4IEJA

Crystal structure of a dna methyltransferase 1 associated protein 1 (dmap1) from homo sapiens at 1.45 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
VQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA methyltransferase 1-associated protein 1
publication title Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16282 SANT_DAMP1_like SANT/Myb-like domain of DAMP1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4iejA00
4I6ZA 2M2EA 4AC0A 2JA5J 3OSGA 2XB0X 4DZJA 2FD5A 5F04A 3BR3A 2WV1A 4A3GJ 5M5YJ 5EZHA 1X2MA 4UUSA 4A3DJ 4FE4A 2XPUA 3JRCA 3S1NJ 5EYRA 1JT6A 3M4OJ 2NVXJ 5FKMA 1MBEA 3BR6A 4M3GA 3MKLA 5F08A 4M3FA 1OJLA 2LLKA 1ETOA 1RPWA 1WI3A 4JX6A 1P7JA 2DA1A 1MBKA 2GLOA 1ITYA 5FKLA 2Y0SN 3W6VA 2HXOA 5F27A 3B6CA 4G12A 3JRDA 1ORKA 1U9NA 5EG0B 2JWTA 3MN2A 4MLOA 4DYRA 2IEKA 3JRBA 2LD5A 1G2HA 3H0GJ 1XC5A 2EQRA 5GP9A 4A3LJ 2Y31A 4ABZA 5JLWA 5IYCJ 1MBGA 5E3MA 3JRFA 4B4CA 5BNGA 1MBHA 2MSYA 3NARA 3S15J 2KDZA 3HOWJ 2MG4A 1ETYA 1AU7A 5JLXA 3S17J 5GPAA 4FE7A 3A03A 4LOCA 1HDDC 5IPAA 2Y30A 5DTDA 2YU9J 5F1JA 4M6VA 5K7ZA 4C3HJ 1TWHJ 1ETQA 2HOSA 1LFBA 2LTPA 1LFUP 4CYCB 4I76A 4JX5A 2M0CA 4XRMA 1IDZA 1A5JA 4DZPA 2ELKA 2NVYJ 1B72A 2OF7A 4A3FJ 4IHYA 2D5VA 3LSRA 2XGDA 3BQZA 2R7ZJ 4L5EA 4GFBA 3BQYA 3ZQHA 1X2NA 4M3DA 4A3CJ 2B63J 4EEFG 1BA5A 3NAUA 3FISA 4AUXA 4C3IJ 2DMQA 3Q0UA 5FKKA 9ANTA 4UUTA 4D7MA 4QIWN 3LSPA 3UKGA 2R92J 2CQQA 4BXXJ 4RBOA 1T56A 1ZKGA 2NOGA 5F0FA 4HNVA 2X6OA 3OOUA 4B1RA 1HCRA 3S2HJ 2DA4A 4IHXA 2KT0A 2LK2A 1BW5A 1FJLA 2FJ1A 3FKIJ 3K2AA 2DJNA 2R5YB 3RZOJ 2IBDA 1NTCA 1XG1A 1RKTA 3LSJA 2QF7A 2VUMJ 4X1EA 2LFBA 3BG5A 3ZQIA 3GTQJ 1VI0A 4V2GA 2W48A 3ZQFA 1SFOJ 3RQIA 2M9HA 4UUSB 2L0KA 3OIOA 1B8IA 2JA7J 1GVDA 2H1KA 2TRTA 1Y1VJ 1IDYA 2E2IJ 2R93J 2N8GA 2DMTA 1BJZA 3LSGA 5FLVA 1K83J 2WAQN 4BBRJ 5EZGA 2K9QA 5EGOA 3IV5A 4JX4A 3OSFA 1D5YA 1UHSA 3K7AJ 2JJ7A 1U8BA 1AKHA 4S0HB 3G1LA 2ZB9A 3Q0WA 3IH3A 1WH5A 3TW7A 2HYJA 2ME0A 1OFCX 3B6AA 1AHDP 1GDTA 3CDLA 1Z0XA 1TWCJ 1H89C 5IYDJ 2JA6J 3HEFA 3M3YJ 2LY9A 5IP6A 3DEWA 2GM4A 3LNQA 1UMQA 1JUMA 2CJJA 4FTHA 3I4NJ 1ETXA 1BW6A 4A93J 2LP0A 4XRSG 1CQTA 5F0HA 2HDDA 4BY1J 3A01A 3MVPA 1IGNA 4A3MJ 2EBIA 3D1NI 3C2BA 4XICA 1OCPA 3RZDJ 4BY7J 4DYQA 2JMWA 3BR5A 4A3KJ 1U78A 1IC8A 2EZHA 3S1RJ 2EH3A 5IP7J 2DMPA 4C3JJ 3ZQCA 2R5ZA 3LOCA 1ZR4A 2E2JJ 3BG3A 2X9DA 5M5XJ 4IHVA 1VNDA 1QVUA 2K9SA 2GBYA 3GBGA 2HOAA 5IOZA 3L1PA 2QCOA 1ENHA 5C4XJ 2ID3A 1UG2A 2K40A 3BTIA 1Z77A 1JKPC 4DYCA 2DMNA 5F0CA 2MW8A 2LKXA 3TP0A 4D5CA 2XPWA 2DMUA 3QQAA 1B72B 1YRNA 1DU6A 4AYBN 1FEXA 3BTJA 4MFDA 5M3MJ 3JR9A 3GTJJ 1RKWA 3JRGA 3QPSA 1X58A 2L7ZA 5IOYA 1NK3P 3S1MJ 2L9RA 2NS7A 4W1UA 4MFEA 1XS9A 3BR0A 2EZIA 2NVTJ 3GTOJ 3HOYJ 4D5FA 1APLC 2O7OA 3S14J 1MBJA 2IAIA 3Q0VA 1T33A 3O8HA 2XB5A 1GV2A 5J3LA 3SFIA 1WH7A 2VPRA 4IHWA 1TC3C 2Y2ZA 5FLMJ 1VF9A 4MIMA 1HLVA 1ETVA 2R0QC 4V2FA 1H88C 3TP3A 5E3LA 1JTXA 4JYKA 1HF0A 5J1UA 3GTPJ 3GTMJ 3E7LA 1PUFA 4BKXA 1S7EA 5EDNA 3S2DJ 4XK4A 1H8AC 1RR7A 4M3BA 1JKRC 1LE8A 3IH4A 3WHCA 3BTCA 4FISA 3ZQLA 3ZQGA 2JA8J 1I50J 3Q3SA 2P81A 1MH3A 5FKOA 4D7NA 2PMZN 3BTLA 1B8IB 5IYBJ 2HXIA 2Y9ZA 3FK6A 1I6HJ 3JREA 1W0UA 3WHBA 1W0TA 2AO9A 2VI6A 3SJMA 2H8RA 2COBA 1MSFC 3FIWA 5EGOB 1U9OA 3JRHA 1QPIA 2YUSA 1AKHB 3PM1A 3CMYA 2HQ5A 3GTLJ 4XRSA 1ZR2A 3H3VK 4C2MJ 2HOTA 1FTZA 5FJ8J 1TWFJ 3JRIA 4QTRA 1ZK8A 4A3JJ 3CCYA 3FK7A 1IUFA 2VKVA 2YS9A 3BT9A 1IRZA 4A3EJ 1MH4A 2FX0A 5J1YA 4XIDA 2DA7A 4BBSJ 3I4MJ 2JK3A 4RDUA 3PO3J 4QSHA 2XSDC 3JRAA 2CUEA 2ECBA 2WB1N 3A01B 3ZOBA 1F36A 2O9LA 2E19A 1IV6A 5IP9J 2LVSA 3HKZN 2JN6A 2L7MP 1MSEC 1I3QJ 2AHQA 2DTZA 2ECCA 2CRGA 3IH2A 2R5ZB 1QRYA 2K9NA 2Y9YA 3HOZJ 1GT0C 2G0EA 1RETA 3HOVJ 1WGXA 4FCYA 2ME6A 2MGQA 3GTGJ 2DA6A 4IEJA 1RESA 1JGGA 3HOUJ 2FQ4A 1WPKA 1Y1WJ 1P7IA 1JTYA 2DN0A 5C4JJ 1SANA 1YRNB 2CU7A 3TEDA 3S16J 2I10A 2X48A 2E1OA 2LR8A 1BL0A 2L7FP 1FTTA 4DW6A 5EG0A 4MO7A 3HDDA 3G1MA 2EZLA 1JJ6C 2O8KA 5M3FJ 3G1OA 3BG9A 1ETWA 4Y7NJ 1VFCA 1Q1VA 5EEAA 1IJWC 2E2HJ 1F43A 3SDGA 4B3AA 3DCFA 3HGYA 5C44J 1HDPA 4A3IJ 2XPVA 2M34A 1JKQC 4X6AJ 3RKQA 1GUUA 2RAEA 3QPLA 2XRLA 2XGCA 2NS8A 1FIAA 1PUFB 4NDLA 3HM5A 1POGA 1R9TJ 2NVQJ 4A69C 1JT0A 1OCTC 2HI3A 3GTKJ 1HOMA 1IG7A 3VPRA 4CYCA 1A6IA 2EZKA 3BR1A 5HODA 1LE8B 3A02A 1NK2P 1JUPA 3HGGA 1ZQ3P 4J19A 1MBFA 1FIPA 5K7FA 5C3EJ 1JUSA 5M5WJ 2TCTA 1ZTRA 1JJ8C 2VKEA 1TWAJ 1WCMJ 5EF6A 1TWGJ 3PO2J 2CQXA 2M8GX 1E3OC 3O8GA 5K7HA 4Y52J 1GV5A 1ZGWA 4A3BJ 5E3OA 2CUFA 2DA5A 3HBLA 3TW6A 5GPCA 3BR2A 5E3NA 4W97A 1K61A 3S1QJ 2ID6A 2XGEA 3HB9A 5FKNA 4M3EA 1O4XA 2OPTA 2DA3A 4JP0A 3F0CA 2DA2A 1EF4A 3CQZJ 1DU0A 5DS9A 1QVTA 3HOXJ 1JKOC 2R5YA 1MNMC 5J1RA 1ETKA
chains in the Genus database with same CATH superfamily
4I6ZA 2M2EA 1O3SA 4KYWA 3U9GA 2XHKA 1FBUA 2R7UA 5CKTA 3WE3A 4DZJA 2FD5A 5F04A 3BOQA 5CJ9A 2RNJA 3KZZA 5EZHA 5IY5H 2Q2EA 4UUSA 1LKXA 3Q9VA 2LF8A 3J81K 1VQ5I 1SVLA 4FE4A 3L2CA 3DEUA 1OISA 2FNPA 2RN7A 1EH7A 1R1TA 4GO1A 2CGPA 1JT6A 3PL8A 5FKMA 2L9SA 1WJBA 2X4HA 1HW2A 2JSPA 2F2EA 3M8FA 3MKLA 4BGDA 2HYGD 4EGZA 2WBMA 1S5LC 2GWRA 2VQLA 2VBXA 5FRNA 4I09A 2GLOA 4ZYAA 3QP6A 3MMYB 1IN7A 1T38A 2Y0SN 2FSWA 2COMA 3WGHA 2HXOA 3B6CA 2JPBA 1FP1D 4U7DA 2IEKA 3FXJA 2VXDA 4NUBA 5JHUA 1G2HA 3OYGA 5DCMB 4KMUX 3MCZA 5BMZA 4OIQF 4A3LJ 1VQ6I 2ZSIB 4U88A 2ZSHB 3JRFA 4B4CA 2FQ3A 2OZ6A 2H8WA 3CCRI 4A0YA 1Y56A 2KDZA 1ETYA 4UB6C 4KNYA 1Q1HA 5GPAA 5IT3A 4M71A 2IPQX 3ECHA 2ZNYA 5DTDA 4BDZA 5J40A 1YLFA 3TGNA 3CJRB 3S3OA 3LA7A 3CCVI 5K7ZA 1RUNA 4IKFA 1YE9A 1LFUP 2GXAA 4CYCB 3ZQQA 2KRFA 3GEZA 3KIOA 3QYBA 1TNTA 1XDUA 4UVCA 1HKQA 5E8IA 2ELKA 1KQ8A 2O3FA 2MA3A 1PP8F 4A3FJ 2STWA 1USTA 2HQNA 3S8PA 2D5VA 2XGDA 2VQCA 1ZARA 1DPRA 1Z67A 4NQWA 3BQYA 4EJWA 1X2NA 1YX5A 2VXZA 4A3CJ 3ECOA 3DXJF 4EEFG 4ZC3A 2LSOA 5KVRA 1IO2A 4AUXA 2E35A 2R3SA 3PNTA 5TRDA 2UUZA 2DMQA 9ANTA 2IA1A 4KIBA 4D7MA 4QIWN 3UKGA 3LWFA 1ZKGA 5F0FA 4HNVA 2DA4A 4B47A 3M1CA 3WODF 2KT0A 2OA4A 4A0ZA 4BE0A 3WTZA 3VYUB 4IZZA 1W1WE 2RC4A 3U1KA 2NOJB 1FJLA 4KFCA 4AIJA 2IP2A 2HYFA 2IBDA 1XG1A 3I64A 3RZOJ 1BM9A 3CC2I 2VUMJ 1TBXA 1R22A 4R79A 2Z9OA 3R60A 3ZQIA 1VI0A 3OS2A 2OCCH 3EUAA 2DODA 3H36A 3OL4A 4V2GA 3PJRA 3DTIA 4I0AA 4BEHA 2JPCA 2HPIA 3WU1B 2L0KA 3PSFA 1L3LA 2FNAA 1Y1VJ 3HRSA 3DLAA 4E7ZA 2WTEA 3KPHA 3CF5F 3HC7A 3OOPA 4BHBA 1HQCA 5BPDA 2DI3A 5EZGA 2K9QA 2UV1A 4EQQA 2FEZA 1I1SA 5H2FC 3OSFA 4WXCA 2LC2A 1TNSA 5L3DA 3SHFA 2W24A 3LFUA 1HSTA 2V26A 2H94A 2QVOA 3IH3A 4HPQA 5E1WA 2HYJA 4ZJZA 1OYYA 5KAFC 3B6AA 4IF4A 3OYEA 3CDLA 3AG1H 2HQAA 2JA6J 2VT3A 3CJQB 1A31A 3ABTA 2LKPA 3M3YJ 1K4TA 3LNQA 1QZYA 1Y39A 3I4NJ 3EUHC 1BW6A 4XLHA 1QO0D 4HW0A 1OCRH 3RPQA 3A01A 1KYWA 5LGNA 2EBIA 3X2QH 3D1NI 3V42A 3IKTA 3C2BA 5JR3A 3FHNA 1OCPA 3RZDJ 3BR5A 3RKXA 3WGGA 4LLGF 1U78A 3S1RJ 2EH3A 2QBYB 4PZJA 2DMPA 3IRRA 3SQNA 3LOCA 1D8KA 2W7NA 1IW7F 3BG3A 2Z1DA 3FXMA 3SEZA 2RGVA 3LSTA 2GBYA 1NHAA 5IOZA 1TLHB 3NRVA 2MH9A 2XAQA 2XDVA 4I0BA 3OS1A 3FM5A 1JKPC 2CH0A 1WJFA 1B4AA 2W85A 2PJRB 4D5CA 4BACA 2IS4A 2E1MB 1SAUA 5HDNA 3RCOA 1WVRA 2P5VA 1QPMA 3GFJA 1U3EM 3OYNA 3HXLA 2Y69H 5E8GA 3FBIB 4BL0B 1X58A 1WSUA 2L7ZA 3DU6A 2NS7A 5FROA 3OYLA 4OWRB 4EJTA 4W1UA 4EJOA 2F48A 5K5QA 3BR0A 2EZIA 2F5FA 3ZQ7A 2IGNA 1MZBA 4ZYGA 1RR8C 3Q0VA 1T33A 2G7UA 3O8HA 4LK1F 4IRHA 1G6NA 2PX9A 1VQPI 2A05A 2HVSA 2ZXJA 4MIMA 3FX3A 1ETVA 4EGYA 3TP3A 2MBFA 3ZMDA 2BV6A 2DOFA 3A0HC 4BH9A 1PUFA 1SVOA 3BCBA 1LPQA 4BAYA 4BKXA 4FHTA 3S2DJ 5E18F 2ELJA 2KMUA 4N9IA 2KRHA 1H8AC 4G7OF 1R1UA 2ISYA 4GXOA 2W4SA 3COAC 2LY1A 3DBRB 4CCLA 1RI7A 5AONA 1LFPA 3ZQLA 2LRDA 1WZ2A 5FKOA 3CLQA 2PMZN 5IYBJ 2HXIA 1OYWA 2AQEA 2ESNA 3M8EA 3WHBA 2AO9A 2VI6A 3H3ZA 4IRGA 1H9TA 1CF7A 3FIWA 3TO6A 2Z5UA 3S3NA 1AKHB 2HVQA 2HPMA 1A04A 2M8EA 3H3VK 2L5QA 2ZNZA 3C2GA 5LRSA 3FKJA 3DWLE 5FGMA 5B3SH 2BVMA 5FJ8J 2CQNA 4Y15A 2ZBKA 1OR7A 5KHDA 1ZK8A 2LMDA 5B5EC 3FK7A 4WWCA 3BT9A 1QBJA 1IRZA 1FOYA 3K4JA 1D3YA 3N05A 4A3EJ 5J1YA 4XIDA 3PO3J 3ERMA 1EH8A 3JRAA 2CUEA 2B9SA 1V3FA 3ZOBA 1F36A 1G3SA 2O9LA 2JRTA 2IT0A 5D5XB 2DXIA 2LVSA 3G73A 3NEUA 4GRIA 3MKWB 3IC7A 3DTEA 2R5ZB 1MW7A 3SZTA 4YIFA 2B7EA 1OMIA 2M1BA 2VBYA 4BHPA 1GLNA 2LF7A 3I58A 4HSRA 1GT0C 1BR1A 4HLYA 1ZREA 3W2WA 1AOYA 4EV0A 2ZJ2A 2ME6A 2HU9A 2L2OA 3E6DA 2ZC2A 2LY2A 4CCKA 4GGGA 3UR3C 4F7ZA 5ICGA 2V1DA 4RGSA 5TISC 5C4JJ 1YRNB 2EA4A 4MTEA 3S16J 2X48A 1BL0A 2J5OA 2Z3YA 3MKYB 1B9NA 2E1MC 3VYTB 3HRUA 3ZMVA 1MD0A 1FYLA 2XVCA 1G3WA 4HOBA 4R1HA 3JAMK 3KLNA 4IVNA 3FXQA 3QOPA 5M3FJ 1RNLA 2L4MA 3QRFF 4ESFA 1TQPA 3G1OA 1SFKA 3R0AA 3CCJI 4KIGA 2I8DA 2ZKZA 3BG9A 3HTUA 4LFUA 2KIMA 4PK4A 4YFNF 1ODDA 1LEBA 2PI0A 3CO6C 1IJWC 2E36A 2E2HJ 2X51A 4KISA 2W1OA 2MC3A 4OIOF 1FX7A 1OYIA 4CA0A 5KAIC 3V4GA 2VPLA 1WHUA 2GQQA 1JKQC 1XDSA 4BJ6C 4BUPA 4UV9A 2RAEA 4PFOA 2XRLA 1I1GA 