4KA4A

Crystal structure of a proteolytically defined zbeta domain of human dai (zbp1, dlm-1)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
FSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Z-DNA-binding protein 1
publication title Crystal structure of a proteolytically defined Zbeta domain of human DAI (ZBP1, DLM-1)
rcsb
source organism Homo sapiens
total genus 18
structure length 61
sequence length 61
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2013-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ka4A00
1AOYA 1ZYRF 3LQQA 3H92A 4IRHA 1F9NA 1FYLA 2GXGA 3FM5A 4BQAA 2MH2A 3K1NA 1DUXC 4NB5A 3K1MA 2IA2A 1G4DA 2D45A 2H94A 1OYYA 3F8BA 1YLFA 3FM3A 1KQ9A 2DO7A 4LD5A 2L4AA 3P9IA 2IW5A 5K5RA 1F4KA 1T2KA 3CUQC 3CJNA 1MKMA 4ENMA 2G7HA 4RAYA 3F3XA 3LQRA 4ZYGA 2MD5A 3GFMA 3KE2A 4Y15A 4XLNF 3K1PA 5ICFA 2HFHA 1T39A 3DF8A 4IHTA 5H20A 4WCGA 1UFMA 4UUVA 3I64A 1HW2A 4I0BA 4F7ZA 3GW2A 1FY7A 1OR7A 1AWCA 5DD4A 4CXFA 3GYHX 3N4MA 2XAHA 3H3UA 4PZJA 3J80Z 2FRHA 4A6EA 2F5EA 2BYVE 2RN7A 4G6QA 2IJLA 3BPXA 1XDUA 1B1BA 4AIJA 3KCCA 4ZZLA 3IC7A 2A3SA 1ZARA 4UVBA 4KIGA 4DQ2A 3O2PE 1FOKA 2E7XA 3HYIA 3BY6A 1YIOA 3TDZC 3E5XA 3E5UA 1IXRC 1K6OA 2XVCA 1R5GA 3J7AO 1T0FA 2CWEA 1J5YA 2R3SA 2QENA 2HGCA 1RNLA 3P7NA 2V79A 2HEOA 1HXDA 3I0TA 5TJJA 3RYRA 2Z33A 2ZFWA 1BI1A 4M71A 1E2XA 1K78A 1W7PB 3FWEA 1SD5A 2FEZA 2OQGA 2PEXA 2K4JA 1CGPA 2MLKA 4LJZF 1FYKA 4UNOA 2PBIA 3TO7A 3ZP5A 4N0BA 2FQ3A 3C7JA 4IJAA 2STTA 3W6JB 3HOTA 2VT2A 1BC7C 3V7RA 1W4MA 4N9HA 5D5XB 2FF4A 3F8CA 4ZH4F 2F5FA 2MA3A 3E6DA 3RPUA 3T0YA 3FF5A 4WWCA 2VE9A 1KU9A 1F1ZA 1L0OC 3HIFA 4HZFA 2ZJ2A 3R6SA 1OPCA 1J75A 3TOAA 5CJ9A 3C3WA 1HKQA 4HF0A 2W84A 3V8JA 2P5VA 1J9IA 3KETA 3BJAA 5CVIA 2A07F 4I0AA 3KFWX 5CLSA 1O3QA 2Q0OA 4LG0A 3ZN0A 3WE2A 1FLIA 2VODA 3WTUC 2GIVA 4LG0B 3TDUC 1QPMA 3O3KA 4GYGA 1P6RA 2YX7A 3WTXC 4BXUA 4GXOA 3KP7A 2VN2A 2EFNA 3JAMK 3KZYA 1HSTA 4AD9A 1BBYA 5D8KB 3C1DA 4BHBA 1WI9A 3V7SA 4ASNA 2F5CA 2DPUA 4RAZA 1R1UA 2C6YA 3D0SA 4CDGA 3HRTA 1O7FA 2CFXA 2DQLA 2V9VA 2R7FA 4LLGF 4EJTA 5DCFA 1QBJA 1SFUA 1MJBA 4PDKA 4EVIA 4QLCU 4YFNF 2VT3A 4HLXA 4L9VA 2OU2A 2Z5UA 2KJBA 5JHUA 1TBXA 2M1BA 3NQOA 4N9IA 4HLYA 3SHFA 1BM9A 1KQ8A 4RGUA 1TNSA 4L5IA 2FNPA 3ECOA 4EGYA 4LGWA 2ADUA 3QRFF 1RI7A 4M9XA 3ZMVA 1ODDA 3RYPA 3ZMSA 3J81Z 2ETHA 1R7JA 1J2XA 2D1VA 1Q1HA 4HX8A 4RGXA 2JRTA 1FSEA 4RB1A 3VODA 4FHTA 3RIRA 1GVJA 5CVUA 3OOPA 4GGGA 2ISZA 3HSFA 2KIFA 2PQ8A 2NNNA 5EEHA 2FOKA 4OOIA 1ZG1A 5LGNA 2ZKZA 1G6NA 2DU9A 2EB7A 2M87A 2HWVA 2K7LA 3HRMA 1JHFA 3EDPA 4EJUA 4WX9A 1HKTA 1J59A 1Z05A 1XMAA 1QQIA 3P9CA 2A5YB 4Q5SF 3BPVA 4M6YA 1QZYA 3M8FA 3JW4A 3OV8A 4MHGA 4I01A 5FD6A 1P2FA 2LF8A 4ENJA 2YU3A 1T6SA 3BWGA 4MGRA 4PCQA 4I02A 2VC0A 5ED4A 5DYMA 1EV7A 4O6JA 5FFZA 2JSCA 3HSEA 2RDPA 3HTUA 2PG4A 4PGHA 1L3LA 1G3SA 4WK8F 1MJAA 5CVVA 1PP7U 5ICCA 2IVMA 3RI4A 2CG4A 3J80K 5LLQA 2QVOA 4A12A 1ZAOA 1I6XA 1YG2A 2HQRA 4JQFA 4P96A 2HTSA 2L01A 2M5WA 3K2ZA 1ZGJA 4OIPF 5LRSA 1FBQA 4E70A 3TKYA 3S2WA 1CF7B 3WE3A 2RV8A 2H09A 3QPTA 2O03A 1XSDA 2BBYA 2B0LA 1B59A 1FP2A 3TGNA 3PQJA 3K9TA 4P55A 1B9NA 4IRGA 5HLIA 1KU2A 2DLLA 2A69F 5L3FA 1S7OA 3V8LA 4NHJA 2J5OA 3FHZA 4P9FA 3F6VA 1KQ0A 2GWRA 3GVAA 1MGTA 3LSTA 3DXJF 2RNJA 2P5KA 5DCMA 2WC2A 1IUYA 3GUDA 4UVAA 2EFPA 4EM1A 4OIOF 2UZKA 3M9AA 2LDUA 3ISPA 2DT5A 5D6EA 1OKRA 2HDCA 4KT5C 3K69A 3KLNA 1U8RA 1FC3A 3LA7A 4KICA 2ESNA 4MTEA 2OAZA 1TW2A 1STZA 3G73A 3I4PA 2M30A 5D4RA 2HZTA 3ZMTA 1ZLKA 2EA4A 2Y0MA 3E6CC 2A61A 4EGZA 5HLHA 1RIOH 4AIKA 3DPLC 5JFRA 1YW7A 3MWMA 4BHPA 3U9GA 3EUHA 4RB3C 2QBYB 1FBSA 4EM2A 2A6EF 2OD5A 2CW0F 4HDVA 5CVJA 4CYDA 3E6BA 1X3UA 1HKSA 4XSXF 1BC8C 2PLYA 3IRQA 2O8XA 3ABUA 3C18A 2XASA 5F6FA 3DKWA 1LEBA 2F2EA 2JTVA 3DFGA 1D8JA 1R5HA 1FPQA 5K5QA 2L4MA 4PGGA 5DD8A 3TQNA 3MEXA 1IN8A 1KYWA 2ZXJA 4BNCA 4Q48A 1DPUA 3WGIA 4UV8A 1YTYA 2HOEA 2ZNZA 5D6FA 2EV6A 2O0YA 2Y75A 4RB2C 4ON0A 2O6GE 3KLOA 3DPTA 2VC1A 2DW4A 5DUKA 1USTA 3J81K 1LDJA 2G9WA 5LRRA 4ZYDA 4XRFA 1MZBA 4EQQA 3E5QA 5E17F 4UHTA 1BIAA 5JI6A 3LA3A 2ZCWA 1B6AA 3M1EA 2LNBA 2H6CA 4I7HA 2QQBA 1BI2A 2XGXA 4HA8A 1IRGA 2QQAA 4LFUA 5KVRA 1ULYA 3MFKA 4RGSA 4U7BA 3KEOA 1LJ9A 3F8NA 5E8IA 4KYWA 2ISYA 4A6DA 2L02A 2FMYA 1R00A 4R79A 4KMFA 2LSOA 1EH8A 4NQWA 1W7PA 2DAOA 5IT9Z 3FZVA 5E8GA 1A04A 5JR3A 3GLXA 5BQTA 1P92A 3MZHA 1I27A 4BHCA 3RTRA 1R23A 1FX7A 3SXYA 2IA0A 5ILUA 1R22A 2D1HA 4U88A 2XAFA 3EQLF 4A0YA 1XSXA 2DPDA 3F72A 1ZRFA 4XBFA 3VEPA 2QLZA 3VOEA 2GA2A 5HDGA 4MTDA 1Y0UA 5A2QK 3KP3A 2BGCA 4TV7A 2MC3A 3DEUA 2GZWA 1KU7A 1Z6RA 1D5VA 3WODF 4R8HA 4S04A 2HQNA 2W57A 4ZZDA 4KUMA 3BJ6A 5FFXA 1LDDA 3ERED 2QM3A 3F21A 4KIFA 1WQ2A 2KJCA 3HHGA 4ENNA 4BH9A 1BOAA 4U7DA 2YPRA 5KK1A 2IA1A 5D4SA 3V7CA 2X4HA 5F1RA 1ZLJA 2FU4A 2PJPA 2V1DA 1UB9A 1QNTA 2IRFG 4MNUA 2L54A 4L9NA 1ON2A 1U78A 2FBKA 1HQCA 2JPBA 1XGOA 2FSWA 2RVCA 1UHWA 4CO8A 3HUGA 5E18F 1FP1D 1XD7A 2QZ8A 2XKPA 3FX3A 2XAQA 3HTSB 1IN5A 2DFIA 2Z99A 4P9UA 4EJVA 5J8FA 2D2WA 1XB4A 2OBPA 4EM0B 1F5TA 2O3FA 3BZ6A 4IVNA 2ZMEB 3JSOA 4BYYA 2O61A 2EV0A 5FLXZ 4LB5A 4A5NA 1R36A 3NEUA 4EMSA 3I53A 4M9SA 4UVCA 5DEQA 4KNYA 3KP5A 4WXHA 3ZMZA 2H27A 2ZO4A 3ELKA 3PFIA 3TO9A 3N97A 4HAMA 3BROA 2JT1A 1MJ9A 3BOQA 2P7CB 3GZ5A 3BJOA 4CZZA 2PMHA 1FWZA 2Z9OA 4KA4A 1LDKB 1XDSA 2VBXA 3HHHA 4FX0A 1W7PD 2A6HF 1XMKA 1H9GA 4KMUX 5AONA 3R0AA 2ACJA 5HVQC 3ZQ7A 4KN7X 5L3EA 2CQKA 1IRFA 3MAJA 1ZREA 3TO6A 5BMZA 3QU6A 2QUFA 3GZ6A 4ESFA 2BEOA 2P8TA 3WTSC 2XRNA 1MD0A 1JHHA 4G9YA 1FT9A 2P7VB 1TQIA 3Q5FA 2JPCA 3EYIA 1YO5C 1GXQA 5LEJA 2PN6A 3RPQA 3GO5A 4LK1F 5H6QA 4CHUA 2NNYA 3V4GA 1XCBA 3JTGA 4ZYHA 4DNCA 4JBAA 1JXSA 1CF7A 1RZ4A 3WG9A 5FD5A 1FSHA 4L5JA 2DK8A 4M74A 3F23A 4AVPA 2E7WA 2P4WA 2EJRA 1O3TA 4A0XA 5HLGA 4GO1A 2FE3A 1TTYA 4IPAA 3GF2A 2XUBA 4KFCA 1XGNA 1BIBA 4HF2A 4HOBA 4LK0F 1ZRCA 3IRRA 2KIMA 1SD6A 2P5LC 4A5MA 1GHCA 4OINF 5A2QZ 3TOBA 4L0ZB 1J7KA 5IT9K 5ICEA 1OYIA 4EV0A 4AIHA 2ZBKA 1OMIA 1PDNC 2WWYA 3PQKA 3HRUA 1B9MA 5CYVA 3V8KA 1HW1A 3WTZA 2UXNA 2W25A 4FT8A 3D5LA 2AXLA 2V1XA 5ILVA 5ERIA 2M45A 2K86A 4KIBA 1VTNC 1D8KA 2ELHA 2CGPA 3QAHA 3DQVC 5L3GA 1O3SA 2Y48A 4CICA 1R1TA 1HW5A 4KDPA 4RGRA 5E1WA 1ONVA 1U3EM 1KA8A 2IPQX 3VFZA 5ILSA 5EEGA 4IF4A 2GAUA 3ZN1A 2XAJA 2EWNA 1UCRA 1H0MA 1IW7F 3U2RA 1TQMA 5DUIA 1YS6A 4WXDA 2QBYA 3R61A 1HBXG 3CUQB 1I1GA 3DV8A 3MZYA 4LMYA 3GEZA 3T8RA 1R58A 4CGZA 4G6DA 1P4WA 4OMYA 3WTWC 1ZRDA 4JK1X 2E1CA 3HSRA 2PMUA 4OIQF 2XIGA 3WTTC 5FGMA 4OMZA 1EH7A 1FNNA 3EETA 2DBBA 4GCVA 2HR3A 1T98A 3IKVA 3CTAA 2P6SA 2DI3A 3GWZA 4O3MA 1T38A 1SD7A 5BPDA 1RUNA 4M73A 2MBFA 1FZPB 1QO0D 1YYVA 1ON1A 3O6BB 4R1HA 2Q8KA 4Q4ZF 4YIFA 2DTRA 4Q47A 4GYIA 2TDXA 4L9TA 5FLXK 2RGVA 1MDMA 2PFBA 3L2CA 3R60A 3T8TA 1Z91A 5LEKA 4QWQA 4HX4A 1MDMB 3QU3A 3H3ZA 2MLGA 1K7AA 3WTVC 2KKOA 3I54A 1TLHB 3FXQA 2VXZA 4LB6B 5L3CA 3I71A 2W24A 1O3RA 3T1BA 1IXCA 3ECHA 4HBLA 1DDNA 5E20A 2NYXA 2IP2A 3CLOA 3Q9VA 4H0EA 3KP6A 4U0WA 1K79A 2YSRA 3VB2A 2XAGA 5J8CA 2XROA 4IXAA 5LHGA 2VBYA 4OIRF 5LGTA 2RQPA 3R4KA 3FMSA 1ZG5A 1YS7A 3RKYA 1DP7P 3NRVA 4AWXB 2X0LA 1XCVA 4LLLA 4HW0A 1SAXA 5D5WB 4ESBA 4HQEA 3QPHA 1LNWA 4XLPF 2EK5A 5DDGA 1XGSA 1U5TA 3E97A 1P4XA 3QP6A 1BN5A 1S8NA 3FXUA 1H9TA 1PP8F 1LEAA 4G8XA 1U5TB 1KU3A 5HS8A 4MEYF 1USSA 2MH9A 4L0YB 4B09A 3IHUA 1KYZA 3WGHA 2CYYA 2ZNYA 2VE8A 2F5DA 3BDDA 4L18B 1XGMA 3QP5A 4IHSA 3B73A 5BOXA 2NAZA 1E17A 1SFEA 5BS6A 2CSOA 1DPRA 1S6LA 2BE5F 3L00A 1IN6A 1G3TA 1FBUA 2H6BA 1TNTA 3KP2A 3KZZA 1O7LA 5LHIA 4M72A 1K78B 1B4AA 5DV5A 2GXBA 1Z7UA 4XSZF 3DP7A 3F8MA 3FMRA 3COAC 1BJAA 5BPIA 2XKOA 2FMLA 4Y17A 2XV4S 2M8EA 5L3BA 1D3YA 1TQPA 2QQ9A 2FA5A 1ZG3A 1IN7A 1IAWA 2DK5A 4B8XA 1W5TA 2W85A 1U5TC 4HQMA 1JE8A 3I58A 5ICGA 1S7AA 1IN4A 4HF1A 3T5XA 1P4AA 3GFLA 3ZMDA 4A2UA 3ZPLA 1YW9A 2YR2A 5H6RA 2EV5A 5IT3A 3L7WA 4L9JA 4FX4A 5HDKA 5AIPA 3RKXA 5D5VB 1YW8A 3I59A 3HOSA 1ZGAA 5D5UB 3IWFA 2GQQA 1ZH5A 2VOPA 1V3FA 1TW3A 3ROUA 3I59B 3Q9SA 4EJWA 4S05A 2ZMEA 1Z1DA 4G7ZF 3WTYC 4Z2YA 2LKPA 3M8EA 1RUOA 3CO6C 4HV6A 1HSJA 1O57A 3E3VA 4G94A 4I2OA 2FNAA 2EFWA 1WWXA 2YX4A 2HYGD 4YG2F 2A68F 1QGPA 4MQVA 5TRDA 1IZ1A 2GA1A 2E1NA 1I5ZA 2EFOA 2QWWA 3K0LA 5F64A 2XHKA 4HDUA 1S3JA 2FXAA 4U0VA 3B02A 5CVRA 2HYFA 5LHHA 4HX7A 3GFIA 2HKXA 3MCZA 1WSUA 3WU1B 1V4RA 4UV9A 2VONA 2EFQA 3U1DA 3GFJA 4YIIA 1JGSA 3RDIA 5LGUA 2UXXA 1I1SA 3I5UA 3ZMUA 6PAXA 2NRAC 2G7UA 4IRIA 4BAYA 2LF7A 1C0WA 5K1YA 1Z6TA 1IXSB 4OU0A 4RB0A 5K5OA 5E1XA 4HYEA 2R7DA 1OYWA 5J6XA 1LVAA 2Z3YA 2EA2A 1S29A 4U0YA 1LQ1A 4ESJA 3L09A 4ETSA 2BV6A 2STWA 3KP4A 3CO7C 2K02A 2KIUA 2P6TA 1UHMA 3GXOA 1XN7A 1EH6A 2FBHA 4HV5A 4UXNA 1J0RA 5LBQA 2JZYA 4ENKA 3L9FA 3F22A 3KEQA 1ZHFA 1WRJA 4ZYEA 1WKMA 1BI3A 2PI0A 3MQ0A 1Z9CA 2NS0A 1YFHA 3ULQB 2K27A 3E6MA 2Q2EA 1SMYF 3LFKA 3CUOA 2RC4A 1NHAA 1QZZA 5FB2A 2WTEA 4WF2A 2HS5A 1SMTA 2AS5F 2RKHA 5HDNA 4MEXF 1LB2A 3IL2A 4MQ9F 3BP8A 3ABTA 3M7GA 4LLNA 3W6KB 4Y13A 5HS7A 5HS9A 5HOOA 1G3YA 2FBIA 1IF1A 3FMQA 5AIQA 3GX4X 3RKWA 3IWZA 1U2WA 3EYYA 1W5SA 2HKOA 3JTHA 3WU0A 2UWMA 2J5PA 3ML6A 1REPC 1R1VA 4I09A 2VOOA 3LAPA 2IT0A 2QYOA 2WV0A 5DCMB 3SQNA 4O5VA 4M6XA 1ZN2A 2VBWA 4YFXF 4I98B 2OQRA 4EJOA 4KN4X 3SZPA 1FYMA 3CUQA 2V1UA 3JAMZ 2K4BA 2CO5A 3LA2A 3LAJA 3P9KA 3IKTA 2VBZA 1SFXA 3R0JA 3CDHA 5FO5A 3WGGA 3JSPA 3SZTA 3RJPA 2OZ6A 3QOPA 4P5OA 1BI0A 2L3DA 4G7OF 3F8FA 2DQRA 2KRFA 2HTJA 1XSVA 5E1ZB 2COMA 5JVTA 3AAFA 2OA4A 5D8LB 1YQAA 3F6OA 4G7HF 2OZUA 5L3DA 1G3WA 3G3ZA 1GXPA 1KGSA 4K2EA 4YFKF 1SD4A 2V6CA 3REOA 3SFZA 3FXRA 1PUEE 4RS8A 4WXCA 4M9ZA 4D0PA 3HRSA 4A0ZA 3LWFA 2ESHA 1U6GA
chains in the Genus database with same CATH superfamily
1AOYA 1ZYRF 3LQQA 3H92A 4IRHA 5GTHC 1F9NA 1FYLA 2GXGA 3FM5A 1MW7A 2B7EA 2MH2A 4F92B 1MBJA 2CV0A 3K1NA 1DUXC 3CC2I 4BQAA 4NB5A 1QRYA 2M0CA 2WY8Q 4HNTA 3K1MA 4ANJA 1ETVA 2IA2A 1ZTRA 1G4DA 2D45A 2DDBA 3PNTA 2H94A 1OYYA 1GVDA 3K4BA 4XLAA 4DYQA 3F8BA 1CQTA 3OYDA 1FOXA 4E4HA 1QU3A 1YLFA 3FM3A 1KQ9A 3CMEI 1TT5B 2DO7A 2FOWA 2O8KA 4LD5A 2L4AA 3ZQGA 3P9IA 4DIQA 2IW5A 2NXNB 4N4OB 5K5RA 1FOWA 1F4KA 1T2KA 3P5JA 3CUQC 2XB5A 3AG4H 3CJNA 1MKMA 5IP9J 5C4JJ 4XONA 4II3A 4ENMA 5GTIC 2G7HA 3VSLA 3K4MA 4RAYA 1GLNA 1MMGA 2JWTA 2KRCA 4RBOA 3ZQQA 2KP6A 1HLVA 3F3XA 3LQRA 4ZYGA 4AU7A 3NWTA 5IP6A 1LPQA 4A3IJ 2MD5A 3GFMA 3PL8A 3KE2A 4Y15A 1P9QC 4XLNF 3K1PA 1JTXA 4NC7A 4A3KJ 3EPZA 5ICFA 2HFHA 1T39A 3WHCA 1IDZA 3DF8A 4IHTA 2XGDA 1U9NA 5CQGA 5H20A 4ZTFA 4WCGA 1UFMA 4A93J 3CMYA 2ME0A 4UUVA 4Y7NJ 1OCZH 1K83J 3I64A 3E1SA 4NC8A 5IOYA 2ZJPF 1HW2A 2E5NA 4I0BA 4F7ZA 1QVTA 1WJBA 3GW2A 3G1LA 1FY7A 4BJ6C 1OR7A 1AWCA 2A6TA 5DD4A 4A69C 4CXFA 1JKRC 3PNYA 3JRCA 1Z0XA 3GYHX 3N4MA 3CCYA 2XAHA 3H3UA 3B6AA 4PZJA 3J80Z 1FTTA 2FRHA 4UUTA 4A6EA 2VQLA 2F5EA 2BYVE 2RN7A 5J1RA 4G6QA 2IJLA 4YRVA 3BPXA 4XOPA 1XDUA 1B1BA 2DMPA 4PSWA 3UR3C 3KCCA 4AIJA 1MMNA 4ZZLA 3H5AA 3LSIA 3IC7A 2A3SA 1ZARA 4UVBA 4KIGA 2XDVA 4DQ2A 3O2PE 3MKYB 1FOKA 2E7XA 2M4GA 3HYIA 3QWLA 3BY6A 1YIOA 3TDZC 3E5XA 3E5UA 2F4OB 2RREA 1IXRC 3GCMA 4IHYA 1K6OA 2K40A 2XVCA 3A1YA 1R5GA 4RLQA 3RQIA 4ZC3A 1NK2P 3J7AO 2G0EA 1T0FA 3A0BC 2CWEA 1J5YA 2R3SA 1XC5A 1POGA 2QENA 2MABA 1IG7A 2A05A 3K4NA 2TCTA 2HGCA 3IUOA 4BL0B 4F55A 1BJZA 4M6VA 4CZCA 1RNLA 3P7NA 5J40A 3FXKA 2V79A 1XG1A 2HEOA 1HXDA 3I0TA 5TJJA 3RYRA 2Z33A 2ZFWA 2Q1ZB 4Y4RA 1BI1A 1T56A 2JSPA 4M71A 4J19A 2OCEA 1E2XA 4D5CA 1K78A 3W6VA 4AIDA 2OJED 4RAGA 4NQWB 1W7PB 3FWEA 2R7TA 1SD5A 4FETA 2FEZA 2K9SA 2UV1A 2OQGA 2PEXA 2K4JA 1YJNI 1CGPA 1R4NB 3KZIC 2MLKA 2DFEA 4LJZF 3DEEA 3DCFA 1FYKA 4UNOA 3DPUA 3OMYA 2PBIA 1UMQA 3TO7A 3ZP5A 4N0BA 2FQ3A 1AA7A 3C7JA 5E79C 2M7AA 4IJAA 2STTA 3W6JB 5K7FA 3HOTA 1Y1VJ 2VT2A 1BC7C 3V7RA 1W4MA 4N9HA 5D5XB 2FF4A 3F8CA 4ZH4F 1B72B 3BG9A 2F5FA 2VKHA 1ZKGA 2W82A 1OR7C 3I3LA 4AUXA 2MA3A 3E6DA 4II2A 3KYLA 