1BM9A

Replication terminator protein from bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
EEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords REPLICATION TERMINATOR PROTEIN
publication title Crystal structure of the replication terminator protein from B. subtilis at 2.6 A.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 41
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bm9A00
2KRFA 4NB5A 2FU4A 3J80Z 4PDKA 2AS5F 2RQPA 5K5RA 2VE9A 3FWEA 4FX0A 5HOOA 1IZ1A 4HV6A 3FX3A 2F5EA 2G7HA 1XCVA 5ERIA 2TDXA 2E1NA 4I0BA 4A5NA 3KEOA 1OYIA 4LLGF 1KQ8A 5LGNA 3LA3A 4A0ZA 3F8MA 2OAZA 2XUBA 4OIOF 1XDSA 1H9TA 1FYMA 2NS0A 2R3SA 2BYVE 1BI2A 2RNJA 5E1ZB 3EYYA 1TW2A 2KJBA 2VC0A 3MCZA 3F8BA 3HUGA 1X3UA 1MDMB 4G94A 1DPRA 3K69A 4OOIA 2ZMEB 3U2RA 4MEYF 1TQPA 4KUMA 2HYFA 2EV6A 5D8KB 1J5YA 3SZPA 1K78A 3NQOA 2EJRA 3BPVA 3SXYA 3EYIA 4HW0A 1JE8A 1ZAOA 2A5YB 5L3BA 2RV8A 4D0PA 5BMZA 3F22A 1O3TA 3REOA 1U6GA 3KP4A 3MZYA 3RYPA 2E7XA 3HRUA 1KU3A 1IRFA 2NYXA 2XAQA 2ISZA 3IRQA 2YU3A 1WRJA 1XMKA 1HKSA 2QQBA 2GAUA 2EFNA 4EJWA 4LK1F 2Z99A 4AIJA 2MH2A 5BS6A 3RPUA 4HYEA 1R1TA 4HLXA 5BPDA 4S04A 1TW3A 3MWMA 4O6JA 2HS5A 1O7FA 5HLGA 4Y17A 3HRSA 1ZG3A 1H9GA 1GXPA 3ROUA 2D1VA 1ZH5A 3QOPA 1BC7C 4AD9A 1ZGJA 2QLZA 2UXXA 2E1CA 2V6CA 4HF0A 4JQFA 3ISPA 2GA2A 3AAFA 1OYYA 2GIVA 4ZZDA 4A0XA 1MZBA 2FBKA 1S8NA 3DV8A 4EMSA 4ESBA 3B02A 2DT5A 5ICFA 5CVVA 1BOAA 1FNNA 4JBAA 4KIBA 5D5WB 3WTZA 5L3GA 3V8KA 1K79A 3S2WA 2HGCA 5DD4A 4Y13A 3FZVA 1UHWA 4BH9A 1U5TB 4E70A 3F6VA 2M8EA 1B9MA 3DXJF 4H0EA 2O61A 1YS6A 1O3RA 2VOPA 4IHSA 5D5UB 3M8EA 2HR3A 4M74A 3G3ZA 4OIRF 1J7KA 2FA5A 3ZMVA 2WC2A 2PEXA 1O3SA 2V1DA 1BM9A 2MBFA 5LBQA 2VT2A 3JTGA 3FMSA 3WTXC 3LAPA 4Q47A 2FOKA 3GEZA 3I59A 2PLYA 1LDJA 1GHCA 4ON0A 2MLGA 2F2EA 5BOXA 2LKPA 2ZNZA 3MQ0A 2VBYA 4HV5A 3LFKA 4M6YA 4EJUA 3ECHA 4OMZA 1LEAA 2IJLA 5E17F 2JPBA 1FBSA 4OIPF 1FYLA 1OKRA 1T6SA 3T8RA 5LLQA 2W25A 2KKOA 3R0JA 3QRFF 4IPAA 3TDZC 2HQRA 1GVJA 3BP8A 5ILVA 1RUOA 3NEUA 1W7PB 3ZN1A 3HIFA 1RZ4A 5DDGA 5AONA 4LG0B 3F21A 5IT9Z 2OD5A 4EQQA 3BROA 4HDVA 3W6JB 2JTVA 2H6CA 2DBBA 2OZ6A 2DK8A 1ZREA 2ZJ2A 1Z7UA 3JAMZ 2XKPA 4RB2C 4M9XA 1OR7A 4R1HA 2Q0OA 2JRTA 1T0FA 2KIFA 4I09A 2HTJA 2D2WA 1QO0D 2QZ8A 2V1XA 2UXNA 4RAZA 4KFCA 1XB4A 3F6OA 1YW9A 4DNCA 2ELHA 5JVTA 2STWA 1YO5C 3IL2A 4OIQF 1F1ZA 1YIOA 5L3DA 4ESJA 5J8CA 5DCMA 2IRFG 1R58A 5ICCA 1ULYA 3O2PE 1JHHA 4UVBA 4U0VA 3B73A 3T1BA 1CF7A 5LHIA 2DQLA 2VXZA 3MEXA 4KT5C 1H0MA 3KZYA 4G6DA 4AIKA 1U5TC 5F64A 1O7LA 2DW4A 2Y75A 5J6XA 1FWZA 3WE2A 4A6DA 3GWZA 3I64A 1USTA 2LDUA 2R7DA 2DPUA 2FSWA 5DD8A 4ENJA 3VEPA 1XGMA 4EM1A 2K86A 2A07F 2NRAC 3BZ6A 4UV9A 4GGGA 2OQGA 4AVPA 5HS7A 1IN6A 1SD6A 5DCFA 1G3WA 1K78B 1R23A 3CUQA 1IF1A 3IKTA 3PQKA 1YTYA 1D3YA 2ZCWA 2EFWA 2KIMA 2W85A 3CLOA 1DUXC 3U9GA 2OQRA 1W5TA 1BJAA 1JGSA 1QZZA 3MFKA 1PUEE 5LEJA 1W5SA 2HZTA 4HF1A 4LB6B 1DPUA 4ETSA 3PFIA 4A5MA 5D6EA 2P7VB 3VODA 1P2FA 5LRRA 1XSDA 1R1VA 1TNSA 5IT9K 5FLXZ 3HYIA 2O3FA 2QQAA 1WKMA 2VBXA 4CDGA 2XHKA 1QGPA 4Q48A 3WGGA 1U2WA 1F5TA 1FT9A 1BBYA 2P4WA 2EB7A 3BY6A 2HTSA 3TO6A 3WTSC 4NHJA 1U8RA 1Z91A 2FRHA 3V7SA 4EJOA 2ETHA 4XSXF 2WWYA 2IA0A 2XAFA 3HHGA 1XMAA 4M6XA 5EEHA 4U7BA 2J5OA 5D4SA 2M45A 4I7HA 4RGUA 3E6DA 2EA4A 4CHUA 5JI6A 1IUYA 5HDNA 3F8NA 5K5QA 4FHTA 3HSRA 1RI7A 1HW2A 1FYKA 5FFXA 4N0BA 3RKYA 4ENKA 3C7JA 2Z9OA 5LGTA 1I27A 1JHFA 5FGMA 2PN6A 5H20A 2V9VA 1ZGAA 3E6CC 2JZYA 1D8JA 2QBYA 2F5DA 3FF5A 1RNLA 2F5CA 3C3WA 2WTEA 5ICEA 3RI4A 2IP2A 1LDDA 5H6RA 3TDUC 1I5ZA 4OINF 3LQRA 1HW1A 4HAMA 2QENA 2ZKZA 3HHHA 2BEOA 5FD5A 1FX7A 5CLSA 2XIGA 4KN7X 1KYWA 4EJTA 3BWGA 1SFUA 2GWRA 1EH8A 3KFWX 3CO6C 2ESHA 3DFGA 3V7RA 3ZMSA 6PAXA 4ENNA 2IPQX 3WU0A 2L02A 1HW5A 3GFLA 5LHHA 4Y15A 1HQCA 4M71A 3I59B 2Z33A 4GO1A 2VN2A 2RGVA 2FF4A 2VE8A 3JTHA 1IW7F 5FB2A 4M9SA 4CYDA 4AWXB 3ZQ7A 4DQ2A 1YS7A 1YG2A 2WV0A 1ONVA 4CZZA 4HQEA 2JT1A 1C0WA 2PMUA 2XASA 4WXDA 2A6HF 2NNNA 4YFNF 2MH9A 2ISYA 4LK0F 5BQTA 1ON1A 3M7GA 3WTYC 4B8XA 1O57A 4HZFA 3E6MA 1R1UA 3E5UA 1LDKB 3DKWA 4I0AA 4QLCU 2XAHA 3V7CA 1G4DA 4HLYA 3WODF 4CO8A 5JR3A 1OMIA 4EV0A 3OOPA 3GYHX 3LQQA 2DI3A 3GF2A 4U0YA 2L4MA 3I5UA 3HTUA 1KQ0A 2M5WA 3GX4X 5F6FA 2QQ9A 2EFPA 2YX4A 2L4AA 5H6QA 3WGIA 4YIFA 4XSZF 3J80K 1TLHB 3HOTA 1HKTA 1DDNA 4BQAA 2IA2A 1TNTA 2QYOA 2P5LC 4ENMA 1YQAA 5AIQA 2Y48A 2DQRA 2Q2EA 4WCGA 1R5GA 2O8XA 3I53A 4UVCA 4EJVA 3HSFA 4KMUX 2RDPA 4M9ZA 2YR2A 3F8FA 2BV6A 2E7WA 5DCMB 1R7JA 2L54A 3QAHA 1BC8C 4P5OA 2XRNA 3OV8A 4Z2YA 3J81Z 1CF7B 1F9NA 4IHTA 4FT8A 2H6BA 3C1DA 3L09A 5LHGA 1S3JA 5HS9A 3CJNA 5JHUA 4UNOA 2M30A 3TO7A 3I58A 2COMA 2G7UA 1UFMA 3QP5A 4MGRA 2HFHA 1XGNA 2XV4S 1BI1A 1MJ9A 4KA4A 3BDDA 1IN5A 2FQ3A 5HLHA 2EK5A 3E3VA 4M72A 2X4HA 3N4MA 2A6EF 4PCQA 1LVAA 2NNYA 4HDUA 3K1NA 5ILUA 4R79A 3RYRA 5K1YA 3WG9A 4HA8A 1D5VA 2W57A 5LGUA 2C6YA 3O6BB 4YIIA 4CXFA 3ZMUA 3WE3A 4RGXA 4P9UA 5KVRA 2HEOA 3H92A 1R00A 3CUQB 4L0ZB 1O3QA 4GXOA 5E18F 4BYYA 3KLOA 4RGSA 4ASNA 5TRDA 3HRTA 2PJPA 5L3FA 1Q1HA 2PBIA 3ERED 1HXDA 1IRGA 5DUIA 4KIGA 3RIRA 3GLXA 3LAJA 3KE2A 3P9CA 3KLNA 1OYWA 2XAGA 1ZHFA 3CUOA 3P9KA 1U78A 3L7WA 1U3EM 4A2UA 1UCRA 3RKWA 1FBQA 2STTA 2EV0A 3HRMA 3QU3A 5DUKA 2LF7A 4G9YA 1E2XA 2FBIA 4G7HF 4JK1X 2XROA 1P6RA 3GFIA 1SMYF 2VODA 2P6TA 1MD0A 4P55A 1FZPB 4KNYA 3TOAA 4HX8A 1YW7A 2K4JA 3KP5A 2D45A 1MKMA 4I02A 2IT0A 3FXUA 1FPQA 3TOBA 4IRHA 1K6OA 2DFIA 3NRVA 4GYIA 2YSRA 2O6GE 1UB9A 2FNAA 1S7AA 3FHZA 2H27A 2ZO4A 3F72A 2HQNA 4LFUA 3JSPA 2AXLA 3WGHA 4RGRA 3K1MA 1XGOA 2Z5UA 3R0AA 4BNCA 3KP3A 4BXUA 3J81K 3FXQA 5EEGA 5DEQA 1PDNC 2IA1A 4G8XA 2LF8A 4K2EA 3BOQA 1ZRFA 2JPCA 4WXHA 2CYYA 3LSTA 1SD4A 4MQ9F 5L3EA 4MQVA 2W84A 4EVIA 4LLLA 2QBYB 3M8FA 2OZUA 1ZLKA 4UVAA 2ZXJA 5HDGA 1DP7P 1V3FA 5HS8A 2PI0A 4EM0B 2EV5A 2K4BA 5D5XB 1QBJA 2HKXA 5CYVA 4G7ZF 2Y0MA 4A0YA 5KK1A 3SFZA 3ZP5A 1IN4A 2HOEA 1USSA 1K7AA 4L5IA 5E1XA 2A68F 4N9HA 1SAXA 4I2OA 3V8JA 1XD7A 3ML6A 4N9IA 5LEKA 3Q5FA 4HF2A 4MTDA 2VBZA 4MTEA 1ZN2A 3EUHA 1G3SA 4S05A 1F4KA 1B1BA 2ZFWA 5DV5A 1FLIA 2FXAA 3E5QA 4PGGA 3H3ZA 2RKHA 2FMYA 3KEQA 2PMHA 1Y0UA 2CSOA 3Q9SA 1FP1D 4GCVA 5D5VB 2R7FA 2XAJA 4KYWA 2V79A 3DEUA 5CVRA 3ABTA 3EDPA 4CGZA 2ACJA 3O3KA 4IVNA 1HKQA 1T39A 5ILSA 1FSHA 4U88A 3TO9A 2MA3A 2OU2A 4A12A 1UHMA 1SFXA 4L5JA 3Q9VA 1MJAA 1SMTA 1J2XA 4LLNA 2PFBA 1YLFA 1Z9CA 3I0TA 4HQMA 4ZZLA 3JAMK 5F1RA 3TKYA 4UXNA 5JFRA 1FY7A 2EFOA 1MGTA 1BIBA 2K27A 2GQQA 5CVUA 3T5XA 1QNTA 4WWCA 1XN7A 1B6AA 3HTSB 3M1EA 1VTNC 1WQ2A 5CJ9A 1P4AA 1P4XA 2CG4A 3ECOA 1G3TA 5TJJA 4UHTA 2GXBA 1YW8A 4YFXF 1J75A 5AIPA 3L00A 2EFQA 4M73A 1WWXA 2YPRA 1J59A 2CFXA 2DAOA 2MC3A 1FC3A 3SZTA 1ZLJA 5IT3A 4OU0A 1YYVA 5J8FA 3WTUC 1XDUA 2ADUA 3L9FA 1S7OA 1J9IA 2DLLA 4RAYA 3W6KB 1P92A 1XGSA 3K0LA 2G9WA 2OBPA 5E8IA 2ZBKA 4I01A 4L9JA 4LB5A 1PP8F 3VB2A 5ED4A 2J5PA 2QUFA 1KA8A 1IXSB 3LWFA 4KIFA 2FBHA 2DTRA 2HYGD 4AIHA 3IWFA 4PGHA 4WK8F 2DO7A 3RTRA 2A61A 3QPTA 2P5KA 4O3MA 2X0LA 1HSTA 1WI9A 3R60A 4IF4A 1J0RA 1KU7A 1LEBA 3KZZA 3C18A 3IWZA 4XRFA 3E6BA 4RS8A 1R36A 5FLXK 4BHCA 4FX4A 1ZG5A 2ESNA 3GZ5A 3ZMTA 1SD5A 1R22A 4BAYA 5E20A 4XBFA 3F8CA 3DF8A 1B4AA 3E97A 3I4PA 4O5VA 1W4MA 4TV7A 1KQ9A 3T0YA 1CGPA 4PZJA 4BHBA 3PQJA 4KICA 3FMRA 2CO5A 2IW5A 1B59A 5FD6A 3TGNA 1ODDA 4ZH4F 3TQNA 3GFMA 2UWMA 2M1BA 4KN4X 3F3XA 5BPIA 1FP2A 2A69F 3BJAA 2F5FA 5A2QZ 5HVQC 1AWCA 1Z1DA 3L2CA 5LRSA 1L0OC 3VFZA 1AOYA 1P4WA 4EM2A 1T98A 5HLIA 3HSEA 1IXRC 1Z6RA 3KP7A 3LA2A 4IJAA 3WTWC 2K02A 4L9VA 3IKVA 3J7AO 3CTAA 1RUNA 5FO5A 4U0WA 1QZYA 2O03A 1IN7A 5CVIA 4CICA 4YFKF 2KJCA 1T2KA 4F7ZA 4GYGA 1L3LA 3KETA 3GXOA 1QQIA 1FBUA 2JSCA 3JW4A 4L18B 3GFJA 2M87A 3QPHA 3VOEA 2O0YA 1ZYRF 3MAJA 4KMFA 3K2ZA 3FM5A 2Q8KA 2L01A 4ESFA 1G3YA 2W24A 4L9TA 4ZYGA 3R6SA 4BHPA 1I1SA 4ZYEA 3GVAA 2V1UA 1KYZA 4WF2A 1YFHA 1SFEA 3V8LA 1MDMA 3SHFA 1BIAA 4XLPF 2ZMEA 4G7OF 1ZRDA 1D8KA 4LGWA 1ZG1A 2XGXA 1FSEA 2P8TA 1KU2A 5D6FA 3ZMZA 2GA1A 3COAC 3R61A 4OMYA 4HOBA 1S29A 3I71A 4L0YB 3M9AA 1EH7A 1KU9A 2B0LA 2DU9A 2VONA 2FNPA 2PQ8A 1OPCA 3HOSA 1IXCA 3DPTA 5D8LB 2YX7A 2K7LA 3RKXA 2MLKA 3V4GA 2CW0F 4A6EA 5E1WA 1I6XA 4NQWA 3WTTC 3ABUA 3DP7A 1XCBA 1BI0A 1A04A 4I98B 2QVOA 4Q5SF 3D5LA 5A2QK 1KGSA 2HDCA 1MJBA 1IAWA 3MZHA 1NHAA 4MNUA 1EH6A 3CDHA 2VOOA 4Q4ZF 2XVCA 2IVMA 3FMQA 4ZYDA 2VBWA 1FOKA 1STZA 2EA2A 4MEXF 4XLNF 3FM3A 2P7CB 4G6QA 5HDKA 3KCCA 3U1DA 1LQ1A 2DPDA 3N97A 1IN8A 3H3UA 4LMYA 4ZYHA 1TQMA 5ICGA 3ZN0A 2RVCA 2ZNYA 1W7PD 4LJZF 3IHUA 5CVJA 1B9NA 3F23A 3K9TA 3RJPA 2FEZA 1XSVA 3LA7A 5L3CA 1TQIA 3R4KA 2FE3A 4HBLA 2VC1A 2H09A 2GXGA 2DK5A 5D4RA 1S6LA 2QM3A 3JSOA 3T8TA 1ZARA 2OA4A 2D1HA 5FFZA 4B09A 1PP7U 2HKOA 1U5TA 4U7DA 2UZKA 1QPMA 1G6NA 2QWWA 3RDIA 4IRIA 2LSOA 4UUVA 2H94A 5DYMA 3BJOA 1HBXG 4WX9A 3KP2A 1Z6TA 5K5OA 2P6SA 4IXAA 2RN7A 4P96A 2BE5F 4QWQA 4HX4A 1EV7A 1R5HA 2XKOA 4RB1A 2CGPA 3CUQC 1ON2A 1REPC 4WXCA 4EGZA 4R8HA 4UV8A 1I1GA 2NAZA 3IC7A 2PG4A 5E8GA 3E5XA 4L9NA 3WU1B 2GZWA 2VT3A 2CQKA 2L3DA 3DQVC 3DPLC 4HX7A 3FXRA 1LNWA 1BN5A 3ZPLA 4LD5A 4YG2F 4RB3C 3ELKA 1TTYA 1V4RA 1Z05A 2P5VA 1GXQA 3G73A 2RC4A 4P9FA 1T38A 4IRGA 1LB2A 1E17A 4RB0A 2EWNA 1W7PA 3GUDA 3GZ6A 3D0SA 4MHGA 1RIOH 2Z3YA 3EQLF 1TBXA 3P9IA 4LG0A 1JXSA 2MD5A 3I54A 2HWVA 3K1PA 3QP6A 1HSJA 3KP6A 3BPXA 3IRRA 1LJ9A 1SD7A 3WTVC 3RPQA 3P7NA 4KDPA 3QU6A 3GO5A 2KIUA 2FMLA 2CWEA 2BGCA 3EETA 1XSXA 2BBYA 1ZRCA 3SQNA 3CO7C 1WSUA 2LNBA 3BJ6A 2A3SA 1BI3A 3GW2A 3ZMDA 3ULQB 4EGYA
chains in the Genus database with same CATH superfamily
