1BM9A

Replication terminator protein from bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
EEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the replication terminator protein from B. subtilis at 2.6 A.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords REPLICATION TERMINATOR PROTEIN
total genus 41
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bm9A00
2PG4A 2ESNA 1B9NA 1IRGA 4IRGA 2FQ3A 4MQ9F 1FP2A 2DPDA 1G4DA 2VBYA 4HQMA 3QPTA 2QVOA 1FBQA 4UVAA 3P7NA 1Y0UA 5ICGA 3C1DA 2QM3A 3S2WA 4ENNA 4RB1A 3DEUA 3FXRA 1RI7A 4K2EA 1FSEA 5F1RA 2A6EF 3ROUA 5DD8A 3HOSA 3HSEA 4WF2A 4I09A 3BROA 5HLHA 5D5XB 2DQLA 1SD7A 5FLXK 1FBUA 3ECOA 3ZN0A 3QAHA 2ZO4A 3KP3A 2HOEA 1FLIA 4KA4A 4KN7X 5DD4A 1XCBA 1U6GA 2FXAA 3DPTA 2P4WA 3IWZA 1QZZA 5HDGA 3WGHA 4GXOA 2R3SA 5ICCA 2QYOA 1SFEA 3R0JA 4WCGA 1ZG1A 3HRUA 2YSRA 4ENKA 1D3YA 1RUNA 2CQKA 2DPUA 5FD5A 2JRTA 3F22A 1L3LA 3M8FA 4TV7A 5E8GA 3RKWA 2VOOA 3VB2A 3DPLC 4UVCA 5CVRA 5J6XA 2EFOA 1YLFA 3J80K 1YS7A 4OIPF 2KRFA 4L9VA 3L2CA 4BAYA 2CSOA 4G7ZF 4B8XA 3OV8A 3E6DA 2EFNA 2CYYA 4UNOA 2HDCA 1ZRDA 3BJ6A 3CDHA 2JPBA 4UV8A 4CHUA 4S05A 1WI9A 5FLXZ 3WTTC 5J8FA 4P55A 3D0SA 4HLXA 2GXGA 4JK1X 3ZPLA 5LHIA 1T98A 1T6SA 3JTHA 4KICA 3PFIA 1KA8A 2HWVA 4JQFA 2RV8A 2HTJA 1OKRA 1MJBA 4PGGA 4G6DA 2EFQA 1BOAA 2OU2A 5EEHA 2P7VB 3MEXA 4GYIA 3V7RA 1UCRA 1BI2A 2G9WA 4L5IA 1KU9A 5DCMA 4KDPA 2PMHA 3ZN1A 3K69A 1ZGAA 4HX8A 1J0RA 1HXDA 1QQIA 3LSTA 3KEOA 3O6BB 3R60A 1R23A 3H92A 3WTYC 4OMYA 2PQ8A 4YFXF 1ZREA 2GXBA 5E1ZB 1J59A 3TKYA 3U1DA 3EQLF 5IT9K 1R00A 2OBPA 1Z1DA 1FYKA 1T2KA 1XMAA 4BYYA 4CICA 5DEQA 3P9CA 4LB5A 3T5XA 4M71A 3FX3A 4S04A 3RYRA 5HVQC 3I5UA 5DUIA 1UHWA 5DCMB 4ZZLA 1K6OA 3GFMA 2XRNA 3P9IA 4U0VA 2VODA 2DU9A 4KMFA 3HSRA 2FU4A 3E5XA 5FFXA 2WTEA 1FT9A 4G9YA 1O3QA 3I71A 1USTA 4D0PA 2XIGA 1LDJA 2AXLA 4XSZF 1YYVA 2D1HA 3HHGA 2W57A 1S3JA 1YS6A 1F4KA 4ESBA 2XVCA 1ZHFA 2DTRA 2F5DA 1J2XA 1DPRA 3REOA 2YU3A 3JSOA 4LGWA 3WE2A 1LDKB 4HF2A 1FY7A 3DFGA 1SFUA 5ED4A 2GA1A 4Q47A 3KCCA 2F5EA 3ELKA 3ZMSA 1RZ4A 2A3SA 2G7UA 1KQ9A 4ON0A 1XB4A 3E5QA 2HQRA 3LQQA 1AOYA 4ENJA 2OAZA 4XLPF 3M8EA 3CUOA 1HSTA 1D8JA 3U2RA 4I0BA 2TDXA 5JVTA 3IRRA 2VC1A 1DPUA 1Z7UA 1F1ZA 2AS5F 4HAMA 5DYMA 1JHHA 1S7OA 1TBXA 2H94A 4ESJA 2RVCA 3I53A 1G3SA 1V4RA 3E97A 4A2UA 4PCQA 1XDSA 1ZLKA 3SZTA 2L02A 5JI6A 2XASA 3HSFA 2LSOA 5J8CA 3F21A 3IKVA 1H9TA 3T8RA 3I54A 1X3UA 1FWZA 2XV4S 4GO1A 4YG2F 4XBFA 4HW0A 1R36A 4KN4X 4LJZF 4IJAA 2EK5A 2A68F 1WQ2A 1R58A 4MGRA 1EH8A 3KP4A 1F5TA 3CJNA 1IN8A 4B09A 1HW5A 3GLXA 1K79A 4KUMA 5H6RA 3WTZA 2K4BA 4AIJA 1E2XA 4NQWA 2E7XA 3KE2A 2QENA 3ML6A 4L9NA 2RGVA 3WE3A 1G3TA 3M7GA 3JAMK 5HLGA 5D4SA 2NYXA 4YFKF 5HS8A 1EV7A 2VC0A 3IC7A 2FE3A 1XMKA 1R1VA 1GHCA 1YO5C 4LG0A 2MLGA 1JHFA 4A0YA 4QWQA 3WTUC 1DP7P 1XSXA 5JHUA 1Z05A 4HOBA 2JZYA 4AVPA 1I1SA 2LNBA 1SD6A 2V9VA 3T1BA 1GXQA 3WTWC 4CXFA 2P5VA 4Y15A 1I5ZA 2Q2EA 2EWNA 2Y75A 1YQAA 3MCZA 1OR7A 4P96A 4U0WA 3MQ0A 4L5JA 2KKOA 3K1NA 3DF8A 4YIFA 1PUEE 3KZYA 2E7WA 3BZ6A 4G6QA 2STTA 2GA2A 2HYFA 1P4WA 3K1PA 4L18B 2ADUA 2XUBA 4GCVA 2W25A 4IHSA 2V1XA 4IXAA 2IRFG 5L3CA 2CG4A 5A2QK 4IVNA 4MTDA 1S7AA 4CZZA 4RB3C 4M9XA 5A2QZ 4ZYHA 3GUDA 2PI0A 1IAWA 3NEUA 1YW9A 4RGRA 4RS8A 4WWCA 3V4GA 3TOAA 1OYIA 3GFLA 5D6EA 2PEXA 3K1MA 1F9NA 5FD6A 4L9TA 4U88A 5BPDA 2NNYA 5JR3A 4F7ZA 1P6RA 4EJOA 4Q48A 2HEOA 2FEZA 4BXUA 3BPVA 1BJAA 4HQEA 1USSA 1YIOA 2ZNZA 2B0LA 1IN6A 1T38A 1ONVA 2HQNA 4CGZA 2ETHA 4BH9A 5H6QA 3SFZA 2DK5A 2QBYA 1KU7A 3CTAA 5E20A 5L3DA 2ZMEB 2IA2A 4A6EA 1QNTA 3KP2A 1RNLA 1OYYA 4EM0B 1FYMA 2EFPA 4P9UA 5ERIA 2A5YB 4G94A 1ZGJA 2QZ8A 2C6YA 1FPQA 2XKPA 5LBQA 2M45A 5D5UB 2OD5A 2VXZA 1D5VA 4CYDA 4EGYA 1E17A 1B59A 2F5FA 5TJJA 2GAUA 1H9GA 3E6BA 3MAJA 3FMSA 1WWXA 2GIVA 3F6VA 1A04A 5LHHA 3JAMZ 2FNAA 5EEGA 1ULYA 3HHHA 2OQGA 3H3ZA 2ZCWA 1W5SA 3GFJA 2O03A 5FO5A 4HV6A 4GGGA 4HDUA 2VBXA 1XCVA 1G6NA 4O5VA 5D5WB 4I2OA 4LB6B 5DUKA 2G7HA 2A69F 2LF8A 2P7CB 4HF0A 1MD0A 1ZYRF 2BBYA 4EQQA 4EJTA 1O3TA 2FOKA 3RDIA 3IWFA 2RNJA 4OIQF 2MD5A 3M1EA 4I7HA 3GEZA 4YIIA 1LVAA 2IPQX 5IT3A 3LQRA 5HS9A 2P6SA 3GX4X 4HLYA 3EUHA 2EJRA 5LGNA 2X0LA 5HOOA 2VOPA 3FZVA 1H0MA 3D5LA 4DNCA 3CO6C 3RTRA 3RYPA 4U0YA 4HYEA 3VOEA 5ICFA 1TQPA 1S8NA 3F23A 5DDGA 4RGUA 5AIPA 1ZG5A 2BV6A 2L4AA 3HRTA 3F8NA 3O2PE 1ZN2A 2H09A 2NNNA 3ERED 1R1TA 1EH6A 1XD7A 5F6FA 1XGNA 1O3RA 2RQPA 4CO8A 1PDNC 2EV5A 1MJAA 4OIOF 5BMZA 5IT9Z 1JXSA 4CDGA 3GFIA 1ZRCA 3Q9SA 4U7DA 5CYVA 5HDNA 4PDKA 1BI3A 4LK1F 4FX4A 3LA3A 1R5HA 1P2FA 3ZMUA 4LMYA 2BEOA 2IJLA 3IKTA 5CVIA 2IVMA 2OQRA 4XSXF 3GZ5A 5CVUA 3CO7C 2LF7A 1IUYA 5LGTA 3KZZA 4I01A 1VTNC 2L54A 2JTVA 4KYWA 1O7FA 3NRVA 3HYIA 2DBBA 3C3WA 1ODDA 2IW5A 2QQBA 2XAJA 3RIRA 5FFZA 2CWEA 2XHKA 2W24A 3SXYA 4QLCU 4HA8A 2XAFA 4HZFA 1V3FA 2JT1A 5LLQA 4EGZA 1IN4A 3F8BA 5ILVA 1KYWA 1GXPA 2K27A 1BI0A 4OIRF 4EM2A 5H20A 1OPCA 2Z5UA 2NRAC 5HS7A 4BHBA 2FBHA 3WODF 3G73A 4RB0A 2ACJA 4OOIA 2HTSA 3OOPA 3EYIA 1KU3A 3Q9VA 5BPIA 3L7WA 3GXOA 2V79A 4RGSA 3FM3A 4ASNA 2FBKA 1IZ1A 3GYHX 4WXHA 4ZZDA 2WC2A 2VT3A 2LDUA 5LRRA 1GVJA 2FNPA 3GVAA 2LKPA 2MH2A 3KFWX 5D8KB 4PZJA 2A6HF 5D6FA 4KIBA 2O8XA 3EYYA 3TDZC 5E1XA 3FF5A 2QQAA 3BOQA 2YPRA 2FSWA 1G3YA 3RKYA 2FMYA 4PGHA 4KMUX 3MWMA 4A12A 5ILSA 2OZ6A 2D45A 4HF1A 1I6XA 2M5WA 4Z2YA 2DI3A 1ON1A 1U8RA 1QZYA 4AD9A 1HW1A 1TLHB 2ZJ2A 1REPC 3F8CA 1U5TC 2O6GE 3HUGA 1BC8C 1XGSA 1JGSA 3B02A 1HW2A 2DLLA 3FWEA 5FGMA 1SMTA 2BGCA 2K02A 4R1HA 1XN7A 2MBFA 1W5TA 4WX9A 1IXCA 2F2EA 1B6AA 2EA2A 2XKOA 2CFXA 5L3GA 1QO0D 3DP7A 4MHGA 1IN5A 1BIAA 5E18F 4MEYF 3V8JA 4ESFA 2WWYA 2FBIA 1LDDA 3E6MA 1HSJA 2O0YA 2HS5A 2MC3A 2EV0A 3LA7A 3ZMDA 4O6JA 3VEPA 4HV5A 3RKXA 5LRSA 4BNCA 1P4AA 4UHTA 3K0LA 1SD4A 1Z9CA 1G3WA 5TRDA 1WRJA 5BS6A 3HTUA 1CF7B 2QWWA 4EJVA 1MZBA 1YFHA 2M8EA 1HQCA 3EDPA 5F64A 2KJCA 2P5LC 4G7OF 3ZMTA 2YX4A 2V1DA 4LK0F 2FMLA 4LG0B 3E3VA 4GYGA 4FX0A 3CUQA 1S29A 4JBAA 3EETA 2NS0A 1TNTA 1SMYF 2O3FA 3KP7A 4E70A 1L0OC 1U5TB 1OYWA 4MQVA 3RJPA 2E1NA 4AIHA 3WTSC 1J75A 3ULQB 1BC7C 4A0XA 2DQRA 1FSHA 3W6JB 2VE9A 3ECHA 3CLOA 2VT2A 1CF7A 4N0BA 2XAQA 2QUFA 1IN7A 3KLOA 1MKMA 2Z3YA 2ZBKA 2HKOA 3N97A 1LQ1A 1LEBA 3LWFA 3MZYA 2VBWA 2MLKA 4KIGA 3WTXC 3O3KA 2JSCA 3U9GA 3SZPA 4WXCA 4FT8A 5L3FA 2H27A 4EJWA 2PN6A 5CVVA 4I98B 1SAXA 1LNWA 2HYGD 3I64A 3ZMZA 3MZHA 1MDMA 4IPAA 2ZXJA 4RB2C 1UB9A 2A61A 2DW4A 2M30A 3MFKA 4KIFA 3GO5A 3GZ6A 3F8MA 3CUQB 4EMSA 4A5NA 2P8TA 3R6SA 1UFMA 2VBZA 3GWZA 4OINF 4AWXB 4RAZA 3HTSB 3E5UA 1LEAA 4M9SA 1LJ9A 1R5GA 2W84A 2HZTA 3I4PA 4N9HA 3QP5A 3VFZA 4Y13A 1KU2A 4M72A 1O7LA 2ESHA 2ISZA 3I0TA 2VE8A 5CJ9A 3FHZA 2KIUA 4ETSA 4KNYA 4AIKA 1K78B 3JW4A 3QOPA 3TO6A 2GZWA 1FOKA 4DQ2A 2HGCA 3GW2A 2D2WA 4KT5C 2BYVE 2XAHA 2IT0A 1U78A 1PP7U 3E6CC 3BJOA 1R1UA 1WSUA 3ABTA 1HBXG 2K7LA 4UXNA 1FX7A 2D1VA 2H6BA 2PBIA 1W7PB 1R22A 2ISYA 1T39A 3WG9A 3I59A 4RGXA 5JFRA 1BBYA 4FHTA 2RDPA 3JSPA 1FBSA 1T0FA 4P9FA 2EB7A 2M87A 4YFNF 2QLZA 5D8LB 3SQNA 2PLYA 1RIOH 5AONA 2V6CA 3F72A 1IF1A 1TW2A 1HKQA 1NHAA 3AAFA 2RC4A 3M9AA 2QBYB 4Q5SF 4HX4A 1CGPA 1XDUA 2XGXA 2VN2A 1IXSB 2COMA 2MH9A 2WV0A 5ILUA 2W85A 5E1WA 2DFIA 3LAJA 4Y17A 5D4RA 3HRSA 2L4MA 1K78A 1HKTA 4OU0A 3TOBA 1BN5A 2KIFA 1W7PD 2IA1A 1SFXA 4EJUA 2ZFWA 4UUVA 2ZKZA 2JPCA 1U3EM 4BHPA 1OMIA 1TQIA 4HX7A 1FNNA 1ZH5A 2EA4A 1W7PA 4L0ZB 3R0AA 2X4HA 3TO7A 1FYLA 3IHUA 1WKMA 1ZARA 3BDDA 1D8KA 4U7BA 2KIMA 2PFBA 2Q8KA 1QPMA 5BOXA 2L3DA 3B73A 5CLSA 1XSDA 2NAZA 4A0ZA 3W6KB 2K4JA 3RPQA 4O3MA 2DO7A 3KEQA 1C0WA 3QU3A 1HKSA 1BIBA 1O3SA 4BHCA 2O61A 3J80Z 4A6DA 5LEJA 5ICEA 3I58A 1BI1A 3PQJA 1J7KA 1Z6RA 1MJ9A 2EV6A 3GF2A 3I59B 2Z99A 2STWA 2P5KA 2ZNYA 4M6YA 3T0YA 2L01A 2UXNA 1B9MA 1XGOA 3K2ZA 3BPXA 1J9IA 3WU0A 3BY6A 3C7JA 1IW7F 4HBLA 4XRFA 1R7JA 2RKHA 2J5PA 2Z33A 1TTYA 2QQ9A 2FA5A 4LLGF 4IF4A 1PP8F 4EV0A 2CO5A 4ENMA 4NB5A 1ON2A 5E17F 3HRMA 4XLNF 1QGPA 3RI4A 4G8XA 1DDNA 1TW3A 3ZQ7A 2F5CA 2DT5A 4Q4ZF 2E1CA 4M74A 2HR3A 5K5QA 4H0EA 4MEXF 2UWMA 1BM9A 3G3ZA 1YW7A 4M6XA 4LD5A 3LA2A 3WGIA 5L3BA 1AWCA 3LAPA 3IRQA 3ZMVA 5DCFA 1U2WA 5D5VB 1B4AA 5K1YA 3DKWA 3J81Z 1STZA 2BE5F 1YG2A 2P6TA 1DUXC 4OMZA 1ZRFA 2RN7A 3BJAA 4KFCA 3WTVC 2R7DA 1I1GA 3QRFF 3FMRA 3P9KA 3FXUA 1ZG3A 3F6OA 4N9IA 3KP6A 5L3EA 5FB2A 1U5TA 5K5RA 1S6LA 4EVIA 4M9ZA 2DAOA 5LEKA 2YX7A 3TQNA 1UHMA 4LFUA 2EFWA 5KVRA 4LLNA 1JE8A 4P5OA 1XSVA 3DXJF 5LGUA 1Z6TA 2XROA 2A07F 3FXQA 3F8FA 3NQOA 4ZYEA 5BQTA 3BP8A 2ZMEA 2XAGA 2J5OA 2Y48A 4ZYGA 2H6CA 3RPUA 3COAC 3CUQC 4RAYA 3L00A 2IP2A 3K9TA 5HLIA 1YW8A 3R61A 3TO9A 3N4MA 1P4XA 1KQ8A 3WU1B 3DV8A 3V8LA 2FF4A 5K5OA 1B1BA 1FP1D 2M1BA 1EH7A 2GQQA 2R7FA 1O57A 3T8TA 1Q1HA 4R79A 3BWGA 3H3UA 4BQAA 1I27A 1ZLJA 1J5YA 2VONA 1KQ0A 2Z9OA 3KP5A 1IRFA 3L09A 2GWRA 4A5MA 1KGSA 5E8IA 4ZH4F 3V7CA 2UZKA 1TQMA 1QBJA 2K86A 3WGGA 1RUOA 3QP6A 4WXDA 1LB2A 2YR2A 3F3XA 3FM5A 1Z91A 4R8HA 3Q5FA 1TNSA 4M73A 4IRIA 3V8KA 5AIQA 1IXRC 2OZUA 3J7AO 4LLLA 3DQVC 4ZYDA 1MDMB 1SD5A 4WK8F 4EM1A 2HFHA 3VODA 5LHGA 3FMQA 2PMUA 2HKXA 4UVBA 3QPHA 4HDVA 5CVJA 2ELHA 2KJBA 3TDUC 4G7HF 3C18A 4L9JA 3R4KA 1MGTA 3L9FA 2OA4A 2Y0MA 3PQKA 3IL2A 3HIFA 2CW0F 4MTEA 3V7SA 1YTYA 2V1UA 3JTGA 3ZP5A 3ABUA 1FZPB 1K7AA 3QU6A 2IA0A 1ZAOA 1XGMA 4MNUA 2UXXA 4I0AA 1P92A 2CGPA 3LFKA 2DK8A 3KLNA 3SHFA 4UV9A 2PJPA 4IRHA 1KYZA 3KETA 5DV5A 4NHJA 3HOTA 3TGNA 2MA3A 4I02A 1W4MA 6PAXA 4L0YB 2FRHA 1FC3A 2Q0OA 5HDKA 5KK1A 3ISPA 3J81K 4IHTA
chains in the Genus database with same CATH superfamily
1ZK8A 1YHQI 1VQ5I 2PG4A 2ESNA 4U87A 4F91B 2BZTA 5DS9A 1B9NA 3ERMA 1IRGA 4IRGA 2UUZA 2KRHA 2ZC2A 2M0MA 5EZHA 2FQ3A 1DGRM 4MQ9F 5M5XJ 1FP2A 2DPDA 2ECCA 1SANA 1G4DA 2VBYA 4HQMA 3QPTA 3BG7A 2QVOA 4M3EA 1FBQA 1UMQA 3ZQCA 4UVAA 3P7NA 1Y0UA 2PJRA 3DBHB 1HCRA 1AU7A 1X19A 4XR6A 1A6IA 5ICGA 3OIQA 3C1DA 2QM3A 3S2WA 4ENNA 2H8RA 4RB1A 3DEUA 3FXRA 1RI7A 4K2EA 1FSEA 2FQ4A 2HVQA 5F1RA 2A6EF 3ROUA 2VQLA 5DD8A 1MMGA 1V5FA 3JRHA 3HOSA 1MBGA 3HSEA 2LKSA 4WF2A 2F4OB 4I09A 3BROA 3DU6A 3OWTA 4OAYA 3FXMA 5HLHA 4JYKA 3GTKJ 3FXKA 4XRMA 5D5XB 1UAAA 2DQLA 1SD7A 5FLXK 1FBUA 4NQWB 4HG2A 3ECOA 3KZIC 3BTCA 3ZN0A 1OCTC 3QAHA 2ZO4A 3KP3A 4RAFA 2JMWA 2HOEA 1V5GA 1FLIA 3K4NA 4PSWA 3L2RA 3CLQA 4KA4A 2E2IJ 4RBOA 1YI2I 2VJ5A 4KN7X 3CCSI 3KYCB 5DD4A 1XCBA 1U6GA 3BR3A 2KPMA 2O8KA 2FXAA 3DPTA 3H9JA 2AQFA 2P4WA 3IWZA 1QZZA 2DDAA 2M0CA 3QYFA 2XAUA 3ABLH 5HDGA 4J01A 1OLTA 1VQ8I 3WGHA 4GXOA 2R3SA 5ICCA 1D0YA 2QYOA 1SFEA 3R0JA 5FLVA 4WCGA 1X1PA 1ZG1A 3HRUA 2YSRA 4N4OB 4XM3A 1D3YA 4ENKA 2CQKA 1RUNA 3S16J 1H88C 1U0JA 2DPUA 2V4JC 5FD5A 2JRTA 3F22A 1L3LA 3CD6I 2XSJC 2KLOA 3M8FA 4TV7A 5E8GA 3L2VA 4HNVA 4AM3A 3RKWA 3ABKH 2VOOA 4NC8A 4ZDLA 4A3GJ 3FISA 4C3HJ 1N75A 3VB2A 3AG4H 2LG4A 3DPLC 1IRXA 4UVCA 4EATA 5CVRA 3J7YJ 1MSFC 5J6XA 2EFOA 1YLFA 3J80K 1YS7A 4OIPF 2KRFA 4L9VA 5JVGF 2NVQJ 3L2CA 3KYDB 2A6TA 4BAYA 4E7LA 2CSOA 4G7ZF 4B8XA 2FJ1A 3OV8A 3E6DA 5FKNA 5GAEJ 2PJRB 3GTOJ 1JKPC 4B1RA 1A6QA 2EFNA 3H36A 2CYYA 1K4TA 4UNOA 1VQ6I 1ETWA 3LL7A 3BJ6A 1ZRDA 2ZJQF 2HDCA 3CDHA 2JPBA 4UV8A 2OTLI 4CHUA 2E36A 4S05A 1WI9A 4CCNA 5FLXZ 3CF5F 3WTTC 1NG6A 2EBIA 5J8FA 3FIWA 1D0ZA 4P55A 3D0SA 4HLXA 2GXGA 5E3OA 1I3AA 4JK1X 4XLHA 3KEYA 4RLQA 3ZPLA 5LHIA 1Y8RB 1Z0XA 1T98A 5M3MJ 3P5JA 4XL9A 1T6SA 3JTHA 4KICA 4PFPA 3PFIA 1KA8A 2HWVA 3BR2A 4JQFA 2IS4A 2RV8A 1RC9A 1VQ9I 2HTJA 1JGGA 1OKRA 1GV2A 1MJBA 1VNDA 4PGGA 4G6DA 5F0HA 2EFQA 1BOAA 3H5RA 2OU2A 5EEHA 3LSHA 2P7VB 3MEXA 4ZYAA 1WVRA 4GYIA 3V7RA 2NOJB 1B72A 2DA1A 3QYEA 3S14J 3JRAA 1UCRA 1GUUA 1LFUP 1MIJA 1BI2A 3AFHA 2G9WA 2NS8A 4L5IA 1KU9A 5DCMA 4KDPA 2PMHA 3ZN1A 3K69A 2E34A 1ZGAA 4HX8A 1J0RA 3EUKL 2L0KA 1HXDA 1QQIA 4MO7A 3LSTA 3KEOA 3O6BB 1YE9A 1V55H 2E19A 3IH2A 3HC7A 1CQTA 1WHUA 1MW7A 1ERDA 3R60A 1R23A 2KHMA 3H92A 4UUSB 3WTYC 4OMYA 2VQCA 4BACA 