3HL2A 3CMAI 3RPUA 5HLTA 3L2UA 3T0YA 2CU7A 3FF5A 4WWCA 2VE9A 1KU9A 3MKLA 1PJRA 3AL0B 1F1ZA 1L0OC 3HIFA 4UB6C 4HZFA 2L7ZA 2ZJ2A 4XRSA 3CCLI 3R6SA 1F36A 1OPCA 1J75A 1E0EA 3TOAA 5CJ9A 3C3WA 1HKQA 4HF0A 2W84A 3V8JA 2P5VA 1J9IA 3KETA 3BJAA 5CVIA 2A07F 3DTEA 1D1CA 4I0AA 2O7OA 3KFWX 5CLSA 3FXMA 2VLAA 1O3QA 2X6OA 2Q0OA 4LG0A 3ZN0A 3WE2A 1FLIA 2VODA 3KX2A 3MD2A 3WTUC 2GIVA 3S14J 3DU5A 1DGWY 2X1CA 4LG0B 3TDUC 5E3MA 1QPMA 3O3KA 4GYGA 4P1WA 1T0FC 1P6RA 2YX7A 3WTXC 1FJLA 2XRLA 4XRSG 4BXUA 4IHXA 1RR8C 4GXOA 2V6EA 3KP7A 4FQGA 2B9SA 2VN2A 2LC2A 1UELB 2EFNA 3CCQI 1U9OA 3ASOH 3JAMK 1ZGWA 1JKOC 2QCOA 1P7IA 3KZYA 1HSTA 4AD9A 1BBYA 2BOLA 5D8KB 5B1AH 5IPAA 1OCOH 3C1DA 1WI9A 3V7SA 4BHBA 1JI8A 4ASNA 4IO9F 2JVGA 2F5CA 1A6QA 3JCUC 2DPUA 4RAZA 2MYSA 3H0GJ 1R1UA 2C6YA 3D0SA 1D0YA 4CDGA 3HUGB 3JRFA 3HRTA 5HNHA 1R4MB 3NAUA 1O7FA 2CFXA 2DQLA 2V9VA 2R7FA 4J00A 4LLGF 4EJTA 2XGCA 5DCFA 1QBJA 1SFUA 3S16J 1MJBA 3C2HA 1ENHA 2WB1A 4PDKA 2WY7Q 4EVIA 2QQ8A 4QLCU 4UUSA 3BTLA 4YFNF 2VT3A 4B43A 4HLXA 4L9VA 3S1MJ 3SFIA 1T08B 2CFOA 2BXYA 2OU2A 2Z5UA 1RKWA 2KJBA 3ZQHA 5JHUA 1LFBA 4G12A 5JHFA 5LFAA 3OIQA 1TBXA 2M1BA 3NQOA 4UUSB 3S3NA 2JA7J 3AL0C 4N9IA 4HLYA 3SHFA 5K7ZA 1BM9A 4U87A 1KQ8A 2CUFA 4RGUA 1TNSA 1ZK8A 4MIMA 4L5IA 2L9VA 2QA4I 2FNPA 3ECOA 4EGYA 4LGWA 1EF4A 2ADUA 3QRFF 1RI7A 4M9XA 3ZMVA 1OISA 1ODDA 2OV7A 4PUSA 1M1EB 1ETYA 4F3QA 5FKNA 1NG6A 3A03A 3RYPA 3ZMSA 3J81Z 2ETHA 1R7JA 1J2XA 3SJMA 2JA6J 2D1VA 1Q1HA 4HX8A 4RGXA 4E7SA 5HNFA 2JRTA 2WAFA 4V2GA 1PVEA 1FSEA 3OYMA 4RB1A 3VODA 4FHTA 3RIRA 1S5LC 2RNGA 2RAEA 3E0JB 4AYBN 1GVJA 2JN6A 5CVUA 2P81A 1MBKA 3OOPA 4GGGA 2ISZA 3HSFA 5IP7J 2KIFA 2PQ8A 3Q0UA 2HYJA 2JQ7A 2NNNA 5EEHA 4BGDA 2P0WA 1XTAA 2FOKA 2MG4A 1IRZA 4OOIA 4KJZA 3ABKH 1ZG1A 5LGNA 1Z67A 2HI3A 2ZKZA 1G6NA 3CLQA 3S1RJ 2DU9A 2EB7A 2M87A 2HWVA 2K7LA 3G2BA 3HRMA 1JHFA 4JP0A 3M07A 3EDPA 1D1AA 4EJUA 4WX9A 1HKTA 1J59A 1Z05A 1V5FA 1QQIA 1XMAA 3P9CA 2QSGX 2R7WA 2A5YB 2HQAA 3BPVA 1NTCA 1QZYA 4M6YA 4Q5SF 3M8FA 2NOGA 2XF6A 3JW4A 2GXAA 3OV8A 4MHGA 4PFOA 4BE0A 4I01A 5FD6A 1P2FA 2LF8A 2JMWA 3FBIB 4ENJA 2YU3A 1IGNA 2FJ1A 1IO2A 4D7MA 3CCSI 1T6SA 1S9HA 4W1UA 3BWGA 4MGRA 4PCQA 3IH4A 1ORKA 4I02A 4JX4A 2VC0A 5ED4A 2DXIA 5DYMA 1EV7A 4O6JA 5FFZA 1DGRM 1MIJA 2JSCA 3HSEA 2RDPA 2VQCA 3HTUA 4BY7J 3BZCA 2PG4A 4PGHA 1L3LA 4J01A 1ZELA 3S17J 4XKWA 1G3SA 4WK8F 1MJAA 5CVVA 2F5VA 1PP7U 5EZHA 5ICCA 2CJJA 2IVMA 3RI4A 2CG4A 1Y39A 3J80K 4A3DJ 5B3SH 5LLQA 2QVOA 4A12A 4KT6A 3BTJA 4OAZA 1ZAOA 3TW7A 1I6XA 1YG2A 2HQRA 2W00A 4JQFA 2IS2A 4P96A 2HTSA 2L01A 2M5WA 9ANTA 2VKEA 3K2ZA 1ZGJA 4OIPF 5LRSA 2O5RA 1FBQA 4RA2A 4XORA 2K9MA 3TKYA 3FDYA 4E70A 3VYSB 3S2WA 1VQ6I 2X85A 1CF7B 3WE3A 2MW8A 5B1BH 2RV8A 2H09A 5FLVA 3QPTA 2O03A 1XSDA 2BBYA 2CW8A 2B0LA 2DODA 1B59A 1X2MA 1FP2A 1MSFC 3LMMA 3TGNA 5K7HA 3PQJA 3K9TA 3PSFA 4E7JA 4P55A 3OS2A 4XRMA 1B9NA 3QPLA 1Y0NA 3M8JA 4IRGA 1YJ9I 5HLIA 1KU2A 2DLLA 2A69F 5F0FA 5M3FJ 5L3FA 1S7OA 3V8LA 4NHJA 1ITYA 2J5OA 2JUGA 3FHZA 3QPSA 4P9FA 2AQEA 2R5ZA 2H1KA 3F6VA 3MVPA 1KQ0A 2GWRA 4AC0A 2E35A 3GVAA 3OR1C 1MGTA 4XNFA 3LSTA 3DXJF 2RNJA 2LTPA 2P5KA 3OYFA 1MNDA 3C2GA 2R5ZB 3DKYA 5EZGA 3OL4A 1QZEA 1DU6A 5DCMA 2WC2A 1IUYA 4E7ZA 3GUDA 4UVAA 5GAGJ 2EFPA 2WAQN 4CCJA 4EM1A 3HGGA 3CDIA 4OIOF 3OYJA 4B47A 2DOAA 2UZKA 2CUJA 2Y0SA 3M9AA 5CPRB 2LDUA 3ISPA 3L2VA 2DT5A 5D6EA 1OKRA 1B8IA 2HDCA 4KT5C 3K69A 3KLNA 3JR9A 1U8RA 4H4KC 4IQ4A 1FC3A 3LA7A 4KICA 2ESNA 2BVMA 2R7RA 3GTPJ 4MTEA 1B8IB 2OAZA 1TW2A 1STZA 3G73A 1A31A 2K3PA 3I4PA 1TP4A 1X1AA 2M30A 3LSKA 5D4RA 2HZTA 3ZMTA 5EG0B 3ZR8X 2EA4A 2Y0MA 1ZLKA 3E6CC 2A61A 4EGZA 3G4SI 3HGYA 1E3HA 2ID3A 5HLHA 3PIPF 1RIOH 3DBLB 2JUCA 4AIKA 2HZDA 3DPLC 4DBQA 5JFRA 2HDWA 3BR0A 4PK4A 3I4NJ 1YW7A 3MWMA 2IBDA 3MZ8A 5E3NA 2DJNA 3DU6A 2LVSA 4BHPA 3U9GA 3EUHA 4RB3C 2E2HJ 2QBYB 1FBSA 4EM2A 4HNVA 2A6EF 2E19A 4LOCA 2OD5A 3PSIA 2CW0F 3M3YJ 4HDVA 2NS7A 4BDYA 5CVJA 2YUSA 2DJIA 3OS1A 1YI2I 2JJ7A 2HOSA 4CYDA 5FRNA 3E6BA 2DA5A 2Y9ZA 4IOAF 2AHQA 1X3UA 1HKSA 1WJDA 4IL6C 2Y0SN 3O8HA 4XSXF 5J47A 1BC8C 4QPOA 3OS0A 2PLYA 3IRQA 2O8XA 4MFEA 3M4OJ 2GM4A 3ABUA 1Y8QB 3C18A 2XASA 3HG9A 4M3GA 5F6FA 5IY5H 3DKWA 1LEBA 2F2EA 2JTVA 1KONA 2DFHA 1A35A 3DFGA 1D8JA 1YE9A 1R5HA 1FPQA 3HZJA 2IXSA 3OIPA 5K5QA 3AG3H 3A01B 2L4MA 4PGGA 3BR6A 5DD8A 3BC8A 1WJEA 3TQNA 2DOFA 3MEXA 1IN8A 1XX5A 1KYWA 1EKEA 2ZXJA 4DGWB 2CUZA 2WA0A 3QYEA 4BNCA 4Q48A 1DPUA 3WGIA 2X1DA 3AKZA 4UV8A 4E6KG 4GDFA 1YTYA 4DW6A 2HOEA 4HSRA 2VJJA 2ZNZA 4JX6A 4YELA 3A4CA 4C2UA 5D6FA 3JRIA 2EV6A 2GOXB 3GTJJ 1MBGA 2O0YA 1I50J 1TT0A 2Y75A 1A5JA 4RB2C 4DBRA 2LD5A 2K9QA 4ON0A 2O6GE 1RRJA 1YHQI 3KLOA 3DPTA 4CUGA 2VC1A 3AG2H 3SEQA 2DW4A 5DUKA 1USTA 3F9KA 4A3CJ 3J81K 1LDJA 2G9WA 3KPHA 5LRRA 3OL3A 4ZYDA 1LFUP 1RR7A 3FBNB 2KFDA 4Y3OA 4XRFA 4XLEA 4I76A 3KYDB 1MZBA 4EQQA 1X3WB 3E5QA 5E17F 1TZLA 2HPIA 4UHTA 1BIAA 3VDXA 3JREA 2DA7A 3W2VA 1IJWC 3EUHC 5JI6A 1YJWI 3LA3A 2ZCWA 2ZJQF 4LB5A 1B6AA 2KZVA 3M1EA 4XR6A 1TC3C 2LNBA 2H6CA 3SYTA 2EILH 2XPWA 4BUPA 1G59A 4CCNA 2K85A 4I7HA 3OYGA 4C3JJ 2QQBA 1BI2A 2XGXA 3IH2A 3OYCA 3H9GA 1IDYA 1MNEA 4HA8A 1TWHJ 2EZIA 1IRGA 3PUBA 1VZ0A 4M3FA 2CQ7A 2CUEA 1K4TA 3CJTB 2BY1A 1ERDA 3BTIA 1Y1WJ 2QQAA 5JLWA 5C4XJ 4LFUA 3ZQCA 2HDDA 3K70C 2LKSA 3S15J 5KVRA 1ULYA 3MFKA 2DFFA 4CA0A 2BY0A 3H5RA 4RGSA 4U7BA 2ECBA 4JYKA 1LE8A 1A36A 2V26A 3OSGA 2R7OA 2OCCH 4PSXA 3KEOA 1LJ9A 3F8NA 5EDNA 4E7HA 5E8IA 4KYWA 2VIXA 2X1EA 4E7LA 3LNQA 3ZCOA 2ISYA 1LE8B 4A6DA 2L02A 1SANA 2FMYA 1R00A 1H89C 2VI6A 2LG4A 3S1NJ 1AHDP 4R79A 4RLFA 4KMFA 2LSOA 2LFBA 4RAFA 3WHBA 5IYCJ 1EH8A 4NQWA 1W7PA 1FTZA 2DAOA 5IT9Z 3FZVA 5E8GA 1A6IA 2HPMA 3DLAA 2LK2A 3HKZA 2KIQA 1A04A 5JR3A 2VKDA 1PYVA 1JJ6C 4PJMA 1YRNB 1VI0A 5DS9A 1X3ZB 3GLXA 1Y6IA 5BQTA 1P92A 3MZHA 3FXJA 1I27A 4BHCA 2H8RA 3RTRA 1R23A 1WH7A 3VYTB 2R7UA 5KNLA 1B72A 4PJ0C 3C2BA 2R7ZJ 1VQ5I 1FX7A 4RMNA 3SXYA 2IA0A 2D5VA 2HVQA 5ILUA 1BR2A 1R22A 2D1HA 4U88A 2XAFA 3EQLF 1UHSA 4A0YA 1XSXA 2DPDA 3F72A 1ZRFA 4XBFA 4RM2A 3H9QA 1ZR2A 3K4CA 3VEPA 2R7QA 2W48A 2QLZA 2MGQA 2XF7A 3VOEA 1OCCH 4UB8C 1MMDA 2GA2A 3BG3A 5HDGA 4MTDA 1Y0UA 2CV2A 5A2QK 3KP3A 2BGCA 1BW5A 4TV7A 2OTJI 2MC3A 3DEUA 2GZWA 1KU7A 2LREA 2Y9YA 1X1PA 1Z6RA 1D5VA 1JT6A 3K70D 5GAHJ 3WODF 4R8HA 2XGEA 1SFOJ 4S04A 4ZDLA 1MBFA 2HQNA 2W57A 1DP3A 4ZZDA 4D5FA 2A5WA 4KUMA 3BJ6A 3BQZA 5FFXA 1LDDA 2R4GA 4NUBA 2KHMA 2QM3A 3F21A 3ERED 4KIFA 1WQ2A 2KJCA 3HHGA 3MMYB 4BH9A 2PMZA 4ENNA 1BOAA 2XB0X 4Z6YA 4U7DA 2YPRA 5C44J 3HKZN 1ETXA 1TWCJ 5KK1A 2IA1A 5D4SA 4N4NB 3V7CA 2X4HA 2W7NA 2X6YA 1X19A 5F1RA 2E2JJ 1ZLJA 3H9JA 1WJ5A 2BZTA 2FU4A 2PJPA 2V1DA 1UB9A 1Y8RB 1QNTA 2IRFG 4MNUA 4IX7A 2L54A 5DM7F 3ZQIA 4C3HJ 4L9NA 3UNGC 3OYBA 1ON2A 4XLHA 1U78A 2FBKA 2Y69H 3ZGKA 1HQCA 2JPBA 4BKXA 1XGOA 2FSWA 3QYFA 1MBHA 1W36C 3HC7A 2RVCA 1UHWA 4CO8A 4M3BA 3HUGA 5E18F 4DJAA 3FXLA 1FP1D 2EIMH 4E7KA 1XD7A 4B48A 2QZ8A 2VB6A 2XKPA 4HG2A 5LD2C 3K4KA 5FKKA 2K9LA 1Q1VA 2HOAA 4ZTJA 3FX3A 2XAQA 3J7ZI 5EEAA 3HTSB 3GTGJ 1IN5A 2E36A 3BCBA 1Z3XA 3X2QH 1JGGA 2DFIA 2Z99A 1OLTA 3A02A 3BG6A 4EJVA 4P9UA 5J8FA 3ABLH 4AVZA 2D2WA 1XB4A 2OBPA 5J1UA 3HOVJ 4EM0B 1F5TA 2O3FA 2DYRH 3BZ6A 4IVNA 3S2DJ 4A3GJ 2ZMEB 3JSOA 4BYYA 1Z21A 4LG3A 2O61A 2PMZN 1OFCX 2EV0A 3DTKA 5FLXZ 2EZLA 1JUPA 3BQYA 1WVRA 4A5NA 1R71A 1R36A 1RPWA 3NEUA 3TMOA 1S7EA 4EMSA 1WGXA 2WADA 2I5UA 3WU2C 2M3AA 3I53A 4MFDA 5J4VA 2R5YA 3HM5A 4M9SA 4UVCA 5DEQA 2FUG2 1SAUA 4KNYA 3KP5A 1NH3A 4WXHA 1T8IA 3ZMZA 2BY2A 2H27A 2ZO4A 3E7LA 2R5YB 2NVQJ 1NG7A 3ELKA 3PFIA 4QPQA 4LIUA 3TO9A 2CQXA 2AQFA 5JVGF 1IRXA 3N97A 5F0CA 2UUZA 3GZNB 4HAMA 3BROA 2JT1A 1MJ9A 2L9NA 4QIWN 5GPAA 4JOMA 2IEKA 3BOQA 2BHZA 2AO9A 2P7CB 1WCMJ 2GIZA 3GZ5A 3J7YJ 3BJOA 4CZZA 3OYHA 2PMHA 3EUKL 2KLOA 3BLYA 3G1OA 2QEXI 1FWZA 4F91B 2HVSA 2Z9OA 3CD6I 1YOVB 4KA4A 1DU0A 1LDKB 1XDSA 5J3LA 2VBXA 3HHHA 4FX0A 1W7PD 1FIPA 2BW3A 2WB1N 4L5EA 2A6HF 1XMKA 2GOMA 2XSJC 4HPQA 4UY8I 4CSWA 1VQPI 2ZXWH 1H9GA 3ESWB 4KMUX 3R0AA 5AONA 2ACJA 5HVQC 3ZQ7A 2BW3B 4KN7X 3OYAA 4XIDA 5L3EA 2CQKA 1IRFA 1UG2A 4ZYAA 3J7AY 3I55I 3MAJA 1ZREA 3ABMH 2GLOA 3TO6A 1T33A 3QU6A 3H35A 5H2FC 3L2RA 5BMZA 3CESA 1IV6A 2QUFA 2MD0A 1VQ7I 3GZ6A 3S1QJ 4ESFA 2BEOA 4HSTA 3BG5A 2M2EA 2EPFA 1HA8A 2P8TA 4XLCA 1YIJI 3WTSC 5DTDA 3LSPA 2XRNA 1MD0A 1JHHA 4G9YA 1GUUA 1FT9A 2P7VB 4XICA 1TQIA 3CF5F 1X2NA 2X6WA 3Q5FA 2JPCA 2ZMEC 3EYIA 3RPUD 2LY1A 3GBGA 1YO5C 3Q0VA 1GXQA 2VQHA 2XPVA 5BNGA 4DYCA 5LEJA 4A3MJ 2PN6A 3RPQA 3GO5A 2M8GX 4LK1F 5FJ8J 2KDOA 5H6QA 4CHUA 1G2HA 4ITVA 2JA5J 3HOYJ 2NNYA 4CCMA 1N77A 3V4GA 4IHVA 1XCBA 2JVHA 1VQ4I 3OSFA 3JTGA 3G71I 4ZYHA 3HB9A 2NOJB 4DNCA 4JBAA 3HDDA 1JXSA 1CF7A 1RZ4A 2VPLA 3WG9A 3LOCA 2QSHX 5FD5A 2DA4A 1FSHA 4L5JA 3PUFA 3Q3SA 5FLMJ 1UAAA 4CCKA 1N75A 2DK8A 4M74A 2DT6A 2XAUA 3F23A 1YX5A 4AVPA 2E7WA 2P4WA 3CCVI 2EJRA 1O3TA 4A0XA 5HLGA 3IH3A 3VYRB 4GO1A 2KL4A 3B6CA 2FE3A 2R7SA 1TTYA 1H8AC 4IPAA 4XQFA 3GF2A 3LSGA 1EA3A 3ZOBA 2XUBA 2ELKA 4KFCA 3NWSA 1XGNA 1BIBA 2M0MA 4HF2A 4HOBA 4LK0F 3S93A 1Z7LA 4HRIA 1AU7A 1SEUA 1ZRCA 3IRRA 2KIMA 5FKOA 2EBIA 2KMUA 1SD6A 4D9JA 2P5LC 4A5MA 1GHCA 4GRIA 2NVXJ 1APLC 1T95A 4NDLA 4OINF 2DDAA 5A2QZ 3TOBA 4Y52J 4L0ZB 3DKXA 5E3OA 2F4MB 1J7KA 3H0DA 3GTQJ 2IS6A 4BXXJ 1RESA 5IT9K 5ICEA 1OYIA 4EV0A 2F48A 4AIHA 2ZBKA 5KAFC 4HEA2 1OMIA 4CCLA 3CZ6A 5HODA 2HXOA 1PDNC 2WWYA 1ACIA 2X48A 2EINH 1X58A 3PQKA 2HOTA 3HRUA 1B9MA 5CYVA 1K6YA 3V8KA 4XMYA 3L2WA 1HW1A 2ZC2A 1WJFA 3WTZA 4KITB 2UXNA 2W25A 4FT8A 3WG7H 3D5LA 2W1OA 2R0QC 3AG1H 2AXLA 2V1XA 5ILVA 1GV2A 3CCMI 5ERIA 2M45A 3TL4X 2K86A 4KIBA 1VTNC 1D8KA 2ELHA 2CGPA 3QAHA 5IOZA 4G6TB 2VQGA 3DQVC 3D5SC 5L3GA 1O3SA 1VQNI 2Y48A 3FISA 4CICA 1R1TA 1HW5A 2DTZA 4KDPA 5C3EJ 3BR1A 2EIKH 4RGRA 1E3OC 5E1WA 5J1YA 1BR4A 1MH4A 1ONVA 4DZJA 3N05A 3QQAA 1U3EM 2Z2SB 5EG0A 1KA8A 2IPQX 5EJCA 3MKWB 3VFZA 1G8XA 5ILSA 3SZGA 4BXFA 3RQ4A 5EEGA 4IF4A 2GAUA 2CRGA 2LKXA 3ZN1A 4B3AA 3OYEA 5EF6A 1V5EA 1YX3A 2XAJA 1EJ9A 2EWNA 1XMXA 2QKLB 1UCRA 3H1CA 1AKHB 5B66C 1H0MA 3DEWA 1IW7F 3U2RA 4M3DA 1TQMA 3A2KA 2N8GA 5DUIA 1E3PA 1YS6A 2X51A 4WXDA 1BOBA 2K9NA 3OOUA 2QBYA 2ME6A 3R61A 4IEJA 1HBXG 3CUQB 1PUFA 1I1GA 3DV8A 4AM3A 2H1LA 1OQYA 3MZYA 4LMYA 1UJ8A 3GEZA 4X1EA 3T8RA 3S3OA 1WPKA 2CQQA 1R58A 3Q0WA 1PUFB 1IC8A 4CGZA 2KDZA 4NNJA 2KZGA 2LH9A 4G6DA 1P4WA 2COBA 4OMYA 3WTWC 3PFYA 4FE7A 1ZRDA 3SDBA 3K6GA 2CS3A 4DOZA 5FRMA 5CQEA 4JK1X 3DBRB 3HSRA 2PMUA 1QA6A 2XIGA 2E1CA 4OIQF 3RCOA 3WTTC 4Y33A 5FGMA 2EIJH 4OMZA 4C2TA 1EH7A 1FNNA 2TRTA 3EETA 2DBBA 3PNVA 4GCVA 2R7VA 2HR3A 3JRAA 2OC6A 1JTYA 1T98A 3IKVA 1SVLA 4JX5A 4NC6A 3CTAA 2GBYA 2DMNA 4PJJA 1WH5A 1N25A 3LFUA 3A01A 2P6SA 2BXZA 3SDGA 1VF9A 2DI3A 3OYLA 3GWZA 4O3MA 1T38A 1GDTA 2ID6A 5M5XJ 1JKPC 1SD7A 5BPDA 3BG7A 3PJRA 3G1MA 1RUNA 4M73A 1TL8A 2MBFA 1ETKA 1QO0D 1FZPB 2E2IJ 3IAS2 1YYVA 1UZCA 2WV1A 3QODA 2E34A 1ON1A 2VASA 2ZXIA 3O6BB 3OWTA 2ELJA 4R1HA 2Q8KA 4Q4ZF 2IAIA 4YIFA 1UG0A 4OAYA 2DTRA 4Q47A 4YEJA 5GAEJ 2JRMA 4GYIA 4B4CA 3SEZA 2TDXA 1R6RA 4L9TA 5FLXK 2RGVA 1MDMA 2PFBA 3L2CA 3R60A 3T8TA 1IUFA 5M5WJ 1I3QJ 1O4XA 1Z91A 2L9RA 1U8BA 2CH0A 5LEKA 4QWQA 2Y31A 2FQ4A 4HX4A 2CV1A 1QHHD 1MDMB 3QU3A 1I6HJ 2YU9J 4RM3A 2ECCA 3H36A 3H3ZA 2MLGA 5E3LA 1QHGA 1HOMA 4BQNA 1K7AA 3UKGA 3WTVC 4A3JJ 3JRHA 2KKOA 2I10A 2DYSH 3I54A 3OYIA 1FEXA 4BY1J 2AXTC 1TLHB 1Y56A 3FXQA 3O8GA 4BQOA 1WZ2A 2VXZA 3ZQLA 3ONQA 4LB6B 5L3CA 3I71A 2W24A 1O3RA 2V9KA 3T1BA 1VQLI 2KQRA 1IXCA 1V54H 3ECHA 4FCYA 3GTMJ 4HBLA 1DDNA 5E20A 2L0KA 2NYXA 2IP2A 3CLOA 3Q9VA 2ZJRF 4H0EA 1OJLA 2Z16A 3KP6A 4U0WA 1K79A 2YSRA 2NVYJ 3VB2A 2VJIA 2XAGA 2BVLA 5J8CA 2XROA 1SFKA 1MSEC 2K5CA 4BBSJ 4A3LJ 3S3MA 2Z1DA 4IXAA 5LHGA 1RKTA 2VBYA 4BACA 1F43A 1VFCA 4OIRF 5LGTA 2L7FP 2RQPA 3TP0A 4FTHA 1JKQC 1FMVA 4BEHA 3R4KA 3FMSA 5M5YJ 1ZG5A 