2GOMA

Crystal structure of efb-c from staphylococcus aureus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
61
structure length
61
Chain Sequence
IKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/toxin
molecule keywords Fibrinogen-binding protein
publication title A structural basis for complement inhibition by Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 25
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2gomA00
2WY8Q 2JVHA 3D5RC 3D5SC 2WY7Q 2NOJB 2JVGA 2GOXB 2GOMA
chains in the Genus database with same CATH superfamily
1HSTA 1ETVA 3GTPJ 4BJTA 5HLGA 2CV0A 4G6TB 4BEHB 2EV5A 2OC6A 3EQLF 3F9KA 1DQUA 1GLNA 3H9GA 1HOMA 1JJ6C 2DOAA 2CUFA 4HSRA 1BIBA 2DFEA 4I7HA 2LKXA 5L3CA 3KYLA 4ZDLA 1MNDA 4BXFA 3A0HC 4YIRX 4X0GA 5K1YA 4HZFA 4CHUA 3JRIA 3LA7A 1AKHA 4ENNA 2CSOA 4N9HA 4XBFA 1OYYA 2YX7A 1SANA 2PBIA 1ZKGA 3OIOA 2OTLI 2WAEA 1Z0XA 3TP3A 4NNJA 2MSYA 3J7AO 3W2AA 5K5QA 2IVMA 2PX9A 1ZRFA 3K2ZA 4E6KG 1JHFA 4CYCB 3LSGA 5CVUA 1WJAA 4S05A 3KP3A 2A68F 5ICEA 4BE0A 2KJBA 2IW5A 2VBXA 2A61A 2FA5A 2XDVA 4BL0B 4C3JJ 1ZREA 3VEPA 1B9NA 4A2UA 3BP8A 2BY3A 1FX7A 2WA0A 1ZRDA 4HX7A 4ZYHA 5BQTA 1H88C 3JTHA 1S72I 3Q3SA 3GF2A 1REPC 3CZ6A 5HDGA 3K1NA 1KQ0A 4EQQA 3EPZA 1IRGA 4FQGA 5GAHJ 2OZUA 3S32A 3GVAA 4M6XA 2ETHA 3E6BA 3I64A 2DMPA 2P5VA 3IRRA 3K70D 3S3OA 1UMQA 3R0AA 2IEKA 1FTZA 1T98A 5GAEJ 1LJ9A 3SZGA 3HOTA 4UY8I 3RKXA 1Z6RA 1QVUA 3WTUC 3WU0A 2V1XA 5L3FA 1EJ9A 4M74A 2V6EA 3E1SA 4OAYA 1IDYA 1Y39A 1ONVA 2XSJC 3G2BA 4A3BJ 4UVCA 4BUPA 4XLCA 3ZGKA 2GWRA 2OA4A 2JRMA 1U5TA 3P9CA 4A0XA 3P7NA 2JN6A 4XRFA 4EM2A 2OCEA 2RQQA 4ZDOA 2YU9J 3L7WA 5KK1A 3MQ0A 2ZJRF 4CA0A 1X3UA 2IGMA 4HDVA 3BWGA 3AG4H 1I5ZA 2OJED 5JHUA 2IS4A 4L9NA 3T1BA 4FE7A 3J7YJ 4KT6A 2DLLA 3IL2A 1WVRA 1YX3A 2Y9ZA 2DOEA 1TWFJ 5ERIA 2O8KA 3LQQA 2EV0A 4HSTA 5TJJA 5K5OA 5ILUA 4D7MA 2X0LA 2IGOA 3VDXA 2YSRA 4KN4X 4M6VA 2ELJA 4JX5A 3FF5A 4KA4A 2ESNA 5J3LA 2ZCWA 3GFMA 3LQRA 4LLGF 1QA6A 2HQAA 4QIWN 4JQFA 3ABTA 1WI9A 1UELB 3QP5A 2L2OA 3DPTA 4ZYEA 4UUTA 1MGTA 1RESA 2K3PA 1Y8QB 2LREA 3QPSA 2L7FP 4E7HA 2PMHA 2R5ZB 4CGZA 1KU3A 1TQPA 4BHPA 1Q1VA 2ZSIB 5HS8A 2VE9A 2FOKA 3O6BB 3NWSA 2OAZA 1T95A 3O2PE 1RI7A 2MG4A 5D5VB 2H94A 2JJ7A 3QODA 3BG3A 3IH3A 3WU2C 4RLQA 4UVAA 2O3FA 4P5OA 5HVQC 2L4AA 2XVCA 3A1YA 1N25A 3U21A 4XOTA 5J1UA 4C3IJ 3DF8A 2Z16A 1SMYF 4JK1X 2CFXA 5J4YA 3ZMVA 1W36C 4BBSJ 1J9IA 4I76A 1MBJA 1KA8A 2VASA 5FD6A 2KKOA 2DMTA 1FYLA 5FLVA 4DYRA 3I4PA 1R5HA 2AXLA 3TGNA 1F5TA 2HVRA 2M30A 1LKXA 2A3SA 1XCVA 4I99C 1IG7A 3TO6A 1SD6A 1MD0A 4QLCU 2L4MA 2VBYA 3L2VA 3RKQA 4A3JJ 3LAPA 1UCRA 4DBQA 3DXJF 3KZZA 5EDNA 1BR1A 2CUJA 2MABA 5B5EC 4MHGA 1X2NA 5DCMB 3U1DA 3V8LA 3JR9A 3H5RA 1UHSA 1OCTC 1YFHA 1NH3A 1K83J 1ZK8A 3IUOA 2MC3A 2YX4A 2JSCA 4XRSG 4G6DA 2DA6A 4II3A 1MW7A 1UJ8A 3H5AA 2JRTA 4JBAA 3O8GA 4M3EA 1XPXA 3EUKL 2E2JJ 4AWXB 1BW5A 4EMSA 1ERDA 4E7JA 4YFXF 3EDPA 3KP2A 2Z2SB 3JSPA 3MKWB 2MH9A 4MTEA 3BJ6A 3F72A 1NHAA 1G6NA 2X6YA 3TP0A 5E20A 5EG0A 3L2RA 2XPVA 1WRJA 3FXOA 3IC7A 2DT7B 2ZXHA 3JREA 2LF7A 1IC8A 3LSJA 2QM3A 1Z3XA 5FLXZ 4PSXA 1TWGJ 3B02A 1I27A 3K4KA 3RTRA 3VOEA 1YJWI 1AKHB 4BQAA 2ZXIA 4HV5A 1D0ZA 5L3BA 3G71I 1I1GA 2DCEA 3BPVA 2CW0F 1QVTA 2XKOA 2KDZA 1S5LC 4ASNA 3R60A 3QOEA 1A35A 4OIPF 2PJPA 2KIFA 4BH9A 1R5ID 4M73A 1DDNA 4A3MJ 3OYHA 5IP9J 2ZB9A 5H6RA 3RIRA 1FNNA 2LRDA 2M4KA 3GEZA 2ZMEA 4KJZA 2BXYA 2IA1A 4ZZDA 4EM1A 1R7JA 1V54H 2C6YA 2ELKA 5H2FC 1JXSA 4GYIA 5E18F 3B6CA 2M8EA 4YEJA 3GFJA 1A36A 1B4AA 1I39A 5LFAA 1QBJA 5HDNA 5F1RA 3PUFA 1ITYA 2QBYA 4E7ZA 3HM5A 1ON2A 2FBHA 2HGCA 4XLHA 1POGA 2DAOA 4CSWA 2F4IA 2QA4I 2VKHA 5LHGA 4HX8A 2QWWA 2XAQA 3WE2A 2RQPA 2MC4A 2WV1A 2NYXA 5D5XB 3F22A 2M5WA 1IUYA 4IOAF 1FZPB 9ANTA 3HGYA 3SDBA 4JX6A 2DA4A 1SFOJ 1XCBA 5IT3A 1MBFA 4W97A 1JKOC 4NBQA 3LWFA 2QF7A 1VNDA 4RAYA 2FUG2 4HNVA 4A3CJ 2LY9A 4BXUA 3AFHA 3M8JA 2K86A 2HQNA 1UFMA 2K4BA 4A12A 4FASD 3TW7A 3KEOA 3HJEA 3RZDJ 3WTVC 2A5WA 3OL3A 4ON0A 5L3GA 2BVMA 5HNHA 1T33A 2L54A 5F0HA 3AL0C 3C7JA 1KU9A 2E5NA 2FEZA 2JSPA 2E1MC 5CVIA 4JX4A 4S0HB 1W36D 2PMUA 1BBYA 2J5PA 4MEYF 3BR1A 5A2QZ 2I8DA 1U0JA 1UG0A 1KZHA 2JZYA 4B43A 2NS0A 1VQKI 4XLPF 2L5QA 5FLMJ 4RAFA 5J8FA 3S2DJ 5CVJA 5DUIA 3KLOA 2E7XA 2DFIA 2IXSA 3I5UA 4LMYA 2V9KA 5IT9Z 2L0KA 4PZJA 4AIJA 2R7FA 2KRFA 3M07A 2PEXA 3GFIA 1PP7U 3HSEA 5HOOA 4LG0A 4Q48A 5DTDA 3IHUA 2O03A 3RPUA 2BZTA 3BR3A 4IQ4A 4XKWA 3MMYB 2AQFA 4CCNA 2FBKA 2XAGA 1U6GA 3PNVA 1WJEA 4LK1F 4Z6YA 2ZJQF 4R8HA 4J19A 3GTGJ 3BQZA 3KIOA 2B63J 4RDUA 1O3QA 1E3OC 2DTRA 2CV2A 2F5FA 3BTIA 3WGHA 3A02A 2HU9A 2ZJ2A 2HVSA 4Q47A 3BY6A 2Y0SN 3LMMA 2MBFA 3KP7A 2FX0A 3R61A 1RETA 1JI8A 1N75A 2E1NA 3L00A 3BC8A 2KRHA 4F7ZA 5BOXA 1Y1WJ 1K4SA 3IH2A 4AIDA 1O57A 4ABZA 3ZMSA 4E70A 3ZOBA 1TW2A 2M7BA 3QYBA 2CW7A 3ZMTA 4AU7A 4UNOA 2UUZA 1WJBA 1JUPA 1JKPC 3GUDA 2B7EA 5DM7F 3HHHA 1L0OC 1V5FA 3C1DA 3MWMA 4YG2F 4HF1A 3DCFA 1FEXA 2W24A 2IS6A 1VQMI 4KMUX 1ZG3A 3CC4I 2LTPA 2VQGA 4UB6C 2KIMA 1S9HA 2IGNA 1HDDC 4XONA 3TDUC 1T38A 2XAFA 1MKMA 2XPWA 3TW6A 2V26A 3ZQQA 2Z33A 4OINF 3ZP5A 1E17A 1B8IB 2EBIA 5DD8A 4OIOF 3DBRB 3MCZA 2OF7A 3F8NA 3W2VA 5JVGF 3ECHA 1SAUA 1V3FA 2DDAA 3L09A 1BIAA 3LSIA 3GZNB 1ETOA 2QSGX 4RA2A 2GA1A 2OUMA 1MNMC 2Y2ZA 4XR6A 4A3FJ 2ISYA 3M7GA 3JRAA 3H9QA 5EG0B 2XRNA 4MO7A 2OQRA 3C18A 3FXKA 3BG6A 2CWEA 4NQWA 3TOAA 4FTHA 2DYRH 1X3ZB 1UG2A 4O5VA 2O8XA 2DA7A 2BW3B 4ZYDA 1VQOI 3PO2J 5CPRB 1BR4A 2WB1A 4J01A 2ID6A 4MQ9F 3RQ4A 1LE8A 4L0YB 1R23A 1HW5A 4L5IA 1RKWA 2I10A 2IA2A 2VT2A 2O5RA 1FOXA 3AL0B 1EA3A 2IAIA 1V4RA 3COAC 2E1MB 1X2MA 5FKLA 3RZOJ 3OYDA 3OS0A 1PVEA 2F5CA 2E5ZA 1HW2A 1YTYA 1EF4A 4FISA 4UVBA 1D1AA 1J0RA 5EEGA 2OBPA 1T08B 1MBKA 4QSHA 2DPDA 2EH3A 3ESWB 3OYAA 4IHVA 2KMUA 2ZMEB 3CP2A 2G9WA 3I9V2 1R49A 2K5CA 3DKWA 1W4MA 2LSOA 5C4JJ 5FKNA 5BMZA 4XN0A 3SQNA 1X1DA 4L0ZB 2DQRA 2P0WA 2PG4A 4G6QA 3QRFF 2L9RA 2HDDA 3I54A 3E0JB 2A05A 1LPQA 1AOYA 5J1RA 3EUHA 2RKHA 3H3UA 2MLGA 4OIRF 4RAZA 4Y7NJ 3NRVA 4L9VA 2JA5J 5E17F 1Y56A 2IP2A 3VYUB 1B6AA 1S7AA 5B66C 3CCEI 1XC5A 3E5UA 1R5GA 2LP0A 4PGGA 4UUSA 1FSEA 2WY7Q 3OS1A 3WGGA 2BBYA 4AD9A 2AXTC 1JUMA 3M1EA 1K79A 2B0LA 5FRMA 4KICA 2L7MP 3GTJJ 5HODA 1OJLA 2EFWA 1ZQ3P 2Z1DA 3GTQJ 2DW4A 1XGOA 2IBDA 2W4SA 3F8BA 3HRSA 5H6QA 3T5XA 3KFWX 4D5CA 3AKZA 2VUMJ 3DV8A 3HUGA 4F92B 3G73A 1LVKA 2L02A 4AYBN 5C44J 4G7OF 1WKMA 2M2EA 2MD5A 2HDWA 2K9SA 3E97A 1SVLA 2M87A 1HQCA 2NVYJ 3E6MA 4MFEA 3E5XA 1LDDA 5AIQA 3TQNA 3BQYA 5EEAA 4DZPA 3I59B 4LLNA 2JUCA 4BNCA 3NAUA 1XTAA 2LBFB 1XSDA 1R22A 1MBEA 2KISA 3GMEA 4H4KC 3ABMH 2F48A 2KDOA 3B6AA 2E7WA 3HKZN 3LL7A 1EH8A 1FY7A 1K6YA 4XKCA 2E34A 1MMNA 1IXSB 5K7ZA 1KQ9A 1TQIA 1PUFB 2R7OA 4HNUA 2HI3A 1QPIA 2CYYA 1VQ6I 3OSFA 1P7IA 1XDUA 3IAS2 4CCOA 3SEZA 3DQVC 1Z9CA 3OYNA 5HLIA 5E1WA 5EJCA 2VODA 3TL4X 1U9OA 3S8PA 1JT0A 3HB9A 2G7HA 1TT5B 2EZIA 4H0EA 1T0FA 3FZVA 4RGRA 3DEEA 2TCTA 4YIIA 5C4XJ 2W48A 4N9IA 3JRBA 4A5NA 1JTYA 1G8XA 4N0BA 3RYPA 3OYJA 2Q2EA 5LGUA 5BPDA 1R71A 3F8FA 4EJUA 2FQ3A 1LDJA 3S1RJ 4CCKA 3BR5A 4UB8C 4XICA 3V7RA 3E6CC 4YFKF 4LG0B 4D5FA 2V6CA 3QYEA 4WF2A 3J81K 3QAHA 2IA0A 3BR6A 1S8NA 1RR8C 2KP6A 3OIPA 3H3VK 3BCBA 3WTSC 2K40A 1V5EA 1HBXG 1QHHD 2CS3A 1MDMA 5ILVA 3GO5A 4A69C 1BM9A 1G3SA 2EFNA 1D5VA 2UZKA 4LITA 2ME0A 4B3AA 3FBNB 2QENA 1GXQA 4BHBA 3PSFA 2QCOA 3CLQA 3L2WA 4XN3A 2KJCA 1WWXA 2VC1A 5TGTA 4PJNA 2K9QA 2BV6A 2P6SA 2IS1A 4G9YA 2NOGA 3M8FA 3G1LA 2BHYA 4M9ZA 4WXCA 2RNGA 2FD5A 2CUZA 1ETXA 2DYSH 1SFKA 3PQJA 1OKRA 5J47A 1A6QA 5F04A 2RDPA 4CZZA 1GDTA 4IOCF 