4IEJA

Crystal structure of a dna methyltransferase 1 associated protein 1 (dmap1) from homo sapiens at 1.45 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
VQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA methyltransferase 1-associated protein 1
publication title Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16282 SANT_DAMP1_like SANT/Myb-like domain of DAMP1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4iejA00
2R92J 1PUFA 1WCMJ 2R5YB 2XB5A 1MH3A 2IEKA 2LR8A 2FJ1A 4M3DA 3OSFA 4X1EA 2XGCA 5EEAA 2LFBA 1JJ8C 2Y0SN 3GBGA 5C3EJ 3ZQCA 2HI3A 1QVTA 2JMWA 3PO3J 2R5ZB 1MBGA 5GPCA 3LNQA 3IH3A 1JTYA 1AKHB 3FIWA 2MGQA 1JKRC 1B8IB 3RQIA 1IDYA 3CQZJ 1HF0A 1WPKA 3JRGA 4FTHA 2JA8J 5IOYA 1Z77A 2H8RA 1F43A 3TW7A 3GTPJ 4JYKA 2ELKA 1T56A 5FKKA 4LOCA 1GVDA 1RR7A 2JK3A 2MG4A 3RKQA 1OCPA 3TP0A 1XG1A 5BNGA 4AUXA 3FK7A 2W48A 3BTJA 2X48A 4W1UA 4D5FA 3HOWJ 2L0KA 2VPRA 4A3DJ 3H0GJ 4A3CJ 4CYCB 1GT0C 5IPAA 5EGOA 3S2DJ 2NVQJ 3MKLA 4XICA 3M4OJ 2TCTA 5FLMJ 3A01A 1I50J 1IC8A 4UUSB 2LKXA 2OF7A 3BG3A 3WHBA 2VI6A 2VKEA 1IGNA 5F0FA 2IBDA 4DZJA 5FLVA 2JJ7A 1JT0A 1ZR2A 3BR6A 3BR2A 5DS9A 4NDLA 3RZOJ 5IOZA 1T33A 2CQXA 4JX6A 3S1RJ 4V2GA 1TWHJ 1BL0A 2EQRA 4DYRA 2P81A 1FEXA 1TC3C 2L7MP 3VPRA 2CQQA 3ZOBA 2LLKA 3BTLA 2Y2ZA 1U9NA 1MBFA 2DA1A 1JTXA 5J1UA 1W0TA 1FIAA 5IP6A 1JKQC 3I4NJ 1LE8A 2M9HA 3ZQFA 1ITYA 1BJZA 4A3KJ 2D5VA 3GTLJ 3S17J 3FKIJ 4J19A 1ETWA 5EZHA 1U9OA 4A3GJ 1VI0A 1IV6A 3LSGA 3SJMA 1MH4A 1WGXA 4G12A 1DU6A 4JP0A 1PUFB 1E3OC 5M5WJ 1IG7A 3O8HA 3BR5A 3FISA 1JUMA 2FX0A 2ECCA 5K7ZA 4I6ZA 3M3YJ 2K9SA 4QSHA 4AC0A 3DEWA 3JRAA 1ETVA 1RKTA 3HOXJ 4D7NA 3Q0WA 2ME6A 1WH7A 2CRGA 5EDNA 1IRZA 1NK3P 1H89C 4D5CA 5EG0A 2FQ4A 2CJJA 3A03A 5FKNA 2K9QA 4BBSJ 2ID6A 2Y30A 1LFBA 4Y52J 2ECBA 2O7OA 1K83J 3NAUA 4IHWA 5EYRA 3SDGA 3ZQHA 2Y9YA 1OFCX 1QPIA 3BT9A 5E3LA 2XGDA 1LFUP 1BA5A 2DA3A 1VNDA 4XRSA 1MBKA 3MVPA 1WH5A 3BG9A 2B63J 5EZGA 5EGOB 2LD5A 1A6IA 1SANA 1UG2A 4XRMA 2LVSA 4D7MA 2E2HJ 1I6HJ 2AO9A 2E19A 2DJNA 1F36A 3D1NI 3BTCA 2GM4A 4JX4A 2G0EA 1ETOA 4GFBA 3HM5A 4B3AA 2I10A 3JR9A 2DMQA 3IV5A 1U78A 1S7EA 3HGGA 2CU7A 1X58A 1MBEA 2PMZN 3K2AA 2RAEA 5J1RA 4QTRA 1APLC 2EZLA 1ETQA 2K9NA 1HOMA 1P7IA 1U8BA 3Q3SA 3NARA 3H3VK 1VF9A 3JREA 2XPUA 1R9TJ 1LE8B 1B72A 2DMPA 2R93J 4JX5A 5K7HA 3JRDA 2HQ5A 3HOYJ 2EZKA 3Q0VA 5FKMA 2DMTA 2FD5A 1OCTC 4A69C 5M5XJ 1K61A 4A3FJ 4DZPA 5J1YA 2E2IJ 3LSRA 3HGYA 5GPAA 4UUTA 4A3EJ 3S1MJ 1H88C 3E7LA 1W0UA 1FIPA 4IHVA 1D5YA 1A5JA 2WAQN 3QQAA 2WV1A 5GP9A 3S16J 2HOTA 3A02A 1OJLA 2DA2A 3LSJA 5F27A 4S0HB 1AHDP 3ZQLA 4A3BJ 2XB0X 2DA4A 2NOGA 5IYCJ 1JKPC 3GTMJ 1Q1VA 4I76A 1ZKGA 1NK2P 2COBA 1TWGJ 4ABZA 3S15J 2HOSA 4MFEA 3BQYA 1AU7A 1RETA 4Y7NJ 2QF7A 4M6VA 5IP9J 2CUEA 4M3BA 4C3HJ 1Y1WJ 1HCRA 3HOZJ 4BXXJ 1O4XA 1YRNA 3HBLA 4A3JJ 2LP0A 3S14J 1GV2A 1JUPA 3DCFA 5FJ8J 5J3LA 2KDZA 1HLVA 1ZQ3P 2YUSA 1MBHA 1GV5A 3O8GA 3L1PA 1X2MA 5C4XJ 1ETKA 4FCYA 3TP3A 3BR0A 2R0QC 1Z0XA 2DTZA 2GBYA 3B6CA 4L5EA 1TWCJ 3GTKJ 2XPWA 1IDZA 3TW6A 1FTZA 3JRBA 1RKWA 3LOCA 4BBRJ 2QCOA 2JN6A 2X6OA 5M5YJ 2EH3A 4A3IJ 2VUMJ 2JA7J 5JLWA 2YS9A 4RBOA 4BY1J 1JKOC 3BR1A 4DYQA 1I3QJ 3CDLA 1MBJA 4IEJA 3JRFA 2XSDC 4IHYA 2E1OA 2M8GX 4DW6A 4C3JJ 3W6VA 3OIOA 2N8GA 3ZQGA 3A01B 2DN0A 3OOUA 1ZTRA 3Q0UA 2GLOA 2IAIA 1JUSA 2AHQA 3IH2A 5F08A 3I4MJ 2L7ZA 4IHXA 3IH4A 2M0CA 3BQZA 1CQTA 2ID3A 5FKLA 5K7FA 1EF4A 5DTDA 4MIMA 5F1JA 3FK6A 2E2JJ 4FE7A 2M34A 3UKGA 1JGGA 1FTTA 4DYCA 2XGEA 5E3NA 3HEFA 3HKZN 1GDTA 2H1KA 1ZGWA 1WI3A 5IYBJ 1P7JA 2YU9J 1ORKA 3OSGA 2M2EA 2XRLA 4MLOA 2HXIA 5IP7J 3JRIA 4A3LJ 4XIDA 4AYBN 5C44J 3JRHA 1DU0A 3G1LA 2MW8A 1TWAJ 2JA6J 2XPVA 4BY7J 2CUFA 4EEFG 3BTIA 1IJWC 2NS8A 1SFOJ 2HXOA 5M3MJ 2NVXJ 2JA5J 2R5YA 2L9RA 1BW6A 1POGA 2EBIA 4BKXA 3TEDA 4RDUA 2KT0A 4M3GA 1RESA 4QIWN 3SFIA 2LK2A 1FJLA 5FKOA 5F0HA 1Y1VJ 2NVTJ 1BW5A 3HOUJ 3GTQJ 2HOAA 4FISA 1YRNB 2Y31A 2R5ZA 1G2HA 3MN2A 4A93J 3PO2J 1AKHA 4X6AJ 2OPTA 1RPWA 4B1RA 3BG5A 1X2NA 1B8IA 4V2FA 4M3EA 3ZQIA 5IYDJ 4B4CA 3WHCA 5EG0B 2DA5A 2ME0A 3F0CA 2VKVA 2DA6A 2DMUA 3GTJJ 3S2HJ 2MSYA 2O8KA 3HOVJ 3GTOJ 2TRTA 2Y9ZA 2ZB9A 5M3FJ 3B6AA 3C2BA 3HDDA 3PM1A 2NS7A 2DMNA 5HODA 1NTCA 1MSFC 2HYJA 3JRCA 1XC5A 4XK4A 1MNMC 1GUUA 1QRYA 2WB1N 4CYCA 4W97A 3CMYA 3RZDJ 1XS9A 4M3FA 5F04A 1UHSA 4UUSA 1UMQA 2LY9A 3G1MA 3S1QJ 1ZR4A 3QPSA 1MSEC 2EZHA 2X9DA 3K7AJ 3LSPA 1HDPA 3CCYA 2O9LA 4HNVA 1JT6A 5E3OA 5C4JJ 4XRSG 1ENHA 4C2MJ 2JWTA 1ZK8A 5JLXA 4MO7A 2HDDA 1IUFA 1JJ6C 2DA7A 3BR3A 2EZIA 2L7FP 2R7ZJ 9ANTA 3QPLA 3GTGJ 1TWFJ 2LTPA 3S1NJ 3HB9A 4FE4A 3G1OA 1HDDC 1ETXA 5E3MA 1H8AC 1ETYA 5F0CA 4A3MJ 1B72B 2K40A 2NVYJ 4MFDA 4C3IJ 5EF6A 1VFCA 1QVUA
chains in the Genus database with same CATH superfamily
2R92J 1OISA 4BE1A 3V8LA 1LKXA 2EK5A 4XLCA 1Z6TA 2LR8A 4NQWB 4RS8A 4DIQA 4X1EA 4HPQA 2XGCA 5K1YA 3GFIA 1G3YA 1UAAA 1O7LA 1T39A 3BPXA 1TW2A 1VQMI 1W7PB 3ZPLA 3MCZA 3F3XA 2VE8A 4J01A 3V42A 1QZZA 2MGQA 4LG0A 5HNFA 5JI6A 2NVUB 3PIOF 5L3FA 3CQZJ 5E17F 1WPKA 1K6OA 3CF5F 3JRGA 5H6QA 1SD6A 3D5LA 4PDKA 4O3MA 5IOYA 3MKWB 1F43A 3AFHA 1R5GA 4JYKA 3MFKA 2FNAA 2CQNA 1ZH5A 2FA5A 1T56A 3DPTA 3CUQA 1GVDA 4LOCA 1S9HA 3DF8A 5ICEA 3G73A 1CF7A 3ECHA 2E1NA 3WTYC 2X48A 2BEOA 1FC3A 2HKOA 2VQHA 3JAMZ 2COMA 4LITA 5EJCA 1YS6A 2NVQJ 3GZ6A 4NC6A 1I5ZA 3MEXA 5ERIA 3V7RA 5E1WA 3AKZA 5FLMJ 2H09A 5HLGA 2KJBA 2VI6A 2VKEA 5AIQA 1LQ1A 2CYYA 3WGHA 2IBDA 1N75A 1BN5A 4CCMA 2K5CA 4F7ZA 2QEXI 5FLVA 1JT0A 1PP7U 2E36A 1ZR2A 3BCAA 4HNTA 1KQ8A 4PGGA 4HDUA 1T33A 3HKZA 4JX6A 3S1RJ 4EM2A 1JI8A 1X19A 3HXLA 3CP2A 2V9KA 1FEXA 4HA8A 3SZGA 3VPRA 1VTNC 2PBIA 3BTLA 1MIJA 5K5RA 3F9KA 2M45A 4MQVA 4CDGA 2GA1A 1MBFA 2DA1A 2CV0A 4EJVA 1EV7A 1JTXA 3Q9VA 1R49A 4BXFA 5CVIA 3W6KB 2W84A 1FIAA 4RGXA 4XLPF 3CO7C 1LE8A 4II2A 1SD7A 4MQ9F 2O3FA 3K4NA 2D5VA 3GTLJ 3IL2A 3QPTA 2K3FA 5EZHA 1U5TC 2FBKA 5JVGF 1VI0A 3SJMA 2Q2EA 3CDIA 3H5NA 1E3OC 5M5WJ 5BOXA 2V1NA 4HSTA 3HUGB 5FGMA 1JUMA 1W5SA 1R23A 2QUFA 3H5AA 3VYRB 1F4KA 3M3YJ 4QSHA 1FP1D 1D0ZA 4DGWB 3JRAA 3GFLA 3ZGKA 1PYVA 1WFXA 3Q0WA 4LB6B 1WH7A 2QBYA 4F92B 1XPXA 3W2AA 5CPRB 3LQQA 3SYTA 1YS7A 5ICGA 1Z1DA 3A03A 1IXRC 2EA4A 3LSHA 2ID6A 2Y30A 3E6MA 1G3WA 5IT9K 2O7OA 3F72A 2GAUA 4DOZA 2OUMA 5EYRA 3KLNA 3SDGA 3KZYA 2IXSA 2ZO4A 2HQRA 4I2OA 1K78B 5HDNA 4AIJA 1BA5A 4AIDA 4P96A 2XROA 2R7OA 1ULYA 3MD2A 4XRSA 3LAJA 1MBKA 3MVPA 1O7FA 4G7OF 2IW5A 5EGOB 3LL7A 4LG3A 2CO5A 1A6IA 3H35A 1D1BA 1OYYA 4I01A 4RB0A 1Q1HA 2QGUA 2E60A 3DU6A 2ISZA 2R7DA 4D7MA 2E2HJ 5TISC 1HQCA 5ILSA 2E19A 1F1ZA 1UB9A 1Z6RA 1F36A 2DJNA 3D1NI 2DYSH 2K4BA 2XAHA 1YJ9I 1ETOA 2E5ZA 4GFBA 5DUKA 2ZC2A 2KMUA 2DMQA 1U78A 2NXNB 3HGGA 1XX5A 4RLFA 3V7CA 3GZ5A 4AIHA 1IUYA 2RREA 1QZEA 3HSRA 3R60A 2K9NA 2JA2A 1NG6A 4ENKA 2PJRA 1U8BA 2L7KA 5HDKA 2F6CA 1TZLA 3E97A 4HRIA 4WCGA 3VWBA 1SEUA 2EB7A 2QENA 3V8JA 2IRFG 4MEXF 4EJUA 2UUZA 3F21A 2CFXA 1R9TJ 2MD5A 1B72A 2QQ9A 3F8FA 2DMPA 2K02A 1R4NB 2R93J 2WY7Q 3E1SA 3ZN0A 2H1LA 1XGNA 3QPHA 2DMTA 2EFOA 3FXJA 2RQQA 4LFUA 1O3TA 1UG0A 3CZ6A 3OV8A 5HS7A 5J1YA 1QBJA 2XKOA 1R5HA 4A0YA 3ABTA 3CJNA 4ZJZA 2IT0A 1YLFA 2FMYA 3K1PA 1S7AA 1P4AA 3QQAA 5GP9A 2IGOA 3ZMTA 2YU3A 3D5SC 1VQKI 2OTJI 1TQPA 1KGSA 4CHUA 2IS2A 2KKOA 4A3BJ 2DA4A 3G4SI 1JKPC 2XAFA 3HOSA 4HX8A 1G6NA 2RC4A 2HNHA 3PIPF 4CGZA 2IA2A 3DQVC 3B73A 4WF2A 1XTAA 1XSDA 2WC2A 1HW1A 1DDNA 4KN7X 1AU7A 3WG7H 1U6GA 3G3ZA 1YIJI 5F6FA 2ZCWA 3V7SA 4A12A 3KP4A 1MDMB 1ZN2A 4LLGF 4M9XA 1HCRA 4BXXJ 1BC8C 1BI2A 1V5GA 1R58A 4PZJA 5J6XA 4KIBA 2DFEA 3S14J 2HZTA 5DV5A 3F23A 3R0JA 5J3LA 5CVVA 3CLOA 4KMUX 2KDZA 1ZQ3P 1IXSB 2HPIA 3AG2H 4JOMA 4P9UA 2F4IA 5FD5A 2P5KA 3O2PE 2R0QC 4RB1A 2M5WA 1A31A 2DTZA 3OYNA 1YIOA 1TW3A 3L00A 2UWMA 3BZ6A 3H9QA 5LRSA 4XQFA 3A2KA 1KU9A 2DQLA 2JN6A 2X6OA 2EH3A 3I3LA 3DKYA 5M5YJ 2ZFUA 3FZVA 5DYMA 2DCEA 3OIQA 2QSHX 3BY6A 2BY1A 2VT2A 4N4NB 4DYQA 2W24A 4XLHA 1IO2A 3IC7A 2OQRA 4AVZA 4CYDA 2LY2A 4IEJA 3GFJA 2HYFA 2K9LA 2M8GX 4A0ZA 2LH9A 2ZFWA 4L9VA 1X1PA 4C3JJ 2CW8A 3A4CA 4LMYA 3OIOA 3ZQGA 3BJOA 3A01B 3ZXSA 4CZCA 3OOUA 2EPFA 2AS5F 4ETSA 3QP5A 4IJAA 3KP3A 3IWFA 2AHQA 3FMQA 3I4MJ 1BR4A 1PJRA 5D5WB 3NWTA 2L7ZA 5H6RA 1ERDA 1SAXA 3QYEA 3SEZA 2BW3B 2M0CA 1X1AA 2OV7A 5DD8A 4A5NA 2ID3A 4B47A 3FDYA 5K7FA 4BQQA 4MIMA 4IRGA 3FK6A 4S05A 3UKGA 3EUKL 2O0YA 3L2UA 1J2XA 4Z2YA 2H1KA 2X6WA 4U0VA 1WKMA 2CG4A 5IYBJ 2YU9J 1MD0A 1ONVA 3WTWC 3A0BC 1YW8A 2HWVA 2XRLA 4XIDA 5C44J 3LA3A 1DU0A 5GTIC 3CESA 2JA6J 3BOQA 4BY7J 1MJAA 1EH6A 2OCEA 2RDPA 4GO1A 2GA2A 3T1BA 2XAJA 2NS8A 3S8PA 2AQFA 2EIJH 3PQKA 5L3DA 2R5YA 4JQFA 1R1UA 1Y56A 3M9AA 4JK1X 5CKTA 5E8IA 2EA2A 4QIWN 2LK2A 1FPQA 2ZXIA 5FKOA 2JT1A 3HOUJ 3GTQJ 3SZTA 1YRNB 2Y31A 2M1BA 2R5ZA 4GYGA 4XN3A 4XRFA 1LPQA 4A93J 2K3PA 2RV8A 5HLHA 2KP6A 1D1AA 4P9FA 2VT3A 2BZTA 2DT7B 2MA3A 