4IEJA

Crystal structure of a dna methyltransferase 1 associated protein 1 (dmap1) from homo sapiens at 1.45 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
VQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA methyltransferase 1-associated protein 1
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16282 SANT_DAMP1_like SANT/Myb-like domain of DAMP1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4iejA00
1W0TA 1BJZA 5BNGA 1NK2P 4C3HJ 1IV6A 2GLOA 3ZQIA 5F0CA 2JA5J 3GTGJ 2NOGA 2R5YB 2EZLA 2MG4A 1B8IB 1B8IA 3BR1A 3IH3A 1I50J 2FJ1A 4DZPA 1P7IA 3ZQLA 5IOYA 5C44J 1UG2A 2CUFA 3RZDJ 2O7OA 2CUEA 1JTXA 1TWCJ 4M3BA 1T56A 1WI3A 1RETA 3S16J 2GBYA 2RAEA 2HOAA 1DU0A 4ABZA 3HOZJ 2W48A 4CYCB 4CYCA 3GTKJ 3HEFA 5IYDJ 2VKVA 1JKPC 1IDYA 2R93J 5EYRA 3BR5A 1ZR4A 2WV1A 5FKMA 3RQIA 4J19A 3E7LA 4QTRA 3Q3SA 1Q1VA 3CDLA 2CQQA 2VPRA 3LSJA 2HXIA 4JX5A 1UMQA 4HNVA 2Y30A 1JKOC 3GTOJ 1GUUA 1FIAA 4IHXA 4FE4A 1Z77A 2XGCA 1RPWA 4UUSB 4UUSA 2E2HJ 2LLKA 2JA7J 1FJLA 1IUFA 4M3FA 3HOXJ 1HLVA 3IV5A 1MSFC 2HYJA 1K83J 3K7AJ 1YRNB 1YRNA 1MBEA 2NVTJ 4B4CA 2CRGA 4I76A 5M5WJ 2VUMJ 3WHCA 4EEFG 4IEJA 2KDZA 5K7FA 3OIOA 2HOTA 2FQ4A 3S1MJ 1BL0A 3ZQHA 4A93J 1Y1VJ 4MFEA 2L7FP 3C2BA 1XS9A 4JP0A 1BW5A 3NAUA 4FCYA 2L7ZA 3GBGA 3JRCA 2N8GA 3S14J 4C3IJ 1G2HA 3HKZN 3SFIA 1MBJA 3BQZA 5FLMJ 1FTTA 3G1MA 1HCRA 3BQYA 5EZGA 1B72B 4A69C 1B72A 2OPTA 1IC8A 1MNMC 4IHVA 5C3EJ 3TW6A 3G1LA 3IH4A 3DEWA 1POGA 3MN2A 2YS9A 1MH3A 2DA5A 5E3OA 3S15J 3OSFA 1BA5A 3JRBA 3HOVJ 2DA1A 4RDUA 5DS9A 3CMYA 3B6CA 1OJLA 1RESA 4A3CJ 2HDDA 4DYQA 3LNQA 2O8KA 9ANTA 3I4MJ 3UKGA 3S1QJ 3GTQJ 1JKRC 1ZR2A 3NARA 4JX6A 4A3LJ 4M3EA 2X6OA 3FKIJ 4X1EA 2COBA 4D7NA 3PO3J 1CQTA 2HI3A 2XB0X 2LVSA 2ECCA 1XG1A 2FX0A 4IHYA 3ZOBA 3TP0A 1MBKA 2LR8A 1QVUA 1IJWC 5C4JJ 4M3DA 1ORKA 3S1RJ 1A6IA 1XC5A 3HOYJ 2K40A 1AHDP 2JA6J 4A3BJ 5J1YA 1W0UA 3GTLJ 1JT6A 4XK4A 1X2NA 2XGDA 2XGEA 3JRDA 1U9NA 2OF7A 2LKXA 1F36A 5FKLA 5HODA 1RR7A 5FKNA 1NK3P 3LSRA 3SJMA 1RKWA 2HQ5A 2M8GX 2EZKA 2YU9J 1ETWA 3O8HA 3BG5A 5EZHA 3CQZJ 2FD5A 4D7MA 4DW6A 3LSGA 1ZK8A 5FKKA 3RZOJ 4MFDA 3HGYA 3PO2J 2Y2ZA 1IGNA 2ID6A 4B1RA 4NDLA 5F04A 5IOZA 1WGXA 2DMUA 5K7HA 2TCTA 2EBIA 1TWFJ 2R7ZJ 2DA3A 3A02A 2WB1N 5FJ8J 5EEAA 3TEDA 1ETVA 1HDDC 4BBRJ 5GPCA 3HBLA 1JTYA 2JA8J 5F08A 5IP6A 4S0HB 1TC3C 4MO7A 5JLWA 4V2GA 3VPRA 3JREA 3BTIA 5C4XJ 5E3NA 2G0EA 2M0CA 1LFBA 4FE7A 4G12A 3Q0VA 5M5XJ 2L9RA 3MVPA 1IDZA 3HOWJ 1MSEC 4BXXJ 2Y0SN 3BR6A 2M2EA 4XRSA 2Y31A 1JUSA 2XPWA 3DCFA 4A3DJ 3BTCA 1VI0A 3JRHA 2JK3A 3A03A 3S2DJ 2M34A 5F0HA 1APLC 1T33A 3BR2A 1U9OA 4W97A 4A3GJ 1ETOA 2CU7A 4W1UA 3GTPJ 1K61A 2ZB9A 2R5YA 2H8RA 1MH4A 3LSPA 1H8AC 1X58A 1MBGA 4XIDA 5JLXA 5FKOA 2LK2A 3OOUA 2X48A 2L0KA 1NTCA 2JJ7A 1AKHA 1AKHB 3JRFA 5M5YJ 4JX4A 2NVXJ 2O9LA 3CCYA 3L1PA 4A3FJ 3IH2A 3ZQFA 1JGGA 3HOUJ 3I4NJ 2E2IJ 2R92J 3TP3A 5IYBJ 3QPSA 1VFCA 3S1NJ 2DMTA 2K9NA 2LD5A 1TWAJ 1DU6A 1PUFA 1PUFB 1BW6A 3A01A 3A01B 1AU7A 1ZKGA 3BR0A 2QCOA 1FTZA 2DA7A 2H1KA 2NVYJ 3JR9A 3ZQGA 3FISA 5EDNA 5IYCJ 3SDGA 3GTJJ 5M3FJ 2TRTA 1RKTA 1JUPA 1SANA 1X2MA 2E2JJ 1GT0C 2NS7A 4D5CA 2EZIA 5EF6A 5E3MA 2IEKA 3BTLA 1MBFA 4D5FA 1D5YA 2XPUA 2ME6A 2B63J 3MKLA 4BBSJ 1GVDA 2E1OA 1FIPA 4DYRA 4A3IJ 1GV2A 4Y52J 5J1RA 1F43A 2NVQJ 2EH3A 1E3OC 2AO9A 1I6HJ 2VKEA 1FEXA 4Y7NJ 2DA6A 3QPLA 3QQAA 3BG3A 3W6VA 1VF9A 1JJ6C 4LOCA 2ID3A 1WH7A 3HB9A 3BTJA 5IPAA 5F1JA 1GV5A 2X9DA 1OFCX 4DYCA 5EG0A 5EG0B 3PM1A 1EF4A 4C2MJ 4C3JJ 2Y9YA 3K2AA 1ETQA 4A3MJ 3S2HJ 2GM4A 3HDDA 1MBHA 2K9SA 2Y9ZA 4L5EA 1ETYA 3ZQCA 4A3EJ 5DTDA 5EGOB 5EGOA 3BG9A 3G1OA 2IBDA 1ZGWA 4V2FA 5F0FA 4XRSG 1LE8B 1LE8A 1LFUP 4UUTA 3M3YJ 2LFBA 1WH5A 4JYKA 4MLOA 1R9TJ 3S17J 2VI6A 2L7MP 2DN0A 2R5ZA 2R5ZB 2EZHA 3OSGA 1HDPA 2CJJA 2MW8A 5K7ZA 2I10A 2IAIA 2E19A 1Z0XA 2XRLA 2K9QA 1QRYA 2DA2A 2KT0A 4QSHA 4FTHA 3M4OJ 4BY7J 3WHBA 5GP9A 1U78A 2DJNA 2DMQA 2EQRA 3JRGA 5J1UA 1ENHA 2XSDC 4GFBA 3JRAA 2ELKA 2JWTA 3HGGA 2XPVA 1VNDA 1U8BA 2ME0A 4A3JJ 4RBOA 1JKQC 3RKQA 2DMPA 1ETKA 2HXOA 1HF0A 4AYBN 1QVTA 4A3KJ 1ZTRA 2JMWA 1JT0A 1HOMA 4AUXA 2AHQA 4BKXA 4M6VA 3LOCA 3B6AA 4XRMA 1OCTC 2NS8A 5F27A 1Y1WJ 1ITYA 4I6ZA 1S7EA 4QIWN 2D5VA 1P7JA 1GDTA 1OCPA 1A5JA 4B3AA 2DTZA 5IP7J 3BT9A 5J3LA 3H3VK 3Q0UA 3HM5A 1TWGJ 2R0QC 2PMZN 1WPKA 5GPAA 2DA4A 5FLVA 3H0GJ 2M9HA 1IRZA 2WAQN 4XICA 2P81A 2YUSA 3FK6A 3GTMJ 2LP0A 2XB5A 3FIWA 2HOSA 1SFOJ 1H89C 1O4XA 4M3GA 2QF7A 1ETXA 3JRIA 4X6AJ 3TW7A 2MGQA 1I3QJ 3BR3A 1TWHJ 1H88C 1ZQ3P 4AC0A 2LY9A 2JN6A 4DZJA 5IP9J 2DMNA 4MIMA 1UHSA 1JJ8C 2MSYA 4FISA 2CQXA 1QPIA 2LTPA 5M3MJ 1WCMJ 3D1NI 5E3LA 3O8GA 3F0CA 4IHWA 2ECBA 4BY1J 1JUMA 1IG7A 3FK7A 3Q0WA
chains in the Genus database with same CATH superfamily
1BJZA 4OIQF 5BNGA 1N25A 2VKHA 4GXOA 4LG0A 5F0CA 2F5FA 2RN7A 2WA0A 5ILUA 3P9CA 1B8IA 2JA2A 1KGSA 1SVLA 4F55A 4DGWB 3P7NA 5IOYA 1UG2A 3WTXC 3HXLA 2LH9A 2ZO4A 5TISC 1A36A 3BZ6A 4I7HA 3A2KA 2LYCA 4PJLA 1IRXA 3K9TA 2BHZA 2HQNA 1FBUA 4Z2YA 2DQRA 1Z3YA 2Z99A 1WI3A 3QYEA 2XF5A 3CUQC 1IN6A 4EJUA 3S16J 2CWEA 3M1CA 4II3A 4OIOF 4ESFA 4ABZA 2QYOA 1SD6A 1Z21A 2XAUA 3GZ5A 4A5NA 4IL6C 5HS7A 2QENA 2P5VA 2EIKH 4GO1A 4NQWB 4FX0A 3LMMA 4CYCA 2BVMA 5IT9K 1T0FA 1MMDA 2B7EA 1FBSA 3BR5A 1R1VA 3BZCA 4J19A 3E7LA 3QYBA 2DFHA 3CDLA 1MJ9A 4DIQA 4CCKA 5TJJA 2CQQA 2VPRA 2HXIA 1UMQA 3DTEA 1GUUA 3W6JB 1FIAA 5BS6A 1XSVA 2CV2A 3QU6A 2GWRA 4F3QA 4H4KC 1RPWA 2L5QA 5HLGA 1Y56A 2JA7J 1XDSA 4CXFA 1FJLA 5ICFA 3HOXJ 1S9HA 2Q0OA 3ZPLA 1V54H 2HYJA 1K83J 3ZQQA 1YRNA 3SZTA 2QGUA 1SFUA 1WJFA 3I3LA 3R6SA 2EV0A 5M5WJ 4EEFG 4AIKA 2NOJB 2NS0A 2OQGA 4KT5C 3H5NA 1BI0A 2FQ4A 4M9ZA 1BL0A 1UAAA 5IY5H 4G8XA 4MFEA 1HQCA 1FX7A 4CH7A 3ECHA 2VKDA 2HNHA 3MKZA 2VXDA 3S93A 3H1CA 4XKWA 2PMUA 1LNWA 4JP0A 4NUBA 4Y15A 1BW5A 2RNGA 1YIJI 3J81K 3E6DA 2KRFA 5B3SH 1MIJA 3GFMA 1YITI 2MFZA 1KA8A 1OQYA 1FWZA 2LREA 3KZIC 3RI4A 1B72A 5GTIC 4IHVA 4IF4A 5C3EJ 1YS7A 1OISA 3KEQA 4NC6A 4XN3A 5FROA 2AXTC 1VZ0A 4EJTA 5E3OA 3S15J 2QKLB 2XKPA 1YYVA 1CF7B 4CHUA 5DS9A 4IOCF 2DTRA 3CMYA 2WWYA 4ASNA 1W5SA 3TQNA 3J7AO 3LNQA 2O8KA 3J7AY 2QSFX 4KISA 2IJLA 3KLOA 4XBFA 3GXOA 1KQ0A 4XR6A 3J80K 1UCRA 3MZ8A 4M3EA 3FX3A 4X1EA 2COBA 4D7NA 1CQTA 4MTDA 3AG3H 1TZLA 3OMYA 3WE3A 1WZ2A 2ECCA 3DEEA 1X1PA 3V7CA 3A1YA 4BHPA 3ZOBA 1SFXA 2ISZA 3ELKA 1QVUA 3AFHA 2VONA 1NG6A 2P8TA 2CV0A 3NRVA 1A6IA 1XC5A 1YTYA 3CCUI 3HOYJ 2K40A 1AHDP 3ML6A 3FF5A 4BJ6C 3I59A 2JRMA 2UUZA 5D5VB 4GYGA 5TRDA 1H9GA 2XKOA 1JT6A 1QU3A 1D1CA 2XGDA 4A6DA 4OAYA 2OF7A 3QWLA 3GVAA 1F36A 5FKNA 3H9QA 2HQ5A 5DCMB 1X1AA 2RQQA 3S8PA 1WSUA 2EZKA 5L3BA 3QOEA 1KYZA 5CVRA 5E8GA 2K7LA 5EZHA 3CQZJ 3CUQA 4C30A 4D7MA 3L7WA 1ZK8A 5FKKA 4IHSA 3H36A 2D2WA 5HLTA 3KEYA 2ID6A 1P2FA 1WKMA 3KP6A 4BHCA 2STWA 2XAFA 3OS1A 5HNHA 2TCTA 2EBIA 3WTUC 4ENNA 4B48A 1T0FC 1R7JA 4XLNF 5HDNA 3RYPA 1SFKA 2H8WA 2V9KA 2Z16A 3M8JA 3WTSC 3W3CA 1R23A 2F5EA 5GPCA 2OUMA 1R1TA 3AL0B 3BWGA 4MO7A 2LRDA 4BGDA 4YFKF 3ABLH 5F64A 5GAEJ 1K4SA 3OS2A 5LGNA 2QA4I 1LFBA 4YEJA 4EJWA 3HTUA 4NHJA 2IGNA 2L9RA 3FMRA 3HOWJ 4MNUA 2EINH 3BR6A 3OYAA 3PNTA 2Y31A 4G7HF 3EYIA 2CSOA 3BTCA 3JRHA 1NHAA 2JK3A 3LFKA 2OTLI 1NG7A 1S5LC 5BPIA 1JI8A 5F0HA 1KZHA 2LKPA 4XKBA 2D1HA 3VSKA 1XD7A 4U7BA 5DUKA 3BJ6A 4W1UA 4O3MA 2Q2EA 1E3HA 2CQKA 4E7HA 2Y48A 3TGNA 3BG7A 3LSPA 2K02A 2IW5A 2IA0A 2O3FA 5FKOA 4CICA 2FF4A 5BOXA 1D0ZA 2JJ7A 3L09A 1QZEA 1AKHB 2M4GA 3PQJA 3FXLA 5FFXA 5KK1A 2O9LA 4LLLA 4F52A 5D5XB 2R7SA 4A3FJ 3HOUJ 1JGGA 3I4NJ 2R92J 3TP3A 3S1NJ 2KMUA 2HPMA 3RYRA 1PUFA 1J2XA 2OD5A 4KMFA 2R7OA 2BEOA 3A01A 1AU7A 1ZKGA 1WFXA 3LFUA 1XDUA 1LDDA 3ZQGA 3GTJJ 5EDNA 5IYCJ 4RLFA 4KDPA 4OMYA 3LAPA 1REPC 2CYYA 5CQGA 2ADUA 5B5EC 2H27A 1SANA 4XLCA 2ZXWH 1X2MA 1ULYA 2CFOA 3U9GA 1WRJA 4ESBA 1ZRDA 4E4HA 4HEA2 4ZTFA 2RREA 1GT0C 4P9UA 5EF6A 2HQAA 2R7FA 4A6EA 3H9GA 1BIAA 2IP2A 1MD0A 2LBFB 1SAUA 2HTSA 3OYLA 3MKLA 2LOOA 3JSOA 1GVDA 2GAUA 4AIDA 1BC7C 4IOAF 1R5HA 4PSWA 3G3ZA 2RVCA 4DYRA 5DCFA 1MMNA 3OYMA 1Z6TA 3K1PA 2A69F 2GOMA 1MKMA 1E3OC 2CQNA 4M74A 1I6HJ 2DFIA 2CGPA 2L3DA 2Z9OA 3KX2A 2XHKA 4LOCA 3BTJA 4PUSA 5F1JA 4L9VA 1LFPA 1IAWA 4GDFA 2PLYA 1U5TC 4PFOA 4C2MJ 4BDZA 3K2AA 1ETQA 5HLIA 2LKSA 2DK8A 3HDDA 4F7ZA 4ZTJA 2A5WA 1ETYA 4KIFA 3ERMA 5DTDA 4WXHA 5DM6F 5EGOB 2IBDA 5IT9Z 3HZJA 1Y8QB 3MWMA 4U7DA 1G3TA 3CDIA 4JYKA 4MLOA 5HS8A 1YFHA 3I5UA 3S17J 3M9AA 4CZCA 2L4AA 2DN0A 2LMDA 3OL4A 5LEJA 4HLXA 4D1QA 1LKXA 3CZ6A 4L0YB 1YJWI 2M30A 1HDPA 3FXJA 1SVOA 1P92A 5B1BH 1RR8C 2OC6A 2ZSHB 3KYCB 3M4OJ 4BY7J 3WG7H 3F9KA 5B66C 3IP4B 2IA1A 1XCBA 3FZVA 1ENHA 3JRAA 3HGGA 3IL2A 1A31A 2DPUA 4YELA 2ICWG 4N9HA 4A3JJ 2WADA 1VQKI 4IXAA 4BYYA 3RKQA 3H3ZA 2WBMA 2HXOA 2WTEA 4OWRB 2OBPA 2XUBA 4AYBN 1QVTA 4Z6YA 4BQOA 1ZTRA 2FQ3A 3EQLF 4CUGA 1SEUA 5BPDA 3RSNA 1D8KA 3HSEA 2NS8A 4PFPA 2HVSA 