4IEJA

Crystal structure of a dna methyltransferase 1 associated protein 1 (dmap1) from homo sapiens at 1.45 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
VQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords DNA methyltransferase 1-associated protein 1
publication title Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution
rcsb
source organism Homo sapiens
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16282 SANT_DAMP1_like SANT/Myb-like domain of DAMP1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4iejA00
4JX6A 3HOXJ 2XSDC 3S1RJ 4FE7A 4BKXA 5M5XJ 3LOCA 4W1UA 3CMYA 1LE8B 1QRYA 1IC8A 1HOMA 2ZB9A 2COBA 2DJNA 1DU6A 3S2HJ 3LSPA 4A69C 1RETA 1K83J 2R7ZJ 3BTJA 2X48A 1TC3C 1ETOA 4XK4A 2OF7A 2W48A 3Q0WA 4XIDA 1JJ8C 4XRSG 1ORKA 4A93J 2M8GX 2VKVA 1R9TJ 1D5YA 5EGOB 2JA8J 3CQZJ 3F0CA 2DA3A 3JRFA 3OSGA 3MN2A 1TWFJ 1B8IA 1MNMC 4G12A 1JKRC 5BNGA 5JLWA 3BTLA 3NARA 3E7LA 1OCPA 4X1EA 4FCYA 5EDNA 3W6VA 1I50J 3BG3A 3QPSA 3TP0A 5K7FA 1SANA 2XPWA 1WH5A 2EZIA 5F0HA 2EBIA 2O7OA 3QPLA 1IGNA 2LK2A 2ME0A 2MGQA 2NS7A 3H0GJ 1ETXA 2L7MP 2GLOA 2GM4A 2EZHA 1JKQC 3G1OA 3SJMA 4JP0A 3HBLA 1U9NA 5M3FJ 3JRCA 3JR9A 2WAQN 1ZR2A 3JRIA 4I6ZA 3ZQLA 3JREA 4I76A 2LKXA 1H8AC 3MVPA 1X2NA 3ZQIA 3FK7A 3M4OJ 2XB5A 5J1UA 3RQIA 1F43A 4L5EA 1W0UA 2I10A 5DS9A 3IH2A 5J3LA 1GUUA 1GDTA 4Y52J 3IV5A 3ZQHA 1H88C 3DEWA 2CU7A 2HXIA 1U78A 1BJZA 3A01B 1LE8A 4B1RA 2DMQA 5EG0B 2LFBA 2HOAA 4B4CA 2D5VA 9ANTA 4JX4A 1OCTC 4BY1J 5C3EJ 5F0CA 4W97A 5IP6A 1Z0XA 2R92J 2DMTA 4QIWN 4BBRJ 1FIAA 1EF4A 5IYBJ 1S7EA 4MFDA 4C3IJ 2RAEA 2GBYA 3RKQA 1ENHA 1ETYA 5M5WJ 4A3IJ 5FLVA 2DA1A 5EYRA 4J19A 2MG4A 1IV6A 3LSRA 1A6IA 4UUSA 2HOSA 2H1KA 1P7IA 2LP0A 2XB0X 3BR2A 2MW8A 4A3GJ 3B6AA 1GV5A 1B72A 2R5ZB 2YS9A 2JJ7A 1MBJA 1HLVA 5IYDJ 3A02A 2DA4A 1X58A 1RESA 2YU9J 1FEXA 2HOTA 1T33A 5C44J 1JTXA 4RBOA 2FX0A 1IDZA 2VKEA 4M3EA 5M5YJ 4D5FA 1VI0A 2B63J 2FQ4A 1NK2P 2Y2ZA 1AHDP 3WHBA 2Y31A 1MBEA 2EZLA 3VPRA 4LOCA 3A01A 3UKGA 5EG0A 4C3HJ 1BW5A 3BG9A 2DMPA 1VF9A 3HDDA 4A3JJ 4DYCA 1HDPA 2XPVA 3LNQA 3SFIA 2TRTA 2CQXA 3BTCA 1VFCA 1ZGWA 1MBGA 4A3EJ 4M3BA 2FD5A 1JUSA 4XICA 1TWCJ 4UUSB 1OFCX 3BR5A 5IOZA 3S17J 1JT6A 5C4JJ 2EH3A 3TW6A 4V2GA 4JX5A 3Q3SA 3HOWJ 3GTOJ 1GVDA 1ZKGA 2AO9A 1B72B 1T56A 2CUEA 4DYRA 3LSGA 3HKZN 1YRNA 2CUFA 2HI3A 2L7FP 1MBHA 2LD5A 3G1LA 3JRBA 1FIPA 3FK6A 4C3JJ 2ECBA 3QQAA 2CRGA 2R5ZA 3S2DJ 1GT0C 2DTZA 1APLC 2E19A 5F0FA 5HODA 2JMWA 3GBGA 2HDDA 3G1MA 1QVUA 2R5YB 4IHWA 4S0HB 4QSHA 3ZQFA 4FISA 1LFUP 3I4MJ 5F08A 2AHQA 3OSFA 2YUSA 3S1NJ 5IOYA 1ETKA 2CJJA 3D1NI 2M2EA 4XRSA 1HDDC 1NK3P 4A3MJ 1JT0A 4MIMA 1K61A 1NTCA 2X6OA 4DZPA 2HQ5A 4CYCA 1GV2A 2LR8A 1XS9A 2E2HJ 2WV1A 1FJLA 1JJ6C 1POGA 1QVTA 3HOYJ 1ZK8A 1XG1A 5IP7J 5FKOA 3MKLA 4A3LJ 2XGEA 5EF6A 5GPAA 3K7AJ 2JA7J 3BQZA 5IYCJ 2HYJA 4HNVA 4IHVA 2E1OA 2MSYA 3BTIA 3H3VK 2JK3A 1WPKA 3HM5A 1JKOC 3JRHA 4IEJA 5IP9J 1UHSA 4XRMA 1YRNB 2M34A 4UUTA 3ZQGA 3GTGJ 2LTPA 2OPTA 3IH4A 3PO3J 4FE4A 1BA5A 3JRDA 4A3BJ 1ITYA 1UMQA 3GTQJ 2Y0SN 3DCFA 5E3NA 5FLMJ 1A5JA 1JUMA 1Z77A 2VPRA 3HEFA 2Y9ZA 5F27A 2H8RA 2K9NA 1IJWC 5E3MA 2XPUA 4ABZA 2FJ1A 1JGGA 2M0CA 3HOVJ 2JA5J 3GTMJ 4AUXA 4GFBA 2XGDA 2Y30A 3PM1A 4A3CJ 1W0TA 3FIWA 2LLKA 3BR0A 3OIOA 2XRLA 1MSFC 2R5YA 4MLOA 4FTHA 1QPIA 4IHYA 1E3OC 4CYCB 1TWHJ 4EEFG 3WHCA 1G2HA 1WH7A 3HGYA 2L9RA 1MSEC 4DZJA 4M3DA 3ZOBA 3CDLA 5GP9A 1JTYA 2O8KA 3TEDA 4B3AA 1H89C 1X2MA 4DYQA 2JN6A 2EQRA 1JKPC 2JA6J 3TP3A 4DW6A 3S1QJ 2VI6A 5EZGA 1Y1WJ 1MBFA 2DA6A 2P81A 5JLXA 5K7HA 3S16J 1RKTA 3S1MJ 3A03A 3Q0UA 2EZKA 5FKMA 1ZTRA 3S15J 1RPWA 2IEKA 3PO2J 4A3KJ 1AKHB 2NVYJ 4AC0A 3O8GA 4JYKA 2DA5A 4V2FA 5EEAA 2N8GA 3IH3A 3SDGA 1IUFA 4BXXJ 4RDUA 3GTPJ 1RR7A 2K9QA 2ID6A 1I3QJ 1IDYA 4AYBN 1WGXA 4D7NA 3HOUJ 2WB1N 2TCTA 1JUPA 5E3LA 3M3YJ 1SFOJ 2VUMJ 2E2JJ 1UG2A 1LFBA 4A3FJ 5C4XJ 4D5CA 3BG5A 3JRAA 2LY9A 3L1PA 5EZHA 1DU0A 1PUFB 2L0KA 2K40A 3HGGA 4X6AJ 4NDLA 5M3MJ 5F1JA 4QTRA 3HOZJ 1VNDA 2IBDA 2NS8A 2O9LA 2R93J 1U8BA 2M9HA 2E2IJ 3NAUA 3K2AA 3B6CA 1IRZA 3BT9A 1ZQ3P 4A3DJ 1HCRA 4D7MA 1CQTA 3RZOJ 5GPCA 1IG7A 1XC5A 1Q1VA 5J1RA 3TW7A 3O8HA 1MH3A 2X9DA 2HXOA 5FJ8J 2Y9YA 3Q0VA 3BQYA 3GTJJ 1RKWA 2QF7A 1FTZA 2DMUA 1MH4A 2CQQA 3C2BA 1TWAJ 1ZR4A 3BR1A 3JRGA 3BR3A 2KT0A 2DMNA 1B8IB 4M6VA 3FISA 1WCMJ 2LVSA 2NVXJ 1BL0A 2ID3A 3FKIJ 1TWGJ 3CCYA 2IAIA 1ETQA 3I4NJ 2KDZA 4Y7NJ 2NVTJ 2QCOA 5IPAA 5DTDA 2R0QC 1AKHA 5EGOA 1I6HJ 2NVQJ 1Y1VJ 5J1YA 3GTKJ 2DA2A 1ETVA 3S14J 4M3GA 5FKKA 4IHXA 4BBSJ 1OJLA 2K9SA 4MFEA 5F04A 1FTTA 5E3OA 1ETWA 5K7ZA 4C2MJ 3LSJA 4BY7J 3GTLJ 2DA7A 2NOGA 2DN0A 1AU7A 1BW6A 3ZQCA 3RZDJ 1P7JA 4M3FA 1HF0A 2ME6A 1MBKA 4MO7A 2L7ZA 2G0EA 1O4XA 1F36A 2JWTA 2PMZN 1PUFA 2ECCA 2XGCA 1WI3A 3OOUA 5FKLA 1U9OA 3BR6A 5FKNA 3HB9A 2ELKA
chains in the Genus database with same CATH superfamily
2EK5A 2XSDC 2QZ8A 4BKXA 5M5XJ 3LOCA 4W1UA 4HDUA 5LEKA 1LE8B 1K6OA 1HOMA 1LQ1A 1U5TA 2DAOA 1UAAA 2HDWA 4A69C 2AS5F 1RETA 1I1GA 3GFIA 4YIRX 1FBSA 5KHDA 4PUSA 5D5VB 2OF7A 2HTJA 1EJ9A 3QYFA 4A93J 2M8GX 1T95A 1R9TJ 5EGOB 3OYFA 2CW8A 2EFPA 3F0CA 1TWFJ 2BY0A 4A6EA 4PGHA 3LL7A 1MNMC 4G12A 1IN7A 2LYCA 4CH7A 2XROA 3SFZA 2KJCA 1ODDA 2OTJI 3CCMI 1E17A 3NARA 2X6YA 2P7CB 1W5TA 2A6EF 2EA2A 1XD7A 2F2EA 4G8XA 2DK8A 4D9JA 3BG3A 2P6SA 4IF4A 4OINF 1S9HA 4C2TA 3BROA 4F52A 4B3XA 3HPHA 4H0EA 4XKWA 2DPUA 4OIOF 4IL6C 1TQIA 4MEYF 2L7MP 3VDXA 3TDUC 1JKQC 5ED4A 1KGSA 3G1OA 5DD8A 3WTXC 3HBLA 5KK1A 2IS4A 2Y0SA 3JRCA 3C1DA 3ZQ7A 4UVAA 1N77A 3OWTA 3JRIA 2LH9A 4YELA 5ILVA 3BG6A 3OS2A 2LKXA 3M4OJ 2ZSHB 2ZKZA 4E7SA 3AG4H 3O2PE 2MBFA 1W0UA 3SDBA 2LMDA 4P96A 3IV5A 4UXNA 1GDTA 3CJRB 4Y52J 2OCEA 3IRQA 3GXOA 5F6FA 1BJZA 2ZO4A 1X3WB 9ANTA 2LFBA 4B4CA 5E1WA 4BE2A 5EEHA 2WV0A 3ABKH 2QEXI 2LNBA 4EM0B 4BY1J 2PG4A 3RSNA 4HYEA 4W97A 1D3YA 3KYLA 2CG4A 2DMTA 4LGWA 5LBQA 3CUQB 4KN4X 4Y33A 4IRHA 1Z9CA 2VKHA 4R79A 2E7WA 4O5VA 4IZZA 4HF2A 1R36A 1MNEA 3PL8A 3V8JA 2I8DA 5IY5H 4XL9A 2FE3A 2DDBA 4BJ6C 3CDIA 1IV6A 2DDAA 1A6IA 4UUSA 1NG7A 2HKXA 4L5IA 4GGGA 3U9GA 4I98B 2NYXA 1SVOA 2LP0A 5DM6F 2V9KA 2MW8A 2W25A 4A3GJ 3B6AA 4QWQA 2R7TA 1B72A 4HX8A 3KP3A 3HKZA 2JJ7A 4DIQA 3W2AA 2G7UA 3DFGA 1QHHD 1FLIA 4XSXF 2DA4A 4GRIA 4IRGA 4ITVA 1RESA 3W6JB 4YIFA 2BHZA 4XOPA 2HOTA 1YX3A 3AAFA 1JTXA 4LB6B 2FX0A 4Z6YA 3P9KA 2WADA 2PJRB 2BGCA 3OYJA 1XDUA 5M5YJ 1I5ZA 2ZMEB 2Z99A 3HL2A 2E1CA 1IRXA 3D5RC 1IW7F 1KU2A 2V9PA 4QPQA 3K70D 3RPUA 3AG1H 1AHDP 2GZWA 1F1ZA 5BPIA 2Y31A 1MBEA 4BQQA 1FYMA 4LOCA 3BPXA 3A01A 3UKGA 1O3TA 1W1WE 1QA6A 1PJRA 1W7PD 2DMPA 5FD6A 1Z1DA 1J2XA 2KIMA 2QA4I 4IXAA 1MZBA 2XPVA 5FFZA 4KIFA 3SFIA 2CQXA 2RKHA 3CMMA 4M73A 1P4AA 2JSPA 3HZJA 2KQRA 2W1OA 1VFCA 4X0GA 1MBGA 3KP7A 3OOPA 2JRTA 1TWCJ 4XN0A 1V55H 5D8LB 2IPQX 4ESJA 3S17J 3RI4A 1JT6A 2C6YA 4WF2A 3SZTA 4MHGA 4I99C 4V2GA 3DTIA 4XM3A 4JX5A 4O3MA 3SZPA 1GVDA 2DFIA 4ASNA 3BC8A 3DPUA 2L3DA 3J81K 4WWCA 4QPOA 1PP8F 2O5RA 1WVRA 5B3SH 4HOBA 3KZZA 5LEJA 4A0ZA 1FY7A 3R60A 4HLYA 1R5HA 4GO1A 1W36D 1FIPA 3C3WA 3FK6A 1HA8A 4MQ9F 2FUG2 3N97A 1GT0C 2DTZA 2E19A 3V4GA 5F0FA 3H3UA 3S3MA 2HDDA 3GBGA 1PYVA 3G1MA 1G8XA 4IHWA 2WC2A 3ZQFA 4NC6A 3K2ZA 4KMUX 3I4MJ 5F08A 5BOXA 3OSFA 3WTVC 1T0FA 4HF0A 3ERED 3KEQA 5F1RA 1NK3P 4M9SA 1JT0A 4U7DA 3H5RA 4DBRA 1K61A 4N0BA 2W82A 2KP6A 4DZPA 1WJFA 2VBWA 3P9CA 3ECHA 5ILSA 2YR2A 2E2HJ 1FJLA 1QVTA 4II2A 4KIGA 1EH6A 2E5NA 5D5XB 2EFQA 2QYOA 5IP7J 1G3TA 2WAFA 3MKLA 5EF6A 3KPHA 3K7AJ 1WI9A 3BQZA 2PEXA 3LMMA 4OMZA 3H9JA 3VEPA 1GVJA 3BTIA 2LBFA 1SFEA 4CYDA 2VBYA 2PFBA 3HM5A 3L00A 5IP9J 3RJPA 1UHSA 4UUTA 3DBRB 2VJ4A 3IH4A 2OJED 4FE4A 3PO3J 3JRDA 4O6JA 4OMYA 1UMQA 2RV8A 2Y0SN 1O7FA 2X85A 1WQ2A 1JUMA 4AWXB 2Y9ZA 2PN6A 1JI8A 1YS6A 2MFZA 1FP1D 3HOVJ 1MJ9A 2DW4A 3K1NA 1P4WA 3A2KA 3OYKA 2RVCA 1K7AA 5H6RA 2BXYA 2KMUA 3PJRA 2KIUA 3GFJA 3K9TA 2R5YA 2K4BA 3DBHB 5HDGA 1G3YA 3C7JA 3R0AA 1Z7UA 4XKVA 2XSJC 3ZP5A 1E3OC 4CYCB 4UB6C 4U0WA 3AL0B 3GFLA 1ZN2A 2K27A 3SZGA 3CP8A 4OU0A 1MSEC 2JVGA 4I01A 4WXCA 4BQNA 4M3DA 2GWRA 3RDIA 5FO5A 3ZOBA 4DZJA 1XGOA 3BG7A 4IOAF 5B5EC 1AA7A 2BY2A 3M8JA 1JTYA 2UXXA 3ONQA 1G3SA 2PMHA 2EV0A 1X2MA 3MCZA 2JN6A 2EQRA 5D4RA 3MKYB 1B6AA 3QAHA 1JKPC 4A0YA 3S1QJ 5HDKA 1MBFA 3T1BA 2P81A 4LD5A 4NC7A 2MC4A 2Y69H 3LQQA 1RKTA 2QQAA 4P1WA 2EV5A 5FKMA 3PSIA 1Y39A 1WJBA 2NVYJ 4RB3C 4XORA 4LG0B 2DK5A 3O8GA 4JYKA 3WE3A 1X3ZB 2L4AA 4BXXJ 2K3FA 2BOLA 2F4OB 4Y13A 2VB6A 2R7SA 3CCQI 1RR7A 2K9QA 1WZ2A 2ID6A 1I3QJ 4AYBN 4D7NA 1WGXA 4AIHA 3HOUJ 2WB1N 3CC7I 1FX7A 5E3LA 2HNHA 2P4WA 2A3SA 2F4IA 2HZTA 1UG0A 4CDGA 1UG2A 4A3FJ 2EFWA 2Q0OA 3QPTA 4KA4A 3LA2A 4RAZA 1MMAA 2LY9A 1IXSB 5DDGA 3L1PA 1YQAA 1DU0A 1T98A 4F93B 1HSTA 4MTEA 4HF1A 4QTRA 1VNDA 1AWCA 3SHFA 3CJTB 4BL0B 2EA4A 1R58A 4A6DA 3H36A 2CUJA 4BXFA 3K2AA 3OYIA 3IKTA 2LC2A 1QO0D 3MD2A 