1WJEA 2PMZA 4M3EA 5IYDJ 2D1VA 3OS2A 2KZVA 2QYOA 4V19K 2F5CA 2DA5A 3GTJJ 1FX7A 2MSYA 4F91B 3QU6A 3FHNA 2R7SA 4AM3A 2P7CB 5L3EA 3E6CC 3ZMDA 3CUOA 4AU7A 2DMNA 2UXXA 4XLEA 2HYJA 1ZGAA 2X0LA 3S2WA 1KU7A 4D0PA 2JSPA 4Y13A 4W97A 4N4OB 1VQ6I 3LSMA 3H0DA 1ON1A 4OIRF 3RPUA 4HV5A 1JHHA 2M4GA 1XMKA 3I58A 1UMQA 2DU9A 3CMAI 1LEBA 1FYMA 4S04A 2YX4A 3KYDB 3WTVC 1A04A 1WJAA 2XF5A 2BHYA 3JAMK 3FX3A 1PDNC 1U0JA 3TMOA 2MABA 5E3OA 2E1MC 5C4JJ 3R0AA 4XRSG 3OYMA 1HBXG 1OQYA 4HX4A 2DT6A 4FQGA 4MO7A 2HDDA 1IUFA 1JJ6C 2FU4A 5J40A 1OYIA 4BDYA 3HRUA 5JFRA 2XC7A 4IRHA 2WAEA 3HIFA 1ETYA 5F0CA 1FWZA 4A3MJ 2K40A 4MFDA 4EQQA 2J5OA 5EF6A 1X3WB 3KEQA 2VODA 2JUGA 5L3CA 4L0YB 4OAZA 3E6BA 2LF8A 2Y48A 1RC9A 5DCMB 4IOCF 2EFNA 2PQ8A 3K1NA 2XB5A 1MH3A 2WTEA 1AA7A 1R1TA 1TTYA 2IEKA 4IHSA 2AQEA 2FJ1A 4M3DA 2A6HF 5EEAA 3C1DA 2ZXJA 2LDUA 2VIXA 2PMUA 1JJ8C 3WE3A 2IVMA 5J8CA 2STTA 3CJQB 4KMFA 2JMWA 3JTHA 4LK1F 4LIVA 3VODA 1REPC 5GPCA 3LNQA 2Z2SB 1R1VA 2OU2A 4EJTA 3OS1A 3FIWA 1KONA 2CQ7A 2LREA 2IPQX 2W00A 5LGUA 1B8IB 2DLLA 3BWGA 1HF0A 4FX0A 3BP8A 3DP7A 1L3LA 2JA8J 5CVRA 2H8RA 2B7EA 2EV5A 2LSOA 2UV1A 3D5RC 2EFWA 4CO8A 2DODA 4CSWA 2CGPA 2ELKA 2MG4A 4N9IA 3BTJA 3M1EA 4W1UA 4UB6C 1VQ8I 5FROA 5LEJA 2VKHA 4L9NA 4H0EA 4BQAA 3GVAA 3ERED 4GYIA 1HSJA 1IF1A 5LRRA 4RB2C 3M4OJ 3KZIC 2EWNA 3A01A 1I50J 2R3SA 1IC8A 1T0FC 3SHFA 2OF7A 3BG3A 4EM0B 1K79A 3WHBA 1E0EA 5F0FA 4WX9A 3A0HC 2JJ7A 1BJAA 2V7FA 2ZNZA 3M07A 4Y15A 5DS9A 1KQ0A 1U2WA 2HVQA 2YX7A 3DLAA 2HEOA 3H1CA 3KZZA 2DI3A 3DBRB 5H20A 2EQRA 2Y75A 4AD9A 3TL4X 4E7IA 1E2XA 1TC3C 2L7MP 3OL4A 2ICWG 3D0SA 3KLOA 3PNYA 2LLKA 4BH9A 1K4TA 5LHHA 2BV6A 4R8HA 4P5OA 1RNLA 2L01A 3C2HA 1P4XA 3UNGC 2UXNA 4P1WA 1JKQC 4ENNA 1UHWA 2BHZA 3ZQFA 1N77A 2FEZA 3K0LA 2X1CA 5FRMA 2LC2A 3DTEA 1SFEA 5E79C 4EATA 2DQRA 3KEOA 1UHMA 2IJLA 3IAS2 3CC4I 4BGDA 2K4JA 3P9CA 1OLTA 4E6KG 4G7ZF 2DK8A 2FBHA 3MZ8A 3U9GA 1HKTA 4JP0A 4XKWA 3RTRA 1PUFB 2VOOA 4IPAA 2R7XA 1I39A 3E6DA 3MKZA 2ECCA 2FX0A 5K7ZA 4I6ZA 2K9SA 2QQAA 4YELA 3U21A 2JZYA 3DEWA 1ETVA 3H92A 4D7NA 2KDOA 2KRHA 1JGSA 4KA4A 2CRGA 5EDNA 1OKRA 2P8TA 5LBQA 1YG2A 3K10A 2F5DA 4OWRB 3OYLA 3H9JA 3KE2A 2FQ4A 1R71A 1T6SA 2R7TA 5FKNA 2K9QA 2HZDA 2GOXB 1ZARA 3TOBA 4OU0A 1Z9CA 2QSGX 4NC8A 4OOIA 5DM7F 4Y52J 1FOXA 3H5RA 2WB1A 3NAUA 4ZDPA 2BXZA 4EGZA 4LK0F 3PUFA 1IN6A 1QA6A 2XGDA 3K4MA 2E7WA 2QQ8A 3ABUA 3L2WA 1S5LC 4P55A 4U0YA 4M72A 4CXFA 1FT9A 1WH5A 3KYLA 3EPZA 1M1EB 4CCNA 3HC7A 3MQ0A 3DWLE 4XR6A 2IP2A 4E7JA 2LD5A 2B63J 2AXLA 2BY3A 4GXOA 1UG2A 3FXUA 2VOPA 2ZJQF 3HPHA 2ZXWH 3L7WA 3A1YA 3KP6A 1KYWA 3ONQA 3RDIA 3DV8A 2C6YA 2WWYA 2LMDA 2GM4A 2IGNA 4G94A 2VJIA 4JX4A 3ULQB 1EH7A 1GHCA 4B3AA 2I10A 2DW4A 3WG9A 5LGTA 1S7EA 2CU7A 1MBEA 3GZNB 1QGPA 4I0BA 3K2AA 4TV7A 2RAEA 4QTRA 1W5TA 3GLLA 1C0WA 1ETQA 2XASA 2R7FA 3H3ZA 3K70D 1USTA 2BOLA 2DT5A 3BCBA 3KP5A 3VB2A 1DPUA 5LGNA 3JREA 2WAFA 2QZ8A 3PSIA 3V4GA 1VQ9I 2F5EA 3W6JB 5BPDA 2BE5F 2Y0MA 1ZREA 5ED4A 2FBIA 1R22A 1XMXA 3IRRA 3P9IA 4GRIA 4UB8C 1TQMA 3QOPA 2Y0SA 5LHIA 4M9SA 3VYUB 5KK1A 2FD5A 4G9YA 4U7BA 4ESBA 3EUHA 4KISA 4KDPA 1YYVA 2HVSA 2E2IJ 1SC7A 4G6QA 2CUZA 2IGMA 4A3EJ 1S29A 1FIPA 2F5VA 4U87A 2FRHA 5EEGA 4AYBA 1A5JA 2WAQN 2FE3A 3L2VA 2GIZA 2K9MA 4OAYA 2B0LA 2XAGA 4RGRA 4E70A 1Y0NA 1YW9A 2CQKA 2XRNA 1OJLA 3PFYA 4E7HA 2DA2A 3BJAA 1ODDA 2XKPA 4S0HB 1T38A 2OTLI 4D1QA 4RGUA 3LQRA 2NOGA 5IYCJ 1VQ5I 2VN2A 1ZLJA 4EJOA 3HL2A 4LB5A 2RVCA 3X2QH 4ABZA 1R5ID 2A61A 4F3QA 1P9QC 3BQYA 4QPQA 5D8KB 3F6VA 4M6VA 2M8EA 1LFPA 3GLXA 4BQOA 1J59A 1X1BA 2ZMEA 4LJZF 4M3BA 1Y1WJ 2JQ7A 2DJIA 4A6EA 3LAPA 4HZFA 1N25A 4A3JJ 2NYXA 3DEEA 2XHKA 2BVMA 2EILH 1Y8RB 1D8KA 3J7AO 1D3YA 4G6DA 5LFAA 3L2QA 1D0XA 2DOEA 3J80Z 1HLVA 2YUSA 1XGOA 1BI0A 2JVGA 2OC6A 1MBHA 3HZJA 3O8GA 3PNVA 1X2MA 4UNOA 4B3XA 1SD4A 4FCYA 4XBFA 1DGRM 2B9SA 4KT6A 3MMYB 3ZRGA 4HLYA 3GTKJ 5EEHA 4D9JA 4ZYDA 1IDZA 3S3OA 2HR3A 2MH9A 3JRBA 3LOCA 4YFNF 2Z9OA 2VUMJ 3CCQI 1U5TB 3R61A 4ZDOA 4RBOA 1ZG5A 3ECOA 3FXQA 4C2TA 2KLOA 1MBJA 3JRFA 3F8BA 2XSDC 4IHYA 3C18A 3N4MA 2VQGA 1O3RA 2N8GA 3ROUA 1BOAA 2DN0A 2Z33A 1ZTRA 2GLOA 2IAIA 1OR7A 2LY1A 1JUSA 4DBRA 2M7BA 5B5EC 2OD5A 3E5UA 1B6AA 3IH4A 1O57A 3BQZA 1CQTA 1EJ9A 3TOAA 4Q47A 1QZYA 3ISPA 5DTDA 4ON0A 2ZSHB 5HVQC 3HG9A 1Y39A 2V9VA 4ITVA 2WV0A 1JGGA 2R7VA 3WU0A 4A5MA 4A0XA 4DYCA 3I0TA 1STZA 3DTIA 3HEFA 3HKZN 1P7JA 2O6GE 2NRAC 3BZKA 4YRVA 2R7UA 1CGPA 1SD5A 1UCRA 2IS4A 1YHQI 2HXIA 5IP7J 2ZXHA 2YSRA 4AYBN 1LNWA 3G1LA 2CV2A 3K1MA 2XPVA 2YPRA 2CUFA 2KIUA 1O3QA 3W3CA 1W36D 3BTIA 2HOEA 3H36A 1QHGA 4WK8F 3C2GA 3DLLF 1Z67A 2EBIA 1FYLA 4BKXA 4NQWA 1MJBA 1FJLA 3SFIA 2LKPA 4E7SA 2W7NA 1Y1VJ 2VJ4A 1OCCH 3TBIA 1YOVB 4I02A 5H2FC 2BBYA 1W7PA 3I71A 2MC4A 3FKJA 5K5QA 4RAFA 5K5OA 1QPMA 1WJ5A 4HYEA 4Y3OA 4B1RA 5D4RA 1GVJA 4XN0A 1OCZH 4UVBA 3CMMA 2DOAA 3SQNA 3CCUI 4BEHB 4B4CA 4M6YA 4NC7A 2ME0A 1S3JA 2W25A 1V5FA 2E1CA 4HLXA 2DMUA 4R79A 2VB6A 3S2HJ 4PGHA 3OYBA 1G59A 4MNUA 4PSXA 1QO0D 1SVLA 4XKBA 4ZYGA 5M3FJ 3B6AA 3HDDA 3PM1A 4EMSA 1XC5A 2ZBKA 2KRFA 4CUGA 4E4HA 3VEPA 3K4CA 2K7LA 2NNYA 5J47A 4M3FA 5F04A 1UHSA 2KISA 2A07F 2KFDA 3F8MA 4I7HA 3RPQA 3LFKA 3S1QJ 1ZR4A 3LSIA 1J75A 1X4OA 1XGSA 2CH0A 2X9DA 3UR3C 1OMIA 2CW0F 4DNCA 3LSPA 2PEXA 3I5UA 1HDPA 2XSJC 1ZG1A 3CCYA 2O9LA 3OYIA 1JT6A 1R6RA 4FX4A 4PSWA 5GAHJ 2WY8Q 4C2MJ 3KYCB 1DGWY 2A05A 1ZELA 4II3A 1NG7A 3BG6A 1UFMA 1YE9A 2GQQA 4HSRA 1I1SA 1LDDA 2HGCA 1W4MA 2EZIA 3E3VA 2R7ZJ 5IT3A 3NWSA 3QPLA 2E71A 2H6CA 3T8RA 2MC3A 4F52A 1SFKA 1LVAA 3K70C 3HB9A 3S1NJ 4XMYA 1R00A 2DDBA 3QOEA 3OWTA 5E3MA 2LF7A 3QRFF 2KIFA 3H9GA 1E3HA 2ZJPF 1QVUA 4I99C 1RRJA 1P2FA 2H6BA 2DAOA 1YTYA 3NRVA 1WCMJ 1T95A 3TO7A 3L2CA 2D45A 1H0MA 4NB5A 3HUGA 3HTUA 3CCEI 3IP4B 1I3AA 3OSFA 3LA7A 2KZGA 2K85A 4OIQF 3CF2A 1OYWA 2K27A 3EETA 1I1GA 3GBGA 3WTUC 5C3EJ 3ZQCA 1D5VA 2EFPA 2XIGA 2VLAA 1PP8F 2RNGA 5E1XA 4C30A 3PO3J 5B1AH 5KVRA 5LD2C 1YW7A 3IH3A 3OS0A 1AKHB 4HW0A 1JKRC 1IRXA 4KUMA 3CJTB 4PJJA 1UELB 5JHFA 2HS5A 5B3SH 2ACJA 3CP8A 5D5UB 4RLQA 3EDPA 2FQ3A 3TO6A 3LFUA 1Z77A 2LNBA 4UV8A 3TW7A 1MMNA 3MWMA 3GTPJ 1OCOH 2L3DA 1AOYA 5FKKA 3HSFA 2HVRA 1ZRFA 1RR7A 3JW4A 4U0WA 1TQIA 1J0RA 1HW5A 4A2UA 3ZMSA 3TP0A 4CCOA 4XORA 3RKQA 4HEA2 1K78A 2NAZA 3FK7A 4BHCA 3HOTA 3HOWJ 2CUJA 2L0KA 1Y8QB 3LSKA 4A3DJ 3H0GJ 2V1XA 4CYCB 1GT0C 5EGOA 3S2DJ 4A3CJ 3MKLA 2XGXA 4PJLA 2R7WA 2TCTA 2VXZA 3KP7A 2H8WA 1FY7A 4YIFA 4UUSB 2JRTA 1ON2A 1P4WA 4OIOF 4ZH4F 2LYCA 3RSNA 5HDGA 2MLKA 2VQCA 4DZJA 2ELJA 4KT5C 2DDAA 3BR6A 3BR2A 4KIGA 3CJRB 3K4JA 2HPMA 5LHGA 2PI0A 3J7ZI 3FXLA 2CQXA 2XAQA 2IS6A 4MTDA 3IAM2 2ESNA 4DYRA 2P81A 1KZHA 3F8CA 3GFMA 3WODF 1U9NA 1F5TA 4K2EA 4UV9A 3CTAA 1T2KA 4IKFA 1VQ4I 5J1UA 1W0TA 3OYHA 5IP6A 3CCRI 2G7UA 2NS0A 1ITYA 2G9WA 4A3KJ 3CUQC 2QA4I 4J19A 1ETWA 2OA4A 1U9OA 2HQNA 1IV6A 3LSGA 4Q5SF 3OY9A 1DU6A 2VKDA 3BR5A 1VZ0A 1X1DA 1FBSA 4AC0A 4BAYA 3HOXJ 1IRZA 3CCLI 5CQEA 1NK3P 5B66C 3K4LA 4HAMA 3I55I 4O6JA 2CJJA 2O61A 4LG0B 2A5WA 5E20A 1RI7A 4BBSJ 2FNPA 3EUHC 4L9TA 2LG4A 1VQOI 3FXMA 3GUDA 2QLZA 3HHGA 2ECBA 4IHWA 3ZQHA 4BHPA 1OFCX 1IRGA 1QPIA 2LBFB 3BT9A 3CUQB 2RQPA 4E7KA 4Q48A 1LFUP 1CF7B 2P5LC 1MDMA 3HTSB 4UUVA 1VNDA 3U1KA 3CDHA 2A3SA 3W2WA 3P9KA 3AG3H 3I64A 2IA0A 1A6QA 2E1MB 5EZGA 4OMYA 1ZRCA 1SANA 2JVHA 2X1EA 4ZTFA 4XRMA 2LVSA 2QKMB 3VYTB 1BR1A 1DPRA 3KFWX 1IAWA 2ZMEC 2G0EA 1KU3A 3HM5A 2HYGD 1XSXA 5J4VA 5GAGJ 3FBNB 1TT0A 5HLTA 3JR9A 3ZMVA 4CH7A 3J80K 4CCKA 2PMZN 2VC0A 1TNSA 5J1RA 4HBLA 4J00A 1SVOA 2RGVA 1WJDA 4Z6YA 2EZLA 1XCVA 3FXRA 3KPHA 3GYHX 1FP2A 1P7IA 2DYRH 3Q3SA 2E34A 1HSTA 3GX4X 2A6EF 3H3VK 1TLHB 4HF0A 4L5IA 1J09A 1H9GA 1ZHFA 1LE8B 1LVKA 1S6LA 2ESHA 2PFBA 2JSCA 5HOOA 4EV0A 2PLYA 2M3AA 4JX5A 5ICCA 5K7HA 3JRDA 3CD6I 1FYKA 4IQ4A 3C3WA 3HOYJ 2M4KA 2IGKA 3Q0VA 5FKMA 5L3BA 3BG7A 1KU2A 2BW3A 2ZNYA 5LEKA 1OCTC 2Q2EB 4IF4A 3RPUD 4PK4A 4A69C 5M5XJ 5D5VB 4M71A 2F4OB 4YG2F 3IKTA 1T8IA 3AAFA 1ZLKA 4DZPA 3CO6C 4XOTA 3LSRA 3TGNA 3I4PA 5BPIA 4WWCA 1KQ9A 4UUTA 1H88C 3E7LA 3ZN1A 5HNHA 1W0UA 3J7YJ 2GXGA 3IWZA 3KEYA 4IHVA 1BI1A 2A5YB 2FOWA 3MZYA 1FBUA 4XL9A 2QBYB 4KJZA 3LSJA 5F27A 6PAXA 3BJ6A 1YI2I 1AHDP 3M7GA 4BE2A 1IN7A 4XNFA 3GTMJ 3DKWA 1Q1VA 3HRMA 4I76A 3TO9A 3GO5A 1TWGJ 1MMGA 1Z7LA 4PJMA 2HOSA 3K4BA 1V5EA 2K86A 2P0WA 2F5FA 3IRQA 1W1WE 4Y7NJ 3OYDA 5FFZA 2KRCA 3K9TA 3M8JA 4C3HJ 4WXHA 3RJPA 3HOZJ 3LMMA 5E1ZB 4MHGA 1O4XA 5AIPA 1YRNA 3HBLA 4U88A 3VOEA 2DTRA 1SAUA 3FF5A 3OYAA 1GV2A 3QU3A 4XLFA 2VASA 4RA2A 2VBZA 3C7JA 1FOWA 1GLNA 3OYEA 2M87A 1WRJA 2V9PA 3LA2A 1BIBA 2BGCA 2V6EA 1ETKA 3TP3A 2GXAA 3V8KA 1Z0XA 2GIVA 4ENMA 2XPWA 2Z1DA 1LB2A 3CCVI 4L5JA 1U8RA 4KNYA 2XF6A 1RKWA 3WTSC 2QCOA 3WE2A 3ZR8X 2DFHA 4A3IJ 1WSUA 1Z91A 1DP7P 4M73A 1HXDA 3KCCA 3TDZC 1JKOC 3TQNA 1I3QJ 3CDLA 1K4SA 2PJRB 3K2ZA 1B9MA 