2GOMA

Crystal structure of efb-c from staphylococcus aureus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
61
structure length
61
Chain Sequence
IKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen-binding protein
publication title A structural basis for complement inhibition by Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion/toxin
total genus 25
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2gomA00
2WY8Q 2WY7Q 2JVHA 2GOXB 2NOJB 2JVGA 3D5RC 3D5SC 2GOMA
chains in the Genus database with same CATH superfamily
2J5OA 1OJLA 4AIKA 2IAIA 3HRUA 2Z16A 1MMSA 1HLVA 2HZDA 4A3KJ 5IP7J 1VQ5I 1QU3A 4HDVA 5H2FC 3COAC 4I0AA 5B3SH 5J1YA 1XS9A 3QP5A 1C0WA 3MD2A 3KYLA 1J9IA 1S7EA 2HXOA 3K4LA 1I27A 2IJLA 3WG9A 3OIPA 3IH2A 2XB5A 5ILUA 3CUOA 2XDVA 3Q0WA 2H1LA 3DBHB 1ETXA 4EEFG 3I55I 4I99C 4V19K 2JK3A 1D1BA 3LSJA 3S93A 2BV6A 4BE2A 5CKTA 2O61A 2GIVA 4HX7A 2K9NA 2MYSA 2DOAA 3OL3A 1IN8A 2IXSA 2GXGA 2NNYA 2E1NA 4IXAA 2FRHA 4UVAA 3EPZA 4XORA 2NOGA 5E1XA 3RYPA 1FMVA 1YG2A 3QWLA 1USSA 1MGTA 1LEAA 2PQ8A 4CCNA 1FY7A 1DDNA 1J75A 2VBZA 1ZRCA 4JOMA 3FM3A 1I39A 4EM0B 1QPMA 4ZYDA 3GTQJ 1SVOA 4CICA 4EV0A 1HBXG 4WXCA 1RKWA 4D7MA 5FFXA 2A07F 2QKLB 3FWEA 1YRNA 3B73A 4DBQA 3KLOA 4ZC3A 4WXHA 1IF1A 2BY2A 4M71A 1ZHFA 2Y2ZA 3D0SA 2YU9J 1V3FA 1QZYA 3I3LA 2YX7A 3DPUA 1G3SA 1XCBA 2IA0A 3GTOJ 1SD7A 2VQGA 1ETVA 4JK1X 3CJQB 1V5GA 4IRGA 5JHFA 3R0JA 3EUAA 1TL8A 1U0JA 2MFZA 2VKEA 4BDZA 3OSGA 1LDJA 2K3FA 4EJVA 1X1CA 5ILSA 1LB2A 1ACIA 3T8TA 2WV0A 2AHQA 1ONVA 3E6MA 3WTZA 3BPVA 1MBFA 1B59A 1LVAA 3DEWA 1H8AC 1EH8A 1LFBA 3GTKJ 3JSPA 2XF7A 2CFXA 5DYMA 2E5NA 1E3HA 4KNYA 3Q0VA 2M9HA 1YW9A 2EIMH 2YUSA 4P5OA 4IQ4A 1X1PA 3T5XA 1TWFJ 5L3DA 3R4KA 3F6VA 4IEJA 3HG9A 2EFPA 4FX4A 1K79A 1FIPA 3LSTA 2JA6J 3BPXA 4B44A 4AC0A 1J0RA 2E2IJ 4L18B 2L7FP 2F5VA 2M4KA 2OA4A 1A31A 3HEFA 3TO6A 3FZVA 4XN0A 2X51A 1ZARA 3KP6A 2DW4A 2R7QA 3DP7A 4JYKA 2LKXA 3RCOA 1XMAA 5IOYA 2A3SA 3JRHA 4RB2C 1OPCA 4HV5A 2AXLA 1SVMA 3VYTB 3FMSA 4ENJA 3OYNA 2VQLA 5FO5A 5GAHJ 4A3IJ 5LHGA 2HGCA 1WPKA 2V9VA 4RLQA 2F5FA 4JBAA 3W2VA 2R7RA 5JVTA 2NAZA 1DQUA 4WX9A 1I3AA 4PUSA 2X9DA 3P7NA 2XGEA 3F22A 1MMDA 3IKTA 3Q3SA 4LJZF 4DIQA 4IZZA 1IDYA 1R49A 3N05A 5KNLA 2GXAA 2D1VA 1O7FA 5J4YA 2A6EF 2E2HJ 1VQMI 2LY2A 5IP6A 2NYXA 2LTPA 1HOMA 4RDUA 2DFEA 1ZTRA 3H0DA 3MN2A 4G7OF 3VSKA 1TWCJ 1RC9A 4YELA 2QVOA 3LL7A 2OUMA 1EV7A 2JZYA 3SZGA 2CSOA 2P5KA 5LEJA 2BGCA 2PMUA 2ZC2A 5TJJA 4DYRA 3BR1A 2L4AA 1S3JA 2O6GE 3O8GA 2DO7A 1UB9A 3L1PA 3HOSA 1QBJA 1FYLA 1JTXA 4OAZA 1BOAA 3QU6A 4Y13A 2ZXJA 4KIFA 1REPC 1R22A 3FX3A 5F04A 3W6VA 4MEYF 1WCMJ 2HS5A 2DA5A 2RV8A 4HNTA 3JCUC 1BN5A 3TW7A 2E60A 3S15J 5E17F 1ORKA 1D0YA 5BMZA 4E7JA 2LFBA 2O8KA 1GVJA 2EJRA 1DPUA 5J1RA 2EZHA 4E7ZA 3OYEA 1BI2A 3H3VK 3CCEI 3KP3A 3C3WA 1WJBA 1ZELA 2ISYA 4PDKA 4LIUA 1SAXA 5CQEA 1IV6A 4XLHA 2W00A 3F72A 2KISA 1VQOI 4CSWA 2XHKA 2XAQA 5LGNA 4EJWA 1OCOH 5ICCA 5EGOA 4BE1A 1QA6A 3ZP5A 1Y39A 1AKHA 2HEOA 2VONA 3WTXC 5KHDA 2JA2A 3DKXA 5K7FA 1B8IA 3BWGA 1GVDA 1SMTA 1Y1WJ 2A6HF 1QZZA 2FJ1A 1USTA 4D5CA 2R7TA 3GTPJ 3D5LA 1IZ1A 2RC4A 2WBMA 2M87A 4EJOA 5AONA 4B8XA 4A6DA 4IPAA 2WB1A 2IEKA 1IN5A 4YFXF 3LWFA 3IL2A 2IPQX 2K02A 4ZJZA 3DTIA 3TMOA 1BOBA 3HUGB 5JHUA 5E79C 2DA7A 1EKEA 2RAEA 1U5TB 4EJTA 5IT9Z 1X19A 1S8NA 1LE8A 5IT3A 4OMZA 3LQQA 4HSTA 3OV8A 5KCMA 1U5TC 1B4AA 1BJAA 1YW7A 3ZPLA 3FM5A 2X1CA 1W5CC 3PO3J 3FBNB 5EEHA 1H88C 5GP9A 4RMNA 5K1YA 2BVMA 5FKNA 3K9TA 2L7ZA 3CMEI 2G7HA 3V7CA 2QCOA 3J80Z 4XLNF 4IX7A 4Y52J 2BE5F 3MWMA 4C2MJ 3WHCA 3JTHA 2GM4A 1QVTA 3IRRA 4OWRB 3HSRA 1ERDA 2XF6A 4AVZA 1FYMA 3TL4X 2OZUA 1UZCA 4KN4X 1SFOJ 1XGOA 1X1DA 1Y8RB 5D5WB 4WK8F 2YX4A 4RB3C 2B63J 4RGSA 2WC2A 2R7SA 1LQ1A 2IBDA 2DPUA 3OR1C 5IPAA 3TKYA 4HDUA 4LMYA 2YS9A 2IS6A 4BXFA 4C3HJ 1DPRA 4QPOA 1FJLA 3WODF 5FKKA 5HLTA 1RETA 2DK8A 1MIJA 1XGMA 2MW8A 4OU0A 1IUYA 3WE3A 3TO7A 4GDFA 2F4OB 2DBBA 1FPQA 4G7ZF 3S14J 3HHGA 4I09A 5DS9A 2M5WA 2DMPA 3OR2C 1VZ0A 2RQPA 1LFUP 1IG7A 2A6TA 3C18A 3P9CA 3M3YJ 2QF7A 2CWEA 1FNNA 3ZQCA 4BQAA 1UMQA 2HPIA 3ZQHA 2R3SA 3OS1A 2H09A 4HNUA 2UWMA 2ZNYA 3K10A 2A5WA 3C2HA 3LSPA 1V5EA 3OYAA 3CMAI 1YJWI 1FOKA 4CH7A 4CCJA 2DYRH 1W5TA 3E7LA 4HG2A 2OAZA 3HPHA 5DDGA 1VQLI 3L2CA 3V8JA 1OLTA 3RSNA 3HOTA 1D5YA 5FLMJ 1BW6A 2A5YB 2PEXA 1W7PD 4M9ZA 3FIWA 1EA3A 4Y4RA 1WFXA 2QKMB 4G8XA 2EK5A 2LK2A 1FLIA 4RM3A 4L5JA 4O3MA 2BXYA 3C7JA 4C3IJ 3GW2A 4UV8A 3HOWJ 3C1DA 1AHDP 1MNDA 1HW5A 4PJLA 4ZH4F 5CVUA 3PJRA 3HM5A 2DODA 3ZQFA 2WA0A 4ZTFA 2M0CA 2IRFG 4ESFA 3BR3A 2V7FA 1POGA 5D5XB 3H9JA 3BTJA 2GOMA 4M3GA 1H9TA 2FA5A 3A02A 2M8GX 1QVUA 3S1NJ 1SFUA 1PDNC 4WF2A 3DQVC 4RGXA 5CVIA 5JLXA 1HKTA 4F91B 3LFUA 1MH3A 2A61A 4CA0A 5K5RA 1MJBA 2RGVA 3WG7H 1MDMA 4YIFA 3M1CA 4XR6A 5D5UB 1TQMA 2V9KA 4KFCA 3R6SA 4DNCA 2CGPA 2GAUA 5DM6F 2CW8A 2X1EA 5E8IA 3BG3A 1YS7A 4A2UA 2KDZA 5CYVA 1JTYA 5DD8A 2VQCA 4WWCA 4N4NB 4BY1J 2AS5F 4HF1A 1F4KA 2LLKA 2P0WA 1BA5A 4ENMA 1VFCA 2EZIA 4XKCA 4UXNA 2EH3A 5HS8A 1XX5A 2ZXHA 3PNTA 2X6YA 2QWWA 2IA2A 1R9TJ 5HLIA 4BBSJ 3DPLC 1NH3A 1W5SA 3AFHA 1N75A 4HA8A 4U7DA 4U7BA 2CUJA 2V26A 3J81Z 2L0KA 5DCMB 1X58A 1VQ8I 1UHSA 2A05A 3OYIA 2F2EA 2IVMA 2KRHA 4M6VA 5HNFA 1RI7A 2DT5A 4BU2A 4MLOA 4RA2A 1FBSA 2K9MA 2BEOA 5ED4A 3ZMTA 1GT0C 3BCBA 4HRIA 1MNMC 4GYIA 3CO6C 3FBIB 5DCMA 4ZDLA 4U0YA 1HKSA 3MEXA 3CDIA 5EEAA 1J7KA 1ZH5A 2KFDA 2L02A 4I98B 1YOVB 5BPIA 3HOYJ 3LQRA 4CZCA 1A36A 2WTEA 4XKBA 1A04A 2ICWG 1BI1A 2VE8A 2WY7Q 1FSEA 3SEZA 2BW3B 2DAOA 3I71A 4I02A 1PP7U 4E4HA 3KZYA 4H0EA 1RKTA 1R4MB 2P5LC 1IC8A 1W36C 1D3YA 2P7VB 4XLEA 1KQ9A 2JVGA 1IUFA 3A0BC 1P4XA 4M3DA 4S05A 1JUSA 1S7AA 2K9SA 3BT9A 3M8EA 3PNVA 2FMLA 4FQGA 5C44J 3RZDJ 4E6KG 1IXSB 4BH9A 4BACA 4HBLA 4X1EA 2DMUA 3K2ZA 1ZG5A 2COBA 2XRNA 4IHWA 1VQNI 1RUNA 2R92J 3I59A 4J01A 4N9HA 3HJEA 3J7ZI 1HSJA 4A3BJ 1XG1A 4BJ6C 4ZDPA 5A2QK 4GRIA 2DJIA 3OYJA 2CFOA 2BZTA 1A6QA 2M2EA 2I5UA 3W3CA 3TP0A 1BI3A 4UHTA 4XKVA 5HDGA 3WU2C 3K2AA 3WGGA 5HODA 3OYKA 3FK7A 5JFRA 2DOEA 2CV2A 3L7WA 4P1WA 1FT9A 1WSUA 3KIOA 2NVYJ 2K3PA 3R61A 3K7AJ 3JAMZ 4BKXA 3BZCA 2O9LA 5J8CA 1ZRDA 4YFKF 2M34A 2CRGA 1KGSA 3HSEA 4XK4A 2HI3A 2ADUA 2E2JJ 1TNSA 2NVUB 1CF7B 1VNDA 1ON1A 4MHGA 1WQ2A 3R60A 5TGTA 2W85A 3IKVA 1JJ6C 3QODA 3RPUA 2A68F 2E1MC 4E7KA 4DZPA 5EEGA 1STZA 2F5CA 2G7UA 1XGNA 3CLQA 3KP5A 3CCSI 4U0WA 1TZLA 1JHFA 1HDDC 2VUMJ 3KPHA 3TBIA 4II3A 4R8HA 3NWTA 2L7MP 3EUKL 1P7JA 4A0XA 2QA4I 5TISC 3H9QA 1WRJA 3ZCOA 2MC4A 4IOAF 5FROA 3WTUC 2MC3A 1XC5A 5K5QA 1PUFA 2MSYA 1WJDA 5GPCA 4KUMA 2L01A 2XASA 4UUSA 3CCQI 1W0TA 4A3FJ 4C2TA 4MO7A 4AWXB 4B47A 1N77A 2VOOA 3GZ6A 1GUUA 3CC7I 1W7PA 1M1EB 1AOYA 1DGRM 3WTYC 4C30A 1D8KA 1VTNC 2EILH 2ZMEC 3SQNA 1FOWA 2MLKA 5E3OA 4HV6A 2Q1ZB 5IOZA 1D1CA 3FXLA 2EINH 3TP3A 2XGCA 1F36A 2KZVA 2DMNA 2CMPA 4LOCA 5J4VA 2QSFX 2ZMEA 5F64A 4Z2YA 1RESA 3TO9A 1Z7LA 3HRTA 2V1DA 3DTKA 1JKOC 1TT5B 3OL4A 3VODA 3BG7A 3U21A 4P9UA 4BDYA 2LKSA 2MBFA 2X1DA 2JQ7A 2QM3A 3B02A 1S6LA 5DTDA 1D1AA 3K70D 2BVLA 2EV5A 2RNJA 3DPTA 3DXJF 5K7HA 1A6IA 4M3EA 4BEHB 2NVXJ 2JUGA 2W48A 3ELKA 4PSXA 1ETWA 4PGHA 1JUMA 3BG5A 4NB5A 2FOWA 1IN6A 2TRTA 2G9WA 4LFUA 5FKMA 4B1RA 1QQIA 1DP3A 4A3CJ 2K7LA 4XLPF 2HYFA 4BEHA 3QPLA 3KEYA 3M9AA 2BY1A 1F1ZA 1IN7A 1SFKA 3OYBA 1FP1D 4IRHA 1QGPA 1ZGWA 1QZEA 2CQQA 4HX8A 4E7SA 1YJ9I 5DM7F 3CCUI 2EB7A 2VB6A 2FD5A 2LY1A 4JP0A 5LHIA 5L3EA 2HDWA 2OJED 5L3GA 2DYSH 2LP0A 1I1GA 5M3FJ 4V2FA 4V2GA 4BBRJ 1I1SA 2DA6A 3PSIA 4F93B 4O5VA 4IO9F 2EFNA 4CZZA 2QQBA 3I5UA 2NS7A 2W25A 4ZDOA 