4K2EA

Hlyu from vibrio cholerae n16961
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
94
Chain Sequence
LQEMEKNSAKAVVLLKAMANERRLQILMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRKEAQTVFYTLSSTEVKAMIELLHRLYCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator HlyU
publication title Crystal structure of HlyU, the hemolysin gene transcription activator, from Vibrio cholerae N16961 and functional implications.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription activator
total genus 29
structure length 94
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4k2eA00
3RKXA 1K78A 5CVRA 3E6BA 2H6CA 1FWZA 2DFIA 1YIOA 1K78B 2HKXA 1FX7A 3OV8A 3DF8A 3KLNA 2ZCWA 1U5TB 1P2FA 1MKMA 2FOKA 4B09A 2XAJA 2CYYA 1D8KA 1HKQA 1IRGA 1YW7A 1R1VA 2RDPA 5E18F 5CVVA 4PGGA 1FLIA 4IPAA 5JI6A 5LLQA 2IJLA 2LSOA 1IN7A 4HAMA 4YFXF 3ML6A 2RV8A 3M1EA 2R7DA 4BAYA 3TOBA 1RI7A 1FOKA 4P9FA 3CO7C 3P9CA 1G3SA 1R22A 2K4JA 2GA1A 2V1XA 3DQVC 4UUVA 3NEUA 1TBXA 4OU0A 4L0YB 2FMYA 4HBLA 2DU9A 3EETA 5D5UB 4MQVA 1BIAA 2Z99A 5ICFA 3FWEA 3ZMDA 5AIQA 2OQRA 3WE2A 2Q8KA 1W7PD 3C1DA 1VTNC 1FBQA 2M8EA 2V1DA 4Q48A 4BHPA 4BXUA 2M87A 2VXZA 1T39A 1BJAA 3LA2A 2H27A 3GFMA 2XAFA 1D5VA 4YIFA 4KDPA 3TO6A 3LSTA 1ON2A 4LLLA 4KUMA 3H92A 3QAHA 2ISYA 3JSOA 2L01A 2DBBA 3U9GA 1JXSA 1MGTA 4HQMA 4M72A 3GYHX 3K9TA 5LGNA 2VE9A 1XGNA 2NRAC 2EFPA 2A69F 1F4KA 5DDGA 1L0OC 4N0BA 3L9FA 3WGIA 1I6XA 1Z6RA 4AIHA 1O7FA 4OINF 3RPUA 4ESJA 1QQIA 1GHCA 2M5WA 1HXDA 1OYWA 3P9IA 2VT3A 4IHSA 2FU4A 2PN6A 5JVTA 2K02A 3LA3A 3AAFA 5ERIA 2EV6A 4AVPA 4GGGA 1FP2A 5HDNA 5ED4A 2FA5A 4GCVA 5TJJA 5HLIA 5K5OA 4OMYA 1JHFA 2MH2A 2QQ9A 4L0ZB 2L02A 3MZYA 1W5SA 1KU9A 2EK5A 2ZBKA 3HSRA 1ZRCA 3T0YA 3M8EA 2FE3A 1OPCA 1LJ9A 3ZQ7A 4LK0F 2UWMA 2G7UA 1WSUA 4IJAA 1E2XA 2KIFA 3L2CA 4L9VA 2ZFWA 2Y48A 4U88A 3W6JB 1IAWA 3RI4A 3EQLF 2RQPA 2IA0A 4L5IA 1J2XA 3JSPA 2P6SA 2HKOA 1ZG3A 1BI3A 1BC8C 4KA4A 3T1BA 3IRQA 1BOAA 1OYYA 5DCFA 1KQ0A 2ADUA 3ZN0A 1QPMA 4ETSA 1BM9A 4RS8A 4KN4X 4GO1A 2Y75A 3KZZA 3CJNA 3JTHA 1MZBA 4UXNA 2JZYA 4F7ZA 3I71A 3ABTA 5J8CA 4KFCA 3TQNA 3HRTA 2P8TA 2RKHA 5HLHA 2WWYA 1XGSA 4K2EA 2VBZA 1R36A 4BHBA 1Z6TA 1U78A 3I64A 5E17F 2E7XA 3SQNA 1BN5A 4G6QA 1AWCA 2P7VB 1IZ1A 4ASNA 2B0LA 3CDHA 5L3CA 1LDJA 1ZH5A 3GXOA 4ZYHA 1UB9A 4I7HA 5D5VB 5FLXK 5H20A 3GUDA 4BYYA 2A3SA 3M8FA 1ZHFA 3MWMA 2PBIA 2BGCA 3ZN1A 1YTYA 5DYMA 3FMSA 3R61A 3HRSA 2VN2A 4EMSA 2QYOA 5F64A 5E8IA 3E5QA 4OMZA 4RB3C 3K1PA 2STTA 4A5MA 3R0AA 1MDMB 1J0RA 1SD5A 2EFNA 3JAMK 2RNJA 3IKVA 4A0XA 6PAXA 1TQIA 2ACJA 1YG2A 2E1CA 3MAJA 5HDGA 2OD5A 5BPIA 1KU7A 4EVIA 2FEZA 2V79A 1W4MA 2DI3A 3I0TA 4IHTA 2LF7A 3FXQA 1O57A 2IVMA 1R5GA 2BBYA 3WU0A 2NAZA 2X4HA 1XCVA 1MJAA 4Y17A 5LHGA 1UFMA 4G6DA 3KE2A 2Z5UA 2L54A 2DTRA 1IXRC 2PFBA 3K69A 3GZ5A 2ZMEB 4JQFA 2MC3A 2MA3A 2W57A 1KA8A 1HSJA 5FD5A 4KIBA 2GWRA 4ZZLA 3KCCA 1S7OA 3CTAA 4EJUA 4L9JA 1LEAA 4TV7A 2R7FA 1HBXG 3R0JA 1T6SA 1BI2A 2DT5A 2A68F 5LEKA 2WTEA 3GFLA 3HHGA 5L3BA 1H9TA 1F9NA 2F2EA 2P5LC 4R1HA 4PZJA 3CO6C 1DDNA 1YYVA 3M7GA 4LFUA 3U1DA 1OKRA 5J6XA 3DEUA 3D5LA 4LLGF 1WKMA 3KEQA 5J8FA 3NRVA 3WTZA 5BOXA 4E70A 1O7LA 1O3SA 1TQMA 2XROA 3O2PE 2BYVE 5CVJA 1R58A 2HFHA 4DQ2A 5ILSA 1KU2A 1OMIA 2W24A 4S05A 2DK5A 3VFZA 4IRIA 1ULYA 5DEQA 3I54A 3KP2A 1XMAA 3QU6A 2DLLA 4RB1A 2QBYA 2O0YA 4NHJA 3SFZA 2QBYB 3ZMSA 1SMTA 2NNYA 2EA2A 2J5PA 1LDDA 2QWWA 1Z9CA 2OBPA 3K2ZA 3C7JA 1O3QA 3WTSC 1Y0UA 2K4BA 3KP7A 2ZNYA 4HQEA 2CO5A 1U5TA 5LBQA 4CO8A 1SFUA 3GF2A 5BMZA 2HDCA 4HDVA 3G3ZA 2DK8A 3DFGA 2CQKA 3QRFF 4WXCA 5FFZA 3C3WA 1XGMA 2XVCA 1OYIA 2BE5F 1XD7A 2O3FA 1FY7A 2QVOA 1ZRFA 3WTXC 1SD4A 3O6BB 3I53A 3QOPA 3REOA 2DQRA 2XGXA 4EGYA 1BBYA 1G3WA 1G4DA 1P4AA 4A6DA 1SAXA 5BPDA 1V3FA 2YX7A 5L3EA 4HX7A 4I01A 2IA1A 5D5XB 4ZYGA 2GXGA 1Z7UA 3S2WA 2XAQA 5CVUA 3MEXA 3GFIA 3F6OA 4H0EA 4KN7X 4A0ZA 1REPC 5BQTA 3P9KA 4LMYA 5FFXA 1TTYA 4JK1X 3U2RA 3WTYC 1K7AA 2E1NA 1LEBA 4L9TA 2XUBA 4EJOA 1R00A 2JT1A 1IXSB 2CG4A 4CYDA 2COMA 2JPCA 4I02A 3BOQA 2OQGA 1WI9A 3FF5A 2AXLA 1R1TA 2F5CA 2HZTA 2DW4A 3EYIA 1H9GA 1FPQA 4GYGA 1LDKB 4G8XA 2FXAA 4WK8F 4M9XA 3WTWC 5LHIA 2O61A 2QQBA 2QLZA 4IRGA 2FQ3A 4WX9A 3PQJA 3RKWA 2O8XA 4RGRA 2PEXA 2Y0MA 5ICCA 4L9NA 3E6CC 4A6EA 4NB5A 2HS5A 4EGZA 5H6RA 5LGTA 5D4RA 2YR2A 1IN4A 1K6OA 4I2OA 4UV9A 4I09A 1FZPB 4L18B 3QPHA 4P96A 5H6QA 3F3XA 1KU3A 3C18A 3JTGA 2HYFA 3E97A 2ESNA 1XB4A 3LQQA 2VONA 4QLCU 1FBSA 2XAGA 3EYYA 1FYKA 2XKOA 3RYRA 2IP2A 2A5YB 3HYIA 5D8KB 4FHTA 4ENJA 4KIFA 2FBKA 5L3GA 4HF1A 1ZG5A 3ZPLA 1TNTA 2DPDA 3IKTA 3E3VA 2XV4S 3MZHA 1Z1DA 2F5FA 1USSA 3HTUA 3BJOA 5DD8A 3G73A 1ZGAA 2BEOA 4IF4A 5ICEA 3ROUA 3NQOA 1XDSA 5HDKA 1FP1D 2JTVA 3KP3A 3WGHA 2PMUA 1IRFA 1C0WA 1T2KA 4CZZA 4ESBA 4EJVA 3LAPA 3V4GA 1SFEA 1OR7A 2PG4A 3K1MA 3RPQA 2P5VA 5HS8A 2PMHA 3FX3A 2EV0A 2UXNA 3FZVA 4KICA 2J5OA 1AOYA 1ZARA 3QP5A 3LFKA 4RB2C 3I4PA 3KLOA 3OOPA 4RGXA 2P6TA 4A5NA 2OU2A 3BPVA 3E5UA 1Q1HA 3V7RA 5JFRA 4KNYA 3IRRA 1D3YA 2V1UA 3BWGA 4WF2A 4G7ZF 2A6EF 1IW7F 4HW0A 4DNCA 4ZH4F 1DP7P 3ULQB 1X3UA 2FBHA 4UV8A 1SFXA 5EEHA 3KEOA 2EA4A 4LB5A 1S8NA 4BH9A 3DV8A 3HSEA 2DO7A 3SXYA 4GYIA 3F22A 2KKOA 3N4MA 2H94A 2FBIA 1ZG1A 1SD7A 5JHUA 3HHHA 3BROA 3KP6A 3GLXA 3CUQC 3ZP5A 1Z05A 2FNPA 3H3ZA 1CF7B 4M9ZA 3MFKA 1WQ2A 2H09A 2CFXA 4Y15A 2G9WA 4I0AA 2K27A 2OZUA 3GVAA 1ZRDA 2A6HF 1D8JA 3LAJA 4Q4ZF 2IRFG 1KQ9A 1EH7A 2MD5A 1RZ4A 3GZ6A 2H6BA 2W25A 1T0FA 4Y13A 3ELKA 2FRHA 5LGUA 3BP8A 4HLXA 1B59A 4UVAA 3IHUA 1MDMA 2A61A 4OIRF 1MD0A 3B02A 4O5VA 5EEGA 2IPQX 4KYWA 2PJPA 2ZNZA 3IL2A 4RAZA 2YX4A 5A2QK 1TQPA 3HSFA 3VOEA 3BJAA 1ZREA 2QQAA 2EFWA 2L4MA 4U7DA 5K1YA 1FBUA 3PFIA 3F8MA 1S7AA 3FXRA 1FSHA 2E7WA 1R7JA 1GXQA 2W84A 1W7PB 2C6YA 1IN8A 3SZTA 2ZMEA 1NHAA 3QU3A 4WXHA 1RUNA 2ISZA 3F23A 5FLXZ 1STZA 4CGZA 1W5TA 3O3KA 1PUEE 2M45A 5FD6A 1HW2A 4HYEA 1QGPA 1QBJA 3N97A 1WRJA 3I5UA 2HQNA 3T8TA 4EM1A 4U0YA 2D45A 4M6YA 2FSWA 2W85A 2QZ8A 5IT9K 4IVNA 4LG0B 1FYMA 1A04A 4KIGA 1J75A 3J81K 4AWXB 4MHGA 4L5JA 1YLFA 3JAMZ 4LB6B 3ZMUA 3BZ6A 1PDNC 1L3LA 2Q0OA 2XIGA 4U0WA 1MJBA 4BNCA 1B4AA 4YG2F 2QM3A 3HRMA 2ZXJA 4HX4A 4CDGA 2V6CA 4D0PA 1SD6A 3R4KA 1IUYA 4O3MA 1XSVA 4P55A 3P7NA 1FSEA 1B1BA 3B73A 1O3TA 2EFQA 1EH8A 2OA4A 2XHKA 2PLYA 5HLGA 4P9UA 1USTA 2M1BA 4G7OF 2LKPA 3DKWA 1P4XA 5LHHA 5AIPA 1FNNA 4MGRA 2IA2A 3MQ0A 1KQ8A 2RC4A 2WV0A 5DCMB 4OOIA 3VEPA 3GW2A 4CXFA 4ZYEA 1IXCA 4RAYA 1IN6A 5E1WA 3V8LA 3GEZA 2ETHA 4G94A 2L3DA 2EV5A 4G9YA 4PDKA 3R60A 4HF0A 3V8KA 1GVJA 4HOBA 3WE3A 3J80K 3L09A 3I59A 4MTDA 4HZFA 1I1GA 4MEYF 3I59B 4HX8A 3DPTA 4RGUA 4CHUA 1LB2A 4S04A 2K7LA 1DPRA 4XLNF 4KMUX 1S3JA 2BV6A 2F5EA 5K5QA 2DAOA 2VC1A 4FX4A 5CLSA 1ZLKA 5ILVA 1KYZA 4MQ9F 2FNAA 1O3RA 4M6XA 2Z3YA 1YFHA 2RN7A 2AS5F 1H0MA 4O6JA 1XN7A 4N9IA 1HKTA 3FMQA 3TO9A 2P5KA 4M74A 1TW2A 4FT8A 2JRTA 4WCGA 1YW8A 1IN5A 3WTVC 1HKSA 2G7HA 4RGSA 5L3FA 3RYPA 1YO5C 5D4SA 3FM5A 4BHCA 2FMLA 4Z2YA 4KT5C 3BY6A 2YSRA 1T38A 2OAZA 3J80Z 1I27A 1G6NA 3HOTA 4LLNA 3COAC 1B6AA 3F8NA 3TOAA 5TRDA 5FGMA 5ILUA 2KIMA 4QWQA 3WTUC 3ZMZA 2O6GE 5LEJA 4R8HA 1TW3A 3ECOA 2QENA 2NS0A 4HF2A 3I58A 3L7WA 3J7AO 1I1SA 3K1NA 3ISPA 1RIOH 3LWFA 2X0LA 2HYGD 1G3TA 4ZYDA 4XBFA 5CVIA 3V8JA 2IT0A 4YFKF 3DPLC 2V9VA 1QNTA 1MJ9A 1BIBA 4EM2A 2Z9OA 5KK1A 4WWCA 5FB2A 2KRFA 4UHTA 1J59A 3F8BA 1ON1A 4KMFA 3IC7A 4MNUA 1BC7C 3SZPA 3K0LA 3CUOA 4MTEA 3RIRA 2L4AA 1G3YA 2STWA 1U8RA 5HS9A 3R6SA 3TDUC 2D1HA 5D6EA 2MLGA 4I0BA 2CW0F 3HIFA 2VT2A 1FT9A 2D1VA 4ZZDA 1K79A 2HR3A 1V4RA 5DD4A 2XAHA 2GAUA 1UCRA 2HQRA 2VOOA 2HOEA 2D2WA 3KP5A 4YIIA 2LF8A 2TDXA 3DP7A 5D8LB 1JE8A 4ESFA 4JBAA 3Q9SA 1FYLA 5E1XA 3QP6A 2K86A 1F1ZA 2ZKZA 1CGPA 1RUOA 1ODDA 4BQAA 2CGPA 5D6FA 1GXPA 4U0VA 4HV6A 4PGHA 4UVBA 3ABUA 5FO5A 2A07F 3HOSA 3VB2A 1B9NA 2IW5A 2JPBA 4ENMA 2HTJA 3FMRA 3Q9VA 3T8RA 2EJRA 4HV5A 2EFOA 2GZWA 4CICA 3LA7A 2KJCA 1J5YA 1WWXA 1UHWA 2HEOA 3VODA 4ENNA 2M30A 1RNLA 1YS6A 5LRSA 3E6DA 1TLHB 3TDZC 4PCQA 3IWZA 1P4WA 1U3EM 3CLOA 5E1ZB 3F72A 2Z33A 1LVAA 4LJZF 5LRRA 1YW9A 1S6LA 1R23A 1P92A 3HRUA 3DXJF 1T98A 1U2WA 4MEXF 1EV7A 1XMKA 4M71A 4B8XA 1PP8F 4N9HA 1XCBA 2MH9A 3GX4X 4EJTA 4HDUA 4RB0A 1BI1A 2R3SA 1QZYA 3L00A 3MCZA 2HTSA 1QO0D 5E20A 2GQQA 1CF7A 3HTSB 2CSOA 5HS7A 2DQLA 3GO5A 2VC0A 1XGOA 1ZN2A 2EWNA 4U7BA 3E5XA 2HGCA 2NYXA 5E8GA 4OIOF 3WTTC 3TGNA 2XKPA 2CWEA 3FXUA 3CUQA 4XSZF 1YS7A 4A2UA 3F6VA 5IT3A 3CUQB 4A0YA 2RVCA 4M73A 1P6RA 3HUGA 5D5WB 3WGGA 4LD5A 4UNOA 1F5TA 4UVCA 2UXXA 2MLKA 1I5ZA 2PQ8A 3F8FA 5HVQC 1J7KA 3F21A 3KP4A 4IRHA 4YFNF 1J9IA 3WODF 3D0SA 2GXBA 5JR3A 3V7SA 4XSXF 4EM0B 2OZ6A 1JHHA 2VE8A 4P5OA 3ZMVA 5ICGA 4HLYA 1U6GA 3GFJA 2LNBA 1XSXA 5DUKA 4I98B 4G7HF 2LDUA 2VOPA 4EQQA 5KVRA 3RTRA 3PQKA 2XRNA 2GIVA 1W7PA 1R5HA 4EJWA 4A12A 1SMYF 2QUFA 4ON0A 1PP7U 5CJ9A 5BS6A 1UHMA 1XDUA 4AD9A 1IF1A 2F5DA 4AIJA 3W6KB 3F8CA 4XLPF 2UZKA 4OIQF 4FX0A 2ELHA 3WG9A 2YU3A 4LGWA 4LG0A 1Z91A 4EV0A 3RDIA 4OIPF 4Q47A 2KIUA 2ZJ2A 5DV5A 3FM3A 5A2QZ 1HW5A 2VODA 1EH6A 2VBYA 3FHZA 2DPUA 4LK1F 3ZMTA 2ZO4A 4R79A 2O03A 2MBFA 1ONVA 1XSDA 3ECHA 5F6FA 5F1RA 1ZGJA 2GA2A 2FF4A 1S29A 1YQAA 3KETA 1BI0A 2ESHA 3KFWX 3WU1B 2NNNA 5HOOA 1DUXC 4XRFA 4Q5SF 1DPUA 2YPRA 2WC2A 2P4WA 1HSTA 4IXAA 3EDPA 3RKYA 1HQCA 3TO7A 3SHFA 5DCMA 2EB7A 2KJBA 2RGVA 1B9MA 2HWVA 5AONA 3Q5FA 4M9SA 2JSCA 1FC3A 1R1UA 3BJ6A 1LQ1A 1ZLJA 3E6MA 1E17A 1QZZA 2XASA 1JGSA 1ZYRF 2VBWA 3IWFA 4WXDA 5IT9Z 1ZAOA 3GWZA 3ERED 5DUIA 4AIKA 1TNSA 1KYWA 3V7CA 3J81Z 3TKYA 3BDDA 2Q2EA 3BPXA 5K5RA 3JW4A 3RJPA 1HW1A 3EUHA 3T5XA 5CYVA 3LQRA 3M9AA 1KGSA 3H3UA 4NQWA 3KZYA 5L3DA 1U5TC 4ENKA 2VBXA 3QPTA 4GXOA 4HA8A 2P7CB 2PI0A 1LNWA
chains in the Genus database with same CATH superfamily
3RKXA 1K78A 1IDYA 5CVRA 3E6BA 2H6CA 1FWZA 2DFIA 3I3LA 1YIOA 1K78B 2HKXA 1FX7A 3OV8A 3SDBA 3DF8A 3CMMA 3KLNA 2ZCWA 1U5TB 5TGTA 4B44A 2HDDA 4Y52J 1P2FA 1T95A 1Y1VJ 3CF2A 4E7KA 2MFZA 3PFYA 1MKMA 2FOKA 1D1CA 4B09A 2XAJA 2CYYA 1D8KA 4PSWA 1WHUA 1HKQA 2DMQA 3OIPA 1Z0XA 1IRGA 1YW7A 1R1VA 2RDPA 5E18F 5CVVA 4PGGA 3GTJJ 3GTPJ 1BW5A 1FLIA 4IPAA 5JI6A 5LLQA 1RR7A 3PO2J 2IJLA 2LSOA 2I5UA 1IN7A 3H36A 4HAMA 2ID6A 3NWSA 3M3YJ 1VQ5I 4YFXF 3LL7A 3ML6A 2RV8A 3GTOJ 3M1EA 3HPHA 3FXJA 3OY9A 2FUG2 2R7DA 4IKFA 2FJ1A 4BAYA 3TOBA 1RI7A 1FOKA 2VI6A 4P9FA 1ETVA 4CA0A 3CO7C 3B6CA 3CCQI 2KISA 4HSRA 3S8PA 3P5JA 5FKOA 3OYNA 3P9CA 1MNMC 2VQHA 1VI0A 1WJDA 1G3SA 1R22A 2OPTA 4PSXA 2K4JA 4QPQA 2GA1A 2V1XA 3DQVC 4ABZA 5GADJ 2OTLI 4UUVA 3NEUA 1HDDC 3BR1A 4A3FJ 3CCMI 3JR9A 2LY1A 1TBXA 4OU0A 4BBSJ 4L0YB 2FMYA 3M1CA 4HBLA 2DU9A 3EETA 5D5UB 3JRIA 4ZYAA 2LKXA 1N25A 4MQVA 3DBRB 2ZB9A 1BIAA 3KYCB 5HNFA 2GBYA 2X48A 3ZQLA 2Z99A 1W5CC 5IP7J 5ICFA 3FWEA 3ZMDA 1GV2A 1I39A 5AIQA 2OQRA 3WE2A 3LSJA 4RLQA 2Q8KA 3ZQIA 1U8BA 1W7PD 2EBIA 4CH7A 1W36D 3C1DA 1OQYA 5J40A 1VTNC 1FBQA 2M8EA 2V1DA 3D5RC 4Q48A 3S14J 4LG3A 4BHPA 3MD2A 2BY0A 4BXUA 2LG4A 2BXYA 4UUSA 2M87A 2VXZA 1T39A 1BJAA 2BVLA 3IAM2 3LA2A 3GFMA 4F91B 2H27A 2IS1A 2XAFA 2QF7A 1D5VA 4YELA 1OCOH 2NOJB 4YIFA 4KDPA 3KYDB 3TO6A 3K4BA 4C3JJ 2Y0SN 3LSTA 1ON2A 3OIOA 1VQKI 2M7AA 4IQJA 4LLLA 4KUMA 3A0BC 3H92A 3QAHA 2M9HA 3HG9A 4A3LJ 1FMVA 2ISYA 3JSOA 3HOXJ 1ITYA 1P9QC 2L01A 2KZVA 2DBBA 3U9GA 2F4MB 3G6EI 4A3MJ 1JXSA 1MGTA 4RAGA 2Q1ZB 4BY7J 2X6YA 2H8RA 3UR3C 3MKYB 4HQMA 4AVZA 4M72A 1R6RA 3GYHX 3K9TA 1MH3A 3OYGA 5LGNA 5GAEJ 3G71I 3OYJA 2VE9A 4BQQA 2LREA 1XGNA 2NRAC 1UMQA 2LYCA 2EFPA 1LFPA 2A69F 5EF6A 1F4KA 3HBLA 2R7UA 1EJ9A 5DDGA 2DA3A 1L0OC 4N0BA 3H5AA 3L9FA 3WGIA 1I6XA 1Z6RA 4AIHA 1O7FA 4OINF 2E5ZA 4PK4A 3RPUA 2Z16A 2WB1A 2X6OA 2MGQA 4ESJA 2R5ZB 3BTIA 1KZHA 1QQIA 1GHCA 5JHFA 2EH3A 2UV1A 4XQFA 2M5WA 2QEXI 1HXDA 1OYWA 3K4NA 3P9IA 3D1NI 2EIKH 2MC4A 1A35A 2JK3A 2VT3A 3K70C 4IHSA 2R7XA 2FU4A 2F5VA 2PN6A 5JVTA 2K02A 3LA3A 3Q0WA 3AAFA 1YX3A 