4CDGA 1FTTA 1SFEA 2HKOA 3IH4A 4XKBA 3K4JA 2KPMA 1DGRM 4PDKA 5F64A 2UWMA 1KYZA 3FXUA 3SXYA 5FFZA 1R6RA 1USSA 3ZR8X 5F0CA 1FYKA 3VWBA 2W82A 3HL2A 3RPQA 5L3DA 2MYSA 3R6SA 2HXOA 4PJ0C 3CD6I 1FMWA 2O0YA 3PNYA 5AIPA 4UUVA 2F5DA 3S1MJ 1W7PA 1G2HA 2R4GA 2R7RA 1KGSA 3CCYA 1WJ5A 2ZC2A 2X6WA 2GBYA 2VONA 1KU2A 2VQLA 2H8WA 2R7XA 2W7NA 3WG7H 1ZLKA 5LHIA 1PYVA 2WAQA 1ZR4A 5F1JA 4NQWB 2M8GX 2XKPA 2YPRA 4ESFA 3S3MA 2FOWA 2HOEA 4HX4A 4IVNA 3U1KA 3ULQB 2HQ5A 1Z7LA 5CKTA 1FT9A 4XLFA 5K5RA 3RCOA 3QP6A 4O6JA 5HS9A 4V2GA 1LE8B 4II2A 5DS9A 2QSFX 5BNGA 2DT6A 5D4RA 3BZCA 3QPLA 5J8CA 1QQIA 2LY2A 3CC2I 2ECBA 5E3NA 3A01A 1HA8A 1MBGA 3HTSB 2F4MB 4CCMA 4X1EA 1LFUP 1H0MA 1K78A 5JLWA 4FCYA 2BEOA 4LIUA 4HV6A 2JMWA 2BYVE 1DPRA 1G3YA 3S1QJ 3CMYA 3RKWA 5FD5A 2YR2A 2EZKA 4PSWA 1BL0A 2CRGA 4FX0A 2Z9OA 1GV5A 1V5GA 5DEQA 3HOZJ 2H6BA 4S04A 3VYRB 2HZTA 2VIXA 5LRRA 1GV2A 3PM1A 1HW1A 1YE9A 2DODA 5IOYA 5IOZA 4AIKA 5F08A 3HPGA 1GUUA 2EFQA 2Z3YA 2KZVA 2JPBA 2LY1A 4PJLA 4AIHA 4QTRA 4M3BA 1YLFA 2LR8A 4ZZLA 1TZLA 3DWLE 2JPCA 2M3AA 1B72A 2KL4A 1IUFA 3ZRGA 4IX7A 3PIPF 2V9PA 4N4NB 1IXCA 2OCCH 3TOBA 2NRAC 5LBQA 4UUSB 1IF1A 2GM4A 2XV4S 4R79A 1YITI 2R7QA 2X1DA 3E7LA 3JAMZ 3SFIA 4ENKA 2R7WA 3K9TA 3AG3H 3N05A 4BYYA 3K1PA 1P92A 1IGNA 4HDUA 2GXAA 2KRCA 4LFUA 3BR0A 3HUGB 3FXRA 1AWCA 1SFUA 4KYWA 3WTWC 3SJMA 3KZYA 3ZQCA 2P81A 2GIZA 1F9NA 3FISA 2DA5A 2RGVA 3A0BC 3R0JA 2EILH 2J5OA 3ZN1A 3K7AJ 1OQYA 1KONA 5GP9A 3BLYA 1PP8F 3DP7A 4TV7A 5EEHA 2EZLA 1ZARA 3CCLI 4Z2YA 3CTAA 2VL8A 1YO5C 1U5TC 1WPKA 2DOFA 2PLYA 3DFGA 5EGOA 1BJAA 5LEKA 1DPUA 4XLAA 4V2FA 2QVOA 3OYLA 1SC7A 2Y75A 4CO8A 2BXZA 1F43A 3GBGA 1TC3C 1WCMJ 1R4MB 1R36A 2W84A 3GW2A 3OOPA 4BY7J 4A3GJ 3E3VA 2ME6A 1MSEC 2R92J 4LLLA 2V1UA 3VB2A 1YG2A 4KITB 2GLOA 1VFCA 5CLSA 4IF4A 4ITVA 3HYIA 3G4SI 2XC7A 3V7CA 4C30A 1K4TA 2R5YB 5L3EA 2DMUA 2N8GA 3KX2A 1BI3A 3KLNA 4HPQA 1OYIA 3WTZA 3GCMA 2Q2EB 5KVRA 5F0FA 2ZO4A 2HKXA 4KIGA 3U2RA 1MMSA 2IRFG 2NVQJ 2ZJPF 3FIWA 4GXOA 3TMOA 3F23A 1ZRCA 2KZGA 3ZQHA 4ZH4F 2LKSA 5E8IA 5LEJA 1T56A 4E7KA 1D0XA 1G3TA 1MMDA 3VYTB 3JRFA 2VPRA 3CCUI 4V19K 4C9YA 3ABLH 1YHQI 3KP6A 2XGXA 2ICWG 1XB4A 1X1BA 5EZHA 3CQZJ 1I6HJ 2HFHA 2HS5A 2FMLA 3LOCA 4P9UA 2LNBA 2R7SA 3K69A 3K6GA 2DBBA 3PSIA 4I98B 2F5EA 3CUQA 4IJAA 2ISZA 4HG2A 1F1ZA 3S17J 1W5SA 3WODF 3VFZA 1MBHA 1JGSA 2A6TA 5KHDA 1EH6A 2VBZA 1XMKA 5E3MA 3BT9A 4N4OB 3T0YA 1YIOA 1Z6TA 2LLKA 4FETA 1ZAOA 1U8RA 2BE5F 3VSLA 1USTA 2VJIA 5IPAA 1J75A 3HPHA 2L01A 1TW3A 3K4LA 5JVTA 4U0YA 5JLXA 4BDYA 2ZNYA 4F52A 1R4NB 3KP4A 4Y17A 2A6HF 5IYBJ 2WY8Q 5ED4A 2DTZA 3OYBA 2WC2A 3L9FA 1D8KA 2DA3A 4M71A 4CYDA 2DK5A 4HBLA 2I5UA 4HA8A 2LG4A 1BA5A 3K4BA 2FJ1A 1RZ4A 1WJFA 1ZELA 4NC8A 2AQEA 4EJOA 4G12A 3C2BA 4YELA 2NVXJ 2V4JC 3FBIB 5DUKA 1O7FA 3ASNH 3GLXA 2XB0X 4EM0B 2LK2A 2EJRA 1FP1D 3DTKA 2HOSA 3DTEA 2VOPA 4OMZA 3S15J 5CVVA 1U5TB 2K85A 3WTYC 5D8LB 2V1NA 1ZLJA 4K2EA 3FXJA 3CMMA 4E4HA 3ISPA 4PJJA 4ENJA 3BPXA 5DYMA 3VYSB 4GRIA 2X51A 3S2WA 3LAJA 3A01B 3MZYA 4DBRA 2WTEA 1ZTRA 2YUSA 2BOLA 2BY0A 1UAAA 4IKFA 1NG7A 2KQRA 4KISA 2RC4A 2HYFA 2XAHA 3LSKA 2E36A 3FXLA 1XG1A 4LJZF 3K2AA 3SYTA 4C2MJ 3J81Z 4BQOA 2X1EA 4MQVA 4KN7X 4RMNA 4FX4A 2EIMH 3BOQA 1E0EA 3A03A 3K0LA 4RGSA 4U88A 3ZN0A 4ESBA 5CJ9A 4ZJZA 3BTLA 2PMZA 3E5QA 3O8HA 3HRMA 2RREA 4HEA2 2ZMEC 2LDUA 3MD2A 1NG6A 2ECCA 2XSDC 2JUGA 3ERMA 1XN7A 4BDZA 4PFOA 3HSFA 1R58A 1P4XA 3J80K 5KAIC 3FHZA 2OQGA 1B72B 1KYWA 2HOAA 5E8GA 3RJPA 1BI2A 1HLVA 4LK0F 2JA2A 2D2WA 3ZPLA 2JQ7A 1IXRC 3GZ5A 4E7IA 3KYDB 2CUEA 4XORA 2COMA 3J7AY 1SMTA 5EF6A 1YS7A 2OV7A 1GXPA 1R00A 2FU4A 4EGYA 2A6EF 2Y31A 5HS7A 4AC0A 1BC7C 2EPFA 1EKEA 1LQ1A 1SAXA 1QRYA 2K02A 4KUMA 4HRIA 2WADA 2ZSHB 3FWEA 3Q0WA 3CC7I 1S29A 2K3FA 4I0AA 2CQ7A 4D1QA 2E60A 4DZJA 5LHHA 2STTA 3HC7A 4BEHA 2EA4A 1ORKA 3A4CA 1ZYRF 3RQIA 2A69F 4GFBA 2M45A 3G6EI 4W1UA 4MTDA 3BZ6A 1S7EA 2XIGA 4Y3OA 3CCRI 3OSGA 5ICFA 5HLTA 2UV1A 2ZFWA 1VQ7I 2BGCA 3ZQLA 2CJJA 4U7DA 2CU7A 2K27A 4KIFA 3JW4A 4EJVA 2EB7A 3LFUA 5EGOB 1LDKB 2PN6A 3LNQA 2XGEA 1TNTA 1RNLA 2H27A 3EETA 1XSXA 3HOYJ 1WZ2A 2E1OA 1HKSA 1ETKA 1EV7A 1FOYA 1D0YA 3CDLA 2D45A 1VI0A 1B9MA 3H0DA 1K7AA 1ZGJA 3TKYA 3KEYA 1O3SA 3ROUA 1QPMA 2DFFA 3V42A 2HWVA 3OYEA 1VQ8I 4YFNF 4RB3C 3OYFA 4IHTA 1OLTA 2EZHA 2MLKA 3ZCOA 3UNGC 3L2UA 1R9TJ 4JYKA 1P9QC 4Q4ZF 2G0EA 3HDDA 1TBXA 4PGHA 4DIQA 1S6LA 3CCQI 3BR2A 2XASA 1BI1A 3ZQFA 4L9TA 4IZZA 1I50J 2FRHA 4UHTA 2VT3A 3HOUJ 3AAFA 3TBIA 4GDFA 3F8CA 2FF4A 4OWRB 3CCMI 2Q1ZB 5IYCJ 3RKYA 2H1LA 3P9IA 3QU3A 4Y4RA 3HZJA 4NB5A 3QYFA 2LH9A 4IRIA 5D4SA 1OMIA 3X2QH 2O6GE 1HKTA 3JRDA 2DT5A 1QZEA 2Z5UA 3CESA 4Q5SF 1IN5A 2OTJI 1X58A 2MH2A 3BCAA 2XUBA 1I3QJ 3FXMA 4M3FA 1ON1A 2X6OA 4IQJA 2EIKH 2OZ6A 1HDPA 4CCLA 3WTTC 2R7ZJ 2EWNA 2GOMA 3CDHA 3QOPA 2IPQX 4KT5C 3P9KA 6PAXA 3CUQB 3KP5A 3OS2A 3HEFA 2XROA 1ZN2A 4HOBA 1MMAA 2DA2A 4L5EA 1X4PA 5D6FA 3U9GA 2KIUA 4EGZA 3GX4X 1BI0A 2QQ8A 5E1XA 1W0UA 5TRDA 1LEBA 3TEDA 1P6RA 2CW8A 2E19A 1SD7A 2M4GA 3H0GJ 4BE2A 4HW0A 2VJ4A 2DU9A 2XF5A 3MKLA 1Z05A 3KE2A 1IRFA 2XHKA 3N97A 1LFPA 2HYGD 4A3KJ 2JVHA 2W57A 3WE3A 1LVAA 2OU2A 2QBYB 2XF6A 1YJ9I 1Y8RB 1F4KA 3S3NA 3ABKH 2VBWA 1O4XA 3F0CA 2D1HA 1JTXA 3F21A 3QPTA 1S7OA 3I4NJ 5DDGA 4ESJA 5D5WB 2GA2A 4JOMA 2Y9YA 4BQNA 3FM3A 4IHXA 3CJNA 2R7DA 3MAJA 4B48A 1A5JA 4MIMA 3D5SC 2O7OA 1H9TA 2DDBA 3MKZA 5CYVA 2EINH 1X1AA 3IKVA 1VZ0A 1IRZA 1QHGA 1E3PA 4BBRJ 4B47A 4IHYA 4D9JA 5F6FA 2EFOA 1JT6A 2OPTA 3OOUA 2O9LA 2X48A 2VOOA 2P5KA 2W85A 3BJAA 4A93J 2HZDA 3ZMZA 4P9FA 1STZA 3KCCA 3K4CA 1H8AC 4B3XA 1TQMA 1NK2P 3OMYA 4GCVA 4HYEA 5LD2C 1JJ8C 1XX5A 4D0PA 2H8RA 1Y0UA 5DV5A 5FFXA 4A6EA 2A07F 2HVQA 2F2EA 3DEUA 2E35A 4CH7A 4RGUA 2L9NA 3REOA 4B1RA 1X3WB 2NS7A 3TO9A 1F36A 3NWTA 1TWAJ 1YYVA 2W00A 3H36A 4RB2C 2DMQA 3V8JA 3K10A 3OR2C 3PFYA 5GAGJ 1YIJI 2GAUA 1CF7A 3F8MA 1LB2A 2CFOA 3EUAA 3WTXC 2DJIA 1Y6IA 1QO0D 4CUGA 1FPQA 1BN5A 3VPRA 1ENHA 1R1UA 2EIJH 5FRNA 3EUHC 3SZPA 3W6JB 3ZQ7A 2CQXA 1JE8A 1NTCA 1VQPI 4XIDA 4WX9A 2EFPA 4KMFA 2NNNA 4IXAA 4MGRA 2DO7A 3HIFA 5B1AH 2B9SA 2KLOA 2H1KA 1JHHA 1IRXA 5AONA 2JTVA 1J7KA 3D1NI 1YI2I 1N78A 1OCPA 2ADUA 4I2OA 3I4MJ 1VQ5I 1Z77A 2UXNA 5TISC 1AU7A 2Q8KA 3UR3C 5A2QK 4LD5A 1X1PA 1FBSA 1U2WA 5IYDJ 2R7VA 3H92A 1OFCX 1WGXA 3SZTA 2M9HA 4BS9A 3RPUD 3IKTA 3N4MA 2LKPA 2E2IJ 3M8EA 4F93B 4U0VA 2AHQA 5J6XA 4QPQA 4U0WA 1FYMA 3FKJA 1CGPA 2QQAA 4L9JA 5M5YJ 5IT9K 5LGNA 2R7UA 3I55I 2DI3A 2F6CA 4B44A 4EV0A 3LSTA 4M3DA 1MH4A 2VXZA 4KIBA 2UXXA 4XQFA 2H09A 3ML6A 3JRGA 1Y0NA 3ZMUA 5D6EA 1BC8C 2VPLA 2JWTA 2WB1N 5EZGA 3DKXA 2P7CB 3PIOF 2HR3A 4BQQA 3AG1H 1RRJA 4WXDA 4AM3A 1T0FC 3BJOA 4IRGA 1Z67A 3HRUA 3G1MA 4A0ZA 3MZ8A 4MFDA 1G59A 1BR2A 2LF8A 5FKMA 4I01A 1QZZA 1ZGAA 4XK4A 5ICGA 5CQGA 1BW6A 3NEUA 1FSHA 4IRHA 4EATA 4Y52J 2R7TA 4EJTA 1W5CC 1ETWA 2COBA 1FIPA 1GVJA 3J80Z 1TTYA 2QQBA 2WBMA 4B09A 1IN6A 1FP2A 3MVPA 2W25A 3HOXJ 4PUSA 3DU6A 4A3IJ 2V7FA 3RDIA 1JUSA 4RB0A 2HQRA 4DW6A 2JA6J 2KIQA 3CLOA 2V9VA 3GTMJ 4NC6A 2K7LA 2DMNA 2LC2A 4XLEA 5HLHA 4XM3A 1VTNC 1P2FA 2P7VB 4O3MA 5DM6F 1Z3YA 3DU5A 3M3YJ 1XDSA 3S2HJ 3HGGA 4L18B 3SEQA 1RC9A 4XRMA 4KDPA 2DK8A 3EYYA 1P4WA 3M4OJ 1ETYA 4U7BA 4BY1J 2NAZA 4BU2A 1WHUA 2XB5A 1QNTA 3ELKA 1IJWC 1X1CA 1MJ9A 5ILSA 4DJAA 1AHDP 3AG2H 2X85A 3FKIJ 1U8BA 1MMGA 3W6KB 5C3EJ 1QGPA 4QPOA 5JI6A 1DGWY 4BKXA 3I0TA 2NXNB 2X6XA 2FBIA 3KYCB 3BTJA 3BG9A 1W0TA 4HLYA 4M9SA 2EV6A 2XPUA 4RB1A 2GOXB 1TWCJ 2CG4A 4CCJA 5EYRA 3KEQA 5FGMA 5BPIA 5KCMA 1OCRH 1WQ2A 3WHCA 1A04A 4IL6C 3VODA 1TNSA 1XMXA 3UKGA 1P7JA 1GHCA 