1BM9A

Replication terminator protein from bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
b'EEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REPLICATION TERMINATOR PROTEIN
publication title Crystal structure of the replication terminator protein from B. subtilis at 2.6 A.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 41
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bm9A00
2EA4A 2MBFA 1ZRDA 3L00A 3RDIA 3TOBA 1JHHA 5DUKA 5AIPA 4HOBA 2HS5A 3CDHA 2FBIA 4BXUA 1ON2A 3K9TA 4HV6A 4EVIA 1OMIA 2V79A 2DU9A 1QZZA 2FBHA 4KN7X 2HOEA 3HHHA 4LG0B 2L4MA 4RB0A 2NS0A 4EQQA 3U9GA 5LGTA 2EFOA 1TTYA 5H6RA 3KLNA 3SZPA 3LA3A 2VE9A 2Q8KA 2UXNA 3ULQB 2VOOA 1YQAA 1WKMA 3J80K 2G7UA 2KKOA 4KIGA 4LD5A 2EFWA 2F5CA 1YG2A 3QRFF 4HLXA 3TO7A 4JK1X 1IAWA 2H27A 3K1NA 1OKRA 1SAXA 1RI7A 4HBLA 4ZZLA 1EH6A 4KIBA 2DAOA 3GO5A 1HSTA 1SD6A 4L0ZB 1FP1D 2VOPA 1KYWA 5HLIA 1IXRC 3KZYA 1KA8A 1H9GA 1YLFA 3DPLC 1R5HA 3I53A 3J80Z 2EFPA 1W5SA 3CO6C 4XSZF 4KN4X 5H20A 3ERED 3VB2A 5BQTA 2E1CA 3E6DA 2IW5A 3F8NA 2EV0A 5ERIA 1BN5A 4MQVA 1G3TA 5A2QZ 5D5VB 5HS7A 4RGXA 2QYOA 2UXXA 1RIOH 3TOAA 5E17F 1ULYA 2QBYB 2NNNA 1C0WA 3NRVA 5F6FA 4G8XA 2CGPA 1R23A 1MDMA 2IP2A 1G3SA 1MGTA 4FX0A 2O6GE 1S8NA 3J81K 1ZLKA 4IVNA 2YR2A 4S04A 1TQPA 1O3TA 1CF7B 4YG2F 1RUNA 2EK5A 4A0ZA 3TO6A 4M71A 3F8MA 3RKYA 3KP5A 5E18F 3WTWC 2COMA 5BS6A 3IKTA 1B6AA 1BOAA 1JXSA 3M8EA 1EH8A 1U5TA 2DQRA 4AVPA 4CXFA 1YW8A 1B9NA 2ELHA 1FX7A 5HDKA 4ESJA 2E7WA 4IHTA 5J8FA 4WXCA 2IRFG 3DFGA 3FXQA 2P5KA 3BWGA 1BIBA 3K1PA 1P6RA 3MZHA 2A68F 3ROUA 5EEGA 1YS7A 1JE8A 4LFUA 1IUYA 1UB9A 3HRUA 4TV7A 1QNTA 2RN7A 1FYMA 4AD9A 2V6CA 1DPUA 1XGSA 4EGZA 4B09A 4M9ZA 2DI3A 4HX7A 2OZUA 3SQNA 1GXQA 4L9TA 5BPDA 4U88A 2CG4A 1FP2A 3DKWA 4HX8A 3RI4A 3ZMSA 3CLOA 4AIHA 1HKSA 1IRGA 5L3DA 3ZP5A 1HKTA 4QWQA 1U6GA 1G3YA 3WG9A 5D6EA 2CQKA 3Q5FA 1A04A 2PJPA 1I5ZA 4Q4ZF 3LWFA 1ZRCA 2HGCA 3D5LA 2Z33A 4KICA 3CJNA 3ZMTA 3LA7A 3COAC 3QAHA 3P9CA 3DV8A 1S6LA 1LDKB 4I01A 4BHBA 5J6XA 2M45A 1ZREA 1SD7A 2V9VA 4RAYA 3R0AA 2FOKA 1PUEE 3ELKA 4ENMA 5DDGA 4WXDA 5LRRA 3IHUA 1KQ0A 2O3FA 2IT0A 1R7JA 2P7VB 3F6OA 1YIOA 2FE3A 4U0VA 2D2WA 3EDPA 1T38A 3RPUA 1OYWA 2KJCA 1X3UA 1XN7A 1TW3A 1FSEA 5LGNA 2W25A 2HWVA 1SD4A 2FA5A 2HFHA 2V1UA 1FY7A 4L0YB 2O0YA 2HQNA 3IWFA 2XV4S 2CWEA 3KETA 1ZH5A 5FLXZ 1S7AA 3ZQ7A 4Q5SF 1I1SA 5HS9A 1W7PB 3FXRA 4L18B 3Q9SA 2XAJA 2VBWA 1EH7A 2EA2A 2PBIA 1SMYF 4CZZA 4EMSA 3GVAA 5ILVA 2PEXA 3O2PE 3LAJA 4L5JA 3F72A 5ICGA 3WU0A 3FF5A 5DD4A 5E1ZB 1B4AA 4RB3C 2XAFA 5DEQA 3SHFA 1S7OA 4LK0F 3I4PA 3RJPA 2YPRA 4HZFA 1WRJA 2K7LA 1CGPA 4L9JA 2DT5A 2O61A 2Z3YA 3CO7C 1O3QA 2FMLA 1U78A 2XAQA 5LGUA 5K5QA 3K0LA 1BI3A 5DCFA 4L9NA 4U0WA 1IN6A 4PZJA 4LG0A 1D5VA 2NAZA 3LA2A 1ZG3A 2OQRA 2M5WA 4WXHA 3F6VA 3WTVC 5ICCA 3N4MA 1RZ4A 1ZARA 3LQQA 2O8XA 1K78B 4G6DA 4WCGA 4XBFA 1R36A 4OINF 3BROA 3WE2A 4DQ2A 4YIFA 3V4GA 1GVJA 3NEUA 2HZTA 4EJTA 2DFIA 1K79A 3WODF 3EUHA 2DQLA 4IF4A 4QLCU 3E6MA 4A2UA 1ZAOA 3HSRA 5CVVA 5L3EA 2V1DA 3WU1B 2WC2A 5FD6A 4KFCA 2M87A 2FBKA 2PFBA 1LDJA 3O3KA 4LLLA 3BY6A 4A6EA 4YFKF 4FT8A 2D1VA 4KUMA 2EB7A 1MJBA 4LB5A 3MZYA 2NNYA 1IN8A 2OBPA 1V4RA 2MC3A 1S3JA 3DXJF 2XIGA 1BI0A 4U7BA 5J8CA 1MKMA 3MEXA 2DK8A 3FMRA 2FXAA 2ZNYA 1K6OA 4GO1A 2Z99A 1OYIA 2PG4A 1LNWA 4A5MA 5BPIA 2E7XA 3VODA 4PGHA 3VFZA 1LDDA 5K5RA 3V8LA 3V7RA 4WX9A 1Y0UA 5FB2A 1YS6A 3BPXA 4OU0A 2K86A 3T5XA 2IA1A 2QBYA 4KNYA 4PGGA 4A5NA 2W24A 1ONVA 2HQRA 2CO5A 3S2WA 3HSEA 2ESNA 3C1DA 2Q0OA 3V7SA 5KK1A 1SMTA 5CVIA 3QPTA 2B0LA 5TJJA 4EM1A 1P4AA 1J5YA 4CO8A 5DYMA 4MEYF 5LEKA 5FO5A 1FLIA 3WTTC 4UVBA 4YFXF 1R22A 4XSXF 2ESHA 1CF7A 3E5XA 1SFXA 5F64A 2MH2A 5DUIA 2J5PA 3WE3A 3QP6A 2XKOA 4ESFA 5HS8A 5LHGA 1FBUA 2FU4A 5A2QK 4KMUX 1XGNA 2O03A 1D8JA 4ASNA 2G9WA 3ZMZA 1P4WA 1IRFA 1ZN2A 2IVMA 4IHSA 1LVAA 4I0AA 1I6XA 2VT3A 5D8LB 1JHFA 1U5TC 3ML6A 1UFMA 1RNLA 3HOSA 1BIAA 2D1HA 1BM9A 2XHKA 4UV9A 2QLZA 4Y17A 4HLYA 2ETHA 5LEJA 2VN2A 1TQIA 4LK1F 1XCVA 3BPVA 1HBXG 1FPQA 1ODDA 2FEZA 5ICEA 3F23A 5FGMA 2XUBA 4M9SA 5CVUA 4IRGA 4G6QA 2RNJA 2KIMA 4UHTA 2GA2A 3J7AO 3P9IA 1AWCA 4P5OA 3HTSB 2F5FA 4IRHA 1P92A 3GFJA 3SXYA 2QWWA 3OV8A 1I1GA 3GFIA 4M73A 2ADUA 4ENJA 1R1VA 4HW0A 1T98A 5TRDA 2MLKA 2BV6A 1PP7U 4G7HF 2RC4A 1LEAA 4M6YA 2QENA 3JAMZ 2BGCA 2MH9A 3CTAA 3JSPA 1UHMA 4R8HA 3L2CA 3T8TA 2VC0A 4LB6B 2PI0A 1XGMA 3SFZA 3TDZC 1B59A 5L3CA 2VODA 3CUQA 1DP7P 3DP7A 4GYGA 3GF2A 2A61A 4D0PA 4U0YA 3MFKA 4BQAA 3D0SA 1EV7A 4MTEA 4HF0A 4PCQA 2XKPA 4KT5C 1Z6TA 5E8GA 3IL2A 1B1BA 2VONA 4ZYEA 1DUXC 4I09A 2ACJA 2A69F 2FSWA 2M8EA 2FNAA 1G3WA 3ISPA 1IZ1A 5D5XB 2PLYA 2LF8A 5D4SA 1FBSA 3WTUC 3HOTA 4GYIA 2IJLA 2JSCA 1YTYA 4N9IA 2OZ6A 3T0YA 3GEZA 2BBYA 2RQPA 2XAGA 1W7PA 4BNCA 4HF1A 2Y0MA 4AIJA 3EYYA 1SFEA 1QZYA 3FWEA 4R79A 1P4XA 1ZGJA 1F1ZA 4HDVA 1JGSA 3BP8A 3TKYA 3R4KA 3G3ZA 1FOKA 5HOOA 3V8JA 3ZMUA 3F8FA 4RB2C 4Y13A 1TNTA 2YX7A 1BC7C 3KP7A 3LFKA 3HYIA 1MDMB 2LSOA 5D6FA 1ZG1A 1FC3A 2STTA 2ZNZA 1LJ9A 3JW4A 4H0EA 1XSDA 3BDDA 2WWYA 4HYEA 5JR3A 4HDUA 3F8CA 4M6XA 2QQBA 4ZH4F 2F5EA 1SFUA 3R61A 4ZZDA 5HLGA 3RKXA 1L0OC 5FLXK 2ZO4A 3G73A 2AXLA 1BBYA 1G6NA 1TW2A 3CUOA 3QP5A 2RKHA 4OOIA 4G94A 4XLPF 1TQMA 5L3FA 2HYFA 1Z1DA 1MD0A 3M1EA 1REPC 1U5TB 2BYVE 3MCZA 1K78A 1PP8F 3I59B 5DD8A 2A6HF 2UZKA 4M72A 5DCMB 4OIPF 1F4KA 1XMAA 1O3RA 5CLSA 1RUOA 2L3DA 5K5OA 3ZN1A 4RB1A 2AS5F 3M8FA 3L9FA 1QGPA 1WSUA 5L3BA 3GLXA 2EV6A 1ZGAA 2HEOA 1R58A 1D8KA 4CHUA 2A3SA 1R00A 2VE8A 3GWZA 1LQ1A 1ZYRF 5IT9Z 3WTXC 1J0RA 5D5UB 2DTRA 3H3UA 3F3XA 1J75A 2K4BA 2KIUA 4B8XA 1Z6RA 2UWMA 4I0BA 3ECOA 2A6EF 4WWCA 3W6KB 1WWXA 2EJRA 2VBXA 1KU7A 4HF2A 5LRSA 4NB5A 2FQ3A 5HDGA 3I64A 1L3LA 1BC8C 2DPDA 2H94A 1XMKA 3LQRA 2ZCWA 3WTSC 1MJ9A 4WK8F 1VTNC 2ZKZA 1T6SA 2CYYA 2L01A 4KMFA 1ZRFA 1KU9A 2M1BA 4YIIA 5E8IA 3FXUA 2HKOA 3B73A 3L7WA 2ZBKA 1O57A 1YO5C 4A0YA 2V1XA 4G7OF 3IC7A 4KYWA 2W84A 3LSTA 2X4HA 2QQ9A 3KP2A 5CJ9A 1DPRA 3IRRA 4ENKA 1TBXA 3LAPA 4CDGA 3U2RA 3RIRA 1MJAA 5EEHA 2DW4A 2DO7A 2HTSA 2RV8A 4OIRF 2QUFA 4UUVA 4BYYA 1KU3A 3GFLA 2K4JA 3GZ6A 2ZMEB 3HRTA 3HIFA 2Q2EA 1J2XA 1QBJA 3KLOA 3BJ6A 2P6SA 3ECHA 4EJUA 2VT2A 3RPQA 2Y75A 3K1MA 3N97A 6PAXA 4LLGF 5KVRA 2Y48A 3KZZA 3JTGA 2L54A 3QU3A 3PFIA 4OIOF 4RS8A 2D45A 2IA2A 2EV5A 2JT1A 2GA1A 3KE2A 4LGWA 3RYPA 1BJAA 4S05A 4P55A 3E3VA 1U8RA 2P8TA 4IRIA 4GCVA 3K69A 1IN7A 3M9AA 2GAUA 1R5GA 3PQKA 3BJOA 4P96A 1KGSA 2P7CB 2YSRA 3TDUC 4F7ZA 2L02A 1XSVA 1HKQA 5K1YA 3WGHA 1XCBA 1KYZA 4MHGA 1YW7A 2OU2A 4HV5A 1GHCA 2XAHA 5IT3A 4CICA 5E1XA 1XDSA 4A12A 4HX4A 2JPBA 4MQ9F 4LMYA 4G7ZF 1NHAA 3F8BA 2CW0F 3GZ5A 2FNPA 5AONA 3HHGA 2KJBA 3H3ZA 3HUGA 4UXNA 1HW1A 3E5QA 1KQ9A 4EGYA 2PQ8A 2K02A 3HSFA 2EWNA 3BZ6A 2XASA 3WGGA 5HVQC 1F9NA 3REOA 2NYXA 2C6YA 1T2KA 4A6DA 2FRHA 5ILSA 4UVAA 1TLHB 1U2WA 3HRMA 2GIVA 4AIKA 4O6JA 1R1TA 2VBYA 3CUQC 4Q48A 2FMYA 3V7CA 2F5DA 2OQGA 3DPTA 2KRFA 2OD5A 5L3GA 4AWXB 3GX4X 1W5TA 5BOXA 4LLNA 4ZYDA 2ISYA 1E2XA 1FNNA 4ZYGA 4ON0A 2W85A 5ILUA 4KA4A 1R1UA 2LNBA 1OR7A 5JHUA 2GXGA 3JAMK 2F2EA 4EM2A 4L5IA 1ZLJA 3EETA 1XDUA 1S29A 3FM5A 4JQFA 3AAFA 2WTEA 4RAZA 2X0LA 1HQCA 3P9KA 3R0JA 2GQQA 3FX3A 3KFWX 4M9XA 2JZYA 1KQ8A 3O6BB 2KIFA 2Z5UA 1FWZA 2G7HA 2NRAC 2P6TA 2CSOA 3T1BA 3PQJA 3TO9A 3HTUA 2WV0A 1G4DA 4MEXF 3GFMA 3R6SA 4O5VA 4ESBA 2L4AA 3FZVA 1KU2A 3FHZA 1FYLA 1UHWA 4UNOA 3I71A 4K2EA 3E6BA 3ABTA 2LKPA 3QU6A 4EM0B 4UV8A 2LDUA 1OYYA 3E97A 1P2FA 2P5VA 1D3YA 2P5LC 1I27A 3GXOA 4PDKA 2MD5A 4WF2A 3KP3A 2DPUA 3E5UA 2HYGD 4UVCA 4BHPA 2EFQA 2MLGA 2PMHA 3WTYC 5LHHA 4CGZA 4ENNA 2VXZA 2XRNA 4U7DA 5CVJA 2IA0A 1QQIA 3NQOA 1IN4A 2ZFWA 3H92A 3KP4A 5DV5A 1LEBA 2H6BA 3GW2A 3QPHA 3I59A 5DCMA 4R1HA 3KCCA 1FZPB 3J81Z 3QOPA 2H6CA 4RGUA 4BH9A 5E20A 5H6QA 2PN6A 3EYIA 3E6CC 4NQWA 5CYVA 4N9HA 4FX4A 3TQNA 2Z9OA 5D5WB 3OOPA 3WTZA 3VEPA 5ED4A 1HW5A 4EJVA 5F1RA 4OMZA 3ZPLA 2H09A 4Q47A 2OA4A 5FFXA 1H9TA 4BAYA 2IPQX 3IWZA 3KEOA 4RGRA 4GXOA 1Z9CA 4I02A 1Z05A 2OAZA 4L9VA 1TNSA 4MGRA 4HQMA 1WI9A 3U1DA 4HQEA 1GXPA 3ZN0A 2E1NA 4OIQF 5AIQA 3Q9VA 3BOQA 2STWA 4GGGA 5JFRA 3I0TA 5FD5A 2M30A 4YFNF 2BE5F 3P7NA 3F22A 4HAMA 3ZMVA 1UCRA 3ZMDA 1YFHA 4I7HA 1BI2A 1O3SA 1BI1A 1AOYA 1HXDA 1HSJA 4FHTA 3WGIA 3V8KA 2YX4A 2QZ8A 3TGNA 1V3FA 3CUQB 1O7FA 2HKXA 2A5YB 1YYVA 2RVCA 4EJWA 5IT9K 5LBQA 3EQLF 2TDXA 1ZG5A 1DDNA 4IXAA 1XB4A 2DBBA 3MWMA 4P9UA 2ZXJA 1J59A 2VC1A 3MQ0A 5LLQA 1STZA 2GWRA 5D8KB 3GUDA 2ZMEA 1FT9A 4KIFA 4OMYA 4BHCA 3RTRA 4ETSA 5FFZA 1XD7A 1USTA 2XVCA 4NHJA 1B9MA 3W6JB 2JPCA 1XSXA 4MNUA 4EV0A 5JI6A 3HRSA 1FYKA 5LHIA 2BEOA 1H0MA 4XLNF 3FM3A 3I5UA 1Q1HA 4I98B 2HTJA 1XGOA 4I2OA 1IXCA 3ABUA 3FMQA 1QPMA 3GYHX 3DF8A 1ON1A 1PDNC 1T39A 1W4MA 5JVTA 5ICFA 4G9YA 2A07F 3IRQA 1YW9A 3BJAA 2JTVA 2R7DA 2K27A 4IJAA 4E70A 4Z2YA 1LB2A 2DK5A 5D4RA 2P4WA 4EJOA 3RKWA 2VBZA 2XROA 4XRFA 2RGVA 3DQVC 2J5OA 4M74A 4N0BA 1HW2A 1WQ2A 3F21A 2QVOA 3JSOA 4A0XA 1OPCA 3R60A 2R3SA 3I58A 2DLLA 4KDPA 2JRTA 4O3MA 2MA3A 2QM3A 3SZTA 3C7JA 1J9IA 2PMUA 2GXBA 1U3EM 3C18A 3I54A 1QO0D 1SD5A 5E1WA 4LJZF 2R7FA 2HDCA 1Z91A 3RYRA 1USSA 4IPAA 5HLHA 3M7GA 2EFNA 1IN5A 4ZYHA 2CFXA 4DNCA 3DEUA 2FF4A 3T8RA 1K7AA 3C3WA 1FSHA 4MTDA 3L09A 2HR3A 2LF7A 2W57A 3IKVA 4RGSA 3FMSA 1E17A 1MZBA 1O7LA 1ZHFA 2ZJ2A 1Z7UA 4CYDA 1F5TA 5CVRA 3K2ZA 1T0FA 3JTHA 1IF1A 2RDPA 2GZWA 2YU3A 5BMZA 3MAJA 3VOEA 1IW7F 1IXSB 2XGXA 4JBAA 2ISZA 1FBQA 3B02A 4Y15A 2QQAA 4P9FA 5HDNA 4HA8A 1W7PD 1J7KA 3KP6A 3KEQA
chains in the Genus database with same CATH superfamily
2EA4A 3OYNA 2K40A 1BR1A 2MBFA 1ZRDA 1ZR2A 3L00A 3RDIA 4YRVA 3TOBA 2P81A 1BJZA 1JHHA 1WJ5A 3K6GA 5DUKA 5AIPA 3H3VK 4HOBA 3S15J 2HS5A 4DW6A 2XPUA 4XLAA 3CDHA 2FBIA 4BXUA 1ON2A 5J3LA 3K9TA 4HV6A 4EVIA 4D7NA 1OMIA 1D1BA 3HKZN 2V79A 2DU9A 1QHGA 1QZZA 2FBHA 5M3FJ 4KN7X 3WG7H 1FTZA 2HOEA 3HHHA 1WHUA 2KQRA 4LG0B 2HVRA 4U87A 2L9RA 2L4MA 4RB0A 2NS0A 4EQQA 3I56I 3I4NJ 3U9GA 5LGTA 2EFOA 1TTYA 2Y0SN 3JRHA 3TEDA 2HOSA 1V54H 2OJED 5H6RA 4DBQA 2JN6A 3KLNA 3LA3A 3SZPA 2VE9A 4E7LA 1VQ5I 2Q8KA 1N77A 3VWBA 2IS2A 1TWGJ 4UY8I 4XONA 1XX5A 3QWLA 2DA7A 3D5SC 2UXNA 4CZCA 2OTLI 3ULQB 5EGOB 3K4KA 2WY7Q 2L7FP 1T56A 2VOOA 3EUKL 2R7OA 3QOEA 5EZHA 2QEXI 4XKBA 4XRMA 1YQAA 1WKMA 2X1CA 4XMYA 1ZTRA 3J80K 2G7UA 2KKOA 2JMWA 4KIGA 4HSTA 4LD5A 2EFWA 2F5CA 3FK6A 1K61A 1YG2A 3QRFF 2BHZA 3K4CA 4HLXA 2VQCA 3TO7A 4AC0A 4JX4A 1RR7A 3CCRI 4JK1X 3OMYA 4PJ0C 4XKWA 4QIWN 4YIRX 1IAWA 1I6HJ 2H27A 5F04A 3K1NA 1OKRA 2LY9A 3DPUA 1SAXA 1RI7A 3CJQB 4HBLA 2JVGA 3DEEA 3DBRB 4ZZLA 1EH6A 4KIBA 1OCOH 2DAOA 3OYAA 1OQYA 3HC7A 3GO5A 1HSTA 1MH4A 2MGQA 1SD6A 2R7UA 4L0ZB 3LFUA 1JUPA 1FP1D 3Q3SA 2VOPA 1KYWA 4I99C 1MBGA 2VKVA 1XG1A 3S93A 5HLIA 3H9GA 1IXRC 2B9SA 3KZYA 3DTIA 1R71A 1KA8A 1H9GA 1W1WE 1YLFA 2XGEA 3DPLC 4F3QA 4C2UA 1R5HA 1Z67A 4FE4A 3I53A 1WGXA 5C3EJ 3J80Z 2DCEA 2LH9A 2ZFUA 1G8XA 2EFPA 1W5SA 1LE8A 1IGNA 5M5YJ 4KJZA 3CO6C 4IEJA 4XSZF 4IQJA 4KN4X 5H20A 2IGOA 4S0HB 3ERED 3VB2A 2VIXA 2VQLA 5BQTA 2VASA 3MKLA 3OYJA 2E1CA 1LVKA 2XC7A 3E6DA 2IW5A 3CDIA 3F8NA 4XM3A 3OYBA 3SJMA 2CMPA 2EV0A 2VKHA 1BN5A 4MQVA 5ERIA 3A01A 2CW7A 1G3TA 5A2QZ 5D5VB 5HS7A 3LSKA 4RGXA 4ABZA 2RREA 2QYOA 2UXXA 4PJJA 5E3NA 1RIOH 2M9HA 4G6TB 3TOAA 2ID3A 3VYUB 5E17F 1ULYA 2FQ4A 4NNJA 2QBYB 2R7WA 4M3DA 1XS9A 2M3AA 4YEJA 3DEWA 1EF4A 1FOXA 2NNNA 1C0WA 3NRVA 5F6FA 4QTRA 1X4OA 4G8XA 1K4SA 2CGPA 4JYKA 3IP4B 3A4CA 1R23A 1A31A 1MDMA 2ME6A 2IP2A 1G3SA 2WY8Q 2RAEA 1MGTA 4UUTA 1WCMJ 4DYCA 1HDDC 4FX0A 1WFXA 2O6GE 1S8NA 3KIOA 5E3LA 2R7SA 3HUGB 4ITVA 3FISA 1PYVA 3J81K 5GTHC 1ZLKA 4IVNA 3J7YJ 2YR2A 3CMEI 2DMTA 4S04A 1TC3C 1TQPA 1Z77A 1VQMI 1Y0NA 1O3TA 1CF7B 2R7QA 4YG2F 1H89C 1RUNA 2EK5A 4HPQA 2ZJQF 2E1MB 4A0ZA 1Z3XA 2PMZA 4PK4A 1I3QJ 3TO6A 4UUSB 4M71A 3F8MA 2P0WA 1I3AA 4PSXA 2OCEA 3CMAI 3RKYA 4A3IJ 