2KRFA 4NB5A 4XRSA 2FU4A 4D7MA 5FRNA 3J80Z 2ZB9A 2E2HJ 4PDKA 3VDXA 1XS9A 2AS5F 1QPIA 4PJLA 2RQPA 5K5RA 2VE9A 2E1MB 5M5WJ 3FWEA 4FX0A 5HOOA 2K3FA 1IZ1A 4HV6A 2I10A 1YX3A 1D1BA 2OCEA 3FX3A 2F5EA 2G7HA 1XCVA 5ERIA 4CA0A 2TDXA 2E1NA 4I0BA 4A5NA 4RLFA 4E6KG 3KEOA 1MIJA 1OYIA 1IC8A 3OYGA 4LLGF 1FMWA 2OCCH 1W0UA 1KQ8A 5LGNA 3LA3A 4A0ZA 2QSHX 3F8MA 2ZJRF 2OAZA 4BUPA 3BTIA 2CQQA 2XUBA 4ZTJA 3K4MA 3CCJI 3GTQJ 4OIOF 1U9OA 1XDSA 2HNHA 2E35A 1H9TA 1FYMA 1HDPA 2NS0A 2R3SA 2BYVE 3ZQGA 1BI2A 3SDGA 2V6EA 2RNJA 2VASA 4LITA 5E1ZB 4I6ZA 3HXLA 5F0FA 3EYYA 1MBEA 1TW2A 2KJBA 2CMPA 2VC0A 1YI2I 2DDBA 1U0JA 3HJEA 3MCZA 2JVGA 5JLWA 3F8BA 2VPRA 2BVMA 2MG4A 2WADA 3HUGA 5GAHJ 1X3UA 1AKHB 1MDMB 4BQOA 3CCLI 3MN2A 2ID3A 4IX7A 4G94A 4E7IA 4Y52J 1DPRA 2QSGX 1W5CC 1SANA 3K69A 2UUZA 2R7VA 4OOIA 2ZMEB 4EATA 3RCOA 3I4MJ 3U2RA 4MEYF 1ERDA 4RAGA 1TQPA 2X1CA 2TCTA 4KUMA 2HYFA 2EV6A 2IXSA 5D8KB 1J5YA 3SZPA 4IHWA 2CQNA 3AG4H 5F0CA 1K78A 3NQOA 2DMUA 2EJRA 4DYRA 3CCUI 4B44A 4XN3A 3BPVA 3HOUJ 1X19A 3ZOBA 3G1OA 4BS9A 2LY9A 1X4OA 3SXYA 3KZIC 4DJAA 3EYIA 2DYSH 4HW0A 4BE1A 4ZTFA 1JE8A 1ZAOA 2A5YB 2OUMA 5L3BA 3GMEA 5C4JJ 2BVLA 2RV8A 2M7BA 4B3AA 4D0PA 5BMZA 4IOAF 1JJ6C 5GPCA 3F22A 1O3TA 3REOA 1U6GA 4M3BA 3KP4A 3MZYA 3U1KA 2Y69H 3OS2A 1R9TJ 4A3BJ 4AIDA 3RYPA 2CRGA 2E7XA 2NXNB 3H0GJ 2FJ1A 3HRUA 1KU3A 1IRFA 4F3QA 4DZPA 2NYXA 2XAQA 1GV5A 3HEFA 2ISZA 1YE9A 2YU3A 1WRJA 3OYBA 2FD5A 3IRQA 2WAQA 1XMKA 2E19A 2VPLA 1HKSA 2QQBA 4B48A 4NBQA 2NVTJ 2GAUA 1VQ7I 2EFNA 4EJWA 1A36A 4LK1F 1BR1A 2Z99A 5K7FA 2VIXA 4AIJA 1YJ9I 2MH2A 3H9GA 3CQZJ 3RPUA 3S32A 5BS6A 4HYEA 1R1TA 3JCUC 4HLXA 5BPDA 5GADJ 1TW3A 4S04A 3MWMA 4O6JA 4NQWB 2HS5A 1O7FA 5HLGA 4Y17A 1FMVA 3HRSA 2KLOA 1OLTA 1ZG3A 3A01B 1H9GA 2PMZA 1GXPA 2L9SA 3ROUA 2D1VA 3E1SA 4RLQA 1ZH5A 1XTAA 2IEKA 3FXOA 3QOPA 1BC7C 4AD9A 2COBA 3JRGA 1A35A 1ZGJA 2K9MA 3ZR8X 1K83J 4F91B 3CCRI 2QLZA 1JI8A 2UXXA 2E1CA 2V6CA 1JKQC 3I56I 3ABMH 3PL8A 5KNLA 1LE8A 4HF0A 4JQFA 3K70D 2L7KA 5C44J 3ISPA 2GA2A 5JHFA 1APLC 3N05A 4Y4RA 3AAFA 1OYYA 5E3LA 2GIVA 5EGOA 3ZQCA 4ZZDA 1T8IA 2DMPA 2DMQA 2ZFUA 2E36A 4A0XA 3NWTA 1SEUA 2QA4I 1MZBA 2FBKA 1QHGA 3OL4A 1IGNA 1S8NA 3DV8A 2MABA 5FRMA 4EMSA 5DS9A 1N75A 2VKEA 2M0CA 4ESBA 1X4PA 2XAUA 1RKWA 3B02A 3IV5A 2DT5A 3QYFA 1WJFA 4UY8I 1GUUA 5CVVA 5ICFA 1BOAA 1FNNA 4JBAA 4PSWA 3CZ6A 4KIBA 3RQ4A 3KYDB 5D5WB 3WTZA 5L3GA 3OYCA 3V8KA 1K79A 2EILH 3S2WA 4V2FA 2A6TA 3G1MA 3RSNA 2HGCA 2VQGA 1TL8A 5DD4A 4XLAA 4Y13A 2HXIA 3FZVA 1UHWA 4BH9A 1U5TB 4E70A 3F6VA 2IGOA 4EEFG 4A3JJ 4IQJA 2GOXB 2M8EA 1B9MA 3DXJF 4KJZA 3OYEA 4H0EA 2O61A 1YS6A 4XLFA 1O3RA 2VOPA 4IHSA 1X1CA 5D5UB 3M8EA 2ME0A 3S1MJ 3ASNH 2HR3A 3DBHB 2KQRA 4M74A 3G3ZA 1MSEC 2GXAA 2IS6A 4A69C 1YJNI 4OIRF 1J7KA 2FA5A 3MZ8A 2JVHA 5GTIC 3ZMVA 2VUMJ 2WC2A 3FXKA 3VSLA 2PEXA 1O3SA 1POGA 1KZHA 4JX5A 2V1DA 2FUG2 1HDDC 2CV0A 4BDYA 5GTHC 1BM9A 2MBFA 5LBQA 2VT2A 3JTGA 1IUFA 3FMSA 3WTXC 3LAPA 4Q47A 3G2BA 2YU9J 2FOKA 1JTYA 3FKJA 2ZMEC 3PO2J 2KZVA 3FDYA 3GEZA 1FOYA 1I3AA 3I59A 2ZJQF 2PLYA 2DYRH 3BTJA 1LDJA 1GHCA 1EKEA 3S3MA 4NC8A 4XLHA 3K7AJ 1GLNA 2XGEA 2BY0A 2EIKH 1I3QJ 2F2EA 2MLGA 4ON0A 5BOXA 4V2GA 2AO9A 1OFCX 2GIZA 2LKPA 2ZNZA 5EEAA 3MQ0A 3PNVA 3W2VA 1Y1VJ 2VBYA 2X6XA 4XRSG 2X6WA 1TWHJ 1MMGA 4HV5A 3LFKA 2XSDC 3D5RC 1FIAA 4M6YA 4EJUA 3FIWA 3ECHA 2DDAA 1LEAA 2IJLA 4OMZA 5E17F 3G71I 2JPBA 2UV1A 4ZDOA 2I8DA 1E3PA 1FBSA 1QVUA 2DFHA 2XPWA 2LMDA 3ASOH 4OIPF 5IYCJ 1FYLA 1FTZA 1OKRA 1T6SA 3T8RA 5LLQA 4BJ5C 2W25A 2KKOA 1MNMC 4CCMA 2JWTA 1DP3A 3R0JA 3QRFF 3CMEI 2CUFA 4IPAA 3TDZC 3QPLA 2HQRA 1I39A 5E3MA 1GVJA 1MBJA 3BP8A 5ILVA 2DOFA 1BW5A 1TP4A 1WPKA 3M1CA 4E7LA 2A5WA 1RUOA 2QSFX 3DTKA 3K6GA 1W7PB 3NEUA 4IZZA 3DU6A 4XK4A 2E71A 3ZN1A 3HIFA 2XSJC 3BR2A 1RZ4A 5KAFC 4AYBA 1NK3P 3IH2A 5DDGA 1Y56A 5AONA 1WH7A 2HI3A 4LG0B 2VJ5A 3F21A 2Y30A 2ZXWH 5IT9Z 2OD5A 4EQQA 3A4CA 3MKWB 4JX6A 3BROA 4KITB 4HDVA 2M4KA 3W6JB 2JTVA 2EIJH 3HGGA 2H6CA 1BW6A 2DBBA 2OZ6A 5GP9A 1MSFC 3QYEA 2XF5A 4CCJA 2DK8A 1ZREA 3Q0VA 5GAEJ 3Q0UA 1T95A 3BTCA 4DYQA 2ZJ2A 1Z7UA 3BZKA 1FOWA 3JAMZ 3OYIA 2M9HA 2XKPA 4RB2C 4F93B 4M9XA 1OR7A 4R1HA 4FASD 3G1LA 2Q0OA 2JRTA 2LREA 2Z1DA 4HRIA 1T0FA 2KIFA 4I09A 2M8GX 2HTJA 2D2WA 4BQQA 2DMTA 1QO0D 3CF5F 1X3ZB 3ONQA 1QU3A 2QZ8A 2L9NA 2V1XA 2UXNA 3LSKA 2IAIA 2Y0SA 4RAZA 4KFCA 1XB4A 3F6OA 3OMYA 1YW9A 4DNCA 2ELHA 5JVTA 2STWA 4ZDPA 3PM1A 2WBMA 3H5AA 4HNVA 1YO5C 3IL2A 3OYDA 4OIQF 1F1ZA 2Y0SN 1YIOA 2P0WA 1QZEA 5L3DA 4ESJA 3QPSA 5B3SH 1WI3A 4L5EA 5J8CA 5DCMA 2IRFG 2DMNA 3Q3SA 1SC7A 1R58A 3ZQHA 5ICCA 3OSGA 1ACIA 1ULYA 3O2PE 2W48A 1JHHA 4UVBA 4U0VA 3I4NJ 3B73A 3T1BA 2VJIA 1CF7A 5LHIA 2DQLA 2VXZA 1DQUA 3MEXA 4KT5C 3MD2A 5BNGA 2BHYA 2R7UA 1RKTA 2W4SA 2AXTC 1H0MA 3KZYA 3H9JA 4G6DA 1GV2A 3OYNA 4AIKA 1TWAJ 1U5TC 3GBGA 5F64A 1O7LA 2DW4A 2Y75A 2I5UA 5IYDJ 5J6XA 2KHMA 2LR8A 1LKXA 1Y8QB 2OF7A 2LY1A 1FWZA 3WE2A 4A6DA 1Y8RB 2Q1ZB 3OYHA 3OYKA 3GWZA 3S17J 3TP3A 3I64A 4C9YA 1USTA 2LDUA 2R4GA 2R7DA 3BCAA 1VF9A 1BR2A 3EUAA 4C30A 2DPUA 4JOMA 2FSWA 3PSIA 2K9NA 5DD8A 4ENJA 1Y1WJ 2MFZA 3EUHC 2KPMA 3VEPA 1XGMA 3S2DJ 4EM1A 4M3GA 2ZJPF 1Q1VA 2K86A 1WJEA 3IAS2 1UJ8A 3BQZA 2A07F 2NRAC 3HUGB 3BZ6A 4UV9A 2DCEA 1WJBA 2PX9A 4GGGA 2AHQA 2EPFA 2VLAA 3OL3A 3VWBA 2OQGA 1HA8A 4AVPA 2K5CA 3DCFA 1N77A 5HS7A 4KISA 2MW8A 3HOWJ 5IP6A 2WB1A 3CDIA 1IN6A 2F48A 1SD6A 5DCFA 1G3WA 1K78B 1R23A 2JSPA 3CUQA 1IF1A 2CFOA 3IKTA 3PQKA 5J47A 1YTYA 3OY9A 1R4MB 1D3YA 2ZCWA 2EFWA 3DTIA 4G6TB 4CH7A 2KIMA 2W85A 3CLOA 1DUXC 3CC7I 4BEHA 2R5YA 3U9GA 2OQRA 4NC6A 2JA7J 4UB6C 1Y39A 5EZHA 2HDDA 2BHZA 2Y9YA 3TW7A 1W5TA 4S0HB 1BJAA 1JGSA 2V4JC 1QZZA 2NVYJ 3MFKA 3S1RJ 4W1UA 1PUEE 5LEJA 1W5SA 1VQLI 3GTOJ 2HOSA 4IL6C 3K4NA 2HZTA 4HF1A 5J4VA 4LB6B 1DPUA 4ETSA 3PFIA 4DOZA 4A5MA 2L5QA 5D6EA 1RC9A 2P7VB 3I9V2 3RQIA 3VODA 1IRZA 1P2FA 2OJED 5LRRA 1XSDA 2DA2A 3IUOA 2O7OA 1R1VA 1TNSA 4AUXA 5IT9K 5FLXZ 4RDUA 3HYIA 2JQ7A 1XC5A 2O3FA 2HOTA 1DGWY 1Z3XA 3HOYJ 1QRYA 3LSGA 5DM6F 2H8RA 2QQAA 1WKMA 1WJAA 2VBXA 4CDGA 3M3YJ 2IBDA 4YELA 3JREA 2WY8Q 2XHKA 5IOYA 1QGPA 4Q48A 4E7JA 2ZC2A 5HNHA 3WGGA 1U2WA 3S2HJ 1F5TA 2M34A 1FT9A 1BBYA 3LSIA 2P4WA 2EB7A 3BY6A 2HTSA 3JR9A 3TO6A 3WTSC 4NHJA 1U8RA 1Z91A 2JA8J 2KIQA 2FRHA 4FE4A 3L2RA 3V7SA 4EJOA 2ETHA 3K4BA 4XSXF 2K9LA 3ZQLA 4X1EA 4IHYA 2WWYA 2IA0A 3S93A 2XAFA 3HHGA 1XMAA 4M6XA 4J01A 3JRDA 5EEHA 3LMMA 4U7BA 2J5OA 1LE8B 2E5ZA 4ZYAA 2M45A 4I7HA 5D4SA 4CUGA 1W36C 4RGUA 3E6DA 1V5GA 4BQNA 2EA4A 2ELKA 4DW6A 4Y33A 1LFUP 4CHUA 3IH4A 5JI6A 2CQXA 3V42A 1IUYA 4JP0A 5HDNA 3HBLA 4IO9F 3F8NA 1SFOJ 2JJ7A 3TP0A 2R5ZA 1JGGA 5K5QA 4C3HJ 4FHTA 3HSRA 1RI7A 1HW2A 1A31A 1FYKA 3H0DA 5FFXA 4N0BA 5J4YA 2YS9A 3RKYA 5EDNA 3PUFA 3BR1A 4ENKA 3C7JA 2QF7A 2QQ8A 2Z9OA 2R92J 2MYSA 1I27A 1JHFA 5LGTA 2OPTA 2X6OA 2LH9A 1XG1A 4UUSA 5FGMA 2PN6A 3OYAA 5H20A 2V9VA 1ZGAA 3E6CC 3IAM2 3FK6A 4BDZA 2JZYA 2M0MA 4IEJA 4E7KA 4GFBA 2CV1A 1D8JA 2QBYA 2F5DA 2HVSA 1FJLA 2QGUA 1TT5B 3FF5A 1RNLA 3IP4B 2F5CA 3C3WA 2WTEA 5ICEA 3RI4A 1D0YA 1GT0C 2IP2A 1LDDA 5H6RA 3TDUC 3H1CA 1FEXA 2E2IJ 1I5ZA 4OINF 2DT6A 3AL0B 3ZQQA 1VQMI 3CMYA 3LQRA 1HW1A 4MLOA 4HAMA 4XKBA 2QENA 2TRTA 2ZKZA 4QSHA 2XGCA 3BTLA 3HHHA 3OOUA 2BEOA 3PNTA 2DOAA 3A03A 5FD5A 1FX7A 5CLSA 1HCRA 2XIGA 4KN7X 1KYWA 4EJTA 3BWGA 1SFUA 3H5NA 2GWRA 5TGTA 1EH8A 1G2HA 4ITVA 4OAYA 4PJJA 3G4SI 3KFWX 2EIMH 3WHBA 3DPUA 1SFKA 4B4CA 3CO6C 3GTGJ 2ESHA 1MBFA 1BOBA 3DFGA 3DBRB 3V7RA 3HOZJ 3ZMSA 2FQ4A 4E7ZA 6PAXA 4A3LJ 3K4JA 4QIWN 4ENNA 2IPQX 3WU0A 2L02A 2Y2ZA 2AQEA 1TT0A 1HW5A 3GFLA 5LHHA 4Y15A 1HQCA 1T08B 3HOXJ 1RRJA 4M71A 1XX5A 2DXIA 2HXOA 3I59B 2Y31A 2Z33A 4GO1A 2VN2A 3HPGA 2CS3A 2RGVA 4D7NA 2FF4A 2VE8A 3JTHA 2NOJB 1IW7F 5FB2A 4II2A 4GDFA 1A5JA 4M9SA 4CYDA 4AWXB 1M1EB 2NS7A 2LYCA 3ZQ7A 3A02A 2DN0A 1X2NA 4DQ2A 1YS7A 1YG2A 3DEWA 4AC0A 2HQ5A 2WV0A 2Y9ZA 1ONVA 4CZZA 4HQEA 2JT1A 1C0WA 2ELJA 2V1NA 2PMUA 2XASA 3L2QA 1EJ9A 4HSTA 4WXDA 1P7JA 2A6HF 2NNNA 3VYSB 1JUSA 4AU7A 4YFNF 3GTMJ 2MH9A 2ISYA 1X2MA 2K3PA 4LK0F 5BQTA 5M3MJ 1YX5A 1ON1A 3M7GA 2EZIA 3WTYC 4B8XA 1O57A 4HZFA 3E6MA 1X1PA 1U9NA 2V9PA 1R1UA 2E1OA 2XGDA 3E5UA 4HEA2 1LDKB 3FISA 2K9QA 2EBIA 3DKWA 4I0AA 1XPXA 1TC3C 1E3OC 4QLCU 2XAHA 4DIQA 3V7CA 1G4DA 4HLYA 5CKTA 4BE0A 2HDWA 3K4CA 2F5VA 3GZNB 3WODF 2KDZA 4FETA 4CO8A 4DZJA 5JR3A 2EINH 3TL4X 1OMIA 3DLLF 3UKGA 4EV0A 3OOPA 3OYLA 4XN0A 3GYHX 3LQQA 2DT7B 3QQAA 2DI3A 1V5FA 3GF2A 4U0YA 3GTJJ 5IOZA 2L4MA 3I5UA 3HTUA 4F52A 1KQ0A 2M5WA 5J3LA 3GX4X 4MFEA 3PIOF 5F6FA 2QQ9A 4ZDLA 1Z67A 2EFPA 3H5RA 2YX4A 2L4AA 3D5SC 4CCLA 1VI0A 3JRIA 2LKSA 5H6QA 3WGIA 2VI6A 3LL7A 4YIFA 4XSZF 5FKNA 3J80K 1TLHB 3HOTA 1HKTA 1DDNA 1HOMA 4BQAA 2IA2A 2KZGA 1TNTA 2QYOA 2P5LC 4ENMA 1YQAA 3BR0A 5AIQA 1NG7A 4V19K 2Y48A 2DQRA 3HKZA 1P7IA 2Q2EA 2X48A 4WCGA 1RETA 2CQ7A 1R5GA 4BL0B 1K6YA 2O8XA 2IS2A 1LUJB 3I53A 3LFUA 2VL8A 3I55I 4UVCA 2LFBA 4EJVA 3PO3J 3HSFA 3SZGA 4KMUX 2M7AA 1YOVB 2XB5A 2G0EA 3HKZN 4F55A 2RDPA 2E1MC 4M9ZA 2YR2A 3F8FA 2CJJA 2BV6A 5FKMA 2E7WA 5DCMB 1R7JA 2L54A 3QAHA 3G6EI 1BC8C 4P5OA 2XRNA 3OV8A 4Z2YA 2RQQA 3J81Z 1F9NA 1CF7B 3SJMA 3CCMI 4IHTA 4NUBA 4FT8A 2H6BA 3C1DA 3L09A 5LHGA 5M5YJ 1S3JA 5HS9A 2O8KA 1K4SA 5HODA 3CJNA 1RR7A 2KP6A 3K10A 5JHUA 1V54H 4UNOA 3GLLA 4A3KJ 3AL0C 2M30A 3TO7A 3I58A 1JKOC 2COMA 2G7UA 2EQRA 1Y0NA 1UFMA 3QP5A 4MGRA 2HFHA 1B72A 2E34A 1XGNA 3P5JA 4N4OB 2XV4S 1BI1A 4Z6YA 2LOOA 1MJ9A 2GM4A 4XOPA 4KA4A 5IYBJ 3BDDA 3CD6I 1IN5A 2FQ3A 5HLHA 2EK5A 3E3VA 3LSJA 4M72A 4FCYA 4BXFA 3TBIA 3ZXSA 4MIMA 2X4HA 3N4MA 2A6EF 2W00A 4PCQA 1H89C 4FTHA 1LVAA 4XM3A 2NNYA 4HDUA 3K1NA 5ILUA 4PJNA 3VYUB 4R79A 2LP0A 3RYRA 5K1YA 3WG9A 4HA8A 1D5VA 1ZELA 2WY7Q 1WJDA 2W57A 2E5NA 3KPHA 3S14J 5LGUA 1BJZA 4CZCA 2C6YA 3O6BB 4YIIA 2QKLB 4CXFA 3ZMUA 3WE3A 3BT9A 4RGXA 1YRNA 4P9UA 2LLKA 5KVRA 2HEOA 1Z3YA 3H92A 1R00A 3CUQB 5F1JA 4L0ZB 1O3QA 3FHNA 4GXOA 4M3DA 5E18F 4BYYA 3KLOA 4RGSA 4J19A 4ASNA 5TRDA 1ZR4A 3HRTA 1AHDP 5L3FA 2PJPA 1Q1HA 2PBIA 1AA7A 1HXDA 4PSXA 4RMNA 5E79C 3CMMA 4BEHB 3ERED 2R5YB 1IRGA 5DUIA 3KIOA 4KIGA 1UZCA 2LKXA 3RIRA 3GLXA 3LAJA 1DU0A 1VQ5I 3KE2A 3P9CA 1GVDA 1OYWA 2XAGA 3KLNA 4RM2A 1ZHFA 3CUOA 3P9KA 1U78A 3L7WA 1U3EM 4A2UA 2LD5A 4XICA 1TWFJ 1UCRA 3RKWA 1FBQA 2STTA 2EV0A 3HRMA 3ZGKA 4XORA 3QU3A 5DUKA 2LF7A 4G9YA 3TMOA 1F43A 2LC2A 1E2XA 2FBIA 1CQTA 4G7HF 2DA5A 4JK1X 1BR4A 2BW3A 2XROA 3GTPJ 1P6RA 3GFIA 1SMYF 2VODA 2RREA 3BG9A 5B1BH 1Z7LA 2B7EA 2P6TA 1JT6A 3VPRA 1WGXA 1MD0A 4P55A 5EJCA 1FZPB 3AFHA 1IDYA 4KNYA 4IHXA 5CQGA 5H2FC 3BG6A 3M4OJ 3TOAA 1ZTRA 4HX8A 1YW7A 2K4JA 3KP5A 4A3IJ 1MBKA 1G8XA 2D45A 3RZOJ 1MKMA 4I02A 2IT0A 3FXUA 5EF6A 1FPQA 3HM5A 3TOBA 3JRFA 2K40A 1WJ5A 4IRHA 1H8AC 1K6OA 2DFIA 3NRVA 2MC4A 4GYIA 2YSRA 3J7AY 4XL9A 2O6GE 1UB9A 2LBFA 1GDTA 3A2KA 2FNAA 1S7AA 3FHZA 2H27A 2ZO4A 3J7YJ 2M4GA 1B8IA 3F72A 2X6YA 2HQNA 1UMQA 2NS8A 4LFUA 3OYMA 3JSPA 2AXLA 2DFEA 3WGHA 4A93J 4E7HA 4RGRA 3K1MA 2DJIA 1XGOA 2VXDA 3CCEI 3UNGC 4XNFA 2R5ZB 2Z5UA 3R0AA 4BNCA 3KP3A 1R6RA 4BXUA 3J81K 3FXQA 1ZK8A 5EEGA 5FLVA 5DEQA 5IY5H 1PDNC 2IA1A 3C2BA 4G8XA 3CJRB 2QEXI 2LF8A 2XF6A 4K2EA 3BOQA 1ZRFA 1V5EA 3NAUA 2JPCA 4UUSB 4WXHA 2CYYA 3K4LA 3LSTA 1A6QA 1SD4A 4MQ9F 3ESWB 5L3EA 4MQVA 1D1AA 2W84A 4EVIA 4LLLA 2QBYB 3M8FA 4M3FA 2OZUA 1ZLKA 4UVAA 2ZXJA 5HDGA 1DP7P 1V3FA 3CCVI 5HS8A 3WG7H 4EM0B 2PI0A 3ZQFA 1E0EA 2EV5A 2K4BA 4RA2A 5TISC 1NH3A 5D5XB 1QBJA 2HKXA 5CYVA 4G7ZF 2Y0MA 1LPQA 4A0YA 5KK1A 2JN6A 3SFZA 1S7EA 3ZP5A 1IN4A 2HOEA 1Z21A 3ZCOA 3FXLA 2LY2A 1USSA 1K7AA 4L5IA 1R4NB 4LOCA 4P1WA 5E1XA 3H3VK 2A68F 4N9HA 3NWSA 1SAXA 3NARA 2KDOA 3VYRB 4I2OA 3V8JA 3HC7A 1XD7A 1A6IA 3ML6A 2DFFA 4N9IA 1W36D 5LEKA 3BR3A 2A05A 3Q5FA 2NVXJ 2GBYA 1IDZA 2BY1A 4HF2A 5HNFA 3HOVJ 4B1RA 5J1YA 4MTDA 2VBZA 4MTEA 1ZN2A 1W1WE 2OV7A 3HPHA 