4IEJA

Crystal structure of a dna methyltransferase 1 associated protein 1 (dmap1) from homo sapiens at 1.45 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
VQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA methyltransferase 1-associated protein 1
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16282 SANT_DAMP1_like SANT/Myb-like domain of DAMP1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4iejA00
2KT0A 3FIWA 1JUMA 1JT6A 2CRGA 1W0TA 2VUMJ 2K9NA 1D5YA 5GPAA 1XS9A 4A3DJ 1T56A 5BNGA 1HDDC 4DZJA 3TP3A 1OCTC 4JP0A 3ZOBA 1JTYA 1ETQA 3HOYJ 4V2FA 1F43A 3ZQHA 1TWCJ 5FKOA 3S1QJ 2LY9A 2E19A 4AYBN 1ETWA 1MBJA 2RAEA 1ZR2A 5J1UA 3IH4A 4A3FJ 5EZGA 3I4NJ 2XPUA 1B8IA 3JRFA 4M3GA 2R92J 1WH5A 4FTHA 5E3MA 3TEDA 1NK3P 1YRNA 3JRDA 3ZQIA 1O4XA 1HOMA 2JA6J 1POGA 3JRGA 1FIPA 1UHSA 1OCPA 5IP6A 3FK6A 2GLOA 4BY1J 5K7ZA 2R5ZB 4XICA 2EZHA 1B72B 5EYRA 1RKWA 3FKIJ 3O8HA 3E7LA 3JRAA 5E3LA 1GT0C 4CYCA 4Y52J 1JTXA 1PUFB 4A3LJ 3MKLA 5EEAA 3QQAA 1IG7A 1IGNA 5EGOA 3GTMJ 2R93J 1IJWC 4EEFG 3GTKJ 1MBGA 4JX5A 2R7ZJ 2JWTA 3HOUJ 3TP0A 1G2HA 1T33A 1IV6A 1XC5A 2HDDA 1GV5A 4DYQA 4AC0A 5E3OA 2XSDC 1U78A 4DYRA 5FJ8J 3HB9A 4A3GJ 3RZOJ 1APLC 1IRZA 2X6OA 4ABZA 2DN0A 4MFDA 1I50J 2PMZN 3S1RJ 1ETXA 2AO9A 1HDPA 5FLVA 4FCYA 5F0FA 3WHCA 2AHQA 5FKMA 1FEXA 2TCTA 3GBGA 1JKPC 3L1PA 2ME6A 1SANA 1MH4A 1JUSA 1BW6A 4C2MJ 1MSEC 2CJJA 1TWGJ 4DZPA 3GTJJ 1HLVA 1LE8A 1TC3C 4W1UA 1BA5A 3CDLA 4D5CA 3FISA 1YRNB 5IPAA 1UG2A 3TW7A 3F0CA 4XIDA 4A3MJ 1EF4A 3M3YJ 1I3QJ 2LKXA 3BR5A 5DS9A 4B4CA 4UUSB 2OF7A 2XGEA 4C3JJ 5EF6A 4IHVA 2M0CA 2IBDA 3LSJA 2DA4A 2VKVA 5DTDA 2IEKA 5F08A 5IYBJ 1LFBA 2LFBA 1ETKA 1ZGWA 1X2MA 4XRMA 1JGGA 2M34A 3HDDA 2IAIA 2K9SA 1Y1VJ 2XB0X 3LOCA 3ZQCA 1Z0XA 3IV5A 4S0HB 2Y31A 2MGQA 2E2IJ 4I76A 3PO3J 2X48A 2CQQA 3BT9A 1S7EA 1U9OA 2JMWA 1FTZA 5EG0B 2XPWA 1VI0A 3DEWA 1QVUA 2M9HA 3HKZN 3MN2A 3S16J 3W6VA 2XB5A 3HBLA 3SDGA 2R5ZA 5EZHA 1NK2P 1K83J 2DTZA 2ECBA 2YU9J 3CQZJ 4M3FA 2GBYA 3K2AA 1AKHA 3CMYA 2VPRA 1Z77A 2XGDA 4UUSA 2Y30A 4C3IJ 5IOYA 1HCRA 5M5WJ 4QTRA 1AU7A 4IHWA 1W0UA 3C2BA 1P7JA 1RKTA 1DU6A 2HQ5A 1BL0A 2DMUA 3OSGA 4A3BJ 1FIAA 2LR8A 5IP9J 3BR6A 3HGGA 3BR1A 3A02A 1JKOC 1NTCA 1JUPA 3BTIA 1B8IB 2CQXA 2W48A 2ELKA 2ME0A 4I6ZA 5FKLA 4MLOA 2R0QC 5F27A 3JRCA 4L5EA 2X9DA 2EZLA 4NDLA 2QCOA 4LOCA 1ENHA 3Q0VA 3JRBA 2E2HJ 3BG5A 1E3OC 4M3DA 3A01A 2ECCA 2E2JJ 2LVSA 3PM1A 2NS7A 2NS8A 2JA5J 2N8GA 2H8RA 3NAUA 2NOGA 3VPRA 2ID3A 5JLWA 3S15J 1WGXA 4IHXA 3GTPJ 4CYCB 1ETYA 3S2HJ 2CU7A 3JR9A 4G12A 3S2DJ 2YUSA 3LNQA 1LE8B 5C3EJ 2LD5A 2R5YA 3S14J 4J19A 3IH2A 1JKRC 3S17J 3OIOA 1K61A 5C4JJ 1FTTA 5J3LA 1QVTA 1JJ8C 3G1LA 4BBRJ 1I6HJ 4RDUA 2YS9A 3WHBA 1MSFC 5HODA 4FISA 5EDNA 3TW6A 5F04A 3BR3A 3BQZA 5E3NA 4A69C 1GUUA 1B72A 4QIWN 1R9TJ 5EG0A 4BBSJ 3DCFA 1HF0A 4XRSG 1TWHJ 3BTCA 2NVXJ 3JRHA 4UUTA 1ZKGA 2Y9ZA 1RR7A 3BG9A 4A3IJ 4A93J 3HOVJ 4JX4A 2B63J 4D7MA 5F0HA 2I10A 4B3AA 3NARA 2HI3A 1TWAJ 3QPLA 1GV2A 2HXOA 4A3KJ 3BR0A 1ZTRA 2XGCA 4MIMA 2DA6A 3ZQFA 1ORKA 2EZKA 2FQ4A 2LP0A 2DJNA 3BTJA 3H3VK 2LK2A 1MBHA 2HOAA 2G0EA 1VF9A 3A01B 2VI6A 1JJ6C 2P81A 1AHDP 3ZQGA 1ITYA 2JK3A 1WI3A 1Q1VA 2EZIA 3RQIA 3GTQJ 3B6AA 5F1JA 1IDYA 5M3FJ 3CCYA 2O9LA 2DA5A 3HGYA 1RESA 4RBOA 1SFOJ 2JA7J 2DA1A 2VKEA 2Y2ZA 3G1MA 1H8AC 5IP7J 2XPVA 2K40A 1ZR4A 3LSPA 1DU0A 1GDTA 2GM4A 1JT0A 1ZK8A 4GFBA 3D1NI 4HNVA 2LLKA 2L9RA 5C4XJ 5K7FA 4XRSA 3I4MJ 2NVQJ 4D5FA 4V2GA 2HOSA 2TRTA 3K7AJ 3Q0WA 2NVYJ 2H1KA 3OOUA 3HM5A 4FE7A 2L7FP 1OJLA 1U8BA 4BXXJ 2WV1A 2JJ7A 2WAQN 2DMPA 4X1EA 4C3HJ 2FJ1A 3HOXJ 1CQTA 2HYJA 2M8GX 4A3EJ 4Y7NJ 2ID6A 4BKXA 2HXIA 2O7OA 1VNDA 3JREA 2ZB9A 4AUXA 5IYCJ 1WH7A 5F0CA 3GTOJ 2COBA 1ZQ3P 1LFUP 1AKHB 2L0KA 1UMQA 1F36A 2LTPA 4JYKA 5FKKA 3GTLJ 1MH3A 3BR2A 3RKQA 4A3CJ 1WPKA 3BQYA 1BW5A 1IUFA 1TWFJ 5J1RA 1IC8A 2JA8J 2OPTA 4W97A 2MW8A 1QPIA 2CUEA 3MVPA 5GP9A 2MSYA 9ANTA 5FLMJ 4XK4A 3SFIA 3S1MJ 1H88C 1OFCX 4M3EA 3Q0UA 2DMTA 1RPWA 2FD5A 4FE4A 3M4OJ 1XG1A 1A6IA 1Y1WJ 1BJZA 3S1NJ 2CUFA 3BG3A 3FK7A 3JRIA 1H89C 3RZDJ 5IOZA 3IH3A 2L7ZA 1MBEA 3B6CA 5EGOB 3Q3SA 3GTGJ 4MFEA 4QSHA 1X58A 3O8GA 4M3BA 1U9NA 3LSGA 4B1RA 2DA3A 2KDZA 2D5VA 5M5XJ 2WB1N 2R5YB 3HOWJ 2NVTJ 1MBFA 5JLXA 3G1OA 5M5YJ 5GPCA 1ETOA 2DMQA 1P7IA 3ZQLA 3UKGA 2XRLA 2QF7A 1X2NA 3QPSA 4JX6A 2E1OA 4IEJA 4A3JJ 1GVDA 5FKNA 4M6VA 1FJLA 2DMNA 1PUFA 1IDZA 1QRYA 3A03A 1MBKA 2FX0A 1JKQC 3HOZJ 1WCMJ 2EH3A 3OSFA 2O8KA 5IYDJ 3BTLA 2K9QA 1ETVA 3PO2J 1RETA 2EBIA 4DW6A 4D7NA 4DYCA 1MNMC 2L7MP 1A5JA 2DA2A 2HOTA 2MG4A 2Y9YA 4MO7A 3SJMA 4IHYA 2EQRA 5K7HA 3H0GJ 3HEFA 2JN6A 3LSRA 4X6AJ 2DA7A 5M3MJ 2M2EA 2Y0SN 5J1YA 1VFCA 5C44J 4BY7J
chains in the Genus database with same CATH superfamily
1D1CA 1MDMA 2LYCA 1W0TA 1EKEA 2MC4A 2PN6A 1IAWA 1D5YA 5FRNA 3MQ0A 1D1AA 3RSNA 4DZJA 1UB9A 1JTYA 3WTYC 5LD2C 5IT9Z 2A07F 4BS9A 3LA2A 4KIFA 2W84A 1ERDA 3TQNA 1LFPA 3ZMTA 4L9TA 4M9SA 3X2QH 5FKOA 3S1QJ 2LY9A 2CQKA 1V5GA 2E19A 3L7WA 4KITB 1FPQA 1ZR2A 3ROUA 4A3FJ 5EZGA 4BDZA 2XC7A 3HXLA 3MCZA 4C30A 4Y33A 1G3WA 4GDFA 3SZPA 1WH5A 3ZQ7A 2QQBA 3FX3A 3TEDA 1NK3P 3JRDA 4BE2A 2BY1A 1YQAA 2ICWG 1E17A 4G7OF 3I55I 1DP7P 3C2GA 4XKBA 1UHSA 1MW7A 1OCPA 3AAFA 3ZN0A 1K6OA 1SD4A 4ZYGA 3FF5A 1JHFA 2EB7A 3QPTA 3CO7C 1R4MB 2EZHA 3FXQA 1RKWA 4CCOA 5FFXA 1P6RA 4OMYA 2MYSA 3ZP5A 1PUFB 3BJ6A 4GGGA 5EEAA 1I3AA 1LPQA 1IGNA 3S3NA 1PYVA 2WAEA 3MWMA 1TNSA 2R93J 3GTMJ 3CUOA 2MH2A 2AXTC 1OQYA 5F6FA 4EEFG 4RGUA 1XN7A 3EYIA 2F48A 1RR8C 3SXYA 4NHJA 4F52A 3ZMSA 5JR3A 3M7GA 3TP0A 4E7SA 4F3QA 1WJBA 4WWCA 3VYTB 3TDUC 1LVAA 1RI7A 2ZBKA 3AG1H 2HDDA 5H2FC 3T8TA 1R7JA 3H36A 3PQKA 4ESBA 3RYRA 3HB9A 2EWNA 5FJ8J 2H27A 1IRZA 2E5ZA 4BEHB 1APLC 4U7BA 3BY6A 3IWFA 1H9TA 3DPUA 4MFDA 2GA1A 4OIOF 3WTTC 4UY8I 1I50J 3BG7A 4L5IA 3RKXA 1K78B 1BJAA 4AIDA 1H9GA 2CV1A 3QP5A 4BQNA 1MNDA 5KAIC 5HLGA 2E35A 1XDUA 4RB3C 3WTXC 1I1SA 1JUSA 3WG9A 1NG6A 1ZN2A 4BHBA 2CJJA 5K5OA 1MZBA 3GTJJ 2YPRA 3WE2A 2FBKA 2E36A 1HLVA 2NNYA 1YFHA 5HS8A 3CDLA 4IKFA 4G9YA 2O61A 4WXDA 4KIBA 1X3WB 3F0CA 2X1EA 3M3YJ 1I3QJ 1OCZH 3BR5A 5GAEJ 2RQPA 1QZEA 1VQ8I 5TISC 2OF7A 5EF6A 5CVVA 4CSWA 2HEOA 4IPAA 1CF7B 2DT6A 2IBDA 2ZSIB 2VKVA 3GXOA 5HLIA 4KISA 3EUHC 4YELA 3CCSI 1LFBA 1ZGWA 1OYYA 1X2MA 3FXKA 1HA8A 2M34A 3DWLE 1KU7A 2K9SA 1Y1VJ 1ZG5A 2F6CA 2P5KA 3CC4I 3DLLF 3U1KA 2I8DA 2MGQA 3ZPLA 1R1TA 4LLNA 3U1DA 5D6EA 2NYXA 2A6HF 2OJED 4EM2A 4Y15A 4YIRX 2HYFA 2LMDA 3ZXSA 1UZCA 2Q2EB 3KLNA 2DK5A 3RKWA 3BT9A 2PMZA 2ZMEA 3OYLA 4D1QA 1FLIA 1S7EA 1U9OA 4HOBA 2JMWA 5EG0B 1I6XA 3H5RA 3OYFA 2IGMA 2K4JA 2M9HA 2W25A 3OV8A 2OZ6A 1TL8A 4HF2A 3K4CA 4LMYA 3SDGA 1K83J 1S7OA 3A1YA 4OWRB 1FT9A 2XSJC 4BU2A 3M8FA 3QOEA 1VQLI 3E97A 3WTVC 4L0ZB 3JTHA 4C3IJ 5ERIA 1U6GA 1Z3XA 2HQRA 3C2BA 1RKTA 1VQKI 3NQOA 2LNBA 1W5SA 3G71I 5D8KB 4E7KA 4IOCF 4A3BJ 1YTYA 1V54H 3DFGA 3GYHX 2LR8A 2W4SA 2F2EA 3HSEA 4LK0F 3ABKH 1MDMB 3HGGA 1R1VA 2EFNA 1MJ9A 4M72A 1NTCA 5E1ZB 1JUPA 2VJ5A 1U3EM 5F27A 5D5UB 3F3XA 5LGTA 2EA4A 5FD5A 4NQWB 3E5XA 1ENHA 3FXJA 3JRBA 4M3DA 3A01A 3RQ4A 2E2JJ 3W2AA 5LEJA 1WSUA 4E7HA 1YW9A 3PM1A 2DOEA 5CVUA 3OS1A 5L3FA 4LG0A 3N97A 1J0RA 3CLOA 3NAUA 3GO5A 4Y17A 3S15J 2M0MA 4CZZA 1WGXA 4IHXA 3GTPJ 2IA2A 1TQPA 1V3FA 4RM2A 3JR9A 2CS3A 4G12A 3S2DJ 2YUSA 3TOBA 1LE8B 3KP7A 4Z6YA 4PCQA 2LD5A 1VQNI 1PP8F 1ULYA 4ZYEA 1FTTA 1QZZA 4PJ0C 2GA2A 4BBRJ 3JSOA 4RB1A 1XGOA 4HF0A 2A61A 3TW6A 5F04A 2YSRA 3BQZA 4S05A 3LAJA 3FXUA 3FBNB 4KJZA 3LFKA 3FMRA 4ZH4F 5EG0A 5E79C 1T38A 1CF7A 3S3MA 3DQVC 1LEAA 4PFOA 1AA7A 2LF7A 3PUBA 3BTCA 3PUFA 4BQOA 3JRHA 4A0ZA 1FY7A 3K2ZA 2M87A 3A0HC 4Q4ZF 2J5PA 1Y8QB 2OQRA 1RR7A 4N0BA 2VT3A 3BG9A 3HOVJ 4JX4A 5DCFA 4RMNA 4D7MA 5F0HA 4B3AA 2MH9A 2P8TA 3NARA 4PGHA 1B4AA 4P55A 2HXOA 4A3KJ 2VKHA 3BR0A 1ZTRA 2XGCA 2DA6A 4MIMA 2V1DA 2KRCA 1XGNA 2LP0A 4ZYDA 3CUQA 2JVGA 3TO6A 3VDXA 2V1UA 4BHPA 2WV0A 3CESA 2KFDA 5L3BA 1IF1A 2FBHA 2LK2A 4BACA 2RDPA 1VF9A 3BOQA 1W36D 3KPHA 3GWZA 4PFPA 2Z5UA 1AHDP 3I56I 1ITYA 5LFAA 4OAZA 2Z33A 2DBBA 3R0JA 3B6AA 3CD6I 3M1CA 4GCVA 3CCYA 5B5EC 4IRIA 1YIOA 4BAYA 2ZJ2A 4OIRF 2EV6A 2DA1A 4IO9F 4G7ZF 3G1MA 2ADUA 5H6RA 5IP7J 3H5AA 3HYIA 4GFBA 2FRHA 3VWBA 2FMLA 5C4XJ 4CUGA 5K1YA 4ENJA 1A6QA 1BM9A 4A5MA 1IXSB 3IC7A 5KCMA 2VXDA 2DYRH 3K7AJ 3REOA 4A0YA 3MAJA 4I01A 1FSEA 3LFUA 3OOUA 4HW0A 2BV6A 4XSXF 1U8BA 4UNOA 2UWMA 2HDWA 3HC7A 5J6XA 3KYLA 2XAJA 4NBQA 2DMPA 3ECOA 3MKYB 2IGKA 3F8MA 3QWLA 4DBRA 2HYJA 1PP7U 1YO5C 4A3EJ 4CO8A 2H6CA 2IT0A 1D8JA 3S3OA 1VNDA 4I09A 3I54A 4HEA2 4B44A 1WH7A 2FXAA 3PL8A 1X1CA 3CF5F 1CGPA 2COBA 5DD4A 2DT7B 1LFUP 3M9AA 4WK8F 1OYIA 2L0KA 3COAC 1EJ9A 4JYKA 4MQVA 1MH3A 3VYUB 3WTUC 2XASA 4KIGA 5IT3A 3PNVA 4PJNA 1SFXA 1BOBA 4YIIA 1IC8A 2FUG2 3OYJA 4FETA 2CV0A 1LJ9A 4I98B 3V7RA 1YIJI 2CUEA 2RNGA 3MVPA 2LBFB 3RI4A 2F4OB 