2PQ8A 1TL8A 1TC3C 1TZLA 2VQHA 4YFXF 2HXOA 1ZREA 2GXBA 3SFIA 3HDDA 5E1ZB 2LBFA 1J59A 3TKYA 2HOSA 1ITYA 3U1DA 3EQLF 5IT9K 2K3FA 1R00A 2CUJA 2OBPA 2GLOA 3A03A 3NAUA 1Z1DA 4XKWA 1FYKA 2HOTA 1T2KA 1XMAA 4HSTA 4BYYA 4CICA 2IEKA 4JX5A 1X4PA 5DEQA 1POGA 3P9CA 4LB5A 3T5XA 4M71A 3FX3A 4JP0A 4S04A 2CU7A 2VUMJ 5C44J 2AO9A 3RYRA 5B66C 5HVQC 3I5UA 5DUIA 3BG3A 1UHWA 5DCMB 2EQRA 1HF0A 4ZZLA 5FRNA 2DXIA 1K6OA 2HDDA 3GFMA 4AUXA 4BL0B 2CFOA 2XGDA 1A31A 2XRNA 3P9IA 4U0VA 2JQ7A 2K5CA 2F4MB 2VODA 1XMXA 2HQAA 1MMSA 2Y69H 2DU9A 2VB6A 4KMFA 3HSRA 2FU4A 3E5XA 5FFXA 1VQ7I 2HVSA 1MNDA 2VJJA 3O8GA 2WTEA 4XRSG 1FT9A 4G9YA 5J47A 1O3QA 3M1CA 3I71A 1USTA 1WJAA 2HDWA 2OJED 4D0PA 2XIGA 3QODA 1LDJA 1MNMC 2TRTA 2R92J 2KL4A 2AXLA 4XSZF 1YYVA 3HHGA 3HKZA 2D1HA 2W57A 2DT7B 4XKVA 1P7JA 1ACIA 1S3JA 1YS6A 4NC6A 3RQIA 1F4KA 4ESBA 2XVCA 1ZHFA 5K7HA 2DTRA 2DMPA 2F5DA 4Y33A 5GTHC 1J2XA 2LK2A 5EJCA 1DPRA 1R9TJ 3REOA 2YU3A 2MABA 3JSOA 4LGWA 3WE2A 2MGQA 2E2HJ 1LDKB 4AIDA 3CC4I 1FY7A 1APLC 3DFGA 1SFUA 4HF2A 1IRZA 5ED4A 2GA1A 4Q47A 3KCCA 2F5EA 3ELKA 3PNVA 3ZMSA 1RZ4A 2A3SA 3CJRB 1VQKI 2G7UA 4G12A 1KQ9A 4ON0A 4AVZA 2GOXB 1XB4A 2DCEA 3E5QA 2HQRA 3LQQA 1AOYA 2GM4A 2Y9YA 4ENJA 2OAZA 4XLPF 3MMYB 3M8EA 2Q1ZB 5KAFC 2NOGA 4IEJA 3CUOA 3K4LA 4F3QA 3WG7H 1HSTA 2XGEA 3TBIA 3J7ZI 1D8JA 3U2RA 2CUEA 2ELKA 4I0BA 4B3XA 5K7FA 2BW3B 2TDXA 4KJZA 5JVTA 3IRRA 2EIMH 3OYIA 3A01B 2VC1A 1DPUA 1Z7UA 1LKXA 1F1ZA 4J00A 4LITA 4KT6A 2AS5F 3N05A 2XSDC 4DOZA 4HAMA 1Z67A 3CCEI 5DYMA 1JHHA 1S7OA 3HOWJ 1TBXA 4AYBN 2EZHA 5EF6A 3SDGA 1MBHA 5IYBJ 2DOEA 2HOAA 2H94A 4H4KC 4RA2A 2OCEA 4ESJA 2LR8A 1X1CA 2RVCA 1FIPA 3I53A 4HSRA 1G3SA 1V4RA 2FUG2 1E3OC 5IP6A 3E97A 4BXFA 1SFOJ 4A2UA 4PCQA 1XDSA 1ZLKA 4NUBA 4E6KG 3SZTA 2XB0X 1XG1A 2Y0SN 2L02A 5JI6A 3HEFA 4LIUA 1XTAA 3KX2A 2XASA 3HSFA 4P1WA 1Y6IA 4RLFA 1FTTA 3K70D 2LSOA 5J8CA 3F21A 3IKVA 4CYCA 1H9TA 2R5ZB 3T8RA 3LSKA 4HPQA 3I54A 4BE2A 1X3UA 2AXTC 2DJNA 1HDPA 1WJCA 1FWZA 2K40A 2XV4S 2X6XA 4NNJA 3OYGA 3CMMA 4GO1A 4DBRA 2ME6A 1Y1VJ 2CH0A 4YG2F 2M34A 4XBFA 4HW0A 1R36A 4XICA 4KN4X 4LJZF 3CP2A 4CCMA 4IJAA 4IHWA 2VJIA 2EK5A 2A68F 1WQ2A 1R58A 4MGRA 1EH8A 5IPAA 1IV6A 2X6YA 3KP4A 3L2UA 1F5TA 1T95A 3CJNA 1IN8A 1SFKA 5J1YA 3ESWB 4B09A 2EILH 1HW5A 3GLXA 3K6GA 1K79A 4KUMA 5H6RA 3BG9A 4FQGA 3S2DJ 3WTZA 1M1EB 3VPRA 1UG0A 2K4BA 4AIJA 1E0EA 1E2XA 4NQWA 3PUBA 2E7XA 1XX5A 3KE2A 3BQZA 4A3MJ 2ID3A 1MBFA 1H89C 2QENA 3ML6A 4L9NA 2BVMA 4BDZA 2RGVA 3WE3A 1G3TA 3M7GA 1U9OA 3JAMK 3MN2A 5HLGA 3ZQHA 5D4SA 2NVXJ 2NYXA 3NWSA 4YFKF 5HS8A 1EV7A 2VC0A 3IC7A 2FE3A 1XMKA 3SDBA 1R1VA 1GHCA 2RREA 3RSNA 1YO5C 5CQEA 1OCZH 4LG0A 3ABMH 2MLGA 3MZ8A 3G1MA 3LSPA 1JHFA 4A0YA 4PJ0C 4QWQA 3TMOA 3PUFA 4Z6YA 3WTUC 2RNGA 1DP7P 1XSXA 5JHUA 2EH3A 3DTEA 1Z05A 3A4CA 4HOBA 2ZSIB 3HOXJ 1TT0A 2JZYA 2WADA 3BCBA 4AVPA 1I1SA 4CCOA 1RR7A 1VF9A 2LNBA 1SD6A 2V9VA 5EZGA 2JA7J 2QF7A 3T1BA 2V7FA 2X6WA 3OYAA 2JA2A 1GXQA 2L7ZA 5FKKA 3WHCA 3WTWC 4CXFA 2P5VA 3HUGB 1I5ZA 4Y15A 5EYRA 1I3QJ 1K6YA 1TWGJ 2Q2EA 1JKRC 1QVUA 2EWNA 2Y75A 2HPMA 5C4XJ 3JRDA 1YQAA 3MCZA 4C3IJ 1OR7A 4E7SA 4P96A 4U0WA 4BUPA 4BE1A 3MQ0A 4IOAF 4L5JA 3H1CA 1X2NA 3MKLA 3S1MJ 2KKOA 3K1NA 3DF8A 4YIFA 3K4KA 1PUEE 2DODA 1X2MA 4QIWN 4RM2A 3G6EI 2BW3A 3KZYA 2E7WA 4FISA 3BZ6A 2GBYA 3SJMA 4G6QA 2OPTA 2STTA 2GA2A 2HYFA 1P4WA 3K1PA 1ZELA 4L18B 2ADUA 2XUBA 4GCVA 2W25A 5FLMJ 4IHSA 2V1XA 4IXAA 1WGXA 2IRFG 5KNLA 2IGOA 4IX7A 4XMYA 5L3CA 3G1OA 1PYVA 3VYUB 4BQNA 2CG4A 5A2QK 5C3EJ 4IVNA 4MTDA 2DOFA 1F43A 3MKZA 1S7AA 4CZZA 4RB3C 2LD5A 1SC7A 4QTRA 1PUFA 4M9XA 5A2QZ 1TT5B 1ETXA 4ZYHA 2DFFA 3GUDA 4BBRJ 2PI0A 1IAWA 3NEUA 1YW9A 4XIDA 4RGRA 4RS8A 3C2GA 3V4GA 4WWCA 3TOAA 5IP9J 4IOCF 2LREA 4XKCA 1S72I 3ASOH 4X1EA 3A2KA 1OYIA 3GFLA 5D6EA 3LSRA 2PEXA 1YX5A 5KAIC 2VASA 2QSGX 1MBEA 4HNTA 3K1MA 3NWTA 3DKXA 1F9NA 3G1LA 5FD6A 2PMZA 4XK4A 2JK3A 4L9TA 3C2HA 4F92B 1LUJB 5B5EC 1V54H 2CQQA 3LSMA 4U88A 5BPDA 3J7AY 2NNYA 2XRLA 4Y7NJ 5JR3A 2QKMB 2LY2A 4F7ZA 1P6RA 2W7NA 3CCVI 2WB1N 3DLAA 4EJOA 2BY0A 4Q48A 2HEOA 3D5RC 2FEZA 2IGMA 4BXUA 2R0QC 3BPVA 5F1JA 1BJAA 4HQEA 1USSA 1YIOA 3K4MA 2ZNZA 4OAZA 2B0LA 2PMZN 1IN6A 1T38A 1WPKA 1ONVA 2HQNA 2ELJA 2QSHX 4CGZA 2ETHA 4BH9A 2NS7A 4A3IJ 5H6QA 3ASNH 4XLAA 3SFZA 2DK5A 3K2AA 2KMUA 2WB1A 2QBYA 2EZIA 3ZQIA 1WJDA 1KU7A 2P81A 3CTAA 4N4NB 5E20A 5L3DA 2ZMEB 3BTIA 1OQYA 2IA2A 3I4NJ 4A6EA 1QNTA 3KP2A 4M3FA 1RNLA 1OYYA 4IQ4A 4ZC3A 4EM0B 1FYMA 2JUCA 3TL4X 2EFPA 4C9YA 2Z1DA 4P9UA 1Y1WJ 5ERIA 3ZQQA 2VLAA 2IBDA 4I99C 2A5YB 4G94A 2B63J 2MD0A 1ZGJA 1YX3A 2QZ8A 3OY9A 2C6YA 2R93J 1FPQA 2XKPA 5LBQA 2M45A 2MC4A 2OD5A 2G0EA 2VXZA 2A5WA 5D5UB 5EDNA 1VFCA 1D5VA 2GXAA 4CYDA 3S2HJ 1FOYA 4EGYA 1E17A 4MLOA 4D9JA 1B59A 2F5FA 5TJJA 2GAUA 1H9GA 3E6BA 3MAJA 4BKXA 2R4GA 3FMSA 1BOBA 3DWLE 1IJWC 1QVTA 1WWXA 2GIVA 1WJFA 1T33A 2K3PA 2KQRA 3F6VA 2Y2ZA 1A04A 5LHHA 3CMEI 1N25A 2E5ZA 3JAMZ 2FNAA 2Y9ZA 5EEGA 4XLEA 1IUFA 1ULYA 3HHHA 2OQGA 3H3ZA 1RR8C 3L1PA 2KZVA 4D5FA 5EG0A 2ZCWA 3CCYA 1W5SA 3GFJA 3UR3C 2O03A 5FO5A 2W1OA 4HV6A 4GGGA 4HDUA 4E7JA 4BJ5C 3K4JA 2IXSA 2KRCA 1TWCJ 2VBXA 3A0BC 4IKFA 1XCVA 3S1NJ 3MKYB 1G6NA 1D0XA 4O5VA 2DYSH 5D5WB 2DT6A 3BTLA 2VI6A 4LB6B 4I2OA 5DUKA 2G7HA 4B48A 4M3BA 3PIOF 2A69F 2LF8A 2P7CB 1WH5A 4HF0A 1MD0A 1ZYRF 2PX9A 2VJ4A 3CCJI 2BBYA 4EQQA 3JRIA 3S15J 4EJTA 2LY9A 1QU3A 1O3TA 2FOKA 3RDIA 3IWFA 1D1BA 2RNJA 5LFAA 4OIQF 1Z21A 1S7EA 3SZGA 2MD5A 3M1EA 4I7HA 3GEZA 4YIIA 4I6ZA 3S8PA 1LVAA 1O4XA 2EZKA 1MBJA 2IPQX 3D5SC 5IT3A 2HPIA 3LQRA 1Y56A 3HGYA 3LOCA 5HS9A 3HM5A 4C3JJ 3I55I 2P6SA 1E3HA 3GX4X 4HLYA 2BY1A 3EUHA 2EJRA 5LGNA 2L9VA 2X0LA 5HOOA 2WV1A 3CC2I 2VOPA 3FZVA 1H0MA 3CESA 2BHYA 2DA6A 3FBNB 3D5LA 5IYDJ 2OF7A 5J40A 1RKWA 3PM1A 4DNCA 3CO6C 3RTRA 3IAS2 4Y3OA 3RYPA 4A93J 2X51A 4U0YA 2DMTA 4HYEA 3VSLA 3VOEA 3IH4A 5ICFA 1TQPA 1S8NA 3F23A 5DDGA 2ID6A 4RGUA 2DFEA 5AIPA 1ZG5A 3RZOJ 2BV6A 2L4AA 3HRTA 3JCUC 4XN0A 3F8NA 2QCOA 3O2PE 3HXLA 2WAEA 3BG6A 3I9V2 1ZN2A 2DYRH 2M2EA 1Z77A 3OYLA 3GTQJ 2H09A 2NNNA 1R5ID 4X0GA 3ERED 4F93B 1R1TA 2E2JJ 1EH6A 4X6AJ 3K7AJ 3VSKA 1XD7A 4A69C 5F6FA 4NBQA 1XGNA 5FKOA 1O3RA 3OSGA 5E3MA 4FASD 1NK3P 1HLVA 4F52A 1YRNA 2HNHA 3VWBA 1T8IA 1IGNA 1HDDC 2RQPA 3Q0UA 1KZHA 1KONA 1VI0A 5IY5H 3W3CA 3IH3A 4CO8A 2WA0A 1PDNC 2EV5A 1MJAA 4OIOF 5BMZA 5IT9Z 3CCLI 2H1KA 1S5LC 4HEA2 1JXSA 2RQQA 3IAM2 1EF4A 1MH3A 2QGUA 4CDGA 3GFIA 1ZRCA 3Q9SA 5J4VA 4U7DA 3UNGC 5CYVA 3RPUD 3FBIB 3JRCA 3DTIA 5HDNA 2XC7A 4PDKA 5CPRB 2RAEA 5E3NA 3HPHA 1BI3A 1AHDP 3K10A 4LK1F 4FX4A 2MYSA 3HJEA 1DQUA 2X1CA 3LA3A 1R5HA 3WU2C 4FTHA 1W36C 2CQ7A 1G2HA 1T56A 3BR1A 4V19K 3I56I 1P2FA 5J4YA 3ZMUA 4LMYA 1GV5A 4C30A 1GLNA 2KDOA 5FKMA 2BEOA 3LSIA 3IV5A 2IJLA 3OYEA 3H5AA 4IHVA 1ZR2A 2JA8J 4XQFA 3IKTA 5CVIA 1EA3A 2IVMA 3HZJA 3MKWB 2OQRA 3GCMA 2O7OA 2MW8A 4XSXF 3GZ5A 5CVUA 3CO7C 2LF7A 1IUYA 5LGTA 3KZZA 4I01A 1WH7A 2VKDA 1VTNC 2BVLA 2BOLA 2L54A 2LBFB 2JTVA 4KYWA 1O7FA 2DJIA 3GBGA 2EINH 3NRVA 2K9SA 2QEXI 1OCCH 2BXZA 3HYIA 2DBBA 3C3WA 1WI3A 2IS2A 3TP0A 4DW6A 1RESA 2X1EA 4KITB 1ODDA 2IW5A 2QQBA 2XAJA 3RIRA 5FFZA 2E1OA 2CWEA 3PSIA 2XHKA 2W24A 3SXYA 4II3A 2L2OA 4QLCU 4AC0A 4HA8A 2L9SA 2XAFA 4HZFA 1V3FA 2JT1A 3QQAA 1T39A 2L5QA 5LLQA 4EGZA 1ZQ3P 1IN4A 3FHNA 1X1BA 3OIPA 1JUPA 1N77A 2Z2SB 3F8BA 1KYWA 5ILVA 2K27A 1GXPA 1YITI 3BTJA 3K4CA 2ICWG 5KHDA 4YRVA 1BI0A 4JX4A 4OIRF 3EUHC 4EM2A 2CRGA 5H20A 4CCLA 1OPCA 2LVSA 1JUMA 3ZQLA 2X48A 2Z5UA 2NRAC 5HS7A 4BHBA 2FOWA 2FBHA 4AU7A 3WODF 3G73A 4RB0A 2ACJA 1UZCA 2ZSHB 4PJMA 2WAFA 4E7HA 5GADJ 1IC8A 2HXIA 1I50J 3FDYA 2HTSA 2Y0SA 3OOPA 4OOIA 3EYIA 1NK2P 3DEEA 4BQOA 3VYRB 3DU5A 3H9GA 2B9SA 1JJ6C 2XPWA 4XNFA 1BW6A 1KU3A 5B1AH 3Q9VA 5BPIA 3L7WA 5M3FJ 2DMQA 3GXOA 3A0HC 2V79A 4RGSA 3PNTA 3FM3A 4ASNA 2MSYA 1RETA 2FBKA 5GTIC 2L9RA 1IZ1A 2R7RA 3GYHX 4WXHA 3LNQA 1PVEA 4ZZDA 5EG0B 3W2AA 2WC2A 2VT3A 1I39A 4L5EA 1D5YA 2LDUA 2KP6A 5LRRA 1GVJA 2FNPA 3GVAA 1FMWA 3FKJA 3PJRA 2LKPA 1P9QC 4PK4A 2MH2A 1DU6A 2M7AA 3KFWX 3O8HA 4LOCA 3AL0C 2V1NA 4QPQA 5D8KB 3BZCA 1FOXA 4PZJA 2A6HF 2DA4A 5D6FA 4NDLA 4KIBA 2DOAA 2O8XA 3EYYA 5F27A 3TDZC 1MBKA 4ZDPA 5E1XA 3FF5A 3OYFA 2KISA 2WBMA 2EIJH 4BGDA 2QQAA 3BOQA 1A5JA 2GOMA 5E79C 3OIOA 4G6TB 4YEJA 2YPRA 4YIRX 4V2GA 4B44A 2FSWA 2CMPA 4E7ZA 1G3YA 3RKYA 2K9NA 5K7ZA 2FMYA 3SYTA 4PGHA 2CJJA 4KMUX 2NVTJ 3MWMA 3QPSA 4A12A 2HVRA 5ILSA 1IDZA 1ORKA 2OZ6A 2W00A 5H2FC 2D45A 4IHYA 1I6XA 4HF1A 2M5WA 4GRIA 2CQNA 2QA4I 4Z2YA 3ONQA 2DI3A 1GDTA 1ON1A 1U8RA 1QZYA 5IOZA 3M4OJ 4AD9A 2M3AA 4Y52J 1HW1A 1TLHB 1TWHJ 1IO2A 1OCRH 2ZJ2A 4IZZA 2ZXIA 4DYQA 1REPC 2XF6A 3F8CA 1U5TC 3VDXA 2O6GE 4GFBA 2NVYJ 2E1MB 3ZR8X 3OYDA 2HQ5A 3HUGA 3W2VA 2M8GX 1XGSA 4RDUA 1BC8C 3WHBA 1JGSA 1LE8A 3B02A 1HW2A 1X1DA 2DLLA 3FWEA 5FGMA 1SMTA 2BGCA 2K02A 3V42A 4R1HA 1XN7A 4ABZA 1R49A 2MBFA 1W5TA 2COBA 3I4MJ 5F04A 2EIKH 1VZ0A 4WX9A 1IXCA 2F2EA 4IQJA 2EZLA 1B6AA 2EA2A 2XKOA 2CFXA 5L3GA 2Q2EB 1QO0D 1W0TA 3DP7A 4MHGA 3Q0VA 1IN5A 4GDFA 3Q3SA 1BIAA 2JWTA 5E18F 4MEYF 3V8JA 4ESFA 2WWYA 5TISC 2FBIA 1LDDA 2Y30A 2ZJRF 3E6MA 1HSJA 2O0YA 2DFHA 2HS5A 2F4IA 2MC3A 3S1RJ 2EV0A 3LA7A 3ZMDA 4O6JA 3VEPA 4HV5A 3RKXA 5LRSA 4V2FA 1P4AA 4BNCA 4UHTA 2F6CA 3K0LA 1SD4A 4UUTA 5JLWA 1Z9CA 3E0JB 4BU2A 1G3WA 4PJJA 2QSFX 1FTZA 1JTYA 1MMDA 5BNGA 5TRDA 1WRJA 1JUSA 3DBRB 5BS6A 2LMDA 1RPWA 3HTUA 2E1MC 4JX6A 1CF7B 2YU9J 2QWWA 3F0CA 4EJVA 1MZBA 4XN3A 1NH3A 1S9HA 1YFHA 4BY7J 2M8EA 1A36A 3OL3A 2Y31A 5EEAA 1HQCA 3EDPA 5F64A 3DTKA 1VQ4I 2KJCA 2P5LC 2XB5A 4G7OF 3ZMTA 2YX4A 5J3LA 2V1DA 4LK0F 4B3AA 2FMLA 4LG0B 3E3VA 4DJAA 2R7UA 2B7EA 4GYGA 2MFZA 4FX0A 4XKBA 2H8WA 2R5ZA 3CUQA 5DTDA 1Z7LA 1S29A 4JBAA 1BA5A 3EETA 3H0GJ 2NS0A 2M4KA 3TW6A 1TNTA 3B6AA 2L7KA 1DP3A 1SMYF 2O3FA 3KP7A 3LSJA 4E70A 1L0OC 1U5TB 3FK7A 5GP9A 1OYWA 3PIPF 2M7BA 1BR2A 2DN0A 1K83J 4MQVA 4XOPA 1SVMA 3RJPA 2E1NA 3L2WA 1JT6A 4AIHA 3WTSC 3EPZA 3NARA 1J75A 3CQZJ 3ULQB 1BC7C 2YS9A 4A0XA 3QPLA 1OR7C 2DQRA 4DZJA 1FSHA 4QSHA 3CMAI 2DMUA 5GAGJ 3FXOA 3W6JB 2VE9A 3ECHA 3CLOA 2VT2A 2W48A 3OR2C 1CF7A 4N0BA 2XAQA 2QUFA 3JRFA 3SEZA 1IN7A 3KLOA 1MKMA 2Z3YA 1HC8A 2ZBKA 1YJWI 2HKOA 4ZTJA 3FXLA 3N97A 2JVHA 2XF7A 1LQ1A 1LEBA 2K9LA 3LWFA 3MZYA 2VBWA 2MLKA 4FE4A 2I5UA 4KIGA 3WTXC 5FKLA 2HU9A 3O3KA 2JSCA 5HODA 1XPXA 3U9GA 3SZPA 1EJ9A 4WXCA 1OJLA 4FT8A 5L3FA 3DEWA 2H27A 3AKZA 4C2TA 2R7ZJ 4EJWA 2PN6A 4DBQA 5CVVA 4I98B 1SAXA 2E5NA 1LNWA 4BEHB 2HYGD 2R7QA 3I64A 2IGKA 3ZMZA 2WAQN 3HOVJ 3MZHA 2IGNA 1YJ9I 1MDMA 4IPAA 2ZXJA 4RB2C 4QPOA 1UB9A 1HA8A 3E7LA 2JUGA 4CCKA 2A61A 3JR9A 2DW4A 2M30A 3BLYA 3MFKA 1ETYA 4KIFA 1RKTA 3CF2A 3GO5A 4UB8C 3GZ6A 3F8MA 4M6VA 3CUQB 2ECBA 4EMSA 1I6HJ 1PJRA 5CQGA 4A5NA 1GVDA 2P8TA 3ZOBA 4PFOA 3R6SA 1UFMA 2VBZA 3GWZA 4BY1J 4OINF 2R7TA 2L7MP 5JLXA 4ZDOA 1AA7A 1R71A 4AWXB 4RAZA 2NXNB 3HTSB 4XORA 3E5UA 1LEAA 4M9SA 1LJ9A 1R5GA 2W84A 1MNEA 2HZTA 3I4PA 4LIVA 4N9HA 3QP5A 3VFZA 1N78A 4BJTA 1SVLA 4Y13A 1KU2A 2R7WA 3D1NI 4M72A 1O7LA 2ESHA 2IS1A 1QPIA 2WY8Q 2ISZA 4PUSA 1UHSA 3I0TA 4CYCB 5E3LA 4RAGA 3S1QJ 3E1SA 2AHQA 4A3CJ 2VE8A 5CJ9A 1Y0NA 5CKTA 3FHZA 2KIUA 4ETSA 4BE0A 4E7IA 4KNYA 4AIKA 4PSXA 1K78B 4FETA 3JW4A 3CZ6A 1H8AC 3QOPA 3TO6A 4ZTFA 3JRGA 2BY3A 2GZWA 1FOKA 5GPCA 5M5YJ 1YRNB 3F9KA 4DQ2A 2HGCA 1WJBA 3GW2A 2D2WA 4KT5C 5M5WJ 2BYVE 2XAHA 2IT0A 1W5CC 1WJ5A 5FJ8J 3OS1A 1U78A 2BHZA 2XGCA 1PP7U 3E6CC 5GPAA 3RZDJ 2BY2A 3L2QA 3BJOA 4DIQA 1RRJA 2W4SA 1R1UA 3OS2A 1WSUA 5F0FA 3MD2A 3VYTB 3RQ4A 1FJLA 3ABTA 4BQQA 1HBXG 2K7LA 4UXNA 1FX7A 2D1VA 2H6BA 2LLKA 2MG4A 2PBIA 1W7PB 1R22A 2ISYA 2F5VA 3LSGA 3WG9A 3S3NA 3OS0A 1XS9A 3OYJA 3I59A 4RGXA 3S93A 5JFRA 1AKHB 1K4SA 2K9QA 5KCMA 4E7KA 1BBYA 3OYBA 4FHTA 1MMAA 2RDPA 3JSPA 3H35A 3HOUJ 1UJ8A 1FBSA 1T0FA 2VKEA 1U9NA 3DKYA 2EB7A 2M87A 4P9FA 2QLZA 4YFNF 5D8LB 