1BM9A

Replication terminator protein from bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
b'EEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REPLICATION TERMINATOR PROTEIN
molecule tags Dna binding protein
source organism Bacillus subtilis
publication title Crystal structure of the replication terminator protein from B. subtilis at 2.6 A.
pubmed doi rcsb
total genus 41
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bm9A00
1J0RA 4N9HA 4LK1F 3IWFA 2MLKA 3Q5FA 4OIRF 1TBXA 2E1NA 1TW3A 4HX8A 3M1EA 1I27A 1AOYA 1W4MA 1FNNA 5FD5A 4MTEA 4OIPF 3CO6C 2MBFA 4ESBA 4M71A 1GXPA 3ZMVA 1YS7A 3NRVA 4Q47A 4F7ZA 4RB2C 1HBXG 2PJPA 1B9MA 4XRFA 2DO7A 4GCVA 3RDIA 3JSOA 4FT8A 3CDHA 2ISZA 2D1HA 1B59A 3E5XA 2MA3A 1ZREA 2XGXA 2XVCA 2ISYA 3DV8A 3KLNA 1H0MA 2AS5F 4EGYA 2XASA 2NNNA 3B73A 4ENMA 2IA2A 1K79A 1YTYA 3RKWA 1FYMA 4HYEA 1J75A 1XCBA 1TQPA 2ZCWA 5K5QA 2DU9A 2VBZA 3TO9A 1R1UA 4PZJA 1BM9A 1GXQA 4ESFA 2JZYA 1OYYA 3I5UA 3GUDA 4LD5A 5ICFA 1IUYA 2HTSA 3TDUC 2VODA 1Z7UA 3SQNA 3J81Z 2FEZA 2UWMA 2RNJA 1YG2A 4LB5A 2LF8A 3BJAA 4AIKA 2EA4A 3GLXA 4L0ZB 3WTVC 2V6CA 3LQQA 2HR3A 4ZYDA 3FX3A 5DD4A 4MQVA 5D8LB 2G7UA 3P9IA 5BPIA 3MWMA 3DEUA 4RGRA 2YR2A 4FX4A 2QM3A 5CVJA 3LWFA 1OYWA 1FSEA 4A0ZA 2PBIA 4AIJA 5CVIA 5ILSA 4A6DA 4EJUA 1P4AA 4UV9A 2M87A 1XCVA 1LVAA 2HFHA 4LFUA 5LEKA 3RYPA 1LEAA 4MHGA 2K02A 2P8TA 4I98B 4MNUA 2DFIA 4A6EA 3W6JB 3PQKA 3TO6A 4KNYA 2VXZA 2NNYA 4JK1X 3JAMZ 2YPRA 1QO0D 2YU3A 4H0EA 2HZTA 5E1WA 4N0BA 5JVTA 4UNOA 1RUNA 3F8NA 1BC7C 4RAZA 4ZYGA 4HV5A 4UVBA 4EV0A 1MDMA 3F3XA 4YG2F 1FP1D 1ZH5A 3ABTA 5D4SA 3TGNA 4L9JA 4P96A 2EV0A 3FXQA 3F8BA 2OD5A 3VEPA 1QZZA 4EGZA 2HTJA 1SD4A 4IHTA 4U7BA 4AWXB 4Y17A 1R1VA 4LG0A 2GXBA 5FFXA 2AXLA 2BGCA 5KK1A 2M5WA 1ULYA 1U5TB 3FMQA 4JBAA 2KRFA 4A5NA 1WRJA 3EQLF 4BQAA 1U2WA 4G7ZF 1P6RA 1FPQA 2R7DA 1IW7F 1XGNA 2QZ8A 2P4WA 4PDKA 4EJVA 5LRSA 2W85A 3GFMA 5JI6A 3JSPA 2BV6A 3WE2A 4A5MA 4M6XA 4OU0A 3SZPA 1HSJA 3N4MA 1L3LA 1K78B 2QQBA 2ZO4A 4EVIA 4IXAA 3DPTA 1CGPA 3V7RA 2YSRA 3HHHA 2M45A 3ROUA 2CSOA 4L0YB 2KKOA 1SFXA 1G4DA 1MJBA 4HQEA 2JTVA 1ZG5A 1KU3A 3ZN1A 2FA5A 3TOAA 3L00A 4AVPA 1D8JA 2V1XA 3J80Z 2YX4A 3NEUA 1BOAA 3I64A 5BQTA 4GYGA 3K69A 3CTAA 3R61A 2Z99A 4M72A 3ZN0A 1MJAA 4Z2YA 2XAFA 2CG4A 2M8EA 1P2FA 3QAHA 2QQ9A 4AD9A 1YLFA 4DQ2A 1ZGJA 3BJOA 3WTZA 1P92A 4KIBA 1FYKA 2ETHA 4LB6B 4IRHA 4HF1A 4CDGA 5DDGA 4NHJA 4XBFA 3OV8A 5ED4A 1XGMA 2XROA 2EV6A 1G3WA 5E1ZB 2JSCA 3FMSA 4CZZA 1ODDA 5J8FA 2Z5UA 2ZJ2A 1USTA 5HVQC 4ON0A 3ABUA 2A3SA 2F5EA 1JHHA 4RGXA 3HYIA 4ETSA 4YIIA 2DTRA 3GW2A 2Z33A 3HTUA 2FSWA 4U0WA 1Z1DA 1TTYA 3KEOA 2EB7A 4K2EA 5BS6A 4Q5SF 2HEOA 3I59A 2FQ3A 5HDKA 5BPDA 2KIUA 5HS8A 4L9TA 2VE8A 5DD8A 4RS8A 5HLIA 3T8RA 1STZA 2UXNA 3I0TA 3I4PA 3KETA 2E7WA 3R4KA 2RN7A 1OPCA 1T2KA 4ASNA 1XSVA 3MAJA 2H6CA 4KMUX 3WTSC 4I09A 2WTEA 2STWA 1IN8A 3RI4A 1SFUA 5CJ9A 1U78A 3CUQA 3U2RA 3IRRA 1LDDA 3KP6A 5FD6A 5D5UB 3K0LA 4LLNA 3HRTA 1W7PB 3E5UA 2VBWA 2Y75A 1SD5A 1O7FA 3T1BA 3WGHA 5E8IA 1PUEE 1YW7A 1FBSA 3F6VA 2X0LA 2IA1A 3CUQC 1E17A 2O61A 1YW9A 3NQOA 2GA2A 1FBQA 2MC3A 5E17F 1WWXA 1XMAA 1SFEA 4RGSA 4GXOA 4RB3C 2R7FA 2XHKA 1I6XA 2HKOA 3TKYA 4I7HA 1HW5A 1XDUA 2J5OA 2L3DA 1OMIA 1MD0A 2O6GE 2ZNZA 2QBYB 2GAUA 1S8NA 2RV8A 2GQQA 1LNWA 1D5VA 2QENA 2WC2A 4IJAA 1OYIA 4M74A 2KIFA 2UXXA 5CVVA 3F8FA 3LFKA 3D5LA 5JHUA 4A0XA 2VT2A 4YFXF 4DNCA 3KE2A 3O3KA 4KA4A 5FFZA 1U5TA 2OAZA 1ZGAA 3HRUA 4EM2A 5F1RA 2FBIA 2A6EF 5IT9Z 2NRAC 4FHTA 4BHBA 1U8RA 3IC7A 2H6BA 3V8LA 2EFWA 4OIQF 2ZBKA 4IF4A 1Z6TA 2L4MA 4Q48A 4PCQA 1KYWA 3FZVA 1BBYA 3LAJA 2QYOA 4UVAA 2DQRA 2PLYA 1HXDA 4R8HA 2Q8KA 5J6XA 5EEHA 3M7GA 4IVNA 3BPVA 1ZRCA 5LEJA 3WGGA 2DT5A 3BPXA 2B0LA 1USSA 1I1GA 1YS6A 2FU4A 4BHCA 1QBJA 3HTSB 1YW8A 2V1UA 1SAXA 1MZBA 1U5TC 2D1VA 3M8FA 2EFPA 1BC8C 1ZAOA 1K7AA 1JHFA 2A5YB 1O7LA 1U3EM 4AIHA 1PDNC 1J5YA 1F5TA 5D5VB 4G94A 3COAC 4IHSA 2ZKZA 3MEXA 5HDNA 1ZLJA 3MZHA 3K9TA 4LJZF 3ZPLA 1TNTA 1FZPB 2Q2EA 3V4GA 5FGMA 1VTNC 4I0AA 4QLCU 2R3SA 3V7CA 2A07F 4HQMA 5BMZA 2IT0A 2UZKA 5FB2A 2O0YA 3E3VA 1HW1A 1T39A 1CF7B 1HKSA 3VB2A 1KQ9A 5CVUA 4HA8A 5E20A 4KT5C 3WU1B 2ZMEB 2DBBA 3FF5A 4ZYHA 2FNAA 3DKWA 2VE9A 1W5SA 4KIGA 1HKQA 1G6NA 1G3TA 3IL2A 2W57A 1SMTA 1XGOA 2LSOA 5L3DA 1YQAA 2P7VB 5KVRA 1XMKA 2P6SA 2DI3A 4KIFA 3QPTA 2P5VA 5K1YA 4YIFA 2HDCA 2XAHA 5FLXZ 4LGWA 5ILUA 1Z91A 3WTYC 2DK5A 2JPBA 1RIOH 4EJTA 3FMRA 2O3FA 3AAFA 3KEQA 4HX4A 5D5WB 4O5VA 1HQCA 3LSTA 2JRTA 2A6HF 3V7SA 1EH8A 2PMHA 4U0VA 1ZG1A 4XSZF 4JQFA 3BDDA 4M9SA 3PQJA 1XN7A 2HGCA 6PAXA 2XUBA 5D6FA 2ESHA 2E1CA 3ULQB 3W6KB 1KU7A 1V3FA 2IJLA 1DUXC 1OR7A 2V9VA 4MGRA 1JE8A 5HDGA 4CXFA 1D8KA 4HF2A 2CW0F 3R0JA 3WTUC 5J8CA 2PFBA 5A2QZ 3BROA 1ZLKA 5E18F 1S7OA 1IN5A 3KLOA 3TQNA 3HHGA 5TJJA 1V4RA 5FLXK 1S6LA 3DP7A 1HKTA 2A68F 2XRNA 2CGPA 5CLSA 2VOOA 4L5JA 5LGTA 2J5PA 2W24A 4RAYA 3LA7A 3EETA 3TO7A 1XSDA 1O3RA 2Q0OA 2GXGA 3RPUA 1O3QA 3F8CA 2ELHA 4G6QA 5L3BA 4U7DA 4S04A 3REOA 3LAPA 3P7NA 1GHCA 1IN7A 2X4HA 1HSTA 5JFRA 3HUGA 4FX0A 4TV7A 3DPLC 1TQIA 2OU2A 5DUKA 1IXSB 5DCMB 5D8KB 1B1BA 1T98A 4M6YA 4HW0A 2FE3A 2PQ8A 5AONA 3BP8A 3WE3A 2BBYA 1FSHA 1LDJA 1DDNA 3TOBA 1R1TA 2K7LA 1U6GA 4KYWA 3U9GA 2WWYA 1RZ4A 1F4KA 4BHPA 5BOXA 1BI0A 2W84A 3K1MA 2IA0A 4MTDA 4LLLA 3RJPA 1IZ1A 2VONA 2ZXJA 3KZZA 4EJWA 3BOQA 1K78A 2MH2A 2XKPA 1XDSA 4XLNF 3RKYA 5H6QA 2XV4S 2DW4A 2XAJA 2OA4A 3SXYA 5K5OA 5IT3A 3CLOA 4KUMA 5FO5A 1R23A 3H3UA 2P7CB 1LEBA 2IVMA 5HLGA 1BI2A 3HRMA 2PG4A 4OOIA 2RKHA 1YO5C 3H3ZA 2HS5A 3I53A 5L3GA 3F72A 5TRDA 3KP5A 1IAWA 1UHWA 2ADUA 2CQKA 4PGHA 4LG0B 1MGTA 2CYYA 1BJAA 3R60A 1FOKA 1E2XA 4CICA 4EMSA 1FP2A 1OKRA 2A69F 2K27A 2XKOA 1YIOA 5DCMA 4P55A 1C0WA 3E6CC 1A04A 2CWEA 1Z05A 3T5XA 4KN7X 1MDMB 1YFHA 3VFZA 2F5FA 1TNSA 3CUQB 2EFQA 1W5TA 4I02A 3ZMZA 4UV8A 1LB2A 3GFJA 2IRFG 2BEOA 3HSFA 1UHMA 2V79A 1RI7A 3K1PA 2LF7A 1R22A 3Q9VA 2HQNA 3WU0A 3V8KA 2L54A 1O57A 5D5XB 3BY6A 3DF8A 1O3TA 3P9CA 2LKPA 1ON2A 3E6BA 4IRGA 1I1SA 3L2CA 3I71A 4IPAA 2FNPA 2HOEA 4YFNF 4I0BA 3M8EA 2F5CA 1F9NA 2DK8A 2QLZA 4L9NA 4A2UA 3O2PE 3K2ZA 1DPUA 1P4WA 2QQAA 1IF1A 5HS7A 4CGZA 2HQRA 4L5IA 1Y0UA 2MD5A 4GGGA 4BAYA 5LHIA 4G9YA 3FXUA 3GF2A 4WWCA 4HDVA 3LA2A 2HYGD 2RDPA 4ZZDA 3ZMUA 3FXRA 3R0AA 5CVRA 3CO7C 3KP7A 1QGPA 4Q4ZF 3HIFA 2NS0A 1J59A 1QNTA 2GWRA 3C7JA 2IW5A 1B6AA 3H92A 3WTXC 1X3UA 3ZQ7A 3J81K 1T0FA 3VODA 3R6SA 3KP3A 3RPQA 2VN2A 2PMUA 1H9TA 3C3WA 3EYYA 1DPRA 1MJ9A 1G3YA 4HLYA 4RB0A 2VOPA 3TDZC 3GZ5A 2EFNA 2FOKA 2OBPA 1KQ0A 2H94A 1KU9A 1KYZA 3DQVC 2PEXA 4GYIA 3LA3A 5HLHA 3FM5A 4KMFA 1R7JA 4UVCA 5ICGA 3MQ0A 2NAZA 2HWVA 4ZH4F 1FYLA 2L01A 4ENJA 3SFZA 2QWWA 1ZARA 4HZFA 5IT9K 2QVOA 2D45A 2RQPA 3QPHA 1UCRA 2MLGA 3V8JA 1JGSA 1WQ2A 1R5HA 4A0YA 2ZMEA 3IKTA 1XD7A 1R5GA 4M9XA 1XGSA 4ENNA 1CF7A 4KDPA 5L3FA 3RTRA 4EM1A 2RVCA 4R1HA 2EJRA 2COMA 2GIVA 3BJ6A 1RUOA 3IWZA 4BXUA 2P5LC 3E6MA 4L9VA 1R36A 4XSXF 1WSUA 1TQMA 3E97A 3GZ6A 2FBKA 2O8XA 3JTGA 2FXAA 3U1DA 2VBXA 5E8GA 1RNLA 1B4AA 2YX7A 2W25A 5L3CA 3QOPA 4G7OF 4N9IA 3QU6A 1G3SA 1EV7A 4WXDA 4WK8F 2F5DA 3JW4A 3WGIA 1Z6RA 3ECOA 4G6DA 3CJNA 1LDKB 5D4RA 4WX9A 5F6FA 3S2WA 3MFKA 2PI0A 3KCCA 1GVJA 1W7PD 1FT9A 3PFIA 2STTA 3ERED 2H09A 4LK0F 1ZRDA 1ZRFA 2O03A 2XAQA 2EK5A 3F22A 2BE5F 2Y0MA 3E5QA 4ZZLA 2K86A 5DUIA 2VT3A 3KFWX 1LJ9A 1ZYRF 4HBLA 2OZ6A 3MZYA 1IXCA 2JPCA 4UHTA 5LHGA 4UUVA 4CYDA 1EH6A 2L4AA 4D0PA 1ON1A 3SZTA 2V1DA 3RKXA 1XB4A 3OOPA 3ML6A 4OIOF 2PN6A 1KGSA 2FRHA 5HS9A 4HX7A 3GXOA 4RB1A 3GVAA 4NQWA 5LRRA 2DAOA 3MCZA 1AWCA 3L9FA 3WODF 1J2XA 4WCGA 2KIMA 1FY7A 3ZMSA 2QBYA 2KJBA 2Z3YA 2HKXA 2CFXA 4A12A 5F64A 4UXNA 4KICA 3I54A 1I5ZA 1P4XA 2ZNYA 5ILVA 3N97A 2M30A 2OZUA 1PP7U 1Z9CA 4S05A 3ECHA 4I01A 4HOBA 3SHFA 4PGGA 2VC1A 1MKMA 3LQRA 2P5KA 1R58A 4GO1A 3IHUA 5LHHA 1NHAA 2XAGA 3CUOA 5DEQA 3EYIA 5ICEA 2NYXA 3ZMTA 2WV0A 3GX4X 4NB5A 2QUFA 3GWZA 3HOTA 4CHUA 1SD7A 1TLHB 3F21A 4EM0B 5DYMA 4P5OA 4EJOA 3WTWC 3DXJF 1BI1A 1KQ8A 2XIGA 1TW2A 1BN5A 4YFKF 2HYFA 4Y15A 4LMYA 1EH7A 5H6RA 1FWZA 4HDUA 3L7WA 1S3JA 3J80K 4G8XA 2DPDA 2ACJA 2DQLA 3J7AO 2FMYA 2H27A 4Y13A 1UFMA 2RGVA 4E70A 1B9NA 2EV5A 3WG9A 2FF4A 4U88A 3K1NA 2CO5A 2TDXA 4P9UA 4QWQA 3HSRA 1L0OC 2OQRA 3G73A 3HOSA 1IRGA 3ZMDA 4ESJA 3QU3A 3JTHA 3HRSA 1QPMA 4U0YA 3C18A 5AIQA 1S29A 4B8XA 4EQQA 2BYVE 2K4BA 2OQGA 4G7HF 2VC0A 3QP5A 2EFOA 2VBYA 1SMYF 4MEYF 3ISPA 1J9IA 3C1DA 3EDPA 4O6JA 3L09A 4I2OA 4M9ZA 3IRQA 2JT1A 5H20A 1O3SA 1KU2A 4IRIA 2LNBA 5CYVA 1SD6A 1FC3A 5E1XA 1ZHFA 2P6TA 1Q1HA 4B09A 3FM3A 3RYRA 5LLQA 3WTTC 1ONVA 4MEXF 5K5RA 3KP2A 2ESNA 1ZG3A 4HAMA 2DPUA 3M9AA 2IP2A 4R79A 1JXSA 2GZWA 2KJCA 4WXCA 3T8TA 1T6SA 3GFLA 2FBHA 1XSXA 1K6OA 2K4JA 1ZN2A 2C6YA 3FHZA 3ZP5A 3GFIA 3DFGA 1IN6A 1BIBA 3I58A 4BH9A 3F23A 2ZFWA 3D0SA 1FBUA 1WI9A 1S7AA 4CO8A 3E6DA 1H9GA 4HLXA 3B02A 5A2QK 1FLIA 4KFCA 1BI3A 2E7XA 3JAMK 4HF0A 1IRFA 4P9FA 1WKMA 2GA1A 5LBQA 4M73A 1T38A 1F1ZA 2G9WA 2LDUA 2Z9OA 2EA2A 2Y48A 5HOOA 3P9KA 3Q9SA 2G7HA 5EEGA 3QRFF 1YYVA 4OINF 1J7KA 3F6OA 2RC4A 3T0YA 2FMLA 5L3EA 4LLGF 1PP8F 1IN4A 4ENKA 1QQIA 4KN4X 3QP6A 1R00A 5LGNA 2DLLA 4OMYA 2A61A 4L18B 1D3YA 1BIAA 2F2EA 1LQ1A 1DP7P 1QZYA 4BNCA 2EWNA 5JR3A 5ERIA 3IKVA 2IPQX 4RGUA 3GO5A 5ICCA 1KA8A 4WXHA 1W7PA 3RIRA 1HW2A 3BZ6A 2D2WA 4WF2A 3F8MA 2M1BA 1UB9A 2L02A 3ELKA 4BYYA 3KP4A 4HV6A 3KZYA 1IXRC 4ZYEA 2MH9A 3GEZA 3G3ZA 4MQ9F 5DV5A 3BWGA 4XLPF 3EUHA 3I59B 5D6EA 4O3MA 5DCFA 3GYHX 5LGUA 3VOEA 1FX7A 3FWEA 5AIPA 1REPC 3HSEA 3O6BB 4OMZA
chains in the Genus database with same CATH superfamily
1J0RA 4N9HA 2KRCA 3JRGA 1K4SA 4LK1F 3IWFA 3OL3A 2MLKA 3Q5FA 2KFDA 3VWBA 1LE8A 4OIRF 2LG4A 1TBXA 2XPVA 2E1NA 5C44J 1TW3A 1VQ6I 2W4SA 4HX8A 3M1EA 4C3IJ 1I27A 1FOYA 3AG1H 1AOYA 1W4MA 1W5CC 2XSJC 1FNNA 3HKZA 5FD5A 2L2OA 2Z1DA 3BZCA 2L7ZA 4MTEA 1HDDC 4OIPF 3CO6C 2L9NA 3A1YA 2MBFA 2UV1A 4ESBA 1ZGWA 3VYTB 4V2GA 4E4HA 4M71A 1GXPA 2JMWA 3A03A 3ZMVA 4BGDA 1YS7A 2XC7A 2EZIA 3NRVA 4Q47A 4Y52J 4F7ZA 4RB2C 5J40A 1HBXG 4FASD 3CCLI 1K61A 2PJPA 2BY0A 1B9MA 5HNFA 4XRFA 2ZJRF 3NWSA 2KDOA 3H36A 2DO7A 2LR8A 4GCVA 3RDIA 3JSOA 4IZZA 4FT8A 2QSGX 1ETQA 3CDHA 2ISZA 4XORA 4B1RA 2LVSA 5GTIC 3GMEA 2D1HA 1B59A 1Z3YA 2R7XA 3E5XA 1LVKA 2MA3A 1ZREA 2XGXA 4Y3OA 2XVCA 2ISYA 3DV8A 3KLNA 3QQAA 4F91B 1H0MA 2AS5F 2HZDA 1OCRH 2HDDA 4EGYA 2DT6A 4UUTA 2M2EA 2GLOA 2XASA 2NNNA 3QOEA 2IGKA 3B73A 4ENMA 2IA2A 4BKXA 1K79A 1YTYA 3RKWA 2OPTA 3GCMA 1FYMA 2DA3A 4HYEA 3JR9A 1J75A 2BZTA 1XCBA 1TQPA 3RKQA 2E5NA 2ZCWA 5K5QA 3B6AA 4KISA 2DU9A 2CU7A 2VBZA 3TO9A 3KYLA 1R1UA 4PZJA 2KZGA 4EEFG 5FRMA 4HNUA 1BM9A 1GXQA 4ESFA 1Z7LA 2JUCA 4NC7A 2JZYA 2M0MA 1N78A 1MBEA 5CQGA 1OYYA 1WPKA 4C2TA 3S8PA 5KCMA 3I5UA 3L2WA 1JUMA 3GUDA 4UB6C 4LD5A 5ICFA 1IUYA 2HTSA 4G12A 3TDUC 2VODA 3BG3A 1Z7UA 3SQNA 2B9SA 1JT0A 1LKXA 3J81Z 1WJAA 2FEZA 2EIKH 2QQ8A 2ID6A 2UWMA 1SVOA 1XX5A 1IGNA 2RNJA 1YG2A 4LB5A 4PSXA 4XR6A 2LF8A 1MBHA 2OC6A 3BJAA 4AIKA 2EA4A 3GLXA 4L0ZB 1MW7A 3PM1A 3WTVC 1T95A 2V6CA 1Z21A 3LQQA 2MGQA 4RM3A 2KZVA 4AM3A 2HR3A 4ZYDA 1WJFA 2Y30A 3FX3A 3FK6A 3W2VA 5DD4A 4MQVA 5D8LB 3LOCA 4HNVA 3OYAA 1R71A 2G7UA 1X1DA 3P9IA 5BPIA 1YX3A 3MWMA 3DEUA 5M5WJ 2DA7A 5B3SH 4RGRA 3RCOA 3IV5A 3ZQFA 4DW6A 2YR2A 4FX4A 2QM3A 3E0JB 1BR4A 3SYTA 3OIQA 5CVJA 3LWFA 2F6CA 4XLFA 1OYWA 1FSEA 4A0ZA 1AU7A 2PBIA 4AIJA 1X1BA 5CVIA 5ILSA 2V4JC 4A6DA 4EJUA 1P4AA 4UV9A 2M87A 3BT9A 1MMGA 4PUSA 1XCVA 1GLNA 1LVAA 2HFHA 4LFUA 3O8GA 5LEKA 3OYIA 3RYPA 1LEAA 4MHGA 2K02A 9ANTA 3S15J 2P8TA 4I98B 1NH3A 4MNUA 2JK3A 4ABZA 3S2HJ 2DFIA 3FXLA 4A6EA 3G2BA 3DTIA 1EKEA 3HXLA 3W6JB 3PQKA 1HOMA 4FE4A 2X51A 3TO6A 1G59A 4KNYA 3A0HC 2VXZA 2NNYA 3DLAA 2BW3A 2YS9A 4JK1X 3JAMZ 4M3FA 3H0GJ 3CMEI 2YPRA 1QO0D 2YU3A 5E1WA 2HZTA 2DFFA 4H0EA 4N0BA 5JVTA 2Z16A 4UNOA 2JSPA 1RUNA 2K9LA 3F8NA 