3ZXSA 4IKFA 1YS7A 3FXOA 3RKYA 1DP7P 3A0HC 2EZKA 3NRVA 3HOUJ 1RETA 1SVOA 2H8WA 4AWXB 2L7KA 2OF7A 2X0LA 1XCVA 4LLLA 4BEHB 3AFHA 4HW0A 1SAXA 2DA3A 3JRDA 1BA5A 3F0CA 5D5WB 4ESBA 4HQEA 3QPHA 2HXIA 1X1DA 1LNWA 4XLPF 2DA2A 2EK5A 4OWRB 5DDGA 5IYDJ 1K4SA 1WI3A 5JLXA 1XGSA 2IS4A 1U5TA 3E97A 2WAEA 4EEFG 3QOEA 2X9DA 2QKMB 1P4XA 3TP3A 5F27A 3QP6A 4ZJZA 1BN5A 1S8NA 3DTIA 3FXUA 4PFPA 1H9TA 1PP8F 1VQ9I 1LEAA 4G8XA 1U5TB 4HNUA 1KU3A 4XKBA 2LLKA 2HQ5A 1USSA 4MEYF 1D1BA 2MH9A 1FMWA 5HS8A 3OYKA 2I8DA 4L0YB 3CP2A 4XM3A 3K7AJ 4B09A 4IZZA 2LMDA 3IHUA 1D5YA 5M3MJ 1YRNA 2NVUB 1KYZA 3WGHA 2CYYA 2DN0A 2ZNYA 1LFPA 3GTKJ 2VE8A 2F5DA 2QGUA 1SVMA 3BDDA 4L18B 1XGMA 3QP5A 1X1BA 2E71A 1MMSA 3RKQA 4IHSA 5KCMA 3B73A 5CKTA 5BOXA 4ZDPA 2NAZA 1E17A 1SFEA 5BS6A 3CCJI 2JA8J 1XPXA 2CSOA 4DYRA 4A3BJ 1DPRA 4IOCF 1S6LA 2BE5F 3BT9A 3L00A 5TGTA 1IN6A 3ZQFA 2HNHA 1G3TA 1FBUA 2LY9A 1VQMI 2H6BA 1TNTA 5KAIC 3KP2A 4RDUA 3GMEA 3V42A 3KZZA 1O7LA 2QF7A 5LHIA 1Z3YA 4M72A 3OR2C 2BY3A 1K78B 1B4AA 2VPRA 3OYNA 1MNMC 4ABZA 5DV5A 1VQ8I 2GXBA 1Z7UA 2JA2A 1YITI 4XSZF 1RC9A 1J09A 1QVUA 3DP7A 2NS8A 3F8MA 3FMRA 1S72I 2CW7A 3COAC 1GT0C 1BJAA 2ZB9A 5FROA 5BPIA 3KIOA 3BCAA 2XKOA 2DOEA 3CCEI 1NK3P 2FMLA 4Y17A 2XV4S 3L1PA 4S0HB 2M8EA 5L3BA 1ETQA 1D3YA 1TQPA 2QQ9A 2M34A 5FKLA 2KRHA 2FA5A 1ZG3A 4C30A 1JT0A 1IN7A 1IAWA 2DK5A 1ETOA 4B8XA 1I39A 1W5TA 2W85A 3H3VK 1U5TC 2VXDA 4HQMA 2FX0A 4XN0A 1JE8A 3I58A 2XSDC 5ICGA 3JRBA 1OCRH 1S7AA 1ZR4A 4V2FA 3FHNA 3RSNA 1IN4A 3HPGA 4HF1A 3T5XA 1P4AA 4FASD 2Y2ZA 3GFLA 1X1CA 3I9V2 3ZMDA 4A2UA 4BQQA 4CYCA 3ZPLA 2DCEA 5J4YA 3K4JA 1YW9A 2OTLI 1D0XA 2YR2A 5FKMA 3I56I 5TISC 5H6RA 4CYCB 2EV5A 5IT3A 3G6EI 2E1OA 3L7WA 2QSFX 4L9JA 4FX4A 5HDKA 2LR8A 2L9SA 5AIPA 2Y30A 2ZFUA 1WJCA 3RKXA 2PX9A 3HPHA 4CCOA 1LUJB 1YW8A 5D5VB 1MMAA 2VKVA 2CQNA 3GTLJ 3RZDJ 3I59A 2V1NA 4XKVA 3HOSA 4FE4A 1ZGAA 4LITA 1R5ID 4DZPA 3IWFA 2GQQA 3W2WA 5D5UB 4BDZA 1JJ8C 1ZH5A 3GLLA 4AYBA 2VOPA 3H5NA 1V3FA 3LSHA 3BR3A 1TW3A 2CMPA 3ROUA 1N78A 2R92J 3I59B 3Q9SA 4XN3A 4EJWA 2E5ZA 4S05A 2ZMEA 3U1KA 5GPCA 1Z1DA 2M9HA 2JK3A 2V4JC 3WTYC 4G7ZF 4Z2YA 5F04A 3PO3J 2LKPA 5EYRA 3M8EA 1RUOA 3CO6C 3JRGA 4HV6A 3VYUB 1HSJA 1O57A 4B3XA 3K10A 5GADJ 2O9LA 3E3VA 4G94A 3CC4I 5IYBJ 3IP4B 2R93J 4I2OA 2FNAA 2EFWA 3S2HJ 1WWXA 2YX4A 2HYGD 4XLFA 4YIRX 1ETWA 3TW6A 3HOWJ 4YG2F 2IGOA 2A68F 2E60A 4MO7A 4X0GA 2E1MB 1QGPA 3FK7A 3PIOF 4GFBA 1BL0A 4MQVA 5TRDA 1IZ1A 2GA1A 2E1NA 1I5ZA 2EQRA 2F4IA 2EFOA 2QWWA 3K0LA 5F64A 2XHKA 4HDUA 1WHUA 1I3AA 1S3JA 3TBIA 2X6XA 1H88C 2NVTJ 2FXAA 4U0VA 2IGNA 3B02A 1HF0A 1DQUA 5CVRA 2HYFA 3L2QA 5LHHA 3BZKA 4HX7A 4I99C 1GV5A 3HXLA 3GFIA 2HKXA 1V55H 3PM1A 3FKJA 2VJ4A 3MCZA 1W36D 3RZOJ 1WSUA 3WU1B 3D5RC 1OCPA 1V4RA 4UV9A 4I6ZA 3S8PA 3CJQB 2VONA 2EFQA 3U1DA 3ASNH 3GFJA 4XK4A 4YIIA 1JGSA 3RDIA 5LGUA 2UXXA 3HEFA 1JUMA 1I1SA 2LOOA 1R49A 3I5UA 3ZMUA 3TEDA 6PAXA 2NRAC 1VNDA 4W97A 3LSRA 2KPMA 2G7UA 2ZXHA 3U21A 4BU2A 4IRIA 4BAYA 4IHWA 2LF7A 2DT7B 4IQJA 1C0WA 5K1YA 3KEYA 2EZHA 3CJRB 1HCRA 2ZSIB 3GTOJ 3ERMA 3W2AA 1WJAA 2WBMA 1Z6TA 5DM6F 4BJTA 2LY2A 2MC4A 1IXSB 3ZRGA 4F52A 4OU0A 4RB0A 2XPUA 4D1QA 4X6AJ 5K5OA 4QTRA 1XS9A 5E1XA 4HYEA 2R7DA 1OYWA 1TWAJ 3CCRI 5J6XA 2HVRA 1LVAA 2Z3YA 2EA2A 1S29A 4U0YA 1LQ1A 4ESJA 5KHDA 3IAM2 3L09A 4ETSA 4QSHA 2BV6A 1X4PA 3MKZA 2STWA 1X4OA 4BS9A 4MLOA 1HDDC 3KP4A 3CO7C 2K02A 2OUMA 2KIUA 3LSMA 2OPTA 2P6TA 2FD5A 2E1MC 2DMTA 4BBRJ 1UHMA 3GXOA 1VQKI 2B63J 1XN7A 3LSJA 1EH6A 2FBHA 3HBLA 4C9YA 2IGKA 4HV5A 4UXNA 1J0RA 5LBQA 2JZYA 1LVKA 1KZHA 4ENKA 3L9FA 3F22A 1LKXA 3KEQA 1W5CC 3VSKA 1U0JA 1ZHFA 1WRJA 4ZYEA 1WKMA 2L7MP 1BI3A 4CH7A 3DBHB 2PI0A 4XL9A 3MQ0A 1Z9CA 2NS0A 3CCUI 2WAQA 1YFHA 3ULQB 4A3FJ 2K27A 3E6MA 2Q2EA 1R9TJ 1SMYF 3LFKA 3CUOA 3CQZJ 2RC4A 3DLLF 3FK6A 2RQQA 4NBQA 4XOTA 1NHAA 3NARA 5EGOA 2MSYA 1QZZA 2Q2EB 3CC7I 2DMQA 5FB2A 2V7FA 3CF2A 2WTEA 2XF5A 3HJEA 5EGOB 4WF2A 2W4SA 1HDPA 2HS5A 4A3EJ 1SMTA 1W0TA 2DMUA 3LL7A 1MBEA 1V5GA 2RKHA 5HDNA 4MEXF 1LB2A 2AS5F 3IL2A 5GP9A 2KISA 5F0HA 2DA6A 2KT0A 4MQ9F 3BP8A 1TWFJ 3ABTA 3M7GA 4BE2A 2XC7A 3KYCB 1QPIA 4LLNA 3W6KB 1MH3A 5HS7A 5HS9A 2K3FA 4Y13A 3BTCA 3HOZJ 3PO2J 3OIOA 4PJNA 5HOOA 1K61A 1G3YA 1JUSA 2FBIA 1IF1A 3FKIJ 2VUMJ 2DA1A 1IV8A 3FMQA 3QYBA 2ICWG 5AIQA 3GX4X 3RKWA 4C2MJ 3IWZA 2VL8A 1U2WA 1SC7A 3D1NI 1ZQ3P 1BR1A 3EYYA 1W5SA 2HKOA 2EH3A 2L5QA 2LBFA 3CMMA 3JTHA 3BR5A 3WU0A 1HC8A 2LP0A 3M1CA 2UWMA 2J5PA 3ML6A 4KISA 1REPC 1R1VA 4I09A 2M4KA 3W3CA 3S32A 2VOOA 3LAPA 2LBFB 2IT0A 4FISA 4B44A 3IV5A 2QYOA 2WV0A 1AKHA 5DCMB 2BHYA 2YS9A 3SQNA 4O5VA 4M6XA 3VWBA 5F1JA 1BW6A 3DWLE 1ZN2A 3FIWA 4E7IA 3K4LA 3BR2A 2PJRA 4D7NA 4BJ5C 2VBWA 4YFXF 1W0UA 4I98B 2MFZA 2OQRA 4EJOA 4KN4X 3SZPA 1FYMA 1FIAA 3CUQA 4XKCA 3JAMZ 2V1UA 2K4BA 2PJRB 4C3IJ 2CO5A 2LRDA 1P7JA 2R7XA 3LA2A 4PJLA 3LAJA 3K2AA 3P9KA 1D0ZA 3IKTA 1FOYA 2VBZA 1SFXA 3MN2A 2ZSHB 3R0JA 3CDHA 3OY9A 5FO5A 5F08A 3VPRA 3WGGA 3JSPA 3RJPA 3SZTA 2OZ6A 3I4MJ 3QOPA 4P5OA 1BI0A 2L3DA 4M3EA 1WFXA 3F8FA 2DQRA 4G7OF 2KRFA 1W1WE 1XSVA 2HTJA 2F6CA 3CDLA 5E1ZB 5B5EC 2COMA 5JVTA 3AAFA 2OA4A 5D8LB 1YQAA 2HU9A 3F6OA 2V9PA 2LYCA 4V19K 3EUAA 4G7HF 4ZDOA 2IGMA 2OZUA 4F93B 2M7BA 5L3DA 1G3WA 3G3ZA 2L2OA 1GXPA 3CP8A 1KGSA 1VQOI 1OCTC 4EATA 4K2EA 3HOXJ 4B1RA 4YFKF 4BE1A 2IS1A 1SD4A 2V6CA 3REOA 1TWGJ 3SFZA 3FXRA 1PUEE 4RS8A 4WXCA 4M9ZA 4D0PA 3HRSA 2VJ5A 4A0ZA 3LWFA 2ESHA 4LIVA 1U6GA 1Z77A
chains in the Genus database with same CATH topology
1AOYA 1ZYRF 3LQQA 3H92A 4IRHA 1F9NA 1FYLA 2GXGA 3FM5A 4BQAA 2MH2A 3K1NA 1DUXC 4NB5A 3K1MA 2IA2A 1G4DA 2D45A 2H94A 1OYYA 3F8BA 1YLFA 3FM3A 1KQ9A 2DO7A 4LD5A 2L4AA 3P9IA 2IW5A 5K5RA 1F4KA 1T2KA 3CUQC 3CJNA 1MKMA 4ENMA 2G7HA 4RAYA 3F3XA 3LQRA 4ZYGA 2MD5A 3GFMA 3KE2A 4Y15A 4XLNF 3K1PA 5ICFA 2HFHA 1T39A 3DF8A 4IHTA 5H20A 4WCGA 1UFMA 4UUVA 3I64A 1HW2A 4I0BA 4F7ZA 3GW2A 1FY7A 1OR7A 1AWCA 5DD4A 4CXFA 3GYHX 3N4MA 2XAHA 3H3UA 4PZJA 3J80Z 2FRHA 4A6EA 2F5EA 2BYVE 2RN7A 4G6QA 2IJLA 3BPXA 1XDUA 1B1BA 4AIJA 3KCCA 4ZZLA 3IC7A 2A3SA 1ZARA 4UVBA 4KIGA 4DQ2A 3O2PE 1FOKA 2E7XA 3HYIA 3BY6A 1YIOA 3TDZC 3E5XA 3E5UA 1IXRC 1K6OA 2XVCA 1R5GA 3J7AO 1T0FA 2CWEA 1J5YA 2R3SA 2QENA 2HGCA 1RNLA 3P7NA 2V79A 2HEOA 1HXDA 3I0TA 5TJJA 3RYRA 2Z33A 2ZFWA 1BI1A 4M71A 1E2XA 1K78A 1W7PB 3FWEA 1SD5A 2FEZA 2OQGA 2PEXA 2K4JA 1CGPA 2MLKA 4LJZF 1FYKA 4UNOA 2PBIA 3TO7A 3ZP5A 4N0BA 2FQ3A 3C7JA 4IJAA 2STTA 3W6JB 3HOTA 2VT2A 1BC7C 3V7RA 1W4MA 4N9HA 5D5XB 2FF4A 3F8CA 4ZH4F 2F5FA 2MA3A 3E6DA 3RPUA 3T0YA 3FF5A 4WWCA 2VE9A 1KU9A 1F1ZA 1L0OC 3HIFA 4HZFA 2ZJ2A 3R6SA 1OPCA 1J75A 3TOAA 5CJ9A 3C3WA 1HKQA 4HF0A 2W84A 3V8JA 2P5VA 1J9IA 3KETA 3BJAA 5CVIA 2A07F 4I0AA 3KFWX 5CLSA 1O3QA 2Q0OA 4LG0A 3ZN0A 3WE2A 1FLIA 2VODA 3WTUC 2GIVA 4LG0B 3TDUC 1QPMA 3O3KA 4GYGA 1P6RA 2YX7A 3WTXC 4BXUA 4GXOA 3KP7A 2VN2A 2EFNA 3JAMK 3KZYA 1HSTA 4AD9A 1BBYA 5D8KB 3C1DA 4BHBA 1WI9A 3V7SA 4ASNA 2F5CA 2DPUA 4RAZA 1R1UA 2C6YA 3D0SA 4CDGA 3HRTA 1O7FA 2CFXA 2DQLA 2V9VA 2R7FA 4LLGF 4EJTA 5DCFA 1QBJA 1SFUA 1MJBA 4PDKA 4EVIA 4QLCU 4YFNF 2VT3A 4HLXA 4L9VA 2OU2A 2Z5UA 2KJBA 5JHUA 1TBXA 2M1BA 3NQOA 4N9IA 4HLYA 3SHFA 1BM9A 1KQ8A 4RGUA 1TNSA 4L5IA 2FNPA 3ECOA 4EGYA 4LGWA 2ADUA 3QRFF 1RI7A 4M9XA 3ZMVA 1ODDA 3RYPA 3ZMSA 3J81Z 2ETHA 1R7JA 1J2XA 2D1VA 1Q1HA 4HX8A 4RGXA 2JRTA 1FSEA 4RB1A 3VODA 4FHTA 3RIRA 1GVJA 5CVUA 3OOPA 4GGGA 2ISZA 3HSFA 2KIFA 2PQ8A 2NNNA 5EEHA 2FOKA 4OOIA 1ZG1A 5LGNA 2ZKZA 1G6NA 2DU9A 2EB7A 2M87A 2HWVA 2K7LA 3HRMA 1JHFA 3EDPA 4EJUA 4WX9A 1HKTA 1J59A 1Z05A 1XMAA 1QQIA 3P9CA 2A5YB 4Q5SF 3BPVA 4M6YA 1QZYA 3M8FA 3JW4A 3OV8A 4MHGA 4I01A 5FD6A 1P2FA 2LF8A 4ENJA 2YU3A 1T6SA 3BWGA 4MGRA 4PCQA 4I02A 2VC0A 5ED4A 5DYMA 1EV7A 4O6JA 5FFZA 2JSCA 3HSEA 2RDPA 3HTUA 2PG4A 4PGHA 1L3LA 1G3SA 4WK8F 1MJAA 5CVVA 1PP7U 5ICCA 2IVMA 3RI4A 2CG4A 3J80K 5LLQA 2QVOA 4A12A 1ZAOA 1I6XA 1YG2A 2HQRA 4JQFA 4P96A 2HTSA 2L01A 2M5WA 3K2ZA 1ZGJA 4OIPF 5LRSA 1FBQA 4E70A 3TKYA 3S2WA 1CF7B 3WE3A 2RV8A 2H09A 3QPTA 2O03A 1XSDA 2BBYA 2B0LA 1B59A 1FP2A 3TGNA 3PQJA 3K9TA 4P55A 1B9NA 4IRGA 5HLIA 1KU2A 2DLLA 2A69F 5L3FA 1S7OA 3V8LA 4NHJA 2J5OA 3FHZA 4P9FA 3F6VA 1KQ0A 2GWRA 3GVAA 1MGTA 3LSTA 3DXJF 2RNJA 2P5KA 5DCMA 2WC2A 1IUYA 3GUDA 4UVAA 2EFPA 4EM1A 4OIOF 2UZKA 3M9AA 2LDUA 3ISPA 2DT5A 5D6EA 1OKRA 2HDCA 4KT5C 3K69A 3KLNA 1U8RA 1FC3A 3LA7A 4KICA 2ESNA 4MTEA 2OAZA 1TW2A 1STZA 3G73A 3I4PA 2M30A 5D4RA 2HZTA 3ZMTA 1ZLKA 2EA4A 2Y0MA 3E6CC 2A61A 4EGZA 5HLHA 1RIOH 4AIKA 3DPLC 5JFRA 1YW7A 3MWMA 4BHPA 3U9GA 3EUHA 4RB3C 2QBYB 1FBSA 4EM2A 2A6EF 2OD5A 2CW0F 4HDVA 5CVJA 4CYDA 3E6BA 1X3UA 1HKSA 4XSXF 1BC8C 2PLYA 3IRQA 2O8XA 3ABUA 3C18A 2XASA 5F6FA 3DKWA 1LEBA 2F2EA 2JTVA 3DFGA 1D8JA 1R5HA 1FPQA 5K5QA 2L4MA 4PGGA 5DD8A 3TQNA 3MEXA 1IN8A 1KYWA 2ZXJA 4BNCA 4Q48A 1DPUA 3WGIA 4UV8A 1YTYA 2HOEA 2ZNZA 5D6FA 2EV6A 2O0YA 2Y75A 4RB2C 4ON0A 2O6GE 3KLOA 3DPTA 2VC1A 2DW4A 5DUKA 1USTA 3J81K 1LDJA 2G9WA 5LRRA 4ZYDA 4XRFA 1MZBA 4EQQA 3E5QA 5E17F 4UHTA 1BIAA 5JI6A 3LA3A 2ZCWA 1B6AA 3M1EA 2LNBA 2H6CA 4I7HA 2QQBA 1BI2A 2XGXA 4HA8A 1IRGA 2QQAA 4LFUA 5KVRA 1ULYA 3MFKA 4RGSA 4U7BA 3KEOA 1LJ9A 3F8NA 5E8IA 4KYWA 2ISYA 4A6DA 2L02A 2FMYA 1R00A 4R79A 4KMFA 2LSOA 1EH8A 4NQWA 1W7PA 2DAOA 5IT9Z 3FZVA 5E8GA 1A04A 5JR3A 3GLXA 5BQTA 1P92A 3MZHA 1I27A 4BHCA 3RTRA 1R23A 1FX7A 3SXYA 2IA0A 5ILUA 1R22A 2D1HA 4U88A 2XAFA 3EQLF 4A0YA 1XSXA 2DPDA 3F72A 1ZRFA 4XBFA 3VEPA 2QLZA 3VOEA 2GA2A 5HDGA 4MTDA 1Y0UA 5A2QK 3KP3A 2BGCA 4TV7A 2MC3A 3DEUA 2GZWA 1KU7A 1Z6RA 1D5VA 3WODF 4R8HA 4S04A 2HQNA 2W57A 4ZZDA 4KUMA 3BJ6A 5FFXA 1LDDA 3ERED 2QM3A 3F21A 4KIFA 1WQ2A 2KJCA 3HHGA 4ENNA 4BH9A 1BOAA 4U7DA 2YPRA 5KK1A 2IA1A 5D4SA 3V7CA 2X4HA 5F1RA 1ZLJA 2FU4A 2PJPA 2V1DA 1UB9A 1QNTA 2IRFG 4MNUA 2L54A 4L9NA 1ON2A 1U78A 2FBKA 1HQCA 2JPBA 1XGOA 2FSWA 2RVCA 1UHWA 4CO8A 3HUGA 5E18F 1FP1D 1XD7A 2QZ8A 2XKPA 3FX3A 2XAQA 3HTSB 1IN5A 2DFIA 2Z99A 4P9UA 4EJVA 5J8FA 2D2WA 1XB4A 2OBPA 4EM0B 1F5TA 2O3FA 3BZ6A 4IVNA 2ZMEB 3JSOA 4BYYA 2O61A 2EV0A 5FLXZ 4LB5A 4A5NA 1R36A 3NEUA 4EMSA 3I53A 4M9SA 4UVCA 5DEQA 4KNYA 3KP5A 4WXHA 3ZMZA 2H27A 2ZO4A 3ELKA 3PFIA 3TO9A 3N97A 4HAMA 3BROA 2JT1A 1MJ9A 3BOQA 2P7CB 3GZ5A 3BJOA 4CZZA 2PMHA 1FWZA 2Z9OA 4KA4A 1LDKB 1XDSA 2VBXA 3HHHA 4FX0A 1W7PD 2A6HF 1XMKA 1H9GA 4KMUX 5AONA 3R0AA 2ACJA 5HVQC 3ZQ7A 4KN7X 5L3EA 2CQKA 1IRFA 3MAJA 1ZREA 3TO6A 5BMZA 3QU6A 2QUFA 3GZ6A 4ESFA 2BEOA 2P8TA 3WTSC 2XRNA 1MD0A 1JHHA 4G9YA 1FT9A 2P7VB 1TQIA 3Q5FA 2JPCA 3EYIA 1YO5C 1GXQA 5LEJA 2PN6A 3RPQA 3GO5A 4LK1F 5H6QA 4CHUA 2NNYA 3V4GA 1XCBA 3JTGA 4ZYHA 4DNCA 4JBAA 1JXSA 1CF7A 1RZ4A 3WG9A 5FD5A 1FSHA 4L5JA 2DK8A 4M74A 3F23A 4AVPA 2E7WA 2P4WA 2EJRA 1O3TA 4A0XA 5HLGA 4GO1A 2FE3A 1TTYA 4IPAA 3GF2A 2XUBA 4KFCA 1XGNA 1BIBA 4HF2A 4HOBA 4LK0F 1ZRCA 3IRRA 2KIMA 1SD6A 2P5LC 4A5MA 1GHCA 4OINF 5A2QZ 3TOBA 4L0ZB 1J7KA 5IT9K 5ICEA 1OYIA 4EV0A 4AIHA 2ZBKA 1OMIA 1PDNC 2WWYA 3PQKA 3HRUA 1B9MA 5CYVA 3V8KA 1HW1A 3WTZA 2UXNA 2W25A 4FT8A 3D5LA 2AXLA 2V1XA 5ILVA 5ERIA 2M45A 2K86A 4KIBA 1VTNC 1D8KA 2ELHA 2CGPA 3QAHA 3DQVC 5L3GA 1O3SA 2Y48A 4CICA 1R1TA 1HW5A 4KDPA 4RGRA 5E1WA 1ONVA 1U3EM 1KA8A 2IPQX 3VFZA 5ILSA 5EEGA 4IF4A 2GAUA 3ZN1A 2XAJA 2EWNA 1UCRA 1H0MA 1IW7F 3U2RA 1TQMA 5DUIA 1YS6A 4WXDA 2QBYA 3R61A 1HBXG 3CUQB 1I1GA 3DV8A 3MZYA 4LMYA 3GEZA 3T8RA 1R58A 4CGZA 4G6DA 1P4WA 4OMYA 3WTWC 1ZRDA 4JK1X 2E1CA 3HSRA 2PMUA 4OIQF 2XIGA 3WTTC 5FGMA 4OMZA 1EH7A 1FNNA 3EETA 2DBBA 4GCVA 2HR3A 1T98A 3IKVA 3CTAA 2P6SA 2DI3A 3GWZA 4O3MA 1T38A 1SD7A 5BPDA 1RUNA 4M73A 2MBFA 1FZPB 1QO0D 1YYVA 1ON1A 3O6BB 4R1HA 2Q8KA 4Q4ZF 4YIFA 2DTRA 4Q47A 4GYIA 2TDXA 4L9TA 5FLXK 2RGVA 1MDMA 2PFBA 3L2CA 3R60A 3T8TA 1Z91A 5LEKA 4QWQA 4HX4A 1MDMB 3QU3A 3H3ZA 2MLGA 1K7AA 3WTVC 2KKOA 3I54A 1TLHB 3FXQA 2VXZA 4LB6B 5L3CA 3I71A 2W24A 1O3RA 3T1BA 1IXCA 3ECHA 