4XK4A 3SFIA 4ESFA 2EINH 2ELJA 4ZDPA 1X1PA 4M3EA 2FD5A 1TP4A 2F5VA 3KFWX 2CV2A 4QPQA 4BNCA 4A5NA 5JHFA 4XBFA 2K27A 3FK7A 1KQ9A 2EA2A 2HU9A 3ZMUA 1VZ0A 2UXXA 3IH3A 1HBXG 1WJFA 5CLSA 4KYWA 3K1MA 5EGOB 3Q3SA 3W6KB 4DNCA 2PI0A 2E1MB 4QSHA 2WBMA 4M3BA 3GEZA 1U9NA 3LSGA 5KK1A 3E5UA 3FMSA 3I59B 4BJTA 4IOAF 4KICA 3HOWJ 1FOYA 1K4SA 1MMSA 1MBFA 3SYTA 4AM3A 3GCMA 3G3ZA 1IN8A 1MD0A 1LDDA 1VQPI 5L3EA 3LSKA 5D4RA 1XPXA 1DQUA 1XD7A 3C18A 2QF7A 3HSFA 4JX6A 4IEJA 1REPC 4KDPA 1GVDA 2L01A 1PUFA 3IWZA 2X6YA 1MBKA 1XX5A 1LDKB 2FX0A 3ABMH 3CUQC 3V8KA 2ZXHA 2M3AA 3TOAA 1HC8A 1WCMJ 2UUZA 1IV8A 2BW3B 2CWEA 4XKVA 1QU3A 1P4XA 1S9HA 2BXZA 4XMYA 1BIAA 3BZKA 1USTA 3SZTA 4B8XA 2DA2A 4DOZA 3GFJA 2R7VA 4MO7A 1NHAA 5HLHA 2GXAA 4N9HA 2DLLA 2XAUA 3JSPA 3H0GJ 1VQOI 1I39A 1NH3A 2M2EA 4Y13A 2EFQA 2RKHA 3P7NA 4M73A 1VFCA 4A6EA 1WJAA 4N9IA 1JT6A 1IW7F 5GAGJ 2VUMJ 3LWFA 3OIPA 1XS9A 1D0ZA 1R36A 5HDKA 3MFKA 1O3QA 4R1HA 1HDDC 1VQ5I 5H20A 1K4TA 1OCTC 3K70D 3ZOBA 5DM7F 1I5ZA 3A0BC 1ETQA 2M7AA 3GLXA 1O3SA 1BC7C 1YHQI 2ZJPF 1F43A 3S32A 3ZQHA 4UB8C 3OYNA 3RYPA 1TWCJ 4CCJA 1K78A 2HVQA 4PJJA 1A36A 2OV7A 2HQAA 5J1UA 1B8IA 3I3LA 3I5UA 3ZN1A 1XTAA 1ZREA 4HDUA 2VBYA 4V19K 4U88A 2RVCA 3ABTA 3DV8A 4HG2A 3PIOF 2QVOA 3VEPA 4EGYA 1O4XA 3NEUA 1KU9A 2H94A 4KNYA 3MZHA 1POGA 4CA0A 2V9KA 1OPCA 4UXNA 3F8FA 1XGSA 2CO5A 2LY2A 2GLOA 1FMWA 4XICA 2LH9A 5DUKA 3FKIJ 3GX4X 2STTA 2HFHA 1ZH5A 1S72I 3CJQB 2A5YB 5HNFA 5E3LA 5JVGF 1GT0C 4Y52J 1JTXA 2MD0A 4BDYA 1KYZA 4DIQA 3QQAA 1D0YA 4UVBA 1PDNC 5DCMA 3EYYA 1SVOA 2CMPA 4RAYA 2P5LC 1WJ5A 1IJWC 1Y39A 1MBGA 4RB2C 3RTRA 2EIJH 5K5QA 5HS7A 4XL9A 1S6LA 2MBFA 4ZTJA 5L3GA 1LB2A 2HYGD 3LA7A 1XC5A 1XMXA 4RAFA 1GV5A 2O0YA 4DYQA 4C2UA 5E3OA 3L2WA 4XLAA 5EEGA 1U78A 2BHYA 1QHGA 4A3GJ 2IVMA 2WAQA 4IL6C 3BZ6A 2R7UA 3BCAA 2UXNA 2WA0A 4HAMA 5HS9A 4ABZA 1RC9A 4MQ9F 3S1RJ 4P9UA 3LSIA 2UZKA 2AHQA 2HQNA 2Z2SB 4IRHA 3JAMK 2TCTA 5JHUA 5DEQA 1DP3A 2CSOA 1T6SA 4EJOA 3L1PA 1FBSA 2ME6A 2MFZA 1MH4A 4F92B 2IS1A 2M7BA 2E71A 1TWGJ 3O6BB 4PSXA 4FT8A 2X4HA 4E7ZA 4YFXF 3KETA 4BQQA 1P2FA 4XOTA 4AVPA 4N4OB 4Y3OA 4HSRA 5CVIA 4I2OA 2F5EA 1YRNB 5IPAA 1K79A 3TW7A 3VSKA 2FSWA 1BI2A 4A3MJ 2JT1A 3ASNH 1IN4A 2PMHA 2LKXA 4B48A 5GTHC 1W7PB 3UNGC 2OD5A 4UUSB 3DLAA 3D5RC 2XGEA 3Q9VA 3P9KA 2QYOA 4NNJA 3EDPA 3LSJA 1D0XA 2L54A 2KKOA 1F4KA 3C1DA 4HLXA 4KN4X 2NVUB 3J7AO 4IHSA 1ETKA 2EV5A 4XRMA 1JGGA 3HDDA 1J09A 3BC8A 3IHUA 5FGMA 2XB0X 2O5RA 3I59A 1QNTA 1IN5A 5AIQA 5GTIC 2V79A 3LMMA 4MHGA 3IV5A 3E6BA 1BR1A 2Y31A 3TDZC 1UCRA 3L2RA 3ZCOA 1OISA 2KHMA 3CLQA 2QWWA 3ONQA 2DYSH 4LK1F 4BE0A 2JSCA 3BPVA 3RJPA 4G6DA 2X48A 4E70A 1FSHA 1K6YA 5FO5A 3V8JA 3AG4H 4NC7A 1T0FA 1FTZA 2F5DA 1L3LA 4GXOA 3DEWA 1QO0D 1GXPA 1QVUA 1KZHA 5D5WB 3MN2A 2DI3A 1EV7A 2QZ8A 2XB5A 1WI9A 5EZHA 5LHGA 1D8KA 2QLZA 4IXAA 2ECBA 3FXLA 2GXGA 4NQWA 2GBYA 1R1UA 3CCQI 2OA4A 1DPRA 5B66C 3V7SA 2VPRA 2VOOA 2Y30A 4U7DA 3ELKA 1HCRA 3I0TA 5BQTA 1SMTA 1DUXC 2FBIA 4BJ5C 1VQ6I 3OSGA 1F1ZA 2R7QA 3RPUA 1T2KA 3OL3A 1FIAA 4FQGA 3ABLH 3BR6A 2JPCA 3DXJF 2L9NA 2QKMB 4XM3A 1W7PD 4WXHA 4I6ZA 3VYRB 2MLKA 5LLQA 2W57A 2X9DA 1SD7A 2EZLA 3WU0A 3QYBA 1ONVA 1U5TB 4LOCA 2VLAA 2V9PA 3BG5A 1TTYA 1E3OC 4LLGF 1R5GA 2ECCA 3DP7A 3DTKA 3BCBA 1R49A 2DOFA 2VC0A 1MKMA 2NOGA 5DDGA 3I71A 1FZPB 2R7SA 2E34A 5CPRB 4HSTA 4UHTA 2G7UA 3D5LA 3LNQA 2RNJA 4EJWA 2QBYA 4ON0A 3WTWC 4J19A 3IH2A 1JKRC 3S17J 1K61A 3S8PA 5C4JJ 5D5VB 2IS2A 5J47A 1QVTA 1MMDA 1I6HJ 2EV0A 4M6XA 3KEOA 3LQRA 4RDUA 2YS9A 1QZYA 2OAZA 3TBIA 2P0WA 4FISA 2Z16A 4DQ2A 3F8BA 3KYCB 2CG4A 4CDGA 1ON1A 5LRRA 3KIOA 3K9TA 4F93B 5CQEA 2VB6A 2W00A 1R9TJ 3PNTA 2P5VA 5E17F 4I0AA 2ESNA 4RB0A 5FD6A 4HNTA 1WJCA 2E7WA 1HF0A 3FMQA 2RC4A 2P6SA 4Q5SF 2NVXJ 3MD2A 3CJNA 1BBYA 3SEQA 2UV1A 2ZO4A 5F64A 3PIPF 1FYKA 4PDKA 2O6GE 3MKZA 1BOAA 3P9CA 1XCBA 4OOIA 3C2HA 1QHHD 1EH6A 3ZMDA 2OZUA 5AONA 1TW3A 5JI6A 1TWAJ 2D1VA 1ORKA 2OC6A 3K4NA 3OWTA 3T1BA 3GZNB 2DJNA 3BTJA 4L0YB 3OYGA 2KL4A 2L4AA 1ODDA 1YYVA 4UVAA 3H3VK 2V4JC 1N78A 4YFKF 3BLYA 1MBHA 1W1WE 3HRUA 4AIKA 1P9QC 1SFKA 3RPUD 3ISPA 4LJZF 2VI6A 1LKXA 2JK3A 4EM1A 4XR6A 1EA3A 5DM6F 4GYGA 5F1JA 4O6JA 4BE1A 5CKTA 4II2A 2O9LA 2Z99A 1D1BA 3HGYA 1HSJA 4RBOA 2VN2A 2Y2ZA 1H8AC 2X1DA 2YU3A 3SQNA 2DQRA 4LFUA 1ZR4A 1GDTA 1DU0A 3MMYB 2HZTA 4OIQF 1ZK8A 4JQFA 2R7RA 1BN5A 3D1NI 2XAQA 5J4VA 2LLKA 2QSGX 1UFMA 2X51A 1R58A 3CJTB 4KMUX 3G2BA 2W85A 4P5OA 3GLLA 3S2WA 2TRTA 2HOSA 4ZZLA 5J8CA 4IQJA 4B3XA 3KCCA 5IT9K 2PQ8A 2ZNYA 1MJBA 2NVYJ 2H1KA 1Z67A 1RRJA 4FE7A 4CYDA 2WY7Q 1Y0NA 1F9NA 2JJ7A 4E7JA 2XF7A 1FP2A 2ESHA 4X1EA 2IA0A 4C3HJ 4CGZA 1S29A 2LBFA 4R8HA 3J80K 3E6CC 4R79A 4Y7NJ 2WWYA 2FOWA 2ID6A 4PSWA 2V1XA 3J80Z 2HXIA 3BP8A 3IL2A 5L3CA 3JREA 2QA4I 2ZB9A 4AUXA 5IYCJ 4L9JA 2M1BA 2VODA 1AKHB 2B0LA 2K86A 4PK4A 1F36A 5HDNA 3H5NA 3SDBA 1Y0UA 3F72A 3L2QA 2O3FA 4E7LA 2F5CA 1TWFJ 5J1RA 2G7HA 2QSHX 3P5JA 2OPTA 1C0WA 2PJRB 1B6AA 1N75A 3PSFA 3HG9A 3BG6A 2HS5A 1UHWA 5F1RA 2HGCA 2L02A 4ETSA 1TBXA 1KA8A 4IVNA 4FE4A 3M4OJ 1XG1A 3CCRI 3PNYA 1A6IA 4RGXA 1VQ4I 1TLHB 2X6WA 2P4WA 2R4GA 1J9IA 2KLOA 2RREA 1QBJA 3VODA 3RZDJ 1K7AA 4OINF 1A04A 3AFHA 4KA4A 1W4MA 3DTEA 1S8NA 2LC2A 1WHUA 4MFEA 3FKJA 3K4KA 5H6QA 3OYKA 1ZG1A 1X58A 1X1AA 1XMAA 3FHNA 1YW8A 5M5XJ 2WB1N 4L9NA 3AL0B 1Z1DA 1E0EA 5JLXA 3PFYA 1Z21A 5M5YJ 2VE8A 3H9QA 1JI8A 4A2UA 4CHUA 2DMQA 3UKGA 2XRLA 1X2NA 3OIQA 2E1OA 4A3JJ 2ZKZA 3GZ5A 3TMOA 1KGSA 2QM3A 2EH3A 5LGUA 2MA3A 4RA2A 1OCCH 4EV0A 1HQCA 2K9QA 4BUPA 4XOPA 4HF1A 4HDVA 3K0LA 3PO2J 2HWVA 2JVHA 2EFWA 3SFZA 4ESJA 2DJIA 2GOXB 4DYCA 1MNMC 1QQIA 1VQMI 5KHDA 2Y9YA 2D1HA 5JFRA 3SJMA 2VIXA 2KDOA 3H3ZA 1WFXA 2E7XA 2JN6A 3LSRA 4X6AJ 1WVRA 2DA7A 3OR1C 2VJ4A 5M3MJ 5J1YA 4AIHA 4BY7J 1Y56A 2DQLA 1PJRA 1STZA 2CUJA 3ERED 2G9WA 1R4NB 5BNGA 1HKQA 3GUDA 1WKMA 1V5FA 3FXRA 3RDIA 2CW8A 5GADJ 4JP0A 5ILVA 2OTJI 4CCKA 1N25A 3HOYJ 2DXIA 2VJJA 2XF6A 2M45A 2WY8Q 2VC1A 2M8EA 4V2FA 5TGTA 4RS8A 1YJNI 3DBRB 1BR2A 3LAPA 3TKYA 2WB1A 1G3YA 5KAFC 2ISYA 4AYBN 5JVTA 2A5WA 4RGSA 1J5YA 2RAEA 4YIFA 1Z6RA 3PFIA 3IH4A 3HL2A 1G59A 1ZLKA 2XPUA 1ZARA 2QQAA 3GFIA 2EPFA 3WU1B 4CXFA 2RGVA 1UELB 4BJ6C 2I5UA 2E1NA 3LSTA 1IZ1A 5E8IA 1X4OA 3KZIC 5E3MA 2PJRA 3KZYA 1YRNA 3ZQIA 2DCEA 4PUSA 2DAOA 1HOMA 2JA6J 5D8LB 3EUAA 4ZDLA 1VQ9I 2EILH 4E6KG 2DFFA 3AG3H 3FXOA 3RCOA 4RAGA 5K7ZA 2VBXA 5EYRA 3E7LA 4YEJA 1WJDA 2R7OA 3WGHA 2OU2A 1ZRDA 2DO7A 1HXDA 3E0JB 1U0JA 3MKLA 1MMAA 3HRMA 1X3UA 2A6EF 1IG7A 3ML6A 4EATA 3CCJI 1X4PA 3GTKJ 4JX5A 3HUGA 2R7ZJ 3H9GA 2FF4A 4GYIA 3RKYA 3H35A 3R0AA 1I1GA 3L2UA 1IV6A 1R22A 1OYWA 4TV7A 3WU2C 2FE3A 4AC0A 3CMMA 4D9JA 4M6YA 4X0GA 4XKWA 2X6OA 3K1NA 4HA8A 2LRDA 3O2PE 2F4MB 2FQ3A 2YR2A 2DN0A 2PMZN 1ETXA 3E6MA 4IZZA 1BI0A 2VKDA 2MC3A 1LQ1A 3DEEA 1HKSA 2WADA 4XNFA 3J81Z 5DD8A 4CICA 3J81K 1MSEC 2Y0SA 2F4IA 4ZZDA 1TC3C 2PJPA 2CQ7A 4W1UA 3LA3A 1U5TA 1BA5A 4IRGA 3FISA 3G6EI 5ILUA 2GQQA 4EJTA 1J75A 5J40A 3ZGKA 4XLPF 3OYCA 3DKWA 1A31A 3F23A 3H0DA 4C3JJ 4IHVA 2M0CA 3E3VA 1JGSA 4Y4RA 2DA4A 1J7KA 5B1AH 4LG0B 4QPOA 2IEKA 4CCMA 4HNUA 3FWEA 5IYBJ 2LFBA 3ZRGA 3M8EA 2KMUA 3FDYA 1YJWI 4HX8A 1MGTA 3DKYA 2K9MA 4LIUA 3CDHA 3LOCA 3U21A 1LEBA 4IQ4A 4U0VA 2J5OA 2JUGA 3KYDB 5TRDA 2CQNA 2V7FA 2HKOA 3PO3J 4I02A 2IS4A 4XLHA 1D5VA 1I27A 2L2OA 2PX9A 2IRFG 3CJRB 2CQQA 4NUBA 5EEHA 3HIFA 2DPUA 2IJLA 3QRFF 2XRNA 3TGNA 5TJJA 2XPWA 3L00A 5EJCA 1M1EB 2XHKA 1X3ZB 4WCGA 2DODA 3HKZN 3S16J 5ED4A 4Q47A 1T08B 2LDUA 3IRRA 4RLFA 3ZR8X 1GLNA 1OKRA 4L5JA 3KP5A 1AKHA 2V26A 1NG7A 2XGDA 4UUSA 2GXBA 1YW7A 4QTRA 3SHFA 4IHWA 2DFIA 1P7JA 3V42A 1VTNC 1Q1HA 3HSRA 1XSVA 1XCVA 1BL0A 2YX4A 2DMUA 2IGOA 2XKOA 2MD5A 3BPXA 2XIGA 1FMVA 5IP9J 3DKXA 1Z7LA 3BR1A 1S3JA 3H3UA 1B9MA 3NWSA 4PGGA 1W36C 2EFOA 1JKOC 2IP2A 5HOOA 4I99C 2P6TA 3M1EA 5A2QK 4XN3A 2CQXA 3I53A 1FNNA 3FXMA 4MLOA 3HOTA 2R0QC 3JRCA 3CTAA 1BIBA 2KIQA 1T8IA 1YJ9I 1BC8C 1XDSA 3ECHA 4BEHA 2R3SA 2E2HJ 1EH8A 2VJIA 1Y6IA 1G8XA 2Y69H 3LL7A 2LVSA 2VQLA 2NS7A 1MMNA 2NS8A 2JA5J 2N8GA 1WZ2A 3U2RA 2H8RA 1ZGAA 3VB2A 2ID3A 1Z7UA 4EJUA 5D4SA 2XUBA 4KMFA 4HYEA 4XLEA 4CYCB 3AL0C 2CU7A 4RAZA 3CP2A 4H0EA 2E5NA 1KQ8A 2R5YA 3WE3A 3S14J 3HPHA 3OIOA 2JA2A 4D0PA 4ANJA 3KP3A 5J3LA 2LREA 1LUJB 1JJ8C 4HQEA 1YX3A 2NNNA 2WTEA 2LG4A 3GFMA 1JHHA 2K02A 5EDNA 4E7IA 3HHGA 4YRVA 4A69C 4ZDOA 4G6QA 2KZGA 2YX7A 4QIWN 2ELHA 1KYWA 2RN7A 1FYMA 3E6DA 3TO7A 1KQ0A 3I9V2 3C7JA 1SVMA 1U5TC 3L09A 4G6TB 4HX7A 4XRSG 1TWHJ 4EJVA 3E5QA 3NWTA 4UUTA 2HPIA 3CP8A 2HVRA 1ZKGA 2EK5A 5E20A 2O8XA 2Y9ZA 3DU5A 1BR4A 2B63J 2CYYA 3OS2A 3CCUI 3J7AY 4K2EA 2I10A 2NXNB 3K70C 3QPLA 1GV2A 3GFLA 4NB5A 4EGZA 1XGMA 1ZELA 2B7EA 3J7YJ 3ZQFA 2LF8A 2EZKA 3OYMA 3M07A 3WGGA 3MZYA 2BY0A 3CMEI 2FA5A 3ABUA 2QGUA 3CC7I 3EQLF 1OCRH 3K4MA 2HOAA 4JBAA 4EMSA 1X19A 5E8GA 3A01B 