1SD4A 3KETA 1IN7A 3JRHA 2MD0A 4XKVA 2PFBA 4DNCA 1ZH5A 4NC7A 5IP7J 3VSKA 3W2WA 2JA8J 1XD7A 3GZ6A 3Q9VA 4XSXF 2WWYA 2JVGA 1W5TA 1HKQA 2DJNA 4UV9A 4LIVA 2LD5A 3DEWA 2EQRA 3F6VA 3OWTA 2AS5F 1T2KA 1S3JA 2VN2A 2DQLA 5D5UB 1U78A 3QU6A 2NOJB 4BACA 4IO9F 5CVRA 5FROA 1E2XA 4M3GA 2L9VA 2K9LA 4HF0A 2ZKZA 4BGDA 4WXHA 3CCVI 1OCCH 2HXIA 2HNHA 3MEXA 4RAGA 2ID3A 2XRLA 4ZDPA 3ERED 3JSOA 5E79C 3M9AA 4OU0A 2RNJA 4ZC3A 1RUNA 3BG5A 1IW7F 2DPUA 2PJRA 4LB5A 2KT0A 5GPCA 1YW8A 2Y0SA 3L2QA 3HHGA 2VXDA 2X4HA 3JRCA 2RVCA 4EVIA 1DU6A 2A5YB 2FSWA 2WV0A 2QLZA 2XGCA 4E7SA 4HF2A 2V79A 1VF9A 3DKYA 1CF7B 4BJ5C 2FNPA 3CDIA 5M5WJ 1C0WA 1GVDA 2CQKA 2Y48A 5GADJ 5FJ8J 3GTOJ 2GIVA 1CQTA 3LA2A 3OY9A 4HNTA 2P6TA 5B3SH 2K9MA 3Q0UA 2R0QC 1B8IA 5J4VA 2P5LC 2ACJA 5CQEA 2STWA 1R1TA 2DFHA 2R93J 4XL9A 5KNLA 1GT0C 4ZYAA 2QUFA 4FHTA 1MDMB 3FXQA 2EK5A 4G7ZF 4G8XA 5IY5H 3OR1C 2QQ9A 3F6OA 4YRVA 1IO2A 1YQAA 3ZQGA 2LVSA 4HLXA 5FKKA 3HSRA 2QEXI 4A3LJ 1I1SA 3BZKA 2DA1A 4UV8A 2VI6A 2HDCA 4J00A 2BW3A 4G94A 5H20A 3FM5A 2E1CA 3PJRA 5GPAA 3D5LA 1TT0A 4Y13A 3Q5FA 3DPLC 3MFKA 4GGGA 3C2HA 3LA3A 1FJLA 3K4NA 1XS9A 3MN2A 1MJAA 3ZXSA 2VB6A 3H3ZA 2QKLB 3L1PA 5B1BH 1OCZH 2JT1A 3HOWJ 1LEAA 3HOSA 5DD4A 2MW8A 1ACIA 2M1BA 4I6ZA 2YU3A 1IN8A 2CQNA 2FE3A 3KZIC 2FXAA 3S16J 1YX5A 2QYOA 2WAFA 2ZXJA 2DXIA 2V1DA 3I3LA 3OV8A 1D8JA 3K1MA 4I02A 2XAUA 4PK4A 4XOPA 2WAQN 3GTKJ 2QSHX 4IHSA 3GLLA 1YW9A 3IWFA 5K7FA 2VQHA 3ASOH 1DP3A 1OCOH 1SFXA 1W7PB 3S93A 3DPUA 2MA3A 3FMRA 1X4OA 1TP4A 3J7ZI 4Y33A 3FX3A 4DYQA 2VE8A 3PFIA 3CF5F 3LSPA 1XMAA 3F3XA 3FK7A 3LFKA 5JHFA 1FC3A 2XAJA 2HPMA 4OIQF 4AVPA 4EJWA 1H9GA 2JA7J 4RM3A 2HPIA 2FNAA 1ZR2A 1YRNA 1WI3A 1O3RA 2VJ5A 1FMVA 2NS8A 1A6IA 5D8KB 1TLHB 2QGUA 3SDGA 1UHMA 3H1CA 2M0CA 3CMEI 3ZMDA 2X9DA 4PCQA 4NHJA 2Y30A 3HXLA 2ZFUA 1W7PD 2OD5A 1JKQC 1V55H 3TO7A 1K78B 2L7KA 3T8TA 2HEOA 4CICA 2W1OA 3QWLA 4M72A 3I59A 2CO5A 1WJDA 1WFXA 1U9NA 2M7AA 4LOCA 5LLQA 1FBQA 5JFRA 4LG3A 2QKMB 1XSVA 2LBFA 4BJ6C 2GXGA 4AYBA 3OYMA 4C2UA 2L7ZA 3R4KA 1Y1VJ 3ONQA 4IEJA 4Y15A 3OYGA 3CUQC 1J2XA 1ZGWA 1T8IA 1SD5A 4RGXA 3HTUA 5GTHC 1WSUA 1T39A 3K4MA 5GTIC 2CGPA 2M34A 2PI0A 2H6CA 3GXOA 1FIAA 3SFZA 3B73A 1PUFA 2ZNZA 2LFBA 4UXNA 3TDZC 5FKOA 3BROA 1QZYA 3WU1B 2R3SA 2Q0OA 2EA2A 3CF2A 3LSHA 1I6XA 5F27A 4EEFG 3I56I 3CO6C 2ESHA 2BVLA 1N77A 3HKZA 2LOOA 1LNWA 3KPHA 4KFCA 3V4GA 3PO3J 1Z1DA 2F4OB 3IV5A 1L3LA 1D5YA 3Q9SA 3HOVJ 1G4DA 1MJBA 1PJRA 2NVTJ 1MSFC 2D1VA 1VQLI 3CJTB 1PUEE 4L5JA 1BOBA 3FMQA 1J59A 4RM2A 1P4AA 5K7HA 2CQQA 1FLIA 5ICCA 1DP7P 2RAEA 3ZQIA 3ECOA 1TL8A 3IP4B 3GTLJ 1DUXC 2VQCA 3MZHA 2GZWA 2Y69H 1HF0A 1YS6A 4F91B 2IGKA 3GYHX 2JK3A 3C2GA 1B1BA 3E6DA 3RSNA 2L3DA 5LGTA 3HBLA 3MKYB 1FOWA 2BY2A 4P96A 4D7NA 4XRSA 4ZTFA 5LRSA 1RR7A 2TDXA 1HSJA 1RKTA 4NUBA 2HOTA 1IV6A 1D3YA 2CV1A 3BDDA 3P5JA 3M1CA 3OYKA 2IJLA 4DYCA 4G7HF 1MNEA 4B8XA 4BXXJ 4ANJA 4CYCA 4HQEA 2PJRB 3WG9A 3JAMK 4IHWA 1BJZA 5HNFA 3IRQA 3DTIA 1AA7A 1A31A 3FK6A 1G3WA 4OAZA 5E3OA 4WK8F 4E7LA 3JTGA 1RPWA 3PNTA 1OISA 4X6AJ 1Z91A 4ETSA 1VQ9I 3I71A 4HAMA 3A2KA 3ABUA 4DOZA 1FBUA 2RV8A 3I58A 4P55A 1IN4A 1MZBA 3EYIA 5DCFA 2XF7A 2FQ4A 4WCGA 1O3TA 3HG9A 1IAWA 4M9XA 5IP6A 2GXBA 1M1EB 1YJNI 5M3FJ 4LB6B 1SEUA 1J09A 2ZXWH 3DLAA 4CZCA 1OR7A 1R1VA 3CCSI 3FDYA 3DBHB 4A3EJ 3CJQB 1PDNC 1B59A 1MH3A 1UZCA 2E71A 1WH7A 3H9JA 4FE4A 5J1YA 3DLLF 1RIOH 1RUOA 3IWZA 1VQ4I 3V7SA 1WH5A 2F5VA 1NK3P 4MEXF 1E3HA 4DGWB 2AO9A 2X1CA 1YOVB 3NQOA 4JP0A 2TRTA 4OMYA 2P4WA 4ENMA 1ULYA 3S1NJ 1OPCA 1FWZA 3W3CA 4XNFA 4F55A 4A5MA 5FO5A 1U3EM 1IZ1A 2LYCA 2KHMA 1Z21A 4RS8A 2DN0A 4A3DJ 1HCRA 1YW7A 4DQ2A 2VC0A 3W6VA 1KU7A 4KNYA 4I09A 2E2HJ 4C3HJ 4C2TA 1ETQA 5KAFC 4RBOA 2XGDA 1BOAA 1JGGA 3O3KA 1Q1HA 1IV8A 1T6SA 3BTCA 3GFLA 1O7LA 5E1ZB 3LSRA 1LFBA 3RYRA 3OYIA 1JKRC 1SVMA 2MGQA 3OIQA 1K6OA 1X19A 2L9SA 4F3QA 1XGMA 1FOKA 3Q0VA 2ELHA 3K70C 4M6YA 5FLXK 2YS9A 3IAM2 2VJJA 3GWZA 3RI4A 4A6DA 4MNUA 2VKDA 4PFPA 2ZBKA 2GQQA 2NNYA 3NARA 4U87A 1MIJA 4MLOA 1UHWA 3HRTA 2O61A 4XMYA 1EH7A 3CUOA 3FMSA 3DBLB 3D5RC 1ZHFA 3FHNA 2D5VA 4XSZF 2R5ZA 5M3MJ 3OYCA 3PQKA 3QQAA 3OL4A 4GYGA 1D1CA 5M5XJ 4BHCA 1YRNB 1ODDA 3WHBA 2LMDA 1TWHJ 3PUBA 3WGIA 1J5YA 2BY1A 3CMAI 3CO7C 2PQ8A 2NVUB 2Y0MA 4PJMA 5HDKA 2VKEA 2HTSA 4RLFA 3S14J 4XLNF 3CJRB 2CMPA 3QPHA 3V8KA 1OR7C 5E3LA 1H89C 1WJCA 1HC8A 2VLAA 1KQ8A 4GO1A 2VKVA 2QZ8A 2PMZN 3T8RA 1VQNI 3G1OA 3H5NA 1I3AA 3I53A 2Z99A 2G7UA 1DU0A 2MFZA 4NDLA 3JCUC 4FT8A 4B4CA 1SVOA 2RN7A 4AVZA 1ZG1A 4AUXA 4A0YA 2K4JA 4WWCA 4QWQA 4BAYA 1IDZA 4LGWA 3PL8A 4OOIA 3H35A 4ZTJA 1APLC 3C3WA 4YIFA 1W1WE 5JR3A 3BG7A 3G3ZA 3CCJI 5DCMA 1K61A 2BHZA 2M0MA 2IS2A 1XGNA 1HXDA 2HTJA 2HYJA 4HQMA 4ZYGA 5FB2A 5J40A 3CP8A 4BE1A 2K9NA 1D1BA 1QU3A 2IT0A 3D0SA 1UB9A 4R1HA 1XGSA 1Z7UA 3LSMA 4I0BA 1OYWA 2P8TA 4P1WA 2R5YA 2FMYA 1LUJB 3L2CA 5BS6A 2CH0A 4CXFA 4IPAA 2KFDA 3SHFA 1ZG5A
chains in the Genus database with same CATH topology
5KCMA 4BJTA 3BG6A 2CV0A 4G6TB 4BEHB 3DTKA 3DTEA 2OC6A 3F9KA 1DQUA 1GLNA 3H9GA 2DOAA 4HSRA 2BW3B 3KYLA 5CPRB 2MD0A 4XKVA 1BR4A 4ZDLA 1MNDA 2WB1A 4NC7A 4BXFA 4J01A 3RQ4A 3VSKA 3W2WA 4X0GA 2V1NA 3CMMA 2JVGA 4E4HA 4PJJA 4LIVA 3OWTA 2O5RA 3VYSB 1EA3A 2X51A 4GRIA 3AL0B 4DBRA 2NOJB 2E1MB 4BACA 2BOLA 4IKFA 3OYDA 3OS0A 1UAAA 1NG7A 2KQRA 2WAEA 2E5ZA 4KISA 5FROA 3LSKA 2K9LA 4BGDA 4NNJA 3SYTA 2HNHA 1D1AA 4BQOA 4ZDPA 2X1EA 4RMNA 3W2AA 1E0EA 4ZC3A 3OYAA 2KMUA 4E6KG 3CP2A 2PJRA 3I9V2 3LSGA 1WJAA 2K5CA 2Y0SA 4ZJZA 3L2QA 2PMZA 4XN0A 2VXDA 2RREA 4HEA2 4BE0A 3MD2A 1X1DA 4BL0B 2XDVA 1NG6A 2P0WA 4BDZA 2JUGA 4E7SA 4PFOA 3E0JB 3DKYA 4BJ5C 2WA0A 2JA2A 3OY9A 1Y56A 4HNTA 3VYUB 2K9MA 4E7IA 4XORA 5CQEA 3OS1A 2WY7Q 3J7AY 3CZ6A 4XL9A 5KNLA 2OV7A 3EPZA 5FRMA 4ZYAA 3S32A 3K70D 3S3OA 2Z1DA 2W4SA 3AKZA 4F92B 3OR1C 4HRIA 1LVKA 2WADA 2ZSHB 3SZGA 3HOTA 4YRVA 2HDWA 4D1QA 2E60A 2V6EA 3E1SA 4OAYA 3HC7A 4BEHA 2XSJC 3G2BA 4BUPA 4XLCA 3A4CA 4J00A 2BW3A 3ZGKA 3PJRA 3D5LA 1TT0A 2RQQA 3DPLC 4ZDOA 4Y3OA 2LBFB 3C2HA 3K4NA 2UV1A 5HLTA 4CA0A 2IGMA 4H4KC 3ZXSA 3LFUA 1LDKB 2VB6A 2QKLB 2KDOA 2IS4A 3LL7A 1K6YA 4XKCA 3HOSA 4KT6A 1MMNA 1YX3A 1D0YA 1YX5A 2R7OA 2WAFA 4HNUA 4HSTA 3H0DA 2DXIA 3I3LA 2IGOA 3KEYA 2XAUA 3VDXA 3IAS2 4CCOA 3SEZA 4PK4A 4XOPA 2ELJA 3V42A 3DQVC 3OYEA 3OYFA 3OYNA 2HQAA 1OLTA 2VQHA 1DP3A 3ZCOA 3TL4X 3S8PA 3UNGC 3L2UA 4JQFA 3S93A 3DPUA 1P9QC 1UELB 2L2OA 3DPTA 1X4OA 3DEEA 4Y33A 4DIQA 5JHFA 3OYJA 2HPMA 1G8XA 2K3PA 2LREA 4IZZA 4E7HA 4RM3A 4CCKA 2HPIA 2ZSIB 3TBIA 3QYEA 4OWRB 3NWSA 2Q1ZB 2VJ5A 1FMVA 1T95A 4Y4RA 2KP6A 3OIPA 3QYFA 2LH9A 3BCBA 1V5EA 1QHHD 2CS3A 3QODA 4RLQA 3CESA 4P5OA 5HVQC 3A1YA 3HXLA 3U21A 4XOTA 2ZFUA 4LITA 3BCAA 2L7KA 3FBNB 2Z16A 1W36C 2W1OA 4IQJA 3PSFA 4CCLA 3L2WA 4XN3A 2GOMA 2VASA 1WJDA 1WFXA 2M7AA 3OS2A 5TGTA 4PJNA 4LG3A 2QKMB 2HVRA 1MMAA 2LBFA 2IS1A 1X4PA 4BJ6C 4C2UA 4AYBA 3OYMA 1LKXA 3OYGA 3ONQA 2RNGA 2CUZA 1SFKA 2CW8A 3L2VA 3K4MA 4DBQA 2M4GA 4BE2A 1BR1A 2CUJA 2MABA 4XKBA 3K4JA 2VJ4A 2KPMA 1DGRM 2XF5A 2UWMA 1LFPA 3H5RA 3CF2A 1R6RA 3LSHA 3ZR8X 2JVHA 3VWBA 3IUOA 2W82A 2XF6A 2BVLA 3HL2A 1N77A 2MYSA 4II3A 1MW7A 2LOOA 3H5AA 3HKZA 3S3NA 1FMWA 3PNYA 3EUKL 2R4GA 1ERDA 2R7RA 4E7JA 1WJ5A 2X6WA 1PJRA 2Z2SB 3MKWB 2VQLA 4JOMA 2R7XA 2X6YA 4BQNA 2W7NA 1BOBA 4B48A 3L2RA 4RM2A 1PYVA 2WAQA 3D5SC 4NQWB 3MKZA 3S3MA 2DT7B 2ZXHA 3H9QA 1X1AA 1Z7LA 5CKTA 1Z3XA 1VZ0A 1QHGA 3IP4B 4XLFA 4B47A 4PSXA 3RCOA 4D9JA 2VQCA 3K4KA 4II2A 3RTRA 2DT6A 4F91B 2IGKA 2ZXIA 3OOUA 3C2GA 1D0ZA 2LY2A 3RSNA 2DCEA 1HA8A 3MKYB 2HZDA 4CCMA 3K4CA 4B3XA 3QOEA 