4M74A

Mutant structure of methyltransferase from streptomyces hygroscopicus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHAFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGEYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 121
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m74A01
3I59B 2F5CA 3GF2A 6PAXA 1K79A 2EB7A 3G73A 3H3ZA 1G3TA 3WTZA 1I6XA 4Q4ZF 1T0FA 1S6LA 2FOKA 5DDGA 3FXUA 3CO7C 5DD8A 2JPCA 3ML6A 3F8FA 3LA2A 1KQ8A 2MD5A 2ZCWA 1GVJA 3VFZA 3VEPA 4B09A 3BJ6A 1SFEA 4KIGA 2NAZA 3TKYA 5ED4A 1BI0A 2LDUA 4KN4X 4MQ9F 1IN8A 5E8IA 1DPUA 4A2UA 5ICCA 3OV8A 2R3SA 2LNBA 2O61A 3Q9VA 3W6JB 1KU3A 5JI6A 2K02A 3MZYA 4WCGA 2XRNA 4JK1X 5L3CA 4G6QA 4N0BA 3E3VA 2STWA 4P9FA 3KCCA 4OIOF 3K69A 5LEKA 3FM3A 3CUQA 4LJZF 4BXUA 4XLNF 1R5GA 1BOAA 2R7DA 4EM1A 1J9IA 1U8RA 3WGGA 2DBBA 2ZXJA 4I98B 4YG2F 3KFWX 4FX4A 4LG0B 4HDVA 3F8BA 2LF8A 2Z5UA 2XUBA 4HF0A 2IP2A 2HWVA 4KT5C 3RJPA 3GFJA 4AD9A 4RAZA 1K7AA 4HQMA 5KVRA 3QAHA 2VONA 3HOSA 1XMKA 3LSTA 3SHFA 1I1GA 4L9NA 2FBHA 5FD6A 3DPLC 4ZYHA 5AIPA 5HVQC 4KICA 3WTYC 3T8RA 2AS5F 3U9GA 1S3JA 2PQ8A 2VBYA 1QZZA 1J59A 2IJLA 4CDGA 3DFGA 3O6BB 5L3FA 3IKTA 1XCVA 1FZPB 2OU2A 1ON2A 2XHKA 3M1EA 1X3UA 2OA4A 1KU7A 4UHTA 3LFKA 1I27A 3D5LA 2HYFA 1H9GA 2CW0F 5HS8A 4ENMA 3R60A 3I4PA 4K2EA 2W57A 2PFBA 2ISZA 1KQ0A 4LLLA 1TLHB 4ZYEA 3GZ6A 1IN7A 4PDKA 1OYIA 3TO6A 4R79A 1MKMA 1MDMB 2JSCA 4JBAA 3T8TA 5FLXK 5K5OA 4IVNA 3ULQB 4A5MA 2M45A 3FMSA 1BN5A 2W85A 1YW9A 3F21A 5FB2A 3I64A 3DPTA 2FE3A 5K1YA 2HQNA 2ZBKA 1HKTA 3BDDA 1FP1D 1UCRA 2QUFA 3N4MA 4O6JA 2VOOA 1W4MA 2LF7A 1FNNA 5LBQA 1HXDA 2L54A 3LA3A 3HHHA 3RKXA 2VT2A 1FYLA 3PFIA 4IRIA 2FMYA 3ZMZA 1B4AA 4KMFA 1D8JA 3L00A 1GXQA 3GLXA 4N9IA 2PJPA 3VB2A 3R4KA 1ZRDA 3MEXA 1YW8A 2K7LA 3DEUA 3LWFA 4BHBA 1WSUA 1Z7UA 5DD4A 2RKHA 1J2XA 3FHZA 4BNCA 1ZG3A 1ZYRF 1IXSB 3HRMA 2Y48A 2QLZA 3I5UA 3E6DA 3J81Z 1FC3A 4OU0A 2M1BA 2Q0OA 1CF7A 2LSOA 2C6YA 1ZHFA 4MQVA 5LHHA 5HLGA 1FYKA 4DNCA 1IAWA 3HSFA 4N9HA 5FO5A 2V1UA 3COAC 1SD5A 2H94A 1BC7C 4I2OA 1TQIA 4S04A 1UHMA 3ZP5A 1SD7A 1WWXA 4XSZF 1XGSA 3RYRA 4S05A 4IF4A 2ZNZA 2EA4A 3QPTA 1IXCA 5TRDA 2F5FA 1LB2A 4OIRF 1FT9A 2XAQA 1HKSA 2PMUA 3FZVA 1BJAA 2DAOA 3IRQA 1I1SA 1IXRC 1DDNA 3P7NA 4IXAA 1GXPA 4XBFA 4Y17A 2M5WA 4KN7X 4LD5A 1YLFA 4WXDA 4HF2A 4WWCA 2XASA 1FBQA 1SFUA 2OBPA 3CUOA 3L2CA 3G3ZA 4M73A 4EM2A 1Z6RA 2BYVE 3M9AA 3CUQB 1REPC 2HGCA 5D4RA 4A6EA 4YFKF 4AVPA 1K78A 1LNWA 4IRGA 1HSTA 2D2WA 1IZ1A 2JT1A 2Z33A 2IPQX 4GGGA 3VOEA 1R00A 3H92A 3O3KA 4UXNA 4LMYA 2KJCA 2Y75A 1FYMA 3Q9SA 2RGVA 1SD6A 1XGOA 4ZYGA 3QOPA 1D5VA 1BI3A 2VE9A 2PG4A 4CGZA 1ODDA 3J7AO 4ESBA 5IT3A 4ESFA 5CLSA 1P4AA 1RUNA 2PI0A 1TBXA 2STTA 2HTJA 2XAFA 5E20A 3QRFF 3ECHA 1XGMA 1LVAA 2CO5A 5ERIA 5D4SA 3FXQA 3ZMUA 1W7PA 4FHTA 2DQLA 3BJOA 2O6GE 4L18B 2QVOA 1P4XA 3JTHA 2ZKZA 2PMHA 3ZQ7A 3V8KA 1KYZA 2Q2EA 3QPHA 3GYHX 1YTYA 3O2PE 4GYIA 2D45A 4AIJA 3Q5FA 2DO7A 4O5VA 4Q5SF 1ULYA 4DQ2A 2PN6A 3WTTC 3HRTA 1TNSA 1FPQA 4KUMA 1Z9CA 2FU4A 4UVAA 5AONA 2FQ3A 4L9TA 4LFUA 1IN4A 1LQ1A 2EV5A 5D6FA 4UV8A 1U6GA 4UVCA 5FFZA 1T98A 2EFOA 2RN7A 2JRTA 5E18F 3F6OA 4FT8A 1MZBA 1XSXA 3NEUA 1GHCA 1QZYA 1EH8A 4U7DA 5ILUA 1O3TA 2EWNA 4ASNA 3TOAA 1L0OC 2NNNA 3ELKA 4U0WA 2YX4A 1R58A 1T38A 2X0LA 2KIUA 2XAJA 4GO1A 2QZ8A 3F8MA 4ENKA 1RZ4A 2R7FA 5BS6A 3REOA 1ZN2A 2ZO4A 5E1XA 1TQPA 1D8KA 3RKWA 5CVJA 3GX4X 1XN7A 1R1VA 2DK5A 4L9JA 2G7UA 3I54A 2RNJA 4EM0B 5J8FA 5JVTA 3MFKA 3L9FA 3I0TA 4UNOA 1FY7A 5F1RA 3S2WA 1CF7B 2DK8A 1R1UA 5E1ZB 4HX4A 1S29A 4M9ZA 4A0ZA 1FOKA 1WKMA 1FLIA 4HX7A 3J81K 3CJNA 1SMTA 1OMIA 1FSHA 2COMA 1CGPA 3AAFA 4RB1A 2VBZA 1O7FA 4CICA 1R5HA 2P6TA 1HW1A 2JPBA 2WC2A 3CTAA 3DXJF 3J80Z 1B6AA 1K6OA 2FSWA 2V6CA 4M72A 1LDDA 2QBYA 2FBIA 2ETHA 1B1BA 1H9TA 2CYYA 5HDKA 3ERED 1U5TC 2EJRA 3V7SA 2XVCA 4GYGA 1AWCA 2EFPA 2IRFG 3PQJA 4U88A 2KKOA 5DYMA 2QM3A 3MCZA 1R7JA 1QQIA 5ICGA 3L09A 2CSOA 2FNAA 2A68F 2P5VA 2DPUA 1YS6A 3GFLA 1G4DA 4L0YB 1MGTA 1YYVA 1PDNC 2L4MA 2ESHA 4IPAA 3WODF 2GA2A 5HOOA 2DQRA 2A6HF 4HX8A 2FNPA 1K78B 2D1VA 3WG9A 2V1XA 1U5TB 1DUXC 1LJ9A 2VOPA 1P2FA 3QU3A 5CVRA 4ZZDA 4I0BA 3E6MA 2IW5A 2P6SA 2GXGA 5K5QA 1T39A 2W25A 4ZYDA 1XD7A 3IHUA 2VT3A 4A12A 4OINF 4YIIA 3JTGA 3ZMDA 3GEZA 1IRGA 4M6YA 3HTSB 4AIKA 2MC3A 3TDUC 2UZKA 3D0SA 2IT0A 1SAXA 1YIOA 2H6CA 4M74A 4EMSA 4HF1A 4AIHA 2BE5F 2VODA 2RC4A 2FA5A 2FF4A 1BM9A 5L3BA 2OQGA 2YU3A 1W7PB 3HSEA 3U2RA 4QLCU 4GCVA 1ZG5A 1F1ZA 3WTVC 5KK1A 2EFNA 4OMYA 2FBKA 5ILVA 4RB3C 2QQBA 2A6EF 3GUDA 4WX9A 1SD4A 3WGIA 1R1TA 4ENJA 4G9YA 4RAYA 4A0XA 1BI1A 4MNUA 4HYEA 3GVAA 3ZN0A 4ESJA 3K1NA 3KEOA 4G6DA 1SFXA 2XIGA 3GZ5A 2OQRA 5LRSA 3MZHA 3KP6A 3F72A 4ETSA 3K2ZA 5LEJA 3WU1B 2DW4A 4P9UA 5CVVA 3DF8A 2GWRA 2EFQA 3VODA 4M9SA 5DV5A 4EJVA 2O03A 2HQRA 2YR2A 2HKXA 1F5TA 5D5WB 2P7CB 3KLOA 2A69F 2BGCA 3RDIA 3I71A 4HV5A 4LLGF 2DI3A 4RB2C 3EDPA 4KMUX 1IW7F 5J8CA 2XGXA 5FGMA 4WF2A 3LAJA 1G3YA 2HYGD 3M8EA 5H6QA 2D1HA 3HYIA 2GA1A 4EQQA 2LKPA 3BOQA 4RGUA 3ZMVA 3TDZC 4CZZA 4Q48A 5ILSA 4L9VA 4G7ZF 4OMZA 3PQKA 2NRAC 4ENNA 1KYWA 2FRHA 3CUQC 1HSJA 2KIMA 5HS9A 3DV8A 1YQAA 2Z99A 4HV6A 4M6XA 3NRVA 1YO5C 4BHPA 3ZPLA 5D6EA 4BAYA 3EYIA 1C0WA 3KETA 1PUEE 3BROA 3SQNA 3N97A 1NHAA 2JZYA 4M71A 3LA7A 3WTWC 4HQEA 3E5QA 3QP6A 1ZLKA 1IN5A 1O7LA 4LB5A 2P5KA 1PP7U 1U78A 3P9CA 2A5YB 1QNTA 4LG0A 5IT9Z 2KIFA 1JHHA 5JHUA 4I0AA 3J80K 2L01A 1J7KA 4PCQA 3JSOA 4UUVA 2F5EA 1B9NA 5DUIA 3SFZA 5HLHA 4CYDA 2QWWA 4HZFA 3P9KA 1OR7A 3R6SA 1EH6A 1FP2A 1ZGJA 3K0LA 2EA2A 3ROUA 3TOBA 2TDXA 1JHFA 3IC7A 4U0VA 1FBUA 4HLYA 1TW3A 3V7CA 1WRJA 4D0PA 3KP4A 1G3SA 1P6RA 1IUYA 3QP5A 5EEHA 2QQ9A 4NQWA 2M30A 2RQPA 2YX7A 5EEGA 3FX3A 3EYYA 3WTXC 4ZH4F 5F64A 3RI4A 4B8XA 3GXOA 4MEYF 3GFMA 1Z91A 2VBWA 4KIBA 3RKYA 1MD0A 4GXOA 4YFNF 2DU9A 4P55A 1OYWA 1S7OA 4EJWA 2GXBA 1J0RA 4XRFA 4A0YA 1AOYA 3HIFA 1W5SA 3F23A 4L0ZB 5D8KB 4E70A 3SZPA 4G94A 2H6BA 3TQNA 1MDMA 2KJBA 3NQOA 1WI9A 1Z6TA 1T6SA 4ON0A 4KNYA 1HKQA 3FF5A 3KLNA 5LGTA 2IA1A 1FX7A 2V79A 5DCFA 2HS5A 3P9IA 4EJTA 3KP5A 1W5TA 5L3GA 1E2XA 4F7ZA 3WTSC 2K86A 4L5IA 2NS0A 4HW0A 1YFHA 3F22A 1ON1A 1ZARA 2M87A 2O0YA 2MA3A 2E1CA 1RI7A 1XCBA 4HAMA 3I58A 4MEXF 1Z1DA 2A07F 2HOEA 2RV8A 4CXFA 2BBYA 2QENA 5J6XA 5DEQA 2Z3YA 3T5XA 4WXHA 5LGUA 1O57A 5ICEA 3L7WA 4JQFA 4QWQA 2ESNA 1XGNA 3FXRA 4UVBA 4IRHA 3C7JA 1RUOA 2E1NA 2PEXA 2GAUA 1ZRFA 2P8TA 3BZ6A 4OOIA 1STZA 1O3SA 5A2QZ 3U1DA 2F5DA 3FWEA 3TO9A 4KFCA 4G8XA 1V3FA 3IRRA 2PBIA 4G7OF 3KP3A 1G6NA 5FFXA 4EV0A 1HBXG 1BBYA 2NYXA 4RB0A 3C1DA 1WQ2A 3OOPA 5JFRA 3K9TA 1KU9A 2VC0A 1OKRA 2ZFWA 4Y15A 2EFWA 5LHGA 3HTUA 3DKWA 2H09A 2DLLA 4Z2YA 4IJAA 2G7HA 2OZUA 3ZN1A 2YSRA 3CO6C 2FXAA 4UV9A 3RTRA 5LLQA 1UFMA 3HSRA 5DCMA 4A6DA 3M8FA 2Q8KA 2EV6A 5D5UB 4I09A 1XMAA 2MLKA 3B73A 4LB6B 3MQ0A 2X4HA 1R36A 4KYWA 1TQMA 1MJAA 1SMYF 1D3YA 3EQLF 3V7RA 4IHTA 1HW2A 3EUHA 2DFIA 5HLIA 2HR3A 3HUGA 1F4KA 1H0MA 4HBLA 4HDUA 3F6VA 1RIOH 4BH9A 3CLOA 1QBJA 4FX0A 1S7AA 3LAPA 2KRFA 4Q47A 4EGZA 5E1WA 3DP7A 1ZH5A 5BPIA 3GW2A 2VBXA 3ECOA 5IT9K 1ONVA 4MTEA 3E5UA 5TJJA 3BPXA 1R22A 1ZG1A 5CYVA 1L3LA 2K4BA 1W7PD 4WXCA 1USSA 2PLYA 1XB4A 3FMRA 3FMQA 3WGHA 3KZZA 1YS7A 2OZ6A 4G7HF 1EV7A 1DP7P 1I5ZA 4NB5A 3F3XA 4CHUA 1BIBA 1HQCA 2ZNYA 2MH2A 4R1HA 4I01A 2MLGA 4KIFA 5BQTA 3SXYA 1JGSA 1OPCA 4YIFA 4MHGA 5BPDA 2XKPA 3IKVA 3HRUA 1IF1A 2ADUA 3IWFA 2IVMA 2OAZA 3HHGA 4PZJA 2VN2A 5D5VB 4R8HA 5E17F 3RPUA 4YFXF 1PP8F 3LQQA 5L3DA 1ZLJA 1FWZA 2CG4A 3JAMZ 4OIQF 2P4WA 1Z05A 5H6RA 1BC8C 4CO8A 1DPRA 1QPMA 1HW5A 5E8GA 4HLXA 3MAJA 3CDHA 3EETA 3W6KB 2ZJ2A 1TW2A 4RGXA 5LHIA 1FBSA 5CVUA 4P5OA 3QU6A 1LEBA 3KZYA 1MJ9A 4BHCA 2W24A 3T1BA 3WTUC 3BP8A 4HA8A 5H20A 4LLNA 1JE8A 2GIVA 3GWZA 4NHJA 1UB9A 3IL2A 2VC1A 2GZWA 3MWMA 3BJAA 1BI2A 3E97A 2E7WA 1LEAA 3HRSA 3R0AA 2HTSA 5LRRA 2ZMEA 2V9VA 2UXXA 2FEZA 1U3EM 3IWZA 2IA0A 3F8CA 4OIPF 2IA2A 5JR3A 4IHSA 1FSEA 2CQKA 4MTDA 3ABUA 2MH9A 1LDKB 2XAGA 3I59A 5BOXA 4O3MA 3E6CC 2CFXA 2XKOA 1R23A 3KEQA 4KA4A 4XSXF 1YG2A 1ZREA 1ZGAA 4AWXB 2BEOA 3H3UA 3F8NA 5CVIA 2OD5A 2YPRA 3LQRA 2K4JA 3T0YA 2Y0MA 3JSPA 3ABTA 1EH7A 2JTVA 2ISYA 5BMZA 5DUKA 2HDCA 3K1MA 2HFHA 4LGWA 5A2QK 2EK5A 2J5OA 3V4GA 1VTNC 1KGSA 2MBFA 2CGPA 1O3QA 3C18A 2EV0A 3R0JA 3ISPA 1RNLA 2RDPA 1USTA 4EJUA 2DTRA 3E6BA 5HS7A 4ZZLA 1XDUA 4EVIA 3BWGA 3WE3A 3M7GA 4Y13A 2ELHA 5DCMB 2QBYB 4M9XA 3TO7A 1KQ9A 4P96A 1J5YA 1B59A 4BYYA 2L02A 2HKOA 3BPVA 3JW4A 2L4AA 4LK0F 4U7BA 5LGNA 1B9MA 2WWYA 4MGRA 1V4RA 4RGRA 2Z9OA 3V8LA 1KU2A 4RS8A 3HOTA 5FD5A 2V1DA 1QGPA 5HDNA 1Y0UA 5HDGA 2XAHA 4H0EA 2XROA 4PGHA 3GFIA 1TTYA 1ZAOA 1U5TA 5F6FA 1Q1HA 1XDSA 2DT5A 2RVCA 4EGYA 3V8JA 2ACJA 3RPQA 2BV6A 2HEOA 2FMLA 4HOBA 4L5JA 2W84A 2QQAA 3SZTA 3KP7A 2O3FA 1J75A 1U2WA 2CWEA 4I7HA 1TNTA 1IRFA 2UXNA 2VXZA 5D8LB 1G3WA 1P4WA 2WTEA 3E5XA 2UWMA 4LK1F 5CJ9A 1A04A 2P7VB 4I02A 1XSVA 3ZMSA 5FLXZ 1JXSA 5D5XB 4WK8F 3B02A 5ICFA 3WE2A 3DQVC 2XV4S 1LDJA 3I53A 1O3RA 2GQQA 2O8XA 2J5PA 2P5LC 2L3DA 1S8NA 1P92A 2F2EA 2NNYA 1IN6A 1QO0D 4KDPA 4XLPF 4RGSA 2B0LA 3KP2A 1BIAA 4BQAA 3JAMK 2HZTA 3ZMTA 5K5RA 2E7XA 2K27A 2QYOA 5L3EA 1OYYA 2H27A 2AXLA 1MJBA 1KA8A 3GO5A 4TV7A 1F9NA 2M8EA 2A61A 1YW7A 2A3SA 1UHWA 2VE8A 2G9WA 1E17A 3K1PA 3KE2A 2WV0A 4PGGA 4A5NA 4U0YA 2ZMEB 3RIRA 1XSDA 5AIQA 3C3WA 1ZRCA 3R61A 3TGNA 4EJOA 1T2KA 3RYPA 2DPDA 3BY6A 3FM5A 3WU0A
chains in the Genus database with same CATH superfamily
3I59B 2F5CA 3GF2A 1WFXA 2CUFA 6PAXA 1XC5A 1K79A 2EB7A 3OL3A 4FQGA 1UG0A 3G73A 3H3ZA 1G3TA 3A02A 4BKXA 2X51A 2DA6A 2CJJA 3WTZA 1I6XA 1RR7A 2KRHA 4A3LJ 2WA0A 4Q4ZF 2JA5J 1T0FA 1AU7A 5F27A 2IS6A 1S6LA 1HCRA 1S5LC 2FOKA 5DDGA 3FXUA 2W00A 1ETYA 4II3A 5M5YJ 3CO7C 5DD8A 2JPCA 1SC7A 2E2JJ 2TRTA 3MKWB 3ZQHA 3ML6A 3F8FA 2X6XA 3IV5A 3LA2A 1W0TA 1KQ8A 2MD5A 3O8GA 2ZCWA 4ZJZA 1GVJA 3KYDB 3VFZA 3VEPA 4B09A 3BJ6A 1SFEA 1RKWA 4KIGA 4ZTFA 2NAZA 3TKYA 4XOPA 1HF0A 5ED4A 1BI0A 2LDUA 4ITVA 4KN4X 2OPTA 4ZYAA 5DM6F 1J09A 4MQ9F 1IN8A 5E8IA 1DPUA 1RKTA 2FX0A 3TW6A 4A2UA 4CCJA 5ICCA 3OYBA 4E6KG 3OV8A 2XGEA 1OFCX 2R3SA 2BVLA 3DCFA 2LNBA 4NC6A 3FXOA 3Q9VA 3W6JB 2O61A 2M7BA 4CCOA 4Y4RA 2I5UA 1KU3A 2XF7A 5JI6A 2K02A 3MZYA 4WCGA 4XLAA 3B6AA 2XRNA 4JK1X 3H1CA 5L3CA 2DA4A 3DBHB 4G6QA 4N0BA 5GP9A 3E3VA 3G4SI 2WAQA 2STWA 4P9FA 4I76A 4Y33A 1QHGA 3KCCA 2LK2A 1FMWA 1YX3A 4OIOF 3LSMA 3K69A 2W48A 3CF5F 5LEKA 4CCNA 3FM3A 2JN6A 2LC2A 4RA2A 4JYKA 3CUQA 4LJZF 1AKHB 4BXUA 2VKDA 3K4LA 4XLNF 1R5GA 1E3HA 2VQHA 3DKXA 1BOAA 2R7DA 1P7JA 1V5EA 1Z21A 4EM1A 1J9IA 1U8RA 3WGGA 5GPCA 3ZQFA 2DOAA 4DYRA 2XSDC 1ZGWA 2DBBA 2RREA 1VI0A 1VQLI 2ZXJA 4I98B 4YG2F 3KFWX 4FX4A 4LG0B 4HDVA 3F8BA 3AL0B 2IGNA 4BBRJ 3S3NA 2LF8A 3OS0A 2WBMA 2Z5UA 2XUBA 4BEHA 4HF0A 1YRNA 2IP2A 2HWVA 4KT5C 2JWTA 2DA2A 2F48A 3RJPA 3GFJA 1MNMC 4UB8C 4AD9A 4RAZA 3I4MJ 2R7VA 3RZOJ 1K7AA 3CQZJ 2MABA 2Y30A 1V55H 3G2BA 4HQMA 5KVRA 1PJRA 1IRXA 3QAHA 3CLQA 2VONA 3HOSA 1XMKA 3LSTA 3X2QH 3SHFA 3JRGA 4BUPA 1I1GA 1WJBA 1Z3XA 4L9NA 4XKCA 2FBHA 5FD6A 3DPLC 4HG2A 4ZYHA 3AG1H 5AIPA 5HVQC 4KICA 3WTYC 3T8RA 2AS5F 2F4OB 1IG7A 1X19A 3U9GA 4LOCA 2LD5A 3S32A 4AVZA 2R7WA 1S3JA 2PQ8A 4IQJA 4B1RA 2VBYA 1QZZA 1J59A 2IJLA 1UHSA 4CDGA 3DFGA 3O6BB 5L3FA 5HNFA 3IKTA 1XCVA 1WJCA 2UUZA 1FZPB 2OU2A 2N8GA 2GOXB 1ON2A 1SFKA 5FKNA 3PIOF 3NWSA 2XHKA 3M1EA 2EQRA 1X3UA 2LY2A 2OA4A 1T8IA 4IO9F 1DU0A 1KU7A 2CU7A 3CZ6A 1JTYA 1IV6A 3RQ4A 5CPRB 4NBQA 4UHTA 3GTPJ 4JP0A 4IHXA 1JGGA 5F04A 3LFKA 2NS8A 5IY5H 3TEDA 5JLWA 1I27A 2DMQA 3D5LA 2DYRH 3NWTA 2H8RA 2HYFA 1FTTA 4BU2A 5J4VA 1H9GA 2CW0F 2EZIA 3FDYA 5HS8A 4ENMA 5KHDA 3CCYA 3I4PA 3R60A 4K2EA 2BXZA 1W1WE 2W57A 2PFBA 2ISZA 1KQ0A 4LLLA 1TLHB 4E7HA 4NNJA 2K40A 1IC8A 4ZYEA 3GZ6A 1IN7A 1HOMA 4PDKA 4XLHA 1OYIA 2LLKA 2VIXA 3TO6A 4R79A 1MKMA 1MDMB 2JSCA 4JBAA 3T8TA 