2RC4A 5LHHA 3EYYA 1ITYA 2HVRA 1P7JA 2C6YA 4YRVA 4CCJA 2CMPA 2G7HA 2O8XA 4ENJA 2DTZA 5IP7J 3Q0UA 2PMZN 1WPKA 3DKXA 3LQQA 1HSJA 1X19A 5K5RA 5FLVA 3LA7A 4L0ZB 2HTJA 3QP5A 3W2AA 4J01A 4HNTA 3FMQA 4BEHB 1BN5A 1D0YA 3R0JA 4LGWA 4RAGA 1ZYRF 3DWLE 2P81A 4BXUA 1BOAA 3GTMJ 2EILH 1IN8A 2HOSA 4IHTA 2IPQX 1FSHA 4HG2A 4I01A 1RNLA 1ETXA 3E6CC 2H6CA 1MDMB 2DJIA 3DTKA 4N9IA 3JRIA 1BR2A 3H35A 3CF5F 1B9NA 1U6GA 1FZPB 1K4TA 1PUEE 3ROUA 5E79C 1ZQ3P 5D8KB 2LY9A 2JN6A 4EM0B 3IRRA 1UB9A 1UHSA 1JJ8C 3ZGKA 4XONA 4FISA 3L2RA 5B1AH 2QM3A 2DLLA 2DT6A 3K4BA 5KAFC 1QHHD 3E97A 3FBNB 4NC7A 4R1HA 1W7PA 2Y0SA 2DO7A 3IWFA 4IRGA 2JSCA 2BE5F 1JUMA 3TKYA 3A0HC 2VE9A 2R5YB 2ZXJA 2WAEA 4WF2A 3SFZA 5DDGA 3T8RA 1GLNA 1FOXA 2P5KA 4LG0B 3ZQIA 3V42A 1A04A 3VSLA 5J8CA 1FMVA 2GA1A 2MG4A 3MEXA 1JXSA 1B8IB 1USTA 2PJRB 3IH3A 3D1NI 1I50J 2FJ1A 5C44J 4M72A 1TBXA 1YHQI 4XKVA 3KPHA 3G71I 4E7IA 1O3TA 2ZC2A 2VL8A 3FHZA 4EATA 1XCVA 4PJJA 2JSPA 1OPCA 1MNDA 3HC7A 2RAEA 2BYVE 5KVRA 1VQ8I 4RA2A 2W85A 2R7TA 2DDBA 5HDGA 3AAFA 3VDXA 3KLNA 4I98B 3GFLA 5HLHA 2E60A 2W48A 4CYCB 1WJAA 3GTKJ 1J0RA 3HEFA 4BS9A 2E7XA 3O2PE 1IV8A 2WV1A 5FKMA 2M45A 3CP2A 3RQIA 4QTRA 1WWXA 1H0MA 2UV1A 3L2QA 2VODA 3LSJA 1EH6A 2EFQA 4JX5A 1JKOC 3TMOA 2P6TA 1T38A 4WWCA 1OCRH 4UUSA 2HYGD 2E2HJ 4Y13A 4PK4A 5L3CA 5FD6A 5FGMA 2MH2A 5ILVA 1USSA 2X1DA 3K7AJ 1XB4A 1F5TA 1O7LA 1MBEA 1YRNB 2RQPA 2CRGA 4KMUX 1X1CA 1VQMI 3CLOA 4RS8A 4IEJA 4AVZA 2LY1A 2E36A 5K7FA 1P4AA 3CTAA 2HOTA 1U5TA 3GWZA 3OYFA 1LEBA 1Y1VJ 1SMYF 1OCZH 2L7FP 2MA3A 4G6DA 1I1GA 5HNFA 2FU4A 2DOAA 2F4IA 3C2BA 2F4MB 2LY2A 1XS9A 1F4KA 2CG4A 4XSZF 5E1ZB 2ZJ2A 3JRCA 1Z6RA 3CC2I 3OYJA 2BY1A 2KIQA 2M4KA 5HVQC 2V4JC 4A0YA 3S14J 4B44A 2FXAA 1YO5C 1VQ4I 3PJRA 2M87A 1N78A 4UXNA 3FWEA 1RZ4A 1VQOI 3G1MA 5EZGA 5DD8A 4U0YA 4Q4ZF 1B72B 5ERIA 2OPTA 2M1BA 5JVGF 1MNMC 5TGTA 4XLPF 4E7ZA 2FA5A 3G1LA 2AQEA 2ESNA 3QPHA 3PUBA 1SD5A 2DA5A 1BA5A 3DV8A 2DYRH 3VYRB 1G59A 3W2VA 1QPMA 2VC0A 2KZVA 2QBYA 3G6EI 4RDUA 4N4NB 1CF7A 1DP7P 1YS6A 3B6CA 4P5OA 1RESA 2GZWA 3W6KB 5GAGJ 2HDDA 2QSHX 4P9FA 3CCQI 2DBBA 2L9SA 1P9QC 5LGUA 1X3UA 3UKGA 3GTQJ 3GFIA 5D4SA 3HHHA 3NARA 4NNJA 1ZR2A 2ZXHA 4HLYA 3JCUC 2LG4A 3F8NA 4BH9A 1HKSA 2J5OA 3OV8A 2X6OA 3FKIJ 4KICA 2HI3A 1KU2A 2LVSA 4XL9A 1OYYA 1XG1A 2FX0A 3ZN1A 4IHYA 4PGHA 2VT3A 2L9VA 1MJBA 2LR8A 2P5LC 4L5IA 2I8DA 3BC8A 4HOBA 2NNNA 5C4JJ 4B8XA 1FSEA 4BDYA 3QPTA 2FNAA 2JA6J 5E8IA 5J1YA 3BROA 1SMTA 2UZKA 1W0UA 1I3AA 3AG2H 3ZQ7A 3K4CA 4XK4A 3TBIA 4I2OA 4MHGA 1L3LA 1Y0UA 2A5YB 1C0WA 3OR1C 4KN4X 3ZMTA 1U9NA 3M1EA 4UVCA 5FKLA 4CCMA 1NK3P 3BLYA 1RKWA 5BQTA 2O61A 2YU9J 1ZGJA 5L3DA 3DP7A 3K69A 4GRIA 1SD7A 2R7XA 2FD5A 1PJRA 1ZG1A 2JVHA 4DW6A 3LSGA 2X6YA 1EA3A 4MFDA 1Z05A 3E5XA 5L3EA 1G8XA 2Y2ZA 4BQQA 5LHGA 3F6VA 2DMUA 3A0BC 2Y0MA 5E1XA 5K7HA 3V8JA 1XGOA 2EWNA 1BOBA 3L2UA 1U0JA 1RIOH 2BW3A 2XRNA 4U88A 2XIGA 4BBRJ 1CGPA 2HZTA 3HHGA 3HBLA 2JA8J 2RNJA 3BOQA 4RB2C 1TC3C 4HQMA 3K1MA 2FEZA 2PQ8A 2VQHA 3C3WA 4M9XA 4EQQA 1KQ8A 3BTIA 4ZDPA 4BJTA 4J00A 2OA4A 4EVIA 1K7AA 2A05A 2A6TA 4C2TA 3EDPA 4AU7A 3FXMA 5AONA 2KIUA 5CVVA 1ZLKA 5DYMA 1GXQA 1UHMA 1FOYA 3CJRB 2DT5A 3OIQA 4CSWA 4E70A 2XAHA 3QRFF 4A3DJ 1XTAA 2KJCA 4XLEA 3PIOF 3M8EA 5AIQA 2DODA 4RGRA 1T33A 3CJTB 3KIOA 3AKZA 1U9OA 4W97A 2EFWA 1XSDA 3FKJA 3O6BB 2PMHA 4OINF 4A5MA 2R7QA 2ZB9A 3VWBA 2K9MA 2YX4A 4HZFA 3DTIA 1MH4A 3C18A 4BUPA 3H3UA 4U0VA 1X58A 1R5ID 3WU1B 1P4WA 1HKQA 3OYBA 5JLXA 4QPQA 1KONA 5ICEA 3TOBA 2X4HA 3QODA 1NTCA 3SZGA 1AKHA 3WTYC 3JRFA 5KAIC 2ZBKA 3DU6A 1DGRM 1TW2A 5FRMA 1YJNI 2QQ8A 3CCYA 2B0LA 2EFPA 3IH2A 3ZQFA 3OOPA 3GEZA 3GX4X 2DMTA 2W25A 4XKCA 5ED4A 2XF6A 3W2WA 1VTNC 1HBXG 4UNOA 3QOPA 3R0AA 2X6XA 3ISPA 1Z91A 1FTZA 3KCCA 1QO0D 3JR9A 1S29A 4WXCA 4HF0A 2PEXA 4AIJA 2DCEA 3S32A 3I56I 1RKTA 3OYDA 3IC7A 2W4SA 4RMNA 3CCMI 2G7UA 3F21A 2DT7B 2DXIA 3HUGA 4BNCA 4LK0F 3ABMH 2E2JJ 1SFEA 4HX7A 4JBAA 1J9IA 2ZNZA 4D5CA 2EZIA 5E3MA 1VQ7I 4CYDA 1R49A 4IO9F 3PFYA 3FXRA 2JVGA 3BTLA 1UZCA 3F3XA 3X2QH 4RB3C 2LBFA 3VYSB 2XPUA 3D5LA 2ME6A 4BACA 4BBSJ 2KDOA 1FIPA 3JW4A 1F43A 2NVQJ 4E7JA 2EH3A 3SHFA 3CCSI 2AO9A 1U3EM 2ZJRF 2DA6A 1ZELA 3QQAA 3BG3A 2AS5F 2K86A 3DQVC 3W6VA 2M7AA 4A2UA 2ZKZA 5JFRA 2BV6A 5IPAA 1GV5A 1XMKA 2BY0A 3E3VA 3IUOA 1W1WE 2X9DA 3HOSA 3PM1A 4RAYA 3S3NA 4ANJA 5J6XA 1ZARA 2M5WA 2BVLA 5H6RA 1EH8A 2VQCA 2EFNA 2NYXA 3WGGA 5EGOA 4A3EJ 3G1OA 1BBYA 1B4AA 3S3MA 4V2FA 5F0FA 2IA2A 1D1AA 2EIJH 2QLZA 3L2WA 4F91B 1LFUP 2LFBA 1ZGAA 4M71A 1WI9A 1WH5A 3F8CA 3HRUA 4KITB 5LEKA 3WTVC 1DPUA 1S8NA 4FASD 1WHUA 2ACJA 1J5YA 3GF2A 2HZDA 3OSGA 2PBIA 5K7ZA 3V7RA 2I10A 2ETHA 2E19A 1Z0XA 2LF7A 2K9QA 1DDNA 1ACIA 2P7CB 2W1OA 1W5TA 5J1UA 4OMZA 2JWTA 4AIHA 3RPUA 3SQNA 1U8BA 4UB8C 2ME0A 4RBOA 4YIRX 3K0LA 1IN5A 4UUVA 1WVRA 3F8BA 2ZJPF 3BPVA 1MMSA 4XRFA 1HKTA 4EM2A 2LSOA 4CZZA 3DEUA 2Y69H 1HOMA 3MZYA 4AM3A 2G9WA 2F6CA 1OCTC 3B6AA 3IRQA 4RAZA 5JR3A 3ZMDA 3CLQA 5HOOA 3H9JA 3C7JA 1LDJA 2IXSA 5F27A 1O7FA 4RGXA 4G7ZF 4HDVA 2HVQA 5D6EA 4M6XA 3H3VK 3I64A 3HM5A 1ZRFA 2L2OA 2R0QC 2X6WA 1IUYA 5GPAA 3V8LA 2DA4A 1X1BA 3F6OA 1GHCA 4G9YA 2M9HA 1AA7A 5CLSA 3DBRB 1IRZA 2A3SA 4BEHA 4XICA 3OWTA 3LQRA 2O6GE 5JI6A 2YUSA 2CQ7A 3FK6A 1HXDA 3LSKA 2LP0A 3FIWA 3U21A 3WTWC 5LD2C 1O4XA 1BI1A 2KIFA 2QF7A 3U1KA 5E1WA 1IRFA 1OLTA 4C9YA 4Y17A 4WXDA 3IKVA 3REOA 4RLQA 1VQNI 2IGKA 1I3QJ 3BR3A 1TWHJ 4BXFA 3K70C 1EV7A 2K5CA 2WY8Q 2CW0F 1I1SA 3I58A 2DMNA 1IXSB 3ZMZA 4FX4A 4LLGF 3NWTA 4XN0A 2R3SA 4P96A 4EJVA 1V5FA 5E3LA 1Z7LA 4GYIA 2B9SA 2V1UA 3F72A 2VXZA 3O8GA 2WC2A 3DPUA 4BY1J 2PJPA 2X0LA 3F22A 4EGZA 5ICGA 2V26A 1V3FA 4YIIA 2R5YA 1W0TA 3FMSA 3ABUA 2XV4S 3TO9A 2GLOA 1B6AA 3CP8A 3BP8A 3IAM2 2JA5J 2NOGA 3PL8A 2EZLA 3J81Z 1XMXA 3NEUA 1E17A 1PVEA 2PJRA 1ON1A 2PG4A 4DZPA 1P7IA 2FBKA 3ZQLA 2CUFA 4YFNF 1K6OA 2XDVA 4D9JA 4KYWA 2MC3A 3ZMVA 2CUEA 3KP7A 2IS1A 2MC4A 1S7OA 2FMYA 1JTXA 1G6NA 1T56A 2QVOA 3JTHA 4BAYA 1XMAA 1RETA 2H94A 3ASOH 3ZXSA 1FY7A 4KA4A 1DU0A 2W84A 1YW9A 1DP3A 1ZAOA 4XM3A 2CFXA 1R58A 2F4OB 2KL4A 1YW8A 2PFBA 3DBHB 5DM7F 2CS3A 2V7FA 1P4XA 1ON2A 5D5WB 4KN7X 5LFAA 2EV6A 5CQEA 1WJEA 2KRHA 5IYDJ 2EA4A 1R71A 1IDYA 3PUFA 2R93J 2A07F 4XNFA 5EYRA 4O5VA 3VYTB 3GLLA 1S7AA 3I71A 4G6TB 4L9JA 2FOWA 4Q48A 2Y30A 1IW7F 3GTOJ 4ZYHA 2BXZA 2J5PA 2BY3A 2QQ9A 1QQIA 1XGNA 2XGCA 4UUSB 3N97A 1HW5A 2LLKA 4HX4A 1FP1D 1STZA 2K4JA 2OCCH 4BQNA 3IV5A 4NBQA 1BC8C 1MSFC 1IZ1A 3H5AA 2GIVA 3J80Z 2F5DA 1VQ9I 4AYBA 2VJIA 3B02A 2KDZA 2NNYA 3EPZA 1X4PA 2QQBA 3ERED 1U5TB 1BM9A 3C2HA 2V9PA 3ZQHA 4A93J 4DOZA 5FO5A 1D5VA 1FLIA 3OY9A 2ZXIA 2QUFA 2Z1DA 3EUHA 3NAUA 3D0SA 3GBGA 2M7BA 5ILSA 2F5VA 3KP4A 1LJ9A 1FOWA 2CUZA 5FD5A 1I6XA 3HYIA 3OYKA 1RUOA 1I27A 2R7UA 1UELB 1MBJA 4A69C 2MD0A 1IC8A 4A12A 3TW6A 1R00A 1JHFA 3B73A 3E5QA 3FDYA 1FOKA 2ELJA 2W00A 4NC8A 2JQ7A 2KP6A 3K1NA 1G3SA 3DEWA 1POGA 2L01A 2YS9A 2DFFA 1ZG5A 2XAGA 2L9NA 3T0YA 3OSFA 2BBYA 3JRBA 3ESWB 1I5ZA 2QBYB 1T39A 1N77A 1FYMA 1OJLA 2H09A 4DYQA 2D1VA 3H92A 1H9TA 1QGPA 4FQGA 1R36A 5BMZA 1LVKA 3MCZA 3S1QJ 1JKRC 2QQAA 4ENKA 4JX6A 1W7PD 2NAZA 3ABTA 2STTA 2KPMA 3GZNB 1ZREA 1E3PA 4XOTA 2HQRA 2JPBA 1IXRC 5HDKA 2XB0X 1F9NA 2E1NA 3ABKH 1V55H 2IT0A 4HBLA 3CO6C 1MBKA 1KU3A 3FBIB 3K4MA 4CA0A 3WODF 5GTHC 5CVJA 4M3DA 1D8JA 4XSXF 4LG3A 3S1RJ 2K3PA 2ELHA 4QPOA 5A2QK 4A3BJ 5H20A 3ULQB 4EV0A 4ZYDA 4LIVA 3PSFA 3VFZA 3JRDA 2XASA 3MMYB 4E7LA 1S72I 1RR7A 3JSPA 4X0GA 3R60A 3LSRA 4PSXA 1DGWY 3SJMA 5JHUA 4V19K 1YE9A 3CUOA 4KNYA 1ETWA 1Y0NA 1OCCH 4MGRA 1T08B 1FPQA 3HGYA 4MQVA 3IKTA 3PO2J 2DOEA 1IGNA 5F1RA 1XGSA 3U1DA 4Q5SF 4B1RA 4NDLA 3MZHA 3CD6I 5IOZA 1WGXA 2UXNA 2CH0A 1K6YA 3CDHA 1WQ2A 2R7ZJ 2DA3A 3A02A 2LF8A 5EEAA 3TEDA 2BW3B 5J4YA 4HQEA 4ZJZA 1ETVA 3DFGA 3DPLC 4RB1A 1HDDC 1J59A 3I9V2 3M8FA 3VB2A 4FT8A 1YLFA 2OJED 2WB1A 2BY2A 2V1DA 3I0TA 5JLWA 4V2GA 4JOMA 4UVAA 5D4RA 3HTSB 3JREA 1TW3A 1V5GA 2HOEA 2HYFA 5C4XJ 2XVCA 4K2EA 3GLXA 3H5RA 4HRIA 3DBLB 2WV0A 5M5XJ 4G12A 3Q0VA 2H6BA 3MVPA 4Y3OA 1IDZA 3VYUB 2Y0SN 3D5SC 3BZKA 2M2EA 4XRSA 2XPWA 1O3RA 1W4MA 2OV7A 5CPRB 4BHBA 1R4NB 1U8RA 3S2DJ 2M3AA 1AOYA 1K78B 2GXGA 1APLC 3DPTA 1E2XA 4HF1A 4YG2F 1HW2A 2Z3YA 3GTPJ 1K61A 1DQUA 2OQRA 1UJ8A 3OS0A 2H8RA 1MNEA 3HL2A 2UWMA 5J47A 2GXBA 2VOOA 3V7SA 1O57A 4HSRA 1WJ5A 2EV5A 4EM1A 3J7ZI 1E0EA 3G4SI 3ECOA 1LDKB 4D0PA 4ZYGA 2HFHA 1T8IA 2JPCA 1ZHFA 2GOXB 2OZUA 4JX4A 3DLLF 3I54A 1XN7A 2VJJA 3K70D 3UNGC 3A4CA 5D8LB 3E6BA 3L1PA 1UG0A 4ON0A 4OAZA 4HX8A 1R22A 3CMAI 3CC7I 1YJ9I 5IYBJ 5LHIA 2JUCA 3J7YJ 4ZYEA 2K9NA 1TLHB 1TWAJ 5FLXK 1DU6A 4IX7A 3LSMA 4PJ0C 3VODA 1BW6A 3BR0A 2QCOA 2H1KA 5J40A 3KFWX 3FISA 5M3FJ 2KJBA 4AWXB 1FYKA 2TRTA 2JRTA 2V9VA 3G73A 1JUPA 3I4PA 4AD9A 5K1YA 3ZRGA 4HYEA 1T2KA 4U87A 3HUGB 4L18B 5FRNA 3SEQA 3FHNA 3MQ0A 1FYLA 