1ZQ3P 4ENKA 4D7MA 3DPTA 3K10A 4KYWA 3RZOJ 4V19K 2DU9A 1U5TB 1SD7A 1UELB 2E1NA 1ZREA 1L0OC 1XB4A 2Y9YA 4PFPA 3GTJJ 4BNCA 1U8RA 1CF7B 2F4MB 5KCMA 3CESA 2Y0MA 1G3WA 2OUMA 2UV1A 3WGGA 4HQEA 2HYGD 4RMNA 2DBBA 2DMNA 4M6VA 1WCMJ 1RI7A 2LREA 3HUGA 3VFZA 3QOPA 2NVXJ 4HPQA 2V26A 3NQOA 2FQ3A 1OYYA 5DTDA 4G9YA 2D1HA 2VBXA 2M4KA 1XMKA 4RAYA 3F9KA 3I58A 4EJTA 4CCJA 1DP3A 5ICFA 4UV9A 3J81Z 5H2FC 1WHUA 5E3OA 3IC7A 2W00A 4PSXA 2X0LA 5K7ZA 4XN3A 2BY3A 4C2MJ 1YJNI 3GTLJ 4M6XA 2R7RA 2BZTA 2DN0A 5DEQA 3WTYC 3DKYA 1EKEA 4KITB 4KIBA 2H8WA 2ZBKA 3M7GA 2L7ZA 1TT0A 2G0EA 1R23A 1SFUA 3F3XA 1O4XA 2AXLA 4L5JA 2L9NA 5HS7A 2JWTA 1IRFA 3H9GA 3OOUA 1OMIA 1V54H 1D1AA 4HW0A 1U9OA 3BR6A 5FKNA 1QZZA 3AFHA 1Q1HA 4BH9A 4HNTA 4JX6A 5CVRA 1OQYA 3FXRA 4EGZA 1WFXA 2X1EA 4PJLA 1IJWC 3ECOA 1IO2A 1IC8A 3KP2A 5BS6A 3MKZA 2COBA 1DU6A 4XNFA 1B9MA 1RIOH 1JGSA 3ZMUA 2Q2EB 3A0HC 2EIMH 3ESWB 2TDXA 2X48A 4CCKA 2X51A 1SVLA 4OIQF 3Q0WA 1ORKA 4XMYA 1ZRFA 2O6GE 1Z05A 3G2BA 3OSGA 4LK0F 1DQUA 1VQKI 2CV2A 1F4KA 2VONA 1USTA 2NS0A 5JLWA 4HAMA 4C30A 4MTDA 5KAFC 5CQEA 5K1YA 4IO9F 3I59A 3LSIA 3DLLF 3IP4B 4CCLA 2BW3A 1G6NA 2JPCA 4FCYA 3W6VA 3QPSA 3TP0A 5K7FA 5KNLA 1SANA 3EUHC 4AVPA 2QBYB 2E36A 5F0HA 4Y17A 2O7OA 3MZ8A 5GAGJ 1X1AA 2ME0A 1HW5A 2MGQA 3HRMA 3ZN0A 3DTKA 1ETXA 4Q5SF 4BHCA 1OLTA 4N9IA 2L5QA 2Y75A 1U9NA 2VQCA 4F91B 3LA3A 3EUHA 1ZR2A 3F72A 3JTHA 5LGNA 2QSGX 3O6BB 4I6ZA 3ZQLA 4I76A 3M9AA 1H8AC 3MVPA 1X2NA 2UZKA 4E6KG 2XB5A 3I64A 5J1UA 2XKOA 1A31A 1YOVB 3RPQA 3HTUA 1MIJA 5CVJA 4M74A 5FLXK 2HOEA 3MWMA 5J40A 3ZQHA 1MJAA 5HOOA 1IN6A 1J7KA 3DEWA 3FMSA 3HOSA 2HPMA 1ZG5A 3A01B 4K2EA 4PJ0C 4B1RA 2YSRA 2HOAA 1W7PA 2F5VA 1FZPB 2WA0A 4JX4A 5C3EJ 5B1BH 2KL4A 4E7HA 3OYAA 3QYEA 3EUKL 3RIRA 1B4AA 1E2XA 4BQAA 1R22A 1GLNA 3LAPA 1QNTA 2LF8A 1FSEA 2M5WA 4L9JA 4ZDPA 3AG2H 4EJOA 1EF4A 5IYBJ 5CKTA 3EPZA 2HWVA 2RAEA 4RGSA 5L3DA 1UHMA 2BEOA 4CO8A 5EJCA 4A3IJ 5FLVA 3U21A 4UUVA 3IKVA 4P9UA 4BDYA 1K79A 1W36C 2EB7A 3CCVI 2MG4A 4CCNA 5HLTA 2L9VA 4P5OA 2VBZA 3ZMZA 3OYHA 2HOSA 2COMA 4AIKA 3IAS2 2Z9OA 2YX7A 2XDVA 2GQQA 2VC0A 1GV5A 1QPMA 3GFMA 1YX5A 2YS9A 2W7NA 1MBJA 4FX0A 5E17F 1HLVA 5IYDJ 4EJWA 3ZXSA 3A02A 1X58A 1C0WA 5AIPA 4MNUA 5DCMB 4F92B 4OIRF 1NHAA 1ZARA 5C44J 1R49A 2VE8A 5K5OA 1IV8A 3FMRA 2GXBA 1RC9A 4BAYA 3BOQA 5JHUA 5LRSA 1BIBA 4PJMA 3ZPLA 3U1DA 5K5RA 3WHBA 2V6CA 1FPQA 4ZZDA 2EZLA 2V1NA 3VPRA 4BEHB 3DWLE 3LA7A 2R3SA 4R1HA 1PP7U 3LSTA 4KISA 4F55A 3M1EA 2EPFA 4DYCA 3CMAI 1HDPA 3KE2A 2VC1A 4GXOA 3JW4A 4CCOA 4ZH4F 4L0YB 1R7JA 4UB8C 2XAHA 4LG3A 3PIOF 3LFKA 3M1CA 4M3BA 1JUSA 2LBFB 4XICA 1OFCX 1MMGA 1ZYRF 1Y0UA 3R4KA 3ASOH 4XONA 1RNLA 2M45A 2DODA 2A6HF 1N75A 4MGRA 3TW6A 4BHPA 4LJZF 2ACJA 4EV0A 3Q3SA 3QODA 3HOWJ 4PK4A 1FOYA 1YW9A 2ZNYA 1FSHA 3FF5A 1IN5A 2DCEA 3UR3C 1GHCA 3LSGA 3J80K 5F64A 3V7RA 4B44A 4PGGA 1VQPI 2CFXA 2L7FP 2W24A 4BE0A 3G1LA 2CQNA 2ECBA 4CGZA 2R5ZA 2BVMA 2FBKA 2A5YB 3L7WA 2ZNZA 2A69F 3C2HA 3QRFF 2KIQA 1BOBA 1QVUA 2R5YB 4S0HB 1ZG3A 4NUBA 5FRMA 1LFUP 1RUNA 2AHQA 3S1NJ 2OD5A 4FT8A 1ETKA 1S3JA 2FBHA 2XF6A 5HNHA 2Q8KA 3GZNB 5FFXA 2Z3YA 1YJWI 3T5XA 4CZZA 1S7OA 1X19A 4R8HA 4RM2A 3WTZA 1GV2A 1TT5B 1W5SA 3ZMTA 4UY8I 1MMSA 1J5YA 3E6MA 4HQMA 2WY7Q 3E6DA 2WV1A 3HOYJ 3FXMA 1ZK8A 2L9SA 4C9YA 1XG1A 4E4HA 3BZ6A 2DO7A 2K3PA 2VE9A 1UZCA 1J09A 3DBLB 5ICEA 1ZGJA 2XGEA 5GAEJ 2B7EA 2R7VA 5IYCJ 1ZG1A 3G4SI 2JUCA 4HNVA 3L9FA 4IHVA 4UVBA 2MSYA 3E5UA 3F23A 1WPKA 1Y8RB 1HSJA 5HLGA 1JKOC 3O3KA 4IEJA 3PNVA 1YRNB 2M34A 3ABLH 2W4SA 2BXZA 1M1EB 2LTPA 1SFKA 3IAM2 3HG9A 4ZYEA 2IGMA 1YI2I 1G4DA 2R7UA 1HKTA 1BA5A 1ITYA 4A3BJ 1J75A 4Z2YA 3KLNA 4PDKA 4NNJA 4BUPA 3GTQJ 4IOCF 2CH0A 4ENJA 2DFHA 5E3NA 5FLMJ 1Z77A 3DU5A 1D1CA 3FXOA 3CCUI 4AYBA 2H8RA 2K9NA 3ASNH 3VYTB 5E3MA 2WB1A 2XPUA 3KP6A 5GAHJ 3PFIA 1V5EA 2CQ7A 5CVIA 5HVQC 3MKWB 1HW2A 4RGUA 1FP2A 1XGNA 4GFBA 4A3CJ 3PM1A 2VL8A 3KX2A 1W0TA 2EIKH 2PQ8A 4UHTA 3FIWA 4UV8A 4XLPF 1FOXA 2R7FA 3BR0A 2V1UA 3OIOA 2X4HA 2JA2A 5TGTA 2X6XA 3OYGA 5D6EA 3WU1B 3A4CA 5IT9K 1PDNC 1X3UA 3ZCOA 2KLOA 4EEFG 4B09A 2XC7A 3QWLA 1GXQA 1MDMB 1LEBA 2BY1A 5J4YA 2VIXA 2FA5A 1WJDA 2L9RA 1F5TA 2IA1A 2NOJB 3CDLA 3BP8A 3LQRA 2FEZA 3EDPA 3TO7A 3ZR8X 1D5VA 2XIGA 2O8KA 3CO7C 4LIVA 4XSZF 3HSRA 4B3AA 3K4JA 4N4OB 3NWTA 3TP3A 1DGRM 2Z33A 3PFYA 4YRVA 2VOOA 2LY2A 2EFNA 1SVMA 4EMSA 2XHKA 2A61A 2QSFX 5K7HA 2KPMA 3H92A 3S15J 1OCZH 1Z6RA 2IEKA 4A3KJ 4HRIA 3TOAA 2BV6A 4I0BA 2QLZA 2RNJA 2G9WA 1VQ6I 2R7QA 4DJAA 2DA5A 2MD5A 3BZKA 4V2FA 5EEAA 2M3AA 3GTPJ 3CTAA 1KQ8A 3FM5A 2ISYA 1IDYA 1OCOH 1WWXA 4RS8A 1T0FC 3GZ6A 4HZFA 1WSUA 3GW2A 2O8XA 1JUPA 2TCTA 1SD5A 3OL3A 3M3YJ 2M87A 3OYCA 1VQMI 1DDNA 1LFBA 3TBIA 5C4XJ 3QP5A 4D5CA 3JAMK 2A07F 2LDUA 3ABUA 2MA3A 3E1SA 2E1MC 3H5NA 1T39A 1NH3A 3G3ZA 2GOXB 3BDDA 3I56I 2L0KA 2EINH 1FT9A 4NDLA 2NRAC 2O9LA 2R93J 1D8JA 1U8BA 4HX4A 4B8XA 3CO6C 1TW2A 3ML6A 1IRZA 3BT9A 4A3DJ 4WX9A 4ENNA 2RNGA 1HCRA 4JOMA 4BU2A 2VN2A 1XC5A 1A35A 3KEYA 2WAEA 1I1SA 1Q1VA 3TW7A 1XSVA 1LDDA 3O8HA 1TQPA 1MH3A 4LFUA 5E1ZB 3CC2I 2P0WA 2JPBA 3FMQA 3E6CC 4FX4A 2CMPA 4NQWB 3CCJI 4CHUA 2CV1A 1T2KA 4I2OA 1TWAJ 1RR8C 2XRNA 3BR1A 3JRGA 2CUZA 3WE2A 3ZN1A 3WTWC 3BR3A 2GAUA 2J5PA 5H20A 5LHHA 2KT0A 3OYDA 1MKMA 5DCFA 2LVSA 3L2WA 2KZVA 4DOZA 4BJTA 1TWGJ 2VJJA 4EM1A 2IAIA 2QQ9A 1K78A 2QCOA 2R0QC 3I59B 5EGOA 3DQVC 3HHGA 5J1YA 4HSRA 3P5JA 2KZGA 3KZYA 4KT5C 5E79C 3S14J 1Z21A 2M7AA 2ZSIB 1H9TA 1VQ9I 2K9SA 3J80Z 5F04A 1S8NA 3LSJA 4BY7J 2ICWG 3R61A 3RZDJ 2DT5A 1LPQA 4XLHA 4I09A 3HOTA 1HF0A 2VLAA 3CP2A 1YJ9I 1BC7C 2HDCA 2D1VA 3I9V2 4EM2A 2E5ZA 4XQFA 5AONA 2D45A 4U0YA 1QBJA 4M9ZA 3OL4A 4M6YA 1PUFA 1K4SA 5FKLA 5LLQA 3WU0A 2P6TA 2CO5A 1STZA 4OIPF 1HQCA 3KFWX 1TLHB 4FASD 3P7NA 5L3BA 3HOXJ 3S1RJ 2PX9A 3CMYA 3X2QH 2M7BA 3ZRGA 2ZB9A 2L54A 3WODF 3LSPA 1FOKA 1T8IA 3SYTA 2CV0A 2FU4A 1K83J 2AXTC 2R7ZJ 1X1DA 1TC3C 5CPRB 1SD4A 1ETOA 1QHGA 1TBXA 4XK4A 2IJLA 3WGIA 1JJ8C 4HV6A 2HEOA 2GA2A 1D5YA 4OAYA 2JA8J 1TNSA 5HS8A 5B1AH 1B8IA 4KDPA 2K9LA 3QP6A 3WG9A 2NNNA 3C18A 1R71A 3WTSC 2Q1ZB 1EH7A 4JBAA 4LK1F 2OCCH 2CYYA 3BTLA 3CUOA 2PMUA 3OV8A 4ZYGA 5D5WB 3LSHA 3I53A 4ZZLA 2ZFUA 2YX4A 1B59A 5EDNA 2PBIA 3FKJA 2WWYA 4NBQA 4AU7A 2B9SA 3HHHA 4MEXF 2EBIA 3DV8A 3QPLA 5DV5A 3S32A 3HJEA 1H9GA 4BACA 4RM3A 2NS7A 3U1KA 3H0GJ 4JP0A 3F22A 5E20A 1BOAA 5M3FJ 2VJ5A 1R1VA 2P5LC 2O61A 4P55A 3JR9A 3I54A 3E5QA 2H09A 3U2RA 2E34A 2ZXWH 2BBYA 2LKSA 3GF2A 1D1BA 3OIQA 1VQNI 3ZQIA 1REPC 5IT9Z 1KU9A 2LG4A 3RQIA 2VT2A 4BYYA 1YS7A 2DOEA 1KU3A 4EATA 2I10A 5DS9A 1G59A 2DOAA 5GTHC 1WJEA 1BI3A 4D0PA 1H88C 2XAJA 3RYRA 2L02A 1U78A 3L2UA 1D8KA 2ZMEA 5DYMA 2DMQA 4ZDLA 2JVHA 1BM9A 2ZJPF 5F0CA 1ON1A 2PI0A 1YE9A 1TW3A 5IP6A 3QU6A 1Z0XA 3TOBA 1VQLI 1D0YA 1YIJI 4QIWN 2XASA 4BBRJ 2LF7A 3T8RA 1DPUA 4CXFA 4E7JA 1S7EA 4MFDA 4C3IJ 5LRRA 1P9QC 3M8EA 3GX4X 4ZTJA 1T6SA 2DYSH 2XAFA 1SEUA 2DA1A 1Z3YA 5EYRA 6PAXA 4RB1A 2ZXHA 3LSRA 2VJIA 1R4NB 2P5VA 3B02A 3TGNA 2H1KA 2LKPA 1WJ5A 5K5QA 1DGWY 2VQLA 1LEAA 1KYZA 3QU3A 1JXSA 4BHBA 3G71I 2R5ZB 2HQNA 3KYCB 3FX3A 4JQFA 4ANJA 1HKSA 4Q48A 4E7LA 2YU9J 1FEXA 4M9XA 3HC7A 5JHFA 4NC8A 1YFHA 1NG6A 2YPRA 4I7HA 1X1PA 4BS9A 4RBOA 3GWZA 4II3A 2K9MA 4M3EA 3E5XA 3EUAA 3L2RA 2STTA 3OMYA 1KQ9A 3NRVA 5E8GA 4PZJA 1BR2A 1NK2P 3VYRB 2Y2ZA 4LLLA 2VODA 5BQTA 3OYMA 3JSOA 3N4MA 1B9NA 1ACIA 2H1LA 5EG0A 1QGPA 4EQQA 4C3HJ 1MNDA 1BW5A 2UUZA 4XLNF 1D0ZA 1VF9A 3I71A 4L0ZB 3LNQA 2TRTA 3I4PA 4U88A 2CFOA 4LMYA 4HLXA 2QENA 3ELKA 1ERDA 3BTCA 3ABTA 2OC6A 1Z6TA 2JUGA 3V7CA 2WTEA 4KT6A 2AQFA 3E0JB 4XOTA 4A3EJ 2VT3A 4GYGA 1ZGWA 2FD5A 1XTAA 1A6QA 4UUSB 3BPVA 5GTIC 3H0DA 3K4CA 4XBFA 2E60A 3V7SA 3MFKA 2EWNA 1BBYA 2ELJA 3TQNA 5C4JJ 2EH3A 1XSXA 2VOPA 2L7KA 3GTOJ 1B72B 2DTRA 5JVTA 2R7WA 2ESNA 2MABA 3K70C 2H6CA 1TP4A 2ZC2A 4IX7A 2LD5A 1LUJB 2XVCA 3QQAA 3S8PA 3E97A 3VWBA 1APLC 3D5LA 4U87A 4CZCA 3PNYA 4H4KC 4AD9A 1LNWA 5BPDA 3MQ0A 4QSHA 4S04A 4FISA 1XSDA 2QUFA 2V4JC 3DP7A 3QPHA 1O3QA 4N9HA 4P9FA 1YYVA 2QM3A 3KZIC 3IWFA 4A3MJ 3KYDB 1UHWA 4MIMA 3BJAA 4DQ2A 4KMFA 3V42A 2M1BA 3GVAA 4KFCA 1NTCA 2M0MA 4HSTA 4CYCA 4RA2A 3VB2A 1XS9A 1E3PA 3A0BC 2F6CA 1ZGAA 2IGNA 1JJ6C 1RZ4A 4EJVA 1FBUA 3I0TA 4PJNA 3ZQQA 3TMOA 3ZMSA 2OQRA 1X1CA 5GPAA 2JA7J 4EGYA 1U0JA 2XUBA 2E1OA 2OZ6A 3H3VK 1XGMA 2JK3A 1SMTA 3HYIA 2J5OA 2HVRA 5GADJ 3JRHA 3H3ZA 4G6DA 1A04A 1XPXA 4L9NA 3S2WA 2RC4A 2BHYA 3V8LA 1OPCA 1Y6IA 1R1TA 2M8EA 2OPTA 3HSFA 3OYEA 5ERIA 1HKQA 1S29A 1V4RA 2X1CA 4LG0A 2DT6A 3H9QA 4RLFA 3DCFA 1LDKB 2O3FA 2VPRA 2DFFA 4ZTFA 4GCVA 3PUBA 4WXHA 1RUOA 3DF8A 2QSHX 2FJ1A 1JGGA 3OYBA 2JA5J 1FNNA 4AIDA 3JSPA 2R7XA 3SEZA 1JHHA 2LLKA 2Y48A 2XRLA 1MSFC 2BE5F 3NWSA 1PVEA 1YITI 1Y8QB 2XF7A 4MLOA 2O03A 2STWA 5FB2A 4FTHA 1QPIA 2E1MB 4IHYA 2VKDA 2I5UA 1JE8A 5KAIC 3WTUC 1VQOI 3KP4A 3CJQB 1TWHJ 5HS9A 