A;  3D5S C;  2IVM A;  4XLF A;  3KX2 A;  5D5X B;  2PBI A;  1FWZ A;  2R7Q A;  3CC7 I;  1KON A;  2NVQ J;  2JSC A;  2XRO A;  1WZ2 A;  1OJL A;  1VQL I;  1UJ8 A;  2HDD A;  3VB2 A;  3F8C A;  1RET A;  2VE8 A;  4G6D A;  5AIP A;  3JAM Z;  1ZRF A;  2F5F A;  2I8D A;  2MAB A;  1LFB A;  3EDP A;  1B8I A;  2A6T A;  2X6Y A;  3ABT A;  5ILU A;  2OBP A;  4N4N B;  3PNT A;  2D5V A;  2R7U A;  2QKL B;  1EH7 A;  5ED4 A;  2FJ1 A;  1UB9 A;  1JJ8 C;  4A3K J;  5J4Y A;  3OYD A;  3K4L A;  2ELJ A;  2DFH A;  4A2U A;  4BE0 A;  1UFM A;  5E1X A;  1I27 A;  3I5U A;  3G3Z A;  4PUS A;  1FYM A;  1RPW A;  2LR8 A;  1BIA A;  2ZXI A;  1TQP A;  4GYG A;  3IC7 A;  3EET A;  3R4K A;  4LLL A;  4UUS B;  3JSO A;  3TOB A;  1RIO H;  2NRA C;  2CQQ A;  2E1M B;  4GCV A;  3OR2 C;  5ICG A;  2M9H A;  5CQE A;  1JTX A;  2E5Z A;  4M6V A;  3QAH A;  1YI2 I;  1EJ9 A;  2FRH A;  5E3M A;  2MH2 A;  3CCL I;  2BHZ A;  4YFN F;  3MQ0 A;  4BHC A;  1D0X A;  2Y9Z A;  1LKX A;  4NQW B;  2A69 F;  1WJF A;  3DP7 A;  1FY7 A;  1O4X A;  1OLT A;  2Y2Z A;  4XOT A;  2KIU A;  2LH9 A;  1TT5 B;  1D0Y A;  3GF2 A;  1YHQ I;  4W97 A;  2YU3 A;  1O3T A;  1ERD A;  1P2F A;  2F4I A;  3CCR I;  1R4M B;  1K78 B;  3RI4 A;  2HOA A;  3I55 I;  1SVM A;  2IS1 A;  1SMY F;  4DZJ A;  4Q48 A;  4EJT A;  3OYJ A;  5FRO A;  3V7S A;  4OIQ F;  4G8X A;  2HWV A;  5GAG J;  5IYC J;  4HYE A;  1XSD A;  4BU2 A;  4ENM A;  2H6C A;  1IUF A;  1FOW A;  2M2E A;  5F1R A;  2L3D A;  3M07 A;  1SD4 A;  1ETW A;  1G3S A;  1P4A A;  3I56 I;  5J4V A;  4BE2 A;  1LJ9 A;  1U8B A;  1CF7 A;  1JGS A;  5L3F A;  2ZB9 A;  2O03 A;  1TT0 A;  2VC0 A;  2MYS A;  2OCC H;  4HV5 A;  2XV4 S;  3I4N J;  1XB4 A;  3DU5 A;  1WJ5 A;  2QKM B;  2VJI A;  4LB6 B;  5IT9 K;  4C9Y A;  2A5W A;  1HOM A;  3DWL E;  3MWM A;  1X4P A;  2VQL A;  3TW7 A;  2OV7 A;  4B3X A;  5IPA A;  1OCP A;  2XAG A;  2RVC A;  3BPV A;  1R23 A;  1FMV A;  4B43 A;  5LFA A;  1XC5 A;  2BGC A;  4HNV A;  3ZQG A;  1OR7 A;  5J8C A;  1MDM B;  4S05 A;  2X1E A;  5H6R A;  1MH3 A;  2A05 A;  4BBR J;  3E0J B;  2HKO A;  3MVP A;  2E19 A;  2R7D A;  3QYF A;  1PUF B;  1VQ9 I;  2V6C A;  3P9K A;  1VQ6 I;  4RGS A;  2R93 J;  4IO9 F;  1MJA A;  4UVC A;  4EEF G;  2LKP A;  5TJJ A;  4DBR A;  5EGO B;  2CFX A;  2IA1 A;  2A6H F;  1WH7 A;  5IYB J;  3OS0 A;  1SFO J;  1XTA A;  2G7H A;  4PZJ A;  1W0T A;  3BP8 A;  2OAZ A;  1OMI A;  2VXD A;  4YII A;  2DA2 A;  3K7A J;  1QVT A;  1TP4 A;  3F8N A;  1B1B A;  1ZHF A;  1WPK A;  3ERM A;  1BI3 A;  1I50 J;  4A3F J;  2KDZ A;  5JLW A;  3MMY B;  2BXY A;  4EMS A;  3J7A Y;  1T08 B;  4LGW A;  4OIP F;  1JUP A;  2DMN A;  2MBF A;  1YS6 A;  3EYY A;  1FP1 D;  3F72 A;  3HBL A;  1FEX A;  3BCA A;  3H5N A;  4A3L J;  3BC8 A;  3FXR A;  5E1W A;  4I01 A;  1OKR A;  2UWM A;  4L9T A;  4OAY A;  4BHP A;  2VI6 A;  2GWR A;  4CXF A;  4ESJ A;  2DT7 B;  1MBE A;  2I5U A;  2X6W A;  4IRG A;  2CH0 A;  2ZXH A;  1FOK A;  2KDO A;  2IRF G;  2PFB A;  1MBJ A;  2CU7 A;  3E5U A;  1QNT A;  1R5H A;  1HW5 A;  4AIJ A;  1U2W A;  2BY2 A;  3F6V A;  3EUH C;  5E1Z B;  4F91 B;  1HDD C;  4Y52 J;  4ZTJ A;  1V5E A;  4RAY A;  2LRE A;  3K4K A;  5TIS C;  1TWC J;  2H1K A;  4PK4 A;  1TC3 C;  1TTY A;  2X48 A;  2AO9 A;  5FB2 A;  3RDI A;  5LD2 C;  1J5Y A;  3CJR B;  4QWQ A;  2QEX I;  2HQ5 A;  2VBY A;  2LKS A;  1BL0 A;  4HF0 A;  1DQU A;  1WVR A;  2ELK A;  4BQN A;  1Z3X A;  2QSG X;  3NAU A;  4N0B A;  3I53 A;  2DCE A;  3GZ6 A;  2LTP A;  1S3J A;  3TDU C;  1O7F A;  1S7O A;  4Y33 A;  3W6V A;  3EYI A;  2HYG D;  3K4J A;  2A6E F;  4R1H A;  1LQ1 A;  2B63 J;  4X6A