4M74A

Mutant structure of methyltransferase from streptomyces hygroscopicus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHAFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGEYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 121
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m74A01
3W6KB 5FLXK 5H20A 3SZPA 3VEPA 3SXYA 2YX7A 4NQWA 4U0YA 4IPAA 2EA4A 3IKVA 1FP1D 5L3BA 3SHFA 4M9ZA 3D5LA 1E17A 1T38A 3DV8A 1G3SA 1ODDA 1P2FA 2GA2A 2KIUA 3FXRA 2J5PA 4LLNA 3HUGA 4ETSA 2F2EA 2AS5F 3HTUA 3HRTA 4M74A 2BEOA 4O5VA 1FSEA 4I02A 4EM1A 3P9IA 1R36A 3VB2A 2QUFA 2MA3A 2Q0OA 1Y0UA 4YFXF 2JT1A 1FNNA 4RAYA 3K0LA 3RTRA 4WCGA 2R7DA 3G73A 4HQMA 3MFKA 1JXSA 1YS6A 1ZRDA 4LK0F 1YO5C 4Y17A 4CICA 3BP8A 4RGUA 3U9GA 4ZYEA 1L3LA 3TOAA 5HLIA 3R61A 3R0JA 1U5TB 2P5KA 1HSJA 1SFEA 1Z05A 3MZHA 4OIPF 2VOOA 1KQ0A 1H9TA 4IF4A 2NNNA 3HHHA 4LGWA 3E5QA 3EDPA 4XSZF 2K7LA 5JFRA 2A68F 1IRGA 2QZ8A 3FMQA 3M1EA 1D3YA 2AXLA 4HAMA 3T8TA 4CDGA 4OIOF 1LEAA 1XGMA 3KCCA 2DBBA 5DV5A 3I54A 1DDNA 3ABTA 4QWQA 5L3EA 4BXUA 5HOOA 2DQLA 5HS8A 4MHGA 2XV4S 2HEOA 2DFIA 2QQAA 2BYVE 2MC3A 1HW2A 4Y15A 3QAHA 5E1ZB 3GO5A 2MH2A 2GIVA 3WTUC 1XSDA 4BHPA 3F8BA 4UNOA 1MZBA 4ZYDA 4WX9A 2F5CA 1XCVA 3DPTA 2GZWA 1G4DA 1P4AA 4CGZA 4LLLA 1PP7U 1GVJA 3HHGA 1YTYA 3QP5A 1EV7A 3R4KA 1H9GA 1OR7A 3SQNA 3E6MA 5E1WA 1O3SA 1HBXG 2IRFG 1IN7A 1YG2A 3FX3A 1IN5A 5L3GA 1FYLA 4G9YA 2HWVA 4OIRF 3EYYA 3K2ZA 2R7FA 3TQNA 3CUOA 2OAZA 2CW0F 4HZFA 1J0RA 1ZGJA 2EFOA 4G8XA 5ILSA 4HOBA 4N9IA 1QPMA 4ENNA 1V3FA 2F5DA 3B73A 1XDSA 2FNAA 4EV0A 3J80K 2V1DA 3KLNA 2EV6A 1W5SA 2XAQA 3GF2A 2NRAC 2ESHA 2Y48A 3V7CA 1RI7A 3HRSA 3RJPA 3CUQA 3HTSB 1OMIA 4AVPA 3WGIA 1Z1DA 2VODA 1S29A 2XROA 5E8GA 2PQ8A 1K79A 5FD5A 2ZCWA 2P7VB 1UB9A 1FBUA 5D8KB 2XAFA 3IC7A 1R23A 3WTYC 2DT5A 1SD7A 2M30A 3DF8A 2FQ3A 1SD6A 4LMYA 1ON1A 1E2XA 1I27A 2JRTA 5CJ9A 3TGNA 2OQRA 2JPBA 3T1BA 1R00A 3HIFA 2A3SA 4YFKF 3W6JB 2QLZA 1V4RA 4AWXB 4EJOA 4A2UA 3RKWA 5E18F 5E17F 3RYRA 2RNJA 3KP4A 3DP7A 4FT8A 3LQRA 3F8FA 1IW7F 5FGMA 4EVIA 3DQVC 1XB4A 5FD6A 4OINF 1F4KA 1DUXC 1FC3A 1J59A 3WODF 3FM3A 1K7AA 1W5TA 4HX8A 4G7HF 4ESJA 5JVTA 5HDKA 2QENA 1FX7A 2COMA 1Q1HA 3J81K 4BH9A 3WU0A 5BPIA 4IRGA 3BJAA 4EJWA 3RPQA 4PZJA 4RB0A 4U0VA 2OZUA 2M8EA 2R3SA 2FU4A 2DPDA 3JTHA 2H6CA 5A2QZ 3T8RA 4KIGA 2V79A 1QNTA 3HRMA 2YR2A 1CF7A 4MQVA 2K02A 2JSCA 2HOEA 5L3DA 2BGCA 4CO8A 3NEUA 3BOQA 1QO0D 4G7OF 3F23A 4HQEA 1MJ9A 4ZH4F 3TOBA 5D6EA 2P8TA 4WXDA 3SZTA 1U2WA 2PLYA 3MZYA 2Y0MA 1UHMA 4OU0A 1IXCA 2VC0A 4OMYA 2UZKA 1Z91A 2ZNYA 2QYOA 4ZZLA 2F5EA 3NQOA 1JHHA 1MDMB 1W7PB 4HF2A 2K86A 3H92A 1TQPA 3CLOA 2Z9OA 4FX4A 4JQFA 2H94A 4D0PA 3KP6A 3V7RA 5LEKA 1U3EM 3LAPA 3BWGA 3RPUA 1SMTA 4Q4ZF 1FT9A 4XRFA 3KETA 3J80Z 4B8XA 3I59A 2BV6A 4R8HA 2PEXA 1Z9CA 4HF0A 3I71A 3OV8A 2XUBA 4HX7A 3V4GA 2FEZA 1U5TA 4PGHA 1DPRA 4CYDA 5TRDA 3BPXA 2UXNA 6PAXA 1LDKB 2H27A 2HYFA 3IWFA 1I5ZA 2ADUA 1IAWA 3F21A 2LSOA 2NS0A 4KYWA 3Q9SA 4KUMA 3KZZA 4YIIA 3BZ6A 2LDUA 3LQQA 2ZMEB 4AD9A 4WWCA 2VXZA 4ENKA 3ML6A 3WTXC 2O61A 3HSEA 1JE8A 1F5TA 2RN7A 3CUQC 2FMLA 2VC1A 4P9UA 4KDPA 4LG0A 4LB6B 2D2WA 4IHTA 2J5OA 5LRRA 3E97A 3ZMZA 2ZBKA 1FZPB 2XKPA 3FMSA 3ISPA 4MQ9F 4ON0A 4L18B 1S6LA 5KK1A 5L3FA 5D5WB 2HYGD 1K78A 4I7HA 3J7AO 3EETA 5FLXZ 1B4AA 3GWZA 1OYIA 1QQIA 4HBLA 4DQ2A 1D5VA 1B59A 2XVCA 4TV7A 1U5TC 1OPCA 4JK1X 1SFUA 2XKOA 3J81Z 1YYVA 2W25A 2IA2A 1LJ9A 3CO6C 2XHKA 5CLSA 3F8MA 3V8KA 4LD5A 2ACJA 1TQIA 4KIBA 4ASNA 1PP8F 1TLHB 1U8RA 1WWXA 2O8XA 2EV0A 4YG2F 3BDDA 2VBWA 3EUHA 4L0YB 1HKQA 2HTSA 2B0LA 4IHSA 2MD5A 3ULQB 2STTA 4XLNF 4EJTA 1ZN2A 3IHUA 4P5OA 1H0MA 1NHAA 3SFZA 3LA7A 2ZMEA 1UFMA 1T2KA 3LSTA 3GFJA 3H3UA 3S2WA 2IVMA 3TO6A 1D8KA 5EEGA 2V9VA 1LEBA 1SD4A 4KT5C 3IKTA 4M72A 2GXBA 3LA3A 2HQRA 4O3MA 5DD4A 2G7HA 1IXSB 2BE5F 3QU6A 3E6DA 3K9TA 1G3WA 2W84A 3GFLA 3BPVA 4BHBA 3O2PE 3HOTA 3ERED 4KMFA 4NB5A 4HF1A 1R22A 1STZA 1IUYA 1ON2A 3TDUC 1ZRCA 1I1SA 3V7SA 5L3CA 2KKOA 3VFZA 2VOPA 1XCBA 3LWFA 3M7GA 4KN4X 3F8CA 1LDDA 3IRRA 4PGGA 3CTAA 3WE2A 1Z6TA 1CGPA 3M8FA 1W7PD 2MLGA 1IN6A 5D6FA 2A6HF 5DEQA 1MDMA 1XGSA 5DCMA 3LAJA 1SFXA 4HW0A 1W7PA 3ZN1A 3VODA 2RQPA 4R1HA 1IZ1A 2IW5A 4A0XA 5ICEA 1R1VA 2XAGA 3COAC 2EWNA 2RV8A 1LB2A 4UV8A 4RGSA 2Z5UA 3C1DA 4S04A 3KP2A 3CDHA 2ETHA 5HS7A 5FO5A 4GCVA 2PMHA 4OOIA 1YLFA 5LGTA 4XSXF 2PI0A 2M45A 4P9FA 1O7LA 5LHGA 1RUOA 4L9TA 4A6EA 2L01A 1ZREA 2D1VA 3RKYA 1KU7A 3WTVC 3ZQ7A 4Z2YA 1O57A 1TBXA 2PG4A 2BBYA 3E5UA 2HKXA 1KYZA 4AIKA 2HKOA 1DPUA 3MEXA 4YIFA 5FFXA 1UCRA 4P96A 5HLHA 4ESBA 4UHTA 3DXJF 4PDKA 2GA1A 5ERIA 1IN4A 2JZYA 3WTWC 1FYMA 5FB2A 2ELHA 1ONVA 5ILUA 1ULYA 1HQCA 1VTNC 3OOPA 4KICA 5DYMA 1UHWA 4MTEA 1P4XA 2QWWA 2Y75A 3QP6A 3P7NA 3GW2A 2RGVA 4KMUX 3FZVA 3QPHA 3HOSA 3RIRA 4FHTA 4LFUA 3MAJA 4CZZA 4HDUA 1R1UA 3C7JA 3GEZA 2QBYA 3MQ0A 2ZFWA 3R6SA 3R0AA 2WWYA 1HKTA 4M6YA 3TO9A 2OBPA 1L0OC 1G6NA 2YSRA 3ECOA 1ZG1A 1J5YA 2XRNA 4HLYA 4L0ZB 5ICFA 1ZARA 3M8EA 5IT9Z 5A2QK 3L9FA 4UXNA 2ZNZA 3ZMSA 1TTYA 1FLIA 3GZ6A 2CYYA 1YS7A 3BY6A 1RZ4A 2CO5A 4LLGF 1R7JA 1A04A 3MWMA 1EH8A 2E1NA 1BBYA 3HRUA 2IA1A 1YW8A 5HLGA 5AIPA 4I0BA 2CQKA 3I53A 2D1HA 3F22A 1U6GA 1QZZA 2VT2A 4L5JA 2NYXA 3I59B 1KU2A 5ICCA 3FWEA 4M9XA 4BYYA 2EFPA 2EFQA 2VT3A 5DCMB 2MBFA 3IWZA 2EK5A 3M9AA 5JR3A 4L9VA 2WV0A 1LQ1A 4EJVA 2V1UA 2UWMA 5K5OA 4G7ZF 1GHCA 5DCFA 4M6XA 4EJUA 2KRFA 3ABUA 5ILVA 2HQNA 2LF7A 4UUVA 1TW2A 2TDXA 5CVIA 1SD5A 1T98A 1P6RA 2G7UA 1LVAA 3QRFF 2FE3A 4KNYA 2A5YB 3ZMDA 3DPLC 3CUQB 2DTRA 1QBJA 2GQQA 2O3FA 1MKMA 1ZHFA 2FA5A 1S7AA 3DKWA 2JPCA 5F64A 3KLOA 5K1YA 4MEYF 3RYPA 3G3ZA 4U7DA 4U88A 1DP7P 2OD5A 2ZXJA 4EQQA 2DLLA 2V6CA 5J6XA 3ECHA 3MCZA 1D8JA 2QBYB 4CXFA 2FBKA 2LKPA 3FM5A 1MD0A 4BHCA 3P9CA 2A69F 4PCQA 3B02A 1XDUA 2DAOA 4U0WA 4Q47A 3GVAA 2ISYA 2W85A 1FPQA 3BJOA 5D5UB 1IN8A 1S3JA 2DK5A 2ISZA 2QQBA 2DI3A 4G94A 3T5XA 1F9NA 3GLXA 3T0YA 1C0WA 5ICGA 2K27A 3JAMK 1AWCA 3IRQA 4HYEA 1FY7A 3KP7A 5BOXA 4GYIA 4Q5SF 3I5UA 1I1GA 2Q8KA 5JHUA 4KFCA 3U1DA 1BI0A 1ZG3A 5FFZA 4N0BA 4F7ZA 2ZKZA 4GGGA 4I98B 3EYIA 5D5XB 3ZMVA 3L7WA 3I64A 2L3DA 3FF5A 4BQAA 4B09A 3PQJA 1T6SA 4HV6A 4LJZF 4A6DA 5HVQC 1U78A 4XLPF 1HW5A 3WGHA 2L4AA 4JBAA 1B9NA 3EQLF 2Z3YA 4Y13A 3GFIA 1B9MA 3KZYA 1O7FA 3O6BB 4M71A 1WI9A 1KU3A 2E7WA 5LLQA 4OIQF 2Z99A 4RB2C 2L54A 1R58A 2IJLA 5IT9K 4IVNA 2HFHA 3QOPA 5BPDA 4AIJA 4IRIA 4M73A 1XGOA 2CSOA 4L9JA 2CFXA 3L09A 3WU1B 1Z7UA 1OKRA 1RNLA 2W57A 3I4PA 3CO7C 4A0ZA 3F6VA 3I0TA 2P6TA 3WG9A 2PBIA 2KIFA 1T39A 1PDNC 2FSWA 4IRHA 2P7CB 1WKMA 4H0EA 5HS9A 1FWZA 2OQGA 2RVCA 2D45A 2A61A 2EFNA 1BI1A 1KQ9A 1LNWA 2X0LA 3ELKA 4MNUA 1FSHA 4MTDA 4HDVA 3C3WA 5LBQA 3JTGA 4P55A 1ZGAA 3K1MA 1USTA 2G9WA 2JTVA 4LK1F 2V1XA 3K1NA 4HLXA 2FBHA 5IT3A 2KIMA 3QPTA 3GFMA 4UVCA 3WE3A 2GWRA 3TDZC 2O0YA 4N9HA 4A5NA 1O3TA 2L02A 1XMKA 1HKSA 3FXQA 2ZO4A 2M5WA 5F6FA 3N4MA 5D5VB 3N97A 2W24A 5EEHA 5BS6A 3TKYA 5JI6A 4WXCA 2DQRA 3I58A 3LA2A 1BOAA 5CVRA 1WQ2A 2M1BA 2FMYA 4Q48A 1BC7C 5AONA 3JAMZ 1HW1A 2ZJ2A 3D0SA 3KEQA 2GXGA 4IXAA 3C18A 2STWA 2HTJA 3ZPLA 1ZRFA 1XD7A 5BMZA 1P4WA 5D4RA 4UVBA 2VBXA 2MH9A 1B6AA 1KYWA 3JSOA 1MJAA 2XASA 1EH6A 5E1XA 4NHJA 3NRVA 1USSA 3ZMTA 1ZH5A 3ZN0A 4M9SA 3F6OA 4HV5A 1FYKA 3WTTC 1I6XA 4YFNF 5TJJA 3E5XA 3HYIA 3V8LA 2A6EF 2VE8A 5BQTA 1BJAA 2E7XA 5E8IA 3WTSC 2DW4A 1BM9A 4I01A 5D4SA 2EFWA 5DD8A 4I0AA 2QVOA 4KIFA 1K6OA 2E1CA 2CWEA 2A07F 2CG4A 4I09A 2PMUA 4BAYA 5LRSA 3QU3A 1RUNA 1KU9A 4RGRA 1J2XA 3FXUA 3GXOA 5J8CA 1IF1A 4U7BA 3HSRA 2EV5A 1XMAA 2YX4A 4KA4A 2KJCA 3JW4A 3ZP5A 2LNBA 1QGPA 4O6JA 1KA8A 2GAUA 1ZAOA 3F3XA 2XAHA 3GX4X 2DK8A 1ZLJA 3RKXA 4EM0B 3E6CC 5CVJA 4UVAA 2HDCA 2VBZA 4ZYGA 2FF4A 4WXHA 1WRJA 3GZ5A 3LFKA 1RIOH 5H6RA 1IRFA 3K69A 2M87A 3FHZA 3RDIA 1BIBA 1XSVA 5LEJA 2RDPA 1JGSA 3WTZA 4RAZA 3DFGA 1HSTA 2O03A 1LDJA 2HR3A 1ZLKA 4QLCU 1TNSA 4IJAA 3FMRA 3BJ6A 3Q5FA 1R5GA 5ED4A 1R1TA 2MLKA 2O6GE 2DO7A 2XIGA 4EM2A 2XGXA 5K5RA 2NNYA 1O3RA 1G3TA 1QZYA 4WK8F 4WF2A 3PFIA 2OA4A 2EJRA 3AAFA 1MGTA 3E6BA 2QQ9A 2WC2A 3IL2A 4LB5A 1YW7A 2CGPA 1YW9A 4A12A 1REPC 5HDNA 1R5HA 2VN2A 4ZZDA 5LHHA 2H6BA 3DEUA 1G3YA 2L4MA 1SAXA 2IT0A 4GO1A 3GYHX 2VONA 5KVRA 1GXPA 1TQMA 3H3ZA 2WTEA 1XSXA 1P92A 1YQAA 4E70A 5K5QA 4ESFA 5DUIA 2YPRA 1O3QA 2ESNA 2RKHA 2VE9A 4FX0A 2RC4A 1BIAA 3F8NA 4EGZA 1TNTA 2HGCA 3U2RA 2P5LC 1KGSA 3TO7A 1HXDA 1XGNA 3KP3A 2DU9A 3JSPA 3KE2A 4L5IA 2LF8A 3ZMUA 4KN7X 5HDGA 3GUDA 4MGRA 4UV9A 4RS8A 2VBYA 4G6QA 4RB1A 5LGUA 2F5FA 2P5VA 1K78B 2FBIA 3CJNA 2DPUA 2NAZA 2QM3A 3L00A 1SMYF 2PJPA 3Q9VA 3ROUA 1OYWA 1B1BA 2IPQX 1CF7B 4RGXA 5CVVA 1FBQA 2FRHA 1ZG5A 1XN7A 4G6DA 4DNCA 5H6QA 1BI2A 1X3UA 4HA8A 3V8JA 1J9IA 1FBSA 3F72A 2UXXA 1S7OA 2EB7A 3L2CA 1ZYRF 2XAJA 2PN6A 1PUEE 1BC8C 5F1RA 2H09A 4GXOA 1J7KA 5E20A 4K2EA 4EMSA 4S05A 5CVUA 5LHIA 4BNCA 3REOA 2FOKA 1J75A 3KFWX 4MEXF 2FNPA 5DDGA 4L9NA 1AOYA 1BN5A 1EH7A 1YFHA 4R79A 3E3VA 2OU2A 3K1PA 4CHUA 2K4JA 5D8LB 2OZ6A 1FOKA 3PQKA 5J8FA 1OYYA 2HS5A 4HX4A 2Q2EA 3R60A 3BROA 4ENJA 1BI3A 5DUKA 2KJBA 2P6SA 2C6YA 1Z6RA 3RI4A 3O3KA 2EA2A 4LG0B 2IP2A 5LGNA 4AIHA 1IXRC 5AIQA 3HSFA 1GXQA 1MJBA 2PFBA 1S8NA 1W4MA 2YU3A 1F1ZA 4OMZA 1TW3A 5CYVA 3VOEA 4XBFA 1FP2A 2HZTA 4A0YA 1T0FA 2P4WA 4GYGA 1JHFA 4I2OA 2FXAA 1YIOA 3WGGA 1WSUA 1KQ8A 4ZYHA 3KP5A 3P9KA 4ENMA 2X4HA 4A5MA 4RB3C 3KEOA 2IA0A 4EGYA 2Z33A 2K4BA
chains in the Genus database with same CATH superfamily
3W6KB 1MIJA 5H20A 4IO9F 3SZPA 3VEPA 3PNVA 3ZQCA 5FLXK 3SXYA 2ECBA 2YX7A 4NQWA 4U0YA 4IPAA 2EA4A 3IKVA 1X2MA 3I56I 1FP1D 5L3BA 3SHFA 2LD5A 4RAGA 4XR6A 1D0YA 4M9ZA 3D5LA 3IH2A 1E17A 3S16J 1T38A 3DV8A 1G3SA 2KDOA 1ODDA 1P2FA 2GA2A 2KIUA 2QKLB 3FXRA 2J5PA 4DBQA 1R71A 4XLHA 4D5FA 4LLNA 2OF7A 2M0CA 3HUGA 4ETSA 2F2EA 2WADA 2AS5F 1I6HJ 3HTUA 2LRDA 3HRTA 4M74A 3RSNA 4ZJZA 2BEOA 4O5VA 3FXJA 1NK2P 1FSEA 2VJJA 4I02A 5GADJ 2VXDA 4EM1A 3P9IA 1R36A 2NS7A 4M3FA 3VB2A 4BEHB 2QUFA 1U8BA 2MA3A 4M3DA 2L5QA 2Q0OA 1HC8A 1Y0UA 1Q1VA 4YFXF 2JT1A 3A01A 1FNNA 4RAYA 3K0LA 3RTRA 4WCGA 1V55H 5M3MJ 2R7DA 2O9LA 3G73A 4HQMA 3LNQA 3CCLI 2Y69H 1DU0A 5HLTA 3MFKA 1JXSA 1YS6A 1ZRDA 1MH4A 4LK0F 1YO5C 4Y17A 1JUSA 4CICA 4PK4A 4Y3OA 5CQEA 3BP8A 4RGUA 1X1AA 3U9GA 4ZYEA 3TOAA 1L3LA 3DCFA 3R61A 3R0JA 5HLIA 1U5TB 1Y56A 1FMWA 2P5KA 1IRZA 1HSJA 1SFEA 4RBOA 1Y8QB 1Z05A 3MZHA 2BVLA 4OIPF 2VOOA 1KQ0A 5JVGF 3FXKA 1H9TA 4IF4A 2NNNA 3M07A 2ZSHB 3HHHA 1MSFC 4LGWA 3E5QA 3EDPA 3S1MJ 4XSZF 2K7LA 5JFRA 3UR3C 2JA7J 2A68F 1G59A 4NC7A 2KMUA 1X1BA 1QU3A 1IRGA 1TT5B 4II3A 1HF0A 2QZ8A 3FMQA 3M1EA 1D3YA 2AXLA 2HPMA 4HAMA 3T8TA 4CDGA 4OIOF 2TCTA 5HODA 1LEAA 2VKDA 4A69C 1XGMA 3KCCA 2ID3A 2DBBA 5DV5A 2M34A 3I54A 1DDNA 2HDDA 3ABTA 2R0QC 1VQLI 4QWQA 5L3EA 3BR0A 4BXUA 5HOOA 2DQLA 5HS8A 1RRJA 3KYCB 4MHGA 1M1EB 4FCYA 2XV4S 5H2FC 2HEOA 2DFIA 2QQAA 3K4LA 2BYVE 1X3WB 2MC3A 3CJTB 4Y15A 1HW2A 3QAHA 2EH3A 5E1ZB 3GO5A 1X58A 1K61A 3Q0UA 2MH2A 5JLXA 3VYUB 1TWFJ 4A3EJ 2R7QA 5EG0A 1XTAA 1LFPA 2KRCA 2GIVA 3WTUC 1XSDA 4BHPA 3F8BA 4PUSA 3HB9A 4UNOA 1MZBA 4ZYDA 4WX9A 2F5CA 1XCVA 5TISC 3DPTA 2IBDA 4A3GJ 2QCOA 2GZWA 2DMUA 1G4DA 4A3DJ 1P4AA 4CGZA 4LLLA 2V4JC 1PP7U 1GVJA 1FOXA 1POGA 2K5CA 1I3AA 3TBIA 3HHGA 4BEHA 1OISA 1YTYA 1K4TA 3QP5A 1EV7A 3R4KA 1H9GA 1OR7A 3SQNA 3E6MA 1A35A 3M4OJ 3E7LA 2JSPA 2JVHA 5E1WA 1O3SA 1HBXG 5LFAA 2IRFG 2HPIA 1IN7A 1YG2A 2P81A 2XC7A 3FX3A 2DTZA 1IN5A 5L3GA 1FYLA 4XLCA 2X6YA 3BCAA 4G9YA 2HWVA 3LSMA 4OIRF 2RAEA 2DT6A 5C4XJ 4MFEA 1MSEC 1X1PA 4JX5A 2HQ5A 3EYYA 3K2ZA 2R7FA 4BY7J 3TQNA 3CUOA 2OAZA 2AXTC 2CW0F 4HZFA 3HOWJ 4BBSJ 5B1AH 1MBFA 1J0RA 1ZGJA 2EFOA 2E1OA 3HM5A 1ETWA 1FOWA 4G8XA 2CQQA 4BXXJ 2MGQA 5EZGA 4DYCA 3A0BC 5ILSA 4HOBA 4N9IA 1QPMA 4ENNA 1V3FA 2F5DA 3B73A 1SAUA 1XDSA 3D5SC 4CCLA 2DA2A 3Q3SA 2FNAA 4EV0A 3OYAA 3J80K 2V1DA 3GTMJ 