2Z1DA 2P7CB 2NAZA 3F6VA 2HOEA 5HLTA 4FASD 1ZHFA 2P81A 3ZQGA 5BMZA 1XSDA 2BVMA 4AWXB 2EZIA 2PFBA 3GTQJ 3K4BA 2QBYB 3ERMA 5ICGA 2QSFX 4BGDA 5M3FJ 4RGRA 2DA5A 1RESA 2JA7J 4PZJA 1B9NA 2VKEA 3U9GA 3OYIA 2XPVA 2K40A 4KN7X 2LY1A 3N05A 4B47A 1JT0A 2Y0MA 4ZYHA 2D45A 3CMAI 4HNVA 3OYEA 4U0YA 1W5TA 2L9RA 4KT5C 3I4MJ 3R61A 4AD9A 2NS0A 3V7CA 3FM3A 2PLYA 3LSHA 1G3SA 3QODA 2VQHA 3DPTA 2X1CA 5CVRA 4HBLA 5J4YA 2RV8A 3HM5A 4JK1X 2K9LA 2WV1A 1O3RA 2ZNZA 3OYBA 1SMYF 2WAQN 4G7HF 2KJBA 5B3SH 2B9SA 1OCOH 3KP6A 2FJ1A 3WODF 3I58A 1CQTA 2M8GX 1KU2A 2X85A 2O7OA 2L5QA 4N4NB 5BS6A 1YG2A 5F0CA 2KJCA 3ZMVA 2R7XA 1ZQ3P 3EETA 4IX7A 2LSOA 3DU6A 4IF4A 1UMQA 2LOOA 2LTPA 1J59A 4YFNF 2IPQX 2GIZA 3OOPA 2CH0A 2HTJA 3BR2A 3CO6C 3BQYA 3DPLC 1BW5A 1IUFA 1X1DA 2Q0OA 4A0XA 4CH7A 2A05A 2ZC2A 4WX9A 1MJAA 4P9FA 2MW8A 3I64A 4A12A 3EPZA 1B1BA 2DFEA 2XV4S 4GRIA 9ANTA 5FLMJ 3S1MJ 1H88C 1LNWA 1OFCX 2X6XA 3HTSB 3Q0UA 2DMTA 1RPWA 3SZGA 4HLYA 3G4SI 2HZDA 4XSZF 3F21A 2M4GA 2ZXJA 3FZVA 1BJZA 3WGIA 1G3TA 2CUFA 1BI1A 3CC2I 3JRIA 1H89C 4G8XA 4XLCA 1SD6A 1O3TA 5IOZA 3OYDA 4ZYAA 3CCMI 2QEXI 1YE9A 2DDBA 4KUMA 2Q8KA 3GTGJ 1RNLA 3KZZA 4CZCA 1ACIA 1SFEA 4ASNA 3O8GA 3OYHA 1Z3YA 1YS6A 2KDZA 2L7KA 3F8NA 2NVTJ 2KISA 1HW5A 2FEZA 2KIUA 1W7PA 2EIMH 3G1OA 3K10A 4XQFA 3IKVA 4II3A 4IHTA 1ON2A 2H1LA 4CCLA 3WTZA 5HNHA 5GPCA 1ETOA 1ZYRF 1PUEE 4I7HA 3ZQLA 1G4DA 4WXCA 2IA1A 3HOSA 1DPUA 4Q48A 3IKTA 2Y75A 1FBUA 3AG2H 3BDDA 1FJLA 5FKNA 1IDZA 1FOKA 5E1XA 1QRYA 1JKQC 2XROA 3DBHB 3OSFA 3DTIA 5IYDJ 1BI3A 1DDNA 5GAHJ 2R7DA 3BROA 2BYVE 4P96A 1JE8A 1IRFA 2HNHA 1XMKA 4DW6A 4A6DA 4D7NA 5FRMA 5CJ9A 1R5HA 1A5JA 1FBQA 3K4LA 4FX4A 1FYLA 4CCNA 1U8RA 4HX4A 2EJRA 4QLCU 1S7AA 3CDIA 3FHZA 4IHYA 4JOMA 2BEOA 3HJEA 2Y0SN 2ZMEB 2L4MA 3PSIA 2CUZA 2KT0A 3FIWA 4UUVA 3HHHA 1JUMA 2JRMA 2OBPA 2CRGA 2FOKA 2K9NA 4A3DJ 5GPAA 2BY2A 1T56A 1WWXA 2W82A 4O5VA 2DW4A 2WAFA 1IN7A 1XSXA 4LG3A 3TP3A 2VPLA 4M71A 2BHZA 3F9KA 4HZFA 2ZXIA 3VYSB 4BYYA 2IW5A 2PBIA 2ZCWA 2BY3A 3WG7H 2F5FA 5FFZA 2FNAA 2JPBA 1ETWA 1MBJA 1E2XA 1SAXA 2E60A 5B1BH 3I4NJ 3JRFA 5BPDA 3NRVA 1GXQA 3R60A 1HSTA 4OU0A 3K69A 4HQMA 1IXRC 1TZLA 3QAHA 4M3GA 3WTSC 1USSA 4M9XA 2JUCA 2QQ9A 2H8WA 2HTSA 4BHCA 2R7FA 4EVIA 4BQAA 1TW2A 3OYAA 2R92J 4FTHA 3CUQB 5DUIA 3LQQA 3L2VA 2IS6A 3QU3A 2PEXA 4DBQA 2A68F 1FIPA 2BE5F 3HTUA 3QYFA 3JRGA 2QUFA 2W24A 4C9YA 3A4CA 3FK6A 5IP6A 4EM0B 2BZTA 4BY1J 2R5ZB 1B72B 2QENA 1YX5A 4L9VA 3O8HA 1WQ2A 2M30A 3HRTA 1KU3A 2VQGA 3W3CA 3JRAA 2E1MC 4CYCA 1ZRCA 4Z2YA 4A3LJ 2BW3A 5FB2A 5LHIA 2QQ8A 2VBZA 2A6TA 3JW4A 3L9FA 5EGOA 3BWGA 1SAUA 2ETHA 2HR3A 2OCCH 1ZAOA 2DOAA 4XLNF 2BVLA 4MGRA 2BOLA 2JWTA 3HOUJ 3OY9A 3ASOH 3QU6A 4LB6B 1G2HA 1T33A 3LSMA 3MKWB 3O3KA 2XSDC 2OTLI 3GZ6A 2DPDA 4DYRA 5A2QZ 1AOYA 2GWRA 3RZOJ 3IAS2 2RQQA 2VONA 1T98A 3TO9A 5ICEA 4AIJA 2AQFA 3S93A 3CCLI 4HRIA 2DFHA 2MABA 2ZMEC 5ICFA 4F91B 2AO9A 1HDPA 5FLVA 4FCYA 2CFOA 2XVCA 3OS0A 3Q5FA 5F0FA 2P7VB 3WHCA 1SD5A 2WC2A 5FKMA 1FEXA 1V55H 3GBGA 3QOPA 1JKPC 2ZJQF 2OCEA 1SANA 4WF2A 1BW6A 4C2MJ 2VOPA 1GHCA 4DZPA 1OR7C 5LHHA 3B73A 4UVCA 1FP1D 3BZCA 1QPMA 4KFCA 3GVAA 1LE8A 5HDGA 2GOMA 1O57A 4ZC3A 4XONA 3H1CA 4D5CA 1UG2A 2K3PA 4XIDA 3TL4X 5ICCA 5J8FA 1EF4A 3EUHA 3G73A 2K7LA 5DS9A 1HKTA 2HDCA 4B4CA 4NC8A 1ZG3A 2OUMA 2AS5F 1TNTA 5DV5A 5DTDA 5F08A 1YI2I 1SEUA 3IAM2 3GW2A 2K5CA 2STWA 1OLTA 3H9JA 2IAIA 3T5XA 4UV9A 3ZQCA 4GO1A 1Z0XA 4S0HB 3QPHA 2CW0F 1R6RA 2E2IJ 3DEUA 3W2VA 2JSPA 1G6NA 4I76A 2AQEA 1W5CC 4FHTA 4DJAA 1MNEA 4BL0B 3P9IA 4M74A 2Q1ZB 2L9SA 4MEYF 2VXZA 1FX7A 1DGWY 5CVJA 3CCEI 1XB4A 1H0MA 1IO2A 1V4RA 4AU7A 2HPMA 4XLFA 2VE9A 3VFZA 4BH9A 1WJEA 3V4GA 1GVJA 1VI0A 2Q2EA 3M8JA 3W6VA 3BJOA 1PVEA 3FBIB 3HBLA 3KEYA 2R5ZA 4J00A 1NK2P 1RZ4A 2HKXA 2HVSA 2DTRA 1B59A 2DTZA 2JTVA 4U0WA 2VQCA 5BOXA 2YU9J 1RUOA 1E3PA 2DU9A 3CQZJ 4M3FA 3K2AA 3B02A 3CMYA 2BXYA 2TDXA 2OQGA 3CCVI 3OL4A 4HV6A 1Z77A 5IOYA 5M5WJ 1AU7A 2BGCA 4XKCA 1W0UA 1DU6A 1IUYA 2KIMA 2HQ5A 2PG4A 3HUGB 4BXFA 2XDVA 3MZ8A 5LBQA 2V1NA 2XKPA 3A02A 1B8IB 3BTIA 1Z05A 3RIRA 2W48A 2ELKA 2ME0A 5FKLA 6PAXA 1HW2A 4L5EA 2O03A 4NDLA 2QCOA 3Q0VA 5ILSA 1WRJA 5AIPA 3SEZA 2V6EA 2H6BA 3K4JA 2V9VA 3IUOA 2R7WA 3BJAA 4EQQA 3ESWB 2FU4A 2CGPA 1S5LC 2EIKH 3VPRA 2K3FA 4NC6A 5JLWA 5LEKA 1ETYA 4OAYA 1O7FA 2DDAA 3S2HJ 1P4AA 4OMZA 5IY5H 3EUKL 3OMYA 1UG0A 2KRHA 2MLGA 4IJAA 5C3EJ 2A3SA 2GZWA 5D6FA 1R71A 3QYEA 2D2WA 3KP4A 3G1LA 1D3YA 3WHBA 3IP4B 4LLLA 2K85A 1MSFC 5HODA 2EFPA 5D5XB 1F5TA 1HW1A 3D5SC 3BR3A 5E3NA 1B72A 1GUUA 4LGWA 1L0OC 3GF2A 4BBSJ 4L18B 2KRFA 3C3WA 3DCFA 2KZVA 5LRSA 1KONA 3R6SA 3VSLA 5E18F 1V5EA 2VBWA 2R7TA 2KP6A 3F8CA 3H92A 2H09A 1OR7A 4RM3A 3CZ6A 4A3IJ 2L3DA 2VASA 1SFUA 4A93J 4UV8A 3K1PA 4ENMA 3N4MA 5L3DA 3ZQQA 1Y8RB 4U87A 1MIJA 2HI3A 1R5ID 2XAFA 2AXLA 5K5RA 1RUNA 2GAUA 1DGRM 2FQ4A 4KT6A 3HZJA 3E1SA 4XORA 1UHMA 2LKPA 1R23A 4H4KC 1IRGA 4ZJZA 2C6YA 3T0YA 2V6CA 2G0EA 2DT5A 1UJ8A 1JJ6C 3RPQA 1YS7A 4UB6C 1WI3A 1Q1VA 3JAMZ 4ZTFA 1IXCA 4DGWB 3RQIA 4S04A 2ZJRF 1IDYA 4FX0A 1E3HA 1LDJA 2PMUA 4P1WA 2XF5A 3ULQB 1SFOJ 2XAHA 2LKSA 3W6JB 3LSPA 3KX2A 2GM4A 4MTDA 5HVQC 4F55A 2CFXA 3I4PA 5K7FA 3F6OA 1FC3A 4AYBA 4XRSA 2KPMA 2NVQJ 4YG2F 4D5FA 4V2GA 5KVRA 1ZGJA 2K4BA 3KE2A 1ZLJA 3Q0WA 4LITA 4OIPF 3D0SA 4HV5A 1IN6A 3V8LA 2L7FP 1OJLA 4BXXJ 2L9VA 1J2XA 2NOJB 3DF8A 1YLFA 5FLXZ 4E4HA 5FLXK 1X1BA 3HOXJ 3OR2C 5DCMB 4BKXA 2VL8A 3W2WA 3F22A 3UR3C 4O3MA 4B43A 4QWQA 3PQJA 2GIVA 2JQ7A 3GTOJ 2FNPA 2E1CA 1VQ7I 4I0BA 2DK8A 4HPQA 5CYVA 5CQGA 3L2CA 5FKKA 3A2KA 1R00A 3CF2A 3GTLJ 3T8RA 1LVKA 3HKZA 1O7LA 2Y48A 3RKQA 4A3CJ 1WPKA 1P92A 2IXSA 4ENKA 3R4KA 4F7ZA 1ZRFA 2JA8J 2X0LA 4W97A 3QP6A 3IRQA 1QPIA 2ZFWA 2MSYA 5GP9A 3GMEA 1UAAA 5BPIA 2KIFA 3HRSA 1SVLA 2XGXA 4MTEA 2ISZA 4ENNA 1Z9CA 2BBYA 4RLQA 2A69F 5FROA 4G94A 1Z91A 1JXSA 3J7ZI 2NRAC 1FOWA 4PJMA 1Y1WJ 1YITI 2COMA 3S1NJ 1N77A 1AWCA 3BG3A 1SC7A 4C2TA 2M4KA 2L7ZA 1MBEA 1QA6A 3B6CA 4XRFA 5DYMA 3Q9SA 2KQRA 1MMGA 4B1RA 4LB5A 2QKLB 2DA3A 2Z9OA 1YOVB 5LGNA 2D5VA 3JCUC 2ACJA 2R5YB 2M5WA 5E1WA 3KP2A 1Z6TA 1FOXA 4B09A 1P7IA 2JRTA 1TT0A 5KNLA 3MEXA 4M9ZA 3QPSA 1RIOH 3ZMZA 1T95A 1EH7A 4M6VA 2DMNA 4MEXF 1FWZA 3A03A 1U2WA 3DBLB 1QGPA 4PJLA 3VOEA 3HOZJ 2O8KA 1TT5B 3AKZA 4LD5A 2W7NA 3PJRA 3BTLA 2XAGA 3K6GA 2CW7A 4LIVA 1T39A 1P4WA 1ETVA 1T0FC 3JTGA 1RETA 2EBIA 4J01A 4XN0A 2JZYA 3HPGA 2L7MP 1OMIA 1TQMA 2HOTA 3FM5A 2W1OA 2IGNA 2MG4A 2ZXWH 2ZFUA 4AVZA 2EQRA 1TQIA 3KEQA 4MNUA 3HEFA 2FMYA 3KLOA 4BXUA 5K7HA 2ZSHB 1IRXA 1A35A 2VT2A 4ITVA 5C44J 2Z3YA
chains in the Genus database with same CATH topology
2KT0A 3FIWA 1JUMA 1JT6A 2CRGA 1W0TA 2VUMJ 2K9NA 1D5YA 5GPAA 1XS9A 4A3DJ 1T56A 5BNGA 1HDDC 4DZJA 3TP3A 1OCTC 4JP0A 3ZOBA 1JTYA 1ETQA 3HOYJ 4V2FA 1F43A 3ZQHA 1TWCJ 5FKOA 3S1QJ 2LY9A 2E19A 4AYBN 1ETWA 1MBJA 2RAEA 1ZR2A 5J1UA 3IH4A 4A3FJ 5EZGA 3I4NJ 2XPUA 1B8IA 3JRFA 4M3GA 2R92J 1WH5A 4FTHA 5E3MA 3TEDA 1NK3P 1YRNA 3JRDA 3ZQIA 1O4XA 1HOMA 2JA6J 1POGA 3JRGA 1FIPA 1UHSA 1OCPA 5IP6A 3FK6A 2GLOA 4BY1J 5K7ZA 2R5ZB 4XICA 2EZHA 1B72B 5EYRA 1RKWA 3FKIJ 3O8HA 3E7LA 3JRAA 5E3LA 1GT0C 4CYCA 4Y52J 1JTXA 1PUFB 4A3LJ 3MKLA 5EEAA 3QQAA 1IG7A 1IGNA 5EGOA 3GTMJ 2R93J 1IJWC 4EEFG 3GTKJ 1MBGA 4JX5A 2R7ZJ 2JWTA 3HOUJ 3TP0A 1G2HA 1T33A 1IV6A 1XC5A 2HDDA 1GV5A 4DYQA 4AC0A 5E3OA 2XSDC 1U78A 4DYRA 5FJ8J 3HB9A 4A3GJ 3RZOJ 1APLC 1IRZA 2X6OA 4ABZA 2DN0A 4MFDA 1I50J 2PMZN 3S1RJ 1ETXA 2AO9A 1HDPA 5FLVA 4FCYA 5F0FA 3WHCA 2AHQA 5FKMA 1FEXA 2TCTA 3GBGA 1JKPC 3L1PA 2ME6A 1SANA 1MH4A 1JUSA 1BW6A 4C2MJ 1MSEC 2CJJA 1TWGJ 4DZPA 3GTJJ 1HLVA 1LE8A 1TC3C 4W1UA 1BA5A 3CDLA 4D5CA 3FISA 1YRNB 5IPAA 1UG2A 3TW7A 3F0CA 4XIDA 4A3MJ 1EF4A 3M3YJ 1I3QJ 2LKXA 3BR5A 5DS9A 4B4CA 4UUSB 2OF7A 2XGEA 4C3JJ 5EF6A 4IHVA 2M0CA 2IBDA 3LSJA 2DA4A 2VKVA 5DTDA 2IEKA 5F08A 5IYBJ 1LFBA 2LFBA 1ETKA 1ZGWA 1X2MA 4XRMA 1JGGA 2M34A 3HDDA 2IAIA 2K9SA 1Y1VJ 2XB0X 3LOCA 3ZQCA 1Z0XA 3IV5A 4S0HB 2Y31A 2MGQA 2E2IJ 4I76A 3PO3J 2X48A 2CQQA 3BT9A 1S7EA 1U9OA 2JMWA 1FTZA 5EG0B 2XPWA 1VI0A 3DEWA 1QVUA 2M9HA 3HKZN 3MN2A 3S16J 3W6VA 2XB5A 3HBLA 3SDGA 2R5ZA 5EZHA 1NK2P 1K83J 2DTZA 2ECBA 2YU9J 3CQZJ 4M3FA 2GBYA 3K2AA 1AKHA 3CMYA 2VPRA 1Z77A 2XGDA 4UUSA 2Y30A 4C3IJ 5IOYA 1HCRA 5M5WJ 4QTRA 1AU7A 4IHWA 1W0UA 3C2BA 1P7JA 1RKTA 1DU6A 2HQ5A 1BL0A 2DMUA 3OSGA 4A3BJ 1FIAA 2LR8A 5IP9J 3BR6A 3HGGA 3BR1A 3A02A 1JKOC 1NTCA 1JUPA 3BTIA 1B8IB 2CQXA 2W48A 2ELKA 2ME0A 4I6ZA 5FKLA 4MLOA 2R0QC 5F27A 3JRCA 4L5EA 2X9DA 2EZLA 4NDLA 2QCOA 4LOCA 1ENHA 3Q0VA 3JRBA 2E2HJ 3BG5A 1E3OC 4M3DA 3A01A 2ECCA 2E2JJ 2LVSA 3PM1A 2NS7A 2NS8A 2JA5J 2N8GA 2H8RA 3NAUA 2NOGA 3VPRA 2ID3A 5JLWA 3S15J 1WGXA 4IHXA 3GTPJ 4CYCB 1ETYA 3S2HJ 2CU7A 3JR9A 4G12A 3S2DJ 2YUSA 3LNQA 1LE8B 5C3EJ 2LD5A 2R5YA 3S14J 4J19A 3IH2A 1JKRC 3S17J 3OIOA 1K61A 5C4JJ 