4IEJA

Crystal structure of a dna methyltransferase 1 associated protein 1 (dmap1) from homo sapiens at 1.45 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
VQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA methyltransferase 1-associated protein 1
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16282 SANT_DAMP1_like SANT/Myb-like domain of DAMP1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4iejA00
1BL0A 1JUPA 2R5ZA 2EZHA 2N8GA 2L9RA 1WPKA 2HOSA 3S14J 3I4NJ 4I76A 2X48A 2DMTA 3IH3A 1GDTA 2HDDA 5FKMA 3HGGA 4V2GA 3BR2A 5EEAA 1VNDA 4A69C 1T56A 2DA2A 2M0CA 5FJ8J 3HKZN 3HOUJ 4QSHA 1ZR2A 1MH4A 3BR5A 3Q0VA 3H0GJ 3BR0A 3BTJA 1Z77A 2LY9A 4QIWN 4I6ZA 2JA7J 1G2HA 3S1NJ 1XS9A 5J3LA 3BR1A 1JKOC 3S15J 1F43A 3BTLA 4BY7J 2MGQA 2JMWA 2FD5A 3JRGA 3DEWA 5M5WJ 5FKNA 2JA6J 2EH3A 3PO2J 2LLKA 3RKQA 1MBEA 3BG9A 1JKQC 2HOTA 4A3MJ 4UUSB 1QVTA 3LSGA 2LK2A 2LVSA 2MSYA 2JA5J 3S16J 2K40A 2L7ZA 3UKGA 3HB9A 2QCOA 1POGA 1WH5A 5F0FA 1NK2P 2L7FP 2XRLA 4G12A 3M3YJ 3VPRA 2OF7A 3G1LA 2VPRA 2FX0A 3GTKJ 3TW7A 2CUEA 2M8GX 1BA5A 1LFUP 3IV5A 2K9SA 3IH4A 1P7JA 3G1OA 2HXOA 5M5YJ 1PUFB 4BKXA 2M9HA 1JGGA 1MBKA 4D7MA 1ETYA 2ID6A 1BW5A 5F27A 2HYJA 2M34A 4J19A 3HBLA 2MG4A 2W48A 2YUSA 3CMYA 1LE8A 2CQXA 2DJNA 3BTCA 4X1EA 4C3JJ 4MLOA 1QRYA 4C3HJ 3JRCA 1WCMJ 1JJ6C 4RBOA 2B63J 1XG1A 3OIOA 2RAEA 2R7ZJ 1JT6A 1VF9A 2XPVA 4CYCB 3JREA 1O4XA 2YS9A 5C4JJ 4C3IJ 4M3BA 4A93J 1HDDC 2R0QC 4C2MJ 2CJJA 2E2JJ 2NVQJ 1D5YA 3NAUA 1IC8A 5K7HA 3MVPA 4A3JJ 1R9TJ 1ETXA 1S7EA 3CQZJ 5EYRA 1LE8B 1IDYA 1YRNB 1P7IA 1FEXA 1W0UA 3OSFA 2AO9A 2YU9J 3GTPJ 5IOYA 4UUTA 1B8IB 1AHDP 2HXIA 4IHWA 5J1RA 5DS9A 1BJZA 4CYCA 2DMQA 5GP9A 3SJMA 1B72A 2XGDA 1OJLA 1I3QJ 1WGXA 2NVTJ 4D5FA 2Y2ZA 4IHYA 1ETWA 2IBDA 3S2HJ 2PMZN 2I10A 3LOCA 3JRDA 1FJLA 1Z0XA 1JKRC 4JP0A 1Y1WJ 2XSDC 3S1RJ 2O7OA 1ZTRA 1RPWA 5EG0A 4DYRA 4HNVA 2GBYA 1SFOJ 3GTOJ 1JKPC 4D7NA 1JTYA 5C3EJ 1BW6A 3HOYJ 3HOZJ 3TEDA 4D5CA 3HOWJ 1ETVA 4NDLA 3MKLA 5EDNA 1UMQA 1I50J 2E19A 3F0CA 5JLXA 3WHCA 1HCRA 4L5EA 3MN2A 3GTMJ 3JR9A 2ID3A 3QQAA 1ETKA 3GBGA 4AC0A 1TWHJ 3GTGJ 5EG0B 3HOVJ 5E3OA 5C4XJ 2NS8A 5JLWA 4QTRA 1U8BA 1JT0A 4M3EA 1ZKGA 4FCYA 1MBGA 5FLMJ 3RZOJ 2DA4A 2DMUA 2LD5A 2AHQA 3B6AA 4M3DA 5E3NA 1QPIA 2R5YB 4B3AA 4A3DJ 2LFBA 2DA5A 4JX4A 3QPLA 3GTQJ 3A02A 1A6IA 3OOUA 2JA8J 3TW6A 2NOGA 5K7ZA 3S1QJ 3M4OJ 3QPSA 2HOAA 5DTDA 4DZJA 4XK4A 5IOZA 3CDLA 2CUFA 1MBFA 1APLC 4A3CJ 1OCTC 1A5JA 5J1YA 2VKEA 2FQ4A 1ETQA 2DTZA 4XRSG 1UG2A 1K83J 1OCPA 4JX5A 5F0HA 1DU6A 1QVUA 1IJWC 1H88C 1GVDA 1MBHA 4Y52J 3PM1A 1TC3C 4A3EJ 1WH7A 4DZPA 2EZIA 1LFBA 2OPTA 2R5YA 3L1PA 2R92J 4FE7A 1JTXA 3K2AA 2R93J 4DYQA 5IYDJ 1TWAJ 5EZHA 3JRHA 4GFBA 2FJ1A 4FE4A 4A3KJ 3BR6A 1TWCJ 2Y31A 1GT0C 1AKHA 2Y9ZA 3HGYA 5FKKA 2DA6A 2EZKA 3BQYA 4FISA 5M5XJ 2KDZA 3BG3A 3ZQHA 3ZQCA 2NVXJ 3HOXJ 1I6HJ 1NK3P 2WAQN 3GTJJ 3FK6A 4MFEA 5F1JA 4BBSJ 2E2IJ 4B4CA 2LKXA 2E2HJ 4AUXA 2Y9YA 3B6CA 2DMPA 4JX6A 4MIMA 1JJ8C 5EGOA 1U9NA 3S17J 2LTPA 2GM4A 1B8IA 5BNGA 1X2NA 1Y1VJ 3HEFA 3JRFA 2ELKA 1Q1VA 3BR3A 5M3FJ 1GV2A 2ME0A 2EQRA 3CCYA 1B72B 2DA7A 4MO7A 1HOMA 3BTIA 3FIWA 3FISA 4MFDA 5EF6A 1ZR4A 2XGEA 2Y0SN 2HQ5A 5FKLA 1RKTA 4M6VA 1EF4A 4IHVA 5EGOB 5M3MJ 2ECBA 2ME6A 2GLOA 1JUMA 5FLVA 2O9LA 4ABZA 4X6AJ 4UUSA 5FKOA 2JK3A 3E7LA 5E3LA 5K7FA 3A01B 1RKWA 2IEKA 1IGNA 2CRGA 2R5ZB 4XICA 4DW6A 2JJ7A 2IAIA 3LSPA 1IDZA 1CQTA 2MW8A 4FTHA 2ECCA 3IH2A 5IPAA 1RR7A 2WB1N 3C2BA 2CQQA 4S0HB 3JRBA 2EBIA 4BBRJ 4DYCA 3RQIA 3SFIA 1W0TA 4XIDA 4A3FJ 4LOCA 2JN6A 5C44J 1FIPA 1ZGWA 1OFCX 2L0KA 3LNQA 3ZQFA 5IP6A 1U78A 3FK7A 2L7MP 1WI3A 2VI6A 2VUMJ 5IYBJ 1XC5A 1MNMC 2O8KA 3S2DJ 2XB0X 3S1MJ 4BXXJ 2P81A 1VI0A 2DA3A 3BQZA 2X6OA 2NS7A 2G0EA 3PO3J 1RETA 1H89C 2M2EA 1GUUA 1FTZA 2DMNA 2LR8A 2QF7A 4A3GJ 2Y30A 1RESA 3GTLJ 1GV5A 1MH3A 1U9OA 5EZGA 4XRMA 2D5VA 3DCFA 3Q3SA 4A3IJ 4AYBN 2X9DA 3Q0WA 2XB5A 1HF0A 3ZQLA 2DN0A 4BY1J 1MBJA 1ZQ3P 1MSFC 5GPAA 3HM5A 2E1OA 4A3LJ 2HI3A 2ZB9A 3BT9A 1SANA 4XRSA 3BG5A 1ORKA 4IHXA 2CU7A 1JUSA 4Y7NJ 2H1KA 1UHSA 5IP9J 3K7AJ 3A03A 5IYCJ 3H3VK 3LSRA 4M3FA 3JRAA 1PUFA 5HODA 4IEJA 1AKHB 1ETOA 5GPCA 1NTCA 2K9QA 3I4MJ 1X2MA 4W1UA 1ZK8A 5E3MA 2EZLA 2XPUA 5J1UA 3NARA 4B1RA 2TRTA 1K61A 4JYKA 5F08A 3O8GA 4W97A 2H8RA 3D1NI 2VKVA 4RDUA 1ITYA 1IV6A 3G1MA 1E3OC 1T33A 4A3BJ 3TP0A 2JWTA 2LP0A 2DA1A 3O8HA 1TWFJ 1MSEC 3WHBA 3Q0UA 5IP7J 1ENHA 1IUFA 2XPWA 1DU0A 5F04A 3HDDA 3ZQIA 1TWGJ 3RZDJ 1IRZA 1FTTA 3TP3A 1YRNA 1HDPA 3FKIJ 3SDGA 1IG7A 3ZQGA 2XGCA 4EEFG 9ANTA 1H8AC 2NVYJ 2KT0A 1AU7A 3ZOBA 1F36A 4V2FA 1VFCA 3OSGA 1FIAA 2K9NA 1X58A 2COBA 4M3GA 1HLVA 2TCTA 3LSJA 5F0CA 3W6VA 2WV1A 3JRIA 3A01A
chains in the Genus database with same CATH superfamily
1BL0A 4PJ0C 3DPLC 1XSVA 3AKZA 2EZHA 4RB0A 1IV8A 2JSPA 4U87A 3CTAA 1U0JA 2F5CA 1WPKA 2CW7A 1YITI 4UY8I 3S14J 3I4NJ 1MNDA 1N25A 2X48A 5JHUA 4CCNA 2RV8A 3GFJA 5LGTA 1GDTA 2MC4A 1FP1D 4RB2C 4V2GA 2FU4A 2GWRA 3BR2A 1RNLA 2BY3A 3R4KA 1T56A 2A69F 3V7SA 5HS9A 1FSEA 5FJ8J 5FRNA 2P6SA 4BEHA 2BGCA 3HKZN 3W6JB 2K5CA 1EH7A 3IKTA 1GLNA 1IRFA 1R6RA 1XSXA 1FSHA 3H0GJ 2UUZA 1TZLA 1W36D 3AG4H 1OCCH 4QIWN 5J3LA 3S15J 2Y69H 2PJRB 1J5YA 2LY1A 1O7FA 4HYEA 1TL8A 4L18B 2FD5A 4XOTA 3VOEA 2V1NA 4ZYEA 2EH3A 3PO2J 1G4DA 1F1ZA 2FSWA 4BU2A 1JKQC 2HOTA 4UUSB 3H3UA 3ULQB 5L3BA 2MSYA 2JA5J 1R1VA 1Y39A 2R4GA 2L7ZA 2XIGA 1R5GA 4DOZA 1YX5A 3BZ6A 1F4KA 3HB9A 3RTRA 2M5WA 1R4MB 5AIQA 3GMEA 1IRGA 4Q4ZF 4H4KC 2CO5A 4P9FA 5HDKA 2K85A 1RIOH 1Z1DA 1D0ZA 5EEHA 2R7FA 4P9UA 2VC0A 2OF7A 2KHMA 3AG3H 2VPRA 1TW3A 3M1EA 3GTKJ 1P2FA 2CUEA 2M8GX 2Z9OA 2PG4A 4IJAA 2IT0A 2W4SA 5GTHC 1WSUA 2K9SA 3MZHA 1P7JA 3IH4A 4EGZA 2LMDA 5LBQA 1F5TA 1RUNA 4JK1X 3Q5FA 4BKXA 4IX7A 1VQ9I 1ZHFA 2BHYA 1JGGA 1HA8A 3A1YA 1MBKA 3ECOA 2LC2A 3HHGA 5HLTA 2M34A 4AIJA 1FOYA 4J19A 3HBLA 1IXRC 1MDMA 1ZGJA 2FBKA 2KQRA 2VKDA 5D6FA 3KEYA 2M4GA 2COMA 4BE0A 3N05A 2DJNA 3WTSC 4C3JJ 2UXXA 4BH9A 1QRYA 3JRCA 1TQIA 3Q9SA 4IKFA 3CC2I 1XG1A 2A6TA 2W24A 2BVLA 2DOEA 4CYCB 5C4JJ 5KK1A 3E6DA 2D2WA 4E7IA 4JOMA 1HDDC 4XQFA 2BZTA 1ZH5A 2R0QC 2EV5A 2XF5A 2EIMH 2IW5A 4XKVA 2WBMA 4A0YA 5EYRA 1LE8B 1IDYA 3F72A 1W1WE 1W0UA 2DAOA 3U2RA 2YU9J 5DM7F 4P1WA 3GVAA 2F2EA 1VQ5I 4YFXF 4BJ6C 4MEXF 2ZCWA 4E7KA 1IN5A 4KN7X 2EFNA 5GP9A 4FETA 5ICGA 1SEUA 5ERIA 1ZELA 2KLOA 5L3GA 5JI6A 4J00A 3WG9A 1Y1WJ 1FWZA 3RKYA 2GA2A 4A0XA 2XSDC 1X1PA 2JVHA 3S1RJ 4E7HA 2IGKA 2VKHA 4QPOA 4DYRA 1SFOJ 5B3SH 2OC6A 3GTOJ 2JRMA 4P96A 4LIUA 2L4AA 3HOZJ 4N9HA 1BW6A 1FBUA 3TEDA 3L2WA 1DUXC 3OR1C 5LHIA 4F3QA 3CCRI 3KZYA 3EUHA 3CMEI 1UMQA 3GEZA 2LF7A 3E6MA 5FLXZ 2E19A 4KIFA 3WHCA 1YJNI 1YO5C 4M6XA 3N97A 1AWCA 1KU9A 2KMUA 2OZUA 2GXBA 3V7RA 5TJJA 3DF8A 3R6SA 3E0JB 1HQCA 1TWHJ 4KT5C 1XMKA 1R49A 2L01A 3KP3A 5E3OA 1LDJA 3HOVJ 4QTRA 2DK8A 1R4NB 2EV0A 2ISYA 2ZO4A 1JT0A 3AL0C 1TTYA 2Z2SB 3P7NA 1V54H 1X1DA 4XNFA 4KMFA 5FLMJ 2OJED 4BXFA 1ODDA 1FX7A 3B6AA 1ZLJA 5J8FA 3IAS2 4KFCA 3CF5F 2R5YB 3S3OA 2VE8A 3VEPA 5BPDA 1D3YA 5KCMA 2LFBA 1R71A 1A6IA 3OOUA 4CYDA 1GHCA 1O3SA 3FBNB 3VSLA 3QPSA 5GAEJ 3QOPA 2RQQA 3S93A 3CDLA 4LG0B 1QZYA 1ZRDA 4XLPF 1OCTC 2FE3A 4LK0F 2FQ4A 5KVRA 1ETQA 4XRSG 4G7OF 2Z1DA 1P6RA 1DU6A 2RDPA 4E7ZA 2PJRA 3I56I 1ZG5A 1OCRH 1MBHA 1VQLI 2FXAA 3H36A 4Y52J 4QPQA 1LFBA 3J81K 2M8EA 2LG4A 4LB6B 1JTXA 2R93J 2DT5A 1WWXA 3MKZA 1TWAJ 3JRHA 1O3TA 4GFBA 1FBSA 2FJ1A 2HKOA 5H6QA 1IRXA 5L3CA 1UAAA 2Y31A 1AKHA 2Y9ZA 4Y33A 2EZKA 5M5XJ 2KDZA 2VB6A 4XLEA 4PCQA 1KQ0A 3ZN0A 2PEXA 3OS1A 4R79A 5F1JA 2E2IJ 4HLYA 3ZCOA 2IS2A 4G6TB 3TOAA 4AUXA 2Y9YA 2H8WA 3TL4X 3BPVA 3NWSA 4MIMA 4O5VA 4N0BA 3OR2C 2K3FA 1WJFA 3TO9A 2ZNZA 4B48A 2P7VB 1SAXA 1QO0D 1N75A 1X2NA 2A3SA 1WVRA 1YG2A 2DTRA 1D0YA 2ME0A 4AD9A 2I5UA 3L00A 2KIFA 1HOMA 3CP8A 3CUQA 3KYDB 1ZR4A 2XGEA 4G6DA 4HSTA 3DV8A 1RKTA 2JPBA 3CJQB 1FMWA 1EF4A 2ZSHB 4IHVA 5EGOB 2Z5UA 3RYPA 4CICA 2O9LA 4HF2A 2MYSA 4KDPA 4EGYA 2JQ7A 3A01B 2PLYA 3C2HA 4OAYA 4XICA 3DTEA 2FRHA 1W5TA 1IO2A 3EETA 3LSPA 5DD8A 3K70D 5HLGA 2L5QA 5E1ZB 3IH2A 2EIKH 4HBLA 2F4IA 2D1VA 4U0VA 2XAGA 3SFIA 5D4SA 2FMLA 3ZPLA 4XORA 2HTSA 1OFCX 2IA2A 5DCMA 1FOKA 3IL2A 2AS5F 3ZQFA 5IP6A 1QHGA 2VQHA 2MD0A 1XN7A 1Y8QB 4PDKA 4RM3A 4ESFA 2EILH 2MH9A 5HNFA 4M71A 5F64A 3VODA 1XC5A 5K1YA 4WK8F 3S2DJ 2CV0A 1YIJI 3K4NA 4HX8A 2R7OA 5JFRA 2QF7A 4A3GJ 3DKYA 4B43A 1MH3A 1GXQA 2AQEA 2V6CA 3DCFA 4A6EA 3F6OA 1XX5A 4AYBN 4CA0A 4A3IJ 2ZXJA 3GZ5A 1PDNC 1WJCA 2A6HF 3WTVC 3I59B 4ON0A 2NXNB 4BQNA 2V1XA 3HM5A 3CJNA 1YOVB 2E1OA 4A3LJ 2VQLA 3BT9A 2E5ZA 2RKHA 3BP8A 2EPFA 1IW7F 1TQMA 2P5VA 2ZSIB 1BBYA 3SQNA 1FBQA 1YX3A 4LJZF 4UV9A 3BDDA 5IP9J 3L2RA 1FY7A 1Z6TA 5EJCA 4XKCA 2IGNA 3IRRA 2XGXA 4DIQA 4XSZF 1PUFA 1MJAA 2IPQX 1Y6IA 4ESBA 2PI0A 1T0FC 1ETOA 5GPCA 1V5FA 2P0WA 5H2FC 4PGHA 5E3MA 3PFIA 2XPUA 1W7PA 4NHJA 2HPMA 