5KVRA

X-ray crystal structure of a fragment (1-75) of a transcriptional regulator pdhr from escherichia coli cft073
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
NAMAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Crystal Structure of a Fragment (1-75) of a Transcriptional Regulator PdhR from Escherichia coli CFT073
rcsb
source organism Escherichia coli o6:h1 (strain cft073 / atcc 700928 / upec)
molecule tags Translation
molecule keywords Pyruvate dehydrogenase complex repressor
total genus 21
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5kvrA00
1ZLJA 2ZO4A 5ICFA 3V7CA 3BY6A 4LJZF 4HX7A 3U9GA 1BIAA 3FXRA 4ESBA 2G9WA 3AAFA 3JTHA 5L3CA 1OR7A 5ICGA 2QWWA 2UZKA 1HKTA 1LDKB 3P9KA 4AWXB 2RC4A 3WE3A 4M74A 1O3TA 2AS5F 4DNCA 1IN6A 5AIPA 4GGGA 4G7ZF 1ON2A 4ON0A 3V8KA 5HDKA 2BGCA 4YIFA 4I02A 4CO8A 3E3VA 4YFXF 4CYDA 4UVAA 4HF2A 2PN6A 4HF1A 4I01A 4EM2A 1P4WA 4RGSA 2HKXA 2COMA 1K7AA 1YIOA 5E8IA 1IF1A 3WU1B 4FT8A 1G3SA 2XUBA 1UHMA 3J7AO 1XGNA 3IC7A 4ZH4F 2PBIA 3KEQA 4RGRA 5EEGA 2KJBA 1UFMA 2K02A 3FF5A 3F72A 4KN7X 1O3SA 1PUEE 4UVCA 5BS6A 5BOXA 3F8NA 2HTSA 5LRSA 5D4RA 2AXLA 4A0YA 2NNNA 2QM3A 5FLXK 1MJ9A 4WWCA 1A04A 2MLGA 1HKSA 1YLFA 1C0WA 5KVRA 5TRDA 3N4MA 1ZRDA 2L01A 1H9GA 1LEAA 3FMRA 5L3EA 2RN7A 5CVJA 1XDUA 1AOYA 1R36A 1ZYRF 2VBZA 3I59A 2ZJ2A 5CYVA 2K4BA 4HV6A 2E7XA 2CWEA 3DPLC 4AIKA 3K9TA 1H9TA 1OYWA 2MBFA 1LQ1A 3EYIA 3V7RA 4LD5A 4EJOA 1L3LA 4EM1A 2EB7A 2ZNZA 2VOPA 3KP2A 5A2QK 5ILSA 4RB0A 3RI4A 5BMZA 5LLQA 4XLNF 2D1HA 3ZMUA 4CGZA 3F6VA 3DP7A 2IA2A 1G3YA 1VTNC 3C1DA 1HSTA 2MA3A 3SQNA 5JFRA 4JBAA 1KA8A 2A5YB 2O3FA 1YO5C 1SMYF 2HDCA 3P9CA 2ZMEA 4BAYA 2D1VA 3KLNA 5DUIA 1DDNA 3O6BB 4HW0A 1TW2A 1WQ2A 4YFKF 2P5KA 5JHUA 3JTGA 1ZRFA 3CUOA 2FQ3A 3NQOA 1OMIA 1E17A 3HRSA 2PJPA 2DU9A 4Z2YA 1IXCA 1IXRC 4LGWA 2BYVE 2XKOA 5LRRA 3M7GA 3R61A 3VFZA 5K1YA 1MZBA 2Y48A 2IJLA 1K78B 4KIGA 3F8MA 2XROA 1HXDA 4BXUA 1B1BA 3EQLF 5AIQA 3ULQB 1FBSA 1WRJA 3FWEA 3CO6C 1K79A 1BIBA 4A6DA 4LB5A 3HHGA 1FX7A 2X4HA 2FF4A 2ZCWA 2KRFA 2MD5A 3C3WA 3M9AA 1QQIA 2NAZA 2UXXA 4EM0B 4AVPA 3LAPA 4A0ZA 1H0MA 2W84A 3I0TA 4P9UA 2OQRA 2VN2A 1P6RA 5F64A 3K1MA 4NB5A 1X3UA 1DUXC 3T0YA 4MEYF 3KE2A 1RUNA 2BV6A 2K7LA 4EV0A 3Q9SA 2GWRA 1R5GA 3K2ZA 2IRFG 1MDMB 3GZ5A 5E17F 4KUMA 3M8EA 3CUQB 3TQNA 2A68F 2XRNA 3FX3A 2WWYA 3GFIA 2VXZA 4OINF 3CDHA 3QOPA 2RNJA 1YYVA 3ISPA 1J75A 1O3QA 1B4AA 2NRAC 4HLYA 1RNLA 4L18B 3KP3A 2KIMA 2YU3A 2RKHA 3C18A 1IUYA 4M9XA 3SZPA 3RTRA 2WC2A 3QPTA 3L2CA 5DCFA 3QU6A 4N9IA 3HHHA 1FP2A 3H3ZA 1G3TA 2LNBA 5DYMA 1RIOH 4AD9A 2O6GE 2A6HF 2MC3A 3WE2A 1OYIA 2M45A 3VB2A 3WODF 4OU0A 3U1DA 5K5OA 2DW4A 1KU9A 4OIPF 4MEXF 4AIHA 3V4GA 4A6EA 2BEOA 2LSOA 4EVIA 2IA1A 3CTAA 3I4PA 3I64A 4UHTA 1WKMA 2Z99A 1W5TA 2IVMA 4Q47A 3DF8A 2YSRA 1P92A 1BJAA 2EA4A 4RB3C 2W57A 5LGUA 1KYWA 4UV8A 2ESHA 1JE8A 2Q0OA 3QRFF 3K69A 3ERED 3WU0A 5HOOA 3KZYA 1ODDA 3WTZA 2VC1A 2VT2A 4O3MA 3WTSC 2Z3YA 2QQAA 1IN4A 4KDPA 2PI0A 4Y17A 3JAMK 2L54A 3OOPA 5HLIA 2FSWA 4Y15A 4R8HA 1YG2A 1P4XA 2YX7A 2FMYA 1UHWA 3E97A 2PG4A 1O7FA 2ADUA 2FOKA 5LHHA 3T8RA 1UB9A 4PCQA 4MTDA 1FT9A 2XASA 3MCZA 4EJWA 1MGTA 4GCVA 5HVQC 3KP6A 4L9TA 4K2EA 3LA2A 1L0OC 3U2RA 3TGNA 2DLLA 3LFKA 1Z91A 3I53A 5D6FA 1FWZA 3MEXA 3BZ6A 4NHJA 1J5YA 3I59B 3BP8A 1P2FA 5D8KB 1RZ4A 3T5XA 1GXPA 3FZVA 1R22A 2CW0F 3L09A 3LSTA 3BJOA 2L3DA 1SMTA 4L9VA 1BI0A 3REOA 3E6BA 2EFNA 2XGXA 1IW7F 2ISZA 2L4MA 2V1UA 1R1TA 4IPAA 5ILVA 3DQVC 3GFMA 4U0YA 2CG4A 3VOEA 5HDNA 2F5DA 5F1RA 2O61A 4YIIA 1BOAA 3E5XA 3RYRA 4KFCA 5H6RA 4CHUA 2CFXA 4ZYDA 4RB1A 3EETA 2O8XA 3Q9VA 4MQVA 1HW2A 1KQ0A 3HTSB 1I1SA 2FE3A 4F7ZA 2M30A 1BN5A 2VT3A 3LQQA 4TV7A 1IRFA 6PAXA 1XMAA 4CZZA 2FNAA 5DD4A 4M6XA 2XAHA 5J6XA 1FP1D 2F5FA 1XCBA 4RGXA 3WTXC 3HUGA 3TO9A 5J8CA 2VODA 4Y13A 1LVAA 1KU3A 1FLIA 1ONVA 4M6YA 3TDZC 3ZMTA 1FYMA 4GYGA 4A5MA 4ENMA 4Q48A 2A69F 1R5HA 4HBLA 2P7VB 3J80K 1T0FA 1S8NA 4XLPF 1K78A 3Q5FA 4UXNA 2P5VA 2PMHA 5D8LB 3ZMSA 4WF2A 3KZZA 3KP7A 1USSA 5ED4A 5E1ZB 5LGTA 1B9MA 1JXSA 1KGSA 1BI3A 4IJAA 3BROA 5D5VB 1DPRA 1T38A 3ZMVA 1SFXA 4HF0A 1CF7A 4HOBA 2FU4A 2O0YA 4ENNA 1BC7C 2EJRA 1HSJA 3B02A 1T39A 1TNSA 3WGIA 1KQ8A 2H6BA 5IT3A 2C6YA 2XHKA 2JTVA 2OD5A 4HX4A 1W4MA 1YW9A 2ZBKA 3I54A 1ZAOA 4LFUA 1IN7A 2QBYB 3KP5A 4PGHA 3ROUA 1GXQA 3ABTA 1Z9CA 2JRTA 2DAOA 5H20A 2M87A 2L4AA 3IWZA 5FLXZ 4BHPA 2RDPA 4MHGA 4IF4A 2ELHA 1KU2A 2LF8A 3LWFA 4L9NA 3D5LA 4PDKA 4KMFA 4LLGF 3CJNA 4G7OF 1U8RA 1F1ZA 5D5UB 3T1BA 2ESNA 3GF2A 1OYYA 2W24A 2HWVA 1HKQA 2DTRA 5L3GA 1FPQA 3K1NA 5D6EA 3HSEA 4IRGA 3ZMZA 3LAJA 1QBJA 1TLHB 4U7BA 3W6KB 1RUOA 3MWMA 4U88A 4LB6B 1R58A 2YPRA 2UWMA 3CLOA 3QU3A 2VOOA 2EFWA 4E70A 5H6QA 3HRMA 2BE5F 4LK0F 1MDMA 2XIGA 2PMUA 1K6OA 5TJJA 5JVTA 2EWNA 3F8BA 3OV8A 4HA8A 2M8EA 4BHCA 3HSRA 4RB2C 5JI6A 2VBXA 3E6CC 3QPHA 4BQAA 4KT5C 2MH2A 3SHFA 4IHSA 4P9FA 4LMYA 2HQNA 4HLXA 4L0ZB 3MZHA 2YX4A 3RDIA 2HQRA 2E7WA 2KJCA 3J80Z 3L9FA 2VC0A 3IL2A 2EFOA 4IHTA 1FZPB 4ZYGA 2KIUA 1YW8A 2EFPA 4KMUX 4YG2F 1ZG3A 4FX0A 1CF7B 3HSFA 5FO5A 1BI1A 5D5WB 5J8FA 1I1GA 5FD6A 2DO7A 3ZPLA 1ZGAA 4L5IA 1XMKA 1B6AA 2A61A 3R4KA 1IN5A 4IXAA 4HAMA 1KQ9A 4WXHA 5E20A 3ZN1A 3T8TA 4PGGA 4JQFA 1U3EM 3WTVC 5LHIA 2ZXJA 4EJTA 1KYZA 2M1BA 2LDUA 2NYXA 2YR2A 4D0PA 1SFUA 1YQAA 3RPQA 3WTUC 3JSPA 2HEOA 2QLZA 3FMSA 2XKPA 2OZUA 4BHBA 2HFHA 3DEUA 2G7UA 3GFJA 1ZHFA 1EH6A 2L02A 1BC8C 1DP7P 5LBQA 4FHTA 2DPUA 5DDGA 1ZARA 4OIOF 1LEBA 2Y0MA 1RI7A 4KA4A 1O57A 2EV5A 1R7JA 3NRVA 4ZZDA 4ZYEA 2Z33A 1I6XA 4WXCA 2LF7A 1HW5A 1S29A 3CO7C 3HIFA 4DQ2A 1GHCA 3GO5A 3KETA 5BPIA 1FOKA 3QAHA 4Q4ZF 5E18F 1SD5A 3L7WA 4WXDA 1PP7U 2R7DA 3F22A 2O03A 1Q1HA 1WI9A 4AIJA 1R23A 3KCCA 5HDGA 5DD8A 3VEPA 1MKMA 2IA0A 2OQGA 3EYYA 3F6OA 4OIRF 1MJBA 3R0JA 4B8XA 3I58A 5D4SA 2DQRA 4EJVA 1SD7A 2E1CA 1QO0D 4M71A 2RQPA 3R0AA 3KFWX 2Q2EA 4I98B 2F2EA 1HQCA 1T98A 4ASNA 3S2WA 4BYYA 1T6SA 1J59A 2RVCA 3WTYC 3GFLA 3FXQA 2J5OA 2R3SA 5HLHA 4L9JA 4I09A 3F23A 1YS7A 5L3FA 4MNUA 3WTWC 2M5WA 2GXBA 3M1EA 3F8FA 1FBQA 2FBHA 1MD0A 3MFKA 3DFGA 4GYIA 1U78A 4WCGA 1JGSA 3SFZA 4HX8A 3DKWA 2ACJA 1ZGJA 1OPCA 3KP4A 1LNWA 5HS8A 2RGVA 4ENKA 3FM3A 3O3KA 1STZA 1CGPA 3GLXA 2JT1A 3PQKA 2V1DA 5JR3A 1OKRA 1Z6TA 1IZ1A 5ILUA 4I2OA 1D5VA 3C7JA 4XSZF 4WX9A 2H09A 2PQ8A 3GZ6A 3GWZA 5LHGA 4UVBA 2VBWA 2GQQA 2GAUA 1EV7A 2ISYA 2IPQX 4LG0A 2F5EA 5L3BA 1F5TA 4G9YA 1TQPA 1G3WA 5BQTA 3HTUA 1BI2A 5DUKA 3BWGA 1U5TA 2HKOA 1DPUA 2OZ6A 1HBXG 3RKWA 4OOIA 3FXUA 2D2WA 4JK1X 1R1VA 4EGZA 1Z7UA 1FYKA 1XGOA 3LA3A 1R1UA 4RS8A 3PFIA 2BBYA 3ML6A 5D5XB 1D8JA 5ICCA 5E1WA 2J5PA 2DT5A 1NHAA 3W6JB 1I27A 2K86A 3H3UA 1O3RA 5FFZA 5DEQA 2GZWA 1D8KA 2GA2A 3IKVA 4HYEA 1MJAA 2VBYA 4HQMA 2HYFA 2KKOA 3R60A 1E2XA 1ZG5A 4ESFA 4UUVA 2GXGA 3G3ZA 4GXOA 1B59A 2DQLA 3FMQA 3MAJA 4U0VA 4U0WA 3P7NA 1XSVA 4R1HA 2XVCA 5K5RA 4MQ9F 2FXAA 5KK1A 4M72A 5CJ9A 3SZTA 1YS6A 2GA1A 1F4KA 2P8TA 2VE8A 3I5UA 4B09A 1ZLKA 2B0LA 2P5LC 5CLSA 3KEOA 2V9VA 3WG9A 5DCMA 2VONA 2VE9A 1YFHA 3DXJF 4CXFA 4EGYA 3FHZA 3RKXA 2HOEA 2HS5A 2KIFA 4CDGA 2TDXA 4MGRA 1IAWA 1XSXA 2ZNYA 1J2XA 3TO6A 1ZH5A 3QP5A 5CVIA 1PDNC 3K0LA 5FFXA 3K1PA 2NNYA 5DV5A 3TOAA 1XGSA 2QBYA 3ECOA 3IHUA 3PQJA 3TKYA 4A2UA 4BH9A 2FBKA 5LEJA 1FY7A 1ZG1A 4A5NA 5FB2A 4FX4A 2FMLA 5L3DA 2ZMEB 5A2QZ 3IKTA 1TW3A 2OU2A 2RV8A 2XV4S 3SXYA 4G6DA 3GUDA 1Z05A 1TTYA 2P7CB 1P4AA 3LA7A 1J7KA 3VODA 2EV6A 3E5QA 4KN4X 3JSOA 1BM9A 1S3JA 1Z1DA 3BPXA 4RAYA 3ELKA 2FRHA 1LJ9A 3H92A 3WGHA 1I5ZA 1XD7A 3ZMDA 4Q5SF 3FM5A 4I7HA 4LLNA 4MTEA 4XBFA 2DBBA 1SD4A 2W25A 1GVJA 2HR3A 4IVNA 4I0BA 3F8CA 2H27A 2CQKA 4ZZLA 2E1NA 1U5TC 3O2PE 1ON1A 2K27A 2QUFA 4QWQA 4H0EA 3V8LA 4G94A 1D3YA 1WSUA 5EEHA 2PFBA 1LDDA 4A12A 2PEXA 1W7PB 2FNPA 2IW5A 2HZTA 3JAMZ 2F5CA 2XAJA 5E8GA 4KIBA 4G7HF 1BBYA 1QPMA 5AONA 2XAQA 1TNTA 4XSXF 2QQBA 3RJPA 4EMSA 2WV0A 1T2KA 2NS0A 4YFNF 1W7PD 2G7HA 4L5JA 1QGPA 4KIFA 1SD6A 3ZP5A 3BPVA 3ZQ7A 2HTJA 4QLCU 4OMYA 3V8JA 1QZYA 5FD5A 3P9IA 2DFIA 4OMZA 5BPDA 3GVAA 4LLLA 2V1XA 1YTYA 2HGCA 1ZN2A 2P6SA 3IRRA 4XRFA 5IT9K 5F6FA 2JPCA 3NEUA 5ERIA 4EQQA 3CUQA 4LK1F 4A0XA 1WWXA 2QQ9A 2D45A 2LKPA 2OA4A 1JHHA 1XB4A 2A3SA 1TQMA 3E5UA 1PP8F 1XCVA 2STTA 3N97A 4UNOA 2MH9A 3E6MA 3GX4X 4L0YB 3CUQC 4NQWA 2XAFA 2A07F 4IRIA 2FA5A 2MLKA 1U2WA 3GEZA 2EV0A 4N9HA 1IN8A 4KICA 1V3FA 1FNNA 2Q8KA 2H94A 3TDUC 1SAXA 1F9NA 3E6DA 1U5TB 1JHFA 1FSEA 1AWCA 2X0LA 3HRUA 3TO7A 4OIQF 4O6JA 2A6EF 4S05A 2EA2A 4LG0B 1IXSB 4M73A 3RIRA 1IRGA 4CICA 2JZYA 1EH7A 2P4WA 3LQRA 4ESJA 2ZKZA 2IT0A 2FEZA 2P6TA 4O5VA 3MZYA 2GIVA 3DV8A 1FC3A 5IT9Z 3V7SA 4G8XA 2DI3A 1O7LA 2CYYA 1S7OA 3GYHX 3ECHA 2ETHA 1J9IA 2STWA 4UV9A 2IP2A 2QYOA 5LGNA 3R6SA 4R79A 2W85A 3M8FA 4HZFA 5HLGA 2EFQA 1W5SA 1R00A 3BDDA 3DPTA 1Z6RA 4P96A 2JPBA 1REPC 1S6LA 1USTA 4KNYA 2JSCA 1G4DA 2ZFWA 2CGPA 3EUHA 4G6QA 2R7FA 3EDPA 1TBXA 1Y0UA 3WGGA 4U7DA 5DCMB 1J0RA 4N0BA 1EH8A 4ENJA 2H6CA 3HRTA 1QZZA 2QENA 1KU7A 4HV5A 5CVRA 2DPDA 3HOTA 3KLOA 3J81K 1LB2A 4I0AA 2V6CA 2CO5A 3GW2A 3TOBA 1S7AA 3BJ6A 4GO1A 1LDJA 4RAZA 5CVUA 1FSHA 1ZRCA 2WTEA 2UXNA 4IRHA 3GXOA 1YW7A 4M9ZA 2Y75A 3RYPA 5ICEA 5LEKA 3F21A 2QVOA 3WTTC 1B9NA 5E1XA 4EJUA 1XN7A 4M9SA 4ETSA 2HYGD 3HYIA 3BJAA 2OAZA 4S04A 4ZYHA 1XDSA 2PLYA 4P5OA 5CVVA 4PZJA 3I71A 3QP6A 2XAGA 3IWFA 1XSDA 3B73A 4HDUA 3J81Z 1SFEA 2OBPA 4RGUA 1W7PA 4HQEA 2V79A 3ZN0A 3BOQA 5HS9A 1G6NA 1HW1A 3L00A 5HS7A 3D0SA 1XGMA 1TQIA 5FGMA 3IRQA 3JW4A 4P55A 3RPUA 1QNTA 2DK8A 1U6GA 3RKYA 5K5QA 1FBUA 2Z5UA 3COAC 2K4JA 2EK5A 3F3XA 2FBIA 2DK5A 3ABUA 3MQ0A 1UCRA 1ZREA 4WK8F 4BNCA 3G73A 1ULYA 3HOSA 4HDVA 1FYLA 2QZ8A 2Z9OA 4KYWA 2CSOA 1V4RA
chains in the Genus database with same CATH superfamily
1ZLJA 1MNMC 3H3VK 2ZO4A 3S17J 5ICFA 3DEWA 3V7CA 1BR1A 3BY6A 3HBLA 4HSTA 4LJZF 4HX7A 1YOVB 3U9GA 1BIAA 3FXRA 4ESBA 2G9WA 3AAFA 4Y4RA 3TL4X 4ZTFA 1ZR2A 3H9QA 4RBOA 3JTHA 5L3CA 4XL9A 1OR7A 5ICGA 3OYMA 2QWWA 2M2EA 2UZKA 3VYSB 1HKTA 1WH5A 3M3YJ 4JYKA 1LDKB 3P9KA 4DYQA 4AWXB 1TWAJ 2A6TA 2RC4A 4QSHA 3WE3A 4M74A 4FE7A 1O3TA 2AS5F 2LBFA 5C4JJ 5EYRA 4DNCA 1IN6A 2DA1A 2OUMA 3W2WA 4A3GJ 3ZRGA 4M3EA 5AIPA 5GAHJ 2BY2A 4GGGA 4G7ZF 3OYLA 1ON2A 4ON0A 2EH3A 1JTYA 1Z7LA 3V8KA 5HDKA 2KMUA 4A69C 2BGCA 4YIFA 5IY5H 4PK4A 3IH2A 4I02A 4CO8A 3E3VA 4YFXF 4CYDA 4UVAA 3CCJI 2LH9A 1SVLA 4HF2A 2PN6A 4M6VA 3CMMA 4HF1A 1LFUP 1JT6A 4I01A 4EM2A 1P4WA 4RGSA 1JKOC 1JKRC 3A03A 2HKXA 4BU2A 1FIAA 2COMA 1K7AA 4NQWB 1YIOA 1VQ4I 1X3WB 5E8IA 2HQ5A 4S0HB 1S9HA 1PVEA 3FK6A 3H1CA 1IF1A 3WU1B 5HNHA 4FT8A 1G3SA 2XUBA 3I3LA 1V5GA 3DWLE 1NK3P 1UHMA 2LK2A 3J7AO 4QTRA 3OYGA 2HU9A 1XGNA 2VJIA 3IC7A 4ZH4F 2PBIA 3OYHA 3KEQA 3RSNA 3ABLH 4RGRA 3RPUD 5EEGA 2KJBA 1YHQI 1UFMA 2K02A 2X1CA 3OYCA 3FF5A 4D9JA 3F72A 3GTPJ 4KN7X 1O3SA 4IKFA 1PUEE 2DJNA 3Q0VA 4UVCA 5BS6A 5BOXA 2M9HA 3F8NA 2HTSA 2KRHA 2LKSA 1MIJA 5LRSA 5D4RA 2AXLA 2H1KA 4A0YA 2NNNA 2QM3A 1X1DA 2IS4A 5FLXK 1MJ9A 4G12A 4WWCA 1A04A 2I10A 2MLGA 4BDZA 1MBHA 1HKSA 1YLFA 3OYIA 4MO7A 4RM3A 1C0WA 3S2DJ 5KVRA 5CQEA 2VJ4A 5TRDA 1VFCA 4HNTA 2LREA 3KEYA 3LSGA 2PX9A 5HLTA 3N4MA 3PFYA 1A36A 1ZRDA 2IGKA 1BW6A 2L01A 2DT6A 4FE4A 1A31A 1H9GA 1LEAA 3S32A 2XPWA 3FMRA 5L3EA 4DZJA 2LG4A 2RN7A 3K7AJ 5LFAA 5CVJA 3KIOA 4B4CA 1XDUA 1AOYA 3QOEA 3Q0WA 4PFOA 1RR7A 1APLC 4GFBA 3K4LA 1R36A 2QQ8A 1ZYRF 2VBZA 3I59A 2ZJ2A 4IQ4A 2K4BA 5CYVA 3I4MJ 2CH0A 3UR3C 3N05A 4XLFA 4HV6A 2QKMB 2E7XA 4BDYA 2CWEA 3DPLC 4W97A 3EPZA 3K9TA 3TW7A 4AIKA 1H9TA 1T08B 4XLHA 5JHFA 2KLOA 1OYWA 2LR8A 2MBFA 1WVRA 2B7EA 2KL4A 1LQ1A 3CP8A 3GTOJ 3EYIA 3V7RA 1N75A 5H2FC 4LD5A 2A5WA 2R0QC 2ZSHB 3JRHA 4EJOA 1JI8A 5E3MA 1L3LA 1VQ7I 3LMMA 4EM1A 2EB7A 2BHYA 2ZNZA 2HVSA 3RQ4A 2VOPA 2M7BA 3KP2A 5A2QK 5ILSA 2DA5A 4RB0A 3RI4A 3MKLA 5BMZA 5LLQA 4XLNF 2D1HA 3ZMUA 5CQGA 3F0CA 4CGZA 1D1BA 3F6VA 3VWBA 1QHGA 3DP7A 1P9QC 