1W0TA 3KP5A 5E18F 3WTWC 2E71A 1GV2A 3PIOF 1OCPA 2COMA 5BS6A 3IKTA 1Q1VA 4KISA 1B6AA 1BOAA 3FBNB 1JXSA 3M8EA 3VYRB 3S3MA 1VFCA 2EILH 1EH8A 1U5TA 2DQRA 4NUBA 4AVPA 4CXFA 2NVQJ 1YW8A 1B9NA 3J7AY 1YI2I 2ELHA 1FX7A 5FLVA 1BW6A 5HDKA 3L2VA 5FJ8J 4ESJA 2E7WA 4IHTA 1DQUA 5J8FA 4WXCA 1D1CA 2BW3A 3DFGA 3W2WA 2IRFG 3FXQA 2P5KA 3BWGA 3TMOA 1VQ6I 2F4OB 1BIBA 3K1PA 1H88C 1P6RA 3K7AJ 2GM4A 3MZHA 4MO7A 3FDYA 1D0YA 3PNTA 2A68F 3OYCA 1RC9A 2DODA 3QPLA 3ROUA 3OYKA 2KRHA 5EEGA 1ETOA 1YS7A 2ZMEC 1JE8A 4LFUA 1IUYA 3HPGA 4ZJZA 1UB9A 3GZNB 3HRUA 2WB1A 4TV7A 1QNTA 2RN7A 1FYMA 4AD9A 4Y3OA 4H4KC 2V6CA 3B6AA 4FTHA 1JT0A 1WVRA 1DPUA 3HGGA 2VJIA 1B72A 4DYRA 4DZJA 1PVEA 1XGSA 4EGZA 4B09A 2JRMA 2VKEA 4M9ZA 2XF7A 2DI3A 3OIPA 2OZUA 4HX7A 1GXQA 4L9TA 3SQNA 1GVDA 5BPDA 4L5EA 4U88A 1YRNA 2CG4A 1FP2A 5IOYA 3DKWA 4A93J 4HX8A 5FKOA 2Y2ZA 3RI4A 3ZMSA 3CLOA 4AIHA 1HKSA 1NH3A 2CJJA 3AKZA 2VJ4A 3O8GA 1IJWC 1IRGA 4GFBA 1R49A 3LSPA 5L3DA 3ZP5A 1HKTA 4QWQA 1U6GA 1TT0A 3GMEA 3A1YA 1G3YA 4N4OB 3WG9A 5D6EA 2CQKA 2W1OA 4QSHA 3L2RA 3Q5FA 1A04A 2WADA 3Q0VA 2PJPA 1I5ZA 4Q4ZF 3LWFA 4Y33A 2KP6A 1ZRCA 5B3SH 2HGCA 3D5LA 1JT6A 2Z33A 3PSIA 2PJRB 4KICA 3CJNA 3ZMTA 2K3PA 3KEQA 3LA7A 3U1KA 3COAC 3CF2A 3QAHA 3P9CA 1K83J 3DV8A 1S6LA 1LDKB 4I01A 4A3CJ 2AQFA 4F91B 3ZR8X 4BHBA 5IPAA 5GAHJ 1ZGWA 9ANTA 1TL8A 2IBDA 1MMDA 5J6XA 2M45A 3L2WA 5J4YA 3K4NA 1ZREA 3S1NJ 2VB6A 4JX5A 4BEHA 3OR1C 1SD7A 4XKCA 1HDPA 2V9VA 4RAYA 3R0AA 2FOKA 1MBFA 2RQQA 1ZR4A 1IG7A 1PUEE 3ELKA 4MIMA 4ENMA 5DDGA 4WXDA 1QHHD 5LRRA 2XSDC 1MMGA 3IHUA 3OOUA 3FHNA 1KQ0A 3BG7A 2O3FA 2IT0A 1R7JA 2P7VB 3F6OA 1YIOA 2FE3A 4U0VA 3M07A 2VL8A 1VNDA 5C4XJ 1E0EA 3H5AA 2D2WA 3EDPA 1T38A 4EATA 3RPUA 1OYWA 3CCUI 2EZKA 2KJCA 1ITYA 1X3UA 1XN7A 1IO2A 1TW3A 4AYBA 4BDYA 1FSEA 5LGNA 1NG7A 5EG0B 2W25A 2HWVA 1SD4A 2FA5A 2OC6A 1QU3A 2HFHA 2V1UA 1FY7A 4L0YB 2O0YA 2NVUB 2HQNA 3IWFA 2XV4S 2CWEA 5DM7F 3KETA 4BDZA 2JA8J 2NVXJ 2A6TA 1ZH5A 5FLXZ 1S7AA 3ZQ7A 1MIJA 4NQWB 1JGGA 4Q5SF 1BOBA 1I1SA 4A3KJ 5HS9A 5EEAA 1W7PB 5FKNA 3FXRA 4L18B 2TCTA 4BGDA 1MSEC 4CYCA 3Q9SA 2XAJA 2VBWA 1EH7A 2EA2A 2PBIA 2JUCA 2XRLA 1SMYF 4CZZA 2ZSHB 4EMSA 4HNTA 1YIJI 3MMYB 3GVAA 5ILVA 2PEXA 3O2PE 1MH3A 3LAJA 2DXIA 4L5JA 5E79C 3F72A 5ICGA 4AVZA 3WU0A 3FF5A 2FJ1A 5DD4A 2BY1A 5E1ZB 1B4AA 3SHFA 2XAFA 1S7OA 5DEQA 4RB3C 3CCEI 1DP3A 2YS9A 1T0FC 3I4PA 4LK0F 3RJPA 1N78A 2BZTA 2YPRA 4XRSG 2CUZA 2L2OA 1PUFB 3G4SI 3H9JA 4HZFA 1WRJA 2K7LA 1CGPA 4L9JA 1WPKA 2DT5A 2O61A 2Z3YA 2VJ5A 3GTJJ 2GOXB 5J4VA 4FISA 3CO7C 1O3QA 2FMLA 4CCNA 3AFHA 3ASNH 2DOEA 1U78A 1X1DA 3FXMA 2XAQA 5LGUA 5K5QA 1UZCA 4GRIA 3K0LA 1NK3P 1BI3A 5DCFA 4L9NA 4XLCA 4U0WA 1IN6A 4PZJA 4LG0A 2NVTJ 1D5VA 4CA0A 2NAZA 3LA2A 1ZG3A 4NBQA 4C30A 2OQRA 4KITB 2H8RA 3N05A 1FIPA 5HLTA 2M5WA 4WXHA 3F6VA 3WTVC 5ICCA 4DBRA 4C3JJ 3N4MA 4G12A 2LP0A 2WAQN 3QPSA 1RZ4A 1ZARA 3MKZA 1T33A 4LIUA 3LQQA 3OIQA 1JKQC 3CZ6A 2O8XA 2MYSA 5EGOA 1K78B 4G6DA 4WCGA 3HG9A 4A69C 4XBFA 3S32A 1R36A 1G2HA 3PL8A 3BROA 4OINF 1GT0C 3WE2A 1IC8A 4DQ2A 4BJTA 4YIFA 1SAUA 3V4GA 5KNLA 4ZDOA 2UUZA 5FKLA 1GVJA 3I3LA 1R6RA 3NEUA 2HZTA 4EJTA 2DFIA 4CCLA 4D7MA 1K79A 5J1RA 3WODF 3EUHA 2DQLA 4IF4A 4QLCU 3E6MA 4A2UA 2Y69H 1ZAOA 4I76A 1X19A 2EZLA 1BL0A 3HSRA 4E4HA 5CVVA 3OSFA 3TW7A 5L3EA 2V1DA 1S7EA 5EDNA 3WU1B 2LOOA 2WC2A 5FD6A 4KFCA 2M87A 2HNHA 2FBKA 2PFBA 2QSFX 4E7KA 4HSRA 1LDJA 5IYCJ 2AO9A 3O3KA 4LLLA 3BY6A 2YU9J 4A6EA 5F0HA 3C2HA 1LFUP 4YFKF 4B1RA 4FT8A 2D1VA 2LK2A 1K4TA 2BY3A 4KUMA 2EB7A 3FBIB 1GDTA 1MJBA 1U9NA 4LB5A 3MZYA 2NNYA 3FIWA 3M3YJ 1IN8A 2ECCA 2OBPA 3HL2A 1V4RA 3W2AA 2XPVA 2MC3A 1S3JA 2DA3A 2E35A 3DXJF 3QQAA 2XIGA 2LD5A 1BI0A 4U7BA 4XLFA 3PUFA 5J8CA 1MKMA 3MEXA 4CCMA 2DK8A 2NXNB 3FMRA 2FXAA 3GTOJ 2ZNYA 4AM3A 1K6OA 4GO1A 2Z99A 1OR7C 1OYIA 2DA4A 2PG4A 2W4SA 2R5ZB 1LNWA 4A5MA 5BPIA 1XPXA 2E7XA 2L9VA 3VODA 4PGHA 3VFZA 1LDDA 5K5RA 1SVLA 3WHBA 2DA6A 3V8LA 4E7HA 1VQ8I 1TWHJ 1ZQ3P 3V7RA 5IYBJ 3VYTB 4WX9A 1Y0UA 3NARA 1W5CC 5FB2A 1X4PA 1YS6A 1N75A 2OTJI 3BPXA 2XB5A 4AIDA 1WJCA 4OU0A 3PO2J 2K86A 4LG3A 3T5XA 2IA1A 3CJTB 2QBYA 1X1BA 2O9LA 4KNYA 4PGGA 4A5NA 2W24A 3RCOA 1ONVA 2HQRA 3JREA 3RZDJ 4JOMA 2ICWG 2TRTA 3BR2A 4E7JA 2CUFA 2CO5A 3RQIA 4DGWB 2X51A 1ETXA 3S2WA 2XF6A 2L7KA 3HSEA 2ESNA 2MABA 3C1DA 1UHSA 2X6XA 2Q0OA 3V7SA 4X0GA 1RRJA 5KK1A 1SMTA 3MKWB 2FUG2 5CVIA 3QPTA 2B0LA 5M5WJ 1J09A 5TJJA 1A36A 2HDWA 4AUXA 4EM1A 2JVHA 1P4AA 2KMUA 1J5YA 1DU6A 3HOVJ 4UB8C 4CO8A 5DYMA 4MEYF 5LEKA 5FO5A 1FLIA 3WTTC 4UVBA 3ABKH 4YFXF 1R22A 2MG4A 5GTIC 4XSXF 4ZTJA 2JWTA 2Q2EB 4II3A 2ESHA 1CF7A 2V9KA 3E5XA 2LREA 4NC8A 1SFXA 5F64A 1SVOA 2KISA 1I50J 2Y9ZA 2MH2A 5DUIA 2J5PA 3WE3A 5IOZA 3QP6A 2XKOA 3GBGA 5GADJ 4ESFA 2LVSA 4UUSA 5HS8A 1NTCA 1JTYA 3KYLA 5LHGA 2QA4I 1FBUA 2FU4A 5A2QK 4KMUX 1XGNA 2DA1A 2XB0X 3CCSI 2K9NA 2O03A 1D8JA 3ABLH 1FJLA 2CQNA 3IH2A 1ETYA 2E2HJ 4ASNA 4X1EA 5FKMA 2G9WA 2CV1A 2W82A 3ZMZA 1P4WA 1IRFA 1ZN2A 2FX0A 2IVMA 3BR5A 4IHSA 1LVAA 2V26A 4I0AA 5IP9J 1I6XA 2M2EA 2VT3A 5D8LB 1JHFA 1U5TC 3IAS2 1Z7LA 3E1SA 3ML6A 1UFMA 2OPTA 1RNLA 2X85A 3ABMH 3HOSA 1CQTA 3NWTA 1BIAA 2D1HA 1BM9A 2Z1DA 2M4KA 2XHKA 4UV9A 4V2FA 2Y31A 2QLZA 1U8BA 1UG2A 4Y17A 5IY5H 4HLYA 2DMNA 2X6OA 2ETHA 1MNEA 5LEJA 2VN2A 1FTTA 2E34A 3QODA 1TQIA 4LK1F 1ZKGA 1AKHB 1XCVA 3BPVA 4HNVA 5DTDA 5EJCA 3OYFA 1HBXG 3E7LA 2JQ7A 1FPQA 1ODDA 2FEZA 2HQ5A 5ICEA 3F23A 5FGMA 5J40A 4DIQA 2VJJA 2XUBA 3ZCOA 4M9SA 3BR1A 3F0CA 5CVUA 4PJLA 3QYEA 4IRGA 4Y52J 3I9V2 2AXTC 2E2JJ 4G6QA 5HNHA 3OWTA 2PMZN 4IZZA 2RNJA 1MBEA 2I10A 2KIMA 5GPAA 4UHTA 2GA2A 3J7AO 3HEFA 3P9IA 3HBLA 4BS9A 4P5OA 3JRAA 1AWCA 3HTSB 2F5FA 4IRHA 3OR2C 3UKGA 2EBIA 1P92A 3S16J 3SEZA 3ZRGA 2KZGA 3CESA 3GFJA 3SXYA 2QWWA 3OV8A 1F43A 1I1GA 3GFIA 4M73A 2W7NA 2ADUA 4ENJA 1R1VA 3CP8A 3M1CA 4HW0A 2GIZA 4A3BJ 1T98A 5TRDA 2MLKA 2BV6A 2V4JC 5M3MJ 1PP7U 2NVYJ 4G7HF 2RC4A 4CH7A 1LEAA 3H9QA 1Y56A 1SFOJ 1P7IA 4M6YA 2JUGA 2QENA 1GV5A 3JAMZ 2BGCA 3BQYA 2DJNA 1XC5A 2MH9A 3CTAA 3A2KA 1H8AC 3OYMA 3JSPA 4D5CA 1UHMA 4BQOA 4R8HA 1FMVA 3O8HA 3UR3C 3L2CA 3S3NA 3T8TA 2KZVA 3AL0B 2VC0A 4A3EJ 5B66C 4LB6B 2PJRA 3ZQQA 1T08B 2HXIA 2K5CA 2PI0A 2BHYA 1XGMA 4FQGA 3SFZA 3TDZC 1QVTA 1B59A 2WB1N 5L3CA 5CKTA 2OUMA 5FRMA 2VODA 3CUQA 1DP7P 3DP7A 2XDVA 3LOCA 1TWFJ 3GF2A 4GYGA 5KCMA 2A61A 3LSMA 4D0PA 4U0YA 2DDAA 3MFKA 3S14J 4BQAA 2YUSA 5KAFC 4E6KG 1V55H 1M1EB 1MBKA 3HB9A 3D0SA 1EV7A 4HF0A 4MTEA 4PCQA 2XKPA 4RAFA 4KT5C 3G71I 1Z6TA 2B7EA 5E8GA 3BTIA 3IL2A 1B1BA 1QRYA 2GBYA 3EPZA 2VONA 2EINH 4ZYEA 1DUXC 4I09A 2ACJA 2A69F 2FSWA 4RMNA 2M8EA 4I6ZA 2FNAA 1G3WA 1U9OA 3ISPA 1VQLI 1IZ1A 5D5XB 3D5RC 3ERMA 2PLYA 2LF8A 2X6YA 2DYRH 1SANA 5D4SA 1YJWI 4BY1J 4AU7A 1FBSA 3WTUC 2LYCA 2AHQA 1LE8B 5EG0A 3HOTA 2K9LA 4W97A 3U21A 2HOTA 2XGDA 4GYIA 3HPHA 2IJLA 2DFFA 3B6CA 1A5JA 1V5FA 2JSCA 4NC7A 1YTYA 3HJEA 4N9IA 3S1MJ 2OZ6A 4XNFA 3IUOA 5CQGA 3IV5A 2X9DA 2OF7A 2HZDA 2L7ZA 4M3GA 1TT5B 3T0YA 3GEZA 2BBYA 2RQPA 2JK3A 2XAGA 1W7PA 4BNCA 1FOYA 4V2GA 4HF1A 3H35A 2DMUA 5CQEA 2QF7A 5EYRA 2Y0MA 1ENHA 3A01B 4AIJA 3EYYA 1JI8A 1SFEA 3CCVI 1QZYA 2VQGA 1B8IB 3FK7A 1A6IA 3FWEA 4R79A 1P4XA 1ZGJA 2ZC2A 1MBJA 1F1ZA 4HDVA 5H2FC 5IP6A 1O4XA 2L9NA 2I8DA 1JGSA 1WJDA 3BP8A 4FASD 3TKYA 3R4KA 3G3ZA 4D5FA 1FOKA 5HOOA 3V8JA 3ZMUA 3F8FA 2MW8A 3C2GA 4RB2C 2G0EA 4Y13A 3OS1A 1N25A 5J1YA 1TNTA 4IHVA 1NG6A 3DTEA 1OFCX 2YX7A 1BC7C 2ECBA 3KP7A 3LFKA 3HYIA 1MDMB 1BR4A 2LSOA 5D6FA 1ZG1A 1FC3A 2STTA 4AYBN 2ZNZA 1LJ9A 3DLAA 3JW4A 4H0EA 1XSDA 3BDDA 2WWYA 4HYEA 5JR3A 3A0BC 4HDUA 3F8CA 1YHQI 3DKXA 4HG2A 4M6XA 3GLLA 2KDOA 2QQBA 2VKDA 4ZH4F 2EIJH 2F5EA 3OSGA 3CMMA 3ZQFA 3BT9A 3AG1H 1SFUA 3R61A 1RKWA 4ZZDA 5HLGA 2HPMA 1RESA 2K9QA 3RKXA 1E3OC 3ZGKA 1L0OC 1K6YA 5FLXK 2ZO4A 3G73A 1T95A 2AXLA 3SDBA 1BBYA 3HGYA 1G6NA 1TW2A 3CUOA 3LSGA 2GLOA 3SDGA 1IV6A 1HOMA 3QP5A 4IQ4A 5E3MA 2RKHA 3JRBA 4OOIA 4G94A 4XLPF 2DA2A 1TQMA 5L3FA 2HYFA 1Z1DA 1MD0A 3K4JA 3RZOJ 5FROA 3M1EA 1REPC 1U5TB 2BYVE 3MCZA 1IDZA 4IHWA 1K78A 1PP8F 3I59B 5DD8A 3CCQI 2A6HF 3LL7A 4M72A 4B48A 2UZKA 3HDDA 3CC2I 5DCMB 2DT7B 2HVSA 3BG6A 1D5YA 4OIPF 4Y4RA 4XOPA 3H5NA 1F4KA 1APLC 2F6CA 1XMAA 3IH3A 5CLSA 5DS9A 1KZHA 1O3RA 1RUOA 3K4MA 3G1LA 2LRDA 2L3DA 1HC8A 4DOZA 5K5OA 3A0HC 3TP3A 2R7ZJ 3ZN1A 4RB1A 2KL4A 2AS5F 3M8FA 2V7FA 1ETWA 3L9FA 5DM6F 1QGPA 2XGCA 5L3BA 1WSUA 2LMDA 3L2QA 3GLXA 2EV6A 1YE9A 1ZGAA 2HEOA 1R58A 1YX5A 1D8KA 2BY0A 3DTKA 4PUSA 2HI3A 3EUHC 3PFYA 1WH7A 2N8GA 4CHUA 3ZQIA 4CCOA 2A3SA 1R00A 2VE8A 3GWZA 3K2AA 2EQRA 1LQ1A 1ZYRF 1ETVA 5IT9Z 4RM3A 2E19A 4BUPA 1RKTA 4KT6A 3WTXC 1J0RA 4XORA 1JJ6C 2ELKA 3FXJA 3QYBA 5D5UB 2DTRA 1EA3A 3H3UA 3F3XA 1J75A 2JA2A 3DBLB 2K4BA 2KIUA 4B8XA 1Z6RA 2E1OA 1X1PA 2UWMA 3OY9A 2ZSIB 4I0BA 3CLQA 3ECOA 4BXFA 2A6EF 4WWCA 1W0UA 3EUAA 3W6KB 3NAUA 1WWXA 1TWCJ 5BNGA 3HOWJ 2EJRA 2VBXA 2LBFB 1KU7A 4HF2A 4N4NB 3SFIA 3VDXA 5LRSA 3HOZJ 4NB5A 3OL3A 2VPRA 4RAGA 2FQ3A 1R4NB 3BLYA 5HDGA 3I64A 1L3LA 2IGKA 3JRCA 1BC8C 3PIPF 2DPDA 2H94A 1XMKA 3LQRA 2ZCWA 3WTSC 3Q0WA 1HA8A 4A3MJ 1MJ9A 2HU9A 2Q1ZB 4WK8F 4J01A 1VTNC 2ZKZA 1T6SA 1R5ID 3BG5A 2M8GX 3QYFA 2CYYA 2L01A 3JRIA 4KMFA 4F92B 1ZRFA 1KU9A 2M1BA 4YIIA 2M0CA 5E8IA 4MLOA 5CPRB 4E7SA 1YX3A 2R92J 2DTZA 4XN3A 3FXUA 2WBMA 2HKOA 3CQZJ 1VF9A 3B73A 3BG3A 3L7WA 1ORKA 2ZBKA 2HXOA 2UV1A 1O57A 1YO5C 4A0YA 3JRGA 1VQ9I 2V1XA 1JKOC 4G7OF 4PFPA 4C2TA 2IS6A 2V1NA 2EZHA 3IC7A 1WJBA 4KYWA 3S2HJ 2X1DA 2W84A 3LSTA 2R7RA 2XPWA 1IUFA 2QQ9A 2X4HA 3KP2A 5CJ9A 4IKFA 5EF6A 3RSNA 3BZKA 1DPRA 4E7IA 4A3GJ 3IRRA 4ENKA 2HPIA 3LSIA 3LSRA 2ID6A 1TBXA 3LAPA 1HLVA 4CDGA 3ZQGA 3A02A 3U2RA 3CMYA 4M6VA 1ZELA 3RIRA 2IS1A 1MJAA 4B47A 5EEHA 1TWAJ 1Z3YA 2I5UA 2DW4A 2DO7A 2HTSA 2X1EA 2RV8A 4OIRF 2QUFA 2DFEA 4UUVA 2CH0A 3OS2A 4BYYA 4B3AA 1KU3A 1R9TJ 3GFLA 2K4JA 3GZ6A 2ZMEB 3HRTA 5J47A 1Y39A 3HIFA 3ZOBA 2Q2EA 1UELB 2HYJA 1J2XA 3UNGC 5KHDA 1QBJA 3PM1A 3KLOA 3BJ6A 1D1AA 2P6SA 1VQ7I 3SYTA 3ECHA 1Y8RB 2KFDA 4EJUA 2VT2A 3RPQA 2Y75A 3TW6A 3GTQJ 4M3FA 4PFOA 3K1MA 3N97A 6PAXA 4LLGF 5KVRA 2Y48A 3KZZA 1DGRM 3JTGA 2DN0A 2L54A 3QU3A 3PFIA 4OIOF 4RS8A 4UB6C 1SVMA 1UG0A 2L9SA 2D45A 1FOWA 1VQPI 2IA2A 1A6QA 2BOLA 2EV5A 2JT1A 2GA1A 3KE2A 2NS8A 1Y1WJ 1QA6A 3RQ4A 2Z16A 3VPRA 3AG3H 4LGWA 3C2BA 4B43A 3RYPA 2CFOA 2HQAA 4D1QA 1YJNI 1BJAA 4S05A 2DMQA 4P55A 3BTLA 3E3VA 1VZ0A 1U8RA 2P8TA 4IRIA 3ZQHA 2JJ7A 4GCVA 3K69A 1IN7A 3M9AA 2GAUA 1JTXA 3A03A 3DU6A 2CV0A 1R5GA 2K85A 3S8PA 3PQKA 3BJOA 3KEYA 4P96A 1KGSA 1EJ9A 2P7CB 2YSRA 3TDUC 1OCTC 2A5WA 3DLLF 2L5QA 4BY7J 3OS0A 4C3HJ 3BTCA 4F7ZA 2L02A 1XSVA 1HKQA 5K1YA 2LLKA 1IV8A 3CF5F 1T8IA 5C44J 3BCAA 3TP0A 3WGHA 1WJEA 1XCBA 3S2DJ 4DJAA 2R4GA 4BBSJ 3K4BA 1KYZA 4MHGA 1YW7A 2EIMH 3DWLE 2OU2A 4HV5A 3FKIJ 1DGWY 1GHCA 2PX9A 2XAHA 4W1UA 5IT3A 4CICA 5E1XA 1XDSA 3BQZA 4HX4A 4QPQA 2JPBA 4A12A 4MQ9F 4LMYA 4BBRJ 2EPFA 4ZYAA 2QKMB 1A35A 3VSLA 4G7ZF 1NHAA 3F8BA 4FE7A 1E3HA 4IHYA 3CC7I 3MZ8A 1UAAA 1RETA 2CW0F 3GZ5A 3M4OJ 2FNPA 1SFKA 5AONA 3HHGA 2KJBA 1OCZH 3BR3A 3HM5A 2ZJRF 1LKXA 3H3ZA 4A3LJ 3HUGA 4UXNA 1X1CA 1HW1A 3FXLA 1WZ2A 3JCUC 3KYDB 3E5QA 1KQ9A 1QZEA 3HOUJ 4EGYA 4EEFG 1ETQA 2H1KA 2F4MB 2PQ8A 2K02A 3HSFA 2EWNA 4HEA2 3BZ6A 4P1WA 3K70C 2XASA 1ERDA 3WGGA 5HVQC 3V42A 1F9NA 3REOA 2NYXA 2C6YA 1T2KA 4A6DA 2FRHA 5ILSA 3PNVA 4UVAA 1TLHB 1U2WA 4PSWA 2CUEA 3HRMA 2GIVA 3KX2A 1IDYA 4AIKA 4O6JA 2VUMJ 1RPWA 4E7ZA 1R1TA 1JKPC 3S1QJ 2M34A 2VBYA 3CUQC 3DU5A 4Q48A 2FMYA 3BCBA 3ESWB 3HKZA 1MBHA 3BC8A 1IRXA 3V7CA 2F5DA 2OQGA 2W48A 2LY2A 1F36A 3DPTA 2KRFA 5LFAA 2OD5A 1S9HA 5GAEJ 5L3GA 3VYSB 2Y0SA 2R5YB 4AWXB 1OCCH 3GX4X 3TL4X 3H1CA 1W5TA 2LKSA 5BOXA 5KAIC 3RPUD 4LLNA 2IGMA 4ZYDA 2ISYA 2VXDA 4A3DJ 1E2XA 1FNNA 4ZYGA 4ON0A 2W85A 5ILUA 2LY1A 3E0JB 5M5XJ 4KA4A 1R1UA 4FCYA 4XL9A 2LNBA 5TISC 1OR7A 4QPOA 2EH3A 2GXGA 