5ERIA 2EV6A 1MBJA 4AVPA 1TWAJ 3LMMA 4GGGA 1FP2A 2BHZA 2LK2A 2FA5A 4GCVA 5HDNA 5ED4A 5DS9A 3LOCA 5TJJA 1VFCA 2KT0A 2XRLA 1RR8C 4BJ6C 1OR7C 5HLIA 4Y4RA 5K5OA 3FIWA 2L7ZA 4OMYA 4YEJA 1JHFA 2MH2A 1AA7A 3H3VK 2QQ9A 4L0ZB 1UAAA 3K4KA 4D1QA 2L02A 3MZYA 4FE7A 1W5SA 2LMDA 1KU9A 2EK5A 2X51A 2ZBKA 3HSRA 3AG4H 3S93A 3T0YA 3M8EA 2FE3A 4DBRA 1YRNB 1ZRCA 1OPCA 3GBGA 4D7MA 1I3QJ 1LJ9A 3ZQ7A 1QVTA 4LK0F 4BBRJ 1EKEA 1JKPC 2E34A 2UWMA 5IOZA 4XN3A 2G7UA 2HDWA 1WSUA 4IJAA 4KISA 3JCUC 1E2XA 2KIFA 3K2AA 3L2CA 4L9VA 4FQGA 2ZFWA 5IP6A 2Y48A 4U88A 3W2AA 2XAUA 3W6JB 1WPKA 1FOWA 2X1EA 2Y30A 1IAWA 2E71A 4XKCA 2ZJPF 4UB8C 2IS6A 4RLFA 3RI4A 2A6TA 3EQLF 2RQPA 2IA0A 4L5IA 1SVLA 1J2XA 4J19A 4M3GA 3JSPA 1WH5A 2P6SA 3H5RA 2HKOA 1ZG3A 4IHWA 4DIQA 1VQ7I 3CD6I 1BI3A 4XONA 1BC8C 1U0JA 4KA4A 2ECBA 2V4JC 3T1BA 3IRQA 2B63J 4IL6C 4HNTA 1BOAA 1OYYA 5DCFA 1E3HA 1KQ0A 3S3NA 2LC2A 2ADUA 3OYDA 3ZN0A 2IAIA 2EQRA 4B43A 1G2HA 3OYIA 1QPMA 2BW3A 4ETSA 4HSTA 1BM9A 4RS8A 3HGYA 4KN4X 4GO1A 2Y75A 3KZZA 4B48A 3CJNA 1JI8A 3JTHA 3K4LA 1MZBA 4UXNA 2K9SA 2JZYA 4F7ZA 3LSGA 2WV1A 3I71A 3ABTA 5J8CA 3ZQCA 2V1NA 3TQNA 3Q3SA 4KFCA 4JX5A 3K6GA 5E3LA 3HRTA 2P8TA 1NK3P 2KLOA 3CJRB 2HPIA 2E5NA 3GLLA 3CC7I 1NTCA 2RKHA 5HLHA 1G8XA 2WWYA 1XGSA 4K2EA 2VBZA 1R36A 4BHBA 1Z6TA 1U78A 3I64A 4L5EA 5E17F 2E7XA 4AU7A 3SQNA 2QA4I 4HPQA 1R49A 1JJ8C 3ASOH 2AXTC 1BN5A 3HJEA 3GZNB 3IH2A 1WVRA 2DMTA 3FKIJ 2E36A 4FETA 4G6QA 2NVUB 5GP9A 3HOVJ 1TZLA 2DJNA 3CC2I 3S15J 1AWCA 2W4SA 1LFUP 2P7VB 3S32A 1IZ1A 1BJZA 2DXIA 2DA4A 4E4HA 1OLTA 3G4SI 4XRMA 1JTXA 4ASNA 2B0LA 2IS2A 2WB1N 3CDHA 1O4XA 1RKTA 5L3CA 1LDJA 1ZH5A 1T0FC 1OJLA 3GXOA 2BY2A 4ZYHA 1UB9A 3KPHA 2R7OA 4BJ5C 3PIPF 3PNYA 5J1UA 4I7HA 5D5VB 5FLXK 3FXMA 5H20A 3GUDA 4BYYA 2A3SA 3M8FA 1ZHFA 3MWMA 2PBIA 4HNUA 2BGCA 4BXFA 4B1RA 4X1EA 3ZN1A 1YTYA 5DYMA 3FMSA 3R61A 3HRSA 2VN2A 3LSPA 4EMSA 2QYOA 5F64A 5E8IA 3S1RJ 3OWTA 2O5RA 3E5QA 4OMZA 4RB3C 3HL2A 3PUBA 3BG6A 1N77A 1I50J 3K1PA 2STTA 4BE2A 2HZDA 2QQ8A 5FLVA 4F55A 4A5MA 3R0AA 4XLCA 1MDMB 2K5CA 2OJED 2LY2A 4XOPA 1J0RA 1SD5A 2EFNA 2HNHA 3JAMK 2DN0A 2RNJA 3IKVA 3A0HC 4A0XA 6PAXA 3A2KA 1TQIA 3MKLA 2LVSA 1ZR4A 2ACJA 4XORA 2E2IJ 1YG2A 2XPVA 2E1CA 3MAJA 4XKBA 4CCJA 1WFXA 5B5EC 1JKRC 5HDGA 2DYSH 2COBA 2OD5A 5F0HA 3CCEI 4B4CA 2VXDA 3DLAA 5BPIA 1H89C 1KU7A 4U87A 4EVIA 1GLNA 2FEZA 2V79A 2VQCA 2JJ7A 1DQUA 1W4MA 2DI3A 3I0TA 3JRAA 4IHTA 2LF7A 4BDYA 3FXQA 3HEFA 1O57A 5M5WJ 5FRNA 3F0CA 5H2FC 5CKTA 2I10A 2IVMA 2HI3A 1R5GA 2BBYA 2ZMEC 3WU0A 2NAZA 2K9NA 2X4HA 3CP2A 3QQAA 1XCVA 4HG2A 1MJAA 4Y17A 5LHGA 1UFMA 2GM4A 3LFUA 4G6DA 3KE2A 3GTKJ 2Z5UA 2L54A 2DTRA 1IUFA 4XOTA 1IXRC 2PFBA 2XF6A 3K69A 2CS3A 3CESA 3GZ5A 3RPUD 2ZMEB 4JQFA 4KT6A 1E3OC 3TEDA 3W2WA 5HLTA 2MC3A 2MA3A 4CCLA 3FHNA 2W57A 1QZEA 1VZ0A 1KA8A 1HSJA 5FD5A 4KIBA 2GWRA 1I6HJ 1BW6A 3TW7A 4B47A 4ZZLA 2CQXA 3CJTB 2CH0A 3KCCA 1K83J 1S7OA 2CMPA 2EPFA 2QKLB 3CTAA 1Y56A 1X2NA 4EJUA 2JA8J 4HEA2 4L9JA 2CV1A 1ETYA 1OFCX 2HOSA 1LEAA 4TV7A 2R7FA 1HBXG 3R0JA 4YRVA 4C2UA 1T6SA 1BI2A 4E7ZA 3K70D 2DT5A 2A68F 3EUAA 3PNVA 5LEKA 5GAGJ 2UUZA 2WTEA 3K4MA 3GFLA 3CMAI 3HHGA 5L3BA 1H9TA 2HXOA 1F9NA 1X3ZB 2F2EA 1VQ6I 2OTJI 2P5LC 4R1HA 1D1BA 4PZJA 2EIJH 3FKJA 2LKSA 3CO6C 5F1JA 1MIJA 1YYVA 4BUPA 4A3IJ 3M7GA 1DDNA 3GTMJ 4LFUA 1LVKA 3U1DA 1TP4A 1PJRA 1OKRA 5J6XA 2B9SA 3KYLA 3DEUA 2VKHA 3D5LA 1ETQA 4BKXA 2E60A 4LLGF 2CW7A 4F92B 1QPIA 1WKMA 2X1CA 4DW6A 3KEQA 5J8FA 2JSPA 3NRVA 3WTZA 4YIRX 3H9GA 5BOXA 3LSIA 4E70A 2QCOA 4CCNA 1HCRA 2GOXB 2WY7Q 3DTIA 1O7LA 3SYTA 2K3PA 1O3SA 3W6VA 1D1AA 5E79C 1B8IB 1TQMA 2XROA 3WHCA 4GFBA 3O2PE 2BYVE 5CVJA 1J09A 3OYLA 1YJNI 4AC0A 1R58A 2JUCA 4JX4A 2HFHA 2V9PA 3CCUI 1XPXA 1S7EA 1ETKA 4DQ2A 3OYMA 5ILSA 1KU2A 1OMIA 1TT5B 2W24A 3QWLA 4LOCA 4S05A 2DK5A 5K7ZA 3VFZA 4IRIA 1ULYA 3OL3A 1YJWI 3QYEA 1JTYA 5KCMA 5DEQA 3I54A 3KP2A 5JLWA 4BQNA 1XMAA 3QU6A 2DLLA 1P7JA 4RB1A 2QBYA 3I4MJ 1ORKA 1MNEA 2O0YA 4NHJA 3MKZA 1MMSA 2L0KA 4XICA 3PJRA 3SFZA 4QSHA 2CQQA 2QBYB 2V6EA 3ZQFA 3ZMSA 4G12A 1SMTA 3OYEA 2NNYA 2EA2A 3SEZA 5CPRB 2IBDA 2J5PA 3EUKL 1LDDA 2QWWA 2BY1A 2CUZA 1Z9CA 1ZK8A 2OBPA 3I9V2 1NH3A 3DU5A 3K2ZA 3C7JA 5B3SH 1O3QA 3OYHA 3WTSC 1Y0UA 3KX2A 2K4BA 3KP7A 3HPGA 2ZNYA 3PUFA 2CO5A 4PJNA 4HQEA 1U5TA 5LBQA 4CO8A 5EEAA 3CCLI 1SFUA 3GF2A 5BMZA 2HDCA 4HDVA 1F36A 3G3ZA 2DK8A 1D0ZA 2R7VA 1W0TA 3DFGA 2CQKA 3QRFF 4WXCA 5FFZA 1K4SA 3G1OA 3C3WA 5CQEA 1UELB 2A05A 1XGMA 2XVCA 3K7AJ 1OYIA 2BE5F 1XD7A 4Y33A 3ZQGA 4NNJA 3DBLB 4D5CA 2O3FA 1FY7A 1VQ4I 2QVOA 1ZRFA 3WTXC 2VKDA 1PVEA 3G2BA 1SD4A 3O6BB 3I53A 3QOPA 3VPRA 3REOA 2DQRA 2XGDA 2XGXA 5EGOB 1BR2A 4EGYA 1BBYA 2NVTJ 2NS7A 5EZGA 1G3WA 1G4DA 1P4AA 4A6DA 1SAXA 5BPDA 1V3FA 2YX7A 5L3EA 2RQQA 4I01A 4HX7A 3W3CA 5GPCA 2IA1A 4S0HB 4RAFA 5D5XB 3BR5A 4ZYGA 2GXGA 2WAQA 4F52A 3CJQB 3BG9A 1VNDA 1Z7UA 3IP4B 3S2WA 2XAQA 4BJTA 5CVUA 3MEXA 3GFIA 4H4KC 3F6OA 3RKQA 1K6YA 4KN7X 4A0ZA 4H0EA 2LBFA 1REPC 2DFFA 4JX6A 5BQTA 3P9KA 4LMYA 5FFXA 2IS4A 1TTYA 2AQFA 1V54H 4JK1X 2LBFB 3U2RA 1AU7A 3PO3J 4CYCB 2BXZA 1A6QA 3WTYC 1K7AA 1ZELA 2E1NA 1LEBA 5C4XJ 4XRSA 3QOEA 3S3OA 4L9TA 2XUBA 4EJOA 4NBQA 2OCCH 1R00A 2JT1A 1IXSB 3BCBA 4UUTA 2CG4A 4CYDA 3HZJA 2COMA 2JPCA 4I02A 4M3DA 3BOQA 2OQGA 1YOVB 3GTLJ 4C30A 3S2DJ 1ZGWA 1WI9A 3FF5A 2G0EA 2KP6A 4OAYA 1SFKA 2AXLA 4C2MJ 1R1TA 2LLKA 2F5CA 2HZTA 2DW4A 3EYIA 1H9GA 1RPWA 3LNQA 1TWFJ 1QVUA 1FPQA 3LSRA 2O9LA 4GYGA 1LDKB 4OWRB 2VB6A 2FXAA 4G8XA 4WK8F 4RBOA 4M9XA 4CUGA 5LHIA 3WTWC 3I55I 2QQBA 4C2TA 2O61A 2QLZA 1FTZA 3NWTA 2Y9ZA 4IRGA 2FQ3A 2JRMA 1Z3YA 4WX9A 5FKLA 3PQJA 4XLEA 3RKWA 3QPLA 3HOZJ 2O8XA 4RGRA 3DCFA 2PEXA 2Y0MA 3DTKA 5ICCA 4L9NA 2DCEA 2IGKA 3E6CC 4A6EA 2OC6A 1UZCA 4NB5A 3JREA 2HS5A 2X6WA 4EGZA 5H6RA 5LGTA 3MVPA 2YR2A 5D4RA 2O7OA 1T8IA 2AQEA 4JP0A 3AG2H 1IN4A 2CJJA 4BACA 4CCKA 1K6OA 4I2OA 4UV9A 2AO9A 2Y31A 4IHYA 4I09A 1ETWA 1Y0NA 1FZPB 2NVXJ 3H5NA 4L18B 2LY9A 3QPHA 1LKXA 4P96A 5H6QA 3IUOA 4F3QA 3F3XA 4B3AA 2A5WA 2KMUA 1KU3A 3ZCOA 2ZXHA 3C18A 3JTGA 2HYFA 3E97A 2ESNA 1XB4A 3LQQA 2VONA 3O8GA 4QLCU 1FBSA 2XAGA 3GMEA 1D5YA 2M8GX 3EYYA 2XKOA 1FYKA 5M5YJ 3RYRA 2BOLA 2WY8Q 3CLQA 2IP2A 3EPZA 2A5YB 4BY1J 2DTZA 2ID3A 3HYIA 5M3MJ 5D8KB 1ETXA 4E7SA 4BXXJ 2R5ZA 4FHTA 4ENJA 4KIFA 2FBKA 2H1LA 2WADA 5L3GA 4HF1A 3V42A 2VJ4A 1MBGA 1ZG5A 1X1AA 4PJ0C 2ICWG 3ZPLA 1TNTA 4BU2A 1WGXA 2DA7A 2JN6A 2DPDA 3IKTA 3E3VA 1Z21A 2XV4S 2Y2ZA 1JKOC 3E1SA 3MZHA 1Z1DA 2W7NA 2F5FA 3WHBA 2EIMH 1N75A 1VQMI 1MNDA 1USSA 3HTUA 1XTAA 3BJOA 5DD8A 3G73A 1ZGAA 2BEOA 3VYUB 2D5VA 4IF4A 5ICEA 3ROUA 3NQOA 3HOUJ 1XDSA 2VKVA 1E0EA 1MMGA 5HDKA 5IYDJ 2LRDA 1FP1D 2JTVA 3KP3A 3M07A 1JJ6C 4DZJA 1QHGA 3WGHA 1DGWY 3ESWB 2PMUA 5E3OA 1G59A 1IRFA 1Y8QB 2WAQN 1C0WA 1T2KA 4CZZA 4ESBA 1YRNA 2RREA 1IRZA 4EJVA 3LAPA 4GDFA 2M4GA 2BHYA 3A01B 3V4GA 1SFEA 2XDVA 1OR7A 2GIZA 2PG4A 2CU7A 2CUEA 2P5VA 3K1MA 3RPQA 2PMHA 5HS8A 2ELJA 3U1KA 3PSIA 3FX3A 2DJIA 3AFHA 3LSHA 3BR0A 2EV0A 4ZDOA 1T56A 2UXNA 4DJAA 3FZVA 4KICA 2J5OA 1AOYA 1ZARA 3QP5A 2XB5A 5LD2C 4W1UA 1POGA 3LFKA 1YHQI 5IY5H 2E2HJ 4RA2A 4RB2C 1A6IA 3I4PA 3DLLF 2EZLA 3KLOA 3OS0A 3OOPA 4RGXA 3UNGC 2P6TA 4A5NA 4XNFA 4XLFA 2OU2A 4X0GA 2R5YB 1OCPA 3BPVA 3E5UA 4E6KG 2XPWA 4I6ZA 1Q1HA 3KEYA 1BR1A 3V7RA 5JFRA 4N4OB 3SZGA 4KNYA 3IRRA 1D3YA 1CQTA 2V1UA 3BWGA 4WF2A 4LITA 3W2VA 4JYKA 3PIOF 4G7ZF 2M0MA 2A6EF 1IW7F 3ABLH 2O8KA 3HM5A 4HW0A 4DNCA 4ZH4F 1DP7P 3ULQB 1X3UA 3BR2A 1DP3A 2FBHA 4ZDPA 4UV8A 3HOYJ 1SFXA 5EEHA 3ZGKA 3KEOA 2EA4A 3U21A 4LB5A 1S8NA 1ZTRA 4BH9A 3DV8A 2W82A 2DO7A 3HSEA 1GT0C 3SXYA 1F43A 1DGRM 4GYIA 3F22A 2KKOA 2H94A 1MMNA 3X2QH 3N4MA 1EA3A 2FBIA 1ZG1A 2DODA 2WAFA 4QTRA 2HVRA 1SD7A 3RZDJ 4F93B 3J7AY 3ONQA 5JHUA 3HHHA 2DA5A 4BL0B 3BROA 3KP6A 1YI2I 3GLXA 4BGDA 3CUQC 3ZP5A 1VQLI 1Z05A 2FNPA 3H3ZA 1CF7B 3CZ6A 3OR1C 5B1BH 2ZJQF 1I3AA 4M9ZA 4XK4A 3MFKA 4AM3A 4HRIA 1WQ2A 1Z3XA 5J4YA 2MD0A 2H09A 2CFXA 4Y15A 2G9WA 3OYKA 4I0AA 2K27A 1OCZH 2OZUA 3GVAA 4B3XA 5FJ8J 1ZRDA 2A6HF 1D8JA 3LAJA 1WH7A 4Q4ZF 2IRFG 3K4JA 5J4VA 4A3JJ 1KQ9A 1EH7A 2MD5A 5EDNA 1RZ4A 3GCMA 3GZ6A 3HUGB 1PYVA 2H6BA 2GXAA 3DWLE 2W25A 1T0FA 4Y13A 2F6CA 3CCYA 3WU2C 2PJRA 3ELKA 2FRHA 5LGUA 1ENHA 3BP8A 2PJRB 2LTPA 1EF4A 1ZQ3P 4HLXA 1B59A 4UVAA 2L9RA 2F4OB 3VSKA 3H0DA 1X19A 1IDZA 3IHUA 1FIAA 1MDMA 2A61A 2DDAA 4OIRF 1MD0A 3B02A 2L9NA 4O5VA 5EEGA 3G1LA 2IPQX 4KYWA 2PJPA 2R92J 2ZNZA 3IL2A 4RAZA 2HOTA 2YX4A 5A2QK 2VPLA 2R93J 1TQPA 3HSFA 4M3EA 3VOEA 3BJAA 1ZREA 1XMXA 3OOUA 4A3EJ 2QQAA 3MN2A 3O8HA 5IOYA 2M4KA 2EFWA 2EZHA 2L4MA 3BZKA 5IPAA 4U7DA 2HQAA 2FOWA 3ZOBA 5K1YA 2R7SA 1FBUA 3FDYA 3PFIA 4IHXA 3F8MA 1S7AA 2HYJA 3M8JA 3FXRA 1FSHA 2HU9A 2E7WA 1N78A 1R7JA 3RCOA 2EZIA 4A69C 3HB9A 1GXQA 2CQ7A 2L7KA 5FKKA 2X9DA 2W84A 4DOZA 3PL8A 1QHHD 1RRJA 2DOAA 1W7PB 3S1NJ 1HA8A 2C6YA 1HOMA 1MBFA 3BR6A 1IN8A 3SZTA 2ZMEA 1NHAA 3QU3A 4WXHA 1RUNA 2ISZA 3F23A 5FLXZ 1STZA 2F4IA 4CGZA 1W5TA 3O3KA 4DZPA 3CC4I 1BL0A 5KAIC 1PUEE 2M45A 5FD6A 4NDLA 1HW2A 4HYEA 1QGPA 5F04A 1QBJA 1XG1A 3N97A 1WRJA 3K10A 3RQIA 3AKZA 1TT0A 2HQNA 3I5UA 2WA0A 4IEJA 3T8TA 4EM1A 4U0YA 2D45A 4M6YA 2FSWA 2W85A 4E7LA 4M3BA 4PFPA 2QZ8A 5IT9K 2L7FP 4ZDLA 4C9YA 4IVNA 1VQ9I 4M3FA 2JUGA 1MH4A 4LG0B 4E7JA 1FYMA 2QSFX 1A04A 4KIGA 1HC8A 1J75A 4FASD 3J81K 5IYBJ 4AYBA 2R7RA 3B6AA 4MHGA 4L5JA 4AWXB 2JA7J 1YLFA 3JAMZ 2JQ7A 4LB6B 1WJEA 2MYSA 3ZMUA 3BZ6A 4GRIA 3GTQJ 5M3FJ 2LR8A 1PDNC 1L3LA 2Q0OA 2XIGA 1XX5A 1B72B 1WI3A 4RM3A 3FXKA 2LOOA 4FCYA 4U0WA 1HF0A 4X6AJ 1MJBA 2N8GA 4BNCA 1B4AA 4YG2F 2QM3A 2EILH 3HRMA 2ZXJA 4HX4A 1LUJB 4CDGA 3BG7A 5FKMA 1YX5A 2V6CA 4D0PA 1SD6A 2CV2A 1LFBA 3R4KA 5C4JJ 1IUYA 1WCMJ 1NK2P 2K85A 3SFIA 4O3MA 3JRCA 1XSVA 4P55A 3P7NA 1FSEA 1B1BA 3B73A 1O3TA 2EFQA 3CP8A 3L2UA 1VF9A 1NG7A 4KJZA 4ZTFA 1B8IA 1WJFA 1EH8A 2OA4A 3CQZJ 2XHKA 1AHDP 2PLYA 4P9UA 1USTA 2M1BA 5HLGA 2HPMA 4LIUA 4G7OF 2KZGA 3UKGA 2LKPA 1NG6A 2HOAA 5IYCJ 3DKWA 3RZOJ 1MBKA 1ZKGA 1P4XA 5LHHA 1Z7LA 5AIPA 2JA2A 2CW8A 1FNNA 2H1KA 3S16J 4MGRA 2IA2A 3MQ0A 2NS8A 1QA6A 2JVGA 1YITI 1KQ8A 2RC4A 4QIWN 2WV0A 5DCMB 4OOIA 3VEPA 3GW2A 4CXFA 3F9KA 2XB0X 4ZYEA 3E7LA 1IXCA 4RAYA 1IN6A 5E1WA 3V8LA 1WJ5A 2WAEA 3GEZA 4DBQA 1K4TA 3HGGA 4XMYA 1DU6A 2ETHA 1WJCA 2PMZA 1MSEC 4G94A 1IRXA 2M34A 2L3DA 3OYCA 2EV5A 4G9YA 4PDKA 3R60A 2LH9A 4HF0A 3V8KA 1ZR2A 1GVJA 5EG0A 3EUHC 4HOBA 2M2EA 3WE3A 3J80K 3JRFA 1S5LC 1SVMA 3L09A 2VQGA 4II3A 3I59A 5EG0B 4MTDA 4HZFA 4A3BJ 1I1GA 2I8DA 4MEYF 1X4OA 3L2RA 3I59B 4HX8A 2BY3A 2ECCA 3DPTA 4RGUA 4CHUA 1LB2A 1X58A 1Y39A 1MW7A 2DFHA 4S04A 1VQPI 1RETA 2K7LA 5FROA 1DPRA 5FRMA 3BG3A 3ZRGA 4XLNF 2Q2EB 4KMUX 1S3JA 2HVQA 1MBHA 2BV6A 2F5EA 2KPMA 3DPUA 1WZ2A 5B1AH 2YU9J 5K5QA 2DAOA 2VC1A 3QPSA 4I99C 1RC9A 4XN0A 4FX4A 5CLSA 2ZXWH 3A03A 4NQWB 1ZLKA 1UG2A 5ILVA 1KYZA 4E7IA 4HNVA 4EATA 4MQ9F 2FNAA 3KZIC 1O3RA 2OF7A 2HQ5A 4M6XA 5EGOA 2Z3YA 4PFOA 1YFHA 4A3GJ 2RN7A 1S9HA 5FLMJ 2AS5F 1H0MA 4O6JA 4PJMA 1XN7A 4N9IA 2L9SA 1A5JA 1HKTA 1TWGJ 3FMQA 3TO9A 2IGOA 2P5KA 4M74A 5FKNA 2YS9A 1TW2A 2JA6J 4FT8A 2JRTA 2X1DA 4WCGA 1YW8A 3BR3A 1IN5A 1FMWA 5J47A 3WTVC 3LSKA 2VLAA 1HKSA 2EINH 1GVDA 4D7NA 2VL8A 2G7HA 2K3FA 4RGSA 1GV5A 2KFDA 2DOFA 2Y69H 3OS1A 4ZJZA 1YIJI 5L3FA 1V5FA 3RYPA 1YO5C 1U9OA 5D4SA 3FM5A 3HDDA 2DYRH 2K9LA 4AYBN 4CYCA 4J01A 3NARA 4BHCA 1AKHA 3CMYA 2CUJA 3SDGA 4PJLA 2ME6A 3OL4A 3H35A 2KQRA 2FMLA 1SEUA 4Z2YA 1MMAA 4KT5C 3BY6A 1HLVA 1AKHB 2QSHX 2DA1A 2YSRA 1T38A 2OAZA 3J80Z 2ZJRF 1I27A 1IV6A 1G6NA 1SVOA 1UHSA 3HOTA 4LLNA 2TRTA 5GAHJ 3COAC 2VJJA 2KIQA 1R4MB 1B6AA 2W48A 3F8NA 3TOAA 1LE8A 1RKWA 5TRDA 3C2HA 3DU6A 5FGMA 5ILUA 4KITB 2KIMA 4QWQA 3WTUC 3ZMZA 2O6GE 1MSFC 3BQZA 1LE8B 5LEJA 2OV7A 4R8HA 1TW3A 2XF5A 2VJ5A 5EZHA 3ECOA 3FXLA 3HOWJ 2QENA 2NS0A 2W00A 4HF2A 1QU3A 3I58A 3L7WA 3J7AO 2CQNA 1I1SA 5F0FA 3FBIB 3K1NA 2VASA 