3KLNA 2EV6A 1W5SA 2XPVA 2KISA 3QODA 3S2DJ 1OCZH 1IDZA 2XAQA 3GF2A 2NRAC 2ESHA 2Y48A 2WAEA 1TWHJ 3QPSA 3V7CA 2IS2A 3ZRGA 2V26A 1RI7A 3HRSA 3PNYA 4ZYAA 2XF7A 3RJPA 3CUQA 3HTSB 1OMIA 4AVPA 3WGIA 1Z1DA 4HNTA 2JA8J 3ONQA 2XRLA 4ITVA 2VODA 1S29A 2XROA 1N25A 5E8GA 2PQ8A 1K79A 5DS9A 1YRNA 5FD5A 3K70D 4CCOA 3KPHA 2ZCWA 1DU6A 5KAIC 2P7VB 1UB9A 1FBUA 1ETQA 5D8KB 2LFBA 2XAFA 5FKOA 3IC7A 1R23A 2HXOA 3RQIA 3WTYC 2DT5A 1SD7A 3BQZA 2M30A 3DF8A 4ZC3A 2FQ3A 5IP9J 4BDYA 1R9TJ 1SD6A 1OCOH 4AYBA 4D5CA 4LMYA 5J4VA 2HDWA 1ON1A 2A5WA 2IGNA 3JRDA 3ABMH 1E2XA 1I27A 1E3HA 1W5CC 4E7SA 2JRTA 1Y39A 1JTYA 5CJ9A 4AUXA 3TGNA 1OR7C 2OQRA 2JPBA 3RCOA 3T1BA 2LY9A 1VQ8I 1R00A 3HIFA 2ELKA 3U1KA 2A3SA 4YFKF 1A5JA 3W6JB 2QLZA 1V4RA 4AWXB 4EJOA 4A2UA 4PJMA 4YRVA 3RKWA 4RDUA 5E18F 1DP3A 2DA4A 4E7ZA 5E17F 3RYRA 2VLAA 3ZXSA 3B6CA 2RNJA 3M8JA 3KP4A 3DP7A 2FUG2 3G1LA 4FT8A 2VASA 3LMMA 3LQRA 3F8FA 1IW7F 5FGMA 4C3JJ 4EVIA 2L9RA 3DQVC 1XB4A 5FD6A 2JUCA 3EUKL 4OINF 2WB1A 3FKIJ 3J7AY 2K9QA 5M5XJ 4A3LJ 4F92B 1F4KA 1DUXC 1FC3A 1J59A 3AL0B 4BS9A 3WODF 4B3AA 3FM3A 1K7AA 3HOYJ 3OIQA 1W5TA 3AG3H 3TEDA 2DOAA 3CQZJ 3HGGA 2E1MC 4HX8A 4G7HF 2E2IJ 4ESJA 1Y1VJ 5JVTA 2NVTJ 1VQ9I 1TWGJ 5C44J 5BNGA 5HDKA 2QENA 2VI6A 1FX7A 2COMA 4J19A 4XKCA 1DGRM 1Q1HA 3J81K 4BH9A 2E36A 5B66C 5IP7J 3WU0A 5BPIA 3I3LA 4IRGA 3BJAA 4XL9A 1OCCH 4EJWA 5KNLA 3RPQA 3HL2A 2L0KA 3EUAA 4RMNA 2BY1A 4PZJA 4RB0A 4U0VA 3OIOA 2CUEA 2OZUA 2M8EA 2R3SA 2FU4A 2LYCA 3H0DA 2DPDA 2W00A 3JTHA 2K3PA 5E3MA 4J01A 1UHSA 4IHWA 2F5VA 2H6CA 5A2QZ 2GIZA 3T8RA 4HEA2 5F0CA 4KIGA 2V79A 1QNTA 3HRMA 2YR2A 1CF7A 3BG9A 4MQVA 4G12A 1X1CA 5EDNA 1MBEA 2K02A 4BXFA 3H3VK 4X6AJ 5FLVA 2JSCA 3OS2A 4BE1A 2HOEA 2DMTA 4V2GA 2O7OA 5C4JJ 3L2RA 5L3DA 1N75A 2BGCA 4CO8A 3NEUA 3BOQA 1QO0D 4G7OF 3F23A 2JRMA 4A3CJ 2V1NA 1F36A 3JRBA 4HQEA 2Z16A 2NVUB 4BDZA 1QHGA 1MJ9A 2KP6A 2QA4I 1LFBA 4ZH4F 3TOBA 4CZCA 5D6EA 2P8TA 2JMWA 5HNHA 4WXDA 3G4SI 3SZTA 1U2WA 2PLYA 3MZYA 2Y0MA 1UHMA 4OU0A 1IXCA 2DDAA 1MMGA 2VC0A 4OMYA 1KZHA 2UZKA 1JJ8C 1LKXA 2CUFA 2WAFA 1Z91A 3CCYA 2ZNYA 2QYOA 4ZZLA 2DFFA 2F5EA 3NQOA 1JHHA 3BR3A 1MDMB 1W7PB 5GAHJ 4HF2A 2DFHA 1PJRA 2K86A 4GRIA 3H92A 1TQPA 2M9HA 3CLOA 2Z9OA 4FX4A 4QPOA 1Y8RB 4JQFA 2H94A 4D0PA 3BG6A 3KP6A 3V7RA 3H5AA 5FJ8J 1MNDA 5LEKA 1U3EM 3LAPA 3BWGA 3RPUA 1LE8A 1SMTA 3CP8A 4Q4ZF 1FT9A 4XRFA 4QPQA 2NOJB 1NTCA 3KETA 3J80Z 4B8XA 2EZLA 3I59A 2HOTA 2BV6A 4R8HA 2V6EA 2A05A 1WJFA 2R7OA 5KAFC 2PEXA 1V54H 2JJ7A 3BTCA 4HF0A 4HSRA 1Z9CA 4P1WA 3OYHA 3I71A 3AG2H 2VQHA 3OV8A 2XUBA 4HX7A 3V4GA 2FEZA 1U5TA 1JI8A 1D0XA 4PGHA 1DPRA 1S7EA 3OOUA 2R7TA 4XK4A 4CYDA 1IGNA 5TRDA 1Y1WJ 3BPXA 2UXNA 6PAXA 2L9VA 1LDKB 5F04A 1X4OA 2H27A 2HYFA 4PSWA 2ZXHA 3IWFA 1I5ZA 4W97A 2ADUA 2ZJQF 1IAWA 1OLTA 2F4OB 1R5ID 2EILH 3F21A 2LSOA 2UUZA 2E71A 2NS0A 4KYWA 3AFHA 2XGEA 3Q9SA 4KUMA 3OYLA 1JKOC 3VSKA 3IV5A 1Z0XA 1ZR4A 3KZZA 2KZGA 4YIIA 1FTTA 1S9HA 3BZ6A 2LDUA 4OAZA 3AG4H 1R4MB 3CMMA 1RKTA 2L9NA 2AQFA 3AKZA 4MIMA 3LQQA 4CCNA 2ZMEB 5K7HA 4AD9A 4WWCA 2VXZA 2NVQJ 1W1WE 3MZ8A 4ENKA 3SEZA 3ML6A 3WTXC 4XORA 5FKMA 2XF5A 4II2A 2O61A 4UY8I 3HSEA 1JE8A 1F5TA 2RN7A 3CUQC 2FMLA 4CA0A 1P7JA 2Z1DA 2VC1A 4B4CA 4P9UA 4FETA 3ZQQA 4KDPA 5IOYA 3S2HJ 3J7ZI 3H35A 2EPFA 4LG0A 4LB6B 2D2WA 2ZMEC 2F4MB 4G6TB 3RQ4A 3KX2A 4ANJA 5FKLA 4KITB 4IHTA 2J5OA 2VQLA 2KIQA 5LRRA 2YU9J 1I50J 4PJJA 1RR7A 3E97A 3ZMZA 2DA1A 2ZBKA 1FZPB 4BKXA 1LFUP 4E7HA 1GV5A 2XKPA 3VYRB 2Y9ZA 3FMSA 4IQ4A 3ISPA 4MQ9F 4ON0A 4XKVA 4L18B 2R7UA 1S6LA 3H1CA 3NAUA 1AA7A 5KK1A 5L3FA 1B8IA 1Z77A 5D5WB 2HYGD 5CKTA 3FIWA 1K78A 2R7XA 4I7HA 3G1OA 3J7AO 3BZCA 3EETA 3KEYA 5FLXZ 1B4AA 2VJIA 1SEUA 1TL8A 3GWZA 3OYIA 1A31A 1OYIA 1QQIA 4HBLA 2BY3A 4NBQA 1JKRC 2A6TA 1QRYA 2VB6A 4EEFG 4DQ2A 2WBMA 4FQGA 1D5VA 1B59A 3CMEI 2XVCA 4TV7A 1U5TC 1OPCA 4MLOA 1GUUA 1VZ0A 4JK1X 1SFUA 2AHQA 2CRGA 2DODA 2XKOA 2HOAA 4ZDLA 3J81Z 1TT0A 2ELJA 1ITYA 1YYVA 2CS3A 2W25A 2IA2A 3K4BA 1LJ9A 1ZK8A 4ABZA 3CO6C 4DGWB 2BY2A 3HKZN 1WJEA 2XHKA 5CLSA 3SZGA 5EYRA 1A6QA 4F93B 3F8MA 3V8KA 4LD5A 4A93J 1MBHA 2ACJA 2K3FA 2L7ZA 1TQIA 1TWCJ 2LBFB 4KIBA 4ASNA 1PP8F 4XLAA 1IV8A 5GPCA 3PUBA 3K4JA 1ZR2A 1TLHB 4XKBA 1U8RA 1WWXA 3GZNB 2O8XA 3H0GJ 3UKGA 2X6WA 1MMNA 2EV0A 2ZXWH 4DYRA 4YG2F 3BDDA 2OC6A 2VBWA 3EUHA 1YX5A 3MKZA 4L0YB 1BOBA 4CCMA 1ETVA 1HKQA 5J4YA 2KDZA 2HTSA 1VF9A 3BG3A 3K4CA 2B0LA 4IHSA 2MD5A 1J09A 2IGOA 2HYJA 3ULQB 2STTA 1PYVA 4XLNF 4EJTA 2WY7Q 1ZN2A 3IHUA 2HVRA 2COBA 2XB0X 4P5OA 4NQWB 1H0MA 1NHAA 1Y6IA 3SFZA 1G8XA 1V5EA 5KCMA 3LA7A 4BJ5C 2ZMEA 2L9SA 1UFMA 1T2KA 1APLC 1YIJI 2XPWA 3LSTA 3GFJA 2X1DA 3HXLA 3H5NA 3H3UA 3S2WA 2IVMA 3GMEA 3BZKA 1D8KA 3TO6A 2PX9A 2WA0A 3PSFA 1X19A 5EEGA 2V9VA 5K7ZA 1LEBA 3HPGA 1SD4A 4KT5C 3OYEA 3IKTA 4M72A 2GXBA 3WG7H 2MD0A 3LA3A 3CJQB 3W2WA 2HQRA 2K9NA 4RLQA 4O3MA 5DD4A 2G7HA 1IXSB 2BE5F 3QU6A 4XICA 2ID6A 1ERDA 4A3JJ 3E6DA 3K9TA 1G3WA 2W84A 4PFPA 1JUMA 3GFLA 3DTIA 1BR2A 3BPVA 2PJRB 4BHBA 2MG4A 1D5YA 3O2PE 3HOTA 3ERED 1ETKA 2MW8A 4KMFA 4BJ6C 2IGKA 2FX0A 2V9KA 4NB5A 3ZOBA 3PO2J 1RC9A 4B47A 1R22A 4HF1A 1MNEA 4V2FA 2E34A 1STZA 1IUYA 4JP0A 1ON2A 2DXIA 3TDUC 1ZRCA 1RESA 1I1SA 3DTKA 3V7SA 5L3CA 2KKOA 4D9JA 3VFZA 2QSGX 2VOPA 1XCBA 2CQ7A 3LWFA 3M7GA 4KN4X 3F8CA 1LDDA 5B5EC 3IRRA 2GLOA 4UUSB 4RLFA 4PGGA 2ZSIB 3CTAA 4ZDPA 1VQNI 4CUGA 3G1MA 1FIPA 3WE2A 2VUMJ 1WI3A 1Z6TA 3S14J 4XQFA 1CGPA 4GDFA 2QGUA 1ETOA 3FK7A 3M8FA 1W7PD 2WV1A 2MLGA 1IN6A 5D6FA 1IV6A 3PUFA 2NVYJ 1JT6A 2A6HF 1B72A 1FJLA 1DGWY 5FLMJ 1F43A 1QZEA 5DEQA 1MDMA 3SJMA 1XGSA 5DCMA 4QTRA 3DBRB 1SFXA 4HW0A 3OS1A 1W7PA 3LAJA 3ZN1A 3VODA 2L2OA 2RQPA 1KONA 4R1HA 3D1NI 1IZ1A 2IW5A 4A0XA 5ICEA 2R5ZA 1R1VA 2F4IA 4EATA 2XAGA 3COAC 2EWNA 2RV8A 1IO2A 1LB2A 1BR1A 3OYCA 4JOMA 2LK2A 4UV8A 2E60A 4RGSA 2Z5UA 3C1DA 4A3KJ 3BR5A 4S04A 3KP2A 3CDHA 2ETHA 3FKJA 5HS7A 3A02A 3QPLA 4XLFA 5FO5A 4B1RA 2LP0A 1UG0A 2PMHA 3IH3A 4GCVA 2R7VA 4OOIA 1YLFA 2KT0A 3TP0A 1NG6A 3OYGA 5LGTA 4XSXF 2PI0A 2M45A 2Y2ZA 1WH5A 1O7LA 4P9FA 1WJBA 2LOOA 5LHGA 1RUOA 4IKFA 4L9TA 4A6EA 2L01A 1ZREA 2D1VA 4XRSA 1MMSA 3RKYA 1ACIA 4AU7A 2ME0A 5M3FJ 1KU7A 3VYTB 2BHYA 4HNVA 3WTVC 3ABKH 3ZQ7A 2B7EA 4Z2YA 2VPLA 1JTXA 3H9JA 5E3NA 3K70C 3A03A 1O57A 1TBXA 4AIDA 1GLNA 2EIJH 2RREA 3MD2A 2PG4A 1RR8C 3HOUJ 5J3LA 4DBRA 2BBYA 3FDYA 2L7FP 3K4MA 2CW8A 2TRTA 3E5UA 1LUJB 2HKXA 1KYZA 4AIKA 2HKOA 1HA8A 1DPUA 3CCVI 1X4PA 1RETA 2XAUA 2XGDA 3MEXA 4YIFA 5FFXA 4E7KA 3BTLA 1HLVA 1UCRA 4P96A 5HLHA 1VQ4I 2PMZN 1WCMJ 1BW6A 4ESBA 4UB8C 2O5RA 4X0GA 5J1YA 1T08B 3ZP5A 4UHTA 3DXJF 1D1AA 2E5NA 1OJLA 3F9KA 4PDKA 4YEJA 4XRMA 1V5GA 2X1CA 3JR9A 4IX7A 2GA1A 2VPRA 5ERIA 1IN4A 3DLAA 2JZYA 3K2AA 3WTWC 5LD2C 1FYMA 4I99C 5FB2A 1WHUA 2ELHA 1ONVA 2EIMH 4B3XA 5ILUA 1XG1A 1JKPC 1ULYA 2K9LA 1UMQA 3S93A 1HQCA 4BUPA 2R7SA 1VTNC 3OOPA 2EZKA 1E3PA 1VQ5I 3SFIA 4KICA 2RNGA 2LR8A 5DYMA 3LSJA 2JQ7A 5F27A 2Y0SA 3S1RJ 1UHWA 4MTEA 4ZDOA 1P4XA 3I55I 1HOMA 2QWWA 2Y75A 3QP6A 3P7NA 1XC5A 3ZQIA 2GXAA 4ZTJA 3GW2A 4B43A 2RGVA 2W48A 2DOEA 1RKWA 4KMUX 3FZVA 4BU2A 3QPHA 3HOSA 2K9MA 3RIRA 3L1PA 1JUPA 3DPUA 4FHTA 4LFUA 1ZQ3P 1PUFB 3MAJA 4CZZA 4HDUA 1R1UA 4Z6YA 5CQGA 2EIKH 2R93J 4LITA 4HSTA 3JRHA 2R5ZB 3HOVJ 3C7JA 3S17J 2OPTA 2VJ5A 2X6XA 2IS6A 2M0MA 3GEZA 2QBYA 3OL3A 3MQ0A 3S32A 1BJZA 2ZFWA 1E0EA 1MNMC 4A3FJ 3R6SA 3R0AA 2WWYA 1HKTA 3DEEA 4M6YA 2OBPA 3TO9A 3H5RA 1L0OC 1VNDA 5CPRB 4C2UA 3G6EI 3EUHC 1G6NA 2DYSH 2YSRA 3ECOA 3CC7I 2Z2SB 1ZG1A 1BA5A 1J5YA 2XRNA 4HLYA 2HVSA 4L0ZB 4PJ0C 5ICFA 5FKNA 1ZARA 3M8EA 5IT9Z 1P7IA 2LG4A 5A2QK 3L9FA 2NVXJ 4UXNA 2LKSA 2ZNZA 3ZMSA 3CCJI 5FROA 4C2MJ 1TTYA 3H36A 2VQGA 1FLIA 3GZ6A 2CYYA 1YS7A 1K6YA 1RZ4A 2E5ZA 3BY6A 1FMVA 2CO5A 4E4HA 2JVGA 1T33A 4D1QA 4LLGF 1R7JA 1A04A 3MWMA 1EH8A 2E1NA 2DYRH 2KZVA 2K85A 3K10A 1BBYA 1SVLA 3HRUA 2IA1A 5FRMA 3ZR8X 1YW8A 1OFCX 1B8IB 1WH7A 4BACA 5HLGA 1SVMA 4NNJA 1VQ7I 1U0JA 5AIPA 3TW7A 3HZJA 3PL8A 2CQKA 3I53A 4I0BA 2D1HA 1W0UA 3C2BA 2CV1A 3S8PA 1X1DA 3F22A 1U6GA 3HKZA 2QSHX 5E3LA 5J40A 4LIUA 1QZZA 2VT2A 3K4NA 4L5JA 2NYXA 3H9GA 1ZTRA 1ENHA 3LOCA 3OSGA 4PSXA 2CV2A 2VKHA 4I6ZA 5IYDJ 2HI3A 2ZJRF 3ZQLA 3I59B 1KU2A 5ICCA 1Z21A 1ETYA 1Z3XA 3QYBA 3FWEA 2DT7B 5IYBJ 3JRCA 1E3OC 4M9XA 2PJRA 4BYYA 2EFQA 1UZCA 2EFPA 1Z3YA 3IP4B 3HDDA 2VT3A 5DCMB 2MBFA 3IWZA 2KHMA 2EK5A 3M9AA 5JR3A 4L9VA 3RZDJ 4Y4RA 2WV0A 3S3OA 1WVRA 4AYBN 1GT0C 4RM3A 3OSFA 2P0WA 1LQ1A 4EJVA 2V1UA 1PVEA 3CLQA 4BJTA 4D7MA 2UWMA 4Y33A 5K5OA 1YJ9I 1VQKI 4G7ZF 2LTPA 3LFUA 2K40A 5DCFA 4M6XA 4EJUA 2KRFA 1GHCA 3ABUA 3S1NJ 4XN3A 5ILVA 2HQNA 2LF7A 5FRNA 2M4GA 3KIOA 4UUVA 1TW2A 2TDXA 5CVIA 1SD5A 2ECCA 4IL6C 4W1UA 1T98A 4AM3A 2MABA 1P6RA 2G7UA 2CFOA 1LVAA 5F08A 2M8GX 2EQRA 3QRFF 2FE3A 3PM1A 4KNYA 4RM2A 2G0EA 1WJDA 1AU7A 2A5YB 3ASNH 2VKEA 1FEXA 1ZELA 3ZMDA 3DPLC 2HXIA 3CUQB 2HU9A 3L2VA 2DTRA 4DIQA 2ZXIA 1QBJA 2DJIA 2HOSA 1SANA 2GQQA 2O3FA 1MKMA 1ZHFA 2FA5A 3ZQGA 1S7AA 3DKWA 3LSHA 2JPCA 2H1KA 5F64A 3CESA 3KLOA 3S1QJ 5K1YA 4E7IA 4MEYF 3RYPA 3OYDA 3S3NA 3G3ZA 2EZHA 2E19A 4LOCA 4U7DA 4U88A 1DP7P 2OD5A 4JX6A 4E6KG 1IUFA 2JK3A 3M3YJ 4J00A 2ZXJA 4EQQA 1VFCA 2DLLA 2V6CA 1AKHB 1X2NA 5J6XA 3ECHA 3MCZA 1D8JA 4HG2A 2QBYB 2DMNA 4CXFA 2KFDA 2DA6A 4CYCB 1MW7A 2FBKA 4UUSA 1GVDA 2ICWG 2LKPA 3FM5A 3FBNB 1MD0A 1A36A 2KRHA 5B1BH 1V5FA 3BQYA 3QYEA 4BHCA 3P9CA 2A69F 4PCQA 3B02A 2K9SA 1XDUA 2DAOA 1QPIA 4U0WA 2OCCH 1A6IA 3K7AJ 4Q47A 3GTQJ 2DFEA 3OYJA 3GVAA 1YHQI 2ISYA 2W85A 3LSPA 1FPQA 3BJOA 5D5UB 1IN8A 1S3JA 2DK5A 2ISZA 1DQUA 3A4CA 2QQBA 3W6VA 2DI3A 1HCRA 4G94A 1OCPA 3T5XA 2XSDC 1F9NA 3GLXA 3GLLA 3T0YA 3OS0A 1C0WA 5JHFA 1WJCA 2V7FA 5ICGA 2K27A 3JAMK 3BG5A 1AWCA 3IRQA 4HYEA 1FY7A 3KP7A 5BOXA 4GYIA 1RPWA 4Q5SF 3I5UA 2FQ4A 1QHHD 2JA2A 3GTKJ 1EA3A 2YS9A 4CH7A 4IHYA 3P5JA 1I1GA 3NWSA 5J47A 2Q8KA 2VKVA 5JHUA 1W36D 3OYMA 1N78A 1FTZA 3HJEA 4KFCA 3W2VA 3U1DA 1BI0A 3OYFA 5JLWA 4E7LA 2ZC2A 1ZG3A 5FFZA 4N0BA 2N8GA 1K83J 3D5RC 2AQEA 4F7ZA 3HUGB 2B9SA 2ZKZA 5K7FA 3MVPA 1SVOA 4GGGA 4I98B 3EYIA 5D5XB 3ZMVA 3L7WA 3I64A 5HNFA 4IZZA 3HG9A 2Y9YA 2L3DA 3BCBA 2QKMB 1TWAJ 2VL8A 2LY2A 2ZFUA 3FF5A 4BQAA 1OQYA 4B09A 3PQJA 3JRFA 4CCJA 4QSHA 2I8DA 5FKKA 4C3IJ 1T6SA 2EINH 5DTDA 4HV6A 4LJZF 5C3EJ 1UAAA 4A6DA 1IC8A 1NK3P 5HVQC 1U78A 2F6CA 1HW5A 4XLPF 4M3EA 2L4AA 2VIXA 4JBAA 1XMXA 4MFDA 3WGHA 3VSLA 1B9NA 2ZJPF 3QOEA 2MYSA 3EQLF 2Z3YA 4Y13A 3GFIA 3AL0C 1B9MA 3KZYA 2E35A 1O7FA 3PSIA 3RKQA 3O6BB 1U9NA 3IH4A 4M71A 1TC3C 1WI9A 2LY1A 1KU3A 3VYSB 4B48A 2E7WA 1Z67A 5LLQA 4OIQF 2Z99A 4RB2C 3OYBA 2L54A 5DM7F 1R58A 4DZPA 2IJLA 3WU2C 5IT9K 4M6VA 1JGGA 4IVNA 2HFHA 3QOPA 5BPDA 4AIJA 3CP2A 4IRIA 4M73A 1LVKA 1XGOA 2CSOA 4L9JA 2CFXA 3HEFA 1B72B 3L09A 3WU1B 1Z7UA 3DU5A 3PO3J 4FTHA 4A3IJ 2JA6J 1OKRA 1RNLA 2W57A 3I4PA 1VI0A 4CYCA 2IXSA 2XPUA 4BQOA 4DZJA 3CO7C 4A0ZA 3F6VA 3I0TA 4V19K 2P6TA 5F1JA 3WG9A 3BTIA 5EJCA 2IS1A 2PBIA 2I5UA 2KIFA 3OR1C 3VDXA 1T39A 1PDNC 2FSWA 2XDVA 4IRHA 2P7CB 1WKMA 2WB1N 3KYDB 1U9OA 5GPAA 4H0EA 1I3QJ 1LPQA 1IJWC 3K4KA 2YUSA 4M3GA 2NS8A 5HS9A 1FWZA 2OQGA 2LBFA 1D1CA 2DCEA 2RVCA 3EPZA 2D45A 1YJNI 2A61A 1FOYA 2HQAA 2X51A 2W4SA 2EFNA 1BI1A 1KQ9A 4CSWA 4Y7NJ 1LNWA 2X0LA 2R5YB 1T8IA 4B44A 2QQ8A 3ELKA 3OY9A 2R92J 2M7BA 4MNUA 1FSHA 2X48A 4HRIA 2IS4A 4MTDA 4HDVA 2CJJA 1WGXA 3C3WA 5LBQA 3JTGA 4P55A 3GTGJ 1EJ9A 1ZGAA 4HNUA 3W2AA 3K1MA 1USTA 4IHXA 3VPRA 2G9WA 3CDLA 3B6AA 3FBIB 2JTVA 2KPMA 3SEQA 4LK1F 2V1XA 3UNGC 3K1NA 4HLXA 1GDTA 1IRXA 3K6GA 2FBHA 2M2EA 5IT3A 2KIMA 3C2GA 3QPTA 3GFMA 5EEAA 3NARA 4U87A 4UVCA 1K4SA 4OAYA 1UJ8A 3CJRB 3WE3A 3SYTA 2GWRA 3TDZC 2O0YA 4N9HA 4A5NA 3CD6I 1O3TA 3DWLE 2L02A 1XMKA 1HKSA 3FXQA 2ZO4A 2CQXA 2M5WA 1H88C 5F6FA 4MO7A 5D5VB 3N4MA 5E79C 2KQRA 3TW6A 4C3HJ 4F55A 3N97A 1ETXA 2KL4A 2IGMA 2W24A 2XB5A 3ABLH 5EEHA 