5JHUA 3JAMK 1W36D 2ME0A 2XSJC 4CUGA 3JR9A 4A3JJ 2IGNA 2F2EA 3WU2C 4EM2A 3VSKA 4L5IA 1ZLJA 3EETA 1XDUA 1S29A 3FM5A 2CRGA 4JQFA 3AAFA 2WTEA 4BL0B 4XIDA 4RAZA 2X0LA 3BTJA 1HQCA 3P9KA 3R0JA 1G59A 1V5EA 2B63J 1PJRA 2GQQA 3FX3A 3KFWX 4M9XA 2IAIA 1R4MB 2JZYA 3AG2H 1KQ8A 3O6BB 3LMMA 2KIFA 1B8IA 2Z5UA 3HXLA 3OYGA 3JRDA 1FWZA 2G7HA 2NRAC 2P6TA 1ZK8A 4FETA 2E5ZA 1OJLA 3CP2A 2FD5A 3PSFA 3W6VA 2CSOA 3OIOA 4XN0A 2M0MA 5JLWA 2R7TA 3W2VA 1BW5A 2NOGA 2X48A 3T1BA 1YITI 1P7JA 2KHMA 4M3BA 3PQJA 2V6EA 3TO9A 3HTUA 2WV0A 3D1NI 1G4DA 4OWRB 4MEXF 3GFMA 3R6SA 3G6EI 2KPMA 4BJ5C 4O5VA 4ESBA 1X2MA 2L4AA 2MSYA 3FZVA 4F55A 1KU2A 3FHZA 1FYLA 2BXZA 3FXKA 1UHWA 1AU7A 1X1AA 4UNOA 2L0KA 3I71A 4K2EA 3E6BA 4BQQA 1BA5A 3ABTA 1GUUA 2LKPA 3QU6A 4EM0B 4UV8A 2E2IJ 2LDUA 1OYYA 3MKYB 4MFDA 3H0DA 3CCMI 2O5RA 3KZIC 4XOTA 2CS3A 4BQNA 3E97A 4IX7A 4DZPA 2DYSH 3F9KA 1JUMA 1WI3A 2WAFA 1AHDP 2E5NA 1VQKI 2QCOA 1P2FA 2P5VA 1D3YA 1I27A 3GXOA 4PDKA 2P5LC 2MD5A 4WF2A 3KP3A 3KYCB 1JJ8C 1ETKA 3E5UA 3S3OA 2DPUA 2CV2A 2HYGD 4UVCA 4BHPA 2A05A 1XMXA 2EFQA 1FEXA 4MFEA 2K3FA 3DCFA 2MLGA 1LPQA 2VPLA 2R0QC 2PMHA 2R7XA 3WTYC 5LHHA 4IO9F 4CGZA 3L2UA 1S5LC 4ENNA 1MSFC 3LSJA 2V9PA 2VXZA 2XRNA 4U7DA 5CVJA 2IA0A 2K9MA 1Y8QB 2BVMA 4OAZA 2NS7A 3OYDA 1BR2A 1QQIA 3NQOA 1IN4A 2ZFWA 3H92A 3KP4A 5DV5A 5FKKA 1Z21A 3BZCA 1LEBA 2E60A 2H6BA 3GW2A 1X3ZB 3QPHA 2VI6A 3I59A 3CDLA 3S1RJ 3WHCA 2VQHA 5DCMA 2DOAA 5C4JJ 1LFBA 4R1HA 3KCCA 3OYIA 3ONQA 1FZPB 1YJ9I 3J81Z 2R7VA 3QOPA 4BKXA 1FIAA 4BU2A 2H6CA 2RNGA 2L7MP 4CCJA 2JA7J 5B1AH 2JA6J 2BVLA 2CQXA 4RGUA 1MMNA 4BH9A 3M8JA 5E20A 2CU7A 5H6QA 2M7AA 1KONA 2PN6A 3EYIA 3BR6A 3E6CC 4NQWA 5CYVA 4N9HA 4FX4A 3TQNA 3DBHB 1QPIA 2R93J 1W36C 4Z6YA 2Z9OA 1P9QC 2ZJPF 2KLOA 5D5WB 3OOPA 2LG4A 3WTZA 2GXAA 4ZC3A 3VEPA 5ED4A 1HW5A 1RR8C 4BJ6C 4EJVA 5F1RA 4OMZA 2LTPA 2H09A 3G1MA 5HNFA 3ZPLA 5GPCA 4Q47A 2OA4A 5FFXA 3H5RA 1H9TA 4BAYA 4JX6A 4NC6A 4J19A 2IPQX 3PO3J 3IWZA 2ELJA 2H8WA 2LFBA 4PJNA 2BY2A 5GAGJ 3FKJA 3OL4A 1VQNI 3GCMA 2IS4A 1WH5A 2O7OA 3DKYA 3KEOA 4RGRA 5TGTA 4GXOA 2D5VA 1Z9CA 4I02A 1Z05A 4HRIA 1LFPA 2OAZA 4M3EA 3S17J 4RM2A 4L9VA 2Z2SB 2LBFA 2EIKH 2LC2A 1TNSA 2WV1A 4MGRA 3K4LA 4HQMA 1PUFA 4J00A 1WI9A 3U1DA 4HQEA 1GXPA 3G2BA 3ZN0A 2E1NA 3J7ZI 4OIQF 5AIQA 4F93B 3Q9VA 3BR0A 3CCLI 1S72I 3BOQA 2STWA 5JLXA 4A3FJ 2DDBA 4GGGA 2WAEA 5JFRA 3I0TA 5FD5A 2M30A 4YFNF 2BE5F 3P7NA 3F22A 3HZJA 4HAMA 2QSHX 3ZMVA 4B3XA 1UCRA 3GTLJ 3ZMDA 1YFHA 1E3PA 4I7HA 1QVUA 3ZQLA 4B4CA 1BI2A 1MMAA 4C2MJ 1O3SA 2HVQA 2DT6A 4RLQA 2FOWA 1BI1A 1AOYA 2HOAA 1HXDA 1HSJA 1OISA 4FHTA 5FRNA 3WGIA 5JHFA 3V8KA 2MFZA 2CW8A 2YX4A 4XK4A 3L1PA 2QZ8A 3TGNA 1V3FA 3CUQB 2QSGX 4LOCA 1O7FA 2HKXA 2A5YB 1YYVA 4X6AJ 2RVCA 4EJWA 3PUBA 5IT9K 2DOFA 5F08A 1UMQA 5LBQA 4DYQA 3EQLF 3CJRB 2TDXA 3TBIA 2K9SA 5K7FA 1Y1VJ 1I39A 1ZG5A 1DDNA 1FMWA 4V19K 4IXAA 1XB4A 3PNYA 2BXYA 2NOJB 4IOCF 2DBBA 3CCJI 3MWMA 4P9UA 4CCKA 2WA0A 5E3OA 2ZXJA 1J59A 3CCYA 2VC1A 3MQ0A 3NWSA 2COBA 2E36A 5LLQA 1MW7A 2BW3B 2M4GA 2F48A 1STZA 2GWRA 5D8KB 3GUDA 2ZMEA 1UJ8A 3GTGJ 1FT9A 4KIFA 3KPHA 4OMYA 4BHCA 1V5GA 3RTRA 4ETSA 2W00A 1X3WB 5FFZA 1XD7A 1WJFA 1USTA 3LNQA 3CC4I 2VLAA 2XVCA 3PJRA 1U0JA 2X6WA 4NHJA 1B9MA 3W6JB 4BE1A 3RKQA 2JPCA 1XSXA 5F0FA 4JP0A 4MNUA 4EV0A 1HCRA 3Q0UA 4XLEA 1B72B 5JI6A 3HRSA 2XAUA 1FYKA 5LHIA 1EKEA 2QQ8A 2BEOA 1H0MA 2CQ7A 5K7HA 4XLNF 3FM3A 2DFHA 3OYEA 3I5UA 1NK2P 2EZIA 1DU0A 1Q1HA 4I98B 2HTJA 1XGOA 1YRNB 4I2OA 1IXCA 1SC7A 3ABUA 4IOAF 3FMQA 1QPMA 3GYHX 4C3IJ 2F4IA 3DF8A 1IRZA 4BE2A 1Z0XA 1ON1A 1VI0A 1T39A 1PDNC 1W4MA 5B5EC 2QGUA 5K7ZA 3IAM2 5JVTA 3ZQCA 5ICFA 2R5ZA 4ZTFA 4G9YA 4ZDPA 4F52A 2IXSA 2A07F 3IRQA 4XICA 1YW9A 2OV7A 2ZXWH 3BJAA 3SZGA 2JTVA 1JUSA 4Y7NJ 1WJAA 1ACIA 2R7DA 3BG9A 4II2A 2KRCA 3I4MJ 2JSPA 1YOVB 5GP9A 2K27A 2ZXHA 1AA7A 3GTPJ 4IJAA 4E70A 4Z2YA 2CUJA 2M7BA 5B1BH 1LB2A 3X2QH 4XQFA 3OYHA 2JA5J 2AQEA 3ASOH 2DK5A 2Y9YA 3H36A 5D4RA 2HDDA 2P4WA 2H1LA 1GLNA 4IL6C 4EJOA 4PJMA 3RKWA 4RA2A 1X58A 2VBZA 2XROA 4XKVA 3ZXSA 3HOXJ 4XRFA 5F0CA 2XF5A 2RGVA 3DQVC 2J5OA 4XR6A 4BEHB 4M74A 4GDFA 3K10A 4BACA 2O8KA 4N0BA 4OAYA 5F27A 2KT0A 1HW2A 1WQ2A 3MD2A 3F21A 2F5VA 1VQ4I 2CQQA 4CSWA 4RDUA 3K70D 3GTMJ 1D0ZA 3CD6I 2QVOA 3G1OA 4C9YA 3JSOA 4A0XA 5J1UA 2MC4A 1OPCA 3R60A 2R3SA 1XTAA 3I58A 2DLLA 5JVGF 1JKRC 4KDPA 3FXOA 3SEQA 3MVPA 4BE0A 1HF0A 2JRTA 2ZB9A 5FLMJ 1MMSA 4O3MA 2DMPA 4XRSA 3HOYJ 2DJIA 3AL0C 2MA3A 2QM3A 5IP7J 2ZXIA 3SZTA 3C7JA 1VQOI 3H0GJ 1J9IA 2PMUA 2GXBA 1U3EM 3C18A 3I54A 1QO0D 1SD5A 1TZLA 5E1WA 3JRFA 1MNMC 4LJZF 2R7FA 2HDCA 2E1MC 1OLTA 1Z91A 2QKLB 3RYRA 1MNDA 1USSA 4IPAA 1LUJB 4NDLA 5HLHA 4RBOA 3M7GA 2EFNA 1IN5A 2KIQA 4ZYHA 5F1JA 2IEKA 2CFXA 4B44A 4DNCA 4ZDLA 2GOMA 3DEUA 2FF4A 1X2NA 3T8RA 2DA5A 1OCRH 2MD0A 3IH4A 5HODA 1K7AA 3C3WA 1FSHA 4HNUA 4MTDA 4CYCB 3GTKJ 1Y6IA 2Y30A 2R5YA 3L09A 2HR3A 4BXXJ 2LF7A 2W57A 3OYLA 3IKVA 4RGSA 1SEUA 3FMSA 2WAQA 1MZBA 1O7LA 1E17A 1ZHFA 5LD2C 2ZJ2A 1Z7UA 4CYDA 1POGA 4IHXA 1F5TA 5EZGA 5CVRA 3K2ZA 3P5JA 1T0FA 2KDZA 3JTHA 4YELA 2OCCH 1IF1A 2RDPA 4LITA 2GZWA 2YU3A 4RLFA 5BMZA 1AKHA 3LSHA 3MAJA 3AG4H 3VOEA 1IW7F 1IXSB 1TP4A 2XGXA 4JBAA 1D0XA 3I55I 2ISZA 1FBQA 4LIVA 3B02A 4Y15A 2QQAA 4XLHA 4P9FA 5HDNA 4HA8A 3W3CA 3MN2A 2LKXA 5IYDJ 1W7PD 4D9JA 1J7KA 3KP6A 4ANJA 2LR8A
chains in the Genus database with same CATH topology
2EA4A 2MBFA 1ZRDA 3L00A 3RDIA 3TOBA 1JHHA 5DUKA 5AIPA 4HOBA 2HS5A 3CDHA 2FBIA 4BXUA 1ON2A 3K9TA 4HV6A 4EVIA 1OMIA 2V79A 2DU9A 1QZZA 2FBHA 4KN7X 2HOEA 3HHHA 4LG0B 2L4MA 4RB0A 2NS0A 4EQQA 3U9GA 5LGTA 2EFOA 1TTYA 5H6RA 3KLNA 3SZPA 3LA3A 2VE9A 2Q8KA 2UXNA 3ULQB 2VOOA 1YQAA 1WKMA 3J80K 2G7UA 2KKOA 4KIGA 4LD5A 2EFWA 2F5CA 1YG2A 3QRFF 4HLXA 3TO7A 4JK1X 1IAWA 2H27A 3K1NA 1OKRA 1SAXA 1RI7A 4HBLA 4ZZLA 1EH6A 4KIBA 2DAOA 3GO5A 1HSTA 1SD6A 4L0ZB 1FP1D 2VOPA 1KYWA 5HLIA 1IXRC 3KZYA 1KA8A 1H9GA 1YLFA 3DPLC 1R5HA 3I53A 3J80Z 2EFPA 1W5SA 3CO6C 4XSZF 4KN4X 5H20A 3ERED 3VB2A 5BQTA 2E1CA 3E6DA 2IW5A 3F8NA 2EV0A 5ERIA 1BN5A 4MQVA 1G3TA 5A2QZ 5D5VB 5HS7A 4RGXA 2QYOA 2UXXA 1RIOH 3TOAA 5E17F 1ULYA 2QBYB 2NNNA 1C0WA 3NRVA 5F6FA 4G8XA 2CGPA 1R23A 1MDMA 2IP2A 1G3SA 1MGTA 4FX0A 2O6GE 1S8NA 3J81K 1ZLKA 4IVNA 2YR2A 4S04A 1TQPA 1O3TA 1CF7B 4YG2F 1RUNA 2EK5A 4A0ZA 3TO6A 4M71A 3F8MA 3RKYA 3KP5A 5E18F 3WTWC 2COMA 5BS6A 3IKTA 1B6AA 1BOAA 1JXSA 3M8EA 1EH8A 1U5TA 2DQRA 4AVPA 4CXFA 1YW8A 1B9NA 2ELHA 1FX7A 5HDKA 4ESJA 2E7WA 4IHTA 5J8FA 4WXCA 2IRFG 3DFGA 3FXQA 2P5KA 3BWGA 1BIBA 3K1PA 1P6RA 3MZHA 2A68F 3ROUA 5EEGA 1YS7A 1JE8A 4LFUA 1IUYA 1UB9A 3HRUA 4TV7A 1QNTA 2RN7A 1FYMA 4AD9A 2V6CA 1DPUA 1XGSA 4EGZA 4B09A 4M9ZA 2DI3A 4HX7A 2OZUA 3SQNA 1GXQA 4L9TA 5BPDA 4U88A 2CG4A 1FP2A 3DKWA 4HX8A 3RI4A 3ZMSA 3CLOA 4AIHA 1HKSA 1IRGA 5L3DA 3ZP5A 1HKTA 4QWQA 1U6GA 1G3YA 3WG9A 5D6EA 2CQKA 3Q5FA 1A04A 2PJPA 1I5ZA 4Q4ZF 3LWFA 1ZRCA 2HGCA 3D5LA 2Z33A 4KICA 3CJNA 3ZMTA 3LA7A 3COAC 3QAHA 3P9CA 3DV8A 1S6LA 1LDKB 4I01A 4BHBA 5J6XA 2M45A 1ZREA 1SD7A 2V9VA 4RAYA 3R0AA 2FOKA 1PUEE 3ELKA 4ENMA 5DDGA 4WXDA 5LRRA 3IHUA 1KQ0A 2O3FA 2IT0A 1R7JA 2P7VB 3F6OA 1YIOA 2FE3A 4U0VA 2D2WA 3EDPA 1T38A 3RPUA 1OYWA 2KJCA 1X3UA 1XN7A 1TW3A 1FSEA 5LGNA 2W25A 2HWVA 1SD4A 2FA5A 2HFHA 2V1UA 1FY7A 4L0YB 2O0YA 2HQNA 3IWFA 2XV4S 2CWEA 3KETA 1ZH5A 5FLXZ 1S7AA 3ZQ7A 4Q5SF 1I1SA 5HS9A 1W7PB 3FXRA 4L18B 3Q9SA 2XAJA 2VBWA 1EH7A 2EA2A 2PBIA 1SMYF 4CZZA 4EMSA 3GVAA 5ILVA 2PEXA 3O2PE 3LAJA 4L5JA 3F72A 5ICGA 3WU0A 3FF5A 5DD4A 5E1ZB 1B4AA 4RB3C 2XAFA 5DEQA 3SHFA 1S7OA 4LK0F 3I4PA 3RJPA 2YPRA 4HZFA 1WRJA 2K7LA 1CGPA 4L9JA 2DT5A 2O61A 2Z3YA 3CO7C 1O3QA 2FMLA 1U78A 2XAQA 5LGUA 5K5QA 3K0LA 1BI3A 5DCFA 4L9NA 4U0WA 1IN6A 4PZJA 4LG0A 1D5VA 2NAZA 3LA2A 1ZG3A 2OQRA 2M5WA 4WXHA 3F6VA 3WTVC 5ICCA 3N4MA 1RZ4A 1ZARA 3LQQA 2O8XA 1K78B 4G6DA 4WCGA 4XBFA 1R36A 4OINF 3BROA 3WE2A 4DQ2A 4YIFA 3V4GA 1GVJA 3NEUA 2HZTA 4EJTA 2DFIA 1K79A 3WODF 3EUHA 2DQLA 4IF4A 4QLCU 3E6MA 4A2UA 1ZAOA 3HSRA 5CVVA 5L3EA 2V1DA 3WU1B 2WC2A 5FD6A 4KFCA 2M87A 2FBKA 2PFBA 1LDJA 3O3KA 4LLLA 3BY6A 4A6EA 4YFKF 4FT8A 2D1VA 4KUMA 2EB7A 1MJBA 4LB5A 3MZYA 2NNYA 1IN8A 2OBPA 1V4RA 2MC3A 1S3JA 3DXJF 2XIGA 1BI0A 4U7BA 5J8CA 1MKMA 3MEXA 2DK8A 3FMRA 2FXAA 2ZNYA 1K6OA 4GO1A 2Z99A 1OYIA 2PG4A 1LNWA 4A5MA 5BPIA 2E7XA 3VODA 4PGHA 3VFZA 1LDDA 5K5RA 3V8LA 3V7RA 4WX9A 1Y0UA 5FB2A 1YS6A 3BPXA 4OU0A 2K86A 3T5XA 2IA1A 2QBYA 4KNYA 4PGGA 4A5NA 2W24A 1ONVA 2HQRA 2CO5A 3S2WA 3HSEA 2ESNA 3C1DA 2Q0OA 3V7SA 5KK1A 1SMTA 5CVIA 3QPTA 2B0LA 5TJJA 4EM1A 1P4AA 1J5YA 4CO8A 5DYMA 4MEYF 5LEKA 5FO5A 1FLIA 3WTTC 4UVBA 4YFXF 1R22A 4XSXF 2ESHA 1CF7A 3E5XA 1SFXA 5F64A 2MH2A 5DUIA 2J5PA 3WE3A 3QP6A 2XKOA 4ESFA 5HS8A 5LHGA 1FBUA 2FU4A 5A2QK 4KMUX 1XGNA 2O03A 1D8JA 4ASNA 2G9WA 3ZMZA 1P4WA 1IRFA 1ZN2A 2IVMA 4IHSA 1LVAA 4I0AA 1I6XA 2VT3A 5D8LB 1JHFA 1U5TC 3ML6A 1UFMA 1RNLA 3HOSA 1BIAA 2D1HA 1BM9A 2XHKA 4UV9A 2QLZA 4Y17A 4HLYA 2ETHA 5LEJA 2VN2A 1TQIA 4LK1F 1XCVA 3BPVA 1HBXG 1FPQA 1ODDA 2FEZA 5ICEA 3F23A 5FGMA 2XUBA 4M9SA 5CVUA 4IRGA 4G6QA 2RNJA 2KIMA 4UHTA 2GA2A 3J7AO 3P9IA 1AWCA 4P5OA 3HTSB 2F5FA 4IRHA 1P92A 3GFJA 3SXYA 2QWWA 3OV8A 1I1GA 3GFIA 4M73A 2ADUA 4ENJA 1R1VA 4HW0A 1T98A 5TRDA 2MLKA 2BV6A 1PP7U 4G7HF 2RC4A 1LEAA 4M6YA 2QENA 3JAMZ 2BGCA 2MH9A 3CTAA 3JSPA 1UHMA 4R8HA 3L2CA 3T8TA 2VC0A 4LB6B 2PI0A 1XGMA 3SFZA 3TDZC 1B59A 5L3CA 2VODA 3CUQA 1DP7P 3DP7A 4GYGA 3GF2A 2A61A 4D0PA 4U0YA 3MFKA 4BQAA 3D0SA 1EV7A 4MTEA 4HF0A 4PCQA 2XKPA 4KT5C 1Z6TA 5E8GA 3IL2A 1B1BA 2VONA 4ZYEA 1DUXC 4I09A 2ACJA 2A69F 2FSWA 2M8EA 2FNAA 1G3WA 3ISPA 1IZ1A 5D5XB 2PLYA 2LF8A 5D4SA 1FBSA 3WTUC 3HOTA 4GYIA 2IJLA 2JSCA 1YTYA 4N9IA 2OZ6A 3T0YA 3GEZA 2BBYA 2RQPA 2XAGA 1W7PA 4BNCA 4HF1A 2Y0MA 4AIJA 3EYYA 1SFEA 1QZYA 3FWEA 4R79A 1P4XA 1ZGJA 1F1ZA 4HDVA 1JGSA 3BP8A 3TKYA 3R4KA 3G3ZA 1FOKA 5HOOA 3V8JA 3ZMUA 3F8FA 4RB2C 4Y13A 1TNTA 2YX7A 1BC7C 3KP7A 3LFKA 3HYIA 1MDMB 2LSOA 5D6FA 1ZG1A 1FC3A 2STTA 2ZNZA 1LJ9A 3JW4A 4H0EA 1XSDA 3BDDA 2WWYA 4HYEA 5JR3A 4HDUA 3F8CA 4M6XA 2QQBA 4ZH4F 2F5EA 1SFUA 3R61A 4ZZDA 5HLGA 3RKXA 1L0OC 5FLXK 2ZO4A 3G73A 2AXLA 1BBYA 1G6NA 1TW2A 3CUOA 3QP5A 2RKHA 4OOIA 4G94A 4XLPF 1TQMA 5L3FA 2HYFA 1Z1DA 1MD0A 3M1EA 1REPC 1U5TB 2BYVE 3MCZA 1K78A 1PP8F 3I59B 5DD8A 2A6HF 2UZKA 4M72A 5DCMB 4OIPF 1F4KA 1XMAA 1O3RA 5CLSA 1RUOA 2L3DA 5K5OA 3ZN1A 4RB1A 2AS5F 3M8FA 3L9FA 1QGPA 1WSUA 5L3BA 3GLXA 2EV6A 1ZGAA 2HEOA 1R58A 1D8KA 4CHUA 2A3SA 1R00A 2VE8A 3GWZA 1LQ1A 1ZYRF 5IT9Z 3WTXC 1J0RA 5D5UB 2DTRA 3H3UA 3F3XA 1J75A 2K4BA 2KIUA 4B8XA 1Z6RA 2UWMA 4I0BA 3ECOA 2A6EF 4WWCA 3W6KB 1WWXA 2EJRA 2VBXA 1KU7A 4HF2A 5LRSA 4NB5A 2FQ3A 5HDGA 3I64A 1L3LA 1BC8C 2DPDA 2H94A 1XMKA 3LQRA 2ZCWA 3WTSC 1MJ9A 4WK8F 1VTNC 2ZKZA 1T6SA 2CYYA 2L01A 4KMFA 1ZRFA 1KU9A 2M1BA 4YIIA 5E8IA 3FXUA 2HKOA 3B73A 3L7WA 2ZBKA 1O57A 1YO5C 4A0YA 2V1XA 4G7OF 3IC7A 4KYWA 2W84A 3LSTA 2X4HA 2QQ9A 3KP2A 5CJ9A 1DPRA 3IRRA 4ENKA 1TBXA 3LAPA 4CDGA 3U2RA 3RIRA 1MJAA 5EEHA 2DW4A 2DO7A 2HTSA 2RV8A 4OIRF 2QUFA 4UUVA 4BYYA 1KU3A 3GFLA 2K4JA 3GZ6A 2ZMEB 3HRTA 3HIFA 2Q2EA 1J2XA 1QBJA 3KLOA 3BJ6A 2P6SA 3ECHA 4EJUA 2VT2A 3RPQA 2Y75A 3K1MA 3N97A 6PAXA 4LLGF 5KVRA 2Y48A 3KZZA 3JTGA 2L54A 3QU3A 3PFIA 4OIOF 4RS8A 2D45A 2IA2A 2EV5A 2JT1A 2GA1A 3KE2A 4LGWA 3RYPA 1BJAA 4S05A 4P55A 3E3VA 1U8RA 2P8TA 4IRIA 4GCVA 3K69A 1IN7A 3M9AA 2GAUA 1R5GA 3PQKA 3BJOA 4P96A 1KGSA 2P7CB 2YSRA 3TDUC 4F7ZA 2L02A 1XSVA 1HKQA 5K1YA 3WGHA 1XCBA 1KYZA 4MHGA 1YW7A 2OU2A 4HV5A 1GHCA 2XAHA 5IT3A 4CICA 5E1XA 1XDSA 4A12A 4HX4A 2JPBA 4MQ9F 4LMYA 4G7ZF 1NHAA 3F8BA 2CW0F 3GZ5A 2FNPA 5AONA 3HHGA 2KJBA 3H3ZA 3HUGA 4UXNA 1HW1A 3E5QA 1KQ9A 4EGYA 2PQ8A 2K02A 3HSFA 2EWNA 3BZ6A 2XASA 3WGGA 5HVQC 1F9NA 3REOA 2NYXA 2C6YA 1T2KA 4A6DA 2FRHA 5ILSA 4UVAA 1TLHB 1U2WA 3HRMA 2GIVA 4AIKA 4O6JA 1R1TA 