3L9FA 3O3KA 2E1OA 2X1DA 2Z5UA 1JE8A 3HHHA 4DW6A 1SFXA 1BOBA 4WXDA 3IHUA 5D4SA 3DU5A 2RN7A 4ESFA 4CA0A 1FMVA 3JSOA 2EV0A 1TL8A 2P5VA 3Q0UA 1FZPB 3OIPA 2KQRA 1XB4A 1ACIA 1KYZA 3IH2A 3TDUC 1OCRH 4ENJA 4IHXA 3E0JB 2V26A 3QYFA 1R7JA 2WA0A 3T0YA 2STWA 3DTKA 1J5YA 1EKEA 5FKLA 3CC2I 4DQ2A 5F1JA 2R7RA 4FE7A 4UVCA 2M34A 1FTTA 1GDTA 4PFPA 1WI3A 3E5QA 5A2QZ 3OYJA 2HU9A 4O5VA 1ZRDA 4OIPF 1ORKA 4RGSA 3I53A 4MLOA 3RI4A 4A3LJ 3JRIA 2MYSA 5AONA 2VJ5A 1B9NA 4HQMA 2MW8A 1TWAJ 3EQLF 3QP6A 2KPMA 5ILUA 2FSWA 2E7XA 3ML6A 3OYCA 2LBFA 3EUAA 2GXBA 2JPCA 2M0MA 5DCMA 5M3MJ 4B44A 3FBIB 1BW6A 1K7AA 4DJAA 3Q9SA 3TEDA 3VDXA 4M3GA 1FBQA 5F0HA 2NVTJ 1BW5A 4HF1A 3FM5A 2HOAA 3P5JA 3AG1H 3PO2J 1RPWA 1G4DA 1WVRA 3COAC 1X2NA 2VBYA 1B8IA 3I59B 1TNTA 1UZCA 2DFFA 2EFQA 2NNNA 3OMYA 4V2FA 5FFXA 1AWCA 3WHCA 5EG0B 2ISYA 4B8XA 2QWWA 3MAJA 3DPLC 4N0BA 5B1BH 2DA6A 2Z16A 4HV6A 4BL0B 1YO5C 2BY0A 4RMNA 3PFIA 2P4WA 5D6FA 3GTOJ 2Y9ZA 2ZB9A 5DM6F 2NS7A 5DUIA 4G7HF 4OMZA 2I5UA 2X6XA 1S72I 2A68F 2FXAA 1P92A 1WJCA 2IA1A 1KA8A 1MNMC 1QRYA 2WB1N 3SDBA 2OZ6A 5CVUA 4XSXF 1MGTA 1VQ7I 1XS9A 4G8XA 2V1DA 4EGYA 5IY5H 2D2WA 1GXQA 2UZKA 1E3PA 2MLGA 5J8FA 1WHUA 1XD7A 4XSZF 1Y0UA 5TJJA 3SEQA 5ICFA 2LY9A 4BNCA 3G1MA 4DBQA 3FXOA 4ZC3A 4C9YA 4WXCA 1ZG3A 1MSEC 2EZHA 4H4KC 2DPUA 1LJ9A 3K7AJ 5LLQA 4XKCA 4HNVA 3HRSA 2HTSA 3JSPA 5CVJA 3WGGA 1BIAA 2DXIA 1ZYRF 2RKHA 3OYKA 1ENHA 1DQUA 1OPCA 1F9NA 2JWTA 5JLXA 5D5XB 1RR8C 3PL8A 2O8XA 4LGWA 2DA7A 1HA8A 2L9SA 2V79A 3BR3A 5KCMA 4M6XA 2L7FP 9ANTA 3JCUC 2L2OA 3E5XA 1TWFJ 1MJ9A 2MBFA 2ZJ2A 1X4PA 3G1OA 4EJWA 1S8NA 1HDDC 1ETXA 4Y4RA 1ZGJA 3ERMA 4PUSA 4C3IJ 1T0FA 1VFCA 1HKQA 1U3EM 1BC7C 2EV6A 2D1HA 1PUFA 1MMSA 4RB3C 2R5YB 4XOPA 3N05A 1YJNI 4C2UA 3OYGA 2LFBA 4MGRA 2QSFX 2WBMA 1K6YA 3BLYA 2M30A 2NOJB 2VQLA 2Y0SN 3PNTA 1MMDA 1LEAA 2DK5A 2HI3A 1JXSA 1QVTA 2PX9A 4Y17A 2R5ZB 1MBGA 3QODA 1JTYA 3ZCOA 1A35A 5CJ9A 5JHUA 3SFZA 5KNLA 2CS3A 2KL4A 3RQIA 1IDYA 3DEUA 3IUOA 4I09A 3CC7I 2VONA 3RQ4A 4ESJA 3LSTA 4FTHA 2ZKZA 4HF2A 3MZHA 2L02A 3PSFA 3PUBA 3DXJF 4IOAF 4LLLA 2JK3A 1UJ8A 3BDDA 1OCPA 1XG1A 5HS9A 5BNGA 4AUXA 2W48A 3R6SA 3R4KA 3RKYA 4D5FA 3ASOH 4BJTA 4I0AA 3FM3A 2W1OA 2VPRA 1T08B 2L4AA 1B1BA 2A69F 5IPAA 2JUCA 3GWZA 3RKWA 3RKXA 3U1DA 4XICA 4I98B 1XDSA 1BM9A 3RCOA 1IN5A 2LKXA 2KIQA 1IGNA 2XAUA 3NQOA 2P6SA 3B02A 4CZZA 4XM3A 3U2RA 3CCMI 3K6GA 2V4JC 4BJ5C 3DBLB 5FLXK 4LIUA 4NDLA 3RZOJ 1R36A 3WTZA 1I27A 5IOZA 1WJFA 1B4AA 3K69A 4IX7A 3FXKA 5KAIC 4V2GA 3FWEA 1TWHJ 1G3SA 1BL0A 1FMWA 3WTTC 1IN4A 3CCSI 1W5CC 4MTEA 2CQQA 3ZOBA 4ANJA 1IRFA 2PG4A 4B09A 2Y2ZA 4HOBA 2EIMH 2ZJRF 3PQJA 3ASNH 4YIIA 1R4MB 3OYFA 4FHTA 4XLNF 2HDCA 2JTVA 1XDUA 3I4NJ 4PJNA 2M9HA 3J7AY 3HPGA 2QKLB 1BJZA 1Z3YA 3S17J 3FKIJ 2LKSA 3GW2A 4LD5A 3KX2A 4A3GJ 5ILVA 2ADUA 3H3UA 1MH4A 1V54H 1WGXA 2KJCA 4G12A 5TRDA 1IG7A 1G8XA 2E5NA 2AXTC 3O8HA 3FISA 3T5XA 5TGTA 2I8DA 1V4RA 3G2BA 1X3UA 3REOA 3SXYA 4Q4ZF 2OZUA 4EVIA 1RKTA 4AWXB 1Z05A 2O5RA 1V55H 3BPVA 4BACA 2ME6A 3PJRA 2JPBA 3I59A 2H94A 1E17A 2FMLA 2VBWA 4E7LA 3K4KA 5D6EA 1H89C 1Z21A 5HLIA 4D5CA 5EG0A 3Q5FA 2G7HA 3F8NA 5FO5A 3EYYA 4NBQA 4BU2A 2BY2A 2M7AA 1LFBA 3P7NA 1N78A 1K83J 2HFHA 3HJEA 2L54A 3GXOA 1LDJA 2BYVE 1EH8A 1PUEE 2Y9YA 3GCMA 4ZTJA 1Y6IA 5E3LA 1QNTA 1TT5B 3T8TA 4B43A 2Y69H 1J7KA 2DA3A 3QWLA 4ZZLA 4BYYA 1TBXA 5CLSA 3EYIA 2XV4S 2V1UA 4UHTA 3S93A 2YR2A 3FHZA 3BG9A 3KIOA 5FD6A 3RYPA 2TDXA 1XN7A 4RAGA 3ABLH 1VQPI 2OJED 1I6HJ 4ZDLA 3ZMUA 2AO9A 1RZ4A 2MD0A 3DFGA 3BTCA 4XONA 2VXDA 1WI9A 2FUG2 2F48A 2E35A 3WU2C 4U7DA 5BMZA 1W7PD 4BS9A 1MNDA 4XLAA 3VSLA 3IV5A 1VQNI 1X58A 3DPUA 3J81K 3ZP5A 1FOYA 2XVCA 5CYVA 5JVTA 3M8FA 1MKMA 1U5TA 2DFIA 2BVLA 1A36A 3I54A 1APLC 4PFOA 3WTXC 2O03A 4ASNA 4AVPA 1FNNA 3S3NA 1HOMA 2XF7A 2Z99A 3RIRA 2OBPA 1IW7F 3FMRA 3KP2A 3CMEI 2GOMA 3NARA 3L2RA 1Z7UA 1VF9A 2KHMA 2Q8KA 2FOKA 2XPUA 3VFZA 3M1CA 1XCBA 2HOTA 4YFXF 2X51A 2HQ5A 2EZKA 1YJWI 3AG4H 3F6OA 1IV8A 1K61A 5F1RA 1FOKA 4A3FJ 3HGYA 5GPAA 3S1MJ 1RUNA 4BHBA 1G3TA 5IT9Z 2OQGA 2DPDA 1WWXA 4ZYAA 2VPLA 1FSHA 1D5YA 4YEJA 4BQNA 2WV1A 3JTGA 2CV1A 3S16J 1YFHA 2V6CA 3A02A 4FASD 1XGMA 1O3SA 2LRDA 4RM2A 3ZQLA 1XMAA 2HQAA 2XB0X 3AL0C 2PN6A 3S3MA 1MMAA 1L0OC 4F55A 1XSVA 2PMHA 1D8JA 1ZKGA 1NK2P 2COBA 2F4MB 2HDWA 5DD4A 1SMTA 3S15J 4MFEA 5FB2A 1BR2A 1D0YA 2CSOA 3TKYA 5A2QK 1HW2A 1TP4A 1RETA 4IO9F 1D1CA 2QF7A 2R4GA 2W85A 5IP9J 3ZMZA 2CUEA 2F2EA 1YX5A 1USSA 4FETA 4YIRX 5CQGA 2LP0A 1MZBA 2EIKH 4RM3A 2MFZA 1JUPA 3BC8A 3DCFA 5FJ8J 1NHAA 4KIFA 5KHDA 3BZCA 1X1CA 4IZZA 4KICA 3ABMH 1GV5A 4BEHA 3L1PA 1SFUA 1FLIA 4F93B 3ZQ7A 2A6TA 5C4XJ 3QYBA 5KAFC 2MH2A 3BR0A 1DP3A 3RYRA 3OOPA 2L5QA 2GBYA 3VYSB 4UXNA 1Z3XA 3B6CA 4L5EA 1TWCJ 1BBYA 3AL0B 1IN8A 4UY8I 3TW6A 1IZ1A 1FTZA 1V3FA 1WQ2A 4BBRJ 5FRNA 2JA7J 5JLWA 1W36C 2YS9A 1LUJB 4CCJA 4BUPA 4BY1J 4LLNA 5F64A 3BR1A 3FMSA 3I9V2 4NNJA 5FLXZ 2H27A 4L0ZB 4QLCU 1T98A 2IS1A 4M74A 2EJRA 2W57A 1LDKB 4KYWA 3W6VA 1ZAOA 4IQJA 3MKYB 2Q0OA 2PJPA 5L3GA 3VSKA 4BE0A 2W82A 5F08A 4L18B 4BDZA 4X0GA 1H9TA 2OCCH 4G6TB 1YX3A 4B48A 2Q1ZB 4QPOA 4YFKF 2X85A 4ZYEA 4BJ6C 5E18F 1I6XA 2J5PA 3WGIA 2VC1A 4RAZA 3CCJI 1EF4A 2E2JJ 4EM1A 1RIOH 5DEQA 3GMEA 4HQEA 5D8LB 4IRIA 3CLQA 2ZSIB 4NHJA 2XGEA 5E3NA 4HX7A 1PVEA 1ZGWA 2W4SA 3GF2A 4PCQA 1P6RA 4ZZDA 4RAYA 3OSGA 2CWEA 2M2EA 2VJJA 3WU1B 3JRHA 3N97A 2BXYA 2VL8A 2L9VA 4Y33A 2L9NA 3HYIA 4E7ZA 2GWRA 4HG2A 1FSEA 4EEFG 3M8EA 1IJWC 1SFOJ 2HXOA 2NVXJ 2JA5J 4HDVA 1SVMA 3HRTA 4R1HA 2Z3YA 3OL3A 2L9RA 1J9IA 1POGA 3G71I 1WZ2A 2R7QA 4RDUA 2KT0A 1RESA 4XKVA 2RNJA 2ZMEB 1YQAA 4GGGA 3DBHB 4AIKA 2KIMA 3IKVA 2JRMA 4FISA 4ZYHA 4PJ0C 5E8GA 1G2HA 1IXCA 3MN2A 2CW7A 1AKHA 4X6AJ 4JBAA 2OPTA 1BI3A 3BG5A 5J4YA 1OR7C 3W2VA 2P7VB 3ZQQA 3ZQIA 4NUBA 3DKXA 2EINH 2FF4A 4HNUA 3F0CA 3ELKA 3L09A 5GTHC 2VKVA 1NH3A 1QQIA 2CMPA 2P6TA 3I56I 3G6EI 2O8KA 1YITI 1QHHD 2XUBA 4QWQA 4A6DA 2CFOA 4KFCA 3HOVJ 1HKSA 2TRTA 3S32A 4CICA 3C2BA 3ABKH 4IXAA 5GAEJ 5HODA 1NTCA 1MSFC 3O6BB 3JRCA 4IHTA 2LOOA 4XK4A 1GUUA 1QU3A 4CYCA 2L4MA 5DDGA 3CMYA 3OR2C 3RZDJ 5BS6A 1SMYF 3BROA 2GZWA 1RUOA 4OINF 4MEYF 2WADA 2DOFA 2ELHA 4UVAA 4UUSA 3J81Z 2VBXA 2DBBA 3LWFA 3QPSA 2DO7A 1S7OA 2X4HA 3ESWB 3QAHA 1MW7A 3HSEA 3NEUA 2WAQA 1B59A 2HTJA 2ETHA 4N9HA 4GCVA 3OR1C 5DCFA 1ZK8A 4KN4X 2QM3A 2QQBA 5JR3A 3GEZA 4KITB 1EA3A 1WJBA 3F22A 2XDVA 1JHFA 4FT8A 2VE9A 4L9JA 5GADJ 1VQLI 1HC8A 3GTGJ 3KETA 1DUXC 5BQTA 1MNEA 2X6YA 2LTPA 4GDFA 4FE4A 4BXUA 4CCLA 3SZPA 1H8AC 4IVNA 2HKXA 1B72B 2NVYJ 1X3ZB 2OAZA 2QVOA 5HS8A 4M9ZA 1GXPA 4IL6C
chains in the Genus database with same CATH topology
2R92J 1PUFA 1WCMJ 2R5YB 2XB5A 1MH3A 2IEKA 2LR8A 2FJ1A 4M3DA 3OSFA 4X1EA 2XGCA 5EEAA 2LFBA 1JJ8C 2Y0SN 3GBGA 5C3EJ 3ZQCA 2HI3A 1QVTA 2JMWA 3PO3J 2R5ZB 1MBGA 5GPCA 3LNQA 3IH3A 1JTYA 1AKHB 3FIWA 2MGQA 1JKRC 1B8IB 3RQIA 1IDYA 3CQZJ 1HF0A 1WPKA 3JRGA 4FTHA 2JA8J 5IOYA 1Z77A 2H8RA 1F43A 3TW7A 3GTPJ 4JYKA 2ELKA 1T56A 5FKKA 4LOCA 1GVDA 1RR7A 2JK3A 2MG4A 3RKQA 1OCPA 3TP0A 1XG1A 5BNGA 4AUXA 3FK7A 2W48A 3BTJA 2X48A 4W1UA 4D5FA 3HOWJ 2L0KA 2VPRA 4A3DJ 3H0GJ 4A3CJ 4CYCB 1GT0C 5IPAA 5EGOA 3S2DJ 2NVQJ 3MKLA 4XICA 3M4OJ 2TCTA 5FLMJ 3A01A 1I50J 1IC8A 4UUSB 2LKXA 2OF7A 3BG3A 3WHBA 2VI6A 2VKEA 1IGNA 5F0FA 2IBDA 4DZJA 5FLVA 2JJ7A 1JT0A 1ZR2A 3BR6A 3BR2A 5DS9A 4NDLA 3RZOJ 5IOZA 1T33A 2CQXA 4JX6A 3S1RJ 4V2GA 1TWHJ 1BL0A 2EQRA 4DYRA 2P81A 1FEXA 1TC3C 2L7MP 3VPRA 2CQQA 3ZOBA 2LLKA 3BTLA 2Y2ZA 1U9NA 1MBFA 2DA1A 1JTXA 5J1UA 1W0TA 1FIAA 5IP6A 1JKQC 3I4NJ 1LE8A 2M9HA 3ZQFA 1ITYA 1BJZA 4A3KJ 2D5VA 3GTLJ 3S17J 3FKIJ 4J19A 1ETWA 5EZHA 1U9OA 4A3GJ 1VI0A 1IV6A 3LSGA 3SJMA 1MH4A 1WGXA 4G12A 1DU6A 4JP0A 1PUFB 1E3OC 5M5WJ 1IG7A 3O8HA 3BR5A 3FISA 1JUMA 2FX0A 2ECCA 5K7ZA 4I6ZA 3M3YJ 2K9SA 4QSHA 4AC0A 3DEWA 3JRAA 1ETVA 1RKTA 3HOXJ 4D7NA 3Q0WA 2ME6A 1WH7A 2CRGA 5EDNA 1IRZA 1NK3P 1H89C 4D5CA 5EG0A 2FQ4A 2CJJA 3A03A 5FKNA 2K9QA 4BBSJ 2ID6A 2Y30A 1LFBA 4Y52J 2ECBA 2O7OA 1K83J 3NAUA 4IHWA 5EYRA 3SDGA 3ZQHA 2Y9YA 1OFCX 1QPIA 3BT9A 5E3LA 2XGDA 1LFUP 1BA5A 2DA3A 1VNDA 4XRSA 1MBKA 3MVPA 1WH5A 3BG9A 2B63J 5EZGA 5EGOB 2LD5A 1A6IA 1SANA 1UG2A 4XRMA 2LVSA 4D7MA 2E2HJ 1I6HJ 2AO9A 2E19A 2DJNA 1F36A 3D1NI 3BTCA 2GM4A 4JX4A 2G0EA 1ETOA 4GFBA 3HM5A 4B3AA 2I10A 3JR9A 2DMQA 3IV5A 1U78A 1S7EA 3HGGA 2CU7A 1X58A 1MBEA 2PMZN 3K2AA 2RAEA 5J1RA 4QTRA 1APLC 2EZLA 1ETQA 2K9NA 1HOMA 1P7IA 1U8BA 3Q3SA 3NARA 3H3VK 1VF9A 3JREA 2XPUA 1R9TJ 1LE8B 1B72A 2DMPA 2R93J 4JX5A 5K7HA 3JRDA 2HQ5A 3HOYJ 2EZKA 3Q0VA 5FKMA 2DMTA 2FD5A 1OCTC 4A69C 5M5XJ 1K61A 4A3FJ 4DZPA 5J1YA 2E2IJ 3LSRA 3HGYA 5GPAA 4UUTA 4A3EJ 3S1MJ 1H88C 3E7LA 1W0UA 1FIPA 4IHVA 1D5YA 1A5JA 2WAQN 3QQAA 2WV1A 5GP9A 3S16J 2HOTA 3A02A 1OJLA 2DA2A 3LSJA 5F27A 4S0HB 1AHDP 3ZQLA 4A3BJ 2XB0X 2DA4A 2NOGA 5IYCJ 1JKPC 3GTMJ 