3PJRA 2DA4A 2KRCA 2R7ZJ 3H9QA 4PFPA 4XR6A 2VB6A 3EUHA 3PUBA 2IS4A 1G3SA 5F04A 4S05A 1G59A 1F4KA 1B1BA 2X85A 1I6HJ 2ZFWA 3UR3C 5DV5A 4ANJA 4OWRB 1OJLA 1FLIA 1PYVA 2QKMB 2FXAA 4XLEA 3E5QA 4PGGA 5FKOA 2JMWA 3H3ZA 1ORKA 2HPIA 2RKHA 2FMYA 2L9VA 3KEQA 1NG6A 2PMHA 1Y0UA 1T33A 3S1QJ 4HNTA 2CSOA 5C4XJ 3Q9SA 4HPQA 1FP1D 4GCVA 3K4KA 5D5VB 2R7FA 1BA5A 1D0XA 2XAJA 1VQ9I 5IP7J 4KYWA 1EF4A 2CU7A 2MGQA 2V79A 3DEUA 5CVRA 2R7QA 3EPZA 4PJ0C 5JVGF 4GRIA 3TW6A 3W2AA 3ABTA 3F9KA 2HU9A 3EDPA 1MH3A 4CGZA 2ACJA 3O3KA 4IVNA 1HKQA 1T39A 2CW8A 3MKLA 3SEZA 5ILSA 2KRHA 2B63J 3OIQA 2EZLA 1FSHA 4U88A 1F36A 3TO9A 2MA3A 3CESA 1WFXA 2OU2A 4A12A 1UHMA 1SFXA 3B6AA 4L5JA 4PJMA 3Q9VA 1LFPA 2K9SA 3LSPA 1MJAA 1SMTA 2XB0X 3CC2I 1DGRM 5DTDA 3ERMA 1PUFA 1J2XA 4LLNA 2PFBA 4QPQA 1YLFA 2OC6A 3RZDJ 1Z9CA 2R7SA 3I0TA 4HQMA 4ZZLA 4BXXJ 3JAMK 2WV1A 4W97A 1Z0XA 5F1RA 3CP8A 1QVTA 3DWLE 4UXNA 3TKYA 5JFRA 1WJCA 2VQCA 1FY7A 3KEYA 3BG5A 2O5RA 2EFOA 1MGTA 1BIBA 2K27A 4XIDA 1LVKA 2KT0A 3MVPA 2GQQA 5CVUA 5E3OA 3PFYA 5KAIC 3T5XA 1QNTA 3BLYA 2M3AA 1XN7A 4WWCA 4D9JA 1B6AA 3HTSB 3M1EA 3JRHA 1VTNC 4M6VA 3VSKA 1WQ2A 2KFDA 5CJ9A 3WHCA 5EGOB 2DA7A 1VQ6I 1P4AA 1P4XA 5EG0A 2IGMA 1RPWA 2CG4A 3ECOA 1G3TA 4BGDA 1MBGA 2Q2EB 3CJTB 1SVLA 4UHTA 5TJJA 1YW8A 4OAZA 4YFXF 1J75A 2GXBA 4BU2A 1LFBA 1IV8A 1WZ2A 3IH3A 5AIPA 2R7OA 3L00A 2EFQA 4JYKA 4M73A 5B1AH 1WWXA 2YPRA 1YJWI 1J59A 2CFXA 2D5VA 2DAOA 2MC3A 1FC3A 3QYBA 2E60A 3CCYA 3SZTA 2KISA 5IP9J 1ZLJA 5IT3A 4OU0A 3ZRGA 3BQYA 1YYVA 3O8HA 5CQEA 5J8FA 3WTUC 1XDUA 2N8GA 3E0JB 4A3CJ 2ADUA 3L9FA 1VFCA 1S7OA 3CJQB 1J9IA 3KX2A 2DLLA 4RAYA 4IKFA 3W6KB 1ETQA 1P92A 1XGSA 3K0LA 2L7FP 2G9WA 3S16J 2K85A 2OBPA 5E8IA 3OYJA 2ZBKA 4I01A 4L9JA 1VQOI 1WH5A 3S3OA 4LB5A 1PP8F 4RAFA 1B72B 5FJ8J 1ETKA 3VB2A 5ED4A 2J5PA 2V7FA 2QUFA 4A3EJ 1KA8A 2R93J 2B9SA 1E3HA 3BG3A 1MH4A 1IXSB 3HB9A 3I3LA 2FOWA 1UELB 4NDLA 1WHUA 4XMYA 3LWFA 2BOLA 2L9RA 1HC8A 1JT0A 1OCOH 2XF7A 5GPAA 4KIFA 4E4HA 3LSHA 5B66C 2FBHA 2DTRA 2HYGD 4AIHA 3OYFA 2W7NA 3IWFA 3Q0WA 2GOMA 3OR1C 3HL2A 2PJRA 2Z16A 1SVMA 2BXZA 3CLQA 4CCNA 4PGHA 1ZR2A 1VQKI 3A0BC 5M5XJ 4WK8F 2DO7A 3RTRA 2A61A 2P81A 3QPTA 4UUTA 2P5KA 3OSFA 2LRDA 4O3MA 1WCMJ 2X0LA 1JUPA 1YRNB 1HSTA 1WI9A 2YUSA 3R60A 4PK4A 1YITI 2ZSIB 4IF4A 3DKXA 1J0RA 1OCZH 4A3DJ 2FX0A 3QOEA 2BXYA 1KU7A 1LEBA 4ABZA 3KZZA 3C18A 3IWZA 3ABLH 2HYJA 4XRFA 4YRVA 1IO2A 2BY2A 3E6BA 4RS8A 1R36A 5FLXK 4A3MJ 3BZCA 4BHCA 3L2VA 4FX4A 2ESNA 1ZG5A 3GZ5A 2DA6A 1D1CA 3KYCB 3ZMTA 3S8PA 1SD5A 1YIJI 1OQYA 3BCBA 1HLVA 2ECBA 1R22A 4BAYA 5E20A 4XBFA 3SDBA 1QHHD 3F8CA 3LOCA 2HOAA 1ZGWA 3DF8A 4B3XA 3L2WA 1UHSA 5FLMJ 1B4AA 2VQHA 1IG7A 2BW3B 3ZQIA 3JRAA 1JKPC 4B43A 4Y7NJ 1X1DA 3E97A 3I4PA 4O5VA 3FK7A 1W4MA 3GCMA 4TV7A 1KQ9A 3AG1H 3T0YA 4ZC3A 1CGPA 4M3EA 4PZJA 4BHBA 2WAQN 4ZJZA 2XDVA 2BY3A 3PQJA 1H88C 2HVQA 4KICA 2WAEA 3FMRA 2CO5A 2CUZA 1IJWC 3W6VA 2IW5A 1B59A 3S3NA 5FD6A 3AG3H 1ODDA 3TGNA 4ZH4F 1EA3A 1V55H 2EZKA 3TQNA 3W3CA 1U8BA 3DKYA 2DA3A 3GFMA 4XOTA 2UWMA 2VKDA 1Z77A 4U87A 2M1BA 2LBFB 4KN4X 3F3XA 5BPIA 2PMZN 2DOEA 4CYCA 1FP2A 2A69F 1B8IB 3BJAA 1W0TA 3MKZA 2F5FA 5A2QZ 5HVQC 1AWCA 2V9KA 1Y6IA 1Z1DA 2X1DA 3L2CA 3GTKJ 5LRSA 1L0OC 3VFZA 2L0KA 9ANTA 1AOYA 2MSYA 1P4WA 4EM2A 5FROA 1T98A 3FXMA 1UAAA 3B6CA 2M2EA 2R0QC 5HLIA 4BJ6C 1FIPA 1UG2A 3HSEA 4PUSA 1BL0A 1ETVA 1IXRC 2W1OA 5GAGJ 1Z6RA 3KP7A 2XPUA 3LA2A 4FQGA 2DA1A 2X51A 3W2WA 4IJAA 4XKCA 4CCOA 3WTWC 1X58A 2K02A 3CCQI 2JRMA 3JRCA 3WU2C 3H35A 4L9VA 1K61A 3IKVA 3J7AO 3CTAA 4DGWB 1D5YA 1RUNA 5FO5A 3BR5A 5J1RA 5FKLA 4U0WA 2JA5J 3FBNB 2QCOA 1QZYA 1WVRA 3OIOA 2O03A 1IN7A 5CVIA 4XLCA 4CICA 2ZXIA 4YFKF 3A0HC 3PSFA 3H36A 3S15J 2KJCA 1T2KA 2VQLA 2DODA 3O8GA 4F7ZA 4GYGA 1L3LA 2VKHA 3KETA 3GXOA 1QQIA 4H4KC 1FBUA 4KT6A 3U21A 4HSRA 2V26A 4XKVA 2JSCA 3JW4A 5K7ZA 2VJJA 4L18B 1JTXA 1OCRH 3GFJA 2M87A 3QPHA 2O9LA 1VQ4I 3FBIB 4XONA 3VOEA 2O0YA 1ZYRF 2KMUA 1R5ID 3MAJA 4KMFA 4EGYA 1I50J 3K2ZA 1NTCA 3FM5A 4FISA 4DBRA 2Q8KA 2L01A 1N25A 4N4NB 1ENHA 4C2MJ 4C3IJ 1MBHA 4BACA 3BC8A 4ESFA 5C3EJ 1G3YA 2W24A 1J09A 4L9TA 4ZYGA 3R6SA 1PVEA 3FKIJ 2VJ4A 4BHPA 1I1SA 4ZYEA 4II3A 3GVAA 5DM7F 1AKHA 2V1UA 1KYZA 4WF2A 1YFHA 1SFEA 3V8LA 3A1YA 3SHFA 1MDMA 1BIAA 2CW7A 4XLPF 2ZMEA 4G7OF 1ZRDA 1D8KA 1ITYA 2WA0A 1O4XA 4LGWA 3L2UA 1ZG1A 2WAFA 3HG9A 1AU7A 2XGXA 4DYCA 4HG2A 4LIUA 1TWGJ 1FSEA 2P8TA 5EYRA 1XMXA 4AM3A 1KU2A 5D6FA 3ZMZA 2GA1A 3COAC 2EZHA 3QODA 1ETXA 3EUKL 1VNDA 2IGNA 3R61A 4OMYA 4HOBA 1S29A 1UG0A 3I71A 3K70C 4L0YB 3M9AA 1EH7A 1KU9A 2RNGA 4XQFA 1VQ8I 2AQFA 3LSMA 2B0LA 1QA6A 2DU9A 2CUEA 3CC4I 2VONA 4I99C 1PJRA 2FNPA 1OISA 5KCMA 2PQ8A 1OPCA 2DTZA 3HOSA 3AG2H 4BE2A 1IXCA 3DPTA 5D8LB 5J1UA 2W82A 1FTTA 2VKVA 2NVQJ 2YX7A 2ZSHB 4NC7A 5B5EC 2K7LA 1MMSA 2NVUB 3RKXA 2JUGA 3OS1A 1R49A 4AVZA 2MLKA 3V4GA 2CW0F 2ZXHA 1PUFB 2XPVA 2LVSA 4A6EA 5E1WA 4D5CA 1I6XA 2LK2A 1YHQI 2HPMA 2DJNA 4FE7A 4NQWA 3CCSI 3WTTC 1TWCJ 4Y3OA 2F4MB 1VQNI 3ABUA 2KL4A 4CCKA 1IRXA 2EH3A 3DP7A 1XCBA 2MD0A 3A01A 1BI0A 1A04A 5LFAA 1P9QC 5HLTA 4I98B 2ECCA 2QVOA 1HF0A 2IS1A 3DBLB 4Q5SF 3D5LA 5A2QK 1MMNA 1KGSA 1RESA 2HDCA 4BY7J 4A3FJ 4AYBN 3F0CA 2HZDA 1MJBA 1OR7C 1IAWA 3MZHA 3LNQA 1FOXA 1NHAA 4MNUA 3M8JA 1EH6A 1MMAA 1SAUA 3CDHA 1T0FC 3DU5A 5M3FJ 2VOOA 4Q4ZF 2XVCA 1ETOA 2IVMA 2L7ZA 3HDDA 5EG0B 3FMQA 4ZYDA 3FXJA 2VBWA 3S1NJ 2R7RA 2JUCA 1FOKA 2R7XA 1STZA 2H8WA 2EA2A 3CDLA 1DU6A 4MEXF 4XLNF 3FM3A 1JJ8C 2P7CB 4HNUA 4G6QA 5HDKA 3KCCA 3U1DA 3ABKH 1D0ZA 1ETWA 3JRBA 1LQ1A 2BZTA 2DPDA 3N97A 1IN8A 4JX4A 3CMAI 4CSWA 4YIRX 3QWLA 3H3UA 5F0HA 4LMYA 4ZYHA 1TQMA 3DLAA 5ICGA 3GTLJ 3ZN0A 3SFIA 2RVCA 2ZNYA 1W7PD 4LJZF 3IHUA 5F08A 5CVJA 1VQPI 2JA6J 1B9NA 3F23A 1R71A 3K9TA 3RJPA 2XC7A 2FEZA 1XSVA 3LA7A 5L3CA 4NNJA 1TQIA 3R4KA 2FE3A 2CUJA 4HBLA 2VC1A 2H09A 2GXGA 2ICWG 2DK5A 5D4RA 1S6LA 2QM3A 1S5LC 3T8TA 3JSOA 2H1KA 4DBQA 1ZARA 1X1BA 2OA4A 2D1HA 1SVOA 5FFZA 4BY1J 2NOGA 4B09A 1PP7U 2HKOA 4J00A 3OR2C 5LD2C 4X6AJ 3E7LA 1U5TA 4U7DA 2UZKA 1QPMA 5K7HA 1G6NA 4XKWA 2X1EA 2QWWA 3RDIA 2E2JJ 4IRIA 1MMDA 2L7MP 3CP2A 4C3JJ 2LSOA 3DTEA 4UUVA 4UB8C 2CH0A 5FKKA 4I76A 2IGKA 1ZKGA 2H94A 5DYMA 5J40A 3BJOA 1HBXG 3C2HA 4WX9A 3KP2A 4XRMA 1Z6TA 4F92B 5K5OA 2P6SA 2PJRB 2HVRA 5JLXA 4IXAA 5IPAA 2RN7A 4P96A 4G12A 2BE5F 2L2OA 3MMYB 2LTPA 4QWQA 4HX4A 1EV7A 1R5HA 1OCPA 1X1AA 2XKOA 4LIVA 4RB1A 2CGPA 3OIPA 4IHVA 2JK3A 3CUQC 3RKQA 1K4TA 1ON2A 3M07A 1JUMA 4WXCA 4EGZA 1REPC 2H1LA 2XRLA 2GLOA 4R8HA 4UV8A 1I1GA 2NAZA 4E7SA 4IOCF 3IC7A 2PG4A 4PFOA 5E8GA 3SEQA 4RBOA 2HQAA 1MNEA 3LSRA 2LG4A 1RR8C 3E5XA 1OCTC 4L9NA 3WU1B 2GZWA 1S9HA 2VT3A 2CQKA 2JA2A 2L3DA 2WB1N 3HGYA 3DQVC 3TEDA 4MFDA 2F4OB 2ME6A 2R7WA 1S72I 3DPLC 4HX7A 1MNDA 3FXRA 1LNWA 1BN5A 2Z2SB 4QTRA 3ZPLA 2R7TA 1OCCH 4LD5A 1ZQ3P 4YG2F 4RB3C 4IQ4A 4QPOA 2OTLI 3X2QH 3ELKA 1TTYA 1V4RA 1Z05A 2P5VA 1GXQA 3G73A 4D1QA 1NK2P 2RC4A 4YEJA 4P9FA 1T38A 4IRGA 1LB2A 3BR6A 1E17A 3HZJA 4RB0A 2EWNA 3SYTA 2F6CA 3K2AA 1W7PA 3GUDA 3L1PA 3PNYA 3GZ6A 3PIPF 3D0SA 4MHGA 1RIOH 3BG7A 2Z3YA 4X0GA 3AKZA 4BJTA 3EQLF 2RAEA 5E3NA 1TBXA 3P9IA 4LG0A 5CPRB 1JXSA 3OWTA 4BBRJ 2MD5A 3I54A 3OS0A 2HWVA 4BKXA 3CF2A 3K1PA 3QP6A 1HSJA 5KHDA 1MW7A 4B47A 3KP6A 3BPXA 2F4IA 3IRRA 1LJ9A 1SD7A 3WTVC 3VYTB 3RPQA 3P7NA 1VZ0A 4KDPA 3QU6A 2OTJI 3GO5A 2KIUA 4LG3A 4CYCB 2X9DA 5F27A 1X3WB 1TZLA 2FMLA 3C2GA 2CV2A 2CWEA 4D5FA 3KYLA 1IV6A 3J7ZI 2ID6A 2BGCA 3EETA 1XSXA 2BBYA 3MKYB 1ZRCA 1N78A 3SQNA 3CO7C 4BBSJ 4A3GJ 1WSUA 1JKRC 4MO7A 1ETYA 4C2UA 2LNBA 3BJ6A 5EZGA 1KONA 2A3SA 4C2TA 4RM3A 1BI3A 3DEEA 3D1NI 3GW2A 3ZMDA 1T56A 3ULQB 3RPUD
chains in the Genus database with same CATH topology
2KRFA 4NB5A 2FU4A 3J80Z 4PDKA 2AS5F 2RQPA 5K5RA 2VE9A 3FWEA 4FX0A 5HOOA 1IZ1A 4HV6A 3FX3A 2F5EA 2G7HA 1XCVA 5ERIA 2TDXA 2E1NA 4I0BA 4A5NA 3KEOA 1OYIA 4LLGF 1KQ8A 5LGNA 3LA3A 4A0ZA 3F8MA 2OAZA 2XUBA 4OIOF 1XDSA 1H9TA 1FYMA 2NS0A 2R3SA 2BYVE 1BI2A 2RNJA 5E1ZB 3EYYA 1TW2A 2KJBA 2VC0A 3MCZA 3F8BA 3HUGA 1X3UA 1MDMB 4G94A 1DPRA 3K69A 4OOIA 2ZMEB 3U2RA 4MEYF 1TQPA 4KUMA 2HYFA 2EV6A 5D8KB 1J5YA 3SZPA 1K78A 3NQOA 2EJRA 3BPVA 3SXYA 3EYIA 4HW0A 1JE8A 1ZAOA 2A5YB 5L3BA 2RV8A 4D0PA 5BMZA 3F22A 1O3TA 3REOA 1U6GA 3KP4A 3MZYA 3RYPA 2E7XA 3HRUA 1KU3A 1IRFA 2NYXA 2XAQA 2ISZA 3IRQA 2YU3A 1WRJA 1XMKA 1HKSA 2QQBA 2GAUA 2EFNA 4EJWA 4LK1F 2Z99A 4AIJA 2MH2A 5BS6A 3RPUA 4HYEA 1R1TA 4HLXA 5BPDA 4S04A 1TW3A 3MWMA 4O6JA 2HS5A 1O7FA 5HLGA 4Y17A 3HRSA 1ZG3A 1H9GA 1GXPA 3ROUA 2D1VA 1ZH5A 3QOPA 1BC7C 4AD9A 1ZGJA 2QLZA 2UXXA 2E1CA 2V6CA 4HF0A 4JQFA 3ISPA 2GA2A 3AAFA 1OYYA 2GIVA 4ZZDA 4A0XA 1MZBA 2FBKA 1S8NA 3DV8A 4EMSA 4ESBA 3B02A 2DT5A 5ICFA 5CVVA 1BOAA 1FNNA 4JBAA 4KIBA 5D5WB 3WTZA 5L3GA 3V8KA 1K79A 3S2WA 2HGCA 5DD4A 4Y13A 3FZVA 1UHWA 4BH9A 1U5TB 4E70A 3F6VA 2M8EA 1B9MA 3DXJF 4H0EA 2O61A 1YS6A 1O3RA 2VOPA 4IHSA 5D5UB 3M8EA 2HR3A 4M74A 3G3ZA 4OIRF 1J7KA 2FA5A 3ZMVA 2WC2A 2PEXA 1O3SA 2V1DA 1BM9A 2MBFA 5LBQA 2VT2A 3JTGA 3FMSA 3WTXC 3LAPA 4Q47A 2FOKA 3GEZA 3I59A 2PLYA 1LDJA 1GHCA 4ON0A 2MLGA 2F2EA 5BOXA 2LKPA 2ZNZA 3MQ0A 2VBYA 4HV5A 3LFKA 4M6YA 4EJUA 3ECHA 4OMZA 1LEAA 2IJLA 5E17F 2JPBA 1FBSA 4OIPF 1FYLA 1OKRA 1T6SA 3T8RA 5LLQA 2W25A 2KKOA 3R0JA 3QRFF 4IPAA 3TDZC 2HQRA 1GVJA 3BP8A 5ILVA 1RUOA 3NEUA 1W7PB 3ZN1A 3HIFA 1RZ4A 5DDGA 5AONA 4LG0B 3F21A 5IT9Z 2OD5A 4EQQA 3BROA 4HDVA 3W6JB 2JTVA 2H6CA 2DBBA 2OZ6A 2DK8A 1ZREA 2ZJ2A 1Z7UA 3JAMZ 2XKPA 4RB2C 4M9XA 1OR7A 4R1HA 2Q0OA 2JRTA 1T0FA 2KIFA 4I09A 2HTJA 2D2WA 1QO0D 2QZ8A 2V1XA 2UXNA 4RAZA 4KFCA 1XB4A 3F6OA 1YW9A 4DNCA 2ELHA 5JVTA 2STWA 1YO5C 3IL2A 4OIQF 1F1ZA 1YIOA 5L3DA 4ESJA 5J8CA 5DCMA 2IRFG 1R58A 5ICCA 1ULYA 3O2PE 1JHHA 4UVBA 4U0VA 3B73A 3T1BA 1CF7A 5LHIA 2DQLA 2VXZA 3MEXA 4KT5C 1H0MA 3KZYA 4G6DA 4AIKA 1U5TC 5F64A 1O7LA 2DW4A 2Y75A 5J6XA 1FWZA 3WE2A 4A6DA 3GWZA 3I64A 1USTA 2LDUA 2R7DA 2DPUA 2FSWA 5DD8A 4ENJA 3VEPA 1XGMA 4EM1A 2K86A 2A07F 2NRAC 3BZ6A 4UV9A 4GGGA 2OQGA 4AVPA 5HS7A 1IN6A 1SD6A 5DCFA 1G3WA 1K78B 1R23A 3CUQA 1IF1A 3IKTA 3PQKA 1YTYA 1D3YA 2ZCWA 2EFWA 2KIMA 2W85A 3CLOA 1DUXC 3U9GA 2OQRA 1W5TA 1BJAA 1JGSA 1QZZA 3MFKA 1PUEE 5LEJA 1W5SA 2HZTA 4HF1A 4LB6B 1DPUA 4ETSA 3PFIA 4A5MA 5D6EA 2P7VB 3VODA 1P2FA 5LRRA 1XSDA 1R1VA 1TNSA 5IT9K 5FLXZ 3HYIA 2O3FA 2QQAA 1WKMA 2VBXA 4CDGA 2XHKA 1QGPA 4Q48A 3WGGA 1U2WA 1F5TA 1FT9A 1BBYA 2P4WA 2EB7A 3BY6A 2HTSA 3TO6A 3WTSC 4NHJA 1U8RA 1Z91A 2FRHA 3V7SA 4EJOA 2ETHA 4XSXF 2WWYA 2IA0A 2XAFA 3HHGA 1XMAA 4M6XA 5EEHA 4U7BA 2J5OA 5D4SA 2M45A 4I7HA 4RGUA 3E6DA 2EA4A 4CHUA 5JI6A 1IUYA 5HDNA 3F8NA 5K5QA 4FHTA 3HSRA 1RI7A 1HW2A 1FYKA 5FFXA 4N0BA 3RKYA 4ENKA 3C7JA 2Z9OA 5LGTA 1I27A 1JHFA 5FGMA 