4M74A

Mutant structure of methyltransferase from streptomyces hygroscopicus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHAFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGEYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
total genus 121
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m74A01
3T5XA 3CO6C 5HLGA 2DAOA 2ZFWA 3F6VA 2LSOA 4U7BA 3JSOA 2PN6A 5FD5A 2CO5A 3WGHA 3EETA 5JR3A 3LQRA 5LHIA 3LA3A 5ICCA 4HDUA 3HIFA 3RKYA 3KEQA 2OZUA 3M8FA 4FT8A 3E5QA 5JFRA 3VOEA 1LEBA 1QBJA 3FM3A 4P96A 1REPC 3NQOA 2OU2A 4GO1A 3FX3A 1TBXA 1FYMA 2GXBA 2QQ9A 2VOOA 4BNCA 3E5XA 5BS6A 2VOPA 3HSFA 3WG9A 2RC4A 2LF8A 3GWZA 1UB9A 1I1GA 4LK0F 2V1XA 3SHFA 4YG2F 4MQ9F 4ZYEA 1YIOA 3FXQA 5K5OA 3FMSA 3COAC 1FYKA 3I0TA 4CDGA 4HW0A 1I27A 2GWRA 3K69A 1RI7A 3CDHA 5D6EA 4AIKA 5EEHA 1TLHB 5LEKA 2VBXA 4L9NA 2O3FA 1O7FA 2X4HA 1BM9A 3WTWC 3ML6A 1Z05A 3CO7C 3E6CC 4HA8A 2GA1A 1FOKA 4IRHA 2LKPA 4KUMA 5ILVA 3KFWX 1EV7A 1SMTA 1S8NA 5CVIA 4BYYA 1DUXC 3WE2A 1G3SA 3GFIA 2IA2A 2O8XA 2HQRA 4I01A 4CYDA 2IW5A 2K27A 3R0JA 3F23A 5L3GA 5F64A 1HBXG 3LFKA 2GAUA 3HRSA 2W24A 2D2WA 4OINF 3MZYA 5BMZA 2HWVA 3HOSA 3N4MA 2NAZA 2P6TA 1IAWA 1FNNA 2WV0A 4Q48A 1I5ZA 3U9GA 2VC1A 1R23A 3ERED 4EJOA 1MZBA 1HW2A 4MHGA 4ZH4F 4LJZF 2IT0A 2HYFA 2XV4S 2FMLA 1B59A 3FXUA 3LA2A 1ZAOA 3TOBA 2QQBA 1JHHA 1YW8A 3GO5A 1SFEA 1OR7A 5ED4A 3ECHA 4K2EA 2WWYA 1B6AA 1AWCA 1SFXA 1FBSA 3I59A 3RPUA 2A68F 2UWMA 3CUQA 5DD8A 3T1BA 1RUOA 3ELKA 5IT9K 1JXSA 5KVRA 1YTYA 1FBUA 4S05A 2J5OA 1ZREA 1YO5C 3JAMZ 3HUGA 2DBBA 3KP2A 1T98A 5FD6A 1ZARA 4P9UA 3DP7A 3TQNA 1P4AA 2F5FA 2HYGD 4M6YA 3PQJA 1J75A 3H92A 4ZYGA 2OQRA 4FX4A 2ACJA 4EM2A 4L9JA 4G8XA 4M74A 2HR3A 5BOXA 5H6RA 4HV5A 4I09A 2CFXA 1UHMA 3F8NA 1IXSB 4UVCA 2A69F 5HDGA 4Q5SF 1KQ8A 4MEYF 4G9YA 3J81Z 3C7JA 2KKOA 4ZYDA 4I02A 1SMYF 4G7OF 2O03A 2ZO4A 4UXNA 1GHCA 3M9AA 1VTNC 1IW7F 2Y75A 1J5YA 5DEQA 3SFZA 2O0YA 3CUQB 2PJPA 1IRGA 1USSA 4A0XA 3PFIA 1WWXA 4R8HA 2PFBA 2Q2EA 1IN5A 4KIBA 3WTTC 3RI4A 5F1RA 5K5RA 3EQLF 2ZKZA 1FWZA 4GYGA 4EM1A 4WWCA 4H0EA 1KYWA 1RZ4A 3KP7A 2M30A 5CVUA 1FC3A 3K9TA 3ZPLA 3WGGA 4IRGA 1WSUA 2NS0A 4HYEA 1YS6A 2PG4A 2M87A 2R3SA 3V7SA 4B8XA 5BPIA 2F5CA 3L2CA 5ICFA 1IN4A 3L7WA 4P9FA 1G3YA 2FOKA 3DKWA 4U7DA 2YSRA 4LB5A 3EUHA 3IKVA 5DYMA 3KP5A 2OD5A 5DCFA 3D0SA 4HAMA 2MH9A 1QZYA 3Q9SA 5LGNA 4IVNA 1KGSA 2F5DA 2ISYA 1WQ2A 1L3LA 2L4MA 3ZN1A 5ILUA 4HZFA 5L3EA 1W7PA 2JSCA 2H6CA 2LDUA 5D5WB 5D4SA 5TJJA 2EV6A 2YPRA 2CW0F 2Z99A 5L3FA 3FXRA 1WI9A 3WODF 2BE5F 1T38A 4U0WA 2V9VA 3WTZA 4KDPA 1HW1A 4FX0A 4XSXF 4ESJA 2XAGA 4IHTA 1FSEA 2VBYA 3D5LA 3GYHX 5ICGA 4ON0A 4YFXF 3ZMDA 1U5TA 4N9HA 3DFGA 2EFWA 3SQNA 4Y17A 4U0YA 4RGSA 1G6NA 1YLFA 1HSTA 2HGCA 3E5UA 1P92A 2WC2A 4HX7A 4WK8F 4BQAA 4F7ZA 4OIQF 4Q4ZF 2ZCWA 4U88A 2D1VA 1W7PB 5BPDA 2IRFG 1MGTA 2BGCA 4P5OA 3TGNA 3RKXA 1D8JA 2BEOA 3TOAA 3P9IA 4KNYA 2MH2A 2MLKA 2HQNA 1J7KA 1KA8A 2C6YA 2VC0A 4HOBA 5FFZA 1O3RA 3V4GA 5FGMA 3BOQA 1R22A 4BHBA 4WXDA 2PEXA 3B02A 5AONA 3C18A 1U5TB 4KIFA 2FBIA 4KICA 2EFOA 3FZVA 1YQAA 4BH9A 4LB6B 2PMUA 2O6GE 1HKSA 1I1SA 5E8IA 1OPCA 2MC3A 3MEXA 3CUQC 4JK1X 3P7NA 3T0YA 2V79A 2EFPA 2COMA 5LRRA 4YFKF 4A12A 1ZG5A 1MJAA 1O3QA 4A2UA 1D3YA 3GX4X 2Z9OA 3QAHA 4YIFA 3GEZA 1BOAA 4A6DA 1Z7UA 4CGZA 4I7HA 2QLZA 4AWXB 1RIOH 5HS9A 3GXOA 3KLOA 1Z6RA 5A2QK 1F5TA 3J80K 4M71A 4HQMA 3RJPA 3O6BB 4ESBA 4A0ZA 3LA7A 4EJUA 3ZMVA 4IXAA 4KA4A 2FRHA 1IN7A 1R5GA 1BI3A 2XASA 4S04A 1HSJA 2RDPA 4EJVA 2DI3A 2KIMA 3FM5A 1R58A 1B1BA 3K1MA 1P2FA 4EJWA 1OKRA 1XSXA 3IL2A 1XGOA 3RYPA 2DPUA 4ASNA 4R1HA 1S7AA 2H94A 2PMHA 4DNCA 2KIUA 5IT3A 1MJBA 5HDKA 2GZWA 3VB2A 2KRFA 5EEGA 1XCBA 2HS5A 3BJOA 1XN7A 1P6RA 1KU9A 4HV6A 3F21A 4KFCA 2MA3A 1ODDA 4RGXA 3RDIA 4XSZF 6PAXA 4U0VA 3KP3A 4RAYA 5AIPA 3HYIA 2EFNA 5JVTA 1XDUA 3GW2A 2M5WA 4NQWA 4M6XA 3IWFA 2PQ8A 1LQ1A 1S29A 3TDUC 2P4WA 2QUFA 2EB7A 2FBHA 4KT5C 4HX4A 4UV9A 1QO0D 2NRAC 3LSTA 1R00A 3R4KA 2JT1A 5LHGA 4DQ2A 4EQQA 2CSOA 4ETSA 1OMIA 2DK5A 5ICEA 1IF1A 1R1TA 1H0MA 2XGXA 3NEUA 2XHKA 1GXPA 1U8RA 2R7FA 1Q1HA 5CLSA 1JE8A 2VBZA 3H3UA 3GLXA 3BP8A 2KJCA 1KYZA 2RQPA 2A6EF 1U5TC 3QU6A 2Y48A 2P5VA 1HKTA 2HTSA 3DXJF 1XMAA 3BDDA 1G4DA 3M1EA 2DW4A 2RGVA 1XD7A 3R0AA 3HSRA 3C3WA 1SFUA 3TO9A 4MTEA 2VT3A 2VT2A 3K2ZA 3BJ6A 2K7LA 1ZLJA 1IZ1A 3QRFF 2CGPA 4RAZA 2STTA 4TV7A 4OIRF 5E20A 2KJBA 3K1PA 2P5KA 3ISPA 1ZG3A 3E97A 1ONVA 2JRTA 1BJAA 1IRFA 3WTUC 3H3ZA 2R7DA 1BI1A 2RN7A 2W57A 2DK8A 5H20A 2FXAA 3DV8A 4HDVA 1FYLA 1FX7A 2ADUA 2K02A 2Q0OA 2P7CB 2G7HA 1ZRCA 2HEOA 1G3WA 2QZ8A 3HHGA 3F6OA 3QP5A 3IC7A 3T8RA 4LK1F 1P4WA 3W6JB 3DPTA 5D6FA 2Z3YA 3HHHA 4CICA 3GVAA 5FO5A 1B4AA 1IN8A 1FP2A 2HFHA 4IPAA 2YU3A 2DQRA 2WTEA 5DD4A 3MWMA 5E8GA 1H9GA 5JHUA 4P55A 1EH6A 1SD6A 2FEZA 3GF2A 2W85A 1ON1A 5DUIA 3F8MA 1FSHA 1YYVA 5ERIA 4GGGA 1RUNA 4ZZDA 1ULYA 4UVAA 1T39A 4RGUA 1K78A 1XMKA 3KE2A 2Z5UA 2J5PA 3O2PE 2V1DA 4YFNF 1KQ9A 4O3MA 2L4AA 5IT9Z 3WTSC 5H6QA 2QQAA 2FU4A 3LQQA 3QP6A 4GXOA 1W5SA 2JPCA 4L5JA 1R36A 1LNWA 5CVRA 1CF7B 3I53A 2ZMEB 2GXGA 3WGIA 2K4JA 4G6QA 4I2OA 1RNLA 1BIBA 4HBLA 3R6SA 1BC7C 2H6BA 1LVAA 4PGGA 1TQPA 1PUEE 1HKQA 5LEJA 3E6BA 4LMYA 3G3ZA 4L9TA 4CO8A 1S7OA 4M72A 2EJRA 5KK1A 1O57A 3TDZC 4RB3C 4HLXA 3J7AO 1LEAA 2NYXA 1K78B 3P9KA 3V7RA 1XCVA 4OIOF 5FLXK 3JSPA 3T8TA 3FF5A 5HS8A 5D8LB 3ZP5A 2DQLA 1GVJA 4HF2A 4OMZA 1W5TA 1J9IA 1D8KA 1FLIA 2ESNA 2ZNZA 1L0OC 3WE3A 4ENNA 4ENKA 2G9WA 1DDNA 2RVCA 1FZPB 1USTA 3BY6A 4KYWA 3ABTA 3BPXA 4M9SA 2IA1A 2HKXA 1IN6A 4A5NA 4XRFA 3P9CA 1J59A 3KZZA 2BBYA 4NB5A 1D5VA 3HTUA 2V1UA 1HQCA 2FSWA 2IJLA 5LRSA 3BWGA 3HRUA 1YW9A 2JZYA 4QWQA 3JTHA 3LWFA 4LFUA 4I98B 4ESFA 2QM3A 1R7JA 2IA0A 2MBFA 3IWZA 5HDNA 1ZG1A 2QBYB 2BV6A 3C1DA 3LAJA 2XAFA 1UHWA 2O61A 1Z6TA 2NNYA 2CQKA 5CVJA 1KU2A 3O3KA 1XGNA 1Z1DA 5J6XA 2PBIA 1GXQA 2K4BA 1O3SA 1S3JA 2L01A 2JPBA 3V8LA 4RB2C 4XLPF 4EV0A 2A6HF 1XSVA 1ON2A 2XIGA 4RGRA 2ESHA 1JHFA 3HOTA 1NHAA 4D0PA 1MD0A 4AD9A 1R1UA 2VONA 1TNTA 4RB1A 2Z33A 2K86A 1LDDA 4WXHA 2HTJA 1B9NA 2VN2A 2L3DA 3WTXC 2Y0MA 2UXNA 2LNBA 1MKMA 1U2WA 2FMYA 3IRRA 4Z2YA 4YIIA 3EYIA 4R79A 3FMRA 1LDKB 3K0LA 1R5HA 3MAJA 4LGWA 3EDPA 5E1ZB 2P7VB 2VBWA 1AOYA 4B09A 1CGPA 5J8FA 4EMSA 3WTYC 1LJ9A 4XBFA 2L02A 4Q47A 4MTDA 4LLGF 4IJAA 3DEUA 3TO6A 2DTRA 1A04A 1BC8C 2VE9A 3JTGA 4G6DA 4HLYA 1R1VA 5HVQC 3IRQA 2EWNA 4AIJA 2LF7A 4MGRA 5E17F 1T0FA 2M8EA 2H09A 1K7AA 3R61A 2E1CA 4EGZA 2A5YB 3KETA 3FHZA 1X3UA 2RNJA 2RV8A 3JAMK 2VXZA 2EV5A 1KU3A 5LGTA 1OYIA 3CLOA 4BHCA 2JTVA 2CYYA 1SD5A 5D5UB 2W84A 1P4XA 4L9VA 4I0AA 5DV5A 2UXXA 3Q9VA 2A07F 3F8CA 4KN4X 4A6EA 2QYOA 2IP2A 3QOPA 3CUOA 4QLCU 3NRVA 4WF2A 1ZHFA 2OQGA 3WTVC 3W6KB 4BXUA 1F9NA 1XSDA 3J81K 2YX4A 4BAYA 1ZN2A 3KLNA 4G7HF 1V3FA 2HZTA 4A5MA 2GA2A 4EJTA 5A2QZ 4PZJA 3J80Z 2X0LA 1HW5A 5LGUA 2A61A 1YG2A 3S2WA 1BIAA 2AXLA 1J0RA 2ZBKA 3TKYA 3HTSB 3I5UA 1FT9A 5D5XB 1E2XA 2EA4A 1STZA 5F6FA 4MEXF 4KMUX 1TW2A 5FFXA 4N9IA 1ZGJA 1E17A 2RKHA 1YW7A 3F8FA 3L09A 3ULQB 2XAHA 2D45A 4OIPF 5ILSA 3U2RA 3RTRA 1TTYA 4L0YB 4EGYA 5D4RA 1ZRDA 2XAQA 3EYYA 3SZPA 4PDKA 3G73A 5CYVA 5D8KB 2ZNYA 3K1NA 3E6MA 3V8JA 3MFKA 1QZZA 5LHHA 5LLQA 2P8TA 3HRMA 2ISZA 1XGSA 3HSEA 2XKPA 1KU7A 3GZ5A 4IRIA 3ZN0A 4LG0A 1WRJA 2XVCA 4AVPA 2FQ3A 2XKOA 4CHUA 4FHTA 4M9ZA 4MQVA 2ETHA 3N97A 3TO7A 1UCRA 3GUDA 1MDMA 2EFQA 4E70A 1IXCA 4CXFA 4KN7X 3RPQA 3V8KA 2PI0A 3VFZA 2MLGA 3GFLA 3Q5FA 5L3CA 3PQKA 2B0LA 3WU1B 2CG4A 3I64A 2OZ6A 3ABUA 3WU0A 2GQQA 3FMQA 1FY7A 2MD5A 5BQTA 3KP4A 3E6DA 3KZYA 4HX8A 4O5VA 4UV8A 2D1HA 3VODA 2FNPA 3F3XA 3V7CA 3AAFA 1CF7A 2E7XA 3I59B 2ZMEA 3JW4A 4LG0B 3B73A 5J8CA 1QQIA 4LLNA 4HQEA 3REOA 4EVIA 1U78A 4O6JA 3QPTA 2OAZA 4UHTA 2Q8KA 2E7WA 3OV8A 3KCCA 5TRDA 1QNTA 2FA5A 1G3TA 1DP7P 4IHSA 1V4RA 2NNNA 1QPMA 1MDMB 1K6OA 4PGHA 2XAJA 1HXDA 3LAPA 1LB2A 2FNAA 4OOIA 1XB4A 2OBPA 2DPDA 1W4MA 1DPUA 2E1NA 1UFMA 2ZJ2A 3BROA 4JQFA 2M45A 4RB0A 1TQIA 1OYWA 2DT5A 4I0BA 1FPQA 2FF4A 4Y15A 1MJ9A 5D5VB 1ZGAA 2H27A 3GFJA 4OMYA 3F72A 1BBYA 3MCZA 1FBQA 2IPQX 5E1XA 5JI6A 4HF1A 2L54A 2HKOA 2VE8A 3QPHA 3SXYA 2P6SA 1U6GA 3ECOA 2A3SA 3I54A 1TQMA 1I6XA 4L0ZB 1O7LA 3E3VA 1PP8F 5L3BA 2BYVE 2P5LC 4UUVA 3IHUA 5K1YA 4G94A 2QWWA 3ROUA 1KQ0A 2TDXA 3BJAA 1SD7A 4HF0A 4ZYHA 5CVVA 4UVBA 3M8EA 3ZMSA 1T6SA 1QGPA 1FP1D 3OOPA 5K5QA 2DU9A 2HOEA 1W7PD 3BPVA 1JGSA 2EV0A 3ZQ7A 3GFMA 1YFHA 2AS5F 3F22A 3ZMZA 1BI0A 1DPRA 3RIRA 1XGMA 1ZLKA 4ZZLA 3HRTA 3I58A 4KIGA 2W25A 1YS7A 2QBYA 2ZXJA 5E1WA 4G7ZF 1O3TA 3IKTA 4L18B 2G7UA 1PP7U 2CWEA 3DQVC 3VEPA 4RS8A 5DDGA 3CJNA 4OU0A 4EM0B 4LD5A 5HLIA 1K79A 2QENA 1BN5A 5L3DA 3KEOA 4WCGA 4N0BA 2QVOA 4ENJA 4Y13A 1T2KA 3L9FA 2XUBA 2STWA 2YR2A 5DCMA 2DFIA 1C0WA 2EA2A 2F5EA 2F2EA 5HOOA 3U1DA 3ZMTA 1EH7A 2PLYA 3MQ0A 2FE3A 1PDNC 1OYYA 3GZ6A 3KP6A 1IUYA 5HLHA 3I71A 1IXRC 4WX9A 3QU3A 2IVMA 3MZHA 3FWEA 5LBQA 3RYRA 1SD4A 2YX7A 2EK5A 3F8BA 1BI2A 3R60A 1F1ZA 4MNUA 1TNSA 1ZRFA 3L00A 4BHPA 4KMFA 2UZKA 5FB2A 1F4KA 2GIVA 1Z91A 2FBKA 1H9TA 4GYIA 1Y0UA 2XRNA 4PCQA 2DO7A 5DUKA 1LDJA 1ZYRF 4WXCA 1U3EM 5HS7A 2ELHA 2M1BA 4ENMA 3SZTA 3DPLC 4CZZA 5DCMB 4AIHA 4L5IA 2DLLA 1WKMA 5FLXZ 3M7GA 2XROA 5CJ9A 4GCVA 1SAXA 2VODA 1S6LA 3CTAA 3DF8A 1Z9CA 5E18F 1B9MA 4UNOA 3RKWA 4M73A 3BZ6A 1J2XA 3ZMUA 4XLNF 4LLLA 5AIQA 4M9XA 1EH8A 2HDCA 1ZH5A 2KIFA 1XDSA 2OA4A 4A0YA 4JBAA 3I4PA 2V6CA 4IF4A 1TW3A 4NHJA
chains in the Genus database with same CATH superfamily
2K5CA 3T5XA 2XB0X 3MKWB 1MSEC 2NS7A 1ETYA 3CO6C 3QODA 1Z3YA 2KFDA 2CMPA 1VI0A 5HLGA 1K83J 2DAOA 2ZFWA 3F6VA 2LSOA 4U7BA 1GVDA 4BDZA 3JSOA 3WHBA 2KZVA 4BDYA 3HOYJ 1VQPI 2PN6A 3ABMH 5FD5A 2CO5A 3WGHA 3EETA 2FQ4A 2ZMEC 4UB8C 3LQRA 5JR3A 3LA3A 2E60A 5ICCA 2E1OA 4U87A 5LHIA 5EDNA 3KZIC 4HDUA 3ZQLA 2ZJQF 1X1DA 3GTOJ 3HIFA 2PX9A 3RKYA 2LC2A 3KEQA 3BLYA 2OZUA 4IO9F 3M8FA 3CZ6A 4FT8A 5K7HA 3E5QA 3ERMA 2QQ8A 1OJLA 3BTLA 2YS9A 2E2HJ 1PVEA 2XF6A 5JFRA 3JRDA 2XF5A 3VOEA 1LEBA 1QBJA 3IAM2 2CQQA 1HC8A 1OCTC 3RZOJ 3DU5A 3FM3A 4P96A 1Z67A 1S9HA 1REPC 3NQOA 2OU2A 4GO1A 3FX3A 5E3MA 3E0JB 1HLVA 5GPAA 1TBXA 1FYMA 2GXBA 2QQ9A 2VOOA 4BNCA 3E5XA 5BS6A 3SFIA 4C2UA 3GBGA 2EQRA 2VOPA 1RKWA 3A1YA 3HSFA 2XGEA 2ELKA 2K9QA 3WG9A 2RC4A 2LF8A 3GWZA 1UB9A 1I1GA 4LK0F 5E3OA 2R7ZJ 3A2KA 1K4TA 2HDWA 4B44A 2V1XA 3CP2A 2LFBA 3SHFA 3P5JA 1VFCA 4YG2F 4MQ9F 4ZYEA 1YIOA 3FXQA 3FIWA 2JN6A 1GT0C 4PJJA 1YE9A 5K5OA 2JK3A 1F36A 3FMSA 3COAC 1FYKA 3CJQB 2BXZA 3Q0VA 3I0TA 4CDGA 4HW0A 2CH0A 3D5RC 1I27A 1W1WE 2GWRA 3K69A 3JRGA 1RI7A 3CDHA 5D6EA 1WJAA 2IS6A 4AIKA 5EEHA 2VIXA 1ETQA 2EZIA 2MABA 5JVGF 1N77A 2BOLA 2W7NA 1EKEA 1TLHB 5LEKA 2E5ZA 4QIWN 3J7ZI 3ASNH 2VBXA 2FX0A 4L9NA 4CUGA 1Y39A 1D1AA 2O3FA 3S93A 2CU7A 1O7FA 2X4HA 1BM9A 3ESWB 3WTWC 3ML6A 1Z05A 3CO7C 3E6CC 4HA8A 2GA1A 5DTDA 3FXKA 4IRHA 2LKPA 4KUMA 5ILVA 3KFWX 3PSFA 1SVLA 1S72I 1FOKA 1EV7A 4FASD 4A3JJ 3QQAA 2HYJA 3FBNB 2BY3A 1SMTA 1S8NA 2E1MC 5IP6A 5CVIA 3GTKJ 1ENHA 4UUTA 3D1NI 5J4YA 4BYYA 4LG3A 1DUXC 3WE2A 2DOAA 1IRZA 2X51A 1G3SA 3GFIA 3U1KA 2IA2A 2HDDA 2O8XA 2HQRA 4I01A 4CYDA 1Z77A 2IW5A 2K27A 3R0JA 4XNFA 3F23A 5L3GA 5F64A 1HBXG 3LFKA 2GAUA 2COBA 3HRSA 2FUG2 3GTPJ 2W24A 2CUZA 2D2WA 4OINF 3MZYA 5BMZA 2V4JC 2HWVA 3HOSA 4XN3A 1O4XA 3N4MA 2NAZA 2CW8A 2P6TA 2VXDA 2VJ5A 1IAWA 1FNNA 2WV0A 2IGOA 2X6YA 2HOTA 4Q48A 9ANTA 1I5ZA 3U9GA 2P81A 2DA1A 2VC1A 1R23A 3ERED 4EJOA 1MZBA 3K2AA 1HW2A 2CUJA 4MHGA 4ZH4F 4Y3OA 4LJZF 2IT0A 4BJTA 2HYFA 2XV4S 4XOTA 1XX5A 2FMLA 3BCAA 3GMEA 1B59A 3FXUA 3LA2A 1ZAOA 3DKXA 3TOBA 2QQBA 2N8GA 1JHHA 1YW8A 3GO5A 2DT6A 2VASA 3KEYA 1SFEA 1V5GA 1Y6IA 3K7AJ 2DMPA 1OR7A 2HI3A 3ECHA 5ED4A 2QKLB 4A3DJ 4K2EA 2M3AA 4E6KG 2WWYA 1JT0A 1B6AA 1AWCA 3HZJA 1ETKA 1SFXA 3BC8A 2PMZN 1FBSA 3I59A 1RETA 2JUGA 2A68F 3RPUA 1N25A 2UWMA 3CUQA 3K4NA 3CF2A 5DD8A 2DOFA 3ELKA 