4EJWA

Staphylococcus epidermidis tcar in complex with streptomycin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
136
Chain Sequence
RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis rp62a
total genus 47
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejwA00
1SD6A 2LNBA 3M8EA 4MNUA 1ONVA 5HVQC 1FBSA 1IN8A 1XMKA 3B73A 3GLXA 2HYFA 1KQ0A 4RB3C 1TQPA 2G9WA 2EV0A 1KU9A 3REOA 5CVIA 1G4DA 3JTHA 3MAJA 5K5OA 3BP8A 3EETA 2WWYA 3QOPA 3R0AA 2DQRA 2HOEA 1SFEA 1GHCA 4WXDA 5HS7A 3V8KA 2L4MA 4WXHA 1SAXA 2OZUA 4FX4A 4Q4ZF 4KMFA 2PI0A 2HS5A 3F8NA 2NYXA 3FMQA 1DPRA 4GYIA 2Y48A 1S8NA 3ERED 1ZG5A 1FSHA 2QM3A 1YW7A 4IXAA 2GA1A 3DEUA 5BPDA 1KU2A 2NNNA 3BROA 3VOEA 5E18F 3DP7A 3HSFA 5D4RA 1L0OC 3ZMDA 1MDMB 3CUQB 1TQMA 5IT9K 1LDKB 5D5XB 3BJ6A 1EV7A 2QUFA 2NAZA 4M9SA 1J75A 3RI4A 3ZMUA 2D1VA 2DLLA 1HW1A 3F21A 3QU3A 4LG0A 2QWWA 3T1BA 5HLGA 5HLIA 4A0YA 4EGYA 1GVJA 3RPUA 3ELKA 5CVUA 5LHHA 2UWMA 4EM1A 2IT0A 1DDNA 2FMYA 1J9IA 4LB6B 2DQLA 4U7DA 3KEQA 3ZQ7A 2JTVA 2VBYA 1MGTA 5BS6A 4EJWA 2BE5F 2YSRA 3TO9A 3HRMA 5K1YA 2XAFA 4L5IA 1Z91A 1I6XA 3HRUA 3TDUC 3T8RA 3WTVC 3J80Z 2FMLA 1FY7A 3R6SA 2UZKA 2FF4A 5A2QK 1ZGJA 2DW4A 2H6CA 5BMZA 1ZLJA 1E17A 1UCRA 2FEZA 1G3YA 2HR3A 1FLIA 1ZRFA 4RGUA 2QQBA 2ISZA 3GO5A 1Z1DA 1U5TA 5BQTA 2AXLA 1IUYA 3RDIA 4QWQA 3CJNA 1YQAA 3ZP5A 1BI2A 1R1VA 4Z2YA 4ZYEA 1YTYA 1J5YA 4EJOA 2XV4S 3BJAA 4L0ZB 3GFJA 3I64A 2YX4A 3RJPA 1T2KA 3LQQA 1IRGA 3MQ0A 2P5LC 2E1NA 1Q1HA 2FNAA 2XHKA 4MTDA 1IN4A 2Q2EA 3L09A 2P5VA 4I09A 1XDSA 3FX3A 1QPMA 1IN5A 2RDPA 2W25A 2XRNA 1R22A 3CUOA 4GYGA 4PGGA 1XGSA 3BJOA 2R7DA 1KGSA 1WKMA 3WTUC 1WI9A 3COAC 5F1RA 2GQQA 3K9TA 5IT9Z 4NQWA 2VOOA 2KIUA 3I53A 1R1TA 1K7AA 2PQ8A 1BIAA 2DK5A 1Z9CA 1D3YA 2PEXA 1HW5A 3WTTC 3LA2A 3L00A 5L3CA 1H9TA 2IA0A 4UV8A 4HX4A 2QBYA 2HDCA 5DYMA 3V7CA 2EJRA 3QPHA 2Z99A 1T6SA 5FD5A 3KZZA 3R4KA 3WG9A 4Q5SF 2HGCA 4B8XA 4MGRA 5E1ZB 1UHMA 3HSRA 5D8KB 2STTA 2D45A 5LRSA 1ZG3A 3QP6A 2FOKA 1O7LA 2MH2A 3RKYA 3N97A 2E7XA 5LRRA 4N9HA 2VE8A 1PP7U 3K1PA 4KIGA 2IVMA 3CTAA 3MZYA 2ZO4A 1RIOH 5JHUA 2HKOA 4IF4A 3VB2A 3L2CA 2VONA 1QQIA 1A04A 1S3JA 5J8FA 2CQKA 4WK8F 3G73A 4UVBA 3IKTA 3F8CA 3K0LA 1LEBA 1LDDA 1JGSA 2D1HA 4HBLA 5FO5A 3ROUA 3SZTA 1XGMA 2HZTA 2GZWA 1S29A 4HV5A 5FB2A 4HZFA 2DU9A 5HDNA 4I02A 2K4JA 5DCFA 1MJBA 2XIGA 3FXUA 1ODDA 5CVVA 4YIIA 2P4WA 1CGPA 4EJTA 4D0PA 3HOSA 1LVAA 1BC7C 1XMAA 1FNNA 3FHZA 4OMYA 4P5OA 1DP7P 2AS5F 5FLXZ 2F5EA 3RPQA 3IC7A 1P4AA 3CLOA 3KLNA 4A6EA 4XSXF 5KK1A 1TQIA 2CO5A 2H6BA 2IA1A 3DPLC 4YFXF 2L54A 1BJAA 4NB5A 4HOBA 1W4MA 1OYIA 4ZZLA 3K1NA 4XLNF 3IRRA 1F1ZA 4GO1A 2KIFA 2KRFA 2HWVA 2OQGA 1U5TC 4IRGA 3GFLA 3R60A 3J7AO 2EA2A 3I0TA 1XSDA 2JT1A 3MCZA 3M9AA 5LHGA 3HUGA 1I1GA 3KFWX 3GW2A 1TNTA 3MZHA 4KYWA 5EEGA 3LA3A 1RUNA 1HSJA 3WTWC 2ZMEB 3KEOA 1TBXA 3U2RA 3OOPA 3EQLF 2UXNA 1ZRDA 1B59A 4A0XA 4MEXF 4LMYA 1XD7A 1I5ZA 5DEQA 1ZAOA 1Z05A 3WE3A 3C3WA 4PCQA 3IHUA 5IT3A 5L3GA 4ENMA 4CDGA 1FPQA 5D5VB 5J8CA 3TQNA 1FWZA 2Z9OA 3Q5FA 2J5PA 4R1HA 5ICEA 4ESBA 1KU7A 5HDGA 3BOQA 2LDUA 3O2PE 2FU4A 4ENNA 1HKSA 2F5DA 3WGHA 3GWZA 3ZMZA 1R5HA 4OINF 4BAYA 3DPTA 3K69A 1D8KA 3P9KA 4BHBA 4L9NA 1V4RA 2B0LA 5LHIA 4FX0A 4IRIA 5ED4A 4B09A 2W85A 4AIJA 1BI1A 4YFNF 4KT5C 2BYVE 1XSVA 3G3ZA 1SD7A 1YS6A 1T0FA 2EFOA 4LJZF 1SFXA 4ZYGA 1U2WA 2O0YA 5ICFA 4BYYA 2L01A 5JR3A 2F5CA 3RTRA 4HX7A 5E17F 5K5QA 1IXCA 4E70A 2DPDA 2ETHA 1PUEE 3ABTA 2KJCA 2H94A 1QZZA 2XAQA 3JSPA 2V1XA 2CSOA 4ON0A 4L9TA 2DI3A 3F8MA 4JQFA 3F22A 5CVRA 2IJLA 3BWGA 3CO7C 1YIOA 2R7FA 2OQRA 2V6CA 5DUIA 2RQPA 1FOKA 5L3BA 1F5TA 3ZMVA 4A2UA 4I01A 4MTEA 3ZMTA 3BPVA 1P4WA 2W84A 2QQ9A 4RAZA 4M9ZA 1W7PB 2EV6A 2P5KA 4ZZDA 3E97A 5E20A 3CDHA 5CVJA 3SXYA 1YFHA 5DCMB 5D5WB 1KYZA 1BBYA 3M7GA 3I4PA 1D8JA 1OR7A 4KNYA 2A6HF 2LSOA 3KP3A 4O6JA 3TOAA 3I59A 2PN6A 3EYIA 4HW0A 5FFZA 4CZZA 4KA4A 4U0YA 2K4BA 1ZLKA 4LLLA 3W6JB 5EEHA 1CF7B 1KQ8A 3GF2A 3WU0A 1W7PD 1HSTA 1YO5C 3T8TA 4HF2A 3D0SA 1SMYF 1BC8C 4KICA 3GXOA 3TO7A 1JHHA 3WGGA 3KP6A 1SMTA 2ZXJA 2UXXA 1BOAA 4S04A 1WSUA 1JHFA 2L02A 4OIRF 1SD5A 1YYVA 1R5GA 2VOPA 5E1XA 5ILVA 2JPCA 3WTSC 4WX9A 1HXDA 4MQVA 5HS8A 2EV5A 2PLYA 5FGMA 2QVOA 2VBXA 3KE2A 4G6QA 1R7JA 2XAGA 2XKOA 3R0JA 1BM9A 1FYKA 3TOBA 2BV6A 2Y75A 3ULQB 5CJ9A 5BPIA 1HBXG 4RB0A 2EWNA 4KN7X 1BI0A 3LAJA 3ISPA 5F6FA 4BNCA 4HAMA 1BIBA 1FX7A 2BBYA 5JVTA 2CFXA 3V4GA 4I0BA 2GAUA 3JTGA 1J7KA 2HQNA 2DPUA 2VT2A 4ZYDA 3RYRA 1HKQA 3F6OA 1K78B 4OIOF 1RNLA 1K79A 3T0YA 1JXSA 2JZYA 3HHHA 1YW8A 3K1MA 4M71A 4LGWA 3PQKA 4AIHA 1ZARA 4RAYA 2XUBA 3HRSA 1DUXC 1QO0D 4G8XA 4M74A 2QENA 4LK0F 1C0WA 4LFUA 4LD5A 2ZFWA 2H09A 1W7PA 1MD0A 4YFKF 1MDMA 3CUQA 3GUDA 1ZH5A 1P92A 5AONA 5K5RA 1TTYA 4JBAA 1RUOA 1XGNA 1UFMA 3ZPLA 4RGSA 3BDDA 2NRAC 2A5YB 3ZN1A 4G6DA 3E6BA 2RN7A 4ENJA 5L3FA 4PZJA 3NRVA 4LLGF 3DQVC 1O3QA 4MQ9F 5LGUA 4HA8A 2XVCA 3GFMA 5J6XA 4ZH4F 2P7CB 5CYVA 3QPTA 3PFIA 1LJ9A 3E6CC 2JPBA 3F8BA 3WTZA 4G7OF 1UB9A 3SHFA 2YU3A 4EV0A 3VEPA 3I54A 2M5WA 2CGPA 5LEKA 4HQMA 1J59A 4Q48A 4ASNA 2ESNA 2FBIA 5A2QZ 2PMUA 3DV8A 5HOOA 1G3TA 1AWCA 2GA2A 3N4MA 5DD8A 4AVPA 2XAJA 4OIPF 1WWXA 4N9IA 2WC2A 1B9NA 3MFKA 5HS9A 2A07F 3P7NA 1MKMA 4HLYA 1TLHB 4BQAA 4U88A 1R23A 1ULYA 1FYLA 4UXNA 5D5UB 2O8XA 2O03A 2RGVA 1K6OA 4L0YB 4U0WA 1IRFA 2HEOA 4U7BA 2IA2A 2A61A 4UUVA 2NS0A 2MC3A 1RZ4A 2QLZA 4DQ2A 1H0MA 1ZYRF 4WF2A 2FSWA 3NEUA 5LGNA 2FRHA 3LFKA 2RKHA 3FM5A 5L3DA 4L18B 1QBJA 4PDKA 2A6EF 4PGHA 1BI3A 5ILSA 1YS7A 2MLKA 3RIRA 3T5XA 3QP5A 3BPXA 4G7HF 3SFZA 2BEOA 2YPRA 5ILUA 2FBHA 3L9FA 4UHTA 1S7OA 2O6GE 2R3SA 4ENKA 3JAMK 2NNYA 1OYYA 1XCVA 2G7UA 2QZ8A 4FHTA 1O7FA 3LSTA 2P6TA 1B9MA 1SFUA 1IAWA 2CYYA 3U9GA 1DPUA 1ON1A 2EK5A 2JRTA 3D5LA 4U0VA 4I98B 1I27A 3ECOA 5LGTA 4IHSA 3SZPA 4HDUA 4L9JA 4LK1F 2RV8A 2V1UA 1IXRC 1REPC 3J81K 3HYIA 2PG4A 1T39A 2XROA 4CO8A 4I7HA 4ZYHA 5TRDA 2P7VB 5H6QA 3F23A 3GFIA 5AIQA 3W6KB 5E8IA 3Q9VA 5LBQA 3CUQC 3ZMSA 4Q47A 3RYPA 3IWFA 4EM2A 1ZRCA 1W5SA 2RC4A 2XAHA 2DAOA 2IRFG 2PBIA 5LLQA 2MLGA 1I1SA 4EQQA 3GEZA 1TW2A 4AWXB 2VODA 1ZN2A 3Q9SA 4YG2F 3CO6C 5BOXA 1O57A 4CHUA 2ISYA 5HDKA 5ICCA 1LDJA 5HLHA 5DV5A 2HYGD 3HHGA 4FT8A 4EJVA 1KA8A 5D8LB 3I71A 4RS8A 3TGNA 3WTYC 5LEJA 4BHCA 2A3SA 5F64A 3V8JA 4HLXA 3KLOA 3HTSB 2GIVA 1YW9A 1KYWA 1AOYA 3R61A 2Q0OA 3TDZC 4OU0A 1U78A 3QRFF 5ICGA 1VTNC 2OAZA 2DFIA 3HOTA 1FC3A 2QQAA 4MEYF 3IL2A 1U5TB 4XLPF 4M6YA 4KMUX 1TNSA 4KUMA 1XGOA 2HQRA 4KDPA 1EH8A 2X0LA 1S7AA 2KIMA 1OYWA 2L3DA 1Z6RA 2C6YA 3ML6A 2K27A 4EVIA 1R00A 2KKOA 2WV0A 3TKYA 2DO7A 1IN7A 3GZ5A 1Z6TA 3FZVA 2CW0F 4L5JA 2LF8A 4O5VA 3JAMZ 4Y15A 4HF0A 1XN7A 2DTRA 1F4KA 2DBBA 4YIFA 4UV9A 3C1DA 2ZNYA 1R58A 4KIFA 2M87A 4RGXA 3FMRA 1OPCA 1FZPB 1WRJA 1IW7F 2VBWA 4KFCA 4F7ZA 1HW2A 2ZMEA 3E6DA 1XSXA 1ZREA 2F5FA 3KETA 5JFRA 4DNCA 1FP2A 4HV6A 3J81Z 1F9NA 3WTXC 3V8LA 3HTUA 2FXAA 2VE9A 2QBYB 2OBPA 1USSA 1T38A 1XCBA 4IHTA 1JE8A 2ZCWA 1J2XA 4HDVA 4KN4X 2ELHA 2YR2A 1V3FA 4UVAA 2RNJA 2EFWA 4QLCU 2FA5A 1STZA 1TW3A 1LB2A 2P6SA 4EJUA 2D2WA 4CGZA 3WODF 2PMHA 2F2EA 1FT9A 3FXQA 3FXRA 2M45A 2CWEA 4IVNA 4XSZF 3O6BB 5DDGA 1S6LA 1QNTA 2LKPA 2M1BA 2H27A 1U6GA 4RB2C 1SD4A 3IWZA 3H3ZA 5JI6A 3QU6A 1BN5A 4TV7A 6PAXA 1U3EM 1RI7A 1EH6A 2MA3A 2GXGA 3E5QA 3GX4X 1G6NA 1G3WA 3E6MA 3E3VA 3DKWA 3FF5A 2VXZA 3AAFA 4WWCA 4ETSA 3GZ6A 2TDXA 1U8RA 3WU1B 2XGXA 4N0BA 3KZYA 3F8FA 5AIPA 3I5UA 3FWEA 5TJJA 5L3EA 1FBUA 3EUHA 1IF1A 2G7HA 1PP8F 4IJAA 1X3UA 5E8GA 3OV8A 4P9FA 4I2OA 3K2ZA 4M9XA 1KU3A 2ADUA 2V79A 3EYYA 1FBQA 3LQRA 5FFXA 1USTA 2ESHA 4NHJA 2FBKA 3F6VA 3BZ6A 3V7RA 4BHPA 3C7JA 2PJPA 4JK1X 2HTJA 3LAPA 3FMSA 4CYDA 4CICA 4RB1A 2XASA 4I0AA 1Z7UA 1PDNC 3EDPA 4OIQF 4G9YA 3WE2A 5FLXK 2J5OA 3MWMA 2HTSA 2V9VA 1IN6A 1ZGAA 4S05A 3U1DA 2MBFA 1R1UA 1Y0UA 2KJBA 3PQJA 1P2FA 3JW4A 2O61A 5DCMA 1W5TA 3ZN0A 3LWFA 3VFZA 4G7ZF 2ZNZA 2BGCA 2XKPA 1E2XA 3DF8A 2K7LA 2GWRA 3F72A 1B4AA 4P9UA 1EH7A 4GXOA 3F3XA 1IZ1A 1O3SA 2ZJ2A 4HYEA 4LB5A 3IKVA 5KVRA 2OD5A 3LA7A 1LQ1A 4O3MA 3QAHA 1QZYA 1CF7A 3I58A 3HIFA 3NQOA 3VODA 4ESJA 1XDUA 2HFHA 4M73A 1ON2A 2K02A 1QGPA 2QYOA 4A5MA 2EFQA 4HF1A 2HKXA 1ZHFA 3B02A 2EFPA 2FQ3A 3V7SA 4EM0B 3HRTA 3ECHA 3C18A 3P9CA 1XB4A 4HX8A 1LNWA 1GXPA 3H92A 1FSEA 5E1WA 2Z33A 2JSCA 4M6XA 1LEAA 2EFNA 4XRFA 5DUKA 3L7WA 1H9GA 2VBZA 1HKTA 1P4XA 1O3TA 4OOIA 5D6EA 4BH9A 3DXJF 5H20A 1YG2A 2K86A 2EA4A 1D5VA 5CLSA 3IRQA 4R8HA 2EB7A 3FM3A 4GGGA 4LLNA 4UNOA 2E7WA 1MJ9A 4IPAA 4Y17A 2V1DA 1K78A 2FE3A 1WQ2A 4XBFA 4G94A 1FP1D 3TO6A 2Z5UA 3WGIA 1B1BA 5DD4A 2CG4A 2IW5A 3HSEA 2M8EA 4L9VA 2PFBA 4RGRA 2LF7A 3E5XA 1J0RA 5H6RA 1HQCA 4A0ZA 4BXUA 4A6DA 5FD6A 1OKRA 5D4SA 1L3LA 2RVCA 4K2EA 3M1EA 2WTEA 3KP2A 1YLFA 4A12A 2O3FA 3P9IA 4Y13A 3RKWA 2X4HA 2YX7A 4CXFA 2STWA 1T98A 3DFGA 4EMSA 3GYHX 2W24A 4P96A 2GXBA 4HQEA 1O3RA 2DT5A 2IP2A 2FNPA 1OMIA 2MH9A 3BY6A 4MHGA 2Z3YA 4ESFA 2COMA 4M72A 2P8TA 2DK8A 1P6RA 2W57A 4LG0B 1B6AA 3M8FA 4A5NA 3SQNA 1MZBA 1FYMA 3RKXA 3I59B 1UHWA 4GCVA 3H3UA 4WCGA 2ZKZA 1NHAA 4OMZA 1ZG1A 2M30A 4P55A 4R79A 4UVCA 1MJAA 2ACJA 3MEXA 4WXCA 1R36A 4H0EA 2IPQX 4KIBA 3E5UA 2Q8KA 2VN2A 3JSOA 3KP4A 1GXQA 4IRHA 4EGZA 5ERIA 2MD5A 3KP5A 4AD9A 5D6FA 1KQ9A 2ZBKA 3O3KA 1IXSB 2VC0A 2OZ6A 2A68F 2VC1A 2VT3A 2L4AA 2OA4A 2E1CA 3KP7A 3S2WA 3KCCA 3J80K 2Y0MA 2OU2A 4AIKA 3ABUA 1G3SA 2A69F 3GVAA
chains in the Genus database with same CATH superfamily
3DU6A 1SD6A 4C2UA 1UZCA 2LNBA 1VQ8I 4IHYA 3M8EA 4MNUA 1ONVA 3K4JA 5HVQC 1FBSA 3PSFA 1KONA 1IN8A 1P7JA 1XMKA 4UB8C 2X85A 2OUMA 2Y0SN 3B73A 2HYFA 2BY0A 2WA0A 3FIWA 3GLXA 2XGDA 1KQ0A 4RB3C 5J1UA 1TQPA 3X2QH 2G9WA 2DFEA 2NVXJ 3BTIA 1ITYA 4BJTA 1OCCH 1NH3A 3I9V2 1V5EA 1RRJA 2E2HJ 2EV0A 3D5SC 1KU9A 3REOA 5CVIA 1G4DA 3JTHA 3MAJA 5K5OA 4M6VA 1FMWA 3BP8A 3EETA 2WWYA 1H89C 5F1JA 3QOPA 3ZQQA 3W2VA 3R0AA 3UNGC 5HLTA 2DQRA 2HOEA 1SFEA 1GHCA 4WXDA 1YIJI 5HS7A 4BE1A 3V8KA 3BTJA 1MBFA 2L4MA 1X19A 4WXHA 1YJWI 1SAXA 1ZK8A 2OZUA 4FX4A 3WHBA 5F0FA 2QEXI 3DWLE 4Q4ZF 4KMFA 1X1PA 3L1PA 1OCOH 3K4MA 3SEQA 2MG4A 3FBIB 4DZJA 2PI0A 2HS5A 3F8NA 2NYXA 4E7ZA 3HBLA 3FMQA 1DPRA 4GYIA 1MBJA 2ZJPF 2Y48A 3OR2C 2IS6A 1S8NA 1MMDA 3ERED 2LVSA 4MO7A 1ZG5A 1FSHA 2QM3A 3VPRA 4QPQA 1YW7A 4IXAA 2L9VA 1MBKA 2GA1A 3DEUA 3KYCB 5EGOA 5BPDA 2VUMJ 2VQHA 1KU2A 1YITI 3CC2I 2NNNA 3O8GA 3BROA 3VOEA 4DYCA 2DMQA 5E18F 2JQ7A 1N75A 2LTPA 3OYBA 4PUSA 1YOVB 2IGKA 2VB6A 2DCEA 4NBQA 1QHHD 2K9QA 3DP7A 2L0KA 4C3JJ 3S15J 3HSFA 2BHZA 5D4RA 2KFDA 2X6YA 1L0OC 3ZMDA 2NVTJ 1MDMB 3CUQB 4JP0A 2L7KA 3S14J 1TQMA 2ZSHB 5IT9K 4D5CA 3VDXA 2EILH 1W0UA 1LDKB 1MNEA 5D5XB 3BJ6A 3TL4X 4RDUA 4CCLA 1IJWC 2CW7A 2JWTA 3H9JA 3S1RJ 3AL0C 1EV7A 2RNGA 3CJRB 2QUFA 2NAZA 4M9SA 4BQQA 3JR9A 1J75A 2R7TA 1VI0A 2ICWG 3RI4A 4CCMA 1Z7LA 4HNUA 3ZMUA 2D1VA 2NS7A 3IV5A 2DLLA 2QCOA 1HW1A 2UUZA 2AHQA 3HZJA 3QU3A 2NVYJ 4LG0A 3F21A 2KISA 1FJLA 3VWBA 2QWWA 4A69C 1WJCA 2ZXIA 2KQRA 1UJ8A 3BTLA 3RZOJ 2NVUB 4XRSG 3T1BA 5HLGA 1T95A 1U8BA 1O4XA 5HLIA 1HLVA 4A0YA 1VQ6I 1A5JA 2LYCA 2LC2A 2R7XA 3OYMA 1VQNI 4EGYA 1YRNB 1GVJA 1XC5A 3RPUA 3CP8A 3ELKA 5CVUA 5LHHA 2UWMA 3TBIA 4EM1A 2MYSA 2IT0A 1DDNA 4A3MJ 3BR5A 2X1CA 4CH7A 2NXNB 2FMYA 4BY7J 4X6AJ 1J9IA 4LB6B 2DQLA 2TRTA 4CYCB 4U7DA 1GUUA 3B6CA 3KEQA 3ZQ7A 3FXKA 3O8HA 4ABZA 2JTVA 2VBYA 1MGTA 4EJWA 2BE5F 5BS6A 2YSRA 3TO9A 3HRMA 5K1YA 2XAFA 4L5IA 4II2A 2XC7A 1K4TA 1Z91A 3QPLA 1I6XA 4JX5A 3HRUA 3SYTA 2O8KA 1NTCA 4XORA 3TDUC 3T8RA 3WTVC 1GT0C 3J80Z 2FMLA 1FY7A 3R6SA 4J01A 2B63J 3H5AA 3UKGA 3S1MJ 5CKTA 4XM3A 3OSFA 4E6KG 2UZKA 2NOGA 2WAQN 2FF4A 3D5RC 1MH3A 5A2QK 3CCEI 3H5NA 1ZGJA 2DW4A 3RCOA 2H6CA 1TL8A 4B4CA 4HPQA 3FK7A 3OYEA 5BMZA 1RR8C 3RKQA 1ZLJA 2OC6A 1Z21A 2H8WA 4CZCA 1E17A 3ABMH 1UCRA 2FEZA 1ZTRA 1G3YA 2HR3A 1V5FA 4BU2A 1FLIA 4FE7A 3KYLA 3SDGA 1ZRFA 1AA7A 4RGUA 