1Q1VA 4I76A 1ZKGA 1NK2P 2COBA 1TWGJ 4ABZA 3S15J 2HOSA 4MFEA 3BQYA 1AU7A 1RETA 4Y7NJ 2QF7A 4M6VA 5IP9J 2CUEA 4M3BA 4C3HJ 1Y1WJ 1HCRA 3HOZJ 4BXXJ 1O4XA 1YRNA 3HBLA 4A3JJ 2LP0A 3S14J 1GV2A 1JUPA 3DCFA 5FJ8J 5J3LA 2KDZA 1HLVA 1ZQ3P 2YUSA 1MBHA 1GV5A 3O8GA 3L1PA 1X2MA 5C4XJ 1ETKA 4FCYA 3TP3A 3BR0A 2R0QC 1Z0XA 2DTZA 2GBYA 3B6CA 4L5EA 1TWCJ 3GTKJ 2XPWA 1IDZA 3TW6A 1FTZA 3JRBA 1RKWA 3LOCA 4BBRJ 2QCOA 2JN6A 2X6OA 5M5YJ 2EH3A 4A3IJ 2VUMJ 2JA7J 5JLWA 2YS9A 4RBOA 4BY1J 1JKOC 3BR1A 4DYQA 1I3QJ 3CDLA 1MBJA 4IEJA 3JRFA 2XSDC 4IHYA 2E1OA 2M8GX 4DW6A 4C3JJ 3W6VA 3OIOA 2N8GA 3ZQGA 3A01B 2DN0A 3OOUA 1ZTRA 3Q0UA 2GLOA 2IAIA 1JUSA 2AHQA 3IH2A 5F08A 3I4MJ 2L7ZA 4IHXA 3IH4A 2M0CA 3BQZA 1CQTA 2ID3A 5FKLA 5K7FA 1EF4A 5DTDA 4MIMA 5F1JA 3FK6A 2E2JJ 4FE7A 2M34A 3UKGA 1JGGA 1FTTA 4DYCA 2XGEA 5E3NA 3HEFA 3HKZN 1GDTA 2H1KA 1ZGWA 1WI3A 5IYBJ 1P7JA 2YU9J 1ORKA 3OSGA 2M2EA 2XRLA 4MLOA 2HXIA 5IP7J 3JRIA 4A3LJ 4XIDA 4AYBN 5C44J 3JRHA 1DU0A 3G1LA 2MW8A 1TWAJ 2JA6J 2XPVA 4BY7J 2CUFA 4EEFG 3BTIA 1IJWC 2NS8A 1SFOJ 2HXOA 5M3MJ 2NVXJ 2JA5J 2R5YA 2L9RA 1BW6A 1POGA 2EBIA 4BKXA 3TEDA 4RDUA 2KT0A 4M3GA 1RESA 4QIWN 3SFIA 2LK2A 1FJLA 5FKOA 5F0HA 1Y1VJ 2NVTJ 1BW5A 3HOUJ 3GTQJ 2HOAA 4FISA 1YRNB 2Y31A 2R5ZA 1G2HA 3MN2A 4A93J 3PO2J 1AKHA 4X6AJ 2OPTA 1RPWA 4B1RA 3BG5A 1X2NA 1B8IA 4V2FA 4M3EA 3ZQIA 5IYDJ 4B4CA 3WHCA 5EG0B 2DA5A 2ME0A 3F0CA 2VKVA 2DA6A 2DMUA 3GTJJ 3S2HJ 2MSYA 2O8KA 3HOVJ 3GTOJ 2TRTA 2Y9ZA 2ZB9A 5M3FJ 3B6AA 3C2BA 3HDDA 3PM1A 2NS7A 2DMNA 5HODA 1NTCA 1MSFC 2HYJA 3JRCA 1XC5A 4XK4A 1MNMC 1GUUA 1QRYA 2WB1N 4CYCA 4W97A 3CMYA 3RZDJ 1XS9A 4M3FA 5F04A 1UHSA 4UUSA 1UMQA 2LY9A 3G1MA 3S1QJ 1ZR4A 3QPSA 1MSEC 2EZHA 2X9DA 3K7AJ 3LSPA 1HDPA 3CCYA 2O9LA 4HNVA 1JT6A 5E3OA 5C4JJ 4XRSG 1ENHA 4C2MJ 2JWTA 1ZK8A 5JLXA 4MO7A 2HDDA 1IUFA 1JJ6C 2DA7A 3BR3A 2EZIA 2L7FP 2R7ZJ 9ANTA 3QPLA 3GTGJ 1TWFJ 2LTPA 3S1NJ 3HB9A 4FE4A 3G1OA 1HDDC 1ETXA 5E3MA 1H8AC 1ETYA 5F0CA 4A3MJ 1B72B 2K40A 2NVYJ 4MFDA 4C3IJ 5EF6A 1VFCA 1QVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 J;  1PUF A;  1WCM J;  2R5Y B;  2XB5 A;  1MH3 A;  2IEK A;  2LR8 A;  2FJ1 A;  4M3D A;  3OSF A;  4X1E A;  2XGC A;  5EEA A;  2LFB A;  1JJ8 C;  2Y0S N;  3GBG A;  5C3E J;  3ZQC A;  2HI3 A;  1QVT A;  2JMW A;  3PO3 J;  2R5Z B;  1MBG A;  5GPC A;  3LNQ A;  3IH3 A;  1JTY A;  1AKH B;  3FIW A;  2MGQ A;  1JKR C;  1B8I B;  3RQI A;  1IDY A;  3CQZ J;  1HF0 A;  1WPK A;  3JRG A;  4FTH A;  2JA8 J;  5IOY A;  1Z77 A;  2H8R A;  1F43 A;  3TW7 A;  3GTP J;  4JYK A;  2ELK A;  1T56 A;  5FKK A;  4LOC A;  1GVD A;  1RR7 A;  2JK3 A;  2MG4 A;  3RKQ A;  1OCP A;  3TP0 A;  1XG1 A;  5BNG A;  4AUX A;  3FK7 A;  2W48 A;  3BTJ A;  2X48 A;  4W1U A;  4D5F A;  3HOW J;  2L0K A;  2VPR A;  4A3D J;  3H0G J;  4A3C J;  4CYC B;  1GT0 C;  5IPA A;  5EGO A;  3S2D J;  2NVQ J;  3MKL A;  4XIC A;  3M4O J;  2TCT A;  5FLM J;  3A01 A;  1I50 J;  1IC8 A;  4UUS B;  2LKX A;  2OF7 A;  3BG3 A;  3WHB A;  2VI6 A;  2VKE A;  1IGN A;  5F0F A;  2IBD A;  4DZJ A;  5FLV A;  2JJ7 A;  1JT0 A;  1ZR2 A;  3BR6 A;  3BR2 A;  5DS9 A;  4NDL A;  3RZO J;  5IOZ A;  1T33 A;  2CQX A;  4JX6 A;  3S1R J;  4V2G A;  1TWH J;  1BL0 A;  2EQR A;  4DYR A;  2P81 A;  1FEX A;  1TC3 C;  2L7M P;  3VPR A;  2CQQ A;  3ZOB A;  2LLK A;  3BTL A;  2Y2Z A;  1U9N A;  1MBF A;  2DA1 A;  1JTX A;  5J1U A;  1W0T A;  1FIA A;  5IP6 A;  1JKQ C;  3I4N J;  1LE8 A;  2M9H A;  3ZQF A;  1ITY A;  1BJZ A;  4A3K J;  2D5V A;  3GTL J;  3S17 J;  3FKI J;  4J19 A;  1ETW A;  5EZH A;  1U9O A;  4A3G J;  1VI0 A;  1IV6 A;  3LSG A;  3SJM A;  1MH4 A;  1WGX A;  4G12 A;  1DU6 A;  4JP0 A;  1PUF B;  1E3O C;  5M5W J;  1IG7 A;  3O8H A;  3BR5 A;  3FIS A;  1JUM A;  2FX0 A;  2ECC A;  5K7Z A;  4I6Z A;  3M3Y J;  2K9S A;  4QSH A;  4AC0 A;  3DEW A;  3JRA A;  1ETV A;  1RKT A;  3HOX J;  4D7N A;  3Q0W A;  2ME6 A;  1WH7 A;  2CRG A;  5EDN A;  1IRZ A;  1NK3 P;  1H89 C;  4D5C A;  5EG0 A;  2FQ4 A;  2CJJ A;  3A03 A;  5FKN A;  2K9Q A;  4BBS J;  2ID6 A;  2Y30 A;  1LFB A;  4Y52 J;  2ECB A;  2O7O A;  1K83 J;  3NAU A;  4IHW A;  5EYR A;  3SDG A;  3ZQH A;  2Y9Y A;  1OFC X;  1QPI A;  3BT9 A;  5E3L A;  2XGD A;  1LFU P;  1BA5 A;  2DA3 A;  1VND A;  4XRS A;  1MBK A;  3MVP A;  1WH5 A;  3BG9 A;  2B63 J;  5EZG A;  5EGO B;  2LD5 A;  1A6I A;  1SAN A;  1UG2 A;  4XRM A;  2LVS A;  4D7M A;  2E2H J;  1I6H J;  2AO9 A;  2E19 A;  2DJN A;  1F36 A;  3D1N I;  3BTC A;  2GM4 A;  4JX4 A;  2G0E A;  1ETO A;  4GFB A;  3HM5 A;  4B3A A;  2I10 A;  3JR9 A;  2DMQ A;  3IV5 A;  1U78 A;  1S7E A;  3HGG A;  2CU7 A;  1X58 A;  1MBE A;  2PMZ N;  3K2A A;  2RAE A;  5J1R A;  4QTR A;  1APL C;  2EZL A;  1ETQ A;  2K9N A;  1HOM A;  1P7I A;  1U8B A;  3Q3S A;  3NAR A;  3H3V K;  1VF9 A;  3JRE A;  2XPU A;  1R9T J;  1LE8 B;  1B72 A;  2DMP A;  2R93 J;  4JX5 A;  5K7H A;  3JRD A;  2HQ5 A;  3HOY J;  2EZK A;  3Q0V A;  5FKM A;  2DMT A;  2FD5 A;  1OCT C;  4A69 C;  5M5X J;  1K61 A;  4A3F J;  4DZP A;  5J1Y A;  2E2I J;  3LSR A;  3HGY A;  5GPA A;  4UUT A;  4A3E J;  3S1M J;  1H88 C;  3E7L A;  1W0U A;  1FIP A;  4IHV A;  1D5Y A;  1A5J A;  2WAQ N;  3QQA A;  2WV1 A;  5GP9 A;  3S16 J;  2HOT A;  3A02 A;  1OJL A;  2DA2 A;  3LSJ A;  5F27 A;  4S0H B;  1AHD P;  3ZQL A;  4A3B J;  2XB0 X;  2DA4 A;  2NOG A;  5IYC J;  1JKP C;  3GTM J;  1Q1V A;  4I76 A;  1ZKG A;  1NK2 P;  2COB A;  1TWG J;  4ABZ A;  3S15 J;  2HOS A;  4MFE A;  3BQY A;  1AU7 A;  1RET A;  4Y7N J;  2QF7 A;  4M6V A;  5IP9 J;  2CUE A;  4M3B A;  4C3H J;  1Y1W J;  1HCR A;  3HOZ J;  4BXX J;  1O4X A;  1YRN A;  3HBL A;  4A3J J;  2LP0 A;  3S14 J;  1GV2 A;  1JUP A;  3DCF A;  5FJ8 J;  5J3L A;  2KDZ A;  1HLV A;  1ZQ3 P;  2YUS A;  1MBH A;  1GV5 A;  3O8G A;  3L1P A;  1X2M A;  5C4X J;  1ETK A;  4FCY A;  3TP3 A;  3BR0 A;  2R0Q C;  1Z0X A;  2DTZ A;  2GBY A;  3B6C A;  4L5E A;  1TWC J;  3GTK J;  2XPW A;  1IDZ A;  3TW6 A;  1FTZ A;  3JRB A;  1RKW A;  3LOC A;  4BBR J;  2QCO A;  2JN6 A;  2X6O A;  5M5Y J;  2EH3 A;  4A3I J;  2VUM J;  2JA7 J;  5JLW A;  2YS9 A;  4RBO A;  4BY1 J;  1JKO C;  3BR1 A;  4DYQ A;  1I3Q J;  3CDL A;  1MBJ A;  4IEJ A;  3JRF A;  2XSD C;  4IHY A;  2E1O A;  2M8G X;  4DW6 A;  4C3J J;  3W6V A;  3OIO A;  2N8G A;  3ZQG A;  3A01 B;  2DN0 A;  3OOU A;  1ZTR A;  3Q0U A;  2GLO A;  2IAI A;  1JUS A;  2AHQ A;  3IH2 A;  5F08 A;  3I4M J;  2L7Z A;  4IHX A;  3IH4 A;  2M0C A;  3BQZ A;  1CQT A;  2ID3 A;  5FKL A;  5K7F A;  1EF4 A;  5DTD A;  4MIM A;  5F1J A;  3FK6 A;  2E2J J;  4FE7 A;  2M34 A;  3UKG A;  1JGG A;  1FTT A;  4DYC A;  2XGE A;  5E3N A;  3HEF A;  3HKZ N;  1GDT A;  2H1K A;  1ZGW A;  1WI3 A;  5IYB J;  1P7J A;  2YU9 J;  1ORK A;  3OSG A;  2M2E A;  2XRL A;  4MLO A;  2HXI A;  5IP7 J;  3JRI A;  4A3L J;  4XID A;  4AYB N;  5C44 J;  3JRH A;  1DU0 A;  3G1L A;  2MW8 A;  1TWA J;  2JA6 J;  2XPV A;  4BY7 J;  2CUF A;  4EEF G;  3BTI A;  1IJW C;  2NS8 A;  1SFO J;  2HXO A;  5M3M J;  2NVX J;  2JA5 J;  2R5Y A;  2L9R A;  1BW6 A;  1POG A;  2EBI A;  4BKX A;  3TED A;  4RDU A;  2KT0 A;  4M3G A;  1RES A;  4QIW N;  3SFI A;  2LK2 A;  1FJL A;  5FKO A;  5F0H A;  1Y1V J;  2NVT J;  1BW5 A;  3HOU J;  3GTQ J;  2HOA A;  4FIS A;  1YRN B;  2Y31 A;  2R5Z A;  1G2H A;  3MN2 A;  4A93 J;  3PO2 J;  1AKH A;  4X6A J;  2OPT A;  1RPW A;  4B1R A;  3BG5 A;  1X2N A;  1B8I A;  4V2F A;  4M3E A;  3ZQI A;  5IYD J;  4B4C A;  3WHC A;  5EG0 B;  2DA5 A;  2ME0 A;  3F0C A;  2VKV A;  2DA6 A;  2DMU A;  3GTJ J;  3S2H J;  2MSY A;  2O8K A;  3HOV J;  3GTO J;  2TRT A;  2Y9Z A;  2ZB9 A;  5M3F J;  3B6A A;  3C2B A;  3HDD A;  3PM1 A;  2NS7 A;  2DMN A;  5HOD A;  1NTC A;  1MSF C;  2HYJ A;  3JRC A;  1XC5 A;  4XK4 A;  1MNM C;  1GUU A;  1QRY A;  2WB1 N;  4CYC A;  4W97 A;  3CMY A;  3RZD J;  1XS9 A;  4M3F A;  5F04 A;  1UHS A;  4UUS A;  1UMQ A;  2LY9 A;  3G1M A;  3S1Q J;  1ZR4 A;  3QPS A;  1MSE C;  2EZH A;  2X9D A;  3K7A J;  3LSP A;  1HDP A;  3CCY A;  2O9L A;  4HNV A;  1JT6 A;  5E3O A;  5C4J J;  4XRS G;  1ENH A;  4C2M J;  2JWT A;  1ZK8 A;  5JLX A;  4MO7 A;  2HDD A;  1IUF A;  1JJ6 C;  2DA7 A;  3BR3 A;  2EZI A;  2L7F P;  2R7Z J;  9ANT A;  3QPL A;  3GTG J;  1TWF J;  2LTP A;  3S1N J;  3HB9 A;  4FE4 A;  3G1O A;  1HDD C;  1ETX A;  5E3M A;  1H8A C;  1ETY A;  5F0C A;  4A3M J;  1B72 B;  2K40 A;  2NVY J;  4MFD A;  4C3I J;  5EF6 A;  1VFC A;  1QVU A; 
#chains in the Genus database with same CATH topology