3W6VA 2DA7A 3SQNA 2PLYA 1RIOH 4ZJZA 5AONA 4RM3A 1YOVB 2V6CA 2JN6A 3F72A 1IF1A 1TW2A 1HKQA 1NHAA 2VXDA 5FROA 1ZGWA 1QHHD 3TW7A 3AAFA 2RC4A 3QOEA 1BJZA 3ZCOA 3M9AA 2QBYB 2HYJA 2KFDA 4Q5SF 3SEQA 4HX4A 4RMNA 3HOYJ 4A3EJ 2CV0A 4FE7A 1HOMA 3CDIA 3DCFA 1CGPA 5HNFA 1XDUA 2JJ7A 2XGXA 3OL4A 1BR4A 2VN2A 3M8JA 1BL0A 3BR5A 2H1LA 1IXSB 1EKEA 2COMA 2MH9A 2DA2A 2XPVA 1X4OA 4CUGA 1VQMI 2WV0A 5ILUA 2W85A 1WZ2A 5E1WA 2DFIA 3LAJA 2K85A 4Y17A 2YUSA 5D4RA 4E4HA 1BW5A 3HRSA 2M4GA 3GTLJ 5TGTA 2L4MA 4IO9F 1K78A 1HKTA 3G2BA 4OU0A 3TOBA 9ANTA 1BN5A 3CJTB 1AKHA 2KIFA 1W7PD 3OYKA 2IA1A 4DZPA 1WCMJ 1SAUA 1SFXA 4EJUA 2ZFWA 1WFXA 4UUSA 1J09A 4UUVA 1FEXA 4C2MJ 3AG1H 5J1UA 2ZKZA 2JPCA 4S0HB 4BDYA 3PL8A 3OSFA 1U3EM 2DA5A 1ZKGA 2ZXHA 3W2WA 3U21A 4BHPA 3QWLA 1OMIA 1TP4A 1TQIA 4HX7A 2LOOA 3CCUI 1V5EA 1FNNA 1TWFJ 1LVKA 4CZCA 1ZH5A 2EA4A 1W7PA 4L0ZB 3R0AA 2X4HA 2O9LA 1ZR4A 1FMVA 3TO7A 2IS6A 5IYCJ 2DDBA 1IV8A 1VQLI 4YELA 3CJQB 1X58A 5HLTA 2LKXA 1FYLA 2XDVA 5EGOA 2WY7Q 3IHUA 2ZJPF 2DTZA 1WKMA 1F36A 3GLLA 1ZARA 4BJ6C 3BDDA 4D7MA 1D8KA 4U7BA 2KIMA 2PFBA 2Q8KA 1QPMA 5BOXA 4IL6C 3HPGA 2L3DA 4XLCA 4J19A 2DA3A 3B73A 5CLSA 1XSDA 2NAZA 4A0ZA 1W36D 3HGGA 3W6KB 3I3LA 4D1QA 2R5YB 2R7OA 4W1UA 3H3VK 1D1AA 1W0UA 3S17J 2K4JA 3RPQA 2IAIA 1FIAA 4ITVA 3X2QH 4O3MA 4A3BJ 2DO7A 3KEQA 1C0WA 3QU3A 2EPFA 5B3SH 1HKSA 2KDZA 1BIBA 1O3SA 2R7VA 2CW7A 4BHCA 2X6OA 1OCOH 2K9MA 4HRIA 2O61A 3A02A 1OISA 3J80Z 4A6DA 4PJLA 2TCTA 5LEJA 5ICEA 3I58A 3GTPJ 1BI1A 3PQJA 1J7KA 1Z6RA 1MJ9A 2EV6A 3GF2A 5F08A 3I59B 2Z99A 2STWA 2P0WA 2P5KA 1NTCA 2ZNYA 3IP4B 4M6YA 3JRBA 4JOMA 3T0YA 2L01A 3HBLA 2UXNA 1B9MA 2LRDA 3HL2A 2CV2A 2OC6A 3FXJA 1XGOA 4BS9A 1JKOC 3K2ZA 3BPXA 1J9IA 1T0FC 3WU0A 3BY6A 3ZQFA 4MFEA 3C7JA 1MSEC 1IW7F 4HBLA 2CV1A 4XRFA 2OTJI 1R7JA 4BEHA 2RKHA 2J5PA 1IG7A 2Z33A 1YIJI 1TTYA 3DPUA 4KISA 2QQ9A 2FA5A 4LLGF 4IF4A 1PP8F 2GIZA 4B43A 2LYCA 4XONA 3GMEA 4BXXJ 1SEUA 3KYLA 3BQYA 3HB9A 4EV0A 2CO5A 1FOWA 4ENMA 1JJ8C 1X1AA 1P7IA 2JSPA 2E71A 4NB5A 5IOYA 1ON2A 4ANJA 3BT9A 1A35A 5E17F 3HRMA 4XLNF 1QGPA 3RI4A 4G8XA 3A1YA 3OYHA 1DDNA 2JA5J 1QA6A 3BZKA 1TW3A 3AG2H 3ZQ7A 4B47A 1SVOA 2F5CA 3ZXSA 1ETQA 1G8XA 2DT5A 4Q4ZF 2E1CA 3PFYA 4M74A 3ZRGA 2HR3A 2V9PA 5K5QA 4H0EA 4MEXF 2UWMA 2F48A 1BM9A 4A3JJ 1X3WB 2E35A 3G3ZA 1YW7A 4M6XA 4LD5A 3LA2A 1MMNA 4UB6C 3WGIA 5L3BA 1NG7A 4CH7A 1QRYA 2VL8A 3LAPA 1AWCA 3IRQA 1B8IA 4A3FJ 1VQOI 3CCQI 3ZMVA 5DCFA 1U2WA 5D5VB 1B4AA 1B8IB 5K1YA 2R5YA 3M07A 3DKWA 3S3OA 2CQXA 3J81Z 1STZA 5DM7F 5HNHA 2BE5F 1YG2A 4DYCA 3TEDA 2P6TA 2WAQA 3CCMI 2L9NA 1DUXC 1Z3YA 1WJEA 4OMZA 3OOUA 1TWAJ 1ZRFA 2LP0A 2RN7A 3BJAA 1Y39A 4IHXA 2ZB9A 4KFCA 3WTVC 2R7DA 2ZXWH 1R4MB 3RKQA 1I1GA 4XOTA 3QRFF 5J1RA 3FMRA 1R4NB 3AG3H 3GTJJ 3P9KA 2VPLA 2OV7A 3FXUA 1ZG3A 3F6OA 4N9IA 2L7FP 3KP6A 5L3EA 2LH9A 4MFDA 2HZDA 5FB2A 3CMYA 1VQNI 1U5TA 5K5RA 1S6LA 4EVIA 5LD2C 4OWRB 3GZNB 4M9ZA 3ZGKA 2DAOA 5LEKA 2YX7A 3TQNA 1UHMA 4LFUA 2EFWA 3K4BA 1Z3XA 5KVRA 4LLNA 2UV1A 4A3LJ 1JE8A 4P5OA 1LFBA 1XSVA 3DXJF 3CP8A 2HI3A 2N8GA 5LGUA 3CCRI 3K70C 5JHFA 1Z6TA 3OYCA 5IP7J 1ENHA 1XC5A 2XROA 2A07F 3FXQA 3F8FA 3NQOA 3FKIJ 4ZYEA 2FX0A 4D7NA 5BQTA 3BP8A 2ZMEA 2Z16A 2M9HA 2XAGA 2J5OA 1MH4A 2OUMA 2Y48A 2DMNA 3S3MA 2XF5A 4ZYGA 2H6CA 1T08B 2AQEA 2QKLB 3RPUA 2V9KA 3COAC 4F55A 3CUQC 1GT0C 4RAYA 3L00A 3S32A 3RCOA 2IP2A 3FK6A 3K9TA 1OCPA 5HLIA 1YW8A 2I10A 3BC8A 3R61A 3TO9A 3N4MA 3GTMJ 1P4XA 2KT0A 3BG5A 3G71I 2CS3A 1KQ8A 2QQ8A 3WU1B 3DV8A 2R7XA 2O5RA 2FF4A 3V8LA 5K5OA 2VKHA 1B1BA 1FP1D 1G59A 2M1BA 2LC2A 4Y4RA 3DLLF 2W82A 1EH7A 2GQQA 1Y8QB 2R7FA 2X9DA 1LE8B 1O57A 3T8TA 1Q1HA 2I8DA 4R79A 3BWGA 3H3UA 4FCYA 4BQAA 1I27A 3H0DA 5EGOB 4XRSA 1ZLJA 3TP3A 3JREA 1J5YA 2VONA 1KQ0A 2Z9OA 4A3KJ 3KP5A 1IRFA 4B4CA 3BR6A 2OCCH 1ETVA 3PO2J 2A05A 4C2UA 2V26A 1OFCX 3IUOA 3L09A 3OYMA 2GWRA 4A5MA 1KGSA 4CSWA 5E8IA 4ZH4F 3CDLA 3V7CA 2UZKA 1TQMA 4XLFA 4EEFG 1QBJA 1ETKA 4M3GA 1LPQA 2NVUB 2K86A 4M3DA 3OMYA 3WGGA 5C4JJ 1W1WE 1RUOA 1QZEA 3M3YJ 5GAHJ 1R6RA 3QP6A 2VIXA 1D1CA 4WXDA 1LB2A 3LFUA 3PNYA 4W97A 1JT0A 3AL0B 4A3DJ 1JKQC 1JI8A 2YR2A 3A01A 3F3XA 3FM5A 4UY8I 1X3ZB 1Z91A 4R8HA 2ZFUA 3Q5FA 3PO3J 1UG2A 2LY1A 1TNSA 4M73A 4IRIA 3V8KA 4CCJA 5AIQA 1IXRC 1DU0A 3OR1C 2OZUA 2E60A 3J7AO 4LLLA 3DQVC 2BXYA 2ZMEC 4ZYDA 1ETOA 1LFPA 1MDMB 4LG3A 1SD5A 3BR0A 4WK8F 5FRMA 3U1KA 3Q0WA 4PJNA 4EM1A 1PUFB 1ZTRA 2HFHA 2ME0A 3VODA 5LHGA 1VQPI 3FMQA 4MIMA 2PMUA 1BR1A 1DGWY 2HKXA 1E3PA 4UVBA 3QPHA 4HDVA 1UELB 1IDYA 5CVJA 2ELHA 3PSFA 3EUAA 3B6CA 3QYBA 3HKZN 1U8BA 2KJBA 3TDUC 4G7HF 2CUFA 3C18A 4NC7A 4BBSJ 5DM6F 4L9JA 3LMMA 3R4KA 1MGTA 3L9FA 2OA4A 3H5NA 2Y0MA 3PQKA 3IL2A 2X1DA 3BCAA 3HIFA 3OYNA 2CW0F 4MTEA 2LTPA 3V7SA 1YTYA 2JRMA 3ZQGA 2V1UA 5F0CA 3GTGJ 3JTGA 3ZP5A 3ABUA 1FZPB 1K7AA 3QU6A 2R7SA 1Q1VA 2XPUA 5B1BH 2KZGA 4HNUA 1K61A 2IA0A 4D5CA 1ZAOA 1XGMA 3KIOA 2CW8A 1YJNI 4MNUA 2UXXA 4I0AA 1P92A 2CGPA 2X85A 3LFKA 2JA6J 2DK8A 2D5VA 2LFBA 3G4SI 3HG9A 3KLNA 3SHFA 4UV9A 2PJPA 4IRHA 1KYZA 4DGWB 3KETA 1B72B 5DV5A 4NHJA 3HOTA 3KPHA 1QHGA 3H9QA 3TGNA 3UKGA 2MA3A 4I02A 1W4MA 2KIQA 1JTXA 4CA0A 2VQGA 2VKVA 6PAXA 3CC7I 3C2BA 2V6EA 3VYSB 4I76A 4L0YB 3DBLB 2FRHA 2VPRA 1FC3A 2Q0OA 5HDKA 4II2A 5KK1A 3ISPA 3HOZJ 2CUZA 2JVGA 3MVPA 4AYBA 3J81K 2FD5A 4DYRA 4IHTA
chains in the Genus database with same CATH topology
2PG4A 2ESNA 1B9NA 1IRGA 4IRGA 2FQ3A 4MQ9F 1FP2A 2DPDA 1G4DA 2VBYA 4HQMA 3QPTA 2QVOA 1FBQA 4UVAA 3P7NA 1Y0UA 5ICGA 3C1DA 2QM3A 3S2WA 4ENNA 4RB1A 3DEUA 3FXRA 1RI7A 4K2EA 1FSEA 5F1RA 2A6EF 3ROUA 5DD8A 3HOSA 3HSEA 4WF2A 4I09A 3BROA 5HLHA 5D5XB 2DQLA 1SD7A 5FLXK 1FBUA 3ECOA 3ZN0A 3QAHA 2ZO4A 3KP3A 2HOEA 1FLIA 4KA4A 4KN7X 5DD4A 1XCBA 1U6GA 2FXAA 3DPTA 2P4WA 3IWZA 1QZZA 5HDGA 3WGHA 4GXOA 2R3SA 5ICCA 2QYOA 1SFEA 3R0JA 4WCGA 1ZG1A 3HRUA 2YSRA 4ENKA 1D3YA 1RUNA 2CQKA 2DPUA 5FD5A 2JRTA 3F22A 1L3LA 3M8FA 4TV7A 5E8GA 3RKWA 2VOOA 3VB2A 3DPLC 4UVCA 5CVRA 5J6XA 2EFOA 1YLFA 3J80K 1YS7A 4OIPF 2KRFA 4L9VA 3L2CA 4BAYA 2CSOA 4G7ZF 4B8XA 3OV8A 3E6DA 2EFNA 2CYYA 4UNOA 2HDCA 1ZRDA 3BJ6A 3CDHA 2JPBA 4UV8A 4CHUA 4S05A 1WI9A 5FLXZ 3WTTC 5J8FA 4P55A 3D0SA 4HLXA 2GXGA 4JK1X 3ZPLA 5LHIA 1T98A 1T6SA 3JTHA 4KICA 3PFIA 1KA8A 2HWVA 4JQFA 2RV8A 2HTJA 1OKRA 1MJBA 4PGGA 4G6DA 2EFQA 1BOAA 2OU2A 5EEHA 2P7VB 3MEXA 4GYIA 3V7RA 1UCRA 1BI2A 2G9WA 4L5IA 1KU9A 5DCMA 4KDPA 2PMHA 3ZN1A 3K69A 1ZGAA 4HX8A 1J0RA 1HXDA 1QQIA 3LSTA 3KEOA 3O6BB 3R60A 1R23A 3H92A 3WTYC 4OMYA 2PQ8A 4YFXF 1ZREA 2GXBA 5E1ZB 1J59A 3TKYA 3U1DA 3EQLF 5IT9K 1R00A 2OBPA 1Z1DA 1FYKA 1T2KA 1XMAA 4BYYA 4CICA 5DEQA 3P9CA 4LB5A 3T5XA 4M71A 3FX3A 4S04A 3RYRA 5HVQC 3I5UA 5DUIA 1UHWA 5DCMB 4ZZLA 1K6OA 3GFMA 2XRNA 3P9IA 4U0VA 2VODA 2DU9A 4KMFA 3HSRA 2FU4A 3E5XA 5FFXA 2WTEA 1FT9A 4G9YA 1O3QA 3I71A 1USTA 4D0PA 2XIGA 1LDJA 2AXLA 4XSZF 1YYVA 2D1HA 3HHGA 2W57A 1S3JA 1YS6A 1F4KA 4ESBA 2XVCA 1ZHFA 2DTRA 2F5DA 1J2XA 1DPRA 3REOA 2YU3A 3JSOA 4LGWA 3WE2A 1LDKB 4HF2A 1FY7A 3DFGA 1SFUA 5ED4A 2GA1A 4Q47A 3KCCA 2F5EA 3ELKA 3ZMSA 1RZ4A 2A3SA 2G7UA 1KQ9A 4ON0A 1XB4A 3E5QA 2HQRA 3LQQA 1AOYA 4ENJA 2OAZA 4XLPF 3M8EA 3CUOA 1HSTA 1D8JA 3U2RA 4I0BA 2TDXA 5JVTA 3IRRA 2VC1A 1DPUA 1Z7UA 1F1ZA 2AS5F 4HAMA 5DYMA 1JHHA 1S7OA 1TBXA 2H94A 4ESJA 2RVCA 3I53A 1G3SA 1V4RA 3E97A 4A2UA 4PCQA 1XDSA 1ZLKA 3SZTA 2L02A 5JI6A 2XASA 3HSFA 2LSOA 5J8CA 3F21A 3IKVA 1H9TA 3T8RA 3I54A 1X3UA 1FWZA 2XV4S 4GO1A 4YG2F 4XBFA 4HW0A 1R36A 4KN4X 4LJZF 4IJAA 2EK5A 2A68F 1WQ2A 1R58A 4MGRA 1EH8A 3KP4A 1F5TA 3CJNA 1IN8A 4B09A 1HW5A 3GLXA 1K79A 4KUMA 5H6RA 3WTZA 2K4BA 4AIJA 1E2XA 4NQWA 2E7XA 3KE2A 2QENA 3ML6A 4L9NA 2RGVA 3WE3A 1G3TA 3M7GA 3JAMK 5HLGA 5D4SA 2NYXA 4YFKF 5HS8A 1EV7A 2VC0A 3IC7A 2FE3A 1XMKA 1R1VA 1GHCA 1YO5C 4LG0A 2MLGA 1JHFA 4A0YA 4QWQA 3WTUC 1DP7P 1XSXA 5JHUA 1Z05A 4HOBA 2JZYA 4AVPA 1I1SA 2LNBA 1SD6A 2V9VA 3T1BA 1GXQA 3WTWC 4CXFA 2P5VA 4Y15A 1I5ZA 2Q2EA 2EWNA 2Y75A 1YQAA 3MCZA 1OR7A 4P96A 4U0WA 3MQ0A 4L5JA 2KKOA 3K1NA 3DF8A 4YIFA 1PUEE 3KZYA 2E7WA 3BZ6A 4G6QA 2STTA 2GA2A 2HYFA 1P4WA 3K1PA 4L18B 2ADUA 2XUBA 4GCVA 2W25A 4IHSA 2V1XA 4IXAA 2IRFG 5L3CA 2CG4A 5A2QK 4IVNA 4MTDA 1S7AA 4CZZA 4RB3C 4M9XA 5A2QZ 4ZYHA 3GUDA 2PI0A 1IAWA 3NEUA 1YW9A 4RGRA 4RS8A 4WWCA 3V4GA 3TOAA 1OYIA 3GFLA 5D6EA 2PEXA 3K1MA 1F9NA 5FD6A 4L9TA 4U88A 5BPDA 2NNYA 5JR3A 4F7ZA 1P6RA 4EJOA 4Q48A 2HEOA 2FEZA 4BXUA 3BPVA 1BJAA 4HQEA 1USSA 1YIOA 2ZNZA 2B0LA 1IN6A 1T38A 1ONVA 2HQNA 4CGZA 2ETHA 4BH9A 5H6QA 3SFZA 2DK5A 2QBYA 1KU7A 3CTAA 5E20A 5L3DA 2ZMEB 2IA2A 4A6EA 1QNTA 3KP2A 1RNLA 1OYYA 4EM0B 1FYMA 2EFPA 4P9UA 5ERIA 2A5YB 4G94A 1ZGJA 2QZ8A 2C6YA 1FPQA 2XKPA 5LBQA 2M45A 5D5UB 2OD5A 2VXZA 1D5VA 4CYDA 4EGYA 1E17A 1B59A 2F5FA 5TJJA 2GAUA 1H9GA 3E6BA 3MAJA 3FMSA 1WWXA 2GIVA 3F6VA 1A04A 5LHHA 3JAMZ 2FNAA 5EEGA 1ULYA 3HHHA 2OQGA 3H3ZA 2ZCWA 1W5SA 3GFJA 2O03A 5FO5A 4HV6A 4GGGA 4HDUA 2VBXA 1XCVA 1G6NA 4O5VA 5D5WB 4I2OA 4LB6B 5DUKA 2G7HA 2A69F 2LF8A 2P7CB 4HF0A 1MD0A 1ZYRF 2BBYA 4EQQA 4EJTA 1O3TA 2FOKA 3RDIA 3IWFA 2RNJA 4OIQF 2MD5A 3M1EA 4I7HA 3GEZA 4YIIA 1LVAA 2IPQX 5IT3A 3LQRA 5HS9A 2P6SA 3GX4X 4HLYA 3EUHA 2EJRA 5LGNA 2X0LA 5HOOA 2VOPA 3FZVA 1H0MA 3D5LA 4DNCA 3CO6C 3RTRA 3RYPA 4U0YA 4HYEA 3VOEA 5ICFA 1TQPA 1S8NA 3F23A 5DDGA 4RGUA 5AIPA 1ZG5A 2BV6A 2L4AA 3HRTA 3F8NA 3O2PE 1ZN2A 2H09A 2NNNA 3ERED 1R1TA 1EH6A 1XD7A 5F6FA 1XGNA 1O3RA 2RQPA 4CO8A 1PDNC 2EV5A 1MJAA 4OIOF 5BMZA 5IT9Z 1JXSA 4CDGA 3GFIA 1ZRCA 3Q9SA 4U7DA 5CYVA 5HDNA 4PDKA 1BI3A 4LK1F 4FX4A 3LA3A 1R5HA 1P2FA 3ZMUA 4LMYA 2BEOA 2IJLA 3IKTA 5CVIA 2IVMA 2OQRA 4XSXF 3GZ5A 5CVUA 3CO7C 2LF7A 1IUYA 5LGTA 3KZZA 4I01A 1VTNC 2L54A 2JTVA 4KYWA 1O7FA 3NRVA 3HYIA 2DBBA 3C3WA 1ODDA 2IW5A 2QQBA 2XAJA 3RIRA 5FFZA 2CWEA 2XHKA 2W24A 3SXYA 4QLCU 4HA8A 2XAFA 4HZFA 1V3FA 2JT1A 5LLQA 4EGZA 1IN4A 3F8BA 5ILVA 1KYWA 1GXPA 2K27A 1BI0A 4OIRF 4EM2A 5H20A 1OPCA 2Z5UA 2NRAC 5HS7A 4BHBA 2FBHA 3WODF 3G73A 4RB0A 2ACJA 4OOIA 2HTSA 3OOPA 3EYIA 1KU3A 3Q9VA 5BPIA 3L7WA 3GXOA 2V79A 4RGSA 3FM3A 4ASNA 2FBKA 1IZ1A 3GYHX 4WXHA 4ZZDA 2WC2A 2VT3A 2LDUA 5LRRA 1GVJA 2FNPA 3GVAA 2LKPA 2MH2A 3KFWX 5D8KB 4PZJA 2A6HF 5D6FA 4KIBA 2O8XA 3EYYA 3TDZC 5E1XA 3FF5A 2QQAA 3BOQA 2YPRA 2FSWA 1G3YA 3RKYA 2FMYA 4PGHA 4KMUX 3MWMA 4A12A 5ILSA 2OZ6A 2D45A 4HF1A 1I6XA 2M5WA 4Z2YA 2DI3A 1ON1A 1U8RA 1QZYA 4AD9A 1HW1A 1TLHB 2ZJ2A 1REPC 3F8CA 1U5TC 2O6GE 3HUGA 1BC8C 1XGSA 1JGSA 3B02A 1HW2A 2DLLA 3FWEA 5FGMA 1SMTA 2BGCA 2K02A 4R1HA 1XN7A 2MBFA 1W5TA 4WX9A 1IXCA 2F2EA 1B6AA 2EA2A 2XKOA 2CFXA 5L3GA 1QO0D 3DP7A 4MHGA 1IN5A 1BIAA 5E18F 4MEYF 3V8JA 4ESFA 2WWYA 2FBIA 1LDDA 3E6MA 1HSJA 2O0YA 2HS5A 2MC3A 2EV0A 3LA7A 3ZMDA 4O6JA 3VEPA 4HV5A 3RKXA 5LRSA 4BNCA 1P4AA 4UHTA 3K0LA 1SD4A 1Z9CA 1G3WA 5TRDA 1WRJA 5BS6A 3HTUA 1CF7B 2QWWA 4EJVA 1MZBA 1YFHA 2M8EA 1HQCA 3EDPA 5F64A 2KJCA 2P5LC 4G7OF 3ZMTA 2YX4A 2V1DA 4LK0F 2FMLA 4LG0B 3E3VA 4GYGA 4FX0A 3CUQA 1S29A 4JBAA 3EETA 2NS0A 1TNTA 1SMYF 2O3FA 3KP7A 4E70A 1L0OC 1U5TB 1OYWA 4MQVA 3RJPA 2E1NA 4AIHA 3WTSC 1J75A 3ULQB 1BC7C 4A0XA 2DQRA 1FSHA 3W6JB 2VE9A 3ECHA 3CLOA 2VT2A 1CF7A 4N0BA 2XAQA 2QUFA 1IN7A 3KLOA 1MKMA 2Z3YA 2ZBKA 2HKOA 3N97A 1LQ1A 1LEBA 3LWFA 3MZYA 2VBWA 2MLKA 4KIGA 3WTXC 3O3KA 2JSCA 3U9GA 3SZPA 4WXCA 4FT8A 5L3FA 2H27A 4EJWA 2PN6A 5CVVA 4I98B 1SAXA 1LNWA 2HYGD 3I64A 3ZMZA 3MZHA 1MDMA 4IPAA 2ZXJA 4RB2C 1UB9A 2A61A 2DW4A 2M30A 3MFKA 4KIFA 3GO5A 3GZ6A 3F8MA 3CUQB 4EMSA 4A5NA 2P8TA 3R6SA 1UFMA 2VBZA 3GWZA 4OINF 4AWXB 4RAZA 3HTSB 3E5UA 1LEAA 4M9SA 1LJ9A 1R5GA 2W84A 2HZTA 3I4PA 4N9HA 3QP5A 3VFZA 4Y13A 1KU2A 4M72A 1O7LA 2ESHA 2ISZA 3I0TA 2VE8A 5CJ9A 3FHZA 2KIUA 4ETSA 4KNYA 4AIKA 1K78B 3JW4A 3QOPA 3TO6A 2GZWA 1FOKA 4DQ2A 2HGCA 3GW2A 2D2WA 4KT5C 2BYVE 2XAHA 2IT0A 1U78A 1PP7U 3E6CC 3BJOA 1R1UA 1WSUA 3ABTA 1HBXG 2K7LA 4UXNA 1FX7A 2D1VA 