5FLXK 5K5OA 4IVNA 3ULQB 4A5MA 2M45A 3FMSA 3HOYJ 1BN5A 4I6ZA 2W85A 3VSKA 1YW9A 3BLYA 5FB2A 3F21A 3I64A 1G8XA 5F0CA 3DPTA 2FE3A 4H4KC 2HQNA 2ZBKA 5K1YA 1HKTA 3S1MJ 2L9VA 5FRMA 4QSHA 2CS3A 5GAGJ 5DS9A 3BDDA 1FP1D 3O8HA 1UCRA 3Q0WA 3EUKL 1X1BA 1SVLA 2R7SA 2QUFA 2DA7A 5IP6A 5EYRA 3K4KA 2VQGA 2LP0A 5IPAA 3N4MA 4O6JA 2K3FA 3RZDJ 2VOOA 1W4MA 1WH5A 2LF7A 3OMYA 1FNNA 2RQQA 1Y39A 4A3JJ 1XMXA 4ZDPA 5LBQA 1HXDA 2L54A 3LA3A 3HHHA 3RKXA 1JKQC 2VT2A 1MBKA 1FYLA 3OS2A 1BR1A 3PFIA 3F0CA 3KZIC 4DYQA 4IRIA 2FMYA 3ZMZA 2E71A 3S1RJ 1B4AA 4KMFA 1D8JA 5IP7J 3L00A 1RC9A 1GXQA 1A36A 5DM7F 2EZKA 5GAEJ 2HDDA 3GLXA 4N9IA 5F0FA 2PJPA 2HXIA 3R4KA 2JSPA 3PUFA 3VB2A 5KNLA 2CW7A 1ZRDA 2E5NA 2F4IA 1TC3C 3MEXA 1YW8A 3CCSI 1HDDC 2K7LA 3CCLI 2PJRB 3DEUA 3H5RA 3LWFA 4BHBA 1WSUA 1Z7UA 2KDOA 2GLOA 5DD4A 2RKHA 5EZGA 2R4GA 1J2XA 3FHZA 4BNCA 3S15J 1K83J 3OYKA 2VJ5A 1DGWY 1ZG3A 1R5ID 4PJNA 1ZYRF 2Y0SA 1IXSB 2M4KA 4C3JJ 3HRMA 2Y48A 2E34A 3TL4X 2QLZA 3I5UA 1QPIA 3E6DA 1SANA 3J81Z 5J3LA 1FC3A 2OF7A 4OU0A 2M1BA 1JUPA 2DYSH 2Q0OA 3F9KA 3IUOA 1CF7A 2LSOA 2C6YA 3LSGA 1ZHFA 4MQVA 2M0MA 3L2WA 5LHHA 1HDPA 5HLGA 1VQ7I 4NC7A 1FYKA 3G71I 4DNCA 1IAWA 3LSIA 3OYNA 4E7KA 3HSFA 5EG0A 4N9HA 1OCOH 5FO5A 4NDLA 2V1UA 1U8BA 5EGOA 3COAC 1SD5A 2A6TA 2H94A 1BC7C 4I2OA 1TQIA 4S04A 4F52A 5GPAA 1UHMA 1TWCJ 3ZP5A 1SD7A 4DIQA 1WWXA 4E4HA 4XSZF 3OYIA 4I99C 1XGSA 1ETXA 2KFDA 2X1CA 1OCZH 3RYRA 2QCOA 4S05A 3WHBA 4IF4A 2ZNZA 2EA4A 3QPTA 3BR6A 4UUSA 1IXCA 2OC6A 1FIAA 2A5WA 3BR5A 5TRDA 4BGDA 1A6QA 1WGXA 2F5FA 2M9HA 1LB2A 4OIRF 1F36A 1T95A 3FHNA 1G2HA 4XLFA 2R7ZJ 1FT9A 3QYFA 2XAQA 2NS7A 1HKSA 2PMUA 2EIJH 3FZVA 4EEFG 1BJAA 2DAOA 3IRQA 1I1SA 5FKKA 1IXRC 1DDNA 3OS1A 1MH3A 3P7NA 1Y0NA 3D5RC 4IXAA 1GXPA 4XBFA 1SVMA 4Y17A 5IYDJ 2M5WA 2R93J 4J00A 1ETVA 4KN7X 1S72I 4LD5A 1YLFA 1IDYA 4WXDA 2E5ZA 4HF2A 3CDLA 2E1MC 3NARA 1OJLA 5IYCJ 4WWCA 2XASA 1FBQA 2CQQA 1SFUA 3GTMJ 1D1CA 4LITA 2OBPA 4PJ0C 1K4SA 3CUOA 3L2CA 1FOXA 4CUGA 4BE1A 1VQ6I 2R7RA 3CP8A 4OAZA 2LYCA 2VJIA 1U9NA 3G3ZA 3ZCOA 4M73A 4LIUA 4E7SA 4EM2A 1A5JA 1Z6RA 1UG2A 2O7OA 2BYVE 3M9AA 3CUQB 3FBIB 1REPC 3HUGB 2DOEA 2ZSIB 2HGCA 2X48A 5D4RA 2KHMA 3RSNA 2LR8A 1VZ0A 1MBJA 4II2A 4A6EA 4YFKF 3G1OA 3SFIA 4AVPA 1D1BA 1K78A 1LNWA 4IRGA 4GRIA 4KJZA 1NH3A 1HLVA 1HSTA 2D2WA 2CH0A 1IZ1A 1LFUP 2JT1A 2Z33A 2DXIA 1JUMA 1TP4A 4XL9A 2IPQX 4GGGA 2ZXIA 3VOEA 1R00A 2IS2A 3H92A 3O3KA 4UXNA 4BEHB 3HOXJ 3ZXSA 4LMYA 1YRNB 2KJCA 2Y75A 1FYMA 3Q9SA 3IAS2 2DCEA 2RGVA 4X0GA 1SD6A 1XGOA 2ME6A 3J7AY 2V9PA 4ZYGA 3QOPA 1D5VA 3SDBA 2QSHX 2E1MB 2O5RA 1BI3A 1OCPA 2VE9A 2PG4A 3JRFA 4A3MJ 3RPUD 2XGCA 4CGZA 1ODDA 3JR9A 3J7AO 4ESBA 1YITI 3PNTA 5IT3A 2NVQJ 1W36C 4ESFA 1WJ5A 5CLSA 1P4AA 1RUNA 1TWGJ 1QA6A 2PI0A 1TBXA 4HSRA 2STTA 2HTJA 2XAFA 5E20A 2Z2SB 1W36D 3QRFF 1FTZA 3ECHA 1FOYA 1XGMA 4A3EJ 1LVAA 1JUSA 3PFYA 3C2HA 2CO5A 4CA0A 2WB1N 5ERIA 2JMWA 3FXQA 5D4SA 3ZMUA 1LE8A 3VDXA 1W7PA 4FHTA 2DQLA 2R5YA 4YEJA 4HNVA 1TZLA 3BJOA 2O6GE 4L18B 3HEFA 5M5XJ 2QVOA 3VYUB 4KISA 3H0DA 1GT0C 1WZ2A 1P4XA 2M34A 5F1JA 2L9SA 3JTHA 2ZKZA 2PMHA 3HGYA 2AO9A 3ZQ7A 3V8KA 2GM4A 4FETA 1KYZA 3AG3H 4A3KJ 2Q2EA 3QPHA 3GYHX 2NVUB 1ORKA 4XQFA 1MBFA 3O2PE 2LKSA 4GYIA 4E7IA 2BY1A 1YTYA 2D45A 4AIJA 3Q5FA 1A31A 2DO7A 3DKYA 4O5VA 4D7NA 1MBGA 2ZMEC 4Q5SF 5F08A 1ULYA 4MFEA 4DQ2A 2E2HJ 2PN6A 3WTTC 2JA7J 3BQZA 3HRTA 4BY7J 1TNSA 3BTJA 1FPQA 4KUMA 1Z9CA 2FU4A 4UVAA 3S3MA 2MC4A 2FQ3A 5AONA 5B1BH 4L9TA 3S1NJ 1Z0XA 5F0HA 1Y1VJ 4LFUA 2ZJRF 2L9RA 3OIPA 2XC7A 4A69C 2M2EA 1IN4A 5KCMA 2PMZA 3H9JA 1LQ1A 2EV5A 1QRYA 5D6FA 4U87A 2EIKH 1WJAA 3E7LA 4UV8A 2Z16A 2FD5A 1U6GA 4UVCA 5FFZA 4DJAA 1VFCA 1T98A 2EFOA 3ONQA 3AKZA 4PFPA 2L0KA 2RN7A 2JRTA 4G12A 1GDTA 5E18F 4BL0B 3F6OA 2W4SA 3MKYB 4FT8A 1MZBA 1XSXA 3NEUA 1GHCA 1QZYA 1EH8A 4U7DA 1I6HJ 5ILUA 1O3TA 1S9HA 2EWNA 4ASNA 3TOAA 1L0OC 1I39A 2NNNA 3ELKA 4U0WA 5FROA 2YX4A 1R58A 3L2UA 1T38A 5J1RA 2X0LA 1JTXA 3OYLA 1JKOC 2KIUA 1BR2A 2DODA 2XAJA 4GO1A 2QZ8A 3F8MA 4G6TB 3IP4B 4EATA 2DMPA 4ENKA 4QTRA 1N75A 1RZ4A 3GBGA 3KEYA 2R7FA 5BS6A 1W0UA 3W3CA 2NOGA 1T56A 3REOA 3HPGA 2VKEA 4FE7A 3MKLA 1ZN2A 2EZLA 1MNDA 2ZO4A 1X2MA 1YJWI 5E1XA 1U0JA 4NC8A 1TQPA 1D8KA 1EJ9A 2KL4A 3M1CA 3RKWA 5CVJA 4CYCB 3GX4X 1XN7A 1R1VA 2DK5A 3KYCB 2F4MB 2XPUA 1LVKA 4Y7NJ 4CCKA 4L9JA 5IYBJ 3PM1A 4UUTA 2G7UA 3I54A 3CCVI 2RNJA 2ID6A 4EM0B 5J8FA 5JVTA 3MFKA 2KDZA 3L9FA 3I0TA 4D5FA 2F6CA 3DU5A 3ABMH 3OY9A 3CDIA 3K4JA 4UNOA 3HM5A 2QEXI 1JJ6C 2X1DA 3DEWA 1FY7A 1S7EA 3OR2C 3AFHA 5F1RA 3S2WA 1CF7B 2DK8A 1R1UA 2LOOA 5E1ZB 4HX4A 1S29A 3OR1C 4M9ZA 5FLMJ 4A0ZA 3BTIA 4DZPA 1WJDA 1FOKA 1Z77A 1WKMA 1K6YA 4CSWA 4HNTA 1FLIA 4HX7A 3J81K 3AL0C 3CJNA 1SMTA 1OMIA 2BY2A 3QQAA 5EG0B 1FSHA 3BC8A 2R7XA 2COMA 4A93J 1GUUA 5EGOB 5J4YA 1AA7A 9ANTA 1VF9A 1CGPA 3AAFA 3W6VA 4RB1A 2VBZA 1UJ8A 1Y56A 1O7FA 4CICA 4GFBA 1R5HA 2P6TA 1HW1A 2JPBA 2WC2A 3KX2A 3CTAA 1LFBA 3CJQB 1MMSA 1RESA 1T33A 3DXJF 5HLTA 3J80Z 2K9LA 1B6AA 1K6OA 2FSWA 5GTIC 2QKMB 3L2VA 2V6CA 2E1OA 1MIJA 4M72A 1LDDA 2QBYA 2FBIA 3G6EI 1H89C 2ETHA 4UUSB 1B1BA 1H88C 4GDFA 4PSWA 2CYYA 1H9TA 3CJRB 2KPMA 3HDDA 5HDKA 3ERED 1U5TC 2EJRA 1ZQ3P 3V7SA 3CESA 2R0QC 2XVCA 4GYGA 3HZJA 1YIJI 1AWCA 2EFPA 4RMNA 1IUFA 2IRFG 3PQJA 1Y6IA 1K61A 2HVSA 4U88A 2DDBA 2KKOA 5DYMA 5FKOA 3CCJI 2QM3A 4PJMA 3MCZA 1R7JA 2BY0A 1QQIA 5ICGA 3L09A 2JVHA 2OV7A 4BDZA 2VI6A 2CSOA 4AYBN 3MN2A 2QSGX 2FNAA 3HB9A 2A68F 2P5VA 3L2RA 3QPSA 2DPUA 2CV0A 1YS6A 2HYJA 3GFLA 2HVRA 1G4DA 4L0YB 2VASA 1D5YA 1MGTA 1YYVA 2L2OA 1PDNC 5B5EC 2L4MA 2ESHA 1X4OA 4IPAA 1WI3A 4BJ5C 4RBOA 4ZC3A 3WODF 2GA2A 1FMVA 5HOOA 2DQRA 1P9QC 4AM3A 5DTDA 1TT0A 2A6HF 4XR6A 4HX8A 2FNPA 1K78B 2D1VA 3WG9A 1BA5A 2V1XA 1UELB 1U5TB 3SYTA 1LJ9A 1DUXC 3S2DJ 2V26A 1JI8A 5K7ZA 2VOPA 1P2FA 3QU3A 3B6CA 1ETQA 3J7YJ 4M3FA 5CVRA 2KP6A 3TBIA 1MBEA 3ABKH 3E6MA 4I0BA 2IW5A 4ZZDA 4Y3OA 2P6SA 2IBDA 2DA1A 4A3BJ 2GXGA 3LMMA 5K5QA 1Z7LA 1T39A 2NVXJ 2W25A 4ZYDA 3SZGA 1X3ZB 1YE9A 3OWTA 2L7FP 1XD7A 3IHUA 2VT3A 1E3OC 4A12A 4XKBA 4OINF 3I3LA 4IZZA 4YIIA 3JTGA 1OQYA 1Q1VA 3ZMDA 3GEZA 1B8IA 1IRGA 4M6YA 1QHHD 3HTSB 4AIKA 4B4CA 2DMTA 2MC3A 1WJEA 5J1YA 4BACA 3TDUC 2UZKA 3LFUA 2LH9A 4B3XA 2VUMJ 3D0SA 3FIWA 3OYDA 2XB0X 1GV5A 3PIPF 1SAXA 2IT0A 3BCBA 1YIOA 2LY1A 2ME0A 4C9YA 2H6CA 3D1NI 1OCCH 2R7TA 4M74A 4EMSA 3K4MA 4HF1A 4AIHA 2BE5F 2VODA 2RC4A 3TP3A 1O4XA 2FA5A 2OJED 4DW6A 1ERDA 2FF4A 1BM9A 5L3BA 2BVMA 3PL8A 2OQGA 2YU3A 1LE8B 3BG6A 1IDZA 1W7PB 3HSEA 2BW3B 1WPKA 3U2RA 4QLCU 2R5YB 4JX5A 4D5CA 4YIRX 2D5VA 4GCVA 2P81A 1ZG5A 4IHWA 2E35A 1F1ZA 3WTVC 5KK1A 2NVTJ 3LNQA 4A3FJ 2EFNA 5E3OA 5J1UA 4OMYA 2FBKA 2HOSA 3M07A 5ILVA 5TGTA 2AQEA 4JOMA 4RB3C 2Q2EB 2QQBA 1ITYA 3K4CA 1ETOA 2A6EF 3GUDA 2JRMA 1ACIA 4WX9A 3HKZN 1SD4A 2H1LA 3FXJA 4UB6C 4DZJA 1LFPA 1R1TA 3WGIA 3GTGJ 4ENJA 4G9YA 4RAYA 4BS9A 4A0XA 1BI1A 4MNUA 4HYEA 4XIDA 4D7MA 3SEZA 4CCLA 3GVAA 3ZN0A 3HG9A 4ESJA 4OAYA 4HPQA 2JVGA 3K1NA 3VYSB 3KEOA 4G6DA 1SFXA 2XIGA 3GZ5A 4AU7A 2OQRA 2X1EA 1VQOI 5LRSA 4ABZA 4KITB 3MZHA 3KP6A 3F72A 4ETSA 3K2ZA 5LEJA 4C2UA 2K9SA 3HBLA 4HNUA 2DT6A 3WU1B 2I10A 2R7QA 2DW4A 4P9UA 2ZFUA 5CVVA 2OTLI 3DU6A 3HC7A 5CQEA 2ZJQF 3DF8A 3ERMA 1T0FC 2GWRA 5FJ8J 1Y1WJ 2EFQA 3VODA 4M9SA 4IOAF 5DV5A 2P0WA 4EJVA 2O03A 3VWBA 2VJ4A 3VSLA 2HQRA 1FEXA 3DTIA 4S0HB 2CW8A 1LUJB 4IL6C 2YR2A 2HKXA 1F5TA 5D5WB 2P7CB 3KLOA 2A69F 2BGCA 3RDIA 3OYMA 3I71A 4HV5A 4LLGF 2DI3A 3W2VA 4CCMA 1VQ4I 4JX6A 4RB2C 3EDPA 4KMUX 1IW7F 3RQIA 2JQ7A 5LD2C 5J47A 1Y8RB 1ENHA 5J8CA 4UY8I 2EH3A 2XGXA 5FGMA 4WF2A 5EDNA 5FKLA 3GTKJ 3K70C 3U1KA 1YOVB 2EZHA 3LAJA 1G3YA 2HYGD 3M8EA 1YHQI 3ZQIA 5H6QA 2D1HA 3C2GA 1POGA 2X6YA 3HYIA 1EKEA 3MKZA 2DT7B 2LRDA 4D1QA 3K70D 2GA1A 3CCQI 4EQQA 2LKPA 1RETA 3BOQA 3FBNB 2DFEA 3LL7A 2GOMA 2GBYA 4RGUA 3ZMVA 5B66C 3H9QA 3TDZC 4CZZA 1MMNA 4Q48A 1VQKI 5ILSA 3S8PA 2CUZA 4L9VA 4G7ZF 1DU6A 4OMZA 3HOUJ 3PQKA 3ASNH 2NRAC 3BCAA 3FXKA 1MSEC 2IS4A 4DGWB 2ICWG 5M3FJ 4ENNA 1KYWA 1WCMJ 2FRHA 3CUQC 1SFOJ 1HSJA 1OLTA 2KIMA 5HS9A 2WY7Q 2Y69H 3DV8A 1YQAA 1VQPI 2Z99A 4HV6A 4M6XA 1KZHA 3NRVA 1PUFA 1YO5C 4PSXA 4BHPA 3ZPLA 5D6EA 2WY8Q 2IGOA 3DBRB 4BAYA 2DA5A 3BQYA 3ZQLA 3A0HC 1CQTA 3EYIA 1XPXA 1C0WA 2RNGA 3KIOA 3KETA 3PO3J 2DMUA 1PUEE 3UR3C 3BROA 3SQNA 3CCMI 3N97A 2WADA 4HRIA 1NHAA 4XRMA 1SEUA 2O9LA 2JZYA 5IOYA 4M71A 3LA7A 5B3SH 1QVUA 4BE0A 1YI2I 3WTWC 3OSFA 1GLNA 4B3AA 4HQEA 4IHVA 2AQFA 3E5QA 4BE2A 4V2GA 1JJ8C 2VKHA 3GTQJ 3QP6A 2BHZA 1ZLKA 2DMNA 2HU9A 2VQLA 4CH7A 2KZVA 3TMOA 5GADJ 3DBLB 4F93B 3JRDA 1IN5A 1X1AA 3RCOA 1O7LA 2XSJC 4IX7A 2X6OA 4LB5A 4PUSA 2P5KA 2ELJA 1U78A 1PP7U 2A5YB 3P9CA 2L7MP 1QNTA 3LSRA 4LG0A 3IAM2 2KIFA 3WU2C 1JHHA 5JHUA 4FTHA 5IT9Z 3BG7A 4QIWN 4I0AA 3J80K 2L01A 4IOCF 1D0ZA 3S2HJ 1J7KA 4PCQA 1W5CC 3PSFA 3JSOA 4UUVA 2F5EA 1B9NA 3HJEA 5DUIA 4B47A 1YX5A 2VJJA 4ANJA 2HXOA 3SFZA 3BTCA 5HLHA 2LMDA 3I4NJ 4AIDA 2TCTA 4C3HJ 3DPUA 4CYDA 2V7FA 2QWWA 4HZFA 3P9KA 1VQ8I 1IJWC 1OR7A 2HI3A 3R6SA 1DP3A 1EH6A 2L7ZA 3CP2A 1JKRC 1FP2A 1ZGJA 3K0LA 3HOWJ 1YJ9I 2EA2A 3ROUA 3TOBA 2TDXA 1JHFA 3IC7A 4U0VA 3BTLA 1FBUA 4HLYA 1TW3A 4BQNA 1LKXA 1MNEA 3V7CA 5C4JJ 1VQMI 2CQ7A 1WRJA 4D0PA 2VQCA 3KP4A 3S1QJ 1G3SA 1P6RA 3S16J 1IUYA 3H9GA 3QP5A 5EEHA 2QF7A 1NG6A 2QA4I 2QQ9A 3LSKA 3HOZJ 2Y2ZA 5JHFA 3RKQA 4NQWA 3HOVJ 2M30A 3KPHA 2ECBA 2IEKA 2RQPA 2M3AA 2YX7A 3FX3A 3EYYA 5EEGA 3WTXC 2ZXHA 4ZH4F 5F64A 3RI4A 4B8XA 2M8GX 4ZTJA 3QYEA 3PJRA 5C3EJ 3GXOA 2NOJB 4F3QA 4MEYF 3LOCA 2VL8A 3GFMA 1Z91A 2VBWA 4LG3A 3EUAA 4KIBA 5IOZA 5LFAA 3RKYA 1MD0A 4GXOA 4YFNF 2DU9A 4P55A 1OYWA 3BR3A 1S7OA 3A2KA 4N4OB 1B8IB 4EJWA 4A3GJ 1OISA 3H5NA 2GXBA 1J0RA 2HZDA 1NK2P 4XRFA 1SVOA 1A35A 2X6WA 4A0YA 1AOYA 4C30A 3HIFA 3ZRGA 1W5SA 2XB5A 3F23A 4L0ZB 5D8KB 5CKTA 4E70A 2HOTA 3SZPA 4G94A 2H6BA 3TQNA 1MDMA 2KJBA 3NQOA 1WI9A 1Z6TA 3QPLA 1T6SA 3FKJA 2MSYA 4ON0A 4KNYA 2OCCH 3A01A 1HKQA 3FF5A 3KLNA 3SDGA 3H35A 4RM3A 2KQRA 2DDAA 5LGTA 2WB1A 2IA1A 1FX7A 4XN3A 2V79A 5DCFA 3DLLF 4XM3A 2HS5A 2M0CA 3P9IA 4EJTA 2JA6J 1P7IA 3KP5A 1E0EA 1W5TA 1IGNA 3GTLJ 2XF5A 2IXSA 1UAAA 3CD6I 3A0BC 5L3GA 3M4OJ 1E2XA 2BOLA 4F7ZA 5M3MJ 3WTSC 2K86A 3A03A 3Q0UA 3QYBA 2NS0A 3EPZA 4L5IA 4HW0A 1YFHA 4NUBA 3F22A 1ON1A 1ZARA 2M87A 2O0YA 3BG5A 4X6AJ 4OWRB 5B1AH 5E79C 2MA3A 2E1CA 3CMAI 1RI7A 1XCBA 2CMPA 3FXMA 1XTAA 4QPQA 2CFOA 4XMYA 1B72A 4HAMA 1RRJA 2B7EA 1DGRM 3I58A 3M8JA 4RLQA 4MEXF 4W1UA 3DEEA 1Z1DA 4LIVA 2A07F 1BR4A 2HOEA 2RV8A 4CXFA 1JT0A 1N77A 2K9QA 1I3QJ 2BBYA 4XKVA 2QENA 5J6XA 3S17J 3BR1A 1ZR2A 5DEQA 4IHYA 2Z3YA 3E0JB 4WXHA 3T5XA 1V5GA 5LGUA 1O57A 1UZCA 1Z67A 5ICEA 3L7WA 3G1MA 4JQFA 4DBQA 2W82A 4QWQA 2IGMA 2VKVA 2ESNA 1XGNA 2BZTA 2MYSA 3ZQQA 3FXRA 3TP0A 2X85A 4UVBA 4IRHA 3C7JA 1RUOA 4C2TA 2E1NA 3FK6A 4HSTA 5E3MA 4J19A 4YELA 3CCRI 2PEXA 3OYFA 2GAUA 1ZRFA 2KT0A 3C2BA 2P8TA 3BZ6A 4CZCA 3IH3A 1STZA 4MIMA 4OOIA 3GMEA 2V4JC 2LVSA 1O3SA 3CCUI 5A2QZ 4AUXA 3U1DA 2F5DA 3FWEA 1NG7A 3TO9A 4BQQA 2DTZA 3OYEA 3FKIJ 4DYCA 3TW7A 4A3CJ 4KFCA 4G8XA 1V3FA 1K4TA 3IRRA 2PBIA 1VQNI 4G7OF 4RAFA 2JA2A 2HPMA 1EA3A 3KP3A 1G6NA 5EF6A 5C44J 4XK4A 1X1DA 5FFXA 4EV0A 3I55I 1BBYA 2DOFA 2NYXA 4RB0A 1HBXG 3C1DA 1WQ2A 3E1SA 3FXLA 3CCEI 2Z1DA 2ELKA 3OOPA 1ETKA 3K9TA 5JFRA 4F92B 1KU9A 2VC0A 3HL2A 2LBFA 1OKRA 2MFZA 2ZFWA 4Y15A 2WAQN 2CQNA 2EFWA 5LHGA 1R49A 3BR0A 3BG9A 2AHQA 3HTUA 3IH4A 3DKWA 3UKGA 2H09A 3H3VK 2DLLA 3WHCA 3GZNB 4Z2YA 4IJAA 3Q3SA 3A1YA 4J01A 1ZKGA 2G7HA 2OZUA 3ZN1A 1MW7A 2YSRA 3JRAA 3CO6C 2FXAA 4BDYA 4UV9A 3RTRA 2BXYA 5LLQA 1UFMA 5BNGA 1YJNI 3HSRA 2FOWA 2OTJI 1FIPA 1X1PA 2R7UA 2E60A 5DCMA 4A6DA 3M8FA 2Q8KA 2AXTC 1PUFB 2EV6A 3V42A 1VQ9I 2COBA 4XOTA 5D5UB 2XDVA 3PUBA 4ZDOA 1BJZA 4I09A 2IS1A 1LPQA 3A4CA 2Y9ZA 1OR7C 1R4NB 2QSFX 3OL4A 1RPWA 1XMAA 2MLKA 4XORA 2IGKA 3B73A 