4KA4A

Crystal structure of a proteolytically defined zbeta domain of human dai (zbp1, dlm-1)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
FSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Z-DNA-binding protein 1
publication title Crystal structure of a proteolytically defined Zbeta domain of human DAI (ZBP1, DLM-1)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 18
structure length 61
sequence length 61
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2013-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ka4A00
2M45A 5FD5A 4KMFA 3Q9SA 4F7ZA 4U0YA 1FNNA 4A0YA 3CUQC 1YTYA 3TDUC 3FWEA 1HW1A 5LRRA 1RIOH 1E2XA 5LEJA 2FMYA 2B0LA 4WK8F 4BH9A 5DCMB 2KJCA 2P7CB 4LGWA 3JTGA 4ZYDA 3I53A 3KP3A 1UCRA 1O3RA 4HA8A 4RGRA 4I98B 1R7JA 3F21A 3BDDA 3GFLA 1UFMA 4HBLA 4NQWA 2V1UA 4M71A 5E8IA 3RPUA 3NRVA 3W6JB 4YFXF 5IT3A 2MH9A 2CGPA 3B02A 2ZFWA 3E6BA 2QQ9A 3RIRA 4HYEA 2COMA 2JSCA 1Z7UA 3WTUC 4KT5C 2ADUA 1UHMA 2XAJA 1BM9A 3REOA 1V3FA 2FSWA 2LNBA 1IUYA 4Q47A 2GXBA 2XHKA 4OIOF 3K69A 4KICA 2KIUA 3SQNA 3SFZA 5LGTA 2GWRA 5FGMA 2H27A 3ERED 5L3DA 5J8CA 1H9TA 1T0FA 2OAZA 1FPQA 3WGIA 3RKYA 4UVBA 4GO1A 2XUBA 1G6NA 1VTNC 4KIBA 1ULYA 4YG2F 2QLZA 2IJLA 1ON2A 3E6MA 3O2PE 2STTA 2HQRA 1Q1HA 2YX4A 4MHGA 2F5EA 2P7VB 1H9GA 1K7AA 1MGTA 4EVIA 3KP4A 3RTRA 2IT0A 1SFEA 2HKXA 1MZBA 3GYHX 3R4KA 1SFXA 2F5DA 3T8TA 4AIJA 2O3FA 1KA8A 1BC7C 3BPXA 3WGHA 3WE2A 1B1BA 3E5XA 2WC2A 1AOYA 2ZJ2A 1XDUA 1XMAA 4OIQF 4M6XA 2A07F 2DFIA 1D3YA 1P92A 2EB7A 4HAMA 4Y15A 3U9GA 1S29A 3Q9VA 2PN6A 5FLXZ 2OA4A 1P2FA 2O03A 5LEKA 1P4XA 1SD6A 1OPCA 4Q48A 4EJUA 1LVAA 4IPAA 2Y48A 2A5YB 2DTRA 1IN4A 1G3SA 4HF2A 2E7WA 2D45A 1HW5A 4R8HA 3IRQA 1NHAA 3DKWA 3T5XA 2OZ6A 4ZYGA 4HV6A 4S04A 4Y13A 3FMSA 2PMUA 1XSXA 3M1EA 3GFMA 1LQ1A 4UXNA 3LA3A 1ZG5A 5JHUA 4G6DA 1SFUA 1FYLA 5DUKA 1T38A 2UWMA 4L9TA 1FWZA 2EK5A 2OBPA 3GW2A 2FF4A 3FMRA 2QYOA 1W7PD 3TO9A 2QZ8A 5EEHA 4ZZDA 1IN8A 1FZPB 3KETA 1TBXA 4M9SA 5K5OA 2FQ3A 5D5XB 3MCZA 5HDNA 1SD4A 5CVRA 4HDVA 4IF4A 4HV5A 1KQ8A 1FT9A 5E1WA 1O57A 4O5VA 2VBXA 5CYVA 4LFUA 1EH8A 2CSOA 4M9ZA 2YU3A 1MKMA 3CJNA 1ZAOA 2PMHA 2JPCA 4L0ZB 4QLCU 3K1NA 3HSRA 2STWA 2D2WA 2IA1A 2VBZA 3QP6A 1KU9A 4I02A 2QQBA 2HTJA 1R5HA 1B59A 2PI0A 2QUFA 2HOEA 2M1BA 5ICFA 4M6YA 5DCFA 3LSTA 4U0VA 5ED4A 4EJWA 1KU7A 4G94A 3L9FA 2LDUA 5L3EA 1YO5C 1F9NA 1R00A 5DYMA 4EQQA 5BMZA 2VN2A 1G4DA 1WSUA 3E6CC 1A04A 2IPQX 2WWYA 4XLNF 5FFXA 1ZGJA 5DUIA 1QPMA 3C7JA 1J9IA 3OV8A 1RZ4A 2FBKA 3JTHA 5JR3A 2BGCA 3ZN0A 1HKTA 3ZP5A 3J7AO 3WODF 2EWNA 2QVOA 2WV0A 2VT2A 5CVJA 2A6EF 1IZ1A 5E8GA 2O0YA 3KP6A 2ETHA 2RN7A 3SHFA 4CYDA 4BNCA 1TNSA 4EM1A 3CUOA 5EEGA 4GXOA 3HRMA 2ELHA 2MA3A 5CJ9A 5DD8A 3FXQA 4RAYA 1YW8A 3QAHA 2FMLA 1KU2A 2L4AA 1FBUA 2R7DA 5FO5A 3GX4X 2P5LC 1O3QA 1FLIA 4YIIA 4EV0A 2BBYA 3R6SA 3RYRA 2FRHA 3RI4A 2EV5A 3VODA 1HKQA 2V1XA 2GA2A 3F72A 3ZPLA 2RGVA 3J80Z 3EUHA 1ZYRF 4EJOA 1B9NA 4KYWA 4UVAA 1IAWA 1MJBA 1IXRC 1EV7A 2LF8A 3KCCA 3CLOA 2G9WA 2ZO4A 3RKWA 5HLHA 3QRFF 3ZMSA 1I1SA 5TRDA 2LF7A 3MFKA 1JXSA 5E1ZB 2ISYA 2JPBA 4EM0B 2E1CA 2ZNZA 2A3SA 2JZYA 4MQVA 4ENMA 3E97A 4I01A 5A2QZ 2VOOA 2EFOA 3VOEA 4A0XA 4Z2YA 2A69F 2O8XA 4WXCA 5ICGA 4BYYA 4L9VA 1USSA 4RB0A 1I6XA 3EYYA 2EJRA 4G7OF 4XSZF 2M5WA 2IA2A 3K0LA 3MZYA 4BQAA 3GZ6A 3RPQA 1XSVA 4L9JA 2D1VA 5LGUA 1KGSA 3GWZA 2KIMA 4LG0A 1FY7A 4B09A 1WRJA 5ILSA 3WTWC 4RGXA 2C6YA 1FC3A 4EJTA 1Z1DA 3MWMA 3HRTA 3FZVA 1QBJA 1TW3A 4IRIA 5BQTA 2NRAC 3ABTA 2MLKA 1XMKA 5K5RA 3CTAA 2CO5A 1I27A 4R79A 4O6JA 4U7BA 3FHZA 2GIVA 4XLPF 4PGGA 2A61A 3KP2A 1W5SA 3W6KB 3DV8A 4RGUA 2FNAA 2UXXA 1ZLKA 2LSOA 2DK5A 1KYZA 4I7HA 2M87A 4I2OA 5ERIA 4IRHA 3IKTA 1MDMB 2VXZA 4FX4A 4CDGA 2KKOA 5LHIA 3EYIA 3WGGA 2BEOA 3J80K 1J0RA 4LG0B 3M7GA 3FXUA 4WWCA 4JQFA 3FXRA 3V8KA 4BHCA 1XGSA 2VT3A 1IW7F 4CICA 1FSHA 5HDKA 3V8JA 2CYYA 3DF8A 2P5KA 1W5TA 1UHWA 5K1YA 2V9VA 1ZRDA 2HYGD 1PUEE 4RGSA 1XCVA 1BIBA 2HS5A 4WXDA 5DV5A 4A5NA 4OIPF 5H6RA 2XRNA 4KFCA 4UV9A 3HRUA 2XAGA 2CG4A 3LAJA 5JVTA 2FE3A 4P96A 5A2QK 3T8RA 4YFKF 3BP8A 1FBQA 4E70A 2CW0F 4Q5SF 3U1DA 3D5LA 3ULQB 4ZH4F 5BOXA 3BPVA 1D5VA 3GFIA 1QO0D 2NAZA 4RS8A 1O7FA 1ZGAA 1HBXG 1TQPA 2VOPA 2DQRA 4OMZA 3HSEA 2EFPA 5AONA 3ELKA 3M8EA 2W24A 1G3YA 4LMYA 2P6TA 4L5IA 5HLIA 3H3UA 2MH2A 2HWVA 1WI9A 2TDXA 3J81Z 1U3EM 1RUOA 3IRRA 1FYKA 4UNOA 2DAOA 4ZYEA 2NNYA 1YS6A 4M72A 4GYGA 2PFBA 5L3GA 4K2EA 2DBBA 4P9UA 4UV8A 1Z9CA 4LB6B 5FFZA 1FP1D 5D4SA 1BI0A 3F6OA 2VBYA 4I09A 5FD6A 2OZUA 2XASA 4JBAA 4EJVA 1T39A 5D5UB 5JFRA 3HTSB 4L0YB 1P4WA 3F8MA 4OOIA 2G7HA 3O3KA 2IP2A 1B4AA 2XVCA 2DK8A 2CFXA 3HOSA 3TOBA 3OOPA 5CVUA 3P9IA 3E5UA 2A6HF 4HX4A 3GVAA 5D6EA 1PP8F 4IHSA 3F8CA 1SAXA 3T0YA 4MTEA 3D0SA 4AVPA 1R1TA 2V1DA 2QQAA 1OYWA 2HTSA 1T6SA 3ECOA 1C0WA 3VFZA 2FA5A 1ODDA 1Z6TA 3KLNA 3R0AA 4M9XA 4O3MA 4XSXF 3E6DA 3EDPA 4AWXB 4NB5A 1ZG1A 3G73A 3ZMTA 2HKOA 2W57A 1XSDA 1LEBA 3SZTA 2G7UA 2JTVA 1DPUA 1BN5A 1TNTA 3QP5A 1ON1A 2WTEA 4YIFA 5H6QA 4A12A 4MNUA 3PQJA 4EM2A 2RQPA 2ACJA 1FP2A 1O3SA 1R1VA 3QU3A 5D6FA 3ZMDA 1REPC 2XKOA 2GXGA 4HLXA 1EH6A 3HUGA 3L2CA 3Q5FA 3HRSA 3BROA 3F8BA 3E3VA 5H20A 2HYFA 4BHPA 2Q0OA 1OKRA 1U6GA 3ZN1A 5HVQC 2K02A 4XRFA 4ON0A 1WWXA 4ESJA 1IXCA 3RYPA 4DQ2A 1CGPA 2YPRA 2EA2A 3VEPA 3GFJA 1HXDA 2VONA 2J5OA 5AIQA 1HQCA 2Z3YA 1S3JA 3KP5A 3J81K 4R1HA 1R58A 4CZZA 5ICEA 2IVMA 4L18B 2Z33A 3E5QA 4HX7A 3H3ZA 1O3TA 5FLXK 3WTTC 1P4AA 2FXAA 1YYVA 1CF7B 1R5GA 3TGNA 4I0AA 3EQLF 4RB3C 1W4MA 1JHFA 1YLFA 4G6QA 3I4PA 1WQ2A 4OINF 2ESNA 4BHBA 4HDUA 3GLXA 2BYVE 4OMYA 1RNLA 4KIGA 4JK1X 3U2RA 4UVCA 3JSOA 2AXLA 1LDKB 2KJBA 4GGGA 1G3TA 2W25A 3H92A 4BXUA 4U88A 3JAMZ 1GVJA 3R60A 1S7OA 5CVIA 1KYWA 2RKHA 2QBYB 4KNYA 4KA4A 1ZRFA 2HGCA 1J75A 3BZ6A 1KQ9A 3QPHA 5TJJA 4UHTA 3WG9A 3L09A 2H6CA 5E17F 4PGHA 2Y75A 3TO6A 5D8KB 1QZZA 4FHTA 3BOQA 3WE3A 5BPIA 4ESBA 1I1GA 2FBHA 3LAPA 2HR3A 1L3LA 4HZFA 2E7XA 1J59A 5LHHA 1OYIA 4N0BA 1J2XA 1DPRA 1BBYA 3PQKA 2XROA 2H94A 3P9CA 5LRSA 1LEAA 1U2WA 2XIGA 3CO7C 3WTZA 1B6AA 2EA4A 3DPTA 3GZ5A 4Y17A 2RC4A 1IRGA 2EFNA 3F3XA 1IN6A 2OQGA 3IWZA 2P4WA 3KEQA 2XKPA 3CO6C 1XD7A 2DO7A 2XAQA 3ZMZA 1U5TA 2PLYA 1MJ9A 4P55A 2V79A 1PDNC 5HOOA 3FX3A 4L5JA 1HW2A 3NQOA 3F23A 2H6BA 1DP7P 1BI3A 3DXJF 3I58A 4KUMA 5K5QA 2MBFA 3I0TA 1YG2A 2M30A 4DNCA 3F22A 3I54A 3IHUA 3KEOA 3IKVA 1MDMA 1J5YA 1I5ZA 3ZMUA 4MQ9F 3JW4A 1W7PA 2P8TA 3TOAA 3FMQA 2L4MA 5AIPA 1Y0UA 2MLGA 4LLLA 1P6RA 2Q8KA 5J8FA 2ZBKA 1ONVA 1SMTA 2RNJA 4G9YA 2VC0A 3RKXA 3N4MA 2LKPA 1K6OA 3KLOA 3MEXA 4L9NA 5HS9A 2RVCA 2PJPA 4IJAA 4TV7A 1R1UA 2HQNA 4AIHA 1WKMA 4PDKA 1YIOA 4HOBA 1U5TB 1XGNA 4WX9A 5HS8A 1TTYA 4Q4ZF 3JAMK 2ZMEB 2IRFG 3TKYA 3RDIA 4IVNA 4ESFA 1BOAA 2KIFA 1FSEA 2UZKA 4A0ZA 3WTXC 4FT8A 1U8RA 2RDPA 1R36A 1QQIA 3GXOA 5BS6A 2PBIA 5HS7A 5D4RA 2VE8A 3L00A 2KRFA 1V4RA 1S8NA 2MD5A 4IRGA 1W7PB 3FM3A 2X0LA 1K78A 2Z99A 3LFKA 5BPDA 1YW9A 2ZKZA 1TQMA 4GYIA 4H0EA 4KIFA 4U7DA 4ETSA 5D5WB 4IHTA 1LB2A 1J7KA 1R23A 1ZHFA 2DLLA 2VE9A 1SD7A 3V7CA 1PP7U 1YFHA 1Z05A 1Z91A 3ZMVA 2EFWA 1STZA 2EV0A 3I5UA 3F8FA 4RAZA 3ABUA 4LLGF 2DI3A 4ENNA 2CQKA 5LGNA 1FX7A 3GO5A 3O6BB 3DP7A 5HLGA 1F1ZA 2W85A 5KVRA 4HQEA 2DQLA 4OIRF 1QNTA 1X3UA 3KE2A 1JE8A 3LA7A 2YX7A 3N97A 3C1DA 3DPLC 2XGXA 3WU0A 5L3CA 5CLSA 3SXYA 3GUDA 2ZXJA 1FBSA 1O7LA 1IN7A 2QWWA 2MC3A 1K78B 1MJAA 4KDPA 1BIAA 4EGYA 2FEZA 1T98A 4LK1F 1G3WA 2XAHA 2J5PA 1HSTA 2K7LA 4HQMA 4LB5A 1XN7A 1JHHA 3KZZA 4CHUA 1U78A 2V6CA 4A6DA 6PAXA 2O61A 2A68F 3K9TA 1GHCA 4ENJA 1S6LA 4A6EA 3LQQA 3QOPA 3HHHA 1DUXC 3FM5A 3COAC 2YR2A 1LDJA 2UXNA 4FX0A 4N9IA 1SMYF 3TO7A 1UB9A 3I64A 3CUQA 4P5OA 3FF5A 5LHGA 2VBWA 5CVVA 1K79A 4A2UA 4AD9A 3HOTA 3I59A 2P5VA 4LJZF 2OQRA 2IA0A 2O6GE 5ILVA 2E1NA 3JSPA 3HIFA 2DW4A 1E17A 4QWQA 4ENKA 1Z6RA 3G3ZA 3F6VA 4U0WA 2JT1A 3ISPA 1IRFA 4P9FA 5IT9Z 1XGMA 1BC8C 4G7ZF 3HHGA 3M9AA 1ZRCA 1GXQA 1QZYA 2HEOA 2GZWA 3BJ6A 4WXHA 3ROUA 3ZQ7A 4ASNA 4WCGA 3VB2A 5ILUA 2GAUA 1IF1A 1F5TA 5F1RA 3RJPA 3MZHA 1D8JA 4LLNA 3CDHA 4RB1A 1CF7A 4KMUX 2BE5F 5HDGA 1OMIA 3GF2A 3S2WA 2IW5A 4CO8A 2NYXA 3CUQB 4PZJA 2K86A 5F64A 4HF1A 3I59B 4HX8A 3I71A 2OD5A 1L0OC 2CWEA 4PCQA 4LK0F 1OR7A 5E18F 1FYMA 4NHJA 1LNWA 1FOKA 4B8XA 5DEQA 4HF0A 4EMSA 1U5TC 4CGZA 2F2EA 1ZG3A 3ECHA 3B73A 1DDNA 4EGZA 2F5FA 2X4HA 3QU6A 3WTYC 5ICCA 5J6XA 1YS7A 1KQ0A 3BJAA 2QBYA 2GQQA 4I0BA 2R7FA 1H0MA 4G8XA 1XDSA 3DEUA 2DPDA 3C3WA 1ZREA 1BJAA 4KN7X 1TW2A 4YFNF 2QM3A 4G7HF 2JRTA 1OYYA 1JGSA 4OU0A 1RUNA 2AS5F 3AAFA 5DD4A 2Q2EA 4M74A 2L01A 2M8EA 2DT5A 1B9MA 2ZCWA 2D1HA 3WTSC 4HLYA 3F8NA 2DU9A 1HSJA 1D8KA 1XB4A 3LQRA 3MAJA 1R22A 4UUVA 1TQIA 2PEXA 5FB2A 1HKSA 2Z5UA 5D8LB 2L3DA 3NEUA 4BAYA 2HDCA 3T1BA 1T2KA 3KZYA 3EETA 4HW0A 2XV4S 3R0JA 3V8LA 1EH7A 3WTVC 3LWFA 3C18A 3KP7A 1YW7A 2Y0MA 1TLHB 2K4JA 3MQ0A 5IT9K 4WF2A 4LD5A 1ZH5A 3IC7A 1QGPA 2K27A 2H09A 1XGOA 3P9KA 2K4BA 5LBQA 2R3SA 2W84A 3DQVC 1BI2A 5LLQA 3K1MA 5JI6A 4M73A 1AWCA 4CXFA 3WU1B 3SZPA 3L7WA 4D0PA 3K2ZA 4S05A 4MEYF 2BV6A 3IWFA 1F4KA 4RB2C 2EV6A 4ZZLA 2GA1A 1LJ9A 1SD5A 4XBFA 5L3FA 2OU2A 2QENA 5D5VB 4ZYHA 4IXAA 3V7SA 3GEZA 3QPTA 1RI7A 1ZARA 3KFWX 2DPUA 4AIKA 3HSFA 3ML6A 2NS0A 4MEXF 1ZLJA 5DDGA 1IXSB 2PQ8A 4N9HA 1YQAA 2Z9OA 4GCVA 1MD0A 2L54A 3PFIA 5E1XA 2RV8A 2VC1A 3R61A 2NNNA 2PG4A 1BI1A 2YSRA 3BWGA 2ZMEA 5DCMA 2VODA 2FNPA 3HTUA 3IL2A 3V4GA 3HYIA 3LA2A 2F5CA 2ESHA 4A5MA 4KN4X 1S7AA 3TDZC 5KK1A 2P6SA 3P7NA 2FBIA 5L3BA 2FOKA 3TQNA 3V7RA 2XAFA 4MTDA 5F6FA 1ZN2A 5E20A 3M8FA 1USTA 1LDDA 2ZNYA 1IN5A 1KU3A 2ISZA 3BJOA 4MGRA 1GXPA 2L02A 3BY6A 2HZTA 3DFGA 2HFHA 1XCBA 2EFQA 2FU4A 3K1PA
chains in the Genus database with same CATH superfamily
2M45A 5FD5A 1ZGWA 2V6EA 2EPFA 1ERDA 4KMFA 3Q9SA 4NDLA 4F7ZA 2EIMH 4U0YA 5DTDA 1SVMA 1FNNA 3A1YA 5CKTA 4A0YA 3CUQC 3W2VA 1YTYA 3TDUC 3FWEA 2K85A 1HW1A 4DW6A 4C2TA 2VIXA 4BBSJ 2YS9A 5LRRA 1RIOH 1FIAA 2P0WA 3HGGA 2M7BA 2EQRA 2E19A 3GZNB 1E2XA 1K6YA 3OR1C 5LEJA 2FMYA 3ERMA 2B0LA 4WK8F 4BH9A 2ZXHA 4XORA 2EZKA 5DCMB 2KJCA 2P7CB 4LGWA 3JTGA 1GT0C 2MD0A 4C3IJ 3I53A 4ZDLA 4ZYDA 3KP3A 2P81A 3AG1H 4UUSA 1UCRA 2Q1ZB 2X1CA 4HA8A 4RGRA 4M3GA 1O3RA 4I98B 4MFDA 5B3SH 1R7JA 3F21A 1MMDA 3BDDA 3OSGA 1NK2P 2R7OA 5IP9J 3JREA 3GFLA 4CH7A 4F93B 1UFMA 1AHDP 3CC4I 3HOZJ 4HBLA 1X19A 4NQWA 5EZGA 2V1UA 4A3JJ 5EG0B 3JR9A 4M71A 1IO2A 5E8IA 3RPUA 3NRVA 1RPWA 3G6EI 4V2FA 3W6JB 4YFXF 3FKJA 4GFBA 4RLQA 5IT3A 2MH9A 2OF7A 2CGPA 1MMNA 2DTZA 4DOZA 4UB6C 3ZXSA 3B02A 2HOAA 4DYCA 2ZFWA 3E6BA 2QQ9A 3RIRA 4HYEA 4XK4A 4F3QA 2COMA 2JSCA 1Z7UA 1JT6A 3WTUC 4XIDA 4KT5C 2ADUA 3TW7A 1ZR4A 1UHMA 4KT6A 5J40A 5E3OA 2XAJA 3HXLA 1BM9A 4RM2A 3REOA 5E3MA 1V3FA 2FSWA 2LNBA 3DWLE 4NC7A 4YELA 3LSPA 1QA6A 1IUYA 4Q47A 3W2AA 2XHKA 2GXBA 4OIOF 2BY2A 3K69A 4FISA 4KICA 2KIUA 2KFDA 3B6AA 5JLXA 2ME6A 4Z6YA 3OS2A 2R7TA 3SQNA 3SFZA 4AM3A 2XC7A 5LGTA 4PK4A 5JVGF 2GWRA 2DFEA 5FGMA 3AG3H 3RZDJ 2R7SA 1T56A 2H27A 3ERED 3OSFA 1MBFA 2X6WA 5L3DA 4L5EA 5J8CA 1H9TA 1T0FA 2OAZA 1MNDA 3HBLA 5FKMA 1FPQA 4C2MJ 3WGIA 2CV1A 4BQQA 2NVUB 3RKYA 4UVBA 3PUFA 3DKYA 4D7MA 4GO1A 3K4JA 2XUBA 3QQAA 1ZR2A 1G6NA 2KT0A 1VTNC 4KIBA 1ULYA 1LPQA 4YG2F 2QLZA 1I6HJ 5IYDJ 2IJLA 1ON2A 4E7LA 2JRMA 2LKXA 1XX5A 3HOVJ 1AU7A 2YUSA 3E6MA 3O2PE 1G59A 1OR7C 1TT0A 2STTA 4CCJA 2MC4A 4BQOA 2XRLA 4UUSB 4BE2A 2HQRA 1Q1HA 5F04A 2ZJPF 4XRSG 2YX4A 2JN6A 4MHGA 2F5EA 2P7VB 4C9YA 1H9GA 1K7AA 1MGTA 1IDZA 4NQWB 4EVIA 3KP4A 2Y9YA 3RTRA 2IT0A 2M2EA 3TW6A 3BG7A 1SFEA 2HKXA 1MZBA 1GV2A 1WVRA 3RCOA 3GYHX 3R4KA 1ZTRA 2L7MP 1SFXA 2F5DA 4OAZA 3DTKA 3T8TA 4A3GJ 3CQZJ 1GV5A 4AIJA 4DZJA 3VYTB 2O3FA 5GAEJ 3MKZA 2EH3A 2JVGA 1KA8A 1BC7C 2VKHA 2RAEA 3BPXA 3K70D 2DJNA 2X6XA 1UZCA 3Q0VA 3WGHA 5JHFA 3WE2A 1B1BA 5HLTA 3HB9A 3E5XA 2WC2A 3LMMA 1AOYA 3K4CA 2HVSA 2ZJ2A 1XDUA 1XMAA 4OIQF 1A31A 4M6XA 2A07F 3X2QH 1EKEA 