3H1CA 3H9QA 1Z21A 5F08A 3TO6A 4NBQA 1UELB 4AU7A 1O57A 2VKVA 2HU9A 4C30A 2QQAA 1N78A 2GAUA 2IVMA 3KEOA 1YE9A 3G1MA 4HF0A 4BQQA 4LG0A 5D6EA 1E3OC 2JWTA 4BJ5C 1BI1A 1LVKA 2DA1A 2PMUA 2GIZA 2X1CA 2A61A 3IWFA 3H9GA 1HW2A 5HDGA 1LEAA 4UB6C 3RPQA 2XUBA 1QZZA 3WHBA 3J81Z 2V9KA 4BL0B 3C2GA 3M1CA 4KMUX 5F04A 2W84A 3ZQIA 4OIRF 2O5RA 3RZDJ 5LLQA 1IRZA 3I9V2 4ANJA 1YRNA 2OCEA 2XGCA 4HX7A 3V4GA 2VT2A 3I54A 5DCFA 1L3LA 4ASNA 3CLOA 3RQ4A 2M4KA 2BOLA 1FC3A 2KT0A 3KPHA 2CQ7A 2DLLA 3OSGA 2WY7Q 2K9NA 2DBBA 2KDOA 3MWMA 2TCTA 2YSRA 3TOBA 3W6VA 2L3DA 4E7JA 2E36A 1WI9A 3J7YJ 2HS5A 4XMYA 1YI2I 1JUPA 3CDIA 4CXFA 3MEXA 2L9RA 3OYFA 4OMZA 1JI8A 1DPUA 4XM3A 2GA1A 3ZRGA 2ZC2A 1U5TC 3CMMA 4AYBA 1LPQA 2DMTA 1QHHD 2OV7A 2V1DA 3CUQC 3QAHA 4ENKA 1VQNI 4ZDOA 1ZLKA 4G94A 4F93B 3DWLE 1S29A 2DQLA 1YFHA 3BJAA 4WXCA 1VNDA 3RCOA 3JAMZ 1B59A 4OAZA 2V79A 2M0CA 4Y3OA 2R7WA 2E34A 2G7UA 2XROA 1U6GA 1I39A 3LQRA 1OISA 2VBXA 3Q0VA 1SAUA 2BEOA 3ONQA 5BPIA 3CUQB 2HWVA 1GVJA 3BR0A 2OA4A 3BTJA 1U5TB 2JA7J 5TISC 2CMPA 2QSGX 3BR1A 1JKOC 3K2ZA 1K78B 4BY7J 3CF2A 3JRGA 3DEWA 2IS1A 2A6EF 5FGMA 2JA6J 2LLKA 3RKQA 1MBEA 1XGNA 5CYVA 3D0SA 5GADJ 4ZJZA 3LSGA 3RIRA 4IRHA 4BE2A 3M8FA 2L02A 2AXLA 1HW1A 2QCOA 4XN3A 3I0TA 1WH5A 3HRUA 3P9CA 4UVCA 1XSDA 3V8KA 1HKQA 4Q48A 1TW2A 1NK2P 4MQ9F 1T2KA 5H6RA 4U0WA 2GOXB 2XRLA 4KISA 3C1DA 4Y15A 1RRJA 4EQQA 2LKPA 2JUCA 1VQ4I 2R7RA 3WTXC 4BQAA 3TW7A 1BA5A 2KRCA 4FX0A 4J01A 3PNVA 2V9VA 3K4LA 2NRAC 3K4MA 1MNEA 4HSRA 3QYFA 2XF6A 1PUFB 2VBWA 2EFQA 3ASOH 3OL4A 3FXRA 2OBPA 4IRIA 4D9JA 1BW5A 5BS6A 2M0MA 3BWGA 4HLXA 3CMYA 3WG7H 4Z6YA 2IXSA 2VBYA 4X1EA 2EK5A 3BJOA 3G71I 2ZFWA 1WCMJ 1WRJA 2QQ8A 3H92A 3RPUA 4RS8A 2B63J 3CCMI 5GAHJ 1G8XA 3COAC 4YELA 2R7ZJ 5IT3A 3KETA 3JREA 2MD5A 4AM3A 1R1UA 1HC8A 3JSPA 4D0PA 1G3WA 2NVQJ 1IC8A 4WF2A 3MVPA 3LL7A 4DBRA 2X1DA 2GOMA 1X19A 2AXTC 3CQZJ 1LVAA 1P7IA 4KA4A 2A68F 2E7XA 1FEXA 3P9KA 2AQFA 3OSFA 2AO9A 4FX4A 3BY6A 5IOYA 2R7UA 2R7QA 4IL6C 4UUTA 2R7TA 2OD5A 4HQEA 1SC7A 1BJZA 2CUJA 4CYCA 2DMQA 2PMHA 1A36A 3HSRA 3LA2A 3SJMA 1B72A 3K0LA 3DP7A 1I3QJ 1VQPI 4I02A 2IBDA 4II3A 4IHYA 1I6XA 3PUFA 3SXYA 3LOCA 4CZZA 3JRDA 1D1CA 5LEKA 4XSXF 1JHFA 1Z0XA 3TBIA 3QP6A 3WGHA 1REPC 2W82A 1HSJA 3W2WA 3HOTA 1RR8C 1JKRC 2A07F 3O6BB 2VLAA 1V5GA 5CKTA 4L9NA 4BAYA 1ZG1A 2K86A 3QYEA 1ZTRA 5EG0A 5J4VA 1JHHA 2HGCA 2K9MA 4BHCA 3OMYA 2FNPA 1JKPC 2W25A 1NH3A 1USSA 3HOYJ 5K5OA 3HC7A 3VYUB 1YS7A 4ITVA 2NVUB 4D5CA 2R7SA 4NDLA 2E1MB 2P7CB 1U5TA 2QSFX 3CMAI 1I50J 5JLXA 3F0CA 2A5WA 2Q1ZB 3OS2A 4MQVA 2MC3A 1T08B 5ILVA 4RLQA 1HBXG 4ZYGA 1Z05A 4UHTA 2FMYA 2FOKA 4GCVA 4AIHA 4F92B 5F1RA 2XAJA 5JHFA 5DM6F 4ENJA 2KISA 3PNYA 2XKOA 4BXUA 5JLWA 2XAHA 3FBIB 3QPTA 2IJLA 4F52A 1H9TA 4M3EA 1FLIA 1QGPA 4HEA2 2CW8A 1TT0A 1MBGA 1O3RA 3LSTA 3EUKL 2M7BA 3M7GA 1DQUA 4U0YA 2LD5A 2AHQA 3HSFA 1S8NA 1DDNA 4WXDA 2DXIA 3VYRB 4M3DA 2R7DA 2IGOA 4EM0B 1W5CC 1NG6A 3CCVI 5E3NA 5E8GA 1QPIA 1OYYA 2Y75A 3F23A 3BPXA 4XLNF 2DA5A 2HYFA 4JX4A 4NC8A 4MGRA 2VPLA 3GTQJ 3A02A 3OL3A 2QWWA 3TW6A 4CZCA 3S1QJ 2HOAA 3PNTA 2XSJC 5IOZA 5A2QK 2CUFA 2VJ4A 3OWTA 4HNTA 1NG7A 1APLC 4P5OA 4ZYAA 5J1YA 2VKEA 1BC7C 4ETSA 2DTZA 4U88A 3H35A 1UG2A 1K83J 5FO5A 1YW8A 5F0HA 4ESJA 2K02A 3CCQI 2V7FA 2RGVA 1H88C 5ICCA 1E2XA 1TC3C 3HTUA 4A3EJ 2L4MA 1N77A 2EZIA 2YR2A 3CJRB 2X4HA 1K7AA 5KNLA 5HDNA 3K2AA 1SMTA 3FHZA 4GYGA 3VYTB 4DYQA 5EZHA 3A2KA 1L0OC 1LEBA 4N4OB 2QKLB 3W2VA 2Q2EB 2F5EA 3OIPA 3BR6A 5H20A 2IP2A 3PIOF 2LH9A 2XHKA 1LFPA 2I8DA 4FISA 1IAWA 3BG3A 3LA7A 2NVXJ 1NK3P 2WAQN 3FK6A 4MFEA 3ABKH 4BBSJ 4MTDA 5LD2C 2LKXA 2B9SA 3B6CA 2DMPA 3MMYB 4JX6A 2GXGA 2XAQA 1JJ8C 4BQOA 2DFFA 2EV6A 1U9NA 4RB1A 1KYZA 3HRMA 3S17J 3F21A 4PK4A 4PUSA 2LTPA 4HG2A 2GM4A 1F9NA 3HUGB 1Y1VJ 3PIPF 1VQ7I 2OTJI 1T6SA 1J75A 5M3FJ 1Q1VA 3A4CA 3BG6A 1DGRM 1QNTA 2HKXA 3CCYA 2EQRA 2BW3B 4L9TA 1ZG3A 1TNSA 2LDUA 3FIWA 4MFDA 5EF6A 1KU7A 1J9IA 5FKLA 1CGPA 1W36C 1G3TA 2DPDA 4GRIA 1SD5A 1R22A 2HTJA 4OWRB 1MJ9A 3V8JA 1E3PA 1DPRA 3OOPA 2ZXWH 2W00A 2ECBA 2ME6A 1K6YA 1JUMA 5FLVA 1T95A 4UUSA 1XD7A 2CRGA 5CVVA 2J5PA 2QEXI 1G59A 4BDYA 2KZVA 3OYKA 4CGZA 3RI4A 2M1BA 1IDZA 2JSCA 4UUVA 3A0BC 1ONVA 2ECCA 2ADUA 3MZYA 3EPZA 2WB1N 3RKWA 2CQQA 4S05A 4ZZLA 4DQ2A 4DYCA 3RQIA 3S8PA 4XIDA 4LOCA 1B4AA 2JN6A 4CCJA 1FIPA 3IHUA 4UB8C 3QP5A 1R1TA 2C6YA 3DTIA 4XLAA 4ZYHA 3SFZA 2L0KA 2LKSA 5ICFA 2B7EA 2QM3A 1ACIA 1XCBA 3K4BA 2D1HA 4IHSA 4GYIA 2EFPA 2CW0F 2WY8Q 2BXYA 3GCMA 1VQMI 1XPXA 1VQKI 1MMNA 1WI3A 3P5JA 2VI6A 4IOCF 1ZYRF 1U3EM 2XB0X 2KRHA 3J80K 3V8LA 3S1MJ 4PGGA 1I5ZA 4BXXJ 2NS7A 3KP6A 1MDMB 1S5LC 3EUHC 5AONA 1RETA 3J80Z 1D0XA 2LR8A 3FZVA 4YRVA 2Y30A 1VQOI 1YJ9I 2DK5A 1SD7A 2KIQA 2XC7A 3E97A 1YIOA 1U9OA 2K4JA 5EZGA 2P5KA 4AIDA 4XRMA 3Q3SA 4KNYA 3MKWB 4RAGA 4ZZDA 4BGDA 1WJAA 3ECHA 1T8IA 2Y48A 3G3ZA 2CV2A 3HHHA 1BR1A 4E70A 4ZYDA 2KIMA 4OIOF 1T38A 2IRFG 3BG5A 3BROA 3EDPA 4RMNA 1P9QC 2H1KA 3KIOA 1IN6A 3BLYA 3A03A 1UHMA 3K4JA 4UVBA 3H3VK 2NYXA 3KCCA 3SZPA 1I27A 4HRIA 4EJOA 1SVMA 3NWTA 1NTCA 3WTZA 3KEQA 2LREA 3M07A 3MZ8A 4B1RA 3GFLA 1RZ4A 4JYKA 3CO7C 3U9GA 3T1BA 2LSOA 4HV6A 4LD5A 4TV7A 4DGWB 2H8RA 4BHPA 4OIPF 4CH7A 4ZTFA 2GXAA 4ZH4F 3C18A 5DDGA 2J5OA 2VXDA 2FEZA 1T33A 4I01A 3TP0A 3WTYC 1D1AA 2QENA 3SYTA 2VN2A 1YHQI 2Z3YA 3KYLA 3CCUI 5HS8A 2KRFA 1ENHA 3SDBA 3DKXA 1IUFA 2HVRA 4F55A 1TWGJ 3TKYA 5TRDA 1A35A 1W7PB 2OU2A 3HRTA 1Z67A 4JBAA 3SDGA 1XTAA 1IG7A 2O3FA 3ZQGA 4L9JA 3LSKA 4EEFG 2M87A 4YIIA 5J4YA 1AU7A 3SEQA 3ZOBA 4A5NA 1VQ6I 1FPQA 2IS6A 1VFCA 2H09A 3K6GA 3LFKA 5D8KB 3FMRA 2ZNYA 2P8TA 1HLVA 1KGSA 4I99C 4XBFA 2ZBKA 2ZJ2A 1EH8A 2P5LC 4KIGA 4BNCA 2KJBA 2R5ZA 2RNJA 2BY2A 4JQFA 2HOSA 1B9NA 4I76A 1MD0A 2VQGA 4I0BA 1UCRA 2OQRA 3I55I 4HDUA 3ERMA 1X4OA 1OCOH 3HGGA 4RGUA 4KJZA 1FOWA 1LB2A 4K2EA 4A69C 1KA8A 2CV1A 1BI2A 2GIVA 3HOUJ 3PQKA 4QSHA 3CC4I 5LRRA 1ZR2A 2VBZA 1XDSA 4A6DA 3F8FA 5CPRB 3WU1B 3BR5A 5E18F 4UV8A 2X85A 5E17F 1TBXA 1Z77A 2LY9A 1G2HA 1XS9A 1I3AA 4EV0A 1F43A 4PJLA 1IXSB 3FM3A 3QWLA 4DBQA 2MGQA 3DLAA 3U1KA 5FD6A 2KL4A 3SHFA 2KIUA 5DYMA 2LNBA 2DFEA 4BHBA 4L5JA 3EUAA 5CJ9A 3BCAA 1FOXA 2LK2A 4AVPA 1HSTA 2LVSA 1IN7A 1O3QA 2K40A 4XR6A 3K69A 3L2CA 4UNOA 1POGA 4HV5A 3R0JA 4XRFA 5F0FA 5DD4A 3T5XA 1BN5A 3D5SC 3CC7I 2TDXA 2QBYA 3AL0B 1ZN2A 4EM2A 1Z9CA 1MW7A 5FLXK 4G12A 1Y8RB 3LFUA 4LLGF 2DODA 3VPRA 1ZREA 3ZR8X 2LOOA 2FX0A 4BJTA 3FXJA 4IF4A 3U1DA 4IO9F 4HA8A 1IN8A 4OINF 2CYYA 1X4PA 4B8XA 1LFUP 1ZAOA 1MMAA 5HLIA 3E1SA 5E1XA 2VC1A 3JAMK 3G1OA 2HXOA 5LFAA 2L7KA 2KJCA 3I64A 2ESHA 5BOXA 2M9HA 5JVTA 4D7MA 1ETYA 2ID6A 2HDCA 5F27A 1FYMA 3F8NA 2YUSA 1S7OA 3F8CA 1DP7P 1QZEA 3N4MA 1IZ1A 3OYBA 2D45A 3C7JA 4C3HJ 4CCKA 2X6WA 1U2WA 1P4XA 1XGOA 4RBOA 3OIOA 3AG2H 2WAFA 2VOOA 4IOAF 1I1GA 1DGWY 2ZXHA 3LAJA 3ASNH 1QA6A 3W3CA 3R0AA 2G9WA 4M3BA 4A93J 3PJRA 1JE8A 2ZFUA 1UG0A 4HQMA 4C2MJ 2CJJA 1G6NA 3GFIA 2E2JJ 1BIAA 3EYIA 3M8EA 3GFMA 3UNGC 5K7HA 1V4RA 1OPCA 3HSEA 1R9TJ 1WJEA 3DBHB 1S7EA 2H1LA 2EINH 1WHUA 3OYMA 4RGRA 4EJVA 3WTTC 2UZKA 3ZMVA 2HXIA 3F6VA 1OKRA 5DS9A 1TP4A 2HDWA 2M45A 1DP3A 4PFOA 1WJDA 1Y0NA 1A31A 3JW4A 1R7JA 2XGDA 2VOPA 5B1BH 4HPQA 3HL2A 4EJWA 2NVTJ 4D5FA 2Y2ZA 3OYJA 3KLOA 3S2HJ 2I10A 1W7PD 4YIRX 3QODA 1FJLA 3B73A 5CQEA 4GGGA 1IUYA 1UB9A 2PN6A 4E7LA 2E71A 1TLHB 4QLCU 3OYIA 3QRFF 3KYCB 3E6BA 2EB7A 3G2BA 3H5NA 4CCMA 3ISPA 4EM1A 2NNYA 2L9NA 3L2QA 3ABMH 3AAFA 2GBYA 1SMYF 2IA1A 4M73A 3I59A 3ESWB 4D7NA 5E20A 3SZGA 3OY9A 4BE1A 3RYRA 1S72I 5D5WB 1YW9A 2JVGA 2NAZA 1ETVA 1CF7A 3K10A 2QZ8A 3ELKA 5EDNA 2LY2A 1OLTA 4RAZA 2VONA 4E4HA 3MN2A 3AG1H 3QQAA 4CCLA 1JGSA 5J8CA 1XCVA 4F7ZA 1QBJA 3DXJF 4M9ZA 2UXNA 1X3WB 4CCOA 3GTGJ 5EG0B 4PJMA 4EJUA 2V1UA 1QPMA 2F5VA 3G73A 1U8BA 4YFKF 2HPIA 5CLSA 1ZKGA 4C2UA 1BR2A 4LLLA 1XMXA 4XN0A 2DA4A 1T98A 1FP2A 1O7LA 5L3EA 5LGNA 1LJ9A 3H5RA 3I53A 4BUPA 3TO7A 3FXLA 3BZKA 2HZDA 3LMMA 3QPLA 4Z2YA 2ZJQF 2DT6A 1MKMA 2MA3A 1YJWI 3IUOA 2O61A 2DYSH 4XK4A 4BEHB 3AFHA 3BG7A 3HG9A 3L9FA 3I58A 1ERDA 4CO8A 1FT9A 5GTIC 1MBFA 5FD5A 3WTUC 2DQRA 2BY1A 2F48A 1Z3YA 2BBYA 2CFXA 2VQCA 3GO5A 1OCPA 4JX5A 3H0DA 2KPMA 3O2PE 4IQJA 4OU0A 1K79A 4NNJA 2E35A 2Y0SA 1GVDA 3TQNA 2YPRA 3PM1A 4NUBA 4DZPA 2BY0A 5JR3A 3HJEA 2X51A 6PAXA 2OPTA 2EA4A 2R92J 3V7CA 5IYDJ 2Z99A 4XOPA 3HPHA 4MHGA 4A3KJ 1TWCJ 2FBIA 1ZARA 4KIBA 1GT0C 2CSOA 3DPTA 3NEUA 4HOBA 4ZDPA 3MFKA 3TDZC 3MCZA 5CVJA 2L9SA 1YLFA 4ZDLA 1J09A 2QBYB 2XF7A 1YTYA 3K1NA 2PJPA 2M30A 1MMDA 4B4CA 1RUOA 2QYOA 1KQ9A 5CVIA 1EH6A 3K9TA 2BVMA 3MQ0A 2CWEA 4I7HA 3TGNA 2EA2A 5TGTA 3OYNA 5D5XB 2PFBA 3E5UA 1KONA 5BMZA 3I3LA 1ON1A 2H6BA 4YFNF 4YG2F 2ELKA 3BR3A 4HW0A 1GV2A 2CS3A 2B0LA 3DBLB 1V55H 1XGSA 1HW5A 1S6LA 2FA5A 4HAMA 4MNUA 2DA7A 4OOIA 4MO7A 3FISA 3C3WA 1D1BA 2Y0SN 1J59A 3TMOA 2W1OA 2RVCA 2QQ9A 4DJAA 