2QQBA 4AVZA 2ISZA 1K6YA 2L7MP 3GO5A 4BACA 1Z1DA 3BCAA 1U5TA 1LVKA 5BQTA 2AXLA 1IUYA 3M8JA 3E0JB 3CJNA 1YQAA 4QWQA 2HQ5A 3CJTB 3RDIA 3ZP5A 1BI2A 5FKLA 1R1VA 1WJDA 2QA4I 4Z2YA 3LOCA 4ZYEA 1YTYA 3LSHA 3BG7A 2DMUA 5F0CA 1J5YA 4CCJA 4EJOA 2DA2A 2XV4S 1KZHA 3BJAA 2R7RA 4L0ZB 3ASOH 3GFJA 5HODA 3I64A 2QSFX 2HVRA 2YX4A 3RJPA 1JGGA 4IKFA 1T2KA 1F36A 4BEHB 3LQQA 2X1EA 1IRGA 3MQ0A 2P5LC 1ZKGA 2E1NA 1Q1HA 4H4KC 2F48A 2FNAA 2XHKA 2NS8A 3BR6A 4MTDA 1IN4A 1X1DA 2Q2EA 4BBRJ 3L09A 3OYLA 2P5VA 4I09A 1Y1VJ 3CF2A 3CCJI 2L5QA 5M3MJ 1XDSA 3FX3A 3MKWB 2MC4A 4FQGA 1OJLA 1LKXA 1QPMA 3LSRA 2GIZA 1IN5A 4YRVA 2RDPA 5TISC 2W25A 3RQ4A 4DIQA 2XRNA 2BW3A 4AC0A 1R22A 3CUOA 4GYGA 4PGGA 2QSHX 1XGSA 3BJOA 2R7DA 1KGSA 1Y8RB 1WKMA 3WTUC 2R93J 1DQUA 1WI9A 3COAC 5J47A 5F1RA 2GQQA 2XGEA 3K9TA 5IT9Z 4NQWA 2VOOA 3GZNB 2KIUA 1MNMC 3I53A 3PNVA 4LIUA 1R1TA 5K7ZA 1K7AA 1P7IA 2AO9A 3DCFA 2PQ8A 2O7OA 2AQFA 1BIAA 1ETOA 3D1NI 1JUPA 4HRIA 3HUGB 5IPAA 2DK5A 1S72I 1Z9CA 1D3YA 2RREA 2PEXA 4LOCA 3PNYA 1HW5A 4D7MA 1D1AA 3WTTC 3LA2A 2R0QC 1OCTC 3L00A 5L3CA 4ZJZA 1H9TA 2IA0A 4UV8A 4HX4A 3MKYB 2QBYA 5FLMJ 2HDCA 3M07A 5DYMA 3V7CA 2EJRA 1PJRA 1LUJB 3QPHA 2MD0A 1X4OA 2K9NA 1VQ4I 4BKXA 3A4CA 1ZGWA 2Z99A 1T6SA 4ZYAA 5FD5A 3KZZA 3R4KA 3WG9A 4Q5SF 1XTAA 3BCBA 3CQZJ 2HGCA 4B8XA 4MGRA 4QPOA 1IG7A 5E1ZB 1UHMA 3HSRA 5F27A 5D8KB 2K9SA 3EPZA 2STTA 2D45A 4P1WA 4OWRB 1YHQI 3K70C 3CCSI 3LL7A 5LRSA 1ZG3A 3QP6A 2FOKA 1MNDA 1O7LA 3BQYA 1JUMA 3I55I 2MH2A 3LSGA 3RKYA 3OYAA 4ZDOA 2ELKA 4UB6C 3N97A 2E7XA 3VYUB 5LRRA 2LFBA 4A3LJ 4N9HA 2VE8A 1PP7U 5M3FJ 3PL8A 3GMEA 5B1AH 3K1PA 1IDYA 2QGUA 4KIGA 1DP3A 2IVMA 1ETWA 3CTAA 2BY2A 3MZYA 4XLAA 2M2EA 3OMYA 1K61A 1LE8B 2ZO4A 1RIOH 3MKZA 3WHCA 5JHUA 3K4NA 3W2WA 1AHDP 2MW8A 2HKOA 4IF4A 1NG7A 3L2WA 2VJ4A 3ABLH 3M1CA 4JX4A 2CUJA 3VB2A 3L2CA 2VONA 1QQIA 1A04A 1S3JA 3ZRGA 3NARA 1IRZA 5J8FA 2M7BA 2HI3A 2CV2A 2CQKA 4WK8F 3OSGA 3IP4B 1IDZA 3G73A 4UVBA 1JKRC 3IKTA 3F8CA 2VKDA 3K0LA 1LPQA 1LEBA 1LDDA 1JGSA 2D1HA 1HC8A 2CUZA 3IAM2 4HBLA 5FO5A 3ROUA 5GTHC 1T56A 1TT0A 4NUBA 5DS9A 3SZTA 3OYCA 4ZTFA 4JOMA 1XGMA 4HNTA 2HZTA 2GZWA 1S29A 4HV5A 5KAFC 5FB2A 4DGWB 3BT9A 4HZFA 4CCNA 2DU9A 5HDNA 3KPHA 4I02A 4KITB 2K4JA 2HNHA 2V1NA 1D0ZA 5GAGJ 1MMSA 3ZQGA 3ZCOA 2Y9YA 2LBFA 3FKJA 5DCFA 1BOBA 1X1BA 2KZGA 1SFOJ 1MJBA 2XIGA 3FXUA 4MLOA 2LG4A 1ODDA 5CVVA 5J40A 4YIIA 2R5YA 2P4WA 3PSIA 1F43A 1G59A 1CGPA 3ZXSA 2JUCA 4N4OB 2WBMA 4BDYA 3NAUA 2VJIA 4KJZA 1ZR4A 4EJTA 2R92J 4D0PA 3HOSA 3ZGKA 1WVRA 5E3MA 1LVAA 1OCRH 1BC7C 1XMAA 2E2IJ 1FNNA 2I10A 3FHZA 4OMYA 3HL2A 4P5OA 5C4XJ 4GRIA 4RAGA 1DP7P 2AS5F 1N77A 5FLXZ 2F5EA 2WADA 1DGWY 3RPQA 3IC7A 3S3OA 1P4AA 3CLOA 3KLNA 4A6EA 4XSXF 3OYHA 4IHXA 3FXMA 2E36A 5KK1A 1TQIA 2CO5A 2H6BA 2IA1A 3DPLC 4YFXF 2L54A 1BJAA 4NB5A 4HOBA 2DA1A 1W4MA 2DMPA 1OYIA 3GBGA 1SVOA 3A02A 4ZZLA 3K4CA 2HPMA 3K1NA 4X1EA 4XLNF 3IRRA 1F1ZA 4GO1A 3A01B 1OISA 1X3WB 2KIFA 2KRFA 2HWVA 2OQGA 1U5TC 4IRGA 4A3EJ 3GCMA 3GFLA 3R60A 2E2JJ 2O5RA 2XAUA 3J7AO 2EA2A 1QHGA 3E7LA 3I0TA 1XSDA 2JT1A 3MCZA 3M9AA 1E3OC 5LHGA 3HUGA 1ZQ3P 1I1GA 3ZQHA 3KFWX 3GW2A 1G8XA 1X3ZB 1TNTA 3MZHA 1IRXA 4KYWA 5EEGA 3LA3A 1RUNA 1HSJA 3WTWC 2ZMEB 3KEOA 1TBXA 3U2RA 3OOPA 2EZLA 1H88C 2LKSA 3EQLF 1FOWA 2UXNA 1ZRDA 4D9JA 1B59A 4A0XA 1W0TA 4MEXF 2DFFA 4BJ5C 4LMYA 1XD7A 4GDFA 1I5ZA 5DEQA 5GTIC 2EBIA 1ZAOA 1Z05A 3WE3A 4I6ZA 4A3JJ 1FTTA 2ZFUA 2F6CA 4UY8I 3C3WA 4XMYA 1FOXA 3KYDB 2X51A 4PCQA 2WAQA 3IHUA 5IT3A 1DGRM 4PJ0C 3JRHA 5L3GA 1YX5A 4ENMA 2B9SA 2CV1A 3OIOA 4CDGA 1FPQA 5D5VB 2IGOA 5J8CA 3TQNA 1YX3A 1FWZA 3EUAA 2Z9OA 3OS0A 3JRBA 3Q5FA 2J5PA 3LMMA 3AG2H 1GV5A 2PJRB 4C3IJ 4R1HA 3HM5A 5ICEA 3GTPJ 2R7QA 4ESBA 1Y39A 1KU7A 3CLQA 1LFPA 5HDGA 3BOQA 5FKMA 2CJJA 3BR3A 2EZHA 4AYBN 1LE8A 2LDUA 3O2PE 2FU4A 4ENNA 2GOMA 1Z77A 2KP6A 1HKSA 3H36A 3ASNH 9ANTA 2F5DA 3WGHA 3GWZA 4IHWA 3ZMZA 1R5HA 2QKLB 1RETA 2E60A 3DPTA 3K69A 4OINF 4BAYA 1D8KA 3P9KA 2XF7A 4BHBA 3CD6I 3PIOF 4L9NA 3A1YA 4IQ4A 1V4RA 2B0LA 3EUKL 5LHIA 4J00A 2M9HA 2M0MA 4FX0A 2LOOA 4IRIA 3S2DJ 5ED4A 3V42A 4B09A 2W85A 2TCTA 3W6VA 4AIJA 1DU6A 2HXIA 5GPCA 1TC3C 4XOPA 1BI1A 4YFNF 4KT5C 4V2GA 2BYVE 3KIOA 1VFCA 3TEDA 1XSVA 2IBDA 2W82A 3G3ZA 5IP6A 1SD7A 2GOXB 1YS6A 2X6OA 3VSLA 1T0FA 2EFOA 4LJZF 4B47A 1SFXA 1U2WA 4ZYGA 1NG6A 2O0YA 4XN3A 2BVLA 5ICFA 4BYYA 2L01A 3QOEA 5JR3A 4IX7A 2F5CA 3RTRA 4HX7A 5E17F 2A6TA 5K5QA 5CQEA 1IXCA 5EZGA 4E70A 2DPDA 5FKNA 2LKXA 1A6QA 2ETHA 1PUEE 3ABTA 3PFYA 3RQIA 4FCYA 3OIQA 5KHDA 2HDDA 3ZQCA 1R71A 2KJCA 2H94A 2EIKH 5EF6A 1QZZA 2XAQA 5K7HA 2CFOA 4DW6A 3JSPA 1VQPI 2V1XA 2CSOA 2HVQA 3HPHA 2V9KA 3LSIA 2RAEA 3DBLB 4ON0A 2LRDA 3Q0VA 3LNQA 2M3AA 4L9TA 4XLEA 2DI3A 2GBYA 2JVGA 3F8MA 4JQFA 2DYSH 5CVRA 3F22A 2IJLA 3BWGA 2DMTA 3FK6A 3CO7C 1RPWA 1YIOA 2R7FA 1UG0A 2K85A 2E1OA 2OQRA 5FLVA 2V6CA 5DUIA 5KCMA 2RQPA 3S32A 1FOKA 2VKEA 1V54H 5L3BA 1F5TA 2CQNA 1SEUA 4DOZA 3ZMVA 2Q1ZB 1VQ9I 3H35A 2CRGA 4A2UA 2Y30A 3K4LA 4I01A 4MTEA 3ZMTA 3BPVA 1P4WA 2W84A 2QQ9A 1B8IA 4I99C 1X2MA 1SAUA 1W5CC 4PJLA 5EDNA 3J7AY 4NDLA 1TWFJ 4RAZA 2JA7J 4HSTA 4M9ZA 1W7PB 1Z3XA 2EV6A 2P5KA 4ZZDA 2R7UA 2ZJQF 3F9KA 3SEZA 3E97A 1NK3P 3IH4A 3H9QA 1QA6A 3BC8A 1HOMA 5E20A 3AFHA 3CDHA 2WY8Q 1I50J 1IO2A 5CVJA 4IQJA 4ZDLA 2NOJB 2DA6A 5E3NA 4BE2A 1I3QJ 3SXYA 1YFHA 3JCUC 5DCMB 2K3PA 5D5WB 2BXYA 1KYZA 1BBYA 1LFUP 4XQFA 3G71I 3M7GA 3I4PA 1D8JA 1OR7A 1W36C 4KNYA 5IP9J 2A6HF 2LSOA 4MFDA 3KP3A 4O6JA 3TOAA 2AXTC 2XPUA 2E5ZA 4XK4A 1R4NB 3MN2A 3I59A 2B7EA 2PN6A 3EYIA 1VQLI 3DU5A 4HW0A 3OYFA 1BR2A 1PUFB 5FFZA 4CZZA 4KA4A 3C2HA 4U0YA 2JRMA 4UUSB 2K4BA 1ZLKA 5EG0A 4PJJA 4LLLA 3W6JB 1AU7A 2ZXWH 1GVDA 1B72A 5EEHA 3BG9A 1CF7B 1KQ8A 2LD5A 4XKCA 2EZKA 2W4SA 3GF2A 3WU0A 1ENHA 2JMWA 1W7PD 4II3A 2PJRA 3BQZA 2ECBA 1HSTA 1YJ9I 1YO5C 4ZDPA 3HEFA 3T8TA 3DKYA 4HF2A 3HJEA 1T8IA 3D0SA 1SMYF 2OCCH 4KICA 1BC8C 3GXOA 3U21A 3OY9A 3TO7A 1JHHA 2QF7A 2CS3A 3FISA 3WGGA 2VJJA 3OYIA 3KP6A 1SMTA 2ZXJA 2UXXA 1BOAA 4S04A 1WSUA 1JHFA 2L02A 4OIRF 3S3MA 1SD5A 1YYVA 1R5GA 2VOPA 5E1XA 5ILVA 3QYFA 2JPCA 3WTSC 5C44J 4WX9A 1HXDA 4MQVA 5HS8A 2EV5A 1V5GA 2PLYA 4RM3A 3W2AA 4RA2A 5FGMA 2QVOA 2VBXA 3KE2A 4G6QA 3S2HJ 1R7JA 2VIXA 2XAGA 2HU9A 2XKOA 5TGTA 3R0JA 2X6WA 1BL0A 1BM9A 2X1DA 1FYKA 3TOBA 2BV6A 5FRNA 3PO3J 2Y75A 3ULQB 5CJ9A 1ETVA 5BPIA 4B44A 3BG6A 3MMYB 3OYDA 1HBXG 1FTZA 3HPGA 1ETQA 2EWNA 4RB0A 4OAYA 1HDPA 3HXLA 3DLAA 4KN7X 3GTJJ 1BI0A 3LAJA 3DPUA 3WU2C 1JKPC 3OR1C 3ISPA 5F6FA 4BNCA 5M5WJ 4HAMA 2HOAA 1BIBA 1FX7A 2BBYA 5F0HA 5JVTA 3LSJA 4B48A 5HNHA 1IGNA 4QTRA 2IS2A 5KNLA 2V7FA 2CFXA 3C2BA 2VL8A 4I0BA 3V4GA 5J4VA 1N25A 1VF9A 2GAUA 2DA7A 3CCRI 3JTGA 3CCVI 2Y69H 1J7KA 2HQNA 3IAS2 1JJ8C 2VT2A 2DPUA 4FISA 4HNVA 4ZYDA 3RYRA 3PJRA 2DOFA 1HKQA 1Y56A 3F6OA 3S3NA 1H8AC 1K78B 4CA0A 4OIOF 1RNLA 3U1KA 2FQ4A 1K79A 3CCYA 3T0YA 1JXSA 2JZYA 3HHHA 1YW8A 3H1CA 3K1MA 4M71A 2K9MA 4BUPA 4LGWA 3PQKA 3AL0B 1MBEA 3S8PA 1XG1A 3ERMA 4AIHA 3PIPF 2V26A 3G2BA 1ZARA 4RAYA 2XUBA 3HRSA 1RC9A 4MFEA 1DUXC 3G1LA 4GFBA 1QO0D 4XKBA 1T0FC 3ZR8X 2KHMA 4G8XA 4M74A 3E1SA 2QENA 2VPLA 4LK0F 1ERDA 4E7LA 1C0WA 1MMAA 4LFUA 4LD5A 2BY3A 2ZFWA 2H09A 3SZGA 1W7PA 1MD0A 3DKXA 4YFKF 1MDMA 3FXOA 3CUQA 3GUDA 1ZH5A 3S1QJ 1P92A 5AONA 1XX5A 3IUOA 5K5RA 1TTYA 4JBAA 3FXJA 5E3OA 1RUOA 1XGNA 4V19K 1UFMA 2MABA 3ZPLA 3BG5A 4RGSA 4A3FJ 1YJNI 3M4OJ 2V9PA 3BDDA 4FETA 2DA3A 2NRAC 2A5YB 4AYBA 3ZN1A 2VASA 1MMGA 4G6DA 3E6BA 2KDZA 2RN7A 3OYNA 4ENJA 2HOTA 5L3FA 3JRFA 4NC7A 4PZJA 3NRVA 3HGYA 1NK2P 4LLGF 1RESA 4FASD 1FOYA 2JJ7A 3DQVC 1O3QA 3MKLA 4MQ9F 5F08A 3OYGA 4M3DA 5CQGA 5LGUA 3BTCA 1QRYA 4XL9A 4HA8A 1HCRA 1GDTA 1UG2A 4IO9F 2XVCA 3Q0UA 2QKMB 5IOZA 3FKIJ 3GFMA 4KT6A 5J6XA 4ZH4F 3AG1H 2D5VA 4DJAA 1D1CA 1YE9A 2CQQA 2XPWA 3LFUA 2P7CB 5CYVA 1YRNA 3QPTA 1JUSA 4DBQA 4RMNA 2Y0SA 3PFIA 2HVSA 1LJ9A 3E6CC 4QIWN 2JPBA 3KX2A 2CU7A 4CYCA 1TZLA 4FE4A 4F93B 4D5FA 3F8BA 3WTZA 4F91B 4G7OF 1UB9A 3SHFA 2ZB9A 2YU3A 4EV0A 1BA5A 4BQOA 5J1YA 5E79C 3VEPA 2XF6A 3I54A 2M5WA 2P81A 2CGPA 5LEKA 3PUBA 4HQMA 1JT6A 1J59A 4HEA2 1EF4A 5JVGF 1OLTA 4Q48A 1OR7C 4ASNA 2ESNA 3S1NJ 2DJIA 2LREA 2FBIA 2VI6A 5A2QZ 2CUFA 2PMUA 2R7SA 5K7FA 3DV8A 5HOOA 2A5WA 1MSFC 1G3TA 3QYEA 1AWCA 2GA2A 2VQGA 3N4MA 5DD8A 2DT7B 4XIDA 4AVPA 2XAJA 1AKHB 1WWXA 3CCMI 4OIPF 2E19A 4N9IA 5IYDJ 2EIMH 2IAIA 2WC2A 1B9NA 3MFKA 3CCLI 1D1BA 5HS9A 2A07F 2XPVA 4PJNA 3WG7H 3P7NA 1MKMA 2HPIA 4HLYA 4IEJA 4XR6A 1FIAA 3CMAI 1D0YA 2M34A 1TLHB 4BQAA 4U88A 2HZDA 2Z1DA 1VQMI 1R23A 1ULYA 1ETKA 4IHVA 2PMZN 1FYLA 4UXNA 3ZOBA 5D5UB 2YUSA 2O8XA 1TT5B 1UAAA 2O03A 3DTKA 2RGVA 1K6OA 1ZELA 1UHSA 5DM7F 3ZQFA 3I3LA 4L0YB 4U0WA 5J3LA 4E7JA 1IRFA 2HEOA 4U7BA 2IA2A 2VPRA 2A61A 4UUVA 2NS0A 2MGQA 2JA2A 5EEAA 2MC3A 2XB5A 1FEXA 1RZ4A 2QLZA 4DQ2A 1VQ5I 1H0MA 1ZYRF 2E1MC 4WF2A 1XS9A 2HXOA 2FSWA 3NEUA 5LGNA 5FJ8J 5JLWA 2FRHA 2LP0A 3LFKA 2RKHA 4BEHA 3HKZN 2I5UA 3CJQB 3FM5A 5L3DA 4L18B 1A31A 1QPIA 1QBJA 4PDKA 2JVHA 2A6EF 4PGHA 1BI3A 5ILSA 1YS7A 4W1UA 2JSPA 2MLKA 3RIRA 3CC4I 1M1EB 4F52A 1JKOC 3T5XA 3QP5A 3BPXA 4B3AA 3SFZA 2BEOA 4G7HF 2WAEA 3GLLA 1FIPA 1K4SA 2YPRA 1X4PA 5ILUA 2FBHA 5IYCJ 3L9FA 4UHTA 4KISA 2YU9J 1S7OA 1YI2I 4HSRA 2FD5A 2YS9A 3HOXJ 2O6GE 4JYKA 5EGOB 2R3SA 3G4SI 4ENKA 2E71A 1U0JA 3JAMK 2NNYA 2CV0A 2KRHA 1OYYA 4PJMA 1XCVA 1WCMJ 2ME0A 2G7UA 1MBHA 2QZ8A 4FHTA 1O7FA 2RQQA 1FMVA 1HF0A 3LSTA 1RR7A 1PYVA 2P6TA 1B9MA 1SFUA 1IAWA 2OJED 2CYYA 2KT0A 5GADJ 3BLYA 3U9GA 1DPUA 1ON1A 2DN0A 3PUFA 5BNGA 2DT6A 1EA3A 2EK5A 4XKWA 2JRTA 4B3XA 5KAIC 3D5LA 4U0VA 3K4BA 4I98B 1I27A 4BE0A 2Y31A 4X0GA 5FKOA 3ECOA 1VZ0A 5LGTA 4IHSA 2LH9A 2DODA 3IH2A 3SZPA 3G1OA 3S93A 3H3VK 4HDUA 4LG3A 4L9JA 4LK1F 2RV8A 2V1UA 1IXRC 1D5YA 3J81K 1REPC 3HYIA 2PG4A 2IXSA 3OS2A 1WJ5A 5IP7J 1T39A 2XROA 1SVLA 4CCKA 2DDAA 4CO8A 1R6RA 2E5NA 4I7HA 4ZYHA 5TRDA 1SANA 2P7VB 2L7FP 1U9OA 2CQ7A 5H6QA 3F23A 3CCQI 3GFIA 4RM2A 5AIQA 3W6KB 5E8IA 3Q9VA 5LBQA 2ID6A 2BXZA 3K70D 3CUQC 4BBSJ 3ZMSA 4Q47A 3RYPA 3BR1A 3IWFA 2MFZA 4A3GJ 1XMXA 5LD2C 3M3YJ 4EM2A 1ZRCA 2FUG2 1W5SA 2RC4A 4BGDA 2XAHA 2DAOA 3DEWA 2IGNA 3MZ8A 2IRFG 4B43A 2PBIA 5LLQA 3JRAA 3OL3A 2MLGA 1I1SA 3GTQJ 1TP4A 4EQQA 3GEZA 3ZQLA 3S16J 4AM3A 2EPFA 1APLC 1TW2A 4AWXB 2VODA 1V55H 1WI3A 1ZN2A 3ESWB 3Q9SA 4YG2F 3CO6C 5BOXA 1O57A 4YIRX 1Z67A 3J7YJ 4CHUA 3DEEA 2ISYA 5HDKA 5ICCA 1ETYA 5M5XJ 1JTYA 1LDJA 3DTIA 5HLHA 5GPAA 2BY1A 5DV5A 3QYBA 1Z3YA 2HYGD 3ZQIA 5FRMA 3FBNB 3HHGA 1BW6A 2LY9A 4XLHA 4FT8A 4EJVA 1KA8A 3DTEA 3MVPA 5D8LB 4PK4A 4CSWA 2F5VA 3I71A 4RS8A 2JA5J 3TGNA 1VQKI 3WTYC 2XSDC 5LEJA 3B6AA 4BHCA 2XRLA 2A3SA 1WFXA 3JRCA 3HOWJ 5F64A 1JTXA 3V8JA 4HLXA 5EZHA 3KLOA 2HQAA 3HTSB 2GIVA 3UR3C 1YW9A 3RPUD 3GTLJ 1KYWA 4UUTA 1AOYA 4PFPA 3R61A 1HA8A 2Q0OA 3TDZC 4OU0A 1U78A 2ID3A 2DOEA 3QRFF 5ICGA 4BL0B 1VTNC 2KPMA 1VNDA 2OAZA 2DFIA 3HOTA 2AQEA 1FC3A 2F4OB 2QQAA 4MEYF 3IL2A 2K40A 1U5TB 4XLPF 4M6YA 2M4KA 3H0GJ 4KMUX 3RSNA 1TNSA 3DBRB 2DJNA 4KUMA 1XGOA 2HQRA 3DLLF 3GTMJ 4KDPA 1EH8A 2I8DA 1GV2A 3KZIC 2W48A 2X0LA 1S7AA 2KIMA 1W1WE 2DMNA 1OYWA 5EYRA 2L3DA 4XRMA 1Z6RA 4M3FA 2C6YA 3ML6A 2K27A 4EVIA 1R00A 2KKOA 1TWAJ 2X6XA 2VXDA 2WV0A 3TKYA 1CQTA 2DO7A 1IN7A 3GZ5A 1X58A 4XKVA 1Z6TA 4Y33A 3FZVA 2N8GA 2WB1N 4BY1J 2CW0F 2EH3A 4L5JA 2LF8A 2Q2EB 1D0XA 4O5VA 4BQNA 1K83J 3A01A 5DM6F 3JAMZ 2IS1A 3LSPA 4Y15A 4HF0A 1XN7A 3K4KA 2DDBA 3AG3H 2DTRA 4F55A 1F4KA 2DBBA 4U87A 4YIFA 4C3HJ 4UV9A 2HOSA 3C1DA 2BW3B 4A3IJ 3BR0A 3VYRB 2ZNYA 1R58A 4KIFA 4ANJA 2M87A 2EZIA 1I6HJ 4RGXA 3FMRA 2BOLA 2KDOA 1OPCA 2L7ZA 4AUXA 1FZPB 4RLFA 2ELJA 2XB0X 1WRJA 4NQWB 1IW7F 2VBWA 4KFCA 2F4IA 3A03A 4F7ZA 1HW2A 2ZMEA 3E6DA 3G1MA 4A3CJ 1XSXA 2OTJI 1ZREA 2R5ZB 2F5FA 3BR2A 3KETA 1GLNA 5JFRA 4DNCA 1FP2A 4HV6A 3J81Z 1WPKA 3GTGJ 2P0WA 3L2QA 1F9NA 3BG3A 