5BS6A 3GBGA 3DKYA 3TKYA 1D1BA 1WPKA 4WXCA 5JI6A 1YJWI 2DQRA 3I58A 3LA2A 3ERMA 4FE7A 4XONA 1BOAA 3A2KA 4NC8A 5CVRA 3CCEI 2LH9A 1WQ2A 2M1BA 3CCMI 2QF7A 4C2TA 2FMYA 4Q48A 1BC7C 5AONA 1YE9A 3ZGKA 2H8WA 2DJNA 3JAMZ 3GTPJ 2XGCA 1HW1A 9ANTA 4LG3A 2ZJ2A 3IUOA 3FK6A 3D0SA 3KEQA 2GXGA 1EKEA 2X9DA 4IXAA 3DTEA 3CZ6A 3C18A 5M5WJ 2STWA 2HTJA 4XN0A 3ZPLA 1ZRFA 2M7AA 1T95A 1XD7A 5BMZA 1AHDP 1MBKA 1P4WA 5D4RA 3LSGA 5J1RA 4UVBA 2R7RA 4BGDA 2VBXA 1YI2I 2MH9A 1B6AA 3S3MA 2OTJI 1KYWA 3JSOA 1MJAA 2XASA 4NC6A 2R7WA 1EH6A 5E1XA 2BXZA 4NHJA 3NRVA 1USSA 4IQJA 3ZMTA 4JX4A 4PJLA 1ZH5A 3ZN0A 4M9SA 3F6OA 3FXLA 4HV5A 3H9QA 2FD5A 1R49A 1FYKA 2E2JJ 1R4NB 3WTTC 1QVUA 1I6XA 3C2HA 2XF6A 4YFNF 5TJJA 3E5XA 4BY1J 3HYIA 3V8LA 3M1CA 2A6EF 2VE8A 3O8GA 5BQTA 1YX3A 1BL0A 1BJAA 2E7XA 5E8IA 3WTSC 2DW4A 1BM9A 4I01A 2NXNB 5D4SA 2EFWA 5DD8A 4I0AA 2QVOA 2L7KA 3WHBA 3RZOJ 4KIFA 1K6OA 2E1CA 2CWEA 2A07F 2X1EA 2R7ZJ 3IAM2 3QYFA 2CG4A 2JUGA 3ESWB 2DA3A 4I09A 4HPQA 4N4NB 2MFZA 2E2HJ 1IG7A 4NDLA 2PMUA 3IAS2 1JJ6C 4BAYA 2Q2EB 3CCSI 1HDPA 1W36C 3A1YA 5LRSA 5GAEJ 3CMYA 2BVMA 1NH3A 3FHNA 3QU3A 2MSYA 1RUNA 1KU9A 4RGRA 3MKWB 3GCMA 4QIWN 3CF2A 1SC7A 1J2XA 1MMDA 4IHVA 2RQQA 3FXUA 3GXOA 1QVTA 4L5EA 1D0ZA 5J8CA 1IF1A 3L2QA 3OYKA 4U7BA 1EF4A 3HSRA 2EV5A 1W0TA 1XMAA 2YX4A 4KA4A 2KJCA 3JW4A 4DYQA 2DN0A 1QGPA 2LNBA 1KA8A 2GBYA 4O6JA 4XNFA 2GAUA 1ZAOA 3F3XA 5KHDA 1I39A 2GOMA 2XAHA 3GX4X 1BR4A 3FISA 4UUTA 1Z7LA 2ZB9A 1Y0NA 2Q1ZB 2DK8A 2V9PA 5EGOA 1ZLJA 3RKXA 4EM0B 3E6CC 5CVJA 4UVAA 4XIDA 2HDCA 3I4MJ 4XKWA 2VBZA 4DJAA 4ZYGA 4KT6A 4XMYA 1QA6A 2FF4A 4WXHA 1WRJA 2HNHA 2M4KA 3GZ5A 1ORKA 2CV0A 1UG2A 3PNTA 3BR2A 3LFKA 2DDBA 1RIOH 2GOXB 3BTJA 4FISA 4BE2A 3OL4A 2OJED 3G2BA 5H6RA 1IRFA 3K69A 3TL4X 2M87A 3FHZA 3DBHB 4DW6A 3RDIA 1YITI 1BIBA 1XSVA 2X6OA 5LEJA 1XPXA 2HVQA 2RDPA 3NWTA 1N77A 1JGSA 3WTZA 1JKQC 4RAZA 3DFGA 5IYCJ 1HSTA 2O03A 3HOZJ 1LDJA 1XX5A 2LC2A 3VWBA 4BQQA 3BG7A 2HR3A 1ZLKA 4QLCU 1TNSA 3BT9A 3FMRA 3HPHA 4IJAA 3ASOH 4E7JA 5E3OA 3PJRA 3BJ6A 3Q5FA 1R5GA 5ED4A 1R1TA 1MMAA 3MN2A 4N4OB 2MLKA 3KZIC 1H89C 2DA7A 2O6GE 2DO7A 3OMYA 3Q0VA 2XIGA 4EM2A 2XGXA 2LKXA 1TZLA 5K5RA 2NNYA 1O3RA 2QSFX 1G3TA 1QZYA 4WK8F 1JT0A 2LREA 4WF2A 4IOCF 3PFIA 2OA4A 2EJRA 3AAFA 2BOLA 1MGTA 2LLKA 3E6BA 3CC4I 2E1MB 4XLEA 3F0CA 2QQ9A 1ZGWA 3HC7A 2WC2A 3IL2A 2MC4A 4LB5A 1YW7A 5GAGJ 2CGPA 2BY0A 4AVZA 2H8RA 1YW9A 3O8HA 3CCRI 4A12A 1REPC 3Q0WA 5HDNA 1R5HA 2FJ1A 2VN2A 5F0HA 2DA5A 1TP4A 3HBLA 3PIPF 4ZZDA 3U21A 3CCQI 5LHHA 5IOZA 4C30A 2H6BA 2QEXI 3GTLJ 2KLOA 3DEUA 1G3YA 4PFOA 1BW5A 2L4MA 2CQNA 4JYKA 2WY8Q 1MBGA 3PIOF 5GTIC 1SAXA 2IT0A 4UB6C 2WAQA 3MMYB 4GO1A 2BW3B 4OWRB 3GYHX 1CQTA 5KVRA 2VONA 1GXPA 2IEKA 1TQMA 3H3ZA 2AO9A 2WTEA 1R6RA 1XSXA 1WFXA 2CU7A 1P92A 1WJ5A 3MKYB 1YQAA 4E70A 3RPUD 1XS9A 2F48A 5K5QA 4ESFA 5DUIA 1MBJA 3DBLB 2YPRA 1O3QA 4AC0A 2ESNA 2W7NA 2WAQN 2RKHA 2OV7A 2VE9A 1NG7A 4F52A 2O8KA 3PFYA 4LIVA 1VQMI 1VQ6I 4FX0A 2OTLI 5F0FA 3JREA 2RC4A 2PMZA 3LL7A 3JRAA 1BIAA 1GV2A 3F8NA 4EGZA 2HZDA 4D7NA 2W82A 1VQPI 3JCUC 1TNTA 1OCTC 2HGCA 3U2RA 4BL0B 2CMPA 2P5LC 1KGSA 1S5LC 3TO7A 1HXDA 4XRSG 1XGNA 3KP3A 2DU9A 3JSPA 3KE2A 4L5IA 2LF8A 3A0HC 3MKLA 2W1OA 4KN7X 3ZMUA 4A3BJ 5HDGA 3SDBA 3FXMA 3J7YJ 3GUDA 2DMQA 4MGRA 4F3QA 2GM4A 4UV9A 4RS8A 2VBYA 3HGYA 2I10A 2DOFA 4FE4A 4G6QA 5LGUA 5EF6A 4RB1A 3CCUI 2F5FA 2P5VA 2BHZA 2FBIA 3CJNA 2R5YA 1K78B 2NAZA 2DPUA 2QM3A 2BXYA 3L00A 4PJNA 3DLLF 1T0FC 1VQOI 3OYNA 1SMYF 2PJPA 3Q9VA 3ROUA 5IPAA 4XM3A 1OYWA 1B1BA 5DM6F 3QWLA 1S72I 2IPQX 2OUMA 4RGXA 1CF7B 5CVVA 1FBQA 2FRHA 1ZG5A 2CH0A 3CDIA 1XN7A 4G6DA 5TGTA 3GTOJ 4DNCA 5H6QA 1BI2A 3CC2I 1X3UA 1P9QC 2UV1A 2CW7A 4HA8A 3V8JA 3WHCA 4ZTFA 1J9IA 1FBSA 2CUJA 2OCEA 4BBRJ 1YOVB 3KYLA 3F72A 2ME6A 2UXXA 4FASD 3TP3A 3X2QH 1S7OA 2H1LA 2EB7A 3G71I 3L2CA 1ZYRF 5IP6A 5M5YJ 2XAJA 2PN6A 2EZIA 1AKHA 1PUEE 3V42A 2LVSA 3DKXA 3OWTA 3GTJJ 1ZKGA 3S15J 1BC8C 3E1SA 5F1RA 3ZCOA 3BLYA 5EG0B 3L2UA 3CMAI 4XOTA 2H09A 4GXOA 4BE0A 1FIAA 2JWTA 4X1EA 1T56A 1J7KA 5E20A 4K2EA 2DMPA 3HOXJ 4GFBA 4EMSA 1YRNB 4A3MJ 3OIPA 4S05A 1IDYA 4RA2A 5CVUA 4Y52J 3SDGA 5LHIA 3L2WA 4BNCA 4YELA 3REOA 2FOKA 3N05A 2CUZA 1J75A 5IY5H 3KFWX 2JA5J 4MEXF 2FNPA 2L7MP 4L9NA 5DDGA 1AOYA 2R4GA 1BN5A 1O4XA 1EH7A 1YFHA 3A01B 4R79A 3E3VA 3CF5F 3LSKA 2OU2A 3ZQFA 1SFOJ 3K1PA 5GTHC 2M3AA 4CHUA 2EBIA 2Y30A 2K4JA 4F91B 1LE8B 5D8LB 2OZ6A 1OCRH 5J1UA 2BW3A 2Y31A 1WZ2A 1FOKA 2IAIA 3DU6A 3E0JB 3OR2C 3PQKA 5J8FA 1G2HA 1OYYA 2JN6A 2HS5A 4HX4A 5B3SH 4I76A 2Q2EA 4CCKA 3R60A 4H4KC 3BROA 4ENJA 1BI3A 5DUKA 4KJZA 4M3BA 2B63J 2KJBA 3W3CA 2P6SA 2C6YA 3TMOA 4C9YA 4RAFA 1Z6RA 3RI4A 3O3KA 1MH3A 2EA2A 4LG0B 2IP2A 3ZQHA 3I4NJ 3FXOA 5LGNA 4AIHA 1SFKA 1IXRC 5AIQA 3HSFA 1GXQA 3DEWA 3LSIA 3I9V2 1PUFA 4IOAF 4IEJA 2D5VA 1MJBA 3LSRA 1HDDC 1X3ZB 2PFBA 1S8NA 1W4MA 2YU3A 4YIRX 1F1ZA 4OMZA 1TW3A 4S0HB 2XSJC 1UELB 5CYVA 3BC8A 2VQCA 3BR1A 3VOEA 2LMDA 3JRGA 4XBFA 1FP2A 2HZTA 4A0YA 1T0FA 5GP9A 4DOZA 2NOGA 2BZTA 3QQAA 3JRIA 2P4WA 1WJAA 4GYGA 1JHFA 4I2OA 1YIOA 2FXAA 3WGGA 4NUBA 1WSUA 1KQ8A 3AG1H 5EZHA 4XOPA 2VJ4A 3BR6A 1H8AC 4ZYHA 4BQNA 4KISA 3KP5A 3P9KA 2X4HA 4A5MA 4RB3C 4ENMA 2Y0SN 2FOWA 5EGOB 2X85A 3KEOA 2IA0A 4EGYA 2Z33A 2K4BA
chains in the Genus database with same CATH topology
3W6KB 5FLXK 5H20A 3SZPA 3VEPA 3SXYA 2YX7A 4NQWA 4U0YA 4IPAA 2EA4A 3IKVA 1FP1D 5L3BA 3SHFA 4M9ZA 3D5LA 1E17A 1T38A 3DV8A 1G3SA 1ODDA 1P2FA 2GA2A 2KIUA 3FXRA 2J5PA 4LLNA 3HUGA 4ETSA 2F2EA 2AS5F 3HTUA 3HRTA 4M74A 2BEOA 4O5VA 1FSEA 4I02A 4EM1A 3P9IA 1R36A 3VB2A 2QUFA 2MA3A 2Q0OA 1Y0UA 4YFXF 2JT1A 1FNNA 4RAYA 3K0LA 3RTRA 4WCGA 2R7DA 3G73A 4HQMA 3MFKA 1JXSA 1YS6A 1ZRDA 4LK0F 1YO5C 4Y17A 4CICA 3BP8A 4RGUA 3U9GA 4ZYEA 1L3LA 3TOAA 5HLIA 3R61A 3R0JA 1U5TB 2P5KA 1HSJA 1SFEA 1Z05A 3MZHA 4OIPF 2VOOA 1KQ0A 1H9TA 4IF4A 2NNNA 3HHHA 4LGWA 3E5QA 3EDPA 4XSZF 2K7LA 5JFRA 2A68F 1IRGA 2QZ8A 3FMQA 3M1EA 1D3YA 2AXLA 4HAMA 3T8TA 4CDGA 4OIOF 1LEAA 1XGMA 3KCCA 2DBBA 5DV5A 3I54A 1DDNA 3ABTA 4QWQA 5L3EA 4BXUA 5HOOA 2DQLA 5HS8A 4MHGA 2XV4S 2HEOA 2DFIA 2QQAA 2BYVE 2MC3A 1HW2A 4Y15A 3QAHA 5E1ZB 3GO5A 2MH2A 2GIVA 3WTUC 1XSDA 4BHPA 3F8BA 4UNOA 1MZBA 4ZYDA 4WX9A 2F5CA 1XCVA 3DPTA 2GZWA 1G4DA 1P4AA 4CGZA 4LLLA 1PP7U 1GVJA 3HHGA 1YTYA 3QP5A 1EV7A 3R4KA 1H9GA 1OR7A 3SQNA 3E6MA 5E1WA 1O3SA 1HBXG 2IRFG 1IN7A 1YG2A 3FX3A 1IN5A 5L3GA 1FYLA 4G9YA 2HWVA 4OIRF 3EYYA 3K2ZA 2R7FA 3TQNA 3CUOA 2OAZA 2CW0F 4HZFA 1J0RA 1ZGJA 2EFOA 4G8XA 5ILSA 4HOBA 4N9IA 1QPMA 4ENNA 1V3FA 2F5DA 3B73A 1XDSA 2FNAA 4EV0A 3J80K 2V1DA 3KLNA 2EV6A 1W5SA 2XAQA 3GF2A 2NRAC 2ESHA 2Y48A 3V7CA 1RI7A 3HRSA 3RJPA 3CUQA 3HTSB 1OMIA 4AVPA 3WGIA 1Z1DA 2VODA 1S29A 2XROA 5E8GA 2PQ8A 1K79A 5FD5A 2ZCWA 2P7VB 1UB9A 1FBUA 5D8KB 2XAFA 3IC7A 1R23A 3WTYC 2DT5A 1SD7A 2M30A 3DF8A 2FQ3A 1SD6A 4LMYA 1ON1A 1E2XA 1I27A 2JRTA 5CJ9A 3TGNA 2OQRA 2JPBA 3T1BA 1R00A 3HIFA 2A3SA 4YFKF 3W6JB 2QLZA 1V4RA 4AWXB 4EJOA 4A2UA 3RKWA 5E18F 5E17F 3RYRA 2RNJA 3KP4A 3DP7A 4FT8A 3LQRA 3F8FA 1IW7F 5FGMA 4EVIA 3DQVC 1XB4A 5FD6A 4OINF 1F4KA 1DUXC 1FC3A 1J59A 3WODF 3FM3A 1K7AA 1W5TA 4HX8A 4G7HF 4ESJA 5JVTA 5HDKA 2QENA 1FX7A 2COMA 1Q1HA 3J81K 4BH9A 3WU0A 5BPIA 4IRGA 3BJAA 4EJWA 3RPQA 4PZJA 4RB0A 4U0VA 2OZUA 2M8EA 2R3SA 2FU4A 2DPDA 3JTHA 2H6CA 5A2QZ 3T8RA 4KIGA 2V79A 1QNTA 3HRMA 2YR2A 1CF7A 4MQVA 2K02A 2JSCA 2HOEA 5L3DA 2BGCA 4CO8A 3NEUA 3BOQA 1QO0D 4G7OF 3F23A 4HQEA 1MJ9A 4ZH4F 3TOBA 5D6EA 2P8TA 4WXDA 3SZTA 1U2WA 2PLYA 3MZYA 2Y0MA 1UHMA 4OU0A 1IXCA 2VC0A 4OMYA 2UZKA 1Z91A 2ZNYA 2QYOA 4ZZLA 2F5EA 3NQOA 1JHHA 1MDMB 1W7PB 4HF2A 2K86A 3H92A 1TQPA 3CLOA 2Z9OA 4FX4A 4JQFA 2H94A 4D0PA 3KP6A 3V7RA 5LEKA 1U3EM 3LAPA 3BWGA 3RPUA 1SMTA 4Q4ZF 1FT9A 4XRFA 3KETA 3J80Z 4B8XA 3I59A 2BV6A 4R8HA 2PEXA 1Z9CA 4HF0A 3I71A 3OV8A 2XUBA 4HX7A 3V4GA 2FEZA 1U5TA 4PGHA 1DPRA 4CYDA 5TRDA 3BPXA 2UXNA 6PAXA 1LDKB 2H27A 2HYFA 3IWFA 1I5ZA 2ADUA 1IAWA 3F21A 2LSOA 2NS0A 4KYWA 3Q9SA 4KUMA 3KZZA 4YIIA 3BZ6A 2LDUA 3LQQA 2ZMEB 4AD9A 4WWCA 2VXZA 4ENKA 3ML6A 3WTXC 2O61A 3HSEA 1JE8A 1F5TA 2RN7A 3CUQC 2FMLA 2VC1A 4P9UA 4KDPA 4LG0A 4LB6B 2D2WA 4IHTA 2J5OA 5LRRA 3E97A 3ZMZA 2ZBKA 1FZPB 2XKPA 3FMSA 3ISPA 4MQ9F 4ON0A 4L18B 1S6LA 5KK1A 5L3FA 5D5WB 2HYGD 1K78A 4I7HA 3J7AO 3EETA 5FLXZ 1B4AA 3GWZA 1OYIA 1QQIA 4HBLA 4DQ2A 1D5VA 1B59A 2XVCA 4TV7A 1U5TC 1OPCA 4JK1X 1SFUA 2XKOA 3J81Z 1YYVA 2W25A 2IA2A 1LJ9A 3CO6C 2XHKA 5CLSA 3F8MA 3V8KA 4LD5A 2ACJA 1TQIA 4KIBA 4ASNA 1PP8F 1TLHB 1U8RA 1WWXA 2O8XA 2EV0A 4YG2F 3BDDA 2VBWA 3EUHA 4L0YB 1HKQA 2HTSA 2B0LA 4IHSA 2MD5A 3ULQB 2STTA 4XLNF 4EJTA 1ZN2A 3IHUA 4P5OA 1H0MA 1NHAA 3SFZA 3LA7A 2ZMEA 1UFMA 1T2KA 3LSTA 3GFJA 3H3UA 3S2WA 2IVMA 3TO6A 1D8KA 5EEGA 2V9VA 1LEBA 1SD4A 4KT5C 3IKTA 4M72A 2GXBA 3LA3A 2HQRA 4O3MA 5DD4A 2G7HA 1IXSB 2BE5F 3QU6A 3E6DA 3K9TA 1G3WA 2W84A 3GFLA 3BPVA 4BHBA 3O2PE 3HOTA 3ERED 4KMFA 4NB5A 4HF1A 1R22A 1STZA 1IUYA 1ON2A 3TDUC 1ZRCA 1I1SA 3V7SA 5L3CA 2KKOA 3VFZA 2VOPA 1XCBA 3LWFA 3M7GA 4KN4X 3F8CA 1LDDA 3IRRA 4PGGA 3CTAA 3WE2A 1Z6TA 1CGPA 3M8FA 1W7PD 2MLGA 1IN6A 5D6FA 2A6HF 5DEQA 1MDMA 1XGSA 5DCMA 3LAJA 1SFXA 4HW0A 1W7PA 3ZN1A 3VODA 2RQPA 4R1HA 1IZ1A 2IW5A 4A0XA 5ICEA 1R1VA 2XAGA 3COAC 2EWNA 2RV8A 1LB2A 4UV8A 4RGSA 2Z5UA 3C1DA 4S04A 3KP2A 3CDHA 2ETHA 5HS7A 5FO5A 4GCVA 2PMHA 4OOIA 1YLFA 5LGTA 4XSXF 2PI0A 2M45A 4P9FA 1O7LA 5LHGA 1RUOA 4L9TA 4A6EA 2L01A 1ZREA 2D1VA 3RKYA 1KU7A 3WTVC 3ZQ7A 4Z2YA 1O57A 1TBXA 2PG4A 2BBYA 3E5UA 2HKXA 1KYZA 4AIKA 2HKOA 1DPUA 3MEXA 4YIFA 5FFXA 1UCRA 4P96A 5HLHA 4ESBA 4UHTA 3DXJF 4PDKA 2GA1A 5ERIA 1IN4A 2JZYA 3WTWC 1FYMA 5FB2A 2ELHA 1ONVA 5ILUA 1ULYA 1HQCA 1VTNC 3OOPA 4KICA 5DYMA 1UHWA 4MTEA 1P4XA 2QWWA 2Y75A 3QP6A 3P7NA 3GW2A 2RGVA 4KMUX 3FZVA 3QPHA 3HOSA 3RIRA 4FHTA 4LFUA 3MAJA 4CZZA 4HDUA 1R1UA 3C7JA 3GEZA 2QBYA 3MQ0A 2ZFWA 3R6SA 3R0AA 2WWYA 1HKTA 4M6YA 3TO9A 2OBPA 1L0OC 1G6NA 2YSRA 3ECOA 1ZG1A 1J5YA 2XRNA 4HLYA 4L0ZB 5ICFA 1ZARA 3M8EA 5IT9Z 5A2QK 3L9FA 4UXNA 2ZNZA 3ZMSA 1TTYA 1FLIA 3GZ6A 2CYYA 1YS7A 3BY6A 1RZ4A 2CO5A 4LLGF 1R7JA 1A04A 3MWMA 1EH8A 2E1NA 1BBYA 3HRUA 2IA1A 1YW8A 5HLGA 5AIPA 4I0BA 2CQKA 3I53A 2D1HA 3F22A 1U6GA 1QZZA 2VT2A 4L5JA 2NYXA 3I59B 1KU2A 5ICCA 3FWEA 4M9XA 4BYYA 2EFPA 2EFQA 2VT3A 5DCMB 2MBFA 3IWZA 2EK5A 3M9AA 5JR3A 4L9VA 2WV0A 1LQ1A 4EJVA 2V1UA 2UWMA 5K5OA 4G7ZF 1GHCA 5DCFA 4M6XA 4EJUA 2KRFA 3ABUA 5ILVA 2HQNA 2LF7A 4UUVA 1TW2A 2TDXA 5CVIA 1SD5A 1T98A 1P6RA 2G7UA 1LVAA 3QRFF 2FE3A 4KNYA 2A5YB 3ZMDA 3DPLC 3CUQB 2DTRA 1QBJA 2GQQA 2O3FA 1MKMA 1ZHFA 2FA5A 1S7AA 3DKWA 2JPCA 5F64A 3KLOA 5K1YA 4MEYF 3RYPA 3G3ZA 4U7DA 4U88A 1DP7P 2OD5A 2ZXJA 4EQQA 2DLLA 2V6CA 5J6XA 3ECHA 3MCZA 1D8JA 2QBYB 4CXFA 2FBKA 2LKPA 3FM5A 1MD0A 4BHCA 3P9CA 2A69F 4PCQA 3B02A 1XDUA 2DAOA 4U0WA 4Q47A 3GVAA 2ISYA 2W85A 1FPQA 3BJOA 5D5UB 1IN8A 1S3JA 2DK5A 2ISZA 2QQBA 2DI3A 4G94A 3T5XA 1F9NA 3GLXA 3T0YA 1C0WA 5ICGA 2K27A 3JAMK 1AWCA 3IRQA 4HYEA 1FY7A 3KP7A 5BOXA 4GYIA 4Q5SF 3I5UA 1I1GA 2Q8KA 5JHUA 4KFCA 3U1DA 1BI0A 1ZG3A 5FFZA 4N0BA 4F7ZA 2ZKZA 4GGGA 4I98B 3EYIA 5D5XB 3ZMVA 3L7WA 3I64A 2L3DA 3FF5A 4BQAA 4B09A 3PQJA 1T6SA 4HV6A 4LJZF 4A6DA 5HVQC 1U78A 4XLPF 1HW5A 3WGHA 2L4AA 4JBAA 1B9NA 3EQLF 2Z3YA 4Y13A 3GFIA 1B9MA 3KZYA 1O7FA 3O6BB 4M71A 1WI9A 1KU3A 2E7WA 5LLQA 4OIQF 2Z99A 4RB2C 2L54A 1R58A 2IJLA 5IT9K 4IVNA 2HFHA 3QOPA 5BPDA 4AIJA 4IRIA 4M73A 1XGOA 2CSOA 4L9JA 2CFXA 3L09A 3WU1B 1Z7UA 1OKRA 1RNLA 2W57A 3I4PA 3CO7C 4A0ZA 3F6VA 3I0TA 2P6TA 3WG9A 2PBIA 2KIFA 1T39A 1PDNC 2FSWA 4IRHA 2P7CB 1WKMA 4H0EA 5HS9A 1FWZA 2OQGA 2RVCA 2D45A 2A61A 2EFNA 1BI1A 1KQ9A 1LNWA 2X0LA 3ELKA 4MNUA 1FSHA 4MTDA 4HDVA 3C3WA 5LBQA 3JTGA 4P55A 1ZGAA 3K1MA 1USTA 2G9WA 2JTVA 4LK1F 2V1XA 3K1NA 4HLXA 2FBHA 5IT3A 2KIMA 3QPTA 3GFMA 4UVCA 3WE3A 2GWRA 3TDZC 2O0YA 4N9HA 