4KA4A

Crystal structure of a proteolytically defined zbeta domain of human dai (zbp1, dlm-1)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
FSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Z-DNA-binding protein 1
publication title Crystal structure of a proteolytically defined Zbeta domain of human DAI (ZBP1, DLM-1)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 18
structure length 61
sequence length 61
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2013-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ka4A00
2VE9A 3ECHA 5LLQA 1FC3A 2L3DA 2UXNA 2EV0A 4RGXA 1R1TA 2OZUA 1CF7A 2IJLA 1HW1A 3L7WA 1LEBA 1BC7C 4ESJA 1GHCA 2OD5A 3MZYA 3BPXA 2VT3A 3DV8A 2JSCA 4G7ZF 1OYWA 2ELHA 1XB4A 1XSDA 2NAZA 1T38A 1QZYA 3C18A 3REOA 4I2OA 5JHUA 1ZARA 3BROA 3E3VA 1E17A 2PFBA 2MBFA 1NHAA 1S7AA 2V1XA 4TV7A 3T0YA 4OIRF 1VTNC 3W6KB 1FYKA 2J5PA 2Q8KA 3ML6A 3CUQC 5LGNA 1JGSA 1UHWA 4HQEA 1KQ8A 4KUMA 3KP6A 2XAFA 2PMHA 2BBYA 4LLLA 5BQTA 5CLSA 1BJAA 5ED4A 2HS5A 5FB2A 3HSRA 4P5OA 3J81K 1Z7UA 4YFXF 2IA2A 2BV6A 3PQKA 1FBQA 5L3DA 1BI2A 1ZH5A 3GW2A 4KT5C 3E97A 2CQKA 3V8JA 3R6SA 4UNOA 1O7LA 1BM9A 4O6JA 2IP2A 2K4JA 3HTSB 4N9IA 1EH6A 3HYIA 2EFNA 1RNLA 2RVCA 4LMYA 5HLHA 3ZN1A 3SZTA 4Q5SF 2R3SA 2IPQX 3RDIA 3ZMZA 2EFQA 1G3WA 2EK5A 3F8FA 3F22A 3KP7A 2XUBA 2DBBA 1HKQA 2XIGA 2L02A 4WXHA 5D4RA 2K4BA 2PQ8A 2DTRA 5D8LB 2V6CA 1IN7A 2KIUA 4PCQA 4DQ2A 2ACJA 1S8NA 4WX9A 4EV0A 2XHKA 2L01A 3RKXA 1HSTA 4CHUA 1XD7A 3G73A 1TQMA 2EWNA 4A0YA 3D5LA 2FNAA 3VOEA 2QLZA 2ZJ2A 4R79A 2ZNYA 4AIHA 1MGTA 3IC7A 4LB6B 4HOBA 3WTXC 2W25A 4RS8A 4G7HF 3DEUA 2LNBA 5ICFA 3VEPA 2HR3A 2KJBA 4JQFA 2VONA 2B0LA 5JR3A 1B9MA 1T0FA 4O3MA 4I0BA 5DCFA 3GWZA 4R1HA 1W4MA 5E8GA 1UHMA 4IRIA 1BIAA 4HW0A 5K1YA 4P96A 4EM0B 3V7CA 1K7AA 2H27A 4G94A 2HTSA 4OIQF 2EFPA 2DFIA 5LGUA 5BOXA 3DKWA 3GEZA 2BGCA 4I09A 4HX4A 2GXBA 2NYXA 3CDHA 1YO5C 1YQAA 3ZMTA 1LDKB 2JRTA 2DQLA 3RKWA 3LWFA 1RIOH 1CGPA 4IRGA 4HV6A 1O3QA 2CFXA 3ZN0A 5ERIA 4UVAA 3DPTA 2MLGA 4L0YB 1P92A 5HS7A 2ZMEA 2M1BA 2XROA 2UWMA 3DFGA 4G6DA 1J9IA 1R1VA 4A5NA 3FMRA 2HYGD 4N0BA 5D4SA 3JAMK 4HBLA 4EGZA 3HSEA 1L0OC 4B8XA 4ESBA 2K27A 1KU9A 4CICA 4NB5A 1SD5A 5D6EA 2Q2EA 2FU4A 6PAXA 1FBSA 3JW4A 4HX7A 5J8FA 1O7FA 5EEGA 3ISPA 4MTDA 4M73A 1P4AA 3IWFA 2M8EA 1OMIA 1BOAA 5FO5A 2JPBA 1AWCA 1Z91A 3GFIA 3T5XA 2DAOA 5LHHA 1ZG1A 3KE2A 3P7NA 3MZHA 4JK1X 2FMYA 2R7FA 2HQNA 4R8HA 1B4AA 3ZQ7A 1XCVA 3MQ0A 3LQRA 2RGVA 2XAHA 3E5QA 3JSOA 1BC8C 2VE8A 4KA4A 2DW4A 5HOOA 4FHTA 1O3TA 2STTA 2ISYA 3SFZA 2MLKA 4OOIA 5JFRA 4KN7X 3FM3A 2RKHA 3R4KA 3SZPA 1BI0A 2JZYA 5JVTA 3M8FA 5AIPA 4AIKA 2ZKZA 4RGSA 2P5KA 5ICCA 1TW2A 1AOYA 5LRSA 1FY7A 4WCGA 2HZTA 4KN4X 5HS8A 4M9XA 4L5JA 1IRFA 1KYWA 1S29A 3DF8A 2X4HA 2YX7A 4RAZA 1HXDA 3G3ZA 3M7GA 3GYHX 1XN7A 2NS0A 3V8KA 4CO8A 3DQVC 3H3UA 1RZ4A 1XSVA 4U7DA 1TTYA 4BH9A 1IN4A 2WV0A 4HF1A 2E1NA 3WTVC 1SD7A 4L0ZB 3L2CA 4L9JA 1MDMB 4CGZA 1U5TB 1DUXC 3WTUC 3CO7C 3F6VA 3TO6A 4EJOA 3FX3A 5BPIA 2Z99A 1U2WA 3QP5A 4HQMA 4GYIA 3EQLF 1SD6A 2C6YA 1L3LA 1I1SA 5E1WA 3JTHA 5AIQA 2P8TA 3I54A 3RYRA 2QZ8A 1HKTA 5DDGA 2XGXA 3KZYA 3O6BB 4K2EA 2ISZA 2WWYA 1PDNC 1FX7A 5J8CA 3ROUA 4YFNF 3EDPA 3HRMA 4RGUA 4U0YA 2D45A 4RGRA 2A6HF 4I98B 3TDUC 3ERED 2VBYA 4BHBA 5BPDA 3GX4X 1K78A 1K79A 1GVJA 5D5WB 2A69F 4OIPF 3F8NA 1IXSB 5E1XA 3K2ZA 4KIFA 4Q48A 2XRNA 3NQOA 3FXUA 1P4WA 1B6AA 5LEJA 1MDMA 1XMKA 3K1PA 2F2EA 3MEXA 2PG4A 3ABTA 2F5FA 2DPUA 3BY6A 3C1DA 1R5HA 3RJPA 1UCRA 2W57A 2EV5A 3LSTA 3TOAA 2FF4A 1MJAA 2F5EA 3JTGA 2NNNA 2YSRA 2P7CB 2FA5A 4LFUA 5EEHA 2RQPA 4ENMA 2LSOA 3F8MA 2XV4S 3M1EA 1JHHA 2Z33A 3ZMSA 4ESFA 3FXQA 2VOPA 3I64A 1Z05A 3DXJF 4BHPA 1SMTA 1FBUA 3RI4A 1GXPA 4UV8A 4PGHA 3WTTC 1DPRA 5E1ZB 1STZA 1Y0UA 3MWMA 2BEOA 3E5XA 1E2XA 4A6DA 3FMSA 1BI1A 1U5TC 1QO0D 4ZYDA 1UB9A 2GA2A 1QZZA 1C0WA 1R1UA 3QU6A 2MA3A 4UHTA 3WTWC 1ZGJA 4KNYA 1LJ9A 2L54A 3QPTA 3MAJA 1TNSA 2BE5F 2V1UA 3RPQA 5IT9K 3CTAA 4LLGF 1LNWA 1YS6A 1TW3A 4KICA 4IRHA 4ZYEA 1A04A 2CO5A 2XAGA 1DP7P 4EQQA 3WTSC 1BN5A 1SD4A 3J80Z 1J2XA 3JSPA 4Q4ZF 1IW7F 3BJOA 2ZXJA 1FSHA 2K7LA 1I6XA 1ZLKA 1Z6TA 3U2RA 3HTUA 2R7DA 1FYLA 3KLNA 3ULQB 5H20A 3HUGA 2LDUA 5F64A 5KVRA 4LGWA 1TLHB 1FOKA 3DPLC 5H6RA 3BZ6A 3B73A 2G9WA 1W7PD 3QOPA 4EJVA 3J81Z 5FFXA 5ICEA 4CYDA 2VXZA 4OMZA 5FLXK 2Q0OA 4IHSA 3HHGA 2V79A 2A3SA 2J5OA 4IHTA 4WK8F 2HKXA 5L3CA 1G6NA 3WU0A 3WGIA 3F6OA 4ZZDA 3LA7A 2LF8A 3F21A 4MQVA 2EA2A 1ZRCA 3NRVA 5HLIA 2Z5UA 5FFZA 3GF2A 2OAZA 3TKYA 3CLOA 1W7PB 3QU3A 4ENNA 3P9CA 4XSXF 1MJ9A 4KIBA 3E6DA 4I0AA 1IZ1A 3F23A 1G3SA 4HAMA 5J6XA 1XGMA 4WF2A 1SFUA 1S3JA 1KA8A 5CVIA 5ICGA 1KQ9A 2L4AA 1XDSA 2P5LC 3CO6C 5A2QK 2AS5F 5LEKA 4Q47A 1XGNA 3I59A 2M30A 1IXCA 2WTEA 3EYYA 1TNTA 2D2WA 3SHFA 3FMQA 1XDUA 3FWEA 2GA1A 4ZYGA 2VBWA 1YLFA 1W7PA 2ZMEB 3KP3A 1D8KA 3V7RA 4M71A 3F8CA 3Q9SA 1R36A 1EH7A 3V8LA 2H94A 4HLXA 3PFIA 4U0WA 3IWZA 1T39A 2ADUA 2HQRA 4IF4A 3FM5A 1IN8A 5LGTA 1LDJA 1IAWA 5L3GA 4A5MA 2STWA 4RAYA 4M72A 4MNUA 1IXRC 4HLYA 1WQ2A 3OV8A 2HOEA 5K5OA 2NNYA 4G6QA 3BPVA 1JHFA 2P6TA 3GO5A 1ON2A 3EUHA 1RI7A 2YU3A 2ESHA 3P9IA 3KFWX 1D5VA 1R23A 2A07F 3WG9A 4AVPA 4ASNA 3CUOA 2XKPA 3JAMZ 2V1DA 4EM2A 3J7AO 5FD5A 4P9UA 4U7BA 4LB5A 5BMZA 1WRJA 2FNPA 3H3ZA 4OINF 3MFKA 1F1ZA 2O03A 3N97A 3KP4A 2E1CA 2LKPA 1U8RA 1I5ZA 4QLCU 3F3XA 1U6GA 3WTYC 3SQNA 2G7HA 4QWQA 4RB2C 4DNCA 4PDKA 2FBHA 1YIOA 2CYYA 2VODA 3LAJA 1FLIA 2DLLA 4HZFA 3E6MA 1ZYRF 3HRSA 1HW2A 1FP1D 2CW0F 1YTYA 2PJPA 1V4RA 1KGSA 1T2KA 3R0JA 3FZVA 1B9NA 3GFJA 4KFCA 2HGCA 2W84A 3R61A 2HYFA 1UFMA 1YW8A 4LJZF 1IF1A 2M5WA 4OIOF 1P4XA 3VB2A 3KZZA 5ILSA 1JXSA 4N9HA 4AWXB 3NEUA 1YS7A 1YYVA 3O2PE 4RB3C 1SMYF 4YG2F 2IA0A 5HVQC 2MH2A 2ESNA 3TO7A 2VOOA 3ECOA 4NQWA 3HOTA 1R5GA 3FF5A 3E6CC 2MH9A 2P4WA 5LBQA 4B09A 3SXYA 1QQIA 4BQAA 4ZYHA 2F5CA 4FT8A 1S7OA 1K78B 2IT0A 2GIVA 1RUOA 1H9TA 2RDPA 2DPDA 2P5VA 4EJUA 1G4DA 3I58A 1R22A 1ZLJA 2JTVA 4GYGA 4LD5A 2CG4A 1OPCA 3R60A 1MD0A 1TQPA 5H6QA 4CDGA 1FZPB 1J5YA 4UXNA 4WXDA 1J59A 1FT9A 4LK0F 3ZMDA 1T6SA 3WGHA 3WE2A 4M6YA 1KU2A 3VFZA 3RTRA 3TOBA 4IVNA 1EV7A 2XAJA 1PUEE 3ZPLA 5DCMB 4KIGA 4XRFA 4CZZA 5AONA 3BOQA 2OA4A 2FRHA 2RNJA 1USTA 1QGPA 4ENJA 1WI9A 4M74A 5E18F 2O61A 1OKRA 1W5SA 2ZBKA 2IW5A 2PN6A 3L09A 5LHIA 1B59A 1MZBA 1X3UA 3I71A 2UXXA 4HA8A 4UVBA 3KCCA 2O6GE 1W5TA 2IRFG 1BIBA 4BNCA 4G7OF 2HEOA 2QENA 1SFEA 3BWGA 3IRRA 2DU9A 4WXCA 2W24A 3KLOA 1ON1A 2PMUA 4L18B 4L5IA 1Q1HA 1EH8A 2QQAA 4IPAA 5FGMA 3GFLA 3CJNA 4EJWA 2ZFWA 5K5QA 5DCMA 1ODDA 2XKOA 3E6BA 2FEZA 3KEQA 4FX4A 2Y0MA 3OOPA 2FBKA 1XSXA 2HTJA 2RN7A 2KKOA 2HWVA 1O3RA 2X0LA 4HYEA 3T8TA 3ZMUA 2DQRA 3K69A 1REPC 5E8IA 2FSWA 2DT5A 2CWEA 5HLGA 2O0YA 2UZKA 2MD5A 5HDKA 3CUQA 1KU3A 4OMYA 3HSFA 5IT9Z 4HF2A 5DEQA 1FYMA 4L9TA 3IKTA 1HSJA 1Z9CA 4ZH4F 3U1DA 1P6RA 1WSUA 1KYZA 3MCZA 3GFMA 5TJJA 1HQCA 4KYWA 4UUVA 1H0MA 4O5VA 1J75A 1IN5A 5DD8A 4JBAA 1DPUA 2KRFA 4L9NA 3B02A 3HRTA 3I0TA 3O3KA 2VT2A 3J80K 2IVMA 5E20A 2EA4A 2QQ9A 2VBXA 2DK8A 2AXLA 5BS6A 3WGGA 4OU0A 3LA3A 4PZJA 4A6EA 5D5VB 3K1MA 4L9VA 3BP8A 5HDGA 1GXQA 3V7SA 5FLXZ 5D5UB 5DV5A 4G8XA 3I59B 1O57A 1ULYA 1BI3A 3KEOA 1K6OA 4EVIA 1B1BA 4S05A 1DDNA 2Z9OA 5L3BA 2E7WA 4NHJA 2DO7A 5CJ9A 1IUYA 2NRAC 5TRDA 2FOKA 1G3TA 1LEAA 3I53A 5KK1A 1XMAA 4I02A 4EJTA 4GO1A 2PEXA 2PBIA 3FHZA 1JE8A 3DP7A 4KDPA 4G9YA 2VBZA 5DD4A 4ETSA 3BJAA 4BYYA 1FPQA 1BBYA 5DUKA 4HDVA 1QPMA 2EB7A 3QRFF 2IA1A 4WWCA 3TGNA 1ZN2A 1HW5A 2XASA 4RB1A 1YG2A 4M6XA 2H6BA 1RUNA 5A2QZ 2ZNZA 3L9FA 4Y13A 1LB2A 1OR7A 3LA2A 3IHUA 2M87A 3BDDA 4RB0A 4HV5A 3H92A 2CGPA 4Y15A 1S6LA 3TQNA 4MQ9F 4UVCA 3V4GA 1Z1DA 3C7JA 3M9AA 4MEYF 2QBYB 1WKMA 2EJRA 3I4PA 1XGSA 4BHCA 4GXOA 3COAC 3T1BA 2OU2A 4EMSA 3GLXA 3N4MA 1IN6A 4XSZF 3GZ6A 5F1RA 5D5XB 2OQRA 3K0LA 2ETHA 3IKVA 3S2WA 1FSEA 2F5DA 4IXAA 1IRGA 4MHGA 2COMA 2FXAA 1D3YA 5ILUA 4MGRA 4A12A 3FXRA 3U9GA 1FNNA 1HBXG 4IJAA 2EFOA 4FX0A 4U88A 2JT1A 1FP2A 1KQ0A 4EM1A 1ZG5A 4A0ZA 3HIFA 3QPHA 4D0PA 2V9VA 3K1NA 4HDUA 4KMUX 4UV9A 4YIIA 4M9ZA 4ON0A 5JI6A 4A0XA 1XCBA 2QBYA 1LQ1A 2A68F 2WC2A 5HDNA 2MC3A 1MKMA 1QNTA 2HFHA 3ABUA 3D0SA 1QBJA 5CYVA 3KP2A 2G7UA 2L4MA 3R0AA 2GQQA 2QYOA 2HDCA 3Q5FA 5L3FA 3IRQA 3E5UA 1LVAA 1PP8F 1USSA 5LHGA 3F72A 2OZ6A 1R58A 2OQGA 2QWWA 1O3SA 3LFKA 1T98A 2GXGA 3ZP5A 3IL2A 5D6FA 4E70A 1R7JA 1I1GA 5LRRA 2QQBA 3Q9VA 3GUDA 3LAPA 3HOSA 2QVOA 2D1HA 1WWXA 3BJ6A 1YW9A 2JPCA 3WU1B 2O8XA 3QAHA 4XLPF 5F6FA 1SFXA 1ZAOA 1ZHFA 3ELKA 4ZZLA 4M9SA 2OBPA 2KJCA 4I01A 1U3EM 3K9TA 2KIMA 3RYPA 2O3FA 2RC4A 2LF7A 2RV8A 3KP5A 4F7ZA 2VC0A 1YFHA 1ZGAA 2CSOA 1LDDA 2VC1A 5E17F 2EV6A 3GZ5A 1V3FA 3LQQA 2Y48A 2BYVE 2TDXA 3ZMVA 2PLYA 2ZCWA 5DYMA 3EETA 4AIJA 2FE3A 3PQJA 5DUIA 4ENKA 2PI0A 5CVJA 4P55A 2DK5A 4MTEA 4AD9A 4HF0A 4LLNA 2XVCA 3C3WA 4U0VA 5FD6A 2H09A 2D1VA 3RIRA 4H0EA 3EYIA 3M8EA 1HKSA 3GVAA 2DI3A 3RKYA 1ONVA 1YW7A 2FBIA 4P9FA 5L3EA 2HKOA 3RPUA 5IT3A 1P2FA 4Z2YA 4KMFA 1TBXA 1TQIA 1J0RA 1ZREA 1R00A 3HRUA 1ZRFA 2FMLA 4GGGA 4MEXF 3W6JB 2QUFA 1ZG3A 3F8BA 4A2UA 1MJBA 1ZRDA 4Y17A 1U78A 2GWRA 4PGGA 2KIFA 2P7VB 4CXFA 2E7XA 2H6CA 2GZWA 4LG0B 1F9NA 2YPRA 2ZO4A 1F5TA 4BAYA 2YX4A 3QP6A 1PP7U 2K86A 2A5YB 1Z6RA 4BXUA 1I27A 4YFKF 2A6EF 2P6SA 4EGYA 3VODA 1CF7B 3WE3A 1F4KA 1KU7A 1H9GA 2EFWA 5CVVA 5ILVA 2A61A 2Y75A 3CUQB 4S04A 1U5TA 4XBFA 3AAFA 4I7HA 2M45A 2FQ3A 2XAQA 2YR2A 1XGOA 1G3YA 2Z3YA 4HX8A 5CVUA 3KETA 2QM3A 4XLNF 4GCVA 1D8JA 5D8KB 3WODF 2W85A 1SAXA 5HS9A 3P9KA 4YIFA 1J7KA 3TDZC 3HHHA 2GAUA 3GXOA 5CVRA 3WTZA 1OYIA 1OYYA 2VN2A 4LK1F 4LG0A 2K02A 3L00A 3I5UA 1FWZA 3T8RA 5K5RA 3TO9A
chains in the Genus database with same CATH superfamily
3HM5A 2VE9A 3ECHA 5LLQA 3QPLA 1QA6A 1FC3A 2L3DA 2DMNA 2UXNA 2EV0A 3A1YA 4A3GJ 4RGXA 1R1TA 2OZUA 3ZOBA 3KEYA 1AU7A 1CF7A 2IJLA 1PYVA 1HW1A 3FKIJ 2W00A 1K61A 3D5SC 2ZFUA 3L7WA 3Q3SA 3JRIA 1LEBA 3H0GJ 4A3LJ 5B1AH 4RLQA 1S72I 3PM1A 4ESJA 1BC7C 2MW8A 1GHCA 3BZCA 4XQFA 3HBLA 2OD5A 2L7FP 2IGOA 4V19K 4A93J 3MZYA 2HPIA 3MMYB 1B72B 4RBOA 1QZEA 3BPXA 4DJAA 1VQ9I 2VT3A 3DV8A 3FXOA 2JSCA 1V54H 3GTPJ 4G7ZF 2E19A 1RPWA 2L5QA 3VPRA 1OYWA 3VDXA 2ELHA 4XLCA 5EG0B 1XB4A 1XSDA 1W36C 4C2MJ 5F0CA 4CUGA 4QIWN 2NAZA 2ZJPF 1T38A 1BW5A 2M4GA 2LRDA 1QZYA 3C18A 3REOA 2FD5A 4YIRX 4ZTFA 3SYTA 4I2OA 5JHUA 4D7MA 3MZ8A 1ZARA 3BROA 3E3VA 5DM7F 1E17A 2PFBA 1MSFC 2KHMA 2K3FA 2MBFA 1BOBA 1NHAA 1S7AA 2V1XA 1OCZH 4PJ0C 4TV7A 1SC7A 3T0YA 1XTAA 4OIRF 1VTNC 1WJAA 2BY0A 3H5RA 3W6KB 1KONA 3RCOA 5EYRA 4C2TA 1FYKA 4BDYA 2Y9ZA 2YUSA 2E36A 5J47A 1ZELA 3H5NA 2EBIA 2VJJA 3OSGA 2J5PA 2CW8A 2Q8KA 5GAGJ 3ML6A 3CUQC 5LGNA 1JGSA 1UHWA 4HQEA 1F43A 2MABA 1KQ8A 4KUMA 3KP6A 1ETKA 2XAFA 2IBDA 2PMHA 2ME6A 2X6WA 2BBYA 4LLLA 5BQTA 3WU2C 3J7YJ 3H9GA 5CLSA 1BJAA 2RNGA 2IS6A 1IC8A 4AIDA 3JRDA 4YELA 5ED4A 1B72A 2HS5A 3CC7I 5FB2A 3HSRA 4P5OA 5GADJ 1P7JA 4IZZA 3J81K 1Z7UA 4YFXF 2IA2A 4XM3A 2BV6A 3PQKA 3PNVA 2DTZA 2Z2SB 1VNDA 2KZVA 1FBQA 5L3DA 1BI2A 1T33A 1ZH5A 2DA2A 3GW2A 4KT5C 3E97A 2CQKA 2K85A 3A01B 3IH4A 3V8JA 2VQGA 3R6SA 4UNOA 4XN3A 1O7LA 2DFFA 1BM9A 2X1DA 4UUTA 4CCLA 2L7ZA 4O6JA 2IP2A 2K4JA 2L7MP 3MKZA 3HTSB 4N9IA 2QCOA 4RDUA 2B63J 1XS9A 1EH6A 3HYIA 2DODA 2EFNA 3A0BC 3EPZA 1RNLA 2RVCA 3H36A 4LMYA 5HLHA 3ZN1A 4RM2A 3SZTA 1BR2A 1Y8QB 4B3AA 4Q5SF 4PFOA 1OCCH 2R3SA 3TMOA 2DT6A 2IPQX 3RDIA 3ZMZA 5DM6F 2EFQA 1G3WA 2EK5A 3F8FA 3F22A 1SFOJ 2QKLB 3KP7A 2XUBA 2XIGA 1BW6A 1HKQA 2DBBA 2DOEA 2L02A 4WXHA 2B9SA 2AO9A 5D4RA 2K4BA 2JMWA 2PQ8A 2DTRA 5D8LB 2V6CA 2KRCA 1IN7A 2F6CA 2KIUA 4PCQA 1Z0XA 4DQ2A 2ACJA 1S8NA 5M5YJ 3AG4H 1K4TA 2ID3A 4WX9A 4EV0A 5EEAA 1HF0A 2XHKA 2L01A 3G1MA 2KDOA 3RKXA 1HSTA 4CHUA 1XD7A 3CF5F 3TBIA 4A69C 4DZPA 3G73A 1TQMA 4BQOA 3OS2A 2EWNA 4CYCB 4A0YA 3SDBA 5M5WJ 1JTYA 3H9QA 4BXXJ 3D5LA 2FNAA 1VQOI 2VL8A 3VOEA 4A3CJ 1XX5A 2OJED 