3T1BA 1RUOA 2A6TA 5KVRA 2OUMA 1YTYA 5IT9K 2A05A 1JXSA 4ANJA 1FBUA 4S05A 1YIJI 3PSIA 4CSWA 2J5OA 3G4SI 2BHYA 3CMYA 1ZREA 2CQXA 5B3SH 2ZJRF 3HOZJ 1YO5C 1MMDA 1DU0A 3JAMZ 4IHVA 3HUGA 2DBBA 3KP2A 2WY7Q 4MLOA 3PM1A 1T98A 5FD6A 2F4IA 1ZARA 4P9UA 2ELJA 3DP7A 3TQNA 1P4AA 2F5FA 2HYGD 4D9JA 4M6YA 3PQJA 1J75A 3HPGA 2Z2SB 3H92A 4ZYGA 2OQRA 2ZB9A 1XS9A 4FX4A 2ACJA 4EM2A 4L9JA 3H5AA 4G8XA 4M74A 2HR3A 3CC2I 3NAUA 5BOXA 2R5ZB 5H6RA 4HV5A 3OYNA 4RLFA 4I09A 3Q0WA 2CFXA 2DA2A 3OYAA 1UHMA 3F8NA 1IXSB 4RDUA 4UVCA 5KCMA 4XR6A 1VQOI 2A69F 1AHDP 1CQTA 2Z16A 5HDGA 4IOAF 4Q5SF 1KQ8A 4MEYF 4G9YA 3OYHA 3J81Z 2WAFA 3H0DA 3C7JA 2LP0A 4HPQA 2KKOA 3HG9A 1DP3A 2HVQA 4ZYDA 2OF7A 4I02A 1A6QA 1SMYF 5FKNA 4G7OF 2O03A 1D1CA 2ZO4A 3GTLJ 4UXNA 5J4VA 1GHCA 3M9AA 3CMAI 2Q1ZB 1VTNC 2IBDA 1IW7F 2Y75A 1J5YA 5DEQA 2LKXA 4II3A 3SFZA 2O0YA 1BA5A 3CUQB 2PJPA 1UJ8A 1X3WB 3TW6A 1G2HA 1H88C 3A0BC 1IRGA 1USSA 4B3XA 1IV6A 4A0XA 3PFIA 2W4SA 2XGDA 4CCNA 2IEKA 1X4PA 1WWXA 4R8HA 2PFBA 5E3LA 2Q2EA 1IN5A 4I99C 4KIBA 5JHFA 3WTTC 1VQ4I 3HUGB 4B47A 5CQEA 1X19A 3RI4A 5F1RA 1E3OC 5K5RA 3LOCA 3EQLF 2ZKZA 3DU6A 1FWZA 4GYGA 4B4CA 2I8DA 4EM1A 4F55A 4WWCA 4H0EA 1A35A 1KYWA 4RBOA 1RZ4A 2JA2A 1EF4A 2QSFX 3KP7A 2M30A 5F1JA 5CVUA 4XLFA 2R7VA 2DA7A 1HDPA 1FC3A 3K9TA 3ZPLA 2LK2A 3WGGA 3LMMA 1JKPC 2E34A 3HC7A 4IRGA 2R92J 2M2EA 1LPQA 1WSUA 2NS0A 4PJ0C 3ZXSA 4HYEA 1GUUA 4DBQA 1YS6A 1MBHA 2PG4A 2M87A 2R3SA 3V7SA 4B8XA 4BXFA 5BPIA 1R71A 4KITB 3H9JA 1YJWI 1AKHA 3H3VK 2UV1A 2F5CA 3L2CA 1H89C 3H5NA 2M9HA 1T95A 5ICFA 1IN4A 3AG1H 3L7WA 4P9FA 1G3YA 3KYLA 4M3FA 1DU6A 4MO7A 2FOKA 3ZR8X 3DKWA 4HNUA 4U7DA 2YSRA 4D1QA 4LB5A 3S1QJ 3DTKA 4BQOA 3OS2A 3RKQA 2NVTJ 3EUHA 2LMDA 3H36A 3IKVA 2DA5A 5DYMA 2DODA 3KP5A 2OD5A 5DCFA 2LLKA 4XONA 3D0SA 4AYBA 4HAMA 4M3BA 2MH9A 3A02A 4E7HA 4DOZA 1E3PA 1QZYA 3HBLA 3Q9SA 3H0GJ 5LGNA 4IVNA 1KGSA 2F5DA 1BOBA 2ISYA 2Q2EB 2LG4A 1WQ2A 2F6CA 1L3LA 2L4MA 3ZN1A 5ILUA 4HZFA 5L3EA 1W7PA 2JSCA 2H6CA 4M6VA 3Q3SA 2LDUA 2DDBA 5D5WB 5D4SA 1RPWA 3A01A 1I6HJ 3C2GA 5TJJA 2EV6A 3ZQIA 5TISC 2YPRA 1JKQC 2CW0F 2Z99A 3QYEA 5L3FA 3NWSA 5FRMA 1MH4A 2NOJB 1WI9A 3FXRA 1ZTRA 3WODF 2BE5F 1WHUA 1T38A 3A0HC 1JT6A 2M0CA 4U0WA 5LFAA 1VQ7I 3ZOBA 1SC7A 3SYTA 2V9VA 3WTZA 3D5SC 4KDPA 1HW1A 4GRIA 1RKTA 4A3EJ 4FX0A 4XSXF 4ESJA 1IC8A 3K10A 4EEFG 1VQKI 4A69C 2XAGA 4IHTA 1AKHB 1FSEA 2IGNA 4DW6A 2VBYA 3D5LA 5J47A 3GYHX 5ICGA 4ON0A 4RM2A 4PSXA 5DS9A 4CH7A 4YFXF 2DMUA 2H8WA 2L5QA 2QSHX 2JVGA 3ZMDA 2DFHA 1WVRA 3FHNA 2L9SA 4XIDA 4ZDOA 3PIOF 2JRMA 3MN2A 3SDGA 1U5TA 4N9HA 3DFGA 2EFWA 3OR2C 1TP4A 3SQNA 3HL2A 2EINH 4IOCF 4Y17A 1UELB 4U0YA 4RGSA 1G6NA 4PJNA 4BE0A 1YLFA 1HSTA 2HGCA 3E5UA 3E7LA 1P92A 5CPRB 1IG7A 2IGKA 2WC2A 4HX7A 4BGDA 4WK8F 4BQAA 2R7RA 4F7ZA 2EZLA 2HXIA 4OIQF 4Q4ZF 2ZCWA 4U88A 2D1VA 2DFFA 1WPKA 1W7PB 2CQ7A 4UY8I 4M3EA 2CFOA 4E7KA 4MIMA 4UUSA 5BPDA 2IRFG 1MGTA 3A01B 3AG4H 2BGCA 5F0FA 4JX6A 2BY1A 5F0HA 4P5OA 3TGNA 5C44J 5LD2C 4ABZA 3RKXA 1D8JA 1FIPA 1IO2A 1BR1A 2NOGA 2BEOA 3DBHB 4OAZA 2VJJA 3PNTA 4BEHA 3UR3C 3H9QA 3TOAA 1Y1VJ 1J09A 2E5NA 2MH2A 2MLKA 3P9IA 3S32A 3OYJA 2HQNA 4KNYA 2QCOA 2DJNA 1K6YA 2FD5A 3HPHA 1J7KA 1KA8A 2C6YA 3W6VA 2VC0A 2B9SA 4HOBA 3LSRA 5FFZA 1O3RA 3OYCA 1T08B 3V4GA 3RSNA 3HKZN 2AQFA 5FGMA 4IKFA 1Y8RB 3BOQA 3DPUA 1R22A 4ZC3A 3LNQA 2Y31A 3UNGC 4P1WA 4BHBA 4WXDA 4XQFA 2KZGA 2PEXA 3I4NJ 1E0EA 3B02A 1MBFA 5AONA 1ETXA 3C18A 1Y1WJ 2QA4I 2WB1N 1U5TB 3PJRA 1GV5A 4KIFA 2FBIA 4KICA 5F27A 2EFOA 1OR7C 1F43A 3FZVA 1YQAA 4BH9A 4LB6B 2PMUA 2VKDA 1R4MB 2VPRA 2MFZA 3S2DJ 2O6GE 1HKSA 1I1SA 5E8IA 1OPCA 1GV2A 2MC3A 3MEXA 2H1KA 3RCOA 3CUQC 3O8HA 4JK1X 3P7NA 3NARA 1X1PA 3T0YA 5C4XJ 4IZZA 1D0YA 2V79A 1AU7A 1K61A 2EFPA 2COMA 3EPZA 5LRRA 1U8BA 2IS2A 4XL9A 4YFKF 4A12A 4BEHB 1ZG5A 1TWFJ 3CLQA 1MJAA 3G1LA 1O3QA 4NC7A 2A5WA 4A2UA 4BU2A 2OTLI 2HPIA 3OS0A 5FJ8J 3QWLA 1D3YA 2X85A 3GX4X 1TT0A 2Z9OA 3QAHA 5B66C 4YIFA 2X1EA 3GEZA 2KP6A 2R7XA 3CCEI 1NK2P 3HOUJ 3FK6A 4HNTA 3B6AA 1BOAA 4A6DA 1Z7UA 1BW6A 4CGZA 4I7HA 2OCCH 2CJJA 2QLZA 3F9KA 4AWXB 4LITA 1KZHA 3WU2C 1RIOH 4M3GA 3SJMA 1MW7A 5M5YJ 5HS9A 2VKVA 4NDLA 4NBQA 3GXOA 3DEEA 3KLOA 1Z6RA 4JX5A 5M5XJ 5A2QK 2XF7A 1F5TA 3M07A 3J80K 4B48A 4M71A 4BJ6C 3HOWJ 4MFEA 4HQMA 3RJPA 3O6BB 2E19A 4ESBA 1NG7A 4A0ZA 3K4CA 2GIZA 3LA7A 4EJUA 1S7EA 3BT9A 3ZMVA 4IXAA 4KA4A 2FRHA 4KT6A 1IN7A 1ZGWA 3K4JA 3HJEA 2KMUA 1R5GA 3HXLA 1BI3A 2XASA 2HVRA 1MNMC 2W00A 4S04A 1HSJA 2RDPA 3PO3J 4EJVA 2JMWA 2DI3A 3OR1C 3BG3A 2KIMA 3VYUB 3S3MA 3FM5A 2KRCA 1R58A 1B1BA 3K1MA 1P2FA 3N05A 2TCTA 2B7EA 4HSRA 5IOYA 4EJWA 3TBIA 1W0TA 1OKRA 1XSXA 2XGCA 3IL2A 4PK4A 3VPRA 1XGOA 1WJEA 2DA4A 3BG5A 5M3MJ 2M4KA 3RYPA 2DPUA 3CJTB 3OOUA 1XC5A 3L2VA 1UG0A 2IGMA 4ASNA 3PUBA 4R1HA 1S7AA 5GAEJ 2H94A 3L2WA 2M34A 2LYCA 2PMHA 2GLOA 2L7FP 4DNCA 4XKWA 2KIUA 5IT3A 1MJBA 5HDKA 4HEA2 2GZWA 3U21A 3VB2A 2KRFA 5F08A 1FMVA 1HDDC 5EEGA 3DBRB 2QGUA 1XCBA 2HS5A 2Y69H 3BJOA 2Y0SA 3J7AY 1MMGA 1XN7A 3J7YJ 2D5VA 1P6RA 4A3BJ 1KU9A 4HV6A 2E2IJ 4FE7A 5FKLA 3PIPF 3F21A 1DGWY 4B3AA 2KPMA 3BTJA 3CCSI 3HGGA 4KFCA 2ZSIB 2MA3A 1ODDA 4RGXA 3TP0A 2WAQN 5GADJ 3EUHC 2KLOA 3RDIA 4XSZF 1W0UA 4RM3A 6PAXA 3LFUA 4U0VA 1Z3XA 3KP3A 4RAYA 1TT5B 5AIPA 4W1UA 3HYIA 1NG6A 2EFNA 3IAS2 5JVTA 1XDUA 3GW2A 3W2AA 2M5WA 1U9OA 4NQWA 3KPHA 4M6XA 3QYFA 5IYBJ 3IWFA 2PQ8A 4IHXA 1LQ1A 1S29A 3TDUC 3VWBA 3IV5A 2P4WA 1YJ9I 3SZGA 4XN0A 4HRIA 1GLNA 3VSKA 4CCKA 5B1BH 2DMQA 4PUSA 3BCBA 3HEFA 4LIVA 2UUZA 3ABLH 2YU9J 2K85A 2QUFA 2EB7A 2FBHA 3BR2A 2R7OA 4KT5C 4HX4A 4UV9A 2VQCA 2F4MB 1QO0D 2KISA 1MBKA 2LBFB 2M4GA 2NRAC 2BVMA 2ID6A 3LSTA 3S14J 1R00A 3R4KA 2JT1A 2VPLA 3UKGA 3OSGA 5LHGA 4DQ2A 2GXAA 3G1MA 3S3NA 4EQQA 2CSOA 4ETSA 1OMIA 2DK5A 5ICEA 1IF1A 5IYDJ 2ME6A 1R1TA 1G59A 1H0MA 1QHHD 2XGXA 1X2NA 3GTQJ 2R7TA 3NEUA 1UHSA 2XHKA 4NUBA 1U8RA 2R7FA 1Q1HA 5CLSA 1GXPA 3OYDA 4N4OB 2R5ZA 2ZC2A 3M1CA 1JE8A 2VBZA 3H3UA 1ETWA 3GLXA 2IS1A 3BP8A 3HGYA 2KJCA 1KYZA 2RQPA 2A6EF 1U5TC 3QU6A 2CQNA 2Y48A 1D1BA 2K9LA 4PFOA 2P5VA 1IJWC 1HKTA 1X58A 1Q1VA 2VQLA 1ITYA 2CW7A 4V2FA 4X6AJ 2KRHA 2HTSA 1WJFA 4NQWB 1YX5A 3DXJF 1XMAA 3BDDA 1G4DA 3B6CA 5IY5H 2BHZA 3W2WA 3M1EA 2DW4A 1S5LC 2RGVA 1XD7A 3R0AA 3HSRA 3C3WA 1SFUA 3JREA 3TO9A 4AUXA 4MTEA 3AG2H 4AC0A 2VT3A 3EUAA 5EZHA 3I56I 2L7MP 2VT2A 2EIJH 3K2ZA 2LH9A 2K7LA 3BJ6A 2R7SA 1ZLJA 1WCMJ 5GAGJ 4ZJZA 2H8RA 1IZ1A 3QRFF 2CGPA 4RAZA 1VZ0A 2STTA 3O8GA 2NVUB 3FXJA 4DYQA 3CCYA 3VYRB 2BY2A 4TV7A 2MGQA 2IXSA 4OIRF 1TWCJ 5E20A 3QYBA 2KJBA 3K1PA 2P5KA 2CUEA 4XK4A 1SAUA 3E1SA 1ZG3A 3E97A 3ISPA 4BACA 1OCPA 3OS1A 5KNLA 1ONVA 2XPUA 5EG0A 3RPUD 2L9RA 1W36C 2L7ZA 1QVTA 4BL0B 2AHQA 2JRTA 5GAHJ 1BJAA 1SFOJ 1IRFA 4E7SA 3HOVJ 4DIQA 1Y56A 3WTUC 3H3ZA 1Y8QB 5M5WJ 1UZCA 2R7DA 4JP0A 1IDZA 1BI1A 2DTZA 2RN7A 4J01A 1VQNI 3DLLF 1APLC 2W57A 3MKZA 2DK8A 4XICA 4XM3A 5H20A 1YHQI 3L2QA 2FXAA 2Y9YA 1WI3A 3DV8A 1MH3A 4HDVA 1FYLA 1FX7A 1YRNB 1TWHJ 3FXMA 5HODA 2ADUA 1ETOA 4B1RA 1K4SA 2HNHA 2K02A 4IL6C 3ZCOA 4RAGA 2LVSA 2Q0OA 2P7CB 2G7HA 2OC6A 2BVLA 1ZRCA 2HEOA 1G3WA 2QZ8A 1JJ8C 3HHGA 2XPVA 3F6OA 2R7WA 4DGWB 2KL4A 3QP5A 3IC7A 3T8RA 2IAIA 2ICWG 4F52A 2RNGA 4LK1F 1P4WA 4YRVA 3W6JB 3DPTA 5D6FA 2Z3YA 3HHHA 4CICA 3GVAA 4XORA 4D7MA 2CRGA 4D7NA 1OFCX 5FO5A 3A03A 1B4AA 1IN8A 5J1RA 1AA7A 3QOEA 4BQNA 1FP2A 3ZRGA 2HFHA 1DGRM 4XKVA 3PO2J 4IPAA 2YU3A 4FETA 2RQQA 1T56A 2DQRA 2WTEA 5DD4A 3MWMA 5E8GA 1H9GA 4BKXA 5JHUA 4QTRA 4P55A 1VQLI 2ZXIA 3K4MA 1EH6A 1SD6A 3OL3A 1Z7LA 5EG0B 2NVXJ 2FEZA 3GF2A 1HA8A 4AIDA 2W85A 1ON1A 5DUIA 4FCYA 4RAFA 3F8MA 2WBMA 1FSHA 1YYVA 5ERIA 3FBIB 4GGGA 5JLWA 1RUNA 4ZZDA 3GZNB 1ULYA 1ETVA 4UVAA 1T39A 4RGUA 1K78A 2JWTA 1XMKA 3KE2A 2Z5UA 4AM3A 2J5PA 3O2PE 5EEAA 4A3KJ 2LREA 2V1DA 4YFNF 2E35A 1KQ9A 1W5CC 3AL0B 5FKKA 2VJIA 2K40A 3OL4A 4O3MA 2L4AA 5IT9Z 3OYFA 1MMSA 3WTSC 2GOXB 5H6QA 2R4GA 1MBEA 2QQAA 2EH3A 1X1AA 5GPCA 2FU4A 4XKCA 3LQQA 3KYCB 1MNDA 2MC4A 4BUPA 2WY8Q 4FISA 3QP6A 2ZFUA 3W2VA 1MIJA 2WADA 5KHDA 5BNGA 2B63J 1YI2I 4GXOA 4CCLA 1W5SA 2JPCA 4L5JA 4CCJA 4XKBA 3ZQCA 1R36A 1ZK8A 1LNWA 4NC6A 5CVRA 3CCLI 3DWLE 2R0QC 1CF7B 3I53A 5FLMJ 3KIOA 2HQ5A 2O9LA 3CCRI 2ZMEB 2GXGA 1LFBA 3WGIA 3GTGJ 2K4JA 4G6QA 4I2OA 1RNLA 1BIBA 4HBLA 3R6SA 1WH7A 1BC7C 2H6BA 1LVAA 2P0WA 2JA5J 4PGGA 1TQPA 1PUEE 1HKQA 1JTXA 5LEJA 3E6BA 4LMYA 2H1LA 5C4JJ 3C2BA 3G3ZA 2R7UA 3BTCA 4L9TA 4E7LA 4CO8A 1S7OA 3G2BA 4M72A 2EJRA 3ZGKA 3BZKA 3HKZA 4XLCA 4ZDLA 1V5FA 1OCZH 5KK1A 1O57A 3TDZC 1B72B 2JA8J 2M8GX 4RB3C 4HLXA 2R5YA 3J7AO 1LEAA 3CESA 5F04A 4BY1J 5HNFA 1LKXA 1RC9A 2NYXA 4M3DA 1R9TJ 1K78B 3P9KA 4FTHA 3V7RA 5EYRA 1XCVA 5IYCJ 4OIOF 1VQMI 5FLXK 2JSPA 4XRSG 3JSPA 5DM7F 3T8TA 3FF5A 5HS8A 5D8LB 2EILH 1WH5A 3ZP5A 2DQLA 1GVJA 5FKMA 2E71A 4HF2A 1MMAA 1N75A 4OMZA 1W5TA 1J9IA 1D8KA 1FLIA 4IHYA 2OJED 3DEWA 4PJMA 2ESNA 2ZNZA 3DBLB 2V9PA 1VQ6I 1L0OC 1TZLA 3WE3A 1WGXA 1HCRA 4ENNA 3VDXA 1X1CA 3PNVA 1VQ5I 3HDDA 4DZPA 4ENKA 1FOWA 2G9WA 1DDNA 3DTEA 2R7QA 2RVCA 1FZPB 1USTA 3BY6A 4KYWA 3ABTA 3SEZA 2I10A 1IRXA 2DJIA 3BPXA 3CDLA 2IA1A 2OV7A 2HKXA 2KQRA 4M9SA 1NH3A 3FDYA 2Y9ZA 1IN6A 4A5NA 4AYBN 4XRFA 1R49A 3MKLA 1B8IA 3P9CA 1J59A 4CCMA 1ERDA 1V55H 2OCEA 3KZZA 2BBYA 2E1MB 4NB5A 1D5VA 3HOXJ 3HTUA 4DZJA 2V1UA 1HQCA 2EZHA 2R5YB 1IGNA 2VI6A 2FSWA 2IJLA 5LRSA 4Y7NJ 4J19A 3ZQGA 3BWGA 2ECCA 2WA0A 3LL7A 3HRUA 2DMTA 1YW9A 3CD6I 2JZYA 2AXTC 5EZGA 4QWQA 1OISA 3JTHA 1UMQA 3IH3A 4GDFA 5J40A 5TGTA 3LSGA 3LWFA 4LFUA 4I98B 4ESFA 2QM3A 5M3FJ 1R7JA 2VLAA 4OAYA 2IA0A 2MBFA 3SDBA 4A3IJ 3IWZA 5HDNA 1YITI 4HSTA 3X2QH 3CCMI 2GM4A 5GTIC 1LUJB 5CQGA 1ZG1A 2QBYB 2BV6A 3C1DA 2DFEA 1VNDA 2XAFA 3LAJA 1UHWA 2O61A 1Z6TA 4UB6C 2NNYA 3OMYA 1IV8A 2CQKA 5CVJA 1KU2A 3O3KA 1XGNA 1Z1DA 5J6XA 3F0CA 2PBIA 1GXQA 2K4BA 1O3SA 1S3JA 4CYCB 2L01A 2JPBA 3LSMA 3S16J 2W1OA 3V8LA 3OYIA 1W36D 2JJ7A 2V26A 2MW8A 4RB2C 2KDZA 3KYDB 1VQ9I 1ZQ3P 4XLPF 3M4OJ 2KIQA 4EV0A 2A6HF 4ZDPA 1B8IB 4N4NB 1XSVA 1ON2A 2XIGA 4RGRA 1Y0NA 2DDAA 2ESHA 1JHFA 3HOTA 3LSPA 4Y52J 4IQ4A 2HVSA 2ME0A 1NHAA 1JGGA 4D0PA 1MD0A 4AD9A 4BE1A 1R1UA 2VONA 1MNEA 4D5FA 3OWTA 1TNTA 3VYTB 4RB1A 3JRCA 4V19K 2Z33A 2K86A 4XRMA 3HB9A 1WZ2A 3CC4I 1LDDA 3OIQA 3H1CA 4WXHA 2XC7A 2HTJA 3FXLA 1B9NA 2VN2A 2X48A 2L3DA 3ZQFA 3WTXC 2Y0MA 2UXNA 2XRLA 3JRIA 1V54H 2DA3A 2LNBA 1MKMA 1U2WA 2X9DA 2FMYA 3IRRA 3AL0C 2W48A 4Z2YA 4YIIA 1PYVA 3OYEA 3EYIA 2NXNB 4R79A 3FMRA 1LDKB 3K0LA 3V42A 4X1EA 3BQZA 2Z1DA 1R5HA 3MAJA 4LGWA 3EDPA 1N78A 1I3AA 5E1ZB 4C3JJ 2JUCA 1JUSA 2VL8A 4BBSJ 2P7VB 4YEJA 4DBRA 3TP3A 2VBWA 1Z21A 1QPIA 1AOYA 4B09A 1CGPA 5J8FA 1TWAJ 3CCQI 3JRBA 1XPXA 4Y33A 2HOAA 2NVYJ 3BR5A 2MD0A 4EMSA 1XTAA 3ASOH 3WTYC 1LJ9A 2ZXWH 4E7IA 4HG2A 3VYSB 4D5CA 1U0JA 5J1UA 2DMNA 4EATA 1D0XA 2L9NA 4XBFA 1D0ZA 2L02A 2LBFA 2VQHA 4Q47A 4MTDA 1V5EA 4LLGF 4IJAA 3DEUA 4PJLA 4XOPA 3JCUC 3TO6A 2DTRA 4NNJA 2XDVA 2F48A 1A04A 1BC8C 2VE9A 2R93J 1Z0XA 2CUFA 1QA6A 1R4NB 3JTGA 1R5ID 2GOMA 4G6DA 2X6OA 2VQGA 4HLYA 5GTHC 1R1VA 4NC8A 3VSLA 3BG6A 2V1NA 2XAUA 5HVQC 3IRQA 1BJZA 2EWNA 1ACIA 4AIJA 2LF7A 4MGRA 5E17F 1T0FA 2X1DA 2M8EA 4QPQA 2ZJPF 2H09A 1K7AA 1X2MA 3R61A 1P7JA 2E1CA 4EGZA 3FKJA 2A5YB 2XSJC 2G0EA 1X4OA 3DTIA 3KETA 3I55I 4F3QA 3FHZA 3TMOA 1FEXA 3TL4X 1A31A 1X3UA 2RNJA 2RV8A 3JAMK 2PJRA 3OYMA 2VXZA 2EV5A 1MBJA 2MSYA 1KU3A 5LGTA 1OYIA 2F4OB 5EGOA 4JOMA 2PMZA 3TW7A 3CLOA 4BHCA 2JTVA 3W3CA 4RMNA 2CYYA 3FXOA 1SD5A 5D5UB 1PUFA 2W84A 1P4XA 4L9VA 1WJCA 4I0AA 5DV5A 2UXXA 4JX4A 3OYBA 3Q9VA 4H4KC 3F8CA 2A07F 5J1YA 4KN4X 4A6EA 2QYOA 2IP2A 3QOPA 3CUOA 5HNHA 4QLCU 3NRVA 4WF2A 1ZHFA 2OQGA 3WTVC 3W6KB 4BXUA 1F9NA 1XSDA 3WG7H 3J81K 1X1BA 2YX4A 4BAYA 1XG1A 1ZN2A 3FISA 3KLNA 4G7HF 1V3FA 1JTYA 5EF6A 2K9MA 2HZTA 4A5MA 2GA2A 3MMYB 4EJTA 2I5UA 5A2QZ 3ZQHA 3S3OA 4PZJA 3J80Z 2X0LA 4LOCA 1QRYA 1HW5A 5LGUA 2A61A 1YG2A 3S2WA 1ZKGA 1BIAA 1HF0A 2AXLA 1J0RA 2ZBKA 3TKYA 4F93B 3HTSB 4KJZA 3I5UA 3JRHA 1FT9A 1WJ5A 2VKEA 5D5XB 3CMMA 1E2XA 2EA4A 2YUSA 1YX3A 1STZA 5F6FA 4MEXF 3I4MJ 1GDTA 3DCFA 4KMUX 2CV2A 3BG7A 4IEJA 4QSHA 1TW2A 5FFXA 5C3EJ 4G12A 4N9IA 2L7KA 1ZGJA 4ZTJA 1E17A 1PJRA 2L2OA 2RKHA 1YW7A 2LY1A 2L9VA 3F8FA 3L09A 2PJRB 2WAEA 1A6IA 3ULQB 5K7FA 2RREA 2XAHA 2D45A 4OIPF 2MYSA 5ILSA 4RA2A 1UAAA 3K4BA 2Y0SN 3U2RA 2NS8A 4OWRB 3RTRA 1TTYA 1YRNA 4L0YB 4EGYA 5D4RA 1ZRDA 2XAQA 3EYYA 3GLLA 5EGOB 3SZPA 4PDKA 3G73A 1G8XA 5CYVA 3RQ4A 5D8KB 1PUFB 1U9NA 2W82A 4F91B 3BR0A 4A3CJ 2ZNYA 1MMNA 2DN0A 3K1NA 3E6MA 1P9QC 1QZEA 3V8JA 4B43A 3MFKA 1QHGA 4DJAA 1XMXA 4E4HA 1LFPA 1QZZA 1WJDA 4Y4RA 5LHHA 1MBGA 1LE8A 5LLQA 2P8TA 3HRMA 2ISZA 1XGSA 3GCMA 1FTZA 1JJ6C 2M0MA 3HSEA 4FE4A 2XKPA 1KU7A 2V9KA 1BR2A 3PUFA 3GZ5A 1M1EB 1T33A 3S8PA 4AVZA 4IRIA 3ZN0A 2FOWA 2QF7A 3JR9A 4LG0A 1FIAA 2M7BA 1WRJA 2K9SA 3S15J 3OIPA 5CKTA 2ID3A 2XVCA 1OCCH 4AVPA 2VB6A 2K9NA 2FQ3A 3DKYA 2XKOA 4XRSA 3AKZA 4CHUA 4FHTA 4M9ZA 4MQVA 2K3FA 2ETHA 3A4CA 5B1AH 3M3YJ 1P7IA 2E2JJ 3BR1A 3N97A 3TO7A 1UCRA 3GUDA 1JUPA 2HZDA 1MDMA 2EFQA 4XMYA 2GBYA 4E70A 1IXCA 2EBIA 4C9YA 4CXFA 4KN7X 3RPQA 5GP9A 3V8KA 1H8AC 1NTCA 3OIOA 2PI0A 2KDOA 4CA0A 3K70C 3VFZA 2MLGA 3GFLA 3Q5FA 5L3CA 3PQKA 2B0LA 4MFDA 3WU1B 2CG4A 2FJ1A 3I64A 4I76A 2OZ6A 4E7JA 4QPOA 3ABUA 3WU0A 3CF5F 2GQQA 5EJCA 1JI8A 3KX2A 3K6GA 3FMQA 1FY7A 3OSFA 2MD5A 5BQTA 2LR8A 3MZ8A 3FK7A 2XSDC 1EA3A 5K7ZA 3KP4A 3G6EI 3E6DA 5B5EC 3KZYA 4HX8A 4O5VA 4CZCA 1LE8B 4DYCA 5FLVA 3H35A 3IH4A 3H9GA 1RR8C 1D5YA 4UV8A 2D1HA 3VODA 4C3HJ 2FNPA 3F3XA 3V7CA 1I39A 3AAFA 1CF7A 3CP8A 3QPSA 2E7XA 5KAIC 3I59B 2ZMEA 4BJ5C 3JW4A 4V2GA 4LG0B 1A36A 4BS9A 2LY2A 3S1RJ 3B73A 5J8CA 1QQIA 4XLEA 4LLNA 1T8IA 3Q0UA 4HQEA 3REOA 2BW3A 4EVIA 1U78A 1IUFA 4O6JA 3QPTA 2OAZA 1ZR2A 4UHTA 2Q8KA 2E7WA 3OV8A 2OPTA 2K3PA 3KCCA 5TRDA 1QNTA 2FA5A 1G3TA 4ITVA 4GFBA 4E7ZA 1DP7P 4IHSA 1V4RA 2NNNA 3L2UA 1RRJA 2IS4A 1QPMA 1RESA 2X6WA 1MDMB 1WFXA 1K6OA 4PGHA 2XAJA 3BZCA 1HXDA 1B72A 3LAPA 1LB2A 1I3QJ 3OYLA 2FNAA 4OOIA 5FKOA 1XB4A 2OBPA 5KAFC 2DPDA 1W4MA 1DPUA 2E1NA 3MD2A 3LSJA 3L1PA 1UFMA 2ZJ2A 2ZXHA 3JRAA 1TL8A 3BROA 4JQFA 2WV1A 2M45A 4RB0A 2JA6J 2VJ4A 2XB5A 1TQIA 2DYRH 3ZQQA 1OYWA 3EUKL 2DT5A 3BQYA 1FPQA 4I0BA 2FF4A 4Y15A 3HM5A 3OYGA 1MJ9A 5D5VB 3G71I 1ZGAA 2H27A 5FROA 3GFJA 2L0KA 1JUMA 5E3NA 1HOMA 3I9V2 3NWTA 1ZR4A 4OMYA 2OTJI 1FOXA 3MKYB 3F72A 1BBYA 3MCZA 1FBQA 2IPQX 5E1XA 5JI6A 4HF1A 3M8JA 2L54A 2HKOA 2VE8A 2LOOA 1OCRH 2DA6A 3ABKH 3GTJJ 2X1CA 3QPHA 3SXYA 1I50J 2P6SA 1U6GA 2VUMJ 2LTPA 3ECOA 4G6TB 2A3SA 3S2HJ 2Y2ZA 3I54A 1SANA 3CMEI 1TQMA 3GTMJ 1I6XA 1IDYA 4L0ZB 3IP4B 2E36A 1FTTA 1O7LA 4CCOA 2JVHA 3ONQA 4A93J 2BW3B 3E3VA 3I3LA 1PP8F 2CV0A 5L3BA 2BYVE 2P5LC 2BZTA 2V6EA 5IOZA 4UUVA 3IHUA 5K1YA 4G94A 4XLHA 2QWWA 3ROUA 1KQ0A 3CJRB 2V7FA 2TDXA 2HPMA 3BJAA 2EZKA 3BR6A 1SD7A 4LIUA 4BXXJ 2LY9A 4FQGA 4HF0A 2XPWA 4J00A 4ZYHA 5CVVA 4UVBA 3M8EA 2O8KA 2O5RA 3CDIA 1T0FC 3SEQA 3ZMSA 1T6SA 3JRFA 1EJ9A 1QGPA 4Z6YA 1FP1D 3OOPA 4BE2A 5K5QA 2DU9A 2HOEA 3MVPA 1W7PD 1TWGJ 3BPVA 1JGSA 2CV1A 2EV0A 2WB1A 3ZQ7A 4IX7A 1OQYA 3GFMA 1YFHA 1ORKA 2HXOA 2AS5F 3RQIA 3S17J 3F22A 3ZMZA 1BI0A 1DPRA 3TEDA 2BXYA 3RIRA 1XGMA 4BBRJ 4C2TA 1ZLKA 4ZZLA 2DXIA 1VF9A 3HRTA 3I58A 4KIGA 3G1OA 3CC7I 2W25A 3DLAA 3RZDJ 1YS7A 3OY9A 4AU7A 2QBYA 2ZXJA 5E1WA 4G7ZF 1O3TA 3IH2A 3IKTA 3LSKA 1YJNI 4L18B 3AG3H 1ZELA 2JQ7A 2G7UA 4A3LJ 1PP7U 2CWEA 3DQVC 3CCJI 3VEPA 4RS8A 5DDGA 3CJNA 3PNYA 4OU0A 4CYCA 2EPFA 4EM0B 3LSHA 4LD5A 5HLIA 1K79A 2LKSA 2QENA 2BY0A 2ZSHB 5DM6F 4BY7J 1BN5A 2EIMH 3K4KA 2KHMA 5L3DA 3KEOA 2HQAA 4WCGA 1R6RA 2ECBA 4N0BA 3S1NJ 2QVOA 4ENJA 4F92B 1OLTA 4W97A 4Y13A 1T2KA 3L9FA 2XUBA 1SVMA 3BR3A 5H2FC 5IP9J 2STWA 2LRDA 3PL8A 2YR2A 5DCMA 2DFIA 1C0WA 3C2HA 2EA2A 2F5EA 2F2EA 4C2MJ 2X6XA 5HOOA 3U1DA 4L5EA 1NK3P 3ZMTA 3CCVI 2Y30A 5E79C 2O7OA 2AO9A 1EH7A 4A3MJ 2PLYA 2EIKH 1YOVB 2DOEA 1SVOA 3MQ0A 2FE3A 1PDNC 4XLAA 4X0GA 2LD5A 1JKOC 1OYYA 1VQ8I 2AQEA 3GZ6A 3KP6A 1MSFC 3FKIJ 1IUYA 5HLHA 3I71A 1IXRC 4WX9A 2NVQJ 3QU3A 2IVMA 2QKMB 3MZHA 3FWEA 3H5RA 4JYKA 4KISA 2HU9A 4IQJA 4HNVA 5LBQA 1LFUP 3BTIA 3RYRA 2JA7J 3AFHA 1SD4A 2YX7A 4II2A 4PSWA 2EK5A 1WJBA 3F8BA 1BI2A 4A3FJ 3R60A 1F1ZA 4ZTFA 4MNUA 1TNSA 1OCOH 5F0CA 4PFPA 1ZRFA 1A5JA 3L00A 1SFKA 4BHPA 4KMFA 2UZKA 2QSGX 3IUOA 3S1MJ 5FB2A 1F4KA 2GIVA 1Z91A 2FBKA 1H9TA 4GYIA 1Y0UA 4BQQA 4I6ZA 2XRNA 4PCQA 4C3IJ 2DO7A 1BL0A 5DUKA 1LDJA 1ZYRF 2MG4A 3QPLA 4WXCA 1U3EM 2HOSA 3CCUI 5HS7A 2ELHA 2M1BA 3SZTA 4ENMA 3DPLC 4CZZA 5DCMB 4A3GJ 4AIHA 4L5IA 2DLLA 2VKHA 4YIRX 1X3ZB 4UUSB 1LVKA 1KONA 1WKMA 5FLXZ 3K70D 3M7GA 2XROA 4DYRA 5CJ9A 5HLTA 4GCVA 3WHCA 1JKRC 1FMWA 5JLXA 1E3HA 1SAXA 2VODA 1S6LA 3CTAA 3DF8A 3PFYA 1Z9CA 5FRNA 3CQZJ 5J3LA 5E18F 1B9MA 4UNOA 2CS3A 1DQUA 3RKWA 4M73A 1TC3C 3BZ6A 3BG9A 1FOYA 3LSIA 1J2XA 3ZMUA 2TRTA 2M7AA 4RLQA 1POGA 1QU3A 4XLNF 3K4LA 2QEXI 4LLLA 1RR7A 5AIQA 4ZYAA 1QVUA 2F5VA 2DYSH 4S0HB 2DCEA 2WAQA 1FJLA 4M9XA 1EH8A 2HDCA 1ZH5A 4YELA 2KIFA 1XDSA 2OA4A 1UG2A 4A0YA 1BW5A 2KT0A 2RAEA 5IP7J 5IPAA 2DT7B 4IHWA 4JBAA 3I4PA 2V6CA 3OYKA 4IF4A 1SEUA 3L2RA 1TW3A 1BR4A 4NHJA 4C30A
chains in the Genus database with same CATH topology
3T5XA 3CO6C 5HLGA 2DAOA 2ZFWA 3F6VA 2LSOA 4U7BA 3JSOA 2PN6A 5FD5A 2CO5A 3WGHA 3EETA 5JR3A 3LQRA 5LHIA 3LA3A 5ICCA 4HDUA 3HIFA 3RKYA 3KEQA 2OZUA 3M8FA 4FT8A 3E5QA 5JFRA 3VOEA 1LEBA 1QBJA 3FM3A 4P96A 1REPC 3NQOA 2OU2A 4GO1A 3FX3A 1TBXA 1FYMA 2GXBA 2QQ9A 2VOOA 4BNCA 3E5XA 5BS6A 2VOPA 3HSFA 3WG9A 2RC4A 2LF8A 3GWZA 1UB9A 1I1GA 4LK0F 2V1XA 3SHFA 4YG2F 4MQ9F 4ZYEA 1YIOA 3FXQA 5K5OA 3FMSA 3COAC 1FYKA 3I0TA 4CDGA 4HW0A 1I27A 2GWRA 3K69A 1RI7A 3CDHA 5D6EA 4AIKA 5EEHA 1TLHB 5LEKA 2VBXA 4L9NA 2O3FA 1O7FA 2X4HA 1BM9A 3WTWC 3ML6A 1Z05A 3CO7C 3E6CC 4HA8A 2GA1A 1FOKA 4IRHA 2LKPA 4KUMA 5ILVA 3KFWX 1EV7A 1SMTA 1S8NA 5CVIA 4BYYA 1DUXC 3WE2A 1G3SA 3GFIA 2IA2A 2O8XA 2HQRA 4I01A 4CYDA 2IW5A 2K27A 3R0JA 3F23A 5L3GA 5F64A 1HBXG 3LFKA 2GAUA 3HRSA 2W24A 2D2WA 4OINF 3MZYA 5BMZA 2HWVA 3HOSA 3N4MA 2NAZA 2P6TA 1IAWA 1FNNA 2WV0A 4Q48A 1I5ZA 3U9GA 2VC1A 1R23A 3ERED 4EJOA 1MZBA 1HW2A 4MHGA 4ZH4F 4LJZF 2IT0A 2HYFA 2XV4S 2FMLA 1B59A 3FXUA 3LA2A 1ZAOA 3TOBA 2QQBA 1JHHA 1YW8A 3GO5A 1SFEA 1OR7A 5ED4A 3ECHA 4K2EA 2WWYA 1B6AA 1AWCA 1SFXA 1FBSA 3I59A 3RPUA 2A68F 2UWMA 3CUQA 5DD8A 3T1BA 1RUOA 3ELKA 5IT9K 1JXSA 5KVRA 1YTYA 1FBUA 4S05A 2J5OA 1ZREA 1YO5C 3JAMZ 3HUGA 2DBBA 3KP2A 1T98A 5FD6A 1ZARA 4P9UA 3DP7A 3TQNA 1P4AA 2F5FA 2HYGD 4M6YA 3PQJA 1J75A 3H92A 4ZYGA 2OQRA 4FX4A 2ACJA 4EM2A 4L9JA 4G8XA 4M74A 2HR3A 5BOXA 5H6RA 4HV5A 4I09A 2CFXA 1UHMA 3F8NA 1IXSB 4UVCA 2A69F 5HDGA 4Q5SF 1KQ8A 4MEYF 4G9YA 3J81Z 3C7JA 2KKOA 4ZYDA 4I02A 1SMYF 4G7OF 2O03A 2ZO4A 4UXNA 1GHCA 3M9AA 1VTNC 1IW7F 2Y75A 1J5YA 5DEQA 3SFZA 2O0YA 3CUQB 2PJPA 1IRGA 1USSA 4A0XA 3PFIA 1WWXA 4R8HA 2PFBA 2Q2EA 1IN5A 4KIBA 3WTTC 3RI4A 5F1RA 5K5RA 3EQLF 2ZKZA 1FWZA 4GYGA 4EM1A 4WWCA 4H0EA 1KYWA 1RZ4A 3KP7A 2M30A 5CVUA 1FC3A 3K9TA 3ZPLA 3WGGA 4IRGA 1WSUA 2NS0A 4HYEA 1YS6A 2PG4A 2M87A 2R3SA 3V7SA 4B8XA 5BPIA 2F5CA 3L2CA 5ICFA 1IN4A 3L7WA 4P9FA 1G3YA 2FOKA 3DKWA 4U7DA 2YSRA 4LB5A 3EUHA 3IKVA 5DYMA 3KP5A 2OD5A 5DCFA 3D0SA 4HAMA 2MH9A 1QZYA 3Q9SA 5LGNA 4IVNA 1KGSA 2F5DA 2ISYA 1WQ2A 1L3LA 2L4MA 3ZN1A 5ILUA 4HZFA 5L3EA 1W7PA 2JSCA 2H6CA 2LDUA 5D5WB 5D4SA 5TJJA 2EV6A 2YPRA 2CW0F 2Z99A 5L3FA 3FXRA 1WI9A 3WODF 2BE5F 1T38A 4U0WA 2V9VA 3WTZA 4KDPA 1HW1A 4FX0A 4XSXF 4ESJA 2XAGA 4IHTA 1FSEA 2VBYA 3D5LA 3GYHX 5ICGA 4ON0A 4YFXF 3ZMDA 1U5TA 4N9HA 3DFGA 2EFWA 3SQNA 4Y17A 4U0YA 4RGSA 1G6NA 1YLFA 1HSTA 2HGCA 3E5UA 1P92A 2WC2A 4HX7A 4WK8F 4BQAA 4F7ZA 4OIQF 4Q4ZF 2ZCWA 4U88A 2D1VA 1W7PB 5BPDA 2IRFG 1MGTA 2BGCA 4P5OA 3TGNA 3RKXA 1D8JA 2BEOA 3TOAA 3P9IA 4KNYA 2MH2A 2MLKA 2HQNA 1J7KA 1KA8A 2C6YA 2VC0A 4HOBA 5FFZA 1O3RA 3V4GA 5FGMA 3BOQA 1R22A 4BHBA 4WXDA 2PEXA 3B02A 5AONA 3C18A 1U5TB 4KIFA 2FBIA 4KICA 2EFOA 3FZVA 1YQAA 4BH9A 4LB6B 2PMUA 2O6GE 1HKSA 1I1SA 5E8IA 1OPCA 2MC3A 3MEXA 3CUQC 4JK1X 3P7NA 3T0YA 2V79A 2EFPA 2COMA 5LRRA 4YFKF 4A12A 1ZG5A 1MJAA 1O3QA 4A2UA 1D3YA 3GX4X 2Z9OA 3QAHA 4YIFA 3GEZA 1BOAA 4A6DA 1Z7UA 4CGZA 4I7HA 2QLZA 4AWXB 1RIOH 5HS9A 3GXOA 3KLOA 1Z6RA 5A2QK 1F5TA 3J80K 4M71A 4HQMA 3RJPA 3O6BB 4ESBA 4A0ZA 3LA7A 4EJUA 3ZMVA 4IXAA 4KA4A 2FRHA 1IN7A 1R5GA 1BI3A 2XASA 4S04A 1HSJA 2RDPA 4EJVA 2DI3A 2KIMA 3FM5A 1R58A 1B1BA 3K1MA 1P2FA 4EJWA 1OKRA 1XSXA 3IL2A 1XGOA 3RYPA 2DPUA 4ASNA 4R1HA 1S7AA 2H94A 2PMHA 4DNCA 2KIUA 5IT3A 1MJBA 5HDKA 2GZWA 3VB2A 2KRFA 5EEGA 1XCBA 2HS5A 3BJOA 1XN7A 1P6RA 1KU9A 4HV6A 3F21A 4KFCA 2MA3A 1ODDA 4RGXA 3RDIA 4XSZF 6PAXA 4U0VA 3KP3A 4RAYA 5AIPA 3HYIA 2EFNA 5JVTA 1XDUA 3GW2A 2M5WA 4NQWA 4M6XA 3IWFA 2PQ8A 1LQ1A 1S29A 3TDUC 2P4WA 2QUFA 2EB7A 2FBHA 4KT5C 4HX4A 4UV9A 1QO0D 2NRAC 3LSTA 1R00A 3R4KA 2JT1A 5LHGA 4DQ2A 4EQQA 2CSOA 4ETSA 1OMIA 2DK5A 5ICEA 1IF1A 1R1TA 1H0MA 2XGXA 3NEUA 2XHKA 1GXPA 1U8RA 2R7FA 1Q1HA 5CLSA 1JE8A 2VBZA 3H3UA 3GLXA 3BP8A 2KJCA 1KYZA 2RQPA 2A6EF 1U5TC 3QU6A 2Y48A 2P5VA 1HKTA 2HTSA 3DXJF 1XMAA 3BDDA 1G4DA 3M1EA 2DW4A 2RGVA 1XD7A 3R0AA 3HSRA 3C3WA 1SFUA 3TO9A 4MTEA 2VT3A 2VT2A 3K2ZA 3BJ6A 2K7LA 1ZLJA 1IZ1A 3QRFF 2CGPA 4RAZA 2STTA 4TV7A 4OIRF 5E20A 2KJBA 3K1PA 2P5KA 3ISPA 1ZG3A 3E97A 1ONVA 2JRTA 1BJAA 1IRFA 3WTUC 3H3ZA 2R7DA 1BI1A 2RN7A 2W57A 2DK8A 5H20A 2FXAA 3DV8A 4HDVA 1FYLA 1FX7A 2ADUA 2K02A 2Q0OA 2P7CB 2G7HA 1ZRCA 2HEOA 1G3WA 2QZ8A 3HHGA 3F6OA 3QP5A 3IC7A 3T8RA 4LK1F 1P4WA 3W6JB 3DPTA 5D6FA 2Z3YA 3HHHA 4CICA 3GVAA 5FO5A 1B4AA 1IN8A 1FP2A 2HFHA 4IPAA 2YU3A 2DQRA 2WTEA 5DD4A 3MWMA 5E8GA 1H9GA 5JHUA 4P55A 1EH6A 1SD6A 2FEZA 3GF2A 2W85A 1ON1A 5DUIA 3F8MA 1FSHA 1YYVA 5ERIA 4GGGA 1RUNA 4ZZDA 1ULYA 4UVAA 1T39A 4RGUA 1K78A 1XMKA 3KE2A 2Z5UA 2J5PA 3O2PE 2V1DA 4YFNF 1KQ9A 4O3MA 2L4AA 5IT9Z 3WTSC 5H6QA 2QQAA 2FU4A 3LQQA 3QP6A 4GXOA 1W5SA 2JPCA 4L5JA 1R36A 1LNWA 5CVRA 1CF7B 3I53A 2ZMEB 2GXGA 3WGIA 2K4JA 4G6QA 4I2OA 1RNLA 1BIBA 4HBLA 3R6SA 1BC7C 2H6BA 1LVAA 4PGGA 1TQPA 1PUEE 1HKQA 5LEJA 3E6BA 4LMYA 3G3ZA 4L9TA 4CO8A 1S7OA 4M72A 2EJRA 5KK1A 1O57A 3TDZC 4RB3C 4HLXA 3J7AO 1LEAA 2NYXA 1K78B 3P9KA 3V7RA 1XCVA 4OIOF 5FLXK 3JSPA 3T8TA 3FF5A 5HS8A 5D8LB 3ZP5A 2DQLA 1GVJA 4HF2A 4OMZA 1W5TA 1J9IA 1D8KA 1FLIA 2ESNA 2ZNZA 1L0OC 3WE3A 4ENNA 4ENKA 2G9WA 1DDNA 2RVCA 1FZPB 1USTA 3BY6A 4KYWA 3ABTA 3BPXA 4M9SA 2IA1A 2HKXA 1IN6A 4A5NA 4XRFA 3P9CA 1J59A 3KZZA 2BBYA 4NB5A 1D5VA 3HTUA 2V1UA 1HQCA 2FSWA 2IJLA 5LRSA 3BWGA 3HRUA 1YW9A 2JZYA 4QWQA 3JTHA 3LWFA 4LFUA 4I98B 4ESFA 2QM3A 1R7JA 2IA0A 2MBFA 3IWZA 5HDNA 1ZG1A 2QBYB 2BV6A 3C1DA 3LAJA 2XAFA 1UHWA 2O61A 1Z6TA 2NNYA 2CQKA 5CVJA 1KU2A 3O3KA 1XGNA 1Z1DA 5J6XA 2PBIA 1GXQA 2K4BA 1O3SA 1S3JA 2L01A 2JPBA 3V8LA 4RB2C 4XLPF 4EV0A 2A6HF 1XSVA 1ON2A 2XIGA 4RGRA 2ESHA 1JHFA 3HOTA 1NHAA 4D0PA 1MD0A 4AD9A 1R1UA 2VONA 1TNTA 4RB1A 2Z33A 2K86A 1LDDA 4WXHA 2HTJA 1B9NA 2VN2A 2L3DA 3WTXC 2Y0MA 2UXNA 2LNBA 1MKMA 1U2WA 2FMYA 3IRRA 4Z2YA 4YIIA 3EYIA 4R79A 3FMRA 1LDKB 3K0LA 1R5HA 3MAJA 4LGWA 3EDPA 5E1ZB 2P7VB 2VBWA 1AOYA 4B09A 1CGPA 5J8FA 4EMSA 3WTYC 1LJ9A 4XBFA 2L02A 4Q47A 4MTDA 4LLGF 4IJAA 3DEUA 3TO6A 2DTRA 1A04A 1BC8C 2VE9A 3JTGA 4G6DA 4HLYA 1R1VA 5HVQC 3IRQA 2EWNA 4AIJA 2LF7A 4MGRA 5E17F 1T0FA 2M8EA 2H09A 1K7AA 3R61A 2E1CA 4EGZA 2A5YB 3KETA 3FHZA 1X3UA 2RNJA 2RV8A 3JAMK 2VXZA 2EV5A 1KU3A 5LGTA 1OYIA 3CLOA 4BHCA 2JTVA 2CYYA 1SD5A 5D5UB 2W84A 1P4XA 4L9VA 4I0AA 5DV5A 2UXXA 3Q9VA 2A07F 3F8CA 4KN4X 4A6EA 2QYOA 2IP2A 3QOPA 3CUOA 4QLCU 3NRVA 4WF2A 1ZHFA 2OQGA 3WTVC 3W6KB 4BXUA 1F9NA 1XSDA 3J81K 2YX4A 4BAYA 1ZN2A 3KLNA 4G7HF 1V3FA 2HZTA 4A5MA 2GA2A 4EJTA 5A2QZ 4PZJA 3J80Z 2X0LA 1HW5A 5LGUA 