3ISPA 3BCAA 1RIOH 3LWFA 4RMNA 2X0LA 1X4PA 1V55H 2HYGD 3I4NJ 3C2BA 1G3TA 4ZYDA 4XBFA 3JRHA 3H9QA 5CVIA 2M7BA 3L2QA 1MMDA 3CCVI 3E0JB 1X1CA 3VYSB 3V8JA 2IT0A 4YFKF 3DPLC 2V9VA 3J7YJ 1X1BA 1QNTA 1MJ9A 2L9VA 2AHQA 3TL4X 1BIBA 4EM2A 2Z9OA 5KK1A 1JGGA 2X6XA 1ACIA 4WWCA 3OR2C 1MBEA 1V5EA 3S2HJ 5FB2A 1Y6IA 2KRFA 4UHTA 1J59A 3F8BA 1FEXA 4XR6A 1ON1A 4A3CJ 1R9TJ 3OMYA 2VJIA 4KMFA 1UG0A 3IC7A 5J3LA 4MNUA 2Y9YA 4UUSB 1JKQC 1BC7C 3QYFA 2VPRA 3SZPA 2PMZN 3K0LA 2LFBA 2X85A 3CUOA 3OIQA 2VIXA 2LD5A 4I76A 4MTEA 3RIRA 2L4AA 3VSLA 3S17J 3SEQA 4ITVA 1G3YA 3G1MA 4BE1A 3FK7A 4IQ4A 2STWA 3IV5A 3ABKH 1U8RA 3CDLA 5HS9A 3R6SA 5LFAA 3TDUC 5CQGA 2D1HA 5D6EA 2MLGA 3DEEA 4I0BA 4NUBA 2CW0F 3HIFA 2B7EA 2VT2A 1FT9A 2D1VA 4ZZDA 2JVHA 1XS9A 1K79A 3MKWB 4MFEA 2HR3A 1LPQA 2MW8A 1V4RA 5DD4A 3TP3A 2Z1DA 1W1WE 2XAHA 4V2GA 3HC7A 4V2FA 2GAUA 1UCRA 2HQRA 3CCRI 2VOOA 1U9NA 2HOEA 2D2WA 3KP5A 2ELKA 4YIIA 2LF8A 2TDXA 3DP7A 5D8LB 2MG4A 1JE8A 4ESFA 2ZC2A 2XGEA 3S1MJ 9ANTA 2RNGA 4JBAA 2E1MC 2HVSA 1V5GA 3Q9SA 1FYLA 5TISC 5E1XA 3QP6A 1BA5A 2K86A 1JT0A 1F1ZA 2ZKZA 1ETOA 3PNTA 1CGPA 1RUOA 3MZ8A 1ODDA 3BT9A 2R0QC 4BQAA 1Q1VA 2CGPA 5D6FA 4MFDA 1GXPA 4U0VA 3ZR8X 2CRGA 4HV6A 1OISA 4PGHA 3ABUA 4UVBA 2BZTA 5FO5A 2E1MB 2R7ZJ 2A07F 3HOSA 3DTEA 3CCJI 1H88C 3M4OJ 3ABMH 3VB2A 4CZCA 2VUMJ 3TBIA 4BDZA 3A01A 3L2VA 1B9NA 2K9QA 2IW5A 2JPBA 4ENMA 2DMNA 2HTJA 3FMRA 1KONA 3Q9VA 3K4CA 3T8RA 2XSJC 3Q0UA 2KDOA 2EJRA 3H0GJ 2EFOA 4HV5A 1FOXA 3OYBA 3RSNA 4LIVA 2GZWA 4CICA 4A3DJ 3LA7A 4IX7A 2KDZA 3OS2A 3LSMA 1WJAA 2KJCA 2NVYJ 1J5YA 1WWXA 1D0XA 2K40A 1UHWA 2PX9A 2HEOA 1TWCJ 4NC7A 1IC8A 1IG7A 2R5YA 3ZQQA 3VODA 4ENNA 4EEFG 2M30A 1X1DA 3CF5F 2VKEA 4XLAA 1RNLA 1YS6A 5LRSA 3E6DA 1TLHB 1TC3C 3TDZC 4PCQA 2R7WA 3IH4A 3IWZA 1P4WA 3VYTB 3JRBA 1U3EM 4C3IJ 3CLOA 5E1ZB 3F72A 3BQYA 5B66C 2Z33A 2XPUA 1D0YA 1LVAA 4LJZF 4ZTJA 3H1CA 5LRRA 1YW9A 3S1QJ 1S6LA 5KNLA 2JWTA 4M6VA 4NC6A 4IO9F 2CV0A 1R23A 1IJWC 2CUFA 2QSGX 3DKYA 1P92A 3HRUA 5EJCA 5DTDA 3DXJF 1VQOI 1T98A 1TWHJ 1U2WA 4MEXF 5E3MA 1EV7A 1XMKA 4M71A 4RM2A 4B8XA 1PP8F 1VQNI 1ERDA 4N9HA 1XCBA 2IEKA 2MH9A 3N05A 4UB6C 3GX4X 4HDUA 4EJTA 4RB0A 4FISA 1BI1A 3CDIA 2R3SA 3AL0C 1H8AC 4ZC3A 1FTTA 2BW3B 1QZYA 3NAUA 4AIDA 1TL8A 1R5ID 4IOCF 3L00A 3MCZA 2HTSA 3CCSI 1OCCH 1SFOJ 3A4CA 2R4GA 1QO0D 2RAEA 5HNHA 5E20A 2GQQA 1CF7A 2L7MP 1JT6A 2CSOA 2OUMA 3HTSB 5HS7A 5KHDA 2DQLA 3GO5A 2VC0A 1FOYA 3BG5A 1XGOA 4DGWB 4MLOA 1ZN2A 2EWNA 4U7BA 3E5XA 2Z2SB 2YUSA 3AL0B 5F0CA 2HGCA 3TP0A 5KAFC 2MSYA 3L1PA 2NYXA 3BTJA 2FX0A 5E8GA 4OIOF 4D9JA 2P0WA 5EYRA 3WTTC 3TGNA 2XKPA 4JOMA 2CWEA 3FXUA 3CUQA 1K61A 4PJJA 4XSZF 1YS7A 1R71A 4A2UA 3F6VA 2NVQJ 5IT3A 3CUQB 4A0YA 3BTCA 3PM1A 2LP0A 3OSGA 2RVCA 4M73A 1P6RA 4DYRA 1PUFA 3HUGA 1GUUA 4XKWA 3WGGA 5D5WB 1W0UA 4LD5A 4UNOA 1F5TA 2E1OA 4DYCA 1PUFB 4UVCA 2ZFUA 1JUPA 1A31A 2P81A 4G6TB 4ANJA 5K7FA 2UXXA 2MLKA 1M1EB 2E19A 2WBMA 1I5ZA 2PQ8A 3F8FA 5JLXA 5HVQC 1J7KA 3F21A 4RDUA 1S72I 4D5FA 1X3WB 2XC7A 3KP4A 3CMEI 4IRHA 4YFNF 1HDPA 3PSFA 3DKXA 1J9IA 1E3PA 1IGNA 3WODF 2L5QA 4XL9A 3D0SA 3A1YA 2GXBA 1DU0A 5JR3A 3V7SA 2QKMB 3H9JA 4XSXF 1SC7A 1WJBA 4EM0B 2DT7B 2OZ6A 5GPAA 4QPOA 5HODA 3S3MA 2DFEA 3QODA 5E3NA 2E2JJ 3OSFA 1BOBA 2L2OA 3HKZA 1JUMA 1JHHA 2XGCA 2VE8A 4P5OA 4N4NB 3ZMVA 3RQ4A 1SANA 4CSWA 5ICGA 4FTHA 4CCMA 4HLYA 1U6GA 3GFJA 2LNBA 2BVMA 4BS9A 2NXNB 1XSXA 5DUKA 4I98B 4G7HF 1W36C 1OCRH 1T33A 2LDUA 3BZCA 2DDBA 5GTIC 2VOPA 4EQQA 2GOMA 2DMPA 5KVRA 3RTRA 2M0CA 3DBHB 3WG7H 3PQKA 2XRNA 2GIVA 4XRSG 1W7PA 3BLYA 1R5HA 2DA6A 4EJWA 1IV8A 3FISA 4NC8A 3TW6A 4IOAF 2DT6A 4A12A 1SMYF 2JMWA 2QUFA 4ON0A 1PP7U 4C3HJ 5CJ9A 5BS6A 1UHMA 2F48A 4MIMA 1T08B 1XDUA 5M5XJ 3VDXA 2GLOA 5C3EJ 2W1OA 4AD9A 3MMYB 1IF1A 2V9KA 4Y7NJ 2F5DA 2HXIA 4AIJA 3FXOA 3D5SC 2FD5A 4MO7A 3W6KB 3I56I 2H8WA 3F8CA 3KIOA 4XLPF 3BC8A 2UZKA 2DMUA 3IH3A 4OIQF 4FX0A 5K7HA 2ELHA 2V7FA 4W97A 3WG9A 1GDTA 2YU3A 1FIPA 4AUXA 4LGWA 1YE9A 4LG0A 3FBNB 2TCTA 2JA5J 1Z91A 3OYFA 4EV0A 3OYAA 4XLHA 1YJ9I 3RDIA 4BEHA 4BQOA 3ZQHA 5GTHC 2KRHA 4BEHB 4OIPF 2OCEA 4Q47A 4FE4A 2KIUA 4IZZA 2ZJ2A 5DV5A 3FM3A 1SAUA 5DM6F 1QRYA 1BR4A 5A2QZ 1Y8RB 2CFOA 1HW5A 3TMOA 1B72A 2VODA 1EH6A 2VBYA 3FHZA 3L2WA 1R4NB 2DPUA 4LK1F 3FK6A 3ZMTA 4Z6YA 2ZO4A 4A3KJ 4R79A 4V19K 2ZSHB 2O03A 3QYBA 2MBFA 4Y3OA 3IAS2 2XSDC 5JVGF 1ONVA 1OCTC 2ME0A 2FQ4A 3DEWA 1XSDA 4P1WA 3ECHA 3VYRB 5F6FA 4PUSA 1UJ8A 1APLC 5F1RA 1ZGJA 2GA2A 2FF4A 2M3AA 1S29A 1X1PA 1YQAA 5F08A 2KL4A 1BI0A 2NOGA 3KETA 2EZKA 2ESHA 3KFWX 3WU1B 4DYQA 1X2MA 2MABA 2NNNA 5HOOA 1Y1WJ 4IHVA 1DUXC 4XRFA 4Q5SF 1DPUA 2YPRA 1RESA 1XC5A 2XF7A 2WC2A 2P4WA 1HSTA 3HXLA 4IXAA 2R7QA 3EDPA 3RKYA 4BE0A 1HQCA 3TO7A 3SHFA 2IXSA 2EB7A 5DCMA 2KJBA 2RGVA 2IGNA 1B9MA 3Q0VA 4UY8I 2DA2A 3JRDA 2HWVA 5AONA 3Q5FA 1IO2A 1Z77A 2JSCA 1FC3A 4M9SA 3VWBA 2K9MA 1R1UA 3BJ6A 4CCOA 5J1RA 1LQ1A 2VQLA 1ZLJA 3E6MA 1E17A 1QZZA 2XASA 2QGUA 3ZXSA 1JGSA 1ZYRF 4II2A 4J00A 2KRCA 3HKZN 2Y0SA 2DOEA 2VBWA 3IWFA 3J7ZI 4WXDA 5IT9Z 5IP9J 3C2GA 1ZAOA 3GWZA 3ERED 5DUIA 2ZXIA 4XM3A 4AIKA 5DM7F 2KHMA 1TNSA 1KYWA 4OAZA 1P7IA 1JUSA 3AG1H 3V7CA 4XIDA 3J81Z 4XKVA 3ERMA 4E7HA 3TKYA 3BDDA 1VQ8I 5BNGA 2Q2EA 3SJMA 2ZSIB 3BPXA 5K5RA 2IGMA 3JW4A 3RJPA 1HW1A 3AG3H 3EUHA 3BTLA 3T5XA 5CYVA 5F27A 3JRGA 4A93J 3LQRA 2R7TA 1Z67A 3M9AA 3GTGJ 2E35A 1KGSA 3H3UA 4NQWA 3KZYA 5L3DA 1U5TC 2V26A 4ENKA 5J1YA 3A02A 2VBXA 3QPTA 4GXOA 4HA8A 5C44J 2P7CB 2PI0A 3ASNH 1A36A 1FJLA 1LNWA
chains in the Genus database with same CATH topology
3RKXA 1K78A 5CVRA 3E6BA 2H6CA 1FWZA 2DFIA 1YIOA 1K78B 2HKXA 1FX7A 3OV8A 3DF8A 3KLNA 2ZCWA 1U5TB 1P2FA 1MKMA 2FOKA 4B09A 2XAJA 2CYYA 1D8KA 1HKQA 1IRGA 1YW7A 1R1VA 2RDPA 5E18F 5CVVA 4PGGA 1FLIA 4IPAA 5JI6A 5LLQA 2IJLA 2LSOA 1IN7A 4HAMA 4YFXF 3ML6A 2RV8A 3M1EA 2R7DA 4BAYA 3TOBA 1RI7A 1FOKA 4P9FA 3CO7C 3P9CA 1G3SA 1R22A 2K4JA 2GA1A 2V1XA 3DQVC 4UUVA 3NEUA 1TBXA 4OU0A 4L0YB 2FMYA 4HBLA 2DU9A 3EETA 5D5UB 4MQVA 1BIAA 2Z99A 5ICFA 3FWEA 3ZMDA 5AIQA 2OQRA 3WE2A 2Q8KA 1W7PD 3C1DA 1VTNC 1FBQA 2M8EA 2V1DA 4Q48A 4BHPA 4BXUA 2M87A 2VXZA 1T39A 1BJAA 3LA2A 2H27A 3GFMA 2XAFA 1D5VA 4YIFA 4KDPA 3TO6A 3LSTA 1ON2A 4LLLA 4KUMA 3H92A 3QAHA 2ISYA 3JSOA 2L01A 2DBBA 3U9GA 1JXSA 1MGTA 4HQMA 4M72A 3GYHX 3K9TA 5LGNA 2VE9A 1XGNA 2NRAC 2EFPA 2A69F 1F4KA 5DDGA 1L0OC 4N0BA 3L9FA 3WGIA 1I6XA 1Z6RA 4AIHA 1O7FA 4OINF 3RPUA 4ESJA 1QQIA 1GHCA 2M5WA 1HXDA 1OYWA 3P9IA 2VT3A 4IHSA 2FU4A 2PN6A 5JVTA 2K02A 3LA3A 3AAFA 5ERIA 2EV6A 4AVPA 4GGGA 1FP2A 5HDNA 5ED4A 2FA5A 4GCVA 5TJJA 5HLIA 5K5OA 4OMYA 1JHFA 2MH2A 2QQ9A 4L0ZB 2L02A 3MZYA 1W5SA 1KU9A 2EK5A 2ZBKA 3HSRA 1ZRCA 3T0YA 3M8EA 2FE3A 1OPCA 1LJ9A 3ZQ7A 4LK0F 2UWMA 2G7UA 1WSUA 4IJAA 1E2XA 2KIFA 3L2CA 4L9VA 2ZFWA 2Y48A 4U88A 3W6JB 1IAWA 3RI4A 3EQLF 2RQPA 2IA0A 4L5IA 1J2XA 3JSPA 2P6SA 2HKOA 1ZG3A 1BI3A 1BC8C 4KA4A 3T1BA 3IRQA 1BOAA 1OYYA 5DCFA 1KQ0A 2ADUA 3ZN0A 1QPMA 4ETSA 1BM9A 4RS8A 4KN4X 4GO1A 2Y75A 3KZZA 3CJNA 3JTHA 1MZBA 4UXNA 2JZYA 4F7ZA 3I71A 3ABTA 5J8CA 4KFCA 3TQNA 3HRTA 2P8TA 2RKHA 5HLHA 2WWYA 1XGSA 4K2EA 2VBZA 1R36A 4BHBA 1Z6TA 1U78A 3I64A 5E17F 2E7XA 3SQNA 1BN5A 4G6QA 1AWCA 2P7VB 1IZ1A 4ASNA 2B0LA 3CDHA 5L3CA 1LDJA 1ZH5A 3GXOA 4ZYHA 1UB9A 4I7HA 5D5VB 5FLXK 5H20A 3GUDA 4BYYA 2A3SA 3M8FA 1ZHFA 3MWMA 2PBIA 2BGCA 3ZN1A 1YTYA 5DYMA 3FMSA 3R61A 3HRSA 2VN2A 4EMSA 2QYOA 5F64A 5E8IA 3E5QA 4OMZA 4RB3C 3K1PA 2STTA 4A5MA 3R0AA 1MDMB 1J0RA 1SD5A 2EFNA 3JAMK 2RNJA 3IKVA 4A0XA 6PAXA 1TQIA 2ACJA 1YG2A 2E1CA 3MAJA 5HDGA 2OD5A 5BPIA 1KU7A 4EVIA 2FEZA 2V79A 1W4MA 2DI3A 3I0TA 4IHTA 2LF7A 3FXQA 1O57A 2IVMA 1R5GA 2BBYA 3WU0A 2NAZA 2X4HA 1XCVA 1MJAA 4Y17A 5LHGA 1UFMA 4G6DA 3KE2A 2Z5UA 2L54A 2DTRA 1IXRC 2PFBA 3K69A 3GZ5A 2ZMEB 4JQFA 2MC3A 2MA3A 2W57A 1KA8A 1HSJA 5FD5A 4KIBA 2GWRA 4ZZLA 3KCCA 1S7OA 3CTAA 4EJUA 4L9JA 1LEAA 4TV7A 2R7FA 1HBXG 3R0JA 1T6SA 1BI2A 2DT5A 2A68F 5LEKA 2WTEA 3GFLA 3HHGA 5L3BA 1H9TA 1F9NA 2F2EA 2P5LC 4R1HA 4PZJA 3CO6C 1DDNA 1YYVA 3M7GA 4LFUA 3U1DA 1OKRA 5J6XA 3DEUA 3D5LA 4LLGF 1WKMA 3KEQA 5J8FA 3NRVA 3WTZA 5BOXA 4E70A 1O7LA 1O3SA 1TQMA 2XROA 3O2PE 2BYVE 5CVJA 1R58A 2HFHA 4DQ2A 5ILSA 1KU2A 1OMIA 2W24A 4S05A 2DK5A 3VFZA 4IRIA 1ULYA 5DEQA 3I54A 3KP2A 1XMAA 3QU6A 2DLLA 4RB1A 2QBYA 2O0YA 4NHJA 3SFZA 2QBYB 3ZMSA 1SMTA 2NNYA 2EA2A 2J5PA 1LDDA 2QWWA 1Z9CA 2OBPA 3K2ZA 3C7JA 1O3QA 3WTSC 1Y0UA 2K4BA 3KP7A 2ZNYA 4HQEA 2CO5A 1U5TA 5LBQA 4CO8A 1SFUA 3GF2A 5BMZA 2HDCA 4HDVA 3G3ZA 2DK8A 3DFGA 2CQKA 3QRFF 4WXCA 5FFZA 3C3WA 1XGMA 2XVCA 1OYIA 2BE5F 1XD7A 2O3FA 1FY7A 2QVOA 1ZRFA 3WTXC 1SD4A 3O6BB 3I53A 3QOPA 3REOA 2DQRA 2XGXA 4EGYA 1BBYA 1G3WA 1G4DA 1P4AA 4A6DA 1SAXA 5BPDA 1V3FA 2YX7A 5L3EA 4HX7A 4I01A 2IA1A 5D5XB 4ZYGA 2GXGA 1Z7UA 3S2WA 2XAQA 5CVUA 3MEXA 3GFIA 3F6OA 4H0EA 4KN7X 4A0ZA 1REPC 5BQTA 3P9KA 4LMYA 5FFXA 1TTYA 4JK1X 3U2RA 3WTYC 1K7AA 2E1NA 1LEBA 4L9TA 2XUBA 4EJOA 1R00A 2JT1A 1IXSB 2CG4A 4CYDA 2COMA 2JPCA 4I02A 3BOQA 2OQGA 1WI9A 3FF5A 2AXLA 1R1TA 2F5CA 2HZTA 2DW4A 3EYIA 1H9GA 1FPQA 4GYGA 1LDKB 4G8XA 2FXAA 4WK8F 4M9XA 3WTWC 5LHIA 2O61A 2QQBA 2QLZA 4IRGA 2FQ3A 4WX9A 3PQJA 3RKWA 2O8XA 4RGRA 2PEXA 2Y0MA 5ICCA 4L9NA 3E6CC 4A6EA 4NB5A 2HS5A 4EGZA 5H6RA 5LGTA 5D4RA 2YR2A 1IN4A 1K6OA 4I2OA 4UV9A 4I09A 1FZPB 4L18B 3QPHA 4P96A 5H6QA 3F3XA 1KU3A 3C18A 3JTGA 2HYFA 3E97A 2ESNA 1XB4A 3LQQA 2VONA 4QLCU 1FBSA 2XAGA 3EYYA 1FYKA 2XKOA 3RYRA 2IP2A 2A5YB 3HYIA 5D8KB 4FHTA 4ENJA 4KIFA 2FBKA 5L3GA 4HF1A 1ZG5A 3ZPLA 1TNTA 2DPDA 3IKTA 3E3VA 2XV4S 3MZHA 1Z1DA 2F5FA 1USSA 3HTUA 3BJOA 5DD8A 3G73A 1ZGAA 2BEOA 4IF4A 5ICEA 3ROUA 3NQOA 1XDSA 5HDKA 1FP1D 2JTVA 3KP3A 3WGHA 2PMUA 1IRFA 1C0WA 1T2KA 4CZZA 4ESBA 4EJVA 3LAPA 3V4GA 1SFEA 1OR7A 2PG4A 3K1MA 3RPQA 2P5VA 5HS8A 2PMHA 3FX3A 2EV0A 2UXNA 3FZVA 4KICA 2J5OA 1AOYA 1ZARA 3QP5A 3LFKA 4RB2C 3I4PA 3KLOA 3OOPA 4RGXA 2P6TA 4A5NA 2OU2A 3BPVA 3E5UA 1Q1HA 3V7RA 5JFRA 4KNYA 3IRRA 1D3YA 2V1UA 3BWGA 4WF2A 4G7ZF 2A6EF 1IW7F 4HW0A 4DNCA 4ZH4F 1DP7P 3ULQB 1X3UA 2FBHA 4UV8A 1SFXA 5EEHA 3KEOA 2EA4A 4LB5A 1S8NA 4BH9A 3DV8A 3HSEA 2DO7A 3SXYA 4GYIA 3F22A 2KKOA 3N4MA 2H94A 2FBIA 1ZG1A 1SD7A 5JHUA 3HHHA 3BROA 3KP6A 3GLXA 3CUQC 3ZP5A 1Z05A 2FNPA 3H3ZA 1CF7B 4M9ZA 3MFKA 1WQ2A 2H09A 2CFXA 4Y15A 2G9WA 4I0AA 2K27A 2OZUA 3GVAA 1ZRDA 2A6HF 1D8JA 3LAJA 4Q4ZF 2IRFG 1KQ9A 1EH7A 2MD5A 1RZ4A 3GZ6A 2H6BA 2W25A 1T0FA 4Y13A 3ELKA 2FRHA 5LGUA 3BP8A 4HLXA 1B59A 4UVAA 3IHUA 1MDMA 2A61A 4OIRF 1MD0A 3B02A 4O5VA 5EEGA 2IPQX 4KYWA 2PJPA 2ZNZA 3IL2A 4RAZA 2YX4A 5A2QK 1TQPA 3HSFA 3VOEA 3BJAA 1ZREA 2QQAA 2EFWA 2L4MA 4U7DA 5K1YA 1FBUA 3PFIA 3F8MA 1S7AA 3FXRA 1FSHA 2E7WA 1R7JA 1GXQA 2W84A 1W7PB 2C6YA 1IN8A 3SZTA 2ZMEA 1NHAA 3QU3A 4WXHA 1RUNA 2ISZA 3F23A 5FLXZ 1STZA 4CGZA 1W5TA 3O3KA 1PUEE 2M45A 5FD6A 1HW2A 4HYEA 1QGPA 1QBJA 3N97A 1WRJA 3I5UA 2HQNA 3T8TA 4EM1A 4U0YA 2D45A 4M6YA 2FSWA 2W85A 2QZ8A 5IT9K 4IVNA 4LG0B 1FYMA 1A04A 4KIGA 1J75A 3J81K 4AWXB 4MHGA 4L5JA 1YLFA 3JAMZ 4LB6B 3ZMUA 3BZ6A 1PDNC 1L3LA 2Q0OA 2XIGA 4U0WA 1MJBA 4BNCA 1B4AA 4YG2F 2QM3A 3HRMA 2ZXJA 4HX4A 4CDGA 2V6CA 4D0PA 1SD6A 3R4KA 1IUYA 4O3MA 1XSVA 4P55A 3P7NA 1FSEA 1B1BA 3B73A 1O3TA 2EFQA 1EH8A 2OA4A 2XHKA 2PLYA 5HLGA 4P9UA 1USTA 2M1BA 4G7OF 2LKPA 3DKWA 1P4XA 5LHHA 5AIPA 1FNNA 4MGRA 2IA2A 3MQ0A 1KQ8A 2RC4A 2WV0A 5DCMB 4OOIA 3VEPA 3GW2A 4CXFA 4ZYEA 1IXCA 4RAYA 1IN6A 5E1WA 3V8LA 3GEZA 2ETHA 4G94A 2L3DA 2EV5A 4G9YA 4PDKA 3R60A 4HF0A 3V8KA 1GVJA 4HOBA 3WE3A 3J80K 3L09A 3I59A 4MTDA 4HZFA 1I1GA 4MEYF 3I59B 4HX8A 3DPTA 4RGUA 4CHUA 1LB2A 4S04A 2K7LA 1DPRA 4XLNF 4KMUX 1S3JA 2BV6A 2F5EA 5K5QA 2DAOA 2VC1A 4FX4A 5CLSA 1ZLKA 5ILVA 1KYZA 4MQ9F 2FNAA 1O3RA 4M6XA 2Z3YA 1YFHA 2RN7A 2AS5F 1H0MA 4O6JA 1XN7A 4N9IA 1HKTA 3FMQA 3TO9A 2P5KA 4M74A 1TW2A 4FT8A 2JRTA 4WCGA 1YW8A 1IN5A 3WTVC 1HKSA 2G7HA 4RGSA 5L3FA 3RYPA 1YO5C 5D4SA 3FM5A 