1BC7C 4RAZA 4ZYGA 3I4MJ 3TW7A 3J7YJ 4HV5A 2FUG2 4UVBA 4M6VA 4EV0A 5F0CA 2M3AA 2ELJA 3F3XA 3OY9A 1MDMA 4YG2F 1FP1D 2H1KA 5C4XJ 1ZH5A 2IGNA 3ABTA 5D4SA 1Q1VA 2WAQN 3H9QA 3TGNA 1ZKGA 2KMUA 5KAFC 5K7ZA 4L9JA 4P96A 2JA6J 3D1NI 2EV0A 3FXQA 3F8BA 1RETA 2IS6A 2VXDA 2OD5A 4B3XA 3H35A 3VEPA 1QZZA 1XG1A 4EGZA 5C4JJ 2HTJA 1V5GA 5M3MJ 1SD4A 4IHTA 4U7BA 3S1NJ 2AO9A 1HF0A 2BW3B 1DGWY 4AWXB 2KIQA 2VJ5A 4Y17A 4CYCB 3KYDB 1R1VA 1AHDP 2HPMA 2HOAA 2HQAA 4LG0A 1QRYA 3OR1C 4MLOA 2GXBA 3HJEA 5FFXA 2NVQJ 3BG7A 3CCEI 2AXLA 2BGCA 2KLOA 5KK1A 5JLWA 2M5WA 3JCUC 1ULYA 1U5TB 2MSYA 2PMZA 3FMQA 3GTJJ 1D1BA 3BZKA 4JBAA 4BE2A 2KRFA 4A5NA 1WRJA 1JKQC 2YU9J 4IHVA 3EQLF 2XRLA 4BQAA 3GTGJ 2V7FA 4IHWA 3W2WA 1U2WA 4G7ZF 3DKYA 3PUFA 4HRIA 1P6RA 1FMVA 1FPQA 1R4NB 2R7DA 5IYCJ 1IW7F 1XGNA 2QZ8A 2P4WA 1JKPC 4PDKA 4EJVA 1J09A 1YOVB 2W85A 3QYBA 5LRSA 3GFMA 5JI6A 3JSPA 2BV6A 3K6GA 3WE2A 2DFEA 5B1AH 3SFIA 4BEHB 5IP7J 4A5MA 4M6XA 2LY1A 4OU0A 3SZPA 1HSJA 3JRCA 2AXTC 4A3MJ 3N4MA 1ZQ3P 1L3LA 1VQMI 1K78B 2QQBA 2ZO4A 2QKMB 4EVIA 4M3BA 2OTJI 2H1LA 2UUZA 4IXAA 3DPTA 1ZK8A 1MBFA 1CGPA 3V7RA 2XPWA 2YSRA 3FISA 3HHHA 4B4CA 2M45A 4IOAF 1FJLA 2F4OB 1OQYA 4W97A 3ROUA 1PVEA 2CSOA 4PSWA 2XGEA 2M34A 4L0YB 2KKOA 2XF7A 2A6TA 1SFXA 1G4DA 1MJBA 3CCSI 4XRSG 4HQEA 2ZSHB 2JTVA 3FBIB 4IHXA 1MNEA 1OCZH 2F48A 4ZTFA 1ZG5A 1KU3A 2HXOA 3ZN1A 2K3FA 2FA5A 3TOAA 3IH4A 3QWLA 2RNGA 4RAGA 3L00A 4Y7NJ 4AVPA 1D8JA 2Z2SB 2V1XA 1HC8A 2X85A 1G8XA 3J80Z 1OLTA 3KZIC 4XLEA 2YX4A 3NEUA 1BOAA 3I64A 5BQTA 3CP2A 4GYGA 3K69A 3CTAA 2WAFA 3R61A 2Z99A 4M72A 2R92J 3ZN0A 1MJAA 4Z2YA 2XAFA 2CG4A 3K4LA 3LSHA 2KHMA 1W0TA 4A3FJ 3OL4A 1T33A 2M8EA 1KZHA 1P2FA 1MMDA 3QAHA 1MBKA 2QQ9A 1W0UA 4XRMA 1GT0C 2KRHA 4AD9A 3A2KA 1YLFA 4DQ2A 3C2BA 1ZGJA 1NK2P 1VQ5I 1HA8A 3I9V2 3BJOA 3GLLA 1ORKA 3WTZA 1SVMA 1P92A 4DJAA 4KIBA 1RRJA 1FYKA 2JA8J 2ETHA 4D7MA 3BTIA 4LB6B 3SDGA 4IRHA 4HF1A 4CDGA 4F55A 5B1BH 5DDGA 3H5AA 1YRNA 5GTHC 4NHJA 4XBFA 2XB5A 3OV8A 5ED4A 1E3OC 2F4MB 1K83J 1XGMA 3ZQIA 2XROA 2EV6A 3PO2J 1G3WA 5E1ZB 4UY8I 3FIWA 5J3LA 2JSCA 4NDLA 3FMSA 4CZZA 1ODDA 1R6RA 1AKHB 1MSEC 2MW8A 5J8FA 5IYDJ 1R4MB 4E7ZA 2Z5UA 2ZJ2A 4BXXJ 1USTA 3A0BC 1OJLA 1EA3A 5HVQC 4ON0A 1F43A 2VIXA 4BBSJ 2FQ4A 3ABUA 3FKIJ 1O4XA 2A3SA 2ZXHA 2F5EA 3H9JA 1JHHA 3PNVA 4RGXA 3HYIA 4ETSA 3IP4B 4YIIA 3W3CA 1VFCA 2DTRA 5B5EC 3GW2A 3GTMJ 3CP8A 4E6KG 2Z33A 4LITA 2VPRA 3HTUA 3G71I 2FSWA 2E60A 2DA1A 2WY8Q 4U0WA 1U9NA 3TW6A 1Z1DA 1TTYA 3PUBA 1Z3XA 3KEOA 2TCTA 2EB7A 4FQGA 4BBRJ 3H0DA 4K2EA 1D5YA 3H5NA 5BS6A 1YRNB 1JKRC 4Q5SF 3PIOF 2HEOA 3I59A 2FQ3A 5HDKA 1R9TJ 2E1MB 3CC2I 5BPDA 2KIUA 5HS8A 5KNLA 1H89C 4C2UA 4L9TA 2VE8A 2CUFA 4RS8A 5DD8A 5HLIA 2X6XA 3T8RA 2G0EA 2HVQA 2WB1N 3J7ZI 1STZA 3WHCA 1JJ8C 2UXNA 3I0TA 3I4PA 3KPHA 4JX5A 4PJLA 3KETA 2E7WA 4F3QA 4L5EA 3BR6A 3R4KA 2RN7A 2FOWA 1OPCA 1T2KA 5DM7F 4ASNA 2CRGA 1XSVA 3AG3H 3BCBA 3MAJA 2H6CA 4KMUX 3HPGA 3WTSC 1FTTA 4I09A 2WTEA 3OOUA 4NC8A 4MIMA 2STWA 1IN8A 3RI4A 1SFUA 5CJ9A 3EUKL 1EF4A 1U78A 3CUQA 3U2RA 3IRRA 5F0HA 1LDDA 3KP6A 3MD2A 3DCFA 5FD6A 2BVLA 2VJJA 5D5UB 3K0LA 4LLNA 3HRTA 5HNHA 2L9VA 2Y9YA 4XKCA 2IXSA 3A02A 1OFCX 1W7PB 3E5UA 1A5JA 2VBWA 2Y75A 1TWFJ 1NG6A 5CKTA 1SD5A 1O7FA 3T1BA 5J4VA 3DPUA 3WGHA 5E8IA 4AYBA 5FLMJ 4FE7A 1MBJA 1MMAA 4B44A 2R5ZA 1PUEE 1YW7A 2KISA 1FBSA 3HBLA 3F6VA 2X0LA 2IA1A 2DMQA 3CUQC 1E17A 2CW7A 3OS1A 2O61A 1YW9A 4IKFA 3NQOA 2GA2A 3BG5A 1FBQA 4JP0A 1RKTA 2MC3A 1PUFB 1JJ6C 5E17F 1WWXA 2R5YB 2P0WA 1XMAA 4LIUA 3TL4X 1IRXA 1SFEA 1YE9A 2ECBA 4RGSA 4C3JJ 4GXOA 4RB3C 3C2HA 2R7FA 2XHKA 1I6XA 2HKOA 4KT6A 3TKYA 3CC4I 4I7HA 4CCNA 2BHYA 5F1JA 2FX0A 1CQTA 1HW5A 1XDUA 4BY7J 1IO2A 2R0QC 5LD2C 1VQ8I 2J5OA 2L3DA 2HVSA 4JOMA 2Q1ZB 1OMIA 1MD0A 2O6GE 3FHNA 3TMOA 4PJMA 1ETVA 2ZNZA 2QBYB 4V19K 2GAUA 2LOOA 1S8NA 2RV8A 1WFXA 2GQQA 3BR2A 1LNWA 1D5VA 2QENA 2WC2A 3LFUA 5K7FA 4IJAA 4DZPA 1OYIA 4PFPA 1SAUA 2KIFA 4M74A 1NK3P 2UXXA 5CVVA 3F8FA 3LFKA 1TWCJ 3D5LA 5JHUA 4A0XA 3K70D 1OR7C 2VT2A 4YFXF 4DNCA 1UZCA 3KE2A 1FMWA 3O3KA 4XIDA 5FJ8J 5FFZA 4KA4A 5FKOA 1U5TA 2OAZA 2VQCA 1ZGAA 3HRUA 1AA7A 4EM2A 1ETWA 5F1RA 4A3CJ 4I76A 4RAFA 1VF9A 2FBIA 4RBOA 2A6EF 1FOXA 5IT9Z 2K5CA 2NRAC 3HM5A 4FHTA 4BHBA 1U8RA 3IC7A 4CYCA 2H6BA 3V8LA 2EFWA 4OIQF 2ZBKA 4IF4A 5KHDA 1Z6TA 2DT7B 3S93A 4XQFA 2R5YA 2L4MA 1PUFA 4Q48A 4PCQA 5EEAA 1V54H 1YITI 1KYWA 2HI3A 3FZVA 2XGDA 1IUFA 3ZQLA 3OSFA 1BBYA 2A05A 3I3LA 3LAJA 2QYOA 4UVAA 1FIPA 2DQRA 1JGGA 2D5VA 2PLYA 1HXDA 4R8HA 2Q8KA 3OYFA 5EF6A 1VQ7I 1HLVA 2OF7A 3S3OA 2COBA 5J6XA 5EEHA 1VI0A 3M7GA 4IVNA 1IJWC 1I50J 3BPVA 1A31A 1ZRCA 3LNQA 5LEJA 3CMYA 3CLQA 2HOSA 4BJTA 3WGGA 3TP3A 4XOTA 2DT5A 3BPXA 2B0LA 2M8GX 5EGOB 1USSA 3JRBA 2O7OA 1I1GA 1YS6A 1MBGA 2FU4A 4BHCA 1QBJA 3HTSB 1YW8A 2V1UA 3FXJA 3LSPA 1SAXA 3ZR8X 1MZBA 1U5TC 2D1VA 3M8FA 2HDWA 4RM2A 4XRSA 3OYEA 2EFPA 1BC8C 1ZAOA 2RREA 1K7AA 1JHFA 2A5YB 1O7LA 1U3EM 2TRTA 4AIHA 1PDNC 1J5YA 1X19A 1X58A 1BOBA 1F5TA 4D5CA 4RDUA 5D5VB 2CJJA 4G94A 1WGXA 5J4YA 2WAQA 3DTKA 3COAC 1S72I 4IHSA 1VZ0A 2ZKZA 3V42A 3MEXA 4JX4A 5HDNA 1ZLJA 3MZHA 3K9TA 4LJZF 3OYNA 3ZPLA 3OYGA 1TNTA 1E3PA 2Q2EA 1FZPB 1A6QA 2I8DA 3V4GA 5FGMA 2DJNA 3HGYA 1FOWA 1VTNC 4I0AA 4BXFA 1QVTA 4QLCU 4CCMA 3LSRA 2R3SA 2NOJB 3LSGA 1SEUA 3V7CA 2A07F 1Z0XA 2Y0SA 4HQMA 5BMZA 2IT0A 1AKHA 4PJJA 1VQ4I 4CH7A 2UZKA 2VQLA 2DDAA 4BY1J 5FB2A 5JLXA 2O0YA 3NARA 2XF6A 3E3VA 1HW1A 1T39A 1CF7B 1MNMC 2WB1A 1UAAA 1HKSA 2BXZA 3LMMA 3S32A 3VB2A 1KQ9A 5CVUA 4HA8A 5E20A 2VLAA 3I4NJ 4MFDA 4E7KA 4KT5C 3WU1B 2ZMEB 3OYLA 2DBBA 3FF5A 1QZEA 4ZYHA 2FNAA 2OCEA 3DKWA 3K10A 2LTPA 2W82A 1ETYA 1X4OA 2VE9A 1W5SA 2VJIA 2EPFA 4KIGA 2DFHA 2EBIA 3HOYJ 1UELB 2EINH 1HKQA 4YEJA 1G6NA 4A3JJ 2MG4A 1LFBA 1G3TA 3IL2A 5FKKA 2W57A 2X1CA 2DOEA 1ETOA 3TBIA 1SMTA 1XGOA 5IPAA 2PX9A 5IOYA 3S1QJ 4HG2A 2X1DA 1ENHA 2LSOA 2YUSA 5L3DA 1RPWA 3ERMA 1YQAA 2P7VB 3W6VA 1R49A 2NVTJ 3DEEA 2ZXWH 4GRIA 4XM3A 1XMKA 2JN6A 1GV2A 2MC4A 5KVRA 3K2AA 2E2IJ 2P6SA 2DI3A 4A3BJ 4PFOA 2X9DA 1SANA 4KIFA 3QPTA 3AKZA 4BQOA 2P5VA 4UUSB 3S17J 1B72A 5K1YA 4II3A 3MKLA 4YIFA 2HDCA 4XN0A 4II2A 1BW6A 2XAHA 1P7JA 5FLXZ 1W36D 4LGWA 1B8IA 2CS3A 5ILUA 1ZR2A 2L0KA 1Z91A 1N77A 3WTYC 1UHSA 2DK5A 3QYFA 2JPBA 2ME6A 1YJNI 2K9MA 4H4KC 1RIOH 3L2VA 4EJTA 3FBNB 2VASA 3FMRA 2HXIA 1D0YA 1QVUA 2EIMH 2K85A 2K9QA 2O3FA 3H1CA 3D5SC 3CCYA 3AAFA 3S3NA 5EZGA 4AUXA 5E79C 3ZQQA 2WA0A 3KEQA 4HX4A 2BOLA 2M0CA 5D5WB 1PJRA 2GBYA 2M7AA 4O5VA 3P5JA 2LKXA 1HQCA 3GTOJ 3LSTA 5J1YA 1N25A 2JRTA 2A6HF 3V7SA 1EH8A 1DQUA 2PMHA 4U0VA 3DU5A 4XSZF 4JQFA 1ZG1A 3BDDA 3CF2A 4CCKA 3CMMA 3Q0UA 3D5RC 4M9SA 2XDVA 3PQJA 5EYRA 1S9HA 2JQ7A 4A3IJ 4NBQA 4Z6YA 5KAIC 2R7RA 1XN7A 2HGCA 3UKGA 6PAXA 2XUBA 5D6FA 3BG9A 2JVHA 2ESHA 2E1CA 3ULQB 2L5QA 1ZTRA 3W6KB 1KU7A 1V3FA 1WJCA 2IJLA 1OR7A 1DUXC 4BDYA 4NQWB 3KEYA 2V9VA 1QPIA 3ZOBA 5GAGJ 4MGRA 1JE8A 5HDGA 1PYVA 4CXFA 1LUJB 1LE8B 1D8KA 4HF2A 5GP9A 3CC7I 2BHZA 2CW0F 3R0JA 5EZHA 5J8CA 3WTUC 1V5EA 2PFBA 5A2QZ 4IX7A 3BROA 3PSIA 1ZLKA 4D9JA 5E18F 2OCCH 1S7OA 1I6HJ 1IN5A 3HOVJ 2VQGA 2LP0A 3KLOA 3TQNA 3HHGA 4DYCA 2BY1A 5TJJA 1YIJI 3RZDJ 1V4RA 5FLXK 1S6LA 3DP7A 3OS2A 1HKTA 2A68F 2XRNA 2CGPA 5CLSA 5IY5H 3MKYB 2XPUA 2VOOA 3PIPF 2W48A 4L5JA 5LGTA 3AG2H 2J5PA 1GV5A 2ME0A 2W24A 4XKBA 4BU2A 4M3EA 2NVXJ 4RAYA 5E3NA 4CCJA 3LA7A 3I56I 2R7UA 3EETA 1FIAA 3TO7A 1XSDA 1O3RA 2Q0OA 2GXGA 3OIPA 3RPUA 3ZCOA 1O3QA 3F8CA 1QHGA 3WG7H 2QF7A 4QIWN 2ELHA 1IRZA 2V9PA 4G6QA 2V26A 4ZTJA 1IDZA 5L3BA 4U7DA 4S04A 1YHQI 3GTKJ 4HEA2 3REOA 2FJ1A 5EGOA 2DJIA 3LAPA 3P7NA 1TWHJ 1GHCA 1IN7A 2X4HA 1HSTA 3CQZJ 1WVRA 1ETKA 5JFRA 3HUGA 2V1NA 4FX0A 4TV7A 3E7LA 3A01B 1IDYA 3DPLC 4C30A 1TQIA 2V6EA 2OU2A 1BJZA 1RC9A 5DUKA 4GFBA 3SZGA 1IXSB 5DM6F 2DMNA 5DCMB 1XC5A 3B6CA 4D7NA 5D8KB 5FKMA 3CDIA 4RMNA 5E3LA 1B1BA 1T98A 3NWTA 4BL0B 3HOUJ 4M6YA 1D0ZA 4HW0A 2FE3A 2PQ8A 1YJ9I 2X48A 5AONA 5FLVA 3BP8A 4XK4A 3CCJI 3WE3A 3HPHA 2BBYA 3OYBA 1FSHA 1LDJA 2Y2ZA 1DDNA 3TOBA 2PMZN 1R1TA 2K7LA 4JYKA 4ZYAA 5F08A 1U6GA 4HNTA 4KYWA 3U9GA 3HC7A 2VQHA 4BQNA 5CPRB 2WWYA 1NG7A 2R7QA 1RZ4A 3KIOA 1F4KA 4BHPA 5BOXA 2P81A 1BI0A 3Q0WA 4QSHA 2W84A 3K1MA 3EUHC 2XF5A 2IA0A 4MTDA 4LLLA 3RJPA 1IZ1A 1FTZA 2VONA 2K3PA 2ZXJA 1WH7A 3KZZA 2NS8A 4FISA 4EJWA 3JRDA 3BOQA 1P7IA 1K78A 2MH2A 1RESA 4QTRA 2XKPA 2QGUA 5DTDA 1XDSA 4XLNF 2X6OA 2VKDA 3RKYA 2EILH 5H6QA 2XV4S 5EDNA 4BS9A 4ZJZA 4J00A 2DW4A 1JTYA 2XAJA 4M3GA 2OA4A 3SXYA 5K5OA 1MH4A 5IT3A 2BXYA 3CLOA 4KUMA 5FO5A 1R23A 3H3UA 2P7CB 1LEBA 2GM4A 2IVMA 4LIVA 5HLGA 4BQQA 1BI2A 3HRMA 2PG4A 2RQQA 2E35A 2Y9ZA 2JVGA 4OOIA 4XLAA 1GUUA 5J1RA 5FRNA 2RKHA 2MABA 1YO5C 3H3ZA 3VYUB 2HS5A 3I53A 2CUJA 5GADJ 3UR3C 5L3GA 1T8IA 3F72A 5TRDA 3KP5A 1IAWA 2JRMA 3WU2C 1UHWA 4CA0A 4F93B 3JREA 2ADUA 4XL9A 2CQKA 4PGHA 4LG0B 3VSLA 4BE1A 1MGTA 2DA6A 2R7VA 2LC2A 2CYYA 2ZMEC 1BJAA 1D1AA 3R60A 1QHHD 4ZDLA 1MMNA 3AG4H 1FOKA 1E2XA 3K4NA 4XKWA 4B43A 4CICA 4EMSA 1FP2A 2GOMA 4IHYA 5B66C 1OKRA 3S16J 2A69F 2K27A 4AC0A 2XKOA 2CQXA 1YIOA 5DCMA 4P55A 3TP0A 3DBRB 1C0WA 5E3MA 1BR1A 4G6TB 3E6CC 1A04A 2CWEA 1Z05A 2R4GA 3T5XA 4AYBN 3M4OJ 2JUGA 4KN7X 1MDMB 3AL0C 2F4IA 1RR8C 1YFHA 3VFZA 2F5FA 3HUGB 1TNSA 3DKXA 4N4OB 3CUQB 2EFQA 1W5TA 3G1MA 4I02A 3ZMZA 1H88C 1TP4A 4UV8A 1LB2A 1I3QJ 3EPZA 3GFJA 2IRFG 2BEOA 3HSFA 1UHMA 2V79A 1QU3A 1RI7A 3K1PA 4CZCA 2QCOA 3G4SI 2LF7A 1R22A 3H3VK 1SFKA 3Q9VA 2HQNA 3WU0A 3V8KA 1UJ8A 3GTLJ 1NTCA 3FKJA 4IO9F 1RR7A 3OWTA 1R5ID 1MNDA 1O57A 2L54A 2Y31A 3HGGA 3LSJA 5D5XB 2VPLA 3BY6A 3DF8A 1O3TA 2BVMA 3P9CA 2LKPA 4A93J 2QSHX 1ON2A 2L7KA 3E6BA 4IRGA 1I1SA 3L2CA 3I71A 2I5UA 3AL0B 3QYEA 1ITYA 4IPAA 2FNPA 2WAEA 2HOEA 4YFNF 4I0BA 4AU7A 3M8EA 2F5CA 3JRHA 4ANJA 1F9NA 1UG2A 2DK8A 2QLZA 4L9NA 4A2UA 3O2PE 2X1EA 3ABLH 3K2ZA 1DPUA 2QSFX 5IP9J 1T08B 3HEFA 1P4WA 3IH2A 2QQAA 1IF1A 5HS7A 4CGZA 4NUBA 5F04A 3PJRA 1A6IA 3Q3SA 2HQRA 4L5IA 3OS0A 1Y0UA 2MD5A 4GGGA 3ONQA 1VQKI 3CCRI 4BAYA 5LHIA 4G9YA 3FXUA 3GF2A 4WWCA 5JVGF 4HDVA 5EJCA 2K9SA 5F27A 3LA2A 2HYGD 1X1CA 2RDPA 4ZZDA 3ZMUA 3FXRA 3R0AA 5CVRA 3CO7C 3KP7A 3FXKA 1QGPA 3CD6I 2VL8A 3BQYA 1X1AA 4Q4ZF 3HIFA 2E34A 2NS0A 2R7SA 4DBRA 4KJZA 1J59A 3F9KA 1TC3C 2N8GA 2JA5J 1QNTA 2GWRA 4B3AA 1K4TA 2HYJA 2O8KA 3C7JA 5DS9A 3C2GA 2IW5A 4V2FA 1B6AA 1K6YA 3H92A 3BR5A 1X3UA 2HQ5A 4S0HB 3WTXC 2ZJQF 3ZQ7A 3J81K 4OAZA 1T0FA 1GVDA 3HDDA 3VODA 1OCPA 2R93J 3R6SA 3KP3A 1OCOH 2VN2A 3RPQA 3ZXSA 2PMUA 4BJ5C 5M3FJ 1H9TA 3WHBA 3MKZA 2GIZA 3C3WA 3SJMA 2OTLI 1B8IB 2ZC2A 3EYYA 1W36C 3DTEA 1DPRA 2IEKA 3PFYA 4GDFA 1MJ9A 1G3YA 4HLYA 1ETXA 2FD5A 4RB0A 2VOPA 3TDZC 3GZ5A 3FDYA 2EFNA 3RQIA 2FOKA 3BTCA 2OBPA 1KQ0A 1E3HA 2H94A 1KU9A 1KYZA 2CV0A 3DQVC 1T0FC 2PEXA 4GYIA 3CCMI 3LA3A 4ZDPA 5HLHA 3FM5A 4KMFA 1R7JA 3VSKA 2DCEA 3BCAA 5EG0B 2MYSA 4UVCA 4XONA 2VB6A 3G1OA 2CMPA 5ICGA 3MQ0A 2DMUA 2NAZA 2E5ZA 4J19A 2EQRA 3RPUD 1X4PA 3TEDA 2HWVA 4ZH4F 1FYLA 3BTJA 2ELKA 2LRDA 2XAUA 4F92B 2L01A 4A69C 4ENJA 3SFZA 3ZQHA 2QWWA 4MO7A 1VQPI 1ZARA 4HZFA 5IT9K 2QVOA 2D45A 2E1OA 4BJ6C 2RQPA 1WCMJ 2LD5A 3DBHB 3QPHA 3CJTB 1UCRA 3MZ8A 1LPQA 4XKVA 1UMQA 1Y8RB 2KT0A 2LY2A 2MLGA 4A3GJ 3ASOH 4M3DA 2B7EA 2CUEA 2QA4I 1X3ZB 4MFEA 3I55I 3V8JA 2CH0A 3SEQA 3L2QA 3OYKA 5GAEJ 1JGSA 2NS7A 1WQ2A 1R5HA 3N05A 2DYSH 1Y8QB 4A0YA 2DDBA 2W7NA 2ZMEA 3IKTA 1X3WB 1XD7A 1TZLA 1R5GA 4M9XA 1XGSA 1T56A 2O5RA 3G1LA 4ENNA 2IAIA 1CF7A 4KDPA 1BW5A 5L3FA 4PJ0C 1VQLI 4PJNA 1YI2I 3RTRA 1U0JA 4W1UA 4EM1A 2RVCA 1JUSA 2ZSIB 4R1HA 2EJRA 2DA4A 1TT5B 2COMA 2GIVA 3BJ6A 1RUOA 3IWZA 4BXUA 4E7LA 2P5LC 4XOPA 4YELA 3E6MA 2H8RA 4L9VA 1R36A 2DOAA 2OUMA 4XSXF 3JRIA 1WSUA 5IOZA 4E7JA 4DYQA 1APLC 3VPRA 1TQMA 2Q2EB 3E97A 2ICWG 3DU6A 2NVUB 3GZ6A 4P1WA 2FBKA 1BA5A 2O8XA 3JTGA 2FXAA 3U1DA 2VBXA 5E8GA 3CESA 1RNLA 2KP6A 1W1WE 3M07A 2LK2A 2DMTA 2ZJPF 