1FIAA 2NVQJ 1V5GA 1PYVA 4A69C 1OCTC 2HI3A 1LJ9A 1HOMA 2MLKA 1QZZA 3VPRA 1FWZA 1A6IA 5HOOA 4WX9A 3G2BA 4XM3A 3BR1A 2UZKA 1KA8A 1R5HA 3C1DA 1JUPA 2X6WA 3I5UA 3VSKA 3IRQA 2VC0A 2DFEA 3E97A 3WTXC 1QQIA 2BZTA 5JVGF 4XOTA 1SD4A 1QZEA 5D5WB 4HF1A 1ZTRA 3FXLA 3H92A 3S93A 2VKEA 1ONVA 2W25A 4AYBA 4KUMA 4CXFA 3V8KA 2E71A 4RB2C 2K3PA 2RVCA 3WU0A 1E3OC 3O8GA 1EJ9A 1GV5A 2XUBA 1BI3A 3KLOA 1IUYA 2DA5A 1YYVA 4W97A 2VJIA 2EILH 2XGEA 3F6OA 3HB9A 5CQEA 5FKNA 4MTDA 1O4XA 5CYVA 3OMYA 2DA3A 4JP0A 2DFFA 3KCCA 5D8LB 1OKRA 3CF2A 3IWFA 4A2UA 3BC8A 5DS9A 4XKBA 4HF2A 3HOXJ 3KP4A 1JKOC 1Y8RB 3K1MA 3WGIA 1F5TA 2R5YA 3GFMA 1ZLJA 3AG3H 4M9ZA 1DP3A 2KJCA 1TT0A 5FD6A 3VEPA 2O5RA 1XSVA 3BR3A 4RAFA 4A3GJ 1G3YA 5M5YJ 1X2MA 4OINF 1TZLA 3PIOF 3LL7A 2XPUA 2F4IA 3S1NJ 1BI2A 4H4KC 1SVMA 3A1YA 4AIHA 2LDUA 1UAAA 2PEXA 4D0PA 4B3XA 5J8FA 3CCMI 3CUQB 4BQNA 1MBEA 2NVXJ 3M4OJ 3BR6A 2IGMA 2Y0MA 1W4MA 4M3FA 5F08A 2QEXI 4HZFA 2XROA 3J7YJ 4LIUA 5B1AH 3GFIA 1P7JA 1MBKA 2DDBA 3R0JA 2CQKA 4RGRA 3W6VA 4I98B 5F27A 3JRDA 4QLCU 4XR6A 2P0WA 3PNVA 1U9NA 1Z3YA 3GCMA 3OIPA 4ZYHA 3I53A 4MLOA 3QPHA 4OOIA 3BWGA 4FASD 1O7FA 3OYDA 1YO5C 3OYJA 1K78A 2X1CA 2IRFG 2OTLI 5HS9A 1E17A 3KP3A 4GDFA 4EM2A 3BP8A 2XSJC 2Y31A 4ABZA 5IYCJ 1R5ID 3GLXA 1KU2A 3KYDB 5BNGA 2O8XA 2VASA 4O6JA 1MBHA 3ABMH 2MSYA 1XD7A 4N9HA 3S15J 2WB1A 3PFIA 3K10A 3TMOA 5FO5A 4CGZA 2OCEA 2ZMEA 3HKZA 4Q4ZF 5IPAA 3ULQB 3K70C 4M6XA 2Y30A 2KKOA 4DQ2A 1DDNA 4M6VA 2OTJI 2OBPA 4XQFA 2EINH 1W36C 1ETQA 4ON0A 2LTPA 2H1LA 4I76A 5IT9Z 4BS9A 2M0CA 2VT2A 2M7BA 5DUIA 5GTHC 4KMFA 1P2FA 3QYFA 1WJCA 2A6EF 1ULYA 3DTKA 4CSWA 3I55I 2A6HF 4G7ZF 1O3TA 3TO7A 2R4GA 2FUG2 3K6GA 3SXYA 2ZJQF 5LD2C 3S2WA 1K7AA 4L5EA 3LMMA 4DBRA 3ZQHA 1UFMA 2VQHA 3C2HA 1HKTA 1RRJA 3WE2A 1F9NA 2D1VA 1BA5A 3F23A 3L2RA 4C3IJ 2K85A 2QWWA 1T2KA 3DLLF 3Q0UA 4CCOA 2Q0OA 4E7JA 4F3QA 2MD5A 3MKZA 2K7LA 4E70A 2KIFA 2AQFA 4RBOA 1T56A 3F8CA 5CVVA 2GIZA 2DLLA 2NOGA 1HKSA 2PMUA 4OAYA 5ICEA 5D4RA 3BZKA 2CW8A 1MGTA 4B1RA 2QA4I 2LG4A 2DDAA 4PJJA 1LVKA 2EFOA 3DPUA 1LQ1A 4IHXA 1YIJI 1R5GA 4L9NA 2QQ8A 5AIQA 1FMWA 2V1XA 3FKIJ 1LDJA 2BHZA 3K2AA 1NG6A 2VJJA 1S6LA 2BY0A 1BJAA 1EV7A 4XL9A 3CC7I 4LD5A 4X1EA 4Q5SF 3E3VA 2OZUA 2P6TA 2CUJA 3K4CA 3OY9A 3MZYA 2MLGA 2XAHA 4BYYA 2OC6A 4I01A 4HF0A 4AVZA 4XSZF 2HKXA 3RQIA 3IL2A 2M9HA 3R6SA 1I6XA 2Q2EB 4FX0A 4UUSB 5D8KB 4XBFA 3H9QA 5ICCA 3N4MA 3U21A 2MFZA 1P9QC 2JQ7A 2G7HA 3H5RA 3FZVA 2DMTA 2VKHA 3RYRA 4UB8C 3LSGA 5FLVA 1K83J 4KIFA 5DM6F 2WADA 4JX4A 1T08B 2KQRA 2PMHA 2FBIA 1UHSA 3K7AJ 1MMSA 2DU9A 3DPTA 5ICFA 1X3UA 3Q0WA 4LMYA 1LNWA 4GYIA 1OFCX 1MJ9A 3ABUA 3U2RA 1MNDA 2MD0A 1Z0XA 1H89C 2QYOA 2NS0A 4JOMA 3HEFA 1Z91A 4HX8A 5IYDJ 1PJRA 2HNHA 2LY9A 4II3A 1D1AA 5IP6A 2DW4A 3LSIA 2DFHA 2JUGA 3HPGA 1XX5A 1LUJB 1X3ZB 2X0LA 2P6SA 5FFZA 4BY1J 3FHZA 3J80Z 4A3MJ 2QENA 3Q9SA 4DYQA 2JMWA 3JTHA 4A3KJ 1IC8A 2EZHA 3S32A 1U6GA 3CJTB 5HS8A 4P9UA 3KEOA 2CSOA 4E7LA 2VODA 3OIQA 3ISPA 2NXNB 1VNDA 2E5ZA 3FMSA 2K9SA 3L00A 4MHGA 3GBGA 2JTVA 3FXKA 5C4XJ 3KZIC 2BW3B 2ID3A 2KL4A 5HLGA 1QHGA 4X0GA 4PJ0C 1Z77A 4YELA 4IHTA 5F0CA 2ISZA 2MW8A 4IJAA 1MMAA 3EUHA 1YJ9I 2XPWA 4FT8A 1DU6A 4AYBN 1HSJA 2BW3A 1FEXA 4MQ9F 3DKWA 4MFDA 2BEOA 4FX4A 5GADJ 3GTJJ 4NQWB 5L3FA 1K79A 3WTWC 2KPMA 3QPSA 3N97A 2WWYA 2A3SA 3HSRA 2IS2A 1W7PD 3QP5A 4KJZA 3GX4X 2HWVA 2LBFA 4MFEA 3R61A 5DV5A 2D1HA 2NAZA 2HKOA 1LB2A 1APLC 5CPRB 2PLYA 1UCRA 1IN8A 2O7OA 2IAIA 4XLAA 1P4AA 3MAJA 3I0TA 5J3LA 2FF4A 4HAMA 2VPRA 3HJEA 1U2WA 2Y2ZA 2YX4A 1XSDA 3OYIA 1F1ZA 5FLMJ 4L9VA 1B9MA 1SFXA 3F3XA 2CWEA 4NC7A 2PBIA 1X1AA 1IRXA 1T8IA 5E3LA 2R7WA 1JTXA 2K4JA 1O3RA 3GTPJ 2BYVE 3GTMJ 3DBLB 1E3PA 4PGGA 4B43A 4U87A 2KZVA 5CVRA 3FDYA 2W57A 4ZDPA 1S7EA 4OMYA 4XK4A 4TV7A 4ETSA 1FBQA 4M3BA 1LE8A 1VQ7I 3IH4A 4BEHB 1XGOA 3WHCA 3F21A 3V8LA 4FISA 3S3MA 4F52A 3Q3SA 4E7IA 4A12A 4QPOA 3BCAA 5E1XA 2Y9ZA 2EFQA 4G7HF 1I6HJ 2Z2SB 2HFHA 2DOAA 1W0TA 4NHJA 5E20A 3SJMA 2COBA 4MGRA 4HA8A 3OL3A 2XF5A 2YUSA 4RB0A 3CMYA 3GTLJ 1ZR2A 2F4MB 2F5CA 2OQGA 4JBAA 4ESBA 5F6FA 3D5RC 3JRIA 3K4KA 3IAM2 2Y48A 5CQGA 4CUGA 1TW3A 1BC7C 4A3JJ 2EJRA 3B02A 3PFYA 5L3BA 2VKVA 1XMXA 4RB3C 4HRIA 2A61A 1V4RA 3I3LA 1ZG1A 2FX0A 1KQ9A 2DA7A 4ANJA 1ON1A 4I2OA 3WTTC 4QSHA 3CD6I 5HNFA 4CCMA 2WB1N 3A01B 3CC4I 4ZZDA 1Z05A 4IQ4A 2CV0A 1BN5A 2E19A 1IV6A 1YX3A 1USSA 1OLTA 3HKZN 3NWSA 2JN6A 2ETHA 3F8MA 1MSEC 1I3QJ 4BU2A 2FMLA 2KHMA 2AHQA 2DTZA 3K9TA 1XB4A 3HTSB 2OQRA 3BG6A 2QQ9A 2FBHA 2YSRA 5KCMA 1QRYA 2GA1A 2W84A 4XMYA 4M6YA 2G0EA 4CCJA 5LRRA 4DNCA 2IJLA 4FETA 1J9IA 3GTGJ 5LHHA 2DA6A 1JGGA 3AFHA 5GAHJ 2QSFX 3E5XA 3V8JA 4B48A 2STTA 2DN0A 3T8TA 2L9VA 2CU7A 3TEDA 2NRAC 1FPQA 3LQQA 4BQOA 1ZGJA 2L7FP 1TL8A 1JE8A 2QSGX 1FTTA 1P4XA 3G6EI 4RLQA 5EG0A 4WF2A 4AM3A 1SD7A 3HDDA 3H0DA 2BY3A 3L2VA 2CFOA 3HUGA 2DYSH 4NNJA 4CICA 4E7KA 2V1NA 2C6YA 5ILVA 2XAJA 3ZP5A 1JXSA 1Z7LA 2VE9A 3ZMUA 1S3JA 3PQJA 2M0MA 3PUFA 1QU3A 1IN5A 2EFPA 3K69A 1VFCA 1GHCA 1R23A 3I4PA 1Z6TA 2R7SA 4BNCA 2E7XA 2ESHA 3DCFA 4Z6YA 4HX4A 3LAJA 5J4YA 1U5TA 1N77A 1J09A 2BOLA 1TQMA 2XGCA 4Y3OA 1R4NB 2NS8A 1PUFB 4NDLA 3HM5A 3K70D 1R9TJ 3GTKJ 1JHFA 1JT0A 1IG7A 1W7PA 4L9JA 4C2TA 1W36D 1FOWA 4DBQA 1HBXG 1UELB 4YIIA 5HODA 3A4CA 2R7QA 5HNHA 2VJ4A 1NK2P 4LG3A 3HGGA 4M9XA 2TDXA 3ERED 3F22A 1P6RA 2HEOA 2XIGA 3W6KB 3LSKA 2GAUA 4PDKA 2LOOA 2BGCA 2GOMA 3KP6A 5M5WJ 2V9PA 4EM0B 3OYFA 3CZ6A 5EF6A 1K4SA 1T6SA 2FU4A 3QU3A 1WJEA 4KITB 3CMAI 2CQXA 1CF7B 2LNBA 1OCOH 4YRVA 1IN4A 4IL6C 5D5UB 1PVEA 4A3BJ 2CUFA 3DU5A 3HBLA 3KZYA 3HRMA 5FFXA 5GPCA 1YQAA 2R7RA 2HR3A 1K61A 3LA3A 3BJAA 4II2A 2D2WA 4JQFA 3S1QJ 1YFHA 1X1PA 1FSHA 1XGNA 1YS6A 4UNOA 4M3EA 2OPTA 2VB6A 1IAWA 4PCQA 4EJUA 2DA2A 2GA2A 1S8NA 4KN4X 3AKZA 2RKHA 3GFLA 2JSCA 5JFRA 2P7VB 4XLPF 3I71A 1B59A 1UG0A 1DPUA 4PGHA 3DKXA 2UXXA 5B66C 5LEKA 2GOXB 4XLEA 4UHTA 4U7BA 2JA5J 1I27A 3OSGA 2XB0X 2EK5A 2K3FA 4E7SA 4BDYA 2WV1A 1D5VA 1R1VA 2A68F 5TJJA 1ZN2A 4IHSA 4A3DJ 3ABKH 4G6DA 2FOKA 1PDNC 2OU2A 3FXUA 5EYRA 3JSPA 1ZYRF 1ZG5A 2KRCA 4M3GA 2XRNA 2VKDA 4L5IA 3GO5A 2OUMA 1ZRDA 1OQYA 3ESWB 4F92B 2HZDA 3OYCA 4KA4A 1RPWA 1J2XA 1WI3A 4IRIA 3E6CC 3V7RA 5GAGJ 3FWEA 2P4WA 1A35A 4FQGA 1SFUA 1B6AA 3O6BB 5JHFA 3LSHA 1BC8C 4CHUA 1FMVA 3RKWA 4IOAF 2XGXA 3MN2A 4NC8A 1KZHA 2NVUB 2R7DA 2EPFA 4RMNA 3JRBA 5LEJA 1FSEA 3H0GJ 2EQRA 5GP9A 4B44A 2RDPA 2WA0A 5JLWA 1MBGA 2OJED 5E3MA 1KGSA 4ZH4F 1YHQI 3RQ4A 3GXOA 5D4SA 3S17J 3GZNB 5HS7A 4XKCA 4FE7A 3E0JB 1YW7A 3A03A 4HQMA 3RPUD 5DEQA 1HDDC 1K6YA 4EATA 2YU9J 2EV0A 2XAUA 1ERDA 2VOPA 2L3DA 2OV7A 4C3HJ 1TWHJ 3GLLA 4HNUA 4PJMA 2CG4A 1LFBA 4NB5A 4RGXA 2HOSA 4IQJA 1QA6A 3ZRGA 3EETA 4JX5A 4XRMA 4N4OB 1IDZA 2RQPA 3H9JA 1A5JA 4H0EA 3PNYA 2A5WA 2NVYJ 3K4NA 1B72A 2HTJA 4ZDLA 1ZAOA 1Z21A 3HRTA 4IHYA 2DK5A 1YG2A 4ZDOA 5CVJA 4GFBA 5DYMA 2EA2A 1XTAA 4XLFA 2XAGA 5B1BH 3K1PA 1P4WA 4CO8A 3RI4A 2VE8A 3FMQA 5FKKA 4HDUA 4UUTA 4YIRX 3M1EA 2R92J 4F93B 2CQQA 1FBSA 1X4PA 3I9V2 1LDKB 4A5NA 3WTSC 2K27A 1OR7C 4HNTA 1YS7A 4ENNA 1YW9A 2HVRA 2CFXA 3W2VA 3BZCA 5FLXZ 2FJ1A 2XAFA 2DJNA 4KN7X 3SDBA 3FMRA 3C3WA 3SZPA 4YFKF 1RKTA 2R5YB 1FOKA 3LSJA 4L18B 3QODA 4V19K 2LFBA 3HZJA 3Q5FA 4WCGA 3KX2A 4XKWA 1YTYA 2DCEA 1FP2A 3R4KA 4L0YB 4MNUA 2W48A 4ENMA 2GXBA 4YEJA 3ZQFA 3JW4A 1T98A 3J7ZI 2W82A 2ACJA 3OIOA 2GXGA 3L7WA 1B8IA 2JA7J 4UXNA 1V5EA 1Y6IA 4HSTA 2ZJPF 2TRTA 2KZGA 2LH9A 5LLQA 3AL0B 3D0SA 1IDYA 3HIFA 2R93J 2N8GA 2OD5A 3DP7A 1BJZA 4HX7A 3RDIA 1G4DA 4BBRJ 2K86A 5EGOA 1VQOI 4WXHA 4G8XA 3E6MA 4PSXA 2V7FA 1QGPA 2ZB9A 1R58A 3TW7A 1IN6A 1WH5A 2JZYA 1HA8A 3EUKL 5DD4A 1BIAA 1LVAA 2XKPA 4PJNA 4ZYDA 1TWCJ 1L0OC 2M4GA 2LYCA 4HLXA 2HDCA 4MQVA 4ENJA 2GM4A 1UMQA 1JUMA 2FRHA 2L02A 2CJJA 4FTHA 5FRMA 2ZFUA 1VQ8I 4HV5A 2LKSA 4N0BA 4A93J 2KP6A 2VN2A 3HPHA 2LP0A 1CQTA 5F0HA 2HDDA 3JCUC 3MVPA 4HEA2 1K78B 3KEYA 3ZCOA 3FM3A 2O03A 1FLIA 2KJBA 5H6RA 2DK8A 2RREA 4PUSA 4BY7J 4PFPA 3EDPA 2AXTC 4P55A 3NWTA 1BOBA 1IXRC 3BLYA 2V6EA 2E2JJ 3TBIA 1P92A 3LAPA 2ZMEB 1WJDA 2X9DA 5M5XJ 4PSWA 4J01A 4IHVA 1ZHFA 4D9JA 5DM7F 1BR4A 3PQKA 2DT5A 3MEXA 2QQAA 3L1PA 2QCOA 2CW7A 1ENHA 4HQEA 1A6QA 4RAZA 3BTIA 1DQUA 1YJWI 3A2KA 4DYCA 3ONQA 3BPVA 1E2XA 5HLIA 3GZ6A 5BS6A 2DMUA 3QQAA 5BOXA 4L9TA 1TQIA 1FZPB 2MH2A 1V54H 3JR9A 4I7HA 1Z3XA 2FA5A 2L4AA 3J7AO 1T0FC 3JRGA 1A36A 4EJVA 1UB9A 4XLNF 2M3AA 5IOYA 3S1MJ 1NK3P 3ELKA 5CVUA 2DPUA 3RPUA 3W3CA 1WFXA 1J59A 4D5FA 2HQRA 3HOYJ 4HG2A 3S14J 4XORA 3EYYA 2F5VA 1R7JA 3P5JA 1GV2A 4U0VA 4IX7A 1BOAA 1STZA 3SFIA 1YJNI 4LJZF 1WH7A 3WTYC 1TC3C 1N78A 1DUXC 1S9HA 4CDGA 1O57A 1F4KA 2UWMA 5KNLA 1HLVA 3RSNA 4V2FA 3REOA 2GZWA 2Z16A 2H09A 3LSMA 4LGWA 4JYKA 4ZTFA 2CYYA 2ZCWA 3E7LA 1D1BA 3I59A 2EV5A 1X4OA 2BXYA 5EDNA 4M9SA 1TT5B 3W6JB 1RR7A 4XONA 3TO9A 3P9IA 4R8HA 3ZQGA 2JA8J 3CO7C 6PAXA 