5D8KB 4ZC3A 3KLOA 1G2HA 1WH7A 4XLFA 1IRGA 1OISA 2HU9A 2XAQA 3CF2A 1IN4A 1FC3A 4UNOA 1F9NA 2OBPA 2AQEA 3TEDA 3S3OA 1BJAA 3DLAA 4XRFA 1H89C 2JA6J 1BC8C 4PFOA 4DW6A 2QWWA 4ETSA 1Y1WJ 4U0VA 2DA6A 1PUEE 2NNYA 5JLXA 2KRFA 2R7OA 3K4LA 1Y56A 2LSOA 2Z5UA 5H6QA 3SQNA 1CF7A 1FYLA 3KIOA 3I55I 4HV5A 3A03A 3Q0UA 3PSFA 1W5CC 1K78B 2GA1A 2X1DA 4HBLA 3IL2A 1OKRA 1WRJA 1XCBA 2E7XA 3DKXA 3S3NA 3SDGA 2XGXA 3IH3A 1IUFA 2GXGA 4NB5A 5DUKA 4RDUA 4WK8F 1GXPA 3EYYA 3FBIB 3VYUB 3MMYB 1KZHA 2GXAA 4WXDA 3IUOA 1IZ1A 3DU6A 1N25A 1XX5A 2VUMJ 5ILUA 3F8FA 1V5FA 1YHQI 2KRHA 5A2QK 3BG5A 2ZJRF 2P7VB 2V6EA 4U7BA 3KP5A 2OZUA 3OY9A 1O7LA 2R7DA 1XMXA 1PUFB 3HGGA 1QZEA 1XCVA 5F1JA 3FHZA 3HOZJ 1FBQA 2HKOA 2E2IJ 3K6GA 2HTSA 2OU2A 3NAUA 5CJ9A 3TL4X 3CLOA 2OV7A 1Z3XA 4L18B 2KJBA 1CQTA 1ON2A 1R5ID 3LSKA 1BN5A 2OA4A 2FSWA 2CW7A 3K4NA 4XLCA 3H5AA 3Q0VA 2QF7A 2EILH 3C2BA 3D0SA 3J7AY 2K7LA 4LLGF 2Q2EA 2IW5A 1B8IB 4BGDA 5DUIA 3AKZA 2NVUB 2NAZA 4E7ZA 3FKIJ 4NHJA 3CCYA 2PLYA 1ETQA 1I6XA 2KDZA 2IS2A 2NVTJ 5IPAA 1AKHA 1I6HJ 1V5GA 1O57A 3DKWA 1VQ5I 3FXLA 2NVQJ 1Y1VJ 2A5WA 1ETVA 1YIOA 2P5KA 1FWZA 3J7YJ 4AIJA 2Z16A 2MH9A 4IVNA 4M3GA 2QKLB 3H35A 4IHXA 3Q9SA 1OJLA 3FXKA 3ERMA 2HQRA 4Q47A 4G6QA 4G7OF 3K69A 1ETWA 2QQBA 3OR1C 2DA7A 3RTRA 1AU7A 1BW6A 1P7JA 4PSWA 2QBYA 4M3FA 1Z67A 2ME6A 4MO7A 1MD0A 3PIPF 1O3SA 2ZXJA 2W57A 3PNTA 3QYBA 1F36A 3D5SC 3CCEI 4BE1A 2KIFA 1UCRA 5FLXZ 1UB9A 2XGCA 3H1CA 3HRTA 2P8TA 4IHSA 5CQGA 2XAUA 3AG3H 1IF1A 3HB9A 2IGOA 3BWGA 4IRIA 4FE7A 3RCOA 4AVZA 5TJJA 1QRYA 2DJNA 3S2HJ 2XF5A 3CJNA 3BLYA 3BTJA 3HUGB 1J9IA 1K6YA 2Z1DA 2W48A 2RQPA 4XIDA 3M07A 4OAZA 3C2GA 4XRSG 2MH2A 3EQLF 2VKVA 3Q5FA 2ETHA 3EETA 2M30A 3CQZJ 3JRFA 2DA3A 2MLGA 1SAXA 3MN2A 5L3GA 4M72A 4Y3OA 3CDHA 2DQRA 1JKRC 3F8CA 5BNGA 2DXIA 2MD0A 5CLSA 4J00A 3PQKA 2R4GA 3E7LA 1OCPA 4X1EA 4ESBA 3ZMVA 1I50J 1UJ8A 1I27A 2IS1A 2XPWA 1WH5A 4YFXF 2EZIA 3JTGA 2IP2A 4FQGA 2LK2A 1IGNA 1I3AA 4A5MA 2GLOA 4A0XA 5L3FA 2GM4A 2EZHA 4Q4ZF 3MZYA 1HC8A 1BI0A 3WTTC 3SJMA 4YEJA 1YLFA 2E71A 2EFOA 4IJAA 4ENMA 1B1BA 2WAQN 2MYSA 2V7FA 1ULYA 2RGVA 2LOOA 4XKCA 3QOEA 3JREA 3B73A 3COAC 4G94A 2F5CA 2NXNB 4YFNF 3FK7A 2HZDA 4XKBA 5B66C 1F43A 4L5EA 2FOKA 1BR1A 2WBMA 5DCMA 3VSKA 3IH2A 5J3LA 1CGPA 1GUUA 2ZJ2A 1SFXA 5EEGA 2CU7A 2HXIA 1LE8A 5DD4A 5DM7F 3CCSI 1XGSA 2HYFA 3CZ6A 4PJJA 5EG0B 2W85A 2D5VA 1VQ8I 2F5EA 1OCTC 1ZAOA 4IKFA 2GIVA 1JHFA 1S7AA 2B0LA 2R92J 4BEHA 2X6WA 3VOEA 4KNYA 2QGUA 1ZHFA 1FIAA 3GLXA 2V9VA 3DPLC 3GMEA 4KJZA 4CSWA 3RQ4A 5LFAA 4G7ZF 2DI3A 2BW3B 3K4KA 5HDNA 2GBYA 3RKQA 1ENHA 1ETYA 3GYHX 3CCLI 5M5WJ 1MGTA 2FBIA 4J19A 4C2UA 3F8NA 2FNPA 2IT0A 2K02A 3PUFA 3Q9VA 2ZCWA 3K1PA 1YO5C 1YW7A 1BI2A 2IVMA 1DPRA 5HLIA 1P7IA 2XB0X 3BR2A 2KFDA 4IQJA 3RYPA 4E7IA 5TRDA 3E3VA 3E6BA 1R00A 3CC4I 2JQ7A 1U2WA 2GIZA 5A2QZ 2DT7B 3FZVA 1HBXG 1BI1A 1LVAA 4DBQA 1OR7C 1L3LA 1BIAA 2VQHA 1LB2A 3BY6A 4UVCA 3ULQB 2ESHA 2IS6A 2HPIA 2FRHA 5ICCA 3V8KA 3OYLA 1T33A 5LHGA 1LJ9A 3L2VA 3DXJF 3GUDA 4RB0A 1IDZA 2VKEA 3F21A 2OTLI 3BJ6A 2CW0F 4N4NB 1VQ7I 4D5FA 5IT3A 1VI0A 1OR7A 2B63J 1W7PB 1LVKA 2FQ4A 3FDYA 2V1XA 3L09A 4LITA 2PJPA 1AOYA 1P92A 3FM3A 3K0LA 3OR2C 2IXSA 4DGWB 3CUQC 1SMYF 3I5UA 2V1DA 4EVIA 2FXAA 1X4OA 3HIFA 1H0MA 3J7AO 1FYKA 3WGHA 3I3LA 3FWEA 3BG9A 5E1XA 3HDDA 2MC3A 3FXJA 1WJAA 4A3JJ 3F6VA 2ZFWA 3T0YA 3NEUA 3CUQA 4CUGA 1V3FA 3OYNA 4J01A 2IRFG 3J7ZI 2E35A 1QU3A 5D4SA 3BR5A 5IOZA 5L3CA 1EA3A 5BMZA 1ZRDA 3LSMA 4JK1X 2IA0A 4KN7X 4HEA2 2HQAA 4XLAA 1FMWA 2Z2SB 1XN7A 5CVVA 2F48A 4B43A 4A5NA 2VXZA 4AM3A 2VQGA 2AO9A 1ZKGA 4YIIA 1T56A 2CUEA 2DYRH 4DYRA 3HKZN 5FGMA 1YRNA 2CUFA 5CVUA 3K1MA 1S5LC 2HI3A 5AIQA 4A12A 2G7HA 1MBHA 1MW7A 4XR6A 1XMAA 3JRBA 3RKWA 4C3JJ 1OYIA 2KRCA 2CRGA 3HSEA 4WCGA 3S2DJ 5J6XA 3IWZA 1EV7A 2ZMEC 4F7ZA 1ZRCA 5HODA 2JMWA 2IA2A 5LHIA 3BJOA 2FNAA 3G6EI 4QLCU 4Y15A 3G73A 4I02A 4A2UA 2YUSA 4IPAA 5IOYA 2CJJA 4S05A 5J47A 2DJIA 4BXUA 3D1NI 2M2EA 2W84A 2PJRA 3M8FA 1D0XA 2KISA 4XRSA 1HDDC 1IXRC 3HRUA 1LFPA 3RPUD 2CSOA 4HDVA 4GYIA 2LRDA 2PMZA 2X6OA 2HQ5A 4OWRB 2KKOA 2LR8A 4KUMA 4BDZA 5JI6A 1O3RA 1SC7A 2IGKA 1MDMA 4BJ5C 1POGA 3CCRI 3A1YA 1W4MA 2HVQA 2RDPA 2UXNA 3ROUA 1S72I 3W2VA 2DOFA 2EV6A 5FKOA 5D6FA 4A3LJ 2FMLA 2V79A 1ONVA 3BCAA 1DP7P 3FHNA 2UWMA 2HYJA 2DFEA 2FMYA 1WKMA 5J4VA 4D1QA 3CMEI 1ZH5A 3VYSB 4CICA 4YG2F 3MEXA 2HFHA 2ADUA 1TTYA 4RGXA 4XRMA 3IRRA 3WG7H 3ZQGA 4HA8A 3GTGJ 3EYIA 3ABMH 2QQ8A 3OIPA 1VTNC 1Z7LA 3K4BA 3JAMZ 1R1UA 2XV4S 1A5JA 3HRSA 5E8IA 2ISZA 3HEFA 5F27A 4B47A 4RAGA 3OS0A 4ABZA 2K5CA 4ZYAA 4LB5A 2M0CA 1XDSA 3GTMJ 4AUXA 2XGDA 2Y30A 2JTVA 5HNFA 5FRNA 1OCRH 2A6TA 4FETA 3W2WA 3VSLA 4LLNA 2DLLA 4RGRA 2EJRA 4BQOA 1E3HA 3GO5A 2L4MA 3IHUA 1TL8A 3KEOA 1K4TA 1UFMA 1SAUA 3DTEA 4RB2C 1RRJA 1KONA 3GLLA 5TISC 2QKMB 3WHCA 3HGYA 3KCCA 2K85A 2BVLA 4HX7A 5D5UB 3TDZC 1J0RA 2F5FA 5GP9A 5ICGA 3HPGA 4FHTA 2KHMA 2HR3A 2K86A 2CWEA 4DYQA 3T8TA 3BCBA 2DQLA 4LIUA 1EH8A 2VI6A 4IQ4A 2K4JA 5EZGA 4ON0A 4CCMA 1KU7A 2CGPA 4RLQA 3HTSB 3N05A 4GDFA 3CLQA 4DNCA 1R6RA 2ZJQF 4NQWA 4TV7A 2OQGA 4G6TB 4E7KA 3S1MJ 5E18F 3S16J 3UNGC 2EZKA 5JVGF 1ZTRA 3F8BA 1VQ4I 1IUYA 1RPWA 3TO9A 3PO2J 1AKHB 4AC0A 2GOMA 3RKYA 3ZMDA 1T08B 4RAFA 3PQJA 2VASA 3DEUA 4HG2A 1KYWA 2XAGA 4M71A 2N8GA 1LDJA 5HLHA 2OAZA 4MQVA 2YU3A 2QVOA 1HXDA 5FD5A 1BR4A 2JRMA 1X1BA 2HS5A 1ZELA 2A05A 3GCMA 5LD2C 2RQQA 4E70A 1P2FA 2F5DA 4ESFA 1SFOJ 1N78A 2M4GA 2E2JJ 2JSCA 1HW1A 1TZLA 2LY1A 5KVRA 4G7HF 1J59A 1DUXC 4CA0A 1MJBA 3JRAA 1VZ0A 1I39A 5EZHA 1TQMA 2HGCA 3OS1A 3AL0C 5LGTA 1S6LA 4HNUA 3S93A 4X6AJ 2K40A 1E0EA 3LAJA 5M3MJ 2BYVE 3LFUA 2IBDA 2NS8A 2D2WA 3VODA 2M9HA 3JCUC 1ZLKA 4PCQA 1IN8A 3MAJA 2JZYA 3DEEA 3B6CA 1SD6A 3LWFA 5J8CA 1IAWA 2JT1A 3L2CA 1IXCA 1FMVA 2FOWA 3BZCA 4L9TA 2H94A 5L3EA 2A68F 5GPCA 1IG7A 3HXLA 4I0AA 1OCCH 5J1RA 1QQIA 1T38A 1YW8A 2H6BA 3SEQA 4ZDOA 2X9DA 1MMDA 3REOA 2HXOA 5FJ8J 4L9VA 3BQYA 1RKWA 1FTZA 2DMUA 1QZYA 1KA8A 1MH4A 1MMNA 2CQQA 2ELHA 1YTYA 1ZR4A 1X4PA 1FOWA 4XLEA 5LGUA 2L2OA 2RREA 3R0JA 2CQKA 5CYVA 2ZXIA 3TO6A 2VPLA 2MLKA 3FISA 2VXDA 1USSA 1BL0A 3CF5F 2WY8Q 2ID3A 5JR3A 4ZYDA 3ISPA 1R5GA 3I4NJ 3TKYA 2O0YA 4Y7NJ 1TNTA 3L2QA 1A36A 5FROA 2L01A 3K4MA 4IHTA 3GTKJ 3FBNB 3R6SA 2DA2A 2KDOA 3CD6I 3F8MA 5J8FA 4B48A 3KETA 3GZ5A 3P9IA 4KICA 5FKKA 3SXYA 3W3CA 2FF4A 3WU2C 4BBSJ 4ZYHA 1P6RA 4MFEA 1FTTA 4ZJZA 3MZHA 4F3QA 2CS3A 5JFRA 1U3EM 1LKXA 4EJUA 3F6OA 4YFKF 2HVSA 2NOGA 1YG2A 4OOIA 3ZQCA 1Y0NA 3FXQA 2XKPA 1OYWA 2RN7A 1Z91A 1MBKA 1U6GA 2EIJH 3GEZA 1R4MB 2DPDA 1ZLJA 3FXUA 3W6KB 1U5TC 2H27A 2PMZN 2ECCA 1WI3A 2WAQA 1WJCA 3RKXA 1KQ0A 1P4XA 4Y4RA 3ZGKA 2ELKA
chains in the Genus database with same CATH topology
4JX6A 3HOXJ 2XSDC 3S1RJ 4FE7A 4BKXA 5M5XJ 3LOCA 4W1UA 3CMYA 1LE8B 1QRYA 1IC8A 1HOMA 2ZB9A 2COBA 2DJNA 1DU6A 3S2HJ 3LSPA 4A69C 1RETA 1K83J 2R7ZJ 3BTJA 2X48A 1TC3C 1ETOA 4XK4A 2OF7A 2W48A 3Q0WA 4XIDA 1JJ8C 4XRSG 1ORKA 4A93J 2M8GX 2VKVA 1R9TJ 1D5YA 5EGOB 2JA8J 3CQZJ 3F0CA 2DA3A 3JRFA 3OSGA 3MN2A 1TWFJ 1B8IA 1MNMC 4G12A 1JKRC 5BNGA 5JLWA 3BTLA 3NARA 3E7LA 1OCPA 4X1EA 4FCYA 5EDNA 3W6VA 1I50J 3BG3A 3QPSA 3TP0A 5K7FA 1SANA 2XPWA 1WH5A 2EZIA 5F0HA 2EBIA 2O7OA 3QPLA 1IGNA 2LK2A 2ME0A 2MGQA 2NS7A 3H0GJ 1ETXA 2L7MP 2GLOA 2GM4A 2EZHA 1JKQC 3G1OA 3SJMA 4JP0A 3HBLA 1U9NA 5M3FJ 3JRCA 3JR9A 2WAQN 1ZR2A 3JRIA 4I6ZA 3ZQLA 3JREA 4I76A 2LKXA 1H8AC 3MVPA 1X2NA 3ZQIA 3FK7A 3M4OJ 2XB5A 5J1UA 3RQIA 1F43A 4L5EA 1W0UA 2I10A 5DS9A 3IH2A 5J3LA 1GUUA 1GDTA 4Y52J 3IV5A 3ZQHA 1H88C 3DEWA 2CU7A 2HXIA 1U78A 1BJZA 3A01B 1LE8A 4B1RA 2DMQA 5EG0B 2LFBA 2HOAA 4B4CA 2D5VA 9ANTA 4JX4A 1OCTC 4BY1J 5C3EJ 5F0CA 4W97A 5IP6A 1Z0XA 2R92J 2DMTA 4QIWN 4BBRJ 1FIAA 1EF4A 5IYBJ 1S7EA 4MFDA 4C3IJ 2RAEA 2GBYA 3RKQA 1ENHA 1ETYA 5M5WJ 4A3IJ 5FLVA 2DA1A 5EYRA 4J19A 2MG4A 1IV6A 3LSRA 1A6IA 4UUSA 2HOSA 2H1KA 1P7IA 2LP0A 2XB0X 3BR2A 2MW8A 4A3GJ 3B6AA 1GV5A 1B72A 2R5ZB 2YS9A 2JJ7A 1MBJA 1HLVA 5IYDJ 3A02A 2DA4A 1X58A 1RESA 2YU9J 1FEXA 2HOTA 1T33A 5C44J 1JTXA 4RBOA 2FX0A 1IDZA 2VKEA 4M3EA 5M5YJ 4D5FA 1VI0A 2B63J 2FQ4A 1NK2P 2Y2ZA 1AHDP 3WHBA 2Y31A 1MBEA 2EZLA 3VPRA 4LOCA 3A01A 3UKGA 5EG0A 4C3HJ 1BW5A 3BG9A 2DMPA 1VF9A 3HDDA 4A3JJ 4DYCA 1HDPA 2XPVA 3LNQA 3SFIA 2TRTA 2CQXA 3BTCA 1VFCA 1ZGWA 1MBGA 4A3EJ 4M3BA 2FD5A 1JUSA 4XICA 1TWCJ 4UUSB 1OFCX 3BR5A 5IOZA 3S17J 1JT6A 5C4JJ 2EH3A 3TW6A 4V2GA 4JX5A 3Q3SA 3HOWJ 3GTOJ 1GVDA 1ZKGA 2AO9A 1B72B 1T56A 2CUEA 4DYRA 3LSGA 3HKZN 1YRNA 2CUFA 2HI3A 2L7FP 1MBHA 2LD5A 3G1LA 3JRBA 1FIPA 3FK6A 4C3JJ 2ECBA 3QQAA 2CRGA 2R5ZA 3S2DJ 1GT0C 2DTZA 1APLC 2E19A 5F0FA 5HODA 2JMWA 3GBGA 2HDDA 3G1MA 1QVUA 2R5YB 4IHWA 4S0HB 4QSHA 3ZQFA 4FISA 1LFUP 3I4MJ 5F08A 2AHQA 3OSFA 2YUSA 3S1NJ 5IOYA 1ETKA 2CJJA 3D1NI 2M2EA 4XRSA 1HDDC 1NK3P 4A3MJ 1JT0A 4MIMA 1K61A 1NTCA 2X6OA 4DZPA 2HQ5A 4CYCA 