2IA2A 1G3YA 2LMDA 2WY8Q 4Y3OA 4KJZA 1VTNC 4F91B 4I76A 4IHXA 3C1DA 1HSTA 2MA3A 1RPWA 4A3BJ 3SQNA 1I3QJ 3WHBA 5JFRA 4JBAA 3EUHC 1KA8A 2A5YB 2O3FA 1YO5C 5C3EJ 4PJMA 1SMYF 3BCBA 3H9GA 1TC3C 2HDCA 2DA2A 3P9CA 2ZMEA 4BAYA 4C2TA 3G1LA 2D1VA 3KLNA 2H1LA 3ONQA 5DUIA 1DDNA 1D0ZA 2G0EA 2JJ7A 3DTKA 3O6BB 4HW0A 1IJWC 3RZDJ 1TW2A 1WQ2A 2X1EA 2DMUA 3BTIA 3BTLA 4YFKF 2P5KA 5JHUA 3JTGA 3IV5A 1ZRFA 3CUOA 2FQ3A 4C9YA 3NQOA 1OMIA 3S93A 2KFDA 4XK4A 4PSXA 1E17A 2M0MA 4BE0A 3HRSA 2Q1ZB 2PJPA 2AQEA 2HPIA 2DU9A 2HI3A 4Z2YA 4ITVA 4J19A 2R5ZA 1IXCA 1UMQA 3IH4A 1IXRC 2R5YB 4LGWA 3HEFA 2BYVE 4B1RA 2XKOA 4HEA2 4D7NA 1MBGA 5LRRA 3M7GA 3PSIA 3R61A 3VFZA 4FTHA 5K1YA 4XNFA 1MZBA 3NAUA 3SDBA 3HL2A 2Y48A 3QPSA 2MFZA 2IJLA 3K4NA 1K78B 4KIGA 4F93B 5K7FA 3F8MA 2XROA 1HXDA 4BXUA 1B1BA 2ZC2A 3EQLF 4BE1A 1ACIA 5AIQA 3ULQB 1VQOI 1FBSA 1WRJA 3FWEA 3MZ8A 3CO6C 1K79A 1BIBA 5J3LA 5EGOB 4A6DA 4LB5A 3HHGA 3I9V2 1FX7A 2W7NA 1EA3A 5GAGJ 2X4HA 2FF4A 2ZXWH 2LC2A 3S1MJ 2CRGA 3GMEA 2ZCWA 1YRNB 2KRFA 4PJJA 2MD5A 4PSWA 3C3WA 3M9AA 1XPXA 1YE9A 2YUSA 1FTZA 2HYJA 2EBIA 1D1AA 4E7KA 1WJBA 1OISA 1QQIA 1FOYA 2NAZA 2UXXA 1FIPA 2CUFA 4EM0B 4AVPA 3LAPA 4A0ZA 5HNFA 3DKXA 3SEZA 1H0MA 3DLLF 2W84A 3I0TA 4P9UA 1TT0A 3S1NJ 2DMNA 4CCMA 2OQRA 2OC6A 2JVHA 2VN2A 1P6RA 1ENHA 5F64A 3K1MA 4N4OB 2AQFA 1JUMA 4NB5A 1X3UA 4B48A 1S72I 2FQ4A 2FUG2 1DUXC 3H36A 2CQQA 2X51A 3T0YA 3ZR8X 5IP7J 2ID3A 4MEYF 1QA6A 3PJRA 3KE2A 5EG0B 3PM1A 3MKZA 1RUNA 3PIOF 2BV6A 5GPCA 2K7LA 4QPQA 1ETVA 1RKTA 4EV0A 3Q9SA 2GWRA 1R5GA 3K2ZA 1W36D 1JTXA 2IRFG 3OIOA 4E7HA 4C30A 5E3OA 1MDMB 3GZ5A 5E17F 4KUMA 3GZNB 3M8EA 3CUQB 3TQNA 2A68F 1WJDA 2XRNA 3FX3A 2XC7A 1IDYA 3QODA 2VXZA 3GFIA 2WWYA 5KAFC 4OINF 2R7QA 3CDHA 2F4OB 1T0FC 3QOPA 3LNQA 2RNJA 1YYVA 3ISPA 5GAEJ 1J75A 1O3QA 3S16J 2X6YA 2VI6A 3SZGA 2KDOA 1B4AA 1X4OA 2NRAC 4HLYA 3HKZN 4YIRX 1RNLA 2XPUA 4FQGA 4L18B 3KP3A 4HPQA 4BY1J 2OF7A 2KIMA 2Y30A 2YU3A 2RKHA 3C18A 1IUYA 4M9XA 3SZPA 3RTRA 2WC2A 2Z2SB 3QPTA 1XMXA 1Y6IA 5DTDA 3L2CA 2WAEA 3DKYA 5DCFA 2IS2A 4F3QA 2K40A 3QU6A 1X2NA 4BACA 1G8XA 2LRDA 4N9IA 1M1EB 3HHHA 3P5JA 2VUMJ 1FP2A 3H3ZA 3SFIA 1G3TA 2LNBA 5DYMA 1RIOH 1VI0A 2ELJA 3BR2A 4AD9A 2O6GE 2A6HF 2MC3A 2A05A 1ETWA 3E1SA 3WE2A 2BY1A 3JRAA 1OYIA 2M45A 3VB2A 3WODF 5B5EC 5DS9A 4AUXA 2DXIA 4IHWA 3ERMA 1LFPA 1ETKA 4Y52J 4OU0A 3U1DA 5K5OA 2DW4A 2TCTA 4C2UA 1KU9A 1VQMI 4OIPF 4MEXF 1BW5A 4AIHA 3V4GA 2MYSA 4A6EA 2BEOA 2EPFA 2LSOA 2XF7A 4A3FJ 4EVIA 2VLAA 2IA1A 3LSHA 3CTAA 4V2FA 3OS0A 3I4PA 3I64A 4UHTA 2F4MB 4GDFA 1DP3A 1WKMA 2KHMA 3RZOJ 1UZCA 2Z99A 1W5TA 2IVMA 4Q47A 4BE2A 1YX3A 2HOSA 3DF8A 2E2JJ 2YSRA 1X1BA 2DA6A 2M7AA 4BBSJ 4JX5A 2DJIA 1P92A 1BJAA 3GBGA 2EA4A 4RB3C 2W57A 5LGUA 2VL8A 1KYWA 4A3IJ 4UV8A 2ESHA 2BY0A 1JE8A 2Q0OA 1RETA 3QRFF 4UUSB 3CCUI 3K69A 3M1CA 3ERED 3WU0A 5HOOA 1HDPA 3KZYA 1ODDA 4A93J 5FKMA 3WTZA 2VC1A 2VT2A 4O3MA 3DPUA 3BR0A 2WAQN 4Z6YA 2Z3YA 4CYCB 2K5CA 3WTSC 1O4XA 2QQAA 5IP6A 1IN4A 3ZQQA 4FASD 4KDPA 2PI0A 3CCYA 3TMOA 3G4SI 4Y17A 3JAMK 1G2HA 2L54A 3OOPA 3OYAA 2JMWA 5HLIA 2FSWA 4Y15A 4V2GA 4R8HA 1YG2A 1P4XA 3HGYA 2YX7A 2FMYA 1UHWA 3CMEI 3E97A 4HG2A 2PG4A 2IGNA 1O7FA 1WPKA 2ELKA 3Q3SA 2ADUA 2FOKA 2M34A 2V26A 3T8RA 1UB9A 2K9MA 4PCQA 5LHHA 4MTDA 4RAFA 1FT9A 2XASA 3MCZA 4EJWA 1MGTA 4GCVA 4EEFG 5HVQC 3KP6A 4DGWB 4L9TA 4K2EA 3LA2A 3IAM2 1L0OC 4XM3A 3U2RA 3TGNA 4N4NB 3ZGKA 2BW3A 2DLLA 3LFKA 3H5RA 4A3LJ 4FCYA 1Z91A 3I53A 5D6FA 5IOZA 2LY9A 3BZKA 1FWZA 1TWCJ 3BZ6A 3MEXA 4NHJA 1J5YA 3I59B 3BP8A 2HDDA 1P2FA 3KX2A 2WV1A 2XF6A 5D8KB 1RZ4A 3T5XA 2Y31A 3UKGA 2JK3A 3FZVA 1VNDA 1R22A 2W00A 3BQYA 1GXPA 3BG7A 2CW0F 3ZQGA 3L09A 1Q1VA 1B8IA 4A3CJ 1IV8A 2L2OA 3LSTA 4DYRA 3BJOA 2L3DA 1SMTA 4L9VA 1BI0A 4U87A 1ZKGA 3REOA 2DN0A 4XRSG 3E6BA 4XR6A 3G2BA 3U21A 2EFNA 2RAEA 2XGXA 2K85A 1DGWY 3MD2A 1IW7F 2ISZA 2L4MA 3S1RJ 4HNVA 1WFXA 1X1AA 3LSRA 2V1UA 3ZXSA 1R1TA 4IPAA 1K4TA 5ILVA 3DQVC 1BR2A 3GFMA 4U0YA 2CG4A 3VOEA 4DW6A 4BJ5C 5HDNA 2F5DA 5F1RA 2O61A 4YIIA 4PJNA 1BOAA 2L0KA 3E5XA 3RYRA 4KFCA 2XSJC 2CS3A 5H6RA 4CHUA 2CFXA 2VQLA 5C4XJ 1ITYA 2EQRA 4ZYDA 4RB1A 3EETA 2O8XA 2ZFUA 3Q9VA 4MQVA 4BEHB 1HW2A 2ZB9A 1KQ0A 1UG2A 2E2HJ 3HTSB 3NARA 5J1RA 3WHCA 2NVQJ 1I1SA 2HNHA 2FE3A 3CC2I 2JA6J 4I99C 4F7ZA 3PUBA 2M30A 3PL8A 3G71I 5F1JA 1BN5A 2QSFX 3M07A 3MVPA 5IYBJ 3H5NA 2VT3A 2HXIA 3LQQA 4TV7A 2DYRH 3MKYB 1IRFA 3GTJJ 4J01A 5J47A 4H4KC 3QYEA 1XMAA 6PAXA 3ZQFA 4LOCA 4CZZA 3U1KA 2FNAA 3LSMA 5DD4A 4M6XA 2XAHA 5J6XA 1FP1D 3AL0C 5J4VA 2F5FA 1XCBA 4RGXA 1KONA 3WTXC 3HUGA 3TO9A 2XB0X 5J8CA 2VODA 1HA8A 4Y13A 1LVAA 2VPLA 1KU3A 4KITB 3JRGA 1FLIA 1ONVA 4M6YA 4E7SA 4DBQA 1JJ8C 4IOAF 3TDZC 3H0DA 3ZMTA 1FYMA 3DCFA 4GYGA 4A5MA 2V4JC 4Q48A 2A69F 4ENMA 1R5HA 5KNLA 1W0UA 4HBLA 1K83J 2P7VB 3J80K 2ECCA 1T0FA 1S8NA 4XLPF 1K78A 4RAGA 3Q5FA 4UXNA 2P5VA 5B1AH 2PMHA 3CESA 5D8LB 2H8WA 2MABA 3ZMSA 4WF2A 3KZZA 3KP7A 1USSA 3M8JA 4LITA 5ED4A 5E1ZB 5LGTA 3K4KA 5JLXA 1B9MA 4QIWN 1JXSA 2VKHA 2CV1A 1KGSA 1BI3A 4IJAA 1IG7A 2R93J 1DU0A 1DQUA 3OL3A 3BROA 5D5VB 1DPRA 1T38A 1UG0A 1SFXA 3ZMVA 3SEQA 3HC7A 4HF0A 1CF7A 2IBDA 4HOBA 2HPMA 2FU4A 2ZMEC 2PMZN 4XLEA 2O0YA 3ZQHA 4CYCA 4OAZA 5GTIC 3RQIA 4ENNA 3C2GA 1IUFA 3K4MA 2HVRA 2NVTJ 1BC7C 4FETA 2EJRA 1HSJA 2IGOA 2V7FA 3B02A 1T39A 1TNSA 3WGIA 5BNGA 1KQ8A 2H6BA 1I39A 5IT3A 2C6YA 2XHKA 3KYLA 2JTVA 2OD5A 2MD0A 4HX4A 5GPAA 4CCKA 4UUSA 1W4MA 3CP2A 1YW9A 2ZBKA 4CCLA 3I54A 2ZXHA 1ZAOA 5M5WJ 4LFUA 1ORKA 1IN7A 2QBYB 3KP5A 4PGHA 3ROUA 1GXQA 1OCPA 3ABTA 1POGA 4E6KG 2K9QA 1Z9CA 2XSDC 4AYBA 2JRTA 2M3AA 1JKQC 3HOWJ 2DAOA 5H20A 2M87A 4DBRA 2L4AA 4BBRJ 3AG4H 3IWZA 3WU2C 5FLXZ 1WH7A 4BHPA 5K7ZA 3HKZA 2RDPA 1FOWA 2RQQA 4MHGA 4IF4A 2ELHA 1KU2A 2W4SA 2Z1DA 3ZOBA 2LF8A 2IGMA 3LWFA 4L9NA 3D5LA 2CU7A 4PDKA 3A0BC 4KMFA 2L9VA 2B63J 3OIPA 3W3CA 5DM7F 2CQ7A 4LLGF 4C3JJ 1SEUA 5HODA 2K9LA 2XF5A 3CJNA 4G7OF 4OAYA 4A3EJ 2W82A 1Y8RB 1F1ZA 1U8RA 5FRNA 1BR4A 3EUKL 5D5UB 3T1BA 2ESNA 3GF2A 1OYYA 3CMAI 3B6AA 2W24A 1T56A 2HWVA 1HKQA 2DTRA 5L3GA 3L2WA 3CCLI 3K4CA 1FPQA 3K1NA 2Z16A 4XIDA 5FRMA 5D6EA 3HSEA 1MH3A 4IRGA 4RA2A 3ZMZA 1OCOH 2CV2A 3LAJA 1QBJA 2W48A 2NVXJ 1TLHB 5B1BH 2E5NA 1E3HA 2V9PA 4U7BA 3HOZJ 3W6KB 2BY3A 1R4NB 1RUOA 1VQ6I 3MWMA 1SVMA 4U88A 3S15J 4LB6B 4UUTA 1R58A 2YPRA 3J7AY 2UWMA 1ZK8A 5F27A 2LY2A 3CLOA 3QU3A 2VOOA 1TZLA 1TWFJ 2EFWA 1PUFA 1W5CC 2DOEA 3A01B 4E70A 1Y1WJ 5H6QA 1BA5A 2OCCH 3HRMA 2BE5F 2EZIA 4LK0F 1MDMA 3G1OA 2ZJRF 2XIGA 2PMUA 1MMGA 1V55H 3FDYA 3PNTA 5TJJA 4F52A 1K6OA 5JVTA 2EWNA 2DFFA 4G6TB 2EINH 2DFHA 3F8BA 3OV8A 1T8IA 4HA8A 2BHZA 2M8EA 4BHCA 3HSRA 4RB2C 5JI6A 3E0JB 3VPRA 2JUCA 2VBXA 1WI3A 3E6CC 1OCTC 3JRIA 3QPHA 4BQAA 4KT5C 2MH2A 5EJCA 3SHFA 4NC8A 4P9FA 4LMYA 4IHSA 2HQNA 5E79C 2HZDA 4HLXA 2L5QA 4L0ZB 3MZHA 2UUZA 2N8GA 2XAUA 2YX4A 3RDIA 2HQRA 1X3ZB 2E7WA 4CUGA 3ABMH 2KJCA 5J4YA 3J80Z 2TRTA 2R4GA 5DM6F 2P81A 1P7IA 4NBQA 3GTQJ 1NG6A 2ME6A 1WJEA 3L9FA 2VC0A 3IL2A 3I55I 4YRVA 2EFOA 4IHTA 4XN0A 1FZPB 4ZYGA 2KIUA 5J40A 1YW8A 2BZTA 3AG2H 2EFPA 4KMUX 4YG2F 1DU6A 1ZG3A 1EKEA 2RREA 2OJED 2V9KA 2VIXA 4FX0A 1CF7B 3HSFA 1MMAA 3ZQLA 1NG7A 5FO5A 1B72B 1GUUA 1BI1A 2YU9J 4RDUA 5D5WB 3HOYJ 5J8FA 5JVGF 1I1GA 1N78A 1BOBA 5FD6A 2DO7A 3ZPLA 1ZGAA 4ZTJA 2H8RA 3BQZA 4L5IA 1XMKA 1B6AA 3OMYA 3PNVA 4X0GA 2LD5A 3HOUJ 4M3DA 1RESA 2A61A 4LIUA 1WHUA 3BG6A 2EZKA 2Y9YA 2ZJPF 3LSPA 4BJ6C 1VQNI 1IGNA 1LUJB 3R4KA 2JQ7A 1IN5A 4IXAA 3RCOA 3QPLA 4HAMA 1KQ9A 4WXHA 2DMQA 5E20A 2X6WA 3BR1A 3ZN1A 3T8TA 4PGGA 4JQFA 1U3EM 3WTVC 5LHIA 2ZXJA 4EJTA 1KYZA 2M1BA 2LDUA 2NYXA 2YR2A 4D0PA 5KHDA 3TP3A 1YQAA 1SFUA 3K10A 2LY1A 3DBHB 3RPQA 3GLLA 3WTUC 2EIJH 3JSPA 2HEOA 2QLZA 3FMSA 2VKVA 3PIPF 2E2IJ 1ETOA 2XKPA 3A0HC 2F6CA 2FOWA 2OZUA 3FK7A 4BHBA 2HFHA 4W1UA 5FLVA 4XMYA 3DEUA 2O9LA 1YITI 2G7UA 3GFJA 1ZHFA 4JP0A 5FJ8J 1EH6A 2L02A 1BC8C 1DP7P 5LBQA 4FHTA 2DPUA 2WAFA 3FXMA 3CCSI 3D1NI 2E35A 3HZJA 5DDGA 4F92B 1ZARA 1U8BA 2CQNA 4OIOF 3FISA 5KAIC 1LEBA 3OYDA 2HQAA 1XX5A 2Y0MA 1RI7A 2GIZA 3A1YA 4KA4A 2R7WA 2JVGA 2ZSIB 1O57A 2EV5A 1VQ8I 1R7JA 3NRVA 2VB6A 2V6EA 4ZZDA 4ZYEA 2Z33A 1PYVA 3BCAA 1AKHA 1I6XA 4WXCA 2LF7A 1HW5A 1HOMA 3H9JA 1S29A 1R6RA 2BXZA 3CO7C 3HIFA 1MMNA 4DQ2A 1GHCA 5IYDJ 1NTCA 2Q2EB 1U9OA 3GO5A 4IQJA 3KETA 5BPIA 1FOKA 4XKVA 4RLQA 3QAHA 1RR8C 2D5VA 4Q4ZF 5E18F 3AL0B 2BXYA 1SD5A 3L7WA 4WXDA 1FOXA 1PP7U 1W36C 3CF5F 2R7DA 3F22A 2O03A 1Q1HA 1WI9A 4AIJA 1R23A 3KCCA 1QU3A 3LSJA 1D5YA 4XKWA 5HDGA 3JREA 1GDTA 5DD8A 4ZDOA 3ZCOA 2DDBA 3VEPA 1EJ9A 1MKMA 2M4GA 2IA0A 2KP6A 2GBYA 2OQGA 3EYYA 3F6OA 2EIKH 4OIRF 3K70C 2I5UA 1MJBA 3R0JA 2K3FA 4B8XA 3BG9A 3I58A 2X85A 1I6HJ 1Z21A 2PJRA 5D4SA 2W1OA 2DQRA 2VKDA 4EJVA 1VF9A 1SD7A 3OWTA 4MFEA 1RC9A 4ZDPA 2WAQA 3A2KA 3LSKA 3W2VA 5CPRB 2E1CA 1QO0D 3C2BA 5FLMJ 4LIVA 4M71A 2XRLA 2RQPA 3R0AA 3KFWX 2F48A 2Q2EA 3RKQA 4BXFA 3ASNH 2JSPA 1V5EA 4M3FA 2BVLA 4I98B 2F2EA 1OCCH 1HQCA 2DA4A 1T98A 5EZGA 2GOXB 1T33A 4IHVA 4ASNA 3S2WA 4BYYA 1T6SA 1J59A 2RVCA 3X2QH 2PJRB 3WTYC 4BUPA 2R7TA 2KIQA 4RM2A 3FXLA 3GFLA 1B8IB 3FXQA 2J5OA 2R3SA 5HLHA 4NUBA 4L9JA 4I09A 3F23A 1YS7A 2HOTA 5L3FA 4MNUA 3WTWC 1WGXA 3NWSA 1K6YA 1OJLA 2M4KA 3IUOA 1A6QA 3H35A 2EIMH 2M5WA 2GXBA 3M1EA 1MBKA 3F8FA 1FBQA 2FBHA 1MD0A 3ZQIA 2IXSA 3ABKH 3MFKA 3DFGA 2IAIA 4GYIA 2QA4I 2VXDA 3ASOH 3PSFA 3FBNB 4BL0B 2MGQA 3OL4A 5M5XJ 1AA7A 1U78A 3AFHA 4WCGA 1JGSA 3L1PA 4II3A 1X19A 4HSRA 3F9KA 3H5AA 4HX8A 3SFZA 3DKWA 1PJRA 2ACJA 4IX7A 1ZGJA 3PNYA 3VSKA 1IRXA 3GTKJ 2GOMA 1OPCA 1ETYA 3KP4A 1LNWA 5HS8A 3J7ZI 2RGVA 2XPVA 3BTJA 4XORA 4ENKA 1SFOJ 4XOPA 1GV2A 3FM3A 3O3KA 1STZA 1CGPA 3GLXA 2JT1A 3PQKA 4UY8I 2KZVA 2V1DA 1A6IA 5JR3A 1OKRA 1Z6TA 2NS8A 3OY9A 3TBIA 1IZ1A 5ILUA 4I2OA 1D5VA 1TT5B 3C7JA 3OS1A 2RNGA 2X48A 4XSZF 4WX9A 4A3JJ 2H09A 2PQ8A 5C44J 3K4JA 3GZ6A 3GWZA 3JRBA 5LHGA 4UVBA 3S14J 4M3BA 2VBWA 2GQQA 2JA5J 2GAUA 3S8PA 4AYBN 1EV7A 2ISYA 2IPQX 4LG0A 2F5EA 5L3BA 5B3SH 1F5TA 4G9YA 1TQPA 5GTHC 1G3WA 1KZHA 5FKOA 5BQTA 3BTCA 1IO2A 3HTUA 1BI2A 3BLYA 5DUKA 4D7MA 3BWGA 2L9NA 2K9NA 3TP0A 1U5TA 2HKOA 1DPUA 2OZ6A 1YX5A 1HBXG 3RKWA 1BJZA 4OOIA 3FXUA 2D2WA 4JK1X 5F08A 1HDDC 4XONA 5IPAA 1A5JA 1R1VA 1FMVA 2L7FP 4EGZA 1E3OC 1Z7UA 4MFDA 3V42A 1FYKA 2KT0A 2JRMA 1XC5A 1XGOA 3LA3A 1R1UA 4RS8A 3PFIA 2BBYA 3ML6A 4J00A 1D0XA 1IC8A 1QPIA 5D5XB 1D8JA 1OFCX 5ICCA 1GLNA 1IDZA 5E1WA 2J5PA 2DT5A 3ZQCA 3JRFA 4FISA 5TISC 1NHAA 1J09A 3W6JB 1I27A 3CJQB 2QEXI 5J1YA 3BR6A 2K86A 2PMZA 3H3UA 1O3RA 5FFZA 5DEQA 2GZWA 1D8KA 2ZXIA 2HOAA 4YELA 1WJCA 2GA2A 3IKVA 4HYEA 2DT7B 2AHQA 1MJAA 1ETXA 3IP4B 1QZEA 2L9RA 2VBYA 2Y0SN 4HQMA 3CF2A 3MN2A 2HYFA 4CA0A 4C3HJ 2KKOA 3R60A 2M8GX 1E2XA 1ZG5A 4ESFA 2AO9A 4UUVA 2GXGA 3CZ6A 3TW6A 3G3ZA 2EZHA 4IL6C 4F55A 5EG0A 2LYCA 4GXOA 4NDLA 1W0TA 1B59A 1X2MA 2DQLA 3FMQA 2L9SA 3MAJA 3CDIA 4U0VA 3JRDA 1K4SA 4U0WA 5F04A 3P7NA 1VQKI 2DFEA 4XLAA 2CQXA 1HCRA 3H0GJ 1XSVA 1YJWI 3LOCA 4R1HA 3DLAA 3FBIB 4C3IJ 2XVCA 5B66C 5K5RA 4MQ9F 2FXAA 5KK1A 3S3OA 4M72A 4ZJZA 5CJ9A 3SZTA 3OR1C 2X1DA 1VQ5I 1YS6A 2GA1A 2F5VA 3CLQA 1F4KA 2P8TA 3VYTB 2VE8A 3I5UA 4B09A 4LG3A 1F36A 3OYFA 2B0LA 1ZLKA 1XG1A 3DTIA 2P5LC 5CLSA 3KEOA 3DBRB 2V9VA 1H89C 3WG9A 5DCMA 1QVUA 1HF0A 2VONA 1OQYA 2VE9A 1YFHA 1ZQ3P 1IV6A 3DXJF 4CXFA 4EGYA 3FHZA 3AG3H 3BG5A 3RKXA 2HOEA 2HS5A 2KIFA 4CDGA 2TDXA 4MGRA 1IAWA 1XSXA 1VQ9I 1I3AA 3OOUA 2ZNYA 1J2XA 4PJ0C 3O8GA 3TO6A 4ANJA 1A35A 3QP5A 1ZH5A 4JX6A 3CD6I 5CVIA 1PDNC 3K0LA 5FFXA 3HPHA 3OSGA 3K1PA 5CKTA 2NNYA 5DV5A 3TOAA 3KYDB 1DGRM 4B44A 4EATA 1XGSA 3S3MA 5FKLA 1JJ6C 4OWRB 4JOMA 2QBYA 2JA8J 1UJ8A 3ECOA 3IHUA 3PQJA 3TKYA 2JA2A 2NOJB 5EEAA 4A2UA 4BH9A 2FBKA 5LEJA 1FY7A 2XDVA 1ZG1A 4A5NA 5FB2A 4FX4A 1SAUA 2QCOA 2FMLA 3S3NA 5L3DA 2QKLB 2ZMEB 3IAS2 5A2QZ 3IKTA 1TW3A 2OU2A 1OCZH 2RV8A 2XV4S 3SXYA 4G6DA 3GUDA 2LBFB 4A3KJ 