4TV7A 2C6YA 4NUBA 1MW7A 1U3EM 3EDPA 4ANJA 2FQ4A 1IRFA 1ZQ3P 4Y33A 2ZNZA 2DA1A 4NC6A 1P7IA 2IGKA 2Y30A 2KQRA 4D1QA 4AM3A 3S2WA 3VSLA 4BYYA 2EBIA 2ZJPF 3SHFA 3G6EI 2V79A 3AG3H 4XN3A 4Q47A 4XQFA 3K0LA 1KU3A 3RKWA 4IHYA 1BR2A 1SD4A 4LLNA 3FK6A 3H35A 3CESA 5DUKA 1SAUA 5E18F 4B48A 3NARA 4AIDA 5DEQA 2JA7J 4BQNA 1E0EA 2VLAA 4ENKA 4I7HA 5GTHC 3ISPA 3HOVJ 3V7RA 1ON2A 2I8DA 5J40A 2ME0A 3J7AY 2TDXA 4A3GJ 3TEDA 3I64A 1G8XA 2Y9ZA 3W6JB 2RN7A 4G6TB 3FDYA 2R0QC 1D0XA 4GCVA 4F52A 1J5YA 3CJRB 3S32A 3WHBA 4XOTA 4Y17A 1W0UA 1B6AA 3BOQA 2OCCH 2O7OA 2XF5A 3GWZA 4ETSA 1OCPA 3VPRA 1HA8A 2K27A 2DDAA 4MFEA 2L9NA 3ECOA 3HGYA 2EIJH 1X4OA 1K83J 2MH2A 4P96A 2W7NA 2E19A 4NQWB 3E5XA 3MFKA 4OIOF 1YIOA 3V4GA 1QHHD 3ZN0A 1H9GA 2FX0A 1JT0A 3A0HC 4KIBA 3DV8A 3F3XA 4FISA 3LNQA 4HEA2 2ZFWA 3S3OA 1LFPA 3CD6I 2ESHA 2K4BA 5B1BH 2CG4A 4AVPA 4W1UA 3OMYA 3I4NJ 2MA3A 4L0ZB 1N78A 1LJ9A 2QLZA 2ZSIB 2D2WA 2Q0OA 4U88A 4F92B 2KJBA 1K78B 5J1UA 4A5NA 2KL4A 5JI6A 1YW8A 3FXJA 4LG3A 4PJMA 3L2VA 5FFZA 2KP6A 2DDBA 2DFFA 2PMZN 4PFOA 3ASOH 4N0BA 2Q2EB 4AU7A 3CP8A 2QEXI 2OTLI 2E35A 1E3PA 1B9NA 1O57A 3H1CA 1ENHA 4L5EA 2MLGA 2YSRA 2KDOA 3LA2A 2Z33A 4KN7X 4A6EA 2BBYA 2LF7A 1S9HA 2XGDA 4E7IA 2PG4A 3N97A 1T33A 1BL0A 5FB2A 3T1BA 3PFYA 1QHGA 3VOEA 2XKPA 3K4JA 2EA4A 5B66C 2H6BA 4XL9A 2WV1A 2HTSA 4BQOA 5K5OA 2JVHA 4Y3OA 3FXKA 3U2RA 1OCCH 4OAYA 1VQ4I 4LG0B 2IGNA 2Z99A 2P7CB 2HFHA 1WJFA 1XMKA 2XIGA 3SFIA 4M6XA 5IY5H 3F21A 4EQQA 2DJNA 3IH3A 2QGUA 3ABTA 2IW5A 1WI3A 1IV8A 3W2WA 1JKRC 1GV5A 3PL8A 5E1ZB 3L2UA 4FTHA 3ULQB 2L7KA 4EM1A 1PUEE 1ZKGA 2GZWA 3L09A 4NNJA 5F6FA 1WKMA 4LG0A 3ZR8X 4J19A 2CQNA 4UY8I 1VQ6I 1FTTA 3QRFF 5M3MJ 4A3MJ 4UNOA 3E6DA 3G2BA 3ERED 2NVQJ 3HHHA 3K70C 3PSFA 3WTSC 3CTAA 2ZKZA 3QYEA 3E5UA 2NRAC 1WZ2A 3CMMA 5CQGA 4Z6YA 1R5ID 3UKGA 2M30A 1FEXA 2F5EA 3C2BA 2KIFA 5F27A 3AAFA 4S04A 4JQFA 2DT6A 2KIQA 2MGQA 1MSEC 2JRTA 1JXSA 4OIRF 3TOBA 2F48A 4DZJA 1GHCA 3CP2A 4UVBA 1TWAJ 3ZGKA 2BXZA 1VF9A 1FSHA 5M5XJ 3FMQA 5ILVA 4ZYEA 2M7BA 2RKHA 3BR2A 1DUXC 2CW7A 3SZPA 4KISA 3F6OA 1BW5A 3WU1B 5HOOA 4KIGA 2YU3A 4PSWA 5HNHA 5LRSA 3EYYA 1KYWA 4RAGA 4ZTJA 4E7LA 1HQCA 1OQYA 1WJAA 4OMYA 1HKQA 1U6GA 3H5AA 1D5VA 1T39A 3OYFA 5JVGF 1W36D 2FXAA 1IW7F 3IWZA 2JUCA 2HQAA 3FISA 4IRIA 1MBKA 4E70A 5HS9A 4ON0A 1S7OA 3FXUA 5J47A 3MKZA 4FHTA 2KZGA 3CJTB 3EYIA 3R0AA 3HUGA 1U5TA 3GTLJ 2O3FA 3QYFA 4F7ZA 1U8RA 3KP2A 2W1OA 1Z1DA 3RQ4A 3V8LA 2DFHA 3CMYA 1HW1A 4Q48A 1Y6IA 3S8PA 3ERMA 4C9YA 3Q0UA 2LBFB 1I5ZA 2LOOA 4BJ5C 5D4RA 1KA8A 2MG4A 3OYGA 2GA1A 2CU7A 4DGWB 3KZIC 4PK4A 3V8KA 1Z3XA 1FX7A 3Q9SA 1N25A 4Q5SF 4PCQA 3HL2A 4MEXF 3LSHA 2IP2A 1ULYA 5C3EJ 2JA8J 4UB8C 2O5RA 2BY0A 2ELKA 3BTCA 3ZQ7A 2ZCWA 2DN0A 2IGMA 2WY8Q 4AUXA 3RPUD 1IRZA 1TW3A 2M1BA 3ZQGA 3JRBA 1G4DA 4HQEA 1MZBA 1YJNI 2E7XA 5FGMA 4GGGA 3DU6A 3HKZN 1ZLKA 2ZXWH 3ASNH 2IT0A 3BY6A 3CCVI 2VODA 3GUDA 3GX4X 2VBXA 1D0ZA 3L00A 3SFZA 2AXTC 1J2XA 2QSHX 3KE2A 5FD6A 5LGTA 3QPSA 5D5VB 2R7WA 2J5PA 5EG0B 1Z3YA 1P9QC 4A3JJ 2PMHA 3L2RA 2EFQA 1YS6A 4PJ0C 2OF7A 1YIJI 4KJZA 2ZJQF 1OCRH 2DQLA 3DU5A 3LSKA 3IAS2 3N4MA 2B0LA 2KHMA 2OTJI 2H1KA 2NS8A 3ZQLA 2LMDA 4XICA 5F08A 3A01B 4KA4A 1E17A 1HXDA 3DKYA 4AD9A 4EATA 4YFNF 5JLWA 2PBIA 1Q1VA 4CCMA 1IGNA 1MH4A 3B6CA 3P9IA 4A93J 3BZ6A 3M8JA 4R1HA 3RJPA 3CLOA 2V4JC 2B9SA 1LPQA 5FLVA 1P2FA 1ITYA 3CJNA 2EPFA 4Y15A 4FASD 4O6JA 3LSGA 1Z9CA 3JRCA 3OIQA 3S2DJ 2VT2A 3S2HJ 4RAFA 2DTRA 3NRVA 3OYDA 1JGGA 1Z7UA 3OWTA 1Z21A 3HIFA 3B6AA 3K69A 3Q5FA 5CJ9A 3K4CA 1NG7A 2KIMA 1SD5A 3V7SA 2X4HA 1YFHA 4OIPF 4EJUA 2VL8A 4FE7A 5HDKA 3ZXSA 1U78A 3OS0A 4B43A 5F0HA 4HF2A 2KRCA 2P81A 3MCZA 4ENNA 4GYGA 2AQEA 3RKQA 3W2AA 2VC0A 3GEZA 2VC1A 2LDUA 1X4PA 2R7OA 2CO5A 2H8WA 4ZZLA 2WAQN 3BR6A 4LB5A 1F43A 2QBYB 3HDDA 3SJMA 3BQZA 1VQ7I 4JX4A 4MQVA 1EJ9A 3C2GA 3FKIJ 3I9V2 3VFZA 4DYCA 1HCRA 4CYCB 1FC3A 3CF5F 1TP4A 4BJTA 5M5YJ 2NNNA 1BIBA 2OCEA 4DJAA 3FXQA 1K4TA 2HOTA 1X3UA 3ZN1A 4BGDA 3JRFA 4IVNA 5FRNA 3ABKH 1CQTA 2KIUA 4A3EJ 3TDZC 4CCOA 2Z1DA 5L3CA 4QPQA 3HXLA 3KEQA 4LD5A 2D45A 4FT8A 3FHZA 1ZR2A 5C4XJ 2E34A 3H3ZA 3I4PA 3CCMI 2VE9A 2V1NA 3JTGA 2EV6A 2VJ5A 3E1SA 2GLOA 1WH7A 2GWRA 3VWBA 2L5QA 4B4CA 2XPWA 3F9KA 1SMYF 1Y8QB 3J81K 4A12A 3FXRA 5D4SA 1O7LA 2XRLA 2UV1A 3U1DA 4I0BA 4EMSA 1XSXA 4IHTA 2HTJA 3NEUA 2HR3A 2EIKH 4DOZA 3CUQB 4M74A 3G1OA 2VPLA 3F0CA 2XAFA 1QPIA 1TW2A 1UFMA 2D5VA 2DXIA 1GXQA 2CUZA 1ZR4A 2R5ZB 1EH7A 5J6XA 3CUQC 1Z67A 1W1WE 2LC2A 3RTRA 3ECHA 3F8NA 2BW3A 4HYEA 3CUQA 4AIJA 3L9FA 2ELJA 3ONQA 3GVAA 1QNTA 2QUFA 1LVKA 1UG2A 4L9NA 5BNGA 4G6DA 2L9SA 3DWLE 1FIAA 2K4JA 3KP7A 4ABZA 3BTIA 1OYWA 2Q8KA 2CJJA 2M7AA 3A4CA 3H3UA 2R7FA 2X85A 1P92A 4R79A 3L2WA 4S0HB 3AL0B 1KU9A 3TGNA 3LA7A 1R6RA 1J59A 3DKWA 5EYRA 2ETHA 3H5RA 3QYBA 1JKQC 2VJIA 1JT6A 1V4RA 2QENA 3EETA 4NBQA 3AL0C 4RAZA 2K9QA 2LR8A 4A69C 1ZGJA 2Y0SN 3I0TA 4OIQF 1R1TA 3MZYA 3EQLF 1R58A 1TWHJ 3AKZA 1TC3C 3WGIA 1B1BA 3CCYA 2JRMA 3K4MA 3T8RA 2XROA 3GF2A 4MFDA 2Y69H 2P5VA 2ECCA 3GFIA 3OSFA 2WWYA 1R1UA 4BAYA 2QQ8A 5D6FA 5CVVA 2CV0A 3KZZA 3CO7C 2FE3A 4BHCA 3BJOA 2FBKA 1SFEA 3JRAA 5FLXZ 3IWFA 4HAMA 2IS2A 2E5ZA 1W4MA 2PLYA 1FYKA 4RM2A 1R36A 2HYJA 2V6CA 3JAMK 1CF7A 2R7ZJ 5LLQA 2RVCA 4L0YB 5H6QA 2PX9A 5KK1A 4DBRA 3PIPF 2ID3A 4OOIA 3CQZJ 4BE0A 1FOXA 4ZYAA 1RR8C 4M6YA 5BPDA 2PJRB 1Z0XA 4YEJA 4QWQA 4AYBN 5E20A 2DOFA 1IRGA 1G2HA 5B1AH 2DA2A 3RKXA 2UXNA 4YG2F 4A0ZA 3LAPA 2DQRA 1K4SA 1YO5C 1FBUA 5CPRB 4LIVA 2JPBA 2VKVA 1F9NA 3HRSA 1JHHA 2WAEA 3CC2I 3VDXA 2PMZA 3KYDB 3MZ8A 1IXCA 1Z6TA 1B72B 1DU0A 3SXYA 1A5JA 1IDZA 2OPTA 3WU0A 3WTVC 2VKDA 5AIPA 5IYDJ 5HDNA 2E7WA 1TQIA 3MAJA 5IP9J 2P4WA 4HW0A 1VI0A 2L2OA 5LFAA 1BI0A 4YIRX 2H8RA 3MKYB 4BQQA 2LG4A 4LGWA 1OKRA 4M3BA 1OFCX 4CO8A 4Q4ZF 1BJZA 3LSIA 3O8HA 1MBEA 1XD7A 3NWSA 1SC7A 4NDLA 4I2OA 3A1YA 3K1NA 2IA1A 4OINF 1J09A 4WXDA 5C4JJ 3FXOA 1U9NA 1BR4A 2H27A 2PJPA 4BUPA 4ESBA 3CCLI 3NAUA 3MKWB 5HLGA 2VIXA 2XVCA 5CVRA 2EFWA 3GTGJ 9ANTA 4QSHA 1JJ8C 2R4GA 2JMWA 1XSDA 3IC7A 1R23A 3RYRA 2EA2A 1NTCA 4MGRA 1UG0A 4XRFA 3ZQQA 2LD5A 4FETA 2HNHA 4KT5C 5HLHA 2FF4A 2XUBA 1VQKI 2F5DA 1VQ9I 2XV4S 3E0JB 3G4SI 4MIMA 1V54H 2GQQA 4BHPA 1YE9A 2ZO4A 2XSDC 3ZMUA 3DBRB 5EZHA 1Z05A 4B3AA 4B3XA 4ZZDA 4XBFA 4PGGA 1S5LC 2VQHA 4KICA 4G6QA 1MMGA 1HSTA 2VJJA 2E1CA 5GPAA 4NC7A 3D5SC 4H4KC 5E3NA 1WJ5A 2PN6A 3DFGA 2FQ3A 5EJCA 3O2PE 1KU7A 1ETYA 1OYIA 3QOPA 5D6EA 4KMFA 2STTA 1NG6A 5GAEJ 2KKOA 4I01A 5B5EC 4A0YA 3IRQA 4HNVA 3G73A 3A2KA 1YX5A 2CUEA 2KJCA 4IJAA 3T0YA 2FNPA 1YRNB 2CW0F 2O03A 3KLNA 3O6BB 3ABMH 4DW6A 1L3LA 4K2EA 2NS0A 3ABLH 3RZOJ 2VXZA 3IAM2 4MQ9F 1Y56A 2M0MA 5FD5A 4A3DJ 4LITA 1OR7C 1MKMA 4XRSG 3IV5A 1T6SA 3P9KA 2GBYA 2OQGA 2L3DA 3RIRA 4YIIA 2GXBA 3AG2H 2IS4A 1OR7A 2R7DA 4I6ZA 4XM3A 2KRFA 2JSCA 4HOBA 5TRDA 3CC4I 2K85A 1WJEA 3CF2A 3GXOA 2IS1A 4F55A 2Z5UA 5LBQA 1YI2I 1GV2A 3G1LA 3I54A 5F1JA 2HU9A 5J3LA 1KQ0A 2X6WA 3G3ZA 2CQ7A 3HZJA 2M45A 1BM9A 4D9JA 2HQ5A 3S3NA 2ZBKA 3F8BA 2DMTA 2F4IA 3MZHA 2LNBA 2W24A 2I10A 3BP8A 3IUOA 1LNWA 3BR5A 4P55A 4DYQA 2JPCA 3KCCA 2HDCA 3HRMA 3VB2A 1D8JA 1SD6A 2LRDA 3MKLA 1G59A 2Y75A 2WADA 3U1KA 4BL0B 1Q1HA 3KFWX 4Y7NJ 3SDBA 1LKXA 3DEUA 1UJ8A 3KETA 4CYDA 3ESWB 1K7AA 3PNYA 4ITVA 4RAYA 2HOSA 2LSOA 3HKZA 3IHUA 3A03A 2MD0A 5KVRA 3LMMA 2GOXB 3O3KA 1ZN2A 2W84A 3FHNA 3BJ6A 4RS8A 5BOXA 2BHZA 4HPQA 4XONA 3BG9A 4NQWA 3IP4B 3DF8A 1OMIA 2QZ8A 1YTYA 1YITI 3SEQA 3CDHA 4EGZA 3ABUA 4I76A 5ICFA 1TWGJ 3GLLA 1MJ9A 2EFOA 3CCJI 3KEOA 2ACJA 2PFBA 2XPUA 2QQAA 3PM1A 4BXUA 4M72A 1XPXA 4G94A 3RI4A 2OZ6A 