1FTTA 5J3LA 1QVTA 1JJ8C 3G1LA 4BBRJ 1I6HJ 4RDUA 2YS9A 3WHBA 1MSFC 5HODA 4FISA 5EDNA 3TW6A 5F04A 3BR3A 3BQZA 5E3NA 4A69C 1GUUA 1B72A 4QIWN 1R9TJ 5EG0A 4BBSJ 3DCFA 1HF0A 4XRSG 1TWHJ 3BTCA 2NVXJ 3JRHA 4UUTA 1ZKGA 2Y9ZA 1RR7A 3BG9A 4A3IJ 4A93J 3HOVJ 4JX4A 2B63J 4D7MA 5F0HA 2I10A 4B3AA 3NARA 2HI3A 1TWAJ 3QPLA 1GV2A 2HXOA 4A3KJ 3BR0A 1ZTRA 2XGCA 4MIMA 2DA6A 3ZQFA 1ORKA 2EZKA 2FQ4A 2LP0A 2DJNA 3BTJA 3H3VK 2LK2A 1MBHA 2HOAA 2G0EA 1VF9A 3A01B 2VI6A 1JJ6C 2P81A 1AHDP 3ZQGA 1ITYA 2JK3A 1WI3A 1Q1VA 2EZIA 3RQIA 3GTQJ 3B6AA 5F1JA 1IDYA 5M3FJ 3CCYA 2O9LA 2DA5A 3HGYA 1RESA 4RBOA 1SFOJ 2JA7J 2DA1A 2VKEA 2Y2ZA 3G1MA 1H8AC 5IP7J 2XPVA 2K40A 1ZR4A 3LSPA 1DU0A 1GDTA 2GM4A 1JT0A 1ZK8A 4GFBA 3D1NI 4HNVA 2LLKA 2L9RA 5C4XJ 5K7FA 4XRSA 3I4MJ 2NVQJ 4D5FA 4V2GA 2HOSA 2TRTA 3K7AJ 3Q0WA 2NVYJ 2H1KA 3OOUA 3HM5A 4FE7A 2L7FP 1OJLA 1U8BA 4BXXJ 2WV1A 2JJ7A 2WAQN 2DMPA 4X1EA 4C3HJ 2FJ1A 3HOXJ 1CQTA 2HYJA 2M8GX 4A3EJ 4Y7NJ 2ID6A 4BKXA 2HXIA 2O7OA 1VNDA 3JREA 2ZB9A 4AUXA 5IYCJ 1WH7A 5F0CA 3GTOJ 2COBA 1ZQ3P 1LFUP 1AKHB 2L0KA 1UMQA 1F36A 2LTPA 4JYKA 5FKKA 3GTLJ 1MH3A 3BR2A 3RKQA 4A3CJ 1WPKA 3BQYA 1BW5A 1IUFA 1TWFJ 5J1RA 1IC8A 2JA8J 2OPTA 4W97A 2MW8A 1QPIA 2CUEA 3MVPA 5GP9A 2MSYA 9ANTA 5FLMJ 4XK4A 3SFIA 3S1MJ 1H88C 1OFCX 4M3EA 3Q0UA 2DMTA 1RPWA 2FD5A 4FE4A 3M4OJ 1XG1A 1A6IA 1Y1WJ 1BJZA 3S1NJ 2CUFA 3BG3A 3FK7A 3JRIA 1H89C 3RZDJ 5IOZA 3IH3A 2L7ZA 1MBEA 3B6CA 5EGOB 3Q3SA 3GTGJ 4MFEA 4QSHA 1X58A 3O8GA 4M3BA 1U9NA 3LSGA 4B1RA 2DA3A 2KDZA 2D5VA 5M5XJ 2WB1N 2R5YB 3HOWJ 2NVTJ 1MBFA 5JLXA 3G1OA 5M5YJ 5GPCA 1ETOA 2DMQA 1P7IA 3ZQLA 3UKGA 2XRLA 2QF7A 1X2NA 3QPSA 4JX6A 2E1OA 4IEJA 4A3JJ 1GVDA 5FKNA 4M6VA 1FJLA 2DMNA 1PUFA 1IDZA 1QRYA 3A03A 1MBKA 2FX0A 1JKQC 3HOZJ 1WCMJ 2EH3A 3OSFA 2O8KA 5IYDJ 3BTLA 2K9QA 1ETVA 3PO2J 1RETA 2EBIA 4DW6A 4D7NA 4DYCA 1MNMC 2L7MP 1A5JA 2DA2A 2HOTA 2MG4A 2Y9YA 4MO7A 3SJMA 4IHYA 2EQRA 5K7HA 3H0GJ 3HEFA 2JN6A 3LSRA 4X6AJ 2DA7A 5M3MJ 2M2EA 2Y0SN 5J1YA 1VFCA 5C44J 4BY7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT0 A;  3FIW A;  1JUM A;  1JT6 A;  2CRG A;  1W0T A;  2VUM J;  2K9N A;  1D5Y A;  5GPA A;  1XS9 A;  4A3D J;  1T56 A;  5BNG A;  1HDD C;  4DZJ A;  3TP3 A;  1OCT C;  4JP0 A;  3ZOB A;  1JTY A;  1ETQ A;  3HOY J;  4V2F A;  1F43 A;  3ZQH A;  1TWC J;  5FKO A;  3S1Q J;  2LY9 A;  2E19 A;  4AYB N;  1ETW A;  1MBJ A;  2RAE A;  1ZR2 A;  5J1U A;  3IH4 A;  4A3F J;  5EZG A;  3I4N J;  2XPU A;  1B8I A;  3JRF A;  4M3G A;  2R92 J;  1WH5 A;  4FTH A;  5E3M A;  3TED A;  1NK3 P;  1YRN A;  3JRD A;  3ZQI A;  1O4X A;  1HOM A;  2JA6 J;  1POG A;  3JRG A;  1FIP A;  1UHS A;  1OCP A;  5IP6 A;  3FK6 A;  2GLO A;  4BY1 J;  5K7Z A;  2R5Z B;  4XIC A;  2EZH A;  1B72 B;  5EYR A;  1RKW A;  3FKI J;  3O8H A;  3E7L A;  3JRA A;  5E3L A;  1GT0 C;  4CYC A;  4Y52 J;  1JTX A;  1PUF B;  4A3L J;  3MKL A;  5EEA A;  3QQA A;  1IG7 A;  1IGN A;  5EGO A;  3GTM J;  2R93 J;  1IJW C;  4EEF G;  3GTK J;  1MBG A;  4JX5 A;  2R7Z J;  2JWT A;  3HOU J;  3TP0 A;  1G2H A;  1T33 A;  1IV6 A;  1XC5 A;  2HDD A;  1GV5 A;  4DYQ A;  4AC0 A;  5E3O A;  2XSD C;  1U78 A;  4DYR A;  5FJ8 J;  3HB9 A;  4A3G J;  3RZO J;  1APL C;  1IRZ A;  2X6O A;  4ABZ A;  2DN0 A;  4MFD A;  1I50 J;  2PMZ N;  3S1R J;  1ETX A;  2AO9 A;  1HDP A;  5FLV A;  4FCY A;  5F0F A;  3WHC A;  2AHQ A;  5FKM A;  1FEX A;  2TCT A;  3GBG A;  1JKP C;  3L1P A;  2ME6 A;  1SAN A;  1MH4 A;  1JUS A;  1BW6 A;  4C2M J;  1MSE C;  2CJJ A;  1TWG J;  4DZP A;  3GTJ J;  1HLV A;  1LE8 A;  1TC3 C;  4W1U A;  1BA5 A;  3CDL A;  4D5C A;  3FIS A;  1YRN B;  5IPA A;  1UG2 A;  3TW7 A;  3F0C A;  4XID A;  4A3M J;  1EF4 A;  3M3Y J;  1I3Q J;  2LKX A;  3BR5 A;  5DS9 A;  4B4C A;  4UUS B;  2OF7 A;  2XGE A;  4C3J J;  5EF6 A;  4IHV A;  2M0C A;  2IBD A;  3LSJ A;  2DA4 A;  2VKV A;  5DTD A;  2IEK A;  5F08 A;  5IYB J;  1LFB A;  2LFB A;  1ETK A;  1ZGW A;  1X2M A;  4XRM A;  1JGG A;  2M34 A;  3HDD A;  2IAI A;  2K9S A;  1Y1V J;  2XB0 X;  3LOC A;  3ZQC A;  1Z0X A;  3IV5 A;  4S0H B;  2Y31 A;  2MGQ A;  2E2I J;  4I76 A;  3PO3 J;  2X48 A;  2CQQ A;  3BT9 A;  1S7E A;  1U9O A;  2JMW A;  1FTZ A;  5EG0 B;  2XPW A;  1VI0 A;  3DEW A;  1QVU A;  2M9H A;  3HKZ N;  3MN2 A;  3S16 J;  3W6V A;  2XB5 A;  3HBL A;  3SDG A;  2R5Z A;  5EZH A;  1NK2 P;  1K83 J;  2DTZ A;  2ECB A;  2YU9 J;  3CQZ J;  4M3F A;  2GBY A;  3K2A A;  1AKH A;  3CMY A;  2VPR A;  1Z77 A;  2XGD A;  4UUS A;  2Y30 A;  4C3I J;  5IOY A;  1HCR A;  5M5W J;  4QTR A;  1AU7 A;  4IHW A;  1W0U A;  3C2B A;  1P7J A;  1RKT A;  1DU6 A;  2HQ5 A;  1BL0 A;  2DMU A;  3OSG A;  4A3B J;  1FIA A;  2LR8 A;  5IP9 J;  3BR6 A;  3HGG A;  3BR1 A;  3A02 A;  1JKO C;  1NTC A;  1JUP A;  3BTI A;  1B8I B;  2CQX A;  2W48 A;  2ELK A;  2ME0 A;  4I6Z A;  5FKL A;  4MLO A;  2R0Q C;  5F27 A;  3JRC A;  4L5E A;  2X9D A;  2EZL A;  4NDL A;  2QCO A;  4LOC A;  1ENH A;  3Q0V A;  3JRB A;  2E2H J;  3BG5 A;  1E3O C;  4M3D A;  3A01 A;  2ECC A;  2E2J J;  2LVS A;  3PM1 A;  2NS7 A;  2NS8 A;  2JA5 J;  2N8G A;  2H8R A;  3NAU A;  2NOG A;  3VPR A;  2ID3 A;  5JLW A;  3S15 J;  1WGX A;  4IHX A;  3GTP J;  4CYC B;  1ETY A;  3S2H J;  2CU7 A;  3JR9 A;  4G12 A;  3S2D J;  2YUS A;  3LNQ A;  1LE8 B;  5C3E J;  2LD5 A;  2R5Y A;  3S14 J;  4J19 A;  3IH2 A;  1JKR C;  3S17 J;  3OIO A;  1K61 A;  5C4J J;  1FTT A;  5J3L A;  1QVT A;  1JJ8 C;  3G1L A;  4BBR J;  1I6H J;  4RDU A;  2YS9 A;  3WHB A;  1MSF C;  5HOD A;  4FIS A;  5EDN A;  3TW6 A;  5F04 A;  3BR3 A;  3BQZ A;  5E3N A;  4A69 C;  1GUU A;  1B72 A;  4QIW N;  1R9T J;  5EG0 A;  4BBS J;  3DCF A;  1HF0 A;  4XRS G;  1TWH J;  3BTC A;  2NVX J;  3JRH A;  4UUT A;  1ZKG A;  2Y9Z A;  1RR7 A;  3BG9 A;  4A3I J;  4A93 J;  3HOV J;  4JX4 A;  2B63 J;  4D7M A;  5F0H A;  2I10 A;  4B3A A;  3NAR A;  2HI3 A;  1TWA J;  3QPL A;  1GV2 A;  2HXO A;  4A3K J;  3BR0 A;  1ZTR A;  2XGC A;  4MIM A;  2DA6 A;  3ZQF A;  1ORK A;  2EZK A;  2FQ4 A;  2LP0 A;  2DJN A;  3BTJ A;  3H3V K;  2LK2 A;  1MBH A;  2HOA A;  2G0E A;  1VF9 A;  3A01 B;  2VI6 A;  1JJ6 C;  2P81 A;  1AHD P;  3ZQG A;  1ITY A;  2JK3 A;  1WI3 A;  1Q1V A;  2EZI A;  3RQI A;  3GTQ J;  3B6A A;  5F1J A;  1IDY A;  5M3F J;  3CCY A;  2O9L A;  2DA5 A;  3HGY A;  1RES A;  4RBO A;  1SFO J;  2JA7 J;  2DA1 A;  2VKE A;  2Y2Z A;  3G1M A;  1H8A C;  5IP7 J;  2XPV A;  2K40 A;  1ZR4 A;  3LSP A;  1DU0 A;  1GDT A;  2GM4 A;  1JT0 A;  1ZK8 A;  4GFB A;  3D1N I;  4HNV A;  2LLK A;  2L9R A;  5C4X J;  5K7F A;  4XRS A;  3I4M J;  2NVQ J;  4D5F A;  4V2G A;  2HOS A;  2TRT A;  3K7A J;  3Q0W A;  2NVY J;  2H1K A;  3OOU A;  3HM5 A;  4FE7 A;  2L7F P;  1OJL A;  1U8B A;  4BXX J;  2WV1 A;  2JJ7 A;  2WAQ N;  2DMP A;  4X1E A;  4C3H J;  2FJ1 A;  3HOX J;  1CQT A;  2HYJ A;  2M8G X;  4A3E J;  4Y7N J;  2ID6 A;  4BKX A;  2HXI A;  2O7O A;  1VND A;  3JRE A;  2ZB9 A;  4AUX A;  5IYC J;  1WH7 A;  5F0C A;  3GTO J;  2COB A;  1ZQ3 P;  1LFU P;  1AKH B;  2L0K A;  1UMQ A;  1F36 A;  2LTP A;  4JYK A;  5FKK A;  3GTL J;  1MH3 A;  3BR2 A;  3RKQ A;  4A3C J;  1WPK A;  3BQY A;  1BW5 A;  1IUF A;  1TWF J;  5J1R A;  1IC8 A;  2JA8 J;  2OPT A;  4W97 A;  2MW8 A;  1QPI A;  2CUE A;  3MVP A;  5GP9 A;  2MSY A;  9ANT A;  5FLM J;  4XK4 A;  3SFI A;  3S1M J;  1H88 C;  1OFC X;  4M3E A;  3Q0U A;  2DMT A;  1RPW A;  2FD5 A;  4FE4 A;  3M4O J;  1XG1 A;  1A6I A;  1Y1W J;  1BJZ A;  3S1N J;  2CUF A;  3BG3 A;  3FK7 A;  3JRI A;  1H89 C;  3RZD J;  5IOZ A;  3IH3 A;  2L7Z A;  1MBE A;  3B6C A;  5EGO B;  3Q3S A;  3GTG J;  4MFE A;  4QSH A;  1X58 A;  3O8G A;  4M3B A;  1U9N A;  3LSG A;  4B1R A;  2DA3 A;  2KDZ A;  2D5V A;  5M5X J;  2WB1 N;  2R5Y B;  3HOW J;  2NVT J;  1MBF A;  5JLX A;  3G1O A;  5M5Y J;  5GPC A;  1ETO A;  2DMQ A;  1P7I A;  3ZQL A;  3UKG A;  2XRL A;  2QF7 A;  1X2N A;  3QPS A;  4JX6 A;  2E1O A;  4IEJ A;  4A3J J;  1GVD A;  5FKN A;  4M6V A;  1FJL A;  2DMN A;  1PUF A;  1IDZ A;  1QRY A;  3A03 A;  1MBK A;  2FX0 A;  1JKQ C;  3HOZ J;  1WCM J;  2EH3 A;  3OSF A;  2O8K A;  5IYD J;  3BTL A;  2K9Q A;  1ETV A;  3PO2 J;  1RET A;  2EBI A;  4DW6 A;  4D7N A;  4DYC A;  1MNM C;  2L7M P;  1A5J A;  2DA2 A;  2HOT A;  2MG4 A;  2Y9Y A;  4MO7 A;  3SJM A;  4IHY A;  2EQR A;  5K7H A;  3H0G J;  3HEF A;  2JN6 A;  3LSR A;  4X6A J;  2DA7 A;  5M3M J;  2M2E A;  2Y0S N;  5J1Y A;  1VFC A;  5C44 J;  4BY7 J; 
#chains in the Genus database with same CATH topology