1B4AA 1ACIA 1S7EA 2YX7A 2WV1A 2W25A 4XN3A 3QODA 3K4MA 4BE0A 4ZDOA 2NOGA 5L3CA 4J01A 3QOPA 4G7OF 4N9IA 3QU6A 4NC6A 4BACA 1WI3A 3CZ6A 1G3SA 1EV7A 3A01A 4WXDA 4C2MJ 4WK8F 3CMAI 2H8WA 2F5DA 3AFHA 3JW4A 3MN2A 3WGIA 1Z6RA 2OJED 1Z67A 2LY9A 3ECOA 4G6DA 1XMXA 3CJNA 2I10A 1LDKB 5D4RA 1ZR4A 1VNDA 5IYBJ 4WX9A 1TWGJ 5GPCA 1RKWA 5F6FA 3S2WA 3MFKA 4X6AJ 4X0GA 3KCCA 2PI0A 1GVJA 1W7PD 1FT9A 3PFIA 2STTA 3ERED 2H09A 3PNYA 4AVZA 2HPIA 4LK0F 1G2HA 1ZRDA 1ZRFA 2O03A 4RLFA 2AHQA 2R7TA 4N4NB 5GPAA 2L9RA 2XAQA 2EK5A 3OIOA 2MD0A 5J47A 3F22A 2BE5F 2Y0MA 2DTZA 1LFPA 3E5QA 1WJEA 1Y39A 4ZZLA 2K86A 5DUIA 2VT3A 3KFWX 3X2QH 1WHUA 1LJ9A 5HODA 1ZYRF 4HBLA 2OZ6A 3MZYA 1IXCA 2CQ7A 3ASNH 3L2UA 1SC7A 2NVYJ 2JPCA 4UHTA 5LHGA 2R7WA 4UUVA 2IS1A 4CYDA 1EH6A 2EZHA 3O8HA 2L4AA 4LOCA 3MVPA 4D0PA 4D5FA 2LYCA 4DZJA 4YIRX 2E36A 1ON1A 1DU6A 3SZTA 2V1DA 3PSFA 2BY2A 2R7ZJ 2HU9A 3RKXA 1XB4A 3M3YJ 3OOPA 3ML6A 3L1PA 1I39A 2JWTA 4OIOF 1GDTA 3OMYA 2PN6A 3CJQB 1KGSA 2FRHA 5HS9A 4HX7A 3GXOA 4X1EA 2M4GA 4RB1A 3RQ4A 3H5RA 4BUPA 3GVAA 3G6EI 4NQWA 5LRRA 2DAOA 2KQRA 3MCZA 5H2FC 2DMPA 1AWCA 3ABMH 2L7FP 3BR1A 3L9FA 2Y69H 5M5YJ 5TGTA 3WODF 1MSFC 3CCUI 1J2XA 2VKVA 2KIMA 1FY7A 3ZMSA 4WCGA 2QBYA 2KJBA 4IQJA 5FKLA 1V55H 2Z3YA 2B63J 4C9YA 5IP6A 2HKXA 3OYMA 2JJ7A 3CDLA 2CFXA 4A12A 5F64A 4HSTA 4UXNA 1WJ5A 4KICA 3ABKH 3I54A 1I5ZA 3J7AY 1X2NA 5GAHJ 3W2AA 1P4XA 1A35A 1U8BA 1WH5A 2ZNYA 2LLKA 1YX5A 3ZRGA 5ILVA 3S1RJ 3N97A 2K40A 2M30A 3F0CA 4YRVA 4CSWA 2OZUA 1PP7U 1E0EA 4IQ4A 1Z9CA 4S05A 3ECHA 1LFUP 3DLLF 4BDZA 2E71A 4AIDA 4XICA 3OYHA 4I01A 1IG7A 4HOBA 3SHFA 3LSKA 4PGGA 2M9HA 2VC1A 1MKMA 2L9SA 3LQRA 2P5KA 1B72B 4UUSA 1R58A 2KL4A 2CUZA 4GO1A 4A3LJ 2ECCA 3IHUA 2AQFA 5LHHA 1NHAA 1M1EB 4HSRA 4IEJA 2IS2A 2XAGA 3CUOA 5DEQA 2GOXB 3IAM2 2DXIA 3EYIA 5ICEA 5LFAA 2NYXA 3ZMTA 3A4CA 2WV0A 3GX4X 4UB8C 3VYSB 4NB5A 2QUFA 2IGOA 3GWZA 3HOTA 4CHUA 1SD7A 3DEWA 3GBGA 1TLHB 3F21A 4EM0B 3H9GA 5DYMA 3OYDA 4P5OA 4EJOA 3WTWC 3OYCA 3DXJF 1BI1A 1KQ8A 2AQEA 2XIGA 1TW2A 1IC8A 1X1PA 2K9NA 1BN5A 4IOCF 2LMDA 4YFKF 3KX2A 2HYFA 4Y15A 2KPMA 1HCRA 4LMYA 1KONA 3FK7A 3ZGKA 1DGRM 1EH7A 5H6RA 3VYRB 1FWZA 2EZKA 4HDUA 3L7WA 3HKZN 1S3JA 3EUAA 1YJWI 3SDBA 5FROA 2WY7Q 3J80K 1UG0A 3KYCB 3K4JA 4G8XA 2DPDA 3OYJA 4Y33A 2ACJA 3JRFA 2DQLA 3J7AO 2FMYA 3S1MJ 2VUMJ 2WADA 3S2DJ 2H27A 3BR3A 4Y13A 3HOZJ 1Y56A 1UFMA 2RGVA 4E70A 1B9NA 2EV5A 3WG9A 2FF4A 4U88A 2HNHA 3K1NA 2CO5A 3HL2A 1JUPA 3QPLA 1BL0A 2VJ4A 5CQEA 1MIJA 1ZELA 2TDXA 4P9UA 4A3DJ 4QWQA 1IV8A 3K7AJ 3BC8A 3HSRA 1L0OC 2OQRA 3G73A 3HOSA 2BY3A 1IRGA 2CFOA 3ZMDA 3U21A 4B48A 4ESJA 4A3EJ 2NXNB 3QU3A 3JTHA 3HRSA 1QPMA 4U0YA 3C18A 5AIQA 2Y0SN 4XLHA 1S29A 4B8XA 4CCLA 3ZQCA 4EQQA 5JHFA 2BYVE 4IL6C 2HVRA 5K7HA 3CCQI 2K4BA 2OQGA 4FETA 4G7HF 2VC0A 3QP5A 2PJRB 1OCCH 4CUGA 2EFOA 4QPOA 2VBYA 1SMYF 4MEYF 1X2MA 5BNGA 3JRAA 3ISPA 1J9IA 1EJ9A 4DGWB 2VI6A 3C1DA 3K70C 1WZ2A 3EDPA 4O6JA 5J1UA 3L09A 4XNFA 3U1KA 4I2OA 2LKSA 4M9ZA 3IRQA 4I99C 1XPXA 2JT1A 3UNGC 5H20A 4CCOA 2MFZA 2LBFB 2CQNA 1TT0A 1O3SA 1KU2A 4IRIA 2LNBA 5CYVA 5FKNA 1SD6A 1FC3A 2VKHA 1ZHFA 5E1XA 3RSNA 2P6TA 4LG3A 1Q1HA 4B09A 3FM3A 3RYRA 3IUOA 5LLQA 2GXAA 2EZLA 3WTTC 1ONVA 4MEXF 2V9KA 3K4CA 2XB0X 3BTLA 5K5RA 3KP2A 2ZXIA 2ESNA 3PNTA 3IH3A 1ZG3A 2ZB9A 3BR0A 4HAMA 2DPUA 2XGCA 3M9AA 4RA2A 4ZC3A 2IP2A 4R79A 2R7OA 1JXSA 3PL8A 2F5VA 1HDPA 2GZWA 4JX6A 2KJCA 4WXCA 3T8TA 3VDXA 2QKLB 3ZQGA 1T6SA 2ID3A 5C3EJ 2DODA 1IV6A 2LFBA 3GFLA 1I3AA 2FBHA 1XSXA 1K6OA 1JTXA 2K4JA 3MMYB 1ZN2A 2C6YA 3FHZA 3ZP5A 3M1CA 3GFIA 3DFGA 3NAUA 1IN6A 3HG9A 1BIBA 3M8JA 2CV1A 3I58A 4BH9A 1S5LC 2LREA 2CQQA 2DYRH 3F23A 2ZFWA 3D0SA 2XSDC 1FBUA 1WI9A 2IGMA 4FTHA 1S7AA 2RAEA 4HPQA 4CO8A 1QA6A 2DOFA 2M7BA 4XMYA 5HLTA 3E6DA 1H9GA 3HZJA 3SEZA 4HLXA 3GTPJ 3B02A 1F36A 5A2QK 1VQOI 2JA2A 1DP3A 4DYRA 4B47A 1N75A 2A5WA 1WJDA 1D0XA 1FLIA 3K4KA 4KFCA 1BI3A 2E7XA 3JAMK 3ESWB 1Y6IA 3S14J 4HF0A 4EATA 1IRFA 4P9FA 5E3OA 1WKMA 2GA1A 1VQ9I 2LH9A 3CJRB 5LBQA 3OR2C 3CF5F 3Q0VA 2ZFUA 4M73A 1T38A 2VKEA 5F0FA 4BEHA 1A36A 1F1ZA 2G9WA 3DBLB 2LDUA 4DBQA 2Z9OA 2EA2A 4FCYA 3FXMA 2Y48A 4OWRB 1WJBA 1Y1VJ 2E19A 5HOOA 2W1OA 3P9KA 3Q9SA 2G7HA 4I6ZA 3GZNB 5EEGA 2KDZA 2X6WA 2W00A 3QRFF 4ITVA 1YYVA 4OINF 1MH3A 1J7KA 2CW8A 4A3KJ 2WBMA 3F6OA 3LSIA 3GTQJ 3K4BA 5TISC 2RC4A 2X6YA 4QPQA 3T0YA 1XTAA 2FMLA 3E1SA 5L3EA 2IS4A 4LLGF 1JKOC 2O9LA 1PP8F 1IN4A 4DOZA 4NNJA 1P9QC 4ENKA 1QQIA 2EIJH 4KN4X 3QP6A 4D1QA 1R00A 5LGNA 2QEXI 2M4KA 2DLLA 4OMYA 1POGA 5EG0A 2A61A 5M5XJ 4L18B 1D3YA 4E7IA 1SFOJ 2DN0A 1BIAA 2F2EA 1LQ1A 1DP7P 1QZYA 1OCTC 4BNCA 3LL7A 1FEXA 2EWNA 5JR3A 3BLYA 4RLQA 1V5FA 1OISA 5ERIA 3IKVA 2IPQX 1Z77A 4RGUA 2R5ZB 3GO5A 4Y4RA 3FXOA 4KITB 5ICCA 2CV2A 1KA8A 3PO3J 4WXHA 2E2JJ 1W7PA 3DWLE 4XLCA 3IAS2 4F52A 3RIRA 1HW2A 1Y1WJ 3BZ6A 2D2WA 4WF2A 1TL8A 1BR2A 4OAYA 3CCVI 1VQNI 1U9OA 3F8MA 4E7HA 2M1BA 1TWAJ 1UB9A 1D1CA 2L02A 3ELKA 4BYYA 2LBFA 1SVLA 3L2RA 3MKWB 3KP4A 4HV6A 3BQZA 3RZOJ 3KZYA 1IXRC 2E1MC 4ZYEA 2MH9A 3OSGA 3GEZA 3LSMA 1ERDA 4E7SA 3HB9A 3G3ZA 4MQ9F 4PK4A 5DV5A 1Y0NA 3BWGA 4XLPF 2DA2A 3EUHA 3I59B 4U87A 1H8AC 2E2HJ 5D6EA 3QPSA 4O3MA 5DCFA 3GYHX 5LGUA 2PJRA 1JT6A 3VOEA 3HOXJ 3S3MA 3HOWJ 1FX7A 1DU0A 1JI8A 4C3HJ 2EH3A 2L7MP 2DA5A 3FWEA 3BG6A 2JA7J 5AIPA 1REPC 2HOTA 2IBDA 2OV7A 3HSEA 4DIQA 3O6BB 1MMSA 1XS9A 4OMZA
chains in the Genus database with same CATH topology
1J0RA 4N9HA 4LK1F 3IWFA 2MLKA 3Q5FA 4OIRF 1TBXA 2E1NA 1TW3A 4HX8A 3M1EA 1I27A 1AOYA 1W4MA 1FNNA 5FD5A 4MTEA 4OIPF 3CO6C 2MBFA 4ESBA 4M71A 1GXPA 3ZMVA 1YS7A 3NRVA 4Q47A 4F7ZA 4RB2C 1HBXG 2PJPA 1B9MA 4XRFA 2DO7A 4GCVA 3RDIA 3JSOA 4FT8A 3CDHA 2ISZA 2D1HA 1B59A 3E5XA 2MA3A 1ZREA 2XGXA 2XVCA 2ISYA 3DV8A 3KLNA 1H0MA 2AS5F 4EGYA 2XASA 2NNNA 3B73A 4ENMA 2IA2A 1K79A 1YTYA 3RKWA 1FYMA 4HYEA 1J75A 1XCBA 1TQPA 2ZCWA 5K5QA 2DU9A 2VBZA 3TO9A 1R1UA 4PZJA 1BM9A 1GXQA 4ESFA 2JZYA 1OYYA 3I5UA 3GUDA 4LD5A 5ICFA 1IUYA 2HTSA 3TDUC 2VODA 1Z7UA 3SQNA 3J81Z 2FEZA 2UWMA 2RNJA 1YG2A 4LB5A 2LF8A 3BJAA 4AIKA 2EA4A 3GLXA 4L0ZB 3WTVC 2V6CA 3LQQA 2HR3A 4ZYDA 3FX3A 5DD4A 4MQVA 5D8LB 2G7UA 3P9IA 5BPIA 3MWMA 3DEUA 4RGRA 2YR2A 4FX4A 2QM3A 5CVJA 3LWFA 1OYWA 1FSEA 4A0ZA 2PBIA 4AIJA 5CVIA 5ILSA 4A6DA 4EJUA 1P4AA 4UV9A 2M87A 1XCVA 1LVAA 2HFHA 4LFUA 5LEKA 3RYPA 1LEAA 4MHGA 2K02A 2P8TA 4I98B 4MNUA 2DFIA 4A6EA 3W6JB 3PQKA 3TO6A 4KNYA 2VXZA 2NNYA 4JK1X 3JAMZ 2YPRA 1QO0D 2YU3A 4H0EA 2HZTA 5E1WA 4N0BA 5JVTA 4UNOA 1RUNA 3F8NA 1BC7C 4RAZA 4ZYGA 4HV5A 4UVBA 4EV0A 1MDMA 3F3XA 4YG2F 1FP1D 1ZH5A 3ABTA 5D4SA 3TGNA 4L9JA 4P96A 2EV0A 3FXQA 3F8BA 2OD5A 3VEPA 1QZZA 4EGZA 2HTJA 1SD4A 4IHTA 4U7BA 4AWXB 4Y17A 1R1VA 4LG0A 2GXBA 5FFXA 2AXLA 2BGCA 5KK1A 2M5WA 1ULYA 1U5TB 3FMQA 4JBAA 2KRFA 4A5NA 1WRJA 3EQLF 4BQAA 1U2WA 4G7ZF 1P6RA 1FPQA 2R7DA 1IW7F 1XGNA 2QZ8A 2P4WA 4PDKA 4EJVA 5LRSA 2W85A 3GFMA 5JI6A 3JSPA 2BV6A 3WE2A 4A5MA 4M6XA 4OU0A 3SZPA 1HSJA 3N4MA 1L3LA 1K78B 2QQBA 2ZO4A 4EVIA 4IXAA 3DPTA 1CGPA 3V7RA 2YSRA 3HHHA 2M45A 3ROUA 2CSOA 4L0YB 2KKOA 1SFXA 1G4DA 1MJBA 4HQEA 2JTVA 1ZG5A 1KU3A 3ZN1A 2FA5A 3TOAA 3L00A 4AVPA 1D8JA 2V1XA 3J80Z 2YX4A 3NEUA 1BOAA 3I64A 5BQTA 4GYGA 3K69A 3CTAA 3R61A 2Z99A 4M72A 3ZN0A 1MJAA 4Z2YA 2XAFA 2CG4A 2M8EA 1P2FA 3QAHA 2QQ9A 4AD9A 1YLFA 4DQ2A 1ZGJA 3BJOA 3WTZA 1P92A 4KIBA 1FYKA 2ETHA 4LB6B 4IRHA 4HF1A 4CDGA 5DDGA 4NHJA 4XBFA 3OV8A 5ED4A 1XGMA 2XROA 2EV6A 1G3WA 5E1ZB 2JSCA 3FMSA 4CZZA 1ODDA 5J8FA 2Z5UA 2ZJ2A 1USTA 5HVQC 4ON0A 3ABUA 2A3SA 2F5EA 1JHHA 4RGXA 3HYIA 4ETSA 4YIIA 2DTRA 3GW2A 2Z33A 3HTUA 2FSWA 4U0WA 1Z1DA 1TTYA 3KEOA 2EB7A 4K2EA 5BS6A 4Q5SF 2HEOA 3I59A 2FQ3A 5HDKA 5BPDA 2KIUA 5HS8A 4L9TA 2VE8A 5DD8A 4RS8A 5HLIA 3T8RA 1STZA 2UXNA 3I0TA 3I4PA 3KETA 2E7WA 3R4KA 2RN7A 1OPCA 1T2KA 4ASNA 1XSVA 3MAJA 2H6CA 4KMUX 3WTSC 4I09A 2WTEA 2STWA 1IN8A 3RI4A 1SFUA 5CJ9A 1U78A 3CUQA 3U2RA 3IRRA 1LDDA 3KP6A 5FD6A 5D5UB 3K0LA 4LLNA 3HRTA 1W7PB 3E5UA 2VBWA 2Y75A 1SD5A 1O7FA 3T1BA 3WGHA 5E8IA 1PUEE 1YW7A 1FBSA 3F6VA 2X0LA 2IA1A 3CUQC 1E17A 2O61A 1YW9A 3NQOA 2GA2A 1FBQA 2MC3A 5E17F 1WWXA 1XMAA 1SFEA 4RGSA 4GXOA 4RB3C 2R7FA 2XHKA 1I6XA 2HKOA 3TKYA 4I7HA 1HW5A 1XDUA 2J5OA 2L3DA 1OMIA 1MD0A 2O6GE 2ZNZA 2QBYB 2GAUA 1S8NA 2RV8A 2GQQA 1LNWA 1D5VA 2QENA 2WC2A 4IJAA 1OYIA 4M74A 2KIFA 2UXXA 5CVVA 3F8FA 3LFKA 3D5LA 5JHUA 4A0XA 2VT2A 4YFXF 4DNCA 3KE2A 3O3KA 4KA4A 5FFZA 1U5TA 2OAZA 1ZGAA 3HRUA 4EM2A 5F1RA 2FBIA 2A6EF 5IT9Z 2NRAC 4FHTA 4BHBA 1U8RA 3IC7A 2H6BA 3V8LA 2EFWA 4OIQF 2ZBKA 4IF4A 1Z6TA 2L4MA 4Q48A 4PCQA 1KYWA 3FZVA 1BBYA 3LAJA 2QYOA 4UVAA 2DQRA 2PLYA 1HXDA 4R8HA 2Q8KA 5J6XA 5EEHA 3M7GA 4IVNA 3BPVA 1ZRCA 5LEJA 3WGGA 2DT5A 3BPXA 2B0LA 1USSA 1I1GA 1YS6A 2FU4A 4BHCA 1QBJA 3HTSB 1YW8A 2V1UA 1SAXA 1MZBA 1U5TC 2D1VA 3M8FA 2EFPA 1BC8C 1ZAOA 1K7AA 1JHFA 2A5YB 1O7LA 1U3EM 4AIHA 1PDNC 1J5YA 1F5TA 5D5VB 4G94A 3COAC 4IHSA 2ZKZA 3MEXA 5HDNA 1ZLJA 3MZHA 3K9TA 4LJZF 3ZPLA 1TNTA 1FZPB 2Q2EA 3V4GA 5FGMA 1VTNC 4I0AA 4QLCU 2R3SA 3V7CA 2A07F 4HQMA 5BMZA 2IT0A 2UZKA 5FB2A 2O0YA 3E3VA 1HW1A 1T39A 1CF7B 1HKSA 3VB2A 1KQ9A 5CVUA 4HA8A 5E20A 4KT5C 3WU1B 2ZMEB 2DBBA 3FF5A 4ZYHA 2FNAA 3DKWA 2VE9A 1W5SA 4KIGA 1HKQA 1G6NA 1G3TA 3IL2A 2W57A 1SMTA 1XGOA 2LSOA 5L3DA 1YQAA 2P7VB 5KVRA 1XMKA 2P6SA 2DI3A 4KIFA 3QPTA 2P5VA 5K1YA 4YIFA 2HDCA 2XAHA 5FLXZ 4LGWA 5ILUA 1Z91A 3WTYC 2DK5A 2JPBA 1RIOH 4EJTA 3FMRA 2O3FA 3AAFA 3KEQA 4HX4A 5D5WB 4O5VA 1HQCA 3LSTA 2JRTA 2A6HF 3V7SA 1EH8A 2PMHA 4U0VA 1ZG1A 4XSZF 4JQFA 3BDDA 4M9SA 3PQJA 1XN7A 2HGCA 6PAXA 2XUBA 5D6FA 2ESHA 2E1CA 3ULQB 3W6KB 1KU7A 1V3FA 2IJLA 1DUXC 1OR7A 2V9VA 4MGRA 1JE8A 5HDGA 4CXFA 1D8KA 4HF2A 2CW0F 3R0JA 3WTUC 5J8CA 2PFBA 5A2QZ 3BROA 1ZLKA 5E18F 1S7OA 1IN5A 3KLOA 3TQNA 3HHGA 5TJJA 1V4RA 5FLXK 1S6LA 3DP7A 1HKTA 2A68F 2XRNA 2CGPA 5CLSA 2VOOA 4L5JA 5LGTA 2J5PA 2W24A 4RAYA 3LA7A 3EETA 3TO7A 1XSDA 1O3RA 2Q0OA 2GXGA 3RPUA 1O3QA 3F8CA 2ELHA 4G6QA 5L3BA 4U7DA 4S04A 3REOA 3LAPA 3P7NA 1GHCA 1IN7A 2X4HA 1HSTA 5JFRA 3HUGA 4FX0A 4TV7A 3DPLC 1TQIA 2OU2A 5DUKA 1IXSB 5DCMB 5D8KB 1B1BA 1T98A 4M6YA 4HW0A 2FE3A 2PQ8A 5AONA 3BP8A 3WE3A 2BBYA 1FSHA 1LDJA 1DDNA 3TOBA 1R1TA 2K7LA 1U6GA 4KYWA 3U9GA 2WWYA 1RZ4A 1F4KA 4BHPA 5BOXA 1BI0A 2W84A 3K1MA 2IA0A 4MTDA 4LLLA 3RJPA 1IZ1A 2VONA 2ZXJA 3KZZA 4EJWA 3BOQA 1K78A 2MH2A 2XKPA 1XDSA 4XLNF 3RKYA 5H6QA 2XV4S 2DW4A 2XAJA 2OA4A 3SXYA 5K5OA 5IT3A 3CLOA 4KUMA 5FO5A 1R23A 3H3UA 2P7CB 1LEBA 2IVMA 5HLGA 1BI2A 3HRMA 2PG4A 4OOIA 2RKHA 1YO5C 3H3ZA 2HS5A 3I53A 5L3GA 3F72A 5TRDA 3KP5A 1IAWA 1UHWA 2ADUA 2CQKA 4PGHA 4LG0B 1MGTA 2CYYA 1BJAA 3R60A 1FOKA 1E2XA 4CICA 4EMSA 1FP2A 1OKRA 2A69F 2K27A 2XKOA 1YIOA 5DCMA 4P55A 1C0WA 3E6CC 1A04A 2CWEA 1Z05A 3T5XA 4KN7X 1MDMB 1YFHA 3VFZA 2F5FA 1TNSA 3CUQB 2EFQA 1W5TA 4I02A 3ZMZA 4UV8A 1LB2A 3GFJA 2IRFG 2BEOA 3HSFA 1UHMA 2V79A 1RI7A 3K1PA 2LF7A 1R22A 3Q9VA 2HQNA 3WU0A 3V8KA 2L54A 1O57A 5D5XB 3BY6A 3DF8A 1O3TA 3P9CA 2LKPA 1ON2A 3E6BA 4IRGA 1I1SA 3L2CA 3I71A 4IPAA 2FNPA 2HOEA 4YFNF 4I0BA 3M8EA 2F5CA 1F9NA 2DK8A 2QLZA 4L9NA 4A2UA 3O2PE 3K2ZA 1DPUA 1P4WA 2QQAA 1IF1A 5HS7A 4CGZA 2HQRA 4L5IA 1Y0UA 2MD5A 4GGGA 4BAYA 5LHIA 4G9YA 3FXUA 3GF2A 4WWCA 4HDVA 3LA2A 2HYGD 2RDPA 4ZZDA 3ZMUA 3FXRA 3R0AA 5CVRA 3CO7C 3KP7A 1QGPA 4Q4ZF 3HIFA 2NS0A 1J59A 1QNTA 2GWRA 3C7JA 2IW5A 1B6AA 3H92A 3WTXC 1X3UA 3ZQ7A 3J81K 1T0FA 3VODA 3R6SA 3KP3A 3RPQA 2VN2A 2PMUA 1H9TA 3C3WA 3EYYA 1DPRA 1MJ9A 1G3YA 4HLYA 4RB0A 2VOPA 3TDZC 3GZ5A 2EFNA 2FOKA 2OBPA 1KQ0A 2H94A 1KU9A 1KYZA 3DQVC 2PEXA 4GYIA 3LA3A 5HLHA 3FM5A 4KMFA 1R7JA 4UVCA 5ICGA 3MQ0A 2NAZA 2HWVA 4ZH4F 1FYLA 2L01A 4ENJA 3SFZA 2QWWA 1ZARA 4HZFA 5IT9K 2QVOA 2D45A 2RQPA 3QPHA 1UCRA 2MLGA 3V8JA 1JGSA 1WQ2A 1R5HA 4A0YA 2ZMEA 3IKTA 1XD7A 1R5GA 4M9XA 1XGSA 4ENNA 1CF7A 4KDPA 5L3FA 3RTRA 4EM1A 2RVCA 4R1HA 2EJRA 2COMA 