2DFIA 1D3YA 1P92A 2FD5A 2EB7A 3PNTA 4HAMA 3PJRA 2E1MC 4Y15A 3U9GA 1S29A 2CQQA 1Y56A 1VQPI 3Q9VA 1YITI 2PN6A 2CH0A 5FLXZ 2OA4A 1P2FA 2O03A 5LEKA 1P4XA 1SD6A 2B7EA 3RQ4A 3L1PA 4IKFA 2QEXI 1OPCA 4Q48A 2HVRA 4EJUA 1LVAA 2CUFA 4IPAA 2Y48A 2A05A 2A5YB 2DA2A 1IN4A 1G3SA 2DTRA 3OYIA 2IGNA 1IJWC 4IQ4A 4HF2A 1BR4A 2E7WA 2D45A 2QF7A 2CV2A 1HW5A 1Z67A 5M3MJ 4R8HA 3BG5A 1PUFA 3IRQA 4UB8C 1NHAA 3DKWA 2ZJRF 4D5CA 3T5XA 2OZ6A 4ZYGA 5B1BH 4HV6A 4S04A 4Y13A 3FMSA 1RR8C 2PMUA 1XSXA 1TT5B 4CUGA 3M1EA 3IP4B 2HDDA 3GFMA 4AYBA 3ZGKA 1LQ1A 4UXNA 4F92B 3G71I 3LA3A 1ZG5A 3BR2A 4QIWN 1K83J 2WAFA 3WG7H 5JHUA 4G6DA 1MNMC 4CA0A 1SFUA 1FYLA 2VQLA 5DUKA 1W36D 5FLVA 1T38A 2UWMA 4L9TA 2XB5A 1FWZA 2EK5A 2OBPA 3A01B 4LG3A 3ZQQA 2VXDA 4LIVA 2MGQA 3GW2A 3PIPF 2FF4A 3FMRA 5FRNA 2JA8J 1A35A 2KRHA 4BU2A 2QYOA 1W7PD 3IH3A 3TO9A 3PUBA 3OYNA 2QZ8A 5TISC 1ORKA 3VPRA 5EEHA 2DA3A 3HEFA 3TL4X 4ZZDA 1IN8A 3Q0WA 4AC0A 2CRGA 1FZPB 3KETA 1TBXA 4M9SA 5K5OA 2FQ3A 5FKLA 1SFKA 3CDLA 4F52A 3BCAA 1KZHA 5D5XB 2G0EA 3MCZA 3EUHC 1XPXA 1ITYA 3NAUA 5HDNA 1SD4A 1WHUA 5CVRA 4HDVA 2HVQA 4IF4A 1HDPA 2Z2SB 4HV5A 1KQ8A 1FT9A 5E1WA 4XLAA 1O57A 3DU6A 3CD6I 4O5VA 2VBXA 5CYVA 4CCNA 1X1PA 1RKWA 1XG1A 4B1RA 1VQ6I 4LFUA 1EH8A 2CSOA 4E7JA 4M9ZA 4FE7A 2YU3A 1MKMA 3CJNA 1ZAOA 4PSWA 5F0CA 2Z16A 2PMHA 4XRSA 2NS8A 1BOBA 1FIPA 2JPCA 5F0HA 4L0ZB 3E0JB 3S2HJ 2HQ5A 4QLCU 2IAIA 2LY9A 2N8GA 3K1NA 3HSRA 3QODA 2OTJI 4KISA 1JKPC 2JA2A 2STWA 4XMYA 3ZQCA 2D2WA 2IXSA 2IA1A 2CMPA 2VBZA 2R5ZA 3BR0A 3QP6A 1KU9A 3ESWB 3LOCA 3VYUB 2AQFA 1E3PA 4I02A 3ZOBA 2QQBA 1XTAA 4Y3OA 2HTJA 1RESA 1R5HA 1B59A 2PI0A 2QUFA 4EEFG 2DMPA 4CYCA 5EZHA 2GM4A 2XSDC 2HOEA 1JKQC 2M1BA 4QSHA 5IOZA 5ICFA 3PO3J 4M6YA 5DCFA 3LSTA 4U0VA 1QU3A 1TC3C 2GXAA 3OYAA 1YRNB 1TWFJ 5ED4A 4EJWA 3K7AJ 3KYDB 4G94A 1KU7A 4S0HB 3G1OA 3KX2A 3L9FA 2LDUA 3I3LA 5L3EA 1ETWA 1YO5C 1APLC 1F9NA 1R00A 4XM3A 5DYMA 4EQQA 5GAGJ 1VQKI 2CW7A 3MVPA 4RAGA 1B72A 3S3NA 5BMZA 2VN2A 1U0JA 1WSUA 1G4DA 3E6CC 2BXZA 1FTTA 2M4GA 3PSIA 1LVKA 2Y2ZA 5F08A 1A04A 2IPQX 2DT6A 3WU2C 2WWYA 4XLNF 5FFXA 1VQ9I 2DMNA 1WZ2A 1ZGJA 1D1BA 5DUIA 3OL3A 4CSWA 1QPMA 3C7JA 1J9IA 2BHZA 3OV8A 4DYQA 1RZ4A 2FBKA 3JTHA 3VSKA 5JR3A 4FCYA 4PJ0C 2BGCA 3ZN0A 1HKTA 3ZP5A 3CCEI 3J7AO 3WODF 4B3XA 1Z77A 1SAUA 1V54H 2EWNA 2QVOA 3VDXA 1Y39A 2WV0A 3BR5A 1VI0A 1FEXA 5GADJ 2VT2A 1R71A 1X3WB 5CVJA 2CU7A 2A6EF 1IZ1A 5E8GA 2O0YA 3KP6A 2ETHA 2E36A 2RN7A 3SHFA 4CYDA 2KZGA 3BCBA 3BG3A 4CZCA 4FTHA 4BNCA 1TNSA 1WPKA 3K4KA 4RM3A 4EM1A 3CUOA 3GTQJ 3TP0A 5EEGA 4H4KC 4BUPA 4BL0B 4GXOA 2ZSHB 3OYJA 2E5ZA 3HUGB 3M07A 1GLNA 3HRMA 2ELHA 2R7UA 1ETYA 4E7ZA 3S32A 1GVDA 2MA3A 1G8XA 4QPQA 5CJ9A 5DD8A 2KRCA 3I56I 4I6ZA 3HPHA 3FXQA 2V26A 4IEJA 1S72I 4RAYA 1D0XA 1YW8A 4NC6A 4Y52J 2O9LA 2VPLA 4A3IJ 3AL0B 3QAHA 2FMLA 1KU2A 2L4AA 1FMVA 2R7XA 1FBUA 1TWCJ 2R7DA 2KDOA 5FO5A 3GX4X 2P5LC 1O3QA 4C3JJ 5BNGA 1FLIA 4YIIA 4EV0A 3C2HA 2BBYA 1HA8A 3IV5A 3R6SA 3RYRA 2FRHA 2GLOA 2M34A 3RSNA 3RI4A 2EV5A 3VODA 1HKQA 3HOWJ 5FJ8J 3OYHA 5GP9A 2V1XA 2GA2A 3F72A 1U8BA 3ZPLA 3ASNH 1UMQA 4CCOA 3JRDA 2RGVA 3S15J 1U9OA 3J80Z 2WV1A 3EUHA 3BT9A 1ZYRF 3GMEA 3H5AA 3OYEA 1R49A 4ZDOA 4DBRA 2Y31A 4EJOA 1B9NA 1K4TA 4KYWA 4UVAA 3OYCA 5J1YA 1IAWA 3U1KA 2HPMA 2QSFX 1YJ9I 2XPUA 1MJBA 3LSJA 1X4OA 2PMZN 4LITA 1IXRC 1EV7A 2LF8A 2R5YB 3A0HC 3KCCA 1VF9A 3CLOA 2G9WA 2ZO4A 3RKWA 3CCYA 3BZKA 2BOLA 2CQNA 5HLHA 1K61A 3H9GA 2X1DA 2DMTA 4M3EA 5HNFA 3QRFF 3ZMSA 3PNYA 1I1SA 5TRDA 2LF7A 4PSXA 1PYVA 1ZELA 3MFKA 1JXSA 3PM1A 2TCTA 5E1ZB 3JRIA 2ISYA 2JPBA 4EM0B 2E1CA 3ABLH 5KHDA 2ZNZA 5IP7J 2RREA 1OFCX 1A6QA 2BW3A 2EINH 2CFOA 2A3SA 2JZYA 2HI3A 1Z3XA 4MQVA 4IOCF 3E97A 4ENMA 5F0FA 4I01A 4U87A 5A2QZ 2OTLI 1S9HA 2VOOA 2EFOA 3VOEA 3OIQA 4A0XA 4Z2YA 2M0MA 2A69F 2MW8A 2O8XA 3HOUJ 4WXCA 2K9QA 3ZR8X 1V5GA 3H3VK 5ICGA 4BYYA 3ZQLA 4L9VA 1J09A 3BTIA 2RQQA 3DU5A 2L0KA 1USSA 3JRAA 4RB0A 2MABA 3JRFA 4Y4RA 1I6XA 3EYYA 2EJRA 3FIWA 4YIRX 2NVXJ 4G7OF 4XSZF 3CCVI 2M5WA 5EJCA 1XS9A 3HPGA 2IA2A 3K0LA 5JLWA 3J7YJ 3MZYA 3QYBA 4E4HA 3GZ6A 3RPQA 4BQAA 1XSVA 3K4MA 4L9JA 2D1VA 4D9JA 1KGSA 5LGUA 2L9RA 3GWZA 2KIMA 2NVTJ 4LG0A 1N75A 1FOWA 1FY7A 4B09A 5B66C 1WRJA 3JCUC 5ILSA 3WTWC 3LL7A 1SFOJ 4II2A 1UG2A 3QWLA 4RGXA 3GCMA 2DT7B 2C6YA 3TBIA 1FC3A 1NG7A 1WJCA 2FOWA 4EJTA 1Z1DA 3P5JA 3MWMA 4XLFA 3HRTA 2OUMA 3DEEA 3HOXJ 4GDFA 3FZVA 1QBJA 2F4OB 3UNGC 1TW3A 4IRIA 2RNGA 5BQTA 2H8WA 2NRAC 3ABTA 2QCOA 2W4SA 2MLKA 3OYLA 3WHBA 1SEUA 2ECBA 1XMKA 3F0CA 2E60A 5FKNA 2MYSA 2XPVA 5K5RA 3CTAA 4M3BA 4GRIA 2CO5A 2BW3B 1I27A 4R79A 4O6JA 4U7BA 5IP6A 3FHZA 4BGDA 3U21A 5K7FA 2GIVA 1F43A 3OS0A 4XLPF 1I3QJ 2H1LA 2VI6A 4B47A 2VJ5A 4EATA 4AIDA 4PGGA 3I4NJ 4HSRA 2A61A 3KP2A 1W5SA 2BVMA 3CJRB 3W6KB 1UJ8A 2JK3A 3DV8A 3Q3SA 4RGUA 2FNAA 2UXXA 1D1CA 4A3MJ 1ZLKA 2LSOA 2CUJA 5E79C 2DK5A 1CQTA 2LD5A 1ENHA 3H0DA 4YRVA 1KYZA 4I7HA 2M87A 3H35A 2KHMA 3AG2H 4I2OA 1RRJA 5ERIA 2K9MA 4IRHA 3DLLF 3IKTA 4MIMA 1MDMB 2VXZA 3VWBA 4QPOA 4FX4A 3I4MJ 4G6TB 1B8IA 2LLKA 4CDGA 3SEQA 2KKOA 5LHIA 3C2GA 3FXKA 3EYIA 2Y0SN 3WGGA 3D5SC 3H1CA 2BEOA 2UUZA 3BR6A 3J80K 4A3BJ 1J0RA 5M3FJ 4LG0B 2W7NA 1MIJA 3M7GA 1IGNA 3CMMA 3FXUA 4XN3A 4WWCA 4JQFA 3FXRA 2DMUA 3V8KA 4BHCA 2ME0A 1XGSA 2VT3A 1IW7F 5M5YJ 2VASA 4CICA 4RMNA 1FSHA 5HDKA 4KITB 2KPMA 3IH2A 3V8JA 4XKBA 4MO7A 2CYYA 3CP2A 1N25A 2P5KA 3DF8A 2MG4A 1WJAA 3G1LA 4M6VA 1OCTC 4ZJZA 5IYCJ 1W5TA 1UHWA 1E3HA 2Y9ZA 4RDUA 4IHXA 5K1YA 4XOPA 3GTMJ 3K2AA 1GDTA 2V9VA 1ZRDA 2HYGD 1PUEE 4RGSA 1XCVA 1TP4A 4BEHB 1BIBA 1SC7A 1IUFA 1MSFC 4HNUA 2HS5A 4WXDA 5DV5A 4A5NA 4OIPF 3AG4H 5H6RA 2XRNA 4KFCA 4UV9A 3HRUA 2XAGA 1R6RA 2CG4A 1Z21A 3LAJA 1EJ9A 5JVTA 2FE3A 3A02A 4P96A 3SYTA 3T8RA 5A2QK 4YFKF 3BP8A 1FBQA 4E70A 1HLVA 2CW0F 2DYSH 4Q5SF 3U1DA 3D5LA 3ULQB 3L2UA 4ZH4F 2GBYA 5BOXA 2EIJH 3BPVA 1D5VA 3GFIA 1I39A 2ECCA 1QO0D 4II3A 5GPAA 2NVYJ 2NAZA 4XKVA 3L2VA 3W6VA 2IS2A 4RS8A 5CQEA 1O7FA 1ZGAA 1HBXG 1TQPA 2VOPA 2DQRA 4BDYA 4OMZA 3A01A 2AO9A 3HSEA 3AL0C 2EFPA 1B8IB 5AONA 3ELKA 1MBJA 2HU9A 1JUPA 3M8EA 2OPTA 2W24A 1G3YA 2R7ZJ 2ZSIB 4LMYA 2P6TA 4ITVA 4L5IA 5HLIA 1ETKA 3H3UA 3WHCA 4W97A 2MH2A 2HWVA 3W3CA 1DU6A 1TWGJ 1WI9A 3JRCA 2TDXA 1DP3A 1MH4A 3J81Z 4BY7J 1U3EM 1RUOA 3IRRA 1UELB 1FYKA 4XN0A 1D0ZA 4UNOA 2DAOA 3FXOA 4ZYEA 1VQ5I 2NNYA 2L9VA 2JQ7A 5C4JJ 4XLHA 3LFUA 1YS6A 2LH9A 4M72A 4GYGA 1GUUA 2GIZA 4JP0A 2PFBA 1SVLA 5L3GA 2CUEA 5LFAA 4K2EA 3MKLA 2DBBA 4P9UA 1MBEA 2F6CA 3OIOA 4FQGA 1JKRC 2EIKH 3FK7A 4UV8A 3CF2A 3KIOA 1Z9CA 2BY1A 3S93A 2XB0X 4LB6B 2JWTA 5FFZA 3HC7A 1FP1D 5D4SA 1BI0A 4BJ5C 1LE8B 3F6OA 4XQFA 1FTZA 3D1NI 3MKWB 2VBYA 3S3OA 4D5FA 3DBLB 3TP3A 4XLEA 3GTGJ 1IV8A 2LY1A 4I09A 3OYGA 5FD6A 2DA6A 2Y69H 1X1DA 2FUG2 2OZUA 3A03A 3MD2A 5FROA 2LP0A 2XASA 3S2DJ 3VSLA 4JBAA 4EJVA 4BJ6C 1T39A 2L9SA 1WJBA 3LSKA 5D5UB 2LRDA 5JFRA 2KDZA 3HTSB 4L0YB 1P4WA 3F8MA 1MBGA 5KAFC 1LKXA 4OOIA 2G7HA 1QHGA 3O3KA 4V2GA 2LREA 3H0GJ 2IP2A 1JUSA 1FOYA 1B4AA 1NK3P 2XVCA 4IOAF 2DK8A 2CFXA 3HOSA 1LFBA 1POGA 2LFBA 5CQGA 3TOBA 3OOPA 2IS6A 5CVUA 3P9IA 3J7AY 3E5UA 2A6HF 4HX4A 4Y33A 3GVAA 1YRNA 4AUXA 4E7IA 5D6EA 1PP8F 4IHSA 3F8CA 4C30A 5K7HA 1SAXA 3T0YA 2L7ZA 4MTEA 3D0SA 4AVPA 1R1TA 3S1MJ 3UKGA 2V1DA 2QQAA 4W1UA 1OYWA 2HTSA 3QOEA 1W5CC 2DDAA 1T6SA 3ECOA 1V5EA 5IOYA 1C0WA 3VFZA 3H5RA 3E7LA 5HODA 1P7IA 2FA5A 1ODDA 1Z6TA 3KPHA 3KLNA 3R0AA 4M9XA 5KAIC 4O3MA 3AFHA 2LBFB 4XICA 4XSXF 3OYKA 1W0TA 3E6DA 3EDPA 4AWXB 5E3NA 5KNLA 4NB5A 2WB1N 4BS9A 2ICWG 1ZG1A 5J4VA 3G73A 3ZMTA 2HKOA 2W57A 2W00A 1XSDA 1LEBA 3SZTA 2G7UA 4XNFA 2JTVA 1DPUA 1BN5A 1LFUP 1TNTA 3QP5A 2E2IJ 3CCQI 1ON1A 4PJMA 2WTEA 4MFEA 4YIFA 5H6QA 3CMYA 4A12A 3CCSI 4MNUA 3PQJA 4EM2A 2RQPA 2CUZA 2HYJA 2ACJA 1FP2A 2QA4I 1O3SA 1R1VA 4CCMA 3GTOJ 2ZB9A 3QU3A 3DEWA 5D6FA 3ZMDA 5IYBJ 1REPC 2HOSA 2KMUA 2XKOA 2GXGA 3KYCB 2KISA 2Z1DA 1EH6A 3HUGA 4HLXA 4UY8I 3L2CA 3Q5FA 4LOCA 3HRSA 3GTKJ 1HDDC 1UAAA 3I55I 3BROA 3F8BA 4KJZA 3E3VA 5H20A 2LYCA 1ACIA 1ETOA 1JUMA 2HYFA 4BHPA 2M4KA 5B1AH 3RPUD 2VB6A 3ASOH 3K4NA 2Q0OA 1OKRA 1U6GA 3ZN1A 5HVQC 2K02A 4XRFA 4ON0A 1WWXA 3FXLA 4ESJA 2R93J 1IXCA 3RYPA 4DQ2A 1CGPA 2F4IA 2XF7A 2YPRA 2EA2A 3FBIB 3QPLA 4XRMA 3VEPA 3GFJA 1WCMJ 1HXDA 1HF0A 2VONA 2J5OA 5AIQA 1HQCA 2WAQA 2Z3YA 1S3JA 3KP5A 3J81K 4R1HA 1R58A 4ANJA 4CZZA 5ICEA 2JSPA 2R7VA 2IVMA 4L18B 2Z33A 3E5QA 1TWHJ 2IEKA 2JUCA 3H3ZA 4HX7A 4M3FA 4B4CA 1MMSA 1O3TA 4JX5A 5FLXK 3WTTC 1P4AA 2FXAA 1NTCA 1YYVA 1CF7B 5J3LA 5GTHC 1R5GA 3TGNA 1X1BA 1QVTA 4I0AA 3EQLF 3ZQIA 4RB3C 3HKZN 1W4MA 3O8HA 3DBRB 3HM5A 2HQAA 2VQHA 3DPUA 1JHFA 1YLFA 4G6QA 5DS9A 3I4PA 1WQ2A 4NC8A 4OINF 2ESNA 4BHBA 2R5YA 4HDUA 3PO2J 3GLXA 3FBNB 2BYVE 4OMYA 2LC2A 2VUMJ 1RNLA 4KIGA 4JK1X 3U2RA 4UVCA 3CMEI 1ZQ3P 4JOMA 2I10A 3JSOA 1E3OC 2AXLA 3CP8A 2FQ4A 1FMWA 1RETA 1LDKB 2KJBA 4GGGA 3E1SA 1G3TA 3DTEA 5CPRB 2HXIA 2XSJC 3ZQGA 2AXTC 5GTIC 2W25A 3H92A 4BXUA 4U88A 1MMAA 3JAMZ 1GVJA 3R60A 1S7OA 5CVIA 2QSGX 4E7SA 1W1WE 4IO9F 1VQMI 1YJWI 1KYWA 2RKHA 5IY5H 4DYRA 1FJLA 3FXMA 3QYEA 2XGDA 3CF5F 2QBYB 4XKWA 4KNYA 4KA4A 3S3MA 1ZRFA 1T8IA 1HOMA 2HGCA 2WA0A 1J75A 3BZ6A 2OCEA 1KQ9A 3QPHA 5TJJA 4UHTA 4A3EJ 3WG9A 1TWAJ 3L09A 2H6CA 5E17F 2KZVA 2NOGA 3S14J 3HG9A 3PSFA 2L7KA 4PGHA 2F4MB 1OCRH 2Y75A 3SDBA 3TO6A 5D8KB 1QZZA 4FHTA 3BOQA 3WE3A 2M0CA 5BPIA 3W2WA 4ZTJA 4ESBA 1I1GA 2FBHA 3LAPA 2HR3A 2ZXIA 1L3LA 1AKHB 4HZFA 2PMZA 4CCLA 2E7XA 1J59A 3PNVA 4NBQA 2K9LA 2Q2EB 2BY3A 5LHHA 1OYIA 1YE9A 2OCCH 4N0BA 1J2XA 1DPRA 1BBYA 3OYBA 4JYKA 2A6TA 3PQKA 2AHQA 1VQ8I 2H94A 3P9CA 2XROA 5LRSA 4B43A 1YJNI 1LEAA 1U2WA 2XIGA 3S16J 2VPRA 3CO7C 3WTZA 4A93J 1B6AA 1JJ8C 2EA4A 4BXXJ 3DPTA 5J47A 1OISA 3GZ5A 2OJED 4N4OB 4Y17A 2RC4A 4J01A 2EFNA 1IRGA 3F3XA 2LKSA 3OMYA 1IN6A 2OQGA 4A3FJ 3IWZA 2P4WA 3KEQA 2XKPA 3S1RJ 3CO6C 9ANTA 1XD7A 2DO7A 2XAQA 3ZMZA 4HSTA 2JUGA 1U5TA 5J4YA 2XGEA 3C2BA 2PLYA 2TRTA 5GPCA 1MJ9A 4NUBA 2DODA 4P55A 1IRXA 2VLAA 2V79A 4E6KG 1PDNC 5HOOA 1R4NB 3FX3A 4L5JA 1HW2A 1HC8A 3NQOA 3F23A 2H6BA 4FASD 1DP7P 1BI3A 2HZDA 3DXJF 4IHWA 3I58A 3BG6A 4KUMA 5K5QA 5K7ZA 2MBFA 3I0TA 1WJFA 1X2MA 1YG2A 2M30A 3DTIA 2V4JC 4DNCA 3HDDA 3HZJA 3F22A 2E71A 3I54A 3IHUA 1IC8A 3KEOA 3CJTB 3IKVA 3G2BA 1MDMA 1J5YA 1I5ZA 3ZMUA 2WY8Q 4MQ9F 3D5RC 3JW4A 1W7PA 2P8TA 4MLOA 1R4MB 3TOAA 3SEZA 3FMQA 2L4MA 5AIPA 2W1OA 3M1CA 1Y0UA 2MLGA 4LLLA 1M1EB 4BE1A 2V9PA 1P6RA 1G2HA 2Q8KA 5J8FA 4DZPA 1FOXA 1H89C 2ZBKA 4D7NA 1ONVA 1SMTA 3JRBA 2RNJA 3AKZA 2FJ1A 4G9YA 2VC0A 1R5ID 4XONA 3RKXA 1SANA 3MZ8A 2X6YA 4NNJA 3N4MA 1WJDA 2ZFUA 1RKTA 2LKPA 1K6OA 1X4PA 1BR2A 3DCFA 4BY1J 3KLOA 3MEXA 4ZTFA 1WH5A 4RAFA 1D0YA 4L9NA 5HS9A 2RVCA 1BR1A 2PJPA 4IJAA 4BEHA 3A4CA 4TV7A 1R1UA 2HQNA 2FX0A 4AIHA 2NS7A 1WKMA 4PDKA 1YIOA 2I5UA 2COBA 4HOBA 1Y6IA 1U5TB 1VQOI 5FLMJ 3S1NJ 2DXIA 1XGNA 4WX9A 5HS8A 1TTYA 4Q4ZF 5F27A 2ZMEB 3JAMK 2IRFG 4LIUA 1A36A 3TKYA 2X51A 3RDIA 4IVNA 4X1EA 1BOAA 4ESFA 4XKCA 4FE4A 2KIFA 1FSEA 2X1EA 2K5CA 2UZKA 3O8GA 2VKDA 4A0ZA 3WTXC 4FT8A 4PUSA 1U8RA 2RDPA 2E34A 1R36A 2GOMA 2Y0SA 3A2KA 2LY2A 1QQIA 3BG9A 3GXOA 5BS6A 2PBIA 5HS7A 1WJ5A 1ZKGA 1I3AA 3N05A 5D4RA 2K9NA 4BE0A 2VE8A 3L00A 2KRFA 1V4RA 1S8NA 2MD5A 2L2OA 5GAHJ 2IGKA 4IRGA 2DJIA 2E35A 1W7PB 3FM3A 1BL0A 2WAEA 2X0LA 1K78A 2Z99A 3LFKA 5BPDA 1YW9A 2ZKZA 2DOFA 1TQMA 2KQRA 1PJRA 3FK6A 3LSIA 4GYIA 5TGTA 4H0EA 2L9NA 4KIFA 5FKOA 5M5XJ 1MNEA 3K4BA 3K10A 2LOOA 4U7DA 4DJAA 4ETSA 2DA4A 5D5WB 4IHTA 3DLAA 4HEA2 2V7FA 1LB2A 4M3DA 4HNTA 1IV6A 1J7KA 1R23A 1ZHFA 1Z7LA 1D1AA 1YIJI 1Z0XA 2M8GX 2DLLA 2R92J 1VQ7I 3CESA 2VE9A 2V1NA 5HNHA 1SD7A 1WH7A 1UHSA 2E2JJ 3V7CA 1PP7U 4V19K 1I50J 1LUJB 3V42A 1YFHA 1Z05A 1Z91A 3ZMVA 2EFWA 3CCRI 4ZDPA 1STZA 3BR1A 1S5LC 2EV0A 4AVZA 3I5UA 5M5WJ 4IQJA 3F8FA 4OWRB 4RAZA 3ABUA 4LLGF 3ZQFA 5C3EJ 2DI3A 4ENNA 3H5NA 1Y0NA 2CQKA 1FX7A 