2VBYA 3CUQC 4Q48A 2FMYA 3V7CA 2F5DA 2OQGA 3DPTA 2KRFA 2OD5A 5L3GA 4AWXB 3GX4X 1W5TA 5BOXA 4LLNA 4ZYDA 2ISYA 1E2XA 1FNNA 4ZYGA 4ON0A 2W85A 5ILUA 4KA4A 1R1UA 2LNBA 1OR7A 5JHUA 2GXGA 3JAMK 2F2EA 4EM2A 4L5IA 1ZLJA 3EETA 1XDUA 1S29A 3FM5A 4JQFA 3AAFA 2WTEA 4RAZA 2X0LA 1HQCA 3P9KA 3R0JA 2GQQA 3FX3A 3KFWX 4M9XA 2JZYA 1KQ8A 3O6BB 2KIFA 2Z5UA 1FWZA 2G7HA 2NRAC 2P6TA 2CSOA 3T1BA 3PQJA 3TO9A 3HTUA 2WV0A 1G4DA 4MEXF 3GFMA 3R6SA 4O5VA 4ESBA 2L4AA 3FZVA 1KU2A 3FHZA 1FYLA 1UHWA 4UNOA 3I71A 4K2EA 3E6BA 3ABTA 2LKPA 3QU6A 4EM0B 4UV8A 2LDUA 1OYYA 3E97A 1P2FA 2P5VA 1D3YA 2P5LC 1I27A 3GXOA 4PDKA 2MD5A 4WF2A 3KP3A 2DPUA 3E5UA 2HYGD 4UVCA 4BHPA 2EFQA 2MLGA 2PMHA 3WTYC 5LHHA 4CGZA 4ENNA 2VXZA 2XRNA 4U7DA 5CVJA 2IA0A 1QQIA 3NQOA 1IN4A 2ZFWA 3H92A 3KP4A 5DV5A 1LEBA 2H6BA 3GW2A 3QPHA 3I59A 5DCMA 4R1HA 3KCCA 1FZPB 3J81Z 3QOPA 2H6CA 4RGUA 4BH9A 5E20A 5H6QA 2PN6A 3EYIA 3E6CC 4NQWA 5CYVA 4N9HA 4FX4A 3TQNA 2Z9OA 5D5WB 3OOPA 3WTZA 3VEPA 5ED4A 1HW5A 4EJVA 5F1RA 4OMZA 3ZPLA 2H09A 4Q47A 2OA4A 5FFXA 1H9TA 4BAYA 2IPQX 3IWZA 3KEOA 4RGRA 4GXOA 1Z9CA 4I02A 1Z05A 2OAZA 4L9VA 1TNSA 4MGRA 4HQMA 1WI9A 3U1DA 4HQEA 1GXPA 3ZN0A 2E1NA 4OIQF 5AIQA 3Q9VA 3BOQA 2STWA 4GGGA 5JFRA 3I0TA 5FD5A 2M30A 4YFNF 2BE5F 3P7NA 3F22A 4HAMA 3ZMVA 1UCRA 3ZMDA 1YFHA 4I7HA 1BI2A 1O3SA 1BI1A 1AOYA 1HXDA 1HSJA 4FHTA 3WGIA 3V8KA 2YX4A 2QZ8A 3TGNA 1V3FA 3CUQB 1O7FA 2HKXA 2A5YB 1YYVA 2RVCA 4EJWA 5IT9K 5LBQA 3EQLF 2TDXA 1ZG5A 1DDNA 4IXAA 1XB4A 2DBBA 3MWMA 4P9UA 2ZXJA 1J59A 2VC1A 3MQ0A 5LLQA 1STZA 2GWRA 5D8KB 3GUDA 2ZMEA 1FT9A 4KIFA 4OMYA 4BHCA 3RTRA 4ETSA 5FFZA 1XD7A 1USTA 2XVCA 4NHJA 1B9MA 3W6JB 2JPCA 1XSXA 4MNUA 4EV0A 5JI6A 3HRSA 1FYKA 5LHIA 2BEOA 1H0MA 4XLNF 3FM3A 3I5UA 1Q1HA 4I98B 2HTJA 1XGOA 4I2OA 1IXCA 3ABUA 3FMQA 1QPMA 3GYHX 3DF8A 1ON1A 1PDNC 1T39A 1W4MA 5JVTA 5ICFA 4G9YA 2A07F 3IRQA 1YW9A 3BJAA 2JTVA 2R7DA 2K27A 4IJAA 4E70A 4Z2YA 1LB2A 2DK5A 5D4RA 2P4WA 4EJOA 3RKWA 2VBZA 2XROA 4XRFA 2RGVA 3DQVC 2J5OA 4M74A 4N0BA 1HW2A 1WQ2A 3F21A 2QVOA 3JSOA 4A0XA 1OPCA 3R60A 2R3SA 3I58A 2DLLA 4KDPA 2JRTA 4O3MA 2MA3A 2QM3A 3SZTA 3C7JA 1J9IA 2PMUA 2GXBA 1U3EM 3C18A 3I54A 1QO0D 1SD5A 5E1WA 4LJZF 2R7FA 2HDCA 1Z91A 3RYRA 1USSA 4IPAA 5HLHA 3M7GA 2EFNA 1IN5A 4ZYHA 2CFXA 4DNCA 3DEUA 2FF4A 3T8RA 1K7AA 3C3WA 1FSHA 4MTDA 3L09A 2HR3A 2LF7A 2W57A 3IKVA 4RGSA 3FMSA 1E17A 1MZBA 1O7LA 1ZHFA 2ZJ2A 1Z7UA 4CYDA 1F5TA 5CVRA 3K2ZA 1T0FA 3JTHA 1IF1A 2RDPA 2GZWA 2YU3A 5BMZA 3MAJA 3VOEA 1IW7F 1IXSB 2XGXA 4JBAA 2ISZA 1FBQA 3B02A 4Y15A 2QQAA 4P9FA 5HDNA 4HA8A 1W7PD 1J7KA 3KP6A 3KEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA4 A;  2MBF A;  1ZRD A;  3L00 A;  3RDI A;  3TOB A;  1JHH A;  5DUK A;  5AIP A;  4HOB A;  2HS5 A;  3CDH A;  2FBI A;  4BXU A;  1ON2 A;  3K9T A;  4HV6 A;  4EVI A;  1OMI A;  2V79 A;  2DU9 A;  1QZZ A;  2FBH A;  4KN7 X;  2HOE A;  3HHH A;  4LG0 B;  2L4M A;  4RB0 A;  2NS0 A;  4EQQ A;  3U9G A;  5LGT A;  2EFO A;  1TTY A;  5H6R A;  3KLN A;  3SZP A;  3LA3 A;  2VE9 A;  2Q8K A;  2UXN A;  3ULQ B;  2VOO A;  1YQA A;  1WKM A;  3J80 K;  2G7U A;  2KKO A;  4KIG A;  4LD5 A;  2EFW A;  2F5C A;  1YG2 A;  3QRF F;  4HLX A;  3TO7 A;  4JK1 X;  1IAW A;  2H27 A;  3K1N A;  1OKR A;  1SAX A;  1RI7 A;  4HBL A;  4ZZL A;  1EH6 A;  4KIB A;  2DAO A;  3GO5 A;  1HST A;  1SD6 A;  4L0Z B;  1FP1 D;  2VOP A;  1KYW A;  5HLI A;  1IXR C;  3KZY A;  1KA8 A;  1H9G A;  1YLF A;  3DPL C;  1R5H A;  3I53 A;  3J80 Z;  2EFP A;  1W5S A;  3CO6 C;  4XSZ F;  4KN4 X;  5H20 A;  3ERE D;  3VB2 A;  5BQT A;  2E1C A;  3E6D A;  2IW5 A;  3F8N A;  2EV0 A;  5ERI A;  1BN5 A;  4MQV A;  1G3T A;  5A2Q Z;  5D5V B;  5HS7 A;  4RGX A;  2QYO A;  2UXX A;  1RIO H;  3TOA A;  5E17 F;  1ULY A;  2QBY B;  2NNN A;  1C0W A;  3NRV A;  5F6F A;  4G8X A;  2CGP A;  1R23 A;  1MDM A;  2IP2 A;  1G3S A;  1MGT A;  4FX0 A;  2O6G E;  1S8N A;  3J81 K;  1ZLK A;  4IVN A;  2YR2 A;  4S04 A;  1TQP A;  1O3T A;  1CF7 B;  4YG2 F;  1RUN A;  2EK5 A;  4A0Z A;  3TO6 A;  4M71 A;  3F8M A;  3RKY A;  3KP5 A;  5E18 F;  3WTW C;  2COM A;  5BS6 A;  3IKT A;  1B6A A;  1BOA A;  1JXS A;  3M8E A;  1EH8 A;  1U5T A;  2DQR A;  4AVP A;  4CXF A;  1YW8 A;  1B9N A;  2ELH A;  1FX7 A;  5HDK A;  4ESJ A;  2E7W A;  4IHT A;  5J8F A;  4WXC A;  2IRF G;  3DFG A;  3FXQ A;  2P5K A;  3BWG A;  1BIB A;  3K1P A;  1P6R A;  3MZH A;  2A68 F;  3ROU A;  5EEG A;  1YS7 A;  1JE8 A;  4LFU A;  1IUY A;  1UB9 A;  3HRU A;  4TV7 A;  1QNT A;  2RN7 A;  1FYM A;  4AD9 A;  2V6C A;  1DPU A;  1XGS A;  4EGZ A;  4B09 A;  4M9Z A;  2DI3 A;  4HX7 A;  2OZU A;  3SQN A;  1GXQ A;  4L9T A;  5BPD A;  4U88 A;  2CG4 A;  1FP2 A;  3DKW A;  4HX8 A;  3RI4 A;  3ZMS A;  3CLO A;  4AIH A;  1HKS A;  1IRG A;  5L3D A;  3ZP5 A;  1HKT A;  4QWQ A;  1U6G A;  1G3Y A;  3WG9 A;  5D6E A;  2CQK A;  3Q5F A;  1A04 A;  2PJP A;  1I5Z A;  4Q4Z F;  3LWF A;  1ZRC A;  2HGC A;  3D5L A;  2Z33 A;  4KIC A;  3CJN A;  3ZMT A;  3LA7 A;  3COA C;  3QAH A;  3P9C A;  3DV8 A;  1S6L A;  1LDK B;  4I01 A;  4BHB A;  5J6X A;  2M45 A;  1ZRE A;  1SD7 A;  2V9V A;  4RAY A;  3R0A A;  2FOK A;  1PUE E;  3ELK A;  4ENM A;  5DDG A;  4WXD A;  5LRR A;  3IHU A;  1KQ0 A;  2O3F A;  2IT0 A;  1R7J A;  2P7V B;  3F6O A;  1YIO A;  2FE3 A;  4U0V A;  2D2W A;  3EDP A;  1T38 A;  3RPU A;  1OYW A;  2KJC A;  1X3U A;  1XN7 A;  1TW3 A;  1FSE A;  5LGN A;  2W25 A;  2HWV A;  1SD4 A;  2FA5 A;  2HFH A;  2V1U A;  1FY7 A;  4L0Y B;  2O0Y A;  2HQN A;  3IWF A;  2XV4 S;  2CWE A;  3KET A;  1ZH5 A;  5FLX Z;  1S7A A;  3ZQ7 A;  4Q5S F;  1I1S A;  5HS9 A;  1W7P B;  3FXR A;  4L18 B;  3Q9S A;  2XAJ A;  2VBW A;  1EH7 A;  2EA2 A;  2PBI A;  1SMY F;  4CZZ A;  4EMS A;  3GVA A;  5ILV A;  2PEX A;  3O2P E;  3LAJ A;  4L5J A;  3F72 A;  5ICG A;  3WU0 A;  3FF5 A;  5DD4 A;  5E1Z B;  1B4A A;  4RB3 C;  2XAF A;  5DEQ A;  3SHF A;  1S7O A;  4LK0 F;  3I4P A;  3RJP A;  2YPR A;  4HZF A;  1WRJ A;  2K7L A;  1CGP A;  4L9J A;  2DT5 A;  2O61 A;  2Z3Y A;  3CO7 C;  1O3Q A;  2FML A;  1U78 A;  2XAQ A;  5LGU A;  5K5Q A;  3K0L A;  1BI3 A;  5DCF A;  4L9N A;  4U0W A;  1IN6 A;  4PZJ A;  4LG0 A;  1D5V A;  2NAZ A;  3LA2 A;  1ZG3 A;  2OQR A;  2M5W A;  4WXH A;  3F6V A;  3WTV C;  5ICC A;  3N4M A;  1RZ4 A;  1ZAR A;  3LQQ A;  2O8X A;  1K78 B;  4G6D A;  4WCG A;  4XBF A;  1R36 A;  4OIN F;  3BRO A;  3WE2 A;  4DQ2 A;  4YIF A;  3V4G A;  1GVJ A;  3NEU A;  2HZT A;  4EJT A;  2DFI A;  1K79 A;  3WOD F;  3EUH A;  2DQL A;  4IF4 A;  4QLC U;  3E6M A;  4A2U A;  1ZAO A;  3HSR A;  5CVV A;  5L3E A;  2V1D A;  3WU1 B;  2WC2 A;  5FD6 A;  4KFC A;  2M87 A;  2FBK A;  2PFB A;  1LDJ A;  3O3K A;  4LLL A;  3BY6 A;  4A6E A;  4YFK F;  4FT8 A;  2D1V A;  4KUM A;  2EB7 A;  1MJB A;  4LB5 A;  3MZY A;  2NNY A;  1IN8 A;  2OBP A;  1V4R A;  2MC3 A;  1S3J A;  3DXJ F;  2XIG A;  1BI0 A;  4U7B A;  5J8C A;  1MKM A;  3MEX A;  2DK8 A;  3FMR A;  2FXA A;  2ZNY A;  1K6O A;  4GO1 A;  2Z99 A;  1OYI A;  2PG4 A;  1LNW A;  4A5M A;  5BPI A;  2E7X A;  3VOD A;  4PGH A;  3VFZ A;  1LDD A;  5K5R A;  3V8L A;  3V7R A;  4WX9 A;  1Y0U A;  5FB2 A;  1YS6 A;  3BPX A;  4OU0 A;  2K86 A;  3T5X A;  2IA1 A;  2QBY A;  4KNY A;  4PGG A;  4A5N A;  2W24 A;  1ONV A;  2HQR A;  2CO5 A;  3S2W A;  3HSE A;  2ESN A;  3C1D A;  2Q0O A;  3V7S A;  5KK1 A;  1SMT A;  5CVI A;  3QPT A;  2B0L A;  5TJJ A;  4EM1 A;  1P4A A;  1J5Y A;  4CO8 A;  5DYM A;  4MEY F;  5LEK A;  5FO5 A;  1FLI A;  3WTT C;  4UVB A;  4YFX F;  1R22 A;  4XSX F;  2ESH A;  1CF7 A;  3E5X A;  1SFX A;  5F64 A;  2MH2 A;  5DUI A;  2J5P A;  3WE3 A;  3QP6 A;  2XKO A;  4ESF A;  5HS8 A;  5LHG A;  1FBU A;  2FU4 A;  5A2Q K;  4KMU X;  1XGN A;  2O03 A;  1D8J A;  4ASN A;  2G9W A;  3ZMZ A;  1P4W A;  1IRF A;  1ZN2 A;  2IVM A;  4IHS A;  1LVA A;  4I0A A;  1I6X A;  2VT3 A;  5D8L B;  1JHF A;  1U5T C;  3ML6 A;  1UFM A;  1RNL A;  3HOS A;  1BIA A;  2D1H A;  1BM9 A;  2XHK A;  4UV9 A;  2QLZ A;  4Y17 A;  4HLY A;  2ETH A;  5LEJ A;  2VN2 A;  1TQI A;  4LK1 F;  1XCV A;  3BPV A;  1HBX G;  1FPQ A;  1ODD A;  2FEZ A;  5ICE A;  3F23 A;  5FGM A;  2XUB A;  4M9S A;  5CVU A;  4IRG A;  4G6Q A;  2RNJ A;  2KIM A;  4UHT A;  2GA2 A;  3J7A O;  3P9I A;  1AWC A;  4P5O A;  3HTS B;  2F5F A;  4IRH A;  1P92 A;  3GFJ A;  3SXY A;  2QWW A;  3OV8 A;  1I1G A;  3GFI A;  4M73 A;  2ADU A;  4ENJ A;  1R1V A;  4HW0 A;  1T98 A;  5TRD A;  2MLK A;  2BV6 A;  1PP7 U;  4G7H F;  2RC4 A;  1LEA A;  4M6Y A;  2QEN A;  3JAM Z;  2BGC A;  2MH9 A;  3CTA A;  3JSP A;  1UHM A;  4R8H A;  3L2C A;  3T8T A;  2VC0 A;  4LB6 B;  2PI0 A;  1XGM A;  3SFZ A;  3TDZ C;  1B59 A;  5L3C A;  2VOD A;  3CUQ A;  1DP7 P;  3DP7 A;  4GYG A;  3GF2 A;  2A61 A;  4D0P A;  4U0Y A;  3MFK A;  4BQA A;  3D0S A;  1EV7 A;  4MTE A;  4HF0 A;  4PCQ A;  2XKP A;  4KT5 C;  1Z6T A;  5E8G A;  3IL2 A;  1B1B A;  2VON A;  4ZYE A;  1DUX C;  4I09 A;  2ACJ A;  2A69 F;  2FSW A;  2M8E A;  2FNA A;  1G3W A;  3ISP A;  1IZ1 A;  5D5X B;  2PLY A;  2LF8 A;  5D4S A;  1FBS A;  3WTU C;  3HOT A;  4GYI A;  2IJL A;  2JSC A;  1YTY A;  4N9I A;  2OZ6 A;  3T0Y A;  3GEZ A;  2BBY A;  2RQP A;  2XAG A;  1W7P A;  4BNC A;  4HF1 A;  2Y0M A;  4AIJ A;  3EYY A;  1SFE A;  1QZY A;  3FWE A;  4R79 A;  1P4X A;  1ZGJ A;  1F1Z A;  4HDV A;  1JGS A;  3BP8 A;  3TKY A;  3R4K A;  3G3Z A;  1FOK A;  5HOO A;  3V8J A;  3ZMU A;  3F8F A;  4RB2 C;  4Y13 A;  1TNT A;  2YX7 A;  1BC7 C;  3KP7 A;  3LFK A;  3HYI A;  1MDM B;  2LSO A;  5D6F A;  1ZG1 A;  1FC3 A;  2STT A;  2ZNZ A;  1LJ9 A;  3JW4 A;  4H0E A;  1XSD A;  3BDD A;  2WWY A;  4HYE A;  5JR3 A;  4HDU A;  3F8C A;  4M6X A;  2QQB A;  4ZH4 F;  2F5E A;  1SFU A;  3R61 A;  4ZZD A;  5HLG A;  3RKX A;  1L0O C;  5FLX K;  2ZO4 A;  3G73 A;  2AXL A;  1BBY A;  1G6N A;  1TW2 A;  3CUO A;  3QP5 A;  2RKH A;  4OOI A;  4G94 A;  4XLP F;  1TQM A;  5L3F A;  2HYF A;  1Z1D A;  1MD0 A;  3M1E A;  1REP C;  1U5T B;  2BYV E;  3MCZ A;  1K78 A;  1PP8 F;  3I59 B;  5DD8 A;  2A6H F;  2UZK A;  4M72 A;  5DCM B;  4OIP F;  1F4K A;  1XMA A;  1O3R A;  5CLS A;  1RUO A;  2L3D A;  5K5O A;  3ZN1 A;  4RB1 A;  2AS5 F;  3M8F A;  3L9F A;  1QGP A;  1WSU A;  5L3B A;  3GLX A;  2EV6 A;  1ZGA A;  2HEO A;  1R58 A;  1D8K A;  4CHU A;  2A3S A;  1R00 A;  2VE8 A;  3GWZ A;  1LQ1 A;  1ZYR F;  5IT9 Z;  3WTX C;  1J0R A;  5D5U B;  2DTR A;  3H3U A;  3F3X A;  1J75 A;  2K4B A;  2KIU A;  4B8X A;  1Z6R A;  2UWM A;  4I0B A;  3ECO A;  2A6E F;  4WWC A;  3W6K B;  1WWX A;  2EJR A;  2VBX A;  1KU7 A;  4HF2 A;  5LRS A;  4NB5 A;  2FQ3 A;  5HDG A;  3I64 A;  1L3L A;  1BC8 C;  2DPD A;  2H94 A;  1XMK A;  3LQR A;  2ZCW A;  3WTS C;  1MJ9 A;  4WK8 F;  1VTN C;  2ZKZ A;  1T6S A;  2CYY A;  2L01 A;  4KMF A;  1ZRF A;  1KU9 A;  2M1B A;  4YII A;  5E8I A;  3FXU A;  2HKO A;  3B73 A;  3L7W A;  2ZBK A;  1O57 A;  1YO5 C;  4A0Y A;  2V1X A;  4G7O F;  3IC7 A;  4KYW A;  2W84 A;  3LST A;  2X4H A;  2QQ9 A;  3KP2 A;  5CJ9 A;  1DPR A;  3IRR A;  4ENK A;  1TBX A;  3LAP A;  4CDG A;  3U2R A;  3RIR A;  1MJA A;  5EEH A;  2DW4 A;  2DO7 A;  2HTS A;  2RV8 A;  4OIR F;  2QUF A;  4UUV A;  4BYY A;  1KU3 A;  3GFL A;  2K4J A;  3GZ6 A;  2ZME B;  3HRT A;  3HIF A;  2Q2E A;  1J2X A;  1QBJ A;  3KLO A;  3BJ6 A;  2P6S A;  3ECH A;  4EJU A;  2VT2 A;  3RPQ A;  2Y75 A;  3K1M A;  3N97 A;  6PAX A;  4LLG F;  5KVR A;  2Y48 A;  3KZZ A;  3JTG A;  2L54 A;  3QU3 A;  3PFI A;  4OIO F;  4RS8 A;  2D45 A;  2IA2 A;  2EV5 A;  2JT1 A;  2GA1 A;  3KE2 A;  4LGW A;  3RYP A;  1BJA A;  4S05 A;  4P55 A;  3E3V A;  1U8R A;  2P8T A;  4IRI A;  4GCV A;  3K69 A;  1IN7 A;  3M9A A;  2GAU A;  1R5G A;  3PQK A;  3BJO A;  4P96 A;  1KGS A;  2P7C B;  2YSR A;  3TDU C;  4F7Z A;  2L02 A;  1XSV A;  1HKQ A;  5K1Y A;  3WGH A;  1XCB A;  1KYZ A;  4MHG A;  1YW7 A;  2OU2 A;  4HV5 A;  1GHC