1GV2A 2LR8A 1XS9A 2E2HJ 2WV1A 1FJLA 1JJ6C 1POGA 1QVTA 3HOYJ 1ZK8A 1XG1A 5IP7J 5FKOA 3MKLA 4A3LJ 2XGEA 5EF6A 5GPAA 3K7AJ 2JA7J 3BQZA 5IYCJ 2HYJA 4HNVA 4IHVA 2E1OA 2MSYA 3BTIA 3H3VK 2JK3A 1WPKA 3HM5A 1JKOC 3JRHA 4IEJA 5IP9J 1UHSA 4XRMA 1YRNB 2M34A 4UUTA 3ZQGA 3GTGJ 2LTPA 2OPTA 3IH4A 3PO3J 4FE4A 1BA5A 3JRDA 4A3BJ 1ITYA 1UMQA 3GTQJ 2Y0SN 3DCFA 5E3NA 5FLMJ 1A5JA 1JUMA 1Z77A 2VPRA 3HEFA 2Y9ZA 5F27A 2H8RA 2K9NA 1IJWC 5E3MA 2XPUA 4ABZA 2FJ1A 1JGGA 2M0CA 3HOVJ 2JA5J 3GTMJ 4AUXA 4GFBA 2XGDA 2Y30A 3PM1A 4A3CJ 1W0TA 3FIWA 2LLKA 3BR0A 3OIOA 2XRLA 1MSFC 2R5YA 4MLOA 4FTHA 1QPIA 4IHYA 1E3OC 4CYCB 1TWHJ 4EEFG 3WHCA 1G2HA 1WH7A 3HGYA 2L9RA 1MSEC 4DZJA 4M3DA 3ZOBA 3CDLA 5GP9A 1JTYA 2O8KA 3TEDA 4B3AA 1H89C 1X2MA 4DYQA 2JN6A 2EQRA 1JKPC 2JA6J 3TP3A 4DW6A 3S1QJ 2VI6A 5EZGA 1Y1WJ 1MBFA 2DA6A 2P81A 5JLXA 5K7HA 3S16J 1RKTA 3S1MJ 3A03A 3Q0UA 2EZKA 5FKMA 1ZTRA 3S15J 1RPWA 2IEKA 3PO2J 4A3KJ 1AKHB 2NVYJ 4AC0A 3O8GA 4JYKA 2DA5A 4V2FA 5EEAA 2N8GA 3IH3A 3SDGA 1IUFA 4BXXJ 4RDUA 3GTPJ 1RR7A 2K9QA 2ID6A 1I3QJ 1IDYA 4AYBN 1WGXA 4D7NA 3HOUJ 2WB1N 2TCTA 1JUPA 5E3LA 3M3YJ 1SFOJ 2VUMJ 2E2JJ 1UG2A 1LFBA 4A3FJ 5C4XJ 4D5CA 3BG5A 3JRAA 2LY9A 3L1PA 5EZHA 1DU0A 1PUFB 2L0KA 2K40A 3HGGA 4X6AJ 4NDLA 5M3MJ 5F1JA 4QTRA 3HOZJ 1VNDA 2IBDA 2NS8A 2O9LA 2R93J 1U8BA 2M9HA 2E2IJ 3NAUA 3K2AA 3B6CA 1IRZA 3BT9A 1ZQ3P 4A3DJ 1HCRA 4D7MA 1CQTA 3RZOJ 5GPCA 1IG7A 1XC5A 1Q1VA 5J1RA 3TW7A 3O8HA 1MH3A 2X9DA 2HXOA 5FJ8J 2Y9YA 3Q0VA 3BQYA 3GTJJ 1RKWA 2QF7A 1FTZA 2DMUA 1MH4A 2CQQA 3C2BA 1TWAJ 1ZR4A 3BR1A 3JRGA 3BR3A 2KT0A 2DMNA 1B8IB 4M6VA 3FISA 1WCMJ 2LVSA 2NVXJ 1BL0A 2ID3A 3FKIJ 1TWGJ 3CCYA 2IAIA 1ETQA 3I4NJ 2KDZA 4Y7NJ 2NVTJ 2QCOA 5IPAA 5DTDA 2R0QC 1AKHA 5EGOA 1I6HJ 2NVQJ 1Y1VJ 5J1YA 3GTKJ 2DA2A 1ETVA 3S14J 4M3GA 5FKKA 4IHXA 4BBSJ 1OJLA 2K9SA 4MFEA 5F04A 1FTTA 5E3OA 1ETWA 5K7ZA 4C2MJ 3LSJA 4BY7J 3GTLJ 2DA7A 2NOGA 2DN0A 1AU7A 1BW6A 3ZQCA 3RZDJ 1P7JA 4M3FA 1HF0A 2ME6A 1MBKA 4MO7A 2L7ZA 2G0EA 1O4XA 1F36A 2JWTA 2PMZN 1PUFA 2ECCA 2XGCA 1WI3A 3OOUA 5FKLA 1U9OA 3BR6A 5FKNA 3HB9A 2ELKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX6 A;  3HOX J;  2XSD C;  3S1R J;  4FE7 A;  4BKX A;  5M5X J;  3LOC A;  4W1U A;  3CMY A;  1LE8 B;  1QRY A;  1IC8 A;  1HOM A;  2ZB9 A;  2COB A;  2DJN A;  1DU6 A;  3S2H J;  3LSP A;  4A69 C;  1RET A;  1K83 J;  2R7Z J;  3BTJ A;  2X48 A;  1TC3 C;  1ETO A;  4XK4 A;  2OF7 A;  2W48 A;  3Q0W A;  4XID A;  1JJ8 C;  4XRS G;  1ORK A;  4A93 J;  2M8G X;  2VKV A;  1R9T J;  1D5Y A;  5EGO B;  2JA8 J;  3CQZ J;  3F0C A;  2DA3 A;  3JRF A;  3OSG A;  3MN2 A;  1TWF J;  1B8I A;  1MNM C;  4G12 A;  1JKR C;  5BNG A;  5JLW A;  3BTL A;  3NAR A;  3E7L A;  1OCP A;  4X1E A;  4FCY A;  5EDN A;  3W6V A;  1I50 J;  3BG3 A;  3QPS A;  3TP0 A;  5K7F A;  1SAN A;  2XPW A;  1WH5 A;  2EZI A;  5F0H A;  2EBI A;  2O7O A;  3QPL A;  1IGN A;  2LK2 A;  2ME0 A;  2MGQ A;  2NS7 A;  3H0G J;  1ETX A;  2L7M P;  2GLO A;  2GM4 A;  2EZH A;  1JKQ C;  3G1O A;  3SJM A;  4JP0 A;  3HBL A;  1U9N A;  5M3F J;  3JRC A;  3JR9 A;  2WAQ N;  1ZR2 A;  3JRI A;  4I6Z A;  3ZQL A;  3JRE A;  4I76 A;  2LKX A;  1H8A C;  3MVP A;  1X2N A;  3ZQI A;  3FK7 A;  3M4O J;  2XB5 A;  5J1U A;  3RQI A;  1F43 A;  4L5E A;  1W0U A;  2I10 A;  5DS9 A;  3IH2 A;  5J3L A;  1GUU A;  1GDT A;  4Y52 J;  3IV5 A;  3ZQH A;  1H88 C;  3DEW A;  2CU7 A;  2HXI A;  1U78 A;  1BJZ A;  3A01 B;  1LE8 A;  4B1R A;  2DMQ A;  5EG0 B;  2LFB A;  2HOA A;  4B4C A;  2D5V A;  9ANT A;  4JX4 A;  1OCT C;  4BY1 J;  5C3E J;  5F0C A;  4W97 A;  5IP6 A;  1Z0X A;  2R92 J;  2DMT A;  4QIW N;  4BBR J;  1FIA A;  1EF4 A;  5IYB J;  1S7E A;  4MFD A;  4C3I J;  2RAE A;  2GBY A;  3RKQ A;  1ENH A;  1ETY A;  5M5W J;  4A3I J;  5FLV A;  2DA1 A;  5EYR A;  4J19 A;  2MG4 A;  1IV6 A;  3LSR A;  1A6I A;  4UUS A;  2HOS A;  2H1K A;  1P7I A;  2LP0 A;  2XB0 X;  3BR2 A;  2MW8 A;  4A3G J;  3B6A A;  1GV5 A;  1B72 A;  2R5Z B;  2YS9 A;  2JJ7 A;  1MBJ A;  1HLV A;  5IYD J;  3A02 A;  2DA4 A;  1X58 A;  1RES A;  2YU9 J;  1FEX A;  2HOT A;  1T33 A;  5C44 J;  1JTX A;  4RBO A;  2FX0 A;  1IDZ A;  2VKE A;  4M3E A;  5M5Y J;  4D5F A;  1VI0 A;  2B63 J;  2FQ4 A;  1NK2 P;  2Y2Z A;  1AHD P;  3WHB A;  2Y31 A;  1MBE A;  2EZL A;  3VPR A;  4LOC A;  3A01 A;  3UKG A;  5EG0 A;  4C3H J;  1BW5 A;  3BG9 A;  2DMP A;  1VF9 A;  3HDD A;  4A3J J;  4DYC A;  1HDP A;  2XPV A;  3LNQ A;  3SFI A;  2TRT A;  2CQX A;  3BTC A;  1VFC A;  1ZGW A;  1MBG A;  4A3E J;  4M3B A;  2FD5 A;  1JUS A;  4XIC A;  1TWC J;  4UUS B;  1OFC X;  3BR5 A;  5IOZ A;  3S17 J;  1JT6 A;  5C4J J;  2EH3 A;  3TW6 A;  4V2G A;  4JX5 A;  3Q3S A;  3HOW J;  3GTO J;  1GVD A;  1ZKG A;  2AO9 A;  1B72 B;  1T56 A;  2CUE A;  4DYR A;  3LSG A;  3HKZ N;  1YRN A;  2CUF A;  2HI3 A;  2L7F P;  1MBH A;  2LD5 A;  3G1L A;  3JRB A;  1FIP A;  3FK6 A;  4C3J J;  2ECB A;  3QQA A;  2CRG A;  2R5Z A;  3S2D J;  1GT0 C;  2DTZ A;  1APL C;  2E19 A;  5F0F A;  5HOD A;  2JMW A;  3GBG A;  2HDD A;  3G1M A;  1QVU A;  2R5Y B;  4IHW A;  4S0H B;  4QSH A;  3ZQF A;  4FIS A;  1LFU P;  3I4M J;  5F08 A;  2AHQ A;  3OSF A;  2YUS A;  3S1N J;  5IOY A;  1ETK A;  2CJJ A;  3D1N I;  2M2E A;  4XRS A;  1HDD C;  1NK3 P;  4A3M J;  1JT0 A;  4MIM A;  1K61 A;  1NTC A;  2X6O A;  4DZP A;  2HQ5 A;  4CYC A;  1GV2 A;  2LR8 A;  1XS9 A;  2E2H J;  2WV1 A;  1FJL A;  1JJ6 C;  1POG A;  1QVT A;  3HOY J;  1ZK8 A;  1XG1 A;  5IP7 J;  5FKO A;  3MKL A;  4A3L J;  2XGE A;  5EF6 A;  5GPA A;  3K7A J;  2JA7 J;  3BQZ A;  5IYC J;  2HYJ A;  4HNV A;  4IHV A;  2E1O A;  2MSY A;  3BTI A;  3H3V K;  2JK3 A;  1WPK A;  3HM5 A;  1JKO C;  3JRH A;  4IEJ A;  5IP9 J;  1UHS A;  4XRM A;  1YRN B;  2M34 A;  4UUT A;  3ZQG A;  3GTG J;  2LTP A;  2OPT A;  3IH4 A;  3PO3 J;  4FE4 A;  1BA5 A;  3JRD A;  4A3B J;  1ITY A;  1UMQ A;  3GTQ J;  2Y0S N;  3DCF A;  5E3N A;  5FLM J;  1A5J A;  1JUM A;  1Z77 A;  2VPR A;  3HEF A;  2Y9Z A;  5F27 A;  2H8R A;  2K9N A;  1IJW C;  5E3M A;  2XPU A;  4ABZ A;  2FJ1 A;  1JGG A;  2M0C A;  3HOV J;  2JA5 J;  3GTM J;  4AUX A;  4GFB A;  2XGD A;  2Y30 A;  3PM1 A;  4A3C J;  1W0T A;  3FIW A;  2LLK A;  3BR0 A;  3OIO A;  2XRL A;  1MSF C;  2R5Y A;  4MLO A;  4FTH A;  1QPI A;  4IHY A;  1E3O C;  4CYC B;  1TWH J;  4EEF G;  3WHC A;  1G2H A;  1WH7 A;  3HGY A;  2L9R A;  1MSE C;  4DZJ A;  4M3D A;  3ZOB A;  3CDL A;  5GP9 A;  1JTY A;  2O8K A;  3TED A;  4B3A A;  1H89 C;  1X2M A;  4DYQ A;  2JN6 A;  2EQR A;  1JKP C;  2JA6 J;  3TP3 A;  4DW6 A;  3S1Q J;  2VI6 A;  5EZG A;  1Y1W J;  1MBF A;  2DA6 A;  2P81 A;  5JLX A;  5K7H A;  3S16 J;  1RKT A;  3S1M J;  3A03 A;  3Q0U A;  2EZK A;  5FKM A;  1ZTR A;  3S15 J;  1RPW A;  2IEK A;  3PO2 J;  4A3K J;  1AKH B;  2NVY J;  4AC0 A;  3O8G A;  4JYK A;  2DA5 A;  4V2F A;  5EEA A;  2N8G A;  3IH3 A;  3SDG A;  1IUF A;  4BXX J;  4RDU A;  3GTP J;  1RR7 A;  2K9Q A;  2ID6 A;  1I3Q J;  1IDY A;  4AYB N;  1WGX A;  4D7N A;  3HOU J;  2WB1 N;  2TCT A;  1JUP A;  5E3L A;  3M3Y J;  1SFO J;  2VUM J;  2E2J J;  1UG2 A;  1LFB A;  4A3F J;  5C4X J;  4D5C A;  3BG5 A;  3JRA A;  2LY9 A;  3L1P A;  5EZH A;  1DU0 A;  1PUF B;  2L0K A;  2K40 A;  3HGG A;  4X6A J;  4NDL A;  5M3M J;  5F1J A;  4QTR A;  3HOZ J;  1VND A;  2IBD A;  2NS8 A;  2O9L A;  2R93 J;  1U8B A;  2M9H A;  2E2I J;  3NAU A;  3K2A A;  3B6C A;  1IRZ A;  3BT9 A;  1ZQ3 P;  4A3D J;  1HCR A;  4D7M A;  1CQT A;  3RZO J;  5GPC A;  1IG7 A;  1XC5 A;  1Q1V A;  5J1R A;  3TW7 A;  3O8H A;  1MH3 A;  2X9D A;  2HXO A;  5FJ8 J;  2Y9Y A;  3Q0V A;  3BQY A;  3GTJ J;  1RKW A;  2QF7 A;  1FTZ A;  2DMU A;  1MH4 A;  2CQQ A;  3C2B A;  1TWA J;  1ZR4 A;  3BR1 A;  3JRG A;  3BR3 A;  2KT0 A;  2DMN A;  1B8I B;  4M6V A;  3FIS A;  1WCM J;  2LVS A;  2NVX J;  1BL0 A;  2ID3 A;  3FKI J;  1TWG J;  3CCY A;  2IAI A;  1ETQ A;  3I4N J;  2KDZ A;  4Y7N J;  2NVT J;  2QCO A;  5IPA A;  5DTD A;  2R0Q C;  1AKH A;  5EGO A;  1I6H J;  2NVQ J;  1Y1V J;  5J1Y A;  3GTK J;  2DA2 A;  1ETV A;  3S14 J;  4M3G A;  5FKK A;  4IHX A;  4BBS J;  1OJL A;  2K9S A;  4MFE A;  5F04 A;  1FTT A;  5E3O A;  1ETW A;  5K7Z A;  4C2M J;  3LSJ A;  4BY7 J;  3GTL J;  2DA7 A;  2NOG A;  2DN0 A;  1AU7 A;  1BW6 A;  3ZQC A;  3RZD J;  1P7J A;  4M3F A;  1HF0 A;  2ME6 A;  1MBK A;  4MO7 A;  2L7Z A;  2G0E A;  1O4X A;  1F36 A;  2JWT A;  2PMZ N;  1PUF A;  2ECC A;  2XGC A;  1WI3 A;  3OOU A;  5FKL A;  1U9O A;  3BR6 A;  5FKN A;  3HB9 A;  2ELK A; 
#chains in the Genus database with same CATH topology