2PN6A 5H20A 2V9VA 1ZGAA 3E6CC 2JZYA 1D8JA 2QBYA 2F5DA 3FF5A 1RNLA 2F5CA 3C3WA 2WTEA 5ICEA 3RI4A 2IP2A 1LDDA 5H6RA 3TDUC 1I5ZA 4OINF 3LQRA 1HW1A 4HAMA 2QENA 2ZKZA 3HHHA 2BEOA 5FD5A 1FX7A 5CLSA 2XIGA 4KN7X 1KYWA 4EJTA 3BWGA 1SFUA 2GWRA 1EH8A 3KFWX 3CO6C 2ESHA 3DFGA 3V7RA 3ZMSA 6PAXA 4ENNA 2IPQX 3WU0A 2L02A 1HW5A 3GFLA 5LHHA 4Y15A 1HQCA 4M71A 3I59B 2Z33A 4GO1A 2VN2A 2RGVA 2FF4A 2VE8A 3JTHA 1IW7F 5FB2A 4M9SA 4CYDA 4AWXB 3ZQ7A 4DQ2A 1YS7A 1YG2A 2WV0A 1ONVA 4CZZA 4HQEA 2JT1A 1C0WA 2PMUA 2XASA 4WXDA 2A6HF 2NNNA 4YFNF 2MH9A 2ISYA 4LK0F 5BQTA 1ON1A 3M7GA 3WTYC 4B8XA 1O57A 4HZFA 3E6MA 1R1UA 3E5UA 1LDKB 3DKWA 4I0AA 4QLCU 2XAHA 3V7CA 1G4DA 4HLYA 3WODF 4CO8A 5JR3A 1OMIA 4EV0A 3OOPA 3GYHX 3LQQA 2DI3A 3GF2A 4U0YA 2L4MA 3I5UA 3HTUA 1KQ0A 2M5WA 3GX4X 5F6FA 2QQ9A 2EFPA 2YX4A 2L4AA 5H6QA 3WGIA 4YIFA 4XSZF 3J80K 1TLHB 3HOTA 1HKTA 1DDNA 4BQAA 2IA2A 1TNTA 2QYOA 2P5LC 4ENMA 1YQAA 5AIQA 2Y48A 2DQRA 2Q2EA 4WCGA 1R5GA 2O8XA 3I53A 4UVCA 4EJVA 3HSFA 4KMUX 2RDPA 4M9ZA 2YR2A 3F8FA 2BV6A 2E7WA 5DCMB 1R7JA 2L54A 3QAHA 1BC8C 4P5OA 2XRNA 3OV8A 4Z2YA 3J81Z 1CF7B 1F9NA 4IHTA 4FT8A 2H6BA 3C1DA 3L09A 5LHGA 1S3JA 5HS9A 3CJNA 5JHUA 4UNOA 2M30A 3TO7A 3I58A 2COMA 2G7UA 1UFMA 3QP5A 4MGRA 2HFHA 1XGNA 2XV4S 1BI1A 1MJ9A 4KA4A 3BDDA 1IN5A 2FQ3A 5HLHA 2EK5A 3E3VA 4M72A 2X4HA 3N4MA 2A6EF 4PCQA 1LVAA 2NNYA 4HDUA 3K1NA 5ILUA 4R79A 3RYRA 5K1YA 3WG9A 4HA8A 1D5VA 2W57A 5LGUA 2C6YA 3O6BB 4YIIA 4CXFA 3ZMUA 3WE3A 4RGXA 4P9UA 5KVRA 2HEOA 3H92A 1R00A 3CUQB 4L0ZB 1O3QA 4GXOA 5E18F 4BYYA 3KLOA 4RGSA 4ASNA 5TRDA 3HRTA 2PJPA 5L3FA 1Q1HA 2PBIA 3ERED 1HXDA 1IRGA 5DUIA 4KIGA 3RIRA 3GLXA 3LAJA 3KE2A 3P9CA 3KLNA 1OYWA 2XAGA 1ZHFA 3CUOA 3P9KA 1U78A 3L7WA 1U3EM 4A2UA 1UCRA 3RKWA 1FBQA 2STTA 2EV0A 3HRMA 3QU3A 5DUKA 2LF7A 4G9YA 1E2XA 2FBIA 4G7HF 4JK1X 2XROA 1P6RA 3GFIA 1SMYF 2VODA 2P6TA 1MD0A 4P55A 1FZPB 4KNYA 3TOAA 4HX8A 1YW7A 2K4JA 3KP5A 2D45A 1MKMA 4I02A 2IT0A 3FXUA 1FPQA 3TOBA 4IRHA 1K6OA 2DFIA 3NRVA 4GYIA 2YSRA 2O6GE 1UB9A 2FNAA 1S7AA 3FHZA 2H27A 2ZO4A 3F72A 2HQNA 4LFUA 3JSPA 2AXLA 3WGHA 4RGRA 3K1MA 1XGOA 2Z5UA 3R0AA 4BNCA 3KP3A 4BXUA 3J81K 3FXQA 5EEGA 5DEQA 1PDNC 2IA1A 4G8XA 2LF8A 4K2EA 3BOQA 1ZRFA 2JPCA 4WXHA 2CYYA 3LSTA 1SD4A 4MQ9F 5L3EA 4MQVA 2W84A 4EVIA 4LLLA 2QBYB 3M8FA 2OZUA 1ZLKA 4UVAA 2ZXJA 5HDGA 1DP7P 1V3FA 5HS8A 2PI0A 4EM0B 2EV5A 2K4BA 5D5XB 1QBJA 2HKXA 5CYVA 4G7ZF 2Y0MA 4A0YA 5KK1A 3SFZA 3ZP5A 1IN4A 2HOEA 1USSA 1K7AA 4L5IA 5E1XA 2A68F 4N9HA 1SAXA 4I2OA 3V8JA 1XD7A 3ML6A 4N9IA 5LEKA 3Q5FA 4HF2A 4MTDA 2VBZA 4MTEA 1ZN2A 3EUHA 1G3SA 4S05A 1F4KA 1B1BA 2ZFWA 5DV5A 1FLIA 2FXAA 3E5QA 4PGGA 3H3ZA 2RKHA 2FMYA 3KEQA 2PMHA 1Y0UA 2CSOA 3Q9SA 1FP1D 4GCVA 5D5VB 2R7FA 2XAJA 4KYWA 2V79A 3DEUA 5CVRA 3ABTA 3EDPA 4CGZA 2ACJA 3O3KA 4IVNA 1HKQA 1T39A 5ILSA 1FSHA 4U88A 3TO9A 2MA3A 2OU2A 4A12A 1UHMA 1SFXA 4L5JA 3Q9VA 1MJAA 1SMTA 1J2XA 4LLNA 2PFBA 1YLFA 1Z9CA 3I0TA 4HQMA 4ZZLA 3JAMK 5F1RA 3TKYA 4UXNA 5JFRA 1FY7A 2EFOA 1MGTA 1BIBA 2K27A 2GQQA 5CVUA 3T5XA 1QNTA 4WWCA 1XN7A 1B6AA 3HTSB 3M1EA 1VTNC 1WQ2A 5CJ9A 1P4AA 1P4XA 2CG4A 3ECOA 1G3TA 5TJJA 4UHTA 2GXBA 1YW8A 4YFXF 1J75A 5AIPA 3L00A 2EFQA 4M73A 1WWXA 2YPRA 1J59A 2CFXA 2DAOA 2MC3A 1FC3A 3SZTA 1ZLJA 5IT3A 4OU0A 1YYVA 5J8FA 3WTUC 1XDUA 2ADUA 3L9FA 1S7OA 1J9IA 2DLLA 4RAYA 3W6KB 1P92A 1XGSA 3K0LA 2G9WA 2OBPA 5E8IA 2ZBKA 4I01A 4L9JA 4LB5A 1PP8F 3VB2A 5ED4A 2J5PA 2QUFA 1KA8A 1IXSB 3LWFA 4KIFA 2FBHA 2DTRA 2HYGD 4AIHA 3IWFA 4PGHA 4WK8F 2DO7A 3RTRA 2A61A 3QPTA 2P5KA 4O3MA 2X0LA 1HSTA 1WI9A 3R60A 4IF4A 1J0RA 1KU7A 1LEBA 3KZZA 3C18A 3IWZA 4XRFA 3E6BA 4RS8A 1R36A 5FLXK 4BHCA 4FX4A 1ZG5A 2ESNA 3GZ5A 3ZMTA 1SD5A 1R22A 4BAYA 5E20A 4XBFA 3F8CA 3DF8A 1B4AA 3E97A 3I4PA 4O5VA 1W4MA 4TV7A 1KQ9A 3T0YA 1CGPA 4PZJA 4BHBA 3PQJA 4KICA 3FMRA 2CO5A 2IW5A 1B59A 5FD6A 3TGNA 1ODDA 4ZH4F 3TQNA 3GFMA 2UWMA 2M1BA 4KN4X 3F3XA 5BPIA 1FP2A 2A69F 3BJAA 2F5FA 5A2QZ 5HVQC 1AWCA 1Z1DA 3L2CA 5LRSA 1L0OC 3VFZA 1AOYA 1P4WA 4EM2A 1T98A 5HLIA 3HSEA 1IXRC 1Z6RA 3KP7A 3LA2A 4IJAA 3WTWC 2K02A 4L9VA 3IKVA 3J7AO 3CTAA 1RUNA 5FO5A 4U0WA 1QZYA 2O03A 1IN7A 5CVIA 4CICA 4YFKF 2KJCA 1T2KA 4F7ZA 4GYGA 1L3LA 3KETA 3GXOA 1QQIA 1FBUA 2JSCA 3JW4A 4L18B 3GFJA 2M87A 3QPHA 3VOEA 2O0YA 1ZYRF 3MAJA 4KMFA 3K2ZA 3FM5A 2Q8KA 2L01A 4ESFA 1G3YA 2W24A 4L9TA 4ZYGA 3R6SA 4BHPA 1I1SA 4ZYEA 3GVAA 2V1UA 1KYZA 4WF2A 1YFHA 1SFEA 3V8LA 1MDMA 3SHFA 1BIAA 4XLPF 2ZMEA 4G7OF 1ZRDA 1D8KA 4LGWA 1ZG1A 2XGXA 1FSEA 2P8TA 1KU2A 5D6FA 3ZMZA 2GA1A 3COAC 3R61A 4OMYA 4HOBA 1S29A 3I71A 4L0YB 3M9AA 1EH7A 1KU9A 2B0LA 2DU9A 2VONA 2FNPA 2PQ8A 1OPCA 3HOSA 1IXCA 3DPTA 5D8LB 2YX7A 2K7LA 3RKXA 2MLKA 3V4GA 2CW0F 4A6EA 5E1WA 1I6XA 4NQWA 3WTTC 3ABUA 3DP7A 1XCBA 1BI0A 1A04A 4I98B 2QVOA 4Q5SF 3D5LA 5A2QK 1KGSA 2HDCA 1MJBA 1IAWA 3MZHA 1NHAA 4MNUA 1EH6A 3CDHA 2VOOA 4Q4ZF 2XVCA 2IVMA 3FMQA 4ZYDA 2VBWA 1FOKA 1STZA 2EA2A 4MEXF 4XLNF 3FM3A 2P7CB 4G6QA 5HDKA 3KCCA 3U1DA 1LQ1A 2DPDA 3N97A 1IN8A 3H3UA 4LMYA 4ZYHA 1TQMA 5ICGA 3ZN0A 2RVCA 2ZNYA 1W7PD 4LJZF 3IHUA 5CVJA 1B9NA 3F23A 3K9TA 3RJPA 2FEZA 1XSVA 3LA7A 5L3CA 1TQIA 3R4KA 2FE3A 4HBLA 2VC1A 2H09A 2GXGA 2DK5A 5D4RA 1S6LA 2QM3A 3JSOA 3T8TA 1ZARA 2OA4A 2D1HA 5FFZA 4B09A 1PP7U 2HKOA 1U5TA 4U7DA 2UZKA 1QPMA 1G6NA 2QWWA 3RDIA 4IRIA 2LSOA 4UUVA 2H94A 5DYMA 3BJOA 1HBXG 4WX9A 3KP2A 1Z6TA 5K5OA 2P6SA 4IXAA 2RN7A 4P96A 2BE5F 4QWQA 4HX4A 1EV7A 1R5HA 2XKOA 4RB1A 2CGPA 3CUQC 1ON2A 1REPC 4WXCA 4EGZA 4R8HA 4UV8A 1I1GA 2NAZA 3IC7A 2PG4A 5E8GA 3E5XA 4L9NA 3WU1B 2GZWA 2VT3A 2CQKA 2L3DA 3DQVC 3DPLC 4HX7A 3FXRA 1LNWA 1BN5A 3ZPLA 4LD5A 4YG2F 4RB3C 3ELKA 1TTYA 1V4RA 1Z05A 2P5VA 1GXQA 3G73A 2RC4A 4P9FA 1T38A 4IRGA 1LB2A 1E17A 4RB0A 2EWNA 1W7PA 3GUDA 3GZ6A 3D0SA 4MHGA 1RIOH 2Z3YA 3EQLF 1TBXA 3P9IA 4LG0A 1JXSA 2MD5A 3I54A 2HWVA 3K1PA 3QP6A 1HSJA 3KP6A 3BPXA 3IRRA 1LJ9A 1SD7A 3WTVC 3RPQA 3P7NA 4KDPA 3QU6A 3GO5A 2KIUA 2FMLA 2CWEA 2BGCA 3EETA 1XSXA 2BBYA 1ZRCA 3SQNA 3CO7C 1WSUA 2LNBA 3BJ6A 2A3SA 1BI3A 3GW2A 3ZMDA 3ULQB 4EGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRF A;  4NB5 A;  2FU4 A;  3J80 Z;  4PDK A;  2AS5 F;  2RQP A;  5K5R A;  2VE9 A;  3FWE A;  4FX0 A;  5HOO A;  1IZ1 A;  4HV6 A;  3FX3 A;  2F5E A;  2G7H A;  1XCV A;  5ERI A;  2TDX A;  2E1N A;  4I0B A;  4A5N A;  3KEO A;  1OYI A;  4LLG F;  1KQ8 A;  5LGN A;  3LA3 A;  4A0Z A;  3F8M A;  2OAZ A;  2XUB A;  4OIO F;  1XDS A;  1H9T A;  1FYM A;  2NS0 A;  2R3S A;  2BYV E;  1BI2 A;  2RNJ A;  5E1Z B;  3EYY A;  1TW2 A;  2KJB A;  2VC0 A;  3MCZ A;  3F8B A;  3HUG A;  1X3U A;  1MDM B;  4G94 A;  1DPR A;  3K69 A;  4OOI A;  2ZME B;  3U2R A;  4MEY F;  1TQP A;  4KUM A;  2HYF A;  2EV6 A;  5D8K B;  1J5Y A;  3SZP A;  1K78 A;  3NQO A;  2EJR A;  3BPV A;  3SXY A;  3EYI A;  4HW0 A;  1JE8 A;  1ZAO A;  2A5Y B;  5L3B A;  2RV8 A;  4D0P A;  5BMZ A;  3F22 A;  1O3T A;  3REO A;  1U6G A;  3KP4 A;  3MZY A;  3RYP A;  2E7X A;  3HRU A;  1KU3 A;  1IRF A;  2NYX A;  2XAQ A;  2ISZ A;  3IRQ A;  2YU3 A;  1WRJ A;  1XMK A;  1HKS A;  2QQB A;  2GAU A;  2EFN A;  4EJW A;  4LK1 F;  2Z99 A;  4AIJ A;  2MH2 A;  5BS6 A;  3RPU A;  4HYE A;  1R1T A;  4HLX A;  5BPD A;  4S04 A;  1TW3 A;  3MWM A;  4O6J A;  2HS5 A;  1O7F A;  5HLG A;  4Y17 A;  3HRS A;  1ZG3 A;  1H9G A;  1GXP A;  3ROU A;  2D1V A;  1ZH5 A;  3QOP A;  1BC7 C;  4AD9 A;  1ZGJ A;  2QLZ A;  2UXX A;  2E1C A;  2V6C A;  4HF0 A;  4JQF A;  3ISP A;  2GA2 A;  3AAF A;  1OYY A;  2GIV A;  4ZZD A;  4A0X A;  1MZB A;  2FBK A;  1S8N A;  3DV8 A;  4EMS A;  4ESB A;  3B02 A;  2DT5 A;  5ICF A;  5CVV A;  1BOA A;  1FNN A;  4JBA A;  4KIB A;  5D5W B;  3WTZ A;  5L3G A;  3V8K A;  1K79 A;  3S2W A;  2HGC A;  5DD4 A;  4Y13 A;  3FZV A;  1UHW A;  4BH9 A;  1U5T B;  4E70 A;  3F6V A;  2M8E A;  1B9M A;  3DXJ F;  4H0E A;  2O61 A;  1YS6 A;  1O3R A;  2VOP A;  4IHS A;  5D5U B;  3M8E A;  2HR3 A;  4M74 A;  3G3Z A;  4OIR F;  1J7K A;  2FA5 A;  3ZMV A;  2WC2 A;  2PEX A;  1O3S A;  2V1D A;  1BM9 A;  2MBF A;  5LBQ A;  2VT2 A;  3JTG A;  3FMS A;  3WTX C;  3LAP A;  4Q47 A;  2FOK A;  3GEZ A;  3I59 A;  2PLY A;  1LDJ A;  1GHC A;  4ON0 A;  2MLG A;  2F2E A;  5BOX A;  2LKP A;  2ZNZ A;  3MQ0 A;  2VBY A;  4HV5 A;  3LFK A;  4M6Y A;  4EJU A;  3ECH A;  4OMZ A;  1LEA A;  2IJL A;  5E17 F;  2JPB A;  1FBS A;  4OIP F;  1FYL A;  1OKR A;  1T6S A;  3T8R A;  5LLQ A;  2W25 A;  2KKO A;  3R0J A;  3QRF F;  4IPA A;  3TDZ C;  2HQR A;  1GVJ A;  3BP8 A;  5ILV A;  1RUO A;  3NEU A;  1W7P B;  3ZN1 A;  3HIF A;  1RZ4 A;  5DDG A;  5AON A;  4LG0 B;  3F21 A;  5IT9 Z;  2OD5 A;  4EQQ A;  3BRO A;  4HDV A;  3W6J B;  2JTV A;  2H6C A;  2DBB A;  2OZ6 A;  2DK8 A;  1ZRE A;  2ZJ2 A;  1Z7U A;  3JAM Z;  2XKP A;  4RB2 C;  4M9X A;  1OR7 A;  4R1H A;  2Q0O A;  2JRT A;  1T0F A;  2KIF A;  4I09 A;  2HTJ A;  2D2W A;  1QO0 D;  2QZ8 A;  2V1X A;  2UXN A;  4RAZ A;  4KFC A;  1XB4 A;  3F6O A;  1YW9 A;  4DNC A;  2ELH A;  5JVT A;  2STW A;  1YO5 C;  3IL2 A;  4OIQ F;  1F1Z A;  1YIO A;  5L3D A;  4ESJ A;  5J8C A;  5DCM A;  2IRF G;  1R58 A;  5ICC A;  1ULY A;  3O2P E;  1JHH A;  4UVB A;  4U0V A;  3B73 A;  3T1B A;  1CF7 A;  5LHI A;  2DQL A;  2VXZ A;  3MEX A;  4KT5 C;  1H0M A;  3KZY A;  4G6D A;  4AIK A;  1U5T C;  5F64 A;  1O7L A;  2DW4 A;  2Y75 A;  5J6X A;  1FWZ A;  3WE2 A;  4A6D A;  3GWZ A;  3I64 A;  1UST A;  2LDU A;  2R7D A;  2DPU A;  2FSW A;  5DD8 A;  4ENJ A;  3VEP A;  1XGM A;  4EM1 A;  2K86 A;  2A07 F;  2NRA C;  3BZ6 A;  4UV9 A;  4GGG A;  2OQG A;  4AVP A;  5HS7 A;  1IN6 A;  1SD6 A;  5DCF A;  1G3W A;  1K78 B;  1R23 A;  3CUQ A;  1IF1 A;  3IKT A;  3PQK A;  1YTY A;  1D3Y A;  2ZCW A;  2EFW A;  2KIM A;  2W85 A;  3CLO A;  1DUX C;  3U9G A;  2OQR A;  1W5T A;  1BJA A;  1JGS A;  1QZZ A;  3MFK A;  1PUE E;  5LEJ A;  1W5S A;  2HZT A;  4HF1 A;  4LB6 B;  1DPU A;  4ETS A;  3PFI A;  4A5M A;  5D6E A;  2P7V B;  3VOD A;  1P2F A;  5LRR A;  1XSD A;  1R1V A;  1TNS A;  5IT9 K;  5FLX Z;  3HYI A;  2O3F A;  2QQA A;  1WKM A;  2VBX A;  4CDG A;  2XHK A;  1QGP A;  4Q48 A;  3WGG A;  1U2W A;  1F5T A;  1FT9 A;  1BBY A;  2P4W A;  2EB7 A;  3BY6 A;  2HTS A;  3TO6 A;  3WTS C;  4NHJ A;  1U8R A;  1Z91 A;  2FRH A;  3V7S A;  4EJO A;  2ETH A;  4XSX F;  2WWY A;  2IA0 A;  2XAF A;  3HHG A;  1XMA A;  4M6X A;  5EEH A;  4U7B A;  2J5O A;  5D4S A;  2M45 A;  4I7H A;  4RGU A;  3E6D A;  2EA4 A;  4CHU A;  5JI6 A;  1IUY A;  5HDN A;  3F8N A;  5K5Q A;  4FHT A;  3HSR A;  1RI7 A;  1HW2 A;  1FYK A;  5FFX A;  4N0B A;  3RKY A;  4ENK A;  3C7J A;  2Z9O A;  5LGT A;  1I27 A;  1JHF A;  5FGM A;  2PN6 A;  5H20 A;  2V9V A;  1ZGA A;  3E6C C;  2JZY A;  1D8J A;  2QBY A;  2F5D