3P9IA 2E1NA 3L09A 2DW4A 2PX9A 5M3MJ 3FHNA 4RLFA 1YW7A 2GLOA 2QUFA 5BQTA 4I2OA 4ABZA 5IT9Z 5E3LA 5K7FA 3IC7A 3HPGA 1IGNA 1WFXA 5HS7A 3J7AY 2IAIA 1EV7A 1JXSA 3HTSB 4U7BA 4FTHA 5LGUA 4GXOA 4KUMA 3C2BA 2HOEA 2XRNA 1ZRCA 3JRBA 4LK1F 1YYVA 3KZZA 4IHTA 5C44J 1J0RA 2F5DA 2OCCH 3WODF 4H0EA 3ZMTA 3W2AA 3IKVA 3LNQA 3PSFA 1BI3A 2WWYA 5D8LB 2HFHA 1Z3XA 2FUG2 2LYCA 2QVOA 2K3PA 3T8TA 2BHZA 4ZTJA 3KP4A 4LFUA 4IVNA 3FDYA 1ULYA 1MNMC 5B1AH 1ZRFA 3BC8A 3HIFA 2DA3A 3L2UA 2W7NA 2QGUA 3CESA 3K4CA 3PO3J 1H89C 2BE5F 2M2EA 1GUUA 2XV4S 1FTZA 2BXZA 1RESA 1GV5A 3QU3A 5ED4A 4AWXB 2E7WA 1HXDA 3REOA 2X9DA 3Q0WA 2WC2A 2XB5A 3ZQLA 2DN0A 3BZCA 3GWZA 3ZP5A 4BY1J 1TT5B 1D8JA 2HI3A 2KP6A 3I71A 3FWEA 5LRSA 1I1SA 2X6XA 2RC4A 2YU3A 4WX9A 3Q9VA 4RB3C 1ORKA 3K4KA 2CU7A 1E0EA 1JUSA 2QKMB 2DO7A 5IYCJ 4A12A 2HQAA 3JSOA 1BR4A 1BIBA 5HODA 4IEJA 1AKHB 3LSHA 3ZMUA 2E1CA 3RDIA 3I4MJ 2MLGA 3OIQA 4W1UA 1ZK8A 1S3JA 3EYYA 2EZLA 4ENMA 3BCBA 3NARA 2KKOA 2TRTA 1K61A 3KE2A 4I0AA 3E3VA 3O8GA 4LITA 2MBFA 4WXHA 1SFEA 1J7KA 2CQNA 1M1EB 3IP4B 2VASA 1IV6A 2Q0OA 4LB5A 2EFOA 2OZ6A 4A3BJ 2O03A 3WU0A 1LDDA 3DEEA 3HOSA 2GQQA 4M74A 1MSEC 3M8JA 2H27A 4LLNA 5IP7J 1H0MA 5J6XA 1LNWA 1USTA 1B6AA 1DU0A 3VYSB 1X3UA 4E7SA 3IAM2 1G3SA 4NC7A 2E60A 1UZCA 1FTTA 2V6EA 3TDUC 1STZA 1IF1A 3FKIJ 3VFZA 4RAFA 2ZXIA 3E6CC 1H8AC 4KITB 3PUBA 2O6GE 2JRTA 3FM5A 2VJ5A 4V2FA 3V42A 3FX3A 1D8KA 1IXCA 1E17A 1X58A 4M3GA 3FXUA 3U21A 3B02A 2WAQA 4YIFA 2WV1A 5IY5H 3A01A 3S1NJ 2M3AA 5D5VB 4G9YA 5HOOA 2QSHX 1LUJB 2JTVA 3FF5A 5LHGA 1KZHA 2N8GA 1ON2A 4KT6A 2DOAA 1R58A 3MD2A 4U7DA 2VL8A 2ZMEA 2OTLI 3H5AA 4FQGA 3IH3A 3FMQA 1S9HA 1SD4A 2HDDA 1OYIA 1P92A 5FKMA 2WB1A 1PYVA 3O3KA 3SZTA 5EEAA 4RAYA 1ZGAA 1Y56A 3DU6A 4KICA 2XKPA 1R23A 2Z16A 2DA2A 4CHUA 2BV6A 3QYBA 5AIPA 3FXQA 2DYRH 4UXNA 1WQ2A 4YEJA 2F5FA 4XKBA 1MMSA 3CLQA 1MH4A 1OCZH 1Z91A 3CCSI 1EKEA 5KHDA 5FRMA 4N9IA 4AIKA 1S7AA 2FOWA 1SVOA 4I6ZA 5A2QZ 3MAJA 4XKWA 3BTLA 5D4RA 2JMWA 5M5WJ 5FKNA 4NQWB 2G7HA 3BG9A 3DU5A 1MZBA 1UFMA 4A3MJ 3CD6I 1Z6RA 1OQYA 1QVTA 3F8MA 5FFXA 1PUEE 3ML6A 3IWZA 3S16J 1XB4A 2EJRA 4S04A 3UKGA 2X1EA 5CQGA 5ILUA 1Q1HA 2LRDA 2Q8KA 3BJ6A 3S2WA 2DU9A 1R00A 1V5EA 2ZJPF 5DEQA 3FXOA 2HZTA 4RA2A 2CUZA 2L7FP 3M3YJ 4RGSA 5KAIC 2WAEA 2BYVE 3G1LA 5JVGF 2EIJH 5LEJA 3RKXA 2V9PA 3HYIA 2PQ8A 2RNGA 4B44A 3IV5A 2ISZA 3F3XA 3GZNB 4E6KG 2KZGA 3CP2A 3W6KB 5M5YJ 1LDKB 2ZKZA 3KX2A 3IRQA 3LSMA 2DCEA 2F6CA 2HYJA 2K7LA 2MABA 4I98B 4M72A 2NS0A 3CCJI 2MG4A 2W48A 3SEZA 4FT8A 2DFIA 1LE8A 5CVUA 1SFXA 2CQXA 3BTCA 4MLOA 2ACJA 2IA0A 2NNNA 2XVCA 3CZ6A 1JJ6C 2VJJA 2Z33A 3RJPA 1XGMA 2RAEA 2R3SA 3OYEA 1JT6A 1VF9A 4PSXA 2XPVA 1Z7UA 1W4MA 2MLKA 2XAUA 2K27A 3DKWA 2ZJRF 1O4XA 2DDBA 2YS9A 1EJ9A 4C3IJ 3WE2A 5DUIA 1Z7LA 3CO6C 1WZ2A 3CJTB 1J2XA 2UV1A 2OQGA 3E5QA 3NAUA 2EWNA 3CDHA 4Y4RA 1D5YA 4GDFA 3ROUA 5E79C 4A3JJ 1KU3A 1EA3A 2MFZA 1ETXA 2VIXA 2O8XA 1H9GA 4NQWA 3DFGA 1YRNB 1BOBA 2VXZA 4WCGA 3GTPJ 4C2TA 1SFUA 3OYGA 1B8IB 5FFZA 1B9MA 4XLHA 5EEGA 1AHDP 4Q5SF 4IHWA 1B1BA 1XDUA 5J1RA 2V4JC 3K1PA 3OV8A 5L3FA 1A04A 3WGIA 3GLXA 2BW3A 1OJLA 4ZC3A 2WADA 4IRGA 1IN4A 1WGXA 3GYHX 1CF7B 3JTHA 1ETWA 3WE3A 2RQPA 2PMZN 2DT7B 4IZZA 3I4PA 3DEUA 4JP0A 1VQ8I 1KQ8A 2H6CA 5DV5A 3RSNA 2O7OA 1WJ5A 3F9KA 1RPWA 1MMGA 3KP7A 3BOQA 3PQJA 4HNVA 5LHHA 2DOFA 4A5MA 1MJBA 4XONA 3ZQQA 4L5IA 3D5LA 3GF2A 4R1HA 1JTYA 5C3EJ 1OR7A 1OR7C 1AA7A 2W57A 2DI3A 3CCEI 3GXOA 3HOWJ 2KFDA 4Y13A 1QU3A 1C0WA 2DFHA 3WTWC 3MKLA 3DLLF 3X2QH 3ABUA 1P4WA 1K4TA 4O6JA 1HCRA 1BOAA 4L5EA 3GTMJ 4M6YA 1PP8F 2HQNA 5HVQC 3JR9A 1OMIA 2ID3A 5B5EC 2V26A 3RPUD 2JA2A 2JZYA 3T0YA 1QQIA 1ETKA 1RC9A 3WGGA 3GBGA 3J7ZI 4AC0A 4L0YB 1FMVA 5C4XJ 5L3DA 2NS8A 4RGXA 1R5ID 4V19K 3ERED 4FCYA 3M9AA 2X6YA 3RZOJ 2DMUA 2ZMEB 5GAGJ 5B66C 3CCLI 2W85A 1PVEA 2ICWG 5HLHA 3DTKA 4B3AA 4A3DJ 3NRVA 2OAZA 2FBHA 5D5UB 2R7XA 2JA8J 2LBFB 1FYLA 1MIJA 3M4OJ 2NOGA 5K7ZA 5DTDA 4DZJA 3ZGKA 2XDVA 4A3CJ 2CFOA 3PL8A 2PBIA 5HNHA 1A5JA 1LKXA 2R7VA 3WU2C 2NOJB 4CUGA 4BACA 3K1MA 1K78A 3A0HC 1QVUA 3H9JA 1IJWC 4R8HA 4A0ZA 1WH7A 3JTGA 2QLZA 2L9VA 3L1PA 2R5YA 4I09A 4FE7A 2A05A 4PJNA 2IGMA 2RREA 4LGWA 2OUMA 4LMYA 3JCUC 1X1BA 4FE4A 5DUKA 3PFYA 4NC6A 1FYKA 2ZMEC 3D5RC 3GUDA 3EQLF 3HGYA 5FKKA 1TNTA 1FNNA 2DA6A 1R5HA 3BQYA 1YS6A 1G3YA 1WKMA 1K6OA 3KP2A 3ZQHA 3ZQCA 2F4OB 3HOXJ 1I6HJ 2QQBA 4BDZA 3R61A 4BS9A 3GTJJ 4P55A 1MGTA 3FXKA 3H3ZA 3QPHA 3LSIA 2E2HJ 2K9LA 3GX4X 3NQOA 5CVRA 1BM9A 4HDVA 2STWA 5EGOA 4HZFA 2F4MB 4IXAA 2CQKA 3ZXSA 2IS4A 1P4AA 3L7WA 1B8IA 5BNGA 4RM2A 3HEFA 2CGPA 3GZ6A 1X1AA 3JRFA 3UR3C 2K4BA 2ELHA 4XL9A 1BJAA 2HYGD 3J7AO 3GW2A 4FASD 1B72B 2XAFA 2P4WA 2WV0A 3I5UA 4KN4X 2STTA 1LQ1A 3VDXA 1T0FA 4EMSA 2VE9A 3BTIA 5E1WA 1OYWA 2HQ5A 3QU6A 2VT3A 4G6QA 1SVLA 3FKJA 1AOYA 2O0YA 4EVIA 4N4NB 4M6VA 4HX4A 3S3MA 1KU2A 2VODA 4IQ4A 4QWQA 4M9XA 3LAPA 2EFWA 2CH0A 3OYCA 4X6AJ 5FKOA 2JK3A 3E7LA 1RKWA 1YQAA 2IEKA 1X1CA 4ENNA 3FXMA 2R5ZB 5K5RA 4XLCA 2UWMA 4DW6A 2JJ7A 4Y17A 3LQQA 1CQTA 3F8BA 1GXPA 2MW8A 5KAFC 3QOEA 3OYHA 5IPAA 3E5XA 1RR7A 4S0HB 3LA3A 4X0GA 4L0ZB 2EBIA 4BBRJ 2PMZA 4MTEA 1UJ8A 1W0TA 2MH2A 4A3FJ 3DPUA 1ZGWA 4PSWA 3PSIA 4G8XA 1X3ZB 2GZWA 2WA0A 3FMSA 1U78A 3FK7A 3ZMZA 5E8IA 4BYYA 3HZJA 2L7MP 2QA4I 3HRSA 2FQ3A 1U8RA 4DNCA 1TQPA 5ILSA 4CDGA 1SD6A 5K5QA 1K4SA 4F91B 4IPAA 1PP7U 2VUMJ 5IYBJ 2O8KA 1RI7A 3VWBA 3S32A 2FF4A 5J47A 4XLFA 2P81A 1VI0A 2YX7A 2HR3A 3BQZA 2X6OA 2JUGA 1VZ0A 2G0EA 2L54A 3KFWX 2DMNA 3KZIC 5ICEA 4A2UA 3GTLJ 4FHTA 4B09A 3G4SI 3HUGA 1SFKA 2LBFA 2D5VA 5DCMB 3OS0A 1T39A 4GO1A 2HEOA 3OYLA 1Y0UA 1HF0A 5IT9K 1MBJA 1UHWA 1VTNC 1MSFC 1ZQ3P 5GPAA 1BC8C 2A5YB 1XMAA 2ZB9A 3L2VA 2X0LA 3S3NA 2HVQA 1SANA 4MEYF 5J40A 4L9VA 4XRSA 4UVAA 2L2OA 4CSWA 3G6EI 2E5NA 3OYAA 4IHXA 2E1MC 3ZN1A 3GLLA 4Y7NJ 4LIVA 1UHSA 3K7AJ 2DDAA 4B47A 3KLNA 3LSRA 4NB5A 4M3FA 4PZJA 3VSKA 3JRAA 2DPUA 1WJBA 2Q2EA 1R36A 4AVZA 5F6FA 1BI0A 5FB2A 3K70C 2HNHA 2K9QA 1X2MA 3ZQ7A 3ZMSA 2YX4A 1A6QA 5J1UA 3MKYB 2JT1A 2P6TA 3T8RA 3OYDA 1D5VA 2Y0MA 3F22A 3VB2A 4W97A 4EJTA 3D1NI 1E3HA 4RDUA 1FZPB 3DQVC 1ITYA 1V3FA 2FNAA 5FROA 4D1QA 4B3XA 3ZMDA 3HKZA 2HQRA 2LP0A 4PJJA 3O8HA 1TWFJ 4EATA 2CG4A 4II2A 2DJIA 2VJIA 3Q0UA 4G7HF 4O3MA 4C9YA 3LWFA 1HKTA 4HNUA 1NHAA 2XPWA 4HF1A 4G7ZF 1HKSA 3HDDA 1W5SA 3HXLA 2RN7A 4M9SA 3TP3A 1HDPA 2M7AA 2ELJA 3ABLH 3CUOA 4WWCA 4OIQF 9ANTA 2ETHA 1KYWA 2NVYJ 3ABTA 2WTEA 1F36A 1PJRA 3DBRB 3KP5A 4Q47A 4KYWA 2JPCA 3R60A 1FIAA 2COBA 4PFPA 2ESNA 3LSJA 5F0CA 2XASA 2HVSA 2LF8A 2H94A 3JRIA 4LG3A 4OMYA
chains in the Genus database with same CATH topology
1BL0A 1JUPA 2R5ZA 2EZHA 2N8GA 2L9RA 1WPKA 2HOSA 3S14J 3I4NJ 4I76A 2X48A 2DMTA 3IH3A 1GDTA 2HDDA 5FKMA 3HGGA 4V2GA 3BR2A 5EEAA 1VNDA 4A69C 1T56A 2DA2A 2M0CA 5FJ8J 3HKZN 3HOUJ 4QSHA 1ZR2A 1MH4A 3BR5A 3Q0VA 3H0GJ 3BR0A 3BTJA 1Z77A 2LY9A 4QIWN 4I6ZA 2JA7J 1G2HA 3S1NJ 1XS9A 5J3LA 3BR1A 1JKOC 3S15J 1F43A 3BTLA 4BY7J 2MGQA 2JMWA 2FD5A 3JRGA 3DEWA 5M5WJ 5FKNA 2JA6J 2EH3A 3PO2J 2LLKA 3RKQA 1MBEA 3BG9A 1JKQC 2HOTA 4A3MJ 4UUSB 1QVTA 3LSGA 2LK2A 2LVSA 2MSYA 2JA5J 3S16J 2K40A 2L7ZA 3UKGA 3HB9A 2QCOA 1POGA 1WH5A 5F0FA 1NK2P 2L7FP 2XRLA 4G12A 3M3YJ 3VPRA 2OF7A 3G1LA 2VPRA 2FX0A 3GTKJ 3TW7A 2CUEA 2M8GX 1BA5A 1LFUP 3IV5A 2K9SA 3IH4A 1P7JA 3G1OA 2HXOA 5M5YJ 1PUFB 4BKXA 2M9HA 1JGGA 1MBKA 4D7MA 1ETYA 2ID6A 1BW5A 5F27A 2HYJA 2M34A 4J19A 3HBLA 2MG4A 2W48A 2YUSA 3CMYA 1LE8A 2CQXA 2DJNA 3BTCA 4X1EA 4C3JJ 4MLOA 1QRYA 4C3HJ 3JRCA 1WCMJ 1JJ6C 4RBOA 2B63J 1XG1A 3OIOA 2RAEA 2R7ZJ 1JT6A 1VF9A 2XPVA 4CYCB 3JREA 1O4XA 2YS9A 5C4JJ 4C3IJ 4M3BA 4A93J 1HDDC 2R0QC 4C2MJ 2CJJA 2E2JJ 2NVQJ 1D5YA 3NAUA 1IC8A 5K7HA 3MVPA 4A3JJ 1R9TJ 1ETXA 1S7EA 3CQZJ 5EYRA 1LE8B 1IDYA 1YRNB 1P7IA 1FEXA 1W0UA 3OSFA 2AO9A 2YU9J 3GTPJ 5IOYA 4UUTA 1B8IB 1AHDP 2HXIA 4IHWA 5J1RA 5DS9A 1BJZA 4CYCA 2DMQA 5GP9A 3SJMA 1B72A 2XGDA 1OJLA 1I3QJ 1WGXA 2NVTJ 4D5FA 2Y2ZA 4IHYA 1ETWA 2IBDA 3S2HJ 2PMZN 2I10A 3LOCA 3JRDA 1FJLA 1Z0XA 1JKRC 4JP0A 1Y1WJ 2XSDC 3S1RJ 2O7OA 1ZTRA 1RPWA 5EG0A 4DYRA 4HNVA 2GBYA 1SFOJ 3GTOJ 1JKPC 4D7NA 1JTYA 5C3EJ 1BW6A 3HOYJ 3HOZJ 3TEDA 4D5CA 3HOWJ 1ETVA 4NDLA 3MKLA 5EDNA 1UMQA 1I50J 2E19A 3F0CA 5JLXA 3WHCA 1HCRA 4L5EA 3MN2A 3GTMJ 3JR9A 2ID3A 3QQAA 1ETKA 3GBGA 4AC0A 1TWHJ 3GTGJ 5EG0B 3HOVJ 5E3OA 5C4XJ 2NS8A 5JLWA 4QTRA 1U8BA 1JT0A 4M3EA 1ZKGA 4FCYA 1MBGA 5FLMJ 3RZOJ 2DA4A 2DMUA 2LD5A 2AHQA 3B6AA 4M3DA 5E3NA 1QPIA 2R5YB 4B3AA 4A3DJ 2LFBA 2DA5A 4JX4A 3QPLA 3GTQJ 3A02A 1A6IA 3OOUA 2JA8J 3TW6A 2NOGA 5K7ZA 3S1QJ 3M4OJ 3QPSA 2HOAA 5DTDA 4DZJA 4XK4A 5IOZA 3CDLA 2CUFA 1MBFA 1APLC 4A3CJ 1OCTC 1A5JA 5J1YA 2VKEA 2FQ4A 1ETQA 2DTZA 4XRSG 1UG2A 1K83J 1OCPA 4JX5A 5F0HA 1DU6A 1QVUA 1IJWC 1H88C 1GVDA 1MBHA 4Y52J 3PM1A 1TC3C 4A3EJ 1WH7A 4DZPA 2EZIA 1LFBA 2OPTA 2R5YA 3L1PA 2R92J 