4P1WA 1F43A 1D0YA 4LB6B 1U9OA 3MQ0A 2X4HA 2OCEA 1R36A 4KYWA 1TQMA 4F91B 1MJAA 1SMYF 1D3YA 1MMGA 3H36A 3CMYA 2VB6A 3EQLF 1GV2A 2L5QA 4KT6A 3OYGA 2KIQA 3V7RA 4FCYA 2X9DA 4IHTA 1HW2A 3EUHA 2DFIA 5HLIA 3OYCA 2HR3A 2W7NA 3HUGA 3GCMA 1F4KA 4M6VA 2NXNB 1H0MA 4HBLA 2XF6A 3CJTB 3VYTB 3F6VA 4HDUA 1RIOH 4BH9A 4PJLA 5EJCA 1X2NA 3CLOA 1R71A 1QBJA 4FX0A 1S7AA 5TISC 2G0EA 3LAPA 2KRFA 3I56I 2DJNA 2L9NA 4Q47A 1WJFA 4EGZA 5E1WA 3DP7A 4ZDLA 2YU9J 1ZH5A 5BPIA 3JCUC 3GW2A 5M5WJ 2VBXA 3MMYB 3PNYA 4RLFA 5FRNA 2KLOA 3ECOA 5IT9K 1ONVA 2ZJPF 2UV1A 3FK7A 4MTEA 3E5UA 1MSFC 5TJJA 3BPXA 1R22A 1ZG1A 3DWLE 1V54H 5CYVA 3JREA 1L3LA 1FOWA 4BXXJ 1N25A 2K4BA 2XRLA 2LTPA 4AYBA 1W7PD 2K9NA 4WXCA 1USSA 2PLYA 1XB4A 4DBRA 2R7OA 3ZQGA 3S14J 3FMRA 3FMQA 3WGHA 2B9SA 1BOBA 2MG4A 3AG2H 3KZZA 1YS7A 4RAGA 5HNHA 3PNVA 2JJ7A 2HDWA 2OZ6A 4G7HF 1EV7A 1DP7P 1I5ZA 3KYLA 2IAIA 4NB5A 3F3XA 5KAFC 1T08B 3H0GJ 3OOUA 2YUSA 4CHUA 2EPFA 1BIBA 3K2AA 1HQCA 2ZNYA 2K9MA 2MH2A 4R1HA 4XLCA 4I01A 2JA8J 1X3WB 2MLGA 4KIFA 4NQWB 2CV1A 2WAEA 5BQTA 3SXYA 1R9TJ 4C3IJ 1JGSA 2JUGA 2MGQA 4QPOA 1OPCA 1TT5B 2H8WA 1BW6A 4MHGA 4YIFA 5BPDA 2XKPA 3IKVA 3UNGC 5GTHC 3HRUA 1IF1A 2ADUA 2K5CA 2YS9A 3IWFA 2O8KA 2IVMA 2OAZA 1WHUA 3HHGA 4PZJA 3S3OA 2VN2A 2HOAA 5D5VB 4R8HA 3GTJJ 2EINH 5E17F 2KISA 4M3GA 3RPUA 2VXDA 2VLAA 3MD2A 5J40A 4YFXF 1PP8F 1HC8A 3K6GA 4PJJA 3LQQA 5L3DA 1ZLJA 1R6RA 1FWZA 2CG4A 3JAMZ 4OIQF 2P4WA 1Z05A 5H6RA 1BC8C 1HA8A 4CO8A 1DPRA 1IO2A 1QPMA 2NVYJ 2DN0A 1HW5A 5E8GA 3DTKA 3MAJA 2HQAA 1ZK8A 4HLXA 3L2QA 2LY9A 3CDHA 3EETA 3GLLA 3W6KB 3WG7H 2ZJ2A 1TW2A 4XRSA 4RGXA 5LHIA 1FBSA 5CVUA 2EBIA 4P5OA 3QU6A 1LEBA 3KZYA 2R5ZA 1MJ9A 4BHCA 4IKFA 2W24A 1D1AA 3T1BA 4L5EA 3WTUC 3W2WA 1ZELA 3BP8A 5K7FA 4HA8A 4BJTA 1BL0A 5H20A 4A3IJ 4LLNA 3A01B 1JE8A 3OIOA 2GIVA 3K4BA 1N78A 3HGGA 4XKWA 4IQ4A 3W2AA 3GWZA 1XG1A 4NHJA 4FISA 4A3DJ 1UB9A 3IL2A 3K7AJ 2VC1A 4RDUA 2GZWA 3MWMA 3BJAA 1BI2A 3E97A 2E7WA 1LEAA 3HRSA 2L7KA 3R0AA 2HTSA 5LRRA 2ZMEA 2V9VA 4BXFA 4BY1J 2UXXA 2Y0SN 4N4NB 2FEZA 2JUCA 1U3EM 3BT9A 2M7AA 4JX4A 4D9JA 3IWZA 1WVRA 2IA0A 3HKZA 3F8CA 4OIPF 2IA2A 1E3PA 1R4MB 5JR3A 4IHSA 4M3BA 1B72B 1BW5A 1FSEA 5C4XJ 1X58A 2CQKA 4MTDA 3ABUA 2MH9A 1LDKB 2XAGA 1GVDA 3I59A 5BOXA 3CMEI 4MFDA 3OSGA 4O3MA 3E6CC 2CFXA 2XKOA 1ZTRA 1PVEA 1R23A 2EIMH 3KEQA 2KMUA 4M3EA 4KA4A 5EEAA 4XSXF 4CYCA 1YG2A 1ZREA 5FKMA 1ZGAA 4XN0A 4XONA 4AWXB 3K4NA 3ZOBA 2PX9A 3K10A 2BEOA 1VNDA 3H3UA 3DTEA 4B48A 3F8NA 5CVIA 2OD5A 2XGDA 2YPRA 2QKLB 2A05A 4MO7A 3OIQA 3CF2A 3LQRA 2CV2A 2K4JA 1QZEA 3T0YA 2KRCA 2Y0MA 3JSPA 1X4PA 2Y31A 1EH7A 3ABTA 4XLEA 2XPVA 4W97A 1WH7A 3Q0VA 2JTVA 2ISYA 5BMZA 5DUKA 1ETWA 3QOEA 3ESWB 2HDCA 3K1MA 3J7ZI 2HFHA 3OYJA 4LGWA 2DA3A 1MH4A 2RAEA 5A2QK 2EK5A 2OUMA 2J5OA 4AC0A 3PO2J 3JRHA 3V4GA 3CC7I 1UMQA 3BZCA 1MMAA 1VTNC 1KGSA 2JK3A 2MBFA 2CGPA 1O3QA 2LBFB 2HPIA 3JRBA 1M1EB 3P5JA 3C18A 4E7ZA 2EV0A 3EUHC 3R0JA 3ISPA 1RNLA 2CUEA 5GAHJ 2RDPA 1USTA 3CMMA 5JVGF 3M3YJ 1RR8C 4EJUA 2LG4A 2DTRA 3E6BA 5HS7A 3PSIA 3ZGKA 1MMDA 4ZZLA 1XDUA 4EVIA 1NK3P 1IRZA 3BWGA 1TWFJ 1AKHA 3WE3A 2QGUA 5CQGA 1TWAJ 1SAUA 1IV8A 2H1KA 2DJIA 3M7GA 1XS9A 4Y13A 2ELHA 2FQ4A 1JKPC 5DCMB 3ZR8X 1JT6A 2HVQA 2QBYB 4M9XA 4MLOA 3TO7A 1KQ9A 3JRCA 4P96A 1J5YA 1X1CA 1B59A 3CC4I 4BYYA 2L02A 2M4GA 2HKOA 2GIZA 3BPVA 3DLAA 2XAUA 3JW4A 2L4AA 4LK0F 1OCTC 4U7BA 5LGNA 1B9MA 2WWYA 1H8AC 4MGRA 1V4RA 4RGRA 4BJ6C 2Z9OA 3V8LA 4XICA 5KAIC 1KU2A 2KZGA 4RS8A 3HOTA 4B44A 3BZKA 5FD5A 3LSJA 4C2MJ 3QODA 2V1DA 1QGPA 2Q1ZB 2ZXWH 5HDNA 1Y0UA 3D5SC 5HDGA 5IP9J 2XAHA 2CQXA 4H0EA 2XROA 4F55A 4PGHA 3GFIA 1TTYA 4XNFA 1ZAOA 1U5TA 3L1PA 2GXAA 5F6FA 1Q1HA 3OYHA 2DFHA 2MD0A 1XDSA 3AG4H 2DT5A 4FE4A 4XRSG 4HEA2 2FUG2 3LSPA 2RVCA 4EGYA 2HNHA 2ECCA 3V8JA 2ACJA 3RPQA 2BV6A 2R92J 2K3PA 4RM2A 2V9KA 2HEOA 2FMLA 4PFOA 4HOBA 4L5JA 1TL8A 2W84A 3BG3A 2QQAA 2ZB9A 3SZTA 3CC2I 3KP7A 1G59A 2O3FA 2VPRA 1J75A 1U2WA 1PYVA 2CWEA 1Z3YA 5K7HA 4I7HA 1TNTA 2CRGA 3HXLA 1IRFA 1KONA 2UXNA 4M3DA 1XX5A 2VXZA 5D8LB 1G3WA 4E7JA 1P4WA 2WTEA 3E5XA 2UWMA 5E3LA 4LK1F 5CJ9A 3VPRA 3ABLH 1A04A 2P7VB 4I02A 1I3AA 1TWHJ 3ASOH 2BY3A 4PK4A 1XSVA 3SJMA 3ZMSA 5FLXZ 1JXSA 5D5XB 2LKXA 4YRVA 4WK8F 3G1LA 3B02A 1OCRH 5ICFA 3SEQA 4BBSJ 2LREA 2PMZN 3BR2A 3WE2A 3DQVC 5HODA 1QU3A 2BW3A 2XV4S 3I9V2 1LDJA 4DOZA 2F5VA 2BHYA 3FISA 1I50J 3I53A 3U21A 1O3RA 4E7LA 1EF4A 2GQQA 2V6EA 2O8XA 4V19K 1FJLA 2J5PA 2P5LC 2L3DA 1S8NA 1VQ5I 1P92A 3NAUA 2F2EA 2QQ8A 3HPHA 3ZQCA 2NNYA 2B63J 1QVTA 1APLC 1IN6A 1QO0D 4KDPA 2DFFA 4IEJA 4XLPF 4RGSA 1NTCA 2K85A 2B0LA 3KP2A 2EILH 3IH2A 2XPWA 2WAFA 1BIAA 4BQAA 3JAMK 2HZTA 5H2FC 3ZMTA 5K5RA 2E7XA 2K27A 5FLVA 2QYOA 5L3EA 4V2FA 1OYYA 2H27A 2R5ZB 4Y52J 3VYRB 1MBHA 2AXLA 3LSHA 3QWLA 1MJBA 1KA8A 3GO5A 1D0XA 5E3NA 2CUJA 3H5AA 5EZHA 4TV7A 2ID3A 2FJ1A 1DQUA 4X1EA 2LFBA 2ZC2A 1Y8QB 2VPLA 1V5FA 2E19A 1F9NA 1A6IA 2M8EA 2A61A 2ZSHB 1YW7A 2A3SA 5JLXA 2V1NA 3N05A 3OYAA 1UHWA 2VE8A 4BQOA 2WV1A 2G9WA 1E17A 3MVPA 3K1PA 3KE2A 4Z6YA 2WV0A 4PGGA 4A5NA 4U0YA 2Y9YA 2PJRA 2HQ5A 1ZR4A 2ZMEB 3RIRA 1XSDA 5AIQA 3C3WA 1AHDP 2E2IJ 1ZRCA 4FASD 2W1OA 3R61A 2MW8A 2E36A 3S93A 3TGNA 4EJOA 1T2KA 2I8DA 4B43A 3RYPA 3JRIA 2DPDA 3BY6A 3GTOJ 3FM5A 3MZ8A 3WU0A
chains in the Genus database with same CATH topology
3I59B 2F5CA 3GF2A 6PAXA 1K79A 2EB7A 3G73A 3H3ZA 1G3TA 3WTZA 1I6XA 4Q4ZF 1T0FA 1S6LA 2FOKA 5DDGA 3FXUA 3CO7C 5DD8A 2JPCA 3ML6A 3F8FA 3LA2A 1KQ8A 2MD5A 2ZCWA 1GVJA 3VFZA 3VEPA 4B09A 3BJ6A 1SFEA 4KIGA 2NAZA 3TKYA 5ED4A 1BI0A 2LDUA 4KN4X 4MQ9F 1IN8A 5E8IA 1DPUA 4A2UA 5ICCA 3OV8A 2R3SA 2LNBA 2O61A 3Q9VA 3W6JB 1KU3A 5JI6A 2K02A 3MZYA 4WCGA 2XRNA 4JK1X 5L3CA 4G6QA 4N0BA 3E3VA 2STWA 4P9FA 3KCCA 4OIOF 3K69A 5LEKA 3FM3A 3CUQA 4LJZF 4BXUA 4XLNF 1R5GA 1BOAA 2R7DA 4EM1A 1J9IA 1U8RA 3WGGA 2DBBA 2ZXJA 4I98B 4YG2F 3KFWX 4FX4A 4LG0B 4HDVA 3F8BA 2LF8A 2Z5UA 2XUBA 4HF0A 2IP2A 2HWVA 4KT5C 3RJPA 3GFJA 4AD9A 4RAZA 1K7AA 4HQMA 5KVRA 3QAHA 2VONA 3HOSA 1XMKA 3LSTA 3SHFA 1I1GA 4L9NA 2FBHA 5FD6A 3DPLC 4ZYHA 5AIPA 5HVQC 4KICA 3WTYC 3T8RA 2AS5F 3U9GA 1S3JA 2PQ8A 2VBYA 1QZZA 1J59A 2IJLA 4CDGA 3DFGA 3O6BB 5L3FA 3IKTA 1XCVA 1FZPB 2OU2A 1ON2A 2XHKA 3M1EA 1X3UA 2OA4A 1KU7A 4UHTA 3LFKA 1I27A 3D5LA 2HYFA 1H9GA 2CW0F 5HS8A 4ENMA 3R60A 3I4PA 4K2EA 2W57A 2PFBA 2ISZA 1KQ0A 4LLLA 1TLHB 4ZYEA 3GZ6A 1IN7A 4PDKA 1OYIA 3TO6A 4R79A 1MKMA 1MDMB 2JSCA 4JBAA 3T8TA 5FLXK 5K5OA 4IVNA 3ULQB 4A5MA 2M45A 3FMSA 1BN5A 2W85A 1YW9A 3F21A 5FB2A 3I64A 3DPTA 2FE3A 5K1YA 2HQNA 2ZBKA 1HKTA 3BDDA 1FP1D 1UCRA 2QUFA 3N4MA 4O6JA 2VOOA 1W4MA 2LF7A 1FNNA 5LBQA 1HXDA 2L54A 3LA3A 3HHHA 3RKXA 2VT2A 1FYLA 3PFIA 4IRIA 2FMYA 3ZMZA 1B4AA 4KMFA 1D8JA 3L00A 1GXQA 3GLXA 4N9IA 2PJPA 3VB2A 3R4KA 1ZRDA 3MEXA 1YW8A 2K7LA 3DEUA 3LWFA 4BHBA 1WSUA 1Z7UA 5DD4A 2RKHA 1J2XA 3FHZA 4BNCA 1ZG3A 1ZYRF 1IXSB 3HRMA 2Y48A 2QLZA 3I5UA 3E6DA 3J81Z 1FC3A 4OU0A 2M1BA 2Q0OA 1CF7A 2LSOA 2C6YA 1ZHFA 4MQVA 5LHHA 5HLGA 1FYKA 4DNCA 1IAWA 3HSFA 4N9HA 5FO5A 2V1UA 3COAC 1SD5A 2H94A 1BC7C 4I2OA 1TQIA 4S04A 1UHMA 3ZP5A 1SD7A 1WWXA 4XSZF 1XGSA 3RYRA 4S05A 4IF4A 2ZNZA 2EA4A 3QPTA 1IXCA 5TRDA 2F5FA 1LB2A 4OIRF 1FT9A 2XAQA 1HKSA 2PMUA 3FZVA 1BJAA 2DAOA 3IRQA 1I1SA 1IXRC 1DDNA 3P7NA 4IXAA 1GXPA 4XBFA 4Y17A 2M5WA 4KN7X 4LD5A 1YLFA 4WXDA 4HF2A 4WWCA 2XASA 1FBQA 1SFUA 2OBPA 3CUOA 3L2CA 3G3ZA 4M73A 4EM2A 1Z6RA 2BYVE 3M9AA 3CUQB 1REPC 2HGCA 5D4RA 4A6EA 4YFKF 4AVPA 1K78A 1LNWA 4IRGA 1HSTA 2D2WA 1IZ1A 2JT1A 2Z33A 2IPQX 4GGGA 3VOEA 1R00A 3H92A 3O3KA 4UXNA 4LMYA 2KJCA 2Y75A 1FYMA 3Q9SA 2RGVA 1SD6A 1XGOA 4ZYGA 3QOPA 1D5VA 1BI3A 2VE9A 2PG4A 4CGZA 1ODDA 3J7AO 4ESBA 5IT3A 4ESFA 5CLSA 1P4AA 1RUNA 2PI0A 1TBXA 2STTA 2HTJA 2XAFA 5E20A 3QRFF 3ECHA 1XGMA 1LVAA 2CO5A 5ERIA 5D4SA 3FXQA 3ZMUA 1W7PA 4FHTA 2DQLA 3BJOA 2O6GE 4L18B 2QVOA 1P4XA 3JTHA 2ZKZA 2PMHA 3ZQ7A 3V8KA 1KYZA 2Q2EA 3QPHA 3GYHX 1YTYA 3O2PE 4GYIA 2D45A 4AIJA 3Q5FA 2DO7A 4O5VA 4Q5SF 1ULYA 4DQ2A 2PN6A 3WTTC 3HRTA 1TNSA 1FPQA 4KUMA 1Z9CA 2FU4A 4UVAA 5AONA 2FQ3A 4L9TA 4LFUA 1IN4A 1LQ1A 2EV5A 5D6FA 4UV8A 1U6GA 4UVCA 5FFZA 1T98A 2EFOA 2RN7A 2JRTA 5E18F 3F6OA 4FT8A 1MZBA 1XSXA 3NEUA 1GHCA 1QZYA 1EH8A 4U7DA 5ILUA 1O3TA 2EWNA 4ASNA 3TOAA 1L0OC 2NNNA 3ELKA 4U0WA 2YX4A 1R58A 1T38A 2X0LA 2KIUA 2XAJA 4GO1A 2QZ8A 3F8MA 4ENKA 1RZ4A 2R7FA 5BS6A 3REOA 1ZN2A 2ZO4A 5E1XA 1TQPA 1D8KA 3RKWA 5CVJA 3GX4X 1XN7A 1R1VA 2DK5A 4L9JA 2G7UA 3I54A 2RNJA 4EM0B 5J8FA 5JVTA 3MFKA 3L9FA 3I0TA 4UNOA 1FY7A 5F1RA 3S2WA 1CF7B 2DK8A 1R1UA 5E1ZB 4HX4A 1S29A 4M9ZA 4A0ZA 1FOKA 1WKMA 1FLIA 4HX7A 3J81K 3CJNA 1SMTA 1OMIA 1FSHA 2COMA 1CGPA 3AAFA 4RB1A 2VBZA 1O7FA 4CICA 1R5HA 2P6TA 1HW1A 2JPBA 2WC2A 3CTAA 3DXJF 3J80Z 1B6AA 1K6OA 2FSWA 2V6CA 4M72A 1LDDA 2QBYA 2FBIA 2ETHA 1B1BA 1H9TA 2CYYA 5HDKA 3ERED 1U5TC 2EJRA 3V7SA 2XVCA 4GYGA 1AWCA 2EFPA 2IRFG 3PQJA 4U88A 2KKOA 5DYMA 2QM3A 3MCZA 1R7JA 1QQIA 5ICGA 3L09A 2CSOA 2FNAA 2A68F 2P5VA 2DPUA 1YS6A 3GFLA 1G4DA 4L0YB 1MGTA 1YYVA 1PDNC 2L4MA 2ESHA 4IPAA 3WODF 2GA2A 5HOOA 2DQRA 2A6HF 4HX8A 2FNPA 1K78B 2D1VA 3WG9A 2V1XA 1U5TB 1DUXC 1LJ9A 2VOPA 1P2FA 3QU3A 5CVRA 4ZZDA 4I0BA 3E6MA 2IW5A 2P6SA 2GXGA 5K5QA 1T39A 2W25A 4ZYDA 1XD7A 3IHUA 2VT3A 4A12A 4OINF 4YIIA 3JTGA 3ZMDA 3GEZA 1IRGA 4M6YA 3HTSB 4AIKA 2MC3A 3TDUC 2UZKA 3D0SA 2IT0A 1SAXA 1YIOA 2H6CA 4M74A 4EMSA 4HF1A 4AIHA 2BE5F 2VODA 2RC4A 2FA5A 2FF4A 1BM9A 5L3BA 2OQGA 2YU3A 1W7PB 3HSEA 3U2RA 4QLCU 4GCVA 1ZG5A 1F1ZA 3WTVC 5KK1A 2EFNA 4OMYA 2FBKA 5ILVA 4RB3C 2QQBA 2A6EF 3GUDA 4WX9A 1SD4A 3WGIA 1R1TA 4ENJA 4G9YA 4RAYA 4A0XA 1BI1A 4MNUA 4HYEA 3GVAA 3ZN0A 4ESJA 3K1NA 3KEOA 4G6DA 1SFXA 2XIGA 3GZ5A 2OQRA 5LRSA 3MZHA 3KP6A 3F72A 4ETSA 3K2ZA 5LEJA 3WU1B 2DW4A 4P9UA 5CVVA 3DF8A 2GWRA 2EFQA 3VODA 4M9SA 5DV5A 4EJVA 2O03A 2HQRA 2YR2A 2HKXA 1F5TA 5D5WB 2P7CB 3KLOA 2A69F 2BGCA 3RDIA 3I71A 4HV5A 4LLGF 2DI3A 4RB2C 3EDPA 4KMUX 1IW7F 5J8CA 2XGXA 5FGMA 4WF2A 3LAJA 1G3YA 2HYGD 3M8EA 5H6QA 2D1HA 3HYIA 2GA1A 4EQQA 2LKPA 3BOQA 4RGUA 3ZMVA 3TDZC 4CZZA 4Q48A 5ILSA 4L9VA 4G7ZF 4OMZA 3PQKA 2NRAC 4ENNA 1KYWA 2FRHA 3CUQC 1HSJA 2KIMA 5HS9A 3DV8A 1YQAA 2Z99A 4HV6A 4M6XA 3NRVA 1YO5C 4BHPA 3ZPLA 5D6EA 4BAYA 3EYIA 1C0WA 3KETA 1PUEE 3BROA 3SQNA 3N97A 1NHAA 2JZYA 4M71A 3LA7A 3WTWC 4HQEA 3E5QA 3QP6A 1ZLKA 1IN5A 1O7LA 4LB5A 2P5KA 1PP7U 1U78A 3P9CA 2A5YB 1QNTA 4LG0A 5IT9Z 2KIFA 1JHHA 5JHUA 4I0AA 3J80K 2L01A 1J7KA 4PCQA 3JSOA 4UUVA 2F5EA 1B9NA 5DUIA 3SFZA 5HLHA 4CYDA 2QWWA 4HZFA 3P9KA 1OR7A 3R6SA 1EH6A 1FP2A 1ZGJA 3K0LA 2EA2A 3ROUA 3TOBA 2TDXA 1JHFA 3IC7A 4U0VA 1FBUA 4HLYA 1TW3A 3V7CA 1WRJA 4D0PA 3KP4A 1G3SA 1P6RA 1IUYA 3QP5A 5EEHA 2QQ9A 4NQWA 2M30A 2RQPA 2YX7A 5EEGA 3FX3A 3EYYA 3WTXC 4ZH4F 5F64A 3RI4A 4B8XA 3GXOA 4MEYF 3GFMA 1Z91A 2VBWA 4KIBA 3RKYA 1MD0A 4GXOA 4YFNF 2DU9A 4P55A 1OYWA 1S7OA 4EJWA 2GXBA 1J0RA 4XRFA 4A0YA 1AOYA 3HIFA 1W5SA 3F23A 4L0ZB 5D8KB 4E70A 3SZPA 4G94A 2H6BA 3TQNA 1MDMA 2KJBA 3NQOA 1WI9A 1Z6TA 1T6SA 4ON0A 4KNYA 1HKQA 3FF5A 3KLNA 5LGTA 2IA1A 1FX7A 2V79A 5DCFA 2HS5A 3P9IA 4EJTA 3KP5A 1W5TA 5L3GA 1E2XA 4F7ZA 3WTSC 2K86A 4L5IA 2NS0A 4HW0A 1YFHA 3F22A 1ON1A 1ZARA 2M87A 2O0YA 2MA3A 2E1CA 1RI7A 1XCBA 4HAMA 3I58A 4MEXF 1Z1DA 2A07F 2HOEA 2RV8A 4CXFA 2BBYA 2QENA 5J6XA 5DEQA 2Z3YA 3T5XA 4WXHA 5LGUA 1O57A 5ICEA 3L7WA 4JQFA 4QWQA 2ESNA 1XGNA 3FXRA 4UVBA 4IRHA 3C7JA 1RUOA 2E1NA 2PEXA 2GAUA 1ZRFA 2P8TA 3BZ6A 4OOIA 1STZA 1O3SA 5A2QZ 3U1DA 2F5DA 3FWEA 3TO9A 4KFCA 4G8XA 1V3FA 3IRRA 2PBIA 4G7OF 3KP3A 1G6NA 5FFXA 4EV0A 1HBXG 1BBYA 2NYXA 4RB0A 3C1DA 1WQ2A 3OOPA 5JFRA 3K9TA 1KU9A 2VC0A 1OKRA 2ZFWA 4Y15A 2EFWA 5LHGA 3HTUA 3DKWA 2H09A 2DLLA 4Z2YA 4IJAA 2G7HA 2OZUA 3ZN1A 2YSRA 3CO6C 2FXAA 4UV9A 3RTRA 5LLQA 1UFMA 3HSRA 5DCMA 4A6DA 3M8FA 2Q8KA 2EV6A 5D5UB 4I09A 1XMAA 2MLKA 3B73A 4LB6B 3MQ0A 2X4HA 1R36A 