A;  2XAH A;  5IT3 A;  4CIC A;  5E1X A;  1XDS A;  4A12 A;  4HX4 A;  2JPB A;  4MQ9 F;  4LMY A;  4G7Z F;  1NHA A;  3F8B A;  2CW0 F;  3GZ5 A;  2FNP A;  5AON A;  3HHG A;  2KJB A;  3H3Z A;  3HUG A;  4UXN A;  1HW1 A;  3E5Q A;  1KQ9 A;  4EGY A;  2PQ8 A;  2K02 A;  3HSF A;  2EWN A;  3BZ6 A;  2XAS A;  3WGG A;  5HVQ C;  1F9N A;  3REO A;  2NYX A;  2C6Y A;  1T2K A;  4A6D A;  2FRH A;  5ILS A;  4UVA A;  1TLH B;  1U2W A;  3HRM A;  2GIV A;  4AIK A;  4O6J A;  1R1T A;  2VBY A;  3CUQ C;  4Q48 A;  2FMY A;  3V7C A;  2F5D A;  2OQG A;  3DPT A;  2KRF A;  2OD5 A;  5L3G A;  4AWX B;  3GX4 X;  1W5T A;  5BOX A;  4LLN A;  4ZYD A;  2ISY A;  1E2X A;  1FNN A;  4ZYG A;  4ON0 A;  2W85 A;  5ILU A;  4KA4 A;  1R1U A;  2LNB A;  1OR7 A;  5JHU A;  2GXG A;  3JAM K;  2F2E A;  4EM2 A;  4L5I A;  1ZLJ A;  3EET A;  1XDU A;  1S29 A;  3FM5 A;  4JQF A;  3AAF A;  2WTE A;  4RAZ A;  2X0L A;  1HQC A;  3P9K A;  3R0J A;  2GQQ A;  3FX3 A;  3KFW X;  4M9X A;  2JZY A;  1KQ8 A;  3O6B B;  2KIF A;  2Z5U A;  1FWZ A;  2G7H A;  2NRA C;  2P6T A;  2CSO A;  3T1B A;  3PQJ A;  3TO9 A;  3HTU A;  2WV0 A;  1G4D A;  4MEX F;  3GFM A;  3R6S A;  4O5V A;  4ESB A;  2L4A A;  3FZV A;  1KU2 A;  3FHZ A;  1FYL A;  1UHW A;  4UNO A;  3I71 A;  4K2E A;  3E6B A;  3ABT A;  2LKP A;  3QU6 A;  4EM0 B;  4UV8 A;  2LDU A;  1OYY A;  3E97 A;  1P2F A;  2P5V A;  1D3Y A;  2P5L C;  1I27 A;  3GXO A;  4PDK A;  2MD5 A;  4WF2 A;  3KP3 A;  2DPU A;  3E5U A;  2HYG D;  4UVC A;  4BHP A;  2EFQ A;  2MLG A;  2PMH A;  3WTY C;  5LHH A;  4CGZ A;  4ENN A;  2VXZ A;  2XRN A;  4U7D A;  5CVJ A;  2IA0 A;  1QQI A;  3NQO A;  1IN4 A;  2ZFW A;  3H92 A;  3KP4 A;  5DV5 A;  1LEB A;  2H6B A;  3GW2 A;  3QPH A;  3I59 A;  5DCM A;  4R1H A;  3KCC A;  1FZP B;  3J81 Z;  3QOP A;  2H6C A;  4RGU A;  4BH9 A;  5E20 A;  5H6Q A;  2PN6 A;  3EYI A;  3E6C C;  4NQW A;  5CYV A;  4N9H A;  4FX4 A;  3TQN A;  2Z9O A;  5D5W B;  3OOP A;  3WTZ A;  3VEP A;  5ED4 A;  1HW5 A;  4EJV A;  5F1R A;  4OMZ A;  3ZPL A;  2H09 A;  4Q47 A;  2OA4 A;  5FFX A;  1H9T A;  4BAY A;  2IPQ X;  3IWZ A;  3KEO A;  4RGR A;  4GXO A;  1Z9C A;  4I02 A;  1Z05 A;  2OAZ A;  4L9V A;  1TNS A;  4MGR A;  4HQM A;  1WI9 A;  3U1D A;  4HQE A;  1GXP A;  3ZN0 A;  2E1N A;  4OIQ F;  5AIQ A;  3Q9V A;  3BOQ A;  2STW A;  4GGG A;  5JFR A;  3I0T A;  5FD5 A;  2M30 A;  4YFN F;  2BE5 F;  3P7N A;  3F22 A;  4HAM A;  3ZMV A;  1UCR A;  3ZMD A;  1YFH A;  4I7H A;  1BI2 A;  1O3S A;  1BI1 A;  1AOY A;  1HXD A;  1HSJ A;  4FHT A;  3WGI A;  3V8K A;  2YX4 A;  2QZ8 A;  3TGN A;  1V3F A;  3CUQ B;  1O7F A;  2HKX A;  2A5Y B;  1YYV A;  2RVC A;  4EJW A;  5IT9 K;  5LBQ A;  3EQL F;  2TDX A;  1ZG5 A;  1DDN A;  4IXA A;  1XB4 A;  2DBB A;  3MWM A;  4P9U A;  2ZXJ A;  1J59 A;  2VC1 A;  3MQ0 A;  5LLQ A;  1STZ A;  2GWR A;  5D8K B;  3GUD A;  2ZME A;  1FT9 A;  4KIF A;  4OMY A;  4BHC A;  3RTR A;  4ETS A;  5FFZ A;  1XD7 A;  1UST A;  2XVC A;  4NHJ A;  1B9M A;  3W6J B;  2JPC A;  1XSX A;  4MNU A;  4EV0 A;  5JI6 A;  3HRS A;  1FYK A;  5LHI A;  2BEO A;  1H0M A;  4XLN F;  3FM3 A;  3I5U A;  1Q1H A;  4I98 B;  2HTJ A;  1XGO A;  4I2O A;  1IXC A;  3ABU A;  3FMQ A;  1QPM A;  3GYH X;  3DF8 A;  1ON1 A;  1PDN C;  1T39 A;  1W4M A;  5JVT A;  5ICF A;  4G9Y A;  2A07 F;  3IRQ A;  1YW9 A;  3BJA A;  2JTV A;  2R7D A;  2K27 A;  4IJA A;  4E70 A;  4Z2Y A;  1LB2 A;  2DK5 A;  5D4R A;  2P4W A;  4EJO A;  3RKW A;  2VBZ A;  2XRO A;  4XRF A;  2RGV A;  3DQV C;  2J5O A;  4M74 A;  4N0B A;  1HW2 A;  1WQ2 A;  3F21 A;  2QVO A;  3JSO A;  4A0X A;  1OPC A;  3R60 A;  2R3S A;  3I58 A;  2DLL A;  4KDP A;  2JRT A;  4O3M A;  2MA3 A;  2QM3 A;  3SZT A;  3C7J A;  1J9I A;  2PMU A;  2GXB A;  1U3E M;  3C18 A;  3I54 A;  1QO0 D;  1SD5 A;  5E1W A;  4LJZ F;  2R7F A;  2HDC A;  1Z91 A;  3RYR A;  1USS A;  4IPA A;  5HLH A;  3M7G A;  2EFN A;  1IN5 A;  4ZYH A;  2CFX A;  4DNC A;  3DEU A;  2FF4 A;  3T8R A;  1K7A A;  3C3W A;  1FSH A;  4MTD A;  3L09 A;  2HR3 A;  2LF7 A;  2W57 A;  3IKV A;  4RGS A;  3FMS A;  1E17 A;  1MZB A;  1O7L A;  1ZHF A;  2ZJ2 A;  1Z7U A;  4CYD A;  1F5T A;  5CVR A;  3K2Z A;  1T0F A;  3JTH A;  1IF1 A;  2RDP A;  2GZW A;  2YU3 A;  5BMZ A;  3MAJ A;  3VOE A;  1IW7 F;  1IXS B;  2XGX A;  4JBA A;  2ISZ A;  1FBQ A;  3B02 A;  4Y15 A;  2QQA A;  4P9F A;  5HDN A;  4HA8 A;  1W7P D;  1J7K A;  3KP6 A;  3KEQ A; 
#chains in the Genus database with same CATH topology
 2EA4 A;  3OYN A;  2K40 A;  1BR1 A;  2MBF A;  1ZRD A;  1ZR2 A;  3L00 A;  3RDI A;  4YRV A;  3TOB A;  2P81 A;  1BJZ A;  1JHH A;  1WJ5 A;  3K6G A;  5DUK A;  5AIP A;  3H3V K;  4HOB A;  3S15 J;  2HS5 A;  4DW6 A;  2XPU A;  4XLA A;  3CDH A;  2FBI A;  4BXU A;  1ON2 A;  5J3L A;  3K9T A;  4HV6 A;  4EVI A;  4D7N A;  1OMI A;  1D1B A;  3HKZ N;  2V79 A;  2DU9 A;  1QHG A;  1QZZ A;  2FBH A;  5M3F J;  4KN7 X;  3WG7 H;  1FTZ A;  2HOE A;  3HHH A;  1WHU A;  2KQR A;  4LG0 B;  2HVR A;  4U87 A;  2L9R A;  2L4M A;  4RB0 A;  2NS0 A;  4EQQ A;  3I56 I;  3I4N J;  3U9G A;  5LGT A;  2EFO A;  1TTY A;  2Y0S N;  3JRH A;  3TED A;  2HOS A;  1V54 H;  2OJE D;  5H6R A;  4DBQ A;  2JN6 A;  3KLN A;  3LA3 A;  3SZP A;  2VE9 A;  4E7L A;  1VQ5 I;  2Q8K A;  1N77 A;  3VWB A;  2IS2 A;  1TWG J;  4UY8 I;  4XON A;  1XX5 A;  3QWL A;  2DA7 A;  3D5S C;  2UXN A;  4CZC A;  2OTL I;  3ULQ B;  5EGO B;  3K4K A;  2WY7 Q;  2L7F P;  1T56 A;  2VOO A;  3EUK L;  2R7O A;  3QOE A;  5EZH A;  2QEX I;  4XKB A;  4XRM A;  1YQA A;  1WKM A;  2X1C A;  4XMY A;  1ZTR A;  3J80 K;  2G7U A;  2KKO A;  2JMW A;  4KIG A;  4HST A;  4LD5 A;  2EFW A;  2F5C A;  3FK6 A;  1K61 A;  1YG2 A;  3QRF F;  2BHZ A;  3K4C A;  4HLX A;  2VQC A;  3TO7 A;  4AC0 A;  4JX4 A;  1RR7 A;  3CCR I;  4JK1 X;  3OMY A;  4PJ0 C;  4XKW A;  4QIW N;  4YIR X;  1IAW A;  1I6H J;  2H27 A;  5F04 A;  3K1N A;  1OKR A;  2LY9 A;  3DPU A;  1SAX A;  1RI7 A;  3CJQ B;  4HBL A;  2JVG A;  3DEE A;  3DBR B;  4ZZL A;  1EH6 A;  4KIB A;  1OCO H;  2DAO A;  3OYA A;  1OQY A;  3HC7 A;  3GO5 A;  1HST A;  1MH4 A;  2MGQ A;  1SD6 A;  2R7U A;  4L0Z B;  3LFU A;  1JUP A;  1FP1 D;  3Q3S A;  2VOP A;  1KYW A;  4I99 C;  1MBG A;  2VKV A;  1XG1 A;  3S93 A;  5HLI A;  3H9G A;  1IXR C;  2B9S A;  3KZY A;  3DTI A;  1R71 A;  1KA8 A;  1H9G A;  1W1W E;  1YLF A;  2XGE A;  3DPL C;  4F3Q A;  4C2U A;  1R5H A;  1Z67 A;  4FE4 A;  3I53 A;  1WGX A;  5C3E J;  3J80 Z;  2DCE A;  2LH9 A;  2ZFU A;  1G8X A;  2EFP A;  1W5S A;  1LE8 A;  1IGN A;  5M5Y J;  4KJZ A;  3CO6 C;  4IEJ A;  4XSZ F;  4IQJ A;  4KN4 X;  5H20 A;  2IGO A;  4S0H B;  3ERE D;  3VB2 A;  2VIX A;  2VQL A;  5BQT A;  2VAS A;  3MKL A;  3OYJ A;  2E1C A;  1LVK A;  2XC7 A;  3E6D A;  2IW5 A;  3CDI A;  3F8N A;  4XM3 A;  3OYB A;  3SJM A;  2CMP A;  2EV0 A;  2VKH A;  1BN5 A;  4MQV A;  5ERI A;  3A01 A;  2CW7 A;  1G3T A;  5A2Q Z;  5D5V B;  5HS7 A;  3LSK A;  4RGX A;  4ABZ A;  2RRE A;  2QYO A;  2UXX A;  4PJJ A;  5E3N A;  1RIO H;  2M9H A;  4G6T B;  3TOA A;  2ID3 A;  3VYU B;  5E17 F;  1ULY A;  2FQ4 A;  4NNJ A;  2QBY B;  2R7W A;  4M3D A;  1XS9 A;  2M3A A;  4YEJ A;  3DEW A;  1EF4 A;  1FOX A;  2NNN A;  1C0W A;  3NRV A;  5F6F A;  4QTR A;  1X4O A;  4G8X A;  1K4S A;  2CGP A;  4JYK A;  3IP4 B;  3A4C A;  1R23 A;  1A31 A;  1MDM A;  2ME6 A;  2IP2 A;  1G3S A;  2WY8 Q;  2RAE A;  1MGT A;  4UUT A;  1WCM J;  4DYC A;  1HDD C;  4FX0 A;  1WFX A;  2O6G E;  1S8N A;  3KIO A;  5E3L A;  2R7S A;  3HUG B;  4ITV A;  3FIS A;  1PYV A;  3J81 K;  5GTH C;  1ZLK A;  4IVN A;  3J7Y J;  2YR2 A;  3CME I;  2DMT A;  4S04 A;  1TC3 C;  1TQP A;  1Z77 A;  1VQM I;  1Y0N A;  1O3T A;  1CF7 B;  2R7Q A;  4YG2 F;  1H89 C;  1RUN A;  2EK5 A;  4HPQ A;  2ZJQ F;  2E1M B;  4A0Z A;  1Z3X A;  2PMZ A;  4PK4 A;  1I3Q J;  3TO6 A;  4UUS B;  4M71 A;  3F8M A;  2P0W A;  1I3A A;  4PSX A;  2OCE A;  3CMA I;  3RKY A;  4A3I J;  1W0T A;  3KP5 A;  5E18 F;  3WTW C;  2E71 A;  1GV2 A;  3PIO F;  1OCP A;  2COM A;  5BS6 A;  3IKT A;  1Q1V A;  4KIS A;  1B6A A;  1BOA A;  3FBN B;  1JXS A;  3M8E A;  3VYR B;  3S3M A;  1VFC A;  2EIL H;  1EH8 A;  1U5T A;  2DQR A;  4NUB A;  4AVP A;  4CXF A;  2NVQ J;  1YW8 A;  1B9N A;  3J7A Y;  1YI2 I;  2ELH A;  1FX7 A;  5FLV A;  1BW6 A;  5HDK A;  3L2V A;  5FJ8 J;  4ESJ A;  2E7W A;  4IHT A;  1DQU A;  5J8F A;  4WXC A;  1D1C A;  2BW3 A;  3DFG A;  3W2W A;  2IRF G;  3FXQ A;  2P5K A;  3BWG A;  3TMO A;  1VQ6 I;  2F4O B;  1BIB A;  3K1P A;  1H88 C;  1P6R A;  3K7A J;  2GM4 A;  3MZH A;  4MO7 A;  3FDY A;  1D0Y A;  3PNT A;  2A68 F;  3OYC A;  1RC9 A;  2DOD A;  3QPL A;  3ROU A;  3OYK A;  2KRH A;  5EEG A;  1ETO A;  1YS7 A;  2ZME C;  1JE8 A;  4LFU A;  1IUY A;  3HPG A;  4ZJZ A;  1UB9 A;  3GZN B;  3HRU A;  2WB1 A;  4TV7 A;  1QNT A;  2RN7 A;  1FYM A;  4AD9 A;  4Y3O A;  4H4K C;  2V6C A;  3B6A A;  4FTH A;  1JT0 A;  1WVR A;  1DPU A;  3HGG A;  2VJI A;  1B72 A;  4DYR A;  4DZJ A;  1PVE A;  1XGS A;  4EGZ A;  4B09 A;  2JRM A;  2VKE A;  4M9Z A;  2XF7 A;  2DI3 A;  3OIP A;  2OZU A;  4HX7 A;  1GXQ A;  4L9T A;  3SQN A;  1GVD A;  5BPD A;  4L5E A;  4U88 A;  1YRN A;  2CG4 A;  1FP2 A;  5IOY A;  3DKW A;  4A93 J;  4HX8 A;  5FKO A;  2Y2Z A;  3RI4 A;  3ZMS A;  3CLO A;  4AIH A;  1HKS A;  1NH3 A;  2CJJ A;  3AKZ A;  2VJ4 A;  3O8G A;  1IJW C;  1IRG A;  4GFB A;  1R49 A;  3LSP A;  5L3D A;  3ZP5 A;  1HKT A;  4QWQ A;  1U6G A;  1TT0 A;  3GME A;  3A1Y A;  1G3Y A;  4N4O B;  3WG9 A;  5D6E A;  2CQK A;  2W1O A;  4QSH A;  3L2R A;  3Q5F A;  1A04 A;  2WAD A;  3Q0V A;  2PJP A;  1I5Z A;  4Q4Z F;  3LWF A;  4Y33 A;  2KP6 A;  1ZRC A;  5B3S H;  2HGC A;  3D5L A;  1JT6 A;  2Z33 A;  3PSI A;  2PJR B;  4KIC A;  3CJN A;  3ZMT A;  2K3P A;  3KEQ A;  3LA7 A;  3U1K A;  3COA C;  3CF2 A;  3QAH A;  3P9C A;  1K83 J;  3DV8 A;  1S6L A;  1LDK B;  4I01 A;  4A3C J;  2AQF A;  4F91 B;  3ZR8 X;  4BHB A;  5IPA A;  5GAH J;  1ZGW A;  9ANT A;  1TL8 A;  2IBD A;  1MMD A;  5J6X A;  2M45 A;  3L2W A;  5J4Y A;  3K4N A;  1ZRE A;  3S1N J;  2VB6 A;  4JX5 A;  4BEH A;  3OR1 C;  1SD7 A;  4XKC A;  1HDP A;  2V9V A;  4RAY A;  3R0A A;  2FOK A;  1MBF A;  2RQQ A;  1ZR4 A;  1IG7 A;  1PUE E;  3ELK A;  4MIM A;  4ENM A;  5DDG A;  4WXD A;  1QHH D;  5LRR A;  2XSD C;  1MMG A;  3IHU A;  3OOU A;  3FHN A;  1KQ0 A;  3BG7 A;  2O3F A;  2IT0 A;  1R7J A;  2P7V B;  3F6O A;  1YIO A;  2FE3 A;  4U0V A;  3M07 A;  2VL8 A;  1VND A;  5C4X J;  1E0E A;  3H5A A;  2D2W A;  3EDP A;  1T38 A;  4EAT A;  3RPU A;  1OYW A;  3CCU I;  2EZK A;  2KJC A;  1ITY A;  1X3U A;  1XN7 A;  1IO2 A;  1TW3 A;  4AYB A;  4BDY A;  1FSE A;  5LGN A;  1NG7 A;  5EG0 B;  2W25 A;  2HWV A;  1SD4 A;  2FA5 A;  2OC6 A;  1QU3 A;  2HFH A;  2V1U A;  1FY7 A;  4L0Y B;  2O0Y A;  2NVU B;  2HQN A;  3IWF A;  2XV4 S;  2CWE A;  5DM7 F;  3KET A;  4BDZ A;  2JA8 J;  2NVX J;  2A6T A;  1ZH5 A;  5FLX Z;  1S7A A;  3ZQ7 A;  1MIJ A;  4NQW B;  1JGG A;  4Q5S F;  1BOB A;  1I1S A;  4A3K J;  5HS9 A;  5EEA A;  1W7P B;  5FKN A;  3FXR A;  4L18 B;  2TCT A;  4BGD A;  1MSE C;  4CYC A;  3Q9S A;  2XAJ A;  2VBW A;  1EH7 A;  2EA2 A;  2PBI A;  2JUC A;  2XRL A;  1SMY F;  4CZZ A;  2ZSH B;  4EMS A;  4HNT A;  1YIJ I;  3MMY B;  3GVA A;  5ILV A;  2PEX A;  3O2P E;  1MH3 A;  3LAJ A;  2DXI A;  4L5J A;  5E79 C;  3F72 A;  5ICG A;  4AVZ A;  3WU0 A;  3FF5 A;  2FJ1 A;  5DD4 A;  2BY1 A;  5E1Z B;  1B4A A;  3SHF A;  2XAF A;  1S7O A;  5DEQ A;  4RB3 C;  3CCE I;  1DP3 A;  2YS9 A;  1T0F C;  3I4P A;  4LK0 F;  3RJP A;  1N78 A;  2BZT A;  2YPR A;  4XRS G;  2CUZ A;  2L2O A;  1PUF B;  3G4S I;  3H9J A;  4HZF A;  1WRJ A;  2K7L A;  1CGP A;  4L9J A;  1WPK A;  2DT5 A;  2O61 A;  2Z3Y A;  2VJ5 A;  3GTJ J;  2GOX B;  5J4V A;  4FIS A;  3CO7 C;  1O3Q A;  2FML A;  4CCN A;  3AFH A;  3ASN H;  2DOE A;  1U78 A;  1X1D A;  3FXM A;  2XAQ A;  5LGU