4FE7A 1JTXA 3K2AA 2R93J 4DYQA 5IYDJ 1TWAJ 5EZHA 3JRHA 4GFBA 2FJ1A 4FE4A 4A3KJ 3BR6A 1TWCJ 2Y31A 1GT0C 1AKHA 2Y9ZA 3HGYA 5FKKA 2DA6A 2EZKA 3BQYA 4FISA 5M5XJ 2KDZA 3BG3A 3ZQHA 3ZQCA 2NVXJ 3HOXJ 1I6HJ 1NK3P 2WAQN 3GTJJ 3FK6A 4MFEA 5F1JA 4BBSJ 2E2IJ 4B4CA 2LKXA 2E2HJ 4AUXA 2Y9YA 3B6CA 2DMPA 4JX6A 4MIMA 1JJ8C 5EGOA 1U9NA 3S17J 2LTPA 2GM4A 1B8IA 5BNGA 1X2NA 1Y1VJ 3HEFA 3JRFA 2ELKA 1Q1VA 3BR3A 5M3FJ 1GV2A 2ME0A 2EQRA 3CCYA 1B72B 2DA7A 4MO7A 1HOMA 3BTIA 3FIWA 3FISA 4MFDA 5EF6A 1ZR4A 2XGEA 2Y0SN 2HQ5A 5FKLA 1RKTA 4M6VA 1EF4A 4IHVA 5EGOB 5M3MJ 2ECBA 2ME6A 2GLOA 1JUMA 5FLVA 2O9LA 4ABZA 4X6AJ 4UUSA 5FKOA 2JK3A 3E7LA 5E3LA 5K7FA 3A01B 1RKWA 2IEKA 1IGNA 2CRGA 2R5ZB 4XICA 4DW6A 2JJ7A 2IAIA 3LSPA 1IDZA 1CQTA 2MW8A 4FTHA 2ECCA 3IH2A 5IPAA 1RR7A 2WB1N 3C2BA 2CQQA 4S0HB 3JRBA 2EBIA 4BBRJ 4DYCA 3RQIA 3SFIA 1W0TA 4XIDA 4A3FJ 4LOCA 2JN6A 5C44J 1FIPA 1ZGWA 1OFCX 2L0KA 3LNQA 3ZQFA 5IP6A 1U78A 3FK7A 2L7MP 1WI3A 2VI6A 2VUMJ 5IYBJ 1XC5A 1MNMC 2O8KA 3S2DJ 2XB0X 3S1MJ 4BXXJ 2P81A 1VI0A 2DA3A 3BQZA 2X6OA 2NS7A 2G0EA 3PO3J 1RETA 1H89C 2M2EA 1GUUA 1FTZA 2DMNA 2LR8A 2QF7A 4A3GJ 2Y30A 1RESA 3GTLJ 1GV5A 1MH3A 1U9OA 5EZGA 4XRMA 2D5VA 3DCFA 3Q3SA 4A3IJ 4AYBN 2X9DA 3Q0WA 2XB5A 1HF0A 3ZQLA 2DN0A 4BY1J 1MBJA 1ZQ3P 1MSFC 5GPAA 3HM5A 2E1OA 4A3LJ 2HI3A 2ZB9A 3BT9A 1SANA 4XRSA 3BG5A 1ORKA 4IHXA 2CU7A 1JUSA 4Y7NJ 2H1KA 1UHSA 5IP9J 3K7AJ 3A03A 5IYCJ 3H3VK 3LSRA 4M3FA 3JRAA 1PUFA 5HODA 4IEJA 1AKHB 1ETOA 5GPCA 1NTCA 2K9QA 3I4MJ 1X2MA 4W1UA 1ZK8A 5E3MA 2EZLA 2XPUA 5J1UA 3NARA 4B1RA 2TRTA 1K61A 4JYKA 5F08A 3O8GA 4W97A 2H8RA 3D1NI 2VKVA 4RDUA 1ITYA 1IV6A 3G1MA 1E3OC 1T33A 4A3BJ 3TP0A 2JWTA 2LP0A 2DA1A 3O8HA 1TWFJ 1MSEC 3WHBA 3Q0UA 5IP7J 1ENHA 1IUFA 2XPWA 1DU0A 5F04A 3HDDA 3ZQIA 1TWGJ 3RZDJ 1IRZA 1FTTA 3TP3A 1YRNA 1HDPA 3FKIJ 3SDGA 1IG7A 3ZQGA 2XGCA 4EEFG 9ANTA 1H8AC 2NVYJ 2KT0A 1AU7A 3ZOBA 1F36A 4V2FA 1VFCA 3OSGA 1FIAA 2K9NA 1X58A 2COBA 4M3GA 1HLVA 2TCTA 3LSJA 5F0CA 3W6VA 2WV1A 3JRIA 3A01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL0 A;  1JUP A;  2R5Z A;  2EZH A;  2N8G A;  2L9R A;  1WPK A;  2HOS A;  3S14 J;  3I4N J;  4I76 A;  2X48 A;  2DMT A;  3IH3 A;  1GDT A;  2HDD A;  5FKM A;  3HGG A;  4V2G A;  3BR2 A;  5EEA A;  1VND A;  4A69 C;  1T56 A;  2DA2 A;  2M0C A;  5FJ8 J;  3HKZ N;  3HOU J;  4QSH A;  1ZR2 A;  1MH4 A;  3BR5 A;  3Q0V A;  3H0G J;  3BR0 A;  3BTJ A;  1Z77 A;  2LY9 A;  4QIW N;  4I6Z A;  2JA7 J;  1G2H A;  3S1N J;  1XS9 A;  5J3L A;  3BR1 A;  1JKO C;  3S15 J;  1F43 A;  3BTL A;  4BY7 J;  2MGQ A;  2JMW A;  2FD5 A;  3JRG A;  3DEW A;  5M5W J;  5FKN A;  2JA6 J;  2EH3 A;  3PO2 J;  2LLK A;  3RKQ A;  1MBE A;  3BG9 A;  1JKQ C;  2HOT A;  4A3M J;  4UUS B;  1QVT A;  3LSG A;  2LK2 A;  2LVS A;  2MSY A;  2JA5 J;  3S16 J;  2K40 A;  2L7Z A;  3UKG A;  3HB9 A;  2QCO A;  1POG A;  1WH5 A;  5F0F A;  1NK2 P;  2L7F P;  2XRL A;  4G12 A;  3M3Y J;  3VPR A;  2OF7 A;  3G1L A;  2VPR A;  2FX0 A;  3GTK J;  3TW7 A;  2CUE A;  2M8G X;  1BA5 A;  1LFU P;  3IV5 A;  2K9S A;  3IH4 A;  1P7J A;  3G1O A;  2HXO A;  5M5Y J;  1PUF B;  4BKX A;  2M9H A;  1JGG A;  1MBK A;  4D7M A;  1ETY A;  2ID6 A;  1BW5 A;  5F27 A;  2HYJ A;  2M34 A;  4J19 A;  3HBL A;  2MG4 A;  2W48 A;  2YUS A;  3CMY A;  1LE8 A;  2CQX A;  2DJN A;  3BTC A;  4X1E A;  4C3J J;  4MLO A;  1QRY A;  4C3H J;  3JRC A;  1WCM J;  1JJ6 C;  4RBO A;  2B63 J;  1XG1 A;  3OIO A;  2RAE A;  2R7Z J;  1JT6 A;  1VF9 A;  2XPV A;  4CYC B;  3JRE A;  1O4X A;  2YS9 A;  5C4J J;  4C3I J;  4M3B A;  4A93 J;  1HDD C;  2R0Q C;  4C2M J;  2CJJ A;  2E2J J;  2NVQ J;  1D5Y A;  3NAU A;  1IC8 A;  5K7H A;  3MVP A;  4A3J J;  1R9T J;  1ETX A;  1S7E A;  3CQZ J;  5EYR A;  1LE8 B;  1IDY A;  1YRN B;  1P7I A;  1FEX A;  1W0U A;  3OSF A;  2AO9 A;  2YU9 J;  3GTP J;  5IOY A;  4UUT A;  1B8I B;  1AHD P;  2HXI A;  4IHW A;  5J1R A;  5DS9 A;  1BJZ A;  4CYC A;  2DMQ A;  5GP9 A;  3SJM A;  1B72 A;  2XGD A;  1OJL A;  1I3Q J;  1WGX A;  2NVT J;  4D5F A;  2Y2Z A;  4IHY A;  1ETW A;  2IBD A;  3S2H J;  2PMZ N;  2I10 A;  3LOC A;  3JRD A;  1FJL A;  1Z0X A;  1JKR C;  4JP0 A;  1Y1W J;  2XSD C;  3S1R J;  2O7O A;  1ZTR A;  1RPW A;  5EG0 A;  4DYR A;  4HNV A;  2GBY A;  1SFO J;  3GTO J;  1JKP C;  4D7N A;  1JTY A;  5C3E J;  1BW6 A;  3HOY J;  3HOZ J;  3TED A;  4D5C A;  3HOW J;  1ETV A;  4NDL A;  3MKL A;  5EDN A;  1UMQ A;  1I50 J;  2E19 A;  3F0C A;  5JLX A;  3WHC A;  1HCR A;  4L5E A;  3MN2 A;  3GTM J;  3JR9 A;  2ID3 A;  3QQA A;  1ETK A;  3GBG A;  4AC0 A;  1TWH J;  3GTG J;  5EG0 B;  3HOV J;  5E3O A;  5C4X J;  2NS8 A;  5JLW A;  4QTR A;  1U8B A;  1JT0 A;  4M3E A;  1ZKG A;  4FCY A;  1MBG A;  5FLM J;  3RZO J;  2DA4 A;  2DMU A;  2LD5 A;  2AHQ A;  3B6A A;  4M3D A;  5E3N A;  1QPI A;  2R5Y B;  4B3A A;  4A3D J;  2LFB A;  2DA5 A;  4JX4 A;  3QPL A;  3GTQ J;  3A02 A;  1A6I A;  3OOU A;  2JA8 J;  3TW6 A;  2NOG A;  5K7Z A;  3S1Q J;  3M4O J;  3QPS A;  2HOA A;  5DTD A;  4DZJ A;  4XK4 A;  5IOZ A;  3CDL A;  2CUF A;  1MBF A;  1APL C;  4A3C J;  1OCT C;  1A5J A;  5J1Y A;  2VKE A;  2FQ4 A;  1ETQ A;  2DTZ A;  4XRS G;  1UG2 A;  1K83 J;  1OCP A;  4JX5 A;  5F0H A;  1DU6 A;  1QVU A;  1IJW C;  1H88 C;  1GVD A;  1MBH A;  4Y52 J;  3PM1 A;  1TC3 C;  4A3E J;  1WH7 A;  4DZP A;  2EZI A;  1LFB A;  2OPT A;  2R5Y A;  3L1P A;  2R92 J;  4FE7 A;  1JTX A;  3K2A A;  2R93 J;  4DYQ A;  5IYD J;  1TWA J;  5EZH A;  3JRH A;  4GFB A;  2FJ1 A;  4FE4 A;  4A3K J;  3BR6 A;  1TWC J;  2Y31 A;  1GT0 C;  1AKH A;  2Y9Z A;  3HGY A;  5FKK A;  2DA6 A;  2EZK A;  3BQY A;  4FIS A;  5M5X J;  2KDZ A;  3BG3 A;  3ZQH A;  3ZQC A;  2NVX J;  3HOX J;  1I6H J;  1NK3 P;  2WAQ N;  3GTJ J;  3FK6 A;  4MFE A;  5F1J A;  4BBS J;  2E2I J;  4B4C A;  2LKX A;  2E2H J;  4AUX A;  2Y9Y A;  3B6C A;  2DMP A;  4JX6 A;  4MIM A;  1JJ8 C;  5EGO A;  1U9N A;  3S17 J;  2LTP A;  2GM4 A;  1B8I A;  5BNG A;  1X2N A;  1Y1V J;  3HEF A;  3JRF A;  2ELK A;  1Q1V A;  3BR3 A;  5M3F J;  1GV2 A;  2ME0 A;  2EQR A;  3CCY A;  1B72 B;  2DA7 A;  4MO7 A;  1HOM A;  3BTI A;  3FIW A;  3FIS A;  4MFD A;  5EF6 A;  1ZR4 A;  2XGE A;  2Y0S N;  2HQ5 A;  5FKL A;  1RKT A;  4M6V A;  1EF4 A;  4IHV A;  5EGO B;  5M3M J;  2ECB A;  2ME6 A;  2GLO A;  1JUM A;  5FLV A;  2O9L A;  4ABZ A;  4X6A J;  4UUS A;  5FKO A;  2JK3 A;  3E7L A;  5E3L A;  5K7F A;  3A01 B;  1RKW A;  2IEK A;  1IGN A;  2CRG A;  2R5Z B;  4XIC A;  4DW6 A;  2JJ7 A;  2IAI A;  3LSP A;  1IDZ A;  1CQT A;  2MW8 A;  4FTH A;  2ECC A;  3IH2 A;  5IPA A;  1RR7 A;  2WB1 N;  3C2B A;  2CQQ A;  4S0H B;  3JRB A;  2EBI A;  4BBR J;  4DYC A;  3RQI A;  3SFI A;  1W0T A;  4XID A;  4A3F J;  4LOC A;  2JN6 A;  5C44 J;  1FIP A;  1ZGW A;  1OFC X;  2L0K A;  3LNQ A;  3ZQF A;  5IP6 A;  1U78 A;  3FK7 A;  2L7M P;  1WI3 A;  2VI6 A;  2VUM J;  5IYB J;  1XC5 A;  1MNM C;  2O8K A;  3S2D J;  2XB0 X;  3S1M J;  4BXX J;  2P81 A;  1VI0 A;  2DA3 A;  3BQZ A;  2X6O A;  2NS7 A;  2G0E A;  3PO3 J;  1RET A;  1H89 C;  2M2E A;  1GUU A;  1FTZ A;  2DMN A;  2LR8 A;  2QF7 A;  4A3G J;  2Y30 A;  1RES A;  3GTL J;  1GV5 A;  1MH3 A;  1U9O A;  5EZG A;  4XRM A;  2D5V A;  3DCF A;  3Q3S A;  4A3I J;  4AYB N;  2X9D A;  3Q0W A;  2XB5 A;  1HF0 A;  3ZQL A;  2DN0 A;  4BY1 J;  1MBJ A;  1ZQ3 P;  1MSF C;  5GPA A;  3HM5 A;  2E1O A;  4A3L J;  2HI3 A;  2ZB9 A;  3BT9 A;  1SAN A;  4XRS A;  3BG5 A;  1ORK A;  4IHX A;  2CU7 A;  1JUS A;  4Y7N J;  2H1K A;  1UHS A;  5IP9 J;  3K7A J;  3A03 A;  5IYC J;  3H3V K;  3LSR A;  4M3F A;  3JRA A;  1PUF A;  5HOD A;  4IEJ A;  1AKH B;  1ETO A;  5GPC A;  1NTC A;  2K9Q A;  3I4M J;  1X2M A;  4W1U A;  1ZK8 A;  5E3M A;  2EZL A;  2XPU A;  5J1U A;  3NAR A;  4B1R A;  2TRT A;  1K61 A;  4JYK A;  5F08 A;  3O8G A;  4W97 A;  2H8R A;  3D1N I;  2VKV A;  4RDU A;  1ITY A;  1IV6 A;  3G1M A;  1E3O C;  1T33 A;  4A3B J;  3TP0 A;  2JWT A;  2LP0 A;  2DA1 A;  3O8H A;  1TWF J;  1MSE C;  3WHB A;  3Q0U A;  5IP7 J;  1ENH A;  1IUF A;  2XPW A;  1DU0 A;  5F04 A;  3HDD A;  3ZQI A;  1TWG J;  3RZD J;  1IRZ A;  1FTT A;  3TP3 A;  1YRN A;  1HDP A;  3FKI J;  3SDG A;  1IG7 A;  3ZQG A;  2XGC A;  4EEF G;  9ANT A;  1H8A C;  2NVY J;  2KT0 A;  1AU7 A;  3ZOB A;  1F36 A;  4V2F A;  1VFC A;  3OSG A;  1FIA A;  2K9N A;  1X58 A;  2COB A;  4M3G A;  1HLV A;  2TCT A;  3LSJ A;  5F0C A;  3W6V A;  2WV1 A;  3JRI A;  3A01 A; 
#chains in the Genus database with same CATH topology