2Y30A 2BZTA 2V4JC 3A2KA 3PNYA 1PUFB 2QLZA 2ZJ2A 4UY8I 4R79A 2ZNYA 4AIHA 1MGTA 3IC7A 4LB6B 4HOBA 4A3EJ 3WTXC 5FKOA 2W25A 4RS8A 4G7HF 3DEUA 2LNBA 5ICFA 4J01A 3VEPA 2HR3A 2KJBA 4JQFA 2VONA 4CCMA 4PJNA 2B0LA 3K7AJ 1F36A 1FOXA 5JR3A 4BUPA 1B9MA 2ZXWH 1T0FA 4O3MA 2DA1A 4I0BA 5DCFA 3BLYA 1Y6IA 4E7LA 2N8GA 3GWZA 5IYBJ 4R1HA 5FRNA 3AG3H 2W7NA 1W4MA 5E8GA 1LPQA 1UHMA 4IRIA 1TC3C 1ITYA 1BIAA 3WG7H 4HW0A 3DTIA 5K1YA 4P96A 4EM0B 3V7CA 1W1WE 2M2EA 3CD6I 3EUAA 2DA4A 1K7AA 1WH7A 1OR7C 2H27A 4G94A 3KPHA 2HTSA 4OIQF 2EFPA 5JLWA 4CYCA 3L2UA 2DFIA 5LGUA 2E34A 5BOXA 3DKWA 3GEZA 2BGCA 4I09A 5TGTA 4HX4A 2Q2EB 2GXBA 2NYXA 3CDHA 1YO5C 4XOTA 3S3MA 1OFCX 1YQAA 4X6AJ 1X19A 2PJRA 2BY3A 1PUFA 3ZMTA 1LDKB 2JVHA 3K4CA 5KAIC 2ECBA 2CU7A 2JRTA 2DQLA 3RKWA 3LWFA 1RIOH 3AL0C 1UG0A 3NARA 3PUBA 1CGPA 4IRGA 1Z67A 4HV6A 1O3QA 2CFXA 3ZN0A 5ERIA 4FQGA 2GOMA 4UVAA 3DPTA 1WVRA 2LY2A 3W2AA 3M1CA 2MLGA 4L0YB 1FMVA 1P92A 2KP6A 5HS7A 3BG7A 4HG2A 2ZMEA 2M1BA 2XROA 2KZGA 2UWMA 1JKOC 3DFGA 4G6DA 1J9IA 1R1VA 2MC4A 5FROA 4UUSB 1LUJB 4A5NA 3FMRA 2HYGD 3BTCA 4N0BA 2E71A 9ANTA 2L2OA 4HSRA 5D4SA 1X4OA 3PFYA 4LOCA 2VXDA 3JAMK 1VQ5I 2WAFA 2R7TA 4HBLA 4EGZA 5GP9A 3BR1A 3HSEA 2EINH 1L0OC 4B8XA 4ESBA 2R7VA 4W97A 4V2GA 2K27A 2R7RA 1A35A 3MKYB 1KU9A 4CICA 3UKGA 2BW3B 4NB5A 2OUMA 3DTEA 2X6OA 1SD5A 5D6EA 2Q2EA 2JA5J 2FU4A 6PAXA 2YU9J 1FBSA 4A3JJ 3JW4A 4HX7A 5K7FA 5J8FA 1O7FA 2WADA 5EEGA 2O7OA 3ISPA 4ZJZA 4MTDA 3IP4B 4M73A 3A03A 1P4AA 3IWFA 4H4KC 1GVDA 2NVTJ 2XC7A 4IHVA 1Y1WJ 2M8EA 4AUXA 2HZDA 1OMIA 1BOAA 5FO5A 4M3BA 4B3XA 4XICA 3SEQA 4BKXA 3DPUA 3PUFA 4F93B 1CQTA 2JPBA 1AWCA 2DYSH 1Z91A 1Q1VA 4E7SA 2UUZA 4F55A 3GFIA 5FKNA 1U9NA 1TZLA 3T5XA 2DMTA 2DAOA 5LHHA 5B5EC 1ZG1A 3KE2A 3P7NA 2X6XA 4IO9F 3MZHA 4JK1X 4CH7A 2FMYA 2R7FA 1RKWA 2HQNA 3O8GA 4B48A 2M0CA 3FKJA 4R8HA 1B4AA 3ZQ7A 1ETXA 1U9OA 1XCVA 2CUJA 2Y31A 3MQ0A 3CDLA 3LQRA 2RGVA 2XAHA 3E5QA 3JSOA 1YHQI 1BC8C 4CSWA 2VE8A 1VQLI 4KA4A 2DW4A 5HOOA 4FHTA 1O3TA 2STTA 1WHUA 2R92J 3OWTA 2ISYA 3SFZA 4DBQA 1GUUA 2MLKA 4OOIA 5JFRA 2BW3A 4KN7X 2F4OB 4I6ZA 3FM3A 3G1LA 5CQEA 1YIJI 2RKHA 2BXYA 3R4KA 2EZKA 3K10A 3SZPA 1BI0A 2JZYA 5JVTA 3CMYA 3S3NA 3M8FA 1S9HA 5AIPA 5C4JJ 4AIKA 3CCYA 3TW7A 2ZKZA 3MD2A 4RGSA 1WPKA 1HDPA 2P5KA 5ICCA 1TW2A 3S32A 1AOYA 5KCMA 5LRSA 3BCBA 1FY7A 5F27A 2HDWA 3OYLA 2LY1A 1W0TA 4WCGA 2HZTA 4KN4X 5HS8A 3S14J 4M9XA 4L5JA 1IRFA 1KYWA 3GBGA 1S29A 3DF8A 2X4HA 5J1RA 2YX7A 4RAZA 1HXDA 3G3ZA 2P81A 2OV7A 3IAS2 2WY8Q 4D7NA 5F0HA 4RAFA 3M7GA 4RM3A 1TT0A 2VJ4A 3JR9A 2H1KA 3GYHX 4CCKA 1XN7A 3HGYA 2LP0A 2M7BA 2NS0A 3HPHA 3CP8A 2RQQA 2KT0A 3DQVC 3V8KA 4B44A 4CO8A 3H3UA 1OCTC 3PSIA 4X1EA 1ERDA 2XGEA 4XL9A 4UB6C 1RZ4A 3OSFA 3HDDA 4EEFG 1OCPA 1XSVA 3BR3A 2EQRA 4U7DA 1TTYA 1FOWA 4BH9A 1IN4A 1NG6A 3QOEA 2WV0A 4HF1A 2Z16A 2JUCA 2E1NA 3WTVC 2DXIA 1SD7A 4L0ZB 3L2CA 3OIPA 4L9JA 1YX5A 1MDMB 4CGZA 3LSMA 1U5TB 1DUXC 3WTUC 2JRMA 3CO7C 2JWTA 3F6VA 3TO6A 4EJOA 2NXNB 1D0XA 1W36D 3FX3A 5BPIA 3GMEA 2Z99A 1U2WA 3QP5A 4HQMA 3VYTB 4GYIA 3EQLF 1S5LC 1SD6A 2X9DA 1L3LA 2C6YA 4Y7NJ 1QRYA 4L5EA 2KPMA 1I1SA 5E1WA 2E2JJ 3JTHA 5AIQA 2P8TA 3I54A 2M9HA 5J3LA 3RYRA 2QZ8A 1HKTA 3PL8A 5DDGA 2XGXA 3ZQQA 3HOXJ 1VZ0A 3KZYA 1UG2A 4ABZA 3O6BB 1FMWA 4K2EA 5C3EJ 3C2GA 3H9JA 2ISZA 2WWYA 3OYCA 4A3FJ 1XC5A 1PDNC 3ZQCA 1DP3A 4F92B 1FX7A 5J8CA 1X58A 4G6TB 2XRLA 3ROUA 4YFNF 3EDPA 3HRMA 4RGUA 4U0YA 4LIVA 2D45A 2X6YA 1IDZA 2QSFX 2VUMJ 3OIQA 2A6HF 4RGRA 4I98B 3K70C 4CCOA 3TDUC 3ERED 2VBYA 4BHBA 2F4MB 5BPDA 3GX4X 4KJZA 3BR5A 1K78A 2LKXA 4A3KJ 2IS1A 1K79A 1GVJA 2DMQA 3HGGA 5D5WB 2A69F 4OIPF 3F8NA 1IXSB 1G59A 3DWLE 3K2ZA 5E1XA 3BT9A 3CESA 4F52A 4KIFA 4C3HJ 4Q48A 4OWRB 4RAGA 2XRNA 3NQOA 3FXUA 1P4WA 3ZQGA 3KYLA 1HDDC 1NTCA 1B6AA 5LEJA 5HNFA 2WAEA 1MDMA 1XMKA 3K1PA 2HDDA 2F2EA 1I3AA 3MEXA 2PG4A 3ABTA 1X3WB 2F5FA 2LFBA 2VJ5A 2DPUA 3BY6A 3C1DA 1I3QJ 1R5HA 3AFHA 3JRFA 3RJPA 1UCRA 2HVRA 2W57A 3LMMA 2EV5A 3LSTA 3TOAA 1QU3A 2HNHA 4BJ5C 2FF4A 1MJAA 3SFIA 2F5EA 4PSXA 3CCLI 3I3LA 3MKLA 3JTGA 3OYAA 2NNNA 2YSRA 1K4SA 2P7CB 2FA5A 4LFUA 5EEHA 2RQPA 4XKCA 4ENMA 2LSOA 4BBRJ 4BJ6C 3F8MA 2XV4S 4PJMA 3M1EA 3ZQHA 1ACIA 1LFPA 1JHHA 3HOZJ 2Z33A 2QGUA 3ZMSA 4ESFA 3LL7A 3FXQA 2VOPA 3I64A 1Z05A 3DXJF 4W1UA 3H1CA 1JT0A 4BHPA 1SMTA 1FBUA 2IEKA 4C3IJ 1RETA 1MMGA 2ME0A 3RI4A 2AHQA 1GXPA 2X51A 1E3OC 4UV8A 4PGHA 3CJRB 1DPRA 3WTTC 1MSEC 5E1ZB 5C44J 1POGA 4E6KG 1STZA 2I8DA 3AG1H 1Y0UA 3MWMA 2BEOA 3E5XA 1E2XA 4A6DA 3FMSA 1BI1A 3DLAA 4LIUA 1U5TC 1BR1A 2R93J 1VQNI 3H0DA 1YJ9I 1QO0D 4ZYDA 1UB9A 2GA2A 2Z1DA 3M3YJ 1QZZA 3OOUA 1C0WA 1R1UA 3VYSB 3GTQJ 3QU6A 2MA3A 4UHTA 1JJ6C 4U87A 3HUGB 2WBMA 4JYKA 3VSKA 2LR8A 3WTWC 1ZGJA 1MMNA 4KNYA 1LJ9A 2L54A 3B6CA 1R4MB 3QPTA 3OYJA 2R5YA 1X2NA 3MAJA 4JOMA 3S3OA 1TNSA 2BE5F 2ECCA 1VF9A 4YEJA 2V1UA 3RPQA 5IT9K 2QKMB 3CTAA 4LLGF 4LITA 4XORA 2CUZA 4IQJA 4Y52J 3OS1A 2V26A 2CRGA 2XPWA 1VQ7I 4N4OB 1N25A 1LNWA 1YS6A 5FKMA 1TW3A 4KICA 4IRHA 1YRNA 4M6VA 4ZYEA 1A04A 3BR0A 5LD2C 2CO5A 1GLNA 1FTTA 4XLAA 2XAGA 5J1YA 2QA4I 2H8RA 3LSHA 1DP7P 4D9JA 2IGKA 2MFZA 3RKQA 2CUEA 2G0EA 4EQQA 1ZR2A 3WTSC 1BN5A 1SD4A 3J80Z 2X1CA 2E1OA 1J2XA 5IP7J 3JSPA 3DLLF 4Q4ZF 1IW7F 3BJOA 2EIMH 3DEEA 4DOZA 2ZXJA 2E35A 3OYHA 2OCEA 1FSHA 2K7LA 5E3LA 1I6XA 2IGMA 4HNTA 3FXKA 1ZLKA 1Z6TA 3U2RA 2VPRA 3CCJI 2LTPA 3HTUA 2R7DA 3HZJA 3CCRI 3LNQA 1FYLA 2DYRH 3KLNA 3CDIA 1OQYA 3ULQB 5H20A 2L9VA 1NK2P 3HUGA 2LDUA 2EZHA 2TCTA 5LFAA 2A6TA 2K40A 5FJ8J 5F64A 5KVRA 1T08B 2OCCH 3A02A 4LGWA 1TLHB 1FOKA 3DPLC 5H6RA 3BZ6A 4B43A 1IO2A 1Y8RB 2G9WA 3B73A 1W7PD 3QOPA 2JA8J 4EJVA 5J4YA 3J81Z 5FFXA 2DFHA 5ICEA 4CYDA 2VXZA 4OMZA 1ZQ3P 5FLXK 1G8XA 2Q0OA 4IHSA 3HHGA 4BQQA 2V79A 2A3SA 3ABKH 2J5OA 3BTLA 4IKFA 4IHTA 4WK8F 3GTJJ 1WZ2A 2HKXA 3ZQFA 2BVLA 4BDZA 1JI8A 4QPOA 1FEXA 4OAYA 5L3CA 1G6NA 3WU0A 2GBYA 2LBFA 3WGIA 3F6OA 4BS9A 4ZZDA 3I4NJ 4BE1A 3LA7A 2LF8A 3F21A 4MQVA 2EA2A 5B1BH 2CUFA 4CZCA 1ZRCA 3NRVA 1SAUA 1D1CA 2Z5UA 5HLIA 3X2QH 5FFZA 3GLLA 3GF2A 1R9TJ 1IGNA 2CQQA 2OAZA 1YJNI 3TKYA 3CLOA 1W7PB 3QU3A 4ENNA 1BA5A 4XKVA 3P9CA 3A4CA 1MJ9A 4XSXF 2M0MA 2EH3A 5B3SH 1JKRC 1ENHA 2QEXI 3WHBA 4KIBA 4BQNA 4E4HA 1QHGA 1VQ6I 3I55I 1ETYA 3NAUA 3I4MJ 1K83J 3E6DA 1TWGJ 3UR3C 4I0AA 3OYIA 1IZ1A 3SEZA 3N05A 3F23A 1UZCA 1I39A 1G3SA 1WGXA 3JRGA 4HAMA 4M3GA 5J6XA 1XGMA 4WF2A 1QHHD 2BY2A 3Q0WA 5B66C 1SFUA 4E7HA 1S3JA 1EA3A 1KA8A 5CVIA 5ICGA 1KQ9A 2NVUB 2L4AA 2R5ZA 1XDSA 3OL4A 2V7FA 3QYEA 2P5LC 3OL3A 3CO6C 3OYEA 3HOWJ 5A2QK 2AS5F 5LEKA 4A3BJ 4Q47A 1XGNA 3I59A 2M30A 2PJRB 2E2IJ 1IXCA 3J7ZI 2WTEA 1UELB 3EYYA 5IYCJ 2JK3A 1ZTRA 1TNTA 2D2WA 2O8KA 1YITI 3RZOJ 3SHFA 3H35A 1V5GA 3FMQA 5E3OA 5FRMA 1XDUA 3FWEA 2GA1A 3RZDJ 1A6QA 2OC6A 4ZYGA 2VBWA 1YLFA 1W7PA 2ZMEB 1TP4A 3FXLA 3KP3A 3J7AY 4IHXA 1D8KA 1A31A 4BACA 3S15J 2MG4A 1Z3YA 1VQMI 3V7RA 1P7IA 4M71A 3F8CA 3Q9SA 3ZQLA 1R36A 1VI0A 2IAIA 1EH7A 3V8LA 1TL8A 1D0ZA 2H94A 3F9KA 2K9SA 1XMXA 3C2BA 5BNGA 3HC7A 1D1BA 3CP2A 3L2VA 4HLXA 2KMUA 1N75A 3PFIA 3HOVJ 4U0WA 3IWZA 3CMEI 1T39A 4IQ4A 2ADUA 3TP3A 1MBJA 1OJLA 2HQRA 3K4JA 4IF4A 1OCRH 2W4SA 4IHWA 2XB0X 2M34A 3H5AA 1RR7A 3FM5A 1IN8A 1S7EA 1SFKA 5LGTA 5M3MJ 2HOAA 1LDJA 1WFXA 5FLMJ 4AU7A 2DN0A 5K7HA 4BE0A 1IAWA 1SVOA 2XF5A 5L3GA 4C3JJ 3CZ6A 4A5MA 2KDZA 2STWA 4RAYA 4M72A 2V9KA 1OCOH 4MNUA 1T0FC 2R7SA 4XK4A 1MBGA 3ABLH 1IXRC 4HLYA 1WQ2A 3OV8A 2HOEA 5K5OA 3M8JA 1X1PA 2NNYA 4G6QA 3BPVA 1JHFA 2P6TA 3GO5A 3BG3A 1ON2A 4M3FA 3EUHA 2HYJA 1RI7A 2KISA 4PSWA 2YU3A 3QYBA 1D1AA 2ESHA 3P9IA 3LFUA 3KFWX 2Y2ZA 2X1EA 4RA2A 1D5VA 1R23A 2A07F 3MKWB 3PO3J 3WG9A 4AVPA 5EGOB 4ASNA 3CUOA 2XKPA 5JHFA 3JAMZ 5M3FJ 1IV8A 2V1DA 2VKVA 1U0JA 4EM2A 3J7AO 5FD5A 4P9UA 1Z3XA 4U7BA 1JGGA 2R7QA 1SEUA 4LB5A 3CCQI 5BMZA 4NC6A 1WRJA 2FNPA 3H3ZA 5IY5H 1JKPC 4OINF 3MFKA 1F1ZA 2O03A 3HXLA 3ZXSA 4BXFA 4D5CA 3N97A 2YS9A 5H2FC 3TEDA 2CW7A 4GRIA 4HSTA 3LSPA 2WA0A 3HJEA 3KP4A 2DDAA 2E1CA 2LKPA 2NOJB 4PJLA 2BHYA 3KX2A 1U8RA 1I5ZA 4QLCU 2ZMEC 3BTJA 3F3XA 4RLFA 1U6GA 1UHSA 1IDYA 3WTYC 2W1OA 3TP0A 3SQNA 2G7HA 4QWQA 4RB2C 4DNCA 2WY7Q 3CCVI 4PDKA 2FBHA 4A3IJ 3K70D 1YIOA 2CYYA 2VODA 1Y0NA 2FJ1A 4BEHB 2KFDA 4ZTJA 3QQAA 2AQFA 3LAJA 1RESA 4ZDLA 1FLIA 2DLLA 4HZFA 1MW7A 3IH3A 5E3NA 3LOCA 3E6MA 1ZYRF 3HRSA 5FLVA 1HW2A 1FP1D 2LD5A 2CW0F 1YTYA 3RPUD 2JUGA 2PJPA 1V4RA 5CKTA 1KGSA 1T2KA 4XLEA 2LK2A 5M5XJ 3EUKL 3K4NA 2GIZA 3R0JA 5EGOA 1PVEA 3FZVA 1B9NA 2OTLI 3GTMJ 3PIOF 3GFJA 4DYCA 3P5JA 4QSHA 4KFCA 1T95A 2XAUA 5GTIC 2HGCA 2JSPA 2GXAA 2W84A 1MNMC 3R61A 3K4MA 3FBNB 1TWHJ 5HLTA 2HYFA 1UFMA 4ZYAA 1YW8A 4LJZF 1IF1A 2M5WA 4OIOF 1FOYA 1P4XA 4FCYA 1JKQC 3GTKJ 2NS8A 3VB2A 3KZZA 5ILSA 1JXSA 4N9HA 1AA7A 3NEUA 4AWXB 1YE9A 1YS7A 1YYVA 2XPVA 4ITVA 1DGWY 3O2PE 3U21A 2VQHA 4RB3C 3JRBA 5GAHJ 5IOYA 4DZJA 1Z77A 2CJJA 4NC7A 1SMYF 4E7ZA 1M1EB 1SVMA 4YG2F 2IA0A 5HVQC 1R49A 2MH2A 4BEHA 2ESNA 5EZHA 3TO7A 3LSRA 2VOOA 3FK7A 4BY1J 2AXTC 3CLQA 3ECOA 3S1QJ 2DMUA 4NQWA 1EKEA 2W82A 1R5GA 3HOTA 3DU6A 3FF5A 3HL2A 3E6CC 4IHYA 2DA6A 1SVLA 2MH9A 2P4WA 5LBQA 2XSJC 4B09A 3SXYA 4Y4RA 4HRIA 2HVSA 1QQIA 4BQAA 2F5CA 4FT8A 4ZYHA 1S7OA 1K78B 2IT0A 2GIVA 1PJRA 2MYSA 4XLHA 1RUOA 2M7AA 2MGQA 1H9TA 1ORKA 2RDPA 3DU5A 1LKXA 2DPDA 2WAQA 2P5VA 4EJUA 1G4DA 3I58A 2W48A 1R22A 1ZLJA 3IH2A 2KQRA 2CV0A 2CV1A 3DBHB 2IS4A 2JTVA 2ZJRF 1WJDA 3BR6A 4GYGA 4LD5A 2CG4A 3OMYA 2RREA 1OPCA 3R60A 2NVYJ 3CMAI 1MD0A 2E2HJ 1TQPA 5H6QA 4C9YA 2X85A 1ETOA 1WJCA 4CDGA 1FZPB 1J5YA 4IX7A 4I76A 4UXNA 4NDLA 4WXDA 1J59A 4FTHA 1FT9A 1NK3P 4BY7J 4LK0F 3ZMDA 2RAEA 1DQUA 1T6SA 3WGHA 3WE2A 3PIPF 1NH3A 1GDTA 4M6YA 1KU2A 3VFZA 1APLC 3RTRA 3FIWA 1EJ9A 3OY9A 3TOBA 4IVNA 2KLOA 3LSJA 1MMSA 1XG1A 4XLFA 1EV7A 3FHNA 2XAJA 3FBIB 3OYBA 2VJIA 4PK4A 1PUEE 2CV2A 3ZPLA 1AKHB 3GZNB 5DCMB 4XRFA 4CZZA 5AONA 1E3PA 2R7OA 3BOQA 4LG3A 2OA4A 3OR1C 3RQ4A 2FRHA 2RNJA 1USTA 1QGPA 2LKSA 4ENJA 4HPQA 1WI9A 4M74A 1H8AC 5E18F 2F48A 3BG9A 2O61A 1OKRA 1W5SA 2ZBKA 2IW5A 4M3DA 5DTDA 1IV6A 3HEFA 1A36A 4DBRA 2PN6A 3L09A 4PJJA 2K5CA 1B59A 5LHIA 1MZBA 1U8BA 1X3UA 3I71A 4II2A 4KT6A 2JA6J 2UXXA 2ZXIA 4HA8A 1R6RA 2R5YB 4UVBA 3KCCA 2O6GE 4OAZA 3ERMA 1W5TA 2IRFG 1BIBA 1UAAA 4BNCA 4G7OF 2HEOA 2JJ7A 2QENA 2X48A 1GT0C 1SFEA 3BWGA 3IRRA 2R7UA 2DU9A 3WHCA 4WXCA 2W24A 3KLOA 2QF7A 3B6AA 1BR4A 1X1CA 1ON1A 2PMUA 1YRNB 1HCRA 4L18B 2NOGA 2CH0A 4L5IA 1ZR4A 3OS0A 1Q1HA 2DMPA 2XGDA 1EH8A 2PX9A 2Y69H 3S93A 3BZKA 2QQAA 4IPAA 5FGMA 1N77A 1V5FA 3GFLA 3L2QA 2GM4A 3CJNA 3HOYJ 4EJWA 2O5RA 2ZFWA 5K5QA 1AKHA 5DCMA 3BC8A 2O9LA 1ODDA 3VYUB 2V9PA 2XKOA 3E6BA 5EJCA 1X4PA 2FEZA 3KEQA 4FX4A 1LE8A 2Y0MA 3OOPA 2IGNA 2XSDC 2FBKA 4X0GA 3S1NJ 1XSXA 2LY9A 3D5RC 3PO2J 4IEJA 2HTJA 2RN7A 3HKZA 2ZC2A 2KKOA 2HWVA 2WV1A 4NC8A 1O3RA 3OYGA 2X0LA 1MMAA 3DEWA 4IL6C 4HYEA 4UB8C 3T8TA 1ETWA 3ZMUA 4XOPA 4P1WA 2DQRA 4BJTA 3K69A 1REPC 3ZGKA 1J09A 5E8IA 2HU9A 2I5UA 3S2DJ 2FSWA 5E79C 2DJIA 2DT5A 2CWEA 1NG7A 5HLGA 3M07A 1SANA 2O0YA 2UZKA 3S8PA 1DU6A 3MVPA 2MD5A 1WI3A 5HDKA 3CUQA 2HOSA 1KU3A 2R7ZJ 4OMYA 3TO9A 1K6YA 4IOCF 2WAQN 3HSFA 4MFEA 5IT9Z 4HF2A 3S1MJ 5DEQA 1AHDP 1FYMA 4L9TA 2H8WA 3IKTA 1HSJA 1GV5A 1Z9CA 1IG7A 4ZH4F 2ELKA 1VQ4I 1WJEA 4KITB 1Z7LA 3U1DA 1TWAJ 1P6RA 3DTKA 2L7KA 4FETA 2LH9A 1WSUA 1KYZA 3MCZA 2K9QA 3CQZJ 3ABMH 3TW6A 3GFMA 3F0CA 1HQCA 1Y56A 5TJJA 3TL4X 3IV5A 2DCEA 4BGDA 4KYWA 4UUVA 2M3AA 1H0MA 2FOWA 5C4XJ 4O5VA 3OYMA 2BOLA 3GTOJ 2CQ7A 1J75A 2LBFB 2VKEA 1IN5A 3BTIA 5DD8A 4JBAA 1DPUA 3M4OJ 3L1PA 3ONQA 2VB6A 2XF6A 4FASD 2CQNA 2KRFA 4L9NA 3B02A 3HRTA 2XPUA 3I0TA 4XR6A 3CCSI 3O3KA 2VT2A 1DGRM 4B47A 3J80K 2IVMA 3CCEI 3QYFA 1W0UA 2VI6A 4HNVA 3DKXA 3ESWB 3KZIC 1Y39A 5E20A 2EA4A 3ASNH 2QQ9A 2DA7A 2VLAA 2GOXB 2VBXA 2Q1ZB 2DK8A 2AXLA 2FX0A 5BS6A 3CJQB 3WGGA 3OYKA 4OU0A 4KISA 3ZRGA 3QODA 5F08A 3JREA 1IRZA 3LA3A 4PZJA 