2GIVA 3BJ6A 1RUOA 3IWZA 4BXUA 2P5LC 3E6MA 4L9VA 1R36A 4XSXF 1WSUA 1TQMA 3E97A 3GZ6A 2FBKA 2O8XA 3JTGA 2FXAA 3U1DA 2VBXA 5E8GA 1RNLA 1B4AA 2YX7A 2W25A 5L3CA 3QOPA 4G7OF 4N9IA 3QU6A 1G3SA 1EV7A 4WXDA 4WK8F 2F5DA 3JW4A 3WGIA 1Z6RA 3ECOA 4G6DA 3CJNA 1LDKB 5D4RA 4WX9A 5F6FA 3S2WA 3MFKA 2PI0A 3KCCA 1GVJA 1W7PD 1FT9A 3PFIA 2STTA 3ERED 2H09A 4LK0F 1ZRDA 1ZRFA 2O03A 2XAQA 2EK5A 3F22A 2BE5F 2Y0MA 3E5QA 4ZZLA 2K86A 5DUIA 2VT3A 3KFWX 1LJ9A 1ZYRF 4HBLA 2OZ6A 3MZYA 1IXCA 2JPCA 4UHTA 5LHGA 4UUVA 4CYDA 1EH6A 2L4AA 4D0PA 1ON1A 3SZTA 2V1DA 3RKXA 1XB4A 3OOPA 3ML6A 4OIOF 2PN6A 1KGSA 2FRHA 5HS9A 4HX7A 3GXOA 4RB1A 3GVAA 4NQWA 5LRRA 2DAOA 3MCZA 1AWCA 3L9FA 3WODF 1J2XA 4WCGA 2KIMA 1FY7A 3ZMSA 2QBYA 2KJBA 2Z3YA 2HKXA 2CFXA 4A12A 5F64A 4UXNA 4KICA 3I54A 1I5ZA 1P4XA 2ZNYA 5ILVA 3N97A 2M30A 2OZUA 1PP7U 1Z9CA 4S05A 3ECHA 4I01A 4HOBA 3SHFA 4PGGA 2VC1A 1MKMA 3LQRA 2P5KA 1R58A 4GO1A 3IHUA 5LHHA 1NHAA 2XAGA 3CUOA 5DEQA 3EYIA 5ICEA 2NYXA 3ZMTA 2WV0A 3GX4X 4NB5A 2QUFA 3GWZA 3HOTA 4CHUA 1SD7A 1TLHB 3F21A 4EM0B 5DYMA 4P5OA 4EJOA 3WTWC 3DXJF 1BI1A 1KQ8A 2XIGA 1TW2A 1BN5A 4YFKF 2HYFA 4Y15A 4LMYA 1EH7A 5H6RA 1FWZA 4HDUA 3L7WA 1S3JA 3J80K 4G8XA 2DPDA 2ACJA 2DQLA 3J7AO 2FMYA 2H27A 4Y13A 1UFMA 2RGVA 4E70A 1B9NA 2EV5A 3WG9A 2FF4A 4U88A 3K1NA 2CO5A 2TDXA 4P9UA 4QWQA 3HSRA 1L0OC 2OQRA 3G73A 3HOSA 1IRGA 3ZMDA 4ESJA 3QU3A 3JTHA 3HRSA 1QPMA 4U0YA 3C18A 5AIQA 1S29A 4B8XA 4EQQA 2BYVE 2K4BA 2OQGA 4G7HF 2VC0A 3QP5A 2EFOA 2VBYA 1SMYF 4MEYF 3ISPA 1J9IA 3C1DA 3EDPA 4O6JA 3L09A 4I2OA 4M9ZA 3IRQA 2JT1A 5H20A 1O3SA 1KU2A 4IRIA 2LNBA 5CYVA 1SD6A 1FC3A 5E1XA 1ZHFA 2P6TA 1Q1HA 4B09A 3FM3A 3RYRA 5LLQA 3WTTC 1ONVA 4MEXF 5K5RA 3KP2A 2ESNA 1ZG3A 4HAMA 2DPUA 3M9AA 2IP2A 4R79A 1JXSA 2GZWA 2KJCA 4WXCA 3T8TA 1T6SA 3GFLA 2FBHA 1XSXA 1K6OA 2K4JA 1ZN2A 2C6YA 3FHZA 3ZP5A 3GFIA 3DFGA 1IN6A 1BIBA 3I58A 4BH9A 3F23A 2ZFWA 3D0SA 1FBUA 1WI9A 1S7AA 4CO8A 3E6DA 1H9GA 4HLXA 3B02A 5A2QK 1FLIA 4KFCA 1BI3A 2E7XA 3JAMK 4HF0A 1IRFA 4P9FA 1WKMA 2GA1A 5LBQA 4M73A 1T38A 1F1ZA 2G9WA 2LDUA 2Z9OA 2EA2A 2Y48A 5HOOA 3P9KA 3Q9SA 2G7HA 5EEGA 3QRFF 1YYVA 4OINF 1J7KA 3F6OA 2RC4A 3T0YA 2FMLA 5L3EA 4LLGF 1PP8F 1IN4A 4ENKA 1QQIA 4KN4X 3QP6A 1R00A 5LGNA 2DLLA 4OMYA 2A61A 4L18B 1D3YA 1BIAA 2F2EA 1LQ1A 1DP7P 1QZYA 4BNCA 2EWNA 5JR3A 5ERIA 3IKVA 2IPQX 4RGUA 3GO5A 5ICCA 1KA8A 4WXHA 1W7PA 3RIRA 1HW2A 3BZ6A 2D2WA 4WF2A 3F8MA 2M1BA 1UB9A 2L02A 3ELKA 4BYYA 3KP4A 4HV6A 3KZYA 1IXRC 4ZYEA 2MH9A 3GEZA 3G3ZA 4MQ9F 5DV5A 3BWGA 4XLPF 3EUHA 3I59B 5D6EA 4O3MA 5DCFA 3GYHX 5LGUA 3VOEA 1FX7A 3FWEA 5AIPA 1REPC 3HSEA 3O6BB 4OMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J0R A;  4N9H A;  4LK1 F;  3IWF A;  2MLK A;  3Q5F A;  4OIR F;  1TBX A;  2E1N A;  1TW3 A;  4HX8 A;  3M1E A;  1I27 A;  1AOY A;  1W4M A;  1FNN A;  5FD5 A;  4MTE A;  4OIP F;  3CO6 C;  2MBF A;  4ESB A;  4M71 A;  1GXP A;  3ZMV A;  1YS7 A;  3NRV A;  4Q47 A;  4F7Z A;  4RB2 C;  1HBX G;  2PJP A;  1B9M A;  4XRF A;  2DO7 A;  4GCV A;  3RDI A;  3JSO A;  4FT8 A;  3CDH A;  2ISZ A;  2D1H A;  1B59 A;  3E5X A;  2MA3 A;  1ZRE A;  2XGX A;  2XVC A;  2ISY A;  3DV8 A;  3KLN A;  1H0M A;  2AS5 F;  4EGY A;  2XAS A;  2NNN A;  3B73 A;  4ENM A;  2IA2 A;  1K79 A;  1YTY A;  3RKW A;  1FYM A;  4HYE A;  1J75 A;  1XCB A;  1TQP A;  2ZCW A;  5K5Q A;  2DU9 A;  2VBZ A;  3TO9 A;  1R1U A;  4PZJ A;  1BM9 A;  1GXQ A;  4ESF A;  2JZY A;  1OYY A;  3I5U A;  3GUD A;  4LD5 A;  5ICF A;  1IUY A;  2HTS A;  3TDU C;  2VOD A;  1Z7U A;  3SQN A;  3J81 Z;  2FEZ A;  2UWM A;  2RNJ A;  1YG2 A;  4LB5 A;  2LF8 A;  3BJA A;  4AIK A;  2EA4 A;  3GLX A;  4L0Z B;  3WTV C;  2V6C A;  3LQQ A;  2HR3 A;  4ZYD A;  3FX3 A;  5DD4 A;  4MQV A;  5D8L B;  2G7U A;  3P9I A;  5BPI A;  3MWM A;  3DEU A;  4RGR A;  2YR2 A;  4FX4 A;  2QM3 A;  5CVJ A;  3LWF A;  1OYW A;  1FSE A;  4A0Z A;  2PBI A;  4AIJ A;  5CVI A;  5ILS A;  4A6D A;  4EJU A;  1P4A A;  4UV9 A;  2M87 A;  1XCV A;  1LVA A;  2HFH A;  4LFU A;  5LEK A;  3RYP A;  1LEA A;  4MHG A;  2K02 A;  2P8T A;  4I98 B;  4MNU A;  2DFI A;  4A6E A;  3W6J B;  3PQK A;  3TO6 A;  4KNY A;  2VXZ A;  2NNY A;  4JK1 X;  3JAM Z;  2YPR A;  1QO0 D;  2YU3 A;  4H0E A;  2HZT A;  5E1W A;  4N0B A;  5JVT A;  4UNO A;  1RUN A;  3F8N A;  1BC7 C;  4RAZ A;  4ZYG A;  4HV5 A;  4UVB A;  4EV0 A;  1MDM A;  3F3X A;  4YG2 F;  1FP1 D;  1ZH5 A;  3ABT A;  5D4S A;  3TGN A;  4L9J A;  4P96 A;  2EV0 A;  3FXQ A;  3F8B A;  2OD5 A;  3VEP A;  1QZZ A;  4EGZ A;  2HTJ A;  1SD4 A;  4IHT A;  4U7B A;  4AWX B;  4Y17 A;  1R1V A;  4LG0 A;  2GXB A;  5FFX A;  2AXL A;  2BGC A;  5KK1 A;  2M5W A;  1ULY A;  1U5T B;  3FMQ A;  4JBA A;  2KRF A;  4A5N A;  1WRJ A;  3EQL F;  4BQA A;  1U2W A;  4G7Z F;  1P6R A;  1FPQ A;  2R7D A;  1IW7 F;  1XGN A;  2QZ8 A;  2P4W A;  4PDK A;  4EJV A;  5LRS A;  2W85 A;  3GFM A;  5JI6 A;  3JSP A;  2BV6 A;  3WE2 A;  4A5M A;  4M6X A;  4OU0 A;  3SZP A;  1HSJ A;  3N4M A;  1L3L A;  1K78 B;  2QQB A;  2ZO4 A;  4EVI A;  4IXA A;  3DPT A;  1CGP A;  3V7R A;  2YSR A;  3HHH A;  2M45 A;  3ROU A;  2CSO A;  4L0Y B;  2KKO A;  1SFX A;  1G4D A;  1MJB A;  4HQE A;  2JTV A;  1ZG5 A;  1KU3 A;  3ZN1 A;  2FA5 A;  3TOA A;  3L00 A;  4AVP A;  1D8J A;  2V1X A;  3J80 Z;  2YX4 A;  3NEU A;  1BOA A;  3I64 A;  5BQT A;  4GYG A;  3K69 A;  3CTA A;  3R61 A;  2Z99 A;  4M72 A;  3ZN0 A;  1MJA A;  4Z2Y A;  2XAF A;  2CG4 A;  2M8E A;  1P2F A;  3QAH A;  2QQ9 A;  4AD9 A;  1YLF A;  4DQ2 A;  1ZGJ A;  3BJO A;  3WTZ A;  1P92 A;  4KIB A;  1FYK A;  2ETH A;  4LB6 B;  4IRH A;  4HF1 A;  4CDG A;  5DDG A;  4NHJ A;  4XBF A;  3OV8 A;  5ED4 A;  1XGM A;  2XRO A;  2EV6 A;  1G3W A;  5E1Z B;  2JSC A;  3FMS A;  4CZZ A;  1ODD A;  5J8F A;  2Z5U A;  2ZJ2 A;  1UST A;  5HVQ C;  4ON0 A;  3ABU A;  2A3S A;  2F5E A;  1JHH A;  4RGX A;  3HYI A;  4ETS A;  4YII A;  2DTR A;  3GW2 A;  2Z33 A;  3HTU A;  2FSW A;  4U0W A;  1Z1D A;  1TTY A;  3KEO A;  2EB7 A;  4K2E A;  5BS6 A;  4Q5S F;  2HEO A;  3I59 A;  2FQ3 A;  5HDK A;  5BPD A;  2KIU A;  5HS8 A;  4L9T A;  2VE8 A;  5DD8 A;  4RS8 A;  5HLI A;  3T8R A;  1STZ A;  2UXN A;  3I0T A;  3I4P A;  3KET A;  2E7W A;  3R4K A;  2RN7 A;  1OPC A;  1T2K A;  4ASN A;  1XSV A;  3MAJ A;  2H6C A;  4KMU X;  3WTS C;  4I09 A;  2WTE A;  2STW A;  1IN8 A;  3RI4 A;  1SFU A;  5CJ9 A;  1U78 A;  3CUQ A;  3U2R A;  3IRR A;  1LDD A;  3KP6 A;  5FD6 A;  5D5U B;  3K0L A;  4LLN A;  3HRT A;  1W7P B;  3E5U A;  2VBW A;  2Y75 A;  1SD5 A;  1O7F A;  3T1B A;  3WGH A;  5E8I A;  1PUE E;  1YW7 A;  1FBS A;  3F6V A;  2X0L A;  2IA1 A;  3CUQ C;  1E17 A;  2O61 A;  1YW9 A;  3NQO A;  2GA2 A;  1FBQ A;  2MC3 A;  5E17 F;  1WWX A;  1XMA A;  1SFE A;  4RGS A;  4GXO A;  4RB3 C;  2R7F A;  2XHK A;  1I6X A;  2HKO A;  3TKY A;  4I7H A;  1HW5 A;  1XDU A;  2J5O A;  2L3D A;  1OMI A;  1MD0 A;  2O6G E;  2ZNZ A;  2QBY B;  2GAU A;  1S8N A;  2RV8 A;  2GQQ A;  1LNW A;  1D5V A;  2QEN A;  2WC2 A;  4IJA A;  1OYI A;  4M74 A;  2KIF A;  2UXX A;  5CVV A;  3F8F A;  3LFK A;  3D5L A;  5JHU A;  4A0X A;  2VT2 A;  4YFX F;  4DNC A;  3KE2 A;  3O3K A;  4KA4 A;  5FFZ A;  1U5T A;  2OAZ A;  1ZGA A;  3HRU A;  4EM2 A;  5F1R A;  2FBI A;  2A6E F;  5IT9 Z;  2NRA C;  4FHT A;  4BHB A;  1U8R A;  3IC7 A;  2H6B A;  3V8L A;  2EFW A;  4OIQ F;  2ZBK A;  4IF4 A;  1Z6T A;  2L4M A;  4Q48 A;  4PCQ A;  1KYW A;  3FZV A;  1BBY A;  3LAJ A;  2QYO A;  4UVA A;  2DQR A;  2PLY A;  1HXD A;  4R8H A;  2Q8K A;  5J6X A;  5EEH A;  3M7G A;  4IVN A;  3BPV A;  1ZRC A;  5LEJ A;  3WGG A;  2DT5 A;  3BPX A;  2B0L A;  1USS A;  1I1G A;  1YS6 A;  2FU4 A;  4BHC A;  1QBJ A;  3HTS B;  1YW8 A;  2V1U A;  1SAX A;  1MZB A;  1U5T C;  2D1V A;  3M8F A;  2EFP A;  1BC8 C;  1ZAO A;  1K7A A;  1JHF A;  2A5Y B;  1O7L A;  1U3E M;  4AIH A;  1PDN C;  1J5Y A;  1F5T A;  5D5V B;  4G94 A;  3COA C;  4IHS A;  2ZKZ A;  3MEX A;  5HDN A;  1ZLJ A;  3MZH A;  3K9T A;  4LJZ F;  3ZPL A;  1TNT A;  1FZP B;  2Q2E A;  3V4G A;  5FGM A;  1VTN C;  4I0A A;  4QLC U;  2R3S A;  3V7C A;  2A07 F;  4HQM A;  5BMZ A;  2IT0 A;  2UZK A;  5FB2 A;  2O0Y A;  3E3V A;  1HW1 A;  1T39 A;  1CF7 B;  1HKS A;  3VB2 A;  1KQ9 A;  5CVU A;  4HA8 A;  5E20 A;  4KT5 C;  3WU1 B;  2ZME B;  2DBB A;  3FF5 A;  4ZYH A;  2FNA A;  3DKW A;  2VE9 A;  1W5S A;  4KIG A;  1HKQ A;  1G6N A;  1G3T A;  3IL2 A;  2W57 A;  1SMT A;  1XGO A;  2LSO A;  5L3D A;  1YQA A;  2P7V B;  5KVR A;  1XMK A;  2P6S A;  2DI3 A;  4KIF A;  3QPT A;  2P5V A;  5K1Y A;  4YIF A;  2HDC A;  2XAH A;  5FLX Z;  4LGW A;  5ILU A;  1Z91 A;  3WTY C;  2DK5 A;  2JPB A;  1RIO H;  4EJT A;  3FMR A;  2O3F A;  3AAF A;  3KEQ A;  4HX4 A;  5D5W B;  4O5V A;  1HQC A;  3LST A;  2JRT A;  2A6H F;  3V7S A;  1EH8 A;  2PMH A;  4U0V A;  1ZG1 A;  4XSZ F;  4JQF A;  3BDD A;  4M9S A;  3PQJ A;  1XN7 A;  2HGC A;  6PAX A;  2XUB A;  5D6F A;  2ESH A;  2E1C A;  3ULQ B;  3W6K B;  1KU7 A;  1V3F A;  2IJL A;  1DUX C;  1OR7 A;  2V9V A;  4MGR A;  1JE8 A;  5HDG A;  4CXF A;  1D8K A;  4HF2 A;  2CW0 F;  3R0J A;  3WTU C;  5J8C A;  2PFB A;  5A2Q Z;  3BRO A;  1ZLK A;  5E18 F;  1S7O A;  1IN5 A;  3KLO A;  3TQN A;  3HHG A;  5TJJ A;  1V4R A;  5FLX K;  1S6L A;  3DP7 A;  1HKT A;  2A68 F;  2XRN A;  2CGP A;  5CLS A;  2VOO A;  4L5J A;  5LGT A;  2J5P A;  2W24 A;  4RAY A;  3LA7 A;  3EET A;  3TO7 A;  1XSD A;  1O3R A;  2Q0O A;  2GXG A;  3RPU A;  1O3Q A;  3F8C A;  2ELH A;  4G6Q A;  5L3B A;  4U7D A;  4S04 A;  3REO A;  3LAP A;  3P7N A;  1GHC A;  1IN7 A;  2X4H A;  1HST A;  5JFR A;  3HUG A;  4FX0 A;  4TV7 A;  3DPL C;  1TQI A;  2OU2 A;  5DUK A;  1IXS B;  5DCM B;  5D8K B;  1B1B A;  1T98 A;  4M6Y A;  4HW0 A;  2FE3 A;  2PQ8 A;  5AON A;  3BP8 A;  3WE3 A;  2BBY A;  1FSH A;  1LDJ A;  1DDN A;  3TOB A;  1R1T A;  2K7L A;  1U6G A;  4KYW A;  3U9G A;  2WWY A;  1RZ4 A;  1F4K A;  4BHP A;  5BOX A;  1BI0 A;  2W84 A;  3K1M A;  2IA0 A;  4MTD A;  4LLL A;  3RJP A;  1IZ1 A;  2VON A;  2ZXJ A;  3KZZ A;  4EJW A;  3BOQ A;  1K78 A;  2MH2 A;  2XKP A;  1XDS A;  4XLN F;  3RKY A;  5H6Q A;  2XV4 S;  2DW4 A;  2XAJ A;  2OA4 A;  3SXY A;  5K5O A;  5IT3 A;  3CLO A;  4KUM A;  5FO5 A;  1R23 A;  3H3U A;  2P7C B;  1LEB A;  2IVM A;  5HLG A;  1BI2 A;  3HRM A;  2PG4 A;  4OOI A;  2RKH A;  1YO5 C;  3H3Z A;  2HS5 A;  3I53 A;  5L3G A;  3F72 A;  5TRD A;  3KP5 A;  1IAW A;  1UHW A;  2ADU A;  2CQK A;  4PGH A;  4LG0 B;  1MGT A;  2CYY A;  1BJA A;  3R60 A;  1FOK A;  1E2X A;  4CIC A;  4EMS A;  1FP2 A;  1OKR A;  2A69 F;  2K27 A;  2XKO A;  1YIO A;  5DCM A;  4P55 A;  1C0W A;  3E6C C;  1A04 A;  2CWE A;  1Z05 A;  3T5X A;  4KN7 X;  1MDM B;  1YFH A;  3VFZ A;  2F5F A;  1TNS A;  3CUQ B;  2EFQ A;  1W5T A;  4I02 A;  3ZMZ A;  4UV8 A;  1LB2 A;  3GFJ A;  2IRF G;  2BEO A;  3HSF A;  1UHM A;  2V79 A;  1RI7 A;  3K1P A;  2LF7 A;  1R22 A;  3Q9V A;  2HQN A;  3WU0 A;  3V8K A;  2L54 A;  1O57 A;  5D5X B;  3BY6 A;  3DF8 A;  1O3T A;  3P9C A;  2LKP A;  1ON2 A;  3E6B A;  4IRG A;  1I1S A;  3L2C A;  3I71 A;  4IPA A;  2FNP A;  2HOE A;  4YFN F;  4I0B A;  3M8E A;  2F5C A;  1F9N A;  2DK8 A;  2QLZ A;  4L9N A;  4A2U A;  3O2P E;  3K2Z A;  1DPU A;  1P4W A;  2QQA A;  1IF1 A;  5HS7 A;  4CGZ A;  2HQR A;  4L5I A;  1Y0U A;  2MD5 A;  4GGG A;  4BAY A;  5LHI A;  4G9Y A;  3FXU A;  3GF2 A;  4WWC A;  4HDV A;  3LA2 A;  2HYG D;  2RDP A;  4ZZD A;  3ZMU A;  3FXR A;  3R0A A;  5CVR A;  3CO7 C;  3KP7 A;  1QGP A;  4Q4Z F;  3HIF A;  2NS0 A;  1J59 A;  1QNT A;  2GWR A;  3C7J A;  2IW5 A;  1B6A A;  3H92 A;  3WTX C;  1X3U A;  3ZQ7 A;  3J81 K;  1T0F A;  3VOD A;  3R6S A;  3KP3 A;  3RPQ A;  2VN2 A;  2PMU A;  1H9T A;  3C3W A;  3EYY A;  1DPR A;  1MJ9 A;  1G3Y A;  4HLY A;  4RB0 A;  2VOP A;  3TDZ C;  3GZ5 A;  2EFN A;  2FOK A;  2OBP A;  1KQ0 A;  2H94 A;  1KU9 A;  1KYZ A;  3DQV C;  