3OMYA 4LIUA 4ZTFA 5LD2C 3OYHA 4NUBA 2HVQA 2CV1A 4PSWA 2LRDA 3M1CA 2M4KA 4CH7A 3OYKA 2L9NA 4KJZA 1MNEA 4ANJA 1V5GA 2PJRB 3NWTA 2W00A 2VIXA 3VYRB 5HNFA 1YE9A 3HPGA 3DTIA 1AA7A 3K10A 4OAZA 3OR2C 2KZVA 4E7LA 2LY1A 3PFYA 4PJLA 3PNTA 4YEJA 1TZLA 2CFOA 3DWLE 3EUAA 2M3AA 2DJIA 1Y6IA 4CUGA 5LFAA 3A2KA 2KL4A 3ZRGA 4DOZA 4IX7A 4N4NB 4E7ZA 2XF7A 4XLHA 4R79A 5FRNA 2R7QA 3HG9A 3EUHC 2X1DA 2R7WA 4CSWA 2F4IA 2VKHA 3N05A 1J09A 3DLAA 2MC4A 4CZCA 2KRCA 2KLOA 3FDYA 3HUGB 1IRXA 3CJQB 3H9JA 3SDBA 1N78A 2F5VA 4DGWB 2X1CA 1KONA 2FUG2 3BLYA 3UR3C 3W3CA 4XNFA 4F55A 3AFHA 2R7VA 3M8JA 2LYCA 2KHMA 2VL8A 1Z21A 4FASD 4BS9A 3RPUD 2A5WA 3OL3A 4C2TA 4XLAA 2BVMA 4F93B 3OYLA 5HNHA 3GBGA 3AL0C 4QPQA 3FKJA 2E5NA 2JSPA 2E1MC 1W36D 2R7UA 2F6CA 4B44A 3OYIA 3OIQA 2I8DA 1U0JA 2VXZA 1X19A 2L9SA 4F3QA 1UG0A 4KITB 4XQFA 4B43A 3K70C 3IAM2 2VJJA 4ITVA 2XC7A 4PFPA 2VKDA 4C30A 2VPLA 2L5QA 4U87A 3DKXA 3KX2A 4MLOA 4HPQA 2IXSA 2V9KA 4XMYA 4BQQA 2Q2EB 3FHNA 1T0FC 3D5RC 3OYCA 3OL4A 1D1CA 1BR2A 5HOOA 3TMOA 1G59A 3PUBA 4IQ4A 4XKWA 5CQGA 3MMYB 4PJMA 4EATA 1D0XA 2AQFA 4CCNA 4E7KA 1MMDA 3PNVA 1WJEA 3VYTB 2R7TA 4RLFA 3CJRB 2CMPA 4C9YA 2CV2A 2WBMA 1OR7C 2HU9A 2HVSA 1WJCA 1X1BA 2VLAA 3LMMA 1JI8A 1N75A 3H5NA 2R7SA 3K6GA 4PUSA 3BC8A 2KRHA 3DU6A 2V7FA 3PSIA 2MFZA 4HG2A 2M7BA 3QYBA 2CW7A 4AVZA 4AU7A 2UUZA 1WJBA 2LC2A 4XLEA 4XM3A 2A6TA 5KHDA 3PL8A 1V5FA 4N4OB 1Z3YA 3DU5A 3H35A 4ZTJA 4FETA 3SEQA 3VSLA 2VJIA 3BG7A 2IS6A 3HPHA 4BDYA 2VQGA 3K4LA 4U7BA 4BU2A 4F52A 1S9HA 2IGNA 4XONA 2IS2A 2M0MA 3ZQQA 1X1CA 2V26A 2WY8Q 3OYBA 4DJAA 3CP8A 4BE1A 3W2VA 1D1BA 1QU3A 2X85A 1MMGA 2LG4A 4QPOA 1SAUA 3LSMA 3K4BA 1WJFA 4P1WA 1DGWY 1ZELA 4NC8A 3LSIA 2X6XA 2CH0A 2AQEA 2OUMA 4YELA 4XR6A 2V4JC 2GOXB 4CCJA 3FBIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WY8 Q;  2JVH A;  3D5R C;  3D5S C;  2WY7 Q;  2NOJ B;  2JVG A;  2GOX B;  2GOM A; 
#chains in the Genus database with same CATH topology
 1HST A;  1ETV A;  3GTP J;  4BJT A;  5HLG A;  2CV0 A;  4G6T B;  4BEH B;  2EV5 A;  2OC6 A;  3EQL F;  3F9K A;  1DQU A;  1GLN A;  3H9G A;  1HOM A;  1JJ6 C;  2DOA A;  2CUF A;  4HSR A;  1BIB A;  2DFE A;  4I7H A;  2LKX A;  5L3C A;  3KYL A;  4ZDL A;  1MND A;  4BXF A;  3A0H C;  4YIR X;  4X0G A;  5K1Y A;  4HZF A;  4CHU A;  3JRI A;  3LA7 A;  1AKH A;  4ENN A;  2CSO A;  4N9H A;  4XBF A;  1OYY A;  2YX7 A;  1SAN A;  2PBI A;  1ZKG A;  3OIO A;  2OTL I;  2WAE A;  1Z0X A;  3TP3 A;  4NNJ A;  2MSY A;  3J7A O;  3W2A A;  5K5Q A;  2IVM A;  2PX9 A;  1ZRF A;  3K2Z A;  4E6K G;  1JHF A;  4CYC B;  3LSG A;  5CVU A;  1WJA A;  4S05 A;  3KP3 A;  2A68 F;  5ICE A;  4BE0 A;  2KJB A;  2IW5 A;  2VBX A;  2A61 A;  2FA5 A;  2XDV A;  4BL0 B;  4C3J J;  1ZRE A;  3VEP A;  1B9N A;  4A2U A;  3BP8 A;  2BY3 A;  1FX7 A;  2WA0 A;  1ZRD A;  4HX7 A;  4ZYH A;  5BQT A;  1H88 C;  3JTH A;  1S72 I;  3Q3S A;  3GF2 A;  1REP C;  3CZ6 A;  5HDG A;  3K1N A;  1KQ0 A;  4EQQ A;  3EPZ A;  1IRG A;  4FQG A;  5GAH J;  2OZU A;  3S32 A;  3GVA A;  4M6X A;  2ETH A;  3E6B A;  3I64 A;  2DMP A;  2P5V A;  3IRR A;  3K70 D;  3S3O A;  1UMQ A;  3R0A A;  2IEK A;  1FTZ A;  1T98 A;  5GAE J;  1LJ9 A;  3SZG A;  3HOT A;  4UY8 I;  3RKX A;  1Z6R A;  1QVU A;  3WTU C;  3WU0 A;  2V1X A;  5L3F A;  1EJ9 A;  4M74 A;  2V6E A;  3E1S A;  4OAY A;  1IDY A;  1Y39 A;  1ONV A;  2XSJ C;  3G2B A;  4A3B J;  4UVC A;  4BUP A;  4XLC A;  3ZGK A;  2GWR A;  2OA4 A;  2JRM A;  1U5T A;  3P9C A;  4A0X A;  3P7N A;  2JN6 A;  4XRF A;  4EM2 A;  2OCE A;  2RQQ A;  4ZDO A;  2YU9 J;  3L7W A;  5KK1 A;  3MQ0 A;  2ZJR F;  4CA0 A;  1X3U A;  2IGM A;  4HDV A;  3BWG A;  3AG4 H;  1I5Z A;  2OJE D;  5JHU A;  2IS4 A;  4L9N A;  3T1B A;  4FE7 A;  3J7Y J;  4KT6 A;  2DLL A;  3IL2 A;  1WVR A;  1YX3 A;  2Y9Z A;  2DOE A;  1TWF J;  5ERI A;  2O8K A;  3LQQ A;  2EV0 A;  4HST A;  5TJJ A;  5K5O A;  5ILU A;  4D7M A;  2X0L A;  2IGO A;  3VDX A;  2YSR A;  4KN4 X;  4M6V A;  2ELJ A;  4JX5 A;  3FF5 A;  4KA4 A;  2ESN A;  5J3L A;  2ZCW A;  3GFM A;  3LQR A;  4LLG F;  1QA6 A;  2HQA A;  4QIW N;  4JQF A;  3ABT A;  1WI9 A;  1UEL B;  3QP5 A;  2L2O A;  3DPT A;  4ZYE A;  4UUT A;  1MGT A;  1RES A;  2K3P A;  1Y8Q B;  2LRE A;  3QPS A;  2L7F P;  4E7H A;  2PMH A;  2R5Z B;  4CGZ A;  1KU3 A;  1TQP A;  4BHP A;  1Q1V A;  2ZSI B;  5HS8 A;  2VE9 A;  2FOK A;  3O6B B;  3NWS A;  2OAZ A;  1T95 A;  3O2P E;  1RI7 A;  2MG4 A;  5D5V B;  2H94 A;  2JJ7 A;  3QOD A;  3BG3 A;  3IH3 A;  3WU2 C;  4RLQ A;  4UVA A;  2O3F A;  4P5O A;  5HVQ C;  2L4A A;  2XVC A;  3A1Y A;  1N25 A;  3U21 A;  4XOT A;  5J1U A;  4C3I J;  3DF8 A;  2Z16 A;  1SMY F;  4JK1 X;  2CFX A;  5J4Y A;  3ZMV A;  1W36 C;  4BBS J;  1J9I A;  4I76 A;  1MBJ A;  1KA8 A;  2VAS A;  5FD6 A;  2KKO A;  2DMT A;  1FYL A;  5FLV A;  4DYR A;  3I4P A;  1R5H A;  2AXL A;  3TGN A;  1F5T A;  2HVR A;  2M30 A;  1LKX A;  2A3S A;  1XCV A;  4I99 C;  1IG7 A;  3TO6 A;  1SD6 A;  1MD0 A;  4QLC U;  2L4M A;  2VBY A;  3L2V A;  3RKQ A;  4A3J J;  3LAP A;  1UCR A;  4DBQ A;  3DXJ F;  3KZZ A;  5EDN A;  1BR1 A;  2CUJ A;  2MAB A;  5B5E C;  4MHG A;  1X2N A;  5DCM B;  3U1D A;  3V8L A;  3JR9 A;  3H5R A;  1UHS A;  1OCT C;  1YFH A;  1NH3 A;  1K83 J;  1ZK8 A;  3IUO A;  2MC3 A;  2YX4 A;  2JSC A;  4XRS G;  4G6D A;  2DA6 A;  4II3 A;  1MW7 A;  1UJ8 A;  3H5A A;  2JRT A;  4JBA A;  3O8G A;  4M3E A;  1XPX A;  3EUK L;  2E2J J;  4AWX B;  1BW5 A;  4EMS A;  1ERD A;  4E7J A;  4YFX F;  3EDP A;  3KP2 A;  2Z2S B;  3JSP A;  3MKW B;  2MH9 A;  4MTE A;  3BJ6 A;  3F72 A;  1NHA A;  1G6N A;  2X6Y A;  3TP0 A;  5E20 A;  5EG0 A;  3L2R A;  2XPV A;  1WRJ A;  3FXO A;  3IC7 A;  2DT7 B;  2ZXH A;  3JRE A;  2LF7 A;  1IC8 A;  3LSJ A;  2QM3 A;  1Z3X A;  5FLX Z;  4PSX A;  1TWG J;  3B02 A;  1I27 A;  3K4K A;  3RTR A;  3VOE A;  1YJW I;  1AKH B;  4BQA A;  2ZXI A;  4HV5 A;  1D0Z A;  5L3B A;  3G71 I;  1I1G A;  2DCE A;  3BPV A;  2CW0 F;  1QVT A;  2XKO A;  2KDZ A;  1S5L C;  4ASN A;  3R60 A;  3QOE A;  1A35 A;  4OIP F;  2PJP A;  2KIF A;  4BH9 A;  1R5I D;  4M73 A;  1DDN A;  4A3M J;  3OYH A;  5IP9 J;  2ZB9 A;  5H6R A;  3RIR A;  1FNN A;  2LRD A;  2M4K A;  3GEZ A;  2ZME A;  4KJZ A;  2BXY A;  2IA1 A;  4ZZD A;  4EM1 A;  1R7J A;  1V54 H;  2C6Y A;  2ELK A;  5H2F C;  1JXS A;  4GYI A;  5E18 F;  3B6C A;  2M8E A;  4YEJ A;  3GFJ A;  1A36 A;  1B4A A;  1I39 A;  5LFA A;  1QBJ A;  5HDN A;  5F1R A;  3PUF A;  1ITY A;  2QBY A;  4E7Z A;  3HM5 A;  1ON2 A;  2FBH A;  2HGC A;  4XLH A;  1POG A;  2DAO A;  4CSW A;  2F4I A;  2QA4 I;  2VKH A;  5LHG A;  4HX8 A;  2QWW A;  2XAQ A;  3WE2 A;  2RQP A;  2MC4 A;  2WV1 A;  2NYX A;  5D5X B;  3F22 A;  2M5W A;  1IUY A;  4IOA F;  1FZP B;  9ANT A;  3HGY A;  3SDB A;  4JX6 A;  2DA4 A;  1SFO J;  1XCB A;  5IT3 A;  1MBF A;  4W97 A;  1JKO C;  4NBQ A;  3LWF A;  2QF7 A;  1VND A;  4RAY A;  2FUG 2;  4HNV A;  4A3C J;  2LY9 A;  4BXU A;  3AFH A;  3M8J A;  2K86 A;  2HQN A;  1UFM A;  2K4B A;  4A12 A;  4FAS D;  3TW7 A;  3KEO A;  3HJE A;  3RZD J;  3WTV C;  2A5W A;  3OL3 A;  4ON0 A;  5L3G A;  2BVM A;  5HNH A;  1T33 A;  2L54 A;  5F0H A;  3AL0 C;  3C7J A;  1KU9 A;  2E5N A;  2FEZ A;  2JSP A;  2E1M C;  5CVI A;  4JX4 A;  4S0H B;  1W36 D;  2PMU A;  1BBY A;  2J5P A;  4MEY F;  3BR1 A;  5A2Q Z;  2I8D A;  1U0J A;  1UG0 A;  1KZH A;  2JZY A;  4B43 A;  2NS0 A;  1VQK I;  4XLP F;  2L5Q A;  5FLM J;  4RAF A;  5J8F A;  3S2D J;  5CVJ A;  5DUI A;  3KLO A;  2E7X A;  2DFI A;  2IXS A;  3I5U A;  4LMY A;  2V9K A;  5IT9 Z;  2L0K A;  4PZJ A;  4AIJ A;  2R7F A;  2KRF A;  3M07 A;  2PEX A;  3GFI A;  1PP7 U;  3HSE A;  5HOO A;  4LG0 A;  4Q48 A;  5DTD A;  3IHU A;  2O03 A;  3RPU A;  2BZT A;  3BR3 A;  4IQ4 A;  4XKW A;  3MMY B;  2AQF A;  4CCN A;  2FBK A;  2XAG A;  1U6G A;  3PNV A;  1WJE A;  4LK1 F;  4Z6Y A;  2ZJQ F;  4R8H A;  4J19 A;  3GTG J;  3BQZ A;  3KIO A;  2B63 J;  4RDU A;  1O3Q A;  1E3O C;  2DTR A;  2CV2 A;  2F5F A;  3BTI A;  3WGH A;  3A02 A;  2HU9 A;  2ZJ2 A;  2HVS A;  4Q47 A;  3BY6 A;  2Y0S N;  3LMM A;  2MBF A;  3KP7 A;  2FX0 A;  3R61 A;  1RET A;  1JI8 A;  1N75 A;  2E1N A;  3L00 A;  3BC8 A;  2KRH A;  4F7Z A;  5BOX A;  1Y1W J;  1K4S A;  3IH2 A;  4AID A;  1O57 A;  4ABZ A;  3ZMS A;  4E70 A;  3ZOB A;  1TW2 A;  2M7B A;  3QYB A;  2CW7 A;  3ZMT A;  4AU7 A;  4UNO A;  2UUZ A;  1WJB A;  1JUP A;  1JKP C;  3GUD A;  2B7E A;  5DM7 F;  3HHH A;  1L0O C;  1V5F A;  3C1D A;  3MWM A;  4YG2 F;  4HF1 A;  3DCF A;  1FEX A;  2W24 A;  2IS6 A;  1VQM I;  4KMU X;  1ZG3 A;  3CC4 I;  2LTP A;  2VQG A;  4UB6 C;  2KIM A;  1S9H A;  2IGN A;  1HDD C;  4XON A;  3TDU C;  1T38 A;  2XAF A;  1MKM A;  2XPW A;  3TW6 A;  2V26 A;  3ZQQ A;  2Z33 A;  4OIN F;  3ZP5 A;  1E17 A;  1B8I B;  2EBI A;  5DD8 A;  4OIO F;  3DBR B;  3MCZ A;  2OF7 A;  3F8N A;  3W2V A;  5JVG F;  3ECH A;  1SAU A;  1V3F A;  2DDA A;  3L09 A;  1BIA A;  3LSI A;  3GZN B;  1ETO A;  2QSG X;  4RA2 A;  2GA1 A;  2OUM A;  1MNM C;  2Y2Z A;  4XR6 A;  4A3F J;  2ISY A;  3M7G A;  3JRA A;  3H9Q A;  5EG0 B;  2XRN A;  4MO7 A;  2OQR A;  3C18 A;  3FXK A;  3BG6 A;  2CWE A;  4NQW A;  3TOA A;  4FTH A;  2DYR H;  1X3Z B;  1UG2 A;  4O5V A;  2O8X A;  2DA7 A;  2BW3 B;  4ZYD A;  1VQO I;  3PO2 J;  5CPR B;  1BR4 A;  2WB1 A;  4J01 A;  2ID6 A;  4MQ9 F;  3RQ4 A;  1LE8 A;  4L0Y B;  1R23 A;  1HW5 A;  4L5I A;  1RKW A;  2I10 A;  2IA2 A;  2VT2 A;  2O5R A;  1FOX A;  3AL0 B;  1EA3 A;  2IAI A;  1V4R A;  3COA C;  2E1M B;  1X2M A;  5FKL A;  3RZO J;  3OYD A;  3OS0 A;  1PVE A;  2F5C A;  2E5Z A;  1HW2 A;  1YTY A;  1EF4 A;  4FIS A;  4UVB A;  1D1A A;  1J0R A;  5EEG A;  2OBP A;  1T08 B;  1MBK A;  4QSH A;  2DPD A;  2EH3 A;  3ESW B;  3OYA A;  4IHV A;  2KMU A;  2ZME B;  3CP2 A;  2G9W A;  3I9V 2;  1R49 A;  2K5C A;  3DKW A;  1W4M A;  2LSO A;  5C4J J;  5FKN A;  5BMZ A;  4XN0 A;  3SQN A;  1X1D A;  4L0Z B;  2DQR A;  2P0W A;  2PG4 A;  4G6Q A;  3QRF F;  2L9R A;  2HDD A;  3I54 A;  3E0J B;  2A05 A;  1LPQ A;  1AOY A;  5J1R A;  3EUH A;  2RKH A;  3H3U A;  2MLG A;  4OIR F;  4RAZ A;  4Y7N J;  3NRV A;  4L9V A;  2JA5 J;  5E17 F;  1Y56 A;  2IP2 A;  3VYU B;  1B6A A;  1S7A A;  5B66 C;  3CCE I;  1XC5 A;  3E5U A;  1R5G A;  2LP0 A;  4PGG A;  4UUS A;  1FSE A;  2WY7 Q;  3OS1 A;  3WGG A;  2BBY A;  4AD9 A;  2AXT C;  1JUM A;  3M1E A;  1K79 A;  2B0L A;  5FRM A;  4KIC A;  2L7M P;  3GTJ J;  5HOD A;  1OJL A;  2EFW A;  1ZQ3 P;  2Z1D A;  3GTQ J;  2DW4 A;  1XGO A;  2IBD A;  2W4S A;  3F8B A;  3HRS A;  5H6Q A;  3T5X A;  3KFW X;  4D5C A;  3AKZ A;  2VUM J;  3DV8 A;  3HUG A;  4F92 B;  3G73 A;  1LVK A;  2L02 A;  4AYB N;  5C44 J;  4G7O F;  1WKM A;  2M2E A;  2MD5 A;  2HDW A;  2K9S A;  3E97 A;  1SVL A;  2M87 A;  1HQC A;  2NVY J;  3E6M A;  4MFE A;  3E5X A;  1LDD A;  5AIQ A;  3TQN A;  3BQY A;  5EEA A;  4DZP A;  3I59 B;  4LLN A;  2JUC A;  4BNC A;  3NAU A;  1XTA A;  2LBF B;  1XSD A;  1R22 A;  1MBE A;  2KIS A;  3GME A;  4H4K C;  3ABM H;  2F48 A;  2KDO A;  3B6A A;  2E7W A;  3HKZ N;  3LL7 A;  1EH8 A;  1FY7 A;  1K6Y A;  4XKC A;  2E34 A;  1MMN A;  1IXS B;  5K7Z A;  1KQ9 A;  1TQI A;  1PUF B;  2R7O A;  4HNU A;  2HI3 A;  1QPI A;  2CYY A;  1VQ6 I;  3OSF A;  1P7I A;  1XDU A;  3IAS 2;  4CCO A;  3SEZ A;  3DQV C;  1Z9C A;  3OYN A;  5HLI A;  5E1W A;  5EJC A;  2VOD A;  3TL4 X;  1U9O A;  3S8P A;  1JT0 A;  3HB9 A;  2G7H A;  1TT5 B;  2EZI A;  4H0E A;  1T0F A;  3FZV A;  4RGR A;  3DEE A;  2TCT A;  4YII A;  5C4X J;  2W48 A;  4N9I A;  3JRB A;  4A5N A;  1JTY A;  1G8X A;  4N0B A;  3RYP A;  3OYJ A;  2Q2E A;  5LGU A;  5BPD A;  1R71 A;  3F8F A;  4EJU A;  2FQ3 A;  1LDJ A;  3S1R J;  4CCK A;  3BR5 A;  4UB8 C;  4XIC A;  3V7R A;  3E6C C;  4YFK F;  4LG0 B;  4D5F A;  2V6C A;  3QYE A;  4WF2 A;  3J81 K;  3QAH A;  2IA0 A;  3BR6 A;  1S8N A;  1RR8 C;  2KP6 A;  3OIP A;  3H3V K;  3BCB A;  3WTS C;  2K40 A;  1V5E A;  1HBX G;  1QHH D;  2CS3 A;  1MDM A;  5ILV A;  3GO5 A;  4A69 C;  1BM9 A;  1G3S A;  2EFN A;  1D5V A;  2UZK A;  4LIT A;  2ME0 A;  4B3A A;  3FBN B;  2QEN A;  1GXQ A;  4BHB A;  3PSF A;  2QCO A;  3CLQ A;  3L2W A;  4XN3 A;  2KJC A;  1WWX A;  2VC1 A;  5TGT A;  4PJN A;  2K9Q A;  2BV6 A;  2P6S A;  2IS1 A;  4G9Y A;  2NOG A;  3M8F A;  3G1L A;  2BHY A;  4M9Z A;  4WXC A;  2RNG A;  2FD5 A;  2CUZ A;  1ETX A;  2DYS H;  1SFK A;  3PQJ A;  1OKR A;  5J47 A;  1A6Q A;  5F04 A;  2RDP A;  4CZZ A;  1GDT A;  4IOC F;  4CDG A;  1FTT A;  1SFE A;  2HKO A;  3IH4 A;  4XKB A;  3K4J A;  2KPM A;  1DGR M;  4PDK A;  5F64 A;  2UWM A;  1KYZ A;  3FXU A;  3SXY A;  5FFZ A;  1R6R A;  1USS A;  3ZR8 X;  5F0C A;  1FYK A;  3VWB A;  2W82 A;  3HL2 A;  3RPQ A;  5L3D A;  2MYS A;  3R6S A;  2HXO A;  4PJ0 C;  3CD6 I;  1FMW A;  2O0Y A;  3PNY A;  5AIP A;  4UUV A;  2F5D A;  3S1M J;  1W7P A;  1G2H A;  2R4G A;  2R7R A;  1KGS A;  3CCY A;  1WJ5 A;  2ZC2 A;  2X6W A;  2GBY A;  2VON A;  1KU2 A;  2VQL A;  2H8W A;  2R7X A;  2W7N A;  3WG7 H;  1ZLK A;  5LHI A;  1PYV A;  2WAQ A;  1ZR4 A;  5F1J A;  4NQW B;  2M8G X;  2XKP A;  2YPR A;  4ESF A;  3S3M A;  2FOW A;  2HOE A;  4HX4 A;  4IVN A;  3U1K A;  3ULQ B;  2HQ5 A;  1Z7L A;  5CKT A;  1FT9 A;  4XLF A;  5K5R A;  3RCO A;  3QP6 A;  4O6J A;  5HS9 A;  4V2G A;  1LE8 B;  4II2 A;  5DS9 A;  2QSF X;  5BNG A;  2DT6 A;  5D4R A;  3BZC A;  3QPL A;  5J8C A;  1QQI A;  2LY2 A;  3CC2 I;  2ECB A;  5E3N A;  3A01 A;  1HA8 A;  1MBG A;  3HTS B;  2F4M B;  4CCM A;  4X1E A;  1LFU P;  1H0M A;  1K78 A;  5JLW A;  4FCY A;  2BEO A;  4LIU A;  4HV6 A;  2JMW A;  2BYV E;  1DPR A;  1G3Y A;  3S1Q J;  3CMY A;  3RKW A;  5FD5 A;  2YR2 A;  2EZK A;  4PSW A;  1BL0 A;  2CRG A;  4FX0 A;  2Z9O A;  1GV5 A;  1V5G A;  5DEQ A;  3HOZ J;  2H6B A;  4S04 A;  3VYR B;  2HZT A;  2VIX A;  5LRR A;  1GV2 A;  3PM1 A;  1HW1 A;  1YE9 A;  2DOD A;  5IOY A;  5IOZ A;  4AIK A;  5F08 A;  3HPG A;  1GUU A;  2EFQ A;  2Z3Y A;  2KZV A;  2JPB A;  2LY1 A;  4PJL A;  4AIH A;  4QTR A;  4M3B A;  1YLF A;  2LR8 A;  4ZZL A;  1TZL A;  3DWL E;  2JPC A;  2M3A A;  1B72 A;  2KL4 A;  1IUF A;  3ZRG A;  4IX7 A;  3PIP F;  2V9P A;  4N4N B;  1IXC A;  2OCC H;  3TOB A;  2NRA C;  5LBQ A;  4UUS B;  1IF1 A;  2GM4 A;  2XV4 S;  4R79 A;  1YIT I;  2R7Q A;  2X1D A;  3E7L A;  3JAM Z;  3SFI A;  4ENK A;  2R7W A;  3K9T A;  3AG3 H;  3N05 A;  4BYY A;  3K1P A;  1P92 A;  1IGN A;  4HDU A;  2GXA A;  2KRC A;  4LFU A;  3BR0 A;  3HUG B;  3FXR A;  1AWC A;  1SFU A;  4KYW A;  3WTW C;  3SJM A;  3KZY A;  3ZQC A;  2P81 A;  2GIZ A;  1F9N A;  3FIS A;  2DA5 A;  2RGV A;  3A0B C;  3R0J A;  2EIL H;  2J5O A;  3ZN1 A;  3K7A J;  1OQY A;  1KON A;  5GP9 A;  3BLY A;  1PP8 F;  3DP7 A;  4TV7 A;  5EEH A;  2EZL A;  1ZAR A;  3CCL I;  4Z2Y A;  3CTA A;  2VL8 A;  1YO5 C;  1U5T C;  1WPK A;  2DOF A;  2PLY A;  3DFG A;  5EGO A;  1BJA A;  5LEK A;  1DPU A;  4XLA A;  4V2F A;  2QVO A;  3OYL A;  1SC7 A;  2Y75 A;  4CO8 A;  2BXZ A;  1F43 A;  3GBG A;  1TC3 C;  1WCM J;  1R4M B;  1R36 A;  2W84 A;  3GW2 A;  3OOP A;  4BY7 J;  4A3G J;  3E3V A;  2ME6 A;  1MSE C;  2R92 J;  4LLL A;  2V1U A;  3VB2 A;  1YG2 A;  4KIT B;  2GLO A;  1VFC