4F93B 2CW7A 2HWVA 4D5FA 2CV1A 3AL0C 3CCRI 2B63J 3Q9VA 5IT3A 2E1OA 3LL7A 1TQIA 1R4MB 2E5NA 1JHHA 3OYCA 4DJAA 4A3IJ 4E7SA 1GV2A 3KP2A 4Y52J 1OCOH 2FMLA 2AQFA 4B3XA 4IQJA 4L5JA 1FEXA 2NXNB 4Y7NJ 3QPLA 4O6JA 1L0OC 1IF1A 3K6GA 2D45A 1ERDA 2E7WA 2ID3A 5A2QZ 1WH7A 2ZMEB 3HB9A 4A0XA 2FRHA 4XLAA 1Y39A 1OFCX 2KLOA 2OAZA 3HRMA 5EG0B 2DPDA 5FB2A 2E34A 4C3JJ 2Q8KA 2GM4A 1RI7A 1KYWA 1YX3A 1OKRA 4L5EA 2A61A 1XX5A 1OYIA 2FUG2 4XRSG 1LE8A 2VC1A 3GCMA 2VPLA 4S04A 4UUTA 2R7DA 4KIGA 4JQFA 4UHTA 2VI6A 2ESHA 2R5ZB 2E35A 3OYNA 2HR3A 2EZHA 3CJNA 2QSGX 2PX9A 1LEAA 3KE2A 3R61A 2XAJA 3WE2A 2CW8A 3F23A 1QA6A 4RGUA 2XRLA 3F8FA 1QRYA 1SVMA 2KT0A 4QSHA 3RKWA 4YIFA 2Z2SB 2XF7A 3HJEA 3T1BA 4CGZA 4OIPF 5GP9A 1Z7UA 1U78A 2DJNA 2DMQA 4MEXF 1UHWA 4XMYA 2XSDC 4GFBA 1QBJA 2OTJI 2O5RA 2XPVA 3MKWB 1NH3A 1VNDA 2R7WA 3FXUA 3E1SA 2DMPA 4YFXF 1HF0A 2R4GA 3S2WA 1JT0A 2JMWA 4M9SA 4N4OB 2AHQA 3OYHA 1W36D 5JVTA 4M6VA 1HSTA 3LOCA 4XRMA 2TDXA 5L3GA 4UVBA 3HKZA 2HKXA 3GFJA 4I6ZA 1S7EA 4QIWN 2D5VA 3FXKA 1GDTA 1A5JA 5JHFA 1K79A 1WJDA 3CO7C 3SEZA 3LSTA 4ZH4F 1QZYA 2L54A 5F6FA 1N75A 5FFZA 2HEOA 1TWGJ 3KZYA 1FNNA 2GXAA 5DEQA 3WG9A 1YW7A 2BZTA 4RM2A 1XSXA 1J7KA 2ISYA 3K4LA 4CCOA 4E7KA 1TP4A 2K85A 3QU3A 2W57A 1TNSA 2XB5A 2XGXA 5DUIA 1OR7A 3L2CA 1RRJA 1AWCA 1D1BA 1YIOA 2KHMA 3E5UA 4N0BA 1FC3A 3T5XA 4C2UA 1PP7U 1F1ZA 2VASA 2YX7A 3GW2A 4X6AJ 2WAFA 1LVAA 1PYVA 3WU0A 2LC2A 3TW7A 2MGQA 3DXJF 3ZR8X 2X1CA 5J4VA 3ASNH 2MABA 2CQXA 3CJQB 1QPIA 4IPAA 2AXLA 2LTPA 3LAJA 5M3MJ 2DOFA 1JGSA 5CYVA 3F0CA 4DBRA 4H0EA 4IHWA 1YG2A 2ECBA 2KRCA 2MD5A 3MFKA 1ZRCA 3FK7A 3D5RC 2HU9A 2XROA 2FNPA 3CCLI 4R8HA 4U0WA 1BIBA 5FLXZ 1NK2P 4C3HJ 4G7OF 1D3YA 3VEPA 1IV6A 2HDCA 4QLCU 4I09A 3GTGJ 5LLQA 4IJAA 1WJBA 2RKHA 4IVNA 5D6FA 2PMZA 3BR1A 1PP8F 1BI3A 3RZDJ 1PDNC 1TQMA 2EK5A 2O7OA 2F48A 1R6RA 5KHDA 2OU2A 3RQ4A 5LRSA 2RV8A 1TWCJ 3CMMA 4M3BA 4LJZF 4S05A 1YX5A 2OCEA 3IHUA 1TT0A 4Y33A 1MJAA 4Y4RA 4CO8A 2GBYA 5E17F 2HOAA 2DK5A 4I0AA 2M0MA 2W7NA 1Z67A 3ZMSA 1VQ5I 3BJAA 2IS4A 3RKYA 5EJCA 2KZGA 1FP2A 3S3OA 3EETA 1KU7A 3HOZJ 2QWWA 2VJ5A 2V6EA 4NQWA 3L2VA 2K9LA 2VKVA 3EUAA 1JKPC 3TOAA 2YSRA 3N05A 3V8KA 1R5GA 1BR1A 1ZR4A 1QHGA 1T95A 2IGMA 2V79A 3OIPA 3ZP5A 3Q3SA 1Q1VA 4HW0A 1IO2A 2WAQA 4HNVA 2YPRA 4NB5A 3K4NA 4OOIA 4PGGA 4LD5A 1LPQA 4IHXA 3NWSA 4FE4A 1Z77A 1SC7A 3LSIA 2V1NA 1IUFA 4M3FA 2MLKA 5ICCA 3CCEI 4UV8A 1HLVA 4XLHA 2P4WA 3CCVI 2NVTJ 4B4CA 3IAS2 3BG6A 4I76A 3DKYA 2FBIA 2VUMJ 3LA2A 3WHCA 2DI3A 3FXQA 4KJZA 1YI2I 3OIOA 4Q47A 1FMWA 3S1MJ 3DLAA 2VBWA 5GAHJ 3H0DA 4EGYA 3GUDA 2DAOA 3SZPA 3KYDB 4R79A 2ZNYA 4RAFA 2L7KA 3WTTC 4FCYA 1OYWA 2L7ZA 3RPQA 4IZZA 2N8GA 3SDBA 2Y75A 3BCAA 3DF8A 1G2HA 1O3QA 3HKZN 4PJMA 3SFIA 3BQZA 5FLMJ 1FTTA 5L3FA 3BQYA 1HCRA 2E1CA 1YOVB 2VT2A 4KIBA 3WGHA 2P6SA 3NQOA 4FETA 4CDGA 3MKYB 1R1UA 1EH7A 2EIMH 4XORA 1XPXA 3IH4A 3K4JA 3MN2A 3RTRA 1MH3A 5AIPA 3JTGA 3E6MA 2GQQA 1RUNA 3HOVJ 2DA1A 2VJ4A 4IRHA 3RKXA 2HS5A 1VQPI 1ZH5A 4A3CJ 2W24A 4LK1F 1QNTA 3GMEA 4AVPA 9ANTA 5H6QA 3I4MJ 3PQKA 1Z9CA 2Q1ZB 3OYIA 2HPIA 2IS2A 5EEGA 3K2ZA 6PAXA 3TL4X 3I53A 4A3LJ 1RC9A 3PO3J 4GGGA 2FBHA 4UB6C 2ZCWA 2A68F 4HF2A 3I55I 3TP0A 4BE0A 3AG1H 1Y8RB 1IJWC 2EB7A 5LBQA 1ORKA 2XSJC 4LMYA 2EJRA 2O03A 3M07A 1O3SA 1VQLI 3I59B 2E1MC 4PDKA 2K27A 3RIRA 3GTLJ 2KKOA 1X2NA 2F5CA 1Z1DA 2XGEA 2ZJQF 1J75A 2LKXA 4MTEA 3PSIA 3HSFA 5HODA 1B9MA 3HG9A 3CESA 5DCMA 2M8GX 3HRSA 4HV5A 3QYFA 3PNYA 2QKMB 3RJPA 3HPGA 3O8HA 3BG5A 1BR4A 2E1MB 3CUQB 1EKEA 4HAMA 2HGCA 3RZOJ 4LLNA 4BQAA 2ZMEC 1MMGA 4CCLA 1LB2A 2PN6A 3QP6A 4MEYF 2K3FA 2DDAA 2HDWA 1V5EA 5F04A 4CCNA 3R4KA 2WY7Q 1TWFJ 3FXOA 1ZN2A 3COAC 2WB1N 5FJ8J 2BOLA 2MYSA 1U2WA 2E71A 4UV9A 4DBQA 2DU9A 2L4MA 4EJOA 1JTYA 2A6EF 3SXYA 4DNCA 5F08A 1B1BA 2X51A 4S0HB 5IP6A 3C1DA 3E0JB 1ZLJA 2VBYA 4A0ZA 3JAMK 2M8EA 3BDDA 4I0BA 3VPRA 3SYTA 5E3NA 2G0EA 2M0CA 3OL3A 3HOTA 3GZ6A 2KQRA 1TQPA 4FE7A 3RPUD 2JZYA 5K5QA 1WJCA 4ZDOA 2FOKA 3HSRA 1MSEC 4BXXJ 4P55A 5DD4A 1IN4A 2F2EA 1JUSA 3DCFA 3RCOA 1X3WB 2ZFUA 1VI0A 2KIMA 3QAHA 2BXYA 3A03A 3BY6A 4KT6A 2M34A 3JAMZ 2P0WA 3BJOA 2NVUB 1K78A 3BR2A 1A35A 4B09A 3WTZA 4A3GJ 1ETOA 2CU7A 2H1LA 1QZZA 1BI2A 2NRAC 2Q2EB 1T6SA 1SD4A 2CO5A 2EFOA 4IQ4A 2KISA 3WGIA 3OR2C 3KYLA 1TNTA 1YQAA 1OMIA 3LA3A 4UY8I 1H8AC 1MBGA 4XIDA 2PI0A 2LK2A 3OOUA 2VBXA 2X48A 4XLFA 5D5UB 2O0YA 2L0KA 3T8TA 1MW7A 2NVXJ 5M5YJ 4L9NA 3Q9SA 1Y6IA 2VOPA 2IS6A 2OZ6A 2E2IJ 4GCVA 1VFCA 1HW1A 3QPSA 2DYSH 3DKWA 3LSHA 2LD5A 2QEXI 1EJ9A 1G4DA 2W82A 2BHYA 3KEOA 2I5UA 1PUFB 4KFCA 3A01B 1S3JA 2DA7A 5KNLA 1JE8A 2P7VB 2NVYJ 3EUKL 4KUMA 3ZCOA 3KETA 4QWQA 3SDGA 3AG4H 1M1EB 4FHTA 3LWFA 4B43A 2VN2A 3N4MA 3ZN0A 3TO7A 3PIPF 4PJNA 4ESJA 2NS7A 2DW4A 3RDIA 1TT5B 4ITVA 2IEKA 5LRRA 2COMA 3WU2C 1VQ6I 2ZSIB 3PFIA 1MBFA 4I02A 3K10A 4RM3A 3P9IA 4ZYAA 3F8MA 1D5YA 1W5CC 2X85A 4P1WA 2IRFG 1IXCA 2KFDA 1MZBA 4HNUA 1W36C 1ONVA 3M7GA 3TDZC 3TDUC 4M6YA 1LUJB 2VLAA 5J1RA 3FM3A 5CVUA 2BGCA 2VKEA 2JT1A 3O3KA 2K4BA 1IN7A 1VF9A 2MBFA 5EEHA 1J09A 1JJ6C 2E5ZA 4HV6A 2ZMEA 3HIFA 5K5OA 1P6RA 4I99C 4WCGA 2RGVA 2IGOA 2GA2A 4DYCA 2MLGA 5EG0A 2LNBA 1EF4A 1KU9A 2CUJA 1Z3XA 2DQLA 2Y9YA 2Z5UA 4A3MJ 4LFUA 3S2HJ 2ZFWA 1MBHA 2K9SA 3KP5A 4JK1X 3DU5A 2Y9ZA 3ZQCA 4XQFA 1ZGWA 1BJAA 3BG9A 1I39A 1X4OA 1LE8B 5KCMA 1MMAA 2EPFA 3M3YJ 1MGTA 1R9TJ 4M73A 1B59A 2L7MP 1GXPA 4XOPA 2VB6A 3KP3A 2R5ZA 1FBQA 1IRGA 4HSTA 3VOEA 4BE1A 4LIUA 4RGSA 3GO5A 3TO6A 1ODDA 2CJJA 4E6KG 3G2BA 1SAXA 2MW8A 3CCJI 1FT9A 4BJ5C 2IAIA 3U2RA 3OYGA 1X1DA 3CF2A 2DA2A 3L9FA 4FTHA 3WHBA 2L02A 1TL8A 3P5JA 2JTVA 4RB0A 2EQRA 5CVIA 3L00A 3IWZA 3JRGA 5HS9A 2X1EA 2ELKA 4MQ9F 2MH9A 3BCBA 3UR3C 2XAQA 3HRTA 3V4GA 4LB6B 4LB5A 2GIZA 2UXXA 4G94A 1JKQC 4ZDLA 1ETKA 1T98A 1OR7C 4BU2A 1G3WA 1ZG3A 2A6HF 4B47A 3BPXA 3KZZA 4A3KJ 3CMEI 1HC8A 4AUXA 4IRIA 4BKXA 4ZZLA 4BL0B 2LDUA 4WX9A 1D0XA 2V1XA 1Y1WJ 3K4KA 2R7VA 2R7RA 3C2GA 4L9TA 3EUHC 1GVJA 1OCPA 4TV7A 2FE3A 4B3AA 3ZMUA 4EMSA 5E18F 3BT9A 3HPHA 5J3LA 1TTYA 1UFMA 3MAJA 2V6CA 4OIRF 1XGMA 4ZC3A 2RDPA 5CKTA 4WK8F 3H0GJ 3GYHX 4HDUA 4ENMA 2FSWA 3ONQA 2WAQN 4OU0A 2Z33A 3FM5A 2YR2A 2VQLA 1LQ1A 2VBZA 5DV5A 2JUGA 4BE2A 1SFOJ 1H89C 4ETSA 4F92B 4M3GA 4DQ2A 1MDMA 2EA2A 1V4RA 2VE8A 3MD2A 5LGTA 3OYEA 4IKFA 1KQ9A 2VQGA 2VIXA 1H88C 4G6QA 4AC0A 1G3YA 3PNVA 4DZJA 5IP9J 1HA8A 4MIMA 4LITA 1S6LA 2MSYA 3P9KA 4PZJA 2DFEA 1DUXC 1DPRA 4II2A 1X3ZB 1WCMJ 4HPQA 4ZZDA 2IVMA 1A6QA 2YU3A 5H2FC 1Q1HA 5J8FA 2XC7A 3CC4I 1W7PB 5E20A 4HA8A 5CJ9A 2HKOA 2QZ8A 3Q5FA 5GADJ 4C3IJ 1IG7A 3Q0WA 4PCQA
chains in the Genus database with same CATH topology
1W0TA 1BJZA 5BNGA 1NK2P 4C3HJ 1IV6A 2GLOA 3ZQIA 5F0CA 2JA5J 3GTGJ 2NOGA 2R5YB 2EZLA 2MG4A 1B8IB 1B8IA 3BR1A 3IH3A 1I50J 2FJ1A 4DZPA 1P7IA 3ZQLA 5IOYA 5C44J 1UG2A 2CUFA 3RZDJ 2O7OA 2CUEA 1JTXA 1TWCJ 4M3BA 1T56A 1WI3A 1RETA 3S16J 2GBYA 2RAEA 2HOAA 1DU0A 4ABZA 3HOZJ 2W48A 4CYCB 4CYCA 3GTKJ 3HEFA 5IYDJ 2VKVA 1JKPC 1IDYA 2R93J 5EYRA 3BR5A 1ZR4A 2WV1A 5FKMA 3RQIA 4J19A 3E7LA 4QTRA 3Q3SA 1Q1VA 3CDLA 2CQQA 2VPRA 3LSJA 2HXIA 4JX5A 1UMQA 4HNVA 2Y30A 1JKOC 3GTOJ 1GUUA 1FIAA 4IHXA 4FE4A 1Z77A 2XGCA 1RPWA 4UUSB 4UUSA 2E2HJ 2LLKA 2JA7J 1FJLA 1IUFA 4M3FA 3HOXJ 1HLVA 3IV5A 1MSFC 2HYJA 1K83J 3K7AJ 1YRNB 1YRNA 1MBEA 2NVTJ 4B4CA 2CRGA 4I76A 5M5WJ 2VUMJ 3WHCA 4EEFG 4IEJA 2KDZA 5K7FA 3OIOA 2HOTA 2FQ4A 3S1MJ 1BL0A 3ZQHA 4A93J 1Y1VJ 4MFEA 2L7FP 3C2BA 1XS9A 4JP0A 1BW5A 3NAUA 4FCYA 2L7ZA 3GBGA 3JRCA 2N8GA 3S14J 4C3IJ 1G2HA 3HKZN 3SFIA 1MBJA 3BQZA 5FLMJ 1FTTA 3G1MA 1HCRA 3BQYA 5EZGA 1B72B 4A69C 1B72A 2OPTA 1IC8A 1MNMC 4IHVA 5C3EJ 3TW6A 3G1LA 3IH4A 3DEWA 1POGA 3MN2A 2YS9A 1MH3A 2DA5A 5E3OA 3S15J 3OSFA 1BA5A 3JRBA 3HOVJ 2DA1A 4RDUA 5DS9A 3CMYA 3B6CA 1OJLA 1RESA 4A3CJ 2HDDA 4DYQA 3LNQA 2O8KA 9ANTA 3I4MJ 3UKGA 3S1QJ 3GTQJ 1JKRC 1ZR2A 3NARA 4JX6A 4A3LJ 4M3EA 2X6OA 3FKIJ 4X1EA 2COBA 4D7NA 3PO3J 1CQTA 2HI3A 2XB0X 2LVSA 2ECCA 1XG1A 2FX0A 4IHYA 3ZOBA 3TP0A 1MBKA 2LR8A 1QVUA 1IJWC 5C4JJ 4M3DA 1ORKA 3S1RJ 1A6IA 1XC5A 3HOYJ 2K40A 1AHDP 2JA6J 4A3BJ 5J1YA 1W0UA 3GTLJ 1JT6A 4XK4A 1X2NA 2XGDA 2XGEA 3JRDA 1U9NA 2OF7A 2LKXA 1F36A 5FKLA 5HODA 1RR7A 5FKNA 1NK3P 3LSRA 3SJMA 1RKWA 2HQ5A 2M8GX 2EZKA 2YU9J 1ETWA 3O8HA 3BG5A 5EZHA 3CQZJ 2FD5A 4D7MA 4DW6A 3LSGA 1ZK8A 5FKKA 3RZOJ 4MFDA 3HGYA 3PO2J 2Y2ZA 1IGNA 2ID6A 4B1RA 4NDLA 5F04A 5IOZA 1WGXA 2DMUA 5K7HA 2TCTA 2EBIA 1TWFJ 2R7ZJ 2DA3A 3A02A 2WB1N 5FJ8J 5EEAA 3TEDA 1ETVA 1HDDC 4BBRJ 5GPCA 3HBLA 1JTYA 2JA8J 5F08A 5IP6A 4S0HB 1TC3C 4MO7A 5JLWA 4V2GA 3VPRA 3JREA 3BTIA 5C4XJ 5E3NA 2G0EA 2M0CA 1LFBA 4FE7A 4G12A 3Q0VA 5M5XJ 2L9RA 3MVPA 1IDZA 3HOWJ 1MSEC 4BXXJ 2Y0SN 3BR6A 2M2EA 4XRSA 2Y31A 1JUSA 2XPWA 3DCFA 4A3DJ 3BTCA 1VI0A 3JRHA 2JK3A 3A03A 3S2DJ 2M34A 5F0HA 1APLC 1T33A 3BR2A 1U9OA 4W97A 4A3GJ 1ETOA 2CU7A 4W1UA 3GTPJ 