5LGNA 1LE8A 4AU7A 2VQGA 3GO5A 4B3AA 3O6BB 1YI2I 2JA5J 4DGWB 3DP7A 2KIQA 5HLGA 1F1ZA 2W85A 2W48A 5KVRA 4HQEA 2DQLA 4OIRF 2JVHA 1QNTA 1X3UA 2O5RA 3KE2A 1DGWY 1JE8A 1OCZH 3LA7A 2YX7A 3ZQHA 3N97A 3C1DA 3DPLC 2XGXA 1XMXA 3L2QA 3WU0A 1V55H 5L3CA 3NWSA 3OWTA 3OYFA 2LTPA 1N78A 4P1WA 5CLSA 3SXYA 2K40A 3CLQA 3GUDA 2ZXJA 1FBSA 1O7LA 1IN7A 2QWWA 2MC3A 4IX7A 2DOAA 2OV7A 1K78B 1MJAA 4E7HA 4KDPA 1V5FA 1PVEA 1NH3A 1BIAA 4EGYA 2FEZA 3ZRGA 1T98A 4LK1F 1G3WA 2XAHA 4DIQA 2J5PA 4HPQA 3PFYA 1HSTA 2K7LA 1K4SA 2EZLA 4HQMA 4LB5A 1OCPA 3CCMI 5EF6A 1XN7A 3G1MA 2ID6A 1JHHA 3KZZA 3GTJJ 4CHUA 1Q1VA 5B5EC 2V6CA 4A6DA 1U78A 5KCMA 6PAXA 2JA7J 2O61A 2XDVA 2A68F 2ZJQF 3BR3A 3K9TA 3IAM2 1GHCA 4ENJA 1S6LA 4A6EA 3LSGA 3LQQA 2X6OA 3CCJI 3QOPA 3HHHA 4PJJA 1DUXC 3BTJA 3FM5A 3OY9A 3COAC 2KP6A 2XF6A 2YR2A 1DQUA 1WJEA 2LBFA 1LDJA 2UXNA 4FX0A 4N9IA 1SMYF 3TO7A 3RZOJ 2LK2A 5FRMA 1UB9A 2E1OA 3I64A 3CUQA 1HCRA 4P5OA 3FF5A 5LHGA 1VFCA 2EILH 2VBWA 3M4OJ 3IAS2 2WADA 4A3LJ 3HL2A 5CVVA 2JMWA 1K79A 4A2UA 2KL4A 2QKMB 4AD9A 1TZLA 4UUTA 3HOTA 4J19A 2IGMA 3H9JA 3I59A 1QZEA 2P5VA 3EPZA 1WGXA 4LJZF 3CJQB 3PIOF 2OQRA 3ABKH 4I76A 4OAYA 2IA0A 1UG0A 1IDYA 1OCOH 2BZTA 5DM7F 2O6GE 3SZGA 2E1NA 5ILVA 2HPIA 3JSPA 2F5VA 3HIFA 2DW4A 4QTRA 4X0GA 2R0QC 1E17A 1JI8A 4BKXA 1S7EA 4QWQA 4ENKA 1QVUA 1Z6RA 3G3ZA 1TL8A 1JKOC 3ZCOA 1YHQI 3F6VA 4U0WA 2HDWA 2JT1A 2X48A 3ISPA 1IRFA 4P9FA 4PJLA 3TEDA 1YOVB 3SFIA 3FXJA 2PJRA 5IT9Z 1XGMA 3BLYA 4G12A 5EYRA 1BC8C 2HXOA 3KYLA 3IUOA 1OQYA 4G7ZF 4PFPA 3HHGA 4IZZA 3M9AA 1QPIA 3CCLI 1ZRCA 4PJNA 4BJTA 1X3ZB 2IS4A 1X58A 1OJLA 1GXQA 1QZYA 5LD2C 1ETQA 2HEOA 2CS3A 2GZWA 3OOUA 3MMYB 3K70C 3BJ6A 2ELKA 4WXHA 3ROUA 4C2UA 2QSHX 3ZQ7A 4ASNA 1DGRM 4WCGA 2DYRH 4AYBN 4N4NB 3VB2A 2ID3A 5ILUA 3LSRA 1H88C 2GAUA 1IF1A 2WB1A 1F5TA 5F1RA 1AA7A 1BA5A 3RJPA 3MZHA 2VJJA 3NARA 1DU0A 1D8JA 2M9HA 4HRIA 4LLNA 1JTXA 2HNHA 1EF4A 3CDHA 4RB1A 1CF7A 1XC5A 2XAUA 2R7QA 4KMUX 1IG7A 2BE5F 5HDGA 4J00A 1OMIA 3GF2A 2DA5A 2IW5A 3S2WA 2NYXA 4CO8A 3CUQB 3HJEA 2O8KA 4PZJA 4B44A 4FETA 4XR6A 2K86A 4IL6C 1WI3A 5F64A 2IBDA 3G4SI 4HF1A 5E3LA 1MSEC 2O7OA 3CC7I 3I59B 2IS1A 4HX8A 3I71A 2OD5A 3OS1A 1L0OC 2CWEA 4PCQA 1IRZA 4LK0F 2NXNB 1OR7A 5E18F 1FYMA 2R4GA 1WFXA 4NHJA 4RLFA 1LNWA 1PUFB 1FOKA 1P7JA 1X2NA 2DFFA 4B8XA 2WY7Q 1NG6A 2MFZA 3EUAA 5DEQA 4HF0A 4EMSA 3CCUI 4HG2A 2Y30A 1U5TC 2ZXWH 4CGZA 4B48A 2F2EA 1JTYA 2V9KA 2PJRB 1ZG3A 2I8DA 3ECHA 2QGUA 3B73A 2ZMEC 1DDNA 4EGZA 1SVOA 2F5FA 2X4HA 3QU6A 1OCCH 1BJZA 4RA2A 5ICCA 3WTYC 1E0EA 5J6XA 1YS7A 1KQ0A 3KEYA 3BJAA 2EZHA 2QBYA 2GQQA 3QYFA 1QRYA 1Y1WJ 1ZK8A 3SJMA 3K6GA 2R7FA 4I0BA 1H0MA 2EZIA 4G8XA 4BBRJ 2R7RA 1XDSA 2NVQJ 1W36C 3ONQA 3DEUA 4DBQA 5IPAA 2DPDA 2OC6A 3C3WA 2CJJA 1EA3A 2M7AA 1H8AC 1ZREA 3M3YJ 5EDNA 3EUKL 1BJAA 4KN7X 1TW2A 4YFNF 4E7KA 3K4LA 3HKZA 4YEJA 2M3AA 2QM3A 5J1UA 4G7HF 1A5JA 3BQYA 3JRGA 2JRTA 1OYYA 1JGSA 4OU0A 2VKEA 1AKHA 1RUNA 2AS5F 2EBIA 3AAFA 2LVSA 3S1QJ 5DD4A 2Q2EA 3GLLA 4A3KJ 4M74A 3OYDA 2L01A 1OLTA 2M8EA 2DA1A 4PFOA 2DT5A 3BQZA 1B9MA 2ZCWA 3SDGA 2D1HA 4BXFA 3WTSC 4HLYA 2CQXA 3F8NA 2DU9A 1HSJA 3OR2C 5DM6F 3KZIC 1D8KA 1XB4A 3LQRA 4A69C 3L2RA 3MAJA 4IHVA 3MKYB 1MW7A 3VYSB 1R22A 4UUVA 1TQIA 1P9QC 2PEXA 5FB2A 1HKSA 2VKVA 2Z5UA 3CDIA 5D8LB 1N77A 2L3DA 3NEUA 2WAQN 4BAYA 3RKQA 4ZC3A 3T1BA 2HDCA 2L7FP 3M8JA 3BTCA 1VQNI 1T2KA 3S17J 3KZYA 1X1AA 3EETA 4HW0A 2XV4S 3R0JA 2B63J 1MMGA 3V8LA 2HOTA 1EH7A 3BZCA 3H36A 3LNQA 3WTVC 5F1JA 2DDBA 3LWFA 3C18A 3KP7A 1YW7A 2Y0MA 1T08B 1TLHB 2K4JA 3MQ0A 1JJ6C 3GTLJ 2LG4A 5IT9K 1Y8QB 4JX6A 3DKXA 2NOJB 1U9NA 4F91B 2GOXB 4WF2A 4LD5A 1ZH5A 3FISA 3IC7A 1QGPA 2DOEA 2K27A 3HGYA 2ELJA 4JX4A 2H09A 1XGOA 3P9KA 2R5ZB 3BTLA 2K4BA 5LBQA 2R3SA 1YX3A 2W84A 4HNVA 2X9DA 1T95A 1BI2A 3DQVC 4I99C 1YX5A 5LLQA 4D1QA 2F48A 3CC2I 3A0BC 3K1MA 3RQIA 5JI6A 1ETVA 4M73A 3LSHA 1VZ0A 2E2HJ 1AWCA 3F9KA 5J1RA 4CXFA 2DN0A 3WU1B 3SZPA 2CW8A 3L7WA 3K2ZA 4D0PA 4S05A 4CYCB 4MEYF 2BV6A 1ETXA 2LMDA 1RR7A 1X1CA 2XGCA 3FKIJ 3IWFA 1F4KA 4XL9A 4RB2C 2EV6A 3PL8A 2GA1A 4ZZLA 5EGOA 1LJ9A 1SD5A 4XBFA 5L3FA 2B9SA 2OU2A 1VQ4I 2QENA 5D5VB 4ZYHA 1BW5A 2K3FA 4IXAA 3V7SA 2ZC2A 1RC9A 3GEZA 2LR8A 3ABMH 2CQ7A 2JA6J 1B72B 2E1MB 3QPTA 3OL4A 1RI7A 1ZARA 3KFWX 4CCKA 2DPUA 2BVLA 4AIKA 2H1KA 3H9QA 3NWTA 3HSFA 3I9V2 4IHYA 5C4XJ 2K9SA 2A5WA 3FDYA 3B6CA 1VNDA 2UV1A 3ML6A 2VL8A 3OIPA 3HOYJ 4A3CJ 4XLCA 2BHYA 3TMOA 2NS0A 5EEAA 4MEXF 1A6IA 4C3HJ 1R9TJ 3GBGA 1Y8RB 1ZLJA 3CZ6A 1O4XA 1T0FC 5DDGA 1IXSB 2PQ8A 2PX9A 4N9HA 1YQAA 1Z3YA 3CMAI 2Z9OA 4GCVA 1MD0A 3QPSA 2L54A 3PFIA 5E1XA 1Y1VJ 2RV8A 2VC1A 3R61A 3J7ZI 2NNNA 2DA7A 2PG4A 2WBMA 2E5NA 3FHNA 4X6AJ 2JJ7A 1BI1A 1LFPA 2DMQA 2YSRA 3BWGA 1JT0A 2QQ8A 2ZMEA 5DCMA 2VODA 3L2WA 2FNPA 2KLOA 3HTUA 3IL2A 5FKKA 1QHHD 3V4GA 3HYIA 2QKLB 3LSMA 1MBKA 3LA2A 2F5CA 1VQLI 2IGOA 3MN2A 3GTPJ 2ESHA 2X85A 4A5MA 4KN4X 1S7AA 4ZYAA 2VQCA 3TDZC 2DCEA 2D5VA 5KK1A 3DBHB 2P6SA 4Y7NJ 3P7NA 2CV0A 2FBIA 5H2FC 5L3BA 2FOKA 2BXYA 3TQNA 3V7RA 2XAFA 5EG0A 2XPWA 5C44J 4MTDA 3JRHA 2R7WA 5F6FA 4A3DJ 1ZN2A 1BW6A 5E20A 4XOTA 1MBHA 3M8FA 2VJ4A 4BDZA 2H8RA 1JGGA 1F36A 1KONA 1USTA 1LDDA 2DFHA 3VYRB 2VJIA 2K3PA 2ZNYA 5EGOB 4BACA 1IN5A 3BC8A 1KU3A 3IH4A 2BY0A 2W82A 2ISZA 3BJOA 2AQEA 4MGRA 2XF5A 2YU9J 1D5YA 3Q0UA 2L5QA 1GXPA 3UR3C 1W0UA 2L02A 3BY6A 3S8PA 4ABZA 2HZTA 3OYMA 3DFGA 4F55A 4BQNA 4RBOA 2HFHA 1XCBA 2EFQA 1T33A 2FU4A 1MH3A 3K1PA 2MSYA
chains in the Genus database with same CATH topology
2M45A 5FD5A 4KMFA 3Q9SA 4F7ZA 4U0YA 1FNNA 4A0YA 3CUQC 1YTYA 3TDUC 3FWEA 1HW1A 5LRRA 1RIOH 1E2XA 5LEJA 2FMYA 2B0LA 4WK8F 4BH9A 5DCMB 2KJCA 2P7CB 4LGWA 3JTGA 4ZYDA 3I53A 3KP3A 1UCRA 1O3RA 4HA8A 4RGRA 4I98B 1R7JA 3F21A 3BDDA 3GFLA 1UFMA 4HBLA 4NQWA 2V1UA 4M71A 5E8IA 3RPUA 3NRVA 3W6JB 4YFXF 5IT3A 2MH9A 2CGPA 3B02A 2ZFWA 3E6BA 2QQ9A 3RIRA 4HYEA 2COMA 2JSCA 1Z7UA 3WTUC 4KT5C 2ADUA 1UHMA 2XAJA 1BM9A 3REOA 1V3FA 2FSWA 2LNBA 1IUYA 4Q47A 2GXBA 2XHKA 4OIOF 3K69A 4KICA 2KIUA 3SQNA 3SFZA 5LGTA 2GWRA 5FGMA 2H27A 3ERED 5L3DA 5J8CA 1H9TA 1T0FA 2OAZA 1FPQA 3WGIA 3RKYA 4UVBA 4GO1A 2XUBA 1G6NA 1VTNC 4KIBA 1ULYA 4YG2F 2QLZA 2IJLA 1ON2A 3E6MA 3O2PE 2STTA 2HQRA 1Q1HA 2YX4A 4MHGA 2F5EA 2P7VB 1H9GA 1K7AA 1MGTA 4EVIA 3KP4A 3RTRA 2IT0A 1SFEA 2HKXA 1MZBA 3GYHX 3R4KA 1SFXA 2F5DA 3T8TA 4AIJA 2O3FA 1KA8A 1BC7C 3BPXA 3WGHA 3WE2A 1B1BA 3E5XA 2WC2A 1AOYA 2ZJ2A 1XDUA 1XMAA 4OIQF 4M6XA 2A07F 2DFIA 1D3YA 1P92A 2EB7A 4HAMA 4Y15A 3U9GA 1S29A 3Q9VA 2PN6A 5FLXZ 2OA4A 1P2FA 2O03A 5LEKA 1P4XA 1SD6A 1OPCA 4Q48A 4EJUA 1LVAA 4IPAA 2Y48A 2A5YB 2DTRA 1IN4A 1G3SA 4HF2A 2E7WA 2D45A 1HW5A 4R8HA 3IRQA 1NHAA 3DKWA 3T5XA 2OZ6A 4ZYGA 4HV6A 4S04A 4Y13A 3FMSA 2PMUA 1XSXA 3M1EA 3GFMA 1LQ1A 4UXNA 3LA3A 1ZG5A 5JHUA 4G6DA 1SFUA 1FYLA 5DUKA 1T38A 2UWMA 4L9TA 1FWZA 2EK5A 2OBPA 3GW2A 2FF4A 3FMRA 2QYOA 1W7PD 3TO9A 2QZ8A 5EEHA 4ZZDA 1IN8A 1FZPB 3KETA 1TBXA 4M9SA 5K5OA 2FQ3A 5D5XB 3MCZA 5HDNA 1SD4A 5CVRA 4HDVA 4IF4A 4HV5A 1KQ8A 1FT9A 5E1WA 1O57A 4O5VA 2VBXA 5CYVA 4LFUA 1EH8A 2CSOA 4M9ZA 2YU3A 1MKMA 3CJNA 1ZAOA 2PMHA 2JPCA 4L0ZB 4QLCU 3K1NA 3HSRA 2STWA 2D2WA 2IA1A 2VBZA 3QP6A 1KU9A 4I02A 2QQBA 2HTJA 1R5HA 1B59A 2PI0A 2QUFA 2HOEA 2M1BA 5ICFA 4M6YA 5DCFA 3LSTA 4U0VA 5ED4A 4EJWA 1KU7A 4G94A 3L9FA 2LDUA 5L3EA 1YO5C 1F9NA 1R00A 5DYMA 4EQQA 5BMZA 2VN2A 1G4DA 1WSUA 3E6CC 1A04A 2IPQX 2WWYA 4XLNF 5FFXA 1ZGJA 5DUIA 1QPMA 3C7JA 1J9IA 3OV8A 1RZ4A 2FBKA 3JTHA 5JR3A 2BGCA 3ZN0A 1HKTA 3ZP5A 3J7AO 3WODF 2EWNA 2QVOA 2WV0A 2VT2A 5CVJA 2A6EF 1IZ1A 5E8GA 2O0YA 3KP6A 2ETHA 2RN7A 3SHFA 4CYDA 4BNCA 1TNSA 4EM1A 3CUOA 5EEGA 4GXOA 3HRMA 2ELHA 2MA3A 5CJ9A 5DD8A 3FXQA 4RAYA 1YW8A 3QAHA 2FMLA 1KU2A 2L4AA 1FBUA 2R7DA 5FO5A 3GX4X 2P5LC 1O3QA 1FLIA 4YIIA 4EV0A 2BBYA 3R6SA 3RYRA 2FRHA 3RI4A 2EV5A 3VODA 1HKQA 2V1XA 2GA2A 3F72A 3ZPLA 2RGVA 3J80Z 3EUHA 1ZYRF 4EJOA 1B9NA 4KYWA 4UVAA 1IAWA 1MJBA 1IXRC 1EV7A 2LF8A 3KCCA 3CLOA 2G9WA 2ZO4A 3RKWA 5HLHA 3QRFF 3ZMSA 1I1SA 5TRDA 2LF7A 3MFKA 1JXSA 5E1ZB 2ISYA 2JPBA 4EM0B 2E1CA 2ZNZA 2A3SA 2JZYA 4MQVA 4ENMA 3E97A 4I01A 5A2QZ 2VOOA 2EFOA 3VOEA 4A0XA 4Z2YA 2A69F 2O8XA 4WXCA 5ICGA 4BYYA 4L9VA 1USSA 4RB0A 1I6XA 3EYYA 2EJRA 4G7OF 4XSZF 2M5WA 2IA2A 3K0LA 3MZYA 4BQAA 3GZ6A 3RPQA 1XSVA 4L9JA 2D1VA 5LGUA 1KGSA 3GWZA 2KIMA 4LG0A 1FY7A 4B09A 1WRJA 5ILSA 3WTWC 4RGXA 2C6YA 1FC3A 4EJTA 1Z1DA 3MWMA 3HRTA 3FZVA 1QBJA 1TW3A 4IRIA 5BQTA 2NRAC 3ABTA 2MLKA 1XMKA 5K5RA 3CTAA 2CO5A 1I27A 4R79A 4O6JA 4U7BA 3FHZA 2GIVA 4XLPF 4PGGA 2A61A 3KP2A 1W5SA 3W6KB 3DV8A 4RGUA 2FNAA 2UXXA 1ZLKA 2LSOA 2DK5A 1KYZA 4I7HA 2M87A 4I2OA 5ERIA 4IRHA 3IKTA 1MDMB 2VXZA 4FX4A 4CDGA 2KKOA 5LHIA 3EYIA 3WGGA 2BEOA 3J80K 1J0RA 4LG0B 3M7GA 3FXUA 4WWCA 4JQFA 3FXRA 3V8KA 4BHCA 1XGSA 2VT3A 1IW7F 4CICA 1FSHA 5HDKA 3V8JA 2CYYA 3DF8A 2P5KA 1W5TA 1UHWA 5K1YA 2V9VA 1ZRDA 2HYGD 1PUEE 4RGSA 1XCVA 1BIBA 2HS5A 4WXDA 5DV5A 4A5NA 4OIPF 5H6RA 2XRNA 4KFCA 4UV9A 3HRUA 2XAGA 2CG4A 3LAJA 5JVTA 2FE3A 4P96A 5A2QK 3T8RA 4YFKF 3BP8A 1FBQA 4E70A 2CW0F 4Q5SF 3U1DA 3D5LA 3ULQB 4ZH4F 5BOXA 3BPVA 1D5VA 3GFIA 1QO0D 2NAZA 4RS8A 1O7FA 1ZGAA 1HBXG 1TQPA 2VOPA 2DQRA 4OMZA 3HSEA 2EFPA 5AONA 3ELKA 3M8EA 2W24A 1G3YA 4LMYA 2P6TA 4L5IA 5HLIA 3H3UA 2MH2A 2HWVA 1WI9A 2TDXA 3J81Z 1U3EM 1RUOA 3IRRA 1FYKA 4UNOA 2DAOA 4ZYEA 2NNYA 1YS6A 4M72A 4GYGA 2PFBA 5L3GA 4K2EA 2DBBA 4P9UA 4UV8A 1Z9CA 4LB6B 5FFZA 1FP1D 5D4SA 1BI0A 3F6OA 2VBYA 4I09A 5FD6A 2OZUA 2XASA 4JBAA 4EJVA 1T39A 5D5UB 5JFRA 3HTSB 4L0YB 1P4WA 3F8MA 4OOIA 2G7HA 3O3KA 2IP2A 1B4AA 2XVCA 2DK8A 2CFXA 3HOSA 3TOBA 3OOPA 5CVUA 3P9IA 3E5UA 2A6HF 4HX4A 3GVAA 5D6EA 1PP8F 4IHSA 3F8CA 1SAXA 3T0YA 4MTEA 3D0SA 4AVPA 1R1TA 2V1DA 2QQAA 1OYWA 2HTSA 1T6SA 3ECOA 1C0WA 3VFZA 2FA5A 1ODDA 1Z6TA 3KLNA 3R0AA 4M9XA 4O3MA 4XSXF 3E6DA 3EDPA 4AWXB 4NB5A 1ZG1A 3G73A 3ZMTA 2HKOA 2W57A 1XSDA 1LEBA 3SZTA 2G7UA 2JTVA 1DPUA 1BN5A 1TNTA 3QP5A 1ON1A 2WTEA 4YIFA 5H6QA 4A12A 4MNUA 3PQJA 4EM2A 2RQPA 2ACJA 1FP2A 1O3SA 1R1VA 3QU3A 5D6FA 3ZMDA 1REPC 2XKOA 2GXGA 4HLXA 1EH6A 3HUGA 3L2CA 3Q5FA 3HRSA 3BROA 3F8BA 3E3VA 5H20A 2HYFA 4BHPA 2Q0OA 1OKRA 1U6GA 3ZN1A 5HVQC 2K02A 4XRFA 4ON0A 1WWXA 4ESJA 1IXCA 3RYPA 4DQ2A 1CGPA 2YPRA 2EA2A 3VEPA 3GFJA 1HXDA 2VONA 2J5OA 5AIQA 1HQCA 2Z3YA 1S3JA 3KP5A 3J81K 4R1HA 1R58A 4CZZA 5ICEA 2IVMA 4L18B 2Z33A 3E5QA 4HX7A 3H3ZA 1O3TA 5FLXK 3WTTC 1P4AA 2FXAA 1YYVA 1CF7B 1R5GA 3TGNA 4I0AA 3EQLF 4RB3C 1W4MA 1JHFA 1YLFA 4G6QA 3I4PA 1WQ2A 4OINF 2ESNA 4BHBA 4HDUA 3GLXA 2BYVE 4OMYA 1RNLA 4KIGA 4JK1X 3U2RA 4UVCA 3JSOA 2AXLA 1LDKB 2KJBA 4GGGA 1G3TA 2W25A 3H92A 4BXUA 4U88A 3JAMZ 1GVJA 3R60A 1S7OA 5CVIA 1KYWA 2RKHA 2QBYB 4KNYA 4KA4A 1ZRFA 2HGCA 1J75A 3BZ6A 1KQ9A 3QPHA 5TJJA 4UHTA 3WG9A 3L09A 2H6CA 5E17F 4PGHA 2Y75A 3TO6A 5D8KB 1QZZA 4FHTA 3BOQA 3WE3A 5BPIA 4ESBA 1I1GA 2FBHA 3LAPA 2HR3A 1L3LA 4HZFA 2E7XA 1J59A 5LHHA 1OYIA 4N0BA 1J2XA 1DPRA 1BBYA 3PQKA 2XROA 2H94A 3P9CA 5LRSA 1LEAA 1U2WA 2XIGA 3CO7C 3WTZA 1B6AA 2EA4A 3DPTA 3GZ5A 4Y17A 2RC4A 1IRGA 2EFNA 3F3XA 1IN6A 2OQGA 3IWZA 2P4WA 3KEQA 2XKPA 3CO6C 1XD7A 2DO7A 2XAQA 3ZMZA 1U5TA 2PLYA 1MJ9A 4P55A 2V79A 1PDNC 5HOOA 3FX3A 4L5JA 1HW2A 3NQOA 3F23A 2H6BA 1DP7P 1BI3A 3DXJF 3I58A 4KUMA 5K5QA 2MBFA 3I0TA 1YG2A 2M30A 4DNCA 3F22A 3I54A 3IHUA 3KEOA 3IKVA 1MDMA 1J5YA 1I5ZA 3ZMUA 4MQ9F 3JW4A 1W7PA 2P8TA 3TOAA 3FMQA 2L4MA 5AIPA 1Y0UA 2MLGA 4LLLA 1P6RA 2Q8KA 5J8FA 2ZBKA 1ONVA 1SMTA 2RNJA 4G9YA 2VC0A 3RKXA 3N4MA 2LKPA 1K6OA 3KLOA 3MEXA 4L9NA 5HS9A 2RVCA 2PJPA 4IJAA 4TV7A 1R1UA 2HQNA 4AIHA 1WKMA 4PDKA 1YIOA 4HOBA 1U5TB 1XGNA 4WX9A 5HS8A 1TTYA 4Q4ZF 3JAMK 2ZMEB 2IRFG 3TKYA 3RDIA 4IVNA 4ESFA 1BOAA 2KIFA 1FSEA 2UZKA 4A0ZA 3WTXC 4FT8A 1U8RA 2RDPA 1R36A 1QQIA 3GXOA 5BS6A 2PBIA 5HS7A 5D4RA 2VE8A 3L00A 2KRFA 1V4RA 1S8NA 2MD5A 4IRGA 1W7PB 3FM3A 2X0LA 1K78A 2Z99A 3LFKA 5BPDA 1YW9A 