A;  5CLS A;  4IF4 A;  4ITV A;  3HYI A;  3G4S I;  2XC7 A;  3V7C A;  4C30 A;  1K4T A;  2R5Y B;  5L3E A;  2DMU A;  2N8G A;  3KX2 A;  1BI3 A;  3KLN A;  4HPQ A;  1OYI A;  3WTZ A;  3GCM A;  2Q2E B;  5KVR A;  5F0F A;  2ZO4 A;  2HKX A;  4KIG A;  3U2R A;  1MMS A;  2IRF G;  2NVQ J;  2ZJP F;  3FIW A;  4GXO A;  3TMO A;  3F23 A;  1ZRC A;  2KZG A;  3ZQH A;  4ZH4 F;  2LKS A;  5E8I A;  5LEJ A;  1T56 A;  4E7K A;  1D0X A;  1G3T A;  1MMD A;  3VYT B;  3JRF A;  2VPR A;  3CCU I;  4V19 K;  4C9Y A;  3ABL H;  1YHQ I;  3KP6 A;  2XGX A;  2ICW G;  1XB4 A;  1X1B A;  5EZH A;  3CQZ J;  1I6H J;  2HFH A;  2HS5 A;  2FML A;  3LOC A;  4P9U A;  2LNB A;  2R7S A;  3K69 A;  3K6G A;  2DBB A;  3PSI A;  4I98 B;  2F5E A;  3CUQ A;  4IJA A;  2ISZ A;  4HG2 A;  1F1Z A;  3S17 J;  1W5S A;  3WOD F;  3VFZ A;  1MBH A;  1JGS A;  2A6T A;  5KHD A;  1EH6 A;  2VBZ A;  1XMK A;  5E3M A;  3BT9 A;  4N4O B;  3T0Y A;  1YIO A;  1Z6T A;  2LLK A;  4FET A;  1ZAO A;  1U8R A;  2BE5 F;  3VSL A;  1UST A;  2VJI A;  5IPA A;  1J75 A;  3HPH A;  2L01 A;  1TW3 A;  3K4L A;  5JVT A;  4U0Y A;  5JLX A;  4BDY A;  2ZNY A;  4F52 A;  1R4N B;  3KP4 A;  4Y17 A;  2A6H F;  5IYB J;  2WY8 Q;  5ED4 A;  2DTZ A;  3OYB A;  2WC2 A;  3L9F A;  1D8K A;  2DA3 A;  4M71 A;  4CYD A;  2DK5 A;  4HBL A;  2I5U A;  4HA8 A;  2LG4 A;  1BA5 A;  3K4B A;  2FJ1 A;  1RZ4 A;  1WJF A;  1ZEL A;  4NC8 A;  2AQE A;  4EJO A;  4G12 A;  3C2B A;  4YEL A;  2NVX J;  2V4J C;  3FBI B;  5DUK A;  1O7F A;  3ASN H;  3GLX A;  2XB0 X;  4EM0 B;  2LK2 A;  2EJR A;  1FP1 D;  3DTK A;  2HOS A;  3DTE A;  2VOP A;  4OMZ A;  3S15 J;  5CVV A;  1U5T B;  2K85 A;  3WTY C;  5D8L B;  2V1N A;  1ZLJ A;  4K2E A;  3FXJ A;  3CMM A;  4E4H A;  3ISP A;  4PJJ A;  4ENJ A;  3BPX A;  5DYM A;  3VYS B;  4GRI A;  2X51 A;  3S2W A;  3LAJ A;  3A01 B;  3MZY A;  4DBR A;  2WTE A;  1ZTR A;  2YUS A;  2BOL A;  2BY0 A;  1UAA A;  4IKF A;  1NG7 A;  2KQR A;  4KIS A;  2RC4 A;  2HYF A;  2XAH A;  3LSK A;  2E36 A;  3FXL A;  1XG1 A;  4LJZ F;  3K2A A;  3SYT A;  4C2M J;  3J81 Z;  4BQO A;  2X1E A;  4MQV A;  4KN7 X;  4RMN A;  4FX4 A;  2EIM H;  3BOQ A;  1E0E A;  3A03 A;  3K0L A;  4RGS A;  4U88 A;  3ZN0 A;  4ESB A;  5CJ9 A;  4ZJZ A;  3BTL A;  2PMZ A;  3E5Q A;  3O8H A;  3HRM A;  2RRE A;  4HEA 2;  2ZME C;  2LDU A;  3MD2 A;  1NG6 A;  2ECC A;  2XSD C;  2JUG A;  3ERM A;  1XN7 A;  4BDZ A;  4PFO A;  3HSF A;  1R58 A;  1P4X A;  3J80 K;  5KAI C;  3FHZ A;  2OQG A;  1B72 B;  1KYW A;  2HOA A;  5E8G A;  3RJP A;  1BI2 A;  1HLV A;  4LK0 F;  2JA2 A;  2D2W A;  3ZPL A;  2JQ7 A;  1IXR C;  3GZ5 A;  4E7I A;  3KYD B;  2CUE A;  4XOR A;  2COM A;  3J7A Y;  1SMT A;  5EF6 A;  1YS7 A;  2OV7 A;  1GXP A;  1R00 A;  2FU4 A;  4EGY A;  2A6E F;  2Y31 A;  5HS7 A;  4AC0 A;  1BC7 C;  2EPF A;  1EKE A;  1LQ1 A;  1SAX A;  1QRY A;  2K02 A;  4KUM A;  4HRI A;  2WAD A;  2ZSH B;  3FWE A;  3Q0W A;  3CC7 I;  1S29 A;  2K3F A;  4I0A A;  2CQ7 A;  4D1Q A;  2E60 A;  4DZJ A;  5LHH A;  2STT A;  3HC7 A;  4BEH A;  2EA4 A;  1ORK A;  3A4C A;  1ZYR F;  3RQI A;  2A69 F;  4GFB A;  2M45 A;  3G6E I;  4W1U A;  4MTD A;  3BZ6 A;  1S7E A;  2XIG A;  4Y3O A;  3CCR I;  3OSG A;  5ICF A;  5HLT A;  2UV1 A;  2ZFW A;  1VQ7 I;  2BGC A;  3ZQL A;  2CJJ A;  4U7D A;  2CU7 A;  2K27 A;  4KIF A;  3JW4 A;  4EJV A;  2EB7 A;  3LFU A;  5EGO B;  1LDK B;  2PN6 A;  3LNQ A;  2XGE A;  1TNT A;  1RNL A;  2H27 A;  3EET A;  1XSX A;  3HOY J;  1WZ2 A;  2E1O A;  1HKS A;  1ETK A;  1EV7 A;  1FOY A;  1D0Y A;  3CDL A;  2D45 A;  1VI0 A;  1B9M A;  3H0D A;  1K7A A;  1ZGJ A;  3TKY A;  3KEY A;  1O3S A;  3ROU A;  1QPM A;  2DFF A;  3V42 A;  2HWV A;  3OYE A;  1VQ8 I;  4YFN F;  4RB3 C;  3OYF A;  4IHT A;  1OLT A;  2EZH A;  2MLK A;  3ZCO A;  3UNG C;  3L2U A;  1R9T J;  4JYK A;  1P9Q C;  4Q4Z F;  2G0E A;  3HDD A;  1TBX A;  4PGH A;  4DIQ A;  1S6L A;  3CCQ I;  3BR2 A;  2XAS A;  1BI1 A;  3ZQF A;  4L9T A;  4IZZ A;  1I50 J;  2FRH A;  4UHT A;  2VT3 A;  3HOU J;  3AAF A;  3TBI A;  4GDF A;  3F8C A;  2FF4 A;  4OWR B;  3CCM I;  2Q1Z B;  5IYC J;  3RKY A;  2H1L A;  3P9I A;  3QU3 A;  4Y4R A;  3HZJ A;  4NB5 A;  3QYF A;  2LH9 A;  4IRI A;  5D4S A;  1OMI A;  3X2Q H;  2O6G E;  1HKT A;  3JRD A;  2DT5 A;  1QZE A;  2Z5U A;  3CES A;  4Q5S F;  1IN5 A;  2OTJ I;  1X58 A;  2MH2 A;  3BCA A;  2XUB A;  1I3Q J;  3FXM A;  4M3F A;  1ON1 A;  2X6O A;  4IQJ A;  2EIK H;  2OZ6 A;  1HDP A;  4CCL A;  3WTT C;  2R7Z J;  2EWN A;  2GOM A;  3CDH A;  3QOP A;  2IPQ X;  4KT5 C;  3P9K A;  6PAX A;  3CUQ B;  3KP5 A;  3OS2 A;  3HEF A;  2XRO A;  1ZN2 A;  4HOB A;  1MMA A;  2DA2 A;  4L5E A;  1X4P A;  5D6F A;  3U9G A;  2KIU A;  4EGZ A;  3GX4 X;  1BI0 A;  2QQ8 A;  5E1X A;  1W0U A;  5TRD A;  1LEB A;  3TED A;  1P6R A;  2CW8 A;  2E19 A;  1SD7 A;  2M4G A;  3H0G J;  4BE2 A;  4HW0 A;  2VJ4 A;  2DU9 A;  2XF5 A;  3MKL A;  1Z05 A;  3KE2 A;  1IRF A;  2XHK A;  3N97 A;  1LFP A;  2HYG D;  4A3K J;  2JVH A;  2W57 A;  3WE3 A;  1LVA A;  2OU2 A;  2QBY B;  2XF6 A;  1YJ9 I;  1Y8R B;  1F4K A;  3S3N A;  3ABK H;  2VBW A;  1O4X A;  3F0C A;  2D1H A;  1JTX A;  3F21 A;  3QPT A;  1S7O A;  3I4N J;  5DDG A;  4ESJ A;  5D5W B;  2GA2 A;  4JOM A;  2Y9Y A;  4BQN A;  3FM3 A;  4IHX A;  3CJN A;  2R7D A;  3MAJ A;  4B48 A;  1A5J A;  4MIM A;  3D5S C;  2O7O A;  1H9T A;  2DDB A;  3MKZ A;  5CYV A;  2EIN H;  1X1A A;  3IKV A;  1VZ0 A;  1IRZ A;  1QHG A;  1E3P A;  4BBR J;  4B47 A;  4IHY A;  4D9J A;  5F6F A;  2EFO A;  1JT6 A;  2OPT A;  3OOU A;  2O9L A;  2X48 A;  2VOO A;  2P5K A;  2W85 A;  3BJA A;  4A93 J;  2HZD A;  3ZMZ A;  4P9F A;  1STZ A;  3KCC A;  3K4C A;  1H8A C;  4B3X A;  1TQM A;  1NK2 P;  3OMY A;  4GCV A;  4HYE A;  5LD2 C;  1JJ8 C;  1XX5 A;  4D0P A;  2H8R A;  1Y0U A;  5DV5 A;  5FFX A;  4A6E A;  2A07 F;  2HVQ A;  2F2E A;  3DEU A;  2E35 A;  4CH7 A;  4RGU A;  2L9N A;  3REO A;  4B1R A;  1X3W B;  2NS7 A;  3TO9 A;  1F36 A;  3NWT A;  1TWA J;  1YYV A;  2W00 A;  3H36 A;  4RB2 C;  2DMQ A;  3V8J A;  3K10 A;  3OR2 C;  3PFY A;  5GAG J;  1YIJ I;  2GAU A;  1CF7 A;  3F8M A;  1LB2 A;  2CFO A;  3EUA A;  3WTX C;  2DJI A;  1Y6I A;  1QO0 D;  4CUG A;  1FPQ A;  1BN5 A;  3VPR A;  1ENH A;  1R1U A;  2EIJ H;  5FRN A;  3EUH C;  3SZP A;  3W6J B;  3ZQ7 A;  2CQX A;  1JE8 A;  1NTC A;  1VQP I;  4XID A;  4WX9 A;  2EFP A;  4KMF A;  2NNN A;  4IXA A;  4MGR A;  2DO7 A;  3HIF A;  5B1A H;  2B9S A;  2KLO A;  2H1K A;  1JHH A;  1IRX A;  5AON A;  2JTV A;  1J7K A;  3D1N I;  1YI2 I;  1N78 A;  1OCP A;  2ADU A;  4I2O A;  3I4M J;  1VQ5 I;  1Z77 A;  2UXN A;  5TIS C;  1AU7 A;  2Q8K A;  3UR3 C;  5A2Q K;  4LD5 A;  1X1P A;  1FBS A;  1U2W A;  5IYD J;  2R7V A;  3H92 A;  1OFC X;  1WGX A;  3SZT A;  2M9H A;  4BS9 A;  3RPU D;  3IKT A;  3N4M A;  2LKP A;  2E2I J;  3M8E A;  4F93 B;  4U0V A;  2AHQ A;  5J6X A;  4QPQ A;  4U0W A;  1FYM A;  3FKJ A;  1CGP A;  2QQA A;  4L9J A;  5M5Y J;  5IT9 K;  5LGN A;  2R7U A;  3I55 I;  2DI3 A;  2F6C A;  4B44 A;  4EV0 A;  3LST A;  4M3D A;  1MH4 A;  2VXZ A;  4KIB A;  2UXX A;  4XQF A;  2H09 A;  3ML6 A;  3JRG A;  1Y0N A;  3ZMU A;  5D6E A;  1BC8 C;  2VPL A;  2JWT A;  2WB1 N;  5EZG A;  3DKX A;  2P7C B;  3PIO F;  2HR3 A;  4BQQ A;  3AG1 H;  1RRJ A;  4WXD A;  4AM3 A;  1T0F C;  3BJO A;  4IRG A;  1Z67 A;  3HRU A;  3G1M A;  4A0Z A;  3MZ8 A;  4MFD A;  1G59 A;  1BR2 A;  2LF8 A;  5FKM A;  4I01 A;  1QZZ A;  1ZGA A;  4XK4 A;  5ICG A;  5CQG A;  1BW6 A;  3NEU A;  1FSH A;  4IRH A;  4EAT A;  4Y52 J;  2R7T A;  4EJT A;  1W5C C;  1ETW A;  2COB A;  1FIP