1K61A 2ZB9A 2R5YA 2H8RA 1MH4A 3LSPA 1H8AC 1X58A 1MBGA 4XIDA 5JLXA 5FKOA 2LK2A 3OOUA 2X48A 2L0KA 1NTCA 2JJ7A 1AKHA 1AKHB 3JRFA 5M5YJ 4JX4A 2NVXJ 2O9LA 3CCYA 3L1PA 4A3FJ 3IH2A 3ZQFA 1JGGA 3HOUJ 3I4NJ 2E2IJ 2R92J 3TP3A 5IYBJ 3QPSA 1VFCA 3S1NJ 2DMTA 2K9NA 2LD5A 1TWAJ 1DU6A 1PUFA 1PUFB 1BW6A 3A01A 3A01B 1AU7A 1ZKGA 3BR0A 2QCOA 1FTZA 2DA7A 2H1KA 2NVYJ 3JR9A 3ZQGA 3FISA 5EDNA 5IYCJ 3SDGA 3GTJJ 5M3FJ 2TRTA 1RKTA 1JUPA 1SANA 1X2MA 2E2JJ 1GT0C 2NS7A 4D5CA 2EZIA 5EF6A 5E3MA 2IEKA 3BTLA 1MBFA 4D5FA 1D5YA 2XPUA 2ME6A 2B63J 3MKLA 4BBSJ 1GVDA 2E1OA 1FIPA 4DYRA 4A3IJ 1GV2A 4Y52J 5J1RA 1F43A 2NVQJ 2EH3A 1E3OC 2AO9A 1I6HJ 2VKEA 1FEXA 4Y7NJ 2DA6A 3QPLA 3QQAA 3BG3A 3W6VA 1VF9A 1JJ6C 4LOCA 2ID3A 1WH7A 3HB9A 3BTJA 5IPAA 5F1JA 1GV5A 2X9DA 1OFCX 4DYCA 5EG0A 5EG0B 3PM1A 1EF4A 4C2MJ 4C3JJ 2Y9YA 3K2AA 1ETQA 4A3MJ 3S2HJ 2GM4A 3HDDA 1MBHA 2K9SA 2Y9ZA 4L5EA 1ETYA 3ZQCA 4A3EJ 5DTDA 5EGOB 5EGOA 3BG9A 3G1OA 2IBDA 1ZGWA 4V2FA 5F0FA 4XRSG 1LE8B 1LE8A 1LFUP 4UUTA 3M3YJ 2LFBA 1WH5A 4JYKA 4MLOA 1R9TJ 3S17J 2VI6A 2L7MP 2DN0A 2R5ZA 2R5ZB 2EZHA 3OSGA 1HDPA 2CJJA 2MW8A 5K7ZA 2I10A 2IAIA 2E19A 1Z0XA 2XRLA 2K9QA 1QRYA 2DA2A 2KT0A 4QSHA 4FTHA 3M4OJ 4BY7J 3WHBA 5GP9A 1U78A 2DJNA 2DMQA 2EQRA 3JRGA 5J1UA 1ENHA 2XSDC 4GFBA 3JRAA 2ELKA 2JWTA 3HGGA 2XPVA 1VNDA 1U8BA 2ME0A 4A3JJ 4RBOA 1JKQC 3RKQA 2DMPA 1ETKA 2HXOA 1HF0A 4AYBN 1QVTA 4A3KJ 1ZTRA 2JMWA 1JT0A 1HOMA 4AUXA 2AHQA 4BKXA 4M6VA 3LOCA 3B6AA 4XRMA 1OCTC 2NS8A 5F27A 1Y1WJ 1ITYA 4I6ZA 1S7EA 4QIWN 2D5VA 1P7JA 1GDTA 1OCPA 1A5JA 4B3AA 2DTZA 5IP7J 3BT9A 5J3LA 3H3VK 3Q0UA 3HM5A 1TWGJ 2R0QC 2PMZN 1WPKA 5GPAA 2DA4A 5FLVA 3H0GJ 2M9HA 1IRZA 2WAQN 4XICA 2P81A 2YUSA 3FK6A 3GTMJ 2LP0A 2XB5A 3FIWA 2HOSA 1SFOJ 1H89C 1O4XA 4M3GA 2QF7A 1ETXA 3JRIA 4X6AJ 3TW7A 2MGQA 1I3QJ 3BR3A 1TWHJ 1H88C 1ZQ3P 4AC0A 2LY9A 2JN6A 4DZJA 5IP9J 2DMNA 4MIMA 1UHSA 1JJ8C 2MSYA 4FISA 2CQXA 1QPIA 2LTPA 5M3MJ 1WCMJ 3D1NI 5E3LA 3O8GA 3F0CA 4IHWA 2ECBA 4BY1J 1JUMA 1IG7A 3FK7A 3Q0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0T A;  1BJZ A;  5BNG A;  1NK2 P;  4C3H J;  1IV6 A;  2GLO A;  3ZQI A;  5F0C A;  2JA5 J;  3GTG J;  2NOG A;  2R5Y B;  2EZL A;  2MG4 A;  1B8I B;  1B8I A;  3BR1 A;  3IH3 A;  1I50 J;  2FJ1 A;  4DZP A;  1P7I A;  3ZQL A;  5IOY A;  5C44 J;  1UG2 A;  2CUF A;  3RZD J;  2O7O A;  2CUE A;  1JTX A;  1TWC J;  4M3B A;  1T56 A;  1WI3 A;  1RET A;  3S16 J;  2GBY A;  2RAE A;  2HOA A;  1DU0 A;  4ABZ A;  3HOZ J;  2W48 A;  4CYC B;  4CYC A;  3GTK J;  3HEF A;  5IYD J;  2VKV A;  1JKP C;  1IDY A;  2R93 J;  5EYR A;  3BR5 A;  1ZR4 A;  2WV1 A;  5FKM A;  3RQI A;  4J19 A;  3E7L A;  4QTR A;  3Q3S A;  1Q1V A;  3CDL A;  2CQQ A;  2VPR A;  3LSJ A;  2HXI A;  4JX5 A;  1UMQ A;  4HNV A;  2Y30 A;  1JKO C;  3GTO J;  1GUU A;  1FIA A;  4IHX A;  4FE4 A;  1Z77 A;  2XGC A;  1RPW A;  4UUS B;  4UUS A;  2E2H J;  2LLK A;  2JA7 J;  1FJL A;  1IUF A;  4M3F A;  3HOX J;  1HLV A;  3IV5 A;  1MSF C;  2HYJ A;  1K83 J;  3K7A J;  1YRN B;  1YRN A;  1MBE A;  2NVT J;  4B4C A;  2CRG A;  4I76 A;  5M5W J;  2VUM J;  3WHC A;  4EEF G;  4IEJ A;  2KDZ A;  5K7F A;  3OIO A;  2HOT A;  2FQ4 A;  3S1M J;  1BL0 A;  3ZQH A;  4A93 J;  1Y1V J;  4MFE A;  2L7F P;  3C2B A;  1XS9 A;  4JP0 A;  1BW5 A;  3NAU A;  4FCY A;  2L7Z A;  3GBG A;  3JRC A;  2N8G A;  3S14 J;  4C3I J;  1G2H A;  3HKZ N;  3SFI A;  1MBJ A;  3BQZ A;  5FLM J;  1FTT A;  3G1M A;  1HCR A;  3BQY A;  5EZG A;  1B72 B;  4A69 C;  1B72 A;  2OPT A;  1IC8 A;  1MNM C;  4IHV A;  5C3E J;  3TW6 A;  3G1L A;  3IH4 A;  3DEW A;  1POG A;  3MN2 A;  2YS9 A;  1MH3 A;  2DA5 A;  5E3O A;  3S15 J;  3OSF A;  1BA5 A;  3JRB A;  3HOV J;  2DA1 A;  4RDU A;  5DS9 A;  3CMY A;  3B6C A;  1OJL A;  1RES A;  4A3C J;  2HDD A;  4DYQ A;  3LNQ A;  2O8K A;  9ANT A;  3I4M J;  3UKG A;  3S1Q J;  3GTQ J;  1JKR C;  1ZR2 A;  3NAR A;  4JX6 A;  4A3L J;  4M3E A;  2X6O A;  3FKI J;  4X1E A;  2COB A;  4D7N A;  3PO3 J;  1CQT A;  2HI3 A;  2XB0 X;  2LVS A;  2ECC A;  1XG1 A;  2FX0 A;  4IHY A;  3ZOB A;  3TP0 A;  1MBK A;  2LR8 A;  1QVU A;  1IJW C;  5C4J J;  4M3D A;  1ORK A;  3S1R J;  1A6I A;  1XC5 A;  3HOY J;  2K40 A;  1AHD P;  2JA6 J;  4A3B J;  5J1Y A;  1W0U A;  3GTL J;  1JT6 A;  4XK4 A;  1X2N A;  2XGD A;  2XGE A;  3JRD A;  1U9N A;  2OF7 A;  2LKX A;  1F36 A;  5FKL A;  5HOD A;  1RR7 A;  5FKN A;  1NK3 P;  3LSR A;  3SJM A;  1RKW A;  2HQ5 A;  2M8G X;  2EZK A;  2YU9 J;  1ETW A;  3O8H A;  3BG5 A;  5EZH A;  3CQZ J;  2FD5 A;  4D7M A;  4DW6 A;  3LSG A;  1ZK8 A;  5FKK A;  3RZO J;  4MFD A;  3HGY A;  3PO2 J;  2Y2Z A;  1IGN A;  2ID6 A;  4B1R A;  4NDL A;  5F04 A;  5IOZ A;  1WGX A;  2DMU A;  5K7H A;  2TCT A;  2EBI A;  1TWF J;  2R7Z J;  2DA3 A;  3A02 A;  2WB1 N;  5FJ8 J;  5EEA A;  3TED A;  1ETV A;  1HDD C;  4BBR J;  5GPC A;  3HBL A;  1JTY A;  2JA8 J;  5F08 A;  5IP6 A;  4S0H B;  1TC3 C;  4MO7 A;  5JLW A;  4V2G A;  3VPR A;  3JRE A;  3BTI A;  5C4X J;  5E3N A;  2G0E A;  2M0C A;  1LFB A;  4FE7 A;  4G12 A;  3Q0V A;  5M5X J;  2L9R A;  3MVP A;  1IDZ A;  3HOW J;  1MSE C;  4BXX J;  2Y0S N;  3BR6 A;  2M2E A;  4XRS A;  2Y31 A;  1JUS A;  2XPW A;  3DCF A;  4A3D J;  3BTC A;  1VI0 A;  3JRH A;  2JK3 A;  3A03 A;  3S2D J;  2M34 A;  5F0H A;  1APL C;  1T33 A;  3BR2 A;  1U9O A;  4W97 A;  4A3G J;  1ETO A;  2CU7 A;  4W1U A;  3GTP J;  1K61 A;  2ZB9 A;  2R5Y A;  2H8R A;  1MH4 A;  3LSP A;  1H8A C;  1X58 A;  1MBG A;  4XID A;  5JLX A;  5FKO A;  2LK2 A;  3OOU A;  2X48 A;  2L0K A;  1NTC A;  2JJ7 A;  1AKH A;  1AKH B;  3JRF A;  5M5Y J;  4JX4 A;  2NVX J;  2O9L A;  3CCY A;  3L1P A;  4A3F J;  3IH2 A;  3ZQF A;  1JGG A;  3HOU J;  3I4N J;  2E2I J;  2R92 J;  3TP3 A;  5IYB J;  3QPS A;  1VFC A;  3S1N J;  2DMT A;  2K9N A;  2LD5 A;  1TWA J;  1DU6 A;  1PUF A;  1PUF B;  1BW6 A;  3A01 A;  3A01 B;  1AU7 A;  1ZKG A;  3BR0 A;  2QCO A;  1FTZ A;  2DA7 A;  2H1K A;  2NVY J;  3JR9 A;  3ZQG A;  3FIS A;  5EDN A;  5IYC J;  3SDG A;  3GTJ J;  5M3F J;  2TRT A;  1RKT A;  1JUP A;  1SAN A;  1X2M A;  2E2J J;  1GT0 C;  2NS7 A;  4D5C A;  2EZI A;  5EF6 A;  5E3M A;  2IEK A;  3BTL A;  1MBF A;  4D5F A;  1D5Y A;  2XPU A;  2ME6 A;  2B63 J;  3MKL A;  4BBS J;  1GVD A;  2E1O A;  1FIP A;  4DYR A;  4A3I J;  1GV2 A;  4Y52 J;  5J1R A;  1F43 A;  2NVQ J;  2EH3 A;  1E3O C;  2AO9 A;  1I6H J;  2VKE A;  1FEX A;  4Y7N J;  2DA6 A;  3QPL A;  3QQA A;  3BG3 A;  3W6V A;  1VF9 A;  1JJ6 C;  4LOC A;  2ID3 A;  1WH7 A;  3HB9 A;  3BTJ A;  5IPA A;  5F1J A;  1GV5 A;  2X9D A;  1OFC X;  4DYC A;  5EG0 A;  5EG0 B;  3PM1 A;  1EF4 A;  4C2M J;  4C3J J;  2Y9Y A;  3K2A A;  1ETQ A;  4A3M J;  3S2H J;  2GM4 A;  3HDD A;  1MBH A;  2K9S A;  2Y9Z A;  4L5E A;  1ETY A;  3ZQC A;  4A3E J;  5DTD A;  5EGO B;  5EGO A;  3BG9 A;  3G1O A;  2IBD A;  1ZGW A;  4V2F A;  5F0F A;  4XRS G;  1LE8 B;  1LE8 A;  1LFU P;  4UUT A;  3M3Y J;  2LFB A;  1WH5 A;  4JYK A;  4MLO A;  1R9T J;  3S17 J;  2VI6 A;  2L7M P;  2DN0 A;  2R5Z A;  2R5Z B;  2EZH A;  3OSG A;  1HDP A;  2CJJ A;  2MW8 A;  5K7Z A;  2I10 A;  2IAI A;  2E19 A;  1Z0X A;  2XRL A;  2K9Q A;  1QRY A;  2DA2 A;  2KT0 A;  4QSH A;  4FTH A;  3M4O J;  4BY7 J;  3WHB A;  5GP9 A;  1U78 A;  2DJN A;  2DMQ A;  2EQR A;  3JRG A;  5J1U A;  1ENH A;  2XSD C;  4GFB A;  3JRA A;  2ELK A;  2JWT A;  3HGG A;  2XPV A;  1VND A;  1U8B A;  2ME0 A;  4A3J J;  4RBO A;  1JKQ C;  3RKQ A;  2DMP A;  1ETK A;  2HXO A;  1HF0 A;  4AYB N;  1QVT A;  4A3K J;  1ZTR A;  2JMW A;  1JT0 A;  1HOM A;  4AUX A;  2AHQ A;  4BKX A;  4M6V A;  3LOC A;  3B6A A;  4XRM A;  1OCT C;  2NS8 A;  5F27 A;  1Y1W J;  1ITY A;  4I6Z A;  1S7E A;  4QIW N;  2D5V A;  1P7J A;  1GDT A;  1OCP A;  1A5J A;  4B3A A;  2DTZ A;  5IP7 J;  3BT9 A;  5J3L A;  3H3V K;  3Q0U A;  3HM5 A;  1TWG J;  2R0Q C;  2PMZ N;  1WPK A;  5GPA A;  2DA4 A;  5FLV A;  3H0G J;  2M9H A;  1IRZ A;  2WAQ N;  4XIC A;  2P81 A;  2YUS A;  3FK6 A;  3GTM J;  2LP0 A;  2XB5 A;  3FIW A;  2HOS A;  1SFO J;  1H89 C;  1O4X A;  4M3G A;  2QF7 A;  1ETX A;  3JRI A;  4X6A J;  3TW7 A;  2MGQ A;  1I3Q J;  3BR3 A;  1TWH J;  1H88 C;  1ZQ3 P;  4AC0 A;  2LY9 A;  2JN6 A;  4DZJ A;  5IP9 J;  2DMN A;  4MIM A;  1UHS A;  1JJ8 C;  2MSY A;  4FIS A;  2CQX A;  1QPI A;  2LTP A;  5M3M J;  1WCM J;  3D1N I;  5E3L A;  3O8G A;  3F0C A;  4IHW A;  2ECB A;  4BY1 J;  1JUM A;  1IG7 A;  3FK7 A;  3Q0W A; 
#chains in the Genus database with same CATH topology