1EJ9A 3WTXC 3V8LA 3HTUA 2FXAA 2VE9A 2K5CA 2LY1A 3I4NJ 3NWTA 2R7ZJ 2QBYB 2OBPA 1USSA 4YELA 3JRGA 1T38A 2ZJRF 1XCBA 2PX9A 4IHTA 1JE8A 2ZCWA 4E7SA 1J2XA 4HDVA 4KN4X 5M5YJ 2ELHA 2YR2A 3Q0WA 2ME6A 1V3FA 1ORKA 4UVAA 2RNJA 1DU0A 3QODA 2F4MB 2M0CA 2EFWA 4BXXJ 4QLCU 2FA5A 4XRSA 2XDVA 1STZA 1WJBA 4RLQA 1TW3A 1LB2A 2W1OA 2P6SA 5J1RA 4EJUA 2D2WA 4CGZA 3WODF 2PMZA 4IOAF 2KZVA 2PMHA 2VQCA 1SVMA 2F2EA 1G2HA 1FT9A 3FXQA 2QQ8A 3FXRA 2M45A 3TP0A 3HDDA 2CWEA 3K6GA 1WH7A 2KL4A 4XOTA 4IVNA 2R7WA 2ECCA 4XSZF 3O6BB 2M7AA 4EATA 5DDGA 1S6LA 1QNTA 2LKPA 2M1BA 2KLOA 4QSHA 4E7KA 2H27A 1U6GA 4E7HA 4G6TB 4RB2C 1SD4A 3IWZA 4NC8A 4M3EA 3H3ZA 1X1CA 1OQYA 3N05A 3HOVJ 2CH0A 5JI6A 2H1LA 1X1AA 3QU6A 3BZKA 1BN5A 3VYTB 2E35A 4TV7A 6PAXA 2VQLA 2Z2SB 1U3EM 1RI7A 1EH6A 2MA3A 4A3DJ 4I76A 3HKZA 3FDYA 5F04A 2GXGA 3SFIA 2DOAA 3E5QA 1E0EA 3GX4X 3VSKA 1G6NA 1G3WA 1JI8A 3E6MA 2CW8A 1QZEA 3CESA 3HOZJ 3E3VA 3DKWA 3FF5A 2HDWA 1ACIA 2VXZA 2H1KA 3AAFA 4WWCA 4ETSA 2VLAA 3GZ6A 5JLXA 2KMUA 2MSYA 2R7VA 2TDXA 1U8RA 1MSEC 2GM4A 4DBRA 4CCOA 3WU1B 2XGXA 4DYRA 1IV8A 1MW7A 4N0BA 3CMYA 3KZYA 4M3BA 3FHNA 1QVTA 3CF5F 3F8FA 1R4MB 3PM1A 4BXFA 3GTKJ 5FROA 1QU3A 5CPRB 5AIPA 3I5UA 2LBFB 3FWEA 5TJJA 5L3EA 1FBUA 2E34A 3EUHA 3Q3SA 3CMMA 1IF1A 2W7NA 2G7HA 4DYQA 1PP8F 1Z0XA 4IJAA 1X3UA 5E8GA 3OV8A 2K9LA 4P9FA 4I2OA 3K2ZA 4M9XA 2R5YB 1KU3A 2ADUA 2V79A 4PFOA 4AIDA 3EYYA 1FBQA 1I3AA 4B1RA 2LMDA 3LQRA 2DYRH 2IEKA 5FFXA 1USTA 2ESHA 3LSKA 4NHJA 1WJFA 2FBKA 2XF5A 3RZDJ 1TWHJ 3F6VA 1T08B 4XNFA 3BZ6A 5B66C 3TMOA 1JT0A 2DXIA 3HOUJ 3V7RA 3H0DA 5FKKA 2G0EA 4Y4RA 2O9LA 2OTLI 4BHPA 1BR4A 4A93J 3C7JA 2PJPA 4JK1X 1UELB 2HTJA 3L2UA 3LAPA 3FMSA 4CYDA 2LR8A 4CICA 4A3KJ 4ZTJA 4RB1A 2XASA 3I56I 1Y6IA 2BZTA 4I0AA 1Z7UA 1PDNC 3EDPA 4OIQF 4G9YA 4BS9A 3GTOJ 3WE2A 2L9RA 3SDBA 5FLXK 2J5OA 3MWMA 3LSMA 1MMNA 2A05A 2HTSA 1U9NA 5IYBJ 3A2KA 2V9VA 1IN6A 1ZGAA 3PNTA 4S05A 4C2TA 3U1DA 2FJ1A 1VQ7I 4XLFA 2MBFA 2OCEA 1PVEA 1R1UA 1Y0UA 2KJBA 3KEYA 3PQJA 3VYSB 3OS1A 2OF7A 4M3GA 1P2FA 4IZZA 3JW4A 2O61A 3QQAA 5DCMA 1W5TA 3BZCA 3ZN0A 3LWFA 3L2RA 3VFZA 2DFHA 4ITVA 4IOCF 1WJEA 3HG9A 4RBOA 2OPTA 4G7ZF 2VJ5A 2R5ZA 2UV1A 2L9SA 1R5ID 1MIJA 4E4HA 2BHYA 2ZNZA 2BGCA 2EQRA 1VQOI 3L2VA 4Y52J 2XKPA 1E2XA 3DF8A 2K7LA 2GWRA 5GP9A 3F72A 3AKZA 1B4AA 4P9UA 1TWGJ 3CP2A 2XSJC 1EH7A 2V6EA 3OL4A 4GXOA 3A0BC 3F3XA 2ZXHA 1IZ1A 1W36D 1PUFA 5B1BH 1A6IA 1O3SA 2Y2ZA 2ZJ2A 4HYEA 4UUSA 4LB5A 1S5LC 2NVQJ 1A35A 2OV7A 3IKVA 2W00A 5KVRA 2OD5A 4BDZA 3LA7A 1LQ1A 4O3MA 3QAHA 1QZYA 4G12A 1J09A 3QPSA 1CF7A 3I58A 3OWTA 5H2FC 3HIFA 3NQOA 3VODA 3K2AA 5DTDA 3OYKA 4ESJA 1WHUA 1XDUA 2HFHA 4M73A 1ON2A 2K02A 4C9YA 1QGPA 2QYOA 4A5MA 5HNFA 2EFQA 4HF1A 2CUEA 4MIMA 3OIPA 2HKXA 4J19A 1ZHFA 3B02A 3JREA 2EFPA 2FQ3A 2CMPA 3V7SA 2DA4A 4NNJA 3CCUI 2HYJA 4EM0B 3HRTA 3IH3A 2V4JC 3ECHA 1S9HA 1BW5A 1Q1VA 2QSGX 3C18A 2ZMEC 4W97A 3P9CA 1XB4A 2LK2A 4HX8A 3TP3A 1LNWA 1GXPA 2ZSIB 4FTHA 2KRCA 2JA8J 3H92A 1FSEA 5E1WA 2IS4A 2Z33A 2JSCA 1OCPA 4M6XA 1LEAA 2EFNA 4BJ6C 2DA5A 4XRFA 5DUKA 3L7WA 5GAEJ 3OYJA 2KIQA 3SJMA 4PSXA 5C3EJ 1BJZA 1H9GA 2VBZA 1HKTA 2LLKA 1JKQC 1P4XA 2IGMA 1O3TA 4OOIA 3HB9A 3CZ6A 2GXAA 4YEJA 3ABKH 1P9QC 1LFBA 5D6EA 2L2OA 4BH9A 3DXJF 3F0CA 5H20A 1YG2A 3HC7A 3OOUA 1SC7A 1I39A 2K86A 4RAFA 4D7NA 2EA4A 2WB1A 1D5VA 1EKEA 2WAFA 5CLSA 3IRQA 1N78A 4Z6YA 4R8HA 4F92B 2EB7A 3G6EI 1WZ2A 2COBA 3FM3A 2Z16A 4GGGA 4LLNA 1POGA 4UNOA 2EIJH 4HG2A 1WGXA 3JRDA 5EJCA 2E7WA 1MJ9A 1WH5A 4IPAA 4Y17A 4AU7A 4F3QA 5C4JJ 3CDIA 2V1DA 4E7IA 1K78A 5B3SH 2FE3A 1WQ2A 4XBFA 4G94A 5J4YA 1FP1D 2X48A 3TO6A 4S0HB 4N4NB 2Z5UA 5LFAA 3WGIA 3TW7A 1B1BA 5DD4A 1IC8A 3CDLA 2X9DA 2CG4A 2IW5A 2CQXA 3HSEA 2Y9ZA 2JA6J 2M8EA 4L9VA 2PFBA 2L9NA 4C2MJ 1ETXA 4RGRA 2R7OA 2LF7A 3E5XA 4OAZA 1J0RA 1SFKA 4A3BJ 5H6RA 1HQCA 4A0ZA 3W3CA 4BXUA 2VKHA 4A6DA 5FD6A 1BR1A 1OKRA 4LITA 2M4GA 1Y1WJ 5D4SA 4XICA 1L3LA 2RVCA 4XN0A 4K2EA 5B5EC 4ZC3A 3M1EA 2WTEA 3DBHB 3KP2A 1YLFA 3HOYJ 4A12A 2O3FA 3H9GA 3P9IA 3HGGA 4Y13A 1S7EA 3RKWA 4DZPA 2X4HA 4L5EA 2YX7A 4CXFA 2STWA 1X2NA 1ZR2A 2FX0A 1T98A 2FOWA 2EINH 1E3PA 1XPXA 1HDDC 3DFGA 4XLCA 2K3FA 1B8IB 4EMSA 3GYHX 3EUHC 1JJ6C 3NWSA 1R49A 3A0HC 2W24A 4P96A 2GXBA 1E3HA 4HQEA 1O3RA 2DT5A 2IP2A 1IV6A 2XGCA 2FNPA 3K7AJ 5IY5H 1OFCX 3C2GA 1OMIA 2H8RA 1R9TJ 1WJAA 2MH9A 3BY6A 2WV1A 3CMEI 4MHGA 3FXLA 2Z3YA 5JHFA 4ESFA 2DTZA 4C30A 2COMA 4XONA 3H5RA 4M72A 2P8TA 3AG4H 2DK8A 1P6RA 2W57A 4LG0B 1B6AA 5E3LA 3M8FA 4A5NA 3SQNA 1MZBA 1FYMA 1RKTA 3RKXA 3I59B 1UHWA 4GCVA 3JRIA 1MBGA 3H3UA 4V2FA 4NC6A 4WCGA 2ZKZA 1NHAA 2M8GX 4OMZA 1TWCJ 1ZG1A 2M30A 4P55A 4R79A 3MD2A 4UVCA 3TW6A 1MJAA 2JUGA 1A36A 2ACJA 4Y3OA 3MEXA 3CC7I 4WXCA 1IUFA 1R36A 1T33A 2R4GA 5EG0B 4H0EA 4PSWA 3S17J 2ZC2A 2IPQX 4KIBA 3E5UA 2Q8KA 2VN2A 3JSOA 1B72B 3QWLA 2GLOA 3KP4A 3ONQA 2VKVA 1RKWA 1GXQA 2JK3A 1UMQA 4IRHA 4EGZA 5IOYA 4LIVA 5ERIA 2MD5A 3KP5A 4AD9A 5D6FA 1KQ9A 4Y7NJ 2ZBKA 1QVUA 2WY7Q 4EEFG 2LY2A 3J7ZI 1Y0NA 3O3KA 4IL6C 4D1QA 3I4MJ 3PO2J 1IXSB 1AKHA 2VC0A 2OZ6A 2BVMA 1OCZH 2A68F 2VC1A 2VT3A 2L4AA 2OA4A 2JN6A 2E1CA 3K10A 1Y8QB 3KP7A 3S2WA 4JX6A 2E1MB 3KCCA 3J80K 1MH4A 2Y0MA 3P5JA 5GAHJ 2OU2A 4AIKA 3ABUA 1G3SA 4CUGA 2A69F 3GVAA
chains in the Genus database with same CATH topology
1SD6A 2LNBA 3M8EA 4MNUA 1ONVA 5HVQC 1FBSA 1IN8A 1XMKA 3B73A 3GLXA 2HYFA 1KQ0A 4RB3C 1TQPA 2G9WA 2EV0A 1KU9A 3REOA 5CVIA 1G4DA 3JTHA 3MAJA 5K5OA 3BP8A 3EETA 2WWYA 3QOPA 3R0AA 2DQRA 2HOEA 1SFEA 1GHCA 4WXDA 5HS7A 3V8KA 2L4MA 4WXHA 1SAXA 2OZUA 4FX4A 4Q4ZF 4KMFA 2PI0A 2HS5A 3F8NA 2NYXA 3FMQA 1DPRA 4GYIA 2Y48A 1S8NA 3ERED 1ZG5A 1FSHA 2QM3A 1YW7A 4IXAA 2GA1A 3DEUA 5BPDA 1KU2A 2NNNA 3BROA 3VOEA 5E18F 3DP7A 3HSFA 5D4RA 1L0OC 3ZMDA 1MDMB 3CUQB 1TQMA 5IT9K 1LDKB 5D5XB 3BJ6A 1EV7A 2QUFA 2NAZA 4M9SA 1J75A 3RI4A 3ZMUA 2D1VA 2DLLA 1HW1A 3F21A 3QU3A 4LG0A 2QWWA 3T1BA 5HLGA 5HLIA 4A0YA 4EGYA 1GVJA 3RPUA 3ELKA 5CVUA 5LHHA 2UWMA 4EM1A 2IT0A 1DDNA 2FMYA 1J9IA 4LB6B 2DQLA 4U7DA 3KEQA 3ZQ7A 2JTVA 2VBYA 1MGTA 5BS6A 4EJWA 2BE5F 2YSRA 3TO9A 3HRMA 5K1YA 2XAFA 4L5IA 1Z91A 1I6XA 3HRUA 3TDUC 3T8RA 3WTVC 3J80Z 2FMLA 1FY7A 3R6SA 2UZKA 2FF4A 5A2QK 1ZGJA 2DW4A 2H6CA 5BMZA 1ZLJA 1E17A 1UCRA 2FEZA 1G3YA 2HR3A 1FLIA 1ZRFA 4RGUA 2QQBA 2ISZA 3GO5A 1Z1DA 1U5TA 5BQTA 2AXLA 1IUYA 3RDIA 4QWQA 3CJNA 1YQAA 3ZP5A 1BI2A 1R1VA 4Z2YA 4ZYEA 1YTYA 1J5YA 4EJOA 2XV4S 3BJAA 4L0ZB 3GFJA 3I64A 2YX4A 3RJPA 1T2KA 3LQQA 1IRGA 3MQ0A 2P5LC 2E1NA 1Q1HA 2FNAA 2XHKA 4MTDA 1IN4A 2Q2EA 3L09A 2P5VA 4I09A 1XDSA 3FX3A 1QPMA 1IN5A 2RDPA 2W25A 2XRNA 1R22A 3CUOA 4GYGA 4PGGA 1XGSA 3BJOA 2R7DA 1KGSA 1WKMA 3WTUC 1WI9A 3COAC 5F1RA 2GQQA 3K9TA 5IT9Z 4NQWA 2VOOA 2KIUA 3I53A 1R1TA 1K7AA 2PQ8A 1BIAA 2DK5A 1Z9CA 1D3YA 2PEXA 1HW5A 3WTTC 3LA2A 3L00A 5L3CA 1H9TA 2IA0A 4UV8A 4HX4A 2QBYA 2HDCA 5DYMA 3V7CA 2EJRA 3QPHA 2Z99A 1T6SA 5FD5A 3KZZA 3R4KA 3WG9A 4Q5SF 2HGCA 4B8XA 4MGRA 5E1ZB 1UHMA 3HSRA 5D8KB 2STTA 2D45A 5LRSA 1ZG3A 3QP6A 2FOKA 1O7LA 2MH2A 3RKYA 3N97A 2E7XA 5LRRA 4N9HA 2VE8A 1PP7U 3K1PA 4KIGA 2IVMA 3CTAA 3MZYA 2ZO4A 1RIOH 5JHUA 2HKOA 4IF4A 3VB2A 3L2CA 2VONA 1QQIA 1A04A 1S3JA 5J8FA 2CQKA 4WK8F 3G73A 4UVBA 3IKTA 3F8CA 3K0LA 1LEBA 1LDDA 1JGSA 2D1HA 4HBLA 5FO5A 3ROUA 3SZTA 1XGMA 2HZTA 2GZWA 1S29A 4HV5A 5FB2A 4HZFA 2DU9A 5HDNA 4I02A 2K4JA 5DCFA 1MJBA 2XIGA 3FXUA 1ODDA 5CVVA 4YIIA 2P4WA 1CGPA 4EJTA 4D0PA 3HOSA 1LVAA 1BC7C 1XMAA 1FNNA 3FHZA 4OMYA 4P5OA 1DP7P 2AS5F 5FLXZ 2F5EA 3RPQA 3IC7A 1P4AA 3CLOA 3KLNA 4A6EA 4XSXF 5KK1A 1TQIA 2CO5A 2H6BA 2IA1A 3DPLC 4YFXF 2L54A 1BJAA 4NB5A 4HOBA 1W4MA 1OYIA 4ZZLA 3K1NA 4XLNF 3IRRA 1F1ZA 4GO1A 2KIFA 2KRFA 2HWVA 2OQGA 1U5TC 4IRGA 3GFLA 3R60A 3J7AO 2EA2A 3I0TA 1XSDA 2JT1A 3MCZA 3M9AA 5LHGA 3HUGA 1I1GA 3KFWX 3GW2A 1TNTA 3MZHA 4KYWA 5EEGA 3LA3A 1RUNA 1HSJA 3WTWC 2ZMEB 3KEOA 1TBXA 3U2RA 3OOPA 3EQLF 2UXNA 1ZRDA 1B59A 4A0XA 4MEXF 4LMYA 1XD7A 1I5ZA 5DEQA 1ZAOA 1Z05A 3WE3A 3C3WA 4PCQA 3IHUA 5IT3A 5L3GA 4ENMA 4CDGA 1FPQA 5D5VB 5J8CA 3TQNA 1FWZA 2Z9OA 3Q5FA 2J5PA 4R1HA 5ICEA 4ESBA 1KU7A 5HDGA 3BOQA 2LDUA 3O2PE 2FU4A 4ENNA 1HKSA 2F5DA 3WGHA 3GWZA 3ZMZA 1R5HA 4OINF 4BAYA 3DPTA 3K69A 1D8KA 3P9KA 4BHBA 4L9NA 1V4RA 2B0LA 5LHIA 4FX0A 4IRIA 5ED4A 4B09A 2W85A 4AIJA 1BI1A 4YFNF 4KT5C 2BYVE 1XSVA 3G3ZA 1SD7A 1YS6A 1T0FA 2EFOA 4LJZF 1SFXA 4ZYGA 1U2WA 2O0YA 5ICFA 4BYYA 2L01A 5JR3A 2F5CA 3RTRA 4HX7A 5E17F 5K5QA 1IXCA 4E70A 2DPDA 2ETHA 1PUEE 3ABTA 2KJCA 2H94A 1QZZA 2XAQA 3JSPA 2V1XA 2CSOA 4ON0A 4L9TA 2DI3A 3F8MA 4JQFA 3F22A 5CVRA 2IJLA 3BWGA 3CO7C 1YIOA 2R7FA 2OQRA 2V6CA 5DUIA 2RQPA 1FOKA 5L3BA 1F5TA 3ZMVA 4A2UA 4I01A 4MTEA 3ZMTA 3BPVA 1P4WA 2W84A 2QQ9A 4RAZA 4M9ZA 1W7PB 2EV6A 2P5KA 4ZZDA 3E97A 5E20A 3CDHA 5CVJA 3SXYA 1YFHA 5DCMB 5D5WB 1KYZA 1BBYA 3M7GA 3I4PA 1D8JA 1OR7A 4KNYA 2A6HF 2LSOA 3KP3A 4O6JA 3TOAA 3I59A 2PN6A 3EYIA 4HW0A 5FFZA 4CZZA 4KA4A 4U0YA 2K4BA 1ZLKA 4LLLA 3W6JB 5EEHA 1CF7B 1KQ8A 3GF2A 3WU0A 1W7PD 1HSTA 1YO5C 3T8TA 4HF2A 3D0SA 1SMYF 1BC8C 4KICA 3GXOA 3TO7A 1JHHA 3WGGA 3KP6A 1SMTA 2ZXJA 2UXXA 1BOAA 4S04A 1WSUA 1JHFA 2L02A 4OIRF 1SD5A 1YYVA 1R5GA 2VOPA 5E1XA 5ILVA 2JPCA 3WTSC 4WX9A 1HXDA 4MQVA 5HS8A 2EV5A 2PLYA 5FGMA 2QVOA 2VBXA 3KE2A 4G6QA 1R7JA 2XAGA 2XKOA 3R0JA 1BM9A 1FYKA 3TOBA 2BV6A 2Y75A 3ULQB 5CJ9A 5BPIA 1HBXG 4RB0A 2EWNA 4KN7X 1BI0A 3LAJA 3ISPA 5F6FA 4BNCA 4HAMA 1BIBA 1FX7A 2BBYA 5JVTA 2CFXA 3V4GA 4I0BA 2GAUA 3JTGA 1J7KA 2HQNA 2DPUA 2VT2A 4ZYDA 3RYRA 1HKQA 3F6OA 1K78B 4OIOF 1RNLA 1K79A 3T0YA 1JXSA 2JZYA 3HHHA 1YW8A 3K1MA 4M71A 4LGWA 3PQKA 4AIHA 1ZARA 4RAYA 2XUBA 3HRSA 1DUXC 1QO0D 4G8XA 4M74A 2QENA 4LK0F 1C0WA 4LFUA 4LD5A 2ZFWA 2H09A 1W7PA 1MD0A 4YFKF 1MDMA 3CUQA 3GUDA 1ZH5A 1P92A 5AONA 5K5RA 1TTYA 4JBAA 1RUOA 1XGNA 1UFMA 3ZPLA 4RGSA 3BDDA 2NRAC 2A5YB 3ZN1A 4G6DA 3E6BA 2RN7A 4ENJA 5L3FA 4PZJA 3NRVA 4LLGF 3DQVC 1O3QA 4MQ9F 5LGUA 4HA8A 2XVCA 3GFMA 5J6XA 4ZH4F 2P7CB 5CYVA 3QPTA 3PFIA 1LJ9A 3E6CC 2JPBA 3F8BA 3WTZA 4G7OF 1UB9A 3SHFA 2YU3A 4EV0A 3VEPA 3I54A 2M5WA 2CGPA 5LEKA 4HQMA 1J59A 4Q48A 4ASNA 2ESNA 2FBIA 5A2QZ 2PMUA 3DV8A 5HOOA 1G3TA 1AWCA 2GA2A 3N4MA 5DD8A 4AVPA 2XAJA 4OIPF 1WWXA 4N9IA 2WC2A 1B9NA 3MFKA 5HS9A 2A07F 3P7NA 1MKMA 4HLYA 1TLHB 4BQAA 4U88A 1R23A 1ULYA 1FYLA 4UXNA 5D5UB 2O8XA 2O03A 2RGVA 1K6OA 4L0YB 4U0WA 1IRFA 2HEOA 4U7BA 2IA2A 2A61A 4UUVA 2NS0A 2MC3A 1RZ4A 2QLZA 4DQ2A 1H0MA 1ZYRF 4WF2A 2FSWA 3NEUA 5LGNA 2FRHA 3LFKA 2RKHA 3FM5A 5L3DA 4L18B 1QBJA 4PDKA 2A6EF 4PGHA 1BI3A 5ILSA 1YS7A 2MLKA 3RIRA 3T5XA 3QP5A 3BPXA 4G7HF 3SFZA 2BEOA 2YPRA 5ILUA 2FBHA 3L9FA 4UHTA 1S7OA 2O6GE 2R3SA 4ENKA 3JAMK 2NNYA 1OYYA 1XCVA 2G7UA 2QZ8A 4FHTA 1O7FA 3LSTA 2P6TA 1B9MA 1SFUA 1IAWA 2CYYA 3U9GA 1DPUA 1ON1A 2EK5A 2JRTA 3D5LA 4U0VA 4I98B 1I27A 3ECOA 5LGTA 4IHSA 3SZPA 4HDUA 4L9JA 4LK1F 2RV8A 2V1UA 1IXRC 1REPC 3J81K 3HYIA 2PG4A 1T39A 2XROA 4CO8A 4I7HA 4ZYHA 5TRDA 2P7VB 5H6QA 3F23A 3GFIA 5AIQA 3W6KB 5E8IA 3Q9VA 5LBQA 3CUQC 3ZMSA 4Q47A 3RYPA 3IWFA 4EM2A 1ZRCA 1W5SA 2RC4A 2XAHA 2DAOA 2IRFG 2PBIA 5LLQA 2MLGA 1I1SA 4EQQA 3GEZA 1TW2A 4AWXB 2VODA 1ZN2A 3Q9SA 4YG2F 3CO6C 5BOXA 1O57A 4CHUA 2ISYA 5HDKA 5ICCA 1LDJA 5HLHA 5DV5A 2HYGD 3HHGA 4FT8A 4EJVA 1KA8A 5D8LB 3I71A 4RS8A 3TGNA 3WTYC 5LEJA 4BHCA 2A3SA 5F64A 3V8JA 4HLXA 3KLOA 3HTSB 2GIVA 1YW9A 1KYWA 1AOYA 3R61A 2Q0OA 3TDZC 4OU0A 1U78A 3QRFF 5ICGA 1VTNC 2OAZA 2DFIA 3HOTA 1FC3A 2QQAA 4MEYF 3IL2A 1U5TB 4XLPF 4M6YA 4KMUX 1TNSA 4KUMA 1XGOA 2HQRA 4KDPA 1EH8A 2X0LA 1S7AA 2KIMA 1OYWA 2L3DA 1Z6RA 2C6YA 3ML6A 2K27A 4EVIA 1R00A 2KKOA 2WV0A 3TKYA 2DO7A 1IN7A 3GZ5A 1Z6TA 3FZVA 2CW0F 4L5JA 2LF8A 4O5VA 3JAMZ 4Y15A 4HF0A 1XN7A 2DTRA 1F4KA 2DBBA 4YIFA 4UV9A 3C1DA 2ZNYA 1R58A 4KIFA 2M87A 4RGXA 3FMRA 1OPCA 1FZPB 1WRJA 1IW7F 2VBWA 4KFCA 4F7ZA 1HW2A 2ZMEA 3E6DA 1XSXA 1ZREA 2F5FA 3KETA 5JFRA 