2H6BA 2PBIA 1W7PB 1R22A 2ISYA 1T39A 3WG9A 3I59A 4RGXA 5JFRA 1BBYA 4FHTA 2RDPA 3JSPA 1FBSA 1T0FA 4P9FA 2EB7A 2M87A 4YFNF 2QLZA 5D8LB 3SQNA 2PLYA 1RIOH 5AONA 2V6CA 3F72A 1IF1A 1TW2A 1HKQA 1NHAA 3AAFA 2RC4A 3M9AA 2QBYB 4Q5SF 4HX4A 1CGPA 1XDUA 2XGXA 2VN2A 1IXSB 2COMA 2MH9A 2WV0A 5ILUA 2W85A 5E1WA 2DFIA 3LAJA 4Y17A 5D4RA 3HRSA 2L4MA 1K78A 1HKTA 4OU0A 3TOBA 1BN5A 2KIFA 1W7PD 2IA1A 1SFXA 4EJUA 2ZFWA 4UUVA 2ZKZA 2JPCA 1U3EM 4BHPA 1OMIA 1TQIA 4HX7A 1FNNA 1ZH5A 2EA4A 1W7PA 4L0ZB 3R0AA 2X4HA 3TO7A 1FYLA 3IHUA 1WKMA 1ZARA 3BDDA 1D8KA 4U7BA 2KIMA 2PFBA 2Q8KA 1QPMA 5BOXA 2L3DA 3B73A 5CLSA 1XSDA 2NAZA 4A0ZA 3W6KB 2K4JA 3RPQA 4O3MA 2DO7A 3KEQA 1C0WA 3QU3A 1HKSA 1BIBA 1O3SA 4BHCA 2O61A 3J80Z 4A6DA 5LEJA 5ICEA 3I58A 1BI1A 3PQJA 1J7KA 1Z6RA 1MJ9A 2EV6A 3GF2A 3I59B 2Z99A 2STWA 2P5KA 2ZNYA 4M6YA 3T0YA 2L01A 2UXNA 1B9MA 1XGOA 3K2ZA 3BPXA 1J9IA 3WU0A 3BY6A 3C7JA 1IW7F 4HBLA 4XRFA 1R7JA 2RKHA 2J5PA 2Z33A 1TTYA 2QQ9A 2FA5A 4LLGF 4IF4A 1PP8F 4EV0A 2CO5A 4ENMA 4NB5A 1ON2A 5E17F 3HRMA 4XLNF 1QGPA 3RI4A 4G8XA 1DDNA 1TW3A 3ZQ7A 2F5CA 2DT5A 4Q4ZF 2E1CA 4M74A 2HR3A 5K5QA 4H0EA 4MEXF 2UWMA 1BM9A 3G3ZA 1YW7A 4M6XA 4LD5A 3LA2A 3WGIA 5L3BA 1AWCA 3LAPA 3IRQA 3ZMVA 5DCFA 1U2WA 5D5VB 1B4AA 5K1YA 3DKWA 3J81Z 1STZA 2BE5F 1YG2A 2P6TA 1DUXC 4OMZA 1ZRFA 2RN7A 3BJAA 4KFCA 3WTVC 2R7DA 1I1GA 3QRFF 3FMRA 3P9KA 3FXUA 1ZG3A 3F6OA 4N9IA 3KP6A 5L3EA 5FB2A 1U5TA 5K5RA 1S6LA 4EVIA 4M9ZA 2DAOA 5LEKA 2YX7A 3TQNA 1UHMA 4LFUA 2EFWA 5KVRA 4LLNA 1JE8A 4P5OA 1XSVA 3DXJF 5LGUA 1Z6TA 2XROA 2A07F 3FXQA 3F8FA 3NQOA 4ZYEA 5BQTA 3BP8A 2ZMEA 2XAGA 2J5OA 2Y48A 4ZYGA 2H6CA 3RPUA 3COAC 3CUQC 4RAYA 3L00A 2IP2A 3K9TA 5HLIA 1YW8A 3R61A 3TO9A 3N4MA 1P4XA 1KQ8A 3WU1B 3DV8A 3V8LA 2FF4A 5K5OA 1B1BA 1FP1D 2M1BA 1EH7A 2GQQA 2R7FA 1O57A 3T8TA 1Q1HA 4R79A 3BWGA 3H3UA 4BQAA 1I27A 1ZLJA 1J5YA 2VONA 1KQ0A 2Z9OA 3KP5A 1IRFA 3L09A 2GWRA 4A5MA 1KGSA 5E8IA 4ZH4F 3V7CA 2UZKA 1TQMA 1QBJA 2K86A 3WGGA 1RUOA 3QP6A 4WXDA 1LB2A 2YR2A 3F3XA 3FM5A 1Z91A 4R8HA 3Q5FA 1TNSA 4M73A 4IRIA 3V8KA 5AIQA 1IXRC 2OZUA 3J7AO 4LLLA 3DQVC 4ZYDA 1MDMB 1SD5A 4WK8F 4EM1A 2HFHA 3VODA 5LHGA 3FMQA 2PMUA 2HKXA 4UVBA 3QPHA 4HDVA 5CVJA 2ELHA 2KJBA 3TDUC 4G7HF 3C18A 4L9JA 3R4KA 1MGTA 3L9FA 2OA4A 2Y0MA 3PQKA 3IL2A 3HIFA 2CW0F 4MTEA 3V7SA 1YTYA 2V1UA 3JTGA 3ZP5A 3ABUA 1FZPB 1K7AA 3QU6A 2IA0A 1ZAOA 1XGMA 4MNUA 2UXXA 4I0AA 1P92A 2CGPA 3LFKA 2DK8A 3KLNA 3SHFA 4UV9A 2PJPA 4IRHA 1KYZA 3KETA 5DV5A 4NHJA 3HOTA 3TGNA 2MA3A 4I02A 1W4MA 6PAXA 4L0YB 2FRHA 1FC3A 2Q0OA 5HDKA 5KK1A 3ISPA 3J81K 4IHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PG4 A;  2ESN A;  1B9N A;  1IRG A;  4IRG A;  2FQ3 A;  4MQ9 F;  1FP2 A;  2DPD A;  1G4D A;  2VBY A;  4HQM A;  3QPT A;  2QVO A;  1FBQ A;  4UVA A;  3P7N A;  1Y0U A;  5ICG A;  3C1D A;  2QM3 A;  3S2W A;  4ENN A;  4RB1 A;  3DEU A;  3FXR A;  1RI7 A;  4K2E A;  1FSE A;  5F1R A;  2A6E F;  3ROU A;  5DD8 A;  3HOS A;  3HSE A;  4WF2 A;  4I09 A;  3BRO A;  5HLH A;  5D5X B;  2DQL A;  1SD7 A;  5FLX K;  1FBU A;  3ECO A;  3ZN0 A;  3QAH A;  2ZO4 A;  3KP3 A;  2HOE A;  1FLI A;  4KA4 A;  4KN7 X;  5DD4 A;  1XCB A;  1U6G A;  2FXA A;  3DPT A;  2P4W A;  3IWZ A;  1QZZ A;  5HDG A;  3WGH A;  4GXO A;  2R3S A;  5ICC A;  2QYO A;  1SFE A;  3R0J A;  4WCG A;  1ZG1 A;  3HRU A;  2YSR A;  4ENK A;  1D3Y A;  1RUN A;  2CQK A;  2DPU A;  5FD5 A;  2JRT A;  3F22 A;  1L3L A;  3M8F A;  4TV7 A;  5E8G A;  3RKW A;  2VOO A;  3VB2 A;  3DPL C;  4UVC A;  5CVR A;  5J6X A;  2EFO A;  1YLF A;  3J80 K;  1YS7 A;  4OIP F;  2KRF A;  4L9V A;  3L2C A;  4BAY A;  2CSO A;  4G7Z F;  4B8X A;  3OV8 A;  3E6D A;  2EFN A;  2CYY A;  4UNO A;  2HDC A;  1ZRD A;  3BJ6 A;  3CDH A;  2JPB A;  4UV8 A;  4CHU A;  4S05 A;  1WI9 A;  5FLX Z;  3WTT C;  5J8F A;  4P55 A;  3D0S A;  4HLX A;  2GXG A;  4JK1 X;  3ZPL A;  5LHI A;  1T98 A;  1T6S A;  3JTH A;  4KIC A;  3PFI A;  1KA8 A;  2HWV A;  4JQF A;  2RV8 A;  2HTJ A;  1OKR A;  1MJB A;  4PGG A;  4G6D A;  2EFQ A;  1BOA A;  2OU2 A;  5EEH A;  2P7V B;  3MEX A;  4GYI A;  3V7R A;  1UCR A;  1BI2 A;  2G9W A;  4L5I A;  1KU9 A;  5DCM A;  4KDP A;  2PMH A;  3ZN1 A;  3K69 A;  1ZGA A;  4HX8 A;  1J0R A;  1HXD A;  1QQI A;  3LST A;  3KEO A;  3O6B B;  3R60 A;  1R23 A;  3H92 A;  3WTY C;  4OMY A;  2PQ8 A;  4YFX F;  1ZRE A;  2GXB A;  5E1Z B;  1J59 A;  3TKY A;  3U1D A;  3EQL F;  5IT9 K;  1R00 A;  2OBP A;  1Z1D A;  1FYK A;  1T2K A;  1XMA A;  4BYY A;  4CIC A;  5DEQ A;  3P9C A;  4LB5 A;  3T5X A;  4M71 A;  3FX3 A;  4S04 A;  3RYR A;  5HVQ C;  3I5U A;  5DUI A;  1UHW A;  5DCM B;  4ZZL A;  1K6O A;  3GFM A;  2XRN A;  3P9I A;  4U0V A;  2VOD A;  2DU9 A;  4KMF A;  3HSR A;  2FU4 A;  3E5X A;  5FFX A;  2WTE A;  1FT9 A;  4G9Y A;  1O3Q A;  3I71 A;  1UST A;  4D0P A;  2XIG A;  1LDJ A;  2AXL A;  4XSZ F;  1YYV A;  2D1H A;  3HHG A;  2W57 A;  1S3J A;  1YS6 A;  1F4K A;  4ESB A;  2XVC A;  1ZHF A;  2DTR A;  2F5D A;  1J2X A;  1DPR A;  3REO A;  2YU3 A;  3JSO A;  4LGW A;  3WE2 A;  1LDK B;  4HF2 A;  1FY7 A;  3DFG A;  1SFU A;  5ED4 A;  2GA1 A;  4Q47 A;  3KCC A;  2F5E A;  3ELK A;  3ZMS A;  1RZ4 A;  2A3S A;  2G7U A;  1KQ9 A;  4ON0 A;  1XB4 A;  3E5Q A;  2HQR A;  3LQQ A;  1AOY A;  4ENJ A;  2OAZ A;  4XLP F;  3M8E A;  3CUO A;  1HST A;  1D8J A;  3U2R A;  4I0B A;  2TDX A;  5JVT A;  3IRR A;  2VC1 A;  1DPU A;  1Z7U A;  1F1Z A;  2AS5 F;  4HAM A;  5DYM A;  1JHH A;  1S7O A;  1TBX A;  2H94 A;  4ESJ A;  2RVC A;  3I53 A;  1G3S A;  1V4R A;  3E97 A;  4A2U A;  4PCQ A;  1XDS A;  1ZLK A;  3SZT A;  2L02 A;  5JI6 A;  2XAS A;  3HSF A;  2LSO A;  5J8C A;  3F21 A;  3IKV A;  1H9T A;  3T8R A;  3I54 A;  1X3U A;  1FWZ A;  2XV4 S;  4GO1 A;  4YG2 F;  4XBF A;  4HW0 A;  1R36 A;  4KN4 X;  4LJZ F;  4IJA A;  2EK5 A;  2A68 F;  1WQ2 A;  1R58 A;  4MGR A;  1EH8 A;  3KP4 A;  1F5T A;  3CJN A;  1IN8 A;  4B09 A;  1HW5 A;  3GLX A;  1K79 A;  4KUM A;  5H6R A;  3WTZ A;  2K4B A;  4AIJ A;  1E2X A;  4NQW A;  2E7X A;  3KE2 A;  2QEN A;  3ML6 A;  4L9N A;  2RGV A;  3WE3 A;  1G3T A;  3M7G A;  3JAM K;  5HLG A;  5D4S A;  2NYX A;  4YFK F;  5HS8 A;  1EV7 A;  2VC0 A;  3IC7 A;  2FE3 A;  1XMK A;  1R1V A;  1GHC A;  1YO5 C;  4LG0 A;  2MLG A;  1JHF A;  4A0Y A;  4QWQ A;  3WTU C;  1DP7 P;  1XSX A;  5JHU A;  1Z05 A;  4HOB A;  2JZY A;  4AVP A;  1I1S A;  2LNB A;  1SD6 A;  2V9V A;  3T1B A;  1GXQ A;  3WTW C;  4CXF A;  2P5V A;  4Y15 A;  1I5Z A;  2Q2E A;  2EWN A;  2Y75 A;  1YQA A;  3MCZ A;  1OR7 A;  4P96 A;  4U0W A;  3MQ0 A;  4L5J A;  2KKO A;  3K1N A;  3DF8 A;  4YIF A;  1PUE E;  3KZY A;  2E7W A;  3BZ6 A;  4G6Q A;  2STT A;  2GA2 A;  2HYF A;  1P4W A;  3K1P A;  4L18 B;  2ADU A;  2XUB A;  4GCV A;  2W25 A;  4IHS A;  2V1X A;  4IXA A;  2IRF G;  5L3C A;  2CG4 A;  5A2Q K;  4IVN A;  4MTD A;  1S7A A;  4CZZ A;  4RB3 C;  4M9X A;  5A2Q Z;  4ZYH A;  3GUD A;  2PI0 A;  1IAW A;  3NEU A;  1YW9 A;  4RGR A;  4RS8 A;  4WWC A;  3V4G A;  3TOA A;  1OYI A;  3GFL A;  5D6E A;  2PEX A;  3K1M A;  1F9N A;  5FD6 A;  4L9T A;  4U88 A;  5BPD A;  2NNY A;  5JR3 A;  4F7Z A;  1P6R A;  4EJO A;  4Q48 A;  2HEO A;  2FEZ A;  4BXU A;  3BPV A;  1BJA A;  4HQE A;  1USS A;  1YIO A;  2ZNZ A;  2B0L A;  1IN6 A;  1T38 A;  1ONV A;  2HQN A;  4CGZ A;  2ETH A;  4BH9 A;  5H6Q A;  3SFZ A;  2DK5 A;  2QBY A;  1KU7 A;  3CTA A;  5E20 A;  5L3D A;  2ZME B;  2IA2 A;  4A6E A;  1QNT A;  3KP2 A;  1RNL A;  1OYY A;  4EM0 B;  1FYM A;  2EFP A;  4P9U A;  5ERI A;  2A5Y B;  4G94 A;  1ZGJ A;  2QZ8 A;  2C6Y A;  1FPQ A;  2XKP A;  5LBQ A;  2M45 A;  5D5U B;  2OD5 A;  2VXZ A;  1D5V A;  4CYD A;  4EGY A;  1E17 A;  1B59 A;  2F5F A;  5TJJ A;  2GAU A;  1H9G A;  3E6B A;  3MAJ A;  3FMS A;  1WWX A;  2GIV A;  3F6V A;  1A04 A;  5LHH A;  3JAM Z;  2FNA A;  5EEG A;  1ULY A;  3HHH A;  2OQG A;  3H3Z A;  2ZCW A;  1W5S A;  3GFJ A;  2O03 A;  5FO5 A;  4HV6 A;  4GGG A;  4HDU A;  2VBX A;  1XCV A;  1G6N A;  4O5V A;  5D5W B;  4I2O A;  4LB6 B;  5DUK A;  2G7H A;  2A69 F;  2LF8 A;  2P7C B;  4HF0 A;  1MD0 A;  1ZYR F;  2BBY A;  4EQQ A;  4EJT A;  1O3T A;  2FOK A;  3RDI A;  3IWF A;  2RNJ A;  4OIQ F;  2MD5 A;  3M1E A;  4I7H A;  3GEZ A;  4YII A;  1LVA A;  2IPQ X;  5IT3 A;  3LQR A;  5HS9 A;  2P6S A;  3GX4 X;  4HLY A;  3EUH A;  2EJR A;  5LGN A;  2X0L A;  5HOO A;  2VOP A;  3FZV A;  1H0M A;  3D5L A;  4DNC A;  3CO6 C;  3RTR A;  3RYP A;  4U0Y A;  4HYE A;  3VOE A;  5ICF A;  1TQP A;  1S8N A;  3F23 A;  5DDG A;  4RGU A;  5AIP A;  1ZG5 A;  2BV6 A;  2L4A A;  3HRT A;  3F8N A;  3O2P E;  1ZN2 A;  2H09 A;  2NNN A;  3ERE D;  1R1T A;  1EH6 A;  1XD7 A;  5F6F A;  1XGN A;  1O3R A;  2RQP A;  4CO8 A;  1PDN C;  2EV5 A;  1MJA A;  4OIO F;  5BMZ A;  5IT9 Z;  1JXS A;  4CDG A;  3GFI A;  1ZRC A;  3Q9S A;  4U7D A;  5CYV A;  5HDN A;  4PDK A;  1BI3 A;  4LK1 F;  4FX4 A;  3LA3 A;  1R5H A;  1P2F A;  3ZMU A;  4LMY A;  2BEO A;  2IJL A;  3IKT A;  5CVI A;  2IVM A;  2OQR A;  4XSX F;  3GZ5 A;  5CVU A;  3CO7 C;  2LF7 A;  1IUY A;  5LGT A;  3KZZ A;  4I01 A;  1VTN C;  2L54 A;  2JTV A;  4KYW A;  1O7F A;  3NRV A;  3HYI A;  2DBB A;  3C3W A;  1ODD A;  2IW5 A;  2QQB A;  2XAJ A;  3RIR A;  5FFZ A;  2CWE A;  2XHK A;  2W24 A;  3SXY A;  4QLC U;  4HA8 A;  2XAF A;  4HZF A;  1V3F A;  2JT1 A;  5LLQ A;  4EGZ A;  1IN4 A;  3F8B A;  5ILV A;  1KYW A;  1GXP A;  2K27 A;  1BI0 A;  4OIR F;  4EM2 A;  5H20 A;  1OPC A;  2Z5U A;  2NRA C;  5HS7 A;  4BHB A;  2FBH A;  3WOD F;  3G73 A;  4RB0 A;  2ACJ A;  4OOI A;  2HTS A;  3OOP A;  3EYI A;  1KU3 A;  3Q9V A;  5BPI A;  3L7W A;  3GXO A;  2V79 A;  4RGS A;  3FM3 A;  4ASN A;  2FBK A;  1IZ1 A;  3GYH X;  4WXH A;  4ZZD A;  2WC2 A;  2VT3 A;  2LDU A;  5LRR A;  1GVJ A;  2FNP A;  3GVA A;  2LKP A;  2MH2 A;  3KFW X;  5D8K B;  4PZJ A;  2A6H F;  5D6F A;  4KIB A;  2O8X A;  3EYY A;  3TDZ C;  5E1X A;  3FF5 A;  2QQA A;  3BOQ A;  2YPR A;  2FSW A;  1G3Y A;  3RKY A;  2FMY A;  4PGH A;  4KMU X;  3MWM A;  4A12 A;  5ILS A;  2OZ6 A;  2D45 A;  4HF1 A;  1I6X A;  2M5W A;  4Z2Y A;  2DI3 A;  1ON1 A;  1U8R A;  1QZY A;  4AD9 A;  1HW1 A;  1TLH B;  2ZJ2 A;  1REP C;  3F8C A;  1U5T C;  2O6G E;  3HUG A;  1BC8 C;  1XGS A;  1JGS A;  3B02 A;  1HW2 A;  2DLL A;  3FWE A;  5FGM A;  1SMT A;  2BGC A;  2K02 A;  4R1H A;  1XN7 A;  2MBF A;  1W5T A;  4WX9 A;  1IXC A;  2F2E A;  1B6A A;  2EA2 A;  2XKO A;  2CFX A;  5L3G A;  1QO0 D;  3DP7 A;  4MHG A;  1IN5 A;  1BIA A;  5E18 F;  4MEY F;  3V8J A;  4ESF A;  2WWY A;  2FBI A;  1LDD A;  3E6M A;  1HSJ A;  2O0Y A;  2HS5 A;  2MC3 A;  2EV0 A;  3LA7 A;  3ZMD A;  4O6J A;  3VEP A;  4HV5 A;  3RKX A;  5LRS A;  4BNC A;  1P4A A;  4UHT A;  3K0L A;  1SD4 A;  1Z9C A;  1G3W A;  5TRD A;  1WRJ A;  5BS6 A;  3HTU A;  1CF7 B;  2QWW A;  4EJV A;  1MZB A;  1YFH A;  2M8E A;  1HQC A;  3EDP A;  5F64 A;  2KJC A;  2P5L C;  4G7O F;  3ZMT A;  2YX4 A;  2V1D A;  4LK0 F;  2FML A;  4LG0 B;  3E3V A;  4GYG A;  4FX0 A;  3CUQ A;  1S29 A;  4JBA A;  3EET A;  2NS0 A;  1TNT A;  1SMY F;  2O3F A;  3KP7 A;  4E70 A;  1L0O C;  1U5T B;  1OYW A;  4MQV A;  3RJP A;  2E1N A;  4AIH A;  3WTS C;  1J75 A;  3ULQ B;  1BC7 C;  4A0X A;  2DQR A;  1FSH A;  3W6J B;  2VE9 A;  3ECH A;  3CLO A;  2VT2 A;  1CF7 A;  4N0B A;  2XAQ A;  2QUF A;  1IN7 A;  3KLO A;  1MKM A;  2Z3Y A;  2ZBK A;  2HKO A;  3N97 A;  1LQ1 A;  1LEB A;  3LWF A;  3MZY A;  2VBW A;  2MLK A;  4KIG A;  3WTX C;  3O3K A;  2JSC A;  3U9G A;  3SZP A;  4WXC A;  4FT8 A;  5L3F A;  2H27 A;  4EJW A;  2PN6 A;  5CVV A;  4I98 B;  1SAX A;  1LNW A;  2HYG D;  3I64 A;  3ZMZ A;  3MZH A;  1MDM A;  4IPA A;  2ZXJ A;  4RB2 C;  1UB9 A;  2A61 A;  2DW4 A;  2M30 A;  3MFK A;  4KIF A;  3GO5 A;  3GZ6 A;  3F8M A;  3CUQ B;  4EMS A;  4A5N A;  2P8T A;  3R6S A;  1UFM A;  2VBZ A;  3GWZ A;  4OIN F;  4AWX B;  4RAZ A;  3HTS B;  