4A6EA 1O4XA 1H89C 4B1RA 1JUSA 5D5VB 3K1MA 2R5ZB 4L9VA 3BP8A 5KNLA 2NVXJ 5HDGA 1GXQA 3ZQIA 3V7SA 5FLXZ 1X2MA 5D5UB 5DV5A 1QVUA 2KL4A 4G8XA 4E7KA 1RKTA 3I59B 1O57A 1ULYA 1UMQA 4XN0A 1BI3A 2IXSA 3KEOA 1K6OA 4EVIA 1B1BA 4S05A 5EG0A 2L9RA 2LC2A 1DDNA 2Z9OA 2R4GA 2M4KA 1FIAA 5L3BA 2ICWG 2ZB9A 1I50J 5F0FA 2XB5A 2E7WA 4AYBA 1FTZA 4NHJA 1X3ZB 2DO7A 5CJ9A 1BJZA 1IUYA 1TWCJ 2R7XA 1FJLA 2NRAC 3S2HJ 5TRDA 1JT6A 2OTJI 2COBA 2CFOA 1RC9A 4GFBA 3HPGA 4Z6YA 2LMDA 3C2HA 2NS7A 2FOKA 1DU0A 1G3TA 1LEAA 3I53A 5KK1A 4DGWB 1XMAA 4I02A 4PUSA 2LVSA 4EJTA 4GO1A 3AL0B 4BBSJ 2DOAA 2PEXA 1W5CC 2P0WA 4C30A 1R71A 1HOMA 2PBIA 5DS9A 3AKZA 3FHZA 1WCMJ 2DA3A 2NVQJ 1JE8A 5JLXA 3DP7A 4GDFA 4KDPA 4G9YA 2DJNA 2VBZA 4JX6A 5DD4A 3GTLJ 4ETSA 3BJAA 2B7EA 2F4IA 4BYYA 1FPQA 3CCUI 1BBYA 5DUKA 2ELJA 1QPMA 4HDVA 1HC8A 3RSNA 3KYCB 2EB7A 5JVGF 3QRFF 5IYDJ 5TISC 4FISA 2IA1A 4WWCA 3HKZN 3TGNA 1ZN2A 1HW5A 3JRCA 2XASA 4AVZA 4RB1A 2K9NA 4Y33A 1YG2A 1A5JA 4M6XA 2H6BA 4II3A 1RUNA 4ANJA 1JUPA 2HVQA 1OISA 4A3DJ 5A2QZ 2ZNZA 3K4LA 3L9FA 4JX5A 1UJ8A 3W2VA 4XRMA 1MIJA 4XIDA 4Y13A 1LB2A 1OR7A 2ZXHA 3FXJA 1OLTA 3A01A 3LA2A 3IHUA 2M87A 4ZDPA 1D5YA 4EATA 4XKBA 3BDDA 4RB0A 4HEA2 4HV5A 1RRJA 2IS2A 2EILH 3H92A 4S0HB 4D1QA 2CGPA 3G1OA 4Y15A 2R7WA 5K7ZA 1S6LA 2KRHA 3LSKA 2VIXA 2LG4A 3TQNA 4MQ9F 3PJRA 4UVCA 3V4GA 1Z1DA 3C7JA 3M9AA 4MEYF 2QBYB 2BVMA 3ASOH 1WKMA 2EJRA 3I4PA 1XGSA 4BHCA 4GXOA 5KAFC 2LYCA 3COAC 2V6EA 5J40A 4BL0B 3T1BA 2OU2A 4EMSA 3GLXA 3N4MA 1T8IA 5IPAA 1IN6A 2VQLA 4AM3A 4XSZF 3GZ6A 5F1RA 5D5XB 2OQRA 3K0LA 1MH3A 2ETHA 3IAM2 4JX4A 3U1KA 3BG5A 4A3MJ 3S16J 3IKVA 2HXIA 3S2WA 4ZDOA 1R4NB 1FSEA 4J19A 1VQPI 2I10A 2F5DA 5FKLA 2LOOA 4IXAA 4CCJA 1FIPA 1ZGWA 1IRGA 3V42A 5F04A 4J00A 2E5NA 2COMA 2FXAA 4MHGA 3G6EI 1D3YA 2VASA 5ILUA 4MGRA 4A12A 4CA0A 3FXRA 3FDYA 2KIQA 3U9GA 3VSLA 1FNNA 5EDNA 3JRHA 3JCUC 1HBXG 4IJAA 1R5ID 2EFOA 4FX0A 1LVKA 4U88A 4QPQA 2JT1A 3SJMA 1X1DA 1FP2A 1KQ0A 4RMNA 4G12A 1MNEA 2ZSHB 4EM1A 1IUFA 3L2RA 1ZG5A 4A0ZA 3G4SI 3HIFA 3GTGJ 3QPHA 4D0PA 1YJWI 2V9VA 3K4KA 3G71I 3K1NA 4HDUA 4KMUX 4DW6A 4UV9A 2Y0SA 1MH4A 4YIIA 4M9ZA 5IOZA 4ON0A 5JI6A 4A0XA 3CC4I 3VWBA 1XCBA 2QBYA 5J4VA 1LQ1A 1MBEA 2A68F 4PFPA 4XRSA 3BQYA 3Q0UA 2WC2A 5HDNA 2MC3A 1MKMA 1QNTA 2HFHA 3ABUA 4AYBN 3D0SA 4NNJA 1QBJA 5CYVA 1B8IB 3KP2A 1P9QC 2G7UA 2L4MA 3OYFA 3BR2A 1E0EA 3VYRB 3R0AA 2M8GX 2GQQA 2QYOA 2HDCA 3Q5FA 5L3FA 1V5EA 3IRQA 1WH5A 3E5UA 3CC2I 1LVAA 1PP8F 1USSA 3JRAA 5LHGA 1LFBA 1JUMA 3F72A 2OZ6A 1R58A 5KHDA 1A6IA 2OQGA 2QWWA 3HB9A 5EZGA 1O3SA 2JA7J 1EF4A 4N4NB 2D5VA 3LFKA 2DOFA 1T98A 2TRTA 2ID6A 4FE4A 2GXGA 3ZP5A 3IL2A 2VKDA 3CJTB 5D6FA 2CQXA 4E70A 3OIOA 4E7JA 1R7JA 1I1GA 1V55H 5LRRA 2QQBA 3QWLA 3FXMA 3Q9VA 3GUDA 2VPLA 2JQ7A 4BE2A 3LAPA 2QSGX 3EUHC 3HOSA 4NQWB 2QVOA 2D1HA 2K3PA 2OF7A 1WWXA 1WJFA 3BJ6A 2VKHA 2XF7A 4B4CA 4JP0A 1YW9A 3RQIA 2JPCA 3A0HC 3WU1B 2O8XA 3GCMA 3E0JB 3QAHA 4XLPF 1GV2A 5F6FA 2BXZA 1SFXA 1WJBA 1B8IA 1ZAOA 1ZHFA 3ELKA 2QQ8A 4ZZLA 3E1SA 1MMDA 2WB1A 4UUSA 4CCNA 3KIOA 5HODA 4M9SA 1X1AA 2OBPA 2KJCA 3QPSA 3FISA 2L9NA 3S1RJ 1JJ8C 4YRVA 1HLVA 4I01A 1U3EM 1HA8A 2OPTA 2BHZA 2DA5A 4XKWA 3S17J 3K9TA 2KIMA 4F3QA 4HNUA 1YI2I 3RYPA 2O3FA 2RC4A 2LF7A 2XGCA 5GPCA 2A5WA 3BG6A 1D0YA 2RV8A 3KP5A 4F7ZA 2VC0A 1YFHA 1ZGAA 2PMZA 2CSOA 2GLOA 1LDDA 3MN2A 4DIQA 2AQEA 1VQ8I 1MNDA 2VC1A 5E17F 2EV6A 3GZ5A 1V3FA 2EIJH 2ZJQF 3Q0VA 3LQQA 2Y48A 2BYVE 2ZSIB 2TDXA 3ZMVA 2CMPA 3L2WA 2PLYA 2ZCWA 5DYMA 2VQCA 4ZC3A 2HQ5A 3EETA 4AIJA 3E7LA 3K2AA 4DYQA 2FE3A 1T56A 3PQJA 1X1BA 5DUIA 4IOAF 4V2FA 2MSYA 4ENKA 2PI0A 3OYDA 5CVJA 2FUG2 4P55A 2DK5A 3CCMI 2L9SA 4MTEA 3UNGC 4M3EA 2E1MB 2Y0SN 4AD9A 4MFDA 4HF0A 3NWSA 3I9V2 5GAEJ 4LLNA 2XVCA 3C3WA 3K4BA 4U0VA 2H09A 5FD6A 1RR8C 2D1VA 3RIRA 1H88C 3SDGA 1MBFA 5IP9J 2E5ZA 4H0EA 2H1LA 3PNTA 3EYIA 1WJ5A 3M8EA 1YOVB 1TWFJ 2R0QC 2EIKH 2HOTA 1HKSA 2FQ4A 3GVAA 2DI3A 4MIMA 3RKYA 1ETVA 1ONVA 1YW7A 2FBIA 2K9MA 3AG2H 4QTRA 1G2HA 4P9FA 2E60A 4E7IA 5L3EA 2HKOA 3DBRB 4NUBA 3RPUA 5GTHC 5IT3A 1P2FA 4Z2YA 4AC0A 2BY1A 3DBLB 5E3MA 2MD0A 4KMFA 1TBXA 1TQIA 1J0RA 3O8HA 1ZREA 1R00A 3HRUA 1ZRFA 3CF2A 2XDVA 3D1NI 2DFEA 2LREA 2HQAA 2F5VA 2HXOA 2FMLA 4D5FA 4GGGA 4MO7A 5F1JA 4I99C 4MEXF 3W6JB 4NBQA 2QUFA 1ZG3A 3F8BA 1MBHA 4A2UA 1MJBA 1LFUP 1ZRDA 1IRXA 4Y17A 1QVTA 1U78A 1ETQA 1Y1VJ 2GWRA 3DKYA 4PGGA 3ZCOA 3W6VA 1LE8B 1VQKI 2KIFA 2P7VB 2JN6A 4XRSG 2E7XA 4CXFA 2EPFA 2H6CA 4F91B 2GZWA 4LG0B 1F9NA 2YPRA 2ZO4A 1F5TA 3BQZA 4BAYA 2YX4A 3QP6A 3KYDB 1ZKGA 1PP7U 2K86A 3K6GA 2A5YB 3LSIA 1Z6RA 1BL0A 1QPIA 3HOUJ 2A05A 3W2WA 4BXUA 1I27A 4YFKF 2HI3A 2A6EF 2P6SA 1N78A 4EGYA 3VODA 5CQGA 3OYNA 4XNFA 5CPRB 1CF7B 3WE3A 1F4KA 3SZGA 1KU7A 1H9GA 2EFWA 3DCFA 3BCAA 5CVVA 5ILVA 3NWTA 1KZHA 3I56I 3LSGA 1MBKA 1ZK8A 2A61A 3OR2C 3PSFA 2Y75A 3CUQB 2CS3A 3ZR8X 4S04A 1U5TA 2WB1N 5J1UA 3H3VK 4XBFA 3AAFA 2K9LA 2EZLA 4I7HA 2HPMA 2M45A 2FQ3A 2XAQA 4DYRA 1E3HA 2YR2A 3FK6A 1XGOA 1G3YA 2Z3YA 4HX8A 1I6HJ 1Z21A 2V1NA 5CVUA 3KETA 2QM3A 4XLNF 4GCVA 1D8JA 2LLKA 5D8KB 3WODF 4BU2A 5IP6A 5EF6A 2DDBA 1VFCA 1IJWC 4Y3OA 5FKKA 2W85A 2QSHX 1SAXA 4FE7A 3P9KA 5HS9A 1TT5B 4YIFA 4C2UA 1J7KA 2JA2A 4XMYA 3W3CA 2DT7B 3HHHA 3TDZC 2GAUA 2EZIA 3GXOA 2PMZN 5CVRA 1YX3A 3CMMA 3WTZA 2JVGA 2E1MC 5HNHA 1OYIA 1OYYA 4XONA 2VN2A 3HG9A 4LK1F 2K02A 4MLOA 4LG0A 3L00A 3I5UA 5GPAA 1XPXA 1FWZA 2Y9YA 3T8RA 2L0KA 5K5RA 3IUOA 2UV1A 3G2BA 4KIGA 1JTXA
chains in the Genus database with same CATH topology
2VE9A 3ECHA 5LLQA 1FC3A 2L3DA 2UXNA 2EV0A 4RGXA 1R1TA 2OZUA 1CF7A 2IJLA 1HW1A 3L7WA 1LEBA 1BC7C 4ESJA 1GHCA 2OD5A 3MZYA 3BPXA 2VT3A 3DV8A 2JSCA 4G7ZF 1OYWA 2ELHA 1XB4A 1XSDA 2NAZA 1T38A 1QZYA 3C18A 3REOA 4I2OA 5JHUA 1ZARA 3BROA 3E3VA 1E17A 2PFBA 2MBFA 1NHAA 1S7AA 2V1XA 4TV7A 3T0YA 4OIRF 1VTNC 3W6KB 1FYKA 2J5PA 2Q8KA 3ML6A 3CUQC 5LGNA 1JGSA 1UHWA 4HQEA 1KQ8A 4KUMA 3KP6A 2XAFA 2PMHA 2BBYA 4LLLA 5BQTA 5CLSA 1BJAA 5ED4A 2HS5A 5FB2A 3HSRA 4P5OA 3J81K 1Z7UA 4YFXF 2IA2A 2BV6A 3PQKA 1FBQA 5L3DA 1BI2A 1ZH5A 3GW2A 4KT5C 3E97A 2CQKA 3V8JA 3R6SA 4UNOA 1O7LA 1BM9A 4O6JA 2IP2A 2K4JA 3HTSB 4N9IA 1EH6A 3HYIA 2EFNA 1RNLA 2RVCA 4LMYA 5HLHA 3ZN1A 3SZTA 4Q5SF 2R3SA 2IPQX 3RDIA 3ZMZA 2EFQA 1G3WA 2EK5A 3F8FA 3F22A 3KP7A 2XUBA 2DBBA 1HKQA 2XIGA 2L02A 4WXHA 5D4RA 2K4BA 2PQ8A 2DTRA 5D8LB 2V6CA 1IN7A 2KIUA 4PCQA 4DQ2A 2ACJA 1S8NA 4WX9A 4EV0A 2XHKA 2L01A 3RKXA 1HSTA 4CHUA 1XD7A 3G73A 1TQMA 2EWNA 4A0YA 3D5LA 2FNAA 3VOEA 2QLZA 2ZJ2A 4R79A 2ZNYA 4AIHA 1MGTA 3IC7A 4LB6B 4HOBA 3WTXC 2W25A 4RS8A 4G7HF 3DEUA 2LNBA 5ICFA 3VEPA 2HR3A 2KJBA 4JQFA 2VONA 2B0LA 5JR3A 1B9MA 1T0FA 4O3MA 4I0BA 5DCFA 3GWZA 4R1HA 1W4MA 5E8GA 1UHMA 4IRIA 1BIAA 4HW0A 5K1YA 4P96A 4EM0B 3V7CA 1K7AA 2H27A 4G94A 2HTSA 4OIQF 2EFPA 2DFIA 5LGUA 5BOXA 3DKWA 3GEZA 2BGCA 4I09A 4HX4A 2GXBA 2NYXA 3CDHA 1YO5C 1YQAA 3ZMTA 1LDKB 2JRTA 2DQLA 3RKWA 3LWFA 1RIOH 1CGPA 4IRGA 4HV6A 1O3QA 2CFXA 3ZN0A 5ERIA 4UVAA 3DPTA 2MLGA 4L0YB 1P92A 5HS7A 2ZMEA 2M1BA 2XROA 2UWMA 3DFGA 4G6DA 1J9IA 1R1VA 4A5NA 3FMRA 2HYGD 4N0BA 5D4SA 3JAMK 4HBLA 4EGZA 3HSEA 1L0OC 4B8XA 4ESBA 2K27A 1KU9A 4CICA 4NB5A 1SD5A 5D6EA 2Q2EA 2FU4A 6PAXA 1FBSA 3JW4A 4HX7A 5J8FA 1O7FA 5EEGA 3ISPA 4MTDA 4M73A 1P4AA 3IWFA 2M8EA 1OMIA 1BOAA 5FO5A 2JPBA 1AWCA 1Z91A 3GFIA 3T5XA 2DAOA 5LHHA 1ZG1A 3KE2A 3P7NA 3MZHA 4JK1X 2FMYA 2R7FA 2HQNA 4R8HA 1B4AA 3ZQ7A 1XCVA 3MQ0A 3LQRA 2RGVA 2XAHA 3E5QA 3JSOA 1BC8C 2VE8A 4KA4A 2DW4A 5HOOA 4FHTA 1O3TA 2STTA 2ISYA 3SFZA 2MLKA 4OOIA 5JFRA 4KN7X 3FM3A 2RKHA 3R4KA 3SZPA 1BI0A 2JZYA 5JVTA 3M8FA 5AIPA 4AIKA 2ZKZA 4RGSA 2P5KA 5ICCA 1TW2A 1AOYA 5LRSA 1FY7A 4WCGA 2HZTA 4KN4X 5HS8A 4M9XA 4L5JA 1IRFA 1KYWA 1S29A 3DF8A 2X4HA 2YX7A 4RAZA 1HXDA 3G3ZA 3M7GA 3GYHX 1XN7A 2NS0A 3V8KA 4CO8A 3DQVC 3H3UA 1RZ4A 1XSVA 4U7DA 1TTYA 4BH9A 1IN4A 2WV0A 4HF1A 2E1NA 3WTVC 1SD7A 4L0ZB 3L2CA 4L9JA 1MDMB 4CGZA 1U5TB 1DUXC 3WTUC 3CO7C 3F6VA 3TO6A 4EJOA 3FX3A 5BPIA 2Z99A 1U2WA 3QP5A 4HQMA 4GYIA 3EQLF 1SD6A 2C6YA 1L3LA 1I1SA 5E1WA 3JTHA 5AIQA 2P8TA 3I54A 3RYRA 2QZ8A 1HKTA 5DDGA 2XGXA 3KZYA 3O6BB 4K2EA 2ISZA 2WWYA 1PDNC 1FX7A 5J8CA 3ROUA 4YFNF 3EDPA 3HRMA 4RGUA 4U0YA 2D45A 4RGRA 2A6HF 4I98B 3TDUC 3ERED 2VBYA 4BHBA 5BPDA 3GX4X 1K78A 1K79A 1GVJA 5D5WB 2A69F 4OIPF 3F8NA 1IXSB 5E1XA 3K2ZA 4KIFA 4Q48A 2XRNA 3NQOA 3FXUA 1P4WA 1B6AA 5LEJA 1MDMA 1XMKA 3K1PA 2F2EA 3MEXA 2PG4A 3ABTA 2F5FA 2DPUA 3BY6A 3C1DA 1R5HA 3RJPA 1UCRA 2W57A 2EV5A 3LSTA 3TOAA 2FF4A 1MJAA 2F5EA 3JTGA 2NNNA 2YSRA 2P7CB 2FA5A 4LFUA 5EEHA 2RQPA 4ENMA 2LSOA 3F8MA 2XV4S 3M1EA 1JHHA 2Z33A 3ZMSA 4ESFA 3FXQA 2VOPA 3I64A 1Z05A 3DXJF 4BHPA 1SMTA 1FBUA 3RI4A 1GXPA 4UV8A 4PGHA 3WTTC 1DPRA 5E1ZB 1STZA 1Y0UA 3MWMA 2BEOA 3E5XA 1E2XA 4A6DA 3FMSA 1BI1A 1U5TC 1QO0D 4ZYDA 1UB9A 2GA2A 1QZZA 1C0WA 1R1UA 3QU6A 2MA3A 4UHTA 3WTWC 1ZGJA 4KNYA 1LJ9A 2L54A 3QPTA 3MAJA 1TNSA 2BE5F 2V1UA 3RPQA 5IT9K 3CTAA 4LLGF 1LNWA 1YS6A 1TW3A 4KICA 4IRHA 4ZYEA 1A04A 2CO5A 2XAGA 1DP7P 4EQQA 3WTSC 1BN5A 1SD4A 3J80Z 1J2XA 3JSPA 4Q4ZF 1IW7F 3BJOA 2ZXJA 1FSHA 2K7LA 1I6XA 1ZLKA 1Z6TA 3U2RA 3HTUA 2R7DA 1FYLA 3KLNA 3ULQB 5H20A 3HUGA 2LDUA 5F64A 5KVRA 4LGWA 1TLHB 1FOKA 3DPLC 5H6RA 3BZ6A 3B73A 2G9WA 1W7PD 3QOPA 4EJVA 3J81Z 5FFXA 5ICEA 4CYDA 2VXZA 4OMZA 5FLXK 2Q0OA 4IHSA 3HHGA 2V79A 2A3SA 2J5OA 4IHTA 4WK8F 2HKXA 5L3CA 1G6NA 3WU0A 3WGIA 3F6OA 4ZZDA 3LA7A 2LF8A 3F21A 4MQVA 2EA2A 1ZRCA 3NRVA 5HLIA 2Z5UA 5FFZA 3GF2A 2OAZA 3TKYA 3CLOA 1W7PB 3QU3A 4ENNA 3P9CA 4XSXF 1MJ9A 4KIBA 3E6DA 4I0AA 1IZ1A 3F23A 1G3SA 4HAMA 5J6XA 1XGMA 4WF2A 1SFUA 1S3JA 1KA8A 5CVIA 5ICGA 1KQ9A 2L4AA 1XDSA 2P5LC 3CO6C 5A2QK 2AS5F 5LEKA 4Q47A 1XGNA 3I59A 2M30A 1IXCA 2WTEA 3EYYA 1TNTA 2D2WA 3SHFA 3FMQA 1XDUA 3FWEA 2GA1A 4ZYGA 2VBWA 1YLFA 1W7PA 2ZMEB 3KP3A 1D8KA 3V7RA 4M71A 3F8CA 3Q9SA 1R36A 1EH7A 3V8LA 2H94A 4HLXA 3PFIA 4U0WA 3IWZA 1T39A 2ADUA 2HQRA 4IF4A 3FM5A 1IN8A 5LGTA 1LDJA 1IAWA 5L3GA 4A5MA 2STWA 4RAYA 4M72A 4MNUA 1IXRC 4HLYA 1WQ2A 3OV8A 2HOEA 5K5OA 2NNYA 4G6QA 3BPVA 1JHFA 2P6TA 3GO5A 1ON2A 3EUHA 1RI7A 2YU3A 2ESHA 3P9IA 3KFWX 1D5VA 1R23A 2A07F 3WG9A 4AVPA 4ASNA 3CUOA 2XKPA 3JAMZ 2V1DA 4EM2A 3J7AO 5FD5A 4P9UA 4U7BA 4LB5A 5BMZA 1WRJA 2FNPA 3H3ZA 4OINF 3MFKA 1F1ZA 2O03A 3N97A 3KP4A 2E1CA 2LKPA 1U8RA 1I5ZA 4QLCU 3F3XA 1U6GA 3WTYC 3SQNA 2G7HA 4QWQA 4RB2C 4DNCA 4PDKA 2FBHA 1YIOA 2CYYA 2VODA 3LAJA 1FLIA 2DLLA 4HZFA 3E6MA 1ZYRF 3HRSA 1HW2A 1FP1D 2CW0F 1YTYA 2PJPA 1V4RA 1KGSA 1T2KA 3R0JA 3FZVA 1B9NA 3GFJA 4KFCA 2HGCA 2W84A 3R61A 2HYFA 1UFMA 1YW8A 4LJZF 1IF1A 2M5WA 4OIOF 1P4XA 3VB2A 3KZZA 5ILSA 1JXSA 4N9HA 4AWXB 3NEUA 1YS7A 1YYVA 3O2PE 4RB3C 1SMYF 4YG2F 2IA0A 5HVQC 2MH2A 2ESNA 3TO7A 2VOOA 3ECOA 4NQWA 3HOTA 1R5GA 3FF5A 3E6CC 2MH9A 2P4WA 5LBQA 4B09A 3SXYA 1QQIA 4BQAA 4ZYHA 2F5CA 4FT8A 1S7OA 1K78B 2IT0A 2GIVA 1RUOA 1H9TA 2RDPA 2DPDA 2P5VA 4EJUA 1G4DA 3I58A 1R22A 1ZLJA 2JTVA 4GYGA 4LD5A 2CG4A 1OPCA 3R60A 1MD0A 1TQPA 5H6QA 4CDGA 1FZPB 1J5YA 4UXNA 4WXDA 1J59A 1FT9A 4LK0F 3ZMDA 1T6SA 3WGHA 3WE2A 4M6YA 1KU2A 3VFZA 3RTRA 3TOBA 4IVNA 1EV7A 2XAJA 1PUEE 3ZPLA 5DCMB 4KIGA 4XRFA 4CZZA 5AONA 3BOQA 2OA4A 2FRHA 2RNJA 1USTA 1QGPA 4ENJA 1WI9A 4M74A 5E18F 2O61A 1OKRA 1W5SA 2ZBKA 2IW5A 2PN6A 3L09A 5LHIA 1B59A 1MZBA 1X3UA 3I71A 2UXXA 4HA8A 4UVBA 3KCCA 2O6GE 1W5TA 2IRFG 1BIBA 4BNCA 4G7OF 2HEOA 2QENA 1SFEA 3BWGA 3IRRA 2DU9A 4WXCA 2W24A 3KLOA 1ON1A 2PMUA 4L18B 4L5IA 1Q1HA 1EH8A 2QQAA 4IPAA 5FGMA 3GFLA 3CJNA 4EJWA 2ZFWA 5K5QA 5DCMA 1ODDA 2XKOA 3E6BA 2FEZA 3KEQA 4FX4A 2Y0MA 3OOPA 2FBKA 1XSXA 2HTJA 2RN7A 2KKOA 2HWVA 1O3RA 2X0LA 4HYEA 3T8TA 3ZMUA 2DQRA 3K69A 1REPC 5E8IA 2FSWA 2DT5A 2CWEA 5HLGA 2O0YA 2UZKA 2MD5A 5HDKA 3CUQA 1KU3A 4OMYA 3HSFA 5IT9Z 4HF2A 5DEQA 1FYMA 4L9TA 3IKTA 1HSJA 1Z9CA 4ZH4F 3U1DA 1P6RA 1WSUA 1KYZA 3MCZA 3GFMA 5TJJA 1HQCA 4KYWA 4UUVA 1H0MA 4O5VA 1J75A 