A;  5K5Q A;  1UZC A;  4GRI A;  3K0L A;  1NK3 P;  1BI3 A;  5DCF A;  4L9N A;  4XLC A;  4U0W A;  1IN6 A;  4PZJ A;  4LG0 A;  2NVT J;  1D5V A;  4CA0 A;  2NAZ A;  3LA2 A;  1ZG3 A;  4NBQ A;  4C30 A;  2OQR A;  4KIT B;  2H8R A;  3N05 A;  1FIP A;  5HLT A;  2M5W A;  4WXH A;  3F6V A;  3WTV C;  5ICC A;  4DBR A;  4C3J J;  3N4M A;  4G12 A;  2LP0 A;  2WAQ N;  3QPS A;  1RZ4 A;  1ZAR A;  3MKZ A;  1T33 A;  4LIU A;  3LQQ A;  3OIQ A;  1JKQ C;  3CZ6 A;  2O8X A;  2MYS A;  5EGO A;  1K78 B;  4G6D A;  4WCG A;  3HG9 A;  4A69 C;  4XBF A;  3S32 A;  1R36 A;  1G2H A;  3PL8 A;  3BRO A;  4OIN F;  1GT0 C;  3WE2 A;  1IC8 A;  4DQ2 A;  4BJT A;  4YIF A;  1SAU A;  3V4G A;  5KNL A;  4ZDO A;  2UUZ A;  5FKL A;  1GVJ A;  3I3L A;  1R6R A;  3NEU A;  2HZT A;  4EJT A;  2DFI A;  4CCL A;  4D7M A;  1K79 A;  5J1R A;  3WOD F;  3EUH A;  2DQL A;  4IF4 A;  4QLC U;  3E6M A;  4A2U A;  2Y69 H;  1ZAO A;  4I76 A;  1X19 A;  2EZL A;  1BL0 A;  3HSR A;  4E4H A;  5CVV A;  3OSF A;  3TW7 A;  5L3E A;  2V1D A;  1S7E A;  5EDN A;  3WU1 B;  2LOO A;  2WC2 A;  5FD6 A;  4KFC A;  2M87 A;  2HNH A;  2FBK A;  2PFB A;  2QSF X;  4E7K A;  4HSR A;  1LDJ A;  5IYC J;  2AO9 A;  3O3K A;  4LLL A;  3BY6 A;  2YU9 J;  4A6E A;  5F0H A;  3C2H A;  1LFU P;  4YFK F;  4B1R A;  4FT8 A;  2D1V A;  2LK2 A;  1K4T A;  2BY3 A;  4KUM A;  2EB7 A;  3FBI B;  1GDT A;  1MJB A;  1U9N A;  4LB5 A;  3MZY A;  2NNY A;  3FIW A;  3M3Y J;  1IN8 A;  2ECC A;  2OBP A;  3HL2 A;  1V4R A;  3W2A A;  2XPV A;  2MC3 A;  1S3J A;  2DA3 A;  2E35 A;  3DXJ F;  3QQA A;  2XIG A;  2LD5 A;  1BI0 A;  4U7B A;  4XLF A;  3PUF A;  5J8C A;  1MKM A;  3MEX A;  4CCM A;  2DK8 A;  2NXN B;  3FMR A;  2FXA A;  3GTO J;  2ZNY A;  4AM3 A;  1K6O A;  4GO1 A;  2Z99 A;  1OR7 C;  1OYI A;  2DA4 A;  2PG4 A;  2W4S A;  2R5Z B;  1LNW A;  4A5M A;  5BPI A;  1XPX A;  2E7X A;  2L9V A;  3VOD A;  4PGH A;  3VFZ A;  1LDD A;  5K5R A;  1SVL A;  3WHB A;  2DA6 A;  3V8L A;  4E7H A;  1VQ8 I;  1TWH J;  1ZQ3 P;  3V7R A;  5IYB J;  3VYT B;  4WX9 A;  1Y0U A;  3NAR A;  1W5C C;  5FB2 A;  1X4P A;  1YS6 A;  1N75 A;  2OTJ I;  3BPX A;  2XB5 A;  4AID A;  1WJC A;  4OU0 A;  3PO2 J;  2K86 A;  4LG3 A;  3T5X A;  2IA1 A;  3CJT B;  2QBY A;  1X1B A;  2O9L A;  4KNY A;  4PGG A;  4A5N A;  2W24 A;  3RCO A;  1ONV A;  2HQR A;  3JRE A;  3RZD J;  4JOM A;  2ICW G;  2TRT A;  3BR2 A;  4E7J A;  2CUF A;  2CO5 A;  3RQI A;  4DGW B;  2X51 A;  1ETX A;  3S2W A;  2XF6 A;  2L7K A;  3HSE A;  2ESN A;  2MAB A;  3C1D A;  1UHS A;  2X6X A;  2Q0O A;  3V7S A;  4X0G A;  1RRJ A;  5KK1 A;  1SMT A;  3MKW B;  2FUG 2;  5CVI A;  3QPT A;  2B0L A;  5M5W J;  1J09 A;  5TJJ A;  1A36 A;  2HDW A;  4AUX A;  4EM1 A;  2JVH A;  1P4A A;  2KMU A;  1J5Y A;  1DU6 A;  3HOV J;  4UB8 C;  4CO8 A;  5DYM A;  4MEY F;  5LEK A;  5FO5 A;  1FLI A;  3WTT C;  4UVB A;  3ABK H;  4YFX F;  1R22 A;  2MG4 A;  5GTI C;  4XSX F;  4ZTJ A;  2JWT A;  2Q2E B;  4II3 A;  2ESH A;  1CF7 A;  2V9K A;  3E5X A;  2LRE A;  4NC8 A;  1SFX A;  5F64 A;  1SVO A;  2KIS A;  1I50 J;  2Y9Z A;  2MH2 A;  5DUI A;  2J5P A;  3WE3 A;  5IOZ A;  3QP6 A;  2XKO A;  3GBG A;  5GAD J;  4ESF A;  2LVS A;  4UUS A;  5HS8 A;  1NTC A;  1JTY A;  3KYL A;  5LHG A;  2QA4 I;  1FBU A;  2FU4 A;  5A2Q K;  4KMU X;  1XGN A;  2DA1 A;  2XB0 X;  3CCS I;  2K9N A;  2O03 A;  1D8J A;  3ABL H;  1FJL A;  2CQN A;  3IH2 A;  1ETY A;  2E2H J;  4ASN A;  4X1E A;  5FKM A;  2G9W A;  2CV1 A;  2W82 A;  3ZMZ A;  1P4W A;  1IRF A;  1ZN2 A;  2FX0 A;  2IVM A;  3BR5 A;  4IHS A;  1LVA A;  2V26 A;  4I0A A;  5IP9 J;  1I6X A;  2M2E A;  2VT3 A;  5D8L B;  1JHF A;  1U5T C;  3IAS 2;  1Z7L A;  3E1S A;  3ML6 A;  1UFM A;  2OPT A;  1RNL A;  2X85 A;  3ABM H;  3HOS A;  1CQT A;  3NWT A;  1BIA A;  2D1H A;  1BM9 A;  2Z1D A;  2M4K A;  2XHK A;  4UV9 A;  4V2F A;  2Y31 A;  2QLZ A;  1U8B A;  1UG2 A;  4Y17 A;  5IY5 H;  4HLY A;  2DMN A;  2X6O A;  2ETH A;  1MNE A;  5LEJ A;  2VN2 A;  1FTT A;  2E34 A;  3QOD A;  1TQI A;  4LK1 F;  1ZKG A;  1AKH B;  1XCV A;  3BPV A;  4HNV A;  5DTD A;  5EJC A;  3OYF A;  1HBX G;  3E7L A;  2JQ7 A;  1FPQ A;  1ODD A;  2FEZ A;  2HQ5 A;  5ICE A;  3F23 A;  5FGM A;  5J40 A;  4DIQ A;  2VJJ A;  2XUB A;  3ZCO A;  4M9S A;  3BR1 A;  3F0C A;  5CVU A;  4PJL A;  3QYE A;  4IRG A;  4Y52 J;  3I9V 2;  2AXT C;  2E2J J;  4G6Q A;  5HNH A;  3OWT A;  2PMZ N;  4IZZ A;  2RNJ A;  1MBE A;  2I10 A;  2KIM A;  5GPA A;  4UHT A;  2GA2 A;  3J7A O;  3HEF A;  3P9I A;  3HBL A;  4BS9 A;  4P5O A;  3JRA A;  1AWC A;  3HTS B;  2F5F A;  4IRH A;  3OR2 C;  3UKG A;  2EBI A;  1P92 A;  3S16 J;  3SEZ A;  3ZRG A;  2KZG A;  3CES A;  3GFJ A;  3SXY A;  2QWW A;  3OV8 A;  1F43 A;  1I1G A;  3GFI A;  4M73 A;  2W7N A;  2ADU A;  4ENJ A;  1R1V A;  3CP8 A;  3M1C A;  4HW0 A;  2GIZ A;  4A3B J;  1T98 A;  5TRD A;  2MLK A;  2BV6 A;  2V4J C;  5M3M J;  1PP7 U;  2NVY J;  4G7H F;  2RC4 A;  4CH7 A;  1LEA A;  3H9Q A;  1Y56 A;  1SFO J;  1P7I A;  4M6Y A;  2JUG A;  2QEN A;  1GV5 A;  3JAM Z;  2BGC A;  3BQY A;  2DJN A;  1XC5 A;  2MH9 A;  3CTA A;  3A2K A;  1H8A C;  3OYM A;  3JSP A;  4D5C A;  1UHM A;  4BQO A;  4R8H A;  1FMV A;  3O8H A;  3UR3 C;  3L2C A;  3S3N A;  3T8T A;  2KZV A;  3AL0 B;  2VC0 A;  4A3E J;  5B66 C;  4LB6 B;  2PJR A;  3ZQQ A;  1T08 B;  2HXI A;  2K5C A;  2PI0 A;  2BHY A;  1XGM A;  4FQG A;  3SFZ A;  3TDZ C;  1QVT A;  1B59 A;  2WB1 N;  5L3C A;  5CKT A;  2OUM A;  5FRM A;  2VOD A;  3CUQ A;  1DP7 P;  3DP7 A;  2XDV A;  3LOC A;  1TWF J;  3GF2 A;  4GYG A;  5KCM A;  2A61 A;  3LSM A;  4D0P A;  4U0Y A;  2DDA A;  3MFK A;  3S14 J;  4BQA A;  2YUS A;  5KAF C;  4E6K G;  1V55 H;  1M1E B;  1MBK A;  3HB9 A;  3D0S A;  1EV7 A;  4HF0 A;  4MTE A;  4PCQ A;  2XKP A;  4RAF A;  4KT5 C;  3G71 I;  1Z6T A;  2B7E A;  5E8G A;  3BTI A;  3IL2 A;  1B1B A;  1QRY A;  2GBY A;  3EPZ A;  2VON A;  2EIN H;  4ZYE A;  1DUX C;  4I09 A;  2ACJ A;  2A69 F;  2FSW A;  4RMN A;  2M8E A;  4I6Z A;  2FNA A;  1G3W A;  1U9O A;  3ISP A;  1VQL I;  1IZ1 A;  5D5X B;  3D5R C;  3ERM A;  2PLY A;  2LF8 A;  2X6Y A;  2DYR H;  1SAN A;  5D4S A;  1YJW I;  4BY1 J;  4AU7 A;  1FBS A;  3WTU C;  2LYC A;  2AHQ A;  1LE8 B;  5EG0 A;  3HOT A;  2K9L A;  4W97 A;  3U21 A;  2HOT A;  2XGD A;  4GYI A;  3HPH A;  2IJL A;  2DFF A;  3B6C A;  1A5J A;  1V5F A;  2JSC A;  4NC7 A;  1YTY A;  3HJE A;  4N9I A;  3S1M J;  2OZ6 A;  4XNF A;  3IUO A;  5CQG A;  3IV5 A;  2X9D A;  2OF7 A;  2HZD A;  2L7Z A;  4M3G A;  1TT5 B;  3T0Y A;  3GEZ A;  2BBY A;  2RQP A;  2JK3 A;  2XAG A;  1W7P A;  4BNC A;  1FOY A;  4V2G A;  4HF1 A;  3H35 A;  2DMU A;  5CQE A;  2QF7 A;  5EYR A;  2Y0M A;  1ENH A;  3A01 B;  4AIJ A;  3EYY A;  1JI8 A;  1SFE A;  3CCV I;  1QZY A;  2VQG A;  1B8I B;  3FK7 A;  1A6I A;  3FWE A;  4R79 A;  1P4X A;  1ZGJ A;  2ZC2 A;  1MBJ A;  1F1Z A;  4HDV A;  5H2F C;  5IP6 A;  1O4X A;  2L9N A;  2I8D A;  1JGS A;  1WJD A;  3BP8 A;  4FAS D;  3TKY A;  3R4K A;  3G3Z A;  4D5F A;  1FOK A;  5HOO A;  3V8J A;  3ZMU A;  3F8F A;  2MW8 A;  3C2G A;  4RB2 C;  2G0E A;  4Y13 A;  3OS1 A;  1N25 A;  5J1Y A;  1TNT A;  4IHV A;  1NG6 A;  3DTE A;  1OFC X;  2YX7 A;  1BC7 C;  2ECB A;  3KP7 A;  3LFK A;  3HYI A;  1MDM B;  1BR4 A;  2LSO A;  5D6F A;  1ZG1 A;  1FC3 A;  2STT A;  4AYB N;  2ZNZ A;  1LJ9 A;  3DLA A;  3JW4 A;  4H0E A;  1XSD A;  3BDD A;  2WWY A;  4HYE A;  5JR3 A;  3A0B C;  4HDU A;  3F8C A;  1YHQ I;  3DKX A;  4HG2 A;  4M6X A;  3GLL A;  2KDO A;  2QQB A;  2VKD A;  4ZH4 F;  2EIJ H;  2F5E A;  3OSG A;  3CMM A;  3ZQF A;  3BT9 A;  3AG1 H;  1SFU A;  3R61 A;  1RKW A;  4ZZD A;  5HLG A;  2HPM A;  1RES A;  2K9Q A;  3RKX A;  1E3O C;  3ZGK A;  1L0O C;  1K6Y A;  5FLX K;  2ZO4 A;  3G73 A;  1T95 A;  2AXL A;  3SDB A;  1BBY A;  3HGY A;  1G6N A;  1TW2 A;  3CUO A;  3LSG A;  2GLO A;  3SDG A;  1IV6 A;  1HOM A;  3QP5 A;  4IQ4 A;  5E3M A;  2RKH A;  3JRB A;  4OOI A;  4G94 A;  4XLP F;  2DA2 A;  1TQM A;  5L3F A;  2HYF A;  1Z1D A;  1MD0 A;  3K4J A;  3RZO J;  5FRO A;  3M1E A;  1REP C;  1U5T B;  2BYV E;  3MCZ A;  1IDZ A;  4IHW A;  1K78 A;  1PP8 F;  3I59 B;  5DD8 A;  3CCQ I;  2A6H F;  3LL7 A;  4M72 A;  4B48 A;  2UZK A;  3HDD A;  3CC2 I;  5DCM B;  2DT7 B;  2HVS A;  3BG6 A;  1D5Y A;  4OIP F;  4Y4R A;  4XOP A;  3H5N A;  1F4K A;  1APL C;  2F6C A;  1XMA A;  3IH3 A;  5CLS A;  5DS9 A;  1KZH A;  1O3R A;  1RUO A;  3K4M A;  3G1L A;  2LRD A;  2L3D A;  1HC8 A;  4DOZ A;  5K5O A;  3A0H C;  3TP3 A;  2R7Z J;  3ZN1 A;  4RB1 A;  2KL4 A;  2AS5 F;  3M8F A;  2V7F A;  1ETW A;  3L9F A;  5DM6 F;  1QGP A;  2XGC A;  5L3B A;  1WSU A;  2LMD A;  3L2Q A;  3GLX A;  2EV6 A;  1YE9 A;  1ZGA A;  2HEO A;  1R58 A;  1YX5 A;  1D8K A;  2BY0 A;  3DTK A;  4PUS A;  2HI3 A;  3EUH C;  3PFY A;  1WH7 A;  2N8G A;  4CHU A;  3ZQI A;  4CCO A;  2A3S A;  1R00 A;  2VE8 A;  3GWZ A;  3K2A A;  2EQR A;  1LQ1 A;  1ZYR F;  1ETV A;  5IT9 Z;  4RM3 A;  2E19 A;  4BUP A;  1RKT A;  4KT6 A;  3WTX C;  1J0R A;  4XOR A;  1JJ6 C;  2ELK A;  3FXJ A;  3QYB A;  5D5U B;  2DTR A;  1EA3 A;  3H3U A;  3F3X A;  1J75 A;  2JA2 A;  3DBL B;  2K4B A;  2KIU A;  4B8X A;  1Z6R A;  2E1O A;  1X1P A;  2UWM A;  3OY9 A;  2ZSI B;  4I0B A;  3CLQ A;  3ECO A;  4BXF A;  2A6E F;  4WWC A;  1W0U A;  3EUA A;  3W6K B;  3NAU A;  1WWX A;  1TWC J;  5BNG A;  3HOW J;  2EJR A;  2VBX A;  2LBF B;  1KU7 A;  4HF2 A;  4N4N B;  3SFI A;  3VDX A;  5LRS A;  3HOZ J;  4NB5 A;  3OL3 A;  2VPR A;  4RAG A;  2FQ3 A;  1R4N B;  3BLY A;  5HDG A;  3I64 A;  1L3L A;  2IGK A;  3JRC A;  1BC8 C;  3PIP F;  2DPD A;  2H94 A;  1XMK A;  3LQR A;  2ZCW A;  3WTS C;  3Q0W A;  1HA8 A;  4A3M J;  1MJ9 A;  2HU9 A;  2Q1Z B;  4WK8 F;  4J01 A;  1VTN C;  2ZKZ A;  1T6S A;  1R5I D;  3BG5 A;  2M8G X;  3QYF A;  2CYY A;  2L01 A;  3JRI A;  4KMF A;  4F92 B;  1ZRF A;  1KU9 A;  2M1B A;  4YII A;  2M0C A;  5E8I A;  4MLO A;  5CPR B;  4E7S A;  1YX3 A;  2R92 J;  2DTZ A;  4XN3 A;  3FXU A;  2WBM A;  2HKO A;  3CQZ J;  1VF9 A;  3B73 A;  3BG3 A;  3L7W A;  1ORK A;  2ZBK A;  2HXO A;  2UV1 A;  1O57 A;  1YO5 C;  4A0Y A;  3JRG A;  1VQ9 I;  2V1X A;  1JKO C;  4G7O F;  4PFP A;  4C2T A;  2IS6 A;  2V1N A;  2EZH A;  3IC7 A;  1WJB A;  4KYW A;  3S2H J;  2X1D A;  2W84 A;  3LST A;  2R7R A;  2XPW A;  1IUF A;  2QQ9 A;  2X4H A;  3KP2 A;  5CJ9 A;  4IKF A;  5EF6 A;  3RSN A;  3BZK A;  1DPR A;  4E7I A;  4A3G J;  3IRR A;  4ENK A;  2HPI A;  3LSI A;  3LSR A;  2ID6 A;  1TBX A;  3LAP A;  1HLV A;  4CDG A;  3ZQG A;  3A02 A;  3U2R A;  3CMY A;  4M6V A;  1ZEL A;  3RIR A;  2IS1 A;  1MJA A;  4B47 A;  5EEH A;  1TWA J;  1Z3Y A;  2I5U A;  2DW4 A;  2DO7 A;  2HTS A;  2X1E A;  2RV8 A;  4OIR F;  2QUF A;  2DFE A;  4UUV A;  2CH0 A;  3OS2 A;  4BYY A;  4B3A A;  1KU3 A;  1R9T J;  3GFL A;  2K4J A;  3GZ6 A;  2ZME B;  3HRT A;  5J47 A;  1Y39 A;  3HIF A;  3ZOB A;  2Q2E A;  1UEL B;  2HYJ A;  1J2X A;  3UNG C;  5KHD A;  1QBJ A;  3PM1 A;  3KLO A;  3BJ6 A;  1D1A A;  2P6S A;  1VQ7 I;  3SYT A;  3ECH A;  1Y8R B;  2KFD A;  4EJU A;  2VT2 A;  3RPQ A;  2Y75 A;  3TW6 A;  3GTQ J;  4M3F A;  4PFO A;  3K1M A;  3N97 A;  6PAX A;  4LLG F;  5KVR A;  2Y48 A;  3KZZ A;  1DGR M;  3JTG A;  2DN0 A;  2L54 A;  3QU3 A;  3PFI A;  4OIO F;  4RS8 A;  4UB6 C;  1SVM A;  1UG0 A;  2L9S A;  2D45 A;  1FOW A;  1VQP I;  2IA2 A;  1A6Q A;  2BOL A;  2EV5 A;  2JT1 A;  2GA1 A;  3KE2 A;  2NS8 A;  1Y1W J;  1QA6 A;  3RQ4 A;  2Z16 A;  3VPR A;  3AG3 H;  4LGW A;  3C2B A;  4B43 A;  3RYP A;  2CFO A;  2HQA A;  4D1Q A;  1YJN I;  1BJA A;  4S05 A;  2DMQ A;  4P55 A;  3BTL A;  3E3V A;  1VZ0 A;  1U8R A;  2P8T A;  4IRI A;  3ZQH A;  2JJ7 A;  4GCV A;  3K69 A;  1IN7 A;  3M9A A;  2GAU A;  1JTX A;  3A03 A;  3DU6 A;  2CV0 A;  1R5G A;  2K85 A;  3S8P A;  3PQK A;  3BJO A;  3KEY A;  4P96 A;  1KGS A;  1EJ9 A;  2P7C B;  