4K2EA

Hlyu from vibrio cholerae n16961
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
94
Chain Sequence
LQEMEKNSAKAVVLLKAMANERRLQILMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRKEAQTVFYTLSSTEVKAMIELLHRLYCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords Transcriptional activator HlyU
publication title Crystal structure of HlyU, the hemolysin gene transcription activator, from Vibrio cholerae N16961 and functional implications.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 29
structure length 94
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4k2eA00
3D0SA 1Z9CA 4XLNF 4EJWA 3C18A 5D4SA 3DPTA 1Z91A 1RNLA 3KLOA 1BI3A 4IPAA 1XGNA 1HW1A 1U5TB 2V6CA 3GFIA 2LF7A 5DV5A 5BPDA 2H27A 3W6JB 2QENA 2OBPA 3SXYA 1RUNA 1K7AA 5LEJA 5L3FA 2ZMEB 2K86A 1MJ9A 1E2XA 2YU3A 1KU3A 3BDDA 3K0LA 2F5EA 3DFGA 3T1BA 3WTTC 1YW8A 2DT5A 2PQ8A 4YFKF 3F8MA 4E70A 4R8HA 5KK1A 1O7LA 2XIGA 2BV6A 4MTEA 2W57A 3C3WA 2K4JA 4WWCA 3J80K 1BI2A 2GXBA 5HDNA 1B4AA 4OIPF 2D1VA 5D8KB 3R4KA 5H6RA 3WU1B 2RV8A 2OZ6A 3RI4A 3CUQA 1B9MA 3BJAA 1ZYRF 2IVMA 1IN8A 2Y75A 5ED4A 1XDUA 1YS6A 2AXLA 4YIIA 4RB2C 2MLGA 4A5MA 3HRUA 2IT0A 2L02A 5F1RA 1O3QA 3ROUA 4KN7X 1DP7P 4HQEA 5LGUA 1K78B 5H6QA 1TQPA 5HDGA 1HBXG 2PG4A 3QRFF 3QPTA 2HTSA 5F64A 2H09A 1SD4A 3P9IA 4A12A 1KQ8A 2EB7A 3QU6A 2MA3A 4YFXF 3O6BB 1W5SA 5HLIA 3GW2A 1OYWA 2OA4A 2ISZA 2JSCA 3WTZA 1I6XA 2LF8A 3WE2A 3F21A 2QBYB 2QQ9A 3PQJA 1T98A 3HSRA 2CG4A 4Q48A 5K5QA 1ZG3A 4TV7A 4RAYA 1UHMA 3B73A 4EJOA 4L5IA 3ZMUA 1MGTA 4LG0A 1G3YA 4GYIA 3L09A 4KIFA 1P2FA 3HOSA 4MHGA 5BS6A 3RYRA 1R23A 3FXRA 1LDJA 2P6TA 2FMYA 3J7AO 4A0YA 1I27A 1SMYF 4IXAA 3TQNA 1IUYA 3WTVC 4ZYHA 1REPC 3I58A 2GXGA 5ICCA 5CVVA 1Z6TA 4UVCA 2WV0A 3F8CA 2CFXA 4CYDA 1GVJA 2MLKA 4UHTA 1Z7UA 1Z1DA 4HF0A 1KA8A 3ZMTA 3BWGA 4G7HF 5L3CA 1MD0A 1IN4A 1QO0D 2QM3A 3CJNA 3LQRA 2ESNA 1IZ1A 1ZG1A 2RC4A 4HW0A 5K5RA 5FD6A 2DW4A 4WK8F 1Z05A 4I0BA 2FEZA 3LFKA 3M9AA 5D4RA 2FMLA 4YIFA 1XSXA 3HUGA 4N9HA 2OAZA 2FNPA 4U88A 2JZYA 2R3SA 5D8LB 2PMHA 3MQ0A 3DQVC 4L0ZB 2F5FA 1KYZA 4MEYF 1OR7A 1R00A 4HDVA 4XSXF 2WTEA 4ON0A 2CGPA 4RAZA 4BXUA 1LB2A 4IHTA 5DEQA 4EQQA 3S2WA 3OOPA 2HOEA 2JPCA 4O6JA 4BH9A 3KLNA 1BC7C 1R36A 4CICA 3KE2A 4G7ZF 4PGHA 3GXOA 2V79A 4IRHA 2BYVE 3JAMZ 4IRIA 1GXQA 2IP2A 3KP5A 4EM1A 3TO7A 5AONA 3KP2A 4HAMA 4AWXB 2GA2A 3CUQB 2EV0A 3GFMA 1FBSA 4M72A 2DPDA 2A5YB 1HKQA 4JBAA 4HF2A 4BAYA 2G7HA 4N9IA 3RYPA 2ZFWA 1Q1HA 3F8BA 4RGXA 3KP6A 2HDCA 2J5OA 3GUDA 2EK5A 5HLHA 3SZPA 1IAWA 4I2OA 5TJJA 3M7GA 1BI0A 3IC7A 2FF4A 3TOBA 3F22A 1MDMB 1WWXA 5JI6A 1YW9A 4HLXA 2QWWA 3I0TA 1T0FA 5ICFA 3SHFA 1ZARA 4IJAA 4KFCA 3H3UA 1S3JA 3L7WA 3V7CA 3E6MA 3CO7C 4L0YB 3BPVA 2XHKA 5DCMA 2STWA 2F2EA 2DU9A 3J81Z 3DXJF 4G7OF 2HR3A 5JR3A 1LVAA 3GZ6A 3WTWC 3HOTA 4WXDA 2CWEA 4RB1A 3T0YA 1LQ1A 2VC0A 1J5YA 2JRTA 4KMFA 1KYWA 4LG0B 1IN6A 4LGWA 3NRVA 4O3MA 4UUVA 3WTXC 3IKTA 5CVUA 1IRGA 3RDIA 1YQAA 2UXXA 4XSZF 3SQNA 1FX7A 1G3WA 3FMQA 1ON1A 1YS7A 4B09A 3GFLA 3K9TA 3FM5A 2P8TA 1JXSA 1O57A 3FMRA 3CUOA 2MH2A 1SFUA 1PUEE 1P4WA 1ULYA 4A2UA 4BQAA 2DO7A 2EFNA 1L0OC 5LHHA 3MFKA 3F3XA 3M8EA 2C6YA 2W24A 3E97A 5CVRA 2A07F 1KQ9A 1R1UA 3ZP5A 1ZRFA 3TKYA 1GHCA 3IHUA 4U0VA 4EVIA 1F1ZA 4MQ9F 2P6SA 2YR2A 4UNOA 2CO5A 4GYGA 5LEKA 1P4AA 3WGGA 4F7ZA 4I98B 3V8LA 1J2XA 3BROA 1WRJA 5IT9Z 5CYVA 4UXNA 4U0WA 1I1GA 3BJOA 3DP7A 2EFQA 2ELHA 4M74A 3QAHA 2FE3A 4GCVA 1S29A 3F8FA 1FOKA 1RUOA 5DDGA 3REOA 4EJVA 1UFMA 1WKMA 3O3KA 4XBFA 1CF7A 3QOPA 3TOAA 2VODA 5ICEA 2XRNA 2ADUA 2Y48A 2A6HF 1YG2A 1ZGAA 1USTA 3GYHX 3HTUA 5CJ9A 1MJAA 2JPBA 1FC3A 5ILSA 2XAQA 3FXUA 2TDXA 2KJCA 4LLLA 3KEQA 1B6AA 3QP5A 3Q9SA 1RIOH 4KYWA 2HS5A 3ZMSA 3V7SA 1D3YA 5DYMA 4ASNA 2IW5A 2P5VA 2R7DA 2VBYA 1P4XA 4KIBA 5HS9A 1T6SA 5D6FA 3BP8A 4UVBA 2ISYA 1TLHB 3CO6C 3ZMZA 1PDNC 1QPMA 3MAJA 4FX0A 5LGNA 2KIUA 3ERED 1BM9A 3T8RA 2FOKA 3EQLF 1Y0UA 4PGGA 4BYYA 5D6EA 5CLSA 3KETA 3P9CA 1F5TA 2Z9OA 5LLQA 4I01A 4CXFA 4U0YA 1TNSA 3MWMA 1LEAA 4U7BA 2ZJ2A 3P7NA 3LQQA 1FLIA 4MEXF 4KDPA 5FLXZ 4LB5A 2ZNYA 3F8NA 1S6LA 1T39A 2M87A 4LB6B 4LLGF 3H3ZA 1E17A 4AIJA 2FU4A 2DQRA 3RKWA 2STTA 2H6BA 1O7FA 1OYYA 4L9VA 5DCMB 1XMAA 3WGIA 3RKXA 3NQOA 2HKOA 3JW4A 5CVIA 2F5DA 3L9FA 2L3DA 2XAHA 3DEUA 4MTDA 4KIGA 2O0YA 4ZYGA 4I0AA 3VB2A 1HXDA 1MDMA 2IRFG 3KZYA 1USSA 5D5XB 3R6SA 2IPQX 3RTRA 1STZA 5F6FA 2LSOA 1ZLKA 3I54A 3HTSB 1FP1D 3TO6A 4N0BA 1LDDA 2Q8KA 4DQ2A 2A3SA 1F9NA 1P92A 4HV6A 1BOAA 1P6RA 2O03A 4KA4A 4A0ZA 2OD5A 1IXSB 1HW5A 3ZMVA 1OPCA 3ZN1A 4GGGA 2HWVA 4NB5A 4BHCA 2K27A 3ZN0A 5L3DA 3WG9A 1FYLA 1U5TC 2HGCA 2QVOA 2L01A 3LSTA 3ZMDA 3J80Z 2X0LA 2KRFA 3HSEA 5AIPA 2BE5F 2FBKA 2K02A 1B9NA 2DK8A 3V7RA 1AOYA 3KEOA 4R1HA 3VFZA 1WI9A 1QQIA 2YSRA 2FNAA 3FXQA 2VT2A 3KFWX 3LA7A 5HOOA 4OMZA 1SFEA 3FMSA 2KIFA 3F6OA 1QGPA 2Q2EA 4OOIA 3GEZA 4HQMA 4UVAA 3BPXA 2RN7A 2FRHA 4G94A 5ILUA 2D45A 1BIBA 4EJUA 3N97A 1CF7B 1IXCA 2QZ8A 4ZZDA 2FBHA 3DPLC 3ECOA 2PLYA 1ZRDA 4I09A 2PMUA 2IA2A 2PJPA 2H6CA 5E1ZB 3RJPA 3PFIA 1XCBA 4S05A 2M1BA 1BIAA 1TW2A 5ERIA 4YFNF 3TDZC 2P5KA 3GO5A 5FGMA 2O61A 1MKMA 5J8FA 2YX7A 5L3GA 2NS0A 1FWZA 3K2ZA 1S8NA 2EV5A 2BEOA 2HYGD 1W7PB 4HLYA 2OU2A 1OMIA 1F4KA 2CQKA 4Y17A 1UB9A 2W84A 3WE3A 4HBLA 1BC8C 2EFPA 5TRDA 1PP7U 2KIMA 4K2EA 4NHJA 2A68F 5HS7A 4P5OA 1Z6RA 4OINF 1KU2A 3BY6A 4OMYA 1IN5A 4RS8A 4MQVA 2ZXJA 3EETA 1SMTA 3ULQB 4G8XA 1UHWA 1FBUA 1IRFA 4IHSA 3ABTA 1DPUA 2H94A 1XB4A 4JQFA 1TW3A 4OIQF 4PDKA 1ON2A 3TGNA 1SD7A 1ZHFA 2LDUA 4M6YA 1J7KA 1T2KA 1QZYA 4G6QA 3WTSC 3HIFA 3ISPA 3RPUA 1V4RA 4OIOF 1KU7A 2OZUA 3RIRA 1O3TA 5E8GA 5D5WB 1QZZA 3KP3A 2YX4A 1FYMA 3GF2A 2L4MA 2JT1A 4FX4A 1YIOA 2WWYA 4JK1X 4HV5A 4HX8A 4MGRA 3R61A 4Y15A 2BGCA 4RGSA 4AIKA 1RI7A 3HRMA 2FXAA 1S7OA 5L3BA 1BN5A 3Q9VA 4HZFA 1G3SA 4L5JA 5E1WA 2CW0F 1R22A 5JFRA 2LNBA 2FBIA 2RQPA 4KMUX 1ONVA 2G7UA 4ZYDA 1FP2A 2P4WA 4H0EA 2XVCA 4L9JA 1XDSA 4Q5SF 2UWMA 2NYXA 1ZH5A 2L4AA 1BI1A 1OKRA 3ELKA 1CGPA 1H9TA 1U6GA 1R58A 3E3VA 2Q0OA 1OYIA 1J59A 2D1HA 2ZKZA 4P9UA 5D5VB 2XROA 2GA1A 4ENKA 2E7XA 2Z33A 1YLFA 3R0AA 4PCQA 1J9IA 1FT9A 3DKWA 2M8EA 3ABUA 1KGSA 1HKTA 2MD5A 3QPHA 1IF1A 2ETHA 2HEOA 4RGUA 3I5UA 3GVAA 1EH6A 3R0JA 2ACJA 1JE8A 1MJBA 3M1EA 2A6EF 4P9FA 2QQBA 2IJLA 4XLPF 2XUBA 1ZLJA 2O8XA 5FD5A 1LEBA 3OV8A 3KZZA 3FWEA 2DFIA 3CDHA 3VEPA 1LJ9A 5EEGA 4HF1A 4BHBA 4IVNA 1B59A 1K6OA 4IRGA 5FFXA 3Q5FA 2EJRA 4M9SA 3ECHA 4EGZA 3DV8A 3LA3A 1A04A 3HRTA 2XV4S 4R79A 1D8JA 3CUQC 1HQCA 2E1NA 3LAPA 1U78A 4A0XA 4ESFA 1YFHA 1LNWA 1WSUA 1XCVA 1QBJA 3JTGA 4HA8A 2RDPA 1KQ0A 2FSWA 1FSHA 3FM3A 1NHAA 4WF2A 1FZPB 3QP6A 3JTHA 4EM2A 4M6XA 3G73A 2FA5A 5LRRA 3IWFA 4XRFA 5E17F 1LDKB 1H9GA 1J0RA 3IWZA 3SZTA 4YG2F 1RZ4A 4EMSA 1U3EM 2Z99A 4PZJA 4G6DA 2P7VB 4L9NA 3GZ5A 5J8CA 2J5PA 3WODF 3L2CA 2HKXA 5DCFA 1T38A 1ZAOA 1G4DA 2VT3A 2EV6A 2QQAA 2GZWA 3BOQA 4M71A 1I1SA 5HVQC 1W7PA 1XMKA 3K1PA 3CLOA 2E1CA 2DK5A 1XSDA 4WXHA 3I4PA 5DD8A 2EA2A 1O3RA 1XGSA 2VBWA 4HOBA 5E18F 3T8TA 1R5GA 4EV0A 2DQLA 3HHGA 1R1VA 4HX7A 2KJBA 2VN2A 3MZYA 4HDUA 1TQIA 4CZZA 5LHGA 4KUMA 3KP7A 1EH8A 1TBXA 4P96A 2MH9A 4D0PA 4ENMA 2GAUA 5A2QK 4Z2YA 5LBQA 4LFUA 2EFWA 4UV8A 3F6VA 2HZTA 4FHTA 3R60A 5LRSA 1R7JA 2A69F 5L3EA 2EWNA 2O6GE 3TO9A 1H0MA 2RKHA 1GXPA 5LGTA 2YPRA 2NAZA 3GLXA 2DBBA 4U7DA 1ZN2A 2VONA 2D2WA 4ZYEA 2XKPA 5HDKA 3P9KA 4LK1F 1YTYA 1HSJA 4WXCA 4Q47A 4QLCU 2OQRA 1C0WA 4ENNA 5E1XA 4ENJA 3VODA 1ZG5A 4CDGA 3E6CC 4RB3C 3C7JA 4O5VA 2W85A 2VBXA 1ZREA 4M9XA 3BZ6A 3F72A 4RGRA 4EGYA 1WQ2A 2R7FA 2HTJA 1DUXC 2V1XA 2P5LC 4Q4ZF 3KCCA 2NNYA 2CSOA 1ZGJA 4GO1A 3E5QA 4OIRF 5EEHA 2Y0MA 4I7HA 3C1DA 3HYIA 2X4HA 3DF8A 4WCGA 3PQKA 3NEUA 2ZNZA 1YW7A 5ICGA 3HHHA 5AIQA 1HKSA 3LAJA 3E6BA 2RGVA 3JSOA 2UZKA 3GFJA 4KNYA 3JAMK 3M8FA 5FO5A 4CGZA 2HQNA 1JHFA 4LMYA 4QWQA 2RVCA 1AWCA 4ETSA 1EH7A 4M73A 3V4GA 3U1DA 4AIHA 2VOOA 3E5UA 3E5XA 2V9VA 4EM0B 5DUIA 5A2QZ 4FT8A 1V3FA 3CTAA 2M30A 1J75A 1W7PD 4P55A 3EUHA 2Z3YA 1FY7A 4HYEA 4AD9A 2G9WA 2W25A 3I59A 3O2PE 1QNTA 3JSPA 1BJAA 2QYOA 1W4MA 3T5XA 4S04A 4LJZF 5HLGA 4KN4X 4ESBA 2WC2A 4I02A 5DD4A 2VOPA 1G6NA 4L9TA 4UV9A 4LK0F 3E6DA 2MBFA 2B0LA 3FX3A 1XGMA 2KKOA 2E7WA 1IN7A 4Y13A 3U2RA 5K5OA 3IL2A 3MZHA 3K1MA 3BJ6A 2M5WA 4KICA 3ZPLA 1IW7F 2NNNA 1MZBA 1I5ZA 3ML6A 5FFZA 5IT3A 3ZQ7A 1TQMA 3QU3A 3D5LA 1U8RA 2PEXA 1FNNA 4LLNA 1K79A 3J81K 1XD7A 2XAGA 2CYYA 4KT5C 4IF4A 4HX4A 1XSVA 3IRRA 1XGOA 3I71A 1U5TA 4G9YA 5ILVA 2XKOA 5BOXA 3F23A 1HSTA 2XAJA 2OQGA 6PAXA 2VE8A 1UCRA 1O3SA 3RKYA 2GIVA 3FZVA 2ZMEA 2K7LA 2DPUA 2DAOA 4DNCA 1D8KA 1L3LA 1DDNA 3COAC 1U2WA 3RPQA 1TTYA 3I64A 3B02A 3L00A 2M45A 1S7AA 2VC1A 3HRSA 1G3TA 3GWZA 2UXNA 2RNJA 2LKPA 2PFBA 4LD5A 2ZBKA 2DI3A 4CHUA 1R1TA 2BBYA 5K1YA 3IRQA 4B8XA 2A61A 3WTUC 1R5HA 1JHHA 1SD5A 4A6DA 2HFHA 4WX9A 5IT9K 3K69A 3EYYA 4M9ZA 1HW2A 5FB2A 5BPIA 5JHUA 3TDUC 2PI0A 1SFXA 3GX4X 2L54A 3VOEA 5J6XA 5D5UB 4BHPA 2IA0A 2DLLA 1SD6A 5BQTA 1X3UA 2VBZA 1K78A 1D5VA 2ESHA 2GQQA 2ZCWA 2PBIA 2HQRA 1EV7A 3LWFA 2MC3A 2AS5F 2XAFA 5JVTA 2VE9A 2QUFA 1ODDA 1VTNC 1DPRA 5BMZA 2NRAC 2GWRA 2VXZA 3MEXA 1PP8F 2XASA 4MNUA 1ZRCA 1SAXA 3WGHA 2Z5UA 1TNTA 1W5TA 2F5CA 3WTYC 3N4MA 3SFZA 1YO5C 5LHIA 2QBYA 2FQ3A 5KVRA 4OU0A 2P7CB 1YYVA 4ESJA 2XGXA 5H20A 1JGSA 3EDPA 4NQWA 3WU0A 3I59B 2PN6A 3AAFA 2V1DA 4A6EA 2COMA 3IKVA 1FBQA 4RB0A 3I53A 5E20A 3V8JA 4CO8A 3U9GA 2V1UA 3EYIA 3FHZA 4ZH4F 1B1BA 2ZO4A 2O3FA 3G3ZA 2DTRA 3H92A 1IXRC 3KP4A 2JTVA 5HS8A 5FLXK 4L18B 4A5NA 5DUKA 3HSFA 2QLZA 3V8KA 1FPQA 4BNCA 3MCZA 4EJTA 4GXOA 1BBYA 3W6KB 2K4BA 1FYKA 2EFOA 5CVJA 2HYFA 4AVPA 3FF5A 3K1NA 5E8IA 1XN7A 1FSEA 1KU9A 3LA2A 4ZZLA 2EA4A 2IA1A
chains in the Genus database with same CATH superfamily
1XPXA 3D0SA 5F0FA 1Z9CA 4XLNF 4YEJA 4EJWA 3C18A 3CZ6A 5D4SA 3U21A 3FIWA 3DPTA 3CJRB 1Z91A 4F3QA 1RNLA 3KLOA 1BI3A 4IPAA 1XGNA 2PX9A 1HW1A 1U5TB 2V6CA 3GFIA 3HKZN 2LF7A 2FUG2 1R71A 1Z7LA 1ETYA 4QIWN 3GTGJ 5DV5A 3RPUD 3OYDA 2LH9A 1YJWI 5DS9A 5JLWA 5BPDA 2H27A 2M4GA 3W6JB 1IUFA 2QENA 1OCPA 1LE8B 2OBPA 3SXYA 3SEQA 1YIJI 1RUNA 1F43A 1FJLA 5J1UA 1K7AA 1UMQA 5LEJA 5L3FA 1ETQA 4XKBA 4CCNA 2ZMEB 2E5ZA 4XNFA 2K86A 4AU7A 5GTIC 1MJ9A 2HOSA 2TRTA 1HOMA 3S2DJ 1E2XA 2YU3A 5HODA 1KU3A 3BDDA 2BY3A 1I39A 3K0LA 2R92J 2F5EA 3QQAA 3HOVJ 3DFGA 3T1BA 4XOTA 3WTTC 1YW8A 2DT5A 2PQ8A 4YFKF 2H8RA 3F8MA 4E70A 4R8HA 2DA7A 5KK1A 2VI6A 3HC7A 3S3NA 1O7LA 2XIGA 1BOBA 2BV6A 4MTEA 3QYBA 2R7SA 2W57A 3S1MJ 3OYIA 1YRNA 3C3WA 2KZGA 2K4JA 1RESA 1GLNA 1X19A 3EUAA 4WWCA 1AA7A 3J80K 1OFCX 3H5NA 5CPRB 3VSKA 3K6GA 2MFZA 3CMMA 1OCZH 2ME6A 3ZRGA 1SVLA 1BI2A 2GXBA 5HDNA 3C2HA 2BZTA 1B4AA 4OIPF 2D1VA 2VQHA 4D5CA 2LC2A 5D8KB 3R4KA 3OYLA 2MSYA 4JOMA 5H6RA 3WU1B 1BJZA 2RV8A 2OZ6A 3RI4A 4XKCA 4B3XA 5FKOA 1Z0XA 1A6QA 3CUQA 3NAUA 1MMAA 2DA6A 3W2AA 4FTHA 1B9MA 2Y30A 2QKMB 5KAFC 3BJAA 4FE4A 4DGWB 1E3PA 1ZYRF 2IVMA 1IN8A 2QKLB 3F9KA 2Y75A 2BXYA 3DEEA 2NVXJ 3J7YJ 5ED4A 1XDUA 1YS6A 1POGA 2AXLA 4YIIA 2ZXIA 4XQFA 2O5RA 2XF5A 3K10A 1JTYA 4RB2C 2MLGA 3A02A 3K4CA 3HRUA 4A5MA 2IT0A 5F0HA 2V7FA 2HQAA 2L02A 4B43A 5F1RA 1O3QA 3ROUA 4KN7X 3DBRB 1NK2P 1DP7P 1N25A 2FX0A 1K6YA 5LGUA 4HQEA 1K78B 5H6QA 4II2A 4UUTA 4PJJA 1TQPA 4ANJA 3JRAA 5HDGA 3JR9A 1HBXG 5IOZA 4AUXA 3TMOA 4A3FJ 2PG4A 3BTIA 2MG4A 3QRFF 1TT0A 3QPTA 2HTSA 5F64A 2H09A 2QEXI 1SD4A 3P9IA 1IV8A 5J4YA 4YELA 4A12A 1KQ8A 2EB7A 1IG7A 3S3MA 3QU6A 4PJNA 2MA3A 4YFXF 2DOAA 3O6BB 1W5SA 2PJRA 4M6VA 3AG1H 5HLIA 3OYKA 3QOEA 3GW2A 1OYWA 2ICWG 2OA4A 5EG0A 2ISZA 2JSCA 2K9LA 4BE1A 3WTZA 1I6XA 1X3WB 4IOCF 3GTLJ 2F4MB 2LF8A 3WE2A 2LKXA 2L0KA 2KFDA 3F21A 1TWAJ 2QBYB 2QQ9A 2IGMA 5KCMA 3OWTA 3PQJA 1T98A 3HSRA 4DZJA 2CG4A 4Q48A 2QSGX 1E3HA 4YRVA 5K5QA 1ZG3A 5GADJ 4TV7A 1MMSA 2BY1A 4RAYA 2ZJQF 1UHMA 3FHNA 4XLFA 1KZHA 3B73A 4NQWB 2NS8A 4EJOA 4L5IA 2ZJPF 3ZMUA 