1OPCA 2P81A 2WV0A 3BTLA 2IA2A 5LGUA 2FOWA 2NNNA 3FK6A 4ZTJA 3QPTA 1QNTA 1XGSA 3DBHB 3JREA 1W0UA 1ZGAA 5EEGA 5JI6A 2H8RA 3AL0C 3V7CA 1YI2I 1MSFC 2JRMA 2XV4S 1U9OA 3DQVC 3KE2A 3H5NA 4I02A 4LG0A 3CCUI 1S29A 4C30A 1U8RA 1C0WA 1RZ4A 4C2MJ 4AWXB 1VQKI 1DGRM 2HOTA 1ON2A 1FTZA 1VQ9I 3CUQC 4DJAA 2DQRA 4LLNA 2VOOA 1WJ5A 1IV8A 4ASNA 5IT9K 2VC1A 5DUKA 1YIOA 2PG4A 3G71I 1MDMA 1MH4A 1R36A 5LGTA 3I4MJ 2VBWA 2JK3A 2WY7Q 1FOXA 2EIMH 2K9MA 2ECBA 4BQAA 5IP9J 1X19A 5DDGA 2L7MP 3ASOH 5DD8A 4RGUA 1VTNC 3AAFA 5JVTA 3KP2A 2BY1A 2CRGA 3IH2A 4M74A 4XOPA 3L2UA 1OCZH 1WQ2A 1HC8A 2PMZA 1YW8A 5EJCA 3M9AA 2CV2A 2BE5F 4P1WA 3DFGA 3KYLA 2ZMEC 3ZMZA 1RETA 1SD6A 4BE1A 2KIQA 5EEHA 4FCYA 1X3WB 4ITVA 4IEJA 1RESA 3HOUJ 3O2PE 2FQ4A 1Y1WJ 2WAQA 5DCFA 3CMEI 1SANA 3P7NA 1W5TA 3CLOA 2I10A 2E1OA 2NNYA 5K5RA 3IUOA 2D45A 2EB7A 2R7TA 5FD5A 2BY2A 2ZO4A 4DW6A 2DOEA 4XN0A 2CMPA 2FE3A 1KU3A 3E1SA 2V4JC 3BPXA 3EQLF 3KYCB 1JJ6C 2KIUA 2RNGA 1PP7U 2XKOA 2O8KA 2LBFB 1MKMA 5J4VA 4L0ZB 2X1DA 2M5WA 4C2UA 5DCMA 4F91B 3BDDA 1VQLI 1S7AA 3EPZA 4YFXF 1ETWA 4M72A 1D0YA 4BJTA 1Q1VA 2BHYA 3OR2C 1R4MB 4BXFA 3SDGA 1F43A 2DT7B 2P7CB 3KFWX 4A3IJ 1IZ1A 3K2ZA 2A6TA 4RAYA 4X6AJ 3QPLA 4OU0A 1IRFA 1POGA 4S05A 2FXAA 4AIDA 2AXLA 2QUFA 3D5SC 2VIXA 4CYCA 2EZKA 1IXCA 1CGPA 4KT6A 2ZXWH 3CESA 3HHGA 1LE8B 2IXSA 2Q1ZB 2F5EA 3A02A 1HW1A 3L9FA 1ZQ3P 4J19A 1S72I 3J80K 1MBFA 3T5XA 2BXZA 5K7FA 3HSEA 3PIPF 4IXAA 2V79A 2HOEA 1ZRFA 3CP2A 2HGCA 3IAS2 3K0LA 1XMAA 3K4BA 1E0EA 2H6CA 5K7HA 1JHHA 1ZGWA 5E3OA 3TW6A 3MQ0A 3CJNA 3BR2A 5E3NA 3WTVC 3ASNH 1SFEA 4LITA 4RS8A 3HOSA 3PSIA 4WXDA 3CQZJ 3H5AA 4UVBA 1QVTA 1RUOA 2W00A 5CVIA 3WTUC 2V9VA 4E6KG 2ICWG 4WK8F 4P5OA 3SYTA 4MEYF 4XKVA 2E1CA 2ZFWA 3IWZA 3TOAA 3E5QA 3RIRA 4AC0A 4U0WA 1BR2A 1TP4A 1VZ0A 3BJOA 1MJBA 1O7LA 4ZZLA 1X1CA 2CUZA 1BI0A 1O3QA 1XMKA 5E79C 4ZYEA 1J75A 2IW5A 3JRCA 3JSOA 4ESJA 3VSLA 1MIJA 3EYIA 4EVIA 2DPDA 2MABA 2JVGA 3ABLH 3GVAA 1MJAA 2QQBA 3CUOA 1IF1A 2QM3A 3TKYA 1OJLA 2LLKA 4HDVA 1ETOA 1EKEA 2XASA 1BI1A 3F8BA 3HL2A 3MWMA 1T95A 3F8FA 4Y13A 1REPC 4JX6A 2DA1A 5HDGA 1ITYA 5FKLA 3VYRB 4BHCA 4LB5A 4Y4RA 2FBKA 4GCVA 4HV6A 4G12A 2R7XA 1ORKA 1ZG3A 5EG0B 2P8TA 1VQNI 2JWTA 2CS3A 4DYRA 2X6XA 3HUGB 3OV8A 2LD5A 5TGTA 1XC5A 1SMTA 2A07F 1KQ0A 3F6VA 3CCSI 2ELHA 2IA0A 4K2EA 3KP7A 2M87A 3NARA 2QBYA 3CCEI 3HOWJ 2MG4A 1AU7A 3M7GA 5JLXA 3MFKA 3U1DA 2L54A 1G8XA 1UZCA 2XF7A 1U5TB 4LOCA 1R49A 4JK1X 3NQOA 2BVLA 5F1JA 1N75A 2WAFA 1XCVA 4Q48A 1ACIA 4I99C 4UVAA 1W7PB 3LFKA 3H1CA 4Z2YA 2DYRH 2M4KA 3QYEA 3OYKA 2BBYA 4LB6B 3F9KA 5J6XA 2PJRA 1RIOH 3DKYA 1V5FA 1Y0UA 4DZPA 2OF7A 1MMGA 1NH3A 2M30A 3K4MA 3ZMSA 2F4OB 2QSHX 3J7AY 3LSRA 1XGMA 1UJ8A 3BQZA 3IKVA 2R7ZJ 1TTYA 4OIPF 2HTSA 5LBQA 1K6OA 4M3DA 3V7SA 2B63J 2CO5A 2K9LA 3NAUA 3FISA 2YX7A 4PJLA 5E17F 3H35A 1R00A 3I56I 3PUBA 3L09A 4IO9F 3C7JA 5HVQC 3P9CA 4RM3A 3I54A 2VL8A 3LSPA 3GYHX 2MC4A 3BROA 2HDWA 4BXXJ 1GXPA 4P96A 5HDKA 1U0JA 3M8JA 4G6TB 3HYIA 2X6OA 3OOUA 4ENKA 1KU9A 1HCRA 4KDPA 1MMNA 3S2HJ 1R71A 3WU2C 2E60A 2LK2A 1BW5A 2O6GE 3MZ8A 4NBQA 1NTCA 2QF7A 3QWLA 4A6EA 4XN3A 4IPAA 5H6QA 4DGWB 3BG5A 3GTQJ 2CW0F 2HS5A 3DV8A 3ZN1A 2KISA 4RLFA 2E7WA 2RV8A 1BBYA 1SFOJ 4RAGA 1MNEA 3JAMZ 4EM1A 3K1NA 1GVDA 3VB2A 2IVMA 2H1KA 1KU7A 2B0LA 1HW5A 2LREA 3D5LA 2E2IJ 2O61A 2F6CA 4YG2F 2WAQN 3ZPLA 2HZTA 2V9KA 3IV5A 3TQNA 2KDOA 1D5YA 1YITI 2JJ7A 2Q8KA 5L3CA 5J1RA 1U8BA 1AKHA 1LDDA 4S0HB 3G1LA 1JGSA 3CTAA 1I5ZA 2ME0A 1AHDP 1I3AA 2EIJH 1GDTA 4OIRF 1I39A 2K02A 2QGUA 2X85A 2MYSA 3RTRA 3DEWA 4GYGA 4LIVA 1SAXA 2IS1A 3GWZA 5L3GA 1ETXA 4UUVA 2WY8Q 3CCQI 1FT9A 4XRSG 1VQMI 1FYKA 3BY6A 5ILSA 1IGNA 2Z99A 2VQGA 3LA2A 1AA7A 4RB1A 2L7KA 4XICA 3ZR8X 5ED4A 4A6DA 3P9KA 2UXNA 3MD2A 5IP7J 2H6BA 4C3JJ 2ZXIA 3ZQCA 2R5ZA 1ZR4A 3VDXA 4HYEA 5K1YA 2QKMB 1QVUA 1U5TC 3HG9A 3T0YA 3M07A 2HOAA 4CZCA 4M73A 3RKYA 3VWBA 1Z7UA 1X1DA 3GZ5A 1JI8A 3ZN0A 4A0XA 3KP5A 1UG2A 2K40A 3TL4X 3BJ6A 4AVPA 2DMNA 1UHMA 3ZGKA 3JTGA 2LKXA 3TP0A 3E5UA 1B72B 1YRNA 3ROUA 1FNNA 1W5SA 3BTJA 4F55A 4AD9A 5M3MJ 1ZH5A 4UV8A 1WKMA 3CCLI 1RKWA 3KETA 1MMDA 5GTIC 3KEQA 4BXUA 4P9FA 2R7OA 2L9RA 4OAZA 2Y0SA 4OMZA 4AU7A 3FBNB 3HOTA 1XS9A 2NVTJ 1OCCH 3GTOJ 1SD5A 3OR1C 2EFWA 1MBJA 1DGWY 5ERIA 1ZRCA 1LEAA 2IGOA 2XB5A 3HSFA 5BQTA 2CQ7A 4NC6A 4BJ5C 4IHWA 1D1CA 2ZJRF 2VLAA 2IGKA 4N4NB 1D8JA 1VF9A 3FXOA 3GW2A 2R0QC 1H88C 4MEXF 1HF0A 2PQ8A 5J1UA 3OS0A 2GIVA 4AIKA 3SEQA 5D6FA 3BG7A 5D5VB 2P5LC 5KK1A 1T0FA 2DQLA 2R7VA 4BQQA 2YR2A 1JKRC 1Z6RA 4O3MA 4B09A 5J47A 3G3ZA 2DTRA 2ZXHA 1R6RA 3BTCA 5F1RA 2WAEA 5A2QZ 1I50J 3VODA 1MH3A 4D7NA 1B8IB 5HLHA 4G94A 4QPQA 4J00A 3ML6A 5F64A 2X6YA 3WG7H 1RC9A 2PFBA 1SEUA 4HBLA 3A0BC 5EGOB 3O3KA 2VJ5A 3JRHA 2YPRA 1J5YA 1X1BA 1GXQA 1QPIA 3PM1A 2HQ5A 3F8NA 2E5NA 4XRSA 1BIBA 3T1BA 3TDUC 1TWFJ 2ADUA 5LFAA 4QTRA 2A5YB 2K5CA 2L9NA 1UHWA 3HHHA 3CCYA 1J0RA 2I5UA 4RA2A 1IUFA 2YS9A 2XF6A 2Z33A 2K4BA 4O5VA 3F72A 2PN6A 4DIQA 1IRGA 1XN7A 4CYDA 5E1ZB 4BBSJ 4Y17A 1J7KA 1EA3A 1XSXA 3VOEA 5L3EA 4RDUA 2VBZA 1AWCA 2XSDC 1FYMA 2XC7A 2WC2A 2IS6A 3FXRA 5AIPA 2EIKH 1GVJA 1W5CC 1Y8QB 5BPIA 5D6EA 3LQRA 3FF5A 2ECCA 4G6QA 5ILUA 3DEEA 2X1EA 1D0XA 2K9NA 2Y9YA 1TW2A 1V55H 1PUEE 2M7AA 4E7HA 3UNGC 3HOZJ 2VONA 2DJIA 3SZGA 3CUQA 1G59A 2H27A 3HOVJ 2E1NA 1H9GA 1WGXA 5GAEJ 1WJAA 3E6BA 2V6CA 1Z9CA 2MGQA 5FLXK 2M45A 3H9GA 1WPKA 3SFZA 1P7IA 2RQQA 1H0MA 1KONA 1JTYA 2AS5F 3L2QA 3IHUA 1SMYF 2YU3A 4QWQA 1XCBA 1ZLKA 1DP7P 2LR8A 3GF2A 5LHGA 5A2QK 2EFNA 4S04A 1WI9A 3CDHA 3BZ6A 4MO7A 3B73A 3G1MA 4EMSA 3OYBA 3DF8A 2EZLA 3VYSB 3OWTA 4C9YA 1WRJA 2JA2A 2CV1A 1HXDA 1YOVB 1T39A 3RJPA 4XRFA 3CP8A 3CMMA 3DPLC 3OYMA 4DOZA 2DO7A 3CDIA 4A5MA 2J5PA 4Y7NJ 1E3HA 1D0ZA 5EEAA 1SC7A 2KLOA 4U0YA 4B3AA 3J81Z 3HGYA 5C44J 1HDPA 2G9WA 4XNFA 2V1UA 2XPVA 2M34A 3GMEA 2DT6A 4Q47A 3OYHA 2JVHA 3QOEA 5FB2A 2JUCA 3RKQA 1GUUA 2QKLB 4LLLA 3ZXSA 5H20A 1VQ4I 3I59B 2E34A 2L01A 3QAHA 4XSXF 4B8XA 2QZ8A 2KFDA 4XLCA 3OYAA 3ZMTA 3W2AA 4KT5C 4E4HA 1S7OA 1G3TA 2NYXA 2DAOA 4L5JA 5LHIA 1FIPA 1XPXA 5C3EJ 1N25A 1JUSA 4KICA 3C18A 1Z1DA 1QHHD 2DFIA 2O0YA 4G9YA 2TCTA 3VFZA 3WG9A 1IXSB 3QU6A 3MZHA 1TWAJ 1WCMJ 5J8CA 1JJ8C 1TWGJ 3PO2J 4CCNA 2F5DA 2M8GX 4Y33A 4Y52J 1EH6A 3TOBA 2P5KA 4LG0B 3GUDA 3L2WA 1M1EB 3RYPA 3G4SI 1KYZA 2EWNA 2OAZA 4UY8I 2ID6A 3H3UA 5K5OA 2PJPA 3AG4H 4CH7A 2A69F 1ZELA 4LK0F 5CLSA 2R7FA 2DBBA 3AG2H 1B1BA 3F0CA 1NG7A 1EF4A 1Y0NA 1WWXA 2EV6A 3TDZC 1DU0A 5HLTA 2JT1A 2Y75A 2QLZA 3IP4B 1MDMB 3K4LA 4IOCF 1FY7A 3T8RA 4BE2A 4D1QA 4RM2A 1MNMC 2FMYA 1FC3A 4CZZA 1ETKA
chains in the Genus database with same CATH topology
4I6ZA 2M2EA 4AC0A 2JA5J 3OSGA 2XB0X 4DZJA 2FD5A 5F04A 3BR3A 2WV1A 4A3GJ 5M5YJ 5EZHA 1X2MA 4UUSA 4A3DJ 4FE4A 2XPUA 3JRCA 3S1NJ 5EYRA 1JT6A 3M4OJ 2NVXJ 5FKMA 1MBEA 3BR6A 4M3GA 3MKLA 5F08A 4M3FA 1OJLA 2LLKA 1ETOA 1RPWA 1WI3A 4JX6A 1P7JA 2DA1A 1MBKA 2GLOA 1ITYA 5FKLA 2Y0SN 3W6VA 2HXOA 5F27A 3B6CA 4G12A 3JRDA 1ORKA 1U9NA 5EG0B 2JWTA 3MN2A 4MLOA 4DYRA 2IEKA 3JRBA 2LD5A 1G2HA 3H0GJ 1XC5A 2EQRA 5GP9A 4A3LJ 2Y31A 4ABZA 5JLWA 5IYCJ 1MBGA 5E3MA 3JRFA 4B4CA 5BNGA 1MBHA 2MSYA 3NARA 3S15J 2KDZA 3HOWJ 2MG4A 1ETYA 1AU7A 5JLXA 3S17J 5GPAA 4FE7A 3A03A 4LOCA 1HDDC 5IPAA 2Y30A 5DTDA 2YU9J 5F1JA 4M6VA 5K7ZA 4C3HJ 1TWHJ 1ETQA 2HOSA 1LFBA 2LTPA 1LFUP 4CYCB 4I76A 4JX5A 2M0CA 4XRMA 1IDZA 1A5JA 4DZPA 2ELKA 2NVYJ 1B72A 2OF7A 4A3FJ 4IHYA 2D5VA 3LSRA 2XGDA 3BQZA 2R7ZJ 4L5EA 4GFBA 3BQYA 3ZQHA 1X2NA 4M3DA 4A3CJ 2B63J 4EEFG 1BA5A 3NAUA 3FISA 4AUXA 4C3IJ 2DMQA 3Q0UA 5FKKA 9ANTA 4UUTA 4D7MA 4QIWN 3LSPA 3UKGA 2R92J 2CQQA 4BXXJ 4RBOA 1T56A 1ZKGA 2NOGA 5F0FA 4HNVA 2X6OA 3OOUA 4B1RA 1HCRA 3S2HJ 2DA4A 4IHXA 2KT0A 2LK2A 1BW5A 1FJLA 2FJ1A 3FKIJ 3K2AA 2DJNA 2R5YB 3RZOJ 2IBDA 1NTCA 1XG1A 1RKTA 3LSJA 2QF7A 2VUMJ 4X1EA 2LFBA 3BG5A 3ZQIA 3GTQJ 1VI0A 4V2GA 2W48A 3ZQFA 1SFOJ 3RQIA 2M9HA 4UUSB 2L0KA 3OIOA 1B8IA 2JA7J 1GVDA 2H1KA 2TRTA 1Y1VJ 1IDYA 2E2IJ 2R93J 2N8GA 2DMTA 1BJZA 3LSGA 5FLVA 1K83J 2WAQN 4BBRJ 5EZGA 2K9QA 5EGOA 3IV5A 4JX4A 3OSFA 1D5YA 1UHSA 3K7AJ 2JJ7A 1U8BA 1AKHA 4S0HB 3G1LA 2ZB9A 3Q0WA 3IH3A 1WH5A 3TW7A 2HYJA 2ME0A 1OFCX 3B6AA 1AHDP 1GDTA 3CDLA 1Z0XA 1TWCJ 1H89C 5IYDJ 2JA6J 3HEFA 3M3YJ 2LY9A 5IP6A 3DEWA 2GM4A 3LNQA 1UMQA 1JUMA 2CJJA 4FTHA 3I4NJ 1ETXA 1BW6A 4A93J 2LP0A 4XRSG 1CQTA 5F0HA 2HDDA 4BY1J 3A01A 3MVPA 1IGNA 4A3MJ 2EBIA 3D1NI 3C2BA 4XICA 1OCPA 3RZDJ 4BY7J 4DYQA 2JMWA 3BR5A 4A3KJ 1U78A 1IC8A 2EZHA 3S1RJ 2EH3A 5IP7J 2DMPA 4C3JJ 3ZQCA 2R5ZA 3LOCA 1ZR4A 2E2JJ 3BG3A 2X9DA 5M5XJ 4IHVA 1VNDA 1QVUA 2K9SA 2GBYA 3GBGA 2HOAA 5IOZA 3L1PA 2QCOA 1ENHA 5C4XJ 2ID3A 1UG2A 2K40A 3BTIA 1Z77A 1JKPC 4DYCA 2DMNA 5F0CA 2MW8A 2LKXA 3TP0A 4D5CA 2XPWA 2DMUA 3QQAA 1B72B 1YRNA 1DU6A 4AYBN 1FEXA 3BTJA 4MFDA 5M3MJ 3JR9A 3GTJJ 1RKWA 3JRGA 3QPSA 1X58A 2L7ZA 