4DNCA 1FP2A 4HV6A 3J81Z 1F9NA 3WTXC 3V8LA 3HTUA 2FXAA 2VE9A 2QBYB 2OBPA 1USSA 1T38A 1XCBA 4IHTA 1JE8A 2ZCWA 1J2XA 4HDVA 4KN4X 2ELHA 2YR2A 1V3FA 4UVAA 2RNJA 2EFWA 4QLCU 2FA5A 1STZA 1TW3A 1LB2A 2P6SA 4EJUA 2D2WA 4CGZA 3WODF 2PMHA 2F2EA 1FT9A 3FXQA 3FXRA 2M45A 2CWEA 4IVNA 4XSZF 3O6BB 5DDGA 1S6LA 1QNTA 2LKPA 2M1BA 2H27A 1U6GA 4RB2C 1SD4A 3IWZA 3H3ZA 5JI6A 3QU6A 1BN5A 4TV7A 6PAXA 1U3EM 1RI7A 1EH6A 2MA3A 2GXGA 3E5QA 3GX4X 1G6NA 1G3WA 3E6MA 3E3VA 3DKWA 3FF5A 2VXZA 3AAFA 4WWCA 4ETSA 3GZ6A 2TDXA 1U8RA 3WU1B 2XGXA 4N0BA 3KZYA 3F8FA 5AIPA 3I5UA 3FWEA 5TJJA 5L3EA 1FBUA 3EUHA 1IF1A 2G7HA 1PP8F 4IJAA 1X3UA 5E8GA 3OV8A 4P9FA 4I2OA 3K2ZA 4M9XA 1KU3A 2ADUA 2V79A 3EYYA 1FBQA 3LQRA 5FFXA 1USTA 2ESHA 4NHJA 2FBKA 3F6VA 3BZ6A 3V7RA 4BHPA 3C7JA 2PJPA 4JK1X 2HTJA 3LAPA 3FMSA 4CYDA 4CICA 4RB1A 2XASA 4I0AA 1Z7UA 1PDNC 3EDPA 4OIQF 4G9YA 3WE2A 5FLXK 2J5OA 3MWMA 2HTSA 2V9VA 1IN6A 1ZGAA 4S05A 3U1DA 2MBFA 1R1UA 1Y0UA 2KJBA 3PQJA 1P2FA 3JW4A 2O61A 5DCMA 1W5TA 3ZN0A 3LWFA 3VFZA 4G7ZF 2ZNZA 2BGCA 2XKPA 1E2XA 3DF8A 2K7LA 2GWRA 3F72A 1B4AA 4P9UA 1EH7A 4GXOA 3F3XA 1IZ1A 1O3SA 2ZJ2A 4HYEA 4LB5A 3IKVA 5KVRA 2OD5A 3LA7A 1LQ1A 4O3MA 3QAHA 1QZYA 1CF7A 3I58A 3HIFA 3NQOA 3VODA 4ESJA 1XDUA 2HFHA 4M73A 1ON2A 2K02A 1QGPA 2QYOA 4A5MA 2EFQA 4HF1A 2HKXA 1ZHFA 3B02A 2EFPA 2FQ3A 3V7SA 4EM0B 3HRTA 3ECHA 3C18A 3P9CA 1XB4A 4HX8A 1LNWA 1GXPA 3H92A 1FSEA 5E1WA 2Z33A 2JSCA 4M6XA 1LEAA 2EFNA 4XRFA 5DUKA 3L7WA 1H9GA 2VBZA 1HKTA 1P4XA 1O3TA 4OOIA 5D6EA 4BH9A 3DXJF 5H20A 1YG2A 2K86A 2EA4A 1D5VA 5CLSA 3IRQA 4R8HA 2EB7A 3FM3A 4GGGA 4LLNA 4UNOA 2E7WA 1MJ9A 4IPAA 4Y17A 2V1DA 1K78A 2FE3A 1WQ2A 4XBFA 4G94A 1FP1D 3TO6A 2Z5UA 3WGIA 1B1BA 5DD4A 2CG4A 2IW5A 3HSEA 2M8EA 4L9VA 2PFBA 4RGRA 2LF7A 3E5XA 1J0RA 5H6RA 1HQCA 4A0ZA 4BXUA 4A6DA 5FD6A 1OKRA 5D4SA 1L3LA 2RVCA 4K2EA 3M1EA 2WTEA 3KP2A 1YLFA 4A12A 2O3FA 3P9IA 4Y13A 3RKWA 2X4HA 2YX7A 4CXFA 2STWA 1T98A 3DFGA 4EMSA 3GYHX 2W24A 4P96A 2GXBA 4HQEA 1O3RA 2DT5A 2IP2A 2FNPA 1OMIA 2MH9A 3BY6A 4MHGA 2Z3YA 4ESFA 2COMA 4M72A 2P8TA 2DK8A 1P6RA 2W57A 4LG0B 1B6AA 3M8FA 4A5NA 3SQNA 1MZBA 1FYMA 3RKXA 3I59B 1UHWA 4GCVA 3H3UA 4WCGA 2ZKZA 1NHAA 4OMZA 1ZG1A 2M30A 4P55A 4R79A 4UVCA 1MJAA 2ACJA 3MEXA 4WXCA 1R36A 4H0EA 2IPQX 4KIBA 3E5UA 2Q8KA 2VN2A 3JSOA 3KP4A 1GXQA 4IRHA 4EGZA 5ERIA 2MD5A 3KP5A 4AD9A 5D6FA 1KQ9A 2ZBKA 3O3KA 1IXSB 2VC0A 2OZ6A 2A68F 2VC1A 2VT3A 2L4AA 2OA4A 2E1CA 3KP7A 3S2WA 3KCCA 3J80K 2Y0MA 2OU2A 4AIKA 3ABUA 1G3SA 2A69F 3GVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD6 A;  2LNB A;  3M8E A;  4MNU A;  1ONV A;  5HVQ C;  1FBS A;  1IN8 A;  1XMK A;  3B73 A;  3GLX A;  2HYF A;  1KQ0 A;  4RB3 C;  1TQP A;  2G9W A;  2EV0 A;  1KU9 A;  3REO A;  5CVI A;  1G4D A;  3JTH A;  3MAJ A;  5K5O A;  3BP8 A;  3EET A;  2WWY A;  3QOP A;  3R0A A;  2DQR A;  2HOE A;  1SFE A;  1GHC A;  4WXD A;  5HS7 A;  3V8K A;  2L4M A;  4WXH A;  1SAX A;  2OZU A;  4FX4 A;  4Q4Z F;  4KMF A;  2PI0 A;  2HS5 A;  3F8N A;  2NYX A;  3FMQ A;  1DPR A;  4GYI A;  2Y48 A;  1S8N A;  3ERE D;  1ZG5 A;  1FSH A;  2QM3 A;  1YW7 A;  4IXA A;  2GA1 A;  3DEU A;  5BPD A;  1KU2 A;  2NNN A;  3BRO A;  3VOE A;  5E18 F;  3DP7 A;  3HSF A;  5D4R A;  1L0O C;  3ZMD A;  1MDM B;  3CUQ B;  1TQM A;  5IT9 K;  1LDK B;  5D5X B;  3BJ6 A;  1EV7 A;  2QUF A;  2NAZ A;  4M9S A;  1J75 A;  3RI4 A;  3ZMU A;  2D1V A;  2DLL A;  1HW1 A;  3F21 A;  3QU3 A;  4LG0 A;  2QWW A;  3T1B A;  5HLG A;  5HLI A;  4A0Y A;  4EGY A;  1GVJ A;  3RPU A;  3ELK A;  5CVU A;  5LHH A;  2UWM A;  4EM1 A;  2IT0 A;  1DDN A;  2FMY A;  1J9I A;  4LB6 B;  2DQL A;  4U7D A;  3KEQ A;  3ZQ7 A;  2JTV A;  2VBY A;  1MGT A;  5BS6 A;  4EJW A;  2BE5 F;  2YSR A;  3TO9 A;  3HRM A;  5K1Y A;  2XAF A;  4L5I A;  1Z91 A;  1I6X A;  3HRU A;  3TDU C;  3T8R A;  3WTV C;  3J80 Z;  2FML A;  1FY7 A;  3R6S A;  2UZK A;  2FF4 A;  5A2Q K;  1ZGJ A;  2DW4 A;  2H6C A;  5BMZ A;  1ZLJ A;  1E17 A;  1UCR A;  2FEZ A;  1G3Y A;  2HR3 A;  1FLI A;  1ZRF A;  4RGU A;  2QQB A;  2ISZ A;  3GO5 A;  1Z1D A;  1U5T A;  5BQT A;  2AXL A;  1IUY A;  3RDI A;  4QWQ A;  3CJN A;  1YQA A;  3ZP5 A;  1BI2 A;  1R1V A;  4Z2Y A;  4ZYE A;  1YTY A;  1J5Y A;  4EJO A;  2XV4 S;  3BJA A;  4L0Z B;  3GFJ A;  3I64 A;  2YX4 A;  3RJP A;  1T2K A;  3LQQ A;  1IRG A;  3MQ0 A;  2P5L C;  2E1N A;  1Q1H A;  2FNA A;  2XHK A;  4MTD A;  1IN4 A;  2Q2E A;  3L09 A;  2P5V A;  4I09 A;  1XDS A;  3FX3 A;  1QPM A;  1IN5 A;  2RDP A;  2W25 A;  2XRN A;  1R22 A;  3CUO A;  4GYG A;  4PGG A;  1XGS A;  3BJO A;  2R7D A;  1KGS A;  1WKM A;  3WTU C;  1WI9 A;  3COA C;  5F1R A;  2GQQ A;  3K9T A;  5IT9 Z;  4NQW A;  2VOO A;  2KIU A;  3I53 A;  1R1T A;  1K7A A;  2PQ8 A;  1BIA A;  2DK5 A;  1Z9C A;  1D3Y A;  2PEX A;  1HW5 A;  3WTT C;  3LA2 A;  3L00 A;  5L3C A;  1H9T A;  2IA0 A;  4UV8 A;  4HX4 A;  2QBY A;  2HDC A;  5DYM A;  3V7C A;  2EJR A;  3QPH A;  2Z99 A;  1T6S A;  5FD5 A;  3KZZ A;  3R4K A;  3WG9 A;  4Q5S F;  2HGC A;  4B8X A;  4MGR A;  5E1Z B;  1UHM A;  3HSR A;  5D8K B;  2STT A;  2D45 A;  5LRS A;  1ZG3 A;  3QP6 A;  2FOK A;  1O7L A;  2MH2 A;  3RKY A;  3N97 A;  2E7X A;  5LRR A;  4N9H A;  2VE8 A;  1PP7 U;  3K1P A;  4KIG A;  2IVM A;  3CTA A;  3MZY A;  2ZO4 A;  1RIO H;  5JHU A;  2HKO A;  4IF4 A;  3VB2 A;  3L2C A;  2VON A;  1QQI A;  1A04 A;  1S3J A;  5J8F A;  2CQK A;  4WK8 F;  3G73 A;  4UVB A;  3IKT A;  3F8C A;  3K0L A;  1LEB A;  1LDD A;  1JGS A;  2D1H A;  4HBL A;  5FO5 A;  3ROU A;  3SZT A;  1XGM A;  2HZT A;  2GZW A;  1S29 A;  4HV5 A;  5FB2 A;  4HZF A;  2DU9 A;  5HDN A;  4I02 A;  2K4J A;  5DCF A;  1MJB A;  2XIG A;  3FXU A;  1ODD A;  5CVV A;  4YII A;  2P4W A;  1CGP A;  4EJT A;  4D0P A;  3HOS A;  1LVA A;  1BC7 C;  1XMA A;  1FNN A;  3FHZ A;  4OMY A;  4P5O A;  1DP7 P;  2AS5 F;  5FLX Z;  2F5E A;  3RPQ A;  3IC7 A;  1P4A A;  3CLO A;  3KLN A;  4A6E A;  4XSX F;  5KK1 A;  1TQI A;  2CO5 A;  2H6B A;  2IA1 A;  3DPL C;  4YFX F;  2L54 A;  1BJA A;  4NB5 A;  4HOB A;  1W4M A;  1OYI A;  4ZZL A;  3K1N A;  4XLN F;  3IRR A;  1F1Z A;  4GO1 A;  2KIF A;  2KRF A;  2HWV A;  2OQG A;  1U5T C;  4IRG A;  3GFL A;  3R60 A;  3J7A O;  2EA2 A;  3I0T A;  1XSD A;  2JT1 A;  3MCZ A;  3M9A A;  5LHG A;  3HUG A;  1I1G A;  3KFW X;  3GW2 A;  1TNT A;  3MZH A;  4KYW A;  5EEG A;  3LA3 A;  1RUN A;  1HSJ A;  3WTW C;  2ZME B;  3KEO A;  1TBX A;  3U2R A;  3OOP A;  3EQL F;  2UXN A;  1ZRD A;  1B59 A;  4A0X A;  4MEX F;  4LMY A;  1XD7 A;  1I5Z A;  5DEQ A;  1ZAO A;  1Z05 A;  3WE3 A;  3C3W A;  4PCQ A;  3IHU A;  5IT3 A;  5L3G A;  4ENM A;  4CDG A;  1FPQ A;  5D5V B;  5J8C A;  3TQN A;  1FWZ A;  2Z9O A;  3Q5F A;  2J5P A;  4R1H A;  5ICE A;  4ESB A;  1KU7 A;  5HDG A;  3BOQ A;  2LDU A;  3O2P E;  2FU4 A;  4ENN A;  1HKS A;  2F5D A;  3WGH A;  3GWZ A;  3ZMZ A;  1R5H A;  4OIN F;  4BAY A;  3DPT A;  3K69 A;  1D8K A;  3P9K A;  4BHB A;  4L9N A;  1V4R A;  2B0L A;  5LHI A;  4FX0 A;  4IRI A;  5ED4 A;  4B09 A;  2W85 A;  4AIJ A;  1BI1 A;  4YFN F;  4KT5 C;  2BYV E;  1XSV A;  3G3Z A;  1SD7 A;  1YS6 A;  1T0F A;  2EFO A;  4LJZ F;  1SFX A;  4ZYG A;  1U2W A;  2O0Y A;  5ICF A;  4BYY A;  2L01 A;  5JR3 A;  2F5C A;  3RTR A;  4HX7 A;  5E17 F;  5K5Q A;  1IXC A;  4E70 A;  2DPD A;  2ETH A;  1PUE E;  3ABT A;  2KJC A;  2H94 A;  1QZZ A;  2XAQ A;  3JSP A;  2V1X A;  2CSO A;  4ON0 A;  4L9T A;  2DI3 A;  3F8M A;  4JQF A;  3F22 A;  5CVR A;  2IJL A;  3BWG A;  3CO7 C;  1YIO A;  2R7F A;  2OQR A;  2V6C A;  5DUI A;  2RQP A;  1FOK A;  5L3B A;  1F5T A;  3ZMV A;  4A2U A;  4I01 A;  4MTE A;  3ZMT A;  3BPV A;  1P4W A;  2W84 A;  2QQ9 A;  4RAZ A;  4M9Z A;  1W7P B;  2EV6 A;  2P5K A;  4ZZD A;  3E97 A;  5E20 A;  3CDH A;  5CVJ A;  3SXY A;  1YFH A;  5DCM B;  5D5W B;  1KYZ A;  1BBY A;  3M7G A;  3I4P A;  1D8J A;  1OR7 A;  4KNY A;  2A6H F;  2LSO A;  3KP3 A;  4O6J A;  3TOA A;  3I59 A;  2PN6 A;  3EYI A;  4HW0 A;  5FFZ A;  4CZZ A;  4KA4 A;  4U0Y A;  2K4B A;  1ZLK A;  4LLL A;  3W6J B;  5EEH A;  1CF7 B;  1KQ8 A;  3GF2 A;  3WU0 A;  1W7P D;  1HST A;  1YO5 C;  3T8T A;  4HF2 A;  3D0S A;  1SMY F;  1BC8 C;  4KIC A;  3GXO A;  3TO7 A;  1JHH A;  3WGG A;  3KP6 A;  1SMT A;  2ZXJ A;  2UXX A;  1BOA A;  4S04 A;  1WSU A;  1JHF A;  2L02 A;  4OIR F;  1SD5 A;  1YYV A;  1R5G A;  2VOP A;  5E1X A;  5ILV A;  2JPC A;  3WTS C;  4WX9 A;  1HXD A;  4MQV A;  5HS8 A;  2EV5 A;  2PLY A;  5FGM A;  2QVO A;  2VBX A;  3KE2 A;  4G6Q A;  1R7J A;  2XAG A;  2XKO A;  3R0J A;  1BM9 A;  1FYK A;  3TOB A;  2BV6 A;  2Y75 A;  3ULQ B;  5CJ9 A;  5BPI A;  1HBX G;  4RB0 A;  2EWN A;  4KN7 X;  1BI0 A;  3LAJ A;  3ISP A;  5F6F A;  4BNC A;  4HAM A;  1BIB A;  1FX7 A;  2BBY A;  5JVT A;  2CFX A;  3V4G A;  4I0B A;  2GAU A;  3JTG A;  1J7K A;  2HQN A;  2DPU A;  2VT2 A;  4ZYD A;  3RYR A;  1HKQ A;  3F6O A;  1K78 B;  4OIO F;  1RNL A;  1K79 A;  3T0Y A;  1JXS A;  2JZY A;  3HHH A;  1YW8 A;  3K1M A;  4M71 A;  4LGW A;  3PQK A;  4AIH A;  1ZAR A;  4RAY A;  2XUB A;  3HRS A;  1DUX C;  1QO0 D;  4G8X A;  4M74 A;  2QEN A;  4LK0 F;  1C0W A;  4LFU A;  4LD5 A;  2ZFW A;  2H09 A;  1W7P A;  1MD0 A;  4YFK F;  1MDM A;  3CUQ A;  3GUD A;  1ZH5 A;  1P92 A;  5AON A;  5K5R A;  1TTY A;  4JBA A;  1RUO A;  1XGN A;  1UFM A;  3ZPL A;  4RGS A;  3BDD A;  2NRA C;  2A5Y B;  3ZN1 A;  4G6D A;  3E6B A;  2RN7 A;  4ENJ A;  5L3F A;  4PZJ A;  3NRV A;  4LLG F;  3DQV C;  1O3Q A;  4MQ9 F;  5LGU A;  4HA8 A;  2XVC A;  3GFM A;  5J6X A;  4ZH4 F;  2P7C B;  5CYV A;  3QPT A;  3PFI A;  1LJ9 A;  3E6C C;  2JPB A;  3F8B A;  3WTZ A;  4G7O F;  1UB9 A;  3SHF A;  2YU3 A;  4EV0 A;  3VEP A;  3I54 A;  2M5W A;  2CGP A;  5LEK A;  4HQM A;  1J59 A;  4Q48 A;  4ASN A;  2ESN A;  2FBI A;  5A2Q Z;  2PMU A;  3DV8 A;  5HOO A;  1G3T A;  1AWC A;  2GA2 A;  3N4M A;  5DD8 A;  4AVP A;  2XAJ A;  4OIP F;  1WWX A;  4N9I A;  2WC2 A;  1B9N A;  3MFK A;  5HS9 A;  2A07 F;  3P7N A;  1MKM A;  4HLY A;  1TLH B;  4BQA A;  4U88 A;  1R23 A;  1ULY A;  1FYL A;  4UXN A;  5D5U B;  2O8X A;  2O03 A;  2RGV A;  1K6O A;  4L0Y B;  4U0W A;  1IRF A;  2HEO A;  4U7B A;  2IA2 A;  2A61 A;  4UUV A;  2NS0 A;  2MC3 A;  1RZ4 A;  2QLZ A;  4DQ2 A;  1H0M A;  1ZYR F;  4WF2 A;  2FSW A;  3NEU A;  5LGN A;  2FRH A;  3LFK A;  2RKH A;  3FM5 A;  5L3D A;  4L18 B;  1QBJ A;  4PDK A;  2A6E F;  4PGH A;  1BI3 A;  5ILS A;  1YS7 A;  2MLK A;  3RIR A;  3T5X A;  3QP5 A;  3BPX A;  4G7H F;  3SFZ A;  2BEO A;  2YPR A;  5ILU A;  2FBH A;  3L9F A;  4UHT A;  1S7O A;  2O6G E;  2R3S A;  4ENK A;  3JAM K;  2NNY A;  1OYY A;  1XCV A;  2G7U A;  2QZ8 A;  4FHT A;  1O7F A;  3LST A;  2P6T A;  1B9M A;  1SFU A;  1IAW A;  2CYY A;  3U9G A;  1DPU A;  1ON1 A;  2EK5 A;  2JRT A;  3D5L A;  4U0V A;  4I98 B;  1I27 A;  3ECO A;  5LGT A;  4IHS A;  3SZP A;  4HDU A;  4L9J A;  4LK1 F;  2RV8 A;  2V1U A;  1IXR C;  1REP C;  3J81 K;  3HYI A;  2PG4 A;  1T39 A;  2XRO A;  4CO8 A;  4I7H A;  4ZYH A;  5TRD A;  2P7V B;  5H6Q A;  3F23 A;  3GFI A;  5AIQ A;  3W6K B;  5E8I A;  3Q9V A;  5LBQ A;  3CUQ C;  3ZMS A;  4Q47 A;  3RYP A;  3IWF A;  4EM2 A;  1ZRC A;  1W5S A;  2RC4 A;  2XAH A;  2DAO A;  2IRF G;  2PBI A;  5LLQ A;  2MLG A;  1I1S A;  4EQQ A;  3GEZ A;  1TW2 A;  4AWX B;  2VOD A;  1ZN2 A;  3Q9S A;  4YG2 F;  3CO6 C;  5BOX A;  1O57 A;  4CHU A;  2ISY A;  5HDK A;  5ICC A;  1LDJ A;  5HLH A;  5DV5 A;  2HYG D;  3HHG A;  4FT8 A;  4EJV A;  1KA8 A;  5D8L B;  3I71 A;  4RS8 A;  3TGN A;  3WTY C;  5LEJ A;  4BHC A;  2A3S A;  5F64 A;  3V8J A;  4HLX A;  3KLO A;  3HTS B;  2GIV A;  1YW9 A;  1KYW A;  1AOY A;  3R61 A;  2Q0O A;  3TDZ C;  4OU0 A;  1U78 A;  3QRF F;  5ICG A;  1VTN C;  2OAZ A;  2DFI A;  3HOT A;  1FC3 A;  2QQA A;  4MEY F;  3IL2 A;  1U5T B;  4XLP F;  4M6Y A;  4KMU X;  1TNS A;  4KUM A;  1XGO A;  2HQR