1MGTA 4LG0A 1G3YA 1IDYA 4GYIA 3CDLA 2M3AA 3HXLA 3L09A 4KIFA 1P2FA 1WJFA 3HOSA 3G1LA 4MHGA 4BJTA 5BS6A 3RYRA 1GV5A 1R23A 2HVRA 3FXRA 1R4NB 1LDJA 2KMUA 2I10A 4QPOA 2P6TA 2EZIA 4CYCA 2LRDA 2RAEA 3BR0A 2KRHA 5M5XJ 4BE2A 1VQ4I 2FMYA 1FMWA 4OWRB 3J7AO 4A0YA 2JK3A 1AU7A 1I27A 1IDZA 4IHXA 2A5WA 2JWTA 1SMYF 3CLQA 4IXAA 5FRMA 4F55A 3TQNA 4CZCA 1IUYA 3WTVC 4Y3OA 3C2BA 4ZYHA 1REPC 3I58A 1A31A 1VQ5I 2GXGA 3G4SI 5ICCA 5CVVA 1Z6TA 2L9VA 2X51A 2XC7A 4UVCA 2WV0A 1MSEC 3F8CA 1SFOJ 1X58A 2CFXA 4CYDA 4MLOA 2CRGA 2R5YB 1GVJA 2MLKA 4UHTA 1Z7UA 2CFOA 4FISA 4M3EA 1Z1DA 4F92B 3JRGA 1Y56A 4HF0A 3F0CA 1KA8A 3ZMTA 3BWGA 2E2JJ 3Q0VA 3H36A 4G7HF 1LKXA 4D7MA 1MD0A 1IN4A 1I3AA 5L3CA 1QO0D 5IP7J 2QM3A 3CJNA 2ZFUA 3LQRA 2O7OA 2ESNA 3K70D 3LSHA 1IZ1A 1VQOI 2NOGA 1G2HA 2DMUA 2O8KA 2HI3A 1W0TA 2R7XA 2OF7A 2DFHA 1ZG1A 2RC4A 2R7OA 4HW0A 1ZR2A 3GTKJ 5K5RA 1X1CA 5FD6A 1MBJA 4LOCA 4F93B 4LG3A 5GPCA 1TWCJ 2DW4A 4WK8F 2X1EA 1RKWA 1Z05A 1MBHA 2X48A 4C2MJ 4D1QA 3L2RA 2EILH 4I0BA 2FEZA 3OYJA 3LFKA 3M9AA 5D4RA 3BTLA 2FMLA 2ELJA 3A4CA 3HZJA 1XSXA 3DBLB 3HUGA 2RREA 4YIFA 1T0FC 4N9HA 2OAZA 2FNPA 4U88A 1Z3YA 2JZYA 2R3SA 4OAZA 5DM7F 5D8LB 2PMHA 3MQ0A 2K3FA 3DQVC 5GAHJ 4L0ZB 3A01A 5FKLA 2DMNA 2VB6A 1KYZA 2F5FA 4MEYF 3OR2C 1OR7A 1LUJB 1R00A 4YIRX 2IAIA 4HDVA 4XSXF 2WTEA 4ON0A 2AHQA 2XSDC 2CGPA 4RAZA 4BXUA 3BQYA 1LB2A 1D0XA 2JN6A 1JI8A 1MBFA 3AL0C 4IHTA 2F4OB 4KJZA 2AXTC 5DEQA 2WAQN 3Q0UA 1FOWA 2NXNB 4HSTA 4EQQA 1GVDA 3S2WA 3OOPA 2HOEA 2R7WA 2W82A 2JPCA 1RETA 3PO2J 3A0HC 4O6JA 3HPGA 4BH9A 3L1PA 1YRNB 2OTLI 3KLNA 1BC7C 1R36A 4CICA 1TC3C 2BVMA 3KE2A 2JSPA 3DKXA 3KPHA 4G7ZF 4PGHA 2L9SA 3GXOA 1EF4A 2Y9YA 3ZQGA 2DFFA 4Y52J 1D1BA 1K61A 2JUCA 4J00A 2V79A 4IRHA 2BYVE 2E19A 3JAMZ 5IP6A 4IRIA 5IPAA 1PJRA 3IAS2 2W1OA 3GTOJ 1GXQA 2IP2A 3KP5A 4EM1A 1E0EA 2XGDA 4NC7A 1MBKA 5TGTA 3TO7A 1P7IA 5AONA 3KP2A 4XK4A 2W00A 3HOUJ 3MKLA 3KZIC 4HAMA 3AG3H 4AWXB 2GA2A 3CUQB 2O9LA 2R7UA 2EV0A 4BDZA 3GFMA 4DYRA 1FBSA 1HLVA 4M72A 2DPDA 2LY1A 2A5YB 1HKQA 2E1MC 4JBAA 1X1PA 4E7JA 4RAFA 4HF2A 4BAYA 2G7HA 4HRIA 4N9IA 3RYPA 2ZFWA 3VYRB 4BBSJ 1PUFA 1Q1HA 1WFXA 5IYCJ 3IAM2 4OAYA 3A2KA 1D1AA 3F8BA 4ITVA 4RGXA 3KP6A 4E4HA 3FXJA 2HDCA 2WY7Q 4IOAF 4RAGA 2KDZA 4KITB 4M3BA 3W2VA 2J5OA 3GUDA 2PMZN 4BE0A 2EK5A 4I99C 5HLHA 3SZPA 1IAWA 4I2OA 2M7BA 5TJJA 3HG9A 2DA4A 1YE9A 1TWFJ 3M7GA 4BJ5C 1VZ0A 1JKQC 1BI0A 4MFDA 3IC7A 4I6ZA 2FF4A 2BY0A 3TOBA 3HB9A 3F22A 1D5YA 1SVMA 1MDMB 3ERMA 1WWXA 3FXKA 5JI6A 1APLC 1UJ8A 4DZPA 1YW9A 4HLXA 4RLQA 1GV2A 4D7NA 2QWWA 3I0TA 3FXMA 1T0FA 4A3EJ 3HGGA 5ICFA 3SHFA 1ZARA 3I9V2 4IJAA 3RZDJ 4KFCA 1SANA 3IUOA 3CP8A 2PJRB 5E3MA 4BEHA 5EG0B 3I56I 3H3UA 2ELKA 1S3JA 3L7WA 3V7CA 3E6MA 3CO7C 4L0YB 3BPVA 1MMNA 2JVGA 2XHKA 5DCMA 2STWA 2F2EA 3OYEA 2ZXWH 2DU9A 3J81Z 2DOFA 3RSNA 3BR6A 3DXJF 1S7EA 4X6AJ 4G7OF 3A03A 2HR3A 5JR3A 1LVAA 3GZ6A 1Y39A 3RZOJ 1JJ6C 2LK2A 3N05A 4CSWA 3WTWC 3HOTA 4WXDA 2NVUB 1X1DA 3WU2C 2LY2A 4NBQA 2CWEA 4RB1A 3T0YA 1LQ1A 2KQRA 1J5YA 2VC0A 2JRTA 2X6XA 1KYWA 4KMFA 4LG0B 1IN6A 1BR1A 4AVZA 4LGWA 3NRVA 1X2NA 4RM3A 4C2UA 4O3MA 4UUVA 3WTXC 3IKTA 2QQ8A 4A3JJ 3FBNB 5CVUA 3OYMA 1QRYA 1WH7A 5H2FC 2E60A 3L2UA 3RDIA 1IRGA 4CYCB 3DKYA 3CCSI 2KL4A 2K9MA 1YQAA 2UXXA 4XSZF 3SQNA 1FX7A 1G3WA 3FMQA 1ON1A 1YS7A 4B09A 3GFLA 2FQ4A 4JP0A 3K9TA 1YJNI 3FM5A 1TWHJ 1ZTRA 2P8TA 1JXSA 1O57A 3FMRA 3CUOA 2MH2A 2IEKA 1SFUA 1PUEE 1P4WA 1ULYA 4A2UA 4BQAA 2DO7A 3K70C 3RCOA 2EFNA 1R5ID 3MZ8A 1L0OC 3TP0A 3RQIA 5GPAA 5LHHA 3MFKA 3F3XA 3IH4A 3M8EA 2C6YA 2W24A 4BU2A 2XRLA 3E97A 5CVRA 4BS9A 2A07F 2VQGA 1KQ9A 3CCEI 1R1UA 3ZP5A 1ZRFA 3TKYA 3BCBA 1GHCA 3PUBA 2KISA 3IHUA 4U0VA 4EVIA 2KHMA 1F1ZA 2M0MA 4MQ9F 1JGGA 2JQ7A 3M07A 2P6SA 2YR2A 2X1CA 4UNOA 2CO5A 2ZC2A 3LSPA 2V6EA 2BHZA 2EQRA 4GYGA 5LEKA 1P4AA 3ZQFA 3WGGA 4XRMA 4KISA 2EIKH 3PNTA 4F7ZA 2NVQJ 2BHYA 4Y4RA 1BW6A 1WI3A 4XOPA 1YOVB 4I98B 3V8LA 3QODA 2M0CA 3HUGB 2KZVA 2X6WA 3KYCB 1J2XA 3BROA 4FQGA 1WRJA 3QPLA 5IT9Z 3SFIA 2WAQA 3AFHA 5CYVA 3ZGKA 3KIOA 5E3NA 4UXNA 4U0WA 2LVSA 1I1GA 4PFOA 3BJOA 1A6IA 1VF9A 4PSXA 3DP7A 2EFQA 5F04A 2A05A 2ELHA 4M74A 3OYGA 3QAHA 2FE3A 4GCVA 1S29A 2XSJC 3F8FA 4II3A 1RC9A 3PSIA 1ETXA 2YU9J 1FOKA 4MFEA 1RUOA 1DQUA 5DDGA 3REOA 4EJVA 5M5WJ 4N4OB 1UFMA 4BY1J 1WKMA 2F5VA 3O3KA 4XBFA 1CF7A 2IGKA 1W5CC 3QOPA 4IX7A 1JUPA 3TOAA 2VODA 1MNEA 2HXOA 5ICEA 2OCEA 2XRNA 3G2BA 5FLVA 2ADUA 5FKKA 2Y48A 1YG2A 1ZGAA 2A6HF 2HOAA 3K4NA 1VQMI 1USTA 2HPIA 3GYHX 2N8GA 3HTUA 1MJAA 2JPBA 1FC3A 3BZCA 5CJ9A 5ILSA 5J1YA 4PJMA 2IS6A 2K40A 2XAQA 3FXUA 2GLOA 2TDXA 5J47A 2E2IJ 2KJCA 4LLLA 3KEQA 1QHGA 1B6AA 3QP5A 4QPQA 1WJEA 3Q9SA 5KAIC 1P7JA 2F6CA 3JRBA 1RIOH 1CQTA 4KYWA 3LSJA 1G8XA 2HS5A 5LFAA 3BT9A 3V7SA 3ZMSA 3L2VA 1D3YA 5DYMA 1Z3XA 4LITA 4JX4A 2R0QC 2KP6A 1BR4A 4ASNA 4W1UA 2IW5A 2QSHX 2P5VA 2R7DA 2VBYA 4XONA 1P4XA 4KIBA 5HS9A 1T6SA 5D6FA 4PFPA 2WAEA 3BP8A 4UVBA 2ISYA 1UZCA 4D5FA 4RBOA 1TLHB 3G1MA 2PMZA 3CO6C 1IRZA 2R7ZJ 3ZMZA 1PDNC 1QPMA 2FD5A 3MAJA 2VKEA 4FX0A 3ZOBA 5LGNA 2KIUA 3OIQA 3ERED 1OQYA 1BM9A 1PUFB 3T8RA 2FOKA 3EQLF 1HCRA 1DU0A 2LOOA 1Y0UA 4PGGA 3GBGA 4DJAA 4BYYA 5D6EA 5E3LA 4PJLA 5CLSA 3KETA 2EZKA 3P9CA 1F5TA 2K9SA 2Z9OA 2L2OA 3BG3A 4A93J 5LLQA 2JA7J 1R49A 4I01A 4CXFA 4U0YA 2Y2ZA 1T33A 1TNSA 3MWMA 1LEAA 4U7BA 2ZJ2A 3P7NA 2K9NA 2JA6J 3LQQA 1FLIA 2M34A 4MEXF 3J7ZI 1FTTA 4KDPA 5FLXZ 4LB5A 4ZDLA 3GTMJ 2ZNYA 3F8NA 1S6LA 3IV5A 3CCLI 3HGYA 3CCJI 3A1YA 1T39A 3OR1C 2M87A 4LB6B 4LLGF 3H3ZA 1BA5A 1E17A 4AIJA 2HZDA 4XICA 2FU4A 2CW8A 3D5SC 4S0HB 1MBGA 4BEHB 2DQRA 3RKWA 1SEUA 1BR2A 1I3QJ 2STTA 1YJ9I 3TW7A 1K83J 1OCOH 2H6BA 1WCMJ 1O7FA 4D9JA 4RDUA 1OYYA 4AIDA 4L9VA 2BY2A 5DCMB 1XMAA 3WGIA 3Q3SA 3RKXA 3H9JA 4UUSA 3NQOA 2QSFX 4DYCA 2HKOA 1Y0NA 3JW4A 5CVIA 2F5DA 3L9FA 1T08B 2L3DA 2DXIA 1UELB 2XAHA 3DEUA 4MTDA 4KIGA 2O0YA 3VDXA 1JTXA 4ZYGA 1IGNA 4I0AA 3VB2A 3B6AA 4GRIA 1HXDA 1XX5A 2DFEA 1MDMA 2IRFG 1OISA 3KZYA 1USSA 1EKEA 5D5XB 3R6SA 2IPQX 5EEAA 1TWGJ 1VFCA 3RTRA 3D1NI 1STZA 5F6FA 3CQZJ 5JVGF 2M8GX 2LSOA 1ZLKA 3I54A 1XMXA 1ZK8A 1FP1D 3TO6A 3HTSB 4N0BA 1LDDA 1EA3A 1OJLA 2IGOA 2ZXHA 4A3IJ 3GCMA 2Q8KA 3CC2I 4DQ2A 1N78A 4U87A 2A3SA 3CCRI 1IC8A 3S17J 4CA0A 3MD2A 1F9NA 4CCOA 1P92A 2EBIA 3KYDB 1VQ8I 4HV6A 1BOAA 3DPUA 2DJNA 1P6RA 2O03A 2W7NA 4KA4A 3IH2A 2W48A 3SDBA 4A0ZA 2OD5A 1IXSB 2RQQA 1D1CA 1HW5A 2EPFA 4XLCA 3ZMVA 4BQQA 1OPCA 5IP9J 2L7MP 1H88C 3FISA 3ZN1A 4GGGA 2X85A 2LTPA 3QWLA 2HWVA 4NB5A 4BHCA 2XPUA 3B6CA 2E34A 2K27A 3ZN0A 2R7VA 3W3CA 5L3DA 3WG9A 4C9YA 1FYLA 1U5TC 2E1MB 4C2TA 3OOUA 2CV0A 1U9OA 3TL4X 4C30A 2HGCA 3KX2A 2QVOA 2R7RA 2L01A 1WJCA 2WB1N 3LSTA 3ZMDA 3Q0WA 3J80Z 3G6EI 4G6TB 3C2GA 2M9HA 2X0LA 1Y1VJ 2KRFA 4XLAA 2X1DA 2GOXB 3LNQA 3HSEA 5AIPA 2BE5F 4CCMA 1TP4A 4E7KA 4XLHA 2DA3A 2FBKA 2K02A 3EUKL 1B9NA 2ZMEC 2CV1A 2DK8A 2DMPA 2LFBA 3V7RA 1AOYA 3KEOA 3ZR8X 3M4OJ 4R1HA 5EJCA 2EH3A 4DIQA 4NDLA 3VFZA 1WI9A 5HNFA 1ITYA 4ZC3A 1QQIA 2YSRA 3SJMA 2FNAA 3FXQA 4XIDA 1W36D 2VT2A 3KFWX 3LA7A 5HOOA 2HOTA 4OMZA 1SFEA 3FMSA 2KIFA 2LP0A 4PJ0C 1SFKA 3WHCA 3F6OA 1FEXA 1QGPA 2Q2EA 4OOIA 3GTPJ 5GAGJ 2F4IA 3LSIA 3GEZA 2HYJA 4HQMA 3BPXA 4UVAA 2CW7A 4A3BJ 2RN7A 2FRHA 4G94A 5ILUA 1DGWY 2D45A 1BIBA 4EJUA 5F08A 3FBIB 2FOWA 3OMYA 1ZR4A 3HOYJ 3N97A 1CF7B 1IXCA 3MN2A 2QZ8A 4ZZDA 1VNDA 3K2AA 5HLTA 1JKOC 2FBHA 3DPLC 1DGRM 3DLAA 3ECOA 2EIMH 3CCQI 2PLYA 3CCMI 1ZRDA 1MMGA 4I09A 4B4CA 2PMUA 2IA2A 3FXOA 2PJPA 2R5ZA 2LYCA 2ID3A 2H6CA 5E1ZB 3H1CA 3RJPA 3BC8A 1XS9A 3PFIA 1XCBA 4S05A 2M1BA 1BIAA 1Z67A 1TW2A 4EEFG 2MW8A 5ERIA 4YFNF 2EZHA 1I50J 1HDPA 3TDZC 2P5KA 3A0BC 3JRDA 1Y6IA 2WA0A 3GO5A 2MD0A 5FGMA 2O61A 1MKMA 1QPIA 5J8FA 3S16J 2YX7A 5L3GA 1MMDA 2NS0A 3S8PA 1FWZA 1HA8A 3K2ZA 1S8NA 2EV5A 2BEOA 2HYGD 1W7PB 2A6TA 1VQ7I 4HLYA 2OU2A 2MYSA 2V1NA 3LOCA 2V26A 1WJBA 1OMIA 2CMPA 1F4KA 1GUUA 2CQKA 4Y17A 5EYRA 1UB9A 2W84A 3SZGA 3S3OA 3WE3A 3K4BA 4IEJA 1IJWC 4HBLA 1BC8C 1VQNI 2EFPA 2P0WA 5TRDA 1PP7U 1QZEA 2KIMA 2JUGA 2G0EA 3BCAA 4K2EA 2A68F 4NHJA 1MSFC 5HS7A 4P5OA 1I6HJ 1Z6RA 3SYTA 4OINF 4IHVA 3CCVI 2AO9A 2IXSA 1KU2A 4X1EA 4A3MJ 4ABZA 2LBFA 4J19A 3BY6A 4OMYA 1IN5A 4RS8A 4MQVA 4C3IJ 2ZXJA 3EETA 1Q1VA 1SMTA 1UG2A 4J01A 3PNYA 3ULQB 2LG4A 2ZB9A 1V55H 1XC5A 4G8XA 1UHWA 1FBUA 1IRFA 1WGXA 2WADA 4IHSA 3ABTA 2VIXA 4IQJA 3BG9A 1DPUA 2H94A 2IS1A 2L9NA 4AM3A 1XB4A 4JQFA 2VKDA 1TW3A 4IHYA 3OIPA 1U8BA 2K85A 4OIQF 3FDYA 4BJ6C 3DU5A 5M3MJ 4PDKA 5F0CA 1ON2A 3ZCOA 1NG7A 2NVYJ 3TGNA 3OYHA 1SD7A 4QSHA 1ZHFA 2LDUA 1XG1A 3D5RC 4M6YA 1JJ8C 1J7KA 1T2KA 2ME0A 3HOZJ 3FKJA 1DU6A 1QZYA 1B72A 4G6QA 3WTSC 3HBLA 3HIFA 1VQ9I 2GOMA 1XTAA 3H35A 3ISPA 3RPUA 5B3SH 4UUSB 1V4RA 3VYUB 4OIOF 3PUFA 4FETA 1PYVA 4ZYAA 5E3OA 1KU7A 1MNDA 2OZUA 3RIRA 1O3TA 4PUSA 5E8GA 5D5WB 1QZZA 3KP3A 4NUBA 2B63J 2YX4A 2TCTA 2E71A 1FYMA 2DJIA 2L4MA 3GF2A 2Q1ZB 2JT1A 4FX4A 1WVRA 2WV1A 1YIOA 5KNLA 2WWYA 4JK1X 2V9PA 4HV5A 1K4SA 3PL8A 3CESA 4BQNA 2HVQA 4X0GA 1FTZA 4HX8A 2Z2SB 2DYSH 4MGRA 3R61A 4Y15A 2BGCA 4RGSA 5JLXA 5C3EJ 4HG2A 4AIKA 1RI7A 3HRMA 5IYBJ 3HOWJ 1S9HA 3PIPF 1ENHA 2FXAA 2ZSHB 1S7OA 5L3BA 1BN5A 3LL7A 3AG4H 3PSFA 3LSGA 3Q9VA 4HZFA 1G3SA 4L5JA 2DA2A 5E1WA 2CV2A 2CW0F 2VQLA 1R22A 2HNHA 5K7HA 3K7AJ 5JFRA 1FIAA 2LNBA 3HJEA 2FBIA 2F48A 4UY8I 2RQPA 2WB1A 4KMUX 1ONVA 2RNGA 2VL8A 2G7UA 3DTEA 3BQZA 1FP2A 4ZYDA 2P4WA 3K4JA 2I5UA 2XVCA 4H0EA 4L9JA 5K7FA 1XDSA 4Q5SF 5F27A 4F52A 1GT0C 1ORKA 2UWMA 4L5EA 2LY9A 2NYXA 1ZH5A 2L4AA 1BI1A 1OKRA 3DCFA 1X4OA 3CCYA 3ELKA 1CGPA 1N75A 3OYNA 1H9TA 3FK7A 1U6GA 1MW7A 1R58A 3E3VA 2Q0OA 3UNGC 1OYIA 1LVKA 2DA1A 1J59A 1A36A 2D1HA 4BKXA 2COBA 2ZKZA 4P9UA 2HVSA 5D5VB 2XROA 1ETOA 2GA1A 4ENKA 2E7XA 1O4XA 1W36C 1V5GA 4HSRA 2Z33A 2GXAA 1YLFA 2BXZA 3R0AA 2K9QA 3HOXJ 4ZTJA 4PCQA 1J9IA 1FT9A 1VI0A 2VKHA 3DKWA 2M8EA 3ABUA 1KGSA 1HKTA 2MD5A 3QPHA 4B47A 2ETHA 2IGNA 1IF1A 2HEOA 2IS4A 4BXFA 4RGUA 2HDDA 3I5UA 3GVAA 2KT0A 3L2WA 2R93J 1EH6A 3R0JA 3ZQHA 3IH3A 4IQ4A 3IP4B 3TEDA 2ACJA 4C3HJ 1JE8A 1MJBA 1TZLA 2Z16A 3M1EA 2A6EF 3JRFA 3L2QA 3DU6A 2AQEA 2L7ZA 2QQBA 2IJLA 2VKVA 4P9FA 5EZHA 2JMWA 2Q2EB 1W0UA 3M3YJ 4XLPF 2XUBA 1ZLJA 2O8XA 3BZKA 5FD5A 5HNHA 1LEBA 2V9KA 3OS1A 2WY8Q 3DBHB 3OV8A 3KZZA 2DDBA 2VUMJ 3OS2A 3V42A 3O8HA 2DT6A 3FWEA 2DFIA 3CDHA 3S14J 5EGOB 4XMYA 2AQFA 1LJ9A 3LFUA 3ONQA 2LR8A 3VEPA 5EEGA 2I8DA 4HF1A 2XPVA 4BHBA 4IVNA 1B59A 2H1LA 1K6OA 2OUMA 4IRGA 1FOYA 2DODA 5FFXA 3Q5FA 2EJRA 3CD6I 4M9SA 3ECHA 4EGZA 3DV8A 3LA3A 4BQOA 1A04A 1V5EA 1UG0A 3HRTA 2XV4S 4R79A 1D8JA 3JREA 2X9DA 3VPRA 2R5ZB 2ZJRF 3CUQC 1HQCA 2E1NA 4ZJZA 3LAPA 4XKVA 1U78A 4A0XA 4ESFA 1YFHA 1P9QC 1LNWA 3K4KA 3OS0A 5E79C 4M3GA 3OIOA 1XCVA 3BG7A 1WSUA 1QBJA 3BR1A 2GIZA 3JTGA 4HA8A 2RDPA 2DN0A 1KQ0A 2OV7A 2FSWA 3CF2A 1FSHA 5B66C 3FM3A 3GTJJ 5IOYA 1NHAA 4KT6A 4WF2A 2M2EA 1FZPB 3QP6A 3JTHA 4EM2A 4M6XA 5KHDA 4P1WA 3G73A 3HPHA 5B5EC 1R4MB 3MKWB 2FA5A 5LRRA 3IWFA 4XM3A 4XRFA 5E17F 3H0GJ 1JUSA 1WH5A 1JUMA 1LDKB 1H9GA 3KEYA 1J0RA 3IWZA 4A3LJ 3SZTA 2CH0A 1RZ4A 3OL3A 4YG2F 3QYEA 4EMSA 2R4GA 2Z99A 1U3EM 4PZJA 4BBRJ 4G6DA 2P7VB 3MKYB 5EDNA 4L9NA 3GZ5A 5CKTA 5J8CA 3NARA 2J5PA 2JVHA 2LBFB 3WODF 2DMTA 3L2CA 2GM4A 3S15J 2HKXA 2K3PA 2OC6A 5DCFA 1RR8C 1ZAOA 1T38A 1G4DA 3O8GA 1FOXA 4IL6C 2XAUA 1AKHA 3S1NJ 2VT3A 2EV6A 2MC4A 2QQAA 2GZWA 3BOQA 5J4VA 1TT5B 3TP3A 4QTRA 1KONA 4M71A 1I1SA 5HVQC 1W7PA 4DBQA 4E7HA 3JRIA 1LFPA 5B1BH 4BXXJ 4DYQA 2JJ7A 2QF7A 5LD2C 2VPLA 1QVUA 3CMEI 3GTQJ 1XMKA 1QA6A 3K1PA 3FK6A 3CLOA 3ABMH 2E1CA 1YI2I 2BOLA 2WBMA 2FJ1A 2QGUA 2XB5A 2DK5A 2XF6A 1XSDA 1Y1WJ 3I3LA 4WXHA 3I4PA 5DD8A 1B72B 4N4NB 2EA2A 1O3RA 1XGSA 2VBWA 4HOBA 5E18F 3GZNB 3T8TA 4BACA 1ERDA 1R5GA 4EV0A 5C4XJ 2DQLA 3HHGA 1U9NA 1R1VA 4HX7A 2K5CA 2KJBA 2VN2A 3MZYA 1HDDC 4HDUA 2Y9ZA 4FE7A 1TQIA 4CZZA 5LHGA 3VWBA 4KUMA 4IO9F 3KP7A 3CCUI 2M7AA 1EH8A 