 1D1C A;  1MDM A;  2LYC A;  1W0T A;  1EKE A;  2MC4 A;  2PN6 A;  1IAW A;  1D5Y A;  5FRN A;  3MQ0 A;  1D1A A;  3RSN A;  4DZJ A;  1UB9 A;  1JTY A;  3WTY C;  5LD2 C;  5IT9 Z;  2A07 F;  4BS9 A;  3LA2 A;  4KIF A;  2W84 A;  1ERD A;  3TQN A;  1LFP A;  3ZMT A;  4L9T A;  4M9S A;  3X2Q H;  5FKO A;  3S1Q J;  2LY9 A;  2CQK A;  1V5G A;  2E19 A;  3L7W A;  4KIT B;  1FPQ A;  1ZR2 A;  3ROU A;  4A3F J;  5EZG A;  4BDZ A;  2XC7 A;  3HXL A;  3MCZ A;  4C30 A;  4Y33 A;  1G3W A;  4GDF A;  3SZP A;  1WH5 A;  3ZQ7 A;  2QQB A;  3FX3 A;  3TED A;  1NK3 P;  3JRD A;  4BE2 A;  2BY1 A;  1YQA A;  2ICW G;  1E17 A;  4G7O F;  3I55 I;  1DP7 P;  3C2G A;  4XKB A;  1UHS A;  1MW7 A;  1OCP A;  3AAF A;  3ZN0 A;  1K6O A;  1SD4 A;  4ZYG A;  3FF5 A;  1JHF A;  2EB7 A;  3QPT A;  3CO7 C;  1R4M B;  2EZH A;  3FXQ A;  1RKW A;  4CCO A;  5FFX A;  1P6R A;  4OMY A;  2MYS A;  3ZP5 A;  1PUF B;  3BJ6 A;  4GGG A;  5EEA A;  1I3A A;  1LPQ A;  1IGN A;  3S3N A;  1PYV A;  2WAE A;  3MWM A;  1TNS A;  2R93 J;  3GTM J;  3CUO A;  2MH2 A;  2AXT C;  1OQY A;  5F6F A;  4EEF G;  4RGU A;  1XN7 A;  3EYI A;  2F48 A;  1RR8 C;  3SXY A;  4NHJ A;  4F52 A;  3ZMS A;  5JR3 A;  3M7G A;  3TP0 A;  4E7S A;  4F3Q A;  1WJB A;  4WWC A;  3VYT B;  3TDU C;  1LVA A;  1RI7 A;  2ZBK A;  3AG1 H;  2HDD A;  5H2F C;  3T8T A;  1R7J A;  3H36 A;  3PQK A;  4ESB A;  3RYR A;  3HB9 A;  2EWN A;  5FJ8 J;  2H27 A;  1IRZ A;  2E5Z A;  4BEH B;  1APL C;  4U7B A;  3BY6 A;  3IWF A;  1H9T A;  3DPU A;  4MFD A;  2GA1 A;  4OIO F;  3WTT C;  4UY8 I;  1I50 J;  3BG7 A;  4L5I A;  3RKX A;  1K78 B;  1BJA A;  4AID A;  1H9G A;  2CV1 A;  3QP5 A;  4BQN A;  1MND A;  5KAI C;  5HLG A;  2E35 A;  1XDU A;  4RB3 C;  3WTX C;  1I1S A;  1JUS A;  3WG9 A;  1NG6 A;  1ZN2 A;  4BHB A;  2CJJ A;  5K5O A;  1MZB A;  3GTJ J;  2YPR A;  3WE2 A;  2FBK A;  2E36 A;  1HLV A;  2NNY A;  1YFH A;  5HS8 A;  3CDL A;  4IKF A;  4G9Y A;  2O61 A;  4WXD A;  4KIB A;  1X3W B;  3F0C A;  2X1E A;  3M3Y J;  1I3Q J;  1OCZ H;  3BR5 A;  5GAE J;  2RQP A;  1QZE A;  1VQ8 I;  5TIS C;  2OF7 A;  5EF6 A;  5CVV A;  4CSW A;  2HEO A;  4IPA A;  1CF7 B;  2DT6 A;  2IBD A;  2ZSI B;  2VKV A;  3GXO A;  5HLI A;  4KIS A;  3EUH C;  4YEL A;  3CCS I;  1LFB A;  1ZGW A;  1OYY A;  1X2M A;  3FXK A;  1HA8 A;  2M34 A;  3DWL E;  1KU7 A;  2K9S A;  1Y1V J;  1ZG5 A;  2F6C A;  2P5K A;  3CC4 I;  3DLL F;  3U1K A;  2I8D A;  2MGQ A;  3ZPL A;  1R1T A;  4LLN A;  3U1D A;  5D6E A;  2NYX A;  2A6H F;  2OJE D;  4EM2 A;  4Y15 A;  4YIR X;  2HYF A;  2LMD A;  3ZXS A;  1UZC A;  2Q2E B;  3KLN A;  2DK5 A;  3RKW A;  3BT9 A;  2PMZ A;  2ZME A;  3OYL A;  4D1Q A;  1FLI A;  1S7E A;  1U9O A;  4HOB A;  2JMW A;  5EG0 B;  1I6X A;  3H5R A;  3OYF A;  2IGM A;  2K4J A;  2M9H A;  2W25 A;  3OV8 A;  2OZ6 A;  1TL8 A;  4HF2 A;  3K4C A;  4LMY A;  3SDG A;  1K83 J;  1S7O A;  3A1Y A;  4OWR B;  1FT9 A;  2XSJ C;  4BU2 A;  3M8F A;  3QOE A;  1VQL I;  3E97 A;  3WTV C;  4L0Z B;  3JTH A;  4C3I J;  5ERI A;  1U6G A;  1Z3X A;  2HQR A;  3C2B A;  1RKT A;  1VQK I;  3NQO A;  2LNB A;  1W5S A;  3G71 I;  5D8K B;  4E7K A;  4IOC F;  4A3B J;  1YTY A;  1V54 H;  3DFG A;  3GYH X;  2LR8 A;  2W4S A;  2F2E A;  3HSE A;  4LK0 F;  3ABK H;  1MDM B;  3HGG A;  1R1V A;  2EFN A;  1MJ9 A;  4M72 A;  1NTC A;  5E1Z B;  1JUP A;  2VJ5 A;  1U3E M;  5F27 A;  5D5U B;  3F3X A;  5LGT A;  2EA4 A;  5FD5 A;  4NQW B;  3E5X A;  1ENH A;  3FXJ A;  3JRB A;  4M3D A;  3A01 A;  3RQ4 A;  2E2J J;  3W2A A;  5LEJ A;  1WSU A;  4E7H A;  1YW9 A;  3PM1 A;  2DOE A;  5CVU A;  3OS1 A;  5L3F A;  4LG0 A;  3N97 A;  1J0R A;  3CLO A;  3NAU A;  3GO5 A;  4Y17 A;  3S15 J;  2M0M A;  4CZZ A;  1WGX A;  4IHX A;  3GTP J;  2IA2 A;  1TQP A;  1V3F A;  4RM2 A;  3JR9 A;  2CS3 A;  4G12 A;  3S2D J;  2YUS A;  3TOB A;  1LE8 B;  3KP7 A;  4Z6Y A;  4PCQ A;  2LD5 A;  1VQN I;  1PP8 F;  1ULY A;  4ZYE A;  1FTT A;  1QZZ A;  4PJ0 C;  2GA2 A;  4BBR J;  3JSO A;  4RB1 A;  1XGO A;  4HF0 A;  2A61 A;  3TW6 A;  5F04 A;  2YSR A;  3BQZ A;  4S05 A;  3LAJ A;  3FXU A;  3FBN B;  4KJZ A;  3LFK A;  3FMR A;  4ZH4 F;  5EG0 A;  5E79 C;  1T38 A;  1CF7 A;  3S3M A;  3DQV C;  1LEA A;  4PFO A;  1AA7 A;  2LF7 A;  3PUB A;  3BTC A;  3PUF A;  4BQO A;  3JRH A;  4A0Z A;  1FY7 A;  3K2Z A;  2M87 A;  3A0H C;  4Q4Z F;  2J5P A;  1Y8Q B;  2OQR A;  1RR7 A;  4N0B A;  2VT3 A;  3BG9 A;  3HOV J;  4JX4 A;  5DCF A;  4RMN A;  4D7M A;  5F0H A;  4B3A A;  2MH9 A;  2P8T A;  3NAR A;  4PGH A;  1B4A A;  4P55 A;  2HXO A;  4A3K J;  2VKH A;  3BR0 A;  1ZTR A;  2XGC A;  2DA6 A;  4MIM A;  2V1D A;  2KRC A;  1XGN A;  2LP0 A;  4ZYD A;  3CUQ A;  2JVG A;  3TO6 A;  3VDX A;  2V1U A;  4BHP A;  2WV0 A;  3CES A;  2KFD A;  5L3B A;  1IF1 A;  2FBH A;  2LK2 A;  4BAC A;  2RDP A;  1VF9 A;  3BOQ A;  1W36 D;  3KPH A;  3GWZ A;  4PFP A;  2Z5U A;  1AHD P;  3I56 I;  1ITY A;  5LFA A;  4OAZ A;  2Z33 A;  2DBB A;  3R0J A;  3B6A A;  3CD6 I;  3M1C A;  4GCV A;  3CCY A;  5B5E C;  4IRI A;  1YIO A;  4BAY A;  2ZJ2 A;  4OIR F;  2EV6 A;  2DA1 A;  4IO9 F;  4G7Z F;  3G1M A;  2ADU A;  5H6R A;  5IP7 J;  3H5A A;  3HYI A;  4GFB A;  2FRH A;  3VWB A;  2FML A;  5C4X J;  4CUG A;  5K1Y A;  4ENJ A;  1A6Q A;  1BM9 A;  4A5M A;  1IXS B;  3IC7 A;  5KCM A;  2VXD A;  2DYR H;  3K7A J;  3REO A;  4A0Y A;  3MAJ A;  4I01 A;  1FSE A;  3LFU A;  3OOU A;  4HW0 A;  2BV6 A;  4XSX F;  1U8B A;  4UNO A;  2UWM A;  2HDW A;  3HC7 A;  5J6X A;  3KYL A;  2XAJ A;  4NBQ A;  2DMP A;  3ECO A;  3MKY B;  2IGK A;  3F8M A;  3QWL A;  4DBR A;  2HYJ A;  1PP7 U;  1YO5 C;  4A3E J;  4CO8 A;  2H6C A;  2IT0 A;  1D8J A;  3S3O A;  1VND A;  4I09 A;  3I54 A;  4HEA 2;  4B44 A;  1WH7 A;  2FXA A;  3PL8 A;  1X1C A;  3CF5 F;  1CGP A;  2COB A;  5DD4 A;  2DT7 B;  1LFU P;  3M9A A;  4WK8 F;  1OYI A;  2L0K A;  3COA C;  1EJ9 A;  4JYK A;  4MQV A;  1MH3 A;  3VYU B;  3WTU C;  2XAS A;  4KIG A;  5IT3 A;  3PNV A;  4PJN A;  1SFX A;  1BOB A;  4YII A;  1IC8 A;  2FUG 2;  3OYJ A;  4FET A;  2CV0 A;  1LJ9 A;  4I98 B;  3V7R A;  1YIJ I;  2CUE A;  2RNG A;  3MVP A;  2LBF B;  3RI4 A;  2F4O B;  4XK4 A;  3SFI A;  4ESF A;  2EIN H;  2ELJ A;  4ZDP A;  1X1P A;  4M3E A;  2FD5 A;  1TP4 A;  2F5V A;  3KFW X;  2CV2 A;  4QPQ A;  4BNC A;  4A5N A;  5JHF A;  4XBF A;  2K27 A;  3FK7 A;  1KQ9 A;  2EA2 A;  2HU9 A;  3ZMU A;  1VZ0 A;  2UXX A;  3IH3 A;  1HBX G;  1WJF A;  5CLS A;  4KYW A;  3K1M A;  5EGO B;  3Q3S A;  3W6K B;  4DNC A;  2PI0 A;  2E1M B;  4QSH A;  2WBM A;  4M3B A;  3GEZ A;  1U9N A;  3LSG A;  5KK1 A;  3E5U A;  3FMS A;  3I59 B;  4BJT A;  4IOA F;  4KIC A;  3HOW J;  1FOY A;  1K4S A;  1MMS A;  1MBF A;  3SYT A;  4AM3 A;  3GCM A;  3G3Z A;  1IN8 A;  1MD0 A;  1LDD A;  1VQP I;  5L3E A;  3LSK A;  5D4R A;  1XPX A;  1DQU A;  1XD7 A;  3C18 A;  2QF7 A;  3HSF A;  4JX6 A;  4IEJ A;  1REP C;  4KDP A;  1GVD A;  2L01 A;  1PUF A;  3IWZ A;  2X6Y A;  1MBK A;  1XX5 A;  1LDK B;  2FX0 A;  3ABM H;  3CUQ C;  3V8K A;  2ZXH A;  2M3A A;  3TOA A;  1HC8 A;  1WCM J;  2UUZ A;  1IV8 A;  2BW3 B;  2CWE A;  4XKV A;  1QU3 A;  1P4X A;  1S9H A;  2BXZ A;  4XMY A;  1BIA A;  3BZK A;  1UST A;  3SZT A;  4B8X A;  2DA2 A;  4DOZ A;  3GFJ A;  2R7V A;  4MO7 A;  1NHA A;  5HLH A;  2GXA A;  4N9H A;  2DLL A;  2XAU A;  3JSP A;  3H0G J;  1VQO I;  1I39 A;  1NH3 A;  2M2E A;  4Y13 A;  2EFQ A;  2RKH A;  3P7N A;  4M73 A;  1VFC A;  4A6E A;  1WJA A;  4N9I A;  1JT6 A;  1IW7 F;  5GAG J;  2VUM J;  3LWF A;  3OIP A;  1XS9 A;  1D0Z A;  1R36 A;  5HDK A;  3MFK A;  1O3Q A;  4R1H A;  1HDD C;  1VQ5 I;  5H20 A;  1K4T A;  1OCT C;  3K70 D;  3ZOB A;  5DM7 F;  1I5Z A;  3A0B C;  1ETQ A;  2M7A A;  3GLX A;  1O3S A;  1BC7 C;  1YHQ I;  2ZJP F;  1F43 A;  3S32 A;  3ZQH A;  4UB8 C;  3OYN A;  3RYP A;  1TWC J;  4CCJ A;  1K78 A;  2HVQ A;  4PJJ A;  1A36 A;  2OV7 A;  2HQA A;  5J1U A;  1B8I A;  3I3L A;  3I5U A;  3ZN1 A;  1XTA A;  1ZRE A;  4HDU A;  2VBY A;  4V19 K;  4U88 A;  2RVC A;  3ABT A;  3DV8 A;  4HG2 A;  3PIO F;  2QVO A;  3VEP A;  4EGY A;  1O4X A;  3NEU A;  1KU9 A;  2H94 A;  4KNY A;  3MZH A;  1POG A;  4CA0 A;  2V9K A;  1OPC A;  4UXN A;  3F8F A;  1XGS A;  2CO5 A;  2LY2 A;  2GLO A;  1FMW A;  4XIC A;  2LH9 A;  5DUK A;  3FKI J;  3GX4 X;  2STT A;  2HFH A;  1ZH5 A;  1S72 I;  3CJQ B;  2A5Y B;  5HNF A;  5E3L A;  5JVG F;  1GT0 C;  4Y52 J;  1JTX A;  2MD0 A;  4BDY A;  1KYZ A;  4DIQ A;  3QQA A;  1D0Y A;  4UVB A;  1PDN C;  5DCM A;  3EYY A;  1SVO A;  2CMP A;  4RAY A;  2P5L C;  1WJ5 A;  1IJW C;  1Y39 A;  1MBG A;  4RB2 C;  3RTR A;  2EIJ H;  5K5Q A;  5HS7 A;  4XL9 A;  1S6L A;  2MBF A;  4ZTJ A;  5L3G A;  1LB2 A;  2HYG D;  3LA7 A;  1XC5 A;  1XMX A;  4RAF A;  1GV5 A;  2O0Y A;  4DYQ A;  4C2U A;  5E3O A;  3L2W A;  4XLA A;  5EEG A;  1U78 A;  2BHY A;  1QHG A;  4A3G J;  2IVM A;  2WAQ A;  4IL6 C;  3BZ6 A;  2R7U A;  3BCA A;  2UXN A;  2WA0 A;  4HAM A;  5HS9 A;  4ABZ A;  1RC9 A;  4MQ9 F;  3S1R J;  4P9U A;  3LSI A;  2UZK A;  2AHQ A;  2HQN A;  2Z2S B;  4IRH A;  3JAM K;  2TCT A;  5JHU A;  5DEQ A;  1DP3 A;  2CSO A;  1T6S A;  4EJO A;  3L1P A;  1FBS A;  2ME6 A;  2MFZ A;  1MH4 A;  4F92 B;  2IS1 A;  2M7B A;  