 2EK5 A;  2XSD C;  2QZ8 A;  4BKX A;  5M5X J;  3LOC A;  4W1U A;  4HDU A;  5LEK A;  1LE8 B;  1K6O A;  1HOM A;  1LQ1 A;  1U5T A;  2DAO A;  1UAA A;  2HDW A;  4A69 C;  2AS5 F;  1RET A;  1I1G A;  3GFI A;  4YIR X;  1FBS A;  5KHD A;  4PUS A;  5D5V B;  2OF7 A;  2HTJ A;  1EJ9 A;  3QYF A;  4A93 J;  2M8G X;  1T95 A;  1R9T J;  5EGO B;  3OYF A;  2CW8 A;  2EFP A;  3F0C A;  1TWF J;  2BY0 A;  4A6E A;  4PGH A;  3LL7 A;  1MNM C;  4G12 A;  1IN7 A;  2LYC A;  4CH7 A;  2XRO A;  3SFZ A;  2KJC A;  1ODD A;  2OTJ I;  3CCM I;  1E17 A;  3NAR A;  2X6Y A;  2P7C B;  1W5T A;  2A6E F;  2EA2 A;  1XD7 A;  2F2E A;  4G8X A;  2DK8 A;  4D9J A;  3BG3 A;  2P6S A;  4IF4 A;  4OIN F;  1S9H A;  4C2T A;  3BRO A;  4F52 A;  4B3X A;  3HPH A;  4H0E A;  4XKW A;  2DPU A;  4OIO F;  4IL6 C;  1TQI A;  4MEY F;  2L7M P;  3VDX A;  3TDU C;  1JKQ C;  5ED4 A;  1KGS A;  3G1O A;  5DD8 A;  3WTX C;  3HBL A;  5KK1 A;  2IS4 A;  2Y0S A;  3JRC A;  3C1D A;  3ZQ7 A;  4UVA A;  1N77 A;  3OWT A;  3JRI A;  2LH9 A;  4YEL A;  5ILV A;  3BG6 A;  3OS2 A;  2LKX A;  3M4O J;  2ZSH B;  2ZKZ A;  4E7S A;  3AG4 H;  3O2P E;  2MBF A;  1W0U A;  3SDB A;  2LMD A;  4P96 A;  3IV5 A;  4UXN A;  1GDT A;  3CJR B;  4Y52 J;  2OCE A;  3IRQ A;  3GXO A;  5F6F A;  1BJZ A;  2ZO4 A;  1X3W B;  9ANT A;  2LFB A;  4B4C A;  5E1W A;  4BE2 A;  5EEH A;  2WV0 A;  3ABK H;  2QEX I;  2LNB A;  4EM0 B;  4BY1 J;  2PG4 A;  3RSN A;  4HYE A;  4W97 A;  1D3Y A;  3KYL A;  2CG4 A;  2DMT A;  4LGW A;  5LBQ A;  3CUQ B;  4KN4 X;  4Y33 A;  4IRH A;  1Z9C A;  2VKH A;  4R79 A;  2E7W A;  4O5V A;  4IZZ A;  4HF2 A;  1R36 A;  1MNE A;  3PL8 A;  3V8J A;  2I8D A;  5IY5 H;  4XL9 A;  2FE3 A;  2DDB A;  4BJ6 C;  3CDI A;  1IV6 A;  2DDA A;  1A6I A;  4UUS A;  1NG7 A;  2HKX A;  4L5I A;  4GGG A;  3U9G A;  4I98 B;  2NYX A;  1SVO A;  2LP0 A;  5DM6 F;  2V9K A;  2MW8 A;  2W25 A;  4A3G J;  3B6A A;  4QWQ A;  2R7T A;  1B72 A;  4HX8 A;  3KP3 A;  3HKZ A;  2JJ7 A;  4DIQ A;  3W2A A;  2G7U A;  3DFG A;  1QHH D;  1FLI A;  4XSX F;  2DA4 A;  4GRI A;  4IRG A;  4ITV A;  1RES A;  3W6J B;  4YIF A;  2BHZ A;  4XOP A;  2HOT A;  1YX3 A;  3AAF A;  1JTX A;  4LB6 B;  2FX0 A;  4Z6Y A;  3P9K A;  2WAD A;  2PJR B;  2BGC A;  3OYJ A;  1XDU A;  5M5Y J;  1I5Z A;  2ZME B;  2Z99 A;  3HL2 A;  2E1C A;  1IRX A;  3D5R C;  1IW7 F;  1KU2 A;  2V9P A;  4QPQ A;  3K70 D;  3RPU A;  3AG1 H;  1AHD P;  2GZW A;  1F1Z A;  5BPI A;  2Y31 A;  1MBE A;  4BQQ A;  1FYM A;  4LOC A;  3BPX A;  3A01 A;  3UKG A;  1O3T A;  1W1W E;  1QA6 A;  1PJR A;  1W7P D;  2DMP A;  5FD6 A;  1Z1D A;  1J2X A;  2KIM A;  2QA4 I;  4IXA A;  1MZB A;  2XPV A;  5FFZ A;  4KIF A;  3SFI A;  2CQX A;  2RKH A;  3CMM A;  4M73 A;  1P4A A;  2JSP A;  3HZJ A;  2KQR A;  2W1O A;  1VFC A;  4X0G A;  1MBG A;  3KP7 A;  3OOP A;  2JRT A;  1TWC J;  4XN0 A;  1V55 H;  5D8L B;  2IPQ X;  4ESJ A;  3S17 J;  3RI4 A;  1JT6 A;  2C6Y A;  4WF2 A;  3SZT A;  4MHG A;  4I99 C;  4V2G A;  3DTI A;  4XM3 A;  4JX5 A;  4O3M A;  3SZP A;  1GVD A;  2DFI A;  4ASN A;  3BC8 A;  3DPU A;  2L3D A;  3J81 K;  4WWC A;  4QPO A;  1PP8 F;  2O5R A;  1WVR A;  5B3S H;  4HOB A;  3KZZ A;  5LEJ A;  4A0Z A;  1FY7 A;  3R60 A;  4HLY A;  1R5H A;  4GO1 A;  1W36 D;  1FIP A;  3C3W A;  3FK6 A;  1HA8 A;  4MQ9 F;  2FUG 2;  3N97 A;  1GT0 C;  2DTZ A;  2E19 A;  3V4G A;  5F0F A;  3H3U A;  3S3M A;  2HDD A;  3GBG A;  1PYV A;  3G1M A;  1G8X A;  4IHW A;  2WC2 A;  3ZQF A;  4NC6 A;  3K2Z A;  4KMU X;  3I4M J;  5F08 A;  5BOX A;  3OSF A;  3WTV C;  1T0F A;  4HF0 A;  3ERE D;  3KEQ A;  5F1R A;  1NK3 P;  4M9S A;  1JT0 A;  4U7D A;  3H5R A;  4DBR A;  1K61 A;  4N0B A;  2W82 A;  2KP6 A;  4DZP A;  1WJF A;  2VBW A;  3P9C A;  3ECH A;  5ILS A;  2YR2 A;  2E2H J;  1FJL A;  1QVT A;  4II2 A;  4KIG A;  1EH6 A;  2E5N A;  5D5X B;  2EFQ A;  2QYO A;  5IP7 J;  1G3T A;  2WAF A;  3MKL A;  5EF6 A;  3KPH A;  3K7A J;  1WI9 A;  3BQZ A;  2PEX A;  3LMM A;  4OMZ A;  3H9J A;  3VEP A;  1GVJ A;  3BTI A;  2LBF A;  1SFE A;  4CYD A;  2VBY A;  2PFB A;  3HM5 A;  3L00 A;  5IP9 J;  3RJP A;  1UHS A;  4UUT A;  3DBR B;  2VJ4 A;  3IH4 A;  2OJE D;  4FE4 A;  3PO3 J;  3JRD A;  4O6J A;  4OMY A;  1UMQ A;  2RV8 A;  2Y0S N;  1O7F A;  2X85 A;  1WQ2 A;  1JUM A;  4AWX B;  2Y9Z A;  2PN6 A;  1JI8 A;  1YS6 A;  2MFZ A;  1FP1 D;  3HOV J;  1MJ9 A;  2DW4 A;  3K1N A;  1P4W A;  3A2K A;  3OYK A;  2RVC A;  1K7A A;  5H6R A;  2BXY A;  2KMU A;  3PJR A;  2KIU A;  3GFJ A;  3K9T A;  2R5Y A;  2K4B A;  3DBH B;  5HDG A;  1G3Y A;  3C7J A;  3R0A A;  1Z7U A;  4XKV A;  2XSJ C;  3ZP5 A;  1E3O C;  4CYC B;  4UB6 C;  4U0W A;  3AL0 B;  3GFL A;  1ZN2 A;  2K27 A;  3SZG A;  3CP8 A;  4OU0 A;  1MSE C;  2JVG A;  4I01 A;  4WXC A;  4BQN A;  4M3D A;  2GWR A;  3RDI A;  5FO5 A;  3ZOB A;  4DZJ A;  1XGO A;  3BG7 A;  4IOA F;  5B5E C;  1AA7 A;  2BY2 A;  3M8J A;  1JTY A;  2UXX A;  3ONQ A;  1G3S A;  2PMH A;  2EV0 A;  1X2M A;  3MCZ A;  2JN6 A;  2EQR A;  5D4R A;  3MKY B;  1B6A A;  3QAH A;  1JKP C;  4A0Y A;  3S1Q J;  5HDK A;  1MBF A;  3T1B A;  2P81 A;  4LD5 A;  4NC7 A;  2MC4 A;  2Y69 H;  3LQQ A;  1RKT A;  2QQA A;  4P1W A;  2EV5 A;  5FKM A;  3PSI A;  1Y39 A;  1WJB A;  2NVY J;  4RB3 C;  4XOR A;  4LG0 B;  2DK5 A;  3O8G A;  4JYK A;  3WE3 A;  1X3Z B;  2L4A A;  4BXX J;  2K3F A;  2BOL A;  2F4O B;  4Y13 A;  2VB6 A;  2R7S A;  3CCQ I;  1RR7 A;  2K9Q A;  1WZ2 A;  2ID6 A;  1I3Q J;  4AYB N;  4D7N A;  1WGX A;  4AIH A;  3HOU J;  2WB1 N;  3CC7 I;  1FX7 A;  5E3L A;  2HNH A;  2P4W A;  2A3S A;  2F4I A;  2HZT A;  1UG0 A;  4CDG A;  1UG2 A;  4A3F J;  2EFW A;  2Q0O A;  3QPT A;  4KA4 A;  3LA2 A;  4RAZ A;  1MMA A;  2LY9 A;  1IXS B;  5DDG A;  3L1P A;  1YQA A;  1DU0 A;  1T98 A;  4F93 B;  1HST A;  4MTE A;  4HF1 A;  4QTR A;  1VND A;  1AWC A;  3SHF A;  3CJT B;  4BL0 B;  2EA4 A;  1R58 A;  4A6D A;  3H36 A;  2CUJ A;  4BXF A;  3K2A A;  3OYI A;  3IKT A;  2LC2 A;  1QO0 D;  3MD2 A;  1ZQ3 P;  4ENK A;  4D7M A;  3DPT A;  3K10 A;  4KYW A;  3RZO J;  4V19 K;  2DU9 A;  1U5T B;  1SD7 A;  1UEL B;  2E1N A;  1ZRE A;  1L0O C;  1XB4 A;  2Y9Y A;  4PFP A;  3GTJ J;  4BNC A;  1U8R A;  1CF7 B;  2F4M B;  5KCM A;  3CES A;  2Y0M A;  1G3W A;  2OUM A;  2UV1 A;  3WGG A;  4HQE A;  2HYG D;  4RMN A;  2DBB A;  2DMN A;  4M6V A;  1WCM J;  1RI7 A;  2LRE A;  3HUG A;  3VFZ A;  3QOP A;  2NVX J;  4HPQ A;  2V26 A;  3NQO A;  2FQ3 A;  1OYY A;  5DTD A;  4G9Y A;  2D1H A;  2VBX A;  2M4K A;  1XMK A;  4RAY A;  3F9K A;  3I58 A;  4EJT A;  4CCJ A;  1DP3 A;  5ICF A;  4UV9 A;  3J81 Z;  5H2F C;  1WHU A;  5E3O A;  3IC7 A;  2W00 A;  4PSX A;  2X0L A;  5K7Z A;  4XN3 A;  2BY3 A;  4C2M J;  1YJN I;  3GTL J;  4M6X A;  2R7R A;  2BZT A;  2DN0 A;  5DEQ A;  3WTY C;  3DKY A;  1EKE A;  4KIT B;  4KIB A;  2H8W A;  2ZBK A;  3M7G A;  2L7Z A;  1TT0 A;  2G0E A;  1R23 A;  1SFU A;  3F3X A;  1O4X A;  2AXL A;  4L5J A;  2L9N A;  5HS7 A;  2JWT A;  1IRF A;  3H9G A;  3OOU A;  1OMI A;  1V54 H;  1D1A A;  4HW0 A;  1U9O A;  3BR6 A;  5FKN A;  1QZZ A;  3AFH A;  1Q1H A;  4BH9 A;  4HNT A;  4JX6 A;  5CVR A;  1OQY A;  3FXR A;  4EGZ A;  1WFX A;  2X1E A;  4PJL A;  1IJW C;  3ECO A;  1IO2 A;  1IC8 A;  3KP2 A;  5BS6 A;  3MKZ A;  2COB A;  1DU6 A;  4XNF A;  1B9M A;  1RIO H;  1JGS A;  3ZMU A;  2Q2E B;  3A0H C;  2EIM H;  3ESW B;  2TDX A;  2X48 A;  4CCK A;  2X51 A;  1SVL A;  4OIQ F;  3Q0W A;  1ORK A;  4XMY A;  1ZRF A;  2O6G E;  1Z05 A;  3G2B A;  3OSG A;  4LK0 F;  1DQU A;  1VQK I;  2CV2 A;  1F4K A;  2VON A;  1UST A;  2NS0 A;  5JLW A;  4HAM A;  4C30 A;  4MTD A;  5KAF C;  5CQE A;  5K1Y A;  4IO9 F;  3I59 A;  3LSI A;  3DLL F;  3IP4 B;  4CCL A;  2BW3 A;  1G6N A;  2JPC A;  4FCY A;  3W6V A;  3QPS A;  3TP0 A;  5K7F A;  5KNL A;  1SAN A;  3EUH C;  4AVP A;  2QBY B;  2E36 A;  5F0H A;  4Y17 A;  2O7O A;  3MZ8 A;  5GAG J;  1X1A A;  2ME0 A;  1HW5 A;  2MGQ A;  3HRM A;  3ZN0 A;  3DTK A;  1ETX A;  4Q5S F;  4BHC A;  1OLT A;  4N9I A;  2L5Q A;  2Y75 A;  1U9N A;  2VQC A;  4F91 B;  3LA3 A;  3EUH A;  1ZR2 A;  3F72 A;  3JTH A;  5LGN A;  2QSG X;  3O6B B;  4I6Z A;  3ZQL A;  4I76 A;  3M9A A;  1H8A C;  3MVP A;  1X2N A;  2UZK A;  4E6K G;  2XB5 A;  3I64 A;  5J1U A;  2XKO A;  1A31 A;  1YOV B;  3RPQ A;  3HTU A;  1MIJ A;  5CVJ A;  4M74 A;  5FLX K;  2HOE A;  3MWM A;  5J40 A;  3ZQH A;  1MJA A;  5HOO A;  1IN6 A;  1J7K A;  3DEW A;  3FMS A;  3HOS A;  2HPM A;  1ZG5 A;  3A01 B;  4K2E A;  4PJ0 C;  4B1R A;  2YSR A;  2HOA A;  1W7P A;  2F5V A;  1FZP B;  2WA0 A;  4JX4 A;  5C3E J;  5B1B H;  2KL4 A;  4E7H A;  3OYA A;  3QYE A;  3EUK L;  3RIR A;  1B4A A;  1E2X A;  4BQA A;  1R22 A;  1GLN A;  3LAP A;  1QNT A;  2LF8 A;  1FSE A;  2M5W A;  4L9J A;  4ZDP A;  3AG2 H;  4EJO A;  1EF4 A;  5IYB J;  5CKT A;  3EPZ A;  2HWV A;  2RAE A;  4RGS A;  5L3D A;  1UHM A;  2BEO A;  4CO8 A;  5EJC A;  4A3I J;  5FLV A;  3U21 A;  4UUV A;  3IKV A;  4P9U A;  4BDY A;  1K79 A;  1W36 C;  2EB7 A;  3CCV I;  2MG4 A;  4CCN A;  5HLT A;  2L9V A;  4P5O A;  2VBZ A;  3ZMZ A;  3OYH A;  2HOS A;  2COM A;  4AIK A;  3IAS 2;  2Z9O A;  2YX7 A;  2XDV A;  2GQQ A;  