J;  3BR5 A;  3M1C A;  5JI6 A;  1Y8R B;  1ETV A;  2XAU A;  5M3F J;  2DDB A;  3KLN A;  5D5W B;  2ETH A;  3KIO A;  3FBN B;  1FPQ A;  5FKN A;  3C2G A;  1YX5 A;  2BEO A;  1XDU A;  3D0S A;  4XLC A;  4CYC B;  5DCF A;  1JKP C;  1NHA A;  2OA4 A;  2DA4 A;  5BS6 A;  4BXF A;  1MMS A;  3LSG A;  4O5V A;  1APL C;  2E2H J;  3DV8 A;  4FHT A;  1XD7 A;  3S14 J;  3K2Z A;  2KKO A;  2XIG A;  1L0O C;  4WF2 A;  3RKX A;  5KVR A;  1ENH A;  1R22 A;  3HUG A;  5KK1 A;  1P4X A;  2VKH A;  3Q0W A;  2EJR A;  4UXN A;  2M7A A;  2OQR A;  1JKQ C;  3DEE A;  2AXL A;  3VDX A;  3ZRG A;  1X2N A;  2QSF X;  3SJM A;  2UXN A;  3K1N A;  1B8I B;  1T0F C;  2LY1 A;  4UUV A;  2YS9 A;  2YPR A;  1R5G A;  1YW8 A;  5HDN A;  1TQM A;  4M72 A;  5FFZ A;  5L3C A;  3E6C C;  1MJ9 A;  1Z0X A;  4UB8 C;  1I1S A;  2JZY A;  1GVD A;  1WCM J;  1FYL A;  2PJR A;  2CWE A;  3U1K A;  3SDG A;  4XSZ F;  3G71 I;  1TWF J;  2PMZ N;  2DOF A;  3L09 A;  5DYM A;  3IRQ A;  2GOX B;  3RKY A;  1SD5 A;  2Z99 A;  1GV5 A;  3BR1 A;  2V6E A;  1PUE E;  4A0X A;  3J7Y J;  5EDN A;  3MFK A;  3QOP A;  4KYW A;  3BG7 A;  1X1C A;  3H1C A;  2R7W A;  4HDV A;  2JA6 J;  4ESF A;  1U3E M;  1R71 A;  2MG4 A;  3WG7 H;  1L3L A;  1TNT A;  2R3S A;  4KJZ A;  3M8F A;  4E7Z A;  5DUI A;  4R8H A;  3JSP A;  4HW0 A;  2ZJR F;  1O3R A;  1LE8 B;  5ICF A;  4DOZ A;  5J1Y A;  4IOC F;  3GTG J;  3IKT A;  1N77 A;  3A01 A;  1OCO H;  4M3F A;  4B3A A;  2GM4 A;  1OYW A;  3Q9S A;  5DM7 F;  3RQ4 A;  2KLO A;  1S6L A;  4U0Y A;  2AHQ A;  2VUM J;  4DZP A;  4ZZL A;  2H27 A;  1LEA A;  1VQN I;  4G7H F;  2COM A;  2OZU A;  3GCM A;  3VYU B;  1NG6 A;  2GXG A;  2P4W A;  3CJT B;  4V19 K;  2VJ4 A;  4RB3 C;  2LRD A;  2WAF A;  1BW6 A;  4I98 B;  3PO3 J;  1IW7 F;  3K4N A;  2CV2 A;  2H8R A;  1Z91 A;  2X6X A;  3E3V A;  3UR3 C;  3B02 A;  2P7C B;  4M74 A;  5D4S A;  1Y1W J;  1KQ0 A;  4E7J A;  1QPM A;  2EZL A;  2XGD A;  3ZMS A;  3CCQ I;  1G59 A;  4LFU A;  2F2E A;  3FHZ A;  4C2M J;  4RB0 A;  3KYL A;  4CCJ A;  3WTS C;  3BT9 A;  1MNM C;  2QLZ A;  3HB9 A;  1CF7 B;  1J59 A;  3SQN A;  1YJ9 I;  1HST A;  1P7J A;  4EV0 A;  1F43 A;  3ASO H;  5F1J A;  3DKX A;  1BI1 A;  1RKW A;  5D5V B;  2XAH A;  3GLL A;  1RNL A;  4X1E A;  5IP6 A;  3JR9 A;  2LKX A;  1S72 I;  4NUB A;  5B1B H;  4JX5 A;  5M5X J;  1BI0 A;  1MIJ A;  4HBL A;  3RPQ A;  3RZD J;  4Y3O A;  2HDC A;  3BRO A;  2EQR A;  2GXA A;  3ABK H;  4A3G J;  3F23 A;  2J5O A;  1IO2 A;  1J0R A;  1ETQ A;  2MGQ A;  2N8G A;  4DBQ A;  2KFD A;  3LA3 A;  1W7P D;  2Y30 A;  4OWR B;  5IOZ A;  3LST A;  5LGN A;  1TWG J;  4RBO A;  4QTR A;  3T1B A;  5ILV A;  2K4J A;  2QGU A;  2XF7 A;  5GAD J;  4MQV A;  3BR0 A;  1PP7 U;  1Q1H A;  1TW3 A;  2WAQ N;  4DQ2 A;  2PG4 A;  1OFC X;  2DDA A;  1JKR C;  2FBI A;  4XNF A;  4A12 A;  3SZT A;  4F52 A;  4JX6 A;  2HOT A;  2NS7 A;  1X19 A;  3ASN H;  4FX0 A;  4L9V A;  2K85 A;  2FUG 2;  1G4D A;  1ZG5 A;  2D1H A;  2V26 A;  5H6Q A;  5EZG A;  4PJN A;  1FBQ A;  2QYO A;  2MD5 A;  2GIZ A;  1V5G A;  2DU9 A;  3CME I;  1C0W A;  3L1P A;  5FJ8 J;  3BLY A;  1IDY A;  2EV6 A;  5DCM B;  1RC9 A;  2Q1Z B;  4RLF A;  1AU7 A;  3DBH B;  1UEL B;  1TW2 A;  1MH4 A;  4M3B A;  1ZAO A;  3RKW A;  3S1R J;  5ERI A;  3ZXS A;  2W85 A;  4A3I J;  3LA2 A;  2L5Q A;  3J7Z I;  2O6G E;  2M45 A;  1ETK A;  1A5J A;  1KGS A;  5GPC A;  3HRT A;  1R36 A;  2EIN H;  2XGX A;  3A02 A;  3CUQ C;  3GME A;  2A5Y B;  3K1M A;  5EEG A;  5J40 A;  1D1B A;  1JI8 A;  1IN8 A;  5FFX A;  5HNF A;  3M7G A;  3WTV C;  1DGW Y;  5EJC A;  5B66 C;  2KRF A;  3ESW B;  3P7N A;  2Q2E