1DU6A 2FBHA 3CDLA 4EGYA 1K78A 4FCYA 4L5IA 5F1RA 3GFLA 3OYCA 2RQQA 1UELB 2OU2A 1FMWA 2Q2EA 3M1EA 1O3QA 1G3WA 4XKWA 1LDDA 2NXNB 1IJWC 4MTEA 1KZHA 3L2QA 3BROA 1R4NB 5FKOA 1JUPA 2HQRA 2KT0A 1GLNA 1U2WA 3HTUA 4N9IA 2UZKA 4HF0A 1Z6RA 3BZKA 2VJ4A 4X0GA 1FP2A 3WGHA 5GAGJ 3MMYB 2N8GA 2BY3A 3BG6A 3DBLB 3GFJA 4GO1A 4HX4A 2K5CA 1GDTA 2O0YA 2Z9OA 5EDNA 3ML6A 2M8EA 1RRJA 1ZREA 1B9MA 4C2UA 4PZJA 1U9OA 2EV0A 2R7VA 1SFXA 4UUTA 2M3AA 3RKYA 3F8MA 2DTZA 1FWZA 2R5YB 3S3MA 3I56I 1G3YA 1A35A 4LLLA 1G3TA 5CVJA 3TOAA 4CXFA 4RGUA 3LSRA 2CH0A 3DEEA 3K4NA 3V42A 1WVRA 2MD5A 3FMRA 1P4WA 2JSPA 4P9FA 2VKHA 5KAIC 1ZG3A 2IGOA 4KT6A 3HOUJ 1AWCA 2WAQA 4CCKA 5EGOB 2GIZA 1T38A 2X0LA 1AKHB 3I53A 1ETOA 1YQAA 3OS2A 2DPDA 2Y9YA 2R5YA 4MNUA 4II2A 1FOYA 3OYLA 4A3LJ 1B8IB 1K6YA 1U8BA 1RNLA 3TW6A 4IHVA 3IH4A 3WE2A 2LH9A 4PJJA 4XSZF 3FXMA 3TQNA 3BJAA 3ROUA 1Y0UA 3P5JA 3QU3A 1K6OA 2ME6A 3W6KB 4G7HF 1Y0NA 4HZFA 2X6XA 2HQNA 3ZRGA 1MJAA 2BHYA 5DV5A 1MMAA 1X1AA 1HC8A 2P6TA 2FSWA 1I3QJ 4NC8A 4NHJA 1XN7A 2HVQA 1S72I 2V6EA 2Z3YA 3MVPA 1LE8B 2OV7A 1X2MA 3JRGA 4U87A 1UAAA 2ZXIA 3SZTA 1MBHA 2F4MB 4RB0A 1YHQI 5H6RA 3QP6A 3KX2A 2XGXA 1FTZA 1YX3A 2XKOA 1HDPA 4LLGF 4XSXF 3LA3A 1ODDA 4RLFA 4CUGA 3LOCA 3WTTC 1PP8F 2HOAA 3JRDA 3REOA 5L3FA 2VN2A 4C3JJ 5IT9K 2F6CA 3S17J 3PUBA 1IRXA 1RZ4A 4XMYA 2ZJ2A 1OCTC 3HYIA 4BXXJ 2HYGD 1IO2A 1R71A 4F3QA 1LUJB 2BYVE 1DGWY 4IOCF 2EZLA 4GFBA 4IQJA 1S29A 1TT0A 4CDGA 1R00A 2VI6A 3VYUB 2R7XA 1E3OC 1I6HJ 2JJ7A 1CGPA 2HVRA 2LBFA 4CHUA 2W4SA 2Y31A 1T95A 1WJCA 2LKPA 3H5NA 2W57A 4IL6C 1UHWA 3J80K 1V55H 2XAUA 3JREA 5E1WA 2Y0MA 5ICGA 1KYZA 1PJRA 2VT3A 3S1RJ 3GLXA 1ZGAA 2MABA 2LREA 1R5GA 4XLCA 4XLFA 4MTDA 2XB0X 5LGUA 1XSVA 3BQYA 5D8LB 3DLLF 2K9LA 4JX5A 1I6XA 4U0VA 2CQKA 3BCAA 2WAFA 3OIOA 4ASNA 1KU2A 3M07A 4M3FA 3JR9A 2QQ9A 4PJNA 5GTIC 2Y0SA 2H6CA 1JKPC 4HLYA 3DTEA 3CZ6A 5GADJ 3QPHA 3BC8A 1AU7A 2O8XA 2E36A 3RDIA 1IN4A 1P4AA 2JWTA 5ERIA 2W82A 3LSMA 2HXIA 3UNGC 3UR3C 2DLLA 2HOEA 2G0EA 4XIDA 1V5FA 3U9GA 3D5RC 1ETQA 3HGGA 3BLYA 1O4XA 1OISA 5EG0A 3MQ0A 1XDUA 1XTAA 2LVSA 4M73A 2ZSHB 5M5WJ 2M4GA 4L9TA 4KMUX 1EH6A 4RB1A 2VPRA 4CCLA 2E1OA 2D1HA 4XRSA 1Y1VJ 4N4OB 2DU9A 2DA4A 3G1MA 3GMEA 1NHAA 1T98A 2E71A 4XRMA 4AYBA 2OD5A 2V9PA 2DK5A 5DD4A 3A01A 3GYHX 3M4OJ 1R7JA 1ZLJA 3I4MJ 4QIWN 4G12A 2STWA 3HOZJ 1FZPB 1AA7A 4B09A 3ZMSA 1T2KA 5IYBJ 1H89C 1O3TA 3DLAA 2ID6A 2JT1A 1XCVA 3M7GA 3BR0A 5F0FA 3VEPA 3F23A 3WTWC 1X1BA 1XB4A 3JSOA 2P6SA 1F5TA 5KAFC 4RBOA 2HKXA 4IHSA 1RUOA 5LRRA 4IKFA 1MDMB 3K4KA 3NQOA 1JI8A 1WHUA 2K40A 2XAGA 3OYHA 4D7NA 4L9VA 2FEZA 1XGSA 3K6GA 3ZOBA 2L54A 2Y48A 2UXXA 1KONA 4XOPA 3BDDA 3E3VA 3QAHA 3ZQIA 1BBYA 1APLC 1DP7P 3S1MJ 4GXOA 4FE4A 3E97A 2DCEA 2XAHA 4BY7J 4ESJA 3I58A 4PFPA 4DQ2A 3M8FA 3VYSB 5IYCJ 4D0PA 4BHBA 2L9RA 3DCFA 3K1MA 1TBXA 1Z77A 4A5MA 1RR7A 1T0FC 2L9VA 1SEUA 1E2XA 3G71I 4XNFA 1TTYA 5H20A 3VYRB 4CGZA 2HVSA 4LB6B 1T0FA 4FX0A 2QBYA 5LHHA 2Z2SB 1ZK8A 2DFIA 3HBLA 4BNCA 1X2NA 2OQRA 1X3WB 1MSFC 5JR3A 5LEKA 2CUFA 4CYCA 1T08B 1Z91A 2V1UA 1LEBA 2B7EA 4E7HA 2LF8A 2JN6A 2GA2A 2CS3A 2X48A 3PO2J 3AG4H 2AO9A 2XC7A 2EZKA 1JGSA 2X6OA 2HDDA 2WB1N 2ISZA 3H0GJ 1WGXA 2XAJA 3E5QA 5FRMA 2R7UA 2BOLA 4ZYHA 4EVIA 4UV9A 6PAXA 1T8IA 2ECBA 2H94A 1L0OC 2VXDA 2PI0A 5J8FA 4KYWA 3S16J 3OOPA 5HVQC 3PIOF 2DT7B 2ESNA 2ZJRF 4KDPA 2QYOA 2NOJB 1EF4A 1NK2P 2EQRA 4JX6A 3AG1H 2FBIA 5CLSA 2FMYA 3LAJA 1OYYA 1KQ8A 1OCZH 1IXRC 1TQPA 3FKJA 2HKOA 3GBGA 3E6CC 1IAWA 3ZMZA 2DA3A 4UB6C 2ZFUA 3FF5A 3K4BA 2TCTA 3E6BA 2DMQA 2V1XA 1WWXA 4W97A 4KITB 3OYMA 2KPMA 1LDKB 3JRIA 5BS6A 2R93J 1G6NA 2JA5J 2K86A 1PVEA 5A2QZ 3ZMVA 1MNEA 3RPQA 2R5ZA 1QRYA 2CV1A 3I59B 3F8FA 3K1PA 3J7YJ 5HS7A 4YRVA 3H92A 4RGRA 3SDGA 1UCRA 4IHXA 1R1VA 2LY9A 3GZNB 2XPVA 3KP4A 3HPGA 4M9XA 4LK1F 5EF6A 2KLOA 4X6AJ 1RPWA 4QTRA 3H36A 2NVTJ 5DUIA 1UHMA 2RREA 2ZB9A 2COMA 1ETKA 1BC8C 1MBGA 2AQFA 5FKLA 1NK3P 2DI3A 5AIQA 3HC7A 1XMXA 2VBWA 4WCGA 5E3MA 1JE8A 3OOUA 1BIAA 1YYVA 2FOKA 3PQJA 4IF4A 1HF0A 1T56A 3QOEA 4BS9A 2P8TA 5BQTA 5F0CA 1QO0D 4J00A 1H0MA 3F8CA 1SVLA 1YLFA 5D8KB 4EM2A 4LK0F 3TDUC 2A69F 2JTVA 1BC7C 4QLCU 2FUG2 3GO5A 1RIOH 1GXPA 2OBPA 2VBYA 2E1MB 3PQKA 4HSRA 3S1QJ 5FJ8J 1PYVA 2UUZA 1HW2A 2EWNA 3RQIA 3QPTA 3ZMDA 2FU4A 3PUFA 1O3RA 1TLHB 2VOPA 2RDPA 1ZG1A 1K61A 1TNTA 4UVCA 5K7ZA 3QQAA 4G9YA 3J7AO 2XSJC 5DCFA 2CQXA 4XLAA 1PUFB 1BR1A 5EZGA 1P6RA 5FLXK 3GZ5A 4UUSB 3HSFA 2YPRA 4UUVA 3H9GA 3Q9VA 1ZYRF 2PJRA 3JW4A 3HOXJ 1W7PB 3HTSB 1I50J 3BTLA 2HZTA 2FNAA 3D1NI 1SANA 2QSGX 5E3LA 1MBJA 3HB9A 2HPMA 2VASA 3LFKA 1R5HA 4HLXA 3EUHC 4L9JA 1MMNA 2KMUA 3GTMJ 5LD2C 5E8GA 3X2QH 2CYYA 2HWVA 2L4MA 3PFIA 5ICEA 1MD0A 2ZMEB 1O3SA 3GCMA 2MH9A 3GTJJ 1XDSA 2OC6A 4AIHA 1WI9A 2YR2A 3EUHA 4ZYGA 1B72A 4HQMA 1FBQA 2ELHA 3GFMA 5L3BA 1ZAOA 4D5FA 3KYCB 3CCRI 1ZRFA 3OY9A 2RNGA 3SYTA 2LYCA 1VQPI 1X3ZB 1WH5A 4M9SA
chains in the Genus database with same CATH topology
3BCBA 4HRIA 3FBIB 4ZDLA 2IGMA 2Z16A 2WY8Q 2HZDA 3RPUD 1QU3A 4CZCA 4XKBA 3DU6A 2WY7Q 3SEZA 3MD2A 2BW3B 3OYCA 3KYLA 2RQQA 3K4LA 1UELB 4E4HA 3OIPA 1FMWA 1W36C 4XLEA 4XKWA 2JVGA 2XDVA 1D0ZA 3L2QA 1D1BA 3S93A 4BE2A 5CKTA 3PNVA 2R7WA 4E6KG 1GLNA 1Z3YA 1P9QC 2MYSA 2DOAA 3OL3A 4BACA 2VJ4A 3L2RA 4X0GA 2IXSA 3MMYB 3BG6A 3EPZA 4KJZA 4XORA 1FMVA 2K5CA 3DU5A 4J01A 3LSKA 3IAS2 4BJ6C 4C2UA 4ZDPA 4CCNA 4GRIA 2KHMA 2DJIA 4JOMA 2R7VA 3OYJA 2CFOA 3DKYA 3W3CA 4EATA 2M3AA 4XKVA 4CCMA 3OYKA 3S3MA 2QKLB 2CV2A 4P1WA 3M8JA 2CH0A 4DBQA 3DEEA 2V4JC 3K4NA 4ZC3A 3V42A 4FASD 2JSPA 3LSGA 2K3PA 2VKHA 2IGOA 3OIQA 4KT6A 2WAQA 3I3LA 4CCKA 3DPUA 3OS2A 3OYDA 2VQGA 3CJQB 3OWTA 4II2A 3OYLA 1V5GA 5JHFA 3EUAA 1K6YA 1Z21A 1U0JA 2MFZA 2LH9A 4PJJA 5TGTA 4BDZA 3QODA 1X1CA 3K4CA 1NG7A 2E1MC 4E7KA 2X6XA 2VL8A 3ZRGA 3ZXSA 3OS0A 1MMAA 1TZLA 1X1AA 4B43A 2KRCA 4NC8A 3TBIA 2XF7A 4II3A 2HVQA 2E5NA 3NWTA 2V6EA 3EUKL 2AQEA 4P5OA 3H9QA 2OV7A 4IQ4A 3W2AA 3ZCOA 2MC4A 4U87A 5FROA 1UAAA 1X4PA 2R7OA 2ZXIA 1WJDA 3HG9A 3KX2A 3C2GA 1YX3A 3I9V2 4B44A 4RLFA 4C2TA 4CUGA 2F5VA 2M4KA 4BJTA 4B47A 1N77A 4DJAA 2F6CA 4XN0A 1DGRM 3PUBA 1IRXA 2X51A 4XMYA 4C30A 2R7QA 4BGDA 4F3QA 2Q1ZB 5FRNA 1DGWY 1D1CA 3RCOA 4IQJA 4CCOA 1TT0A 2KZVA 2Z1DA 2CMPA 4QPQA 3HXLA 3VYUB 3VYTB 2R7XA 1Z7LA 3OYNA 2VQLA 3DTKA 3OL4A 2HVRA 2LBFA 2W4SA 3BG7A 2V1NA 3U21A 2VJ5A 1T95A 1WJCA 3H5NA 4BDYA 2X1DA 3E1SA 3VWBA 2L5QA 4RLQA 1D1AA 3K70D 2BVLA 2XAUA 3F9KA 3W2VA 2R7RA 1DQUA 3DPTA 4BEHB 1PJRA 2UV1A 2JUGA 4PUSA 4PSXA 2MABA 2LREA 4XLCA 1MMDA 4XLFA 4DOZA 4IZZA 4DIQA 3N05A 5KNLA 2VPLA 2K9LA 3BCAA 2DXIA 2WAFA 2CUZA 1DP3A 4PJNA 2LY2A 4BEHA 2LC2A 3KEYA 3RTRA 2Y0SA 1SFKA 3DTEA 3H0DA 2BW3A 3OYBA 3CZ6A 3BC8A 3VSKA 4E7SA 2VB6A 2ELJA 4YELA 3LL7A 3ONQA 2LY1A 2OUMA 2W82A 3SZGA 3LSMA 3UNGC 2HDWA 3UR3C 1LVKA 2L9SA 3PSIA 4F93B 3DWLE 1V5FA 3D5RC 3BLYA 3HOSA 2M7AA 3A4CA 4OAZA 2X85A 4R79A 3L2WA 3AL0B 4ZDOA 1R6RA 2ZSHB 2M4GA 4NUBA 1MW7A 4HNTA 3H5RA 4CCLA 3QYBA 2E60A 4ANJA 4N4OB 2VJIA 1D0YA 4E7JA 3AL0C 4Y33A 4AYBA 2IGKA 4E7ZA 2KQRA 4D1QA 3OYEA 3VSLA 1AA7A 3AKZA 4XN3A 1WJBA 1ZELA 4XQFA 3K4MA 3DLAA 1BR2A 4LIUA 5CQEA 3H35A 4XLHA 1X1BA 2W00A 3CESA 1SAUA 4CSWA 4B48A 2CV0A 4BE1A 4BQNA 4IKFA 1E0EA 2VLAA 3K4KA 1JI8A 2IS2A 2E5ZA 2I8DA 3OYHA 5KHDA 4RM2A 2JA2A 3DKXA 3J7AY 3K6GA 1KONA 4XOPA 1G8XA 4DBRA 4G6TB 3FDYA 2R7TA 3D5LA 4BE0A 4ZYAA 2WBMA 1D0XA 4F52A 2DCEA 3CJRB 2PJRB 3S32A 4YEJA 4XOTA 4PFPA 2WB1A 3VYSB 2XF5A 4ZJZA 3DTIA 3TMOA 1BOBA 3HUGB 1HA8A 1T0FC 5CPRB 4LIVA 1X19A 2L9NA 2WAEA 4XNFA 3VDXA 3VYRB 1X4OA 4HSTA 2PMZA 5KCMA 2HVSA 