2PEX A;  4GYI A;  3LA3 A;  5HLH A;  3FM5 A;  4KMF A;  1R7J A;  4UVC A;  5ICG A;  3MQ0 A;  2NAZ A;  2HWV A;  4ZH4 F;  1FYL A;  2L01 A;  4ENJ A;  3SFZ A;  2QWW A;  1ZAR A;  4HZF A;  5IT9 K;  2QVO A;  2D45 A;  2RQP A;  3QPH A;  1UCR A;  2MLG A;  3V8J A;  1JGS A;  1WQ2 A;  1R5H A;  4A0Y A;  2ZME A;  3IKT A;  1XD7 A;  1R5G A;  4M9X A;  1XGS A;  4ENN A;  1CF7 A;  4KDP A;  5L3F A;  3RTR A;  4EM1 A;  2RVC A;  4R1H A;  2EJR A;  2COM A;  2GIV A;  3BJ6 A;  1RUO A;  3IWZ A;  4BXU A;  2P5L C;  3E6M A;  4L9V A;  1R36 A;  4XSX F;  1WSU A;  1TQM A;  3E97 A;  3GZ6 A;  2FBK A;  2O8X A;  3JTG A;  2FXA A;  3U1D A;  2VBX A;  5E8G A;  1RNL A;  1B4A A;  2YX7 A;  2W25 A;  5L3C A;  3QOP A;  4G7O F;  4N9I A;  3QU6 A;  1G3S A;  1EV7 A;  4WXD A;  4WK8 F;  2F5D A;  3JW4 A;  3WGI A;  1Z6R A;  3ECO A;  4G6D A;  3CJN A;  1LDK B;  5D4R A;  4WX9 A;  5F6F A;  3S2W A;  3MFK A;  2PI0 A;  3KCC A;  1GVJ A;  1W7P D;  1FT9 A;  3PFI A;  2STT A;  3ERE D;  2H09 A;  4LK0 F;  1ZRD A;  1ZRF A;  2O03 A;  2XAQ A;  2EK5 A;  3F22 A;  2BE5 F;  2Y0M A;  3E5Q A;  4ZZL A;  2K86 A;  5DUI A;  2VT3 A;  3KFW X;  1LJ9 A;  1ZYR F;  4HBL A;  2OZ6 A;  3MZY A;  1IXC A;  2JPC A;  4UHT A;  5LHG A;  4UUV A;  4CYD A;  1EH6 A;  2L4A A;  4D0P A;  1ON1 A;  3SZT A;  2V1D A;  3RKX A;  1XB4 A;  3OOP A;  3ML6 A;  4OIO F;  2PN6 A;  1KGS A;  2FRH A;  5HS9 A;  4HX7 A;  3GXO A;  4RB1 A;  3GVA A;  4NQW A;  5LRR A;  2DAO A;  3MCZ A;  1AWC A;  3L9F A;  3WOD F;  1J2X A;  4WCG A;  2KIM A;  1FY7 A;  3ZMS A;  2QBY A;  2KJB A;  2Z3Y A;  2HKX A;  2CFX A;  4A12 A;  5F64 A;  4UXN A;  4KIC A;  3I54 A;  1I5Z A;  1P4X A;  2ZNY A;  5ILV A;  3N97 A;  2M30 A;  2OZU A;  1PP7 U;  1Z9C A;  4S05 A;  3ECH A;  4I01 A;  4HOB A;  3SHF A;  4PGG A;  2VC1 A;  1MKM A;  3LQR A;  2P5K A;  1R58 A;  4GO1 A;  3IHU A;  5LHH A;  1NHA A;  2XAG A;  3CUO A;  5DEQ A;  3EYI A;  5ICE A;  2NYX A;  3ZMT A;  2WV0 A;  3GX4 X;  4NB5 A;  2QUF A;  3GWZ A;  3HOT A;  4CHU A;  1SD7 A;  1TLH B;  3F21 A;  4EM0 B;  5DYM A;  4P5O A;  4EJO A;  3WTW C;  3DXJ F;  1BI1 A;  1KQ8 A;  2XIG A;  1TW2 A;  1BN5 A;  4YFK F;  2HYF A;  4Y15 A;  4LMY A;  1EH7 A;  5H6R A;  1FWZ A;  4HDU A;  3L7W A;  1S3J A;  3J80 K;  4G8X A;  2DPD A;  2ACJ A;  2DQL A;  3J7A O;  2FMY A;  2H27 A;  4Y13 A;  1UFM A;  2RGV A;  4E70 A;  1B9N A;  2EV5 A;  3WG9 A;  2FF4 A;  4U88 A;  3K1N A;  2CO5 A;  2TDX A;  4P9U A;  4QWQ A;  3HSR A;  1L0O C;  2OQR A;  3G73 A;  3HOS A;  1IRG A;  3ZMD A;  4ESJ A;  3QU3 A;  3JTH A;  3HRS A;  1QPM A;  4U0Y A;  3C18 A;  5AIQ A;  1S29 A;  4B8X A;  4EQQ A;  2BYV E;  2K4B A;  2OQG A;  4G7H F;  2VC0 A;  3QP5 A;  2EFO A;  2VBY A;  1SMY F;  4MEY F;  3ISP A;  1J9I A;  3C1D A;  3EDP A;  4O6J A;  3L09 A;  4I2O A;  4M9Z A;  3IRQ A;  2JT1 A;  5H20 A;  1O3S A;  1KU2 A;  4IRI A;  2LNB A;  5CYV A;  1SD6 A;  1FC3 A;  5E1X A;  1ZHF A;  2P6T A;  1Q1H A;  4B09 A;  3FM3 A;  3RYR A;  5LLQ A;  3WTT C;  1ONV A;  4MEX F;  5K5R A;  3KP2 A;  2ESN A;  1ZG3 A;  4HAM A;  2DPU A;  3M9A A;  2IP2 A;  4R79 A;  1JXS A;  2GZW A;  2KJC A;  4WXC A;  3T8T A;  1T6S A;  3GFL A;  2FBH A;  1XSX A;  1K6O A;  2K4J A;  1ZN2 A;  2C6Y A;  3FHZ A;  3ZP5 A;  3GFI A;  3DFG A;  1IN6 A;  1BIB A;  3I58 A;  4BH9 A;  3F23 A;  2ZFW A;  3D0S A;  1FBU A;  1WI9 A;  1S7A A;  4CO8 A;  3E6D A;  1H9G A;  4HLX A;  3B02 A;  5A2Q K;  1FLI A;  4KFC A;  1BI3 A;  2E7X A;  3JAM K;  4HF0 A;  1IRF A;  4P9F A;  1WKM A;  2GA1 A;  5LBQ A;  4M73 A;  1T38 A;  1F1Z A;  2G9W A;  2LDU A;  2Z9O A;  2EA2 A;  2Y48 A;  5HOO A;  3P9K A;  3Q9S A;  2G7H A;  5EEG A;  3QRF F;  1YYV A;  4OIN F;  1J7K A;  3F6O A;  2RC4 A;  3T0Y A;  2FML A;  5L3E A;  4LLG F;  1PP8 F;  1IN4 A;  4ENK A;  1QQI A;  4KN4 X;  3QP6 A;  1R00 A;  5LGN A;  2DLL A;  4OMY A;  2A61 A;  4L18 B;  1D3Y A;  1BIA A;  2F2E A;  1LQ1 A;  1DP7 P;  1QZY A;  4BNC A;  2EWN A;  5JR3 A;  5ERI A;  3IKV A;  2IPQ X;  4RGU A;  3GO5 A;  5ICC A;  1KA8 A;  4WXH A;  1W7P A;  3RIR A;  1HW2 A;  3BZ6 A;  2D2W A;  4WF2 A;  3F8M A;  2M1B A;  1UB9 A;  2L02 A;  3ELK A;  4BYY A;  3KP4 A;  4HV6 A;  3KZY A;  1IXR C;  4ZYE A;  2MH9 A;  3GEZ A;  3G3Z A;  4MQ9 F;  5DV5 A;  3BWG A;  4XLP F;  3EUH A;  3I59 B;  5D6E A;  4O3M A;  5DCF A;  3GYH X;  5LGU A;  3VOE A;  1FX7 A;  3FWE A;  5AIP A;  1REP C;  3HSE A;  3O6B B;  4OMZ A; 
#chains in the Genus database with same CATH topology
 1J0R A;  4N9H A;  2KRC A;  3JRG A;  1K4S A;  4LK1 F;  3IWF A;  3OL3 A;  2MLK A;  3Q5F A;  2KFD A;  3VWB A;  1LE8 A;  4OIR F;  2LG4 A;  1TBX A;  2XPV A;  2E1N A;  5C44 J;  1TW3 A;  1VQ6 I;  2W4S A;  4HX8 A;  3M1E A;  4C3I J;  1I27 A;  1FOY A;  3AG1 H;  1AOY A;  1W4M A;  1W5C C;  2XSJ C;  1FNN A;  3HKZ A;  5FD5 A;  2L2O A;  2Z1D A;  3BZC A;  2L7Z A;  4MTE A;  1HDD C;  4OIP F;  3CO6 C;  2L9N A;  3A1Y A;  2MBF A;  2UV1 A;  4ESB A;  1ZGW A;  3VYT B;  4V2G A;  4E4H A;  4M71 A;  1GXP A;  2JMW A;  3A03 A;  3ZMV A;  4BGD A;  1YS7 A;  2XC7 A;  2EZI A;  3NRV A;  4Q47 A;  4Y52 J;  4F7Z A;  4RB2 C;  5J40 A;  1HBX G;  4FAS D;  3CCL I;  1K61 A;  2PJP A;  2BY0 A;  1B9M A;  5HNF A;  4XRF A;  2ZJR F;  3NWS A;  2KDO A;  3H36 A;  2DO7 A;  2LR8 A;  4GCV A;  3RDI A;  3JSO A;  4IZZ A;  4FT8 A;  2QSG X;  1ETQ A;  3CDH A;  2ISZ A;  4XOR A;  4B1R A;  2LVS A;  5GTI C;  3GME A;  2D1H A;  1B59 A;  1Z3Y A;  2R7X A;  3E5X A;  1LVK A;  2MA3 A;  1ZRE A;  2XGX A;  4Y3O A;  2XVC A;  2ISY A;  3DV8 A;  3KLN A;  3QQA A;  4F91 B;  1H0M A;  2AS5 F;  2HZD A;  1OCR H;  2HDD A;  4EGY A;  2DT6 A;  4UUT A;  2M2E A;  2GLO A;  2XAS A;  2NNN A;  3QOE A;  2IGK A;  3B73 A;  4ENM A;  2IA2 A;  4BKX A;  1K79 A;  1YTY A;  3RKW A;  2OPT A;  3GCM A;  1FYM A;  2DA3 A;  4HYE A;  3JR9 A;  1J75 A;  2BZT A;  1XCB A;  1TQP A;  3RKQ A;  2E5N A;  2ZCW A;  5K5Q A;  3B6A A;  4KIS A;  2DU9 A;  2CU7 A;  2VBZ A;  3TO9 A;  3KYL A;  1R1U A;  4PZJ A;  2KZG A;  4EEF G;  5FRM A;  4HNU A;  1BM9 A;  1GXQ A;  4ESF A;  1Z7L A;  2JUC A;  4NC7 A;  2JZY A;  2M0M A;  1N78 A;  1MBE A;  5CQG A;  1OYY A;  1WPK A;  4C2T A;  3S8P A;  5KCM A;  3I5U A;  3L2W A;  1JUM A;  3GUD A;  4UB6 C;  4LD5 A;  5ICF A;  1IUY A;  2HTS A;  4G12 A;  3TDU C;  2VOD A;  3BG3 A;  1Z7U A;  3SQN A;  2B9S A;  1JT0 A;  1LKX A;  3J81 Z;  1WJA A;  2FEZ A;  2EIK H;  2QQ8 A;  2ID6 A;  2UWM A;  1SVO A;  1XX5 A;  1IGN A;  2RNJ A;  1YG2 A;  4LB5 A;  4PSX A;  4XR6 A;  2LF8 A;  1MBH A;  2OC6 A;  3BJA A;  4AIK A;  2EA4 A;  3GLX A;  4L0Z B;  1MW7 A;  3PM1 A;  3WTV C;  1T95 A;  2V6C A;  1Z21 A;  3LQQ A;  2MGQ A;  4RM3 A;  2KZV A;  4AM3 A;  2HR3 A;  4ZYD A;  1WJF A;  2Y30 A;  3FX3 A;  3FK6 A;  3W2V A;  5DD4 A;  4MQV A;  5D8L B;  3LOC A;  4HNV A;  3OYA A;  1R71 A;  2G7U A;  1X1D A;  3P9I A;  5BPI A;  1YX3 A;  3MWM A;  3DEU A;  5M5W J;  2DA7 A;  5B3S H;  4RGR A;  3RCO A;  3IV5 A;  3ZQF A;  4DW6 A;  2YR2 A;  4FX4 A;  2QM3 A;  3E0J B;  1BR4 A;  3SYT A;  3OIQ A;  5CVJ A;  3LWF A;  2F6C A;  4XLF A;  1OYW A;  1FSE A;  4A0Z A;  1AU7 A;  2PBI A;  4AIJ A;  1X1B A;  5CVI A;  5ILS A;  2V4J C;  4A6D A;  4EJU A;  1P4A A;  4UV9 A;  2M87 A;  3BT9 A;  1MMG A;  4PUS A;  1XCV A;  1GLN A;  1LVA A;  2HFH A;  4LFU A;  3O8G A;  5LEK A;  3OYI A;  3RYP A;  1LEA A;  4MHG A;  2K02 A;  9ANT A;  3S15 J;  2P8T A;  4I98 B;  1NH3 A;  4MNU A;  2JK3 A;  4ABZ A;  3S2H J;  2DFI A;  3FXL A;  4A6E A;  3G2B A;  3DTI A;  1EKE A;  3HXL A;  3W6J B;  3PQK A;  1HOM A;  4FE4 A;  2X51 A;  3TO6 A;  1G59 A;  4KNY A;  3A0H C;  2VXZ A;  2NNY A;  3DLA A;  2BW3 A;  2YS9 A;  4JK1 X;  3JAM Z;  4M3F A;  3H0G J;  3CME I;  2YPR A;  1QO0 D;  2YU3 A;  5E1W A;  2HZT A;  2DFF A;  4H0E A;  4N0B A;  5JVT A;  2Z16 A;  4UNO A;  2JSP A;  1RUN A;  2K9L A;  3F8N A;  1BC7 C;  4RAZ A;  4ZYG A;  3I4M J;  3TW7 A;  3J7Y J;  4HV5 A;  2FUG 2;  4UVB A;  4M6V A;  4EV0 A;  5F0C A;  2M3A A;  2ELJ A;  3F3X A;  3OY9 A;  1MDM A;  4YG2 F;  1FP1 D;  2H1K A;  5C4X J;  1ZH5 A;  2IGN A;  3ABT A;  5D4S A;  1Q1V A;  2WAQ N;  3H9Q A;  3TGN A;  1ZKG A;  2KMU A;  5KAF C;  5K7Z A;  4L9J A;  4P96 A;  2JA6 J;  3D1N I;  2EV0 A;  3FXQ A;  3F8B A;  1RET A;  2IS6 A;  2VXD A;  2OD5 A;  4B3X A;  3H35 A;  3VEP A;  1QZZ A;  1XG1 A;  4EGZ A;  5C4J J;  2HTJ A;  1V5G A;  5M3M J;  1SD4 A;  4IHT A;  4U7B A;  3S1N J;  2AO9 A;  1HF0 A;  2BW3 B;  1DGW Y;  4AWX B;  2KIQ A;  2VJ5 A;  4Y17 A;  4CYC B;  3KYD B;  1R1V A;  1AHD P;  2HPM A;  2HOA A;  2HQA A;  4LG0 A;  1QRY A;  3OR1 C;  4MLO A;  2GXB A;  3HJE A;  5FFX A;  2NVQ J;  3BG7 A;  3CCE I;  2AXL A;  2BGC A;  2KLO A;  5KK1 A;  5JLW A;  2M5W A;  3JCU C;  1ULY A;  1U5T B;  2MSY A;  2PMZ A;  3FMQ A;  3GTJ J;  1D1B A;  3BZK A;  4JBA A;  4BE2 A;  2KRF A;  4A5N A;  1WRJ A;  1JKQ C;  2YU9 J;  4IHV A;  3EQL F;  2XRL A;  4BQA A;  3GTG J;  2V7F A;  4IHW A;  3W2W A;  1U2W A;  4G7Z F;  3DKY A;  3PUF A;  4HRI A;  1P6R A;  1FMV A;  1FPQ A;  1R4N B;  2R7D A;  5IYC J;  1IW7 F;  1XGN A;  2QZ8 A;  2P4W A;  1JKP C;  4PDK A;  4EJV A;  1J09 A;  1YOV B;  2W85 A;  3QYB A;  5LRS A;  3GFM A;  5JI6 A;  3JSP A;  2BV6 A;  3K6G A;  3WE2 A;  2DFE A;  5B1A H;  3SFI A;  4BEH B;  5IP7 J;  4A5M A;  4M6X A;  2LY1 A;  4OU0 A;  3SZP A;  1HSJ A;  3JRC A;  2AXT C;  4A3M J;  3N4M A;  1ZQ3 P;  1L3L A;  1VQM I;  1K78 B;  2QQB A;  2ZO4 A;  2QKM B;  4EVI A;  4M3B A;  2OTJ I;  2H1L A;  2UUZ A;  4IXA A;  3DPT A;  1ZK8 A;  1MBF A;  1CGP A;  3V7R A;  2XPW A;  2YSR A;  3FIS A;  3HHH A;  4B4C A;  2M45 A;  4IOA F;  1FJL A;  2F4O B;  1OQY A;  4W97 A;  3ROU A;  1PVE A;  2CSO A;  4PSW A;  2XGE A;  2M34 A;  4L0Y B;  2KKO A;  2XF7 A;  2A6T A;  1SFX A;  1G4D A;  1MJB A;  3CCS I;  4XRS G;  4HQE A;  2ZSH B;  2JTV A;  3FBI B;  4IHX A;  1MNE A;  1OCZ H;  2F48 A;  4ZTF A;  1ZG5 A;  1KU3 A;  2HXO A;  3ZN1 A;  2K3F A;  2FA5 A;  3TOA A;  3IH4 A;  3QWL A;  2RNG A;  4RAG A;  3L00 A;  4Y7N J;  4AVP A;  1D8J A;  2Z2S B;  2V1X A;  1HC8 A;  2X85 A;  1G8X A;  3J80 Z;  1OLT A;  3KZI C;  4XLE A;  2YX4 A;  3NEU A;  1BOA A;  3I64 A;  5BQT A;  3CP2 A;  4GYG A;  3K69 A;  3CTA A;  2WAF A;  3R61 A;  2Z99 A;  4M72 A;  2R92 J;  3ZN0 A;  1MJA A;  4Z2Y A;  2XAF A;  2CG4 A;  3K4L A;  3LSH A;  2KHM A;  1W0T A;  4A3F J;  3OL4 A;  1T33 A;  2M8E A;  1KZH A;  1P2F A;  1MMD A;  3QAH A;  1MBK A;  2QQ9 A;  1W0U A;  4XRM A;  1GT0 C;  2KRH A;  4AD9 A;  3A2K A;  1YLF A;  4DQ2 A;  3C2B A;  1ZGJ A;  1NK2 P;  1VQ5 I;  1HA8 A;  3I9V 2;  3BJO A;  3GLL A;  1ORK A;  3WTZ A;  1SVM A;  1P92 A;  4DJA A;  4KIB A;  1RRJ A;  1FYK A;  2JA8 J;  2ETH A;  4D7M A;  3BTI A;  4LB6 B;  3SDG A;  4IRH A;  4HF1 A;  4CDG A;  4F55 A;  5B1B H;  5DDG A;  3H5A A;  1YRN A;  5GTH C;  4NHJ A;  4XBF A;  2XB5 A;  3OV8 A;  5ED4 A;  1E3O C;  2F4M B;  1K83 J;  1XGM A;  3ZQI A;  2XRO A;  2EV6 A;  3PO2 J;  1G3W A;  5E1Z B;  4UY8 I;  3FIW A;  5J3L A;  2JSC A;  4NDL A;  3FMS A;  4CZZ A;  1ODD A;  1R6R A;  1AKH B;  1MSE C;  2MW8 A;  5J8F A;  5IYD J;  1R4M B;  4E7Z A;  2Z5U A;  2ZJ2 A;  4BXX J;  1UST A;  3A0B C;  1OJL A;  1EA3 A;  5HVQ C;  4ON0 A;  1F43 A;  2VIX A;  4BBS J;  2FQ4 A;  3ABU A;  3FKI J;  1O4X A;  2A3S A;  2ZXH A;  2F5E A;  3H9J A;  1JHH A;  3PNV A;  4RGX A;  3HYI A;  4ETS A;  3IP4 B;  4YII A;  3W3C A;  1VFC A;  2DTR A;  5B5E C;  3GW2 A;  3GTM J;  3CP8 A;  4E6K G;  2Z33 A;  4LIT A;  2VPR A;  3HTU A;  3G71 I;  2FSW A;  2E60 A;  2DA1 A;  2WY8 Q;  4U0W A;  1U9N A;  3TW6 A;  1Z1D A;  1TTY A;  3PUB A;  1Z3X A;  3KEO A;  2TCT A;  2EB7 A;  4FQG A;  4BBR J;  3H0D A;  4K2E A;  1D5Y A;  3H5N A;  5BS6 A;  1YRN B;  1JKR C;  4Q5S F;  3PIO F;  2HEO A;  3I59 A;  2FQ3 A;  5HDK A;  1R9T J;  2E1M B;  3CC2 I;  5BPD A;  2KIU