4KYWA 1TQMA 1MJAA 1SMYF 1D3YA 3EQLF 3V7RA 4IHTA 1HW2A 3EUHA 2DFIA 5HLIA 2HR3A 3HUGA 1F4KA 1H0MA 4HBLA 4HDUA 3F6VA 1RIOH 4BH9A 3CLOA 1QBJA 4FX0A 1S7AA 3LAPA 2KRFA 4Q47A 4EGZA 5E1WA 3DP7A 1ZH5A 5BPIA 3GW2A 2VBXA 3ECOA 5IT9K 1ONVA 4MTEA 3E5UA 5TJJA 3BPXA 1R22A 1ZG1A 5CYVA 1L3LA 2K4BA 1W7PD 4WXCA 1USSA 2PLYA 1XB4A 3FMRA 3FMQA 3WGHA 3KZZA 1YS7A 2OZ6A 4G7HF 1EV7A 1DP7P 1I5ZA 4NB5A 3F3XA 4CHUA 1BIBA 1HQCA 2ZNYA 2MH2A 4R1HA 4I01A 2MLGA 4KIFA 5BQTA 3SXYA 1JGSA 1OPCA 4YIFA 4MHGA 5BPDA 2XKPA 3IKVA 3HRUA 1IF1A 2ADUA 3IWFA 2IVMA 2OAZA 3HHGA 4PZJA 2VN2A 5D5VB 4R8HA 5E17F 3RPUA 4YFXF 1PP8F 3LQQA 5L3DA 1ZLJA 1FWZA 2CG4A 3JAMZ 4OIQF 2P4WA 1Z05A 5H6RA 1BC8C 4CO8A 1DPRA 1QPMA 1HW5A 5E8GA 4HLXA 3MAJA 3CDHA 3EETA 3W6KB 2ZJ2A 1TW2A 4RGXA 5LHIA 1FBSA 5CVUA 4P5OA 3QU6A 1LEBA 3KZYA 1MJ9A 4BHCA 2W24A 3T1BA 3WTUC 3BP8A 4HA8A 5H20A 4LLNA 1JE8A 2GIVA 3GWZA 4NHJA 1UB9A 3IL2A 2VC1A 2GZWA 3MWMA 3BJAA 1BI2A 3E97A 2E7WA 1LEAA 3HRSA 3R0AA 2HTSA 5LRRA 2ZMEA 2V9VA 2UXXA 2FEZA 1U3EM 3IWZA 2IA0A 3F8CA 4OIPF 2IA2A 5JR3A 4IHSA 1FSEA 2CQKA 4MTDA 3ABUA 2MH9A 1LDKB 2XAGA 3I59A 5BOXA 4O3MA 3E6CC 2CFXA 2XKOA 1R23A 3KEQA 4KA4A 4XSXF 1YG2A 1ZREA 1ZGAA 4AWXB 2BEOA 3H3UA 3F8NA 5CVIA 2OD5A 2YPRA 3LQRA 2K4JA 3T0YA 2Y0MA 3JSPA 3ABTA 1EH7A 2JTVA 2ISYA 5BMZA 5DUKA 2HDCA 3K1MA 2HFHA 4LGWA 5A2QK 2EK5A 2J5OA 3V4GA 1VTNC 1KGSA 2MBFA 2CGPA 1O3QA 3C18A 2EV0A 3R0JA 3ISPA 1RNLA 2RDPA 1USTA 4EJUA 2DTRA 3E6BA 5HS7A 4ZZLA 1XDUA 4EVIA 3BWGA 3WE3A 3M7GA 4Y13A 2ELHA 5DCMB 2QBYB 4M9XA 3TO7A 1KQ9A 4P96A 1J5YA 1B59A 4BYYA 2L02A 2HKOA 3BPVA 3JW4A 2L4AA 4LK0F 4U7BA 5LGNA 1B9MA 2WWYA 4MGRA 1V4RA 4RGRA 2Z9OA 3V8LA 1KU2A 4RS8A 3HOTA 5FD5A 2V1DA 1QGPA 5HDNA 1Y0UA 5HDGA 2XAHA 4H0EA 2XROA 4PGHA 3GFIA 1TTYA 1ZAOA 1U5TA 5F6FA 1Q1HA 1XDSA 2DT5A 2RVCA 4EGYA 3V8JA 2ACJA 3RPQA 2BV6A 2HEOA 2FMLA 4HOBA 4L5JA 2W84A 2QQAA 3SZTA 3KP7A 2O3FA 1J75A 1U2WA 2CWEA 4I7HA 1TNTA 1IRFA 2UXNA 2VXZA 5D8LB 1G3WA 1P4WA 2WTEA 3E5XA 2UWMA 4LK1F 5CJ9A 1A04A 2P7VB 4I02A 1XSVA 3ZMSA 5FLXZ 1JXSA 5D5XB 4WK8F 3B02A 5ICFA 3WE2A 3DQVC 2XV4S 1LDJA 3I53A 1O3RA 2GQQA 2O8XA 2J5PA 2P5LC 2L3DA 1S8NA 1P92A 2F2EA 2NNYA 1IN6A 1QO0D 4KDPA 4XLPF 4RGSA 2B0LA 3KP2A 1BIAA 4BQAA 3JAMK 2HZTA 3ZMTA 5K5RA 2E7XA 2K27A 2QYOA 5L3EA 1OYYA 2H27A 2AXLA 1MJBA 1KA8A 3GO5A 4TV7A 1F9NA 2M8EA 2A61A 1YW7A 2A3SA 1UHWA 2VE8A 2G9WA 1E17A 3K1PA 3KE2A 2WV0A 4PGGA 4A5NA 4U0YA 2ZMEB 3RIRA 1XSDA 5AIQA 3C3WA 1ZRCA 3R61A 3TGNA 4EJOA 1T2KA 3RYPA 2DPDA 3BY6A 3FM5A 3WU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I59 B;  2F5C A;  3GF2 A;  6PAX A;  1K79 A;  2EB7 A;  3G73 A;  3H3Z A;  1G3T A;  3WTZ A;  1I6X A;  4Q4Z F;  1T0F A;  1S6L A;  2FOK A;  5DDG A;  3FXU A;  3CO7 C;  5DD8 A;  2JPC A;  3ML6 A;  3F8F A;  3LA2 A;  1KQ8 A;  2MD5 A;  2ZCW A;  1GVJ A;  3VFZ A;  3VEP A;  4B09 A;  3BJ6 A;  1SFE A;  4KIG A;  2NAZ A;  3TKY A;  5ED4 A;  1BI0 A;  2LDU A;  4KN4 X;  4MQ9 F;  1IN8 A;  5E8I A;  1DPU A;  4A2U A;  5ICC A;  3OV8 A;  2R3S A;  2LNB A;  2O61 A;  3Q9V A;  3W6J B;  1KU3 A;  5JI6 A;  2K02 A;  3MZY A;  4WCG A;  2XRN A;  4JK1 X;  5L3C A;  4G6Q A;  4N0B A;  3E3V A;  2STW A;  4P9F A;  3KCC A;  4OIO F;  3K69 A;  5LEK A;  3FM3 A;  3CUQ A;  4LJZ F;  4BXU A;  4XLN F;  1R5G A;  1BOA A;  2R7D A;  4EM1 A;  1J9I A;  1U8R A;  3WGG A;  2DBB A;  2ZXJ A;  4I98 B;  4YG2 F;  3KFW X;  4FX4 A;  4LG0 B;  4HDV A;  3F8B A;  2LF8 A;  2Z5U A;  2XUB A;  4HF0 A;  2IP2 A;  2HWV A;  4KT5 C;  3RJP A;  3GFJ A;  4AD9 A;  4RAZ A;  1K7A A;  4HQM A;  5KVR A;  3QAH A;  2VON A;  3HOS A;  1XMK A;  3LST A;  3SHF A;  1I1G A;  4L9N A;  2FBH A;  5FD6 A;  3DPL C;  4ZYH A;  5AIP A;  5HVQ C;  4KIC A;  3WTY C;  3T8R A;  2AS5 F;  3U9G A;  1S3J A;  2PQ8 A;  2VBY A;  1QZZ A;  1J59 A;  2IJL A;  4CDG A;  3DFG A;  3O6B B;  5L3F A;  3IKT A;  1XCV A;  1FZP B;  2OU2 A;  1ON2 A;  2XHK A;  3M1E A;  1X3U A;  2OA4 A;  1KU7 A;  4UHT A;  3LFK A;  1I27 A;  3D5L A;  2HYF A;  1H9G A;  2CW0 F;  5HS8 A;  4ENM A;  3R60 A;  3I4P A;  4K2E A;  2W57 A;  2PFB A;  2ISZ A;  1KQ0 A;  4LLL A;  1TLH B;  4ZYE A;  3GZ6 A;  1IN7 A;  4PDK A;  1OYI A;  3TO6 A;  4R79 A;  1MKM A;  1MDM B;  2JSC A;  4JBA A;  3T8T A;  5FLX K;  5K5O A;  4IVN A;  3ULQ B;  4A5M A;  2M45 A;  3FMS A;  1BN5 A;  2W85 A;  1YW9 A;  3F21 A;  5FB2 A;  3I64 A;  3DPT A;  2FE3 A;  5K1Y A;  2HQN A;  2ZBK A;  1HKT A;  3BDD A;  1FP1 D;  1UCR A;  2QUF A;  3N4M A;  4O6J A;  2VOO A;  1W4M A;  2LF7 A;  1FNN A;  5LBQ A;  1HXD A;  2L54 A;  3LA3 A;  3HHH A;  3RKX A;  2VT2 A;  1FYL A;  3PFI A;  4IRI A;  2FMY A;  3ZMZ A;  1B4A A;  4KMF A;  1D8J A;  3L00 A;  1GXQ A;  3GLX A;  4N9I A;  2PJP A;  3VB2 A;  3R4K A;  1ZRD A;  3MEX A;  1YW8 A;  2K7L A;  3DEU A;  3LWF A;  4BHB A;  1WSU A;  1Z7U A;  5DD4 A;  2RKH A;  1J2X A;  3FHZ A;  4BNC A;  1ZG3 A;  1ZYR F;  1IXS B;  3HRM A;  2Y48 A;  2QLZ A;  3I5U A;  3E6D A;  3J81 Z;  1FC3 A;  4OU0 A;  2M1B A;  2Q0O A;  1CF7 A;  2LSO A;  2C6Y A;  1ZHF A;  4MQV A;  5LHH A;  5HLG A;  1FYK A;  4DNC A;  1IAW A;  3HSF A;  4N9H A;  5FO5 A;  2V1U A;  3COA C;  1SD5 A;  2H94 A;  1BC7 C;  4I2O A;  1TQI A;  4S04 A;  1UHM A;  3ZP5 A;  1SD7 A;  1WWX A;  4XSZ F;  1XGS A;  3RYR A;  4S05 A;  4IF4 A;  2ZNZ A;  2EA4 A;  3QPT A;  1IXC A;  5TRD A;  2F5F A;  1LB2 A;  4OIR F;  1FT9 A;  2XAQ A;  1HKS A;  2PMU A;  3FZV A;  1BJA A;  2DAO A;  3IRQ A;  1I1S A;  1IXR C;  1DDN A;  3P7N A;  4IXA A;  1GXP A;  4XBF A;  4Y17 A;  2M5W A;  4KN7 X;  4LD5 A;  1YLF A;  4WXD A;  4HF2 A;  4WWC A;  2XAS A;  1FBQ A;  1SFU A;  2OBP A;  3CUO A;  3L2C A;  3G3Z A;  4M73 A;  4EM2 A;  1Z6R A;  2BYV E;  3M9A A;  3CUQ B;  1REP C;  2HGC A;  5D4R A;  4A6E A;  4YFK F;  4AVP A;  1K78 A;  1LNW A;  4IRG A;  1HST A;  2D2W A;  1IZ1 A;  2JT1 A;  2Z33 A;  2IPQ X;  4GGG A;  3VOE A;  1R00 A;  3H92 A;  3O3K A;  4UXN A;  4LMY A;  2KJC A;  2Y75 A;  1FYM A;  3Q9S A;  2RGV A;  1SD6 A;  1XGO A;  4ZYG A;  3QOP A;  1D5V A;  1BI3 A;  2VE9 A;  2PG4 A;  4CGZ A;  1ODD A;  3J7A O;  4ESB A;  5IT3 A;  4ESF A;  5CLS A;  1P4A A;  1RUN A;  2PI0 A;  1TBX A;  2STT A;  2HTJ A;  2XAF A;  5E20 A;  3QRF F;  3ECH A;  1XGM A;  1LVA A;  2CO5 A;  5ERI A;  5D4S A;  3FXQ A;  3ZMU A;  1W7P A;  4FHT A;  2DQL A;  3BJO A;  2O6G E;  4L18 B;  2QVO A;  1P4X A;  3JTH A;  2ZKZ A;  2PMH A;  3ZQ7 A;  3V8K A;  1KYZ A;  2Q2E A;  3QPH A;  3GYH X;  1YTY A;  3O2P E;  4GYI A;  2D45 A;  4AIJ A;  3Q5F A;  2DO7 A;  4O5V A;  4Q5S F;  1ULY A;  4DQ2 A;  2PN6 A;  3WTT C;  3HRT A;  1TNS A;  1FPQ A;  4KUM A;  1Z9C A;  2FU4 A;  4UVA A;  5AON A;  2FQ3 A;  4L9T A;  4LFU A;  1IN4 A;  1LQ1 A;  2EV5 A;  5D6F A;  4UV8 A;  1U6G A;  4UVC A;  5FFZ A;  1T98 A;  2EFO A;  2RN7 A;  2JRT A;  5E18 F;  3F6O A;  4FT8 A;  1MZB A;  1XSX A;  3NEU A;  1GHC A;  1QZY A;  1EH8 A;  4U7D A;  5ILU A;  1O3T A;  2EWN A;  4ASN A;  3TOA A;  1L0O C;  2NNN A;  3ELK A;  4U0W A;  2YX4 A;  1R58 A;  1T38 A;  2X0L A;  2KIU A;  2XAJ A;  4GO1 A;  2QZ8 A;  3F8M A;  4ENK A;  1RZ4 A;  2R7F A;  5BS6 A;  3REO A;  1ZN2 A;  2ZO4 A;  5E1X A;  1TQP A;  1D8K A;  3RKW A;  5CVJ A;  3GX4 X;  1XN7 A;  1R1V A;  2DK5 A;  4L9J A;  2G7U A;  3I54 A;  2RNJ A;  4EM0 B;  5J8F A;  5JVT A;  3MFK A;  3L9F A;  3I0T A;  4UNO A;  1FY7 A;  5F1R A;  3S2W A;  1CF7 B;  2DK8 A;  1R1U A;  5E1Z B;  4HX4 A;  1S29 A;  4M9Z A;  4A0Z A;  1FOK A;  1WKM A;  1FLI A;  4HX7 A;  3J81 K;  3CJN A;  1SMT A;  1OMI A;  1FSH A;  2COM A;  1CGP A;  3AAF A;  4RB1 A;  2VBZ A;  1O7F A;  4CIC A;  1R5H A;  2P6T A;  1HW1 A;  2JPB A;  2WC2 A;  3CTA A;  3DXJ F;  3J80 Z;  1B6A A;  1K6O A;  2FSW A;  2V6C A;  4M72 A;  1LDD A;  2QBY A;  2FBI A;  2ETH A;  1B1B A;  1H9T A;  2CYY A;  5HDK A;  3ERE D;  1U5T C;  2EJR A;  3V7S A;  2XVC A;  4GYG A;  1AWC A;  2EFP A;  2IRF G;  3PQJ A;  4U88 A;  2KKO A;  5DYM A;  2QM3 A;  3MCZ A;  1R7J A;  1QQI A;  5ICG A;  3L09 A;  2CSO A;  2FNA A;  2A68 F;  2P5V A;  2DPU A;  1YS6 A;  3GFL A;  1G4D A;  4L0Y B;  1MGT A;  1YYV A;  1PDN C;  2L4M A;  2ESH A;  4IPA A;  3WOD F;  2GA2 A;  5HOO A;  2DQR A;  2A6H F;  4HX8 A;  2FNP A;  1K78 B;  2D1V A;  3WG9 A;  2V1X A;  1U5T B;  1DUX C;  1LJ9 A;  2VOP A;  1P2F A;  3QU3 A;  5CVR A;  4ZZD A;  4I0B A;  3E6M A;  2IW5 A;  2P6S A;  2GXG A;  5K5Q A;  1T39 A;  2W25 A;  4ZYD A;  1XD7 A;  3IHU A;  2VT3 A;  4A12 A;  4OIN F;  4YII A;  3JTG A;  3ZMD A;  3GEZ A;  1IRG A;  4M6Y A;  3HTS B;  4AIK A;  2MC3 A;  3TDU C;  2UZK A;  3D0S A;  2IT0 A;  1SAX A;  1YIO A;  2H6C A;  4M74 A;  4EMS A;  4HF1 A;  4AIH A;  2BE5 F;  2VOD A;  2RC4 A;  2FA5 A;  2FF4 A;  1BM9 A;  5L3B A;  2OQG A;  2YU3 A;  1W7P B;  3HSE A;  3U2R A;  4QLC U;  4GCV A;  1ZG5 A;  1F1Z A;  3WTV C;  5KK1 A;  2EFN A;  4OMY A;  2FBK A;  5ILV A;  4RB3 C;  2QQB A;  2A6E F;  3GUD A;  4WX9 A;  1SD4 A;  3WGI A;  1R1T A;  4ENJ A;  4G9Y A;  4RAY A;  4A0X A;  1BI1 A;  4MNU A;  4HYE A;  3GVA A;  3ZN0 A;  4ESJ A;  3K1N A;  3KEO A;  4G6D A;  1SFX A;  2XIG A;  3GZ5 A;  2OQR A;  5LRS A;  3MZH A;  3KP6 A;  3F72 A;  4ETS A;  3K2Z A;  5LEJ A;  3WU1 B;  2DW4 A;  4P9U A;  5CVV A;  3DF8 A;  2GWR A;  2EFQ A;  3VOD A;  4M9S A;  5DV5 A;  4EJV A;  2O03 A;  2HQR A;  2YR2 A;  2HKX A;  1F5T A;  5D5W B;  2P7C B;  3KLO A;  2A69 F;  2BGC A;  3RDI A;  3I71 A;  4HV5 A;  4LLG F;  2DI3 A;  4RB2 C;  3EDP A;  4KMU X;  1IW7 F;  5J8C A;  2XGX A;  5FGM A;  4WF2 A;  3LAJ A;  1G3Y A;  2HYG D;  3M8E A;  5H6Q A;  2D1H A;  3HYI A;  2GA1 A;  4EQQ A;  2LKP A;  3BOQ A;  4RGU A;  3ZMV A;  3TDZ C;  4CZZ A;  4Q48 A;  5ILS A;  4L9V A;  4G7Z F;  4OMZ A;  3PQK A;  2NRA C;  4ENN A;  1KYW A;  2FRH A;  3CUQ C;  1HSJ A;  2KIM A;  5HS9 A;  3DV8 A;  1YQA A;  2Z99 A;  4HV6 A;  4M6X A;  3NRV A;  1YO5 C;  4BHP A;  3ZPL A;  5D6E A;  4BAY A;  3EYI A;  1C0W A;  3KET A;  1PUE E;  3BRO A;  3SQN A;  3N97 A;  1NHA A;  2JZY A;  4M71 A;  3LA7 A;  3WTW C;  4HQE A;  3E5Q A;  3QP6 A;  1ZLK A;  1IN5 A;  1O7L A;  4LB5 A;  2P5K A;  1PP7 U;  1U78 A;  3P9C A;  2A5Y B;  1QNT A;  4LG0 A;  5IT9 Z;  2KIF A;  1JHH A;  5JHU A;  4I0A A;  3J80 K;  2L01 A;  1J7K A;  4PCQ A;  3JSO A;  4UUV A;  2F5E A;  1B9N A;  5DUI A;  3SFZ A;  5HLH A;  4CYD A;  2QWW A;  4HZF A;  3P9K A;  1OR7 A;  3R6S A;  1EH6 A;  1FP2 A;  1ZGJ A;  3K0L A;  2EA2 A;  3ROU A;  3TOB A;  2TDX A;  1JHF A;  3IC7 A;  4U0V A;  1FBU A;  4HLY A;  1TW3 A;  3V7C A;  1WRJ A;  4D0P A;  3KP4 A;  1G3S A;  1P6R A;  1IUY A;  3QP5 A;  5EEH A;  2QQ9 A;  4NQW A;  2M30 A;  2RQP A;  2YX7 A;  5EEG A;  3FX3 A;  3EYY A;  3WTX C;  4ZH4 F;  5F64 A;  3RI4 A;  4B8X A;  3GXO A;  4MEY F;  3GFM A;  1Z91 A;  2VBW A;  4KIB A;  3RKY A;  1MD0 A;  4GXO A;  4YFN F;  2DU9 A;  4P55 A;  1OYW A;  1S7O A;  4EJW A;  2GXB A;  1J0R A;  4XRF A;  4A0Y A;  1AOY A;  3HIF A;  1W5S A;  3F23 A;  4L0Z B;  5D8K B;  4E70 A;  3SZP A;  4G94 A;  2H6B A;  3TQN A;  1MDM A;  2KJB A;  3NQO A;  1WI9 A;  1Z6T A;  1T6S A;  4ON0 A;  4KNY A;  1HKQ A;  3FF5 A;  3KLN A;  5LGT A;  2IA1 A;  1FX7 A;  2V79 A;  5DCF A;  2HS5 A;  3P9I A;  4EJT A;  3KP5 A;  1W5T A;  5L3G A;  1E2X A;  4F7Z A;  3WTS C;  2K86 A;  4L5I A;  2NS0 A;  4HW0 A;  1YFH A;  3F22 A;  1ON1 A;  1ZAR A;  2M87 A;  2O0Y A;  2MA3 A;  2E1C A;  1RI7 A;  1XCB A;  4HAM A;  3I58 A;  4MEX F;  1Z1D A;  2A07 F;  2HOE A;  2RV8 A;  4CXF A;  2BBY A;  2QEN A;  5J6X A;  5DEQ A;  2Z3Y A;  3T5X A;  4WXH A;  5LGU A;  1O57 A;  5ICE A;  3L7W A;  4JQF A;  4QWQ A;  2ESN A;  1XGN A;  3FXR A;  4UVB A;  4IRH A;  3C7J A;  1RUO A;  2E1N A;  2PEX A;  2GAU A;  1ZRF A;  2P8T A;  3BZ6 A;  4OOI A;  1STZ A;  1O3S A;  5A2Q Z;  3U1D A;  2F5D A;  3FWE A;  3TO9 A;  4KFC A;  4G8X A;  