4HBLA 1DDNA 5E20A 2NYXA 2IP2A 3CLOA 3Q9VA 4H0EA 3KP6A 4U0WA 1K79A 2YSRA 3VB2A 2XAGA 5J8CA 2XROA 4IXAA 5LHGA 2VBYA 4OIRF 5LGTA 2RQPA 3R4KA 3FMSA 1ZG5A 1YS7A 3RKYA 1DP7P 3NRVA 4AWXB 2X0LA 1XCVA 4LLLA 4HW0A 1SAXA 5D5WB 4ESBA 4HQEA 3QPHA 1LNWA 4XLPF 2EK5A 5DDGA 1XGSA 1U5TA 3E97A 1P4XA 3QP6A 1BN5A 1S8NA 3FXUA 1H9TA 1PP8F 1LEAA 4G8XA 1U5TB 1KU3A 5HS8A 4MEYF 1USSA 2MH9A 4L0YB 4B09A 3IHUA 1KYZA 3WGHA 2CYYA 2ZNYA 2VE8A 2F5DA 3BDDA 4L18B 1XGMA 3QP5A 4IHSA 3B73A 5BOXA 2NAZA 1E17A 1SFEA 5BS6A 2CSOA 1DPRA 1S6LA 2BE5F 3L00A 1IN6A 1G3TA 1FBUA 2H6BA 1TNTA 3KP2A 3KZZA 1O7LA 5LHIA 4M72A 1K78B 1B4AA 5DV5A 2GXBA 1Z7UA 4XSZF 3DP7A 3F8MA 3FMRA 3COAC 1BJAA 5BPIA 2XKOA 2FMLA 4Y17A 2XV4S 2M8EA 5L3BA 1D3YA 1TQPA 2QQ9A 2FA5A 1ZG3A 1IN7A 1IAWA 2DK5A 4B8XA 1W5TA 2W85A 1U5TC 4HQMA 1JE8A 3I58A 5ICGA 1S7AA 1IN4A 4HF1A 3T5XA 1P4AA 3GFLA 3ZMDA 4A2UA 3ZPLA 1YW9A 2YR2A 5H6RA 2EV5A 5IT3A 3L7WA 4L9JA 4FX4A 5HDKA 5AIPA 3RKXA 5D5VB 1YW8A 3I59A 3HOSA 1ZGAA 5D5UB 3IWFA 2GQQA 1ZH5A 2VOPA 1V3FA 1TW3A 3ROUA 3I59B 3Q9SA 4EJWA 4S05A 2ZMEA 1Z1DA 4G7ZF 3WTYC 4Z2YA 2LKPA 3M8EA 1RUOA 3CO6C 4HV6A 1HSJA 1O57A 3E3VA 4G94A 4I2OA 2FNAA 2EFWA 1WWXA 2YX4A 2HYGD 4YG2F 2A68F 1QGPA 4MQVA 5TRDA 1IZ1A 2GA1A 2E1NA 1I5ZA 2EFOA 2QWWA 3K0LA 5F64A 2XHKA 4HDUA 1S3JA 2FXAA 4U0VA 3B02A 5CVRA 2HYFA 5LHHA 4HX7A 3GFIA 2HKXA 3MCZA 1WSUA 3WU1B 1V4RA 4UV9A 2VONA 2EFQA 3U1DA 3GFJA 4YIIA 1JGSA 3RDIA 5LGUA 2UXXA 1I1SA 3I5UA 3ZMUA 6PAXA 2NRAC 2G7UA 4IRIA 4BAYA 2LF7A 1C0WA 5K1YA 1Z6TA 1IXSB 4OU0A 4RB0A 5K5OA 5E1XA 4HYEA 2R7DA 1OYWA 5J6XA 1LVAA 2Z3YA 2EA2A 1S29A 4U0YA 1LQ1A 4ESJA 3L09A 4ETSA 2BV6A 2STWA 3KP4A 3CO7C 2K02A 2KIUA 2P6TA 1UHMA 3GXOA 1XN7A 1EH6A 2FBHA 4HV5A 4UXNA 1J0RA 5LBQA 2JZYA 4ENKA 3L9FA 3F22A 3KEQA 1ZHFA 1WRJA 4ZYEA 1WKMA 1BI3A 2PI0A 3MQ0A 1Z9CA 2NS0A 1YFHA 3ULQB 2K27A 3E6MA 2Q2EA 1SMYF 3LFKA 3CUOA 2RC4A 1NHAA 1QZZA 5FB2A 2WTEA 4WF2A 2HS5A 1SMTA 2AS5F 2RKHA 5HDNA 4MEXF 1LB2A 3IL2A 4MQ9F 3BP8A 3ABTA 3M7GA 4LLNA 3W6KB 4Y13A 5HS7A 5HS9A 5HOOA 1G3YA 2FBIA 1IF1A 3FMQA 5AIQA 3GX4X 3RKWA 3IWZA 1U2WA 3EYYA 1W5SA 2HKOA 3JTHA 3WU0A 2UWMA 2J5PA 3ML6A 1REPC 1R1VA 4I09A 2VOOA 3LAPA 2IT0A 2QYOA 2WV0A 5DCMB 3SQNA 4O5VA 4M6XA 1ZN2A 2VBWA 4YFXF 4I98B 2OQRA 4EJOA 4KN4X 3SZPA 1FYMA 3CUQA 2V1UA 3JAMZ 2K4BA 2CO5A 3LA2A 3LAJA 3P9KA 3IKTA 2VBZA 1SFXA 3R0JA 3CDHA 5FO5A 3WGGA 3JSPA 3SZTA 3RJPA 2OZ6A 3QOPA 4P5OA 1BI0A 2L3DA 4G7OF 3F8FA 2DQRA 2KRFA 2HTJA 1XSVA 5E1ZB 2COMA 5JVTA 3AAFA 2OA4A 5D8LB 1YQAA 3F6OA 4G7HF 2OZUA 5L3DA 1G3WA 3G3ZA 1GXPA 1KGSA 4K2EA 4YFKF 1SD4A 2V6CA 3REOA 3SFZA 3FXRA 1PUEE 4RS8A 4WXCA 4M9ZA 4D0PA 3HRSA 4A0ZA 3LWFA 2ESHA 1U6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOY A;  1ZYR F;  3LQQ A;  3H92 A;  4IRH A;  1F9N A;  1FYL A;  2GXG A;  3FM5 A;  4BQA A;  2MH2 A;  3K1N A;  1DUX C;  4NB5 A;  3K1M A;  2IA2 A;  1G4D A;  2D45 A;  2H94 A;  1OYY A;  3F8B A;  1YLF A;  3FM3 A;  1KQ9 A;  2DO7 A;  4LD5 A;  2L4A A;  3P9I A;  2IW5 A;  5K5R A;  1F4K A;  1T2K A;  3CUQ C;  3CJN A;  1MKM A;  4ENM A;  2G7H A;  4RAY A;  3F3X A;  3LQR A;  4ZYG A;  2MD5 A;  3GFM A;  3KE2 A;  4Y15 A;  4XLN F;  3K1P A;  5ICF A;  2HFH A;  1T39 A;  3DF8 A;  4IHT A;  5H20 A;  4WCG A;  1UFM A;  4UUV A;  3I64 A;  1HW2 A;  4I0B A;  4F7Z A;  3GW2 A;  1FY7 A;  1OR7 A;  1AWC A;  5DD4 A;  4CXF A;  3GYH X;  3N4M A;  2XAH A;  3H3U A;  4PZJ A;  3J80 Z;  2FRH A;  4A6E A;  2F5E A;  2BYV E;  2RN7 A;  4G6Q A;  2IJL A;  3BPX A;  1XDU A;  1B1B A;  4AIJ A;  3KCC A;  4ZZL A;  3IC7 A;  2A3S A;  1ZAR A;  4UVB A;  4KIG A;  4DQ2 A;  3O2P E;  1FOK A;  2E7X A;  3HYI A;  3BY6 A;  1YIO A;  3TDZ C;  3E5X A;  3E5U A;  1IXR C;  1K6O A;  2XVC A;  1R5G A;  3J7A O;  1T0F A;  2CWE A;  1J5Y A;  2R3S A;  2QEN A;  2HGC A;  1RNL A;  3P7N A;  2V79 A;  2HEO A;  1HXD A;  3I0T A;  5TJJ A;  3RYR A;  2Z33 A;  2ZFW A;  1BI1 A;  4M71 A;  1E2X A;  1K78 A;  1W7P B;  3FWE A;  1SD5 A;  2FEZ A;  2OQG A;  2PEX A;  2K4J A;  1CGP A;  2MLK A;  4LJZ F;  1FYK A;  4UNO A;  2PBI A;  3TO7 A;  3ZP5 A;  4N0B A;  2FQ3 A;  3C7J A;  4IJA A;  2STT A;  3W6J B;  3HOT A;  2VT2 A;  1BC7 C;  3V7R A;  1W4M A;  4N9H A;  5D5X B;  2FF4 A;  3F8C A;  4ZH4 F;  2F5F A;  2MA3 A;  3E6D A;  3RPU A;  3T0Y A;  3FF5 A;  4WWC A;  2VE9 A;  1KU9 A;  1F1Z A;  1L0O C;  3HIF A;  4HZF A;  2ZJ2 A;  3R6S A;  1OPC A;  1J75 A;  3TOA A;  5CJ9 A;  3C3W A;  1HKQ A;  4HF0 A;  2W84 A;  3V8J A;  2P5V A;  1J9I A;  3KET A;  3BJA A;  5CVI A;  2A07 F;  4I0A A;  3KFW X;  5CLS A;  1O3Q A;  2Q0O A;  4LG0 A;  3ZN0 A;  3WE2 A;  1FLI A;  2VOD A;  3WTU C;  2GIV A;  4LG0 B;  3TDU C;  1QPM A;  3O3K A;  4GYG A;  1P6R A;  2YX7 A;  3WTX C;  4BXU A;  4GXO A;  3KP7 A;  2VN2 A;  2EFN A;  3JAM K;  3KZY A;  1HST A;  4AD9 A;  1BBY A;  5D8K B;  3C1D A;  4BHB A;  1WI9 A;  3V7S A;  4ASN A;  2F5C A;  2DPU A;  4RAZ A;  1R1U A;  2C6Y A;  3D0S A;  4CDG A;  3HRT A;  1O7F A;  2CFX A;  2DQL A;  2V9V A;  2R7F A;  4LLG F;  4EJT A;  5DCF A;  1QBJ A;  1SFU A;  1MJB A;  4PDK A;  4EVI A;  4QLC U;  4YFN F;  2VT3 A;  4HLX A;  4L9V A;  2OU2 A;  2Z5U A;  2KJB A;  5JHU A;  1TBX A;  2M1B A;  3NQO A;  4N9I A;  4HLY A;  3SHF A;  1BM9 A;  1KQ8 A;  4RGU A;  1TNS A;  4L5I A;  2FNP A;  3ECO A;  4EGY A;  4LGW A;  2ADU A;  3QRF F;  1RI7 A;  4M9X A;  3ZMV A;  1ODD A;  3RYP A;  3ZMS A;  3J81 Z;  2ETH A;  1R7J A;  1J2X A;  2D1V A;  1Q1H A;  4HX8 A;  4RGX A;  2JRT A;  1FSE A;  4RB1 A;  3VOD A;  4FHT A;  3RIR A;  1GVJ A;  5CVU A;  3OOP A;  4GGG A;  2ISZ A;  3HSF A;  2KIF A;  2PQ8 A;  2NNN A;  5EEH A;  2FOK A;  4OOI A;  1ZG1 A;  5LGN A;  2ZKZ A;  1G6N A;  2DU9 A;  2EB7 A;  2M87 A;  2HWV A;  2K7L A;  3HRM A;  1JHF A;  3EDP A;  4EJU A;  4WX9 A;  1HKT A;  1J59 A;  1Z05 A;  1XMA A;  1QQI A;  3P9C A;  2A5Y B;  4Q5S F;  3BPV A;  4M6Y A;  1QZY A;  3M8F A;  3JW4 A;  3OV8 A;  4MHG A;  4I01 A;  5FD6 A;  1P2F A;  2LF8 A;  4ENJ A;  2YU3 A;  1T6S A;  3BWG A;  4MGR A;  4PCQ A;  4I02 A;  2VC0 A;  5ED4 A;  5DYM A;  1EV7 A;  4O6J A;  5FFZ A;  2JSC A;  3HSE A;  2RDP A;  3HTU A;  2PG4 A;  4PGH A;  1L3L A;  1G3S A;  4WK8 F;  1MJA A;  5CVV A;  1PP7 U;  5ICC A;  2IVM A;  3RI4 A;  2CG4 A;  3J80 K;  5LLQ A;  2QVO A;  4A12 A;  1ZAO A;  1I6X A;  1YG2 A;  2HQR A;  4JQF A;  4P96 A;  2HTS A;  2L01 A;  2M5W A;  3K2Z A;  1ZGJ A;  4OIP F;  5LRS A;  1FBQ A;  4E70 A;  3TKY A;  3S2W A;  1CF7 B;  3WE3 A;  2RV8 A;  2H09 A;  3QPT A;  2O03 A;  1XSD A;  2BBY A;  2B0L A;  1B59 A;  1FP2 A;  3TGN A;  3PQJ A;  3K9T A;  4P55 A;  1B9N A;  4IRG A;  5HLI A;  1KU2 A;  2DLL A;  2A69 F;  5L3F A;  1S7O A;  3V8L A;  4NHJ A;  2J5O A;  3FHZ A;  4P9F A;  3F6V A;  1KQ0 A;  2GWR A;  3GVA A;  1MGT A;  3LST A;  3DXJ F;  2RNJ A;  2P5K A;  5DCM A;  2WC2 A;  1IUY A;  3GUD A;  4UVA A;  2EFP A;  4EM1 A;  4OIO F;  2UZK A;  3M9A A;  2LDU A;  3ISP A;  2DT5 A;  5D6E A;  1OKR A;  2HDC A;  4KT5 C;  3K69 A;  3KLN A;  1U8R A;  1FC3 A;  3LA7 A;  4KIC A;  2ESN A;  4MTE A;  2OAZ A;  1TW2 A;  1STZ A;  3G73 A;  3I4P A;  2M30 A;  5D4R A;  2HZT A;  3ZMT A;  1ZLK A;  2EA4 A;  2Y0M A;  3E6C C;  2A61 A;  4EGZ A;  5HLH A;  1RIO H;  4AIK A;  3DPL C;  5JFR A;  1YW7 A;  3MWM A;  4BHP A;  3U9G A;  3EUH A;  4RB3 C;  2QBY B;  1FBS A;  4EM2 A;  2A6E F;  2OD5 A;  2CW0 F;  4HDV A;  5CVJ A;  4CYD A;  3E6B A;  1X3U A;  1HKS A;  4XSX F;  1BC8 C;  2PLY A;  3IRQ A;  2O8X A;  3ABU A;  3C18 A;  2XAS A;  5F6F A;  3DKW A;  1LEB A;  2F2E A;  2JTV A;  3DFG A;  1D8J A;  1R5H A;  1FPQ A;  5K5Q A;  2L4M A;  4PGG A;  5DD8 A;  3TQN A;  3MEX A;  1IN8 A;  1KYW A;  2ZXJ A;  4BNC A;  4Q48 A;  1DPU A;  3WGI A;  4UV8 A;  1YTY A;  2HOE A;  2ZNZ A;  5D6F A;  2EV6 A;  2O0Y A;  2Y75 A;  4RB2 C;  4ON0 A;  2O6G E;  3KLO A;  3DPT A;  2VC1 A;  2DW4 A;  5DUK A;  1UST A;  3J81 K;  1LDJ A;  2G9W A;  5LRR A;  4ZYD A;  4XRF A;  1MZB A;  4EQQ A;  3E5Q A;  5E17 F;  4UHT A;  1BIA A;  5JI6 A;  3LA3 A;  2ZCW A;  1B6A A;  3M1E A;  2LNB A;  2H6C A;  4I7H A;  2QQB A;  1BI2 A;  2XGX A;  4HA8 A;  1IRG A;  2QQA A;  4LFU A;  5KVR A;  1ULY A;  3MFK A;  4RGS A;  4U7B A;  3KEO A;  1LJ9 A;  3F8N A;  5E8I A;  4KYW A;  2ISY A;  4A6D A;  2L02 A;  2FMY A;  1R00 A;  4R79 A;  4KMF A;  2LSO A;  1EH8 A;  4NQW A;  1W7P A;  2DAO A;  5IT9 Z;  3FZV A;  5E8G A;  1A04 A;  5JR3 A;  3GLX A;  5BQT A;  1P92 A;  3MZH A;  1I27 A;  4BHC A;  3RTR A;  1R23 A;  1FX7 A;  3SXY A;  2IA0 A;  5ILU A;  1R22 A;  2D1H A;  4U88 A;  2XAF A;  3EQL F;  4A0Y A;  1XSX A;  2DPD A;  3F72 A;  1ZRF A;  4XBF A;  3VEP A;  2QLZ A;  3VOE A;  2GA2 A;  5HDG A;  4MTD A;  1Y0U A;  5A2Q K;  3KP3 A;  2BGC A;  4TV7 A;  2MC3 A;  3DEU A;  2GZW A;  1KU7 A;  1Z6R A;  1D5V A;  3WOD F;  4R8H A;  4S04 A;  2HQN A;  2W57 A;  4ZZD A;  4KUM A;  3BJ6 A;  5FFX A;  1LDD A;  3ERE D;  2QM3 A;  3F21 A;  4KIF A;  1WQ2 A;  2KJC A;  3HHG A;  4ENN A;  4BH9 A;  1BOA A;  4U7D A;  2YPR A;  5KK1 A;  2IA1 A;  5D4S A;  3V7C A;  2X4H A;  5F1R A;  1ZLJ A;  2FU4 A;  2PJP A;  2V1D A;  1UB9 A;  1QNT A;  2IRF G;  4MNU A;  2L54 A;  4L9N A;  1ON2 A;  1U78 A;  2FBK A;  1HQC A;  2JPB A;  1XGO A;  2FSW A;  2RVC A;  1UHW A;  4CO8 A;  3HUG A;  5E18 F;  1FP1 D;  1XD7 A;  2QZ8 A;  2XKP A;  3FX3 A;  2XAQ A;  3HTS B;  1IN5 A;  2DFI A;  2Z99 A;  4P9U A;  4EJV A;  5J8F A;  2D2W A;  1XB4 A;  2OBP A;  4EM0 B;  1F5T A;  2O3F A;  3BZ6 A;  4IVN A;  2ZME B;  3JSO A;  4BYY A;  2O61 A;  2EV0 A;  5FLX Z;  4LB5 A;  4A5N A;  1R36 A;  3NEU A;  4EMS A;  3I53 A;  4M9S A;  4UVC A;  5DEQ A;  4KNY A;  3KP5 A;  4WXH A;  3ZMZ A;  2H27 A;  2ZO4 A;  3ELK A;  3PFI A;  3TO9 A;  3N97 A;  4HAM A;  3BRO A;  2JT1 A;  1MJ9 A;  3BOQ A;  2P7C B;  3GZ5 A;  3BJO A;  4CZZ A;  2PMH A;  1FWZ A;  2Z9O A;  4KA4 A;  1LDK B;  1XDS A;  2VBX A;  3HHH A;  4FX0 A;  1W7P D;  2A6H F;  1XMK A;  1H9G A;  4KMU X;  5AON A;  3R0A A;  2ACJ A;  5HVQ C;  3ZQ7 A;  4KN7 X;  5L3E A;  2CQK A;  1IRF A;  3MAJ A;  1ZRE A;  3TO6 A;  5BMZ A;  3QU6 A;  2QUF A;  3GZ6 A;  4ESF A;  2BEO A;  2P8T A;  3WTS C;  2XRN A;  1MD0 A;  1JHH A;  4G9Y A;  1FT9 A;  2P7V B;  1TQI A;  3Q5F A;  2JPC A;  3EYI A;  1YO5 C;  1GXQ A;  5LEJ A;  2PN6 A;  3RPQ A;  3GO5 A;  4LK1 F;  5H6Q A;  4CHU A;  2NNY A;  3V4G A;  1XCB A;  3JTG A;  4ZYH A;  4DNC A;  4JBA A;  1JXS A;  1CF7 A;  1RZ4 A;  3WG9 A;  5FD5 A;  1FSH A;  4L5J A;  2DK8 A;  4M74 A;  3F23 A;  4AVP A;  2E7W A;  2P4W A;  2EJR A;  1O3T A;  4A0X A;  5HLG A;  4GO1 A;  2FE3 A;  1TTY A;  4IPA A;  3GF2 A;  2XUB A;  4KFC A;  1XGN A;  1BIB A;  4HF2 A;  4HOB A;  4LK0 F;  1ZRC A;  3IRR A;  2KIM A;  1SD6 A;  2P5L C;  4A5M A;  1GHC A;  4OIN F;  5A2Q Z;  3TOB A;  4L0Z B;  1J7K A;  5IT9 K;  5ICE A;  1OYI A;  4EV0 A;  4AIH A;  2ZBK A;  1OMI A;  1PDN C;  2WWY A;  3PQK A;  3HRU A;  1B9M A;  5CYV A;  3V8K A;  1HW1 A;  3WTZ A;  2UXN A;  2W25 A;  4FT8 A;  3D5L A;  2AXL A;  2V1X A;  5ILV A;  5ERI A;  2M45 A;  2K86 A;  4KIB A;  1VTN C;  1D8K A;  2ELH A;  2CGP A;  3QAH A;  3DQV C;  5L3G A;  1O3S A;  2Y48 A;  4CIC A;  1R1T A;  1HW5 A;  4KDP A;  4RGR A;  5E1W A;  1ONV A;  1U3E M;  1KA8 A;  2IPQ X;  3VFZ A;  5ILS A;  5EEG A;  4IF4 A;  2GAU A;  3ZN1 A;  2XAJ A;  2EWN A;  1UCR A;  1H0M A;  1IW7 F;  3U2R A;  1TQM A;  5DUI A;  1YS6 A;  4WXD A;  2QBY A;  3R61 A;  1HBX G;  3CUQ B;  1I1G A;  3DV8 A;  3MZY A;  4LMY A;  3GEZ A;  3T8R A;  1R58 A;  4CGZ A;  4G6D A;  1P4W A;  4OMY A;  3WTW C;  1ZRD A;  4JK1 X;  2E1C A;  3HSR A;  2PMU A;  4OIQ F;  2XIG A;  3WTT C;  5FGM A;  4OMZ A;  1EH7 A;  1FNN A;  3EET A;  2DBB A;  4GCV A;  2HR3 A;  1T98 A;  3IKV A;  3CTA A;  2P6S A;  2DI3 A;  3GWZ A;  4O3M A;  1T38 A;  1SD7 A;  5BPD A;  1RUN A;  4M73 A;  2MBF A;  