2A61A 1YG2A 3S2WA 1BIAA 2AXLA 1J0RA 2ZBKA 3TKYA 3HTSB 3I5UA 1FT9A 5D5XB 1E2XA 2EA4A 1STZA 5F6FA 4MEXF 4KMUX 1TW2A 5FFXA 4N9IA 1ZGJA 1E17A 2RKHA 1YW7A 3F8FA 3L09A 3ULQB 2XAHA 2D45A 4OIPF 5ILSA 3U2RA 3RTRA 1TTYA 4L0YB 4EGYA 5D4RA 1ZRDA 2XAQA 3EYYA 3SZPA 4PDKA 3G73A 5CYVA 5D8KB 2ZNYA 3K1NA 3E6MA 3V8JA 3MFKA 1QZZA 5LHHA 5LLQA 2P8TA 3HRMA 2ISZA 1XGSA 3HSEA 2XKPA 1KU7A 3GZ5A 4IRIA 3ZN0A 4LG0A 1WRJA 2XVCA 4AVPA 2FQ3A 2XKOA 4CHUA 4FHTA 4M9ZA 4MQVA 2ETHA 3N97A 3TO7A 1UCRA 3GUDA 1MDMA 2EFQA 4E70A 1IXCA 4CXFA 4KN7X 3RPQA 3V8KA 2PI0A 3VFZA 2MLGA 3GFLA 3Q5FA 5L3CA 3PQKA 2B0LA 3WU1B 2CG4A 3I64A 2OZ6A 3ABUA 3WU0A 2GQQA 3FMQA 1FY7A 2MD5A 5BQTA 3KP4A 3E6DA 3KZYA 4HX8A 4O5VA 4UV8A 2D1HA 3VODA 2FNPA 3F3XA 3V7CA 3AAFA 1CF7A 2E7XA 3I59B 2ZMEA 3JW4A 4LG0B 3B73A 5J8CA 1QQIA 4LLNA 4HQEA 3REOA 4EVIA 1U78A 4O6JA 3QPTA 2OAZA 4UHTA 2Q8KA 2E7WA 3OV8A 3KCCA 5TRDA 1QNTA 2FA5A 1G3TA 1DP7P 4IHSA 1V4RA 2NNNA 1QPMA 1MDMB 1K6OA 4PGHA 2XAJA 1HXDA 3LAPA 1LB2A 2FNAA 4OOIA 1XB4A 2OBPA 2DPDA 1W4MA 1DPUA 2E1NA 1UFMA 2ZJ2A 3BROA 4JQFA 2M45A 4RB0A 1TQIA 1OYWA 2DT5A 4I0BA 1FPQA 2FF4A 4Y15A 1MJ9A 5D5VB 1ZGAA 2H27A 3GFJA 4OMYA 3F72A 1BBYA 3MCZA 1FBQA 2IPQX 5E1XA 5JI6A 4HF1A 2L54A 2HKOA 2VE8A 3QPHA 3SXYA 2P6SA 1U6GA 3ECOA 2A3SA 3I54A 1TQMA 1I6XA 4L0ZB 1O7LA 3E3VA 1PP8F 5L3BA 2BYVE 2P5LC 4UUVA 3IHUA 5K1YA 4G94A 2QWWA 3ROUA 1KQ0A 2TDXA 3BJAA 1SD7A 4HF0A 4ZYHA 5CVVA 4UVBA 3M8EA 3ZMSA 1T6SA 1QGPA 1FP1D 3OOPA 5K5QA 2DU9A 2HOEA 1W7PD 3BPVA 1JGSA 2EV0A 3ZQ7A 3GFMA 1YFHA 2AS5F 3F22A 3ZMZA 1BI0A 1DPRA 3RIRA 1XGMA 1ZLKA 4ZZLA 3HRTA 3I58A 4KIGA 2W25A 1YS7A 2QBYA 2ZXJA 5E1WA 4G7ZF 1O3TA 3IKTA 4L18B 2G7UA 1PP7U 2CWEA 3DQVC 3VEPA 4RS8A 5DDGA 3CJNA 4OU0A 4EM0B 4LD5A 5HLIA 1K79A 2QENA 1BN5A 5L3DA 3KEOA 4WCGA 4N0BA 2QVOA 4ENJA 4Y13A 1T2KA 3L9FA 2XUBA 2STWA 2YR2A 5DCMA 2DFIA 1C0WA 2EA2A 2F5EA 2F2EA 5HOOA 3U1DA 3ZMTA 1EH7A 2PLYA 3MQ0A 2FE3A 1PDNC 1OYYA 3GZ6A 3KP6A 1IUYA 5HLHA 3I71A 1IXRC 4WX9A 3QU3A 2IVMA 3MZHA 3FWEA 5LBQA 3RYRA 1SD4A 2YX7A 2EK5A 3F8BA 1BI2A 3R60A 1F1ZA 4MNUA 1TNSA 1ZRFA 3L00A 4BHPA 4KMFA 2UZKA 5FB2A 1F4KA 2GIVA 1Z91A 2FBKA 1H9TA 4GYIA 1Y0UA 2XRNA 4PCQA 2DO7A 5DUKA 1LDJA 1ZYRF 4WXCA 1U3EM 5HS7A 2ELHA 2M1BA 4ENMA 3SZTA 3DPLC 4CZZA 5DCMB 4AIHA 4L5IA 2DLLA 1WKMA 5FLXZ 3M7GA 2XROA 5CJ9A 4GCVA 1SAXA 2VODA 1S6LA 3CTAA 3DF8A 1Z9CA 5E18F 1B9MA 4UNOA 3RKWA 4M73A 3BZ6A 1J2XA 3ZMUA 4XLNF 4LLLA 5AIQA 4M9XA 1EH8A 2HDCA 1ZH5A 2KIFA 1XDSA 2OA4A 4A0YA 4JBAA 3I4PA 2V6CA 4IF4A 1TW3A 4NHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T5X A;  3CO6 C;  5HLG A;  2DAO A;  2ZFW A;  3F6V A;  2LSO A;  4U7B A;  3JSO A;  2PN6 A;  5FD5 A;  2CO5 A;  3WGH A;  3EET A;  5JR3 A;  3LQR A;  5LHI A;  3LA3 A;  5ICC A;  4HDU A;  3HIF A;  3RKY A;  3KEQ A;  2OZU A;  3M8F A;  4FT8 A;  3E5Q A;  5JFR A;  3VOE A;  1LEB A;  1QBJ A;  3FM3 A;  4P96 A;  1REP C;  3NQO A;  2OU2 A;  4GO1 A;  3FX3 A;  1TBX A;  1FYM A;  2GXB A;  2QQ9 A;  2VOO A;  4BNC A;  3E5X A;  5BS6 A;  2VOP A;  3HSF A;  3WG9 A;  2RC4 A;  2LF8 A;  3GWZ A;  1UB9 A;  1I1G A;  4LK0 F;  2V1X A;  3SHF A;  4YG2 F;  4MQ9 F;  4ZYE A;  1YIO A;  3FXQ A;  5K5O A;  3FMS A;  3COA C;  1FYK A;  3I0T A;  4CDG A;  4HW0 A;  1I27 A;  2GWR A;  3K69 A;  1RI7 A;  3CDH A;  5D6E A;  4AIK A;  5EEH A;  1TLH B;  5LEK A;  2VBX A;  4L9N A;  2O3F A;  1O7F A;  2X4H A;  1BM9 A;  3WTW C;  3ML6 A;  1Z05 A;  3CO7 C;  3E6C C;  4HA8 A;  2GA1 A;  1FOK A;  4IRH A;  2LKP A;  4KUM A;  5ILV A;  3KFW X;  1EV7 A;  1SMT A;  1S8N A;  5CVI A;  4BYY A;  1DUX C;  3WE2 A;  1G3S A;  3GFI A;  2IA2 A;  2O8X A;  2HQR A;  4I01 A;  4CYD A;  2IW5 A;  2K27 A;  3R0J A;  3F23 A;  5L3G A;  5F64 A;  1HBX G;  3LFK A;  2GAU A;  3HRS A;  2W24 A;  2D2W A;  4OIN F;  3MZY A;  5BMZ A;  2HWV A;  3HOS A;  3N4M A;  2NAZ A;  2P6T A;  1IAW A;  1FNN A;  2WV0 A;  4Q48 A;  1I5Z A;  3U9G A;  2VC1 A;  1R23 A;  3ERE D;  4EJO A;  1MZB A;  1HW2 A;  4MHG A;  4ZH4 F;  4LJZ F;  2IT0 A;  2HYF A;  2XV4 S;  2FML A;  1B59 A;  3FXU A;  3LA2 A;  1ZAO A;  3TOB A;  2QQB A;  1JHH A;  1YW8 A;  3GO5 A;  1SFE A;  1OR7 A;  5ED4 A;  3ECH A;  4K2E A;  2WWY A;  1B6A A;  1AWC A;  1SFX A;  1FBS A;  3I59 A;  3RPU A;  2A68 F;  2UWM A;  3CUQ A;  5DD8 A;  3T1B A;  1RUO A;  3ELK A;  5IT9 K;  1JXS A;  5KVR A;  1YTY A;  1FBU A;  4S05 A;  2J5O A;  1ZRE A;  1YO5 C;  3JAM Z;  3HUG A;  2DBB A;  3KP2 A;  1T98 A;  5FD6 A;  1ZAR A;  4P9U A;  3DP7 A;  3TQN A;  1P4A A;  2F5F A;  2HYG D;  4M6Y A;  3PQJ A;  1J75 A;  3H92 A;  4ZYG A;  2OQR A;  4FX4 A;  2ACJ A;  4EM2 A;  4L9J A;  4G8X A;  4M74 A;  2HR3 A;  5BOX A;  5H6R A;  4HV5 A;  4I09 A;  2CFX A;  1UHM A;  3F8N A;  1IXS B;  4UVC A;  2A69 F;  5HDG A;  4Q5S F;  1KQ8 A;  4MEY F;  4G9Y A;  3J81 Z;  3C7J A;  2KKO A;  4ZYD A;  4I02 A;  1SMY F;  4G7O F;  2O03 A;  2ZO4 A;  4UXN A;  1GHC A;  3M9A A;  1VTN C;  1IW7 F;  2Y75 A;  1J5Y A;  5DEQ A;  3SFZ A;  2O0Y A;  3CUQ B;  2PJP A;  1IRG A;  1USS A;  4A0X A;  3PFI A;  1WWX A;  4R8H A;  2PFB A;  2Q2E A;  1IN5 A;  4KIB A;  3WTT C;  3RI4 A;  5F1R A;  5K5R A;  3EQL F;  2ZKZ A;  1FWZ A;  4GYG A;  4EM1 A;  4WWC A;  4H0E A;  1KYW A;  1RZ4 A;  3KP7 A;  2M30 A;  5CVU A;  1FC3 A;  3K9T A;  3ZPL A;  3WGG A;  4IRG A;  1WSU A;  2NS0 A;  4HYE A;  1YS6 A;  2PG4 A;  2M87 A;  2R3S A;  3V7S A;  4B8X A;  5BPI A;  2F5C A;  3L2C A;  5ICF A;  1IN4 A;  3L7W A;  4P9F A;  1G3Y A;  2FOK A;  3DKW A;  4U7D A;  2YSR A;  4LB5 A;  3EUH A;  3IKV A;  5DYM A;  3KP5 A;  2OD5 A;  5DCF A;  3D0S A;  4HAM A;  2MH9 A;  1QZY A;  3Q9S A;  5LGN A;  4IVN A;  1KGS A;  2F5D A;  2ISY A;  1WQ2 A;  1L3L A;  2L4M A;  3ZN1 A;  5ILU A;  4HZF A;  5L3E A;  1W7P A;  2JSC A;  2H6C A;  2LDU A;  5D5W B;  5D4S A;  5TJJ A;  2EV6 A;  2YPR A;  2CW0 F;  2Z99 A;  5L3F A;  3FXR A;  1WI9 A;  3WOD F;  2BE5 F;  1T38 A;  4U0W A;  2V9V A;  3WTZ A;  4KDP A;  1HW1 A;  4FX0 A;  4XSX F;  4ESJ A;  2XAG A;  4IHT A;  1FSE A;  2VBY A;  3D5L A;  3GYH X;  5ICG A;  4ON0 A;  4YFX F;  3ZMD A;  1U5T A;  4N9H A;  3DFG A;  2EFW A;  3SQN A;  4Y17 A;  4U0Y A;  4RGS A;  1G6N A;  1YLF A;  1HST A;  2HGC A;  3E5U A;  1P92 A;  2WC2 A;  4HX7 A;  4WK8 F;  4BQA A;  4F7Z A;  4OIQ F;  4Q4Z F;  2ZCW A;  4U88 A;  2D1V A;  1W7P B;  5BPD A;  2IRF G;  1MGT A;  2BGC A;  4P5O A;  3TGN A;  3RKX A;  1D8J A;  2BEO A;  3TOA A;  3P9I A;  4KNY A;  2MH2 A;  2MLK A;  2HQN A;  1J7K A;  1KA8 A;  2C6Y A;  2VC0 A;  4HOB A;  5FFZ A;  1O3R A;  3V4G A;  5FGM A;  3BOQ A;  1R22 A;  4BHB A;  4WXD A;  2PEX A;  3B02 A;  5AON A;  3C18 A;  1U5T B;  4KIF A;  2FBI A;  4KIC A;  2EFO A;  3FZV A;  1YQA A;  4BH9 A;  4LB6 B;  2PMU A;  2O6G E;  1HKS A;  1I1S A;  5E8I A;  1OPC A;  2MC3 A;  3MEX A;  3CUQ C;  4JK1 X;  3P7N A;  3T0Y A;  2V79 A;  2EFP A;  2COM A;  5LRR A;  4YFK F;  4A12 A;  1ZG5 A;  1MJA A;  1O3Q A;  4A2U A;  1D3Y A;  3GX4 X;  2Z9O A;  3QAH A;  4YIF A;  3GEZ A;  1BOA A;  4A6D A;  1Z7U A;  4CGZ A;  4I7H A;  2QLZ A;  4AWX B;  1RIO H;  5HS9 A;  3GXO A;  3KLO A;  1Z6R A;  5A2Q K;  1F5T A;  3J80 K;  4M71 A;  4HQM A;  3RJP A;  3O6B B;  4ESB A;  4A0Z A;  3LA7 A;  4EJU A;  3ZMV A;  4IXA A;  4KA4 A;  2FRH A;  1IN7 A;  1R5G A;  1BI3 A;  2XAS A;  4S04 A;  1HSJ A;  2RDP A;  4EJV A;  2DI3 A;  2KIM A;  3FM5 A;  1R58 A;  1B1B A;  3K1M A;  1P2F A;  4EJW A;  1OKR A;  1XSX A;  3IL2 A;  1XGO A;  3RYP A;  2DPU A;  4ASN A;  4R1H A;  1S7A A;  2H94 A;  2PMH A;  4DNC A;  2KIU A;  5IT3 A;  1MJB A;  5HDK A;  2GZW A;  3VB2 A;  2KRF A;  5EEG A;  1XCB A;  2HS5 A;  3BJO A;  1XN7 A;  1P6R A;  1KU9 A;  4HV6 A;  3F21 A;  4KFC A;  2MA3 A;  1ODD A;  4RGX A;  3RDI A;  4XSZ F;  6PAX A;  4U0V A;  3KP3 A;  4RAY A;  5AIP A;  3HYI A;  2EFN A;  5JVT A;  1XDU A;  3GW2 A;  2M5W A;  4NQW A;  4M6X A;  3IWF A;  2PQ8 A;  1LQ1 A;  1S29 A;  3TDU C;  2P4W A;  2QUF A;  2EB7 A;  2FBH A;  4KT5 C;  4HX4 A;  4UV9 A;  1QO0 D;  2NRA C;  3LST A;  1R00 A;  3R4K A;  2JT1 A;  5LHG A;  4DQ2 A;  4EQQ A;  2CSO A;  4ETS A;  1OMI A;  2DK5 A;  5ICE A;  1IF1 A;  1R1T A;  1H0M A;  2XGX A;  3NEU A;  2XHK A;  1GXP A;  1U8R A;  2R7F A;  1Q1H A;  5CLS A;  1JE8 A;  2VBZ A;  3H3U A;  3GLX A;  3BP8 A;  2KJC A;  1KYZ A;  2RQP A;  2A6E F;  1U5T C;  3QU6 A;  2Y48 A;  2P5V A;  1HKT A;  2HTS A;  3DXJ F;  1XMA A;  3BDD A;  1G4D A;  3M1E A;  2DW4 A;  2RGV A;  1XD7 A;  3R0A A;  3HSR A;  3C3W A;  1SFU A;  3TO9 A;  4MTE A;  2VT3 A;  2VT2 A;  3K2Z A;  3BJ6 A;  2K7L A;  1ZLJ A;  1IZ1 A;  3QRF F;  2CGP A;  4RAZ A;  2STT A;  4TV7 A;  4OIR F;  5E20 A;  2KJB A;  3K1P A;  2P5K A;  3ISP A;  1ZG3 A;  3E97 A;  1ONV A;  2JRT A;  1BJA A;  1IRF A;  3WTU C;  3H3Z A;  2R7D A;  1BI1 A;  2RN7 A;  2W57 A;  2DK8 A;  5H20 A;  2FXA A;  3DV8 A;  4HDV A;  1FYL A;  1FX7 A;  2ADU A;  2K02 A;  2Q0O A;  2P7C B;  2G7H A;  1ZRC A;  2HEO A;  1G3W A;  2QZ8 A;  3HHG A;  3F6O A;  3QP5 A;  3IC7 A;  3T8R A;  4LK1 F;  1P4W A;  3W6J B;  3DPT A;  5D6F A;  2Z3Y A;  3HHH A;  4CIC A;  3GVA A;  5FO5 A;  1B4A A;  1IN8 A;  1FP2 A;  2HFH A;  4IPA A;  2YU3 A;  2DQR A;  2WTE A;  5DD4 A;  3MWM A;  5E8G A;  1H9G A;  5JHU A;  4P55 A;  1EH6 A;  1SD6 A;  2FEZ A;  3GF2 A;  2W85 A;  1ON1 A;  5DUI A;  3F8M A;  1FSH A;  1YYV A;  5ERI A;  4GGG A;  1RUN A;  4ZZD A;  1ULY A;  4UVA A;  1T39 A;  4RGU A;  1K78 A;  1XMK A;  3KE2 A;  2Z5U A;  2J5P A;  3O2P E;  2V1D A;  4YFN F;  1KQ9 A;  4O3M A;  2L4A A;  5IT9 Z;  3WTS C;  5H6Q A;  2QQA A;  2FU4 A;  3LQQ A;  3QP6 A;  4GXO A;  1W5S A;  2JPC A;  4L5J A;  1R36 A;  1LNW A;  5CVR A;  1CF7 B;  3I53 A;  2ZME B;  2GXG A;  3WGI A;  2K4J A;  4G6Q A;  4I2O A;  1RNL A;  1BIB A;  4HBL A;  3R6S A;  1BC7 C;  2H6B A;  1LVA A;  4PGG A;  1TQP A;  1PUE E;  1HKQ A;  5LEJ A;  3E6B A;  4LMY A;  3G3Z A;  4L9T A;  4CO8 A;  1S7O A;  4M72 A;  2EJR A;  5KK1 A;  1O57 A;  3TDZ C;  4RB3 C;  4HLX A;  3J7A O;  1LEA A;  2NYX A;  1K78 B;  3P9K A;  3V7R A;  1XCV A;  4OIO F;  5FLX K;  3JSP A;  3T8T A;  3FF5 A;  5HS8 A;  5D8L B;  3ZP5 A;  2DQL A;  1GVJ A;  4HF2 A;  4OMZ A;  1W5T A;  1J9I A;  1D8K A;  1FLI A;  2ESN A;  2ZNZ A;  1L0O C;  3WE3 A;  4ENN A;  4ENK A;  2G9W A;  1DDN A;  2RVC A;  1FZP B;  1UST A;  3BY6 A;  4KYW A;  3ABT A;  3BPX A;  4M9S A;  2IA1 A;  2HKX A;  1IN6 A;  4A5N A;  4XRF A;  3P9C A;  1J59 A;  3KZZ A;  2BBY A;  4NB5 A;  1D5V A;  3HTU A;  2V1U A;  1HQC A;  2FSW A;  2IJL A;  5LRS A;  3BWG A;  3HRU A;  1YW9 A;  2JZY A;  4QWQ A;  3JTH A;  3LWF A;  4LFU A;  4I98 B;  4ESF A;  2QM3 A;  1R7J A;  2IA0 A;  2MBF A;  3IWZ A;  5HDN A;  1ZG1 A;  2QBY B;  2BV6 A;  3C1D A;  3LAJ A;  2XAF A;  1UHW A;  2O61 A;  1Z6T A;  2NNY A;  2CQK A;  5CVJ A;  1KU2 A;  3O3K A;  1XGN A;  1Z1D A;  5J6X A;  2PBI A;  1GXQ A;  2K4B A;  1O3S A;  1S3J A;  2L01 A;  2JPB A;  3V8L A;  4RB2 C;  4XLP F;  4EV0 A;  2A6H F;  1XSV A;  1ON2 A;  2XIG A;  4RGR A;  2ESH A;  1JHF A;  3HOT A;  1NHA A;  4D0P A;  1MD0 A;  4AD9 A;  1R1U A;  2VON A;  1TNT A;  4RB1 A;  2Z33 A;  2K86 A;  1LDD A;  4WXH A;  2HTJ A;  1B9N A;  2VN2 A;  2L3D A;  3WTX C;  2Y0M A;  2UXN A;  2LNB A;  1MKM A;  1U2W A;  2FMY A;  3IRR A;  4Z2Y A;  4YII A;  3EYI A;  4R79 A;  3FMR A;  1LDK B;  3K0L A;  1R5H A;  3MAJ A;  4LGW A;  3EDP A;  5E1Z B;  2P7V B;  2VBW A;  1AOY A;  4B09 A;  1CGP A;  5J8F A;  4EMS A;  3WTY C;  1LJ9 A;  4XBF A;  2L02 A;  4Q47 A;  4MTD A;  4LLG F;  4IJA A;  3DEU A;  3TO6 A;  2DTR A;  1A04 A;  1BC8 C;  2VE9 A;  3JTG A;  4G6D A;  4HLY A;  1R1V A;  5HVQ C;  3IRQ A;  2EWN A;  4AIJ A;  2LF7 A;  4MGR A;  5E17 F;  1T0F A;  2M8E A;  2H09 A;  1K7A A;  3R61 A;  2E1C A;  4EGZ A;  2A5Y B;  3KET A;  3FHZ A;  1X3U A;  2RNJ A;  