3E5U A;  1LEA A;  4M9S A;  1LJ9 A;  1R5G A;  2W84 A;  2HZT A;  3I4P A;  4N9H A;  3QP5 A;  3VFZ A;  4Y13 A;  1KU2 A;  4M72 A;  1O7L A;  2ESH A;  2ISZ A;  3I0T A;  2VE8 A;  5CJ9 A;  3FHZ A;  2KIU A;  4ETS A;  4KNY A;  4AIK A;  1K78 B;  3JW4 A;  3QOP A;  3TO6 A;  2GZW A;  1FOK A;  4DQ2 A;  2HGC A;  3GW2 A;  2D2W A;  4KT5 C;  2BYV E;  2XAH A;  2IT0 A;  1U78 A;  1PP7 U;  3E6C C;  3BJO A;  1R1U A;  1WSU A;  3ABT A;  1HBX G;  2K7L A;  4UXN A;  1FX7 A;  2D1V A;  2H6B A;  2PBI A;  1W7P B;  1R22 A;  2ISY A;  1T39 A;  3WG9 A;  3I59 A;  4RGX A;  5JFR A;  1BBY A;  4FHT A;  2RDP A;  3JSP A;  1FBS A;  1T0F A;  4P9F A;  2EB7 A;  2M87 A;  4YFN F;  2QLZ A;  5D8L B;  3SQN A;  2PLY A;  1RIO H;  5AON A;  2V6C A;  3F72 A;  1IF1 A;  1TW2 A;  1HKQ A;  1NHA A;  3AAF A;  2RC4 A;  3M9A A;  2QBY B;  4Q5S F;  4HX4 A;  1CGP A;  1XDU A;  2XGX A;  2VN2 A;  1IXS B;  2COM A;  2MH9 A;  2WV0 A;  5ILU A;  2W85 A;  5E1W A;  2DFI A;  3LAJ A;  4Y17 A;  5D4R A;  3HRS A;  2L4M A;  1K78 A;  1HKT A;  4OU0 A;  3TOB A;  1BN5 A;  2KIF A;  1W7P D;  2IA1 A;  1SFX A;  4EJU A;  2ZFW A;  4UUV A;  2ZKZ A;  2JPC A;  1U3E M;  4BHP A;  1OMI A;  1TQI A;  4HX7 A;  1FNN A;  1ZH5 A;  2EA4 A;  1W7P A;  4L0Z B;  3R0A A;  2X4H A;  3TO7 A;  1FYL A;  3IHU A;  1WKM A;  1ZAR A;  3BDD A;  1D8K A;  4U7B A;  2KIM A;  2PFB A;  2Q8K A;  1QPM A;  5BOX A;  2L3D A;  3B73 A;  5CLS A;  1XSD A;  2NAZ A;  4A0Z A;  3W6K B;  2K4J A;  3RPQ A;  4O3M A;  2DO7 A;  3KEQ A;  1C0W A;  3QU3 A;  1HKS A;  1BIB A;  1O3S A;  4BHC A;  2O61 A;  3J80 Z;  4A6D A;  5LEJ A;  5ICE A;  3I58 A;  1BI1 A;  3PQJ A;  1J7K A;  1Z6R A;  1MJ9 A;  2EV6 A;  3GF2 A;  3I59 B;  2Z99 A;  2STW A;  2P5K A;  2ZNY A;  4M6Y A;  3T0Y A;  2L01 A;  2UXN A;  1B9M A;  1XGO A;  3K2Z A;  3BPX A;  1J9I A;  3WU0 A;  3BY6 A;  3C7J A;  1IW7 F;  4HBL A;  4XRF A;  1R7J A;  2RKH A;  2J5P A;  2Z33 A;  1TTY A;  2QQ9 A;  2FA5 A;  4LLG F;  4IF4 A;  1PP8 F;  4EV0 A;  2CO5 A;  4ENM A;  4NB5 A;  1ON2 A;  5E17 F;  3HRM A;  4XLN F;  1QGP A;  3RI4 A;  4G8X A;  1DDN A;  1TW3 A;  3ZQ7 A;  2F5C A;  2DT5 A;  4Q4Z F;  2E1C A;  4M74 A;  2HR3 A;  5K5Q A;  4H0E A;  4MEX F;  2UWM A;  1BM9 A;  3G3Z A;  1YW7 A;  4M6X A;  4LD5 A;  3LA2 A;  3WGI A;  5L3B A;  1AWC A;  3LAP A;  3IRQ A;  3ZMV A;  5DCF A;  1U2W A;  5D5V B;  1B4A A;  5K1Y A;  3DKW A;  3J81 Z;  1STZ A;  2BE5 F;  1YG2 A;  2P6T A;  1DUX C;  4OMZ A;  1ZRF A;  2RN7 A;  3BJA A;  4KFC A;  3WTV C;  2R7D A;  1I1G A;  3QRF F;  3FMR A;  3P9K A;  3FXU A;  1ZG3 A;  3F6O A;  4N9I A;  3KP6 A;  5L3E A;  5FB2 A;  1U5T A;  5K5R A;  1S6L A;  4EVI A;  4M9Z A;  2DAO A;  5LEK A;  2YX7 A;  3TQN A;  1UHM A;  4LFU A;  2EFW A;  5KVR A;  4LLN A;  1JE8 A;  4P5O A;  1XSV A;  3DXJ F;  5LGU A;  1Z6T A;  2XRO A;  2A07 F;  3FXQ A;  3F8F A;  3NQO A;  4ZYE A;  5BQT A;  3BP8 A;  2ZME A;  2XAG A;  2J5O A;  2Y48 A;  4ZYG A;  2H6C A;  3RPU A;  3COA C;  3CUQ C;  4RAY A;  3L00 A;  2IP2 A;  3K9T A;  5HLI A;  1YW8 A;  3R61 A;  3TO9 A;  3N4M A;  1P4X A;  1KQ8 A;  3WU1 B;  3DV8 A;  3V8L A;  2FF4 A;  5K5O A;  1B1B A;  1FP1 D;  2M1B A;  1EH7 A;  2GQQ A;  2R7F A;  1O57 A;  3T8T A;  1Q1H A;  4R79 A;  3BWG A;  3H3U A;  4BQA A;  1I27 A;  1ZLJ A;  1J5Y A;  2VON A;  1KQ0 A;  2Z9O A;  3KP5 A;  1IRF A;  3L09 A;  2GWR A;  4A5M A;  1KGS A;  5E8I A;  4ZH4 F;  3V7C A;  2UZK A;  1TQM A;  1QBJ A;  2K86 A;  3WGG A;  1RUO A;  3QP6 A;  4WXD A;  1LB2 A;  2YR2 A;  3F3X A;  3FM5 A;  1Z91 A;  4R8H A;  3Q5F A;  1TNS A;  4M73 A;  4IRI A;  3V8K A;  5AIQ A;  1IXR C;  2OZU A;  3J7A O;  4LLL A;  3DQV C;  4ZYD A;  1MDM B;  1SD5 A;  4WK8 F;  4EM1 A;  2HFH A;  3VOD A;  5LHG A;  3FMQ A;  2PMU A;  2HKX A;  4UVB A;  3QPH A;  4HDV A;  5CVJ A;  2ELH A;  2KJB A;  3TDU C;  4G7H F;  3C18 A;  4L9J A;  3R4K A;  1MGT A;  3L9F A;  2OA4 A;  2Y0M A;  3PQK A;  3IL2 A;  3HIF A;  2CW0 F;  4MTE A;  3V7S A;  1YTY A;  2V1U A;  3JTG A;  3ZP5 A;  3ABU A;  1FZP B;  1K7A A;  3QU6 A;  2IA0 A;  1ZAO A;  1XGM A;  4MNU A;  2UXX A;  4I0A A;  1P92 A;  2CGP A;  3LFK A;  2DK8 A;  3KLN A;  3SHF A;  4UV9 A;  2PJP A;  4IRH A;  1KYZ A;  3KET A;  5DV5 A;  4NHJ A;  3HOT A;  3TGN A;  2MA3 A;  4I02 A;  1W4M A;  6PAX A;  4L0Y B;  2FRH A;  1FC3 A;  2Q0O A;  5HDK A;  5KK1 A;  3ISP A;  3J81 K;  4IHT A; 
#chains in the Genus database with same CATH topology
 1ZK8 A;  1YHQ I;  1VQ5 I;  2PG4 A;  2ESN A;  4U87 A;  4F91 B;  2BZT A;  5DS9 A;  1B9N A;  3ERM A;  1IRG A;  4IRG A;  2UUZ A;  2KRH A;  2ZC2 A;  2M0M A;  5EZH A;  2FQ3 A;  1DGR M;  4MQ9 F;  5M5X J;  1FP2 A;  2DPD A;  2ECC A;  1SAN A;  1G4D A;  2VBY A;  4HQM A;  3QPT A;  3BG7 A;  2QVO A;  4M3E A;  1FBQ A;  1UMQ A;  3ZQC A;  4UVA A;  3P7N A;  1Y0U A;  2PJR A;  3DBH B;  1HCR A;  1AU7 A;  1X19 A;  4XR6 A;  1A6I A;  5ICG A;  3OIQ A;  3C1D A;  2QM3 A;  3S2W A;  4ENN A;  2H8R A;  4RB1 A;  3DEU A;  3FXR A;  1RI7 A;  4K2E A;  1FSE A;  2FQ4 A;  2HVQ A;  5F1R A;  2A6E F;  3ROU A;  2VQL A;  5DD8 A;  1MMG A;  1V5F A;  3JRH A;  3HOS A;  1MBG A;  3HSE A;  2LKS A;  4WF2 A;  2F4O B;  4I09 A;  3BRO A;  3DU6 A;  3OWT A;  4OAY A;  3FXM A;  5HLH A;  4JYK A;  3GTK J;  3FXK A;  4XRM A;  5D5X B;  1UAA A;  2DQL A;  1SD7 A;  5FLX K;  1FBU A;  4NQW B;  4HG2 A;  3ECO A;  3KZI C;  3BTC A;  3ZN0 A;  1OCT C;  3QAH A;  2ZO4 A;  3KP3 A;  4RAF A;  2JMW A;  2HOE A;  1V5G A;  1FLI A;  3K4N A;  4PSW A;  3L2R A;  3CLQ A;  4KA4 A;  2E2I J;  4RBO A;  1YI2 I;  2VJ5 A;  4KN7 X;  3CCS I;  3KYC B;  5DD4 A;  1XCB A;  1U6G A;  3BR3 A;  2KPM A;  2O8K A;  2FXA A;  3DPT A;  3H9J A;  2AQF A;  2P4W A;  3IWZ A;  1QZZ A;  2DDA A;  2M0C A;  3QYF A;  2XAU A;  3ABL H;  5HDG A;  4J01 A;  1OLT A;  1VQ8 I;  3WGH A;  4GXO A;  2R3S A;  5ICC A;  1D0Y A;  2QYO A;  1SFE A;  3R0J A;  5FLV A;  4WCG A;  1X1P A;  1ZG1 A;  3HRU A;  2YSR A;  4N4O B;  4XM3 A;  1D3Y A;  4ENK A;  2CQK A;  1RUN A;  3S16 J;  1H88 C;  1U0J A;  2DPU A;  2V4J C;  5FD5 A;  2JRT A;  3F22 A;  1L3L A;  3CD6 I;  2XSJ C;  2KLO A;  3M8F A;  4TV7 A;  5E8G A;  3L2V A;  4HNV A;  4AM3 A;  3RKW A;  3ABK H;  2VOO A;  4NC8 A;  4ZDL A;  4A3G J;  3FIS A;  4C3H J;  1N75 A;  3VB2 A;  3AG4 H;  2LG4 A;  3DPL C;  1IRX A;  4UVC A;  4EAT A;  5CVR A;  3J7Y J;  1MSF C;  5J6X A;  2EFO A;  1YLF A;  3J80 K;  1YS7 A;  4OIP F;  2KRF A;  4L9V A;  5JVG F;  2NVQ J;  3L2C A;  3KYD B;  2A6T A;  4BAY A;  4E7L A;  2CSO A;  4G7Z F;  4B8X A;  2FJ1 A;  3OV8 A;  3E6D A;  5FKN A;  5GAE J;  2PJR B;  3GTO J;  1JKP C;  4B1R A;  1A6Q A;  2EFN A;  3H36 A;  2CYY A;  1K4T A;  4UNO A;  1VQ6 I;  1ETW A;  3LL7 A;  3BJ6 A;  1ZRD A;  2ZJQ F;  2HDC A;  3CDH A;  2JPB A;  4UV8 A;  2OTL I;  4CHU A;  2E36 A;  4S05 A;  1WI9 A;  4CCN A;  5FLX Z;  3CF5 F;  3WTT C;  1NG6 A;  2EBI A;  5J8F A;  3FIW A;  1D0Z A;  4P55 A;  3D0S A;  4HLX A;  2GXG A;  5E3O A;  1I3A A;  4JK1 X;  4XLH A;  3KEY A;  4RLQ A;  3ZPL A;  5LHI A;  1Y8R B;  1Z0X A;  1T98 A;  5M3M J;  3P5J A;  4XL9 A;  1T6S A;  3JTH A;  4KIC A;  4PFP A;  3PFI A;  1KA8 A;  2HWV A;  3BR2 A;  4JQF A;  2IS4 A;  2RV8 A;  1RC9 A;  1VQ9 I;  2HTJ A;  1JGG A;  1OKR A;  1GV2 A;  1MJB A;  1VND A;  4PGG A;  4G6D A;  5F0H A;  2EFQ A;  1BOA A;  3H5R A;  2OU2 A;  5EEH A;  3LSH A;  2P7V B;  3MEX A;  4ZYA A;  1WVR A;  4GYI A;  3V7R A;  2NOJ B;  1B72 A;  2DA1 A;  3QYE A;  3S14 J;  3JRA A;  1UCR A;  1GUU A;  1LFU P;  1MIJ A;  1BI2 A;  3AFH A;  2G9W A;  2NS8 A;  4L5I A;  1KU9 A;  5DCM A;  4KDP A;  2PMH A;  3ZN1 A;  3K69 A;  2E34 A;  1ZGA A;  4HX8 A;  1J0R A;  3EUK L;  2L0K A;  1HXD A;  1QQI A;  4MO7 A;  3LST A;  3KEO A;  3O6B B;  1YE9 A;  1V55 H;  2E19 A;  3IH2 A;  3HC7 A;  1CQT A;  1WHU A;  1MW7 A;  1ERD A;  3R60 A;  1R23 A;  2KHM A;  3H92 A;  4UUS B;  3WTY C;  4OMY A;  2VQC A;  4BAC A;  2PQ8 A;  1TL8 A;  1TC3 C;  1TZL A;  2VQH A;  4YFX F;  2HXO A;  1ZRE A;  2GXB A;  3SFI A;  3HDD A;  5E1Z B;  2LBF A;  1J59 A;  3TKY A;  2HOS A;  1ITY A;  3U1D A;  3EQL F;  5IT9 K;  2K3F A;  1R00 A;  2CUJ A;  2OBP A;  2GLO A;  3A03 A;  3NAU A;  1Z1D A;  4XKW A;  1FYK A;  2HOT A;  1T2K A;  1XMA A;  4HST A;  4BYY A;  4CIC A;  2IEK A;  4JX5 A;  1X4P A;  5DEQ A;  1POG A;  3P9C A;  4LB5 A;  3T5X A;  4M71 A;  3FX3 A;  4JP0 A;  4S04 A;  2CU7 A;  2VUM J;  5C44 J;  2AO9 A;  3RYR A;  5B66 C;  5HVQ C;  3I5U A;  5DUI A;  3BG3 A;  1UHW A;  5DCM B;  2EQR A;  1HF0 A;  4ZZL A;  5FRN A;  2DXI A;  1K6O A;  2HDD A;  3GFM A;  4AUX A;  4BL0 B;  2CFO A;  2XGD A;  1A31 A;  2XRN A;  3P9I A;  4U0V A;  2JQ7 A;  2K5C A;  2F4M B;  2VOD A;  1XMX A;  2HQA A;  1MMS A;  2Y69 H;  2DU9 A;  2VB6 A;  4KMF A;  3HSR A;  2FU4 A;  3E5X A;  5FFX A;  1VQ7 I;  2HVS A;  1MND A;  2VJJ A;  3O8G A;  2WTE A;  4XRS G;  1FT9 A;  4G9Y A;  5J47 A;  1O3Q A;  3M1C A;  3I71 A;  1UST A;  1WJA A;  2HDW A;  2OJE D;  4D0P A;  2XIG A;  3QOD A;  1LDJ A;  1MNM C;  2TRT A;  2R92 J;  2KL4 A;  2AXL A;  4XSZ F;  1YYV A;  3HHG A;  3HKZ A;  2D1H A;  2W57 A;  2DT7 B;  4XKV A;  1P7J A;  1ACI A;  1S3J A;  1YS6 A;  4NC6 A;  3RQI A;  1F4K A;  4ESB A;  2XVC A;  1ZHF A;  5K7H A;  2DTR A;  2DMP A;  2F5D A;  4Y33 A;  5GTH C;  1J2X A;  2LK2 A;  5EJC A;  1DPR A;  1R9T J;  3REO A;  2YU3 A;  2MAB A;  3JSO A;  4LGW A;  3WE2 A;  2MGQ A;  2E2H J;  1LDK B;  4AID A;  3CC4 I;  1FY7 A;  1APL C;  3DFG A;  1SFU A;  4HF2 A;  1IRZ A;  5ED4 A;  2GA1 A;  4Q47 A;  3KCC A;  2F5E A;  3ELK A;  3PNV A;  3ZMS A;  1RZ4 A;  2A3S A;  3CJR B;  1VQK I;  2G7U A;  4G12 A;  1KQ9 A;  4ON0 A;  4AVZ A;  2GOX B;  1XB4 A;  2DCE A;  3E5Q A;  2HQR A;  3LQQ A;  1AOY A;  2GM4 A;  2Y9Y A;  4ENJ A;  2OAZ A;  4XLP F;  3MMY B;  3M8E A;  2Q1Z B;  5KAF C;  2NOG A;  4IEJ A;  3CUO A;  3K4L A;  4F3Q A;  3WG7 H;  1HST A;  2XGE A;  3TBI A;  3J7Z I;  1D8J A;  3U2R A;  2CUE A;  2ELK A;  4I0B A;  4B3X A;  5K7F A;  2BW3 B;  2TDX A;  4KJZ A;  5JVT A;  3IRR A;  2EIM H;  3OYI A;  3A01 B;  2VC1 A;  1DPU A;  1Z7U A;  1LKX A;  1F1Z A;  4J00 A;  4LIT A;  4KT6 A;  2AS5 F;  3N05 A;  2XSD C;  4DOZ A;  4HAM A;  1Z67 A;  3CCE I;  5DYM A;  1JHH A;  1S7O A;  3HOW J;  1TBX A;  4AYB N;  2EZH A;  5EF6 A;  3SDG A;  1MBH A;  5IYB J;  2DOE A;  2HOA A;  2H94 A;  4H4K C;  4RA2 A;  2OCE A;  4ESJ A;  2LR8 A;  1X1C A;  2RVC A;  1FIP A;  3I53 A;  4HSR A;  1G3S A;  1V4R A;  2FUG 2;  1E3O C;  5IP6 A;  3E97 A;  4BXF A;  1SFO J;  4A2U A;  4PCQ A;  1XDS A;  1ZLK A;  4NUB A;  4E6K G;  3SZT A;  2XB0 X;  1XG1 A;  2Y0S N;  2L02 A;  5JI6 A;  3HEF A;  4LIU A;  1XTA A;  3KX2 A;  2XAS A;  3HSF A;  4P1W A;  1Y6I A;  4RLF A;  1FTT A;  3K70 D;  2LSO A;  5J8C A;  3F21 A;  3IKV A;  4CYC A;  1H9T A;  2R5Z B;  3T8R A;  3LSK A;  4HPQ A;  3I54 A;  4BE2 A;  1X3U A;  2AXT C;  2DJN A;  1HDP A;  1WJC A;  1FWZ A;  2K40 A;  2XV4 S;  2X6X A;  4NNJ A;  3OYG A;  3CMM A;  4GO1 A;  4DBR A;  2ME6 A;  1Y1V J;  2CH0 A;  4YG2 F;  2M34 A;  4XBF A;  4HW0 A;  1R36 A;  4XIC A;  4KN4 X;  4LJZ F;  3CP2 A;  4CCM A;  4IJA A;  4IHW A;  2VJI A;  2EK5 A;  2A68 F;  1WQ2 A;  1R58 A;  4MGR A;  1EH8 A;  5IPA A;  1IV6 A;  2X6Y A;  3KP4 A;  3L2U A;  1F5T A;  1T95 A;  3CJN A;  1IN8 A;  1SFK A;  5J1Y A;  3ESW B;  4B09 A;  2EIL H;  1HW5 A;  3GLX A;  3K6G A;  1K79 A;  4KUM A;  5H6R A;  3BG9 A;  4FQG A;  3S2D J;  3WTZ A;  1M1E B;  3VPR A;  1UG0 A;  2K4B A;  4AIJ A;  1E0E A;  1E2X A;  4NQW A;  3PUB A;  2E7X A;  1XX5 A;  3KE2 A;  3BQZ A;  4A3M J;  2ID3 A;  1MBF A;  1H89 C;  2QEN A;  3ML6 A;  4L9N A;  2BVM A;  4BDZ A;  2RGV A;  3WE3 A;  1G3T A;  3M7G A;  1U9O A;  3JAM K;  3MN2 A;  5HLG A;  3ZQH A;  5D4S A;  2NVX J;  2NYX A;  3NWS A;  4YFK F;  5HS8 A;  1EV7 A;  2VC0 A;  3IC7 A;  2FE3 