1IN5A 5DD8A 4JBAA 1DPUA 2KRFA 4L9NA 3B02A 3HRTA 3I0TA 3O3KA 2VT2A 3J80K 2IVMA 5E20A 2EA4A 2QQ9A 2VBXA 2DK8A 2AXLA 5BS6A 3WGGA 4OU0A 3LA3A 4PZJA 4A6EA 5D5VB 3K1MA 4L9VA 3BP8A 5HDGA 1GXQA 3V7SA 5FLXZ 5D5UB 5DV5A 4G8XA 3I59B 1O57A 1ULYA 1BI3A 3KEOA 1K6OA 4EVIA 1B1BA 4S05A 1DDNA 2Z9OA 5L3BA 2E7WA 4NHJA 2DO7A 5CJ9A 1IUYA 2NRAC 5TRDA 2FOKA 1G3TA 1LEAA 3I53A 5KK1A 1XMAA 4I02A 4EJTA 4GO1A 2PEXA 2PBIA 3FHZA 1JE8A 3DP7A 4KDPA 4G9YA 2VBZA 5DD4A 4ETSA 3BJAA 4BYYA 1FPQA 1BBYA 5DUKA 4HDVA 1QPMA 2EB7A 3QRFF 2IA1A 4WWCA 3TGNA 1ZN2A 1HW5A 2XASA 4RB1A 1YG2A 4M6XA 2H6BA 1RUNA 5A2QZ 2ZNZA 3L9FA 4Y13A 1LB2A 1OR7A 3LA2A 3IHUA 2M87A 3BDDA 4RB0A 4HV5A 3H92A 2CGPA 4Y15A 1S6LA 3TQNA 4MQ9F 4UVCA 3V4GA 1Z1DA 3C7JA 3M9AA 4MEYF 2QBYB 1WKMA 2EJRA 3I4PA 1XGSA 4BHCA 4GXOA 3COAC 3T1BA 2OU2A 4EMSA 3GLXA 3N4MA 1IN6A 4XSZF 3GZ6A 5F1RA 5D5XB 2OQRA 3K0LA 2ETHA 3IKVA 3S2WA 1FSEA 2F5DA 4IXAA 1IRGA 4MHGA 2COMA 2FXAA 1D3YA 5ILUA 4MGRA 4A12A 3FXRA 3U9GA 1FNNA 1HBXG 4IJAA 2EFOA 4FX0A 4U88A 2JT1A 1FP2A 1KQ0A 4EM1A 1ZG5A 4A0ZA 3HIFA 3QPHA 4D0PA 2V9VA 3K1NA 4HDUA 4KMUX 4UV9A 4YIIA 4M9ZA 4ON0A 5JI6A 4A0XA 1XCBA 2QBYA 1LQ1A 2A68F 2WC2A 5HDNA 2MC3A 1MKMA 1QNTA 2HFHA 3ABUA 3D0SA 1QBJA 5CYVA 3KP2A 2G7UA 2L4MA 3R0AA 2GQQA 2QYOA 2HDCA 3Q5FA 5L3FA 3IRQA 3E5UA 1LVAA 1PP8F 1USSA 5LHGA 3F72A 2OZ6A 1R58A 2OQGA 2QWWA 1O3SA 3LFKA 1T98A 2GXGA 3ZP5A 3IL2A 5D6FA 4E70A 1R7JA 1I1GA 5LRRA 2QQBA 3Q9VA 3GUDA 3LAPA 3HOSA 2QVOA 2D1HA 1WWXA 3BJ6A 1YW9A 2JPCA 3WU1B 2O8XA 3QAHA 4XLPF 5F6FA 1SFXA 1ZAOA 1ZHFA 3ELKA 4ZZLA 4M9SA 2OBPA 2KJCA 4I01A 1U3EM 3K9TA 2KIMA 3RYPA 2O3FA 2RC4A 2LF7A 2RV8A 3KP5A 4F7ZA 2VC0A 1YFHA 1ZGAA 2CSOA 1LDDA 2VC1A 5E17F 2EV6A 3GZ5A 1V3FA 3LQQA 2Y48A 2BYVE 2TDXA 3ZMVA 2PLYA 2ZCWA 5DYMA 3EETA 4AIJA 2FE3A 3PQJA 5DUIA 4ENKA 2PI0A 5CVJA 4P55A 2DK5A 4MTEA 4AD9A 4HF0A 4LLNA 2XVCA 3C3WA 4U0VA 5FD6A 2H09A 2D1VA 3RIRA 4H0EA 3EYIA 3M8EA 1HKSA 3GVAA 2DI3A 3RKYA 1ONVA 1YW7A 2FBIA 4P9FA 5L3EA 2HKOA 3RPUA 5IT3A 1P2FA 4Z2YA 4KMFA 1TBXA 1TQIA 1J0RA 1ZREA 1R00A 3HRUA 1ZRFA 2FMLA 4GGGA 4MEXF 3W6JB 2QUFA 1ZG3A 3F8BA 4A2UA 1MJBA 1ZRDA 4Y17A 1U78A 2GWRA 4PGGA 2KIFA 2P7VB 4CXFA 2E7XA 2H6CA 2GZWA 4LG0B 1F9NA 2YPRA 2ZO4A 1F5TA 4BAYA 2YX4A 3QP6A 1PP7U 2K86A 2A5YB 1Z6RA 4BXUA 1I27A 4YFKF 2A6EF 2P6SA 4EGYA 3VODA 1CF7B 3WE3A 1F4KA 1KU7A 1H9GA 2EFWA 5CVVA 5ILVA 2A61A 2Y75A 3CUQB 4S04A 1U5TA 4XBFA 3AAFA 4I7HA 2M45A 2FQ3A 2XAQA 2YR2A 1XGOA 1G3YA 2Z3YA 4HX8A 5CVUA 3KETA 2QM3A 4XLNF 4GCVA 1D8JA 5D8KB 3WODF 2W85A 1SAXA 5HS9A 3P9KA 4YIFA 1J7KA 3TDZC 3HHHA 2GAUA 3GXOA 5CVRA 3WTZA 1OYIA 1OYYA 2VN2A 4LK1F 4LG0A 2K02A 3L00A 3I5UA 1FWZA 3T8RA 5K5RA 3TO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE9 A;  3ECH A;  5LLQ A;  1FC3 A;  2L3D A;  2UXN A;  2EV0 A;  4RGX A;  1R1T A;  2OZU A;  1CF7 A;  2IJL A;  1HW1 A;  3L7W A;  1LEB A;  1BC7 C;  4ESJ A;  1GHC A;  2OD5 A;  3MZY A;  3BPX A;  2VT3 A;  3DV8 A;  2JSC A;  4G7Z F;  1OYW A;  2ELH A;  1XB4 A;  1XSD A;  2NAZ A;  1T38 A;  1QZY A;  3C18 A;  3REO A;  4I2O A;  5JHU A;  1ZAR A;  3BRO A;  3E3V A;  1E17 A;  2PFB A;  2MBF A;  1NHA A;  1S7A A;  2V1X A;  4TV7 A;  3T0Y A;  4OIR F;  1VTN C;  3W6K B;  1FYK A;  2J5P A;  2Q8K A;  3ML6 A;  3CUQ C;  5LGN A;  1JGS A;  1UHW A;  4HQE A;  1KQ8 A;  4KUM A;  3KP6 A;  2XAF A;  2PMH A;  2BBY A;  4LLL A;  5BQT A;  5CLS A;  1BJA A;  5ED4 A;  2HS5 A;  5FB2 A;  3HSR A;  4P5O A;  3J81 K;  1Z7U A;  4YFX F;  2IA2 A;  2BV6 A;  3PQK A;  1FBQ A;  5L3D A;  1BI2 A;  1ZH5 A;  3GW2 A;  4KT5 C;  3E97 A;  2CQK A;  3V8J A;  3R6S A;  4UNO A;  1O7L A;  1BM9 A;  4O6J A;  2IP2 A;  2K4J A;  3HTS B;  4N9I A;  1EH6 A;  3HYI A;  2EFN A;  1RNL A;  2RVC A;  4LMY A;  5HLH A;  3ZN1 A;  3SZT A;  4Q5S F;  2R3S A;  2IPQ X;  3RDI A;  3ZMZ A;  2EFQ A;  1G3W A;  2EK5 A;  3F8F A;  3F22 A;  3KP7 A;  2XUB A;  2DBB A;  1HKQ A;  2XIG A;  2L02 A;  4WXH A;  5D4R A;  2K4B A;  2PQ8 A;  2DTR A;  5D8L B;  2V6C A;  1IN7 A;  2KIU A;  4PCQ A;  4DQ2 A;  2ACJ A;  1S8N A;  4WX9 A;  4EV0 A;  2XHK A;  2L01 A;  3RKX A;  1HST A;  4CHU A;  1XD7 A;  3G73 A;  1TQM A;  2EWN A;  4A0Y A;  3D5L A;  2FNA A;  3VOE A;  2QLZ A;  2ZJ2 A;  4R79 A;  2ZNY A;  4AIH A;  1MGT A;  3IC7 A;  4LB6 B;  4HOB A;  3WTX C;  2W25 A;  4RS8 A;  4G7H F;  3DEU A;  2LNB A;  5ICF A;  3VEP A;  2HR3 A;  2KJB A;  4JQF A;  2VON A;  2B0L A;  5JR3 A;  1B9M A;  1T0F A;  4O3M A;  4I0B A;  5DCF A;  3GWZ A;  4R1H A;  1W4M A;  5E8G A;  1UHM A;  4IRI A;  1BIA A;  4HW0 A;  5K1Y A;  4P96 A;  4EM0 B;  3V7C A;  1K7A A;  2H27 A;  4G94 A;  2HTS A;  4OIQ F;  2EFP A;  2DFI A;  5LGU A;  5BOX A;  3DKW A;  3GEZ A;  2BGC A;  4I09 A;  4HX4 A;  2GXB A;  2NYX A;  3CDH A;  1YO5 C;  1YQA A;  3ZMT A;  1LDK B;  2JRT A;  2DQL A;  3RKW A;  3LWF A;  1RIO H;  1CGP A;  4IRG A;  4HV6 A;  1O3Q A;  2CFX A;  3ZN0 A;  5ERI A;  4UVA A;  3DPT A;  2MLG A;  4L0Y B;  1P92 A;  5HS7 A;  2ZME A;  2M1B A;  2XRO A;  2UWM A;  3DFG A;  4G6D A;  1J9I A;  1R1V A;  4A5N A;  3FMR A;  2HYG D;  4N0B A;  5D4S A;  3JAM K;  4HBL A;  4EGZ A;  3HSE A;  1L0O C;  4B8X A;  4ESB A;  2K27 A;  1KU9 A;  4CIC A;  4NB5 A;  1SD5 A;  5D6E A;  2Q2E A;  2FU4 A;  6PAX A;  1FBS A;  3JW4 A;  4HX7 A;  5J8F A;  1O7F A;  5EEG A;  3ISP A;  4MTD A;  4M73 A;  1P4A A;  3IWF A;  2M8E A;  1OMI A;  1BOA A;  5FO5 A;  2JPB A;  1AWC A;  1Z91 A;  3GFI A;  3T5X A;  2DAO A;  5LHH A;  1ZG1 A;  3KE2 A;  3P7N A;  3MZH A;  4JK1 X;  2FMY A;  2R7F A;  2HQN A;  4R8H A;  1B4A A;  3ZQ7 A;  1XCV A;  3MQ0 A;  3LQR A;  2RGV A;  2XAH A;  3E5Q A;  3JSO A;  1BC8 C;  2VE8 A;  4KA4 A;  2DW4 A;  5HOO A;  4FHT A;  1O3T A;  2STT A;  2ISY A;  3SFZ A;  2MLK A;  4OOI A;  5JFR A;  4KN7 X;  3FM3 A;  2RKH A;  3R4K A;  3SZP A;  1BI0 A;  2JZY A;  5JVT A;  3M8F A;  5AIP A;  4AIK A;  2ZKZ A;  4RGS A;  2P5K A;  5ICC A;  1TW2 A;  1AOY A;  5LRS A;  1FY7 A;  4WCG A;  2HZT A;  4KN4 X;  5HS8 A;  4M9X A;  4L5J A;  1IRF A;  1KYW A;  1S29 A;  3DF8 A;  2X4H A;  2YX7 A;  4RAZ A;  1HXD A;  3G3Z A;  3M7G A;  3GYH X;  1XN7 A;  2NS0 A;  3V8K A;  4CO8 A;  3DQV C;  3H3U A;  1RZ4 A;  1XSV A;  4U7D A;  1TTY A;  4BH9 A;  1IN4 A;  2WV0 A;  4HF1 A;  2E1N A;  3WTV C;  1SD7 A;  4L0Z B;  3L2C A;  4L9J A;  1MDM B;  4CGZ A;  1U5T B;  1DUX C;  3WTU C;  3CO7 C;  3F6V A;  3TO6 A;  4EJO A;  3FX3 A;  5BPI A;  2Z99 A;  1U2W A;  3QP5 A;  4HQM A;  4GYI A;  3EQL F;  1SD6 A;  2C6Y A;  1L3L A;  1I1S A;  5E1W A;  3JTH A;  5AIQ A;  2P8T A;  3I54 A;  3RYR A;  2QZ8 A;  1HKT A;  5DDG A;  2XGX A;  3KZY A;  3O6B B;  4K2E A;  2ISZ A;  2WWY A;  1PDN C;  1FX7 A;  5J8C A;  3ROU A;  4YFN F;  3EDP A;  3HRM A;  4RGU A;  4U0Y A;  2D45 A;  4RGR A;  2A6H F;  4I98 B;  3TDU C;  3ERE D;  2VBY A;  4BHB A;  5BPD A;  3GX4 X;  1K78 A;  1K79 A;  1GVJ A;  5D5W B;  2A69 F;  4OIP F;  3F8N A;  1IXS B;  5E1X A;  3K2Z A;  4KIF A;  4Q48 A;  2XRN A;  3NQO A;  3FXU A;  1P4W A;  1B6A A;  5LEJ A;  1MDM A;  1XMK A;  3K1P A;  2F2E A;  3MEX A;  2PG4 A;  3ABT A;  2F5F A;  2DPU A;  3BY6 A;  3C1D A;  1R5H A;  3RJP A;  1UCR A;  2W57 A;  2EV5 A;  3LST A;  3TOA A;  2FF4 A;  1MJA A;  2F5E A;  3JTG A;  2NNN A;  2YSR A;  2P7C B;  2FA5 A;  4LFU A;  5EEH A;  2RQP A;  4ENM A;  2LSO A;  3F8M A;  2XV4 S;  3M1E A;  1JHH A;  2Z33 A;  3ZMS A;  4ESF A;  3FXQ A;  2VOP A;  3I64 A;  1Z05 A;  3DXJ F;  4BHP A;  1SMT A;  1FBU A;  3RI4 A;  1GXP A;  4UV8 A;  4PGH A;  3WTT C;  1DPR A;  5E1Z B;  1STZ A;  1Y0U A;  3MWM A;  2BEO A;  3E5X A;  1E2X A;  4A6D A;  3FMS A;  1BI1 A;  1U5T C;  1QO0 D;  4ZYD A;  1UB9 A;  2GA2 A;  1QZZ A;  1C0W A;  1R1U A;  3QU6 A;  2MA3 A;  4UHT A;  3WTW C;  1ZGJ A;  4KNY A;  1LJ9 A;  2L54 A;  3QPT A;  3MAJ A;  1TNS A;  2BE5 F;  2V1U A;  3RPQ A;  5IT9 K;  3CTA A;  4LLG F;  1LNW A;  1YS6 A;  1TW3 A;  4KIC A;  4IRH A;  4ZYE A;  1A04 A;  2CO5 A;  2XAG A;  1DP7 P;  4EQQ A;  3WTS C;  1BN5 A;  1SD4 A;  3J80 Z;  1J2X A;  3JSP A;  4Q4Z F;  1IW7 F;  3BJO A;  2ZXJ A;  1FSH A;  2K7L A;  1I6X A;  1ZLK A;  1Z6T A;  3U2R A;  3HTU A;  2R7D A;  1FYL A;  3KLN A;  3ULQ B;  5H20 A;  3HUG A;  2LDU A;  5F64 A;  5KVR A;  4LGW A;  1TLH B;  1FOK A;  3DPL C;  5H6R A;  3BZ6 A;  3B73 A;  2G9W A;  1W7P D;  3QOP A;  4EJV A;  3J81 Z;  5FFX A;  5ICE A;  4CYD A;  2VXZ A;  4OMZ A;  5FLX K;  2Q0O A;  4IHS A;  3HHG A;  2V79 A;  2A3S A;  2J5O A;  4IHT A;  4WK8 F;  2HKX A;  5L3C A;  1G6N A;  3WU0 A;  3WGI A;  3F6O A;  4ZZD A;  3LA7 A;  2LF8 A;  3F21 A;  4MQV A;  2EA2 A;  1ZRC A;  3NRV A;  5HLI A;  2Z5U A;  5FFZ A;  3GF2 A;  2OAZ A;  3TKY A;  3CLO A;  1W7P B;  3QU3 A;  4ENN A;  3P9C A;  4XSX F;  1MJ9 A;  4KIB A;  3E6D A;  4I0A A;  1IZ1 A;  3F23 A;  1G3S A;  4HAM A;  5J6X A;  1XGM A;  4WF2 A;  1SFU A;  1S3J A;  1KA8 A;  5CVI A;  5ICG A;  1KQ9 A;  2L4A A;  1XDS A;  2P5L C;  3CO6 C;  5A2Q K;  2AS5 F;  5LEK A;  4Q47 A;  1XGN A;  3I59 A;  2M30 A;  1IXC A;  2WTE A;  3EYY A;  1TNT A;  2D2W A;  3SHF A;  3FMQ A;  1XDU A;  3FWE A;  2GA1 A;  4ZYG A;  2VBW A;  1YLF A;  1W7P A;  2ZME B;  3KP3 A;  1D8K A;  3V7R A;  4M71 A;  3F8C A;  3Q9S A;  1R36 A;  1EH7 A;  3V8L A;  2H94 A;  4HLX A;  3PFI A;  4U0W A;  3IWZ A;  1T39 A;  2ADU A;  2HQR A;  4IF4 A;  3FM5 A;  1IN8 A;  5LGT A;  1LDJ A;  1IAW A;  5L3G A;  4A5M A;  2STW A;  4RAY A;  4M72 A;  4MNU A;  1IXR C;  4HLY A;  1WQ2 A;  3OV8 A;  2HOE A;  5K5O A;  2NNY A;  4G6Q A;  3BPV A;  1JHF A;  2P6T A;  3GO5 A;  1ON2 A;  3EUH A;  1RI7 A;  2YU3 A;  2ESH A;  3P9I A;  3KFW X;  1D5V A;  1R23 A;  2A07 F;  3WG9 A;  4AVP A;  4ASN A;  3CUO A;  2XKP A;  3JAM Z;  2V1D A;  4EM2 A;  3J7A O;  5FD5 A;  4P9U A;  4U7B A;  4LB5 A;  5BMZ A;  1WRJ A;  2FNP A;  3H3Z A;  4OIN F;  3MFK A;  1F1Z A;  2O03 A;  3N97 A;  3KP4 A;  2E1C A;  2LKP A;  1U8R A;  1I5Z A;  4QLC U;  3F3X A;  1U6G A;  3WTY C;  3SQN A;  2G7H A;  4QWQ A;  4RB2 C;  4DNC A;  4PDK A;  2FBH A;  1YIO A;  2CYY A;  2VOD A;  3LAJ A;  1FLI A;  2DLL A;  4HZF A;  3E6M A;  1ZYR F;  3HRS A;  1HW2 A;  1FP1 D;  2CW0 F;  1YTY A;  2PJP A;  1V4R A;  1KGS A;  1T2K A;  3R0J A;  3FZV A;  1B9N A;  3GFJ A;  4KFC A;  2HGC A;  2W84 A;  3R61 A;  2HYF A;  1UFM A;  1YW8 A;  4LJZ F;  1IF1 A;  2M5W A;  4OIO F;  1P4X A;  3VB2 A;  3KZZ A;  5ILS A;  1JXS A;  4N9H A;  4AWX B;  3NEU A;  1YS7 A;  1YYV A;  3O2P E;  4RB3 C;  1SMY F;  4YG2 F;  2IA0 A;  5HVQ C;  2MH2 A;  2ESN A;  3TO7 A;  2VOO A;  3ECO A;  4NQW A;  3HOT A;  1R5G A;  3FF5 A;  3E6C C;  2MH9 A;  2P4W A;  5LBQ A;  4B09 A;  3SXY A;  1QQI A;  4BQA A;  4ZYH A;  2F5C A;  4FT8 A;  1S7O A;  1K78 B;  2IT0 A;  2GIV A;  1RUO A;  1H9T A;  2RDP A;  2DPD A;  2P5V A;  4EJU A;  1G4D A;  3I58 A;  1R22 A;  1ZLJ A;  2JTV A;  4GYG A;  4LD5 A;  2CG4 A;  1OPC A;  3R60 A;  1MD0 A;  1TQP A;  5H6Q A;  4CDG A;  1FZP B;  1J5Y A;  4UXN A;  4WXD A;  1J59 A;  1FT9 A;  4LK0 F;  3ZMD A;  1T6S A;  3WGH A;  3WE2 A;  4M6Y A;  1KU2 A;  3VFZ A;  3RTR A;  3TOB A;  4IVN A;  1EV7 A;  2XAJ A;  1PUE E;  3ZPL A;  5DCM B;  4KIG A;  4XRF A;  4CZZ A;  5AON A;  3BOQ A;  2OA4 A;  2FRH A;  2RNJ A;  1UST A;  1QGP A;  4ENJ A;  1WI9 A;  4M74 A;  5E18 F;  2O61 A;  1OKR A;  1W5S A;  2ZBK A;  2IW5 A;  2PN6 A;  3L09 A;  5LHI A;  1B59 A;  1MZB A;  1X3U A;  3I71 A;  2UXX A;  4HA8 A;  4UVB A;  3KCC A;  2O6G E;  1W5T A;  2IRF G;  1BIB A;  4BNC A;  4G7O F;  2HEO A;  2QEN A;  1SFE A;  3BWG A;  3IRR A;  2DU9 A;  4WXC A;  2W24 A;  3KLO A;  1ON1 A;  2PMU A;  4L18 B;  4L5I A;  1Q1H A;  1EH8 A;  2QQA A;  4IPA A;  5FGM A;  3GFL A;  3CJN A;  4EJW A;  2ZFW A;  5K5Q A;  5DCM A;  1ODD A;  2XKO A;  3E6B A;  2FEZ A;  3KEQ A;  4FX4 A;  2Y0M A;  3OOP A;  2FBK A;  1XSX A;  2HTJ A;  2RN7 A;  2KKO A;  2HWV