A;  1GVJ A;  3J80 Z;  1TTY A;  2QQB A;  2WBM A;  4B09 A;  1IN6 A;  1FP2 A;  3MVP A;  2W25 A;  3HOX J;  4PUS A;  3DU6 A;  4A3I J;  2V7F A;  3RDI A;  1JUS A;  4RB0 A;  2HQR A;  4DW6 A;  2JA6 J;  2KIQ A;  3CLO A;  2V9V A;  3GTM J;  4NC6 A;  2K7L A;  2DMN A;  2LC2 A;  4XLE A;  5HLH A;  4XM3 A;  1VTN C;  1P2F A;  2P7V B;  4O3M A;  5DM6 F;  1Z3Y A;  3DU5 A;  3M3Y J;  1XDS A;  3S2H J;  3HGG A;  4L18 B;  3SEQ A;  1RC9 A;  4XRM A;  4KDP A;  2DK8 A;  3EYY A;  1P4W A;  3M4O J;  1ETY A;  4U7B A;  4BY1 J;  2NAZ A;  4BU2 A;  1WHU A;  2XB5 A;  1QNT A;  3ELK A;  1IJW C;  1X1C A;  1MJ9 A;  5ILS A;  4DJA A;  1AHD P;  3AG2 H;  2X85 A;  3FKI J;  1U8B A;  1MMG A;  3W6K B;  5C3E J;  1QGP A;  4QPO A;  5JI6 A;  1DGW Y;  4BKX A;  3I0T A;  2NXN B;  2X6X A;  2FBI A;  3KYC B;  3BTJ A;  3BG9 A;  1W0T A;  4HLY A;  4M9S A;  2EV6 A;  2XPU A;  4RB1 A;  2GOX B;  1TWC J;  2CG4 A;  4CCJ A;  5EYR A;  3KEQ A;  5FGM A;  5BPI A;  5KCM A;  1OCR H;  1WQ2 A;  3WHC A;  1A04 A;  4IL6 C;  3VOD A;  1TNS A;  1XMX A;  3UKG A;  1P7J A;  1GHC A;  1SD4 A;  3KET A;  1IN7 A;  3JRH A;  2MD0 A;  4XKV A;  2PFB A;  4DNC A;  1ZH5 A;  4NC7 A;  5IP7 J;  3VSK A;  3W2W A;  2JA8 J;  1XD7 A;  3GZ6 A;  3Q9V A;  4XSX F;  2WWY A;  2JVG A;  1W5T A;  1HKQ A;  2DJN A;  4UV9 A;  4LIV A;  2LD5 A;  3DEW A;  2EQR A;  3F6V A;  3OWT A;  2AS5 F;  1T2K A;  1S3J A;  2VN2 A;  2DQL A;  5D5U B;  1U78 A;  3QU6 A;  2NOJ B;  4BAC A;  4IO9 F;  5CVR A;  5FRO A;  1E2X A;  4M3G A;  2L9V A;  2K9L A;  4HF0 A;  2ZKZ A;  4BGD A;  4WXH A;  3CCV I;  1OCC H;  2HXI A;  2HNH A;  3MEX A;  4RAG A;  2ID3 A;  2XRL A;  4ZDP A;  3ERE D;  3JSO A;  5E79 C;  3M9A A;  4OU0 A;  2RNJ A;  4ZC3 A;  1RUN A;  3BG5 A;  1IW7 F;  2DPU A;  2PJR A;  4LB5 A;  2KT0 A;  5GPC A;  1YW8 A;  2Y0S A;  3L2Q A;  3HHG A;  2VXD A;  2X4H A;  3JRC A;  2RVC A;  4EVI A;  1DU6 A;  2A5Y B;  2FSW A;  2WV0 A;  2QLZ A;  2XGC A;  4E7S A;  4HF2 A;  2V79 A;  1VF9 A;  3DKY A;  1CF7 B;  4BJ5 C;  2FNP A;  3CDI A;  5M5W J;  1C0W A;  1GVD A;  2CQK A;  2Y48 A;  5GAD J;  5FJ8 J;  3GTO J;  2GIV A;  1CQT A;  3LA2 A;  3OY9 A;  4HNT A;  2P6T A;  5B3S H;  2K9M A;  3Q0U A;  2R0Q C;  1B8I A;  5J4V A;  2P5L C;  2ACJ A;  5CQE A;  2STW A;  1R1T A;  2DFH A;  2R93 J;  4XL9 A;  5KNL A;  1GT0 C;  4ZYA A;  2QUF A;  4FHT A;  1MDM B;  3FXQ A;  2EK5 A;  4G7Z F;  4G8X A;  5IY5 H;  3OR1 C;  2QQ9 A;  3F6O A;  4YRV A;  1IO2 A;  1YQA A;  3ZQG A;  2LVS A;  4HLX A;  5FKK A;  3HSR A;  2QEX I;  4A3L J;  1I1S A;  3BZK A;  2DA1 A;  4UV8 A;  2VI6 A;  2HDC A;  4J00 A;  2BW3 A;  4G94 A;  5H20 A;  3FM5 A;  2E1C A;  3PJR A;  5GPA A;  3D5L A;  1TT0 A;  4Y13 A;  3Q5F A;  3DPL C;  3MFK A;  4GGG A;  3C2H A;  3LA3 A;  1FJL A;  3K4N A;  1XS9 A;  3MN2 A;  1MJA A;  3ZXS A;  2VB6 A;  3H3Z A;  2QKL B;  3L1P A;  5B1B H;  1OCZ H;  2JT1 A;  3HOW J;  1LEA A;  3HOS A;  5DD4 A;  2MW8 A;  1ACI A;  2M1B A;  4I6Z A;  2YU3 A;  1IN8 A;  2CQN A;  2FE3 A;  3KZI C;  2FXA A;  3S16 J;  1YX5 A;  2QYO A;  2WAF A;  2ZXJ A;  2DXI A;  2V1D A;  3I3L A;  3OV8 A;  1D8J A;  3K1M A;  4I02 A;  2XAU A;  4PK4 A;  4XOP A;  2WAQ N;  3GTK J;  2QSH X;  4IHS A;  3GLL A;  1YW9 A;  3IWF A;  5K7F A;  2VQH A;  3ASO H;  1DP3 A;  1OCO H;  1SFX A;  1W7P B;  3S93 A;  3DPU A;  2MA3 A;  3FMR A;  1X4O A;  1TP4 A;  3J7Z I;  4Y33 A;  3FX3 A;  4DYQ A;  2VE8 A;  3PFI A;  3CF5 F;  3LSP A;  1XMA A;  3F3X A;  3FK7 A;  3LFK A;  5JHF A;  1FC3 A;  2XAJ A;  2HPM A;  4OIQ F;  4AVP A;  4EJW A;  1H9G A;  2JA7 J;  4RM3 A;  2HPI A;  2FNA A;  1ZR2 A;  1YRN A;  1WI3 A;  1O3R A;  2VJ5 A;  1FMV A;  2NS8 A;  1A6I A;  5D8K B;  1TLH B;  2QGU A;  3SDG A;  1UHM A;  3H1C A;  2M0C A;  3CME I;  3ZMD A;  2X9D A;  4PCQ A;  4NHJ A;  2Y30 A;  3HXL A;  2ZFU A;  1W7P D;  2OD5 A;  1JKQ C;  1V55 H;  3TO7 A;  1K78 B;  2L7K A;  3T8T A;  2HEO A;  4CIC A;  2W1O A;  3QWL A;  4M72 A;  3I59 A;  2CO5 A;  1WJD A;  1WFX A;  1U9N A;  2M7A A;  4LOC A;  5LLQ A;  1FBQ A;  5JFR A;  4LG3 A;  2QKM B;  1XSV A;  2LBF A;  4BJ6 C;  2GXG A;  4AYB A;  3OYM A;  4C2U A;  2L7Z A;  3R4K A;  1Y1V J;  3ONQ A;  4IEJ A;  4Y15 A;  3OYG A;  3CUQ C;  1J2X A;  1ZGW A;  1T8I A;  1SD5 A;  4RGX A;  3HTU A;  5GTH C;  1WSU A;  1T39 A;  3K4M A;  5GTI C;  2CGP A;  2M34 A;  2PI0 A;  2H6C A;  3GXO A;  1FIA A;  3SFZ A;  3B73 A;  1PUF A;  2ZNZ A;  2LFB A;  4UXN A;  3TDZ C;  5FKO A;  3BRO A;  1QZY A;  3WU1 B;  2R3S A;  2Q0O A;  2EA2 A;  3CF2 A;  3LSH A;  1I6X A;  5F27 A;  4EEF G;  3I56 I;  3CO6 C;  2ESH A;  2BVL A;  1N77 A;  3HKZ A;  2LOO A;  1LNW A;  3KPH A;  4KFC A;  3V4G A;  3PO3 J;  1Z1D A;  2F4O B;  3IV5 A;  1L3L A;  1D5Y A;  3Q9S A;  3HOV J;  1G4D A;  1MJB A;  1PJR A;  2NVT J;  1MSF C;  2D1V A;  1VQL I;  3CJT B;  1PUE E;  4L5J A;  1BOB A;  3FMQ A;  1J59 A;  4RM2 A;  1P4A A;  5K7H A;  2CQQ A;  1FLI A;  5ICC A;  1DP7 P;  2RAE A;  3ZQI A;  3ECO A;  1TL8 A;  3IP4 B;  3GTL J;  1DUX C;  2VQC A;  3MZH A;  2GZW A;  2Y69 H;  1HF0 A;  1YS6 A;  4F91 B;  2IGK A;  3GYH X;  2JK3 A;  3C2G A;  1B1B A;  3E6D A;  3RSN A;  2L3D A;  5LGT A;  3HBL A;  3MKY B;  1FOW A;  2BY2 A;  4P96 A;  4D7N A;  4XRS A;  4ZTF A;  5LRS A;  1RR7 A;  2TDX A;  1HSJ A;  1RKT A;  4NUB A;  2HOT A;  1IV6 A;  1D3Y A;  2CV1 A;  3BDD A;  3P5J A;  3M1C A;  3OYK A;  2IJL A;  4DYC A;  4G7H F;  1MNE A;  4B8X A;  4BXX J;  4ANJ A;  4CYC A;  4HQE A;  2PJR B;  3WG9 A;  3JAM K;  4IHW A;  1BJZ A;  5HNF A;  3IRQ A;  3DTI A;  1AA7 A;  1A31 A;  3FK6 A;  1G3W A;  4OAZ A;  5E3O A;  4WK8 F;  4E7L A;  3JTG A;  1RPW A;  3PNT A;  1OIS A;  4X6A J;  1Z91 A;  4ETS A;  1VQ9 I;  3I71 A;  4HAM A;  3A2K A;  3ABU A;  4DOZ A;  1FBU A;  2RV8 A;  3I58 A;  4P55 A;  1IN4 A;  1MZB A;  3EYI A;  5DCF A;  2XF7 A;  2FQ4 A;  4WCG A;  1O3T A;  3HG9 A;  1IAW A;  4M9X A;  5IP6 A;  2GXB A;  1M1E B;  1YJN I;  5M3F J;  4LB6 B;  1SEU A;  1J09 A;  2ZXW H;  3DLA A;  4CZC A;  1OR7 A;  1R1V A;  3CCS I;  3FDY A;  3DBH B;  4A3E J;  3CJQ B;  1PDN C;  1B59 A;  1MH3 A;  1UZC A;  2E71 A;  1WH7 A;  3H9J A;  4FE4 A;  5J1Y A;  3DLL F;  1RIO H;  1RUO A;  3IWZ A;  1VQ4 I;  3V7S A;  1WH5 A;  2F5V A;  1NK3 P;  4MEX F;  1E3H A;  4DGW B;  2AO9 A;  2X1C A;  1YOV B;  3NQO A;  4JP0 A;  2TRT A;  4OMY A;  2P4W A;  4ENM A;  1ULY A;  3S1N J;  1OPC A;  1FWZ A;  3W3C A;  4XNF A;  4F55 A;  4A5M A;  5FO5 A;  1U3E M;  1IZ1 A;  2LYC A;  2KHM A;  1Z21 A;  4RS8 A;  2DN0 A;  4A3D J;  1HCR A;  1YW7 A;  4DQ2 A;  2VC0 A;  3W6V A;  1KU7 A;  4KNY A;  4I09 A;  2E2H J;  4C3H J;  4C2T A;  1ETQ A;  5KAF C;  4RBO A;  2XGD A;  1BOA A;  1JGG A;  3O3K A;  1Q1H A;  1IV8 A;  1T6S A;  3BTC A;  3GFL A;  1O7L A;  5E1Z B;  3LSR A;  1LFB A;  3RYR A;  3OYI A;  1JKR C;  1SVM A;  2MGQ A;  3OIQ A;  1K6O A;  1X19 A;  2L9S A;  4F3Q A;  1XGM A;  1FOK A;  3Q0V A;  2ELH A;  3K70 C;  4M6Y A;  5FLX K;  2YS9 A;  3IAM 2;  2VJJ A;  3GWZ A;  3RI4 A;  4A6D A;  4MNU A;  2VKD A;  4PFP A;  2ZBK A;  2GQQ A;  2NNY A;  3NAR A;  4U87 A;  1MIJ A;  4MLO A;  1UHW A;  3HRT A;  2O61 A;  4XMY A;  1EH7 A;  3CUO A;  3FMS A;  3DBL B;  3D5R C;  1ZHF A;  3FHN A;  2D5V A;  4XSZ F;  2R5Z A;  5M3M J;  3OYC A;  3PQK A;  3QQA A;  3OL4 A;  4GYG A;  1D1C A;  5M5X J;  4BHC A;  1YRN B;  1ODD A;  3WHB A;  2LMD A;  1TWH J;  3PUB A;  3WGI A;  1J5Y A;  2BY1 A;  3CMA I;  3CO7 C;  2PQ8 A;  2NVU B;  2Y0M A;  4PJM A;  5HDK A;  2VKE A;  2HTS A;  4RLF A;  3S14 J;  4XLN F;  3CJR B;  2CMP A;  3QPH A;  3V8K A;  1OR7 C;  5E3L A;  1H89 C;  1WJC A;  1HC8 A;  2VLA A;  1KQ8 A;  4GO1 A;  2VKV A;  2QZ8 A;  2PMZ N;  3T8R A;  1VQN I;  3G1O A;  3H5N A;  1I3A A;  3I53 A;  2Z99 A;  2G7U A;  1DU0 A;  2MFZ A;  4NDL A;  3JCU C;  4FT8 A;  4B4C A;  1SVO A;  2RN7 A;  4AVZ A;  1ZG1 A;  4AUX A;  4A0Y A;  2K4J A;  4WWC A;  4QWQ A;  4BAY A;  1IDZ A;  4LGW A;  3PL8 A;  4OOI A;  3H35 A;  4ZTJ A;  1APL C;  3C3W A;  4YIF A;  1W1W E;  5JR3 A;  3BG7 A;  3G3Z A;  3CCJ I;  5DCM A;  1K61 A;  2BHZ A;  2M0M A;  2IS2 A;  1XGN A;  1HXD A;  2HTJ A;  2HYJ A;  4HQM A;  4ZYG A;  5FB2 A;  5J40 A;  3CP8 A;  4BE1 A;  2K9N A;  1D1B A;  1QU3 A;  2IT0 A;  3D0S A;  1UB9 A;  4R1H A;  1XGS A;  1Z7U A;  3LSM A;  4I0B A;  1OYW A;  2P8T A;  4P1W A;  2R5Y A;  2FMY A;  1LUJ B;  3L2C A;  5BS6 A;  2CH0 A;  4CXF A;  4IPA A;  2KFD A;  3SHF A;  1ZG5 A; 