A;  2GA2 A;  2ZFW A;  4FIS A;  4M9S A;  2H94 A;  1E17 A;  3MZH A;  1K78 A;  4IF4 A;  2IA0 A;  3O8H A;  4N9I A;  1BIB A;  1XGM A;  5IY5 H;  2JRT A;  1JUS A;  2KZV A;  3G2B A;  3KYD B;  3G1M A;  4B4C A;  2VJJ A;  2DA5 A;  4MFD A;  4CIC A;  2E60 A;  4RGX A;  2IEK A;  1HA8 A;  3BTL A;  3CLQ A;  1T38 A;  3G6E I;  4HV6 A;  5H20 A;  4BDZ A;  4KT5 C;  2IPQ X;  2K9M A;  2OCE A;  3FIW A;  4II3 A;  2UZK A;  4J01 A;  4CO8 A;  3VYR B;  4BBS J;  1IXR C;  5F0F A;  4A3E J;  3ERE D;  2DOA A;  3BTJ A;  2OZ6 A;  3I58 A;  3HOX J;  1IRZ A;  3QYB A;  2EFP A;  3MZ8 A;  2W84 A;  1B4A A;  4MHG A;  2XAJ A;  4E7S A;  1ZG1 A;  3IRR A;  3HOT A;  2LF7 A;  3GO5 A;  5HS8 A;  4B44 A;  3S2D J;  2R7X A;  2E7X A;  3GFM A;  2QA4 I;  1UG0 A;  3W6J B;  1R6R A;  1TZL A;  4IPA A;  2L7M P;  3BQZ A;  2MA3 A;  4BQO A;  1UHM A;  1MBK A;  2QVO A;  1PUF A;  4L18 B;  5JHU A;  2LF8 A;  3E6D A;  2YX4 A;  2ZXJ A;  4E7L A;  2GXB A;  3ZOB A;  4RB1 A;  2WAQ A;  3ZMU A;  3HXL A;  3GEZ A;  1FTZ A;  2EFO A;  4B47 A;  6PAX A;  3ABU A;  1MSF C;  1P92 A;  3CMA I;  5GTI C;  3KP5 A;  4IJA A;  3GTO J;  2VOO A;  1X1D A;  2V9P A;  4AU7 A;  3ZMZ A;  5IT3 A;  2EIK H;  3UKG A;  4XKW A;  3KET A;  2XGC A;  3K4C A;  3P9C A;  4WXD A;  1R58 A;  1FTT A;  2QUF A;  3VEP A;  5HLG A;  2PMU A;  1XSV A;  2KHM A;  2HOE A;  1W5S A;  2CUF A;  3KP6 A;  1RUN A;  1QRY A;  3K9T A;  3KP2 A;  4BGD A;  2PJR B;  2IGM A;  1HF0 A;  1KQ8 A;  4UUT A;  2XVC A;  5K7H A;  1F1Z A;  2JUC A;  1YIJ I;  2KZG A;  1BC7 C;  4FE7 A;  3BR6 A;  1ORK A;  1VQK I;  3F8B A;  4LMY A;  3LSM A;  3HOS A;  1R1T A;  3HRS A;  4U7D A;  1S8N A;  1B9N A;  4LIV A;  1OYI A;  4ZC3 A;  4C3J J;  4YG2 F;  4XN3 A;  4MGR A;  4P55 A;  4XKV A;  4CSW A;  1GT0 C;  1U5T B;  2OU2 A;  4NC7 A;  3UNG C;  3PQJ A;  2KRH A;  2WAE A;  4ZDO A;  3N4M A;  3CCU I;  2HPM A;  1R7J A;  3H9J A;  3FXM A;  3HOV J;  1S29 A;  2XDV A;  5CVU A;  2ZJP F;  5KCM A;  4MEX F;  5D8L B;  3WG9 A;  4WXH A;  2DO7 A;  2DK8 A;  2KIM A;  4AC0 A;  3DCF A;  4O3M A;  3GFJ A;  3TO6 A;  2EV5 A;  3QU3 A;  3C3W A;  4NB5 A;  2EIJ H;  4GO1 A;  2B7E A;  2XB5 A;  1LFP A;  2V1N A;  2K9S A;  2OTL I;  2IW5 A;  2NOJ B;  1PJR A;  1QZY A;  4Q4Z F;  4M6Y A;  3VYS B;  2CJJ A;  5E79 C;  3A2K A;  1DU6 A;  2LG4 A;  2IXS A;  5IYD J;  1QZZ A;  5L3B A;  4A3M J;  1ODD A;  1QHG A;  2DA1 A;  3HPH A;  1BBY A;  1HKT A;  3MEX A;  1PYV A;  2G7U A;  4EAT A;  2VT3 A;  4YIF A;  2HNH A;  2NNY A;  1SD6 A;  3BWG A;  2I10 A;  1VTN C;  4XIC A;  2KP6 A;  3JCU C;  3PIP F;  2R5Y A;  1WKM A;  5FKL A;  4UVA A;  4C30 A;  4GYI A;  3HL2 A;  5EF6 A;  3HPG A;  1BJZ A;  3HOW J;  2VXZ A;  3RZO J;  2CUJ A;  2FX0 A;  1BR1 A;  3MKY B;  5F27 A;  3K6G A;  2FOW A;  4ZH4 F;  3VOE A;  1E3O C;  2DMT A;  4I6Z A;  4XMY A;  4CYD A;  1ON2 A;  4IVN A;  2E1O A;  4U87 A;  2CUE A;  1BM9 A;  4AM3 A;  1YQA A;  5DM6 F;  5KNL A;  3S3N A;  1YTY A;  1LEB A;  3Q3S A;  3DU6 A;  4X0G A;  3M1E A;  1AWC A;  3CCE I;  1S9H A;  3DPT A;  3CC4 I;  5LHH A;  3SFZ A;  4BAC A;  4V2G A;  3MKZ A;  1IZ1 A;  3HEF A;  2FSW A;  4AVZ A;  4UHT A;  3DTE A;  2OPT A;  3AG1 H;  3EUH A;  3GFL A;  2EA4 A;  1YIT I;  2RC4 A;  2ICW G;  3B6C A;  3LAJ A;  1UZC A;  3MZY A;  1Y0U A;  1IC8 A;  2ACJ A;  3JAM K;  4D1Q A;  1Z77 A;  5K7Z A;  1RUO A;  1Z6T A;  2BBY A;  2O3F A;  4HEA 2;  4C2U A;  3LOC A;  2Q0O A;  3LSP A;  1LE8 A;  3BR2 A;  3FXL A;  3VWB A;  4K2E A;  1J75 A;  3S2W A;  5J1R A;  3V8L A;  2DXI A;  3DPL C;  3T8T A;  3JRC A;  1ZRD A;  5CKT A;  4BJ5 C;  3I64 A;  3DBL