 2R92 J;  1OIS A;  4BE1 A;  3V8L A;  1LKX A;  2EK5 A;  4XLC A;  1Z6T A;  2LR8 A;  4NQW B;  4RS8 A;  4DIQ A;  4X1E A;  4HPQ A;  2XGC A;  5K1Y A;  3GFI A;  1G3Y A;  1UAA A;  1O7L A;  1T39 A;  3BPX A;  1TW2 A;  1VQM I;  1W7P B;  3ZPL A;  3MCZ A;  3F3X A;  2VE8 A;  4J01 A;  3V42 A;  1QZZ A;  2MGQ A;  4LG0 A;  5HNF A;  5JI6 A;  2NVU B;  3PIO F;  5L3F A;  3CQZ J;  5E17 F;  1WPK A;  1K6O A;  3CF5 F;  3JRG A;  5H6Q A;  1SD6 A;  3D5L A;  4PDK A;  4O3M A;  5IOY A;  3MKW B;  1F43 A;  3AFH A;  1R5G A;  4JYK A;  3MFK A;  2FNA A;  2CQN A;  1ZH5 A;  2FA5 A;  1T56 A;  3DPT A;  3CUQ A;  1GVD A;  4LOC A;  1S9H A;  3DF8 A;  5ICE A;  3G73 A;  1CF7 A;  3ECH A;  2E1N A;  3WTY C;  2X48 A;  2BEO A;  1FC3 A;  2HKO A;  2VQH A;  3JAM Z;  2COM A;  4LIT A;  5EJC A;  1YS6 A;  2NVQ J;  3GZ6 A;  4NC6 A;  1I5Z A;  3MEX A;  5ERI A;  3V7R A;  5E1W A;  3AKZ A;  5FLM J;  2H09 A;  5HLG A;  2KJB A;  2VI6 A;  2VKE A;  5AIQ A;  1LQ1 A;  2CYY A;  3WGH A;  2IBD A;  1N75 A;  1BN5 A;  4CCM A;  2K5C A;  4F7Z A;  2QEX I;  5FLV A;  1JT0 A;  1PP7 U;  2E36 A;  1ZR2 A;  3BCA A;  4HNT A;  1KQ8 A;  4PGG A;  4HDU A;  1T33 A;  3HKZ A;  4JX6 A;  3S1R J;  4EM2 A;  1JI8 A;  1X19 A;  3HXL A;  3CP2 A;  2V9K A;  1FEX A;  4HA8 A;  3SZG A;  3VPR A;  1VTN C;  2PBI A;  3BTL A;  1MIJ A;  5K5R A;  3F9K A;  2M45 A;  4MQV A;  4CDG A;  2GA1 A;  1MBF A;  2DA1 A;  2CV0 A;  4EJV A;  1EV7 A;  1JTX A;  3Q9V A;  1R49 A;  4BXF A;  5CVI A;  3W6K B;  2W84 A;  1FIA A;  4RGX A;  4XLP F;  3CO7 C;  1LE8 A;  4II2 A;  1SD7 A;  4MQ9 F;  2O3F A;  3K4N A;  2D5V A;  3GTL J;  3IL2 A;  3QPT A;  2K3F A;  5EZH A;  1U5T C;  2FBK A;  5JVG F;  1VI0 A;  3SJM A;  2Q2E A;  3CDI A;  3H5N A;  1E3O C;  5M5W J;  5BOX A;  2V1N A;  4HST A;  3HUG B;  5FGM A;  1JUM A;  1W5S A;  1R23 A;  2QUF A;  3H5A A;  3VYR B;  1F4K A;  3M3Y J;  4QSH A;  1FP1 D;  1D0Z A;  4DGW B;  3JRA A;  3GFL A;  3ZGK A;  1PYV A;  1WFX A;  3Q0W A;  4LB6 B;  1WH7 A;  2QBY A;  4F92 B;  1XPX A;  3W2A A;  5CPR B;  3LQQ A;  3SYT A;  1YS7 A;  5ICG A;  1Z1D A;  3A03 A;  1IXR C;  2EA4 A;  3LSH A;  2ID6 A;  2Y30 A;  3E6M A;  1G3W A;  5IT9 K;  2O7O A;  3F72 A;  2GAU A;  4DOZ A;  2OUM A;  5EYR A;  3KLN A;  3SDG A;  3KZY A;  2IXS A;  2ZO4 A;  2HQR A;  4I2O A;  1K78 B;  5HDN A;  4AIJ A;  1BA5 A;  4AID A;  4P96 A;  2XRO A;  2R7O A;  1ULY A;  3MD2 A;  4XRS A;  3LAJ A;  1MBK A;  3MVP A;  1O7F A;  4G7O F;  2IW5 A;  5EGO B;  3LL7 A;  4LG3 A;  2CO5 A;  1A6I A;  3H35 A;  1D1B A;  1OYY A;  4I01 A;  4RB0 A;  1Q1H A;  2QGU A;  2E60 A;  3DU6 A;  2ISZ A;  2R7D A;  4D7M A;  2E2H J;  5TIS C;  1HQC A;  5ILS A;  2E19 A;  1F1Z A;  1UB9 A;  1Z6R A;  1F36 A;  2DJN A;  3D1N I;  2DYS H;  2K4B A;  2XAH A;  1YJ9 I;  1ETO A;  2E5Z A;  4GFB A;  5DUK A;  2ZC2 A;  2KMU A;  2DMQ A;  1U78 A;  2NXN B;  3HGG A;  1XX5 A;  4RLF A;  3V7C A;  3GZ5 A;  4AIH A;  1IUY A;  2RRE A;  1QZE A;  3HSR A;  3R60 A;  2K9N A;  2JA2 A;  1NG6 A;  4ENK A;  2PJR A;  1U8B A;  2L7K A;  5HDK A;  2F6C A;  1TZL A;  3E97 A;  4HRI A;  4WCG A;  3VWB A;  1SEU A;  2EB7 A;  2QEN A;  3V8J A;  2IRF G;  4MEX F;  4EJU A;  2UUZ A;  3F21 A;  2CFX A;  1R9T J;  2MD5 A;  1B72 A;  2QQ9 A;  3F8F A;  2DMP A;  2K02 A;  1R4N B;  2R93 J;  2WY7 Q;  3E1S A;  3ZN0 A;  2H1L A;  1XGN A;  3QPH A;  2DMT A;  2EFO A;  3FXJ A;  2RQQ A;  4LFU A;  1O3T A;  1UG0 A;  3CZ6 A;  3OV8 A;  5HS7 A;  5J1Y A;  1QBJ A;  2XKO A;  1R5H A;  4A0Y A;  3ABT A;  3CJN A;  4ZJZ A;  2IT0 A;  1YLF A;  2FMY A;  3K1P A;  1S7A A;  1P4A A;  3QQA A;  5GP9 A;  2IGO A;  3ZMT A;  2YU3 A;  3D5S C;  1VQK I;  2OTJ I;  1TQP A;  1KGS A;  4CHU A;  2IS2 A;  2KKO A;  4A3B J;  2DA4 A;  3G4S I;  1JKP C;  2XAF A;  3HOS A;  4HX8 A;  1G6N A;  2RC4 A;  2HNH A;  3PIP F;  4CGZ A;  2IA2 A;  3DQV C;  3B73 A;  4WF2 A;  1XTA A;  1XSD A;  2WC2 A;  1HW1 A;  1DDN A;  4KN7 X;  1AU7 A;  3WG7 H;  1U6G A;  3G3Z A;  1YIJ I;  5F6F A;  2ZCW A;  3V7S A;  4A12 A;  3KP4 A;  1MDM B;  1ZN2 A;  4LLG F;  4M9X A;  1HCR A;  4BXX J;  1BC8 C;  1BI2 A;  1V5G A;  1R58 A;  4PZJ A;  5J6X A;  4KIB A;  2DFE A;  3S14 J;  2HZT A;  5DV5 A;  3F23 A;  3R0J A;  5J3L A;  5CVV A;  3CLO A;  4KMU X;  2KDZ A;  1ZQ3 P;  1IXS B;  2HPI A;  3AG2 H;  4JOM A;  4P9U A;  2F4I A;  5FD5 A;  2P5K A;  3O2P E;  2R0Q C;  4RB1 A;  2M5W A;  1A31 A;  2DTZ A;  3OYN A;  1YIO A;  1TW3 A;  3L00 A;  2UWM A;  3BZ6 A;  3H9Q A;  5LRS A;  4XQF A;  3A2K A;  1KU9 A;  2DQL A;  2JN6 A;  2X6O A;  2EH3 A;  3I3L A;  3DKY A;  5M5Y J;  2ZFU A;  3FZV A;  5DYM A;  2DCE A;  3OIQ A;  2QSH X;  3BY6 A;  2BY1 A;  2VT2 A;  4N4N B;  4DYQ A;  2W24 A;  4XLH A;  1IO2 A;  3IC7 A;  2OQR A;  4AVZ A;  4CYD A;  2LY2 A;  4IEJ A;  3GFJ A;  2HYF A;  2K9L A;  2M8G X;  4A0Z A;  2LH9 A;  2ZFW A;  4L9V A;  1X1P A;  4C3J J;  2CW8 A;  3A4C A;  4LMY A;  3OIO A;  3ZQG A;  3BJO A;  3A01 B;  3ZXS A;  4CZC A;  3OOU A;  2EPF A;  2AS5 F;  4ETS A;  3QP5 A;  4IJA A;  3KP3 A;  3IWF A;  2AHQ A;  3FMQ A;  3I4M J;  1BR4 A;  1PJR A;  5D5W B;  3NWT A;  2L7Z A;  5H6R A;  1ERD A;  1SAX A;  3QYE A;  3SEZ A;  2BW3 B;  2M0C A;  1X1A A;  2OV7 A;  5DD8 A;  4A5N A;  2ID3 A;  4B47 A;  3FDY A;  5K7F A;  4BQQ A;  4MIM A;  4IRG A;  3FK6 A;  4S05 A;  3UKG A;  3EUK L;  2O0Y A;  3L2U A;  1J2X A;  4Z2Y A;  2H1K A;  2X6W A;  4U0V A;  1WKM A;  2CG4 A;  5IYB J;  2YU9 J;  1MD0 A;  1ONV A;  3WTW C;  3A0B C;  1YW8 A;  2HWV A;  2XRL A;  4XID A;  5C44 J;  3LA3 A;  1DU0 A;  5GTI C;  3CES A;  2JA6 J;  3BOQ A;  4BY7 J;  1MJA A;  1EH6 A;  2OCE A;  2RDP A;  4GO1 A;  2GA2 A;  3T1B A;  2XAJ A;  2NS8 A;  3S8P A;  2AQF A;  2EIJ H;  3PQK A;  5L3D A;  2R5Y A;  4JQF A;  1R1U A;  1Y56 A;  3M9A A;  4JK1 X;  5CKT A;  5E8I A;  2EA2 A;  4QIW N;  2LK2 A;  1FPQ A;  2ZXI A;  5FKO A;  2JT1 A;  3HOU J;  3GTQ J;  3SZT A;  1YRN B;  2Y31 A;  2M1B A;  2R5Z A;  4GYG A;  4XN3 A;  4XRF A;  1LPQ A;  4A93 J;  2K3P A;  2RV8 A;  5HLH A;  2KP6 A;  1D1A A;  4P9F A;  2VT3 A;  2BZT A;  2DT7 B;  2MA3 A;  1WJE A;  2PMZ A;  4M3E A;  5IYD J;  2D1V A;  3OS2 A;  2KZV A;  2QYO A;  4V19 K;  2F5C A;  2DA5 A;  3GTJ J;  1FX7 A;  2MSY A;  4F91 B;  3QU6 A;  3FHN A;  2R7S A;  4AM3 A;  2P7C B;  5L3E A;  3E6C C;  3ZMD A;  3CUO A;  4AU7 A;  2DMN A;  2UXX A;  4XLE A;  2HYJ A;  1ZGA A;  2X0L A;  3S2W A;  1KU7 A;  4D0P A;  2JSP A;  4Y13 A;  4W97 A;  4N4O B;  1VQ6 I;  3LSM A;  3H0D A;  1ON1 A;  4OIR F;  3RPU A;  4HV5 A;  1JHH A;  2M4G A;  1XMK A;  3I58 A;  1UMQ A;  2DU9 A;  3CMA I;  1LEB A;  1FYM A;  4S04 A;  2YX4 A;  3KYD B;  3WTV C;  1A04 A;  1WJA A;  2XF5 A;  2BHY A;  3JAM K;  3FX3 A;  1PDN C;  1U0J A;  3TMO A;  2MAB A;  5E3O A;  2E1M C;  5C4J J;  3R0A A;  4XRS G;  3OYM A;  1HBX G;  1OQY A;  4HX4 A;  2DT6 A;  4FQG A;  4MO7 A;  2HDD A;  1IUF A;  1JJ6 C;  2FU4 A;  5J40 A;  1OYI A;  4BDY A;  3HRU A;  5JFR A;  2XC7 A;  4IRH A;  2WAE A;  3HIF A;  1ETY A;  5F0C A;  1FWZ A;  4A3M J;  2K40 A;  4MFD A;  4EQQ A;  2J5O A;  5EF6 A;  1X3W B;  3KEQ A;  2VOD A;  2JUG A;  5L3C A;  4L0Y B;  4OAZ A;  3E6B A;  2LF8 A;  2Y48 A;  1RC9 A;  5DCM B;  4IOC F;  2EFN A;  2PQ8 A;  3K1N A;  2XB5 A;  1MH3 A;  2WTE A;  1AA7 A;  1R1T A;  1TTY A;  2IEK A;  4IHS A;  2AQE A;  2FJ1 A;  4M3D A;  2A6H F;  5EEA A;  3C1D A;  2ZXJ A;  2LDU A;  2VIX A;  2PMU A;  1JJ8 C;  3WE3 A;  2IVM A;  5J8C A;  2STT A;  3CJQ B;  4KMF A;  2JMW A;  3JTH A;  4LK1 F;  4LIV A;  3VOD A;  1REP C;  5GPC A;  3LNQ A;  2Z2S B;  1R1V A;  2OU2 A;  4EJT A;  3OS1 A;  3FIW A;  1KON A;  2CQ7 A;  2LRE A;  2IPQ X;  2W00 A;  5LGU A;  1B8I B;  2DLL A;  3BWG A;  1HF0 A;  4FX0 A;  3BP8 A;  3DP7 A;  1L3L A;  2JA8 J;  5CVR A;  2H8R A;  2B7E A;  2EV5 A;  2LSO A;  2UV1 A;  3D5R C;  2EFW A;  4CO8 A;  2DOD A;  4CSW A;  2CGP A;  2ELK A;  2MG4 A;  4N9I A;  3BTJ A;  3M1E A;  4W1U A;  4UB6 C;  1VQ8 I;  5FRO A;  5LEJ A;  2VKH A;  4L9N A;  4H0E A;  4BQA A;  3GVA A;  3ERE D;  4GYI A;  1HSJ A;  1IF1 A;  5LRR A;  4RB2 C;  3M4O J;  3KZI C;  2EWN A;  3A01 A;  1I50 J;  2R3S A;  1IC8 A;  1T0F C;  3SHF A;  2OF7 A;  3BG3 A;  4EM0 B;  1K79 A;  3WHB A;  1E0E A;  5F0F A;  4WX9 A;  3A0H C;  2JJ7 A;  1BJA A;  2V7F A;  2ZNZ A;  3M07 A;  4Y15 A;  5DS9 A;  1KQ0 A;  1U2W A;  2HVQ A;  2YX7 A;  3DLA A;  2HEO A;  3H1C A;  3KZZ A;  2DI3 A;  3DBR B;  5H20 A;  2EQR A;  2Y75 A;  4AD9 A;  3TL4 X;  4E7I A;  1E2X A;  1TC3 C;  2L7M P;  3OL4 A;  2ICW G;  3D0S A;  3KLO A;  3PNY A;  2LLK A;  4BH9 A;  1K4T A;  5LHH A;  2BV6 A;  4R8H A;  4P5O A;  1RNL A;  2L01 A;  3C2H A;  1P4X A;  3UNG C;  2UXN A;  4P1W A;  1JKQ C;  4ENN A;  1UHW A;  2BHZ A;  3ZQF A;  1N77 A;  2FEZ A;  3K0L A;  2X1C A;  5FRM A;  2LC2 A;  3DTE A;  1SFE A;  5E79 C;  4EAT A;  2DQR A;  3KEO A;  1UHM A;  2IJL A;  3IAS 2;  3CC4 I;  4BGD A;  2K4J A;  3P9C A;  1OLT A;  4E6K G;  4G7Z F;  2DK8 A;  2FBH A;  3MZ8 A;  3U9G A;  1HKT A;  4JP0 A;  4XKW A;  3RTR A;  1PUF B;  2VOO A;  4IPA A;  2R7X A;  1I39 A;  3E6D A;  3MKZ A;  2ECC A;  2FX0 A;  5K7Z A;  4I6Z A;  2K9S A;  2QQA A;  4YEL A;  