1TBXA 4P96A 2MH9A 1U0JA 4D0PA 2VJ5A 4ENMA 2Y0SN 2GAUA 1FIPA 5A2QK 4AC0A 2CUZA 4Z2YA 4ZDPA 5LBQA 5EZGA 5FJ8J 4LFUA 3OYAA 2EFWA 1LPQA 4UV8A 1YITI 3HM5A 3JCUC 4HNUA 1R6RA 3F6VA 2HZTA 2MABA 4FHTA 1EJ9A 2VJJA 3R60A 5LRSA 1R7JA 2A69F 5L3EA 4XLEA 2EWNA 2NOJB 3HL2A 2O6GE 2VXDA 3OY9A 3EUHC 1QHHD 3BR2A 3TO9A 3BTJA 3LSMA 1H0MA 2RKHA 1GXPA 5LGTA 2YPRA 2NAZA 3GLXA 2CS3A 2DBBA 4XRSA 3H0DA 4U7DA 3DTKA 3CC4I 1ZN2A 2VONA 5M5YJ 2KRCA 3DLLF 4CCKA 3M8JA 3FXLA 2D2WA 4JX5A 4ZYEA 2XKPA 1ZKGA 3BG6A 3P9KA 5HDKA 4UB6C 3TW6A 4Y7NJ 3AL0B 1SAUA 4NC8A 4LK1F 4AYBN 1YTYA 1HSJA 4WXCA 4XORA 4Q47A 3WHBA 3S1QJ 5J3LA 4QLCU 2H1KA 2OQRA 1C0WA 4ENNA 5E1XA 4ENJA 3VODA 2YS9A 4E7SA 1ZG5A 4CDGA 4A3DJ 3E6CC 1W1WE 4RB3C 1VQKI 1OCCH 3C7JA 5B1AH 4O5VA 4ZTFA 3J7AY 2W85A 3G1OA 1H89C 1YX3A 2VBXA 1ZREA 2VQCA 3BR5A 2HPMA 3OL4A 1MBEA 4M9XA 4W97A 3BZ6A 3ESWB 3F72A 4RGRA 4EGYA 1MIJA 1WQ2A 4XN0A 5GAEJ 1RKTA 2R7FA 2HTJA 2ID6A 4G12A 1DUXC 2V1XA 2P5LC 2XPWA 2L9RA 1OR7C 1X2MA 4Q4ZF 1YHQI 3KCCA 4M3DA 2NNYA 1JKRC 1JKPC 1OCRH 2CSOA 2HQ5A 5FKNA 1ZGJA 3H9GA 4GO1A 3E5QA 4BDYA 4IHWA 3MMYB 5EF6A 4OIRF 4LIVA 1MNMC 5EEHA 2ECBA 2Y0MA 3PIOF 2MGQA 1IO2A 3H9QA 4I7HA 4I76A 2VASA 3C1DA 3HYIA 4IZZA 2X4HA 2OPTA 3DF8A 4WCGA 2JA2A 2VJ4A 3PQKA 3NEUA 2ZNZA 3SDGA 1YW7A 2DA5A 3JRCA 2P81A 3E7LA 1IV6A 5ICGA 4E7ZA 3HHHA 1MH4A 5AIQA 4LIUA 3SEZA 1HKSA 3LAJA 2Z1DA 4XRSG 1B8IA 1NK3P 3E6BA 2RGVA 3JSOA 4HPQA 2CQXA 2UZKA 3GFJA 4KNYA 3MVPA 5DTDA 3JAMK 3M8FA 5FO5A 3VSLA 5GTHC 1LFUP 4CGZA 3DTIA 2B9SA 2VPRA 2HQNA 1JHFA 4LMYA 4MIMA 4QWQA 4CCJA 2RVCA 2DDAA 1AWCA 4UB8C 4V2FA 3K4MA 1SVOA 4ETSA 4JYKA 4HNVA 1EH7A 4M73A 4JX6A 2LLKA 3V4GA 3U1DA 4AIHA 2VOOA 2D5VA 3E5UA 3E5XA 2V9VA 4EM0B 5DUIA 5A2QZ 2DCEA 4FT8A 2CQ7A 5IY5H 4CUGA 1V3FA 5FRNA 1VQLI 2DMQA 2KDOA 2M4KA 3W2WA 1K4TA 1OLTA 3CTAA 2M30A 4XN3A 5EGOA 1S5LC 1H8AC 2E36A 1J75A 1W7PD 3HKZA 4P55A 3EUHA 2Z3YA 2LMDA 1FY7A 4HYEA 2JRMA 4AD9A 1WJ5A 2G9WA 5BNGA 2W25A 1JT0A 3I59A 3UKGA 3RKQA 2OTJI 4B48A 1ETKA 2EIJH 3CDIA 3O2PE 1QNTA 3JSPA 2XGCA 1ZQ3P 1BJAA 2QYOA 3OYCA 1W4MA 3T5XA 4S04A 4LJZF 4B1RA 5HLGA 4KN4X 4ESBA 2WC2A 4I02A 4Z6YA 5DD4A 2VOPA 1M1EB 1G6NA 3HDDA 4L9TA 4UV9A 2DOEA 4LK0F 1HF0A 3W6VA 1QVTA 3E6DA 5CQGA 2CUFA 3EPZA 2MBFA 3M1CA 3LSRA 2B0LA 3S2HJ 3PNVA 5CQEA 4FCYA 3FX3A 1S72I 1WJDA 1XGMA 1NH3A 1ZELA 2UV1A 2KKOA 3PO3J 4E6KG 1AKHB 2E7WA 3WG7H 1D0ZA 1IN7A 3ZXSA 1NG6A 4Y13A 3U2RA 5K5OA 3IL2A 5FROA 3MZHA 3K1MA 3BJ6A 2M5WA 4KICA 3ZPLA 1IW7F 2NNNA 5C44J 1RRJA 4XR6A 1MZBA 1I5ZA 3BR3A 3ML6A 5FFZA 1ACIA 2LKSA 5IT3A 3ZQ7A 1TQMA 3QU3A 1N77A 3D5LA 1E3OC 1U8RA 4RLFA 2PEXA 2BW3A 1FNNA 3PJRA 4LLNA 2H8WA 1K79A 3J81K 1XD7A 1D0YA 2LREA 4E7IA 2XAGA 2CYYA 4PK4A 2KLOA 4BL0B 3RQ4A 4KT5C 4IF4A 5J1RA 4HX4A 1YX5A 3CJQB 1XSVA 3IRRA 1XGOA 3DEWA 3I71A 1U5TA 3K4LA 3LMMA 4G9YA 5ILVA 4HEA2 4XKWA 2CUEA 4M3FA 5K7ZA 4E7LA 2Y0SA 1WZ2A 1ZGWA 3S1RJ 2XKOA 5BOXA 1DP3A 3F23A 2XB0X 1HSTA 2X6YA 2XAJA 3BG5A 4Y33A 1Z21A 3MKZA 2OQGA 1V5FA 4XL9A 6PAXA 1Y8RB 2EZLA 1LE8A 2VE8A 3ZQCA 1UCRA 4FASD 4CH7A 2HXIA 5F1JA 1O3SA 3RKYA 2GIVA 2KIQA 1A5JA 2KPMA 3H5RA 3FZVA 2UUZA 3ABKH 1UHSA 3H3VK 2ZMEA 4F91B 1PVEA 1X1AA 3GLLA 2K7LA 2DPUA 2GBYA 1SC7A 2DAOA 5C4JJ 4DNCA 4RMNA 1D8KA 4RA2A 1L3LA 1DDNA 4AYBA 3AG2H 3COAC 1VQPI 1U2WA 2JA8J 5J40A 3RPQA 1TTYA 3I55I 3QPSA 3I64A 3VYTB 3B02A 3GMEA 3S32A 3L00A 2LD5A 2M45A 1S7AA 2VC1A 3HRSA 1G3TA 1GDTA 3X2QH 2DYRH 3GWZA 2X6OA 2UXNA 4B3AA 2RNJA 2LKPA 3BLYA 5TISC 2PFBA 4LD5A 2ZBKA 4NNJA 2XF7A 3DWLE 1T95A 2DI3A 3ZQLA 4CHUA 1R1TA 1X3ZB 2BBYA 3ABLH 5K1YA 4IKFA 3IRQA 2V4JC 4B8XA 2A61A 3WTUC 1R5HA 3OSGA 4BGDA 1JHHA 3ASNH 3NWSA 1SD5A 4A6DA 2HFHA 3FKIJ 4WX9A 5IT9K 2YUSA 1V54H 1WPKA 3EYYA 3K69A 4V2GA 4GFBA 4DBRA 4M9ZA 1HW2A 2CQNA 1FMVA 1QU3A 3CMYA 3CC7I 5FB2A 3HEFA 2CJJA 2L5QA 4A3KJ 5BPIA 3ASOH 1X4PA 3TDUC 5JHUA 3OSFA 2OCCH 2PI0A 1SFXA 3GX4X 2L54A 4HNTA 1R9TJ 3VOEA 5J6XA 3VYSB 1RR7A 1VQ6I 5D5UB 4BHPA 2IA0A 2DLLA 1SD6A 2ZSIB 2HDWA 5BQTA 1X3UA 2VBZA 3LSKA 1K78A 4NC6A 1D5VA 2W4SA 2ESHA 2GQQA 2ZCWA 2L7FP 4ZDOA 3E0JB 1WJAA 4BUPA 2PBIA 3CF5F 2HQRA 2R7TA 9ANTA 2WAFA 1EV7A 1G59A 1LFBA 1AHDP 5FLMJ 3LWFA 2MC3A 1T56A 2AS5F 2XAFA 5JVTA 1Y8QB 1B8IB 2CUJA 2VE9A 2QUFA 1ODDA 1F36A 1VTNC 1DPRA 3ZQIA 4B44A 5BMZA 2OJED 3E1SA 2NRAC 3UR3C 2GWRA 2VXZA 2L7KA 3MEXA 3KYLA 1PP8F 3P5JA 2XASA 1X1BA 2ECCA 4MNUA 1ZRCA 1SAXA 5DM6F 3WGHA 2Z5UA 4MO7A 1TNTA 4A3GJ 1W5TA 2F5CA 3WTYC 3N4MA 3SFZA 1YO5C 3QYFA 5LHIA 5FKMA 2Y69H 2QBYA 2IS2A 2FQ3A 2NVTJ 5KVRA 5IYDJ 2XDVA 4OU0A 2CU7A 2R7QA 2E2HJ 1YYVA 2P7CB 4ESJA 2CQQA 2XGXA 1WHUA 5H20A 3CMAI 4H4KC 1IRXA 2HU9A 1JGSA 3EDPA 2Y31A 3JRHA 4GDFA 4NQWA 5M3FJ 1Z77A 3CP2A 3U1KA 5JHFA 3OYBA 1JT6A 1NTCA 3WU0A 3I59B 1J09A 2PN6A 1UAAA 1HC8A 1A35A 3H5AA 4PSWA 3AAFA 1ETVA 2V1DA 5GP9A 4A6EA 2COMA 3IKVA 1FBQA 2XGEA 2E1OA 4RB0A 3CJTB 3I53A 3OYFA 4C3JJ 3BTCA 4CCLA 5E20A 3V8JA 4CO8A 2VLAA 3TBIA 3U9GA 2DTZA 3I4NJ 2VJIA 4EATA 2V1UA 2E5NA 2E35A 3EYIA 1ETWA 3FHZA 1BL0A 3NWTA 4ZH4F 1B1BA 2ZO4A 2O3FA 3G3ZA 3PM1A 2DTRA 3H92A 1IXRC 3KP4A 2IBDA 2JTVA 3ZQQA 5HS8A 1T8IA 1MH3A 5FLXK 4DW6A 2B7EA 4L18B 4A5NA 5DUKA 2QCOA 3HSFA 2QLZA 3V8KA 1TL8A 1FPQA 1OCTC 3I4MJ 4BNCA 2JA5J 2DT7B 2QA4I 1BW5A 2R5YA 3MCZA 2NS7A 4EJTA 4GXOA 1BBYA 3W6KB 2K4BA 1FYKA 2EFOA 5CVJA 2HYFA 4DOZA 4AVPA 3A01B 4A3CJ 3FF5A 3K1NA 3AKZA 2EINH 1RPWA 2BVLA 5E8IA 1XN7A 1FSEA 1KU9A 3LA2A 4A69C 4ZZLA 4BY7J 3G71I 2BW3B 3PFYA 4RM2A 3S93A 4V19K 2EA4A 2IA1A
chains in the Genus database with same CATH topology
3D0SA 1Z9CA 4XLNF 4EJWA 3C18A 5D4SA 3DPTA 1Z91A 1RNLA 3KLOA 1BI3A 4IPAA 1XGNA 1HW1A 1U5TB 2V6CA 3GFIA 2LF7A 5DV5A 5BPDA 2H27A 3W6JB 2QENA 2OBPA 3SXYA 1RUNA 1K7AA 5LEJA 5L3FA 2ZMEB 2K86A 1MJ9A 1E2XA 2YU3A 1KU3A 3BDDA 3K0LA 2F5EA 3DFGA 3T1BA 3WTTC 1YW8A 2DT5A 2PQ8A 4YFKF 3F8MA 4E70A 4R8HA 5KK1A 1O7LA 2XIGA 2BV6A 4MTEA 2W57A 3C3WA 2K4JA 4WWCA 3J80K 1BI2A 2GXBA 5HDNA 1B4AA 4OIPF 2D1VA 5D8KB 3R4KA 5H6RA 3WU1B 2RV8A 2OZ6A 3RI4A 3CUQA 1B9MA 3BJAA 1ZYRF 2IVMA 1IN8A 2Y75A 5ED4A 1XDUA 1YS6A 2AXLA 4YIIA 4RB2C 2MLGA 4A5MA 3HRUA 2IT0A 2L02A 5F1RA 1O3QA 3ROUA 4KN7X 1DP7P 4HQEA 5LGUA 1K78B 5H6QA 1TQPA 5HDGA 1HBXG 2PG4A 3QRFF 3QPTA 2HTSA 5F64A 2H09A 1SD4A 3P9IA 4A12A 1KQ8A 2EB7A 3QU6A 2MA3A 4YFXF 3O6BB 1W5SA 5HLIA 3GW2A 1OYWA 2OA4A 2ISZA 2JSCA 3WTZA 1I6XA 2LF8A 3WE2A 3F21A 2QBYB 2QQ9A 3PQJA 1T98A 3HSRA 2CG4A 4Q48A 5K5QA 1ZG3A 4TV7A 4RAYA 1UHMA 3B73A 4EJOA 4L5IA 3ZMUA 1MGTA 4LG0A 1G3YA 4GYIA 3L09A 4KIFA 1P2FA 3HOSA 4MHGA 5BS6A 3RYRA 1R23A 3FXRA 1LDJA 2P6TA 2FMYA 3J7AO 4A0YA 1I27A 1SMYF 4IXAA 3TQNA 1IUYA 3WTVC 4ZYHA 1REPC 3I58A 2GXGA 5ICCA 5CVVA 1Z6TA 4UVCA 2WV0A 3F8CA 2CFXA 4CYDA 1GVJA 2MLKA 4UHTA 1Z7UA 1Z1DA 4HF0A 1KA8A 3ZMTA 3BWGA 4G7HF 5L3CA 1MD0A 1IN4A 1QO0D 2QM3A 3CJNA 3LQRA 2ESNA 1IZ1A 1ZG1A 2RC4A 4HW0A 5K5RA 5FD6A 2DW4A 4WK8F 1Z05A 4I0BA 2FEZA 3LFKA 3M9AA 5D4RA 2FMLA 4YIFA 1XSXA 3HUGA 4N9HA 2OAZA 2FNPA 4U88A 2JZYA 2R3SA 5D8LB 2PMHA 3MQ0A 3DQVC 4L0ZB 2F5FA 1KYZA 4MEYF 1OR7A 1R00A 4HDVA 4XSXF 2WTEA 4ON0A 2CGPA 4RAZA 4BXUA 1LB2A 4IHTA 5DEQA 4EQQA 3S2WA 3OOPA 2HOEA 2JPCA 4O6JA 4BH9A 3KLNA 1BC7C 1R36A 4CICA 3KE2A 4G7ZF 4PGHA 3GXOA 2V79A 4IRHA 2BYVE 3JAMZ 4IRIA 1GXQA 2IP2A 3KP5A 4EM1A 3TO7A 5AONA 3KP2A 4HAMA 4AWXB 2GA2A 3CUQB 2EV0A 3GFMA 1FBSA 4M72A 2DPDA 2A5YB 1HKQA 4JBAA 4HF2A 4BAYA 2G7HA 4N9IA 3RYPA 2ZFWA 1Q1HA 3F8BA 4RGXA 3KP6A 2HDCA 2J5OA 3GUDA 2EK5A 5HLHA 3SZPA 1IAWA 4I2OA 5TJJA 3M7GA 1BI0A 3IC7A 2FF4A 3TOBA 3F22A 1MDMB 1WWXA 5JI6A 1YW9A 4HLXA 2QWWA 3I0TA 1T0FA 5ICFA 3SHFA 1ZARA 4IJAA 4KFCA 3H3UA 1S3JA 3L7WA 3V7CA 3E6MA 3CO7C 4L0YB 3BPVA 2XHKA 5DCMA 2STWA 2F2EA 2DU9A 3J81Z 3DXJF 4G7OF 2HR3A 5JR3A 1LVAA 3GZ6A 3WTWC 3HOTA 4WXDA 2CWEA 4RB1A 3T0YA 1LQ1A 2VC0A 1J5YA 2JRTA 4KMFA 1KYWA 4LG0B 1IN6A 4LGWA 3NRVA 4O3MA 4UUVA 3WTXC 3IKTA 5CVUA 1IRGA 3RDIA 1YQAA 2UXXA 4XSZF 3SQNA 1FX7A 1G3WA 3FMQA 1ON1A 1YS7A 4B09A 3GFLA 3K9TA 3FM5A 2P8TA 1JXSA 1O57A 3FMRA 3CUOA 2MH2A 1SFUA 1PUEE 1P4WA 1ULYA 4A2UA 4BQAA 2DO7A 2EFNA 1L0OC 5LHHA 3MFKA 3F3XA 3M8EA 2C6YA 2W24A 3E97A 5CVRA 2A07F 1KQ9A 1R1UA 3ZP5A 1ZRFA 3TKYA 1GHCA 3IHUA 4U0VA 4EVIA 1F1ZA 4MQ9F 2P6SA 2YR2A 4UNOA 2CO5A 4GYGA 5LEKA 1P4AA 3WGGA 4F7ZA 4I98B 3V8LA 1J2XA 3BROA 1WRJA 5IT9Z 5CYVA 4UXNA 4U0WA 1I1GA 3BJOA 3DP7A 2EFQA 2ELHA 4M74A 3QAHA 2FE3A 4GCVA 1S29A 3F8FA 1FOKA 1RUOA 5DDGA 3REOA 4EJVA 1UFMA 1WKMA 3O3KA 4XBFA 1CF7A 3QOPA 3TOAA 2VODA 5ICEA 2XRNA 2ADUA 2Y48A 2A6HF 1YG2A 1ZGAA 1USTA 3GYHX 3HTUA 5CJ9A 1MJAA 2JPBA 1FC3A 5ILSA 2XAQA 3FXUA 2TDXA 2KJCA 4LLLA 3KEQA 1B6AA 3QP5A 3Q9SA 1RIOH 4KYWA 2HS5A 3ZMSA 3V7SA 1D3YA 5DYMA 4ASNA 2IW5A 2P5VA 2R7DA 2VBYA 1P4XA 4KIBA 5HS9A 1T6SA 5D6FA 3BP8A 4UVBA 2ISYA 1TLHB 3CO6C 3ZMZA 1PDNC 1QPMA 3MAJA 4FX0A 5LGNA 2KIUA 3ERED 1BM9A 3T8RA 2FOKA 3EQLF 1Y0UA 4PGGA 4BYYA 5D6EA 5CLSA 3KETA 3P9CA 1F5TA 2Z9OA 5LLQA 4I01A 4CXFA 4U0YA 1TNSA 3MWMA 1LEAA 4U7BA 2ZJ2A 3P7NA 3LQQA 1FLIA 4MEXF 4KDPA 5FLXZ 4LB5A 2ZNYA 3F8NA 1S6LA 1T39A 2M87A 4LB6B 4LLGF 3H3ZA 1E17A 4AIJA 2FU4A 2DQRA 3RKWA 2STTA 2H6BA 1O7FA 1OYYA 4L9VA 5DCMB 1XMAA 3WGIA 3RKXA 3NQOA 2HKOA 3JW4A 5CVIA 2F5DA 3L9FA 2L3DA 2XAHA 3DEUA 4MTDA 4KIGA 2O0YA 4ZYGA 4I0AA 3VB2A 1HXDA 1MDMA 2IRFG 3KZYA 1USSA 5D5XB 3R6SA 2IPQX 3RTRA 1STZA 5F6FA 2LSOA 1ZLKA 3I54A 3HTSB 1FP1D 3TO6A 4N0BA 1LDDA 2Q8KA 4DQ2A 2A3SA 1F9NA 1P92A 4HV6A 1BOAA 1P6RA 2O03A 4KA4A 4A0ZA 2OD5A 1IXSB 1HW5A 3ZMVA 1OPCA 3ZN1A 4GGGA 2HWVA 4NB5A 4BHCA 2K27A 3ZN0A 5L3DA 3WG9A 1FYLA 1U5TC 2HGCA 2QVOA 2L01A 3LSTA 3ZMDA 3J80Z 2X0LA 2KRFA 3HSEA 5AIPA 2BE5F 2FBKA 2K02A 1B9NA 2DK8A 3V7RA 1AOYA 3KEOA 4R1HA 3VFZA 1WI9A 1QQIA 2YSRA 2FNAA 3FXQA 2VT2A 3KFWX 3LA7A 5HOOA 4OMZA 1SFEA 3FMSA 2KIFA 3F6OA 1QGPA 2Q2EA 4OOIA 3GEZA 4HQMA 4UVAA 3BPXA 2RN7A 2FRHA 4G94A 5ILUA 2D45A 1BIBA 4EJUA 3N97A 1CF7B 1IXCA 2QZ8A 4ZZDA 2FBHA 3DPLC 3ECOA 2PLYA 1ZRDA 4I09A 2PMUA 2IA2A 2PJPA 2H6CA 5E1ZB 3RJPA 3PFIA 1XCBA 4S05A 2M1BA 1BIAA 1TW2A 5ERIA 4YFNF 3TDZC 2P5KA 3GO5A 5FGMA 2O61A 1MKMA 5J8FA 2YX7A 5L3GA 2NS0A 1FWZA 3K2ZA 1S8NA 2EV5A 2BEOA 2HYGD 1W7PB 4HLYA 2OU2A 1OMIA 1F4KA 2CQKA 4Y17A 1UB9A 2W84A 3WE3A 4HBLA 1BC8C 2EFPA 5TRDA 1PP7U 2KIMA 4K2EA 4NHJA 2A68F 5HS7A 4P5OA 1Z6RA 4OINF 1KU2A 3BY6A 4OMYA 1IN5A 4RS8A 4MQVA 2ZXJA 3EETA 1SMTA 3ULQB 4G8XA 1UHWA 1FBUA 1IRFA 4IHSA 3ABTA 1DPUA 2H94A 1XB4A 4JQFA 1TW3A 4OIQF 4PDKA 1ON2A 3TGNA 1SD7A 1ZHFA 2LDUA 4M6YA 1J7KA 1T2KA 1QZYA 4G6QA 3WTSC 3HIFA 3ISPA 3RPUA 1V4RA 4OIOF 1KU7A 2OZUA 3RIRA 1O3TA 5E8GA 5D5WB 1QZZA 3KP3A 2YX4A 1FYMA 3GF2A 2L4MA 2JT1A 4FX4A 1YIOA 2WWYA 4JK1X 4HV5A 4HX8A 4MGRA 3R61A 4Y15A 2BGCA 4RGSA 4AIKA 1RI7A 3HRMA 2FXAA 1S7OA 5L3BA 1BN5A 3Q9VA 4HZFA 1G3SA 4L5JA 5E1WA 2CW0F 1R22A 5JFRA 2LNBA 2FBIA 2RQPA 4KMUX 1ONVA 2G7UA 4ZYDA 1FP2A 2P4WA 4H0EA 2XVCA 4L9JA 1XDSA 4Q5SF 2UWMA 2NYXA 1ZH5A 2L4AA 1BI1A 1OKRA 3ELKA 1CGPA 1H9TA 1U6GA 1R58A 3E3VA 2Q0OA 1OYIA 1J59A 2D1HA 2ZKZA 4P9UA 5D5VB 2XROA 2GA1A 4ENKA 2E7XA 2Z33A 1YLFA 3R0AA 4PCQA 1J9IA 1FT9A 3DKWA 2M8EA 3ABUA 1KGSA 1HKTA 2MD5A 3QPHA 1IF1A 2ETHA 2HEOA 4RGUA 3I5UA 3GVAA 1EH6A 3R0JA 2ACJA 1JE8A 1MJBA 3M1EA 2A6EF 4P9FA 2QQBA 2IJLA 4XLPF 2XUBA 1ZLJA 2O8XA 5FD5A 1LEBA 3OV8A 3KZZA 3FWEA 2DFIA 3CDHA 3VEPA 1LJ9A 5EEGA 4HF1A 4BHBA 4IVNA 1B59A 1K6OA 4IRGA 5FFXA 3Q5FA 2EJRA 4M9SA 3ECHA 4EGZA 3DV8A 3LA3A 1A04A 3HRTA 2XV4S 4R79A 1D8JA 3CUQC 1HQCA 2E1NA 3LAPA 1U78A 4A0XA 4ESFA 1YFHA 1LNWA 1WSUA 1XCVA 1QBJA 3JTGA 4HA8A 2RDPA 1KQ0A 2FSWA 1FSHA 3FM3A 1NHAA 4WF2A 1FZPB 3QP6A 3JTHA 4EM2A 4M6XA 3G73A 2FA5A 5LRRA 3IWFA 4XRFA 5E17F 1LDKB 1H9GA 1J0RA 3IWZA 3SZTA 4YG2F 1RZ4A 4EMSA 1U3EM 2Z99A 4PZJA 4G6DA 2P7VB 4L9NA 3GZ5A 5J8CA 2J5PA 3WODF 3L2CA 2HKXA 5DCFA 1T38A 1ZAOA 1G4DA 2VT3A 2EV6A 2QQAA 2GZWA 3BOQA 4M71A 1I1SA 5HVQC 1W7PA 1XMKA 3K1PA 3CLOA 2E1CA 