2BW3B 1Z05A 4L5EA 1TTYA 4IZZA 2NXNB 2P7CB 3SJMA 1P4AA 3LA7A 1J7KA 1ZTRA 4IHYA 3VODA 1Y56A 2EV6A 4PJLA 3E5QA 4KN4X 3JSOA 1BM9A 3UNGC 2DA3A 1S3JA 1Z1DA 5E3NA 3BPXA 4RAYA 3OIQA 3ELKA 2CMPA 2FRHA 2E71A 3SYTA 4II2A 2M0CA 1LJ9A 4ZYAA 3H92A 3WGHA 1I5ZA 4CSWA 1XD7A 4XKBA 2VJJA 3ZMDA 4Q5SF 3GTMJ 2AXTC 3FM5A 4I7HA 2DDAA 4LLNA 4MTEA 1TWHJ 4XBFA 2DBBA 4DJAA 1SD4A 5E3LA 2W25A 1GVJA 1QVTA 4B47A 2E1MB 2HR3A 4BS9A 4IVNA 4Y7NJ 2R7ZJ 1D0YA 3G1MA 4I0BA 4C2MJ 1SFKA 1Y0NA 2NVUB 3F8CA 3M4OJ 2H27A 3HM5A 2CQKA 4ZZLA 2E1NA 3I4NJ 1S7EA 2IS1A 1U5TC 3PO2J 3FXKA 3O2PE 1YJ9I 1JKPC 1ON1A 3O8HA 2K27A 3BR3A 3DTEA 2QUFA 1E3PA 4QWQA 3V8LA 4H0EA 4G94A 1D3YA 2O7OA 1WSUA 5EEHA 2MW8A 1LDDA 2PFBA 3KYCB 4Y33A 2PEXA 4IOCF 2CW8A 4A12A 3S1QJ 1W7PB 2FNPA 2IW5A 2HZTA 3BT9A 4HNUA 3S2HJ 1X4PA 3JAMZ 2F5CA 3JCUC 2XAJA 5E8GA 4KIBA 4D1QA 1MBJA 4G7HF 5M3MJ 3KPHA 1R49A 4XLCA 1BBYA 1QPMA 5AONA 2XAQA 1X1PA 2O5RA 1TNTA 4BEHA 4XSXF 2MSYA 3IH3A 2LFBA 2QQBA 1Z3XA 2JN6A 4NNJA 4BY7J 3J7YJ 5F0HA 3RJPA 4EMSA 2WV0A 1W1WE 2F4IA 2DYSH 1T2KA 1NH3A 2NS0A 4YFNF 5KCMA 1W7PD 2G7HA 4AC0A 1MSFC 3G6EI 4L5JA 2K3PA 1WJAA 1QGPA 4KIFA 1SD6A 5EF6A 1WCMJ 3ZP5A 2HXOA 4BQQA 1IRZA 1N77A 4X1EA 3BPVA 2KDZA 2VQGA 3ZQ7A 1Y8QB 3Q0UA 3A01A 2HTJA 1UAAA 1WJ5A 4QLCU 1LKXA 4OMYA 3V8JA 3K70D 2I8DA 1SVOA 3JRCA 2ICWG 3VSLA 4E7LA 1QZYA 5FD5A 2X6OA 3K6GA 3P9IA 3FHNA 1MBEA 2DFIA 4OMZA 5BPDA 4CH7A 3GVAA 2GXAA 4QPOA 4LLLA 1JT0A 2V1XA 3BG3A 1YTYA 1MMSA 2CUEA 2HGCA 2FJ1A 1HLVA 1YJNI 1QRYA 1ZN2A 2CJJA 1QHHD 4P1WA 2KZGA 2X9DA 4E7JA 5IYCJ 2L7ZA 1MW7A 2BOLA 2R7SA 1FMWA 2P6SA 3HB9A 3IRRA 4XRFA 3DU5A 3LSIA 5M5YJ 4IO9F 3HDDA 1F43A 5IT9K 2KPMA 5F6FA 1D1CA 2JPCA 3NEUA 5ERIA 4EQQA 1VZ0A 1ZGWA 3CUQA 1R71A 1VQPI 4LK1F 4A0XA 2LKXA 2R7UA 1WWXA 2XGDA 2QQ9A 3PUFA 2D45A 2XGCA 2LKPA 2OA4A 4HRIA 1JHHA 1XB4A 3C2HA 2A3SA 1TQMA 3L2RA 3CQZJ 1OLTA 2DTZA 3W6VA 2Y0SA 1Z77A 2LOOA 3E5UA 1PP8F 3QQAA 1XCVA 2STTA 1P7JA 3N97A 4UNOA 2E60A 2P0WA 3MMYB 3AG1H 4BJTA 2B9SA 2MH9A 1SC7A 3E6MA 1ERDA 3GX4X 4L0YB 4BGDA 1CQTA 2DODA 3CUQC 1V54H 4NQWA 1R4MB 2XAFA 4PUSA 2R7RA 1AU7A 2R5ZB 1FTTA 2A07F 3GCMA 4IRIA 2FA5A 2MLKA 1U2WA 1JGGA 2R7XA 3GEZA 2EV0A 1LVKA 3CJRB 3HOXJ 1GT0C 4N9HA 4B3XA 1IN8A 4KICA 1AKHB 1V3FA 2CFOA 2ECBA 1FNNA 1I50J 4BQNA 2Q8KA 2NOGA 2H94A 4ABZA 3TDUC 3CJTB 3HXLA 1SAXA 5F0CA 3MKWB 1F9NA 3E6DA 2KISA 2WBMA 1WJFA 2NS7A 4A3DJ 5GADJ 1U5TB 5K7HA 1JHFA 1FSEA 1AWCA 3GTLJ 1UELB 2X0LA 3HRUA 3TO7A 3WG7H 2K9SA 4OIQF 4O6JA 5EDNA 4I6ZA 5EGOA 2A6EF 2VJ5A 4S05A 1YIJI 2Y9ZA 2WB1N 2EA2A 4LG0B 3HJEA 4NC7A 5GP9A 1IXSB 4M73A 3RIRA 4DOZA 2Y2ZA 4A3MJ 4E7ZA 1IRGA 2EZLA 4CICA 2JZYA 2NVYJ 1B72A 1EH7A 3VYUB 4B3AA 2DCEA 2P4WA 3LQRA 5FKKA 4ESJA 3PO3J 9ANTA 2MG4A 2ZKZA 1MNEA 2FEZA 2P6TA 2IT0A 1ETQA 1ZR4A 3QWLA 2VPRA 4O5VA 1RRJA 3MZYA 1TWGJ 2OCEA 2GIVA 3DV8A 3HG9A 1MSEC 4XOTA 1FC3A 2DA7A 5IT9Z 3V7SA 2HVQA 1AHDP 4X6AJ 1K61A 4G8XA 2DI3A 2KQRA 1O7LA 2CYYA 3W2AA 1FEXA 1S7OA 2WY7Q 2HDWA 3GYHX 4XQFA 3CDLA 3ECHA 3OSFA 3L2VA 2ETHA 1J9IA 3VDXA 3TEDA 2STWA 4UV9A 2IP2A 2QYOA 5LGNA 4BXXJ 3R6SA 4R79A 4UB8C 2E34A 1X1CA 5EZHA 1WZ2A 4CCJA 2W85A 3M8FA 4HZFA 1V5FA 5HLGA 2EFQA 2XB5A 1U9NA 1W5SA 1R00A 3BDDA 2JWTA 3DPTA 5TGTA 2LLKA 3NWTA 4DIQA 2COBA 3I56I 1LPQA 4M3GA 1Z6RA 1X58A 4P96A 2JPBA 2VQHA 3QYFA 1REPC 5F0FA 2DOFA 1XS9A 3HPGA 1S6LA 1USTA 1S5LC 1Y1VJ 4KNYA 2JSCA 3D5SC 1H88C 2IS6A 4XRSA 1N25A 2DMPA 5FKNA 2JA7J 3FIWA 2DMTA 3VYRB 1G4DA 2ZFWA 4AM3A 2EILH 2CGPA 2KRCA 3EUHA 2OPTA 4D5FA 3CCEI 1OCRH 2CUJA 4G6QA 2R7FA 3OS2A 1YI2I 3EDPA 1TBXA 1Y0UA 1H8AC 3WGGA 4U7DA 2QSHX 1MH4A 5DCMB 1J0RA 4N0BA 1EH8A 4ENJA 2E5ZA 2H6CA 1BL0A 2R7VA 4DYCA 3HRTA 1QZZA 4RLFA 2QENA 3JR9A 3FKIJ 3K4BA 3CCMI 1G59A 1KU7A 1T95A 2QF7A 4HV5A 5CVRA 2DPDA 3HOTA 2LP0A 3GTGJ 3L2QA 3A4CA 3KLOA 2OTLI 4XN3A 3A02A 4DZPA 1OR7C 3HOVJ 2V1NA 3BR5A 4E7IA 3J81K 1LB2A 4I0AA 2V6CA 3KZIC 2CO5A 2Y69H 4GRIA 3GW2A 4D5CA 2E1MC 3TOBA 4PFPA 1Y39A 3L2UA 1S7AA 2E36A 3BJ6A 4GO1A 3SDGA 1LDJA 4RMNA 4AU7A 4RAZA 5CVUA 3CMYA 1FSHA 2UV1A 1ZRCA 5IP9J 2WTEA 3CC7I 4XRMA 2UXNA 4IRHA 2FX0A 3GXOA 1YW7A 4M9ZA 3CC4I 2X6XA 1GV5A 2LVSA 2Y75A 1XTAA 1FJLA 3RYPA 5ICEA 2L7MP 4YEJA 5LEKA 3F21A 1TP4A 1LFBA 2OV7A 2VASA 2QVOA 3D5RC 2R92J 3WTTC 4BKXA 1U0JA 1B9NA 2MC4A 3FXOA 3EUAA 5E1XA 1PUFB 4EJUA 2VQCA 3OYJA 1YRNA 4ZDLA 1XN7A 1MNDA 4M9SA 1ZELA 4ETSA 2CW7A 2VKEA 4JX4A 2GLOA 2ID6A 2HYGD 1EF4A 2OTJI 3HYIA 3BJAA 2L7KA 5IOYA 2FD5A 3CCVI 2QGUA 5J1UA 2OAZA 4S04A 4ZYHA 2CUZA 1XDSA 4BQOA 5LD2C 2PLYA 4CCNA 2WADA 4P5OA 5CVVA 2R5YA 4PZJA 3I71A 3QP6A 3CCRI 1R5ID 1GVDA 2XAGA 2E19A 2QSGX 2XGEA 3IWFA 4MLOA 1XSDA 5JLWA 1Z0XA 3B73A 5M3FJ 4HDUA 3DU6A 3BZCA 3DEEA 3ESWB 2WB1A 3J81Z 2ME0A 4KISA 1SFEA 5FROA 2OBPA 3LL7A 2CV0A 4RGUA 1R9TJ 1W7PA 4HQEA 2V79A 3FKJA 3ZN0A 2R7OA 3BOQA 5HS9A 4XICA 3OYKA 1G6NA 2BVMA 1HW1A 3L00A 5HS7A 2JUGA 3D0SA 3B6CA 4AVZA 4CCOA 1XGMA 3QYBA 1TQIA 2GM4A 5FGMA 3LFUA 3JW4A 3IRQA 4P55A 1SANA 3RPUA 1JUPA 1QNTA 2DK8A 4UB6C 1U6GA 4B43A 3BC8A 2DOAA 1Z3YA 1UHSA 3OR2C 3RKYA 4MIMA 1FBUA 5K5QA 1RKWA 2Z5UA 4ZC3A 3COAC 2LTPA 4IEJA 3OYEA 3FXJA 2K4JA 3K2AA 1NK2P 4XKCA 2EK5A 1LE8B 3HGGA 2IEKA 1Z67A 3F3XA 2FBIA 2YS9A 3E7LA 2E1OA 1LE8A 2DK5A 3ABUA 1VQLI 3DBLB 3CCQI 1MMDA 4E4HA 4NC6A 1E0EA 3MQ0A 4CZCA 1UCRA 1ZREA 4WK8F 4V19K 4BNCA 3AKZA 3G73A 3HUGB 1ULYA 2O8KA 3HOSA 3OYNA 1TL8A 4HDVA 1FYLA 2QZ8A 2Z9OA 2WA0A 4KT6A 2ZJQF 1HC8A 1JUSA 4KYWA 2CSOA 1MBFA 1V4RA 4AIDA 3OYBA
chains in the Genus database with same CATH topology
1ZLJA 2ZO4A 5ICFA 3V7CA 3BY6A 4LJZF 4HX7A 3U9GA 1BIAA 3FXRA 4ESBA 2G9WA 3AAFA 3JTHA 5L3CA 1OR7A 5ICGA 2QWWA 2UZKA 1HKTA 1LDKB 3P9KA 4AWXB 2RC4A 3WE3A 4M74A 1O3TA 2AS5F 4DNCA 1IN6A 5AIPA 4GGGA 4G7ZF 1ON2A 4ON0A 3V8KA 5HDKA 2BGCA 4YIFA 4I02A 4CO8A 3E3VA 4YFXF 4CYDA 4UVAA 4HF2A 2PN6A 4HF1A 4I01A 4EM2A 1P4WA 4RGSA 2HKXA 2COMA 1K7AA 1YIOA 5E8IA 1IF1A 3WU1B 4FT8A 1G3SA 2XUBA 1UHMA 3J7AO 1XGNA 3IC7A 4ZH4F 2PBIA 3KEQA 4RGRA 5EEGA 2KJBA 1UFMA 2K02A 3FF5A 3F72A 4KN7X 1O3SA 1PUEE 4UVCA 5BS6A 5BOXA 3F8NA 2HTSA 5LRSA 5D4RA 2AXLA 4A0YA 2NNNA 2QM3A 5FLXK 1MJ9A 4WWCA 1A04A 2MLGA 1HKSA 1YLFA 1C0WA 5KVRA 5TRDA 3N4MA 1ZRDA 2L01A 1H9GA 1LEAA 3FMRA 5L3EA 2RN7A 5CVJA 1XDUA 1AOYA 1R36A 1ZYRF 2VBZA 3I59A 2ZJ2A 5CYVA 2K4BA 4HV6A 2E7XA 2CWEA 3DPLC 4AIKA 3K9TA 1H9TA 1OYWA 2MBFA 1LQ1A 3EYIA 3V7RA 4LD5A 4EJOA 1L3LA 4EM1A 2EB7A 2ZNZA 2VOPA 3KP2A 5A2QK 5ILSA 4RB0A 3RI4A 5BMZA 5LLQA 4XLNF 2D1HA 3ZMUA 4CGZA 3F6VA 3DP7A 2IA2A 1G3YA 1VTNC 3C1DA 1HSTA 2MA3A 3SQNA 5JFRA 4JBAA 1KA8A 2A5YB 2O3FA 1YO5C 1SMYF 2HDCA 3P9CA 2ZMEA 4BAYA 2D1VA 3KLNA 5DUIA 1DDNA 3O6BB 4HW0A 1TW2A 1WQ2A 4YFKF 2P5KA 5JHUA 3JTGA 1ZRFA 3CUOA 2FQ3A 3NQOA 1OMIA 1E17A 3HRSA 2PJPA 2DU9A 4Z2YA 1IXCA 1IXRC 4LGWA 2BYVE 2XKOA 5LRRA 3M7GA 3R61A 3VFZA 5K1YA 1MZBA 2Y48A 2IJLA 1K78B 4KIGA 3F8MA 2XROA 1HXDA 4BXUA 1B1BA 3EQLF 5AIQA 3ULQB 1FBSA 1WRJA 3FWEA 3CO6C 1K79A 1BIBA 4A6DA 4LB5A 3HHGA 1FX7A 2X4HA 2FF4A 2ZCWA 2KRFA 2MD5A 3C3WA 3M9AA 1QQIA 2NAZA 2UXXA 4EM0B 4AVPA 3LAPA 4A0ZA 1H0MA 2W84A 3I0TA 4P9UA 2OQRA 2VN2A 1P6RA 5F64A 3K1MA 4NB5A 1X3UA 1DUXC 3T0YA 4MEYF 3KE2A 1RUNA 2BV6A 2K7LA 4EV0A 3Q9SA 2GWRA 1R5GA 3K2ZA 2IRFG 1MDMB 3GZ5A 5E17F 4KUMA 3M8EA 3CUQB 3TQNA 2A68F 2XRNA 3FX3A 2WWYA 3GFIA 2VXZA 4OINF 3CDHA 3QOPA 2RNJA 1YYVA 3ISPA 1J75A 1O3QA 1B4AA 2NRAC 4HLYA 1RNLA 4L18B 3KP3A 2KIMA 2YU3A 2RKHA 3C18A 1IUYA 4M9XA 3SZPA 3RTRA 2WC2A 3QPTA 3L2CA 5DCFA 3QU6A 4N9IA 3HHHA 1FP2A 3H3ZA 1G3TA 2LNBA 5DYMA 1RIOH 4AD9A 2O6GE 2A6HF 2MC3A 3WE2A 1OYIA 2M45A 3VB2A 3WODF 4OU0A 3U1DA 5K5OA 2DW4A 1KU9A 4OIPF 4MEXF 4AIHA 3V4GA 4A6EA 2BEOA 2LSOA 4EVIA 2IA1A 3CTAA 3I4PA 3I64A 4UHTA 1WKMA 2Z99A 1W5TA 2IVMA 4Q47A 3DF8A 2YSRA 1P92A 1BJAA 2EA4A 4RB3C 2W57A 5LGUA 1KYWA 4UV8A 2ESHA 1JE8A 2Q0OA 3QRFF 3K69A 3ERED 3WU0A 5HOOA 3KZYA 1ODDA 3WTZA 2VC1A 2VT2A 4O3MA 3WTSC 2Z3YA 2QQAA 1IN4A 4KDPA 2PI0A 4Y17A 3JAMK 2L54A 3OOPA 5HLIA 2FSWA 4Y15A 4R8HA 1YG2A 1P4XA 2YX7A 2FMYA 1UHWA 3E97A 2PG4A 1O7FA 2ADUA 2FOKA 5LHHA 3T8RA 1UB9A 4PCQA 4MTDA 1FT9A 2XASA 3MCZA 4EJWA 1MGTA 4GCVA 5HVQC 3KP6A 4L9TA 4K2EA 3LA2A 1L0OC 3U2RA 3TGNA 2DLLA 3LFKA 1Z91A 3I53A 5D6FA 1FWZA 3MEXA 3BZ6A 4NHJA 1J5YA 3I59B 3BP8A 1P2FA 5D8KB 1RZ4A 3T5XA 1GXPA 3FZVA 1R22A 2CW0F 3L09A 3LSTA 3BJOA 2L3DA 1SMTA 4L9VA 1BI0A 3REOA 3E6BA 2EFNA 2XGXA 1IW7F 2ISZA 2L4MA 2V1UA 1R1TA 4IPAA 5ILVA 3DQVC 3GFMA 4U0YA 2CG4A 3VOEA 5HDNA 2F5DA 5F1RA 2O61A 4YIIA 1BOAA 3E5XA 3RYRA 4KFCA 5H6RA 4CHUA 2CFXA 4ZYDA 4RB1A 3EETA 2O8XA 3Q9VA 4MQVA 1HW2A 1KQ0A 3HTSB 1I1SA 2FE3A 4F7ZA 2M30A 1BN5A 2VT3A 3LQQA 4TV7A 1IRFA 6PAXA 1XMAA 4CZZA 2FNAA 5DD4A 4M6XA 2XAHA 5J6XA 1FP1D 2F5FA 1XCBA 4RGXA 3WTXC 3HUGA 3TO9A 5J8CA 2VODA 4Y13A 1LVAA 1KU3A 1FLIA 1ONVA 4M6YA 3TDZC 3ZMTA 1FYMA 4GYGA 4A5MA 4ENMA 4Q48A 2A69F 1R5HA 4HBLA 2P7VB 3J80K 1T0FA 1S8NA 4XLPF 1K78A 3Q5FA 4UXNA 2P5VA 2PMHA 5D8LB 3ZMSA 4WF2A 3KZZA 3KP7A 1USSA 5ED4A 5E1ZB 5LGTA 1B9MA 1JXSA 1KGSA 1BI3A 4IJAA 3BROA 5D5VB 1DPRA 1T38A 3ZMVA 1SFXA 4HF0A 1CF7A 4HOBA 2FU4A 2O0YA 4ENNA 1BC7C 2EJRA 1HSJA 3B02A 1T39A 1TNSA 3WGIA 1KQ8A 2H6BA 5IT3A 2C6YA 2XHKA 2JTVA 2OD5A 4HX4A 1W4MA 1YW9A 2ZBKA 3I54A 1ZAOA 4LFUA 1IN7A 2QBYB 3KP5A 4PGHA 3ROUA 1GXQA 3ABTA 1Z9CA 2JRTA 2DAOA 5H20A 2M87A 2L4AA 3IWZA 5FLXZ 4BHPA 2RDPA 4MHGA 4IF4A 2ELHA 1KU2A 2LF8A 3LWFA 4L9NA 3D5LA 4PDKA 4KMFA 4LLGF 3CJNA 4G7OF 1U8RA 1F1ZA 5D5UB 3T1BA 2ESNA 3GF2A 1OYYA 2W24A 2HWVA 1HKQA 2DTRA 5L3GA 1FPQA 3K1NA 5D6EA 3HSEA 4IRGA 3ZMZA 3LAJA 1QBJA 1TLHB 4U7BA 3W6KB 1RUOA 3MWMA 4U88A 4LB6B 1R58A 2YPRA 2UWMA 3CLOA 3QU3A 2VOOA 2EFWA 4E70A 5H6QA 3HRMA 2BE5F 4LK0F 1MDMA 2XIGA 2PMUA 1K6OA 5TJJA 5JVTA 2EWNA 3F8BA 3OV8A 4HA8A 2M8EA 4BHCA 3HSRA 4RB2C 5JI6A 2VBXA 3E6CC 3QPHA 4BQAA 4KT5C 2MH2A 3SHFA 4IHSA 4P9FA 4LMYA 2HQNA 4HLXA 4L0ZB 3MZHA 2YX4A 3RDIA 2HQRA 2E7WA 2KJCA 3J80Z 3L9FA 2VC0A 3IL2A 2EFOA 4IHTA 1FZPB 4ZYGA 2KIUA 1YW8A 2EFPA 4KMUX 4YG2F 1ZG3A 4FX0A 1CF7B 3HSFA 5FO5A 1BI1A 5D5WB 5J8FA 1I1GA 5FD6A 2DO7A 3ZPLA 1ZGAA 4L5IA 1XMKA 1B6AA 2A61A 3R4KA 1IN5A 4IXAA 4HAMA 1KQ9A 4WXHA 5E20A 3ZN1A 3T8TA 4PGGA 4JQFA 1U3EM 3WTVC 5LHIA 2ZXJA 4EJTA 1KYZA 2M1BA 2LDUA 2NYXA 2YR2A 4D0PA 1SFUA 1YQAA 3RPQA 3WTUC 3JSPA 2HEOA 2QLZA 3FMSA 2XKPA 2OZUA 4BHBA 2HFHA 3DEUA 2G7UA 3GFJA 1ZHFA 1EH6A 2L02A 1BC8C 1DP7P 5LBQA 4FHTA 2DPUA 5DDGA 1ZARA 4OIOF 1LEBA 2Y0MA 1RI7A 4KA4A 1O57A 2EV5A 1R7JA 3NRVA 4ZZDA 4ZYEA 2Z33A 1I6XA 4WXCA 2LF7A 1HW5A 1S29A 3CO7C 3HIFA 4DQ2A 1GHCA 3GO5A 3KETA 5BPIA 1FOKA 3QAHA 4Q4ZF 5E18F 1SD5A 3L7WA 4WXDA 1PP7U 2R7DA 3F22A 2O03A 1Q1HA 1WI9A 4AIJA 1R23A 3KCCA 5HDGA 5DD8A 3VEPA 1MKMA 2IA0A 2OQGA 3EYYA 3F6OA 4OIRF 1MJBA 3R0JA 4B8XA 3I58A 5D4SA 2DQRA 4EJVA 1SD7A 2E1CA 1QO0D 4M71A 2RQPA 3R0AA 3KFWX 2Q2EA 4I98B 2F2EA 1HQCA 1T98A 4ASNA 3S2WA 4BYYA 1T6SA 1J59A 2RVCA 3WTYC 3GFLA 3FXQA 2J5OA 2R3SA 5HLHA 4L9JA 4I09A 3F23A 1YS7A 5L3FA 4MNUA 3WTWC 2M5WA 2GXBA 3M1EA 3F8FA 1FBQA 2FBHA 1MD0A 3MFKA 3DFGA 4GYIA 1U78A 4WCGA 1JGSA 3SFZA 4HX8A 3DKWA 2ACJA 1ZGJA 1OPCA 3KP4A 1LNWA 5HS8A 2RGVA 4ENKA 3FM3A 3O3KA 1STZA 1CGPA 3GLXA 2JT1A 3PQKA 2V1DA 5JR3A 1OKRA 1Z6TA 1IZ1A 5ILUA 4I2OA 1D5VA 3C7JA 4XSZF 4WX9A 2H09A 2PQ8A 3GZ6A 3GWZA 5LHGA 4UVBA 2VBWA 2GQQA 2GAUA 1EV7A 2ISYA 2IPQX 4LG0A 2F5EA 5L3BA 1F5TA 4G9YA 1TQPA 1G3WA 5BQTA 3HTUA 1BI2A 5DUKA 3BWGA 1U5TA 2HKOA 1DPUA 2OZ6A 1HBXG 3RKWA 4OOIA 3FXUA 2D2WA 4JK1X 1R1VA 4EGZA 1Z7UA 1FYKA 1XGOA 3LA3A 1R1UA 4RS8A 3PFIA 2BBYA 3ML6A 5D5XB 1D8JA 5ICCA 5E1WA 2J5PA 2DT5A 1NHAA 3W6JB 1I27A 2K86A 3H3UA 1O3RA 5FFZA 5DEQA 2GZWA 1D8KA 2GA2A 3IKVA 4HYEA 1MJAA 2VBYA 4HQMA 2HYFA 2KKOA 3R60A 1E2XA 1ZG5A 4ESFA 4UUVA 2GXGA 3G3ZA 4GXOA 1B59A 2DQLA 3FMQA 3MAJA 4U0VA 4U0WA 3P7NA 1XSVA 4R1HA 2XVCA 5K5RA 4MQ9F 2FXAA 5KK1A 4M72A 5CJ9A 3SZTA 1YS6A 2GA1A 1F4KA 2P8TA 