2Z2SB 2X1CA 2W7NA 3FBNB 2VKDA 4NQWB 4RMNA 4E7HA 1QHHD 2BVMA 2CS3A 2L2OA 5LFAA 2XC7A 4HEA2 4IX7A 3MKYB 3S3OA 4BQQA 2LG4A 1LFPA 4OWRB 1ERDA 3LSIA 2XF6A 4AVZA 3OMYA 3NWSA 3TL4X 5FRMA 2R7UA 2BOLA 1X1DA 3A1YA 1N78A 1J09A 2ZSIB 2R7SA 1BR4A 4F92B 3OR1C 4BUPA 2KL4A 2IS6A 4LG3A 4PJMA 4BXFA 3MKWB 3L2VA 2VIXA 2VXDA 4QPOA 2KP6A 5HVQC 5HLTA 2DT7B 4PFOA 2Q2EB 2NOJB 4AU7A 2R4GA 3CP8A 2KDOA 3OR2C 1UG0A 1VZ0A 3FKJA 3ZQQA 3GBGA 4FETA 2HNHA 4E7IA 1S9HA 2A6TA 2ZFUA 3K4BA 3OYMA 4KITB 3E0JB 3PFYA 2KPMA 1LDKB 1QHGA 1YE9A 2HPIA 3K4JA 3OS1A 4BQOA 4XL9A 4HNUA 2UWMA 1MNEA 2JVHA 3K10A 4Y3OA 2A5WA 4OAYA 2CV1A 4B3XA 2IGNA 3C2HA 1V5EA 4YRVA 1WJFA 3OYAA 4CH7A 2VQHA 4CCJA 1MMGA 2VJJA 4NC7A 3D5SC 4H4KC 4HG2A 1WJ5A 3HPGA 2KLOA 1NG6A 3HPHA 3W2WA 3PL8A 3L2UA 3A2KA 1YX5A 1OLTA 3RSNA 3HOTA 2L7KA 2RREA 4NNJA 3ZR8X 4Y4RA 1EA3A 1WFXA 2QKMB 2AQFA 3G2BA 3HC7A 4RM3A 3K70C 2VXZA 3IAM2 3PSFA 1Y56A 2M0MA 3OOUA 3QYEA 4LITA 3CMMA 1OR7C 5CQGA 1MNDA 4PJLA 3PJRA 3QOEA 4BS9A 2WA0A 4ZTFA 4JQFA 2DT6A 4J00A 2V7FA 2IS4A 4XM3A 3H9JA 3CP2A 2GOMA 3ZGKA 1WJEA 3CF2A 2FUG2 2IS1A 4F55A 3DQVC 2M7BA 2E1MB 4HSRA 2CW7A 2HU9A 4KISA 1PYVA 4F91B 3LFUA 2X6WA 2UUZA 4CA0A 5HOOA 4PSWA 5HNHA 4ZTJA 4D9JA 4E7LA 3S3NA 3M1CA 1WJAA 2F4IA 2XSJC 4XR6A 4XLAA 1BR1A 3H5AA 3IUOA 2V9KA 3OYFA 1W36D 2CW8A 2X1EA 3H9GA 2HQAA 2PJRA 2LRDA 1G59A 2VQCA 4N4NB 2WADA 4BL0B 2P0WA 3SDBA 1LKXA 3MKZA 2HPMA 2VASA 4XKCA 3EUHC 1MMNA 2KMUA 2ZXHA 3QYFA 5LD2C 3RQ4A 2W1OA 3PNTA 3PNYA 4ITVA 2X6YA 3HKZA 2MD0A 1Y6IA 3S8PA 3LMMA 3DPLC 2OC6A 2GOXB 3AFHA 4C9YA 1N75A 2LBFB 2LOOA 4U7BA 2CUJA 4BJ5C 2V26A 3FHNA 3OYGA 4DGWB 4HPQA 3OYIA 4PK4A 4XONA 3OY9A 2RNGA 3IP4B 2KRHA 1Z3XA 3SYTA 5HNFA 2LYCA 4BU2A 4MLOA 3SEQA 3HL2A 2K9MA 3LSHA 2O5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WY8 Q;  2WY7 Q;  2JVH A;  2GOX B;  2NOJ B;  2JVG A;  3D5R C;  3D5S C;  2GOM A; 
#chains in the Genus database with same CATH topology
 2J5O A;  1OJL A;  4AIK A;  2IAI A;  3HRU A;  2Z16 A;  1MMS A;  1HLV A;  2HZD A;  4A3K J;  5IP7 J;  1VQ5 I;  1QU3 A;  4HDV A;  5H2F C;  3COA C;  4I0A A;  5B3S H;  5J1Y A;  1XS9 A;  3QP5 A;  1C0W A;  3MD2 A;  3KYL A;  1J9I A;  1S7E A;  2HXO A;  3K4L A;  1I27 A;  2IJL A;  3WG9 A;  3OIP A;  3IH2 A;  2XB5 A;  5ILU A;  3CUO A;  2XDV A;  3Q0W A;  2H1L A;  3DBH B;  1ETX A;  4EEF G;  3I55 I;  4I99 C;  4V19 K;  2JK3 A;  1D1B A;  3LSJ A;  3S93 A;  2BV6 A;  4BE2 A;  5CKT A;  2O61 A;  2GIV A;  4HX7 A;  2K9N A;  2MYS A;  2DOA A;  3OL3 A;  1IN8 A;  2IXS A;  2GXG A;  2NNY A;  2E1N A;  4IXA A;  2FRH A;  4UVA A;  3EPZ A;  4XOR A;  2NOG A;  5E1X A;  3RYP A;  1FMV A;  1YG2 A;  3QWL A;  1USS A;  1MGT A;  1LEA A;  2PQ8 A;  4CCN A;  1FY7 A;  1DDN A;  1J75 A;  2VBZ A;  1ZRC A;  4JOM A;  3FM3 A;  1I39 A;  4EM0 B;  1QPM A;  4ZYD A;  3GTQ J;  1SVO A;  4CIC A;  4EV0 A;  1HBX G;  4WXC A;  1RKW A;  4D7M A;  5FFX A;  2A07 F;  2QKL B;  3FWE A;  1YRN A;  3B73 A;  4DBQ A;  3KLO A;  4ZC3 A;  4WXH A;  1IF1 A;  2BY2 A;  4M71 A;  1ZHF A;  2Y2Z A;  3D0S A;  2YU9 J;  1V3F A;  1QZY A;  3I3L A;  2YX7 A;  3DPU A;  1G3S A;  1XCB A;  2IA0 A;  3GTO J;  1SD7 A;  2VQG A;  1ETV A;  4JK1 X;  3CJQ B;  1V5G A;  4IRG A;  5JHF A;  3R0J A;  3EUA A;  1TL8 A;  1U0J A;  2MFZ A;  2VKE A;  4BDZ A;  3OSG A;  1LDJ A;  2K3F A;  4EJV A;  1X1C A;  5ILS A;  1LB2 A;  1ACI A;  3T8T A;  2WV0 A;  2AHQ A;  1ONV A;  3E6M A;  3WTZ A;  3BPV A;  1MBF A;  1B59 A;  1LVA A;  3DEW A;  1H8A C;  1EH8 A;  1LFB A;  3GTK J;  3JSP A;  2XF7 A;  2CFX A;  5DYM A;  2E5N A;  1E3H A;  4KNY A;  3Q0V A;  2M9H A;  1YW9 A;  2EIM H;  2YUS A;  4P5O A;  4IQ4 A;  1X1P A;  3T5X A;  1TWF J;  5L3D A;  3R4K A;  3F6V A;  4IEJ A;  3HG9 A;  2EFP A;  4FX4 A;  1K79 A;  1FIP A;  3LST A;  2JA6 J;  3BPX A;  4B44 A;  4AC0 A;  1J0R A;  2E2I J;  4L18 B;  2L7F P;  2F5V A;  2M4K A;  2OA4 A;  1A31 A;  3HEF A;  3TO6 A;  3FZV A;  4XN0 A;  2X51 A;  1ZAR A;  3KP6 A;  2DW4 A;  2R7Q A;  3DP7 A;  4JYK A;  2LKX A;  3RCO A;  1XMA A;  5IOY A;  2A3S A;  3JRH A;  4RB2 C;  1OPC A;  4HV5 A;  2AXL A;  1SVM A;  3VYT B;  3FMS A;  4ENJ A;  3OYN A;  2VQL A;  5FO5 A;  5GAH J;  4A3I J;  5LHG A;  2HGC A;  1WPK A;  2V9V A;  4RLQ A;  2F5F A;  4JBA A;  3W2V A;  2R7R A;  5JVT A;  2NAZ A;  1DQU A;  4WX9 A;  1I3A A;  4PUS A;  2X9D A;  3P7N A;  2XGE A;  3F22 A;  1MMD A;  3IKT A;  3Q3S A;  4LJZ F;  4DIQ A;  4IZZ A;  1IDY A;  1R49 A;  3N05 A;  5KNL A;  2GXA A;  2D1V A;  1O7F A;  5J4Y A;  2A6E F;  2E2H J;  1VQM I;  2LY2 A;  5IP6 A;  2NYX A;  2LTP A;  1HOM A;  4RDU A;  2DFE A;  1ZTR A;  3H0D A;  3MN2 A;  4G7O F;  3VSK A;  1TWC J;  1RC9 A;  4YEL A;  2QVO A;  3LL7 A;  2OUM A;  1EV7 A;  2JZY A;  3SZG A;  2CSO A;  2P5K A;  5LEJ A;  2BGC A;  2PMU A;  2ZC2 A;  5TJJ A;  4DYR A;  3BR1 A;  2L4A A;  1S3J A;  2O6G E;  3O8G A;  2DO7 A;  1UB9 A;  3L1P A;  3HOS A;  1QBJ A;  1FYL A;  1JTX A;  4OAZ A;  1BOA A;  3QU6 A;  4Y13 A;  2ZXJ A;  4KIF A;  1REP C;  1R22 A;  3FX3 A;  5F04 A;  3W6V A;  4MEY F;  1WCM J;  2HS5 A;  2DA5 A;  2RV8 A;  4HNT A;  3JCU C;  1BN5 A;  3TW7 A;  2E60 A;  3S15 J;  5E17 F;  1ORK A;  1D0Y A;  5BMZ A;  4E7J A;  2LFB A;  2O8K A;  1GVJ A;  2EJR A;  1DPU A;  5J1R A;  2EZH A;  4E7Z A;  3OYE A;  1BI2 A;  3H3V K;  3CCE I;  3KP3 A;  3C3W A;  1WJB A;  1ZEL A;  2ISY A;  4PDK A;  4LIU A;  1SAX A;  5CQE A;  1IV6 A;  4XLH A;  2W00 A;  3F72 A;  2KIS A;  1VQO I;  4CSW A;  2XHK A;  2XAQ A;  5LGN A;  4EJW A;  1OCO H;  5ICC A;  5EGO A;  4BE1 A;  1QA6 A;  3ZP5 A;  1Y39 A;  1AKH A;  2HEO A;  2VON A;  3WTX C;  5KHD A;  2JA2 A;  3DKX A;  5K7F A;  1B8I A;  3BWG A;  1GVD A;  1SMT A;  1Y1W J;  2A6H F;  1QZZ A;  2FJ1 A;  1UST A;  4D5C A;  2R7T A;  3GTP J;  3D5L A;  1IZ1 A;  2RC4 A;  2WBM A;  2M87 A;  4EJO A;  5AON A;  4B8X A;  4A6D A;  4IPA A;  2WB1 A;  2IEK A;  1IN5 A;  4YFX F;  3LWF A;  3IL2 A;  2IPQ X;  2K02 A;  4ZJZ A;  3DTI A;  3TMO A;  1BOB A;  3HUG B;  5JHU A;  5E79 C;  2DA7 A;  1EKE A;  2RAE A;  1U5T B;  4EJT A;  5IT9 Z;  1X19 A;  1S8N A;  1LE8 A;  5IT3 A;  4OMZ A;  3LQQ A;  4HST A;  3OV8 A;  5KCM A;  1U5T C;  1B4A A;  1BJA A;  1YW7 A;  3ZPL A;  3FM5 A;  2X1C A;  1W5C C;  3PO3 J;  3FBN B;  5EEH A;  1H88 C;  5GP9 A;  4RMN A;  5K1Y A;  2BVM A;  5FKN A;  3K9T A;  2L7Z A;  3CME I;  2G7H A;  3V7C A;  2QCO A;  3J80 Z;  4XLN F;  4IX7 A;  4Y52 J;  2BE5 F;  3MWM A;  4C2M J;  3WHC A;  3JTH A;  2GM4 A;  1QVT A;  3IRR A;  4OWR B;  3HSR A;  1ERD A;  2XF6 A;  4AVZ A;  1FYM A;  3TL4 X;  2OZU A;  1UZC A;  4KN4 X;  1SFO J;  1XGO A;  1X1D A;  1Y8R B;  5D5W B;  4WK8 F;  2YX4 A;  4RB3 C;  2B63 J;  4RGS A;  2WC2 A;  2R7S A;  1LQ1 A;  2IBD A;  2DPU A;  3OR1 C;  5IPA A;  3TKY A;  4HDU A;  4LMY A;  2YS9 A;  2IS6 A;  4BXF A;  4C3H J;  1DPR A;  4QPO A;  1FJL A;  3WOD F;  5FKK A;  5HLT A;  1RET A;  2DK8 A;  1MIJ A;  1XGM A;  2MW8 A;  4OU0 A;  1IUY A;  3WE3 A;  3TO7 A;  4GDF A;  2F4O B;  2DBB A;  1FPQ A;  4G7Z F;  3S14 J;  3HHG A;  4I09 A;  5DS9 A;  2M5W A;  2DMP A;  3OR2 C;  1VZ0 A;  2RQP A;  1LFU P;  1IG7 A;  2A6T A;  3C18 A;  3P9C A;  3M3Y J;  2QF7 A;  2CWE A;  1FNN A;  3ZQC A;  4BQA A;  1UMQ A;  2HPI A;  3ZQH A;  2R3S A;  3OS1 A;  2H09 A;  4HNU A;  2UWM A;  2ZNY A;  3K10 A;  2A5W A;  3C2H A;  3LSP A;  1V5E A;  3OYA A;  3CMA I;  1YJW I;  1FOK A;  4CH7 A;  4CCJ A;  2DYR H;  1W5T A;  3E7L A;  4HG2 A;  2OAZ A;  3HPH A;  5DDG A;  1VQL I;  3L2C A;  3V8J A;  1OLT A;  3RSN A;  3HOT A;  1D5Y