2YSR A;  3TDU C;  1OCT C;  2A5W A;  3DLL F;  2L5Q A;  4BY7 J;  3OS0 A;  4C3H J;  3BTC A;  4F7Z A;  2L02 A;  1XSV A;  1HKQ A;  5K1Y A;  2LLK A;  1IV8 A;  3CF5 F;  1T8I A;  5C44 J;  3BCA A;  3TP0 A;  3WGH A;  1WJE A;  1XCB A;  3S2D J;  4DJA A;  2R4G A;  4BBS J;  3K4B A;  1KYZ A;  4MHG A;  1YW7 A;  2EIM H;  3DWL E;  2OU2 A;  4HV5 A;  3FKI J;  1DGW Y;  1GHC A;  2PX9 A;  2XAH A;  4W1U A;  5IT3 A;  4CIC A;  5E1X A;  1XDS A;  3BQZ A;  4HX4 A;  4QPQ A;  2JPB A;  4A12 A;  4MQ9 F;  4LMY A;  4BBR J;  2EPF A;  4ZYA A;  2QKM B;  1A35 A;  3VSL A;  4G7Z F;  1NHA A;  3F8B A;  4FE7 A;  1E3H A;  4IHY A;  3CC7 I;  3MZ8 A;  1UAA A;  1RET A;  2CW0 F;  3GZ5 A;  3M4O J;  2FNP A;  1SFK A;  5AON A;  3HHG A;  2KJB A;  1OCZ H;  3BR3 A;  3HM5 A;  2ZJR F;  1LKX A;  3H3Z A;  4A3L J;  3HUG A;  4UXN A;  1X1C A;  1HW1 A;  3FXL A;  1WZ2 A;  3JCU C;  3KYD B;  3E5Q A;  1KQ9 A;  1QZE A;  3HOU J;  4EGY A;  4EEF G;  1ETQ A;  2H1K A;  2F4M B;  2PQ8 A;  2K02 A;  3HSF A;  2EWN A;  4HEA 2;  3BZ6 A;  4P1W A;  3K70 C;  2XAS A;  1ERD A;  3WGG A;  5HVQ C;  3V42 A;  1F9N A;  3REO A;  2NYX A;  2C6Y A;  1T2K A;  4A6D A;  2FRH A;  5ILS A;  3PNV A;  4UVA A;  1TLH B;  1U2W A;  4PSW A;  2CUE A;  3HRM A;  2GIV A;  3KX2 A;  1IDY A;  4AIK A;  4O6J A;  2VUM J;  1RPW A;  4E7Z A;  1R1T A;  1JKP C;  3S1Q J;  2M34 A;  2VBY A;  3CUQ C;  3DU5 A;  4Q48 A;  2FMY A;  3BCB A;  3ESW B;  3HKZ A;  1MBH A;  3BC8 A;  1IRX A;  3V7C A;  2F5D A;  2OQG A;  2W48 A;  2LY2 A;  1F36 A;  3DPT A;  2KRF A;  5LFA A;  2OD5 A;  1S9H A;  5GAE J;  5L3G A;  3VYS B;  2Y0S A;  2R5Y B;  4AWX B;  1OCC H;  3GX4 X;  3TL4 X;  3H1C A;  1W5T A;  2LKS A;  5BOX A;  5KAI C;  3RPU D;  4LLN A;  2IGM A;  4ZYD A;  2ISY A;  2VXD A;  4A3D J;  1E2X A;  1FNN A;  4ZYG A;  4ON0 A;  2W85 A;  5ILU A;  2LY1 A;  3E0J B;  5M5X J;  4KA4 A;  1R1U A;  4FCY A;  4XL9 A;  2LNB A;  5TIS C;  1OR7 A;  4QPO A;  2EH3 A;  2GXG A;  5JHU A;  3JAM K;  1W36 D;  2ME0 A;  2XSJ C;  4CUG A;  3JR9 A;  4A3J J;  2IGN A;  2F2E A;  3WU2 C;  4EM2 A;  3VSK A;  4L5I A;  1ZLJ A;  3EET A;  1XDU A;  1S29 A;  3FM5 A;  2CRG A;  4JQF A;  3AAF A;  2WTE A;  4BL0 B;  4XID A;  4RAZ A;  2X0L A;  3BTJ A;  1HQC A;  3P9K A;  3R0J A;  1G59 A;  1V5E A;  2B63 J;  1PJR A;  2GQQ A;  3FX3 A;  3KFW X;  4M9X A;  2IAI A;  1R4M B;  2JZY A;  3AG2 H;  1KQ8 A;  3O6B B;  3LMM A;  2KIF A;  1B8I A;  2Z5U A;  3HXL A;  3OYG A;  3JRD A;  1FWZ A;  2G7H A;  2NRA C;  2P6T A;  1ZK8 A;  4FET A;  2E5Z A;  1OJL A;  3CP2 A;  2FD5 A;  3PSF A;  3W6V A;  2CSO A;  3OIO A;  4XN0 A;  2M0M A;  5JLW A;  2R7T A;  3W2V A;  1BW5 A;  2NOG A;  2X48 A;  3T1B A;  1YIT I;  1P7J A;  2KHM A;  4M3B A;  3PQJ A;  2V6E A;  3TO9 A;  3HTU A;  2WV0 A;  3D1N I;  1G4D A;  4OWR B;  4MEX F;  3GFM A;  3R6S A;  3G6E I;  2KPM A;  4BJ5 C;  4O5V A;  4ESB A;  1X2M A;  2L4A A;  2MSY A;  3FZV A;  4F55 A;  1KU2 A;  3FHZ A;  1FYL A;  2BXZ A;  3FXK A;  1UHW A;  1AU7 A;  1X1A A;  4UNO A;  2L0K A;  3I71 A;  4K2E A;  3E6B A;  4BQQ A;  1BA5 A;  3ABT A;  1GUU A;  2LKP A;  3QU6 A;  4EM0 B;  4UV8 A;  2E2I J;  2LDU A;  1OYY A;  3MKY B;  4MFD A;  3H0D A;  3CCM I;  2O5R A;  3KZI C;  4XOT A;  2CS3 A;  4BQN A;  3E97 A;  4IX7 A;  4DZP A;  2DYS H;  3F9K A;  1JUM A;  1WI3 A;  2WAF A;  1AHD P;  2E5N A;  1VQK I;  2QCO A;  1P2F A;  2P5V A;  1D3Y A;  1I27 A;  3GXO A;  4PDK A;  2P5L C;  2MD5 A;  4WF2 A;  3KP3 A;  3KYC B;  1JJ8 C;  1ETK A;  3E5U A;  3S3O A;  2DPU A;  2CV2 A;  2HYG D;  4UVC A;  4BHP A;  2A05 A;  1XMX A;  2EFQ A;  1FEX A;  4MFE A;  2K3F A;  3DCF A;  2MLG A;  1LPQ A;  2VPL A;  2R0Q C;  2PMH A;  2R7X A;  3WTY C;  5LHH A;  4IO9 F;  4CGZ A;  3L2U A;  1S5L C;  4ENN A;  1MSF C;  3LSJ A;  2V9P A;  2VXZ A;  2XRN A;  4U7D A;  5CVJ A;  2IA0 A;  2K9M A;  1Y8Q B;  2BVM A;  4OAZ A;  2NS7 A;  3OYD A;  1BR2 A;  1QQI A;  3NQO A;  1IN4 A;  2ZFW A;  3H92 A;  3KP4 A;  5DV5 A;  5FKK A;  1Z21 A;  3BZC A;  1LEB A;  2E60 A;  2H6B A;  3GW2 A;  1X3Z B;  3QPH A;  2VI6 A;  3I59 A;  3CDL A;  3S1R J;  3WHC A;  2VQH A;  5DCM A;  2DOA A;  5C4J J;  1LFB A;  4R1H A;  3KCC A;  3OYI A;  3ONQ A;  1FZP B;  1YJ9 I;  3J81 Z;  2R7V A;  3QOP A;  4BKX A;  1FIA A;  4BU2 A;  2H6C A;  2RNG A;  2L7M P;  4CCJ A;  2JA7 J;  5B1A H;  2JA6 J;  2BVL A;  2CQX A;  4RGU A;  1MMN A;  4BH9 A;  3M8J A;  5E20 A;  2CU7 A;  5H6Q A;  2M7A A;  1KON A;  2PN6 A;  3EYI A;  3BR6 A;  3E6C C;  4NQW A;  5CYV A;  4N9H A;  4FX4 A;  3TQN A;  3DBH B;  1QPI A;  2R93 J;  1W36 C;  4Z6Y A;  2Z9O A;  1P9Q C;  2ZJP F;  2KLO A;  5D5W B;  3OOP A;  2LG4 A;  3WTZ A;  2GXA A;  4ZC3 A;  3VEP A;  5ED4 A;  1HW5 A;  1RR8 C;  4BJ6 C;  4EJV A;  5F1R A;  4OMZ A;  2LTP A;  2H09 A;  3G1M A;  5HNF A;  3ZPL A;  5GPC A;  4Q47 A;  2OA4 A;  5FFX A;  3H5R A;  1H9T A;  4BAY A;  4JX6 A;  4NC6 A;  4J19 A;  2IPQ X;  3PO3 J;  3IWZ A;  2ELJ A;  2H8W A;  2LFB A;  4PJN A;  2BY2 A;  5GAG J;  3FKJ A;  3OL4 A;  1VQN I;  3GCM A;  2IS4 A;  1WH5 A;  2O7O A;  3DKY A;  3KEO A;  4RGR A;  5TGT A;  4GXO A;  2D5V A;  1Z9C A;  4I02 A;  1Z05 A;  4HRI A;  1LFP A;  2OAZ A;  4M3E A;  3S17 J;  4RM2 A;  4L9V A;  2Z2S B;  2LBF A;  2EIK H;  2LC2 A;  1TNS A;  2WV1 A;  4MGR A;  3K4L A;  4HQM A;  1PUF A;  4J00 A;  1WI9 A;  3U1D A;  4HQE A;  1GXP A;  3G2B A;  3ZN0 A;  2E1N A;  3J7Z I;  4OIQ F;  5AIQ A;  4F93 B;  3Q9V A;  3BR0 A;  3CCL I;  1S72 I;  3BOQ A;  2STW A;  5JLX A;  4A3F J;  2DDB A;  4GGG A;  2WAE A;  5JFR A;  3I0T A;  5FD5 A;  2M30 A;  4YFN F;  2BE5 F;  3P7N A;  3F22 A;  3HZJ A;  4HAM A;  2QSH X;  3ZMV A;  4B3X A;  1UCR A;  3GTL J;  3ZMD A;  1YFH A;  1E3P A;  4I7H A;  1QVU A;  3ZQL A;  4B4C A;  1BI2 A;  1MMA A;  4C2M J;  1O3S A;  2HVQ A;  2DT6 A;  4RLQ A;  2FOW A;  1BI1 A;  1AOY A;  2HOA A;  1HXD A;  1HSJ A;  1OIS A;  4FHT A;  5FRN A;  3WGI A;  5JHF A;  3V8K A;  2MFZ A;  2CW8 A;  2YX4 A;  4XK4 A;  3L1P A;  2QZ8 A;  3TGN A;  1V3F A;  3CUQ B;  2QSG X;  4LOC A;  1O7F A;  2HKX A;  2A5Y B;  1YYV A;  4X6A J;  2RVC A;  4EJW A;  3PUB A;  5IT9 K;  2DOF A;  5F08 A;  1UMQ A;  5LBQ A;  4DYQ A;  3EQL F;  3CJR B;  2TDX A;  3TBI A;  2K9S A;  5K7F A;  1Y1V J;  1I39 A;  1ZG5 A;  1DDN A;  1FMW A;  4V19 K;  4IXA A;  1XB4 A;  3PNY A;  2BXY A;  2NOJ B;  4IOC F;  2DBB A;  3CCJ I;  3MWM A;  4P9U A;  4CCK A;  2WA0 A;  5E3O A;  2ZXJ A;  1J59 A;  3CCY A;  2VC1 A;  3MQ0 A;  3NWS A;  2COB A;  2E36 A;  5LLQ A;  1MW7 A;  2BW3 B;  2M4G A;  2F48 A;  1STZ A;  2GWR A;  5D8K B;  3GUD A;  2ZME A;  1UJ8 A;  3GTG J;  1FT9 A;  4KIF A;  3KPH A;  4OMY A;  4BHC A;  1V5G A;  3RTR A;  4ETS A;  2W00 A;  1X3W B;  5FFZ A;  1XD7 A;  1WJF A;  1UST A;  3LNQ A;  3CC4 I;  2VLA A;  2XVC A;  3PJR A;  1U0J A;  2X6W A;  4NHJ A;  1B9M A;  3W6J B;  4BE1 A;  3RKQ A;  2JPC A;  1XSX A;  5F0F A;  4JP0 A;  4MNU A;  4EV0 A;  1HCR A;  3Q0U A;  4XLE A;  1B72 B;  5JI6 A;  3HRS A;  2XAU A;  1FYK A;  5LHI A;  1EKE A;  2QQ8 A;  2BEO A;  1H0M A;  2CQ7 A;  5K7H A;  4XLN F;  3FM3 A;  2DFH A;  3OYE A;  3I5U A;  1NK2 P;  2EZI A;  1DU0 A;  1Q1H A;  4I98 B;  2HTJ A;  1XGO A;  1YRN B;  4I2O A;  1IXC A;  1SC7 A;  3ABU A;  4IOA F;  3FMQ A;  1QPM A;  3GYH X;  4C3I J;  2F4I A;  3DF8 A;  1IRZ A;  4BE2 A;  1Z0X A;  1ON1 A;  1VI0 A;  1T39 A;  1PDN C;  1W4M A;  5B5E C;  2QGU A;  5K7Z A;  3IAM 2;  5JVT A;  3ZQC A;  5ICF A;  2R5Z A;  4ZTF A;  4G9Y A;  4ZDP A;  4F52 A;  2IXS A;  2A07 F;  3IRQ A;  4XIC A;  1YW9 A;  2OV7 A;  2ZXW H;  3BJA A;  3SZG A;  2JTV A;  1JUS A;  4Y7N J;  1WJA A;  1ACI A;  2R7D A;  3BG9 A;  4II2 A;  2KRC A;  3I4M J;  2JSP A;  1YOV B;  5GP9 A;  2K27 A;  2ZXH A;  1AA7 A;  3GTP J;  4IJA A;  4E70 A;  4Z2Y A;  2CUJ A;  2M7B A;  5B1B H;  1LB2 A;  3X2Q H;  4XQF A;  3OYH A;  2JA5 J;  2AQE A;  3ASO H;  2DK5 A;  2Y9Y A;  3H36 A;  5D4R A;  2HDD A;  2P4W A;  2H1L A;  1GLN A;  4IL6 C;  4EJO A;  4PJM A;  3RKW A;  4RA2 A;  1X58 A;  2VBZ A;  2XRO A;  4XKV A;  3ZXS A;  3HOX J;  4XRF A;  5F0C A;  2XF5 A;  2RGV A;  3DQV C;  2J5O A;  4XR6 A;  4BEH B;  4M74 A;  4GDF A;  3K10 A;  4BAC A;  2O8K A;  4N0B A;  4OAY A;  5F27 A;  2KT0 A;  1HW2 A;  1WQ2 A;  3MD2 A;  3F21 A;  2F5V A;  1VQ4 I;  2CQQ A;  4CSW A;  4RDU A;  3K70 D;  3GTM J;  1D0Z A;  3CD6 I;  2QVO A;  3G1O A;  4C9Y A;  3JSO A;  4A0X A;  5J1U A;  2MC4 A;  1OPC A;  3R60 A;  2R3S A;  1XTA A;  3I58 A;  2DLL A;  5JVG F;  1JKR C;  4KDP A;  3FXO A;  3SEQ A;  3MVP A;  4BE0 A;  1HF0 A;  2JRT A;  2ZB9 A;  5FLM J;  1MMS A;  4O3M A;  2DMP A;  4XRS A;  3HOY J;  2DJI A;  3AL0 C;  2MA3 A;  2QM3 A;  5IP7 J;  2ZXI A;  3SZT A;  3C7J A;  1VQO I;  3H0G J;  1J9I A;  2PMU A;  2GXB A;  1U3E M;  3C18 A;  3I54 A;  1QO0 D;  1SD5 A;  1TZL A;  5E1W A;  3JRF A;  1MNM C;  4LJZ F;  2R7F A;  2HDC A;  2E1M C;  1OLT A;  1Z91 A;  2QKL B;  3RYR A;  1MND A;  1USS A;  4IPA A;  1LUJ B;  4NDL A;  5HLH A;  4RBO A;  3M7G A;  2EFN A;  1IN5 A;  2KIQ A;  4ZYH A;  5F1J A;  2IEK A;  2CFX A;  4B44 A;  4DNC A;  4ZDL A;  2GOM A;  3DEU A;  2FF4 A;  1X2N A;  3T8R A;  2DA5 A;  1OCR H;  2MD0 A;  3IH4 A;  5HOD A;  1K7A A;  3C3W A;  1FSH A;  4HNU A;  4MTD A;  4CYC B;  3GTK J;  1Y6I A;  2Y30 A;  2R5Y A;  3L09 A;  2HR3 A;  4BXX J;  2LF7 A;  2W57 A;  3OYL A;  3IKV A;  4RGS A;  1SEU A;  3FMS A;  2WAQ A;  1MZB A;  1O7L A;  1E17 A;  1ZHF A;  5LD2 C;  2ZJ2 A;  1Z7U A;  4CYD A;  1POG A;  4IHX A;  1F5T A;  5EZG A;  5CVR A;  3K2Z A;  3P5J A;  1T0F A;  2KDZ A;  3JTH A;  4YEL A;  2OCC H;  1IF1 A;  2RDP A;  4LIT A;  2GZW A;  2YU3 A;  4RLF A;  5BMZ A;  1AKH A;  3LSH A;  3MAJ A;  3AG4 H;  3VOE A;  1IW7 F;  1IXS B;  1TP4 A;  2XGX A;  4JBA A;  1D0X A;  3I55 I;  2ISZ A;  1FBQ A;  4LIV A;  3B02 A;  4Y15 A;  2QQA A;  4XLH A;  4P9F A;  5HDN A;  4HA8 A;  3W3C A;  3MN2 A;  2LKX A;  5IYD J;  1W7P D;  4D9J A;  1J7K A;  3KP6 A;  4ANJ A;  2LR8 A; 
#chains in the Genus database with same CATH homology
 2EA4 A;  2MBF A;  1ZRD A;  3L00 A;  3RDI A;  3TOB A;  1JHH A;  5DUK A;  5AIP A;  4HOB A;  2HS5 A;  3CDH A;  2FBI A;  4BXU A;  1ON2 A;  3K9T A;  4HV6 A;  4EVI A;  1OMI A;  2V79 A;  2DU9 A;  1QZZ A;  2FBH A;  4KN7 X;  2HOE A;  3HHH A;  4LG0 B;  2L4M A;  4RB0 A;  2NS0 A;  4EQQ A;  3U9G A;  5LGT A;  2EFO A;  1TTY A;  5H6R A;  3KLN A;  3SZP A;  3LA3 A;  2VE9 A;  2Q8K A;  2UXN A;  3ULQ B;  2VOO A;  1YQA A;  1WKM A;  3J80 K;  2G7U A;  2KKO A;  4KIG A;  4LD5 A;  2EFW A;  2F5C A;  1YG2 A;  3QRF F;  4HLX A;  3TO7 A;  4JK1 X;  1IAW A;  2H27 A;  3K1N A;  1OKR A;  1SAX A;  1RI7 A;  4HBL A;  4ZZL A;  1EH6 A;  4KIB A;  2DAO A;  3GO5 A;  1HST A;  1SD6 A;  4L0Z B;  1FP1 D;  2VOP A;  1KYW A;  5HLI A;  1IXR C;  3KZY A;  1KA8 A;  1H9G A;  1YLF A;  3DPL C;  1R5H A;  3I53 A;  3J80 Z;  2EFP A;  1W5S A;  3CO6 C;  4XSZ F;  4KN4 X;  5H20 A;  3ERE D;  3VB2 A;  5BQT A;  2E1C A;  3E6D A;  2IW5 A;  3F8N A;  2EV0 A;  5ERI A;  1BN5 A;  4MQV A;  1G3T A;  5A2Q Z;  5D5V B;  5HS7 A;  4RGX A;  2QYO A;  2UXX A;  1RIO H;  3TOA A;  5E17 F;  1ULY A;  2QBY B;  2NNN A;  1C0W A;  3NRV A;  5F6F A;  4G8X A;  2CGP A;  1R23 A;  1MDM A;  2IP2 A;  1G3S A;  1MGT A;  4FX0 A;  2O6G E;  1S8N A;  3J81 K;  1ZLK A;  4IVN A;  2YR2 A;  4S04 A;  1TQP A;  1O3T A;  1CF7 B;  4YG2 F;  1RUN A;  2EK5 A;  4A0Z A;  3TO6 A;  4M71 A;  3F8M A;  3RKY A;  3KP5 A;  5E18 F;  3WTW C;  2COM A;  5BS6 A;  3IKT A;  1B6A A;  1BOA A;  1JXS A;  3M8E A;  1EH8 A;  1U5T A;  2DQR A;  4AVP A;  4CXF A;  1YW8 A;  1B9N A;  2ELH A;  1FX7 A;  5HDK A;  4ESJ A;  2E7W A;  4IHT A;  5J8F A;  4WXC A;  2IRF G;  3DFG A;  3FXQ A;  2P5K A;  3BWG A;  1BIB A;  3K1P A;  1P6R A;  3MZH A;  2A68 F;  3ROU A;  5EEG A;  1YS7 A;  1JE8 A;  4LFU