4A5NA 1O3TA 2L02A 1XMKA 1HKSA 3FXQA 2ZO4A 2M5WA 5F6FA 3N4MA 5D5VB 3N97A 2W24A 5EEHA 5BS6A 3TKYA 5JI6A 4WXCA 2DQRA 3I58A 3LA2A 1BOAA 5CVRA 1WQ2A 2M1BA 2FMYA 4Q48A 1BC7C 5AONA 3JAMZ 1HW1A 2ZJ2A 3D0SA 3KEQA 2GXGA 4IXAA 3C18A 2STWA 2HTJA 3ZPLA 1ZRFA 1XD7A 5BMZA 1P4WA 5D4RA 4UVBA 2VBXA 2MH9A 1B6AA 1KYWA 3JSOA 1MJAA 2XASA 1EH6A 5E1XA 4NHJA 3NRVA 1USSA 3ZMTA 1ZH5A 3ZN0A 4M9SA 3F6OA 4HV5A 1FYKA 3WTTC 1I6XA 4YFNF 5TJJA 3E5XA 3HYIA 3V8LA 2A6EF 2VE8A 5BQTA 1BJAA 2E7XA 5E8IA 3WTSC 2DW4A 1BM9A 4I01A 5D4SA 2EFWA 5DD8A 4I0AA 2QVOA 4KIFA 1K6OA 2E1CA 2CWEA 2A07F 2CG4A 4I09A 2PMUA 4BAYA 5LRSA 3QU3A 1RUNA 1KU9A 4RGRA 1J2XA 3FXUA 3GXOA 5J8CA 1IF1A 4U7BA 3HSRA 2EV5A 1XMAA 2YX4A 4KA4A 2KJCA 3JW4A 3ZP5A 2LNBA 1QGPA 4O6JA 1KA8A 2GAUA 1ZAOA 3F3XA 2XAHA 3GX4X 2DK8A 1ZLJA 3RKXA 4EM0B 3E6CC 5CVJA 4UVAA 2HDCA 2VBZA 4ZYGA 2FF4A 4WXHA 1WRJA 3GZ5A 3LFKA 1RIOH 5H6RA 1IRFA 3K69A 2M87A 3FHZA 3RDIA 1BIBA 1XSVA 5LEJA 2RDPA 1JGSA 3WTZA 4RAZA 3DFGA 1HSTA 2O03A 1LDJA 2HR3A 1ZLKA 4QLCU 1TNSA 4IJAA 3FMRA 3BJ6A 3Q5FA 1R5GA 5ED4A 1R1TA 2MLKA 2O6GE 2DO7A 2XIGA 4EM2A 2XGXA 5K5RA 2NNYA 1O3RA 1G3TA 1QZYA 4WK8F 4WF2A 3PFIA 2OA4A 2EJRA 3AAFA 1MGTA 3E6BA 2QQ9A 2WC2A 3IL2A 4LB5A 1YW7A 2CGPA 1YW9A 4A12A 1REPC 5HDNA 1R5HA 2VN2A 4ZZDA 5LHHA 2H6BA 3DEUA 1G3YA 2L4MA 1SAXA 2IT0A 4GO1A 3GYHX 2VONA 5KVRA 1GXPA 1TQMA 3H3ZA 2WTEA 1XSXA 1P92A 1YQAA 4E70A 5K5QA 4ESFA 5DUIA 2YPRA 1O3QA 2ESNA 2RKHA 2VE9A 4FX0A 2RC4A 1BIAA 3F8NA 4EGZA 1TNTA 2HGCA 3U2RA 2P5LC 1KGSA 3TO7A 1HXDA 1XGNA 3KP3A 2DU9A 3JSPA 3KE2A 4L5IA 2LF8A 3ZMUA 4KN7X 5HDGA 3GUDA 4MGRA 4UV9A 4RS8A 2VBYA 4G6QA 4RB1A 5LGUA 2F5FA 2P5VA 1K78B 2FBIA 3CJNA 2DPUA 2NAZA 2QM3A 3L00A 1SMYF 2PJPA 3Q9VA 3ROUA 1OYWA 1B1BA 2IPQX 1CF7B 4RGXA 5CVVA 1FBQA 2FRHA 1ZG5A 1XN7A 4G6DA 4DNCA 5H6QA 1BI2A 1X3UA 4HA8A 3V8JA 1J9IA 1FBSA 3F72A 2UXXA 1S7OA 2EB7A 3L2CA 1ZYRF 2XAJA 2PN6A 1PUEE 1BC8C 5F1RA 2H09A 4GXOA 1J7KA 5E20A 4K2EA 4EMSA 4S05A 5CVUA 5LHIA 4BNCA 3REOA 2FOKA 1J75A 3KFWX 4MEXF 2FNPA 5DDGA 4L9NA 1AOYA 1BN5A 1EH7A 1YFHA 4R79A 3E3VA 2OU2A 3K1PA 4CHUA 2K4JA 5D8LB 2OZ6A 1FOKA 3PQKA 5J8FA 1OYYA 2HS5A 4HX4A 2Q2EA 3R60A 3BROA 4ENJA 1BI3A 5DUKA 2KJBA 2P6SA 2C6YA 1Z6RA 3RI4A 3O3KA 2EA2A 4LG0B 2IP2A 5LGNA 4AIHA 1IXRC 5AIQA 3HSFA 1GXQA 1MJBA 2PFBA 1S8NA 1W4MA 2YU3A 1F1ZA 4OMZA 1TW3A 5CYVA 3VOEA 4XBFA 1FP2A 2HZTA 4A0YA 1T0FA 2P4WA 4GYGA 1JHFA 4I2OA 2FXAA 1YIOA 3WGGA 1WSUA 1KQ8A 4ZYHA 3KP5A 3P9KA 4ENMA 2X4HA 4A5MA 4RB3C 3KEOA 2IA0A 4EGYA 2Z33A 2K4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6K B;  5FLX K;  5H20 A;  3SZP A;  3VEP A;  3SXY A;  2YX7 A;  4NQW A;  4U0Y A;  4IPA A;  2EA4 A;  3IKV A;  1FP1 D;  5L3B A;  3SHF A;  4M9Z A;  3D5L A;  1E17 A;  1T38 A;  3DV8 A;  1G3S A;  1ODD A;  1P2F A;  2GA2 A;  2KIU A;  3FXR A;  2J5P A;  4LLN A;  3HUG A;  4ETS A;  2F2E A;  2AS5 F;  3HTU A;  3HRT A;  4M74 A;  2BEO A;  4O5V A;  1FSE A;  4I02 A;  4EM1 A;  3P9I A;  1R36 A;  3VB2 A;  2QUF A;  2MA3 A;  2Q0O A;  1Y0U A;  4YFX F;  2JT1 A;  1FNN A;  4RAY A;  3K0L A;  3RTR A;  4WCG A;  2R7D A;  3G73 A;  4HQM A;  3MFK A;  1JXS A;  1YS6 A;  1ZRD A;  4LK0 F;  1YO5 C;  4Y17 A;  4CIC A;  3BP8 A;  4RGU A;  3U9G A;  4ZYE A;  1L3L A;  3TOA A;  5HLI A;  3R61 A;  3R0J A;  1U5T B;  2P5K A;  1HSJ A;  1SFE A;  1Z05 A;  3MZH A;  4OIP F;  2VOO A;  1KQ0 A;  1H9T A;  4IF4 A;  2NNN A;  3HHH A;  4LGW A;  3E5Q A;  3EDP A;  4XSZ F;  2K7L A;  5JFR A;  2A68 F;  1IRG A;  2QZ8 A;  3FMQ A;  3M1E A;  1D3Y A;  2AXL A;  4HAM A;  3T8T A;  4CDG A;  4OIO F;  1LEA A;  1XGM A;  3KCC A;  2DBB A;  5DV5 A;  3I54 A;  1DDN A;  3ABT A;  4QWQ A;  5L3E A;  4BXU A;  5HOO A;  2DQL A;  5HS8 A;  4MHG A;  2XV4 S;  2HEO A;  2DFI A;  2QQA A;  2BYV E;  2MC3 A;  1HW2 A;  4Y15 A;  3QAH A;  5E1Z B;  3GO5 A;  2MH2 A;  2GIV A;  3WTU C;  1XSD A;  4BHP A;  3F8B A;  4UNO A;  1MZB A;  4ZYD A;  4WX9 A;  2F5C A;  1XCV A;  3DPT A;  2GZW A;  1G4D A;  1P4A A;  4CGZ A;  4LLL A;  1PP7 U;  1GVJ A;  3HHG A;  1YTY A;  3QP5 A;  1EV7 A;  3R4K A;  1H9G A;  1OR7 A;  3SQN A;  3E6M A;  5E1W A;  1O3S A;  1HBX G;  2IRF G;  1IN7 A;  1YG2 A;  3FX3 A;  1IN5 A;  5L3G A;  1FYL A;  4G9Y A;  2HWV A;  4OIR F;  3EYY A;  3K2Z A;  2R7F A;  3TQN A;  3CUO A;  2OAZ A;  2CW0 F;  4HZF A;  1J0R A;  1ZGJ A;  2EFO A;  4G8X A;  5ILS A;  4HOB A;  4N9I A;  1QPM A;  4ENN A;  1V3F A;  2F5D A;  3B73 A;  1XDS A;  2FNA A;  4EV0 A;  3J80 K;  2V1D A;  3KLN A;  2EV6 A;  1W5S A;  2XAQ A;  3GF2 A;  2NRA C;  2ESH A;  2Y48 A;  3V7C A;  1RI7 A;  3HRS A;  3RJP A;  3CUQ A;  3HTS B;  1OMI A;  4AVP A;  3WGI A;  1Z1D A;  2VOD A;  1S29 A;  2XRO A;  5E8G A;  2PQ8 A;  1K79 A;  5FD5 A;  2ZCW A;  2P7V B;  1UB9 A;  1FBU A;  5D8K B;  2XAF A;  3IC7 A;  1R23 A;  3WTY C;  2DT5 A;  1SD7 A;  2M30 A;  3DF8 A;  2FQ3 A;  1SD6 A;  4LMY A;  1ON1 A;  1E2X A;  1I27 A;  2JRT A;  5CJ9 A;  3TGN A;  2OQR A;  2JPB A;  3T1B A;  1R00 A;  3HIF A;  2A3S A;  4YFK F;  3W6J B;  2QLZ A;  1V4R A;  4AWX B;  4EJO A;  4A2U A;  3RKW A;  5E18 F;  5E17 F;  3RYR A;  2RNJ A;  3KP4 A;  3DP7 A;  4FT8 A;  3LQR A;  3F8F A;  1IW7 F;  5FGM A;  4EVI A;  3DQV C;  1XB4 A;  5FD6 A;  4OIN F;  1F4K A;  1DUX C;  1FC3 A;  1J59 A;  3WOD F;  3FM3 A;  1K7A A;  1W5T A;  4HX8 A;  4G7H F;  4ESJ A;  5JVT A;  5HDK A;  2QEN A;  1FX7 A;  2COM A;  1Q1H A;  3J81 K;  4BH9 A;  3WU0 A;  5BPI A;  4IRG A;  3BJA A;  4EJW A;  3RPQ A;  4PZJ A;  4RB0 A;  4U0V A;  2OZU A;  2M8E A;  2R3S A;  2FU4 A;  2DPD A;  3JTH A;  2H6C A;  5A2Q Z;  3T8R A;  4KIG A;  2V79 A;  1QNT A;  3HRM A;  2YR2 A;  1CF7 A;  4MQV A;  2K02 A;  2JSC A;  2HOE A;  5L3D A;  2BGC A;  4CO8 A;  3NEU A;  3BOQ A;  1QO0 D;  4G7O F;  3F23 A;  4HQE A;  1MJ9 A;  4ZH4 F;  3TOB A;  5D6E A;  2P8T A;  4WXD A;  3SZT A;  1U2W A;  2PLY A;  3MZY A;  2Y0M A;  1UHM A;  4OU0 A;  1IXC A;  2VC0 A;  4OMY A;  2UZK A;  1Z91 A;  2ZNY A;  2QYO A;  4ZZL A;  2F5E A;  3NQO A;  1JHH A;  1MDM B;  1W7P B;  4HF2 A;  2K86 A;  3H92 A;  1TQP A;  3CLO A;  2Z9O A;  4FX4 A;  4JQF A;  2H94 A;  4D0P A;  3KP6 A;  3V7R A;  5LEK A;  1U3E M;  3LAP A;  3BWG A;  3RPU A;  1SMT A;  4Q4Z F;  1FT9 A;  4XRF A;  3KET A;  3J80 Z;  4B8X A;  3I59 A;  2BV6 A;  4R8H A;  2PEX A;  1Z9C A;  4HF0 A;  3I71 A;  3OV8 A;  2XUB A;  4HX7 A;  3V4G A;  2FEZ A;  1U5T A;  4PGH A;  1DPR A;  4CYD A;  5TRD A;  3BPX A;  2UXN A;  6PAX A;  1LDK B;  2H27 A;  2HYF A;  3IWF A;  1I5Z A;  2ADU A;  1IAW A;  3F21 A;  2LSO A;  2NS0 A;  4KYW A;  3Q9S A;  4KUM A;  3KZZ A;  4YII A;  3BZ6 A;  2LDU A;  3LQQ A;  2ZME B;  4AD9 A;  4WWC A;  2VXZ A;  4ENK A;  3ML6 A;  3WTX C;  2O61 A;  3HSE A;  1JE8 A;  1F5T A;  2RN7 A;  3CUQ C;  2FML A;  2VC1 A;  4P9U A;  4KDP A;  4LG0 A;  4LB6 B;  2D2W A;  4IHT A;  2J5O A;  5LRR A;  3E97 A;  3ZMZ A;  2ZBK A;  1FZP B;  2XKP A;  3FMS A;  3ISP A;  4MQ9 F;  4ON0 A;  4L18 B;  1S6L A;  5KK1 A;  5L3F A;  5D5W B;  2HYG D;  1K78 A;  4I7H A;  3J7A O;  3EET A;  5FLX Z;  1B4A A;  3GWZ A;  1OYI A;  1QQI A;  4HBL A;  4DQ2 A;  1D5V A;  1B59 A;  2XVC A;  4TV7 A;  1U5T C;  1OPC A;  4JK1 X;  1SFU A;  2XKO A;  3J81 Z;  1YYV A;  2W25 A;  2IA2 A;  1LJ9 A;  3CO6 C;  2XHK A;  5CLS A;  3F8M A;  3V8K A;  4LD5 A;  2ACJ A;  1TQI A;  4KIB A;  4ASN A;  1PP8 F;  1TLH B;  1U8R A;  1WWX A;  2O8X A;  2EV0 A;  4YG2 F;  3BDD A;  2VBW A;  3EUH A;  4L0Y B;  1HKQ A;  2HTS A;  2B0L A;  4IHS A;  2MD5 A;  3ULQ B;  2STT A;  4XLN F;  4EJT A;  1ZN2 A;  3IHU A;  4P5O A;  1H0M A;  1NHA A;  3SFZ A;  3LA7 A;  2ZME A;  1UFM A;  1T2K A;  3LST A;  3GFJ A;  3H3U A;  3S2W A;  2IVM A;  3TO6 A;  1D8K A;  5EEG A;  2V9V A;  1LEB A;  1SD4 A;  4KT5 C;  3IKT A;  4M72 A;  2GXB A;  3LA3 A;  2HQR A;  4O3M A;  5DD4 A;  2G7H A;  1IXS B;  2BE5 F;  3QU6 A;  3E6D A;  3K9T A;  1G3W A;  2W84 A;  3GFL A;  3BPV A;  4BHB A;  3O2P E;  3HOT A;  3ERE D;  4KMF A;  4NB5 A;  4HF1 A;  1R22 A;  1STZ A;  1IUY A;  1ON2 A;  3TDU C;  1ZRC A;  1I1S A;  3V7S A;  5L3C A;  2KKO A;  3VFZ A;  2VOP A;  1XCB A;  3LWF A;  3M7G A;  4KN4 X;  3F8C A;  1LDD A;  3IRR A;  4PGG A;  3CTA A;  3WE2 A;  1Z6T A;  1CGP A;  3M8F A;  1W7P D;  2MLG A;  1IN6 A;  5D6F A;  2A6H F;  5DEQ A;  1MDM A;  1XGS A;  5DCM A;  3LAJ A;  1SFX A;  4HW0 A;  1W7P A;  3ZN1 A;  3VOD A;  2RQP A;  4R1H A;  1IZ1 A;  2IW5 A;  4A0X A;  5ICE A;  1R1V A;  2XAG A;  3COA C;  2EWN A;  2RV8 A;  1LB2 A;  4UV8 A;  4RGS A;  2Z5U A;  3C1D A;  4S04 A;  3KP2 A;  3CDH A;  2ETH A;  5HS7 A;  5FO5 A;  4GCV A;  2PMH A;  4OOI A;  1YLF A;  5LGT A;  4XSX F;  2PI0 A;  2M45 A;  4P9F A;  1O7L A;  5LHG A;  1RUO A;  4L9T A;  4A6E A;  2L01 A;  1ZRE A;  2D1V A;  3RKY A;  1KU7 A;  3WTV C;  3ZQ7 A;  4Z2Y A;  1O57 A;  1TBX A;  2PG4 A;  2BBY A;  3E5U A;  2HKX A;  1KYZ A;  4AIK A;  2HKO A;  1DPU A;  3MEX A;  4YIF A;  5FFX A;  1UCR A;  4P96 A;  5HLH A;  4ESB A;  4UHT A;  3DXJ F;  4PDK A;  2GA1 A;  5ERI A;  1IN4 A;  2JZY A;  3WTW C;  1FYM A;  5FB2 A;  2ELH A;  1ONV A;  5ILU A;  1ULY A;  1HQC A;  1VTN C;  3OOP A;  4KIC A;  5DYM A;  1UHW A;  4MTE A;  1P4X A;  2QWW A;  2Y75 A;  3QP6 A;  3P7N A;  3GW2 A;  2RGV A;  4KMU X;  3FZV A;  3QPH A;  3HOS A;  3RIR A;  4FHT A;  4LFU A;  3MAJ A;  4CZZ A;  4HDU A;  1R1U A;  3C7J A;  3GEZ A;  2QBY A;  3MQ0 A;  2ZFW A;  3R6S A;  3R0A A;  2WWY A;  1HKT A;  4M6Y A;  3TO9 A;  2OBP A;  1L0O C;  1G6N A;  2YSR A;  3ECO A;  1ZG1 A;  1J5Y A;  2XRN A;  4HLY A;  4L0Z B;  5ICF A;  1ZAR A;  3M8E A;  5IT9 Z;  5A2Q K;  3L9F A;  4UXN A;  2ZNZ A;  3ZMS A;  1TTY A;  1FLI A;  3GZ6 A;  2CYY A;  1YS7 A;  3BY6 A;  1RZ4 A;  2CO5 A;  4LLG F;  1R7J A;  1A04 A;  3MWM A;  1EH8 A;  2E1N A;  1BBY A;  3HRU A;  2IA1 A;  1YW8 A;  5HLG A;  5AIP A;  4I0B A;  2CQK A;  3I53 A;  2D1H A;  3F22 A;  1U6G A;  1QZZ A;  2VT2 A;  4L5J A;  2NYX A;  3I59 B;  1KU2 A;  5ICC A;  3FWE A;  4M9X A;  4BYY A;  2EFP A;  2EFQ A;  2VT3 A;  5DCM B;  2MBF A;  3IWZ A;  2EK5 A;  3M9A A;  5JR3 A;  4L9V A;  2WV0 A;  1LQ1 A;  4EJV A;  2V1U A;  2UWM A;  5K5O A;  4G7Z F;  1GHC A;  5DCF A;  4M6X A;  4EJU A;  2KRF A;  3ABU A;  5ILV A;  2HQN A;  2LF7 A;  4UUV A;  1TW2 A;  2TDX A;  5CVI A;  1SD5 A;  1T98 A;  1P6R A;  2G7U A;  1LVA A;  3QRF F;  2FE3 A;  4KNY A;  2A5Y B;  3ZMD A;  3DPL C;  3CUQ B;  2DTR A;  1QBJ A;  2GQQ A;  2O3F A;  1MKM A;  1ZHF A;  2FA5 A;  1S7A A;  3DKW A;  2JPC A;  5F64 A;  3KLO A;  5K1Y A;  4MEY F;  3RYP A;  3G3Z A;  4U7D A;  4U88 A;  1DP7 P;  2OD5 A;  2ZXJ A;  4EQQ A;  2DLL A;  2V6C A;  5J6X A;  3ECH A;  3MCZ A;  1D8J A;  2QBY B;  4CXF A;  2FBK A;  2LKP A;  3FM5 A;  1MD0 A;  4BHC A;  3P9C A;  2A69 F;  4PCQ A;  3B02 A;  1XDU A;  2DAO A;  4U0W A;  4Q47 A;  3GVA A;  2ISY A;  2W85 A;  1FPQ A;  3BJO A;  5D5U B;  1IN8 A;  1S3J A;  2DK5 A;  2ISZ A;  2QQB A;  2DI3 A;  4G94 A;  3T5X A;  1F9N A;  3GLX A;  3T0Y A;  1C0W A;  5ICG A;  2K27 A;  3JAM K;  1AWC A;  3IRQ A;  4HYE A;  1FY7 A;  3KP7 A;  5BOX A;  4GYI A;  4Q5S F;  3I5U A;  1I1G A;  2Q8K A;  5JHU A;  4KFC A;  3U1D A;  1BI0 A;  1ZG3 A;  5FFZ A;  4N0B A;  4F7Z A;  2ZKZ A;  4GGG A;  4I98 B;  3EYI A;  5D5X B;  3ZMV A;  3L7W A;  3I64 A;  2L3D A;  3FF5 A;  4BQA A;  4B09 A;  3PQJ A;  1T6S A;  4HV6 A;  4LJZ F;  4A6D A;  5HVQ C;  1U78 A;  4XLP F;  1HW5 A;  3WGH A;  2L4A A;  4JBA A;  1B9N A;  3EQL F;  2Z3Y A;  4Y13 A;  3GFI A;  1B9M A;  3KZY A;  1O7F A;  3O6B B;  4M71 A;  1WI9 A;  1KU3 A;  2E7W A;  5LLQ A;  4OIQ F;  2Z99 A;  4RB2 C;  2L54 A;  1R58 A;  2IJL A;  5IT9 K;  4IVN A;  2HFH A;  3QOP A;  5BPD A;  4AIJ A;  4IRI A;  4M73 A;  1XGO A;  2CSO A;  4L9J A;  2CFX A;  3L09 A;  3WU1 B;  1Z7U A;  1OKR A;  1RNL A;  2W57 A;  3I4P A;  