2RV8 A;  3JAM K;  2VXZ A;  2EV5 A;  1KU3 A;  5LGT A;  1OYI A;  3CLO A;  4BHC A;  2JTV A;  2CYY A;  1SD5 A;  5D5U B;  2W84 A;  1P4X A;  4L9V A;  4I0A A;  5DV5 A;  2UXX A;  3Q9V A;  2A07 F;  3F8C A;  4KN4 X;  4A6E A;  2QYO A;  2IP2 A;  3QOP A;  3CUO A;  4QLC U;  3NRV A;  4WF2 A;  1ZHF A;  2OQG A;  3WTV C;  3W6K B;  4BXU A;  1F9N A;  1XSD A;  3J81 K;  2YX4 A;  4BAY A;  1ZN2 A;  3KLN A;  4G7H F;  1V3F A;  2HZT A;  4A5M A;  2GA2 A;  4EJT A;  5A2Q Z;  4PZJ A;  3J80 Z;  2X0L A;  1HW5 A;  5LGU A;  2A61 A;  1YG2 A;  3S2W A;  1BIA A;  2AXL A;  1J0R A;  2ZBK A;  3TKY A;  3HTS B;  3I5U A;  1FT9 A;  5D5X B;  1E2X A;  2EA4 A;  1STZ A;  5F6F A;  4MEX F;  4KMU X;  1TW2 A;  5FFX A;  4N9I A;  1ZGJ A;  1E17 A;  2RKH A;  1YW7 A;  3F8F A;  3L09 A;  3ULQ B;  2XAH A;  2D45 A;  4OIP F;  5ILS A;  3U2R A;  3RTR A;  1TTY A;  4L0Y B;  4EGY A;  5D4R A;  1ZRD A;  2XAQ A;  3EYY A;  3SZP A;  4PDK A;  3G73 A;  5CYV A;  5D8K B;  2ZNY A;  3K1N A;  3E6M A;  3V8J A;  3MFK A;  1QZZ A;  5LHH A;  5LLQ A;  2P8T A;  3HRM A;  2ISZ A;  1XGS A;  3HSE A;  2XKP A;  1KU7 A;  3GZ5 A;  4IRI A;  3ZN0 A;  4LG0 A;  1WRJ A;  2XVC A;  4AVP A;  2FQ3 A;  2XKO A;  4CHU A;  4FHT A;  4M9Z A;  4MQV A;  2ETH A;  3N97 A;  3TO7 A;  1UCR A;  3GUD A;  1MDM A;  2EFQ A;  4E70 A;  1IXC A;  4CXF A;  4KN7 X;  3RPQ A;  3V8K A;  2PI0 A;  3VFZ A;  2MLG A;  3GFL A;  3Q5F A;  5L3C A;  3PQK A;  2B0L A;  3WU1 B;  2CG4 A;  3I64 A;  2OZ6 A;  3ABU A;  3WU0 A;  2GQQ A;  3FMQ A;  1FY7 A;  2MD5 A;  5BQT A;  3KP4 A;  3E6D A;  3KZY A;  4HX8 A;  4O5V A;  4UV8 A;  2D1H A;  3VOD A;  2FNP A;  3F3X A;  3V7C A;  3AAF A;  1CF7 A;  2E7X A;  3I59 B;  2ZME A;  3JW4 A;  4LG0 B;  3B73 A;  5J8C A;  1QQI A;  4LLN A;  4HQE A;  3REO A;  4EVI A;  1U78 A;  4O6J A;  3QPT A;  2OAZ A;  4UHT A;  2Q8K A;  2E7W A;  3OV8 A;  3KCC A;  5TRD A;  1QNT A;  2FA5 A;  1G3T A;  1DP7 P;  4IHS A;  1V4R A;  2NNN A;  1QPM A;  1MDM B;  1K6O A;  4PGH A;  2XAJ A;  1HXD A;  3LAP A;  1LB2 A;  2FNA A;  4OOI A;  1XB4 A;  2OBP A;  2DPD A;  1W4M A;  1DPU A;  2E1N A;  1UFM A;  2ZJ2 A;  3BRO A;  4JQF A;  2M45 A;  4RB0 A;  1TQI A;  1OYW A;  2DT5 A;  4I0B A;  1FPQ A;  2FF4 A;  4Y15 A;  1MJ9 A;  5D5V B;  1ZGA A;  2H27 A;  3GFJ A;  4OMY A;  3F72 A;  1BBY A;  3MCZ A;  1FBQ A;  2IPQ X;  5E1X A;  5JI6 A;  4HF1 A;  2L54 A;  2HKO A;  2VE8 A;  3QPH A;  3SXY A;  2P6S A;  1U6G A;  3ECO A;  2A3S A;  3I54 A;  1TQM A;  1I6X A;  4L0Z B;  1O7L A;  3E3V A;  1PP8 F;  5L3B A;  2BYV E;  2P5L C;  4UUV A;  3IHU A;  5K1Y A;  4G94 A;  2QWW A;  3ROU A;  1KQ0 A;  2TDX A;  3BJA A;  1SD7 A;  4HF0 A;  4ZYH A;  5CVV A;  4UVB A;  3M8E A;  3ZMS A;  1T6S A;  1QGP A;  1FP1 D;  3OOP A;  5K5Q A;  2DU9 A;  2HOE A;  1W7P D;  3BPV A;  1JGS A;  2EV0 A;  3ZQ7 A;  3GFM A;  1YFH A;  2AS5 F;  3F22 A;  3ZMZ A;  1BI0 A;  1DPR A;  3RIR A;  1XGM A;  1ZLK A;  4ZZL A;  3HRT A;  3I58 A;  4KIG A;  2W25 A;  1YS7 A;  2QBY A;  2ZXJ A;  5E1W A;  4G7Z F;  1O3T A;  3IKT A;  4L18 B;  2G7U A;  1PP7 U;  2CWE A;  3DQV C;  3VEP A;  4RS8 A;  5DDG A;  3CJN A;  4OU0 A;  4EM0 B;  4LD5 A;  5HLI A;  1K79 A;  2QEN A;  1BN5 A;  5L3D A;  3KEO A;  4WCG A;  4N0B A;  2QVO A;  4ENJ A;  4Y13 A;  1T2K A;  3L9F A;  2XUB A;  2STW A;  2YR2 A;  5DCM A;  2DFI A;  1C0W A;  2EA2 A;  2F5E A;  2F2E A;  5HOO A;  3U1D A;  3ZMT A;  1EH7 A;  2PLY A;  3MQ0 A;  2FE3 A;  1PDN C;  1OYY A;  3GZ6 A;  3KP6 A;  1IUY A;  5HLH A;  3I71 A;  1IXR C;  4WX9 A;  3QU3 A;  2IVM A;  3MZH A;  3FWE A;  5LBQ A;  3RYR A;  1SD4 A;  2YX7 A;  2EK5 A;  3F8B A;  1BI2 A;  3R60 A;  1F1Z A;  4MNU A;  1TNS A;  1ZRF A;  3L00 A;  4BHP A;  4KMF A;  2UZK A;  5FB2 A;  1F4K A;  2GIV A;  1Z91 A;  2FBK A;  1H9T A;  4GYI A;  1Y0U A;  2XRN A;  4PCQ A;  2DO7 A;  5DUK A;  1LDJ A;  1ZYR F;  4WXC A;  1U3E M;  5HS7 A;  2ELH A;  2M1B A;  4ENM A;  3SZT A;  3DPL C;  4CZZ A;  5DCM B;  4AIH A;  4L5I A;  2DLL A;  1WKM A;  5FLX Z;  3M7G A;  2XRO A;  5CJ9 A;  4GCV A;  1SAX A;  2VOD A;  1S6L A;  3CTA A;  3DF8 A;  1Z9C A;  5E18 F;  1B9M A;  4UNO A;  3RKW A;  4M73 A;  3BZ6 A;  1J2X A;  3ZMU A;  4XLN F;  4LLL A;  5AIQ A;  4M9X A;  1EH8 A;  2HDC A;  1ZH5 A;  2KIF A;  1XDS A;  2OA4 A;  4A0Y A;  4JBA A;  3I4P A;  2V6C A;  4IF4 A;  1TW3 A;  4NHJ A; 
#chains in the Genus database with same CATH topology
 2K5C A;  3T5X A;  2XB0 X;  3MKW B;  1MSE C;  2NS7 A;  1ETY A;  3CO6 C;  3QOD A;  1Z3Y A;  2KFD A;  2CMP A;  1VI0 A;  5HLG A;  1K83 J;  2DAO A;  2ZFW A;  3F6V A;  2LSO A;  4U7B A;  1GVD A;  4BDZ A;  3JSO A;  3WHB A;  2KZV A;  4BDY A;  3HOY J;  1VQP I;  2PN6 A;  3ABM H;  5FD5 A;  2CO5 A;  3WGH A;  3EET A;  2FQ4 A;  2ZME C;  4UB8 C;  3LQR A;  5JR3 A;  3LA3 A;  2E60 A;  5ICC A;  2E1O A;  4U87 A;  5LHI A;  5EDN A;  3KZI C;  4HDU A;  3ZQL A;  2ZJQ F;  1X1D A;  3GTO J;  3HIF A;  2PX9 A;  3RKY A;  2LC2 A;  3KEQ A;  3BLY A;  2OZU A;  4IO9 F;  3M8F A;  3CZ6 A;  4FT8 A;  5K7H A;  3E5Q A;  3ERM A;  2QQ8 A;  1OJL A;  3BTL A;  2YS9 A;  2E2H J;  1PVE A;  2XF6 A;  5JFR A;  3JRD A;  2XF5 A;  3VOE A;  1LEB A;  1QBJ A;  3IAM 2;  2CQQ A;  1HC8 A;  1OCT C;  3RZO J;  3DU5 A;  3FM3 A;  4P96 A;  1Z67 A;  1S9H A;  1REP C;  3NQO A;  2OU2 A;  4GO1 A;  3FX3 A;  5E3M A;  3E0J B;  1HLV A;  5GPA A;  1TBX A;  1FYM A;  2GXB A;  2QQ9 A;  2VOO A;  4BNC A;  3E5X A;  5BS6 A;  3SFI A;  4C2U A;  3GBG A;  2EQR A;  2VOP A;  1RKW A;  3A1Y A;  3HSF A;  2XGE A;  2ELK A;  2K9Q A;  3WG9 A;  2RC4 A;  2LF8 A;  3GWZ A;  1UB9 A;  1I1G A;  4LK0 F;  5E3O A;  2R7Z J;  3A2K A;  1K4T A;  2HDW A;  4B44 A;  2V1X A;  3CP2 A;  2LFB A;  3SHF A;  3P5J A;  1VFC A;  4YG2 F;  4MQ9 F;  4ZYE A;  1YIO A;  3FXQ A;  3FIW A;  2JN6 A;  1GT0 C;  4PJJ A;  1YE9 A;  5K5O A;  2JK3 A;  1F36 A;  3FMS A;  3COA C;  1FYK A;  3CJQ B;  2BXZ A;  3Q0V A;  3I0T A;  4CDG A;  4HW0 A;  2CH0 A;  3D5R C;  1I27 A;  1W1W E;  2GWR A;  3K69 A;  3JRG A;  1RI7 A;  3CDH A;  5D6E A;  1WJA A;  2IS6 A;  4AIK A;  5EEH A;  2VIX A;  1ETQ A;  2EZI A;  2MAB A;  5JVG F;  1N77 A;  2BOL A;  2W7N A;  1EKE A;  1TLH B;  5LEK A;  2E5Z A;  4QIW N;  3J7Z I;  3ASN H;  2VBX A;  2FX0 A;  4L9N A;  4CUG A;  1Y39 A;  1D1A A;  2O3F A;  3S93 A;  2CU7 A;  1O7F A;  2X4H A;  1BM9 A;  3ESW B;  3WTW C;  3ML6 A;  1Z05 A;  3CO7 C;  3E6C C;  4HA8 A;  2GA1 A;  5DTD A;  3FXK A;  4IRH A;  2LKP A;  4KUM A;  5ILV A;  3KFW X;  3PSF A;  1SVL A;  1S72 I;  1FOK A;  1EV7 A;  4FAS D;  4A3J J;  3QQA A;  2HYJ A;  3FBN B;  2BY3 A;  1SMT A;  1S8N A;  2E1M C;  5IP6 A;  5CVI A;  3GTK J;  1ENH A;  4UUT A;  3D1N I;  5J4Y A;  4BYY A;  4LG3 A;  1DUX C;  3WE2 A;  2DOA A;  1IRZ A;  2X51 A;  1G3S A;  3GFI A;  3U1K A;  2IA2 A;  2HDD A;  2O8X A;  2HQR A;  4I01 A;  4CYD A;  1Z77 A;  2IW5 A;  2K27 A;  3R0J A;  4XNF A;  3F23 A;  5L3G A;  5F64 A;  1HBX G;  3LFK A;  2GAU A;  2COB A;  3HRS A;  2FUG 2;  3GTP J;  2W24 A;  2CUZ A;  2D2W A;  4OIN F;  3MZY A;  5BMZ A;  2V4J C;  2HWV A;  3HOS A;  4XN3 A;  1O4X A;  3N4M A;  2NAZ A;  2CW8 A;  2P6T A;  2VXD A;  2VJ5 A;  1IAW A;  1FNN A;  2WV0 A;  2IGO A;  2X6Y A;  2HOT A;  4Q48 A;  9ANT A;  1I5Z A;  3U9G A;  2P81 A;  2DA1 A;  2VC1 A;  1R23 A;  3ERE D;  4EJO A;  1MZB A;  3K2A A;  1HW2 A;  2CUJ A;  4MHG A;  4ZH4 F;  4Y3O A;  4LJZ F;  2IT0 A;  4BJT A;  2HYF A;  2XV4 S;  4XOT A;  1XX5 A;  2FML A;  3BCA A;  3GME A;  1B59 A;  3FXU A;  3LA2 A;  1ZAO A;  3DKX A;  3TOB A;  2QQB A;  2N8G A;  1JHH A;  1YW8 A;  3GO5 A;  2DT6 A;  2VAS A;  3KEY A;  1SFE A;  1V5G A;  1Y6I A;  3K7A J;  2DMP A;  1OR7 A;  2HI3 A;  3ECH A;  5ED4 A;  2QKL B;  4A3D J;  4K2E A;  2M3A A;  4E6K G;  2WWY A;  1JT0 A;  1B6A A;  1AWC A;  3HZJ A;  1ETK A;  1SFX A;  3BC8 A;  2PMZ N;  1FBS A;  3I59 A;  1RET A;  2JUG A;  2A68 F;  3RPU A;  1N25 A;  2UWM A;  3CUQ A;  3K4N A;  3CF2 A;  5DD8 A;  2DOF A;  3ELK A;  3T1B A;  1RUO A;  2A6T A;  5KVR A;  2OUM A;  1YTY A;  5IT9 K;  2A05 A;  1JXS A;  4ANJ A;  1FBU A;  4S05 A;  1YIJ I;  3PSI A;  4CSW A;  2J5O A;  3G4S I;  2BHY A;  3CMY A;  1ZRE A;  2CQX A;  5B3S H;  2ZJR F;  3HOZ J;  1YO5 C;  1MMD A;  1DU0 A;  3JAM Z;  4IHV A;  3HUG A;  2DBB A;  3KP2 A;  2WY7 Q;  4MLO A;  3PM1 A;  1T98 A;  5FD6 A;  2F4I A;  1ZAR A;  4P9U A;  2ELJ A;  3DP7 A;  3TQN A;  1P4A A;  2F5F A;  2HYG D;  4D9J A;  4M6Y A;  3PQJ A;  1J75 A;  3HPG A;  2Z2S B;  3H92 A;  4ZYG A;  2OQR A;  2ZB9 A;  1XS9 A;  4FX4 A;  2ACJ A;  4EM2 A;  4L9J A;  3H5A A;  4G8X A;  4M74 A;  2HR3 A;  3CC2 I;  3NAU A;  5BOX A;  2R5Z B;  5H6R A;  4HV5 A;  3OYN A;  4RLF A;  4I09 A;  3Q0W A;  2CFX A;  2DA2 A;  3OYA A;  1UHM A;  3F8N A;  1IXS B;  4RDU A;  4UVC A;  5KCM A;  4XR6 A;  1VQO I;  2A69 F;  1AHD P;  1CQT A;  2Z16 A;  5HDG A;  4IOA F;  4Q5S F;  1KQ8 A;  4MEY F;  4G9Y A;  3OYH A;  3J81 Z;  2WAF A;  3H0D A;  3C7J A;  2LP0 A;  4HPQ A;  2KKO A;  3HG9 A;  1DP3 A;  2HVQ A;  4ZYD A;  2OF7 A;  4I02 A;  1A6Q A;  1SMY F;  5FKN A;  4G7O F;  2O03 A;  1D1C A;  2ZO4 A;  3GTL J;  4UXN A;  5J4V A;  1GHC A;  3M9A A;  3CMA I;  2Q1Z B;  1VTN C;  2IBD A;  1IW7 F;  2Y75 A;  1J5Y A;  5DEQ A;  2LKX A;  4II3 A;  3SFZ A;  2O0Y A;  1BA5 A;  3CUQ B;  2PJP A;  1UJ8 A;  1X3W B;  3TW6 A;  1G2H A;  1H88 C;  3A0B C;  1IRG A;  1USS A;  4B3X A;  1IV6 A;  4A0X A;  3PFI A;  2W4S A;  2XGD A;  4CCN A;  2IEK A;  1X4P A;  1WWX A;  4R8H A;  2PFB A;  5E3L A;  2Q2E A;  1IN5 A;  4I99 C;  4KIB A;  5JHF A;  3WTT C;  1VQ4 I;  3HUG B;  4B47 A;  5CQE A;  1X19 A;  3RI4 A;  5F1R A;  1E3O C;  5K5R A;  3LOC A;  3EQL F;  2ZKZ A;  3DU6 A;  1FWZ A;  4GYG A;  4B4C A;  2I8D A;  4EM1 A;  4F55 A;  4WWC A;  4H0E A;  1A35 A;  1KYW A;  4RBO A;  1RZ4 A;  2JA2 A;  1EF4 A;  2QSF X;  3KP7 A;  2M30 A;  5F1J A;  5CVU A;  4XLF A;  2R7V A;  2DA7 A;  1HDP A;  1FC3 A;  3K9T A;  3ZPL A;  2LK2 A;  3WGG A;  3LMM A;  1JKP C;  2E34 A;  3HC7 A;  4IRG A;  2R92 J;  2M2E A;  1LPQ A;  1WSU A;  2NS0 A;  4PJ0 C;  3ZXS A;  4HYE A;  1GUU A;  4DBQ A;  1YS6 A;  1MBH A;  2PG4 A;  2M87 A;  2R3S A;  3V7S A;  4B8X A;  4BXF A;  5BPI A;  1R71 A;  4KIT B;  3H9J A;  1YJW I;  1AKH A;  3H3V K;  2UV1 A;  2F5C A;  3L2C A;  1H89 C;  3H5N A;  2M9H A;  1T95 A;  5ICF A;  1IN4 A;  3AG1 H;  3L7W A;  4P9F A;  1G3Y A;  3KYL A;  4M3F A;  1DU6 A;  4MO7 A;  2FOK A;  3ZR8 X;  3DKW A;  4HNU A;  4U7D A;  2YSR A;  4D1Q A;  4LB5 A;  3S1Q J;  3DTK A;  4BQO A;  3OS2 A;  3RKQ A;  2NVT J;  3EUH A;  2LMD A;  3H36 A;  3IKV A;  2DA5 A;  5DYM A;  2DOD A;  3KP5 A;  2OD5 A;  5DCF A;  2LLK A;  4XON A;  3D0S A;  4AYB A;  4HAM A;  4M3B A;  2MH9 A;  3A02 A;  4E7H A;  4DOZ A;  1E3P A;  1QZY A;  3HBL A;  3Q9S A;  3H0G J;  5LGN A;  4IVN A;  1KGS A;  2F5D A;  1BOB A;  2ISY A;  2Q2E B;  2LG4 A;  1WQ2 A;  2F6C A;  1L3L A;  2L4M A;  3ZN1 A;  5ILU A;  4HZF A;  5L3E A;  1W7P A;  2JSC A;  2H6C A;  4M6V A;  3Q3S A;  2LDU A;  2DDB A;  5D5W B;  5D4S A;  1RPW A;  3A01 A;  1I6H J;  3C2G A;  5TJJ A;  2EV6 A;  3ZQI A;  5TIS C;  2YPR A;  1JKQ C;  2CW0 F;  2Z99 A;  3QYE A;  5L3F A;  3NWS A;  5FRM A;  1MH4 A;  2NOJ B;  1WI9 A;  3FXR A;  1ZTR A;  3WOD F;  2BE5 F;  1WHU A;  1T38 A;  3A0H C;  1JT6 A;  2M0C A;  4U0W A;  5LFA A;  1VQ7 I;  3ZOB A;  1SC7 A;  3SYT A;  2V9V A;  3WTZ A;  3D5S C;  4KDP A;  1HW1 A;  4GRI A;  1RKT A;  4A3E J;  4FX0 A;  4XSX F;  4ESJ A;  1IC8 A;  3K10 A;  4EEF G;  1VQK I;  4A69 C;  2XAG A;  4IHT A;  1AKH B;  1FSE A;  2IGN A;  4DW6 A;  2VBY A;  3D5L A;  5J47 A;  3GYH X;  5ICG A;  4ON0 A;  4RM2 A;  4PSX A;  5DS9 A;  4CH7 A;  4YFX F;  2DMU A;  2H8W A;  2L5Q A;  2QSH X;  2JVG A;  3ZMD A;  2DFH A;  1WVR A;  3FHN A;  2L9S A;  4XID A;  4ZDO A;  3PIO F;  2JRM A;  