2VE8A 3I5UA 4B09A 1ZLKA 2B0LA 2P5LC 5CLSA 3KEOA 2V9VA 3WG9A 5DCMA 2VONA 2VE9A 1YFHA 3DXJF 4CXFA 4EGYA 3FHZA 3RKXA 2HOEA 2HS5A 2KIFA 4CDGA 2TDXA 4MGRA 1IAWA 1XSXA 2ZNYA 1J2XA 3TO6A 1ZH5A 3QP5A 5CVIA 1PDNC 3K0LA 5FFXA 3K1PA 2NNYA 5DV5A 3TOAA 1XGSA 2QBYA 3ECOA 3IHUA 3PQJA 3TKYA 4A2UA 4BH9A 2FBKA 5LEJA 1FY7A 1ZG1A 4A5NA 5FB2A 4FX4A 2FMLA 5L3DA 2ZMEB 5A2QZ 3IKTA 1TW3A 2OU2A 2RV8A 2XV4S 3SXYA 4G6DA 3GUDA 1Z05A 1TTYA 2P7CB 1P4AA 3LA7A 1J7KA 3VODA 2EV6A 3E5QA 4KN4X 3JSOA 1BM9A 1S3JA 1Z1DA 3BPXA 4RAYA 3ELKA 2FRHA 1LJ9A 3H92A 3WGHA 1I5ZA 1XD7A 3ZMDA 4Q5SF 3FM5A 4I7HA 4LLNA 4MTEA 4XBFA 2DBBA 1SD4A 2W25A 1GVJA 2HR3A 4IVNA 4I0BA 3F8CA 2H27A 2CQKA 4ZZLA 2E1NA 1U5TC 3O2PE 1ON1A 2K27A 2QUFA 4QWQA 4H0EA 3V8LA 4G94A 1D3YA 1WSUA 5EEHA 2PFBA 1LDDA 4A12A 2PEXA 1W7PB 2FNPA 2IW5A 2HZTA 3JAMZ 2F5CA 2XAJA 5E8GA 4KIBA 4G7HF 1BBYA 1QPMA 5AONA 2XAQA 1TNTA 4XSXF 2QQBA 3RJPA 4EMSA 2WV0A 1T2KA 2NS0A 4YFNF 1W7PD 2G7HA 4L5JA 1QGPA 4KIFA 1SD6A 3ZP5A 3BPVA 3ZQ7A 2HTJA 4QLCU 4OMYA 3V8JA 1QZYA 5FD5A 3P9IA 2DFIA 4OMZA 5BPDA 3GVAA 4LLLA 2V1XA 1YTYA 2HGCA 1ZN2A 2P6SA 3IRRA 4XRFA 5IT9K 5F6FA 2JPCA 3NEUA 5ERIA 4EQQA 3CUQA 4LK1F 4A0XA 1WWXA 2QQ9A 2D45A 2LKPA 2OA4A 1JHHA 1XB4A 2A3SA 1TQMA 3E5UA 1PP8F 1XCVA 2STTA 3N97A 4UNOA 2MH9A 3E6MA 3GX4X 4L0YB 3CUQC 4NQWA 2XAFA 2A07F 4IRIA 2FA5A 2MLKA 1U2WA 3GEZA 2EV0A 4N9HA 1IN8A 4KICA 1V3FA 1FNNA 2Q8KA 2H94A 3TDUC 1SAXA 1F9NA 3E6DA 1U5TB 1JHFA 1FSEA 1AWCA 2X0LA 3HRUA 3TO7A 4OIQF 4O6JA 2A6EF 4S05A 2EA2A 4LG0B 1IXSB 4M73A 3RIRA 1IRGA 4CICA 2JZYA 1EH7A 2P4WA 3LQRA 4ESJA 2ZKZA 2IT0A 2FEZA 2P6TA 4O5VA 3MZYA 2GIVA 3DV8A 1FC3A 5IT9Z 3V7SA 4G8XA 2DI3A 1O7LA 2CYYA 1S7OA 3GYHX 3ECHA 2ETHA 1J9IA 2STWA 4UV9A 2IP2A 2QYOA 5LGNA 3R6SA 4R79A 2W85A 3M8FA 4HZFA 5HLGA 2EFQA 1W5SA 1R00A 3BDDA 3DPTA 1Z6RA 4P96A 2JPBA 1REPC 1S6LA 1USTA 4KNYA 2JSCA 1G4DA 2ZFWA 2CGPA 3EUHA 4G6QA 2R7FA 3EDPA 1TBXA 1Y0UA 3WGGA 4U7DA 5DCMB 1J0RA 4N0BA 1EH8A 4ENJA 2H6CA 3HRTA 1QZZA 2QENA 1KU7A 4HV5A 5CVRA 2DPDA 3HOTA 3KLOA 3J81K 1LB2A 4I0AA 2V6CA 2CO5A 3GW2A 3TOBA 1S7AA 3BJ6A 4GO1A 1LDJA 4RAZA 5CVUA 1FSHA 1ZRCA 2WTEA 2UXNA 4IRHA 3GXOA 1YW7A 4M9ZA 2Y75A 3RYPA 5ICEA 5LEKA 3F21A 2QVOA 3WTTC 1B9NA 5E1XA 4EJUA 1XN7A 4M9SA 4ETSA 2HYGD 3HYIA 3BJAA 2OAZA 4S04A 4ZYHA 1XDSA 2PLYA 4P5OA 5CVVA 4PZJA 3I71A 3QP6A 2XAGA 3IWFA 1XSDA 3B73A 4HDUA 3J81Z 1SFEA 2OBPA 4RGUA 1W7PA 4HQEA 2V79A 3ZN0A 3BOQA 5HS9A 1G6NA 1HW1A 3L00A 5HS7A 3D0SA 1XGMA 1TQIA 5FGMA 3IRQA 3JW4A 4P55A 3RPUA 1QNTA 2DK8A 1U6GA 3RKYA 5K5QA 1FBUA 2Z5UA 3COAC 2K4JA 2EK5A 3F3XA 2FBIA 2DK5A 3ABUA 3MQ0A 1UCRA 1ZREA 4WK8F 4BNCA 3G73A 1ULYA 3HOSA 4HDVA 1FYLA 2QZ8A 2Z9OA 4KYWA 2CSOA 1V4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLJ A;  2ZO4 A;  5ICF A;  3V7C A;  3BY6 A;  4LJZ F;  4HX7 A;  3U9G A;  1BIA A;  3FXR A;  4ESB A;  2G9W A;  3AAF A;  3JTH A;  5L3C A;  1OR7 A;  5ICG A;  2QWW A;  2UZK A;  1HKT A;  1LDK B;  3P9K A;  4AWX B;  2RC4 A;  3WE3 A;  4M74 A;  1O3T A;  2AS5 F;  4DNC A;  1IN6 A;  5AIP A;  4GGG A;  4G7Z F;  1ON2 A;  4ON0 A;  3V8K A;  5HDK A;  2BGC A;  4YIF A;  4I02 A;  4CO8 A;  3E3V A;  4YFX F;  4CYD A;  4UVA A;  4HF2 A;  2PN6 A;  4HF1 A;  4I01 A;  4EM2 A;  1P4W A;  4RGS A;  2HKX A;  2COM A;  1K7A A;  1YIO A;  5E8I A;  1IF1 A;  3WU1 B;  4FT8 A;  1G3S A;  2XUB A;  1UHM A;  3J7A O;  1XGN A;  3IC7 A;  4ZH4 F;  2PBI A;  3KEQ A;  4RGR A;  5EEG A;  2KJB A;  1UFM A;  2K02 A;  3FF5 A;  3F72 A;  4KN7 X;  1O3S A;  1PUE E;  4UVC A;  5BS6 A;  5BOX A;  3F8N A;  2HTS A;  5LRS A;  5D4R A;  2AXL A;  4A0Y A;  2NNN A;  2QM3 A;  5FLX K;  1MJ9 A;  4WWC A;  1A04 A;  2MLG A;  1HKS A;  1YLF A;  1C0W A;  5KVR A;  5TRD A;  3N4M A;  1ZRD A;  2L01 A;  1H9G A;  1LEA A;  3FMR A;  5L3E A;  2RN7 A;  5CVJ A;  1XDU A;  1AOY A;  1R36 A;  1ZYR F;  2VBZ A;  3I59 A;  2ZJ2 A;  5CYV A;  2K4B A;  4HV6 A;  2E7X A;  2CWE A;  3DPL C;  4AIK A;  3K9T A;  1H9T A;  1OYW A;  2MBF A;  1LQ1 A;  3EYI A;  3V7R A;  4LD5 A;  4EJO A;  1L3L A;  4EM1 A;  2EB7 A;  2ZNZ A;  2VOP A;  3KP2 A;  5A2Q K;  5ILS A;  4RB0 A;  3RI4 A;  5BMZ A;  5LLQ A;  4XLN F;  2D1H A;  3ZMU A;  4CGZ A;  3F6V A;  3DP7 A;  2IA2 A;  1G3Y A;  1VTN C;  3C1D A;  1HST A;  2MA3 A;  3SQN A;  5JFR A;  4JBA A;  1KA8 A;  2A5Y B;  2O3F A;  1YO5 C;  1SMY F;  2HDC A;  3P9C A;  2ZME A;  4BAY A;  2D1V A;  3KLN A;  5DUI A;  1DDN A;  3O6B B;  4HW0 A;  1TW2 A;  1WQ2 A;  4YFK F;  2P5K A;  5JHU A;  3JTG A;  1ZRF A;  3CUO A;  2FQ3 A;  3NQO A;  1OMI A;  1E17 A;  3HRS A;  2PJP A;  2DU9 A;  4Z2Y A;  1IXC A;  1IXR C;  4LGW A;  2BYV E;  2XKO A;  5LRR A;  3M7G A;  3R61 A;  3VFZ A;  5K1Y A;  1MZB A;  2Y48 A;  2IJL A;  1K78 B;  4KIG A;  3F8M A;  2XRO A;  1HXD A;  4BXU A;  1B1B A;  3EQL F;  5AIQ A;  3ULQ B;  1FBS A;  1WRJ A;  3FWE A;  3CO6 C;  1K79 A;  1BIB A;  4A6D A;  4LB5 A;  3HHG A;  1FX7 A;  2X4H A;  2FF4 A;  2ZCW A;  2KRF A;  2MD5 A;  3C3W A;  3M9A A;  1QQI A;  2NAZ A;  2UXX A;  4EM0 B;  4AVP A;  3LAP A;  4A0Z A;  1H0M A;  2W84 A;  3I0T A;  4P9U A;  2OQR A;  2VN2 A;  1P6R A;  5F64 A;  3K1M A;  4NB5 A;  1X3U A;  1DUX C;  3T0Y A;  4MEY F;  3KE2 A;  1RUN A;  2BV6 A;  2K7L A;  4EV0 A;  3Q9S A;  2GWR A;  1R5G A;  3K2Z A;  2IRF G;  1MDM B;  3GZ5 A;  5E17 F;  4KUM A;  3M8E A;  3CUQ B;  3TQN A;  2A68 F;  2XRN A;  3FX3 A;  2WWY A;  3GFI A;  2VXZ A;  4OIN F;  3CDH A;  3QOP A;  2RNJ A;  1YYV A;  3ISP A;  1J75 A;  1O3Q A;  1B4A A;  2NRA C;  4HLY A;  1RNL A;  4L18 B;  3KP3 A;  2KIM A;  2YU3 A;  2RKH A;  3C18 A;  1IUY A;  4M9X A;  3SZP A;  3RTR A;  2WC2 A;  3QPT A;  3L2C A;  5DCF A;  3QU6 A;  4N9I A;  3HHH A;  1FP2 A;  3H3Z A;  1G3T A;  2LNB A;  5DYM A;  1RIO H;  4AD9 A;  2O6G E;  2A6H F;  2MC3 A;  3WE2 A;  1OYI A;  2M45 A;  3VB2 A;  3WOD F;  4OU0 A;  3U1D A;  5K5O A;  2DW4 A;  1KU9 A;  4OIP F;  4MEX F;  4AIH A;  3V4G A;  4A6E A;  2BEO A;  2LSO A;  4EVI A;  2IA1 A;  3CTA A;  3I4P A;  3I64 A;  4UHT A;  1WKM A;  2Z99 A;  1W5T A;  2IVM A;  4Q47 A;  3DF8 A;  2YSR A;  1P92 A;  1BJA A;  2EA4 A;  4RB3 C;  2W57 A;  5LGU A;  1KYW A;  4UV8 A;  2ESH A;  1JE8 A;  2Q0O A;  3QRF F;  3K69 A;  3ERE D;  3WU0 A;  5HOO A;  3KZY A;  1ODD A;  3WTZ A;  2VC1 A;  2VT2 A;  4O3M A;  3WTS C;  2Z3Y A;  2QQA A;  1IN4 A;  4KDP A;  2PI0 A;  4Y17 A;  3JAM K;  2L54 A;  3OOP A;  5HLI A;  2FSW A;  4Y15 A;  4R8H A;  1YG2 A;  1P4X A;  2YX7 A;  2FMY A;  1UHW A;  3E97 A;  2PG4 A;  1O7F A;  2ADU A;  2FOK A;  5LHH A;  3T8R A;  1UB9 A;  4PCQ A;  4MTD A;  1FT9 A;  2XAS A;  3MCZ A;  4EJW A;  1MGT A;  4GCV A;  5HVQ C;  3KP6 A;  4L9T A;  4K2E A;  3LA2 A;  1L0O C;  3U2R A;  3TGN A;  2DLL A;  3LFK A;  1Z91 A;  3I53 A;  5D6F A;  1FWZ A;  3MEX A;  3BZ6 A;  4NHJ A;  1J5Y A;  3I59 B;  3BP8 A;  1P2F A;  5D8K B;  1RZ4 A;  3T5X A;  1GXP A;  3FZV A;  1R22 A;  2CW0 F;  3L09 A;  3LST A;  3BJO A;  2L3D A;  1SMT A;  4L9V A;  1BI0 A;  3REO A;  3E6B A;  2EFN A;  2XGX A;  1IW7 F;  2ISZ A;  2L4M A;  2V1U A;  1R1T A;  4IPA A;  5ILV A;  3DQV C;  3GFM A;  4U0Y A;  2CG4 A;  3VOE A;  5HDN A;  2F5D A;  5F1R A;  2O61 A;  4YII A;  1BOA A;  3E5X A;  3RYR A;  4KFC A;  5H6R A;  4CHU A;  2CFX A;  4ZYD A;  4RB1 A;  3EET A;  2O8X A;  3Q9V A;  4MQV A;  1HW2 A;  1KQ0 A;  3HTS B;  1I1S A;  2FE3 A;  4F7Z A;  2M30 A;  1BN5 A;  2VT3 A;  3LQQ A;  4TV7 A;  1IRF A;  6PAX A;  1XMA A;  4CZZ A;  2FNA A;  5DD4 A;  4M6X A;  2XAH A;  5J6X A;  1FP1 D;  2F5F A;  1XCB A;  4RGX A;  3WTX C;  3HUG A;  3TO9 A;  5J8C A;  2VOD A;  4Y13 A;  1LVA A;  1KU3 A;  1FLI A;  1ONV A;  4M6Y A;  3TDZ C;  3ZMT A;  1FYM A;  4GYG A;  4A5M A;  4ENM A;  4Q48 A;  2A69 F;  1R5H A;  4HBL A;  2P7V B;  3J80 K;  1T0F A;  1S8N A;  4XLP F;  1K78 A;  3Q5F A;  4UXN A;  2P5V A;  2PMH A;  5D8L B;  3ZMS A;  4WF2 A;  3KZZ A;  3KP7 A;  1USS A;  5ED4 A;  5E1Z B;  5LGT A;  1B9M A;  1JXS A;  1KGS A;  1BI3 A;  4IJA A;  3BRO A;  5D5V B;  1DPR A;  1T38 A;  3ZMV A;  1SFX A;  4HF0 A;  1CF7 A;  4HOB A;  2FU4 A;  2O0Y A;  4ENN A;  1BC7 C;  2EJR A;  1HSJ A;  3B02 A;  1T39 A;  1TNS A;  3WGI A;  1KQ8 A;  2H6B A;  5IT3 A;  2C6Y A;  2XHK A;  2JTV A;  2OD5 A;  4HX4 A;  1W4M A;  1YW9 A;  2ZBK A;  3I54 A;  1ZAO A;  4LFU A;  1IN7 A;  2QBY B;  3KP5 A;  4PGH A;  3ROU A;  1GXQ A;  3ABT A;  1Z9C A;  2JRT A;  2DAO A;  5H20 A;  2M87 A;  2L4A A;  3IWZ A;  5FLX Z;  4BHP A;  2RDP A;  4MHG A;  4IF4 A;  2ELH A;  1KU2 A;  2LF8 A;  3LWF A;  4L9N A;  3D5L A;  4PDK A;  4KMF A;  4LLG F;  3CJN A;  4G7O F;  1U8R A;  1F1Z A;  5D5U B;  3T1B A;  2ESN A;  3GF2 A;  1OYY A;  2W24 A;  2HWV A;  1HKQ A;  2DTR A;  5L3G A;  1FPQ A;  3K1N A;  5D6E A;  3HSE A;  4IRG A;  3ZMZ A;  3LAJ A;  1QBJ A;  1TLH B;  4U7B A;  3W6K B;  1RUO A;  3MWM A;  4U88 A;  4LB6 B;  1R58 A;  2YPR A;  2UWM A;  3CLO A;  3QU3 A;  2VOO A;  2EFW A;  4E70 A;  5H6Q A;  3HRM A;  2BE5 F;  4LK0 F;  1MDM A;  2XIG A;  2PMU A;  1K6O A;  5TJJ A;  5JVT A;  2EWN A;  3F8B A;  3OV8 A;  4HA8 A;  2M8E A;  4BHC A;  3HSR A;  4RB2 C;  5JI6 A;  2VBX A;  3E6C C;  3QPH A;  4BQA A;  4KT5 C;  2MH2 A;  3SHF A;  4IHS A;  4P9F A;  4LMY A;  2HQN A;  4HLX A;  4L0Z B;  3MZH A;  2YX4 A;  3RDI A;  2HQR A;  2E7W A;  2KJC A;  3J80 Z;  3L9F A;  2VC0 A;  3IL2 A;  2EFO A;  4IHT A;  1FZP B;  4ZYG A;  2KIU A;  1YW8 A;  2EFP A;  4KMU X;  4YG2 F;  1ZG3 A;  4FX0 A;  1CF7 B;  3HSF A;  5FO5 A;  1BI1 A;  5D5W B;  5J8F A;  1I1G A;  5FD6 A;  2DO7 A;  3ZPL A;  1ZGA A;  4L5I A;  1XMK A;  1B6A A;  2A61 A;  3R4K A;  1IN5 A;  4IXA A;  4HAM A;  1KQ9 A;  4WXH A;  5E20 A;  3ZN1 A;  3T8T A;  4PGG A;  4JQF A;  1U3E M;  3WTV C;  5LHI A;  2ZXJ A;  4EJT A;  1KYZ A;  2M1B A;  2LDU A;  2NYX A;  2YR2 A;  4D0P A;  1SFU A;  1YQA A;  3RPQ A;  3WTU C;  3JSP A;  2HEO A;  2QLZ A;  3FMS A;  2XKP A;  2OZU A;  4BHB A;  2HFH A;  3DEU A;  2G7U A;  3GFJ A;  1ZHF A;  1EH6 A;  2L02 A;  1BC8 C;  1DP7 P;  5LBQ A;  4FHT A;  2DPU A;  5DDG A;  1ZAR A;  4OIO F;  1LEB A;  2Y0M A;  1RI7 A;  4KA4 A;  1O57 A;  2EV5 A;  1R7J A;  3NRV A;  4ZZD A;  4ZYE A;  2Z33 A;  1I6X A;  4WXC A;  2LF7 A;  1HW5 A;  1S29 A;  3CO7 C;  3HIF A;  4DQ2 A;  1GHC A;  3GO5 A;  3KET A;  5BPI A;  1FOK A;  3QAH A;  4Q4Z F;  5E18 F;  1SD5 A;  3L7W A;  4WXD A;  1PP7 U;  2R7D A;  3F22 A;  2O03 A;  1Q1H A;  1WI9 A;  4AIJ A;  1R23 A;  3KCC A;  5HDG A;  5DD8 A;  3VEP A;  1MKM A;  2IA0 A;  2OQG A;  3EYY A;  3F6O A;  4OIR F;  1MJB A;  3R0J A;  4B8X A;  3I58 A;  5D4S A;  2DQR A;  4EJV A;  1SD7 A;  2E1C A;  1QO0 D;  4M71 A;  2RQP A;  3R0A A;  3KFW X;  2Q2E A;  4I98 B;  2F2E A;  1HQC A;  1T98 A;  4ASN A;  3S2W A;  4BYY A;  1T6S A;  1J59 A;  2RVC A;  3WTY C;  3GFL A;  3FXQ A;  2J5O A;  2R3S A;  5HLH A;  4L9J A;  4I09 A;  3F23 A;  1YS7 A;  5L3F A;  4MNU A;  3WTW C;  2M5W A;  2GXB A;  3M1E A;  3F8F A;  1FBQ A;  2FBH A;  1MD0 A;  3MFK A;  3DFG A;  4GYI A;  1U78 A;  4WCG A;  1JGS A;  3SFZ A;  4HX8 A;  3DKW A;  2ACJ A;  1ZGJ A;  1OPC A;  3KP4 A;  1LNW A;  5HS8 A;  2RGV A;  4ENK A;  3FM3 A;  3O3K A;  1STZ A;  1CGP A;  3GLX A;  2JT1 A;  3PQK A;  2V1D A;  5JR3 A;  1OKR A;  1Z6T A;  1IZ1 A;  5ILU A;  4I2O A;  1D5V A;  3C7J A;  4XSZ F;  4WX9 A;  2H09 A;  2PQ8 A;  3GZ6 A;  3GWZ A;  5LHG A;  4UVB A;  2VBW A;  2GQQ A;  2GAU A;  1EV7 A;  2ISY A;  2IPQ X;  4LG0 A;  2F5E A;  5L3B A;  1F5T A;  4G9Y A;  1TQP A;  1G3W A;  5BQT A;  3HTU A;  1BI2 A;  5DUK A;  3BWG A;  1U5T A;  2HKO A;  1DPU A;  2OZ6 A;  1HBX G;  3RKW A;  4OOI A;  3FXU A;  2D2W A;  4JK1 X;  1R1V A;  4EGZ A;  1Z7U A;  1FYK A;  1XGO A;  3LA3 A;  1R1U A;  4RS8 A;  3PFI A;  2BBY A;  3ML6 A;  5D5X B;  1D8J A;  5ICC A;  5E1W A;  2J5P A;  2DT5 A;  1NHA A;  3W6J B;  1I27 A;  2K86 A;  3H3U A;  