A;  1O3R A;  2X0L A;  4HYE A;  3T8T A;  3ZMU A;  2DQR A;  3K69 A;  1REP C;  5E8I A;  2FSW A;  2DT5 A;  2CWE A;  5HLG A;  2O0Y A;  2UZK A;  2MD5 A;  5HDK A;  3CUQ A;  1KU3 A;  4OMY A;  3HSF A;  5IT9 Z;  4HF2 A;  5DEQ A;  1FYM A;  4L9T A;  3IKT A;  1HSJ A;  1Z9C A;  4ZH4 F;  3U1D A;  1P6R A;  1WSU A;  1KYZ A;  3MCZ A;  3GFM A;  5TJJ A;  1HQC A;  4KYW A;  4UUV A;  1H0M A;  4O5V A;  1J75 A;  1IN5 A;  5DD8 A;  4JBA A;  1DPU A;  2KRF A;  4L9N A;  3B02 A;  3HRT A;  3I0T A;  3O3K A;  2VT2 A;  3J80 K;  2IVM A;  5E20 A;  2EA4 A;  2QQ9 A;  2VBX A;  2DK8 A;  2AXL A;  5BS6 A;  3WGG A;  4OU0 A;  3LA3 A;  4PZJ A;  4A6E A;  5D5V B;  3K1M A;  4L9V A;  3BP8 A;  5HDG A;  1GXQ A;  3V7S A;  5FLX Z;  5D5U B;  5DV5 A;  4G8X A;  3I59 B;  1O57 A;  1ULY A;  1BI3 A;  3KEO A;  1K6O A;  4EVI A;  1B1B A;  4S05 A;  1DDN A;  2Z9O A;  5L3B A;  2E7W A;  4NHJ A;  2DO7 A;  5CJ9 A;  1IUY A;  2NRA C;  5TRD A;  2FOK A;  1G3T A;  1LEA A;  3I53 A;  5KK1 A;  1XMA A;  4I02 A;  4EJT A;  4GO1 A;  2PEX A;  2PBI A;  3FHZ A;  1JE8 A;  3DP7 A;  4KDP A;  4G9Y A;  2VBZ A;  5DD4 A;  4ETS A;  3BJA A;  4BYY A;  1FPQ A;  1BBY A;  5DUK A;  4HDV A;  1QPM A;  2EB7 A;  3QRF F;  2IA1 A;  4WWC A;  3TGN A;  1ZN2 A;  1HW5 A;  2XAS A;  4RB1 A;  1YG2 A;  4M6X A;  2H6B A;  1RUN A;  5A2Q Z;  2ZNZ A;  3L9F A;  4Y13 A;  1LB2 A;  1OR7 A;  3LA2 A;  3IHU A;  2M87 A;  3BDD A;  4RB0 A;  4HV5 A;  3H92 A;  2CGP A;  4Y15 A;  1S6L A;  3TQN A;  4MQ9 F;  4UVC A;  3V4G A;  1Z1D A;  3C7J A;  3M9A A;  4MEY F;  2QBY B;  1WKM A;  2EJR A;  3I4P A;  1XGS A;  4BHC A;  4GXO A;  3COA C;  3T1B A;  2OU2 A;  4EMS A;  3GLX A;  3N4M A;  1IN6 A;  4XSZ F;  3GZ6 A;  5F1R A;  5D5X B;  2OQR A;  3K0L A;  2ETH A;  3IKV A;  3S2W A;  1FSE A;  2F5D A;  4IXA A;  1IRG A;  4MHG A;  2COM A;  2FXA A;  1D3Y A;  5ILU A;  4MGR A;  4A12 A;  3FXR A;  3U9G A;  1FNN A;  1HBX G;  4IJA A;  2EFO A;  4FX0 A;  4U88 A;  2JT1 A;  1FP2 A;  1KQ0 A;  4EM1 A;  1ZG5 A;  4A0Z A;  3HIF A;  3QPH A;  4D0P A;  2V9V A;  3K1N A;  4HDU A;  4KMU X;  4UV9 A;  4YII A;  4M9Z A;  4ON0 A;  5JI6 A;  4A0X A;  1XCB A;  2QBY A;  1LQ1 A;  2A68 F;  2WC2 A;  5HDN A;  2MC3 A;  1MKM A;  1QNT A;  2HFH A;  3ABU A;  3D0S A;  1QBJ A;  5CYV A;  3KP2 A;  2G7U A;  2L4M A;  3R0A A;  2GQQ A;  2QYO A;  2HDC A;  3Q5F A;  5L3F A;  3IRQ A;  3E5U A;  1LVA A;  1PP8 F;  1USS A;  5LHG A;  3F72 A;  2OZ6 A;  1R58 A;  2OQG A;  2QWW A;  1O3S A;  3LFK A;  1T98 A;  2GXG A;  3ZP5 A;  3IL2 A;  5D6F A;  4E70 A;  1R7J A;  1I1G A;  5LRR A;  2QQB A;  3Q9V A;  3GUD A;  3LAP A;  3HOS A;  2QVO A;  2D1H A;  1WWX A;  3BJ6 A;  1YW9 A;  2JPC A;  3WU1 B;  2O8X A;  3QAH A;  4XLP F;  5F6F A;  1SFX A;  1ZAO A;  1ZHF A;  3ELK A;  4ZZL A;  4M9S A;  2OBP A;  2KJC A;  4I01 A;  1U3E M;  3K9T A;  2KIM A;  3RYP A;  2O3F A;  2RC4 A;  2LF7 A;  2RV8 A;  3KP5 A;  4F7Z A;  2VC0 A;  1YFH A;  1ZGA A;  2CSO A;  1LDD A;  2VC1 A;  5E17 F;  2EV6 A;  3GZ5 A;  1V3F A;  3LQQ A;  2Y48 A;  2BYV E;  2TDX A;  3ZMV A;  2PLY A;  2ZCW A;  5DYM A;  3EET A;  4AIJ A;  2FE3 A;  3PQJ A;  5DUI A;  4ENK A;  2PI0 A;  5CVJ A;  4P55 A;  2DK5 A;  4MTE A;  4AD9 A;  4HF0 A;  4LLN A;  2XVC A;  3C3W A;  4U0V A;  5FD6 A;  2H09 A;  2D1V A;  3RIR A;  4H0E A;  3EYI A;  3M8E A;  1HKS A;  3GVA A;  2DI3 A;  3RKY A;  1ONV A;  1YW7 A;  2FBI A;  4P9F A;  5L3E A;  2HKO A;  3RPU A;  5IT3 A;  1P2F A;  4Z2Y A;  4KMF A;  1TBX A;  1TQI A;  1J0R A;  1ZRE A;  1R00 A;  3HRU A;  1ZRF A;  2FML A;  4GGG A;  4MEX F;  3W6J B;  2QUF A;  1ZG3 A;  3F8B A;  4A2U A;  1MJB A;  1ZRD A;  4Y17 A;  1U78 A;  2GWR A;  4PGG A;  2KIF A;  2P7V B;  4CXF A;  2E7X A;  2H6C A;  2GZW A;  4LG0 B;  1F9N A;  2YPR A;  2ZO4 A;  1F5T A;  4BAY A;  2YX4 A;  3QP6 A;  1PP7 U;  2K86 A;  2A5Y B;  1Z6R A;  4BXU A;  1I27 A;  4YFK F;  2A6E F;  2P6S A;  4EGY A;  3VOD A;  1CF7 B;  3WE3 A;  1F4K A;  1KU7 A;  1H9G A;  2EFW A;  5CVV A;  5ILV A;  2A61 A;  2Y75 A;  3CUQ B;  4S04 A;  1U5T A;  4XBF A;  3AAF A;  4I7H A;  2M45 A;  2FQ3 A;  2XAQ A;  2YR2 A;  1XGO A;  1G3Y A;  2Z3Y A;  4HX8 A;  5CVU A;  3KET A;  2QM3 A;  4XLN F;  4GCV A;  1D8J A;  5D8K B;  3WOD F;  2W85 A;  1SAX A;  5HS9 A;  3P9K A;  4YIF A;  1J7K A;  3TDZ C;  3HHH A;  2GAU A;  3GXO A;  5CVR A;  3WTZ A;  1OYI A;  1OYY A;  2VN2 A;  4LK1 F;  4LG0 A;  2K02 A;  3L00 A;  3I5U A;  1FWZ A;  3T8R A;  5K5R A;  3TO9 A; 
#chains in the Genus database with same CATH topology
 3HM5 A;  2VE9 A;  3ECH A;  5LLQ A;  3QPL A;  1QA6 A;  1FC3 A;  2L3D A;  2DMN A;  2UXN A;  2EV0 A;  3A1Y A;  4A3G J;  4RGX A;  1R1T A;  2OZU A;  3ZOB A;  3KEY A;  1AU7 A;  1CF7 A;  2IJL A;  1PYV A;  1HW1 A;  3FKI J;  2W00 A;  1K61 A;  3D5S C;  2ZFU A;  3L7W A;  3Q3S A;  3JRI A;  1LEB A;  3H0G J;  4A3L J;  5B1A H;  4RLQ A;  1S72 I;  3PM1 A;  4ESJ A;  1BC7 C;  2MW8 A;  1GHC A;  3BZC A;  4XQF A;  3HBL A;  2OD5 A;  2L7F P;  2IGO A;  4V19 K;  4A93 J;  3MZY A;  2HPI A;  3MMY B;  1B72 B;  4RBO A;  1QZE A;  3BPX A;  4DJA A;  1VQ9 I;  2VT3 A;  3DV8 A;  3FXO A;  2JSC A;  1V54 H;  3GTP J;  4G7Z F;  2E19 A;  1RPW A;  2L5Q A;  3VPR A;  1OYW A;  3VDX A;  2ELH A;  4XLC A;  5EG0 B;  1XB4 A;  1XSD A;  1W36 C;  4C2M J;  5F0C A;  4CUG A;  4QIW N;  2NAZ A;  2ZJP F;  1T38 A;  1BW5 A;  2M4G A;  2LRD A;  1QZY A;  3C18 A;  3REO A;  2FD5 A;  4YIR X;  4ZTF A;  3SYT A;  4I2O A;  5JHU A;  4D7M A;  3MZ8 A;  1ZAR A;  3BRO A;  3E3V A;  5DM7 F;  1E17 A;  2PFB A;  1MSF C;  2KHM A;  2K3F A;  2MBF A;  1BOB A;  1NHA A;  1S7A A;  2V1X A;  1OCZ H;  4PJ0 C;  4TV7 A;  1SC7 A;  3T0Y A;  1XTA A;  4OIR F;  1VTN C;  1WJA A;  2BY0 A;  3H5R A;  3W6K B;  1KON A;  3RCO A;  5EYR A;  4C2T A;  1FYK A;  4BDY A;  2Y9Z A;  2YUS A;  2E36 A;  5J47 A;  1ZEL A;  3H5N A;  2EBI A;  2VJJ A;  3OSG A;  2J5P A;  2CW8 A;  2Q8K A;  5GAG J;  3ML6 A;  3CUQ C;  5LGN A;  1JGS A;  1UHW A;  4HQE A;  1F43 A;  2MAB A;  1KQ8 A;  4KUM A;  3KP6 A;  1ETK A;  2XAF A;  2IBD A;  2PMH A;  2ME6 A;  2X6W A;  2BBY A;  4LLL A;  5BQT A;  3WU2 C;  3J7Y J;  3H9G A;  5CLS A;  1BJA A;  2RNG A;  2IS6 A;  1IC8 A;  4AID A;  3JRD A;  4YEL A;  5ED4 A;  1B72 A;  2HS5 A;  3CC7 I;  5FB2 A;  3HSR A;  4P5O A;  5GAD J;  1P7J A;  4IZZ A;  3J81 K;  1Z7U A;  4YFX F;  2IA2 A;  4XM3 A;  2BV6 A;  3PQK A;  3PNV A;  2DTZ A;  2Z2S B;  1VND A;  2KZV A;  1FBQ A;  5L3D A;  1BI2 A;  1T33 A;  1ZH5 A;  2DA2 A;  3GW2 A;  4KT5 C;  3E97 A;  2CQK A;  2K85 A;  3A01 B;  3IH4 A;  3V8J A;  2VQG A;  3R6S A;  4UNO A;  4XN3 A;  1O7L A;  2DFF A;  1BM9 A;  2X1D A;  4UUT A;  4CCL A;  2L7Z A;  4O6J A;  2IP2 A;  2K4J A;  2L7M P;  3MKZ A;  3HTS B;  4N9I A;  2QCO A;  4RDU A;  2B63 J;  1XS9 A;  1EH6 A;  3HYI A;  2DOD A;  2EFN A;  3A0B C;  3EPZ A;  1RNL A;  2RVC A;  3H36 A;  4LMY A;  5HLH A;  3ZN1 A;  4RM2 A;  3SZT A;  1BR2 A;  1Y8Q B;  4B3A A;  4Q5S F;  4PFO A;  1OCC H;  2R3S A;  3TMO A;  2DT6 A;  2IPQ X;  3RDI A;  3ZMZ A;  5DM6 F;  2EFQ A;  1G3W A;  2EK5 A;  3F8F A;  3F22 A;  1SFO J;  2QKL B;  3KP7 A;  2XUB A;  2XIG A;  1BW6 A;  1HKQ A;  2DBB A;  2DOE A;  2L02 A;  4WXH A;  2B9S A;  2AO9 A;  5D4R A;  2K4B A;  2JMW A;  2PQ8 A;  2DTR A;  5D8L B;  2V6C A;  2KRC A;  1IN7 A;  2F6C A;  2KIU A;  4PCQ A;  1Z0X A;  4DQ2 A;  2ACJ A;  1S8N A;  5M5Y J;  3AG4 H;  1K4T A;  2ID3 A;  4WX9 A;  4EV0 A;  5EEA A;  1HF0 A;  2XHK A;  2L01 A;  3G1M A;  2KDO A;  3RKX A;  1HST A;  4CHU A;  1XD7 A;  3CF5 F;  3TBI A;  4A69 C;  4DZP A;  3G73 A;  1TQM A;  4BQO A;  3OS2 A;  2EWN A;  4CYC B;  4A0Y A;  3SDB A;  5M5W J;  1JTY A;  3H9Q A;  4BXX J;  3D5L A;  2FNA A;  1VQO I;  2VL8 A;  3VOE A;  4A3C J;  1XX5 A;  2OJE D;  2Y30 A;  2BZT A;  2V4J C;  3A2K A;  3PNY A;  1PUF B;  2QLZ A;  2ZJ2 A;  4UY8 I;  4R79 A;  2ZNY A;  4AIH A;  1MGT A;  3IC7 A;  4LB6 B;  4HOB A;  4A3E J;  3WTX C;  5FKO A;  2W25 A;  4RS8 A;  4G7H F;  3DEU A;  2LNB A;  5ICF A;  4J01 A;  3VEP A;  2HR3 A;  2KJB A;  4JQF A;  2VON A;  4CCM A;  4PJN A;  2B0L A;  3K7A J;  1F36 A;  1FOX A;  5JR3 A;  4BUP A;  1B9M A;  2ZXW H;  1T0F A;  4O3M A;  2DA1 A;  4I0B A;  5DCF A;  3BLY A;  1Y6I A;  4E7L A;  2N8G A;  3GWZ A;  5IYB J;  4R1H A;  5FRN A;  3AG3 H;  2W7N A;  1W4M A;  5E8G A;  1LPQ A;  1UHM A;  4IRI A;  1TC3 C;  1ITY A;  1BIA A;  3WG7 H;  4HW0 A;  3DTI A;  5K1Y A;  4P96 A;  4EM0 B;  3V7C A;  1W1W E;  2M2E A;  3CD6 I;  3EUA A;  2DA4 A;  1K7A A;  1WH7 A;  1OR7 C;  2H27 A;  4G94 A;  3KPH A;  2HTS A;  4OIQ F;  2EFP A;  5JLW A;  4CYC A;  3L2U A;  2DFI A;  5LGU A;  2E34 A;  5BOX A;  3DKW A;  3GEZ A;  2BGC A;  4I09 A;  5TGT A;  4HX4 A;  2Q2E B;  2GXB A;  2NYX A;  3CDH A;  1YO5 C;  4XOT A;  3S3M A;  1OFC X;  1YQA A;  4X6A J;  1X19 A;  2PJR A;  2BY3 A;  1PUF A;  3ZMT A;  1LDK B;  2JVH A;  3K4C A;  5KAI C;  2ECB A;  2CU7 A;  2JRT A;  2DQL A;  3RKW A;  3LWF A;  1RIO H;  3AL0 C;  1UG0 A;  3NAR A;  3PUB A;  1CGP A;  4IRG A;  1Z67 A;  4HV6 A;  1O3Q A;  2CFX A;  3ZN0 A;  5ERI A;  4FQG A;  2GOM A;  4UVA A;  3DPT A;  1WVR A;  2LY2 A;  3W2A A;  3M1C A;  2MLG A;  4L0Y B;  1FMV A;  1P92 A;  2KP6 A;  5HS7 A;  3BG7 A;  4HG2 A;  2ZME A;  2M1B A;  2XRO A;  2KZG A;  2UWM A;  1JKO C;  3DFG A;  4G6D A;  1J9I A;  1R1V A;  2MC4 A;  5FRO A;  4UUS B;  1LUJ B;  4A5N A;  3FMR A;  2HYG D;  3BTC A;  4N0B A;  2E71 A;  9ANT A;  2L2O A;  4HSR A;  5D4S A;  1X4O A;  3PFY A;  4LOC A;  2VXD A;  3JAM K;  1VQ5 I;  2WAF A;  2R7T A;  4HBL A;  4EGZ A;  5GP9 A;  3BR1 A;  3HSE A;  2EIN H;  1L0O C;  4B8X A;  4ESB A;  2R7V A;  4W97 A;  4V2G A;  2K27 A;  2R7R A;  1A35 A;  3MKY B;  1KU9 A;  4CIC A;  3UKG A;  2BW3 B;  4NB5 A;  2OUM A;  3DTE A;  2X6O A;  1SD5 A;  5D6E A;  2Q2E A;  2JA5 J;  2FU4 A;  6PAX A;  2YU9 J;  1FBS A;  4A3J J;  3JW4 A;  4HX7 A;  5K7F A;  5J8F A;  1O7F A;  2WAD A;  5EEG A;  2O7O A;  3ISP A;  4ZJZ A;  4MTD A;  3IP4 B;  4M73 A;  3A03 A;  1P4A A;  3IWF A;  4H4K C;  1GVD A;  2NVT J;  2XC7 A;  4IHV A;  1Y1W J;  2M8E A;  4AUX A;  2HZD A;  1OMI A;  1BOA A;  5FO5 A;  4M3B A;  4B3X A;  4XIC A;  3SEQ A;  4BKX A;  3DPU A;  3PUF A;  4F93 B;  1CQT A;  2JPB A;  1AWC A;  2DYS H;  1Z91 A;  1Q1V A;  4E7S A;  2UUZ A;  4F55 A;  3GFI A;  5FKN A;  1U9N A;  1TZL A;  3T5X A;  2DMT A;  2DAO A;  5LHH A;  5B5E C;  1ZG1 A;  3KE2 A;  3P7N A;  2X6X A;  4IO9 F;  3MZH A;  4JK1 X;  4CH7 A;  2FMY A;  2R7F A;  1RKW A;  2HQN A;  3O8G A;  4B48 A;  2M0C A;  3FKJ A;  4R8H A;  1B4A A;  3ZQ7 A;  1ETX A;  1U9O A;  1XCV A;  2CUJ A;  2Y31 A;  3MQ0 A;  3CDL A;  3LQR A;  2RGV A;  2XAH A;  3E5Q A;  3JSO A;  1YHQ I;  1BC8 C;  4CSW A;  2VE8 A;  1VQL I;  4KA4 A;  2DW4 A;  5HOO A;  4FHT A;  1O3T A;  2STT A;  1WHU A;  2R92 J;  3OWT A;  2ISY A;  3SFZ A;  4DBQ A;  1GUU A;  2MLK A;  4OOI A;  5JFR A;  2BW3 A;  4KN7 X;  2F4O B;  4I6Z A;  3FM3 A;  3G1L A;  5CQE A;  1YIJ I;  2RKH A;  2BXY A;  3R4K A;  2EZK A;  3K10 A;  3SZP A;  1BI0 A;  2JZY A;  5JVT A;  3CMY A;  3S3N A;  3M8F A;  1S9H A;  5AIP A;  5C4J J;  4AIK A;  3CCY A;  3TW7 A;  2ZKZ A;  3MD2 A;  4RGS A;  1WPK A;  1HDP A;  2P5K A;  5ICC A;  1TW2 A;  3S32 A;  1AOY A;  5KCM A;  5LRS A;  3BCB A;  1FY7 A;  5F27 A;  2HDW A;  3OYL A;  2LY1 A;  1W0T A;  4WCG A;  2HZT A;  4KN4 X;  5HS8 A;  3S14 J;  4M9X A;  4L5J A;  1IRF A;  1KYW A;  3GBG A;  1S29 A;  3DF8 A;  2X4H A;  5J1R A;  2YX7 A;  4RAZ A;  1HXD A;  3G3Z A;  2P81 A;  2OV7 A;  3IAS 2;  2WY8 Q;  4D7N A;  5F0H A;  4RAF A;  3M7G A;  4RM3 A;  1TT0 A;  2VJ4 A;  3JR9 A;  2H1K A;  3GYH X;  4CCK A;  1XN7 A;  3HGY A;  2LP0 A;  2M7B A;  2NS0 A;  3HPH A;  3CP8 A;  2RQQ A;  2KT0 A;  3DQV C;  3V8K A;  4B44 A;  4CO8 A;  3H3U A;  1OCT C;  3PSI A;  4X1E A;  1ERD A;  2XGE A;  4XL9 