A;  4KDP A;  1EH8 A;  2X0L A;  1S7A A;  2KIM A;  1OYW A;  2L3D A;  1Z6R A;  2C6Y A;  3ML6 A;  2K27 A;  4EVI A;  1R00 A;  2KKO A;  2WV0 A;  3TKY A;  2DO7 A;  1IN7 A;  3GZ5 A;  1Z6T A;  3FZV A;  2CW0 F;  4L5J A;  2LF8 A;  4O5V A;  3JAM Z;  4Y15 A;  4HF0 A;  1XN7 A;  2DTR A;  1F4K A;  2DBB A;  4YIF A;  4UV9 A;  3C1D A;  2ZNY A;  1R58 A;  4KIF A;  2M87 A;  4RGX A;  3FMR A;  1OPC A;  1FZP B;  1WRJ A;  1IW7 F;  2VBW A;  4KFC A;  4F7Z A;  1HW2 A;  2ZME A;  3E6D A;  1XSX A;  1ZRE A;  2F5F A;  3KET A;  5JFR A;  4DNC A;  1FP2 A;  4HV6 A;  3J81 Z;  1F9N A;  3WTX C;  3V8L A;  3HTU A;  2FXA A;  2VE9 A;  2QBY B;  2OBP A;  1USS A;  1T38 A;  1XCB A;  4IHT A;  1JE8 A;  2ZCW A;  1J2X A;  4HDV A;  4KN4 X;  2ELH A;  2YR2 A;  1V3F A;  4UVA A;  2RNJ A;  2EFW A;  4QLC U;  2FA5 A;  1STZ A;  1TW3 A;  1LB2 A;  2P6S A;  4EJU A;  2D2W A;  4CGZ A;  3WOD F;  2PMH A;  2F2E A;  1FT9 A;  3FXQ A;  3FXR A;  2M45 A;  2CWE A;  4IVN A;  4XSZ F;  3O6B B;  5DDG A;  1S6L A;  1QNT A;  2LKP A;  2M1B A;  2H27 A;  1U6G A;  4RB2 C;  1SD4 A;  3IWZ A;  3H3Z A;  5JI6 A;  3QU6 A;  1BN5 A;  4TV7 A;  6PAX A;  1U3E M;  1RI7 A;  1EH6 A;  2MA3 A;  2GXG A;  3E5Q A;  3GX4 X;  1G6N A;  1G3W A;  3E6M A;  3E3V A;  3DKW A;  3FF5 A;  2VXZ A;  3AAF A;  4WWC A;  4ETS A;  3GZ6 A;  2TDX A;  1U8R A;  3WU1 B;  2XGX A;  4N0B A;  3KZY A;  3F8F A;  5AIP A;  3I5U A;  3FWE A;  5TJJ A;  5L3E A;  1FBU A;  3EUH A;  1IF1 A;  2G7H A;  1PP8 F;  4IJA A;  1X3U A;  5E8G A;  3OV8 A;  4P9F A;  4I2O A;  3K2Z A;  4M9X A;  1KU3 A;  2ADU A;  2V79 A;  3EYY A;  1FBQ A;  3LQR A;  5FFX A;  1UST A;  2ESH A;  4NHJ A;  2FBK A;  3F6V A;  3BZ6 A;  3V7R A;  4BHP A;  3C7J A;  2PJP A;  4JK1 X;  2HTJ A;  3LAP A;  3FMS A;  4CYD A;  4CIC A;  4RB1 A;  2XAS A;  4I0A A;  1Z7U A;  1PDN C;  3EDP A;  4OIQ F;  4G9Y A;  3WE2 A;  5FLX K;  2J5O A;  3MWM A;  2HTS A;  2V9V A;  1IN6 A;  1ZGA A;  4S05 A;  3U1D A;  2MBF A;  1R1U A;  1Y0U A;  2KJB A;  3PQJ A;  1P2F A;  3JW4 A;  2O61 A;  5DCM A;  1W5T A;  3ZN0 A;  3LWF A;  3VFZ A;  4G7Z F;  2ZNZ A;  2BGC A;  2XKP A;  1E2X A;  3DF8 A;  2K7L A;  2GWR A;  3F72 A;  1B4A A;  4P9U A;  1EH7 A;  4GXO A;  3F3X A;  1IZ1 A;  1O3S A;  2ZJ2 A;  4HYE A;  4LB5 A;  3IKV A;  5KVR A;  2OD5 A;  3LA7 A;  1LQ1 A;  4O3M A;  3QAH A;  1QZY A;  1CF7 A;  3I58 A;  3HIF A;  3NQO A;  3VOD A;  4ESJ A;  1XDU A;  2HFH A;  4M73 A;  1ON2 A;  2K02 A;  1QGP A;  2QYO A;  4A5M A;  2EFQ A;  4HF1 A;  2HKX A;  1ZHF A;  3B02 A;  2EFP A;  2FQ3 A;  3V7S A;  4EM0 B;  3HRT A;  3ECH A;  3C18 A;  3P9C A;  1XB4 A;  4HX8 A;  1LNW A;  1GXP A;  3H92 A;  1FSE A;  5E1W A;  2Z33 A;  2JSC A;  4M6X A;  1LEA A;  2EFN A;  4XRF A;  5DUK A;  3L7W A;  1H9G A;  2VBZ A;  1HKT A;  1P4X A;  1O3T A;  4OOI A;  5D6E A;  4BH9 A;  3DXJ F;  5H20 A;  1YG2 A;  2K86 A;  2EA4 A;  1D5V A;  5CLS A;  3IRQ A;  4R8H A;  2EB7 A;  3FM3 A;  4GGG A;  4LLN A;  4UNO A;  2E7W A;  1MJ9 A;  4IPA A;  4Y17 A;  2V1D A;  1K78 A;  2FE3 A;  1WQ2 A;  4XBF A;  4G94 A;  1FP1 D;  3TO6 A;  2Z5U A;  3WGI A;  1B1B A;  5DD4 A;  2CG4 A;  2IW5 A;  3HSE A;  2M8E A;  4L9V A;  2PFB A;  4RGR A;  2LF7 A;  3E5X A;  1J0R A;  5H6R A;  1HQC A;  4A0Z A;  4BXU A;  4A6D A;  5FD6 A;  1OKR A;  5D4S A;  1L3L A;  2RVC A;  4K2E A;  3M1E A;  2WTE A;  3KP2 A;  1YLF A;  4A12 A;  2O3F A;  3P9I A;  4Y13 A;  3RKW A;  2X4H A;  2YX7 A;  4CXF A;  2STW A;  1T98 A;  3DFG A;  4EMS A;  3GYH X;  2W24 A;  4P96 A;  2GXB A;  4HQE A;  1O3R A;  2DT5 A;  2IP2 A;  2FNP A;  1OMI A;  2MH9 A;  3BY6 A;  4MHG A;  2Z3Y A;  4ESF A;  2COM A;  4M72 A;  2P8T A;  2DK8 A;  1P6R A;  2W57 A;  4LG0 B;  1B6A A;  3M8F A;  4A5N A;  3SQN A;  1MZB A;  1FYM A;  3RKX A;  3I59 B;  1UHW A;  4GCV A;  3H3U A;  4WCG A;  2ZKZ A;  1NHA A;  4OMZ A;  1ZG1 A;  2M30 A;  4P55 A;  4R79 A;  4UVC A;  1MJA A;  2ACJ A;  3MEX A;  4WXC A;  1R36 A;  4H0E A;  2IPQ X;  4KIB A;  3E5U A;  2Q8K A;  2VN2 A;  3JSO A;  3KP4 A;  1GXQ A;  4IRH A;  4EGZ A;  5ERI A;  2MD5 A;  3KP5 A;  4AD9 A;  5D6F A;  1KQ9 A;  2ZBK A;  3O3K A;  1IXS B;  2VC0 A;  2OZ6 A;  2A68 F;  2VC1 A;  2VT3 A;  2L4A A;  2OA4 A;  2E1C A;  3KP7 A;  3S2W A;  3KCC A;  3J80 K;  2Y0M A;  2OU2 A;  4AIK A;  3ABU A;  1G3S A;  2A69 F;  3GVA A; 
#chains in the Genus database with same CATH topology
 3DU6 A;  1SD6 A;  4C2U A;  1UZC A;  2LNB A;  1VQ8 I;  4IHY A;  3M8E A;  4MNU A;  1ONV A;  3K4J A;  5HVQ C;  1FBS A;  3PSF A;  1KON A;  1IN8 A;  1P7J A;  1XMK A;  4UB8 C;  2X85 A;  2OUM A;  2Y0S N;  3B73 A;  2HYF A;  2BY0 A;  2WA0 A;  3FIW A;  3GLX A;  2XGD A;  1KQ0 A;  4RB3 C;  5J1U A;  1TQP A;  3X2Q H;  2G9W A;  2DFE A;  2NVX J;  3BTI A;  1ITY A;  4BJT A;  1OCC H;  1NH3 A;  3I9V 2;  1V5E A;  1RRJ A;  2E2H J;  2EV0 A;  3D5S C;  1KU9 A;  3REO A;  5CVI A;  1G4D A;  3JTH A;  3MAJ A;  5K5O A;  4M6V A;  1FMW A;  3BP8 A;  3EET A;  2WWY A;  1H89 C;  5F1J A;  3QOP A;  3ZQQ A;  3W2V A;  3R0A A;  3UNG C;  5HLT A;  2DQR A;  2HOE A;  1SFE A;  1GHC A;  4WXD A;  1YIJ I;  5HS7 A;  4BE1 A;  3V8K A;  3BTJ A;  1MBF A;  2L4M A;  1X19 A;  4WXH A;  1YJW I;  1SAX A;  1ZK8 A;  2OZU A;  4FX4 A;  3WHB A;  5F0F A;  2QEX I;  3DWL E;  4Q4Z F;  4KMF A;  1X1P A;  3L1P A;  1OCO H;  3K4M A;  3SEQ A;  2MG4 A;  3FBI B;  4DZJ A;  2PI0 A;  2HS5 A;  3F8N A;  2NYX A;  4E7Z A;  3HBL A;  3FMQ A;  1DPR A;  4GYI A;  1MBJ A;  2ZJP F;  2Y48 A;  3OR2 C;  2IS6 A;  1S8N A;  1MMD A;  3ERE D;  2LVS A;  4MO7 A;  1ZG5 A;  1FSH A;  2QM3 A;  3VPR A;  4QPQ A;  1YW7 A;  4IXA A;  2L9V A;  1MBK A;  2GA1 A;  3DEU A;  3KYC B;  5EGO A;  5BPD A;  2VUM J;  2VQH A;  1KU2 A;  1YIT I;  3CC2 I;  2NNN A;  3O8G A;  3BRO A;  3VOE A;  4DYC A;  2DMQ A;  5E18 F;  2JQ7 A;  1N75 A;  2LTP A;  3OYB A;  4PUS A;  1YOV B;  2IGK A;  2VB6 A;  2DCE A;  4NBQ A;  1QHH D;  2K9Q A;  3DP7 A;  2L0K A;  4C3J J;  3S15 J;  3HSF A;  2BHZ A;  5D4R A;  2KFD A;  2X6Y A;  1L0O C;  3ZMD A;  2NVT J;  1MDM B;  3CUQ B;  4JP0 A;  2L7K A;  3S14 J;  1TQM A;  2ZSH B;  5IT9 K;  4D5C A;  3VDX A;  2EIL H;  1W0U A;  1LDK B;  1MNE A;  5D5X B;  3BJ6 A;  3TL4 X;  4RDU A;  4CCL A;  1IJW C;  2CW7 A;  2JWT A;  3H9J A;  3S1R J;  3AL0 C;  1EV7 A;  2RNG A;  3CJR B;  2QUF A;  2NAZ A;  4M9S A;  4BQQ A;  3JR9 A;  1J75 A;  2R7T A;  1VI0 A;  2ICW G;  3RI4 A;  4CCM A;  1Z7L A;  4HNU A;  3ZMU A;  2D1V A;  2NS7 A;  3IV5 A;  2DLL A;  2QCO A;  1HW1 A;  2UUZ A;  2AHQ A;  3HZJ A;  3QU3 A;  2NVY J;  4LG0 A;  3F21 A;  2KIS A;  1FJL A;  3VWB A;  2QWW A;  4A69 C;  1WJC A;  2ZXI A;  2KQR A;  1UJ8 A;  3BTL A;  3RZO J;  2NVU B;  4XRS G;  3T1B A;  5HLG A;  1T95 A;  1U8B A;  1O4X A;  5HLI A;  1HLV A;  4A0Y A;  1VQ6 I;  1A5J A;  2LYC A;  2LC2 A;  2R7X A;  3OYM A;  1VQN I;  4EGY A;  1YRN B;  1GVJ A;  1XC5 A;  3RPU A;  3CP8 A;  3ELK A;  5CVU A;  5LHH A;  2UWM A;  3TBI A;  4EM1 A;  2MYS A;  2IT0 A;  1DDN A;  4A3M J;  3BR5 A;  2X1C A;  4CH7 A;  2NXN B;  2FMY A;  4BY7 J;  4X6A J;  1J9I A;  4LB6 B;  2DQL A;  2TRT A;  4CYC B;  4U7D A;  1GUU A;  3B6C A;  3KEQ A;  3ZQ7 A;  3FXK A;  3O8H A;  4ABZ A;  2JTV A;  2VBY A;  1MGT A;  4EJW A;  2BE5 F;  5BS6 A;  2YSR A;  3TO9 A;  3HRM A;  5K1Y A;  2XAF A;  4L5I A;  4II2 A;  2XC7 A;  1K4T A;  1Z91 A;  3QPL A;  1I6X A;  4JX5 A;  3HRU A;  3SYT A;  2O8K A;  1NTC A;  4XOR A;  3TDU C;  3T8R A;  3WTV C;  1GT0 C;  3J80 Z;  2FML A;  1FY7 A;  3R6S A;  4J01 A;  2B63 J;  3H5A A;  3UKG A;  3S1M J;  5CKT A;  4XM3 A;  3OSF A;  4E6K G;  2UZK A;  2NOG A;  2WAQ N;  2FF4 A;  3D5R C;  1MH3 A;  5A2Q K;  3CCE I;  3H5N A;  1ZGJ A;  2DW4 A;  3RCO A;  2H6C A;  1TL8 A;  4B4C A;  4HPQ A;  3FK7 A;  3OYE A;  5BMZ A;  1RR8 C;  3RKQ A;  1ZLJ A;  2OC6 A;  1Z21 A;  2H8W A;  4CZC A;  1E17 A;  3ABM H;  1UCR A;  2FEZ A;  1ZTR A;  1G3Y A;  2HR3 A;  1V5F A;  4BU2 A;  1FLI A;  4FE7 A;  3KYL A;  3SDG A;  1ZRF A;  1AA7 A;  4RGU A;  2QQB A;  4AVZ A;  2ISZ A;  1K6Y A;  2L7M P;  3GO5 A;  4BAC A;  1Z1D A;  3BCA A;  1U5T A;  1LVK A;  5BQT A;  2AXL A;  1IUY A;  3M8J A;  3E0J B;  3CJN A;  1YQA A;  4QWQ A;  2HQ5 A;  3CJT B;  3RDI A;  3ZP5 A;  1BI2 A;  5FKL A;  1R1V A;  1WJD A;  2QA4 I;  4Z2Y A;  3LOC A;  4ZYE A;  1YTY A;  3LSH A;  3BG7 A;  2DMU A;  5F0C A;  1J5Y A;  4CCJ A;  4EJO A;  2DA2 A;  2XV4 S;  1KZH A;  3BJA A;  2R7R A;  4L0Z B;  3ASO H;  3GFJ A;  5HOD A;  3I64 A;  2QSF X;  2HVR A;  2YX4 A;  3RJP A;  1JGG A;  4IKF A;  1T2K A;  1F36 A;  4BEH B;  3LQQ A;  2X1E A;  1IRG A;  3MQ0 A;  2P5L C;  1ZKG A;  2E1N A;  1Q1H A;  4H4K C;  2F48 A;  2FNA A;  2XHK A;  2NS8 A;  3BR6 A;  4MTD A;  1IN4 A;  1X1D A;  2Q2E A;  4BBR J;  3L09 A;  3OYL A;  2P5V A;  4I09 A;  1Y1V J;  3CF2 A;  3CCJ I;  2L5Q A;  5M3M J;  1XDS A;  3FX3 A;  3MKW B;  2MC4 A;  4FQG A;  1OJL A;  1LKX A;  1QPM A;  3LSR A;  2GIZ A;  1IN5 A;  4YRV A;  2RDP A;  5TIS C;  2W25 A;  3RQ4 A;  4DIQ A;  2XRN A;  2BW3 A;  4AC0 A;  1R22 A;  3CUO A;  4GYG A;  4PGG A;  2QSH X;  1XGS A;  3BJO A;  2R7D A;  1KGS A;  1Y8R B;  1WKM A;  3WTU C;  2R93 J;  1DQU A;  1WI9 A;  3COA C;  5J47 A;  5F1R A;  2GQQ A;  2XGE A;  3K9T A;  5IT9 Z;  4NQW A;  2VOO A;  3GZN B;  2KIU A;  1MNM C;  3I53 A;  3PNV A;  4LIU A;  1R1T A;  5K7Z A;  1K7A A;  1P7I A;  2AO9 A;  3DCF A;  2PQ8 A;  2O7O A;  2AQF A;  1BIA A;  1ETO A;  3D1N I;  1JUP A;  4HRI A;  3HUG B;  5IPA A;  2DK5 A;  1S72 I;  1Z9C A;  1D3Y A;  2RRE A;  2PEX A;  4LOC A;  3PNY A;  1HW5 A;  4D7M A;  1D1A A;  3WTT C;  3LA2 A;  2R0Q C;  1OCT C;  3L00 A;  5L3C A;  4ZJZ A;  1H9T A;  2IA0 A;  4UV8 A;  4HX4 A;  3MKY B;  2QBY A;  5FLM J;  2HDC A;  3M07 A;  5DYM A;  3V7C A;  2EJR A;  1PJR A;  1LUJ B;  3QPH A;  2MD0 A;  1X4O A;  2K9N A;  1VQ4 I;  4BKX A;  3A4C A;  1ZGW A;  2Z99 A;  1T6S A;  4ZYA A;  5FD5 A;  3KZZ A;  3R4K A;  3WG9 A;  4Q5S F;  1XTA A;  3BCB A;  3CQZ J;  2HGC A;  4B8X A;  4MGR A;  4QPO A;  1IG7 A;  5E1Z B;  1UHM A;  3HSR A;  5F27 A;  5D8K B;  2K9S A;  3EPZ A;  2STT A;  2D45 A;  4P1W A;  4OWR B;  1YHQ I;  3K70 C;  3CCS I;  3LL7 A;  5LRS A;  1ZG3 A;  3QP6 A;  2FOK A;  1MND A;  1O7L A;  3BQY A;  1JUM A;  3I55 I;  2MH2 A;  3LSG A;  3RKY A;  3OYA A;  4ZDO A;  2ELK A;  4UB6 C;  3N97 A;  2E7X A;  3VYU B;  5LRR A;  2LFB A;  4A3L J;  4N9H A;  2VE8 A;  1PP7 U;  5M3F J;  3PL8 A;  3GME A;  5B1A H;  3K1P A;  1IDY A;  2QGU A;  4KIG A;  1DP3 A;  2IVM A;  1ETW A;  3CTA A;  2BY2 A;  3MZY A;  4XLA A;  2M2E A;  3OMY A;  1K61 A;  1LE8 B;  2ZO4 A;  1RIO H;  3MKZ A;  3WHC A;  5JHU A;  3K4N A;  3W2W A;  1AHD P;  2MW8 A;  2HKO A;  4IF4 A;  1NG7 A;  3L2W A;  2VJ4 A;  3ABL H;  3M1C A;  4JX4 A;  2CUJ A;  3VB2 A;  3L2C A;  2VON A;  1QQI A;  1A04 A;  1S3J A;  3ZRG A;  3NAR A;  1IRZ A;  5J8F A;  2M7B A;  2HI3 A;  2CV2 A;  2CQK A;  4WK8 F;  3OSG A;  3IP4 B;  1IDZ A;  3G73 A;  4UVB A;  1JKR C;  3IKT A;  3F8C A;  2VKD A;  3K0L A;  1LPQ A;  1LEB A;  1LDD A;  1JGS A;  2D1H A;  1HC8 A;  2CUZ A;  3IAM 2;  4HBL A;  5FO5 A;  3ROU A;  5GTH C;  1T56 A;  1TT0 A;  4NUB A;  5DS9 A;  3SZT A;  3OYC A;  4ZTF A;  4JOM A;  1XGM A;  4HNT A;  2HZT A;  2GZW A;  1S29 A;  4HV5 A;  5KAF C;  5FB2 A;  4DGW B;  3BT9 A;  4HZF A;  4CCN A;  2DU9 A;  5HDN A;  3KPH A;  4I02 A;  4KIT B;  2K4J A;  2HNH A;  2V1N A;  1D0Z A;  5GAG J;  1MMS A;  3ZQG A;  3ZCO A;  2Y9Y A;  2LBF A;  3FKJ A;  5DCF A;  1BOB A;  1X1B A;  2KZG A;  1SFO J;  1MJB A;  2XIG A;  3FXU A;  4MLO A;  2LG4 A;  1ODD A;  5CVV A;  5J40 A;  4YII A;  2R5Y A;  2P4W A;  3PSI A;  1F43 A;  1G59 A;  1CGP A;  3ZXS A;  2JUC A;  4N4O B;  2WBM A;  4BDY A;  3NAU A;  2VJI A;  4KJZ A;  1ZR4 A;  4EJT A;  2R92 J;  4D0P A;  3HOS A;  3ZGK A;  1WVR A;  5E3M