2ZKZA 1TQMA 4GYIA 4H0EA 4KIFA 4U7DA 4ETSA 5D5WB 4IHTA 1LB2A 1J7KA 1R23A 1ZHFA 2DLLA 2VE9A 1SD7A 3V7CA 1PP7U 1YFHA 1Z05A 1Z91A 3ZMVA 2EFWA 1STZA 2EV0A 3I5UA 3F8FA 4RAZA 3ABUA 4LLGF 2DI3A 4ENNA 2CQKA 5LGNA 1FX7A 3GO5A 3O6BB 3DP7A 5HLGA 1F1ZA 2W85A 5KVRA 4HQEA 2DQLA 4OIRF 1QNTA 1X3UA 3KE2A 1JE8A 3LA7A 2YX7A 3N97A 3C1DA 3DPLC 2XGXA 3WU0A 5L3CA 5CLSA 3SXYA 3GUDA 2ZXJA 1FBSA 1O7LA 1IN7A 2QWWA 2MC3A 1K78B 1MJAA 4KDPA 1BIAA 4EGYA 2FEZA 1T98A 4LK1F 1G3WA 2XAHA 2J5PA 1HSTA 2K7LA 4HQMA 4LB5A 1XN7A 1JHHA 3KZZA 4CHUA 1U78A 2V6CA 4A6DA 6PAXA 2O61A 2A68F 3K9TA 1GHCA 4ENJA 1S6LA 4A6EA 3LQQA 3QOPA 3HHHA 1DUXC 3FM5A 3COAC 2YR2A 1LDJA 2UXNA 4FX0A 4N9IA 1SMYF 3TO7A 1UB9A 3I64A 3CUQA 4P5OA 3FF5A 5LHGA 2VBWA 5CVVA 1K79A 4A2UA 4AD9A 3HOTA 3I59A 2P5VA 4LJZF 2OQRA 2IA0A 2O6GE 5ILVA 2E1NA 3JSPA 3HIFA 2DW4A 1E17A 4QWQA 4ENKA 1Z6RA 3G3ZA 3F6VA 4U0WA 2JT1A 3ISPA 1IRFA 4P9FA 5IT9Z 1XGMA 1BC8C 4G7ZF 3HHGA 3M9AA 1ZRCA 1GXQA 1QZYA 2HEOA 2GZWA 3BJ6A 4WXHA 3ROUA 3ZQ7A 4ASNA 4WCGA 3VB2A 5ILUA 2GAUA 1IF1A 1F5TA 5F1RA 3RJPA 3MZHA 1D8JA 4LLNA 3CDHA 4RB1A 1CF7A 4KMUX 2BE5F 5HDGA 1OMIA 3GF2A 3S2WA 2IW5A 4CO8A 2NYXA 3CUQB 4PZJA 2K86A 5F64A 4HF1A 3I59B 4HX8A 3I71A 2OD5A 1L0OC 2CWEA 4PCQA 4LK0F 1OR7A 5E18F 1FYMA 4NHJA 1LNWA 1FOKA 4B8XA 5DEQA 4HF0A 4EMSA 1U5TC 4CGZA 2F2EA 1ZG3A 3ECHA 3B73A 1DDNA 4EGZA 2F5FA 2X4HA 3QU6A 3WTYC 5ICCA 5J6XA 1YS7A 1KQ0A 3BJAA 2QBYA 2GQQA 4I0BA 2R7FA 1H0MA 4G8XA 1XDSA 3DEUA 2DPDA 3C3WA 1ZREA 1BJAA 4KN7X 1TW2A 4YFNF 2QM3A 4G7HF 2JRTA 1OYYA 1JGSA 4OU0A 1RUNA 2AS5F 3AAFA 5DD4A 2Q2EA 4M74A 2L01A 2M8EA 2DT5A 1B9MA 2ZCWA 2D1HA 3WTSC 4HLYA 3F8NA 2DU9A 1HSJA 1D8KA 1XB4A 3LQRA 3MAJA 1R22A 4UUVA 1TQIA 2PEXA 5FB2A 1HKSA 2Z5UA 5D8LB 2L3DA 3NEUA 4BAYA 2HDCA 3T1BA 1T2KA 3KZYA 3EETA 4HW0A 2XV4S 3R0JA 3V8LA 1EH7A 3WTVC 3LWFA 3C18A 3KP7A 1YW7A 2Y0MA 1TLHB 2K4JA 3MQ0A 5IT9K 4WF2A 4LD5A 1ZH5A 3IC7A 1QGPA 2K27A 2H09A 1XGOA 3P9KA 2K4BA 5LBQA 2R3SA 2W84A 3DQVC 1BI2A 5LLQA 3K1MA 5JI6A 4M73A 1AWCA 4CXFA 3WU1B 3SZPA 3L7WA 4D0PA 3K2ZA 4S05A 4MEYF 2BV6A 3IWFA 1F4KA 4RB2C 2EV6A 4ZZLA 2GA1A 1LJ9A 1SD5A 4XBFA 5L3FA 2OU2A 2QENA 5D5VB 4ZYHA 4IXAA 3V7SA 3GEZA 3QPTA 1RI7A 1ZARA 3KFWX 2DPUA 4AIKA 3HSFA 3ML6A 2NS0A 4MEXF 1ZLJA 5DDGA 1IXSB 2PQ8A 4N9HA 1YQAA 2Z9OA 4GCVA 1MD0A 2L54A 3PFIA 5E1XA 2RV8A 2VC1A 3R61A 2NNNA 2PG4A 1BI1A 2YSRA 3BWGA 2ZMEA 5DCMA 2VODA 2FNPA 3HTUA 3IL2A 3V4GA 3HYIA 3LA2A 2F5CA 2ESHA 4A5MA 4KN4X 1S7AA 3TDZC 5KK1A 2P6SA 3P7NA 2FBIA 5L3BA 2FOKA 3TQNA 3V7RA 2XAFA 4MTDA 5F6FA 1ZN2A 5E20A 3M8FA 1USTA 1LDDA 2ZNYA 1IN5A 1KU3A 2ISZA 3BJOA 4MGRA 1GXPA 2L02A 3BY6A 2HZTA 3DFGA 2HFHA 1XCBA 2EFQA 2FU4A 3K1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M45 A;  5FD5 A;  4KMF A;  3Q9S A;  4F7Z A;  4U0Y A;  1FNN A;  4A0Y A;  3CUQ C;  1YTY A;  3TDU C;  3FWE A;  1HW1 A;  5LRR A;  1RIO H;  1E2X A;  5LEJ A;  2FMY A;  2B0L A;  4WK8 F;  4BH9 A;  5DCM B;  2KJC A;  2P7C B;  4LGW A;  3JTG A;  4ZYD A;  3I53 A;  3KP3 A;  1UCR A;  1O3R A;  4HA8 A;  4RGR A;  4I98 B;  1R7J A;  3F21 A;  3BDD A;  3GFL A;  1UFM A;  4HBL A;  4NQW A;  2V1U A;  4M71 A;  5E8I A;  3RPU A;  3NRV A;  3W6J B;  4YFX F;  5IT3 A;  2MH9 A;  2CGP A;  3B02 A;  2ZFW A;  3E6B A;  2QQ9 A;  3RIR A;  4HYE A;  2COM A;  2JSC A;  1Z7U A;  3WTU C;  4KT5 C;  2ADU A;  1UHM A;  2XAJ A;  1BM9 A;  3REO A;  1V3F A;  2FSW A;  2LNB A;  1IUY A;  4Q47 A;  2GXB A;  2XHK A;  4OIO F;  3K69 A;  4KIC A;  2KIU A;  3SQN A;  3SFZ A;  5LGT A;  2GWR A;  5FGM A;  2H27 A;  3ERE D;  5L3D A;  5J8C A;  1H9T A;  1T0F A;  2OAZ A;  1FPQ A;  3WGI A;  3RKY A;  4UVB A;  4GO1 A;  2XUB A;  1G6N A;  1VTN C;  4KIB A;  1ULY A;  4YG2 F;  2QLZ A;  2IJL A;  1ON2 A;  3E6M A;  3O2P E;  2STT A;  2HQR A;  1Q1H A;  2YX4 A;  4MHG A;  2F5E A;  2P7V B;  1H9G A;  1K7A A;  1MGT A;  4EVI A;  3KP4 A;  3RTR A;  2IT0 A;  1SFE A;  2HKX A;  1MZB A;  3GYH X;  3R4K A;  1SFX A;  2F5D A;  3T8T A;  4AIJ A;  2O3F A;  1KA8 A;  1BC7 C;  3BPX A;  3WGH A;  3WE2 A;  1B1B A;  3E5X A;  2WC2 A;  1AOY A;  2ZJ2 A;  1XDU A;  1XMA A;  4OIQ F;  4M6X A;  2A07 F;  2DFI A;  1D3Y A;  1P92 A;  2EB7 A;  4HAM A;  4Y15 A;  3U9G A;  1S29 A;  3Q9V A;  2PN6 A;  5FLX Z;  2OA4 A;  1P2F A;  2O03 A;  5LEK A;  1P4X A;  1SD6 A;  1OPC A;  4Q48 A;  4EJU A;  1LVA A;  4IPA A;  2Y48 A;  2A5Y B;  2DTR A;  1IN4 A;  1G3S A;  4HF2 A;  2E7W A;  2D45 A;  1HW5 A;  4R8H A;  3IRQ A;  1NHA A;  3DKW A;  3T5X A;  2OZ6 A;  4ZYG A;  4HV6 A;  4S04 A;  4Y13 A;  3FMS A;  2PMU A;  1XSX A;  3M1E A;  3GFM A;  1LQ1 A;  4UXN A;  3LA3 A;  1ZG5 A;  5JHU A;  4G6D A;  1SFU A;  1FYL A;  5DUK A;  1T38 A;  2UWM A;  4L9T A;  1FWZ A;  2EK5 A;  2OBP A;  3GW2 A;  2FF4 A;  3FMR A;  2QYO A;  1W7P D;  3TO9 A;  2QZ8 A;  5EEH A;  4ZZD A;  1IN8 A;  1FZP B;  3KET A;  1TBX A;  4M9S A;  5K5O A;  2FQ3 A;  5D5X B;  3MCZ A;  5HDN A;  1SD4 A;  5CVR A;  4HDV A;  4IF4 A;  4HV5 A;  1KQ8 A;  1FT9 A;  5E1W A;  1O57 A;  4O5V A;  2VBX A;  5CYV A;  4LFU A;  1EH8 A;  2CSO A;  4M9Z A;  2YU3 A;  1MKM A;  3CJN A;  1ZAO A;  2PMH A;  2JPC A;  4L0Z B;  4QLC U;  3K1N A;  3HSR A;  2STW A;  2D2W A;  2IA1 A;  2VBZ A;  3QP6 A;  1KU9 A;  4I02 A;  2QQB A;  2HTJ A;  1R5H A;  1B59 A;  2PI0 A;  2QUF A;  2HOE A;  2M1B A;  5ICF A;  4M6Y A;  5DCF A;  3LST A;  4U0V A;  5ED4 A;  4EJW A;  1KU7 A;  4G94 A;  3L9F A;  2LDU A;  5L3E A;  1YO5 C;  1F9N A;  1R00 A;  5DYM A;  4EQQ A;  5BMZ A;  2VN2 A;  1G4D A;  1WSU A;  3E6C C;  1A04 A;  2IPQ X;  2WWY A;  4XLN F;  5FFX A;  1ZGJ A;  5DUI A;  1QPM A;  3C7J A;  1J9I A;  3OV8 A;  1RZ4 A;  2FBK A;  3JTH A;  5JR3 A;  2BGC A;  3ZN0 A;  1HKT A;  3ZP5 A;  3J7A O;  3WOD F;  2EWN A;  2QVO A;  2WV0 A;  2VT2 A;  5CVJ A;  2A6E F;  1IZ1 A;  5E8G A;  2O0Y A;  3KP6 A;  2ETH A;  2RN7 A;  3SHF A;  4CYD A;  4BNC A;  1TNS A;  4EM1 A;  3CUO A;  5EEG A;  4GXO A;  3HRM A;  2ELH A;  2MA3 A;  5CJ9 A;  5DD8 A;  3FXQ A;  4RAY A;  1YW8 A;  3QAH A;  2FML A;  1KU2 A;  2L4A A;  1FBU A;  2R7D A;  5FO5 A;  3GX4 X;  2P5L C;  1O3Q A;  1FLI A;  4YII A;  4EV0 A;  2BBY A;  3R6S A;  3RYR A;  2FRH A;  3RI4 A;  2EV5 A;  3VOD A;  1HKQ A;  2V1X A;  2GA2 A;  3F72 A;  3ZPL A;  2RGV A;  3J80 Z;  3EUH A;  1ZYR F;  4EJO A;  1B9N A;  4KYW A;  4UVA A;  1IAW A;  1MJB A;  1IXR C;  1EV7 A;  2LF8 A;  3KCC A;  3CLO A;  2G9W A;  2ZO4 A;  3RKW A;  5HLH A;  3QRF F;  3ZMS A;  1I1S A;  5TRD A;  2LF7 A;  3MFK A;  1JXS A;  5E1Z B;  2ISY A;  2JPB A;  4EM0 B;  2E1C A;  2ZNZ A;  2A3S A;  2JZY A;  4MQV A;  4ENM A;  3E97 A;  4I01 A;  5A2Q Z;  2VOO A;  2EFO A;  3VOE A;  4A0X A;  4Z2Y A;  2A69 F;  2O8X A;  4WXC A;  5ICG A;  4BYY A;  4L9V A;  1USS A;  4RB0 A;  1I6X A;  3EYY A;  2EJR A;  4G7O F;  4XSZ F;  2M5W A;  2IA2 A;  3K0L A;  3MZY A;  4BQA A;  3GZ6 A;  3RPQ A;  1XSV A;  4L9J A;  2D1V A;  5LGU A;  1KGS A;  3GWZ A;  2KIM A;  4LG0 A;  1FY7 A;  4B09 A;  1WRJ A;  5ILS A;  3WTW C;  4RGX A;  2C6Y A;  1FC3 A;  4EJT A;  1Z1D A;  3MWM A;  3HRT A;  3FZV A;  1QBJ A;  1TW3 A;  4IRI A;  5BQT A;  2NRA C;  3ABT A;  2MLK A;  1XMK A;  5K5R A;  3CTA A;  2CO5 A;  1I27 A;  4R79 A;  4O6J A;  4U7B A;  3FHZ A;  2GIV A;  4XLP F;  4PGG A;  2A61 A;  3KP2 A;  1W5S A;  3W6K B;  3DV8 A;  4RGU A;  2FNA A;  2UXX A;  1ZLK A;  2LSO A;  2DK5 A;  1KYZ A;  4I7H A;  2M87 A;  4I2O A;  5ERI A;  4IRH A;  3IKT A;  1MDM B;  2VXZ A;  4FX4 A;  4CDG A;  2KKO A;  5LHI A;  3EYI A;  3WGG A;  2BEO A;  3J80 K;  1J0R A;  4LG0 B;  3M7G A;  3FXU A;  4WWC A;  4JQF A;  3FXR A;  3V8K A;  4BHC A;  1XGS A;  2VT3 A;  1IW7 F;  4CIC A;  1FSH A;  5HDK A;  3V8J A;  2CYY A;  3DF8 A;  2P5K A;  1W5T A;  1UHW A;  5K1Y A;  2V9V A;  1ZRD A;  2HYG D;  1PUE E;  4RGS A;  1XCV A;  1BIB A;  2HS5 A;  4WXD A;  5DV5 A;  4A5N A;  4OIP F;  5H6R A;  2XRN A;  4KFC A;  4UV9 A;  3HRU A;  2XAG A;  2CG4 A;  3LAJ A;  5JVT A;  2FE3 A;  4P96 A;  5A2Q K;  3T8R A;  4YFK F;  3BP8 A;  1FBQ A;  4E70 A;  2CW0 F;  4Q5S F;  3U1D A;  3D5L A;  3ULQ B;  4ZH4 F;  5BOX A;  3BPV A;  1D5V A;  3GFI A;  1QO0 D;  2NAZ A;  4RS8 A;  1O7F A;  1ZGA A;  1HBX G;  1TQP A;  2VOP A;  2DQR A;  4OMZ A;  3HSE A;  2EFP A;  5AON A;  3ELK A;  3M8E A;  2W24 A;  1G3Y A;  4LMY A;  2P6T A;  4L5I A;  5HLI A;  3H3U A;  2MH2 A;  2HWV A;  1WI9 A;  2TDX A;  3J81 Z;  1U3E M;  1RUO A;  3IRR A;  1FYK A;  4UNO A;  2DAO A;  4ZYE A;  2NNY A;  1YS6 A;  4M72 A;  4GYG A;  2PFB A;  5L3G A;  4K2E A;  2DBB A;  4P9U A;  4UV8 A;  1Z9C A;  4LB6 B;  5FFZ A;  1FP1 D;  5D4S A;  1BI0 A;  3F6O A;  2VBY A;  4I09 A;  5FD6 A;  2OZU A;  2XAS A;  4JBA A;  4EJV A;  1T39 A;  5D5U B;  5JFR A;  3HTS B;  4L0Y B;  1P4W A;  3F8M A;  4OOI A;  2G7H A;  3O3K A;  2IP2 A;  1B4A A;  2XVC A;  2DK8 A;  2CFX A;  3HOS A;  3TOB A;  3OOP A;  5CVU A;  3P9I A;  3E5U A;  2A6H F;  4HX4 A;  3GVA A;  5D6E A;  1PP8 F;  4IHS A;  3F8C A;  1SAX A;  3T0Y A;  4MTE A;  3D0S A;  4AVP A;  1R1T A;  2V1D A;  2QQA A;  1OYW A;  2HTS A;  1T6S A;  3ECO A;  1C0W A;  3VFZ A;  2FA5 A;  1ODD A;  1Z6T A;  3KLN A;  3R0A A;  4M9X A;  4O3M A;  4XSX F;  3E6D A;  3EDP A;  4AWX B;  4NB5 A;  1ZG1 A;  3G73 A;  3ZMT A;  2HKO A;  2W57 A;  1XSD A;  1LEB A;  3SZT A;  2G7U A;  2JTV A;  1DPU A;  1BN5 A;  1TNT A;  3QP5 A;  1ON1 A;  2WTE A;  4YIF A;  5H6Q A;  4A12 A;  4MNU A;  3PQJ A;  4EM2 A;  2RQP A;  2ACJ A;  1FP2 A;  1O3S A;  1R1V A;  3QU3 A;  5D6F A;  3ZMD A;  1REP C;  2XKO A;  2GXG A;  4HLX A;  1EH6 A;  3HUG A;  3L2C A;  3Q5F A;  3HRS A;  3BRO A;  3F8B A;  3E3V A;  5H20 A;  2HYF A;  4BHP A;  2Q0O A;  1OKR A;  1U6G A;  3ZN1 A;  5HVQ C;  2K02 A;  4XRF A;  4ON0 A;  1WWX A;  4ESJ A;  1IXC A;  3RYP A;  4DQ2 A;  1CGP A;  2YPR A;  2EA2 A;  3VEP A;  3GFJ A;  1HXD A;  2VON A;  2J5O A;  5AIQ A;  1HQC A;  2Z3Y A;  1S3J A;  3KP5 A;  3J81 K;  4R1H A;  1R58 A;  4CZZ A;  5ICE A;  2IVM A;  4L18 B;  2Z33 A;  3E5Q A;  4HX7 A;  3H3Z A;  1O3T A;  5FLX K;  3WTT C;  1P4A A;  2FXA A;  1YYV A;  1CF7 B;  1R5G A;  3TGN A;  4I0A A;  3EQL F;  4RB3 C;  1W4M A;  1JHF A;  1YLF A;  4G6Q A;  3I4P A;  1WQ2 A;  4OIN F;  2ESN A;  4BHB A;  4HDU A;  3GLX A;  2BYV E;  4OMY A;  1RNL A;  4KIG A;  4JK1 X;  3U2R A;  4UVC A;  3JSO A;  2AXL A;  1LDK B;  2KJB A;  4GGG A;  1G3T A;  2W25 A;  3H92 A;  4BXU A;  4U88 A;  3JAM Z;  1GVJ A;  3R60 A;  1S7O A;  5CVI A;  1KYW A;  2RKH A;  2QBY B;  4KNY A;  4KA4 A;  1ZRF A;  2HGC A;  1J75 A;  3BZ6 A;  1KQ9 A;  3QPH A;  5TJJ A;  4UHT A;  3WG9 A;  3L09 A;  2H6C A;  5E17 F;  4PGH A;  2Y75 A;  3TO6 A;  5D8K B;  1QZZ A;  4FHT A;  3BOQ A;  3WE3 A;  5BPI A;  4ESB A;  1I1G A;  2FBH A;  3LAP A;  2HR3 A;  1L3L A;  4HZF A;  2E7X A;  1J59 A;  5LHH A;  1OYI A;  4N0B A;  1J2X A;  1DPR A;  1BBY A;  3PQK A;  2XRO A;  2H94 A;  3P9C A;  5LRS A;  1LEA A;  1U2W A;  2XIG A;  3CO7 C;  3WTZ A;  1B6A A;  2EA4 A;  3DPT A;  3GZ5 A;  4Y17 A;  2RC4 A;  1IRG A;  2EFN A;  3F3X A;  1IN6 A;  2OQG A;  3IWZ A;  2P4W A;  3KEQ A;  2XKP A;  3CO6 C;  1XD7 A;  2DO7 A;  2XAQ A;  3ZMZ A;  1U5T A;  2PLY A;  1MJ9 A;  4P55 A;  2V79 A;  1PDN C;  5HOO A;  3FX3 A;  4L5J A;  1HW2 A;  3NQO A;  3F23 A;  2H6B A;  1DP7 P;  1BI3 A;  3DXJ F;  3I58 A;  4KUM A;  5K5Q A;  2MBF A;  3I0T A;  1YG2 A;  2M30 A;  4DNC A;  3F22 A;  3I54 A;  3IHU A;  3KEO A;  3IKV A;  1MDM A;  1J5Y A;  1I5Z A;  3ZMU A;  4MQ9 F;  3JW4 A;  1W7P A;  2P8T A;  3TOA A;  3FMQ A;  2L4M A;  5AIP A;  1Y0U A;  2MLG A;  4LLL A;  1P6R A;  2Q8K A;  5J8F A;  2ZBK A;  1ONV A;  1SMT A;  2RNJ A;  4G9Y A;  2VC0 A;  3RKX A;  3N4M A;  2LKP A;  1K6O A;  3KLO A;  3MEX A;  4L9N A;  5HS9 A;  2RVC A;  2PJP A;  4IJA A;  4TV7 A;  1R1U A;  2HQN A;  4AIH A;  1WKM A;  4PDK A;  1YIO A;  4HOB A;  1U5T