A;  3FF5 A;  1RNL A;  2F5C A;  3C3W A;  2WTE A;  5ICE A;  3RI4 A;  2IP2 A;  1LDD A;  5H6R A;  3TDU C;  1I5Z A;  4OIN F;  3LQR A;  1HW1 A;  4HAM A;  2QEN A;  2ZKZ A;  3HHH A;  2BEO A;  5FD5 A;  1FX7 A;  5CLS A;  2XIG A;  4KN7 X;  1KYW A;  4EJT A;  3BWG A;  1SFU A;  2GWR A;  1EH8 A;  3KFW X;  3CO6 C;  2ESH A;  3DFG A;  3V7R A;  3ZMS A;  6PAX A;  4ENN A;  2IPQ X;  3WU0 A;  2L02 A;  1HW5 A;  3GFL A;  5LHH A;  4Y15 A;  1HQC A;  4M71 A;  3I59 B;  2Z33 A;  4GO1 A;  2VN2 A;  2RGV A;  2FF4 A;  2VE8 A;  3JTH A;  1IW7 F;  5FB2 A;  4M9S A;  4CYD A;  4AWX B;  3ZQ7 A;  4DQ2 A;  1YS7 A;  1YG2 A;  2WV0 A;  1ONV A;  4CZZ A;  4HQE A;  2JT1 A;  1C0W A;  2PMU A;  2XAS A;  4WXD A;  2A6H F;  2NNN A;  4YFN F;  2MH9 A;  2ISY A;  4LK0 F;  5BQT A;  1ON1 A;  3M7G A;  3WTY C;  4B8X A;  1O57 A;  4HZF A;  3E6M A;  1R1U A;  3E5U A;  1LDK B;  3DKW A;  4I0A A;  4QLC U;  2XAH A;  3V7C A;  1G4D A;  4HLY A;  3WOD F;  4CO8 A;  5JR3 A;  1OMI A;  4EV0 A;  3OOP A;  3GYH X;  3LQQ A;  2DI3 A;  3GF2 A;  4U0Y A;  2L4M A;  3I5U A;  3HTU A;  1KQ0 A;  2M5W A;  3GX4 X;  5F6F A;  2QQ9 A;  2EFP A;  2YX4 A;  2L4A A;  5H6Q A;  3WGI A;  4YIF A;  4XSZ F;  3J80 K;  1TLH B;  3HOT A;  1HKT A;  1DDN A;  4BQA A;  2IA2 A;  1TNT A;  2QYO A;  2P5L C;  4ENM A;  1YQA A;  5AIQ A;  2Y48 A;  2DQR A;  2Q2E A;  4WCG A;  1R5G A;  2O8X A;  3I53 A;  4UVC A;  4EJV A;  3HSF A;  4KMU X;  2RDP A;  4M9Z A;  2YR2 A;  3F8F A;  2BV6 A;  2E7W A;  5DCM B;  1R7J A;  2L54 A;  3QAH A;  1BC8 C;  4P5O A;  2XRN A;  3OV8 A;  4Z2Y A;  3J81 Z;  1CF7 B;  1F9N A;  4IHT A;  4FT8 A;  2H6B A;  3C1D A;  3L09 A;  5LHG A;  1S3J A;  5HS9 A;  3CJN A;  5JHU A;  4UNO A;  2M30 A;  3TO7 A;  3I58 A;  2COM A;  2G7U A;  1UFM A;  3QP5 A;  4MGR A;  2HFH A;  1XGN A;  2XV4 S;  1BI1 A;  1MJ9 A;  4KA4 A;  3BDD A;  1IN5 A;  2FQ3 A;  5HLH A;  2EK5 A;  3E3V A;  4M72 A;  2X4H A;  3N4M A;  2A6E F;  4PCQ A;  1LVA A;  2NNY A;  4HDU A;  3K1N A;  5ILU A;  4R79 A;  3RYR A;  5K1Y A;  3WG9 A;  4HA8 A;  1D5V A;  2W57 A;  5LGU A;  2C6Y A;  3O6B B;  4YII A;  4CXF A;  3ZMU A;  3WE3 A;  4RGX A;  4P9U A;  5KVR A;  2HEO A;  3H92 A;  1R00 A;  3CUQ B;  4L0Z B;  1O3Q A;  4GXO A;  5E18 F;  4BYY A;  3KLO A;  4RGS A;  4ASN A;  5TRD A;  3HRT A;  2PJP A;  5L3F A;  1Q1H A;  2PBI A;  3ERE D;  1HXD A;  1IRG A;  5DUI A;  4KIG A;  3RIR A;  3GLX A;  3LAJ A;  3KE2 A;  3P9C A;  3KLN A;  1OYW A;  2XAG A;  1ZHF A;  3CUO A;  3P9K A;  1U78 A;  3L7W A;  1U3E M;  4A2U A;  1UCR A;  3RKW A;  1FBQ A;  2STT A;  2EV0 A;  3HRM A;  3QU3 A;  5DUK A;  2LF7 A;  4G9Y A;  1E2X A;  2FBI A;  4G7H F;  4JK1 X;  2XRO A;  1P6R A;  3GFI A;  1SMY F;  2VOD A;  2P6T A;  1MD0 A;  4P55 A;  1FZP B;  4KNY A;  3TOA A;  4HX8 A;  1YW7 A;  2K4J A;  3KP5 A;  2D45 A;  1MKM A;  4I02 A;  2IT0 A;  3FXU A;  1FPQ A;  3TOB A;  4IRH A;  1K6O A;  2DFI A;  3NRV A;  4GYI A;  2YSR A;  2O6G E;  1UB9 A;  2FNA A;  1S7A A;  3FHZ A;  2H27 A;  2ZO4 A;  3F72 A;  2HQN A;  4LFU A;  3JSP A;  2AXL A;  3WGH A;  4RGR A;  3K1M A;  1XGO A;  2Z5U A;  3R0A A;  4BNC A;  3KP3 A;  4BXU A;  3J81 K;  3FXQ A;  5EEG A;  5DEQ A;  1PDN C;  2IA1 A;  4G8X A;  2LF8 A;  4K2E A;  3BOQ A;  1ZRF A;  2JPC A;  4WXH A;  2CYY A;  3LST A;  1SD4 A;  4MQ9 F;  5L3E A;  4MQV A;  2W84 A;  4EVI A;  4LLL A;  2QBY B;  3M8F A;  2OZU A;  1ZLK A;  4UVA A;  2ZXJ A;  5HDG A;  1DP7 P;  1V3F A;  5HS8 A;  2PI0 A;  4EM0 B;  2EV5 A;  2K4B A;  5D5X B;  1QBJ A;  2HKX A;  5CYV A;  4G7Z F;  2Y0M A;  4A0Y A;  5KK1 A;  3SFZ A;  3ZP5 A;  1IN4 A;  2HOE A;  1USS A;  1K7A A;  4L5I A;  5E1X A;  2A68 F;  4N9H A;  1SAX A;  4I2O A;  3V8J A;  1XD7 A;  3ML6 A;  4N9I A;  5LEK A;  3Q5F A;  4HF2 A;  4MTD A;  2VBZ A;  4MTE A;  1ZN2 A;  3EUH A;  1G3S A;  4S05 A;  1F4K A;  1B1B A;  2ZFW A;  5DV5 A;  1FLI A;  2FXA A;  3E5Q A;  4PGG A;  3H3Z A;  2RKH A;  2FMY A;  3KEQ A;  2PMH A;  1Y0U A;  2CSO A;  3Q9S A;  1FP1 D;  4GCV A;  5D5V B;  2R7F A;  2XAJ A;  4KYW A;  2V79 A;  3DEU A;  5CVR A;  3ABT A;  3EDP A;  4CGZ A;  2ACJ A;  3O3K A;  4IVN A;  1HKQ A;  1T39 A;  5ILS A;  1FSH A;  4U88 A;  3TO9 A;  2MA3 A;  2OU2 A;  4A12 A;  1UHM A;  1SFX A;  4L5J A;  3Q9V A;  1MJA A;  1SMT A;  1J2X A;  4LLN A;  2PFB A;  1YLF A;  1Z9C A;  3I0T A;  4HQM A;  4ZZL A;  3JAM K;  5F1R A;  3TKY A;  4UXN A;  5JFR A;  1FY7 A;  2EFO A;  1MGT A;  1BIB A;  2K27 A;  2GQQ A;  5CVU A;  3T5X A;  1QNT A;  4WWC A;  1XN7 A;  1B6A A;  3HTS B;  3M1E A;  1VTN C;  1WQ2 A;  5CJ9 A;  1P4A A;  1P4X A;  2CG4 A;  3ECO A;  1G3T A;  5TJJ A;  4UHT A;  2GXB A;  1YW8 A;  4YFX F;  1J75 A;  5AIP A;  3L00 A;  2EFQ A;  4M73 A;  1WWX A;  2YPR A;  1J59 A;  2CFX A;  2DAO A;  2MC3 A;  1FC3 A;  3SZT A;  1ZLJ A;  5IT3 A;  4OU0 A;  1YYV A;  5J8F A;  3WTU C;  1XDU A;  2ADU A;  3L9F A;  1S7O A;  1J9I A;  2DLL A;  4RAY A;  3W6K B;  1P92 A;  1XGS A;  3K0L A;  2G9W A;  2OBP A;  5E8I A;  2ZBK A;  4I01 A;  4L9J A;  4LB5 A;  1PP8 F;  3VB2 A;  5ED4 A;  2J5P A;  2QUF A;  1KA8 A;  1IXS B;  3LWF A;  4KIF A;  2FBH A;  2DTR A;  2HYG D;  4AIH A;  3IWF A;  4PGH A;  4WK8 F;  2DO7 A;  3RTR A;  2A61 A;  3QPT A;  2P5K A;  4O3M A;  2X0L A;  1HST A;  1WI9 A;  3R60 A;  4IF4 A;  1J0R A;  1KU7 A;  1LEB A;  3KZZ A;  3C18 A;  3IWZ A;  4XRF A;  3E6B A;  4RS8 A;  1R36 A;  5FLX K;  4BHC A;  4FX4 A;  1ZG5 A;  2ESN A;  3GZ5 A;  3ZMT A;  1SD5 A;  1R22 A;  4BAY A;  5E20 A;  4XBF A;  3F8C A;  3DF8 A;  1B4A A;  3E97 A;  3I4P A;  4O5V A;  1W4M A;  4TV7 A;  1KQ9 A;  3T0Y A;  1CGP A;  4PZJ A;  4BHB A;  3PQJ A;  4KIC A;  3FMR A;  2CO5 A;  2IW5 A;  1B59 A;  5FD6 A;  3TGN A;  1ODD A;  4ZH4 F;  3TQN A;  3GFM A;  2UWM A;  2M1B A;  4KN4 X;  3F3X A;  5BPI A;  1FP2 A;  2A69 F;  3BJA A;  2F5F A;  5A2Q Z;  5HVQ C;  1AWC A;  1Z1D A;  3L2C A;  5LRS A;  1L0O C;  3VFZ A;  1AOY A;  1P4W A;  4EM2 A;  1T98 A;  5HLI A;  3HSE A;  1IXR C;  1Z6R A;  3KP7 A;  3LA2 A;  4IJA A;  3WTW C;  2K02 A;  4L9V A;  3IKV A;  3J7A O;  3CTA A;  1RUN A;  5FO5 A;  4U0W A;  1QZY A;  2O03 A;  1IN7 A;  5CVI A;  4CIC A;  4YFK F;  2KJC A;  1T2K A;  4F7Z A;  4GYG A;  1L3L A;  3KET A;  3GXO A;  1QQI A;  1FBU A;  2JSC A;  3JW4 A;  4L18 B;  3GFJ A;  2M87 A;  3QPH A;  3VOE A;  2O0Y A;  1ZYR F;  3MAJ A;  4KMF A;  3K2Z A;  3FM5 A;  2Q8K A;  2L01 A;  4ESF A;  1G3Y A;  2W24 A;  4L9T A;  4ZYG A;  3R6S A;  4BHP A;  1I1S A;  4ZYE A;  3GVA A;  2V1U A;  1KYZ A;  4WF2 A;  1YFH A;  1SFE A;  3V8L A;  1MDM A;  3SHF A;  1BIA A;  4XLP F;  2ZME A;  4G7O F;  1ZRD A;  1D8K A;  4LGW A;  1ZG1 A;  2XGX A;  1FSE A;  2P8T A;  1KU2 A;  5D6F A;  3ZMZ A;  2GA1 A;  3COA C;  3R61 A;  4OMY A;  4HOB A;  1S29 A;  3I71 A;  4L0Y B;  3M9A A;  1EH7 A;  1KU9 A;  2B0L A;  2DU9 A;  2VON A;  2FNP A;  2PQ8 A;  1OPC A;  3HOS A;  1IXC A;  3DPT A;  5D8L B;  2YX7 A;  2K7L A;  3RKX A;  2MLK A;  3V4G A;  2CW0 F;  4A6E A;  5E1W A;  1I6X A;  4NQW A;  3WTT C;  3ABU A;  3DP7 A;  1XCB A;  1BI0 A;  1A04 A;  4I98 B;  2QVO A;  4Q5S F;  3D5L A;  5A2Q K;  1KGS A;  2HDC A;  1MJB A;  1IAW A;  3MZH A;  1NHA A;  4MNU A;  1EH6 A;  3CDH A;  2VOO A;  4Q4Z F;  2XVC A;  2IVM A;  3FMQ A;  4ZYD A;  2VBW A;  1FOK A;  1STZ A;  2EA2 A;  4MEX F;  4XLN F;  3FM3 A;  2P7C B;  4G6Q A;  5HDK A;  3KCC A;  3U1D A;  1LQ1 A;  2DPD A;  3N97 A;  1IN8 A;  3H3U A;  4LMY A;  4ZYH A;  1TQM A;  5ICG A;  3ZN0 A;  2RVC A;  2ZNY A;  1W7P D;  4LJZ F;  3IHU A;  5CVJ A;  1B9N A;  3F23 A;  3K9T A;  3RJP A;  2FEZ A;  1XSV A;  3LA7 A;  5L3C A;  1TQI A;  3R4K A;  2FE3 A;  4HBL A;  2VC1 A;  2H09 A;  2GXG A;  2DK5 A;  5D4R A;  1S6L A;  2QM3 A;  3JSO A;  3T8T A;  1ZAR A;  2OA4 A;  2D1H A;  5FFZ A;  4B09 A;  1PP7 U;  2HKO A;  1U5T A;  4U7D A;  2UZK A;  1QPM A;  1G6N A;  2QWW A;  3RDI A;  4IRI A;  2LSO A;  4UUV A;  2H94 A;  5DYM A;  3BJO A;  1HBX G;  4WX9 A;  3KP2 A;  1Z6T A;  5K5O A;  2P6S A;  4IXA A;  2RN7 A;  4P96 A;  2BE5 F;  4QWQ A;  4HX4 A;  1EV7 A;  1R5H A;  2XKO A;  4RB1 A;  2CGP A;  3CUQ C;  1ON2 A;  1REP C;  4WXC A;  4EGZ A;  4R8H A;  4UV8 A;  1I1G A;  2NAZ A;  3IC7 A;  2PG4 A;  5E8G A;  3E5X A;  4L9N A;  3WU1 B;  2GZW A;  2VT3 A;  2CQK A;  2L3D A;  3DQV C;  3DPL C;  4HX7 A;  3FXR A;  1LNW A;  1BN5 A;  3ZPL A;  4LD5 A;  4YG2 F;  4RB3 C;  3ELK A;  1TTY A;  1V4R A;  1Z05 A;  2P5V A;  1GXQ A;  3G73 A;  2RC4 A;  4P9F A;  1T38 A;  4IRG A;  1LB2 A;  1E17 A;  4RB0 A;  2EWN A;  1W7P A;  3GUD A;  3GZ6 A;  3D0S A;  4MHG A;  1RIO H;  2Z3Y A;  3EQL F;  1TBX A;  3P9I A;  4LG0 A;  1JXS A;  2MD5 A;  3I54 A;  2HWV A;  3K1P A;  3QP6 A;  1HSJ A;  3KP6 A;  3BPX A;  3IRR A;  1LJ9 A;  1SD7 A;  3WTV C;  3RPQ A;  3P7N A;  4KDP A;  3QU6 A;  3GO5 A;  2KIU A;  2FML A;  2CWE A;  2BGC A;  3EET A;  1XSX A;  2BBY A;  1ZRC A;  3SQN A;  3CO7 C;  1WSU A;  2LNB A;  3BJ6 A;  2A3S A;  1BI3 A;  3GW2 A;  3ZMD A;  3ULQ B;  4EGY A; 
#chains in the Genus database with same CATH topology
 2KRF A;  4NB5 A;  4XRS A;  2FU4 A;  4D7M A;  5FRN A;  3J80 Z;  2ZB9 A;  2E2H J;  4PDK A;  3VDX A;  1XS9 A;  2AS5 F;  1QPI A;  4PJL A;  2RQP A;  5K5R A;  2VE9 A;  2E1M B;  5M5W J;  3FWE A;  4FX0 A;  5HOO A;  2K3F A;  1IZ1 A;  4HV6 A;  2I10 A;  1YX3 A;  1D1B A;  2OCE A;  3FX3 A;  2F5E A;  2G7H A;  1XCV A;  5ERI A;  4CA0 A;  2TDX A;  2E1N A;  4I0B A;  4A5N A;  4RLF A;  4E6K G;  3KEO A;  1MIJ A;  1OYI A;  1IC8 A;  3OYG A;  4LLG F;  1FMW A;  2OCC H;  1W0U A;  1KQ8 A;  5LGN A;  3LA3 A;  4A0Z A;  2QSH X;  3F8M A;  2ZJR F;  2OAZ A;  4BUP A;  3BTI A;  2CQQ A;  2XUB A;  4ZTJ A;  3K4M A;  3CCJ I;  3GTQ J;  4OIO F;  1U9O A;  1XDS A;  2HNH A;  2E35 A;  1H9T A;  1FYM A;  1HDP A;  2NS0 A;  2R3S A;  2BYV E;  3ZQG A;  1BI2 A;  3SDG A;  2V6E A;  2RNJ A;  2VAS A;  4LIT A;  5E1Z B;  4I6Z A;  3HXL A;  5F0F A;  3EYY A;  1MBE A;  1TW2 A;  2KJB A;  2CMP A;  2VC0 A;  1YI2 I;  2DDB A;  1U0J A;  3HJE A;  3MCZ A;  2JVG A;  5JLW A;  3F8B A;  2VPR A;  2BVM A;  2MG4 A;  2WAD A;  3HUG A;  5GAH J;  1X3U A;  1AKH B;  1MDM B;  4BQO A;  3CCL I;  3MN2 A;  2ID3 A;  4IX7 A;  4G94 A;  4E7I A;  4Y52 J;  1DPR A;  2QSG X;  1W5C C;  1SAN A;  3K69 A;  2UUZ A;  2R7V A;  4OOI A;  2ZME B;  4EAT A;  3RCO A;  3I4M J;  3U2R A;  4MEY F;  1ERD A;  4RAG A;  1TQP A;  2X1C A;  2TCT A;  4KUM A;  2HYF A;  2EV6 A;  2IXS A;  5D8K B;  1J5Y A;  3SZP A;  4IHW A;  2CQN A;  3AG4 H;  5F0C A;  1K78 A;  3NQO A;  2DMU A;  2EJR A;  4DYR A;  3CCU I;  4B44 A;  4XN3 A;  3BPV A;  3HOU J;  1X19 A;  3ZOB A;  3G1O A;  4BS9 A;  2LY9 A;  1X4O A;  3SXY A;  3KZI C;  4DJA A;  