2VC0 A;  1GV5 A;  1QPM A;  3GFM A;  1YX5 A;  2YS9 A;  2W7N A;  1MBJ A;  4FX0 A;  5E17 F;  1HLV A;  5IYD J;  4EJW A;  3ZXS A;  3A02 A;  1X58 A;  1C0W A;  5AIP A;  4MNU A;  5DCM B;  4F92 B;  4OIR F;  1NHA A;  1ZAR A;  5C44 J;  1R49 A;  2VE8 A;  5K5O A;  1IV8 A;  3FMR A;  2GXB A;  1RC9 A;  4BAY A;  3BOQ A;  5JHU A;  5LRS A;  1BIB A;  4PJM A;  3ZPL A;  3U1D A;  5K5R A;  3WHB A;  2V6C A;  1FPQ A;  4ZZD A;  2EZL A;  2V1N A;  3VPR A;  4BEH B;  3DWL E;  3LA7 A;  2R3S A;  4R1H A;  1PP7 U;  3LST A;  4KIS A;  4F55 A;  3M1E A;  2EPF A;  4DYC A;  3CMA I;  1HDP A;  3KE2 A;  2VC1 A;  4GXO A;  3JW4 A;  4CCO A;  4ZH4 F;  4L0Y B;  1R7J A;  4UB8 C;  2XAH A;  4LG3 A;  3PIO F;  3LFK A;  3M1C A;  4M3B A;  1JUS A;  2LBF B;  4XIC A;  1OFC X;  1MMG A;  1ZYR F;  1Y0U A;  3R4K A;  3ASO H;  4XON A;  1RNL A;  2M45 A;  2DOD A;  2A6H F;  1N75 A;  4MGR A;  3TW6 A;  4BHP A;  4LJZ F;  2ACJ A;  4EV0 A;  3Q3S A;  3QOD A;  3HOW J;  4PK4 A;  1FOY A;  1YW9 A;  2ZNY A;  1FSH A;  3FF5 A;  1IN5 A;  2DCE A;  3UR3 C;  1GHC A;  3LSG A;  3J80 K;  5F64 A;  3V7R A;  4B44 A;  4PGG A;  1VQP I;  2CFX A;  2L7F P;  2W24 A;  4BE0 A;  3G1L A;  2CQN A;  2ECB A;  4CGZ A;  2R5Z A;  2BVM A;  2FBK A;  2A5Y B;  3L7W A;  2ZNZ A;  2A69 F;  3C2H A;  3QRF F;  2KIQ A;  1BOB A;  1QVU A;  2R5Y B;  4S0H B;  1ZG3 A;  4NUB A;  5FRM A;  1LFU P;  1RUN A;  2AHQ A;  3S1N J;  2OD5 A;  4FT8 A;  1ETK A;  1S3J A;  2FBH A;  2XF6 A;  5HNH A;  2Q8K A;  3GZN B;  5FFX A;  2Z3Y A;  1YJW I;  3T5X A;  4CZZ A;  1S7O A;  1X19 A;  4R8H A;  4RM2 A;  3WTZ A;  1GV2 A;  1TT5 B;  1W5S A;  3ZMT A;  4UY8 I;  1MMS A;  1J5Y A;  3E6M A;  4HQM A;  2WY7 Q;  3E6D A;  2WV1 A;  3HOY J;  3FXM A;  1ZK8 A;  2L9S A;  4C9Y A;  1XG1 A;  4E4H A;  3BZ6 A;  2DO7 A;  2K3P A;  2VE9 A;  1UZC A;  1J09 A;  3DBL B;  5ICE A;  1ZGJ A;  2XGE A;  5GAE J;  2B7E A;  2R7V A;  5IYC J;  1ZG1 A;  3G4S I;  2JUC A;  4HNV A;  3L9F A;  4IHV A;  4UVB A;  2MSY A;  3E5U A;  3F23 A;  1WPK A;  1Y8R B;  1HSJ A;  5HLG A;  1JKO C;  3O3K A;  4IEJ A;  3PNV A;  1YRN B;  2M34 A;  3ABL H;  2W4S A;  2BXZ A;  1M1E B;  2LTP A;  1SFK A;  3IAM 2;  3HG9 A;  4ZYE A;  2IGM A;  1YI2 I;  1G4D A;  2R7U A;  1HKT A;  1BA5 A;  1ITY A;  4A3B J;  1J75 A;  4Z2Y A;  3KLN A;  4PDK A;  4NNJ A;  4BUP A;  3GTQ J;  4IOC F;  2CH0 A;  4ENJ A;  2DFH A;  5E3N A;  5FLM J;  1Z77 A;  3DU5 A;  1D1C A;  3FXO A;  3CCU I;  4AYB A;  2H8R A;  2K9N A;  3ASN H;  3VYT B;  5E3M A;  2WB1 A;  2XPU A;  3KP6 A;  5GAH J;  3PFI A;  1V5E A;  2CQ7 A;  5CVI A;  5HVQ C;  3MKW B;  1HW2 A;  4RGU A;  1FP2 A;  1XGN A;  4GFB A;  4A3C J;  3PM1 A;  2VL8 A;  3KX2 A;  1W0T A;  2EIK H;  2PQ8 A;  4UHT A;  3FIW A;  4UV8 A;  4XLP F;  1FOX A;  2R7F A;  3BR0 A;  2V1U A;  3OIO A;  2X4H A;  2JA2 A;  5TGT A;  2X6X A;  3OYG A;  5D6E A;  3WU1 B;  3A4C A;  5IT9 K;  1PDN C;  1X3U A;  3ZCO A;  2KLO A;  4EEF G;  4B09 A;  2XC7 A;  3QWL A;  1GXQ A;  1MDM B;  1LEB A;  2BY1 A;  5J4Y A;  2VIX A;  2FA5 A;  1WJD A;  2L9R A;  1F5T A;  2IA1 A;  2NOJ B;  3CDL A;  3BP8 A;  3LQR A;  2FEZ A;  3EDP A;  3TO7 A;  3ZR8 X;  1D5V A;  2XIG A;  2O8K A;  3CO7 C;  4LIV A;  4XSZ F;  3HSR A;  4B3A A;  3K4J A;  4N4O B;  3NWT A;  3TP3 A;  1DGR M;  2Z33 A;  3PFY A;  4YRV A;  2VOO A;  2LY2 A;  2EFN A;  1SVM A;  4EMS A;  2XHK A;  2A61 A;  2QSF X;  5K7H A;  2KPM A;  3H92 A;  3S15 J;  1OCZ H;  1Z6R A;  2IEK A;  4A3K J;  4HRI A;  3TOA A;  2BV6 A;  4I0B A;  2QLZ A;  2RNJ A;  2G9W A;  1VQ6 I;  2R7Q A;  4DJA A;  2DA5 A;  2MD5 A;  3BZK A;  4V2F A;  5EEA A;  2M3A A;  3GTP J;  3CTA A;  1KQ8 A;  3FM5 A;  2ISY A;  1IDY A;  1OCO H;  1WWX A;  4RS8 A;  1T0F C;  3GZ6 A;  4HZF A;  1WSU A;  3GW2 A;  2O8X A;  1JUP A;  2TCT A;  1SD5 A;  3OL3 A;  3M3Y J;  2M87 A;  3OYC A;  1VQM I;  1DDN A;  1LFB A;  3TBI A;  5C4X J;  3QP5 A;  4D5C A;  3JAM K;  2A07 F;  2LDU A;  3ABU A;  2MA3 A;  3E1S A;  2E1M C;  3H5N A;  1T39 A;  1NH3 A;  3G3Z A;  2GOX B;  3BDD A;  3I56 I;  2L0K A;  2EIN H;  1FT9 A;  4NDL A;  2NRA C;  2O9L A;  2R93 J;  1D8J A;  1U8B A;  4HX4 A;  4B8X A;  3CO6 C;  1TW2 A;  3ML6 A;  1IRZ A;  3BT9 A;  4A3D J;  4WX9 A;  4ENN A;  2RNG A;  1HCR A;  4JOM A;  4BU2 A;  2VN2 A;  1XC5 A;  1A35 A;  3KEY A;  2WAE A;  1I1S A;  1Q1V A;  3TW7 A;  1XSV A;  1LDD A;  3O8H A;  1TQP A;  1MH3 A;  4LFU A;  5E1Z B;  3CC2 I;  2P0W A;  2JPB A;  3FMQ A;  3E6C C;  4FX4 A;  2CMP A;  4NQW B;  3CCJ I;  4CHU A;  2CV1 A;  1T2K A;  4I2O A;  1TWA J;  1RR8 C;  2XRN A;  3BR1 A;  3JRG A;  2CUZ A;  3WE2 A;  3ZN1 A;  3WTW C;  3BR3 A;  2GAU A;  2J5P A;  5H20 A;  5LHH A;  2KT0 A;  3OYD A;  1MKM A;  5DCF A;  2LVS A;  3L2W A;  2KZV A;  4DOZ A;  4BJT A;  1TWG J;  2VJJ A;  4EM1 A;  2IAI A;  2QQ9 A;  1K78 A;  2QCO A;  2R0Q C;  3I59 B;  5EGO A;  3DQV C;  3HHG A;  5J1Y A;  4HSR A;  3P5J A;  2KZG A;  3KZY A;  4KT5 C;  5E79 C;  3S14 J;  1Z21 A;  2M7A A;  2ZSI B;  1H9T A;  1VQ9 I;  2K9S A;  3J80 Z;  5F04 A;  1S8N A;  3LSJ A;  4BY7 J;  2ICW G;  3R61 A;  3RZD J;  2DT5 A;  1LPQ A;  4XLH A;  4I09 A;  3HOT A;  1HF0 A;  2VLA A;  3CP2 A;  1YJ9 I;  1BC7 C;  2HDC A;  2D1V A;  3I9V 2;  4EM2 A;  2E5Z A;  4XQF A;  5AON A;  2D45 A;  4U0Y A;  1QBJ A;  4M9Z A;  3OL4 A;  4M6Y A;  1PUF A;  1K4S A;  5FKL A;  5LLQ A;  3WU0 A;  2P6T A;  2CO5 A;  1STZ A;  4OIP F;  1HQC A;  3KFW X;  1TLH B;  4FAS D;  3P7N A;  5L3B A;  3HOX J;  3S1R J;  2PX9 A;  3CMY A;  3X2Q H;  2M7B A;  3ZRG A;  2ZB9 A;  2L54 A;  3WOD F;  3LSP A;  1FOK A;  1T8I A;  3SYT A;  2CV0 A;  2FU4 A;  1K83 J;  2AXT C;  2R7Z J;  1X1D A;  1TC3 C;  5CPR B;  1SD4 A;  1ETO A;  1QHG A;  1TBX A;  4XK4 A;  2IJL A;  3WGI A;  1JJ8 C;  4HV6 A;  2HEO A;  2GA2 A;  1D5Y A;  4OAY A;  2JA8 J;  1TNS A;  5HS8 A;  5B1A H;  1B8I A;  4KDP A;  2K9L A;  3QP6 A;  3WG9 A;  2NNN A;  3C18 A;  1R71 A;  3WTS C;  2Q1Z B;  1EH7 A;  4JBA A;  4LK1 F;  2OCC H;  2CYY A;  3BTL A;  3CUO A;  2PMU A;  3OV8 A;  4ZYG A;  5D5W B;  3LSH A;  3I53 A;  4ZZL A;  2ZFU A;  2YX4 A;  1B59 A;  5EDN A;  2PBI A;  3FKJ A;  2WWY A;  4NBQ A;  4AU7 A;  2B9S A;  3HHH A;  4MEX F;  2EBI A;  3DV8 A;  3QPL A;  5DV5 A;  3S32 A;  3HJE A;  1H9G A;  4BAC A;  4RM3 A;  2NS7 A;  3U1K A;  3H0G J;  4JP0 A;  3F22 A;  5E20 A;  1BOA A;  5M3F J;  2VJ5 A;  1R1V A;  2P5L C;  2O61 A;  4P55 A;  3JR9 A;  3I54 A;  3E5Q A;  2H09 A;  3U2R A;  2E34 A;  2ZXW H;  2BBY A;  2LKS A;  3GF2 A;  1D1B A;  3OIQ A;  1VQN I;  3ZQI A;  1REP C;  5IT9 Z;  1KU9 A;  2LG4 A;  3RQI A;  2VT2 A;  4BYY A;  1YS7 A;  2DOE A;  1KU3 A;  4EAT A;  2I10 A;  5DS9 A;  1G59 A;  2DOA A;  5GTH C;  1WJE A;  1BI3 A;  4D0P A;  1H88 C;  2XAJ A;  3RYR A;  2L02 A;  1U78 A;  3L2U A;  1D8K A;  2ZME A;  5DYM A;  2DMQ A;  4ZDL A;  2JVH A;  1BM9 A;  2ZJP F;  5F0C A;  1ON1 A;  2PI0 A;  1YE9 A;  1TW3 A;  5IP6 A;  3QU6 A;  1Z0X A;  3TOB A;  1VQL I;  1D0Y A;  1YIJ I;  4QIW N;  2XAS A;  4BBR J;  2LF7 A;  3T8R A;  1DPU A;  4CXF A;  4E7J A;  1S7E A;  4MFD A;  4C3I J;  5LRR A;  1P9Q C;  3M8E A;  3GX4 X;  4ZTJ A;  1T6S A;  2DYS H;  2XAF A;  1SEU A;  2DA1 A;  1Z3Y A;  5EYR A;  6PAX A;  4RB1 A;  2ZXH A;  3LSR A;  2VJI A;  1R4N B;  2P5V A;  3B02 A;  3TGN A;  2H1K A;  2LKP A;  1WJ5 A;  5K5Q A;  1DGW Y;  2VQL A;  1LEA A;  1KYZ A;  3QU3 A;  1JXS A;  4BHB A;  3G71 I;  2R5Z B;  2HQN A;  3KYC B;  3FX3 A;  4JQF A;  4ANJ A;  1HKS A;  4Q48 A;  4E7L A;  2YU9 J;  1FEX A;  4M9X A;  3HC7 A;  5JHF A;  4NC8 A;  1YFH A;  1NG6 A;  2YPR A;  4I7H A;  1X1P A;  4BS9 A;  4RBO A;  3GWZ A;  4II3 A;  2K9M A;  4M3E A;  3E5X A;  3EUA A;  3L2R A;  2STT A;  3OMY A;  1KQ9 A;  3NRV A;  5E8G A;  4PZJ A;  1BR2 A;  1NK2 P;  3VYR B;  2Y2Z A;  4LLL A;  2VOD A;  5BQT A;  3OYM A;  3JSO A;  3N4M A;  1B9N A;  1ACI A;  2H1L A;  5EG0 A;  1QGP A;  4EQQ A;  4C3H J;  1MND A;  1BW5 A;  2UUZ A;  4XLN F;  1D0Z A;  1VF9 A;  3I71 A;  4L0Z B;  3LNQ A;  2TRT A;  3I4P A;  4U88 A;  2CFO A;  4LMY A;  4HLX A;  2QEN A;  3ELK A;  1ERD A;  3BTC A;  3ABT A;  2OC6 A;  1Z6T A;  2JUG A;  3V7C A;  2WTE A;  4KT6 A;  2AQF A;  3E0J B;  4XOT A;  4A3E J;  2VT3 A;  4GYG A;  1ZGW A;  2FD5 A;  1XTA A;  1A6Q A;  4UUS B;  3BPV A;  5GTI C;  3H0D A;  3K4C A;  4XBF A;  2E60 A;  3V7S A;  3MFK A;  2EWN A;  1BBY A;  2ELJ A;  3TQN A;  5C4J J;  2EH3 A;  1XSX A;  2VOP A;  2L7K A;  3GTO J;  1B72 B;  2DTR A;  5JVT A;  2R7W A;  2ESN A;  2MAB A;  3K70 C;  2H6C A;  1TP4 A;  2ZC2 A;  4IX7 A;  2LD5 A;  1LUJ B;  2XVC A;  3QQA A;  3S8P A;  3E97 A;  3VWB A;  1APL C;  3D5L A;  4U87 A;  4CZC A;  3PNY A;  4H4K C;  4AD9 A;  1LNW A;  5BPD A;  3MQ0 A;  4QSH A;  4S04 A;  4FIS A;  1XSD A;  2QUF A;  2V4J C;  3DP7 A;  3QPH A;  1O3Q A;  4N9H A;  4P9F A;  1YYV A;  