A;  4UB6 C;  1RZ4 A;  3OSF A;  3HDD A;  4EEF G;  1OCP A;  1XSV A;  3BR3 A;  2EQR A;  4U7D A;  1TTY A;  1FOW A;  4BH9 A;  1IN4 A;  1NG6 A;  3QOE A;  2WV0 A;  4HF1 A;  2Z16 A;  2JUC A;  2E1N A;  3WTV C;  2DXI A;  1SD7 A;  4L0Z B;  3L2C A;  3OIP A;  4L9J A;  1YX5 A;  1MDM B;  4CGZ A;  3LSM A;  1U5T B;  1DUX C;  3WTU C;  2JRM A;  3CO7 C;  2JWT A;  3F6V A;  3TO6 A;  4EJO A;  2NXN B;  1D0X A;  1W36 D;  3FX3 A;  5BPI A;  3GME A;  2Z99 A;  1U2W A;  3QP5 A;  4HQM A;  3VYT B;  4GYI A;  3EQL F;  1S5L C;  1SD6 A;  2X9D A;  1L3L A;  2C6Y A;  4Y7N J;  1QRY A;  4L5E A;  2KPM A;  1I1S A;  5E1W A;  2E2J J;  3JTH A;  5AIQ A;  2P8T A;  3I54 A;  2M9H A;  5J3L A;  3RYR A;  2QZ8 A;  1HKT A;  3PL8 A;  5DDG A;  2XGX A;  3ZQQ A;  3HOX J;  1VZ0 A;  3KZY A;  1UG2 A;  4ABZ A;  3O6B B;  1FMW A;  4K2E A;  5C3E J;  3C2G A;  3H9J A;  2ISZ A;  2WWY A;  3OYC A;  4A3F J;  1XC5 A;  1PDN C;  3ZQC A;  1DP3 A;  4F92 B;  1FX7 A;  5J8C A;  1X58 A;  4G6T B;  2XRL A;  3ROU A;  4YFN F;  3EDP A;  3HRM A;  4RGU A;  4U0Y A;  4LIV A;  2D45 A;  2X6Y A;  1IDZ A;  2QSF X;  2VUM J;  3OIQ A;  2A6H F;  4RGR A;  4I98 B;  3K70 C;  4CCO A;  3TDU C;  3ERE D;  2VBY A;  4BHB A;  2F4M B;  5BPD A;  3GX4 X;  4KJZ A;  3BR5 A;  1K78 A;  2LKX A;  4A3K J;  2IS1 A;  1K79 A;  1GVJ A;  2DMQ A;  3HGG A;  5D5W B;  2A69 F;  4OIP F;  3F8N A;  1IXS B;  1G59 A;  3DWL E;  3K2Z A;  5E1X A;  3BT9 A;  3CES A;  4F52 A;  4KIF A;  4C3H J;  4Q48 A;  4OWR B;  4RAG A;  2XRN A;  3NQO A;  3FXU A;  1P4W A;  3ZQG A;  3KYL A;  1HDD C;  1NTC A;  1B6A A;  5LEJ A;  5HNF A;  2WAE A;  1MDM A;  1XMK A;  3K1P A;  2HDD A;  2F2E A;  1I3A A;  3MEX A;  2PG4 A;  3ABT A;  1X3W B;  2F5F A;  2LFB A;  2VJ5 A;  2DPU A;  3BY6 A;  3C1D A;  1I3Q J;  1R5H A;  3AFH A;  3JRF A;  3RJP A;  1UCR A;  2HVR A;  2W57 A;  3LMM A;  2EV5 A;  3LST A;  3TOA A;  1QU3 A;  2HNH A;  4BJ5 C;  2FF4 A;  1MJA A;  3SFI A;  2F5E A;  4PSX A;  3CCL I;  3I3L A;  3MKL A;  3JTG A;  3OYA A;  2NNN A;  2YSR A;  1K4S A;  2P7C B;  2FA5 A;  4LFU A;  5EEH A;  2RQP A;  4XKC A;  4ENM A;  2LSO A;  4BBR J;  4BJ6 C;  3F8M A;  2XV4 S;  4PJM A;  3M1E A;  3ZQH A;  1ACI A;  1LFP A;  1JHH A;  3HOZ J;  2Z33 A;  2QGU A;  3ZMS A;  4ESF A;  3LL7 A;  3FXQ A;  2VOP A;  3I64 A;  1Z05 A;  3DXJ F;  4W1U A;  3H1C A;  1JT0 A;  4BHP A;  1SMT A;  1FBU A;  2IEK A;  4C3I J;  1RET A;  1MMG A;  2ME0 A;  3RI4 A;  2AHQ A;  1GXP A;  2X51 A;  1E3O C;  4UV8 A;  4PGH A;  3CJR B;  1DPR A;  3WTT C;  1MSE C;  5E1Z B;  5C44 J;  1POG A;  4E6K G;  1STZ A;  2I8D A;  3AG1 H;  1Y0U A;  3MWM A;  2BEO A;  3E5X A;  1E2X A;  4A6D A;  3FMS A;  1BI1 A;  3DLA A;  4LIU A;  1U5T C;  1BR1 A;  2R93 J;  1VQN I;  3H0D A;  1YJ9 I;  1QO0 D;  4ZYD A;  1UB9 A;  2GA2 A;  2Z1D A;  3M3Y J;  1QZZ A;  3OOU A;  1C0W A;  1R1U A;  3VYS B;  3GTQ J;  3QU6 A;  2MA3 A;  4UHT A;  1JJ6 C;  4U87 A;  3HUG B;  2WBM A;  4JYK A;  3VSK A;  2LR8 A;  3WTW C;  1ZGJ A;  1MMN A;  4KNY A;  1LJ9 A;  2L54 A;  3B6C A;  1R4M B;  3QPT A;  3OYJ A;  2R5Y A;  1X2N A;  3MAJ A;  4JOM A;  3S3O A;  1TNS A;  2BE5 F;  2ECC A;  1VF9 A;  4YEJ A;  2V1U A;  3RPQ A;  5IT9 K;  2QKM B;  3CTA A;  4LLG F;  4LIT A;  4XOR A;  2CUZ A;  4IQJ A;  4Y52 J;  3OS1 A;  2V26 A;  2CRG A;  2XPW A;  1VQ7 I;  4N4O B;  1N25 A;  1LNW A;  1YS6 A;  5FKM A;  1TW3 A;  4KIC A;  4IRH A;  1YRN A;  4M6V A;  4ZYE A;  1A04 A;  3BR0 A;  5LD2 C;  2CO5 A;  1GLN A;  1FTT A;  4XLA A;  2XAG A;  5J1Y A;  2QA4 I;  2H8R A;  3LSH A;  1DP7 P;  4D9J A;  2IGK A;  2MFZ A;  3RKQ A;  2CUE A;  2G0E A;  4EQQ A;  1ZR2 A;  3WTS C;  1BN5 A;  1SD4 A;  3J80 Z;  2X1C A;  2E1O A;  1J2X A;  5IP7 J;  3JSP A;  3DLL F;  4Q4Z F;  1IW7 F;  3BJO A;  2EIM H;  3DEE A;  4DOZ A;  2ZXJ A;  2E35 A;  3OYH A;  2OCE A;  1FSH A;  2K7L A;  5E3L A;  1I6X A;  2IGM A;  4HNT A;  3FXK A;  1ZLK A;  1Z6T A;  3U2R A;  2VPR A;  3CCJ I;  2LTP A;  3HTU A;  2R7D A;  3HZJ A;  3CCR I;  3LNQ A;  1FYL A;  2DYR H;  3KLN A;  3CDI A;  1OQY A;  3ULQ B;  5H20 A;  2L9V A;  1NK2 P;  3HUG A;  2LDU A;  2EZH A;  2TCT A;  5LFA A;  2A6T A;  2K40 A;  5FJ8 J;  5F64 A;  5KVR A;  1T08 B;  2OCC H;  3A02 A;  4LGW A;  1TLH B;  1FOK A;  3DPL C;  5H6R A;  3BZ6 A;  4B43 A;  1IO2 A;  1Y8R B;  2G9W A;  3B73 A;  1W7P D;  3QOP A;  2JA8 J;  4EJV A;  5J4Y A;  3J81 Z;  5FFX A;  2DFH A;  5ICE A;  4CYD A;  2VXZ A;  4OMZ A;  1ZQ3 P;  5FLX K;  1G8X A;  2Q0O A;  4IHS A;  3HHG A;  4BQQ A;  2V79 A;  2A3S A;  3ABK H;  2J5O A;  3BTL A;  4IKF A;  4IHT A;  4WK8 F;  3GTJ J;  1WZ2 A;  2HKX A;  3ZQF A;  2BVL A;  4BDZ A;  1JI8 A;  4QPO A;  1FEX A;  4OAY A;  5L3C A;  1G6N A;  3WU0 A;  2GBY A;  2LBF A;  3WGI A;  3F6O A;  4BS9 A;  4ZZD A;  3I4N J;  4BE1 A;  3LA7 A;  2LF8 A;  3F21 A;  4MQV A;  2EA2 A;  5B1B H;  2CUF A;  4CZC A;  1ZRC A;  3NRV A;  1SAU A;  1D1C A;  2Z5U A;  5HLI A;  3X2Q H;  5FFZ A;  3GLL A;  3GF2 A;  1R9T J;  1IGN A;  2CQQ A;  2OAZ A;  1YJN I;  3TKY A;  3CLO A;  1W7P B;  3QU3 A;  4ENN A;  1BA5 A;  4XKV A;  3P9C A;  3A4C A;  1MJ9 A;  4XSX F;  2M0M A;  2EH3 A;  5B3S H;  1JKR C;  1ENH A;  2QEX I;  3WHB A;  4KIB A;  4BQN A;  4E4H A;  1QHG A;  1VQ6 I;  3I55 I;  1ETY A;  3NAU A;  3I4M J;  1K83 J;  3E6D A;  1TWG J;  3UR3 C;  4I0A A;  3OYI A;  1IZ1 A;  3SEZ A;  3N05 A;  3F23 A;  1UZC A;  1I39 A;  1G3S A;  1WGX A;  3JRG A;  4HAM A;  4M3G A;  5J6X A;  1XGM A;  4WF2 A;  1QHH D;  2BY2 A;  3Q0W A;  5B66 C;  1SFU A;  4E7H A;  1S3J A;  1EA3 A;  1KA8 A;  5CVI A;  5ICG A;  1KQ9 A;  2NVU B;  2L4A A;  2R5Z A;  1XDS A;  3OL4 A;  2V7F A;  3QYE A;  2P5L C;  3OL3 A;  3CO6 C;  3OYE A;  3HOW J;  5A2Q K;  2AS5 F;  5LEK A;  4A3B J;  4Q47 A;  1XGN A;  3I59 A;  2M30 A;  2PJR B;  2E2I J;  1IXC A;  3J7Z I;  2WTE A;  1UEL B;  3EYY A;  5IYC J;  2JK3 A;  1ZTR A;  1TNT A;  2D2W A;  2O8K A;  1YIT I;  3RZO J;  3SHF A;  3H35 A;  1V5G A;  3FMQ A;  5E3O A;  5FRM A;  1XDU A;  3FWE A;  2GA1 A;  3RZD J;  1A6Q A;  2OC6 A;  4ZYG A;  2VBW A;  1YLF A;  1W7P A;  2ZME B;  1TP4 A;  3FXL A;  3KP3 A;  3J7A Y;  4IHX A;  1D8K A;  1A31 A;  4BAC A;  3S15 J;  2MG4 A;  1Z3Y A;  1VQM I;  3V7R A;  1P7I A;  4M71 A;  3F8C A;  3Q9S A;  3ZQL A;  1R36 A;  1VI0 A;  2IAI A;  1EH7 A;  3V8L A;  1TL8 A;  1D0Z A;  2H94 A;  3F9K A;  2K9S A;  1XMX A;  3C2B A;  5BNG A;  3HC7 A;  1D1B A;  3CP2 A;  3L2V A;  4HLX A;  2KMU A;  1N75 A;  3PFI A;  3HOV J;  4U0W A;  3IWZ A;  3CME I;  1T39 A;  4IQ4 A;  2ADU A;  3TP3 A;  1MBJ A;  1OJL A;  2HQR A;  3K4J A;  4IF4 A;  1OCR H;  2W4S A;  4IHW A;  2XB0 X;  2M34 A;  3H5A A;  1RR7 A;  3FM5 A;  1IN8 A;  1S7E A;  1SFK A;  5LGT A;  5M3M J;  2HOA A;  1LDJ A;  1WFX A;  5FLM J;  4AU7 A;  2DN0 A;  5K7H A;  4BE0 A;  1IAW A;  1SVO A;  2XF5 A;  5L3G A;  4C3J J;  3CZ6 A;  4A5M A;  2KDZ A;  2STW A;  4RAY A;  4M72 A;  2V9K A;  1OCO H;  4MNU A;  1T0F C;  2R7S A;  4XK4 A;  1MBG A;  3ABL H;  1IXR C;  4HLY A;  1WQ2 A;  3OV8 A;  2HOE A;  5K5O A;  3M8J A;  1X1P A;  2NNY A;  4G6Q A;  3BPV A;  1JHF A;  2P6T A;  3GO5 A;  3BG3 A;  1ON2 A;  4M3F A;  3EUH A;  2HYJ A;  1RI7 A;  2KIS A;  4PSW A;  2YU3 A;  3QYB A;  1D1A A;  2ESH A;  3P9I A;  3LFU A;  3KFW X;  2Y2Z A;  2X1E A;  4RA2 A;  1D5V A;  1R23 A;  2A07 F;  3MKW B;  3PO3 J;  3WG9 A;  4AVP A;  5EGO B;  4ASN A;  3CUO A;  2XKP A;  5JHF A;  3JAM Z;  5M3F J;  1IV8 A;  2V1D A;  2VKV A;  1U0J A;  4EM2 A;  3J7A O;  5FD5 A;  4P9U A;  1Z3X A;  4U7B A;  1JGG A;  2R7Q A;  1SEU A;  4LB5 A;  3CCQ I;  5BMZ A;  4NC6 A;  1WRJ A;  2FNP A;  3H3Z A;  5IY5 H;  1JKP C;  4OIN F;  3MFK A;  1F1Z A;  2O03 A;  3HXL A;  3ZXS A;  4BXF A;  4D5C A;  3N97 A;  2YS9 A;  5H2F C;  3TED A;  2CW7 A;  4GRI A;  4HST A;  3LSP A;  2WA0 A;  3HJE A;  3KP4 A;  2DDA A;  2E1C A;  2LKP A;  2NOJ B;  4PJL A;  2BHY A;  3KX2 A;  1U8R A;  1I5Z A;  4QLC U;  2ZME C;  3BTJ A;  3F3X A;  4RLF A;  1U6G A;  1UHS A;  1IDY A;  3WTY C;  2W1O A;  3TP0 A;  3SQN A;  2G7H A;  4QWQ A;  4RB2 C;  4DNC A;  2WY7 Q;  3CCV I;  4PDK A;  2FBH A;  4A3I J;  3K70 D;  1YIO A;  2CYY A;  2VOD A;  1Y0N A;  2FJ1 A;  4BEH B;  2KFD A;  4ZTJ A;  3QQA A;  2AQF A;  3LAJ A;  1RES A;  4ZDL A;  1FLI A;  2DLL A;  4HZF A;  1MW7 A;  3IH3 A;  5E3N A;  3LOC A;  3E6M A;  1ZYR F;  3HRS A;  5FLV A;  1HW2 A;  1FP1 D;  2LD5 A;  2CW0 F;  1YTY A;  3RPU D;  2JUG A;  2PJP A;  1V4R A;  5CKT A;  1KGS A;  1T2K A;  4XLE A;  2LK2 A;  5M5X J;  3EUK L;  3K4N A;  2GIZ A;  3R0J A;  5EGO A;  1PVE A;  3FZV A;  1B9N A;  2OTL I;  3GTM J;  3PIO F;  3GFJ A;  4DYC A;  3P5J A;  4QSH A;  4KFC A;  1T95 A;  2XAU A;  5GTI C;  2HGC A;  2JSP A;  2GXA A;  2W84 A;  1MNM C;  3R61 A;  3K4M A;  3FBN B;  1TWH J;  5HLT A;  2HYF A;  1UFM A;  4ZYA A;  1YW8 A;  4LJZ F;  1IF1 A;  2M5W A;  4OIO F;  1FOY A;  1P4X A;  4FCY A;  1JKQ C;  3GTK J;  2NS8 A;  3VB2 A;  3KZZ A;  5ILS A;  1JXS A;  4N9H A;  1AA7 A;  3NEU A;  4AWX B;  1YE9 A;  1YS7 A;  1YYV A;  2XPV A;  4ITV A;  1DGW Y;  3O2P E;  3U21 A;  2VQH A;  4RB3 C;  3JRB A;  5GAH J;  5IOY A;  4DZJ A;  1Z77 A;  2CJJ A;  4NC7 A;  1SMY F;  4E7Z A;  1M1E B;  1SVM A;  4YG2 F;  2IA0 A;  5HVQ C;  1R49 A;  2MH2 A;  4BEH A;  2ESN A;  5EZH A;  3TO7 A;  3LSR A;  2VOO A;  3FK7 A;  4BY1 J;  2AXT C;  3CLQ A;  3ECO A;  3S1Q J;  2DMU A;  4NQW A;  1EKE A;  2W82 A;  1R5G A;  3HOT A;  3DU6 A;  3FF5 A;  3HL2 A;  3E6C C;  4IHY A;  2DA6 A;  1SVL A;  2MH9 A;  2P4W A;  5LBQ A;  2XSJ C;  4B09 A;  3SXY A;  4Y4R A;  4HRI A;  2HVS A;  1QQI A;  4BQA A;  2F5C A;  4FT8 A;  4ZYH A;  1S7O A;  1K78 B;  2IT0 A;  2GIV A;  1PJR A;  2MYS A;  4XLH A;  1RUO A;  2M7A A;  2MGQ A;  1H9T A;  1ORK A;  2RDP A;  3DU5 A;  1LKX A;  2DPD A;  2WAQ A;  2P5V A;  4EJU A;  1G4D A;  3I58 A;  2W48 A;  1R22 A;  1ZLJ A;  3IH2 A;  2KQR A;  2CV0 A;  2CV1 A;  3DBH B;  2IS4 A;  2JTV A;  2ZJR F;  1WJD A;  3BR6 A;  4GYG A;  4LD5 A;  2CG4 A;  3OMY A;  2RRE A;  1OPC A;  3R60 A;  2NVY J;  3CMA I;  1MD0 A;  2E2H J;  1TQP A;  5H6Q A;  4C9Y A;  2X85 A;  1ETO A;  1WJC A;  4CDG A;  1FZP B;  1J5Y A;  4IX7 A;  4I76 A;  4UXN A;  4NDL A;  4WXD A;  1J59 A;  4FTH A;  1FT9 A;  1NK3 P;  4BY7 J;  4LK0 F;  3ZMD A;  2RAE A;  1DQU A;  1T6S A;  3WGH A;  3WE2 A;  3PIP F;  1NH3 A;  1GDT A;  4M6Y A;  1KU2 A;  3VFZ A;  1APL C;  3RTR A;  3FIW A;  1EJ9 A;  3OY9 A;  3TOB A;  4IVN A;  2KLO A;  3LSJ A;  1MMS A;  1XG1 A;  4XLF A;  1EV7 A;  3FHN A;  2XAJ A;  3FBI B;  3OYB A;  2VJI A;  4PK4 A;  1PUE E;  2CV2 A;  3ZPL A;  1AKH B;  3GZN B;  5DCM B;  4XRF A;  4CZZ A;  5AON A;  1E3P A;  2R7O A;  3BOQ A;  4LG3 A;  2OA4 A;  3OR1 C;  3RQ4 A;  2FRH A;  2RNJ A;  1UST A;  1QGP A;  2LKS A;  4ENJ A;  4HPQ A;  1WI9 A;  4M74 A;  1H8A C;  5E18 F;  2F48 A;  3BG9 A;  2O61 A;  1OKR A;  1W5S A;  2ZBK A;  2IW5 A;  4M3D A;  5DTD A;  1IV6 A;  3HEF A;  1A36 A;  4DBR A;  2PN6 A;  3L09 A;  4PJJ A;  2K5C A;  1B59 A;  5LHI A;  1MZB A;  1U8B A;  1X3U A;  3I71 A;  4II2 A;  4KT6 A;  2JA6 J;  2UXX A;  2ZXI A;  4HA8 A;  1R6R A;  2R5Y B;  4UVB A;  3KCC A;  2O6G E;  4OAZ A;  3ERM A;  1W5T A;  2IRF G;  1BIB A;  1UAA A;  4BNC A;  4G7O F;  2HEO A;  2JJ7 A;  2QEN A;  2X48 A;  1GT0 C;  1SFE A;  3BWG A;  3IRR A;  2R7U A;  2DU9 A;  3WHC A;  4WXC A;  2W24 A;  3KLO A;  2QF7 A;  3B6A A;  1BR4 A;  1X1C A;  1ON1 A;  2PMU A;  1YRN B;  1HCR A;  4L18 B;  2NOG A;  2CH0 A;  4L5I A;  1ZR4 A;  3OS0 A;  1Q1H A;  2DMP A;  2XGD A;  1EH8 A;  2PX9 A;  2Y69 H;  3S93 A;  3BZK A;  2QQA A;  4IPA A;  5FGM A;  1N77 A;  1V5F A;  3GFL A;  3L2Q A;  2GM4 A;  3CJN A;  3HOY J;  4EJW A;  2O5R A;  2ZFW A;  5K5Q A;  1AKH A;  5DCM A;  3BC8 A;  2O9L A;  1ODD A;  3VYU B;  2V9P A;  2XKO A;  3E6B A;  5EJC A;  1X4P A;  2FEZ A;  