5IOYA 1NK3P 3S1MJ 2L9RA 2NS7A 4W1UA 4MFEA 1XS9A 3BR0A 2EZIA 2NVTJ 3GTOJ 3HOYJ 4D5FA 1APLC 2O7OA 3S14J 1MBJA 2IAIA 3Q0VA 1T33A 3O8HA 2XB5A 1GV2A 5J3LA 3SFIA 1WH7A 2VPRA 4IHWA 1TC3C 2Y2ZA 5FLMJ 1VF9A 4MIMA 1HLVA 1ETVA 2R0QC 4V2FA 1H88C 3TP3A 5E3LA 1JTXA 4JYKA 1HF0A 5J1UA 3GTPJ 3GTMJ 3E7LA 1PUFA 4BKXA 1S7EA 5EDNA 3S2DJ 4XK4A 1H8AC 1RR7A 4M3BA 1JKRC 1LE8A 3IH4A 3WHCA 3BTCA 4FISA 3ZQLA 3ZQGA 2JA8J 1I50J 3Q3SA 2P81A 1MH3A 5FKOA 4D7NA 2PMZN 3BTLA 1B8IB 5IYBJ 2HXIA 2Y9ZA 3FK6A 1I6HJ 3JREA 1W0UA 3WHBA 1W0TA 2AO9A 2VI6A 3SJMA 2H8RA 2COBA 1MSFC 3FIWA 5EGOB 1U9OA 3JRHA 1QPIA 2YUSA 1AKHB 3PM1A 3CMYA 2HQ5A 3GTLJ 4XRSA 1ZR2A 3H3VK 4C2MJ 2HOTA 1FTZA 5FJ8J 1TWFJ 3JRIA 4QTRA 1ZK8A 4A3JJ 3CCYA 3FK7A 1IUFA 2VKVA 2YS9A 3BT9A 1IRZA 4A3EJ 1MH4A 2FX0A 5J1YA 4XIDA 2DA7A 4BBSJ 3I4MJ 2JK3A 4RDUA 3PO3J 4QSHA 2XSDC 3JRAA 2CUEA 2ECBA 2WB1N 3A01B 3ZOBA 1F36A 2O9LA 2E19A 1IV6A 5IP9J 2LVSA 3HKZN 2JN6A 2L7MP 1MSEC 1I3QJ 2AHQA 2DTZA 2ECCA 2CRGA 3IH2A 2R5ZB 1QRYA 2K9NA 2Y9YA 3HOZJ 1GT0C 2G0EA 1RETA 3HOVJ 1WGXA 4FCYA 2ME6A 2MGQA 3GTGJ 2DA6A 4IEJA 1RESA 1JGGA 3HOUJ 2FQ4A 1WPKA 1Y1WJ 1P7IA 1JTYA 2DN0A 5C4JJ 1SANA 1YRNB 2CU7A 3TEDA 3S16J 2I10A 2X48A 2E1OA 2LR8A 1BL0A 2L7FP 1FTTA 4DW6A 5EG0A 4MO7A 3HDDA 3G1MA 2EZLA 1JJ6C 2O8KA 5M3FJ 3G1OA 3BG9A 1ETWA 4Y7NJ 1VFCA 1Q1VA 5EEAA 1IJWC 2E2HJ 1F43A 3SDGA 4B3AA 3DCFA 3HGYA 5C44J 1HDPA 4A3IJ 2XPVA 2M34A 1JKQC 4X6AJ 3RKQA 1GUUA 2RAEA 3QPLA 2XRLA 2XGCA 2NS8A 1FIAA 1PUFB 4NDLA 3HM5A 1POGA 1R9TJ 2NVQJ 4A69C 1JT0A 1OCTC 2HI3A 3GTKJ 1HOMA 1IG7A 3VPRA 4CYCA 1A6IA 2EZKA 3BR1A 5HODA 1LE8B 3A02A 1NK2P 1JUPA 3HGGA 1ZQ3P 4J19A 1MBFA 1FIPA 5K7FA 5C3EJ 1JUSA 5M5WJ 2TCTA 1ZTRA 1JJ8C 2VKEA 1TWAJ 1WCMJ 5EF6A 1TWGJ 3PO2J 2CQXA 2M8GX 1E3OC 3O8GA 5K7HA 4Y52J 1GV5A 1ZGWA 4A3BJ 5E3OA 2CUFA 2DA5A 3HBLA 3TW6A 5GPCA 3BR2A 5E3NA 4W97A 1K61A 3S1QJ 2ID6A 2XGEA 3HB9A 5FKNA 4M3EA 1O4XA 2OPTA 2DA3A 4JP0A 3F0CA 2DA2A 1EF4A 3CQZJ 1DU0A 5DS9A 1QVTA 3HOXJ 1JKOC 2R5YA 1MNMC 5J1RA 1ETKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6Z A;  2M2E A;  4AC0 A;  2JA5 J;  3OSG A;  2XB0 X;  4DZJ A;  2FD5 A;  5F04 A;  3BR3 A;  2WV1 A;  4A3G J;  5M5Y J;  5EZH A;  1X2M A;  4UUS A;  4A3D J;  4FE4 A;  2XPU A;  3JRC A;  3S1N J;  5EYR A;  1JT6 A;  3M4O J;  2NVX J;  5FKM A;  1MBE A;  3BR6 A;  4M3G A;  3MKL A;  5F08 A;  4M3F A;  1OJL A;  2LLK A;  1ETO A;  1RPW A;  1WI3 A;  4JX6 A;  1P7J A;  2DA1 A;  1MBK A;  2GLO A;  1ITY A;  5FKL A;  2Y0S N;  3W6V A;  2HXO A;  5F27 A;  3B6C A;  4G12 A;  3JRD A;  1ORK A;  1U9N A;  5EG0 B;  2JWT A;  3MN2 A;  4MLO A;  4DYR A;  2IEK A;  3JRB A;  2LD5 A;  1G2H A;  3H0G J;  1XC5 A;  2EQR A;  5GP9 A;  4A3L J;  2Y31 A;  4ABZ A;  5JLW A;  5IYC J;  1MBG A;  5E3M A;  3JRF A;  4B4C A;  5BNG A;  1MBH A;  2MSY A;  3NAR A;  3S15 J;  2KDZ A;  3HOW J;  2MG4 A;  1ETY A;  1AU7 A;  5JLX A;  3S17 J;  5GPA A;  4FE7 A;  3A03 A;  4LOC A;  1HDD C;  5IPA A;  2Y30 A;  5DTD A;  2YU9 J;  5F1J A;  4M6V A;  5K7Z A;  4C3H J;  1TWH J;  1ETQ A;  2HOS A;  1LFB A;  2LTP A;  1LFU P;  4CYC B;  4I76 A;  4JX5 A;  2M0C A;  4XRM A;  1IDZ A;  1A5J A;  4DZP A;  2ELK A;  2NVY J;  1B72 A;  2OF7 A;  4A3F J;  4IHY A;  2D5V A;  3LSR A;  2XGD A;  3BQZ A;  2R7Z J;  4L5E A;  4GFB A;  3BQY A;  3ZQH A;  1X2N A;  4M3D A;  4A3C J;  2B63 J;  4EEF G;  1BA5 A;  3NAU A;  3FIS A;  4AUX A;  4C3I J;  2DMQ A;  3Q0U A;  5FKK A;  9ANT A;  4UUT A;  4D7M A;  4QIW N;  3LSP A;  3UKG A;  2R92 J;  2CQQ A;  4BXX J;  4RBO A;  1T56 A;  1ZKG A;  2NOG A;  5F0F A;  4HNV A;  2X6O A;  3OOU A;  4B1R A;  1HCR A;  3S2H J;  2DA4 A;  4IHX A;  2KT0 A;  2LK2 A;  1BW5 A;  1FJL A;  2FJ1 A;  3FKI J;  3K2A A;  2DJN A;  2R5Y B;  3RZO J;  2IBD A;  1NTC A;  1XG1 A;  1RKT A;  3LSJ A;  2QF7 A;  2VUM J;  4X1E A;  2LFB A;  3BG5 A;  3ZQI A;  3GTQ J;  1VI0 A;  4V2G A;  2W48 A;  3ZQF A;  1SFO J;  3RQI A;  2M9H A;  4UUS B;  2L0K A;  3OIO A;  1B8I A;  2JA7 J;  1GVD A;  2H1K A;  2TRT A;  1Y1V J;  1IDY A;  2E2I J;  2R93 J;  2N8G A;  2DMT A;  1BJZ A;  3LSG A;  5FLV A;  1K83 J;  2WAQ N;  4BBR J;  5EZG A;  2K9Q A;  5EGO A;  3IV5 A;  4JX4 A;  3OSF A;  1D5Y A;  1UHS A;  3K7A J;  2JJ7 A;  1U8B A;  1AKH A;  4S0H B;  3G1L A;  2ZB9 A;  3Q0W A;  3IH3 A;  1WH5 A;  3TW7 A;  2HYJ A;  2ME0 A;  1OFC X;  3B6A A;  1AHD P;  1GDT A;  3CDL A;  1Z0X A;  1TWC J;  1H89 C;  5IYD J;  2JA6 J;  3HEF A;  3M3Y J;  2LY9 A;  5IP6 A;  3DEW A;  2GM4 A;  3LNQ A;  1UMQ A;  1JUM A;  2CJJ A;  4FTH A;  3I4N J;  1ETX A;  1BW6 A;  4A93 J;  2LP0 A;  4XRS G;  1CQT A;  5F0H A;  2HDD A;  4BY1 J;  3A01 A;  3MVP A;  1IGN A;  4A3M J;  2EBI A;  3D1N I;  3C2B A;  4XIC A;  1OCP A;  3RZD J;  4BY7 J;  4DYQ A;  2JMW A;  3BR5 A;  4A3K J;  1U78 A;  1IC8 A;  2EZH A;  3S1R J;  2EH3 A;  5IP7 J;  2DMP A;  4C3J J;  3ZQC A;  2R5Z A;  3LOC A;  1ZR4 A;  2E2J J;  3BG3 A;  2X9D A;  5M5X J;  4IHV A;  1VND A;  1QVU A;  2K9S A;  2GBY A;  3GBG A;  2HOA A;  5IOZ A;  3L1P A;  2QCO A;  1ENH A;  5C4X J;  2ID3 A;  1UG2 A;  2K40 A;  3BTI A;  1Z77 A;  1JKP C;  4DYC A;  2DMN A;  5F0C A;  2MW8 A;  2LKX A;  3TP0 A;  4D5C A;  2XPW A;  2DMU A;  3QQA A;  1B72 B;  1YRN A;  1DU6 A;  4AYB N;  1FEX A;  3BTJ A;  4MFD A;  5M3M J;  3JR9 A;  3GTJ J;  1RKW A;  3JRG A;  3QPS A;  1X58 A;  2L7Z A;  5IOY A;  1NK3 P;  3S1M J;  2L9R A;  2NS7 A;  4W1U A;  4MFE A;  1XS9 A;  3BR0 A;  2EZI A;  2NVT J;  3GTO J;  3HOY J;  4D5F A;  1APL C;  2O7O A;  3S14 J;  1MBJ A;  2IAI A;  3Q0V A;  1T33 A;  3O8H A;  2XB5 A;  1GV2 A;  5J3L A;  3SFI A;  1WH7 A;  2VPR A;  4IHW A;  1TC3 C;  2Y2Z A;  5FLM J;  1VF9 A;  4MIM A;  1HLV A;  1ETV A;  2R0Q C;  4V2F A;  1H88 C;  3TP3 A;  5E3L A;  1JTX A;  4JYK A;  1HF0 A;  5J1U A;  3GTP J;  3GTM J;  3E7L A;  1PUF A;  4BKX A;  1S7E A;  5EDN A;  3S2D J;  4XK4 A;  1H8A C;  1RR7 A;  4M3B A;  1JKR C;  1LE8 A;  3IH4 A;  3WHC A;  3BTC A;  4FIS A;  3ZQL A;  3ZQG A;  2JA8 J;  1I50 J;  3Q3S A;  2P81 A;  1MH3 A;  5FKO A;  4D7N A;  2PMZ N;  3BTL A;  1B8I B;  5IYB J;  2HXI A;  2Y9Z A;  3FK6 A;  1I6H J;  3JRE A;  1W0U A;  3WHB A;  1W0T A;  2AO9 A;  2VI6 A;  3SJM A;  2H8R A;  2COB A;  1MSF C;  3FIW A;  5EGO B;  1U9O A;  3JRH A;  1QPI A;  2YUS A;  1AKH B;  3PM1 A;  3CMY A;  2HQ5 A;  3GTL J;  4XRS A;  1ZR2 A;  3H3V K;  4C2M J;  2HOT A;  1FTZ A;  5FJ8 J;  1TWF J;  3JRI A;  4QTR A;  1ZK8 A;  4A3J J;  3CCY A;  3FK7 A;  1IUF A;  2VKV A;  2YS9 A;  3BT9 A;  1IRZ A;  4A3E J;  1MH4 A;  2FX0 A;  5J1Y A;  4XID A;  2DA7 A;  4BBS J;  3I4M J;  2JK3 A;  4RDU A;  3PO3 J;  4QSH A;  2XSD C;  3JRA A;  2CUE A;  2ECB A;  2WB1 N;  3A01 B;  3ZOB A;  1F36 A;  2O9L A;  2E19 A;  1IV6 A;  5IP9 J;  2LVS A;  3HKZ N;  2JN6 A;  2L7M P;  1MSE C;  1I3Q J;  2AHQ A;  2DTZ A;  2ECC A;  2CRG A;  3IH2 A;  2R5Z B;  1QRY A;  2K9N A;  2Y9Y A;  3HOZ J;  1GT0 C;  2G0E A;  1RET A;  3HOV J;  1WGX A;  4FCY A;  2ME6 A;  2MGQ A;  3GTG J;  2DA6 A;  4IEJ A;  1RES A;  1JGG A;  3HOU J;  2FQ4 A;  1WPK A;  1Y1W J;  1P7I A;  1JTY A;  2DN0 A;  5C4J J;  1SAN A;  1YRN B;  2CU7 A;  3TED A;  3S16 J;  2I10 A;  2X48 A;  2E1O A;  2LR8 A;  1BL0 A;  2L7F P;  1FTT A;  4DW6 A;  5EG0 A;  4MO7 A;  3HDD A;  3G1M A;  2EZL A;  1JJ6 C;  2O8K A;  5M3F J;  3G1O A;  3BG9 A;  1ETW A;  4Y7N J;  1VFC A;  1Q1V A;  5EEA A;  1IJW C;  2E2H J;  1F43 A;  3SDG A;  4B3A A;  3DCF A;  3HGY A;  5C44 J;  1HDP A;  4A3I J;  2XPV A;  2M34 A;  1JKQ C;  4X6A J;  3RKQ A;  1GUU A;  2RAE A;  3QPL A;  2XRL A;  2XGC A;  2NS8 A;  1FIA A;  1PUF B;  4NDL A;  3HM5 A;  1POG A;  1R9T J;  2NVQ J;  4A69 C;  1JT0 A;  1OCT C;  2HI3 A;  3GTK J;  1HOM A;  1IG7 A;  3VPR A;  4CYC A;  1A6I A;  2EZK A;  3BR1 A;  5HOD A;  1LE8 B;  3A02 A;  1NK2 P;  1JUP A;  3HGG A;  1ZQ3 P;  4J19 A;  1MBF A;  1FIP A;  5K7F A;  5C3E J;  1JUS A;  5M5W J;  2TCT A;  1ZTR A;  1JJ8 C;  2VKE A;  1TWA J;  1WCM J;  5EF6 A;  1TWG J;  3PO2 J;  2CQX A;  2M8G X;  1E3O C;  3O8G A;  5K7H A;  4Y52 J;  1GV5 A;  1ZGW A;  4A3B J;  5E3O A;  2CUF A;  2DA5 A;  3HBL A;  3TW6 A;  5GPC A;  3BR2 A;  5E3N A;  4W97 A;  1K61 A;  3S1Q J;  2ID6 A;  2XGE A;  3HB9 A;  5FKN A;  4M3E A;  1O4X A;  2OPT A;  2DA3 A;  4JP0 A;  3F0C A;  2DA2 A;  1EF4 A;  3CQZ J;  1DU0 A;  5DS9 A;  1QVT A;  3HOX J;  1JKO C;  2R5Y A;  1MNM C;  5J1R A;  1ETK A; 
#chains in the Genus database with same CATH topology