4BHCA 2FMLA 4Z2YA 4KT5C 3BY6A 2YSRA 1T38A 2OAZA 3J80Z 1I27A 1G6NA 3HOTA 4LLNA 3COAC 1B6AA 3F8NA 3TOAA 5TRDA 5FGMA 5ILUA 2KIMA 4QWQA 3WTUC 3ZMZA 2O6GE 5LEJA 4R8HA 1TW3A 3ECOA 2QENA 2NS0A 4HF2A 3I58A 3L7WA 3J7AO 1I1SA 3K1NA 3ISPA 1RIOH 3LWFA 2X0LA 2HYGD 1G3TA 4ZYDA 4XBFA 5CVIA 3V8JA 2IT0A 4YFKF 3DPLC 2V9VA 1QNTA 1MJ9A 1BIBA 4EM2A 2Z9OA 5KK1A 4WWCA 5FB2A 2KRFA 4UHTA 1J59A 3F8BA 1ON1A 4KMFA 3IC7A 4MNUA 1BC7C 3SZPA 3K0LA 3CUOA 4MTEA 3RIRA 2L4AA 1G3YA 2STWA 1U8RA 5HS9A 3R6SA 3TDUC 2D1HA 5D6EA 2MLGA 4I0BA 2CW0F 3HIFA 2VT2A 1FT9A 2D1VA 4ZZDA 1K79A 2HR3A 1V4RA 5DD4A 2XAHA 2GAUA 1UCRA 2HQRA 2VOOA 2HOEA 2D2WA 3KP5A 4YIIA 2LF8A 2TDXA 3DP7A 5D8LB 1JE8A 4ESFA 4JBAA 3Q9SA 1FYLA 5E1XA 3QP6A 2K86A 1F1ZA 2ZKZA 1CGPA 1RUOA 1ODDA 4BQAA 2CGPA 5D6FA 1GXPA 4U0VA 4HV6A 4PGHA 4UVBA 3ABUA 5FO5A 2A07F 3HOSA 3VB2A 1B9NA 2IW5A 2JPBA 4ENMA 2HTJA 3FMRA 3Q9VA 3T8RA 2EJRA 4HV5A 2EFOA 2GZWA 4CICA 3LA7A 2KJCA 1J5YA 1WWXA 1UHWA 2HEOA 3VODA 4ENNA 2M30A 1RNLA 1YS6A 5LRSA 3E6DA 1TLHB 3TDZC 4PCQA 3IWZA 1P4WA 1U3EM 3CLOA 5E1ZB 3F72A 2Z33A 1LVAA 4LJZF 5LRRA 1YW9A 1S6LA 1R23A 1P92A 3HRUA 3DXJF 1T98A 1U2WA 4MEXF 1EV7A 1XMKA 4M71A 4B8XA 1PP8F 4N9HA 1XCBA 2MH9A 3GX4X 4EJTA 4HDUA 4RB0A 1BI1A 2R3SA 1QZYA 3L00A 3MCZA 2HTSA 1QO0D 5E20A 2GQQA 1CF7A 3HTSB 2CSOA 5HS7A 2DQLA 3GO5A 2VC0A 1XGOA 1ZN2A 2EWNA 4U7BA 3E5XA 2HGCA 2NYXA 5E8GA 4OIOF 3WTTC 3TGNA 2XKPA 2CWEA 3FXUA 3CUQA 4XSZF 1YS7A 4A2UA 3F6VA 5IT3A 3CUQB 4A0YA 2RVCA 4M73A 1P6RA 3HUGA 5D5WB 3WGGA 4LD5A 4UNOA 1F5TA 4UVCA 2UXXA 2MLKA 1I5ZA 2PQ8A 3F8FA 5HVQC 1J7KA 3F21A 3KP4A 4IRHA 4YFNF 1J9IA 3WODF 3D0SA 2GXBA 5JR3A 3V7SA 4XSXF 4EM0B 2OZ6A 1JHHA 2VE8A 4P5OA 3ZMVA 5ICGA 4HLYA 1U6GA 3GFJA 2LNBA 1XSXA 5DUKA 4I98B 4G7HF 2LDUA 2VOPA 4EQQA 5KVRA 3RTRA 3PQKA 2XRNA 2GIVA 1W7PA 1R5HA 4EJWA 4A12A 1SMYF 2QUFA 4ON0A 1PP7U 5CJ9A 5BS6A 1UHMA 1XDUA 4AD9A 1IF1A 2F5DA 4AIJA 3W6KB 3F8CA 4XLPF 2UZKA 4OIQF 4FX0A 2ELHA 3WG9A 2YU3A 4LGWA 4LG0A 1Z91A 4EV0A 3RDIA 4OIPF 4Q47A 2KIUA 2ZJ2A 5DV5A 3FM3A 5A2QZ 1HW5A 2VODA 1EH6A 2VBYA 3FHZA 2DPUA 4LK1F 3ZMTA 2ZO4A 4R79A 2O03A 2MBFA 1ONVA 1XSDA 3ECHA 5F6FA 5F1RA 1ZGJA 2GA2A 2FF4A 1S29A 1YQAA 3KETA 1BI0A 2ESHA 3KFWX 3WU1B 2NNNA 5HOOA 1DUXC 4XRFA 4Q5SF 1DPUA 2YPRA 2WC2A 2P4WA 1HSTA 4IXAA 3EDPA 3RKYA 1HQCA 3TO7A 3SHFA 5DCMA 2EB7A 2KJBA 2RGVA 1B9MA 2HWVA 5AONA 3Q5FA 4M9SA 2JSCA 1FC3A 1R1UA 3BJ6A 1LQ1A 1ZLJA 3E6MA 1E17A 1QZZA 2XASA 1JGSA 1ZYRF 2VBWA 3IWFA 4WXDA 5IT9Z 1ZAOA 3GWZA 3ERED 5DUIA 4AIKA 1TNSA 1KYWA 3V7CA 3J81Z 3TKYA 3BDDA 2Q2EA 3BPXA 5K5RA 3JW4A 3RJPA 1HW1A 3EUHA 3T5XA 5CYVA 3LQRA 3M9AA 1KGSA 3H3UA 4NQWA 3KZYA 5L3DA 1U5TC 4ENKA 2VBXA 3QPTA 4GXOA 4HA8A 2P7CB 2PI0A 1LNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKX A;  1K78 A;  5CVR A;  3E6B A;  2H6C A;  1FWZ A;  2DFI A;  1YIO A;  1K78 B;  2HKX A;  1FX7 A;  3OV8 A;  3DF8 A;  3KLN A;  2ZCW A;  1U5T B;  1P2F A;  1MKM A;  2FOK A;  4B09 A;  2XAJ A;  2CYY A;  1D8K A;  1HKQ A;  1IRG A;  1YW7 A;  1R1V A;  2RDP A;  5E18 F;  5CVV A;  4PGG A;  1FLI A;  4IPA A;  5JI6 A;  5LLQ A;  2IJL A;  2LSO A;  1IN7 A;  4HAM A;  4YFX F;  3ML6 A;  2RV8 A;  3M1E A;  2R7D A;  4BAY A;  3TOB A;  1RI7 A;  1FOK A;  4P9F A;  3CO7 C;  3P9C A;  1G3S A;  1R22 A;  2K4J A;  2GA1 A;  2V1X A;  3DQV C;  4UUV A;  3NEU A;  1TBX A;  4OU0 A;  4L0Y B;  2FMY A;  4HBL A;  2DU9 A;  3EET A;  5D5U B;  4MQV A;  1BIA A;  2Z99 A;  5ICF A;  3FWE A;  3ZMD A;  5AIQ A;  2OQR A;  3WE2 A;  2Q8K A;  1W7P D;  3C1D A;  1VTN C;  1FBQ A;  2M8E A;  2V1D A;  4Q48 A;  4BHP A;  4BXU A;  2M87 A;  2VXZ A;  1T39 A;  1BJA A;  3LA2 A;  2H27 A;  3GFM A;  2XAF A;  1D5V A;  4YIF A;  4KDP A;  3TO6 A;  3LST A;  1ON2 A;  4LLL A;  4KUM A;  3H92 A;  3QAH A;  2ISY A;  3JSO A;  2L01 A;  2DBB A;  3U9G A;  1JXS A;  1MGT A;  4HQM A;  4M72 A;  3GYH X;  3K9T A;  5LGN A;  2VE9 A;  1XGN A;  2NRA C;  2EFP A;  2A69 F;  1F4K A;  5DDG A;  1L0O C;  4N0B A;  3L9F A;  3WGI A;  1I6X A;  1Z6R A;  4AIH A;  1O7F A;  4OIN F;  3RPU A;  4ESJ A;  1QQI A;  1GHC A;  2M5W A;  1HXD A;  1OYW A;  3P9I A;  2VT3 A;  4IHS A;  2FU4 A;  2PN6 A;  5JVT A;  2K02 A;  3LA3 A;  3AAF A;  5ERI A;  2EV6 A;  4AVP A;  4GGG A;  1FP2 A;  5HDN A;  5ED4 A;  2FA5 A;  4GCV A;  5TJJ A;  5HLI A;  5K5O A;  4OMY A;  1JHF A;  2MH2 A;  2QQ9 A;  4L0Z B;  2L02 A;  3MZY A;  1W5S A;  1KU9 A;  2EK5 A;  2ZBK A;  3HSR A;  1ZRC A;  3T0Y A;  3M8E A;  2FE3 A;  1OPC A;  1LJ9 A;  3ZQ7 A;  4LK0 F;  2UWM A;  2G7U A;  1WSU A;  4IJA A;  1E2X A;  2KIF A;  3L2C A;  4L9V A;  2ZFW A;  2Y48 A;  4U88 A;  3W6J B;  1IAW A;  3RI4 A;  3EQL F;  2RQP A;  2IA0 A;  4L5I A;  1J2X A;  3JSP A;  2P6S A;  2HKO A;  1ZG3 A;  1BI3 A;  1BC8 C;  4KA4 A;  3T1B A;  3IRQ A;  1BOA A;  1OYY A;  5DCF A;  1KQ0 A;  2ADU A;  3ZN0 A;  1QPM A;  4ETS A;  1BM9 A;  4RS8 A;  4KN4 X;  4GO1 A;  2Y75 A;  3KZZ A;  3CJN A;  3JTH A;  1MZB A;  4UXN A;  2JZY A;  4F7Z A;  3I71 A;  3ABT A;  5J8C A;  4KFC A;  3TQN A;  3HRT A;  2P8T A;  2RKH A;  5HLH A;  2WWY A;  1XGS A;  4K2E A;  2VBZ A;  1R36 A;  4BHB A;  1Z6T A;  1U78 A;  3I64 A;  5E17 F;  2E7X A;  3SQN A;  1BN5 A;  4G6Q A;  1AWC A;  2P7V B;  1IZ1 A;  4ASN A;  2B0L A;  3CDH A;  5L3C A;  1LDJ A;  1ZH5 A;  3GXO A;  4ZYH A;  1UB9 A;  4I7H A;  5D5V B;  5FLX K;  5H20 A;  3GUD A;  4BYY A;  2A3S A;  3M8F A;  1ZHF A;  3MWM A;  2PBI A;  2BGC A;  3ZN1 A;  1YTY A;  5DYM A;  3FMS A;  3R61 A;  3HRS A;  2VN2 A;  4EMS A;  2QYO A;  5F64 A;  5E8I A;  3E5Q A;  4OMZ A;  4RB3 C;  3K1P A;  2STT A;  4A5M A;  3R0A A;  1MDM B;  1J0R A;  1SD5 A;  2EFN A;  3JAM K;  2RNJ A;  3IKV A;  4A0X A;  6PAX A;  1TQI A;  2ACJ A;  1YG2 A;  2E1C A;  3MAJ A;  5HDG A;  2OD5 A;  5BPI A;  1KU7 A;  4EVI A;  2FEZ A;  2V79 A;  1W4M A;  2DI3 A;  3I0T A;  4IHT A;  2LF7 A;  3FXQ A;  1O57 A;  2IVM A;  1R5G A;  2BBY A;  3WU0 A;  2NAZ A;  2X4H A;  1XCV A;  1MJA A;  4Y17 A;  5LHG A;  1UFM A;  4G6D A;  3KE2 A;  2Z5U A;  2L54 A;  2DTR A;  1IXR C;  2PFB A;  3K69 A;  3GZ5 A;  2ZME B;  4JQF A;  2MC3 A;  2MA3 A;  2W57 A;  1KA8 A;  1HSJ A;  5FD5 A;  4KIB A;  2GWR A;  4ZZL A;  3KCC A;  1S7O A;  3CTA A;  4EJU A;  4L9J A;  1LEA A;  4TV7 A;  2R7F A;  1HBX G;  3R0J A;  1T6S A;  1BI2 A;  2DT5 A;  2A68 F;  5LEK A;  2WTE A;  3GFL A;  3HHG A;  5L3B A;  1H9T A;  1F9N A;  2F2E A;  2P5L C;  4R1H A;  4PZJ A;  3CO6 C;  1DDN A;  1YYV A;  3M7G A;  4LFU A;  3U1D A;  1OKR A;  5J6X A;  3DEU A;  3D5L A;  4LLG F;  1WKM A;  3KEQ A;  5J8F A;  3NRV A;  3WTZ A;  5BOX A;  4E70 A;  1O7L A;  1O3S A;  1TQM A;  2XRO A;  3O2P E;  2BYV E;  5CVJ A;  1R58 A;  2HFH A;  4DQ2 A;  5ILS A;  1KU2 A;  1OMI A;  2W24 A;  4S05 A;  2DK5 A;  3VFZ A;  4IRI A;  1ULY A;  5DEQ A;  3I54 A;  3KP2 A;  1XMA A;  3QU6 A;  2DLL A;  4RB1 A;  2QBY A;  2O0Y A;  4NHJ A;  3SFZ A;  2QBY B;  3ZMS A;  1SMT A;  2NNY A;  2EA2 A;  2J5P A;  1LDD A;  2QWW A;  1Z9C A;  2OBP A;  3K2Z A;  3C7J A;  1O3Q A;  3WTS C;  1Y0U A;  2K4B A;  3KP7 A;  2ZNY A;  4HQE A;  2CO5 A;  1U5T A;  5LBQ A;  4CO8 A;  1SFU A;  3GF2 A;  5BMZ A;  2HDC A;  4HDV A;  3G3Z A;  2DK8 A;  3DFG A;  2CQK A;  3QRF F;  4WXC A;  5FFZ A;  3C3W A;  1XGM A;  2XVC A;  1OYI A;  2BE5 F;  1XD7 A;  2O3F A;  1FY7 A;  2QVO A;  1ZRF A;  3WTX C;  1SD4 A;  3O6B B;  3I53 A;  3QOP A;  3REO A;  2DQR A;  2XGX A;  4EGY A;  1BBY A;  1G3W A;  1G4D A;  1P4A A;  4A6D A;  1SAX A;  5BPD A;  1V3F A;  2YX7 A;  5L3E A;  4HX7 A;  4I01 A;  2IA1 A;  5D5X B;  4ZYG A;  2GXG A;  1Z7U A;  3S2W A;  2XAQ A;  5CVU A;  3MEX A;  3GFI A;  3F6O A;  4H0E A;  4KN7 X;  4A0Z A;  1REP C;  5BQT A;  3P9K A;  4LMY A;  5FFX A;  1TTY A;  4JK1 X;  3U2R A;  3WTY C;  1K7A A;  2E1N A;  1LEB A;  4L9T A;  2XUB A;  4EJO A;  1R00 A;  2JT1 A;  1IXS B;  2CG4 A;  4CYD A;  2COM A;  2JPC A;  4I02 A;  3BOQ A;  2OQG A;  1WI9 A;  3FF5 A;  2AXL A;  1R1T A;  2F5C A;  2HZT A;  2DW4 A;  3EYI A;  1H9G A;  1FPQ A;  4GYG A;  1LDK B;  4G8X A;  2FXA A;  4WK8 F;  4M9X A;  3WTW C;  5LHI A;  2O61 A;  2QQB A;  2QLZ A;  4IRG A;  2FQ3 A;  4WX9 A;  3PQJ A;  3RKW A;  2O8X A;  4RGR A;  2PEX A;  2Y0M A;  5ICC A;  4L9N A;  3E6C C;  4A6E A;  4NB5 A;  2HS5 A;  4EGZ A;  5H6R A;  5LGT A;  5D4R A;  2YR2 A;  1IN4 A;  1K6O A;  4I2O A;  4UV9 A;  4I09 A;  1FZP B;  4L18 B;  3QPH A;  4P96 A;  5H6Q A;  3F3X A;  1KU3 A;  3C18 A;  3JTG A;  2HYF A;  3E97 A;  2ESN A;  1XB4 A;  3LQQ A;  2VON A;  4QLC U;  1FBS A;  2XAG A;  3EYY A;  1FYK A;  2XKO A;  3RYR A;  2IP2 A;  2A5Y B;  3HYI A;  5D8K B;  4FHT A;  4ENJ A;  4KIF A;  2FBK A;  5L3G A;  4HF1 A;  1ZG5 A;  3ZPL A;  1TNT A;  2DPD A;  3IKT A;  3E3V A;  2XV4 S;  3MZH A;  1Z1D A;  2F5F A;  1USS A;  3HTU A;  3BJO A;  5DD8 A;  3G73 A;  1ZGA A;  2BEO A;  4IF4 A;  5ICE A;  3ROU A;  3NQO A;  1XDS A;  5HDK A;  1FP1 D;  2JTV A;  3KP3 A;  3WGH A;  2PMU A;  1IRF A;  1C0W A;  1T2K A;  4CZZ A;  4ESB A;  4EJV A;  3LAP A;  3V4G A;  1SFE A;  1OR7 A;  2PG4 A;  3K1M A;  3RPQ A;  2P5V A;  5HS8 A;  2PMH A;  3FX3 A;  2EV0 A;  2UXN A;  3FZV A;  4KIC A;  2J5O A;  1AOY A;  1ZAR A;  3QP5 A;  3LFK A;  4RB2 C;  3I4P A;  3KLO A;  3OOP A;  4RGX A;  2P6T A;  4A5N A;  2OU2 A;  3BPV A;  3E5U A;  1Q1H A;  3V7R A;  5JFR A;  4KNY A;  3IRR A;  1D3Y A;  2V1U A;  3BWG A;  4WF2 A;  4G7Z F;  2A6E F;  1IW7 F;  4HW0 A;  4DNC A;  4ZH4 F;  1DP7 P;  3ULQ B;  1X3U A;  2FBH A;  4UV8 A;  1SFX A;  5EEH A;  3KEO A;  2EA4 A;  4LB5 A;  1S8N A;  4BH9 A;  3DV8 A;  3HSE A;  2DO7 A;  3SXY A;  4GYI A;  3F22 A;  2KKO A;  3N4M A;  2H94 A;  2FBI A;  1ZG1 A;  1SD7 A;  5JHU A;  3HHH A;  3BRO A;  3KP6 A;  3GLX A;  3CUQ C;  3ZP5 A;  1Z05 A;  2FNP A;  3H3Z A;  1CF7 B;  4M9Z A;  3MFK A;  1WQ2 A;  2H09 A;  2CFX A;  4Y15 A;  2G9W A;  4I0A A;  2K27 A;  2OZU A;  3GVA A;  1ZRD A;  2A6H F;  1D8J A;  3LAJ A;  4Q4Z F;  2IRF G;  1KQ9 A;  1EH7 A;  2MD5 A;  1RZ4 A;  3GZ6 A;  2H6B A;  2W25 A;  1T0F A;  4Y13 A;  3ELK A;  2FRH A;  5LGU A;  3BP8 A;  4HLX A;  1B59 A;  4UVA A;  3IHU A;  1MDM A;  2A61 A;  4OIR F;  1MD0 A;  3B02 A;  4O5V A;  5EEG A;  2IPQ X;  4KYW A;  2PJP A;  2ZNZ A;  3IL2 A;  4RAZ A;  2YX4 A;  5A2Q K;  1TQP A;  3HSF A;  3VOE A;  3BJA A;  1ZRE A;  2QQA A;  2EFW A;  2L4M A;  4U7D A;  5K1Y A;  1FBU A;  3PFI A;  3F8M A;  1S7A A;  3FXR A;  1FSH A;  2E7W A;  1R7J A;  1GXQ A;  2W84 A;  1W7P B;  2C6Y A;  1IN8 A;  3SZT A;  2ZME A;  1NHA A;  3QU3 A;  4WXH A;  1RUN A;  2ISZ A;  3F23 A;  5FLX Z;  1STZ A;  4CGZ A;  1W5T A;  3O3K A;  1PUE E;  2M45 A;  5FD6 A;  1HW2 A;  4HYE A;  1QGP A;  1QBJ A;  3N97 A;  1WRJ A;  3I5U A;  2HQN A;  3T8T A;  4EM1 A;  4U0Y A;  2D45 A;  4M6Y A;  2FSW A;  2W85 A;  2QZ8 A;  5IT9 K;  4IVN A;  4LG0 B;  1FYM A;  1A04 A;  4KIG A;  1J75 A;  3J81 K;  4AWX B;  4MHG A;  4L5J A;  1YLF A;  3JAM Z;  4LB6 B;  3ZMU A;  3BZ6 A;  1PDN C;  1L3L A;  2Q0O A;  2XIG A;  4U0W A;  1MJB A;  4BNC A;  1B4A A;  4YG2 F;  2QM3 A;  3HRM A;  2ZXJ A;  4HX4 A;  4CDG A;  2V6C A;  4D0P A;  1SD6 A;  3R4K A;  1IUY A;  4O3M A;  1XSV A;  4P55 A;  3P7N A;  1FSE A;  1B1B A;  3B73 A;  1O3T A;  2EFQ A;  1EH8 A;  2OA4 A;  2XHK A;  2PLY A;  5HLG A;  4P9U A;  1UST A;  2M1B A;  4G7O F;  2LKP A;  3DKW A;  1P4X A;  5LHH A;  5AIP A;  1FNN A;  4MGR A;  2IA2 A;  3MQ0 A;  1KQ8 A;  2RC4 A;  2WV0 A;  5DCM B;  4OOI A;  3VEP A;  3GW2 A;  4CXF A;  4ZYE A;  1IXC A;  4RAY A;  1IN6 A;  5E1W A;  3V8L A;  3GEZ A;  2ETH A;  4G94 A;  2L3D A;  2EV5 A;  4G9Y A;  4PDK A;  3R60 A;  4HF0 A;  3V8K A;  1GVJ A;  4HOB A;  3WE3 A;  3J80 K;  3L09 A;  3I59 A;  4MTD A;  4HZF A;  1I1G A;  4MEY F;  3I59 B;  4HX8 A;  3DPT A;  4RGU A;  4CHU A;  1LB2 A;  4S04 A;  2K7L A;  1DPR A;  4XLN F;  4KMU X;  1S3J A;  2BV6 A;  