3MN2 A;  3SDG A;  1U5T A;  4N9H A;  3DFG A;  2EFW A;  3OR2 C;  1TP4 A;  3SQN A;  3HL2 A;  2EIN H;  4IOC F;  4Y17 A;  1UEL B;  4U0Y A;  4RGS A;  1G6N A;  4PJN A;  4BE0 A;  1YLF A;  1HST A;  2HGC A;  3E5U A;  3E7L A;  1P92 A;  5CPR B;  1IG7 A;  2IGK A;  2WC2 A;  4HX7 A;  4BGD A;  4WK8 F;  4BQA A;  2R7R A;  4F7Z A;  2EZL A;  2HXI A;  4OIQ F;  4Q4Z F;  2ZCW A;  4U88 A;  2D1V A;  2DFF A;  1WPK A;  1W7P B;  2CQ7 A;  4UY8 I;  4M3E A;  2CFO A;  4E7K A;  4MIM A;  4UUS A;  5BPD A;  2IRF G;  1MGT A;  3A01 B;  3AG4 H;  2BGC A;  5F0F A;  4JX6 A;  2BY1 A;  5F0H A;  4P5O A;  3TGN A;  5C44 J;  5LD2 C;  4ABZ A;  3RKX A;  1D8J A;  1FIP A;  1IO2 A;  1BR1 A;  2NOG A;  2BEO A;  3DBH B;  4OAZ A;  2VJJ A;  3PNT A;  4BEH A;  3UR3 C;  3H9Q A;  3TOA A;  1Y1V J;  1J09 A;  2E5N A;  2MH2 A;  2MLK A;  3P9I A;  3S32 A;  3OYJ A;  2HQN A;  4KNY A;  2QCO A;  2DJN A;  1K6Y A;  2FD5 A;  3HPH A;  1J7K A;  1KA8 A;  2C6Y A;  3W6V A;  2VC0 A;  2B9S A;  4HOB A;  3LSR A;  5FFZ A;  1O3R A;  3OYC A;  1T08 B;  3V4G A;  3RSN A;  3HKZ N;  2AQF A;  5FGM A;  4IKF A;  1Y8R B;  3BOQ A;  3DPU A;  1R22 A;  4ZC3 A;  3LNQ A;  2Y31 A;  3UNG C;  4P1W A;  4BHB A;  4WXD A;  4XQF A;  2KZG A;  2PEX A;  3I4N J;  1E0E A;  3B02 A;  1MBF A;  5AON A;  1ETX A;  3C18 A;  1Y1W J;  2QA4 I;  2WB1 N;  1U5T B;  3PJR A;  1GV5 A;  4KIF A;  2FBI A;  4KIC A;  5F27 A;  2EFO A;  1OR7 C;  1F43 A;  3FZV A;  1YQA A;  4BH9 A;  4LB6 B;  2PMU A;  2VKD A;  1R4M B;  2VPR A;  2MFZ A;  3S2D J;  2O6G E;  1HKS A;  1I1S A;  5E8I A;  1OPC A;  1GV2 A;  2MC3 A;  3MEX A;  2H1K A;  3RCO A;  3CUQ C;  3O8H A;  4JK1 X;  3P7N A;  3NAR A;  1X1P A;  3T0Y A;  5C4X J;  4IZZ A;  1D0Y A;  2V79 A;  1AU7 A;  1K61 A;  2EFP A;  2COM A;  3EPZ A;  5LRR A;  1U8B A;  2IS2 A;  4XL9 A;  4YFK F;  4A12 A;  4BEH B;  1ZG5 A;  1TWF J;  3CLQ A;  1MJA A;  3G1L A;  1O3Q A;  4NC7 A;  2A5W A;  4A2U A;  4BU2 A;  2OTL I;  2HPI A;  3OS0 A;  5FJ8 J;  3QWL A;  1D3Y A;  2X85 A;  3GX4 X;  1TT0 A;  2Z9O A;  3QAH A;  5B66 C;  4YIF A;  2X1E A;  3GEZ A;  2KP6 A;  2R7X A;  3CCE I;  1NK2 P;  3HOU J;  3FK6 A;  4HNT A;  3B6A A;  1BOA A;  4A6D A;  1Z7U A;  1BW6 A;  4CGZ A;  4I7H A;  2OCC H;  2CJJ A;  2QLZ A;  3F9K A;  4AWX B;  4LIT A;  1KZH A;  3WU2 C;  1RIO H;  4M3G A;  3SJM A;  1MW7 A;  5M5Y J;  5HS9 A;  2VKV A;  4NDL A;  4NBQ A;  3GXO A;  3DEE A;  3KLO A;  1Z6R A;  4JX5 A;  5M5X J;  5A2Q K;  2XF7 A;  1F5T A;  3M07 A;  3J80 K;  4B48 A;  4M71 A;  4BJ6 C;  3HOW J;  4MFE A;  4HQM A;  3RJP A;  3O6B B;  2E19 A;  4ESB A;  1NG7 A;  4A0Z A;  3K4C A;  2GIZ A;  3LA7 A;  4EJU A;  1S7E A;  3BT9 A;  3ZMV A;  4IXA A;  4KA4 A;  2FRH A;  4KT6 A;  1IN7 A;  1ZGW A;  3K4J A;  3HJE A;  2KMU A;  1R5G A;  3HXL A;  1BI3 A;  2XAS A;  2HVR A;  1MNM C;  2W00 A;  4S04 A;  1HSJ A;  2RDP A;  3PO3 J;  4EJV A;  2JMW A;  2DI3 A;  3OR1 C;  3BG3 A;  2KIM A;  3VYU B;  3S3M A;  3FM5 A;  2KRC A;  1R58 A;  1B1B A;  3K1M A;  1P2F A;  3N05 A;  2TCT A;  2B7E A;  4HSR A;  5IOY A;  4EJW A;  3TBI A;  1W0T A;  1OKR A;  1XSX A;  2XGC A;  3IL2 A;  4PK4 A;  3VPR A;  1XGO A;  1WJE A;  2DA4 A;  3BG5 A;  5M3M J;  2M4K A;  3RYP A;  2DPU A;  3CJT B;  3OOU A;  1XC5 A;  3L2V A;  1UG0 A;  2IGM A;  4ASN A;  3PUB A;  4R1H A;  1S7A A;  5GAE J;  2H94 A;  3L2W A;  2M34 A;  2LYC A;  2PMH A;  2GLO A;  2L7F P;  4DNC A;  4XKW A;  2KIU A;  5IT3 A;  1MJB A;  5HDK A;  4HEA 2;  2GZW A;  3U21 A;  3VB2 A;  2KRF A;  5F08 A;  1FMV A;  1HDD C;  5EEG A;  3DBR B;  2QGU A;  1XCB A;  2HS5 A;  2Y69 H;  3BJO A;  2Y0S A;  3J7A Y;  1MMG A;  1XN7 A;  3J7Y J;  2D5V A;  1P6R A;  4A3B J;  1KU9 A;  4HV6 A;  2E2I J;  4FE7 A;  5FKL A;  3PIP F;  3F21 A;  1DGW Y;  4B3A A;  2KPM A;  3BTJ A;  3CCS I;  3HGG A;  4KFC A;  2ZSI B;  2MA3 A;  1ODD A;  4RGX A;  3TP0 A;  2WAQ N;  5GAD J;  3EUH C;  2KLO A;  3RDI A;  4XSZ F;  1W0U A;  4RM3 A;  6PAX A;  3LFU A;  4U0V A;  1Z3X A;  3KP3 A;  4RAY A;  1TT5 B;  5AIP A;  4W1U A;  3HYI A;  1NG6 A;  2EFN A;  3IAS 2;  5JVT A;  1XDU A;  3GW2 A;  3W2A A;  2M5W A;  1U9O A;  4NQW A;  3KPH A;  4M6X A;  3QYF A;  5IYB J;  3IWF A;  2PQ8 A;  4IHX A;  1LQ1 A;  1S29 A;  3TDU C;  3VWB A;  3IV5 A;  2P4W A;  1YJ9 I;  3SZG A;  4XN0 A;  4HRI A;  1GLN A;  3VSK A;  4CCK A;  5B1B H;  2DMQ A;  4PUS A;  3BCB A;  3HEF A;  4LIV A;  2UUZ A;  3ABL H;  2YU9 J;  2K85 A;  2QUF A;  2EB7 A;  2FBH A;  3BR2 A;  2R7O A;  4KT5 C;  4HX4 A;  4UV9 A;  2VQC A;  2F4M B;  1QO0 D;  2KIS A;  1MBK A;  2LBF B;  2M4G A;  2NRA C;  2BVM A;  2ID6 A;  3LST A;  3S14 J;  1R00 A;  3R4K A;  2JT1 A;  2VPL A;  3UKG A;  3OSG A;  5LHG A;  4DQ2 A;  2GXA A;  3G1M A;  3S3N A;  4EQQ A;  2CSO A;  4ETS A;  1OMI A;  2DK5 A;  5ICE A;  1IF1 A;  5IYD J;  2ME6 A;  1R1T A;  1G59 A;  1H0M A;  1QHH D;  2XGX A;  1X2N A;  3GTQ J;  2R7T A;  3NEU A;  1UHS A;  2XHK A;  4NUB A;  1U8R A;  2R7F A;  1Q1H A;  5CLS A;  1GXP A;  3OYD A;  4N4O B;  2R5Z A;  2ZC2 A;  3M1C A;  1JE8 A;  2VBZ A;  3H3U A;  1ETW A;  3GLX A;  2IS1 A;  3BP8 A;  3HGY A;  2KJC A;  1KYZ A;  2RQP A;  2A6E F;  1U5T C;  3QU6 A;  2CQN A;  2Y48 A;  1D1B A;  2K9L A;  4PFO A;  2P5V A;  1IJW C;  1HKT A;  1X58 A;  1Q1V A;  2VQL A;  1ITY A;  2CW7 A;  4V2F A;  4X6A J;  2KRH A;  2HTS A;  1WJF A;  4NQW B;  1YX5 A;  3DXJ F;  1XMA A;  3BDD A;  1G4D A;  3B6C A;  5IY5 H;  2BHZ A;  3W2W A;  3M1E A;  2DW4 A;  1S5L C;  2RGV A;  1XD7 A;  3R0A A;  3HSR A;  3C3W A;  1SFU A;  3JRE A;  3TO9 A;  4AUX A;  4MTE A;  3AG2 H;  4AC0 A;  2VT3 A;  3EUA A;  5EZH A;  3I56 I;  2L7M P;  2VT2 A;  2EIJ H;  3K2Z A;  2LH9 A;  2K7L A;  3BJ6 A;  2R7S A;  1ZLJ A;  1WCM J;  5GAG J;  4ZJZ A;  2H8R A;  1IZ1 A;  3QRF F;  2CGP A;  4RAZ A;  1VZ0 A;  2STT A;  3O8G A;  2NVU B;  3FXJ A;  4DYQ A;  3CCY A;  3VYR B;  2BY2 A;  4TV7 A;  2MGQ A;  2IXS A;  4OIR F;  1TWC J;  5E20 A;  3QYB A;  2KJB A;  3K1P A;  2P5K A;  2CUE A;  4XK4 A;  1SAU A;  3E1S A;  1ZG3 A;  3E97 A;  3ISP A;  4BAC A;  1OCP A;  3OS1 A;  5KNL A;  1ONV A;  2XPU A;  5EG0 A;  3RPU D;  2L9R A;  1W36 C;  2L7Z A;  1QVT A;  4BL0 B;  2AHQ A;  2JRT A;  5GAH J;  1BJA A;  1SFO J;  1IRF A;  4E7S A;  3HOV J;  4DIQ A;  1Y56 A;  3WTU C;  3H3Z A;  1Y8Q B;  5M5W J;  1UZC A;  2R7D A;  4JP0 A;  1IDZ A;  1BI1 A;  2DTZ A;  2RN7 A;  4J01 A;  1VQN I;  3DLL F;  1APL C;  2W57 A;  3MKZ A;  2DK8 A;  4XIC A;  4XM3 A;  5H20 A;  1YHQ I;  3L2Q A;  2FXA A;  2Y9Y A;  1WI3 A;  3DV8 A;  1MH3 A;  4HDV A;  1FYL A;  1FX7 A;  1YRN B;  1TWH J;  3FXM A;  5HOD A;  2ADU A;  1ETO A;  4B1R A;  1K4S A;  2HNH A;  2K02 A;  4IL6 C;  3ZCO A;  4RAG A;  2LVS A;  2Q0O A;  2P7C B;  2G7H A;  2OC6 A;  2BVL A;  1ZRC A;  2HEO A;  1G3W A;  2QZ8 A;  1JJ8 C;  3HHG A;  2XPV A;  3F6O A;  2R7W A;  4DGW B;  2KL4 A;  3QP5 A;  3IC7 A;  3T8R A;  2IAI A;  2ICW G;  4F52 A;  2RNG A;  4LK1 F;  1P4W A;  4YRV A;  3W6J B;  3DPT A;  5D6F A;  2Z3Y A;  3HHH A;  4CIC A;  3GVA A;  4XOR A;  4D7M A;  2CRG A;  4D7N A;  1OFC X;  5FO5 A;  3A03 A;  1B4A A;  1IN8 A;  5J1R A;  1AA7 A;  3QOE A;  4BQN A;  1FP2 A;  3ZRG A;  2HFH A;  1DGR M;  4XKV A;  3PO2 J;  4IPA A;  2YU3 A;  4FET A;  2RQQ A;  1T56 A;  2DQR A;  2WTE A;  5DD4 A;  3MWM A;  5E8G A;  1H9G A;  4BKX A;  5JHU A;  4QTR A;  4P55 A;  1VQL I;  2ZXI A;  3K4M A;  1EH6 A;  1SD6 A;  3OL3 A;  1Z7L A;  5EG0 B;  2NVX J;  2FEZ A;  3GF2 A;  1HA8 A;  4AID A;  2W85 A;  1ON1 A;  5DUI A;  4FCY A;  4RAF A;  3F8M A;  2WBM A;  1FSH A;  1YYV A;  5ERI A;  3FBI B;  4GGG A;  5JLW A;  1RUN A;  4ZZD A;  3GZN B;  1ULY A;  1ETV A;  4UVA A;  1T39 A;  4RGU A;  1K78 A;  2JWT A;  1XMK A;  3KE2 A;  2Z5U A;  4AM3 A;  2J5P A;  3O2P E;  5EEA A;  4A3K J;  2LRE A;  2V1D A;  4YFN F;  2E35 A;  1KQ9 A;  1W5C C;  3AL0 B;  5FKK A;  2VJI A;  2K40 A;  3OL4 A;  4O3M A;  2L4A A;  5IT9 Z;  3OYF A;  1MMS A;  3WTS C;  2GOX B;  5H6Q A;  2R4G A;  1MBE A;  2QQA A;  2EH3 A;  1X1A A;  5GPC A;  2FU4 A;  4XKC A;  3LQQ A;  3KYC B;  1MND A;  2MC4 A;  4BUP A;  2WY8 Q;  4FIS A;  3QP6 A;  2ZFU A;  3W2V A;  1MIJ A;  2WAD A;  5KHD A;  5BNG A;  2B63 J;  1YI2 I;  4GXO A;  4CCL A;  1W5S A;  2JPC A;  4L5J A;  4CCJ A;  4XKB A;  3ZQC A;  1R36 A;  1ZK8 A;  1LNW A;  4NC6 A;  5CVR A;  3CCL I;  3DWL E;  2R0Q C;  1CF7 B;  3I53 A;  5FLM J;  3KIO A;  2HQ5 A;  2O9L A;  3CCR I;  2ZME B;  2GXG A;  1LFB A;  3WGI A;  3GTG J;  2K4J A;  4G6Q A;  4I2O A;  1RNL A;  1BIB A;  4HBL A;  3R6S A;  1WH7 A;  1BC7 C;  2H6B A;  1LVA A;  2P0W A;  2JA5 J;  4PGG A;  1TQP A;  1PUE E;  1HKQ A;  1JTX A;  5LEJ A;  3E6B A;  4LMY A;  2H1L A;  5C4J J;  3C2B A;  3G3Z A;  2R7U A;  3BTC A;  4L9T A;  4E7L A;  4CO8 A;  1S7O A;  3G2B A;  4M72 A;  2EJR A;  3ZGK A;  3BZK A;  3HKZ A;  4XLC A;  4ZDL A;  1V5F A;  1OCZ H;  5KK1 A;  1O57 A;  3TDZ C;  1B72 B;  2JA8 J;  2M8G X;  4RB3 C;  4HLX A;  2R5Y A;  3J7A O;  1LEA A;  3CES A;  5F04 A;  4BY1 J;  5HNF A;  1LKX A;  1RC9 A;  2NYX A;  4M3D A;  1R9T J;  1K78 B;  3P9K A;  4FTH A;  3V7R A;  5EYR A;  1XCV A;  5IYC J;  4OIO F;  1VQM I;  5FLX K;  2JSP A;  4XRS G;  3JSP A;  5DM7 F;  3T8T A;  3FF5 A;  5HS8 A;  5D8L B;  2EIL H;  1WH5 A;  3ZP5 A;  2DQL A;  1GVJ A;  5FKM A;  2E71 A;  4HF2 A;  1MMA A;  1N75 A;  4OMZ A;  1W5T A;  1J9I A;  1D8K A;  1FLI A;  4IHY A;  2OJE D;  3DEW A;  4PJM A;  2ESN A;  2ZNZ A;  3DBL B;  2V9P A;  1VQ6 I;  1L0O C;  1TZL A;  3WE3 A;  1WGX A;  1HCR A;  4ENN A;  3VDX A;  1X1C A;  3PNV A;  1VQ5 I;  3HDD A;  4DZP A;  4ENK A;  1FOW A;  2G9W A;  1DDN A;  3DTE A;  2R7Q A;  2RVC A;  1FZP B;  1UST A;  3BY6 A;  4KYW A;  3ABT A;  3SEZ A;  2I10 A;  1IRX A;  2DJI A;  3BPX A;  3CDL A;  2IA1 A;  2OV7 A;  2HKX A;  2KQR A;  4M9S A;  1NH3 A;  3FDY A;  2Y9Z A;  1IN6 A;  4A5N A;  4AYB N;  4XRF A;  1R49 A;  3MKL A;  1B8I A;  3P9C A;  1J59 A;  4CCM A;  1ERD A;  1V55 H;  2OCE A;  3KZZ A;  2BBY A;  2E1M B;  4NB5 A;  1D5V A;  3HOX J;  3HTU A;  4DZJ A;  2V1U A;  1HQC A;  2EZH A;  2R5Y B;  1IGN A;  2VI6 A;  2FSW A;  2IJL A;  5LRS A;  4Y7N J;  4J19 A;  3ZQG A;  3BWG A;  2ECC A;  2WA0 A;  3LL7 A;  3HRU A;  2DMT A;  1YW9 A;  3CD6 I;  2JZY A;  2AXT C;  5EZG A;  4QWQ A;  1OIS A;  3JTH A;  1UMQ A;  3IH3 A;  4GDF A;  5J40 A;  5TGT A;  3LSG A;  3LWF A;  4LFU A;  4I98 B;  4ESF A;  2QM3 A;  5M3F J;  1R7J A;  2VLA A;  4OAY A;  2IA0 A;  2MBF A;  3SDB A;  4A3I J;  3IWZ A;  5HDN A;  1YIT I;  4HST A;  3X2Q H;  3CCM I;  2GM4 A;  5GTI C;  1LUJ B;  5CQG A;  1ZG1 A;  2QBY B;  2BV6 A;  3C1D A;  2DFE A;  1VND A;  2XAF A;  3LAJ A;  1UHW A;  2O61 A;  1Z6T A;  4UB6 C;  2NNY A;  3OMY A;  1IV8 A;  2CQK A;  5CVJ A;  1KU2 A;  3O3K A;  1XGN A;  1Z1D A;  5J6X A;  3F0C A;  2PBI A;  1GXQ A;  2K4B A;  1O3S A;  1S3J A;  4CYC B;  2L01 A;  2JPB A;  3LSM A;  3S16 J;  2W1O A;  3V8L A;  3OYI A;  1W36 D;  2JJ7 A;  2V26 A;  2MW8 A;  4RB2 C;  2KDZ A;  3KYD B;  1VQ9 I;  1ZQ3 P;  4XLP F;  3M4O J;  2KIQ A;  4EV0 A;  2A6H F;  4ZDP A;  1B8I B;  4N4N B;  1XSV A;  1ON2 A;  2XIG A;  4RGR A;  1Y0N A;  2DDA A;  2ESH A;  1JHF A;  3HOT A;  3LSP A;  4Y52 J;  4IQ4 A;  2HVS A;  2ME0 A;  1NHA A;  1JGG A;  4D0P A;  1MD0 A;  4AD9 A;  4BE1 A;  1R1U A;  2VON A;  1MNE A;  4D5F A;  3OWT A;  1TNT A;  3VYT B;  4RB1 A;  3JRC A;  4V19 K;  2Z33 A;  2K86 A;  4XRM A;  3HB9 A;  1WZ2 A;  3CC4 I;  1LDD A;  3OIQ A;  3H1C A;  4WXH A;  2XC7 A;  2HTJ A;  3FXL A;  1B9N A;  2VN2 A;  2X48 A;  2L3D A;  3ZQF A;  3WTX C;  2Y0M A;  2UXN A;  2XRL A;  3JRI A;  1V54 H;  2DA3 A;  2LNB A;  1MKM A;  1U2W A;  2X9D A;  2FMY A;  3IRR A;  3AL0 C;  2W48 A;  4Z2Y A;  4YII A;  1PYV A;  3OYE A;  3EYI A;  2NXN B;  4R79 A;  3FMR A;  1LDK B;  3K0L A;  3V42 A;  4X1E