1FZP B;  1QO0 D;  1YYV A;  1ON1 A;  3O6B B;  4R1H A;  2Q8K A;  4Q4Z F;  4YIF A;  2DTR A;  4Q47 A;  4GYI A;  2TDX A;  4L9T A;  5FLX K;  2RGV A;  1MDM A;  2PFB A;  3L2C A;  3R60 A;  3T8T A;  1Z91 A;  5LEK A;  4QWQ A;  4HX4 A;  1MDM B;  3QU3 A;  3H3Z A;  2MLG A;  1K7A A;  3WTV C;  2KKO A;  3I54 A;  1TLH B;  3FXQ A;  2VXZ A;  4LB6 B;  5L3C A;  3I71 A;  2W24 A;  1O3R A;  3T1B A;  1IXC A;  3ECH A;  4HBL A;  1DDN A;  5E20 A;  2NYX A;  2IP2 A;  3CLO A;  3Q9V A;  4H0E A;  3KP6 A;  4U0W A;  1K79 A;  2YSR A;  3VB2 A;  2XAG A;  5J8C A;  2XRO A;  4IXA A;  5LHG A;  2VBY A;  4OIR F;  5LGT A;  2RQP A;  3R4K A;  3FMS A;  1ZG5 A;  1YS7 A;  3RKY A;  1DP7 P;  3NRV A;  4AWX B;  2X0L A;  1XCV A;  4LLL A;  4HW0 A;  1SAX A;  5D5W B;  4ESB A;  4HQE A;  3QPH A;  1LNW A;  4XLP F;  2EK5 A;  5DDG A;  1XGS A;  1U5T A;  3E97 A;  1P4X A;  3QP6 A;  1BN5 A;  1S8N A;  3FXU A;  1H9T A;  1PP8 F;  1LEA A;  4G8X A;  1U5T B;  1KU3 A;  5HS8 A;  4MEY F;  1USS A;  2MH9 A;  4L0Y B;  4B09 A;  3IHU A;  1KYZ A;  3WGH A;  2CYY A;  2ZNY A;  2VE8 A;  2F5D A;  3BDD A;  4L18 B;  1XGM A;  3QP5 A;  4IHS A;  3B73 A;  5BOX A;  2NAZ A;  1E17 A;  1SFE A;  5BS6 A;  2CSO A;  1DPR A;  1S6L A;  2BE5 F;  3L00 A;  1IN6 A;  1G3T A;  1FBU A;  2H6B A;  1TNT A;  3KP2 A;  3KZZ A;  1O7L A;  5LHI A;  4M72 A;  1K78 B;  1B4A A;  5DV5 A;  2GXB A;  1Z7U A;  4XSZ F;  3DP7 A;  3F8M A;  3FMR A;  3COA C;  1BJA A;  5BPI A;  2XKO A;  2FML A;  4Y17 A;  2XV4 S;  2M8E A;  5L3B A;  1D3Y A;  1TQP A;  2QQ9 A;  2FA5 A;  1ZG3 A;  1IN7 A;  1IAW A;  2DK5 A;  4B8X A;  1W5T A;  2W85 A;  1U5T C;  4HQM A;  1JE8 A;  3I58 A;  5ICG A;  1S7A A;  1IN4 A;  4HF1 A;  3T5X A;  1P4A A;  3GFL A;  3ZMD A;  4A2U A;  3ZPL A;  1YW9 A;  2YR2 A;  5H6R A;  2EV5 A;  5IT3 A;  3L7W A;  4L9J A;  4FX4 A;  5HDK A;  5AIP A;  3RKX A;  5D5V B;  1YW8 A;  3I59 A;  3HOS A;  1ZGA A;  5D5U B;  3IWF A;  2GQQ A;  1ZH5 A;  2VOP A;  1V3F A;  1TW3 A;  3ROU A;  3I59 B;  3Q9S A;  4EJW A;  4S05 A;  2ZME A;  1Z1D A;  4G7Z F;  3WTY C;  4Z2Y A;  2LKP A;  3M8E A;  1RUO A;  3CO6 C;  4HV6 A;  1HSJ A;  1O57 A;  3E3V A;  4G94 A;  4I2O A;  2FNA A;  2EFW A;  1WWX A;  2YX4 A;  2HYG D;  4YG2 F;  2A68 F;  1QGP A;  4MQV A;  5TRD A;  1IZ1 A;  2GA1 A;  2E1N A;  1I5Z A;  2EFO A;  2QWW A;  3K0L A;  5F64 A;  2XHK A;  4HDU A;  1S3J A;  2FXA A;  4U0V A;  3B02 A;  5CVR A;  2HYF A;  5LHH A;  4HX7 A;  3GFI A;  2HKX A;  3MCZ A;  1WSU A;  3WU1 B;  1V4R A;  4UV9 A;  2VON A;  2EFQ A;  3U1D A;  3GFJ A;  4YII A;  1JGS A;  3RDI A;  5LGU A;  2UXX A;  1I1S A;  3I5U A;  3ZMU A;  6PAX A;  2NRA C;  2G7U A;  4IRI A;  4BAY A;  2LF7 A;  1C0W A;  5K1Y A;  1Z6T A;  1IXS B;  4OU0 A;  4RB0 A;  5K5O A;  5E1X A;  4HYE A;  2R7D A;  1OYW A;  5J6X A;  1LVA A;  2Z3Y A;  2EA2 A;  1S29 A;  4U0Y A;  1LQ1 A;  4ESJ A;  3L09 A;  4ETS A;  2BV6 A;  2STW A;  3KP4 A;  3CO7 C;  2K02 A;  2KIU A;  2P6T A;  1UHM A;  3GXO A;  1XN7 A;  1EH6 A;  2FBH A;  4HV5 A;  4UXN A;  1J0R A;  5LBQ A;  2JZY A;  4ENK A;  3L9F A;  3F22 A;  3KEQ A;  1ZHF A;  1WRJ A;  4ZYE A;  1WKM A;  1BI3 A;  2PI0 A;  3MQ0 A;  1Z9C A;  2NS0 A;  1YFH A;  3ULQ B;  2K27 A;  3E6M A;  2Q2E A;  1SMY F;  3LFK A;  3CUO A;  2RC4 A;  1NHA A;  1QZZ A;  5FB2 A;  2WTE A;  4WF2 A;  2HS5 A;  1SMT A;  2AS5 F;  2RKH A;  5HDN A;  4MEX F;  1LB2 A;  3IL2 A;  4MQ9 F;  3BP8 A;  3ABT A;  3M7G A;  4LLN A;  3W6K B;  4Y13 A;  5HS7 A;  5HS9 A;  5HOO A;  1G3Y A;  2FBI A;  1IF1 A;  3FMQ A;  5AIQ A;  3GX4 X;  3RKW A;  3IWZ A;  1U2W A;  3EYY A;  1W5S A;  2HKO A;  3JTH A;  3WU0 A;  2UWM A;  2J5P A;  3ML6 A;  1REP C;  1R1V A;  4I09 A;  2VOO A;  3LAP A;  2IT0 A;  2QYO A;  2WV0 A;  5DCM B;  3SQN A;  4O5V A;  4M6X A;  1ZN2 A;  2VBW A;  4YFX F;  4I98 B;  2OQR A;  4EJO A;  4KN4 X;  3SZP A;  1FYM A;  3CUQ A;  2V1U A;  3JAM Z;  2K4B A;  2CO5 A;  3LA2 A;  3LAJ A;  3P9K A;  3IKT A;  2VBZ A;  1SFX A;  3R0J A;  3CDH A;  5FO5 A;  3WGG A;  3JSP A;  3SZT A;  3RJP A;  2OZ6 A;  3QOP A;  4P5O A;  1BI0 A;  2L3D A;  4G7O F;  3F8F A;  2DQR A;  2KRF A;  2HTJ A;  1XSV A;  5E1Z B;  2COM A;  5JVT A;  3AAF A;  2OA4 A;  5D8L B;  1YQA A;  3F6O A;  4G7H F;  2OZU A;  5L3D A;  1G3W A;  3G3Z A;  1GXP A;  1KGS A;  4K2E A;  4YFK F;  1SD4 A;  2V6C A;  3REO A;  3SFZ A;  3FXR A;  1PUE E;  4RS8 A;  4WXC A;  4M9Z A;  4D0P A;  3HRS A;  4A0Z A;  3LWF A;  2ESH A;  1U6G A; 
#chains in the Genus database with same CATH topology
 1AOY A;  1ZYR F;  3LQQ A;  3H92 A;  4IRH A;  5GTH C;  1F9N A;  1FYL A;  2GXG A;  3FM5 A;  1MW7 A;  2B7E A;  2MH2 A;  4F92 B;  1MBJ A;  2CV0 A;  3K1N A;  1DUX C;  3CC2 I;  4BQA A;  4NB5 A;  1QRY A;  2M0C A;  2WY8 Q;  4HNT A;  3K1M A;  4ANJ A;  1ETV A;  2IA2 A;  1ZTR A;  1G4D A;  2D45 A;  2DDB A;  3PNT A;  2H94 A;  1OYY A;  1GVD A;  3K4B A;  4XLA A;  4DYQ A;  3F8B A;  1CQT A;  3OYD A;  1FOX A;  4E4H A;  1QU3 A;  1YLF A;  3FM3 A;  1KQ9 A;  3CME I;  1TT5 B;  2DO7 A;  2FOW A;  2O8K A;  4LD5 A;  2L4A A;  3ZQG A;  3P9I A;  4DIQ A;  2IW5 A;  2NXN B;  4N4O B;  5K5R A;  1FOW A;  1F4K A;  1T2K A;  3P5J A;  3CUQ C;  2XB5 A;  3AG4 H;  3CJN A;  1MKM A;  5IP9 J;  5C4J J;  4XON A;  4II3 A;  4ENM A;  5GTI C;  2G7H A;  3VSL A;  3K4M A;  4RAY A;  1GLN A;  1MMG A;  2JWT A;  2KRC A;  4RBO A;  3ZQQ A;  2KP6 A;  1HLV A;  3F3X A;  3LQR A;  4ZYG A;  4AU7 A;  3NWT A;  5IP6 A;  1LPQ A;  4A3I J;  2MD5 A;  3GFM A;  3PL8 A;  3KE2 A;  4Y15 A;  1P9Q C;  4XLN F;  3K1P A;  1JTX A;  4NC7 A;  4A3K J;  3EPZ A;  5ICF A;  2HFH A;  1T39 A;  3WHC A;  1IDZ A;  3DF8 A;  4IHT A;  2XGD A;  1U9N A;  5CQG A;  5H20 A;  4ZTF A;  4WCG A;  1UFM A;  4A93 J;  3CMY A;  2ME0 A;  4UUV A;  4Y7N J;  1OCZ H;  1K83 J;  3I64 A;  3E1S A;  4NC8 A;  5IOY A;  2ZJP F;  1HW2 A;  2E5N A;  4I0B A;  4F7Z A;  1QVT A;  1WJB A;  3GW2 A;  3G1L A;  1FY7 A;  4BJ6 C;  1OR7 A;  1AWC A;  2A6T A;  5DD4 A;  4A69 C;  4CXF A;  1JKR C;  3PNY A;  3JRC A;  1Z0X A;  3GYH X;  3N4M A;  3CCY A;  2XAH A;  3H3U A;  3B6A A;  4PZJ A;  3J80 Z;  1FTT A;  2FRH A;  4UUT A;  4A6E A;  2VQL A;  2F5E A;  2BYV E;  2RN7 A;  5J1R A;  4G6Q A;  2IJL A;  4YRV A;  3BPX A;  4XOP A;  1XDU A;  1B1B A;  2DMP A;  4PSW A;  3UR3 C;  3KCC A;  4AIJ A;  1MMN A;  4ZZL A;  3H5A A;  3LSI A;  3IC7 A;  2A3S A;  1ZAR A;  4UVB A;  4KIG A;  2XDV A;  4DQ2 A;  3O2P E;  3MKY B;  1FOK A;  2E7X A;  2M4G A;  3HYI A;  3QWL A;  3BY6 A;  1YIO A;  3TDZ C;  3E5X A;  3E5U A;  2F4O B;  2RRE A;  1IXR C;  3GCM A;  4IHY A;  1K6O A;  2K40 A;  2XVC A;  3A1Y A;  1R5G A;  4RLQ A;  3RQI A;  4ZC3 A;  1NK2 P;  3J7A O;  2G0E A;  1T0F A;  3A0B C;  2CWE A;  1J5Y A;  2R3S A;  1XC5 A;  1POG A;  2QEN A;  2MAB A;  1IG7 A;  2A05 A;  3K4N A;  2TCT A;  2HGC A;  3IUO A;  4BL0 B;  4F55 A;  1BJZ A;  4M6V A;  4CZC A;  1RNL A;  3P7N A;  5J40 A;  3FXK A;  2V79 A;  1XG1 A;  2HEO A;  1HXD A;  3I0T A;  5TJJ A;  3RYR A;  2Z33 A;  2ZFW A;  2Q1Z B;  4Y4R A;  1BI1 A;  1T56 A;  2JSP A;  4M71 A;  4J19 A;  2OCE A;  1E2X A;  4D5C A;  1K78 A;  3W6V A;  4AID A;  2OJE D;  4RAG A;  4NQW B;  1W7P B;  3FWE A;  2R7T A;  1SD5 A;  4FET A;  2FEZ A;  2K9S A;  2UV1 A;  2OQG A;  2PEX A;  2K4J A;  1YJN I;  1CGP A;  1R4N B;  3KZI C;  2MLK A;  2DFE A;  4LJZ F;  3DEE A;  3DCF A;  1FYK A;  4UNO A;  3DPU A;  3OMY A;  2PBI A;  1UMQ A;  3TO7 A;  3ZP5 A;  4N0B A;  2FQ3 A;  1AA7 A;  3C7J A;  5E79 C;  2M7A A;  4IJA A;  2STT A;  3W6J B;  5K7F A;  3HOT A;  1Y1V J;  2VT2 A;  1BC7 C;  3V7R A;  1W4M A;  4N9H A;  5D5X B;  2FF4 A;  3F8C A;  4ZH4 F;  1B72 B;  3BG9 A;  2F5F A;  2VKH A;  1ZKG A;  2W82 A;  1OR7 C;  3I3L A;  4AUX A;  2MA3 A;  3E6D A;  4II2 A;  3KYL A;  3HL2 A;  3CMA I;  3RPU A;  5HLT A;  3L2U A;  3T0Y A;  2CU7 A;  3FF5 A;  4WWC A;  2VE9 A;  1KU9 A;  3MKL A;  1PJR A;  3AL0 B;  1F1Z A;  1L0O C;  3HIF A;  4UB6 C;  4HZF A;  2L7Z A;  2ZJ2 A;  4XRS A;  3CCL I;  3R6S A;  1F36 A;  1OPC A;  1J75 A;  1E0E A;  3TOA A;  5CJ9 A;  3C3W A;  1HKQ A;  4HF0 A;  2W84 A;  3V8J A;  2P5V A;  1J9I A;  3KET A;  3BJA A;  5CVI A;  2A07 F;  3DTE A;  1D1C A;  4I0A A;  2O7O A;  3KFW X;  5CLS A;  3FXM A;  2VLA A;  1O3Q A;  2X6O A;  2Q0O A;  4LG0 A;  3ZN0 A;  3WE2 A;  1FLI A;  2VOD A;  3KX2 A;  3MD2 A;  3WTU C;  2GIV A;  3S14 J;  3DU5 A;  1DGW Y;  2X1C A;  4LG0 B;  3TDU C;  5E3M A;  1QPM A;  3O3K A;  4GYG A;  4P1W A;  1T0F C;  1P6R A;  2YX7 A;  3WTX C;  1FJL A;  2XRL A;  4XRS G;  4BXU A;  4IHX A;  1RR8 C;  4GXO A;  2V6E A;  3KP7 A;  4FQG A;  2B9S A;  2VN2 A;  2LC2 A;  1UEL B;  2EFN A;  3CCQ I;  1U9O A;  3ASO H;  3JAM K;  1ZGW A;  1JKO C;  2QCO A;  1P7I A;  3KZY A;  1HST A;  4AD9 A;  1BBY A;  2BOL A;  5D8K B;  5B1A H;  5IPA A;  1OCO H;  3C1D A;  1WI9 A;  3V7S A;  4BHB A;  1JI8 A;  4ASN A;  4IO9 F;  2JVG A;  2F5C A;  1A6Q A;  3JCU C;  2DPU A;  4RAZ A;  2MYS A;  3H0G J;  1R1U A;  2C6Y A;  3D0S A;  1D0Y A;  4CDG A;  3HUG B;  3JRF A;  3HRT A;  5HNH A;  1R4M B;  3NAU A;  1O7F A;  2CFX A;  2DQL A;  2V9V A;  2R7F A;  4J00 A;  4LLG F;  4EJT A;  2XGC A;  5DCF A;  1QBJ A;  1SFU A;  3S16 J;  1MJB A;  3C2H A;  1ENH A;  2WB1 A;  4PDK A;  2WY7 Q;  4EVI A;  2QQ8 A;  4QLC U;  4UUS A;  3BTL A;  4YFN F;  2VT3 A;  4B43 A;  4HLX A;  4L9V A;  3S1M J;  3SFI A;  1T08 B;  2CFO A;  2BXY A;  2OU2 A;  2Z5U A;  1RKW A;  2KJB A;  3ZQH A;  5JHU A;  1LFB A;  4G12 A;  5JHF A;  5LFA A;  3OIQ A;  1TBX A;  2M1B A;  3NQO A;  4UUS B;  3S3N A;  2JA7 J;  3AL0 C;  4N9I A;  4HLY A;  3SHF A;  5K7Z A;  1BM9 A;  4U87 A;  1KQ8 A;  2CUF A;  4RGU A;  1TNS A;  1ZK8 A;  4MIM A;  4L5I A;  2L9V A;  2QA4 I;  2FNP A;  3ECO A;  4EGY A;  4LGW A;  1EF4 A;  2ADU A;  3QRF F;  1RI7 A;  4M9X A;  3ZMV A;  1OIS A;  1ODD A;  2OV7 A;  4PUS A;  1M1E B;  1ETY A;  4F3Q A;  5FKN A;  1NG6 A;  3A03 A;  3RYP A;  3ZMS A;  3J81 Z;  2ETH A;  1R7J A;  1J2X A;  3SJM A;  2JA6 J;  2D1V A;  1Q1H A;  4HX8 A;  4RGX A;  4E7S A;  5HNF A;  2JRT A;  2WAF A;  4V2G A;  1PVE A;  1FSE A;  3OYM A;  4RB1 A;  3VOD A;  4FHT A;  3RIR A;  1S5L C;  2RNG A;  2RAE A;  3E0J B;  4AYB N;  1GVJ A;  2JN6 A;  5CVU A;  2P81 A;  1MBK A;  3OOP A;  4GGG A;  2ISZ A;  3HSF A;  5IP7 J;  2KIF A;  2PQ8 A;  3Q0U A;  2HYJ A;  2JQ7 A;  2NNN A;  5EEH A;  4BGD A;  2P0W A;  1XTA A;  2FOK A;  2MG4 A;  1IRZ A;  4OOI A;  4KJZ A;  3ABK H;  1ZG1 A;  5LGN A;  1Z67 A;  2HI3 A;  2ZKZ A;  1G6N A;  3CLQ A;  3S1R J;  2DU9 A;  2EB7 A;  2M87 A;  2HWV A;  2K7L A;  3G2B A;  3HRM A;  1JHF A;  4JP0 A;  3M07 A;  3EDP A;  1D1A A;  4EJU A;  4WX9 A;  1HKT A;  1J59 A;  1Z05 A;  1V5F A;  1QQI A;  1XMA A;  3P9C A;  2QSG X;  2R7W A;  2A5Y B;  2HQA A;  3BPV A;  1NTC A;  1QZY A;  4M6Y A;  4Q5S F;  3M8F A;  2NOG A;  2XF6 A;  3JW4 A;  2GXA A;  3OV8 A;  4MHG A;  4PFO A;  4BE0 A;  4I01 A;  5FD6 A;  1P2F A;  2LF8 A;  2JMW A;  3FBI B;  4ENJ A;  2YU3 A;  1IGN A;  2FJ1 A;  1IO2 A;  4D7M A;  3CCS I;  1T6S A;  1S9H A;  4W1U A;  3BWG A;  4MGR A;  4PCQ A;  3IH4 A;  1ORK A;  4I02 A;  4JX4 A;  2VC0 A;  5ED4 A;  2DXI A;  5DYM A;  1EV7 A;  4O6J A;  5FFZ A;  1DGR M;  1MIJ A;  2JSC A;  3HSE A;  2RDP A;  2VQC A;  3HTU A;  4BY7 J;  3BZC A;  2PG4 A;  4PGH A;  1L3L A;  4J01 A;  1ZEL A;  3S17 J;  4XKW A;  1G3S A;  4WK8 F;  1MJA A;  5CVV A;  2F5V A;  1PP7 U;  5EZH A;  5ICC A;  2CJJ A;  2IVM A;  3RI4 A;  2CG4 A;  1Y39 A;  3J80 K;  4A3D J;  5B3S H;  5LLQ A;  2QVO A;  4A12 A;  4KT6 A;  3BTJ A;  4OAZ A;  1ZAO A;  3TW7 A;  1I6X A;  1YG2 A;  2HQR A;  2W00 A;  4JQF A;  2IS2 A;  4P96 A;  2HTS A;  2L01 A;  2M5W A;  9ANT A;  2VKE A;  3K2Z A;  1ZGJ A;  4OIP F;  5LRS A;  2O5R A;  1FBQ A;  4RA2 A;  4XOR A;  2K9M A;  3TKY A;  3FDY A;  4E70 A;  3VYS B;  3S2W A;  1VQ6 