3CO7 C;  4A0Z A;  3F6V A;  3I0T A;  2P6T A;  3WG9 A;  2PBI A;  2KIF A;  1T39 A;  1PDN C;  2FSW A;  4IRH A;  2P7C B;  1WKM A;  4H0E A;  5HS9 A;  1FWZ A;  2OQG A;  2RVC A;  2D45 A;  2A61 A;  2EFN A;  1BI1 A;  1KQ9 A;  1LNW A;  2X0L A;  3ELK A;  4MNU A;  1FSH A;  4MTD A;  4HDV A;  3C3W A;  5LBQ A;  3JTG A;  4P55 A;  1ZGA A;  3K1M A;  1UST A;  2G9W A;  2JTV A;  4LK1 F;  2V1X A;  3K1N A;  4HLX A;  2FBH A;  5IT3 A;  2KIM A;  3QPT A;  3GFM A;  4UVC A;  3WE3 A;  2GWR A;  3TDZ C;  2O0Y A;  4N9H A;  4A5N A;  1O3T A;  2L02 A;  1XMK A;  1HKS A;  3FXQ A;  2ZO4 A;  2M5W A;  5F6F A;  3N4M A;  5D5V B;  3N97 A;  2W24 A;  5EEH A;  5BS6 A;  3TKY A;  5JI6 A;  4WXC A;  2DQR A;  3I58 A;  3LA2 A;  1BOA A;  5CVR A;  1WQ2 A;  2M1B A;  2FMY A;  4Q48 A;  1BC7 C;  5AON A;  3JAM Z;  1HW1 A;  2ZJ2 A;  3D0S A;  3KEQ A;  2GXG A;  4IXA A;  3C18 A;  2STW A;  2HTJ A;  3ZPL A;  1ZRF A;  1XD7 A;  5BMZ A;  1P4W A;  5D4R A;  4UVB A;  2VBX A;  2MH9 A;  1B6A A;  1KYW A;  3JSO A;  1MJA A;  2XAS A;  1EH6 A;  5E1X A;  4NHJ A;  3NRV A;  1USS A;  3ZMT A;  1ZH5 A;  3ZN0 A;  4M9S A;  3F6O A;  4HV5 A;  1FYK A;  3WTT C;  1I6X A;  4YFN F;  5TJJ A;  3E5X A;  3HYI A;  3V8L A;  2A6E F;  2VE8 A;  5BQT A;  1BJA A;  2E7X A;  5E8I A;  3WTS C;  2DW4 A;  1BM9 A;  4I01 A;  5D4S A;  2EFW A;  5DD8 A;  4I0A A;  2QVO A;  4KIF A;  1K6O A;  2E1C A;  2CWE A;  2A07 F;  2CG4 A;  4I09 A;  2PMU A;  4BAY A;  5LRS A;  3QU3 A;  1RUN A;  1KU9 A;  4RGR A;  1J2X A;  3FXU A;  3GXO A;  5J8C A;  1IF1 A;  4U7B A;  3HSR A;  2EV5 A;  1XMA A;  2YX4 A;  4KA4 A;  2KJC A;  3JW4 A;  3ZP5 A;  2LNB A;  1QGP A;  4O6J A;  1KA8 A;  2GAU A;  1ZAO A;  3F3X A;  2XAH A;  3GX4 X;  2DK8 A;  1ZLJ A;  3RKX A;  4EM0 B;  3E6C C;  5CVJ A;  4UVA A;  2HDC A;  2VBZ A;  4ZYG A;  2FF4 A;  4WXH A;  1WRJ A;  3GZ5 A;  3LFK A;  1RIO H;  5H6R A;  1IRF A;  3K69 A;  2M87 A;  3FHZ A;  3RDI A;  1BIB A;  1XSV A;  5LEJ A;  2RDP A;  1JGS A;  3WTZ A;  4RAZ A;  3DFG A;  1HST A;  2O03 A;  1LDJ A;  2HR3 A;  1ZLK A;  4QLC U;  1TNS A;  4IJA A;  3FMR A;  3BJ6 A;  3Q5F A;  1R5G A;  5ED4 A;  1R1T A;  2MLK A;  2O6G E;  2DO7 A;  2XIG A;  4EM2 A;  2XGX A;  5K5R A;  2NNY A;  1O3R A;  1G3T A;  1QZY A;  4WK8 F;  4WF2 A;  3PFI A;  2OA4 A;  2EJR A;  3AAF A;  1MGT A;  3E6B A;  2QQ9 A;  2WC2 A;  3IL2 A;  4LB5 A;  1YW7 A;  2CGP A;  1YW9 A;  4A12 A;  1REP C;  5HDN A;  1R5H A;  2VN2 A;  4ZZD A;  5LHH A;  2H6B A;  3DEU A;  1G3Y A;  2L4M A;  1SAX A;  2IT0 A;  4GO1 A;  3GYH X;  2VON A;  5KVR A;  1GXP A;  1TQM A;  3H3Z A;  2WTE A;  1XSX A;  1P92 A;  1YQA A;  4E70 A;  5K5Q A;  4ESF A;  5DUI A;  2YPR A;  1O3Q A;  2ESN A;  2RKH A;  2VE9 A;  4FX0 A;  2RC4 A;  1BIA A;  3F8N A;  4EGZ A;  1TNT A;  2HGC A;  3U2R A;  2P5L C;  1KGS A;  3TO7 A;  1HXD A;  1XGN A;  3KP3 A;  2DU9 A;  3JSP A;  3KE2 A;  4L5I A;  2LF8 A;  3ZMU A;  4KN7 X;  5HDG A;  3GUD A;  4MGR A;  4UV9 A;  4RS8 A;  2VBY A;  4G6Q A;  4RB1 A;  5LGU A;  2F5F A;  2P5V A;  1K78 B;  2FBI A;  3CJN A;  2DPU A;  2NAZ A;  2QM3 A;  3L00 A;  1SMY F;  2PJP A;  3Q9V A;  3ROU A;  1OYW A;  1B1B A;  2IPQ X;  1CF7 B;  4RGX A;  5CVV A;  1FBQ A;  2FRH A;  1ZG5 A;  1XN7 A;  4G6D A;  4DNC A;  5H6Q A;  1BI2 A;  1X3U A;  4HA8 A;  3V8J A;  1J9I A;  1FBS A;  3F72 A;  2UXX A;  1S7O A;  2EB7 A;  3L2C A;  1ZYR F;  2XAJ A;  2PN6 A;  1PUE E;  1BC8 C;  5F1R A;  2H09 A;  4GXO A;  1J7K A;  5E20 A;  4K2E A;  4EMS A;  4S05 A;  5CVU A;  5LHI A;  4BNC A;  3REO A;  2FOK A;  1J75 A;  3KFW X;  4MEX F;  2FNP A;  5DDG A;  4L9N A;  1AOY A;  1BN5 A;  1EH7 A;  1YFH A;  4R79 A;  3E3V A;  2OU2 A;  3K1P A;  4CHU A;  2K4J A;  5D8L B;  2OZ6 A;  1FOK A;  3PQK A;  5J8F A;  1OYY A;  2HS5 A;  4HX4 A;  2Q2E A;  3R60 A;  3BRO A;  4ENJ A;  1BI3 A;  5DUK A;  2KJB A;  2P6S A;  2C6Y A;  1Z6R A;  3RI4 A;  3O3K A;  2EA2 A;  4LG0 B;  2IP2 A;  5LGN A;  4AIH A;  1IXR C;  5AIQ A;  3HSF A;  1GXQ A;  1MJB A;  2PFB A;  1S8N A;  1W4M A;  2YU3 A;  1F1Z A;  4OMZ A;  1TW3 A;  5CYV A;  3VOE A;  4XBF A;  1FP2 A;  2HZT A;  4A0Y A;  1T0F A;  2P4W A;  4GYG A;  1JHF A;  4I2O A;  2FXA A;  1YIO A;  3WGG A;  1WSU A;  1KQ8 A;  4ZYH A;  3KP5 A;  3P9K A;  4ENM A;  2X4H A;  4A5M A;  4RB3 C;  3KEO A;  2IA0 A;  4EGY A;  2Z33 A;  2K4B A; 
#chains in the Genus database with same CATH topology
 3W6K B;  1MIJ A;  5H20 A;  4IO9 F;  3SZP A;  3VEP A;  3PNV A;  3ZQC A;  5FLX K;  3SXY A;  2ECB A;  2YX7 A;  4NQW A;  4U0Y A;  4IPA A;  2EA4 A;  3IKV A;  1X2M A;  3I56 I;  1FP1 D;  5L3B A;  3SHF A;  2LD5 A;  4RAG A;  4XR6 A;  1D0Y A;  4M9Z A;  3D5L A;  3IH2 A;  1E17 A;  3S16 J;  1T38 A;  3DV8 A;  1G3S A;  2KDO A;  1ODD A;  1P2F A;  2GA2 A;  2KIU A;  2QKL B;  3FXR A;  2J5P A;  4DBQ A;  1R71 A;  4XLH A;  4D5F A;  4LLN A;  2OF7 A;  2M0C A;  3HUG A;  4ETS A;  2F2E A;  2WAD A;  2AS5 F;  1I6H J;  3HTU A;  2LRD A;  3HRT A;  4M74 A;  3RSN A;  4ZJZ A;  2BEO A;  4O5V A;  3FXJ A;  1NK2 P;  1FSE A;  2VJJ A;  4I02 A;  5GAD J;  2VXD A;  4EM1 A;  3P9I A;  1R36 A;  2NS7 A;  4M3F A;  3VB2 A;  4BEH B;  2QUF A;  1U8B A;  2MA3 A;  4M3D A;  2L5Q A;  2Q0O A;  1HC8 A;  1Y0U A;  1Q1V A;  4YFX F;  2JT1 A;  3A01 A;  1FNN A;  4RAY A;  3K0L A;  3RTR A;  4WCG A;  1V55 H;  5M3M J;  2R7D A;  2O9L A;  3G73 A;  4HQM A;  3LNQ A;  3CCL I;  2Y69 H;  1DU0 A;  5HLT A;  3MFK A;  1JXS A;  1YS6 A;  1ZRD A;  1MH4 A;  4LK0 F;  1YO5 C;  4Y17 A;  1JUS A;  4CIC A;  4PK4 A;  4Y3O A;  5CQE A;  3BP8 A;  4RGU A;  1X1A A;  3U9G A;  4ZYE A;  3TOA A;  1L3L A;  3DCF A;  3R61 A;  3R0J A;  5HLI A;  1U5T B;  1Y56 A;  1FMW A;  2P5K A;  1IRZ A;  1HSJ A;  1SFE A;  4RBO A;  1Y8Q B;  1Z05 A;  3MZH A;  2BVL A;  4OIP F;  2VOO A;  1KQ0 A;  5JVG F;  3FXK A;  1H9T A;  4IF4 A;  2NNN A;  3M07 A;  2ZSH B;  3HHH A;  1MSF C;  4LGW A;  3E5Q A;  3EDP A;  3S1M J;  4XSZ F;  2K7L A;  5JFR A;  3UR3 C;  2JA7 J;  2A68 F;  1G59 A;  4NC7 A;  2KMU A;  1X1B A;  1QU3 A;  1IRG A;  1TT5 B;  4II3 A;  1HF0 A;  2QZ8 A;  3FMQ A;  3M1E A;  1D3Y A;  2AXL A;  2HPM A;  4HAM A;  3T8T A;  4CDG A;  4OIO F;  2TCT A;  5HOD A;  1LEA A;  2VKD A;  4A69 C;  1XGM A;  3KCC A;  2ID3 A;  2DBB A;  5DV5 A;  2M34 A;  3I54 A;  1DDN A;  2HDD A;  3ABT A;  2R0Q C;  1VQL I;  4QWQ A;  5L3E A;  3BR0 A;  4BXU A;  5HOO A;  2DQL A;  5HS8 A;  1RRJ A;  3KYC B;  4MHG A;  1M1E B;  4FCY A;  2XV4 S;  5H2F C;  2HEO A;  2DFI A;  2QQA A;  3K4L A;  2BYV E;  1X3W B;  2MC3 A;  3CJT B;  4Y15 A;  1HW2 A;  3QAH A;  2EH3 A;  5E1Z B;  3GO5 A;  1X58 A;  1K61 A;  3Q0U A;  2MH2 A;  5JLX A;  3VYU B;  1TWF J;  4A3E J;  2R7Q A;  5EG0 A;  1XTA A;  1LFP A;  2KRC A;  2GIV A;  3WTU C;  1XSD A;  4BHP A;  3F8B A;  4PUS A;  3HB9 A;  4UNO A;  1MZB A;  4ZYD A;  4WX9 A;  2F5C A;  1XCV A;  5TIS C;  3DPT A;  2IBD A;  4A3G J;  2QCO A;  2GZW A;  2DMU A;  1G4D A;  4A3D J;  1P4A A;  4CGZ A;  4LLL A;  2V4J C;  1PP7 U;  1GVJ A;  1FOX A;  1POG A;  2K5C A;  1I3A A;  3TBI A;  3HHG A;  4BEH A;  1OIS A;  1YTY A;  1K4T A;  3QP5 A;  1EV7 A;  3R4K A;  1H9G A;  1OR7 A;  3SQN A;  3E6M A;  1A35 A;  3M4O J;  3E7L A;  2JSP A;  2JVH A;  5E1W A;  1O3S A;  1HBX G;  5LFA A;  2IRF G;  2HPI A;  1IN7 A;  1YG2 A;  2P81 A;  2XC7 A;  3FX3 A;  2DTZ A;  1IN5 A;  5L3G A;  1FYL A;  4XLC A;  2X6Y A;  3BCA A;  4G9Y A;  2HWV A;  3LSM A;  4OIR F;  2RAE A;  2DT6 A;  5C4X J;  4MFE A;  1MSE C;  1X1P A;  4JX5 A;  2HQ5 A;  3EYY A;  3K2Z A;  2R7F A;  4BY7 J;  3TQN A;  3CUO A;  2OAZ A;  2AXT C;  2CW0 F;  4HZF A;  3HOW J;  4BBS J;  5B1A H;  1MBF A;  1J0R A;  1ZGJ A;  2EFO A;  2E1O A;  3HM5 A;  1ETW A;  1FOW A;  4G8X A;  2CQQ A;  4BXX J;  2MGQ A;  5EZG A;  4DYC A;  3A0B C;  5ILS A;  4HOB A;  4N9I A;  1QPM A;  4ENN A;  1V3F A;  2F5D A;  3B73 A;  1SAU A;  1XDS A;  3D5S C;  4CCL A;  2DA2 A;  3Q3S A;  2FNA A;  4EV0 A;  3OYA A;  3J80 K;  2V1D A;  3GTM J;  3KLN A;  2EV6 A;  1W5S A;  2XPV A;  2KIS A;  3QOD A;  3S2D J;  1OCZ H;  1IDZ A;  2XAQ A;  3GF2 A;  2NRA C;  2ESH A;  2Y48 A;  2WAE A;  1TWH J;  3QPS A;  3V7C A;  2IS2 A;  3ZRG A;  2V26 A;  1RI7 A;  3HRS A;  3PNY A;  4ZYA A;  2XF7 A;  3RJP A;  3CUQ A;  3HTS B;  1OMI A;  4AVP A;  3WGI A;  1Z1D A;  4HNT A;  2JA8 J;  3ONQ A;  2XRL A;  4ITV A;  2VOD A;  1S29 A;  2XRO A;  1N25 A;  5E8G A;  2PQ8 A;  1K79 A;  5DS9 A;  1YRN A;  5FD5 A;  3K70 D;  4CCO A;  3KPH A;  2ZCW A;  1DU6 A;  5KAI C;  2P7V B;  1UB9 A;  1FBU A;  1ETQ A;  5D8K B;  2LFB A;  2XAF A;  5FKO A;  3IC7 A;  1R23 A;  2HXO A;  3RQI A;  3WTY C;  2DT5 A;  1SD7 A;  3BQZ A;  2M30 A;  3DF8 A;  4ZC3 A;  2FQ3 A;  5IP9 J;  4BDY A;  1R9T J;  1SD6 A;  1OCO H;  4AYB A;  4D5C A;  4LMY A;  5J4V A;  2HDW A;  1ON1 A;  2A5W A;  2IGN A;  3JRD A;  3ABM H;  1E2X A;  1I27 A;  1E3H A;  1W5C C;  4E7S A;  2JRT A;  1Y39 A;  1JTY A;  5CJ9 A;  4AUX A;  3TGN A;  1OR7 C;  2OQR A;  2JPB A;  3RCO A;  3T1B A;  2LY9 A;  1VQ8 I;  1R00 A;  3HIF A;  2ELK A;  3U1K A;  2A3S A;  4YFK F;  1A5J A;  3W6J B;  2QLZ A;  1V4R A;  4AWX B;  4EJO A;  4A2U A;  4PJM A;  4YRV A;  3RKW A;  4RDU A;  5E18 F;  1DP3 A;  2DA4 A;  4E7Z A;  5E17 F;  3RYR A;  2VLA A;  3ZXS A;  3B6C A;  2RNJ A;  3M8J A;  3KP4 A;  3DP7 A;  2FUG 2;  3G1L A;  4FT8 A;  2VAS A;  3LMM A;  3LQR A;  3F8F A;  1IW7 F;  5FGM A;  4C3J J;  4EVI A;  2L9R A;  3DQV C;  1XB4 A;  5FD6 A;  2JUC A;  3EUK L;  4OIN F;  2WB1 A;  3FKI J;  3J7A Y;  2K9Q A;  5M5X J;  4A3L J;  4F92 B;  1F4K A;  1DUX C;  1FC3 A;  1J59 A;  3AL0 B;  4BS9 A;  3WOD F;  4B3A A;  3FM3 A;  1K7A A;  3HOY J;  3OIQ A;  1W5T A;  3AG3 H;  3TED A;  2DOA A;  3CQZ J;  3HGG A;  2E1M C;  4HX8 A;  4G7H F;  2E2I J;  4ESJ A;  1Y1V J;  5JVT A;  2NVT J;  1VQ9 I;  1TWG J;  5C44 J;  5BNG A;  5HDK A;  2QEN A;  2VI6 A;  1FX7 A;  2COM A;  4J19 A;  4XKC A;  1DGR M;  1Q1H A;  3J81 K;  4BH9 A;  2E36 A;  5B66 C;  5IP7 J;  3WU0 A;  5BPI A;  3I3L A;  4IRG A;  3BJA A;  4XL9 A;  1OCC H;  4EJW A;  5KNL A;  3RPQ A;  3HL2 A;  2L0K A;  3EUA A;  4RMN A;  2BY1 A;  4PZJ A;  4RB0 A;  4U0V A;  3OIO A;  2CUE A;  2OZU A;  2M8E A;  2R3S A;  2FU4 A;  2LYC A;  3H0D A;  2DPD A;  2W00 A;  3JTH A;  2K3P A;  5E3M A;  4J01 A;  1UHS A;  4IHW A;  2F5V A;  2H6C A;  5A2Q Z;  2GIZ A;  3T8R A;  4HEA 2;  5F0C A;  4KIG A;  2V79 A;  1QNT A;  3HRM A;  2YR2 A;  1CF7 A;  3BG9 A;  4MQV A;  4G12 A;  1X1C A;  5EDN A;  1MBE A;  2K02 A;  4BXF A;  3H3V K;  4X6A J;  5FLV A;  2JSC A;  3OS2 A;  4BE1 A;  2HOE A;  2DMT A;  4V2G A;  2O7O A;  5C4J J;  3L2R A;  5L3D A;  1N75 A;  2BGC A;  4CO8 A;  3NEU A;  3BOQ A;  1QO0 D;  4G7O F;  3F23 A;  2JRM A;  4A3C J;  2V1N A;  1F36 A;  3JRB A;  4HQE A;  2Z16 A;  2NVU B;  4BDZ A;  1QHG A;  1MJ9 A;  2KP6 A;  2QA4 I;  1LFB A;  4ZH4 F;  3TOB A;  4CZC A;  5D6E A;  2P8T A;  2JMW A;  5HNH A;  4WXD A;  3G4S I;  3SZT A;  1U2W A;  2PLY A;  3MZY A;  2Y0M A;  1UHM A;  4OU0 A;  1IXC A;  2DDA A;  1MMG A;  2VC0 A;  4OMY A;  1KZH A;  2UZK A;  1JJ8 C;  1LKX A;  2CUF A;  2WAF A;  1Z91 A;  3CCY A;  2ZNY A;  2QYO A;  4ZZL A;  2DFF A;  2F5E A;  3NQO A;  1JHH A;  3BR3 A;  1MDM B;  1W7P B;  5GAH J;  4HF2 A;  2DFH A;  1PJR A;  2K86 A;  4GRI A;  3H92 A;  1TQP A;  2M9H A;  3CLO A;  2Z9O A;  4FX4 A;  4QPO A;  1Y8R B;  4JQF A;  2H94 A;  4D0P A;  3BG6 A;  3KP6 A;  3V7R A;  3H5A A;  5FJ8 J;  1MND A;  5LEK A;  1U3E M;  3LAP A;  3BWG A;  3RPU A;  1LE8 A;  1SMT A;  3CP8 A;  4Q4Z F;  1FT9 A;  4XRF A;  4QPQ A;  2NOJ B;  1NTC A;  3KET A;  3J80 Z;  4B8X A;  2EZL A;  3I59 A;  2HOT A;  2BV6 A;  4R8H A;  2V6E A;  2A05 A;  1WJF A;  2R7O A;  5KAF C;  2PEX A;  1V54 H;  2JJ7 A;  3BTC A;  4HF0 A;  4HSR A;  1Z9C A;  4P1W A;  3OYH A;  3I71 A;  3AG2 H;  2VQH