A;  5FLM J;  1BW6 A;  2A5Y B;  2PEX A;  1W7P D;  4M9Z A;  3FIW A;  1EA3 A;  4Y4R A;  1WFX A;  2QKM B;  4G8X A;  2EK5 A;  2LK2 A;  1FLI A;  4RM3 A;  4L5J A;  4O3M A;  2BXY A;  3C7J A;  4C3I J;  3GW2 A;  4UV8 A;  3HOW J;  3C1D A;  1AHD P;  1MND A;  1HW5 A;  4PJL A;  4ZH4 F;  5CVU A;  3PJR A;  3HM5 A;  2DOD A;  3ZQF A;  2WA0 A;  4ZTF A;  2M0C A;  2IRF G;  4ESF A;  3BR3 A;  2V7F A;  1POG A;  5D5X B;  3H9J A;  3BTJ A;  2GOM A;  4M3G A;  1H9T A;  2FA5 A;  3A02 A;  2M8G X;  1QVU A;  3S1N J;  1SFU A;  1PDN C;  4WF2 A;  3DQV C;  4RGX A;  5CVI A;  5JLX A;  1HKT A;  4F91 B;  3LFU A;  1MH3 A;  2A61 A;  4CA0 A;  5K5R A;  1MJB A;  2RGV A;  3WG7 H;  1MDM A;  4YIF A;  3M1C A;  4XR6 A;  5D5U B;  1TQM A;  2V9K A;  4KFC A;  3R6S A;  4DNC A;  2CGP A;  2GAU A;  5DM6 F;  2CW8 A;  2X1E A;  5E8I A;  3BG3 A;  1YS7 A;  4A2U A;  2KDZ A;  5CYV A;  1JTY A;  5DD8 A;  2VQC A;  4WWC A;  4N4N B;  4BY1 J;  2AS5 F;  4HF1 A;  1F4K A;  2LLK A;  2P0W A;  1BA5 A;  4ENM A;  1VFC A;  2EZI A;  4XKC A;  4UXN A;  2EH3 A;  5HS8 A;  1XX5 A;  2ZXH A;  3PNT A;  2X6Y A;  2QWW A;  2IA2 A;  1R9T J;  5HLI A;  4BBS J;  3DPL C;  1NH3 A;  1W5S A;  3AFH A;  1N75 A;  4HA8 A;  4U7D A;  4U7B A;  2CUJ A;  2V26 A;  3J81 Z;  2L0K A;  5DCM B;  1X58 A;  1VQ8 I;  1UHS A;  2A05 A;  3OYI A;  2F2E A;  2IVM A;  2KRH A;  4M6V A;  5HNF A;  1RI7 A;  2DT5 A;  4BU2 A;  4MLO A;  4RA2 A;  1FBS A;  2K9M A;  2BEO A;  5ED4 A;  3ZMT A;  1GT0 C;  3BCB A;  4HRI A;  1MNM C;  4GYI A;  3CO6 C;  3FBI B;  5DCM A;  4ZDL A;  4U0Y A;  1HKS A;  3MEX A;  3CDI A;  5EEA A;  1J7K A;  1ZH5 A;  2KFD A;  2L02 A;  4I98 B;  1YOV B;  5BPI A;  3HOY J;  3LQR A;  4CZC A;  1A36 A;  2WTE A;  4XKB A;  1A04 A;  2ICW G;  1BI1 A;  2VE8 A;  2WY7 Q;  1FSE A;  3SEZ A;  2BW3 B;  2DAO A;  3I71 A;  4I02 A;  1PP7 U;  4E4H A;  3KZY A;  4H0E A;  1RKT A;  1R4M B;  2P5L C;  1IC8 A;  1W36 C;  1D3Y A;  2P7V B;  4XLE A;  1KQ9 A;  2JVG A;  1IUF A;  3A0B C;  1P4X A;  4M3D A;  4S05 A;  1JUS A;  1S7A A;  2K9S A;  3BT9 A;  3M8E A;  3PNV A;  2FML A;  4FQG A;  5C44 J;  3RZD J;  4E6K G;  1IXS B;  4BH9 A;  4BAC A;  4HBL A;  4X1E A;  2DMU A;  3K2Z A;  1ZG5 A;  2COB A;  2XRN A;  4IHW A;  1VQN I;  1RUN A;  2R92 J;  3I59 A;  4J01 A;  4N9H A;  3HJE A;  3J7Z I;  1HSJ A;  4A3B J;  1XG1 A;  4BJ6 C;  4ZDP A;  5A2Q K;  4GRI A;  2DJI A;  3OYJ A;  2CFO A;  2BZT A;  1A6Q A;  2M2E A;  2I5U A;  3W3C A;  3TP0 A;  1BI3 A;  4UHT A;  4XKV A;  5HDG A;  3WU2 C;  3K2A A;  3WGG A;  5HOD A;  3OYK A;  3FK7 A;  5JFR A;  2DOE A;  2CV2 A;  3L7W A;  4P1W A;  1FT9 A;  1WSU A;  3KIO A;  2NVY J;  2K3P A;  3R61 A;  3K7A J;  3JAM Z;  4BKX A;  3BZC A;  2O9L A;  5J8C A;  1ZRD A;  4YFK F;  2M34 A;  2CRG A;  1KGS A;  3HSE A;  4XK4 A;  2HI3 A;  2ADU A;  2E2J J;  1TNS A;  2NVU B;  1CF7 B;  1VND A;  1ON1 A;  4MHG A;  1WQ2 A;  3R60 A;  5TGT A;  2W85 A;  3IKV A;  1JJ6 C;  3QOD A;  3RPU A;  2A68 F;  2E1M C;  4E7K A;  4DZP A;  5EEG A;  1STZ A;  2F5C A;  2G7U A;  1XGN A;  3CLQ A;  3KP5 A;  3CCS I;  4U0W A;  1TZL A;  1JHF A;  1HDD C;  2VUM J;  3KPH A;  3TBI A;  4II3 A;  4R8H A;  3NWT A;  2L7M P;  3EUK L;  1P7J A;  4A0X A;  2QA4 I;  5TIS C;  3H9Q A;  1WRJ A;  3ZCO A;  2MC4 A;  4IOA F;  5FRO A;  3WTU C;  2MC3 A;  1XC5 A;  5K5Q A;  1PUF A;  2MSY A;  1WJD A;  5GPC A;  4KUM A;  2L01 A;  2XAS A;  4UUS A;  3CCQ I;  1W0T A;  4A3F J;  4C2T A;  4MO7 A;  4AWX B;  4B47 A;  1N77 A;  2VOO A;  3GZ6 A;  1GUU A;  3CC7 I;  1W7P A;  1M1E B;  1AOY A;  1DGR M;  3WTY C;  4C30 A;  1D8K A;  1VTN C;  2EIL H;  2ZME C;  3SQN A;  1FOW A;  2MLK A;  5E3O A;  4HV6 A;  2Q1Z B;  5IOZ A;  1D1C A;  3FXL A;  2EIN H;  3TP3 A;  2XGC A;  1F36 A;  2KZV A;  2DMN A;  2CMP A;  4LOC A;  5J4V A;  2QSF X;  2ZME A;  5F64 A;  4Z2Y A;  1RES A;  3TO9 A;  1Z7L A;  3HRT A;  2V1D A;  3DTK A;  1JKO C;  1TT5 B;  3OL4 A;  3VOD A;  3BG7 A;  3U21 A;  4P9U A;  4BDY A;  2LKS A;  2MBF A;  2X1D A;  2JQ7 A;  2QM3 A;  3B02 A;  1S6L A;  5DTD A;  1D1A A;  3K70 D;  2BVL A;  2EV5 A;  2RNJ A;  3DPT A;  3DXJ F;  5K7H A;  1A6I A;  4M3E A;  4BEH B;  2NVX J;  2JUG A;  2W48 A;  3ELK A;  4PSX A;  1ETW A;  4PGH A;  1JUM A;  3BG5 A;  4NB5 A;  2FOW A;  1IN6 A;  2TRT A;  2G9W A;  4LFU A;  5FKM A;  4B1R A;  1QQI A;  1DP3 A;  4A3C J;  2K7L A;  4XLP F;  2HYF A;  4BEH A;  3QPL A;  3KEY A;  3M9A A;  2BY1 A;  1F1Z A;  1IN7 A;  1SFK A;  3OYB A;  1FP1 D;  4IRH A;  1QGP A;  1ZGW A;  1QZE A;  2CQQ A;  4HX8 A;  4E7S A;  1YJ9 I;  5DM7 F;  3CCU I;  2EB7 A;  2VB6 A;  2FD5 A;  2LY1 A;  4JP0 A;  5LHI A;  5L3E A;  2HDW A;  2OJE D;  5L3G A;  2DYS H;  2LP0 A;  1I1G A;  5M3F J;  4V2F A;  4V2G A;  4BBR J;  1I1S A;  2DA6 A;  3PSI A;  4F93 B;  4O5V A;  4IO9 F;  2EFN A;  4CZZ A;  2QQB A;  3I5U A;  2NS7 A;  2W25 A;  4ZDO A;  4TV7 A;  2C6Y A;  4NUB A;  1MW7 A;  1U3E M;  3EDP A;  4ANJ A;  2FQ4 A;  1IRF A;  1ZQ3 P;  4Y33 A;  2ZNZ A;  2DA1 A;  4NC6 A;  1P7I A;  2IGK A;  2Y30 A;  2KQR A;  4D1Q A;  4AM3 A;  3S2W A;  3VSL A;  4BYY A;  2EBI A;  2ZJP F;  3SHF A;  3G6E I;  2V79 A;  3AG3 H;  4XN3 A;  4Q47 A;  4XQF A;  3K0L A;  1KU3 A;  3RKW A;  4IHY A;  1BR2 A;  1SD4 A;  4LLN A;  3FK6 A;  3H35 A;  3CES A;  5DUK A;  1SAU A;  5E18 F;  4B48 A;  3NAR A;  4AID A;  5DEQ A;  2JA7 J;  4BQN A;  1E0E A;  2VLA A;  4ENK A;  4I7H A;  5GTH C;  3ISP A;  3HOV J;  3V7R A;  1ON2 A;  2I8D A;  5J40 A;  2ME0 A;  3J7A Y;  2TDX A;  4A3G J;  3TED A;  3I64 A;  1G8X A;  2Y9Z A;  3W6J B;  2RN7 A;  4G6T B;  3FDY A;  2R0Q C;  1D0X A;  4GCV A;  4F52 A;  1J5Y A;  3CJR B;  3S32 A;  3WHB A;  4XOT A;  4Y17 A;  1W0U A;  1B6A A;  3BOQ A;  2OCC H;  2O7O A;  2XF5 A;  3GWZ A;  4ETS A;  1OCP A;  3VPR A;  1HA8 A;  2K27 A;  2DDA A;  4MFE A;  2L9N A;  3ECO A;  3HGY A;  2EIJ H;  1X4O A;  1K83 J;  2MH2 A;  4P96 A;  2W7N A;  2E19 A;  4NQW B;  3E5X A;  3MFK A;  4OIO F;  1YIO A;  3V4G A;  1QHH D;  3ZN0 A;  1H9G A;  2FX0 A;  1JT0 A;  3A0H C;  4KIB A;  3DV8 A;  3F3X A;  4FIS A;  3LNQ A;  4HEA 2;  2ZFW A;  3S3O A;  1LFP A;  3CD6 I;  2ESH A;  2K4B A;  5B1B H;  2CG4 A;  4AVP A;  4W1U A;  3OMY A;  3I4N J;  2MA3 A;  4L0Z B;  1N78 A;  1LJ9 A;  2QLZ A;  2ZSI B;  2D2W A;  2Q0O A;  4U88 A;  4F92 B;  2KJB A;  1K78 B;  5J1U A;  4A5N A;  2KL4 A;  5JI6 A;  1YW8 A;  3FXJ A;  4LG3 A;  4PJM A;  3L2V A;  5FFZ A;  2KP6 A;  2DDB A;  2DFF A;  2PMZ N;  4PFO A;  3ASO H;  4N0B A;  2Q2E B;  4AU7 A;  3CP8 A;  2QEX I;  2OTL I;  2E35 A;  1E3P A;  1B9N A;  1O57 A;  3H1C A;  1ENH A;  4L5E A;  2MLG A;  2YSR A;  2KDO A;  3LA2 A;  2Z33 A;  4KN7 X;  4A6E A;  2BBY A;  2LF7 A;  1S9H A;  2XGD A;  4E7I A;  2PG4 A;  3N97 A;  1T33 A;  1BL0 A;  5FB2 A;  3T1B A;  3PFY A;  1QHG A;  3VOE A;  2XKP A;  3K4J A;  2EA4 A;  5B66 C;  2H6B A;  4XL9 A;  2WV1 A;  2HTS A;  4BQO A;  5K5O A;  2JVH A;  4Y3O A;  3FXK A;  3U2R A;  1OCC H;  4OAY A;  1VQ4 I;  4LG0 B;  2IGN A;  2Z99 A;  2P7C B;  2HFH A;  1WJF A;  1XMK A;  2XIG A;  3SFI A;  4M6X A;  5IY5 H;  3F21 A;  4EQQ A;  2DJN A;  3IH3 A;  2QGU A;  3ABT A;  2IW5 A;  1WI3 A;  1IV8 A;  3W2W A;  1JKR C;  1GV5 A;  3PL8 A;  5E1Z B;  3L2U A;  4FTH A;  3ULQ B;  2L7K A;  4EM1 A;  1PUE E;  1ZKG A;  2GZW A;  3L09 A;  4NNJ A;  5F6F A;  1WKM A;  4LG0 A;  3ZR8 X;  4J19 A;  2CQN A;  4UY8 I;  1VQ6 I;  1FTT A;  3QRF F;  5M3M J;  4A3M J;  4UNO A;  3E6D A;  3G2B A;  3ERE D;  2NVQ J;  3HHH A;  3K70 C;  3PSF A;  3WTS C;  3CTA A;  2ZKZ A;  3QYE A;  3E5U A;  