3EYI A;  2DYS H;  4HW0 A;  4BE1 A;  4ZTF A;  1JE8 A;  1ZAO A;  2A5Y B;  2OUM A;  5L3B A;  3GME A;  5C4J J;  2BVL A;  2RV8 A;  2M7B A;  4B3A A;  4D0P A;  5BMZ A;  4IOA F;  1JJ6 C;  5GPC A;  3F22 A;  1O3T A;  3REO A;  1U6G A;  4M3B A;  3KP4 A;  3MZY A;  3U1K A;  2Y69 H;  3OS2 A;  1R9T J;  4A3B J;  4AID A;  3RYP A;  2CRG A;  2E7X A;  2NXN B;  3H0G J;  2FJ1 A;  3HRU A;  1KU3 A;  1IRF A;  4F3Q A;  4DZP A;  2NYX A;  2XAQ A;  1GV5 A;  3HEF A;  2ISZ A;  1YE9 A;  2YU3 A;  1WRJ A;  3OYB A;  2FD5 A;  3IRQ A;  2WAQ A;  1XMK A;  2E19 A;  2VPL A;  1HKS A;  2QQB A;  4B48 A;  4NBQ A;  2NVT J;  2GAU A;  1VQ7 I;  2EFN A;  4EJW A;  1A36 A;  4LK1 F;  1BR1 A;  2Z99 A;  5K7F A;  2VIX A;  4AIJ A;  1YJ9 I;  2MH2 A;  3H9G A;  3CQZ J;  3RPU A;  3S32 A;  5BS6 A;  4HYE A;  1R1T A;  3JCU C;  4HLX A;  5BPD A;  5GAD J;  1TW3 A;  4S04 A;  3MWM A;  4O6J A;  4NQW B;  2HS5 A;  1O7F A;  5HLG A;  4Y17 A;  1FMV A;  3HRS A;  2KLO A;  1OLT A;  1ZG3 A;  3A01 B;  1H9G A;  2PMZ A;  1GXP A;  2L9S A;  3ROU A;  2D1V A;  3E1S A;  4RLQ A;  1ZH5 A;  1XTA A;  2IEK A;  3FXO A;  3QOP A;  1BC7 C;  4AD9 A;  2COB A;  3JRG A;  1A35 A;  1ZGJ A;  2K9M A;  3ZR8 X;  1K83 J;  4F91 B;  3CCR I;  2QLZ A;  1JI8 A;  2UXX A;  2E1C A;  2V6C A;  1JKQ C;  3I56 I;  3ABM H;  3PL8 A;  5KNL A;  1LE8 A;  4HF0 A;  4JQF A;  3K70 D;  2L7K A;  5C44 J;  3ISP A;  2GA2 A;  5JHF A;  1APL C;  3N05 A;  4Y4R A;  3AAF A;  1OYY A;  5E3L A;  2GIV A;  5EGO A;  3ZQC A;  4ZZD A;  1T8I A;  2DMP A;  2DMQ A;  2ZFU A;  2E36 A;  4A0X A;  3NWT A;  1SEU A;  2QA4 I;  1MZB A;  2FBK A;  1QHG A;  3OL4 A;  1IGN A;  1S8N A;  3DV8 A;  2MAB A;  5FRM A;  4EMS A;  5DS9 A;  1N75 A;  2VKE A;  2M0C A;  4ESB A;  1X4P A;  2XAU A;  1RKW A;  3B02 A;  3IV5 A;  2DT5 A;  3QYF A;  1WJF A;  4UY8 I;  1GUU A;  5CVV A;  5ICF A;  1BOA A;  1FNN A;  4JBA A;  4PSW A;  3CZ6 A;  4KIB A;  3RQ4 A;  3KYD B;  5D5W B;  3WTZ A;  5L3G A;  3OYC A;  3V8K A;  1K79 A;  2EIL H;  3S2W A;  4V2F A;  2A6T A;  3G1M A;  3RSN A;  2HGC A;  2VQG A;  1TL8 A;  5DD4 A;  4XLA A;  4Y13 A;  2HXI A;  3FZV A;  1UHW A;  4BH9 A;  1U5T B;  4E70 A;  3F6V A;  2IGO A;  4EEF G;  4A3J J;  4IQJ A;  2GOX B;  2M8E A;  1B9M A;  3DXJ F;  4KJZ A;  3OYE A;  4H0E A;  2O61 A;  1YS6 A;  4XLF A;  1O3R A;  2VOP A;  4IHS A;  1X1C A;  5D5U B;  3M8E A;  2ME0 A;  3S1M J;  3ASN H;  2HR3 A;  3DBH B;  2KQR A;  4M74 A;  3G3Z A;  1MSE C;  2GXA A;  2IS6 A;  4A69 C;  1YJN I;  4OIR F;  1J7K A;  2FA5 A;  3MZ8 A;  2JVH A;  5GTI C;  3ZMV A;  2VUM J;  2WC2 A;  3FXK A;  3VSL A;  2PEX A;  1O3S A;  1POG A;  1KZH A;  4JX5 A;  2V1D A;  2FUG 2;  1HDD C;  2CV0 A;  4BDY A;  5GTH C;  1BM9 A;  2MBF A;  5LBQ A;  2VT2 A;  3JTG A;  1IUF A;  3FMS A;  3WTX C;  3LAP A;  4Q47 A;  3G2B A;  2YU9 J;  2FOK A;  1JTY A;  3FKJ A;  2ZME C;  3PO2 J;  2KZV A;  3FDY A;  3GEZ A;  1FOY A;  1I3A A;  3I59 A;  2ZJQ F;  2PLY A;  2DYR H;  3BTJ A;  1LDJ A;  1GHC A;  1EKE A;  3S3M A;  4NC8 A;  4XLH A;  3K7A J;  1GLN A;  2XGE A;  2BY0 A;  2EIK H;  1I3Q J;  2F2E A;  2MLG A;  4ON0 A;  5BOX A;  4V2G A;  2AO9 A;  1OFC X;  2GIZ A;  2LKP A;  2ZNZ A;  5EEA A;  3MQ0 A;  3PNV A;  3W2V A;  1Y1V J;  2VBY A;  2X6X A;  4XRS G;  2X6W A;  1TWH J;  1MMG A;  4HV5 A;  3LFK A;  2XSD C;  3D5R C;  1FIA A;  4M6Y A;  4EJU A;  3FIW A;  3ECH A;  2DDA A;  1LEA A;  2IJL A;  4OMZ A;  5E17 F;  3G71 I;  2JPB A;  2UV1 A;  4ZDO A;  2I8D A;  1E3P A;  1FBS A;  1QVU A;  2DFH A;  2XPW A;  2LMD A;  3ASO H;  4OIP F;  5IYC J;  1FYL A;  1FTZ A;  1OKR A;  1T6S A;  3T8R A;  5LLQ A;  4BJ5 C;  2W25 A;  2KKO A;  1MNM C;  4CCM A;  2JWT A;  1DP3 A;  3R0J A;  3QRF F;  3CME I;  2CUF A;  4IPA A;  3TDZ C;  3QPL A;  2HQR A;  1I39 A;  5E3M A;  1GVJ A;  1MBJ A;  3BP8 A;  5ILV A;  2DOF A;  1BW5 A;  1TP4 A;  1WPK A;  3M1C A;  4E7L A;  2A5W A;  1RUO A;  2QSF X;  3DTK A;  3K6G A;  1W7P B;  3NEU A;  4IZZ A;  3DU6 A;  4XK4 A;  2E71 A;  3ZN1 A;  3HIF A;  2XSJ C;  3BR2 A;  1RZ4 A;  5KAF C;  4AYB A;  1NK3 P;  3IH2 A;  5DDG A;  1Y56 A;  5AON A;  1WH7 A;  2HI3 A;  4LG0 B;  2VJ5 A;  3F21 A;  2Y30 A;  2ZXW H;  5IT9 Z;  2OD5 A;  4EQQ A;  3A4C A;  3MKW B;  4JX6 A;  3BRO A;  4KIT B;  4HDV A;  2M4K A;  3W6J B;  2JTV A;  2EIJ H;  3HGG A;  2H6C A;  1BW6 A;  2DBB A;  2OZ6 A;  5GP9 A;  1MSF C;  3QYE A;  2XF5 A;  4CCJ A;  2DK8 A;  1ZRE A;  3Q0V A;  5GAE J;  3Q0U A;  1T95 A;  3BTC A;  4DYQ A;  2ZJ2 A;  1Z7U A;  3BZK A;  1FOW A;  3JAM Z;  3OYI A;  2M9H A;  2XKP A;  4RB2 C;  4F93 B;  4M9X A;  1OR7 A;  4R1H A;  4FAS D;  3G1L A;  2Q0O A;  2JRT A;  2LRE A;  2Z1D A;  4HRI A;  1T0F A;  2KIF A;  4I09 A;  2M8G X;  2HTJ A;  2D2W A;  4BQQ A;  2DMT A;  1QO0 D;  3CF5 F;  1X3Z B;  3ONQ A;  1QU3 A;  2QZ8 A;  2L9N A;  2V1X A;  2UXN A;  3LSK A;  2IAI A;  2Y0S A;  4RAZ A;  4KFC A;  1XB4 A;  3F6O A;  3OMY A;  1YW9 A;  4DNC A;  2ELH A;  5JVT A;  2STW A;  4ZDP A;  3PM1 A;  2WBM A;  3H5A A;  4HNV A;  1YO5 C;  3IL2 A;  3OYD A;  4OIQ F;  1F1Z A;  2Y0S N;  1YIO A;  2P0W A;  1QZE A;  5L3D A;  4ESJ A;  3QPS A;  5B3S H;  1WI3 A;  4L5E A;  5J8C A;  5DCM A;  2IRF G;  2DMN A;  3Q3S A;  1SC7 A;  1R58 A;  3ZQH A;  5ICC A;  3OSG A;  1ACI A;  1ULY A;  3O2P E;  2W48 A;  1JHH A;  4UVB A;  4U0V A;  3I4N J;  3B73 A;  3T1B A;  2VJI A;  1CF7 A;  5LHI A;  2DQL A;  2VXZ A;  1DQU A;  3MEX A;  4KT5 C;  3MD2 A;  5BNG A;  2BHY A;  2R7U A;  1RKT A;  2W4S A;  2AXT C;  1H0M A;  3KZY A;  3H9J A;  4G6D A;  1GV2 A;  3OYN A;  4AIK A;  1TWA J;  1U5T C;  3GBG A;  5F64 A;  1O7L A;  2DW4 A;  2Y75 A;  2I5U A;  5IYD J;  5J6X A;  2KHM A;  2LR8 A;  1LKX A;  1Y8Q B;  2OF7 A;  2LY1 A;  1FWZ A;  3WE2 A;  4A6D A;  1Y8R B;  2Q1Z B;  3OYH A;  3OYK A;  3GWZ A;  3S17 J;  3TP3 A;  3I64 A;  4C9Y A;  1UST A;  2LDU A;  2R4G A;  2R7D A;  3BCA A;  1VF9 A;  1BR2 A;  3EUA A;  4C30 A;  2DPU A;  4JOM A;  2FSW A;  3PSI A;  2K9N A;  5DD8 A;  4ENJ A;  1Y1W J;  2MFZ A;  3EUH C;  2KPM A;  3VEP A;  1XGM A;  3S2D J;  4EM1 A;  4M3G A;  2ZJP F;  1Q1V A;  2K86 A;  1WJE A;  3IAS 2;  1UJ8 A;  3BQZ A;  2A07 F;  2NRA C;  3HUG B;  3BZ6 A;  4UV9 A;  2DCE A;  1WJB A;  2PX9 A;  4GGG A;  2AHQ A;  2EPF A;  2VLA A;  3OL3 A;  3VWB A;  2OQG A;  1HA8 A;  4AVP A;  2K5C A;  3DCF A;  1N77 A;  5HS7 A;  4KIS A;  2MW8 A;  3HOW J;  5IP6 A;  2WB1 A;  3CDI A;  1IN6 A;  2F48 A;  1SD6 A;  5DCF A;  1G3W A;  1K78 B;  1R23 A;  2JSP A;  3CUQ A;  1IF1 A;  2CFO A;  3IKT A;  3PQK A;  5J47 A;  1YTY A;  3OY9 A;  1R4M B;  1D3Y A;  2ZCW A;  2EFW A;  3DTI A;  4G6T B;  4CH7 A;  2KIM A;  2W85 A;  3CLO A;  1DUX C;  3CC7 I;  4BEH A;  2R5Y A;  3U9G A;  2OQR A;  4NC6 A;  2JA7 J;  4UB6 C;  1Y39 A;  5EZH A;  2HDD A;  2BHZ A;  2Y9Y A;  3TW7 A;  1W5T A;  4S0H B;  1BJA A;  1JGS A;  2V4J C;  1QZZ A;  2NVY J;  3MFK A;  3S1R J;  4W1U A;  1PUE E;  5LEJ A;  1W5S A;  1VQL I;  3GTO J;  2HOS A;  4IL6 C;  3K4N A;  2HZT A;  4HF1 A;  5J4V A;  4LB6 B;  1DPU A;  4ETS A;  3PFI A;  4DOZ A;  4A5M A;  2L5Q A;  5D6E A;  1RC9 A;  2P7V B;  3I9V 2;  3RQI A;  3VOD A;  1IRZ A;  1P2F A;  2OJE D;  5LRR A;  1XSD A;  2DA2 A;  3IUO A;  2O7O A;  1R1V A;  1TNS A;  4AUX A;  5IT9 K;  5FLX Z;  4RDU A;  3HYI A;  2JQ7 A;  1XC5 A;  2O3F A;  2HOT A;  1DGW Y;  1Z3X A;  3HOY J;  1QRY A;  3LSG A;  5DM6 F;  2H8R A;  2QQA A;  1WKM A;  1WJA A;  2VBX A;  4CDG A;  3M3Y J;  2IBD A;  4YEL A;  3JRE A;  2WY8 Q;  2XHK A;  5IOY A;  1QGP A;  4Q48 A;  4E7J A;  2ZC2 A;  5HNH A;  3WGG A;  1U2W A;  3S2H J;  1F5T A;  2M34 A;  1FT9 A;  1BBY A;  3LSI A;  2P4W A;  2EB7 A;  3BY6 A;  2HTS A;  3JR9 A;  3TO6 A;  3WTS C;  4NHJ A;  1U8R A;  1Z91 A;  2JA8 J;  2KIQ A;  2FRH A;  4FE4 A;  3L2R A;  3V7S A;  4EJO A;  2ETH A;  3K4B A;  4XSX F;  2K9L A;  3ZQL A;  4X1E A;  4IHY A;  2WWY A;  2IA0 A;  3S93 A;  2XAF A;  3HHG A;  1XMA A;  4M6X A;  4J01 A;  3JRD A;  5EEH A;  3LMM A;  4U7B A;  2J5O A;  1LE8 B;  2E5Z A;  4ZYA A;  2M45 A;  4I7H A;  5D4S A;  4CUG A;  1W36 C;  4RGU A;  3E6D A;  1V5G A;  4BQN A;  2EA4 A;  2ELK A;  4DW6 A;  4Y33 A;  1LFU P;  4CHU A;  3IH4 A;  5JI6 A;  2CQX A;  3V42 A;  1IUY A;  4JP0 A;  5HDN A;  3HBL A;  4IO9 F;  3F8N A;  1SFO J;  2JJ7 A;  3TP0 A;  2R5Z A;  1JGG A;  5K5Q A;  4C3H J;  4FHT A;  3HSR A;  1RI7 A;  1HW2 A;  1A31 A;  1FYK A;  3H0D A;  5FFX A;  4N0B A;  5J4Y A;  2YS9 A;  3RKY A;  5EDN A;  3PUF A;  3BR1 A;  4ENK A;  3C7J A;  2QF7 A;  2QQ8 A;  2Z9O A;  2R92 J;  2MYS A;  1I27 A;  1JHF A;  5LGT A;  2OPT A;  2X6O A;  2LH9 A;  1XG1 A;  4UUS A;  5FGM A;  2PN6 A;  3OYA A;  5H20 A;  2V9V A;  1ZGA A;  3E6C C;  3IAM 2;  3FK6 A;  4BDZ A;  2JZY A;  2M0M A;  4IEJ A;  4E7K A;  4GFB A;  2CV1 A;  1D8J A;  2QBY A;  2F5D A;  2HVS A;  1FJL A;  2QGU A;  1TT5 B;  3FF5 A;  1RNL A;  3IP4 B;  2F5C A;  3C3W A;  2WTE A;  5ICE A;  3RI4 A;  1D0Y A;  1GT0 C;  2IP2 A;  1LDD A;  5H6R A;  3TDU C;  3H1C A;  1FEX A;  2E2I J;  1I5Z A;  4OIN F;  2DT6 A;  3AL0 B;  3ZQQ A;  1VQM I;  3CMY A;  3LQR A;  1HW1 A;  4MLO A;  4HAM A;  4XKB A;  2QEN A;  2TRT A;  2ZKZ A;  4QSH A;  2XGC A;  3BTL A;  3HHH A;  3OOU A;  2BEO A;  3PNT A;  2DOA A;  3A03 A;  5FD5 A;  1FX7 A;  5CLS A;  1HCR A;  2XIG A;  4KN7 X;  1KYW A;  4EJT A;  3BWG A;  1SFU A;  3H5N A;  2GWR A;  5TGT A;  1EH8 A;  1G2H A;  4ITV A;  4OAY A;  4PJJ A;  3G4S I;  3KFW X;  2EIM H;  3WHB A;  3DPU A;  1SFK A;  4B4C A;  3CO6 C;  3GTG J;  2ESH A;  1MBF A;  1BOB A;  3DFG A;  3DBR B;  3V7R A;  3HOZ J;  3ZMS A;  2FQ4 A;  4E7Z A;  6PAX A;  4A3L J;  3K4J A;  4QIW N;  4ENN A;  2IPQ X;  3WU0 A;  2L02 A;  2Y2Z A;  2AQE A;  1TT0 A;  1HW5 A;  3GFL A;  5LHH A;  4Y15 A;  1HQC A;  1T08 B;  3HOX J;  1RRJ A;  4M71 A;  1XX5 A;  2DXI A;  2HXO A;  3I59 B;  2Y31 A;  2Z33 A;  4GO1 A;  2VN2 A;  3HPG A;  2CS3 A;  2RGV A;  4D7N A;  2FF4 A;  2VE8 A;  3JTH A;  2NOJ B;  1IW7 F;  5FB2 A;  4II2 A;  4GDF A;  1A5J A;  4M9S A;  4CYD A;  4AWX B;  1M1E B;  2NS7 A;  2LYC A;  3ZQ7 A;  3A02 A;  2DN0 A;  1X2N A;  4DQ2 A;  1YS7 A;  1YG2 A;  3DEW A;  4AC0 A;  2HQ5 A;  2WV0 A;  2Y9Z A;  1ONV A;  4CZZ A;  4HQE A;  2JT1 A;  1C0W A;  2ELJ A;  2V1N A;  2PMU A;  2XAS A;  3L2Q A;  1EJ9 A;  4HST A;  4WXD A;  1P7J A;  2A6H F;  2NNN A;  3VYS B;  1JUS A;  4AU7 A;  4YFN F;  3GTM J;  2MH9 A;  2ISY A;  1X2M A;  2K3P A;  4LK0 F;  5BQT A;  5M3M J;  1YX5 A;  1ON1 A;  3M7G A;  2EZI A;  3WTY C;  4B8X A;  1O57 A;  4HZF A;  3E6M A;  1X1P A;  1U9N A;  2V9P A;  1R1U A;  2E1O A;  2XGD A;  3E5U A;  4HEA 2;  1LDK B;  3FIS A;  2K9Q A;  2EBI A;  3DKW A;  4I0A A;  1XPX A;  