A;  1XMK A;  3SDB A;  1R1V A;  1GHC A;  2RRE A;  3RSN A;  1YO5 C;  5CQE A;  1OCZ H;  4LG0 A;  3ABM H;  2MLG A;  3MZ8 A;  3G1M A;  3LSP A;  1JHF A;  4A0Y A;  4PJ0 C;  4QWQ A;  3TMO A;  3PUF A;  4Z6Y A;  3WTU C;  2RNG A;  1DP7 P;  1XSX A;  5JHU A;  2EH3 A;  3DTE A;  1Z05 A;  3A4C A;  4HOB A;  2ZSI B;  3HOX J;  1TT0 A;  2JZY A;  2WAD A;  3BCB A;  4AVP A;  1I1S A;  4CCO A;  1RR7 A;  1VF9 A;  2LNB A;  1SD6 A;  2V9V A;  5EZG A;  2JA7 J;  2QF7 A;  3T1B A;  2V7F A;  2X6W A;  3OYA A;  2JA2 A;  1GXQ A;  2L7Z A;  5FKK A;  3WHC A;  3WTW C;  4CXF A;  2P5V A;  3HUG B;  1I5Z A;  4Y15 A;  5EYR A;  1I3Q J;  1K6Y A;  1TWG J;  2Q2E A;  1JKR C;  1QVU A;  2EWN A;  2Y75 A;  2HPM A;  5C4X J;  3JRD A;  1YQA A;  3MCZ A;  4C3I J;  1OR7 A;  4E7S A;  4P96 A;  4U0W A;  4BUP A;  4BE1 A;  3MQ0 A;  4IOA F;  4L5J A;  3H1C A;  1X2N A;  3MKL A;  3S1M J;  2KKO A;  3K1N A;  3DF8 A;  4YIF A;  3K4K A;  1PUE E;  2DOD A;  1X2M A;  4QIW N;  4RM2 A;  3G6E I;  2BW3 A;  3KZY A;  2E7W A;  4FIS A;  3BZ6 A;  2GBY A;  3SJM A;  4G6Q A;  2OPT A;  2STT A;  2GA2 A;  2HYF A;  1P4W A;  3K1P A;  1ZEL A;  4L18 B;  2ADU A;  2XUB A;  4GCV A;  2W25 A;  5FLM J;  4IHS A;  2V1X A;  4IXA A;  1WGX A;  2IRF G;  5KNL A;  2IGO A;  4IX7 A;  4XMY A;  5L3C A;  3G1O A;  1PYV A;  3VYU B;  4BQN A;  2CG4 A;  5A2Q K;  5C3E J;  4IVN A;  4MTD A;  2DOF A;  1F43 A;  3MKZ A;  1S7A A;  4CZZ A;  4RB3 C;  2LD5 A;  1SC7 A;  4QTR A;  1PUF A;  4M9X A;  5A2Q Z;  1TT5 B;  1ETX A;  4ZYH A;  2DFF A;  3GUD A;  4BBR J;  2PI0 A;  1IAW A;  3NEU A;  1YW9 A;  4XID A;  4RGR A;  4RS8 A;  3C2G A;  3V4G A;  4WWC A;  3TOA A;  5IP9 J;  4IOC F;  2LRE A;  4XKC A;  1S72 I;  3ASO H;  4X1E A;  3A2K A;  1OYI A;  3GFL A;  5D6E A;  3LSR A;  2PEX A;  1YX5 A;  5KAI C;  2VAS A;  2QSG X;  1MBE A;  4HNT A;  3K1M A;  3NWT A;  3DKX A;  1F9N A;  3G1L A;  5FD6 A;  2PMZ A;  4XK4 A;  2JK3 A;  4L9T A;  3C2H A;  4F92 B;  1LUJ B;  5B5E C;  1V54 H;  2CQQ A;  3LSM A;  4U88 A;  5BPD A;  3J7A Y;  2NNY A;  2XRL A;  4Y7N J;  5JR3 A;  2QKM B;  2LY2 A;  4F7Z A;  1P6R A;  2W7N A;  3CCV I;  2WB1 N;  3DLA A;  4EJO A;  2BY0 A;  4Q48 A;  2HEO A;  3D5R C;  2FEZ A;  2IGM A;  4BXU A;  2R0Q C;  3BPV A;  5F1J A;  1BJA A;  4HQE A;  1USS A;  1YIO A;  3K4M A;  2ZNZ A;  4OAZ A;  2B0L A;  2PMZ N;  1IN6 A;  1T38 A;  1WPK A;  1ONV A;  2HQN A;  2ELJ A;  2QSH X;  4CGZ A;  2ETH A;  4BH9 A;  2NS7 A;  4A3I J;  5H6Q A;  3ASN H;  4XLA A;  3SFZ A;  2DK5 A;  3K2A A;  2KMU A;  2WB1 A;  2QBY A;  2EZI A;  3ZQI A;  1WJD A;  1KU7 A;  2P81 A;  3CTA A;  4N4N B;  5E20 A;  5L3D A;  2ZME B;  3BTI A;  1OQY A;  2IA2 A;  3I4N J;  4A6E A;  1QNT A;  3KP2 A;  4M3F A;  1RNL A;  1OYY A;  4IQ4 A;  4ZC3 A;  4EM0 B;  1FYM A;  2JUC A;  3TL4 X;  2EFP A;  4C9Y A;  2Z1D A;  4P9U A;  1Y1W J;  5ERI A;  3ZQQ A;  2VLA A;  2IBD A;  4I99 C;  2A5Y B;  4G94 A;  2B63 J;  2MD0 A;  1ZGJ A;  1YX3 A;  2QZ8 A;  3OY9 A;  2C6Y A;  2R93 J;  1FPQ A;  2XKP A;  5LBQ A;  2M45 A;  2MC4 A;  2OD5 A;  2G0E A;  2VXZ A;  2A5W A;  5D5U B;  5EDN A;  1VFC A;  1D5V A;  2GXA A;  4CYD A;  3S2H J;  1FOY A;  4EGY A;  1E17 A;  4MLO A;  4D9J A;  1B59 A;  2F5F A;  5TJJ A;  2GAU A;  1H9G A;  3E6B A;  3MAJ A;  4BKX A;  2R4G A;  3FMS A;  1BOB A;  3DWL E;  1IJW C;  1QVT A;  1WWX A;  2GIV A;  1WJF A;  1T33 A;  2K3P A;  2KQR A;  3F6V A;  2Y2Z A;  1A04 A;  5LHH A;  3CME I;  1N25 A;  2E5Z A;  3JAM Z;  2FNA A;  2Y9Z A;  5EEG A;  4XLE A;  1IUF A;  1ULY A;  3HHH A;  2OQG A;  3H3Z A;  1RR8 C;  3L1P A;  2KZV A;  4D5F A;  5EG0 A;  2ZCW A;  3CCY A;  1W5S A;  3GFJ A;  3UR3 C;  2O03 A;  5FO5 A;  2W1O A;  4HV6 A;  4GGG A;  4HDU A;  4E7J A;  4BJ5 C;  3K4J A;  2IXS A;  2KRC A;  1TWC J;  2VBX A;  3A0B C;  4IKF A;  1XCV A;  3S1N J;  3MKY B;  1G6N A;  1D0X A;  4O5V A;  2DYS H;  5D5W B;  2DT6 A;  3BTL A;  2VI6 A;  4LB6 B;  4I2O A;  5DUK A;  2G7H A;  4B48 A;  4M3B A;  3PIO F;  2A69 F;  2LF8 A;  2P7C B;  1WH5 A;  4HF0 A;  1MD0 A;  1ZYR F;  2PX9 A;  2VJ4 A;  3CCJ I;  2BBY A;  4EQQ A;  3JRI A;  3S15 J;  4EJT A;  2LY9 A;  1QU3 A;  1O3T A;  2FOK A;  3RDI A;  3IWF A;  1D1B A;  2RNJ A;  5LFA A;  4OIQ F;  1Z21 A;  1S7E A;  3SZG A;  2MD5 A;  3M1E A;  4I7H A;  3GEZ A;  4YII A;  4I6Z A;  3S8P A;  1LVA A;  1O4X A;  2EZK A;  1MBJ A;  2IPQ X;  3D5S C;  5IT3 A;  2HPI A;  3LQR A;  1Y56 A;  3HGY A;  3LOC A;  5HS9 A;  3HM5 A;  4C3J J;  3I55 I;  2P6S A;  1E3H A;  3GX4 X;  4HLY A;  2BY1 A;  3EUH A;  2EJR A;  5LGN A;  2L9V A;  2X0L A;  5HOO A;  2WV1 A;  3CC2 I;  2VOP A;  3FZV A;  1H0M A;  3CES A;  2BHY A;  2DA6 A;  3FBN B;  3D5L A;  5IYD J;  2OF7 A;  5J40 A;  1RKW A;  3PM1 A;  4DNC A;  3CO6 C;  3RTR A;  3IAS 2;  4Y3O A;  3RYP A;  4A93 J;  2X51 A;  4U0Y A;  2DMT A;  4HYE A;  3VSL A;  3VOE A;  3IH4 A;  5ICF A;  1TQP A;  1S8N A;  3F23 A;  5DDG A;  2ID6 A;  4RGU A;  2DFE A;  5AIP A;  1ZG5 A;  3RZO J;  2BV6 A;  2L4A A;  3HRT A;  3JCU C;  4XN0 A;  3F8N A;  2QCO A;  3O2P E;  3HXL A;  2WAE A;  3BG6 A;  3I9V 2;  1ZN2 A;  2DYR H;  2M2E A;  1Z77 A;  3OYL A;  3GTQ J;  2H09 A;  2NNN A;  1R5I D;  4X0G A;  3ERE D;  4F93 B;  1R1T A;  2E2J J;  1EH6 A;  4X6A J;  3K7A J;  3VSK A;  1XD7 A;  4A69 C;  5F6F A;  4NBQ A;  1XGN A;  5FKO A;  1O3R A;  3OSG A;  5E3M A;  4FAS D;  1NK3 P;  1HLV A;  4F52 A;  1YRN A;  2HNH A;  3VWB A;  1T8I A;  1IGN A;  1HDD C;  2RQP A;  3Q0U A;  1KZH A;  1KON A;  1VI0 A;  5IY5 H;  3W3C A;  3IH3 A;  4CO8 A;  2WA0 A;  1PDN C;  2EV5 A;  1MJA A;  4OIO F;  5BMZ A;  5IT9 Z;  3CCL I;  2H1K A;  1S5L C;  4HEA 2;  1JXS A;  2RQQ A;  3IAM 2;  1EF4 A;  1MH3 A;  2QGU A;  4CDG A;  3GFI A;  1ZRC A;  3Q9S A;  5J4V A;  4U7D A;  3UNG C;  5CYV A;  3RPU D;  3FBI B;  3JRC A;  3DTI A;  5HDN A;  2XC7 A;  4PDK A;  5CPR B;  2RAE A;  5E3N A;  3HPH A;  1BI3 A;  1AHD P;  3K10 A;  4LK1 F;  4FX4 A;  2MYS A;  3HJE A;  1DQU A;  2X1C A;  3LA3 A;  1R5H A;  3WU2 C;  4FTH A;  1W36 C;  2CQ7 A;  1G2H A;  1T56 A;  3BR1 A;  4V19 K;  3I56 I;  1P2F A;  5J4Y A;  3ZMU A;  4LMY A;  1GV5 A;  4C30 A;  1GLN A;  2KDO A;  5FKM A;  2BEO A;  3LSI A;  3IV5 A;  2IJL A;  3OYE A;  3H5A A;  4IHV A;  1ZR2 A;  2JA8 J;  4XQF A;  3IKT A;  5CVI A;  1EA3 A;  2IVM A;  3HZJ A;  3MKW B;  2OQR A;  3GCM A;  2O7O A;  2MW8 A;  4XSX F;  3GZ5 A;  5CVU A;  3CO7 C;  2LF7 A;  1IUY A;  5LGT A;  3KZZ A;  4I01 A;  1WH7 A;  2VKD A;  1VTN C;  2BVL A;  2BOL A;  2L54 A;  2LBF B;  2JTV A;  4KYW A;  1O7F A;  2DJI A;  3GBG A;  2EIN H;  3NRV A;  2K9S A;  2QEX I;  1OCC H;  2BXZ A;  3HYI A;  2DBB A;  3C3W A;  1WI3 A;  2IS2 A;  3TP0 A;  4DW6 A;  1RES A;  2X1E A;  4KIT B;  1ODD A;  2IW5 A;  2QQB A;  2XAJ A;  3RIR A;  5FFZ A;  2E1O A;  2CWE A;  3PSI A;  2XHK A;  2W24 A;  3SXY A;  4II3 A;  2L2O A;  4QLC U;  4AC0 A;  4HA8 A;  2L9S A;  2XAF A;  4HZF A;  1V3F A;  2JT1 A;  3QQA A;  1T39 A;  2L5Q A;  5LLQ A;  4EGZ A;  1ZQ3 P;  1IN4 A;  3FHN A;  1X1B A;  3OIP A;  1JUP A;  1N77 A;  2Z2S B;  3F8B A;  1KYW A;  5ILV A;  2K27 A;  1GXP A;  1YIT I;  3BTJ A;  3K4C A;  2ICW G;  5KHD A;  4YRV A;  1BI0 A;  4JX4 A;  4OIR F;  3EUH C;  4EM2 A;  2CRG A;  5H20 A;  4CCL A;  1OPC A;  2LVS A;  1JUM A;  3ZQL A;  2X48 A;  2Z5U A;  2NRA C;  5HS7 A;  4BHB A;  2FOW A;  2FBH A;  4AU7 A;  3WOD F;  3G73 A;  4RB0 A;  2ACJ A;  1UZC A;  2ZSH B;  4PJM A;  2WAF A;  4E7H A;  5GAD J;  1IC8 A;  2HXI A;  1I50 J;  3FDY A;  2HTS A;  2Y0S A;  3OOP A;  4OOI A;  3EYI A;  1NK2 P;  3DEE A;  4BQO A;  3VYR B;  3DU5 A;  3H9G A;  2B9S A;  1JJ6 C;  2XPW A;  4XNF A;  1BW6 A;  1KU3 A;  5B1A H;  3Q9V A;  5BPI A;  3L7W A;  5M3F J;  2DMQ A;  3GXO A;  3A0H C;  2V79 A;  4RGS A;  3PNT A;  3FM3 A;  4ASN A;  2MSY A;  1RET A;  2FBK A;  5GTI C;  2L9R A;  1IZ1 A;  2R7R A;  3GYH X;  4WXH A;  3LNQ A;  1PVE A;  4ZZD A;  5EG0 B;  3W2A A;  2WC2 A;  2VT3 A;  1I39 A;  4L5E A;  1D5Y A;  2LDU A;  2KP6 A;  5LRR A;  1GVJ A;  2FNP A;  3GVA A;  1FMW A;  3FKJ A;  3PJR A;  2LKP A;  1P9Q C;  4PK4 A;  2MH2 A;  1DU6 A;  2M7A A;  3KFW X;  3O8H A;  4LOC A;  3AL0 C;  2V1N A;  4QPQ A;  5D8K B;  3BZC A;  1FOX A;  4PZJ A;  2A6H F;  2DA4 A;  5D6F A;  4NDL A;  4KIB A;  2DOA A;  2O8X A;  3EYY A;  5F27 A;  3TDZ C;  1MBK A;  4ZDP A;  5E1X A;  3FF5 A;  3OYF A;  2KIS A;  2WBM A;  2EIJ H;  4BGD A;  2QQA A;  3BOQ A;  1A5J A;  2GOM A;  5E79 C;  3OIO A;  4G6T B;  4YEJ A;  2YPR A;  4YIR X;  4V2G A;  4B44 A;  2FSW A;  2CMP A;  4E7Z A;  1G3Y A;  3RKY A;  2K9N A;  5K7Z A;  2FMY A;  3SYT A;  4PGH A;  2CJJ A;  4KMU X;  2NVT J;  3MWM A;  3QPS A;  4A12 A;  2HVR A;  5ILS A;  1IDZ A;  1ORK A;  2OZ6 A;  2W00 A;  5H2F C;  2D45 A;  4IHY A;  1I6X A;  4HF1 A;  2M5W A;  4GRI A;  2CQN A;  2QA4 I;  4Z2Y A;  3ONQ A;  2DI3 A;  1GDT A;  1ON1 A;  1U8R A;  1QZY A;  5IOZ A;  3M4O J;  4AD9 A;  2M3A A;  4Y52 J;  1HW1 A;  1TLH B;  1TWH J;  1IO2 A;  1OCR H;  2ZJ2 A;  4IZZ A;  2ZXI A;  4DYQ A;  1REP C;  2XF6 A;  3F8C A;  1U5T C;  3VDX A;  2O6G E;  4GFB A;  2NVY J;  2E1M B;  3ZR8 X;  3OYD A;  2HQ5 A;  3HUG A;  3W2V A;  2M8G X;  1XGS A;  4RDU A;  1BC8 C;  3WHB A;  1JGS A;  1LE8 A;  3B02 A;  1HW2 A;  1X1D A;  2DLL A;  3FWE A;  5FGM A;  1SMT A;  2BGC A;  2K02 A;  3V42 A;  4R1H A;  1XN7 A;  4ABZ A;  1R49 A;  2MBF A;  1W5T A;  2COB A;  3I4M J;  5F04 A;  2EIK H;  1VZ0 A;  4WX9 A;  1IXC A;  2F2E A;  4IQJ A;  2EZL A;  1B6A A;  2EA2 A;  2XKO A;  2CFX A;  5L3G A;  2Q2E B;  1QO0 D;  1W0T A;  3DP7 A;  4MHG A;  3Q0V A;  1IN5 A;  4GDF A;  3Q3S A;  1BIA A;  2JWT A;  5E18 F;  4MEY F;  3V8J A;  4ESF A;  2WWY A;  5TIS C;  2FBI A;  1LDD A;  2Y30 A;  2ZJR F;  3E6M A;  1HSJ A;  2O0Y A;  2DFH A;  2HS5 A;  2F4I A;  2MC3 A;  3S1R J;  2EV0 A;  3LA7 A;  3ZMD A;  4O6J A;  3VEP A;  4HV5 A;  3RKX A;  5LRS A;  4V2F A;  1P4A A;  4BNC A;  4UHT A;  2F6C A;  3K0L A;  1SD4 A;  4UUT A;  5JLW A;  1Z9C A;  3E0J B;  4BU2 A;  1G3W A;  4PJJ A;  2QSF X;  1FTZ A;  1JTY A;  1MMD A;  5BNG A;  5TRD A;  1WRJ A;  1JUS A;  3DBR B;  5BS6 A;  2LMD A;  1RPW A;  3HTU A;  2E1M C;  4JX6 A;  1CF7 B;  2YU9 J;  2QWW A;  3F0C A;  4EJV A;  1MZB A;  4XN3 A;  1NH3 A;  1S9H A;  1YFH A;  4BY7 J;  2M8E A;  1A36 A;  3OL3 A;  2Y31 A;  5EEA A;  1HQC A;  3EDP A;  5F64 A;  3DTK A;  1VQ4 I;  2KJC A;  2P5L C;  2XB5 A;  4G7O F;  3ZMT A;  2YX4 A;  5J3L A;  2V1D A;  4LK0 F;  4B3A A;  2FML A;  4LG0 B;  3E3V A;  4DJA A;  2R7U A;  2B7E A;  4GYG A;  2MFZ A;  4FX0 A;  4XKB A;  2H8W A;  2R5Z A;  3CUQ A;  5DTD A;  1Z7L A;  1S29 A;  4JBA A;  1BA5 A;  3EET A;  3H0G J;  2NS0 A;  2M4K A;  3TW6 A;  1TNT A;  3B6A A;  2L7K A;  1DP3 A;  1SMY F;  2O3F A;  3KP7 A;  3LSJ A;  4E70 A;  1L0O C;  1U5T B;  3FK7 A;  5GP9 A;  1OYW A;  3PIP F;  2M7B A;  1BR2 A;  2DN0 A;  1K83 J;  4MQV A;  4XOP A;  1SVM A;  3RJP A;  2E1N A;  3L2W A;  1JT6 A;  4AIH A;  3WTS C;  3EPZ A;  3NAR A;  1J75 A;  3CQZ J;  3ULQ B;  1BC7 C;  2YS9 A;  4A0X A;  3QPL A;  1OR7 C;  2DQR A;  4DZJ A;  1FSH A;  4QSH A;  3CMA I;  2DMU A;  5GAG J;  3FXO A;  3W6J B;  2VE9 A;  3ECH A;  3CLO A;  2VT2 A;  2W48 A;  3OR2 C;  1CF7 A;  4N0B A;  2XAQ A;  2QUF A;  3JRF A;  3SEZ A;  1IN7 A;  3KLO A;  1MKM A;  2Z3Y A;  1HC8 A;  2ZBK A;  1YJW I;  2HKO A;  4ZTJ A;  3FXL A;  3N97 A;  2JVH A;  2XF7 A;  1LQ1 A;  1LEB A;  2K9L A;  3LWF A;  3MZY A;  2VBW A;  2MLK A;  4FE4 A;  2I5U A;  4KIG A;  3WTX C;  5FKL A;  2HU9 A;  3O3K A;  2JSC A;  5HOD A;  1XPX A;  3U9G A;  3SZP A;  1EJ9 A;  4WXC A;  1OJL A;  4FT8 A;  5L3F A;  3DEW A;  2H27 A;  3AKZ A;  4C2T A;  2R7Z J;  4EJW A;  2PN6 A;  4DBQ A;  5CVV A;  4I98 B;  1SAX A;  2E5N A;  1LNW A;  4BEH B;  2HYG D;  2R7Q A;  3I64 A;  2IGK A;  3ZMZ A;  2WAQ N;  3HOV