2NRA C;  1WZ2 A;  3CMM A;  5CQG A;  4Z6Y A;  1R5I D;  3UKG A;  2M30 A;  1FEX A;  2F5E A;  3C2B A;  2KIF A;  5F27 A;  3AAF A;  4S04 A;  4JQF A;  2DT6 A;  2KIQ A;  2MGQ A;  1MSE C;  2JRT A;  1JXS A;  4OIR F;  3TOB A;  2F48 A;  4DZJ A;  1GHC A;  3CP2 A;  4UVB A;  1TWA J;  3ZGK A;  2BXZ A;  1VF9 A;  1FSH A;  5M5X J;  3FMQ A;  5ILV A;  4ZYE A;  2M7B A;  2RKH A;  3BR2 A;  1DUX C;  2CW7 A;  3SZP A;  4KIS A;  3F6O A;  1BW5 A;  3WU1 B;  5HOO A;  4KIG A;  2YU3 A;  4PSW A;  5HNH A;  5LRS A;  3EYY A;  1KYW A;  4RAG A;  4ZTJ A;  4E7L A;  1HQC A;  1OQY A;  1WJA A;  4OMY A;  1HKQ A;  1U6G A;  3H5A A;  1D5V A;  1T39 A;  3OYF A;  5JVG F;  1W36 D;  2FXA A;  1IW7 F;  3IWZ A;  2JUC A;  2HQA A;  3FIS A;  4IRI A;  1MBK A;  4E70 A;  5HS9 A;  4ON0 A;  1S7O A;  3FXU A;  5J47 A;  3MKZ A;  4FHT A;  2KZG A;  3CJT B;  3EYI A;  3R0A A;  3HUG A;  1U5T A;  3GTL J;  2O3F A;  3QYF A;  4F7Z A;  1U8R A;  3KP2 A;  2W1O A;  1Z1D A;  3RQ4 A;  3V8L A;  2DFH A;  3CMY A;  1HW1 A;  4Q48 A;  1Y6I A;  3S8P A;  3ERM A;  4C9Y A;  3Q0U A;  2LBF B;  1I5Z A;  2LOO A;  4BJ5 C;  5D4R A;  1KA8 A;  2MG4 A;  3OYG A;  2GA1 A;  2CU7 A;  4DGW B;  3KZI C;  4PK4 A;  3V8K A;  1Z3X A;  1FX7 A;  3Q9S A;  1N25 A;  4Q5S F;  4PCQ A;  3HL2 A;  4MEX F;  3LSH A;  2IP2 A;  1ULY A;  5C3E J;  2JA8 J;  4UB8 C;  2O5R A;  2BY0 A;  2ELK A;  3BTC A;  3ZQ7 A;  2ZCW A;  2DN0 A;  2IGM A;  2WY8 Q;  4AUX A;  3RPU D;  1IRZ A;  1TW3 A;  2M1B A;  3ZQG A;  3JRB A;  1G4D A;  4HQE A;  1MZB A;  1YJN I;  2E7X A;  5FGM A;  4GGG A;  3DU6 A;  3HKZ N;  1ZLK A;  2ZXW H;  3ASN H;  2IT0 A;  3BY6 A;  3CCV I;  2VOD A;  3GUD A;  3GX4 X;  2VBX A;  1D0Z A;  3L00 A;  3SFZ A;  2AXT C;  1J2X A;  2QSH X;  3KE2 A;  5FD6 A;  5LGT A;  3QPS A;  5D5V B;  2R7W A;  2J5P A;  5EG0 B;  1Z3Y A;  1P9Q C;  4A3J J;  2PMH A;  3L2R A;  2EFQ A;  1YS6 A;  4PJ0 C;  2OF7 A;  1YIJ I;  4KJZ A;  2ZJQ F;  1OCR H;  2DQL A;  3DU5 A;  3LSK A;  3IAS 2;  3N4M A;  2B0L A;  2KHM A;  2OTJ I;  2H1K A;  2NS8 A;  3ZQL A;  2LMD A;  4XIC A;  5F08 A;  3A01 B;  4KA4 A;  1E17 A;  1HXD A;  3DKY A;  4AD9 A;  4EAT A;  4YFN F;  5JLW A;  2PBI A;  1Q1V A;  4CCM A;  1IGN A;  1MH4 A;  3B6C A;  3P9I A;  4A93 J;  3BZ6 A;  3M8J A;  4R1H A;  3RJP A;  3CLO A;  2V4J C;  2B9S A;  1LPQ A;  5FLV A;  1P2F A;  1ITY A;  3CJN A;  2EPF A;  4Y15 A;  4FAS D;  4O6J A;  3LSG A;  1Z9C A;  3JRC A;  3OIQ A;  3S2D J;  2VT2 A;  3S2H J;  4RAF A;  2DTR A;  3NRV A;  3OYD A;  1JGG A;  1Z7U A;  3OWT A;  1Z21 A;  3HIF A;  3B6A A;  3K69 A;  3Q5F A;  5CJ9 A;  3K4C A;  1NG7 A;  2KIM A;  1SD5 A;  3V7S A;  2X4H A;  1YFH A;  4OIP F;  4EJU A;  2VL8 A;  4FE7 A;  5HDK A;  3ZXS A;  1U78 A;  3OS0 A;  4B43 A;  5F0H A;  4HF2 A;  2KRC A;  2P81 A;  3MCZ A;  4ENN A;  4GYG A;  2AQE A;  3RKQ A;  3W2A A;  2VC0 A;  3GEZ A;  2VC1 A;  2LDU A;  1X4P A;  2R7O A;  2CO5 A;  2H8W A;  4ZZL A;  2WAQ N;  3BR6 A;  4LB5 A;  1F43 A;  2QBY B;  3HDD A;  3SJM A;  3BQZ A;  1VQ7 I;  4JX4 A;  4MQV A;  1EJ9 A;  3C2G A;  3FKI J;  3I9V 2;  3VFZ A;  4DYC A;  1HCR A;  4CYC B;  1FC3 A;  3CF5 F;  1TP4 A;  4BJT A;  5M5Y J;  2NNN A;  1BIB A;  2OCE A;  4DJA A;  3FXQ A;  1K4T A;  2HOT A;  1X3U A;  3ZN1 A;  4BGD A;  3JRF A;  4IVN A;  5FRN A;  3ABK H;  1CQT A;  2KIU A;  4A3E J;  3TDZ C;  4CCO A;  2Z1D A;  5L3C A;  4QPQ A;  3HXL A;  3KEQ A;  4LD5 A;  2D45 A;  4FT8 A;  3FHZ A;  1ZR2 A;  5C4X J;  2E34 A;  3H3Z A;  3I4P A;  3CCM I;  2VE9 A;  2V1N A;  3JTG A;  2EV6 A;  2VJ5 A;  3E1S A;  2GLO A;  1WH7 A;  2GWR A;  3VWB A;  2L5Q A;  4B4C A;  2XPW A;  3F9K A;  1SMY F;  1Y8Q B;  3J81 K;  4A12 A;  3FXR A;  5D4S A;  1O7L A;  2XRL A;  2UV1 A;  3U1D A;  4I0B A;  4EMS A;  1XSX A;  4IHT A;  2HTJ A;  3NEU A;  2HR3 A;  2EIK H;  4DOZ A;  3CUQ B;  4M74 A;  3G1O A;  2VPL A;  3F0C A;  2XAF A;  1QPI A;  1TW2 A;  1UFM A;  2D5V A;  2DXI A;  1GXQ A;  2CUZ A;  1ZR4 A;  2R5Z B;  1EH7 A;  5J6X A;  3CUQ C;  1Z67 A;  1W1W E;  2LC2 A;  3RTR A;  3ECH A;  3F8N A;  2BW3 A;  4HYE A;  3CUQ A;  4AIJ A;  3L9F A;  2ELJ A;  3ONQ A;  3GVA A;  1QNT A;  2QUF A;  1LVK A;  1UG2 A;  4L9N A;  5BNG A;  4G6D A;  2L9S A;  3DWL E;  1FIA A;  2K4J A;  3KP7 A;  4ABZ A;  3BTI A;  1OYW A;  2Q8K A;  2CJJ A;  2M7A A;  3A4C A;  3H3U A;  2R7F A;  2X85 A;  1P92 A;  4R79 A;  3L2W A;  4S0H B;  3AL0 B;  1KU9 A;  3TGN A;  3LA7 A;  1R6R A;  1J59 A;  3DKW A;  5EYR A;  2ETH A;  3H5R A;  3QYB A;  1JKQ C;  2VJI A;  1JT6 A;  1V4R A;  2QEN A;  3EET A;  4NBQ A;  3AL0 C;  4RAZ A;  2K9Q A;  2LR8 A;  4A69 C;  1ZGJ A;  2Y0S N;  3I0T A;  4OIQ F;  1R1T A;  3MZY A;  3EQL F;  1R58 A;  1TWH J;  3AKZ A;  1TC3 C;  3WGI A;  1B1B A;  3CCY A;  2JRM A;  3K4M A;  3T8R A;  2XRO A;  3GF2 A;  4MFD A;  2Y69 H;  2P5V A;  2ECC A;  3GFI A;  3OSF A;  2WWY A;  1R1U A;  4BAY A;  2QQ8 A;  5D6F A;  5CVV A;  2CV0 A;  3KZZ A;  3CO7 C;  2FE3 A;  4BHC A;  3BJO A;  2FBK A;  1SFE A;  3JRA A;  5FLX Z;  3IWF A;  4HAM A;  2IS2 A;  2E5Z A;  1W4M A;  2PLY A;  1FYK A;  4RM2 A;  1R36 A;  2HYJ A;  2V6C A;  3JAM K;  1CF7 A;  2R7Z J;  5LLQ A;  2RVC A;  4L0Y B;  5H6Q A;  2PX9 A;  5KK1 A;  4DBR A;  3PIP F;  2ID3 A;  4OOI A;  3CQZ J;  4BE0 A;  1FOX A;  4ZYA A;  1RR8 C;  4M6Y A;  5BPD A;  2PJR B;  1Z0X A;  4YEJ A;  4QWQ A;  4AYB N;  5E20 A;  2DOF A;  1IRG A;  1G2H A;  5B1A H;  2DA2 A;  3RKX A;  2UXN A;  4YG2 F;  4A0Z A;  3LAP A;  2DQR A;  1K4S A;  1YO5 C;  1FBU A;  5CPR B;  4LIV A;  2JPB A;  2VKV A;  1F9N A;  3HRS A;  1JHH A;  2WAE A;  3CC2 I;  3VDX A;  2PMZ A;  3KYD B;  3MZ8 A;  1IXC A;  1Z6T A;  1B72 B;  1DU0 A;  3SXY A;  1A5J A;  1IDZ A;  2OPT A;  3WU0 A;  3WTV C;  2VKD A;  5AIP A;  5IYD J;  5HDN A;  2E7W A;  1TQI A;  3MAJ A;  5IP9 J;  2P4W A;  4HW0 A;  1VI0 A;  2L2O A;  5LFA A;  1BI0 A;  4YIR X;  2H8R A;  3MKY B;  4BQQ A;  2LG4 A;  4LGW A;  1OKR A;  4M3B A;  1OFC X;  4CO8 A;  4Q4Z F;  1BJZ A;  3LSI A;  3O8H A;  1MBE A;  1XD7 A;  3NWS A;  1SC7 A;  4NDL A;  4I2O A;  3A1Y A;  3K1N A;  2IA1 A;  4OIN F;  1J09 A;  4WXD A;  5C4J J;  3FXO A;  1U9N A;  1BR4 A;  2H27 A;  2PJP A;  4BUP A;  4ESB A;  3CCL I;  3NAU A;  3MKW B;  5HLG A;  2VIX A;  2XVC A;  5CVR A;  2EFW A;  3GTG J;  9ANT A;  4QSH A;  1JJ8 C;  2R4G A;  2JMW A;  1XSD A;  3IC7 A;  1R23 A;  3RYR A;  2EA2 A;  1NTC A;  4MGR A;  1UG0 A;  4XRF A;  3ZQQ A;  2LD5 A;  4FET A;  2HNH A;  4KT5 C;  5HLH A;  2FF4 A;  2XUB A;  1VQK I;  2F5D A;  1VQ9 I;  2XV4 S;  3E0J B;  3G4S I;  4MIM A;  1V54 H;  2GQQ A;  4BHP A;  1YE9 A;  2ZO4 A;  2XSD C;  3ZMU A;  3DBR B;  5EZH A;  1Z05 A;  4B3A A;  4B3X A;  4ZZD A;  4XBF A;  4PGG A;  1S5L C;  2VQH A;  4KIC A;  4G6Q A;  1MMG A;  1HST A;  2VJJ A;  2E1C A;  5GPA A;  4NC7 A;  3D5S C;  4H4K C;  5E3N A;  1WJ5 A;  2PN6 A;  3DFG A;  2FQ3 A;  5EJC A;  3O2P E;  1KU7 A;  1ETY A;  1OYI A;  3QOP A;  5D6E A;  4KMF A;  2STT A;  1NG6 A;  5GAE J;  2KKO A;  4I01 A;  5B5E C;  4A0Y A;  3IRQ A;  4HNV A;  3G73 A;  3A2K A;  1YX5 A;  2CUE A;  2KJC A;  4IJA A;  3T0Y A;  2FNP A;  1YRN B;  2CW0 F;  2O03 A;  3KLN A;  3O6B B;  3ABM H;  4DW6 A;  1L3L A;  4K2E A;  2NS0 A;  3ABL H;  3RZO J;  2VXZ A;  3IAM 2;  4MQ9 F;  1Y56 A;  2M0M A;  5FD5 A;  4A3D J;  4LIT A;  1OR7 C;  1MKM A;  4XRS G;  3IV5 A;  1T6S A;  3P9K A;  2GBY A;  2OQG A;  2L3D A;  3RIR A;  4YII A;  2GXB A;  3AG2 H;  2IS4 A;  1OR7 A;  2R7D A;  4I6Z A;  4XM3 A;  2KRF A;  2JSC A;  4HOB A;  5TRD A;  3CC4 I;  2K85 A;  1WJE A;  3CF2 A;  3GXO A;  