1TC3 C;  1E3O C;  4QLC U;  2XAH A;  4DIQ A;  3V7C A;  1G4D A;  4HLY A;  5CKT A;  4BE0 A;  2HDW A;  3K4C A;  2F5V A;  3GZN B;  3WOD F;  2KDZ A;  4FET A;  4CO8 A;  4DZJ A;  5JR3 A;  2EIN H;  3TL4 X;  1OMI A;  3DLL F;  3UKG A;  4EV0 A;  3OOP A;  3OYL A;  4XN0 A;  3GYH X;  3LQQ A;  2DT7 B;  3QQA A;  2DI3 A;  1V5F A;  3GF2 A;  4U0Y A;  3GTJ J;  5IOZ A;  2L4M A;  3I5U A;  3HTU A;  4F52 A;  1KQ0 A;  2M5W A;  5J3L A;  3GX4 X;  4MFE A;  3PIO F;  5F6F A;  2QQ9 A;  4ZDL A;  1Z67 A;  2EFP A;  3H5R A;  2YX4 A;  2L4A A;  3D5S C;  4CCL A;  1VI0 A;  3JRI A;  2LKS A;  5H6Q A;  3WGI A;  2VI6 A;  3LL7 A;  4YIF A;  4XSZ F;  5FKN A;  3J80 K;  1TLH B;  3HOT A;  1HKT A;  1DDN A;  1HOM A;  4BQA A;  2IA2 A;  2KZG A;  1TNT A;  2QYO A;  2P5L C;  4ENM A;  1YQA A;  3BR0 A;  5AIQ A;  1NG7 A;  4V19 K;  2Y48 A;  2DQR A;  3HKZ A;  1P7I A;  2Q2E A;  2X48 A;  4WCG A;  1RET A;  2CQ7 A;  1R5G A;  4BL0 B;  1K6Y A;  2O8X A;  2IS2 A;  1LUJ B;  3I53 A;  3LFU A;  2VL8 A;  3I55 I;  4UVC A;  2LFB A;  4EJV A;  3PO3 J;  3HSF A;  3SZG A;  4KMU X;  2M7A A;  1YOV B;  2XB5 A;  2G0E A;  3HKZ N;  4F55 A;  2RDP A;  2E1M C;  4M9Z A;  2YR2 A;  3F8F A;  2CJJ A;  2BV6 A;  5FKM A;  2E7W A;  5DCM B;  1R7J A;  2L54 A;  3QAH A;  3G6E I;  1BC8 C;  4P5O A;  2XRN A;  3OV8 A;  4Z2Y A;  2RQQ A;  3J81 Z;  1F9N A;  1CF7 B;  3SJM A;  3CCM I;  4IHT A;  4NUB A;  4FT8 A;  2H6B A;  3C1D A;  3L09 A;  5LHG A;  5M5Y J;  1S3J A;  5HS9 A;  2O8K A;  1K4S A;  5HOD A;  3CJN A;  1RR7 A;  2KP6 A;  3K10 A;  5JHU A;  1V54 H;  4UNO A;  3GLL A;  4A3K J;  3AL0 C;  2M30 A;  3TO7 A;  3I58 A;  1JKO C;  2COM A;  2G7U A;  2EQR A;  1Y0N A;  1UFM A;  3QP5 A;  4MGR A;  2HFH A;  1B72 A;  2E34 A;  1XGN A;  3P5J A;  4N4O B;  2XV4 S;  1BI1 A;  4Z6Y A;  2LOO A;  1MJ9 A;  2GM4 A;  4XOP A;  4KA4 A;  5IYB J;  3BDD A;  3CD6 I;  1IN5 A;  2FQ3 A;  5HLH A;  2EK5 A;  3E3V A;  3LSJ A;  4M72 A;  4FCY A;  4BXF A;  3TBI A;  3ZXS A;  4MIM A;  2X4H A;  3N4M A;  2A6E F;  2W00 A;  4PCQ A;  1H89 C;  4FTH A;  1LVA A;  4XM3 A;  2NNY A;  4HDU A;  3K1N A;  5ILU A;  4PJN A;  3VYU B;  4R79 A;  2LP0 A;  3RYR A;  5K1Y A;  3WG9 A;  4HA8 A;  1D5V A;  1ZEL A;  2WY7 Q;  1WJD A;  2W57 A;  2E5N A;  3KPH A;  3S14 J;  5LGU A;  1BJZ A;  4CZC A;  2C6Y A;  3O6B B;  4YII A;  2QKL B;  4CXF A;  3ZMU A;  3WE3 A;  3BT9 A;  4RGX A;  1YRN A;  4P9U A;  2LLK A;  5KVR A;  2HEO A;  1Z3Y A;  3H92 A;  1R00 A;  3CUQ B;  5F1J A;  4L0Z B;  1O3Q A;  3FHN A;  4GXO A;  4M3D A;  5E18 F;  4BYY A;  3KLO A;  4RGS A;  4J19 A;  4ASN A;  5TRD A;  1ZR4 A;  3HRT A;  1AHD P;  5L3F A;  2PJP A;  1Q1H A;  2PBI A;  1AA7 A;  1HXD A;  4PSX A;  4RMN A;  5E79 C;  3CMM A;  4BEH B;  3ERE D;  2R5Y B;  1IRG A;  5DUI A;  3KIO A;  4KIG A;  1UZC A;  2LKX A;  3RIR A;  3GLX A;  3LAJ A;  1DU0 A;  1VQ5 I;  3KE2 A;  3P9C A;  1GVD A;  1OYW A;  2XAG A;  3KLN A;  4RM2 A;  1ZHF A;  3CUO A;  3P9K A;  1U78 A;  3L7W A;  1U3E M;  4A2U A;  2LD5 A;  4XIC A;  1TWF J;  1UCR A;  3RKW A;  1FBQ A;  2STT A;  2EV0 A;  3HRM A;  3ZGK A;  4XOR A;  3QU3 A;  5DUK A;  2LF7 A;  4G9Y A;  3TMO A;  1F43 A;  2LC2 A;  1E2X A;  2FBI A;  1CQT A;  4G7H F;  2DA5 A;  4JK1 X;  1BR4 A;  2BW3 A;  2XRO A;  3GTP J;  1P6R A;  3GFI A;  1SMY F;  2VOD A;  2RRE A;  3BG9 A;  5B1B H;  1Z7L A;  2B7E A;  2P6T A;  1JT6 A;  3VPR A;  1WGX A;  1MD0 A;  4P55 A;  5EJC A;  1FZP B;  3AFH A;  1IDY A;  4KNY A;  4IHX A;  5CQG A;  5H2F C;  3BG6 A;  3M4O J;  3TOA A;  1ZTR A;  4HX8 A;  1YW7 A;  2K4J A;  3KP5 A;  4A3I J;  1MBK A;  1G8X A;  2D45 A;  3RZO J;  1MKM A;  4I02 A;  2IT0 A;  3FXU A;  5EF6 A;  1FPQ A;  3HM5 A;  3TOB A;  3JRF A;  2K40 A;  1WJ5 A;  4IRH A;  1H8A C;  1K6O A;  2DFI A;  3NRV A;  2MC4 A;  4GYI A;  2YSR A;  3J7A Y;  4XL9 A;  2O6G E;  1UB9 A;  2LBF A;  1GDT A;  3A2K A;  2FNA A;  1S7A A;  3FHZ A;  2H27 A;  2ZO4 A;  3J7Y J;  2M4G A;  1B8I A;  3F72 A;  2X6Y A;  2HQN A;  1UMQ A;  2NS8 A;  4LFU A;  3OYM A;  3JSP A;  2AXL A;  2DFE A;  3WGH A;  4A93 J;  4E7H A;  4RGR A;  3K1M A;  2DJI A;  1XGO A;  2VXD A;  3CCE I;  3UNG C;  4XNF A;  2R5Z B;  2Z5U A;  3R0A A;  4BNC A;  3KP3 A;  1R6R A;  4BXU A;  3J81 K;  3FXQ A;  1ZK8 A;  5EEG A;  5FLV A;  5DEQ A;  5IY5 H;  1PDN C;  2IA1 A;  3C2B A;  4G8X A;  3CJR B;  2QEX I;  2LF8 A;  2XF6 A;  4K2E A;  3BOQ A;  1ZRF A;  1V5E A;  3NAU A;  2JPC A;  4UUS B;  4WXH A;  2CYY A;  3K4L A;  3LST A;  1A6Q A;  1SD4 A;  4MQ9 F;  3ESW B;  5L3E A;  4MQV A;  1D1A A;  2W84 A;  4EVI A;  4LLL A;  2QBY B;  3M8F A;  4M3F A;  2OZU A;  1ZLK A;  4UVA A;  2ZXJ A;  5HDG A;  1DP7 P;  1V3F A;  3CCV I;  5HS8 A;  3WG7 H;  4EM0 B;  2PI0 A;  3ZQF A;  1E0E A;  2EV5 A;  2K4B A;  4RA2 A;  5TIS C;  1NH3 A;  5D5X B;  1QBJ A;  2HKX A;  5CYV A;  4G7Z F;  2Y0M A;  1LPQ A;  4A0Y A;  5KK1 A;  2JN6 A;  3SFZ A;  1S7E A;  3ZP5 A;  1IN4 A;  2HOE A;  1Z21 A;  3ZCO A;  3FXL A;  2LY2 A;  1USS A;  1K7A A;  4L5I A;  1R4N B;  4LOC A;  4P1W A;  5E1X A;  3H3V K;  2A68 F;  4N9H A;  3NWS A;  1SAX A;  3NAR A;  2KDO A;  3VYR B;  4I2O A;  3V8J A;  3HC7 A;  1XD7 A;  1A6I A;  3ML6 A;  2DFF A;  4N9I A;  1W36 D;  5LEK A;  3BR3 A;  2A05 A;  3Q5F A;  2NVX J;  2GBY A;  1IDZ A;  2BY1 A;  4HF2 A;  5HNF A;  3HOV J;  4B1R A;  5J1Y A;  4MTD A;  2VBZ A;  4MTE A;  1ZN2 A;  1W1W E;  2OV7 A;  3HPH A;  3PJR A;  2DA4 A;  2KRC A;  2R7Z J;  3H9Q A;  4PFP A;  4XR6 A;  2VB6 A;  3EUH A;  3PUB A;  2IS4 A;  1G3S A;  5F04 A;  4S05 A;  1G59 A;  1F4K A;  1B1B A;  2X85 A;  1I6H J;  2ZFW A;  3UR3 C;  5DV5 A;  4ANJ A;  4OWR B;  1OJL A;  1FLI A;  1PYV A;  2QKM B;  2FXA A;  4XLE A;  3E5Q A;  4PGG A;  5FKO A;  2JMW A;  3H3Z A;  1ORK A;  2HPI A;  2RKH A;  2FMY A;  2L9V A;  3KEQ A;  1NG6 A;  2PMH A;  1Y0U A;  1T33 A;  3S1Q J;  4HNT A;  2CSO A;  5C4X J;  3Q9S A;  4HPQ A;  1FP1 D;  4GCV A;  3K4K A;  5D5V B;  2R7F A;  1BA5 A;  1D0X A;  2XAJ A;  1VQ9 I;  5IP7 J;  4KYW A;  1EF4 A;  2CU7 A;  2MGQ A;  2V79 A;  3DEU A;  5CVR A;  2R7Q A;  3EPZ A;  4PJ0 C;  5JVG F;  4GRI A;  3TW6 A;  3W2A A;  3ABT A;  3F9K A;  2HU9 A;  3EDP A;  1MH3 A;  4CGZ A;  2ACJ A;  3O3K A;  4IVN A;  1HKQ A;  1T39 A;  2CW8 A;  3MKL A;  3SEZ A;  5ILS A;  2KRH A;  2B63 J;  3OIQ A;  2EZL A;  1FSH A;  4U88 A;  1F36 A;  3TO9 A;  2MA3 A;  3CES A;  1WFX A;  2OU2 A;  4A12 A;  1UHM A;  1SFX A;  3B6A A;  4L5J A;  4PJM A;  3Q9V A;  1LFP A;  2K9S A;  3LSP A;  1MJA A;  1SMT A;  2XB0 X;  3CC2 I;  1DGR M;  5DTD A;  3ERM A;  1PUF A;  1J2X A;  4LLN A;  2PFB A;  4QPQ A;  1YLF A;  2OC6 A;  3RZD J;  1Z9C A;  2R7S A;  3I0T A;  4HQM A;  4ZZL A;  4BXX J;  3JAM K;  2WV1 A;  4W97 A;  1Z0X A;  5F1R A;  3CP8 A;  1QVT A;  3DWL E;  4UXN A;  3TKY A;  5JFR A;  1WJC A;  2VQC A;  1FY7 A;  3KEY A;  3BG5 A;  2O5R A;  2EFO A;  1MGT A;  1BIB A;  2K27 A;  4XID A;  1LVK A;  2KT0 A;  3MVP A;  2GQQ A;  5CVU A;  5E3O A;  3PFY A;  5KAI C;  3T5X A;  1QNT A;  3BLY A;  2M3A A;  1XN7 A;  4WWC A;  4D9J A;  1B6A A;  3HTS B;  3M1E A;  3JRH A;  1VTN C;  4M6V A;  3VSK A;  1WQ2 A;  2KFD A;  5CJ9 A;  3WHC A;  5EGO B;  2DA7 A;  1VQ6 I;  1P4A A;  1P4X A;  5EG0 A;  2IGM A;  1RPW A;  2CG4 A;  3ECO A;  1G3T A;  4BGD A;  1MBG A;  2Q2E B;  3CJT B;  1SVL A;  4UHT A;  5TJJ A;  1YW8 A;  4OAZ A;  4YFX F;  1J75 A;  2GXB A;  4BU2 A;  1LFB A;  1IV8 A;  1WZ2 A;  3IH3 A;  5AIP A;  2R7O A;  3L00 A;  2EFQ A;  4JYK A;  4M73 A;  5B1A H;  1WWX A;  2YPR A;  1YJW I;  1J59 A;  2CFX A;  2D5V A;  2DAO A;  2MC3 A;  1FC3 A;  3QYB A;  2E60 A;  3CCY A;  3SZT A;  2KIS A;  5IP9 J;  1ZLJ A;  5IT3 A;  4OU0 A;  3ZRG A;  3BQY A;  1YYV A;  3O8H A;  5CQE A;  5J8F A;  3WTU C;  1XDU A;  2N8G A;  3E0J B;  4A3C J;  2ADU A;  3L9F A;  1VFC A;  1S7O A;  3CJQ B;  1J9I A;  3KX2 A;  2DLL A;  4RAY A;  4IKF A;  3W6K B;  1ETQ A;  1P92 A;  1XGS A;  3K0L A;  2L7F P;  2G9W A;  3S16 J;  2K85 A;  2OBP A;  5E8I A;  3OYJ A;  2ZBK A;  4I01 A;  4L9J A;  1VQO I;  1WH5 A;  3S3O A;  4LB5 A;  1PP8 F;  4RAF A;  1B72 B;  5FJ8 J;  1ETK A;  3VB2 A;  5ED4 A;  2J5P A;  2V7F A;  2QUF A;  4A3E J;  1KA8 A;  2R93 J;  2B9S A;  1E3H A;  3BG3 A;  1MH4 A;  1IXS B;  3HB9 A;  3I3L A;  2FOW A;  1UEL B;  4NDL A;  1WHU A;  4XMY A;  3LWF A;  2BOL A;  2L9R A;  1HC8 A;  1JT0 A;  1OCO H;  2XF7 A;  5GPA A;  4KIF A;  4E4H A;  3LSH A;  5B66 C;  2FBH A;  2DTR A;  2HYG D;  4AIH A;  3OYF A;  2W7N A;  3IWF A;  3Q0W A;  2GOM A;  3OR1 C;  3HL2 A;  2PJR A;  2Z16 A;  1SVM A;  2BXZ A;  3CLQ A;  4CCN A;  4PGH A;  1ZR2 A;  1VQK I;  3A0B C;  5M5X J;  4WK8 F;  2DO7 A;  3RTR A;  2A61 A;  2P81 A;  3QPT A;  4UUT A;  2P5K A;  3OSF A;  2LRD A;  4O3M A;  1WCM J;  2X0L A;  1JUP A;  1YRN B;  1HST A;  1WI9 A;  2YUS A;  3R60 A;  4PK4 A;  1YIT I;  2ZSI B;  4IF4 A;  3DKX A;  1J0R A;  1OCZ H;  4A3D J;  2FX0 A;  3QOE A;  2BXY A;  1KU7 A;  1LEB A;  4ABZ A;  3KZZ A;  3C18 A;  3IWZ A;  3ABL H;  2HYJ A;  4XRF A;  4YRV A;  1IO2 A;  2BY2 A;  3E6B A;  4RS8 A;  1R36 A;  5FLX K;  4A3M J;  3BZC A;  4BHC A;  3L2V A;  4FX4 A;  2ESN A;  1ZG5 A;  3GZ5 A;  2DA6 A;  1D1C A;  3KYC B;  3ZMT A;  3S8P A;  1SD5 A;  1YIJ I;  1OQY A;  3BCB A;  1HLV A;  2ECB A;  1R22 A;  4BAY A;  5E20 A;  4XBF A;  3SDB A;  1QHH D;  3F8C A;  3LOC A;  2HOA A;  1ZGW A;  3DF8 A;  4B3X A;  3L2W A;  1UHS A;  5FLM J;  1B4A A;  2VQH A;  1IG7 A;  2BW3 B;  3ZQI A;  3JRA A;  1JKP C;  4B43 A;  4Y7N J;  1X1D A;  3E97 A;  3I4P A;  4O5V A;  3FK7 A;  1W4M A;  3GCM A;  4TV7 A;  1KQ9 A;  3AG1 H;  3T0Y A;  4ZC3 A;  1CGP A;  4M3E A;  4PZJ A;  4BHB A;  2WAQ N;  4ZJZ A;  2XDV A;  2BY3 A;  3PQJ A;  1H88 C;  2HVQ A;  4KIC A;  2WAE A;  3FMR A;  2CO5 A;  2CUZ A;  1IJW C;  3W6V A;  2IW5 A;  1B59 A;  3S3N A;  5FD6 A;  3AG3 H;  1ODD A;  3TGN A;  4ZH4 F;  1EA3 A;  1V55 H;  2EZK A;  3TQN A;  3W3C A;  1U8B A;  3DKY A;  2DA3 A;  3GFM A;  4XOT A;  2UWM A;  2VKD A;  1Z77 A;  4U87 A;  2M1B A;  2LBF B;  4KN4 X;  3F3X A;  5BPI A;  2PMZ N;  2DOE A;  4CYC A;  1FP2 A;  2A69 F;  1B8I B;  3BJA A;  1W0T A;  3MKZ A;  2F5F A;  5A2Q Z;  5HVQ C;  1AWC A;  2V9K A;  1Y6I A;  1Z1D A;  2X1D A;  3L2C A;  3GTK J;  5LRS A;  1L0O C;  3VFZ A;  2L0K A;  9ANT A;  1AOY A;  2MSY A;  1P4W A;  4EM2 A;  5FRO A;  1T98 A;  3FXM A;  1UAA A;  3B6C A;  2M2E A;  2R0Q C;  5HLI A;  4BJ6 C;  1FIP A;  1UG2 A;  3HSE A;  4PUS A;  1BL0 A;  1ETV A;  1IXR C;  2W1O A;  5GAG J;  1Z6R A;  3KP7 A;  2XPU A;  3LA2 A;  4FQG A;  2DA1 A;  2X51 A;  3W2W A;  4IJA A;  4XKC A;  4CCO A;  3WTW C;  1X58 A;  2K02 A;  3CCQ I;  2JRM A;  3JRC A;  3WU2 C;  3H35 