1V3F A;  3IRR A;  2PBI A;  4G7O F;  3KP3 A;  1G6N A;  5FFX A;  4EV0 A;  1HBX G;  1BBY A;  2NYX A;  4RB0 A;  3C1D A;  1WQ2 A;  3OOP A;  5JFR A;  3K9T A;  1KU9 A;  2VC0 A;  1OKR A;  2ZFW A;  4Y15 A;  2EFW A;  5LHG A;  3HTU A;  3DKW A;  2H09 A;  2DLL A;  4Z2Y A;  4IJA A;  2G7H A;  2OZU A;  3ZN1 A;  2YSR A;  3CO6 C;  2FXA A;  4UV9 A;  3RTR A;  5LLQ A;  1UFM A;  3HSR A;  5DCM A;  4A6D A;  3M8F A;  2Q8K A;  2EV6 A;  5D5U B;  4I09 A;  1XMA A;  2MLK A;  3B73 A;  4LB6 B;  3MQ0 A;  2X4H A;  1R36 A;  4KYW A;  1TQM A;  1MJA A;  1SMY F;  1D3Y A;  3EQL F;  3V7R A;  4IHT A;  1HW2 A;  3EUH A;  2DFI A;  5HLI A;  2HR3 A;  3HUG A;  1F4K A;  1H0M A;  4HBL A;  4HDU A;  3F6V A;  1RIO H;  4BH9 A;  3CLO A;  1QBJ A;  4FX0 A;  1S7A A;  3LAP A;  2KRF A;  4Q47 A;  4EGZ A;  5E1W A;  3DP7 A;  1ZH5 A;  5BPI A;  3GW2 A;  2VBX A;  3ECO A;  5IT9 K;  1ONV A;  4MTE A;  3E5U A;  5TJJ A;  3BPX A;  1R22 A;  1ZG1 A;  5CYV A;  1L3L A;  2K4B A;  1W7P D;  4WXC A;  1USS A;  2PLY A;  1XB4 A;  3FMR A;  3FMQ A;  3WGH A;  3KZZ A;  1YS7 A;  2OZ6 A;  4G7H F;  1EV7 A;  1DP7 P;  1I5Z A;  4NB5 A;  3F3X A;  4CHU A;  1BIB A;  1HQC A;  2ZNY A;  2MH2 A;  4R1H A;  4I01 A;  2MLG A;  4KIF A;  5BQT A;  3SXY A;  1JGS A;  1OPC A;  4YIF A;  4MHG A;  5BPD A;  2XKP A;  3IKV A;  3HRU A;  1IF1 A;  2ADU A;  3IWF A;  2IVM A;  2OAZ A;  3HHG A;  4PZJ A;  2VN2 A;  5D5V B;  4R8H A;  5E17 F;  3RPU A;  4YFX F;  1PP8 F;  3LQQ A;  5L3D A;  1ZLJ A;  1FWZ A;  2CG4 A;  3JAM Z;  4OIQ F;  2P4W A;  1Z05 A;  5H6R A;  1BC8 C;  4CO8 A;  1DPR A;  1QPM A;  1HW5 A;  5E8G A;  4HLX A;  3MAJ A;  3CDH A;  3EET A;  3W6K B;  2ZJ2 A;  1TW2 A;  4RGX A;  5LHI A;  1FBS A;  5CVU A;  4P5O A;  3QU6 A;  1LEB A;  3KZY A;  1MJ9 A;  4BHC A;  2W24 A;  3T1B A;  3WTU C;  3BP8 A;  4HA8 A;  5H20 A;  4LLN A;  1JE8 A;  2GIV A;  3GWZ A;  4NHJ A;  1UB9 A;  3IL2 A;  2VC1 A;  2GZW A;  3MWM A;  3BJA A;  1BI2 A;  3E97 A;  2E7W A;  1LEA A;  3HRS A;  3R0A A;  2HTS A;  5LRR A;  2ZME A;  2V9V A;  2UXX A;  2FEZ A;  1U3E M;  3IWZ A;  2IA0 A;  3F8C A;  4OIP F;  2IA2 A;  5JR3 A;  4IHS A;  1FSE A;  2CQK A;  4MTD A;  3ABU A;  2MH9 A;  1LDK B;  2XAG A;  3I59 A;  5BOX A;  4O3M A;  3E6C C;  2CFX A;  2XKO A;  1R23 A;  3KEQ A;  4KA4 A;  4XSX F;  1YG2 A;  1ZRE A;  1ZGA A;  4AWX B;  2BEO A;  3H3U A;  3F8N A;  5CVI A;  2OD5 A;  2YPR A;  3LQR A;  2K4J A;  3T0Y A;  2Y0M A;  3JSP A;  3ABT A;  1EH7 A;  2JTV A;  2ISY A;  5BMZ A;  5DUK A;  2HDC A;  3K1M A;  2HFH A;  4LGW A;  5A2Q K;  2EK5 A;  2J5O A;  3V4G A;  1VTN C;  1KGS A;  2MBF A;  2CGP A;  1O3Q A;  3C18 A;  2EV0 A;  3R0J A;  3ISP A;  1RNL A;  2RDP A;  1UST A;  4EJU A;  2DTR A;  3E6B A;  5HS7 A;  4ZZL A;  1XDU A;  4EVI A;  3BWG A;  3WE3 A;  3M7G A;  4Y13 A;  2ELH A;  5DCM B;  2QBY B;  4M9X A;  3TO7 A;  1KQ9 A;  4P96 A;  1J5Y A;  1B59 A;  4BYY A;  2L02 A;  2HKO A;  3BPV A;  3JW4 A;  2L4A A;  4LK0 F;  4U7B A;  5LGN A;  1B9M A;  2WWY A;  4MGR A;  1V4R A;  4RGR A;  2Z9O A;  3V8L A;  1KU2 A;  4RS8 A;  3HOT A;  5FD5 A;  2V1D A;  1QGP A;  5HDN A;  1Y0U A;  5HDG A;  2XAH A;  4H0E A;  2XRO A;  4PGH A;  3GFI A;  1TTY A;  1ZAO A;  1U5T A;  5F6F A;  1Q1H A;  1XDS A;  2DT5 A;  2RVC A;  4EGY A;  3V8J A;  2ACJ A;  3RPQ A;  2BV6 A;  2HEO A;  2FML A;  4HOB A;  4L5J A;  2W84 A;  2QQA A;  3SZT A;  3KP7 A;  2O3F A;  1J75 A;  1U2W A;  2CWE A;  4I7H A;  1TNT A;  1IRF A;  2UXN A;  2VXZ A;  5D8L B;  1G3W A;  1P4W A;  2WTE A;  3E5X A;  2UWM A;  4LK1 F;  5CJ9 A;  1A04 A;  2P7V B;  4I02 A;  1XSV A;  3ZMS A;  5FLX Z;  1JXS A;  5D5X B;  4WK8 F;  3B02 A;  5ICF A;  3WE2 A;  3DQV C;  2XV4 S;  1LDJ A;  3I53 A;  1O3R A;  2GQQ A;  2O8X A;  2J5P A;  2P5L C;  2L3D A;  1S8N A;  1P92 A;  2F2E A;  2NNY A;  1IN6 A;  1QO0 D;  4KDP A;  4XLP F;  4RGS A;  2B0L A;  3KP2 A;  1BIA A;  4BQA A;  3JAM K;  2HZT A;  3ZMT A;  5K5R A;  2E7X A;  2K27 A;  2QYO A;  5L3E A;  1OYY A;  2H27 A;  2AXL A;  1MJB A;  1KA8 A;  3GO5 A;  4TV7 A;  1F9N A;  2M8E A;  2A61 A;  1YW7 A;  2A3S A;  1UHW A;  2VE8 A;  2G9W A;  1E17 A;  3K1P A;  3KE2 A;  2WV0 A;  4PGG A;  4A5N A;  4U0Y A;  2ZME B;  3RIR A;  1XSD A;  5AIQ A;  3C3W A;  1ZRC A;  3R61 A;  3TGN A;  4EJO A;  1T2K A;  3RYP A;  2DPD A;  3BY6 A;  3FM5 A;  3WU0 A; 
#chains in the Genus database with same CATH topology
 3I59 B;  2F5C A;  3GF2 A;  1WFX A;  2CUF A;  6PAX A;  1XC5 A;  1K79 A;  2EB7 A;  3OL3 A;  4FQG A;  1UG0 A;  3G73 A;  3H3Z A;  1G3T A;  3A02 A;  4BKX A;  2X51 A;  2DA6 A;  2CJJ A;  3WTZ A;  1I6X A;  1RR7 A;  2KRH A;  4A3L J;  2WA0 A;  4Q4Z F;  2JA5 J;  1T0F A;  1AU7 A;  5F27 A;  2IS6 A;  1S6L A;  1HCR A;  1S5L C;  2FOK A;  5DDG A;  3FXU A;  2W00 A;  1ETY A;  4II3 A;  5M5Y J;  3CO7 C;  5DD8 A;  2JPC A;  1SC7 A;  2E2J J;  2TRT A;  3MKW B;  3ZQH A;  3ML6 A;  3F8F A;  2X6X A;  3IV5 A;  3LA2 A;  1W0T A;  1KQ8 A;  2MD5 A;  3O8G A;  2ZCW A;  4ZJZ A;  1GVJ A;  3KYD B;  3VFZ A;  3VEP A;  4B09 A;  3BJ6 A;  1SFE A;  1RKW A;  4KIG A;  4ZTF A;  2NAZ A;  3TKY A;  4XOP A;  1HF0 A;  5ED4 A;  1BI0 A;  2LDU A;  4ITV A;  4KN4 X;  2OPT A;  4ZYA A;  5DM6 F;  1J09 A;  4MQ9 F;  1IN8 A;  5E8I A;  1DPU A;  1RKT A;  2FX0 A;  3TW6 A;  4A2U A;  4CCJ A;  5ICC A;  3OYB A;  4E6K G;  3OV8 A;  2XGE A;  1OFC X;  2R3S A;  2BVL A;  3DCF A;  2LNB A;  4NC6 A;  3FXO A;  3Q9V A;  3W6J B;  2O61 A;  2M7B A;  4CCO A;  4Y4R A;  2I5U A;  1KU3 A;  2XF7 A;  5JI6 A;  2K02 A;  3MZY A;  4WCG A;  4XLA A;  3B6A A;  2XRN A;  4JK1 X;  3H1C A;  5L3C A;  2DA4 A;  3DBH B;  4G6Q A;  4N0B A;  5GP9 A;  3E3V A;  3G4S I;  2WAQ A;  2STW A;  4P9F A;  4I76 A;  4Y33 A;  1QHG A;  3KCC A;  2LK2 A;  1FMW A;  1YX3 A;  4OIO F;  3LSM A;  3K69 A;  2W48 A;  3CF5 F;  5LEK A;  4CCN A;  3FM3 A;  2JN6 A;  2LC2 A;  4RA2 A;  4JYK A;  3CUQ A;  4LJZ F;  1AKH B;  4BXU A;  2VKD A;  3K4L A;  4XLN F;  1R5G A;  1E3H A;  2VQH A;  3DKX A;  1BOA A;  2R7D A;  1P7J A;  1V5E A;  1Z21 A;  4EM1 A;  1J9I A;  1U8R A;  3WGG A;  5GPC A;  3ZQF A;  2DOA A;  4DYR A;  2XSD C;  1ZGW A;  2DBB A;  2RRE A;  1VI0 A;  1VQL I;  2ZXJ A;  4I98 B;  4YG2 F;  3KFW X;  4FX4 A;  4LG0 B;  4HDV A;  3F8B A;  3AL0 B;  2IGN A;  4BBR J;  3S3N A;  2LF8 A;  3OS0 A;  2WBM A;  2Z5U A;  2XUB A;  4BEH A;  4HF0 A;  1YRN A;  2IP2 A;  2HWV A;  4KT5 C;  2JWT A;  2DA2 A;  2F48 A;  3RJP A;  3GFJ A;  1MNM C;  4UB8 C;  4AD9 A;  4RAZ A;  3I4M J;  2R7V A;  3RZO J;  1K7A A;  3CQZ J;  2MAB A;  2Y30 A;  1V55 H;  3G2B A;  4HQM A;  5KVR A;  1PJR A;  1IRX A;  3QAH A;  3CLQ A;  2VON A;  3HOS A;  1XMK A;  3LST A;  3X2Q H;  3SHF A;  3JRG A;  4BUP A;  1I1G A;  1WJB A;  1Z3X A;  4L9N A;  4XKC A;  2FBH A;  5FD6 A;  3DPL C;  4HG2 A;  4ZYH A;  3AG1 H;  5AIP A;  5HVQ C;  4KIC A;  3WTY C;  3T8R A;  2AS5 F;  2F4O B;  1IG7 A;  1X19 A;  3U9G A;  4LOC A;  2LD5 A;  3S32 A;  4AVZ A;  2R7W A;  1S3J A;  2PQ8 A;  4IQJ A;  4B1R A;  2VBY A;  1QZZ A;  1J59 A;  2IJL A;  1UHS A;  4CDG A;  3DFG A;  3O6B B;  5L3F A;  5HNF A;  3IKT A;  1XCV A;  1WJC A;  2UUZ A;  1FZP B;  2OU2 A;  2N8G A;  2GOX B;  1ON2 A;  1SFK A;  5FKN A;  3PIO F;  3NWS A;  2XHK A;  3M1E A;  2EQR A;  1X3U A;  2LY2 A;  2OA4 A;  1T8I A;  4IO9 F;  1DU0 A;  1KU7 A;  2CU7 A;  3CZ6 A;  1JTY A;  1IV6 A;  3RQ4 A;  5CPR B;  4NBQ A;  4UHT A;  3GTP J;  4JP0 A;  4IHX A;  1JGG A;  5F04 A;  3LFK A;  2NS8 A;  5IY5 H;  3TED A;  5JLW A;  1I27 A;  2DMQ A;  3D5L A;  2DYR H;  3NWT A;  2H8R A;  2HYF A;  1FTT A;  4BU2 A;  5J4V A;  1H9G A;  2CW0 F;  2EZI A;  3FDY A;  5HS8 A;  4ENM A;  5KHD A;  3CCY A;  3I4P A;  3R60 A;  4K2E A;  2BXZ A;  1W1W E;  2W57 A;  2PFB A;  2ISZ A;  1KQ0 A;  4LLL A;  1TLH B;  4E7H A;  4NNJ A;  2K40 A;  1IC8 A;  4ZYE A;  3GZ6 A;  1IN7 A;  1HOM A;  4PDK A;  4XLH A;  1OYI A;  2LLK A;  2VIX A;  3TO6 A;  4R79 A;  1MKM A;  1MDM B;  2JSC A;  4JBA A;  3T8T A;  5FLX K;  5K5O A;  4IVN A;  3ULQ B;  4A5M A;  2M45 A;  3FMS A;  3HOY J;  1BN5 A;  4I6Z A;  2W85 A;  3VSK A;  1YW9 A;  3BLY A;  5FB2 A;  3F21 A;  3I64 A;  1G8X A;  5F0C A;  3DPT A;  2FE3 A;  4H4K C;  2HQN A;  2ZBK A;  5K1Y A;  1HKT A;  3S1M J;  2L9V A;  5FRM A;  4QSH A;  2CS3 A;  5GAG J;  5DS9 A;  3BDD A;  1FP1 D;  3O8H A;  1UCR A;  3Q0W A;  3EUK L;  1X1B A;  1SVL A;  2R7S A;  2QUF A;  2DA7 A;  5IP6 A;  5EYR A;  3K4K A;  2VQG A;  2LP0 A;  5IPA A;  3N4M A;  4O6J A;  2K3F A;  3RZD J;  2VOO A;  1W4M A;  1WH5 A;  2LF7 A;  3OMY A;  1FNN A;  2RQQ A;  1Y39 A;  4A3J J;  1XMX A;  4ZDP A;  5LBQ A;  1HXD A;  2L54 A;  3LA3 A;  3HHH A;  3RKX A;  1JKQ C;  2VT2 A;  1MBK A;  1FYL A;  3OS2 A;  1BR1 A;  3PFI A;  3F0C A;  3KZI C;  4DYQ A;  4IRI A;  2FMY A;  3ZMZ A;  2E71 A;  3S1R J;  1B4A A;  4KMF A;  1D8J A;  5IP7 J;  3L00 A;  1RC9 A;  1GXQ A;  1A36 A;  5DM7 F;  2EZK A;  5GAE J;  2HDD A;  3GLX A;  4N9I A;  5F0F A;  2PJP A;  2HXI A;  3R4K A;  2JSP A;  3PUF A;  3VB2 A;  5KNL A;  2CW7 A;  1ZRD A;  2E5N A;  2F4I A;  1TC3 C;  3MEX A;  1YW8 A;  3CCS I;  1HDD C;  2K7L A;  3CCL I;  2PJR B;  3DEU A;  3H5R A;  3LWF A;  4BHB A;  1WSU A;  1Z7U A;  2KDO A;  2GLO A;  5DD4 A;  2RKH A;  5EZG A;  2R4G A;  1J2X A;  3FHZ A;  4BNC A;  3S15 J;  1K83 J;  3OYK A;  2VJ5 A;  1DGW Y;  1ZG3 A;  1R5I D;  4PJN A;  1ZYR F;  2Y0S A;  1IXS B;  2M4K A;  4C3J J;  3HRM A;  2Y48 A;  2E34 A;  3TL4 X;  2QLZ A;  3I5U A;  1QPI A;  3E6D A;  1SAN A;  3J81 Z;  5J3L A;  1FC3 A;  2OF7 A;  4OU0 A;  2M1B A;  1JUP A;  2DYS H;  2Q0O A;  3F9K A;  3IUO A;  1CF7 A;  2LSO A;  2C6Y A;  3LSG A;  1ZHF A;  4MQV A;  2M0M A;  3L2W A;  5LHH A;  1HDP A;  5HLG A;  1VQ7 I;  4NC7 A;  1FYK A;  3G71 I;  4DNC A;  1IAW A;  3LSI A;  3OYN A;  4E7K A;  3HSF A;  5EG0 A;  4N9H A;  1OCO H;  5FO5 A;  4NDL A;  2V1U A;  1U8B A;  5EGO A;  3COA C;  1SD5 A;  2A6T A;  2H94 A;  1BC7 C;  4I2O A;  1TQI A;  4S04 A;  4F52 A;  5GPA A;  1UHM A;  1TWC J;  3ZP5 A;  1SD7 A;  4DIQ A;  1WWX A;  4E4H A;  4XSZ F;  3OYI A;  4I99 C;  1XGS A;  1ETX A;  2KFD A;  2X1C A;  1OCZ H;  3RYR A;  2QCO A;  4S05 A;  3WHB A;  4IF4 A;  2ZNZ A;  2EA4 A;  3QPT A;  3BR6 A;  4UUS A;  1IXC A;  2OC6 A;  1FIA A;  2A5W A;  3BR5 A;  5TRD A;  4BGD A;  1A6Q A;  1WGX A;  2F5F A;  2M9H A;  1LB2 A;  4OIR F;  1F36 A;  1T95 A;  3FHN A;  1G2H A;  4XLF A;  2R7Z J;  1FT9 A;  3QYF A;  2XAQ A;  2NS7 A;  1HKS A;  2PMU A;  2EIJ H;  3FZV A;  4EEF G;  1BJA A;  2DAO A;  3IRQ A;  1I1S A;  5FKK A;  1IXR C;  1DDN A;  3OS1 A;  1MH3 A;  3P7N A;  1Y0N A;  3D5R C;  4IXA A;  1GXP A;  4XBF A;  1SVM A;  4Y17 A;  5IYD J;  2M5W A;  2R93 J;  4J00 A;  1ETV A;  4KN7 X;  1S72 I;  4LD5 A;  1YLF A;  1IDY A;  4WXD A;  2E5Z A;  4HF2 A;  3CDL A;  2E1M C;  3NAR A;  1OJL A;  5IYC J;  4WWC A;  2XAS A;  1FBQ A;  2CQQ A;  1SFU A;  3GTM J;  1D1C A;  4LIT A;  2OBP A;  4PJ0 C;  1K4S A;  3CUO A;  3L2C A;  1FOX A;  4CUG A;  4BE1 A;  1VQ6 I;  2R7R A;  3CP8 A;  4OAZ A;  2LYC A;  2VJI A;  1U9N A;  3G3Z A;  3ZCO A;  4M73 A;  4LIU A;  4E7S A;  4EM2 A;  1A5J A;  1Z6R A;  1UG2 A;  2O7O A;  2BYV E;  3M9A A;  3CUQ B;  3FBI B;  1REP C;  3HUG B;  2DOE A;  2ZSI B;  2HGC A;  2X48 A;  5D4R A;  2KHM A;  3RSN A;  2LR8 A;  1VZ0 A;  1MBJ A;  4II2 A;  4A6E A;  4YFK F;  3G1O A;  3SFI A;  4AVP A;  1D1B A;  1K78 A;  1LNW A;  4IRG A;  4GRI A;  4KJZ A;  1NH3 A;  1HLV A;  1HST A;  2D2W A;  2CH0 A;  1IZ1 A;  1LFU P;  2JT1 A;  2Z33 A;  2DXI A;  1JUM A;  1TP4 A;  4XL9 A;  2IPQ X;  4GGG A;  2ZXI A;  3VOE A;  1R00 A;  2IS2 A;  3H92 A;  3O3K A;  4UXN A;  4BEH B;  3HOX J;  3ZXS A;  4LMY A;  1YRN B;  2KJC A;  2Y75 A;  1FYM A;  3Q9S A;  3IAS 2;  2DCE A;  2RGV A;  4X0G A;  1SD6 A;  1XGO A;  2ME6 A;  3J7A Y;  2V9P A;  4ZYG