B;  4PJL A;  3FX3 A;  4JK1 X;  2B0L A;  1WJB A;  2O9L A;  4IHY A;  4ZTF A;  2Q2E B;  3S1Q J;  1D1C A;  4YRV A;  5TRD A;  3JRA A;  2XRL A;  3AL0 B;  3OYC A;  2RQP A;  5B3S H;  3GTQ J;  1HW1 A;  2Y69 H;  1W7P B;  1FBU A;  2M34 A;  3LSK A;  5HDK A;  1ZRC A;  1Z6R A;  2DI3 A;  1HKQ A;  2CW0 F;  2O8X A;  4OU0 A;  4YIR X;  2DFF A;  4M71 A;  3NAR A;  2Z33 A;  3SEZ A;  3LA7 A;  1IRX A;  4YEL A;  5F64 A;  1AOY A;  5LGU A;  5BPD A;  2DLL A;  2EIL H;  1T0F A;  4AYB N;  4HX7 A;  3TQN A;  2JQ7 A;  2V1U A;  3D1N I;  3JRD A;  4LG0 B;  1JXS A;  4KA4 A;  3RKQ A;  2XSD C;  3NRV A;  3OYE A;  1WJE A;  2E34 A;  2GIV A;  4E70 A;  5LEJ A;  1KZH A;  4HOB A;  5CQG A;  1YW9 A;  3FWE A;  2DBB A;  1A35 A;  2QF7 A;  1F5T A;  2XPU A;  1YFH A;  3QOE A;  2CG4 A;  2O7O A;  2CV1 A;  3H35 A;  2HDW A;  4RB2 C;  3LQQ A;  2ZFU A;  3PIO F;  2EK5 A;  1QPI A;  4IKF A;  1R5I D;  3LQR A;  3V8K A;  1TWA J;  3KPH A;  2QCO A;  4BYY A;  3JRF A;  4QIW N;  2OUM A;  1HSJ A;  3I71 A;  1FIP A;  1QVU A;  4AD9 A;  2ESN A;  5GAH J;  4IRH A;  2E71 A;  1VQP I;  5FD6 A;  1MGT A;  3BJO A;  1WHU A;  5EEH A;  4R79 A;  5CPR B;  1X1P A;  2KIS A;  3R0J A;  2CQX A;  3V42 A;  4OMZ A;  3K70 C;  1H89 C;  2E2I J;  3P9I A;  2PJP A;  1YRN A;  2BOL A;  2FEZ A;  3K69 A;  3ZN1 A;  2K7L A;  2L02 A;  2ZXW H;  4XLE A;  5EG0 B;  4LLG F;  3F9K A;  2JRM A;  3AFH A;  5HLT A;  4GFB A;  5DCM A;  4XLH A;  4KT6 A;  5FD5 A;  4BDY A;  2M8G X;  1Z3Y A;  3QP6 A;  4BKX A;  2GOM A;  2M4G A;  4EM2 A;  3OYA A;  1Y0N A;  2L7F P;  4CA0 A;  4Q5S F;  4NHJ A;  2ELH A;  1WJD A;  4QSH A;  2HZT A;  1DPR A;  3IP4 B;  4B1R A;  3OMY A;  4P9U A;  2M0C A;  1Y56 A;  2RGV A;  5IP9 J;  3CLO A;  4F55 A;  4L5J A;  3AG2 H;  3FM3 A;  4M6X A;  3OYB A;  4QPQ A;  3QRF F;  3U2R A;  2HYJ A;  4MTE A;  2XAS A;  1Y6I A;  4FET A;  1ZRE A;  1X1B A;  4IHS A;  1XCB A;  3QP5 A;  2R7T A;  4N4O B;  3IAM 2;  5J6X A;  4L5E A;  3BZC A;  1M1E B;  4M73 A;  2ZME C;  5JVT A;  2HVR A;  2EWN A;  4ZYE A;  1VQ7 I;  3FXK A;  1KU3 A;  3FIS A;  1ZEL A;  1E3P A;  5AIQ A;  2BVL A;  3OY9 A;  3Q0U A;  2JUG A;  3CCJ I;  1IV6 A;  2VT2 A;  3HG9 A;  4MFE A;  1R1V A;  2FOK A;  3T8R A;  3OR1 C;  4AYB A;  2HYF A;  4IOA F;  2MC3 A;  4ABZ A;  1YJW I;  5K5R A;  5CVI A;  3FXU A;  3VSL A;  2DFI A;  1MMD A;  3F3X A;  2W82 A;  4A5M A;  3F8M A;  4ZJZ A;  1REP C;  2QQA A;  1Z7U A;  5E8I A;  1FT9 A;  1LVK A;  3JRG A;  1A31 A;  4PFP A;  1I1G A;  4BXX J;  4I2O A;  4PFO A;  1STZ A;  2R5Y B;  4PGG A;  2Y75 A;  2ME0 A;  1EA3 A;  1BI2 A;  2AQF A;  3E7L A;  5A2Q Z;  1LB2 A;  4BE1 A;  4V2F A;  1O3S A;  2RN7 A;  3GFI A;  1UHS A;  4G6T B;  2P0W A;  1UG2 A;  2A07 F;  3OSF A;  2FE3 A;  2NYX A;  4ZZD A;  2Z9O A;  3CQZ J;  3REO A;  1ETO A;  3DLL F;  2DW4 A;  3ZQC A;  2QQ8 A;  1R4N B;  4UNO A;  2MLG A;  1XPX A;  5F0H A;  3KYC B;  4I02 A;  4LG3 A;  3AKZ A;  1NTC A;  3E97 A;  3J7A O;  2E36 A;  4ENJ A;  1N78 A;  3HOU J;  4RM3 A;  2O61 A;  2LBF A;  3H9Q A;  2Y0S N;  2GA1 A;  3LSJ A;  3JTH A;  2M4K A;  2R0Q C;  5BPI A;  4XSX F;  1QGP A;  3F0C A;  4II2 A;  2L54 A;  2IAI A;  4G7O F;  1BJA A;  1F9N A;  1PVE A;  2IS6 A;  2R7O A;  1X3U A;  3MD2 A;  5DDG A;  2Q8K A;  3GZN B;  4LLN A;  3GW2 A;  3KZI C;  1O7L A;  3KP7 A;  1ZH5 A;  3ECO A;  1XSX A;  1DP3 A;  3H9G A;  1G3Y A;  1U5T A;  1FOY A;  1S7E A;  1RZ4 A;  2OC6 A;  4H4K C;  1YLF A;  2PLY A;  2EBI A;  3E1S A;  3OYN A;  4BEH B;  4W1U A;  2F6C A;  2WV1 A;  3A03 A;  5D8K B;  2V4J C;  1UST A;  3WHB A;  3BR3 A;  3GTJ J;  2E1C A;  3ZPL