1O3R A;  5FFZ A;  5DEQ A;  2GZW A;  1D8K A;  2GA2 A;  3IKV A;  4HYE A;  1MJA A;  2VBY A;  4HQM A;  2HYF A;  2KKO A;  3R60 A;  1E2X A;  1ZG5 A;  4ESF A;  4UUV A;  2GXG A;  3G3Z A;  4GXO A;  1B59 A;  2DQL A;  3FMQ A;  3MAJ A;  4U0V A;  4U0W A;  3P7N A;  1XSV A;  4R1H A;  2XVC A;  5K5R A;  4MQ9 F;  2FXA A;  5KK1 A;  4M72 A;  5CJ9 A;  3SZT A;  1YS6 A;  2GA1 A;  1F4K A;  2P8T A;  2VE8 A;  3I5U A;  4B09 A;  1ZLK A;  2B0L A;  2P5L C;  5CLS A;  3KEO A;  2V9V A;  3WG9 A;  5DCM A;  2VON A;  2VE9 A;  1YFH A;  3DXJ F;  4CXF A;  4EGY A;  3FHZ A;  3RKX A;  2HOE A;  2HS5 A;  2KIF A;  4CDG A;  2TDX A;  4MGR A;  1IAW A;  1XSX A;  2ZNY A;  1J2X A;  3TO6 A;  1ZH5 A;  3QP5 A;  5CVI A;  1PDN C;  3K0L A;  5FFX A;  3K1P A;  2NNY A;  5DV5 A;  3TOA A;  1XGS A;  2QBY A;  3ECO A;  3IHU A;  3PQJ A;  3TKY A;  4A2U A;  4BH9 A;  2FBK A;  5LEJ A;  1FY7 A;  1ZG1 A;  4A5N A;  5FB2 A;  4FX4 A;  2FML A;  5L3D A;  2ZME B;  5A2Q Z;  3IKT A;  1TW3 A;  2OU2 A;  2RV8 A;  2XV4 S;  3SXY A;  4G6D A;  3GUD A;  1Z05 A;  1TTY A;  2P7C B;  1P4A A;  3LA7 A;  1J7K A;  3VOD A;  2EV6 A;  3E5Q A;  4KN4 X;  3JSO A;  1BM9 A;  1S3J A;  1Z1D A;  3BPX A;  4RAY A;  3ELK A;  2FRH A;  1LJ9 A;  3H92 A;  3WGH A;  1I5Z A;  1XD7 A;  3ZMD A;  4Q5S F;  3FM5 A;  4I7H A;  4LLN A;  4MTE A;  4XBF A;  2DBB A;  1SD4 A;  2W25 A;  1GVJ A;  2HR3 A;  4IVN A;  4I0B A;  3F8C A;  2H27 A;  2CQK A;  4ZZL A;  2E1N A;  1U5T C;  3O2P E;  1ON1 A;  2K27 A;  2QUF A;  4QWQ A;  4H0E A;  3V8L A;  4G94 A;  1D3Y A;  1WSU A;  5EEH A;  2PFB A;  1LDD A;  4A12 A;  2PEX A;  1W7P B;  2FNP A;  2IW5 A;  2HZT A;  3JAM Z;  2F5C A;  2XAJ A;  5E8G A;  4KIB A;  4G7H F;  1BBY A;  1QPM A;  5AON A;  2XAQ A;  1TNT A;  4XSX F;  2QQB A;  3RJP A;  4EMS A;  2WV0 A;  1T2K A;  2NS0 A;  4YFN F;  1W7P D;  2G7H A;  4L5J A;  1QGP A;  4KIF A;  1SD6 A;  3ZP5 A;  3BPV A;  3ZQ7 A;  2HTJ A;  4QLC U;  4OMY A;  3V8J A;  1QZY A;  5FD5 A;  3P9I A;  2DFI A;  4OMZ A;  5BPD A;  3GVA A;  4LLL A;  2V1X A;  1YTY A;  2HGC A;  1ZN2 A;  2P6S A;  3IRR A;  4XRF A;  5IT9 K;  5F6F A;  2JPC A;  3NEU A;  5ERI A;  4EQQ A;  3CUQ A;  4LK1 F;  4A0X A;  1WWX A;  2QQ9 A;  2D45 A;  2LKP A;  2OA4 A;  1JHH A;  1XB4 A;  2A3S A;  1TQM A;  3E5U A;  1PP8 F;  1XCV A;  2STT A;  3N97 A;  4UNO A;  2MH9 A;  3E6M A;  3GX4 X;  4L0Y B;  3CUQ C;  4NQW A;  2XAF A;  2A07 F;  4IRI A;  2FA5 A;  2MLK A;  1U2W A;  3GEZ A;  2EV0 A;  4N9H A;  1IN8 A;  4KIC A;  1V3F A;  1FNN A;  2Q8K A;  2H94 A;  3TDU C;  1SAX A;  1F9N A;  3E6D A;  1U5T B;  1JHF A;  1FSE A;  1AWC A;  2X0L A;  3HRU A;  3TO7 A;  4OIQ F;  4O6J A;  2A6E F;  4S05 A;  2EA2 A;  4LG0 B;  1IXS B;  4M73 A;  3RIR A;  1IRG A;  4CIC A;  2JZY A;  1EH7 A;  2P4W A;  3LQR A;  4ESJ A;  2ZKZ A;  2IT0 A;  2FEZ A;  2P6T A;  4O5V A;  3MZY A;  2GIV A;  3DV8 A;  1FC3 A;  5IT9 Z;  3V7S A;  4G8X A;  2DI3 A;  1O7L A;  2CYY A;  1S7O A;  3GYH X;  3ECH A;  2ETH A;  1J9I A;  2STW A;  4UV9 A;  2IP2 A;  2QYO A;  5LGN A;  3R6S A;  4R79 A;  2W85 A;  3M8F A;  4HZF A;  5HLG A;  2EFQ A;  1W5S A;  1R00 A;  3BDD A;  3DPT A;  1Z6R A;  4P96 A;  2JPB A;  1REP C;  1S6L A;  1UST A;  4KNY A;  2JSC A;  1G4D A;  2ZFW A;  2CGP A;  3EUH A;  4G6Q A;  2R7F A;  3EDP A;  1TBX A;  1Y0U A;  3WGG A;  4U7D A;  5DCM B;  1J0R A;  4N0B A;  1EH8 A;  4ENJ A;  2H6C A;  3HRT A;  1QZZ A;  2QEN A;  1KU7 A;  4HV5 A;  5CVR A;  2DPD A;  3HOT A;  3KLO A;  3J81 K;  1LB2 A;  4I0A A;  2V6C A;  2CO5 A;  3GW2 A;  3TOB A;  1S7A A;  3BJ6 A;  4GO1 A;  1LDJ A;  4RAZ A;  5CVU A;  1FSH A;  1ZRC A;  2WTE A;  2UXN A;  4IRH A;  3GXO A;  1YW7 A;  4M9Z A;  2Y75 A;  3RYP A;  5ICE A;  5LEK A;  3F21 A;  2QVO A;  3WTT C;  1B9N A;  5E1X A;  4EJU A;  1XN7 A;  4M9S A;  4ETS A;  2HYG D;  3HYI A;  3BJA A;  2OAZ A;  4S04 A;  4ZYH A;  1XDS A;  2PLY A;  4P5O A;  5CVV A;  4PZJ A;  3I71 A;  3QP6 A;  2XAG A;  3IWF A;  1XSD A;  3B73 A;  4HDU A;  3J81 Z;  1SFE A;  2OBP A;  4RGU A;  1W7P A;  4HQE A;  2V79 A;  3ZN0 A;  3BOQ A;  5HS9 A;  1G6N A;  1HW1 A;  3L00 A;  5HS7 A;  3D0S A;  1XGM A;  1TQI A;  5FGM A;  3IRQ A;  3JW4 A;  4P55 A;  3RPU A;  1QNT A;  2DK8 A;  1U6G A;  3RKY A;  5K5Q A;  1FBU A;  2Z5U A;  3COA C;  2K4J A;  2EK5 A;  3F3X A;  2FBI A;  2DK5 A;  3ABU A;  3MQ0 A;  1UCR A;  1ZRE A;  4WK8 F;  4BNC A;  3G73 A;  1ULY A;  3HOS A;  4HDV A;  1FYL A;  2QZ8 A;  2Z9O A;  4KYW A;  2CSO A;  1V4R A; 
#chains in the Genus database with same CATH topology
 1ZLJ A;  1MNM C;  3H3V K;  2ZO4 A;  3S17 J;  5ICF A;  3DEW A;  3V7C A;  1BR1 A;  3BY6 A;  3HBL A;  4HST A;  4LJZ F;  4HX7 A;  1YOV B;  3U9G A;  1BIA A;  3FXR A;  4ESB A;  2G9W A;  3AAF A;  4Y4R A;  3TL4 X;  4ZTF A;  1ZR2 A;  3H9Q A;  4RBO A;  3JTH A;  5L3C A;  4XL9 A;  1OR7 A;  5ICG A;  3OYM A;  2QWW A;  2M2E A;  2UZK A;  3VYS B;  1HKT A;  1WH5 A;  3M3Y J;  4JYK A;  1LDK B;  3P9K A;  4DYQ A;  4AWX B;  1TWA J;  2A6T A;  2RC4 A;  4QSH A;  3WE3 A;  4M74 A;  4FE7 A;  1O3T A;  2AS5 F;  2LBF A;  5C4J J;  5EYR A;  4DNC A;  1IN6 A;  2DA1 A;  2OUM A;  3W2W A;  4A3G J;  3ZRG A;  4M3E A;  5AIP A;  5GAH J;  2BY2 A;  4GGG A;  4G7Z F;  3OYL A;  1ON2 A;  4ON0 A;  2EH3 A;  1JTY A;  1Z7L A;  3V8K A;  5HDK A;  2KMU A;  4A69 C;  2BGC A;  4YIF A;  5IY5 H;  4PK4 A;  3IH2 A;  4I02 A;  4CO8 A;  3E3V A;  4YFX F;  4CYD A;  4UVA A;  3CCJ I;  2LH9 A;  1SVL A;  4HF2 A;  2PN6 A;  4M6V A;  3CMM A;  4HF1 A;  1LFU P;  1JT6 A;  4I01 A;  4EM2 A;  1P4W A;  4RGS A;  1JKO C;  1JKR C;  3A03 A;  2HKX A;  4BU2 A;  1FIA A;  2COM A;  1K7A A;  4NQW B;  1YIO A;  1VQ4 I;  1X3W B;  5E8I A;  2HQ5 A;  4S0H B;  1S9H A;  1PVE A;  3FK6 A;  3H1C A;  1IF1 A;  3WU1 B;  5HNH A;  4FT8 A;  1G3S A;  2XUB A;  3I3L A;  1V5G A;  3DWL E;  1NK3 P;  1UHM A;  2LK2 A;  3J7A O;  4QTR A;  3OYG A;  2HU9 A;  1XGN A;  2VJI A;  3IC7 A;  4ZH4 F;  2PBI A;  3OYH A;  3KEQ A;  3RSN A;  3ABL H;  4RGR A;  3RPU D;  5EEG A;  2KJB A;  1YHQ I;  1UFM A;  2K02 A;  2X1C A;  3OYC A;  3FF5 A;  4D9J A;  3F72 A;  3GTP J;  4KN7 X;  1O3S A;  4IKF A;  1PUE E;  2DJN A;  3Q0V A;  4UVC A;  5BS6 A;  5BOX A;  2M9H A;  3F8N A;  2HTS A;  2KRH A;  2LKS A;  1MIJ A;  5LRS A;  5D4R A;  2AXL A;  2H1K A;  4A0Y A;  2NNN A;  2QM3 A;  1X1D A;  2IS4 A;  5FLX K;  1MJ9 A;  4G12 A;  4WWC A;  1A04 A;  2I10 A;  2MLG A;  4BDZ A;  1MBH A;  1HKS A;  1YLF A;  3OYI A;  4MO7 A;  4RM3 A;  1C0W A;  3S2D J;  5KVR A;  5CQE A;  2VJ4 A;  5TRD A;  1VFC A;  4HNT A;  2LRE A;  3KEY A;  3LSG A;  2PX9 A;  5HLT A;  3N4M A;  3PFY A;  1A36 A;  1ZRD A;  2IGK A;  1BW6 A;  2L01 A;  2DT6 A;  4FE4 A;  1A31 A;  1H9G A;  1LEA A;  3S32 A;  2XPW A;  3FMR A;  5L3E A;  4DZJ A;  2LG4 A;  2RN7 A;  3K7A J;  5LFA A;  5CVJ A;  3KIO A;  4B4C A;  1XDU A;  1AOY A;  3QOE A;  3Q0W A;  4PFO A;  1RR7 A;  1APL C;  4GFB A;  3K4L A;  1R36 A;  2QQ8 A;  1ZYR F;  2VBZ A;  3I59 A;  2ZJ2 A;  4IQ4 A;  2K4B A;  5CYV A;  3I4M J;  2CH0 A;  3UR3 C;  3N05 A;  4XLF A;  4HV6 A;  2QKM B;  2E7X A;  4BDY A;  2CWE A;  3DPL C;  4W97 A;  3EPZ A;  3K9T A;  3TW7 A;  4AIK A;  1H9T A;  1T08 B;  4XLH A;  5JHF A;  2KLO A;  1OYW A;  2LR8 A;  2MBF A;  1WVR A;  2B7E A;  2KL4 A;  1LQ1 A;  3CP8 A;  3GTO J;  3EYI A;  3V7R A;  1N75 A;  5H2F C;  4LD5 A;  2A5W A;  2R0Q C;  2ZSH B;  3JRH A;  4EJO A;  1JI8 A;  5E3M A;  1L3L A;  1VQ7 I;  3LMM A;  4EM1 A;  2EB7 A;  2BHY A;  2ZNZ A;  2HVS A;  3RQ4 A;  2VOP A;  2M7B A;  3KP2 A;  5A2Q K;  5ILS A;  2DA5 A;  4RB0 A;  3RI4 A;  3MKL A;  5BMZ A;  5LLQ A;  4XLN F;  2D1H A;  3ZMU A;  5CQG A;  3F0C A;  4CGZ A;  1D1B A;  3F6V A;  3VWB A;  1QHG A;  3DP7 A;  1P9Q C;  2IA2 A;  1G3Y A;  2LMD A;  2WY8 Q;  4Y3O A;  4KJZ A;  1VTN C;  4F91 B;  4I76 A;  4IHX A;  3C1D A;  1HST A;  2MA3 A;  1RPW A;  4A3B J;  3SQN A;  1I3Q J;  3WHB A;  5JFR A;  4JBA A;  3EUH C;  1KA8 A;  2A5Y B;  2O3F A;  1YO5 C;  5C3E J;  4PJM A;  1SMY F;  3BCB A;  3H9G A;  1TC3 C;  2HDC A;  2DA2 A;  3P9C A;  2ZME A;  4BAY A;  4C2T A;  3G1L A;  2D1V A;  3KLN A;  2H1L A;  3ONQ A;  5DUI A;  1DDN A;  1D0Z A;  2G0E A;  2JJ7 A;  3DTK A;  3O6B B;  4HW0 A;  1IJW C;  3RZD J;  1TW2 A;  1WQ2 A;  2X1E A;  2DMU A;  3BTI A;  3BTL A;  4YFK F;  2P5K A;  5JHU A;  3JTG A;  3IV5 A;  1ZRF A;  3CUO A;  2FQ3 A;  4C9Y A;  3NQO A;  1OMI A;  3S93 A;  2KFD A;  4XK4 A;  4PSX A;  1E17 A;  2M0M A;  4BE0 A;  3HRS A;  2Q1Z B;  2PJP A;  2AQE A;  2HPI A;  2DU9 A;  2HI3 A;  4Z2Y A;  4ITV A;  4J19 A;  2R5Z A;  1IXC A;  1UMQ A;  3IH4 A;  1IXR C;  2R5Y B;  4LGW A;  3HEF A;  2BYV E;  4B1R A;  2XKO A;  4HEA 2;  4D7N A;  1MBG A;  5LRR A;  3M7G A;  3PSI A;  3R61 A;  3VFZ A;  4FTH A;  5K1Y A;  4XNF A;  1MZB A;  3NAU A;  3SDB A;  3HL2 A;  2Y48 A;  3QPS A;  2MFZ A;  2IJL A;  3K4N A;  1K78 B;  4KIG A;  4F93 B;  5K7F A;  3F8M A;  2XRO A;  1HXD A;  4BXU A;  1B1B A;  2ZC2 A;  3EQL F;  4BE1 A;  1ACI A;  5AIQ A;  3ULQ B;  1VQO I;  1FBS A;  1WRJ A;  3FWE A;  3MZ8 A;  3CO6 C;  1K79 A;  1BIB A;  5J3L A;  5EGO B;  4A6D A;  4LB5 A;  3HHG A;  3I9V 2;  1FX7 A;  2W7N A;  1EA3 A;  5GAG J;  2X4H A;  2FF4 A;  2ZXW H;  2LC2 A;  3S1M J;  2CRG A;  3GME A;  2ZCW A;  1YRN B;  2KRF A;  4PJJ A;  2MD5 A;  4PSW A;  3C3W A;  3M9A A;  1XPX A;  1YE9 A;  2YUS A;  1FTZ A;  2HYJ A;  2EBI A;  1D1A A;  4E7K A;  1WJB A;  1OIS A;  1QQI A;  1FOY A;  2NAZ A;  2UXX A;  1FIP A;  2CUF A;  4EM0 B;  4AVP A;  3LAP A;  4A0Z A;  5HNF A;  3DKX A;  3SEZ A;  1H0M A;  3DLL F;  2W84 A;  3I0T A;  4P9U A;  1TT0 A;  3S1N J;  2DMN A;  4CCM A;  2OQR A;  2OC6 A;  2JVH A;  2VN2 A;  1P6R A;  1ENH A;  5F64 A;  3K1M A;  4N4O B;  2AQF A;  1JUM A;  4NB5 A;  1X3U A;  4B48 A;  1S72 I;  2FQ4 A;  2FUG 2;  1DUX C;  3H36 A;  2CQQ A;  2X51 A;  3T0Y A;  3ZR8 X;  5IP7 J;  2ID3 A;  4MEY F;  1QA6 A;  3PJR A;  3KE2 A;  5EG0 B;  3PM1 A;  3MKZ A;  1RUN A;  3PIO F;  2BV6 A;  5GPC A;  2K7L A;  4QPQ A;  1ETV A;  1RKT A;  4EV0 A;  3Q9S A;  2GWR A;  1R5G A;  3K2Z A;  1W36 D;  1JTX A;  2IRF G;  3OIO A;  4E7H A;  4C30 A;  5E3O A;  1MDM B;  3GZ5 A;  5E17 F;  4KUM A;  3GZN B;  3M8E A;  3CUQ B;  3TQN A;  2A68 F;  1WJD A;  2XRN A;  3FX3 A;  2XC7 A;  1IDY A;  3QOD A;  2VXZ A;  3GFI A;  2WWY A;  5KAF C;  4OIN F;  2R7Q A;  3CDH A;  2F4O B;  1T0F C;  3QOP A;  3LNQ A;  2RNJ A;  1YYV A;  3ISP A;  5GAE J;  1J75 A;  1O3Q A;  3S16 J;  2X6Y A;  2VI6 A;  3SZG A;  2KDO A;  1B4A A;  1X4O A;  2NRA C;  4HLY A;  3HKZ N;  4YIR X;  1RNL A;  2XPU A;  4FQG A;  4L18 B;  3KP3 A;  4HPQ A;  4BY1 J;  2OF7 A;  2KIM A;  2Y30 A;  2YU3 A;  2RKH A;  3C18 A;  1IUY A;  4M9X A;  3SZP A;  3RTR A;  2WC2 A;  2Z2S B;  3QPT A;  1XMX A;  1Y6I A;  5DTD A;  3L2C A;  2WAE A;  3DKY A;  5DCF A;  2IS2 A;  4F3Q A;  2K40 A;  3QU6 A;  1X2N A;  4BAC A;  1G8X A;  2LRD A;  4N9I A;  1M1E B;  3HHH A;  3P5J A;  2VUM J;  1FP2 A;  3H3Z A;  3SFI A;  1G3T A;  2LNB A;  5DYM A;  1RIO H;  1VI0 A;  2ELJ A;  3BR2 A;  4AD9 A;  2O6G E;  2A6H F;  2MC3 A;  2A05 A;  1ETW A;  3E1S A;  3WE2 A;  2BY1 A;  3JRA A;  1OYI A;  2M45 A;  3VB2 A;  3WOD F;  5B5E C;  5DS9 A;  4AUX A;  2DXI A;  4IHW A;  3ERM A;  1LFP A;  1ETK A;  4Y52 J;  4OU0 A;  3U1D A;  5K5O A;  2DW4 A;  2TCT A;  4C2U A;  1KU9 A;  1VQM I;  4OIP F;  4MEX F;  1BW5 A;  4AIH A;  3V4G A;  2MYS A;  4A6E A;  2BEO A;  2EPF A;  2LSO A;  2XF7 A;  4A3F J;  4EVI A;  2VLA A;  2IA1 A;  3LSH A;  3CTA A;  4V2F A;  3OS0 A;  3I4P A;  3I64 A;  4UHT A;  2F4M B;  4GDF A;  1DP3 A;  1WKM A;  2KHM A;  3RZO J;  1UZC A;  2Z99 A;  1W5T A;  2IVM A;  4Q47 A;  4BE2 A;  1YX3 A;  2HOS A;  3DF8 A;  2E2J J;  2YSR A;  1X1B A;  2DA6 A;  2M7A A;  4BBS J;  4JX5 A;  2DJI A;  1P92 A;  1BJA A;  3GBG A;  2EA4 A;  4RB3 C;  2W57 A;  