2E71 A;  1TWG J;  3O6B B;  4PSX A;  4FT8 A;  2X4H A;  4E7Z A;  4YFX F;  3KET A;  4BQQ A;  1P2F A;  4XOT A;  4AVP A;  4N4O B;  4Y3O A;  4HSR A;  5CVI A;  4I2O A;  2F5E A;  1YRN B;  5IPA A;  1K79 A;  3TW7 A;  3VSK A;  2FSW A;  1BI2 A;  4A3M J;  2JT1 A;  3ASN H;  1IN4 A;  2PMH A;  2LKX A;  4B48 A;  5GTH C;  1W7P B;  3UNG C;  2OD5 A;  4UUS B;  3DLA A;  3D5R C;  2XGE A;  3Q9V A;  3P9K A;  2QYO A;  4NNJ A;  3EDP A;  3LSJ A;  1D0X A;  2L54 A;  2KKO A;  1F4K A;  3C1D A;  4HLX A;  4KN4 X;  2NVU B;  3J7A O;  4IHS A;  1ETK A;  2EV5 A;  4XRM A;  1JGG A;  3HDD A;  1J09 A;  3BC8 A;  3IHU A;  5FGM A;  2XB0 X;  2O5R A;  3I59 A;  1QNT A;  1IN5 A;  5AIQ A;  5GTI C;  2V79 A;  3LMM A;  4MHG A;  3IV5 A;  3E6B A;  1BR1 A;  2Y31 A;  3TDZ C;  1UCR A;  3L2R A;  3ZCO A;  1OIS A;  2KHM A;  3CLQ A;  2QWW A;  3ONQ A;  2DYS H;  4LK1 F;  4BE0 A;  2JSC A;  3BPV A;  3RJP A;  4G6D A;  2X48 A;  4E70 A;  1FSH A;  1K6Y A;  5FO5 A;  3V8J A;  3AG4 H;  4NC7 A;  1T0F A;  1FTZ A;  2F5D A;  1L3L A;  4GXO A;  3DEW A;  1QO0 D;  1GXP A;  1QVU A;  1KZH A;  5D5W B;  3MN2 A;  2DI3 A;  1EV7 A;  2QZ8 A;  2XB5 A;  1WI9 A;  5EZH A;  5LHG A;  1D8K A;  2QLZ A;  4IXA A;  2ECB A;  3FXL A;  2GXG A;  4NQW A;  2GBY A;  1R1U A;  3CCQ I;  2OA4 A;  1DPR A;  5B66 C;  3V7S A;  2VPR A;  2VOO A;  2Y30 A;  4U7D A;  3ELK A;  1HCR A;  3I0T A;  5BQT A;  1SMT A;  1DUX C;  2FBI A;  4BJ5 C;  1VQ6 I;  3OSG A;  1F1Z A;  2R7Q A;  3RPU A;  1T2K A;  3OL3 A;  1FIA A;  4FQG A;  3ABL H;  3BR6 A;  2JPC A;  3DXJ F;  2L9N A;  2QKM B;  4XM3 A;  1W7P D;  4WXH A;  4I6Z A;  3VYR B;  2MLK A;  5LLQ A;  2W57 A;  2X9D A;  1SD7 A;  2EZL A;  3WU0 A;  3QYB A;  1ONV A;  1U5T B;  4LOC A;  2VLA A;  2V9P A;  3BG5 A;  1TTY A;  1E3O C;  4LLG F;  1R5G A;  2ECC A;  3DP7 A;  3DTK A;  3BCB A;  1R49 A;  2DOF A;  2VC0 A;  1MKM A;  2NOG A;  5DDG A;  3I71 A;  1FZP B;  2R7S A;  2E34 A;  5CPR B;  4HST A;  4UHT A;  2G7U A;  3D5L A;  3LNQ A;  2RNJ A;  4EJW A;  2QBY A;  4ON0 A;  3WTW C;  4J19 A;  3IH2 A;  1JKR C;  3S17 J;  1K61 A;  3S8P A;  5C4J J;  5D5V B;  2IS2 A;  5J47 A;  1QVT A;  1MMD A;  1I6H J;  2EV0 A;  4M6X A;  3KEO A;  3LQR A;  4RDU A;  2YS9 A;  1QZY A;  2OAZ A;  3TBI A;  2P0W A;  4FIS A;  2Z16 A;  4DQ2 A;  3F8B A;  3KYC B;  2CG4 A;  4CDG A;  1ON1 A;  5LRR A;  3KIO A;  3K9T A;  4F93 B;  5CQE A;  2VB6 A;  2W00 A;  1R9T J;  3PNT A;  2P5V A;  5E17 F;  4I0A A;  2ESN A;  4RB0 A;  5FD6 A;  4HNT A;  1WJC A;  2E7W A;  1HF0 A;  3FMQ A;  2RC4 A;  2P6S A;  4Q5S F;  2NVX J;  3MD2 A;  3CJN A;  1BBY A;  3SEQ A;  2UV1 A;  2ZO4 A;  5F64 A;  3PIP F;  1FYK A;  4PDK A;  2O6G E;  3MKZ A;  1BOA A;  3P9C A;  1XCB A;  4OOI A;  3C2H A;  1QHH D;  1EH6 A;  3ZMD A;  2OZU A;  5AON A;  1TW3 A;  5JI6 A;  1TWA J;  2D1V A;  1ORK A;  2OC6 A;  3K4N A;  3OWT A;  3T1B A;  3GZN B;  2DJN A;  3BTJ A;  4L0Y B;  3OYG A;  2KL4 A;  2L4A A;  1ODD A;  1YYV A;  4UVA A;  3H3V K;  2V4J C;  1N78 A;  4YFK F;  3BLY A;  1MBH A;  1W1W E;  3HRU A;  4AIK A;  1P9Q C;  1SFK A;  3RPU D;  3ISP A;  4LJZ F;  2VI6 A;  1LKX A;  2JK3 A;  4EM1 A;  4XR6 A;  1EA3 A;  5DM6 F;  4GYG A;  5F1J A;  4O6J A;  4BE1 A;  5CKT A;  4II2 A;  2O9L A;  2Z99 A;  1D1B A;  3HGY A;  1HSJ A;  4RBO A;  2VN2 A;  2Y2Z A;  1H8A C;  2X1D A;  2YU3 A;  3SQN A;  2DQR A;  4LFU A;  1ZR4 A;  1GDT A;  1DU0 A;  3MMY B;  2HZT A;  4OIQ F;  1ZK8 A;  4JQF A;  2R7R A;  1BN5 A;  3D1N I;  2XAQ A;  5J4V A;  2LLK A;  2QSG X;  1UFM A;  2X51 A;  1R58 A;  3CJT B;  4KMU X;  3G2B A;  2W85 A;  4P5O A;  3GLL A;  3S2W A;  2TRT A;  2HOS A;  4ZZL A;  5J8C A;  4IQJ A;  4B3X A;  3KCC A;  5IT9 K;  2PQ8 A;  2ZNY A;  1MJB A;  2NVY J;  2H1K A;  1Z67 A;  1RRJ A;  4FE7 A;  4CYD A;  2WY7 Q;  1Y0N A;  1F9N A;  2JJ7 A;  4E7J A;  2XF7 A;  1FP2 A;  2ESH A;  4X1E A;  2IA0 A;  4C3H J;  4CGZ A;  1S29 A;  2LBF A;  4R8H A;  3J80 K;  3E6C C;  4R79 A;  4Y7N J;  2WWY A;  2FOW A;  2ID6 A;  4PSW A;  2V1X A;  3J80 Z;  2HXI A;  3BP8 A;  3IL2 A;  5L3C A;  3JRE A;  2QA4 I;  2ZB9 A;  4AUX A;  5IYC J;  4L9J A;  2M1B A;  2VOD A;  1AKH B;  2B0L A;  2K86 A;  4PK4 A;  1F36 A;  5HDN A;  3H5N A;  3SDB A;  1Y0U A;  3F72 A;  3L2Q A;  2O3F A;  4E7L A;  2F5C A;  1TWF J;  5J1R A;  2G7H A;  2QSH X;  3P5J A;  2OPT A;  1C0W A;  2PJR B;  1B6A A;  1N75 A;  3PSF A;  3HG9 A;  3BG6 A;  2HS5 A;  1UHW A;  5F1R A;  2HGC A;  2L02 A;  4ETS A;  1TBX A;  1KA8 A;  4IVN A;  4FE4 A;  3M4O J;  1XG1 A;  3CCR I;  3PNY A;  1A6I A;  4RGX A;  1VQ4 I;  1TLH B;  2X6W A;  2P4W A;  2R4G A;  1J9I A;  2KLO A;  2RRE A;  1QBJ A;  3VOD A;  3RZD J;  1K7A A;  4OIN F;  1A04 A;  3AFH A;  4KA4 A;  1W4M A;  3DTE A;  1S8N A;  2LC2 A;  1WHU A;  4MFE A;  3FKJ A;  3K4K A;  5H6Q A;  3OYK A;  1ZG1 A;  1X58 A;  1X1A A;  1XMA A;  3FHN A;  1YW8 A;  5M5X J;  2WB1 N;  4L9N A;  3AL0 B;  1Z1D A;  1E0E A;  5JLX A;  3PFY A;  1Z21 A;  5M5Y J;  2VE8 A;  3H9Q A;  1JI8 A;  4A2U A;  4CHU A;  2DMQ A;  3UKG A;  2XRL A;  1X2N A;  3OIQ A;  2E1O A;  4A3J J;  2ZKZ A;  3GZ5 A;  3TMO A;  1KGS A;  2QM3 A;  2EH3 A;  5LGU A;  2MA3 A;  4RA2 A;  1OCC H;  4EV0 A;  1HQC A;  2K9Q A;  4BUP A;  4XOP A;  4HF1 A;  4HDV A;  3K0L A;  3PO2 J;  2HWV A;  2JVH A;  2EFW A;  3SFZ A;  4ESJ A;  2DJI A;  2GOX B;  4DYC A;  1MNM C;  1QQI A;  1VQM I;  5KHD A;  2Y9Y A;  2D1H A;  5JFR A;  3SJM A;  2VIX A;  2KDO A;  3H3Z A;  1WFX A;  2E7X A;  2JN6 A;  3LSR A;  4X6A J;  1WVR A;  2DA7 A;  3OR1 C;  2VJ4 A;  5M3M J;  5J1Y A;  4AIH A;  4BY7 J;  1Y56 A;  2DQL A;  1PJR A;  1STZ A;  2CUJ A;  3ERE D;  2G9W A;  1R4N B;  5BNG A;  1HKQ A;  3GUD A;  1WKM A;  1V5F A;  3FXR A;  3RDI A;  2CW8 A;  5GAD J;  4JP0 A;  5ILV A;  2OTJ I;  4CCK A;  1N25 A;  3HOY J;  2DXI A;  2VJJ A;  2XF6 A;  2M45 A;  2WY8 Q;  2VC1 A;  2M8E A;  4V2F A;  5TGT A;  4RS8 A;  1YJN I;  3DBR B;  1BR2 A;  3LAP A;  3TKY A;  2WB1 A;  1G3Y A;  5KAF C;  2ISY A;  4AYB N;  5JVT A;  2A5W A;  4RGS A;  1J5Y A;  2RAE A;  4YIF A;  1Z6R A;  3PFI A;  3IH4 A;  3HL2 A;  1G59 A;  1ZLK A;  2XPU A;  1ZAR A;  2QQA A;  3GFI A;  2EPF A;  3WU1 B;  4CXF A;  2RGV A;  1UEL B;  4BJ6 C;  2I5U A;  2E1N A;  3LST A;  1IZ1 A;  5E8I A;  1X4O A;  3KZI C;  5E3M A;  2PJR A;  3KZY A;  1YRN A;  3ZQI A;  2DCE A;  4PUS A;  2DAO A;  1HOM A;  2JA6 J;  5D8L B;  3EUA A;  4ZDL A;  1VQ9 I;  2EIL H;  4E6K G;  2DFF A;  3AG3 H;  3FXO A;  3RCO A;  4RAG A;  5K7Z A;  2VBX A;  5EYR A;  3E7L A;  4YEJ A;  1WJD A;  2R7O A;  3WGH A;  2OU2 A;  1ZRD A;  2DO7 A;  1HXD A;  3E0J B;  1U0J A;  3MKL A;  1MMA A;  3HRM A;  1X3U A;  2A6E F;  1IG7 A;  3ML6 A;  4EAT A;  3CCJ I;  1X4P A;  3GTK J;  4JX5 A;  3HUG A;  2R7Z J;  3H9G A;  2FF4 A;  4GYI A;  3RKY A;  3H35 A;  3R0A A;  1I1G A;  3L2U A;  1IV6 A;  1R22 A;  1OYW A;  4TV7 A;  3WU2 C;  2FE3 A;  4AC0 A;  3CMM A;  4D9J A;  4M6Y A;  4X0G A;  4XKW A;  2X6O A;  3K1N A;  4HA8 A;  2LRD A;  3O2P E;  2F4M B;  2FQ3 A;  2YR2 A;  2DN0 A;  2PMZ N;  1ETX A;  3E6M A;  4IZZ A;  1BI0 A;  2VKD A;  2MC3 A;  1LQ1 A;  3DEE A;  1HKS A;  2WAD A;  4XNF A;  3J81 Z;  5DD8 A;  4CIC A;  3J81 K;  1MSE C;  2Y0S A;  2F4I A;  4ZZD A;  1TC3 C;  2PJP A;  2CQ7 A;  4W1U A;  3LA3 A;  1U5T A;  1BA5 A;  4IRG A;  3FIS A;  3G6E I;  5ILU A;  2GQQ A;  4EJT A;  1J75 A;  5J40 A;  3ZGK A;  4XLP F;  3OYC A;  3DKW A;  1A31 A;  3F23 A;  3H0D A;  4C3J J;  4IHV A;  2M0C A;  3E3V A;  1JGS A;  4Y4R A;  2DA4 A;  1J7K A;  5B1A H;  4LG0 B;  4QPO A;  2IEK A;  4CCM A;  4HNU A;  3FWE A;  5IYB J;  2LFB A;  3ZRG A;  3M8E A;  2KMU A;  3FDY A;  1YJW I;  4HX8 A;  1MGT A;  3DKY A;  2K9M A;  4LIU A;  3CDH A;  3LOC A;  3U21 A;  1LEB A;  4IQ4 A;  4U0V A;  2J5O A;  2JUG A;  3KYD B;  5TRD A;  2CQN A;  2V7F A;  2HKO A;  3PO3 J;  4I02 A;  2IS4 A;  4XLH A;  1D5V A;  1I27 A;  2L2O A;  2PX9 A;  2IRF G;  3CJR B;  2CQQ A;  4NUB A;  5EEH A;  3HIF A;  2DPU A;  2IJL A;  3QRF F;  2XRN A;  3TGN A;  5TJJ A;  2XPW A;  3L00 A;  5EJC A;  1M1E B;  2XHK A;  1X3Z B;  4WCG A;  2DOD A;  3HKZ N;  3S16 J;  5ED4 A;  4Q47 A;  1T08 B;  2LDU A;  3IRR A;  4RLF A;  3ZR8 X;  1GLN A;  1OKR A;  4L5J A;  3KP5 A;  1AKH A;  2V26 A;  1NG7 A;  2XGD A;  4UUS A;  2GXB A;  1YW7 A;  4QTR A;  3SHF A;  4IHW A;  2DFI A;  1P7J A;  3V42 A;  1VTN C;  1Q1H A;  3HSR A;  1XSV A;  1XCV A;  1BL0 A;  2YX4 A;  2DMU A;  2IGO A;  2XKO A;  2MD5 A;  3BPX A;  2XIG A;  1FMV A;  5IP9 J;  3DKX A;  1Z7L A;  3BR1 A;  1S3J A;  3H3U A;  1B9M A;  3NWS A;  4PGG A;  1W36 C;  2EFO A;  1JKO C;  2IP2 A;  5HOO A;  4I99 C;  2P6T A;  3M1E A;  5A2Q K;  4XN3 A;  2CQX A;  3I53 A;  1FNN A;  3FXM A;  4MLO A;  3HOT A;  2R0Q C;  3JRC A;  3CTA A;  1BIB A;  2KIQ A;  1T8I A;  1YJ9 I;  1BC8 C;  