 1BJZ A;  4OIQ F;  5BNG A;  1N25 A;  2VKH A;  4GXO A;  4LG0 A;  5F0C A;  2F5F A;  2RN7 A;  2WA0 A;  5ILU A;  3P9C A;  1B8I A;  2JA2 A;  1KGS A;  1SVL A;  4F55 A;  4DGW B;  3P7N A;  5IOY A;  1UG2 A;  3WTX C;  3HXL A;  2LH9 A;  2ZO4 A;  5TIS C;  1A36 A;  3BZ6 A;  4I7H A;  3A2K A;  2LYC A;  4PJL A;  1IRX A;  3K9T A;  2BHZ A;  2HQN A;  1FBU A;  4Z2Y A;  2DQR A;  1Z3Y A;  2Z99 A;  1WI3 A;  3QYE A;  2XF5 A;  3CUQ C;  1IN6 A;  4EJU A;  3S16 J;  2CWE A;  3M1C A;  4II3 A;  4OIO F;  4ESF A;  4ABZ A;  2QYO A;  1SD6 A;  1Z21 A;  2XAU A;  3GZ5 A;  4A5N A;  4IL6 C;  5HS7 A;  2QEN A;  2P5V A;  2EIK H;  4GO1 A;  4NQW B;  4FX0 A;  3LMM A;  4CYC A;  2BVM A;  5IT9 K;  1T0F A;  1MMD A;  2B7E A;  1FBS A;  3BR5 A;  1R1V A;  3BZC A;  4J19 A;  3E7L A;  3QYB A;  2DFH A;  3CDL A;  1MJ9 A;  4DIQ A;  4CCK A;  5TJJ A;  2CQQ A;  2VPR A;  2HXI A;  1UMQ A;  3DTE A;  1GUU A;  3W6J B;  1FIA A;  5BS6 A;  1XSV A;  2CV2 A;  3QU6 A;  2GWR A;  4F3Q A;  4H4K C;  1RPW A;  2L5Q A;  5HLG A;  1Y56 A;  2JA7 J;  1XDS A;  4CXF A;  1FJL A;  5ICF A;  3HOX J;  1S9H A;  2Q0O A;  3ZPL A;  1V54 H;  2HYJ A;  1K83 J;  3ZQQ A;  1YRN A;  3SZT A;  2QGU A;  1SFU A;  1WJF A;  3I3L A;  3R6S A;  2EV0 A;  5M5W J;  4EEF G;  4AIK A;  2NOJ B;  2NS0 A;  2OQG A;  4KT5 C;  3H5N A;  1BI0 A;  2FQ4 A;  4M9Z A;  1BL0 A;  1UAA A;  5IY5 H;  4G8X A;  4MFE A;  1HQC A;  1FX7 A;  4CH7 A;  3ECH A;  2VKD A;  2HNH A;  3MKZ A;  2VXD A;  3S93 A;  3H1C A;  4XKW A;  2PMU A;  1LNW A;  4JP0 A;  4NUB A;  4Y15 A;  1BW5 A;  2RNG A;  1YIJ I;  3J81 K;  3E6D A;  2KRF A;  5B3S H;  1MIJ A;  3GFM A;  1YIT I;  2MFZ A;  1KA8 A;  1OQY A;  1FWZ A;  2LRE A;  3KZI C;  3RI4 A;  1B72 A;  5GTI C;  4IHV A;  4IF4 A;  5C3E J;  1YS7 A;  1OIS A;  3KEQ A;  4NC6 A;  4XN3 A;  5FRO A;  2AXT C;  1VZ0 A;  4EJT A;  5E3O A;  3S15 J;  2QKL B;  2XKP A;  1YYV A;  1CF7 B;  4CHU A;  5DS9 A;  4IOC F;  2DTR A;  3CMY A;  2WWY A;  4ASN A;  1W5S A;  3TQN A;  3J7A O;  3LNQ A;  2O8K A;  3J7A Y;  2QSF X;  4KIS A;  2IJL A;  3KLO A;  4XBF A;  3GXO A;  1KQ0 A;  4XR6 A;  3J80 K;  1UCR A;  3MZ8 A;  4M3E A;  3FX3 A;  4X1E A;  2COB A;  4D7N A;  1CQT A;  4MTD A;  3AG3 H;  1TZL A;  3OMY A;  3WE3 A;  1WZ2 A;  2ECC A;  3DEE A;  1X1P A;  3V7C A;  3A1Y A;  4BHP A;  3ZOB A;  1SFX A;  2ISZ A;  3ELK A;  1QVU A;  3AFH A;  2VON A;  1NG6 A;  2P8T A;  2CV0 A;  3NRV A;  1A6I A;  1XC5 A;  1YTY A;  3CCU I;  3HOY J;  2K40 A;  1AHD P;  3ML6 A;  3FF5 A;  4BJ6 C;  3I59 A;  2JRM A;  2UUZ A;  5D5V B;  4GYG A;  5TRD A;  1H9G A;  2XKO A;  1JT6 A;  1QU3 A;  1D1C A;  2XGD A;  4A6D A;  4OAY A;  2OF7 A;  3QWL A;  3GVA A;  1F36 A;  5FKN A;  3H9Q A;  2HQ5 A;  5DCM B;  1X1A A;  2RQQ A;  3S8P A;  1WSU A;  2EZK A;  5L3B A;  3QOE A;  1KYZ A;  5CVR A;  5E8G A;  2K7L A;  5EZH A;  3CQZ J;  3CUQ A;  4C30 A;  4D7M A;  3L7W A;  1ZK8 A;  5FKK A;  4IHS A;  3H36 A;  2D2W A;  5HLT A;  3KEY A;  2ID6 A;  1P2F A;  1WKM A;  3KP6 A;  4BHC A;  2STW A;  2XAF A;  3OS1 A;  5HNH A;  2TCT A;  2EBI A;  3WTU C;  4ENN A;  4B48 A;  1T0F C;  1R7J A;  4XLN F;  5HDN A;  3RYP A;  1SFK A;  2H8W A;  2V9K A;  2Z16 A;  3M8J A;  3WTS C;  3W3C A;  1R23 A;  2F5E A;  5GPC A;  2OUM A;  1R1T A;  3AL0 B;  3BWG A;  4MO7 A;  2LRD A;  4BGD A;  4YFK F;  3ABL H;  5F64 A;  5GAE J;  1K4S A;  3OS2 A;  5LGN A;  2QA4 I;  1LFB A;  4YEJ A;  4EJW A;  3HTU A;  4NHJ A;  2IGN A;  2L9R A;  3FMR A;  3HOW J;  4MNU A;  2EIN H;  3BR6 A;  3OYA A;  3PNT A;  2Y31 A;  4G7H F;  3EYI A;  2CSO A;  3BTC A;  3JRH A;  1NHA A;  2JK3 A;  3LFK A;  2OTL I;  1NG7 A;  1S5L C;  5BPI A;  1JI8 A;  5F0H A;  1KZH A;  2LKP A;  4XKB A;  2D1H A;  3VSK A;  1XD7 A;  4U7B A;  5DUK A;  3BJ6 A;  4W1U A;  4O3M A;  2Q2E A;  1E3H A;  2CQK A;  4E7H A;  2Y48 A;  3TGN A;  3BG7 A;  3LSP A;  2K02 A;  2IW5 A;  2IA0 A;  2O3F A;  5FKO A;  4CIC A;  2FF4 A;  5BOX A;  1D0Z A;  2JJ7 A;  3L09 A;  1QZE A;  1AKH B;  2M4G A;  3PQJ A;  3FXL A;  5FFX A;  5KK1 A;  2O9L A;  4LLL A;  4F52 A;  5D5X B;  2R7S A;  4A3F J;  3HOU J;  1JGG A;  3I4N J;  2R92 J;  3TP3 A;  3S1N J;  2KMU A;  2HPM A;  3RYR A;  1PUF A;  1J2X A;  2OD5 A;  4KMF A;  2R7O A;  2BEO A;  3A01 A;  1AU7 A;  1ZKG A;  1WFX A;  3LFU A;  1XDU A;  1LDD A;  3ZQG A;  3GTJ J;  5EDN A;  5IYC J;  4RLF A;  4KDP A;  4OMY A;  3LAP A;  1REP C;  2CYY A;  5CQG A;  2ADU A;  5B5E C;  2H27 A;  1SAN A;  4XLC A;  2ZXW H;  1X2M A;  1ULY A;  2CFO A;  3U9G A;  1WRJ A;  4ESB A;  1ZRD A;  4E4H A;  4HEA 2;  4ZTF A;  2RRE A;  1GT0 C;  4P9U A;  5EF6 A;  2HQA A;  2R7F A;  4A6E A;  3H9G A;  1BIA A;  2IP2 A;  1MD0 A;  2LBF B;  1SAU A;  2HTS A;  3OYL A;  3MKL A;  2LOO A;  3JSO A;  1GVD A;  2GAU A;  4AID A;  1BC7 C;  4IOA F;  1R5H A;  4PSW A;  3G3Z A;  2RVC A;  4DYR A;  5DCF A;  1MMN A;  3OYM A;  1Z6T A;  3K1P A;  2A69 F;  2GOM A;  1MKM A;  1E3O C;  2CQN A;  4M74 A;  1I6H J;  2DFI A;  2CGP A;  2L3D A;  2Z9O A;  3KX2 A;  2XHK A;  4LOC A;  3BTJ A;  4PUS A;  5F1J A;  4L9V A;  1LFP A;  1IAW A;  4GDF A;  2PLY A;  1U5T C;  4PFO A;  4C2M J;  4BDZ A;  3K2A A;  1ETQ A;  5HLI A;  2LKS A;  2DK8 A;  3HDD A;  4F7Z A;  4ZTJ A;  2A5W A;  1ETY A;  4KIF A;  3ERM A;  5DTD A;  4WXH A;  5DM6 F;  5EGO B;  2IBD A;  5IT9 Z;  3HZJ A;  1Y8Q B;  3MWM A;  4U7D A;  1G3T A;  3CDI A;  4JYK A;  4MLO A;  5HS8 A;  1YFH A;  3I5U A;  3S17 J;  3M9A A;  4CZC A;  2L4A A;  2DN0 A;  2LMD A;  3OL4 A;  5LEJ A;  4HLX A;  4D1Q A;  1LKX A;  3CZ6 A;  4L0Y B;  1YJW I;  2M30 A;  1HDP A;  3FXJ A;  1SVO A;  1P92 A;  5B1B H;  1RR8 C;  2OC6 A;  2ZSH B;  3KYC B;  3M4O J;  4BY7 J;  3WG7 H;  3F9K A;  5B66 C;  3IP4 B;  2IA1 A;  1XCB A;  3FZV A;  1ENH A;  3JRA A;  3HGG A;  3IL2 A;  1A31 A;  2DPU A;  4YEL A;  2ICW G;  4N9H A;  4A3J J;  2WAD A;  1VQK I;  4IXA A;  4BYY A;  3RKQ A;  3H3Z A;  2WBM A;  2HXO A;  2WTE A;  4OWR B;  2OBP A;  2XUB A;  4AYB N;  1QVT A;  4Z6Y A;  4BQO A;  1ZTR A;  2FQ3 A;  3EQL F;  4CUG A;  1SEU A;  5BPD A;  3RSN A;  1D8K A;  3HSE A;  2NS8 A;  4PFP A;  2HVS A;  2RC4 A;  5LHH A;  3EYY A;  1ITY A;  2HVR A;  1P7J A;  2C6Y A;  4YRV A;  4CCJ A;  2CMP A;  2G7H A;  2O8X A;  4ENJ A;  2DTZ A;  5IP7 J;  3Q0U A;  2PMZ N;  1WPK A;  3DKX A;  3LQQ A;  1HSJ A;  1X19 A;  5K5R A;  5FLV A;  3LA7 A;  4L0Z B;  2HTJ A;  3QP5 A;  3W2A A;  4J01 A;  4HNT A;  3FMQ A;  4BEH B;  1BN5 A;  1D0Y A;  3R0J A;  4LGW A;  4RAG A;  1ZYR F;  3DWL E;  2P81 A;  4BXU A;  1BOA A;  3GTM J;  2EIL H;  1IN8 A;  2HOS A;  4IHT A;  2IPQ X;  1FSH A;  4HG2 A;  4I01 A;  1RNL A;  1ETX A;  3E6C C;  2H6C A;  1MDM B;  2DJI A;  3DTK A;  4N9I A;  3JRI A;  1BR2 A;  3H35 A;  3CF5 F;  1B9N A;  1U6G A;  1FZP B;  1K4T A;  1PUE E;  3ROU A;  5E79 C;  1ZQ3 P;  5D8K B;  2LY9 A;  2JN6 A;  4EM0 B;  3IRR A;  1UB9 A;  1UHS A;  1JJ8 C;  3ZGK A;  4XON A;  4FIS A;  3L2R A;  5B1A H;  2QM3 A;  2DLL A;  2DT6 A;  3K4B A;  5KAF C;  1QHH D;  3E97 A;  3FBN B;  4NC7 A;  4R1H A;  1W7P A;  2Y0S A;  2DO7 A;  3IWF A;  4IRG A;  2JSC A;  2BE5 F;  1JUM A;  3TKY A;  3A0H C;  2VE9 A;  2R5Y B;  2ZXJ A;  2WAE A;  4WF2 A;  3SFZ A;  5DDG A;  3T8R A;  1GLN A;  1FOX A;  2P5K A;  4LG0 B;  3ZQI A;  3V42 A;  1A04 A;  3VSL A;  5J8C A;  1FMV A;  2GA1 A;  2MG4 A;  3MEX A;  1JXS A;  1B8I B;  1UST A;  2PJR B;  3IH3 A;  3D1N I;  1I50 J;  2FJ1 A;  5C44 J;  4M72 A;  1TBX A;  1YHQ I;  4XKV A;  3KPH A;  3G71 I;  4E7I A;  1O3T A;  2ZC2 A;  2VL8 A;  3FHZ A;  4EAT A;  1XCV A;  4PJJ A;  2JSP A;  1OPC A;  1MND A;  3HC7 A;  2RAE A;  2BYV E;  5KVR A;  1VQ8 I;  4RA2 A;  2W85 A;  2R7T A;  2DDB A;  5HDG A;  3AAF A;  3VDX A;  3KLN A;  4I98 B;  3GFL A;  5HLH A;  2E60 A;  2W48 A;  4CYC B;  1WJA A;  3GTK J;  1J0R A;  3HEF A;  4BS9 A;  2E7X A;  3O2P E;  1IV8 A;  2WV1 A;  5FKM A;  2M45 A;  3CP2 A;  3RQI A;  4QTR A;  1WWX A;  1H0M A;  2UV1 A;  3L2Q A;  2VOD A;  3LSJ A;  1EH6 A;  2EFQ A;  4JX5 A;  1JKO C;  3TMO A;  2P6T A;  1T38 A;  4WWC A;  1OCR H;  4UUS A;  2HYG D;  2E2H J;  4Y13 A;  4PK4 A;  5L3C A;  5FD6 A;  5FGM A;  2MH2 A;  5ILV A;  1USS A;  2X1D A;  3K7A J;  1XB4 A;  1F5T A;  1O7L A;  1MBE A;  1YRN B;  2RQP A;  2CRG A;  4KMU X;  1X1C A;  1VQM I;  3CLO A;  4RS8 A;  4IEJ A;  4AVZ A;  2LY1 A;  2E36 A;  5K7F A;  1P4A A;  3CTA A;  2HOT A;  1U5T A;  3GWZ A;  3OYF A;  1LEB A;  1Y1V J;  1SMY F;  1OCZ H;  2L7F P;  2MA3 A;  4G6D A;  1I1G A;  5HNF A;  2FU4 A;  2DOA A;  2F4I A;  3C2B A;  2F4M B;  2LY2 A;  1XS9 A;  1F4K A;  2CG4 A;  4XSZ F;  5E1Z B;  2ZJ2 A;  3JRC A;  1Z6R A;  3CC2 I;  3OYJ A;  2BY1 A;  2KIQ A;  2M4K A;  5HVQ C;  2V4J C;  4A0Y A;  3S14 J;  4B44 A;  2FXA A;  1YO5 C;  1VQ4 I;  3PJR A;  2M87 A;  1N78 A;  4UXN A;  3FWE A;  1RZ4 A;  1VQO I;  3G1M A;  5EZG A;  5DD8 A;  4U0Y A;  4Q4Z F;  1B72 B;  5ERI A;  2OPT A;  2M1B A;  5JVG F;  1MNM C;  5TGT A;  4XLP F;  4E7Z A;  2FA5 A;  3G1L A;  2AQE A;  2ESN A;  3QPH A;  3PUB A;  1SD5 A;  2DA5 A;  1BA5 A;  3DV8 A;  2DYR H;  3VYR B;  1G59 A;  3W2V A;  1QPM A;  2VC0 A;  2KZV A;  2QBY A;  3G6E I;  4RDU A;  4N4N B;  1CF7 A;  