5LGU A;  2VL8 A;  1KYW A;  4A3I J;  4UV8 A;  2ESH A;  2BY0 A;  1JE8 A;  2Q0O A;  1RET A;  3QRF F;  4UUS B;  3CCU I;  3K69 A;  3M1C A;  3ERE D;  3WU0 A;  5HOO A;  1HDP A;  3KZY A;  1ODD A;  4A93 J;  5FKM A;  3WTZ A;  2VC1 A;  2VT2 A;  4O3M A;  3DPU A;  3BR0 A;  2WAQ N;  4Z6Y A;  2Z3Y A;  4CYC B;  2K5C A;  3WTS C;  1O4X A;  2QQA A;  5IP6 A;  1IN4 A;  3ZQQ A;  4FAS D;  4KDP A;  2PI0 A;  3CCY A;  3TMO A;  3G4S I;  4Y17 A;  3JAM K;  1G2H A;  2L54 A;  3OOP A;  3OYA A;  2JMW A;  5HLI A;  2FSW A;  4Y15 A;  4V2G A;  4R8H A;  1YG2 A;  1P4X A;  3HGY A;  2YX7 A;  2FMY A;  1UHW A;  3CME I;  3E97 A;  4HG2 A;  2PG4 A;  2IGN A;  1O7F A;  1WPK A;  2ELK A;  3Q3S A;  2ADU A;  2FOK A;  2M34 A;  2V26 A;  3T8R A;  1UB9 A;  2K9M A;  4PCQ A;  5LHH A;  4MTD A;  4RAF A;  1FT9 A;  2XAS A;  3MCZ A;  4EJW A;  1MGT A;  4GCV A;  4EEF G;  5HVQ C;  3KP6 A;  4DGW B;  4L9T A;  4K2E A;  3LA2 A;  3IAM 2;  1L0O C;  4XM3 A;  3U2R A;  3TGN A;  4N4N B;  3ZGK A;  2BW3 A;  2DLL A;  3LFK A;  3H5R A;  4A3L J;  4FCY A;  1Z91 A;  3I53 A;  5D6F A;  5IOZ A;  2LY9 A;  3BZK A;  1FWZ A;  1TWC J;  3BZ6 A;  3MEX A;  4NHJ A;  1J5Y A;  3I59 B;  3BP8 A;  2HDD A;  1P2F A;  3KX2 A;  2WV1 A;  2XF6 A;  5D8K B;  1RZ4 A;  3T5X A;  2Y31 A;  3UKG A;  2JK3 A;  3FZV A;  1VND A;  1R22 A;  2W00 A;  3BQY A;  1GXP A;  3BG7 A;  2CW0 F;  3ZQG A;  3L09 A;  1Q1V A;  1B8I A;  4A3C J;  1IV8 A;  2L2O A;  3LST A;  4DYR A;  3BJO A;  2L3D A;  1SMT A;  4L9V A;  1BI0 A;  4U87 A;  1ZKG A;  3REO A;  2DN0 A;  4XRS G;  3E6B A;  4XR6 A;  3G2B A;  3U21 A;  2EFN A;  2RAE A;  2XGX A;  2K85 A;  1DGW Y;  3MD2 A;  1IW7 F;  2ISZ A;  2L4M A;  3S1R J;  4HNV A;  1WFX A;  1X1A A;  3LSR A;  2V1U A;  3ZXS A;  1R1T A;  4IPA A;  1K4T A;  5ILV A;  3DQV C;  1BR2 A;  3GFM A;  4U0Y A;  2CG4 A;  3VOE A;  4DW6 A;  4BJ5 C;  5HDN A;  2F5D A;  5F1R A;  2O61 A;  4YII A;  4PJN A;  1BOA A;  2L0K A;  3E5X A;  3RYR A;  4KFC A;  2XSJ C;  2CS3 A;  5H6R A;  4CHU A;  2CFX A;  2VQL A;  5C4X J;  1ITY A;  2EQR A;  4ZYD A;  4RB1 A;  3EET A;  2O8X A;  2ZFU A;  3Q9V A;  4MQV A;  4BEH B;  1HW2 A;  2ZB9 A;  1KQ0 A;  1UG2 A;  2E2H J;  3HTS B;  3NAR A;  5J1R A;  3WHC A;  2NVQ J;  1I1S A;  2HNH A;  2FE3 A;  3CC2 I;  2JA6 J;  4I99 C;  4F7Z A;  3PUB A;  2M30 A;  3PL8 A;  3G71 I;  5F1J A;  1BN5 A;  2QSF X;  3M07 A;  3MVP A;  5IYB J;  3H5N A;  2VT3 A;  2HXI A;  3LQQ A;  4TV7 A;  2DYR H;  3MKY B;  1IRF A;  3GTJ J;  4J01 A;  5J47 A;  4H4K C;  3QYE A;  1XMA A;  6PAX A;  3ZQF A;  4LOC A;  4CZZ A;  3U1K A;  2FNA A;  3LSM A;  5DD4 A;  4M6X A;  2XAH A;  5J6X A;  1FP1 D;  3AL0 C;  5J4V A;  2F5F A;  1XCB A;  4RGX A;  1KON A;  3WTX C;  3HUG A;  3TO9 A;  2XB0 X;  5J8C A;  2VOD A;  1HA8 A;  4Y13 A;  1LVA A;  2VPL A;  1KU3 A;  4KIT B;  3JRG A;  1FLI A;  1ONV A;  4M6Y A;  4E7S A;  4DBQ A;  1JJ8 C;  4IOA F;  3TDZ C;  3H0D A;  3ZMT A;  1FYM A;  3DCF A;  4GYG A;  4A5M A;  2V4J C;  4Q48 A;  2A69 F;  4ENM A;  1R5H A;  5KNL A;  1W0U A;  4HBL A;  1K83 J;  2P7V B;  3J80 K;  2ECC A;  1T0F A;  1S8N A;  4XLP F;  1K78 A;  4RAG A;  3Q5F A;  4UXN A;  2P5V A;  5B1A H;  2PMH A;  3CES A;  5D8L B;  2H8W A;  2MAB A;  3ZMS A;  4WF2 A;  3KZZ A;  3KP7 A;  1USS A;  3M8J A;  4LIT A;  5ED4 A;  5E1Z B;  5LGT A;  3K4K A;  5JLX A;  1B9M A;  4QIW N;  1JXS A;  2VKH A;  2CV1 A;  1KGS A;  1BI3 A;  4IJA A;  1IG7 A;  2R93 J;  1DU0 A;  1DQU A;  3OL3 A;  3BRO A;  5D5V B;  1DPR A;  1T38 A;  1UG0 A;  1SFX A;  3ZMV A;  3SEQ A;  3HC7 A;  4HF0 A;  1CF7 A;  2IBD A;  4HOB A;  2HPM A;  2FU4 A;  2ZME C;  2PMZ N;  4XLE A;  2O0Y A;  3ZQH A;  4CYC A;  4OAZ A;  5GTI C;  3RQI A;  4ENN A;  3C2G A;  1IUF A;  3K4M A;  2HVR A;  2NVT J;  1BC7 C;  4FET A;  2EJR A;  1HSJ A;  2IGO A;  2V7F A;  3B02 A;  1T39 A;  1TNS A;  3WGI A;  5BNG A;  1KQ8 A;  2H6B A;  1I39 A;  5IT3 A;  2C6Y A;  2XHK A;  3KYL A;  2JTV A;  2OD5 A;  2MD0 A;  4HX4 A;  5GPA A;  4CCK A;  4UUS A;  1W4M A;  3CP2 A;  1YW9 A;  2ZBK A;  4CCL A;  3I54 A;  2ZXH A;  1ZAO A;  5M5W J;  4LFU A;  1ORK A;  1IN7 A;  2QBY B;  3KP5 A;  4PGH A;  3ROU A;  1GXQ A;  1OCP A;  3ABT A;  1POG A;  4E6K G;  2K9Q A;  1Z9C A;  2XSD C;  4AYB A;  2JRT A;  2M3A A;  1JKQ C;  3HOW J;  2DAO A;  5H20 A;  2M87 A;  4DBR A;  2L4A A;  4BBR J;  3AG4 H;  3IWZ A;  3WU2 C;  5FLX Z;  1WH7 A;  4BHP A;  5K7Z A;  3HKZ A;  2RDP A;  1FOW A;  2RQQ A;  4MHG A;  4IF4 A;  2ELH A;  1KU2 A;  2W4S A;  2Z1D A;  3ZOB A;  2LF8 A;  2IGM A;  3LWF A;  4L9N A;  3D5L A;  2CU7 A;  4PDK A;  3A0B C;  4KMF A;  2L9V A;  2B63 J;  3OIP A;  3W3C A;  5DM7 F;  2CQ7 A;  4LLG F;  4C3J J;  1SEU A;  5HOD A;  2K9L A;  2XF5 A;  3CJN A;  4G7O F;  4OAY A;  4A3E J;  2W82 A;  1Y8R B;  1F1Z A;  1U8R A;  5FRN A;  1BR4 A;  3EUK L;  5D5U B;  3T1B A;  2ESN A;  3GF2 A;  1OYY A;  3CMA I;  3B6A A;  2W24 A;  1T56 A;  2HWV A;  1HKQ A;  2DTR A;  5L3G A;  3L2W A;  3CCL I;  3K4C A;  1FPQ A;  3K1N A;  2Z16 A;  4XID A;  5FRM A;  5D6E A;  3HSE A;  1MH3 A;  4IRG A;  4RA2 A;  3ZMZ A;  1OCO H;  2CV2 A;  3LAJ A;  1QBJ A;  2W48 A;  2NVX J;  1TLH B;  5B1B H;  2E5N A;  1E3H A;  2V9P A;  4U7B A;  3HOZ J;  3W6K B;  2BY3 A;  1R4N B;  1RUO A;  1VQ6 I;  3MWM A;  1SVM A;  4U88 A;  3S15 J;  4LB6 B;  4UUT A;  1R58 A;  2YPR A;  3J7A Y;  2UWM A;  1ZK8 A;  5F27 A;  2LY2 A;  3CLO A;  3QU3 A;  2VOO A;  1TZL A;  1TWF J;  2EFW A;  1PUF A;  1W5C C;  2DOE A;  3A01 B;  4E70 A;  1Y1W J;  5H6Q A;  1BA5 A;  2OCC H;  3HRM A;  2BE5 F;  2EZI A;  4LK0 F;  1MDM A;  3G1O A;  2ZJR F;  2XIG A;  2PMU A;  1MMG A;  1V55 H;  3FDY A;  3PNT A;  5TJJ A;  4F52 A;  1K6O A;  5JVT A;  2EWN A;  2DFF A;  4G6T B;  2EIN H;  2DFH A;  3F8B A;  3OV8 A;  1T8I A;  4HA8 A;  2BHZ A;  2M8E A;  4BHC A;  3HSR A;  4RB2 C;  5JI6 A;  3E0J B;  3VPR A;  2JUC A;  2VBX A;  1WI3 A;  3E6C C;  1OCT C;  3JRI A;  3QPH A;  4BQA A;  4KT5 C;  2MH2 A;  5EJC A;  3SHF A;  4NC8 A;  4P9F A;  4LMY A;  4IHS A;  2HQN A;  5E79 C;  2HZD A;  4HLX A;  2L5Q A;  4L0Z B;  3MZH A;  2UUZ A;  2N8G A;  2XAU A;  2YX4 A;  3RDI A;  2HQR A;  1X3Z B;  2E7W A;  4CUG A;  3ABM H;  2KJC A;  5J4Y A;  3J80 Z;  2TRT A;  2R4G A;  5DM6 F;  2P81 A;  1P7I A;  4NBQ A;  3GTQ J;  1NG6 A;  2ME6 A;  1WJE A;  3L9F A;  2VC0 A;  3IL2 A;  3I55 I;  4YRV A;  2EFO A;  4IHT A;  4XN0 A;  1FZP B;  4ZYG A;  2KIU A;  5J40 A;  1YW8 A;  2BZT A;  3AG2 H;  2EFP A;  4KMU X;  4YG2 F;  1DU6 A;  1ZG3 A;  1EKE A;  2RRE A;  2OJE D;  2V9K A;  2VIX A;  4FX0 A;  1CF7 B;  3HSF A;  1MMA A;  3ZQL A;  1NG7 A;  5FO5 A;  1B72 B;  1GUU A;  1BI1 A;  2YU9 J;  4RDU A;  5D5W B;  3HOY J;  5J8F A;  5JVG F;  1I1G A;  1N78 A;  1BOB A;  5FD6 A;  2DO7 A;  3ZPL A;  1ZGA A;  4ZTJ A;  2H8R A;  3BQZ A;  4L5I A;  1XMK A;  1B6A A;  3OMY A;  3PNV A;  4X0G A;  2LD5 A;  3HOU J;  4M3D A;  1RES A;  2A61 A;  4LIU A;  1WHU A;  3BG6 A;  2EZK A;  2Y9Y A;  2ZJP F;  3LSP A;  4BJ6 C;  1VQN I;  1IGN A;  1LUJ B;  3R4K A;  2JQ7 A;  1IN5 A;  4IXA A;  3RCO A;  3QPL A;  4HAM A;  1KQ9 A;  4WXH A;  2DMQ A;  5E20 A;  2X6W A;  3BR1 A;  3ZN1 A;  3T8T A;  4PGG A;  4JQF A;  1U3E M;  3WTV C;  5LHI A;  2ZXJ A;  4EJT A;  1KYZ A;  2M1B A;  2LDU A;  2NYX A;  2YR2 A;  4D0P A;  5KHD A;  3TP3 A;  1YQA A;  1SFU A;  3K10 A;  2LY1 A;  3DBH B;  3RPQ A;  3GLL A;  3WTU C;  2EIJ H;  3JSP A;  2HEO A;  2QLZ A;  3FMS A;  2VKV A;  3PIP F;  2E2I J;  1ETO A;  2XKP A;  3A0H C;  2F6C A;  2FOW A;  2OZU A;  3FK7 A;  4BHB A;  2HFH A;  4W1U A;  5FLV A;  4XMY A;  3DEU A;  2O9L A;  1YIT I;  2G7U A;  3GFJ A;  1ZHF A;  4JP0 A;  5FJ8 J;  1EH6 A;  2L02 A;  1BC8 C;  1DP7 P;  5LBQ A;  4FHT A;  2DPU A;  2WAF A;  3FXM A;  3CCS I;  3D1N I;  2E35 A;  3HZJ A;  5DDG A;  4F92 B;  1ZAR A;  1U8B A;  2CQN A;  4OIO F;  3FIS A;  5KAI C;  1LEB A;  3OYD A;  2HQA A;  1XX5 A;  2Y0M A;  1RI7 A;  2GIZ A;  3A1Y A;  4KA4 A;  2R7W A;  2JVG A;  2ZSI B;  1O57 A;  2EV5 A;  1VQ8 I;  1R7J A;  3NRV A;  2VB6 A;  2V6E A;  4ZZD A;  4ZYE A;  2Z33 A;  1PYV A;  3BCA A;  1AKH A;  1I6X A;  4WXC A;  2LF7 A;  1HW5 A;  1HOM A;  3H9J A;  1S29 A;  1R6R A;  2BXZ A;  3CO7 C;  3HIF A;  1MMN A;  4DQ2 A;  1GHC A;  5IYD J;  1NTC A;  2Q2E B;  1U9O A;  3GO5 A;  4IQJ A;  3KET A;  5BPI A;  1FOK A;  4XKV A;  4RLQ A;  3QAH A;  1RR8 C;  2D5V A;  4Q4Z F;  5E18 F;  3AL0 B;  2BXY A;  1SD5 A;  3L7W A;  4WXD A;  1FOX A;  1PP7 U;  1W36 C;  3CF5 F;  2R7D A;  3F22 A;  2O03 A;  1Q1H A;  1WI9 A;  4AIJ A;  1R23 A;  3KCC A;  1QU3 A;  3LSJ A;  1D5Y A;  4XKW A;  5HDG A;  3JRE A;  1GDT A;  5DD8 A;  4ZDO A;  3ZCO A;  2DDB A;  3VEP A;  1EJ9 A;  1MKM A;  2M4G A;  2IA0 A;  2KP6 A;  2GBY A;  2OQG A;  3EYY A;  3F6O A;  2EIK H;  4OIR F;  3K70 C;  2I5U A;  1MJB A;  3R0J A;  2K3F A;  4B8X A;  3BG9 A;  3I58 A;  2X85 A;  1I6H J;  1Z21 A;  2PJR A;  5D4S A;  2W1O A;  2DQR A;  2VKD A;  4EJV A;  1VF9 A;  1SD7 A;  3OWT A;  4MFE A;  1RC9 A;  4ZDP A;  2WAQ A;  3A2K A;  3LSK A;  3W2V A;  5CPR B;  2E1C A;  1QO0 D;  3C2B A;  5FLM J;  4LIV A;  4M71 A;  2XRL A;  2RQP A;  3R0A A;  3KFW X;  2F48 A;  2Q2E A;  3RKQ A;  4BXF A;  3ASN H;  2JSP A;  1V5E A;  4M3F A;  2BVL A;  4I98 B;  2F2E A;  1OCC H;  1HQC A;  2DA4 A;  1T98 A;  5EZG A;  2GOX B;  1T33 A;  4IHV A;  4ASN A;  3S2W A;  4BYY A;  1T6S A;  1J59 A;  2RVC A;  3X2Q H;  2PJR B;  3WTY C;  4BUP A;  2R7T A;  2KIQ A;  4RM2 A;  3FXL A;  3GFL A;  1B8I B;  3FXQ A;  2J5O A;  2R3S A;  5HLH A;  4NUB A;  4L9J A;  4I09 A;  3F23 A;  1YS7 A;  2HOT A;  5L3F A;  4MNU A;  3WTW C;  1WGX A;  3NWS A;  1K6Y A;  1OJL A;  2M4K A;  3IUO A;  1A6Q A;  3H35 A;  2EIM H;  2M5W A;  2GXB A;  3M1E A;  1MBK A;  3F8F A;  1FBQ A;  2FBH A;  1MD0 A;  3ZQI A;  2IXS A;  3ABK H;  3MFK A;  3DFG A;  2IAI A;  4GYI A;  2QA4 I;  2VXD A;  3ASO H;  3PSF A;  3FBN B;  4BL0 B;  2MGQ A;  3OL4 A;  5M5X J;  1AA7 A;  1U78 A;  3AFH A;  4WCG A;  1JGS A;  3L1P A;  4II3 A;  1X19 A;  4HSR A;  3F9K A;  3H5A A;  4HX8 A;  3SFZ A;  3DKW A;  1PJR A;  2ACJ A;  4IX7 A;  1ZGJ A;  3PNY A;  3VSK A;  1IRX A;  3GTK J;  2GOM A;  1OPC A;  1ETY A;  3KP4 A;  1LNW A;  5HS8 A;  3J7Z I;  2RGV A;  2XPV A;  3BTJ A;  4XOR A;  4ENK A;  1SFO J;  4XOP A;  1GV2 A;  3FM3 A;  3O3K A;  1STZ A;  1CGP A;  3GLX A;  2JT1 A;  3PQK A;  4UY8 I;  2KZV A;  2V1D A;  1A6I A;  5JR3 A;  1OKR A;  1Z6T A;  2NS8 A;  3OY9 A;  3TBI A;  1IZ1 A;  5ILU A;  4I2O A;  1D5V A;  1TT5 B;  3C7J A;  3OS1 A;  2RNG A;  2X48 A;  4XSZ F;  4WX9 A;  4A3J J;  2H09 A;  2PQ8 A;  5C44 J;  3K4J A;  3GZ6 A;  3GWZ A;  3JRB A;  5LHG A;  4UVB A;  3S14 J;  4M3B A;  2VBW A;  2GQQ A;  2JA5 J;  2GAU A;  3S8P A;  4AYB N;  1EV7 A;  2ISY A;  2IPQ X;  4LG0 A;  2F5E A;  5L3B A;  5B3S H;  1F5T A;  4G9Y A;  1TQP A;  5GTH C;  1G3W A;  1KZH A;  5FKO A;  5BQT A;  3BTC A;  1IO2 A;  3HTU A;  1BI2 A;  3BLY A;  5DUK A;  4D7M A;  3BWG A;  2L9N A;  2K9N A;  3TP0 A;  1U5T A;  2HKO A;  1DPU A;  2OZ6 A;  1YX5 A;  1HBX G;  3RKW A;  1BJZ A;  4OOI A;  3FXU A;  2D2W A;  4JK1 X;  5F08 A;  1HDD C;  4XON A;  5IPA A;  1A5J A;  1R1V A;  1FMV A;  2L7F P;  4EGZ A;  1E3O C;  1Z7U A;  4MFD A;  3V42 A;  1FYK A;  2KT0 A;  2JRM A;  1XC5 A;  1XGO A;  3LA3 A;  1R1U A;  4RS8 A;  3PFI A;  2BBY A;  3ML6 A;  4J00 A;  1D0X A;  1IC8 A;  1QPI A;  5D5X B;  1D8J A;  1OFC X;  5ICC A;  1GLN A;  1IDZ A;  5E1W A;  2J5P A;  2DT5 A;  3ZQC A;  3JRF A;  4FIS A;  5TIS C;  1NHA A;  1J09 A;  3W6J B;  1I27 A;  3CJQ B;  2QEX I;  5J1Y A;  3BR6 A;  2K86 A;  2PMZ A;  3H3U A;  1O3R A;  5FFZ A;  5DEQ A;  2GZW A;  1D8K A;  2ZXI A;  2HOA A;  4YEL A;  1WJC A;  2GA2 A;  3IKV A;  4HYE A;  2DT7 B;  2AHQ A;  1MJA A;  1ETX A;  3IP4 B;  1QZE A;  2L9R A;  2VBY A;  2Y0S N;  4HQM A;  3CF2 A;  3MN2 