J;  3MZH A;  2IGN A;  1YJ9 I;  1MDM A;  4IPA A;  2ZXJ A;  4RB2 C;  4QPO A;  1UB9 A;  1HA8 A;  3E7L A;  2JUG A;  4CCK A;  2A61 A;  3JR9 A;  2DW4 A;  2M30 A;  3BLY A;  3MFK A;  1ETY A;  4KIF A;  1RKT A;  3CF2 A;  3GO5 A;  4UB8 C;  3GZ6 A;  3F8M A;  4M6V A;  3CUQ B;  2ECB A;  4EMS A;  1I6H J;  1PJR A;  5CQG A;  4A5N A;  1GVD A;  2P8T A;  3ZOB A;  4PFO A;  3R6S A;  1UFM A;  2VBZ A;  3GWZ A;  4BY1 J;  4OIN F;  2R7T A;  2L7M P;  5JLX A;  4ZDO A;  1AA7 A;  1R71 A;  4AWX B;  4RAZ A;  2NXN B;  3HTS B;  4XOR A;  3E5U A;  1LEA A;  4M9S A;  1LJ9 A;  1R5G A;  2W84 A;  1MNE A;  2HZT A;  3I4P A;  4LIV A;  4N9H A;  3QP5 A;  3VFZ A;  1N78 A;  4BJT A;  1SVL A;  4Y13 A;  1KU2 A;  2R7W A;  3D1N I;  4M72 A;  1O7L A;  2ESH A;  2IS1 A;  1QPI A;  2WY8 Q;  2ISZ A;  4PUS A;  1UHS A;  3I0T A;  4CYC B;  5E3L A;  4RAG A;  3S1Q J;  3E1S A;  2AHQ A;  4A3C J;  2VE8 A;  5CJ9 A;  1Y0N A;  5CKT A;  3FHZ A;  2KIU A;  4ETS A;  4BE0 A;  4E7I A;  4KNY A;  4AIK A;  4PSX A;  1K78 B;  4FET A;  3JW4 A;  3CZ6 A;  1H8A C;  3QOP A;  3TO6 A;  4ZTF A;  3JRG A;  2BY3 A;  2GZW A;  1FOK A;  5GPC A;  5M5Y J;  1YRN B;  3F9K A;  4DQ2 A;  2HGC A;  1WJB A;  3GW2 A;  2D2W A;  4KT5 C;  5M5W J;  2BYV E;  2XAH A;  2IT0 A;  1W5C C;  1WJ5 A;  5FJ8 J;  3OS1 A;  1U78 A;  2BHZ A;  2XGC A;  1PP7 U;  3E6C C;  5GPA A;  3RZD J;  2BY2 A;  3L2Q A;  3BJO A;  4DIQ A;  1RRJ A;  2W4S A;  1R1U A;  3OS2 A;  1WSU A;  5F0F A;  3MD2 A;  3VYT B;  3RQ4 A;  1FJL A;  3ABT A;  4BQQ A;  1HBX G;  2K7L A;  4UXN A;  1FX7 A;  2D1V A;  2H6B A;  2LLK A;  2MG4 A;  2PBI A;  1W7P B;  1R22 A;  2ISY A;  2F5V A;  3LSG A;  3WG9 A;  3S3N A;  3OS0 A;  1XS9 A;  3OYJ A;  3I59 A;  4RGX A;  3S93 A;  5JFR A;  1AKH B;  1K4S A;  2K9Q A;  5KCM A;  4E7K A;  1BBY A;  3OYB A;  4FHT A;  1MMA A;  2RDP A;  3JSP A;  3H35 A;  3HOU J;  1UJ8 A;  1FBS A;  1T0F A;  2VKE A;  1U9N A;  3DKY A;  2EB7 A;  2M87 A;  4P9F A;  2QLZ A;  4YFN F;  5D8L B;  3W6V A;  2DA7 A;  3SQN A;  2PLY A;  1RIO H;  4ZJZ A;  5AON A;  4RM3 A;  1YOV B;  2V6C A;  2JN6 A;  3F72 A;  1IF1 A;  1TW2 A;  1HKQ A;  1NHA A;  2VXD A;  5FRO A;  1ZGW A;  1QHH D;  3TW7 A;  3AAF A;  2RC4 A;  3QOE A;  1BJZ A;  3ZCO A;  3M9A A;  2QBY B;  2HYJ A;  2KFD A;  4Q5S F;  3SEQ A;  4HX4 A;  4RMN A;  3HOY J;  4A3E J;  2CV0 A;  4FE7 A;  1HOM A;  3CDI A;  3DCF A;  1CGP A;  5HNF A;  1XDU A;  2JJ7 A;  2XGX A;  3OL4 A;  1BR4 A;  2VN2 A;  3M8J A;  1BL0 A;  3BR5 A;  2H1L A;  1IXS B;  1EKE A;  2COM A;  2MH9 A;  2DA2 A;  2XPV A;  1X4O A;  4CUG A;  1VQM I;  2WV0 A;  5ILU A;  2W85 A;  1WZ2 A;  5E1W A;  2DFI A;  3LAJ A;  2K85 A;  4Y17 A;  2YUS A;  5D4R A;  4E4H A;  1BW5 A;  3HRS A;  2M4G A;  3GTL J;  5TGT A;  2L4M A;  4IO9 F;  1K78 A;  1HKT A;  3G2B A;  4OU0 A;  3TOB A;  9ANT A;  1BN5 A;  3CJT B;  1AKH A;  2KIF A;  1W7P D;  3OYK A;  2IA1 A;  4DZP A;  1WCM J;  1SAU A;  1SFX A;  4EJU A;  2ZFW A;  1WFX A;  4UUS A;  1J09 A;  4UUV A;  1FEX A;  4C2M J;  3AG1 H;  5J1U A;  2ZKZ A;  2JPC A;  4S0H B;  4BDY A;  3PL8 A;  3OSF A;  1U3E M;  2DA5 A;  1ZKG A;  2ZXH A;  3W2W A;  3U21 A;  4BHP A;  3QWL A;  1OMI A;  1TP4 A;  1TQI A;  4HX7 A;  2LOO A;  3CCU I;  1V5E A;  1FNN A;  1TWF J;  1LVK A;  4CZC A;  1ZH5 A;  2EA4 A;  1W7P A;  4L0Z B;  3R0A A;  2X4H A;  2O9L A;  1ZR4 A;  1FMV A;  3TO7 A;  2IS6 A;  5IYC J;  2DDB A;  1IV8 A;  1VQL I;  4YEL A;  3CJQ B;  1X58 A;  5HLT A;  2LKX A;  1FYL A;  2XDV A;  5EGO A;  2WY7 Q;  3IHU A;  2ZJP F;  2DTZ A;  1WKM A;  1F36 A;  3GLL A;  1ZAR A;  4BJ6 C;  3BDD A;  4D7M A;  1D8K A;  4U7B A;  2KIM A;  2PFB A;  2Q8K A;  1QPM A;  5BOX A;  4IL6 C;  3HPG A;  2L3D A;  4XLC A;  4J19 A;  2DA3 A;  3B73 A;  5CLS A;  1XSD A;  2NAZ A;  4A0Z A;  1W36 D;  3HGG A;  3W6K B;  3I3L A;  4D1Q A;  2R5Y B;  2R7O A;  4W1U A;  3H3V K;  1D1A A;  1W0U A;  3S17 J;  2K4J A;  3RPQ A;  2IAI A;  1FIA A;  4ITV A;  3X2Q H;  4O3M A;  4A3B J;  2DO7 A;  3KEQ A;  1C0W A;  3QU3 A;  2EPF A;  5B3S H;  1HKS A;  2KDZ A;  1BIB A;  1O3S A;  2R7V A;  2CW7 A;  4BHC A;  2X6O A;  1OCO H;  2K9M A;  4HRI A;  2O61 A;  3A02 A;  1OIS A;  3J80 Z;  4A6D A;  4PJL A;  2TCT A;  5LEJ A;  5ICE A;  3I58 A;  3GTP J;  1BI1 A;  3PQJ A;  1J7K A;  1Z6R A;  1MJ9 A;  2EV6 A;  3GF2 A;  5F08 A;  3I59 B;  2Z99 A;  2STW A;  2P0W A;  2P5K A;  1NTC A;  2ZNY A;  3IP4 B;  4M6Y A;  3JRB A;  4JOM A;  3T0Y A;  2L01 A;  3HBL A;  2UXN A;  1B9M A;  2LRD A;  3HL2 A;  2CV2 A;  2OC6 A;  3FXJ A;  1XGO A;  4BS9 A;  1JKO C;  3K2Z A;  3BPX A;  1J9I A;  1T0F C;  3WU0 A;  3BY6 A;  3ZQF A;  4MFE A;  3C7J A;  1MSE C;  1IW7 F;  4HBL A;  2CV1 A;  4XRF A;  2OTJ I;  1R7J A;  4BEH A;  2RKH A;  2J5P A;  1IG7 A;  2Z33 A;  1YIJ I;  1TTY A;  3DPU A;  4KIS A;  2QQ9 A;  2FA5 A;  4LLG F;  4IF4 A;  1PP8 F;  2GIZ A;  4B43 A;  2LYC A;  4XON A;  3GME A;  4BXX J;  1SEU A;  3KYL A;  3BQY A;  3HB9 A;  4EV0 A;  2CO5 A;  1FOW A;  4ENM A;  1JJ8 C;  1X1A A;  1P7I A;  2JSP A;  2E71 A;  4NB5 A;  5IOY A;  1ON2 A;  4ANJ A;  3BT9 A;  1A35 A;  5E17 F;  3HRM A;  4XLN F;  1QGP A;  3RI4 A;  4G8X A;  3A1Y A;  3OYH A;  1DDN A;  2JA5 J;  1QA6 A;  3BZK A;  1TW3 A;  3AG2 H;  3ZQ7 A;  4B47 A;  1SVO A;  2F5C A;  3ZXS A;  1ETQ A;  1G8X A;  2DT5 A;  4Q4Z F;  2E1C A;  3PFY A;  4M74 A;  3ZRG A;  2HR3 A;  2V9P A;  5K5Q A;  4H0E A;  4MEX F;  2UWM A;  2F48 A;  1BM9 A;  4A3J J;  1X3W B;  2E35 A;  3G3Z A;  1YW7 A;  4M6X A;  4LD5 A;  3LA2 A;  1MMN A;  4UB6 C;  3WGI A;  5L3B A;  1NG7 A;  4CH7 A;  1QRY A;  2VL8 A;  3LAP A;  1AWC A;  3IRQ A;  1B8I A;  4A3F J;  1VQO I;  3CCQ I;  3ZMV A;  5DCF A;  1U2W A;  5D5V B;  1B4A A;  1B8I B;  5K1Y A;  2R5Y A;  3M07 A;  3DKW A;  3S3O A;  2CQX A;  3J81 Z;  1STZ A;  5DM7 F;  5HNH A;  2BE5 F;  1YG2 A;  4DYC A;  3TED A;  2P6T A;  2WAQ A;  3CCM I;  2L9N A;  1DUX C;  1Z3Y A;  1WJE A;  4OMZ A;  3OOU A;  1TWA J;  1ZRF A;  2LP0 A;  2RN7 A;  3BJA A;  1Y39 A;  4IHX A;  2ZB9 A;  4KFC A;  3WTV C;  2R7D A;  2ZXW H;  1R4M B;  3RKQ A;  1I1G A;  4XOT A;  3QRF F;  5J1R A;  3FMR A;  1R4N B;  3AG3 H;  3GTJ J;  3P9K A;  2VPL A;  2OV7 A;  3FXU A;  1ZG3 A;  3F6O A;  4N9I A;  2L7F P;  3KP6 A;  5L3E A;  2LH9 A;  4MFD A;  2HZD A;  5FB2 A;  3CMY A;  1VQN I;  1U5T A;  5K5R A;  1S6L A;  4EVI A;  5LD2 C;  4OWR B;  3GZN B;  4M9Z A;  3ZGK A;  2DAO A;  5LEK A;  2YX7 A;  3TQN A;  1UHM A;  4LFU A;  2EFW A;  3K4B A;  1Z3X A;  5KVR A;  4LLN A;  2UV1 A;  4A3L J;  1JE8 A;  4P5O A;  1LFB A;  1XSV A;  3DXJ F;  3CP8 A;  2HI3 A;  2N8G A;  5LGU A;  3CCR I;  3K70 C;  5JHF A;  1Z6T A;  3OYC A;  5IP7 J;  1ENH A;  1XC5 A;  2XRO A;  2A07 F;  3FXQ A;  3F8F A;  3NQO A;  3FKI J;  4ZYE A;  2FX0 A;  4D7N A;  5BQT A;  3BP8 A;  2ZME A;  2Z16 A;  2M9H A;  2XAG A;  2J5O A;  1MH4 A;  2OUM A;  2Y48 A;  2DMN A;  3S3M A;  2XF5 A;  4ZYG A;  2H6C A;  1T08 B;  2AQE A;  2QKL B;  3RPU A;  2V9K A;  3COA C;  4F55 A;  3CUQ C;  1GT0 C;  4RAY A;  3L00 A;  3S32 A;  3RCO A;  2IP2 A;  3FK6 A;  3K9T A;  1OCP A;  5HLI A;  1YW8 A;  2I10 A;  3BC8 A;  3R61 A;  3TO9 A;  3N4M A;  3GTM J;  1P4X A;  2KT0 A;  3BG5 A;  3G71 I;  2CS3 A;  1KQ8 A;  2QQ8 A;  3WU1 B;  3DV8 A;  2R7X A;  2O5R A;  2FF4 A;  3V8L A;  5K5O A;  2VKH A;  1B1B A;  1FP1 D;  1G59 A;  2M1B A;  2LC2 A;  4Y4R A;  3DLL F;  2W82 A;  1EH7 A;  2GQQ A;  1Y8Q B;  2R7F A;  2X9D A;  1LE8 B;  1O57 A;  3T8T A;  1Q1H A;  2I8D A;  4R79 A;  3BWG A;  3H3U A;  4FCY A;  4BQA A;  1I27 A;  3H0D A;  5EGO B;  4XRS A;  1ZLJ A;  3TP3 A;  3JRE A;  1J5Y A;  2VON A;  1KQ0 A;  2Z9O A;  4A3K J;  3KP5 A;  1IRF A;  4B4C A;  3BR6 A;  2OCC H;  1ETV A;  3PO2 J;  2A05 A;  4C2U A;  2V26 A;  1OFC X;  3IUO A;  3L09 A;  3OYM A;  2GWR A;  4A5M A;  1KGS A;  4CSW A;  5E8I A;  4ZH4 F;  3CDL A;  3V7C A;  2UZK A;  1TQM A;  4XLF A;  4EEF G;  1QBJ A;  1ETK A;  4M3G A;  1LPQ A;  2NVU B;  2K86 A;  4M3D A;  3OMY A;  3WGG A;  5C4J J;  1W1W E;  1RUO A;  1QZE A;  3M3Y J;  5GAH J;  1R6R A;  3QP6 A;  2VIX A;  1D1C A;  4WXD A;  1LB2 A;  3LFU A;  3PNY A;  4W97 A;  1JT0 A;  3AL0 B;  4A3D J;  1JKQ C;  1JI8 A;  2YR2 A;  3A01 A;  3F3X A;  3FM5 A;  4UY8 I;  1X3Z B;  1Z91 A;  4R8H A;  2ZFU A;  3Q5F A;  3PO3 J;  1UG2 A;  2LY1 A;  1TNS A;  4M73 A;  4IRI A;  3V8K A;  4CCJ A;  5AIQ A;  1IXR C;  1DU0 A;  3OR1 C;  2OZU A;  2E60 A;  3J7A O;  4LLL A;  3DQV C;  2BXY A;  2ZME C;  4ZYD A;  1ETO A;  1LFP A;  1MDM B;  4LG3 A;  1SD5 A;  3BR0 A;  4WK8 F;  5FRM A;  3U1K A;  3Q0W A;  4PJN A;  4EM1 A;  1PUF B;  1ZTR A;  2HFH A;  2ME0 A;  3VOD A;  5LHG A;  1VQP I;  3FMQ A;  4MIM A;  2PMU A;  1BR1 A;  1DGW Y;  2HKX A;  1E3P A;  4UVB A;  3QPH A;  4HDV A;  1UEL B;  1IDY A;  5CVJ A;  2ELH A;  3PSF A;  3EUA A;  3B6C A;  3QYB A;  3HKZ N;  1U8B A;  2KJB A;  3TDU C;  4G7H F;  2CUF A;  3C18 A;  4NC7 A;  4BBS J;  5DM6 F;  4L9J A;  3LMM A;  3R4K A;  1MGT A;  3L9F A;  2OA4 A;  3H5N A;  2Y0M A;  3PQK A;  3IL2 A;  2X1D A;  3BCA A;  3HIF A;  3OYN A;  2CW0 F;  4MTE A;  2LTP A;  3V7S A;  1YTY A;  2JRM A;  3ZQG A;  2V1U A;  5F0C A;  3GTG J;  3JTG A;  3ZP5 A;  3ABU A;  1FZP B;  1K7A A;  3QU6 A;  2R7S A;  1Q1V A;  2XPU A;  5B1B H;  2KZG A;  4HNU A;  1K61 A;  2IA0 A;  4D5C A;  1ZAO A;  1XGM A;  3KIO A;  2CW8 A;  1YJN I;  4MNU A;  2UXX A;  4I0A A;  1P92 A;  2CGP A;  2X85 A;  3LFK A;  2JA6 J;  2DK8 A;  2D5V A;  2LFB A;  3G4S I;  3HG9 A;  3KLN A;  3SHF A;  4UV9 A;  2PJP A;  4IRH A;  1KYZ A;  4DGW B;  3KET A;  1B72 B;  5DV5 A;  4NHJ A;  3HOT A;  3KPH A;  1QHG A;  3H9Q A;  3TGN A;  3UKG A;  2MA3 A;  4I02 A;  1W4M A;  2KIQ A;  1JTX A;  4CA0 A;  2VQG A;  2VKV A;  6PAX A;  3CC7 I;  3C2B A;  2V6E A;  3VYS B;  4I76 A;  4L0Y B;  3DBL B;  2FRH A;  2VPR A;  1FC3 A;  2Q0O A;  5HDK A;  4II2 A;  5KK1 A;  3ISP A;  3HOZ J;  2CUZ A;  2JVG A;  3MVP A;  4AYB A;  3J81 K;  2FD5 A;  4DYR A;  4IHT A; 
#chains in the Genus database with same CATH homology
 2PG4 A;  2ESN A;  1B9N A;  1IRG A;  4IRG A;  2FQ3 A;  4MQ9 F;  1FP2 A;  2DPD A;  1G4D A;  2VBY A;  4HQM A;  3QPT A;  2QVO A;  1FBQ A;  4UVA A;  3P7N A;  1Y0U A;  5ICG A;  3C1D A;  2QM3 A;  3S2W A;  4ENN A;  4RB1 A;  3DEU A;  3FXR A;  1RI7 A;  4K2E A;  1FSE A;  5F1R A;  2A6E F;  3ROU A;  5DD8 A;  3HOS A;  3HSE A;  4WF2 A;  4I09 A;  3BRO A;  5HLH A;  5D5X B;  2DQL A;  1SD7 A;  5FLX K;  1FBU A;  3ECO A;  3ZN0 A;  3QAH A;  2ZO4 A;  3KP3 A;  2HOE A;  1FLI A;  4KA4 A;  4KN7 X;  5DD4 A;  1XCB A;  1U6G A;  2FXA A;  3DPT A;  2P4W A;  3IWZ A;  1QZZ A;  5HDG A;  3WGH A;  4GXO A;  2R3S A;  5ICC A;  2QYO A;  1SFE A;  3R0J A;  4WCG A;  1ZG1 A;  3HRU A;  2YSR A;  4ENK A;  1D3Y A;  1RUN A;  2CQK A;  2DPU A;  5FD5 A;  2JRT A;  3F22 A;  1L3L A;  3M8F A;  4TV7 A;  5E8G A;  3RKW A;  2VOO A;  3VB2 A;  3DPL C;  4UVC A;  5CVR A;  5J6X A;  2EFO A;  1YLF A;  3J80 K;  1YS7 A;  4OIP F;  2KRF A;  4L9V A;  3L2C A;  4BAY A;  2CSO A;  4G7Z F;  4B8X A;  3OV8 A;  3E6D A;  2EFN A;  2CYY A;  4UNO A;  2HDC A;  1ZRD A;  3BJ6 A;  3CDH A;  2JPB A;  4UV8 A;  4CHU A;  4S05 A;  1WI9 A;  5FLX Z;  3WTT C;  5J8F A;  4P55 A;  3D0S A;  4HLX A;  2GXG A;  4JK1 X;  3ZPL A;  5LHI A;  1T98 A;  1T6S A;  3JTH A;  4KIC A;  3PFI A;  1KA8 A;  2HWV A;  4JQF A;  2RV8 A;  2HTJ A;  1OKR A;  1MJB A;  4PGG A;  4G6D A;  2EFQ A;  1BOA A;  2OU2 A;  5EEH A;  2P7V B;  3MEX A;  4GYI A;  3V7R A;  1UCR A;  1BI2 A;  2G9W A;  4L5I A;  1KU9 A;  5DCM A;  4KDP A;  2PMH A;  3ZN1 A;  3K69 A;  1ZGA A;  4HX8 A;  1J0R A;  1HXD A;  1QQI A;  3LST A;  3KEO A;  3O6B B;  3R60 A;  1R23 A;  3H92 A;  3WTY C;  4OMY A;  2PQ8 A;  4YFX F;  1ZRE A;  2GXB A;  5E1Z B;  1J59 A;  3TKY A;  3U1D A;  3EQL F;  5IT9 K;  1R00 A;  2OBP A;  