 1BL0 A;  4PJ0 C;  3DPL C;  1XSV A;  3AKZ A;  2EZH A;  4RB0 A;  1IV8 A;  2JSP A;  4U87 A;  3CTA A;  1U0J A;  2F5C A;  1WPK A;  2CW7 A;  1YIT I;  4UY8 I;  3S14 J;  3I4N J;  1MND A;  1N25 A;  2X48 A;  5JHU A;  4CCN A;  2RV8 A;  3GFJ A;  5LGT A;  1GDT A;  2MC4 A;  1FP1 D;  4RB2 C;  4V2G A;  2FU4 A;  2GWR A;  3BR2 A;  1RNL A;  2BY3 A;  3R4K A;  1T56 A;  2A69 F;  3V7S A;  5HS9 A;  1FSE A;  5FJ8 J;  5FRN A;  2P6S A;  4BEH A;  2BGC A;  3HKZ N;  3W6J B;  2K5C A;  1EH7 A;  3IKT A;  1GLN A;  1IRF A;  1R6R A;  1XSX A;  1FSH A;  3H0G J;  2UUZ A;  1TZL A;  1W36 D;  3AG4 H;  1OCC H;  4QIW N;  5J3L A;  3S15 J;  2Y69 H;  2PJR B;  1J5Y A;  2LY1 A;  1O7F A;  4HYE A;  1TL8 A;  4L18 B;  2FD5 A;  4XOT A;  3VOE A;  2V1N A;  4ZYE A;  2EH3 A;  3PO2 J;  1G4D A;  1F1Z A;  2FSW A;  4BU2 A;  1JKQ C;  2HOT A;  4UUS B;  3H3U A;  3ULQ B;  5L3B A;  2MSY A;  2JA5 J;  1R1V A;  1Y39 A;  2R4G A;  2L7Z A;  2XIG A;  1R5G A;  4DOZ A;  1YX5 A;  3BZ6 A;  1F4K A;  3HB9 A;  3RTR A;  2M5W A;  1R4M B;  5AIQ A;  3GME A;  1IRG A;  4Q4Z F;  4H4K C;  2CO5 A;  4P9F A;  5HDK A;  2K85 A;  1RIO H;  1Z1D A;  1D0Z A;  5EEH A;  2R7F A;  4P9U A;  2VC0 A;  2OF7 A;  2KHM A;  3AG3 H;  2VPR A;  1TW3 A;  3M1E A;  3GTK J;  1P2F A;  2CUE A;  2M8G X;  2Z9O A;  2PG4 A;  4IJA A;  2IT0 A;  2W4S A;  5GTH C;  1WSU A;  2K9S A;  3MZH A;  1P7J A;  3IH4 A;  4EGZ A;  2LMD A;  5LBQ A;  1F5T A;  1RUN A;  4JK1 X;  3Q5F A;  4BKX A;  4IX7 A;  1VQ9 I;  1ZHF A;  2BHY A;  1JGG A;  1HA8 A;  3A1Y A;  1MBK A;  3ECO A;  2LC2 A;  3HHG A;  5HLT A;  2M34 A;  4AIJ A;  1FOY A;  4J19 A;  3HBL A;  1IXR C;  1MDM A;  1ZGJ A;  2FBK A;  2KQR A;  2VKD A;  5D6F A;  3KEY A;  2M4G A;  2COM A;  4BE0 A;  3N05 A;  2DJN A;  3WTS C;  4C3J J;  2UXX A;  4BH9 A;  1QRY A;  3JRC A;  1TQI A;  3Q9S A;  4IKF A;  3CC2 I;  1XG1 A;  2A6T A;  2W24 A;  2BVL A;  2DOE A;  4CYC B;  5C4J J;  5KK1 A;  3E6D A;  2D2W A;  4E7I A;  4JOM A;  1HDD C;  4XQF A;  2BZT A;  1ZH5 A;  2R0Q C;  2EV5 A;  2XF5 A;  2EIM H;  2IW5 A;  4XKV A;  2WBM A;  4A0Y A;  5EYR A;  1LE8 B;  1IDY A;  3F72 A;  1W1W E;  1W0U A;  2DAO A;  3U2R A;  2YU9 J;  5DM7 F;  4P1W A;  3GVA A;  2F2E A;  1VQ5 I;  4YFX F;  4BJ6 C;  4MEX F;  2ZCW A;  4E7K A;  1IN5 A;  4KN7 X;  2EFN A;  5GP9 A;  4FET A;  5ICG A;  1SEU A;  5ERI A;  1ZEL A;  2KLO A;  5L3G A;  5JI6 A;  4J00 A;  3WG9 A;  1Y1W J;  1FWZ A;  3RKY A;  2GA2 A;  4A0X A;  2XSD C;  1X1P A;  2JVH A;  3S1R J;  4E7H A;  2IGK A;  2VKH A;  4QPO A;  4DYR A;  1SFO J;  5B3S H;  2OC6 A;  3GTO J;  2JRM A;  4P96 A;  4LIU A;  2L4A A;  3HOZ J;  4N9H A;  1BW6 A;  1FBU A;  3TED A;  3L2W A;  1DUX C;  3OR1 C;  5LHI A;  4F3Q A;  3CCR I;  3KZY A;  3EUH A;  3CME I;  1UMQ A;  3GEZ A;  2LF7 A;  3E6M A;  5FLX Z;  2E19 A;  4KIF A;  3WHC A;  1YJN I;  1YO5 C;  4M6X A;  3N97 A;  1AWC A;  1KU9 A;  2KMU A;  2OZU A;  2GXB A;  3V7R A;  5TJJ A;  3DF8 A;  3R6S A;  3E0J B;  1HQC A;  1TWH J;  4KT5 C;  1XMK A;  1R49 A;  2L01 A;  3KP3 A;  5E3O A;  1LDJ A;  3HOV J;  4QTR A;  2DK8 A;  1R4N B;  2EV0 A;  2ISY A;  2ZO4 A;  1JT0 A;  3AL0 C;  1TTY A;  2Z2S B;  3P7N A;  1V54 H;  1X1D A;  4XNF A;  4KMF A;  5FLM J;  2OJE D;  4BXF A;  1ODD A;  1FX7 A;  3B6A A;  1ZLJ A;  5J8F A;  3IAS 2;  4KFC A;  3CF5 F;  2R5Y B;  3S3O A;  2VE8 A;  3VEP A;  5BPD A;  1D3Y A;  5KCM A;  2LFB A;  1R71 A;  1A6I A;  3OOU A;  4CYD A;  1GHC A;  1O3S A;  3FBN B;  3VSL A;  3QPS A;  5GAE J;  3QOP A;  2RQQ A;  3S93 A;  3CDL A;  4LG0 B;  1QZY A;  1ZRD A;  4XLP F;  1OCT C;  2FE3 A;  4LK0 F;  2FQ4 A;  5KVR A;  1ETQ A;  4XRS G;  4G7O F;  2Z1D A;  1P6R A;  1DU6 A;  2RDP A;  4E7Z A;  2PJR A;  3I56 I;  1ZG5 A;  1OCR H;  1MBH A;  1VQL I;  2FXA A;  3H36 A;  4Y52 J;  4QPQ A;  1LFB A;  3J81 K;  2M8E A;  2LG4 A;  4LB6 B;  1JTX A;  2R93 J;  2DT5 A;  1WWX A;  3MKZ A;  1TWA J;  3JRH A;  1O3T A;  4GFB A;  1FBS A;  2FJ1 A;  2HKO A;  5H6Q A;  1IRX A;  5L3C A;  1UAA A;  2Y31 A;  1AKH A;  2Y9Z A;  4Y33 A;  2EZK A;  5M5X J;  2KDZ A;  2VB6 A;  4XLE A;  4PCQ A;  1KQ0 A;  3ZN0 A;  2PEX A;  3OS1 A;  4R79 A;  5F1J A;  2E2I J;  4HLY A;  3ZCO A;  2IS2 A;  4G6T B;  3TOA A;  4AUX A;  2Y9Y A;  2H8W A;  3TL4 X;  3BPV A;  3NWS A;  4MIM A;  4O5V A;  4N0B A;  3OR2 C;  2K3F A;  1WJF A;  3TO9 A;  2ZNZ A;  4B48 A;  2P7V B;  1SAX A;  1QO0 D;  1N75 A;  1X2N A;  2A3S A;  1WVR A;  1YG2 A;  2DTR A;  1D0Y A;  2ME0 A;  4AD9 A;  2I5U A;  3L00 A;  2KIF A;  1HOM A;  3CP8 A;  3CUQ A;  3KYD B;  1ZR4 A;  2XGE A;  4G6D A;  4HST A;  3DV8 A;  1RKT A;  2JPB A;  3CJQ B;  1FMW A;  1EF4 A;  2ZSH B;  4IHV A;  5EGO B;  2Z5U A;  3RYP A;  4CIC A;  2O9L A;  4HF2 A;  2MYS A;  4KDP A;  4EGY A;  2JQ7 A;  3A01 B;  2PLY A;  3C2H A;  4OAY A;  4XIC A;  3DTE A;  2FRH A;  1W5T A;  1IO2 A;  3EET A;  3LSP A;  5DD8 A;  3K70 D;  5HLG A;  2L5Q A;  5E1Z B;  3IH2 A;  2EIK H;  4HBL A;  2F4I A;  2D1V A;  4U0V A;  2XAG A;  3SFI A;  5D4S A;  2FML A;  3ZPL A;  4XOR A;  2HTS A;  1OFC X;  2IA2 A;  5DCM A;  1FOK A;  3IL2 A;  2AS5 F;  3ZQF A;  5IP6 A;  1QHG A;  2VQH A;  2MD0 A;  1XN7 A;  1Y8Q B;  4PDK A;  4RM3 A;  4ESF A;  2EIL H;  2MH9 A;  5HNF A;  4M71 A;  5F64 A;  3VOD A;  1XC5 A;  5K1Y A;  4WK8 F;  3S2D J;  2CV0 A;  1YIJ I;  3K4N A;  4HX8 A;  2R7O A;  5JFR A;  2QF7 A;  4A3G J;  3DKY A;  4B43 A;  1MH3 A;  1GXQ A;  2AQE A;  2V6C A;  3DCF A;  4A6E A;  3F6O A;  1XX5 A;  4AYB N;  4CA0 A;  4A3I J;  2ZXJ A;  3GZ5 A;  1PDN C;  1WJC A;  2A6H F;  3WTV C;  3I59 B;  4ON0 A;  2NXN B;  4BQN A;  2V1X A;  3HM5 A;  3CJN A;  1YOV B;  2E1O A;  4A3L J;  2VQL A;  3BT9 A;  2E5Z A;  2RKH A;  3BP8 A;  2EPF A;  1IW7 F;  1TQM A;  2P5V A;  2ZSI B;  1BBY A;  3SQN A;  1FBQ A;  1YX3 A;  4LJZ F;  4UV9 A;  3BDD A;  5IP9 J;  3L2R A;  1FY7 A;  1Z6T A;  5EJC A;  4XKC A;  2IGN A;  3IRR A;  2XGX A;  4DIQ A;  4XSZ F;  1PUF A;  1MJA A;  2IPQ X;  1Y6I A;  4ESB A;  2PI0 A;  1T0F C;  1ETO A;  5GPC A;  1V5F A;  2P0W A;  5H2F C;  4PGH A;  5E3M A;  3PFI A;  2XPU A;  1W7P A;  4NHJ A;  2HPM A;  3H1C A;  3H9Q A;  1Z21 A;  5F08 A;  3TO6 A;  4NBQ A;  1UEL B;  4AU7 A;  1O57 A;  2VKV A;  2HU9 A;  4C30 A;  2QQA A;  1N78 A;  2GAU A;  2IVM A;  3KEO A;  1YE9 A;  3G1M A;  4HF0 A;  4BQQ A;  4LG0 A;  5D6E A;  1E3O C;  2JWT A;  4BJ5 C;  1BI1 A;  1LVK A;  2DA1 A;  2PMU A;  2GIZ A;  2X1C A;  2A61 A;  3IWF A;  3H9G A;  1HW2 A;  5HDG A;  1LEA A;  4UB6 C;  3RPQ A;  2XUB A;  1QZZ A;  3WHB A;  3J81 Z;  2V9K A;  4BL0 B;  3C2G A;  3M1C A;  4KMU X;  5F04 A;  2W84 A;  3ZQI A;  4OIR F;  2O5R A;  3RZD J;  5LLQ A;  1IRZ A;  3I9V 2;  4ANJ A;  1YRN A;  2OCE A;  2XGC A;  4HX7 A;  3V4G A;  2VT2 A;  3I54 A;  5DCF A;  1L3L A;  4ASN A;  3CLO A;  3RQ4 A;  2M4K A;  2BOL A;  1FC3 A;  2KT0 A;  3KPH A;  2CQ7 A;  2DLL A;  3OSG A;  2WY7 Q;  2K9N A;  2DBB A;  2KDO A;  3MWM A;  2TCT A;  2YSR A;  3TOB A;  3W6V A;  2L3D A;  4E7J A;  2E36 A;  1WI9 A;  3J7Y J;  2HS5 A;  4XMY A;  1YI2 I;  1JUP A;  3CDI A;  4CXF A;  3MEX A;  2L9R A;  3OYF A;  4OMZ A;  1JI8 A;  1DPU A;  4XM3 A;  2GA1 A;  3ZRG A;  2ZC2 A;  1U5T C;  3CMM A;  4AYB A;  1LPQ A;  2DMT A;  1QHH D;  2OV7 A;  2V1D A;  3CUQ C;  3QAH A;  4ENK A;  1VQN I;  4ZDO A;  1ZLK A;  4G94 A;  4F93 B;  3DWL E;  1S29 A;  2DQL A;  1YFH A;  3BJA A;  4WXC A;  1VND A;  3RCO A;  3JAM Z;  1B59 A;  4OAZ A;  2V79 A;  2M0C A;  4Y3O A;  2R7W A;  2E34 A;  2G7U A;  2XRO A;  1U6G A;  1I39 A;  3LQR A;  1OIS A;  2VBX A;  3Q0V A;  1SAU A;  2BEO A;  3ONQ A;  5BPI A;  3CUQ B;  2HWV A;  1GVJ A;  3BR0 A;  2OA4 A;  3BTJ A;  1U5T B;  2JA7 J;  5TIS C;  2CMP A;  2QSG X;  3BR1 A;  1JKO C;  3K2Z A;  1K78 B;  4BY7 J;  3CF2 A;  3JRG A;  3DEW A;  2IS1 A;  2A6E F;  5FGM A;  2JA6 J;  2LLK A;  3RKQ A;  1MBE A;  1XGN A;  5CYV A;  3D0S A;  5GAD J;  4ZJZ A;  3LSG A;  3RIR A;  4IRH A;  4BE2 A;  3M8F A;  2L02 A;  2AXL A;  1HW1 A;  2QCO A;  4XN3 A;  3I0T A;  1WH5 A;  3HRU A;  3P9C A;  4UVC A;  1XSD A;  3V8K A;  1HKQ A;  4Q48 A;  1TW2 A;  1NK2 P;  4MQ9 F;  1T2K A;  5H6R A;  4U0W A;  2GOX B;  2XRL A;  4KIS A;  3C1D A;  4Y15 A;  1RRJ A;  4EQQ A;  2LKP A;  2JUC A;  1VQ4 I;  2R7R A;  3WTX C;  4BQA A;  3TW7 A;  1BA5 A;  2KRC A;  4FX0 A;  4J01 A;  3PNV A;  2V9V A;  3K4L A;  2NRA C;  3K4M A;  1MNE A;  4HSR A;  3QYF A;  2XF6 A;  1PUF B;  2VBW A;  2EFQ A;  3ASO H;  3OL4 A;  3FXR A;  2OBP A;  4IRI A;  4D9J A;  1BW5 A;  5BS6 A;  2M0M A;  3BWG A;  4HLX A;  3CMY A;  3WG7 H;  4Z6Y A;  2IXS A;  2VBY A;  4X1E A;  2EK5 A;  3BJO A;  3G71 I;  2ZFW A;  1WCM J;  1WRJ A;  2QQ8 A;  3H92 A;  3RPU A;  4RS8 A;  2B63 J;  3CCM I;  5GAH J;  1G8X A;  3COA C;  4YEL A;  2R7Z J;  5IT3 A;  3KET A;  3JRE A;  2MD5 A;  4AM3 A;  1R1U A;  1HC8 A;  3JSP A;  4D0P A;  1G3W A;  2NVQ J;  1IC8 A;  4WF2 A;  3MVP A;  3LL7 A;  4DBR A;  2X1D A;  2GOM A;  1X19 A;  2AXT C;  3CQZ J;  1LVA A;  1P7I A;  4KA4 A;  2A68 F;  2E7X A;  1FEX A;  3P9K A;  2AQF A;  3OSF A;  2AO9 A;  4FX4 A;  3BY6 A;  5IOY A;  2R7U A;  2R7Q A;  4IL6 C;  4UUT A;  2R7T A;  2OD5 A;  4HQE A;  1SC7 A;  