#chains in the Genus database with same CATH homology
 5KCM A;  4BJT A;  3BG6 A;  2CV0 A;  4G6T B;  4BEH B;  3DTK A;  3DTE A;  2OC6 A;  3F9K A;  1DQU A;  1GLN A;  3H9G A;  2DOA A;  4HSR A;  2BW3 B;  3KYL A;  5CPR B;  2MD0 A;  4XKV A;  1BR4 A;  4ZDL A;  1MND A;  2WB1 A;  4NC7 A;  4BXF A;  4J01 A;  3RQ4 A;  3VSK A;  3W2W A;  4X0G A;  2V1N A;  3CMM A;  2JVG A;  4E4H A;  4PJJ A;  4LIV A;  3OWT A;  2O5R A;  3VYS B;  1EA3 A;  2X51 A;  4GRI A;  3AL0 B;  4DBR A;  2NOJ B;  2E1M B;  4BAC A;  2BOL A;  4IKF A;  3OYD A;  3OS0 A;  1UAA A;  1NG7 A;  2KQR A;  2WAE A;  2E5Z A;  4KIS A;  5FRO A;  3LSK A;  2K9L A;  4BGD A;  4NNJ A;  3SYT A;  2HNH A;  1D1A A;  4BQO A;  4ZDP A;  2X1E A;  4RMN A;  3W2A A;  1E0E A;  4ZC3 A;  3OYA A;  2KMU A;  4E6K G;  3CP2 A;  2PJR A;  3I9V 2;  3LSG A;  1WJA A;  2K5C A;  2Y0S A;  4ZJZ A;  3L2Q A;  2PMZ A;  4XN0 A;  2VXD A;  2RRE A;  4HEA 2;  4BE0 A;  3MD2 A;  1X1D A;  4BL0 B;  2XDV A;  1NG6 A;  2P0W A;  4BDZ A;  2JUG A;  4E7S A;  4PFO A;  3E0J B;  3DKY A;  4BJ5 C;  2WA0 A;  2JA2 A;  3OY9 A;  1Y56 A;  4HNT A;  3VYU B;  2K9M A;  4E7I A;  4XOR A;  5CQE A;  3OS1 A;  2WY7 Q;  3J7A Y;  3CZ6 A;  4XL9 A;  5KNL A;  2OV7 A;  3EPZ A;  5FRM A;  4ZYA A;  3S32 A;  3K70 D;  3S3O A;  2Z1D A;  2W4S A;  3AKZ A;  4F92 B;  3OR1 C;  4HRI A;  1LVK A;  2WAD A;  2ZSH B;  3SZG A;  3HOT A;  4YRV A;  2HDW A;  4D1Q A;  2E60 A;  2V6E A;  3E1S A;  4OAY A;  3HC7 A;  4BEH A;  2XSJ C;  3G2B A;  4BUP A;  4XLC A;  3A4C A;  4J00 A;  2BW3 A;  3ZGK A;  3PJR A;  3D5L A;  1TT0 A;  2RQQ A;  3DPL C;  4ZDO A;  4Y3O A;  2LBF B;  3C2H A;  3K4N A;  2UV1 A;  5HLT A;  4CA0 A;  2IGM A;  4H4K C;  3ZXS A;  3LFU A;  1LDK B;  2VB6 A;  2QKL B;  2KDO A;  2IS4 A;  3LL7 A;  1K6Y A;  4XKC A;  3HOS A;  4KT6 A;  1MMN A;  1YX3 A;  1D0Y A;  1YX5 A;  2R7O A;  2WAF A;  4HNU A;  4HST A;  3H0D A;  2DXI A;  3I3L A;  2IGO A;  3KEY A;  2XAU A;  3VDX A;  3IAS 2;  4CCO A;  3SEZ A;  4PK4 A;  4XOP A;  2ELJ A;  3V42 A;  3DQV C;  3OYE A;  3OYF A;  3OYN A;  2HQA A;  1OLT A;  2VQH A;  1DP3 A;  3ZCO A;  3TL4 X;  3S8P A;  3UNG C;  3L2U A;  4JQF A;  3S93 A;  3DPU A;  1P9Q C;  1UEL B;  2L2O A;  3DPT A;  1X4O A;  3DEE A;  4Y33 A;  4DIQ A;  5JHF A;  3OYJ A;  2HPM A;  1G8X A;  2K3P A;  2LRE A;  4IZZ A;  4E7H A;  4RM3 A;  4CCK A;  2HPI A;  2ZSI B;  3TBI A;  3QYE A;  4OWR B;  3NWS A;  2Q1Z B;  2VJ5 A;  1FMV A;  1T95 A;  4Y4R A;  2KP6 A;  3OIP A;  3QYF A;  2LH9 A;  3BCB A;  1V5E A;  1QHH D;  2CS3 A;  3QOD A;  4RLQ A;  3CES A;  4P5O A;  5HVQ C;  3A1Y A;  3HXL A;  3U21 A;  4XOT A;  2ZFU A;  4LIT A;  3BCA A;  2L7K A;  3FBN B;  2Z16 A;  1W36 C;  2W1O A;  4IQJ A;  3PSF A;  4CCL A;  3L2W A;  4XN3 A;  2GOM A;  2VAS A;  1WJD A;  1WFX A;  2M7A A;  3OS2 A;  5TGT A;  4PJN A;  4LG3 A;  2QKM B;  2HVR A;  1MMA A;  2LBF A;  2IS1 A;  1X4P A;  4BJ6 C;  4C2U A;  4AYB A;  3OYM A;  1LKX A;  3OYG A;  3ONQ A;  2RNG A;  2CUZ A;  1SFK A;  2CW8 A;  3L2V A;  3K4M A;  4DBQ A;  2M4G A;  4BE2 A;  1BR1 A;  2CUJ A;  2MAB A;  4XKB A;  3K4J A;  2VJ4 A;  2KPM A;  1DGR M;  2XF5 A;  2UWM A;  1LFP A;  3H5R A;  3CF2 A;  1R6R A;  3LSH A;  3ZR8 X;  2JVH A;  3VWB A;  3IUO A;  2W82 A;  2XF6 A;  2BVL A;  3HL2 A;  1N77 A;  2MYS A;  4II3 A;  1MW7 A;  2LOO A;  3H5A A;  3HKZ A;  3S3N A;  1FMW A;  3PNY A;  3EUK L;  2R4G A;  1ERD A;  2R7R A;  4E7J A;  1WJ5 A;  2X6W A;  1PJR A;  2Z2S B;  3MKW B;  2VQL A;  4JOM A;  2R7X A;  2X6Y A;  4BQN A;  2W7N A;  1BOB A;  4B48 A;  3L2R A;  4RM2 A;  1PYV A;  2WAQ A;  3D5S C;  4NQW B;  3MKZ A;  3S3M A;  2DT7 B;  2ZXH A;  3H9Q A;  1X1A A;  1Z7L A;  5CKT A;  1Z3X A;  1VZ0 A;  1QHG A;  3IP4 B;  4XLF A;  4B47 A;  4PSX A;  3RCO A;  4D9J A;  2VQC A;  3K4K A;  4II2 A;  3RTR A;  2DT6 A;  4F91 B;  2IGK A;  2ZXI A;  3OOU A;  3C2G A;  1D0Z A;  2LY2 A;  3RSN A;  2DCE A;  1HA8 A;  3MKY B;  2HZD A;  4CCM A;  3K4C A;  4B3X A;  3QOE A;  3OMY A;  4LIU A;  4ZTF A;  5LD2 C;  3OYH A;  4NUB A;  2HVQ A;  2CV1 A;  4PSW A;  2LRD A;  3M1C A;  2M4K A;  4CH7 A;  3OYK A;  2L9N A;  4KJZ A;  1MNE A;  4ANJ A;  1V5G A;  2PJR B;  3NWT A;  2W00 A;  2VIX A;  3VYR B;  5HNF A;  1YE9 A;  3HPG A;  3DTI A;  1AA7 A;  3K10 A;  4OAZ A;  3OR2 C;  2KZV A;  4E7L A;  2LY1 A;  3PFY A;  4PJL A;  3PNT A;  4YEJ A;  1TZL A;  2CFO A;  3DWL E;  3EUA A;  2M3A A;  2DJI A;  1Y6I A;  4CUG A;  5LFA A;  3A2K A;  2KL4 A;  3ZRG A;  4DOZ A;  4IX7 A;  4N4N B;  4E7Z A;  2XF7 A;  4XLH A;  4R79 A;  5FRN A;  2R7Q A;  3HG9 A;  3EUH C;  2X1D A;  2R7W A;  4CSW A;  2F4I A;  2VKH A;  3N05 A;  1J09 A;  3DLA A;  2MC4 A;  4CZC A;  2KRC A;  2KLO A;  3FDY A;  3HUG B;  1IRX A;  3CJQ B;  3H9J A;  3SDB A;  1N78 A;  2F5V A;  4DGW B;  2X1C A;  1KON A;  2FUG 2;  3BLY A;  3UR3 C;  3W3C A;  4XNF A;  4F55 A;  3AFH A;  2R7V A;  3M8J A;  2LYC A;  2KHM A;  2VL8 A;  1Z21 A;  4FAS D;  4BS9 A;  3RPU D;  2A5W A;  3OL3 A;  4C2T A;  4XLA A;  2BVM A;  4F93 B;  3OYL A;  5HNH A;  3GBG A;  3AL0 C;  4QPQ A;  3FKJ A;  2E5N A;  2JSP A;  2E1M C;  1W36 D;  2R7U A;  2F6C A;  4B44 A;  3OYI A;  3OIQ A;  2I8D A;  1U0J A;  2VXZ A;  1X19 A;  2L9S A;  4F3Q A;  1UG0 A;  4KIT B;  4XQF A;  4B43 A;  3K70 C;  3IAM 2;  2VJJ A;  4ITV A;  2XC7 A;  4PFP A;  2VKD A;  4C30 A;  2VPL A;  2L5Q A;  4U87 A;  3DKX A;  3KX2 A;  4MLO A;  4HPQ A;  2IXS A;  2V9K A;  4XMY A;  4BQQ A;  2Q2E B;  3FHN A;  1T0F C;  3D5R C;  3OYC A;  3OL4 A;  1D1C A;  1BR2 A;  5HOO A;  3TMO A;  1G59 A;  3PUB A;  4IQ4 A;  4XKW A;  5CQG A;  3MMY B;  4PJM A;  4EAT A;  1D0X A;  2AQF A;  4CCN A;  4E7K A;  1MMD A;  3PNV A;  1WJE A;  3VYT B;  2R7T A;  4RLF A;  3CJR B;  2CMP A;  4C9Y A;  2CV2 A;  2WBM A;  1OR7 C;  2HU9 A;  2HVS A;  1WJC A;  1X1B A;  2VLA A;  3LMM A;  1JI8 A;  1N75 A;  3H5N A;  2R7S A;  3K6G A;  4PUS A;  3BC8 A;  2KRH A;  3DU6 A;  2V7F A;  3PSI A;  2MFZ A;  4HG2 A;  2M7B A;  3QYB A;  2CW7 A;  4AVZ A;  4AU7 A;  2UUZ A;  1WJB A;  2LC2 A;  4XLE A;  4XM3 A;  2A6T A;  5KHD A;  3PL8 A;  1V5F A;  4N4O B;  1Z3Y A;  3DU5 A;  3H35 A;  4ZTJ A;  4FET A;  3SEQ A;  3VSL A;  2VJI A;  3BG7 A;  2IS6 A;  3HPH A;  4BDY A;  2VQG A;  3K4L A;  4U7B A;  4BU2 A;  4F52 A;  1S9H A;  2IGN A;  4XON A;  2IS2 A;  2M0M A;  3ZQQ A;  1X1C A;  2V26 A;  2WY8 Q;  3OYB A;  4DJA A;  3CP8 A;  4BE1 A;  3W2V A;  1D1B A;  1QU3 A;  2X85 A;  1MMG A;  2LG4 A;  4QPO A;  1SAU A;  3LSM A;  3K4B A;  1WJF A;  4P1W A;  1DGW Y;  1ZEL A;  4NC8 A;  3LSI A;  2X6X A;  2CH0 A;  2AQE A;  2OUM A;  4YEL A;  4XR6 A;  2V4J C;  2GOX B;  4CCJ A;  3FBI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...