B;  1XGN A;  4WX9 A;  5HS8 A;  1TTY A;  4Q4Z F;  3JAM K;  2ZME B;  2IRF G;  3TKY A;  3RDI A;  4IVN A;  4ESF A;  1BOA A;  2KIF A;  1FSE A;  2UZK A;  4A0Z A;  3WTX C;  4FT8 A;  1U8R A;  2RDP A;  1R36 A;  1QQI A;  3GXO A;  5BS6 A;  2PBI A;  5HS7 A;  5D4R A;  2VE8 A;  3L00 A;  2KRF A;  1V4R A;  1S8N A;  2MD5 A;  4IRG A;  1W7P B;  3FM3 A;  2X0L A;  1K78 A;  2Z99 A;  3LFK A;  5BPD A;  1YW9 A;  2ZKZ A;  1TQM A;  4GYI A;  4H0E A;  4KIF A;  4U7D A;  4ETS A;  5D5W B;  4IHT A;  1LB2 A;  1J7K A;  1R23 A;  1ZHF A;  2DLL A;  2VE9 A;  1SD7 A;  3V7C A;  1PP7 U;  1YFH A;  1Z05 A;  1Z91 A;  3ZMV A;  2EFW A;  1STZ A;  2EV0 A;  3I5U A;  3F8F A;  4RAZ A;  3ABU A;  4LLG F;  2DI3 A;  4ENN A;  2CQK A;  5LGN A;  1FX7 A;  3GO5 A;  3O6B B;  3DP7 A;  5HLG A;  1F1Z A;  2W85 A;  5KVR A;  4HQE A;  2DQL A;  4OIR F;  1QNT A;  1X3U A;  3KE2 A;  1JE8 A;  3LA7 A;  2YX7 A;  3N97 A;  3C1D A;  3DPL C;  2XGX A;  3WU0 A;  5L3C A;  5CLS A;  3SXY A;  3GUD A;  2ZXJ A;  1FBS A;  1O7L A;  1IN7 A;  2QWW A;  2MC3 A;  1K78 B;  1MJA A;  4KDP A;  1BIA A;  4EGY A;  2FEZ A;  1T98 A;  4LK1 F;  1G3W A;  2XAH A;  2J5P A;  1HST A;  2K7L A;  4HQM A;  4LB5 A;  1XN7 A;  1JHH A;  3KZZ A;  4CHU A;  1U78 A;  2V6C A;  4A6D A;  6PAX A;  2O61 A;  2A68 F;  3K9T A;  1GHC A;  4ENJ A;  1S6L A;  4A6E A;  3LQQ A;  3QOP A;  3HHH A;  1DUX C;  3FM5 A;  3COA C;  2YR2 A;  1LDJ A;  2UXN A;  4FX0 A;  4N9I A;  1SMY F;  3TO7 A;  1UB9 A;  3I64 A;  3CUQ A;  4P5O A;  3FF5 A;  5LHG A;  2VBW A;  5CVV A;  1K79 A;  4A2U A;  4AD9 A;  3HOT A;  3I59 A;  2P5V A;  4LJZ F;  2OQR A;  2IA0 A;  2O6G E;  5ILV A;  2E1N A;  3JSP A;  3HIF A;  2DW4 A;  1E17 A;  4QWQ A;  4ENK A;  1Z6R A;  3G3Z A;  3F6V A;  4U0W A;  2JT1 A;  3ISP A;  1IRF A;  4P9F A;  5IT9 Z;  1XGM A;  1BC8 C;  4G7Z F;  3HHG A;  3M9A A;  1ZRC A;  1GXQ A;  1QZY A;  2HEO A;  2GZW A;  3BJ6 A;  4WXH A;  3ROU A;  3ZQ7 A;  4ASN A;  4WCG A;  3VB2 A;  5ILU A;  2GAU A;  1IF1 A;  1F5T A;  5F1R A;  3RJP A;  3MZH A;  1D8J A;  4LLN A;  3CDH A;  4RB1 A;  1CF7 A;  4KMU X;  2BE5 F;  5HDG A;  1OMI A;  3GF2 A;  3S2W A;  2IW5 A;  4CO8 A;  2NYX A;  3CUQ B;  4PZJ A;  2K86 A;  5F64 A;  4HF1 A;  3I59 B;  4HX8 A;  3I71 A;  2OD5 A;  1L0O C;  2CWE A;  4PCQ A;  4LK0 F;  1OR7 A;  5E18 F;  1FYM A;  4NHJ A;  1LNW A;  1FOK A;  4B8X A;  5DEQ A;  4HF0 A;  4EMS A;  1U5T C;  4CGZ A;  2F2E A;  1ZG3 A;  3ECH A;  3B73 A;  1DDN A;  4EGZ A;  2F5F A;  2X4H A;  3QU6 A;  3WTY C;  5ICC A;  5J6X A;  1YS7 A;  1KQ0 A;  3BJA A;  2QBY A;  2GQQ A;  4I0B A;  2R7F A;  1H0M A;  4G8X A;  1XDS A;  3DEU A;  2DPD A;  3C3W A;  1ZRE A;  1BJA A;  4KN7 X;  1TW2 A;  4YFN F;  2QM3 A;  4G7H F;  2JRT A;  1OYY A;  1JGS A;  4OU0 A;  1RUN A;  2AS5 F;  3AAF A;  5DD4 A;  2Q2E A;  4M74 A;  2L01 A;  2M8E A;  2DT5 A;  1B9M A;  2ZCW A;  2D1H A;  3WTS C;  4HLY A;  3F8N A;  2DU9 A;  1HSJ A;  1D8K A;  1XB4 A;  3LQR A;  3MAJ A;  1R22 A;  4UUV A;  1TQI A;  2PEX A;  5FB2 A;  1HKS A;  2Z5U A;  5D8L B;  2L3D A;  3NEU A;  4BAY A;  2HDC A;  3T1B A;  1T2K A;  3KZY A;  3EET A;  4HW0 A;  2XV4 S;  3R0J A;  3V8L A;  1EH7 A;  3WTV C;  3LWF A;  3C18 A;  3KP7 A;  1YW7 A;  2Y0M A;  1TLH B;  2K4J A;  3MQ0 A;  5IT9 K;  4WF2 A;  4LD5 A;  1ZH5 A;  3IC7 A;  1QGP A;  2K27 A;  2H09 A;  1XGO A;  3P9K A;  2K4B A;  5LBQ A;  2R3S A;  2W84 A;  3DQV C;  1BI2 A;  5LLQ A;  3K1M A;  5JI6 A;  4M73 A;  1AWC A;  4CXF A;  3WU1 B;  3SZP A;  3L7W A;  4D0P A;  3K2Z A;  4S05 A;  4MEY F;  2BV6 A;  3IWF A;  1F4K A;  4RB2 C;  2EV6 A;  4ZZL A;  2GA1 A;  1LJ9 A;  1SD5 A;  4XBF A;  5L3F A;  2OU2 A;  2QEN A;  5D5V B;  4ZYH A;  4IXA A;  3V7S A;  3GEZ A;  3QPT A;  1RI7 A;  1ZAR A;  3KFW X;  2DPU A;  4AIK A;  3HSF A;  3ML6 A;  2NS0 A;  4MEX F;  1ZLJ A;  5DDG A;  1IXS B;  2PQ8 A;  4N9H A;  1YQA A;  2Z9O A;  4GCV A;  1MD0 A;  2L54 A;  3PFI A;  5E1X A;  2RV8 A;  2VC1 A;  3R61 A;  2NNN A;  2PG4 A;  1BI1 A;  2YSR A;  3BWG A;  2ZME A;  5DCM A;  2VOD A;  2FNP A;  3HTU A;  3IL2 A;  3V4G A;  3HYI A;  3LA2 A;  2F5C A;  2ESH A;  4A5M A;  4KN4 X;  1S7A A;  3TDZ C;  5KK1 A;  2P6S A;  3P7N A;  2FBI A;  5L3B A;  2FOK A;  3TQN A;  3V7R A;  2XAF A;  4MTD A;  5F6F A;  1ZN2 A;  5E20 A;  3M8F A;  1UST A;  1LDD A;  2ZNY A;  1IN5 A;  1KU3 A;  2ISZ A;  3BJO A;  4MGR A;  1GXP A;  2L02 A;  3BY6 A;  2HZT A;  3DFG A;  2HFH A;  1XCB A;  2EFQ A;  2FU4 A;  3K1P A; 
#chains in the Genus database with same CATH topology
 2M45 A;  5FD5 A;  1ZGW A;  2V6E A;  2EPF A;  1ERD A;  4KMF A;  3Q9S A;  4NDL A;  4F7Z A;  2EIM H;  4U0Y A;  5DTD A;  1SVM A;  1FNN A;  3A1Y A;  5CKT A;  4A0Y A;  3CUQ C;  3W2V A;  1YTY A;  3TDU C;  3FWE A;  2K85 A;  1HW1 A;  4DW6 A;  4C2T A;  2VIX A;  4BBS J;  2YS9 A;  5LRR A;  1RIO H;  1FIA A;  2P0W A;  3HGG A;  2M7B A;  2EQR A;  2E19 A;  3GZN B;  1E2X A;  1K6Y A;  3OR1 C;  5LEJ A;  2FMY A;  3ERM A;  2B0L A;  4WK8 F;  4BH9 A;  2ZXH A;  4XOR A;  2EZK A;  5DCM B;  2KJC A;  2P7C B;  4LGW A;  3JTG A;  1GT0 C;  2MD0 A;  4C3I J;  3I53 A;  4ZDL A;  4ZYD A;  3KP3 A;  2P81 A;  3AG1 H;  4UUS A;  1UCR A;  2Q1Z B;  2X1C A;  4HA8 A;  4RGR A;  4M3G A;  1O3R A;  4I98 B;  4MFD A;  5B3S H;  1R7J A;  3F21 A;  1MMD A;  3BDD A;  3OSG A;  1NK2 P;  2R7O A;  5IP9 J;  3JRE A;  3GFL A;  4CH7 A;  4F93 B;  1UFM A;  1AHD P;  3CC4 I;  3HOZ J;  4HBL A;  1X19 A;  4NQW A;  5EZG A;  2V1U A;  4A3J J;  5EG0 B;  3JR9 A;  4M71 A;  1IO2 A;  5E8I A;  3RPU A;  3NRV A;  1RPW A;  3G6E I;  4V2F A;  3W6J B;  4YFX F;  3FKJ A;  4GFB A;  4RLQ A;  5IT3 A;  2MH9 A;  2OF7 A;  2CGP A;  1MMN A;  2DTZ A;  4DOZ A;  4UB6 C;  3ZXS A;  3B02 A;  2HOA A;  4DYC A;  2ZFW A;  3E6B A;  2QQ9 A;  3RIR A;  4HYE A;  4XK4 A;  4F3Q A;  2COM A;  2JSC A;  1Z7U A;  1JT6 A;  3WTU C;  4XID A;  4KT5 C;  2ADU A;  3TW7 A;  1ZR4 A;  1UHM A;  4KT6 A;  5J40 A;  5E3O A;  2XAJ A;  3HXL A;  1BM9 A;  4RM2 A;  3REO A;  5E3M A;  1V3F A;  2FSW A;  2LNB A;  3DWL E;  4NC7 A;  4YEL A;  3LSP A;  1QA6 A;  1IUY A;  4Q47 A;  3W2A A;  2XHK A;  2GXB A;  4OIO F;  2BY2 A;  3K69 A;  4FIS A;  4KIC A;  2KIU A;  2KFD A;  3B6A A;  5JLX A;  2ME6 A;  4Z6Y A;  3OS2 A;  2R7T A;  3SQN A;  3SFZ A;  4AM3 A;  2XC7 A;  5LGT A;  4PK4 A;  5JVG F;  2GWR A;  2DFE A;  5FGM A;  3AG3 H;  3RZD J;  2R7S A;  1T56 A;  2H27 A;  3ERE D;  3OSF A;  1MBF A;  2X6W A;  5L3D A;  4L5E A;  5J8C A;  1H9T A;  1T0F A;  2OAZ A;  1MND A;  3HBL A;  5FKM A;  1FPQ A;  4C2M J;  3WGI A;  2CV1 A;  4BQQ A;  2NVU B;  3RKY A;  4UVB A;  3PUF A;  3DKY A;  4D7M A;  4GO1 A;  3K4J A;  2XUB A;  3QQA A;  1ZR2 A;  1G6N A;  2KT0 A;  1VTN C;  4KIB A;  1ULY A;  1LPQ A;  4YG2 F;  2QLZ A;  1I6H J;  5IYD J;  2IJL A;  1ON2 A;  4E7L A;  2JRM A;  2LKX A;  1XX5 A;  3HOV J;  1AU7 A;  2YUS A;  3E6M A;  3O2P E;  1G59 A;  1OR7 C;  1TT0 A;  2STT A;  4CCJ A;  2MC4 A;  4BQO A;  2XRL A;  4UUS B;  4BE2 A;  2HQR A;  1Q1H A;  5F04 A;  2ZJP F;  4XRS G;  2YX4 A;  2JN6 A;  4MHG A;  2F5E A;  2P7V B;  4C9Y A;  1H9G A;  1K7A A;  1MGT A;  1IDZ A;  4NQW B;  4EVI A;  3KP4 A;  2Y9Y A;  3RTR A;  2IT0 A;  2M2E A;  3TW6 A;  3BG7 A;  1SFE A;  2HKX A;  1MZB A;  1GV2 A;  1WVR A;  3RCO A;  3GYH X;  3R4K A;  1ZTR A;  2L7M P;  1SFX A;  2F5D A;  4OAZ A;  3DTK A;  3T8T A;  4A3G J;  3CQZ J;  1GV5 A;  4AIJ A;  4DZJ A;  3VYT B;  2O3F A;  5GAE J;  3MKZ A;  2EH3 A;  2JVG A;  1KA8 A;  1BC7 C;  2VKH A;  2RAE A;  3BPX A;  3K70 D;  2DJN A;  2X6X A;  1UZC A;  3Q0V A;  3WGH A;  5JHF A;  3WE2 A;  1B1B A;  5HLT A;  3HB9 A;  3E5X A;  2WC2 A;  3LMM A;  1AOY A;  3K4C A;  2HVS A;  2ZJ2 A;  1XDU A;  1XMA A;  4OIQ F;  1A31 A;  4M6X A;  2A07 F;  3X2Q H;  1EKE A;  2DFI A;  1D3Y A;  1P92 A;  2FD5 A;  2EB7 A;  3PNT A;  4HAM A;  3PJR A;  2E1M C;  4Y15 A;  3U9G A;  1S29 A;  2CQQ A;  1Y56 A;  1VQP I;  3Q9V A;  1YIT I;  2PN6 A;  2CH0 A;  5FLX Z;  2OA4 A;  1P2F A;  2O03 A;  5LEK A;  1P4X A;  1SD6 A;  2B7E A;  3RQ4 A;  3L1P A;  4IKF A;  2QEX I;  1OPC A;  4Q48 A;  2HVR A;  4EJU A;  1LVA A;  2CUF A;  4IPA A;  2Y48 A;  2A05 A;  2A5Y B;  2DA2 A;  1IN4 A;  1G3S A;  2DTR A;  3OYI A;  2IGN A;  1IJW C;  4IQ4 A;  4HF2 A;  1BR4 A;  2E7W A;  2D45 A;  2QF7 A;  2CV2 A;  1HW5 A;  1Z67 A;  5M3M J;  4R8H A;  3BG5 A;  1PUF A;  3IRQ A;  4UB8 C;  1NHA A;  3DKW A;  2ZJR F;  4D5C A;  3T5X A;  2OZ6 A;  4ZYG A;  5B1B H;  4HV6 A;  4S04 A;  4Y13 A;  3FMS A;  1RR8 C;  2PMU A;  1XSX A;  1TT5 B;  4CUG A;  3M1E A;  3IP4 B;  2HDD A;  3GFM A;  4AYB A;  3ZGK A;  1LQ1 A;  4UXN A;  4F92 B;  3G71 I;  3LA3 A;  1ZG5 A;  3BR2 A;  4QIW N;  1K83 J;  2WAF A;  3WG7 H;  5JHU A;  4G6D A;  1MNM C;  4CA0 A;  1SFU A;  1FYL A;  2VQL A;  5DUK A;  1W36 D;  5FLV A;  1T38 A;  2UWM A;  4L9T A;  2XB5 A;  1FWZ A;  2EK5 A;  2OBP A;  3A01 B;  4LG3 A;  3ZQQ A;  2VXD A;  4LIV A;  2MGQ A;  3GW2 A;  3PIP F;  2FF4 A;  3FMR A;  5FRN A;  2JA8 J;  1A35 A;  2KRH A;  4BU2 A;  2QYO A;  1W7P D;  3IH3 A;  3TO9 A;  3PUB A;  3OYN A;  2QZ8 A;  5TIS C;  1ORK A;  3VPR A;  5EEH A;  2DA3 A;  3HEF A;  3TL4 X;  4ZZD A;  1IN8 A;  3Q0W A;  4AC0 A;  2CRG A;  1FZP B;  3KET A;  1TBX A;  4M9S A;  5K5O A;  2FQ3 A;  5FKL A;  1SFK A;  3CDL A;  4F52 A;  3BCA A;  1KZH A;  5D5X B;  2G0E A;  3MCZ A;  3EUH C;  1XPX A;  1ITY A;  3NAU A;  5HDN A;  1SD4 A;  1WHU A;  5CVR A;  4HDV A;  2HVQ A;  4IF4 A;  1HDP A;  2Z2S B;  4HV5 A;  1KQ8 A;  1FT9 A;  5E1W A;  4XLA A;  1O57 A;  3DU6 A;  3CD6 I;  4O5V A;  2VBX A;  5CYV A;  4CCN A;  1X1P A;  1RKW A;  1XG1 A;  4B1R A;  1VQ6 I;  4LFU A;  1EH8 A;  2CSO A;  4E7J A;  4M9Z A;  4FE7 A;  2YU3 A;  1MKM A;  3CJN A;  1ZAO A;  4PSW A;  5F0C A;  2Z16 A;  2PMH A;  4XRS A;  2NS8 A;  1BOB A;  1FIP A;  2JPC A;  5F0H A;  4L0Z B;  3E0J B;  3S2H J;  2HQ5 A;  4QLC U;  2IAI A;  2LY9 A;  2N8G A;  3K1N A;  3HSR A;  3QOD A;  2OTJ I;  4KIS A;  1JKP C;  2JA2 A;  2STW A;  4XMY A;  3ZQC A;  2D2W A;  2IXS A;  2IA1 A;  2CMP A;  2VBZ A;  2R5Z A;  3BR0 A;  3QP6 A;  1KU9 A;  3ESW B;  3LOC A;  3VYU B;  2AQF A;  1E3P A;  4I02 A;  3ZOB A;  2QQB A;  1XTA A;  4Y3O A;  2HTJ A;  1RES A;  1R5H A;  1B59 A;  2PI0 A;  2QUF A;  4EEF G;  2DMP A;  4CYC A;  5EZH A;  2GM4 A;  2XSD C;  2HOE A;  1JKQ C;  2M1B A;  4QSH A;  5IOZ A;  5ICF A;  3PO3 J;  4M6Y A;  5DCF A;  3LST A;  4U0V A;  1QU3 A;  1TC3 C;  2GXA A;  3OYA A;  1YRN B;  1TWF J;  5ED4 A;  4EJW A;  3K7A J;  3KYD B;  4G94 A;  1KU7 A;  4S0H B;  3G1O A;  3KX2 A;  3L9F A;  2LDU A;  3I3L A;  5L3E A;  1ETW A;  1YO5 C;  1APL C;  1F9N A;  1R00 A;  4XM3 A;  5DYM A;  4EQQ A;  5GAG J;  1VQK I;  2CW7 A;  3MVP A;  4RAG A;  1B72 A;  3S3N A;  5BMZ A;  2VN2 A;  1U0J A;  1WSU A;  1G4D A;  3E6C C;  2BXZ A;  1FTT A;  2M4G A;  3PSI A;  1LVK A;  2Y2Z A;  5F08 A;  1A04 A;  2IPQ X;  2DT6 A;  3WU2 C;  2WWY A;  4XLN F;  5FFX A;  1VQ9 I;  2DMN A;  1WZ2 A;  1ZGJ A;  1D1B A;  5DUI A;  3OL3 A;  4CSW A;  1QPM A;  3C7J A;  1J9I A;  2BHZ A;  3OV8 A;  4DYQ A;  1RZ4 A;  2FBK A;  3JTH A;  3VSK A;  5JR3 A;  4FCY A;  4PJ0 C;  2BGC A;  3ZN0 A;  1HKT A;  3ZP5 A;  3CCE I;  3J7A O;  3WOD F;  4B3X A;  1Z77 A;  1SAU A;  1V54 H;  2EWN A;  2QVO A;  3VDX A;  1Y39 A;  2WV0 A;  3BR5 A;  1VI0 A;  1FEX A;  5GAD J;  2VT2 A;  1R71 A;  1X3W B;  5CVJ A;  2CU7 A;  2A6E F;  1IZ1 A;  5E8G A;  2O0Y A;  3KP6 A;  2ETH A;  2E36 A;  2RN7 A;  3SHF A;  4CYD A;  2KZG A;  3BCB A;  3BG3 A;  4CZC A;  4FTH A;  4BNC A;  1TNS A;  1WPK A;  3K4K A;  4RM3 A;  4EM1 A;  3CUO A;  3GTQ J;  3TP0 A;  5EEG A;  4H4K C;  4BUP A;  4BL0 B;  4GXO A;  2ZSH B;  3OYJ A;  2E5Z A;  3HUG B;  3M07 A;  1GLN A;  3HRM A;  2ELH A;  2R7U A;  1ETY A;  4E7Z A;  3S32 A;  1GVD A;  2MA3 A;  1G8X A;  4QPQ A;  5CJ9 A;  5DD8 A;  2KRC