1BJZ A;  2CUJ A;  4CYC A;  2DMQ A;  2PMH A;  1A36 A;  3HSR A;  3LA2 A;  3SJM A;  1B72 A;  3K0L A;  3DP7 A;  1I3Q J;  1VQP I;  4I02 A;  2IBD A;  4II3 A;  4IHY A;  1I6X A;  3PUF A;  3SXY A;  3LOC A;  4CZZ A;  3JRD A;  1D1C A;  5LEK A;  4XSX F;  1JHF A;  1Z0X A;  3TBI A;  3QP6 A;  3WGH A;  1REP C;  2W82 A;  1HSJ A;  3W2W A;  3HOT A;  1RR8 C;  1JKR C;  2A07 F;  3O6B B;  2VLA A;  1V5G A;  5CKT A;  4L9N A;  4BAY A;  1ZG1 A;  2K86 A;  3QYE A;  1ZTR A;  5EG0 A;  5J4V A;  1JHH A;  2HGC A;  2K9M A;  4BHC A;  3OMY A;  2FNP A;  1JKP C;  2W25 A;  1NH3 A;  1USS A;  3HOY J;  5K5O A;  3HC7 A;  3VYU B;  1YS7 A;  4ITV A;  2NVU B;  4D5C A;  2R7S A;  4NDL A;  2E1M B;  2P7C B;  1U5T A;  2QSF X;  3CMA I;  1I50 J;  5JLX A;  3F0C A;  2A5W A;  2Q1Z B;  3OS2 A;  4MQV A;  2MC3 A;  1T08 B;  5ILV A;  4RLQ A;  1HBX G;  4ZYG A;  1Z05 A;  4UHT A;  2FMY A;  2FOK A;  4GCV A;  4AIH A;  4F92 B;  5F1R A;  2XAJ A;  5JHF A;  5DM6 F;  4ENJ A;  2KIS A;  3PNY A;  2XKO A;  4BXU A;  5JLW A;  2XAH A;  3FBI B;  3QPT A;  2IJL A;  4F52 A;  1H9T A;  4M3E A;  1FLI A;  1QGP A;  4HEA 2;  2CW8 A;  1TT0 A;  1MBG A;  1O3R A;  3LST A;  3EUK L;  2M7B A;  3M7G A;  1DQU A;  4U0Y A;  2LD5 A;  2AHQ A;  3HSF A;  1S8N A;  1DDN A;  4WXD A;  2DXI A;  3VYR B;  4M3D A;  2R7D A;  2IGO A;  4EM0 B;  1W5C C;  1NG6 A;  3CCV I;  5E3N A;  5E8G A;  1QPI A;  1OYY A;  2Y75 A;  3F23 A;  3BPX A;  4XLN F;  2DA5 A;  2HYF A;  4JX4 A;  4NC8 A;  4MGR A;  2VPL A;  3GTQ J;  3A02 A;  3OL3 A;  2QWW A;  3TW6 A;  4CZC A;  3S1Q J;  2HOA A;  3PNT A;  2XSJ C;  5IOZ A;  5A2Q K;  2CUF A;  2VJ4 A;  3OWT A;  4HNT A;  1NG7 A;  1APL C;  4P5O A;  4ZYA A;  5J1Y A;  2VKE A;  1BC7 C;  4ETS A;  2DTZ A;  4U88 A;  3H35 A;  1UG2 A;  1K83 J;  5FO5 A;  1YW8 A;  5F0H A;  4ESJ A;  2K02 A;  3CCQ I;  2V7F A;  2RGV A;  1H88 C;  5ICC A;  1E2X A;  1TC3 C;  3HTU A;  4A3E J;  2L4M A;  1N77 A;  2EZI A;  2YR2 A;  3CJR B;  2X4H A;  1K7A A;  5KNL A;  5HDN A;  3K2A A;  1SMT A;  3FHZ A;  4GYG A;  3VYT B;  4DYQ A;  5EZH A;  3A2K A;  1L0O C;  1LEB A;  4N4O B;  2QKL B;  3W2V A;  2Q2E B;  2F5E A;  3OIP A;  3BR6 A;  5H20 A;  2IP2 A;  3PIO F;  2LH9 A;  2XHK A;  1LFP A;  2I8D A;  4FIS A;  1IAW A;  3BG3 A;  3LA7 A;  2NVX J;  1NK3 P;  2WAQ N;  3FK6 A;  4MFE A;  3ABK H;  4BBS J;  4MTD A;  5LD2 C;  2LKX A;  2B9S A;  3B6C A;  2DMP A;  3MMY B;  4JX6 A;  2GXG A;  2XAQ A;  1JJ8 C;  4BQO A;  2DFF A;  2EV6 A;  1U9N A;  4RB1 A;  1KYZ A;  3HRM A;  3S17 J;  3F21 A;  4PK4 A;  4PUS A;  2LTP A;  4HG2 A;  2GM4 A;  1F9N A;  3HUG B;  1Y1V J;  3PIP F;  1VQ7 I;  2OTJ I;  1T6S A;  1J75 A;  5M3F J;  1Q1V A;  3A4C A;  3BG6 A;  1DGR M;  1QNT A;  2HKX A;  3CCY A;  2EQR A;  2BW3 B;  4L9T A;  1ZG3 A;  1TNS A;  2LDU A;  3FIW A;  4MFD A;  5EF6 A;  1KU7 A;  1J9I A;  5FKL A;  1CGP A;  1W36 C;  1G3T A;  2DPD A;  4GRI A;  1SD5 A;  1R22 A;  2HTJ A;  4OWR B;  1MJ9 A;  3V8J A;  1E3P A;  1DPR A;  3OOP A;  2ZXW H;  2W00 A;  2ECB A;  2ME6 A;  1K6Y A;  1JUM A;  5FLV A;  1T95 A;  4UUS A;  1XD7 A;  2CRG A;  5CVV A;  2J5P A;  2QEX I;  1G59 A;  4BDY A;  2KZV A;  3OYK A;  4CGZ A;  3RI4 A;  2M1B A;  1IDZ A;  2JSC A;  4UUV A;  3A0B C;  1ONV A;  2ECC A;  2ADU A;  3MZY A;  3EPZ A;  2WB1 N;  3RKW A;  2CQQ A;  4S05 A;  4ZZL A;  4DQ2 A;  4DYC A;  3RQI A;  3S8P A;  4XID A;  4LOC A;  1B4A A;  2JN6 A;  4CCJ A;  1FIP A;  3IHU A;  4UB8 C;  3QP5 A;  1R1T A;  2C6Y A;  3DTI A;  4XLA A;  4ZYH A;  3SFZ A;  2L0K A;  2LKS A;  5ICF A;  2B7E A;  2QM3 A;  1ACI A;  1XCB A;  3K4B A;  2D1H A;  4IHS A;  4GYI A;  2EFP A;  2CW0 F;  2WY8 Q;  2BXY A;  3GCM A;  1VQM I;  1XPX A;  1VQK I;  1MMN A;  1WI3 A;  3P5J A;  2VI6 A;  4IOC F;  1ZYR F;  1U3E M;  2XB0 X;  2KRH A;  3J80 K;  3V8L A;  3S1M J;  4PGG A;  1I5Z A;  4BXX J;  2NS7 A;  3KP6 A;  1MDM B;  1S5L C;  3EUH C;  5AON A;  1RET A;  3J80 Z;  1D0X A;  2LR8 A;  3FZV A;  4YRV A;  2Y30 A;  1VQO I;  1YJ9 I;  2DK5 A;  1SD7 A;  2KIQ A;  2XC7 A;  3E97 A;  1YIO A;  1U9O A;  2K4J A;  5EZG A;  2P5K A;  4AID A;  4XRM A;  3Q3S A;  4KNY A;  3MKW B;  4RAG A;  4ZZD A;  4BGD A;  1WJA A;  3ECH A;  1T8I A;  2Y48 A;  3G3Z A;  2CV2 A;  3HHH A;  1BR1 A;  4E70 A;  4ZYD A;  2KIM A;  4OIO F;  1T38 A;  2IRF G;  3BG5 A;  3BRO A;  3EDP A;  4RMN A;  1P9Q C;  2H1K A;  3KIO A;  1IN6 A;  3BLY A;  3A03 A;  1UHM A;  3K4J A;  4UVB A;  3H3V K;  2NYX A;  3KCC A;  3SZP A;  1I27 A;  4HRI A;  4EJO A;  1SVM A;  3NWT A;  1NTC A;  3WTZ A;  3KEQ A;  2LRE A;  3M07 A;  3MZ8 A;  4B1R A;  3GFL A;  1RZ4 A;  4JYK A;  3CO7 C;  3U9G A;  3T1B A;  2LSO A;  4HV6 A;  4LD5 A;  4TV7 A;  4DGW B;  2H8R A;  4BHP A;  4OIP F;  4CH7 A;  4ZTF A;  2GXA A;  4ZH4 F;  3C18 A;  5DDG A;  2J5O A;  2VXD A;  2FEZ A;  1T33 A;  4I01 A;  3TP0 A;  3WTY C;  1D1A A;  2QEN A;  3SYT A;  2VN2 A;  1YHQ I;  2Z3Y A;  3KYL A;  3CCU I;  5HS8 A;  2KRF A;  1ENH A;  3SDB A;  3DKX A;  1IUF A;  2HVR A;  4F55 A;  1TWG J;  3TKY A;  5TRD A;  1A35 A;  1W7P B;  2OU2 A;  3HRT A;  1Z67 A;  4JBA A;  3SDG A;  1XTA A;  1IG7 A;  2O3F A;  3ZQG A;  4L9J A;  3LSK A;  4EEF G;  2M87 A;  4YII A;  5J4Y A;  1AU7 A;  3SEQ A;  3ZOB A;  4A5N A;  1VQ6 I;  1FPQ A;  2IS6 A;  1VFC A;  2H09 A;  3K6G A;  3LFK A;  5D8K B;  3FMR A;  2ZNY A;  2P8T A;  1HLV A;  1KGS A;  4I99 C;  4XBF A;  2ZBK A;  2ZJ2 A;  1EH8 A;  2P5L C;  4KIG A;  4BNC A;  2KJB A;  2R5Z A;  2RNJ A;  2BY2 A;  4JQF A;  2HOS A;  1B9N A;  4I76 A;  1MD0 A;  2VQG A;  4I0B A;  1UCR A;  2OQR A;  3I55 I;  4HDU A;  3ERM A;  1X4O A;  1OCO H;  3HGG A;  4RGU A;  4KJZ A;  1FOW A;  1LB2 A;  4K2E A;  4A69 C;  1KA8 A;  2CV1 A;  1BI2 A;  2GIV A;  3HOU J;  3PQK A;  4QSH A;  3CC4 I;  5LRR A;  1ZR2 A;  2VBZ A;  1XDS A;  4A6D A;  3F8F A;  5CPR B;  3WU1 B;  3BR5 A;  5E18 F;  4UV8 A;  2X85 A;  5E17 F;  1TBX A;  1Z77 A;  2LY9 A;  1G2H A;  1XS9 A;  1I3A A;  4EV0 A;  1F43 A;  4PJL A;  1IXS B;  3FM3 A;  3QWL A;  4DBQ A;  2MGQ A;  3DLA A;  3U1K A;  5FD6 A;  2KL4 A;  3SHF A;  2KIU A;  5DYM A;  2LNB A;  2DFE A;  4BHB A;  4L5J A;  3EUA A;  5CJ9 A;  3BCA A;  1FOX A;  2LK2 A;  4AVP A;  1HST A;  2LVS A;  1IN7 A;  1O3Q A;  2K40 A;  4XR6 A;  3K69 A;  3L2C A;  4UNO A;  1POG A;  4HV5 A;  3R0J A;  4XRF A;  5F0F A;  5DD4 A;  3T5X A;  1BN5 A;  3D5S C;  3CC7 I;  2TDX A;  2QBY A;  3AL0 B;  1ZN2 A;  4EM2 A;  1Z9C A;  1MW7 A;  5FLX K;  4G12 A;  1Y8R B;  3LFU A;  4LLG F;  2DOD A;  3VPR A;  1ZRE A;  3ZR8 X;  2LOO A;  2FX0 A;  4BJT A;  3FXJ A;  4IF4 A;  3U1D A;  4IO9 F;  4HA8 A;  1IN8 A;  4OIN F;  2CYY A;  1X4P A;  4B8X A;  1LFU P;  1ZAO A;  1MMA A;  5HLI A;  3E1S A;  5E1X A;  2VC1 A;  3JAM K;  3G1O A;  2HXO A;  5LFA A;  2L7K A;  2KJC A;  3I64 A;  2ESH A;  5BOX A;  2M9H A;  5JVT A;  4D7M A;  1ETY A;  2ID6 A;  2HDC A;  5F27 A;  1FYM A;  3F8N A;  2YUS A;  1S7O A;  3F8C A;  1DP7 P;  1QZE A;  3N4M A;  1IZ1 A;  3OYB A;  2D45 A;  3C7J A;  4C3H J;  4CCK A;  2X6W A;  1U2W A;  1P4X A;  1XGO A;  4RBO A;  3OIO A;  3AG2 H;  2WAF A;  2VOO A;  4IOA F;  1I1G A;  1DGW Y;  2ZXH A;  3LAJ A;  3ASN H;  1QA6 A;  3W3C A;  3R0A A;  2G9W A;  4M3B A;  4A93 J;  3PJR A;  1JE8 A;  2ZFU A;  1UG0 A;  4HQM A;  4C2M J;  2CJJ A;  1G6N A;  3GFI A;  2E2J J;  1BIA A;  3EYI A;  3M8E A;  3GFM A;  3UNG C;  5K7H A;  1V4R A;  1OPC A;  3HSE A;  1R9T J;  1WJE A;  3DBH B;  1S7E A;  2H1L A;  2EIN H;  1WHU A;  3OYM A;  4RGR A;  4EJV A;  3WTT C;  2UZK A;  3ZMV A;  2HXI A;  3F6V A;  1OKR A;  5DS9 A;  1TP4 A;  2HDW A;  2M45 A;  1DP3 A;  4PFO A;  1WJD A;  1Y0N A;  1A31 A;  3JW4 A;  1R7J A;  2XGD A;  2VOP A;  5B1B H;  4HPQ A;  3HL2 A;  4EJW A;  2NVT J;  4D5F A;  2Y2Z A;  3OYJ A;  3KLO A;  3S2H J;  2I10 A;  1W7P D;  4YIR X;  3QOD A;  1FJL A;  3B73 A;  5CQE A;  4GGG A;  1IUY A;  1UB9 A;  2PN6 A;  4E7L A;  2E71 A;  1TLH B;  4QLC U;  3OYI A;  3QRF F;  3KYC B;  3E6B A;  2EB7 A;  3G2B A;  3H5N A;  4CCM A;  3ISP A;  4EM1 A;  2NNY A;  2L9N A;  3L2Q A;  3ABM H;  3AAF A;  2GBY A;  1SMY F;  2IA1 A;  4M73 A;  3I59 A;  3ESW B;  4D7N A;  5E20 A;  3SZG A;  3OY9 A;  4BE1 A;  3RYR A;  1S72 I;  5D5W B;  1YW9 A;  2JVG A;  2NAZ A;  1ETV A;  1CF7 A;  3K10 A;  2QZ8 A;  3ELK A;  5EDN A;  2LY2 A;  1OLT A;  4RAZ A;  2VON A;  4E4H A;  3MN2 A;  3AG1 H;  3QQA A;  4CCL A;  1JGS A;  5J8C A;  1XCV A;  4F7Z A;  1QBJ A;  3DXJ F;  4M9Z A;  2UXN A;  1X3W B;  4CCO A;  3GTG J;  5EG0 B;  4PJM A;  4EJU A;  2V1U A;  1QPM A;  2F5V A;  3G73 A;  1U8B A;  4YFK F;  2HPI A;  5CLS A;  1ZKG A;  4C2U A;  1BR2 A;  4LLL A;  1XMX A;  4XN0 A;  2DA4 A;  1T98 A;  1FP2 A;  1O7L A;  5L3E A;  5LGN A;  1LJ9 A;  3H5R A;  3I53 A;  4BUP A;  3TO7 A;  3FXL A;  3BZK A;  2HZD A;  3LMM A;  3QPL A;  