3KEQ A;  4FX4 A;  1LE8 A;  2Y0M A;  3OOP A;  2IGN A;  2XSD C;  2FBK A;  4X0G A;  3S1N J;  1XSX A;  2LY9 A;  3D5R C;  3PO2 J;  4IEJ A;  2HTJ A;  2RN7 A;  3HKZ A;  2ZC2 A;  2KKO A;  2HWV A;  2WV1 A;  4NC8 A;  1O3R A;  3OYG A;  2X0L A;  1MMA A;  3DEW A;  4IL6 C;  4HYE A;  4UB8 C;  3T8T A;  1ETW A;  3ZMU A;  4XOP A;  4P1W A;  2DQR A;  4BJT A;  3K69 A;  1REP C;  3ZGK A;  1J09 A;  5E8I A;  2HU9 A;  2I5U A;  3S2D J;  2FSW A;  5E79 C;  2DJI A;  2DT5 A;  2CWE A;  1NG7 A;  5HLG A;  3M07 A;  1SAN A;  2O0Y A;  2UZK A;  3S8P A;  1DU6 A;  3MVP A;  2MD5 A;  1WI3 A;  5HDK A;  3CUQ A;  2HOS A;  1KU3 A;  2R7Z J;  4OMY A;  3TO9 A;  1K6Y A;  4IOC F;  2WAQ N;  3HSF A;  4MFE A;  5IT9 Z;  4HF2 A;  3S1M J;  5DEQ A;  1AHD P;  1FYM A;  4L9T A;  2H8W A;  3IKT A;  1HSJ A;  1GV5 A;  1Z9C A;  1IG7 A;  4ZH4 F;  2ELK A;  1VQ4 I;  1WJE A;  4KIT B;  1Z7L A;  3U1D A;  1TWA J;  1P6R A;  3DTK A;  2L7K A;  4FET A;  2LH9 A;  1WSU A;  1KYZ A;  3MCZ A;  2K9Q A;  3CQZ J;  3ABM H;  3TW6 A;  3GFM A;  3F0C A;  1HQC A;  1Y56 A;  5TJJ A;  3TL4 X;  3IV5 A;  2DCE A;  4BGD A;  4KYW A;  4UUV A;  2M3A A;  1H0M A;  2FOW A;  5C4X J;  4O5V A;  3OYM A;  2BOL A;  3GTO J;  2CQ7 A;  1J75 A;  2LBF B;  2VKE A;  1IN5 A;  3BTI A;  5DD8 A;  4JBA A;  1DPU A;  3M4O J;  3L1P A;  3ONQ A;  2VB6 A;  2XF6 A;  4FAS D;  2CQN A;  2KRF A;  4L9N A;  3B02 A;  3HRT A;  2XPU A;  3I0T A;  4XR6 A;  3CCS I;  3O3K A;  2VT2 A;  1DGR M;  4B47 A;  3J80 K;  2IVM A;  3CCE I;  3QYF A;  1W0U A;  2VI6 A;  4HNV A;  3DKX A;  3ESW B;  3KZI C;  1Y39 A;  5E20 A;  2EA4 A;  3ASN H;  2QQ9 A;  2DA7 A;  2VLA A;  2GOX B;  2VBX A;  2Q1Z B;  2DK8 A;  2AXL A;  2FX0 A;  5BS6 A;  3CJQ B;  3WGG A;  3OYK A;  4OU0 A;  4KIS A;  3ZRG A;  3QOD A;  5F08 A;  3JRE A;  1IRZ A;  3LA3 A;  4PZJ A;  4A6E A;  1O4X A;  1H89 C;  4B1R A;  1JUS A;  5D5V B;  3K1M A;  2R5Z B;  4L9V A;  3BP8 A;  5KNL A;  2NVX J;  5HDG A;  1GXQ A;  3ZQI A;  3V7S A;  5FLX Z;  1X2M A;  5D5U B;  5DV5 A;  1QVU A;  2KL4 A;  4G8X A;  4E7K A;  1RKT A;  3I59 B;  1O57 A;  1ULY A;  1UMQ A;  4XN0 A;  1BI3 A;  2IXS A;  3KEO A;  1K6O A;  4EVI A;  1B1B A;  4S05 A;  5EG0 A;  2L9R A;  2LC2 A;  1DDN A;  2Z9O A;  2R4G A;  2M4K A;  1FIA A;  5L3B A;  2ICW G;  2ZB9 A;  1I50 J;  5F0F A;  2XB5 A;  2E7W A;  4AYB A;  1FTZ A;  4NHJ A;  1X3Z B;  2DO7 A;  5CJ9 A;  1BJZ A;  1IUY A;  1TWC J;  2R7X A;  1FJL A;  2NRA C;  3S2H J;  5TRD A;  1JT6 A;  2OTJ I;  2COB A;  2CFO A;  1RC9 A;  4GFB A;  3HPG A;  4Z6Y A;  2LMD A;  3C2H A;  2NS7 A;  2FOK A;  1DU0 A;  1G3T A;  1LEA A;  3I53 A;  5KK1 A;  4DGW B;  1XMA A;  4I02 A;  4PUS A;  2LVS A;  4EJT A;  4GO1 A;  3AL0 B;  4BBS J;  2DOA A;  2PEX A;  1W5C C;  2P0W A;  4C30 A;  1R71 A;  1HOM A;  2PBI A;  5DS9 A;  3AKZ A;  3FHZ A;  1WCM J;  2DA3 A;  2NVQ J;  1JE8 A;  5JLX A;  3DP7 A;  4GDF A;  4KDP A;  4G9Y A;  2DJN A;  2VBZ A;  4JX6 A;  5DD4 A;  3GTL J;  4ETS A;  3BJA A;  2B7E A;  2F4I A;  4BYY A;  1FPQ A;  3CCU I;  1BBY A;  5DUK A;  2ELJ A;  1QPM A;  4HDV A;  1HC8 A;  3RSN A;  3KYC B;  2EB7 A;  5JVG F;  3QRF F;  5IYD J;  5TIS C;  4FIS A;  2IA1 A;  4WWC A;  3HKZ N;  3TGN A;  1ZN2 A;  1HW5 A;  3JRC A;  2XAS A;  4AVZ A;  4RB1 A;  2K9N A;  4Y33 A;  1YG2 A;  1A5J A;  4M6X A;  2H6B A;  4II3 A;  1RUN A;  4ANJ A;  1JUP A;  2HVQ A;  1OIS A;  4A3D J;  5A2Q Z;  2ZNZ A;  3K4L A;  3L9F A;  4JX5 A;  1UJ8 A;  3W2V A;  4XRM A;  1MIJ A;  4XID A;  4Y13 A;  1LB2 A;  1OR7 A;  2ZXH A;  3FXJ A;  1OLT A;  3A01 A;  3LA2 A;  3IHU A;  2M87 A;  4ZDP A;  1D5Y A;  4EAT A;  4XKB A;  3BDD A;  4RB0 A;  4HEA 2;  4HV5 A;  1RRJ A;  2IS2 A;  2EIL H;  3H92 A;  4S0H B;  4D1Q A;  2CGP A;  3G1O A;  4Y15 A;  2R7W A;  5K7Z A;  1S6L A;  2KRH A;  3LSK A;  2VIX A;  2LG4 A;  3TQN A;  4MQ9 F;  3PJR A;  4UVC A;  3V4G A;  1Z1D A;  3C7J A;  3M9A A;  4MEY F;  2QBY B;  2BVM A;  3ASO H;  1WKM A;  2EJR A;  3I4P A;  1XGS A;  4BHC A;  4GXO A;  5KAF C;  2LYC A;  3COA C;  2V6E A;  5J40 A;  4BL0 B;  3T1B A;  2OU2 A;  4EMS A;  3GLX A;  3N4M A;  1T8I A;  5IPA A;  1IN6 A;  2VQL A;  4AM3 A;  4XSZ F;  3GZ6 A;  5F1R A;  5D5X B;  2OQR A;  3K0L A;  1MH3 A;  2ETH A;  3IAM 2;  4JX4 A;  3U1K A;  3BG5 A;  4A3M J;  3S16 J;  3IKV A;  2HXI A;  3S2W A;  4ZDO A;  1R4N B;  1FSE A;  4J19 A;  1VQP I;  2I10 A;  2F5D A;  5FKL A;  2LOO A;  4IXA A;  4CCJ A;  1FIP A;  1ZGW A;  1IRG A;  3V42 A;  5F04 A;  4J00 A;  2E5N A;  2COM A;  2FXA A;  4MHG A;  3G6E I;  1D3Y A;  2VAS A;  5ILU A;  4MGR A;  4A12 A;  4CA0 A;  3FXR A;  3FDY A;  2KIQ A;  3U9G A;  3VSL A;  1FNN A;  5EDN A;  3JRH A;  3JCU C;  1HBX G;  4IJA A;  1R5I D;  2EFO A;  4FX0 A;  1LVK A;  4U88 A;  4QPQ A;  2JT1 A;  3SJM A;  1X1D A;  1FP2 A;  1KQ0 A;  4RMN A;  4G12 A;  1MNE A;  2ZSH B;  4EM1 A;  1IUF A;  3L2R A;  1ZG5 A;  4A0Z A;  3G4S I;  3HIF A;  3GTG J;  3QPH A;  4D0P A;  1YJW I;  2V9V A;  3K4K A;  3G71 I;  3K1N A;  4HDU A;  4KMU X;  4DW6 A;  4UV9 A;  2Y0S A;  1MH4 A;  4YII A;  4M9Z A;  5IOZ A;  4ON0 A;  5JI6 A;  4A0X A;  3CC4 I;  3VWB A;  1XCB A;  2QBY A;  5J4V A;  1LQ1 A;  1MBE A;  2A68 F;  4PFP A;  4XRS A;  3BQY A;  3Q0U A;  2WC2 A;  5HDN A;  2MC3 A;  1MKM A;  1QNT A;  2HFH A;  3ABU A;  4AYB N;  3D0S A;  4NNJ A;  1QBJ A;  5CYV A;  1B8I B;  3KP2 A;  1P9Q C;  2G7U A;  2L4M A;  3OYF A;  3BR2 A;  1E0E A;  3VYR B;  3R0A A;  2M8G X;  2GQQ A;  2QYO A;  2HDC A;  3Q5F A;  5L3F A;  1V5E A;  3IRQ A;  1WH5 A;  3E5U A;  3CC2 I;  1LVA A;  1PP8 F;  1USS A;  3JRA A;  5LHG A;  1LFB A;  1JUM A;  3F72 A;  2OZ6 A;  1R58 A;  5KHD A;  1A6I A;  2OQG A;  2QWW A;  3HB9 A;  5EZG A;  1O3S A;  2JA7 J;  1EF4 A;  4N4N B;  2D5V A;  3LFK A;  2DOF A;  1T98 A;  2TRT A;  2ID6 A;  4FE4 A;  2GXG A;  3ZP5 A;  3IL2 A;  2VKD A;  3CJT B;  5D6F A;  2CQX A;  4E70 A;  3OIO A;  4E7J A;  1R7J A;  1I1G A;  1V55 H;  5LRR A;  2QQB A;  3QWL A;  3FXM A;  3Q9V A;  3GUD A;  2VPL A;  2JQ7 A;  4BE2 A;  3LAP A;  2QSG X;  3EUH C;  3HOS A;  4NQW B;  2QVO A;  2D1H A;  2K3P A;  2OF7 A;  1WWX A;  1WJF A;  3BJ6 A;  2VKH A;  2XF7 A;  4B4C A;  4JP0 A;  1YW9 A;  3RQI A;  2JPC A;  3A0H C;  3WU1 B;  2O8X A;  3GCM A;  3E0J B;  3QAH A;  4XLP F;  1GV2 A;  5F6F A;  2BXZ A;  1SFX A;  1WJB A;  1B8I A;  1ZAO A;  1ZHF A;  3ELK A;  2QQ8 A;  4ZZL A;  3E1S A;  1MMD A;  2WB1 A;  4UUS A;  4CCN A;  3KIO A;  5HOD A;  4M9S A;  1X1A A;  2OBP A;  2KJC A;  3QPS A;  3FIS A;  2L9N A;  3S1R J;  1JJ8 C;  4YRV A;  1HLV A;  4I01 A;  1U3E M;  1HA8 A;  2OPT A;  2BHZ A;  2DA5 A;  4XKW A;  3S17 J;  3K9T A;  2KIM A;  4F3Q A;  4HNU A;  1YI2 I;  3RYP A;  2O3F A;  2RC4 A;  2LF7 A;  2XGC A;  5GPC A;  2A5W A;  3BG6 A;  1D0Y A;  2RV8 A;  3KP5 A;  4F7Z A;  2VC0 A;  1YFH A;  1ZGA A;  2PMZ A;  2CSO A;  2GLO A;  1LDD A;  3MN2 A;  4DIQ A;  2AQE A;  1VQ8 I;  1MND A;  2VC1 A;  5E17 F;  2EV6 A;  3GZ5 A;  1V3F A;  2EIJ H;  2ZJQ F;  3Q0V A;  3LQQ A;  2Y48 A;  2BYV E;  2ZSI B;  2TDX A;  3ZMV A;  2CMP A;  3L2W A;  2PLY A;  2ZCW A;  5DYM A;  2VQC A;  4ZC3 A;  2HQ5 A;  3EET A;  4AIJ A;  3E7L A;  3K2A A;  4DYQ A;  2FE3 A;  1T56 A;  3PQJ A;  1X1B A;  5DUI A;  4IOA F;  4V2F A;  2MSY A;  4ENK A;  2PI0 A;  3OYD A;  5CVJ A;  2FUG 2;  4P55 A;  2DK5 A;  3CCM I;  2L9S A;  4MTE A;  3UNG C;  4M3E A;  2E1M B;  2Y0S N;  4AD9 A;  4MFD A;  4HF0 A;  3NWS A;  3I9V 2;  5GAE J;  4LLN A;  2XVC A;  3C3W A;  3K4B A;  4U0V A;  2H09 A;  5FD6 A;  1RR8 C;  2D1V A;  3RIR A;  1H88 C;  3SDG A;  1MBF A;  5IP9 J;  2E5Z A;  4H0E A;  2H1L A;  3PNT A;  3EYI A;  1WJ5 A;  3M8E A;  1YOV B;  1TWF J;  2R0Q C;  2EIK H;  2HOT A;  1HKS A;  2FQ4 A;  3GVA A;  2DI3 A;  4MIM A;  3RKY A;  1ETV A;  1ONV A;  1YW7 A;  2FBI A;  2K9M A;  3AG2 H;  4QTR A;  1G2H A;  4P9F A;  2E60 A;  4E7I A;  5L3E A;  2HKO A;  3DBR B;  4NUB A;  3RPU A;  5GTH C;  5IT3 A;  1P2F A;  4Z2Y A;  4AC0 A;  2BY1 A;  3DBL B;  5E3M A;  2MD0 A;  4KMF A;  1TBX A;  1TQI A;  1J0R A;  3O8H A;  1ZRE A;  1R00 A;  3HRU A;  1ZRF A;  3CF2 A;  2XDV A;  3D1N I;  2DFE A;  2LRE A;  2HQA A;  2F5V A;  2HXO A;  2FML A;  4D5F A;  4GGG A;  4MO7 A;  5F1J A;  4I99 C;  4MEX F;  3W6J B;  4NBQ A;  2QUF A;  1ZG3 A;  3F8B A;  1MBH A;  4A2U A;  1MJB A;  1LFU P;  1ZRD A;  1IRX A;  4Y17 A;  1QVT A;  1U78 A;  1ETQ A;  1Y1V J;  2GWR A;  3DKY A;  4PGG A;  3ZCO A;  3W6V A;  1LE8 B;  1VQK I;  2KIF A;  2P7V B;  2JN6 A;  4XRS G;  2E7X A;  4CXF A;  2EPF A;  2H6C A;  4F91 B;  2GZW A;  4LG0 B;  1F9N A;  2YPR A;  2ZO4 A;  1F5T A;  3BQZ A;  4BAY A;  2YX4 A;  3QP6 A;  3KYD B;  1ZKG A;  1PP7 U;  2K86 A;  3K6G A;  2A5Y B;  3LSI A;  1Z6R A;  1BL0 A;  1QPI A;  3HOU J;  2A05 A;  3W2W A;  4BXU A;  1I27 A;  4YFK F;  2HI3 A;  2A6E F;  2P6S A;  1N78 A;  4EGY A;  3VOD A;  5CQG A;  3OYN A;  4XNF A;  5CPR B;  1CF7 B;  3WE3 A;  1F4K A;  3SZG A;  1KU7 A;  1H9G A;  2EFW A;  3DCF A;  3BCA A;  5CVV A;  5ILV A;  3NWT A;  1KZH A;  3I56 I;  3LSG A;  1MBK A;  1ZK8 A;  2A61 A;  3OR2 C;  3PSF A;  2Y75 A;  3CUQ B;  2CS3 A;  3ZR8 X;  4S04 A;  1U5T A;  2WB1 N;  5J1U A;  3H3V K;  4XBF A;  3AAF A;  2K9L A;  2EZL A;  4I7H A;  2HPM A;  2M45 A;  2FQ3 A;  2XAQ A;  4DYR A;  1E3H A;  2YR2 A;  3FK6 A;  1XGO A;  1G3Y A;  2Z3Y A;  4HX8 A;  1I6H J;  1Z21 A;  2V1N A;  5CVU A;  3KET A;  2QM3 A;  4XLN F;  4GCV A;  1D8J A;  2LLK A;  5D8K B;  3WOD F;  4BU2 A;  5IP6 A;  5EF6 A;  2DDB A;  1VFC A;  1IJW C;  4Y3O A;  5FKK A;  2W85 A;  2QSH X;  1SAX A;  4FE7 A;  3P9K A;  5HS9 A;  1TT5 B;  4YIF A;  4C2U A;  1J7K A;  2JA2 A;  4XMY A;  3W3C A;  2DT7 B;  3HHH A;  3TDZ C;  2GAU A;  2EZI A;  3GXO A;  2PMZ N;  5CVR A;  1YX3 A;  3CMM A;  3WTZ A;  2JVG A;  2E1M C;  5HNH A;  1OYI A;  1OYY A;  4XON A;  2VN2 A;  3HG9 A;  4LK1 F;  2K02 A;  4MLO A;  4LG0 A;  3L00 A;  3I5U A;  5GPA A;  1XPX A;  1FWZ A;  2Y9Y A;  3T8R A;  2L0K A;  5K5R A;  3IUO A;  2UV1 A;  3G2B A;  4KIG A;  1JTX A; 
#chains in the Genus database with same CATH homology