 4I6Z A;  2M2E A;  1O3S A;  4KYW A;  3U9G A;  2XHK A;  1FBU A;  2R7U A;  5CKT A;  3WE3 A;  4DZJ A;  2FD5 A;  5F04 A;  3BOQ A;  5CJ9 A;  2RNJ A;  3KZZ A;  5EZH A;  5IY5 H;  2Q2E A;  4UUS A;  1LKX A;  3Q9V A;  2LF8 A;  3J81 K;  1VQ5 I;  1SVL A;  4FE4 A;  3L2C A;  3DEU A;  1OIS A;  2FNP A;  2RN7 A;  1EH7 A;  1R1T A;  4GO1 A;  2CGP A;  1JT6 A;  3PL8 A;  5FKM A;  2L9S A;  1WJB A;  2X4H A;  1HW2 A;  2JSP A;  2F2E A;  3M8F A;  3MKL A;  4BGD A;  2HYG D;  4EGZ A;  2WBM A;  1S5L C;  2GWR A;  2VQL A;  2VBX A;  5FRN A;  4I09 A;  2GLO A;  4ZYA A;  3QP6 A;  3MMY B;  1IN7 A;  1T38 A;  2Y0S N;  2FSW A;  2COM A;  3WGH A;  2HXO A;  3B6C A;  2JPB A;  1FP1 D;  4U7D A;  2IEK A;  3FXJ A;  2VXD A;  4NUB A;  5JHU A;  1G2H A;  3OYG A;  5DCM B;  4KMU X;  3MCZ A;  5BMZ A;  4OIQ F;  4A3L J;  1VQ6 I;  2ZSI B;  4U88 A;  2ZSH B;  3JRF A;  4B4C A;  2FQ3 A;  2OZ6 A;  2H8W A;  3CCR I;  4A0Y A;  1Y56 A;  2KDZ A;  1ETY A;  4UB6 C;  4KNY A;  1Q1H A;  5GPA A;  5IT3 A;  4M71 A;  2IPQ X;  3ECH A;  2ZNY A;  5DTD A;  4BDZ A;  5J40 A;  1YLF A;  3TGN A;  3CJR B;  3S3O A;  3LA7 A;  3CCV I;  5K7Z A;  1RUN A;  4IKF A;  1YE9 A;  1LFU P;  2GXA A;  4CYC B;  3ZQQ A;  2KRF A;  3GEZ A;  3KIO A;  3QYB A;  1TNT A;  1XDU A;  4UVC A;  1HKQ A;  5E8I A;  2ELK A;  1KQ8 A;  2O3F A;  2MA3 A;  1PP8 F;  4A3F J;  2STW A;  1UST A;  2HQN A;  3S8P A;  2D5V A;  2XGD A;  2VQC A;  1ZAR A;  1DPR A;  1Z67 A;  4NQW A;  3BQY A;  4EJW A;  1X2N A;  1YX5 A;  2VXZ A;  4A3C J;  3ECO A;  3DXJ F;  4EEF G;  4ZC3 A;  2LSO A;  5KVR A;  1IO2 A;  4AUX A;  2E35 A;  2R3S A;  3PNT A;  5TRD A;  2UUZ A;  2DMQ A;  9ANT A;  2IA1 A;  4KIB A;  4D7M A;  4QIW N;  3UKG A;  3LWF A;  1ZKG A;  5F0F A;  4HNV A;  2DA4 A;  4B47 A;  3M1C A;  3WOD F;  2KT0 A;  2OA4 A;  4A0Z A;  4BE0 A;  3WTZ A;  3VYU B;  4IZZ A;  1W1W E;  2RC4 A;  3U1K A;  2NOJ B;  1FJL A;  4KFC A;  4AIJ A;  2IP2 A;  2HYF A;  2IBD A;  1XG1 A;  3I64 A;  3RZO J;  1BM9 A;  3CC2 I;  2VUM J;  1TBX A;  1R22 A;  4R79 A;  2Z9O A;  3R60 A;  3ZQI A;  1VI0 A;  3OS2 A;  2OCC H;  3EUA A;  2DOD A;  3H36 A;  3OL4 A;  4V2G A;  3PJR A;  3DTI A;  4I0A A;  4BEH A;  2JPC A;  2HPI A;  3WU1 B;  2L0K A;  3PSF A;  1L3L A;  2FNA A;  1Y1V J;  3HRS A;  3DLA A;  4E7Z A;  2WTE A;  3KPH A;  3CF5 F;  3HC7 A;  3OOP A;  4BHB A;  1HQC A;  5BPD A;  2DI3 A;  5EZG A;  2K9Q A;  2UV1 A;  4EQQ A;  2FEZ A;  1I1S A;  5H2F C;  3OSF A;  4WXC A;  2LC2 A;  1TNS A;  5L3D A;  3SHF A;  2W24 A;  3LFU A;  1HST A;  2V26 A;  2H94 A;  2QVO A;  3IH3 A;  4HPQ A;  5E1W A;  2HYJ A;  4ZJZ A;  1OYY A;  5KAF C;  3B6A A;  4IF4 A;  3OYE A;  3CDL A;  3AG1 H;  2HQA A;  2JA6 J;  2VT3 A;  3CJQ B;  1A31 A;  3ABT A;  2LKP A;  3M3Y J;  1K4T A;  3LNQ A;  1QZY A;  1Y39 A;  3I4N J;  3EUH C;  1BW6 A;  4XLH A;  1QO0 D;  4HW0 A;  1OCR H;  3RPQ A;  3A01 A;  1KYW A;  5LGN A;  2EBI A;  3X2Q H;  3D1N I;  3V42 A;  3IKT A;  3C2B A;  5JR3 A;  3FHN A;  1OCP A;  3RZD J;  3BR5 A;  3RKX A;  3WGG A;  4LLG F;  1U78 A;  3S1R J;  2EH3 A;  2QBY B;  4PZJ A;  2DMP A;  3IRR A;  3SQN A;  3LOC A;  1D8K A;  2W7N A;  1IW7 F;  3BG3 A;  2Z1D A;  3FXM A;  3SEZ A;  2RGV A;  3LST A;  2GBY A;  1NHA A;  5IOZ A;  1TLH B;  3NRV A;  2MH9 A;  2XAQ A;  2XDV A;  4I0B A;  3OS1 A;  3FM5 A;  1JKP C;  2CH0 A;  1WJF A;  1B4A A;  2W85 A;  2PJR B;  4D5C A;  4BAC A;  2IS4 A;  2E1M B;  1SAU A;  5HDN A;  3RCO A;  1WVR A;  2P5V A;  1QPM A;  3GFJ A;  1U3E M;  3OYN A;  3HXL A;  2Y69 H;  5E8G A;  3FBI B;  4BL0 B;  1X58 A;  1WSU A;  2L7Z A;  3DU6 A;  2NS7 A;  5FRO A;  3OYL A;  4OWR B;  4EJT A;  4W1U A;  4EJO A;  2F48 A;  5K5Q A;  3BR0 A;  2EZI A;  2F5F A;  3ZQ7 A;  2IGN A;  1MZB A;  4ZYG A;  1RR8 C;  3Q0V A;  1T33 A;  2G7U A;  3O8H A;  4LK1 F;  4IRH A;  1G6N A;  2PX9 A;  1VQP I;  2A05 A;  2HVS A;  2ZXJ A;  4MIM A;  3FX3 A;  1ETV A;  4EGY A;  3TP3 A;  2MBF A;  3ZMD A;  2BV6 A;  2DOF A;  3A0H C;  4BH9 A;  1PUF A;  1SVO A;  3BCB A;  1LPQ A;  4BAY A;  4BKX A;  4FHT A;  3S2D J;  5E18 F;  2ELJ A;  2KMU A;  4N9I A;  2KRH A;  1H8A C;  4G7O F;  1R1U A;  2ISY A;  4GXO A;  2W4S A;  3COA C;  2LY1 A;  3DBR B;  4CCL A;  1RI7 A;  5AON A;  1LFP A;  3ZQL A;  2LRD A;  1WZ2 A;  5FKO A;  3CLQ A;  2PMZ N;  5IYB J;  2HXI A;  1OYW A;  2AQE A;  2ESN A;  3M8E A;  3WHB A;  2AO9 A;  2VI6 A;  3H3Z A;  4IRG A;  1H9T A;  1CF7 A;  3FIW A;  3TO6 A;  2Z5U A;  3S3N A;  1AKH B;  2HVQ A;  2HPM A;  1A04 A;  2M8E A;  3H3V K;  2L5Q A;  2ZNZ A;  3C2G A;  5LRS A;  3FKJ A;  3DWL E;  5FGM A;  5B3S H;  2BVM A;  5FJ8 J;  2CQN A;  4Y15 A;  2ZBK A;  1OR7 A;  5KHD A;  1ZK8 A;  2LMD A;  5B5E C;  3FK7 A;  4WWC A;  3BT9 A;  1QBJ A;  1IRZ A;  1FOY A;  3K4J A;  1D3Y A;  3N05 A;  4A3E J;  5J1Y A;  4XID A;  3PO3 J;  3ERM A;  1EH8 A;  3JRA A;  2CUE A;  2B9S A;  1V3F A;  3ZOB A;  1F36 A;  1G3S A;  2O9L A;  2JRT A;  2IT0 A;  5D5X B;  2DXI A;  2LVS A;  3G73 A;  3NEU A;  4GRI A;  3MKW B;  3IC7 A;  3DTE A;  2R5Z B;  1MW7 A;  3SZT A;  4YIF A;  2B7E A;  1OMI A;  2M1B A;  2VBY A;  4BHP A;  1GLN A;  2LF7 A;  3I58 A;  4HSR A;  1GT0 C;  1BR1 A;  4HLY A;  1ZRE A;  3W2W A;  1AOY A;  4EV0 A;  2ZJ2 A;  2ME6 A;  2HU9 A;  2L2O A;  3E6D A;  2ZC2 A;  2LY2 A;  4CCK A;  4GGG A;  3UR3 C;  4F7Z A;  5ICG A;  2V1D A;  4RGS A;  5TIS C;  5C4J J;  1YRN B;  2EA4 A;  4MTE A;  3S16 J;  2X48 A;  1BL0 A;  2J5O A;  2Z3Y A;  3MKY B;  1B9N A;  2E1M C;  3VYT B;  3HRU A;  3ZMV A;  1MD0 A;  1FYL A;  2XVC A;  1G3W A;  4HOB A;  4R1H A;  3JAM K;  3KLN A;  4IVN A;  3FXQ A;  3QOP A;  5M3F J;  1RNL A;  2L4M A;  3QRF F;  4ESF A;  1TQP A;  3G1O A;  1SFK A;  3R0A A;  3CCJ I;  4KIG A;  2I8D A;  2ZKZ A;  3BG9 A;  3HTU A;  4LFU A;  2KIM A;  4PK4 A;  4YFN F;  1ODD A;  1LEB A;  2PI0 A;  3CO6 C;  1IJW C;  2E36 A;  2E2H J;  2X51 A;  4KIS A;  2W1O A;  2MC3 A;  4OIO F;  1FX7 A;  1OYI A;  4CA0 A;  5KAI C;  3V4G A;  2VPL A;  1WHU A;  2GQQ A;  1JKQ C;  1XDS A;  4BJ6 C;  4BUP A;  4UV9 A;  2RAE A;  4PFO A;  2XRL A;  1I1G A;  1FIA A;  2NVQ J;  1V5G A;  1PYV A;  4A69 C;  1OCT C;  2HI3 A;  1LJ9 A;  1HOM A;  2MLK A;  1QZZ A;  3VPR A;  1FWZ A;  1A6I A;  5HOO A;  4WX9 A;  3G2B A;  4XM3 A;  3BR1 A;  2UZK A;  1KA8 A;  1R5H A;  3C1D A;  1JUP A;  2X6W A;  3I5U A;  3VSK A;  3IRQ A;  2VC0 A;  2DFE A;  3E97 A;  3WTX C;  1QQI A;  2BZT A;  5JVG F;  4XOT A;  1SD4 A;  1QZE A;  5D5W B;  4HF1 A;  1ZTR A;  3FXL A;  3H92 A;  3S93 A;  2VKE A;  1ONV A;  2W25 A;  4AYB A;  4KUM A;  4CXF A;  3V8K A;  2E71 A;  4RB2 C;  2K3P A;  2RVC A;  3WU0 A;  1E3O C;  3O8G A;  1EJ9 A;  1GV5 A;  2XUB A;  1BI3 A;  3KLO A;  1IUY A;  2DA5 A;  1YYV A;  4W97 A;  2VJI A;  2EIL H;  2XGE A;  3F6O A;  3HB9 A;  5CQE A;  5FKN A;  4MTD A;  1O4X A;  5CYV A;  3OMY A;  2DA3 A;  4JP0 A;  2DFF A;  3KCC A;  5D8L B;  1OKR A;  3CF2 A;  3IWF A;  4A2U A;  3BC8 A;  5DS9 A;  4XKB A;  4HF2 A;  3HOX J;  3KP4 A;  1JKO C;  1Y8R B;  3K1M A;  3WGI A;  1F5T A;  2R5Y A;  3GFM A;  1ZLJ A;  3AG3 H;  4M9Z A;  1DP3 A;  2KJC A;  1TT0 A;  5FD6 A;  3VEP A;  2O5R A;  1XSV A;  3BR3 A;  4RAF A;  4A3G J;  1G3Y A;  5M5Y J;  1X2M A;  4OIN F;  1TZL A;  3PIO F;  3LL7 A;  2XPU A;  2F4I A;  3S1N J;  1BI2 A;  4H4K C;  1SVM A;  3A1Y A;  4AIH A;  2LDU A;  1UAA A;  2PEX A;  4D0P A;  4B3X A;  5J8F A;  3CCM I;  3CUQ B;  4BQN A;  1MBE A;  2NVX J;  3M4O J;  3BR6 A;  2IGM A;  2Y0M A;  1W4M A;  4M3F A;  5F08 A;  2QEX I;  4HZF A;  2XRO A;  3J7Y J;  4LIU A;  5B1A H;  3GFI A;  1P7J A;  1MBK A;  2DDB A;  3R0J A;  2CQK A;  4RGR A;  3W6V A;  4I98 B;  5F27 A;  3JRD A;  4QLC U;  4XR6 A;  2P0W A;  3PNV A;  1U9N A;  1Z3Y A;  3GCM A;  3OIP A;  4ZYH A;  3I53 A;  4MLO A;  3QPH A;  4OOI A;  3BWG A;  4FAS D;  1O7F A;  3OYD A;  1YO5 C;  3OYJ A;  1K78 A;  2X1C A;  2IRF G;  2OTL I;  5HS9 A;  1E17 A;  3KP3 A;  4GDF A;  4EM2 A;  3BP8 A;  2XSJ C;  2Y31 A;  4ABZ A;  5IYC J;  1R5I D;  3GLX A;  1KU2 A;  3KYD B;  5BNG A;  2O8X A;  2VAS A;  4O6J A;  1MBH A;  3ABM H;  2MSY A;  1XD7 A;  4N9H A;  3S15 J;  2WB1 A;  3PFI A;  3K10 A;  3TMO A;  5FO5 A;  4CGZ A;  2OCE A;  2ZME A;  3HKZ A;  4Q4Z F;  5IPA A;  3ULQ B;  3K70 C;  4M6X A;  2Y30 A;  2KKO A;  4DQ2 A;  1DDN A;  4M6V A;  2OTJ I;  2OBP A;  4XQF A;  2EIN H;  1W36 C;  1ETQ A;  4ON0 A;  2LTP A;  2H1L A;  4I76 A;  5IT9 Z;  4BS9 A;  2M0C A;  2VT2 A;  2M7B A;  5DUI A;  5GTH C;  4KMF A;  1P2F A;  3QYF A;  1WJC A;  2A6E F;  1ULY A;  3DTK A;  4CSW A;  3I55 I;  2A6H F;  4G7Z F;  1O3T A;  3TO7 A;  2R4G A;  2FUG 2;  3K6G A;  3SXY A;  2ZJQ F;  5LD2 C;  3S2W A;  1K7A A;  4L5E A;  3LMM A;  4DBR A;  3ZQH A;  1UFM A;  2VQH A;  3C2H A;  1HKT A;  1RRJ A;  3WE2 A;  1F9N A;  2D1V A;  1BA5 A;  3F23 A;  3L2R A;  4C3I J;  2K85 A;  2QWW A;  1T2K A;  3DLL F;  3Q0U A;  4CCO A;  2Q0O A;  4E7J A;  4F3Q A;  2MD5 A;  3MKZ A;  2K7L A;  4E70 A;  2KIF A;  2AQF A;  4RBO A;  1T56 A;  3F8C A;  5CVV A;  2GIZ A;  2DLL A;  2NOG A;  1HKS A;  2PMU A;  4OAY A;  5ICE A;  5D4R A;  3BZK A;  2CW8 A;  1MGT A;  4B1R A;  2QA4 I;  2LG4 A;  2DDA A;  