A;  5HS8 A;  5KNL A;  1H89 C;  4C2U A;  4L9T A;  2VE8 A;  2CUF A;  4RS8 A;  5DD8 A;  5HLI A;  2X6X A;  3T8R A;  2G0E A;  2HVQ A;  2WB1 N;  3J7Z I;  1STZ A;  3WHC A;  1JJ8 C;  2UXN A;  3I0T A;  3I4P A;  3KPH A;  4JX5 A;  4PJL A;  3KET A;  2E7W A;  4F3Q A;  4L5E A;  3BR6 A;  3R4K A;  2RN7 A;  2FOW A;  1OPC A;  1T2K A;  5DM7 F;  4ASN A;  2CRG A;  1XSV A;  3AG3 H;  3BCB A;  3MAJ A;  2H6C A;  4KMU X;  3HPG A;  3WTS C;  1FTT A;  4I09 A;  2WTE A;  3OOU A;  4NC8 A;  4MIM A;  2STW A;  1IN8 A;  3RI4 A;  1SFU A;  5CJ9 A;  3EUK L;  1EF4 A;  1U78 A;  3CUQ A;  3U2R A;  3IRR A;  5F0H A;  1LDD A;  3KP6 A;  3MD2 A;  3DCF A;  5FD6 A;  2BVL A;  2VJJ A;  5D5U B;  3K0L A;  4LLN A;  3HRT A;  5HNH A;  2L9V A;  2Y9Y A;  4XKC A;  2IXS A;  3A02 A;  1OFC X;  1W7P B;  3E5U A;  1A5J A;  2VBW A;  2Y75 A;  1TWF J;  1NG6 A;  5CKT A;  1SD5 A;  1O7F A;  3T1B A;  5J4V A;  3DPU A;  3WGH A;  5E8I A;  4AYB A;  5FLM J;  4FE7 A;  1MBJ A;  1MMA A;  4B44 A;  2R5Z A;  1PUE E;  1YW7 A;  2KIS A;  1FBS A;  3HBL A;  3F6V A;  2X0L A;  2IA1 A;  2DMQ A;  3CUQ C;  1E17 A;  2CW7 A;  3OS1 A;  2O61 A;  1YW9 A;  4IKF A;  3NQO A;  2GA2 A;  3BG5 A;  1FBQ A;  4JP0 A;  1RKT A;  2MC3 A;  1PUF B;  1JJ6 C;  5E17 F;  1WWX A;  2R5Y B;  2P0W A;  1XMA A;  4LIU A;  3TL4 X;  1IRX A;  1SFE A;  1YE9 A;  2ECB A;  4RGS A;  4C3J J;  4GXO A;  4RB3 C;  3C2H A;  2R7F A;  2XHK A;  1I6X A;  2HKO A;  4KT6 A;  3TKY A;  3CC4 I;  4I7H A;  4CCN A;  2BHY A;  5F1J A;  2FX0 A;  1CQT A;  1HW5 A;  1XDU A;  4BY7 J;  1IO2 A;  2R0Q C;  5LD2 C;  1VQ8 I;  2J5O A;  2L3D A;  2HVS A;  4JOM A;  2Q1Z B;  1OMI A;  1MD0 A;  2O6G E;  3FHN A;  3TMO A;  4PJM A;  1ETV A;  2ZNZ A;  2QBY B;  4V19 K;  2GAU A;  2LOO A;  1S8N A;  2RV8 A;  1WFX A;  2GQQ A;  3BR2 A;  1LNW A;  1D5V A;  2QEN A;  2WC2 A;  3LFU A;  5K7F A;  4IJA A;  4DZP A;  1OYI A;  4PFP A;  1SAU A;  2KIF A;  4M74 A;  1NK3 P;  2UXX A;  5CVV A;  3F8F A;  3LFK A;  1TWC J;  3D5L A;  5JHU A;  4A0X A;  3K70 D;  1OR7 C;  2VT2 A;  4YFX F;  4DNC A;  1UZC A;  3KE2 A;  1FMW A;  3O3K A;  4XID A;  5FJ8 J;  5FFZ A;  4KA4 A;  5FKO A;  1U5T A;  2OAZ A;  2VQC A;  1ZGA A;  3HRU A;  1AA7 A;  4EM2 A;  1ETW A;  5F1R A;  4A3C J;  4I76 A;  4RAF A;  1VF9 A;  2FBI A;  4RBO A;  2A6E F;  1FOX A;  5IT9 Z;  2K5C A;  2NRA C;  3HM5 A;  4FHT A;  4BHB A;  1U8R A;  3IC7 A;  4CYC A;  2H6B A;  3V8L A;  2EFW A;  4OIQ F;  2ZBK A;  4IF4 A;  5KHD A;  1Z6T A;  2DT7 B;  3S93 A;  4XQF A;  2R5Y A;  2L4M A;  1PUF A;  4Q48 A;  4PCQ A;  5EEA A;  1V54 H;  1YIT I;  1KYW A;  2HI3 A;  3FZV A;  2XGD A;  1IUF A;  3ZQL A;  3OSF A;  1BBY A;  2A05 A;  3I3L A;  3LAJ A;  2QYO A;  4UVA A;  1FIP A;  2DQR A;  1JGG A;  2D5V A;  2PLY A;  1HXD A;  4R8H A;  2Q8K A;  3OYF A;  5EF6 A;  1VQ7 I;  1HLV A;  2OF7 A;  3S3O A;  2COB A;  5J6X A;  5EEH A;  1VI0 A;  3M7G A;  4IVN A;  1IJW C;  1I50 J;  3BPV A;  1A31 A;  1ZRC A;  3LNQ A;  5LEJ A;  3CMY A;  3CLQ A;  2HOS A;  4BJT A;  3WGG A;  3TP3 A;  4XOT A;  2DT5 A;  3BPX A;  2B0L A;  2M8G X;  5EGO B;  1USS A;  3JRB A;  2O7O A;  1I1G A;  1YS6 A;  1MBG A;  2FU4 A;  4BHC A;  1QBJ A;  3HTS B;  1YW8 A;  2V1U A;  3FXJ A;  3LSP A;  1SAX A;  3ZR8 X;  1MZB A;  1U5T C;  2D1V A;  3M8F A;  2HDW A;  4RM2 A;  4XRS A;  3OYE A;  2EFP A;  1BC8 C;  1ZAO A;  2RRE A;  1K7A A;  1JHF A;  2A5Y B;  1O7L A;  1U3E M;  2TRT A;  4AIH A;  1PDN C;  1J5Y A;  1X19 A;  1X58 A;  1BOB A;  1F5T A;  4D5C A;  4RDU A;  5D5V B;  2CJJ A;  4G94 A;  1WGX A;  5J4Y A;  2WAQ A;  3DTK A;  3COA C;  1S72 I;  4IHS A;  1VZ0 A;  2ZKZ A;  3V42 A;  3MEX A;  4JX4 A;  5HDN A;  1ZLJ A;  3MZH A;  3K9T A;  4LJZ F;  3OYN A;  3ZPL A;  3OYG A;  1TNT A;  1E3P A;  2Q2E A;  1FZP B;  1A6Q A;  2I8D A;  3V4G A;  5FGM A;  2DJN A;  3HGY A;  1FOW A;  1VTN C;  4I0A A;  4BXF A;  1QVT A;  4QLC U;  4CCM A;  3LSR A;  2R3S A;  2NOJ B;  3LSG A;  1SEU A;  3V7C A;  2A07 F;  1Z0X A;  2Y0S A;  4HQM A;  5BMZ A;  2IT0 A;  1AKH A;  4PJJ A;  1VQ4 I;  4CH7 A;  2UZK A;  2VQL A;  2DDA A;  4BY1 J;  5FB2 A;  5JLX A;  2O0Y A;  3NAR A;  2XF6 A;  3E3V A;  1HW1 A;  1T39 A;  1CF7 B;  1MNM C;  2WB1 A;  1UAA A;  1HKS A;  2BXZ A;  3LMM A;  3S32 A;  3VB2 A;  1KQ9 A;  5CVU A;  4HA8 A;  5E20 A;  2VLA A;  3I4N J;  4MFD A;  4E7K A;  4KT5 C;  3WU1 B;  2ZME B;  3OYL A;  2DBB A;  3FF5 A;  1QZE A;  4ZYH A;  2FNA A;  2OCE A;  3DKW A;  3K10 A;  2LTP A;  2W82 A;  1ETY A;  1X4O A;  2VE9 A;  1W5S A;  2VJI A;  2EPF A;  4KIG A;  2DFH A;  2EBI A;  3HOY J;  1UEL B;  2EIN H;  1HKQ A;  4YEJ A;  1G6N A;  4A3J J;  2MG4 A;  1LFB A;  1G3T A;  3IL2 A;  5FKK A;  2W57 A;  2X1C A;  2DOE A;  1ETO A;  3TBI A;  1SMT A;  1XGO A;  5IPA A;  2PX9 A;  5IOY A;  3S1Q J;  4HG2 A;  2X1D A;  1ENH A;  2LSO A;  2YUS A;  5L3D A;  1RPW A;  3ERM A;  1YQA A;  2P7V B;  3W6V A;  1R49 A;  2NVT J;  3DEE A;  2ZXW H;  4GRI A;  4XM3 A;  1XMK A;  2JN6 A;  1GV2 A;  2MC4 A;  5KVR A;  3K2A A;  2E2I J;  2P6S A;  2DI3 A;  4A3B J;  4PFO A;  2X9D A;  1SAN A;  4KIF A;  3QPT A;  3AKZ A;  4BQO A;  2P5V A;  4UUS B;  3S17 J;  1B72 A;  5K1Y A;  4II3 A;  3MKL A;  4YIF A;  2HDC A;  4XN0 A;  4II2 A;  1BW6 A;  2XAH A;  1P7J A;  5FLX Z;  1W36 D;  4LGW A;  1B8I A;  2CS3 A;  5ILU A;  1ZR2 A;  2L0K A;  1Z91 A;  1N77 A;  3WTY C;  1UHS A;  2DK5 A;  3QYF A;  2JPB A;  2ME6 A;  1YJN I;  2K9M A;  4H4K C;  1RIO H;  3L2V A;  4EJT A;  3FBN B;  2VAS A;  3FMR A;  2HXI A;  1D0Y A;  1QVU A;  2EIM H;  2K85 A;  2K9Q A;  2O3F A;  3H1C A;  3D5S C;  3CCY A;  3AAF A;  3S3N A;  5EZG A;  4AUX A;  5E79 C;  3ZQQ A;  2WA0 A;  3KEQ A;  4HX4 A;  2BOL A;  2M0C A;  5D5W B;  1PJR A;  2GBY A;  2M7A A;  4O5V A;  3P5J A;  2LKX A;  1HQC A;  3GTO J;  3LST A;  5J1Y A;  1N25 A;  2JRT A;  2A6H F;  3V7S A;  1EH8 A;  1DQU A;  2PMH A;  4U0V A;  3DU5 A;  4XSZ F;  4JQF A;  1ZG1 A;  3BDD A;  3CF2 A;  4CCK A;  3CMM A;  3Q0U A;  3D5R C;  4M9S A;  2XDV A;  3PQJ A;  5EYR A;  1S9H A;  2JQ7 A;  4A3I J;  4NBQ A;  4Z6Y A;  5KAI C;  2R7R A;  1XN7 A;  2HGC A;  3UKG A;  6PAX A;  2XUB A;  5D6F A;  3BG9 A;  2JVH A;  2ESH A;  2E1C A;  3ULQ B;  2L5Q A;  1ZTR A;  3W6K B;  1KU7 A;  1V3F A;  1WJC A;  2IJL A;  1OR7 A;  1DUX C;  4BDY A;  4NQW B;  3KEY A;  2V9V A;  1QPI A;  3ZOB A;  5GAG J;  4MGR A;  1JE8 A;  5HDG A;  1PYV A;  4CXF A;  1LUJ B;  1LE8 B;  1D8K A;  4HF2 A;  5GP9 A;  3CC7 I;  2BHZ A;  2CW0 F;  3R0J A;  5EZH A;  5J8C A;  3WTU C;  1V5E A;  2PFB A;  5A2Q Z;  4IX7 A;  3BRO A;  3PSI A;  1ZLK A;  4D9J A;  5E18 F;  2OCC H;  1S7O A;  1I6H J;  1IN5 A;  3HOV J;  2VQG A;  2LP0 A;  3KLO A;  3TQN A;  3HHG A;  4DYC A;  2BY1 A;  5TJJ A;  1YIJ I;  3RZD J;  1V4R A;  5FLX K;  1S6L A;  3DP7 A;  3OS2 A;  1HKT A;  2A68 F;  2XRN A;  2CGP A;  5CLS A;  5IY5 H;  3MKY B;  2XPU A;  2VOO A;  3PIP F;  2W48 A;  4L5J A;  5LGT A;  3AG2 H;  2J5P A;  1GV5 A;  2ME0 A;  2W24 A;  4XKB A;  4BU2 A;  4M3E A;  2NVX J;  4RAY A;  5E3N A;  4CCJ A;  3LA7 A;  3I56 I;  2R7U A;  3EET A;  1FIA A;  3TO7 A;  1XSD A;  1O3R A;  2Q0O A;  2GXG A;  3OIP A;  3RPU A;  3ZCO A;  1O3Q A;  3F8C A;  1QHG A;  3WG7 H;  2QF7 A;  4QIW N;  2ELH A;  1IRZ A;  2V9P A;  4G6Q A;  2V26 A;  4ZTJ A;  1IDZ A;  5L3B A;  4U7D A;  4S04 A;  1YHQ I;  3GTK J;  4HEA 2;  3REO A;  2FJ1 A;  5EGO A;  2DJI A;  3LAP A;  3P7N A;  1TWH J;  1GHC A;  1IN7 A;  2X4H A;  1HST A;  3CQZ J;  1WVR A;  1ETK A;  5JFR A;  3HUG A;  2V1N A;  4FX0 A;  4TV7 A;  3E7L A;  3A01 B;  1IDY A;  3DPL C;  4C30 A;  1TQI A;  2V6E A;  2OU2 A;  1BJZ A;  1RC9 A;  5DUK A;  4GFB A;  3SZG A;  1IXS B;  5DM6 F;  2DMN A;  5DCM B;  1XC5 A;  3B6C A;  4D7N A;  5D8K B;  5FKM A;  3CDI A;  4RMN A;  5E3L A;  1B1B A;  1T98 A;  3NWT A;  4BL0 B;  3HOU J;  4M6Y A;  1D0Z A;  4HW0 A;  2FE3 A;  2PQ8 A;  1YJ9 I;  2X48 A;  5AON A;  5FLV A;  3BP8 A;  4XK4 A;  3CCJ I;  3WE3 A;  3HPH A;  2BBY A;  3OYB A;  1FSH A;  1LDJ A;  2Y2Z A;  1DDN A;  3TOB A;  2PMZ N;  1R1T A;  2K7L A;  4JYK A;  4ZYA A;  5F08 A;  1U6G A;  4HNT A;  4KYW A;  3U9G A;  3HC7 A;  2VQH A;  4BQN A;  5CPR B;  2WWY A;  1NG7 A;  2R7Q A;  1RZ4 A;  3KIO A;  1F4K A;  4BHP A;  5BOX A;  2P81 A;  1BI0 A;  3Q0W A;  4QSH A;  2W84 A;  3K1M A;  3EUH C;  2XF5 A;  2IA0 A;  4MTD A;  4LLL A;  3RJP A;  1IZ1 A;  1FTZ A;  2VON A;  2K3P A;  2ZXJ A;  1WH7 A;  3KZZ A;  2NS8 A;  4FIS A;  4EJW A;  3JRD A;  3BOQ A;  1P7I A;  1K78 A;  2MH2 A;  1RES A;  4QTR A;  2XKP A;  2QGU A;  5DTD A;  1XDS A;  4XLN F;  2X6O A;  2VKD A;  3RKY A;  2EIL H;  5H6Q A;  2XV4 S;  5EDN A;  4BS9 A;  4ZJZ A;  4J00 A;  2DW4 A;  1JTY A;  2XAJ A;  4M3G A;  2OA4 A;  3SXY A;  5K5O A;  1MH4 A;  5IT3 A;  2BXY A;  3CLO A;  4KUM A;  5FO5 A;  1R23 A;  3H3U A;  2P7C B;  1LEB A;  2GM4 A;  2IVM A;  4LIV A;  5HLG A;  4BQQ A;  1BI2 A;  3HRM A;  2PG4 A;  2RQQ A;  2E35 A;  2Y9Z A;  2JVG A;  4OOI A;  4XLA A;  1GUU A;  5J1R A;  5FRN A;  2RKH A;  2MAB A;  1YO5 C;  3H3Z A;  3VYU B;  2HS5 A;  3I53 A;  2CUJ A;  5GAD J;  3UR3 C;  5L3G A;  1T8I A;  3F72 A;  5TRD A;  3KP5 A;  1IAW A;  2JRM A;  3WU2 C;  1UHW A;  4CA0 A;  4F93 B;  3JRE A;  2ADU A;  4XL9 A;  2CQK A;  4PGH A;  4LG0 B;  3VSL A;  4BE1 A;  1MGT A;  2DA6 A;  2R7V A;  2LC2 A;  2CYY A;  2ZME C;  1BJA A;  1D1A A;  3R60 A;  1QHH D;  4ZDL A;  1MMN A;  3AG4 H;  1FOK A;  1E2X A;  3K4N A;  4XKW A;  4B43 A;  4CIC A;  4EMS A;  1FP2 A;  2GOM A;  4IHY A;  5B66 C;  1OKR A;  3S16 J;  2A69 F;  2K27 A;  4AC0 A;  2XKO A;  2CQX A;  1YIO A;  5DCM A;  4P55 A;  3TP0 A;  3DBR B;  1C0W A;  5E3M A;  1BR1 A;  4G6T B;  3E6C C;  1A04 A;  2CWE A;  1Z05 A;  2R4G A;  3T5X A;  4AYB N;  3M4O J;  2JUG A;  4KN7 X;  1MDM B;  3AL0 C;  2F4I A;  1RR8 C;  1YFH A;  3VFZ A;  2F5F A;  3HUG B;  1TNS A;  3DKX A;  4N4O B;  3CUQ B;  2EFQ A;  1W5T A;  3G1M A;  4I02 A;  3ZMZ A;  1H88 C;  1TP4 A;  4UV8 A;  1LB2 A;  1I3Q J;  3EPZ A;  3GFJ A;  2IRF G;  2BEO A;  3HSF A;  1UHM A;  2V79 A;  1QU3 A;  1RI7 A;  3K1P A;  4CZC A;  2QCO A;  3G4S I;  2LF7 A;  1R22 A;  3H3V K;  1SFK A;  3Q9V A;  2HQN A;  3WU0 A;  3V8K A;  1UJ8 A;  3GTL J;  1NTC A;  3FKJ A;  4IO9 F;  1RR7 A;  3OWT A;  1R5I D;  1MND A;  1O57 A;  2L54 A;  2Y31 A;  3HGG A;  3LSJ A;  5D5X B;  2VPL A;  3BY6 A;  3DF8 A;  1O3T A;  2BVM A;  3P9C A;  2LKP A;  4A93 J;  2QSH X;  1ON2 A;  2L7K A;  3E6B A;  4IRG A;  1I1S A;  3L2C A;  3I71 A;  2I5U A;  3AL0 B;  3QYE A;  1ITY A;  4IPA A;  2FNP A;  2WAE A;  2HOE A;  4YFN F;  4I0B A;  4AU7 A;  3M8E A;  2F5C A;  3JRH A;  4ANJ A;  1F9N A;  1UG2 A;  2DK8 A;  2QLZ A;  4L9N A;  4A2U A;  3O2P E;  2X1E A;  3ABL H;  3K2Z A;  1DPU A;  2QSF X;  5IP9 J;  1T08 B;  3HEF A;  1P4W A;  3IH2 A;  2QQA A;  1IF1 A;  5HS7 A;  4CGZ A;  4NUB A;  5F04 A;  3PJR A;  1A6I A;  3Q3S A;  2HQR A;  4L5I A;  3OS0 A;  1Y0U A;  2MD5 A;  4GGG A;  3ONQ A;  1VQK I;  3CCR I;  4BAY A;  5LHI A;  4G9Y A;  3FXU A;  3GF2 A;  4WWC A;  5JVG F;  4HDV A;  5EJC A;  2K9S A;  5F27 A;  3LA2 A;  2HYG D;  1X1C A;  2RDP A;  4ZZD A;  3ZMU A;  3FXR A;  3R0A A;  5CVR A;  3CO7 C;  3KP7 A;  3FXK A;  1QGP A;  3CD6 I;  2VL8 A;  3BQY A;  1X1A A;  4Q4Z F;  3HIF A;  2E34 A;  2NS0 A;  2R7S A;  4DBR A;  4KJZ A;  1J59 A;  3F9K A;  1TC3 C;  2N8G A;  2JA5 J;  1QNT A;  2GWR A;  4B3A A;  1K4T A;  2HYJ A;  2O8K A;  3C7J A;  5DS9 A;  3C2G A;  2IW5 A;  4V2F A;  1B6A A;  1K6Y A;  3H92 A;  3BR5 A;  1X3U A;  2HQ5 A;  4S0H B;  3WTX C;  2ZJQ F;  3ZQ7 A;  3J81 K;  4OAZ A;  1T0F A;  1GVD A;  3HDD A;  3VOD A;  1OCP A;  2R93 J;  3R6S A;  3KP3 A;  1OCO H;  2VN2 A;  3RPQ A;  3ZXS A;  2PMU A;  4BJ5 C;  5M3F J;  1H9T A;  3WHB A;  3MKZ A;  2GIZ A;  3C3W A;  3SJM A;  2OTL I;  1B8I B;  2ZC2 A;  3EYY A;  1W36 C;  