 2VE9 A;  3ECH A;  5LLQ A;  1FC3 A;  2L3D A;  2UXN A;  2EV0 A;  4RGX A;  1R1T A;  2OZU A;  1CF7 A;  2IJL A;  1HW1 A;  3L7W A;  1LEB A;  1BC7 C;  4ESJ A;  1GHC A;  2OD5 A;  3MZY A;  3BPX A;  2VT3 A;  3DV8 A;  2JSC A;  4G7Z F;  1OYW A;  2ELH A;  1XB4 A;  1XSD A;  2NAZ A;  1T38 A;  1QZY A;  3C18 A;  3REO A;  4I2O A;  5JHU A;  1ZAR A;  3BRO A;  3E3V A;  1E17 A;  2PFB A;  2MBF A;  1NHA A;  1S7A A;  2V1X A;  4TV7 A;  3T0Y A;  4OIR F;  1VTN C;  3W6K B;  1FYK A;  2J5P A;  2Q8K A;  3ML6 A;  3CUQ C;  5LGN A;  1JGS A;  1UHW A;  4HQE A;  1KQ8 A;  4KUM A;  3KP6 A;  2XAF A;  2PMH A;  2BBY A;  4LLL A;  5BQT A;  5CLS A;  1BJA A;  5ED4 A;  2HS5 A;  5FB2 A;  3HSR A;  4P5O A;  3J81 K;  1Z7U A;  4YFX F;  2IA2 A;  2BV6 A;  3PQK A;  1FBQ A;  5L3D A;  1BI2 A;  1ZH5 A;  3GW2 A;  4KT5 C;  3E97 A;  2CQK A;  3V8J A;  3R6S A;  4UNO A;  1O7L A;  1BM9 A;  4O6J A;  2IP2 A;  2K4J A;  3HTS B;  4N9I A;  1EH6 A;  3HYI A;  2EFN A;  1RNL A;  2RVC A;  4LMY A;  5HLH A;  3ZN1 A;  3SZT A;  4Q5S F;  2R3S A;  2IPQ X;  3RDI A;  3ZMZ A;  2EFQ A;  1G3W A;  2EK5 A;  3F8F A;  3F22 A;  3KP7 A;  2XUB A;  2DBB A;  1HKQ A;  2XIG A;  2L02 A;  4WXH A;  5D4R A;  2K4B A;  2PQ8 A;  2DTR A;  5D8L B;  2V6C A;  1IN7 A;  2KIU A;  4PCQ A;  4DQ2 A;  2ACJ A;  1S8N A;  4WX9 A;  4EV0 A;  2XHK A;  2L01 A;  3RKX A;  1HST A;  4CHU A;  1XD7 A;  3G73 A;  1TQM A;  2EWN A;  4A0Y A;  3D5L A;  2FNA A;  3VOE A;  2QLZ A;  2ZJ2 A;  4R79 A;  2ZNY A;  4AIH A;  1MGT A;  3IC7 A;  4LB6 B;  4HOB A;  3WTX C;  2W25 A;  4RS8 A;  4G7H F;  3DEU A;  2LNB A;  5ICF A;  3VEP A;  2HR3 A;  2KJB A;  4JQF A;  2VON A;  2B0L A;  5JR3 A;  1B9M A;  1T0F A;  4O3M A;  4I0B A;  5DCF A;  3GWZ A;  4R1H A;  1W4M A;  5E8G A;  1UHM A;  4IRI A;  1BIA A;  4HW0 A;  5K1Y A;  4P96 A;  4EM0 B;  3V7C A;  1K7A A;  2H27 A;  4G94 A;  2HTS A;  4OIQ F;  2EFP A;  2DFI A;  5LGU A;  5BOX A;  3DKW A;  3GEZ A;  2BGC A;  4I09 A;  4HX4 A;  2GXB A;  2NYX A;  3CDH A;  1YO5 C;  1YQA A;  3ZMT A;  1LDK B;  2JRT A;  2DQL A;  3RKW A;  3LWF A;  1RIO H;  1CGP A;  4IRG A;  4HV6 A;  1O3Q A;  2CFX A;  3ZN0 A;  5ERI A;  4UVA A;  3DPT A;  2MLG A;  4L0Y B;  1P92 A;  5HS7 A;  2ZME A;  2M1B A;  2XRO A;  2UWM A;  3DFG A;  4G6D A;  1J9I A;  1R1V A;  4A5N A;  3FMR A;  2HYG D;  4N0B A;  5D4S A;  3JAM K;  4HBL A;  4EGZ A;  3HSE A;  1L0O C;  4B8X A;  4ESB A;  2K27 A;  1KU9 A;  4CIC A;  4NB5 A;  1SD5 A;  5D6E A;  2Q2E A;  2FU4 A;  6PAX A;  1FBS A;  3JW4 A;  4HX7 A;  5J8F A;  1O7F A;  5EEG A;  3ISP A;  4MTD A;  4M73 A;  1P4A A;  3IWF A;  2M8E A;  1OMI A;  1BOA A;  5FO5 A;  2JPB A;  1AWC A;  1Z91 A;  3GFI A;  3T5X A;  2DAO A;  5LHH A;  1ZG1 A;  3KE2 A;  3P7N A;  3MZH A;  4JK1 X;  2FMY A;  2R7F A;  2HQN A;  4R8H A;  1B4A A;  3ZQ7 A;  1XCV A;  3MQ0 A;  3LQR A;  2RGV A;  2XAH A;  3E5Q A;  3JSO A;  1BC8 C;  2VE8 A;  4KA4 A;  2DW4 A;  5HOO A;  4FHT A;  1O3T A;  2STT A;  2ISY A;  3SFZ A;  2MLK A;  4OOI A;  5JFR A;  4KN7 X;  3FM3 A;  2RKH A;  3R4K A;  3SZP A;  1BI0 A;  2JZY A;  5JVT A;  3M8F A;  5AIP A;  4AIK A;  2ZKZ A;  4RGS A;  2P5K A;  5ICC A;  1TW2 A;  1AOY A;  5LRS A;  1FY7 A;  4WCG A;  2HZT A;  4KN4 X;  5HS8 A;  4M9X A;  4L5J A;  1IRF A;  1KYW A;  1S29 A;  3DF8 A;  2X4H A;  2YX7 A;  4RAZ A;  1HXD A;  3G3Z A;  3M7G A;  3GYH X;  1XN7 A;  2NS0 A;  3V8K A;  4CO8 A;  3DQV C;  3H3U A;  1RZ4 A;  1XSV A;  4U7D A;  1TTY A;  4BH9 A;  1IN4 A;  2WV0 A;  4HF1 A;  2E1N A;  3WTV C;  1SD7 A;  4L0Z B;  3L2C A;  4L9J A;  1MDM B;  4CGZ A;  1U5T B;  1DUX C;  3WTU C;  3CO7 C;  3F6V A;  3TO6 A;  4EJO A;  3FX3 A;  5BPI A;  2Z99 A;  1U2W A;  3QP5 A;  4HQM A;  4GYI A;  3EQL F;  1SD6 A;  2C6Y A;  1L3L A;  1I1S A;  5E1W A;  3JTH A;  5AIQ A;  2P8T A;  3I54 A;  3RYR A;  2QZ8 A;  1HKT A;  5DDG A;  2XGX A;  3KZY A;  3O6B B;  4K2E A;  2ISZ A;  2WWY A;  1PDN C;  1FX7 A;  5J8C A;  3ROU A;  4YFN F;  3EDP A;  3HRM A;  4RGU A;  4U0Y A;  2D45 A;  4RGR A;  2A6H F;  4I98 B;  3TDU C;  3ERE D;  2VBY A;  4BHB A;  5BPD A;  3GX4 X;  1K78 A;  1K79 A;  1GVJ A;  5D5W B;  2A69 F;  4OIP F;  3F8N A;  1IXS B;  5E1X A;  3K2Z A;  4KIF A;  4Q48 A;  2XRN A;  3NQO A;  3FXU A;  1P4W A;  1B6A A;  5LEJ A;  1MDM A;  1XMK A;  3K1P A;  2F2E A;  3MEX A;  2PG4 A;  3ABT A;  2F5F A;  2DPU A;  3BY6 A;  3C1D A;  1R5H A;  3RJP A;  1UCR A;  2W57 A;  2EV5 A;  3LST A;  3TOA A;  2FF4 A;  1MJA A;  2F5E A;  3JTG A;  2NNN A;  2YSR A;  2P7C B;  2FA5 A;  4LFU A;  5EEH A;  2RQP A;  4ENM A;  2LSO A;  3F8M A;  2XV4 S;  3M1E A;  1JHH A;  2Z33 A;  3ZMS A;  4ESF A;  3FXQ A;  2VOP A;  3I64 A;  1Z05 A;  3DXJ F;  4BHP A;  1SMT A;  1FBU A;  3RI4 A;  1GXP A;  4UV8 A;  4PGH A;  3WTT C;  1DPR A;  5E1Z B;  1STZ A;  1Y0U A;  3MWM A;  2BEO A;  3E5X A;  1E2X A;  4A6D A;  3FMS A;  1BI1 A;  1U5T C;  1QO0 D;  4ZYD A;  1UB9 A;  2GA2 A;  1QZZ A;  1C0W A;  1R1U A;  3QU6 A;  2MA3 A;  4UHT A;  3WTW C;  1ZGJ A;  4KNY A;  1LJ9 A;  2L54 A;  3QPT A;  3MAJ A;  1TNS A;  2BE5 F;  2V1U A;  3RPQ A;  5IT9 K;  3CTA A;  4LLG F;  1LNW A;  1YS6 A;  1TW3 A;  4KIC A;  4IRH A;  4ZYE A;  1A04 A;  2CO5 A;  2XAG A;  1DP7 P;  4EQQ A;  3WTS C;  1BN5 A;  1SD4 A;  3J80 Z;  1J2X A;  3JSP A;  4Q4Z F;  1IW7 F;  3BJO A;  2ZXJ A;  1FSH A;  2K7L A;  1I6X A;  1ZLK A;  1Z6T A;  3U2R A;  3HTU A;  2R7D A;  1FYL A;  3KLN A;  3ULQ B;  5H20 A;  3HUG A;  2LDU A;  5F64 A;  5KVR A;  4LGW A;  1TLH B;  1FOK A;  3DPL C;  5H6R A;  3BZ6 A;  3B73 A;  2G9W A;  1W7P D;  3QOP A;  4EJV A;  3J81 Z;  5FFX A;  5ICE A;  4CYD A;  2VXZ A;  4OMZ A;  5FLX K;  2Q0O A;  4IHS A;  3HHG A;  2V79 A;  2A3S A;  2J5O A;  4IHT A;  4WK8 F;  2HKX A;  5L3C A;  1G6N A;  3WU0 A;  3WGI A;  3F6O A;  4ZZD A;  3LA7 A;  2LF8 A;  3F21 A;  4MQV A;  2EA2 A;  1ZRC A;  3NRV A;  5HLI A;  2Z5U A;  5FFZ A;  3GF2 A;  2OAZ A;  3TKY A;  3CLO A;  1W7P B;  3QU3 A;  4ENN A;  3P9C A;  4XSX F;  1MJ9 A;  4KIB A;  3E6D A;  4I0A A;  1IZ1 A;  3F23 A;  1G3S A;  4HAM A;  5J6X A;  1XGM A;  4WF2 A;  1SFU A;  1S3J A;  1KA8 A;  5CVI A;  5ICG A;  1KQ9 A;  2L4A A;  1XDS A;  2P5L C;  3CO6 C;  5A2Q K;  2AS5 F;  5LEK A;  4Q47 A;  1XGN A;  3I59 A;  2M30 A;  1IXC A;  2WTE A;  3EYY A;  1TNT A;  2D2W A;  3SHF A;  3FMQ A;  1XDU A;  3FWE A;  2GA1 A;  4ZYG A;  2VBW A;  1YLF A;  1W7P A;  2ZME B;  3KP3 A;  1D8K A;  3V7R A;  4M71 A;  3F8C A;  3Q9S A;  1R36 A;  1EH7 A;  3V8L A;  2H94 A;  4HLX A;  3PFI A;  4U0W A;  3IWZ A;  1T39 A;  2ADU A;  2HQR A;  4IF4 A;  3FM5 A;  1IN8 A;  5LGT A;  1LDJ A;  1IAW A;  5L3G A;  4A5M A;  2STW A;  4RAY A;  4M72 A;  4MNU A;  1IXR C;  4HLY A;  1WQ2 A;  3OV8 A;  2HOE A;  5K5O A;  2NNY A;  4G6Q A;  3BPV A;  1JHF A;  2P6T A;  3GO5 A;  1ON2 A;  3EUH A;  1RI7 A;  2YU3 A;  2ESH A;  3P9I A;  3KFW X;  1D5V A;  1R23 A;  2A07 F;  3WG9 A;  4AVP A;  4ASN A;  3CUO A;  2XKP A;  3JAM Z;  2V1D A;  4EM2 A;  3J7A O;  5FD5 A;  4P9U A;  4U7B A;  4LB5 A;  5BMZ A;  1WRJ A;  2FNP A;  3H3Z A;  4OIN F;  3MFK A;  1F1Z A;  2O03 A;  3N97 A;  3KP4 A;  2E1C A;  2LKP A;  1U8R A;  1I5Z A;  4QLC U;  3F3X A;  1U6G A;  3WTY C;  3SQN A;  2G7H A;  4QWQ A;  4RB2 C;  4DNC A;  4PDK A;  2FBH A;  1YIO A;  2CYY A;  2VOD A;  3LAJ A;  1FLI A;  2DLL A;  4HZF A;  3E6M A;  1ZYR F;  3HRS A;  1HW2 A;  1FP1 D;  2CW0 F;  1YTY A;  2PJP A;  1V4R A;  1KGS A;  1T2K A;  3R0J A;  3FZV A;  1B9N A;  3GFJ A;  4KFC A;  2HGC A;  2W84 A;  3R61 A;  2HYF A;  1UFM A;  1YW8 A;  4LJZ F;  1IF1 A;  2M5W A;  4OIO F;  1P4X A;  3VB2 A;  3KZZ A;  5ILS A;  1JXS A;  4N9H A;  4AWX B;  3NEU A;  1YS7 A;  1YYV A;  3O2P E;  4RB3 C;  1SMY F;  4YG2 F;  2IA0 A;  5HVQ C;  2MH2 A;  2ESN A;  3TO7 A;  2VOO A;  3ECO A;  4NQW A;  3HOT A;  1R5G A;  3FF5 A;  3E6C C;  2MH9 A;  2P4W A;  5LBQ A;  4B09 A;  3SXY A;  1QQI A;  4BQA A;  4ZYH A;  2F5C A;  4FT8 A;  1S7O A;  1K78 B;  2IT0 A;  2GIV A;  1RUO A;  1H9T A;  2RDP A;  2DPD A;  2P5V A;  4EJU A;  1G4D A;  3I58 A;  1R22 A;  1ZLJ A;  2JTV A;  4GYG A;  4LD5 A;  2CG4 A;  1OPC A;  3R60 A;  1MD0 A;  1TQP A;  5H6Q A;  4CDG A;  1FZP B;  1J5Y A;  4UXN A;  4WXD A;  1J59 A;  1FT9 A;  4LK0 F;  3ZMD A;  1T6S A;  3WGH A;  3WE2 A;  4M6Y A;  1KU2 A;  3VFZ A;  3RTR A;  3TOB A;  4IVN A;  1EV7 A;  2XAJ A;  1PUE E;  3ZPL A;  5DCM B;  4KIG A;  4XRF A;  4CZZ A;  5AON A;  3BOQ A;  2OA4 A;  2FRH A;  2RNJ A;  1UST A;  1QGP A;  4ENJ A;  1WI9 A;  4M74 A;  5E18 F;  2O61 A;  1OKR A;  1W5S A;  2ZBK A;  2IW5 A;  2PN6 A;  3L09 A;  5LHI A;  1B59 A;  1MZB A;  1X3U A;  3I71 A;  2UXX A;  4HA8 A;  4UVB A;  3KCC A;  2O6G E;  1W5T A;  2IRF G;  1BIB A;  4BNC A;  4G7O F;  2HEO A;  2QEN A;  1SFE A;  3BWG A;  3IRR A;  2DU9 A;  4WXC A;  2W24 A;  3KLO A;  1ON1 A;  2PMU A;  4L18 B;  4L5I A;  1Q1H A;  1EH8 A;  2QQA A;  4IPA A;  5FGM A;  3GFL A;  3CJN A;  4EJW A;  2ZFW A;  5K5Q A;  5DCM A;  1ODD A;  2XKO A;  3E6B A;  2FEZ A;  3KEQ A;  4FX4 A;  2Y0M A;  3OOP A;  2FBK A;  1XSX A;  2HTJ A;  2RN7 A;  2KKO A;  2HWV A;  1O3R A;  2X0L A;  4HYE A;  3T8T A;  3ZMU A;  2DQR A;  3K69 A;  1REP C;  5E8I A;  2FSW A;  2DT5 A;  2CWE A;  5HLG A;  2O0Y A;  2UZK A;  2MD5 A;  5HDK A;  3CUQ A;  1KU3 A;  4OMY A;  3HSF A;  5IT9 Z;  4HF2 A;  5DEQ A;  1FYM A;  4L9T A;  3IKT A;  1HSJ A;  1Z9C A;  4ZH4 F;  3U1D A;  1P6R A;  1WSU A;  1KYZ A;  3MCZ A;  3GFM A;  5TJJ A;  1HQC A;  4KYW A;  4UUV A;  1H0M A;  4O5V A;  1J75 A;  1IN5 A;  5DD8 A;  4JBA A;  1DPU A;  2KRF A;  4L9N A;  3B02 A;  3HRT A;  3I0T A;  3O3K A;  2VT2 A;  3J80 K;  2IVM A;  5E20 A;  2EA4 A;  2QQ9 A;  2VBX A;  2DK8 A;  2AXL A;  5BS6 A;  3WGG A;  4OU0 A;  3LA3 A;  4PZJ A;  4A6E A;  5D5V B;  3K1M A;  4L9V A;  3BP8 A;  5HDG A;  1GXQ A;  3V7S A;  5FLX Z;  5D5U B;  5DV5 A;  4G8X A;  3I59 B;  1O57 A;  1ULY A;  1BI3 A;  3KEO A;  1K6O A;  4EVI A;  1B1B A;  4S05 A;  1DDN A;  2Z9O A;  5L3B A;  2E7W A;  4NHJ A;  2DO7 A;  5CJ9 A;  1IUY A;  2NRA C;  5TRD A;  2FOK A;  1G3T A;  1LEA A;  3I53 A;  5KK1 A;  1XMA A;  4I02 A;  4EJT A;  4GO1 A;  2PEX A;  2PBI A;  3FHZ A;  1JE8 A;  3DP7 A;  4KDP A;  4G9Y A;  2VBZ A;  5DD4 A;  4ETS A;  3BJA A;  4BYY A;  1FPQ A;  1BBY A;  5DUK A;  4HDV A;  1QPM A;  2EB7 A;  3QRF F;  2IA1 A;  4WWC A;  3TGN A;  1ZN2 A;  1HW5 A;  2XAS A;  4RB1 A;  1YG2 A;  4M6X A;  2H6B A;  1RUN A;  5A2Q Z;  2ZNZ A;  3L9F A;  4Y13 A;  1LB2 A;  1OR7 A;  3LA2 A;  3IHU A;  2M87 A;  3BDD A;  4RB0 A;  4HV5 A;  3H92 A;  2CGP A;  4Y15 A;  1S6L A;  3TQN A;  4MQ9 F;  4UVC A;  3V4G A;  1Z1D A;  3C7J A;  3M9A A;  4MEY F;  2QBY B;  1WKM A;  2EJR A;  3I4P A;  1XGS A;  4BHC A;  4GXO A;  3COA C;  3T1B A;  2OU2 A;  4EMS A;  3GLX A;  3N4M A;  1IN6 A;  4XSZ F;  3GZ6 A;  5F1R A;  5D5X B;  2OQR A;  3K0L A;  2ETH A;  3IKV A;  3S2W A;  1FSE A;  2F5D A;  4IXA A;  1IRG A;  4MHG A;  2COM A;  2FXA A;  1D3Y A;  5ILU A;  4MGR A;  4A12 A;  3FXR A;  3U9G A;  1FNN A;  1HBX G;  4IJA A;  2EFO A;  4FX0 A;  4U88 A;  2JT1 A;  1FP2 A;  1KQ0 A;  4EM1 A;  1ZG5 A;  4A0Z A;  3HIF A;  3QPH A;  4D0P A;  2V9V A;  3K1N A;  4HDU A;  4KMU X;  4UV9 A;  4YII A;  4M9Z A;  4ON0 A;  5JI6 A;  4A0X A;  1XCB A;  2QBY A;  1LQ1 A;  2A68 F;  2WC2 A;  5HDN A;  2MC3 A;  1MKM A;  1QNT A;  2HFH A;  3ABU A;  3D0S A;  1QBJ A;  5CYV A;  3KP2 A;  2G7U A;  2L4M A;  3R0A A;  2GQQ A;  2QYO A;  2HDC A;  3Q5F A;  5L3F A;  3IRQ A;  3E5U A;  1LVA A;  1PP8 F;  1USS A;  5LHG A;  3F72 A;  2OZ6 A;  1R58 A;  2OQG A;  2QWW A;  1O3S A;  3LFK A;  1T98 A;  2GXG A;  3ZP5 A;  3IL2 A;  5D6F A;  4E70 A;  1R7J A;  1I1G A;  5LRR A;  2QQB A;  3Q9V A;  3GUD A;  3LAP A;  3HOS A;  2QVO A;  2D1H A;  1WWX A;  3BJ6 A;  1YW9 A;  2JPC A;  3WU1 B;  2O8X A;  3QAH A;  4XLP F;  5F6F A;  1SFX A;  1ZAO A;  1ZHF A;  3ELK A;  4ZZL A;  4M9S A;  2OBP A;  2KJC A;  4I01 A;  1U3E M;  3K9T A;  2KIM A;  3RYP A;  2O3F A;  2RC4 A;  2LF7 A;  2RV8 A;  3KP5 A;  4F7Z A;  2VC0 A;  1YFH A;  1ZGA A;  2CSO A;  1LDD A;  2VC1 A;  5E17 F;  2EV6 A;  3GZ5 A;  1V3F A;  3LQQ A;  2Y48 A;  2BYV E;  2TDX A;  3ZMV A;  2PLY A;  2ZCW A;  5DYM A;  3EET A;  4AIJ A;  2FE3 A;  3PQJ A;  5DUI A;  4ENK A;  2PI0 A;  5CVJ A;  4P55 A;  2DK5 A;  4MTE A;  4AD9 A;  4HF0 A;  4LLN A;  2XVC A;  3C3W A;  4U0V A;  5FD6 A;  2H09 A;  2D1V A;  3RIR A;  4H0E A;  3EYI A;  3M8E A;  1HKS A;  3GVA A;  2DI3 A;  3RKY A;  1ONV A;  1YW7 A;  2FBI A;  4P9F A;  5L3E A;  2HKO A;  3RPU A;  5IT3 A;  1P2F A;  4Z2Y A;  4KMF A;  1TBX A;  1TQI A;  1J0R A;  1ZRE A;  1R00 A;  3HRU A;  1ZRF A;  2FML A;  4GGG A;  4MEX F;  3W6J B;  2QUF A;  1ZG3 A;  3F8B A;  4A2U A;  1MJB A;  1ZRD A;  4Y17 A;  1U78 A;  2GWR A;  4PGG A;  2KIF A;  2P7V B;  4CXF A;  2E7X A;  2H6C A;  2GZW A;  4LG0 B;  1F9N A;  2YPR A;  2ZO4 A;  1F5T A;  4BAY A;  2YX4 A;  3QP6 A;  1PP7 U;  2K86 A;  2A5Y B;  1Z6R A;  4BXU A;  1I27 A;  4YFK F;  2A6E F;  2P6S A;  4EGY A;  3VOD A;  1CF7 B;  3WE3 A;  1F4K A;  1KU7 A;  1H9G A;  2EFW A;  5CVV A;  5ILV A;  2A61 A;  2Y75 A;  3CUQ B;  4S04 A;  1U5T A;  4XBF A;  3AAF A;  4I7H A;  2M45 A;  2FQ3 A;  2XAQ A;  2YR2 A;  1XGO A;  1G3Y A;  2Z3Y A;  4HX8 A;  5CVU A;  3KET A;  2QM3 A;  4XLN F;  4GCV A;  1D8J A;  5D8K B;  3WOD F;  2W85 A;  1SAX A;  5HS9 A;  3P9K A;  4YIF A;  1J7K A;  3TDZ C;  3HHH A;  2GAU A;  3GXO A;  5CVR A;  3WTZ A;  1OYI A;  1OYY A;  2VN2 A;  4LK1 F;  4LG0 A;  2K02 A;  3L00 A;  3I5U A;  1FWZ A;  3T8R A;  5K5R A;  3TO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...