A;  1LVA A;  1OCR H;  1BC7 C;  1XMA A;  2E2I J;  1FNN A;  2I10 A;  3FHZ A;  4OMY A;  3HL2 A;  4P5O A;  5C4X J;  4GRI A;  4RAG A;  1DP7 P;  2AS5 F;  1N77 A;  5FLX Z;  2F5E A;  2WAD A;  1DGW Y;  3RPQ A;  3IC7 A;  3S3O A;  1P4A A;  3CLO A;  3KLN A;  4A6E A;  4XSX F;  3OYH A;  4IHX A;  3FXM A;  2E36 A;  5KK1 A;  1TQI A;  2CO5 A;  2H6B A;  2IA1 A;  3DPL C;  4YFX F;  2L54 A;  1BJA A;  4NB5 A;  4HOB A;  2DA1 A;  1W4M A;  2DMP A;  1OYI A;  3GBG A;  1SVO A;  3A02 A;  4ZZL A;  3K4C A;  2HPM A;  3K1N A;  4X1E A;  4XLN F;  3IRR A;  1F1Z A;  4GO1 A;  3A01 B;  1OIS A;  1X3W B;  2KIF A;  2KRF A;  2HWV A;  2OQG A;  1U5T C;  4IRG A;  4A3E J;  3GCM A;  3GFL A;  3R60 A;  2E2J J;  2O5R A;  2XAU A;  3J7A O;  2EA2 A;  1QHG A;  3E7L A;  3I0T A;  1XSD A;  2JT1 A;  3MCZ A;  3M9A A;  1E3O C;  5LHG A;  3HUG A;  1ZQ3 P;  1I1G A;  3ZQH A;  3KFW X;  3GW2 A;  1G8X A;  1X3Z B;  1TNT A;  3MZH A;  1IRX A;  4KYW A;  5EEG A;  3LA3 A;  1RUN A;  1HSJ A;  3WTW C;  2ZME B;  3KEO A;  1TBX A;  3U2R A;  3OOP A;  2EZL A;  1H88 C;  2LKS A;  3EQL F;  1FOW A;  2UXN A;  1ZRD A;  4D9J A;  1B59 A;  4A0X A;  1W0T A;  4MEX F;  2DFF A;  4BJ5 C;  4LMY A;  1XD7 A;  4GDF A;  1I5Z A;  5DEQ A;  5GTI C;  2EBI A;  1ZAO A;  1Z05 A;  3WE3 A;  4I6Z A;  4A3J J;  1FTT A;  2ZFU A;  2F6C A;  4UY8 I;  3C3W A;  4XMY A;  1FOX A;  3KYD B;  2X51 A;  4PCQ A;  2WAQ A;  3IHU A;  5IT3 A;  1DGR M;  4PJ0 C;  3JRH A;  5L3G A;  1YX5 A;  4ENM A;  2B9S A;  2CV1 A;  3OIO A;  4CDG A;  1FPQ A;  5D5V B;  2IGO A;  5J8C A;  3TQN A;  1YX3 A;  1FWZ A;  3EUA A;  2Z9O A;  3OS0 A;  3JRB A;  3Q5F A;  2J5P A;  3LMM A;  3AG2 H;  1GV5 A;  2PJR B;  4C3I J;  4R1H A;  3HM5 A;  5ICE A;  3GTP J;  2R7Q A;  4ESB A;  1Y39 A;  1KU7 A;  3CLQ A;  1LFP A;  5HDG A;  3BOQ A;  5FKM A;  2CJJ A;  3BR3 A;  2EZH A;  4AYB N;  1LE8 A;  2LDU A;  3O2P E;  2FU4 A;  4ENN A;  2GOM A;  1Z77 A;  2KP6 A;  1HKS A;  3H36 A;  3ASN H;  9ANT A;  2F5D A;  3WGH A;  3GWZ A;  4IHW A;  3ZMZ A;  1R5H A;  2QKL B;  1RET A;  2E60 A;  3DPT A;  3K69 A;  4OIN F;  4BAY A;  1D8K A;  3P9K A;  2XF7 A;  4BHB A;  3CD6 I;  3PIO F;  4L9N A;  3A1Y A;  4IQ4 A;  1V4R A;  2B0L A;  3EUK L;  5LHI A;  4J00 A;  2M9H A;  2M0M A;  4FX0 A;  2LOO A;  4IRI A;  3S2D J;  5ED4 A;  3V42 A;  4B09 A;  2W85 A;  2TCT A;  3W6V A;  4AIJ A;  1DU6 A;  2HXI A;  5GPC A;  1TC3 C;  4XOP A;  1BI1 A;  4YFN F;  4KT5 C;  4V2G A;  2BYV E;  3KIO A;  1VFC A;  3TED A;  1XSV A;  2IBD A;  2W82 A;  3G3Z A;  5IP6 A;  1SD7 A;  2GOX B;  1YS6 A;  2X6O A;  3VSL A;  1T0F A;  2EFO A;  4LJZ F;  4B47 A;  1SFX A;  1U2W A;  4ZYG A;  1NG6 A;  2O0Y A;  4XN3 A;  2BVL A;  5ICF A;  4BYY A;  2L01 A;  3QOE A;  5JR3 A;  4IX7 A;  2F5C A;  3RTR A;  4HX7 A;  5E17 F;  2A6T A;  5K5Q A;  5CQE A;  1IXC A;  5EZG A;  4E70 A;  2DPD A;  5FKN A;  2LKX A;  1A6Q A;  2ETH A;  1PUE E;  3ABT A;  3PFY A;  3RQI A;  4FCY A;  3OIQ A;  5KHD A;  2HDD A;  3ZQC A;  1R71 A;  2KJC A;  2H94 A;  2EIK H;  5EF6 A;  1QZZ A;  2XAQ A;  5K7H A;  2CFO A;  4DW6 A;  3JSP A;  1VQP I;  2V1X A;  2CSO A;  2HVQ A;  3HPH A;  2V9K A;  3LSI A;  2RAE A;  3DBL B;  4ON0 A;  2LRD A;  3Q0V A;  3LNQ A;  2M3A A;  4L9T A;  4XLE A;  2DI3 A;  2GBY A;  2JVG A;  3F8M A;  4JQF A;  2DYS H;  5CVR A;  3F22 A;  2IJL A;  3BWG A;  2DMT A;  3FK6 A;  3CO7 C;  1RPW A;  1YIO A;  2R7F A;  1UG0 A;  2K85 A;  2E1O A;  2OQR A;  5FLV A;  2V6C A;  5DUI A;  5KCM A;  2RQP A;  3S32 A;  1FOK A;  2VKE A;  1V54 H;  5L3B A;  1F5T A;  2CQN A;  1SEU A;  4DOZ A;  3ZMV A;  2Q1Z B;  1VQ9 I;  3H35 A;  2CRG A;  4A2U A;  2Y30 A;  3K4L A;  4I01 A;  4MTE A;  3ZMT A;  3BPV A;  1P4W A;  2W84 A;  2QQ9 A;  1B8I A;  4I99 C;  1X2M A;  1SAU A;  1W5C C;  4PJL A;  5EDN A;  3J7A Y;  4NDL A;  1TWF J;  4RAZ A;  2JA7 J;  4HST A;  4M9Z A;  1W7P B;  1Z3X A;  2EV6 A;  2P5K A;  4ZZD A;  2R7U A;  2ZJQ F;  3F9K A;  3SEZ A;  3E97 A;  1NK3 P;  3IH4 A;  3H9Q A;  1QA6 A;  3BC8 A;  1HOM A;  5E20 A;  3AFH A;  3CDH A;  2WY8 Q;  1I50 J;  1IO2 A;  5CVJ A;  4IQJ A;  4ZDL A;  2NOJ B;  2DA6 A;  5E3N A;  4BE2 A;  1I3Q J;  3SXY A;  1YFH A;  3JCU C;  5DCM B;  2K3P A;  5D5W B;  2BXY A;  1KYZ A;  1BBY A;  1LFU P;  4XQF A;  3G71 I;  3M7G A;  3I4P A;  1D8J A;  1OR7 A;  1W36 C;  4KNY A;  5IP9 J;  2A6H F;  2LSO A;  4MFD A;  3KP3 A;  4O6J A;  3TOA A;  2AXT C;  2XPU A;  2E5Z A;  4XK4 A;  1R4N B;  3MN2 A;  3I59 A;  2B7E A;  2PN6 A;  3EYI A;  1VQL I;  3DU5 A;  4HW0 A;  3OYF A;  1BR2 A;  1PUF B;  5FFZ A;  4CZZ A;  4KA4 A;  3C2H A;  4U0Y A;  2JRM A;  4UUS B;  2K4B A;  1ZLK A;  5EG0 A;  4PJJ A;  4LLL A;  3W6J B;  1AU7 A;  2ZXW H;  1GVD A;  1B72 A;  5EEH A;  3BG9 A;  1CF7 B;  1KQ8 A;  2LD5 A;  4XKC A;  2EZK A;  2W4S A;  3GF2 A;  3WU0 A;  1ENH A;  2JMW A;  1W7P D;  4II3 A;  2PJR A;  3BQZ A;  2ECB A;  1HST A;  1YJ9 I;  1YO5 C;  4ZDP A;  3HEF A;  3T8T A;  3DKY A;  4HF2 A;  3HJE A;  1T8I A;  3D0S A;  1SMY F;  2OCC H;  4KIC A;  1BC8 C;  3GXO A;  3U21 A;  3OY9 A;  3TO7 A;  1JHH A;  2QF7 A;  2CS3 A;  3FIS A;  3WGG A;  2VJJ A;  3OYI A;  3KP6 A;  1SMT A;  2ZXJ A;  2UXX A;  1BOA A;  4S04 A;  1WSU A;  1JHF A;  2L02 A;  4OIR F;  3S3M A;  1SD5 A;  1YYV A;  1R5G A;  2VOP A;  5E1X A;  5ILV A;  3QYF A;  2JPC A;  3WTS C;  5C44 J;  4WX9 A;  1HXD A;  4MQV A;  5HS8 A;  2EV5 A;  1V5G A;  2PLY A;  4RM3 A;  3W2A A;  4RA2 A;  5FGM A;  2QVO A;  2VBX A;  3KE2 A;  4G6Q A;  3S2H J;  1R7J A;  2VIX A;  2XAG A;  2HU9 A;  2XKO A;  5TGT A;  3R0J A;  2X6W A;  1BL0 A;  1BM9 A;  2X1D A;  1FYK A;  3TOB A;  2BV6 A;  5FRN A;  3PO3 J;  2Y75 A;  3ULQ B;  5CJ9 A;  1ETV A;  5BPI A;  4B44 A;  3BG6 A;  3MMY B;  3OYD A;  1HBX G;  1FTZ A;  3HPG A;  1ETQ A;  2EWN A;  4RB0 A;  4OAY A;  1HDP A;  3HXL A;  3DLA A;  4KN7 X;  3GTJ J;  1BI0 A;  3LAJ A;  3DPU A;  3WU2 C;  1JKP C;  3OR1 C;  3ISP A;  5F6F A;  4BNC A;  5M5W J;  4HAM A;  2HOA A;  1BIB A;  1FX7 A;  2BBY A;  5F0H A;  5JVT A;  3LSJ A;  4B48 A;  5HNH A;  1IGN A;  4QTR A;  2IS2 A;  5KNL A;  2V7F A;  2CFX A;  3C2B A;  2VL8 A;  4I0B A;  3V4G A;  5J4V A;  1N25 A;  1VF9 A;  2GAU A;  2DA7 A;  3CCR I;  3JTG A;  3CCV I;  2Y69 H;  1J7K A;  2HQN A;  3IAS 2;  1JJ8 C;  2VT2 A;  2DPU A;  4FIS A;  4HNV A;  4ZYD A;  3RYR A;  3PJR A;  2DOF A;  1HKQ A;  1Y56 A;  3F6O A;  3S3N A;  1H8A C;  1K78 B;  4CA0 A;  4OIO F;  1RNL A;  3U1K A;  2FQ4 A;  1K79 A;  3CCY A;  3T0Y A;  1JXS A;  2JZY A;  3HHH A;  1YW8 A;  3H1C A;  3K1M A;  4M71 A;  2K9M A;  4BUP A;  4LGW A;  3PQK A;  3AL0 B;  1MBE A;  3S8P A;  1XG1 A;  3ERM A;  4AIH A;  3PIP F;  2V26 A;  3G2B A;  1ZAR A;  4RAY A;  2XUB A;  3HRS A;  1RC9 A;  4MFE A;  1DUX C;  3G1L A;  4GFB A;  1QO0 D;  4XKB A;  1T0F C;  3ZR8 X;  2KHM A;  4G8X A;  4M74 A;  3E1S A;  2QEN A;  2VPL A;  4LK0 F;  1ERD A;  4E7L A;  1C0W A;  1MMA A;  4LFU A;  4LD5 A;  2BY3 A;  2ZFW A;  2H09 A;  3SZG A;  1W7P A;  1MD0 A;  3DKX A;  4YFK F;  1MDM A;  3FXO A;  3CUQ A;  3GUD A;  1ZH5 A;  3S1Q J;  1P92 A;  5AON A;  1XX5 A;  3IUO A;  5K5R A;  1TTY A;  4JBA A;  3FXJ A;  5E3O A;  1RUO A;  1XGN A;  4V19 K;  1UFM A;  2MAB A;  3ZPL A;  3BG5 A;  4RGS A;  4A3F J;  1YJN I;  3M4O J;  2V9P A;  3BDD A;  4FET A;  2DA3 A;  2NRA C;  2A5Y B;  4AYB A;  3ZN1 A;  2VAS A;  1MMG A;  4G6D A;  3E6B A;  2KDZ A;  2RN7 A;  3OYN A;  4ENJ A;  2HOT A;  5L3F A;  3JRF A;  4NC7 A;  4PZJ A;  3NRV A;  3HGY A;  1NK2 P;  4LLG F;  1RES A;  4FAS D;  1FOY A;  2JJ7 A;  3DQV C;  1O3Q A;  3MKL A;  4MQ9 F;  5F08 A;  3OYG A;  4M3D A;  5CQG A;  5LGU A;  3BTC A;  1QRY A;  4XL9 A;  4HA8 A;  1HCR A;  1GDT A;  1UG2 A;  4IO9 F;  2XVC A;  3Q0U A;  2QKM B;  5IOZ A;  3FKI J;  3GFM A;  4KT6 A;  5J6X A;  4ZH4 F;  3AG1 H;  2D5V A;  4DJA A;  1D1C A;  1YE9 A;  2CQQ A;  2XPW A;  3LFU A;  2P7C B;  5CYV A;  1YRN A;  3QPT A;  1JUS A;  4DBQ A;  4RMN A;  2Y0S A;  3PFI A;  2HVS A;  1LJ9 A;  3E6C C;  4QIW N;  2JPB A;  3KX2 A;  2CU7 A;  4CYC A;  1TZL A;  4FE4 A;  4F93 B;  4D5F A;  3F8B A;  3WTZ A;  4F91 B;  4G7O F;  1UB9 A;  3SHF A;  2ZB9 A;  2YU3 A;  4EV0 A;  1BA5 A;  4BQO A;  5J1Y A;  5E79 C;  3VEP A;  2XF6 A;  3I54 A;  2M5W A;  2P81 A;  2CGP A;  5LEK A;  3PUB A;  4HQM A;  1JT6 A;  1J59 A;  4HEA 2;  1EF4 A;  5JVG F;  1OLT A;  4Q48 A;  1OR7 C;  4ASN A;  2ESN A;  3S1N J;  2DJI A;  2LRE A;  2FBI A;  2VI6 A;  5A2Q Z;  2CUF A;  2PMU A;  2R7S A;  5K7F A;  3DV8 A;  5HOO A;  2A5W A;  1MSF C;  1G3T A;  3QYE A;  1AWC A;  2GA2 A;  2VQG A;  3N4M A;  5DD8 A;  2DT7 B;  4XID A;  4AVP A;  2XAJ A;  1AKH B;  1WWX A;  3CCM I;  4OIP F;  2E19 A;  4N9I A;  5IYD J;  2EIM H;  2IAI A;  2WC2 A;  1B9N A;  3MFK A;  3CCL I;  1D1B A;  5HS9 A;  2A07 F;  2XPV A;  4PJN A;  3WG7 H;  3P7N A;  1MKM A;  2HPI A;  4HLY A;  4IEJ A;  4XR6 A;  1FIA A;  3CMA I;  1D0Y A;  2M34 A;  1TLH B;  4BQA A;  4U88 A;  2HZD A;  2Z1D A;  1VQM I;  1R23 A;  1ULY A;  1ETK A;  4IHV A;  2PMZ N;  1FYL A;  4UXN A;  3ZOB A;  5D5U B;  2YUS A;  2O8X A;  1TT5 B;  1UAA A;  2O03 A;  3DTK A;  2RGV A;  1K6O A;  1ZEL A;  1UHS A;  5DM7 F;  3ZQF A;  3I3L A;  4L0Y B;  4U0W A;  5J3L A;  4E7J A;  1IRF A;  2HEO A;  4U7B A;  2IA2 A;  2VPR A;  2A61 A;  4UUV A;  2NS0 A;  2MGQ A;  2JA2 A;  5EEA A;  2MC3 A;  2XB5 A;  1FEX A;  1RZ4 A;  2QLZ A;  4DQ2 A;  1VQ5 I;  1H0M A;  1ZYR F;  2E1M C;  4WF2 A;  1XS9 A;  2HXO A;  2FSW A;  3NEU A;  5LGN A;  5FJ8 J;  5JLW A;  2FRH A;  2LP0 A;  3LFK A;  2RKH A;  4BEH A;  3HKZ N;  2I5U A;  3CJQ B;  3FM5 A;  5L3D A;  4L18 B;  1A31 A;  1QPI A;  1QBJ A;  4PDK A;  2JVH A;  2A6E F;  4PGH A;  1BI3 A;  5ILS A;  1YS7 A;  4W1U A;  2JSP A;  2MLK A;  3RIR A;  3CC4 I;  1M1E B;  4F52 A;  1JKO C;  3T5X A;  3QP5 A;  3BPX A;  4B3A A;  3SFZ A;  2BEO A;  4G7H F;  2WAE A;  3GLL A;  1FIP A;  1K4S A;  2YPR A;  1X4P A;  5ILU A;  2FBH A;  5IYC J;  3L9F A;  4UHT A;  4KIS A;  2YU9 J;  1S7O A;  1YI2 I;  4HSR A;  2FD5 A;  2YS9 A;  3HOX J;  2O6G E;  4JYK A;  5EGO B;  2R3S A;  3G4S I;  4ENK A;  2E71 A;  1U0J A;  3JAM K;  2NNY A;  2CV0 A;  2KRH A;  1OYY A;  4PJM A;  1XCV A;  1WCM J;  2ME0 A;  2G7U A;  1MBH A;  2QZ8 A;  4FHT A;  1O7F A;  2RQQ A;  1FMV A;  1HF0 A;  3LST A;  1RR7 A;  1PYV A;  2P6T A;  1B9M A;  1SFU A;  1IAW A;  2OJE D;  2CYY A;  2KT0 A;  5GAD J;  3BLY A;  3U9G A;  1DPU A;  1ON1 A;  2DN0 A;  3PUF A;  5BNG A;  2DT6 A;  1EA3 A;  2EK5 A;  4XKW A;  2JRT A;  4B3X A;  5KAI C;  3D5L A;  4U0V A;  3K4B A;  4I98 B;  1I27 A;  4BE0 A;  2Y31 A;  4X0G A;  5FKO A;  3ECO A;  1VZ0 A;  5LGT A;  4IHS A;  2LH9 A;  2DOD A;  3IH2 A;  3SZP A;  3G1O A;  3S93 A;  3H3V K;  4HDU A;  4LG3 A;  4L9J A;  4LK1 F;  2RV8 A;  2V1U A;  1IXR C;  1D5Y A;  3J81 K;  1REP C;  3HYI A;  2PG4 A;  2IXS A;  3OS2 A;  1WJ5 A;  5IP7 J;  1T39 A;  2XRO A;  1SVL A;  4CCK A;  2DDA A;  4CO8 A;  1R6R A;  2E5N A;  4I7H A;  4ZYH A;  5TRD A;  1SAN A;  2P7V B;  2L7F P;  1U9O A;  2CQ7 A;  5H6Q A;  3F23 A;  3CCQ I;  3GFI A;  4RM2 A;  5AIQ A;  3W6K B;  5E8I A;  3Q9V A;  5LBQ A;  2ID6 A;  2BXZ A;  3K70 D;  3CUQ C;  4BBS J;  3ZMS A;  4Q47 A;  3RYP A;  3BR1 A;  3IWF A;  2MFZ A;  4A3G J;  1XMX A;  5LD2 C;  3M3Y J;  4EM2 A;  1ZRC A;  2FUG 2;  1W5S A;  2RC4 A;  4BGD A;  2XAH A;  2DAO A;  3DEW A;  2IGN A;  3MZ8 A;  2IRF G;  4B43 A;  2PBI A;  5LLQ A;  3JRA A;  3OL3 A;  2MLG A;  1I1S A;  3GTQ J;  1TP4 A;  4EQQ A;  3GEZ A;  3ZQL A;  3S16 J;  4AM3 A;  2EPF A;  1APL C;  1TW2 A;  4AWX B;  2VOD A;  1V55 H;  1WI3 A;  1ZN2 A;  3ESW B;  3Q9S A;  4YG2 F;  3CO6 C;  5BOX A;  1O57 A;  4YIR X;  1Z67 A;  3J7Y J;  4CHU A;  3DEE A;  2ISY A;  5HDK A;  5ICC A;  1ETY A;  5M5X J;  1JTY A;  1LDJ A;  3DTI A;  5HLH A;  5GPA A;  2BY1 