4PJJ A;  1LVK A;  2EFO A;  3DPU A;  1LQ1 A;  4IHX A;  1YIJ I;  1R5G A;  4L9N A;  2QQ8 A;  5AIQ A;  1FMW A;  2V1X A;  3FKI J;  1LDJ A;  2BHZ A;  3K2A A;  1NG6 A;  2VJJ A;  1S6L A;  2BY0 A;  1BJA A;  1EV7 A;  4XL9 A;  3CC7 I;  4LD5 A;  4X1E A;  4Q5S F;  3E3V A;  2OZU A;  2P6T A;  2CUJ A;  3K4C A;  3OY9 A;  3MZY A;  2MLG A;  2XAH A;  4BYY A;  2OC6 A;  4I01 A;  4HF0 A;  4AVZ A;  4XSZ F;  2HKX A;  3RQI A;  3IL2 A;  2M9H A;  3R6S A;  1I6X A;  2Q2E B;  4FX0 A;  4UUS B;  5D8K B;  4XBF A;  3H9Q A;  5ICC A;  3N4M A;  3U21 A;  2MFZ A;  1P9Q C;  2JQ7 A;  2G7H A;  3H5R A;  3FZV A;  2DMT A;  2VKH A;  3RYR A;  4UB8 C;  3LSG A;  5FLV A;  1K83 J;  4KIF A;  5DM6 F;  2WAD A;  4JX4 A;  1T08 B;  2KQR A;  2PMH A;  2FBI A;  1UHS A;  3K7A J;  1MMS A;  2DU9 A;  3DPT A;  5ICF A;  1X3U A;  3Q0W A;  4LMY A;  1LNW A;  4GYI A;  1OFC X;  1MJ9 A;  3ABU A;  3U2R A;  1MND A;  2MD0 A;  1Z0X A;  1H89 C;  2QYO A;  2NS0 A;  4JOM A;  3HEF A;  1Z91 A;  4HX8 A;  5IYD J;  1PJR A;  2HNH A;  2LY9 A;  4II3 A;  1D1A A;  5IP6 A;  2DW4 A;  3LSI A;  2DFH A;  2JUG A;  3HPG A;  1XX5 A;  1LUJ B;  1X3Z B;  2X0L A;  2P6S A;  5FFZ A;  4BY1 J;  3FHZ A;  3J80 Z;  4A3M J;  2QEN A;  3Q9S A;  4DYQ A;  2JMW A;  3JTH A;  4A3K J;  1IC8 A;  2EZH A;  3S32 A;  1U6G A;  3CJT B;  5HS8 A;  4P9U A;  3KEO A;  2CSO A;  4E7L A;  2VOD A;  3OIQ A;  3ISP A;  2NXN B;  1VND A;  2E5Z A;  3FMS A;  2K9S A;  3L00 A;  4MHG A;  3GBG A;  2JTV A;  3FXK A;  5C4X J;  3KZI C;  2BW3 B;  2ID3 A;  2KL4 A;  5HLG A;  1QHG A;  4X0G A;  4PJ0 C;  1Z77 A;  4YEL A;  4IHT A;  5F0C A;  2ISZ A;  2MW8 A;  4IJA A;  1MMA A;  3EUH A;  1YJ9 I;  2XPW A;  4FT8 A;  1DU6 A;  4AYB N;  1HSJ A;  2BW3 A;  1FEX A;  4MQ9 F;  3DKW A;  4MFD A;  2BEO A;  4FX4 A;  5GAD J;  3GTJ J;  4NQW B;  5L3F A;  1K79 A;  3WTW C;  2KPM A;  3QPS A;  3N97 A;  2WWY A;  2A3S A;  3HSR A;  2IS2 A;  1W7P D;  3QP5 A;  4KJZ A;  3GX4 X;  2HWV A;  2LBF A;  4MFE A;  3R61 A;  5DV5 A;  2D1H A;  2NAZ A;  2HKO A;  1LB2 A;  1APL C;  5CPR B;  2PLY A;  1UCR A;  1IN8 A;  2O7O A;  2IAI A;  4XLA A;  1P4A A;  3MAJ A;  3I0T A;  5J3L A;  2FF4 A;  4HAM A;  2VPR A;  3HJE A;  1U2W A;  2Y2Z A;  2YX4 A;  1XSD A;  3OYI A;  1F1Z A;  5FLM J;  4L9V A;  1B9M A;  1SFX A;  3F3X A;  2CWE A;  4NC7 A;  2PBI A;  1X1A A;  1IRX A;  1T8I A;  5E3L A;  2R7W A;  1JTX A;  2K4J A;  1O3R A;  3GTP J;  2BYV E;  3GTM J;  3DBL B;  1E3P A;  4PGG A;  4B43 A;  4U87 A;  2KZV A;  5CVR A;  3FDY A;  2W57 A;  4ZDP A;  1S7E A;  4OMY A;  4XK4 A;  4TV7 A;  4ETS A;  1FBQ A;  4M3B A;  1LE8 A;  1VQ7 I;  3IH4 A;  4BEH B;  1XGO A;  3WHC A;  3F21 A;  3V8L A;  4FIS A;  3S3M A;  4F52 A;  3Q3S A;  4E7I A;  4A12 A;  4QPO A;  3BCA A;  5E1X A;  2Y9Z A;  2EFQ A;  4G7H F;  1I6H J;  2Z2S B;  2HFH A;  2DOA A;  1W0T A;  4NHJ A;  5E20 A;  3SJM A;  2COB A;  4MGR A;  4HA8 A;  3OL3 A;  2XF5 A;  2YUS A;  4RB0 A;  3CMY A;  3GTL J;  1ZR2 A;  2F4M B;  2F5C A;  2OQG A;  4JBA A;  4ESB A;  5F6F A;  3D5R C;  3JRI A;  3K4K A;  3IAM 2;  2Y48 A;  5CQG A;  4CUG A;  1TW3 A;  1BC7 C;  4A3J J;  2EJR A;  3B02 A;  3PFY A;  5L3B A;  2VKV A;  1XMX A;  4RB3 C;  4HRI A;  2A61 A;  1V4R A;  3I3L A;  1ZG1 A;  2FX0 A;  1KQ9 A;  2DA7 A;  4ANJ A;  1ON1 A;  4I2O A;  3WTT C;  4QSH A;  3CD6 I;  5HNF A;  4CCM A;  2WB1 N;  3A01 B;  3CC4 I;  4ZZD A;  1Z05 A;  4IQ4 A;  2CV0 A;  1BN5 A;  2E19 A;  1IV6 A;  1YX3 A;  1USS A;  1OLT A;  3HKZ N;  3NWS A;  2JN6 A;  2ETH A;  3F8M A;  1MSE C;  1I3Q J;  4BU2 A;  2FML A;  2KHM A;  2AHQ A;  2DTZ A;  3K9T A;  1XB4 A;  3HTS B;  2OQR A;  3BG6 A;  2QQ9 A;  2FBH A;  2YSR A;  5KCM A;  1QRY A;  2GA1 A;  2W84 A;  4XMY A;  4M6Y A;  2G0E A;  4CCJ A;  5LRR A;  4DNC A;  2IJL A;  4FET A;  1J9I A;  3GTG J;  5LHH A;  2DA6 A;  1JGG A;  3AFH A;  5GAH J;  2QSF X;  3E5X A;  3V8J A;  4B48 A;  2STT A;  2DN0 A;  3T8T A;  2L9V A;  2CU7 A;  3TED A;  2NRA C;  1FPQ A;  3LQQ A;  4BQO A;  1ZGJ A;  2L7F P;  1TL8 A;  1JE8 A;  2QSG X;  1FTT A;  1P4X A;  3G6E I;  4RLQ A;  5EG0 A;  4WF2 A;  4AM3 A;  1SD7 A;  3HDD A;  3H0D A;  2BY3 A;  3L2V A;  2CFO A;  3HUG A;  2DYS H;  4NNJ A;  4CIC A;  4E7K A;  2V1N A;  2C6Y A;  5ILV A;  2XAJ A;  3ZP5 A;  1JXS A;  1Z7L A;  2VE9 A;  3ZMU A;  1S3J A;  3PQJ A;  2M0M A;  3PUF A;  1QU3 A;  1IN5 A;  2EFP A;  3K69 A;  1VFC A;  1GHC A;  1R23 A;  3I4P A;  1Z6T A;  2R7S A;  4BNC A;  2E7X A;  2ESH A;  3DCF A;  4Z6Y A;  4HX4 A;  3LAJ A;  5J4Y A;  1U5T A;  1N77 A;  1J09 A;  2BOL A;  1TQM A;  2XGC A;  4Y3O A;  1R4N B;  2NS8 A;  1PUF B;  4NDL A;  3HM5 A;  3K70 D;  1R9T J;  3GTK J;  1JHF A;  1JT0 A;  1IG7 A;  1W7P A;  4L9J A;  4C2T A;  1W36 D;  1FOW A;  4DBQ A;  1HBX G;  1UEL B;  4YII A;  5HOD A;  3A4C A;  2R7Q A;  5HNH A;  2VJ4 A;  1NK2 P;  4LG3 A;  3HGG A;  4M9X A;  2TDX A;  3ERE D;  3F22 A;  1P6R A;  2HEO A;  2XIG A;  3W6K B;  3LSK A;  2GAU A;  4PDK A;  2LOO A;  2BGC A;  2GOM A;  3KP6 A;  5M5W J;  2V9P A;  4EM0 B;  3OYF A;  3CZ6 A;  5EF6 A;  1K4S A;  1T6S A;  2FU4 A;  3QU3 A;  1WJE A;  4KIT B;  3CMA I;  2CQX A;  1CF7 B;  2LNB A;  1OCO H;  4YRV A;  1IN4 A;  4IL6 C;  5D5U B;  1PVE A;  4A3B J;  2CUF A;  3DU5 A;  3HBL A;  3KZY A;  3HRM A;  5FFX A;  5GPC A;  1YQA A;  2R7R A;  2HR3 A;  1K61 A;  3LA3 A;  3BJA A;  4II2 A;  2D2W A;  4JQF A;  3S1Q J;  1YFH A;  1X1P A;  1FSH A;  1XGN A;  1YS6 A;  4UNO A;  4M3E A;  2OPT A;  2VB6 A;  1IAW A;  4PCQ A;  4EJU A;  2DA2 A;  2GA2 A;  1S8N A;  4KN4 X;  3AKZ A;  2RKH A;  3GFL A;  2JSC A;  5JFR A;  2P7V B;  4XLP F;  3I71 A;  1B59 A;  1UG0 A;  1DPU A;  4PGH A;  3DKX A;  2UXX A;  5B66 C;  5LEK A;  2GOX B;  4XLE A;  4UHT A;  4U7B A;  2JA5 J;  1I27 A;  3OSG A;  2XB0 X;  2EK5 A;  2K3F A;  4E7S A;  4BDY A;  2WV1 A;  1D5V A;  1R1V A;  2A68 F;  5TJJ A;  1ZN2 A;  4IHS A;  4A3D J;  3ABK H;  4G6D A;  2FOK A;  1PDN C;  2OU2 A;  3FXU A;  5EYR A;  3JSP A;  1ZYR F;  1ZG5 A;  2KRC A;  4M3G A;  2XRN A;  2VKD A;  4L5I A;  3GO5 A;  2OUM A;  1ZRD A;  1OQY A;  3ESW B;  4F92 B;  2HZD A;  3OYC A;  4KA4 A;  1RPW A;  1J2X A;  1WI3 A;  4IRI A;  3E6C C;  3V7R A;  5GAG J;  3FWE A;  2P4W A;  1A35 A;  4FQG A;  1SFU A;  1B6A A;  3O6B B;  5JHF A;  3LSH A;  1BC8 C;  4CHU A;  1FMV A;  3RKW A;  4IOA F;  2XGX A;  3MN2 A;  4NC8 A;  1KZH A;  2NVU B;  2R7D A;  2EPF A;  4RMN A;  3JRB A;  5LEJ A;  1FSE A;  3H0G J;  2EQR A;  5GP9 A;  4B44 A;  2RDP A;  2WA0 A;  5JLW A;  1MBG A;  2OJE D;  5E3M A;  1KGS A;  4ZH4 F;  1YHQ I;  3RQ4 A;  3GXO A;  5D4S A;  3S17 J;  3GZN B;  5HS7 A;  4XKC A;  4FE7 A;  3E0J B;  1YW7 A;  3A03 A;  4HQM A;  3RPU D;  5DEQ A;  1HDD C;  1K6Y A;  4EAT A;  2YU9 J;  2EV0 A;  2XAU A;  1ERD A;  2VOP A;  2L3D A;  2OV7 A;  4C3H J;  1TWH J;  3GLL A;  4HNU A;  4PJM A;  2CG4 A;  1LFB A;  4NB5 A;  4RGX A;  2HOS A;  4IQJ A;  1QA6 A;  3ZRG A;  3EET A;  4JX5 A;  4XRM A;  4N4O B;  1IDZ A;  2RQP A;  3H9J A;  1A5J A;  4H0E A;  3PNY A;  2A5W A;  2NVY J;  3K4N A;  1B72 A;  2HTJ A;  4ZDL A;  1ZAO A;  1Z21 A;  3HRT A;  4IHY A;  2DK5 A;  1YG2 A;  4ZDO A;  5CVJ A;  4GFB A;  5DYM A;  2EA2 A;  1XTA A;  4XLF A;  2XAG A;  5B1B H;  3K1P A;  1P4W A;  4CO8 A;  3RI4 A;  2VE8 A;  3FMQ A;  5FKK A;  4HDU A;  4UUT A;  4YIR X;  3M1E A;  2R92 J;  4F93 B;  2CQQ A;  1FBS A;  1X4P A;  3I9V 2;  1LDK B;  4A5N A;  3WTS C;  2K27 A;  1OR7 C;  4HNT A;  1YS7 A;  4ENN A;  1YW9 A;  2HVR A;  2CFX A;  3W2V A;  3BZC A;  5FLX Z;  2FJ1 A;  2XAF A;  2DJN A;  4KN7 X;  3SDB A;  3FMR A;  3C3W A;  3SZP A;  4YFK F;  1RKT A;  2R5Y B;  1FOK A;  3LSJ A;  4L18 B;  3QOD A;  4V19 K;  2LFB A;  3HZJ A;  3Q5F A;  4WCG A;  3KX2 A;  4XKW A;  1YTY A;  2DCE A;  1FP2 A;  3R4K A;  4L0Y B;  4MNU A;  2W48 A;  4ENM A;  2GXB A;  4YEJ A;  3ZQF A;  3JW4 A;  1T98 A;  3J7Z I;  2W82 A;  2ACJ A;  3OIO A;  2GXG A;  3L7W A;  1B8I A;  2JA7 J;  4UXN A;  1V5E A;  1Y6I A;  4HST A;  2ZJP F;  2TRT A;  2KZG A;  2LH9 A;  5LLQ A;  3AL0 B;  3D0S A;  1IDY A;  3HIF A;  2R93 J;  2N8G A;  2OD5 A;  3DP7 A;  1BJZ A;  4HX7 A;  3RDI A;  1G4D A;  4BBR J;  2K86 A;  5EGO A;  1VQO I;  4WXH A;  4G8X A;  3E6M A;  4PSX A;  2V7F A;  1QGP A;  2ZB9 A;  1R58 A;  3TW7 A;  1IN6 A;  1WH5 A;  2JZY A;  1HA8 A;  3EUK L;  5DD4 A;  1BIA A;  1LVA A;  2XKP A;  4PJN A;  4ZYD A;  1TWC J;  1L0O C;  2M4G A;  2LYC A;  4HLX A;  2HDC A;  4MQV A;  4ENJ A;  2GM4 A;  1UMQ A;  1JUM A;  2FRH A;  2L02 A;  2CJJ A;  4FTH A;  5FRM A;  2ZFU A;  1VQ8 I;  4HV5 A;  2LKS A;  4N0B A;  4A93 J;  2KP6 A;  2VN2 A;  3HPH A;  2LP0 A;  1CQT A;  5F0H A;  2HDD A;  3JCU C;  3MVP A;  4HEA 2;  1K78 B;  3KEY A;  3ZCO A;  3FM3 A;  2O03 A;  1FLI A;  2KJB A;  5H6R A;  2DK8 A;  2RRE A;  4PUS A;  4BY7 J;  4PFP