A;  3OV8 A;  2XUB A;  4HX7 A;  3V4G A;  2FEZ A;  1U5T A;  1JI8 A;  1D0X A;  4PGH A;  1DPR A;  1S7E A;  3OOU A;  2R7T A;  4XK4 A;  4CYD A;  1IGN A;  5TRD A;  1Y1W J;  3BPX A;  2UXN A;  6PAX A;  2L9V A;  1LDK B;  5F04 A;  1X4O A;  2H27 A;  2HYF A;  4PSW A;  2ZXH A;  3IWF A;  1I5Z A;  4W97 A;  2ADU A;  2ZJQ F;  1IAW A;  1OLT A;  2F4O B;  1R5I D;  2EIL H;  3F21 A;  2LSO A;  2UUZ A;  2E71 A;  2NS0 A;  4KYW A;  3AFH A;  2XGE A;  3Q9S A;  4KUM A;  3OYL A;  1JKO C;  3VSK A;  3IV5 A;  1Z0X A;  1ZR4 A;  3KZZ A;  2KZG A;  4YII A;  1FTT A;  1S9H A;  3BZ6 A;  2LDU A;  4OAZ A;  3AG4 H;  1R4M B;  3CMM A;  1RKT A;  2L9N A;  2AQF A;  3AKZ A;  4MIM A;  3LQQ A;  4CCN A;  2ZME B;  5K7H A;  4AD9 A;  4WWC A;  2VXZ A;  2NVQ J;  1W1W E;  3MZ8 A;  4ENK A;  3SEZ A;  3ML6 A;  3WTX C;  4XOR A;  5FKM A;  2XF5 A;  4II2 A;  2O61 A;  4UY8 I;  3HSE A;  1JE8 A;  1F5T A;  2RN7 A;  3CUQ C;  2FML A;  4CA0 A;  1P7J A;  2Z1D A;  2VC1 A;  4B4C A;  4P9U A;  4FET A;  3ZQQ A;  4KDP A;  5IOY A;  3S2H J;  3J7Z I;  3H35 A;  2EPF A;  4LG0 A;  4LB6 B;  2D2W A;  2ZME C;  2F4M B;  4G6T B;  3RQ4 A;  3KX2 A;  4ANJ A;  5FKL A;  4KIT B;  4IHT A;  2J5O A;  2VQL A;  2KIQ A;  5LRR A;  2YU9 J;  1I50 J;  4PJJ A;  1RR7 A;  3E97 A;  3ZMZ A;  2DA1 A;  2ZBK A;  1FZP B;  4BKX A;  1LFU P;  4E7H A;  1GV5 A;  2XKP A;  3VYR B;  2Y9Z A;  3FMS A;  4IQ4 A;  3ISP A;  4MQ9 F;  4ON0 A;  4XKV A;  4L18 B;  2R7U A;  1S6L A;  3H1C A;  3NAU A;  1AA7 A;  5KK1 A;  5L3F A;  1B8I A;  1Z77 A;  5D5W B;  2HYG D;  5CKT A;  3FIW A;  1K78 A;  2R7X A;  4I7H A;  3G1O A;  3J7A O;  3BZC A;  3EET A;  3KEY A;  5FLX Z;  1B4A A;  2VJI A;  1SEU A;  1TL8 A;  3GWZ A;  3OYI A;  1A31 A;  1OYI A;  1QQI A;  4HBL A;  2BY3 A;  4NBQ A;  1JKR C;  2A6T A;  1QRY A;  2VB6 A;  4EEF G;  4DQ2 A;  2WBM A;  4FQG A;  1D5V A;  1B59 A;  3CME I;  2XVC A;  4TV7 A;  1U5T C;  1OPC A;  4MLO A;  1GUU A;  1VZ0 A;  4JK1 X;  1SFU A;  2AHQ A;  2CRG A;  2DOD A;  2XKO A;  2HOA A;  4ZDL A;  3J81 Z;  1TT0 A;  2ELJ A;  1ITY A;  1YYV A;  2CS3 A;  2W25 A;  2IA2 A;  3K4B A;  1LJ9 A;  1ZK8 A;  4ABZ A;  3CO6 C;  4DGW B;  2BY2 A;  3HKZ N;  1WJE A;  2XHK A;  5CLS A;  3SZG A;  5EYR A;  1A6Q A;  4F93 B;  3F8M A;  3V8K A;  4LD5 A;  4A93 J;  1MBH A;  2ACJ A;  2K3F A;  2L7Z A;  1TQI A;  1TWC J;  2LBF B;  4KIB A;  4ASN A;  1PP8 F;  4XLA A;  1IV8 A;  5GPC A;  3PUB A;  3K4J A;  1ZR2 A;  1TLH B;  4XKB A;  1U8R A;  1WWX A;  3GZN B;  2O8X A;  3H0G J;  3UKG A;  2X6W A;  1MMN A;  2EV0 A;  2ZXW H;  4DYR A;  4YG2 F;  3BDD A;  2OC6 A;  2VBW A;  3EUH A;  1YX5 A;  3MKZ A;  4L0Y B;  1BOB A;  4CCM A;  1ETV A;  1HKQ A;  5J4Y A;  2KDZ A;  2HTS A;  1VF9 A;  3BG3 A;  3K4C A;  2B0L A;  4IHS A;  2MD5 A;  1J09 A;  2IGO A;  2HYJ A;  3ULQ B;  2STT A;  1PYV A;  4XLN F;  4EJT A;  2WY7 Q;  1ZN2 A;  3IHU A;  2HVR A;  2COB A;  2XB0 X;  4P5O A;  4NQW B;  1H0M A;  1NHA A;  1Y6I A;  3SFZ A;  1G8X A;  1V5E A;  5KCM A;  3LA7 A;  4BJ5 C;  2ZME A;  2L9S A;  1UFM A;  1T2K A;  1APL C;  1YIJ I;  2XPW A;  3LST A;  3GFJ A;  2X1D A;  3HXL A;  3H5N A;  3H3U A;  3S2W A;  2IVM A;  3GME A;  3BZK A;  1D8K A;  3TO6 A;  2PX9 A;  2WA0 A;  3PSF A;  1X19 A;  5EEG A;  2V9V A;  5K7Z A;  1LEB A;  3HPG A;  1SD4 A;  4KT5 C;  3OYE A;  3IKT A;  4M72 A;  2GXB A;  3WG7 H;  2MD0 A;  3LA3 A;  3CJQ B;  3W2W A;  2HQR A;  2K9N A;  4RLQ A;  4O3M A;  5DD4 A;  2G7H A;  1IXS B;  2BE5 F;  3QU6 A;  4XIC A;  2ID6 A;  1ERD A;  4A3J J;  3E6D A;  3K9T A;  1G3W A;  2W84 A;  4PFP A;  1JUM A;  3GFL A;  3DTI A;  1BR2 A;  3BPV A;  2PJR B;  4BHB A;  2MG4 A;  1D5Y A;  3O2P E;  3HOT A;  3ERE D;  1ETK A;  2MW8 A;  4KMF A;  4BJ6 C;  2IGK A;  2FX0 A;  2V9K A;  4NB5 A;  3ZOB A;  3PO2 J;  1RC9 A;  4B47 A;  1R22 A;  4HF1 A;  1MNE A;  4V2F A;  2E34 A;  1STZ A;  1IUY A;  4JP0 A;  1ON2 A;  2DXI A;  3TDU C;  1ZRC A;  1RES A;  1I1S A;  3DTK A;  3V7S A;  5L3C A;  2KKO A;  4D9J A;  3VFZ A;  2QSG X;  2VOP A;  1XCB A;  2CQ7 A;  3LWF A;  3M7G A;  4KN4 X;  3F8C A;  1LDD A;  5B5E C;  3IRR A;  2GLO A;  4UUS B;  4RLF A;  4PGG A;  2ZSI B;  3CTA A;  4ZDP A;  1VQN I;  4CUG A;  3G1M A;  1FIP A;  3WE2 A;  2VUM J;  1WI3 A;  1Z6T A;  3S14 J;  4XQF A;  1CGP A;  4GDF A;  2QGU A;  1ETO A;  3FK7 A;  3M8F A;  1W7P D;  2WV1 A;  2MLG A;  1IN6 A;  5D6F A;  1IV6 A;  3PUF A;  2NVY J;  1JT6 A;  2A6H F;  1B72 A;  1FJL A;  1DGW Y;  5FLM J;  1F43 A;  1QZE A;  5DEQ A;  1MDM A;  3SJM A;  1XGS A;  5DCM A;  4QTR A;  3DBR B;  1SFX A;  4HW0 A;  3OS1 A;  1W7P A;  3LAJ A;  3ZN1 A;  3VOD A;  2L2O A;  2RQP A;  1KON A;  4R1H A;  3D1N I;  1IZ1 A;  2IW5 A;  4A0X A;  5ICE A;  2R5Z A;  1R1V A;  2F4I A;  4EAT A;  2XAG A;  3COA C;  2EWN A;  2RV8 A;  1IO2 A;  1LB2 A;  1BR1 A;  3OYC A;  4JOM A;  2LK2 A;  4UV8 A;  2E60 A;  4RGS A;  2Z5U A;  3C1D A;  4A3K J;  3BR5 A;  4S04 A;  3KP2 A;  3CDH A;  2ETH A;  3FKJ A;  5HS7 A;  3A02 A;  3QPL A;  4XLF A;  5FO5 A;  4B1R A;  2LP0 A;  1UG0 A;  2PMH A;  3IH3 A;  4GCV A;  2R7V A;  4OOI A;  1YLF A;  2KT0 A;  3TP0 A;  1NG6 A;  3OYG A;  5LGT A;  4XSX F;  2PI0 A;  2M45 A;  2Y2Z A;  1WH5 A;  1O7L A;  4P9F A;  1WJB A;  2LOO A;  5LHG A;  1RUO A;  4IKF A;  4L9T A;  4A6E A;  2L01 A;  1ZRE A;  2D1V A;  4XRS A;  1MMS A;  3RKY A;  1ACI A;  4AU7 A;  2ME0 A;  5M3F J;  1KU7 A;  3VYT B;  2BHY A;  4HNV A;  3WTV C;  3ABK H;  3ZQ7 A;  2B7E A;  4Z2Y A;  2VPL A;  1JTX A;  3H9J A;  5E3N A;  3K70 C;  3A03 A;  1O57 A;  1TBX A;  4AID A;  1GLN A;  2EIJ H;  2RRE A;  3MD2 A;  2PG4 A;  1RR8 C;  3HOU J;  5J3L A;  4DBR A;  2BBY A;  3FDY A;  2L7F P;  3K4M A;  2CW8 A;  2TRT A;  3E5U A;  1LUJ B;  2HKX A;  1KYZ A;  4AIK A;  2HKO A;  1HA8 A;  1DPU A;  3CCV I;  1X4P A;  1RET A;  2XAU A;  2XGD A;  3MEX A;  4YIF A;  5FFX A;  4E7K A;  3BTL A;  1HLV A;  1UCR A;  4P96 A;  5HLH A;  1VQ4 I;  2PMZ N;  1WCM J;  1BW6 A;  4ESB A;  4UB8 C;  2O5R A;  4X0G A;  5J1Y A;  1T08 B;  3ZP5 A;  4UHT A;  3DXJ F;  1D1A A;  2E5N A;  1OJL A;  3F9K A;  4PDK A;  4YEJ A;  4XRM A;  1V5G A;  2X1C A;  3JR9 A;  4IX7 A;  2GA1 A;  2VPR A;  5ERI A;  1IN4 A;  3DLA A;  2JZY A;  3K2A A;  3WTW C;  5LD2 C;  1FYM A;  4I99 C;  5FB2 A;  1WHU A;  2ELH A;  1ONV A;  2EIM H;  4B3X A;  5ILU A;  1XG1 A;  1JKP C;  1ULY A;  2K9L A;  1UMQ A;  3S93 A;  1HQC A;  4BUP A;  2R7S A;  1VTN C;  3OOP A;  2EZK A;  1E3P A;  1VQ5 I;  3SFI A;  4KIC A;  2RNG A;  2LR8 A;  5DYM A;  3LSJ A;  2JQ7 A;  5F27 A;  2Y0S A;  3S1R J;  1UHW A;  4MTE A;  4ZDO A;  1P4X A;  3I55 I;  1HOM A;  2QWW A;  2Y75 A;  3QP6 A;  3P7N A;  1XC5 A;  3ZQI A;  2GXA A;  4ZTJ A;  3GW2 A;  4B43 A;  2RGV A;  2W48 A;  2DOE A;  1RKW A;  4KMU X;  3FZV A;  4BU2 A;  3QPH A;  3HOS A;  2K9M A;  3RIR A;  3L1P A;  1JUP A;  3DPU A;  4FHT A;  4LFU A;  1ZQ3 P;  1PUF B;  3MAJ A;  4CZZ A;  4HDU A;  1R1U A;  4Z6Y A;  5CQG A;  2EIK H;  2R93 J;  4LIT A;  4HST A;  3JRH A;  2R5Z B;  3HOV J;  3C7J A;  3S17 J;  2OPT A;  2VJ5 A;  2X6X A;  2IS6 A;  2M0M A;  3GEZ A;  2QBY A;  3OL3 A;  3MQ0 A;  3S32 A;  1BJZ A;  2ZFW A;  1E0E A;  1MNM C;  4A3F J;  3R6S A;  3R0A A;  2WWY A;  1HKT A;  3DEE A;  4M6Y A;  2OBP A;  3TO9 A;  3H5R A;  1L0O C;  1VND A;  5CPR B;  4C2U A;  3G6E I;  3EUH C;  1G6N A;  2DYS H;  2YSR A;  3ECO A;  3CC7 I;  2Z2S B;  1ZG1 A;  1BA5 A;  1J5Y A;  2XRN A;  4HLY A;  2HVS A;  4L0Z B;  4PJ0 C;  5ICF A;  5FKN A;  1ZAR A;  3M8E A;  5IT9 Z;  1P7I A;  2LG4 A;  5A2Q K;  3L9F A;  2NVX J;  4UXN A;  2LKS A;  2ZNZ A;  3ZMS A;  3CCJ I;  5FRO A;  4C2M J;  1TTY A;  3H36 A;  2VQG A;  1FLI A;  3GZ6 A;  2CYY A;  1YS7 A;  1K6Y A;  1RZ4 A;  2E5Z A;  3BY6 A;  1FMV A;  2CO5 A;  4E4H A;  2JVG A;  1T33 A;  4D1Q A;  4LLG F;  1R7J A;  1A04 A;  3MWM A;  1EH8 A;  2E1N A;  2DYR H;  2KZV A;  2K85 A;  3K10 A;  1BBY A;  1SVL A;  3HRU A;  2IA1 A;  5FRM A;  3ZR8 X;  1YW8 A;  1OFC X;  1B8I B;  1WH7 A;  4BAC A;  5HLG A;  1SVM A;  4NNJ A;  1VQ7 I;  1U0J A;  5AIP A;  3TW7 A;  3HZJ A;  3PL8 A;  2CQK A;  3I53 A;  4I0B A;  2D1H A;  1W0U A;  3C2B A;  2CV1 A;  3S8P A;  1X1D A;  3F22 A;  1U6G A;  3HKZ A;  2QSH X;  5E3L A;  5J40 A;  4LIU A;  1QZZ A;  2VT2 A;  3K4N A;  4L5J A;  2NYX A;  3H9G A;  1ZTR A;  1ENH A;  3LOC A;  3OSG A;  4PSX A;  2CV2 A;  2VKH A;  4I6Z A;  5IYD J;  2HI3 A;  2ZJR F;  3ZQL A;  3I59 B;  1KU2 A;  5ICC A;  1Z21 A;  1ETY A;  1Z3X A;  3QYB A;  3FWE A;  2DT7 B;  5IYB J;  3JRC A;  1E3O C;  4M9X A;  2PJR A;  4BYY A;  2EFQ A;  1UZC A;  2EFP A;  1Z3Y A;  3IP4 B;  3HDD A;  2VT3 A;  5DCM B;  2MBF A;  3IWZ A;  2KHM A;  2EK5 A;  3M9A A;  5JR3 A;  4L9V A;  3RZD J;  4Y4R A;  2WV0 A;  3S3O A;  1WVR A;  4AYB N;  1GT0 C;  4RM3 A;  3OSF A;  2P0W A;  1LQ1 A;  4EJV A;  2V1U A;  1PVE A;  3CLQ A;  4BJT A;  4D7M A;  2UWM A;  4Y33 A;  5K5O A;  1YJ9 I;  1VQK I;  4G7Z F;  2LTP A;  3LFU A;  2K40 A;  5DCF A;  4M6X A;  4EJU A;  2KRF A;  1GHC A;  3ABU A;  3S1N J;  4XN3 A;  5ILV A;  2HQN A;  2LF7 A;  5FRN A;  2M4G A;  3KIO A;  4UUV A;  1TW2 A;  2TDX A;  5CVI A;  1SD5 A;  2ECC A;  4IL6 C;  4W1U A;  1T98 A;  4AM3 A;  2MAB A;  1P6R A;  2G7U A;  2CFO A;  1LVA A;  5F08 A;  2M8G X;  2EQR A;  3QRF F;  2FE3 A;  3PM1 A;  4KNY A;  4RM2 A;  2G0E A;  1WJD A;  1AU7 A;  2A5Y B;  3ASN H;  2VKE A;  1FEX A;  1ZEL A;  3ZMD A;  3DPL C;  2HXI A;  3CUQ B;  2HU9 A;  3L2V A;  2DTR A;  4DIQ A;  2ZXI A;  1QBJ A;  2DJI A;  2HOS A;  1SAN A;  2GQQ A;  2O3F A;  1MKM A;  1ZHF A;  2FA5 A;  3ZQG A;  1S7A A;  3DKW A;  3LSH A;  2JPC A;  2H1K A;  5F64 A;  3CES A;  3KLO A;  3S1Q J;  5K1Y A;  4E7I A;  4MEY F;  3RYP A;  3OYD A;  3S3N A;  3G3Z A;  2EZH A;  2E19 A;  4LOC A;  4U7D A;  4U88 A;  1DP7 P;  2OD5 A;  4JX6 A;  4E6K G;  1IUF A;  2JK3 A;  3M3Y J;  4J00 A;  2ZXJ A;  4EQQ A;  1VFC A;  2DLL A;  2V6C A;  1AKH B;  1X2N A;  5J6X A;  3ECH A;  3MCZ A;  1D8J A;  4HG2 A;  2QBY B;  2DMN A;  4CXF A;  2KFD A;  2DA6 A;  4CYC B;  1MW7 A;  2FBK A;  4UUS A;  1GVD A;  2ICW G;  2LKP A;  3FM5 A;  3FBN B;  1MD0 A;  1A36 A;  2KRH A;  5B1B H;  1V5F A;  3BQY A;  3QYE A;  4BHC A;  3P9C A;  2A69 F;  4PCQ A;  3B02 A;  2K9S A;  1XDU A;  2DAO A;  1QPI A;  4U0W A;  2OCC H;  1A6I A;  3K7A J;  4Q47 A;  3GTQ J;  2DFE A;  3OYJ A;  3GVA A;  1YHQ I;  2ISY A;  2W85 A;  3LSP A;  1FPQ A;  3BJO A;  5D5U B;  1IN8 A;  1S3J A;  2DK5 A;  2ISZ A;  1DQU A;  3A4C A;  2QQB A;  3W6V A;  2DI3 A;  1HCR A;  4G94 A;  1OCP A;  3T5X A;  2XSD C;  1F9N A;  3GLX A;  3GLL A;  3T0Y A;  3OS0 A;  1C0W A;  5JHF A;  1WJC A;  2V7F A;  5ICG A;  2K27 A;  3JAM K;  3BG5 A;  1AWC A;  3IRQ A;  4HYE A;  1FY7 A;  3KP7 A;  5BOX A;  4GYI A;  1RPW A;  4Q5S F;  3I5U A;  2FQ4 A;  1QHH D;  2JA2 A;  3GTK J;  1EA3 A;  2YS9 A;  4CH7 A;  4IHY A;  3P5J A;  1I1G A;  3NWS A;  5J47 A;  2Q8K A;  2VKV A;  5JHU A;  1W36 D;  3OYM A;  1N78 A;  1FTZ A;  3HJE A;  4KFC A;  3W2V A;  3U1D A;  1BI0 A;  3OYF A;  5JLW A;  4E7L A;  2ZC2 A;  1ZG3 A;  5FFZ A;  4N0B A;  2N8G A;  1K83 J;  3D5R C;  2AQE A;  4F7Z A;  3HUG B;  2B9S A;  2ZKZ A;  5K7F A;  3MVP A;  1SVO A;  4GGG A;  4I98 B;  3EYI A;  5D5X B;  3ZMV A;  3L7W A;  3I64 A;  5HNF A;  4IZZ A;  3HG9 A;  2Y9Y A;  2L3D A;  3BCB A;  2QKM B;  1TWA J;  2VL8 A;  2LY2 A;  2ZFU A;  3FF5 A;  4BQA A;  1OQY A;  4B09 A;  3PQJ A;  3JRF A;  4CCJ A;  4QSH A;  2I8D A;  5FKK A;  4C3I J;  1T6S A;  2EIN H;  5DTD A;  4HV6 A;  4LJZ F;  5C3E J;  1UAA A;  4A6D A;  1IC8 A;  1NK3 P;  5HVQ C;  1U78 A;  2F6C A;  1HW5 A;  4XLP F;  4M3E A;  2L4A A;  2VIX A;  4JBA A;  1XMX A;  4MFD A;  3WGH A;  3VSL A;  1B9N A;  2ZJP F;  3QOE A;  2MYS A;  3EQL F;  2Z3Y A;  4Y13 A;  3GFI A;  3AL0 C;  1B9M A;  3KZY A;  2E35 A;  1O7F