A;  3BQZ A;  2Z1D A;  1R5H A;  3MAJ A;  4LGW A;  3EDP A;  1N78 A;  1I3A A;  5E1Z B;  4C3J J;  2JUC A;  1JUS A;  2VL8 A;  4BBS J;  2P7V B;  4YEJ A;  4DBR A;  3TP3 A;  2VBW A;  1Z21 A;  1QPI A;  1AOY A;  4B09 A;  1CGP A;  5J8F A;  1TWA J;  3CCQ I;  3JRB A;  1XPX A;  4Y33 A;  2HOA A;  2NVY J;  3BR5 A;  2MD0 A;  4EMS A;  1XTA A;  3ASO H;  3WTY C;  1LJ9 A;  2ZXW H;  4E7I A;  4HG2 A;  3VYS B;  4D5C A;  1U0J A;  5J1U A;  2DMN A;  4EAT A;  1D0X A;  2L9N A;  4XBF A;  1D0Z A;  2L02 A;  2LBF A;  2VQH A;  4Q47 A;  4MTD A;  1V5E A;  4LLG F;  4IJA A;  3DEU A;  4PJL A;  4XOP A;  3JCU C;  3TO6 A;  2DTR A;  4NNJ A;  2XDV A;  2F48 A;  1A04 A;  1BC8 C;  2VE9 A;  2R93 J;  1Z0X A;  2CUF A;  1QA6 A;  1R4N B;  3JTG A;  1R5I D;  2GOM A;  4G6D A;  2X6O A;  2VQG A;  4HLY A;  5GTH C;  1R1V A;  4NC8 A;  3VSL A;  3BG6 A;  2V1N A;  2XAU A;  5HVQ C;  3IRQ A;  1BJZ A;  2EWN A;  1ACI A;  4AIJ A;  2LF7 A;  4MGR A;  5E17 F;  1T0F A;  2X1D A;  2M8E A;  4QPQ A;  2ZJP F;  2H09 A;  1K7A A;  1X2M A;  3R61 A;  1P7J A;  2E1C A;  4EGZ A;  3FKJ A;  2A5Y B;  2XSJ C;  2G0E A;  1X4O A;  3DTI A;  3KET A;  3I55 I;  4F3Q A;  3FHZ A;  3TMO A;  1FEX A;  3TL4 X;  1A31 A;  1X3U A;  2RNJ A;  2RV8 A;  3JAM K;  2PJR A;  3OYM A;  2VXZ A;  2EV5 A;  1MBJ A;  2MSY A;  1KU3 A;  5LGT A;  1OYI A;  2F4O B;  5EGO A;  4JOM A;  2PMZ A;  3TW7 A;  3CLO A;  4BHC A;  2JTV A;  3W3C A;  4RMN A;  2CYY A;  3FXO A;  1SD5 A;  5D5U B;  1PUF A;  2W84 A;  1P4X A;  4L9V A;  1WJC A;  4I0A A;  5DV5 A;  2UXX A;  4JX4 A;  3OYB A;  3Q9V A;  4H4K C;  3F8C A;  2A07 F;  5J1Y A;  4KN4 X;  4A6E A;  2QYO A;  2IP2 A;  3QOP A;  3CUO A;  5HNH A;  4QLC U;  3NRV A;  4WF2 A;  1ZHF A;  2OQG A;  3WTV C;  3W6K B;  4BXU A;  1F9N A;  1XSD A;  3WG7 H;  3J81 K;  1X1B A;  2YX4 A;  4BAY A;  1XG1 A;  1ZN2 A;  3FIS A;  3KLN A;  4G7H F;  1V3F A;  1JTY A;  5EF6 A;  2K9M A;  2HZT A;  4A5M A;  2GA2 A;  3MMY B;  4EJT A;  2I5U A;  5A2Q Z;  3ZQH A;  3S3O A;  4PZJ A;  3J80 Z;  2X0L A;  4LOC A;  1QRY A;  1HW5 A;  5LGU A;  2A61 A;  1YG2 A;  3S2W A;  1ZKG A;  1BIA A;  1HF0 A;  2AXL A;  1J0R A;  2ZBK A;  3TKY A;  4F93 B;  3HTS B;  4KJZ A;  3I5U A;  3JRH A;  1FT9 A;  1WJ5 A;  2VKE A;  5D5X B;  3CMM A;  1E2X A;  2EA4 A;  2YUS A;  1YX3 A;  1STZ A;  5F6F A;  4MEX F;  3I4M J;  1GDT A;  3DCF A;  4KMU X;  2CV2 A;  3BG7 A;  4IEJ A;  4QSH A;  1TW2 A;  5FFX A;  5C3E J;  4G12 A;  4N9I A;  2L7K A;  1ZGJ A;  4ZTJ A;  1E17 A;  1PJR A;  2L2O A;  2RKH A;  1YW7 A;  2LY1 A;  2L9V A;  3F8F A;  3L09 A;  2PJR B;  2WAE A;  1A6I A;  3ULQ B;  5K7F A;  2RRE A;  2XAH A;  2D45 A;  4OIP F;  2MYS A;  5ILS A;  4RA2 A;  1UAA A;  3K4B A;  2Y0S N;  3U2R A;  2NS8 A;  4OWR B;  3RTR A;  1TTY A;  1YRN A;  4L0Y B;  4EGY A;  5D4R A;  1ZRD A;  2XAQ A;  3EYY A;  3GLL A;  5EGO B;  3SZP A;  4PDK A;  3G73 A;  1G8X A;  5CYV A;  3RQ4 A;  5D8K B;  1PUF B;  1U9N A;  2W82 A;  4F91 B;  3BR0 A;  4A3C J;  2ZNY A;  1MMN A;  2DN0 A;  3K1N A;  3E6M A;  1P9Q C;  1QZE A;  3V8J A;  4B43 A;  3MFK A;  1QHG A;  4DJA A;  1XMX A;  4E4H A;  1LFP A;  1QZZ A;  1WJD A;  4Y4R A;  5LHH A;  1MBG A;  1LE8 A;  5LLQ A;  2P8T A;  3HRM A;  2ISZ A;  1XGS A;  3GCM A;  1FTZ A;  1JJ6 C;  2M0M A;  3HSE A;  4FE4 A;  2XKP A;  1KU7 A;  2V9K A;  1BR2 A;  3PUF A;  3GZ5 A;  1M1E B;  1T33 A;  3S8P A;  4AVZ A;  4IRI A;  3ZN0 A;  2FOW A;  2QF7 A;  3JR9 A;  4LG0 A;  1FIA A;  2M7B A;  1WRJ A;  2K9S A;  3S15 J;  3OIP A;  5CKT A;  2ID3 A;  2XVC A;  1OCC H;  4AVP A;  2VB6 A;  2K9N A;  2FQ3 A;  3DKY A;  2XKO A;  4XRS A;  3AKZ A;  4CHU A;  4FHT A;  4M9Z A;  4MQV A;  2K3F A;  2ETH A;  3A4C A;  5B1A H;  3M3Y J;  1P7I A;  2E2J J;  3BR1 A;  3N97 A;  3TO7 A;  1UCR A;  3GUD A;  1JUP A;  2HZD A;  1MDM A;  2EFQ A;  4XMY A;  2GBY A;  4E70 A;  1IXC A;  2EBI A;  4C9Y A;  4CXF A;  4KN7 X;  3RPQ A;  5GP9 A;  3V8K A;  1H8A C;  1NTC A;  3OIO A;  2PI0 A;  2KDO A;  4CA0 A;  3K70 C;  3VFZ A;  2MLG A;  3GFL A;  3Q5F A;  5L3C A;  3PQK A;  2B0L A;  4MFD A;  3WU1 B;  2CG4 A;  2FJ1 A;  3I64 A;  4I76 A;  2OZ6 A;  4E7J A;  4QPO A;  3ABU A;  3WU0 A;  3CF5 F;  2GQQ A;  5EJC A;  1JI8 A;  3KX2 A;  3K6G A;  3FMQ A;  1FY7 A;  3OSF A;  2MD5 A;  5BQT A;  2LR8 A;  3MZ8 A;  3FK7 A;  2XSD C;  1EA3 A;  5K7Z A;  3KP4 A;  3G6E I;  3E6D A;  5B5E C;  3KZY A;  4HX8 A;  4O5V A;  4CZC A;  1LE8 B;  4DYC A;  5FLV A;  3H35 A;  3IH4 A;  3H9G A;  1RR8 C;  1D5Y A;  4UV8 A;  2D1H A;  3VOD A;  4C3H J;  2FNP A;  3F3X A;  3V7C A;  1I39 A;  3AAF A;  1CF7 A;  3CP8 A;  3QPS A;  2E7X A;  5KAI C;  3I59 B;  2ZME A;  4BJ5 C;  3JW4 A;  4V2G A;  4LG0 B;  1A36 A;  4BS9 A;  2LY2 A;  3S1R J;  3B73 A;  5J8C A;  1QQI A;  4XLE A;  4LLN A;  1T8I A;  3Q0U A;  4HQE A;  3REO A;  2BW3 A;  4EVI A;  1U78 A;  1IUF A;  4O6J A;  3QPT A;  2OAZ A;  1ZR2 A;  4UHT A;  2Q8K A;  2E7W A;  3OV8 A;  2OPT A;  2K3P A;  3KCC A;  5TRD A;  1QNT A;  2FA5 A;  1G3T A;  4ITV A;  4GFB A;  4E7Z A;  1DP7 P;  4IHS A;  1V4R A;  2NNN A;  3L2U A;  1RRJ A;  2IS4 A;  1QPM A;  1RES A;  2X6W A;  1MDM B;  1WFX A;  1K6O A;  4PGH A;  2XAJ A;  3BZC A;  1HXD A;  1B72 A;  3LAP A;  1LB2 A;  1I3Q J;  3OYL A;  2FNA A;  4OOI A;  5FKO A;  1XB4 A;  2OBP A;  5KAF C;  2DPD A;  1W4M A;  1DPU A;  2E1N A;  3MD2 A;  3LSJ A;  3L1P A;  1UFM A;  2ZJ2 A;  2ZXH A;  3JRA A;  1TL8 A;  3BRO A;  4JQF A;  2WV1 A;  2M45 A;  4RB0 A;  2JA6 J;  2VJ4 A;  2XB5 A;  1TQI A;  2DYR H;  3ZQQ A;  1OYW A;  3EUK L;  2DT5 A;  3BQY A;  1FPQ A;  4I0B A;  2FF4 A;  4Y15 A;  3HM5 A;  3OYG A;  1MJ9 A;  5D5V B;  3G71 I;  1ZGA A;  2H27 A;  5FRO A;  3GFJ A;  2L0K A;  1JUM A;  5E3N A;  1HOM A;  3I9V 2;  3NWT A;  1ZR4 A;  4OMY A;  2OTJ I;  1FOX A;  3MKY B;  3F72 A;  1BBY A;  3MCZ A;  1FBQ A;  2IPQ X;  5E1X A;  5JI6 A;  4HF1 A;  3M8J A;  2L54 A;  2HKO A;  2VE8 A;  2LOO A;  1OCR H;  2DA6 A;  3ABK H;  3GTJ J;  2X1C A;  3QPH A;  3SXY A;  1I50 J;  2P6S A;  1U6G A;  2VUM J;  2LTP A;  3ECO A;  4G6T B;  2A3S A;  3S2H J;  2Y2Z A;  3I54 A;  1SAN A;  3CME I;  1TQM A;  3GTM J;  1I6X A;  1IDY A;  4L0Z B;  3IP4 B;  2E36 A;  1FTT A;  1O7L A;  4CCO A;  2JVH A;  3ONQ A;  4A93 J;  2BW3 B;  3E3V A;  3I3L A;  1PP8 F;  2CV0 A;  5L3B A;  2BYV E;  2P5L C;  2BZT A;  2V6E A;  5IOZ A;  4UUV A;  3IHU A;  5K1Y A;  4G94 A;  4XLH A;  2QWW A;  3ROU A;  1KQ0 A;  3CJR B;  2V7F A;  2TDX A;  2HPM A;  3BJA A;  2EZK A;  3BR6 A;  1SD7 A;  4LIU A;  4BXX J;  2LY9 A;  4FQG A;  4HF0 A;  2XPW A;  4J00 A;  4ZYH A;  5CVV A;  4UVB A;  3M8E A;  2O8K A;  2O5R A;  3CDI A;  1T0F C;  3SEQ A;  3ZMS A;  1T6S A;  3JRF A;  1EJ9 A;  1QGP A;  4Z6Y A;  1FP1 D;  3OOP A;  4BE2 A;  5K5Q A;  2DU9 A;  2HOE A;  3MVP A;  1W7P D;  1TWG J;  3BPV A;  1JGS A;  2CV1 A;  2EV0 A;  2WB1 A;  3ZQ7 A;  4IX7 A;  1OQY A;  3GFM A;  1YFH A;  1ORK A;  2HXO A;  2AS5 F;  3RQI A;  3S17 J;  3F22 A;  3ZMZ A;  1BI0 A;  1DPR A;  3TED A;  2BXY A;  3RIR A;  1XGM A;  4BBR J;  4C2T A;  1ZLK A;  4ZZL A;  2DXI A;  1VF9 A;  3HRT A;  3I58 A;  4KIG A;  3G1O A;  3CC7 I;  2W25 A;  3DLA A;  3RZD J;  1YS7 A;  3OY9 A;  4AU7 A;  2QBY A;  2ZXJ A;  5E1W A;  4G7Z F;  1O3T A;  3IH2 A;  3IKT A;  3LSK A;  1YJN I;  4L18 B;  3AG3 H;  1ZEL A;  2JQ7 A;  2G7U A;  4A3L J;  1PP7 U;  2CWE A;  3DQV C;  3CCJ I;  3VEP A;  4RS8 A;  5DDG A;  3CJN A;  3PNY A;  4OU0 A;  4CYC A;  2EPF A;  4EM0 B;  3LSH A;  4LD5 A;  5HLI A;  1K79 A;  2LKS A;  2QEN A;  2BY0 A;  2ZSH B;  5DM6 F;  4BY7 J;  1BN5 A;  2EIM H;  3K4K A;  2KHM A;  5L3D A;  3KEO A;  2HQA A;  4WCG A;  1R6R A;  2ECB A;  4N0B A;  3S1N J;  2QVO A;  4ENJ A;  4F92 B;  1OLT A;  4W97 A;  4Y13 A;  1T2K A;  3L9F A;  2XUB A;  1SVM A;  3BR3 A;  5H2F C;  5IP9 J;  2STW A;  2LRD A;  3PL8 A;  2YR2 A;  5DCM A;  2DFI A;  1C0W A;  3C2H A;  2EA2 A;  2F5E A;  2F2E A;  4C2M J;  2X6X A;  5HOO A;  3U1D A;  4L5E A;  1NK3 P;  3ZMT A;  3CCV I;  2Y30 A;  5E79 C;  2O7O A;  2AO9 A;  1EH7 A;  4A3M J;  2PLY A;  2EIK H;  1YOV B;  2DOE A;  1SVO A;  3MQ0 A;  2FE3 A;  1PDN C;  4XLA A;  4X0G A;  2LD5 A;  1JKO C;  1OYY A;  1VQ8 I;  2AQE A;  3GZ6 A;  3KP6 A;  1MSF C;  3FKI J;  1IUY A;  5HLH A;  3I71 A;  1IXR C;  4WX9 A;  2NVQ J;  3QU3 A;  2IVM A;  2QKM B;  3MZH A;  3FWE A;  3H5R A;  4JYK A;  4KIS A;  2HU9 A;  4IQJ A;  4HNV A;  5LBQ A;  1LFU P;  3BTI A;  3RYR A;  2JA7 J;  3AFH A;  1SD4 A;  2YX7 A;  4II2 A;  4PSW A;  2EK5 A;  1WJB A;  3F8B A;  1BI2 A;  4A3F J;  3R60 A;  1F1Z A;  4ZTF A;  4MNU A;  1TNS A;  1OCO H;  5F0C A;  4PFP A;  1ZRF A;  1A5J A;  3L00 A;  1SFK A;  4BHP A;  4KMF A;  2UZK A;  2QSG X;  3IUO A;  3S1M J;  5FB2 A;  1F4K A;  2GIV A;  1Z91 A;  2FBK A;  1H9T A;  4GYI A;  1Y0U A;  4BQQ A;  4I6Z A;  2XRN A;  4PCQ A;  4C3I J;  2DO7 A;  1BL0 A;  5DUK A;  1LDJ A;  1ZYR F;  2MG4 A;  3QPL A;  4WXC A;  1U3E M;  2HOS A;  3CCU I;  5HS7 A;  2ELH A;  2M1B A;  3SZT A;  4ENM A;  3DPL C;  4CZZ A;  5DCM B;  4A3G J;  4AIH A;  4L5I A;  2DLL A;  2VKH A;  4YIR X;  1X3Z B;  4UUS B;  1LVK A;  1KON A;  1WKM A;  5FLX Z;  3K70 D;  3M7G A;  2XRO A;  4DYR A;  5CJ9 A;  5HLT A;  4GCV A;  3WHC A;  1JKR C;  1FMW A;  5JLX A;  1E3H A;  1SAX A;  2VOD A;  1S6L A;  3CTA A;  3DF8 A;  3PFY A;  1Z9C A;  5FRN A;  3CQZ J;  5J3L A;  5E18 F;  1B9M A;  4UNO A;  2CS3 A;  1DQU A;  3RKW A;  4M73 A;  1TC3 C;  3BZ6 A;  3BG9 A;  1FOY A;  3LSI A;  1J2X A;  3ZMU A;  2TRT A;  2M7A A;  4RLQ A;  1POG A;  1QU3 A;  4XLN F;  3K4L A;  2QEX I;  4LLL A;  1RR7 A;  5AIQ A;  4ZYA A;  1QVU A;  2F5V A;  2DYS H;  4S0H B;  2DCE A;  2WAQ A;  1FJL A;  4M9X A;  1EH8 A;  2HDC A;  1ZH5 A;  4YEL A;  2KIF A;  1XDS A;  2OA4 A;  1UG2 A;  4A0Y A;  1BW5 A;  2KT0 A;  2RAE A;  5IP7 J;  5IPA A;  2DT7 B;  4IHW A;  4JBA A;  3I4P A;  2V6C A;  3OYK A;  4IF4 A;  1SEU A;  3L2R A;  1TW3 A;  1BR4 A;  4NHJ A;  4C30 A; 
#chains in the Genus database with same CATH homology
 3T5X A;  3CO6 C;  5HLG A;  2DAO A;  2ZFW A;  3F6V A;  2LSO A;  4U7B A;  3JSO A;  2PN6 A;  5FD5 A;  2CO5 A;  3WGH A;  3EET A;  5JR3 A;  3LQR A;  5LHI A;  3LA3 A;  5ICC A;  4HDU A;  3HIF A;  3RKY A;  3KEQ A;  2OZU A;  3M8F A;  4FT8 A;  3E5Q A;  5JFR A;  3VOE A;  1LEB A;  1QBJ A;  3FM3 A;  4P96 A;  1REP C;  3NQO A;  2OU2 A;  4GO1 A;  3FX3 A;  1TBX A;  1FYM A;  2GXB A;  2QQ9 A;  2VOO A;  4BNC A;  3E5X A;  5BS6 A;  2VOP A;  3HSF A;  3WG9 A;  2RC4 A;  2LF8 A;  3GWZ A;  1UB9 A;  1I1G A;  4LK0 F;  2V1X A;  3SHF A;  4YG2 F;  4MQ9 F;  4ZYE A;  1YIO A;  3FXQ A;  5K5O A;  3FMS A;  3COA C;  1FYK A;  3I0T A;  4CDG A;  4HW0 A;  1I27 A;  2GWR A;  3K69 A;  1RI7 A;  3CDH A;  5D6E A;  4AIK A;  5EEH A;  1TLH B;  5LEK A;  2VBX A;  4L9N A;  2O3F A;  1O7F A;  2X4H A;  1BM9 A;  3WTW C;  3ML6 A;  1Z05 A;  3CO7 C;  3E6C C;  4HA8 A;  2GA1 A;  1FOK A;  4IRH A;  2LKP A;  4KUM A;  5ILV A;  3KFW X;  1EV7 A;  1SMT A;  1S8N A;  5CVI A;  4BYY A;  1DUX C;  3WE2 A;  1G3S A;  3GFI A;  2IA2 A;  2O8X A;  2HQR A;  4I01 A;  4CYD A;  2IW5 A;  2K27 A;  3R0J A;  3F23 A;  5L3G A;  5F64 A;  1HBX G;  3LFK A;  2GAU A;  3HRS A;  2W24 A;  2D2W A;  4OIN F;  3MZY A;  5BMZ A;  2HWV A;  3HOS A;  3N4M A;  2NAZ A;  2P6T A;  1IAW A;  1FNN A;  2WV0 A;  4Q48 A;  1I5Z A;  3U9G A;  2VC1 A;  1R23 A;  3ERE D;  4EJO A;  1MZB A;  1HW2 A;  4MHG A;  4ZH4 F;  4LJZ F;  2IT0 A;  2HYF A;  2XV4 S;  2FML A;  1B59 A;  3FXU A;  3LA2 A;  1ZAO A;  3TOB A;  2QQB A;  1JHH A;  1YW8 A;  3GO5 A;  1SFE A;  1OR7 A;  5ED4 A;  3ECH A;  4K2E A;  2WWY A;  1B6A A;  1AWC A;  1SFX A;  1FBS A;  3I59 A;  3RPU A;  2A68 F;  2UWM A;  3CUQ A;  5DD8 A;  3T1B A;  1RUO A;  3ELK A;  5IT9 K;  1JXS A;  5KVR A;  1YTY A;  1FBU A;  4S05 A;  2J5O A;  