2DK5A 1XSDA 4WXHA 3I4PA 5DD8A 2EA2A 1O3RA 1XGSA 2VBWA 4HOBA 5E18F 3T8TA 1R5GA 4EV0A 2DQLA 3HHGA 1R1VA 4HX7A 2KJBA 2VN2A 3MZYA 4HDUA 1TQIA 4CZZA 5LHGA 4KUMA 3KP7A 1EH8A 1TBXA 4P96A 2MH9A 4D0PA 4ENMA 2GAUA 5A2QK 4Z2YA 5LBQA 4LFUA 2EFWA 4UV8A 3F6VA 2HZTA 4FHTA 3R60A 5LRSA 1R7JA 2A69F 5L3EA 2EWNA 2O6GE 3TO9A 1H0MA 2RKHA 1GXPA 5LGTA 2YPRA 2NAZA 3GLXA 2DBBA 4U7DA 1ZN2A 2VONA 2D2WA 4ZYEA 2XKPA 5HDKA 3P9KA 4LK1F 1YTYA 1HSJA 4WXCA 4Q47A 4QLCU 2OQRA 1C0WA 4ENNA 5E1XA 4ENJA 3VODA 1ZG5A 4CDGA 3E6CC 4RB3C 3C7JA 4O5VA 2W85A 2VBXA 1ZREA 4M9XA 3BZ6A 3F72A 4RGRA 4EGYA 1WQ2A 2R7FA 2HTJA 1DUXC 2V1XA 2P5LC 4Q4ZF 3KCCA 2NNYA 2CSOA 1ZGJA 4GO1A 3E5QA 4OIRF 5EEHA 2Y0MA 4I7HA 3C1DA 3HYIA 2X4HA 3DF8A 4WCGA 3PQKA 3NEUA 2ZNZA 1YW7A 5ICGA 3HHHA 5AIQA 1HKSA 3LAJA 3E6BA 2RGVA 3JSOA 2UZKA 3GFJA 4KNYA 3JAMK 3M8FA 5FO5A 4CGZA 2HQNA 1JHFA 4LMYA 4QWQA 2RVCA 1AWCA 4ETSA 1EH7A 4M73A 3V4GA 3U1DA 4AIHA 2VOOA 3E5UA 3E5XA 2V9VA 4EM0B 5DUIA 5A2QZ 4FT8A 1V3FA 3CTAA 2M30A 1J75A 1W7PD 4P55A 3EUHA 2Z3YA 1FY7A 4HYEA 4AD9A 2G9WA 2W25A 3I59A 3O2PE 1QNTA 3JSPA 1BJAA 2QYOA 1W4MA 3T5XA 4S04A 4LJZF 5HLGA 4KN4X 4ESBA 2WC2A 4I02A 5DD4A 2VOPA 1G6NA 4L9TA 4UV9A 4LK0F 3E6DA 2MBFA 2B0LA 3FX3A 1XGMA 2KKOA 2E7WA 1IN7A 4Y13A 3U2RA 5K5OA 3IL2A 3MZHA 3K1MA 3BJ6A 2M5WA 4KICA 3ZPLA 1IW7F 2NNNA 1MZBA 1I5ZA 3ML6A 5FFZA 5IT3A 3ZQ7A 1TQMA 3QU3A 3D5LA 1U8RA 2PEXA 1FNNA 4LLNA 1K79A 3J81K 1XD7A 2XAGA 2CYYA 4KT5C 4IF4A 4HX4A 1XSVA 3IRRA 1XGOA 3I71A 1U5TA 4G9YA 5ILVA 2XKOA 5BOXA 3F23A 1HSTA 2XAJA 2OQGA 6PAXA 2VE8A 1UCRA 1O3SA 3RKYA 2GIVA 3FZVA 2ZMEA 2K7LA 2DPUA 2DAOA 4DNCA 1D8KA 1L3LA 1DDNA 3COAC 1U2WA 3RPQA 1TTYA 3I64A 3B02A 3L00A 2M45A 1S7AA 2VC1A 3HRSA 1G3TA 3GWZA 2UXNA 2RNJA 2LKPA 2PFBA 4LD5A 2ZBKA 2DI3A 4CHUA 1R1TA 2BBYA 5K1YA 3IRQA 4B8XA 2A61A 3WTUC 1R5HA 1JHHA 1SD5A 4A6DA 2HFHA 4WX9A 5IT9K 3K69A 3EYYA 4M9ZA 1HW2A 5FB2A 5BPIA 5JHUA 3TDUC 2PI0A 1SFXA 3GX4X 2L54A 3VOEA 5J6XA 5D5UB 4BHPA 2IA0A 2DLLA 1SD6A 5BQTA 1X3UA 2VBZA 1K78A 1D5VA 2ESHA 2GQQA 2ZCWA 2PBIA 2HQRA 1EV7A 3LWFA 2MC3A 2AS5F 2XAFA 5JVTA 2VE9A 2QUFA 1ODDA 1VTNC 1DPRA 5BMZA 2NRAC 2GWRA 2VXZA 3MEXA 1PP8F 2XASA 4MNUA 1ZRCA 1SAXA 3WGHA 2Z5UA 1TNTA 1W5TA 2F5CA 3WTYC 3N4MA 3SFZA 1YO5C 5LHIA 2QBYA 2FQ3A 5KVRA 4OU0A 2P7CB 1YYVA 4ESJA 2XGXA 5H20A 1JGSA 3EDPA 4NQWA 3WU0A 3I59B 2PN6A 3AAFA 2V1DA 4A6EA 2COMA 3IKVA 1FBQA 4RB0A 3I53A 5E20A 3V8JA 4CO8A 3U9GA 2V1UA 3EYIA 3FHZA 4ZH4F 1B1BA 2ZO4A 2O3FA 3G3ZA 2DTRA 3H92A 1IXRC 3KP4A 2JTVA 5HS8A 5FLXK 4L18B 4A5NA 5DUKA 3HSFA 2QLZA 3V8KA 1FPQA 4BNCA 3MCZA 4EJTA 4GXOA 1BBYA 3W6KB 2K4BA 1FYKA 2EFOA 5CVJA 2HYFA 4AVPA 3FF5A 3K1NA 5E8IA 1XN7A 1FSEA 1KU9A 3LA2A 4ZZLA 2EA4A 2IA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0S A;  1Z9C A;  4XLN F;  4EJW A;  3C18 A;  5D4S A;  3DPT A;  1Z91 A;  1RNL A;  3KLO A;  1BI3 A;  4IPA A;  1XGN A;  1HW1 A;  1U5T B;  2V6C A;  3GFI A;  2LF7 A;  5DV5 A;  5BPD A;  2H27 A;  3W6J B;  2QEN A;  2OBP A;  3SXY A;  1RUN A;  1K7A A;  5LEJ A;  5L3F A;  2ZME B;  2K86 A;  1MJ9 A;  1E2X A;  2YU3 A;  1KU3 A;  3BDD A;  3K0L A;  2F5E A;  3DFG A;  3T1B A;  3WTT C;  1YW8 A;  2DT5 A;  2PQ8 A;  4YFK F;  3F8M A;  4E70 A;  4R8H A;  5KK1 A;  1O7L A;  2XIG A;  2BV6 A;  4MTE A;  2W57 A;  3C3W A;  2K4J A;  4WWC A;  3J80 K;  1BI2 A;  2GXB A;  5HDN A;  1B4A A;  4OIP F;  2D1V A;  5D8K B;  3R4K A;  5H6R A;  3WU1 B;  2RV8 A;  2OZ6 A;  3RI4 A;  3CUQ A;  1B9M A;  3BJA A;  1ZYR F;  2IVM A;  1IN8 A;  2Y75 A;  5ED4 A;  1XDU A;  1YS6 A;  2AXL A;  4YII A;  4RB2 C;  2MLG A;  4A5M A;  3HRU A;  2IT0 A;  2L02 A;  5F1R A;  1O3Q A;  3ROU A;  4KN7 X;  1DP7 P;  4HQE A;  5LGU A;  1K78 B;  5H6Q A;  1TQP A;  5HDG A;  1HBX G;  2PG4 A;  3QRF F;  3QPT A;  2HTS A;  5F64 A;  2H09 A;  1SD4 A;  3P9I A;  4A12 A;  1KQ8 A;  2EB7 A;  3QU6 A;  2MA3 A;  4YFX F;  3O6B B;  1W5S A;  5HLI A;  3GW2 A;  1OYW A;  2OA4 A;  2ISZ A;  2JSC A;  3WTZ A;  1I6X A;  2LF8 A;  3WE2 A;  3F21 A;  2QBY B;  2QQ9 A;  3PQJ A;  1T98 A;  3HSR A;  2CG4 A;  4Q48 A;  5K5Q A;  1ZG3 A;  4TV7 A;  4RAY A;  1UHM A;  3B73 A;  4EJO A;  4L5I A;  3ZMU A;  1MGT A;  4LG0 A;  1G3Y A;  4GYI A;  3L09 A;  4KIF A;  1P2F A;  3HOS A;  4MHG A;  5BS6 A;  3RYR A;  1R23 A;  3FXR A;  1LDJ A;  2P6T A;  2FMY A;  3J7A O;  4A0Y A;  1I27 A;  1SMY F;  4IXA A;  3TQN A;  1IUY A;  3WTV C;  4ZYH A;  1REP C;  3I58 A;  2GXG A;  5ICC A;  5CVV A;  1Z6T A;  4UVC A;  2WV0 A;  3F8C A;  2CFX A;  4CYD A;  1GVJ A;  2MLK A;  4UHT A;  1Z7U A;  1Z1D A;  4HF0 A;  1KA8 A;  3ZMT A;  3BWG A;  4G7H F;  5L3C A;  1MD0 A;  1IN4 A;  1QO0 D;  2QM3 A;  3CJN A;  3LQR A;  2ESN A;  1IZ1 A;  1ZG1 A;  2RC4 A;  4HW0 A;  5K5R A;  5FD6 A;  2DW4 A;  4WK8 F;  1Z05 A;  4I0B A;  2FEZ A;  3LFK A;  3M9A A;  5D4R A;  2FML A;  4YIF A;  1XSX A;  3HUG A;  4N9H A;  2OAZ A;  2FNP A;  4U88 A;  2JZY A;  2R3S A;  5D8L B;  2PMH A;  3MQ0 A;  3DQV C;  4L0Z B;  2F5F A;  1KYZ A;  4MEY F;  1OR7 A;  1R00 A;  4HDV A;  4XSX F;  2WTE A;  4ON0 A;  2CGP A;  4RAZ A;  4BXU A;  1LB2 A;  4IHT A;  5DEQ A;  4EQQ A;  3S2W A;  3OOP A;  2HOE A;  2JPC A;  4O6J A;  4BH9 A;  3KLN A;  1BC7 C;  1R36 A;  4CIC A;  3KE2 A;  4G7Z F;  4PGH A;  3GXO A;  2V79 A;  4IRH A;  2BYV E;  3JAM Z;  4IRI A;  1GXQ A;  2IP2 A;  3KP5 A;  4EM1 A;  3TO7 A;  5AON A;  3KP2 A;  4HAM A;  4AWX B;  2GA2 A;  3CUQ B;  2EV0 A;  3GFM A;  1FBS A;  4M72 A;  2DPD A;  2A5Y B;  1HKQ A;  4JBA A;  4HF2 A;  4BAY A;  2G7H A;  4N9I A;  3RYP A;  2ZFW A;  1Q1H A;  3F8B A;  4RGX A;  3KP6 A;  2HDC A;  2J5O A;  3GUD A;  2EK5 A;  5HLH A;  3SZP A;  1IAW A;  4I2O A;  5TJJ A;  3M7G A;  1BI0 A;  3IC7 A;  2FF4 A;  3TOB A;  3F22 A;  1MDM B;  1WWX A;  5JI6 A;  1YW9 A;  4HLX A;  2QWW A;  3I0T A;  1T0F A;  5ICF A;  3SHF A;  1ZAR A;  4IJA A;  4KFC A;  3H3U A;  1S3J A;  3L7W A;  3V7C A;  3E6M A;  3CO7 C;  4L0Y B;  3BPV A;  2XHK A;  5DCM A;  2STW A;  2F2E A;  2DU9 A;  3J81 Z;  3DXJ F;  4G7O F;  2HR3 A;  5JR3 A;  1LVA A;  3GZ6 A;  3WTW C;  3HOT A;  4WXD A;  2CWE A;  4RB1 A;  3T0Y A;  1LQ1 A;  2VC0 A;  1J5Y A;  2JRT A;  4KMF A;  1KYW A;  4LG0 B;  1IN6 A;  4LGW A;  3NRV A;  4O3M A;  4UUV A;  3WTX C;  3IKT A;  5CVU A;  1IRG A;  3RDI A;  1YQA A;  2UXX A;  4XSZ F;  3SQN A;  1FX7 A;  1G3W A;  3FMQ A;  1ON1 A;  1YS7 A;  4B09 A;  3GFL A;  3K9T A;  3FM5 A;  2P8T A;  1JXS A;  1O57 A;  3FMR A;  3CUO A;  2MH2 A;  1SFU A;  1PUE E;  1P4W A;  1ULY A;  4A2U A;  4BQA A;  2DO7 A;  2EFN A;  1L0O C;  5LHH A;  3MFK A;  3F3X A;  3M8E A;  2C6Y A;  2W24 A;  3E97 A;  5CVR A;  2A07 F;  1KQ9 A;  1R1U A;  3ZP5 A;  1ZRF A;  3TKY A;  1GHC A;  3IHU A;  4U0V A;  4EVI A;  1F1Z A;  4MQ9 F;  2P6S A;  2YR2 A;  4UNO A;  2CO5 A;  4GYG A;  5LEK A;  1P4A A;  3WGG A;  4F7Z A;  4I98 B;  3V8L A;  1J2X A;  3BRO A;  1WRJ A;  5IT9 Z;  5CYV A;  4UXN A;  4U0W A;  1I1G A;  3BJO A;  3DP7 A;  2EFQ A;  2ELH A;  4M74 A;  3QAH A;  2FE3 A;  4GCV A;  1S29 A;  3F8F A;  1FOK A;  1RUO A;  5DDG A;  3REO A;  4EJV A;  1UFM A;  1WKM A;  3O3K A;  4XBF A;  1CF7 A;  3QOP A;  3TOA A;  2VOD A;  5ICE A;  2XRN A;  2ADU A;  2Y48 A;  2A6H F;  1YG2 A;  1ZGA A;  1UST A;  3GYH X;  3HTU A;  5CJ9 A;  1MJA A;  2JPB A;  1FC3 A;  5ILS A;  2XAQ A;  3FXU A;  2TDX A;  2KJC A;  4LLL A;  3KEQ A;  1B6A A;  3QP5 A;  3Q9S A;  1RIO H;  4KYW A;  2HS5 A;  3ZMS A;  3V7S A;  1D3Y A;  5DYM A;  4ASN A;  2IW5 A;  2P5V A;  2R7D A;  2VBY A;  1P4X A;  4KIB A;  5HS9 A;  1T6S A;  5D6F A;  3BP8 A;  4UVB A;  2ISY A;  1TLH B;  3CO6 C;  3ZMZ A;  1PDN C;  1QPM A;  3MAJ A;  4FX0 A;  5LGN A;  2KIU A;  3ERE D;  1BM9 A;  3T8R A;  2FOK A;  3EQL F;  1Y0U A;  4PGG A;  4BYY A;  5D6E A;  5CLS A;  3KET A;  3P9C A;  1F5T A;  2Z9O A;  5LLQ A;  4I01 A;  4CXF A;  4U0Y A;  1TNS A;  3MWM A;  1LEA A;  4U7B A;  2ZJ2 A;  3P7N A;  3LQQ A;  1FLI A;  4MEX F;  4KDP A;  5FLX Z;  4LB5 A;  2ZNY A;  3F8N A;  1S6L A;  1T39 A;  2M87 A;  4LB6 B;  4LLG F;  3H3Z A;  1E17 A;  4AIJ A;  2FU4 A;  2DQR A;  3RKW A;  2STT A;  2H6B A;  1O7F A;  1OYY A;  4L9V A;  5DCM B;  1XMA A;  3WGI A;  3RKX A;  3NQO A;  2HKO A;  3JW4 A;  5CVI A;  2F5D A;  3L9F A;  2L3D A;  2XAH A;  3DEU A;  4MTD A;  4KIG A;  2O0Y A;  4ZYG A;  4I0A A;  3VB2 A;  1HXD A;  1MDM A;  2IRF G;  3KZY A;  1USS A;  5D5X B;  3R6S A;  2IPQ X;  3RTR A;  1STZ A;  5F6F A;  2LSO A;  1ZLK A;  3I54 A;  3HTS B;  1FP1 D;  3TO6 A;  4N0B A;  1LDD A;  2Q8K A;  4DQ2 A;  2A3S A;  1F9N A;  1P92 A;  4HV6 A;  1BOA A;  1P6R A;  2O03 A;  4KA4 A;  4A0Z A;  2OD5 A;  1IXS B;  1HW5 A;  3ZMV A;  1OPC A;  3ZN1 A;  4GGG A;  2HWV A;  4NB5 A;  4BHC A;  2K27 A;  3ZN0 A;  5L3D A;  3WG9 A;  1FYL A;  1U5T C;  2HGC A;  2QVO A;  2L01 A;  3LST A;  3ZMD A;  3J80 Z;  2X0L A;  2KRF A;  3HSE A;  5AIP A;  2BE5 F;  2FBK A;  2K02 A;  1B9N A;  2DK8 A;  3V7R A;  1AOY A;  3KEO A;  4R1H A;  3VFZ A;  1WI9 A;  1QQI A;  2YSR A;  2FNA A;  3FXQ A;  2VT2 A;  3KFW X;  3LA7 A;  5HOO A;  4OMZ A;  1SFE A;  3FMS A;  2KIF A;  3F6O A;  1QGP A;  2Q2E A;  4OOI A;  3GEZ A;  4HQM A;  4UVA A;  3BPX A;  2RN7 A;  2FRH A;  4G94 A;  5ILU A;  2D45 A;  1BIB A;  4EJU A;  3N97 A;  1CF7 B;  1IXC A;  2QZ8 A;  4ZZD A;  2FBH A;  3DPL C;  3ECO A;  2PLY A;  1ZRD A;  4I09 A;  2PMU A;  2IA2 A;  2PJP A;  2H6C A;  5E1Z B;  3RJP A;  3PFI A;  1XCB A;  4S05 A;  2M1B A;  1BIA A;  1TW2 A;  5ERI A;  4YFN F;  3TDZ C;  2P5K A;  3GO5 A;  5FGM A;  2O61 A;  1MKM A;  5J8F A;  2YX7 A;  5L3G A;  2NS0 A;  1FWZ A;  3K2Z A;  1S8N A;  2EV5 A;  2BEO A;  2HYG D;  1W7P B;  4HLY A;  2OU2 A;  1OMI A;  1F4K A;  2CQK A;  4Y17 A;  1UB9 A;  2W84 A;  3WE3 A;  4HBL A;  1BC8 C;  2EFP A;  5TRD A;  1PP7 U;  2KIM A;  4K2E A;  4NHJ A;  2A68 F;  5HS7 A;  4P5O A;  1Z6R A;  4OIN F;  1KU2 A;  3BY6 A;  4OMY A;  1IN5 A;  4RS8 A;  4MQV A;  2ZXJ A;  3EET A;  1SMT A;  3ULQ B;  4G8X A;  1UHW A;  1FBU A;  1IRF A;  4IHS A;  3ABT A;  1DPU A;  2H94 A;  1XB4 A;  4JQF A;  1TW3 A;  4OIQ F;  4PDK A;  1ON2 A;  3TGN A;  1SD7 A;  1ZHF A;  2LDU A;  4M6Y A;  1J7K A;  1T2K A;  1QZY A;  4G6Q A;  3WTS C;  3HIF A;  3ISP A;  3RPU A;  1V4R A;  4OIO F;  1KU7 A;  2OZU A;  3RIR A;  1O3T A;  5E8G A;  5D5W B;  1QZZ A;  3KP3 A;  2YX4 A;  1FYM A;  3GF2 A;  2L4M A;  2JT1 A;  4FX4 A;  1YIO A;  2WWY A;  4JK1 X;  4HV5 A;  4HX8 A;  4MGR A;  3R61 A;  4Y15 A;  2BGC A;  4RGS A;  4AIK A;  1RI7 A;  3HRM A;  2FXA A;  1S7O A;  5L3B A;  1BN5 A;  3Q9V A;  4HZF A;  1G3S A;  4L5J A;  5E1W A;  2CW0 F;  1R22 A;  5JFR A;  2LNB A;  2FBI A;  2RQP A;  4KMU X;  1ONV A;  2G7U A;  4ZYD A;  1FP2 A;  2P4W A;  4H0E A;  2XVC A;  4L9J A;  1XDS A;  4Q5S F;  2UWM A;  2NYX A;  1ZH5 A;  2L4A A;  1BI1 A;  1OKR A;  3ELK A;  1CGP A;  1H9T A;  1U6G A;  1R58 A;  3E3V A;  2Q0O A;  1OYI A;  1J59 A;  2D1H A;  2ZKZ A;  4P9U A;  5D5V B;  2XRO A;  2GA1 A;  4ENK A;  2E7X A;  2Z33 A;  1YLF A;  3R0A A;  4PCQ A;  1J9I A;  1FT9 A;  3DKW A;  2M8E A;  3ABU A;  1KGS A;  1HKT A;  2MD5 A;  3QPH A;  1IF1 A;  2ETH A;  2HEO A;  4RGU A;  3I5U A;  3GVA A;  1EH6 A;  3R0J A;  2ACJ A;  1JE8 A;  1MJB A;  3M1E A;  2A6E F;  4P9F A;  2QQB A;  2IJL A;  4XLP F;  2XUB A;  1ZLJ A;  2O8X A;  5FD5 A;  1LEB A;  3OV8 A;  3KZZ A;  3FWE A;  2DFI A;  3CDH A;  3VEP A;  1LJ9 A;  5EEG A;  4HF1 A;  4BHB A;  4IVN A;  1B59 A;  1K6O A;  4IRG A;  5FFX A;  3Q5F A;  2EJR A;  4M9S A;  3ECH A;  4EGZ A;  3DV8 A;  3LA3 A;  1A04 A;  3HRT A;  2XV4 S;  4R79 A;  1D8J A;  3CUQ C;  1HQC A;  2E1N A;  3LAP A;  1U78 A;  4A0X A;  4ESF A;  1YFH A;  1LNW A;  1WSU A;  1XCV A;  1QBJ A;  3JTG A;  4HA8 A;  2RDP A;  1KQ0 A;  2FSW A;  1FSH A;  3FM3 A;  1NHA A;  4WF2 A;  1FZP B;  3QP6 A;  3JTH A;  4EM2 A;  4M6X A;  3G73 A;  2FA5 A;  