A;  3PSI A;  3RKQ A;  3O6B B;  1U9N A;  3IH4 A;  4M71 A;  1TC3 C;  1WI9 A;  2LY1 A;  1KU3 A;  3VYS B;  4B48 A;  2E7W A;  1Z67 A;  5LLQ A;  4OIQ F;  2Z99 A;  4RB2 C;  3OYB A;  2L54 A;  5DM7 F;  1R58 A;  4DZP A;  2IJL A;  3WU2 C;  5IT9 K;  4M6V A;  1JGG A;  4IVN A;  2HFH A;  3QOP A;  5BPD A;  4AIJ A;  3CP2 A;  4IRI A;  4M73 A;  1LVK A;  1XGO A;  2CSO A;  4L9J A;  2CFX A;  3HEF A;  1B72 B;  3L09 A;  3WU1 B;  1Z7U A;  3DU5 A;  3PO3 J;  4FTH A;  4A3I J;  2JA6 J;  1OKR A;  1RNL A;  2W57 A;  3I4P A;  1VI0 A;  4CYC A;  2IXS A;  2XPU A;  4BQO A;  4DZJ A;  3CO7 C;  4A0Z A;  3F6V A;  3I0T A;  4V19 K;  2P6T A;  5F1J A;  3WG9 A;  3BTI A;  5EJC A;  2IS1 A;  2PBI A;  2I5U A;  2KIF A;  3OR1 C;  3VDX A;  1T39 A;  1PDN C;  2FSW A;  2XDV A;  4IRH A;  2P7C B;  1WKM A;  2WB1 N;  3KYD B;  1U9O A;  5GPA A;  4H0E A;  1I3Q J;  1LPQ A;  1IJW C;  3K4K A;  2YUS A;  4M3G A;  2NS8 A;  5HS9 A;  1FWZ A;  2OQG A;  2LBF A;  1D1C A;  2DCE A;  2RVC A;  3EPZ A;  2D45 A;  1YJN I;  2A61 A;  1FOY A;  2HQA A;  2X51 A;  2W4S A;  2EFN A;  1BI1 A;  1KQ9 A;  4CSW A;  4Y7N J;  1LNW A;  2X0L A;  2R5Y B;  1T8I A;  4B44 A;  2QQ8 A;  3ELK A;  3OY9 A;  2R92 J;  2M7B A;  4MNU A;  1FSH A;  2X48 A;  4HRI A;  2IS4 A;  4MTD A;  4HDV A;  2CJJ A;  1WGX A;  3C3W A;  5LBQ A;  3JTG A;  4P55 A;  3GTG J;  1EJ9 A;  1ZGA A;  4HNU A;  3W2A A;  3K1M A;  1UST A;  4IHX A;  3VPR A;  2G9W A;  3CDL A;  3B6A A;  3FBI B;  2JTV A;  2KPM A;  3SEQ A;  4LK1 F;  2V1X A;  3UNG C;  3K1N A;  4HLX A;  1GDT A;  1IRX A;  3K6G A;  2FBH A;  2M2E A;  5IT3 A;  2KIM A;  3C2G A;  3QPT A;  3GFM A;  5EEA A;  3NAR A;  4U87 A;  4UVC A;  1K4S A;  4OAY A;  1UJ8 A;  3CJR B;  3WE3 A;  3SYT A;  2GWR A;  3TDZ C;  2O0Y A;  4N9H A;  4A5N A;  3CD6 I;  1O3T A;  3DWL E;  2L02 A;  1XMK A;  1HKS A;  3FXQ A;  2ZO4 A;  2CQX A;  2M5W A;  1H88 C;  5F6F A;  4MO7 A;  5D5V B;  3N4M A;  5E79 C;  2KQR A;  3TW6 A;  4C3H J;  4F55 A;  3N97 A;  1ETX A;  2KL4 A;  2IGM A;  2W24 A;  2XB5 A;  3ABL H;  5EEH A;  5BS6 A;  3GBG A;  3DKY A;  3TKY A;  1D1B A;  1WPK A;  4WXC A;  5JI6 A;  1YJW I;  2DQR A;  3I58 A;  3LA2 A;  3ERM A;  4FE7 A;  4XON A;  1BOA A;  3A2K A;  4NC8 A;  5CVR A;  3CCE I;  2LH9 A;  1WQ2 A;  2M1B A;  3CCM I;  2QF7 A;  4C2T A;  2FMY A;  4Q48 A;  1BC7 C;  5AON A;  1YE9 A;  3ZGK A;  2H8W A;  2DJN A;  3JAM Z;  3GTP J;  2XGC A;  1HW1 A;  9ANT A;  4LG3 A;  2ZJ2 A;  3IUO A;  3FK6 A;  3D0S A;  3KEQ A;  2GXG A;  1EKE A;  2X9D A;  4IXA A;  3DTE A;  3CZ6 A;  3C18 A;  5M5W J;  2STW A;  2HTJ A;  4XN0 A;  3ZPL A;  1ZRF A;  2M7A A;  1T95 A;  1XD7 A;  5BMZ A;  1AHD P;  1MBK A;  1P4W A;  5D4R A;  3LSG A;  5J1R A;  4UVB A;  2R7R A;  4BGD A;  2VBX A;  1YI2 I;  2MH9 A;  1B6A A;  3S3M A;  2OTJ I;  1KYW A;  3JSO A;  1MJA A;  2XAS A;  4NC6 A;  2R7W A;  1EH6 A;  5E1X A;  2BXZ A;  4NHJ A;  3NRV A;  1USS A;  4IQJ A;  3ZMT A;  4JX4 A;  4PJL A;  1ZH5 A;  3ZN0 A;  4M9S A;  3F6O A;  3FXL A;  4HV5 A;  3H9Q A;  2FD5 A;  1R49 A;  1FYK A;  2E2J J;  1R4N B;  3WTT C;  1QVU A;  1I6X A;  3C2H A;  2XF6 A;  4YFN F;  5TJJ A;  3E5X A;  4BY1 J;  3HYI A;  3V8L A;  3M1C A;  2A6E F;  2VE8 A;  3O8G A;  5BQT A;  1YX3 A;  1BL0 A;  1BJA A;  2E7X A;  5E8I A;  3WTS C;  2DW4 A;  1BM9 A;  4I01 A;  2NXN B;  5D4S A;  2EFW A;  5DD8 A;  4I0A A;  2QVO A;  2L7K A;  3WHB A;  3RZO J;  4KIF A;  1K6O A;  2E1C A;  2CWE A;  2A07 F;  2X1E A;  2R7Z J;  3IAM 2;  3QYF A;  2CG4 A;  2JUG A;  3ESW B;  2DA3 A;  4I09 A;  4HPQ A;  4N4N B;  2MFZ A;  2E2H J;  1IG7 A;  4NDL A;  2PMU A;  3IAS 2;  1JJ6 C;  4BAY A;  2Q2E B;  3CCS I;  1HDP A;  1W36 C;  3A1Y A;  5LRS A;  5GAE J;  3CMY A;  2BVM A;  1NH3 A;  3FHN A;  3QU3 A;  2MSY A;  1RUN A;  1KU9 A;  4RGR A;  3MKW B;  3GCM A;  4QIW N;  3CF2 A;  1SC7 A;  1J2X A;  1MMD A;  4IHV A;  2RQQ A;  3FXU A;  3GXO A;  1QVT A;  4L5E A;  1D0Z A;  5J8C A;  1IF1 A;  3L2Q A;  3OYK A;  4U7B A;  1EF4 A;  3HSR A;  2EV5 A;  1W0T A;  1XMA A;  2YX4 A;  4KA4 A;  2KJC A;  3JW4 A;  4DYQ A;  2DN0 A;  1QGP A;  2LNB A;  1KA8 A;  2GBY A;  4O6J A;  4XNF A;  2GAU A;  1ZAO A;  3F3X A;  5KHD A;  1I39 A;  2GOM A;  2XAH A;  3GX4 X;  1BR4 A;  3FIS A;  4UUT A;  1Z7L A;  2ZB9 A;  1Y0N A;  2Q1Z B;  2DK8 A;  2V9P A;  5EGO A;  1ZLJ A;  3RKX A;  4EM0 B;  3E6C C;  5CVJ A;  4UVA A;  4XID A;  2HDC A;  3I4M J;  4XKW A;  2VBZ A;  4DJA A;  4ZYG A;  4KT6 A;  4XMY A;  1QA6 A;  2FF4 A;  4WXH A;  1WRJ A;  2HNH A;  2M4K A;  3GZ5 A;  1ORK A;  2CV0 A;  1UG2 A;  3PNT A;  3BR2 A;  3LFK A;  2DDB A;  1RIO H;  2GOX B;  3BTJ A;  4FIS A;  4BE2 A;  3OL4 A;  2OJE D;  3G2B A;  5H6R A;  1IRF A;  3K69 A;  3TL4 X;  2M87 A;  3FHZ A;  3DBH B;  4DW6 A;  3RDI A;  1YIT I;  1BIB A;  1XSV A;  2X6O A;  5LEJ A;  1XPX A;  2HVQ A;  2RDP A;  3NWT A;  1N77 A;  1JGS A;  3WTZ A;  1JKQ C;  4RAZ A;  3DFG A;  5IYC J;  1HST A;  2O03 A;  3HOZ J;  1LDJ A;  1XX5 A;  2LC2 A;  3VWB A;  4BQQ A;  3BG7 A;  2HR3 A;  1ZLK A;  4QLC U;  1TNS A;  3BT9 A;  3FMR A;  3HPH A;  4IJA A;  3ASO H;  4E7J A;  5E3O A;  3PJR A;  3BJ6 A;  3Q5F A;  1R5G A;  5ED4 A;  1R1T A;  1MMA A;  3MN2 A;  4N4O B;  2MLK A;  3KZI C;  1H89 C;  2DA7 A;  2O6G E;  2DO7 A;  3OMY A;  3Q0V A;  2XIG A;  4EM2 A;  2XGX A;  2LKX A;  1TZL A;  5K5R A;  2NNY A;  1O3R A;  2QSF X;  1G3T A;  1QZY A;  4WK8 F;  1JT0 A;  2LRE A;  4WF2 A;  4IOC F;  3PFI A;  2OA4 A;  2EJR A;  3AAF A;  2BOL A;  1MGT A;  2LLK A;  3E6B A;  3CC4 I;  2E1M B;  4XLE A;  3F0C A;  2QQ9 A;  1ZGW A;  3HC7 A;  2WC2 A;  3IL2 A;  2MC4 A;  4LB5 A;  1YW7 A;  5GAG J;  2CGP A;  2BY0 A;  4AVZ A;  2H8R A;  1YW9 A;  3O8H A;  3CCR I;  4A12 A;  1REP C;  3Q0W A;  5HDN A;  1R5H A;  2FJ1 A;  2VN2 A;  5F0H A;  2DA5 A;  1TP4 A;  3HBL A;  3PIP F;  4ZZD A;  3U21 A;  3CCQ I;  5LHH A;  5IOZ A;  4C30 A;  2H6B A;  2QEX I;  3GTL J;  2KLO A;  3DEU A;  1G3Y A;  4PFO A;  1BW5 A;  2L4M A;  2CQN A;  4JYK A;  2WY8 Q;  1MBG A;  3PIO F;  5GTI C;  1SAX A;  2IT0 A;  4UB6 C;  2WAQ A;  3MMY B;  4GO1 A;  2BW3 B;  4OWR B;  3GYH X;  1CQT A;  5KVR A;  2VON A;  1GXP A;  2IEK A;  1TQM A;  3H3Z A;  2AO9 A;  2WTE A;  1R6R A;  1XSX A;  1WFX A;  2CU7 A;  1P92 A;  1WJ5 A;  3MKY B;  1YQA A;  4E70 A;  3RPU D;  1XS9 A;  2F48 A;  5K5Q A;  4ESF A;  5DUI A;  1MBJ A;  3DBL B;  2YPR A;  1O3Q A;  4AC0 A;  2ESN A;  2W7N A;  2WAQ N;  2RKH A;  2OV7 A;  2VE9 A;  1NG7 A;  4F52 A;  2O8K A;  3PFY A;  4LIV A;  1VQM I;  1VQ6 I;  4FX0 A;  2OTL I;  5F0F A;  3JRE A;  2RC4 A;  2PMZ A;  3LL7 A;  3JRA A;  1BIA A;  1GV2 A;  3F8N A;  4EGZ A;  2HZD A;  4D7N A;  2W82 A;  1VQP I;  3JCU C;  1TNT A;  1OCT C;  2HGC A;  3U2R A;  4BL0 B;  2CMP A;  2P5L C;  1KGS A;  1S5L C;  3TO7 A;  1HXD A;  4XRS G;  1XGN A;  3KP3 A;  2DU9 A;  3JSP A;  3KE2 A;  4L5I A;  2LF8 A;  3A0H C;  3MKL A;  2W1O A;  4KN7 X;  3ZMU A;  4A3B J;  5HDG A;  3SDB A;  3FXM A;  3J7Y J;  3GUD A;  2DMQ A;  4MGR A;  4F3Q A;  2GM4 A;  4UV9 A;  4RS8 A;  2VBY A;  3HGY A;  2I10 A;  2DOF A;  4FE4 A;  4G6Q A;  5LGU A;  5EF6 A;  4RB1 A;  3CCU I;  2F5F A;  2P5V A;  2BHZ A;  2FBI A;  3CJN A;  2R5Y A;  1K78 B;  2NAZ A;  2DPU A;  2QM3 A;  2BXY A;  3L00 A;  4PJN A;  3DLL F;  1T0F C;  1VQO I;  3OYN A;  1SMY F;  2PJP A;  3Q9V A;  3ROU A;  5IPA A;  4XM3 A;  1OYW A;  1B1B A;  5DM6 F;  3QWL A;  1S72 I;  2IPQ X;  2OUM A;  4RGX A;  1CF7 B;  5CVV A;  1FBQ A;  2FRH A;  1ZG5 A;  2CH0 A;  3CDI A;  1XN7 A;  4G6D A;  5TGT A;  3GTO J;  4DNC A;  5H6Q A;  1BI2 A;  3CC2 I;  1X3U A;  1P9Q C;  2UV1 A;  2CW7 A;  4HA8 A;  3V8J A;  3WHC A;  4ZTF A;  1J9I A;  1FBS A;  2CUJ A;  2OCE A;  4BBR J;  1YOV B;  3KYL A;  3F72 A;  2ME6 A;  2UXX A;  4FAS D;  3TP3 A;  3X2Q H;  1S7O A;  2H1L A;  2EB7 A;  3G71 I;  3L2C A;  1ZYR F;  5IP6 A;  5M5Y J;  2XAJ A;  2PN6 A;  2EZI A;  1AKH A;  1PUE E;  3V42 A;  2LVS A;  3DKX A;  3OWT A;  3GTJ J;  1ZKG A;  3S15 J;  1BC8 C;  3E1S A;  5F1R A;  3ZCO A;  3BLY A;  5EG0 B;  3L2U A;  3CMA I;  4XOT A;  2H09 A;  4GXO A;  4BE0 A;  1FIA A;  2JWT A;  4X1E A;  1T56 A;  1J7K A;  5E20 A;  4K2E A;  2DMP A;  3HOX J;  4GFB A;  4EMS A;  1YRN B;  4A3M J;  3OIP A;  4S05 A;  1IDY A;  4RA2 A;  5CVU A;  4Y52 J;  3SDG A;  5LHI A;  3L2W A;  4BNC A;  4YEL A;  3REO A;  2FOK A;  3N05 A;  2CUZ A;  1J75 A;  5IY5 H;  3KFW X;  2JA5 J;  4MEX F;  2FNP A;  2L7M P;  4L9N A;  5DDG A;  1AOY A;  2R4G A;  1BN5 A;  1O4X A;  1EH7 A;  1YFH A;  3A01 B;  4R79 A;  3E3V A;  3CF5 F;  3LSK A;  2OU2 A;  3ZQF A;  1SFO J;  3K1P A;  5GTH C;  2M3A A;  4CHU A;  2EBI A;  2Y30 A;  2K4J A;  4F91 B;  1LE8 B;  5D8L B;  2OZ6 A;  1OCR H;  5J1U A;  2BW3 A;  2Y31 A;  1WZ2 A;  1FOK A;  2IAI A;  3DU6 A;  3E0J B;  3OR2 C;  3PQK A;  5J8F A;  1G2H A;  1OYY A;  2JN6 A;  2HS5 A;  4HX4 A;  5B3S H;  4I76 A;  2Q2E A;  4CCK A;  3R60 A;  4H4K C;  3BRO A;  4ENJ A;  1BI3 A;  5DUK A;  4KJZ A;  4M3B A;  2B63 J;  2KJB A;  3W3C A;  2P6S A;  2C6Y A;  3TMO A;  4C9Y A;  4RAF A;  1Z6R A;  3RI4 A;  3O3K A;  1MH3 A;  2EA2 A;  4LG0 B;  2IP2 A;  3ZQH A;  3I4N J;  3FXO A;  5LGN A;  4AIH A;  1SFK A;  1IXR C;  5AIQ A;  3HSF A;  1GXQ A;  3DEW A;  3LSI A;  3I9V 2;  1PUF A;  4IOA F;  4IEJ A;  2D5V A;  1MJB A;  3LSR A;  1HDD C;  1X3Z B;  2PFB A;  1S8N A;  1W4M A;  2YU3 A;  4YIR X;  1F1Z A;  4OMZ A;  1TW3 A;  4S0H B;  2XSJ C;  1UEL B;  5CYV A;  3BC8 A;  2VQC A;  3BR1 A;  3VOE A;  2LMD A;  3JRG A;  4XBF A;  1FP2 A;  2HZT A;  4A0Y A;  1T0F A;  5GP9 A;  4DOZ A;  2NOG A;  2BZT A;  3QQA A;  3JRI A;  2P4W A;  1WJA A;  4GYG A;  1JHF A;  4I2O A;  1YIO A;  2FXA A;  3WGG A;  4NUB A;  1WSU A;  1KQ8 A;  3AG1 H;  5EZH A;  4XOP A;  2VJ4 A;  3BR6 A;  1H8A C;  4ZYH A;  4BQN A;  4KIS A;  3KP5 A;  3P9K A;  2X4H A;  4A5M A;  4RB3 C;  4ENM A;  2Y0S N;  2FOW A;  5EGO B;  2X85 A;  3KEO A;  2IA0 A;  4EGY A;  2Z33 A;  2K4B A; 
#chains in the Genus database with same CATH homology
 3W6K B;  5FLX K;  5H20 A;  3SZP A;  3VEP A;  3SXY A;  2YX7 A;  4NQW A;  4U0Y A;  4IPA A;  2EA4 A;  3IKV A;  1FP1 D;  5L3B A;  3SHF A;  4M9Z A;  3D5L A;  1E17 A;  1T38 A;  3DV8 A;  1G3S A;  1ODD A;  1P2F A;  2GA2 A;  2KIU A;  3FXR A;  2J5P A;  4LLN A;  3HUG A;  4ETS A;  2F2E A;  2AS5 F;  3HTU A;  3HRT A;  4M74 A;  2BEO A;  4O5V A;  1FSE A;  4I02 A;  4EM1 A;  3P9I A;  1R36 A;  3VB2 A;  2QUF A;  2MA3 A;  2Q0O A;  1Y0U A;  4YFX F;  2JT1 A;  1FNN A;  4RAY A;  3K0L A;  3RTR A;  4WCG A;  2R7D A;  3G73 A;  4HQM A;  3MFK A;  1JXS A;  1YS6 A;  1ZRD A;  4LK0 F;  1YO5 C;  4Y17 A;  4CIC A;  3BP8 A;  4RGU A;  3U9G A;  4ZYE A;  1L3L A;  3TOA A;  5HLI A;  3R61 A;  3R0J A;  1U5T B;  2P5K A;  1HSJ A;  1SFE A;  1Z05 A;  3MZH A;  4OIP F;  2VOO A;  1KQ0 A;  1H9T A;  4IF4 A;  2NNN A;  3HHH A;  4LGW A;  3E5Q A;  3EDP A;  4XSZ F;  2K7L A;  5JFR A;  2A68 F;  1IRG A;  2QZ8 A;  3FMQ A;  3M1E A;  1D3Y A;  2AXL A;  4HAM A;  3T8T A;  4CDG A;  4OIO F;  1LEA A;  1XGM A;  3KCC A;  2DBB A;  5DV5 A;  3I54 A;  1DDN A;  3ABT A;  4QWQ A;  5L3E A;  4BXU A;  5HOO A;  2DQL A;  5HS8 A;  4MHG A;  2XV4 S;  2HEO A;  2DFI A;  2QQA A;  2BYV E;  2MC3 A;  1HW2 A;  4Y15 A;  3QAH A;  5E1Z B;  3GO5 A;  2MH2 A;  2GIV A;  3WTU C;  1XSD A;  4BHP A;  3F8B A;  4UNO A;  1MZB A;  4ZYD A;  4WX9 A;  2F5C A;  1XCV A;  3DPT A;  2GZW A;  1G4D A;  1P4A A;  4CGZ A;  4LLL A;  1PP7 U;  1GVJ A;  3HHG A;  1YTY A;  3QP5 A;  1EV7 A;  3R4K A;  1H9G A;  1OR7 A;  3SQN A;  3E6M A;  5E1W A;  1O3S A;  1HBX G;  2IRF G;  1IN7 A;  1YG2 A;  3FX3 A;  1IN5 A;  5L3G A;  1FYL A;  4G9Y A;  2HWV A;  4OIR F;  3EYY A;  3K2Z A;  2R7F A;  3TQN A;  3CUO A;  2OAZ A;  2CW0 F;  4HZF A;  1J0R A;  1ZGJ A;  2EFO A;  4G8X A;  5ILS A;  4HOB A;  