I;  2X85 A;  1CF7 B;  3WE3 A;  2MW8 A;  5B1B H;  2RV8 A;  2H09 A;  5FLV A;  3QPT A;  2O03 A;  1XSD A;  2BBY A;  2CW8 A;  2B0L A;  2DOD A;  1B59 A;  1X2M A;  1FP2 A;  1MSF C;  3LMM A;  3TGN A;  5K7H A;  3PQJ A;  3K9T A;  3PSF A;  4E7J A;  4P55 A;  3OS2 A;  4XRM A;  1B9N A;  3QPL A;  1Y0N A;  3M8J A;  4IRG A;  1YJ9 I;  5HLI A;  1KU2 A;  2DLL A;  2A69 F;  5F0F A;  5M3F J;  5L3F A;  1S7O A;  3V8L A;  4NHJ A;  1ITY A;  2J5O A;  2JUG A;  3FHZ A;  3QPS A;  4P9F A;  2AQE A;  2R5Z A;  2H1K A;  3F6V A;  3MVP A;  1KQ0 A;  2GWR A;  4AC0 A;  2E35 A;  3GVA A;  3OR1 C;  1MGT A;  4XNF A;  3LST A;  3DXJ F;  2RNJ A;  2LTP A;  2P5K A;  3OYF A;  1MND A;  3C2G A;  2R5Z B;  3DKY A;  5EZG A;  3OL4 A;  1QZE A;  1DU6 A;  5DCM A;  2WC2 A;  1IUY A;  4E7Z A;  3GUD A;  4UVA A;  5GAG J;  2EFP A;  2WAQ N;  4CCJ A;  4EM1 A;  3HGG A;  3CDI A;  4OIO F;  3OYJ A;  4B47 A;  2DOA A;  2UZK A;  2CUJ A;  2Y0S A;  3M9A A;  5CPR B;  2LDU A;  3ISP A;  3L2V A;  2DT5 A;  5D6E A;  1OKR A;  1B8I A;  2HDC A;  4KT5 C;  3K69 A;  3KLN A;  3JR9 A;  1U8R A;  4H4K C;  4IQ4 A;  1FC3 A;  3LA7 A;  4KIC A;  2ESN A;  2BVM A;  2R7R A;  3GTP J;  4MTE A;  1B8I B;  2OAZ A;  1TW2 A;  1STZ A;  3G73 A;  1A31 A;  2K3P A;  3I4P A;  1TP4 A;  1X1A A;  2M30 A;  3LSK A;  5D4R A;  2HZT A;  3ZMT A;  5EG0 B;  3ZR8 X;  2EA4 A;  2Y0M A;  1ZLK A;  3E6C C;  2A61 A;  4EGZ A;  3G4S I;  3HGY A;  1E3H A;  2ID3 A;  5HLH A;  3PIP F;  1RIO H;  3DBL B;  2JUC A;  4AIK A;  2HZD A;  3DPL C;  4DBQ A;  5JFR A;  2HDW A;  3BR0 A;  4PK4 A;  3I4N J;  1YW7 A;  3MWM A;  2IBD A;  3MZ8 A;  5E3N A;  2DJN A;  3DU6 A;  2LVS A;  4BHP A;  3U9G A;  3EUH A;  4RB3 C;  2E2H J;  2QBY B;  1FBS A;  4EM2 A;  4HNV A;  2A6E F;  2E19 A;  4LOC A;  2OD5 A;  3PSI A;  2CW0 F;  3M3Y J;  4HDV A;  2NS7 A;  4BDY A;  5CVJ A;  2YUS A;  2DJI A;  3OS1 A;  1YI2 I;  2JJ7 A;  2HOS A;  4CYD A;  5FRN A;  3E6B A;  2DA5 A;  2Y9Z A;  4IOA F;  2AHQ A;  1X3U A;  1HKS A;  1WJD A;  4IL6 C;  2Y0S N;  3O8H A;  4XSX F;  5J47 A;  1BC8 C;  4QPO A;  3OS0 A;  2PLY A;  3IRQ A;  2O8X A;  4MFE A;  3M4O J;  2GM4 A;  3ABU A;  1Y8Q B;  3C18 A;  2XAS A;  3HG9 A;  4M3G A;  5F6F A;  5IY5 H;  3DKW A;  1LEB A;  2F2E A;  2JTV A;  1KON A;  2DFH A;  1A35 A;  3DFG A;  1D8J A;  1YE9 A;  1R5H A;  1FPQ A;  3HZJ A;  2IXS A;  3OIP A;  5K5Q A;  3AG3 H;  3A01 B;  2L4M A;  4PGG A;  3BR6 A;  5DD8 A;  3BC8 A;  1WJE A;  3TQN A;  2DOF A;  3MEX A;  1IN8 A;  1XX5 A;  1KYW A;  1EKE A;  2ZXJ A;  4DGW B;  2CUZ A;  2WA0 A;  3QYE A;  4BNC A;  4Q48 A;  1DPU A;  3WGI A;  2X1D A;  3AKZ A;  4UV8 A;  4E6K G;  4GDF A;  1YTY A;  4DW6 A;  2HOE A;  4HSR A;  2VJJ A;  2ZNZ A;  4JX6 A;  4YEL A;  3A4C A;  4C2U A;  5D6F A;  3JRI A;  2EV6 A;  2GOX B;  3GTJ J;  1MBG A;  2O0Y A;  1I50 J;  1TT0 A;  2Y75 A;  1A5J A;  4RB2 C;  4DBR A;  2LD5 A;  2K9Q A;  4ON0 A;  2O6G E;  1RRJ A;  1YHQ I;  3KLO A;  3DPT A;  4CUG A;  2VC1 A;  3AG2 H;  3SEQ A;  2DW4 A;  5DUK A;  1UST A;  3F9K A;  4A3C J;  3J81 K;  1LDJ A;  2G9W A;  3KPH A;  5LRR A;  3OL3 A;  4ZYD A;  1LFU P;  1RR7 A;  3FBN B;  2KFD A;  4Y3O A;  4XRF A;  4XLE A;  4I76 A;  3KYD B;  1MZB A;  4EQQ A;  1X3W B;  3E5Q A;  5E17 F;  1TZL A;  2HPI A;  4UHT A;  1BIA A;  3VDX A;  3JRE A;  2DA7 A;  3W2V A;  1IJW C;  3EUH C;  5JI6 A;  1YJW I;  3LA3 A;  2ZCW A;  2ZJQ F;  4LB5 A;  1B6A A;  2KZV A;  3M1E A;  4XR6 A;  1TC3 C;  2LNB A;  2H6C A;  3SYT A;  2EIL H;  2XPW A;  4BUP A;  1G59 A;  4CCN A;  2K85 A;  4I7H A;  3OYG A;  4C3J J;  2QQB A;  1BI2 A;  2XGX A;  3IH2 A;  3OYC A;  3H9G A;  1IDY A;  1MNE A;  4HA8 A;  1TWH J;  2EZI A;  1IRG A;  3PUB A;  1VZ0 A;  4M3F A;  2CQ7 A;  2CUE A;  1K4T A;  3CJT B;  2BY1 A;  1ERD A;  3BTI A;  1Y1W J;  2QQA A;  5JLW A;  5C4X J;  4LFU A;  3ZQC A;  2HDD A;  3K70 C;  2LKS A;  3S15 J;  5KVR A;  1ULY A;  3MFK A;  2DFF A;  4CA0 A;  2BY0 A;  3H5R A;  4RGS A;  4U7B A;  2ECB A;  4JYK A;  1LE8 A;  1A36 A;  2V26 A;  3OSG A;  2R7O A;  2OCC H;  4PSX A;  3KEO A;  1LJ9 A;  3F8N A;  5EDN A;  4E7H A;  5E8I A;  4KYW A;  2VIX A;  2X1E A;  4E7L A;  3LNQ A;  3ZCO A;  2ISY A;  1LE8 B;  4A6D A;  2L02 A;  1SAN A;  2FMY A;  1R00 A;  1H89 C;  2VI6 A;  2LG4 A;  3S1N J;  1AHD P;  4R79 A;  4RLF A;  4KMF A;  2LSO A;  2LFB A;  4RAF A;  3WHB A;  5IYC J;  1EH8 A;  4NQW A;  1W7P A;  1FTZ A;  2DAO A;  5IT9 Z;  3FZV A;  5E8G A;  1A6I A;  2HPM A;  3DLA A;  2LK2 A;  3HKZ A;  2KIQ A;  1A04 A;  5JR3 A;  2VKD A;  1PYV A;  1JJ6 C;  4PJM A;  1YRN B;  1VI0 A;  5DS9 A;  1X3Z B;  3GLX A;  1Y6I A;  5BQT A;  1P92 A;  3MZH A;  3FXJ A;  1I27 A;  4BHC A;  2H8R A;  3RTR A;  1R23 A;  1WH7 A;  3VYT B;  2R7U A;  5KNL A;  1B72 A;  4PJ0 C;  3C2B A;  2R7Z J;  1VQ5 I;  1FX7 A;  4RMN A;  3SXY A;  2IA0 A;  2D5V A;  2HVQ A;  5ILU A;  1BR2 A;  1R22 A;  2D1H A;  4U88 A;  2XAF A;  3EQL F;  1UHS A;  4A0Y A;  1XSX A;  2DPD A;  3F72 A;  1ZRF A;  4XBF A;  4RM2 A;  3H9Q A;  1ZR2 A;  3K4C A;  3VEP A;  2R7Q A;  2W48 A;  2QLZ A;  2MGQ A;  2XF7 A;  3VOE A;  1OCC H;  4UB8 C;  1MMD A;  2GA2 A;  3BG3 A;  5HDG A;  4MTD A;  1Y0U A;  2CV2 A;  5A2Q K;  3KP3 A;  2BGC A;  1BW5 A;  4TV7 A;  2OTJ I;  2MC3 A;  3DEU A;  2GZW A;  1KU7 A;  2LRE A;  2Y9Y A;  1X1P A;  1Z6R A;  1D5V A;  1JT6 A;  3K70 D;  5GAH J;  3WOD F;  4R8H A;  2XGE A;  1SFO J;  4S04 A;  4ZDL A;  1MBF A;  2HQN A;  2W57 A;  1DP3 A;  4ZZD A;  4D5F A;  2A5W A;  4KUM A;  3BJ6 A;  3BQZ A;  5FFX A;  1LDD A;  2R4G A;  4NUB A;  2KHM A;  2QM3 A;  3F21 A;  3ERE D;  4KIF A;  1WQ2 A;  2KJC A;  3HHG A;  3MMY B;  4BH9 A;  2PMZ A;  4ENN A;  1BOA A;  2XB0 X;  4Z6Y A;  4U7D A;  2YPR A;  5C44 J;  3HKZ N;  1ETX A;  1TWC J;  5KK1 A;  2IA1 A;  5D4S A;  4N4N B;  3V7C A;  2X4H A;  2W7N A;  2X6Y A;  1X19 A;  5F1R A;  2E2J J;  1ZLJ A;  3H9J A;  1WJ5 A;  2BZT A;  2FU4 A;  2PJP A;  2V1D A;  1UB9 A;  1Y8R B;  1QNT A;  2IRF G;  4MNU A;  4IX7 A;  2L54 A;  5DM7 F;  3ZQI A;  4C3H J;  4L9N A;  3UNG C;  3OYB A;  1ON2 A;  4XLH A;  1U78 A;  2FBK A;  2Y69 H;  3ZGK A;  1HQC A;  2JPB A;  4BKX A;  1XGO A;  2FSW A;  3QYF A;  1MBH A;  1W36 C;  3HC7 A;  2RVC A;  1UHW A;  4CO8 A;  4M3B A;  3HUG A;  5E18 F;  4DJA A;  3FXL A;  1FP1 D;  2EIM H;  4E7K A;  1XD7 A;  4B48 A;  2QZ8 A;  2VB6 A;  2XKP A;  4HG2 A;  5LD2 C;  3K4K A;  5FKK A;  2K9L A;  1Q1V A;  2HOA A;  4ZTJ A;  3FX3 A;  2XAQ A;  3J7Z I;  5EEA A;  3HTS B;  3GTG J;  1IN5 A;  2E36 A;  3BCB A;  1Z3X A;  3X2Q H;  1JGG A;  2DFI A;  2Z99 A;  1OLT A;  3A02 A;  3BG6 A;  4EJV A;  4P9U A;  5J8F A;  3ABL H;  4AVZ A;  2D2W A;  1XB4 A;  2OBP A;  5J1U A;  3HOV J;  4EM0 B;  1F5T A;  2O3F A;  2DYR H;  3BZ6 A;  4IVN A;  3S2D J;  4A3G J;  2ZME B;  3JSO A;  4BYY A;  1Z21 A;  4LG3 A;  2O61 A;  2PMZ N;  1OFC X;  2EV0 A;  3DTK A;  5FLX Z;  2EZL A;  1JUP A;  3BQY A;  1WVR A;  4A5N A;  1R71 A;  1R36 A;  1RPW A;  3NEU A;  3TMO A;  1S7E A;  4EMS A;  1WGX A;  2WAD A;  2I5U A;  3WU2 C;  2M3A A;  3I53 A;  4MFD A;  5J4V A;  2R5Y A;  3HM5 A;  4M9S A;  4UVC A;  5DEQ A;  2FUG 2;  1SAU A;  4KNY A;  3KP5 A;  1NH3 A;  4WXH A;  1T8I A;  3ZMZ A;  2BY2 A;  2H27 A;  2ZO4 A;  3E7L A;  2R5Y B;  2NVQ J;  1NG7 A;  3ELK A;  3PFI A;  4QPQ A;  4LIU A;  3TO9 A;  2CQX A;  2AQF A;  5JVG F;  1IRX A;  3N97 A;  5F0C A;  2UUZ A;  3GZN B;  4HAM A;  3BRO A;  2JT1 A;  1MJ9 A;  2L9N A;  4QIW N;  5GPA A;  4JOM A;  2IEK A;  3BOQ A;  2BHZ A;  2AO9 A;  2P7C B;  1WCM J;  2GIZ A;  3GZ5 A;  3J7Y J;  3BJO A;  4CZZ A;  3OYH A;  2PMH A;  3EUK L;  2KLO A;  3BLY A;  3G1O A;  2QEX I;  1FWZ A;  4F91 B;  2HVS A;  2Z9O A;  3CD6 I;  1YOV B;  4KA4 A;  1DU0 A;  1LDK B;  1XDS A;  5J3L A;  2VBX A;  3HHH A;  4FX0 A;  1W7P D;  1FIP A;  2BW3 A;  2WB1 N;  4L5E A;  2A6H F;  1XMK A;  2GOM A;  2XSJ C;  4HPQ A;  4UY8 I;  4CSW A;  1VQP I;  2ZXW H;  1H9G A;  3ESW B;  4KMU X;  3R0A A;  5AON A;  2ACJ A;  5HVQ C;  3ZQ7 A;  2BW3 B;  4KN7 X;  3OYA A;  4XID A;  5L3E A;  2CQK A;  1IRF A;  1UG2 A;  4ZYA A;  3J7A Y;  3I55 I;  3MAJ A;  1ZRE A;  3ABM H;  2GLO A;  3TO6 A;  1T33 A;  3QU6 A;  3H35 A;  5H2F C;  3L2R A;  5BMZ A;  3CES A;  1IV6 A;  2QUF A;  2MD0 A;  1VQ7 I;  3GZ6 A;  3S1Q J;  4ESF A;  2BEO A;  4HST A;  3BG5 A;  2M2E A;  2EPF A;  1HA8 A;  2P8T A;  4XLC A;  1YIJ I;  3WTS C;  5DTD A;  3LSP A;  2XRN A;  1MD0 A;  1JHH A;  4G9Y A;  1GUU A;  1FT9 A;  2P7V B;  4XIC A;  1TQI A;  3CF5 F;  1X2N A;  2X6W A;  3Q5F A;  2JPC A;  2ZME C;  3EYI A;  3RPU D;  2LY1 A;  3GBG A;  1YO5 C;  3Q0V A;  1GXQ A;  2VQH A;  2XPV A;  5BNG A;  4DYC A;  5LEJ A;  4A3M J;  2PN6 A;  3RPQ A;  3GO5 A;  2M8G X;  4LK1 F;  5FJ8 J;  2KDO A;  5H6Q A;  4CHU A;  1G2H A;  4ITV A;  2JA5 J;  3HOY J;  2NNY A;  4CCM A;  1N77 A;  3V4G A;  4IHV A;  1XCB A;  2JVH A;  1VQ4 I;  3OSF A;  3JTG A;  3G71 I;  4ZYH A;  3HB9 A;  2NOJ B;  4DNC A;  4JBA A;  3HDD A;  1JXS A;  1CF7 A;  1RZ4 A;  2VPL A;  3WG9 A;  3LOC A;  2QSH X;  5FD5 A;  2DA4 A;  1FSH A;  4L5J A;  3PUF A;  3Q3S A;  5FLM J;  1UAA A;  4CCK A;  1N75 A;  2DK8 A;  4M74 A;  2DT6 A;  2XAU A;  3F23 A;  1YX5 A;  4AVP A;  2E7W A;  2P4W A;  3CCV I;  2EJR A;  1O3T A;  4A0X A;  5HLG A;  3IH3 A;  3VYR B;  4GO1 A;  2KL4 A;  3B6C A;  2FE3 A;  2R7S A;  1TTY A;  1H8A C;  4IPA A;  4XQF A;  3GF2 A;  3LSG A;  1EA3 A;  3ZOB A;  2XUB A;  2ELK A;  4KFC A;  3NWS A;  1XGN A;  1BIB A;  2M0M A;  4HF2 A;  4HOB A;  4LK0 F;  3S93 A;  1Z7L A;  4HRI A;  1AU7 A;  1SEU A;  1ZRC A;  3IRR A;  2KIM A;  5FKO A;  2EBI A;  2KMU A;  1SD6 A;  4D9J A;  2P5L C;  4A5M A;  1GHC A;  4GRI A;  2NVX J;  1APL C;  1T95 A;  4NDL A;  4OIN F;  2DDA A;  5A2Q Z;  3TOB A;  4Y52 J;  4L0Z B;  3DKX A;  5E3O A;  2F4M B;  1J7K A;  3H0D A;  3GTQ J;  2IS6 A;  4BXX J;  1RES A;  5IT9 K;  5ICE A;  1OYI A;  4EV0 A;  2F48 A;  4AIH A;  2ZBK A;  5KAF C;  4HEA 2;  1OMI A;  4CCL A;  3CZ6 A;  5HOD A;  2HXO A;  1PDN C;  2WWY A;  1ACI A;  2X48 A;  2EIN H;  1X58 A;  3PQK A;  2HOT A;  3HRU A;  1B9M A;  5CYV A;  1K6Y A;  3V8K A;  4XMY A;  3L2W A;  1HW1 A;  2ZC2 A;  1WJF A;  3WTZ A;  4KIT B;  2UXN A;  2W25 A;  4FT8 A;  3WG7 H;  3D5L A;  2W1O A;  2R0Q C;  3AG1 H;  2AXL A;  2V1X A;  5ILV A;  1GV2 A;  3CCM I;  5ERI A;  2M45 A;  3TL4 X;  2K86 A;  4KIB A;  1VTN C;  1D8K A;  2ELH A;  2CGP A;  3QAH A;  5IOZ A;  4G6T B;  2VQG A;  3DQV C;  3D5S C;  5L3G A;  1O3S A;  1VQN I;  2Y48 A;  3FIS A;  4CIC A;  1R1T A;  1HW5 A;  2DTZ A;  4KDP A;  5C3E J;  3BR1 A;  2EIK H;  4RGR A;  1E3O C;  5E1W A;  5J1Y A;  1BR4 A;  1MH4 A;  1ONV A;  4DZJ A;  3N05 A;  3QQA A;  1U3E M;  2Z2S B;  5EG0 A;  1KA8 A;  2IPQ X;  5EJC A;  3MKW B;  3VFZ A;  1G8X A;  5ILS A;  3SZG A;  4BXF A;  3RQ4 A;  5EEG A;  4IF4 A;  2GAU A;  2CRG A;  2LKX A;  3ZN1 A;  4B3A A;  3OYE A;  5EF6 A;  1V5E A;  1YX3 A;  2XAJ A;  1EJ9 A;  2EWN A;  1XMX A;  2QKL B;  1UCR A;  3H1C A;  1AKH B;  5B66 C;  1H0M A;  3DEW A;  1IW7 F;  3U2R A;  4M3D A;  1TQM A;  3A2K A;  2N8G A;  5DUI A;  1E3P A;  1YS6 A;  2X51 A;  4WXD A;  1BOB A;  2K9N A;  3OOU A;  2QBY A;  2ME6 A;  3R61 A;  4IEJ A;  1HBX G;  3CUQ B;  1PUF A;  1I1G A;  3DV8 A;  4AM3 A;  2H1L A;  1OQY A;  3MZY A;  4LMY A;  1UJ8 A;  3GEZ A;  4X1E A;  3T8R A;  3S3O A;  1WPK A;  2CQQ A;  1R58 A;  3Q0W A;  1PUF B;  1IC8 A;  4CGZ A;  2KDZ A;  4NNJ A;  2KZG A;  2LH9 A;  4G6D A;  1P4W A;  2COB A;  4OMY A;  3WTW C;  3PFY A;  4FE7 A;  1ZRD A;  3SDB A;  3K6G A;  2CS3 A;  4DOZ A;  5FRM A;  5CQE A;  4JK1 X;  3DBR B;  3HSR A;  2PMU A;  1QA6 A;  2XIG A;  2E1C A;  4OIQ F;  3RCO A;  3WTT C;  4Y33 A;  5FGM A;  2EIJ H;  4OMZ A;  4C2T A;  1EH7 A;  1FNN A;  2TRT A;  3EET A;  2DBB A;  3PNV A;  4GCV A;  2R7V A;  2HR3 A;  3JRA A;  2OC6 A;  1JTY