4Z2Y A;  2ZJQ F;  2DT6 A;  1MKM A;  2MA3 A;  1YJW I;  3IUO A;  2O61 A;  2DYS H;  4XK4 A;  4BEH B;  3AFH A;  3BG7 A;  3HG9 A;  3L9F A;  3I58 A;  1ERD A;  4CO8 A;  1FT9 A;  5GTI C;  1MBF A;  5FD5 A;  3WTU C;  2DQR A;  2BY1 A;  2F48 A;  1Z3Y A;  2BBY A;  2CFX A;  2VQC A;  3GO5 A;  1OCP A;  4JX5 A;  3H0D A;  2KPM A;  3O2P E;  4IQJ A;  4OU0 A;  1K79 A;  4NNJ A;  2E35 A;  2Y0S A;  1GVD A;  3TQN A;  2YPR A;  3PM1 A;  4NUB A;  4DZP A;  2BY0 A;  5JR3 A;  3HJE A;  2X51 A;  6PAX A;  2OPT A;  2EA4 A;  2R92 J;  3V7C A;  5IYD J;  2Z99 A;  4XOP A;  3HPH A;  4MHG A;  4A3K J;  1TWC J;  2FBI A;  1ZAR A;  4KIB A;  1GT0 C;  2CSO A;  3DPT A;  3NEU A;  4HOB A;  4ZDP A;  3MFK A;  3TDZ C;  3MCZ A;  5CVJ A;  2L9S A;  1YLF A;  4ZDL A;  1J09 A;  2QBY B;  2XF7 A;  1YTY A;  3K1N A;  2PJP A;  2M30 A;  1MMD A;  4B4C A;  1RUO A;  2QYO A;  1KQ9 A;  5CVI A;  1EH6 A;  3K9T A;  2BVM A;  3MQ0 A;  2CWE A;  4I7H A;  3TGN A;  2EA2 A;  5TGT A;  3OYN A;  5D5X B;  2PFB A;  3E5U A;  1KON A;  5BMZ A;  3I3L A;  1ON1 A;  2H6B A;  4YFN F;  4YG2 F;  2ELK A;  3BR3 A;  4HW0 A;  1GV2 A;  2CS3 A;  2B0L A;  3DBL B;  1V55 H;  1XGS A;  1HW5 A;  1S6L A;  2FA5 A;  4HAM A;  4MNU A;  2DA7 A;  4OOI A;  4MO7 A;  3FIS A;  3C3W A;  1D1B A;  2Y0S N;  1J59 A;  3TMO A;  2W1O A;  2RVC A;  2QQ9 A;  4DJA A;  3P9I A;  2E1N A;  3L09 A;  2DW4 A;  2PX9 A;  5M3M J;  3FHN A;  4RLF A;  1YW7 A;  2GLO A;  2QUF A;  5BQT A;  4I2O A;  4ABZ A;  5IT9 Z;  5E3L A;  5K7F A;  3IC7 A;  3HPG A;  1IGN A;  1WFX A;  5HS7 A;  3J7A Y;  2IAI A;  1EV7 A;  1JXS A;  3HTS B;  4U7B A;  4FTH A;  5LGU A;  4GXO A;  4KUM A;  3C2B A;  2HOE A;  2XRN A;  1ZRC A;  3JRB A;  4LK1 F;  1YYV A;  3KZZ A;  4IHT A;  5C44 J;  1J0R A;  2F5D A;  2OCC H;  3WOD F;  4H0E A;  3ZMT A;  3W2A A;  3IKV A;  3LNQ A;  3PSF A;  1BI3 A;  2WWY A;  5D8L B;  2HFH A;  1Z3X A;  2FUG 2;  2LYC A;  2QVO A;  2K3P A;  3T8T A;  2BHZ A;  4ZTJ A;  3KP4 A;  4LFU A;  4IVN A;  3FDY A;  1ULY A;  1MNM C;  5B1A H;  1ZRF A;  3BC8 A;  3HIF A;  2DA3 A;  3L2U A;  2W7N A;  2QGU A;  3CES A;  3K4C A;  3PO3 J;  1H89 C;  2BE5 F;  2M2E A;  1GUU A;  2XV4 S;  1FTZ A;  2BXZ A;  1RES A;  1GV5 A;  3QU3 A;  5ED4 A;  4AWX B;  2E7W A;  1HXD A;  3REO A;  2X9D A;  3Q0W A;  2WC2 A;  2XB5 A;  3ZQL A;  2DN0 A;  3BZC A;  3GWZ A;  3ZP5 A;  4BY1 J;  1TT5 B;  1D8J A;  2HI3 A;  2KP6 A;  3I71 A;  3FWE A;  5LRS A;  1I1S A;  2X6X A;  2RC4 A;  2YU3 A;  4WX9 A;  3Q9V A;  4RB3 C;  1ORK A;  3K4K A;  2CU7 A;  1E0E A;  1JUS A;  2QKM B;  2DO7 A;  5IYC J;  4A12 A;  2HQA A;  3JSO A;  1BR4 A;  1BIB A;  5HOD A;  4IEJ A;  1AKH B;  3LSH A;  3ZMU A;  2E1C A;  3RDI A;  3I4M J;  2MLG A;  3OIQ A;  4W1U A;  1ZK8 A;  1S3J A;  3EYY A;  2EZL A;  4ENM A;  3BCB A;  3NAR A;  2KKO A;  2TRT A;  1K61 A;  3KE2 A;  4I0A A;  3E3V A;  3O8G A;  4LIT A;  2MBF A;  4WXH A;  1SFE A;  1J7K A;  2CQN A;  1M1E B;  3IP4 B;  2VAS A;  1IV6 A;  2Q0O A;  4LB5 A;  2EFO A;  2OZ6 A;  4A3B J;  2O03 A;  3WU0 A;  1LDD A;  3DEE A;  3HOS A;  2GQQ A;  4M74 A;  1MSE C;  3M8J A;  2H27 A;  4LLN A;  5IP7 J;  1H0M A;  5J6X A;  1LNW A;  1UST A;  1B6A A;  1DU0 A;  3VYS B;  1X3U A;  4E7S A;  3IAM 2;  1G3S A;  4NC7 A;  2E60 A;  1UZC A;  1FTT A;  2V6E A;  3TDU C;  1STZ A;  1IF1 A;  3FKI J;  3VFZ A;  4RAF A;  2ZXI A;  3E6C C;  1H8A C;  4KIT B;  3PUB A;  2O6G E;  2JRT A;  3FM5 A;  2VJ5 A;  4V2F A;  3V42 A;  3FX3 A;  1D8K A;  1IXC A;  1E17 A;  1X58 A;  4M3G A;  3FXU A;  3U21 A;  3B02 A;  2WAQ A;  4YIF A;  2WV1 A;  5IY5 H;  3A01 A;  3S1N J;  2M3A A;  5D5V B;  4G9Y A;  5HOO A;  2QSH X;  1LUJ B;  2JTV A;  3FF5 A;  5LHG A;  1KZH A;  2N8G A;  1ON2 A;  4KT6 A;  2DOA A;  1R58 A;  3MD2 A;  4U7D A;  2VL8 A;  2ZME A;  2OTL I;  3H5A A;  4FQG A;  3IH3 A;  3FMQ A;  1S9H A;  1SD4 A;  2HDD A;  1OYI A;  1P92 A;  5FKM A;  2WB1 A;  1PYV A;  3O3K A;  3SZT A;  5EEA A;  4RAY A;  1ZGA A;  1Y56 A;  3DU6 A;  4KIC A;  2XKP A;  1R23 A;  2Z16 A;  2DA2 A;  4CHU A;  2BV6 A;  3QYB A;  5AIP A;  3FXQ A;  2DYR H;  4UXN A;  1WQ2 A;  4YEJ A;  2F5F A;  4XKB A;  1MMS A;  3CLQ A;  1MH4 A;  1OCZ H;  1Z91 A;  3CCS I;  1EKE A;  5KHD A;  5FRM A;  4N9I A;  4AIK A;  1S7A A;  2FOW A;  1SVO A;  4I6Z A;  5A2Q Z;  3MAJ A;  4XKW A;  3BTL A;  5D4R A;  2JMW A;  5M5W J;  5FKN A;  4NQW B;  2G7H A;  3BG9 A;  3DU5 A;  1MZB A;  1UFM A;  4A3M J;  3CD6 I;  1Z6R A;  1OQY A;  1QVT A;  3F8M A;  5FFX A;  1PUE E;  3ML6 A;  3IWZ A;  3S16 J;  1XB4 A;  2EJR A;  4S04 A;  3UKG A;  2X1E A;  5CQG A;  5ILU A;  1Q1H A;  2LRD A;  2Q8K A;  3BJ6 A;  3S2W A;  2DU9 A;  1R00 A;  1V5E A;  2ZJP F;  5DEQ A;  3FXO A;  2HZT A;  4RA2 A;  2CUZ A;  2L7F P;  3M3Y J;  4RGS A;  5KAI C;  2WAE A;  2BYV E;  3G1L A;  5JVG F;  2EIJ H;  5LEJ A;  3RKX A;  2V9P A;  3HYI A;  2PQ8 A;  2RNG A;  4B44 A;  3IV5 A;  2ISZ A;  3F3X A;  3GZN B;  4E6K G;  2KZG A;  3CP2 A;  3W6K B;  5M5Y J;  1LDK B;  2ZKZ A;  3KX2 A;  3IRQ A;  3LSM A;  2DCE A;  2F6C A;  2HYJ A;  2K7L A;  2MAB A;  4I98 B;  4M72 A;  2NS0 A;  3CCJ I;  2MG4 A;  2W48 A;  3SEZ A;  4FT8 A;  2DFI A;  1LE8 A;  5CVU A;  1SFX A;  2CQX A;  3BTC A;  4MLO A;  2ACJ A;  2IA0 A;  2NNN A;  2XVC A;  3CZ6 A;  1JJ6 C;  2VJJ A;  2Z33 A;  3RJP A;  1XGM A;  2RAE A;  2R3S A;  3OYE A;  1JT6 A;  1VF9 A;  4PSX A;  2XPV A;  1Z7U A;  1W4M A;  2MLK A;  2XAU A;  2K27 A;  3DKW A;  2ZJR F;  1O4X A;  2DDB A;  2YS9 A;  1EJ9 A;  4C3I J;  3WE2 A;  5DUI A;  1Z7L A;  3CO6 C;  1WZ2 A;  3CJT B;  1J2X A;  2UV1 A;  2OQG A;  3E5Q A;  3NAU A;  2EWN A;  3CDH A;  4Y4R A;  1D5Y A;  4GDF A;  3ROU A;  5E79 C;  4A3J J;  1KU3 A;  1EA3 A;  2MFZ A;  1ETX A;  2VIX A;  2O8X A;  1H9G A;  4NQW A;  3DFG A;  1YRN B;  1BOB A;  2VXZ A;  4WCG A;  3GTP J;  4C2T A;  1SFU A;  3OYG A;  1B8I B;  5FFZ A;  1B9M A;  4XLH A;  5EEG A;  1AHD P;  4Q5S F;  4IHW A;  1B1B A;  1XDU A;  5J1R A;  2V4J C;  3K1P A;  3OV8 A;  5L3F A;  1A04 A;  3WGI A;  3GLX A;  2BW3 A;  1OJL A;  4ZC3 A;  2WAD A;  4IRG A;  1IN4 A;  1WGX A;  3GYH X;  1CF7 B;  3JTH A;  1ETW A;  3WE3 A;  2RQP A;  2PMZ N;  2DT7 B;  4IZZ A;  3I4P A;  3DEU A;  4JP0 A;  1VQ8 I;  1KQ8 A;  2H6C A;  5DV5 A;  3RSN A;  2O7O A;  1WJ5 A;  3F9K A;  1RPW A;  1MMG A;  3KP7 A;  3BOQ A;  3PQJ A;  4HNV A;  5LHH A;  2DOF A;  4A5M A;  1MJB A;  4XON A;  3ZQQ A;  4L5I A;  3D5L A;  3GF2 A;  4R1H A;  1JTY A;  5C3E J;  1OR7 A;  1OR7 C;  1AA7 A;  2W57 A;  2DI3 A;  3CCE I;  3GXO A;  3HOW J;  2KFD A;  4Y13 A;  1QU3 A;  1C0W A;  2DFH A;  3WTW C;  3MKL A;  3DLL F;  3X2Q H;  3ABU A;  1P4W A;  1K4T A;  4O6J A;  1HCR A;  1BOA A;  4L5E A;  3GTM J;  4M6Y A;  1PP8 F;  2HQN A;  5HVQ C;  3JR9 A;  1OMI A;  2ID3 A;  5B5E C;  2V26 A;  3RPU D;  2JA2 A;  2JZY A;  3T0Y A;  1QQI A;  1ETK A;  1RC9 A;  3WGG A;  3GBG A;  3J7Z I;  4AC0 A;  4L0Y B;  1FMV A;  5C4X J;  5L3D A;  2NS8 A;  4RGX A;  1R5I D;  4V19 K;  3ERE D;  4FCY A;  3M9A A;  2X6Y A;  3RZO J;  2DMU A;  2ZME B;  5GAG J;  5B66 C;  3CCL I;  2W85 A;  1PVE A;  2ICW G;  5HLH A;  3DTK A;  4B3A A;  4A3D J;  3NRV A;  2OAZ A;  2FBH A;  5D5U B;  2R7X A;  2JA8 J;  2LBF B;  1FYL A;  1MIJ A;  3M4O J;  2NOG A;  5K7Z A;  5DTD A;  4DZJ A;  3ZGK A;  2XDV A;  4A3C J;  2CFO A;  3PL8 A;  2PBI A;  5HNH A;  1A5J A;  1LKX A;  2R7V A;  3WU2 C;  2NOJ B;  4CUG A;  4BAC A;  3K1M A;  1K78 A;  3A0H C;  1QVU A;  3H9J A;  1IJW C;  4R8H A;  4A0Z A;  1WH7 A;  3JTG A;  2QLZ A;  2L9V A;  3L1P A;  2R5Y A;  4I09 A;  4FE7 A;  2A05 A;  4PJN A;  2IGM A;  2RRE A;  4LGW A;  2OUM A;  4LMY A;  3JCU C;  1X1B A;  4FE4 A;  5DUK A;  3PFY A;  4NC6 A;  1FYK A;  2ZME C;  3D5R C;  3GUD A;  3EQL F;  3HGY A;  5FKK A;  1TNT A;  1FNN A;  2DA6 A;  1R5H A;  3BQY A;  1YS6 A;  1G3Y A;  1WKM A;  1K6O A;  3KP2 A;  3ZQH A;  3ZQC A;  2F4O B;  3HOX J;  1I6H J;  2QQB A;  4BDZ A;  3R61 A;  4BS9 A;  3GTJ J;  4P55 A;  1MGT A;  3FXK A;  3H3Z A;  3QPH A;  3LSI A;  2E2H J;  2K9L A;  3GX4 X;  3NQO A;  5CVR A;  1BM9 A;  4HDV A;  2STW A;  5EGO A;  4HZF A;  2F4M B;  4IXA A;  2CQK A;  3ZXS A;  2IS4 A;  1P4A A;  3L7W A;  1B8I A;  5BNG A;  4RM2 A;  3HEF A;  2CGP A;  3GZ6 A;  1X1A A;  3JRF A;  3UR3 C;  2K4B A;  2ELH A;  4XL9 A;  1BJA A;  2HYG D;  3J7A O;  3GW2 A;  4FAS D;  1B72 B;  2XAF A;  2P4W A;  2WV0 A;  3I5U A;  4KN4 X;  2STT A;  1LQ1 A;  3VDX A;  1T0F A;  4EMS A;  2VE9 A;  3BTI A;  5E1W A;  1OYW A;  2HQ5 A;  3QU6 A;  2VT3 A;  4G6Q A;  1SVL A;  3FKJ A;  1AOY A;  2O0Y A;  4EVI A;  4N4N B;  4M6V A;  4HX4 A;  3S3M A;  1KU2 A;  2VOD A;  4IQ4 A;  4QWQ A;  4M9X A;  3LAP A;  2EFW A;  2CH0 A;  3OYC A;  4X6A J;  5FKO A;  2JK3 A;  3E7L A;  1RKW A;  1YQA A;  2IEK A;  1X1C A;  4ENN A;  3FXM A;  2R5Z B;  5K5R