A;  3QOP A;  1D5V A;  3SDB A;  2QSH X;  2E1M B;  2O5R A;  1BI3 A;  1OCP A;  2VE9 A;  2PG4 A;  3JRF A;  4A3M J;  3RPU D;  2XGC A;  4CGZ A;  1ODD A;  3JR9 A;  3J7A O;  4ESB A;  1YIT I;  3PNT A;  5IT3 A;  2NVQ J;  1W36 C;  4ESF A;  1WJ5 A;  5CLS A;  1P4A A;  1RUN A;  1TWG J;  1QA6 A;  2PI0 A;  1TBX A;  4HSR A;  2STT A;  2HTJ A;  2XAF A;  5E20 A;  2Z2S B;  1W36 D;  3QRF F;  1FTZ A;  3ECH A;  1FOY A;  1XGM A;  4A3E J;  1LVA A;  1JUS A;  3PFY A;  3C2H A;  2CO5 A;  4CA0 A;  2WB1 N;  5ERI A;  2JMW A;  3FXQ A;  5D4S A;  3ZMU A;  1LE8 A;  3VDX A;  1W7P A;  4FHT A;  2DQL A;  2R5Y A;  4YEJ A;  4HNV A;  1TZL A;  3BJO A;  2O6G E;  4L18 B;  3HEF A;  5M5X J;  2QVO A;  3VYU B;  4KIS A;  3H0D A;  1GT0 C;  1WZ2 A;  1P4X A;  2M34 A;  5F1J A;  2L9S A;  3JTH A;  2ZKZ A;  2PMH A;  3HGY A;  2AO9 A;  3ZQ7 A;  3V8K A;  2GM4 A;  4FET A;  1KYZ A;  3AG3 H;  4A3K J;  2Q2E A;  3QPH A;  3GYH X;  2NVU B;  1ORK A;  4XQF A;  1MBF A;  3O2P E;  2LKS A;  4GYI A;  4E7I A;  2BY1 A;  1YTY A;  2D45 A;  4AIJ A;  3Q5F A;  1A31 A;  2DO7 A;  3DKY A;  4O5V A;  4D7N A;  1MBG A;  2ZME C;  4Q5S F;  5F08 A;  1ULY A;  4MFE A;  4DQ2 A;  2E2H J;  2PN6 A;  3WTT C;  2JA7 J;  3BQZ A;  3HRT A;  4BY7 J;  1TNS A;  3BTJ A;  1FPQ A;  4KUM A;  1Z9C A;  2FU4 A;  4UVA A;  3S3M A;  2MC4 A;  2FQ3 A;  5AON A;  5B1B H;  4L9T A;  3S1N J;  1Z0X A;  5F0H A;  1Y1V J;  4LFU A;  2ZJR F;  2L9R A;  3OIP A;  2XC7 A;  4A69 C;  2M2E A;  1IN4 A;  5KCM A;  2PMZ A;  3H9J A;  1LQ1 A;  2EV5 A;  1QRY A;  5D6F A;  4U87 A;  2EIK H;  1WJA A;  3E7L A;  4UV8 A;  2Z16 A;  2FD5 A;  1U6G A;  4UVC A;  5FFZ A;  4DJA A;  1VFC A;  1T98 A;  2EFO A;  3ONQ A;  3AKZ A;  4PFP A;  2L0K A;  2RN7 A;  2JRT A;  4G12 A;  1GDT A;  5E18 F;  4BL0 B;  3F6O A;  2W4S A;  3MKY B;  4FT8 A;  1MZB A;  1XSX A;  3NEU A;  1GHC A;  1QZY A;  1EH8 A;  4U7D A;  1I6H J;  5ILU A;  1O3T A;  1S9H A;  2EWN A;  4ASN A;  3TOA A;  1L0O C;  1I39 A;  2NNN A;  3ELK A;  4U0W A;  5FRO A;  2YX4 A;  1R58 A;  3L2U A;  1T38 A;  5J1R A;  2X0L A;  1JTX A;  3OYL A;  1JKO C;  2KIU A;  1BR2 A;  2DOD A;  2XAJ A;  4GO1 A;  2QZ8 A;  3F8M A;  4G6T B;  3IP4 B;  4EAT A;  2DMP A;  4ENK A;  4QTR A;  1N75 A;  1RZ4 A;  3GBG A;  3KEY A;  2R7F A;  5BS6 A;  1W0U A;  3W3C A;  2NOG A;  1T56 A;  3REO A;  3HPG A;  2VKE A;  4FE7 A;  3MKL A;  1ZN2 A;  2EZL A;  1MND A;  2ZO4 A;  1X2M A;  1YJW I;  5E1X A;  1U0J A;  4NC8 A;  1TQP A;  1D8K A;  1EJ9 A;  2KL4 A;  3M1C A;  3RKW A;  5CVJ A;  4CYC B;  3GX4 X;  1XN7 A;  1R1V A;  2DK5 A;  3KYC B;  2F4M B;  2XPU A;  1LVK A;  4Y7N J;  4CCK A;  4L9J A;  5IYB J;  3PM1 A;  4UUT A;  2G7U A;  3I54 A;  3CCV I;  2RNJ A;  2ID6 A;  4EM0 B;  5J8F A;  5JVT A;  3MFK A;  2KDZ A;  3L9F A;  3I0T A;  4D5F A;  2F6C A;  3DU5 A;  3ABM H;  3OY9 A;  3CDI A;  3K4J A;  4UNO A;  3HM5 A;  2QEX I;  1JJ6 C;  2X1D A;  3DEW A;  1FY7 A;  1S7E A;  3OR2 C;  3AFH A;  5F1R A;  3S2W A;  1CF7 B;  2DK8 A;  1R1U A;  2LOO A;  5E1Z B;  4HX4 A;  1S29 A;  3OR1 C;  4M9Z A;  5FLM J;  4A0Z A;  3BTI A;  4DZP A;  1WJD A;  1FOK A;  1Z77 A;  1WKM A;  1K6Y A;  4CSW A;  4HNT A;  1FLI A;  4HX7 A;  3J81 K;  3AL0 C;  3CJN A;  1SMT A;  1OMI A;  2BY2 A;  3QQA A;  5EG0 B;  1FSH A;  3BC8 A;  2R7X A;  2COM A;  4A93 J;  1GUU A;  5EGO B;  5J4Y A;  1AA7 A;  9ANT A;  1VF9 A;  1CGP A;  3AAF A;  3W6V A;  4RB1 A;  2VBZ A;  1UJ8 A;  1Y56 A;  1O7F A;  4CIC A;  4GFB A;  1R5H A;  2P6T A;  1HW1 A;  2JPB A;  2WC2 A;  3KX2 A;  3CTA A;  1LFB A;  3CJQ B;  1MMS A;  1RES A;  1T33 A;  3DXJ F;  5HLT A;  3J80 Z;  2K9L A;  1B6A A;  1K6O A;  2FSW A;  5GTI C;  2QKM B;  3L2V A;  2V6C A;  2E1O A;  1MIJ A;  4M72 A;  1LDD A;  2QBY A;  2FBI A;  3G6E I;  1H89 C;  2ETH A;  4UUS B;  1B1B A;  1H88 C;  4GDF A;  4PSW A;  2CYY A;  1H9T A;  3CJR B;  2KPM A;  3HDD A;  5HDK A;  3ERE D;  1U5T C;  2EJR A;  1ZQ3 P;  3V7S A;  3CES A;  2R0Q C;  2XVC A;  4GYG A;  3HZJ A;  1YIJ I;  1AWC A;  2EFP A;  4RMN A;  1IUF A;  2IRF G;  3PQJ A;  1Y6I A;  1K61 A;  2HVS A;  4U88 A;  2DDB A;  2KKO A;  5DYM A;  5FKO A;  3CCJ I;  2QM3 A;  4PJM A;  3MCZ A;  1R7J A;  2BY0 A;  1QQI A;  5ICG A;  3L09 A;  2JVH A;  2OV7 A;  4BDZ A;  2VI6 A;  2CSO A;  4AYB N;  3MN2 A;  2QSG X;  2FNA A;  3HB9 A;  2A68 F;  2P5V A;  3L2R A;  3QPS A;  2DPU A;  2CV0 A;  1YS6 A;  2HYJ A;  3GFL A;  2HVR A;  1G4D A;  4L0Y B;  2VAS A;  1D5Y A;  1MGT A;  1YYV A;  2L2O A;  1PDN C;  5B5E C;  2L4M A;  2ESH A;  1X4O A;  4IPA A;  1WI3 A;  4BJ5 C;  4RBO A;  4ZC3 A;  3WOD F;  2GA2 A;  1FMV A;  5HOO A;  2DQR A;  1P9Q C;  4AM3 A;  5DTD A;  1TT0 A;  2A6H F;  4XR6 A;  4HX8 A;  2FNP A;  1K78 B;  2D1V A;  3WG9 A;  1BA5 A;  2V1X A;  1UEL B;  1U5T B;  3SYT A;  1LJ9 A;  1DUX C;  3S2D J;  2V26 A;  1JI8 A;  5K7Z A;  2VOP A;  1P2F A;  3QU3 A;  3B6C A;  1ETQ A;  3J7Y J;  4M3F A;  5CVR A;  2KP6 A;  3TBI A;  1MBE A;  3ABK H;  3E6M A;  4I0B A;  2IW5 A;  4ZZD A;  4Y3O A;  2P6S A;  2IBD A;  2DA1 A;  4A3B J;  2GXG A;  3LMM A;  5K5Q A;  1Z7L A;  1T39 A;  2NVX J;  2W25 A;  4ZYD A;  3SZG A;  1X3Z B;  1YE9 A;  3OWT A;  2L7F P;  1XD7 A;  3IHU A;  2VT3 A;  1E3O C;  4A12 A;  4XKB A;  4OIN F;  3I3L A;  4IZZ A;  4YII A;  3JTG A;  1OQY A;  1Q1V A;  3ZMD A;  3GEZ A;  1B8I A;  1IRG A;  4M6Y A;  1QHH D;  3HTS B;  4AIK A;  4B4C A;  2DMT A;  2MC3 A;  1WJE A;  5J1Y A;  4BAC A;  3TDU C;  2UZK A;  3LFU A;  2LH9 A;  4B3X A;  2VUM J;  3D0S A;  3FIW A;  3OYD A;  2XB0 X;  1GV5 A;  3PIP F;  1SAX A;  2IT0 A;  3BCB A;  1YIO A;  2LY1 A;  2ME0 A;  4C9Y A;  2H6C A;  3D1N I;  1OCC H;  2R7T A;  4M74 A;  4EMS A;  3K4M A;  4HF1 A;  4AIH A;  2BE5 F;  2VOD A;  2RC4 A;  3TP3 A;  1O4X A;  2FA5 A;  2OJE D;  4DW6 A;  1ERD A;  2FF4 A;  1BM9 A;  5L3B A;  2BVM A;  3PL8 A;  2OQG A;  2YU3 A;  1LE8 B;  3BG6 A;  1IDZ A;  1W7P B;  3HSE A;  2BW3 B;  1WPK A;  3U2R A;  4QLC U;  2R5Y B;  4JX5 A;  4D5C A;  4YIR X;  2D5V A;  4GCV A;  2P81 A;  1ZG5 A;  4IHW A;  2E35 A;  1F1Z A;  3WTV C;  5KK1 A;  2NVT J;  3LNQ A;  4A3F J;  2EFN A;  5E3O A;  5J1U A;  4OMY A;  2FBK A;  2HOS A;  3M07 A;  5ILV A;  5TGT A;  2AQE A;  4JOM A;  4RB3 C;  2Q2E B;  2QQB A;  1ITY A;  3K4C A;  1ETO A;  2A6E F;  3GUD A;  2JRM A;  1ACI A;  4WX9 A;  3HKZ N;  1SD4 A;  2H1L A;  3FXJ A;  4UB6 C;  4DZJ A;  1LFP A;  1R1T A;  3WGI A;  3GTG J;  4ENJ A;  4G9Y A;  4RAY A;  4BS9 A;  4A0X A;  1BI1 A;  4MNU A;  4HYE A;  4XID A;  4D7M A;  3SEZ A;  4CCL A;  3GVA A;  3ZN0 A;  3HG9 A;  4ESJ A;  4OAY A;  4HPQ A;  2JVG A;  3K1N A;  3VYS B;  3KEO A;  4G6D A;  1SFX A;  2XIG A;  3GZ5 A;  4AU7 A;  2OQR A;  2X1E A;  1VQO I;  5LRS A;  4ABZ A;  4KIT B;  3MZH A;  3KP6 A;  3F72 A;  4ETS A;  3K2Z A;  5LEJ A;  4C2U A;  2K9S A;  3HBL A;  4HNU A;  2DT6 A;  3WU1 B;  2I10 A;  2R7Q A;  2DW4 A;  4P9U A;  2ZFU A;  5CVV A;  2OTL I;  3DU6 A;  3HC7 A;  5CQE A;  2ZJQ F;  3DF8 A;  3ERM A;  1T0F C;  2GWR A;  5FJ8 J;  1Y1W J;  2EFQ A;  3VOD A;  4M9S A;  4IOA F;  5DV5 A;  2P0W A;  4EJV A;  2O03 A;  3VWB A;  2VJ4 A;  3VSL A;  2HQR A;  1FEX A;  3DTI A;  4S0H B;  2CW8 A;  1LUJ B;  4IL6 C;  2YR2 A;  2HKX A;  1F5T A;  5D5W B;  2P7C B;  3KLO A;  2A69 F;  2BGC A;  3RDI A;  3OYM A;  3I71 A;  4HV5 A;  4LLG F;  2DI3 A;  3W2V A;  4CCM A;  1VQ4 I;  4JX6 A;  4RB2 C;  3EDP A;  4KMU X;  1IW7 F;  3RQI A;  2JQ7 A;  5LD2 C;  5J47 A;  1Y8R B;  1ENH A;  5J8C A;  4UY8 I;  2EH3 A;  2XGX A;  5FGM A;  4WF2 A;  5EDN A;  5FKL A;  3GTK J;  3K70 C;  3U1K A;  1YOV B;  2EZH A;  3LAJ A;  1G3Y A;  2HYG D;  3M8E A;  1YHQ I;  3ZQI A;  5H6Q A;  2D1H A;  3C2G A;  1POG A;  2X6Y A;  3HYI A;  1EKE A;  3MKZ A;  2DT7 B;  2LRD A;  4D1Q A;  3K70 D;  2GA1 A;  3CCQ I;  4EQQ A;  2LKP A;  1RET A;  3BOQ A;  3FBN B;  2DFE A;  3LL7 A;  2GOM A;  2GBY A;  4RGU A;  3ZMV A;  5B66 C;  3H9Q A;  3TDZ C;  4CZZ A;  1MMN A;  4Q48 A;  1VQK I;  5ILS A;  3S8P A;  2CUZ A;  4L9V A;  4G7Z F;  1DU6 A;  4OMZ A;  3HOU J;  3PQK A;  3ASN H;  2NRA C;  3BCA A;  3FXK A;  1MSE C;  2IS4 A;  4DGW B;  2ICW G;  5M3F J;  4ENN A;  1KYW A;  1WCM J;  2FRH A;  3CUQ C;  1SFO J;  1HSJ A;  1OLT A;  2KIM A;  5HS9 A;  2WY7 Q;  2Y69 H;  3DV8 A;  1YQA A;  1VQP I;  2Z99 A;  4HV6 A;  4M6X A;  1KZH A;  3NRV A;  1PUF A;  1YO5 C;  4PSX A;  4BHP A;  3ZPL A;  5D6E A;  2WY8 Q;  2IGO A;  3DBR B;  4BAY A;  2DA5 A;  3BQY A;  3ZQL A;  3A0H C;  1CQT A;  3EYI A;  1XPX A;  1C0W A;  2RNG A;  3KIO A;  3KET A;  3PO3 J;  2DMU A;  1PUE E;  3UR3 C;  3BRO A;  3SQN A;  3CCM I;  3N97 A;  2WAD A;  4HRI A;  1NHA A;  4XRM A;  1SEU A;  2O9L A;  2JZY A;  5IOY A;  4M71 A;  3LA7 A;  5B3S H;  1QVU A;  4BE0 A;  1YI2 I;  3WTW C;  3OSF A;  1GLN A;  4B3A A;  4HQE A;  4IHV A;  2AQF A;  3E5Q A;  4BE2 A;  4V2G A;  1JJ8 C;  2VKH A;  3GTQ J;  3QP6 A;  2BHZ A;  1ZLK A;  2DMN A;  2HU9 A;  2VQL A;  4CH7 A;  2KZV A;  3TMO A;  5GAD J;  3DBL B;  4F93 B;  3JRD A;  1IN5 A;  1X1A A;  3RCO A;  1O7L A;  2XSJ C;  4IX7 A;  2X6O A;  4LB5 A;  4PUS A;  2P5K A;  2ELJ A;  1U78 A;  1PP7 U;  2A5Y B;  3P9C A;  2L7M P;  1QNT A;  3LSR A;  4LG0 A;  3IAM 2;  2KIF A;  3WU2 C;  1JHH A;  5JHU A;  4FTH A;  5IT9 Z;  3BG7 A;  4QIW N;  4I0A A;  3J80 K;  2L01 A;  4IOC F;  1D0Z A;  3S2H J;  1J7K A;  4PCQ A;  1W5C C;  3PSF A;  3JSO A;  4UUV A;  2F5E A;  1B9N A;  3HJE A;  5DUI A;  4B47 A;  1YX5 A;  2VJJ A;  4ANJ A;  2HXO A;  3SFZ A;  3BTC A;  5HLH A;  2LMD A;  3I4N J;  4AID A;  2TCT A;  4C3H J;  3DPU A;  4CYD A;  2V7F A;  2QWW A;  4HZF A;  3P9K A;  1VQ8 I;  1IJW C;  1OR7 A;  2HI3 A;  3R6S A;  1DP3 A;  1EH6 A;  2L7Z A;  3CP2 A;  1JKR C;  1FP2 A;  1ZGJ A;  3K0L A;  3HOW J;  1YJ9 I;  2EA2 A;  3ROU A;  3TOB A;  2TDX A;  1JHF A;  3IC7 A;  4U0V A;  3BTL A;  1FBU A;  4HLY A;  1TW3 A;  4BQN A;  1LKX A;  1MNE A;  3V7C A;  5C4J J;  1VQM I;  2CQ7 A;  1WRJ A;  4D0P A;  2VQC A;  3KP4 A;  3S1Q J;  1G3S A;  1P6R A;  3S16 J;  1IUY A;  3H9G A;  3QP5 A;  5EEH A;  2QF7 A;  1NG6 A;  2QA4 I;  2QQ9 A;  3LSK A;  3HOZ J;  2Y2Z A;  5JHF A;  3RKQ A;  4NQW A;  3HOV J;  2M30 A;  3KPH A;  2ECB A;  2IEK A;  2RQP A;  2M3A A;  2YX7 A;  3FX3 A;  3EYY A;  5EEG A;  3WTX C;  2ZXH A;  4ZH4 F;  5F64 A;  3RI4 A;  4B8X A;  2M8G X;  4ZTJ A;  3QYE A;  3PJR A;  5C3E J;  3GXO A;  2NOJ B;  4F3Q A;  4MEY F;  3LOC A;  2VL8 A;  3GFM A;  1Z91 A;  2VBW A;  4LG3 A;  3EUA A;  4KIB A;  5IOZ A;  5LFA A;  3RKY A;  1MD0 A;  4GXO A;  4YFN F;  2DU9 A;  4P55 A;  1OYW A;  3BR3 A;  1S7O A;  3A2K A;  4N4O B;  1B8I B;  4EJW A;  4A3G J;  1OIS A;  3H5N A;  2GXB A;  1J0R A;  2HZD A;  1NK2 P;  4XRF A;  1SVO A;  1A35 A;  2X6W A;  4A0Y A;  1AOY A;  4C30 A;  3HIF A;  3ZRG A;  1W5S A;  2XB5 A;  3F23 A;  4L0Z B;  5D8K B;  5CKT A;  4E70 A;  2HOT A;  3SZP A;  4G94 A;  2H6B A;  3TQN A;  1MDM A;  2KJB A;  3NQO A;  1WI9 A;  1Z6T A;  3QPL A;  1T6S A;  3FKJ A;  2MSY A;  4ON0 A;  4KNY A;  2OCC H;  3A01 A;  1HKQ A;  3FF5 A;  3KLN A;  3SDG A;  3H35 A;  4RM3 A;  2KQR A;  2DDA A;  5LGT A;  2WB1 A;  2IA1 A;  1FX7 A;  4XN3 A;  2V79 A;  5DCF A;  3DLL F;  4XM3 A;  2HS5 A;  2M0C A;  3P9I A;  4EJT A;  2JA6 J;  1P7I A;  3KP5 A;  1E0E A;  1W5T A;  1IGN A;  3GTL J;  2XF5 A;  2IXS A;  1UAA A;  3CD6 I;  3A0B C;  5L3G A;  3M4O J;  1E2X A;  2BOL A;  4F7Z A;  5M3M J;  3WTS C;  2K86 A;  3A03 A;  3Q0U A;  3QYB A;  2NS0 A;  3EPZ A;  4L5I A;  4HW0 A;  1YFH A;  4NUB A;  3F22 A;  1ON1 A;  1ZAR A;  2M87 A;  2O0Y A;  3BG5 A;  4X6A J;  4OWR B;  5B1A H;  5E79 C;  2MA3 A;  2E1C A;  3CMA I;  1RI7 A;  1XCB A;  2CMP A;  3FXM A;  1XTA A;  4QPQ A;  2CFO A;  4XMY A;  1B72 A;  4HAM A;  1RRJ A;  2B7E A;  1DGR M;  3I58 A;  3M8J A;  4RLQ A;  4MEX F;  4W1U A;  3DEE