A;  3I56 I;  4I6Z A;  3HPH A;  3FXQ A;  2V26 A;  4IEJ A;  1S72 I;  4RAY A;  1D0X A;  1YW8 A;  4NC6 A;  4Y52 J;  2O9L A;  2VPL A;  4A3I J;  3AL0 B;  3QAH A;  2FML A;  1KU2 A;  2L4A A;  1FMV A;  2R7X A;  1FBU A;  1TWC J;  2R7D A;  2KDO A;  5FO5 A;  3GX4 X;  2P5L C;  1O3Q A;  4C3J J;  5BNG A;  1FLI A;  4YII A;  4EV0 A;  3C2H A;  2BBY A;  1HA8 A;  3IV5 A;  3R6S A;  3RYR A;  2FRH A;  2GLO A;  2M34 A;  3RSN A;  3RI4 A;  2EV5 A;  3VOD A;  1HKQ A;  3HOW J;  5FJ8 J;  3OYH A;  5GP9 A;  2V1X A;  2GA2 A;  3F72 A;  1U8B A;  3ZPL A;  3ASN H;  1UMQ A;  4CCO A;  3JRD A;  2RGV A;  3S15 J;  1U9O A;  3J80 Z;  2WV1 A;  3EUH A;  3BT9 A;  1ZYR F;  3GME A;  3H5A A;  3OYE A;  1R49 A;  4ZDO A;  4DBR A;  2Y31 A;  4EJO A;  1B9N A;  1K4T A;  4KYW A;  4UVA A;  3OYC A;  5J1Y A;  1IAW A;  3U1K A;  2HPM A;  2QSF X;  1YJ9 I;  2XPU A;  1MJB A;  3LSJ A;  1X4O A;  2PMZ N;  4LIT A;  1IXR C;  1EV7 A;  2LF8 A;  2R5Y B;  3A0H C;  3KCC A;  1VF9 A;  3CLO A;  2G9W A;  2ZO4 A;  3RKW A;  3CCY A;  3BZK A;  2BOL A;  2CQN A;  5HLH A;  1K61 A;  3H9G A;  2X1D A;  2DMT A;  4M3E A;  5HNF A;  3QRF F;  3ZMS A;  3PNY A;  1I1S A;  5TRD A;  2LF7 A;  4PSX A;  1PYV A;  1ZEL A;  3MFK A;  1JXS A;  3PM1 A;  2TCT A;  5E1Z B;  3JRI A;  2ISY A;  2JPB A;  4EM0 B;  2E1C A;  3ABL H;  5KHD A;  2ZNZ A;  5IP7 J;  2RRE A;  1OFC X;  1A6Q A;  2BW3 A;  2EIN H;  2CFO A;  2A3S A;  2JZY A;  2HI3 A;  1Z3X A;  4MQV A;  4IOC F;  3E97 A;  4ENM A;  5F0F A;  4I01 A;  4U87 A;  5A2Q Z;  2OTL I;  1S9H A;  2VOO A;  2EFO A;  3VOE A;  3OIQ A;  4A0X A;  4Z2Y A;  2M0M A;  2A69 F;  2MW8 A;  2O8X A;  3HOU J;  4WXC A;  2K9Q A;  3ZR8 X;  1V5G A;  3H3V K;  5ICG A;  4BYY A;  3ZQL A;  4L9V A;  1J09 A;  3BTI A;  2RQQ A;  3DU5 A;  2L0K A;  1USS A;  3JRA A;  4RB0 A;  2MAB A;  3JRF A;  4Y4R A;  1I6X A;  3EYY A;  2EJR A;  3FIW A;  4YIR X;  2NVX J;  4G7O F;  4XSZ F;  3CCV I;  2M5W A;  5EJC A;  1XS9 A;  3HPG A;  2IA2 A;  3K0L A;  5JLW A;  3J7Y J;  3MZY A;  3QYB A;  4E4H A;  3GZ6 A;  3RPQ A;  4BQA A;  1XSV A;  3K4M A;  4L9J A;  2D1V A;  4D9J A;  1KGS A;  5LGU A;  2L9R A;  3GWZ A;  2KIM A;  2NVT J;  4LG0 A;  1N75 A;  1FOW A;  1FY7 A;  4B09 A;  5B66 C;  1WRJ A;  3JCU C;  5ILS A;  3WTW C;  3LL7 A;  1SFO J;  4II2 A;  1UG2 A;  3QWL A;  4RGX A;  3GCM A;  2DT7 B;  2C6Y A;  3TBI A;  1FC3 A;  1NG7 A;  1WJC A;  2FOW A;  4EJT A;  1Z1D A;  3P5J A;  3MWM A;  4XLF A;  3HRT A;  2OUM A;  3DEE A;  3HOX J;  4GDF A;  3FZV A;  1QBJ A;  2F4O B;  3UNG C;  1TW3 A;  4IRI A;  2RNG A;  5BQT A;  2H8W A;  2NRA C;  3ABT A;  2QCO A;  2W4S A;  2MLK A;  3OYL A;  3WHB A;  1SEU A;  2ECB A;  1XMK A;  3F0C A;  2E60 A;  5FKN A;  2MYS A;  2XPV A;  5K5R A;  3CTA A;  4M3B A;  4GRI A;  2CO5 A;  2BW3 B;  1I27 A;  4R79 A;  4O6J A;  4U7B A;  5IP6 A;  3FHZ A;  4BGD A;  3U21 A;  5K7F A;  2GIV A;  1F43 A;  3OS0 A;  4XLP F;  1I3Q J;  2H1L A;  2VI6 A;  4B47 A;  2VJ5 A;  4EAT A;  4AID A;  4PGG A;  3I4N J;  4HSR A;  2A61 A;  3KP2 A;  1W5S A;  2BVM A;  3CJR B;  3W6K B;  1UJ8 A;  2JK3 A;  3DV8 A;  3Q3S A;  4RGU A;  2FNA A;  2UXX A;  1D1C A;  4A3M J;  1ZLK A;  2LSO A;  2CUJ A;  5E79 C;  2DK5 A;  1CQT A;  2LD5 A;  1ENH A;  3H0D A;  4YRV A;  1KYZ A;  4I7H A;  2M87 A;  3H35 A;  2KHM A;  3AG2 H;  4I2O A;  1RRJ A;  5ERI A;  2K9M A;  4IRH A;  3DLL F;  3IKT A;  4MIM A;  1MDM B;  2VXZ A;  3VWB A;  4QPO A;  4FX4 A;  3I4M J;  4G6T B;  1B8I A;  2LLK A;  4CDG A;  3SEQ A;  2KKO A;  5LHI A;  3C2G A;  3FXK A;  3EYI A;  2Y0S N;  3WGG A;  3D5S C;  3H1C A;  2BEO A;  2UUZ A;  3BR6 A;  3J80 K;  4A3B J;  1J0R A;  5M3F J;  4LG0 B;  2W7N A;  1MIJ A;  3M7G A;  1IGN A;  3CMM A;  3FXU A;  4XN3 A;  4WWC A;  4JQF A;  3FXR A;  2DMU A;  3V8K A;  4BHC A;  2ME0 A;  1XGS A;  2VT3 A;  1IW7 F;  5M5Y J;  2VAS A;  4CIC A;  4RMN A;  1FSH A;  5HDK A;  4KIT B;  2KPM A;  3IH2 A;  3V8J A;  4XKB A;  4MO7 A;  2CYY A;  3CP2 A;  1N25 A;  2P5K A;  3DF8 A;  2MG4 A;  1WJA A;  3G1L A;  4M6V A;  1OCT C;  4ZJZ A;  5IYC J;  1W5T A;  1UHW A;  1E3H A;  2Y9Z A;  4RDU A;  4IHX A;  5K1Y A;  4XOP A;  3GTM J;  3K2A A;  1GDT A;  2V9V A;  1ZRD A;  2HYG D;  1PUE E;  4RGS A;  1XCV A;  1TP4 A;  4BEH B;  1BIB A;  1SC7 A;  1IUF A;  1MSF C;  4HNU A;  2HS5 A;  4WXD A;  5DV5 A;  4A5N A;  4OIP F;  3AG4 H;  5H6R A;  2XRN A;  4KFC A;  4UV9 A;  3HRU A;  2XAG A;  1R6R A;  2CG4 A;  1Z21 A;  3LAJ A;  1EJ9 A;  5JVT A;  2FE3 A;  3A02 A;  4P96 A;  3SYT A;  3T8R A;  5A2Q K;  4YFK F;  3BP8 A;  1FBQ A;  4E70 A;  1HLV A;  2CW0 F;  2DYS H;  4Q5S F;  3U1D A;  3D5L A;  3ULQ B;  3L2U A;  4ZH4 F;  2GBY A;  5BOX A;  2EIJ H;  3BPV A;  1D5V A;  3GFI A;  1I39 A;  2ECC A;  1QO0 D;  4II3 A;  5GPA A;  2NVY J;  2NAZ A;  4XKV A;  3L2V A;  3W6V A;  2IS2 A;  4RS8 A;  5CQE A;  1O7F A;  1ZGA A;  1HBX G;  1TQP A;  2VOP A;  2DQR A;  4BDY A;  4OMZ A;  3A01 A;  2AO9 A;  3HSE A;  3AL0 C;  2EFP A;  1B8I B;  5AON A;  3ELK A;  1MBJ A;  2HU9 A;  1JUP A;  3M8E A;  2OPT A;  2W24 A;  1G3Y A;  2R7Z J;  2ZSI B;  4LMY A;  2P6T A;  4ITV A;  4L5I A;  5HLI A;  1ETK A;  3H3U A;  3WHC A;  4W97 A;  2MH2 A;  2HWV A;  3W3C A;  1DU6 A;  1TWG J;  1WI9 A;  3JRC A;  2TDX A;  1DP3 A;  1MH4 A;  3J81 Z;  4BY7 J;  1U3E M;  1RUO A;  3IRR A;  1UEL B;  1FYK A;  4XN0 A;  1D0Z A;  4UNO A;  2DAO A;  3FXO A;  4ZYE A;  1VQ5 I;  2NNY A;  2L9V A;  2JQ7 A;  5C4J J;  4XLH A;  3LFU A;  1YS6 A;  2LH9 A;  4M72 A;  4GYG A;  1GUU A;  2GIZ A;  4JP0 A;  2PFB A;  1SVL A;  5L3G A;  2CUE A;  5LFA A;  4K2E A;  3MKL A;  2DBB A;  4P9U A;  1MBE A;  2F6C A;  3OIO A;  4FQG A;  1JKR C;  2EIK H;  3FK7 A;  4UV8 A;  3CF2 A;  3KIO A;  1Z9C A;  2BY1 A;  3S93 A;  2XB0 X;  4LB6 B;  2JWT A;  5FFZ A;  3HC7 A;  1FP1 D;  5D4S A;  1BI0 A;  4BJ5 C;  1LE8 B;  3F6O A;  4XQF A;  1FTZ A;  3D1N I;  3MKW B;  2VBY A;  3S3O A;  4D5F A;  3DBL B;  3TP3 A;  4XLE A;  3GTG J;  1IV8 A;  2LY1 A;  4I09 A;  3OYG A;  5FD6 A;  2DA6 A;  2Y69 H;  1X1D A;  2FUG 2;  2OZU A;  3A03 A;  3MD2 A;  5FRO A;  2LP0 A;  2XAS A;  3S2D J;  3VSL A;  4JBA A;  4EJV A;  4BJ6 C;  1T39 A;  2L9S A;  1WJB A;  3LSK A;  5D5U B;  2LRD A;  5JFR A;  2KDZ A;  3HTS B;  4L0Y B;  1P4W A;  3F8M A;  1MBG A;  5KAF C;  1LKX A;  4OOI A;  2G7H A;  1QHG A;  3O3K A;  4V2G A;  2LRE A;  3H0G J;  2IP2 A;  1JUS A;  1FOY A;  1B4A A;  1NK3 P;  2XVC A;  4IOA F;  2DK8 A;  2CFX A;  3HOS A;  1LFB A;  1POG A;  2LFB A;  5CQG A;  3TOB A;  3OOP A;  2IS6 A;  5CVU A;  3P9I A;  3J7A Y;  3E5U A;  2A6H F;  4HX4 A;  4Y33 A;  3GVA A;  1YRN A;  4AUX A;  4E7I A;  5D6E A;  1PP8 F;  4IHS A;  3F8C A;  4C30 A;  5K7H A;  1SAX A;  3T0Y A;  2L7Z A;  4MTE A;  3D0S A;  4AVP A;  1R1T A;  3S1M J;  3UKG A;  2V1D A;  2QQA A;  4W1U A;  1OYW A;  2HTS A;  3QOE A;  1W5C C;  2DDA A;  1T6S A;  3ECO A;  1V5E A;  5IOY A;  1C0W A;  3VFZ A;  3H5R A;  3E7L A;  5HOD A;  1P7I A;  2FA5 A;  1ODD A;  1Z6T A;  3KPH A;  3KLN A;  3R0A A;  4M9X A;  5KAI C;  4O3M A;  3AFH A;  2LBF B;  4XIC A;  4XSX F;  3OYK A;  1W0T A;  3E6D A;  3EDP A;  4AWX B;  5E3N A;  5KNL A;  4NB5 A;  2WB1 N;  4BS9 A;  2ICW G;  1ZG1 A;  5J4V A;  3G73 A;  3ZMT A;  2HKO A;  2W57 A;  2W00 A;  1XSD A;  1LEB A;  3SZT A;  2G7U A;  4XNF A;  2JTV A;  1DPU A;  1BN5 A;  1LFU P;  1TNT A;  3QP5 A;  2E2I J;  3CCQ I;  1ON1 A;  4PJM A;  2WTE A;  4MFE A;  4YIF A;  5H6Q A;  3CMY A;  4A12 A;  3CCS I;  4MNU A;  3PQJ A;  4EM2 A;  2RQP A;  2CUZ A;  2HYJ A;  2ACJ A;  1FP2 A;  2QA4 I;  1O3S A;  1R1V A;  4CCM A;  3GTO J;  2ZB9 A;  3QU3 A;  3DEW A;  5D6F A;  3ZMD A;  5IYB J;  1REP C;  2HOS A;  2KMU A;  2XKO A;  2GXG A;  3KYC B;  2KIS A;  2Z1D A;  1EH6 A;  3HUG A;  4HLX A;  4UY8 I;  3L2C A;  3Q5F A;  4LOC A;  3HRS A;  3GTK J;  1HDD C;  1UAA A;  3I55 I;  3BRO A;  3F8B A;  4KJZ A;  3E3V A;  5H20 A;  2LYC A;  1ACI A;  1ETO A;  1JUM A;  2HYF A;  4BHP A;  2M4K A;  5B1A H;  3RPU D;  2VB6 A;  3ASO H;  3K4N A;  2Q0O A;  1OKR A;  1U6G A;  3ZN1 A;  5HVQ C;  2K02 A;  4XRF A;  4ON0 A;  1WWX A;  3FXL A;  4ESJ A;  2R93 J;  1IXC A;  3RYP A;  4DQ2 A;  1CGP A;  2F4I A;  2XF7 A;  2YPR A;  2EA2 A;  3FBI B;  3QPL A;  4XRM A;  3VEP A;  3GFJ A;  1WCM J;  1HXD A;  1HF0 A;  2VON A;  2J5O A;  5AIQ A;  1HQC A;  2WAQ A;  2Z3Y A;  1S3J A;  3KP5 A;  3J81 K;  4R1H A;  1R58 A;  4ANJ A;  4CZZ A;  5ICE A;  2JSP A;  2R7V A;  2IVM A;  4L18 B;  2Z33 A;  3E5Q A;  1TWH J;  2IEK A;  2JUC A;  3H3Z A;  4HX7 A;  4M3F A;  4B4C A;  1MMS A;  1O3T A;  4JX5 A;  5FLX K;  3WTT C;  1P4A A;  2FXA A;  1NTC A;  1YYV A;  1CF7 B;  5J3L A;  5GTH C;  1R5G A;  3TGN A;  1X1B A;  1QVT A;  4I0A A;  3EQL F;  3ZQI A;  4RB3 C;  3HKZ N;  1W4M A;  3O8H A;  3DBR B;  3HM5 A;  2HQA A;  2VQH A;  3DPU A;  1JHF A;  1YLF A;  4G6Q A;  5DS9 A;  3I4P A;  1WQ2 A;  4NC8 A;  4OIN F;  2ESN A;  4BHB A;  2R5Y A;  4HDU A;  3PO2 J;  3GLX A;  3FBN B;  2BYV E;  4OMY A;  2LC2 A;  2VUM J;  1RNL A;  4KIG A;  4JK1 X;  3U2R A;  4UVC A;  3CME I;  1ZQ3 P;  4JOM A;  2I10 A;  3JSO A;  1E3O C;  2AXL A;  3CP8 A;  2FQ4 A;  1FMW A;  1RET A;  1LDK B;  2KJB A;  4GGG A;  3E1S A;  1G3T A;  3DTE A;  5CPR B;  2HXI A;  2XSJ C;  3ZQG A;  2AXT C;  5GTI C;  2W25 A;  3H92 A;  4BXU A;  4U88 A;  1MMA A;  3JAM Z;  1GVJ A;  3R60 A;  1S7O A;  5CVI A;  2QSG X;  4E7S A;  1W1W E;  4IO9 F;  1VQM I;  1YJW I;  1KYW A;  2RKH A;  5IY5 H;  4DYR A;  1FJL A;  3FXM A;  3QYE A;  2XGD A;  3CF5 F;  2QBY B;  4XKW A;  4KNY A;  4KA4 A;  3S3M A;  1ZRF A;  1T8I A;  1HOM A;  2HGC A;  2WA0 A;  1J75 A;  3BZ6 A;  2OCE A;  1KQ9 A;  3QPH A;  5TJJ A;  4UHT A;  4A3E J;  3WG9 A;  1TWA J;  3L09 A;  2H6C A;  5E17 F;  2KZV A;  2NOG A;  3S14 J;  3HG9 A;  3PSF A;  2L7K A;  4PGH A;  2F4M B;  1OCR H;  2Y75 A;  3SDB A;  3TO6 A;  5D8K B;  1QZZ A;  4FHT A;  3BOQ A;  3WE3 A;  2M0C A;  5BPI A;  3W2W A;  4ZTJ A;  4ESB A;  1I1G A;  2FBH A;  3LAP A;  2HR3 A;  2ZXI A;  1L3L A;  1AKH B;  4HZF A;  2PMZ A;  4CCL A;  2E7X A;  1J59 A;  3PNV A;  4NBQ A;  2K9L A;  2Q2E B;  2BY3 A;  5LHH A;  1OYI A;  1YE9 A;  2OCC H;  4N0B A;  1J2X A;  1DPR A;  1BBY A;  3OYB A;  4JYK A;  2A6T A;  3PQK A;  2AHQ A;  1VQ8 I;  2H94 A;  3P9C A;  2XRO A;  5LRS A;  4B43 A;  1YJN I;  1LEA A;  1U2W A;  2XIG A;  3S16 J;  2VPR A;  3CO7 C;  3WTZ A;  4A93 J;  1B6A A;  1JJ8 C;  2EA4 A;  4BXX J;  3DPT A;  5J47 A;  1OIS A;  3GZ5 A;  2OJE D;  4N4O B;  4Y17 A;  2RC4 A;  4J01 A;  2EFN A;  1IRG A;  3F3X A;  2LKS A;  3OMY A;  1IN6 A;  2OQG A;  4A3F J;  3IWZ A;  2P4W A;  3KEQ A;  2XKP A;  3S1R J;  3CO6 C;  9ANT A;  1XD7 A;  2DO7 A;  2XAQ A;  3ZMZ A;  4HST A;  2JUG A;  1U5T A;  5J4Y A;  2XGE A;  3C2B A;  2PLY A;  2TRT A;  5GPC A;  1MJ9 A;  4NUB A;  2DOD A;  4P55 A;  1IRX A;  2VLA A;  2V79 A;  4E6K G;  1PDN C;  5HOO A;  1R4N B;  3FX3 A;  4L5J A;  1HW2 A;  1HC8 A;  3NQO A;  3F23 A;  2H6B A;  4FAS D;  1DP7 P;  1BI3 A;  2HZD A;  3DXJ F;  4IHW A;  3I58 A;  3BG6 A;  4KUM A;  5K5Q A;  5K7Z A;  2MBF A;  3I0T A;  1WJF A;  1X2M A;  1YG2 A;  2M30 A;  3DTI A;  2V4J C;  4DNC A;  3HDD A;  3HZJ A;  3F22 A;  2E71 A;  3I54 A;  3IHU A;  1IC8 A;  3KEO A;  3CJT B;  3IKV A;  3G2B A;  1MDM A;  1J5Y A;  1I5Z A;  3ZMU A;  2WY8 Q;  4MQ9 F;  3D5R C;  3JW4 A;  1W7P A;  2P8T A;  4MLO A;  1R4M B;  3TOA A;  3SEZ A;  3FMQ A;  2L4M A;  5AIP A;  2W1O A;  3M1C A;  1Y0U A;  2MLG A;  4LLL A;  1M1E B;  4BE1 A;  2V9P A;  1P6R A;  1G2H A;  2Q8K A;  5J8F A;  4DZP A;  1FOX A;  1H89 C;  2ZBK A;  4D7N A;  1ONV A;  1SMT A;  3JRB A;  2RNJ A;  3AKZ A;  2FJ1 A;  4G9Y A;  2VC0 A;  1R5I D;  4XON A;  3RKX A;  1SAN A;  3MZ8 A;  2X6Y A;  4NNJ A;  3N4M A;  1WJD A;  2ZFU A;  1RKT A;  2LKP A;  1K6O A;  1X4P A;  1BR2 A;  3DCF A;  4BY1 J;  