A;  5DV5 A;  3QYB A;  1Z3Y A;  2HYG D;  3ZQI A;  5FRM A;  3FBN B;  3HHG A;  1BW6 A;  2LY9 A;  4XLH A;  4FT8 A;  4EJV A;  1KA8 A;  3DTE A;  3MVP A;  5D8L B;  4PK4 A;  4CSW A;  2F5V A;  3I71 A;  4RS8 A;  2JA5 J;  3TGN A;  1VQK I;  3WTY C;  2XSD C;  5LEJ A;  3B6A A;  4BHC A;  2XRL A;  2A3S A;  1WFX A;  3JRC A;  3HOW J;  5F64 A;  1JTX A;  3V8J A;  4HLX A;  5EZH A;  3KLO A;  2HQA A;  3HTS B;  2GIV A;  3UR3 C;  1YW9 A;  3RPU D;  3GTL J;  1KYW A;  4UUT A;  1AOY A;  4PFP A;  3R61 A;  1HA8 A;  2Q0O A;  3TDZ C;  4OU0 A;  1U78 A;  2ID3 A;  2DOE A;  3QRF F;  5ICG A;  4BL0 B;  1VTN C;  2KPM A;  1VND A;  2OAZ A;  2DFI A;  3HOT A;  2AQE A;  1FC3 A;  2F4O B;  2QQA A;  4MEY F;  3IL2 A;  2K40 A;  1U5T B;  4XLP F;  4M6Y A;  2M4K A;  3H0G J;  4KMU X;  3RSN A;  1TNS A;  3DBR B;  2DJN A;  4KUM A;  1XGO A;  2HQR A;  3DLL F;  3GTM J;  4KDP A;  1EH8 A;  2I8D A;  1GV2 A;  3KZI C;  2W48 A;  2X0L A;  1S7A A;  2KIM A;  1W1W E;  2DMN A;  1OYW A;  5EYR A;  2L3D A;  4XRM A;  1Z6R A;  4M3F A;  2C6Y A;  3ML6 A;  2K27 A;  4EVI A;  1R00 A;  2KKO A;  1TWA J;  2X6X A;  2VXD A;  2WV0 A;  3TKY A;  1CQT A;  2DO7 A;  1IN7 A;  3GZ5 A;  1X58 A;  4XKV A;  1Z6T A;  4Y33 A;  3FZV A;  2N8G A;  2WB1 N;  4BY1 J;  2CW0 F;  2EH3 A;  4L5J A;  2LF8 A;  2Q2E B;  1D0X A;  4O5V A;  4BQN A;  1K83 J;  3A01 A;  5DM6 F;  3JAM Z;  2IS1 A;  3LSP A;  4Y15 A;  4HF0 A;  1XN7 A;  3K4K A;  2DDB A;  3AG3 H;  2DTR A;  4F55 A;  1F4K A;  2DBB A;  4U87 A;  4YIF A;  4C3H J;  4UV9 A;  2HOS A;  3C1D A;  2BW3 B;  4A3I J;  3BR0 A;  3VYR B;  2ZNY A;  1R58 A;  4KIF A;  4ANJ A;  2M87 A;  2EZI A;  1I6H J;  4RGX A;  3FMR A;  2BOL A;  2KDO A;  1OPC A;  2L7Z A;  4AUX A;  1FZP B;  4RLF A;  2ELJ A;  2XB0 X;  1WRJ A;  4NQW B;  1IW7 F;  2VBW A;  4KFC A;  2F4I A;  3A03 A;  4F7Z A;  1HW2 A;  2ZME A;  3E6D A;  3G1M A;  4A3C J;  1XSX A;  2OTJ I;  1ZRE A;  2R5Z B;  2F5F A;  3BR2 A;  3KET A;  1GLN A;  5JFR A;  4DNC A;  1FP2 A;  4HV6 A;  3J81 Z;  1WPK A;  3GTG J;  2P0W A;  3L2Q A;  1F9N A;  3BG3 A;  1EJ9 A;  3WTX C;  3V8L A;  3HTU A;  2FXA A;  2VE9 A;  2K5C A;  2LY1 A;  3I4N J;  3NWT A;  2R7Z J;  2QBY B;  2OBP A;  1USS A;  4YEL A;  3JRG A;  1T38 A;  2ZJR F;  1XCB A;  2PX9 A;  4IHT A;  1JE8 A;  2ZCW A;  4E7S A;  1J2X A;  4HDV A;  4KN4 X;  5M5Y J;  2ELH A;  2YR2 A;  3Q0W A;  2ME6 A;  1V3F A;  1ORK A;  4UVA A;  2RNJ A;  1DU0 A;  3QOD A;  2F4M B;  2M0C A;  2EFW A;  4BXX J;  4QLC U;  2FA5 A;  4XRS A;  2XDV A;  1STZ A;  1WJB A;  4RLQ A;  1TW3 A;  1LB2 A;  2W1O A;  2P6S A;  5J1R A;  4EJU A;  2D2W A;  4CGZ A;  3WOD F;  2PMZ A;  4IOA F;  2KZV A;  2PMH A;  2VQC A;  1SVM A;  2F2E A;  1G2H A;  1FT9 A;  3FXQ A;  2QQ8 A;  3FXR A;  2M45 A;  3TP0 A;  3HDD A;  2CWE A;  3K6G A;  1WH7 A;  2KL4 A;  4XOT A;  4IVN A;  2R7W A;  2ECC A;  4XSZ F;  3O6B B;  2M7A A;  4EAT A;  5DDG A;  1S6L A;  1QNT A;  2LKP A;  2M1B A;  2KLO A;  4QSH A;  4E7K A;  2H27 A;  1U6G A;  4E7H A;  4G6T B;  4RB2 C;  1SD4 A;  3IWZ A;  4NC8 A;  4M3E A;  3H3Z A;  1X1C A;  1OQY A;  3N05 A;  3HOV J;  2CH0 A;  5JI6 A;  2H1L A;  1X1A A;  3QU6 A;  3BZK A;  1BN5 A;  3VYT B;  2E35 A;  4TV7 A;  6PAX A;  2VQL A;  2Z2S B;  1U3E M;  1RI7 A;  1EH6 A;  2MA3 A;  4A3D J;  4I76 A;  3HKZ A;  3FDY A;  5F04 A;  2GXG A;  3SFI A;  2DOA A;  3E5Q A;  1E0E A;  3GX4 X;  3VSK A;  1G6N A;  1G3W A;  1JI8 A;  3E6M A;  2CW8 A;  1QZE A;  3CES A;  3HOZ J;  3E3V A;  3DKW A;  3FF5 A;  2HDW A;  1ACI A;  2VXZ A;  2H1K A;  3AAF A;  4WWC A;  4ETS A;  2VLA A;  3GZ6 A;  5JLX A;  2KMU A;  2MSY A;  2R7V A;  2TDX A;  1U8R A;  1MSE C;  2GM4 A;  4DBR A;  4CCO A;  3WU1 B;  2XGX A;  4DYR A;  1IV8 A;  1MW7 A;  4N0B A;  3CMY A;  3KZY A;  4M3B A;  3FHN A;  1QVT A;  3CF5 F;  3F8F A;  1R4M B;  3PM1 A;  4BXF A;  3GTK J;  5FRO A;  1QU3 A;  5CPR B;  5AIP A;  3I5U A;  2LBF B;  3FWE A;  5TJJ A;  5L3E A;  1FBU A;  2E34 A;  3EUH A;  3Q3S A;  3CMM A;  1IF1 A;  2W7N A;  2G7H A;  4DYQ A;  1PP8 F;  1Z0X A;  4IJA A;  1X3U A;  5E8G A;  3OV8 A;  2K9L A;  4P9F A;  4I2O A;  3K2Z A;  4M9X A;  2R5Y B;  1KU3 A;  2ADU A;  2V79 A;  4PFO A;  4AID A;  3EYY A;  1FBQ A;  1I3A A;  4B1R A;  2LMD A;  3LQR A;  2DYR H;  2IEK A;  5FFX A;  1UST A;  2ESH A;  3LSK A;  4NHJ A;  1WJF A;  2FBK A;  2XF5 A;  3RZD J;  1TWH J;  3F6V A;  1T08 B;  4XNF A;  3BZ6 A;  5B66 C;  3TMO A;  1JT0 A;  2DXI A;  3HOU J;  3V7R A;  3H0D A;  5FKK A;  2G0E A;  4Y4R A;  2O9L A;  2OTL I;  4BHP A;  1BR4 A;  4A93 J;  3C7J A;  2PJP A;  4JK1 X;  1UEL B;  2HTJ A;  3L2U A;  3LAP A;  3FMS A;  4CYD A;  2LR8 A;  4CIC A;  4A3K J;  4ZTJ A;  4RB1 A;  2XAS A;  3I56 I;  1Y6I A;  2BZT A;  4I0A A;  1Z7U A;  1PDN C;  3EDP A;  4OIQ F;  4G9Y A;  4BS9 A;  3GTO J;  3WE2 A;  2L9R A;  3SDB A;  5FLX K;  2J5O A;  3MWM A;  3LSM A;  1MMN A;  2A05 A;  2HTS A;  1U9N A;  5IYB J;  3A2K A;  2V9V A;  1IN6 A;  1ZGA A;  3PNT A;  4S05 A;  4C2T A;  3U1D A;  2FJ1 A;  1VQ7 I;  4XLF A;  2MBF A;  2OCE A;  1PVE A;  1R1U A;  1Y0U A;  2KJB A;  3KEY A;  3PQJ A;  3VYS B;  3OS1 A;  2OF7 A;  4M3G A;  1P2F A;  4IZZ A;  3JW4 A;  2O61 A;  3QQA A;  5DCM A;  1W5T A;  3BZC A;  3ZN0 A;  3LWF A;  3L2R A;  3VFZ A;  2DFH A;  4ITV A;  4IOC F;  1WJE A;  3HG9 A;  4RBO A;  2OPT A;  4G7Z F;  2VJ5 A;  2R5Z A;  2UV1 A;  2L9S A;  1R5I D;  1MIJ A;  4E4H A;  2BHY A;  2ZNZ A;  2BGC A;  2EQR A;  1VQO I;  3L2V A;  4Y52 J;  2XKP A;  1E2X A;  3DF8 A;  2K7L A;  2GWR A;  5GP9 A;  3F72 A;  3AKZ A;  1B4A A;  4P9U A;  1TWG J;  3CP2 A;  2XSJ C;  1EH7 A;  2V6E A;  3OL4 A;  4GXO A;  3A0B C;  3F3X A;  2ZXH A;  1IZ1 A;  1W36 D;  1PUF A;  5B1B H;  1A6I A;  1O3S A;  2Y2Z A;  2ZJ2 A;  4HYE A;  4UUS A;  4LB5 A;  1S5L C;  2NVQ J;  1A35 A;  2OV7 A;  3IKV A;  2W00 A;  5KVR A;  2OD5 A;  4BDZ A;  3LA7 A;  1LQ1 A;  4O3M A;  3QAH A;  1QZY A;  4G12 A;  1J09 A;  3QPS A;  1CF7 A;  3I58 A;  3OWT A;  5H2F C;  3HIF A;  3NQO A;  3VOD A;  3K2A A;  5DTD A;  3OYK A;  4ESJ A;  1WHU A;  1XDU A;  2HFH A;  4M73 A;  1ON2 A;  2K02 A;  4C9Y A;  1QGP A;  2QYO A;  4A5M A;  5HNF A;  2EFQ A;  4HF1 A;  2CUE A;  4MIM A;  3OIP A;  2HKX A;  4J19 A;  1ZHF A;  3B02 A;  3JRE A;  2EFP A;  2FQ3 A;  2CMP A;  3V7S A;  2DA4 A;  4NNJ A;  3CCU I;  2HYJ A;  4EM0 B;  3HRT A;  3IH3 A;  2V4J C;  3ECH A;  1S9H A;  1BW5 A;  1Q1V A;  2QSG X;  3C18 A;  2ZME C;  4W97 A;  3P9C A;  1XB4 A;  2LK2 A;  4HX8 A;  3TP3 A;  1LNW A;  1GXP A;  2ZSI B;  4FTH A;  2KRC A;  2JA8 J;  3H92 A;  1FSE A;  5E1W A;  2IS4 A;  2Z33 A;  2JSC A;  1OCP A;  4M6X A;  1LEA A;  2EFN A;  4BJ6 C;  2DA5 A;  4XRF A;  5DUK A;  3L7W A;  5GAE J;  3OYJ A;  2KIQ A;  3SJM A;  4PSX A;  5C3E J;  1BJZ A;  1H9G A;  2VBZ A;  1HKT A;  2LLK A;  1JKQ C;  1P4X A;  2IGM A;  1O3T A;  4OOI A;  3HB9 A;  3CZ6 A;  2GXA A;  4YEJ A;  3ABK H;  1P9Q C;  1LFB A;  5D6E A;  2L2O A;  4BH9 A;  3DXJ F;  3F0C A;  5H20 A;  1YG2 A;  3HC7 A;  3OOU A;  1SC7 A;  1I39 A;  2K86 A;  4RAF A;  4D7N A;  2EA4 A;  2WB1 A;  1D5V A;  1EKE A;  2WAF A;  5CLS A;  3IRQ A;  1N78 A;  4Z6Y A;  4R8H A;  4F92 B;  2EB7 A;  3G6E I;  1WZ2 A;  2COB A;  3FM3 A;  2Z16 A;  4GGG A;  4LLN A;  1POG A;  4UNO A;  2EIJ H;  4HG2 A;  1WGX A;  3JRD A;  5EJC A;  2E7W A;  1MJ9 A;  1WH5 A;  4IPA A;  4Y17 A;  4AU7 A;  4F3Q A;  5C4J J;  3CDI A;  2V1D A;  4E7I A;  1K78 A;  5B3S H;  2FE3 A;  1WQ2 A;  4XBF A;  4G94 A;  5J4Y A;  1FP1 D;  2X48 A;  3TO6 A;  4S0H B;  4N4N B;  2Z5U A;  5LFA A;  3WGI A;  3TW7 A;  1B1B A;  5DD4 A;  1IC8 A;  3CDL A;  2X9D A;  2CG4 A;  2IW5 A;  2CQX A;  3HSE A;  2Y9Z A;  2JA6 J;  2M8E A;  4L9V A;  2PFB A;  2L9N A;  4C2M J;  1ETX A;  4RGR A;  2R7O A;  2LF7 A;  3E5X A;  4OAZ A;  1J0R A;  1SFK A;  4A3B J;  5H6R A;  1HQC A;  4A0Z A;  3W3C A;  4BXU A;  2VKH A;  4A6D A;  5FD6 A;  1BR1 A;  1OKR A;  4LIT A;  2M4G A;  1Y1W J;  5D4S A;  4XIC A;  1L3L A;  2RVC A;  4XN0 A;  4K2E A;  5B5E C;  4ZC3 A;  3M1E A;  2WTE A;  3DBH B;  3KP2 A;  1YLF A;  3HOY J;  4A12 A;  2O3F A;  3H9G A;  3P9I A;  3HGG A;  4Y13 A;  1S7E A;  3RKW A;  4DZP A;  2X4H A;  4L5E A;  2YX7 A;  4CXF A;  2STW A;  1X2N A;  1ZR2 A;  2FX0 A;  1T98 A;  2FOW A;  2EIN H;  1E3P A;  1XPX A;  1HDD C;  3DFG A;  4XLC A;  2K3F A;  1B8I B;  4EMS A;  3GYH X;  3EUH C;  1JJ6 C;  3NWS A;  1R49 A;  3A0H C;  2W24 A;  4P96 A;  2GXB A;  1E3H A;  4HQE A;  1O3R A;  2DT5 A;  2IP2 A;  1IV6 A;  2XGC A;  2FNP A;  3K7A J;  5IY5 H;  1OFC X;  3C2G A;  1OMI A;  2H8R A;  1R9T J;  1WJA A;  2MH9 A;  3BY6 A;  2WV1 A;  3CME I;  4MHG A;  3FXL A;  2Z3Y A;  5JHF A;  4ESF A;  2DTZ A;  4C30 A;  2COM A;  4XON A;  3H5R A;  4M72 A;  2P8T A;  3AG4 H;  2DK8 A;  1P6R A;  2W57 A;  4LG0 B;  1B6A A;  5E3L A;  3M8F A;  4A5N A;  3SQN A;  1MZB A;  1FYM A;  1RKT A;  3RKX A;  3I59 B;  1UHW A;  4GCV A;  3JRI A;  1MBG A;  3H3U A;  4V2F A;  4NC6 A;  4WCG A;  2ZKZ A;  1NHA A;  2M8G X;  4OMZ A;  1TWC J;  1ZG1 A;  2M30 A;  4P55 A;  4R79 A;  3MD2 A;  4UVC A;  3TW6 A;  1MJA A;  2JUG A;  1A36 A;  2ACJ A;  4Y3O A;  3MEX A;  3CC7 I;  4WXC A;  1IUF A;  1R36 A;  1T33 A;  2R4G A;  5EG0 B;  4H0E A;  4PSW A;  3S17 J;  2ZC2 A;  2IPQ X;  4KIB A;  3E5U A;  2Q8K A;  2VN2 A;  3JSO A;  1B72 B;  3QWL A;  2GLO A;  3KP4 A;  3ONQ A;  2VKV A;  1RKW A;  1GXQ A;  2JK3 A;  1UMQ A;  4IRH A;  4EGZ A;  5IOY A;  4LIV A;  5ERI A;  2MD5 A;  3KP5 A;  4AD9 A;  5D6F A;  1KQ9 A;  4Y7N J;  2ZBK A;  1QVU A;  2WY7 Q;  4EEF G;  2LY2 A;  3J7Z I;  1Y0N A;  3O3K A;  4IL6 C;  4D1Q A;  3I4M J;  3PO2 J;  1IXS B;  1AKH A;  2VC0 A;  2OZ6 A;  2BVM A;  1OCZ H;  2A68 F;  2VC1 A;  2VT3 A;  2L4A A;  2OA4 A;  2JN6 A;  2E1C A;  3K10 A;  1Y8Q B;  3KP7 A;  3S2W A;  4JX6 A;  2E1M B;  3KCC A;  3J80 K;  1MH4 A;  2Y0M A;  3P5J A;  5GAH J;  2OU2 A;  4AIK A;  3ABU A;  1G3S A;  4CUG A;  2A69 F;  3GVA A; 
#chains in the Genus database with same CATH homology
 1SD6 A;  2LNB A;  3M8E A;  4MNU A;  1ONV A;  5HVQ C;  1FBS A;  1IN8 A;  1XMK A;  3B73 A;  3GLX A;  2HYF A;  1KQ0 A;  4RB3 C;  1TQP A;  2G9W A;  2EV0 A;  1KU9 A;  3REO A;  5CVI A;  1G4D A;  3JTH A;  3MAJ A;  5K5O A;  3BP8 A;  3EET A;  2WWY A;  3QOP A;  3R0A A;  2DQR A;  2HOE A;  1SFE A;  1GHC A;  4WXD A;  5HS7 A;  3V8K A;  2L4M A;  4WXH A;  1SAX A;  2OZU A;  4FX4 A;  4Q4Z F;  4KMF A;  2PI0 A;  2HS5 A;  3F8N A;  2NYX A;  3FMQ A;  1DPR A;  4GYI A;  2Y48 A;  1S8N A;  3ERE D;  1ZG5 A;  1FSH A;  2QM3 A;  1YW7 A;  4IXA A;  2GA1 A;  3DEU A;  5BPD A;  1KU2 A;  2NNN A;  3BRO A;  3VOE A;  5E18 F;  3DP7 A;  3HSF A;  5D4R A;  1L0O C;  3ZMD A;  1MDM B;  3CUQ B;  1TQM A;  5IT9 K;  1LDK B;  5D5X B;  3BJ6 A;  1EV7 A;  2QUF A;  2NAZ A;  4M9S A;  1J75 A;  3RI4 A;  3ZMU A;  2D1V A;  2DLL A;  1HW1 A;  3F21 A;  3QU3 A;  4LG0 A;  2QWW A;  3T1B A;  5HLG A;  5HLI A;  4A0Y A;  4EGY A;  1GVJ A;  3RPU A;  3ELK A;  5CVU A;  5LHH A;  2UWM A;  4EM1 A;  2IT0 A;  1DDN A;  2FMY A;  1J9I A;  4LB6 B;  2DQL A;  4U7D A;  3KEQ A;  3ZQ7 A;  2JTV A;  2VBY A;  1MGT A;  5BS6 A;  4EJW A;  2BE5 F;  2YSR A;  3TO9 A;  3HRM A;  5K1Y A;  2XAF A;  4L5I A;  1Z91 A;  1I6X A;  3HRU A;  3TDU C;  3T8R A;  3WTV C;  3J80 Z;  2FML A;  1FY7 A;  3R6S A;  2UZK A;  2FF4 A;  5A2Q K;  1ZGJ A;  2DW4 A;  2H6C A;  5BMZ A;  1ZLJ A;  1E17 A;  1UCR A;  2FEZ A;  1G3Y A;  2HR3 A;  1FLI A;  1ZRF A;  4RGU A;  2QQB A;  2ISZ A;  3GO5 A;  1Z1D A;  1U5T A;  5BQT A;  2AXL A;  1IUY A;  3RDI A;  4QWQ A;  3CJN A;  1YQA A;  3ZP5 A;  1BI2 A;  1R1V A;  4Z2Y A;  4ZYE A;  1YTY A;  1J5Y A;  4EJO A;  2XV4 S;  3BJA A;  4L0Z B;  3GFJ A;  3I64 A;  2YX4 A;  3RJP A;  1T2K A;  3LQQ A;  1IRG A;  3MQ0 A;  2P5L C;  2E1N A;  1Q1H A;  2FNA A;  2XHK