A;  1Z1D A;  4LIV A;  2A07 F;  1BR4 A;  2HOE A;  2RV8 A;  4CXF A;  1JT0 A;  1N77 A;  2K9Q A;  1I3Q J;  2BBY A;  4XKV A;  2QEN A;  5J6X A;  3S17 J;  3BR1 A;  1ZR2 A;  5DEQ A;  4IHY A;  2Z3Y A;  3E0J B;  4WXH A;  3T5X A;  1V5G A;  5LGU A;  1O57 A;  1UZC A;  1Z67 A;  5ICE A;  3L7W A;  3G1M A;  4JQF A;  4DBQ A;  2W82 A;  4QWQ A;  2IGM A;  2VKV A;  2ESN A;  1XGN A;  2BZT A;  2MYS A;  3ZQQ A;  3FXR A;  3TP0 A;  2X85 A;  4UVB A;  4IRH A;  3C7J A;  1RUO A;  4C2T A;  2E1N A;  3FK6 A;  4HST A;  5E3M A;  4J19 A;  4YEL A;  3CCR I;  2PEX A;  3OYF A;  2GAU A;  1ZRF A;  2KT0 A;  3C2B A;  2P8T A;  3BZ6 A;  4CZC A;  3IH3 A;  1STZ A;  4MIM A;  4OOI A;  3GME A;  2V4J C;  2LVS A;  1O3S A;  3CCU I;  5A2Q Z;  4AUX A;  3U1D A;  2F5D A;  3FWE A;  1NG7 A;  3TO9 A;  4BQQ A;  2DTZ A;  3OYE A;  3FKI J;  4DYC A;  3TW7 A;  4A3C J;  4KFC A;  4G8X A;  1V3F A;  1K4T A;  3IRR A;  2PBI A;  1VQN I;  4G7O F;  4RAF A;  2JA2 A;  2HPM A;  1EA3 A;  3KP3 A;  1G6N A;  5EF6 A;  5C44 J;  4XK4 A;  1X1D A;  5FFX A;  4EV0 A;  3I55 I;  1BBY A;  2DOF A;  2NYX A;  4RB0 A;  1HBX G;  3C1D A;  1WQ2 A;  3E1S A;  3FXL A;  3CCE I;  2Z1D A;  2ELK A;  3OOP A;  1ETK A;  3K9T A;  5JFR A;  4F92 B;  1KU9 A;  2VC0 A;  3HL2 A;  2LBF A;  1OKR A;  2MFZ A;  2ZFW A;  4Y15 A;  2WAQ N;  2CQN A;  2EFW A;  5LHG A;  1R49 A;  3BR0 A;  3BG9 A;  2AHQ A;  3HTU A;  3IH4 A;  3DKW A;  3UKG A;  2H09 A;  3H3V K;  2DLL A;  3WHC A;  3GZN B;  4Z2Y A;  4IJA A;  3Q3S A;  3A1Y A;  4J01 A;  1ZKG A;  2G7H A;  2OZU A;  3ZN1 A;  1MW7 A;  2YSR A;  3JRA A;  3CO6 C;  2FXA A;  4BDY A;  4UV9 A;  3RTR A;  2BXY A;  5LLQ A;  1UFM A;  5BNG A;  1YJN I;  3HSR A;  2FOW A;  2OTJ I;  1FIP A;  1X1P A;  2R7U A;  2E60 A;  5DCM A;  4A6D A;  3M8F A;  2Q8K A;  2AXT C;  1PUF B;  2EV6 A;  3V42 A;  1VQ9 I;  2COB A;  4XOT A;  5D5U B;  2XDV A;  3PUB A;  4ZDO A;  1BJZ A;  4I09 A;  2IS1 A;  1LPQ A;  3A4C A;  2Y9Z A;  1OR7 C;  1R4N B;  2QSF X;  3OL4 A;  1RPW A;  1XMA A;  2MLK A;  4XOR A;  2IGK A;  3B73 A;  4P1W A;  1F43 A;  1D0Y A;  4LB6 B;  1U9O A;  3MQ0 A;  2X4H A;  2OCE A;  1R36 A;  4KYW A;  1TQM A;  4F91 B;  1MJA A;  1SMY F;  1D3Y A;  1MMG A;  3H36 A;  3CMY A;  2VB6 A;  3EQL F;  1GV2 A;  2L5Q A;  4KT6 A;  3OYG A;  2KIQ A;  3V7R A;  4FCY A;  2X9D A;  4IHT A;  1HW2 A;  3EUH A;  2DFI A;  5HLI A;  3OYC A;  2HR3 A;  2W7N A;  3HUG A;  3GCM A;  1F4K A;  4M6V A;  2NXN B;  1H0M A;  4HBL A;  2XF6 A;  3CJT B;  3VYT B;  3F6V A;  4HDU A;  1RIO H;  4BH9 A;  4PJL A;  5EJC A;  1X2N A;  3CLO A;  1R71 A;  1QBJ A;  4FX0 A;  1S7A A;  5TIS C;  2G0E A;  3LAP A;  2KRF A;  3I56 I;  2DJN A;  2L9N A;  4Q47 A;  1WJF A;  4EGZ A;  5E1W A;  3DP7 A;  4ZDL A;  2YU9 J;  1ZH5 A;  5BPI A;  3JCU C;  3GW2 A;  5M5W J;  2VBX A;  3MMY B;  3PNY A;  4RLF A;  5FRN A;  2KLO A;  3ECO A;  5IT9 K;  1ONV A;  2ZJP F;  2UV1 A;  3FK7 A;  4MTE A;  3E5U A;  1MSF C;  5TJJ A;  3BPX A;  1R22 A;  1ZG1 A;  3DWL E;  1V54 H;  5CYV A;  3JRE A;  1L3L A;  1FOW A;  4BXX J;  1N25 A;  2K4B A;  2XRL A;  2LTP A;  4AYB A;  1W7P D;  2K9N A;  4WXC A;  1USS A;  2PLY A;  1XB4 A;  4DBR A;  2R7O A;  3ZQG A;  3S14 J;  3FMR A;  3FMQ A;  3WGH A;  2B9S A;  1BOB A;  2MG4 A;  3AG2 H;  3KZZ A;  1YS7 A;  4RAG A;  5HNH A;  3PNV A;  2JJ7 A;  2HDW A;  2OZ6 A;  4G7H F;  1EV7 A;  1DP7 P;  1I5Z A;  3KYL A;  2IAI A;  4NB5 A;  3F3X A;  5KAF C;  1T08 B;  3H0G J;  3OOU A;  2YUS A;  4CHU A;  2EPF A;  1BIB A;  3K2A A;  1HQC A;  2ZNY A;  2K9M A;  2MH2 A;  4R1H A;  4XLC A;  4I01 A;  2JA8 J;  1X3W B;  2MLG A;  4KIF A;  4NQW B;  2CV1 A;  2WAE A;  5BQT A;  3SXY A;  1R9T J;  4C3I J;  1JGS A;  2JUG A;  2MGQ A;  4QPO A;  1OPC A;  1TT5 B;  2H8W A;  1BW6 A;  4MHG A;  4YIF A;  5BPD A;  2XKP A;  3IKV A;  3UNG C;  5GTH C;  3HRU A;  1IF1 A;  2ADU A;  2K5C A;  2YS9 A;  3IWF A;  2O8K A;  2IVM A;  2OAZ A;  1WHU A;  3HHG A;  4PZJ A;  3S3O A;  2VN2 A;  2HOA A;  5D5V B;  4R8H A;  3GTJ J;  2EIN H;  5E17 F;  2KIS A;  4M3G A;  3RPU A;  2VXD A;  2VLA A;  3MD2 A;  5J40 A;  4YFX F;  1PP8 F;  1HC8 A;  3K6G A;  4PJJ A;  3LQQ A;  5L3D A;  1ZLJ A;  1R6R A;  1FWZ A;  2CG4 A;  3JAM Z;  4OIQ F;  2P4W A;  1Z05 A;  5H6R A;  1BC8 C;  1HA8 A;  4CO8 A;  1DPR A;  1IO2 A;  1QPM A;  2NVY J;  2DN0 A;  1HW5 A;  5E8G A;  3DTK A;  3MAJ A;  2HQA A;  1ZK8 A;  4HLX A;  3L2Q A;  2LY9 A;  3CDH A;  3EET A;  3GLL A;  3W6K B;  3WG7 H;  2ZJ2 A;  1TW2 A;  4XRS A;  4RGX A;  5LHI A;  1FBS A;  5CVU A;  2EBI A;  4P5O A;  3QU6 A;  1LEB A;  3KZY A;  2R5Z A;  1MJ9 A;  4BHC A;  4IKF A;  2W24 A;  1D1A A;  3T1B A;  4L5E A;  3WTU C;  3W2W A;  1ZEL A;  3BP8 A;  5K7F A;  4HA8 A;  4BJT A;  1BL0 A;  5H20 A;  4A3I J;  4LLN A;  3A01 B;  1JE8 A;  3OIO A;  2GIV A;  3K4B A;  1N78 A;  3HGG A;  4XKW A;  4IQ4 A;  3W2A A;  3GWZ A;  1XG1 A;  4NHJ A;  4FIS A;  4A3D J;  1UB9 A;  3IL2 A;  3K7A J;  2VC1 A;  4RDU A;  2GZW A;  3MWM A;  3BJA A;  1BI2 A;  3E97 A;  2E7W A;  1LEA A;  3HRS A;  2L7K A;  3R0A A;  2HTS A;  5LRR A;  2ZME A;  2V9V A;  4BXF A;  4BY1 J;  2UXX A;  2Y0S N;  4N4N B;  2FEZ A;  2JUC A;  1U3E M;  3BT9 A;  2M7A A;  4JX4 A;  4D9J A;  3IWZ A;  1WVR A;  2IA0 A;  3HKZ A;  3F8C A;  4OIP F;  2IA2 A;  1E3P A;  1R4M B;  5JR3 A;  4IHS A;  4M3B A;  1B72 B;  1BW5 A;  1FSE A;  5C4X J;  1X58 A;  2CQK A;  4MTD A;  3ABU A;  2MH9 A;  1LDK B;  2XAG A;  1GVD A;  3I59 A;  5BOX A;  3CME I;  4MFD A;  3OSG A;  4O3M A;  3E6C C;  2CFX A;  2XKO A;  1ZTR A;  1PVE A;  1R23 A;  2EIM H;  3KEQ A;  2KMU A;  4M3E A;  4KA4 A;  5EEA A;  4XSX F;  4CYC A;  1YG2 A;  1ZRE A;  5FKM A;  1ZGA A;  4XN0 A;  4XON A;  4AWX B;  3K4N A;  3ZOB A;  2PX9 A;  3K10 A;  2BEO A;  1VND A;  3H3U A;  3DTE A;  4B48 A;  3F8N A;  5CVI A;  2OD5 A;  2XGD A;  2YPR A;  2QKL B;  2A05 A;  4MO7 A;  3OIQ A;  3CF2 A;  3LQR A;  2CV2 A;  2K4J A;  1QZE A;  3T0Y A;  2KRC A;  2Y0M A;  3JSP A;  1X4P A;  2Y31 A;  1EH7 A;  3ABT A;  4XLE A;  2XPV A;  4W97 A;  1WH7 A;  3Q0V A;  2JTV A;  2ISY A;  5BMZ A;  5DUK A;  1ETW A;  3QOE A;  3ESW B;  2HDC A;  3K1M A;  3J7Z I;  2HFH A;  3OYJ A;  4LGW A;  2DA3 A;  1MH4 A;  2RAE A;  5A2Q K;  2EK5 A;  2OUM A;  2J5O A;  4AC0 A;  3PO2 J;  3JRH A;  3V4G A;  3CC7 I;  1UMQ A;  3BZC A;  1MMA A;  1VTN C;  1KGS A;  2JK3 A;  2MBF A;  2CGP A;  1O3Q A;  2LBF B;  2HPI A;  3JRB A;  1M1E B;  3P5J A;  3C18 A;  4E7Z A;  2EV0 A;  3EUH C;  3R0J A;  3ISP A;  1RNL A;  2CUE A;  5GAH J;  2RDP A;  1UST A;  3CMM A;  5JVG F;  3M3Y J;  1RR8 C;  4EJU A;  2LG4 A;  2DTR A;  3E6B A;  5HS7 A;  3PSI A;  3ZGK A;  1MMD A;  4ZZL A;  1XDU A;  4EVI A;  1NK3 P;  1IRZ A;  3BWG A;  1TWF J;  1AKH A;  3WE3 A;  2QGU A;  5CQG A;  1TWA J;  1SAU A;  1IV8 A;  2H1K A;  2DJI A;  3M7G A;  1XS9 A;  4Y13 A;  2ELH A;  2FQ4 A;  1JKP C;  5DCM B;  3ZR8 X;  1JT6 A;  2HVQ A;  2QBY B;  4M9X A;  4MLO A;  3TO7 A;  1KQ9 A;  3JRC A;  4P96 A;  1J5Y A;  1X1C A;  1B59 A;  3CC4 I;  4BYY A;  2L02 A;  2M4G A;  2HKO A;  2GIZ A;  3BPV A;  3DLA A;  2XAU A;  3JW4 A;  2L4A A;  4LK0 F;  1OCT C;  4U7B A;  5LGN A;  1B9M A;  2WWY A;  1H8A C;  4MGR A;  1V4R A;  4RGR A;  4BJ6 C;  2Z9O A;  3V8L A;  4XIC A;  5KAI C;  1KU2 A;  2KZG A;  4RS8 A;  3HOT A;  4B44 A;  3BZK A;  5FD5 A;  3LSJ A;  4C2M J;  3QOD A;  2V1D A;  1QGP A;  2Q1Z B;  2ZXW H;  5HDN A;  1Y0U A;  3D5S C;  5HDG A;  5IP9 J;  2XAH A;  2CQX A;  4H0E A;  2XRO A;  4F55 A;  4PGH A;  3GFI A;  1TTY A;  4XNF A;  1ZAO A;  1U5T A;  3L1P A;  2GXA A;  5F6F A;  1Q1H A;  3OYH A;  2DFH A;  2MD0 A;  1XDS A;  3AG4 H;  2DT5 A;  4FE4 A;  4XRS G;  4HEA 2;  2FUG 2;  3LSP A;  2RVC A;  4EGY A;  2HNH A;  2ECC A;  3V8J A;  2ACJ A;  3RPQ A;  2BV6 A;  2R92 J;  2K3P A;  4RM2 A;  2V9K A;  2HEO A;  2FML A;  4PFO A;  4HOB A;  4L5J A;  1TL8 A;  2W84 A;  3BG3 A;  2QQA A;  2ZB9 A;  3SZT A;  3CC2 I;  3KP7 A;  1G59 A;  2O3F A;  2VPR A;  1J75 A;  1U2W A;  1PYV A;  2CWE A;  1Z3Y A;  5K7H A;  4I7H A;  1TNT A;  2CRG A;  3HXL A;  1IRF A;  1KON A;  2UXN A;  4M3D A;  1XX5 A;  2VXZ A;  5D8L B;  1G3W A;  4E7J A;  1P4W A;  2WTE A;  3E5X A;  2UWM A;  5E3L A;  4LK1 F;  5CJ9 A;  3VPR A;  3ABL H;  1A04 A;  2P7V B;  4I02 A;  1I3A A;  1TWH J;  3ASO H;  2BY3 A;  4PK4 A;  1XSV A;  3SJM A;  3ZMS A;  5FLX Z;  1JXS A;  5D5X B;  2LKX A;  4YRV A;  4WK8 F;  3G1L A;  3B02 A;  1OCR H;  5ICF A;  3SEQ A;  4BBS J;  2LRE A;  2PMZ N;  3BR2 A;  3WE2 A;  3DQV C;  5HOD A;  1QU3 A;  2BW3 A;  2XV4 S;  3I9V 2;  1LDJ A;  4DOZ A;  2F5V A;  2BHY A;  3FIS A;  1I50 J;  3I53 A;  3U21 A;  1O3R A;  4E7L A;  1EF4 A;  2GQQ A;  2V6E A;  2O8X A;  4V19 K;  1FJL A;  2J5P A;  2P5L C;  2L3D A;  1S8N A;  1VQ5 I;  1P92 A;  3NAU A;  2F2E A;  2QQ8 A;  3HPH A;  3ZQC A;  2NNY A;  2B63 J;  1QVT A;  1APL C;  1IN6 A;  1QO0 D;  4KDP A;  2DFF A;  4IEJ A;  4XLP F;  4RGS A;  1NTC A;  2K85 A;  2B0L A;  3KP2 A;  2EIL H;  3IH2 A;  2XPW A;  2WAF A;  1BIA A;  4BQA A;  3JAM K;  2HZT A;  5H2F C;  3ZMT A;  5K5R A;  2E7X A;  2K27 A;  5FLV A;  2QYO A;  5L3E A;  4V2F A;  1OYY A;  2H27 A;  2R5Z B;  4Y52 J;  3VYR B;  1MBH A;  2AXL A;  3LSH A;  3QWL A;  1MJB A;  1KA8 A;  3GO5 A;  1D0X A;  5E3N A;  2CUJ A;  3H5A A;  5EZH A;  4TV7 A;  2ID3 A;  2FJ1 A;  1DQU A;  4X1E A;  2LFB A;  2ZC2 A;  1Y8Q B;  2VPL A;  1V5F A;  2E19 A;  1F9N A;  1A6I A;  2M8E A;  2A61 A;  2ZSH B;  1YW7 A;  2A3S A;  5JLX A;  2V1N A;  3N05 A;  3OYA A;  1UHW A;  2VE8 A;  4BQO A;  2WV1 A;  2G9W A;  1E17 A;  3MVP A;  3K1P A;  3KE2 A;  4Z6Y A;  2WV0 A;  4PGG A;  4A5N A;  4U0Y A;  2Y9Y A;  2PJR A;  2HQ5 A;  1ZR4 A;  2ZME B;  3RIR A;  1XSD A;  5AIQ A;  3C3W A;  1AHD P;  2E2I J;  1ZRC A;  4FAS D;  2W1O A;  3R61 A;  2MW8 A;  2E36 A;  3S93 A;  3TGN A;  4EJO A;  1T2K A;  2I8D A;  4B43 A;  3RYP A;  3JRI A;  2DPD A;  3BY6 A;  3GTO J;  3FM5 A;  3MZ8 A;  3WU0 A; 
#chains in the Genus database with same CATH homology
 3I59 B;  2F5C A;  3GF2 A;  6PAX A;  1K79 A;  2EB7 A;  3G73 A;  3H3Z A;  1G3T A;  3WTZ A;  1I6X A;  4Q4Z F;  1T0F A;  1S6L A;  2FOK A;  5DDG A;  3FXU A;  3CO7 C;  5DD8 A;  2JPC A;  3ML6 A;  3F8F A;  3LA2 A;  1KQ8 A;  2MD5 A;  2ZCW A;  1GVJ A;  3VFZ A;  3VEP A;  4B09 A;  3BJ6 A;  1SFE A;  4KIG A;  2NAZ A;  3TKY A;  5ED4 A;  1BI0 A;  2LDU A;  4KN4 X;  4MQ9 F;  1IN8 A;  5E8I A;  1DPU A;  4A2U A;  5ICC A;  3OV8 A;  2R3S A;  2LNB A;  2O61 A;  3Q9V A;  3W6J B;  1KU3 A;  5JI6 A;  2K02 A;  3MZY A;  4WCG A;  2XRN A;  4JK1 X;  5L3C A;  4G6Q A;  4N0B A;  3E3V A;  2STW A;  4P9F A;  3KCC A;  4OIO F;  3K69 A;  5LEK A;  3FM3 A;  3CUQ A;  4LJZ F;  4BXU A;  4XLN F;  1R5G A;  1BOA A;  2R7D A;  4EM1 A;  1J9I A;  1U8R A;  3WGG A;  2DBB A;  2ZXJ A;  4I98 B;  4YG2 F;  3KFW X;  4FX4 A;  4LG0 B;  4HDV A;  3F8B A;  2LF8 A;  2Z5U A;  2XUB A;  4HF0 A;  2IP2 A;  2HWV A;  4KT5 C;  3RJP A;  3GFJ A;  4AD9 A;  4RAZ A;  1K7A A;  4HQM A;  5KVR A;  3QAH A;  2VON A;  3HOS A;  1XMK A;  3LST A;  3SHF A;  1I1G A;  4L9N A;  2FBH A;  5FD6 A;  3DPL C;  4ZYH A;  5AIP A;  5HVQ C;  4KIC A;  3WTY C;  3T8R A;  2AS5 F;  3U9G A;  1S3J A;  2PQ8 A;  2VBY A;  1QZZ A;  1J59 A;  2IJL A;  4CDG A;  3DFG A;  3O6B B;  5L3F A;  3IKT A;  1XCV A;  1FZP B;  2OU2 A;  1ON2 A;  2XHK A;  3M1E A;  1X3U A;  2OA4 A;  1KU7 A;  4UHT A;  3LFK A;  1I27 A;  3D5L A;  2HYF A;  1H9G A;  2CW0 F;  5HS8 A;  4ENM A;  3R60 A;  3I4P A;  4K2E A;  2W57 A;  2PFB A;  2ISZ A;  1KQ0 A;  4LLL A;  1TLH B;  4ZYE A;  3GZ6 A;  1IN7 A;  4PDK A;  1OYI A;  3TO6 A;  4R79 A;  1MKM A;  1MDM B;  2JSC A;  4JBA A;  3T8T A;  5FLX K;  5K5O A;  4IVN A;  3ULQ B;  4A5M A;  2M45 A;  3FMS A;  1BN5 A;  2W85 A;  1YW9 A;  3F21 A;  5FB2 A;  3I64 A;  3DPT A;  