2IS1 A;  4F55 A;  2Z5U A;  5LBQ A;  1YI2 I;  1GV2 A;  3G1L A;  3I54 A;  5F1J A;  2HU9 A;  5J3L A;  1KQ0 A;  2X6W A;  3G3Z A;  2CQ7 A;  3HZJ A;  2M45 A;  1BM9 A;  4D9J A;  2HQ5 A;  3S3N A;  2ZBK A;  3F8B A;  2DMT A;  2F4I A;  3MZH A;  2LNB A;  2W24 A;  2I10 A;  3BP8 A;  3IUO A;  1LNW A;  3BR5 A;  4P55 A;  4DYQ A;  2JPC A;  3KCC A;  2HDC A;  3HRM A;  3VB2 A;  1D8J A;  1SD6 A;  2LRD A;  3MKL A;  1G59 A;  2Y75 A;  2WAD A;  3U1K A;  4BL0 B;  1Q1H A;  3KFW X;  4Y7N J;  3SDB A;  1LKX A;  3DEU A;  1UJ8 A;  3KET A;  4CYD A;  3ESW B;  1K7A A;  3PNY A;  4ITV A;  4RAY A;  2HOS A;  2LSO A;  3HKZ A;  3IHU A;  3A03 A;  2MD0 A;  5KVR A;  3LMM A;  2GOX B;  3O3K A;  1ZN2 A;  2W84 A;  3FHN A;  3BJ6 A;  4RS8 A;  5BOX A;  2BHZ A;  4HPQ A;  4XON A;  3BG9 A;  4NQW A;  3IP4 B;  3DF8 A;  1OMI A;  2QZ8 A;  1YTY A;  1YIT I;  3SEQ A;  3CDH A;  4EGZ A;  3ABU A;  4I76 A;  5ICF A;  1TWG J;  3GLL A;  1MJ9 A;  2EFO A;  3CCJ I;  3KEO A;  2ACJ A;  2PFB A;  2XPU A;  2QQA A;  3PM1 A;  4BXU A;  4M72 A;  1XPX A;  4G94 A;  3RI4 A;  2OZ6 A;  1DU6 A;  2FBH A;  3CDL A;  4EGY A;  1K78 A;  4FCY A;  4L5I A;  5F1R A;  3GFL A;  3OYC A;  2RQQ A;  1UEL B;  2OU2 A;  1FMW A;  2Q2E A;  3M1E A;  1O3Q A;  1G3W A;  4XKW A;  1LDD A;  2NXN B;  1IJW C;  4MTE A;  1KZH A;  3L2Q A;  3BRO A;  1R4N B;  5FKO A;  1JUP A;  2HQR A;  2KT0 A;  1GLN A;  1U2W A;  3HTU A;  4N9I A;  2UZK A;  4HF0 A;  1Z6R A;  3BZK A;  2VJ4 A;  4X0G A;  1FP2 A;  3WGH A;  5GAG J;  3MMY B;  2N8G A;  2BY3 A;  3BG6 A;  3DBL B;  3GFJ A;  4GO1 A;  4HX4 A;  2K5C A;  1GDT A;  2O0Y A;  2Z9O A;  5EDN A;  3ML6 A;  2M8E A;  1RRJ A;  1ZRE A;  1B9M A;  4C2U A;  4PZJ A;  1U9O A;  2EV0 A;  2R7V A;  1SFX A;  4UUT A;  2M3A A;  3RKY A;  3F8M A;  2DTZ A;  1FWZ A;  2R5Y B;  3S3M A;  3I56 I;  1G3Y A;  1A35 A;  4LLL A;  1G3T A;  5CVJ A;  3TOA A;  4CXF A;  4RGU A;  3LSR A;  2CH0 A;  3DEE A;  3K4N A;  3V42 A;  1WVR A;  2MD5 A;  3FMR A;  1P4W A;  2JSP A;  4P9F A;  2VKH A;  5KAI C;  1ZG3 A;  2IGO A;  4KT6 A;  3HOU J;  1AWC A;  2WAQ A;  4CCK A;  5EGO B;  2GIZ A;  1T38 A;  2X0L A;  1AKH B;  3I53 A;  1ETO A;  1YQA A;  3OS2 A;  2DPD A;  2Y9Y A;  2R5Y A;  4MNU A;  4II2 A;  1FOY A;  3OYL A;  4A3L J;  1B8I B;  1K6Y A;  1U8B A;  1RNL A;  3TW6 A;  4IHV A;  3IH4 A;  3WE2 A;  2LH9 A;  4PJJ A;  4XSZ F;  3FXM A;  3TQN A;  3BJA A;  3ROU A;  1Y0U A;  3P5J A;  3QU3 A;  1K6O A;  2ME6 A;  3W6K B;  4G7H F;  1Y0N A;  4HZF A;  2X6X A;  2HQN A;  3ZRG A;  1MJA A;  2BHY A;  5DV5 A;  1MMA A;  1X1A A;  1HC8 A;  2P6T A;  2FSW A;  1I3Q J;  4NC8 A;  4NHJ A;  1XN7 A;  2HVQ A;  1S72 I;  2V6E A;  2Z3Y A;  3MVP A;  1LE8 B;  2OV7 A;  1X2M A;  3JRG A;  4U87 A;  1UAA A;  2ZXI A;  3SZT A;  1MBH A;  2F4M B;  4RB0 A;  1YHQ I;  5H6R A;  3QP6 A;  3KX2 A;  2XGX A;  1FTZ A;  1YX3 A;  2XKO A;  1HDP A;  4LLG F;  4XSX F;  3LA3 A;  1ODD A;  4RLF A;  4CUG A;  3LOC A;  3WTT C;  1PP8 F;  2HOA A;  3JRD A;  3REO A;  5L3F A;  2VN2 A;  4C3J J;  5IT9 K;  2F6C A;  3S17 J;  3PUB A;  1IRX A;  1RZ4 A;  4XMY A;  2ZJ2 A;  1OCT C;  3HYI A;  4BXX J;  2HYG D;  1IO2 A;  1R71 A;  4F3Q A;  1LUJ B;  2BYV E;  1DGW Y;  4IOC F;  2EZL A;  4GFB A;  4IQJ A;  1S29 A;  1TT0 A;  4CDG A;  1R00 A;  2VI6 A;  3VYU B;  2R7X A;  1E3O C;  1I6H J;  2JJ7 A;  1CGP A;  2HVR A;  2LBF A;  4CHU A;  2W4S A;  2Y31 A;  1T95 A;  1WJC A;  2LKP A;  3H5N A;  2W57 A;  4IL6 C;  1UHW A;  3J80 K;  1V55 H;  2XAU A;  3JRE A;  5E1W A;  2Y0M A;  5ICG A;  1KYZ A;  1PJR A;  2VT3 A;  3S1R J;  3GLX A;  1ZGA A;  2MAB A;  2LRE A;  1R5G A;  4XLC A;  4XLF A;  4MTD A;  2XB0 X;  5LGU A;  1XSV A;  3BQY A;  5D8L B;  3DLL F;  2K9L A;  4JX5 A;  1I6X A;  4U0V A;  2CQK A;  3BCA A;  2WAF A;  3OIO A;  4ASN A;  1KU2 A;  3M07 A;  4M3F A;  3JR9 A;  2QQ9 A;  4PJN A;  5GTI C;  2Y0S A;  2H6C A;  1JKP C;  4HLY A;  3DTE A;  3CZ6 A;  5GAD J;  3QPH A;  3BC8 A;  1AU7 A;  2O8X A;  2E36 A;  3RDI A;  1IN4 A;  1P4A A;  2JWT A;  5ERI A;  2W82 A;  3LSM A;  2HXI A;  3UNG C;  3UR3 C;  2DLL A;  2HOE A;  2G0E A;  4XID A;  1V5F A;  3U9G A;  3D5R C;  1ETQ A;  3HGG A;  3BLY A;  1O4X A;  1OIS A;  5EG0 A;  3MQ0 A;  1XDU A;  1XTA A;  2LVS A;  4M73 A;  2ZSH B;  5M5W J;  2M4G A;  4L9T A;  4KMU X;  1EH6 A;  4RB1 A;  2VPR A;  4CCL A;  2E1O A;  2D1H A;  4XRS A;  1Y1V J;  4N4O B;  2DU9 A;  2DA4 A;  3G1M A;  3GME A;  1NHA A;  1T98 A;  2E71 A;  4XRM A;  4AYB A;  2OD5 A;  2V9P A;  2DK5 A;  5DD4 A;  3A01 A;  3GYH X;  3M4O J;  1R7J A;  1ZLJ A;  3I4M J;  4QIW N;  4G12 A;  2STW A;  3HOZ J;  1FZP B;  1AA7 A;  4B09 A;  3ZMS A;  1T2K A;  5IYB J;  1H89 C;  1O3T A;  3DLA A;  2ID6 A;  2JT1 A;  1XCV A;  3M7G A;  3BR0 A;  5F0F A;  3VEP A;  3F23 A;  3WTW C;  1X1B A;  1XB4 A;  3JSO A;  2P6S A;  1F5T A;  5KAF C;  4RBO A;  2HKX A;  4IHS A;  1RUO A;  5LRR A;  4IKF A;  1MDM B;  3K4K A;  3NQO A;  1JI8 A;  1WHU A;  2K40 A;  2XAG A;  3OYH A;  4D7N A;  4L9V A;  2FEZ A;  1XGS A;  3K6G A;  3ZOB A;  2L54 A;  2Y48 A;  2UXX A;  1KON A;  4XOP A;  3BDD A;  3E3V A;  3QAH A;  3ZQI A;  1BBY A;  1APL C;  1DP7 P;  3S1M J;  4GXO A;  4FE4 A;  3E97 A;  2DCE A;  2XAH A;  4BY7 J;  4ESJ A;  3I58 A;  4PFP A;  4DQ2 A;  3M8F A;  3VYS B;  5IYC J;  4D0P A;  4BHB A;  2L9R A;  3DCF A;  3K1M A;  1TBX A;  1Z77 A;  4A5M A;  1RR7 A;  1T0F C;  2L9V A;  1SEU A;  1E2X A;  3G71 I;  4XNF A;  1TTY A;  5H20 A;  3VYR B;  4CGZ A;  2HVS A;  4LB6 B;  1T0F A;  4FX0 A;  2QBY A;  5LHH A;  2Z2S B;  1ZK8 A;  2DFI A;  3HBL A;  4BNC A;  1X2N A;  2OQR A;  1X3W B;  1MSF C;  5JR3 A;  5LEK A;  2CUF A;  4CYC A;  1T08 B;  1Z91 A;  2V1U A;  1LEB A;  2B7E A;  4E7H A;  2LF8 A;  2JN6 A;  2GA2 A;  2CS3 A;  2X48 A;  3PO2 J;  3AG4 H;  2AO9 A;  2XC7 A;  2EZK A;  1JGS A;  2X6O A;  2HDD A;  2WB1 N;  2ISZ A;  3H0G J;  1WGX A;  2XAJ A;  3E5Q A;  5FRM A;  2R7U A;  2BOL A;  4ZYH A;  4EVI A;  4UV9 A;  6PAX A;  1T8I A;  2ECB A;  2H94 A;  1L0O C;  2VXD A;  2PI0 A;  5J8F A;  4KYW A;  3S16 J;  3OOP A;  5HVQ C;  3PIO F;  2DT7 B;  2ESN A;  2ZJR F;  4KDP A;  2QYO A;  2NOJ B;  1EF4 A;  1NK2 P;  2EQR A;  4JX6 A;  3AG1 H;  2FBI A;  5CLS A;  2FMY A;  3LAJ A;  1OYY A;  1KQ8 A;  1OCZ H;  1IXR C;  1TQP A;  3FKJ A;  2HKO A;  3GBG A;  3E6C C;  1IAW A;  3ZMZ A;  2DA3 A;  4UB6 C;  2ZFU A;  3FF5 A;  3K4B A;  2TCT A;  3E6B A;  2DMQ A;  2V1X A;  1WWX A;  4W97 A;  4KIT B;  3OYM A;  2KPM A;  1LDK B;  3JRI A;  5BS6 A;  2R93 J;  1G6N A;  2JA5 J;  2K86 A;  1PVE A;  5A2Q Z;  3ZMV A;  1MNE A;  3RPQ A;  2R5Z A;  1QRY A;  2CV1 A;  3I59 B;  3F8F A;  3K1P A;  3J7Y J;  5HS7 A;  4YRV A;  3H92 A;  4RGR A;  3SDG A;  1UCR A;  4IHX A;  1R1V A;  2LY9 A;  3GZN B;  2XPV A;  3KP4 A;  3HPG A;  4M9X A;  4LK1 F;  5EF6 A;  2KLO A;  4X6A J;  1RPW A;  4QTR A;  3H36 A;  2NVT J;  5DUI A;  1UHM A;  2RRE A;  2ZB9 A;  2COM A;  1ETK A;  1BC8 C;  1MBG A;  2AQF A;  5FKL A;  1NK3 P;  2DI3 A;  5AIQ A;  3HC7 A;  1XMX A;  2VBW A;  4WCG A;  5E3M A;  1JE8 A;  3OOU A;  1BIA A;  1YYV A;  2FOK A;  3PQJ A;  4IF4 A;  1HF0 A;  1T56 A;  3QOE A;  4BS9 A;  2P8T A;  5BQT A;  5F0C A;  1QO0 D;  4J00 A;  1H0M A;  3F8C A;  1SVL A;  1YLF A;  5D8K B;  4EM2 A;  4LK0 F;  3TDU C;  2A69 F;  2JTV A;  1BC7 C;  4QLC U;  2FUG 2;  3GO5 A;  1RIO H;  1GXP A;  2OBP A;  2VBY A;  2E1M B;  3PQK A;  4HSR A;  3S1Q J;  5FJ8 J;  1PYV A;  2UUZ A;  1HW2 A;  2EWN A;  3RQI A;  3QPT A;  3ZMD A;  2FU4 A;  3PUF A;  1O3R A;  1TLH B;  2VOP A;  2RDP A;  1ZG1 A;  1K61 A;  1TNT A;  4UVC A;  5K7Z A;  3QQA A;  4G9Y A;  3J7A O;  2XSJ C;  5DCF A;  2CQX A;  4XLA A;  1PUF B;  1BR1 A;  5EZG A;  1P6R A;  5FLX K;  3GZ5 A;  4UUS B;  3HSF A;  2YPR A;  4UUV A;  3H9G A;  3Q9V A;  1ZYR F;  2PJR A;  3JW4 A;  3HOX J;  1W7P B;  3HTS B;  1I50 J;  3BTL A;  2HZT A;  2FNA A;  3D1N I;  1SAN A;  2QSG X;  5E3L A;  1MBJ A;  3HB9 A;  2HPM A;  2VAS A;  3LFK A;  1R5H A;  4HLX A;  3EUH C;  4L9J A;  1MMN A;  2KMU A;  3GTM J;  5LD2 C;  5E8G A;  3X2Q H;  2CYY A;  2HWV A;  2L4M A;  3PFI A;  5ICE A;  1MD0 A;  2ZME B;  1O3S A;  3GCM A;  2MH9 A;  3GTJ J;  1XDS A;  2OC6 A;  4AIH A;  1WI9 A;  2YR2 A;  3EUH A;  4ZYG A;  1B72 A;  4HQM A;  1FBQ A;  2ELH A;  3GFM A;  5L3B A;  1ZAO A;  4D5F A;  3KYC B;  3CCR I;  1ZRF A;  3OY9 A;  2RNG A;  3SYT A;  2LYC A;  1VQP I;  1X3Z B;  1WH5 A;  4M9S A; 