4N9I A;  1QPM A;  4ENN A;  1V3F A;  2F5D A;  3B73 A;  1XDS A;  2FNA A;  4EV0 A;  3J80 K;  2V1D A;  3KLN A;  2EV6 A;  1W5S A;  2XAQ A;  3GF2 A;  2NRA C;  2ESH A;  2Y48 A;  3V7C A;  1RI7 A;  3HRS A;  3RJP A;  3CUQ A;  3HTS B;  1OMI A;  4AVP A;  3WGI A;  1Z1D A;  2VOD A;  1S29 A;  2XRO A;  5E8G A;  2PQ8 A;  1K79 A;  5FD5 A;  2ZCW A;  2P7V B;  1UB9 A;  1FBU A;  5D8K B;  2XAF A;  3IC7 A;  1R23 A;  3WTY C;  2DT5 A;  1SD7 A;  2M30 A;  3DF8 A;  2FQ3 A;  1SD6 A;  4LMY A;  1ON1 A;  1E2X A;  1I27 A;  2JRT A;  5CJ9 A;  3TGN A;  2OQR A;  2JPB A;  3T1B A;  1R00 A;  3HIF A;  2A3S A;  4YFK F;  3W6J B;  2QLZ A;  1V4R A;  4AWX B;  4EJO A;  4A2U A;  3RKW A;  5E18 F;  5E17 F;  3RYR A;  2RNJ A;  3KP4 A;  3DP7 A;  4FT8 A;  3LQR A;  3F8F A;  1IW7 F;  5FGM A;  4EVI A;  3DQV C;  1XB4 A;  5FD6 A;  4OIN F;  1F4K A;  1DUX C;  1FC3 A;  1J59 A;  3WOD F;  3FM3 A;  1K7A A;  1W5T A;  4HX8 A;  4G7H F;  4ESJ A;  5JVT A;  5HDK A;  2QEN A;  1FX7 A;  2COM A;  1Q1H A;  3J81 K;  4BH9 A;  3WU0 A;  5BPI A;  4IRG A;  3BJA A;  4EJW A;  3RPQ A;  4PZJ A;  4RB0 A;  4U0V A;  2OZU A;  2M8E A;  2R3S A;  2FU4 A;  2DPD A;  3JTH A;  2H6C A;  5A2Q Z;  3T8R A;  4KIG A;  2V79 A;  1QNT A;  3HRM A;  2YR2 A;  1CF7 A;  4MQV A;  2K02 A;  2JSC A;  2HOE A;  5L3D A;  2BGC A;  4CO8 A;  3NEU A;  3BOQ A;  1QO0 D;  4G7O F;  3F23 A;  4HQE A;  1MJ9 A;  4ZH4 F;  3TOB A;  5D6E A;  2P8T A;  4WXD A;  3SZT A;  1U2W A;  2PLY A;  3MZY A;  2Y0M A;  1UHM A;  4OU0 A;  1IXC A;  2VC0 A;  4OMY A;  2UZK A;  1Z91 A;  2ZNY A;  2QYO A;  4ZZL A;  2F5E A;  3NQO A;  1JHH A;  1MDM B;  1W7P B;  4HF2 A;  2K86 A;  3H92 A;  1TQP A;  3CLO A;  2Z9O A;  4FX4 A;  4JQF A;  2H94 A;  4D0P A;  3KP6 A;  3V7R A;  5LEK A;  1U3E M;  3LAP A;  3BWG A;  3RPU A;  1SMT A;  4Q4Z F;  1FT9 A;  4XRF A;  3KET A;  3J80 Z;  4B8X A;  3I59 A;  2BV6 A;  4R8H A;  2PEX A;  1Z9C A;  4HF0 A;  3I71 A;  3OV8 A;  2XUB A;  4HX7 A;  3V4G A;  2FEZ A;  1U5T A;  4PGH A;  1DPR A;  4CYD A;  5TRD A;  3BPX A;  2UXN A;  6PAX A;  1LDK B;  2H27 A;  2HYF A;  3IWF A;  1I5Z A;  2ADU A;  1IAW A;  3F21 A;  2LSO A;  2NS0 A;  4KYW A;  3Q9S A;  4KUM A;  3KZZ A;  4YII A;  3BZ6 A;  2LDU A;  3LQQ A;  2ZME B;  4AD9 A;  4WWC A;  2VXZ A;  4ENK A;  3ML6 A;  3WTX C;  2O61 A;  3HSE A;  1JE8 A;  1F5T A;  2RN7 A;  3CUQ C;  2FML A;  2VC1 A;  4P9U A;  4KDP A;  4LG0 A;  4LB6 B;  2D2W A;  4IHT A;  2J5O A;  5LRR A;  3E97 A;  3ZMZ A;  2ZBK A;  1FZP B;  2XKP A;  3FMS A;  3ISP A;  4MQ9 F;  4ON0 A;  4L18 B;  1S6L A;  5KK1 A;  5L3F A;  5D5W B;  2HYG D;  1K78 A;  4I7H A;  3J7A O;  3EET A;  5FLX Z;  1B4A A;  3GWZ A;  1OYI A;  1QQI A;  4HBL A;  4DQ2 A;  1D5V A;  1B59 A;  2XVC A;  4TV7 A;  1U5T C;  1OPC A;  4JK1 X;  1SFU A;  2XKO A;  3J81 Z;  1YYV A;  2W25 A;  2IA2 A;  1LJ9 A;  3CO6 C;  2XHK A;  5CLS A;  3F8M A;  3V8K A;  4LD5 A;  2ACJ A;  1TQI A;  4KIB A;  4ASN A;  1PP8 F;  1TLH B;  1U8R A;  1WWX A;  2O8X A;  2EV0 A;  4YG2 F;  3BDD A;  2VBW A;  3EUH A;  4L0Y B;  1HKQ A;  2HTS A;  2B0L A;  4IHS A;  2MD5 A;  3ULQ B;  2STT A;  4XLN F;  4EJT A;  1ZN2 A;  3IHU A;  4P5O A;  1H0M A;  1NHA A;  3SFZ A;  3LA7 A;  2ZME A;  1UFM A;  1T2K A;  3LST A;  3GFJ A;  3H3U A;  3S2W A;  2IVM A;  3TO6 A;  1D8K A;  5EEG A;  2V9V A;  1LEB A;  1SD4 A;  4KT5 C;  3IKT A;  4M72 A;  2GXB A;  3LA3 A;  2HQR A;  4O3M A;  5DD4 A;  2G7H A;  1IXS B;  2BE5 F;  3QU6 A;  3E6D A;  3K9T A;  1G3W A;  2W84 A;  3GFL A;  3BPV A;  4BHB A;  3O2P E;  3HOT A;  3ERE D;  4KMF A;  4NB5 A;  4HF1 A;  1R22 A;  1STZ A;  1IUY A;  1ON2 A;  3TDU C;  1ZRC A;  1I1S A;  3V7S A;  5L3C A;  2KKO A;  3VFZ A;  2VOP A;  1XCB A;  3LWF A;  3M7G A;  4KN4 X;  3F8C A;  1LDD A;  3IRR A;  4PGG A;  3CTA A;  3WE2 A;  1Z6T A;  1CGP A;  3M8F A;  1W7P D;  2MLG A;  1IN6 A;  5D6F A;  2A6H F;  5DEQ A;  1MDM A;  1XGS A;  5DCM A;  3LAJ A;  1SFX A;  4HW0 A;  1W7P A;  3ZN1 A;  3VOD A;  2RQP A;  4R1H A;  1IZ1 A;  2IW5 A;  4A0X A;  5ICE A;  1R1V A;  2XAG A;  3COA C;  2EWN A;  2RV8 A;  1LB2 A;  4UV8 A;  4RGS A;  2Z5U A;  3C1D A;  4S04 A;  3KP2 A;  3CDH A;  2ETH A;  5HS7 A;  5FO5 A;  4GCV A;  2PMH A;  4OOI A;  1YLF A;  5LGT A;  4XSX F;  2PI0 A;  2M45 A;  4P9F A;  1O7L A;  5LHG A;  1RUO A;  4L9T A;  4A6E A;  2L01 A;  1ZRE A;  2D1V A;  3RKY A;  1KU7 A;  3WTV C;  3ZQ7 A;  4Z2Y A;  1O57 A;  1TBX A;  2PG4 A;  2BBY A;  3E5U A;  2HKX A;  1KYZ A;  4AIK A;  2HKO A;  1DPU A;  3MEX A;  4YIF A;  5FFX A;  1UCR A;  4P96 A;  5HLH A;  4ESB A;  4UHT A;  3DXJ F;  4PDK A;  2GA1 A;  5ERI A;  1IN4 A;  2JZY A;  3WTW C;  1FYM A;  5FB2 A;  2ELH A;  1ONV A;  5ILU A;  1ULY A;  1HQC A;  1VTN C;  3OOP A;  4KIC A;  5DYM A;  1UHW A;  4MTE A;  1P4X A;  2QWW A;  2Y75 A;  3QP6 A;  3P7N A;  3GW2 A;  2RGV A;  4KMU X;  3FZV A;  3QPH A;  3HOS A;  3RIR A;  4FHT A;  4LFU A;  3MAJ A;  4CZZ A;  4HDU A;  1R1U A;  3C7J A;  3GEZ A;  2QBY A;  3MQ0 A;  2ZFW A;  3R6S A;  3R0A A;  2WWY A;  1HKT A;  4M6Y A;  3TO9 A;  2OBP A;  1L0O C;  1G6N A;  2YSR A;  3ECO A;  1ZG1 A;  1J5Y A;  2XRN A;  4HLY A;  4L0Z B;  5ICF A;  1ZAR A;  3M8E A;  5IT9 Z;  5A2Q K;  3L9F A;  4UXN A;  2ZNZ A;  3ZMS A;  1TTY A;  1FLI A;  3GZ6 A;  2CYY A;  1YS7 A;  3BY6 A;  1RZ4 A;  2CO5 A;  4LLG F;  1R7J A;  1A04 A;  3MWM A;  1EH8 A;  2E1N A;  1BBY A;  3HRU A;  2IA1 A;  1YW8 A;  5HLG A;  5AIP A;  4I0B A;  2CQK A;  3I53 A;  2D1H A;  3F22 A;  1U6G A;  1QZZ A;  2VT2 A;  4L5J A;  2NYX A;  3I59 B;  1KU2 A;  5ICC A;  3FWE A;  4M9X A;  4BYY A;  2EFP A;  2EFQ A;  2VT3 A;  5DCM B;  2MBF A;  3IWZ A;  2EK5 A;  3M9A A;  5JR3 A;  4L9V A;  2WV0 A;  1LQ1 A;  4EJV A;  2V1U A;  2UWM A;  5K5O A;  4G7Z F;  1GHC A;  5DCF A;  4M6X A;  4EJU A;  2KRF A;  3ABU A;  5ILV A;  2HQN A;  2LF7 A;  4UUV A;  1TW2 A;  2TDX A;  5CVI A;  1SD5 A;  1T98 A;  1P6R A;  2G7U A;  1LVA A;  3QRF F;  2FE3 A;  4KNY A;  2A5Y B;  3ZMD A;  3DPL C;  3CUQ B;  2DTR A;  1QBJ A;  2GQQ A;  2O3F A;  1MKM A;  1ZHF A;  2FA5 A;  1S7A A;  3DKW A;  2JPC A;  5F64 A;  3KLO A;  5K1Y A;  4MEY F;  3RYP A;  3G3Z A;  4U7D A;  4U88 A;  1DP7 P;  2OD5 A;  2ZXJ A;  4EQQ A;  2DLL A;  2V6C A;  5J6X A;  3ECH A;  3MCZ A;  1D8J A;  2QBY B;  4CXF A;  2FBK A;  2LKP A;  3FM5 A;  1MD0 A;  4BHC A;  3P9C A;  2A69 F;  4PCQ A;  3B02 A;  1XDU A;  2DAO A;  4U0W A;  4Q47 A;  3GVA A;  2ISY A;  2W85 A;  1FPQ A;  3BJO A;  5D5U B;  1IN8 A;  1S3J A;  2DK5 A;  2ISZ A;  2QQB A;  2DI3 A;  4G94 A;  3T5X A;  1F9N A;  3GLX A;  3T0Y A;  1C0W A;  5ICG A;  2K27 A;  3JAM K;  1AWC A;  3IRQ A;  4HYE A;  1FY7 A;  3KP7 A;  5BOX A;  4GYI A;  4Q5S F;  3I5U A;  1I1G A;  2Q8K A;  5JHU A;  4KFC A;  3U1D A;  1BI0 A;  1ZG3 A;  5FFZ A;  4N0B A;  4F7Z A;  2ZKZ A;  4GGG A;  4I98 B;  3EYI A;  5D5X B;  3ZMV A;  3L7W A;  3I64 A;  2L3D A;  3FF5 A;  4BQA A;  4B09 A;  3PQJ A;  1T6S A;  4HV6 A;  4LJZ F;  4A6D A;  5HVQ C;  1U78 A;  4XLP F;  1HW5 A;  3WGH A;  2L4A A;  4JBA A;  1B9N A;  3EQL F;  2Z3Y A;  4Y13 A;  3GFI A;  1B9M A;  3KZY A;  1O7F A;  3O6B B;  4M71 A;  1WI9 A;  1KU3 A;  2E7W A;  5LLQ A;  4OIQ F;  2Z99 A;  4RB2 C;  2L54 A;  1R58 A;  2IJL A;  5IT9 K;  4IVN A;  2HFH A;  3QOP A;  5BPD A;  4AIJ A;  4IRI A;  4M73 A;  1XGO A;  2CSO A;  4L9J A;  2CFX A;  3L09 A;  3WU1 B;  1Z7U A;  1OKR A;  1RNL A;  2W57 A;  3I4P A;  3CO7 C;  4A0Z A;  3F6V A;  3I0T A;  2P6T A;  3WG9 A;  2PBI A;  2KIF A;  1T39 A;  1PDN C;  2FSW A;  4IRH A;  2P7C B;  1WKM A;  4H0E A;  5HS9 A;  1FWZ A;  2OQG A;  2RVC A;  2D45 A;  2A61 A;  2EFN A;  1BI1 A;  1KQ9 A;  1LNW A;  2X0L A;  3ELK A;  4MNU A;  1FSH A;  4MTD A;  4HDV A;  3C3W A;  5LBQ A;  3JTG A;  4P55 A;  1ZGA A;  3K1M A;  1UST A;  2G9W A;  2JTV A;  4LK1 F;  2V1X A;  3K1N A;  4HLX A;  2FBH A;  5IT3 A;  2KIM A;  3QPT A;  3GFM A;  4UVC A;  3WE3 A;  2GWR A;  3TDZ C;  2O0Y A;  4N9H A;  4A5N A;  1O3T A;  2L02 A;  1XMK A;  1HKS A;  3FXQ A;  2ZO4 A;  2M5W A;  5F6F A;  3N4M A;  5D5V B;  3N97 A;  2W24 A;  5EEH A;  5BS6 A;  3TKY A;  5JI6 A;  4WXC A;  2DQR A;  3I58 A;  3LA2 A;  1BOA A;  5CVR A;  1WQ2 A;  2M1B A;  2FMY A;  4Q48 A;  1BC7 C;  5AON A;  3JAM Z;  1HW1 A;  2ZJ2 A;  3D0S A;  3KEQ A;  2GXG A;  4IXA A;  3C18 A;  2STW A;  2HTJ A;  3ZPL A;  1ZRF A;  1XD7 A;  5BMZ A;  1P4W A;  5D4R A;  4UVB A;  2VBX A;  2MH9 A;  1B6A A;  1KYW A;  3JSO A;  1MJA A;  2XAS A;  1EH6 A;  5E1X A;  4NHJ A;  3NRV A;  1USS A;  3ZMT A;  1ZH5 A;  3ZN0 A;  4M9S A;  3F6O A;  4HV5 A;  1FYK A;  3WTT C;  1I6X A;  4YFN F;  5TJJ A;  3E5X A;  3HYI A;  3V8L A;  2A6E F;  2VE8 A;  5BQT A;  1BJA A;  2E7X A;  5E8I A;  3WTS C;  2DW4 A;  1BM9 A;  4I01 A;  5D4S A;  2EFW A;  5DD8 A;  4I0A A;  2QVO A;  4KIF A;  1K6O A;  2E1C A;  2CWE A;  2A07 F;  2CG4 A;  4I09 A;  2PMU A;  4BAY A;  5LRS A;  3QU3 A;  1RUN A;  1KU9 A;  4RGR A;  1J2X A;  3FXU A;  3GXO A;  5J8C A;  1IF1 A;  4U7B A;  3HSR A;  2EV5 A;  1XMA A;  2YX4 A;  4KA4 A;  2KJC A;  3JW4 A;  3ZP5 A;  2LNB A;  1QGP A;  4O6J A;  1KA8 A;  2GAU A;  1ZAO A;  3F3X A;  2XAH A;  3GX4 X;  2DK8 A;  1ZLJ A;  3RKX A;  4EM0 B;  3E6C C;  5CVJ A;  4UVA A;  2HDC A;  2VBZ A;  4ZYG A;  2FF4 A;  4WXH A;  1WRJ A;  3GZ5 A;  3LFK A;  1RIO H;  5H6R A;  1IRF A;  3K69 A;  2M87 A;  3FHZ A;  3RDI A;  1BIB A;  1XSV A;  5LEJ A;  2RDP A;  1JGS A;  3WTZ A;  4RAZ A;  3DFG A;  1HST A;  2O03 A;  1LDJ A;  2HR3 A;  1ZLK A;  4QLC U;  1TNS A;  4IJA A;  3FMR A;  3BJ6 A;  3Q5F A;  1R5G A;  5ED4 A;  1R1T A;  2MLK A;  2O6G E;  2DO7 A;  2XIG A;  4EM2 A;  2XGX A;  5K5R A;  2NNY A;  1O3R A;  1G3T A;  1QZY A;  4WK8 F;  4WF2 A;  3PFI A;  2OA4 A;  2EJR A;  3AAF A;  1MGT A;  3E6B A;  2QQ9 A;  2WC2 A;  3IL2 A;  4LB5 A;  1YW7 A;  2CGP A;  1YW9 A;  4A12 A;  1REP C;  5HDN A;  1R5H A;  2VN2 A;  4ZZD A;  5LHH A;  2H6B A;  3DEU A;  1G3Y A;  2L4M A;  1SAX A;  2IT0 A;  4GO1 A;  3GYH X;  2VON A;  5KVR A;  1GXP A;  1TQM A;  3H3Z A;  2WTE A;  1XSX A;  1P92 A;  1YQA A;  4E70 A;  5K5Q A;  4ESF A;  5DUI A;  2YPR A;  1O3Q A;  2ESN A;  2RKH A;  2VE9 A;  4FX0 A;  2RC4 A;  1BIA A;  3F8N A;  4EGZ A;  1TNT A;  2HGC A;  3U2R A;  2P5L C;  1KGS A;  3TO7 A;  1HXD A;  1XGN A;  3KP3 A;  2DU9 A;  3JSP A;  3KE2 A;  4L5I A;  2LF8 A;  3ZMU A;  4KN7 X;  5HDG A;  3GUD A;  4MGR A;  4UV9 A;  4RS8 A;  2VBY A;  4G6Q A;  4RB1 A;  5LGU A;  2F5F A;  2P5V A;  1K78 B;  2FBI A;  3CJN A;  2DPU A;  2NAZ A;  2QM3 A;  3L00 A;  1SMY F;  2PJP A;  3Q9V A;  3ROU A;  1OYW A;  1B1B A;  2IPQ X;  1CF7 B;  4RGX A;  5CVV A;  1FBQ A;  2FRH A;  1ZG5 A;  1XN7 A;  4G6D A;  4DNC A;  5H6Q A;  1BI2 A;  1X3U A;  4HA8 A;  3V8J A;  1J9I A;  1FBS A;  3F72 A;  2UXX A;  1S7O A;  2EB7 A;  3L2C A;  1ZYR F;  2XAJ A;  2PN6 A;  1PUE E;  1BC8 C;  5F1R A;  2H09 A;  4GXO A;  1J7K A;  5E20 A;  4K2E A;  4EMS A;  4S05 A;  5CVU A;  5LHI A;  4BNC A;  3REO A;  2FOK A;  1J75 A;  3KFW X;  4MEX F;  2FNP A;  5DDG A;  4L9N A;  1AOY A;  1BN5 A;  1EH7 A;  1YFH A;  4R79 A;  3E3V A;  2OU2 A;  3K1P A;  4CHU A;  2K4J A;  5D8L B;  2OZ6 A;  1FOK A;  3PQK A;  5J8F A;  1OYY A;  2HS5 A;  4HX4 A;  2Q2E A;  3R60 A;  3BRO A;  4ENJ A;  1BI3 A;  5DUK A;  2KJB A;  2P6S A;  2C6Y A;  1Z6R A;  3RI4 A;  3O3K A;  2EA2 A;  4LG0 B;  2IP2 A;  5LGN A;  4AIH A;  1IXR C;  5AIQ A;  3HSF A;  1GXQ A;  1MJB A;  2PFB A;  1S8N A;  1W4M A;  2YU3 A;  1F1Z A;  4OMZ A;  1TW3 A;  5CYV A;  3VOE A;  4XBF A;  1FP2 A;  2HZT A;  4A0Y A;  1T0F A;  2P4W A;  4GYG A;  1JHF A;  4I2O A;  2FXA A;  1YIO A;  3WGG A;  1WSU A;  1KQ8 A;  4ZYH A;  3KP5 A;  3P9K A;  4ENM A;  2X4H A;  4A5M A;  4RB3 C;  3KEO A;  2IA0 A;  4EGY A;  2Z33 A;  2K4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...