2FE3 A;  5K1Y A;  2HQN A;  2ZBK A;  1HKT A;  3BDD A;  1FP1 D;  1UCR A;  2QUF A;  3N4M A;  4O6J A;  2VOO A;  1W4M A;  2LF7 A;  1FNN A;  5LBQ A;  1HXD A;  2L54 A;  3LA3 A;  3HHH A;  3RKX A;  2VT2 A;  1FYL A;  3PFI A;  4IRI A;  2FMY A;  3ZMZ A;  1B4A A;  4KMF A;  1D8J A;  3L00 A;  1GXQ A;  3GLX A;  4N9I A;  2PJP A;  3VB2 A;  3R4K A;  1ZRD A;  3MEX A;  1YW8 A;  2K7L A;  3DEU A;  3LWF A;  4BHB A;  1WSU A;  1Z7U A;  5DD4 A;  2RKH A;  1J2X A;  3FHZ A;  4BNC A;  1ZG3 A;  1ZYR F;  1IXS B;  3HRM A;  2Y48 A;  2QLZ A;  3I5U A;  3E6D A;  3J81 Z;  1FC3 A;  4OU0 A;  2M1B A;  2Q0O A;  1CF7 A;  2LSO A;  2C6Y A;  1ZHF A;  4MQV A;  5LHH A;  5HLG A;  1FYK A;  4DNC A;  1IAW A;  3HSF A;  4N9H A;  5FO5 A;  2V1U A;  3COA C;  1SD5 A;  2H94 A;  1BC7 C;  4I2O A;  1TQI A;  4S04 A;  1UHM A;  3ZP5 A;  1SD7 A;  1WWX A;  4XSZ F;  1XGS A;  3RYR A;  4S05 A;  4IF4 A;  2ZNZ A;  2EA4 A;  3QPT A;  1IXC A;  5TRD A;  2F5F A;  1LB2 A;  4OIR F;  1FT9 A;  2XAQ A;  1HKS A;  2PMU A;  3FZV A;  1BJA A;  2DAO A;  3IRQ A;  1I1S A;  1IXR C;  1DDN A;  3P7N A;  4IXA A;  1GXP A;  4XBF A;  4Y17 A;  2M5W A;  4KN7 X;  4LD5 A;  1YLF A;  4WXD A;  4HF2 A;  4WWC A;  2XAS A;  1FBQ A;  1SFU A;  2OBP A;  3CUO A;  3L2C A;  3G3Z A;  4M73 A;  4EM2 A;  1Z6R A;  2BYV E;  3M9A A;  3CUQ B;  1REP C;  2HGC A;  5D4R A;  4A6E A;  4YFK F;  4AVP A;  1K78 A;  1LNW A;  4IRG A;  1HST A;  2D2W A;  1IZ1 A;  2JT1 A;  2Z33 A;  2IPQ X;  4GGG A;  3VOE A;  1R00 A;  3H92 A;  3O3K A;  4UXN A;  4LMY A;  2KJC A;  2Y75 A;  1FYM A;  3Q9S A;  2RGV A;  1SD6 A;  1XGO A;  4ZYG A;  3QOP A;  1D5V A;  1BI3 A;  2VE9 A;  2PG4 A;  4CGZ A;  1ODD A;  3J7A O;  4ESB A;  5IT3 A;  4ESF A;  5CLS A;  1P4A A;  1RUN A;  2PI0 A;  1TBX A;  2STT A;  2HTJ A;  2XAF A;  5E20 A;  3QRF F;  3ECH A;  1XGM A;  1LVA A;  2CO5 A;  5ERI A;  5D4S A;  3FXQ A;  3ZMU A;  1W7P A;  4FHT A;  2DQL A;  3BJO A;  2O6G E;  4L18 B;  2QVO A;  1P4X A;  3JTH A;  2ZKZ A;  2PMH A;  3ZQ7 A;  3V8K A;  1KYZ A;  2Q2E A;  3QPH A;  3GYH X;  1YTY A;  3O2P E;  4GYI A;  2D45 A;  4AIJ A;  3Q5F A;  2DO7 A;  4O5V A;  4Q5S F;  1ULY A;  4DQ2 A;  2PN6 A;  3WTT C;  3HRT A;  1TNS A;  1FPQ A;  4KUM A;  1Z9C A;  2FU4 A;  4UVA A;  5AON A;  2FQ3 A;  4L9T A;  4LFU A;  1IN4 A;  1LQ1 A;  2EV5 A;  5D6F A;  4UV8 A;  1U6G A;  4UVC A;  5FFZ A;  1T98 A;  2EFO A;  2RN7 A;  2JRT A;  5E18 F;  3F6O A;  4FT8 A;  1MZB A;  1XSX A;  3NEU A;  1GHC A;  1QZY A;  1EH8 A;  4U7D A;  5ILU A;  1O3T A;  2EWN A;  4ASN A;  3TOA A;  1L0O C;  2NNN A;  3ELK A;  4U0W A;  2YX4 A;  1R58 A;  1T38 A;  2X0L A;  2KIU A;  2XAJ A;  4GO1 A;  2QZ8 A;  3F8M A;  4ENK A;  1RZ4 A;  2R7F A;  5BS6 A;  3REO A;  1ZN2 A;  2ZO4 A;  5E1X A;  1TQP A;  1D8K A;  3RKW A;  5CVJ A;  3GX4 X;  1XN7 A;  1R1V A;  2DK5 A;  4L9J A;  2G7U A;  3I54 A;  2RNJ A;  4EM0 B;  5J8F A;  5JVT A;  3MFK A;  3L9F A;  3I0T A;  4UNO A;  1FY7 A;  5F1R A;  3S2W A;  1CF7 B;  2DK8 A;  1R1U A;  5E1Z B;  4HX4 A;  1S29 A;  4M9Z A;  4A0Z A;  1FOK A;  1WKM A;  1FLI A;  4HX7 A;  3J81 K;  3CJN A;  1SMT A;  1OMI A;  1FSH A;  2COM A;  1CGP A;  3AAF A;  4RB1 A;  2VBZ A;  1O7F A;  4CIC A;  1R5H A;  2P6T A;  1HW1 A;  2JPB A;  2WC2 A;  3CTA A;  3DXJ F;  3J80 Z;  1B6A A;  1K6O A;  2FSW A;  2V6C A;  4M72 A;  1LDD A;  2QBY A;  2FBI A;  2ETH A;  1B1B A;  1H9T A;  2CYY A;  5HDK A;  3ERE D;  1U5T C;  2EJR A;  3V7S A;  2XVC A;  4GYG A;  1AWC A;  2EFP A;  2IRF G;  3PQJ A;  4U88 A;  2KKO A;  5DYM A;  2QM3 A;  3MCZ A;  1R7J A;  1QQI A;  5ICG A;  3L09 A;  2CSO A;  2FNA A;  2A68 F;  2P5V A;  2DPU A;  1YS6 A;  3GFL A;  1G4D A;  4L0Y B;  1MGT A;  1YYV A;  1PDN C;  2L4M A;  2ESH A;  4IPA A;  3WOD F;  2GA2 A;  5HOO A;  2DQR A;  2A6H F;  4HX8 A;  2FNP A;  1K78 B;  2D1V A;  3WG9 A;  2V1X A;  1U5T B;  1DUX C;  1LJ9 A;  2VOP A;  1P2F A;  3QU3 A;  5CVR A;  4ZZD A;  4I0B A;  3E6M A;  2IW5 A;  2P6S A;  2GXG A;  5K5Q A;  1T39 A;  2W25 A;  4ZYD A;  1XD7 A;  3IHU A;  2VT3 A;  4A12 A;  4OIN F;  4YII A;  3JTG A;  3ZMD A;  3GEZ A;  1IRG A;  4M6Y A;  3HTS B;  4AIK A;  2MC3 A;  3TDU C;  2UZK A;  3D0S A;  2IT0 A;  1SAX A;  1YIO A;  2H6C A;  4M74 A;  4EMS A;  4HF1 A;  4AIH A;  2BE5 F;  2VOD A;  2RC4 A;  2FA5 A;  2FF4 A;  1BM9 A;  5L3B A;  2OQG A;  2YU3 A;  1W7P B;  3HSE A;  3U2R A;  4QLC U;  4GCV A;  1ZG5 A;  1F1Z A;  3WTV C;  5KK1 A;  2EFN A;  4OMY A;  2FBK A;  5ILV A;  4RB3 C;  2QQB A;  2A6E F;  3GUD A;  4WX9 A;  1SD4 A;  3WGI A;  1R1T A;  4ENJ A;  4G9Y A;  4RAY A;  4A0X A;  1BI1 A;  4MNU A;  4HYE A;  3GVA A;  3ZN0 A;  4ESJ A;  3K1N A;  3KEO A;  4G6D A;  1SFX A;  2XIG A;  3GZ5 A;  2OQR A;  5LRS A;  3MZH A;  3KP6 A;  3F72 A;  4ETS A;  3K2Z A;  5LEJ A;  3WU1 B;  2DW4 A;  4P9U A;  5CVV A;  3DF8 A;  2GWR A;  2EFQ A;  3VOD A;  4M9S A;  5DV5 A;  4EJV A;  2O03 A;  2HQR A;  2YR2 A;  2HKX A;  1F5T A;  5D5W B;  2P7C B;  3KLO A;  2A69 F;  2BGC A;  3RDI A;  3I71 A;  4HV5 A;  4LLG F;  2DI3 A;  4RB2 C;  3EDP A;  4KMU X;  1IW7 F;  5J8C A;  2XGX A;  5FGM A;  4WF2 A;  3LAJ A;  1G3Y A;  2HYG D;  3M8E A;  5H6Q A;  2D1H A;  3HYI A;  2GA1 A;  4EQQ A;  2LKP A;  3BOQ A;  4RGU A;  3ZMV A;  3TDZ C;  4CZZ A;  4Q48 A;  5ILS A;  4L9V A;  4G7Z F;  4OMZ A;  3PQK A;  2NRA C;  4ENN A;  1KYW A;  2FRH A;  3CUQ C;  1HSJ A;  2KIM A;  5HS9 A;  3DV8 A;  1YQA A;  2Z99 A;  4HV6 A;  4M6X A;  3NRV A;  1YO5 C;  4BHP A;  3ZPL A;  5D6E A;  4BAY A;  3EYI A;  1C0W A;  3KET A;  1PUE E;  3BRO A;  3SQN A;  3N97 A;  1NHA A;  2JZY A;  4M71 A;  3LA7 A;  3WTW C;  4HQE A;  3E5Q A;  3QP6 A;  1ZLK A;  1IN5 A;  1O7L A;  4LB5 A;  2P5K A;  1PP7 U;  1U78 A;  3P9C A;  2A5Y B;  1QNT A;  4LG0 A;  5IT9 Z;  2KIF A;  1JHH A;  5JHU A;  4I0A A;  3J80 K;  2L01 A;  1J7K A;  4PCQ A;  3JSO A;  4UUV A;  2F5E A;  1B9N A;  5DUI A;  3SFZ A;  5HLH A;  4CYD A;  2QWW A;  4HZF A;  3P9K A;  1OR7 A;  3R6S A;  1EH6 A;  1FP2 A;  1ZGJ A;  3K0L A;  2EA2 A;  3ROU A;  3TOB A;  2TDX A;  1JHF A;  3IC7 A;  4U0V A;  1FBU A;  4HLY A;  1TW3 A;  3V7C A;  1WRJ A;  4D0P A;  3KP4 A;  1G3S A;  1P6R A;  1IUY A;  3QP5 A;  5EEH A;  2QQ9 A;  4NQW A;  2M30 A;  2RQP A;  2YX7 A;  5EEG A;  3FX3 A;  3EYY A;  3WTX C;  4ZH4 F;  5F64 A;  3RI4 A;  4B8X A;  3GXO A;  4MEY F;  3GFM A;  1Z91 A;  2VBW A;  4KIB A;  3RKY A;  1MD0 A;  4GXO A;  4YFN F;  2DU9 A;  4P55 A;  1OYW A;  1S7O A;  4EJW A;  2GXB A;  1J0R A;  4XRF A;  4A0Y A;  1AOY A;  3HIF A;  1W5S A;  3F23 A;  4L0Z B;  5D8K B;  4E70 A;  3SZP A;  4G94 A;  2H6B A;  3TQN A;  1MDM A;  2KJB A;  3NQO A;  1WI9 A;  1Z6T A;  1T6S A;  4ON0 A;  4KNY A;  1HKQ A;  3FF5 A;  3KLN A;  5LGT A;  2IA1 A;  1FX7 A;  2V79 A;  5DCF A;  2HS5 A;  3P9I A;  4EJT A;  3KP5 A;  1W5T A;  5L3G A;  1E2X A;  4F7Z A;  3WTS C;  2K86 A;  4L5I A;  2NS0 A;  4HW0 A;  1YFH A;  3F22 A;  1ON1 A;  1ZAR A;  2M87 A;  2O0Y A;  2MA3 A;  2E1C A;  1RI7 A;  1XCB A;  4HAM A;  3I58 A;  4MEX F;  1Z1D A;  2A07 F;  2HOE A;  2RV8 A;  4CXF A;  2BBY A;  2QEN A;  5J6X A;  5DEQ A;  2Z3Y A;  3T5X A;  4WXH A;  5LGU A;  1O57 A;  5ICE A;  3L7W A;  4JQF A;  4QWQ A;  2ESN A;  1XGN A;  3FXR A;  4UVB A;  4IRH A;  3C7J A;  1RUO A;  2E1N A;  2PEX A;  2GAU A;  1ZRF A;  2P8T A;  3BZ6 A;  4OOI A;  1STZ A;  1O3S A;  5A2Q Z;  3U1D A;  2F5D A;  3FWE A;  3TO9 A;  4KFC A;  4G8X A;  1V3F A;  3IRR A;  2PBI A;  4G7O F;  3KP3 A;  1G6N A;  5FFX A;  4EV0 A;  1HBX G;  1BBY A;  2NYX A;  4RB0 A;  3C1D A;  1WQ2 A;  3OOP A;  5JFR A;  3K9T A;  1KU9 A;  2VC0 A;  1OKR A;  2ZFW A;  4Y15 A;  2EFW A;  5LHG A;  3HTU A;  3DKW A;  2H09 A;  2DLL A;  4Z2Y A;  4IJA A;  2G7H A;  2OZU A;  3ZN1 A;  2YSR A;  3CO6 C;  2FXA A;  4UV9 A;  3RTR A;  5LLQ A;  1UFM A;  3HSR A;  5DCM A;  4A6D A;  3M8F A;  2Q8K A;  2EV6 A;  5D5U B;  4I09 A;  1XMA A;  2MLK A;  3B73 A;  4LB6 B;  3MQ0 A;  2X4H A;  1R36 A;  4KYW A;  1TQM A;  1MJA A;  1SMY F;  1D3Y A;  3EQL F;  3V7R A;  4IHT A;  1HW2 A;  3EUH A;  2DFI A;  5HLI A;  2HR3 A;  3HUG A;  1F4K A;  1H0M A;  4HBL A;  4HDU A;  3F6V A;  1RIO H;  4BH9 A;  3CLO A;  1QBJ A;  4FX0 A;  1S7A A;  3LAP A;  2KRF A;  4Q47 A;  4EGZ A;  5E1W A;  3DP7 A;  1ZH5 A;  5BPI A;  3GW2 A;  2VBX A;  3ECO A;  5IT9 K;  1ONV A;  4MTE A;  3E5U A;  5TJJ A;  3BPX A;  1R22 A;  1ZG1 A;  5CYV A;  1L3L A;  2K4B A;  1W7P D;  4WXC A;  1USS A;  2PLY A;  1XB4 A;  3FMR A;  3FMQ A;  3WGH A;  3KZZ A;  1YS7 A;  2OZ6 A;  4G7H F;  1EV7 A;  1DP7 P;  1I5Z A;  4NB5 A;  3F3X A;  4CHU A;  1BIB A;  1HQC A;  2ZNY A;  2MH2 A;  4R1H A;  4I01 A;  2MLG A;  4KIF A;  5BQT A;  3SXY A;  1JGS A;  1OPC A;  4YIF A;  4MHG A;  5BPD A;  2XKP A;  3IKV A;  3HRU A;  1IF1 A;  2ADU A;  3IWF A;  2IVM A;  2OAZ A;  3HHG A;  4PZJ A;  2VN2 A;  5D5V B;  4R8H A;  5E17 F;  3RPU A;  4YFX F;  1PP8 F;  3LQQ A;  5L3D A;  1ZLJ A;  1FWZ A;  2CG4 A;  3JAM Z;  4OIQ F;  2P4W A;  1Z05 A;  5H6R A;  1BC8 C;  4CO8 A;  1DPR A;  1QPM A;  1HW5 A;  5E8G A;  4HLX A;  3MAJ A;  3CDH A;  3EET A;  3W6K B;  2ZJ2 A;  1TW2 A;  4RGX A;  5LHI A;  1FBS A;  5CVU A;  4P5O A;  3QU6 A;  1LEB A;  3KZY A;  1MJ9 A;  4BHC A;  2W24 A;  3T1B A;  3WTU C;  3BP8 A;  4HA8 A;  5H20 A;  4LLN A;  1JE8 A;  2GIV A;  3GWZ A;  4NHJ A;  1UB9 A;  3IL2 A;  2VC1 A;  2GZW A;  3MWM A;  3BJA A;  1BI2 A;  3E97 A;  2E7W A;  1LEA A;  3HRS A;  3R0A A;  2HTS A;  5LRR A;  2ZME A;  2V9V A;  2UXX A;  2FEZ A;  1U3E M;  3IWZ A;  2IA0 A;  3F8C A;  4OIP F;  2IA2 A;  5JR3 A;  4IHS A;  1FSE A;  2CQK A;  4MTD A;  3ABU A;  2MH9 A;  1LDK B;  2XAG A;  3I59 A;  5BOX A;  4O3M A;  3E6C C;  2CFX A;  2XKO A;  1R23 A;  3KEQ A;  4KA4 A;  4XSX F;  1YG2 A;  1ZRE A;  1ZGA A;  4AWX B;  2BEO A;  3H3U A;  3F8N A;  5CVI A;  2OD5 A;  2YPR A;  3LQR A;  2K4J A;  3T0Y A;  2Y0M A;  3JSP A;  3ABT A;  1EH7 A;  2JTV A;  2ISY A;  5BMZ A;  5DUK A;  2HDC A;  3K1M A;  2HFH A;  4LGW A;  5A2Q K;  2EK5 A;  2J5O A;  3V4G A;  1VTN C;  1KGS A;  2MBF A;  2CGP A;  1O3Q A;  3C18 A;  2EV0 A;  3R0J A;  3ISP A;  1RNL A;  2RDP A;  1UST A;  4EJU A;  2DTR A;  3E6B A;  5HS7 A;  4ZZL A;  1XDU A;  4EVI A;  3BWG A;  3WE3 A;  3M7G A;  4Y13 A;  2ELH A;  5DCM B;  2QBY B;  4M9X A;  3TO7 A;  1KQ9 A;  4P96 A;  1J5Y A;  1B59 A;  4BYY A;  2L02 A;  2HKO A;  3BPV A;  3JW4 A;  2L4A A;  4LK0 F;  4U7B A;  5LGN A;  1B9M A;  2WWY A;  4MGR A;  1V4R A;  4RGR A;  2Z9O A;  3V8L A;  1KU2 A;  4RS8 A;  3HOT A;  5FD5 A;  2V1D A;  1QGP A;  5HDN A;  1Y0U A;  5HDG A;  2XAH A;  4H0E A;  2XRO A;  4PGH A;  3GFI A;  1TTY A;  1ZAO A;  1U5T A;  5F6F A;  1Q1H A;  1XDS A;  2DT5 A;  2RVC A;  4EGY A;  3V8J A;  2ACJ A;  3RPQ A;  2BV6 A;  2HEO A;  2FML A;  4HOB A;  4L5J A;  2W84 A;  2QQA A;  3SZT A;  3KP7 A;  2O3F A;  1J75 A;  1U2W A;  2CWE A;  4I7H A;  1TNT A;  1IRF A;  2UXN A;  2VXZ A;  5D8L B;  1G3W A;  1P4W A;  2WTE A;  3E5X A;  2UWM A;  4LK1 F;  5CJ9 A;  1A04 A;  2P7V B;  4I02 A;  1XSV A;  3ZMS A;  5FLX Z;  1JXS A;  5D5X B;  4WK8 F;  3B02 A;  5ICF A;  3WE2 A;  3DQV C;  2XV4 S;  1LDJ A;  3I53 A;  1O3R A;  2GQQ A;  2O8X A;  2J5P A;  2P5L C;  2L3D A;  1S8N A;  1P92 A;  2F2E A;  2NNY A;  1IN6 A;  1QO0 D;  4KDP A;  4XLP F;  4RGS A;  2B0L A;  3KP2 A;  1BIA A;  4BQA A;  3JAM K;  2HZT A;  3ZMT A;  5K5R A;  2E7X A;  2K27 A;  2QYO A;  5L3E A;  1OYY A;  2H27 A;  2AXL A;  1MJB A;  1KA8 A;  3GO5 A;  4TV7 A;  1F9N A;  2M8E A;  2A61 A;  1YW7 A;  2A3S A;  1UHW A;  2VE8 A;  2G9W A;  1E17 A;  3K1P A;  3KE2 A;  2WV0 A;  4PGG A;  4A5N A;  4U0Y A;  2ZME B;  3RIR A;  1XSD A;  5AIQ A;  3C3W A;  1ZRC A;  3R61 A;  3TGN A;  4EJO A;  1T2K A;  3RYP A;  2DPD A;  3BY6 A;  3FM5 A;  3WU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...