A;  1R1U A;  5AON A;  1EV7 A;  1GLN A;  3TW6 A;  4CCN A;  3F21 A;  4ENK A;  1LUJ B;  1RES A;  2LP0 A;  3GTK J;  4BS9 A;  2A61 A;  2CQ7 A;  4KIF A;  3KP3 A;  2KJB A;  3WTY C;  2HZD A;  1J09 A;  1TNS A;  1IDZ A;  3GWZ A;  3BPX A;  4XN0 A;  3WTU C;  5GAE J;  2FNP A;  3OOU A;  4KDP A;  1FSE A;  2RKH A;  2ZBK A;  4WK8 F;  3OYM A;  3CJQ B;  4A5N A;  1ZYR F;  3HHH A;  3CES A;  3H36 A;  1T8I A;  3CZ6 A;  3RJP A;  3E5Q A;  1SD7 A;  2X9D A;  3CCY A;  1IV8 A;  1ZR2 A;  3NQO A;  2EZK A;  1DGR M;  2HXI A;  4FAS D;  2XC7 A;  3G1O A;  3TL4 X;  1SFX A;  1D0Z A;  1WI3 A;  2CFO A;  4C3I J;  1TWH J;  3I9V 2;  1ZGJ A;  1ZR4 A;  3HSE A;  2JA2 A;  3HM5 A;  1FX7 A;  4RAG A;  4A0Z A;  4S0H B;  2ZNZ A;  3FXQ A;  4XK4 A;  1VI0 A;  4AIH A;  3CMM A; 
#chains in the Genus database with same CATH homology
 4HF2 A;  2EFQ A;  1ZLK A;  4ZYG A;  3T0Y A;  4CDG A;  5CLS A;  4G7Z F;  4IXA A;  4L9J A;  2X0L A;  1TQI A;  3GLX A;  2H09 A;  4XRF A;  2NNN A;  4JQF A;  4EVI A;  2JPC A;  1ZN2 A;  2VN2 A;  1DDN A;  1H0M A;  4HA8 A;  3D5L A;  3GYH X;  4OIO F;  1WQ2 A;  1F4K A;  1YW7 A;  4HLY A;  4B8X A;  3I59 A;  1XMA A;  1MZB A;  1LVA A;  4S04 A;  4KNY A;  3R0A A;  3ML6 A;  4M9Z A;  2JT1 A;  1IXS B;  3M8E A;  1BN5 A;  5J8F A;  5DUK A;  1IRF A;  1W7P A;  4OMY A;  3FZV A;  3PFI A;  3J80 Z;  4Q47 A;  3OOP A;  5CYV A;  2W57 A;  1GHC A;  3WOD F;  3GUD A;  4OOI A;  2TDX A;  2V1D A;  2L4M A;  2KJC A;  2Y0M A;  2WTE A;  3JW4 A;  3O6B B;  1FYK A;  4LG0 A;  5D6E A;  4KN7 X;  2FML A;  4OIN F;  3K0L A;  1QQI A;  1XGO A;  2F5C A;  1J9I A;  5E17 F;  4H0E A;  1YS7 A;  2OQG A;  1Z9C A;  5HLI A;  2ISZ A;  5CJ9 A;  5JFR A;  2KIF A;  1FP2 A;  3CO7 C;  2Y48 A;  3HSR A;  4MTD A;  2FA5 A;  1XDS A;  3KEQ A;  2D45 A;  3V7R A;  3V8J A;  3WU0 A;  4MQ9 F;  3QU6 A;  3RYR A;  2GZW A;  4HQE A;  1FSH A;  3WGG A;  2NAZ A;  3CUQ B;  4AVP A;  1LDD A;  2P6T A;  5HDG A;  2FBH A;  5DD4 A;  4HDU A;  4U0V A;  1Z1D A;  4GGG A;  3PQK A;  3QPT A;  2PI0 A;  2XAF A;  3SXY A;  1DUX C;  2HQR A;  3ZMV A;  2L4A A;  1SMT A;  2DAO A;  1FC3 A;  4BXU A;  4LJZ F;  3GVA A;  3ECH A;  1HW2 A;  3Q9V A;  1D8J A;  4A0Y A;  3KZY A;  3W6K B;  1Z05 A;  2QEN A;  3GZ5 A;  3WGH A;  4ENN A;  3KFW X;  3BDD A;  4P96 A;  3KZZ A;  2EB7 A;  4G94 A;  4AIK A;  4IRI A;  3RTR A;  1ZG3 A;  2IA2 A;  2FBK A;  5HS9 A;  2STW A;  1T98 A;  1K79 A;  2XUB A;  2OD5 A;  3L2C A;  1IXC A;  2HKX A;  1H9T A;  3EQL F;  2FQ3 A;  2GAU A;  2YR2 A;  1LDK B;  2AS5 F;  1W4M A;  3DKW A;  2RDP A;  3FMS A;  4LK1 F;  2LSO A;  5LRS A;  4M9X A;  4ON0 A;  1ON1 A;  3TKY A;  3F8F A;  4CGZ A;  1B59 A;  2CYY A;  4L0Z B;  3HIF A;  5DEQ A;  4I09 A;  1KU9 A;  4F7Z A;  2K86 A;  4PCQ A;  1XGN A;  2CO5 A;  2A3S A;  3J81 Z;  2MH9 A;  4D0P A;  2QZ8 A;  4KFC A;  2ZKZ A;  1U78 A;  5L3G A;  2P6S A;  2VON A;  1OPC A;  2WWY A;  1WWX A;  4IHT A;  3K1P A;  1TLH B;  4UV8 A;  2ZO4 A;  3DXJ F;  3H3U A;  5K5Q A;  3RYP A;  1QO0 D;  2IP2 A;  3VFZ A;  2QQB A;  4UV9 A;  1OYY A;  2VBZ A;  3T5X A;  4HZF A;  4RGU A;  4U88 A;  3JTG A;  2FU4 A;  2ZME A;  3BZ6 A;  3J81 K;  3I59 B;  5D5U B;  3HYI A;  4G9Y A;  4BQA A;  2O0Y A;  5L3D A;  1FLI A;  2ADU A;  2VBW A;  1J7K A;  1KU7 A;  2NS0 A;  2WC2 A;  1G6N A;  2DPD A;  2MLK A;  3TO9 A;  3WE3 A;  4OIR F;  5LBQ A;  3HRM A;  3ZP5 A;  1YO5 C;  2FNA A;  3RPU A;  1D5V A;  3R60 A;  1IAW A;  3F6O A;  4U0W A;  1PP8 F;  4ASN A;  2UXX A;  2E1N A;  1R00 A;  1KQ9 A;  5IT9 Z;  5LHI A;  2Z5U A;  1USS A;  2HS5 A;  2L01 A;  5ICC A;  1CGP A;  4RS8 