1XDS A;  3ECH A;  4BEH A;  2R3S A;  2E2H J;  1EH8 A;  2VJI A;  1Y6I A;  1G8X A;  2Y69 H;  3LL7 A;  2LVS A;  2VQL A;  2NS7 A;  1MMN A;  2NS8 A;  2JA5 J;  2N8G A;  1WZ2 A;  3U2R A;  2H8R A;  1ZGA A;  3VB2 A;  2ID3 A;  1Z7U A;  4EJU A;  5D4S A;  2XUB A;  4KMF A;  4HYE A;  4XLE A;  4CYC B;  3AL0 C;  2CU7 A;  4RAZ A;  3CP2 A;  4H0E A;  2E5N A;  1KQ8 A;  2R5Y A;  3WE3 A;  3S14 J;  3HPH A;  3OIO A;  2JA2 A;  4D0P A;  4ANJ A;  3KP3 A;  5J3L A;  2LRE A;  1LUJ B;  1JJ8 C;  4HQE A;  1YX3 A;  2NNN A;  2WTE A;  2LG4 A;  3GFM A;  1JHH A;  2K02 A;  5EDN A;  4E7I A;  3HHG A;  4YRV A;  4A69 C;  4ZDO A;  4G6Q A;  2KZG A;  2YX7 A;  4QIW N;  2ELH A;  1KYW A;  2RN7 A;  1FYM A;  3E6D A;  3TO7 A;  1KQ0 A;  3I9V 2;  3C7J A;  1SVM A;  1U5T C;  3L09 A;  4G6T B;  4HX7 A;  4XRS G;  1TWH J;  4EJV A;  3E5Q A;  3NWT A;  4UUT A;  2HPI A;  3CP8 A;  2HVR A;  1ZKG A;  2EK5 A;  5E20 A;  2O8X A;  2Y9Z A;  3DU5 A;  1BR4 A;  2B63 J;  2CYY A;  3OS2 A;  3CCU I;  3J7A Y;  4K2E A;  2I10 A;  2NXN B;  3K70 C;  3QPL A;  1GV2 A;  3GFL A;  4NB5 A;  4EGZ A;  1XGM A;  1ZEL A;  2B7E A;  3J7Y J;  3ZQF A;  2LF8 A;  2EZK A;  3OYM A;  3M07 A;  3WGG A;  3MZY A;  2BY0 A;  3CME I;  2FA5 A;  3ABU A;  2QGU A;  3CC7 I;  3EQL F;  1OCR H;  3K4M A;  2HOA A;  4JBA A;  4EMS A;  1X19 A;  5E8G A;  3A01 B;  2Z1D A;  2P7C B;  2NAZ A;  3F6V A;  2HOE A;  5HLT A;  4FAS D;  1ZHF A;  2P81 A;  3ZQG A;  5BMZ A;  1XSD A;  2BVM A;  4AWX B;  2EZI A;  2PFB A;  3GTQ J;  3K4B A;  2QBY B;  3ERM A;  5ICG A;  2QSF X;  4BGD A;  5M3F J;  4RGR A;  2DA5 A;  1RES A;  2JA7 J;  4PZJ A;  1B9N A;  2VKE A;  3U9G A;  3OYI A;  2XPV A;  2K40 A;  4KN7 X;  2LY1 A;  3N05 A;  4B47 A;  1JT0 A;  2Y0M A;  4ZYH A;  2D45 A;  3CMA I;  4HNV A;  3OYE A;  4U0Y A;  1W5T A;  2L9R A;  4KT5 C;  3I4M J;  3R61 A;  4AD9 A;  2NS0 A;  3V7C A;  3FM3 A;  2PLY A;  3LSH A;  1G3S A;  3QOD A;  2VQH A;  3DPT A;  2X1C A;  5CVR A;  4HBL A;  5J4Y A;  2RV8 A;  3HM5 A;  4JK1 X;  2K9L A;  2WV1 A;  1O3R A;  2ZNZ A;  3OYB A;  1SMY F;  2WAQ N;  4G7H F;  2KJB A;  5B3S H;  2B9S A;  1OCO H;  3KP6 A;  2FJ1 A;  3WOD F;  3I58 A;  1CQT A;  2M8G X;  1KU2 A;  2X85 A;  2O7O A;  2L5Q A;  4N4N B;  5BS6 A;  1YG2 A;  5F0C A;  2KJC A;  3ZMV A;  2R7X A;  1ZQ3 P;  3EET A;  4IX7 A;  2LSO A;  3DU6 A;  4IF4 A;  1UMQ A;  2LOO A;  2LTP A;  1J59 A;  4YFN F;  2IPQ X;  2GIZ A;  3OOP A;  2CH0 A;  2HTJ A;  3BR2 A;  3CO6 C;  3BQY A;  3DPL C;  1BW5 A;  1IUF A;  1X1D A;  2Q0O A;  4A0X A;  4CH7 A;  2A05 A;  2ZC2 A;  4WX9 A;  1MJA A;  4P9F A;  2MW8 A;  3I64 A;  4A12 A;  3EPZ A;  1B1B A;  2DFE A;  2XV4 S;  4GRI A;  9ANT A;  5FLM J;  3S1M J;  1H88 C;  1LNW A;  1OFC X;  2X6X A;  3HTS B;  3Q0U A;  2DMT A;  1RPW A;  3SZG A;  4HLY A;  3G4S I;  2HZD A;  4XSZ F;  3F21 A;  2M4G A;  2ZXJ A;  3FZV A;  1BJZ A;  3WGI A;  1G3T A;  2CUF A;  1BI1 A;  3CC2 I;  3JRI A;  1H89 C;  4G8X A;  4XLC A;  1SD6 A;  1O3T A;  5IOZ A;  3OYD A;  4ZYA A;  3CCM I;  2QEX I;  1YE9 A;  2DDB A;  4KUM A;  2Q8K A;  3GTG J;  1RNL A;  3KZZ A;  4CZC A;  1ACI A;  1SFE A;  4ASN A;  3O8G A;  3OYH A;  1Z3Y A;  1YS6 A;  2KDZ A;  2L7K A;  3F8N A;  2NVT J;  2KIS A;  1HW5 A;  2FEZ A;  2KIU A;  1W7P A;  2EIM H;  3G1O A;  3K10 A;  4XQF A;  3IKV A;  4II3 A;  4IHT A;  1ON2 A;  2H1L A;  4CCL A;  3WTZ A;  5HNH A;  5GPC A;  1ETO A;  1ZYR F;  1PUE E;  4I7H A;  3ZQL A;  1G4D A;  4WXC A;  2IA1 A;  3HOS A;  1DPU A;  4Q48 A;  3IKT A;  2Y75 A;  1FBU A;  3AG2 H;  3BDD A;  1FJL A;  5FKN A;  1IDZ A;  1FOK A;  5E1X A;  1QRY A;  1JKQ C;  2XRO A;  3DBH B;  3OSF A;  3DTI A;  5IYD J;  1BI3 A;  1DDN A;  5GAH J;  2R7D A;  3BRO A;  2BYV E;  4P96 A;  1JE8 A;  1IRF A;  2HNH A;  1XMK A;  4DW6 A;  4A6D A;  4D7N A;  5FRM A;  5CJ9 A;  1R5H A;  1A5J A;  1FBQ A;  3K4L A;  4FX4 A;  1FYL A;  4CCN A;  1U8R A;  4HX4 A;  2EJR A;  4QLC U;  1S7A A;  3CDI A;  3FHZ A;  4IHY A;  4JOM A;  2BEO A;  3HJE A;  2Y0S N;  2ZME B;  2L4M A;  3PSI A;  2CUZ A;  2KT0 A;  3FIW A;  4UUV A;  3HHH A;  1JUM A;  2JRM A;  2OBP A;  2CRG A;  2FOK A;  2K9N A;  4A3D J;  5GPA A;  2BY2 A;  1T56 A;  1WWX A;  2W82 A;  4O5V A;  2DW4 A;  2WAF A;  1IN7 A;  1XSX A;  4LG3 A;  3TP3 A;  2VPL A;  4M71 A;  2BHZ A;  3F9K A;  4HZF A;  2ZXI A;  3VYS B;  4BYY A;  2IW5 A;  2PBI A;  2ZCW A;  2BY3 A;  3WG7 H;  2F5F A;  5FFZ A;  2FNA A;  2JPB A;  1ETW A;  1MBJ A;  1E2X A;  1SAX A;  2E60 A;  5B1B H;  3I4N J;  3JRF A;  5BPD A;  3NRV A;  1GXQ A;  3R60 A;  1HST A;  4OU0 A;  3K69 A;  4HQM A;  1IXR C;  1TZL A;  3QAH A;  4M3G A;  3WTS C;  1USS A;  4M9X A;  2JUC A;  2QQ9 A;  2H8W A;  2HTS A;  4BHC A;  2R7F A;  4EVI A;  4BQA A;  1TW2 A;  3OYA A;  2R92 J;  4FTH A;  3CUQ B;  5DUI A;  3LQQ A;  3L2V A;  2IS6 A;  3QU3 A;  2PEX A;  4DBQ A;  2A68 F;  1FIP A;  2BE5 F;  3HTU A;  3QYF A;  3JRG A;  2QUF A;  2W24 A;  4C9Y A;  3A4C A;  3FK6 A;  5IP6 A;  4EM0 B;  2BZT A;  4BY1 J;  2R5Z B;  1B72 B;  2QEN A;  1YX5 A;  4L9V A;  3O8H A;  1WQ2 A;  2M30 A;  3HRT A;  1KU3 A;  2VQG A;  3W3C A;  3JRA A;  2E1M C;  4CYC A;  1ZRC A;  4Z2Y A;  4A3L J;  2BW3 A;  5FB2 A;  5LHI A;  2QQ8 A;  2VBZ A;  2A6T A;  3JW4 A;  3L9F A;  5EGO A;  3BWG A;  1SAU A;  2ETH A;  2HR3 A;  2OCC H;  1ZAO A;  2DOA A;  4XLN F;  2BVL A;  4MGR A;  2BOL A;  2JWT A;  3HOU J;  3OY9 A;  3ASO H;  3QU6 A;  4LB6 B;  1G2H A;  1T33 A;  3LSM A;  3MKW B;  3O3K A;  2XSD C;  2OTL I;  3GZ6 A;  2DPD A;  4DYR A;  5A2Q Z;  1AOY A;  2GWR A;  3RZO J;  3IAS 2;  2RQQ A;  2VON A;  1T98 A;  3TO9 A;  5ICE A;  4AIJ A;  2AQF A;  3S93 A;  3CCL I;  4HRI A;  2DFH A;  2MAB A;  2ZME C;  5ICF A;  4F91 B;  2AO9 A;  1HDP A;  5FLV A;  4FCY A;  2CFO A;  2XVC A;  3OS0 A;  3Q5F A;  5F0F A;  2P7V B;  3WHC A;  1SD5 A;  2WC2 A;  5FKM A;  1FEX A;  1V55 H;  3GBG A;  3QOP A;  1JKP C;  2ZJQ F;  2OCE A;  1SAN A;  4WF2 A;  1BW6 A;  4C2M J;  2VOP A;  1GHC A;  4DZP A;  1OR7 C;  5LHH A;  3B73 A;  4UVC A;  1FP1 D;  3BZC A;  1QPM A;  4KFC A;  3GVA A;  1LE8 A;  5HDG A;  2GOM A;  1O57 A;  4ZC3 A;  4XON A;  3H1C A;  4D5C A;  1UG2 A;  2K3P A;  4XID A;  3TL4 X;  5ICC A;  5J8F A;  1EF4 A;  3EUH A;  3G73 A;  2K7L A;  5DS9 A;  1HKT A;  2HDC A;  4B4C A;  4NC8 A;  1ZG3 A;  2OUM A;  2AS5 F;  1TNT A;  5DV5 A;  5DTD A;  5F08 A;  1YI2 I;  1SEU A;  3IAM 2;  3GW2 A;  2K5C A;  2STW A;  1OLT A;  3H9J A;  2IAI A;  3T5X A;  4UV9 A;  3ZQC A;  4GO1 A;  1Z0X A;  4S0H B;  3QPH A;  2CW0 F;  1R6R A;  2E2I J;  3DEU A;  3W2V A;  2JSP A;  1G6N A;  4I76 A;  2AQE A;  1W5C C;  4FHT A;  4DJA A;  1MNE A;  4BL0 B;  3P9I A;  4M74 A;  2Q1Z B;  2L9S A;  4MEY F;  2VXZ A;  1FX7 A;  1DGW Y;  5CVJ A;  3CCE I;  1XB4 A;  1H0M A;  1IO2 A;  1V4R A;  4AU7 A;  2HPM A;  4XLF A;  2VE9 A;  3VFZ A;  4BH9 A;  1WJE A;  3V4G A;  1GVJ A;  1VI0 A;  2Q2E A;  3M8J A;  3W6V A;  3BJO A;  1PVE A;  3FBI B;  3HBL A;  3KEY A;  2R5Z A;  4J00 A;  1NK2 P;  1RZ4 A;  2HKX A;  2HVS A;  2DTR A;  1B59 A;  2DTZ A;  2JTV A;  4U0W A;  2VQC A;  5BOX A;  2YU9 J;  1RUO A;  1E3P A;  2DU9 A;  3CQZ J;  4M3F A;  3K2A A;  3B02 A;  3CMY A;  2BXY A;  2TDX A;  2OQG A;  3CCV I;  3OL4 A;  4HV6 A;  1Z77 A;  5IOY A;  5M5W J;  1AU7 A;  2BGC A;  4XKC A;  1W0U A;  1DU6 A;  1IUY A;  2KIM A;  2HQ5 A;  2PG4 A;  3HUG B;  4BXF A;  2XDV A;  3MZ8 A;  5LBQ A;  2V1N A;  2XKP A;  3A02 A;  1B8I B;  3BTI A;  1Z05 A;  3RIR A;  2W48 A;  2ELK A;  2ME0 A;  5FKL A;  6PAX A;  1HW2 A;  4L5E A;  2O03 A;  4NDL A;  2QCO A;  3Q0V A;  5ILS A;  1WRJ A;  5AIP A;  3SEZ A;  2V6E A;  2H6B A;  3K4J A;  2V9V A;  3IUO A;  2R7W A;  3BJA A;  4EQQ A;  3ESW B;  2FU4 A;  2CGP A;  1S5L C;  2EIK H;  3VPR A;  2K3F A;  4NC6 A;  5JLW A;  5LEK A;  1ETY A;  4OAY A;  1O7F A;  2DDA A;  3S2H J;  1P4A A;  4OMZ A;  5IY5 H;  3EUK L;  3OMY A;  1UG0 A;  2KRH A;  2MLG A;  4IJA A;  5C3E J;  2A3S A;  2GZW A;  5D6F A;  1R71 A;  3QYE A;  2D2W A;  3KP4 A;  3G1L A;  1D3Y A;  3WHB A;  3IP4 B;  4LLL A;  2K85 A;  1MSF C;  5HOD A;  2EFP A;  5D5X B;  1F5T A;  1HW1 A;  3D5S C;  3BR3 A;  5E3N A;  1B72 A;  1GUU A;  4LGW A;  1L0O C;  3GF2 A;  4BBS J;  4L18 B;  2KRF A;  3C3W A;  3DCF A;  2KZV A;  5LRS A;  1KON A;  3R6S A;  3VSL A;  5E18 F;  1V5E A;  2VBW A;  2R7T A;  2KP6 A;  3F8C A;  3H92 A;  2H09 A;  1OR7 A;  4RM3 A;  3CZ6 A;  4A3I J;  2L3D A;  2VAS A;  1SFU A;  4A93 J;  4UV8 A;  3K1P A;  4ENM A;  3N4M A;  5L3D A;  3ZQQ A;  1Y8R B;  4U87 A;  1MIJ A;  2HI3 A;  1R5I D;  2XAF A;  2AXL A;  5K5R A;  1RUN A;  2GAU A;  1DGR M;  2FQ4 A;  4KT6 A;  3HZJ A;  3E1S A;  4XOR A;  1UHM A;  2LKP A;  1R23 A;  4H4K C;  1IRG A;  4ZJZ A;  2C6Y A;  3T0Y A;  2V6C A;  2G0E A;  2DT5 A;  1UJ8 A;  1JJ6 C;  3RPQ A;  1YS7 A;  4UB6 