5LRR A;  3IWF A;  4XRF A;  5E17 F;  1LDK B;  1H9G A;  1J0R A;  3IWZ A;  3SZT A;  4YG2 F;  1RZ4 A;  4EMS A;  1U3E M;  2Z99 A;  4PZJ A;  4G6D A;  2P7V B;  4L9N A;  3GZ5 A;  5J8C A;  2J5P A;  3WOD F;  3L2C A;  2HKX A;  5DCF A;  1T38 A;  1ZAO A;  1G4D A;  2VT3 A;  2EV6 A;  2QQA A;  2GZW A;  3BOQ A;  4M71 A;  1I1S A;  5HVQ C;  1W7P A;  1XMK A;  3K1P A;  3CLO A;  2E1C A;  2DK5 A;  1XSD A;  4WXH A;  3I4P A;  5DD8 A;  2EA2 A;  1O3R A;  1XGS A;  2VBW A;  4HOB A;  5E18 F;  3T8T A;  1R5G A;  4EV0 A;  2DQL A;  3HHG A;  1R1V A;  4HX7 A;  2KJB A;  2VN2 A;  3MZY A;  4HDU A;  1TQI A;  4CZZ A;  5LHG A;  4KUM A;  3KP7 A;  1EH8 A;  1TBX A;  4P96 A;  2MH9 A;  4D0P A;  4ENM A;  2GAU A;  5A2Q K;  4Z2Y A;  5LBQ A;  4LFU A;  2EFW A;  4UV8 A;  3F6V A;  2HZT A;  4FHT A;  3R60 A;  5LRS A;  1R7J A;  2A69 F;  5L3E A;  2EWN A;  2O6G E;  3TO9 A;  1H0M A;  2RKH A;  1GXP A;  5LGT A;  2YPR A;  2NAZ A;  3GLX A;  2DBB A;  4U7D A;  1ZN2 A;  2VON A;  2D2W A;  4ZYE A;  2XKP A;  5HDK A;  3P9K A;  4LK1 F;  1YTY A;  1HSJ A;  4WXC A;  4Q47 A;  4QLC U;  2OQR A;  1C0W A;  4ENN A;  5E1X A;  4ENJ A;  3VOD A;  1ZG5 A;  4CDG A;  3E6C C;  4RB3 C;  3C7J A;  4O5V A;  2W85 A;  2VBX A;  1ZRE A;  4M9X A;  3BZ6 A;  3F72 A;  4RGR A;  4EGY A;  1WQ2 A;  2R7F A;  2HTJ A;  1DUX C;  2V1X A;  2P5L C;  4Q4Z F;  3KCC A;  2NNY A;  2CSO A;  1ZGJ A;  4GO1 A;  3E5Q A;  4OIR F;  5EEH A;  2Y0M A;  4I7H A;  3C1D A;  3HYI A;  2X4H A;  3DF8 A;  4WCG A;  3PQK A;  3NEU A;  2ZNZ A;  1YW7 A;  5ICG A;  3HHH A;  5AIQ A;  1HKS A;  3LAJ A;  3E6B A;  2RGV A;  3JSO A;  2UZK A;  3GFJ A;  4KNY A;  3JAM K;  3M8F A;  5FO5 A;  4CGZ A;  2HQN A;  1JHF A;  4LMY A;  4QWQ A;  2RVC A;  1AWC A;  4ETS A;  1EH7 A;  4M73 A;  3V4G A;  3U1D A;  4AIH A;  2VOO A;  3E5U A;  3E5X A;  2V9V A;  4EM0 B;  5DUI A;  5A2Q Z;  4FT8 A;  1V3F A;  3CTA A;  2M30 A;  1J75 A;  1W7P D;  4P55 A;  3EUH A;  2Z3Y A;  1FY7 A;  4HYE A;  4AD9 A;  2G9W A;  2W25 A;  3I59 A;  3O2P E;  1QNT A;  3JSP A;  1BJA A;  2QYO A;  1W4M A;  3T5X A;  4S04 A;  4LJZ F;  5HLG A;  4KN4 X;  4ESB A;  2WC2 A;  4I02 A;  5DD4 A;  2VOP A;  1G6N A;  4L9T A;  4UV9 A;  4LK0 F;  3E6D A;  2MBF A;  2B0L A;  3FX3 A;  1XGM A;  2KKO A;  2E7W A;  1IN7 A;  4Y13 A;  3U2R A;  5K5O A;  3IL2 A;  3MZH A;  3K1M A;  3BJ6 A;  2M5W A;  4KIC A;  3ZPL A;  1IW7 F;  2NNN A;  1MZB A;  1I5Z A;  3ML6 A;  5FFZ A;  5IT3 A;  3ZQ7 A;  1TQM A;  3QU3 A;  3D5L A;  1U8R A;  2PEX A;  1FNN A;  4LLN A;  1K79 A;  3J81 K;  1XD7 A;  2XAG A;  2CYY A;  4KT5 C;  4IF4 A;  4HX4 A;  1XSV A;  3IRR A;  1XGO A;  3I71 A;  1U5T A;  4G9Y A;  5ILV A;  2XKO A;  5BOX A;  3F23 A;  1HST A;  2XAJ A;  2OQG A;  6PAX A;  2VE8 A;  1UCR A;  1O3S A;  3RKY A;  2GIV A;  3FZV A;  2ZME A;  2K7L A;  2DPU A;  2DAO A;  4DNC A;  1D8K A;  1L3L A;  1DDN A;  3COA C;  1U2W A;  3RPQ A;  1TTY A;  3I64 A;  3B02 A;  3L00 A;  2M45 A;  1S7A A;  2VC1 A;  3HRS A;  1G3T A;  3GWZ A;  2UXN A;  2RNJ A;  2LKP A;  2PFB A;  4LD5 A;  2ZBK A;  2DI3 A;  4CHU A;  1R1T A;  2BBY A;  5K1Y A;  3IRQ A;  4B8X A;  2A61 A;  3WTU C;  1R5H A;  1JHH A;  1SD5 A;  4A6D A;  2HFH A;  4WX9 A;  5IT9 K;  3K69 A;  3EYY A;  4M9Z A;  1HW2 A;  5FB2 A;  5BPI A;  5JHU A;  3TDU C;  2PI0 A;  1SFX A;  3GX4 X;  2L54 A;  3VOE A;  5J6X A;  5D5U B;  4BHP A;  2IA0 A;  2DLL A;  1SD6 A;  5BQT A;  1X3U A;  2VBZ A;  1K78 A;  1D5V A;  2ESH A;  2GQQ A;  2ZCW A;  2PBI A;  2HQR A;  1EV7 A;  3LWF A;  2MC3 A;  2AS5 F;  2XAF A;  5JVT A;  2VE9 A;  2QUF A;  1ODD A;  1VTN C;  1DPR A;  5BMZ A;  2NRA C;  2GWR A;  2VXZ A;  3MEX A;  1PP8 F;  2XAS A;  4MNU A;  1ZRC A;  1SAX A;  3WGH A;  2Z5U A;  1TNT A;  1W5T A;  2F5C A;  3WTY C;  3N4M A;  3SFZ A;  1YO5 C;  5LHI A;  2QBY A;  2FQ3 A;  5KVR A;  4OU0 A;  2P7C B;  1YYV A;  4ESJ A;  2XGX A;  5H20 A;  1JGS A;  3EDP A;  4NQW A;  3WU0 A;  3I59 B;  2PN6 A;  3AAF A;  2V1D A;  4A6E A;  2COM A;  3IKV A;  1FBQ A;  4RB0 A;  3I53 A;  5E20 A;  3V8J A;  4CO8 A;  3U9G A;  2V1U A;  3EYI A;  3FHZ A;  4ZH4 F;  1B1B A;  2ZO4 A;  2O3F A;  3G3Z A;  2DTR A;  3H92 A;  1IXR C;  3KP4 A;  2JTV A;  5HS8 A;  5FLX K;  4L18 B;  4A5N A;  5DUK A;  3HSF A;  2QLZ A;  3V8K A;  1FPQ A;  4BNC A;  3MCZ A;  4EJT A;  4GXO A;  1BBY A;  3W6K B;  2K4B A;  1FYK A;  2EFO A;  5CVJ A;  2HYF A;  4AVP A;  3FF5 A;  3K1N A;  5E8I A;  1XN7 A;  1FSE A;  1KU9 A;  3LA2 A;  4ZZL A;  2EA4 A;  2IA1 A; 
#chains in the Genus database with same CATH topology
 1XPX A;  3D0S A;  5F0F A;  1Z9C A;  4XLN F;  4YEJ A;  4EJW A;  3C18 A;  3CZ6 A;  5D4S A;  3U21 A;  3FIW A;  3DPT A;  3CJR B;  1Z91 A;  4F3Q A;  1RNL A;  3KLO A;  1BI3 A;  4IPA A;  1XGN A;  2PX9 A;  1HW1 A;  1U5T B;  2V6C A;  3GFI A;  3HKZ N;  2LF7 A;  2FUG 2;  1R71 A;  1Z7L A;  1ETY A;  4QIW N;  3GTG J;  5DV5 A;  3RPU D;  3OYD A;  2LH9 A;  1YJW I;  5DS9 A;  5JLW A;  5BPD A;  2H27 A;  2M4G A;  3W6J B;  1IUF A;  2QEN A;  1OCP A;  1LE8 B;  2OBP A;  3SXY A;  3SEQ A;  1YIJ I;  1RUN A;  1F43 A;  1FJL A;  5J1U A;  1K7A A;  1UMQ A;  5LEJ A;  5L3F A;  1ETQ A;  4XKB A;  4CCN A;  2ZME B;  2E5Z A;  4XNF A;  2K86 A;  4AU7 A;  5GTI C;  1MJ9 A;  2HOS A;  2TRT A;  1HOM A;  3S2D J;  1E2X A;  2YU3 A;  5HOD A;  1KU3 A;  3BDD A;  2BY3 A;  1I39 A;  3K0L A;  2R92 J;  2F5E A;  3QQA A;  3HOV J;  3DFG A;  3T1B A;  4XOT A;  3WTT C;  1YW8 A;  2DT5 A;  2PQ8 A;  4YFK F;  2H8R A;  3F8M A;  4E70 A;  4R8H A;  2DA7 A;  5KK1 A;  2VI6 A;  3HC7 A;  3S3N A;  1O7L A;  2XIG A;  1BOB A;  2BV6 A;  4MTE A;  3QYB A;  2R7S A;  2W57 A;  3S1M J;  3OYI A;  1YRN A;  3C3W A;  2KZG A;  2K4J A;  1RES A;  1GLN A;  1X19 A;  3EUA A;  4WWC A;  1AA7 A;  3J80 K;  1OFC X;  3H5N A;  5CPR B;  3VSK A;  3K6G A;  2MFZ A;  3CMM A;  1OCZ H;  2ME6 A;  3ZRG A;  1SVL A;  1BI2 A;  2GXB A;  5HDN A;  3C2H A;  2BZT A;  1B4A A;  4OIP F;  2D1V A;  2VQH A;  4D5C A;  2LC2 A;  5D8K B;  3R4K A;  3OYL A;  2MSY A;  4JOM A;  5H6R A;  3WU1 B;  1BJZ A;  2RV8 A;  2OZ6 A;  3RI4 A;  4XKC A;  4B3X A;  5FKO A;  1Z0X A;  1A6Q A;  3CUQ A;  3NAU A;  1MMA A;  2DA6 A;  3W2A A;  4FTH A;  1B9M A;  2Y30 A;  2QKM B;  5KAF C;  3BJA A;  4FE4 A;  4DGW B;  1E3P A;  1ZYR F;  2IVM A;  1IN8 A;  2QKL B;  3F9K A;  2Y75 A;  2BXY A;  3DEE A;  2NVX J;  3J7Y J;  5ED4 A;  1XDU A;  1YS6 A;  1POG A;  2AXL A;  4YII A;  2ZXI A;  4XQF A;  2O5R A;  2XF5 A;  3K10 A;  1JTY A;  4RB2 C;  2MLG A;  3A02 A;  3K4C A;  3HRU A;  4A5M A;  2IT0 A;  5F0H A;  2V7F A;  2HQA A;  2L02 A;  4B43 A;  5F1R A;  1O3Q A;  3ROU A;  4KN7 X;  3DBR B;  1NK2 P;  1DP7 P;  1N25 A;  2FX0 A;  1K6Y A;  5LGU A;  4HQE A;  1K78 B;  5H6Q A;  4II2 A;  4UUT A;  4PJJ A;  1TQP A;  4ANJ A;  3JRA A;  5HDG A;  3JR9 A;  1HBX G;  5IOZ A;  4AUX A;  3TMO A;  4A3F J;  2PG4 A;  3BTI A;  2MG4 A;  3QRF F;  1TT0 A;  3QPT A;  2HTS A;  5F64 A;  2H09 A;  2QEX I;  1SD4 A;  3P9I A;  1IV8 A;  5J4Y A;  4YEL A;  4A12 A;  1KQ8 A;  2EB7 A;  1IG7 A;  3S3M A;  3QU6 A;  4PJN A;  2MA3 A;  4YFX F;  2DOA A;  3O6B B;  1W5S A;  2PJR A;  4M6V A;  3AG1 H;  5HLI A;  3OYK A;  3QOE A;  3GW2 A;  1OYW A;  2ICW G;  2OA4 A;  5EG0 A;  2ISZ A;  2JSC A;  2K9L A;  4BE1 A;  3WTZ A;  1I6X A;  1X3W B;  4IOC F;  3GTL J;  2F4M B;  2LF8 A;  3WE2 A;  2LKX A;  2L0K A;  2KFD A;  3F21 A;  1TWA J;  2QBY B;  2QQ9 A;  2IGM A;  5KCM A;  3OWT A;  3PQJ A;  1T98 A;  3HSR A;  4DZJ A;  2CG4 A;  4Q48 A;  2QSG X;  1E3H A;  4YRV A;  5K5Q A;  1ZG3 A;  5GAD J;  4TV7 A;  1MMS A;  2BY1 A;  4RAY A;  2ZJQ F;  1UHM A;  3FHN A;  4XLF A;  1KZH A;  3B73 A;  4NQW B;  2NS8 A;  4EJO A;  4L5I A;  2ZJP F;  3ZMU A;  1MGT A;  4LG0 A;  1G3Y A;  1IDY A;  4GYI A;  3CDL A;  2M3A A;  3HXL A;  3L09 A;  4KIF A;  1P2F A;  1WJF A;  3HOS A;  3G1L A;  4MHG A;  4BJT A;  5BS6 A;  3RYR A;  1GV5 A;  1R23 A;  2HVR A;  3FXR A;  1R4N B;  1LDJ A;  2KMU A;  2I10 A;  4QPO A;  2P6T A;  2EZI A;  4CYC A;  2LRD A;  2RAE A;  3BR0 A;  2KRH A;  5M5X J;  4BE2 A;  1VQ4 I;  2FMY A;  1FMW A;  4OWR B;  3J7A O;  4A0Y A;  2JK3 A;  1AU7 A;  1I27 A;  1IDZ A;  4IHX A;  2A5W A;  2JWT A;  1SMY F;  3CLQ A;  4IXA A;  5FRM A;  4F55 A;  3TQN A;  4CZC A;  1IUY A;  3WTV C;  4Y3O A;  3C2B A;  4ZYH A;  1REP C;  3I58 A;  1A31 A;  1VQ5 I;  2GXG A;  3G4S I;  5ICC A;  5CVV A;  1Z6T A;  2L9V A;  2X51 A;  2XC7 A;  4UVC A;  2WV0 A;  1MSE C;  3F8C A;  1SFO J;  1X58 A;  2CFX A;  4CYD A;  4MLO A;  2CRG A;  2R5Y B;  1GVJ A;  2MLK A;  4UHT A;  1Z7U A;  2CFO A;  4FIS A;  4M3E A;  1Z1D A;  4F92 B;  3JRG A;  1Y56 A;  4HF0 A;  3F0C A;  1KA8 A;  3ZMT A;  3BWG A;  2E2J J;  3Q0V A;  3H36 A;  4G7H F;  1LKX A;  4D7M A;  1MD0 A;  1IN4 A;  1I3A A;  5L3C A;  1QO0 D;  5IP7 J;  2QM3 A;  3CJN A;  2ZFU A;  3LQR A;  2O7O A;  2ESN A;  3K70 D;  3LSH A;  1IZ1 A;  1VQO I;  2NOG A;  1G2H A;  2DMU A;  2O8K A;  2HI3 A;  1W0T A;  2R7X A;  2OF7 A;  2DFH A;  1ZG1 A;  2RC4 A;  2R7O A;  4HW0 A;  1ZR2 A;  3GTK J;  5K5R A;  1X1C A;  5FD6 A;  1MBJ A;  4LOC A;  4F93 B;  4LG3 A;  5GPC A;  1TWC J;  2DW4 A;  4WK8 F;  2X1E A;  1RKW A;  1Z05 A;  1MBH A;  2X48 A;  4C2M J;  4D1Q A;  3L2R A;  2EIL H;  4I0B A;  2FEZ A;  3OYJ A;  3LFK A;  3M9A A;  5D4R A;  3BTL A;  2FML A;  2ELJ A;  3A4C A;  3HZJ A;  1XSX A;  3DBL B;  3HUG A;  2RRE A;  4YIF A;  1T0F C;  4N9H A;  2OAZ A;  2FNP A;  4U88 A;  1Z3Y A;  2JZY A;  2R3S A;  4OAZ A;  5DM7 F;  5D8L B;  2PMH A;  3MQ0 A;  2K3F A;  3DQV C;  5GAH J;  4L0Z B;  3A01 A;  5FKL A;  2DMN A;  2VB6 A;  1KYZ A;  2F5F A;  4MEY F;  3OR2 C;  1OR7 A;  1LUJ B;  1R00 A;  4YIR X;  2IAI A;  4HDV A;  4XSX F;  2WTE A;  4ON0 A;  2AHQ A;  2XSD C;  2CGP A;  4RAZ A;  4BXU A;  3BQY A;  1LB2 A;  1D0X A;  2JN6 A;  1JI8 A;  1MBF A;  3AL0 C;  4IHT A;  2F4O B;  4KJZ A;  2AXT C;  5DEQ A;  2WAQ N;  3Q0U A;  1FOW A;  2NXN B;  4HST A;  4EQQ A;  1GVD A;  3S2W A;  3OOP A;  2HOE A;  2R7W A;  2W82 A;  2JPC A;  1RET A;  3PO2 J;  3A0H C;  4O6J A;  3HPG A;  4BH9 A;  3L1P A;  1YRN B;  2OTL I;  3KLN A;  1BC7 C;  1R36 A;  4CIC A;  1TC3 C;  2BVM A;  3KE2 A;  2JSP A;  3DKX A;  3KPH A;  4G7Z F;  4PGH A;  2L9S A;  3GXO A;  1EF4 A;  2Y9Y A;  3ZQG A;  2DFF A;  4Y52 J;  1D1B A;  1K61 A;  2JUC A;  4J00 A;  2V79 A;  4IRH A;  2BYV E;  2E19 A;  3JAM Z;  5IP6 A;  4IRI A;  5IPA A;  1PJR A;  3IAS 2;  2W1O A;  3GTO J;  1GXQ A;  2IP2 A;  3KP5 A;  4EM1 A;  1E0E A;  2XGD A;  4NC7 A;  1MBK A;  5TGT A;  3TO7 A;  1P7I A;  5AON A;  3KP2 A;  4XK4 A;  2W00 A;  3HOU J;  3MKL A;  3KZI C;  4HAM A;  3AG3 H;  4AWX B;  2GA2 A;  3CUQ B;  2O9L A;  2R7U A;  2EV0 A;  4BDZ A;  3GFM A;  4DYR A;  1FBS A;  1HLV A;  4M72 A;  2DPD A;  2LY1 A;  2A5Y B;  1HKQ A;  2E1M C;  4JBA A;  1X1P A;  4E7J A;  4RAF A;  4HF2 A;  4BAY A;  2G7H A;  4HRI A;  4N9I A;  3RYP A;  2ZFW A;  3VYR B;  4BBS J;  1PUF A;  1Q1H A;  1WFX A;  5IYC J;  3IAM 2;  4OAY A;  3A2K A;  1D1A A;  3F8B A;  4ITV A;  4RGX A;  3KP6 A;  4E4H A;  3FXJ A;  2HDC A;  2WY7 Q;  4IOA F;  4RAG A;  2KDZ A;  4KIT B;  4M3B A;  3W2V A;  2J5O A;  3GUD A;  2PMZ N;  4BE0 A;  2EK5 A;  4I99 C;  5HLH A;  3SZP A;  1IAW A;  4I2O A;  2M7B A;  5TJJ A;  3HG9 A;  2DA4 A;  1YE9 A;  1TWF J;  3M7G A;  4BJ5 C;  1VZ0 A;  1JKQ C;  1BI0 A;  4MFD A;  3IC7 A;  4I6Z A;  2FF4 A;  2BY0 A;  3TOB A;  3HB9 A;  3F22 A;  1D5Y A;  1SVM A;  1MDM B;  3ERM A;  1WWX A;  3FXK A;  5JI6 A;  1APL C;  1UJ8 A;  4DZP A;  1YW9 A;  4HLX A;  4RLQ A;  1GV2 A;  4D7N A;  2QWW A;  3I0T A;  3FXM A;  1T0F A;  4A3E J;  3HGG A;  5ICF A;  3SHF A;  1ZAR A;  3I9V 2;  4IJA A;  3RZD J;  4KFC A;  1SAN A;  3IUO A;  3CP8 A;  2PJR B;  5E3M A;  4BEH A;  5EG0 B;  3I56 I;  3H3U A;  2ELK A;  1S3J A;  3L7W A;  3V7C A;  3E6M A;  3CO7 C;  4L0Y B;  3BPV