A;  3NEU A;  5HOO A;  5F6F A;  1KA8 A;  1YG2 A;  2F5E A;  5CVJ A;  3FM5 A;  2H6B A;  4Y15 A;  3IL2 A;  2ESH A;  2QWW A;  2K02 A;  3U1D A;  3DQV C;  4KN4 X;  3HTU A;  3GX4 X;  2HTJ A;  3QPH A;  4BAY A;  2IJL A;  3BJ6 A;  3DEU A;  4HLX A;  1I6X A;  5CVR A;  5HS7 A;  2ZCW A;  5BMZ A;  1T6S A;  1XN7 A;  1V3F A;  1RI7 A;  2ZNY A;  4G6Q A;  4QLC U;  3E6B A;  2HQN A;  2CGP A;  3I4P A;  2PEX A;  4ZYH A;  1T39 A;  2VE9 A;  3HHG A;  2ZJ2 A;  4KMF A;  3SZP A;  5JR3 A;  1WRJ A;  1ZAR A;  1UCR A;  1HQC A;  2P7V B;  2D1V A;  5HLH A;  4AWX B;  2F5D A;  3TO7 A;  2R7F A;  1ONV A;  3MAJ A;  1FNN A;  3KP4 A;  2XKO A;  4BH9 A;  5E18 F;  3CDH A;  4A6E A;  2VC1 A;  4DNC A;  1ZLJ A;  2HTS A;  4WXC A;  4PDK A;  3ZQ7 A;  5DV5 A;  4Y17 A;  1KU2 A;  3I54 A;  1K7A A;  2QBY B;  2FXA A;  3R6S A;  3MCZ A;  2WV0 A;  3O3K A;  1O57 A;  1P4W A;  2ISY A;  2HR3 A;  1HKS A;  4KIC A;  4EGY A;  1DPU A;  1YIO A;  4EJU A;  3V7C A;  1EH6 A;  1E2X A;  2E7W A;  2K4B A;  1QBJ A;  4L9N A;  4Y13 A;  3GXO A;  4ETS A;  2QQ9 A;  3CUQ A;  2YX7 A;  2DTR A;  4EQQ A;  4EGZ A;  1MJB A;  5A2Q K;  4HX4 A;  1FBS A;  4CHU A;  4CZZ A;  1WI9 A;  2M30 A;  5CVV A;  2GQQ A;  3BOQ A;  4JBA A;  1W5T A;  3DFG A;  4YFK F;  3F22 A;  1O3Q A;  3RIR A;  2ZME B;  4N9H A;  2XRN A;  5E20 A;  2XHK A;  4Z2Y A;  4WX9 A;  2CSO A;  1S7A A;  3ROU A;  1XMK A;  1IN7 A;  5LLQ A;  3C18 A;  2FMY A;  2M87 A;  1A04 A;  2P5V A;  2W24 A;  4UVB A;  4KIG A;  3L00 A;  4MNU A;  3IKV A;  2K27 A;  4BHB A;  1IRG A;  1HXD A;  2VOP A;  4LB5 A;  2W25 A;  4ZYD A;  4RAZ A;  4XLP F;  3N97 A;  3TOA A;  5D4R A;  4BNC A;  5ILS A;  3H92 A;  1JE8 A;  3AAF A;  2D2W A;  4O6J A;  3SHF A;  3CO6 C;  1IN4 A;  3BJA A;  1B6A A;  3HRU A;  1D8K A;  1T2K A;  2J5P A;  2JPB A;  5ICE A;  2V9V A;  1JHH A;  4P5O A;  5K1Y A;  2PQ8 A;  1B9M A;  2M1B A;  3ZN0 A;  3CJN A;  3WE2 A;  3TGN A;  3E5X A;  3WTW C;  4MEY F;  1EH8 A;  4HF1 A;  3U9G A;  1KYW A;  1XGS A;  4L5I A;  4KMU X;  2EA2 A;  2HEO A;  5FLX Z;  5LHG A;  4LK0 F;  3TDZ C;  2EFN A;  1GVJ A;  2XAQ A;  2VBX A;  1U6G A;  2P5K A;  2QM3 A;  5D6F A;  3COA C;  4RGR A;  4L0Y B;  2FF4 A;  4GXO A;  4HAM A;  4EJV A;  1YYV A;  1ZGA A;  3IHU A;  3ELK A;  5FLX K;  3HTS B;  3WTT C;  1K6O A;  1MD0 A;  3I0T A;  3LFK A;  1U8R A;  1SFU A;  2PMH A;  5BQT A;  2BE5 F;  4NQW A;  3ULQ B;  1I5Z A;  4TV7 A;  4EM0 B;  1BOA A;  2IT0 A;  2P5L C;  2DQR A;  3FF5 A;  3C7J A;  5K5O A;  1J2X A;  1WSU A;  2HFH A;  1H9G A;  2V79 A;  5LEK A;  3KEO A;  1IN6 A;  4ESB A;  1TBX A;  1KYZ A;  1SFE A;  2G9W A;  2Z3Y A;  5LRR A;  2RV8 A;  5BOX A;  1U5T C;  3KLO A;  4XLN F;  1MKM A;  1LDJ A;  1IUY A;  3E6M A;  2BYV E;  3J80 K;  4P9F A;  4WCG A;  4XBF A;  3L9F A;  4EM1 A;  2M8E A;  3R61 A;  2LNB A;  3HSF A;  1FZP B;  4LD5 A;  3B73 A;  1P6R A;  1D3Y A;  5FO5 A;  1MDM A;  1G3W A;  3IWZ A;  3LAP A;  2DT5 A;  1LNW A;  1V4R A;  1GXP A;  2M5W A;  2JTV A;  1GXQ A;  3BY6 A;  3C1D A;  4B09 A;  3CUO A;  4PGH A;  2EFW A;  1BC8 C;  3M9A A;  3V4G A;  3Q5F A;  5LGT A;  3ISP A;  3G73 A;  2LDU A;  3WU1 B;  5DD8 A;  3KE2 A;  4WWC A;  2EV0 A;  1UHW A;  2BV6 A;  4KUM A;  3O2P E;  3LWF A;  4I7H A;  1JHF A;  4EJW A;  1HBX G;  5L3E A;  3ZMT A;  4EJO A;  4A6D A;  1XCV A;  1IN5 A;  1G3T A;  3ZMD A;  4KIB A;  3H3Z A;  3IWF A;  4I0A A;  4FX4 A;  4FT8 A;  3FMQ A;  2PN6 A;  2YSR A;  3WTX C;  2X4H A;  2VOD A;  2CQK A;  2RNJ A;  2QBY A;  4HX8 A;  5HVQ C;  3VOD A;  2HGC A;  2C6Y A;  5E8G A;  1DP7 P;  3FMR A;  4YFX F;  2DPU A;  4HQM A;  1IF1 