A;  2HYF A;  4CA0 A;  4C3H J;  2KKO A;  3R60 A;  2M8G X;  1E2X A;  1ZG5 A;  4ESF A;  2AO9 A;  4UUV A;  2GXG A;  3CZ6 A;  3TW6 A;  3G3Z A;  2EZH A;  4IL6 C;  4F55 A;  5EG0 A;  2LYC A;  4GXO A;  4NDL A;  1W0T A;  1B59 A;  1X2M A;  2DQL A;  3FMQ A;  2L9S A;  3MAJ A;  3CDI A;  4U0V A;  3JRD A;  1K4S A;  4U0W A;  5F04 A;  3P7N A;  1VQK I;  2DFE A;  4XLA A;  2CQX A;  1HCR A;  3H0G J;  1XSV A;  1YJW I;  3LOC A;  4R1H A;  3DLA A;  3FBI B;  4C3I J;  2XVC A;  5B66 C;  5K5R A;  4MQ9 F;  2FXA A;  5KK1 A;  3S3O A;  4M72 A;  4ZJZ A;  5CJ9 A;  3SZT A;  3OR1 C;  2X1D A;  1VQ5 I;  1YS6 A;  2GA1 A;  2F5V A;  3CLQ A;  1F4K A;  2P8T A;  3VYT B;  2VE8 A;  3I5U A;  4B09 A;  4LG3 A;  1F36 A;  3OYF A;  2B0L A;  1ZLK A;  1XG1 A;  3DTI A;  2P5L C;  5CLS A;  3KEO A;  3DBR B;  2V9V A;  1H89 C;  3WG9 A;  5DCM A;  1QVU A;  1HF0 A;  2VON A;  1OQY A;  2VE9 A;  1YFH A;  1ZQ3 P;  1IV6 A;  3DXJ F;  4CXF A;  4EGY A;  3FHZ A;  3AG3 H;  3BG5 A;  3RKX A;  2HOE A;  2HS5 A;  2KIF A;  4CDG A;  2TDX A;  4MGR A;  1IAW A;  1XSX A;  1VQ9 I;  1I3A A;  3OOU A;  2ZNY A;  1J2X A;  4PJ0 C;  3O8G A;  3TO6 A;  4ANJ A;  1A35 A;  3QP5 A;  1ZH5 A;  4JX6 A;  3CD6 I;  5CVI A;  1PDN C;  3K0L A;  5FFX A;  3HPH A;  3OSG A;  3K1P A;  5CKT A;  2NNY A;  5DV5 A;  3TOA A;  3KYD B;  1DGR M;  4B44 A;  4EAT A;  1XGS A;  3S3M A;  5FKL A;  1JJ6 C;  4OWR B;  4JOM A;  2QBY A;  2JA8 J;  1UJ8 A;  3ECO A;  3IHU A;  3PQJ A;  3TKY A;  2JA2 A;  2NOJ B;  5EEA A;  4A2U A;  4BH9 A;  2FBK A;  5LEJ A;  1FY7 A;  2XDV A;  1ZG1 A;  4A5N A;  5FB2 A;  4FX4 A;  1SAU A;  2QCO A;  2FML A;  3S3N A;  5L3D A;  2QKL B;  2ZME B;  3IAS 2;  5A2Q Z;  3IKT A;  1TW3 A;  2OU2 A;  1OCZ H;  2RV8 A;  2XV4 S;  3SXY A;  4G6D A;  3GUD A;  2LBF B;  4A3K J;  2BW3 B;  1Z05 A;  4L5E A;  1TTY A;  4IZZ A;  2NXN B;  2P7C B;  3SJM A;  1P4A A;  3LA7 A;  1J7K A;  1ZTR A;  4IHY A;  3VOD A;  1Y56 A;  2EV6 A;  4PJL A;  3E5Q A;  4KN4 X;  3JSO A;  1BM9 A;  3UNG C;  2DA3 A;  1S3J A;  1Z1D A;  5E3N A;  3BPX A;  4RAY A;  3OIQ A;  3ELK A;  2CMP A;  2FRH A;  2E71 A;  3SYT A;  4II2 A;  2M0C A;  1LJ9 A;  4ZYA A;  3H92 A;  3WGH A;  1I5Z A;  4CSW A;  1XD7 A;  4XKB A;  2VJJ A;  3ZMD A;  4Q5S F;  3GTM J;  2AXT C;  3FM5 A;  4I7H A;  2DDA A;  4LLN A;  4MTE A;  1TWH J;  4XBF A;  2DBB A;  4DJA A;  1SD4 A;  5E3L A;  2W25 A;  1GVJ A;  1QVT A;  4B47 A;  2E1M B;  2HR3 A;  4BS9 A;  4IVN A;  4Y7N J;  2R7Z J;  1D0Y A;  3G1M A;  4I0B A;  4C2M J;  1SFK A;  1Y0N A;  2NVU B;  3F8C A;  3M4O J;  2H27 A;  3HM5 A;  2CQK A;  4ZZL A;  2E1N A;  3I4N J;  1S7E A;  2IS1 A;  1U5T C;  3PO2 J;  3FXK A;  3O2P E;  1YJ9 I;  1JKP C;  1ON1 A;  3O8H A;  2K27 A;  3BR3 A;  3DTE A;  2QUF A;  1E3P A;  4QWQ A;  3V8L A;  4H0E A;  4G94 A;  1D3Y A;  2O7O A;  1WSU A;  5EEH A;  2MW8 A;  1LDD A;  2PFB A;  3KYC B;  4Y33 A;  2PEX A;  4IOC F;  2CW8 A;  4A12 A;  3S1Q J;  1W7P B;  2FNP A;  2IW5 A;  2HZT A;  3BT9 A;  4HNU A;  3S2H J;  1X4P A;  3JAM Z;  2F5C A;  3JCU C;  2XAJ A;  5E8G A;  4KIB A;  4D1Q A;  1MBJ A;  4G7H F;  5M3M J;  3KPH A;  1R49 A;  4XLC A;  1BBY A;  1QPM A;  5AON A;  2XAQ A;  1X1P A;  2O5R A;  1TNT A;  4BEH A;  4XSX F;  2MSY A;  3IH3 A;  2LFB A;  2QQB A;  1Z3X A;  2JN6 A;  4NNJ A;  4BY7 J;  3J7Y J;  5F0H A;  3RJP A;  4EMS A;  2WV0 A;  1W1W E;  2F4I A;  2DYS H;  1T2K A;  1NH3 A;  2NS0 A;  4YFN F;  5KCM A;  1W7P D;  2G7H A;  4AC0 A;  1MSF C;  3G6E I;  4L5J A;  2K3P A;  1WJA A;  1QGP A;  4KIF A;  1SD6 A;  5EF6 A;  1WCM J;  3ZP5 A;  2HXO A;  4BQQ A;  1IRZ A;  1N77 A;  4X1E A;  3BPV A;  2KDZ A;  2VQG A;  3ZQ7 A;  1Y8Q B;  3Q0U A;  3A01 A;  2HTJ A;  1UAA A;  1WJ5 A;  4QLC U;  1LKX A;  4OMY A;  3V8J A;  3K70 D;  2I8D A;  1SVO A;  3JRC A;  2ICW G;  3VSL A;  4E7L A;  1QZY A;  5FD5 A;  2X6O A;  3K6G A;  3P9I A;  3FHN A;  1MBE A;  2DFI A;  4OMZ A;  5BPD A;  4CH7 A;  3GVA A;  2GXA A;  4QPO A;  4LLL A;  1JT0 A;  2V1X A;  3BG3 A;  1YTY A;  1MMS A;  2CUE A;  2HGC A;  2FJ1 A;  1HLV A;  1YJN I;  1QRY A;  1ZN2 A;  2CJJ A;  1QHH D;  4P1W A;  2KZG A;  2X9D A;  4E7J A;  5IYC J;  2L7Z A;  1MW7 A;  2BOL A;  2R7S A;  1FMW A;  2P6S A;  3HB9 A;  3IRR A;  4XRF A;  3DU5 A;  3LSI A;  5M5Y J;  4IO9 F;  3HDD A;  1F43 A;  5IT9 K;  2KPM A;  5F6F A;  1D1C A;  2JPC A;  3NEU A;  5ERI A;  4EQQ A;  1VZ0 A;  1ZGW A;  3CUQ A;  1R71 A;  1VQP I;  4LK1 F;  4A0X A;  2LKX A;  2R7U A;  1WWX A;  2XGD A;  2QQ9 A;  3PUF A;  2D45 A;  2XGC A;  2LKP A;  2OA4 A;  4HRI A;  1JHH A;  1XB4 A;  3C2H A;  2A3S A;  1TQM A;  3L2R A;  3CQZ J;  1OLT A;  2DTZ A;  3W6V A;  2Y0S A;  1Z77 A;  2LOO A;  3E5U A;  1PP8 F;  3QQA A;  1XCV A;  2STT A;  1P7J A;  3N97 A;  4UNO A;  2E60 A;  2P0W A;  3MMY B;  3AG1 H;  4BJT A;  2B9S A;  2MH9 A;  1SC7 A;  3E6M A;  1ERD A;  3GX4 X;  4L0Y B;  4BGD A;  1CQT A;  2DOD A;  3CUQ C;  1V54 H;  4NQW A;  1R4M B;  2XAF A;  4PUS A;  2R7R A;  1AU7 A;  2R5Z B;  1FTT A;  2A07 F;  3GCM A;  4IRI A;  2FA5 A;  2MLK A;  1U2W A;  1JGG A;  2R7X A;  3GEZ A;  2EV0 A;  1LVK A;  3CJR B;  3HOX J;  1GT0 C;  4N9H A;  4B3X A;  1IN8 A;  4KIC A;  1AKH B;  1V3F A;  2CFO A;  2ECB A;  1FNN A;  1I50 J;  4BQN A;  2Q8K A;  2NOG A;  2H94 A;  4ABZ A;  3TDU C;  3CJT B;  3HXL A;  1SAX A;  5F0C A;  3MKW B;  1F9N A;  3E6D A;  2KIS A;  2WBM A;  1WJF A;  2NS7 A;  4A3D J;  5GAD J;  1U5T B;  5K7H A;  1JHF A;  1FSE A;  1AWC A;  3GTL J;  1UEL B;  2X0L A;  3HRU A;  3TO7 A;  3WG7 H;  2K9S A;  4OIQ F;  4O6J A;  5EDN A;  4I6Z A;  5EGO A;  2A6E F;  2VJ5 A;  4S05 A;  1YIJ I;  2Y9Z A;  2WB1 N;  2EA2 A;  4LG0 B;  3HJE A;  4NC7 A;  5GP9 A;  1IXS B;  4M73 A;  3RIR A;  4DOZ A;  2Y2Z A;  4A3M J;  4E7Z A;  1IRG A;  2EZL A;  4CIC A;  2JZY A;  2NVY J;  1B72 A;  1EH7 A;  3VYU B;  4B3A A;  2DCE A;  2P4W A;  3LQR A;  5FKK A;  4ESJ A;  3PO3 J;  9ANT A;  2MG4 A;  2ZKZ A;  1MNE A;  2FEZ A;  2P6T A;  2IT0 A;  1ETQ A;  1ZR4 A;  3QWL A;  2VPR A;  4O5V A;  1RRJ A;  3MZY A;  1TWG J;  2OCE A;  2GIV A;  3DV8 A;  3HG9 A;  1MSE C;  4XOT A;  1FC3 A;  2DA7 A;  5IT9 Z;  3V7S A;  2HVQ A;  1AHD P;  4X6A J;  1K61 A;  4G8X A;  2DI3 A;  2KQR A;  1O7L A;  2CYY A;  3W2A A;  1FEX A;  1S7O A;  2WY7 Q;  2HDW A;  3GYH X;  4XQF A;  3CDL A;  3ECH A;  3OSF A;  3L2V A;  2ETH A;  1J9I A;  3VDX A;  3TED A;  2STW A;  4UV9 A;  2IP2 A;  2QYO A;  5LGN A;  4BXX J;  3R6S A;  4R79 A;  4UB8 C;  2E34 A;  1X1C A;  5EZH A;  1WZ2 A;  4CCJ A;  2W85 A;  3M8F A;  4HZF A;  1V5F A;  5HLG A;  2EFQ A;  2XB5 A;  1U9N A;  1W5S A;  1R00 A;  3BDD A;  2JWT A;  3DPT A;  5TGT A;  2LLK A;  3NWT A;  4DIQ A;  2COB A;  3I56 I;  1LPQ A;  4M3G A;  1Z6R A;  1X58 A;  4P96 A;  2JPB A;  2VQH A;  3QYF A;  1REP C;  5F0F A;  2DOF A;  1XS9 A;  3HPG A;  1S6L A;  1UST A;  1S5L C;  1Y1V J;  4KNY A;  2JSC A;  3D5S C;  1H88 C;  2IS6 A;  4XRS A;  1N25 A;  2DMP A;  5FKN A;  2JA7 J;  3FIW A;  2DMT A;  3VYR B;  1G4D A;  2ZFW A;  4AM3 A;  2EIL H;  2CGP A;  2KRC A;  3EUH A;  2OPT A;  4D5F A;  3CCE I;  1OCR H;  2CUJ A;  4G6Q A;  2R7F A;  3OS2 A;  1YI2 I;  3EDP A;  1TBX A;  1Y0U A;  1H8A C;  3WGG A;  4U7D A;  2QSH X;  1MH4 A;  5DCM B;  1J0R A;  4N0B A;  1EH8 A;  4ENJ A;  2E5Z A;  2H6C A;  1BL0 A;  2R7V A;  4DYC A;  3HRT A;  1QZZ A;  4RLF A;  2QEN A;  3JR9 A;  3FKI J;  3K4B A;  3CCM I;  1G59 A;  1KU7 A;  1T95 A;  2QF7 A;  4HV5 A;  5CVR A;  2DPD A;  3HOT A;  2LP0 A;  3GTG J;  3L2Q A;  3A4C A;  3KLO A;  2OTL I;  4XN3 A;  3A02 A;  4DZP A;  1OR7 C;  3HOV J;  2V1N A;  3BR5 A;  4E7I A;  3J81 K;  1LB2 A;  4I0A A;  2V6C A;  3KZI C;  2CO5 A;  2Y69 H;  4GRI A;  3GW2 A;  4D5C A;  2E1M C;  3TOB A;  4PFP A;  1Y39 A;  3L2U A;  1S7A A;  2E36 A;  3BJ6 A;  4GO1 A;  3SDG A;  1LDJ A;  4RMN A;  4AU7 A;  4RAZ A;  5CVU A;  3CMY A;  1FSH A;  2UV1 A;  1ZRC A;  5IP9 J;  2WTE A;  3CC7 I;  4XRM A;  2UXN A;  4IRH A;  2FX0 A;  3GXO A;  1YW7 A;  4M9Z A;  3CC4 I;  2X6X A;  1GV5 A;  2LVS A;  2Y75 A;  1XTA A;  1FJL A;  3RYP A;  5ICE A;  2L7M P;  4YEJ A;  5LEK A;  3F21 A;  1TP4 A;  1LFB A;  2OV7 A;  2VAS A;  2QVO A;  3D5R C;  2R92 J;  3WTT C;  4BKX A;  1U0J A;  1B9N A;  2MC4 A;  3FXO A;  3EUA A;  5E1X A;  1PUF B;  4EJU A;  2VQC A;  3OYJ A;  1YRN A;  4ZDL A;  1XN7 A;  1MND A;  4M9S A;  1ZEL A;  4ETS A;  2CW7 A;  2VKE A;  4JX4 A;  2GLO A;  2ID6 A;  2HYG D;  1EF4 A;  2OTJ I;  3HYI A;  3BJA A;  2L7K A;  5IOY A;  2FD5 A;  3CCV I;  2QGU A;  5J1U A;  2OAZ A;  4S04 A;  4ZYH A;  2CUZ A;  1XDS A;  4BQO A;  5LD2 C;  2PLY A;  4CCN A;  2WAD A;  4P5O A;  5CVV A;  2R5Y A;  4PZJ A;  3I71 A;  3QP6 A;  3CCR I;  1R5I D;  1GVD A;  2XAG A;  2E19 A;  2QSG X;  2XGE A;  3IWF A;  4MLO A;  1XSD A;  5JLW A;  1Z0X A;  3B73 A;  5M3F J;  4HDU A;  3DU6 A;  3BZC A;  3DEE A;  3ESW B;  2WB1 A;  3J81 Z;  2ME0 A;  4KIS A;  1SFE A;  5FRO A;  2OBP A;  3LL7 A;  2CV0 A;  4RGU A;  1R9T J;  1W7P A;  4HQE A;  2V79 A;  3FKJ A;  3ZN0 A;  2R7O A;  3BOQ A;  5HS9 A;  4XIC A;  3OYK A;  1G6N A;  2BVM A;  1HW1 A;  3L00 A;  5HS7 A;  2JUG A;  3D0S A;  3B6C A;  4AVZ A;  4CCO A;  1XGM A;  3QYB A;  1TQI A;  2GM4 A;  5FGM A;  3LFU A;  3JW4 A;  3IRQ A;  4P55 A;  1SAN A;  3RPU A;  1JUP A;  1QNT A;  2DK8 A;  4UB6 C;  1U6G A;  4B43 A;  3BC8 A;  2DOA A;  1Z3Y A;  1UHS A;  3OR2 C;  3RKY A;  4MIM A;  1FBU A;  5K5Q A;  1RKW A;  2Z5U A;  4ZC3 A;  3COA C;  2LTP A;  4IEJ A;  3OYE A;  3FXJ A;  2K4J A;  3K2A A;  1NK2 P;  4XKC A;  2EK5 A;  1LE8 B;  3HGG A;  2IEK A;  1Z67 A;  3F3X A;  2FBI A;  2YS9 A;  3E7L A;  2E1O A;  1LE8 A;  2DK5 A;  3ABU A;  1VQL I;  3DBL B;  3CCQ I;  1MMD A;  4E4H A;  4NC6 A;  1E0E A;  3MQ0 A;  4CZC A;  1UCR A;  1ZRE A;  4WK8 F;  4V19 K;  4BNC A;  3AKZ A;  3G73 A;  3HUG B;  1ULY A;  2O8K A;  3HOS A;  3OYN A;  1TL8 A;  4HDV A;  1FYL A;  2QZ8 A;  2Z9O A;  2WA0 A;  4KT6 A;  2ZJQ F;  1HC8 A;  1JUS A;  4KYW A;  2CSO A;  1MBF A;  1V4R A;  4AID A;  3OYB A; 
#chains in the Genus database with same CATH homology