A;  1MMN A;  2JVG A;  2XHK A;  5DCM A;  2STW A;  2F2E A;  3OYE A;  2ZXW H;  2DU9 A;  3J81 Z;  2DOF A;  3RSN A;  3BR6 A;  3DXJ F;  1S7E A;  4X6A J;  4G7O F;  3A03 A;  2HR3 A;  5JR3 A;  1LVA A;  3GZ6 A;  1Y39 A;  3RZO J;  1JJ6 C;  2LK2 A;  3N05 A;  4CSW A;  3WTW C;  3HOT A;  4WXD A;  2NVU B;  1X1D A;  3WU2 C;  2LY2 A;  4NBQ A;  2CWE A;  4RB1 A;  3T0Y A;  1LQ1 A;  2KQR A;  1J5Y A;  2VC0 A;  2JRT A;  2X6X A;  1KYW A;  4KMF A;  4LG0 B;  1IN6 A;  1BR1 A;  4AVZ A;  4LGW A;  3NRV A;  1X2N A;  4RM3 A;  4C2U A;  4O3M A;  4UUV A;  3WTX C;  3IKT A;  2QQ8 A;  4A3J J;  3FBN B;  5CVU A;  3OYM A;  1QRY A;  1WH7 A;  5H2F C;  2E60 A;  3L2U A;  3RDI A;  1IRG A;  4CYC B;  3DKY A;  3CCS I;  2KL4 A;  2K9M A;  1YQA A;  2UXX A;  4XSZ F;  3SQN A;  1FX7 A;  1G3W A;  3FMQ A;  1ON1 A;  1YS7 A;  4B09 A;  3GFL A;  2FQ4 A;  4JP0 A;  3K9T A;  1YJN I;  3FM5 A;  1TWH J;  1ZTR A;  2P8T A;  1JXS A;  1O57 A;  3FMR A;  3CUO A;  2MH2 A;  2IEK A;  1SFU A;  1PUE E;  1P4W A;  1ULY A;  4A2U A;  4BQA A;  2DO7 A;  3K70 C;  3RCO A;  2EFN A;  1R5I D;  3MZ8 A;  1L0O C;  3TP0 A;  3RQI A;  5GPA A;  5LHH A;  3MFK A;  3F3X A;  3IH4 A;  3M8E A;  2C6Y A;  2W24 A;  4BU2 A;  2XRL A;  3E97 A;  5CVR A;  4BS9 A;  2A07 F;  2VQG A;  1KQ9 A;  3CCE I;  1R1U A;  3ZP5 A;  1ZRF A;  3TKY A;  3BCB A;  1GHC A;  3PUB A;  2KIS A;  3IHU A;  4U0V A;  4EVI A;  2KHM A;  1F1Z A;  2M0M A;  4MQ9 F;  1JGG A;  2JQ7 A;  3M07 A;  2P6S A;  2YR2 A;  2X1C A;  4UNO A;  2CO5 A;  2ZC2 A;  3LSP A;  2V6E A;  2BHZ A;  2EQR A;  4GYG A;  5LEK A;  1P4A A;  3ZQF A;  3WGG A;  4XRM A;  4KIS A;  2EIK H;  3PNT A;  4F7Z A;  2NVQ J;  2BHY A;  4Y4R A;  1BW6 A;  1WI3 A;  4XOP A;  1YOV B;  4I98 B;  3V8L A;  3QOD A;  2M0C A;  3HUG B;  2KZV A;  2X6W A;  3KYC B;  1J2X A;  3BRO A;  4FQG A;  1WRJ A;  3QPL A;  5IT9 Z;  3SFI A;  2WAQ A;  3AFH A;  5CYV A;  3ZGK A;  3KIO A;  5E3N A;  4UXN A;  4U0W A;  2LVS A;  1I1G A;  4PFO A;  3BJO A;  1A6I A;  1VF9 A;  4PSX A;  3DP7 A;  2EFQ A;  5F04 A;  2A05 A;  2ELH A;  4M74 A;  3OYG A;  3QAH A;  2FE3 A;  4GCV A;  1S29 A;  2XSJ C;  3F8F A;  4II3 A;  1RC9 A;  3PSI A;  1ETX A;  2YU9 J;  1FOK A;  4MFE A;  1RUO A;  1DQU A;  5DDG A;  3REO A;  4EJV A;  5M5W J;  4N4O B;  1UFM A;  4BY1 J;  1WKM A;  2F5V A;  3O3K A;  4XBF A;  1CF7 A;  2IGK A;  1W5C C;  3QOP A;  4IX7 A;  1JUP A;  3TOA A;  2VOD A;  1MNE A;  2HXO A;  5ICE A;  2OCE A;  2XRN A;  3G2B A;  5FLV A;  2ADU A;  5FKK A;  2Y48 A;  1YG2 A;  1ZGA A;  2A6H F;  2HOA A;  3K4N A;  1VQM I;  1UST A;  2HPI A;  3GYH X;  2N8G A;  3HTU A;  1MJA A;  2JPB A;  1FC3 A;  3BZC A;  5CJ9 A;  5ILS A;  5J1Y A;  4PJM A;  2IS6 A;  2K40 A;  2XAQ A;  3FXU A;  2GLO A;  2TDX A;  5J47 A;  2E2I J;  2KJC A;  4LLL A;  3KEQ A;  1QHG A;  1B6A A;  3QP5 A;  4QPQ A;  1WJE A;  3Q9S A;  5KAI C;  1P7J A;  2F6C A;  3JRB A;  1RIO H;  1CQT A;  4KYW A;  3LSJ A;  1G8X A;  2HS5 A;  5LFA A;  3BT9 A;  3V7S A;  3ZMS A;  3L2V A;  1D3Y A;  5DYM A;  1Z3X A;  4LIT A;  4JX4 A;  2R0Q C;  2KP6 A;  1BR4 A;  4ASN A;  4W1U A;  2IW5 A;  2QSH X;  2P5V A;  2R7D A;  2VBY A;  4XON A;  1P4X A;  4KIB A;  5HS9 A;  1T6S A;  5D6F A;  4PFP A;  2WAE A;  3BP8 A;  4UVB A;  2ISY A;  1UZC A;  4D5F A;  4RBO A;  1TLH B;  3G1M A;  2PMZ A;  3CO6 C;  1IRZ A;  2R7Z J;  3ZMZ A;  1PDN C;  1QPM A;  2FD5 A;  3MAJ A;  2VKE A;  4FX0 A;  3ZOB A;  5LGN A;  2KIU A;  3OIQ A;  3ERE D;  1OQY A;  1BM9 A;  1PUF B;  3T8R A;  2FOK A;  3EQL F;  1HCR A;  1DU0 A;  2LOO A;  1Y0U A;  4PGG A;  3GBG A;  4DJA A;  4BYY A;  5D6E A;  5E3L A;  4PJL A;  5CLS A;  3KET A;  2EZK A;  3P9C A;  1F5T A;  2K9S A;  2Z9O A;  2L2O A;  3BG3 A;  4A93 J;  5LLQ A;  2JA7 J;  1R49 A;  4I01 A;  4CXF A;  4U0Y A;  2Y2Z A;  1T33 A;  1TNS A;  3MWM A;  1LEA A;  4U7B A;  2ZJ2 A;  3P7N A;  2K9N A;  2JA6 J;  3LQQ A;  1FLI A;  2M34 A;  4MEX F;  3J7Z I;  1FTT A;  4KDP A;  5FLX Z;  4LB5 A;  4ZDL A;  3GTM J;  2ZNY A;  3F8N A;  1S6L A;  3IV5 A;  3CCL I;  3HGY A;  3CCJ I;  3A1Y A;  1T39 A;  3OR1 C;  2M87 A;  4LB6 B;  4LLG F;  3H3Z A;  1BA5 A;  1E17 A;  4AIJ A;  2HZD A;  4XIC A;  2FU4 A;  2CW8 A;  3D5S C;  4S0H B;  1MBG A;  4BEH B;  2DQR A;  3RKW A;  1SEU A;  1BR2 A;  1I3Q J;  2STT A;  1YJ9 I;  3TW7 A;  1K83 J;  1OCO H;  2H6B A;  1WCM J;  1O7F A;  4D9J A;  4RDU A;  1OYY A;  4AID A;  4L9V A;  2BY2 A;  5DCM B;  1XMA A;  3WGI A;  3Q3S A;  3RKX A;  3H9J A;  4UUS A;  3NQO A;  2QSF X;  4DYC A;  2HKO A;  1Y0N A;  3JW4 A;  5CVI A;  2F5D A;  3L9F A;  1T08 B;  2L3D A;  2DXI A;  1UEL B;  2XAH A;  3DEU A;  4MTD A;  4KIG A;  2O0Y A;  3VDX A;  1JTX A;  4ZYG A;  1IGN A;  4I0A A;  3VB2 A;  3B6A A;  4GRI A;  1HXD A;  1XX5 A;  2DFE A;  1MDM A;  2IRF G;  1OIS A;  3KZY A;  1USS A;  1EKE A;  5D5X B;  3R6S A;  2IPQ X;  5EEA A;  1TWG J;  1VFC A;  3RTR A;  3D1N I;  1STZ A;  5F6F A;  3CQZ J;  5JVG F;  2M8G X;  2LSO A;  1ZLK A;  3I54 A;  1XMX A;  1ZK8 A;  1FP1 D;  3TO6 A;  3HTS B;  4N0B A;  1LDD A;  1EA3 A;  1OJL A;  2IGO A;  2ZXH A;  4A3I J;  3GCM A;  2Q8K A;  3CC2 I;  4DQ2 A;  1N78 A;  4U87 A;  2A3S A;  3CCR I;  1IC8 A;  3S17 J;  4CA0 A;  3MD2 A;  1F9N A;  4CCO A;  1P92 A;  2EBI A;  3KYD B;  1VQ8 I;  4HV6 A;  1BOA A;  3DPU A;  2DJN A;  1P6R A;  2O03 A;  2W7N A;  4KA4 A;  3IH2 A;  2W48 A;  3SDB A;  4A0Z A;  2OD5 A;  1IXS B;  2RQQ A;  1D1C A;  1HW5 A;  2EPF A;  4XLC A;  3ZMV A;  4BQQ A;  1OPC A;  5IP9 J;  2L7M P;  1H88 C;  3FIS A;  3ZN1 A;  4GGG A;  2X85 A;  2LTP A;  3QWL A;  2HWV A;  4NB5 A;  4BHC A;  2XPU A;  3B6C A;  2E34 A;  2K27 A;  3ZN0 A;  2R7V A;  3W3C A;  5L3D A;  3WG9 A;  4C9Y A;  1FYL A;  1U5T C;  2E1M B;  4C2T A;  3OOU A;  2CV0 A;  1U9O A;  3TL4 X;  4C30 A;  2HGC A;  3KX2 A;  2QVO A;  2R7R A;  2L01 A;  1WJC A;  2WB1 N;  3LST A;  3ZMD A;  3Q0W A;  3J80 Z;  3G6E I;  4G6T B;  3C2G A;  2M9H A;  2X0L A;  1Y1V J;  2KRF A;  4XLA A;  2X1D A;  2GOX B;  3LNQ A;  3HSE A;  5AIP A;  2BE5 F;  4CCM A;  1TP4 A;  4E7K A;  4XLH A;  2DA3 A;  2FBK A;  2K02 A;  3EUK L;  1B9N A;  2ZME C;  2CV1 A;  2DK8 A;  2DMP A;  2LFB A;  3V7R A;  1AOY A;  3KEO A;  3ZR8 X;  3M4O J;  4R1H A;  5EJC A;  2EH3 A;  4DIQ A;  4NDL A;  3VFZ A;  1WI9 A;  5HNF A;  1ITY A;  4ZC3 A;  1QQI A;  2YSR A;  3SJM A;  2FNA A;  3FXQ A;  4XID A;  1W36 D;  2VT2 A;  3KFW X;  3LA7 A;  5HOO A;  2HOT A;  4OMZ A;  1SFE A;  3FMS A;  2KIF A;  2LP0 A;  4PJ0 C;  1SFK A;  3WHC A;  3F6O A;  1FEX A;  1QGP A;  2Q2E A;  4OOI A;  3GTP J;  5GAG J;  2F4I A;  3LSI A;  3GEZ A;  2HYJ A;  4HQM A;  3BPX A;  4UVA A;  2CW7 A;  4A3B J;  2RN7 A;  2FRH A;  4G94 A;  5ILU A;  1DGW Y;  2D45 A;  1BIB A;  4EJU A;  5F08 A;  3FBI B;  2FOW A;  3OMY A;  1ZR4 A;  3HOY J;  3N97 A;  1CF7 B;  1IXC A;  3MN2 A;  2QZ8 A;  4ZZD A;  1VND A;  3K2A A;  5HLT A;  1JKO C;  2FBH A;  3DPL C;  1DGR M;  3DLA A;  3ECO A;  2EIM H;  3CCQ I;  2PLY A;  3CCM I;  1ZRD A;  1MMG A;  4I09 A;  4B4C A;  2PMU A;  2IA2 A;  3FXO A;  2PJP A;  2R5Z A;  2LYC A;  2ID3 A;  2H6C A;  5E1Z B;  3H1C A;  3RJP A;  3BC8 A;  1XS9 A;  3PFI A;  1XCB A;  4S05 A;  2M1B A;  1BIA A;  1Z67 A;  1TW2 A;  4EEF G;  2MW8 A;  5ERI A;  4YFN F;  2EZH A;  1I50 J;  1HDP A;  3TDZ C;  2P5K A;  3A0B C;  3JRD A;  1Y6I A;  2WA0 A;  3GO5 A;  2MD0 A;  5FGM A;  2O61 A;  1MKM A;  1QPI A;  5J8F A;  3S16 J;  2YX7 A;  5L3G A;  1MMD A;  2NS0 A;  3S8P A;  1FWZ A;  1HA8 A;  3K2Z A;  1S8N A;  2EV5 A;  2BEO A;  2HYG D;  1W7P B;  2A6T A;  1VQ7 I;  4HLY A;  2OU2 A;  2MYS A;  2V1N A;  3LOC A;  2V26 A;  1WJB A;  1OMI A;  2CMP A;  1F4K A;  1GUU A;  2CQK A;  4Y17 A;  5EYR A;  1UB9 A;  2W84 A;  3SZG A;  3S3O A;  3WE3 A;  3K4B A;  4IEJ A;  1IJW C;  4HBL A;  1BC8 C;  1VQN I;  2EFP A;  2P0W A;  5TRD A;  1PP7 U;  1QZE A;  2KIM A;  2JUG A;  2G0E A;  3BCA A;  4K2E A;  2A68 F;  4NHJ A;  1MSF C;  5HS7 A;  4P5O A;  1I6H J;  1Z6R A;  3SYT A;  4OIN F;  4IHV A;  3CCV I;  2AO9 A;  2IXS A;  1KU2 A;  4X1E A;  4A3M J;  4ABZ A;  2LBF A;  4J19 A;  3BY6 A;  4OMY A;  1IN5 A;  4RS8 A;  4MQV A;  4C3I J;  2ZXJ A;  3EET A;  1Q1V A;  1SMT A;  1UG2 A;  4J01 A;  3PNY A;  3ULQ B;  2LG4 A;  2ZB9 A;  1V55 H;  1XC5 A;  4G8X A;  1UHW A;  1FBU A;  1IRF A;  1WGX A;  2WAD A;  4IHS A;  3ABT A;  2VIX A;  4IQJ A;  3BG9 A;  1DPU A;  2H94 A;  2IS1 A;  2L9N A;  4AM3 A;  1XB4 A;  4JQF A;  2VKD A;  1TW3 A;  4IHY A;  3OIP A;  1U8B A;  2K85 A;  4OIQ F;  3FDY A;  4BJ6 C;  3DU5 A;  5M3M J;  4PDK A;  5F0C A;  1ON2 A;  3ZCO A;  1NG7 A;  2NVY J;  3TGN A;  3OYH A;  1SD7 A;  4QSH A;  1ZHF A;  2LDU A;  1XG1 A;  3D5R C;  4M6Y A;  1JJ8 C;  1J7K A;  1T2K A;  2ME0 A;  3HOZ J;  3FKJ A;  1DU6 A;  1QZY A;  1B72 A;  4G6Q A;  3WTS C;  3HBL A;  3HIF A;  1VQ9 I;  2GOM A;  1XTA A;  3H35 A;  3ISP A;  3RPU A;  5B3S H;  4UUS B;  1V4R A;  3VYU B;  4OIO F;  3PUF A;  4FET A;  1PYV A;  4ZYA A;  5E3O A;  1KU7 A;  1MND A;  2OZU A;  3RIR A;  1O3T A;  4PUS A;  5E8G A;  5D5W B;  1QZZ A;  3KP3 A;  4NUB A;  2B63 J;  2YX4 A;  2TCT A;  2E71 A;  1FYM A;  2DJI A;  2L4M A;  3GF2 A;  2Q1Z B;  2JT1 A;  4FX4 A;  1WVR A;  2WV1 A;  1YIO A;  5KNL A;  2WWY A;  4JK1 X;  2V9P A;  4HV5 A;  1K4S A;  3PL8 A;  3CES A;  4BQN A;  2HVQ A;  4X0G A;  1FTZ A;  4HX8 A;  2Z2S B;  2DYS H;  4MGR A;  3R61 A;  4Y15 A;  2BGC A;  4RGS A;  5JLX A;  5C3E J;  4HG2 A;  4AIK A;  1RI7 A;  3HRM A;  5IYB J;  3HOW J;  1S9H A;  3PIP F;  1ENH A;  2FXA A;  2ZSH B;  1S7O A;  5L3B A;  1BN5 A;  3LL7 A;  3AG4 H;  3PSF A;  3LSG A;  3Q9V A;  4HZF A;  1G3S A;  4L5J A;  2DA2 A;  5E1W A;  2CV2 A;  2CW0 F;  2VQL A;  1R22 A;  2HNH A;  5K7H A;  3K7A J;  5JFR A;  1FIA A;  2LNB A;  3HJE A;  2FBI A;  2F48 A;  4UY8 I;  2RQP A;  2WB1 A;  4KMU X;  1ONV A;  2RNG A;  2VL8 A;  2G7U A;  3DTE A;  3BQZ A;  1FP2 A;  4ZYD A;  2P4W A;  3K4J A;  2I5U A;  2XVC A;  4H0E A;  4L9J A;  5K7F A;  1XDS A;  4Q5S F;  5F27 A;  4F52 A;  1GT0 C;  1ORK A;  2UWM A;  4L5E A;  2LY9 A;  2NYX A;  1ZH5 A;  2L4A A;  1BI1 A;  1OKR A;  3DCF A;  1X4O A;  3CCY A;  3ELK A;  1CGP A;  1N75 A;  3OYN A;  1H9T A;  3FK7 A;  1U6G A;  1MW7 A;  1R58 A;  3E3V A;  2Q0O A;  3UNG C;  1OYI A;  1LVK A;  2DA1 A;  1J59 A;  1A36 A;  2D1H A;  4BKX A;  2COB A;  2ZKZ A;  4P9U A;  2HVS A;  5D5V B;  2XRO A;  1ETO A;  2GA1 A;  4ENK A;  2E7X A;  1O4X A;  1W36 C;  1V5G A;  4HSR A;  2Z33 A;  2GXA A;  1YLF A;  2BXZ A;  3R0A A;  2K9Q A;  3HOX J;  4ZTJ A;  4PCQ A;  1J9I A;  1FT9 A;  1VI0 A;  2VKH A;  3DKW A;  2M8E A;  3ABU A;  1KGS A;  1HKT A;  2MD5 A;  3QPH A;  4B47 A;  2ETH A;  2IGN A;  1IF1 A;  2HEO A;  2IS4 A;  4BXF A;  4RGU A;  2HDD A;  3I5U A;  3GVA A;  2KT0 A;  3L2W A;  2R93 J;  1EH6 A;  3R0J A;  3ZQH A;  3IH3 A;  4IQ4 A;  3IP4 B;  3TED A;  2ACJ A;  4C3H J;  1JE8 A;  1MJB A;  1TZL A;  2Z16 A;  3M1E A;  2A6E F;  3JRF A;  3L2Q A;  3DU6 A;  2AQE A;  2L7Z A;  2QQB A;  2IJL A;  2VKV A;  4P9F A;  5EZH A;  2JMW A;  2Q2E B;  1W0U A;  3M3Y J;  4XLP F;  2XUB A;  1ZLJ A;  2O8X A;  3BZK A;  5FD5 A;  5HNH A;  1LEB A;  2V9K A;  3OS1 A;  2WY8 Q;  3DBH B;  3OV8 A;  3KZZ A;  2DDB A;  2VUM J;  3OS2 A;  3V42 A;  3O8H A;  2DT6 A;  3FWE A;  2DFI A;  3CDH A;  3S14 J;  5EGO B;  4XMY A;  2AQF A;  1LJ9 A;  3LFU A;  3ONQ A;  2LR8 A;  3VEP A;  5EEG A;  2I8D A;  4HF1 A;  2XPV A;  4BHB A;  4IVN A;  1B59 A;  2H1L A;  1K6O A;  2OUM A;  4IRG A;  1FOY A;  2DOD A;  5FFX A;  3Q5F A;  2EJR A;  3CD6 I;  4M9S A;  3ECH A;  4EGZ A;  3DV8 A;  3LA3 A;  4BQO A;  1A04 A;  1V5E A;  1UG0 A;  3HRT A;  2XV4 S;  4R79 A;  1D8J A;  3JRE A;  2X9D A;  3VPR A;  2R5Z B;  2ZJR F;  3CUQ C;  1HQC A;  2E1N A;  4ZJZ A;  3LAP A;  4XKV A;  1U78 A;  4A0X A;  4ESF A;  1YFH A;  1P9Q C;  1LNW A;  3K4K A;  3OS0 A;  