A;  4U7B A;  3CTA A;  4I0B A;  1PDN C;  2DK5 A;  3OV8 A;  1ULY A;  2P8T A;  2DQL A;  3WGI A;  3WTZ A;  3DF8 A;  3L7W A;  1SAX A;  2XKP A;  3KCC A;  2STT A;  2A68 F;  5FGM A;  2V1X A;  2IVM A;  5D5X B;  2PBI A;  1FWZ A;  2JSC A;  2XRO A;  3VB2 A;  3F8C A;  3JAM Z;  2VE8 A;  4G6D A;  5AIP A;  1ZRF A;  2F5F A;  3EDP A;  3ABT A;  5ILU A;  2OBP A;  1EH7 A;  5ED4 A;  1UB9 A;  4A2U A;  1UFM A;  5E1X A;  1I27 A;  3I5U A;  3G3Z A;  1FYM A;  1BIA A;  1TQP A;  4GYG A;  3IC7 A;  3EET A;  3R4K A;  4LLL A;  3JSO A;  1RIO H;  3TOB A;  2NRA C;  4GCV A;  5ICG A;  3QAH A;  2FRH A;  2MH2 A;  4YFN F;  3MQ0 A;  4BHC A;  2A69 F;  3DP7 A;  1FY7 A;  2KIU A;  3GF2 A;  2YU3 A;  1O3T A;  1P2F A;  1K78 B;  3RI4 A;  1SMY F;  4EJT A;  4Q48 A;  4OIQ F;  3V7S A;  4G8X A;  2HWV A;  4HYE A;  1XSD A;  4ENM A;  2H6C A;  5F1R A;  2L3D A;  1P4A A;  1G3S A;  1SD4 A;  1LJ9 A;  1CF7 A;  1JGS A;  5L3F A;  2O03 A;  2VC0 A;  4HV5 A;  2XV4 S;  1XB4 A;  4LB6 B;  5IT9 K;  3MWM A;  2XAG A;  2RVC A;  3BPV A;  1R23 A;  2BGC A;  1OR7 A;  5J8C A;  1MDM B;  4S05 A;  5H6R A;  2HKO A;  2R7D A;  2V6C A;  3P9K A;  4RGS A;  1MJA A;  4UVC A;  2LKP A;  5TJJ A;  2CFX A;  2IA1 A;  2A6H F;  2G7H A;  4PZJ A;  3BP8 A;  2OAZ A;  1OMI A;  4YII A;  3F8N A;  1B1B A;  1ZHF A;  1BI3 A;  4EMS A;  4LGW A;  4OIP F;  2MBF A;  1YS6 A;  3EYY A;  1FP1 D;  3F72 A;  3FXR A;  5E1W A;  4I01 A;  1OKR A;  2UWM A;  4L9T A;  4BHP A;  2GWR A;  4CXF A;  4ESJ A;  4IRG A;  1FOK A;  2IRF G;  2PFB A;  3E5U A;  1QNT A;  1R5H A;  1HW5 A;  4AIJ A;  1U2W A;  3F6V A;  5E1Z B;  4RAY A;  1TTY A;  5FB2 A;  3RDI A;  1J5Y A;  4QWQ A;  2VBY A;  4HF0 A;  4N0B A;  3I53 A;  3GZ6 A;  1S3J A;  3TDU C;  1O7F A;  1S7O A;  3EYI A;  2HYG D;  2A6E F;  4R1H A;  1LQ1 A;  5JI6 A;  3KLN A;  5D5W B;  2ETH A;  1FPQ A;  2BEO A;  3D0S A;  1XDU A;  5DCF A;  1NHA A;  2OA4 A;  5BS6 A;  4O5V A;  3DV8 A;  4FHT A;  1XD7 A;  3K2Z A;  2KKO A;  2XIG A;  1L0O C;  4WF2 A;  3RKX A;  5KVR A;  1R22 A;  3HUG A;  5KK1 A;  1P4X A;  2EJR A;  4UXN A;  2OQR A;  2AXL A;  2UXN A;  3K1N A;  4UUV A;  2YPR A;  1R5G A;  1YW8 A;  5HDN A;  1TQM A;  4M72 A;  5FFZ A;  5L3C A;  3E6C C;  1MJ9 A;  1I1S A;  2JZY A;  1FYL A;  2CWE A;  4XSZ F;  3L09 A;  5DYM A;  3IRQ A;  3RKY A;  1SD5 A;  2Z99 A;  1PUE E;  4A0X A;  3MFK A;  3QOP A;  4KYW A;  4HDV A;  4ESF A;  1U3E M;  1L3L A;  1TNT A;  2R3S A;  3M8F A;  5DUI A;  4R8H A;  3JSP A;  4HW0 A;  1O3R A;  5ICF A;  3IKT A;  1OYW A;  3Q9S A;  4U0Y A;  1S6L A;  4ZZL A;  2H27 A;  1LEA A;  4G7H F;  2COM A;  2OZU A;  2GXG A;  2P4W A;  4RB3 C;  4I98 B;  1IW7 F;  1Z91 A;  3E3V A;  3B02 A;  2P7C B;  4M74 A;  5D4S A;  1KQ0 A;  1QPM A;  3ZMS A;  4LFU A;  2F2E A;  3FHZ A;  4RB0 A;  3WTS C;  2QLZ A;  1CF7 B;  1J59 A;  3SQN A;  1HST A;  4EV0 A;  1BI1 A;  5D5V B;  2XAH A;  1RNL A;  1BI0 A;  4HBL A;  3RPQ A;  2HDC A;  3BRO A;  3F23 A;  2J5O A;  1J0R A;  3LA3 A;  1W7P D;  3LST A;  5LGN A;  3T1B A;  5ILV A;  2K4J A;  1PP7 U;  4MQV A;  1Q1H A;  1TW3 A;  4DQ2 A;  2PG4 A;  2FBI A;  4A12 A;  3SZT A;  4FX0 A;  4L9V A;  1G4D A;  1ZG5 A;  2D1H A;  5H6Q A;  1FBQ A;  2QYO A;  2MD5 A;  2DU9 A;  1C0W A;  2EV6 A;  5DCM B;  1TW2 A;  1ZAO A;  3RKW A;  5ERI A;  2W85 A;  3LA2 A;  2O6G E;  2M45 A;  1KGS A;  3HRT A;  1R36 A;  2XGX A;  3CUQ C;  5EEG A;  2A5Y B;  3K1M A;  1IN8 A;  5FFX A;  3M7G A;  3WTV C;  2KRF A;  3P7N A;  2Q2E A;  2GA2 A;  2ZFW A;  4M9S A;  2H94 A;  1E17 A;  3MZH A;  1K78 A;  4IF4 A;  2IA0 A;  4N9I A;  1BIB A;  1XGM A;  2JRT