 1ZLJ A;  2ZO4 A;  5ICF A;  3V7C A;  3BY6 A;  4LJZ F;  4HX7 A;  3U9G A;  1BIA A;  3FXR A;  4ESB A;  2G9W A;  3AAF A;  3JTH A;  5L3C A;  1OR7 A;  5ICG A;  2QWW A;  2UZK A;  1HKT A;  1LDK B;  3P9K A;  4AWX B;  2RC4 A;  3WE3 A;  4M74 A;  1O3T A;  2AS5 F;  4DNC A;  1IN6 A;  5AIP A;  4GGG A;  4G7Z F;  1ON2 A;  4ON0 A;  3V8K A;  5HDK A;  2BGC A;  4YIF A;  4I02 A;  4CO8 A;  3E3V A;  4YFX F;  4CYD A;  4UVA A;  4HF2 A;  2PN6 A;  4HF1 A;  4I01 A;  4EM2 A;  1P4W A;  4RGS A;  2HKX A;  2COM A;  1K7A A;  1YIO A;  5E8I A;  1IF1 A;  3WU1 B;  4FT8 A;  1G3S A;  2XUB A;  1UHM A;  3J7A O;  1XGN A;  3IC7 A;  4ZH4 F;  2PBI A;  3KEQ A;  4RGR A;  5EEG A;  2KJB A;  1UFM A;  2K02 A;  3FF5 A;  3F72 A;  4KN7 X;  1O3S A;  1PUE E;  4UVC A;  5BS6 A;  5BOX A;  3F8N A;  2HTS A;  5LRS A;  5D4R A;  2AXL A;  4A0Y A;  2NNN A;  2QM3 A;  5FLX K;  1MJ9 A;  4WWC A;  1A04 A;  2MLG A;  1HKS A;  1YLF A;  1C0W A;  5KVR A;  5TRD A;  3N4M A;  1ZRD A;  2L01 A;  1H9G A;  1LEA A;  3FMR A;  5L3E A;  2RN7 A;  5CVJ A;  1XDU A;  1AOY A;  1R36 A;  1ZYR F;  2VBZ A;  3I59 A;  2ZJ2 A;  5CYV A;  2K4B A;  4HV6 A;  2E7X A;  2CWE A;  3DPL C;  4AIK A;  3K9T A;  1H9T A;  1OYW A;  2MBF A;  1LQ1 A;  3EYI A;  3V7R A;  4LD5 A;  4EJO A;  1L3L A;  4EM1 A;  2EB7 A;  2ZNZ A;  2VOP A;  3KP2 A;  5A2Q K;  5ILS A;  4RB0 A;  3RI4 A;  5BMZ A;  5LLQ A;  4XLN F;  2D1H A;  3ZMU A;  4CGZ A;  3F6V A;  3DP7 A;  2IA2 A;  1G3Y A;  1VTN C;  3C1D A;  1HST A;  2MA3 A;  3SQN A;  5JFR A;  4JBA A;  1KA8 A;  2A5Y B;  2O3F A;  1YO5 C;  1SMY F;  2HDC A;  3P9C A;  2ZME A;  4BAY A;  2D1V A;  3KLN A;  5DUI A;  1DDN A;  3O6B B;  4HW0 A;  1TW2 A;  1WQ2 A;  4YFK F;  2P5K A;  5JHU A;  3JTG A;  1ZRF A;  3CUO A;  2FQ3 A;  3NQO A;  1OMI A;  1E17 A;  3HRS A;  2PJP A;  2DU9 A;  4Z2Y A;  1IXC A;  1IXR C;  4LGW A;  2BYV E;  2XKO A;  5LRR A;  3M7G A;  3R61 A;  3VFZ A;  5K1Y A;  1MZB A;  2Y48 A;  2IJL A;  1K78 B;  4KIG A;  3F8M A;  2XRO A;  1HXD A;  4BXU A;  1B1B A;  3EQL F;  5AIQ A;  3ULQ B;  1FBS A;  1WRJ A;  3FWE A;  3CO6 C;  1K79 A;  1BIB A;  4A6D A;  4LB5 A;  3HHG A;  1FX7 A;  2X4H A;  2FF4 A;  2ZCW A;  2KRF A;  2MD5 A;  3C3W A;  3M9A A;  1QQI A;  2NAZ A;  2UXX A;  4EM0 B;  4AVP A;  3LAP A;  4A0Z A;  1H0M A;  2W84 A;  3I0T A;  4P9U A;  2OQR A;  2VN2 A;  1P6R A;  5F64 A;  3K1M A;  4NB5 A;  1X3U A;  1DUX C;  3T0Y A;  4MEY F;  3KE2 A;  1RUN A;  2BV6 A;  2K7L A;  4EV0 A;  3Q9S A;  2GWR A;  1R5G A;  3K2Z A;  2IRF G;  1MDM B;  3GZ5 A;  5E17 F;  4KUM A;  3M8E A;  3CUQ B;  3TQN A;  2A68 F;  2XRN A;  3FX3 A;  2WWY A;  3GFI A;  2VXZ A;  4OIN F;  3CDH A;  3QOP A;  2RNJ A;  1YYV A;  3ISP A;  1J75 A;  1O3Q A;  1B4A A;  2NRA C;  4HLY A;  1RNL A;  4L18 B;  3KP3 A;  2KIM A;  2YU3 A;  2RKH A;  3C18 A;  1IUY A;  4M9X A;  3SZP A;  3RTR A;  2WC2 A;  3QPT A;  3L2C A;  5DCF A;  3QU6 A;  4N9I A;  3HHH A;  1FP2 A;  3H3Z A;  1G3T A;  2LNB A;  5DYM A;  1RIO H;  4AD9 A;  2O6G E;  2A6H F;  2MC3 A;  3WE2 A;  1OYI A;  2M45 A;  3VB2 A;  3WOD F;  4OU0 A;  3U1D A;  5K5O A;  2DW4 A;  1KU9 A;  4OIP F;  4MEX F;  4AIH A;  3V4G A;  4A6E A;  2BEO A;  2LSO A;  4EVI A;  2IA1 A;  3CTA A;  3I4P A;  3I64 A;  4UHT A;  1WKM A;  2Z99 A;  1W5T A;  2IVM A;  4Q47 A;  3DF8 A;  2YSR A;  1P92 A;  1BJA A;  2EA4 A;  4RB3 C;  2W57 A;  5LGU A;  1KYW A;  4UV8 A;  2ESH A;  1JE8 A;  2Q0O A;  3QRF F;  3K69 A;  3ERE D;  3WU0 A;  5HOO A;  3KZY A;  1ODD A;  3WTZ A;  2VC1 A;  2VT2 A;  4O3M A;  3WTS C;  2Z3Y A;  2QQA A;  1IN4 A;  4KDP A;  2PI0 A;  4Y17 A;  3JAM K;  2L54 A;  3OOP A;  5HLI A;  2FSW A;  4Y15 A;  4R8H A;  1YG2 A;  1P4X A;  2YX7 A;  2FMY A;  1UHW A;  3E97 A;  2PG4 A;  1O7F A;  2ADU A;  2FOK A;  5LHH A;  3T8R A;  1UB9 A;  4PCQ A;  4MTD A;  1FT9 A;  2XAS A;  3MCZ A;  4EJW A;  1MGT A;  4GCV A;  5HVQ C;  3KP6 A;  4L9T A;  4K2E A;  3LA2 A;  1L0O C;  3U2R A;  3TGN A;  2DLL A;  3LFK A;  1Z91 A;  3I53 A;  5D6F A;  1FWZ A;  3MEX A;  3BZ6 A;  4NHJ A;  1J5Y A;  3I59 B;  3BP8 A;  1P2F A;  5D8K B;  1RZ4 A;  3T5X A;  1GXP A;  3FZV A;  1R22 A;  2CW0 F;  3L09 A;  3LST A;  3BJO A;  2L3D A;  1SMT A;  4L9V A;  1BI0 A;  3REO A;  3E6B A;  2EFN A;  2XGX A;  1IW7 F;  2ISZ A;  2L4M A;  2V1U A;  1R1T A;  4IPA A;  5ILV A;  3DQV C;  3GFM A;  4U0Y A;  2CG4 A;  3VOE A;  5HDN A;  2F5D A;  5F1R A;  2O61 A;  4YII A;  1BOA A;  3E5X A;  3RYR A;  4KFC A;  5H6R A;  4CHU A;  2CFX A;  4ZYD A;  4RB1 A;  3EET A;  2O8X A;  3Q9V A;  4MQV A;  1HW2 A;  1KQ0 A;  3HTS B;  1I1S A;  2FE3 A;  4F7Z A;  2M30 A;  1BN5 A;  2VT3 A;  3LQQ A;  4TV7 A;  1IRF A;  6PAX A;  1XMA A;  4CZZ A;  2FNA A;  5DD4 A;  4M6X A;  2XAH A;  5J6X A;  1FP1 D;  2F5F A;  1XCB A;  4RGX A;  3WTX C;  3HUG A;  3TO9 A;  5J8C A;  2VOD A;  4Y13 A;  1LVA A;  1KU3 A;  1FLI A;  1ONV A;  4M6Y A;  3TDZ C;  3ZMT A;  1FYM A;  4GYG A;  4A5M A;  4ENM A;  4Q48 A;  2A69 F;  1R5H A;  4HBL A;  2P7V B;  3J80 K;  1T0F A;  1S8N A;  4XLP F;  1K78 A;  3Q5F A;  4UXN A;  2P5V A;  2PMH A;  5D8L B;  3ZMS A;  4WF2 A;  3KZZ A;  3KP7 A;  1USS A;  5ED4 A;  5E1Z B;  5LGT A;  1B9M A;  1JXS A;  1KGS A;  1BI3 A;  4IJA A;  3BRO A;  5D5V B;  1DPR A;  1T38 A;  3ZMV A;  1SFX A;  4HF0 A;  1CF7 A;  4HOB A;  2FU4 A;  2O0Y A;  4ENN A;  1BC7 C;  2EJR A;  1HSJ A;  3B02 A;  1T39 A;  1TNS A;  3WGI A;  1KQ8 A;  2H6B A;  5IT3 A;  2C6Y A;  2XHK A;  2JTV A;  2OD5 A;  4HX4 A;  1W4M A;  1YW9 A;  2ZBK A;  3I54 A;  1ZAO A;  4LFU A;  1IN7 A;  2QBY B;  3KP5 A;  4PGH A;  3ROU A;  1GXQ A;  3ABT A;  1Z9C A;  2JRT A;  2DAO A;  5H20 A;  2M87 A;  2L4A A;  3IWZ A;  5FLX Z;  4BHP A;  2RDP A;  4MHG A;  4IF4 A;  2ELH A;  1KU2 A;  2LF8 A;  3LWF A;  4L9N A;  3D5L A;  4PDK A;  4KMF A;  4LLG F;  3CJN A;  4G7O F;  1U8R A;  1F1Z A;  5D5U B;  3T1B A;  2ESN A;  3GF2 A;  1OYY A;  2W24 A;  2HWV A;  1HKQ A;  2DTR A;  5L3G A;  1FPQ A;  3K1N A;  5D6E A;  3HSE A;  4IRG A;  3ZMZ A;  3LAJ A;  1QBJ A;  1TLH B;  4U7B A;  3W6K B;  1RUO A;  3MWM A;  4U88 A;  4LB6 B;  1R58 A;  2YPR A;  2UWM A;  3CLO A;  3QU3 A;  2VOO A;  2EFW A;  4E70 A;  5H6Q A;  3HRM A;  2BE5 F;  4LK0 F;  1MDM A;  2XIG A;  2PMU A;  1K6O A;  5TJJ A;  5JVT A;  2EWN A;  3F8B A;  3OV8 A;  4HA8 A;  2M8E A;  4BHC A;  3HSR A;  4RB2 C;  5JI6 A;  2VBX A;  3E6C C;  3QPH A;  4BQA A;  4KT5 C;  2MH2 A;  3SHF A;  4IHS A;  4P9F A;  4LMY A;  2HQN A;  4HLX A;  4L0Z B;  3MZH A;  2YX4 A;  3RDI A;  2HQR A;  2E7W A;  2KJC A;  3J80 Z;  3L9F A;  2VC0 A;  3IL2 A;  2EFO A;  4IHT A;  1FZP B;  4ZYG A;  2KIU A;  1YW8 A;  2EFP A;  4KMU X;  4YG2 F;  1ZG3 A;  4FX0 A;  1CF7 B;  3HSF A;  5FO5 A;  1BI1 A;  5D5W B;  5J8F A;  1I1G A;  5FD6 A;  2DO7 A;  3ZPL A;  1ZGA A;  4L5I A;  1XMK A;  1B6A A;  2A61 A;  3R4K A;  1IN5 A;  4IXA A;  4HAM A;  1KQ9 A;  4WXH A;  5E20 A;  3ZN1 A;  3T8T A;  4PGG A;  4JQF A;  1U3E M;  3WTV C;  5LHI A;  2ZXJ A;  4EJT A;  1KYZ A;  2M1B A;  2LDU A;  2NYX A;  2YR2 A;  4D0P A;  1SFU A;  1YQA A;  3RPQ A;  3WTU C;  3JSP A;  2HEO A;  2QLZ A;  3FMS A;  2XKP A;  2OZU A;  4BHB A;  2HFH A;  3DEU A;  2G7U A;  3GFJ A;  1ZHF A;  1EH6 A;  2L02 A;  1BC8 C;  1DP7 P;  5LBQ A;  4FHT A;  2DPU A;  5DDG A;  1ZAR A;  4OIO F;  1LEB A;  2Y0M A;  1RI7 A;  4KA4 A;  1O57 A;  2EV5 A;  1R7J A;  3NRV A;  4ZZD A;  4ZYE A;  2Z33 A;  1I6X A;  4WXC A;  2LF7 A;  1HW5 A;  1S29 A;  3CO7 C;  3HIF A;  4DQ2 A;  1GHC A;  3GO5 A;  3KET A;  5BPI A;  1FOK A;  3QAH A;  4Q4Z F;  5E18 F;  1SD5 A;  3L7W A;  4WXD A;  1PP7 U;  2R7D A;  3F22 A;  2O03 A;  1Q1H A;  1WI9 A;  4AIJ A;  1R23 A;  3KCC A;  5HDG A;  5DD8 A;  3VEP A;  1MKM A;  2IA0 A;  2OQG A;  3EYY A;  3F6O A;  4OIR F;  1MJB A;  3R0J A;  4B8X A;  3I58 A;  5D4S A;  2DQR A;  4EJV A;  1SD7 A;  2E1C A;  1QO0 D;  4M71 A;  2RQP A;  3R0A A;  3KFW X;  2Q2E A;  4I98 B;  2F2E A;  1HQC A;  1T98 A;  4ASN A;  3S2W A;  4BYY A;  1T6S A;  1J59 A;  2RVC A;  3WTY C;  3GFL A;  3FXQ A;  2J5O A;  2R3S A;  5HLH A;  4L9J A;  4I09 A;  3F23 A;  1YS7 A;  5L3F A;  4MNU A;  3WTW C;  2M5W A;  2GXB A;  3M1E A;  3F8F A;  1FBQ A;  2FBH A;  1MD0 A;  3MFK A;  3DFG A;  4GYI A;  1U78 A;  4WCG A;  1JGS A;  3SFZ A;  4HX8 A;  3DKW A;  2ACJ A;  1ZGJ A;  1OPC A;  3KP4 A;  1LNW A;  5HS8 A;  2RGV A;  4ENK A;  3FM3 A;  3O3K A;  1STZ A;  1CGP A;  3GLX A;  2JT1 A;  3PQK A;  2V1D A;  5JR3 A;  1OKR A;  1Z6T A;  1IZ1 A;  5ILU A;  4I2O A;  1D5V A;  3C7J A;  4XSZ F;  4WX9 A;  2H09 A;  2PQ8 A;  3GZ6 A;  3GWZ A;  5LHG A;  4UVB A;  2VBW A;  2GQQ A;  2GAU A;  1EV7 A;  2ISY A;  2IPQ X;  4LG0 A;  2F5E A;  5L3B A;  1F5T A;  4G9Y A;  1TQP A;  1G3W A;  5BQT A;  3HTU A;  1BI2 A;  5DUK A;  3BWG A;  1U5T A;  2HKO A;  1DPU A;  2OZ6 A;  1HBX G;  3RKW A;  4OOI A;  3FXU A;  2D2W A;  4JK1 X;  1R1V A;  4EGZ A;  1Z7U A;  1FYK A;  1XGO A;  3LA3 A;  1R1U A;  4RS8 A;  3PFI A;  2BBY A;  3ML6 A;  5D5X B;  1D8J A;  5ICC A;  5E1W A;  2J5P A;  2DT5 A;  1NHA A;  3W6J B;  1I27 A;  2K86 A;  3H3U A;  1O3R A;  5FFZ A;  5DEQ A;  2GZW A;  1D8K A;  2GA2 A;  3IKV A;  4HYE A;  1MJA A;  2VBY A;  4HQM A;  2HYF A;  2KKO A;  3R60 A;  1E2X A;  1ZG5 A;  4ESF A;  4UUV A;  2GXG A;  3G3Z A;  4GXO A;  1B59 A;  2DQL A;  3FMQ A;  3MAJ A;  4U0V A;  4U0W A;  3P7N A;  1XSV A;  4R1H A;  2XVC A;  5K5R A;  4MQ9 F;  2FXA A;  5KK1 A;  4M72 A;  5CJ9 A;  3SZT A;  1YS6 A;  2GA1 A;  1F4K A;  2P8T A;  2VE8 A;  3I5U A;  4B09 A;  1ZLK A;  2B0L A;  2P5L C;  5CLS A;  3KEO A;  2V9V A;  3WG9 A;  5DCM A;  2VON A;  2VE9 A;  1YFH A;  3DXJ F;  4CXF A;  4EGY A;  3FHZ A;  3RKX A;  2HOE A;  2HS5 A;  2KIF A;  4CDG A;  2TDX A;  4MGR A;  1IAW A;  1XSX A;  2ZNY A;  1J2X A;  3TO6 A;  1ZH5 A;  3QP5 A;  5CVI A;  1PDN C;  3K0L A;  5FFX A;  3K1P A;  2NNY A;  5DV5 A;  3TOA A;  1XGS A;  2QBY A;  3ECO A;  3IHU A;  3PQJ A;  3TKY A;  4A2U A;  4BH9 A;  2FBK A;  5LEJ A;  1FY7 A;  1ZG1 A;  4A5N A;  5FB2 A;  4FX4 A;  2FML A;  5L3D A;  2ZME B;  5A2Q Z;  3IKT A;  1TW3 A;  2OU2 A;  2RV8 A;  2XV4 S;  3SXY A;  4G6D A;  3GUD A;  1Z05 A;  1TTY A;  2P7C B;  1P4A A;  3LA7 A;  1J7K A;  3VOD A;  2EV6 A;  3E5Q A;  4KN4 X;  3JSO A;  1BM9 A;  1S3J A;  1Z1D A;  3BPX A;  4RAY A;  3ELK A;  2FRH A;  1LJ9 A;  3H92 A;  3WGH A;  1I5Z A;  1XD7 A;  3ZMD A;  4Q5S F;  3FM5 A;  4I7H A;  4LLN A;  4MTE A;  4XBF A;  2DBB A;  1SD4 A;  2W25 A;  1GVJ A;  2HR3 A;  4IVN A;  4I0B A;  3F8C A;  2H27 A;  2CQK A;  4ZZL A;  2E1N A;  1U5T C;  3O2P E;  1ON1 A;  2K27 A;  2QUF A;  4QWQ A;  4H0E A;  3V8L A;  4G94 A;  1D3Y A;  1WSU A;  5EEH A;  2PFB A;  1LDD A;  4A12 A;  2PEX A;  1W7P B;  2FNP A;  2IW5 A;  2HZT A;  3JAM Z;  2F5C A;  2XAJ A;  5E8G A;  4KIB A;  4G7H F;  1BBY A;  1QPM A;  5AON A;  2XAQ A;  1TNT A;  4XSX F;  2QQB A;  3RJP A;  4EMS A;  2WV0 A;  1T2K A;  2NS0 A;  4YFN F;  1W7P D;  2G7H A;  4L5J A;  1QGP A;  4KIF A;  1SD6 A;  3ZP5 A;  3BPV A;  3ZQ7 A;  2HTJ A;  4QLC U;  4OMY A;  3V8J A;  1QZY A;  5FD5 A;  3P9I A;  2DFI A;  4OMZ A;  5BPD A;  3GVA A;  4LLL A;  2V1X A;  1YTY A;  2HGC A;  1ZN2 A;  2P6S A;  3IRR A;  4XRF A;  5IT9 K;  5F6F A;  2JPC A;  3NEU A;  5ERI A;  4EQQ A;  3CUQ A;  4LK1 F;  4A0X A;  1WWX A;  2QQ9 A;  2D45 A;  2LKP A;  2OA4 A;  1JHH A;  1XB4 A;  2A3S A;  1TQM A;  3E5U A;  1PP8 F;  1XCV A;  2STT A;  3N97 A;  4UNO A;  2MH9 A;  3E6M A;  3GX4 X;  4L0Y B;  3CUQ C;  4NQW A;  2XAF A;  2A07 F;  4IRI A;  2FA5 A;  2MLK A;  1U2W A;  3GEZ A;  2EV0 A;  4N9H A;  1IN8 A;  4KIC A;  1V3F A;  1FNN A;  2Q8K A;  2H94 A;  3TDU C;  1SAX A;  1F9N A;  3E6D A;  1U5T B;  1JHF A;  1FSE A;  1AWC A;  2X0L A;  3HRU A;  3TO7 A;  4OIQ F;  4O6J A;  2A6E F;  4S05 A;  2EA2 A;  4LG0 B;  1IXS B;  4M73 A;  3RIR A;  1IRG A;  4CIC A;  2JZY A;  1EH7 A;  2P4W A;  3LQR A;  4ESJ A;  2ZKZ A;  2IT0 A;  2FEZ A;  2P6T A;  4O5V A;  3MZY A;  2GIV A;  3DV8 A;  1FC3 A;  5IT9 Z;  3V7S A;  4G8X A;  2DI3 A;  1O7L A;  2CYY A;  1S7O A;  3GYH X;  3ECH A;  2ETH A;  1J9I A;  2STW A;  4UV9 A;  2IP2 A;  2QYO A;  5LGN A;  3R6S A;  4R79 A;  2W85 A;  3M8F A;  4HZF A;  5HLG A;  2EFQ A;  1W5S A;  1R00 A;  3BDD A;  3DPT A;  1Z6R A;  4P96 A;  2JPB A;  1REP C;  1S6L A;  1UST A;  4KNY A;  2JSC A;  1G4D A;  2ZFW A;  2CGP A;  3EUH A;  4G6Q A;  2R7F A;  3EDP A;  1TBX A;  1Y0U A;  3WGG A;  4U7D A;  5DCM B;  1J0R A;  4N0B A;  1EH8 A;  4ENJ A;  2H6C A;  3HRT A;  1QZZ A;  2QEN A;  1KU7 A;  4HV5 A;  5CVR A;  2DPD A;  3HOT A;  3KLO A;  3J81 K;  1LB2 A;  4I0A A;  2V6C A;  2CO5 A;  3GW2 A;  3TOB A;  1S7A A;  3BJ6 A;  4GO1 A;  1LDJ A;  4RAZ A;  5CVU A;  1FSH A;  1ZRC A;  2WTE A;  2UXN A;  4IRH A;  3GXO A;  1YW7 A;  4M9Z A;  2Y75 A;  3RYP A;  5ICE A;  5LEK A;  3F21 A;  2QVO A;  3WTT C;  1B9N A;  5E1X A;  4EJU A;  1XN7 A;  4M9S A;  4ETS A;  2HYG D;  3HYI A;  3BJA A;  2OAZ A;  4S04 A;  4ZYH A;  1XDS A;  2PLY A;  4P5O A;  5CVV A;  4PZJ A;  3I71 A;  3QP6 A;  2XAG A;  3IWF A;  1XSD A;  3B73 A;  4HDU A;  3J81 Z;  1SFE A;  2OBP A;  4RGU A;  1W7P A;  4HQE A;  2V79 A;  3ZN0 A;  3BOQ A;  5HS9 A;  1G6N A;  1HW1 A;  3L00 A;  5HS7 A;  3D0S A;  1XGM A;  1TQI A;  5FGM A;  3IRQ A;  3JW4 A;  4P55 A;  3RPU A;  1QNT A;  2DK8 A;  1U6G A;  3RKY A;  5K5Q A;  1FBU A;  2Z5U A;  3COA C;  2K4J A;  2EK5 A;  3F3X A;  2FBI A;  2DK5 A;  3ABU A;  3MQ0 A;  1UCR A;  1ZRE A;  4WK8 F;  4BNC A;  3G73 A;  1ULY A;  3HOS A;  4HDV A;  1FYL A;  2QZ8 A;  2Z9O A;  4KYW A;  2CSO A;  1V4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...