1DP7 P;  1YS6 A;  3B6C A;  4P5O A;  1RES A;  2GZW A;  3W6K B;  5GAG J;  2HDD A;  2QSH X;  4P9F A;  3CCQ I;  2DBB A;  2L9S A;  1P9Q C;  5LGU A;  1X3U A;  3UKG A;  3GTQ J;  3GFI A;  5D4S A;  3HHH A;  3NAR A;  4NNJ A;  1ZR2 A;  2ZXH A;  4HLY A;  3JCU C;  2LG4 A;  3F8N A;  4BH9 A;  1HKS A;  2J5O A;  3OV8 A;  2X6O A;  3FKI J;  4KIC A;  2HI3 A;  1KU2 A;  2LVS A;  4XL9 A;  1OYY A;  1XG1 A;  2FX0 A;  3ZN1 A;  4IHY A;  4PGH A;  2VT3 A;  2L9V A;  1MJB A;  2LR8 A;  2P5L C;  4L5I A;  2I8D A;  3BC8 A;  4HOB A;  2NNN A;  5C4J J;  4B8X A;  1FSE A;  4BDY A;  3QPT A;  2FNA A;  2JA6 J;  5E8I A;  5J1Y A;  3BRO A;  1SMT A;  2UZK A;  1W0U A;  1I3A A;  3AG2 H;  3ZQ7 A;  3K4C A;  4XK4 A;  3TBI A;  4I2O A;  4MHG A;  1L3L A;  1Y0U A;  2A5Y B;  1C0W A;  3OR1 C;  4KN4 X;  3ZMT A;  1U9N A;  3M1E A;  4UVC A;  5FKL A;  4CCM A;  1NK3 P;  3BLY A;  1RKW A;  5BQT A;  2O61 A;  2YU9 J;  1ZGJ A;  5L3D A;  3DP7 A;  3K69 A;  4GRI A;  1SD7 A;  2R7X A;  2FD5 A;  1PJR A;  1ZG1 A;  2JVH A;  4DW6 A;  3LSG A;  2X6Y A;  1EA3 A;  4MFD A;  1Z05 A;  3E5X A;  5L3E A;  1G8X A;  2Y2Z A;  4BQQ A;  5LHG A;  3F6V A;  2DMU A;  3A0B C;  2Y0M A;  5E1X A;  5K7H A;  3V8J A;  1XGO A;  2EWN A;  1BOB A;  3L2U A;  1U0J A;  1RIO H;  2BW3 A;  2XRN A;  4U88 A;  2XIG A;  4BBR J;  1CGP A;  2HZT A;  3HHG A;  3HBL A;  2JA8 J;  2RNJ A;  3BOQ A;  4RB2 C;  1TC3 C;  4HQM A;  3K1M A;  2FEZ A;  2PQ8 A;  2VQH A;  3C3W A;  4M9X A;  4EQQ A;  1KQ8 A;  3BTI A;  4ZDP A;  4BJT A;  4J00 A;  2OA4 A;  4EVI A;  1K7A A;  2A05 A;  2A6T A;  4C2T A;  3EDP A;  4AU7 A;  3FXM A;  5AON A;  2KIU A;  5CVV A;  1ZLK A;  5DYM A;  1GXQ A;  1UHM A;  1FOY A;  3CJR B;  2DT5 A;  3OIQ A;  4CSW A;  4E70 A;  2XAH A;  3QRF F;  4A3D J;  1XTA A;  2KJC A;  4XLE A;  3PIO F;  3M8E A;  5AIQ A;  2DOD A;  4RGR A;  1T33 A;  3CJT B;  3KIO A;  3AKZ A;  1U9O A;  4W97 A;  2EFW A;  1XSD A;  3FKJ A;  3O6B B;  2PMH A;  4OIN F;  4A5M A;  2R7Q A;  2ZB9 A;  3VWB A;  2K9M A;  2YX4 A;  4HZF A;  3DTI A;  1MH4 A;  3C18 A;  4BUP A;  3H3U A;  4U0V A;  1X58 A;  1R5I D;  3WU1 B;  1P4W A;  1HKQ A;  3OYB A;  5JLX A;  4QPQ A;  1KON A;  5ICE A;  3TOB A;  2X4H A;  3QOD A;  1NTC A;  3SZG A;  1AKH A;  3WTY C;  3JRF A;  5KAI C;  2ZBK A;  3DU6 A;  1DGR M;  1TW2 A;  5FRM A;  1YJN I;  2QQ8 A;  3CCY A;  2B0L A;  2EFP A;  3IH2 A;  3ZQF A;  3OOP A;  3GEZ A;  3GX4 X;  2DMT A;  2W25 A;  4XKC A;  5ED4 A;  2XF6 A;  3W2W A;  1VTN C;  1HBX G;  4UNO A;  3QOP A;  3R0A A;  2X6X A;  3ISP A;  1Z91 A;  1FTZ A;  3KCC A;  1QO0 D;  3JR9 A;  1S29 A;  4WXC A;  4HF0 A;  2PEX A;  4AIJ A;  2DCE A;  3S32 A;  3I56 I;  1RKT A;  3OYD A;  3IC7 A;  2W4S A;  4RMN A;  3CCM I;  2G7U A;  3F21 A;  2DT7 B;  2DXI A;  3HUG A;  4BNC A;  4LK0 F;  3ABM H;  2E2J J;  1SFE A;  4HX7 A;  4JBA A;  1J9I A;  2ZNZ A;  4D5C A;  2EZI A;  5E3M A;  1VQ7 I;  4CYD A;  1R49 A;  4IO9 F;  3PFY A;  3FXR A;  2JVG A;  3BTL A;  1UZC A;  3F3X A;  3X2Q H;  4RB3 C;  2LBF A;  3VYS B;  2XPU A;  3D5L A;  2ME6 A;  4BAC A;  4BBS J;  2KDO A;  1FIP A;  3JW4 A;  1F43 A;  2NVQ J;  4E7J A;  2EH3 A;  3SHF A;  3CCS I;  2AO9 A;  1U3E M;  2ZJR F;  2DA6 A;  1ZEL A;  3QQA A;  3BG3 A;  2AS5 F;  2K86 A;  3DQV C;  3W6V A;  2M7A A;  4A2U A;  2ZKZ A;  5JFR A;  2BV6 A;  5IPA A;  1GV5 A;  1XMK A;  2BY0 A;  3E3V A;  3IUO A;  1W1W E;  2X9D A;  3HOS A;  3PM1 A;  4RAY A;  3S3N A;  4ANJ A;  5J6X A;  1ZAR A;  2M5W A;  2BVL A;  5H6R A;  1EH8 A;  2VQC A;  2EFN A;  2NYX A;  3WGG A;  5EGO A;  4A3E J;  3G1O A;  1BBY A;  1B4A A;  3S3M A;  4V2F A;  5F0F A;  2IA2 A;  1D1A A;  2EIJ H;  2QLZ A;  3L2W A;  4F91 B;  1LFU P;  2LFB A;  1ZGA A;  4M71 A;  1WI9 A;  1WH5 A;  3F8C A;  3HRU A;  4KIT B;  5LEK A;  3WTV C;  1DPU A;  1S8N A;  4FAS D;  1WHU A;  2ACJ A;  1J5Y A;  3GF2 A;  2HZD A;  3OSG A;  2PBI A;  5K7Z A;  3V7R A;  2I10 A;  2ETH A;  2E19 A;  1Z0X A;  2LF7 A;  2K9Q A;  1DDN A;  1ACI A;  2P7C B;  2W1O A;  1W5T A;  5J1U A;  4OMZ A;  2JWT A;  4AIH A;  3RPU A;  3SQN A;  1U8B A;  4UB8 C;  2ME0 A;  4RBO A;  4YIR X;  3K0L A;  1IN5 A;  4UUV A;  1WVR A;  3F8B A;  2ZJP F;  3BPV A;  1MMS A;  4XRF A;  1HKT A;  4EM2 A;  2LSO A;  4CZZ A;  3DEU A;  2Y69 H;  1HOM A;  3MZY A;  4AM3 A;  2G9W A;  2F6C A;  1OCT C;  3B6A A;  3IRQ A;  4RAZ A;  5JR3 A;  3ZMD A;  3CLQ A;  5HOO A;  3H9J A;  3C7J A;  1LDJ A;  2IXS A;  5F27 A;  1O7F A;  4RGX A;  4G7Z F;  4HDV A;  2HVQ A;  5D6E A;  4M6X A;  3H3V K;  3I64 A;  3HM5 A;  1ZRF A;  2L2O A;  2R0Q C;  2X6W A;  1IUY A;  5GPA A;  3V8L A;  2DA4 A;  1X1B A;  3F6O A;  1GHC A;  4G9Y A;  2M9H A;  1AA7 A;  5CLS A;  3DBR B;  1IRZ A;  2A3S A;  4BEH A;  4XIC A;  3OWT A;  3LQR A;  2O6G E;  5JI6 A;  2YUS A;  2CQ7 A;  3FK6 A;  1HXD A;  3LSK A;  2LP0 A;  3FIW A;  3U21 A;  3WTW C;  5LD2 C;  1O4X A;  1BI1 A;  2KIF A;  2QF7 A;  3U1K A;  5E1W A;  1IRF A;  1OLT A;  4C9Y A;  4Y17 A;  4WXD A;  3IKV A;  3REO A;  4RLQ A;  1VQN I;  2IGK A;  1I3Q J;  3BR3 A;  1TWH J;  4BXF A;  3K70 C;  1EV7 A;  2K5C A;  2WY8 Q;  2CW0 F;  1I1S A;  3I58 A;  2DMN A;  1IXS B;  3ZMZ A;  4FX4 A;  4LLG F;  3NWT A;  4XN0 A;  2R3S A;  4P96 A;  4EJV A;  1V5F A;  5E3L A;  1Z7L A;  4GYI A;  2B9S A;  2V1U A;  3F72 A;  2VXZ A;  3O8G A;  2WC2 A;  3DPU A;  4BY1 J;  2PJP A;  2X0L A;  3F22 A;  4EGZ A;  5ICG A;  2V26 A;  1V3F A;  4YII A;  2R5Y A;  1W0T A;  3FMS A;  3ABU A;  2XV4 S;  3TO9 A;  2GLO A;  1B6A A;  3CP8 A;  3BP8 A;  3IAM 2;  2JA5 J;  2NOG A;  3PL8 A;  2EZL A;  3J81 Z;  1XMX A;  3NEU A;  1E17 A;  1PVE A;  2PJR A;  1ON1 A;  2PG4 A;  4DZP A;  1P7I A;  2FBK A;  3ZQL A;  2CUF A;  4YFN F;  1K6O A;  2XDV A;  4D9J A;  4KYW A;  2MC3 A;  3ZMV A;  2CUE A;  3KP7 A;  2IS1 A;  2MC4 A;  1S7O A;  2FMY A;  1JTX A;  1G6N A;  1T56 A;  2QVO A;  3JTH A;  4BAY A;  1XMA A;  1RET A;  2H94 A;  3ASO H;  3ZXS A;  1FY7 A;  4KA4 A;  1DU0 A;  2W84 A;  1YW9 A;  1DP3 A;  1ZAO A;  4XM3 A;  2CFX A;  1R58 A;  2F4O B;  2KL4 A;  1YW8 A;  2PFB A;  3DBH B;  5DM7 F;  2CS3 A;  2V7F A;  1P4X A;  1ON2 A;  5D5W B;  4KN7 X;  5LFA A;  2EV6 A;  5CQE A;  1WJE A;  2KRH A;  5IYD J;  2EA4 A;  1R71 A;  1IDY A;  3PUF A;  2R93 J;  2A07 F;  4XNF A;  5EYR A;  4O5V A;  3VYT B;  3GLL A;  1S7A A;  3I71 A;  4G6T B;  4L9J A;  2FOW A;  4Q48 A;  2Y30 A;  1IW7 F;  3GTO J;  4ZYH A;  2BXZ A;  2J5P A;  2BY3 A;  2QQ9 A;  1QQI A;  1XGN A;  2XGC A;  4UUS B;  3N97 A;  1HW5 A;  2LLK A;  4HX4 A;  1FP1 D;  1STZ A;  2K4J A;  2OCC H;  4BQN A;  3IV5 A;  4NBQ A;  1BC8 C;  1MSF C;  1IZ1 A;  3H5A A;  2GIV A;  3J80 Z;  2F5D A;  1VQ9 I;  4AYB A;  2VJI A;  3B02 A;  2KDZ A;  2NNY A;  3EPZ A;  1X4P A;  2QQB A;  3ERE D;  1U5T B;  1BM9 A;  3C2H A;  2V9P A;  3ZQH A;  4A93 J;  4DOZ A;  5FO5 A;  1D5V A;  1FLI A;  3OY9 A;  2ZXI A;  2QUF A;  2Z1D A;  3EUH A;  3NAU A;  3D0S A;  3GBG A;  2M7B A;  5ILS A;  2F5V A;  3KP4 A;  1LJ9 A;  1FOW A;  2CUZ A;  5FD5 A;  1I6X A;  3HYI A;  3OYK A;  1RUO A;  1I27 A;  2R7U A;  1UEL B;  1MBJ A;  4A69 C;  2MD0 A;  1IC8 A;  4A12 A;  3TW6 A;  1R00 A;  1JHF A;  3B73 A;  3E5Q A;  3FDY A;  1FOK A;  2ELJ A;  2W00 A;  4NC8 A;  2JQ7 A;  2KP6 A;  3K1N A;  1G3S A;  3DEW A;  1POG A;  2L01 A;  2YS9 A;  2DFF A;  1ZG5 A;  2XAG A;  2L9N A;  3T0Y A;  3OSF A;  2BBY A;  3JRB A;  3ESW B;  1I5Z A;  2QBY B;  1T39 A;  1N77 A;  1FYM A;  1OJL A;  2H09 A;  4DYQ A;  2D1V A;  3H92 A;  1H9T A;  1QGP A;  4FQG A;  1R36 A;  5BMZ A;  1LVK A;  3MCZ A;  3S1Q J;  1JKR C;  2QQA A;  4ENK A;  4JX6 A;  1W7P D;  2NAZ A;  3ABT A;  2STT A;  2KPM A;  3GZN B;  1ZRE A;  1E3P A;  4XOT A;  2HQR A;  2JPB A;  1IXR C;  5HDK A;  2XB0 X;  1F9N A;  2E1N A;  3ABK H;  1V55 H;  2IT0 A;  4HBL A;  3CO6 C;  1MBK A;  1KU3 A;  3FBI B;  3K4M A;  4CA0 A;  3WOD F;  5GTH C;  5CVJ A;  4M3D A;  1D8J A;  4XSX F;  4LG3 A;  3S1R J;  2K3P A;  2ELH A;  4QPO A;  5A2Q K;  4A3B J;  5H20 A;  3ULQ B;  4EV0 A;  4ZYD A;  4LIV A;  3PSF A;  3VFZ A;  3JRD A;  2XAS A;  3MMY B;  4E7L A;  1S72 I;  1RR7 A;  3JSP A;  4X0G A;  3R60 A;  3LSR A;  4PSX A;  1DGW Y;  3SJM A;  5JHU A;  4V19 K;  1YE9 A;  3CUO A;  4KNY A;  1ETW A;  1Y0N A;  1OCC H;  4MGR A;  1T08 B;  1FPQ A;  3HGY A;  4MQV A;  3IKT A;  3PO2 J;  2DOE A;  1IGN A;  5F1R A;  1XGS A;  3U1D A;  4Q5S F;  4B1R A;  4NDL A;  3MZH A;  3CD6 I;  5IOZ A;  1WGX A;  2UXN A;  2CH0 A;  1K6Y A;  3CDH A;  1WQ2 A;  2R7Z J;  2DA3 A;  3A02 A;  2LF8 A;  5EEA A;  3TED A;  2BW3 B;  5J4Y A;  4HQE A;  4ZJZ A;  1ETV A;  3DFG A;  3DPL C;  4RB1 A;  1HDD C;  1J59 A;  3I9V 2;  3M8F A;  3VB2 A;  4FT8 A;  1YLF A;  2OJE D;  2WB1 A;  2BY2 A;  2V1D A;  3I0T A;  5JLW A;  4V2G A;  4JOM A;  4UVA A;  5D4R A;  3HTS B;  3JRE A;  1TW3 A;  