#chains in the Genus database with same CATH homology
 3BCB A;  4HRI A;  3FBI B;  4ZDL A;  2IGM A;  2Z16 A;  2WY8 Q;  2HZD A;  3RPU D;  1QU3 A;  4CZC A;  4XKB A;  3DU6 A;  2WY7 Q;  3SEZ A;  3MD2 A;  2BW3 B;  3OYC A;  3KYL A;  2RQQ A;  3K4L A;  1UEL B;  4E4H A;  3OIP A;  1FMW A;  1W36 C;  4XLE A;  4XKW A;  2JVG A;  2XDV A;  1D0Z A;  3L2Q A;  1D1B A;  3S93 A;  4BE2 A;  5CKT A;  3PNV A;  2R7W A;  4E6K G;  1GLN A;  1Z3Y A;  1P9Q C;  2MYS A;  2DOA A;  3OL3 A;  4BAC A;  2VJ4 A;  3L2R A;  4X0G A;  2IXS A;  3MMY B;  3BG6 A;  3EPZ A;  4KJZ A;  4XOR A;  1FMV A;  2K5C A;  3DU5 A;  4J01 A;  3LSK A;  3IAS 2;  4BJ6 C;  4C2U A;  4ZDP A;  4CCN A;  4GRI A;  2KHM A;  2DJI A;  4JOM A;  2R7V A;  3OYJ A;  2CFO A;  3DKY A;  3W3C A;  4EAT A;  2M3A A;  4XKV A;  4CCM A;  3OYK A;  3S3M A;  2QKL B;  2CV2 A;  4P1W A;  3M8J A;  2CH0 A;  4DBQ A;  3DEE A;  2V4J C;  3K4N A;  4ZC3 A;  3V42 A;  4FAS D;  2JSP A;  3LSG A;  2K3P A;  2VKH A;  2IGO A;  3OIQ A;  4KT6 A;  2WAQ A;  3I3L A;  4CCK A;  3DPU A;  3OS2 A;  3OYD A;  2VQG A;  3CJQ B;  3OWT A;  4II2 A;  3OYL A;  1V5G A;  5JHF A;  3EUA A;  1K6Y A;  1Z21 A;  1U0J A;  2MFZ A;  2LH9 A;  4PJJ A;  5TGT A;  4BDZ A;  3QOD A;  1X1C A;  3K4C A;  1NG7 A;  2E1M C;  4E7K A;  2X6X A;  2VL8 A;  3ZRG A;  3ZXS A;  3OS0 A;  1MMA A;  1TZL A;  1X1A A;  4B43 A;  2KRC A;  4NC8 A;  3TBI A;  2XF7 A;  4II3 A;  2HVQ A;  2E5N A;  3NWT A;  2V6E A;  3EUK L;  2AQE A;  4P5O A;  3H9Q A;  2OV7 A;  4IQ4 A;  3W2A A;  3ZCO A;  2MC4 A;  4U87 A;  5FRO A;  1UAA A;  1X4P A;  2R7O A;  2ZXI A;  1WJD A;  3HG9 A;  3KX2 A;  3C2G A;  1YX3 A;  3I9V 2;  4B44 A;  4RLF A;  4C2T A;  4CUG A;  2F5V A;  2M4K A;  4BJT A;  4B47 A;  1N77 A;  4DJA A;  2F6C A;  4XN0 A;  1DGR M;  3PUB A;  1IRX A;  2X51 A;  4XMY A;  4C30 A;  2R7Q A;  4BGD A;  4F3Q A;  2Q1Z B;  5FRN A;  1DGW Y;  1D1C A;  3RCO A;  4IQJ A;  4CCO A;  1TT0 A;  2KZV A;  2Z1D A;  2CMP A;  4QPQ A;  3HXL A;  3VYU B;  3VYT B;  2R7X A;  1Z7L A;  3OYN A;  2VQL A;  3DTK A;  3OL4 A;  2HVR A;  2LBF A;  2W4S A;  3BG7 A;  2V1N A;  3U21 A;  2VJ5 A;  1T95 A;  1WJC A;  3H5N A;  4BDY A;  2X1D A;  3E1S A;  3VWB A;  2L5Q A;  4RLQ A;  1D1A A;  3K70 D;  2BVL A;  2XAU A;  3F9K A;  3W2V A;  2R7R A;  1DQU A;  3DPT A;  4BEH B;  1PJR A;  2UV1 A;  2JUG A;  4PUS A;  4PSX A;  2MAB A;  2LRE A;  4XLC A;  1MMD A;  4XLF A;  4DOZ A;  4IZZ A;  4DIQ A;  3N05 A;  5KNL A;  2VPL A;  2K9L A;  3BCA A;  2DXI A;  2WAF A;  2CUZ A;  1DP3 A;  4PJN A;  2LY2 A;  4BEH A;  2LC2 A;  3KEY A;  3RTR A;  2Y0S A;  1SFK A;  3DTE A;  3H0D A;  2BW3 A;  3OYB A;  3CZ6 A;  3BC8 A;  3VSK A;  4E7S A;  2VB6 A;  2ELJ A;  4YEL A;  3LL7 A;  3ONQ A;  2LY1 A;  2OUM A;  2W82 A;  3SZG A;  3LSM A;  3UNG C;  2HDW A;  3UR3 C;  1LVK A;  2L9S A;  3PSI A;  4F93 B;  3DWL E;  1V5F A;  3D5R C;  3BLY A;  3HOS A;  2M7A A;  3A4C A;  4OAZ A;  2X85 A;  4R79 A;  3L2W A;  3AL0 B;  4ZDO A;  1R6R A;  2ZSH B;  2M4G A;  4NUB A;  1MW7 A;  4HNT A;  3H5R A;  4CCL A;  3QYB A;  2E60 A;  4ANJ A;  4N4O B;  2VJI A;  1D0Y A;  4E7J A;  3AL0 C;  4Y33 A;  4AYB A;  2IGK A;  4E7Z A;  2KQR A;  4D1Q A;  3OYE A;  3VSL A;  1AA7 A;  3AKZ A;  4XN3 A;  1WJB A;  1ZEL A;  4XQF A;  3K4M A;  3DLA A;  1BR2 A;  4LIU A;  5CQE A;  3H35 A;  4XLH A;  1X1B A;  2W00 A;  3CES A;  1SAU A;  4CSW A;  4B48 A;  2CV0 A;  4BE1 A;  4BQN A;  4IKF A;  1E0E A;  2VLA A;  3K4K A;  1JI8 A;  2IS2 A;  2E5Z A;  2I8D A;  3OYH A;  5KHD A;  4RM2 A;  2JA2 A;  3DKX A;  3J7A Y;  3K6G A;  1KON A;  4XOP A;  1G8X A;  4DBR A;  4G6T B;  3FDY A;  2R7T A;  3D5L A;  4BE0 A;  4ZYA A;  2WBM A;  1D0X A;  4F52 A;  2DCE A;  3CJR B;  2PJR B;  3S32 A;  4YEJ A;  4XOT A;  4PFP A;  2WB1 A;  3VYS B;  2XF5 A;  4ZJZ A;  3DTI A;  3TMO A;  1BOB A;  3HUG B;  1HA8 A;  1T0F C;  5CPR B;  4LIV A;  1X19 A;  2L9N A;  2WAE A;  4XNF A;  3VDX A;  3VYR B;  1X4O A;  4HST A;  2PMZ A;  5KCM A;  2HVS A;  2Z2S B;  2X1C A;  2W7N A;  3FBN B;  2VKD A;  4NQW B;  4RMN A;  4E7H A;  1QHH D;  2BVM A;  2CS3 A;  2L2O A;  5LFA A;  2XC7 A;  4HEA 2;  4IX7 A;  3MKY B;  3S3O A;  4BQQ A;  2LG4 A;  1LFP A;  4OWR B;  1ERD A;  3LSI A;  2XF6 A;  4AVZ A;  3OMY A;  3NWS A;  3TL4 X;  5FRM A;  2R7U A;  2BOL A;  1X1D A;  3A1Y A;  1N78 A;  1J09 A;  2ZSI B;  2R7S A;  1BR4 A;  4F92 B;  3OR1 C;  4BUP A;  2KL4 A;  2IS6 A;  4LG3 A;  4PJM A;  4BXF A;  3MKW B;  3L2V A;  2VIX A;  2VXD A;  4QPO A;  2KP6 A;  5HVQ C;  5HLT A;  2DT7 B;  4PFO A;  2Q2E B;  2NOJ B;  4AU7 A;  2R4G A;  3CP8 A;  2KDO A;  3OR2 C;  1UG0 A;  1VZ0 A;  3FKJ A;  3ZQQ A;  3GBG A;  4FET A;  2HNH A;  4E7I A;  1S9H A;  2A6T A;  2ZFU A;  3K4B A;  3OYM A;  4KIT B;  3E0J B;  3PFY A;  2KPM A;  1LDK B;  1QHG A;  1YE9 A;  2HPI A;  3K4J A;  3OS1 A;  4BQO A;  4XL9 A;  4HNU A;  2UWM A;  1MNE A;  2JVH A;  3K10 A;  4Y3O A;  2A5W A;  4OAY A;  2CV1 A;  4B3X A;  2IGN A;  3C2H A;  1V5E A;  4YRV A;  1WJF A;  3OYA A;  4CH7 A;  2VQH A;  4CCJ A;  1MMG A;  2VJJ A;  4NC7 A;  3D5S C;  4H4K C;  4HG2 A;  1WJ5 A;  3HPG A;  2KLO A;  1NG6 A;  3HPH A;  3W2W A;  3PL8 A;  3L2U A;  3A2K A;  1YX5 A;  1OLT A;  3RSN A;  3HOT A;  2L7K A;  2RRE A;  4NNJ A;  3ZR8 X;  4Y4R A;  1EA3 A;  1WFX A;  2QKM B;  2AQF A;  3G2B A;  3HC7 A;  4RM3 A;  3K70 C;  2VXZ A;  3IAM 2;  3PSF A;  1Y56 A;  2M0M A;  3OOU A;  3QYE A;  4LIT A;  3CMM A;  1OR7 C;  5CQG A;  1MND A;  4PJL A;  3PJR A;  3QOE A;  4BS9 A;  2WA0 A;  4ZTF A;  4JQF A;  2DT6 A;  4J00 A;  2V7F A;  2IS4 A;  4XM3 A;  3H9J A;  3CP2 A;  2GOM A;  3ZGK A;  1WJE A;  3CF2 A;  2FUG 2;  2IS1 A;  4F55 A;  3DQV C;  2M7B A;  2E1M B;  4HSR A;  2CW7 A;  2HU9 A;  4KIS A;  1PYV A;  4F91 B;  3LFU A;  2X6W A;  2UUZ A;  4CA0 A;  5HOO A;  4PSW A;  5HNH A;  4ZTJ A;  4D9J A;  4E7L A;  3S3N A;  3M1C A;  1WJA A;  2F4I A;  2XSJ C;  4XR6 A;  4XLA A;  1BR1 A;  3H5A A;  3IUO A;  2V9K A;  3OYF A;  1W36 D;  2CW8 A;  2X1E A;  3H9G A;  2HQA A;  2PJR A;  2LRD A;  1G59 A;  2VQC A;  4N4N B;  2WAD A;  4BL0 B;  2P0W A;  3SDB A;  1LKX A;  3MKZ A;  2HPM A;  2VAS A;  4XKC A;  3EUH C;  1MMN A;  2KMU A;  2ZXH A;  3QYF A;  5LD2 C;  3RQ4 A;  2W1O A;  3PNT A;  3PNY A;  4ITV A;  2X6Y A;  3HKZ A;  2MD0 A;  1Y6I A;  3S8P A;  3LMM A;  3DPL C;  2OC6 A;  2GOX B;  3AFH A;  4C9Y A;  1N75 A;  2LBF B;  2LOO A;  4U7B A;  2CUJ A;  4BJ5 C;  2V26 A;  3FHN A;  3OYG A;  4DGW B;  4HPQ A;  3OYI A;  4PK4 A;  4XON A;  3OY9 A;  2RNG A;  3IP4 B;  2KRH A;  1Z3X A;  3SYT A;  5HNF A;  2LYC A;  4BU2 A;  4MLO A;  3SEQ A;  3HL2 A;  2K9M A;  3LSH A;  2O5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...