2QM3 A;  3KZI C;  3IWF A;  4A3M J;  3KYD B;  1UHW A;  4MIM A;  3BJA A;  4DQ2 A;  4KMF A;  3V42 A;  2M1B A;  3GVA A;  4KFC A;  1NTC A;  2M0M A;  4HST A;  4CYC A;  4RA2 A;  3VB2 A;  1XS9 A;  1E3P A;  3A0B C;  2F6C A;  1ZGA A;  2IGN A;  1JJ6 C;  1RZ4 A;  4EJV A;  1FBU A;  3I0T A;  4PJN A;  3ZQQ A;  3TMO A;  3ZMS A;  2OQR A;  1X1C A;  5GPA A;  2JA7 J;  4EGY A;  1U0J A;  2XUB A;  2E1O A;  2OZ6 A;  3H3V K;  1XGM A;  2JK3 A;  1SMT A;  3HYI A;  2J5O A;  2HVR A;  5GAD J;  3JRH A;  3H3Z A;  4G6D A;  1A04 A;  1XPX A;  4L9N A;  3S2W A;  2RC4 A;  2BHY A;  3V8L A;  1OPC A;  1Y6I A;  1R1T A;  2M8E A;  2OPT A;  3HSF A;  3OYE A;  5ERI A;  1HKQ A;  1S29 A;  1V4R A;  2X1C A;  4LG0 A;  2DT6 A;  3H9Q A;  4RLF A;  3DCF A;  1LDK B;  2O3F A;  2VPR A;  2DFF A;  4ZTF A;  4GCV A;  3PUB A;  4WXH A;  1RUO A;  3DF8 A;  2QSH X;  2FJ1 A;  1JGG A;  3OYB A;  2JA5 J;  1FNN A;  4AID A;  3JSP A;  2R7X A;  3SEZ A;  1JHH A;  2LLK A;  2Y48 A;  2XRL A;  1MSF C;  2BE5 F;  3NWS A;  1PVE A;  1YIT I;  1Y8Q B;  2XF7 A;  4MLO A;  2O03 A;  2STW A;  5FB2 A;  4FTH A;  1QPI A;  2E1M B;  4IHY A;  2VKD A;  2I5U A;  1JE8 A;  5KAI C;  3WTU C;  1VQO I;  3KP4 A;  3CJQ B;  1TWH J;  5HS9 A;  5D8K B;  4ZC3 A;  3KLO A;  1G2H A;  1WH7 A;  4XLF A;  1IRG A;  1OIS A;  2HU9 A;  2XAQ A;  3CF2 A;  1IN4 A;  1FC3 A;  4UNO A;  1F9N A;  2OBP A;  2AQE A;  3TED A;  3S3O A;  1BJA A;  3DLA A;  4XRF A;  1H89 C;  2JA6 J;  1BC8 C;  4PFO A;  4DW6 A;  2QWW A;  4ETS A;  1Y1W J;  4U0V A;  2DA6 A;  1PUE E;  2NNY A;  5JLX A;  2KRF A;  2R7O A;  3K4L A;  1Y56 A;  2LSO A;  2Z5U A;  5H6Q A;  3SQN A;  1CF7 A;  1FYL A;  3KIO A;  3I55 I;  4HV5 A;  3A03 A;  3Q0U A;  3PSF A;  1W5C C;  1K78 B;  2GA1 A;  2X1D A;  4HBL A;  3IL2 A;  1OKR A;  1WRJ A;  1XCB A;  2E7X A;  3DKX A;  3S3N A;  3SDG A;  2XGX A;  3IH3 A;  1IUF A;  2GXG A;  4NB5 A;  5DUK A;  4RDU A;  4WK8 F;  1GXP A;  3EYY A;  3FBI B;  3VYU B;  3MMY B;  1KZH A;  2GXA A;  4WXD A;  3IUO A;  1IZ1 A;  3DU6 A;  1N25 A;  1XX5 A;  2VUM J;  5ILU A;  3F8F A;  1V5F A;  1YHQ I;  2KRH A;  5A2Q K;  3BG5 A;  2ZJR F;  2P7V B;  2V6E A;  4U7B A;  3KP5 A;  2OZU A;  3OY9 A;  1O7L A;  2R7D A;  1XMX A;  1PUF B;  3HGG A;  1QZE A;  1XCV A;  5F1J A;  3FHZ A;  3HOZ J;  1FBQ A;  2HKO A;  2E2I J;  3K6G A;  2HTS A;  2OU2 A;  3NAU A;  5CJ9 A;  3TL4 X;  3CLO A;  2OV7 A;  1Z3X A;  4L18 B;  2KJB A;  1CQT A;  1ON2 A;  1R5I D;  3LSK A;  1BN5 A;  2OA4 A;  2FSW A;  2CW7 A;  3K4N A;  4XLC A;  3H5A A;  3Q0V A;  2QF7 A;  2EIL H;  3C2B A;  3D0S A;  3J7A Y;  2K7L A;  4LLG F;  2Q2E A;  2IW5 A;  1B8I B;  4BGD A;  5DUI A;  3AKZ A;  2NVU B;  2NAZ A;  4E7Z A;  3FKI J;  4NHJ A;  3CCY A;  2PLY A;  1ETQ A;  1I6X A;  2KDZ A;  2IS2 A;  2NVT J;  5IPA A;  1AKH A;  1I6H J;  1V5G A;  1O57 A;  3DKW A;  1VQ5 I;  3FXL A;  2NVQ J;  1Y1V J;  2A5W A;  1ETV A;  1YIO A;  2P5K A;  1FWZ A;  3J7Y J;  4AIJ A;  2Z16 A;  2MH9 A;  4IVN A;  4M3G A;  2QKL B;  3H35 A;  4IHX A;  3Q9S A;  1OJL A;  3FXK A;  3ERM A;  2HQR A;  4Q47 A;  4G6Q A;  4G7O F;  3K69 A;  1ETW A;  2QQB A;  3OR1 C;  2DA7 A;  3RTR A;  1AU7 A;  1BW6 A;  1P7J A;  4PSW A;  2QBY A;  4M3F A;  1Z67 A;  2ME6 A;  4MO7 A;  1MD0 A;  3PIP F;  1O3S A;  2ZXJ A;  2W57 A;  3PNT A;  3QYB A;  1F36 A;  3D5S C;  3CCE I;  4BE1 A;  2KIF A;  1UCR A;  5FLX Z;  1UB9 A;  2XGC A;  3H1C A;  3HRT A;  2P8T A;  4IHS A;  5CQG A;  2XAU A;  3AG3 H;  1IF1 A;  3HB9 A;  2IGO A;  3BWG A;  4IRI A;  4FE7 A;  3RCO A;  4AVZ A;  5TJJ A;  1QRY A;  2DJN A;  3S2H J;  2XF5 A;  3CJN A;  3BLY A;  3BTJ A;  3HUG B;  1J9I A;  1K6Y A;  2Z1D A;  2W48 A;  2RQP A;  4XID A;  3M07 A;  4OAZ A;  3C2G A;  4XRS G;  2MH2 A;  3EQL F;  2VKV A;  3Q5F A;  2ETH A;  3EET A;  2M30 A;  3CQZ J;  3JRF A;  2DA3 A;  2MLG A;  1SAX A;  3MN2 A;  5L3G A;  4M72 A;  4Y3O A;  3CDH A;  2DQR A;  1JKR C;  3F8C A;  5BNG A;  2DXI A;  2MD0 A;  5CLS A;  4J00 A;  3PQK A;  2R4G A;  3E7L A;  1OCP A;  4X1E A;  4ESB A;  3ZMV A;  1I50 J;  1UJ8 A;  1I27 A;  2IS1 A;  2XPW A;  1WH5 A;  4YFX F;  2EZI A;  3JTG A;  2IP2 A;  4FQG A;  2LK2 A;  1IGN A;  1I3A A;  4A5M A;  2GLO A;  4A0X A;  5L3F A;  2GM4 A;  2EZH A;  4Q4Z F;  3MZY A;  1HC8 A;  1BI0 A;  3WTT C;  3SJM A;  4YEJ A;  1YLF A;  2E71 A;  2EFO A;  4IJA A;  4ENM A;  1B1B A;  2WAQ N;  2MYS A;  2V7F A;  1ULY A;  2RGV A;  2LOO A;  4XKC A;  3QOE A;  3JRE A;  3B73 A;  3COA C;  4G94 A;  2F5C A;  2NXN B;  4YFN F;  3FK7 A;  2HZD A;  4XKB A;  5B66 C;  1F43 A;  4L5E A;  2FOK A;  1BR1 A;  2WBM A;  5DCM A;  3VSK A;  3IH2 A;  5J3L A;  1CGP A;  1GUU A;  2ZJ2 A;  1SFX A;  5EEG A;  2CU7 A;  2HXI A;  1LE8 A;  5DD4 A;  5DM7 F;  3CCS I;  1XGS A;  2HYF A;  3CZ6 A;  4PJJ A;  5EG0 B;  2W85 A;  2D5V A;  1VQ8 I;  2F5E A;  1OCT C;  1ZAO A;  4IKF A;  2GIV A;  1JHF A;  1S7A A;  2B0L A;  2R92 J;  4BEH A;  2X6W A;  3VOE A;  4KNY A;  2QGU A;  1ZHF A;  1FIA A;  3GLX A;  2V9V A;  3DPL C;  3GME A;  4KJZ A;  4CSW A;  3RQ4 A;  5LFA A;  4G7Z F;  2DI3 A;  2BW3 B;  3K4K A;  5HDN A;  2GBY A;  3RKQ A;  1ENH A;  1ETY A;  3GYH X;  3CCL I;  5M5W J;  1MGT A;  2FBI A;  4J19 A;  4C2U A;  3F8N A;  2FNP A;  2IT0 A;  2K02 A;  3PUF A;  3Q9V A;  2ZCW A;  3K1P A;  1YO5 C;  1YW7 A;  1BI2 A;  2IVM A;  1DPR A;  5HLI A;  1P7I A;  2XB0 X;  3BR2 A;  2KFD A;  4IQJ A;  3RYP A;  4E7I A;  5TRD A;  3E3V A;  3E6B A;  1R00 A;  3CC4 I;  2JQ7 A;  1U2W A;  2GIZ A;  5A2Q Z;  2DT7 B;  3FZV A;  1HBX G;  1BI1 A;  1LVA A;  4DBQ A;  1OR7 C;  1L3L A;  1BIA A;  2VQH A;  1LB2 A;  3BY6 A;  4UVC A;  3ULQ B;  2ESH A;  2IS6 A;  2HPI A;  2FRH A;  5ICC A;  3V8K A;  3OYL A;  1T33 A;  5LHG A;  1LJ9 A;  3L2V A;  3DXJ F;  3GUD A;  4RB0 A;  1IDZ A;  2VKE A;  3F21 A;  2OTL I;  3BJ6 A;  2CW0 F;  4N4N B;  1VQ7 I;  4D5F A;  5IT3 A;  1VI0 A;  1OR7 A;  2B63 J;  1W7P B;  1LVK A;  2FQ4 A;  3FDY A;  2V1X A;  3L09 A;  4LIT A;  2PJP A;  1AOY A;  1P92 A;  3FM3 A;  3K0L A;  3OR2 C;  2IXS A;  4DGW B;  3CUQ C;  1SMY F;  3I5U A;  2V1D A;  4EVI A;  2FXA A;  1X4O A;  3HIF A;  1H0M A;  3J7A O;  1FYK A;  3WGH A;  3I3L A;  3FWE A;  3BG9 A;  5E1X A;  3HDD A;  2MC3 A;  3FXJ A;  1WJA A;  4A3J J;  3F6V A;  2ZFW A;  3T0Y A;  3NEU A;  3CUQ A;  4CUG A;  1V3F A;  3OYN A;  4J01 A;  2IRF G;  3J7Z I;  2E35 A;  1QU3 A;  5D4S A;  3BR5 A;  5IOZ A;  5L3C A;  1EA3 A;  5BMZ A;  1ZRD A;  3LSM A;  4JK1 X;  2IA0 A;  4KN7 X;  4HEA 2;  2HQA A;  4XLA A;  1FMW A;  2Z2S B;  1XN7 A;  5CVV A;  2F48 A;  4B43 A;  4A5N A;  2VXZ A;  4AM3 A;  2VQG A;  2AO9 A;  1ZKG A;  4YII A;  1T56 A;  2CUE A;  2DYR H;  4DYR A;  3HKZ N;  5FGM A;  1YRN A;  2CUF A;  5CVU A;  3K1M A;  1S5L C;  2HI3 A;  5AIQ A;  4A12 A;  2G7H A;  1MBH A;  1MW7 A;  4XR6 A;  1XMA A;  3JRB A;  3RKW A;  4C3J J;  1OYI A;  2KRC A;  2CRG A;  3HSE A;  4WCG A;  3S2D J;  5J6X A;  3IWZ A;  1EV7 A;  2ZME C;  4F7Z A;  1ZRC A;  5HOD A;  2JMW A;  2IA2 A;  5LHI A;  3BJO A;  2FNA A;  3G6E I;  4QLC U;  4Y15 A;  3G73 A;  4I02 A;  4A2U A;  2YUS A;  4IPA A;  5IOY A;  2CJJ A;  4S05 A;  5J47 A;  2DJI A;  4BXU A;  3D1N I;  2M2E A;  2W84 A;  2PJR A;  3M8F A;  1D0X A;  2KIS A;  4XRS A;  1HDD C;  1IXR C;  3HRU A;  1LFP A;  3RPU D;  2CSO A;  4HDV A;  4GYI A;  2LRD A;  2PMZ A;  2X6O A;  2HQ5 A;  4OWR B;  2KKO A;  2LR8 A;  4KUM A;  4BDZ A;  5JI6 A;  1O3R A;  1SC7 A;  2IGK A;  1MDM A;  4BJ5 C;  1POG A;  3CCR I;  3A1Y A;  1W4M A;  2HVQ A;  2RDP A;  2UXN A;  3ROU A;  1S72 I;  3W2V A;  2DOF A;  2EV6 A;  5FKO A;  5D6F A;  4A3L J;  2FML A;  2V79 A;  1ONV A;  3BCA A;  1DP7 P;  3FHN A;  2UWM A;  2HYJ A;  2DFE A;  2FMY A;  1WKM A;  5J4V A;  4D1Q A;  3CME I;  1ZH5 A;  3VYS B;  4CIC A;  4YG2 F;  3MEX A;  2HFH A;  2ADU A;  1TTY A;  4RGX A;  4XRM A;  3IRR A;  3WG7 H;  3ZQG A;  4HA8 A;  3GTG J;  3EYI A;  3ABM H;  2QQ8 A;  3OIP A;  1VTN C;  1Z7L A;  3K4B A;  3JAM Z;  1R1U A;  2XV4 S;  1A5J A;  3HRS A;  5E8I A;  2ISZ A;  3HEF A;  5F27 A;  4B47 A;  4RAG A;  3OS0 A;  4ABZ A;  2K5C A;  4ZYA A;  4LB5 A;  2M0C A;  1XDS A;  3GTM J;  4AUX A;  2XGD A;  2Y30 A;  2JTV A;  5HNF A;  5FRN A;  1OCR H;  2A6T A;  4FET A;  3W2W A;  3VSL A;  4LLN A;  2DLL A;  4RGR A;  2EJR A;  4BQO A;  1E3H A;  3GO5 A;  2L4M A;  3IHU A;  1TL8 A;  3KEO A;  1K4T A;  1UFM A;  1SAU A;  3DTE A;  4RB2 C;  1RRJ A;  1KON A;  3GLL A;  5TIS C;  2QKM B;  3WHC A;  3HGY A;  3KCC A;  2K85 A;  2BVL A;  4HX7 A;  5D5U B;  3TDZ C;  1J0R A;  2F5F A;  5GP9 A;  5ICG A;  3HPG A;  4FHT A;  2KHM A;  2HR3 A;  2K86 A;  2CWE A;  4DYQ A;  3T8T A;  3BCB A;  2DQL A;  4LIU A;  1EH8 A;  2VI6 A;  4IQ4 A;  2K4J A;  5EZG A;  4ON0 A;  4CCM A;  1KU7 A;  2CGP A;  4RLQ A;  3HTS B;  3N05 A;  4GDF A;  3CLQ A;  4DNC A;  1R6R A;  