5E79 C;  4M3G A;  3OIO A;  1XCV A;  3BG7 A;  1WSU A;  1QBJ A;  3BR1 A;  2GIZ A;  3JTG A;  4HA8 A;  2RDP A;  2DN0 A;  1KQ0 A;  2OV7 A;  2FSW A;  3CF2 A;  1FSH A;  5B66 C;  3FM3 A;  3GTJ J;  5IOY A;  1NHA A;  4KT6 A;  4WF2 A;  2M2E A;  1FZP B;  3QP6 A;  3JTH A;  4EM2 A;  4M6X A;  5KHD A;  4P1W A;  3G73 A;  3HPH A;  5B5E C;  1R4M B;  3MKW B;  2FA5 A;  5LRR A;  3IWF A;  4XM3 A;  4XRF A;  5E17 F;  3H0G J;  1JUS A;  1WH5 A;  1JUM A;  1LDK B;  1H9G A;  3KEY A;  1J0R A;  3IWZ A;  4A3L J;  3SZT A;  2CH0 A;  1RZ4 A;  3OL3 A;  4YG2 F;  3QYE A;  4EMS A;  2R4G A;  2Z99 A;  1U3E M;  4PZJ A;  4BBR J;  4G6D A;  2P7V B;  3MKY B;  5EDN A;  4L9N A;  3GZ5 A;  5CKT A;  5J8C A;  3NAR A;  2J5P A;  2JVH A;  2LBF B;  3WOD F;  2DMT A;  3L2C A;  2GM4 A;  3S15 J;  2HKX A;  2K3P A;  2OC6 A;  5DCF A;  1RR8 C;  1ZAO A;  1T38 A;  1G4D A;  3O8G A;  1FOX A;  4IL6 C;  2XAU A;  1AKH A;  3S1N J;  2VT3 A;  2EV6 A;  2MC4 A;  2QQA A;  2GZW A;  3BOQ A;  5J4V A;  1TT5 B;  3TP3 A;  4QTR A;  1KON A;  4M71 A;  1I1S A;  5HVQ C;  1W7P A;  4DBQ A;  4E7H A;  3JRI A;  1LFP A;  5B1B H;  4BXX J;  4DYQ A;  2JJ7 A;  2QF7 A;  5LD2 C;  2VPL A;  1QVU A;  3CME I;  3GTQ J;  1XMK A;  1QA6 A;  3K1P A;  3FK6 A;  3CLO A;  3ABM H;  2E1C A;  1YI2 I;  2BOL A;  2WBM A;  2FJ1 A;  2QGU A;  2XB5 A;  2DK5 A;  2XF6 A;  1XSD A;  1Y1W J;  3I3L A;  4WXH A;  3I4P A;  5DD8 A;  1B72 B;  4N4N B;  2EA2 A;  1O3R A;  1XGS A;  2VBW A;  4HOB A;  5E18 F;  3GZN B;  3T8T A;  4BAC A;  1ERD A;  1R5G A;  4EV0 A;  5C4X J;  2DQL A;  3HHG A;  1U9N A;  1R1V A;  4HX7 A;  2K5C A;  2KJB A;  2VN2 A;  3MZY A;  1HDD C;  4HDU A;  2Y9Z A;  4FE7 A;  1TQI A;  4CZZ A;  5LHG A;  3VWB A;  4KUM A;  4IO9 F;  3KP7 A;  3CCU I;  2M7A A;  1EH8 A;  1TBX A;  4P96 A;  2MH9 A;  1U0J A;  4D0P A;  2VJ5 A;  4ENM A;  2Y0S N;  2GAU A;  1FIP A;  5A2Q K;  4AC0 A;  2CUZ A;  4Z2Y A;  4ZDP A;  5LBQ A;  5EZG A;  5FJ8 J;  4LFU A;  3OYA A;  2EFW A;  1LPQ A;  4UV8 A;  1YIT I;  3HM5 A;  3JCU C;  4HNU A;  1R6R A;  3F6V A;  2HZT A;  2MAB A;  4FHT A;  1EJ9 A;  2VJJ A;  3R60 A;  5LRS A;  1R7J A;  2A69 F;  5L3E A;  4XLE A;  2EWN A;  2NOJ B;  3HL2 A;  2O6G E;  2VXD A;  3OY9 A;  3EUH C;  1QHH D;  3BR2 A;  3TO9 A;  3BTJ A;  3LSM A;  1H0M A;  2RKH A;  1GXP A;  5LGT A;  2YPR A;  2NAZ A;  3GLX A;  2CS3 A;  2DBB A;  4XRS A;  3H0D A;  4U7D A;  3DTK A;  3CC4 I;  1ZN2 A;  2VON A;  5M5Y J;  2KRC A;  3DLL F;  4CCK A;  3M8J A;  3FXL A;  2D2W A;  4JX5 A;  4ZYE A;  2XKP A;  1ZKG A;  3BG6 A;  3P9K A;  5HDK A;  4UB6 C;  3TW6 A;  4Y7N J;  3AL0 B;  1SAU A;  4NC8 A;  4LK1 F;  4AYB N;  1YTY A;  1HSJ A;  4WXC A;  4XOR A;  4Q47 A;  3WHB A;  3S1Q J;  5J3L A;  4QLC U;  2H1K A;  2OQR A;  1C0W A;  4ENN A;  5E1X A;  4ENJ A;  3VOD A;  2YS9 A;  4E7S A;  1ZG5 A;  4CDG A;  4A3D J;  3E6C C;  1W1W E;  4RB3 C;  1VQK I;  1OCC H;  3C7J A;  5B1A H;  4O5V A;  4ZTF A;  3J7A Y;  2W85 A;  3G1O A;  1H89 C;  1YX3 A;  2VBX A;  1ZRE A;  2VQC A;  3BR5 A;  2HPM A;  3OL4 A;  1MBE A;  4M9X A;  4W97 A;  3BZ6 A;  3ESW B;  3F72 A;  4RGR A;  4EGY A;  1MIJ A;  1WQ2 A;  4XN0 A;  5GAE J;  1RKT A;  2R7F A;  2HTJ A;  2ID6 A;  4G12 A;  1DUX C;  2V1X A;  2P5L C;  2XPW A;  2L9R A;  1OR7 C;  1X2M A;  4Q4Z F;  1YHQ I;  3KCC A;  4M3D A;  2NNY A;  1JKR C;  1JKP C;  1OCR H;  2CSO A;  2HQ5 A;  5FKN A;  1ZGJ A;  3H9G A;  4GO1 A;  3E5Q A;  4BDY A;  4IHW A;  3MMY B;  5EF6 A;  4OIR F;  4LIV A;  1MNM C;  5EEH A;  2ECB A;  2Y0M A;  3PIO F;  2MGQ A;  1IO2 A;  3H9Q A;  4I7H A;  4I76 A;  2VAS A;  3C1D A;  3HYI A;  4IZZ A;  2X4H A;  2OPT A;  3DF8 A;  4WCG A;  2JA2 A;  2VJ4 A;  3PQK A;  3NEU A;  2ZNZ A;  3SDG A;  1YW7 A;  2DA5 A;  3JRC A;  2P81 A;  3E7L A;  1IV6 A;  5ICG A;  4E7Z A;  3HHH A;  1MH4 A;  5AIQ A;  4LIU A;  3SEZ A;  1HKS A;  3LAJ A;  2Z1D A;  4XRS G;  1B8I A;  1NK3 P;  3E6B A;  2RGV A;  3JSO A;  4HPQ A;  2CQX A;  2UZK A;  3GFJ A;  4KNY A;  3MVP A;  5DTD A;  3JAM K;  3M8F A;  5FO5 A;  3VSL A;  5GTH C;  1LFU P;  4CGZ A;  3DTI A;  2B9S A;  2VPR A;  2HQN A;  1JHF A;  4LMY A;  4MIM A;  4QWQ A;  4CCJ A;  2RVC A;  2DDA A;  1AWC A;  4UB8 C;  4V2F A;  3K4M A;  1SVO A;  4ETS A;  4JYK A;  4HNV A;  1EH7 A;  4M73 A;  4JX6 A;  2LLK A;  3V4G A;  3U1D A;  4AIH A;  2VOO A;  2D5V A;  3E5U A;  3E5X A;  2V9V A;  4EM0 B;  5DUI A;  5A2Q Z;  2DCE A;  4FT8 A;  2CQ7 A;  5IY5 H;  4CUG A;  1V3F A;  5FRN A;  1VQL I;  2DMQ A;  2KDO A;  2M4K A;  3W2W A;  1K4T A;  1OLT A;  3CTA A;  2M30 A;  4XN3 A;  5EGO A;  1S5L C;  1H8A C;  2E36 A;  1J75 A;  1W7P D;  3HKZ A;  4P55 A;  3EUH A;  2Z3Y A;  2LMD A;  1FY7 A;  4HYE A;  2JRM A;  4AD9 A;  1WJ5 A;  2G9W A;  5BNG A;  2W25 A;  1JT0 A;  3I59 A;  3UKG A;  3RKQ A;  2OTJ I;  4B48 A;  1ETK A;  2EIJ H;  3CDI A;  3O2P E;  1QNT A;  3JSP A;  2XGC A;  1ZQ3 P;  1BJA A;  2QYO A;  3OYC A;  1W4M A;  3T5X A;  4S04 A;  4LJZ F;  4B1R A;  5HLG A;  4KN4 X;  4ESB A;  2WC2 A;  4I02 A;  4Z6Y A;  5DD4 A;  2VOP A;  1M1E B;  1G6N A;  3HDD A;  4L9T A;  4UV9 A;  2DOE A;  4LK0 F;  1HF0 A;  3W6V A;  1QVT A;  3E6D A;  5CQG A;  2CUF A;  3EPZ A;  2MBF A;  3M1C A;  3LSR A;  2B0L A;  3S2H J;  3PNV A;  5CQE A;  4FCY A;  3FX3 A;  1S72 I;  1WJD A;  1XGM A;  1NH3 A;  1ZEL A;  2UV1 A;  2KKO A;  3PO3 J;  4E6K G;  1AKH B;  2E7W A;  3WG7 H;  1D0Z A;  1IN7 A;  3ZXS A;  1NG6 A;  4Y13 A;  3U2R A;  5K5O A;  3IL2 A;  5FRO A;  3MZH A;  3K1M A;  3BJ6 A;  2M5W A;  4KIC A;  3ZPL A;  1IW7 F;  2NNN A;  5C44 J;  1RRJ A;  4XR6 A;  1MZB A;  1I5Z A;  3BR3 A;  3ML6 A;  5FFZ A;  1ACI A;  2LKS A;  5IT3 A;  3ZQ7 A;  1TQM A;  3QU3 A;  1N77 A;  3D5L A;  1E3O C;  1U8R A;  4RLF A;  2PEX A;  2BW3 A;  1FNN A;  3PJR A;  4LLN A;  2H8W A;  1K79 A;  3J81 K;  1XD7 A;  1D0Y A;  2LRE A;  4E7I A;  2XAG A;  2CYY A;  4PK4 A;  2KLO A;  4BL0 B;  3RQ4 A;  4KT5 C;  4IF4 A;  5J1R A;  4HX4 A;  1YX5 A;  3CJQ B;  1XSV A;  3IRR A;  1XGO A;  3DEW A;  3I71 A;  1U5T A;  3K4L A;  3LMM A;  4G9Y A;  5ILV A;  4HEA 2;  4XKW A;  2CUE A;  4M3F A;  5K7Z A;  4E7L A;  2Y0S A;  1WZ2 A;  1ZGW A;  3S1R J;  2XKO A;  5BOX A;  1DP3 A;  3F23 A;  2XB0 X;  1HST A;  2X6Y A;  2XAJ A;  3BG5 A;  4Y33 A;  1Z21 A;  3MKZ A;  2OQG A;  1V5F A;  4XL9 A;  6PAX A;  1Y8R B;  2EZL A;  1LE8 A;  2VE8 A;  3ZQC A;  1UCR A;  4FAS D;  4CH7 A;  2HXI A;  5F1J A;  1O3S A;  3RKY A;  2GIV A;  2KIQ A;  1A5J A;  2KPM A;  3H5R A;  3FZV A;  2UUZ A;  3ABK H;  1UHS A;  3H3V K;  2ZME A;  4F91 B;  1PVE A;  1X1A A;  3GLL A;  2K7L A;  2DPU A;  2GBY A;  1SC7 A;  2DAO A;  5C4J J;  4DNC A;  4RMN A;  1D8K A;  4RA2 A;  1L3L A;  1DDN A;  4AYB A;  3AG2 H;  3COA C;  1VQP I;  1U2W A;  2JA8 J;  5J40 A;  3RPQ A;  1TTY A;  3I55 I;  3QPS A;  3I64 A;  3VYT B;  3B02 A;  3GME A;  3S32 A;  3L00 A;  2LD5 A;  2M45 A;  1S7A A;  2VC1 A;  3HRS A;  1G3T A;  1GDT A;  3X2Q H;  2DYR H;  3GWZ A;  2X6O A;  2UXN A;  4B3A A;  2RNJ A;  2LKP A;  3BLY A;  5TIS C;  2PFB A;  4LD5 A;  2ZBK A;  4NNJ A;  2XF7 A;  3DWL E;  1T95 A;  2DI3 A;  3ZQL A;  4CHU A;  1R1T A;  1X3Z B;  2BBY A;  3ABL H;  5K1Y A;  4IKF A;  3IRQ A;  2V4J C;  4B8X A;  2A61 A;  3WTU C;  1R5H A;  3OSG A;  4BGD A;  1JHH A;  3ASN H;  3NWS A;  1SD5 A;  4A6D A;  2HFH A;  3FKI J;  4WX9 A;  5IT9 K;  2YUS A;  1V54 H;  1WPK A;  3EYY A;  3K69 A;  4V2G A;  4GFB A;  4DBR A;  4M9Z A;  1HW2 A;  2CQN A;  1FMV A;  1QU3 A;  3CMY A;  3CC7 I;  5FB2 A;  3HEF A;  2CJJ A;  2L5Q A;  4A3K J;  5BPI A;  3ASO H;  1X4P A;  3TDU C;  5JHU A;  3OSF A;  2OCC H;  2PI0 A;  1SFX A;  3GX4 X;  2L54 A;  4HNT A;  1R9T J;  3VOE A;  5J6X A;  3VYS B;  1RR7 A;  1VQ6 I;  5D5U B;  4BHP A;  2IA0 A;  2DLL A;  1SD6 A;  2ZSI B;  2HDW A;  5BQT A;  1X3U A;  2VBZ A;  3LSK A;  1K78 A;  4NC6 A;  1D5V A;  2W4S A;  2ESH A;  2GQQ A;  2ZCW A;  2L7F P;  4ZDO A;  3E0J B;  1WJA A;  4BUP A;  2PBI A;  3CF5 F;  2HQR A;  2R7T A;  9ANT A;  2WAF A;  1EV7 A;  1G59 A;  1LFB A;  1AHD P;  5FLM J;  3LWF A;  2MC3 A;  1T56 A;  2AS5 F;  2XAF A;  5JVT A;  1Y8Q B;  1B8I B;  2CUJ A;  2VE9 A;  2QUF A;  1ODD A;  1F36 A;  1VTN C;  1DPR A;  3ZQI A;  4B44 A;  5BMZ A;  2OJE D;  3E1S A;  2NRA C;  3UR3 C;  2GWR A;  2VXZ A;  2L7K A;  3MEX A;  3KYL A;  1PP8 F;  3P5J A;  2XAS A;  1X1B A;  2ECC A;  4MNU A;  1ZRC A;  1SAX A;  5DM6 F;  3WGH A;  2Z5U A;  4MO7 A;  1TNT A;  4A3G J;  1W5T A;  2F5C A;  3WTY C;  3N4M A;  3SFZ A;  1YO5 C;  3QYF A;  5LHI A;  5FKM A;  2Y69 H;  2QBY A;  2IS2 A;  2FQ3 A;  2NVT J;  5KVR A;  5IYD J;  2XDV A;  4OU0 A;  2CU7 A;  2R7Q A;  2E2H J;  1YYV A;  2P7C B;  4ESJ A;  2CQQ A;  2XGX A;  1WHU A;  5H20 A;  3CMA I;  4H4K C;  1IRX A;  2HU9 A;  1JGS A;  3EDP A;  2Y31 A;  3JRH A;  4GDF A;  4NQW A;  5M3F J;  1Z77 A;  3CP2 A;  3U1K A;  5JHF A;  3OYB A;  1JT6 A;  1NTC A;  3WU0 A;  3I59 B;  1J09 A;  2PN6 A;  1UAA A;  1HC8 A;  1A35 A;  3H5A A;  4PSW A;  3AAF A;  1ETV A;  2V1D A;  5GP9 A;  4A6E A;  2COM A;  3IKV A;  1FBQ A;  2XGE A;  2E1O A;  4RB0 A;  3CJT B;  3I53 A;  3OYF A;  4C3J J;  3BTC A;  4CCL A;  5E20 A;  3V8J A;  4CO8 A;  2VLA A;  3TBI A;  3U9G A;  2DTZ A;  3I4N J;  2VJI A;  4EAT A;  2V1U A;  2E5N A;  2E35 A;  3EYI A;  1ETW A;  3FHZ A;  1BL0 A;  3NWT A;  4ZH4 F;  1B1B A;  2ZO4 A;  2O3F A;  3G3Z A;  3PM1 A;  2DTR A;  3H92 A;  1IXR C;  3KP4 A;  2IBD A;  2JTV A;  3ZQQ A;  5HS8 A;  1T8I A;  1MH3 A;  5FLX K;  4DW6 A;  2B7E A;  4L18 B;  4A5N A;  5DUK A;  2QCO A;  3HSF A;  2QLZ A;  3V8K A;  1TL8 A;  1FPQ A;  1OCT C;  3I4M J;  4BNC A;  2JA5 J;  2DT7 B;  2QA4 I;  1BW5 A;  2R5Y A;  3MCZ A;  2NS7 A;  4EJT A;  4GXO A;  1BBY A;  3W6K B;  2K4B A;  1FYK A;  2EFO A;  5CVJ A;  2HYF A;  4DOZ A;  4AVP A;  3A01 B;  4A3C J;  3FF5 A;  3K1N A;  3AKZ A;  2EIN H;  1RPW A;  2BVL A;  5E8I A;  1XN7 A;  1FSE A;  1KU9 A;  3LA2 A;  4A69 C;  4ZZL A;  4BY7 J;  3G71 I;  2BW3 B;  3PFY A;  4RM2 A;  3S93 A;  4V19 K;  2EA4 A;  2IA1 A; 
#chains in the Genus database with same CATH homology