3KLO A;  3MEX A;  4ZTF A;  1WH5 A;  4RAF A;  1D0Y A;  4L9N A;  5HS9 A;  2RVC A;  1BR1 A;  2PJP A;  4IJA A;  4BEH A;  3A4C A;  4TV7 A;  1R1U A;  2HQN A;  2FX0 A;  4AIH A;  2NS7 A;  1WKM A;  4PDK A;  1YIO A;  2I5U A;  2COB A;  4HOB A;  1Y6I A;  1U5T B;  1VQO I;  5FLM J;  3S1N J;  2DXI A;  1XGN A;  4WX9 A;  5HS8 A;  1TTY A;  4Q4Z F;  5F27 A;  2ZME B;  3JAM K;  2IRF G;  4LIU A;  1A36 A;  3TKY A;  2X51 A;  3RDI A;  4IVN A;  4X1E A;  1BOA A;  4ESF A;  4XKC A;  4FE4 A;  2KIF A;  1FSE A;  2X1E A;  2K5C A;  2UZK A;  3O8G A;  2VKD A;  4A0Z A;  3WTX C;  4FT8 A;  4PUS A;  1U8R A;  2RDP A;  2E34 A;  1R36 A;  2GOM A;  2Y0S A;  3A2K A;  2LY2 A;  1QQI A;  3BG9 A;  3GXO A;  5BS6 A;  2PBI A;  5HS7 A;  1WJ5 A;  1ZKG A;  1I3A A;  3N05 A;  5D4R A;  2K9N A;  4BE0 A;  2VE8 A;  3L00 A;  2KRF A;  1V4R A;  1S8N A;  2MD5 A;  2L2O A;  5GAH J;  2IGK A;  4IRG A;  2DJI A;  2E35 A;  1W7P B;  3FM3 A;  1BL0 A;  2WAE A;  2X0L A;  1K78 A;  2Z99 A;  3LFK A;  5BPD A;  1YW9 A;  2ZKZ A;  2DOF A;  1TQM A;  2KQR A;  1PJR A;  3FK6 A;  3LSI A;  4GYI A;  5TGT A;  4H0E A;  2L9N A;  4KIF A;  5FKO A;  5M5X J;  1MNE A;  3K4B A;  3K10 A;  2LOO A;  4U7D A;  4DJA A;  4ETS A;  2DA4 A;  5D5W B;  4IHT A;  3DLA A;  4HEA 2;  2V7F A;  1LB2 A;  4M3D A;  4HNT A;  1IV6 A;  1J7K A;  1R23 A;  1ZHF A;  1Z7L A;  1D1A A;  1YIJ I;  1Z0X A;  2M8G X;  2DLL A;  2R92 J;  1VQ7 I;  3CES A;  2VE9 A;  2V1N A;  5HNH A;  1SD7 A;  1WH7 A;  1UHS A;  2E2J J;  3V7C A;  1PP7 U;  4V19 K;  1I50 J;  1LUJ B;  3V42 A;  1YFH A;  1Z05 A;  1Z91 A;  3ZMV A;  2EFW A;  3CCR I;  4ZDP A;  1STZ A;  3BR1 A;  1S5L C;  2EV0 A;  4AVZ A;  3I5U A;  5M5W J;  4IQJ A;  3F8F A;  4OWR B;  4RAZ A;  3ABU A;  4LLG F;  3ZQF A;  5C3E J;  2DI3 A;  4ENN A;  3H5N A;  1Y0N A;  2CQK A;  1FX7 A;  5LGN A;  1LE8 A;  4AU7 A;  2VQG A;  3GO5 A;  4B3A A;  3O6B B;  1YI2 I;  2JA5 J;  4DGW B;  3DP7 A;  2KIQ A;  5HLG A;  1F1Z A;  2W85 A;  2W48 A;  5KVR A;  4HQE A;  2DQL A;  4OIR F;  2JVH A;  1QNT A;  1X3U A;  2O5R A;  3KE2 A;  1DGW Y;  1JE8 A;  1OCZ H;  3LA7 A;  2YX7 A;  3ZQH A;  3N97 A;  3C1D A;  3DPL C;  2XGX A;  1XMX A;  3L2Q A;  3WU0 A;  1V55 H;  5L3C A;  3NWS A;  3OWT A;  3OYF A;  2LTP A;  1N78 A;  4P1W A;  5CLS A;  3SXY A;  2K40 A;  3CLQ A;  3GUD A;  2ZXJ A;  1FBS A;  1O7L A;  1IN7 A;  2QWW A;  2MC3 A;  4IX7 A;  2DOA A;  2OV7 A;  1K78 B;  1MJA A;  4E7H A;  4KDP A;  1V5F A;  1PVE A;  1NH3 A;  1BIA A;  4EGY A;  2FEZ A;  3ZRG A;  1T98 A;  4LK1 F;  1G3W A;  2XAH A;  4DIQ A;  2J5P A;  4HPQ A;  3PFY A;  1HST A;  2K7L A;  1K4S A;  2EZL A;  4HQM A;  4LB5 A;  1OCP A;  3CCM I;  5EF6 A;  1XN7 A;  3G1M A;  2ID6 A;  1JHH A;  3KZZ A;  3GTJ J;  4CHU A;  1Q1V A;  5B5E C;  2V6C A;  4A6D A;  1U78 A;  5KCM A;  6PAX A;  2JA7 J;  2O61 A;  2XDV A;  2A68 F;  2ZJQ F;  3BR3 A;  3K9T A;  3IAM 2;  1GHC A;  4ENJ A;  1S6L A;  4A6E A;  3LSG A;  3LQQ A;  2X6O A;  3CCJ I;  3QOP A;  3HHH A;  4PJJ A;  1DUX C;  3BTJ A;  3FM5 A;  3OY9 A;  3COA C;  2KP6 A;  2XF6 A;  2YR2 A;  1DQU A;  1WJE A;  2LBF A;  1LDJ A;  2UXN A;  4FX0 A;  4N9I A;  1SMY F;  3TO7 A;  3RZO J;  2LK2 A;  5FRM A;  1UB9 A;  2E1O A;  3I64 A;  3CUQ A;  1HCR A;  4P5O A;  3FF5 A;  5LHG A;  1VFC A;  2EIL H;  2VBW A;  3M4O J;  3IAS 2;  2WAD A;  4A3L J;  3HL2 A;  5CVV A;  2JMW A;  1K79 A;  4A2U A;  2KL4 A;  2QKM B;  4AD9 A;  1TZL A;  4UUT A;  3HOT A;  4J19 A;  2IGM A;  3H9J A;  3I59 A;  1QZE A;  2P5V A;  3EPZ A;  1WGX A;  4LJZ F;  3CJQ B;  3PIO F;  2OQR A;  3ABK H;  4I76 A;  4OAY A;  2IA0 A;  1UG0 A;  1IDY A;  1OCO H;  2BZT A;  5DM7 F;  2O6G E;  3SZG A;  2E1N A;  5ILV A;  2HPI A;  3JSP A;  2F5V A;  3HIF A;  2DW4 A;  4QTR A;  4X0G A;  2R0Q C;  1E17 A;  1JI8 A;  4BKX A;  1S7E A;  4QWQ A;  4ENK A;  1QVU A;  1Z6R A;  3G3Z A;  1TL8 A;  1JKO C;  3ZCO A;  1YHQ I;  3F6V A;  4U0W A;  2HDW A;  2JT1 A;  2X48 A;  3ISP A;  1IRF A;  4P9F A;  4PJL A;  3TED A;  1YOV B;  3SFI A;  3FXJ A;  2PJR A;  5IT9 Z;  1XGM A;  3BLY A;  4G12 A;  5EYR A;  1BC8 C;  2HXO A;  3KYL A;  3IUO A;  1OQY A;  4G7Z F;  4PFP A;  3HHG A;  4IZZ A;  3M9A A;  1QPI A;  3CCL I;  1ZRC A;  4PJN A;  4BJT A;  1X3Z B;  2IS4 A;  1X58 A;  1OJL A;  1GXQ A;  1QZY A;  5LD2 C;  1ETQ A;  2HEO A;  2CS3 A;  2GZW A;  3OOU A;  3MMY B;  3K70 C;  3BJ6 A;  2ELK A;  4WXH A;  3ROU A;  4C2U A;  2QSH X;  3ZQ7 A;  4ASN A;  1DGR M;  4WCG A;  2DYR H;  4AYB N;  4N4N B;  3VB2 A;  2ID3 A;  5ILU A;  3LSR A;  1H88 C;  2GAU A;  1IF1 A;  2WB1 A;  1F5T A;  5F1R A;  1AA7 A;  1BA5 A;  3RJP A;  3MZH A;  2VJJ A;  3NAR A;  1DU0 A;  1D8J A;  2M9H A;  4HRI A;  4LLN A;  1JTX A;  2HNH A;  1EF4 A;  3CDH A;  4RB1 A;  1CF7 A;  1XC5 A;  2XAU A;  2R7Q A;  4KMU X;  1IG7 A;  2BE5 F;  5HDG A;  4J00 A;  1OMI A;  3GF2 A;  2DA5 A;  2IW5 A;  3S2W A;  2NYX A;  4CO8 A;  3CUQ B;  3HJE A;  2O8K A;  4PZJ A;  4B44 A;  4FET A;  4XR6 A;  2K86 A;  4IL6 C;  1WI3 A;  5F64 A;  2IBD A;  3G4S I;  4HF1 A;  5E3L A;  1MSE C;  2O7O A;  3CC7 I;  3I59 B;  2IS1 A;  4HX8 A;  3I71 A;  2OD5 A;  3OS1 A;  1L0O C;  2CWE A;  4PCQ A;  1IRZ A;  4LK0 F;  2NXN B;  1OR7 A;  5E18 F;  1FYM A;  2R4G A;  1WFX A;  4NHJ A;  4RLF A;  1LNW A;  1PUF B;  1FOK A;  1P7J A;  1X2N A;  2DFF A;  4B8X A;  2WY7 Q;  1NG6 A;  2MFZ A;  3EUA A;  5DEQ A;  4HF0 A;  4EMS A;  3CCU I;  4HG2 A;  2Y30 A;  1U5T C;  2ZXW H;  4CGZ A;  4B48 A;  2F2E A;  1JTY A;  2V9K A;  2PJR B;  1ZG3 A;  2I8D A;  3ECH A;  2QGU A;  3B73 A;  2ZME C;  1DDN A;  4EGZ A;  1SVO A;  2F5F A;  2X4H A;  3QU6 A;  1OCC H;  1BJZ A;  4RA2 A;  5ICC A;  3WTY C;  1E0E A;  5J6X A;  1YS7 A;  1KQ0 A;  3KEY A;  3BJA A;  2EZH A;  2QBY A;  2GQQ A;  3QYF A;  1QRY A;  1Y1W J;  1ZK8 A;  3SJM A;  3K6G A;  2R7F A;  4I0B A;  1H0M A;  2EZI A;  4G8X A;  4BBR J;  2R7R A;  1XDS A;  2NVQ J;  1W36 C;  3ONQ A;  3DEU A;  4DBQ A;  5IPA A;  2DPD A;  2OC6 A;  3C3W A;  2CJJ A;  1EA3 A;  2M7A A;  1H8A C;  1ZRE A;  3M3Y J;  5EDN A;  3EUK L;  1BJA A;  4KN7 X;  1TW2 A;  4YFN F;  4E7K A;  3K4L A;  3HKZ A;  4YEJ A;  2M3A A;  2QM3 A;  5J1U A;  4G7H F;  1A5J A;  3BQY A;  3JRG A;  2JRT A;  1OYY A;  1JGS A;  4OU0 A;  2VKE A;  1AKH A;  1RUN A;  2AS5 F;  2EBI A;  3AAF A;  2LVS A;  3S1Q J;  5DD4 A;  2Q2E A;  3GLL A;  4A3K J;  4M74 A;  3OYD A;  2L01 A;  1OLT A;  2M8E A;  2DA1 A;  4PFO A;  2DT5 A;  3BQZ A;  1B9M A;  2ZCW A;  3SDG A;  2D1H A;  4BXF A;  3WTS C;  4HLY A;  2CQX A;  3F8N A;  2DU9 A;  1HSJ A;  3OR2 C;  5DM6 F;  3KZI C;  1D8K A;  1XB4 A;  3LQR A;  4A69 C;  3L2R A;  3MAJ A;  4IHV A;  3MKY B;  1MW7 A;  3VYS B;  1R22 A;  4UUV A;  1TQI A;  1P9Q C;  2PEX A;  5FB2 A;  1HKS A;  2VKV A;  2Z5U A;  3CDI A;  5D8L B;  1N77 A;  2L3D A;  3NEU A;  2WAQ N;  4BAY A;  3RKQ A;  4ZC3 A;  3T1B A;  2HDC A;  2L7F P;  3M8J A;  3BTC A;  1VQN I;  1T2K A;  3S17 J;  3KZY A;  1X1A A;  3EET A;  4HW0 A;  2XV4 S;  3R0J A;  2B63 J;  1MMG A;  3V8L A;  2HOT A;  1EH7 A;  3BZC A;  3H36 A;  3LNQ A;  3WTV C;  5F1J A;  2DDB A;  3LWF A;  3C18 A;  3KP7 A;  1YW7 A;  2Y0M A;  1T08 B;  1TLH B;  2K4J A;  3MQ0 A;  1JJ6 C;  3GTL J;  2LG4 A;  5IT9 K;  1Y8Q B;  4JX6 A;  3DKX A;  2NOJ B;  1U9N A;  4F91 B;  2GOX B;  4WF2 A;  4LD5 A;  1ZH5 A;  3FIS A;  3IC7 A;  1QGP A;  2DOE A;  2K27 A;  3HGY A;  2ELJ A;  4JX4 A;  2H09 A;  1XGO A;  3P9K A;  2R5Z B;  3BTL A;  2K4B A;  5LBQ A;  2R3S A;  1YX3 A;  2W84 A;  4HNV A;  2X9D A;  1T95 A;  1BI2 A;  3DQV C;  4I99 C;  1YX5 A;  5LLQ A;  4D1Q A;  2F48 A;  3CC2 I;  3A0B C;  3K1M A;  3RQI A;  5JI6 A;  1ETV A;  4M73 A;  3LSH A;  1VZ0 A;  2E2H J;  1AWC A;  3F9K A;  5J1R A;  4CXF A;  2DN0 A;  3WU1 B;  3SZP A;  2CW8 A;  3L7W A;  3K2Z A;  4D0P A;  4S05 A;  4CYC B;  4MEY F;  2BV6 A;  1ETX A;  2LMD A;  1RR7 A;  1X1C A;  2XGC A;  3FKI J;  3IWF A;  1F4K A;  4XL9 A;  4RB2 C;  2EV6 A;  3PL8 A;  2GA1 A;  4ZZL A;  5EGO A;  1LJ9 A;  1SD5 A;  4XBF A;  5L3F A;  2B9S A;  2OU2 A;  1VQ4 I;  2QEN A;  5D5V B;  4ZYH A;  1BW5 A;  2K3F A;  4IXA A;  3V7S A;  2ZC2 A;  1RC9 A;  3GEZ A;  2LR8 A;  3ABM H;  2CQ7 A;  2JA6 J;  1B72 B;  2E1M B;  3QPT A;  3OL4 A;  1RI7 A;  1ZAR A;  3KFW X;  4CCK A;  2DPU A;  2BVL A;  4AIK A;  2H1K A;  3H9Q A;  3NWT A;  3HSF A;  3I9V 2;  4IHY A;  5C4X J;  2K9S A;  2A5W A;  3FDY A;  3B6C A;  1VND A;  2UV1 A;  3ML6 A;  2VL8 A;  3OIP A;  3HOY J;  4A3C J;  4XLC A;  2BHY A;  3TMO A;  2NS0 A;  5EEA A;  4MEX F;  1A6I A;  4C3H J;  1R9T J;  3GBG A;  1Y8R B;  1ZLJ A;  3CZ6 A;  1O4X A;  1T0F C;  5DDG A;  1IXS B;  2PQ8 A;  2PX9 A;  4N9H A;  1YQA A;  1Z3Y A;  3CMA I;  2Z9O A;  4GCV A;  1MD0 A;  3QPS A;  2L54 A;  3PFI A;  5E1X A;  1Y1V J;  2RV8 A;  2VC1 A;  3R61 A;  3J7Z I;  2NNN A;  2DA7 A;  2PG4 A;  2WBM A;  2E5N A;  3FHN A;  4X6A J;  2JJ7 A;  1BI1 A;  1LFP A;  2DMQ A;  2YSR A;  3BWG A;  1JT0 A;  2QQ8 A;  2ZME A;  5DCM A;  2VOD A;  3L2W A;  2FNP A;  2KLO A;  3HTU A;  3IL2 A;  5FKK A;  1QHH D;  3V4G A;  3HYI A;  2QKL B;  3LSM A;  1MBK A;  3LA2 A;  2F5C A;  1VQL I;  2IGO A;  3MN2 A;  3GTP J;  2ESH A;  2X85 A;  4A5M A;  4KN4 X;  1S7A A;  4ZYA A;  2VQC A;  3TDZ C;  2DCE A;  2D5V A;  5KK1 A;  3DBH B;  2P6S A;  4Y7N J;  3P7N A;  2CV0 A;  2FBI A;  5H2F C;  5L3B A;  2FOK A;  2BXY A;  3TQN A;  3V7R A;  2XAF A;  5EG0 A;  2XPW A;  5C44 J;  4MTD A;  3JRH A;  2R7W A;  5F6F A;  4A3D J;  1ZN2 A;  1BW6 A;  5E20 A;  4XOT A;  1MBH A;  3M8F A;  2VJ4 A;  4BDZ A;  2H8R A;  1JGG A;  1F36 A;  1KON A;  1UST A;  1LDD A;  2DFH A;  3VYR B;  2VJI A;  2K3P A;  2ZNY A;  5EGO B;  4BAC A;  1IN5 A;  3BC8 A;  1KU3 A;  3IH4 A;  2BY0 A;  2W82 A;  2ISZ A;  3BJO A;  2AQE A;  4MGR A;  2XF5 A;  2YU9 J;  1D5Y A;  3Q0U A;  2L5Q A;  1GXP A;  3UR3 C;  1W0U A;  2L02 A;  3BY6 A;  3S8P A;  4ABZ A;  2HZT A;  3OYM A;  3DFG A;  4F55 A;  4BQN A;  4RBO A;  2HFH A;  1XCB A;  2EFQ A;  1T33 A;  2FU4 A;  1MH3 A;  3K1P A;  2MSY A; 
#chains in the Genus database with same CATH homology