2F5E A;  5K5Q A;  2DAO A;  2VC1 A;  4FX4 A;  5CLS A;  1ZLK A;  5ILV A;  1KYZ A;  4MQ9 F;  2FNA A;  1O3R A;  4M6X A;  2Z3Y A;  1YFH A;  2RN7 A;  2AS5 F;  1H0M A;  4O6J A;  1XN7 A;  4N9I A;  1HKT A;  3FMQ A;  3TO9 A;  2P5K A;  4M74 A;  1TW2 A;  4FT8 A;  2JRT A;  4WCG A;  1YW8 A;  1IN5 A;  3WTV C;  1HKS A;  2G7H A;  4RGS A;  5L3F A;  3RYP A;  1YO5 C;  5D4S A;  3FM5 A;  4BHC A;  2FML A;  4Z2Y A;  4KT5 C;  3BY6 A;  2YSR A;  1T38 A;  2OAZ A;  3J80 Z;  1I27 A;  1G6N A;  3HOT A;  4LLN A;  3COA C;  1B6A A;  3F8N A;  3TOA A;  5TRD A;  5FGM A;  5ILU A;  2KIM A;  4QWQ A;  3WTU C;  3ZMZ A;  2O6G E;  5LEJ A;  4R8H A;  1TW3 A;  3ECO A;  2QEN A;  2NS0 A;  4HF2 A;  3I58 A;  3L7W A;  3J7A O;  1I1S A;  3K1N A;  3ISP A;  1RIO H;  3LWF A;  2X0L A;  2HYG D;  1G3T A;  4ZYD A;  4XBF A;  5CVI A;  3V8J A;  2IT0 A;  4YFK F;  3DPL C;  2V9V A;  1QNT A;  1MJ9 A;  1BIB A;  4EM2 A;  2Z9O A;  5KK1 A;  4WWC A;  5FB2 A;  2KRF A;  4UHT A;  1J59 A;  3F8B A;  1ON1 A;  4KMF A;  3IC7 A;  4MNU A;  1BC7 C;  3SZP A;  3K0L A;  3CUO A;  4MTE A;  3RIR A;  2L4A A;  1G3Y A;  2STW A;  1U8R A;  5HS9 A;  3R6S A;  3TDU C;  2D1H A;  5D6E A;  2MLG A;  4I0B A;  2CW0 F;  3HIF A;  2VT2 A;  1FT9 A;  2D1V A;  4ZZD A;  1K79 A;  2HR3 A;  1V4R A;  5DD4 A;  2XAH A;  2GAU A;  1UCR A;  2HQR A;  2VOO A;  2HOE A;  2D2W A;  3KP5 A;  4YII A;  2LF8 A;  2TDX A;  3DP7 A;  5D8L B;  1JE8 A;  4ESF A;  4JBA A;  3Q9S A;  1FYL A;  5E1X A;  3QP6 A;  2K86 A;  1F1Z A;  2ZKZ A;  1CGP A;  1RUO A;  1ODD A;  4BQA A;  2CGP A;  5D6F A;  1GXP A;  4U0V A;  4HV6 A;  4PGH A;  4UVB A;  3ABU A;  5FO5 A;  2A07 F;  3HOS A;  3VB2 A;  1B9N A;  2IW5 A;  2JPB A;  4ENM A;  2HTJ A;  3FMR A;  3Q9V A;  3T8R A;  2EJR A;  4HV5 A;  2EFO A;  2GZW A;  4CIC A;  3LA7 A;  2KJC A;  1J5Y A;  1WWX A;  1UHW A;  2HEO A;  3VOD A;  4ENN A;  2M30 A;  1RNL A;  1YS6 A;  5LRS A;  3E6D A;  1TLH B;  3TDZ C;  4PCQ A;  3IWZ A;  1P4W A;  1U3E M;  3CLO A;  5E1Z B;  3F72 A;  2Z33 A;  1LVA A;  4LJZ F;  5LRR A;  1YW9 A;  1S6L A;  1R23 A;  1P92 A;  3HRU A;  3DXJ F;  1T98 A;  1U2W A;  4MEX F;  1EV7 A;  1XMK A;  4M71 A;  4B8X A;  1PP8 F;  4N9H A;  1XCB A;  2MH9 A;  3GX4 X;  4EJT A;  4HDU A;  4RB0 A;  1BI1 A;  2R3S A;  1QZY A;  3L00 A;  3MCZ A;  2HTS A;  1QO0 D;  5E20 A;  2GQQ A;  1CF7 A;  3HTS B;  2CSO A;  5HS7 A;  2DQL A;  3GO5 A;  2VC0 A;  1XGO A;  1ZN2 A;  2EWN A;  4U7B A;  3E5X A;  2HGC A;  2NYX A;  5E8G A;  4OIO F;  3WTT C;  3TGN A;  2XKP A;  2CWE A;  3FXU A;  3CUQ A;  4XSZ F;  1YS7 A;  4A2U A;  3F6V A;  5IT3 A;  3CUQ B;  4A0Y A;  2RVC A;  4M73 A;  1P6R A;  3HUG A;  5D5W B;  3WGG A;  4LD5 A;  4UNO A;  1F5T A;  4UVC A;  2UXX A;  2MLK A;  1I5Z A;  2PQ8 A;  3F8F A;  5HVQ C;  1J7K A;  3F21 A;  3KP4 A;  4IRH A;  4YFN F;  1J9I A;  3WOD F;  3D0S A;  2GXB A;  5JR3 A;  3V7S A;  4XSX F;  4EM0 B;  2OZ6 A;  1JHH A;  2VE8 A;  4P5O A;  3ZMV A;  5ICG A;  4HLY A;  1U6G A;  3GFJ A;  2LNB A;  1XSX A;  5DUK A;  4I98 B;  4G7H F;  2LDU A;  2VOP A;  4EQQ A;  5KVR A;  3RTR A;  3PQK A;  2XRN A;  2GIV A;  1W7P A;  1R5H A;  4EJW A;  4A12 A;  1SMY F;  2QUF A;  4ON0 A;  1PP7 U;  5CJ9 A;  5BS6 A;  1UHM A;  1XDU A;  4AD9 A;  1IF1 A;  2F5D A;  4AIJ A;  3W6K B;  3F8C A;  4XLP F;  2UZK A;  4OIQ F;  4FX0 A;  2ELH A;  3WG9 A;  2YU3 A;  4LGW A;  4LG0 A;  1Z91 A;  4EV0 A;  3RDI A;  4OIP F;  4Q47 A;  2KIU A;  2ZJ2 A;  5DV5 A;  3FM3 A;  5A2Q Z;  1HW5 A;  2VOD A;  1EH6 A;  2VBY A;  3FHZ A;  2DPU A;  4LK1 F;  3ZMT A;  2ZO4 A;  4R79 A;  2O03 A;  2MBF A;  1ONV A;  1XSD A;  3ECH A;  5F6F A;  5F1R A;  1ZGJ A;  2GA2 A;  2FF4 A;  1S29 A;  1YQA A;  3KET A;  1BI0 A;  2ESH A;  3KFW X;  3WU1 B;  2NNN A;  5HOO A;  1DUX C;  4XRF A;  4Q5S F;  1DPU A;  2YPR A;  2WC2 A;  2P4W A;  1HST A;  4IXA A;  3EDP A;  3RKY A;  1HQC A;  3TO7 A;  3SHF A;  5DCM A;  2EB7 A;  2KJB A;  2RGV A;  1B9M A;  2HWV A;  5AON A;  3Q5F A;  4M9S A;  2JSC A;  1FC3 A;  1R1U A;  3BJ6 A;  1LQ1 A;  1ZLJ A;  3E6M A;  1E17 A;  1QZZ A;  2XAS A;  1JGS A;  1ZYR F;  2VBW A;  3IWF A;  4WXD A;  5IT9 Z;  1ZAO A;  3GWZ A;  3ERE D;  5DUI A;  4AIK A;  1TNS A;  1KYW A;  3V7C A;  3J81 Z;  3TKY A;  3BDD A;  2Q2E A;  3BPX A;  5K5R A;  3JW4 A;  3RJP A;  1HW1 A;  3EUH A;  3T5X A;  5CYV A;  3LQR A;  3M9A A;  1KGS A;  3H3U A;  4NQW A;  3KZY A;  5L3D A;  1U5T C;  4ENK A;  2VBX A;  3QPT A;  4GXO A;  4HA8 A;  2P7C B;  2PI0 A;  1LNW A; 
#chains in the Genus database with same CATH topology
 3RKX A;  1K78 A;  1IDY A;  5CVR A;  3E6B A;  2H6C A;  1FWZ A;  2DFI A;  3I3L A;  1YIO A;  1K78 B;  2HKX A;  1FX7 A;  3OV8 A;  3SDB A;  3DF8 A;  3CMM A;  3KLN A;  2ZCW A;  1U5T B;  5TGT A;  4B44 A;  2HDD A;  4Y52 J;  1P2F A;  1T95 A;  1Y1V J;  3CF2 A;  4E7K A;  2MFZ A;  3PFY A;  1MKM A;  2FOK A;  1D1C A;  4B09 A;  2XAJ A;  2CYY A;  1D8K A;  4PSW A;  1WHU A;  1HKQ A;  2DMQ A;  3OIP A;  1Z0X A;  1IRG A;  1YW7 A;  1R1V A;  2RDP A;  5E18 F;  5CVV A;  4PGG A;  3GTJ J;  3GTP J;  1BW5 A;  1FLI A;  4IPA A;  5JI6 A;  5LLQ A;  1RR7 A;  3PO2 J;  2IJL A;  2LSO A;  2I5U A;  1IN7 A;  3H36 A;  4HAM A;  2ID6 A;  3NWS A;  3M3Y J;  1VQ5 I;  4YFX F;  3LL7 A;  3ML6 A;  2RV8 A;  3GTO J;  3M1E A;  3HPH A;  3FXJ A;  3OY9 A;  2FUG 2;  2R7D A;  4IKF A;  2FJ1 A;  4BAY A;  3TOB A;  1RI7 A;  1FOK A;  2VI6 A;  4P9F A;  1ETV A;  4CA0 A;  3CO7 C;  3B6C A;  3CCQ I;  2KIS A;  4HSR A;  3S8P A;  3P5J A;  5FKO A;  3OYN A;  3P9C A;  1MNM C;  2VQH A;  1VI0 A;  1WJD A;  1G3S A;  1R22 A;  2OPT A;  4PSX A;  2K4J A;  4QPQ A;  2GA1 A;  2V1X A;  3DQV C;  4ABZ A;  5GAD J;  2OTL I;  4UUV A;  3NEU A;  1HDD C;  3BR1 A;  4A3F J;  3CCM I;  3JR9 A;  2LY1 A;  1TBX A;  4OU0 A;  4BBS J;  4L0Y B;  2FMY A;  3M1C A;  4HBL A;  2DU9 A;  3EET A;  5D5U B;  3JRI A;  4ZYA A;  2LKX A;  1N25 A;  4MQV A;  3DBR B;  2ZB9 A;  1BIA A;  3KYC B;  5HNF A;  2GBY A;  2X48 A;  3ZQL A;  2Z99 A;  1W5C C;  5IP7 J;  5ICF A;  3FWE A;  3ZMD A;  1GV2 A;  1I39 A;  5AIQ A;  2OQR A;  3WE2 A;  3LSJ A;  4RLQ A;  2Q8K A;  3ZQI A;  1U8B A;  1W7P D;  2EBI A;  4CH7 A;  1W36 D;  3C1D A;  1OQY A;  5J40 A;  1VTN C;  1FBQ A;  2M8E A;  2V1D A;  3D5R C;  4Q48 A;  3S14 J;  4LG3 A;  4BHP A;  3MD2 A;  2BY0 A;  4BXU A;  2LG4 A;  2BXY A;  4UUS A;  2M87 A;  2VXZ A;  1T39 A;  1BJA A;  2BVL A;  3IAM 2;  3LA2 A;  3GFM A;  4F91 B;  2H27 A;  2IS1 A;  2XAF A;  2QF7 A;  1D5V A;  4YEL A;  1OCO H;  2NOJ B;  4YIF A;  4KDP A;  3KYD B;  3TO6 A;  3K4B A;  4C3J J;  2Y0S N;  3LST A;  1ON2 A;  3OIO A;  1VQK I;  2M7A A;  4IQJ A;  4LLL A;  4KUM A;  3A0B C;  3H92 A;  3QAH A;  2M9H A;  3HG9 A;  4A3L J;  1FMV A;  2ISY A;  3JSO A;  3HOX J;  1ITY A;  1P9Q C;  2L01 A;  2KZV A;  2DBB A;  3U9G A;  2F4M B;  3G6E I;  4A3M J;  1JXS A;  1MGT A;  4RAG A;  2Q1Z B;  4BY7 J;  2X6Y A;  2H8R A;  3UR3 C;  3MKY B;  4HQM A;  4AVZ A;  4M72 A;  1R6R A;  3GYH X;  3K9T A;  1MH3 A;  3OYG A;  5LGN A;  5GAE J;  3G71 I;  3OYJ A;  2VE9 A;  4BQQ A;  2LRE A;  1XGN A;  2NRA C;  1UMQ A;  2LYC A;  2EFP A;  1LFP A;  2A69 F;  5EF6 A;  1F4K A;  3HBL A;  2R7U A;  1EJ9 A;  5DDG A;  2DA3 A;  1L0O C;  4N0B A;  3H5A A;  3L9F A;  3WGI A;  1I6X A;  1Z6R A;  4AIH A;  1O7F A;  4OIN F;  2E5Z A;  4PK4 A;  3RPU A;  2Z16 A;  2WB1 A;  2X6O A;  2MGQ A;  4ESJ A;  2R5Z B;  3BTI A;  1KZH A;  1QQI A;  1GHC A;  5JHF A;  2EH3 A;  2UV1 A;  4XQF A;  2M5W A;  2QEX I;  1HXD A;  1OYW A;  3K4N A;  3P9I A;  3D1N I;  2EIK H;  2MC4 A;  1A35 A;  2JK3 A;  2VT3 A;  3K70 C;  4IHS A;  2R7X A;  2FU4 A;  2F5V A;  2PN6 A;  5JVT A;  2K02 A;  3LA3 A;  3Q0W A;  3AAF A;  1YX3 A;  5ERI A;  2EV6 A;  1MBJ A;  4AVP A;  1TWA J;  3LMM A;  4GGG A;  1FP2 A;  2BHZ A;  2LK2 A;  2FA5 A;  4GCV A;  5HDN A;  5ED4 A;  5DS9 A;  3LOC A;  5TJJ A;  1VFC A;  2KT0 A;  2XRL A;  1RR8 C;  4BJ6 C;  1OR7 C;  5HLI A;  4Y4R A;  5K5O A;  3FIW A;  2L7Z A;  4OMY A;  4YEJ A;  1JHF A;  2MH2 A;  1AA7 A;  3H3V K;  2QQ9 A;  4L0Z B;  1UAA A;  3K4K A;  4D1Q A;  2L02 A;  3MZY A;  4FE7 A;  1W5S A;  2LMD A;  1KU9 A;  2EK5 A;  2X51 A;  2ZBK A;  3HSR A;  3AG4 H;  3S93 A;  3T0Y A;  3M8E A;  2FE3 A;  4DBR A;  1YRN B;  1ZRC A;  1OPC A;  3GBG A;  4D7M A;  1I3Q J;  1LJ9 A;  3ZQ7 A;  1QVT A;  4LK0 F;  4BBR J;  1EKE A;  1JKP C;  2E34 A;  2UWM A;  5IOZ A;  4XN3 A;  2G7U A;  2HDW A;  1WSU A;  4IJA A;  4KIS A;  3JCU C;  1E2X A;  2KIF A;  3K2A A;  3L2C A;  4L9V A;  4FQG A;  2ZFW A;  5IP6 A;  2Y48 A;  4U88 A;  3W2A A;  2XAU A;  3W6J B;  1WPK A;  1FOW A;  2X1E A;  2Y30 A;  1IAW A;  2E71 A;  4XKC A;  2ZJP F;  4UB8 C;  2IS6 A;  4RLF A;  3RI4 A;  2A6T A;  3EQL F;  2RQP A;  2IA0 A;  4L5I A;  1SVL A;  1J2X A;  4J19 A;  4M3G A;  3JSP A;  1WH5 A;  2P6S A;  3H5R A;  2HKO A;  1ZG3 A;  4IHW A;  4DIQ A;  1VQ7 I;  3CD6 I;  1BI3 A;  4XON A;  1BC8 C;  1U0J A;  4KA4 A;  2ECB A;  2V4J C;  3T1B A;  3IRQ A;  2B63 J;  4IL6 C;  4HNT A;  1BOA A;  1OYY A;  5DCF A;  1E3H A;  1KQ0 A;  3S3N A;  2LC2 A;  2ADU A;  3OYD A;  3ZN0 A;  2IAI A;  2EQR A;  4B43 A;  1G2H A;  3OYI A;  1QPM A;  2BW3 A;  4ETS A;  4HST A;  1BM9 A;  4RS8 A;  3HGY A;  4KN4 X;  4GO1 A;  2Y75 A;  3KZZ A;  4B48 A;  3CJN A;  1JI8 A;  3JTH A;  3K4L A;  1MZB A;  4UXN A;  2K9S A;  2JZY A;  4F7Z A;  3LSG A;  2WV1 A;  3I71 A;  3ABT A;  5J8C A;  3ZQC A;  2V1N A;  3TQN A;  3Q3S A;  4KFC A;  4JX5 A;  3K6G A;  5E3L A;  3HRT A;  2P8T A;  1NK3 P;  2KLO A;  3CJR B;  2HPI A;  2E5N A;  3GLL A;  3CC7 I;  1NTC A;  2RKH A;  5HLH A;  1G8X A;  2WWY A;  1XGS A;  4K2E A;  2VBZ A;  1R36 A;  4BHB A;  1Z6T A;  1U78 A;  3I64 A;  4L5E A;  5E17 F;  2E7X A;  4AU7 A;  3SQN A;  2QA4 I;  4HPQ A;  1R49 A;  1JJ8 C;  3ASO H;  2AXT C;  1BN5 A;  3HJE A;  3GZN B;  3IH2 A;  1WVR A;  2DMT A;  3FKI J;  2E36 A;  4FET A;  4G6Q A;  2NVU B;  5GP9 A;  3HOV J;  1TZL A;  2DJN A;  3CC2 I;  3S15 J;  1AWC A;  2W4S A;  1LFU P;  2P7V B;  3S32 A;  1IZ1 A;  1BJZ A;  2DXI A;  2DA4 A;  4E4H A;  1OLT A;  3G4S I;  4XRM A;  1JTX A;  4ASN A;  2B0L A;  2IS2 A;  2WB1 N;  3CDH A;  1O4X A;  1RKT A;  5L3C A;  1LDJ A;  1ZH5 A;  1T0F C;  1OJL A;  3GXO A;  2BY2 A;  4ZYH A;  1UB9 A;  3KPH A;  2R7O A;  4BJ5 C;  3PIP F;  3PNY A;  5J1U A;  4I7H A;  5D5V B;  5FLX K;  3FXM A;  5H20 A;  3GUD A;  4BYY A;  2A3S A;  3M8F A;  1ZHF A;  3MWM A;  2PBI A;  4HNU A;  2BGC A;  4BXF A;  4B1R A;  4X1E A;  3ZN1 A;  1YTY A;  5DYM A;  3FMS A;  3R61 A;  3HRS A;  2VN2 A;  3LSP A;  4EMS A;  2QYO A;  5F64 A;  5E8I A;  3S1R J;  3OWT A;  2O5R A;  3E5Q A;  4OMZ A;  4RB3 C;  3HL2 A;  3PUB A;  3BG6 A;  1N77 A;  1I50 J;  3K1P A;  2STT A;  4BE2 A;  2HZD A;  2QQ8 A;  5FLV A;  4F55 A;  4A5M A;  3R0A A;  4XLC A;  1MDM B;  2K5C A;  2OJE D;  2LY2 A;  4XOP A;  1J0R A;  1SD5 A;  2EFN A;  2HNH A;  3JAM K;  2DN0 A;  2RNJ A;  3IKV A;  3A0H C;  4A0X A;  6PAX A;  3A2K A;  1TQI A;  3MKL A;  2LVS A;  1ZR4 A;  2ACJ A;  4XOR A;  2E2I J;  1YG2 A;  2XPV A;  2E1C A;  3MAJ A;  4XKB A;  4CCJ A;  1WFX A;  5B5E C;  1JKR C;  5HDG A;  2DYS H;  2COB A;  2OD5 A;  5F0H A;  3CCE I;  4B4C A;  2VXD A;  3DLA A;  5BPI A;  1H89 C;  1KU7 A;  4U87 A;  4EVI A;  1GLN A;  2FEZ A;  2V79 A;  2VQC A;  2JJ7 A;  1DQU A;  1W4M A;  2DI3 A;  3I0T A;  3JRA A;  4IHT A;  2LF7 A;  4BDY A;  3FXQ A;  3HEF A;  1O57 A;  5M5W J;  5FRN A;  3F0C A;  5H2F C;  5CKT A;  2I10 A;  2IVM A;  2HI3 A;  1R5G A;  2BBY A;  2ZME C;  3WU0 A;  2NAZ A;  2K9N A;  2X4H A;  3CP2 A;  3QQA A;  1XCV A;  4HG2 A;  1MJA A;  4Y17 A;  5LHG A;  1UFM A;  2GM4 A;  3LFU A;  4G6D A;  3KE2 A;  3GTK J;  2Z5U A;  2L54 A;  2DTR A;  1IUF A;  4XOT A;  1IXR C;  2PFB A;  2XF6 A;  3K69 A;  2CS3 A;  3CES A;  3GZ5 A;  3RPU D;  2ZME B;  4JQF A;  4KT6 A;  