A;  3EDP A;  2AXT C;  4P55 A;  3NWT A;  1BOB A;  1IXR C;  3BLY A;  2V6E A;  2E2J J;  3TBI A;  1P92 A;  3LAP A;  2ZME B;  1WJD A;  2X9D A;  5M5X J;  4PSW A;  4J01 A;  4IHV A;  1ZHF A;  4D9J A;  5DM7 F;  1BR4 A;  3PQK A;  2DT5 A;  3MEX A;  2QQA A;  3L1P A;  2QCO A;  2CW7 A;  1ENH A;  4HQE A;  1A6Q A;  4RAZ A;  3BTI A;  1DQU A;  1YJW I;  3A2K A;  4DYC A;  3ONQ A;  3BPV A;  1E2X A;  5HLI A;  3GZ6 A;  5BS6 A;  2DMU A;  3QQA A;  5BOX A;  4L9T A;  1TQI A;  1FZP B;  2MH2 A;  1V54 H;  3JR9 A;  4I7H A;  1Z3X A;  2FA5 A;  2L4A A;  3J7A O;  1T0F C;  3JRG A;  1A36 A;  4EJV A;  1UB9 A;  4XLN F;  2M3A A;  5IOY A;  3S1M J;  1NK3 P;  3ELK A;  5CVU A;  2DPU A;  3RPU A;  3W3C A;  1WFX A;  1J59 A;  4D5F A;  2HQR A;  3HOY J;  4HG2 A;  3S14 J;  4XOR A;  3EYY A;  2F5V A;  1R7J A;  3P5J A;  1GV2 A;  4U0V A;  4IX7 A;  1BOA A;  1STZ A;  3SFI A;  1YJN I;  4LJZ F;  1WH7 A;  3WTY C;  1TC3 C;  1N78 A;  1DUX C;  1S9H A;  4CDG A;  1O57 A;  1F4K A;  2UWM A;  5KNL A;  1HLV A;  3RSN A;  4V2F A;  3REO A;  2GZW A;  2Z16 A;  2H09 A;  3LSM A;  4LGW A;  4JYK A;  4ZTF A;  2CYY A;  2ZCW A;  3E7L A;  1D1B A;  3I59 A;  2EV5 A;  1X4O A;  2BXY A;  5EDN A;  4M9S A;  1TT5 B;  3W6J B;  1RR7 A;  4XON A;  3TO9 A;  3P9I A;  4R8H A;  3ZQG A;  2JA8 J;  3CO7 C;  6PAX A;  1OPC A;  2P81 A;  2WV0 A;  3BTL A;  2IA2 A;  5LGU A;  2FOW A;  2NNN A;  3FK6 A;  4ZTJ A;  3QPT A;  1QNT A;  1XGS A;  3DBH B;  3JRE A;  1W0U A;  1ZGA A;  5EEG A;  5JI6 A;  2H8R A;  3AL0 C;  3V7C A;  1YI2 I;  1MSF C;  2JRM A;  2XV4 S;  1U9O A;  3DQV C;  3KE2 A;  3H5N A;  4I02 A;  4LG0 A;  3CCU I;  1S29 A;  4C30 A;  1U8R A;  1C0W A;  1RZ4 A;  4C2M J;  4AWX B;  1VQK I;  1DGR M;  2HOT A;  1ON2 A;  1FTZ A;  1VQ9 I;  3CUQ C;  4DJA A;  2DQR A;  4LLN A;  2VOO A;  1WJ5 A;  1IV8 A;  4ASN A;  5IT9 K;  2VC1 A;  5DUK A;  1YIO A;  2PG4 A;  3G71 I;  1MDM A;  1MH4 A;  1R36 A;  5LGT A;  3I4M J;  2VBW A;  2JK3 A;  2WY7 Q;  1FOX A;  2EIM H;  2K9M A;  2ECB A;  4BQA A;  5IP9 J;  1X19 A;  5DDG A;  2L7M P;  3ASO H;  5DD8 A;  4RGU A;  1VTN C;  3AAF A;  5JVT A;  3KP2 A;  2BY1 A;  2CRG A;  3IH2 A;  4M74 A;  4XOP A;  3L2U A;  1OCZ H;  1WQ2 A;  1HC8 A;  2PMZ A;  1YW8 A;  5EJC A;  3M9A A;  2CV2 A;  2BE5 F;  4P1W A;  3DFG A;  3KYL A;  2ZME C;  3ZMZ A;  1RET A;  1SD6 A;  4BE1 A;  2KIQ A;  5EEH A;  4FCY A;  1X3W B;  4ITV A;  4IEJ A;  1RES A;  3HOU J;  3O2P E;  2FQ4 A;  1Y1W J;  2WAQ A;  5DCF A;  3CME I;  1SAN A;  3P7N A;  1W5T A;  3CLO A;  2I10 A;  2E1O A;  2NNY A;  5K5R A;  3IUO A;  2D45 A;  2EB7 A;  2R7T A;  5FD5 A;  2BY2 A;  2ZO4 A;  4DW6 A;  2DOE A;  4XN0 A;  2CMP A;  2FE3 A;  1KU3 A;  3E1S A;  2V4J C;  3BPX A;  3EQL F;  3KYC B;  1JJ6 C;  2KIU A;  2RNG A;  1PP7 U;  2XKO A;  2O8K A;  2LBF B;  1MKM A;  5J4V A;  4L0Z B;  2X1D A;  2M5W A;  4C2U A;  5DCM A;  4F91 B;  3BDD A;  1VQL I;  1S7A A;  3EPZ A;  4YFX F;  1ETW A;  4M72 A;  1D0Y A;  4BJT A;  1Q1V A;  2BHY A;  3OR2 C;  1R4M B;  4BXF A;  3SDG A;  1F43 A;  2DT7 B;  2P7C B;  3KFW X;  4A3I J;  1IZ1 A;  3K2Z A;  2A6T A;  4RAY A;  4X6A J;  3QPL A;  4OU0 A;  1IRF A;  1POG A;  4S05 A;  2FXA A;  4AID A;  2AXL A;  2QUF A;  3D5S C;  2VIX A;  4CYC A;  2EZK A;  1IXC A;  1CGP A;  4KT6 A;  2ZXW H;  3CES A;  3HHG A;  1LE8 B;  2IXS A;  2Q1Z B;  2F5E A;  3A02 A;  1HW1 A;  3L9F A;  1ZQ3 P;  4J19 A;  1S72 I;  3J80 K;  1MBF A;  3T5X A;  2BXZ A;  5K7F A;  3HSE A;  3PIP F;  4IXA A;  2V79 A;  2HOE A;  1ZRF A;  3CP2 A;  2HGC A;  3IAS 2;  3K0L A;  1XMA A;  3K4B A;  1E0E A;  2H6C A;  5K7H A;  1JHH A;  1ZGW A;  5E3O A;  3TW6 A;  3MQ0 A;  3CJN A;  3BR2 A;  5E3N A;  3WTV C;  3ASN H;  1SFE A;  4LIT A;  4RS8 A;  3HOS A;  3PSI A;  4WXD A;  3CQZ J;  3H5A A;  4UVB A;  1QVT A;  1RUO A;  2W00 A;  5CVI A;  3WTU C;  2V9V A;  4E6K G;  2ICW G;  4WK8 F;  4P5O A;  3SYT A;  4MEY F;  4XKV A;  2E1C A;  2ZFW A;  3IWZ A;  3TOA A;  3E5Q A;  3RIR A;  4AC0 A;  4U0W A;  1BR2 A;  1TP4 A;  1VZ0 A;  3BJO A;  1MJB A;  1O7L A;  4ZZL A;  1X1C A;  2CUZ A;  1BI0 A;  1O3Q A;  1XMK A;  5E79 C;  4ZYE A;  1J75 A;  2IW5 A;  3JRC A;  3JSO A;  4ESJ A;  3VSL A;  1MIJ A;  3EYI A;  4EVI A;  2DPD A;  2MAB A;  2JVG A;  3ABL H;  3GVA A;  1MJA A;  2QQB A;  3CUO A;  1IF1 A;  2QM3 A;  3TKY A;  1OJL A;  2LLK A;  4HDV A;  1ETO A;  1EKE A;  2XAS A;  1BI1 A;  3F8B A;  3HL2 A;  3MWM A;  1T95 A;  3F8F A;  4Y13 A;  1REP C;  4JX6 A;  2DA1 A;  5HDG A;  1ITY A;  5FKL A;  3VYR B;  4BHC A;  4LB5 A;  4Y4R A;  2FBK A;  4GCV A;  4HV6 A;  4G12 A;  2R7X A;  1ORK A;  1ZG3 A;  5EG0 B;  2P8T A;  1VQN I;  2JWT A;  2CS3 A;  4DYR A;  2X6X A;  3HUG B;  3OV8 A;  2LD5 A;  5TGT A;  1XC5 A;  1SMT A;  2A07 F;  1KQ0 A;  3F6V A;  3CCS I;  2ELH A;  2IA0 A;  4K2E A;  3KP7 A;  2M87 A;  3NAR A;  2QBY A;  3CCE I;  3HOW J;  2MG4 A;  1AU7 A;  3M7G A;  5JLX A;  3MFK A;  3U1D A;  2L54 A;  1G8X A;  1UZC A;  2XF7 A;  1U5T B;  4LOC A;  1R49 A;  4JK1 X;  3NQO A;  2BVL A;  5F1J A;  1N75 A;  2WAF A;  1XCV A;  4Q48 A;  1ACI A;  4I99 C;  4UVA A;  1W7P B;  3LFK A;  3H1C A;  4Z2Y A;  2DYR H;  2M4K A;  3QYE A;  3OYK A;  2BBY A;  4LB6 B;  3F9K A;  5J6X A;  2PJR A;  1RIO H;  3DKY A;  1V5F A;  1Y0U A;  4DZP A;  2OF7 A;  1MMG A;  1NH3 A;  2M30 A;  3K4M A;  3ZMS A;  2F4O B;  2QSH X;  3J7A Y;  3LSR A;  1XGM A;  1UJ8 A;  3BQZ A;  3IKV A;  2R7Z J;  1TTY A;  4OIP F;  2HTS A;  5LBQ A;  1K6O A;  4M3D A;  3V7S A;  2B63 J;  2CO5 A;  2K9L A;  3NAU A;  3FIS A;  2YX7 A;  4PJL A;  5E17 F;  3H35 A;  1R00 A;  3I56 I;  3PUB A;  3L09 A;  4IO9 F;  3C7J A;  5HVQ C;  3P9C A;  4RM3 A;  3I54 A;  2VL8 A;  3LSP A;  3GYH X;  2MC4 A;  3BRO A;  2HDW A;  4BXX J;  1GXP A;  4P96 A;  5HDK A;  1U0J A;  3M8J A;  4G6T B;  3HYI A;  2X6O A;  3OOU A;  4ENK A;  1KU9 A;  1HCR A;  4KDP A;  1MMN A;  3S2H J;  1R71 A;  3WU2 C;  2E60 A;  2LK2 A;  1BW5 A;  2O6G E;  3MZ8 A;  4NBQ A;  1NTC A;  2QF7 A;  3QWL A;  4A6E A;  4XN3 A;  4IPA A;  5H6Q A;  4DGW B;  3BG5 A;  3GTQ J;  2CW0 F;  2HS5 A;  3DV8 A;  3ZN1 A;  2KIS A;  4RLF A;  2E7W A;  2RV8 A;  1BBY A;  1SFO J;  4RAG A;  1MNE A;  3JAM Z;  4EM1 A;  3K1N A;  1GVD A;  3VB2 A;  2IVM A;  2H1K A;  1KU7 A;  2B0L A;  1HW5 A;  2LRE A;  3D5L A;  2E2I J;  2O61 A;  2F6C A;  4YG2 F;  2WAQ N;  3ZPL A;  2HZT A;  2V9K A;  3IV5 A;  3TQN A;  2KDO A;  1D5Y A;  1YIT I;  2JJ7 A;  2Q8K A;  5L3C A;  5J1R A;  1U8B A;  1AKH A;  1LDD A;  4S0H B;  3G1L A;  1JGS A;  3CTA A;  1I5Z A;  2ME0 A;  1AHD P;  1I3A A;  2EIJ H;  1GDT A;  4OIR F;  1I39 A;  2K02 A;  2QGU A;  2X85 A;  2MYS A;  3RTR A;  3DEW A;  4GYG A;  4LIV A;  1SAX A;  2IS1 A;  3GWZ A;  5L3G A;  1ETX A;  4UUV A;  2WY8 Q;  3CCQ I;  1FT9 A;  4XRS G;  1VQM I;  1FYK A;  3BY6 A;  5ILS A;  1IGN A;  2Z99 A;  2VQG A;  3LA2 A;  1AA7 A;  4RB1 A;  2L7K A;  4XIC A;  3ZR8 X;  5ED4 A;  4A6D A;  3P9K A;  2UXN A;  3MD2 A;  5IP7 J;  2H6B A;  4C3J J;  2ZXI A;  3ZQC A;  2R5Z A;  1ZR4 A;  3VDX A;  4HYE A;  5K1Y A;  2QKM B;  1QVU A;  1U5T C;  3HG9 A;  3T0Y A;  3M07 A;  2HOA A;  4CZC A;  4M73 A;  3RKY A;  3VWB A;  1Z7U A;  1X1D A;  3GZ5 A;  1JI8 A;  3ZN0 A;  4A0X A;  3KP5 A;  1UG2 A;  2K40 A;  3TL4 X;  3BJ6 A;  4AVP A;  2DMN A;  1UHM A;  3ZGK A;  3JTG A;  2LKX A;  3TP0 A;  3E5U A;  1B72 B;  1YRN A;  3ROU A;  1FNN A;  1W5S A;  3BTJ A;  4F55 A;  4AD9 A;  5M3M J;  1ZH5 A;  4UV8 A;  1WKM A;  3CCL I;  1RKW A;  3KET A;  1MMD A;  5GTI C;  3KEQ A;  4BXU A;  4P9F A;  2R7O A;  2L9R A;  4OAZ A;  2Y0S A;  4OMZ A;  4AU7 A;  3FBN B;  3HOT A;  1XS9 A;  2NVT J;  1OCC H;  3GTO J;  1SD5 A;  3OR1 C;  2EFW A;  1MBJ A;  1DGW Y;  5ERI A;  1ZRC A;  1LEA A;  2IGO A;  2XB5 A;  3HSF A;  5BQT A;  2CQ7 A;  4NC6 A;  4BJ5 C;  4IHW A;  1D1C A;  2ZJR F;  2VLA A;  2IGK A;  4N4N B;  1D8J A;  1VF9 A;  3FXO A;  3GW2 A;  2R0Q C;  1H88 C;  4MEX F;  1HF0 A;  2PQ8 A;  5J1U A;  3OS0 A;  2GIV A;  4AIK A;  3SEQ A;  5D6F A;  3BG7 A;  5D5V B;  2P5L C;  5KK1 A;  1T0F A;  2DQL A;  2R7V A;  4BQQ A;  2YR2 A;  1JKR C;  1Z6R A;  4O3M A;  4B09 A;  5J47 A;  3G3Z A;  2DTR A;  2ZXH A;  1R6R A;  3BTC A;  5F1R A;  2WAE A;  5A2Q Z;  1I50 J;  3VOD A;  1MH3 A;  4D7N A;  1B8I B;  5HLH A;  4G94 A;  4QPQ A;  4J00 A;  3ML6 A;  5F64 A;  2X6Y A;  3WG7 H;  1RC9 A;  2PFB A;  1SEU A;  4HBL A;  3A0B C;  5EGO B;  3O3K A;  2VJ5 A;  3JRH A;  2YPR A;  1J5Y A;  1X1B A;  1GXQ A;  1QPI A;  3PM1 A;  2HQ5 A;  3F8N A;  2E5N A;  4XRS A;  1BIB A;  3T1B A;  3TDU C;  1TWF J;  2ADU A;  5LFA A;  4QTR A;  2A5Y B;  2K5C A;  2L9N A;  1UHW A;  3HHH A;  3CCY A;  1J0R A;  2I5U A;  4RA2 A;  1IUF A;  2YS9 A;  2XF6 A;  2Z33 A;  2K4B A;  4O5V A;  3F72 A;  2PN6 A;  4DIQ A;  1IRG A;  1XN7 A;  4CYD A;  5E1Z B;  