 2M45 A;  5FD5 A;  4KMF A;  3Q9S A;  4F7Z A;  4U0Y A;  1FNN A;  4A0Y A;  3CUQ C;  1YTY A;  3TDU C;  3FWE A;  1HW1 A;  5LRR A;  1RIO H;  1E2X A;  5LEJ A;  2FMY A;  2B0L A;  4WK8 F;  4BH9 A;  5DCM B;  2KJC A;  2P7C B;  4LGW A;  3JTG A;  4ZYD A;  3I53 A;  3KP3 A;  1UCR A;  1O3R A;  4HA8 A;  4RGR A;  4I98 B;  1R7J A;  3F21 A;  3BDD A;  3GFL A;  1UFM A;  4HBL A;  4NQW A;  2V1U A;  4M71 A;  5E8I A;  3RPU A;  3NRV A;  3W6J B;  4YFX F;  5IT3 A;  2MH9 A;  2CGP A;  3B02 A;  2ZFW A;  3E6B A;  2QQ9 A;  3RIR A;  4HYE A;  2COM A;  2JSC A;  1Z7U A;  3WTU C;  4KT5 C;  2ADU A;  1UHM A;  2XAJ A;  1BM9 A;  3REO A;  1V3F A;  2FSW A;  2LNB A;  1IUY A;  4Q47 A;  2GXB A;  2XHK A;  4OIO F;  3K69 A;  4KIC A;  2KIU A;  3SQN A;  3SFZ A;  5LGT A;  2GWR A;  5FGM A;  2H27 A;  3ERE D;  5L3D A;  5J8C A;  1H9T A;  1T0F A;  2OAZ A;  1FPQ A;  3WGI A;  3RKY A;  4UVB A;  4GO1 A;  2XUB A;  1G6N A;  1VTN C;  4KIB A;  1ULY A;  4YG2 F;  2QLZ A;  2IJL A;  1ON2 A;  3E6M A;  3O2P E;  2STT A;  2HQR A;  1Q1H A;  2YX4 A;  4MHG A;  2F5E A;  2P7V B;  1H9G A;  1K7A A;  1MGT A;  4EVI A;  3KP4 A;  3RTR A;  2IT0 A;  1SFE A;  2HKX A;  1MZB A;  3GYH X;  3R4K A;  1SFX A;  2F5D A;  3T8T A;  4AIJ A;  2O3F A;  1KA8 A;  1BC7 C;  3BPX A;  3WGH A;  3WE2 A;  1B1B A;  3E5X A;  2WC2 A;  1AOY A;  2ZJ2 A;  1XDU A;  1XMA A;  4OIQ F;  4M6X A;  2A07 F;  2DFI A;  1D3Y A;  1P92 A;  2EB7 A;  4HAM A;  4Y15 A;  3U9G A;  1S29 A;  3Q9V A;  2PN6 A;  5FLX Z;  2OA4 A;  1P2F A;  2O03 A;  5LEK A;  1P4X A;  1SD6 A;  1OPC A;  4Q48 A;  4EJU A;  1LVA A;  4IPA A;  2Y48 A;  2A5Y B;  2DTR A;  1IN4 A;  1G3S A;  4HF2 A;  2E7W A;  2D45 A;  1HW5 A;  4R8H A;  3IRQ A;  1NHA A;  3DKW A;  3T5X A;  2OZ6 A;  4ZYG A;  4HV6 A;  4S04 A;  4Y13 A;  3FMS A;  2PMU A;  1XSX A;  3M1E A;  3GFM A;  1LQ1 A;  4UXN A;  3LA3 A;  1ZG5 A;  5JHU A;  4G6D A;  1SFU A;  1FYL A;  5DUK A;  1T38 A;  2UWM A;  4L9T A;  1FWZ A;  2EK5 A;  2OBP A;  3GW2 A;  2FF4 A;  3FMR A;  2QYO A;  1W7P D;  3TO9 A;  2QZ8 A;  5EEH A;  4ZZD A;  1IN8 A;  1FZP B;  3KET A;  1TBX A;  4M9S A;  5K5O A;  2FQ3 A;  5D5X B;  3MCZ A;  5HDN A;  1SD4 A;  5CVR A;  4HDV A;  4IF4 A;  4HV5 A;  1KQ8 A;  1FT9 A;  5E1W A;  1O57 A;  4O5V A;  2VBX A;  5CYV A;  4LFU A;  1EH8 A;  2CSO A;  4M9Z A;  2YU3 A;  1MKM A;  3CJN A;  1ZAO A;  2PMH A;  2JPC A;  4L0Z B;  4QLC U;  3K1N A;  3HSR A;  2STW A;  2D2W A;  2IA1 A;  2VBZ A;  3QP6 A;  1KU9 A;  4I02 A;  2QQB A;  2HTJ A;  1R5H A;  1B59 A;  2PI0 A;  2QUF A;  2HOE A;  2M1B A;  5ICF A;  4M6Y A;  5DCF A;  3LST A;  4U0V A;  5ED4 A;  4EJW A;  1KU7 A;  4G94 A;  3L9F A;  2LDU A;  5L3E A;  1YO5 C;  1F9N A;  1R00 A;  5DYM A;  4EQQ A;  5BMZ A;  2VN2 A;  1G4D A;  1WSU A;  3E6C C;  1A04 A;  2IPQ X;  2WWY A;  4XLN F;  5FFX A;  1ZGJ A;  5DUI A;  1QPM A;  3C7J A;  1J9I A;  3OV8 A;  1RZ4 A;  2FBK A;  3JTH A;  5JR3 A;  2BGC A;  3ZN0 A;  1HKT A;  3ZP5 A;  3J7A O;  3WOD F;  2EWN A;  2QVO A;  2WV0 A;  2VT2 A;  5CVJ A;  2A6E F;  1IZ1 A;  5E8G A;  2O0Y A;  3KP6 A;  2ETH A;  2RN7 A;  3SHF A;  4CYD A;  4BNC A;  1TNS A;  4EM1 A;  3CUO A;  5EEG A;  4GXO A;  3HRM A;  2ELH A;  2MA3 A;  5CJ9 A;  5DD8 A;  3FXQ A;  4RAY A;  1YW8 A;  3QAH A;  2FML A;  1KU2 A;  2L4A A;  1FBU A;  2R7D A;  5FO5 A;  3GX4 X;  2P5L C;  1O3Q A;  1FLI A;  4YII A;  4EV0 A;  2BBY A;  3R6S A;  3RYR A;  2FRH A;  3RI4 A;  2EV5 A;  3VOD A;  1HKQ A;  2V1X A;  2GA2 A;  3F72 A;  3ZPL A;  2RGV A;  3J80 Z;  3EUH A;  1ZYR F;  4EJO A;  1B9N A;  4KYW A;  4UVA A;  1IAW A;  1MJB A;  1IXR C;  1EV7 A;  2LF8 A;  3KCC A;  3CLO A;  2G9W A;  2ZO4 A;  3RKW A;  5HLH A;  3QRF F;  3ZMS A;  1I1S A;  5TRD A;  2LF7 A;  3MFK A;  1JXS A;  5E1Z B;  2ISY A;  2JPB A;  4EM0 B;  2E1C A;  2ZNZ A;  2A3S A;  2JZY A;  4MQV A;  4ENM A;  3E97 A;  4I01 A;  5A2Q Z;  2VOO A;  2EFO A;  3VOE A;  4A0X A;  4Z2Y A;  2A69 F;  2O8X A;  4WXC A;  5ICG A;  4BYY A;  4L9V A;  1USS A;  4RB0 A;  1I6X A;  3EYY A;  2EJR A;  4G7O F;  4XSZ F;  2M5W A;  2IA2 A;  3K0L A;  3MZY A;  4BQA A;  3GZ6 A;  3RPQ A;  1XSV A;  4L9J A;  2D1V A;  5LGU A;  1KGS A;  3GWZ A;  2KIM A;  4LG0 A;  1FY7 A;  4B09 A;  1WRJ A;  5ILS A;  3WTW C;  4RGX A;  2C6Y A;  1FC3 A;  4EJT A;  1Z1D A;  3MWM A;  3HRT A;  3FZV A;  1QBJ A;  1TW3 A;  4IRI A;  5BQT A;  2NRA C;  3ABT A;  2MLK A;  1XMK A;  5K5R A;  3CTA A;  2CO5 A;  1I27 A;  4R79 A;  4O6J A;  4U7B A;  3FHZ A;  2GIV A;  4XLP F;  4PGG A;  2A61 A;  3KP2 A;  1W5S A;  3W6K B;  3DV8 A;  4RGU A;  2FNA A;  2UXX A;  1ZLK A;  2LSO A;  2DK5 A;  1KYZ A;  4I7H A;  2M87 A;  4I2O A;  5ERI A;  4IRH A;  3IKT A;  1MDM B;  2VXZ A;  4FX4 A;  4CDG A;  2KKO A;  5LHI A;  3EYI A;  3WGG A;  2BEO A;  3J80 K;  1J0R A;  4LG0 B;  3M7G A;  3FXU A;  4WWC A;  4JQF A;  3FXR A;  3V8K A;  4BHC A;  1XGS A;  2VT3 A;  1IW7 F;  4CIC A;  1FSH A;  5HDK A;  3V8J A;  2CYY A;  3DF8 A;  2P5K A;  1W5T A;  1UHW A;  5K1Y A;  2V9V A;  1ZRD A;  2HYG D;  1PUE E;  4RGS A;  1XCV A;  1BIB A;  2HS5 A;  4WXD A;  5DV5 A;  4A5N A;  4OIP F;  5H6R A;  2XRN A;  4KFC A;  4UV9 A;  3HRU A;  2XAG A;  2CG4 A;  3LAJ A;  5JVT A;  2FE3 A;  4P96 A;  5A2Q K;  3T8R A;  4YFK F;  3BP8 A;  1FBQ A;  4E70 A;  2CW0 F;  4Q5S F;  3U1D A;  3D5L A;  3ULQ B;  4ZH4 F;  5BOX A;  3BPV A;  1D5V A;  3GFI A;  1QO0 D;  2NAZ A;  4RS8 A;  1O7F A;  1ZGA A;  1HBX G;  1TQP A;  2VOP A;  2DQR A;  4OMZ A;  3HSE A;  2EFP A;  5AON A;  3ELK A;  3M8E A;  2W24 A;  1G3Y A;  4LMY A;  2P6T A;  4L5I A;  5HLI A;  3H3U A;  2MH2 A;  2HWV A;  1WI9 A;  2TDX A;  3J81 Z;  1U3E M;  1RUO A;  3IRR A;  1FYK A;  4UNO A;  2DAO A;  4ZYE A;  2NNY A;  1YS6 A;  4M72 A;  4GYG A;  2PFB A;  5L3G A;  4K2E A;  2DBB A;  4P9U A;  4UV8 A;  1Z9C A;  4LB6 B;  5FFZ A;  1FP1 D;  5D4S A;  1BI0 A;  3F6O A;  2VBY A;  4I09 A;  5FD6 A;  2OZU A;  2XAS A;  4JBA A;  4EJV A;  1T39 A;  5D5U B;  5JFR A;  3HTS B;  4L0Y B;  1P4W A;  3F8M A;  4OOI A;  2G7H A;  3O3K A;  2IP2 A;  1B4A A;  2XVC A;  2DK8 A;  2CFX A;  3HOS A;  3TOB A;  3OOP A;  5CVU A;  3P9I A;  3E5U A;  2A6H F;  4HX4 A;  3GVA A;  5D6E A;  1PP8 F;  4IHS A;  3F8C A;  1SAX A;  3T0Y A;  4MTE A;  3D0S A;  4AVP A;  1R1T A;  2V1D A;  2QQA A;  1OYW A;  2HTS A;  1T6S A;  3ECO A;  1C0W A;  3VFZ A;  2FA5 A;  1ODD A;  1Z6T A;  3KLN A;  3R0A A;  4M9X A;  4O3M A;  4XSX F;  3E6D A;  3EDP A;  4AWX B;  4NB5 A;  1ZG1 A;  3G73 A;  3ZMT A;  2HKO A;  2W57 A;  1XSD A;  1LEB A;  3SZT A;  2G7U A;  2JTV A;  1DPU A;  1BN5 A;  1TNT A;  3QP5 A;  1ON1 A;  2WTE A;  4YIF A;  5H6Q A;  4A12 A;  4MNU A;  3PQJ A;  4EM2 A;  2RQP A;  2ACJ A;  1FP2 A;  1O3S A;  1R1V A;  3QU3 A;  5D6F A;  3ZMD A;  1REP C;  2XKO A;  2GXG A;  4HLX A;  1EH6 A;  3HUG A;  3L2C A;  3Q5F A;  3HRS A;  3BRO A;  3F8B A;  3E3V A;  5H20 A;  2HYF A;  4BHP A;  2Q0O A;  1OKR A;  1U6G A;  3ZN1 A;  5HVQ C;  2K02 A;  4XRF A;  4ON0 A;  1WWX A;  4ESJ A;  1IXC A;  3RYP A;  4DQ2 A;  1CGP A;  2YPR A;  2EA2 A;  3VEP A;  3GFJ A;  1HXD A;  2VON A;  2J5O A;  5AIQ A;  1HQC A;  2Z3Y A;  1S3J A;  3KP5 A;  3J81 K;  4R1H A;  1R58 A;  4CZZ A;  5ICE A;  2IVM A;  4L18 B;  2Z33 A;  3E5Q A;  4HX7 A;  3H3Z A;  1O3T A;  5FLX K;  3WTT C;  1P4A A;  2FXA A;  1YYV A;  1CF7 B;  1R5G A;  3TGN A;  4I0A A;  3EQL F;  4RB3 C;  1W4M A;  1JHF A;  1YLF A;  4G6Q A;  3I4P A;  1WQ2 A;  4OIN F;  2ESN A;  4BHB A;  4HDU A;  3GLX A;  2BYV E;  4OMY A;  1RNL A;  4KIG A;  4JK1 X;  3U2R A;  4UVC A;  3JSO A;  2AXL A;  1LDK B;  2KJB A;  4GGG A;  1G3T A;  2W25 A;  3H92 A;  4BXU A;  4U88 A;  3JAM Z;  1GVJ A;  3R60 A;  1S7O A;  5CVI A;  1KYW A;  2RKH A;  2QBY B;  4KNY A;  4KA4 A;  1ZRF A;  2HGC A;  1J75 A;  3BZ6 A;  1KQ9 A;  3QPH A;  5TJJ A;  4UHT A;  3WG9 A;  3L09 A;  2H6C A;  5E17 F;  4PGH A;  2Y75 A;  3TO6 A;  5D8K B;  1QZZ A;  4FHT A;  3BOQ A;  3WE3 A;  5BPI A;  4ESB A;  1I1G A;  2FBH A;  3LAP A;  2HR3 A;  1L3L A;  4HZF A;  2E7X A;  1J59 A;  5LHH A;  1OYI A;  4N0B A;  1J2X A;  1DPR A;  1BBY A;  3PQK A;  2XRO A;  2H94 A;  3P9C A;  5LRS A;  1LEA A;  1U2W A;  2XIG A;  3CO7 C;  3WTZ A;  1B6A A;  2EA4 A;  3DPT A;  3GZ5 A;  4Y17 A;  2RC4 A;  1IRG A;  2EFN A;  3F3X A;  1IN6 A;  2OQG A;  3IWZ A;  2P4W A;  3KEQ A;  2XKP A;  3CO6 C;  1XD7 A;  2DO7 A;  2XAQ A;  3ZMZ A;  1U5T A;  2PLY A;  1MJ9 A;  4P55 A;  2V79 A;  1PDN C;  5HOO A;  3FX3 A;  4L5J A;  1HW2 A;  3NQO A;  3F23 A;  2H6B A;  1DP7 P;  1BI3 A;  3DXJ F;  3I58 A;  4KUM A;  5K5Q A;  2MBF A;  3I0T A;  1YG2 A;  2M30 A;  4DNC A;  3F22 A;  3I54 A;  3IHU A;  3KEO A;  3IKV A;  1MDM A;  1J5Y A;  1I5Z A;  3ZMU A;  4MQ9 F;  3JW4 A;  1W7P A;  2P8T A;  3TOA A;  3FMQ A;  2L4M A;  5AIP A;  1Y0U A;  2MLG A;  4LLL A;  1P6R A;  2Q8K A;  5J8F A;  2ZBK A;  1ONV A;  1SMT A;  2RNJ A;  4G9Y A;  2VC0 A;  3RKX A;  3N4M A;  2LKP A;  1K6O A;  3KLO A;  3MEX A;  4L9N A;  5HS9 A;  2RVC A;  2PJP A;  4IJA A;  4TV7 A;  1R1U A;  2HQN A;  4AIH A;  1WKM A;  4PDK A;  1YIO A;  4HOB A;  1U5T B;  1XGN A;  4WX9 A;  5HS8 A;  1TTY A;  4Q4Z F;  3JAM K;  2ZME B;  2IRF G;  3TKY A;  3RDI A;  4IVN A;  4ESF A;  1BOA A;  2KIF A;  1FSE A;  2UZK A;  4A0Z A;  3WTX C;  4FT8 A;  1U8R A;  2RDP A;  1R36 A;  1QQI A;  3GXO A;  5BS6 A;  2PBI A;  5HS7 A;  5D4R A;  2VE8 A;  3L00 A;  2KRF A;  1V4R A;  1S8N A;  2MD5 A;  4IRG A;  1W7P B;  3FM3 A;  2X0L A;  1K78 A;  2Z99 A;  3LFK A;  5BPD A;  1YW9 A;  2ZKZ A;  1TQM A;  4GYI A;  4H0E A;  4KIF A;  4U7D A;  4ETS A;  5D5W B;  4IHT A;  1LB2 A;  1J7K A;  1R23 A;  1ZHF A;  2DLL A;  2VE9 A;  1SD7 A;  3V7C A;  1PP7 U;  1YFH A;  1Z05 A;  1Z91 A;  3ZMV A;  2EFW A;  1STZ A;  2EV0 A;  3I5U A;  3F8F A;  4RAZ A;  3ABU A;  4LLG F;  2DI3 A;  4ENN A;  2CQK A;  5LGN A;  1FX7 A;  3GO5 A;  3O6B B;  3DP7 A;  5HLG A;  1F1Z A;  2W85 A;  5KVR A;  4HQE A;  2DQL A;  4OIR F;  1QNT A;  1X3U A;  3KE2 A;  1JE8 A;  3LA7 A;  2YX7 A;  3N97 A;  3C1D A;  3DPL C;  2XGX A;  3WU0 A;  5L3C A;  5CLS A;  3SXY A;  3GUD A;  2ZXJ A;  1FBS A;  1O7L A;  1IN7 A;  2QWW A;  2MC3 A;  1K78 B;  1MJA A;  4KDP A;  1BIA A;  4EGY A;  2FEZ A;  1T98 A;  4LK1 F;  1G3W A;  2XAH A;  2J5P A;  1HST A;  2K7L A;  4HQM A;  4LB5 A;  1XN7 A;  1JHH A;  3KZZ A;  4CHU A;  1U78 A;  2V6C A;  4A6D A;  6PAX A;  2O61 A;  2A68 F;  3K9T A;  1GHC A;  4ENJ A;  1S6L A;  4A6E A;  3LQQ A;  3QOP A;  3HHH A;  1DUX C;  3FM5 A;  3COA C;  2YR2 A;  1LDJ A;  2UXN A;  4FX0 A;  4N9I A;  1SMY F;  3TO7 A;  1UB9 A;  3I64 A;  3CUQ A;  4P5O A;  3FF5 A;  5LHG A;  2VBW A;  5CVV A;  1K79 A;  4A2U A;  4AD9 A;  3HOT A;  3I59 A;  2P5V A;  4LJZ F;  2OQR A;  2IA0 A;  2O6G E;  5ILV A;  2E1N A;  3JSP A;  3HIF A;  2DW4 A;  1E17 A;  4QWQ A;  4ENK A;  1Z6R A;  3G3Z A;  3F6V A;  4U0W A;  2JT1 A;  3ISP A;  1IRF A;  4P9F A;  5IT9 Z;  1XGM A;  1BC8 C;  4G7Z F;  3HHG A;  3M9A A;  1ZRC A;  1GXQ A;  1QZY A;  2HEO A;  2GZW A;  3BJ6 A;  4WXH A;  3ROU A;  3ZQ7 A;  4ASN A;  4WCG A;  3VB2 A;  5ILU A;  2GAU A;  1IF1 A;  1F5T A;  5F1R A;  3RJP A;  3MZH A;  1D8J A;  4LLN A;  3CDH A;  4RB1 A;  1CF7 A;  4KMU X;  2BE5 F;  5HDG A;  1OMI A;  3GF2 A;  3S2W A;  2IW5 A;  4CO8 A;  2NYX A;  3CUQ B;  4PZJ A;  2K86 A;  5F64 A;  4HF1 A;  3I59 B;  4HX8 A;  3I71 A;  2OD5 A;  1L0O C;  2CWE A;  4PCQ A;  4LK0 F;  1OR7 A;  5E18 F;  1FYM A;  4NHJ A;  1LNW A;  1FOK A;  4B8X A;  5DEQ A;  4HF0 A;  4EMS A;  1U5T C;  4CGZ A;  2F2E A;  1ZG3 A;  3ECH A;  3B73 A;  1DDN A;  4EGZ A;  2F5F A;  2X4H A;  3QU6 A;  3WTY C;  5ICC A;  5J6X A;  1YS7 A;  1KQ0 A;  3BJA A;  2QBY A;  2GQQ A;  4I0B A;  2R7F A;  1H0M A;  4G8X A;  1XDS A;  3DEU A;  2DPD A;  3C3W A;  1ZRE A;  1BJA A;  4KN7 X;  1TW2 A;  4YFN F;  2QM3 A;  4G7H F;  2JRT A;  1OYY A;  1JGS A;  4OU0 A;  1RUN A;  2AS5 F;  3AAF A;  5DD4 A;  2Q2E A;  4M74 A;  2L01 A;  2M8E A;  2DT5 A;  1B9M A;  2ZCW A;  2D1H A;  3WTS C;  4HLY A;  3F8N A;  2DU9 A;  1HSJ A;  1D8K A;  1XB4 A;  3LQR A;  3MAJ A;  1R22 A;  4UUV A;  1TQI A;  2PEX A;  5FB2 A;  1HKS A;  2Z5U A;  5D8L B;  2L3D A;  3NEU A;  4BAY A;  2HDC A;  3T1B A;  1T2K A;  3KZY A;  3EET A;  4HW0 A;  2XV4 S;  3R0J A;  3V8L A;  1EH7 A;  3WTV C;  3LWF A;  3C18 A;  3KP7 A;  1YW7 A;  2Y0M A;  1TLH B;  2K4J A;  3MQ0 A;  5IT9 K;  4WF2 A;  4LD5 A;  1ZH5 A;  3IC7 A;  1QGP A;  2K27 A;  2H09 A;  1XGO A;  3P9K A;  2K4B A;  5LBQ A;  2R3S A;  2W84 A;  3DQV C;  1BI2 A;  5LLQ A;  3K1M A;  5JI6 A;  4M73 A;  1AWC A;  4CXF A;  3WU1 B;  3SZP A;  3L7W A;  4D0P A;  3K2Z A;  4S05 A;  4MEY F;  2BV6 A;  3IWF A;  1F4K A;  4RB2 C;  2EV6 A;  4ZZL A;  2GA1 A;  1LJ9 A;  1SD5 A;  4XBF A;  5L3F A;  2OU2 A;  2QEN A;  5D5V B;  4ZYH A;  4IXA A;  3V7S A;  3GEZ A;  3QPT A;  1RI7 A;  1ZAR A;  3KFW X;  2DPU A;  4AIK A;  3HSF A;  3ML6 A;  2NS0 A;  4MEX F;  1ZLJ A;  5DDG A;  1IXS B;  2PQ8 A;  4N9H A;  1YQA A;  2Z9O A;  4GCV A;  1MD0 A;  2L54 A;  3PFI A;  5E1X A;  2RV8 A;  2VC1 A;  3R61 A;  2NNN A;  2PG4 A;  1BI1 A;  2YSR A;  3BWG A;  2ZME A;  5DCM A;  2VOD A;  2FNP A;  3HTU A;  3IL2 A;  3V4G A;  3HYI A;  3LA2 A;  2F5C A;  2ESH A;  4A5M A;  4KN4 X;  1S7A A;  3TDZ C;  5KK1 A;  2P6S A;  3P7N A;  2FBI A;  5L3B A;  2FOK A;  3TQN A;  3V7R A;  2XAF A;  4MTD A;  5F6F A;  1ZN2 A;  5E20 A;  3M8F A;  1UST A;  1LDD A;  2ZNY A;  1IN5 A;  1KU3 A;  2ISZ A;  3BJO A;  4MGR A;  1GXP A;  2L02 A;  3BY6 A;  2HZT A;  3DFG A;  2HFH A;  1XCB A;  2EFQ A;  2FU4 A;  3K1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...