 3D0S A;  1Z9C A;  4XLN F;  4EJW A;  3C18 A;  5D4S A;  3DPT A;  1Z91 A;  1RNL A;  3KLO A;  1BI3 A;  4IPA A;  1XGN A;  1HW1 A;  1U5T B;  2V6C A;  3GFI A;  2LF7 A;  5DV5 A;  5BPD A;  2H27 A;  3W6J B;  2QEN A;  2OBP A;  3SXY A;  1RUN A;  1K7A A;  5LEJ A;  5L3F A;  2ZME B;  2K86 A;  1MJ9 A;  1E2X A;  2YU3 A;  1KU3 A;  3BDD A;  3K0L A;  2F5E A;  3DFG A;  3T1B A;  3WTT C;  1YW8 A;  2DT5 A;  2PQ8 A;  4YFK F;  3F8M A;  4E70 A;  4R8H A;  5KK1 A;  1O7L A;  2XIG A;  2BV6 A;  4MTE A;  2W57 A;  3C3W A;  2K4J A;  4WWC A;  3J80 K;  1BI2 A;  2GXB A;  5HDN A;  1B4A A;  4OIP F;  2D1V A;  5D8K B;  3R4K A;  5H6R A;  3WU1 B;  2RV8 A;  2OZ6 A;  3RI4 A;  3CUQ A;  1B9M A;  3BJA A;  1ZYR F;  2IVM A;  1IN8 A;  2Y75 A;  5ED4 A;  1XDU A;  1YS6 A;  2AXL A;  4YII A;  4RB2 C;  2MLG A;  4A5M A;  3HRU A;  2IT0 A;  2L02 A;  5F1R A;  1O3Q A;  3ROU A;  4KN7 X;  1DP7 P;  4HQE A;  5LGU A;  1K78 B;  5H6Q A;  1TQP A;  5HDG A;  1HBX G;  2PG4 A;  3QRF F;  3QPT A;  2HTS A;  5F64 A;  2H09 A;  1SD4 A;  3P9I A;  4A12 A;  1KQ8 A;  2EB7 A;  3QU6 A;  2MA3 A;  4YFX F;  3O6B B;  1W5S A;  5HLI A;  3GW2 A;  1OYW A;  2OA4 A;  2ISZ A;  2JSC A;  3WTZ A;  1I6X A;  2LF8 A;  3WE2 A;  3F21 A;  2QBY B;  2QQ9 A;  3PQJ A;  1T98 A;  3HSR A;  2CG4 A;  4Q48 A;  5K5Q A;  1ZG3 A;  4TV7 A;  4RAY A;  1UHM A;  3B73 A;  4EJO A;  4L5I A;  3ZMU A;  1MGT A;  4LG0 A;  1G3Y A;  4GYI A;  3L09 A;  4KIF A;  1P2F A;  3HOS A;  4MHG A;  5BS6 A;  3RYR A;  1R23 A;  3FXR A;  1LDJ A;  2P6T A;  2FMY A;  3J7A O;  4A0Y A;  1I27 A;  1SMY F;  4IXA A;  3TQN A;  1IUY A;  3WTV C;  4ZYH A;  1REP C;  3I58 A;  2GXG A;  5ICC A;  5CVV A;  1Z6T A;  4UVC A;  2WV0 A;  3F8C A;  2CFX A;  4CYD A;  1GVJ A;  2MLK A;  4UHT A;  1Z7U A;  1Z1D A;  4HF0 A;  1KA8 A;  3ZMT A;  3BWG A;  4G7H F;  5L3C A;  1MD0 A;  1IN4 A;  1QO0 D;  2QM3 A;  3CJN A;  3LQR A;  2ESN A;  1IZ1 A;  1ZG1 A;  2RC4 A;  4HW0 A;  5K5R A;  5FD6 A;  2DW4 A;  4WK8 F;  1Z05 A;  4I0B A;  2FEZ A;  3LFK A;  3M9A A;  5D4R A;  2FML A;  4YIF A;  1XSX A;  3HUG A;  4N9H A;  2OAZ A;  2FNP A;  4U88 A;  2JZY A;  2R3S A;  5D8L B;  2PMH A;  3MQ0 A;  3DQV C;  4L0Z B;  2F5F A;  1KYZ A;  4MEY F;  1OR7 A;  1R00 A;  4HDV A;  4XSX F;  2WTE A;  4ON0 A;  2CGP A;  4RAZ A;  4BXU A;  1LB2 A;  4IHT A;  5DEQ A;  4EQQ A;  3S2W A;  3OOP A;  2HOE A;  2JPC A;  4O6J A;  4BH9 A;  3KLN A;  1BC7 C;  1R36 A;  4CIC A;  3KE2 A;  4G7Z F;  4PGH A;  3GXO A;  2V79 A;  4IRH A;  2BYV E;  3JAM Z;  4IRI A;  1GXQ A;  2IP2 A;  3KP5 A;  4EM1 A;  3TO7 A;  5AON A;  3KP2 A;  4HAM A;  4AWX B;  2GA2 A;  3CUQ B;  2EV0 A;  3GFM A;  1FBS A;  4M72 A;  2DPD A;  2A5Y B;  1HKQ A;  4JBA A;  4HF2 A;  4BAY A;  2G7H A;  4N9I A;  3RYP A;  2ZFW A;  1Q1H A;  3F8B A;  4RGX A;  3KP6 A;  2HDC A;  2J5O A;  3GUD A;  2EK5 A;  5HLH A;  3SZP A;  1IAW A;  4I2O A;  5TJJ A;  3M7G A;  1BI0 A;  3IC7 A;  2FF4 A;  3TOB A;  3F22 A;  1MDM B;  1WWX A;  5JI6 A;  1YW9 A;  4HLX A;  2QWW A;  3I0T A;  1T0F A;  5ICF A;  3SHF A;  1ZAR A;  4IJA A;  4KFC A;  3H3U A;  1S3J A;  3L7W A;  3V7C A;  3E6M A;  3CO7 C;  4L0Y B;  3BPV A;  2XHK A;  5DCM A;  2STW A;  2F2E A;  2DU9 A;  3J81 Z;  3DXJ F;  4G7O F;  2HR3 A;  5JR3 A;  1LVA A;  3GZ6 A;  3WTW C;  3HOT A;  4WXD A;  2CWE A;  4RB1 A;  3T0Y A;  1LQ1 A;  2VC0 A;  1J5Y A;  2JRT A;  4KMF A;  1KYW A;  4LG0 B;  1IN6 A;  4LGW A;  3NRV A;  4O3M A;  4UUV A;  3WTX C;  3IKT A;  5CVU A;  1IRG A;  3RDI A;  1YQA A;  2UXX A;  4XSZ F;  3SQN A;  1FX7 A;  1G3W A;  3FMQ A;  1ON1 A;  1YS7 A;  4B09 A;  3GFL A;  3K9T A;  3FM5 A;  2P8T A;  1JXS A;  1O57 A;  3FMR A;  3CUO A;  2MH2 A;  1SFU A;  1PUE E;  1P4W A;  1ULY A;  4A2U A;  4BQA A;  2DO7 A;  2EFN A;  1L0O C;  5LHH A;  3MFK A;  3F3X A;  3M8E A;  2C6Y A;  2W24 A;  3E97 A;  5CVR A;  2A07 F;  1KQ9 A;  1R1U A;  3ZP5 A;  1ZRF A;  3TKY A;  1GHC A;  3IHU A;  4U0V A;  4EVI A;  1F1Z A;  4MQ9 F;  2P6S A;  2YR2 A;  4UNO A;  2CO5 A;  4GYG A;  5LEK A;  1P4A A;  3WGG A;  4F7Z A;  4I98 B;  3V8L A;  1J2X A;  3BRO A;  1WRJ A;  5IT9 Z;  5CYV A;  4UXN A;  4U0W A;  1I1G A;  3BJO A;  3DP7 A;  2EFQ A;  2ELH A;  4M74 A;  3QAH A;  2FE3 A;  4GCV A;  1S29 A;  3F8F A;  1FOK A;  1RUO A;  5DDG A;  3REO A;  4EJV A;  1UFM A;  1WKM A;  3O3K A;  4XBF A;  1CF7 A;  3QOP A;  3TOA A;  2VOD A;  5ICE A;  2XRN A;  2ADU A;  2Y48 A;  2A6H F;  1YG2 A;  1ZGA A;  1UST A;  3GYH X;  3HTU A;  5CJ9 A;  1MJA A;  2JPB A;  1FC3 A;  5ILS A;  2XAQ A;  3FXU A;  2TDX A;  2KJC A;  4LLL A;  3KEQ A;  1B6A A;  3QP5 A;  3Q9S A;  1RIO H;  4KYW A;  2HS5 A;  3ZMS A;  3V7S A;  1D3Y A;  5DYM A;  4ASN A;  2IW5 A;  2P5V A;  2R7D A;  2VBY A;  1P4X A;  4KIB A;  5HS9 A;  1T6S A;  5D6F A;  3BP8 A;  4UVB A;  2ISY A;  1TLH B;  3CO6 C;  3ZMZ A;  1PDN C;  1QPM A;  3MAJ A;  4FX0 A;  5LGN A;  2KIU A;  3ERE D;  1BM9 A;  3T8R A;  2FOK A;  3EQL F;  1Y0U A;  4PGG A;  4BYY A;  5D6E A;  5CLS A;  3KET A;  3P9C A;  1F5T A;  2Z9O A;  5LLQ A;  4I01 A;  4CXF A;  4U0Y A;  1TNS A;  3MWM A;  1LEA A;  4U7B A;  2ZJ2 A;  3P7N A;  3LQQ A;  1FLI A;  4MEX F;  4KDP A;  5FLX Z;  4LB5 A;  2ZNY A;  3F8N A;  1S6L A;  1T39 A;  2M87 A;  4LB6 B;  4LLG F;  3H3Z A;  1E17 A;  4AIJ A;  2FU4 A;  2DQR A;  3RKW A;  2STT A;  2H6B A;  1O7F A;  1OYY A;  4L9V A;  5DCM B;  1XMA A;  3WGI A;  3RKX A;  3NQO A;  2HKO A;  3JW4 A;  5CVI A;  2F5D A;  3L9F A;  2L3D A;  2XAH A;  3DEU A;  4MTD A;  4KIG A;  2O0Y A;  4ZYG A;  4I0A A;  3VB2 A;  1HXD A;  1MDM A;  2IRF G;  3KZY A;  1USS A;  5D5X B;  3R6S A;  2IPQ X;  3RTR A;  1STZ A;  5F6F A;  2LSO A;  1ZLK A;  3I54 A;  3HTS B;  1FP1 D;  3TO6 A;  4N0B A;  1LDD A;  2Q8K A;  4DQ2 A;  2A3S A;  1F9N A;  1P92 A;  4HV6 A;  1BOA A;  1P6R A;  2O03 A;  4KA4 A;  4A0Z A;  2OD5 A;  1IXS B;  1HW5 A;  3ZMV A;  1OPC A;  3ZN1 A;  4GGG A;  2HWV A;  4NB5 A;  4BHC A;  2K27 A;  3ZN0 A;  5L3D A;  3WG9 A;  1FYL A;  1U5T C;  2HGC A;  2QVO A;  2L01 A;  3LST A;  3ZMD A;  3J80 Z;  2X0L A;  2KRF A;  3HSE A;  5AIP A;  2BE5 F;  2FBK A;  2K02 A;  1B9N A;  2DK8 A;  3V7R A;  1AOY A;  3KEO A;  4R1H A;  3VFZ A;  1WI9 A;  1QQI A;  2YSR A;  2FNA A;  3FXQ A;  2VT2 A;  3KFW X;  3LA7 A;  5HOO A;  4OMZ A;  1SFE A;  3FMS A;  2KIF A;  3F6O A;  1QGP A;  2Q2E A;  4OOI A;  3GEZ A;  4HQM A;  4UVA A;  3BPX A;  2RN7 A;  2FRH A;  4G94 A;  5ILU A;  2D45 A;  1BIB A;  4EJU A;  3N97 A;  1CF7 B;  1IXC A;  2QZ8 A;  4ZZD A;  2FBH A;  3DPL C;  3ECO A;  2PLY A;  1ZRD A;  4I09 A;  2PMU A;  2IA2 A;  2PJP A;  2H6C A;  5E1Z B;  3RJP A;  3PFI A;  1XCB A;  4S05 A;  2M1B A;  1BIA A;  1TW2 A;  5ERI A;  4YFN F;  3TDZ C;  2P5K A;  3GO5 A;  5FGM A;  2O61 A;  1MKM A;  5J8F A;  2YX7 A;  5L3G A;  2NS0 A;  1FWZ A;  3K2Z A;  1S8N A;  2EV5 A;  2BEO A;  2HYG D;  1W7P B;  4HLY A;  2OU2 A;  1OMI A;  1F4K A;  2CQK A;  4Y17 A;  1UB9 A;  2W84 A;  3WE3 A;  4HBL A;  1BC8 C;  2EFP A;  5TRD A;  1PP7 U;  2KIM A;  4K2E A;  4NHJ A;  2A68 F;  5HS7 A;  4P5O A;  1Z6R A;  4OIN F;  1KU2 A;  3BY6 A;  4OMY A;  1IN5 A;  4RS8 A;  4MQV A;  2ZXJ A;  3EET A;  1SMT A;  3ULQ B;  4G8X A;  1UHW A;  1FBU A;  1IRF A;  4IHS A;  3ABT A;  1DPU A;  2H94 A;  1XB4 A;  4JQF A;  1TW3 A;  4OIQ F;  4PDK A;  1ON2 A;  3TGN A;  1SD7 A;  1ZHF A;  2LDU A;  4M6Y A;  1J7K A;  1T2K A;  1QZY A;  4G6Q A;  3WTS C;  3HIF A;  3ISP A;  3RPU A;  1V4R A;  4OIO F;  1KU7 A;  2OZU A;  3RIR A;  1O3T A;  5E8G A;  5D5W B;  1QZZ A;  3KP3 A;  2YX4 A;  1FYM A;  3GF2 A;  2L4M A;  2JT1 A;  4FX4 A;  1YIO A;  2WWY A;  4JK1 X;  4HV5 A;  4HX8 A;  4MGR A;  3R61 A;  4Y15 A;  2BGC A;  4RGS A;  4AIK A;  1RI7 A;  3HRM A;  2FXA A;  1S7O A;  5L3B A;  1BN5 A;  3Q9V A;  4HZF A;  1G3S A;  4L5J A;  5E1W A;  2CW0 F;  1R22 A;  5JFR A;  2LNB A;  2FBI A;  2RQP A;  4KMU X;  1ONV A;  2G7U A;  4ZYD A;  1FP2 A;  2P4W A;  4H0E A;  2XVC A;  4L9J A;  1XDS A;  4Q5S F;  2UWM A;  2NYX A;  1ZH5 A;  2L4A A;  1BI1 A;  1OKR A;  3ELK A;  1CGP A;  1H9T A;  1U6G A;  1R58 A;  3E3V A;  2Q0O A;  1OYI A;  1J59 A;  2D1H A;  2ZKZ A;  4P9U A;  5D5V B;  2XRO A;  2GA1 A;  4ENK A;  2E7X A;  2Z33 A;  1YLF A;  3R0A A;  4PCQ A;  1J9I A;  1FT9 A;  3DKW A;  2M8E A;  3ABU A;  1KGS A;  1HKT A;  2MD5 A;  3QPH A;  1IF1 A;  2ETH A;  2HEO A;  4RGU A;  3I5U A;  3GVA A;  1EH6 A;  3R0J A;  2ACJ A;  1JE8 A;  1MJB A;  3M1E A;  2A6E F;  4P9F A;  2QQB A;  2IJL A;  4XLP F;  2XUB A;  1ZLJ A;  2O8X A;  5FD5 A;  1LEB A;  3OV8 A;  3KZZ A;  3FWE A;  2DFI A;  3CDH A;  3VEP A;  1LJ9 A;  5EEG A;  4HF1 A;  4BHB A;  4IVN A;  1B59 A;  1K6O A;  4IRG A;  5FFX A;  3Q5F A;  2EJR A;  4M9S A;  3ECH A;  4EGZ A;  3DV8 A;  3LA3 A;  1A04 A;  3HRT A;  2XV4 S;  4R79 A;  1D8J A;  3CUQ C;  1HQC A;  2E1N A;  3LAP A;  1U78 A;  4A0X A;  4ESF A;  1YFH A;  1LNW A;  1WSU A;  1XCV A;  1QBJ A;  3JTG A;  4HA8 A;  2RDP A;  1KQ0 A;  2FSW A;  1FSH A;  3FM3 A;  1NHA A;  4WF2 A;  1FZP B;  3QP6 A;  3JTH A;  4EM2 A;  4M6X A;  3G73 A;  2FA5 A;  5LRR A;  3IWF A;  4XRF A;  5E17 F;  1LDK B;  1H9G A;  1J0R A;  3IWZ A;  3SZT A;  4YG2 F;  1RZ4 A;  4EMS A;  1U3E M;  2Z99 A;  4PZJ A;  4G6D A;  2P7V B;  4L9N A;  3GZ5 A;  5J8C A;  2J5P A;  3WOD F;  3L2C A;  2HKX A;  5DCF A;  1T38 A;  1ZAO A;  1G4D A;  2VT3 A;  2EV6 A;  2QQA A;  2GZW A;  3BOQ A;  4M71 A;  1I1S A;  5HVQ C;  1W7P A;  1XMK A;  3K1P A;  3CLO A;  2E1C A;  2DK5 A;  1XSD A;  4WXH A;  3I4P A;  5DD8 A;  2EA2 A;  1O3R A;  1XGS A;  2VBW A;  4HOB A;  5E18 F;  3T8T A;  1R5G A;  4EV0 A;  2DQL A;  3HHG A;  1R1V A;  4HX7 A;  2KJB A;  2VN2 A;  3MZY A;  4HDU A;  1TQI A;  4CZZ A;  5LHG A;  4KUM A;  3KP7 A;  1EH8 A;  1TBX A;  4P96 A;  2MH9 A;  4D0P A;  4ENM A;  2GAU A;  5A2Q K;  4Z2Y A;  5LBQ A;  4LFU A;  2EFW A;  4UV8 A;  3F6V A;  2HZT A;  4FHT A;  3R60 A;  5LRS A;  1R7J A;  2A69 F;  5L3E A;  2EWN A;  2O6G E;  3TO9 A;  1H0M A;  2RKH A;  1GXP A;  5LGT A;  2YPR A;  2NAZ A;  3GLX A;  2DBB A;  4U7D A;  1ZN2 A;  2VON A;  2D2W A;  4ZYE A;  2XKP A;  5HDK A;  3P9K A;  4LK1 F;  1YTY A;  1HSJ A;  4WXC A;  4Q47 A;  4QLC U;  2OQR A;  1C0W A;  4ENN A;  5E1X A;  4ENJ A;  3VOD A;  1ZG5 A;  4CDG A;  3E6C C;  4RB3 C;  3C7J A;  4O5V A;  2W85 A;  2VBX A;  1ZRE A;  4M9X A;  3BZ6 A;  3F72 A;  4RGR A;  4EGY A;  1WQ2 A;  2R7F A;  2HTJ A;  1DUX C;  2V1X A;  2P5L C;  4Q4Z F;  3KCC A;  2NNY A;  2CSO A;  1ZGJ A;  4GO1 A;  3E5Q A;  4OIR F;  5EEH A;  2Y0M A;  4I7H A;  3C1D A;  3HYI A;  2X4H A;  3DF8 A;  4WCG A;  3PQK A;  3NEU A;  2ZNZ A;  1YW7 A;  5ICG A;  3HHH A;  5AIQ A;  1HKS A;  3LAJ A;  3E6B A;  2RGV A;  3JSO A;  2UZK A;  3GFJ A;  4KNY A;  3JAM K;  3M8F A;  5FO5 A;  4CGZ A;  2HQN A;  1JHF A;  4LMY A;  4QWQ A;  2RVC A;  1AWC A;  4ETS A;  1EH7 A;  4M73 A;  3V4G A;  3U1D A;  4AIH A;  2VOO A;  3E5U A;  3E5X A;  2V9V A;  4EM0 B;  5DUI A;  5A2Q Z;  4FT8 A;  1V3F A;  3CTA A;  2M30 A;  1J75 A;  1W7P D;  4P55 A;  3EUH A;  2Z3Y A;  1FY7 A;  4HYE A;  4AD9 A;  2G9W A;  2W25 A;  3I59 A;  3O2P E;  1QNT A;  3JSP A;  1BJA A;  2QYO A;  1W4M A;  3T5X A;  4S04 A;  4LJZ F;  5HLG A;  4KN4 X;  4ESB A;  2WC2 A;  4I02 A;  5DD4 A;  2VOP A;  1G6N A;  4L9T A;  4UV9 A;  4LK0 F;  3E6D A;  2MBF A;  2B0L A;  3FX3 A;  1XGM A;  2KKO A;  2E7W A;  1IN7 A;  4Y13 A;  3U2R A;  5K5O A;  3IL2 A;  3MZH A;  3K1M A;  3BJ6 A;  2M5W A;  4KIC A;  3ZPL A;  1IW7 F;  2NNN A;  1MZB A;  1I5Z A;  3ML6 A;  5FFZ A;  5IT3 A;  3ZQ7 A;  1TQM A;  3QU3 A;  3D5L A;  1U8R A;  2PEX A;  1FNN A;  4LLN A;  1K79 A;  3J81 K;  1XD7 A;  2XAG A;  2CYY A;  4KT5 C;  4IF4 A;  4HX4 A;  1XSV A;  3IRR A;  1XGO A;  3I71 A;  1U5T A;  4G9Y A;  5ILV A;  2XKO A;  5BOX A;  3F23 A;  1HST A;  2XAJ A;  2OQG A;  6PAX A;  2VE8 A;  1UCR A;  1O3S A;  3RKY A;  2GIV A;  3FZV A;  2ZME A;  2K7L A;  2DPU A;  2DAO A;  4DNC A;  1D8K A;  1L3L A;  1DDN A;  3COA C;  1U2W A;  3RPQ A;  1TTY A;  3I64 A;  3B02 A;  3L00 A;  2M45 A;  1S7A A;  2VC1 A;  3HRS A;  1G3T A;  3GWZ A;  2UXN A;  2RNJ A;  2LKP A;  2PFB A;  4LD5 A;  2ZBK A;  2DI3 A;  4CHU A;  1R1T A;  2BBY A;  5K1Y A;  3IRQ A;  4B8X A;  2A61 A;  3WTU C;  1R5H A;  1JHH A;  1SD5 A;  4A6D A;  2HFH A;  4WX9 A;  5IT9 K;  3K69 A;  3EYY A;  4M9Z A;  1HW2 A;  5FB2 A;  5BPI A;  5JHU A;  3TDU C;  2PI0 A;  1SFX A;  3GX4 X;  2L54 A;  3VOE A;  5J6X A;  5D5U B;  4BHP A;  2IA0 A;  2DLL A;  1SD6 A;  5BQT A;  1X3U A;  2VBZ A;  1K78 A;  1D5V A;  2ESH A;  2GQQ A;  2ZCW A;  2PBI A;  2HQR A;  1EV7 A;  3LWF A;  2MC3 A;  2AS5 F;  2XAF A;  5JVT A;  2VE9 A;  2QUF A;  1ODD A;  1VTN C;  1DPR A;  5BMZ A;  2NRA C;  2GWR A;  2VXZ A;  3MEX A;  1PP8 F;  2XAS A;  4MNU A;  1ZRC A;  1SAX A;  3WGH A;  2Z5U A;  1TNT A;  1W5T A;  2F5C A;  3WTY C;  3N4M A;  3SFZ A;  1YO5 C;  5LHI A;  2QBY A;  2FQ3 A;  5KVR A;  4OU0 A;  2P7C B;  1YYV A;  4ESJ A;  2XGX A;  5H20 A;  1JGS A;  3EDP A;  4NQW A;  3WU0 A;  3I59 B;  2PN6 A;  3AAF A;  2V1D A;  4A6E A;  2COM A;  3IKV A;  1FBQ A;  4RB0 A;  3I53 A;  5E20 A;  3V8J A;  4CO8 A;  3U9G A;  2V1U A;  3EYI A;  3FHZ A;  4ZH4 F;  1B1B A;  2ZO4 A;  2O3F A;  3G3Z A;  2DTR A;  3H92 A;  1IXR C;  3KP4 A;  2JTV A;  5HS8 A;  5FLX K;  4L18 B;  4A5N A;  5DUK A;  3HSF A;  2QLZ A;  3V8K A;  1FPQ A;  4BNC A;  3MCZ A;  4EJT A;  4GXO A;  1BBY A;  3W6K B;  2K4B A;  1FYK A;  2EFO A;  5CVJ A;  2HYF A;  4AVP A;  3FF5 A;  3K1N A;  5E8I A;  1XN7 A;  1FSE A;  1KU9 A;  3LA2 A;  4ZZL A;  2EA4 A;  2IA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...