1ZRE A;  1YO5 C;  3JAM Z;  3HUG A;  2DBB A;  3KP2 A;  1T98 A;  5FD6 A;  1ZAR A;  4P9U A;  3DP7 A;  3TQN A;  1P4A A;  2F5F A;  2HYG D;  4M6Y A;  3PQJ A;  1J75 A;  3H92 A;  4ZYG A;  2OQR A;  4FX4 A;  2ACJ A;  4EM2 A;  4L9J A;  4G8X A;  4M74 A;  2HR3 A;  5BOX A;  5H6R A;  4HV5 A;  4I09 A;  2CFX A;  1UHM A;  3F8N A;  1IXS B;  4UVC A;  2A69 F;  5HDG A;  4Q5S F;  1KQ8 A;  4MEY F;  4G9Y A;  3J81 Z;  3C7J A;  2KKO A;  4ZYD A;  4I02 A;  1SMY F;  4G7O F;  2O03 A;  2ZO4 A;  4UXN A;  1GHC A;  3M9A A;  1VTN C;  1IW7 F;  2Y75 A;  1J5Y A;  5DEQ A;  3SFZ A;  2O0Y A;  3CUQ B;  2PJP A;  1IRG A;  1USS A;  4A0X A;  3PFI A;  1WWX A;  4R8H A;  2PFB A;  2Q2E A;  1IN5 A;  4KIB A;  3WTT C;  3RI4 A;  5F1R A;  5K5R A;  3EQL F;  2ZKZ A;  1FWZ A;  4GYG A;  4EM1 A;  4WWC A;  4H0E A;  1KYW A;  1RZ4 A;  3KP7 A;  2M30 A;  5CVU A;  1FC3 A;  3K9T A;  3ZPL A;  3WGG A;  4IRG A;  1WSU A;  2NS0 A;  4HYE A;  1YS6 A;  2PG4 A;  2M87 A;  2R3S A;  3V7S A;  4B8X A;  5BPI A;  2F5C A;  3L2C A;  5ICF A;  1IN4 A;  3L7W A;  4P9F A;  1G3Y A;  2FOK A;  3DKW A;  4U7D A;  2YSR A;  4LB5 A;  3EUH A;  3IKV A;  5DYM A;  3KP5 A;  2OD5 A;  5DCF A;  3D0S A;  4HAM A;  2MH9 A;  1QZY A;  3Q9S A;  5LGN A;  4IVN A;  1KGS A;  2F5D A;  2ISY A;  1WQ2 A;  1L3L A;  2L4M A;  3ZN1 A;  5ILU A;  4HZF A;  5L3E A;  1W7P A;  2JSC A;  2H6C A;  2LDU A;  5D5W B;  5D4S A;  5TJJ A;  2EV6 A;  2YPR A;  2CW0 F;  2Z99 A;  5L3F A;  3FXR A;  1WI9 A;  3WOD F;  2BE5 F;  1T38 A;  4U0W A;  2V9V A;  3WTZ A;  4KDP A;  1HW1 A;  4FX0 A;  4XSX F;  4ESJ A;  2XAG A;  4IHT A;  1FSE A;  2VBY A;  3D5L A;  3GYH X;  5ICG A;  4ON0 A;  4YFX F;  3ZMD A;  1U5T A;  4N9H A;  3DFG A;  2EFW A;  3SQN A;  4Y17 A;  4U0Y A;  4RGS A;  1G6N A;  1YLF A;  1HST A;  2HGC A;  3E5U A;  1P92 A;  2WC2 A;  4HX7 A;  4WK8 F;  4BQA A;  4F7Z A;  4OIQ F;  4Q4Z F;  2ZCW A;  4U88 A;  2D1V A;  1W7P B;  5BPD A;  2IRF G;  1MGT A;  2BGC A;  4P5O A;  3TGN A;  3RKX A;  1D8J A;  2BEO A;  3TOA A;  3P9I A;  4KNY A;  2MH2 A;  2MLK A;  2HQN A;  1J7K A;  1KA8 A;  2C6Y A;  2VC0 A;  4HOB A;  5FFZ A;  1O3R A;  3V4G A;  5FGM A;  3BOQ A;  1R22 A;  4BHB A;  4WXD A;  2PEX A;  3B02 A;  5AON A;  3C18 A;  1U5T B;  4KIF A;  2FBI A;  4KIC A;  2EFO A;  3FZV A;  1YQA A;  4BH9 A;  4LB6 B;  2PMU A;  2O6G E;  1HKS A;  1I1S A;  5E8I A;  1OPC A;  2MC3 A;  3MEX A;  3CUQ C;  4JK1 X;  3P7N A;  3T0Y A;  2V79 A;  2EFP A;  2COM A;  5LRR A;  4YFK F;  4A12 A;  1ZG5 A;  1MJA A;  1O3Q A;  4A2U A;  1D3Y A;  3GX4 X;  2Z9O A;  3QAH A;  4YIF A;  3GEZ A;  1BOA A;  4A6D A;  1Z7U A;  4CGZ A;  4I7H A;  2QLZ A;  4AWX B;  1RIO H;  5HS9 A;  3GXO A;  3KLO A;  1Z6R A;  5A2Q K;  1F5T A;  3J80 K;  4M71 A;  4HQM A;  3RJP A;  3O6B B;  4ESB A;  4A0Z A;  3LA7 A;  4EJU A;  3ZMV A;  4IXA A;  4KA4 A;  2FRH A;  1IN7 A;  1R5G A;  1BI3 A;  2XAS A;  4S04 A;  1HSJ A;  2RDP A;  4EJV A;  2DI3 A;  2KIM A;  3FM5 A;  1R58 A;  1B1B A;  3K1M A;  1P2F A;  4EJW A;  1OKR A;  1XSX A;  3IL2 A;  1XGO A;  3RYP A;  2DPU A;  4ASN A;  4R1H A;  1S7A A;  2H94 A;  2PMH A;  4DNC A;  2KIU A;  5IT3 A;  1MJB A;  5HDK A;  2GZW A;  3VB2 A;  2KRF A;  5EEG A;  1XCB A;  2HS5 A;  3BJO A;  1XN7 A;  1P6R A;  1KU9 A;  4HV6 A;  3F21 A;  4KFC A;  2MA3 A;  1ODD A;  4RGX A;  3RDI A;  4XSZ F;  6PAX A;  4U0V A;  3KP3 A;  4RAY A;  5AIP A;  3HYI A;  2EFN A;  5JVT A;  1XDU A;  3GW2 A;  2M5W A;  4NQW A;  4M6X A;  3IWF A;  2PQ8 A;  1LQ1 A;  1S29 A;  3TDU C;  2P4W A;  2QUF A;  2EB7 A;  2FBH A;  4KT5 C;  4HX4 A;  4UV9 A;  1QO0 D;  2NRA C;  3LST A;  1R00 A;  3R4K A;  2JT1 A;  5LHG A;  4DQ2 A;  4EQQ A;  2CSO A;  4ETS A;  1OMI A;  2DK5 A;  5ICE A;  1IF1 A;  1R1T A;  1H0M A;  2XGX A;  3NEU A;  2XHK A;  1GXP A;  1U8R A;  2R7F A;  1Q1H A;  5CLS A;  1JE8 A;  2VBZ A;  3H3U A;  3GLX A;  3BP8 A;  2KJC A;  1KYZ A;  2RQP A;  2A6E F;  1U5T C;  3QU6 A;  2Y48 A;  2P5V A;  1HKT A;  2HTS A;  3DXJ F;  1XMA A;  3BDD A;  1G4D A;  3M1E A;  2DW4 A;  2RGV A;  1XD7 A;  3R0A A;  3HSR A;  3C3W A;  1SFU A;  3TO9 A;  4MTE A;  2VT3 A;  2VT2 A;  3K2Z A;  3BJ6 A;  2K7L A;  1ZLJ A;  1IZ1 A;  3QRF F;  2CGP A;  4RAZ A;  2STT A;  4TV7 A;  4OIR F;  5E20 A;  2KJB A;  3K1P A;  2P5K A;  3ISP A;  1ZG3 A;  3E97 A;  1ONV A;  2JRT A;  1BJA A;  1IRF A;  3WTU C;  3H3Z A;  2R7D A;  1BI1 A;  2RN7 A;  2W57 A;  2DK8 A;  5H20 A;  2FXA A;  3DV8 A;  4HDV A;  1FYL A;  1FX7 A;  2ADU A;  2K02 A;  2Q0O A;  2P7C B;  2G7H A;  1ZRC A;  2HEO A;  1G3W A;  2QZ8 A;  3HHG A;  3F6O A;  3QP5 A;  3IC7 A;  3T8R A;  4LK1 F;  1P4W A;  3W6J B;  3DPT A;  5D6F A;  2Z3Y A;  3HHH A;  4CIC A;  3GVA A;  5FO5 A;  1B4A A;  1IN8 A;  1FP2 A;  2HFH A;  4IPA A;  2YU3 A;  2DQR A;  2WTE A;  5DD4 A;  3MWM A;  5E8G A;  1H9G A;  5JHU A;  4P55 A;  1EH6 A;  1SD6 A;  2FEZ A;  3GF2 A;  2W85 A;  1ON1 A;  5DUI A;  3F8M A;  1FSH A;  1YYV A;  5ERI A;  4GGG A;  1RUN A;  4ZZD A;  1ULY A;  4UVA A;  1T39 A;  4RGU A;  1K78 A;  1XMK A;  3KE2 A;  2Z5U A;  2J5P A;  3O2P E;  2V1D A;  4YFN F;  1KQ9 A;  4O3M A;  2L4A A;  5IT9 Z;  3WTS C;  5H6Q A;  2QQA A;  2FU4 A;  3LQQ A;  3QP6 A;  4GXO A;  1W5S A;  2JPC A;  4L5J A;  1R36 A;  1LNW A;  5CVR A;  1CF7 B;  3I53 A;  2ZME B;  2GXG A;  3WGI A;  2K4J A;  4G6Q A;  4I2O A;  1RNL A;  1BIB A;  4HBL A;  3R6S A;  1BC7 C;  2H6B A;  1LVA A;  4PGG A;  1TQP A;  1PUE E;  1HKQ A;  5LEJ A;  3E6B A;  4LMY A;  3G3Z A;  4L9T A;  4CO8 A;  1S7O A;  4M72 A;  2EJR A;  5KK1 A;  1O57 A;  3TDZ C;  4RB3 C;  4HLX A;  3J7A O;  1LEA A;  2NYX A;  1K78 B;  3P9K A;  3V7R A;  1XCV A;  4OIO F;  5FLX K;  3JSP A;  3T8T A;  3FF5 A;  5HS8 A;  5D8L B;  3ZP5 A;  2DQL A;  1GVJ A;  4HF2 A;  4OMZ A;  1W5T A;  1J9I A;  1D8K A;  1FLI A;  2ESN A;  2ZNZ A;  1L0O C;  3WE3 A;  4ENN A;  4ENK A;  2G9W A;  1DDN A;  2RVC A;  1FZP B;  1UST A;  3BY6 A;  4KYW A;  3ABT A;  3BPX A;  4M9S A;  2IA1 A;  2HKX A;  1IN6 A;  4A5N A;  4XRF A;  3P9C A;  1J59 A;  3KZZ A;  2BBY A;  4NB5 A;  1D5V A;  3HTU A;  2V1U A;  1HQC A;  2FSW A;  2IJL A;  5LRS A;  3BWG A;  3HRU A;  1YW9 A;  2JZY A;  4QWQ A;  3JTH A;  3LWF A;  4LFU A;  4I98 B;  4ESF A;  2QM3 A;  1R7J A;  2IA0 A;  2MBF A;  3IWZ A;  5HDN A;  1ZG1 A;  2QBY B;  2BV6 A;  3C1D A;  3LAJ A;  2XAF A;  1UHW A;  2O61 A;  1Z6T A;  2NNY A;  2CQK A;  5CVJ A;  1KU2 A;  3O3K A;  1XGN A;  1Z1D A;  5J6X A;  2PBI A;  1GXQ A;  2K4B A;  1O3S A;  1S3J A;  2L01 A;  2JPB A;  3V8L A;  4RB2 C;  4XLP F;  4EV0 A;  2A6H F;  1XSV A;  1ON2 A;  2XIG A;  4RGR A;  2ESH A;  1JHF A;  3HOT A;  1NHA A;  4D0P A;  1MD0 A;  4AD9 A;  1R1U A;  2VON A;  1TNT A;  4RB1 A;  2Z33 A;  2K86 A;  1LDD A;  4WXH A;  2HTJ A;  1B9N A;  2VN2 A;  2L3D A;  3WTX C;  2Y0M A;  2UXN A;  2LNB A;  1MKM A;  1U2W A;  2FMY A;  3IRR A;  4Z2Y A;  4YII A;  3EYI A;  4R79 A;  3FMR A;  1LDK B;  3K0L A;  1R5H A;  3MAJ A;  4LGW A;  3EDP A;  5E1Z B;  2P7V B;  2VBW A;  1AOY A;  4B09 A;  1CGP A;  5J8F A;  4EMS A;  3WTY C;  1LJ9 A;  4XBF A;  2L02 A;  4Q47 A;  4MTD A;  4LLG F;  4IJA A;  3DEU A;  3TO6 A;  2DTR A;  1A04 A;  1BC8 C;  2VE9 A;  3JTG A;  4G6D A;  4HLY A;  1R1V A;  5HVQ C;  3IRQ A;  2EWN A;  4AIJ A;  2LF7 A;  4MGR A;  5E17 F;  1T0F A;  2M8E A;  2H09 A;  1K7A A;  3R61 A;  2E1C A;  4EGZ A;  2A5Y B;  3KET A;  3FHZ A;  1X3U A;  2RNJ A;  2RV8 A;  3JAM K;  2VXZ A;  2EV5 A;  1KU3 A;  5LGT A;  1OYI A;  3CLO A;  4BHC A;  2JTV A;  2CYY A;  1SD5 A;  5D5U B;  2W84 A;  1P4X A;  4L9V A;  4I0A A;  5DV5 A;  2UXX A;  3Q9V A;  2A07 F;  3F8C A;  4KN4 X;  4A6E A;  2QYO A;  2IP2 A;  3QOP A;  3CUO A;  4QLC U;  3NRV A;  4WF2 A;  1ZHF A;  2OQG A;  3WTV C;  3W6K B;  4BXU A;  1F9N A;  1XSD A;  3J81 K;  2YX4 A;  4BAY A;  1ZN2 A;  3KLN A;  4G7H F;  1V3F A;  2HZT A;  4A5M A;  2GA2 A;  4EJT A;  5A2Q Z;  4PZJ A;  3J80 Z;  2X0L A;  1HW5 A;  5LGU A;  2A61 A;  1YG2 A;  3S2W A;  1BIA A;  2AXL A;  1J0R A;  2ZBK A;  3TKY A;  3HTS B;  3I5U A;  1FT9 A;  5D5X B;  1E2X A;  2EA4 A;  1STZ A;  5F6F A;  4MEX F;  4KMU X;  1TW2 A;  5FFX A;  4N9I A;  1ZGJ A;  1E17 A;  2RKH A;  1YW7 A;  3F8F A;  3L09 A;  3ULQ B;  2XAH A;  2D45 A;  4OIP F;  5ILS A;  3U2R A;  3RTR A;  1TTY A;  4L0Y B;  4EGY A;  5D4R A;  1ZRD A;  2XAQ A;  3EYY A;  3SZP A;  4PDK A;  3G73 A;  5CYV A;  5D8K B;  2ZNY A;  3K1N A;  3E6M A;  3V8J A;  3MFK A;  1QZZ A;  5LHH A;  5LLQ A;  2P8T A;  3HRM A;  2ISZ A;  1XGS A;  3HSE A;  2XKP A;  1KU7 A;  3GZ5 A;  4IRI A;  3ZN0 A;  4LG0 A;  1WRJ A;  2XVC A;  4AVP A;  2FQ3 A;  2XKO A;  4CHU A;  4FHT A;  4M9Z A;  4MQV A;  2ETH A;  3N97 A;  3TO7 A;  1UCR A;  3GUD A;  1MDM A;  2EFQ A;  4E70 A;  1IXC A;  4CXF A;  4KN7 X;  3RPQ A;  3V8K A;  2PI0 A;  3VFZ A;  2MLG A;  3GFL A;  3Q5F A;  5L3C A;  3PQK A;  2B0L A;  3WU1 B;  2CG4 A;  3I64 A;  2OZ6 A;  3ABU A;  3WU0 A;  2GQQ A;  3FMQ A;  1FY7 A;  2MD5 A;  5BQT A;  3KP4 A;  3E6D A;  3KZY A;  4HX8 A;  4O5V A;  4UV8 A;  2D1H A;  3VOD A;  2FNP A;  3F3X A;  3V7C A;  3AAF A;  1CF7 A;  2E7X A;  3I59 B;  2ZME A;  3JW4 A;  4LG0 B;  3B73 A;  5J8C A;  1QQI A;  4LLN A;  4HQE A;  3REO A;  4EVI A;  1U78 A;  4O6J A;  3QPT A;  2OAZ A;  4UHT A;  2Q8K A;  2E7W A;  3OV8 A;  3KCC A;  5TRD A;  1QNT A;  2FA5 A;  1G3T A;  1DP7 P;  4IHS A;  1V4R A;  2NNN A;  1QPM A;  1MDM B;  1K6O A;  4PGH A;  2XAJ A;  1HXD A;  3LAP A;  1LB2 A;  2FNA A;  4OOI A;  1XB4 A;  2OBP A;  2DPD A;  1W4M A;  1DPU A;  2E1N A;  1UFM A;  2ZJ2 A;  3BRO A;  4JQF A;  2M45 A;  4RB0 A;  1TQI A;  1OYW A;  2DT5 A;  4I0B A;  1FPQ A;  2FF4 A;  4Y15 A;  1MJ9 A;  5D5V B;  1ZGA A;  2H27 A;  3GFJ A;  4OMY A;  3F72 A;  1BBY A;  3MCZ A;  1FBQ A;  2IPQ X;  5E1X A;  5JI6 A;  4HF1 A;  2L54 A;  2HKO A;  2VE8 A;  3QPH A;  3SXY A;  2P6S A;  1U6G A;  3ECO A;  2A3S A;  3I54 A;  1TQM A;  1I6X A;  4L0Z B;  1O7L A;  3E3V A;  1PP8 F;  5L3B A;  2BYV E;  2P5L C;  4UUV A;  3IHU A;  5K1Y A;  4G94 A;  2QWW A;  3ROU A;  1KQ0 A;  2TDX A;  3BJA A;  1SD7 A;  4HF0 A;  4ZYH A;  5CVV A;  4UVB A;  3M8E A;  3ZMS A;  1T6S A;  1QGP A;  1FP1 D;  3OOP A;  5K5Q A;  2DU9 A;  2HOE A;  1W7P D;  3BPV A;  1JGS A;  2EV0 A;  3ZQ7 A;  3GFM A;  1YFH A;  2AS5 F;  3F22 A;  3ZMZ A;  1BI0 A;  1DPR A;  3RIR A;  1XGM A;  1ZLK A;  4ZZL A;  3HRT A;  3I58 A;  4KIG A;  2W25 A;  1YS7 A;  2QBY A;  2ZXJ A;  5E1W A;  4G7Z F;  1O3T A;  3IKT A;  4L18 B;  2G7U A;  1PP7 U;  2CWE A;  3DQV C;  3VEP A;  4RS8 A;  5DDG A;  3CJN A;  4OU0 A;  4EM0 B;  4LD5 A;  5HLI A;  1K79 A;  2QEN A;  1BN5 A;  5L3D A;  3KEO A;  4WCG A;  4N0B A;  2QVO A;  4ENJ A;  4Y13 A;  1T2K A;  3L9F A;  2XUB A;  2STW A;  2YR2 A;  5DCM A;  2DFI A;  1C0W A;  2EA2 A;  2F5E A;  2F2E A;  5HOO A;  3U1D A;  3ZMT A;  1EH7 A;  2PLY A;  3MQ0 A;  2FE3 A;  1PDN C;  1OYY A;  3GZ6 A;  3KP6 A;  1IUY A;  5HLH A;  3I71 A;  1IXR C;  4WX9 A;  3QU3 A;  2IVM A;  3MZH A;  3FWE A;  5LBQ A;  3RYR A;  1SD4 A;  2YX7 A;  2EK5 A;  3F8B A;  1BI2 A;  3R60 A;  1F1Z A;  4MNU A;  1TNS A;  1ZRF A;  3L00 A;  4BHP A;  4KMF A;  2UZK A;  5FB2 A;  1F4K A;  2GIV A;  1Z91 A;  2FBK A;  1H9T A;  4GYI A;  1Y0U A;  2XRN A;  4PCQ A;  2DO7 A;  5DUK A;  1LDJ A;  1ZYR F;  4WXC A;  1U3E M;  5HS7 A;  2ELH A;  2M1B A;  4ENM A;  3SZT A;  3DPL C;  4CZZ A;  5DCM B;  4AIH A;  4L5I A;  2DLL A;  1WKM A;  5FLX Z;  3M7G A;  2XRO A;  5CJ9 A;  4GCV A;  1SAX A;  2VOD A;  1S6L A;  3CTA A;  3DF8 A;  1Z9C A;  5E18 F;  1B9M A;  4UNO A;  3RKW A;  4M73 A;  3BZ6 A;  1J2X A;  3ZMU A;  4XLN F;  4LLL A;  5AIQ A;  4M9X A;  1EH8 A;  2HDC A;  1ZH5 A;  2KIF A;  1XDS A;  2OA4 A;  4A0Y A;  4JBA A;  3I4P A;  2V6C A;  4IF4 A;  1TW3 A;  4NHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...