A;  1T98 A;  3IKV A;  1SVL A;  4JX5 A;  4NC6 A;  3CTA A;  2GBY A;  2DMN A;  4PJJ A;  1WH5 A;  1N25 A;  3LFU A;  3A01 A;  2P6S A;  2BXZ A;  3SDG A;  1VF9 A;  2DI3 A;  3OYL A;  3GWZ A;  4O3M A;  1T38 A;  1GDT A;  2ID6 A;  5M5X J;  1JKP C;  1SD7 A;  5BPD A;  3BG7 A;  3PJR A;  3G1M A;  1RUN A;  4M73 A;  1TL8 A;  2MBF A;  1ETK A;  1QO0 D;  1FZP B;  2E2I J;  3IAS 2;  1YYV A;  1UZC A;  2WV1 A;  3QOD A;  2E34 A;  1ON1 A;  2VAS A;  2ZXI A;  3O6B B;  3OWT A;  2ELJ A;  4R1H A;  2Q8K A;  4Q4Z F;  2IAI A;  4YIF A;  1UG0 A;  4OAY A;  2DTR A;  4Q47 A;  4YEJ A;  5GAE J;  2JRM A;  4GYI A;  4B4C A;  3SEZ A;  2TDX A;  1R6R A;  4L9T A;  5FLX K;  2RGV A;  1MDM A;  2PFB A;  3L2C A;  3R60 A;  3T8T A;  1IUF A;  5M5W J;  1I3Q J;  1O4X A;  1Z91 A;  2L9R A;  1U8B A;  2CH0 A;  5LEK A;  4QWQ A;  2Y31 A;  2FQ4 A;  4HX4 A;  2CV1 A;  1QHH D;  1MDM B;  3QU3 A;  1I6H J;  2YU9 J;  4RM3 A;  2ECC A;  3H36 A;  3H3Z A;  2MLG A;  5E3L A;  1QHG A;  1HOM A;  4BQN A;  1K7A A;  3UKG A;  3WTV C;  4A3J J;  3JRH A;  2KKO A;  2I10 A;  2DYS H;  3I54 A;  3OYI A;  1FEX A;  4BY1 J;  2AXT C;  1TLH B;  1Y56 A;  3FXQ A;  3O8G A;  4BQO A;  1WZ2 A;  2VXZ A;  3ZQL A;  3ONQ A;  4LB6 B;  5L3C A;  3I71 A;  2W24 A;  1O3R A;  2V9K A;  3T1B A;  1VQL I;  2KQR A;  1IXC A;  1V54 H;  3ECH A;  4FCY A;  3GTM J;  4HBL A;  1DDN A;  5E20 A;  2L0K A;  2NYX A;  2IP2 A;  3CLO A;  3Q9V A;  2ZJR F;  4H0E A;  1OJL A;  2Z16 A;  3KP6 A;  4U0W A;  1K79 A;  2YSR A;  2NVY J;  3VB2 A;  2VJI A;  2XAG A;  2BVL A;  5J8C A;  2XRO A;  1SFK A;  1MSE C;  2K5C A;  4BBS J;  4A3L J;  3S3M A;  2Z1D A;  4IXA A;  5LHG A;  1RKT A;  2VBY A;  4BAC A;  1F43 A;  1VFC A;  4OIR F;  5LGT A;  2L7F P;  2RQP A;  3TP0 A;  4FTH A;  1JKQ C;  1FMV A;  4BEH A;  3R4K A;  3FMS A;  5M5Y J;  1ZG5 A;  3ZXS A;  4IKF A;  1YS7 A;  3FXO A;  3RKY A;  1DP7 P;  3A0H C;  2EZK A;  3NRV A;  3HOU J;  1RET A;  1SVO A;  2H8W A;  4AWX B;  2L7K A;  2OF7 A;  2X0L A;  1XCV A;  4LLL A;  4BEH B;  3AFH A;  4HW0 A;  1SAX A;  2DA3 A;  3JRD A;  1BA5 A;  3F0C A;  5D5W B;  4ESB A;  4HQE A;  3QPH A;  2HXI A;  1X1D A;  1LNW A;  4XLP F;  2DA2 A;  2EK5 A;  4OWR B;  5DDG A;  5IYD J;  1K4S A;  1WI3 A;  5JLX A;  1XGS A;  2IS4 A;  1U5T A;  3E97 A;  2WAE A;  4EEF G;  3QOE A;  2X9D A;  2QKM B;  1P4X A;  3TP3 A;  5F27 A;  3QP6 A;  4ZJZ A;  1BN5 A;  1S8N A;  3DTI A;  3FXU A;  4PFP A;  1H9T A;  1PP8 F;  1VQ9 I;  1LEA A;  4G8X A;  1U5T B;  4HNU A;  1KU3 A;  4XKB A;  2LLK A;  2HQ5 A;  1USS A;  4MEY F;  1D1B A;  2MH9 A;  1FMW A;  5HS8 A;  3OYK A;  2I8D A;  4L0Y B;  3CP2 A;  4XM3 A;  3K7A J;  4B09 A;  4IZZ A;  2LMD A;  3IHU A;  1D5Y A;  5M3M J;  1YRN A;  2NVU B;  1KYZ A;  3WGH A;  2CYY A;  2DN0 A;  2ZNY A;  1LFP A;  3GTK J;  2VE8 A;  2F5D A;  2QGU A;  1SVM A;  3BDD A;  4L18 B;  1XGM A;  3QP5 A;  1X1B A;  2E71 A;  1MMS A;  3RKQ A;  4IHS A;  5KCM A;  3B73 A;  5CKT A;  5BOX A;  4ZDP A;  2NAZ A;  1E17 A;  1SFE A;  5BS6 A;  3CCJ I;  2JA8 J;  1XPX A;  2CSO A;  4DYR A;  4A3B J;  1DPR A;  4IOC F;  1S6L A;  2BE5 F;  3BT9 A;  3L00 A;  5TGT A;  1IN6 A;  3ZQF A;  2HNH A;  1G3T A;  1FBU A;  2LY9 A;  1VQM I;  2H6B A;  1TNT A;  5KAI C;  3KP2 A;  4RDU A;  3GME A;  3V42 A;  3KZZ A;  1O7L A;  2QF7 A;  5LHI A;  1Z3Y A;  4M72 A;  3OR2 C;  2BY3 A;  1K78 B;  1B4A A;  2VPR A;  3OYN A;  1MNM C;  4ABZ A;  5DV5 A;  1VQ8 I;  2GXB A;  1Z7U A;  2JA2 A;  1YIT I;  4XSZ F;  1RC9 A;  1J09 A;  1QVU A;  3DP7 A;  2NS8 A;  3F8M A;  3FMR A;  1S72 I;  2CW7 A;  3COA C;  1GT0 C;  1BJA A;  2ZB9 A;  5FRO A;  5BPI A;  3KIO A;  3BCA A;  2XKO A;  2DOE A;  3CCE I;  1NK3 P;  2FML A;  4Y17 A;  2XV4 S;  3L1P A;  4S0H B;  2M8E A;  5L3B A;  1ETQ A;  1D3Y A;  1TQP A;  2QQ9 A;  2M34 A;  5FKL A;  2KRH A;  2FA5 A;  1ZG3 A;  4C30 A;  1JT0 A;  1IN7 A;  1IAW A;  2DK5 A;  1ETO A;  4B8X A;  1I39 A;  1W5T A;  2W85 A;  3H3V K;  1U5T C;  2VXD A;  4HQM A;  2FX0 A;  4XN0 A;  1JE8 A;  3I58 A;  2XSD C;  5ICG A;  3JRB A;  1OCR H;  1S7A A;  1ZR4 A;  4V2F A;  3FHN A;  3RSN A;  1IN4 A;  3HPG A;  4HF1 A;  3T5X A;  1P4A A;  4FAS D;  2Y2Z A;  3GFL A;  1X1C A;  3I9V 2;  3ZMD A;  4A2U A;  4BQQ A;  4CYC A;  3ZPL A;  2DCE A;  5J4Y A;  3K4J A;  1YW9 A;  2OTL I;  1D0X A;  2YR2 A;  5FKM A;  3I56 I;  5TIS C;  5H6R A;  4CYC B;  2EV5 A;  5IT3 A;  3G6E I;  2E1O A;  3L7W A;  2QSF X;  4L9J A;  4FX4 A;  5HDK A;  2LR8 A;  2L9S A;  5AIP A;  2Y30 A;  2ZFU A;  1WJC A;  3RKX A;  2PX9 A;  3HPH A;  4CCO A;  1LUJ B;  1YW8 A;  5D5V B;  1MMA A;  2VKV A;  2CQN A;  3GTL J;  3RZD J;  3I59 A;  2V1N A;  4XKV A;  3HOS A;  4FE4 A;  1ZGA A;  4LIT A;  1R5I D;  4DZP A;  3IWF A;  2GQQ A;  3W2W A;  5D5U B;  4BDZ A;  1JJ8 C;  1ZH5 A;  3GLL A;  4AYB A;  2VOP A;  3H5N A;  1V3F A;  3LSH A;  3BR3 A;  1TW3 A;  2CMP A;  3ROU A;  1N78 A;  2R92 J;  3I59 B;  3Q9S A;  4XN3 A;  4EJW A;  2E5Z A;  4S05 A;  2ZME A;  3U1K A;  5GPC A;  1Z1D A;  2M9H A;  2JK3 A;  2V4J C;  3WTY C;  4G7Z F;  4Z2Y A;  5F04 A;  3PO3 J;  2LKP A;  5EYR A;  3M8E A;  1RUO A;  3CO6 C;  3JRG A;  4HV6 A;  3VYU B;  1HSJ A;  1O57 A;  4B3X A;  3K10 A;  5GAD J;  2O9L A;  3E3V A;  4G94 A;  3CC4 I;  5IYB J;  3IP4 B;  2R93 J;  4I2O A;  2FNA A;  2EFW A;  3S2H J;  1WWX A;  2YX4 A;  2HYG D;  4XLF A;  4YIR X;  1ETW A;  3TW6 A;  3HOW J;  4YG2 F;  2IGO A;  2A68 F;  2E60 A;  4MO7 A;  4X0G A;  2E1M B;  1QGP A;  3FK7 A;  3PIO F;  4GFB A;  1BL0 A;  4MQV A;  5TRD A;  1IZ1 A;  2GA1 A;  2E1N A;  1I5Z A;  2EQR A;  2F4I A;  2EFO A;  2QWW A;  3K0L A;  5F64 A;  2XHK A;  4HDU A;  1WHU A;  1I3A A;  1S3J A;  3TBI A;  2X6X A;  1H88 C;  2NVT J;  2FXA A;  4U0V A;  2IGN A;  3B02 A;  1HF0 A;  1DQU A;  5CVR A;  2HYF A;  3L2Q A;  5LHH A;  3BZK A;  4HX7 A;  4I99 C;  1GV5 A;  3HXL A;  3GFI A;  2HKX A;  1V55 H;  3PM1 A;  3FKJ A;  2VJ4 A;  3MCZ A;  1W36 D;  3RZO J;  1WSU A;  3WU1 B;  3D5R C;  1OCP A;  1V4R A;  4UV9 A;  4I6Z A;  3S8P A;  3CJQ B;  2VON A;  2EFQ A;  3U1D A;  3ASN H;  3GFJ A;  4XK4 A;  4YII A;  1JGS A;  3RDI A;  5LGU A;  2UXX A;  3HEF A;  1JUM A;  1I1S A;  2LOO A;  1R49 A;  3I5U A;  3ZMU A;  3TED A;  6PAX A;  2NRA C;  1VND A;  4W97 A;  3LSR A;  2KPM A;  2G7U A;  2ZXH A;  3U21 A;  4BU2 A;  4IRI A;  4BAY A;  4IHW A;  2LF7 A;  2DT7 B;  4IQJ A;  1C0W A;  5K1Y A;  3KEY A;  2EZH A;  3CJR B;  1HCR A;  2ZSI B;  3GTO J;  3ERM A;  3W2A A;  1WJA A;  2WBM A;  1Z6T A;  5DM6 F;  4BJT A;  2LY2 A;  2MC4 A;  1IXS B;  3ZRG A;  4F52 A;  4OU0 A;  4RB0 A;  2XPU A;  4D1Q A;  4X6A J;  5K5O A;  4QTR A;  1XS9 A;  5E1X A;  4HYE A;  2R7D A;  1OYW A;  1TWA J;  3CCR I;  5J6X A;  2HVR A;  1LVA A;  2Z3Y A;  2EA2 A;  1S29 A;  4U0Y A;  1LQ1 A;  4ESJ A;  5KHD A;  3IAM 2;  3L09 A;  4ETS A;  4QSH A;  2BV6 A;  1X4P A;  3MKZ A;  2STW A;  1X4O A;  4BS9 A;  4MLO A;  1HDD C;  3KP4 A;  3CO7 C;  2K02 A;  2OUM A;  2KIU A;  3LSM A;  2OPT A;  2P6T A;  2FD5 A;  2E1M C;  2DMT A;  4BBR J;  1UHM A;  3GXO A;  1VQK I;  2B63 J;  1XN7 A;  3LSJ A;  1EH6 A;  2FBH A;  3HBL A;  4C9Y A;  2IGK A;  4HV5 A;  4UXN A;  1J0R A;  5LBQ A;  2JZY A;  1LVK A;  1KZH A;  4ENK A;  3L9F A;  3F22 A;  1LKX A;  3KEQ A;  1W5C C;  3VSK A;  1U0J A;  1ZHF A;  1WRJ A;  4ZYE A;  1WKM A;  2L7M P;  1BI3 A;  4CH7 A;  3DBH B;  2PI0 A;  4XL9 A;  3MQ0 A;  1Z9C A;  2NS0 A;  3CCU I;  2WAQ A;  1YFH A;  3ULQ B;  4A3F J;  2K27 A;  3E6M A;  2Q2E A;  1R9T J;  1SMY F;  3LFK A;  3CUO A;  3CQZ J;  2RC4 A;  3DLL F;  3FK6 A;  2RQQ A;  4NBQ A;  4XOT A;  1NHA A;  3NAR A;  5EGO A;  2MSY A;  1QZZ A;  2Q2E B;  3CC7 I;  2DMQ A;  5FB2 A;  2V7F A;  3CF2 A;  2WTE A;  2XF5 A;  3HJE A;  5EGO B;  4WF2 A;  2W4S A;  1HDP A;  2HS5 A;  4A3E J;  1SMT A;  1W0T A;  2DMU A;  3LL7 A;  1MBE A;  1V5G A;  2RKH A;  5HDN A;  4MEX F;  1LB2 A;  2AS5 F;  3IL2 A;  5GP9 A;  2KIS A;  5F0H A;  2DA6 A;  2KT0 A;  4MQ9 F;  3BP8 A;  1TWF J;  3ABT A;  3M7G A;  4BE2 A;  2XC7 A;  3KYC B;  1QPI A;  4LLN A;  3W6K B;  1MH3 A;  5HS7 A;  5HS9 A;  2K3F A;  4Y13 A;  3BTC A;  3HOZ J;  3PO2 J;  3OIO A;  4PJN A;  5HOO A;  1K61 A;  1G3Y A;  1JUS A;  2FBI A;  1IF1 A;  3FKI J;  2VUM J;  2DA1 A;  1IV8 A;  3FMQ A;  3QYB A;  2ICW G;  5AIQ A;  3GX4 X;  3RKW A;  4C2M J;  3IWZ A;  2VL8 A;  1U2W A;  1SC7 A;  3D1N I;  1ZQ3 P;  1BR1 A;  3EYY A;  1W5S A;  2HKO A;  2EH3 A;  2L5Q A;  2LBF A;  3CMM A;  3JTH A;  3BR5 A;  3WU0 A;  1HC8 A;  2LP0 A;  3M1C A;  2UWM A;  2J5P A;  3ML6 A;  4KIS A;  1REP C;  1R1V A;  4I09 A;  2M4K A;  3W3C A;  3S32 A;  2VOO A;  3LAP A;  2LBF B;  2IT0 A;  4FIS A;  4B44 A;  3IV5 A;  2QYO A;  2WV0 A;  1AKH A;  5DCM B;  2BHY A;  2YS9 A;  3SQN A;  4O5V A;  4M6X A;  3VWB A;  5F1J A;  1BW6 A;  3DWL E;  1ZN2 A;  3FIW A;  4E7I A;  3K4L A;  3BR2 A;  2PJR A;  4D7N A;  4BJ5 C;  2VBW A;  4YFX F;  1W0U A;  4I98 B;  2MFZ A;  2OQR A;  4EJO A;  4KN4 X;  3SZP A;  1FYM A;  1FIA A;  3CUQ A;  4XKC A;  3JAM Z;  2V1U A;  2K4B A;  2PJR B;  4C3I J;  2CO5 A;  2LRD A;  1P7J A;  2R7X A;  3LA2 A;  4PJL A;  3LAJ A;  3K2A A;  3P9K A;  1D0Z A;  3IKT A;  1FOY A;  2VBZ A;  1SFX A;  3MN2 A;  2ZSH B;  3R0J A;  3CDH A;  3OY9 A;  5FO5 A;  5F08 A;  3VPR A;  3WGG A;  3JSP A;  3RJP A;  3SZT A;  2OZ6 A;  3I4M J;  3QOP A;  4P5O A;  1BI0 A;  2L3D A;  4M3E A;  1WFX A;  3F8F A;  2DQR A;  4G7O F;  2KRF A;  1W1W E;  1XSV A;  2HTJ A;  2F6C A;  3CDL A;  5E1Z B;  5B5E C;  2COM A;  5JVT A;  3AAF A;  2OA4 A;  5D8L B;  1YQA A;  2HU9 A;  3F6O A;  2V9P A;  2LYC A;  4V19 K;  3EUA A;  4G7H F;  4ZDO A;  2IGM A;  2OZU A;  4F93 B;  2M7B A;  5L3D A;  1G3W A;  3G3Z A;  2L2O A;  1GXP A;  3CP8 A;  1KGS A;  1VQO I;  1OCT C;  4EAT A;  4K2E A;  3HOX J;  4B1R A;  4YFK F;  4BE1 A;  2IS1 A;  1SD4 A;  2V6C A;  3REO A;  1TWG J;  3SFZ A;  3FXR A;  1PUE E;  4RS8 A;  4WXC A;  4M9Z A;  4D0P A;  3HRS A;  2VJ5 A;  4A0Z A;  3LWF A;  2ESH A;  4LIV A;  1U6G A;  1Z77 A; 
#chains in the Genus database with same CATH homology