1E3O C;  3TED A;  3W2W A;  5HLT A;  2MC3 A;  2MA3 A;  4CCL A;  3FHN A;  2W57 A;  1QZE A;  1VZ0 A;  1KA8 A;  1HSJ A;  5FD5 A;  4KIB A;  2GWR A;  1I6H J;  1BW6 A;  3TW7 A;  4B47 A;  4ZZL A;  2CQX A;  3CJT B;  2CH0 A;  3KCC A;  1K83 J;  1S7O A;  2CMP A;  2EPF A;  2QKL B;  3CTA A;  1Y56 A;  1X2N A;  4EJU A;  2JA8 J;  4HEA 2;  4L9J A;  2CV1 A;  1ETY A;  1OFC X;  2HOS A;  1LEA A;  4TV7 A;  2R7F A;  1HBX G;  3R0J A;  4YRV A;  4C2U A;  1T6S A;  1BI2 A;  4E7Z A;  3K70 D;  2DT5 A;  2A68 F;  3EUA A;  3PNV A;  5LEK A;  5GAG J;  2UUZ A;  2WTE A;  3K4M A;  3GFL A;  3CMA I;  3HHG A;  5L3B A;  1H9T A;  2HXO A;  1F9N A;  1X3Z B;  2F2E A;  1VQ6 I;  2OTJ I;  2P5L C;  4R1H A;  1D1B A;  4PZJ A;  2EIJ H;  3FKJ A;  2LKS A;  3CO6 C;  5F1J A;  1MIJ A;  1YYV A;  4BUP A;  4A3I J;  3M7G A;  1DDN A;  3GTM J;  4LFU A;  1LVK A;  3U1D A;  1TP4 A;  1PJR A;  1OKR A;  5J6X A;  2B9S A;  3KYL A;  3DEU A;  2VKH A;  3D5L A;  1ETQ A;  4BKX A;  2E60 A;  4LLG F;  2CW7 A;  4F92 B;  1QPI A;  1WKM A;  2X1C A;  4DW6 A;  3KEQ A;  5J8F A;  2JSP A;  3NRV A;  3WTZ A;  4YIR X;  3H9G A;  5BOX A;  3LSI A;  4E70 A;  2QCO A;  4CCN A;  1HCR A;  2GOX B;  2WY7 Q;  3DTI A;  1O7L A;  3SYT A;  2K3P A;  1O3S A;  3W6V A;  1D1A A;  5E79 C;  1B8I B;  1TQM A;  2XRO A;  3WHC A;  4GFB A;  3O2P E;  2BYV E;  5CVJ A;  1J09 A;  3OYL A;  1YJN I;  4AC0 A;  1R58 A;  2JUC A;  4JX4 A;  2HFH A;  2V9P A;  3CCU I;  1XPX A;  1S7E A;  1ETK A;  4DQ2 A;  3OYM A;  5ILS A;  1KU2 A;  1OMI A;  1TT5 B;  2W24 A;  3QWL A;  4LOC A;  4S05 A;  2DK5 A;  5K7Z A;  3VFZ A;  4IRI A;  1ULY A;  3OL3 A;  1YJW I;  3QYE A;  1JTY A;  5KCM A;  5DEQ A;  3I54 A;  3KP2 A;  5JLW A;  4BQN A;  1XMA A;  3QU6 A;  2DLL A;  1P7J A;  4RB1 A;  2QBY A;  3I4M J;  1ORK A;  1MNE A;  2O0Y A;  4NHJ A;  3MKZ A;  1MMS A;  2L0K A;  4XIC A;  3PJR A;  3SFZ A;  4QSH A;  2CQQ A;  2QBY B;  2V6E A;  3ZQF A;  3ZMS A;  4G12 A;  1SMT A;  3OYE A;  2NNY A;  2EA2 A;  3SEZ A;  5CPR B;  2IBD A;  2J5P A;  3EUK L;  1LDD A;  2QWW A;  2BY1 A;  2CUZ A;  1Z9C A;  1ZK8 A;  2OBP A;  3I9V 2;  1NH3 A;  3DU5 A;  3K2Z A;  3C7J A;  5B3S H;  1O3Q A;  3OYH A;  3WTS C;  1Y0U A;  3KX2 A;  2K4B A;  3KP7 A;  3HPG A;  2ZNY A;  3PUF A;  2CO5 A;  4PJN A;  4HQE A;  1U5T A;  5LBQ A;  4CO8 A;  5EEA A;  3CCL I;  1SFU A;  3GF2 A;  5BMZ A;  2HDC A;  4HDV A;  1F36 A;  3G3Z A;  2DK8 A;  1D0Z A;  2R7V A;  1W0T A;  3DFG A;  2CQK A;  3QRF F;  4WXC A;  5FFZ A;  1K4S A;  3G1O A;  3C3W A;  5CQE A;  1UEL B;  2A05 A;  1XGM A;  2XVC A;  3K7A J;  1OYI A;  2BE5 F;  1XD7 A;  4Y33 A;  3ZQG A;  4NNJ A;  3DBL B;  4D5C A;  2O3F A;  1FY7 A;  1VQ4 I;  2QVO A;  1ZRF A;  3WTX C;  2VKD A;  1PVE A;  3G2B A;  1SD4 A;  3O6B B;  3I53 A;  3QOP A;  3VPR A;  3REO A;  2DQR A;  2XGD A;  2XGX A;  5EGO B;  1BR2 A;  4EGY A;  1BBY A;  2NVT J;  2NS7 A;  5EZG A;  1G3W A;  1G4D A;  1P4A A;  4A6D A;  1SAX A;  5BPD A;  1V3F A;  2YX7 A;  5L3E A;  2RQQ A;  4I01 A;  4HX7 A;  3W3C A;  5GPC A;  2IA1 A;  4S0H B;  4RAF A;  5D5X B;  3BR5 A;  4ZYG A;  2GXG A;  2WAQ A;  4F52 A;  3CJQ B;  3BG9 A;  1VND A;  1Z7U A;  3IP4 B;  3S2W A;  2XAQ A;  4BJT A;  5CVU A;  3MEX A;  3GFI A;  4H4K C;  3F6O A;  3RKQ A;  1K6Y A;  4KN7 X;  4A0Z A;  4H0E A;  2LBF A;  1REP C;  2DFF A;  4JX6 A;  5BQT A;  3P9K A;  4LMY A;  5FFX A;  2IS4 A;  1TTY A;  2AQF A;  1V54 H;  4JK1 X;  2LBF B;  3U2R A;  1AU7 A;  3PO3 J;  4CYC B;  2BXZ A;  1A6Q A;  3WTY C;  1K7A A;  1ZEL A;  2E1N A;  1LEB A;  5C4X J;  4XRS A;  3QOE A;  3S3O A;  4L9T A;  2XUB A;  4EJO A;  4NBQ A;  2OCC H;  1R00 A;  2JT1 A;  1IXS B;  3BCB A;  4UUT A;  2CG4 A;  4CYD A;  3HZJ A;  2COM A;  2JPC A;  4I02 A;  4M3D A;  3BOQ A;  2OQG A;  1YOV B;  3GTL J;  4C30 A;  3S2D J;  1ZGW A;  1WI9 A;  3FF5 A;  2G0E A;  2KP6 A;  4OAY A;  1SFK A;  2AXL A;  4C2M J;  1R1T A;  2LLK A;  2F5C A;  2HZT A;  2DW4 A;  3EYI A;  1H9G A;  1RPW A;  3LNQ A;  1TWF J;  1QVU A;  1FPQ A;  3LSR A;  2O9L A;  4GYG A;  1LDK B;  4OWR B;  2VB6 A;  2FXA A;  4G8X A;  4WK8 F;  4RBO A;  4M9X A;  4CUG A;  5LHI A;  3WTW C;  3I55 I;  2QQB A;  4C2T A;  2O61 A;  2QLZ A;  1FTZ A;  3NWT A;  2Y9Z A;  4IRG A;  2FQ3 A;  2JRM A;  1Z3Y A;  4WX9 A;  5FKL A;  3PQJ A;  4XLE A;  3RKW A;  3QPL A;  3HOZ J;  2O8X A;  4RGR A;  3DCF A;  2PEX A;  2Y0M A;  3DTK A;  5ICC A;  4L9N A;  2DCE A;  2IGK A;  3E6C C;  4A6E A;  2OC6 A;  1UZC A;  4NB5 A;  3JRE A;  2HS5 A;  2X6W A;  4EGZ A;  5H6R A;  5LGT A;  3MVP A;  2YR2 A;  5D4R A;  2O7O A;  1T8I A;  2AQE A;  4JP0 A;  3AG2 H;  1IN4 A;  2CJJ A;  4BAC A;  4CCK A;  1K6O A;  4I2O A;  4UV9 A;  2AO9 A;  2Y31 A;  4IHY A;  4I09 A;  1ETW A;  1Y0N A;  1FZP B;  2NVX J;  3H5N A;  4L18 B;  2LY9 A;  3QPH A;  1LKX A;  4P96 A;  5H6Q A;  3IUO A;  4F3Q A;  3F3X A;  4B3A A;  2A5W A;  2KMU A;  1KU3 A;  3ZCO A;  2ZXH A;  3C18 A;  3JTG A;  2HYF A;  3E97 A;  2ESN A;  1XB4 A;  3LQQ A;  2VON A;  3O8G A;  4QLC U;  1FBS A;  2XAG A;  3GME A;  1D5Y A;  2M8G X;  3EYY A;  2XKO A;  1FYK A;  5M5Y J;  3RYR A;  2BOL A;  2WY8 Q;  3CLQ A;  2IP2 A;  3EPZ A;  2A5Y B;  4BY1 J;  2DTZ A;  2ID3 A;  3HYI A;  5M3M J;  5D8K B;  1ETX A;  4E7S A;  4BXX J;  2R5Z A;  4FHT A;  4ENJ A;  4KIF A;  2FBK A;  2H1L A;  2WAD A;  5L3G A;  4HF1 A;  3V42 A;  2VJ4 A;  1MBG A;  1ZG5 A;  1X1A A;  4PJ0 C;  2ICW G;  3ZPL A;  1TNT A;  4BU2 A;  1WGX A;  2DA7 A;  2JN6 A;  2DPD A;  3IKT A;  3E3V A;  1Z21 A;  2XV4 S;  2Y2Z A;  1JKO C;  3E1S A;  3MZH A;  1Z1D A;  2W7N A;  2F5F A;  3WHB A;  2EIM H;  1N75 A;  1VQM I;  1MND A;  1USS A;  3HTU A;  1XTA A;  3BJO A;  5DD8 A;  3G73 A;  1ZGA A;  2BEO A;  3VYU B;  2D5V A;  4IF4 A;  5ICE A;  3ROU A;  3NQO A;  3HOU J;  1XDS A;  2VKV A;  1E0E A;  1MMG A;  5HDK A;  5IYD J;  2LRD A;  1FP1 D;  2JTV A;  3KP3 A;  3M07 A;  1JJ6 C;  4DZJ A;  1QHG A;  3WGH A;  1DGW Y;  3ESW B;  2PMU A;  5E3O A;  1G59 A;  1IRF A;  1Y8Q B;  2WAQ N;  1C0W A;  1T2K A;  4CZZ A;  4ESB A;  1YRN A;  2RRE A;  1IRZ A;  4EJV A;  3LAP A;  4GDF A;  2M4G A;  2BHY A;  3A01 B;  3V4G A;  1SFE A;  2XDV A;  1OR7 A;  2GIZ A;  2PG4 A;  2CU7 A;  2CUE A;  2P5V A;  3K1M A;  3RPQ A;  2PMH A;  5HS8 A;  2ELJ A;  3U1K A;  3PSI A;  3FX3 A;  2DJI A;  3AFH A;  3LSH A;  3BR0 A;  2EV0 A;  4ZDO A;  1T56 A;  2UXN A;  4DJA A;  3FZV A;  4KIC A;  2J5O A;  1AOY A;  1ZAR A;  3QP5 A;  2XB5 A;  5LD2 C;  4W1U A;  1POG A;  3LFK A;  1YHQ I;  5IY5 H;  2E2H J;  4RA2 A;  4RB2 C;  1A6I A;  3I4P A;  3DLL F;  2EZL A;  3KLO A;  3OS0 A;  3OOP A;  4RGX A;  3UNG C;  2P6T A;  4A5N A;  4XNF A;  4XLF A;  2OU2 A;  4X0G A;  2R5Y B;  1OCP A;  3BPV A;  3E5U A;  4E6K G;  2XPW A;  4I6Z A;  1Q1H A;  3KEY A;  1BR1 A;  3V7R A;  5JFR A;  4N4O B;  3SZG A;  4KNY A;  3IRR A;  1D3Y A;  1CQT A;  2V1U A;  3BWG A;  4WF2 A;  4LIT A;  3W2V A;  4JYK A;  3PIO F;  4G7Z F;  2M0M A;  2A6E F;  1IW7 F;  3ABL H;  2O8K A;  3HM5 A;  4HW0 A;  4DNC A;  4ZH4 F;  1DP7 P;  3ULQ B;  1X3U A;  3BR2 A;  1DP3 A;  2FBH A;  4ZDP A;  4UV8 A;  3HOY J;  1SFX A;  5EEH A;  3ZGK A;  3KEO A;  2EA4 A;  3U21 A;  4LB5 A;  1S8N A;  1ZTR A;  4BH9 A;  3DV8 A;  2W82 A;  2DO7 A;  3HSE A;  1GT0 C;  3SXY A;  1F43 A;  1DGR M;  4GYI A;  3F22 A;  2KKO A;  2H94 A;  1MMN A;  3X2Q H;  3N4M A;  1EA3 A;  2FBI A;  1ZG1 A;  2DOD A;  2WAF A;  4QTR A;  2HVR A;  1SD7 A;  3RZD J;  4F93 B;  3J7A Y;  3ONQ A;  5JHU A;  3HHH A;  2DA5 A;  4BL0 B;  3BRO A;  3KP6 A;  1YI2 I;  3GLX A;  4BGD A;  3CUQ C;  3ZP5 A;  1VQL I;  1Z05 A;  2FNP A;  3H3Z A;  1CF7 B;  3CZ6 A;  3OR1 C;  5B1B H;  2ZJQ F;  1I3A A;  4M9Z A;  4XK4 A;  3MFK A;  4AM3 A;  4HRI A;  1WQ2 A;  1Z3X A;  5J4Y A;  2MD0 A;  2H09 A;  2CFX A;  4Y15 A;  2G9W A;  3OYK A;  4I0A A;  2K27 A;  1OCZ H;  2OZU A;  3GVA A;  4B3X A;  5FJ8 J;  1ZRD A;  2A6H F;  1D8J A;  3LAJ A;  1WH7 A;  4Q4Z F;  2IRF G;  3K4J A;  5J4V A;  4A3J J;  1KQ9 A;  1EH7 A;  2MD5 A;  5EDN A;  1RZ4 A;  3GCM A;  3GZ6 A;  3HUG B;  1PYV A;  2H6B A;  2GXA A;  3DWL E;  2W25 A;  1T0F A;  4Y13 A;  2F6C A;  3CCY A;  3WU2 C;  2PJR A;  3ELK A;  2FRH A;  5LGU A;  1ENH A;  3BP8 A;  2PJR B;  2LTP A;  1EF4 A;  1ZQ3 P;  4HLX A;  1B59 A;  4UVA A;  2L9R A;  2F4O B;  3VSK A;  3H0D A;  1X19 A;  1IDZ A;  3IHU A;  1FIA A;  1MDM A;  2A61 A;  2DDA A;  4OIR F;  1MD0 A;  3B02 A;  2L9N A;  4O5V A;  5EEG A;  3G1L A;  2IPQ X;  4KYW A;  2PJP A;  2R92 J;  2ZNZ A;  3IL2 A;  4RAZ A;  2HOT A;  2YX4 A;  5A2Q K;  2VPL A;  2R93 J;  1TQP A;  3HSF A;  4M3E A;  3VOE A;  3BJA A;  1ZRE A;  1XMX A;  3OOU A;  4A3E J;  2QQA A;  3MN2 A;  3O8H A;  5IOY A;  2M4K A;  2EFW A;  2EZH A;  2L4M A;  3BZK A;  5IPA A;  4U7D A;  2HQA A;  2FOW A;  3ZOB A;  5K1Y A;  2R7S A;  1FBU A;  3FDY A;  3PFI A;  4IHX A;  3F8M A;  1S7A A;  2HYJ A;  3M8J A;  3FXR A;  1FSH A;  2HU9 A;  2E7W A;  1N78 A;  1R7J A;  3RCO A;  2EZI A;  4A69 C;  3HB9 A;  1GXQ A;  2CQ7 A;  2L7K A;  5FKK A;  2X9D A;  2W84 A;  4DOZ A;  3PL8 A;  1QHH D;  1RRJ A;  2DOA A;  1W7P B;  3S1N J;  1HA8 A;  2C6Y A;  1HOM A;  1MBF A;  3BR6 A;  1IN8 A;  3SZT A;  2ZME A;  1NHA A;  3QU3 A;  4WXH A;  1RUN A;  2ISZ A;  3F23 A;  5FLX Z;  1STZ A;  2F4I A;  4CGZ A;  1W5T A;  3O3K A;  4DZP A;  3CC4 I;  1BL0 A;  5KAI C;  1PUE E;  2M45 A;  5FD6 A;  4NDL A;  1HW2 A;  4HYE A;  1QGP A;  5F04 A;  1QBJ A;  1XG1 A;  3N97 A;  1WRJ A;  3K10 A;  3RQI A;  3AKZ A;  1TT0 A;  2HQN A;  3I5U A;  2WA0 A;  4IEJ A;  3T8T A;  4EM1 A;  4U0Y A;  2D45 A;  4M6Y A;  2FSW A;  2W85 A;  4E7L A;  4M3B A;  4PFP A;  2QZ8 A;  5IT9 K;  2L7F P;  4ZDL A;  4C9Y A;  4IVN A;  1VQ9 I;  4M3F A;  2JUG A;  1MH4 A;  4LG0 B;  4E7J A;  1FYM A;  2QSF X;  1A04 A;  4KIG A;  1HC8 A;  1J75 A;  4FAS D;  3J81 K;  5IYB J;  4AYB A;  2R7R A;  3B6A A;  4MHG A;  4L5J A;  4AWX B;  2JA7 J;  1YLF A;  3JAM Z;  2JQ7 A;  4LB6 B;  1WJE A;  2MYS A;  3ZMU A;  3BZ6 A;  4GRI A;  3GTQ J;  5M3F J;  2LR8 A;  1PDN C;  1L3L A;  2Q0O A;  2XIG A;  1XX5 A;  1B72 B;  1WI3 A;  4RM3 A;  3FXK A;  2LOO A;  4FCY A;  4U0W A;  1HF0 A;  4X6A J;  1MJB A;  2N8G A;  4BNC A;  1B4A A;  4YG2 F;  2QM3 A;  2EIL H;  3HRM A;  2ZXJ A;  4HX4 A;  1LUJ B;  4CDG A;  3BG7 A;  5FKM A;  1YX5 A;  2V6C A;  4D0P A;  1SD6 A;  2CV2 A;  1LFB A;  3R4K A;  5C4J J;  1IUY A;  1WCM J;  1NK2 P;  2K85 A;  3SFI A;  4O3M A;  3JRC A;  1XSV A;  4P55 A;  3P7N A;  1FSE A;  1B1B A;  3B73 A;  1O3T A;  2EFQ A;  3CP8 A;  3L2U A;  1VF9 A;  1NG7 A;  4KJZ A;  4ZTF A;  1B8I A;  1WJF A;  1EH8 A;  2OA4 A;  3CQZ J;  2XHK A;  1AHD P;  2PLY A;  4P9U A;  1UST A;  2M1B A;  5HLG A;  2HPM A;  4LIU A;  4G7O F;  2KZG A;  3UKG A;  2LKP A;  1NG6 A;  2HOA A;  5IYC J;  3DKW A;  3RZO J;  1MBK A;  1ZKG A;  1P4X A;  5LHH A;  1Z7L A;  5AIP A;  2JA2 A;  2CW8 A;  1FNN A;  2H1K A;  3S16 J;  4MGR A;  2IA2 A;  3MQ0 A;  2NS8 A;  1QA6 A;  2JVG A;  1YIT I;  1KQ8 A;  2RC4 A;  4QIW N;  2WV0 A;  5DCM B;  4OOI A;  3VEP A;  3GW2 A;  4CXF A;  3F9K A;  2XB0 X;  4ZYE A;  3E7L A;  1IXC A;  4RAY A;  1IN6 A;  5E1W A;  3V8L A;  1WJ5 A;  2WAE A;  3GEZ A;  4DBQ A;  1K4T A;  3HGG A;  4XMY A;  1DU6 A;  2ETH A;  1WJC A;  2PMZ A;  1MSE C;  4G94 A;  1IRX A;  2M34 A;  2L3D A;  3OYC A;  2EV5 A;  4G9Y A;  4PDK A;  3R60 A;  2LH9 A;  4HF0 A;  3V8K A;  1ZR2 A;  1GVJ A;  5EG0 A;  3EUH C;  4HOB A;  2M2E A;  3WE3 A;  3J80 K;  3JRF A;  1S5L C;  1SVM A;  3L09 A;  2VQG A;  4II3 A;  3I59 A;  5EG0 B;  4MTD A;  4HZF A;  4A3B J;  1I1G A;  2I8D A;  4MEY F;  1X4O A;  3L2R A;  3I59 B;  4HX8 A;  2BY3 A;  2ECC A;  3DPT A;  4RGU A;  4CHU A;  1LB2 A;  1X58 A;  1Y39 A;  1MW7 A;  2DFH A;  4S04 A;  1VQP I;  1RET A;  2K7L A;  5FRO A;  1DPR A;  5FRM A;  3BG3 A;  3ZRG A;  4XLN F;  2Q2E B;  4KMU X;  1S3J