4BBS J;  4Y17 A;  1J7K A;  1EA3 A;  1XSX A;  3VOE A;  5L3E A;  4RDU A;  2VBZ A;  1AWC A;  2XSD C;  1FYM A;  2XC7 A;  2WC2 A;  2IS6 A;  3FXR A;  5AIP A;  2EIK H;  1GVJ A;  1W5C C;  1Y8Q B;  5BPI A;  5D6E A;  3LQR A;  3FF5 A;  2ECC A;  4G6Q A;  5ILU A;  3DEE A;  2X1E A;  1D0X A;  2K9N A;  2Y9Y A;  1TW2 A;  1V55 H;  1PUE E;  2M7A A;  4E7H A;  3UNG C;  3HOZ J;  2VON A;  2DJI A;  3SZG A;  3CUQ A;  1G59 A;  2H27 A;  3HOV J;  2E1N A;  1H9G A;  1WGX A;  5GAE J;  1WJA A;  3E6B A;  2V6C A;  1Z9C A;  2MGQ A;  5FLX K;  2M45 A;  3H9G A;  1WPK A;  3SFZ A;  1P7I A;  2RQQ A;  1H0M A;  1KON A;  1JTY A;  2AS5 F;  3L2Q A;  3IHU A;  1SMY F;  2YU3 A;  4QWQ A;  1XCB A;  1ZLK A;  1DP7 P;  2LR8 A;  3GF2 A;  5LHG A;  5A2Q K;  2EFN A;  4S04 A;  1WI9 A;  3CDH A;  3BZ6 A;  4MO7 A;  3B73 A;  3G1M A;  4EMS A;  3OYB A;  3DF8 A;  2EZL A;  3VYS B;  3OWT A;  4C9Y A;  1WRJ A;  2JA2 A;  2CV1 A;  1HXD A;  1YOV B;  1T39 A;  3RJP A;  4XRF A;  3CP8 A;  3CMM A;  3DPL C;  3OYM A;  4DOZ A;  2DO7 A;  3CDI A;  4A5M A;  2J5P A;  4Y7N J;  1E3H A;  1D0Z A;  5EEA A;  1SC7 A;  2KLO A;  4U0Y A;  4B3A A;  3J81 Z;  3HGY A;  5C44 J;  1HDP A;  2G9W A;  4XNF A;  2V1U A;  2XPV A;  2M34 A;  3GME A;  2DT6 A;  4Q47 A;  3OYH A;  2JVH A;  3QOE A;  5FB2 A;  2JUC A;  3RKQ A;  1GUU A;  2QKL B;  4LLL A;  3ZXS A;  5H20 A;  1VQ4 I;  3I59 B;  2E34 A;  2L01 A;  3QAH A;  4XSX F;  4B8X A;  2QZ8 A;  2KFD A;  4XLC A;  3OYA A;  3ZMT A;  3W2A A;  4KT5 C;  4E4H A;  1S7O A;  1G3T A;  2NYX A;  2DAO A;  4L5J A;  5LHI A;  1FIP A;  1XPX A;  5C3E J;  1N25 A;  1JUS A;  4KIC A;  3C18 A;  1Z1D A;  1QHH D;  2DFI A;  2O0Y A;  4G9Y A;  2TCT A;  3VFZ A;  3WG9 A;  1IXS B;  3QU6 A;  3MZH A;  1TWA J;  1WCM J;  5J8C A;  1JJ8 C;  1TWG J;  3PO2 J;  4CCN A;  2F5D A;  2M8G X;  4Y33 A;  4Y52 J;  1EH6 A;  3TOB A;  2P5K A;  4LG0 B;  3GUD A;  3L2W A;  1M1E B;  3RYP A;  3G4S I;  1KYZ A;  2EWN A;  2OAZ A;  4UY8 I;  2ID6 A;  3H3U A;  5K5O A;  2PJP A;  3AG4 H;  4CH7 A;  2A69 F;  1ZEL A;  4LK0 F;  5CLS A;  2R7F A;  2DBB A;  3AG2 H;  1B1B A;  3F0C A;  1NG7 A;  1EF4 A;  1Y0N A;  1WWX A;  2EV6 A;  3TDZ C;  1DU0 A;  5HLT A;  2JT1 A;  2Y75 A;  2QLZ A;  3IP4 B;  1MDM B;  3K4L A;  4IOC F;  1FY7 A;  3T8R A;  4BE2 A;  4D1Q A;  4RM2 A;  1MNM C;  2FMY A;  1FC3 A;  4CZZ A;  1ETK A; 
#chains in the Genus database with same CATH homology
 4I6Z A;  2M2E A;  4AC0 A;  2JA5 J;  3OSG A;  2XB0 X;  4DZJ A;  2FD5 A;  5F04 A;  3BR3 A;  2WV1 A;  4A3G J;  5M5Y J;  5EZH A;  1X2M A;  4UUS A;  4A3D J;  4FE4 A;  2XPU A;  3JRC A;  3S1N J;  5EYR A;  1JT6 A;  3M4O J;  2NVX J;  5FKM A;  1MBE A;  3BR6 A;  4M3G A;  3MKL A;  5F08 A;  4M3F A;  1OJL A;  2LLK A;  1ETO A;  1RPW A;  1WI3 A;  4JX6 A;  1P7J A;  2DA1 A;  1MBK A;  2GLO A;  1ITY A;  5FKL A;  2Y0S N;  3W6V A;  2HXO A;  5F27 A;  3B6C A;  4G12 A;  3JRD A;  1ORK A;  1U9N A;  5EG0 B;  2JWT A;  3MN2 A;  4MLO A;  4DYR A;  2IEK A;  3JRB A;  2LD5 A;  1G2H A;  3H0G J;  1XC5 A;  2EQR A;  5GP9 A;  4A3L J;  2Y31 A;  4ABZ A;  5JLW A;  5IYC J;  1MBG A;  5E3M A;  3JRF A;  4B4C A;  5BNG A;  1MBH A;  2MSY A;  3NAR A;  3S15 J;  2KDZ A;  3HOW J;  2MG4 A;  1ETY A;  1AU7 A;  5JLX A;  3S17 J;  5GPA A;  4FE7 A;  3A03 A;  4LOC A;  1HDD C;  5IPA A;  2Y30 A;  5DTD A;  2YU9 J;  5F1J A;  4M6V A;  5K7Z A;  4C3H J;  1TWH J;  1ETQ A;  2HOS A;  1LFB A;  2LTP A;  1LFU P;  4CYC B;  4I76 A;  4JX5 A;  2M0C A;  4XRM A;  1IDZ A;  1A5J A;  4DZP A;  2ELK A;  2NVY J;  1B72 A;  2OF7 A;  4A3F J;  4IHY A;  2D5V A;  3LSR A;  2XGD A;  3BQZ A;  2R7Z J;  4L5E A;  4GFB A;  3BQY A;  3ZQH A;  1X2N A;  4M3D A;  4A3C J;  2B63 J;  4EEF G;  1BA5 A;  3NAU A;  3FIS A;  4AUX A;  4C3I J;  2DMQ A;  3Q0U A;  5FKK A;  9ANT A;  4UUT A;  4D7M A;  4QIW N;  3LSP A;  3UKG A;  2R92 J;  2CQQ A;  4BXX J;  4RBO A;  1T56 A;  1ZKG A;  2NOG A;  5F0F A;  4HNV A;  2X6O A;  3OOU A;  4B1R A;  1HCR A;  3S2H J;  2DA4 A;  4IHX A;  2KT0 A;  2LK2 A;  1BW5 A;  1FJL A;  2FJ1 A;  3FKI J;  3K2A A;  2DJN A;  2R5Y B;  3RZO J;  2IBD A;  1NTC A;  1XG1 A;  1RKT A;  3LSJ A;  2QF7 A;  2VUM J;  4X1E A;  2LFB A;  3BG5 A;  3ZQI A;  3GTQ J;  1VI0 A;  4V2G A;  2W48 A;  3ZQF A;  1SFO J;  3RQI A;  2M9H A;  4UUS B;  2L0K A;  3OIO A;  1B8I A;  2JA7 J;  1GVD A;  2H1K A;  2TRT A;  1Y1V J;  1IDY A;  2E2I J;  2R93 J;  2N8G A;  2DMT A;  1BJZ A;  3LSG A;  5FLV A;  1K83 J;  2WAQ N;  4BBR J;  5EZG A;  2K9Q A;  5EGO A;  3IV5 A;  4JX4 A;  3OSF A;  1D5Y A;  1UHS A;  3K7A J;  2JJ7 A;  1U8B A;  1AKH A;  4S0H B;  3G1L A;  2ZB9 A;  3Q0W A;  3IH3 A;  1WH5 A;  3TW7 A;  2HYJ A;  2ME0 A;  1OFC X;  3B6A A;  1AHD P;  1GDT A;  3CDL A;  1Z0X A;  1TWC J;  1H89 C;  5IYD J;  2JA6 J;  3HEF A;  3M3Y J;  2LY9 A;  5IP6 A;  3DEW A;  2GM4 A;  3LNQ A;  1UMQ A;  1JUM A;  2CJJ A;  4FTH A;  3I4N J;  1ETX A;  1BW6 A;  4A93 J;  2LP0 A;  4XRS G;  1CQT A;  5F0H A;  2HDD A;  4BY1 J;  3A01 A;  3MVP A;  1IGN A;  4A3M J;  2EBI A;  3D1N I;  3C2B A;  4XIC A;  1OCP A;  3RZD J;  4BY7 J;  4DYQ A;  2JMW A;  3BR5 A;  4A3K J;  1U78 A;  1IC8 A;  2EZH A;  3S1R J;  2EH3 A;  5IP7 J;  2DMP A;  4C3J J;  3ZQC A;  2R5Z A;  3LOC A;  1ZR4 A;  2E2J J;  3BG3 A;  2X9D A;  5M5X J;  4IHV A;  1VND A;  1QVU A;  2K9S A;  2GBY A;  3GBG A;  2HOA A;  5IOZ A;  3L1P A;  2QCO A;  1ENH A;  5C4X J;  2ID3 A;  1UG2 A;  2K40 A;  3BTI A;  1Z77 A;  1JKP C;  4DYC A;  2DMN A;  5F0C A;  2MW8 A;  2LKX A;  3TP0 A;  4D5C A;  2XPW A;  2DMU A;  3QQA A;  1B72 B;  1YRN A;  1DU6 A;  4AYB N;  1FEX A;  3BTJ A;  4MFD A;  5M3M J;  3JR9 A;  3GTJ J;  1RKW A;  3JRG A;  3QPS A;  1X58 A;  2L7Z A;  5IOY A;  1NK3 P;  3S1M J;  2L9R A;  2NS7 A;  4W1U A;  4MFE A;  1XS9 A;  3BR0 A;  2EZI A;  2NVT J;  3GTO J;  3HOY J;  4D5F A;  1APL C;  2O7O A;  3S14 J;  1MBJ A;  2IAI A;  3Q0V A;  1T33 A;  3O8H A;  2XB5 A;  1GV2 A;  5J3L A;  3SFI A;  1WH7 A;  2VPR A;  4IHW A;  1TC3 C;  2Y2Z A;  5FLM J;  1VF9 A;  4MIM A;  1HLV A;  1ETV A;  2R0Q C;  4V2F A;  1H88 C;  3TP3 A;  5E3L A;  1JTX A;  4JYK A;  1HF0 A;  5J1U A;  3GTP J;  3GTM J;  3E7L A;  1PUF A;  4BKX A;  1S7E A;  5EDN A;  3S2D J;  4XK4 A;  1H8A C;  1RR7 A;  4M3B A;  1JKR C;  1LE8 A;  3IH4 A;  3WHC A;  3BTC A;  4FIS A;  3ZQL A;  3ZQG A;  2JA8 J;  1I50 J;  3Q3S A;  2P81 A;  1MH3 A;  5FKO A;  4D7N A;  2PMZ N;  3BTL A;  1B8I B;  5IYB J;  2HXI A;  2Y9Z A;  3FK6 A;  1I6H J;  3JRE A;  1W0U A;  3WHB A;  1W0T A;  2AO9 A;  2VI6 A;  3SJM A;  2H8R A;  2COB A;  1MSF C;  3FIW A;  5EGO B;  1U9O A;  3JRH A;  1QPI A;  2YUS A;  1AKH B;  3PM1 A;  3CMY A;  2HQ5 A;  3GTL J;  4XRS A;  1ZR2 A;  3H3V K;  4C2M J;  2HOT A;  1FTZ A;  5FJ8 J;  1TWF J;  3JRI A;  4QTR A;  1ZK8 A;  4A3J J;  3CCY A;  3FK7 A;  1IUF A;  2VKV A;  2YS9 A;  3BT9 A;  1IRZ A;  4A3E J;  1MH4 A;  2FX0 A;  5J1Y A;  4XID A;  2DA7 A;  4BBS J;  3I4M J;  2JK3 A;  4RDU A;  3PO3 J;  4QSH A;  2XSD C;  3JRA A;  2CUE A;  2ECB A;  2WB1 N;  3A01 B;  3ZOB A;  1F36 A;  2O9L A;  2E19 A;  1IV6 A;  5IP9 J;  2LVS A;  3HKZ N;  2JN6 A;  2L7M P;  1MSE C;  1I3Q J;  2AHQ A;  2DTZ A;  2ECC A;  2CRG A;  3IH2 A;  2R5Z B;  1QRY A;  2K9N A;  2Y9Y A;  3HOZ J;  1GT0 C;  2G0E A;  1RET A;  3HOV J;  1WGX A;  4FCY A;  2ME6 A;  2MGQ A;  3GTG J;  2DA6 A;  4IEJ A;  1RES A;  1JGG A;  3HOU J;  2FQ4 A;  1WPK A;  1Y1W J;  1P7I A;  1JTY A;  2DN0 A;  5C4J J;  1SAN A;  1YRN B;  2CU7 A;  3TED A;  3S16 J;  2I10 A;  2X48 A;  2E1O A;  2LR8 A;  1BL0 A;  2L7F P;  1FTT A;  4DW6 A;  5EG0 A;  4MO7 A;  3HDD A;  3G1M A;  2EZL A;  1JJ6 C;  2O8K A;  5M3F J;  3G1O A;  3BG9 A;  1ETW A;  4Y7N J;  1VFC A;  1Q1V A;  5EEA A;  1IJW C;  2E2H J;  1F43 A;  3SDG A;  4B3A A;  3DCF A;  3HGY A;  5C44 J;  1HDP A;  4A3I J;  2XPV A;  2M34 A;  1JKQ C;  4X6A J;  3RKQ A;  1GUU A;  2RAE A;  3QPL A;  2XRL A;  2XGC A;  2NS8 A;  1FIA A;  1PUF B;  4NDL A;  3HM5 A;  1POG A;  1R9T J;  2NVQ J;  4A69 C;  1JT0 A;  1OCT C;  2HI3 A;  3GTK J;  1HOM A;  1IG7 A;  3VPR A;  4CYC A;  1A6I A;  2EZK A;  3BR1 A;  5HOD A;  1LE8 B;  3A02 A;  1NK2 P;  1JUP A;  3HGG A;  1ZQ3 P;  4J19 A;  1MBF A;  1FIP A;  5K7F A;  5C3E J;  1JUS A;  5M5W J;  2TCT A;  1ZTR A;  1JJ8 C;  2VKE A;  1TWA J;  1WCM J;  5EF6 A;  1TWG J;  3PO2 J;  2CQX A;  2M8G X;  1E3O C;  3O8G A;  5K7H A;  4Y52 J;  1GV5 A;  1ZGW A;  4A3B J;  5E3O A;  2CUF A;  2DA5 A;  3HBL A;  3TW6 A;  5GPC A;  3BR2 A;  5E3N A;  4W97 A;  1K61 A;  3S1Q J;  2ID6 A;  2XGE A;  3HB9 A;  5FKN A;  4M3E A;  1O4X A;  2OPT A;  2DA3 A;  4JP0 A;  3F0C A;  2DA2 A;  1EF4 A;  3CQZ J;  1DU0 A;  5DS9 A;  1QVT A;  3HOX J;  1JKO C;  2R5Y A;  1MNM C;  5J1R A;  1ETK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...