 1AOY A;  1ZYR F;  3LQQ A;  3H92 A;  4IRH A;  1F9N A;  1FYL A;  2GXG A;  3FM5 A;  4BQA A;  2MH2 A;  3K1N A;  1DUX C;  4NB5 A;  3K1M A;  2IA2 A;  1G4D A;  2D45 A;  2H94 A;  1OYY A;  3F8B A;  1YLF A;  3FM3 A;  1KQ9 A;  2DO7 A;  4LD5 A;  2L4A A;  3P9I A;  2IW5 A;  5K5R A;  1F4K A;  1T2K A;  3CUQ C;  3CJN A;  1MKM A;  4ENM A;  2G7H A;  4RAY A;  3F3X A;  3LQR A;  4ZYG A;  2MD5 A;  3GFM A;  3KE2 A;  4Y15 A;  4XLN F;  3K1P A;  5ICF A;  2HFH A;  1T39 A;  3DF8 A;  4IHT A;  5H20 A;  4WCG A;  1UFM A;  4UUV A;  3I64 A;  1HW2 A;  4I0B A;  4F7Z A;  3GW2 A;  1FY7 A;  1OR7 A;  1AWC A;  5DD4 A;  4CXF A;  3GYH X;  3N4M A;  2XAH A;  3H3U A;  4PZJ A;  3J80 Z;  2FRH A;  4A6E A;  2F5E A;  2BYV E;  2RN7 A;  4G6Q A;  2IJL A;  3BPX A;  1XDU A;  1B1B A;  4AIJ A;  3KCC A;  4ZZL A;  3IC7 A;  2A3S A;  1ZAR A;  4UVB A;  4KIG A;  4DQ2 A;  3O2P E;  1FOK A;  2E7X A;  3HYI A;  3BY6 A;  1YIO A;  3TDZ C;  3E5X A;  3E5U A;  1IXR C;  1K6O A;  2XVC A;  1R5G A;  3J7A O;  1T0F A;  2CWE A;  1J5Y A;  2R3S A;  2QEN A;  2HGC A;  1RNL A;  3P7N A;  2V79 A;  2HEO A;  1HXD A;  3I0T A;  5TJJ A;  3RYR A;  2Z33 A;  2ZFW A;  1BI1 A;  4M71 A;  1E2X A;  1K78 A;  1W7P B;  3FWE A;  1SD5 A;  2FEZ A;  2OQG A;  2PEX A;  2K4J A;  1CGP A;  2MLK A;  4LJZ F;  1FYK A;  4UNO A;  2PBI A;  3TO7 A;  3ZP5 A;  4N0B A;  2FQ3 A;  3C7J A;  4IJA A;  2STT A;  3W6J B;  3HOT A;  2VT2 A;  1BC7 C;  3V7R A;  1W4M A;  4N9H A;  5D5X B;  2FF4 A;  3F8C A;  4ZH4 F;  2F5F A;  2MA3 A;  3E6D A;  3RPU A;  3T0Y A;  3FF5 A;  4WWC A;  2VE9 A;  1KU9 A;  1F1Z A;  1L0O C;  3HIF A;  4HZF A;  2ZJ2 A;  3R6S A;  1OPC A;  1J75 A;  3TOA A;  5CJ9 A;  3C3W A;  1HKQ A;  4HF0 A;  2W84 A;  3V8J A;  2P5V A;  1J9I A;  3KET A;  3BJA A;  5CVI A;  2A07 F;  4I0A A;  3KFW X;  5CLS A;  1O3Q A;  2Q0O A;  4LG0 A;  3ZN0 A;  3WE2 A;  1FLI A;  2VOD A;  3WTU C;  2GIV A;  4LG0 B;  3TDU C;  1QPM A;  3O3K A;  4GYG A;  1P6R A;  2YX7 A;  3WTX C;  4BXU A;  4GXO A;  3KP7 A;  2VN2 A;  2EFN A;  3JAM K;  3KZY A;  1HST A;  4AD9 A;  1BBY A;  5D8K B;  3C1D A;  4BHB A;  1WI9 A;  3V7S A;  4ASN A;  2F5C A;  2DPU A;  4RAZ A;  1R1U A;  2C6Y A;  3D0S A;  4CDG A;  3HRT A;  1O7F A;  2CFX A;  2DQL A;  2V9V A;  2R7F A;  4LLG F;  4EJT A;  5DCF A;  1QBJ A;  1SFU A;  1MJB A;  4PDK A;  4EVI A;  4QLC U;  4YFN F;  2VT3 A;  4HLX A;  4L9V A;  2OU2 A;  2Z5U A;  2KJB A;  5JHU A;  1TBX A;  2M1B A;  3NQO A;  4N9I A;  4HLY A;  3SHF A;  1BM9 A;  1KQ8 A;  4RGU A;  1TNS A;  4L5I A;  2FNP A;  3ECO A;  4EGY A;  4LGW A;  2ADU A;  3QRF F;  1RI7 A;  4M9X A;  3ZMV A;  1ODD A;  3RYP A;  3ZMS A;  3J81 Z;  2ETH A;  1R7J A;  1J2X A;  2D1V A;  1Q1H A;  4HX8 A;  4RGX A;  2JRT A;  1FSE A;  4RB1 A;  3VOD A;  4FHT A;  3RIR A;  1GVJ A;  5CVU A;  3OOP A;  4GGG A;  2ISZ A;  3HSF A;  2KIF A;  2PQ8 A;  2NNN A;  5EEH A;  2FOK A;  4OOI A;  1ZG1 A;  5LGN A;  2ZKZ A;  1G6N A;  2DU9 A;  2EB7 A;  2M87 A;  2HWV A;  2K7L A;  3HRM A;  1JHF A;  3EDP A;  4EJU A;  4WX9 A;  1HKT A;  1J59 A;  1Z05 A;  1XMA A;  1QQI A;  3P9C A;  2A5Y B;  4Q5S F;  3BPV A;  4M6Y A;  1QZY A;  3M8F A;  3JW4 A;  3OV8 A;  4MHG A;  4I01 A;  5FD6 A;  1P2F A;  2LF8 A;  4ENJ A;  2YU3 A;  1T6S A;  3BWG A;  4MGR A;  4PCQ A;  4I02 A;  2VC0 A;  5ED4 A;  5DYM A;  1EV7 A;  4O6J A;  5FFZ A;  2JSC A;  3HSE A;  2RDP A;  3HTU A;  2PG4 A;  4PGH A;  1L3L A;  1G3S A;  4WK8 F;  1MJA A;  5CVV A;  1PP7 U;  5ICC A;  2IVM A;  3RI4 A;  2CG4 A;  3J80 K;  5LLQ A;  2QVO A;  4A12 A;  1ZAO A;  1I6X A;  1YG2 A;  2HQR A;  4JQF A;  4P96 A;  2HTS A;  2L01 A;  2M5W A;  3K2Z A;  1ZGJ A;  4OIP F;  5LRS A;  1FBQ A;  4E70 A;  3TKY A;  3S2W A;  1CF7 B;  3WE3 A;  2RV8 A;  2H09 A;  3QPT A;  2O03 A;  1XSD A;  2BBY A;  2B0L A;  1B59 A;  1FP2 A;  3TGN A;  3PQJ A;  3K9T A;  4P55 A;  1B9N A;  4IRG A;  5HLI A;  1KU2 A;  2DLL A;  2A69 F;  5L3F A;  1S7O A;  3V8L A;  4NHJ A;  2J5O A;  3FHZ A;  4P9F A;  3F6V A;  1KQ0 A;  2GWR A;  3GVA A;  1MGT A;  3LST A;  3DXJ F;  2RNJ A;  2P5K A;  5DCM A;  2WC2 A;  1IUY A;  3GUD A;  4UVA A;  2EFP A;  4EM1 A;  4OIO F;  2UZK A;  3M9A A;  2LDU A;  3ISP A;  2DT5 A;  5D6E A;  1OKR A;  2HDC A;  4KT5 C;  3K69 A;  3KLN A;  1U8R A;  1FC3 A;  3LA7 A;  4KIC A;  2ESN A;  4MTE A;  2OAZ A;  1TW2 A;  1STZ A;  3G73 A;  3I4P A;  2M30 A;  5D4R A;  2HZT A;  3ZMT A;  1ZLK A;  2EA4 A;  2Y0M A;  3E6C C;  2A61 A;  4EGZ A;  5HLH A;  1RIO H;  4AIK A;  3DPL C;  5JFR A;  1YW7 A;  3MWM A;  4BHP A;  3U9G A;  3EUH A;  4RB3 C;  2QBY B;  1FBS A;  4EM2 A;  2A6E F;  2OD5 A;  2CW0 F;  4HDV A;  5CVJ A;  4CYD A;  3E6B A;  1X3U A;  1HKS A;  4XSX F;  1BC8 C;  2PLY A;  3IRQ A;  2O8X A;  3ABU A;  3C18 A;  2XAS A;  5F6F A;  3DKW A;  1LEB A;  2F2E A;  2JTV A;  3DFG A;  1D8J A;  1R5H A;  1FPQ A;  5K5Q A;  2L4M A;  4PGG A;  5DD8 A;  3TQN A;  3MEX A;  1IN8 A;  1KYW A;  2ZXJ A;  4BNC A;  4Q48 A;  1DPU A;  3WGI A;  4UV8 A;  1YTY A;  2HOE A;  2ZNZ A;  5D6F A;  2EV6 A;  2O0Y A;  2Y75 A;  4RB2 C;  4ON0 A;  2O6G E;  3KLO A;  3DPT A;  2VC1 A;  2DW4 A;  5DUK A;  1UST A;  3J81 K;  1LDJ A;  2G9W A;  5LRR A;  4ZYD A;  4XRF A;  1MZB A;  4EQQ A;  3E5Q A;  5E17 F;  4UHT A;  1BIA A;  5JI6 A;  3LA3 A;  2ZCW A;  1B6A A;  3M1E A;  2LNB A;  2H6C A;  4I7H A;  2QQB A;  1BI2 A;  2XGX A;  4HA8 A;  1IRG A;  2QQA A;  4LFU A;  5KVR A;  1ULY A;  3MFK A;  4RGS A;  4U7B A;  3KEO A;  1LJ9 A;  3F8N A;  5E8I A;  4KYW A;  2ISY A;  4A6D A;  2L02 A;  2FMY A;  1R00 A;  4R79 A;  4KMF A;  2LSO A;  1EH8 A;  4NQW A;  1W7P A;  2DAO A;  5IT9 Z;  3FZV A;  5E8G A;  1A04 A;  5JR3 A;  3GLX A;  5BQT A;  1P92 A;  3MZH A;  1I27 A;  4BHC A;  3RTR A;  1R23 A;  1FX7 A;  3SXY A;  2IA0 A;  5ILU A;  1R22 A;  2D1H A;  4U88 A;  2XAF A;  3EQL F;  4A0Y A;  1XSX A;  2DPD A;  3F72 A;  1ZRF A;  4XBF A;  3VEP A;  2QLZ A;  3VOE A;  2GA2 A;  5HDG A;  4MTD A;  1Y0U A;  5A2Q K;  3KP3 A;  2BGC A;  4TV7 A;  2MC3 A;  3DEU A;  2GZW A;  1KU7 A;  1Z6R A;  1D5V A;  3WOD F;  4R8H A;  4S04 A;  2HQN A;  2W57 A;  4ZZD A;  4KUM A;  3BJ6 A;  5FFX A;  1LDD A;  3ERE D;  2QM3 A;  3F21 A;  4KIF A;  1WQ2 A;  2KJC A;  3HHG A;  4ENN A;  4BH9 A;  1BOA A;  4U7D A;  2YPR A;  5KK1 A;  2IA1 A;  5D4S A;  3V7C A;  2X4H A;  5F1R A;  1ZLJ A;  2FU4 A;  2PJP A;  2V1D A;  1UB9 A;  1QNT A;  2IRF G;  4MNU A;  2L54 A;  4L9N A;  1ON2 A;  1U78 A;  2FBK A;  1HQC A;  2JPB A;  1XGO A;  2FSW A;  2RVC A;  1UHW A;  4CO8 A;  3HUG A;  5E18 F;  1FP1 D;  1XD7 A;  2QZ8 A;  2XKP A;  3FX3 A;  2XAQ A;  3HTS B;  1IN5 A;  2DFI A;  2Z99 A;  4P9U A;  4EJV A;  5J8F A;  2D2W A;  1XB4 A;  2OBP A;  4EM0 B;  1F5T A;  2O3F A;  3BZ6 A;  4IVN A;  2ZME B;  3JSO A;  4BYY A;  2O61 A;  2EV0 A;  5FLX Z;  4LB5 A;  4A5N A;  1R36 A;  3NEU A;  4EMS A;  3I53 A;  4M9S A;  4UVC A;  5DEQ A;  4KNY A;  3KP5 A;  4WXH A;  3ZMZ A;  2H27 A;  2ZO4 A;  3ELK A;  3PFI A;  3TO9 A;  3N97 A;  4HAM A;  3BRO A;  2JT1 A;  1MJ9 A;  3BOQ A;  2P7C B;  3GZ5 A;  3BJO A;  4CZZ A;  2PMH A;  1FWZ A;  2Z9O A;  4KA4 A;  1LDK B;  1XDS A;  2VBX A;  3HHH A;  4FX0 A;  1W7P D;  2A6H F;  1XMK A;  1H9G A;  4KMU X;  5AON A;  3R0A A;  2ACJ A;  5HVQ C;  3ZQ7 A;  4KN7 X;  5L3E A;  2CQK A;  1IRF A;  3MAJ A;  1ZRE A;  3TO6 A;  5BMZ A;  3QU6 A;  2QUF A;  3GZ6 A;  4ESF A;  2BEO A;  2P8T A;  3WTS C;  2XRN A;  1MD0 A;  1JHH A;  4G9Y A;  1FT9 A;  2P7V B;  1TQI A;  3Q5F A;  2JPC A;  3EYI A;  1YO5 C;  1GXQ A;  5LEJ A;  2PN6 A;  3RPQ A;  3GO5 A;  4LK1 F;  5H6Q A;  4CHU A;  2NNY A;  3V4G A;  1XCB A;  3JTG A;  4ZYH A;  4DNC A;  4JBA A;  1JXS A;  1CF7 A;  1RZ4 A;  3WG9 A;  5FD5 A;  1FSH A;  4L5J A;  2DK8 A;  4M74 A;  3F23 A;  4AVP A;  2E7W A;  2P4W A;  2EJR A;  1O3T A;  4A0X A;  5HLG A;  4GO1 A;  2FE3 A;  1TTY A;  4IPA A;  3GF2 A;  2XUB A;  4KFC A;  1XGN A;  1BIB A;  4HF2 A;  4HOB A;  4LK0 F;  1ZRC A;  3IRR A;  2KIM A;  1SD6 A;  2P5L C;  4A5M A;  1GHC A;  4OIN F;  5A2Q Z;  3TOB A;  4L0Z B;  1J7K A;  5IT9 K;  5ICE A;  1OYI A;  4EV0 A;  4AIH A;  2ZBK A;  1OMI A;  1PDN C;  2WWY A;  3PQK A;  3HRU A;  1B9M A;  5CYV A;  3V8K A;  1HW1 A;  3WTZ A;  2UXN A;  2W25 A;  4FT8 A;  3D5L A;  2AXL A;  2V1X A;  5ILV A;  5ERI A;  2M45 A;  2K86 A;  4KIB A;  1VTN C;  1D8K A;  2ELH A;  2CGP A;  3QAH A;  3DQV C;  5L3G A;  1O3S A;  2Y48 A;  4CIC A;  1R1T A;  1HW5 A;  4KDP A;  4RGR A;  5E1W A;  1ONV A;  1U3E M;  1KA8 A;  2IPQ X;  3VFZ A;  5ILS A;  5EEG A;  4IF4 A;  2GAU A;  3ZN1 A;  2XAJ A;  2EWN A;  1UCR A;  1H0M A;  1IW7 F;  3U2R A;  1TQM A;  5DUI A;  1YS6 A;  4WXD A;  2QBY A;  3R61 A;  1HBX G;  3CUQ B;  1I1G A;  3DV8 A;  3MZY A;  4LMY A;  3GEZ A;  3T8R A;  1R58 A;  4CGZ A;  4G6D A;  1P4W A;  4OMY A;  3WTW C;  1ZRD A;  4JK1 X;  2E1C A;  3HSR A;  2PMU A;  4OIQ F;  2XIG A;  3WTT C;  5FGM A;  4OMZ A;  1EH7 A;  1FNN A;  3EET A;  2DBB A;  4GCV A;  2HR3 A;  1T98 A;  3IKV A;  3CTA A;  2P6S A;  2DI3 A;  3GWZ A;  4O3M A;  1T38 A;  1SD7 A;  5BPD A;  1RUN A;  4M73 A;  2MBF A;  1FZP B;  1QO0 D;  1YYV A;  1ON1 A;  3O6B B;  4R1H A;  2Q8K A;  4Q4Z F;  4YIF A;  2DTR A;  4Q47 A;  4GYI A;  2TDX A;  4L9T A;  5FLX K;  2RGV A;  1MDM A;  2PFB A;  3L2C A;  3R60 A;  3T8T A;  1Z91 A;  5LEK A;  4QWQ A;  4HX4 A;  1MDM B;  3QU3 A;  3H3Z A;  2MLG A;  1K7A A;  3WTV C;  2KKO A;  3I54 A;  1TLH B;  3FXQ A;  2VXZ A;  4LB6 B;  5L3C A;  3I71 A;  2W24 A;  1O3R A;  3T1B A;  1IXC A;  3ECH A;  4HBL A;  1DDN A;  5E20 A;  2NYX A;  2IP2 A;  3CLO A;  3Q9V A;  4H0E A;  3KP6 A;  4U0W A;  1K79 A;  2YSR A;  3VB2 A;  2XAG A;  5J8C A;  2XRO A;  4IXA A;  5LHG A;  2VBY A;  4OIR F;  5LGT A;  2RQP A;  3R4K A;  3FMS A;  1ZG5 A;  1YS7 A;  3RKY A;  1DP7 P;  3NRV A;  4AWX B;  2X0L A;  1XCV A;  4LLL A;  4HW0 A;  1SAX A;  5D5W B;  4ESB A;  4HQE A;  3QPH A;  1LNW A;  4XLP F;  2EK5 A;  5DDG A;  1XGS A;  1U5T A;  3E97 A;  1P4X A;  3QP6 A;  1BN5 A;  1S8N A;  3FXU A;  1H9T A;  1PP8 F;  1LEA A;  4G8X A;  1U5T B;  1KU3 A;  5HS8 A;  4MEY F;  1USS A;  2MH9 A;  4L0Y B;  4B09 A;  3IHU A;  1KYZ A;  3WGH A;  2CYY A;  2ZNY A;  2VE8 A;  2F5D A;  3BDD A;  4L18 B;  1XGM A;  3QP5 A;  4IHS A;  3B73 A;  5BOX A;  2NAZ A;  1E17 A;  1SFE A;  5BS6 A;  2CSO A;  1DPR A;  1S6L A;  2BE5 F;  3L00 A;  1IN6 A;  1G3T A;  1FBU A;  2H6B A;  1TNT A;  3KP2 A;  3KZZ A;  1O7L A;  5LHI A;  4M72 A;  1K78 B;  1B4A A;  5DV5 A;  2GXB A;  1Z7U A;  4XSZ F;  3DP7 A;  3F8M A;  3FMR A;  3COA C;  1BJA A;  5BPI A;  2XKO A;  2FML A;  4Y17 A;  2XV4 S;  2M8E A;  5L3B A;  1D3Y A;  1TQP A;  2QQ9 A;  2FA5 A;  1ZG3 A;  1IN7 A;  1IAW A;  2DK5 A;  4B8X A;  1W5T A;  2W85 A;  1U5T C;  4HQM A;  1JE8 A;  3I58 A;  5ICG A;  1S7A A;  1IN4 A;  4HF1 A;  3T5X A;  1P4A A;  3GFL A;  3ZMD A;  4A2U A;  3ZPL A;  1YW9 A;  2YR2 A;  5H6R A;  2EV5 A;  5IT3 A;  3L7W A;  4L9J A;  4FX4 A;  5HDK A;  5AIP A;  3RKX A;  5D5V B;  1YW8 A;  3I59 A;  3HOS A;  1ZGA A;  5D5U B;  3IWF A;  2GQQ A;  1ZH5 A;  2VOP A;  1V3F A;  1TW3 A;  3ROU A;  3I59 B;  3Q9S A;  4EJW A;  4S05 A;  2ZME A;  1Z1D A;  4G7Z F;  3WTY C;  4Z2Y A;  2LKP A;  3M8E A;  1RUO A;  3CO6 C;  4HV6 A;  1HSJ A;  1O57 A;  3E3V A;  4G94 A;  4I2O A;  2FNA A;  2EFW A;  1WWX A;  2YX4 A;  2HYG D;  4YG2 F;  2A68 F;  1QGP A;  4MQV A;  5TRD A;  1IZ1 A;  2GA1 A;  2E1N A;  1I5Z A;  2EFO A;  2QWW A;  3K0L A;  5F64 A;  2XHK A;  4HDU A;  1S3J A;  2FXA A;  4U0V A;  3B02 A;  5CVR A;  2HYF A;  5LHH A;  4HX7 A;  3GFI A;  2HKX A;  3MCZ A;  1WSU A;  3WU1 B;  1V4R A;  4UV9 A;  2VON A;  2EFQ A;  3U1D A;  3GFJ A;  4YII A;  1JGS A;  3RDI A;  5LGU A;  2UXX A;  1I1S A;  3I5U A;  3ZMU A;  6PAX A;  2NRA C;  2G7U A;  4IRI A;  4BAY A;  2LF7 A;  1C0W A;  5K1Y A;  1Z6T A;  1IXS B;  4OU0 A;  4RB0 A;  5K5O A;  5E1X A;  4HYE A;  2R7D A;  1OYW A;  5J6X A;  1LVA A;  2Z3Y A;  2EA2 A;  1S29 A;  4U0Y A;  1LQ1 A;  4ESJ A;  3L09 A;  4ETS A;  2BV6 A;  2STW A;  3KP4 A;  3CO7 C;  2K02 A;  2KIU A;  2P6T A;  1UHM A;  3GXO A;  1XN7 A;  1EH6 A;  2FBH A;  4HV5 A;  4UXN A;  1J0R A;  5LBQ A;  2JZY A;  4ENK A;  3L9F A;  3F22 A;  3KEQ A;  1ZHF A;  1WRJ A;  4ZYE A;  1WKM A;  1BI3 A;  2PI0 A;  3MQ0 A;  1Z9C A;  2NS0 A;  1YFH A;  3ULQ B;  2K27 A;  3E6M A;  2Q2E A;  1SMY F;  3LFK A;  3CUO A;  2RC4 A;  1NHA A;  1QZZ A;  5FB2 A;  2WTE A;  4WF2 A;  2HS5 A;  1SMT A;  2AS5 F;  2RKH A;  5HDN A;  4MEX F;  1LB2 A;  3IL2 A;  4MQ9 F;  3BP8 A;  3ABT A;  3M7G A;  4LLN A;  3W6K B;  4Y13 A;  5HS7 A;  5HS9 A;  5HOO A;  1G3Y A;  2FBI A;  1IF1 A;  3FMQ A;  5AIQ A;  3GX4 X;  3RKW A;  3IWZ A;  1U2W A;  3EYY A;  1W5S A;  2HKO A;  3JTH A;  3WU0 A;  2UWM A;  2J5P A;  3ML6 A;  1REP C;  1R1V A;  4I09 A;  2VOO A;  3LAP A;  2IT0 A;  2QYO A;  2WV0 A;  5DCM B;  3SQN A;  4O5V A;  4M6X A;  1ZN2 A;  2VBW A;  4YFX F;  4I98 B;  2OQR A;  4EJO A;  4KN4 X;  3SZP A;  1FYM A;  3CUQ A;  2V1U A;  3JAM Z;  2K4B A;  2CO5 A;  3LA2 A;  3LAJ A;  3P9K A;  3IKT A;  2VBZ A;  1SFX A;  3R0J A;  3CDH A;  5FO5 A;  3WGG A;  3JSP A;  3SZT A;  3RJP A;  2OZ6 A;  3QOP A;  4P5O A;  1BI0 A;  2L3D A;  4G7O F;  3F8F A;  2DQR A;  2KRF A;  2HTJ A;  1XSV A;  5E1Z B;  2COM A;  5JVT A;  3AAF A;  2OA4 A;  5D8L B;  1YQA A;  3F6O A;  4G7H F;  2OZU A;  5L3D A;  1G3W A;  3G3Z A;  1GXP A;  1KGS A;  4K2E A;  4YFK F;  1SD4 A;  2V6C A;  3REO A;  3SFZ A;  3FXR A;  1PUE E;  4RS8 A;  4WXC A;  4M9Z A;  4D0P A;  3HRS A;  4A0Z A;  3LWF A;  2ESH A;  1U6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...