A;  1IUY A;  1UB9 A;  3HRU A;  4TV7 A;  1QNT A;  2RN7 A;  1FYM A;  4AD9 A;  2V6C A;  1DPU A;  1XGS A;  4EGZ A;  4B09 A;  4M9Z A;  2DI3 A;  4HX7 A;  2OZU A;  3SQN A;  1GXQ A;  4L9T A;  5BPD A;  4U88 A;  2CG4 A;  1FP2 A;  3DKW A;  4HX8 A;  3RI4 A;  3ZMS A;  3CLO A;  4AIH A;  1HKS A;  1IRG A;  5L3D A;  3ZP5 A;  1HKT A;  4QWQ A;  1U6G A;  1G3Y A;  3WG9 A;  5D6E A;  2CQK A;  3Q5F A;  1A04 A;  2PJP A;  1I5Z A;  4Q4Z F;  3LWF A;  1ZRC A;  2HGC A;  3D5L A;  2Z33 A;  4KIC A;  3CJN A;  3ZMT A;  3LA7 A;  3COA C;  3QAH A;  3P9C A;  3DV8 A;  1S6L A;  1LDK B;  4I01 A;  4BHB A;  5J6X A;  2M45 A;  1ZRE A;  1SD7 A;  2V9V A;  4RAY A;  3R0A A;  2FOK A;  1PUE E;  3ELK A;  4ENM A;  5DDG A;  4WXD A;  5LRR A;  3IHU A;  1KQ0 A;  2O3F A;  2IT0 A;  1R7J A;  2P7V B;  3F6O A;  1YIO A;  2FE3 A;  4U0V A;  2D2W A;  3EDP A;  1T38 A;  3RPU A;  1OYW A;  2KJC A;  1X3U A;  1XN7 A;  1TW3 A;  1FSE A;  5LGN A;  2W25 A;  2HWV A;  1SD4 A;  2FA5 A;  2HFH A;  2V1U A;  1FY7 A;  4L0Y B;  2O0Y A;  2HQN A;  3IWF A;  2XV4 S;  2CWE A;  3KET A;  1ZH5 A;  5FLX Z;  1S7A A;  3ZQ7 A;  4Q5S F;  1I1S A;  5HS9 A;  1W7P B;  3FXR A;  4L18 B;  3Q9S A;  2XAJ A;  2VBW A;  1EH7 A;  2EA2 A;  2PBI A;  1SMY F;  4CZZ A;  4EMS A;  3GVA A;  5ILV A;  2PEX A;  3O2P E;  3LAJ A;  4L5J A;  3F72 A;  5ICG A;  3WU0 A;  3FF5 A;  5DD4 A;  5E1Z B;  1B4A A;  4RB3 C;  2XAF A;  5DEQ A;  3SHF A;  1S7O A;  4LK0 F;  3I4P A;  3RJP A;  2YPR A;  4HZF A;  1WRJ A;  2K7L A;  1CGP A;  4L9J A;  2DT5 A;  2O61 A;  2Z3Y A;  3CO7 C;  1O3Q A;  2FML A;  1U78 A;  2XAQ A;  5LGU A;  5K5Q A;  3K0L A;  1BI3 A;  5DCF A;  4L9N A;  4U0W A;  1IN6 A;  4PZJ A;  4LG0 A;  1D5V A;  2NAZ A;  3LA2 A;  1ZG3 A;  2OQR A;  2M5W A;  4WXH A;  3F6V A;  3WTV C;  5ICC A;  3N4M A;  1RZ4 A;  1ZAR A;  3LQQ A;  2O8X A;  1K78 B;  4G6D A;  4WCG A;  4XBF A;  1R36 A;  4OIN F;  3BRO A;  3WE2 A;  4DQ2 A;  4YIF A;  3V4G A;  1GVJ A;  3NEU A;  2HZT A;  4EJT A;  2DFI A;  1K79 A;  3WOD F;  3EUH A;  2DQL A;  4IF4 A;  4QLC U;  3E6M A;  4A2U A;  1ZAO A;  3HSR A;  5CVV A;  5L3E A;  2V1D A;  3WU1 B;  2WC2 A;  5FD6 A;  4KFC A;  2M87 A;  2FBK A;  2PFB A;  1LDJ A;  3O3K A;  4LLL A;  3BY6 A;  4A6E A;  4YFK F;  4FT8 A;  2D1V A;  4KUM A;  2EB7 A;  1MJB A;  4LB5 A;  3MZY A;  2NNY A;  1IN8 A;  2OBP A;  1V4R A;  2MC3 A;  1S3J A;  3DXJ F;  2XIG A;  1BI0 A;  4U7B A;  5J8C A;  1MKM A;  3MEX A;  2DK8 A;  3FMR A;  2FXA A;  2ZNY A;  1K6O A;  4GO1 A;  2Z99 A;  1OYI A;  2PG4 A;  1LNW A;  4A5M A;  5BPI A;  2E7X A;  3VOD A;  4PGH A;  3VFZ A;  1LDD A;  5K5R A;  3V8L A;  3V7R A;  4WX9 A;  1Y0U A;  5FB2 A;  1YS6 A;  3BPX A;  4OU0 A;  2K86 A;  3T5X A;  2IA1 A;  2QBY A;  4KNY A;  4PGG A;  4A5N A;  2W24 A;  1ONV A;  2HQR A;  2CO5 A;  3S2W A;  3HSE A;  2ESN A;  3C1D A;  2Q0O A;  3V7S A;  5KK1 A;  1SMT A;  5CVI A;  3QPT A;  2B0L A;  5TJJ A;  4EM1 A;  1P4A A;  1J5Y A;  4CO8 A;  5DYM A;  4MEY F;  5LEK A;  5FO5 A;  1FLI A;  3WTT C;  4UVB A;  4YFX F;  1R22 A;  4XSX F;  2ESH A;  1CF7 A;  3E5X A;  1SFX A;  5F64 A;  2MH2 A;  5DUI A;  2J5P A;  3WE3 A;  3QP6 A;  2XKO A;  4ESF A;  5HS8 A;  5LHG A;  1FBU A;  2FU4 A;  5A2Q K;  4KMU X;  1XGN A;  2O03 A;  1D8J A;  4ASN A;  2G9W A;  3ZMZ A;  1P4W A;  1IRF A;  1ZN2 A;  2IVM A;  4IHS A;  1LVA A;  4I0A A;  1I6X A;  2VT3 A;  5D8L B;  1JHF A;  1U5T C;  3ML6 A;  1UFM A;  1RNL A;  3HOS A;  1BIA A;  2D1H A;  1BM9 A;  2XHK A;  4UV9 A;  2QLZ A;  4Y17 A;  4HLY A;  2ETH A;  5LEJ A;  2VN2 A;  1TQI A;  4LK1 F;  1XCV A;  3BPV A;  1HBX G;  1FPQ A;  1ODD A;  2FEZ A;  5ICE A;  3F23 A;  5FGM A;  2XUB A;  4M9S A;  5CVU A;  4IRG A;  4G6Q A;  2RNJ A;  2KIM A;  4UHT A;  2GA2 A;  3J7A O;  3P9I A;  1AWC A;  4P5O A;  3HTS B;  2F5F A;  4IRH A;  1P92 A;  3GFJ A;  3SXY A;  2QWW A;  3OV8 A;  1I1G A;  3GFI A;  4M73 A;  2ADU A;  4ENJ A;  1R1V A;  4HW0 A;  1T98 A;  5TRD A;  2MLK A;  2BV6 A;  1PP7 U;  4G7H F;  2RC4 A;  1LEA A;  4M6Y A;  2QEN A;  3JAM Z;  2BGC A;  2MH9 A;  3CTA A;  3JSP A;  1UHM A;  4R8H A;  3L2C A;  3T8T A;  2VC0 A;  4LB6 B;  2PI0 A;  1XGM A;  3SFZ A;  3TDZ C;  1B59 A;  5L3C A;  2VOD A;  3CUQ A;  1DP7 P;  3DP7 A;  4GYG A;  3GF2 A;  2A61 A;  4D0P A;  4U0Y A;  3MFK A;  4BQA A;  3D0S A;  1EV7 A;  4MTE A;  4HF0 A;  4PCQ A;  2XKP A;  4KT5 C;  1Z6T A;  5E8G A;  3IL2 A;  1B1B A;  2VON A;  4ZYE A;  1DUX C;  4I09 A;  2ACJ A;  2A69 F;  2FSW A;  2M8E A;  2FNA A;  1G3W A;  3ISP A;  1IZ1 A;  5D5X B;  2PLY A;  2LF8 A;  5D4S A;  1FBS A;  3WTU C;  3HOT A;  4GYI A;  2IJL A;  2JSC A;  1YTY A;  4N9I A;  2OZ6 A;  3T0Y A;  3GEZ A;  2BBY A;  2RQP A;  2XAG A;  1W7P A;  4BNC A;  4HF1 A;  2Y0M A;  4AIJ A;  3EYY A;  1SFE A;  1QZY A;  3FWE A;  4R79 A;  1P4X A;  1ZGJ A;  1F1Z A;  4HDV A;  1JGS A;  3BP8 A;  3TKY A;  3R4K A;  3G3Z A;  1FOK A;  5HOO A;  3V8J A;  3ZMU A;  3F8F A;  4RB2 C;  4Y13 A;  1TNT A;  2YX7 A;  1BC7 C;  3KP7 A;  3LFK A;  3HYI A;  1MDM B;  2LSO A;  5D6F A;  1ZG1 A;  1FC3 A;  2STT A;  2ZNZ A;  1LJ9 A;  3JW4 A;  4H0E A;  1XSD A;  3BDD A;  2WWY A;  4HYE A;  5JR3 A;  4HDU A;  3F8C A;  4M6X A;  2QQB A;  4ZH4 F;  2F5E A;  1SFU A;  3R61 A;  4ZZD A;  5HLG A;  3RKX A;  1L0O C;  5FLX K;  2ZO4 A;  3G73 A;  2AXL A;  1BBY A;  1G6N A;  1TW2 A;  3CUO A;  3QP5 A;  2RKH A;  4OOI A;  4G94 A;  4XLP F;  1TQM A;  5L3F A;  2HYF A;  1Z1D A;  1MD0 A;  3M1E A;  1REP C;  1U5T B;  2BYV E;  3MCZ A;  1K78 A;  1PP8 F;  3I59 B;  5DD8 A;  2A6H F;  2UZK A;  4M72 A;  5DCM B;  4OIP F;  1F4K A;  1XMA A;  1O3R A;  5CLS A;  1RUO A;  2L3D A;  5K5O A;  3ZN1 A;  4RB1 A;  2AS5 F;  3M8F A;  3L9F A;  1QGP A;  1WSU A;  5L3B A;  3GLX A;  2EV6 A;  1ZGA A;  2HEO A;  1R58 A;  1D8K A;  4CHU A;  2A3S A;  1R00 A;  2VE8 A;  3GWZ A;  1LQ1 A;  1ZYR F;  5IT9 Z;  3WTX C;  1J0R A;  5D5U B;  2DTR A;  3H3U A;  3F3X A;  1J75 A;  2K4B A;  2KIU A;  4B8X A;  1Z6R A;  2UWM A;  4I0B A;  3ECO A;  2A6E F;  4WWC A;  3W6K B;  1WWX A;  2EJR A;  2VBX A;  1KU7 A;  4HF2 A;  5LRS A;  4NB5 A;  2FQ3 A;  5HDG A;  3I64 A;  1L3L A;  1BC8 C;  2DPD A;  2H94 A;  1XMK A;  3LQR A;  2ZCW A;  3WTS C;  1MJ9 A;  4WK8 F;  1VTN C;  2ZKZ A;  1T6S A;  2CYY A;  2L01 A;  4KMF A;  1ZRF A;  1KU9 A;  2M1B A;  4YII A;  5E8I A;  3FXU A;  2HKO A;  3B73 A;  3L7W A;  2ZBK A;  1O57 A;  1YO5 C;  4A0Y A;  2V1X A;  4G7O F;  3IC7 A;  4KYW A;  2W84 A;  3LST A;  2X4H A;  2QQ9 A;  3KP2 A;  5CJ9 A;  1DPR A;  3IRR A;  4ENK A;  1TBX A;  3LAP A;  4CDG A;  3U2R A;  3RIR A;  1MJA A;  5EEH A;  2DW4 A;  2DO7 A;  2HTS A;  2RV8 A;  4OIR F;  2QUF A;  4UUV A;  4BYY A;  1KU3 A;  3GFL A;  2K4J A;  3GZ6 A;  2ZME B;  3HRT A;  3HIF A;  2Q2E A;  1J2X A;  1QBJ A;  3KLO A;  3BJ6 A;  2P6S A;  3ECH A;  4EJU A;  2VT2 A;  3RPQ A;  2Y75 A;  3K1M A;  3N97 A;  6PAX A;  4LLG F;  5KVR A;  2Y48 A;  3KZZ A;  3JTG A;  2L54 A;  3QU3 A;  3PFI A;  4OIO F;  4RS8 A;  2D45 A;  2IA2 A;  2EV5 A;  2JT1 A;  2GA1 A;  3KE2 A;  4LGW A;  3RYP A;  1BJA A;  4S05 A;  4P55 A;  3E3V A;  1U8R A;  2P8T A;  4IRI A;  4GCV A;  3K69 A;  1IN7 A;  3M9A A;  2GAU A;  1R5G A;  3PQK A;  3BJO A;  4P96 A;  1KGS A;  2P7C B;  2YSR A;  3TDU C;  4F7Z A;  2L02 A;  1XSV A;  1HKQ A;  5K1Y A;  3WGH A;  1XCB A;  1KYZ A;  4MHG A;  1YW7 A;  2OU2 A;  4HV5 A;  1GHC A;  2XAH A;  5IT3 A;  4CIC A;  5E1X A;  1XDS A;  4A12 A;  4HX4 A;  2JPB A;  4MQ9 F;  4LMY A;  4G7Z F;  1NHA A;  3F8B A;  2CW0 F;  3GZ5 A;  2FNP A;  5AON A;  3HHG A;  2KJB A;  3H3Z A;  3HUG A;  4UXN A;  1HW1 A;  3E5Q A;  1KQ9 A;  4EGY A;  2PQ8 A;  2K02 A;  3HSF A;  2EWN A;  3BZ6 A;  2XAS A;  3WGG A;  5HVQ C;  1F9N A;  3REO A;  2NYX A;  2C6Y A;  1T2K A;  4A6D A;  2FRH A;  5ILS A;  4UVA A;  1TLH B;  1U2W A;  3HRM A;  2GIV A;  4AIK A;  4O6J A;  1R1T A;  2VBY A;  3CUQ C;  4Q48 A;  2FMY A;  3V7C A;  2F5D A;  2OQG A;  3DPT A;  2KRF A;  2OD5 A;  5L3G A;  4AWX B;  3GX4 X;  1W5T A;  5BOX A;  4LLN A;  4ZYD A;  2ISY A;  1E2X A;  1FNN A;  4ZYG A;  4ON0 A;  2W85 A;  5ILU A;  4KA4 A;  1R1U A;  2LNB A;  1OR7 A;  5JHU A;  2GXG A;  3JAM K;  2F2E A;  4EM2 A;  4L5I A;  1ZLJ A;  3EET A;  1XDU A;  1S29 A;  3FM5 A;  4JQF A;  3AAF A;  2WTE A;  4RAZ A;  2X0L A;  1HQC A;  3P9K A;  3R0J A;  2GQQ A;  3FX3 A;  3KFW X;  4M9X A;  2JZY A;  1KQ8 A;  3O6B B;  2KIF A;  2Z5U A;  1FWZ A;  2G7H A;  2NRA C;  2P6T A;  2CSO A;  3T1B A;  3PQJ A;  3TO9 A;  3HTU A;  2WV0 A;  1G4D A;  4MEX F;  3GFM A;  3R6S A;  4O5V A;  4ESB A;  2L4A A;  3FZV A;  1KU2 A;  3FHZ A;  1FYL A;  1UHW A;  4UNO A;  3I71 A;  4K2E A;  3E6B A;  3ABT A;  2LKP A;  3QU6 A;  4EM0 B;  4UV8 A;  2LDU A;  1OYY A;  3E97 A;  1P2F A;  2P5V A;  1D3Y A;  2P5L C;  1I27 A;  3GXO A;  4PDK A;  2MD5 A;  4WF2 A;  3KP3 A;  2DPU A;  3E5U A;  2HYG D;  4UVC A;  4BHP A;  2EFQ A;  2MLG A;  2PMH A;  3WTY C;  5LHH A;  4CGZ A;  4ENN A;  2VXZ A;  2XRN A;  4U7D A;  5CVJ A;  2IA0 A;  1QQI A;  3NQO A;  1IN4 A;  2ZFW A;  3H92 A;  3KP4 A;  5DV5 A;  1LEB A;  2H6B A;  3GW2 A;  3QPH A;  3I59 A;  5DCM A;  4R1H A;  3KCC A;  1FZP B;  3J81 Z;  3QOP A;  2H6C A;  4RGU A;  4BH9 A;  5E20 A;  5H6Q A;  2PN6 A;  3EYI A;  3E6C C;  4NQW A;  5CYV A;  4N9H A;  4FX4 A;  3TQN A;  2Z9O A;  5D5W B;  3OOP A;  3WTZ A;  3VEP A;  5ED4 A;  1HW5 A;  4EJV A;  5F1R A;  4OMZ A;  3ZPL A;  2H09 A;  4Q47 A;  2OA4 A;  5FFX A;  1H9T A;  4BAY A;  2IPQ X;  3IWZ A;  3KEO A;  4RGR A;  4GXO A;  1Z9C A;  4I02 A;  1Z05 A;  2OAZ A;  4L9V A;  1TNS A;  4MGR A;  4HQM A;  1WI9 A;  3U1D A;  4HQE A;  1GXP A;  3ZN0 A;  2E1N A;  4OIQ F;  5AIQ A;  3Q9V A;  3BOQ A;  2STW A;  4GGG A;  5JFR A;  3I0T A;  5FD5 A;  2M30 A;  4YFN F;  2BE5 F;  3P7N A;  3F22 A;  4HAM A;  3ZMV A;  1UCR A;  3ZMD A;  1YFH A;  4I7H A;  1BI2 A;  1O3S A;  1BI1 A;  1AOY A;  1HXD A;  1HSJ A;  4FHT A;  3WGI A;  3V8K A;  2YX4 A;  2QZ8 A;  3TGN A;  1V3F A;  3CUQ B;  1O7F A;  2HKX A;  2A5Y B;  1YYV A;  2RVC A;  4EJW A;  5IT9 K;  5LBQ A;  3EQL F;  2TDX A;  1ZG5 A;  1DDN A;  4IXA A;  1XB4 A;  2DBB A;  3MWM A;  4P9U A;  2ZXJ A;  1J59 A;  2VC1 A;  3MQ0 A;  5LLQ A;  1STZ A;  2GWR A;  5D8K B;  3GUD A;  2ZME A;  1FT9 A;  4KIF A;  4OMY A;  4BHC A;  3RTR A;  4ETS A;  5FFZ A;  1XD7 A;  1UST A;  2XVC A;  4NHJ A;  1B9M A;  3W6J B;  2JPC A;  1XSX A;  4MNU A;  4EV0 A;  5JI6 A;  3HRS A;  1FYK A;  5LHI A;  2BEO A;  1H0M A;  4XLN F;  3FM3 A;  3I5U A;  1Q1H A;  4I98 B;  2HTJ A;  1XGO A;  4I2O A;  1IXC A;  3ABU A;  3FMQ A;  1QPM A;  3GYH X;  3DF8 A;  1ON1 A;  1PDN C;  1T39 A;  1W4M A;  5JVT A;  5ICF A;  4G9Y A;  2A07 F;  3IRQ A;  1YW9 A;  3BJA A;  2JTV A;  2R7D A;  2K27 A;  4IJA A;  4E70 A;  4Z2Y A;  1LB2 A;  2DK5 A;  5D4R A;  2P4W A;  4EJO A;  3RKW A;  2VBZ A;  2XRO A;  4XRF A;  2RGV A;  3DQV C;  2J5O A;  4M74 A;  4N0B A;  1HW2 A;  1WQ2 A;  3F21 A;  2QVO A;  3JSO A;  4A0X A;  1OPC A;  3R60 A;  2R3S A;  3I58 A;  2DLL A;  4KDP A;  2JRT A;  4O3M A;  2MA3 A;  2QM3 A;  3SZT A;  3C7J A;  1J9I A;  2PMU A;  2GXB A;  1U3E M;  3C18 A;  3I54 A;  1QO0 D;  1SD5 A;  5E1W A;  4LJZ F;  2R7F A;  2HDC A;  1Z91 A;  3RYR A;  1USS A;  4IPA A;  5HLH A;  3M7G A;  2EFN A;  1IN5 A;  4ZYH A;  2CFX A;  4DNC A;  3DEU A;  2FF4 A;  3T8R A;  1K7A A;  3C3W A;  1FSH A;  4MTD A;  3L09 A;  2HR3 A;  2LF7 A;  2W57 A;  3IKV A;  4RGS A;  3FMS A;  1E17 A;  1MZB A;  1O7L A;  1ZHF A;  2ZJ2 A;  1Z7U A;  4CYD A;  1F5T A;  5CVR A;  3K2Z A;  1T0F A;  3JTH A;  1IF1 A;  2RDP A;  2GZW A;  2YU3 A;  5BMZ A;  3MAJ A;  3VOE A;  1IW7 F;  1IXS B;  2XGX A;  4JBA A;  2ISZ A;  1FBQ A;  3B02 A;  4Y15 A;  2QQA A;  4P9F A;  5HDN A;  4HA8 A;  1W7P D;  1J7K A;  3KP6 A;  3KEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...