1V5G A;  2HOE A;  2HYF A;  5C4X J;  2XVC A;  4K2E A;  3GLX A;  3H5R A;  4HRI A;  3DBL B;  2WV0 A;  5M5X J;  4G12 A;  3Q0V A;  2H6B A;  3MVP A;  4Y3O A;  1IDZ A;  3VYU B;  2Y0S N;  3D5S C;  3BZK A;  2M2E A;  4XRS A;  2XPW A;  1O3R A;  1W4M A;  2OV7 A;  5CPR B;  4BHB A;  1R4N B;  1U8R A;  3S2D J;  2M3A A;  1AOY A;  1K78 B;  2GXG A;  1APL C;  3DPT A;  1E2X A;  4HF1 A;  4YG2 F;  1HW2 A;  2Z3Y A;  3GTP J;  1K61 A;  1DQU A;  2OQR A;  1UJ8 A;  3OS0 A;  2H8R A;  1MNE A;  3HL2 A;  2UWM A;  5J47 A;  2GXB A;  2VOO A;  3V7S A;  1O57 A;  4HSR A;  1WJ5 A;  2EV5 A;  4EM1 A;  3J7Z I;  1E0E A;  3G4S I;  3ECO A;  1LDK B;  4D0P A;  4ZYG A;  2HFH A;  1T8I A;  2JPC A;  1ZHF A;  2GOX B;  2OZU A;  4JX4 A;  3DLL F;  3I54 A;  1XN7 A;  2VJJ A;  3K70 D;  3UNG C;  3A4C A;  5D8L B;  3E6B A;  3L1P A;  1UG0 A;  4ON0 A;  4OAZ A;  4HX8 A;  1R22 A;  3CMA I;  3CC7 I;  1YJ9 I;  5IYB J;  5LHI A;  2JUC A;  3J7Y J;  4ZYE A;  2K9N A;  1TLH B;  1TWA J;  5FLX K;  1DU6 A;  4IX7 A;  3LSM A;  4PJ0 C;  3VOD A;  1BW6 A;  3BR0 A;  2QCO A;  2H1K A;  5J40 A;  3KFW X;  3FIS A;  5M3F J;  2KJB A;  4AWX B;  1FYK A;  2TRT A;  2JRT A;  2V9V A;  3G73 A;  1JUP A;  3I4P A;  4AD9 A;  5K1Y A;  3ZRG A;  4HYE A;  1T2K A;  4U87 A;  3HUG B;  4L18 B;  5FRN A;  3SEQ A;  3FHN A;  3MQ0 A;  1FYL A;  4F93 B;  2CW7 A;  2HWV A;  4D5F A;  2CV1 A;  3AL0 C;  3CCR I;  2B63 J;  3Q9V A;  5IT3 A;  2E1O A;  3LL7 A;  1TQI A;  1R4M B;  2E5N A;  1JHH A;  3OYC A;  4DJA A;  4A3I J;  4E7S A;  1GV2 A;  3KP2 A;  4Y52 J;  1OCO H;  2FML A;  2AQF A;  4B3X A;  4IQJ A;  4L5J A;  1FEX A;  2NXN B;  4Y7N J;  3QPL A;  4O6J A;  1L0O C;  1IF1 A;  3K6G A;  2D45 A;  1ERD A;  2E7W A;  2ID3 A;  5A2Q Z;  1WH7 A;  2ZME B;  3HB9 A;  4A0X A;  2FRH A;  4XLA A;  1Y39 A;  1OFC X;  2KLO A;  2OAZ A;  3HRM A;  5EG0 B;  2DPD A;  5FB2 A;  2E34 A;  4C3J J;  2Q8K A;  2GM4 A;  1RI7 A;  1KYW A;  1YX3 A;  1OKR A;  4L5E A;  2A61 A;  1XX5 A;  1OYI A;  2FUG 2;  4XRS G;  1LE8 A;  2VC1 A;  3GCM A;  2VPL A;  4S04 A;  4UUT A;  2R7D A;  4KIG A;  4JQF A;  4UHT A;  2VI6 A;  2ESH A;  2R5Z B;  2E35 A;  3OYN A;  2HR3 A;  2EZH A;  3CJN A;  2QSG X;  2PX9 A;  1LEA A;  3KE2 A;  3R61 A;  2XAJ A;  3WE2 A;  2CW8 A;  3F23 A;  1QA6 A;  4RGU A;  2XRL A;  3F8F A;  1QRY A;  1SVM A;  2KT0 A;  4QSH A;  3RKW A;  4YIF A;  2Z2S B;  2XF7 A;  3HJE A;  3T1B A;  4CGZ A;  4OIP F;  5GP9 A;  1Z7U A;  1U78 A;  2DJN A;  2DMQ A;  4MEX F;  1UHW A;  4XMY A;  2XSD C;  4GFB A;  1QBJ A;  2OTJ I;  2O5R A;  2XPV A;  3MKW B;  1NH3 A;  1VND A;  2R7W A;  3FXU A;  3E1S A;  2DMP A;  4YFX F;  1HF0 A;  2R4G A;  3S2W A;  1JT0 A;  2JMW A;  4M9S A;  4N4O B;  2AHQ A;  3OYH A;  1W36 D;  5JVT A;  4M6V A;  1HST A;  3LOC A;  4XRM A;  2TDX A;  5L3G A;  4UVB A;  3HKZ A;  2HKX A;  3GFJ A;  4I6Z A;  1S7E A;  4QIW N;  2D5V A;  3FXK A;  1GDT A;  1A5J A;  5JHF A;  1K79 A;  1WJD A;  3CO7 C;  3SEZ A;  3LST A;  4ZH4 F;  1QZY A;  2L54 A;  5F6F A;  1N75 A;  5FFZ A;  2HEO A;  1TWG J;  3KZY A;  1FNN A;  2GXA A;  5DEQ A;  3WG9 A;  1YW7 A;  2BZT A;  4RM2 A;  1XSX A;  1J7K A;  2ISY A;  3K4L A;  4CCO A;  4E7K A;  1TP4 A;  2K85 A;  3QU3 A;  2W57 A;  1TNS A;  2XB5 A;  2XGX A;  5DUI A;  1OR7 A;  3L2C A;  1RRJ A;  1AWC A;  1D1B A;  1YIO A;  2KHM A;  3E5U A;  4N0B A;  1FC3 A;  3T5X A;  4C2U A;  1PP7 U;  1F1Z A;  2VAS A;  2YX7 A;  3GW2 A;  4X6A J;  2WAF A;  1LVA A;  1PYV A;  3WU0 A;  2LC2 A;  3TW7 A;  2MGQ A;  3DXJ F;  3ZR8 X;  2X1C A;  5J4V A;  3ASN H;  2MAB A;  2CQX A;  3CJQ B;  1QPI A;  4IPA A;  2AXL A;  2LTP A;  3LAJ A;  5M3M J;  2DOF A;  1JGS A;  5CYV A;  3F0C A;  4DBR A;  4H0E A;  4IHW A;  1YG2 A;  2ECB A;  2KRC A;  2MD5 A;  3MFK A;  1ZRC A;  3FK7 A;  3D5R C;  2HU9 A;  2XRO A;  2FNP A;  3CCL I;  4R8H A;  4U0W A;  1BIB A;  5FLX Z;  1NK2 P;  4C3H J;  4G7O F;  1D3Y A;  3VEP A;  1IV6 A;  2HDC A;  4QLC U;  4I09 A;  3GTG J;  5LLQ A;  4IJA A;  1WJB A;  2RKH A;  4IVN A;  5D6F A;  2PMZ A;  3BR1 A;  1PP8 F;  1BI3 A;  3RZD J;  1PDN C;  1TQM A;  2EK5 A;  2O7O A;  2F48 A;  1R6R A;  5KHD A;  2OU2 A;  3RQ4 A;  5LRS A;  2RV8 A;  1TWC J;  3CMM A;  4M3B A;  4LJZ F;  4S05 A;  1YX5 A;  2OCE A;  3IHU A;  1TT0 A;  4Y33 A;  1MJA A;  4Y4R A;  4CO8 A;  2GBY A;  5E17 F;  2HOA A;  2DK5 A;  4I0A A;  2M0M A;  2W7N A;  1Z67 A;  3ZMS A;  1VQ5 I;  3BJA A;  2IS4 A;  3RKY A;  5EJC A;  2KZG A;  1FP2 A;  3S3O A;  3EET A;  1KU7 A;  3HOZ J;  2QWW A;  2VJ5 A;  2V6E A;  4NQW A;  3L2V A;  2K9L A;  2VKV A;  3EUA A;  1JKP C;  3TOA A;  2YSR A;  3N05 A;  3V8K A;  1R5G A;  1BR1 A;  1ZR4 A;  1QHG A;  1T95 A;  2IGM A;  2V79 A;  3OIP A;  3ZP5 A;  3Q3S A;  1Q1V A;  4HW0 A;  1IO2 A;  2WAQ A;  4HNV A;  2YPR A;  4NB5 A;  3K4N A;  4OOI A;  4PGG A;  4LD5 A;  1LPQ A;  4IHX A;  3NWS A;  4FE4 A;  1Z77 A;  1SC7 A;  3LSI A;  2V1N A;  1IUF A;  4M3F A;  2MLK A;  5ICC A;  3CCE I;  4UV8 A;  1HLV A;  4XLH A;  2P4W A;  3CCV I;  2NVT J;  4B4C A;  3IAS 2;  3BG6 A;  4I76 A;  3DKY A;  2FBI A;  2VUM J;  3LA2 A;  3WHC A;  2DI3 A;  3FXQ A;  4KJZ A;  1YI2 I;  3OIO A;  4Q47 A;  1FMW A;  3S1M J;  3DLA A;  2VBW A;  5GAH J;  3H0D A;  4EGY A;  3GUD A;  2DAO A;  3SZP A;  3KYD B;  4R79 A;  2ZNY A;  4RAF A;  2L7K A;  3WTT C;  4FCY A;  1OYW A;  2L7Z A;  3RPQ A;  4IZZ A;  2N8G A;  3SDB A;  2Y75 A;  3BCA A;  3DF8 A;  1G2H A;  1O3Q A;  3HKZ N;  4PJM A;  3SFI A;  3BQZ A;  5FLM J;  1FTT A;  5L3F A;  3BQY A;  1HCR A;  2E1C A;  1YOV B;  2VT2 A;  4KIB A;  3WGH A;  2P6S A;  3NQO A;  4FET A;  4CDG A;  3MKY B;  1R1U A;  1EH7 A;  2EIM H;  4XOR A;  1XPX A;  3IH4 A;  3K4J A;  3MN2 A;  3RTR A;  1MH3 A;  5AIP A;  3JTG A;  3E6M A;  2GQQ A;  1RUN A;  3HOV J;  2DA1 A;  2VJ4 A;  4IRH A;  3RKX A;  2HS5 A;  1VQP I;  1ZH5 A;  4A3C J;  2W24 A;  4LK1 F;  1QNT A;  3GME A;  4AVP A;  9ANT A;  5H6Q A;  3I4M J;  3PQK A;  1Z9C A;  2Q1Z B;  3OYI A;  2HPI A;  2IS2 A;  5EEG A;  3K2Z A;  6PAX A;  3TL4 X;  3I53 A;  4A3L J;  1RC9 A;  3PO3 J;  4GGG A;  2FBH A;  4UB6 C;  2ZCW A;  2A68 F;  4HF2 A;  3I55 I;  3TP0 A;  4BE0 A;  3AG1 H;  1Y8R B;  1IJW C;  2EB7 A;  5LBQ A;  1ORK A;  2XSJ C;  4LMY A;  2EJR A;  2O03 A;  3M07 A;  1O3S A;  1VQL I;  3I59 B;  2E1M C;  4PDK A;  2K27 A;  3RIR A;  3GTL J;  2KKO A;  1X2N A;  2F5C A;  1Z1D A;  2XGE A;  2ZJQ F;  1J75 A;  2LKX A;  4MTE A;  3PSI A;  3HSF A;  5HOD A;  1B9M A;  3HG9 A;  3CES A;  5DCM A;  2M8G X;  3HRS A;  4HV5 A;  3QYF A;  3PNY A;  2QKM B;  3RJP A;  3HPG A;  3O8H A;  3BG5 A;  1BR4 A;  2E1M B;  3CUQ B;  1EKE A;  4HAM A;  2HGC A;  3RZO J;  4LLN A;  4BQA A;  2ZME C;  1MMG A;  4CCL A;  1LB2 A;  2PN6 A;  3QP6 A;  4MEY F;  2K3F A;  2DDA A;  2HDW A;  1V5E A;  5F04 A;  4CCN A;  3R4K A;  2WY7 Q;  1TWF J;  3FXO A;  1ZN2 A;  3COA C;  2WB1 N;  5FJ8 J;  2BOL A;  2MYS A;  1U2W A;  2E71 A;  4UV9 A;  4DBQ A;  2DU9 A;  2L4M A;  4EJO A;  1JTY A;  2A6E F;  3SXY A;  4DNC A;  5F08 A;  1B1B A;  2X51 A;  4S0H B;  5IP6 A;  3C1D A;  3E0J B;  1ZLJ A;  2VBY A;  4A0Z A;  3JAM K;  2M8E A;  3BDD A;  4I0B A;  3VPR A;  3SYT A;  5E3N A;  2G0E A;  2M0C A;  3OL3 A;  3HOT A;  3GZ6 A;  2KQR A;  1TQP A;  4FE7 A;  3RPU D;  2JZY A;  5K5Q A;  1WJC A;  4ZDO A;  2FOK A;  3HSR A;  1MSE C;  4BXX J;  4P55 A;  5DD4 A;  1IN4 A;  2F2E A;  1JUS A;  3DCF A;  3RCO A;  1X3W B;  2ZFU A;  1VI0 A;  2KIM A;  3QAH A;  2BXY A;  3A03 A;  3BY6 A;  4KT6 A;  2M34 A;  3JAM Z;  2P0W A;  3BJO A;  2NVU B;  1K78 A;  3BR2 A;  1A35 A;  4B09 A;  3WTZ A;  4A3G J;  1ETO A;  2CU7 A;  2H1L A;  1QZZ A;  1BI2 A;  2NRA C;  2Q2E B;  1T6S A;  1SD4 A;  2CO5 A;  2EFO A;  4IQ4 A;  2KIS A;  3WGI A;  3OR2 C;  3KYL A;  1TNT A;  1YQA A;  1OMI A;  3LA3 A;  4UY8 I;  1H8A C;  1MBG A;  4XID A;  2PI0 A;  2LK2 A;  3OOU A;  2VBX A;  2X48 A;  4XLF A;  5D5U B;  2O0Y A;  2L0K A;  3T8T A;  1MW7 A;  2NVX J;  5M5Y J;  4L9N A;  3Q9S A;  1Y6I A;  2VOP A;  2IS6 A;  2OZ6 A;  2E2I J;  4GCV A;  1VFC A;  1HW1 A;  3QPS A;  2DYS H;  3DKW A;  3LSH A;  2LD5 A;  2QEX I;  1EJ9 A;  1G4D A;  2W82 A;  2BHY A;  3KEO A;  2I5U A;  1PUF B;  4KFC A;  3A01 B;  1S3J A;  2DA7 A;  5KNL A;  1JE8 A;  2P7V B;  2NVY J;  3EUK L;  4KUM A;  3ZCO A;  3KET A;  4QWQ A;  3SDG A;  3AG4 H;  1M1E B;  4FHT A;  3LWF A;  4B43 A;  2VN2 A;  3N4M A;  3ZN0 A;  3TO7 A;  3PIP F;  4PJN A;  4ESJ A;  2NS7 A;  2DW4 A;  3RDI A;  1TT5 B;  4ITV A;  2IEK A;  5LRR A;  2COM A;  3WU2 C;  1VQ6 I;  2ZSI B;  3PFI A;  1MBF A;  4I02 A;  3K10 A;  4RM3 A;  3P9I A;  4ZYA A;  3F8M A;  1D5Y A;  1W5C C;  2X85 A;  4P1W A;  2IRF G;  1IXC A;  2KFD A;  1MZB A;  4HNU A;  1W36 C;  1ONV A;  3M7G A;  3TDZ C;  3TDU C;  4M6Y A;  1LUJ B;  2VLA A;  5J1R A;  3FM3 A;  5CVU A;  2BGC