1Z1D A;  1FYK A;  1T2K A;  1XMA A;  4BYY A;  4CIC A;  5DEQ A;  3P9C A;  4LB5 A;  3T5X A;  4M71 A;  3FX3 A;  4S04 A;  3RYR A;  5HVQ C;  3I5U A;  5DUI A;  1UHW A;  5DCM B;  4ZZL A;  1K6O A;  3GFM A;  2XRN A;  3P9I A;  4U0V A;  2VOD A;  2DU9 A;  4KMF A;  3HSR A;  2FU4 A;  3E5X A;  5FFX A;  2WTE A;  1FT9 A;  4G9Y A;  1O3Q A;  3I71 A;  1UST A;  4D0P A;  2XIG A;  1LDJ A;  2AXL A;  4XSZ F;  1YYV A;  2D1H A;  3HHG A;  2W57 A;  1S3J A;  1YS6 A;  1F4K A;  4ESB A;  2XVC A;  1ZHF A;  2DTR A;  2F5D A;  1J2X A;  1DPR A;  3REO A;  2YU3 A;  3JSO A;  4LGW A;  3WE2 A;  1LDK B;  4HF2 A;  1FY7 A;  3DFG A;  1SFU A;  5ED4 A;  2GA1 A;  4Q47 A;  3KCC A;  2F5E A;  3ELK A;  3ZMS A;  1RZ4 A;  2A3S A;  2G7U A;  1KQ9 A;  4ON0 A;  1XB4 A;  3E5Q A;  2HQR A;  3LQQ A;  1AOY A;  4ENJ A;  2OAZ A;  4XLP F;  3M8E A;  3CUO A;  1HST A;  1D8J A;  3U2R A;  4I0B A;  2TDX A;  5JVT A;  3IRR A;  2VC1 A;  1DPU A;  1Z7U A;  1F1Z A;  2AS5 F;  4HAM A;  5DYM A;  1JHH A;  1S7O A;  1TBX A;  2H94 A;  4ESJ A;  2RVC A;  3I53 A;  1G3S A;  1V4R A;  3E97 A;  4A2U A;  4PCQ A;  1XDS A;  1ZLK A;  3SZT A;  2L02 A;  5JI6 A;  2XAS A;  3HSF A;  2LSO A;  5J8C A;  3F21 A;  3IKV A;  1H9T A;  3T8R A;  3I54 A;  1X3U A;  1FWZ A;  2XV4 S;  4GO1 A;  4YG2 F;  4XBF A;  4HW0 A;  1R36 A;  4KN4 X;  4LJZ F;  4IJA A;  2EK5 A;  2A68 F;  1WQ2 A;  1R58 A;  4MGR A;  1EH8 A;  3KP4 A;  1F5T A;  3CJN A;  1IN8 A;  4B09 A;  1HW5 A;  3GLX A;  1K79 A;  4KUM A;  5H6R A;  3WTZ A;  2K4B A;  4AIJ A;  1E2X A;  4NQW A;  2E7X A;  3KE2 A;  2QEN A;  3ML6 A;  4L9N A;  2RGV A;  3WE3 A;  1G3T A;  3M7G A;  3JAM K;  5HLG A;  5D4S A;  2NYX A;  4YFK F;  5HS8 A;  1EV7 A;  2VC0 A;  3IC7 A;  2FE3 A;  1XMK A;  1R1V A;  1GHC A;  1YO5 C;  4LG0 A;  2MLG A;  1JHF A;  4A0Y A;  4QWQ A;  3WTU C;  1DP7 P;  1XSX A;  5JHU A;  1Z05 A;  4HOB A;  2JZY A;  4AVP A;  1I1S A;  2LNB A;  1SD6 A;  2V9V A;  3T1B A;  1GXQ A;  3WTW C;  4CXF A;  2P5V A;  4Y15 A;  1I5Z A;  2Q2E A;  2EWN A;  2Y75 A;  1YQA A;  3MCZ A;  1OR7 A;  4P96 A;  4U0W A;  3MQ0 A;  4L5J A;  2KKO A;  3K1N A;  3DF8 A;  4YIF A;  1PUE E;  3KZY A;  2E7W A;  3BZ6 A;  4G6Q A;  2STT A;  2GA2 A;  2HYF A;  1P4W A;  3K1P A;  4L18 B;  2ADU A;  2XUB A;  4GCV A;  2W25 A;  4IHS A;  2V1X A;  4IXA A;  2IRF G;  5L3C A;  2CG4 A;  5A2Q K;  4IVN A;  4MTD A;  1S7A A;  4CZZ A;  4RB3 C;  4M9X A;  5A2Q Z;  4ZYH A;  3GUD A;  2PI0 A;  1IAW A;  3NEU A;  1YW9 A;  4RGR A;  4RS8 A;  4WWC A;  3V4G A;  3TOA A;  1OYI A;  3GFL A;  5D6E A;  2PEX A;  3K1M A;  1F9N A;  5FD6 A;  4L9T A;  4U88 A;  5BPD A;  2NNY A;  5JR3 A;  4F7Z A;  1P6R A;  4EJO A;  4Q48 A;  2HEO A;  2FEZ A;  4BXU A;  3BPV A;  1BJA A;  4HQE A;  1USS A;  1YIO A;  2ZNZ A;  2B0L A;  1IN6 A;  1T38 A;  1ONV A;  2HQN A;  4CGZ A;  2ETH A;  4BH9 A;  5H6Q A;  3SFZ A;  2DK5 A;  2QBY A;  1KU7 A;  3CTA A;  5E20 A;  5L3D A;  2ZME B;  2IA2 A;  4A6E A;  1QNT A;  3KP2 A;  1RNL A;  1OYY A;  4EM0 B;  1FYM A;  2EFP A;  4P9U A;  5ERI A;  2A5Y B;  4G94 A;  1ZGJ A;  2QZ8 A;  2C6Y A;  1FPQ A;  2XKP A;  5LBQ A;  2M45 A;  5D5U B;  2OD5 A;  2VXZ A;  1D5V A;  4CYD A;  4EGY A;  1E17 A;  1B59 A;  2F5F A;  5TJJ A;  2GAU A;  1H9G A;  3E6B A;  3MAJ A;  3FMS A;  1WWX A;  2GIV A;  3F6V A;  1A04 A;  5LHH A;  3JAM Z;  2FNA A;  5EEG A;  1ULY A;  3HHH A;  2OQG A;  3H3Z A;  2ZCW A;  1W5S A;  3GFJ A;  2O03 A;  5FO5 A;  4HV6 A;  4GGG A;  4HDU A;  2VBX A;  1XCV A;  1G6N A;  4O5V A;  5D5W B;  4I2O A;  4LB6 B;  5DUK A;  2G7H A;  2A69 F;  2LF8 A;  2P7C B;  4HF0 A;  1MD0 A;  1ZYR F;  2BBY A;  4EQQ A;  4EJT A;  1O3T A;  2FOK A;  3RDI A;  3IWF A;  2RNJ A;  4OIQ F;  2MD5 A;  3M1E A;  4I7H A;  3GEZ A;  4YII A;  1LVA A;  2IPQ X;  5IT3 A;  3LQR A;  5HS9 A;  2P6S A;  3GX4 X;  4HLY A;  3EUH A;  2EJR A;  5LGN A;  2X0L A;  5HOO A;  2VOP A;  3FZV A;  1H0M A;  3D5L A;  4DNC A;  3CO6 C;  3RTR A;  3RYP A;  4U0Y A;  4HYE A;  3VOE A;  5ICF A;  1TQP A;  1S8N A;  3F23 A;  5DDG A;  4RGU A;  5AIP A;  1ZG5 A;  2BV6 A;  2L4A A;  3HRT A;  3F8N A;  3O2P E;  1ZN2 A;  2H09 A;  2NNN A;  3ERE D;  1R1T A;  1EH6 A;  1XD7 A;  5F6F A;  1XGN A;  1O3R A;  2RQP A;  4CO8 A;  1PDN C;  2EV5 A;  1MJA A;  4OIO F;  5BMZ A;  5IT9 Z;  1JXS A;  4CDG A;  3GFI A;  1ZRC A;  3Q9S A;  4U7D A;  5CYV A;  5HDN A;  4PDK A;  1BI3 A;  4LK1 F;  4FX4 A;  3LA3 A;  1R5H A;  1P2F A;  3ZMU A;  4LMY A;  2BEO A;  2IJL A;  3IKT A;  5CVI A;  2IVM A;  2OQR A;  4XSX F;  3GZ5 A;  5CVU A;  3CO7 C;  2LF7 A;  1IUY A;  5LGT A;  3KZZ A;  4I01 A;  1VTN C;  2L54 A;  2JTV A;  4KYW A;  1O7F A;  3NRV A;  3HYI A;  2DBB A;  3C3W A;  1ODD A;  2IW5 A;  2QQB A;  2XAJ A;  3RIR A;  5FFZ A;  2CWE A;  2XHK A;  2W24 A;  3SXY A;  4QLC U;  4HA8 A;  2XAF A;  4HZF A;  1V3F A;  2JT1 A;  5LLQ A;  4EGZ A;  1IN4 A;  3F8B A;  5ILV A;  1KYW A;  1GXP A;  2K27 A;  1BI0 A;  4OIR F;  4EM2 A;  5H20 A;  1OPC A;  2Z5U A;  2NRA C;  5HS7 A;  4BHB A;  2FBH A;  3WOD F;  3G73 A;  4RB0 A;  2ACJ A;  4OOI A;  2HTS A;  3OOP A;  3EYI A;  1KU3 A;  3Q9V A;  5BPI A;  3L7W A;  3GXO A;  2V79 A;  4RGS A;  3FM3 A;  4ASN A;  2FBK A;  1IZ1 A;  3GYH X;  4WXH A;  4ZZD A;  2WC2 A;  2VT3 A;  2LDU A;  5LRR A;  1GVJ A;  2FNP A;  3GVA A;  2LKP A;  2MH2 A;  3KFW X;  5D8K B;  4PZJ A;  2A6H F;  5D6F A;  4KIB A;  2O8X A;  3EYY A;  3TDZ C;  5E1X A;  3FF5 A;  2QQA A;  3BOQ A;  2YPR A;  2FSW A;  1G3Y A;  3RKY A;  2FMY A;  4PGH A;  4KMU X;  3MWM A;  4A12 A;  5ILS A;  2OZ6 A;  2D45 A;  4HF1 A;  1I6X A;  2M5W A;  4Z2Y A;  2DI3 A;  1ON1 A;  1U8R A;  1QZY A;  4AD9 A;  1HW1 A;  1TLH B;  2ZJ2 A;  1REP C;  3F8C A;  1U5T C;  2O6G E;  3HUG A;  1BC8 C;  1XGS A;  1JGS A;  3B02 A;  1HW2 A;  2DLL A;  3FWE A;  5FGM A;  1SMT A;  2BGC A;  2K02 A;  4R1H A;  1XN7 A;  2MBF A;  1W5T A;  4WX9 A;  1IXC A;  2F2E A;  1B6A A;  2EA2 A;  2XKO A;  2CFX A;  5L3G A;  1QO0 D;  3DP7 A;  4MHG A;  1IN5 A;  1BIA A;  5E18 F;  4MEY F;  3V8J A;  4ESF A;  2WWY A;  2FBI A;  1LDD A;  3E6M A;  1HSJ A;  2O0Y A;  2HS5 A;  2MC3 A;  2EV0 A;  3LA7 A;  3ZMD A;  4O6J A;  3VEP A;  4HV5 A;  3RKX A;  5LRS A;  4BNC A;  1P4A A;  4UHT A;  3K0L A;  1SD4 A;  1Z9C A;  1G3W A;  5TRD A;  1WRJ A;  5BS6 A;  3HTU A;  1CF7 B;  2QWW A;  4EJV A;  1MZB A;  1YFH A;  2M8E A;  1HQC A;  3EDP A;  5F64 A;  2KJC A;  2P5L C;  4G7O F;  3ZMT A;  2YX4 A;  2V1D A;  4LK0 F;  2FML A;  4LG0 B;  3E3V A;  4GYG A;  4FX0 A;  3CUQ A;  1S29 A;  4JBA A;  3EET A;  2NS0 A;  1TNT A;  1SMY F;  2O3F A;  3KP7 A;  4E70 A;  1L0O C;  1U5T B;  1OYW A;  4MQV A;  3RJP A;  2E1N A;  4AIH A;  3WTS C;  1J75 A;  3ULQ B;  1BC7 C;  4A0X A;  2DQR A;  1FSH A;  3W6J B;  2VE9 A;  3ECH A;  3CLO A;  2VT2 A;  1CF7 A;  4N0B A;  2XAQ A;  2QUF A;  1IN7 A;  3KLO A;  1MKM A;  2Z3Y A;  2ZBK A;  2HKO A;  3N97 A;  1LQ1 A;  1LEB A;  3LWF A;  3MZY A;  2VBW A;  2MLK A;  4KIG A;  3WTX C;  3O3K A;  2JSC A;  3U9G A;  3SZP A;  4WXC A;  4FT8 A;  5L3F A;  2H27 A;  4EJW A;  2PN6 A;  5CVV A;  4I98 B;  1SAX A;  1LNW A;  2HYG D;  3I64 A;  3ZMZ A;  3MZH A;  1MDM A;  4IPA A;  2ZXJ A;  4RB2 C;  1UB9 A;  2A61 A;  2DW4 A;  2M30 A;  3MFK A;  4KIF A;  3GO5 A;  3GZ6 A;  3F8M A;  3CUQ B;  4EMS A;  4A5N A;  2P8T A;  3R6S A;  1UFM A;  2VBZ A;  3GWZ A;  4OIN F;  4AWX B;  4RAZ A;  3HTS B;  3E5U A;  1LEA A;  4M9S A;  1LJ9 A;  1R5G A;  2W84 A;  2HZT A;  3I4P A;  4N9H A;  3QP5 A;  3VFZ A;  4Y13 A;  1KU2 A;  4M72 A;  1O7L A;  2ESH A;  2ISZ A;  3I0T A;  2VE8 A;  5CJ9 A;  3FHZ A;  2KIU A;  4ETS A;  4KNY A;  4AIK A;  1K78 B;  3JW4 A;  3QOP A;  3TO6 A;  2GZW A;  1FOK A;  4DQ2 A;  2HGC A;  3GW2 A;  2D2W A;  4KT5 C;  2BYV E;  2XAH A;  2IT0 A;  1U78 A;  1PP7 U;  3E6C C;  3BJO A;  1R1U A;  1WSU A;  3ABT A;  1HBX G;  2K7L A;  4UXN A;  1FX7 A;  2D1V A;  2H6B A;  2PBI A;  1W7P B;  1R22 A;  2ISY A;  1T39 A;  3WG9 A;  3I59 A;  4RGX A;  5JFR A;  1BBY A;  4FHT A;  2RDP A;  3JSP A;  1FBS A;  1T0F A;  4P9F A;  2EB7 A;  2M87 A;  4YFN F;  2QLZ A;  5D8L B;  3SQN A;  2PLY A;  1RIO H;  5AON A;  2V6C A;  3F72 A;  1IF1 A;  1TW2 A;  1HKQ A;  1NHA A;  3AAF A;  2RC4 A;  3M9A A;  2QBY B;  4Q5S F;  4HX4 A;  1CGP A;  1XDU A;  2XGX A;  2VN2 A;  1IXS B;  2COM A;  2MH9 A;  2WV0 A;  5ILU A;  2W85 A;  5E1W A;  2DFI A;  3LAJ A;  4Y17 A;  5D4R A;  3HRS A;  2L4M A;  1K78 A;  1HKT A;  4OU0 A;  3TOB A;  1BN5 A;  2KIF A;  1W7P D;  2IA1 A;  1SFX A;  4EJU A;  2ZFW A;  4UUV A;  2ZKZ A;  2JPC A;  1U3E M;  4BHP A;  1OMI A;  1TQI A;  4HX7 A;  1FNN A;  1ZH5 A;  2EA4 A;  1W7P A;  4L0Z B;  3R0A A;  2X4H A;  3TO7 A;  1FYL A;  3IHU A;  1WKM A;  1ZAR A;  3BDD A;  1D8K A;  4U7B A;  2KIM A;  2PFB A;  2Q8K A;  1QPM A;  5BOX A;  2L3D A;  3B73 A;  5CLS A;  1XSD A;  2NAZ A;  4A0Z A;  3W6K B;  2K4J A;  3RPQ A;  4O3M A;  2DO7 A;  3KEQ A;  1C0W A;  3QU3 A;  1HKS A;  1BIB A;  1O3S A;  4BHC A;  2O61 A;  3J80 Z;  4A6D A;  5LEJ A;  5ICE A;  3I58 A;  1BI1 A;  3PQJ A;  1J7K A;  1Z6R A;  1MJ9 A;  2EV6 A;  3GF2 A;  3I59 B;  2Z99 A;  2STW A;  2P5K A;  2ZNY A;  4M6Y A;  3T0Y A;  2L01 A;  2UXN A;  1B9M A;  1XGO A;  3K2Z A;  3BPX A;  1J9I A;  3WU0 A;  3BY6 A;  3C7J A;  1IW7 F;  4HBL A;  4XRF A;  1R7J A;  2RKH A;  2J5P A;  2Z33 A;  1TTY A;  2QQ9 A;  2FA5 A;  4LLG F;  4IF4 A;  1PP8 F;  4EV0 A;  2CO5 A;  4ENM A;  4NB5 A;  1ON2 A;  5E17 F;  3HRM A;  4XLN F;  1QGP A;  3RI4 A;  4G8X A;  1DDN A;  1TW3 A;  3ZQ7 A;  2F5C A;  2DT5 A;  4Q4Z F;  2E1C A;  4M74 A;  2HR3 A;  5K5Q A;  4H0E A;  4MEX F;  2UWM A;  1BM9 A;  3G3Z A;  1YW7 A;  4M6X A;  4LD5 A;  3LA2 A;  3WGI A;  5L3B A;  1AWC A;  3LAP A;  3IRQ A;  3ZMV A;  5DCF A;  1U2W A;  5D5V B;  1B4A A;  5K1Y A;  3DKW A;  3J81 Z;  1STZ A;  2BE5 F;  1YG2 A;  2P6T A;  1DUX C;  4OMZ A;  1ZRF A;  2RN7 A;  3BJA A;  4KFC A;  3WTV C;  2R7D A;  1I1G A;  3QRF F;  3FMR A;  3P9K A;  3FXU A;  1ZG3 A;  3F6O A;  4N9I A;  3KP6 A;  5L3E A;  5FB2 A;  1U5T A;  5K5R A;  1S6L A;  4EVI A;  4M9Z A;  2DAO A;  5LEK A;  2YX7 A;  3TQN A;  1UHM A;  4LFU A;  2EFW A;  5KVR A;  4LLN A;  1JE8 A;  4P5O A;  1XSV A;  3DXJ F;  5LGU A;  1Z6T A;  2XRO A;  2A07 F;  3FXQ A;  3F8F A;  3NQO A;  4ZYE A;  5BQT A;  3BP8 A;  2ZME A;  2XAG A;  2J5O A;  2Y48 A;  4ZYG A;  2H6C A;  3RPU A;  3COA C;  3CUQ C;  4RAY A;  3L00 A;  2IP2 A;  3K9T A;  5HLI A;  1YW8 A;  3R61 A;  3TO9 A;  3N4M A;  1P4X A;  1KQ8 A;  3WU1 B;  3DV8 A;  3V8L A;  2FF4 A;  5K5O A;  1B1B A;  1FP1 D;  2M1B A;  1EH7 A;  2GQQ A;  2R7F A;  1O57 A;  3T8T A;  1Q1H A;  4R79 A;  3BWG A;  3H3U A;  4BQA A;  1I27 A;  1ZLJ A;  1J5Y A;  2VON A;  1KQ0 A;  2Z9O A;  3KP5 A;  1IRF A;  3L09 A;  2GWR A;  4A5M A;  1KGS A;  5E8I A;  4ZH4 F;  3V7C A;  2UZK A;  1TQM A;  1QBJ A;  2K86 A;  3WGG A;  1RUO A;  3QP6 A;  4WXD A;  1LB2 A;  2YR2 A;  3F3X A;  3FM5 A;  1Z91 A;  4R8H A;  3Q5F A;  1TNS A;  4M73 A;  4IRI A;  3V8K A;  5AIQ A;  1IXR C;  2OZU A;  3J7A O;  4LLL A;  3DQV C;  4ZYD A;  1MDM B;  1SD5 A;  4WK8 F;  4EM1 A;  2HFH A;  3VOD A;  5LHG A;  3FMQ A;  2PMU A;  2HKX A;  4UVB A;  3QPH A;  4HDV A;  5CVJ A;  2ELH A;  2KJB A;  3TDU C;  4G7H F;  3C18 A;  4L9J A;  3R4K A;  1MGT A;  3L9F A;  2OA4 A;  2Y0M A;  3PQK A;  3IL2 A;  3HIF A;  2CW0 F;  4MTE A;  3V7S A;  1YTY A;  2V1U A;  3JTG A;  3ZP5 A;  3ABU A;  1FZP B;  1K7A A;  3QU6 A;  2IA0 A;  1ZAO A;  1XGM A;  4MNU A;  2UXX A;  4I0A A;  1P92 A;  2CGP A;  3LFK A;  2DK8 A;  3KLN A;  3SHF A;  4UV9 A;  2PJP A;  4IRH A;  1KYZ A;  3KET A;  5DV5 A;  4NHJ A;  3HOT A;  3TGN A;  2MA3 A;  4I02 A;  1W4M A;  6PAX A;  4L0Y B;  2FRH A;  1FC3 A;  2Q0O A;  5HDK A;  5KK1 A;  3ISP A;  3J81 K;  4IHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...