3U21 A;  2JZY A;  3DEW A;  1ETV A;  3H92 A;  4D7N A;  2KDO A;  2KRH A;  1JGS A;  4KA4 A;  2CRG A;  5EDN A;  1OKR A;  2P8T A;  5LBQ A;  1YG2 A;  3K10 A;  2F5D A;  4OWR B;  3OYL A;  3H9J A;  3KE2 A;  2FQ4 A;  1R71 A;  1T6S A;  2R7T A;  5FKN A;  2K9Q A;  2HZD A;  2GOX B;  1ZAR A;  3TOB A;  4OU0 A;  1Z9C A;  2QSG X;  4NC8 A;  4OOI A;  5DM7 F;  4Y52 J;  1FOX A;  3H5R A;  2WB1 A;  3NAU A;  4ZDP A;  2BXZ A;  4EGZ A;  4LK0 F;  3PUF A;  1IN6 A;  1QA6 A;  2XGD A;  3K4M A;  2E7W A;  2QQ8 A;  3ABU A;  3L2W A;  1S5L C;  4P55 A;  4U0Y A;  4M72 A;  4CXF A;  1FT9 A;  1WH5 A;  3KYL A;  3EPZ A;  1M1E B;  4CCN A;  3HC7 A;  3MQ0 A;  3DWL E;  4XR6 A;  2IP2 A;  4E7J A;  2LD5 A;  2B63 J;  2AXL A;  2BY3 A;  4GXO A;  1UG2 A;  3FXU A;  2VOP A;  2ZJQ F;  3HPH A;  2ZXW H;  3L7W A;  3A1Y A;  3KP6 A;  1KYW A;  3ONQ A;  3RDI A;  3DV8 A;  2C6Y A;  2WWY A;  2LMD A;  2GM4 A;  2IGN A;  4G94 A;  2VJI A;  4JX4 A;  3ULQ B;  1EH7 A;  1GHC A;  4B3A A;  2I10 A;  2DW4 A;  3WG9 A;  5LGT A;  1S7E A;  2CU7 A;  1MBE A;  3GZN B;  1QGP A;  4I0B A;  3K2A A;  4TV7 A;  2RAE A;  4QTR A;  1W5T A;  3GLL A;  1C0W A;  1ETQ A;  2XAS A;  2R7F A;  3H3Z A;  3K70 D;  1UST A;  2BOL A;  2DT5 A;  3BCB A;  3KP5 A;  3VB2 A;  1DPU A;  5LGN A;  3JRE A;  2WAF A;  2QZ8 A;  3PSI A;  3V4G A;  1VQ9 I;  2F5E A;  3W6J B;  5BPD A;  2BE5 F;  2Y0M A;  1ZRE A;  5ED4 A;  2FBI A;  1R22 A;  1XMX A;  3IRR A;  3P9I A;  4GRI A;  4UB8 C;  1TQM A;  3QOP A;  2Y0S A;  5LHI A;  4M9S A;  3VYU B;  5KK1 A;  2FD5 A;  4G9Y A;  4U7B A;  4ESB A;  3EUH A;  4KIS A;  4KDP A;  1YYV A;  2HVS A;  2E2I J;  1SC7 A;  4G6Q A;  2CUZ A;  2IGM A;  4A3E J;  1S29 A;  1FIP A;  2F5V A;  4U87 A;  2FRH A;  5EEG A;  4AYB A;  1A5J A;  2WAQ N;  2FE3 A;  3L2V A;  2GIZ A;  2K9M A;  4OAY A;  2B0L A;  2XAG A;  4RGR A;  4E70 A;  1Y0N A;  1YW9 A;  2CQK A;  2XRN A;  1OJL A;  3PFY A;  4E7H A;  2DA2 A;  3BJA A;  1ODD A;  2XKP A;  4S0H B;  1T38 A;  2OTL I;  4D1Q A;  4RGU A;  3LQR A;  2NOG A;  5IYC J;  1VQ5 I;  2VN2 A;  1ZLJ A;  4EJO A;  3HL2 A;  4LB5 A;  2RVC A;  3X2Q H;  4ABZ A;  1R5I D;  2A61 A;  4F3Q A;  1P9Q C;  3BQY A;  4QPQ A;  5D8K B;  3F6V A;  4M6V A;  2M8E A;  1LFP A;  3GLX A;  4BQO A;  1J59 A;  1X1B A;  2ZME A;  4LJZ F;  4M3B A;  1Y1W J;  2JQ7 A;  2DJI A;  4A6E A;  3LAP A;  4HZF A;  1N25 A;  4A3J J;  2NYX A;  3DEE A;  2XHK A;  2BVM A;  2EIL H;  1Y8R B;  1D8K A;  3J7A O;  1D3Y A;  4G6D A;  5LFA A;  3L2Q A;  1D0X A;  2DOE A;  3J80 Z;  1HLV A;  2YUS A;  1XGO A;  1BI0 A;  2JVG A;  2OC6 A;  1MBH A;  3HZJ A;  3O8G A;  3PNV A;  1X2M A;  4UNO A;  4B3X A;  1SD4 A;  4FCY A;  4XBF A;  1DGR M;  2B9S A;  4KT6 A;  3MMY B;  3ZRG A;  4HLY A;  3GTK J;  5EEH A;  4D9J A;  4ZYD A;  1IDZ A;  3S3O A;  2HR3 A;  2MH9 A;  3JRB A;  3LOC A;  4YFN F;  2Z9O A;  2VUM J;  3CCQ I;  1U5T B;  3R61 A;  4ZDO A;  4RBO A;  1ZG5 A;  3ECO A;  3FXQ A;  4C2T A;  2KLO A;  1MBJ A;  3JRF A;  3F8B A;  2XSD C;  4IHY A;  3C18 A;  3N4M A;  2VQG A;  1O3R A;  2N8G A;  3ROU A;  1BOA A;  2DN0 A;  2Z33 A;  1ZTR A;  2GLO A;  2IAI A;  1OR7 A;  2LY1 A;  1JUS A;  4DBR A;  2M7B A;  5B5E C;  2OD5 A;  3E5U A;  1B6A A;  3IH4 A;  1O57 A;  3BQZ A;  1CQT A;  1EJ9 A;  3TOA A;  4Q47 A;  1QZY A;  3ISP A;  5DTD A;  4ON0 A;  2ZSH B;  5HVQ C;  3HG9 A;  1Y39 A;  2V9V A;  4ITV A;  2WV0 A;  1JGG A;  2R7V A;  3WU0 A;  4A5M A;  4A0X A;  4DYC A;  3I0T A;  1STZ A;  3DTI A;  3HEF A;  3HKZ N;  1P7J A;  2O6G E;  2NRA C;  3BZK A;  4YRV A;  2R7U A;  1CGP A;  1SD5 A;  1UCR A;  2IS4 A;  1YHQ I;  2HXI A;  5IP7 J;  2ZXH A;  2YSR A;  4AYB N;  1LNW A;  3G1L A;  2CV2 A;  3K1M A;  2XPV A;  2YPR A;  2CUF A;  2KIU A;  1O3Q A;  3W3C A;  1W36 D;  3BTI A;  2HOE A;  3H36 A;  1QHG A;  4WK8 F;  3C2G A;  3DLL F;  1Z67 A;  2EBI A;  1FYL A;  4BKX A;  4NQW A;  1MJB A;  1FJL A;  3SFI A;  2LKP A;  4E7S A;  2W7N A;  1Y1V J;  2VJ4 A;  1OCC H;  3TBI A;  1YOV B;  4I02 A;  5H2F C;  2BBY A;  1W7P A;  3I71 A;  2MC4 A;  3FKJ A;  5K5Q A;  4RAF A;  5K5O A;  1QPM A;  1WJ5 A;  4HYE A;  4Y3O A;  4B1R A;  5D4R A;  1GVJ A;  4XN0 A;  1OCZ H;  4UVB A;  3CMM A;  2DOA A;  3SQN A;  3CCU I;  4BEH B;  4B4C A;  4M6Y A;  4NC7 A;  2ME0 A;  1S3J A;  2W25 A;  1V5F A;  2E1C A;  4HLX A;  2DMU A;  4R79 A;  2VB6 A;  3S2H J;  4PGH A;  3OYB A;  1G59 A;  4MNU A;  4PSX A;  1QO0 D;  1SVL A;  4XKB A;  4ZYG A;  5M3F J;  3B6A A;  3HDD A;  3PM1 A;  4EMS A;  1XC5 A;  2ZBK A;  2KRF A;  4CUG A;  4E4H A;  3VEP A;  3K4C A;  2K7L A;  2NNY A;  5J47 A;  4M3F A;  5F04 A;  1UHS A;  2KIS A;  2A07 F;  2KFD A;  3F8M A;  4I7H A;  3RPQ A;  3LFK A;  3S1Q J;  1ZR4 A;  3LSI A;  1J75 A;  1X4O A;  1XGS A;  2CH0 A;  2X9D A;  3UR3 C;  1OMI A;  2CW0 F;  4DNC A;  3LSP A;  2PEX A;  3I5U A;  1HDP A;  2XSJ C;  1ZG1 A;  3CCY A;  2O9L A;  3OYI A;  1JT6 A;  1R6R A;  4FX4 A;  4PSW A;  5GAH J;  2WY8 Q;  4C2M J;  3KYC B;  1DGW Y;  2A05 A;  1ZEL A;  4II3 A;  1NG7 A;  3BG6 A;  1UFM A;  1YE9 A;  2GQQ A;  4HSR A;  1I1S A;  1LDD A;  2HGC A;  1W4M A;  2EZI A;  3E3V A;  2R7Z J;  5IT3 A;  3NWS A;  3QPL A;  2E71 A;  2H6C A;  3T8R A;  2MC3 A;  4F52 A;  1SFK A;  1LVA A;  3K70 C;  3HB9 A;  3S1N J;  4XMY A;  1R00 A;  2DDB A;  3QOE A;  3OWT A;  5E3M A;  2LF7 A;  3QRF F;  2KIF A;  3H9G A;  1E3H A;  2ZJP F;  1QVU A;  4I99 C;  1RRJ A;  1P2F A;  2H6B A;  2DAO A;  1YTY A;  3NRV A;  1WCM J;  1T95 A;  3TO7 A;  3L2C A;  2D45 A;  1H0M A;  4NB5 A;  3HUG A;  3HTU A;  3CCE I;  3IP4 B;  1I3A A;  3OSF A;  3LA7 A;  2KZG A;  2K85 A;  4OIQ F;  3CF2 A;  1OYW A;  2K27 A;  3EET A;  1I1G A;  3GBG A;  3WTU C;  5C3E J;  3ZQC A;  1D5V A;  2EFP A;  2XIG A;  2VLA A;  1PP8 F;  2RNG A;  5E1X A;  4C30 A;  3PO3 J;  5B1A H;  5KVR A;  5LD2 C;  1YW7 A;  3IH3 A;  3OS0 A;  1AKH B;  4HW0 A;  1JKR C;  1IRX A;  4KUM A;  3CJT B;  4PJJ A;  1UEL B;  5JHF A;  2HS5 A;  5B3S H;  2ACJ A;  3CP8 A;  5D5U B;  4RLQ A;  3EDP A;  2FQ3 A;  3TO6 A;  3LFU A;  1Z77 A;  2LNB A;  4UV8 A;  3TW7 A;  1MMN A;  3MWM A;  3GTP J;  1OCO H;  2L3D A;  1AOY A;  5FKK A;  3HSF A;  2HVR A;  1ZRF A;  1RR7 A;  3JW4 A;  4U0W A;  1TQI A;  1J0R A;  1HW5 A;  4A2U A;  3ZMS A;  3TP0 A;  4CCO A;  4XOR A;  3RKQ A;  4HEA 2;  1K78 A;  2NAZ A;  3FK7 A;  4BHC A;  3HOT A;  3HOW J;  2CUJ A;  2L0K A;  1Y8Q B;  3LSK A;  4A3D J;  3H0G J;  2V1X A;  4CYC B;  1GT0 C;  5EGO A;  3S2D J;  4A3C J;  3MKL A;  2XGX A;  4PJL A;  2R7W A;  2TCT A;  2VXZ A;  3KP7 A;  2H8W A;  1FY7 A;  4YIF A;  4UUS B;  2JRT A;  1ON2 A;  1P4W A;  4OIO F;  4ZH4 F;  2LYC A;  3RSN A;  5HDG A;  2MLK A;  2VQC A;  4DZJ A;  2ELJ A;  4KT5 C;  2DDA A;  3BR6 A;  3BR2 A;  4KIG A;  3CJR B;  3K4J A;  2HPM A;  5LHG A;  2PI0 A;  3J7Z I;  3FXL A;  2CQX A;  2XAQ A;  2IS6 A;  4MTD A;  3IAM 2;  2ESN A;  4DYR A;  2P81 A;  1KZH A;  3F8C A;  3GFM A;  3WOD F;  1U9N A;  1F5T A;  4K2E A;  4UV9 A;  3CTA A;  1T2K A;  4IKF A;  1VQ4 I;  5J1U A;  1W0T A;  3OYH A;  5IP6 A;  3CCR I;  2G7U A;  2NS0 A;  1ITY A;  2G9W A;  4A3K J;  3CUQ C;  2QA4 I;  4J19 A;  1ETW A;  2OA4 A;  1U9O A;  2HQN A;  1IV6 A;  3LSG A;  4Q5S F;  3OY9 A;  1DU6 A;  2VKD A;  3BR5 A;  1VZ0 A;  1X1D A;  1FBS A;  4AC0 A;  4BAY A;  3HOX J;  1IRZ A;  3CCL I;  5CQE A;  1NK3 P;  5B66 C;  3K4L A;  4HAM A;  3I55 I;  4O6J A;  2CJJ A;  2O61 A;  4LG0 B;  2A5W A;  5E20 A;  1RI7 A;  4BBS J;  2FNP A;  3EUH C;  4L9T A;  2LG4 A;  1VQO I;  3FXM A;  3GUD A;  2QLZ A;  3HHG A;  2ECB A;  4IHW A;  3ZQH A;  4BHP A;  1OFC X;  1IRG A;  1QPI A;  2LBF B;  3BT9 A;  3CUQ B;  2RQP A;  4E7K A;  4Q48 A;  1LFU P;  1CF7 B;  2P5L C;  1MDM A;  3HTS B;  4UUV A;  1VND A;  3U1K A;  3CDH A;  2A3S A;  3W2W A;  3P9K A;  3AG3 H;  3I64 A;  2IA0 A;  1A6Q A;  2E1M B;  5EZG A;  4OMY A;  1ZRC A;  1SAN A;  2JVH A;  2X1E A;  4ZTF A;  4XRM A;  2LVS A;  2QKM B;  3VYT B;  1BR1 A;  1DPR A;  3KFW X;  1IAW A;  2ZME C;  2G0E A;  1KU3 A;  3HM5 A;  2HYG D;  1XSX A;  5J4V A;  5GAG J;  3FBN B;  1TT0 A;  5HLT A;  3JR9 A;  3ZMV A;  4CH7 A;  3J80 K;  4CCK A;  2PMZ N;  2VC0 A;  1TNS A;  5J1R A;  4HBL A;  4J00 A;  1SVO A;  2RGV A;  1WJD A;  4Z6Y A;  2EZL A;  1XCV A;  3FXR A;  3KPH A;  3GYH X;  1FP2 A;  1P7I A;  2DYR H;  3Q3S A;  2E34 A;  1HST A;  3GX4 X;  2A6E F;  3H3V K;  1TLH B;  4HF0 A;  4L5I A;  1J09 A;  1H9G A;  1ZHF A;  1LE8 B;  1LVK A;  1S6L A;  2ESH A;  2PFB A;  2JSC A;  5HOO A;  4EV0 A;  2PLY A;  2M3A A;  4JX5 A;  5ICC A;  5K7H A;  3JRD A;  3CD6 I;  1FYK A;  4IQ4 A;  3C3W A;  3HOY J;  2M4K A;  2IGK A;  3Q0V A;  5FKM A;  5L3B A;  3BG7 A;  1KU2 A;  2BW3 A;  2ZNY A;  5LEK A;  1OCT C;  2Q2E B;  4IF4 A;  3RPU D;  4PK4 A;  4A69 C;  5M5X J;  5D5V B;  4M71 A;  2F4O B;  4YG2 F;  3IKT