3DTE A;  1DPR A;  2IEK A;  3PFY A;  4GDF A;  1MJ9 A;  1G3Y A;  4HLY A;  1ETX A;  2FD5 A;  4RB0 A;  2VOP A;  3TDZ C;  3GZ5 A;  3FDY A;  2EFN A;  3RQI A;  2FOK A;  3BTC A;  2OBP A;  1KQ0 A;  1E3H A;  2H94 A;  1KU9 A;  1KYZ A;  2CV0 A;  3DQV C;  1T0F C;  2PEX A;  4GYI A;  3CCM I;  3LA3 A;  4ZDP A;  5HLH A;  3FM5 A;  4KMF A;  1R7J A;  3VSK A;  2DCE A;  3BCA A;  5EG0 B;  2MYS A;  4UVC A;  4XON A;  2VB6 A;  3G1O A;  2CMP A;  5ICG A;  3MQ0 A;  2DMU A;  2NAZ A;  2E5Z A;  4J19 A;  2EQR A;  3RPU D;  1X4P A;  3TED A;  2HWV A;  4ZH4 F;  1FYL A;  3BTJ A;  2ELK A;  2LRD A;  2XAU A;  4F92 B;  2L01 A;  4A69 C;  4ENJ A;  3SFZ A;  3ZQH A;  2QWW A;  4MO7 A;  1VQP I;  1ZAR A;  4HZF A;  5IT9 K;  2QVO A;  2D45 A;  2E1O A;  4BJ6 C;  2RQP A;  1WCM J;  2LD5 A;  3DBH B;  3QPH A;  3CJT B;  1UCR A;  3MZ8 A;  1LPQ A;  4XKV A;  1UMQ A;  1Y8R B;  2KT0 A;  2LY2 A;  2MLG A;  4A3G J;  3ASO H;  4M3D A;  2B7E A;  2CUE A;  2QA4 I;  1X3Z B;  4MFE A;  3I55 I;  3V8J A;  2CH0 A;  3SEQ A;  3L2Q A;  3OYK A;  5GAE J;  1JGS A;  2NS7 A;  1WQ2 A;  1R5H A;  3N05 A;  2DYS H;  1Y8Q B;  4A0Y A;  2DDB A;  2W7N A;  2ZME A;  3IKT A;  1X3W B;  1XD7 A;  1TZL A;  1R5G A;  4M9X A;  1XGS A;  1T56 A;  2O5R A;  3G1L A;  4ENN A;  2IAI A;  1CF7 A;  4KDP A;  1BW5 A;  5L3F A;  4PJ0 C;  1VQL I;  4PJN A;  1YI2 I;  3RTR A;  1U0J A;  4W1U A;  4EM1 A;  2RVC A;  1JUS A;  2ZSI B;  4R1H A;  2EJR A;  2DA4 A;  1TT5 B;  2COM A;  2GIV A;  3BJ6 A;  1RUO A;  3IWZ A;  4BXU A;  4E7L A;  2P5L C;  4XOP A;  4YEL A;  3E6M A;  2H8R A;  4L9V A;  1R36 A;  2DOA A;  2OUM A;  4XSX F;  3JRI A;  1WSU A;  5IOZ A;  4E7J A;  4DYQ A;  1APL C;  3VPR A;  1TQM A;  2Q2E B;  3E97 A;  2ICW G;  3DU6 A;  2NVU B;  3GZ6 A;  4P1W A;  2FBK A;  1BA5 A;  2O8X A;  3JTG A;  2FXA A;  3U1D A;  2VBX A;  5E8G A;  3CES A;  1RNL A;  2KP6 A;  1W1W E;  3M07 A;  2LK2 A;  2DMT A;  2ZJP F;  1B4A A;  1ACI A;  1S7E A;  2YX7 A;  2WV1 A;  2W25 A;  4XN3 A;  3QOD A;  3K4M A;  4BE0 A;  4ZDO A;  2NOG A;  5L3C A;  4J01 A;  3QOP A;  4G7O F;  4N9I A;  3QU6 A;  4NC6 A;  4BAC A;  1WI3 A;  3CZ6 A;  1G3S A;  1EV7 A;  3A01 A;  4WXD A;  4C2M J;  4WK8 F;  3CMA I;  2H8W A;  2F5D A;  3AFH A;  3JW4 A;  3MN2 A;  3WGI A;  1Z6R A;  2OJE D;  1Z67 A;  2LY9 A;  3ECO A;  4G6D A;  1XMX A;  3CJN A;  2I10 A;  1LDK B;  5D4R A;  1ZR4 A;  1VND A;  5IYB J;  4WX9 A;  1TWG J;  5GPC A;  1RKW A;  5F6F A;  3S2W A;  3MFK A;  4X6A J;  4X0G A;  3KCC A;  2PI0 A;  1GVJ A;  1W7P D;  1FT9 A;  3PFI A;  2STT A;  3ERE D;  2H09 A;  3PNY A;  4AVZ A;  2HPI A;  4LK0 F;  1G2H A;  1ZRD A;  1ZRF A;  2O03 A;  4RLF A;  2AHQ A;  2R7T A;  4N4N B;  5GPA A;  2L9R A;  2XAQ A;  2EK5 A;  3OIO A;  2MD0 A;  5J47 A;  3F22 A;  2BE5 F;  2Y0M A;  2DTZ A;  1LFP A;  3E5Q A;  1WJE A;  1Y39 A;  4ZZL A;  2K86 A;  5DUI A;  2VT3 A;  3KFW X;  3X2Q H;  1WHU A;  1LJ9 A;  5HOD A;  1ZYR F;  4HBL A;  2OZ6 A;  3MZY A;  1IXC A;  2CQ7 A;  3ASN H;  3L2U A;  1SC7 A;  2NVY J;  2JPC A;  4UHT A;  5LHG A;  2R7W A;  4UUV A;  2IS1 A;  4CYD A;  1EH6 A;  2EZH A;  3O8H A;  2L4A A;  4LOC A;  3MVP A;  4D0P A;  4D5F A;  2LYC A;  4DZJ A;  4YIR X;  2E36 A;  1ON1 A;  1DU6 A;  3SZT A;  2V1D A;  3PSF A;  2BY2 A;  2R7Z J;  2HU9 A;  3RKX A;  1XB4 A;  3M3Y J;  3OOP A;  3ML6 A;  3L1P A;  1I39 A;  2JWT A;  4OIO F;  1GDT A;  3OMY A;  2PN6 A;  3CJQ B;  1KGS A;  2FRH A;  5HS9 A;  4HX7 A;  3GXO A;  4X1E A;  2M4G A;  4RB1 A;  3RQ4 A;  3H5R A;  4BUP A;  3GVA A;  3G6E I;  4NQW A;  5LRR A;  2DAO A;  2KQR A;  3MCZ A;  5H2F C;  2DMP A;  1AWC A;  3ABM H;  2L7F P;  3BR1 A;  3L9F A;  2Y69 H;  5M5Y J;  5TGT A;  3WOD F;  1MSF C;  3CCU I;  1J2X A;  2VKV A;  2KIM A;  1FY7 A;  3ZMS A;  4WCG A;  2QBY A;  2KJB A;  4IQJ A;  5FKL A;  1V55 H;  2Z3Y A;  2B63 J;  4C9Y A;  5IP6 A;  2HKX A;  3OYM A;  2JJ7 A;  3CDL A;  2CFX A;  4A12 A;  5F64 A;  4HST A;  4UXN A;  1WJ5 A;  4KIC A;  3ABK H;  3I54 A;  1I5Z A;  3J7A Y;  1X2N A;  5GAH J;  3W2A A;  1P4X A;  1A35 A;  1U8B A;  1WH5 A;  2ZNY A;  2LLK A;  1YX5 A;  3ZRG A;  5ILV A;  3S1R J;  3N97 A;  2K40 A;  2M30 A;  3F0C A;  4YRV A;  4CSW A;  2OZU A;  1PP7 U;  1E0E A;  4IQ4 A;  1Z9C A;  4S05 A;  3ECH A;  1LFU P;  3DLL F;  4BDZ A;  2E71 A;  4AID A;  4XIC A;  3OYH A;  4I01 A;  1IG7 A;  4HOB A;  3SHF A;  3LSK A;  4PGG A;  2M9H A;  2VC1 A;  1MKM A;  2L9S A;  3LQR A;  2P5K A;  1B72 B;  4UUS A;  1R58 A;  2KL4 A;  2CUZ A;  4GO1 A;  4A3L J;  2ECC A;  3IHU A;  2AQF A;  5LHH A;  1NHA A;  1M1E B;  4HSR A;  4IEJ A;  2IS2 A;  2XAG A;  3CUO A;  5DEQ A;  2GOX B;  3IAM 2;  2DXI A;  3EYI A;  5ICE A;  5LFA A;  2NYX A;  3ZMT A;  3A4C A;  2WV0 A;  3GX4 X;  4UB8 C;  3VYS B;  4NB5 A;  2QUF A;  2IGO A;  3GWZ A;  3HOT A;  4CHU A;  1SD7 A;  3DEW A;  3GBG A;  1TLH B;  3F21 A;  4EM0 B;  3H9G A;  5DYM A;  3OYD A;  4P5O A;  4EJO A;  3WTW C;  3OYC A;  3DXJ F;  1BI1 A;  1KQ8 A;  2AQE A;  2XIG A;  1TW2 A;  1IC8 A;  1X1P A;  2K9N A;  1BN5 A;  4IOC F;  2LMD A;  4YFK F;  3KX2 A;  2HYF A;  4Y15 A;  2KPM A;  1HCR A;  4LMY A;  1KON A;  3FK7 A;  3ZGK A;  1DGR M;  1EH7 A;  5H6R A;  3VYR B;  1FWZ A;  2EZK A;  4HDU A;  3L7W A;  3HKZ N;  1S3J A;  3EUA A;  1YJW I;  3SDB A;  5FRO A;  2WY7 Q;  3J80 K;  1UG0 A;  3KYC B;  3K4J A;  4G8X A;  2DPD A;  3OYJ A;  4Y33 A;  2ACJ A;  3JRF A;  2DQL A;  3J7A O;  2FMY A;  3S1M J;  2VUM J;  2WAD A;  3S2D J;  2H27 A;  3BR3 A;  4Y13 A;  3HOZ J;  1Y56 A;  1UFM A;  2RGV A;  4E70 A;  1B9N A;  2EV5 A;  3WG9 A;  2FF4 A;  4U88 A;  2HNH A;  3K1N A;  2CO5 A;  3HL2 A;  1JUP A;  3QPL A;  1BL0 A;  2VJ4 A;  5CQE A;  1MIJ A;  1ZEL A;  2TDX A;  4P9U A;  4A3D J;  4QWQ A;  1IV8 A;  3K7A J;  3BC8 A;  3HSR A;  1L0O C;  2OQR A;  3G73 A;  3HOS A;  2BY3 A;  1IRG A;  2CFO A;  3ZMD A;  3U21 A;  4B48 A;  4ESJ A;  4A3E J;  2NXN B;  3QU3 A;  3JTH A;  3HRS A;  1QPM A;  4U0Y A;  3C18 A;  5AIQ A;  2Y0S N;  4XLH A;  1S29 A;  4B8X A;  4CCL A;  3ZQC A;  4EQQ A;  5JHF A;  2BYV E;  4IL6 C;  2HVR A;  5K7H A;  3CCQ I;  2K4B A;  2OQG A;  4FET A;  4G7H F;  2VC0 A;  3QP5 A;  2PJR B;  1OCC H;  4CUG A;  2EFO A;  4QPO A;  2VBY A;  1SMY F;  4MEY F;  1X2M A;  5BNG A;  3JRA A;  3ISP A;  1J9I A;  1EJ9 A;  4DGW B;  2VI6 A;  3C1D A;  3K70 C;  1WZ2 A;  3EDP A;  4O6J A;  5J1U A;  3L09 A;  4XNF A;  3U1K A;  4I2O A;  2LKS A;  4M9Z A;  3IRQ A;  4I99 C;  1XPX A;  2JT1 A;  3UNG C;  5H20 A;  4CCO A;  2MFZ A;  2LBF B;  2CQN A;  1TT0 A;  1O3S A;  1KU2 A;  4IRI A;  2LNB A;  5CYV A;  5FKN A;  1SD6 A;  1FC3 A;  2VKH A;  1ZHF A;  5E1X A;  3RSN A;  2P6T A;  4LG3 A;  1Q1H A;  4B09 A;  3FM3 A;  3RYR A;  3IUO A;  5LLQ A;  2GXA A;  2EZL A;  3WTT C;  1ONV A;  4MEX F;  2V9K A;  3K4C A;  2XB0 X;  3BTL A;  5K5R A;  3KP2 A;  2ZXI A;  2ESN A;  3PNT A;  3IH3 A;  1ZG3 A;  2ZB9 A;  3BR0 A;  4HAM A;  2DPU A;  2XGC A;  3M9A A;  4RA2 A;  4ZC3 A;  2IP2 A;  4R79 A;  2R7O A;  1JXS A;  3PL8 A;  2F5V A;  1HDP A;  2GZW A;  4JX6 A;  2KJC A;  4WXC A;  3T8T A;  3VDX A;  2QKL B;  3ZQG A;  1T6S A;  2ID3 A;  5C3E J;  2DOD A;  1IV6 A;  2LFB A;  3GFL A;  1I3A A;  2FBH A;  1XSX A;  1K6O A;  1JTX A;  2K4J A;  3MMY B;  1ZN2 A;  2C6Y A;  3FHZ A;  3ZP5 A;  3M1C A;  3GFI A;  3DFG A;  3NAU A;  1IN6 A;  3HG9 A;  1BIB A;  3M8J A;  2CV1 A;  3I58 A;  4BH9 A;  1S5L C;  2LRE A;  2CQQ A;  2DYR H;  3F23 A;  2ZFW A;  3D0S A;  2XSD C;  1FBU A;  1WI9 A;  2IGM A;  4FTH A;  1S7A A;  2RAE A;  4HPQ A;  4CO8 A;  1QA6 A;  2DOF A;  2M7B A;  4XMY A;  5HLT A;  3E6D A;  1H9G A;  3HZJ A;  3SEZ A;  4HLX A;  3GTP J;  3B02 A;  1F36 A;  5A2Q K;  1VQO I;  2JA2 A;  1DP3 A;  4DYR A;  4B47 A;  1N75 A;  2A5W A;  1WJD A;  1D0X A;  1FLI A;  3K4K A;  4KFC A;  1BI3 A;  2E7X A;  3JAM K;  3ESW B;  1Y6I A;  3S14 J;  4HF0 A;  4EAT A;  1IRF A;  4P9F A;  5E3O A;  1WKM A;  2GA1 A;  1VQ9 I;  2LH9 A;  3CJR B;  5LBQ A;  3OR2 C;  3CF5 F;  3Q0V A;  2ZFU A;  4M73 A;  1T38 A;  2VKE A;  5F0F A;  4BEH A;  1A36 A;  1F1Z A;  2G9W A;  3DBL B;  2LDU A;  4DBQ A;  2Z9O A;  2EA2 A;  4FCY A;  3FXM A;  2Y48 A;  4OWR B;  1WJB A;  1Y1V J;  2E19 A;  5HOO A;  2W1O A;  3P9K A;  3Q9S A;  2G7H A;  4I6Z A;  3GZN B;  5EEG A;  2KDZ A;  2X6W A;  2W00 A;  3QRF F;  4ITV A;  1YYV A;  4OIN F;  1MH3 A;  1J7K A;  2CW8 A;  4A3K J;  2WBM A;  3F6O A;  3LSI A;  3GTQ J;  3K4B A;  5TIS C;  2RC4 A;  2X6Y A;  4QPQ A;  3T0Y A;  1XTA A;  2FML A;  3E1S A;  5L3E A;  2IS4 A;  4LLG F;  1JKO C;  2O9L A;  1PP8 F;  1IN4 A;  4DOZ A;  4NNJ A;  1P9Q C;  4ENK A;  1QQI A;  2EIJ H;  4KN4 X;  3QP6 A;  4D1Q A;  1R00 A;  5LGN A;  2QEX I;  2M4K A;  2DLL A;  4OMY A;  1POG A;  5EG0 A;  2A61 A;  5M5X J;  4L18 B;  1D3Y A;  4E7I A;  1SFO J;  2DN0 A;  1BIA A;  2F2E A;  1LQ1 A;  1DP7 P;  1QZY A;  1OCT C;  4BNC A;  3LL7 A;  1FEX A;  2EWN A;  5JR3 A;  3BLY A;  4RLQ A;  1V5F A;  1OIS A;  5ERI A;  3IKV A;  2IPQ X;  1Z77 A;  4RGU A;  2R5Z B;  3GO5 A;  4Y4R A;  3FXO A;  4KIT B;  5ICC A;  2CV2 A;  1KA8 A;  3PO3 J;  4WXH A;  2E2J J;  1W7P A;  3DWL E;  4XLC A;  3IAS 2;  4F52 A;  3RIR A;  1HW2 A;  1Y1W J;  3BZ6 A;  2D2W A;  4WF2 A;  1TL8 A;  1BR2 A;  4OAY A;  3CCV I;  1VQN I;  1U9O A;  3F8M A;  4E7H A;  2M1B A;  1TWA J;  1UB9 A;  1D1C A;  2L02 A;  3ELK A;  4BYY A;  2LBF A;  1SVL A;  3L2R A;  3MKW B;  3KP4 A;  4HV6 A;  3BQZ A;  3RZO J;  3KZY A;  1IXR C;  2E1M C;  4ZYE A;  2MH9 A;  3OSG A;  3GEZ A;  3LSM A;  1ERD A;  4E7S A;  3HB9 A;  3G3Z A;  4MQ9 F;  4PK4 A;  5DV5 A;  1Y0N A;  3BWG A;  4XLP F;  2DA2 A;  3EUH A;  3I59 B;  4U87 A;  1H8A C;  2E2H J;  5D6E A;  3QPS A;  4O3M A;  5DCF A;  3GYH X;  5LGU A;  2PJR A;  1JT6 A;  3VOE A;  3HOX J;  3S3M A;  3HOW J;  1FX7 A;  1DU0 A;  1JI8 A;  4C3H J;  2EH3 A;  2L7M P;  2DA5 A;  3FWE A;  3BG6 A;  2JA7 J;  5AIP A;  1REP C;  2HOT A;  2IBD A;  2OV7 A;  3HSE A;  4DIQ A;  3O6B B;  1MMS A;  1XS9 A;  4OMZ A; 
#chains in the Genus database with same CATH homology
 1J0R A;  4N9H A;  4LK1 F;  3IWF A;  2MLK A;  3Q5F A;  4OIR F;  1TBX A;  2E1N A;  1TW3 A;  4HX8 A;  3M1E A;  1I27 A;  1AOY A;  1W4M A;  1FNN A;  5FD5 A;  4MTE A;  4OIP F;  3CO6 C;  2MBF A;  4ESB A;  4M71 A;  1GXP A;  3ZMV A;  1YS7 A;  3NRV A;  4Q47 A;  4F7Z A;  4RB2 C;  1HBX G;  2PJP A;  1B9M A;  4XRF A;  2DO7 A;  4GCV A;  3RDI A;  3JSO A;  4FT8 A;  3CDH A;  2ISZ A;  2D1H A;  1B59 A;  3E5X A;  2MA3 A;  1ZRE A;  2XGX A;  2XVC A;  2ISY A;  3DV8 A;  3KLN A;  1H0M A;  2AS5 F;  4EGY A;  2XAS A;  2NNN A;  3B73 A;  4ENM A;  2IA2 A;  1K79 A;  1YTY A;  3RKW A;  1FYM A;  4HYE A;  1J75 A;  1XCB A;  1TQP A;  2ZCW A;  5K5Q A;  2DU9 A;  2VBZ A;  3TO9 A;  1R1U A;  4PZJ A;  1BM9 A;  1GXQ A;  4ESF A;  2JZY A;  1OYY A;  3I5U A;  3GUD A;  4LD5 A;  5ICF A;  1IUY A;  2HTS A;  3TDU C;  2VOD A;  1Z7U A;  3SQN A;  3J81 Z;  2FEZ A;  2UWM A;  2RNJ A;  1YG2 A;  4LB5 A;  2LF8 A;  3BJA A;  4AIK A;  2EA4 A;  3GLX A;  4L0Z B;  3WTV C;  2V6C A;  3LQQ A;  2HR3 A;  4ZYD A;  3FX3 A;  5DD4 A;  4MQV A;  5D8L B;  2G7U A;  3P9I A;  5BPI A;  3MWM A;  3DEU A;  4RGR A;  2YR2 A;  4FX4 A;  2QM3 A;  5CVJ A;  3LWF A;  1OYW A;  1FSE A;  4A0Z A;  2PBI A;  4AIJ A;  5CVI A;  5ILS A;  4A6D A;  4EJU A;  1P4A A;  4UV9 A;  2M87 A;  1XCV A;  1LVA A;  2HFH A;  4LFU A;  5LEK A;  3RYP A;  1LEA A;  4MHG A;  2K02 A;  2P8T A;  4I98 B;  4MNU A;  2DFI A;  4A6E A;  3W6J B;  3PQK A;  3TO6 A;  4KNY A;  2VXZ A;  2NNY A;  4JK1 X;  3JAM Z;  2YPR A;  1QO0 D;  2YU3 A;  4H0E A;  2HZT A;  5E1W A;  4N0B A;  5JVT A;  4UNO A;  1RUN A;  3F8N A;  1BC7 C;  4RAZ A;  4ZYG A;  4HV5 A;  4UVB A;  4EV0 A;  1MDM A;  3F3X A;  4YG2 F;  1FP1 D;  1ZH5 A;  3ABT A;  5D4S A;  3TGN A;  4L9J A;  4P96 A;  2EV0 A;  3FXQ A;  