A;  4MTD A;  1IN4 A;  2Q2E A;  3L09 A;  2P5V A;  4I09 A;  1XDS A;  3FX3 A;  1QPM A;  1IN5 A;  2RDP A;  2W25 A;  2XRN A;  1R22 A;  3CUO A;  4GYG A;  4PGG A;  1XGS A;  3BJO A;  2R7D A;  1KGS A;  1WKM A;  3WTU C;  1WI9 A;  3COA C;  5F1R A;  2GQQ A;  3K9T A;  5IT9 Z;  4NQW A;  2VOO A;  2KIU A;  3I53 A;  1R1T A;  1K7A A;  2PQ8 A;  1BIA A;  2DK5 A;  1Z9C A;  1D3Y A;  2PEX A;  1HW5 A;  3WTT C;  3LA2 A;  3L00 A;  5L3C A;  1H9T A;  2IA0 A;  4UV8 A;  4HX4 A;  2QBY A;  2HDC A;  5DYM A;  3V7C A;  2EJR A;  3QPH A;  2Z99 A;  1T6S A;  5FD5 A;  3KZZ A;  3R4K A;  3WG9 A;  4Q5S F;  2HGC A;  4B8X A;  4MGR A;  5E1Z B;  1UHM A;  3HSR A;  5D8K B;  2STT A;  2D45 A;  5LRS A;  1ZG3 A;  3QP6 A;  2FOK A;  1O7L A;  2MH2 A;  3RKY A;  3N97 A;  2E7X A;  5LRR A;  4N9H A;  2VE8 A;  1PP7 U;  3K1P A;  4KIG A;  2IVM A;  3CTA A;  3MZY A;  2ZO4 A;  1RIO H;  5JHU A;  2HKO A;  4IF4 A;  3VB2 A;  3L2C A;  2VON A;  1QQI A;  1A04 A;  1S3J A;  5J8F A;  2CQK A;  4WK8 F;  3G73 A;  4UVB A;  3IKT A;  3F8C A;  3K0L A;  1LEB A;  1LDD A;  1JGS A;  2D1H A;  4HBL A;  5FO5 A;  3ROU A;  3SZT A;  1XGM A;  2HZT A;  2GZW A;  1S29 A;  4HV5 A;  5FB2 A;  4HZF A;  2DU9 A;  5HDN A;  4I02 A;  2K4J A;  5DCF A;  1MJB A;  2XIG A;  3FXU A;  1ODD A;  5CVV A;  4YII A;  2P4W A;  1CGP A;  4EJT A;  4D0P A;  3HOS A;  1LVA A;  1BC7 C;  1XMA A;  1FNN A;  3FHZ A;  4OMY A;  4P5O A;  1DP7 P;  2AS5 F;  5FLX Z;  2F5E A;  3RPQ A;  3IC7 A;  1P4A A;  3CLO A;  3KLN A;  4A6E A;  4XSX F;  5KK1 A;  1TQI A;  2CO5 A;  2H6B A;  2IA1 A;  3DPL C;  4YFX F;  2L54 A;  1BJA A;  4NB5 A;  4HOB A;  1W4M A;  1OYI A;  4ZZL A;  3K1N A;  4XLN F;  3IRR A;  1F1Z A;  4GO1 A;  2KIF A;  2KRF A;  2HWV A;  2OQG A;  1U5T C;  4IRG A;  3GFL A;  3R60 A;  3J7A O;  2EA2 A;  3I0T A;  1XSD A;  2JT1 A;  3MCZ A;  3M9A A;  5LHG A;  3HUG A;  1I1G A;  3KFW X;  3GW2 A;  1TNT A;  3MZH A;  4KYW A;  5EEG A;  3LA3 A;  1RUN A;  1HSJ A;  3WTW C;  2ZME B;  3KEO A;  1TBX A;  3U2R A;  3OOP A;  3EQL F;  2UXN A;  1ZRD A;  1B59 A;  4A0X A;  4MEX F;  4LMY A;  1XD7 A;  1I5Z A;  5DEQ A;  1ZAO A;  1Z05 A;  3WE3 A;  3C3W A;  4PCQ A;  3IHU A;  5IT3 A;  5L3G A;  4ENM A;  4CDG A;  1FPQ A;  5D5V B;  5J8C A;  3TQN A;  1FWZ A;  2Z9O A;  3Q5F A;  2J5P A;  4R1H A;  5ICE A;  4ESB A;  1KU7 A;  5HDG A;  3BOQ A;  2LDU A;  3O2P E;  2FU4 A;  4ENN A;  1HKS A;  2F5D A;  3WGH A;  3GWZ A;  3ZMZ A;  1R5H A;  4OIN F;  4BAY A;  3DPT A;  3K69 A;  1D8K A;  3P9K A;  4BHB A;  4L9N A;  1V4R A;  2B0L A;  5LHI A;  4FX0 A;  4IRI A;  5ED4 A;  4B09 A;  2W85 A;  4AIJ A;  1BI1 A;  4YFN F;  4KT5 C;  2BYV E;  1XSV A;  3G3Z A;  1SD7 A;  1YS6 A;  1T0F A;  2EFO A;  4LJZ F;  1SFX A;  4ZYG A;  1U2W A;  2O0Y A;  5ICF A;  4BYY A;  2L01 A;  5JR3 A;  2F5C A;  3RTR A;  4HX7 A;  5E17 F;  5K5Q A;  1IXC A;  4E70 A;  2DPD A;  2ETH A;  1PUE E;  3ABT A;  2KJC A;  2H94 A;  1QZZ A;  2XAQ A;  3JSP A;  2V1X A;  2CSO A;  4ON0 A;  4L9T A;  2DI3 A;  3F8M A;  4JQF A;  3F22 A;  5CVR A;  2IJL A;  3BWG A;  3CO7 C;  1YIO A;  2R7F A;  2OQR A;  2V6C A;  5DUI A;  2RQP A;  1FOK A;  5L3B A;  1F5T A;  3ZMV A;  4A2U A;  4I01 A;  4MTE A;  3ZMT A;  3BPV A;  1P4W A;  2W84 A;  2QQ9 A;  4RAZ A;  4M9Z A;  1W7P B;  2EV6 A;  2P5K A;  4ZZD A;  3E97 A;  5E20 A;  3CDH A;  5CVJ A;  3SXY A;  1YFH A;  5DCM B;  5D5W B;  1KYZ A;  1BBY A;  3M7G A;  3I4P A;  1D8J A;  1OR7 A;  4KNY A;  2A6H F;  2LSO A;  3KP3 A;  4O6J A;  3TOA A;  3I59 A;  2PN6 A;  3EYI A;  4HW0 A;  5FFZ A;  4CZZ A;  4KA4 A;  4U0Y A;  2K4B A;  1ZLK A;  4LLL A;  3W6J B;  5EEH A;  1CF7 B;  1KQ8 A;  3GF2 A;  3WU0 A;  1W7P D;  1HST A;  1YO5 C;  3T8T A;  4HF2 A;  3D0S A;  1SMY F;  1BC8 C;  4KIC A;  3GXO A;  3TO7 A;  1JHH A;  3WGG A;  3KP6 A;  1SMT A;  2ZXJ A;  2UXX A;  1BOA A;  4S04 A;  1WSU A;  1JHF A;  2L02 A;  4OIR F;  1SD5 A;  1YYV A;  1R5G A;  2VOP A;  5E1X A;  5ILV A;  2JPC A;  3WTS C;  4WX9 A;  1HXD A;  4MQV A;  5HS8 A;  2EV5 A;  2PLY A;  5FGM A;  2QVO A;  2VBX A;  3KE2 A;  4G6Q A;  1R7J A;  2XAG A;  2XKO A;  3R0J A;  1BM9 A;  1FYK A;  3TOB A;  2BV6 A;  2Y75 A;  3ULQ B;  5CJ9 A;  5BPI A;  1HBX G;  4RB0 A;  2EWN A;  4KN7 X;  1BI0 A;  3LAJ A;  3ISP A;  5F6F A;  4BNC A;  4HAM A;  1BIB A;  1FX7 A;  2BBY A;  5JVT A;  2CFX A;  3V4G A;  4I0B A;  2GAU A;  3JTG A;  1J7K A;  2HQN A;  2DPU A;  2VT2 A;  4ZYD A;  3RYR A;  1HKQ A;  3F6O A;  1K78 B;  4OIO F;  1RNL A;  1K79 A;  3T0Y A;  1JXS A;  2JZY A;  3HHH A;  1YW8 A;  3K1M A;  4M71 A;  4LGW A;  3PQK A;  4AIH A;  1ZAR A;  4RAY A;  2XUB A;  3HRS A;  1DUX C;  1QO0 D;  4G8X A;  4M74 A;  2QEN A;  4LK0 F;  1C0W A;  4LFU A;  4LD5 A;  2ZFW A;  2H09 A;  1W7P A;  1MD0 A;  4YFK F;  1MDM A;  3CUQ A;  3GUD A;  1ZH5 A;  1P92 A;  5AON A;  5K5R A;  1TTY A;  4JBA A;  1RUO A;  1XGN A;  1UFM A;  3ZPL A;  4RGS A;  3BDD A;  2NRA C;  2A5Y B;  3ZN1 A;  4G6D A;  3E6B A;  2RN7 A;  4ENJ A;  5L3F A;  4PZJ A;  3NRV A;  4LLG F;  3DQV C;  1O3Q A;  4MQ9 F;  5LGU A;  4HA8 A;  2XVC A;  3GFM A;  5J6X A;  4ZH4 F;  2P7C B;  5CYV A;  3QPT A;  3PFI A;  1LJ9 A;  3E6C C;  2JPB A;  3F8B A;  3WTZ A;  4G7O F;  1UB9 A;  3SHF A;  2YU3 A;  4EV0 A;  3VEP A;  3I54 A;  2M5W A;  2CGP A;  5LEK A;  4HQM A;  1J59 A;  4Q48 A;  4ASN A;  2ESN A;  2FBI A;  5A2Q Z;  2PMU A;  3DV8 A;  5HOO A;  1G3T A;  1AWC A;  2GA2 A;  3N4M A;  5DD8 A;  4AVP A;  2XAJ A;  4OIP F;  1WWX A;  4N9I A;  2WC2 A;  1B9N A;  3MFK A;  5HS9 A;  2A07 F;  3P7N A;  1MKM A;  4HLY A;  1TLH B;  4BQA A;  4U88 A;  1R23 A;  1ULY A;  1FYL A;  4UXN A;  5D5U B;  2O8X A;  2O03 A;  2RGV A;  1K6O A;  4L0Y B;  4U0W A;  1IRF A;  2HEO A;  4U7B A;  2IA2 A;  2A61 A;  4UUV A;  2NS0 A;  2MC3 A;  1RZ4 A;  2QLZ A;  4DQ2 A;  1H0M A;  1ZYR F;  4WF2 A;  2FSW A;  3NEU A;  5LGN A;  2FRH A;  3LFK A;  2RKH A;  3FM5 A;  5L3D A;  4L18 B;  1QBJ A;  4PDK A;  2A6E F;  4PGH A;  1BI3 A;  5ILS A;  1YS7 A;  2MLK A;  3RIR A;  3T5X A;  3QP5 A;  3BPX A;  4G7H F;  3SFZ A;  2BEO A;  2YPR A;  5ILU A;  2FBH A;  3L9F A;  4UHT A;  1S7O A;  2O6G E;  2R3S A;  4ENK A;  3JAM K;  2NNY A;  1OYY A;  1XCV A;  2G7U A;  2QZ8 A;  4FHT A;  1O7F A;  3LST A;  2P6T A;  1B9M A;  1SFU A;  1IAW A;  2CYY A;  3U9G A;  1DPU A;  1ON1 A;  2EK5 A;  2JRT A;  3D5L A;  4U0V A;  4I98 B;  1I27 A;  3ECO A;  5LGT A;  4IHS A;  3SZP A;  4HDU A;  4L9J A;  4LK1 F;  2RV8 A;  2V1U A;  1IXR C;  1REP C;  3J81 K;  3HYI A;  2PG4 A;  1T39 A;  2XRO A;  4CO8 A;  4I7H A;  4ZYH A;  5TRD A;  2P7V B;  5H6Q A;  3F23 A;  3GFI A;  5AIQ A;  3W6K B;  5E8I A;  3Q9V A;  5LBQ A;  3CUQ C;  3ZMS A;  4Q47 A;  3RYP A;  3IWF A;  4EM2 A;  1ZRC A;  1W5S A;  2RC4 A;  2XAH A;  2DAO A;  2IRF G;  2PBI A;  5LLQ A;  2MLG A;  1I1S A;  4EQQ A;  3GEZ A;  1TW2 A;  4AWX B;  2VOD A;  1ZN2 A;  3Q9S A;  4YG2 F;  3CO6 C;  5BOX A;  1O57 A;  4CHU A;  2ISY A;  5HDK A;  5ICC A;  1LDJ A;  5HLH A;  5DV5 A;  2HYG D;  3HHG A;  4FT8 A;  4EJV A;  1KA8 A;  5D8L B;  3I71 A;  4RS8 A;  3TGN A;  3WTY C;  5LEJ A;  4BHC A;  2A3S A;  5F64 A;  3V8J A;  4HLX A;  3KLO A;  3HTS B;  2GIV A;  1YW9 A;  1KYW A;  1AOY A;  3R61 A;  2Q0O A;  3TDZ C;  4OU0 A;  1U78 A;  3QRF F;  5ICG A;  1VTN C;  2OAZ A;  2DFI A;  3HOT A;  1FC3 A;  2QQA A;  4MEY F;  3IL2 A;  1U5T B;  4XLP F;  4M6Y A;  4KMU X;  1TNS A;  4KUM A;  1XGO A;  2HQR A;  4KDP A;  1EH8 A;  2X0L A;  1S7A A;  2KIM A;  1OYW A;  2L3D A;  1Z6R A;  2C6Y A;  3ML6 A;  2K27 A;  4EVI A;  1R00 A;  2KKO A;  2WV0 A;  3TKY A;  2DO7 A;  1IN7 A;  3GZ5 A;  1Z6T A;  3FZV A;  2CW0 F;  4L5J A;  2LF8 A;  4O5V A;  3JAM Z;  4Y15 A;  4HF0 A;  1XN7 A;  2DTR A;  1F4K A;  2DBB A;  4YIF A;  4UV9 A;  3C1D A;  2ZNY A;  1R58 A;  4KIF A;  2M87 A;  4RGX A;  3FMR A;  1OPC A;  1FZP B;  1WRJ A;  1IW7 F;  2VBW A;  4KFC A;  4F7Z A;  1HW2 A;  2ZME A;  3E6D A;  1XSX A;  1ZRE A;  2F5F A;  3KET A;  5JFR A;  4DNC A;  1FP2 A;  4HV6 A;  3J81 Z;  1F9N A;  3WTX C;  3V8L A;  3HTU A;  2FXA A;  2VE9 A;  2QBY B;  2OBP A;  1USS A;  1T38 A;  1XCB A;  4IHT A;  1JE8 A;  2ZCW A;  1J2X A;  4HDV A;  4KN4 X;  2ELH A;  2YR2 A;  1V3F A;  4UVA A;  2RNJ A;  2EFW A;  4QLC U;  2FA5 A;  1STZ A;  1TW3 A;  1LB2 A;  2P6S A;  4EJU A;  2D2W A;  4CGZ A;  3WOD F;  2PMH A;  2F2E A;  1FT9 A;  3FXQ A;  3FXR A;  2M45 A;  2CWE A;  4IVN A;  4XSZ F;  3O6B B;  5DDG A;  1S6L A;  1QNT A;  2LKP A;  2M1B A;  2H27 A;  1U6G A;  4RB2 C;  1SD4 A;  3IWZ A;  3H3Z A;  5JI6 A;  3QU6 A;  1BN5 A;  4TV7 A;  6PAX A;  1U3E M;  1RI7 A;  1EH6 A;  2MA3 A;  2GXG A;  3E5Q A;  3GX4 X;  1G6N A;  1G3W A;  3E6M A;  3E3V A;  3DKW A;  3FF5 A;  2VXZ A;  3AAF A;  4WWC A;  4ETS A;  3GZ6 A;  2TDX A;  1U8R A;  3WU1 B;  2XGX A;  4N0B A;  3KZY A;  3F8F A;  5AIP A;  3I5U A;  3FWE A;  5TJJ A;  5L3E A;  1FBU A;  3EUH A;  1IF1 A;  2G7H A;  1PP8 F;  4IJA A;  1X3U A;  5E8G A;  3OV8 A;  4P9F A;  4I2O A;  3K2Z A;  4M9X A;  1KU3 A;  2ADU A;  2V79 A;  3EYY A;  1FBQ A;  3LQR A;  5FFX A;  1UST A;  2ESH A;  4NHJ A;  2FBK A;  3F6V A;  3BZ6 A;  3V7R A;  4BHP A;  3C7J A;  2PJP A;  4JK1 X;  2HTJ A;  3LAP A;  3FMS A;  4CYD A;  4CIC A;  4RB1 A;  2XAS A;  4I0A A;  1Z7U A;  1PDN C;  3EDP A;  4OIQ F;  4G9Y A;  3WE2 A;  5FLX K;  2J5O A;  3MWM A;  2HTS A;  2V9V A;  1IN6 A;  1ZGA A;  4S05 A;  3U1D A;  2MBF A;  1R1U A;  1Y0U A;  2KJB A;  3PQJ A;  1P2F A;  3JW4 A;  2O61 A;  5DCM A;  1W5T A;  3ZN0 A;  3LWF A;  3VFZ A;  4G7Z F;  2ZNZ A;  2BGC A;  2XKP A;  1E2X A;  3DF8 A;  2K7L A;  2GWR A;  3F72 A;  1B4A A;  4P9U A;  1EH7 A;  4GXO A;  3F3X A;  1IZ1 A;  1O3S A;  2ZJ2 A;  4HYE A;  4LB5 A;  3IKV A;  5KVR A;  2OD5 A;  3LA7 A;  1LQ1 A;  4O3M A;  3QAH A;  1QZY A;  1CF7 A;  3I58 A;  3HIF A;  3NQO A;  3VOD A;  4ESJ A;  1XDU A;  2HFH A;  4M73 A;  1ON2 A;  2K02 A;  1QGP A;  2QYO A;  4A5M A;  2EFQ A;  4HF1 A;  2HKX A;  1ZHF A;  3B02 A;  2EFP A;  2FQ3 A;  3V7S A;  4EM0 B;  3HRT A;  3ECH A;  3C18 A;  3P9C A;  1XB4 A;  4HX8 A;  1LNW A;  1GXP A;  3H92 A;  1FSE A;  5E1W A;  2Z33 A;  2JSC A;  4M6X A;  1LEA A;  2EFN A;  4XRF A;  5DUK A;  3L7W A;  1H9G A;  2VBZ A;  1HKT A;  1P4X A;  1O3T A;  4OOI A;  5D6E A;  4BH9 A;  3DXJ F;  5H20 A;  1YG2 A;  2K86 A;  2EA4 A;  1D5V A;  5CLS A;  3IRQ A;  4R8H A;  2EB7 A;  3FM3 A;  4GGG A;  4LLN A;  4UNO A;  2E7W A;  1MJ9 A;  4IPA A;  4Y17 A;  2V1D A;  1K78 A;  2FE3 A;  1WQ2 A;  4XBF A;  4G94 A;  1FP1 D;  3TO6 A;  2Z5U A;  3WGI A;  1B1B A;  5DD4 A;  2CG4 A;  2IW5 A;  3HSE A;  2M8E A;  4L9V A;  2PFB A;  4RGR A;  2LF7 A;  3E5X A;  1J0R A;  5H6R A;  1HQC A;  4A0Z A;  4BXU A;  4A6D A;  5FD6 A;  1OKR A;  5D4S A;  1L3L A;  2RVC A;  4K2E A;  3M1E A;  2WTE A;  3KP2 A;  1YLF A;  4A12 A;  2O3F A;  3P9I A;  4Y13 A;  3RKW A;  2X4H A;  2YX7 A;  4CXF A;  2STW A;  1T98 A;  3DFG A;  4EMS A;  3GYH X;  2W24 A;  4P96 A;  2GXB A;  4HQE A;  1O3R A;  2DT5 A;  2IP2 A;  2FNP A;  1OMI A;  2MH9 A;  3BY6 A;  4MHG A;  2Z3Y A;  4ESF A;  2COM A;  4M72 A;  2P8T A;  2DK8 A;  1P6R A;  2W57 A;  4LG0 B;  1B6A A;  3M8F A;  4A5N A;  3SQN A;  1MZB A;  1FYM A;  3RKX A;  3I59 B;  1UHW A;  4GCV A;  3H3U A;  4WCG A;  2ZKZ A;  1NHA A;  4OMZ A;  1ZG1 A;  2M30 A;  4P55 A;  4R79 A;  4UVC A;  1MJA A;  2ACJ A;  3MEX A;  4WXC A;  1R36 A;  4H0E A;  2IPQ X;  4KIB A;  3E5U A;  2Q8K A;  2VN2 A;  3JSO A;  3KP4 A;  1GXQ A;  4IRH A;  4EGZ A;  5ERI A;  2MD5 A;  3KP5 A;  4AD9 A;  5D6F A;  1KQ9 A;  2ZBK A;  3O3K A;  1IXS B;  2VC0 A;  2OZ6 A;  2A68 F;  2VC1 A;  2VT3 A;  2L4A A;  2OA4 A;  2E1C A;  3KP7 A;  3S2W A;  3KCC A;  3J80 K;  2Y0M A;  2OU2 A;  4AIK A;  3ABU A;  1G3S A;  2A69 F;  3GVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...