A;  1T8I A;  3AAF A;  1ZLK A;  4DZP A;  3CO6 C;  4XOT A;  3LSR A;  3TGN A;  3I4P A;  5BPI A;  4WWC A;  1KQ9 A;  4UUT A;  1H88 C;  3E7L A;  3ZN1 A;  5HNH A;  1W0U A;  3J7Y J;  2GXG A;  3IWZ A;  3KEY A;  4IHV A;  1BI1 A;  2A5Y B;  2FOW A;  3MZY A;  1FBU A;  4XL9 A;  2QBY B;  4KJZ A;  3LSJ A;  5F27 A;  6PAX A;  3BJ6 A;  1YI2 I;  1AHD P;  3M7G A;  4BE2 A;  1IN7 A;  4XNF A;  3GTM J;  3DKW A;  1Q1V A;  3HRM A;  4I76 A;  3TO9 A;  3GO5 A;  1TWG J;  1MMG A;  1Z7L A;  4PJM A;  2HOS A;  3K4B A;  1V5E A;  2K86 A;  2P0W A;  2F5F A;  3IRQ A;  1W1W E;  4Y7N J;  3OYD A;  5FFZ A;  2KRC A;  3K9T A;  3M8J A;  4C3H J;  4WXH A;  3RJP A;  3HOZ J;  3LMM A;  5E1Z B;  4MHG A;  1O4X A;  5AIP A;  1YRN A;  3HBL A;  4U88 A;  3VOE A;  2DTR A;  1SAU A;  3FF5 A;  3OYA A;  1GV2 A;  3QU3 A;  4XLF A;  2VAS A;  4RA2 A;  2VBZ A;  3C7J A;  1FOW A;  1GLN A;  3OYE A;  2M87 A;  1WRJ A;  2V9P A;  3LA2 A;  1BIB A;  2BGC A;  2V6E A;  1ETK A;  3TP3 A;  2GXA A;  3V8K A;  1Z0X A;  2GIV A;  4ENM A;  2XPW A;  2Z1D A;  1LB2 A;  3CCV I;  4L5J A;  1U8R A;  4KNY A;  2XF6 A;  1RKW A;  3WTS C;  2QCO A;  3WE2 A;  3ZR8 X;  2DFH A;  4A3I J;  1WSU A;  1Z91 A;  1DP7 P;  4M73 A;  1HXD A;  3KCC A;  3TDZ C;  1JKO C;  3TQN A;  1I3Q J;  3CDL A;  1K4S A;  2PJR B;  3K2Z A;  1B9M A;  3L9F A;  3O3K A;  2E1O A;  2X1D A;  2Z5U A;  1JE8 A;  3HHH A;  4DW6 A;  1SFX A;  1BOB A;  4WXD A;  3IHU A;  5D4S A;  3DU5 A;  2RN7 A;  4ESF A;  4CA0 A;  1FMV A;  3JSO A;  2EV0 A;  1TL8 A;  2P5V A;  3Q0U A;  1FZP B;  3OIP A;  2KQR A;  1XB4 A;  1ACI A;  1KYZ A;  3IH2 A;  3TDU C;  1OCR H;  4ENJ A;  4IHX A;  3E0J B;  2V26 A;  3QYF A;  1R7J A;  2WA0 A;  3T0Y A;  2STW A;  3DTK A;  1J5Y A;  1EKE A;  5FKL A;  3CC2 I;  4DQ2 A;  5F1J A;  2R7R A;  4FE7 A;  4UVC A;  2M34 A;  1FTT A;  1GDT A;  4PFP A;  1WI3 A;  3E5Q A;  5A2Q Z;  3OYJ A;  2HU9 A;  4O5V A;  1ZRD A;  4OIP F;  1ORK A;  4RGS A;  3I53 A;  4MLO A;  3RI4 A;  4A3L J;  3JRI A;  2MYS A;  5AON A;  2VJ5 A;  1B9N A;  4HQM A;  2MW8 A;  1TWA J;  3EQL F;  3QP6 A;  2KPM A;  5ILU A;  2FSW A;  2E7X A;  3ML6 A;  3OYC A;  2LBF A;  3EUA A;  2GXB A;  2JPC A;  2M0M A;  5DCM A;  5M3M J;  4B44 A;  3FBI B;  1BW6 A;  1K7A A;  4DJA A;  3Q9S A;  3TED A;  3VDX A;  4M3G A;  1FBQ A;  5F0H A;  2NVT J;  1BW5 A;  4HF1 A;  3FM5 A;  2HOA A;  3P5J A;  3AG1 H;  3PO2 J;  1RPW A;  1G4D A;  1WVR A;  3COA C;  1X2N A;  2VBY A;  1B8I A;  3I59 B;  1TNT A;  1UZC A;  2DFF A;  2EFQ A;  2NNN A;  3OMY A;  4V2F A;  5FFX A;  1AWC A;  3WHC A;  5EG0 B;  2ISY A;  4B8X A;  2QWW A;  3MAJ A;  3DPL C;  4N0B A;  5B1B H;  2DA6 A;  2Z16 A;  4HV6 A;  4BL0 B;  1YO5 C;  2BY0 A;  4RMN A;  3PFI A;  2P4W A;  5D6F A;  3GTO J;  2Y9Z A;  2ZB9 A;  5DM6 F;  2NS7 A;  5DUI A;  4G7H F;  4OMZ A;  2I5U A;  2X6X A;  1S72 I;  2A68 F;  2FXA A;  1P92 A;  1WJC A;  2IA1 A;  1KA8 A;  1MNM C;  1QRY A;  2WB1 N;  3SDB A;  2OZ6 A;  5CVU A;  4XSX F;  1MGT A;  1VQ7 I;  1XS9 A;  4G8X A;  2V1D A;  4EGY A;  5IY5 H;  2D2W A;  1GXQ A;  2UZK A;  1E3P A;  2MLG A;  5J8F A;  1WHU A;  1XD7 A;  4XSZ F;  1Y0U A;  5TJJ A;  3SEQ A;  5ICF A;  2LY9 A;  4BNC A;  3G1M A;  4DBQ A;  3FXO A;  4ZC3 A;  4C9Y A;  4WXC A;  1ZG3 A;  1MSE C;  2EZH A;  4H4K C;  2DPU A;  1LJ9 A;  3K7A J;  5LLQ A;  4XKC A;  4HNV A;  3HRS A;  2HTS A;  3JSP A;  5CVJ A;  3WGG A;  1BIA A;  2DXI A;  1ZYR F;  2RKH A;  3OYK A;  1ENH A;  1DQU A;  1OPC A;  1F9N A;  2JWT A;  5JLX A;  5D5X B;  1RR8 C;  3PL8 A;  2O8X A;  4LGW A;  2DA7 A;  1HA8 A;  2L9S A;  2V79 A;  3BR3 A;  5KCM A;  4M6X A;  2L7F P;  9ANT A;  3JCU C;  2L2O A;  3E5X A;  1TWF J;  1MJ9 A;  2MBF A;  2ZJ2 A;  1X4P A;  3G1O A;  4EJW A;  1S8N A;  1HDD C;  1ETX A;  4Y4R A;  1ZGJ A;  3ERM A;  4PUS A;  4C3I J;  1T0F A;  1VFC A;  1HKQ A;  1U3E M;  1BC7 C;  2EV6 A;  2D1H A;  1PUF A;  1MMS A;  4RB3 C;  2R5Y B;  4XOP A;  3N05 A;  1YJN I;  4C2U A;  3OYG A;  2LFB A;  4MGR A;  2QSF X;  2WBM A;  1K6Y A;  3BLY A;  2M30 A;  2NOJ B;  2VQL A;  2Y0S N;  3PNT A;  1MMD A;  1LEA A;  2DK5 A;  2HI3 A;  1JXS A;  1QVT A;  2PX9 A;  4Y17 A;  2R5Z B;  1MBG A;  3QOD A;  1JTY A;  3ZCO A;  1A35 A;  5CJ9 A;  5JHU A;  3SFZ A;  5KNL A;  2CS3 A;  2KL4 A;  3RQI A;  1IDY A;  3DEU A;  3IUO A;  4I09 A;  3CC7 I;  2VON A;  3RQ4 A;  4ESJ A;  3LST A;  4FTH A;  2ZKZ A;  4HF2 A;  3MZH A;  2L02 A;  3PSF A;  3PUB A;  3DXJ F;  4IOA F;  4LLL A;  2JK3 A;  1UJ8 A;  3BDD A;  1OCP A;  1XG1 A;  5HS9 A;  5BNG A;  4AUX A;  2W48 A;  3R6S A;  3R4K A;  3RKY A;  4D5F A;  3ASO H;  4BJT A;  4I0A A;  3FM3 A;  2W1O A;  2VPR A;  1T08 B;  2L4A A;  1B1B A;  2A69 F;  5IPA A;  2JUC A;  3GWZ A;  3RKW A;  3RKX A;  3U1D A;  4XIC A;  4I98 B;  1XDS A;  1BM9 A;  3RCO A;  1IN5 A;  2LKX A;  2KIQ A;  1IGN A;  2XAU A;  3NQO A;  2P6S A;  3B02 A;  4CZZ A;  4XM3 A;  3U2R A;  3CCM I;  3K6G A;  2V4J C;  4BJ5 C;  3DBL B;  5FLX K;  4LIU A;  4NDL A;  3RZO J;  1R36 A;  3WTZ A;  1I27 A;  5IOZ A;  1WJF A;  1B4A A;  3K69 A;  4IX7 A;  3FXK A;  5KAI C;  4V2G A;  3FWE A;  1TWH J;  1G3S A;  1BL0 A;  1FMW A;  3WTT C;  1IN4 A;  3CCS I;  1W5C C;  4MTE A;  2CQQ A;  3ZOB A;  4ANJ A;  1IRF A;  2PG4 A;  4B09 A;  2Y2Z A;  4HOB A;  2EIM H;  2ZJR F;  3PQJ A;  3ASN H;  4YII A;  1R4M B;  3OYF A;  4FHT A;  4XLN F;  2HDC A;  2JTV A;  1XDU A;  3I4N J;  4PJN A;  2M9H A;  3J7A Y;  3HPG A;  2QKL B;  1BJZ A;  1Z3Y A;  3S17 J;  3FKI J;  2LKS A;  3GW2 A;  4LD5 A;  3KX2 A;  4A3G J;  5ILV A;  2ADU A;  3H3U A;  1MH4 A;  1V54 H;  1WGX A;  2KJC A;  4G12 A;  5TRD A;  1IG7 A;  1G8X A;  2E5N A;  2AXT C;  3O8H A;  3FIS A;  3T5X A;  5TGT A;  2I8D A;  1V4R A;  3G2B A;  1X3U A;  3REO A;  3SXY A;  4Q4Z F;  2OZU A;  4EVI A;  1RKT A;  4AWX B;  1Z05 A;  2O5R A;  1V55 H;  3BPV A;  4BAC A;  2ME6 A;  3PJR A;  2JPB A;  3I59 A;  2H94 A;  1E17 A;  2FML A;  2VBW A;  4E7L A;  3K4K A;  5D6E A;  1H89 C;  1Z21 A;  5HLI A;  4D5C A;  5EG0 A;  3Q5F A;  2G7H A;  3F8N A;  5FO5 A;  3EYY A;  4NBQ A;  4BU2 A;  2BY2 A;  2M7A A;  1LFB A;  3P7N A;  1N78 A;  1K83 J;  2HFH A;  3HJE A;  2L54 A;  3GXO A;  1LDJ A;  2BYV E;  1EH8 A;  1PUE E;  2Y9Y A;  3GCM A;  4ZTJ A;  1Y6I A;  5E3L A;  1QNT A;  1TT5 B;  3T8T A;  4B43 A;  2Y69 H;  1J7K A;  2DA3 A;  3QWL A;  4ZZL A;  4BYY A;  1TBX A;  5CLS A;  3EYI A;  2XV4 S;  2V1U A;  4UHT A;  3S93 A;  2YR2 A;  3FHZ A;  3BG9 A;  3KIO A;  5FD6 A;  3RYP A;  2TDX A;  1XN7 A;  4RAG A;  3ABL H;  1VQP I;  2OJE D;  1I6H J;  4ZDL A;  3ZMU A;  2AO9 A;  1RZ4 A;  2MD0 A;  3DFG A;  3BTC A;  4XON A;  2VXD A;  1WI9 A;  2FUG 2;  2F48 A;  2E35 A;  3WU2 C;  4U7D A;  5BMZ A;  1W7P D;  4BS9 A;  1MND A;  4XLA A;  3VSL A;  3IV5 A;  1VQN I;  1X58 A;  3DPU A;  3J81 K;  3ZP5 A;  1FOY A;  2XVC A;  5CYV A;  5JVT A;  3M8F A;  1MKM A;  1U5T A;  2DFI A;  2BVL A;  1A36 A;  3I54 A;  1APL C;  4PFO A;  3WTX C;  2O03 A;  4ASN A;  4AVP A;  1FNN A;  3S3N A;  1HOM A;  2XF7 A;  2Z99 A;  3RIR A;  2OBP A;  1IW7 F;  3FMR A;  3KP2 A;  3CME I;  2GOM A;  3NAR A;  3L2R A;  1Z7U A;  1VF9 A;  2KHM A;  2Q8K A;  2FOK A;  2XPU A;  3VFZ A;  3M1C A;  1XCB A;  2HOT A;  4YFX F;  2X51 A;  2HQ5 A;  2EZK A;  1YJW I;  3AG4 H;  3F6O A;  1IV8 A;  1K61 A;  5F1R A;  1FOK A;  4A3F J;  3HGY A;  5GPA A;  3S1M J;  1RUN A;  4BHB A;  1G3T A;  5IT9 Z;  2OQG A;  2DPD A;  1WWX A;  4ZYA A;  2VPL A;  1FSH A;  1D5Y A;  4YEJ A;  4BQN A;  2WV1 A;  3JTG A;  2CV1 A;  3S16 J;  1YFH A;  2V6C A;  3A02 A;  4FAS D;  1XGM A;  1O3S A;  2LRD A;  4RM2 A;  3ZQL A;  1XMA A;  2HQA A;  2XB0 X;  3AL0 C;  2PN6 A;  3S3M A;  1MMA A;  1L0O C;  4F55 A;  1XSV A;  2PMH A;  1D8J A;  1ZKG A;  1NK2 P;  2COB A;  2F4M B;  2HDW A;  5DD4 A;  1SMT A;  3S15 J;  4MFE A;  5FB2 A;  1BR2 A;  1D0Y A;  2CSO A;  3TKY A;  5A2Q K;  1HW2 A;  1TP4 A;  1RET A;  4IO9 F;  1D1C A;  2QF7 A;  2R4G A;  2W85 A;  5IP9 J;  3ZMZ A;  2CUE A;  2F2E A;  1YX5 A;  1USS A;  4FET A;  4YIR X;  5CQG A;  2LP0 A;  1MZB A;  2EIK H;  4RM3 A;  2MFZ A;  1JUP A;  3BC8 A;  3DCF A;  5FJ8 J;  1NHA A;  4KIF A;  5KHD A;  3BZC A;  1X1C A;  4IZZ A;  4KIC A;  3ABM H;  1GV5 A;  4BEH A;  3L1P A;  1SFU A;  1FLI A;  4F93 B;  3ZQ7 A;  2A6T A;  5C4X J;  3QYB A;  5KAF C;  2MH2 A;  3BR0 A;  1DP3 A;  3RYR A;  3OOP A;  2L5Q A;  2GBY A;  3VYS B;  4UXN A;  1Z3X A;  3B6C A;  4L5E A;  1TWC J;  1BBY A;  3AL0 B;  1IN8 A;  4UY8 I;  3TW6 A;  1IZ1 A;  1FTZ A;  1V3F A;  1WQ2 A;  4BBR J;  5FRN A;  2JA7 J;  5JLW A;  1W36 C;  2YS9 A;  1LUJ B;  4CCJ A;  4BUP A;  4BY1 J;  4LLN A;  5F64 A;  3BR1 A;  3FMS A;  3I9V 2;  4NNJ A;  5FLX Z;  2H27 A;  4L0Z B;  4QLC U;  1T98 A;  2IS1 A;  4M74 A;  2EJR A;  2W57 A;  1LDK B;  4KYW A;  3W6V A;  1ZAO A;  4IQJ A;  