A;  4CIC A;  4RGX A;  1T38 A;  4HV6 A;  5H20 A;  4KT5 C;  2IPQ X;  2UZK A;  4CO8 A;  1IXR C;  3ERE D;  2OZ6 A;  3I58 A;  2EFP A;  2W84 A;  1B4A A;  4MHG A;  2XAJ A;  1ZG1 A;  3IRR A;  3HOT A;  2LF7 A;  3GO5 A;  5HS8 A;  2E7X A;  3GFM A;  3W6J B;  4IPA A;  2MA3 A;  1UHM A;  2QVO A;  4L18 B;  5JHU A;  2LF8 A;  3E6D A;  2YX4 A;  2ZXJ A;  2GXB A;  4RB1 A;  3ZMU A;  3GEZ A;  2EFO A;  6PAX A;  3ABU A;  1P92 A;  3KP5 A;  4IJA A;  2VOO A;  5IT3 A;  3ZMZ A;  3KET A;  4WXD A;  3P9C A;  1R58 A;  2QUF A;  3VEP A;  5HLG A;  2PMU A;  1XSV A;  2HOE A;  1W5S A;  3KP6 A;  1RUN A;  3K9T A;  3KP2 A;  1KQ8 A;  2XVC A;  1F1Z A;  1BC7 C;  3F8B A;  4LMY A;  3HOS A;  1R1T A;  3HRS A;  4U7D A;  1S8N A;  1B9N A;  4YG2 F;  1OYI A;  4MGR A;  4P55 A;  1U5T B;  2OU2 A;  3PQJ A;  3N4M A;  1R7J A;  1S29 A;  5CVU A;  4MEX F;  5D8L B;  3WG9 A;  4WXH A;  2DO7 A;  2DK8 A;  2KIM A;  4O3M A;  3GFJ A;  3TO6 A;  2EV5 A;  3QU3 A;  3C3W A;  4NB5 A;  4GO1 A;  2IW5 A;  1QZY A;  4Q4Z F;  4M6Y A;  1QZZ A;  5L3B A;  1ODD A;  1BBY A;  1HKT A;  3MEX A;  2G7U A;  4YIF A;  2VT3 A;  2NNY A;  1SD6 A;  3BWG A;  1VTN C;  1WKM A;  4UVA A;  4GYI A;  2VXZ A;  4ZH4 F;  3VOE A;  4CYD A;  1ON2 A;  4IVN A;  1BM9 A;  1YQA A;  1LEB A;  1YTY A;  3M1E A;  1AWC A;  3DPT A;  5LHH A;  3SFZ A;  1IZ1 A;  2FSW A;  4UHT A;  3EUH A;  3GFL A;  2EA4 A;  2RC4 A;  3LAJ A;  3MZY A;  1Y0U A;  2ACJ A;  3JAM K;  1RUO A;  1Z6T A;  2BBY A;  2O3F A;  2Q0O A;  4K2E A;  1J75 A;  3S2W A;  3V8L A;  3DPL C;  3T8T A;  1ZRD A;  3I64 A;  3FX3 A;  4JK1 X;  2B0L A;  5TRD A;  2RQP A;  1HW1 A;  1W7P B;  1FBU A;  5HDK A;  1ZRC A;  1Z6R A;  2DI3 A;  1HKQ A;  2CW0 F;  2O8X A;  4OU0 A;  4M71 A;  2Z33 A;  3LA7 A;  5F64 A;  1AOY A;  5LGU A;  5BPD A;  2DLL A;  1T0F A;  4HX7 A;  3TQN A;  2V1U A;  4LG0 B;  1JXS A;  4KA4 A;  3NRV A;  2GIV A;  4E70 A;  5LEJ A;  4HOB A;  1YW9 A;  3FWE A;  2DBB A;  1F5T A;  1YFH A;  2CG4 A;  4RB2 C;  3LQQ A;  2EK5 A;  3LQR A;  3V8K A;  4BYY A;  1HSJ A;  3I71 A;  4AD9 A;  2ESN A;  4IRH A;  5FD6 A;  1MGT A;  3BJO A;  5EEH A;  4R79 A;  3R0J A;  4OMZ A;  3P9I A;  2PJP A;  2FEZ A;  3K69 A;  3ZN1 A;  2K7L A;  2L02 A;  4LLG F;  5DCM A;  5FD5 A;  3QP6 A;  4EM2 A;  4Q5S F;  4NHJ A;  2ELH A;  2HZT A;  1DPR A;  4P9U A;  2RGV A;  3CLO A;  4L5J A;  3FM3 A;  4M6X A;  3QRF F;  3U2R A;  4MTE A;  2XAS A;  1ZRE A;  4IHS A;  1XCB A;  3QP5 A;  5J6X A;  4M73 A;  5JVT A;  2EWN A;  4ZYE A;  1KU3 A;  5AIQ A;  2VT2 A;  1R1V A;  2FOK A;  3T8R A;  2HYF A;  2MC3 A;  5K5R A;  5CVI A;  3FXU A;  2DFI A;  3F3X A;  4A5M A;  3F8M A;  1REP C;  2QQA A;  1Z7U A;  5E8I A;  1FT9 A;  1I1G A;  4I2O A;  1STZ A;  4PGG A;  2Y75 A;  1BI2 A;  5A2Q Z;  1LB2 A;  1O3S A;  2RN7 A;  3GFI A;  2A07 F;  2FE3 A;  2NYX A;  4ZZD A;  2Z9O A;  3REO A;  2DW4 A;  4UNO A;  2MLG A;  4I02 A;  3E97 A;  3J7A O;  4ENJ A;  2O61 A;  2GA1 A;  3JTH A;  5BPI A;  4XSX F;  1QGP A;  2L54 A;  4G7O F;  1BJA A;  1F9N A;  1X3U A;  5DDG A;  2Q8K A;  4LLN A;  3GW2 A;  1O7L A;  3KP7 A;  1ZH5 A;  3ECO A;  1XSX A;  1G3Y A;  1U5T A;  1RZ4 A;  1YLF A;  2PLY A;  5D8K B;  1UST A;  2E1C A;  3ZPL A;  1R1U A;  5AON A;  1EV7 A;  3F21 A;  4ENK A;  2A61 A;  4KIF A;  3KP3 A;  2KJB A;  3WTY C;  1TNS A;  3GWZ A;  3BPX A;  3WTU C;  2FNP A;  4KDP A;  1FSE A;  2RKH A;  2ZBK A;  4WK8 F;  4A5N A;  1ZYR F;  3HHH A;  3RJP A;  3E5Q A;  1SD7 A;  3NQO A;  1SFX A;  1ZGJ A;  3HSE A;  1FX7 A;  4A0Z A;  2ZNZ A;  3FXQ A;  4AIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...