2ZJQ F;  4NQW A;  4TV7 A;  2OQG A;  4G6T B;  4E7K A;  3S1M J;  5E18 F;  3S16 J;  3UNG C;  2EZK A;  5JVG F;  1ZTR A;  3F8B A;  1VQ4 I;  1IUY A;  1RPW A;  3TO9 A;  3PO2 J;  1AKH B;  4AC0 A;  2GOM A;  3RKY A;  3ZMD A;  1T08 B;  4RAF A;  3PQJ A;  2VAS A;  3DEU A;  4HG2 A;  1KYW A;  2XAG A;  4M71 A;  2N8G A;  1LDJ A;  5HLH A;  2OAZ A;  4MQV A;  2YU3 A;  2QVO A;  1HXD A;  5FD5 A;  1BR4 A;  2JRM A;  1X1B A;  2HS5 A;  1ZEL A;  2A05 A;  3GCM A;  5LD2 C;  2RQQ A;  4E70 A;  1P2F A;  2F5D A;  4ESF A;  1SFO J;  1N78 A;  2M4G A;  2E2J J;  2JSC A;  1HW1 A;  1TZL A;  2LY1 A;  5KVR A;  4G7H F;  1J59 A;  1DUX C;  4CA0 A;  1MJB A;  3JRA A;  1VZ0 A;  1I39 A;  5EZH A;  1TQM A;  2HGC A;  3OS1 A;  3AL0 C;  5LGT A;  1S6L A;  4HNU A;  3S93 A;  4X6A J;  2K40 A;  1E0E A;  3LAJ A;  5M3M J;  2BYV E;  3LFU A;  2IBD A;  2NS8 A;  2D2W A;  3VOD A;  2M9H A;  3JCU C;  1ZLK A;  4PCQ A;  1IN8 A;  3MAJ A;  2JZY A;  3DEE A;  3B6C A;  1SD6 A;  3LWF A;  5J8C A;  1IAW A;  2JT1 A;  3L2C A;  1IXC A;  1FMV A;  2FOW A;  3BZC A;  4L9T A;  2H94 A;  5L3E A;  2A68 F;  5GPC A;  1IG7 A;  3HXL A;  4I0A A;  1OCC H;  5J1R A;  1QQI A;  1T38 A;  1YW8 A;  2H6B A;  3SEQ A;  4ZDO A;  2X9D A;  1MMD A;  3REO A;  2HXO A;  5FJ8 J;  4L9V A;  3BQY A;  1RKW A;  1FTZ A;  2DMU A;  1QZY A;  1KA8 A;  1MH4 A;  1MMN A;  2CQQ A;  2ELH A;  1YTY A;  1ZR4 A;  1X4P A;  1FOW A;  4XLE A;  5LGU A;  2L2O A;  2RRE A;  3R0J A;  2CQK A;  5CYV A;  2ZXI A;  3TO6 A;  2VPL A;  2MLK A;  3FIS A;  2VXD A;  1USS A;  1BL0 A;  3CF5 F;  2WY8 Q;  2ID3 A;  5JR3 A;  4ZYD A;  3ISP A;  1R5G A;  3I4N J;  3TKY A;  2O0Y A;  4Y7N J;  1TNT A;  3L2Q A;  1A36 A;  5FRO A;  2L01 A;  3K4M A;  4IHT A;  3GTK J;  3FBN B;  3R6S A;  2DA2 A;  2KDO A;  3CD6 I;  3F8M A;  5J8F A;  4B48 A;  3KET A;  3GZ5 A;  3P9I A;  4KIC A;  5FKK A;  3SXY A;  3W3C A;  2FF4 A;  3WU2 C;  4BBS J;  4ZYH A;  1P6R A;  4MFE A;  1FTT A;  4ZJZ A;  3MZH A;  4F3Q A;  2CS3 A;  5JFR A;  1U3E M;  1LKX A;  4EJU A;  3F6O A;  4YFK F;  2HVS A;  2NOG A;  1YG2 A;  4OOI A;  3ZQC A;  1Y0N A;  3FXQ A;  2XKP A;  1OYW A;  2RN7 A;  1Z91 A;  1MBK A;  1U6G A;  2EIJ H;  3GEZ A;  1R4M B;  2DPD A;  1ZLJ A;  3FXU A;  3W6K B;  1U5T C;  2H27 A;  2PMZ N;  2ECC A;  1WI3 A;  2WAQ A;  1WJC A;  3RKX A;  1KQ0 A;  1P4X A;  4Y4R A;  3ZGK A;  2ELK A; 
#chains in the Genus database with same CATH homology
 4JX6 A;  3HOX J;  2XSD C;  3S1R J;  4FE7 A;  4BKX A;  5M5X J;  3LOC A;  4W1U A;  3CMY A;  1LE8 B;  1QRY A;  1IC8 A;  1HOM A;  2ZB9 A;  2COB A;  2DJN A;  1DU6 A;  3S2H J;  3LSP A;  4A69 C;  1RET A;  1K83 J;  2R7Z J;  3BTJ A;  2X48 A;  1TC3 C;  1ETO A;  4XK4 A;  2OF7 A;  2W48 A;  3Q0W A;  4XID A;  1JJ8 C;  4XRS G;  1ORK A;  4A93 J;  2M8G X;  2VKV A;  1R9T J;  1D5Y A;  5EGO B;  2JA8 J;  3CQZ J;  3F0C A;  2DA3 A;  3JRF A;  3OSG A;  3MN2 A;  1TWF J;  1B8I A;  1MNM C;  4G12 A;  1JKR C;  5BNG A;  5JLW A;  3BTL A;  3NAR A;  3E7L A;  1OCP A;  4X1E A;  4FCY A;  5EDN A;  3W6V A;  1I50 J;  3BG3 A;  3QPS A;  3TP0 A;  5K7F A;  1SAN A;  2XPW A;  1WH5 A;  2EZI A;  5F0H A;  2EBI A;  2O7O A;  3QPL A;  1IGN A;  2LK2 A;  2ME0 A;  2MGQ A;  2NS7 A;  3H0G J;  1ETX A;  2L7M P;  2GLO A;  2GM4 A;  2EZH A;  1JKQ C;  3G1O A;  3SJM A;  4JP0 A;  3HBL A;  1U9N A;  5M3F J;  3JRC A;  3JR9 A;  2WAQ N;  1ZR2 A;  3JRI A;  4I6Z A;  3ZQL A;  3JRE A;  4I76 A;  2LKX A;  1H8A C;  3MVP A;  1X2N A;  3ZQI A;  3FK7 A;  3M4O J;  2XB5 A;  5J1U A;  3RQI A;  1F43 A;  4L5E A;  1W0U A;  2I10 A;  5DS9 A;  3IH2 A;  5J3L A;  1GUU A;  1GDT A;  4Y52 J;  3IV5 A;  3ZQH A;  1H88 C;  3DEW A;  2CU7 A;  2HXI A;  1U78 A;  1BJZ A;  3A01 B;  1LE8 A;  4B1R A;  2DMQ A;  5EG0 B;  2LFB A;  2HOA A;  4B4C A;  2D5V A;  9ANT A;  4JX4 A;  1OCT C;  4BY1 J;  5C3E J;  5F0C A;  4W97 A;  5IP6 A;  1Z0X A;  2R92 J;  2DMT A;  4QIW N;  4BBR J;  1FIA A;  1EF4 A;  5IYB J;  1S7E A;  4MFD A;  4C3I J;  2RAE A;  2GBY A;  3RKQ A;  1ENH A;  1ETY A;  5M5W J;  4A3I J;  5FLV A;  2DA1 A;  5EYR A;  4J19 A;  2MG4 A;  1IV6 A;  3LSR A;  1A6I A;  4UUS A;  2HOS A;  2H1K A;  1P7I A;  2LP0 A;  2XB0 X;  3BR2 A;  2MW8 A;  4A3G J;  3B6A A;  1GV5 A;  1B72 A;  2R5Z B;  2YS9 A;  2JJ7 A;  1MBJ A;  1HLV A;  5IYD J;  3A02 A;  2DA4 A;  1X58 A;  1RES A;  2YU9 J;  1FEX A;  2HOT A;  1T33 A;  5C44 J;  1JTX A;  4RBO A;  2FX0 A;  1IDZ A;  2VKE A;  4M3E A;  5M5Y J;  4D5F A;  1VI0 A;  2B63 J;  2FQ4 A;  1NK2 P;  2Y2Z A;  1AHD P;  3WHB A;  2Y31 A;  1MBE A;  2EZL A;  3VPR A;  4LOC A;  3A01 A;  3UKG A;  5EG0 A;  4C3H J;  1BW5 A;  3BG9 A;  2DMP A;  1VF9 A;  3HDD A;  4A3J J;  4DYC A;  1HDP A;  2XPV A;  3LNQ A;  3SFI A;  2TRT A;  2CQX A;  3BTC A;  1VFC A;  1ZGW A;  1MBG A;  4A3E J;  4M3B A;  2FD5 A;  1JUS A;  4XIC A;  1TWC J;  4UUS B;  1OFC X;  3BR5 A;  5IOZ A;  3S17 J;  1JT6 A;  5C4J J;  2EH3 A;  3TW6 A;  4V2G A;  4JX5 A;  3Q3S A;  3HOW J;  3GTO J;  1GVD A;  1ZKG A;  2AO9 A;  1B72 B;  1T56 A;  2CUE A;  4DYR A;  3LSG A;  3HKZ N;  1YRN A;  2CUF A;  2HI3 A;  2L7F P;  1MBH A;  2LD5 A;  3G1L A;  3JRB A;  1FIP A;  3FK6 A;  4C3J J;  2ECB A;  3QQA A;  2CRG A;  2R5Z A;  3S2D J;  1GT0 C;  2DTZ A;  1APL C;  2E19 A;  5F0F A;  5HOD A;  2JMW A;  3GBG A;  2HDD A;  3G1M A;  1QVU A;  2R5Y B;  4IHW A;  4S0H B;  4QSH A;  3ZQF A;  4FIS A;  1LFU P;  3I4M J;  5F08 A;  2AHQ A;  3OSF A;  2YUS A;  3S1N J;  5IOY A;  1ETK A;  2CJJ A;  3D1N I;  2M2E A;  4XRS A;  1HDD C;  1NK3 P;  4A3M J;  1JT0 A;  4MIM A;  1K61 A;  1NTC A;  2X6O A;  4DZP A;  2HQ5 A;  4CYC A;  1GV2 A;  2LR8 A;  1XS9 A;  2E2H J;  2WV1 A;  1FJL A;  1JJ6 C;  1POG A;  1QVT A;  3HOY J;  1ZK8 A;  1XG1 A;  5IP7 J;  5FKO A;  3MKL A;  4A3L J;  2XGE A;  5EF6 A;  5GPA A;  3K7A J;  2JA7 J;  3BQZ A;  5IYC J;  2HYJ A;  4HNV A;  4IHV A;  2E1O A;  2MSY A;  3BTI A;  3H3V K;  2JK3 A;  1WPK A;  3HM5 A;  1JKO C;  3JRH A;  4IEJ A;  5IP9 J;  1UHS A;  4XRM A;  1YRN B;  2M34 A;  4UUT A;  3ZQG A;  3GTG J;  2LTP A;  2OPT A;  3IH4 A;  3PO3 J;  4FE4 A;  1BA5 A;  3JRD A;  4A3B J;  1ITY A;  1UMQ A;  3GTQ J;  2Y0S N;  3DCF A;  5E3N A;  5FLM J;  1A5J A;  1JUM A;  1Z77 A;  2VPR A;  3HEF A;  2Y9Z A;  5F27 A;  2H8R A;  2K9N A;  1IJW C;  5E3M A;  2XPU A;  4ABZ A;  2FJ1 A;  1JGG A;  2M0C A;  3HOV J;  2JA5 J;  3GTM J;  4AUX A;  4GFB A;  2XGD A;  2Y30 A;  3PM1 A;  4A3C J;  1W0T A;  3FIW A;  2LLK A;  3BR0 A;  3OIO A;  2XRL A;  1MSF C;  2R5Y A;  4MLO A;  4FTH A;  1QPI A;  4IHY A;  1E3O C;  4CYC B;  1TWH J;  4EEF G;  3WHC A;  1G2H A;  1WH7 A;  3HGY A;  2L9R A;  1MSE C;  4DZJ A;  4M3D A;  3ZOB A;  3CDL A;  5GP9 A;  1JTY A;  2O8K A;  3TED A;  4B3A A;  1H89 C;  1X2M A;  4DYQ A;  2JN6 A;  2EQR A;  1JKP C;  2JA6 J;  3TP3 A;  4DW6 A;  3S1Q J;  2VI6 A;  5EZG A;  1Y1W J;  1MBF A;  2DA6 A;  2P81 A;  5JLX A;  5K7H A;  3S16 J;  1RKT A;  3S1M J;  3A03 A;  3Q0U A;  2EZK A;  5FKM A;  1ZTR A;  3S15 J;  1RPW A;  2IEK A;  3PO2 J;  4A3K J;  1AKH B;  2NVY J;  4AC0 A;  3O8G A;  4JYK A;  2DA5 A;  4V2F A;  5EEA A;  2N8G A;  3IH3 A;  3SDG A;  1IUF A;  4BXX J;  4RDU A;  3GTP J;  1RR7 A;  2K9Q A;  2ID6 A;  1I3Q J;  1IDY A;  4AYB N;  1WGX A;  4D7N A;  3HOU J;  2WB1 N;  2TCT A;  1JUP A;  5E3L A;  3M3Y J;  1SFO J;  2VUM J;  2E2J J;  1UG2 A;  1LFB A;  4A3F J;  5C4X J;  4D5C A;  3BG5 A;  3JRA A;  2LY9 A;  3L1P A;  5EZH A;  1DU0 A;  1PUF B;  2L0K A;  2K40 A;  3HGG A;  4X6A J;  4NDL A;  5M3M J;  5F1J A;  4QTR A;  3HOZ J;  1VND A;  2IBD A;  2NS8 A;  2O9L A;  2R93 J;  1U8B A;  2M9H A;  2E2I J;  3NAU A;  3K2A A;  3B6C A;  1IRZ A;  3BT9 A;  1ZQ3 P;  4A3D J;  1HCR A;  4D7M A;  1CQT A;  3RZO J;  5GPC A;  1IG7 A;  1XC5 A;  1Q1V A;  5J1R A;  3TW7 A;  3O8H A;  1MH3 A;  2X9D A;  2HXO A;  5FJ8 J;  2Y9Y A;  3Q0V A;  3BQY A;  3GTJ J;  1RKW A;  2QF7 A;  1FTZ A;  2DMU A;  1MH4 A;  2CQQ A;  3C2B A;  1TWA J;  1ZR4 A;  3BR1 A;  3JRG A;  3BR3 A;  2KT0 A;  2DMN A;  1B8I B;  4M6V A;  3FIS A;  1WCM J;  2LVS A;  2NVX J;  1BL0 A;  2ID3 A;  3FKI J;  1TWG J;  3CCY A;  2IAI A;  1ETQ A;  3I4N J;  2KDZ A;  4Y7N J;  2NVT J;  2QCO A;  5IPA A;  5DTD A;  2R0Q C;  1AKH A;  5EGO A;  1I6H J;  2NVQ J;  1Y1V J;  5J1Y A;  3GTK J;  2DA2 A;  1ETV A;  3S14 J;  4M3G A;  5FKK A;  4IHX A;  4BBS J;  1OJL A;  2K9S A;  4MFE A;  5F04 A;  1FTT A;  5E3O A;  1ETW A;  5K7Z A;  4C2M J;  3LSJ A;  4BY7 J;  3GTL J;  2DA7 A;  2NOG A;  2DN0 A;  1AU7 A;  1BW6 A;  3ZQC A;  3RZD J;  1P7J A;  4M3F A;  1HF0 A;  2ME6 A;  1MBK A;  4MO7 A;  2L7Z A;  2G0E A;  1O4X A;  1F36 A;  2JWT A;  2PMZ N;  1PUF A;  2ECC A;  2XGC A;  1WI3 A;  3OOU A;  5FKL A;  1U9O A;  3BR6 A;  5FKN A;  3HB9 A;  2ELK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...