A;  2HVQ A;  1MBH A;  2BV6 A;  2F5E A;  2KPM A;  3DPU A;  1WZ2 A;  5B1A H;  2YU9 J;  5K5Q A;  2DAO A;  2VC1 A;  3QPS A;  4I99 C;  1RC9 A;  4XN0 A;  4FX4 A;  5CLS A;  2ZXW H;  3A03 A;  4NQW B;  1ZLK A;  1UG2 A;  5ILV A;  1KYZ A;  4E7I A;  4HNV A;  4EAT A;  4MQ9 F;  2FNA A;  3KZI C;  1O3R A;  2OF7 A;  2HQ5 A;  4M6X A;  5EGO A;  2Z3Y A;  4PFO A;  1YFH A;  4A3G J;  2RN7 A;  1S9H A;  5FLM J;  2AS5 F;  1H0M A;  4O6J A;  4PJM A;  1XN7 A;  4N9I A;  2L9S A;  1A5J A;  1HKT A;  1TWG J;  3FMQ A;  3TO9 A;  2IGO A;  2P5K A;  4M74 A;  5FKN A;  2YS9 A;  1TW2 A;  2JA6 J;  4FT8 A;  2JRT A;  2X1D A;  4WCG A;  1YW8 A;  3BR3 A;  1IN5 A;  1FMW A;  5J47 A;  3WTV C;  3LSK A;  2VLA A;  1HKS A;  2EIN H;  1GVD A;  4D7N A;  2VL8 A;  2G7H A;  2K3F A;  4RGS A;  1GV5 A;  2KFD A;  2DOF A;  2Y69 H;  3OS1 A;  4ZJZ A;  1YIJ I;  5L3F A;  1V5F A;  3RYP A;  1YO5 C;  1U9O A;  5D4S A;  3FM5 A;  3HDD A;  2DYR H;  2K9L A;  4AYB N;  4CYC A;  4J01 A;  3NAR A;  4BHC A;  1AKH A;  3CMY A;  2CUJ A;  3SDG A;  4PJL A;  2ME6 A;  3OL4 A;  3H35 A;  2KQR A;  2FML A;  1SEU A;  4Z2Y A;  1MMA A;  4KT5 C;  3BY6 A;  1HLV A;  1AKH B;  2QSH X;  2DA1 A;  2YSR A;  1T38 A;  2OAZ A;  3J80 Z;  2ZJR F;  1I27 A;  1IV6 A;  1G6N A;  1SVO A;  1UHS A;  3HOT A;  4LLN A;  2TRT A;  5GAH J;  3COA C;  2VJJ A;  2KIQ A;  1R4M B;  1B6A A;  2W48 A;  3F8N A;  3TOA A;  1LE8 A;  1RKW A;  5TRD A;  3C2H A;  3DU6 A;  5FGM A;  5ILU A;  4KIT B;  2KIM A;  4QWQ A;  3WTU C;  3ZMZ A;  2O6G E;  1MSF C;  3BQZ A;  1LE8 B;  5LEJ A;  2OV7 A;  4R8H A;  1TW3 A;  2XF5 A;  2VJ5 A;  5EZH A;  3ECO A;  3FXL A;  3HOW J;  2QEN A;  2NS0 A;  2W00 A;  4HF2 A;  1QU3 A;  3I58 A;  3L7W A;  3J7A O;  2CQN A;  1I1S A;  5F0F A;  3FBI B;  3K1N A;  2VAS A;  3ISP A;  3BCA A;  1RIO H;  3LWF A;  4RMN A;  2X0L A;  1X4P A;  1V55 H;  2HYG D;  3I4N J;  3C2B A;  1G3T A;  4ZYD A;  4XBF A;  3JRH A;  3H9Q A;  5CVI A;  2M7B A;  3L2Q A;  1MMD A;  3CCV I;  3E0J B;  1X1C A;  3VYS B;  3V8J A;  2IT0 A;  4YFK F;  3DPL C;  2V9V A;  3J7Y J;  1X1B A;  1QNT A;  1MJ9 A;  2L9V A;  2AHQ A;  3TL4 X;  1BIB A;  4EM2 A;  2Z9O A;  5KK1 A;  1JGG A;  2X6X A;  1ACI A;  4WWC A;  3OR2 C;  1MBE A;  1V5E A;  3S2H J;  5FB2 A;  1Y6I A;  2KRF A;  4UHT A;  1J59 A;  3F8B A;  1FEX A;  4XR6 A;  1ON1 A;  4A3C J;  1R9T J;  3OMY A;  2VJI A;  4KMF A;  1UG0 A;  3IC7 A;  5J3L A;  4MNU A;  2Y9Y A;  4UUS B;  1JKQ C;  1BC7 C;  3QYF A;  2VPR A;  3SZP A;  2PMZ N;  3K0L A;  2LFB A;  2X85 A;  3CUO A;  3OIQ A;  2VIX A;  2LD5 A;  4I76 A;  4MTE A;  3RIR A;  2L4A A;  3VSL A;  3S17 J;  3SEQ A;  4ITV A;  1G3Y A;  3G1M A;  4BE1 A;  3FK7 A;  4IQ4 A;  2STW A;  3IV5 A;  3ABK H;  1U8R A;  3CDL A;  5HS9 A;  3R6S A;  5LFA A;  3TDU C;  5CQG A;  2D1H A;  5D6E A;  2MLG A;  3DEE A;  4I0B A;  4NUB A;  2CW0 F;  3HIF A;  2B7E A;  2VT2 A;  1FT9 A;  2D1V A;  4ZZD A;  2JVH A;  1XS9 A;  1K79 A;  3MKW B;  4MFE A;  2HR3 A;  1LPQ A;  2MW8 A;  1V4R A;  5DD4 A;  3TP3 A;  2Z1D A;  1W1W E;  2XAH A;  4V2G A;  3HC7 A;  4V2F A;  2GAU A;  1UCR A;  2HQR A;  3CCR I;  2VOO A;  1U9N A;  2HOE A;  2D2W A;  3KP5 A;  2ELK A;  4YII A;  2LF8 A;  2TDX A;  3DP7 A;  5D8L B;  2MG4 A;  1JE8 A;  4ESF A;  2ZC2 A;  2XGE A;  3S1M J;  9ANT A;  2RNG A;  4JBA A;  2E1M C;  2HVS A;  1V5G A;  3Q9S A;  1FYL A;  5TIS C;  5E1X A;  3QP6 A;  1BA5 A;  2K86 A;  1JT0 A;  1F1Z A;  2ZKZ A;  1ETO A;  3PNT A;  1CGP A;  1RUO A;  3MZ8 A;  1ODD A;  3BT9 A;  2R0Q C;  4BQA A;  1Q1V A;  2CGP A;  5D6F A;  4MFD A;  1GXP A;  4U0V A;  3ZR8 X;  2CRG A;  4HV6 A;  1OIS A;  4PGH A;  3ABU A;  4UVB A;  2BZT A;  5FO5 A;  2E1M B;  2R7Z J;  2A07 F;  3HOS A;  3DTE A;  3CCJ I;  1H88 C;  3M4O J;  3ABM H;  3VB2 A;  4CZC A;  2VUM J;  3TBI A;  4BDZ A;  3A01 A;  3L2V A;  1B9N A;  2K9Q A;  2IW5 A;  2JPB A;  4ENM A;  2DMN A;  2HTJ A;  3FMR A;  1KON A;  3Q9V A;  3K4C A;  3T8R A;  2XSJ C;  3Q0U A;  2KDO A;  2EJR A;  3H0G J;  2EFO A;  4HV5 A;  1FOX A;  3OYB A;  3RSN A;  4LIV A;  2GZW A;  4CIC A;  4A3D J;  3LA7 A;  4IX7 A;  2KDZ A;  3OS2 A;  3LSM A;  1WJA A;  2KJC A;  2NVY J;  1J5Y A;  1WWX A;  1D0X A;  2K40 A;  1UHW A;  2PX9 A;  2HEO A;  1TWC J;  4NC7 A;  1IC8 A;  1IG7 A;  2R5Y A;  3ZQQ A;  3VOD A;  4ENN A;  4EEF G;  2M30 A;  1X1D A;  3CF5 F;  2VKE A;  4XLA A;  1RNL A;  1YS6 A;  5LRS A;  3E6D A;  1TLH B;  1TC3 C;  3TDZ C;  4PCQ A;  2R7W A;  3IH4 A;  3IWZ A;  1P4W A;  3VYT B;  3JRB A;  1U3E M;  4C3I J;  3CLO A;  5E1Z B;  3F72 A;  3BQY A;  5B66 C;  2Z33 A;  2XPU A;  1D0Y A;  1LVA A;  4LJZ F;  4ZTJ A;  3H1C A;  5LRR A;  1YW9 A;  3S1Q J;  1S6L A;  5KNL A;  2JWT A;  4M6V A;  4NC6 A;  4IO9 F;  2CV0 A;  1R23 A;  1IJW C;  2CUF A;  2QSG X;  3DKY A;  1P92 A;  3HRU A;  5EJC A;  5DTD A;  3DXJ F;  1VQO I;  1T98 A;  1TWH J;  1U2W A;  4MEX F;  5E3M A;  1EV7 A;  1XMK A;  4M71 A;  4RM2 A;  4B8X A;  1PP8 F;  1VQN I;  1ERD A;  4N9H A;  1XCB A;  2IEK A;  2MH9 A;  3N05 A;  4UB6 C;  3GX4 X;  4HDU A;  4EJT A;  4RB0 A;  4FIS A;  1BI1 A;  3CDI A;  2R3S A;  3AL0 C;  1H8A C;  4ZC3 A;  1FTT A;  2BW3 B;  1QZY A;  3NAU A;  4AID A;  1TL8 A;  1R5I D;  4IOC F;  3L00 A;  3MCZ A;  2HTS A;  3CCS I;  1OCC H;  1SFO J;  3A4C A;  2R4G A;  1QO0 D;  2RAE A;  5HNH A;  5E20 A;  2GQQ A;  1CF7 A;  2L7M P;  1JT6 A;  2CSO A;  2OUM A;  3HTS B;  5HS7 A;  5KHD A;  2DQL A;  3GO5 A;  2VC0 A;  1FOY A;  3BG5 A;  1XGO A;  4DGW B;  4MLO A;  1ZN2 A;  2EWN A;  4U7B A;  3E5X A;  2Z2S B;  2YUS A;  3AL0 B;  5F0C A;  2HGC A;  3TP0 A;  5KAF C;  2MSY A;  3L1P A;  2NYX A;  3BTJ A;  2FX0 A;  5E8G A;  4OIO F;  4D9J A;  2P0W A;  5EYR A;  3WTT C;  3TGN A;  2XKP A;  4JOM A;  2CWE A;  3FXU A;  3CUQ A;  1K61 A;  4PJJ A;  4XSZ F;  1YS7 A;  1R71 A;  4A2U A;  3F6V A;  2NVQ J;  5IT3 A;  3CUQ B;  4A0Y A;  3BTC A;  3PM1 A;  2LP0 A;  3OSG A;  2RVC A;  4M73 A;  1P6R A;  4DYR A;  1PUF A;  3HUG A;  1GUU A;  4XKW A;  3WGG A;  5D5W B;  1W0U A;  4LD5 A;  4UNO A;  1F5T A;  2E1O A;  4DYC A;  1PUF B;  4UVC A;  2ZFU A;  1JUP A;  1A31 A;  2P81 A;  4G6T B;  4ANJ A;  5K7F A;  2UXX A;  2MLK A;  1M1E B;  2E19 A;  2WBM A;  1I5Z A;  2PQ8 A;  3F8F A;  5JLX A;  5HVQ C;  1J7K A;  3F21 A;  4RDU A;  1S72 I;  4D5F A;  1X3W B;  2XC7 A;  3KP4 A;  3CME I;  4IRH A;  4YFN F;  1HDP A;  3PSF A;  3DKX A;  1J9I A;  1E3P A;  1IGN A;  3WOD F;  2L5Q A;  4XL9 A;  3D0S A;  3A1Y A;  2GXB A;  1DU0 A;  5JR3 A;  3V7S A;  2QKM B;  3H9J A;  4XSX F;  1SC7 A;  1WJB A;  4EM0 B;  2DT7 B;  2OZ6 A;  5GPA A;  4QPO A;  5HOD A;  3S3M A;  2DFE A;  3QOD A;  5E3N A;  2E2J J;  3OSF A;  1BOB A;  2L2O A;  3HKZ A;  1JUM A;  1JHH A;  2XGC A;  2VE8 A;  4P5O A;  4N4N B;  3ZMV A;  3RQ4 A;  1SAN A;  4CSW A;  5ICG A;  4FTH A;  4CCM A;  4HLY A;  1U6G A;  3GFJ A;  2LNB A;  2BVM A;  4BS9 A;  2NXN B;  1XSX A;  5DUK A;  4I98 B;  4G7H F;  1W36 C;  1OCR H;  1T33 A;  2LDU A;  3BZC A;  2DDB A;  5GTI C;  2VOP A;  4EQQ A;  2GOM A;  2DMP A;  5KVR A;  3RTR A;  2M0C A;  3DBH B;  3WG7 H;  3PQK A;  2XRN A;  2GIV A;  4XRS G;  1W7P A;  3BLY A;  1R5H A;  2DA6 A;  4EJW A;  1IV8 A;  3FIS A;  4NC8 A;  3TW6 A;  4IOA F;  2DT6 A;  4A12 A;  1SMY F;  2JMW A;  2QUF A;  4ON0 A;  1PP7 U;  4C3H J;  5CJ9 A;  5BS6 A;  1UHM A;  2F48 A;  4MIM A;  1T08 B;  1XDU A;  5M5X J;  3VDX A;  2GLO A;  5C3E J;  2W1O A;  4AD9 A;  3MMY B;  1IF1 A;  2V9K A;  4Y7N J;  2F5D A;  2HXI A;  4AIJ A;  3FXO A;  3D5S C;  2FD5 A;  4MO7 A;  3W6K B;  3I56 I;  2H8W A;  3F8C A;  3KIO A;  4XLP F;  3BC8 A;  2UZK A;  2DMU A;  3IH3 A;  4OIQ F;  4FX0 A;  5K7H A;  2ELH A;  2V7F A;  4W97 A;  3WG9 A;  1GDT A;  2YU3 A;  1FIP A;  4AUX A;  4LGW A;  1YE9 A;  4LG0 A;  3FBN B;  2TCT A;  2JA5 J;  1Z91 A;  3OYF A;  4EV0 A;  3OYA A;  4XLH A;  1YJ9 I;  3RDI A;  4BEH A;  4BQO A;  3ZQH A;  5GTH C;  2KRH A;  4BEH B;  4OIP F;  2OCE A;  4Q47 A;  4FE4 A;  2KIU A;  4IZZ A;  2ZJ2 A;  5DV5 A;  3FM3 A;  1SAU A;  5DM6 F;  1QRY A;  1BR4 A;  5A2Q Z;  1Y8R B;  2CFO A;  1HW5 A;  3TMO A;  1B72 A;  2VOD A;  1EH6 A;  2VBY A;  3FHZ A;  3L2W A;  1R4N B;  2DPU A;  4LK1 F;  3FK6 A;  3ZMT A;  4Z6Y A;  2ZO4 A;  4A3K J;  4R79 A;  4V19 K;  2ZSH B;  2O03 A;  3QYB A;  2MBF A;  4Y3O A;  3IAS 2;  2XSD C;  5JVG F;  1ONV A;  1OCT C;  2ME0 A;  2FQ4 A;  3DEW A;  1XSD A;  4P1W A;  3ECH A;  3VYR B;  5F6F A;  4PUS A;  1UJ8 A;  1APL C;  5F1R A;  1ZGJ A;  2GA2 A;  2FF4 A;  2M3A A;  1S29 A;  1X1P A;  1YQA A;  5F08 A;  2KL4 A;  1BI0 A;  2NOG A;  3KET A;  2EZK A;  2ESH A;  3KFW X;  3WU1 B;  4DYQ A;  1X2M A;  2MAB A;  2NNN A;  5HOO A;  1Y1W J;  4IHV A;  1DUX C;  4XRF A;  4Q5S F;  1DPU A;  2YPR A;  1RES A;  1XC5 A;  2XF7 A;  2WC2 A;  2P4W A;  1HST A;  3HXL A;  4IXA A;  2R7Q A;  3EDP A;  3RKY A;  4BE0 A;  1HQC A;  3TO7 A;  3SHF A;  2IXS A;  2EB7 A;  5DCM A;  2KJB A;  2RGV A;  2IGN A;  1B9M A;  3Q0V A;  4UY8 I;  2DA2 A;  3JRD A;  2HWV A;  5AON A;  3Q5F A;  1IO2 A;  1Z77 A;  2JSC A;  1FC3 A;  4M9S A;  3VWB A;  2K9M A;  1R1U A;  3BJ6 A;  4CCO A;  5J1R A;  1LQ1 A;  2VQL A;  1ZLJ A;  3E6M A;  1E17 A;  1QZZ A;  2XAS A;  2QGU A;  3ZXS A;  1JGS A;  1ZYR F;  4II2 A;  4J00 A;  2KRC A;  3HKZ N;  2Y0S A;  2DOE A;  2VBW A;  3IWF A;  3J7Z I;  4WXD A;  5IT9 Z;  5IP9 J;  3C2G A;  1ZAO A;  3GWZ A;  3ERE D;  5DUI A;  2ZXI A;  4XM3 A;  4AIK A;  5DM7 F;  2KHM A;  1TNS A;  1KYW A;  4OAZ A;  1P7I A;  1JUS A;  3AG1 H;  3V7C A;  4XID A;  3J81 Z;  4XKV A;  3ERM A;  4E7H A;  3TKY A;  3BDD A;  1VQ8 I;  5BNG A;  2Q2E A;  3SJM A;  2ZSI B;  3BPX A;  5K5R A;  2IGM A;  3JW4 A;  3RJP A;  1HW1 A;  3AG3 H;  3EUH A;  3BTL A;  3T5X A;  5CYV A;  5F27 A;  3JRG A;  4A93 J;  3LQR A;  2R7T A;  1Z67 A;  3M9A A;  3GTG J;  2E35 A;  1KGS A;  3H3U A;  4NQW A;  3KZY A;  5L3D A;  1U5T C;  2V26 A;  4ENK A;  5J1Y A;  3A02 A;  2VBX A;  3QPT A;  4GXO A;  4HA8 A;  5C44 J;  2P7C B;  2PI0 A;  3ASN H;  1A36 A;  1FJL A;  1LNW A; 
#chains in the Genus database with same CATH homology