A;  4XLC A;  2UWM A;  4DW6 A;  2JJ7 A;  4Y17 A;  3LQQ A;  1CQT A;  3F8B A;  1GXP A;  2MW8 A;  5KAF C;  3QOE A;  3OYH A;  5IPA A;  3E5X A;  1RR7 A;  4S0H B;  3LA3 A;  4X0G A;  4L0Z B;  2EBI A;  4BBR J;  2PMZ A;  4MTE A;  1UJ8 A;  1W0T A;  2MH2 A;  4A3F J;  3DPU A;  1ZGW A;  4PSW A;  3PSI A;  4G8X A;  1X3Z B;  2GZW A;  2WA0 A;  3FMS A;  1U78 A;  3FK7 A;  3ZMZ A;  5E8I A;  4BYY A;  3HZJ A;  2L7M P;  2QA4 I;  3HRS A;  2FQ3 A;  1U8R A;  4DNC A;  1TQP A;  5ILS A;  4CDG A;  1SD6 A;  5K5Q A;  1K4S A;  4F91 B;  4IPA A;  1PP7 U;  2VUM J;  5IYB J;  2O8K A;  1RI7 A;  3VWB A;  3S32 A;  2FF4 A;  5J47 A;  4XLF A;  2P81 A;  1VI0 A;  2YX7 A;  2HR3 A;  3BQZ A;  2X6O A;  2JUG A;  1VZ0 A;  2G0E A;  2L54 A;  3KFW X;  2DMN A;  3KZI C;  5ICE A;  4A2U A;  3GTL J;  4FHT A;  4B09 A;  3G4S I;  3HUG A;  1SFK A;  2LBF A;  2D5V A;  5DCM B;  3OS0 A;  1T39 A;  4GO1 A;  2HEO A;  3OYL A;  1Y0U A;  1HF0 A;  5IT9 K;  1MBJ A;  1UHW A;  1VTN C;  1MSF C;  1ZQ3 P;  5GPA A;  1BC8 C;  2A5Y B;  1XMA A;  2ZB9 A;  3L2V A;  2X0L A;  3S3N A;  2HVQ A;  1SAN A;  4MEY F;  5J40 A;  4L9V A;  4XRS A;  4UVA A;  2L2O A;  4CSW A;  3G6E I;  2E5N A;  3OYA A;  4IHX A;  2E1M C;  3ZN1 A;  3GLL A;  4Y7N J;  4LIV A;  1UHS A;  3K7A J;  2DDA A;  4B47 A;  3KLN A;  3LSR A;  4NB5 A;  4M3F A;  4PZJ A;  3VSK A;  3JRA A;  2DPU A;  1WJB A;  2Q2E A;  1R36 A;  4AVZ A;  5F6F A;  1BI0 A;  5FB2 A;  3K70 C;  2HNH A;  2K9Q A;  1X2M A;  3ZQ7 A;  3ZMS A;  2YX4 A;  1A6Q A;  5J1U A;  3MKY B;  2JT1 A;  2P6T A;  3T8R A;  3OYD A;  1D5V A;  2Y0M A;  3F22 A;  3VB2 A;  4W97 A;  4EJT A;  3D1N I;  1E3H A;  4RDU A;  1FZP B;  3DQV C;  1ITY A;  1V3F A;  2FNA A;  5FRO A;  4D1Q A;  4B3X A;  3ZMD A;  3HKZ A;  2HQR A;  2LP0 A;  4PJJ A;  3O8H A;  1TWF J;  4EAT A;  2CG4 A;  4II2 A;  2DJI A;  2VJI A;  3Q0U A;  4G7H F;  4O3M A;  4C9Y A;  3LWF A;  1HKT A;  4HNU A;  1NHA A;  2XPW A;  4HF1 A;  4G7Z F;  1HKS A;  3HDD A;  1W5S A;  3HXL A;  2RN7 A;  4M9S A;  3TP3 A;  1HDP A;  2M7A A;  2ELJ A;  3ABL H;  3CUO A;  4WWC A;  4OIQ F;  9ANT A;  2ETH A;  1KYW A;  2NVY J;  3ABT A;  2WTE A;  1F36 A;  1PJR A;  3DBR B;  3KP5 A;  4Q47 A;  4KYW A;  2JPC A;  3R60 A;  1FIA A;  2COB A;  4PFP A;  2ESN A;  3LSJ A;  5F0C A;  2XAS A;  2HVS A;  2LF8 A;  2H94 A;  3JRI A;  4LG3 A;  4OMY A; 
#chains in the Genus database with same CATH homology
 1BL0 A;  1JUP A;  2R5Z A;  2EZH A;  2N8G A;  2L9R A;  1WPK A;  2HOS A;  3S14 J;  3I4N J;  4I76 A;  2X48 A;  2DMT A;  3IH3 A;  1GDT A;  2HDD A;  5FKM A;  3HGG A;  4V2G A;  3BR2 A;  5EEA A;  1VND A;  4A69 C;  1T56 A;  2DA2 A;  2M0C A;  5FJ8 J;  3HKZ N;  3HOU J;  4QSH A;  1ZR2 A;  1MH4 A;  3BR5 A;  3Q0V A;  3H0G J;  3BR0 A;  3BTJ A;  1Z77 A;  2LY9 A;  4QIW N;  4I6Z A;  2JA7 J;  1G2H A;  3S1N J;  1XS9 A;  5J3L A;  3BR1 A;  1JKO C;  3S15 J;  1F43 A;  3BTL A;  4BY7 J;  2MGQ A;  2JMW A;  2FD5 A;  3JRG A;  3DEW A;  5M5W J;  5FKN A;  2JA6 J;  2EH3 A;  3PO2 J;  2LLK A;  3RKQ A;  1MBE A;  3BG9 A;  1JKQ C;  2HOT A;  4A3M J;  4UUS B;  1QVT A;  3LSG A;  2LK2 A;  2LVS A;  2MSY A;  2JA5 J;  3S16 J;  2K40 A;  2L7Z A;  3UKG A;  3HB9 A;  2QCO A;  1POG A;  1WH5 A;  5F0F A;  1NK2 P;  2L7F P;  2XRL A;  4G12 A;  3M3Y J;  3VPR A;  2OF7 A;  3G1L A;  2VPR A;  2FX0 A;  3GTK J;  3TW7 A;  2CUE A;  2M8G X;  1BA5 A;  1LFU P;  3IV5 A;  2K9S A;  3IH4 A;  1P7J A;  3G1O A;  2HXO A;  5M5Y J;  1PUF B;  4BKX A;  2M9H A;  1JGG A;  1MBK A;  4D7M A;  1ETY A;  2ID6 A;  1BW5 A;  5F27 A;  2HYJ A;  2M34 A;  4J19 A;  3HBL A;  2MG4 A;  2W48 A;  2YUS A;  3CMY A;  1LE8 A;  2CQX A;  2DJN A;  3BTC A;  4X1E A;  4C3J J;  4MLO A;  1QRY A;  4C3H J;  3JRC A;  1WCM J;  1JJ6 C;  4RBO A;  2B63 J;  1XG1 A;  3OIO A;  2RAE A;  2R7Z J;  1JT6 A;  1VF9 A;  2XPV A;  4CYC B;  3JRE A;  1O4X A;  2YS9 A;  5C4J J;  4C3I J;  4M3B A;  4A93 J;  1HDD C;  2R0Q C;  4C2M J;  2CJJ A;  2E2J J;  2NVQ J;  1D5Y A;  3NAU A;  1IC8 A;  5K7H A;  3MVP A;  4A3J J;  1R9T J;  1ETX A;  1S7E A;  3CQZ J;  5EYR A;  1LE8 B;  1IDY A;  1YRN B;  1P7I A;  1FEX A;  1W0U A;  3OSF A;  2AO9 A;  2YU9 J;  3GTP J;  5IOY A;  4UUT A;  1B8I B;  1AHD P;  2HXI A;  4IHW A;  5J1R A;  5DS9 A;  1BJZ A;  4CYC A;  2DMQ A;  5GP9 A;  3SJM A;  1B72 A;  2XGD A;  1OJL A;  1I3Q J;  1WGX A;  2NVT J;  4D5F A;  2Y2Z A;  4IHY A;  1ETW A;  2IBD A;  3S2H J;  2PMZ N;  2I10 A;  3LOC A;  3JRD A;  1FJL A;  1Z0X A;  1JKR C;  4JP0 A;  1Y1W J;  2XSD C;  3S1R J;  2O7O A;  1ZTR A;  1RPW A;  5EG0 A;  4DYR A;  4HNV A;  2GBY A;  1SFO J;  3GTO J;  1JKP C;  4D7N A;  1JTY A;  5C3E J;  1BW6 A;  3HOY J;  3HOZ J;  3TED A;  4D5C A;  3HOW J;  1ETV A;  4NDL A;  3MKL A;  5EDN A;  1UMQ A;  1I50 J;  2E19 A;  3F0C A;  5JLX A;  3WHC A;  1HCR A;  4L5E A;  3MN2 A;  3GTM J;  3JR9 A;  2ID3 A;  3QQA A;  1ETK A;  3GBG A;  4AC0 A;  1TWH J;  3GTG J;  5EG0 B;  3HOV J;  5E3O A;  5C4X J;  2NS8 A;  5JLW A;  4QTR A;  1U8B A;  1JT0 A;  4M3E A;  1ZKG A;  4FCY A;  1MBG A;  5FLM J;  3RZO J;  2DA4 A;  2DMU A;  2LD5 A;  2AHQ A;  3B6A A;  4M3D A;  5E3N A;  1QPI A;  2R5Y B;  4B3A A;  4A3D J;  2LFB A;  2DA5 A;  4JX4 A;  3QPL A;  3GTQ J;  3A02 A;  1A6I A;  3OOU A;  2JA8 J;  3TW6 A;  2NOG A;  5K7Z A;  3S1Q J;  3M4O J;  3QPS A;  2HOA A;  5DTD A;  4DZJ A;  4XK4 A;  5IOZ A;  3CDL A;  2CUF A;  1MBF A;  1APL C;  4A3C J;  1OCT C;  1A5J A;  5J1Y A;  2VKE A;  2FQ4 A;  1ETQ A;  2DTZ A;  4XRS G;  1UG2 A;  1K83 J;  1OCP A;  4JX5 A;  5F0H A;  1DU6 A;  1QVU A;  1IJW C;  1H88 C;  1GVD A;  1MBH A;  4Y52 J;  3PM1 A;  1TC3 C;  4A3E J;  1WH7 A;  4DZP A;  2EZI A;  1LFB A;  2OPT A;  2R5Y A;  3L1P A;  2R92 J;  4FE7 A;  1JTX A;  3K2A A;  2R93 J;  4DYQ A;  5IYD J;  1TWA J;  5EZH A;  3JRH A;  4GFB A;  2FJ1 A;  4FE4 A;  4A3K J;  3BR6 A;  1TWC J;  2Y31 A;  1GT0 C;  1AKH A;  2Y9Z A;  3HGY A;  5FKK A;  2DA6 A;  2EZK A;  3BQY A;  4FIS A;  5M5X J;  2KDZ A;  3BG3 A;  3ZQH A;  3ZQC A;  2NVX J;  3HOX J;  1I6H J;  1NK3 P;  2WAQ N;  3GTJ J;  3FK6 A;  4MFE A;  5F1J A;  4BBS J;  2E2I J;  4B4C A;  2LKX A;  2E2H J;  4AUX A;  2Y9Y A;  3B6C A;  2DMP A;  4JX6 A;  4MIM A;  1JJ8 C;  5EGO A;  1U9N A;  3S17 J;  2LTP A;  2GM4 A;  1B8I A;  5BNG A;  1X2N A;  1Y1V J;  3HEF A;  3JRF A;  2ELK A;  1Q1V A;  3BR3 A;  5M3F J;  1GV2 A;  2ME0 A;  2EQR A;  3CCY A;  1B72 B;  2DA7 A;  4MO7 A;  1HOM A;  3BTI A;  3FIW A;  3FIS A;  4MFD A;  5EF6 A;  1ZR4 A;  2XGE A;  2Y0S N;  2HQ5 A;  5FKL A;  1RKT A;  4M6V A;  1EF4 A;  4IHV A;  5EGO B;  5M3M J;  2ECB A;  2ME6 A;  2GLO A;  1JUM A;  5FLV A;  2O9L A;  4ABZ A;  4X6A J;  4UUS A;  5FKO A;  2JK3 A;  3E7L A;  5E3L A;  5K7F A;  3A01 B;  1RKW A;  2IEK A;  1IGN A;  2CRG A;  2R5Z B;  4XIC A;  4DW6 A;  2JJ7 A;  2IAI A;  3LSP A;  1IDZ A;  1CQT A;  2MW8 A;  4FTH A;  2ECC A;  3IH2 A;  5IPA A;  1RR7 A;  2WB1 N;  3C2B A;  2CQQ A;  4S0H B;  3JRB A;  2EBI A;  4BBR J;  4DYC A;  3RQI A;  3SFI A;  1W0T A;  4XID A;  4A3F J;  4LOC A;  2JN6 A;  5C44 J;  1FIP A;  1ZGW A;  1OFC X;  2L0K A;  3LNQ A;  3ZQF A;  5IP6 A;  1U78 A;  3FK7 A;  2L7M P;  1WI3 A;  2VI6 A;  2VUM J;  5IYB J;  1XC5 A;  1MNM C;  2O8K A;  3S2D J;  2XB0 X;  3S1M J;  4BXX J;  2P81 A;  1VI0 A;  2DA3 A;  3BQZ A;  2X6O A;  2NS7 A;  2G0E A;  3PO3 J;  1RET A;  1H89 C;  2M2E A;  1GUU A;  1FTZ A;  2DMN A;  2LR8 A;  2QF7 A;  4A3G J;  2Y30 A;  1RES A;  3GTL J;  1GV5 A;  1MH3 A;  1U9O A;  5EZG A;  4XRM A;  2D5V A;  3DCF A;  3Q3S A;  4A3I J;  4AYB N;  2X9D A;  3Q0W A;  2XB5 A;  1HF0 A;  3ZQL A;  2DN0 A;  4BY1 J;  1MBJ A;  1ZQ3 P;  1MSF C;  5GPA A;  3HM5 A;  2E1O A;  4A3L J;  2HI3 A;  2ZB9 A;  3BT9 A;  1SAN A;  4XRS A;  3BG5 A;  1ORK A;  4IHX A;  2CU7 A;  1JUS A;  4Y7N J;  2H1K A;  1UHS A;  5IP9 J;  3K7A J;  3A03 A;  5IYC J;  3H3V K;  3LSR A;  4M3F A;  3JRA A;  1PUF A;  5HOD A;  4IEJ A;  1AKH B;  1ETO A;  5GPC A;  1NTC A;  2K9Q A;  3I4M J;  1X2M A;  4W1U A;  1ZK8 A;  5E3M A;  2EZL A;  2XPU A;  5J1U A;  3NAR A;  4B1R A;  2TRT A;  1K61 A;  4JYK A;  5F08 A;  3O8G A;  4W97 A;  2H8R A;  3D1N I;  2VKV A;  4RDU A;  1ITY A;  1IV6 A;  3G1M A;  1E3O C;  1T33 A;  4A3B J;  3TP0 A;  2JWT A;  2LP0 A;  2DA1 A;  3O8H A;  1TWF J;  1MSE C;  3WHB A;  3Q0U A;  5IP7 J;  1ENH A;  1IUF A;  2XPW A;  1DU0 A;  5F04 A;  3HDD A;  3ZQI A;  1TWG J;  3RZD J;  1IRZ A;  1FTT A;  3TP3 A;  1YRN A;  1HDP A;  3FKI J;  3SDG A;  1IG7 A;  3ZQG A;  2XGC A;  4EEF G;  9ANT A;  1H8A C;  2NVY J;  2KT0 A;  1AU7 A;  3ZOB A;  1F36 A;  4V2F A;  1VFC A;  3OSG A;  1FIA A;  2K9N A;  1X58 A;  2COB A;  4M3G A;  1HLV A;  2TCT A;  3LSJ A;  5F0C A;  3W6V A;  2WV1 A;  3JRI A;  3A01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...