3F8B A;  2OD5 A;  3VEP A;  1QZZ A;  4EGZ A;  2HTJ A;  1SD4 A;  4IHT A;  4U7B A;  4AWX B;  4Y17 A;  1R1V A;  4LG0 A;  2GXB A;  5FFX A;  2AXL A;  2BGC A;  5KK1 A;  2M5W A;  1ULY A;  1U5T B;  3FMQ A;  4JBA A;  2KRF A;  4A5N A;  1WRJ A;  3EQL F;  4BQA A;  1U2W A;  4G7Z F;  1P6R A;  1FPQ A;  2R7D A;  1IW7 F;  1XGN A;  2QZ8 A;  2P4W A;  4PDK A;  4EJV A;  5LRS A;  2W85 A;  3GFM A;  5JI6 A;  3JSP A;  2BV6 A;  3WE2 A;  4A5M A;  4M6X A;  4OU0 A;  3SZP A;  1HSJ A;  3N4M A;  1L3L A;  1K78 B;  2QQB A;  2ZO4 A;  4EVI A;  4IXA A;  3DPT A;  1CGP A;  3V7R A;  2YSR A;  3HHH A;  2M45 A;  3ROU A;  2CSO A;  4L0Y B;  2KKO A;  1SFX A;  1G4D A;  1MJB A;  4HQE A;  2JTV A;  1ZG5 A;  1KU3 A;  3ZN1 A;  2FA5 A;  3TOA A;  3L00 A;  4AVP A;  1D8J A;  2V1X A;  3J80 Z;  2YX4 A;  3NEU A;  1BOA A;  3I64 A;  5BQT A;  4GYG A;  3K69 A;  3CTA A;  3R61 A;  2Z99 A;  4M72 A;  3ZN0 A;  1MJA A;  4Z2Y A;  2XAF A;  2CG4 A;  2M8E A;  1P2F A;  3QAH A;  2QQ9 A;  4AD9 A;  1YLF A;  4DQ2 A;  1ZGJ A;  3BJO A;  3WTZ A;  1P92 A;  4KIB A;  1FYK A;  2ETH A;  4LB6 B;  4IRH A;  4HF1 A;  4CDG A;  5DDG A;  4NHJ A;  4XBF A;  3OV8 A;  5ED4 A;  1XGM A;  2XRO A;  2EV6 A;  1G3W A;  5E1Z B;  2JSC A;  3FMS A;  4CZZ A;  1ODD A;  5J8F A;  2Z5U A;  2ZJ2 A;  1UST A;  5HVQ C;  4ON0 A;  3ABU A;  2A3S A;  2F5E A;  1JHH A;  4RGX A;  3HYI A;  4ETS A;  4YII A;  2DTR A;  3GW2 A;  2Z33 A;  3HTU A;  2FSW A;  4U0W A;  1Z1D A;  1TTY A;  3KEO A;  2EB7 A;  4K2E A;  5BS6 A;  4Q5S F;  2HEO A;  3I59 A;  2FQ3 A;  5HDK A;  5BPD A;  2KIU A;  5HS8 A;  4L9T A;  2VE8 A;  5DD8 A;  4RS8 A;  5HLI A;  3T8R A;  1STZ A;  2UXN A;  3I0T A;  3I4P A;  3KET A;  2E7W A;  3R4K A;  2RN7 A;  1OPC A;  1T2K A;  4ASN A;  1XSV A;  3MAJ A;  2H6C A;  4KMU X;  3WTS C;  4I09 A;  2WTE A;  2STW A;  1IN8 A;  3RI4 A;  1SFU A;  5CJ9 A;  1U78 A;  3CUQ A;  3U2R A;  3IRR A;  1LDD A;  3KP6 A;  5FD6 A;  5D5U B;  3K0L A;  4LLN A;  3HRT A;  1W7P B;  3E5U A;  2VBW A;  2Y75 A;  1SD5 A;  1O7F A;  3T1B A;  3WGH A;  5E8I A;  1PUE E;  1YW7 A;  1FBS A;  3F6V A;  2X0L A;  2IA1 A;  3CUQ C;  1E17 A;  2O61 A;  1YW9 A;  3NQO A;  2GA2 A;  1FBQ A;  2MC3 A;  5E17 F;  1WWX A;  1XMA A;  1SFE A;  4RGS A;  4GXO A;  4RB3 C;  2R7F A;  2XHK A;  1I6X A;  2HKO A;  3TKY A;  4I7H A;  1HW5 A;  1XDU A;  2J5O A;  2L3D A;  1OMI A;  1MD0 A;  2O6G E;  2ZNZ A;  2QBY B;  2GAU A;  1S8N A;  2RV8 A;  2GQQ A;  1LNW A;  1D5V A;  2QEN A;  2WC2 A;  4IJA A;  1OYI A;  4M74 A;  2KIF A;  2UXX A;  5CVV A;  3F8F A;  3LFK A;  3D5L A;  5JHU A;  4A0X A;  2VT2 A;  4YFX F;  4DNC A;  3KE2 A;  3O3K A;  4KA4 A;  5FFZ A;  1U5T A;  2OAZ A;  1ZGA A;  3HRU A;  4EM2 A;  5F1R A;  2FBI A;  2A6E F;  5IT9 Z;  2NRA C;  4FHT A;  4BHB A;  1U8R A;  3IC7 A;  2H6B A;  3V8L A;  2EFW A;  4OIQ F;  2ZBK A;  4IF4 A;  1Z6T A;  2L4M A;  4Q48 A;  4PCQ A;  1KYW A;  3FZV A;  1BBY A;  3LAJ A;  2QYO A;  4UVA A;  2DQR A;  2PLY A;  1HXD A;  4R8H A;  2Q8K A;  5J6X A;  5EEH A;  3M7G A;  4IVN A;  3BPV A;  1ZRC A;  5LEJ A;  3WGG A;  2DT5 A;  3BPX A;  2B0L A;  1USS A;  1I1G A;  1YS6 A;  2FU4 A;  4BHC A;  1QBJ A;  3HTS B;  1YW8 A;  2V1U A;  1SAX A;  1MZB A;  1U5T C;  2D1V A;  3M8F A;  2EFP A;  1BC8 C;  1ZAO A;  1K7A A;  1JHF A;  2A5Y B;  1O7L A;  1U3E M;  4AIH A;  1PDN C;  1J5Y A;  1F5T A;  5D5V B;  4G94 A;  3COA C;  4IHS A;  2ZKZ A;  3MEX A;  5HDN A;  1ZLJ A;  3MZH A;  3K9T A;  4LJZ F;  3ZPL A;  1TNT A;  1FZP B;  2Q2E A;  3V4G A;  5FGM A;  1VTN C;  4I0A A;  4QLC U;  2R3S A;  3V7C A;  2A07 F;  4HQM A;  5BMZ A;  2IT0 A;  2UZK A;  5FB2 A;  2O0Y A;  3E3V A;  1HW1 A;  1T39 A;  1CF7 B;  1HKS A;  3VB2 A;  1KQ9 A;  5CVU A;  4HA8 A;  5E20 A;  4KT5 C;  3WU1 B;  2ZME B;  2DBB A;  3FF5 A;  4ZYH A;  2FNA A;  3DKW A;  2VE9 A;  1W5S A;  4KIG A;  1HKQ A;  1G6N A;  1G3T A;  3IL2 A;  2W57 A;  1SMT A;  1XGO A;  2LSO A;  5L3D A;  1YQA A;  2P7V B;  5KVR A;  1XMK A;  2P6S A;  2DI3 A;  4KIF A;  3QPT A;  2P5V A;  5K1Y A;  4YIF A;  2HDC A;  2XAH A;  5FLX Z;  4LGW A;  5ILU A;  1Z91 A;  3WTY C;  2DK5 A;  2JPB A;  1RIO H;  4EJT A;  3FMR A;  2O3F A;  3AAF A;  3KEQ A;  4HX4 A;  5D5W B;  4O5V A;  1HQC A;  3LST A;  2JRT A;  2A6H F;  3V7S A;  1EH8 A;  2PMH A;  4U0V A;  1ZG1 A;  4XSZ F;  4JQF A;  3BDD A;  4M9S A;  3PQJ A;  1XN7 A;  2HGC A;  6PAX A;  2XUB A;  5D6F A;  2ESH A;  2E1C A;  3ULQ B;  3W6K B;  1KU7 A;  1V3F A;  2IJL A;  1DUX C;  1OR7 A;  2V9V A;  4MGR A;  1JE8 A;  5HDG A;  4CXF A;  1D8K A;  4HF2 A;  2CW0 F;  3R0J A;  3WTU C;  5J8C A;  2PFB A;  5A2Q Z;  3BRO A;  1ZLK A;  5E18 F;  1S7O A;  1IN5 A;  3KLO A;  3TQN A;  3HHG A;  5TJJ A;  1V4R A;  5FLX K;  1S6L A;  3DP7 A;  1HKT A;  2A68 F;  2XRN A;  2CGP A;  5CLS A;  2VOO A;  4L5J A;  5LGT A;  2J5P A;  2W24 A;  4RAY A;  3LA7 A;  3EET A;  3TO7 A;  1XSD A;  1O3R A;  2Q0O A;  2GXG A;  3RPU A;  1O3Q A;  3F8C A;  2ELH A;  4G6Q A;  5L3B A;  4U7D A;  4S04 A;  3REO A;  3LAP A;  3P7N A;  1GHC A;  1IN7 A;  2X4H A;  1HST A;  5JFR A;  3HUG A;  4FX0 A;  4TV7 A;  3DPL C;  1TQI A;  2OU2 A;  5DUK A;  1IXS B;  5DCM B;  5D8K B;  1B1B A;  1T98 A;  4M6Y A;  4HW0 A;  2FE3 A;  2PQ8 A;  5AON A;  3BP8 A;  3WE3 A;  2BBY A;  1FSH A;  1LDJ A;  1DDN A;  3TOB A;  1R1T A;  2K7L A;  1U6G A;  4KYW A;  3U9G A;  2WWY A;  1RZ4 A;  1F4K A;  4BHP A;  5BOX A;  1BI0 A;  2W84 A;  3K1M A;  2IA0 A;  4MTD A;  4LLL A;  3RJP A;  1IZ1 A;  2VON A;  2ZXJ A;  3KZZ A;  4EJW A;  3BOQ A;  1K78 A;  2MH2 A;  2XKP A;  1XDS A;  4XLN F;  3RKY A;  5H6Q A;  2XV4 S;  2DW4 A;  2XAJ A;  2OA4 A;  3SXY A;  5K5O A;  5IT3 A;  3CLO A;  4KUM A;  5FO5 A;  1R23 A;  3H3U A;  2P7C B;  1LEB A;  2IVM A;  5HLG A;  1BI2 A;  3HRM A;  2PG4 A;  4OOI A;  2RKH A;  1YO5 C;  3H3Z A;  2HS5 A;  3I53 A;  5L3G A;  3F72 A;  5TRD A;  3KP5 A;  1IAW A;  1UHW A;  2ADU A;  2CQK A;  4PGH A;  4LG0 B;  1MGT A;  2CYY A;  1BJA A;  3R60 A;  1FOK A;  1E2X A;  4CIC A;  4EMS A;  1FP2 A;  1OKR A;  2A69 F;  2K27 A;  2XKO A;  1YIO A;  5DCM A;  4P55 A;  1C0W A;  3E6C C;  1A04 A;  2CWE A;  1Z05 A;  3T5X A;  4KN7 X;  1MDM B;  1YFH A;  3VFZ A;  2F5F A;  1TNS A;  3CUQ B;  2EFQ A;  1W5T A;  4I02 A;  3ZMZ A;  4UV8 A;  1LB2 A;  3GFJ A;  2IRF G;  2BEO A;  3HSF A;  1UHM A;  2V79 A;  1RI7 A;  3K1P A;  2LF7 A;  1R22 A;  3Q9V A;  2HQN A;  3WU0 A;  3V8K A;  2L54 A;  1O57 A;  5D5X B;  3BY6 A;  3DF8 A;  1O3T A;  3P9C A;  2LKP A;  1ON2 A;  3E6B A;  4IRG A;  1I1S A;  3L2C A;  3I71 A;  4IPA A;  2FNP A;  2HOE A;  4YFN F;  4I0B A;  3M8E A;  2F5C A;  1F9N A;  2DK8 A;  2QLZ A;  4L9N A;  4A2U A;  3O2P E;  3K2Z A;  1DPU A;  1P4W A;  2QQA A;  1IF1 A;  5HS7 A;  4CGZ A;  2HQR A;  4L5I A;  1Y0U A;  2MD5 A;  4GGG A;  4BAY A;  5LHI A;  4G9Y A;  3FXU A;  3GF2 A;  4WWC A;  4HDV A;  3LA2 A;  2HYG D;  2RDP A;  4ZZD A;  3ZMU A;  3FXR A;  3R0A A;  5CVR A;  3CO7 C;  3KP7 A;  1QGP A;  4Q4Z F;  3HIF A;  2NS0 A;  1J59 A;  1QNT A;  2GWR A;  3C7J A;  2IW5 A;  1B6A A;  3H92 A;  3WTX C;  1X3U A;  3ZQ7 A;  3J81 K;  1T0F A;  3VOD A;  3R6S A;  3KP3 A;  3RPQ A;  2VN2 A;  2PMU A;  1H9T A;  3C3W A;  3EYY A;  1DPR A;  1MJ9 A;  1G3Y A;  4HLY A;  4RB0 A;  2VOP A;  3TDZ C;  3GZ5 A;  2EFN A;  2FOK A;  2OBP A;  1KQ0 A;  2H94 A;  1KU9 A;  1KYZ A;  3DQV C;  2PEX A;  4GYI A;  3LA3 A;  5HLH A;  3FM5 A;  4KMF A;  1R7J A;  4UVC A;  5ICG A;  3MQ0 A;  2NAZ A;  2HWV A;  4ZH4 F;  1FYL A;  2L01 A;  4ENJ A;  3SFZ A;  2QWW A;  1ZAR A;  4HZF A;  5IT9 K;  2QVO A;  2D45 A;  2RQP A;  3QPH A;  1UCR A;  2MLG A;  3V8J A;  1JGS A;  1WQ2 A;  1R5H A;  4A0Y A;  2ZME A;  3IKT A;  1XD7 A;  1R5G A;  4M9X A;  1XGS A;  4ENN A;  1CF7 A;  4KDP A;  5L3F A;  3RTR A;  4EM1 A;  2RVC A;  4R1H A;  2EJR A;  2COM A;  2GIV A;  3BJ6 A;  1RUO A;  3IWZ A;  4BXU A;  2P5L C;  3E6M A;  4L9V A;  1R36 A;  4XSX F;  1WSU A;  1TQM A;  3E97 A;  3GZ6 A;  2FBK A;  2O8X A;  3JTG A;  2FXA A;  3U1D A;  2VBX A;  5E8G A;  1RNL A;  1B4A A;  2YX7 A;  2W25 A;  5L3C A;  3QOP A;  4G7O F;  4N9I A;  3QU6 A;  1G3S A;  1EV7 A;  4WXD A;  4WK8 F;  2F5D A;  3JW4 A;  3WGI A;  1Z6R A;  3ECO A;  4G6D A;  3CJN A;  1LDK B;  5D4R A;  4WX9 A;  5F6F A;  3S2W A;  3MFK A;  2PI0 A;  3KCC A;  1GVJ A;  1W7P D;  1FT9 A;  3PFI A;  2STT A;  3ERE D;  2H09 A;  4LK0 F;  1ZRD A;  1ZRF A;  2O03 A;  2XAQ A;  2EK5 A;  3F22 A;  2BE5 F;  2Y0M A;  3E5Q A;  4ZZL A;  2K86 A;  5DUI A;  2VT3 A;  3KFW X;  1LJ9 A;  1ZYR F;  4HBL A;  2OZ6 A;  3MZY A;  1IXC A;  2JPC A;  4UHT A;  5LHG A;  4UUV A;  4CYD A;  1EH6 A;  2L4A A;  4D0P A;  1ON1 A;  3SZT A;  2V1D A;  3RKX A;  1XB4 A;  3OOP A;  3ML6 A;  4OIO F;  2PN6 A;  1KGS A;  2FRH A;  5HS9 A;  4HX7 A;  3GXO A;  4RB1 A;  3GVA A;  4NQW A;  5LRR A;  2DAO A;  3MCZ A;  1AWC A;  3L9F A;  3WOD F;  1J2X A;  4WCG A;  2KIM A;  1FY7 A;  3ZMS A;  2QBY A;  2KJB A;  2Z3Y A;  2HKX A;  2CFX A;  4A12 A;  5F64 A;  4UXN A;  4KIC A;  3I54 A;  1I5Z A;  1P4X A;  2ZNY A;  5ILV A;  3N97 A;  2M30 A;  2OZU A;  1PP7 U;  1Z9C A;  4S05 A;  3ECH A;  4I01 A;  4HOB A;  3SHF A;  4PGG A;  2VC1 A;  1MKM A;  3LQR A;  2P5K A;  1R58 A;  4GO1 A;  3IHU A;  5LHH A;  1NHA A;  2XAG A;  3CUO A;  5DEQ A;  3EYI A;  5ICE A;  2NYX A;  3ZMT A;  2WV0 A;  3GX4 X;  4NB5 A;  2QUF A;  3GWZ A;  3HOT A;  4CHU A;  1SD7 A;  1TLH B;  3F21 A;  4EM0 B;  5DYM A;  4P5O A;  4EJO A;  3WTW C;  3DXJ F;  1BI1 A;  1KQ8 A;  2XIG A;  1TW2 A;  1BN5 A;  4YFK F;  2HYF A;  4Y15 A;  4LMY A;  1EH7 A;  5H6R A;  1FWZ A;  4HDU A;  3L7W A;  1S3J A;  3J80 K;  4G8X A;  2DPD A;  2ACJ A;  2DQL A;  3J7A O;  2FMY A;  2H27 A;  4Y13 A;  1UFM A;  2RGV A;  4E70 A;  1B9N A;  2EV5 A;  3WG9 A;  2FF4 A;  4U88 A;  3K1N A;  2CO5 A;  2TDX A;  4P9U A;  4QWQ A;  3HSR A;  1L0O C;  2OQR A;  3G73 A;  3HOS A;  1IRG A;  3ZMD A;  4ESJ A;  3QU3 A;  3JTH A;  3HRS A;  1QPM A;  4U0Y A;  3C18 A;  5AIQ A;  1S29 A;  4B8X A;  4EQQ A;  2BYV E;  2K4B A;  2OQG A;  4G7H F;  2VC0 A;  3QP5 A;  2EFO A;  2VBY A;  1SMY F;  4MEY F;  3ISP A;  1J9I A;  3C1D A;  3EDP A;  4O6J A;  3L09 A;  4I2O A;  4M9Z A;  3IRQ A;  2JT1 A;  5H20 A;  1O3S A;  1KU2 A;  4IRI A;  2LNB A;  5CYV A;  1SD6 A;  1FC3 A;  5E1X A;  1ZHF A;  2P6T A;  1Q1H A;  4B09 A;  3FM3 A;  3RYR A;  5LLQ A;  3WTT C;  1ONV A;  4MEX F;  5K5R A;  3KP2 A;  2ESN A;  1ZG3 A;  4HAM A;  2DPU A;  3M9A A;  2IP2 A;  4R79 A;  1JXS A;  2GZW A;  2KJC A;  4WXC A;  3T8T A;  1T6S A;  3GFL A;  2FBH A;  1XSX A;  1K6O A;  2K4J A;  1ZN2 A;  2C6Y A;  3FHZ A;  3ZP5 A;  3GFI A;  3DFG A;  1IN6 A;  1BIB A;  3I58 A;  4BH9 A;  3F23 A;  2ZFW A;  3D0S A;  1FBU A;  1WI9 A;  1S7A A;  4CO8 A;  3E6D A;  1H9G A;  4HLX A;  3B02 A;  5A2Q K;  1FLI A;  4KFC A;  1BI3 A;  2E7X A;  3JAM K;  4HF0 A;  1IRF A;  4P9F A;  1WKM A;  2GA1 A;  5LBQ A;  4M73 A;  1T38 A;  1F1Z A;  2G9W A;  2LDU A;  2Z9O A;  2EA2 A;  2Y48 A;  5HOO A;  3P9K A;  3Q9S A;  2G7H A;  5EEG A;  3QRF F;  1YYV A;  4OIN F;  1J7K A;  3F6O A;  2RC4 A;  3T0Y A;  2FML A;  5L3E A;  4LLG F;  1PP8 F;  1IN4 A;  4ENK A;  1QQI A;  4KN4 X;  3QP6 A;  1R00 A;  5LGN A;  2DLL A;  4OMY A;  2A61 A;  4L18 B;  1D3Y A;  1BIA A;  2F2E A;  1LQ1 A;  1DP7 P;  1QZY A;  4BNC A;  2EWN A;  5JR3 A;  5ERI A;  3IKV A;  2IPQ X;  4RGU A;  3GO5 A;  5ICC A;  1KA8 A;  4WXH A;  1W7P A;  3RIR A;  1HW2 A;  3BZ6 A;  2D2W A;  4WF2 A;  3F8M A;  2M1B A;  1UB9 A;  2L02 A;  3ELK A;  4BYY A;  3KP4 A;  4HV6 A;  3KZY A;  1IXR C;  4ZYE A;  2MH9 A;  3GEZ A;  3G3Z A;  4MQ9 F;  5DV5 A;  3BWG A;  4XLP F;  3EUH A;  3I59 B;  5D6E A;  4O3M A;  5DCF A;  3GYH X;  5LGU A;  3VOE A;  1FX7 A;  3FWE A;  5AIP A;  1REP C;  3HSE A;  3O6B B;  4OMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...