A;  2VKE A;  2JT1 A;  3O3K A;  2K4B A;  1IN7 A;  1VF9 A;  2MBF A;  5EEH A;  1J09 A;  1JJ6 C;  2E5Z A;  4HV6 A;  2ZME A;  3HIF A;  5K5O A;  1P6R A;  4I99 C;  4WCG A;  2RGV A;  2IGO A;  2GA2 A;  4DYC A;  2MLG A;  5EG0 A;  2LNB A;  1EF4 A;  1KU9 A;  2CUJ A;  1Z3X A;  2DQL A;  2Y9Y A;  2Z5U A;  4A3M J;  4LFU A;  3S2H J;  2ZFW A;  1MBH A;  2K9S A;  3KP5 A;  4JK1 X;  3DU5 A;  2Y9Z A;  3ZQC A;  4XQF A;  1ZGW A;  1BJA A;  3BG9 A;  1I39 A;  1X4O A;  1LE8 B;  5KCM A;  1MMA A;  2EPF A;  3M3Y J;  1MGT A;  1R9T J;  4M73 A;  1B59 A;  2L7M P;  1GXP A;  4XOP A;  2VB6 A;  3KP3 A;  2R5Z A;  1FBQ A;  1IRG A;  4HST A;  3VOE A;  4BE1 A;  4LIU A;  4RGS A;  3GO5 A;  3TO6 A;  1ODD A;  2CJJ A;  4E6K G;  3G2B A;  1SAX A;  2MW8 A;  3CCJ I;  1FT9 A;  4BJ5 C;  2IAI A;  3U2R A;  3OYG A;  1X1D A;  3CF2 A;  2DA2 A;  3L9F A;  4FTH A;  3WHB A;  2L02 A;  1TL8 A;  3P5J A;  2JTV A;  4RB0 A;  2EQR A;  5CVI A;  3L00 A;  3IWZ A;  3JRG A;  5HS9 A;  2X1E A;  2ELK A;  4MQ9 F;  2MH9 A;  3BCB A;  3UR3 C;  2XAQ A;  3HRT A;  3V4G A;  4LB6 B;  4LB5 A;  2GIZ A;  2UXX A;  4G94 A;  1JKQ C;  4ZDL A;  1ETK A;  1T98 A;  1OR7 C;  4BU2 A;  1G3W A;  1ZG3 A;  2A6H F;  4B47 A;  3BPX A;  3KZZ A;  4A3K J;  3CME I;  1HC8 A;  4AUX A;  4IRI A;  4BKX A;  4ZZL A;  4BL0 B;  2LDU A;  4WX9 A;  1D0X A;  2V1X A;  1Y1W J;  3K4K A;  2R7V A;  2R7R A;  3C2G A;  4L9T A;  3EUH C;  1GVJ A;  1OCP A;  4TV7 A;  2FE3 A;  4B3A A;  3ZMU A;  4EMS A;  5E18 F;  3BT9 A;  3HPH A;  5J3L A;  1TTY A;  1UFM A;  3MAJ A;  2V6C A;  4OIR F;  1XGM A;  4ZC3 A;  2RDP A;  5CKT A;  4WK8 F;  3H0G J;  3GYH X;  4HDU A;  4ENM A;  2FSW A;  3ONQ A;  2WAQ N;  4OU0 A;  2Z33 A;  3FM5 A;  2YR2 A;  2VQL A;  1LQ1 A;  2VBZ A;  5DV5 A;  2JUG A;  4BE2 A;  1SFO J;  1H89 C;  4ETS A;  4F92 B;  4M3G A;  4DQ2 A;  1MDM A;  2EA2 A;  1V4R A;  2VE8 A;  3MD2 A;  5LGT A;  3OYE A;  4IKF A;  1KQ9 A;  2VQG A;  2VIX A;  1H88 C;  4G6Q A;  4AC0 A;  1G3Y A;  3PNV A;  4DZJ A;  5IP9 J;  1HA8 A;  4MIM A;  4LIT A;  1S6L A;  2MSY A;  3P9K A;  4PZJ A;  2DFE A;  1DUX C;  1DPR A;  4II2 A;  1X3Z B;  1WCM J;  4HPQ A;  4ZZD A;  2IVM A;  1A6Q A;  2YU3 A;  5H2F C;  1Q1H A;  5J8F A;  2XC7 A;  3CC4 I;  1W7P B;  5E20 A;  4HA8 A;  5CJ9 A;  2HKO A;  2QZ8 A;  3Q5F A;  5GAD J;  4C3I J;  1IG7 A;  3Q0W A;  4PCQ A; 
#chains in the Genus database with same CATH homology
 1W0T A;  1BJZ A;  5BNG A;  1NK2 P;  4C3H J;  1IV6 A;  2GLO A;  3ZQI A;  5F0C A;  2JA5 J;  3GTG J;  2NOG A;  2R5Y B;  2EZL A;  2MG4 A;  1B8I B;  1B8I A;  3BR1 A;  3IH3 A;  1I50 J;  2FJ1 A;  4DZP A;  1P7I A;  3ZQL A;  5IOY A;  5C44 J;  1UG2 A;  2CUF A;  3RZD J;  2O7O A;  2CUE A;  1JTX A;  1TWC J;  4M3B A;  1T56 A;  1WI3 A;  1RET A;  3S16 J;  2GBY A;  2RAE A;  2HOA A;  1DU0 A;  4ABZ A;  3HOZ J;  2W48 A;  4CYC B;  4CYC A;  3GTK J;  3HEF A;  5IYD J;  2VKV A;  1JKP C;  1IDY A;  2R93 J;  5EYR A;  3BR5 A;  1ZR4 A;  2WV1 A;  5FKM A;  3RQI A;  4J19 A;  3E7L A;  4QTR A;  3Q3S A;  1Q1V A;  3CDL A;  2CQQ A;  2VPR A;  3LSJ A;  2HXI A;  4JX5 A;  1UMQ A;  4HNV A;  2Y30 A;  1JKO C;  3GTO J;  1GUU A;  1FIA A;  4IHX A;  4FE4 A;  1Z77 A;  2XGC A;  1RPW A;  4UUS B;  4UUS A;  2E2H J;  2LLK A;  2JA7 J;  1FJL A;  1IUF A;  4M3F A;  3HOX J;  1HLV A;  3IV5 A;  1MSF C;  2HYJ A;  1K83 J;  3K7A J;  1YRN B;  1YRN A;  1MBE A;  2NVT J;  4B4C A;  2CRG A;  4I76 A;  5M5W J;  2VUM J;  3WHC A;  4EEF G;  4IEJ A;  2KDZ A;  5K7F A;  3OIO A;  2HOT A;  2FQ4 A;  3S1M J;  1BL0 A;  3ZQH A;  4A93 J;  1Y1V J;  4MFE A;  2L7F P;  3C2B A;  1XS9 A;  4JP0 A;  1BW5 A;  3NAU A;  4FCY A;  2L7Z A;  3GBG A;  3JRC A;  2N8G A;  3S14 J;  4C3I J;  1G2H A;  3HKZ N;  3SFI A;  1MBJ A;  3BQZ A;  5FLM J;  1FTT A;  3G1M A;  1HCR A;  3BQY A;  5EZG A;  1B72 B;  4A69 C;  1B72 A;  2OPT A;  1IC8 A;  1MNM C;  4IHV A;  5C3E J;  3TW6 A;  3G1L A;  3IH4 A;  3DEW A;  1POG A;  3MN2 A;  2YS9 A;  1MH3 A;  2DA5 A;  5E3O A;  3S15 J;  3OSF A;  1BA5 A;  3JRB A;  3HOV J;  2DA1 A;  4RDU A;  5DS9 A;  3CMY A;  3B6C A;  1OJL A;  1RES A;  4A3C J;  2HDD A;  4DYQ A;  3LNQ A;  2O8K A;  9ANT A;  3I4M J;  3UKG A;  3S1Q J;  3GTQ J;  1JKR C;  1ZR2 A;  3NAR A;  4JX6 A;  4A3L J;  4M3E A;  2X6O A;  3FKI J;  4X1E A;  2COB A;  4D7N A;  3PO3 J;  1CQT A;  2HI3 A;  2XB0 X;  2LVS A;  2ECC A;  1XG1 A;  2FX0 A;  4IHY A;  3ZOB A;  3TP0 A;  1MBK A;  2LR8 A;  1QVU A;  1IJW C;  5C4J J;  4M3D A;  1ORK A;  3S1R J;  1A6I A;  1XC5 A;  3HOY J;  2K40 A;  1AHD P;  2JA6 J;  4A3B J;  5J1Y A;  1W0U A;  3GTL J;  1JT6 A;  4XK4 A;  1X2N A;  2XGD A;  2XGE A;  3JRD A;  1U9N A;  2OF7 A;  2LKX A;  1F36 A;  5FKL A;  5HOD A;  1RR7 A;  5FKN A;  1NK3 P;  3LSR A;  3SJM A;  1RKW A;  2HQ5 A;  2M8G X;  2EZK A;  2YU9 J;  1ETW A;  3O8H A;  3BG5 A;  5EZH A;  3CQZ J;  2FD5 A;  4D7M A;  4DW6 A;  3LSG A;  1ZK8 A;  5FKK A;  3RZO J;  4MFD A;  3HGY A;  3PO2 J;  2Y2Z A;  1IGN A;  2ID6 A;  4B1R A;  4NDL A;  5F04 A;  5IOZ A;  1WGX A;  2DMU A;  5K7H A;  2TCT A;  2EBI A;  1TWF J;  2R7Z J;  2DA3 A;  3A02 A;  2WB1 N;  5FJ8 J;  5EEA A;  3TED A;  1ETV A;  1HDD C;  4BBR J;  5GPC A;  3HBL A;  1JTY A;  2JA8 J;  5F08 A;  5IP6 A;  4S0H B;  1TC3 C;  4MO7 A;  5JLW A;  4V2G A;  3VPR A;  3JRE A;  3BTI A;  5C4X J;  5E3N A;  2G0E A;  2M0C A;  1LFB A;  4FE7 A;  4G12 A;  3Q0V A;  5M5X J;  2L9R A;  3MVP A;  1IDZ A;  3HOW J;  1MSE C;  4BXX J;  2Y0S N;  3BR6 A;  2M2E A;  4XRS A;  2Y31 A;  1JUS A;  2XPW A;  3DCF A;  4A3D J;  3BTC A;  1VI0 A;  3JRH A;  2JK3 A;  3A03 A;  3S2D J;  2M34 A;  5F0H A;  1APL C;  1T33 A;  3BR2 A;  1U9O A;  4W97 A;  4A3G J;  1ETO A;  2CU7 A;  4W1U A;  3GTP J;  1K61 A;  2ZB9 A;  2R5Y A;  2H8R A;  1MH4 A;  3LSP A;  1H8A C;  1X58 A;  1MBG A;  4XID A;  5JLX A;  5FKO A;  2LK2 A;  3OOU A;  2X48 A;  2L0K A;  1NTC A;  2JJ7 A;  1AKH A;  1AKH B;  3JRF A;  5M5Y J;  4JX4 A;  2NVX J;  2O9L A;  3CCY A;  3L1P A;  4A3F J;  3IH2 A;  3ZQF A;  1JGG A;  3HOU J;  3I4N J;  2E2I J;  2R92 J;  3TP3 A;  5IYB J;  3QPS A;  1VFC A;  3S1N J;  2DMT A;  2K9N A;  2LD5 A;  1TWA J;  1DU6 A;  1PUF A;  1PUF B;  1BW6 A;  3A01 A;  3A01 B;  1AU7 A;  1ZKG A;  3BR0 A;  2QCO A;  1FTZ A;  2DA7 A;  2H1K A;  2NVY J;  3JR9 A;  3ZQG A;  3FIS A;  5EDN A;  5IYC J;  3SDG A;  3GTJ J;  5M3F J;  2TRT A;  1RKT A;  1JUP A;  1SAN A;  1X2M A;  2E2J J;  1GT0 C;  2NS7 A;  4D5C A;  2EZI A;  5EF6 A;  5E3M A;  2IEK A;  3BTL A;  1MBF A;  4D5F A;  1D5Y A;  2XPU A;  2ME6 A;  2B63 J;  3MKL A;  4BBS J;  1GVD A;  2E1O A;  1FIP A;  4DYR A;  4A3I J;  1GV2 A;  4Y52 J;  5J1R A;  1F43 A;  2NVQ J;  2EH3 A;  1E3O C;  2AO9 A;  1I6H J;  2VKE A;  1FEX A;  4Y7N J;  2DA6 A;  3QPL A;  3QQA A;  3BG3 A;  3W6V A;  1VF9 A;  1JJ6 C;  4LOC A;  2ID3 A;  1WH7 A;  3HB9 A;  3BTJ A;  5IPA A;  5F1J A;  1GV5 A;  2X9D A;  1OFC X;  4DYC A;  5EG0 A;  5EG0 B;  3PM1 A;  1EF4 A;  4C2M J;  4C3J J;  2Y9Y A;  3K2A A;  1ETQ A;  4A3M J;  3S2H J;  2GM4 A;  3HDD A;  1MBH A;  2K9S A;  2Y9Z A;  4L5E A;  1ETY A;  3ZQC A;  4A3E J;  5DTD A;  5EGO B;  5EGO A;  3BG9 A;  3G1O A;  2IBD A;  1ZGW A;  4V2F A;  5F0F A;  4XRS G;  1LE8 B;  1LE8 A;  1LFU P;  4UUT A;  3M3Y J;  2LFB A;  1WH5 A;  4JYK A;  4MLO A;  1R9T J;  3S17 J;  2VI6 A;  2L7M P;  2DN0 A;  2R5Z A;  2R5Z B;  2EZH A;  3OSG A;  1HDP A;  2CJJ A;  2MW8 A;  5K7Z A;  2I10 A;  2IAI A;  2E19 A;  1Z0X A;  2XRL A;  2K9Q A;  1QRY A;  2DA2 A;  2KT0 A;  4QSH A;  4FTH A;  3M4O J;  4BY7 J;  3WHB A;  5GP9 A;  1U78 A;  2DJN A;  2DMQ A;  2EQR A;  3JRG A;  5J1U A;  1ENH A;  2XSD C;  4GFB A;  3JRA A;  2ELK A;  2JWT A;  3HGG A;  2XPV A;  1VND A;  1U8B A;  2ME0 A;  4A3J J;  4RBO A;  1JKQ C;  3RKQ A;  2DMP A;  1ETK A;  2HXO A;  1HF0 A;  4AYB N;  1QVT A;  4A3K J;  1ZTR A;  2JMW A;  1JT0 A;  1HOM A;  4AUX A;  2AHQ A;  4BKX A;  4M6V A;  3LOC A;  3B6A A;  4XRM A;  1OCT C;  2NS8 A;  5F27 A;  1Y1W J;  1ITY A;  4I6Z A;  1S7E A;  4QIW N;  2D5V A;  1P7J A;  1GDT A;  1OCP A;  1A5J A;  4B3A A;  2DTZ A;  5IP7 J;  3BT9 A;  5J3L A;  3H3V K;  3Q0U A;  3HM5 A;  1TWG J;  2R0Q C;  2PMZ N;  1WPK A;  5GPA A;  2DA4 A;  5FLV A;  3H0G J;  2M9H A;  1IRZ A;  2WAQ N;  4XIC A;  2P81 A;  2YUS A;  3FK6 A;  3GTM J;  2LP0 A;  2XB5 A;  3FIW A;  2HOS A;  1SFO J;  1H89 C;  1O4X A;  4M3G A;  2QF7 A;  1ETX A;  3JRI A;  4X6A J;  3TW7 A;  2MGQ A;  1I3Q J;  3BR3 A;  1TWH J;  1H88 C;  1ZQ3 P;  4AC0 A;  2LY9 A;  2JN6 A;  4DZJ A;  5IP9 J;  2DMN A;  4MIM A;  1UHS A;  1JJ8 C;  2MSY A;  4FIS A;  2CQX A;  1QPI A;  2LTP A;  5M3M J;  1WCM J;  3D1N I;  5E3L A;  3O8G A;  3F0C A;  4IHW A;  2ECB A;  4BY1 J;  1JUM A;  1IG7 A;  3FK7 A;  3Q0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...