 3RKX A;  1K78 A;  5CVR A;  3E6B A;  2H6C A;  1FWZ A;  2DFI A;  1YIO A;  1K78 B;  2HKX A;  1FX7 A;  3OV8 A;  3DF8 A;  3KLN A;  2ZCW A;  1U5T B;  1P2F A;  1MKM A;  2FOK A;  4B09 A;  2XAJ A;  2CYY A;  1D8K A;  1HKQ A;  1IRG A;  1YW7 A;  1R1V A;  2RDP A;  5E18 F;  5CVV A;  4PGG A;  1FLI A;  4IPA A;  5JI6 A;  5LLQ A;  2IJL A;  2LSO A;  1IN7 A;  4HAM A;  4YFX F;  3ML6 A;  2RV8 A;  3M1E A;  2R7D A;  4BAY A;  3TOB A;  1RI7 A;  1FOK A;  4P9F A;  3CO7 C;  3P9C A;  1G3S A;  1R22 A;  2K4J A;  2GA1 A;  2V1X A;  3DQV C;  4UUV A;  3NEU A;  1TBX A;  4OU0 A;  4L0Y B;  2FMY A;  4HBL A;  2DU9 A;  3EET A;  5D5U B;  4MQV A;  1BIA A;  2Z99 A;  5ICF A;  3FWE A;  3ZMD A;  5AIQ A;  2OQR A;  3WE2 A;  2Q8K A;  1W7P D;  3C1D A;  1VTN C;  1FBQ A;  2M8E A;  2V1D A;  4Q48 A;  4BHP A;  4BXU A;  2M87 A;  2VXZ A;  1T39 A;  1BJA A;  3LA2 A;  2H27 A;  3GFM A;  2XAF A;  1D5V A;  4YIF A;  4KDP A;  3TO6 A;  3LST A;  1ON2 A;  4LLL A;  4KUM A;  3H92 A;  3QAH A;  2ISY A;  3JSO A;  2L01 A;  2DBB A;  3U9G A;  1JXS A;  1MGT A;  4HQM A;  4M72 A;  3GYH X;  3K9T A;  5LGN A;  2VE9 A;  1XGN A;  2NRA C;  2EFP A;  2A69 F;  1F4K A;  5DDG A;  1L0O C;  4N0B A;  3L9F A;  3WGI A;  1I6X A;  1Z6R A;  4AIH A;  1O7F A;  4OIN F;  3RPU A;  4ESJ A;  1QQI A;  1GHC A;  2M5W A;  1HXD A;  1OYW A;  3P9I A;  2VT3 A;  4IHS A;  2FU4 A;  2PN6 A;  5JVT A;  2K02 A;  3LA3 A;  3AAF A;  5ERI A;  2EV6 A;  4AVP A;  4GGG A;  1FP2 A;  5HDN A;  5ED4 A;  2FA5 A;  4GCV A;  5TJJ A;  5HLI A;  5K5O A;  4OMY A;  1JHF A;  2MH2 A;  2QQ9 A;  4L0Z B;  2L02 A;  3MZY A;  1W5S A;  1KU9 A;  2EK5 A;  2ZBK A;  3HSR A;  1ZRC A;  3T0Y A;  3M8E A;  2FE3 A;  1OPC A;  1LJ9 A;  3ZQ7 A;  4LK0 F;  2UWM A;  2G7U A;  1WSU A;  4IJA A;  1E2X A;  2KIF A;  3L2C A;  4L9V A;  2ZFW A;  2Y48 A;  4U88 A;  3W6J B;  1IAW A;  3RI4 A;  3EQL F;  2RQP A;  2IA0 A;  4L5I A;  1J2X A;  3JSP A;  2P6S A;  2HKO A;  1ZG3 A;  1BI3 A;  1BC8 C;  4KA4 A;  3T1B A;  3IRQ A;  1BOA A;  1OYY A;  5DCF A;  1KQ0 A;  2ADU A;  3ZN0 A;  1QPM A;  4ETS A;  1BM9 A;  4RS8 A;  4KN4 X;  4GO1 A;  2Y75 A;  3KZZ A;  3CJN A;  3JTH A;  1MZB A;  4UXN A;  2JZY A;  4F7Z A;  3I71 A;  3ABT A;  5J8C A;  4KFC A;  3TQN A;  3HRT A;  2P8T A;  2RKH A;  5HLH A;  2WWY A;  1XGS A;  4K2E A;  2VBZ A;  1R36 A;  4BHB A;  1Z6T A;  1U78 A;  3I64 A;  5E17 F;  2E7X A;  3SQN A;  1BN5 A;  4G6Q A;  1AWC A;  2P7V B;  1IZ1 A;  4ASN A;  2B0L A;  3CDH A;  5L3C A;  1LDJ A;  1ZH5 A;  3GXO A;  4ZYH A;  1UB9 A;  4I7H A;  5D5V B;  5FLX K;  5H20 A;  3GUD A;  4BYY A;  2A3S A;  3M8F A;  1ZHF A;  3MWM A;  2PBI A;  2BGC A;  3ZN1 A;  1YTY A;  5DYM A;  3FMS A;  3R61 A;  3HRS A;  2VN2 A;  4EMS A;  2QYO A;  5F64 A;  5E8I A;  3E5Q A;  4OMZ A;  4RB3 C;  3K1P A;  2STT A;  4A5M A;  3R0A A;  1MDM B;  1J0R A;  1SD5 A;  2EFN A;  3JAM K;  2RNJ A;  3IKV A;  4A0X A;  6PAX A;  1TQI A;  2ACJ A;  1YG2 A;  2E1C A;  3MAJ A;  5HDG A;  2OD5 A;  5BPI A;  1KU7 A;  4EVI A;  2FEZ A;  2V79 A;  1W4M A;  2DI3 A;  3I0T A;  4IHT A;  2LF7 A;  3FXQ A;  1O57 A;  2IVM A;  1R5G A;  2BBY A;  3WU0 A;  2NAZ A;  2X4H A;  1XCV A;  1MJA A;  4Y17 A;  5LHG A;  1UFM A;  4G6D A;  3KE2 A;  2Z5U A;  2L54 A;  2DTR A;  1IXR C;  2PFB A;  3K69 A;  3GZ5 A;  2ZME B;  4JQF A;  2MC3 A;  2MA3 A;  2W57 A;  1KA8 A;  1HSJ A;  5FD5 A;  4KIB A;  2GWR A;  4ZZL A;  3KCC A;  1S7O A;  3CTA A;  4EJU A;  4L9J A;  1LEA A;  4TV7 A;  2R7F A;  1HBX G;  3R0J A;  1T6S A;  1BI2 A;  2DT5 A;  2A68 F;  5LEK A;  2WTE A;  3GFL A;  3HHG A;  5L3B A;  1H9T A;  1F9N A;  2F2E A;  2P5L C;  4R1H A;  4PZJ A;  3CO6 C;  1DDN A;  1YYV A;  3M7G A;  4LFU A;  3U1D A;  1OKR A;  5J6X A;  3DEU A;  3D5L A;  4LLG F;  1WKM A;  3KEQ A;  5J8F A;  3NRV A;  3WTZ A;  5BOX A;  4E70 A;  1O7L A;  1O3S A;  1TQM A;  2XRO A;  3O2P E;  2BYV E;  5CVJ A;  1R58 A;  2HFH A;  4DQ2 A;  5ILS A;  1KU2 A;  1OMI A;  2W24 A;  4S05 A;  2DK5 A;  3VFZ A;  4IRI A;  1ULY A;  5DEQ A;  3I54 A;  3KP2 A;  1XMA A;  3QU6 A;  2DLL A;  4RB1 A;  2QBY A;  2O0Y A;  4NHJ A;  3SFZ A;  2QBY B;  3ZMS A;  1SMT A;  2NNY A;  2EA2 A;  2J5P A;  1LDD A;  2QWW A;  1Z9C A;  2OBP A;  3K2Z A;  3C7J A;  1O3Q A;  3WTS C;  1Y0U A;  2K4B A;  3KP7 A;  2ZNY A;  4HQE A;  2CO5 A;  1U5T A;  5LBQ A;  4CO8 A;  1SFU A;  3GF2 A;  5BMZ A;  2HDC A;  4HDV A;  3G3Z A;  2DK8 A;  3DFG A;  2CQK A;  3QRF F;  4WXC A;  5FFZ A;  3C3W A;  1XGM A;  2XVC A;  1OYI A;  2BE5 F;  1XD7 A;  2O3F A;  1FY7 A;  2QVO A;  1ZRF A;  3WTX C;  1SD4 A;  3O6B B;  3I53 A;  3QOP A;  3REO A;  2DQR A;  2XGX A;  4EGY A;  1BBY A;  1G3W A;  1G4D A;  1P4A A;  4A6D A;  1SAX A;  5BPD A;  1V3F A;  2YX7 A;  5L3E A;  4HX7 A;  4I01 A;  2IA1 A;  5D5X B;  4ZYG A;  2GXG A;  1Z7U A;  3S2W A;  2XAQ A;  5CVU A;  3MEX A;  3GFI A;  3F6O A;  4H0E A;  4KN7 X;  4A0Z A;  1REP C;  5BQT A;  3P9K A;  4LMY A;  5FFX A;  1TTY A;  4JK1 X;  3U2R A;  3WTY C;  1K7A A;  2E1N A;  1LEB A;  4L9T A;  2XUB A;  4EJO A;  1R00 A;  2JT1 A;  1IXS B;  2CG4 A;  4CYD A;  2COM A;  2JPC A;  4I02 A;  3BOQ A;  2OQG A;  1WI9 A;  3FF5 A;  2AXL A;  1R1T A;  2F5C A;  2HZT A;  2DW4 A;  3EYI A;  1H9G A;  1FPQ A;  4GYG A;  1LDK B;  4G8X A;  2FXA A;  4WK8 F;  4M9X A;  3WTW C;  5LHI A;  2O61 A;  2QQB A;  2QLZ A;  4IRG A;  2FQ3 A;  4WX9 A;  3PQJ A;  3RKW A;  2O8X A;  4RGR A;  2PEX A;  2Y0M A;  5ICC A;  4L9N A;  3E6C C;  4A6E A;  4NB5 A;  2HS5 A;  4EGZ A;  5H6R A;  5LGT A;  5D4R A;  2YR2 A;  1IN4 A;  1K6O A;  4I2O A;  4UV9 A;  4I09 A;  1FZP B;  4L18 B;  3QPH A;  4P96 A;  5H6Q A;  3F3X A;  1KU3 A;  3C18 A;  3JTG A;  2HYF A;  3E97 A;  2ESN A;  1XB4 A;  3LQQ A;  2VON A;  4QLC U;  1FBS A;  2XAG A;  3EYY A;  1FYK A;  2XKO A;  3RYR A;  2IP2 A;  2A5Y B;  3HYI A;  5D8K B;  4FHT A;  4ENJ A;  4KIF A;  2FBK A;  5L3G A;  4HF1 A;  1ZG5 A;  3ZPL A;  1TNT A;  2DPD A;  3IKT A;  3E3V A;  2XV4 S;  3MZH A;  1Z1D A;  2F5F A;  1USS A;  3HTU A;  3BJO A;  5DD8 A;  3G73 A;  1ZGA A;  2BEO A;  4IF4 A;  5ICE A;  3ROU A;  3NQO A;  1XDS A;  5HDK A;  1FP1 D;  2JTV A;  3KP3 A;  3WGH A;  2PMU A;  1IRF A;  1C0W A;  1T2K A;  4CZZ A;  4ESB A;  4EJV A;  3LAP A;  3V4G A;  1SFE A;  1OR7 A;  2PG4 A;  3K1M A;  3RPQ A;  2P5V A;  5HS8 A;  2PMH A;  3FX3 A;  2EV0 A;  2UXN A;  3FZV A;  4KIC A;  2J5O A;  1AOY A;  1ZAR A;  3QP5 A;  3LFK A;  4RB2 C;  3I4P A;  3KLO A;  3OOP A;  4RGX A;  2P6T A;  4A5N A;  2OU2 A;  3BPV A;  3E5U A;  1Q1H A;  3V7R A;  5JFR A;  4KNY A;  3IRR A;  1D3Y A;  2V1U A;  3BWG A;  4WF2 A;  4G7Z F;  2A6E F;  1IW7 F;  4HW0 A;  4DNC A;  4ZH4 F;  1DP7 P;  3ULQ B;  1X3U A;  2FBH A;  4UV8 A;  1SFX A;  5EEH A;  3KEO A;  2EA4 A;  4LB5 A;  1S8N A;  4BH9 A;  3DV8 A;  3HSE A;  2DO7 A;  3SXY A;  4GYI A;  3F22 A;  2KKO A;  3N4M A;  2H94 A;  2FBI A;  1ZG1 A;  1SD7 A;  5JHU A;  3HHH A;  3BRO A;  3KP6 A;  3GLX A;  3CUQ C;  3ZP5 A;  1Z05 A;  2FNP A;  3H3Z A;  1CF7 B;  4M9Z A;  3MFK A;  1WQ2 A;  2H09 A;  2CFX A;  4Y15 A;  2G9W A;  4I0A A;  2K27 A;  2OZU A;  3GVA A;  1ZRD A;  2A6H F;  1D8J A;  3LAJ A;  4Q4Z F;  2IRF G;  1KQ9 A;  1EH7 A;  2MD5 A;  1RZ4 A;  3GZ6 A;  2H6B A;  2W25 A;  1T0F A;  4Y13 A;  3ELK A;  2FRH A;  5LGU A;  3BP8 A;  4HLX A;  1B59 A;  4UVA A;  3IHU A;  1MDM A;  2A61 A;  4OIR F;  1MD0 A;  3B02 A;  4O5V A;  5EEG A;  2IPQ X;  4KYW A;  2PJP A;  2ZNZ A;  3IL2 A;  4RAZ A;  2YX4 A;  5A2Q K;  1TQP A;  3HSF A;  3VOE A;  3BJA A;  1ZRE A;  2QQA A;  2EFW A;  2L4M A;  4U7D A;  5K1Y A;  1FBU A;  3PFI A;  3F8M A;  1S7A A;  3FXR A;  1FSH A;  2E7W A;  1R7J A;  1GXQ A;  2W84 A;  1W7P B;  2C6Y A;  1IN8 A;  3SZT A;  2ZME A;  1NHA A;  3QU3 A;  4WXH A;  1RUN A;  2ISZ A;  3F23 A;  5FLX Z;  1STZ A;  4CGZ A;  1W5T A;  3O3K A;  1PUE E;  2M45 A;  5FD6 A;  1HW2 A;  4HYE A;  1QGP A;  1QBJ A;  3N97 A;  1WRJ A;  3I5U A;  2HQN A;  3T8T A;  4EM1 A;  4U0Y A;  2D45 A;  4M6Y A;  2FSW A;  2W85 A;  2QZ8 A;  5IT9 K;  4IVN A;  4LG0 B;  1FYM A;  1A04 A;  4KIG A;  1J75 A;  3J81 K;  4AWX B;  4MHG A;  4L5J A;  1YLF A;  3JAM Z;  4LB6 B;  3ZMU A;  3BZ6 A;  1PDN C;  1L3L A;  2Q0O A;  2XIG A;  4U0W A;  1MJB A;  4BNC A;  1B4A A;  4YG2 F;  2QM3 A;  3HRM A;  2ZXJ A;  4HX4 A;  4CDG A;  2V6C A;  4D0P A;  1SD6 A;  3R4K A;  1IUY A;  4O3M A;  1XSV A;  4P55 A;  3P7N A;  1FSE A;  1B1B A;  3B73 A;  1O3T A;  2EFQ A;  1EH8 A;  2OA4 A;  2XHK A;  2PLY A;  5HLG A;  4P9U A;  1UST A;  2M1B A;  4G7O F;  2LKP A;  3DKW A;  1P4X A;  5LHH A;  5AIP A;  1FNN A;  4MGR A;  2IA2 A;  3MQ0 A;  1KQ8 A;  2RC4 A;  2WV0 A;  5DCM B;  4OOI A;  3VEP A;  3GW2 A;  4CXF A;  4ZYE A;  1IXC A;  4RAY A;  1IN6 A;  5E1W A;  3V8L A;  3GEZ A;  2ETH A;  4G94 A;  2L3D A;  2EV5 A;  4G9Y A;  4PDK A;  3R60 A;  4HF0 A;  3V8K A;  1GVJ A;  4HOB A;  3WE3 A;  3J80 K;  3L09 A;  3I59 A;  4MTD A;  4HZF A;  1I1G A;  4MEY F;  3I59 B;  4HX8 A;  3DPT A;  4RGU A;  4CHU A;  1LB2 A;  4S04 A;  2K7L A;  1DPR A;  4XLN F;  4KMU X;  1S3J A;  2BV6 A;  2F5E A;  5K5Q A;  2DAO A;  2VC1 A;  4FX4 A;  5CLS A;  1ZLK A;  5ILV A;  1KYZ A;  4MQ9 F;  2FNA A;  1O3R A;  4M6X A;  2Z3Y A;  1YFH A;  2RN7 A;  2AS5 F;  1H0M A;  4O6J A;  1XN7 A;  4N9I A;  1HKT A;  3FMQ A;  3TO9 A;  2P5K A;  4M74 A;  1TW2 A;  4FT8 A;  2JRT A;  4WCG A;  1YW8 A;  1IN5 A;  3WTV C;  1HKS A;  2G7H A;  4RGS A;  5L3F A;  3RYP A;  1YO5 C;  5D4S A;  3FM5 A;  4BHC A;  2FML A;  4Z2Y A;  4KT5 C;  3BY6 A;  2YSR A;  1T38 A;  2OAZ A;  3J80 Z;  1I27 A;  1G6N A;  3HOT A;  4LLN A;  3COA C;  1B6A A;  3F8N A;  3TOA A;  5TRD A;  5FGM A;  5ILU A;  2KIM A;  4QWQ A;  3WTU C;  3ZMZ A;  2O6G E;  5LEJ A;  4R8H A;  1TW3 A;  3ECO A;  2QEN A;  2NS0 A;  4HF2 A;  3I58 A;  3L7W A;  3J7A O;  1I1S A;  3K1N A;  3ISP A;  1RIO H;  3LWF A;  2X0L A;  2HYG D;  1G3T A;  4ZYD A;  4XBF A;  5CVI A;  3V8J A;  2IT0 A;  4YFK F;  3DPL C;  2V9V A;  1QNT A;  1MJ9 A;  1BIB A;  4EM2 A;  2Z9O A;  5KK1 A;  4WWC A;  5FB2 A;  2KRF A;  4UHT A;  1J59 A;  3F8B A;  1ON1 A;  4KMF A;  3IC7 A;  4MNU A;  1BC7 C;  3SZP A;  3K0L A;  3CUO A;  4MTE A;  3RIR A;  2L4A A;  1G3Y A;  2STW A;  1U8R A;  5HS9 A;  3R6S A;  3TDU C;  2D1H A;  5D6E A;  2MLG A;  4I0B A;  2CW0 F;  3HIF A;  2VT2 A;  1FT9 A;  2D1V A;  4ZZD A;  1K79 A;  2HR3 A;  1V4R A;  5DD4 A;  2XAH A;  2GAU A;  1UCR A;  2HQR A;  2VOO A;  2HOE A;  2D2W A;  3KP5 A;  4YII A;  2LF8 A;  2TDX A;  3DP7 A;  5D8L B;  1JE8 A;  4ESF A;  4JBA A;  3Q9S A;  1FYL A;  5E1X A;  3QP6 A;  2K86 A;  1F1Z A;  2ZKZ A;  1CGP A;  1RUO A;  1ODD A;  4BQA A;  2CGP A;  5D6F A;  1GXP A;  4U0V A;  4HV6 A;  4PGH A;  4UVB A;  3ABU A;  5FO5 A;  2A07 F;  3HOS A;  3VB2 A;  1B9N A;  2IW5 A;  2JPB A;  4ENM A;  2HTJ A;  3FMR A;  3Q9V A;  3T8R A;  2EJR A;  4HV5 A;  2EFO A;  2GZW A;  4CIC A;  3LA7 A;  2KJC A;  1J5Y A;  1WWX A;  1UHW A;  2HEO A;  3VOD A;  4ENN A;  2M30 A;  1RNL A;  1YS6 A;  5LRS A;  3E6D A;  1TLH B;  3TDZ C;  4PCQ A;  3IWZ A;  1P4W A;  1U3E M;  3CLO A;  5E1Z B;  3F72 A;  2Z33 A;  1LVA A;  4LJZ F;  5LRR A;  1YW9 A;  1S6L A;  1R23 A;  1P92 A;  3HRU A;  3DXJ F;  1T98 A;  1U2W A;  4MEX F;  1EV7 A;  1XMK A;  4M71 A;  4B8X A;  1PP8 F;  4N9H A;  1XCB A;  2MH9 A;  3GX4 X;  4EJT A;  4HDU A;  4RB0 A;  1BI1 A;  2R3S A;  1QZY A;  3L00 A;  3MCZ A;  2HTS A;  1QO0 D;  5E20 A;  2GQQ A;  1CF7 A;  3HTS B;  2CSO A;  5HS7 A;  2DQL A;  3GO5 A;  2VC0 A;  1XGO A;  1ZN2 A;  2EWN A;  4U7B A;  3E5X A;  2HGC A;  2NYX A;  5E8G A;  4OIO F;  3WTT C;  3TGN A;  2XKP A;  2CWE A;  3FXU A;  3CUQ A;  4XSZ F;  1YS7 A;  4A2U A;  3F6V A;  5IT3 A;  3CUQ B;  4A0Y A;  2RVC A;  4M73 A;  1P6R A;  3HUG A;  5D5W B;  3WGG A;  4LD5 A;  4UNO A;  1F5T A;  4UVC A;  2UXX A;  2MLK A;  1I5Z A;  2PQ8 A;  3F8F A;  5HVQ C;  1J7K A;  3F21 A;  3KP4 A;  4IRH A;  4YFN F;  1J9I A;  3WOD F;  3D0S A;  2GXB A;  5JR3 A;  3V7S A;  4XSX F;  4EM0 B;  2OZ6 A;  1JHH A;  2VE8 A;  4P5O A;  3ZMV A;  5ICG A;  4HLY A;  1U6G A;  3GFJ A;  2LNB A;  1XSX A;  5DUK A;  4I98 B;  4G7H F;  2LDU A;  2VOP A;  4EQQ A;  5KVR A;  3RTR A;  3PQK A;  2XRN A;  2GIV A;  1W7P A;  1R5H A;  4EJW A;  4A12 A;  1SMY F;  2QUF A;  4ON0 A;  1PP7 U;  5CJ9 A;  5BS6 A;  1UHM A;  1XDU A;  4AD9 A;  1IF1 A;  2F5D A;  4AIJ A;  3W6K B;  3F8C A;  4XLP F;  2UZK A;  4OIQ F;  4FX0 A;  2ELH A;  3WG9 A;  2YU3 A;  4LGW A;  4LG0 A;  1Z91 A;  4EV0 A;  3RDI A;  4OIP F;  4Q47 A;  2KIU A;  2ZJ2 A;  5DV5 A;  3FM3 A;  5A2Q Z;  1HW5 A;  2VOD A;  1EH6 A;  2VBY A;  3FHZ A;  2DPU A;  4LK1 F;  3ZMT A;  2ZO4 A;  4R79 A;  2O03 A;  2MBF A;  1ONV A;  1XSD A;  3ECH A;  5F6F A;  5F1R A;  1ZGJ A;  2GA2 A;  2FF4 A;  1S29 A;  1YQA A;  3KET A;  1BI0 A;  2ESH A;  3KFW X;  3WU1 B;  2NNN A;  5HOO A;  1DUX C;  4XRF A;  4Q5S F;  1DPU A;  2YPR A;  2WC2 A;  2P4W A;  1HST A;  4IXA A;  3EDP A;  3RKY A;  1HQC A;  3TO7 A;  3SHF A;  5DCM A;  2EB7 A;  2KJB A;  2RGV A;  1B9M A;  2HWV A;  5AON A;  3Q5F A;  4M9S A;  2JSC A;  1FC3 A;  1R1U A;  3BJ6 A;  1LQ1 A;  1ZLJ A;  3E6M A;  1E17 A;  1QZZ A;  2XAS A;  1JGS A;  1ZYR F;  2VBW A;  3IWF A;  4WXD A;  5IT9 Z;  1ZAO A;  3GWZ A;  3ERE D;  5DUI A;  4AIK A;  1TNS A;  1KYW A;  3V7C A;  3J81 Z;  3TKY A;  3BDD A;  2Q2E A;  3BPX A;  5K5R A;  3JW4 A;  3RJP A;  1HW1 A;  3EUH A;  3T5X A;  5CYV A;  3LQR A;  3M9A A;  1KGS A;  3H3U A;  4NQW A;  3KZY A;  5L3D A;  1U5T C;  4ENK A;  2VBX A;  3QPT A;  4GXO A;  4HA8 A;  2P7C B;  2PI0 A;  1LNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...