C;  1WI3 A;  1Q1V A;  3JAM Z;  4ZTF A;  1IXC A;  4DGW B;  3RQI A;  4S04 A;  2ZJR F;  1IDY A;  4FX0 A;  1E3H A;  1LDJ A;  2PMU A;  4P1W A;  2XF5 A;  3ULQ B;  1SFO J;  2XAH A;  2LKS A;  3W6J B;  3LSP A;  3KX2 A;  2GM4 A;  4MTD A;  5HVQ C;  4F55 A;  2CFX A;  3I4P A;  5K7F A;  3F6O A;  1FC3 A;  4AYB A;  4XRS A;  2KPM A;  2NVQ J;  4YG2 F;  4D5F A;  4V2G A;  5KVR A;  1ZGJ A;  2K4B A;  3KE2 A;  1ZLJ A;  3Q0W A;  4LIT A;  4OIP F;  3D0S A;  4HV5 A;  1IN6 A;  3V8L A;  2L7F P;  1OJL A;  4BXX J;  2L9V A;  1J2X A;  2NOJ B;  3DF8 A;  1YLF A;  5FLX Z;  4E4H A;  5FLX K;  1X1B A;  3HOX J;  3OR2 C;  5DCM B;  4BKX A;  2VL8 A;  3W2W A;  3F22 A;  3UR3 C;  4O3M A;  4B43 A;  4QWQ A;  3PQJ A;  2GIV A;  2JQ7 A;  3GTO J;  2FNP A;  2E1C A;  1VQ7 I;  4I0B A;  2DK8 A;  4HPQ A;  5CYV A;  5CQG A;  3L2C A;  5FKK A;  3A2K A;  1R00 A;  3CF2 A;  3GTL J;  3T8R A;  1LVK A;  3HKZ A;  1O7L A;  2Y48 A;  3RKQ A;  4A3C J;  1WPK A;  1P92 A;  2IXS A;  4ENK A;  3R4K A;  4F7Z A;  1ZRF A;  2JA8 J;  2X0L A;  4W97 A;  3QP6 A;  3IRQ A;  1QPI A;  2ZFW A;  2MSY A;  5GP9 A;  3GME A;  1UAA A;  5BPI A;  2KIF A;  3HRS A;  1SVL A;  2XGX A;  4MTE A;  2ISZ A;  4ENN A;  1Z9C A;  2BBY A;  4RLQ A;  2A69 F;  5FRO A;  4G94 A;  1Z91 A;  1JXS A;  3J7Z I;  2NRA C;  1FOW A;  4PJM A;  1Y1W J;  1YIT I;  2COM A;  3S1N J;  1N77 A;  1AWC A;  3BG3 A;  1SC7 A;  4C2T A;  2M4K A;  2L7Z A;  1MBE A;  1QA6 A;  3B6C A;  4XRF A;  5DYM A;  3Q9S A;  2KQR A;  1MMG A;  4B1R A;  4LB5 A;  2QKL B;  2DA3 A;  2Z9O A;  1YOV B;  5LGN A;  2D5V A;  3JCU C;  2ACJ A;  2R5Y B;  2M5W A;  5E1W A;  3KP2 A;  1Z6T A;  1FOX A;  4B09 A;  1P7I A;  2JRT A;  1TT0 A;  5KNL A;  3MEX A;  4M9Z A;  3QPS A;  1RIO H;  3ZMZ A;  1T95 A;  1EH7 A;  4M6V A;  2DMN A;  4MEX F;  1FWZ A;  3A03 A;  1U2W A;  3DBL B;  1QGP A;  4PJL A;  3VOE A;  3HOZ J;  2O8K A;  1TT5 B;  3AKZ A;  4LD5 A;  2W7N A;  3PJR A;  3BTL A;  2XAG A;  3K6G A;  2CW7 A;  4LIV A;  1T39 A;  1P4W A;  1ETV A;  1T0F C;  3JTG A;  1RET A;  2EBI A;  4J01 A;  4XN0 A;  2JZY A;  3HPG A;  2L7M P;  1OMI A;  1TQM A;  2HOT A;  3FM5 A;  2W1O A;  2IGN A;  2MG4 A;  2ZXW H;  2ZFU A;  4AVZ A;  2EQR A;  1TQI A;  3KEQ A;  4MNU A;  3HEF A;  2FMY A;  3KLO A;  4BXU A;  5K7H A;  2ZSH B;  1IRX A;  1A35 A;  2VT2 A;  4ITV A;  5C44 J;  2Z3Y A; 
#chains in the Genus database with same CATH homology
 2KT0 A;  3FIW A;  1JUM A;  1JT6 A;  2CRG A;  1W0T A;  2VUM J;  2K9N A;  1D5Y A;  5GPA A;  1XS9 A;  4A3D J;  1T56 A;  5BNG A;  1HDD C;  4DZJ A;  3TP3 A;  1OCT C;  4JP0 A;  3ZOB A;  1JTY A;  1ETQ A;  3HOY J;  4V2F A;  1F43 A;  3ZQH A;  1TWC J;  5FKO A;  3S1Q J;  2LY9 A;  2E19 A;  4AYB N;  1ETW A;  1MBJ A;  2RAE A;  1ZR2 A;  5J1U A;  3IH4 A;  4A3F J;  5EZG A;  3I4N J;  2XPU A;  1B8I A;  3JRF A;  4M3G A;  2R92 J;  1WH5 A;  4FTH A;  5E3M A;  3TED A;  1NK3 P;  1YRN A;  3JRD A;  3ZQI A;  1O4X A;  1HOM A;  2JA6 J;  1POG A;  3JRG A;  1FIP A;  1UHS A;  1OCP A;  5IP6 A;  3FK6 A;  2GLO A;  4BY1 J;  5K7Z A;  2R5Z B;  4XIC A;  2EZH A;  1B72 B;  5EYR A;  1RKW A;  3FKI J;  3O8H A;  3E7L A;  3JRA A;  5E3L A;  1GT0 C;  4CYC A;  4Y52 J;  1JTX A;  1PUF B;  4A3L J;  3MKL A;  5EEA A;  3QQA A;  1IG7 A;  1IGN A;  5EGO A;  3GTM J;  2R93 J;  1IJW C;  4EEF G;  3GTK J;  1MBG A;  4JX5 A;  2R7Z J;  2JWT A;  3HOU J;  3TP0 A;  1G2H A;  1T33 A;  1IV6 A;  1XC5 A;  2HDD A;  1GV5 A;  4DYQ A;  4AC0 A;  5E3O A;  2XSD C;  1U78 A;  4DYR A;  5FJ8 J;  3HB9 A;  4A3G J;  3RZO J;  1APL C;  1IRZ A;  2X6O A;  4ABZ A;  2DN0 A;  4MFD A;  1I50 J;  2PMZ N;  3S1R J;  1ETX A;  2AO9 A;  1HDP A;  5FLV A;  4FCY A;  5F0F A;  3WHC A;  2AHQ A;  5FKM A;  1FEX A;  2TCT A;  3GBG A;  1JKP C;  3L1P A;  2ME6 A;  1SAN A;  1MH4 A;  1JUS A;  1BW6 A;  4C2M J;  1MSE C;  2CJJ A;  1TWG J;  4DZP A;  3GTJ J;  1HLV A;  1LE8 A;  1TC3 C;  4W1U A;  1BA5 A;  3CDL A;  4D5C A;  3FIS A;  1YRN B;  5IPA A;  1UG2 A;  3TW7 A;  3F0C A;  4XID A;  4A3M J;  1EF4 A;  3M3Y J;  1I3Q J;  2LKX A;  3BR5 A;  5DS9 A;  4B4C A;  4UUS B;  2OF7 A;  2XGE A;  4C3J J;  5EF6 A;  4IHV A;  2M0C A;  2IBD A;  3LSJ A;  2DA4 A;  2VKV A;  5DTD A;  2IEK A;  5F08 A;  5IYB J;  1LFB A;  2LFB A;  1ETK A;  1ZGW A;  1X2M A;  4XRM A;  1JGG A;  2M34 A;  3HDD A;  2IAI A;  2K9S A;  1Y1V J;  2XB0 X;  3LOC A;  3ZQC A;  1Z0X A;  3IV5 A;  4S0H B;  2Y31 A;  2MGQ A;  2E2I J;  4I76 A;  3PO3 J;  2X48 A;  2CQQ A;  3BT9 A;  1S7E A;  1U9O A;  2JMW A;  1FTZ A;  5EG0 B;  2XPW A;  1VI0 A;  3DEW A;  1QVU A;  2M9H A;  3HKZ N;  3MN2 A;  3S16 J;  3W6V A;  2XB5 A;  3HBL A;  3SDG A;  2R5Z A;  5EZH A;  1NK2 P;  1K83 J;  2DTZ A;  2ECB A;  2YU9 J;  3CQZ J;  4M3F A;  2GBY A;  3K2A A;  1AKH A;  3CMY A;  2VPR A;  1Z77 A;  2XGD A;  4UUS A;  2Y30 A;  4C3I J;  5IOY A;  1HCR A;  5M5W J;  4QTR A;  1AU7 A;  4IHW A;  1W0U A;  3C2B A;  1P7J A;  1RKT A;  1DU6 A;  2HQ5 A;  1BL0 A;  2DMU A;  3OSG A;  4A3B J;  1FIA A;  2LR8 A;  5IP9 J;  3BR6 A;  3HGG A;  3BR1 A;  3A02 A;  1JKO C;  1NTC A;  1JUP A;  3BTI A;  1B8I B;  2CQX A;  2W48 A;  2ELK A;  2ME0 A;  4I6Z A;  5FKL A;  4MLO A;  2R0Q C;  5F27 A;  3JRC A;  4L5E A;  2X9D A;  2EZL A;  4NDL A;  2QCO A;  4LOC A;  1ENH A;  3Q0V A;  3JRB A;  2E2H J;  3BG5 A;  1E3O C;  4M3D A;  3A01 A;  2ECC A;  2E2J J;  2LVS A;  3PM1 A;  2NS7 A;  2NS8 A;  2JA5 J;  2N8G A;  2H8R A;  3NAU A;  2NOG A;  3VPR A;  2ID3 A;  5JLW A;  3S15 J;  1WGX A;  4IHX A;  3GTP J;  4CYC B;  1ETY A;  3S2H J;  2CU7 A;  3JR9 A;  4G12 A;  3S2D J;  2YUS A;  3LNQ A;  1LE8 B;  5C3E J;  2LD5 A;  2R5Y A;  3S14 J;  4J19 A;  3IH2 A;  1JKR C;  3S17 J;  3OIO A;  1K61 A;  5C4J J;  1FTT A;  5J3L A;  1QVT A;  1JJ8 C;  3G1L A;  4BBR J;  1I6H J;  4RDU A;  2YS9 A;  3WHB A;  1MSF C;  5HOD A;  4FIS A;  5EDN A;  3TW6 A;  5F04 A;  3BR3 A;  3BQZ A;  5E3N A;  4A69 C;  1GUU A;  1B72 A;  4QIW N;  1R9T J;  5EG0 A;  4BBS J;  3DCF A;  1HF0 A;  4XRS G;  1TWH J;  3BTC A;  2NVX J;  3JRH A;  4UUT A;  1ZKG A;  2Y9Z A;  1RR7 A;  3BG9 A;  4A3I J;  4A93 J;  3HOV J;  4JX4 A;  2B63 J;  4D7M A;  5F0H A;  2I10 A;  4B3A A;  3NAR A;  2HI3 A;  1TWA J;  3QPL A;  1GV2 A;  2HXO A;  4A3K J;  3BR0 A;  1ZTR A;  2XGC A;  4MIM A;  2DA6 A;  3ZQF A;  1ORK A;  2EZK A;  2FQ4 A;  2LP0 A;  2DJN A;  3BTJ A;  3H3V K;  2LK2 A;  1MBH A;  2HOA A;  2G0E A;  1VF9 A;  3A01 B;  2VI6 A;  1JJ6 C;  2P81 A;  1AHD P;  3ZQG A;  1ITY A;  2JK3 A;  1WI3 A;  1Q1V A;  2EZI A;  3RQI A;  3GTQ J;  3B6A A;  5F1J A;  1IDY A;  5M3F J;  3CCY A;  2O9L A;  2DA5 A;  3HGY A;  1RES A;  4RBO A;  1SFO J;  2JA7 J;  2DA1 A;  2VKE A;  2Y2Z A;  3G1M A;  1H8A C;  5IP7 J;  2XPV A;  2K40 A;  1ZR4 A;  3LSP A;  1DU0 A;  1GDT A;  2GM4 A;  1JT0 A;  1ZK8 A;  4GFB A;  3D1N I;  4HNV A;  2LLK A;  2L9R A;  5C4X J;  5K7F A;  4XRS A;  3I4M J;  2NVQ J;  4D5F A;  4V2G A;  2HOS A;  2TRT A;  3K7A J;  3Q0W A;  2NVY J;  2H1K A;  3OOU A;  3HM5 A;  4FE7 A;  2L7F P;  1OJL A;  1U8B A;  4BXX J;  2WV1 A;  2JJ7 A;  2WAQ N;  2DMP A;  4X1E A;  4C3H J;  2FJ1 A;  3HOX J;  1CQT A;  2HYJ A;  2M8G X;  4A3E J;  4Y7N J;  2ID6 A;  4BKX A;  2HXI A;  2O7O A;  1VND A;  3JRE A;  2ZB9 A;  4AUX A;  5IYC J;  1WH7 A;  5F0C A;  3GTO J;  2COB A;  1ZQ3 P;  1LFU P;  1AKH B;  2L0K A;  1UMQ A;  1F36 A;  2LTP A;  4JYK A;  5FKK A;  3GTL J;  1MH3 A;  3BR2 A;  3RKQ A;  4A3C J;  1WPK A;  3BQY A;  1BW5 A;  1IUF A;  1TWF J;  5J1R A;  1IC8 A;  2JA8 J;  2OPT A;  4W97 A;  2MW8 A;  1QPI A;  2CUE A;  3MVP A;  5GP9 A;  2MSY A;  9ANT A;  5FLM J;  4XK4 A;  3SFI A;  3S1M J;  1H88 C;  1OFC X;  4M3E A;  3Q0U A;  2DMT A;  1RPW A;  2FD5 A;  4FE4 A;  3M4O J;  1XG1 A;  1A6I A;  1Y1W J;  1BJZ A;  3S1N J;  2CUF A;  3BG3 A;  3FK7 A;  3JRI A;  1H89 C;  3RZD J;  5IOZ A;  3IH3 A;  2L7Z A;  1MBE A;  3B6C A;  5EGO B;  3Q3S A;  3GTG J;  4MFE A;  4QSH A;  1X58 A;  3O8G A;  4M3B A;  1U9N A;  3LSG A;  4B1R A;  2DA3 A;  2KDZ A;  2D5V A;  5M5X J;  2WB1 N;  2R5Y B;  3HOW J;  2NVT J;  1MBF A;  5JLX A;  3G1O A;  5M5Y J;  5GPC A;  1ETO A;  2DMQ A;  1P7I A;  3ZQL A;  3UKG A;  2XRL A;  2QF7 A;  1X2N A;  3QPS A;  4JX6 A;  2E1O A;  4IEJ A;  4A3J J;  1GVD A;  5FKN A;  4M6V A;  1FJL A;  2DMN A;  1PUF A;  1IDZ A;  1QRY A;  3A03 A;  1MBK A;  2FX0 A;  1JKQ C;  3HOZ J;  1WCM J;  2EH3 A;  3OSF A;  2O8K A;  5IYD J;  3BTL A;  2K9Q A;  1ETV A;  3PO2 J;  1RET A;  2EBI A;  4DW6 A;  4D7N A;  4DYC A;  1MNM C;  2L7M P;  1A5J A;  2DA2 A;  2HOT A;  2MG4 A;  2Y9Y A;  4MO7 A;  3SJM A;  4IHY A;  2EQR A;  5K7H A;  3H0G J;  3HEF A;  2JN6 A;  3LSR A;  4X6A J;  2DA7 A;  5M3M J;  2M2E A;  2Y0S N;  5J1Y A;  1VFC A;  5C44 J;  4BY7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...