3MKY B;  2Q0O A;  2PJP A;  5L3G A;  3VSK A;  4BE0 A;  2W82 A;  5F08 A;  4L18 B;  4BDZ A;  4X0G A;  1H9T A;  2OCC H;  4G6T B;  1YX3 A;  4B48 A;  2Q1Z B;  4QPO A;  4YFK F;  2X85 A;  4ZYE A;  4BJ6 C;  5E18 F;  1I6X A;  2J5P A;  3WGI A;  2VC1 A;  4RAZ A;  3CCJ I;  1EF4 A;  2E2J J;  4EM1 A;  1RIO H;  5DEQ A;  3GME A;  4HQE A;  5D8L B;  4IRI A;  3CLQ A;  2ZSI B;  4NHJ A;  2XGE A;  5E3N A;  4HX7 A;  1PVE A;  1ZGW A;  2W4S A;  3GF2 A;  4PCQ A;  1P6R A;  4ZZD A;  4RAY A;  3OSG A;  2CWE A;  2M2E A;  2VJJ A;  3WU1 B;  3JRH A;  3N97 A;  2BXY A;  2VL8 A;  2L9V A;  4Y33 A;  2L9N A;  3HYI A;  4E7Z A;  2GWR A;  4HG2 A;  1FSE A;  4EEF G;  3M8E A;  1IJW C;  1SFO J;  2HXO A;  2NVX J;  2JA5 J;  4HDV A;  1SVM A;  3HRT A;  4R1H A;  2Z3Y A;  3OL3 A;  2L9R A;  1J9I A;  1POG A;  3G71 I;  1WZ2 A;  2R7Q A;  4RDU A;  2KT0 A;  1RES A;  4XKV A;  2RNJ A;  2ZME B;  1YQA A;  4GGG A;  3DBH B;  4AIK A;  2KIM A;  3IKV A;  2JRM A;  4FIS A;  4ZYH A;  4PJ0 C;  5E8G A;  1G2H A;  1IXC A;  3MN2 A;  2CW7 A;  1AKH A;  4X6A J;  4JBA A;  2OPT A;  1BI3 A;  3BG5 A;  5J4Y A;  1OR7 C;  3W2V A;  2P7V B;  3ZQQ A;  3ZQI A;  4NUB A;  3DKX A;  2EIN H;  2FF4 A;  4HNU A;  3F0C A;  3ELK A;  3L09 A;  5GTH C;  2VKV A;  1NH3 A;  1QQI A;  2CMP A;  2P6T A;  3I56 I;  3G6E I;  2O8K A;  1YIT I;  1QHH D;  2XUB A;  4QWQ A;  4A6D A;  2CFO A;  4KFC A;  3HOV J;  1HKS A;  2TRT A;  3S32 A;  4CIC A;  3C2B A;  3ABK H;  4IXA A;  5GAE J;  5HOD A;  1NTC A;  1MSF C;  3O6B B;  3JRC A;  4IHT A;  2LOO A;  4XK4 A;  1GUU A;  1QU3 A;  4CYC A;  2L4M A;  5DDG A;  3CMY A;  3OR2 C;  3RZD J;  5BS6 A;  1SMY F;  3BRO A;  2GZW A;  1RUO A;  4OIN F;  4MEY F;  2WAD A;  2DOF A;  2ELH A;  4UVA A;  4UUS A;  3J81 Z;  2VBX A;  2DBB A;  3LWF A;  3QPS A;  2DO7 A;  1S7O A;  2X4H A;  3ESW B;  3QAH A;  1MW7 A;  3HSE A;  3NEU A;  2WAQ A;  1B59 A;  2HTJ A;  2ETH A;  4N9H A;  4GCV A;  3OR1 C;  5DCF A;  1ZK8 A;  4KN4 X;  2QM3 A;  2QQB A;  5JR3 A;  3GEZ A;  4KIT B;  1EA3 A;  1WJB A;  3F22 A;  2XDV A;  1JHF A;  4FT8 A;  2VE9 A;  4L9J A;  5GAD J;  1VQL I;  1HC8 A;  3GTG J;  3KET A;  1DUX C;  5BQT A;  1MNE A;  2X6Y A;  2LTP A;  4GDF A;  4FE4 A;  4BXU A;  4CCL A;  3SZP A;  1H8A C;  4IVN A;  2HKX A;  1B72 B;  2NVY J;  1X3Z B;  2OAZ A;  2QVO A;  5HS8 A;  4M9Z A;  1GXP A;  4IL6 C; 
#chains in the Genus database with same CATH homology
 2R92 J;  1PUF A;  1WCM J;  2R5Y B;  2XB5 A;  1MH3 A;  2IEK A;  2LR8 A;  2FJ1 A;  4M3D A;  3OSF A;  4X1E A;  2XGC A;  5EEA A;  2LFB A;  1JJ8 C;  2Y0S N;  3GBG A;  5C3E J;  3ZQC A;  2HI3 A;  1QVT A;  2JMW A;  3PO3 J;  2R5Z B;  1MBG A;  5GPC A;  3LNQ A;  3IH3 A;  1JTY A;  1AKH B;  3FIW A;  2MGQ A;  1JKR C;  1B8I B;  3RQI A;  1IDY A;  3CQZ J;  1HF0 A;  1WPK A;  3JRG A;  4FTH A;  2JA8 J;  5IOY A;  1Z77 A;  2H8R A;  1F43 A;  3TW7 A;  3GTP J;  4JYK A;  2ELK A;  1T56 A;  5FKK A;  4LOC A;  1GVD A;  1RR7 A;  2JK3 A;  2MG4 A;  3RKQ A;  1OCP A;  3TP0 A;  1XG1 A;  5BNG A;  4AUX A;  3FK7 A;  2W48 A;  3BTJ A;  2X48 A;  4W1U A;  4D5F A;  3HOW J;  2L0K A;  2VPR A;  4A3D J;  3H0G J;  4A3C J;  4CYC B;  1GT0 C;  5IPA A;  5EGO A;  3S2D J;  2NVQ J;  3MKL A;  4XIC A;  3M4O J;  2TCT A;  5FLM J;  3A01 A;  1I50 J;  1IC8 A;  4UUS B;  2LKX A;  2OF7 A;  3BG3 A;  3WHB A;  2VI6 A;  2VKE A;  1IGN A;  5F0F A;  2IBD A;  4DZJ A;  5FLV A;  2JJ7 A;  1JT0 A;  1ZR2 A;  3BR6 A;  3BR2 A;  5DS9 A;  4NDL A;  3RZO J;  5IOZ A;  1T33 A;  2CQX A;  4JX6 A;  3S1R J;  4V2G A;  1TWH J;  1BL0 A;  2EQR A;  4DYR A;  2P81 A;  1FEX A;  1TC3 C;  2L7M P;  3VPR A;  2CQQ A;  3ZOB A;  2LLK A;  3BTL A;  2Y2Z A;  1U9N A;  1MBF A;  2DA1 A;  1JTX A;  5J1U A;  1W0T A;  1FIA A;  5IP6 A;  1JKQ C;  3I4N J;  1LE8 A;  2M9H A;  3ZQF A;  1ITY A;  1BJZ A;  4A3K J;  2D5V A;  3GTL J;  3S17 J;  3FKI J;  4J19 A;  1ETW A;  5EZH A;  1U9O A;  4A3G J;  1VI0 A;  1IV6 A;  3LSG A;  3SJM A;  1MH4 A;  1WGX A;  4G12 A;  1DU6 A;  4JP0 A;  1PUF B;  1E3O C;  5M5W J;  1IG7 A;  3O8H A;  3BR5 A;  3FIS A;  1JUM A;  2FX0 A;  2ECC A;  5K7Z A;  4I6Z A;  3M3Y J;  2K9S A;  4QSH A;  4AC0 A;  3DEW A;  3JRA A;  1ETV A;  1RKT A;  3HOX J;  4D7N A;  3Q0W A;  2ME6 A;  1WH7 A;  2CRG A;  5EDN A;  1IRZ A;  1NK3 P;  1H89 C;  4D5C A;  5EG0 A;  2FQ4 A;  2CJJ A;  3A03 A;  5FKN A;  2K9Q A;  4BBS J;  2ID6 A;  2Y30 A;  1LFB A;  4Y52 J;  2ECB A;  2O7O A;  1K83 J;  3NAU A;  4IHW A;  5EYR A;  3SDG A;  3ZQH A;  2Y9Y A;  1OFC X;  1QPI A;  3BT9 A;  5E3L A;  2XGD A;  1LFU P;  1BA5 A;  2DA3 A;  1VND A;  4XRS A;  1MBK A;  3MVP A;  1WH5 A;  3BG9 A;  2B63 J;  5EZG A;  5EGO B;  2LD5 A;  1A6I A;  1SAN A;  1UG2 A;  4XRM A;  2LVS A;  4D7M A;  2E2H J;  1I6H J;  2AO9 A;  2E19 A;  2DJN A;  1F36 A;  3D1N I;  3BTC A;  2GM4 A;  4JX4 A;  2G0E A;  1ETO A;  4GFB A;  3HM5 A;  4B3A A;  2I10 A;  3JR9 A;  2DMQ A;  3IV5 A;  1U78 A;  1S7E A;  3HGG A;  2CU7 A;  1X58 A;  1MBE A;  2PMZ N;  3K2A A;  2RAE A;  5J1R A;  4QTR A;  1APL C;  2EZL A;  1ETQ A;  2K9N A;  1HOM A;  1P7I A;  1U8B A;  3Q3S A;  3NAR A;  3H3V K;  1VF9 A;  3JRE A;  2XPU A;  1R9T J;  1LE8 B;  1B72 A;  2DMP A;  2R93 J;  4JX5 A;  5K7H A;  3JRD A;  2HQ5 A;  3HOY J;  2EZK A;  3Q0V A;  5FKM A;  2DMT A;  2FD5 A;  1OCT C;  4A69 C;  5M5X J;  1K61 A;  4A3F J;  4DZP A;  5J1Y A;  2E2I J;  3LSR A;  3HGY A;  5GPA A;  4UUT A;  4A3E J;  3S1M J;  1H88 C;  3E7L A;  1W0U A;  1FIP A;  4IHV A;  1D5Y A;  1A5J A;  2WAQ N;  3QQA A;  2WV1 A;  5GP9 A;  3S16 J;  2HOT A;  3A02 A;  1OJL A;  2DA2 A;  3LSJ A;  5F27 A;  4S0H B;  1AHD P;  3ZQL A;  4A3B J;  2XB0 X;  2DA4 A;  2NOG A;  5IYC J;  1JKP C;  3GTM J;  1Q1V A;  4I76 A;  1ZKG A;  1NK2 P;  2COB A;  1TWG J;  4ABZ A;  3S15 J;  2HOS A;  4MFE A;  3BQY A;  1AU7 A;  1RET A;  4Y7N J;  2QF7 A;  4M6V A;  5IP9 J;  2CUE A;  4M3B A;  4C3H J;  1Y1W J;  1HCR A;  3HOZ J;  4BXX J;  1O4X A;  1YRN A;  3HBL A;  4A3J J;  2LP0 A;  3S14 J;  1GV2 A;  1JUP A;  3DCF A;  5FJ8 J;  5J3L A;  2KDZ A;  1HLV A;  1ZQ3 P;  2YUS A;  1MBH A;  1GV5 A;  3O8G A;  3L1P A;  1X2M A;  5C4X J;  1ETK A;  4FCY A;  3TP3 A;  3BR0 A;  2R0Q C;  1Z0X A;  2DTZ A;  2GBY A;  3B6C A;  4L5E A;  1TWC J;  3GTK J;  2XPW A;  1IDZ A;  3TW6 A;  1FTZ A;  3JRB A;  1RKW A;  3LOC A;  4BBR J;  2QCO A;  2JN6 A;  2X6O A;  5M5Y J;  2EH3 A;  4A3I J;  2VUM J;  2JA7 J;  5JLW A;  2YS9 A;  4RBO A;  4BY1 J;  1JKO C;  3BR1 A;  4DYQ A;  1I3Q J;  3CDL A;  1MBJ A;  4IEJ A;  3JRF A;  2XSD C;  4IHY A;  2E1O A;  2M8G X;  4DW6 A;  4C3J J;  3W6V A;  3OIO A;  2N8G A;  3ZQG A;  3A01 B;  2DN0 A;  3OOU A;  1ZTR A;  3Q0U A;  2GLO A;  2IAI A;  1JUS A;  2AHQ A;  3IH2 A;  5F08 A;  3I4M J;  2L7Z A;  4IHX A;  3IH4 A;  2M0C A;  3BQZ A;  1CQT A;  2ID3 A;  5FKL A;  5K7F A;  1EF4 A;  5DTD A;  4MIM A;  5F1J A;  3FK6 A;  2E2J J;  4FE7 A;  2M34 A;  3UKG A;  1JGG A;  1FTT A;  4DYC A;  2XGE A;  5E3N A;  3HEF A;  3HKZ N;  1GDT A;  2H1K A;  1ZGW A;  1WI3 A;  5IYB J;  1P7J A;  2YU9 J;  1ORK A;  3OSG A;  2M2E A;  2XRL A;  4MLO A;  2HXI A;  5IP7 J;  3JRI A;  4A3L J;  4XID A;  4AYB N;  5C44 J;  3JRH A;  1DU0 A;  3G1L A;  2MW8 A;  1TWA J;  2JA6 J;  2XPV A;  4BY7 J;  2CUF A;  4EEF G;  3BTI A;  1IJW C;  2NS8 A;  1SFO J;  2HXO A;  5M3M J;  2NVX J;  2JA5 J;  2R5Y A;  2L9R A;  1BW6 A;  1POG A;  2EBI A;  4BKX A;  3TED A;  4RDU A;  2KT0 A;  4M3G A;  1RES A;  4QIW N;  3SFI A;  2LK2 A;  1FJL A;  5FKO A;  5F0H A;  1Y1V J;  2NVT J;  1BW5 A;  3HOU J;  3GTQ J;  2HOA A;  4FIS A;  1YRN B;  2Y31 A;  2R5Z A;  1G2H A;  3MN2 A;  4A93 J;  3PO2 J;  1AKH A;  4X6A J;  2OPT A;  1RPW A;  4B1R A;  3BG5 A;  1X2N A;  1B8I A;  4V2F A;  4M3E A;  3ZQI A;  5IYD J;  4B4C A;  3WHC A;  5EG0 B;  2DA5 A;  2ME0 A;  3F0C A;  2VKV A;  2DA6 A;  2DMU A;  3GTJ J;  3S2H J;  2MSY A;  2O8K A;  3HOV J;  3GTO J;  2TRT A;  2Y9Z A;  2ZB9 A;  5M3F J;  3B6A A;  3C2B A;  3HDD A;  3PM1 A;  2NS7 A;  2DMN A;  5HOD A;  1NTC A;  1MSF C;  2HYJ A;  3JRC A;  1XC5 A;  4XK4 A;  1MNM C;  1GUU A;  1QRY A;  2WB1 N;  4CYC A;  4W97 A;  3CMY A;  3RZD J;  1XS9 A;  4M3F A;  5F04 A;  1UHS A;  4UUS A;  1UMQ A;  2LY9 A;  3G1M A;  3S1Q J;  1ZR4 A;  3QPS A;  1MSE C;  2EZH A;  2X9D A;  3K7A J;  3LSP A;  1HDP A;  3CCY A;  2O9L A;  4HNV A;  1JT6 A;  5E3O A;  5C4J J;  4XRS G;  1ENH A;  4C2M J;  2JWT A;  1ZK8 A;  5JLX A;  4MO7 A;  2HDD A;  1IUF A;  1JJ6 C;  2DA7 A;  3BR3 A;  2EZI A;  2L7F P;  2R7Z J;  9ANT A;  3QPL A;  3GTG J;  1TWF J;  2LTP A;  3S1N J;  3HB9 A;  4FE4 A;  3G1O A;  1HDD C;  1ETX A;  5E3M A;  1H8A C;  1ETY A;  5F0C A;  4A3M J;  1B72 B;  2K40 A;  2NVY J;  4MFD A;  4C3I J;  5EF6 A;  1VFC A;  1QVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...