A;  4L9V A;  1K61 A;  3IKV A;  3J7A O;  3CTA A;  4DGW B;  1D5Y A;  1RUN A;  5FO5 A;  3BR5 A;  5J1R A;  5FKL A;  4U0W A;  2JA5 J;  3FBN B;  2QCO A;  1QZY A;  1WVR A;  3OIO A;  2O03 A;  1IN7 A;  5CVI A;  4XLC A;  4CIC A;  2ZXI A;  4YFK F;  3A0H C;  3PSF A;  3H36 A;  3S15 J;  2KJC A;  1T2K A;  2VQL A;  2DOD A;  3O8G A;  4F7Z A;  4GYG A;  1L3L A;  2VKH A;  3KET A;  3GXO A;  1QQI A;  4H4K C;  1FBU A;  4KT6 A;  3U21 A;  4HSR A;  2V26 A;  4XKV A;  2JSC A;  3JW4 A;  5K7Z A;  2VJJ A;  4L18 B;  1JTX A;  1OCR H;  3GFJ A;  2M87 A;  3QPH A;  2O9L A;  1VQ4 I;  3FBI B;  4XON A;  3VOE A;  2O0Y A;  1ZYR F;  2KMU A;  1R5I D;  3MAJ A;  4KMF A;  4EGY A;  1I50 J;  3K2Z A;  1NTC A;  3FM5 A;  4FIS A;  4DBR A;  2Q8K A;  2L01 A;  1N25 A;  4N4N B;  1ENH A;  4C2M J;  4C3I J;  1MBH A;  4BAC A;  3BC8 A;  4ESF A;  5C3E J;  1G3Y A;  2W24 A;  1J09 A;  4L9T A;  4ZYG A;  3R6S A;  1PVE A;  3FKI J;  2VJ4 A;  4BHP A;  1I1S A;  4ZYE A;  4II3 A;  3GVA A;  5DM7 F;  1AKH A;  2V1U A;  1KYZ A;  4WF2 A;  1YFH A;  1SFE A;  3V8L A;  3A1Y A;  3SHF A;  1MDM A;  1BIA A;  2CW7 A;  4XLP F;  2ZME A;  4G7O F;  1ZRD A;  1D8K A;  1ITY A;  2WA0 A;  1O4X A;  4LGW A;  3L2U A;  1ZG1 A;  2WAF A;  3HG9 A;  1AU7 A;  2XGX A;  4DYC A;  4HG2 A;  4LIU A;  1TWG J;  1FSE A;  2P8T A;  5EYR A;  1XMX A;  4AM3 A;  1KU2 A;  5D6F A;  3ZMZ A;  2GA1 A;  3COA C;  2EZH A;  3QOD A;  1ETX A;  3EUK L;  1VND A;  2IGN A;  3R61 A;  4OMY A;  4HOB A;  1S29 A;  1UG0 A;  3I71 A;  3K70 C;  4L0Y B;  3M9A A;  1EH7 A;  1KU9 A;  2RNG A;  4XQF A;  1VQ8 I;  2AQF A;  3LSM A;  2B0L A;  1QA6 A;  2DU9 A;  2CUE A;  3CC4 I;  2VON A;  4I99 C;  1PJR A;  2FNP A;  1OIS A;  5KCM A;  2PQ8 A;  1OPC A;  2DTZ A;  3HOS A;  3AG2 H;  4BE2 A;  1IXC A;  3DPT A;  5D8L B;  5J1U A;  2W82 A;  1FTT A;  2VKV A;  2NVQ J;  2YX7 A;  2ZSH B;  4NC7 A;  5B5E C;  2K7L A;  1MMS A;  2NVU B;  3RKX A;  2JUG A;  3OS1 A;  1R49 A;  4AVZ A;  2MLK A;  3V4G A;  2CW0 F;  2ZXH A;  1PUF B;  2XPV A;  2LVS A;  4A6E A;  5E1W A;  4D5C A;  1I6X A;  2LK2 A;  1YHQ I;  2HPM A;  2DJN A;  4FE7 A;  4NQW A;  3CCS I;  3WTT C;  1TWC J;  4Y3O A;  2F4M B;  1VQN I;  3ABU A;  2KL4 A;  4CCK A;  1IRX A;  2EH3 A;  3DP7 A;  1XCB A;  2MD0 A;  3A01 A;  1BI0 A;  1A04 A;  5LFA A;  1P9Q C;  5HLT A;  4I98 B;  2ECC A;  2QVO A;  1HF0 A;  2IS1 A;  3DBL B;  4Q5S F;  3D5L A;  5A2Q K;  1MMN A;  1KGS A;  1RES A;  2HDC A;  4BY7 J;  4A3F J;  4AYB N;  3F0C A;  2HZD A;  1MJB A;  1OR7 C;  1IAW A;  3MZH A;  3LNQ A;  1FOX A;  1NHA A;  4MNU A;  3M8J A;  1EH6 A;  1MMA A;  1SAU A;  3CDH A;  1T0F C;  3DU5 A;  5M3F J;  2VOO A;  4Q4Z F;  2XVC A;  1ETO A;  2IVM A;  2L7Z A;  3HDD A;  5EG0 B;  3FMQ A;  4ZYD A;  3FXJ A;  2VBW A;  3S1N J;  2R7R A;  2JUC A;  1FOK A;  2R7X A;  1STZ A;  2H8W A;  2EA2 A;  3CDL A;  1DU6 A;  4MEX F;  4XLN F;  3FM3 A;  1JJ8 C;  2P7C B;  4HNU A;  4G6Q A;  5HDK A;  3KCC A;  3U1D A;  3ABK H;  1D0Z A;  1ETW A;  3JRB A;  1LQ1 A;  2BZT A;  2DPD A;  3N97 A;  1IN8 A;  4JX4 A;  3CMA I;  4CSW A;  4YIR X;  3QWL A;  3H3U A;  5F0H A;  4LMY A;  4ZYH A;  1TQM A;  3DLA A;  5ICG A;  3GTL J;  3ZN0 A;  3SFI A;  2RVC A;  2ZNY A;  1W7P D;  4LJZ F;  3IHU A;  5F08 A;  5CVJ A;  1VQP I;  2JA6 J;  1B9N A;  3F23 A;  1R71 A;  3K9T A;  3RJP A;  2XC7 A;  2FEZ A;  1XSV A;  3LA7 A;  5L3C A;  4NNJ A;  1TQI A;  3R4K A;  2FE3 A;  2CUJ A;  4HBL A;  2VC1 A;  2H09 A;  2GXG A;  2ICW G;  2DK5 A;  5D4R A;  1S6L A;  2QM3 A;  1S5L C;  3T8T A;  3JSO A;  2H1K A;  4DBQ A;  1ZAR A;  1X1B A;  2OA4 A;  2D1H A;  1SVO A;  5FFZ A;  4BY1 J;  2NOG A;  4B09 A;  1PP7 U;  2HKO A;  4J00 A;  3OR2 C;  5LD2 C;  4X6A J;  3E7L A;  1U5T A;  4U7D A;  2UZK A;  1QPM A;  5K7H A;  1G6N A;  4XKW A;  2X1E A;  2QWW A;  3RDI A;  2E2J J;  4IRI A;  1MMD A;  2L7M P;  3CP2 A;  4C3J J;  2LSO A;  3DTE A;  4UUV A;  4UB8 C;  2CH0 A;  5FKK A;  4I76 A;  2IGK A;  1ZKG A;  2H94 A;  5DYM A;  5J40 A;  3BJO A;  1HBX G;  3C2H A;  4WX9 A;  3KP2 A;  4XRM A;  1Z6T A;  4F92 B;  5K5O A;  2P6S A;  2PJR B;  2HVR A;  5JLX A;  4IXA A;  5IPA A;  2RN7 A;  4P96 A;  4G12 A;  2BE5 F;  2L2O A;  3MMY B;  2LTP A;  4QWQ A;  4HX4 A;  1EV7 A;  1R5H A;  1OCP A;  1X1A A;  2XKO A;  4LIV A;  4RB1 A;  2CGP A;  3OIP A;  4IHV A;  2JK3 A;  3CUQ C;  3RKQ A;  1K4T A;  1ON2 A;  3M07 A;  1JUM A;  4WXC A;  4EGZ A;  1REP C;  2H1L A;  2XRL A;  2GLO A;  4R8H A;  4UV8 A;  1I1G A;  2NAZ A;  4E7S A;  4IOC F;  3IC7 A;  2PG4 A;  4PFO A;  5E8G A;  3SEQ A;  4RBO A;  2HQA A;  1MNE A;  3LSR A;  2LG4 A;  1RR8 C;  3E5X A;  1OCT C;  4L9N A;  3WU1 B;  2GZW A;  1S9H A;  2VT3 A;  2CQK A;  2JA2 A;  2L3D A;  2WB1 N;  3HGY A;  3DQV C;  3TED A;  4MFD A;  2F4O B;  2ME6 A;  2R7W A;  1S72 I;  3DPL C;  4HX7 A;  1MND A;  3FXR A;  1LNW A;  1BN5 A;  2Z2S B;  4QTR A;  3ZPL A;  2R7T A;  1OCC H;  4LD5 A;  1ZQ3 P;  4YG2 F;  4RB3 C;  4IQ4 A;  4QPO A;  2OTL I;  3X2Q H;  3ELK A;  1TTY A;  1V4R A;  1Z05 A;  2P5V A;  1GXQ A;  3G73 A;  4D1Q A;  1NK2 P;  2RC4 A;  4YEJ A;  4P9F A;  1T38 A;  4IRG A;  1LB2 A;  3BR6 A;  1E17 A;  3HZJ A;  4RB0 A;  2EWN A;  3SYT A;  2F6C A;  3K2A A;  1W7P A;  3GUD A;  3L1P A;  3PNY A;  3GZ6 A;  3PIP F;  3D0S A;  4MHG A;  1RIO H;  3BG7 A;  2Z3Y A;  4X0G A;  3AKZ A;  4BJT A;  3EQL F;  2RAE A;  5E3N A;  1TBX A;  3P9I A;  4LG0 A;  5CPR B;  1JXS A;  3OWT A;  4BBR J;  2MD5 A;  3I54 A;  3OS0 A;  2HWV A;  4BKX A;  3CF2 A;  3K1P A;  3QP6 A;  1HSJ A;  5KHD A;  1MW7 A;  4B47 A;  3KP6 A;  3BPX A;  2F4I A;  3IRR A;  1LJ9 A;  1SD7 A;  3WTV C;  3VYT B;  3RPQ A;  3P7N A;  1VZ0 A;  4KDP A;  3QU6 A;  2OTJ I;  3GO5 A;  2KIU A;  4LG3 A;  4CYC B;  2X9D A;  5F27 A;  1X3W B;  1TZL A;  2FML A;  3C2G A;  2CV2 A;  2CWE A;  4D5F A;  3KYL A;  1IV6 A;  3J7Z I;  2ID6 A;  2BGC A;  3EET A;  1XSX A;  2BBY A;  3MKY B;  1ZRC A;  1N78 A;  3SQN A;  3CO7 C;  4BBS J;  4A3G J;  1WSU A;  1JKR C;  4MO7 A;  1ETY A;  4C2U A;  2LNB A;  3BJ6 A;  5EZG A;  1KON A;  2A3S A;  4C2T A;  4RM3 A;  1BI3 A;  3DEE A;  3D1N I;  3GW2 A;  3ZMD A;  1T56 A;  3ULQ B;  3RPU D; 
#chains in the Genus database with same CATH homology
 2KRF A;  4NB5 A;  2FU4 A;  3J80 Z;  4PDK A;  2AS5 F;  2RQP A;  5K5R A;  2VE9 A;  3FWE A;  4FX0 A;  5HOO A;  1IZ1 A;  4HV6 A;  3FX3 A;  2F5E A;  2G7H A;  1XCV A;  5ERI A;  2TDX A;  2E1N A;  4I0B A;  4A5N A;  3KEO A;  1OYI A;  4LLG F;  1KQ8 A;  5LGN A;  3LA3 A;  4A0Z A;  3F8M A;  2OAZ A;  2XUB A;  4OIO F;  1XDS A;  1H9T A;  1FYM A;  2NS0 A;  2R3S A;  2BYV E;  1BI2 A;  2RNJ A;  5E1Z B;  3EYY A;  1TW2 A;  2KJB A;  2VC0 A;  3MCZ A;  3F8B A;  3HUG A;  1X3U A;  1MDM B;  4G94 A;  1DPR A;  3K69 A;  4OOI A;  2ZME B;  3U2R A;  4MEY F;  1TQP A;  4KUM A;  2HYF A;  2EV6 A;  5D8K B;  1J5Y A;  3SZP A;  1K78 A;  3NQO A;  2EJR A;  3BPV A;  3SXY A;  3EYI A;  4HW0 A;  1JE8 A;  1ZAO A;  2A5Y B;  5L3B A;  2RV8 A;  4D0P A;  5BMZ A;  3F22 A;  1O3T A;  3REO A;  1U6G A;  3KP4 A;  3MZY A;  3RYP A;  2E7X A;  3HRU A;  1KU3 A;  1IRF A;  2NYX A;  2XAQ A;  2ISZ A;  3IRQ A;  2YU3 A;  1WRJ A;  1XMK A;  1HKS A;  2QQB A;  2GAU A;  2EFN A;  4EJW A;  4LK1 F;  2Z99 A;  4AIJ A;  2MH2 A;  5BS6 A;  3RPU A;  4HYE A;  1R1T A;  4HLX A;  5BPD A;  4S04 A;  1TW3 A;  3MWM A;  4O6J A;  2HS5 A;  1O7F A;  5HLG A;  4Y17 A;  3HRS A;  1ZG3 A;  1H9G A;  1GXP A;  3ROU A;  2D1V A;  1ZH5 A;  3QOP A;  1BC7 C;  4AD9 A;  1ZGJ A;  2QLZ A;  2UXX A;  2E1C A;  2V6C A;  4HF0 A;  4JQF A;  3ISP A;  2GA2 A;  3AAF A;  1OYY A;  2GIV A;  4ZZD A;  4A0X A;  1MZB A;  2FBK A;  1S8N A;  3DV8 A;  4EMS A;  4ESB A;  3B02 A;  2DT5 A;  5ICF A;  5CVV A;  1BOA A;  1FNN A;  4JBA A;  4KIB A;  5D5W B;  3WTZ A;  5L3G A;  3V8K A;  1K79 A;  3S2W A;  2HGC A;  5DD4 A;  4Y13 A;  3FZV A;  1UHW A;  4BH9 A;  1U5T B;  4E70 A;  3F6V A;  2M8E A;  1B9M A;  3DXJ F;  4H0E A;  2O61 A;  1YS6 A;  1O3R A;  2VOP A;  4IHS A;  5D5U B;  3M8E A;  2HR3 A;  4M74 A;  3G3Z A;  4OIR F;  1J7K A;  2FA5 A;  3ZMV A;  2WC2 A;  2PEX A;  1O3S A;  2V1D A;  1BM9 A;  2MBF A;  5LBQ A;  2VT2 A;  3JTG A;  3FMS A;  3WTX C;  3LAP A;  4Q47 A;  2FOK A;  3GEZ A;  3I59 A;  2PLY A;  1LDJ A;  1GHC A;  4ON0 A;  2MLG A;  2F2E A;  5BOX A;  2LKP A;  2ZNZ A;  3MQ0 A;  2VBY A;  4HV5 A;  3LFK A;  4M6Y A;  4EJU A;  3ECH A;  4OMZ A;  1LEA A;  2IJL A;  5E17 F;  2JPB A;  1FBS A;  4OIP F;  1FYL A;  1OKR A;  1T6S A;  3T8R A;  5LLQ A;  2W25 A;  2KKO A;  3R0J A;  3QRF F;  4IPA A;  3TDZ C;  2HQR A;  1GVJ A;  3BP8 A;  5ILV A;  1RUO A;  3NEU A;  1W7P B;  3ZN1 A;  3HIF A;  1RZ4 A;  5DDG A;  5AON A;  4LG0 B;  3F21 A;  5IT9 Z;  2OD5 A;  4EQQ A;  3BRO A;  4HDV A;  3W6J B;  2JTV A;  2H6C A;  2DBB A;  2OZ6 A;  2DK8 A;  1ZRE A;  2ZJ2 A;  1Z7U A;  3JAM Z;  2XKP A;  4RB2 C;  4M9X A;  1OR7 A;  4R1H A;  2Q0O A;  2JRT A;  1T0F A;  2KIF A;  4I09 A;  2HTJ A;  2D2W A;  1QO0 D;  2QZ8 A;  2V1X A;  2UXN A;  4RAZ A;  4KFC A;  1XB4 A;  3F6O A;  1YW9 A;  4DNC A;  2ELH A;  5JVT A;  2STW A;  1YO5 C;  3IL2 A;  4OIQ F;  1F1Z A;  1YIO A;  5L3D A;  4ESJ A;  5J8C A;  5DCM A;  2IRF G;  1R58 A;  5ICC A;  1ULY A;  3O2P E;  1JHH A;  4UVB A;  4U0V A;  3B73 A;  3T1B A;  1CF7 A;  5LHI A;  2DQL A;  2VXZ A;  3MEX A;  4KT5 C;  1H0M A;  3KZY A;  4G6D A;  4AIK A;  1U5T C;  5F64 A;  1O7L A;  2DW4 A;  2Y75 A;  5J6X A;  1FWZ A;  3WE2 A;  4A6D A;  3GWZ A;  3I64 A;  1UST A;  2LDU A;  2R7D A;  2DPU A;  2FSW A;  5DD8 A;  4ENJ A;  3VEP A;  1XGM A;  4EM1 A;  2K86 A;  2A07 F;  2NRA C;  3BZ6 A;  4UV9 A;  4GGG A;  2OQG A;  4AVP A;  5HS7 A;  1IN6 A;  1SD6 A;  5DCF A;  1G3W A;  1K78 B;  1R23 A;  3CUQ A;  1IF1 A;  3IKT A;  3PQK A;  1YTY A;  1D3Y A;  2ZCW A;  2EFW A;  2KIM A;  2W85 A;  3CLO A;  1DUX C;  3U9G A;  2OQR A;  1W5T A;  1BJA A;  1JGS A;  1QZZ A;  3MFK A;  1PUE E;  5LEJ A;  1W5S A;  2HZT A;  4HF1 A;  4LB6 B;  1DPU A;  4ETS A;  3PFI A;  4A5M A;  5D6E A;  2P7V B;  3VOD A;  1P2F A;  5LRR A;  1XSD A;  1R1V A;  1TNS A;  5IT9 K;  5FLX Z;  3HYI A;  2O3F A;  2QQA A;  1WKM A;  2VBX A;  4CDG A;  2XHK A;  1QGP A;  4Q48 A;  3WGG A;  1U2W A;  1F5T A;  1FT9 A;  1BBY A;  2P4W A;  2EB7 A;  3BY6 A;  2HTS A;  3TO6 A;  3WTS C;  4NHJ A;  1U8R A;  1Z91 A;  2FRH A;  3V7S A;  4EJO A;  2ETH A;  4XSX F;  2WWY A;  2IA0 A;  2XAF A;  3HHG A;  1XMA A;  4M6X A;  5EEH A;  4U7B A;  2J5O A;  5D4S A;  2M45 A;  4I7H A;  4RGU A;  3E6D A;  2EA4 A;  4CHU A;  5JI6 A;  1IUY A;  5HDN A;  3F8N A;  5K5Q A;  4FHT A;  3HSR A;  1RI7 A;  1HW2 A;  1FYK A;  5FFX A;  4N0B A;  3RKY A;  4ENK A;  3C7J A;  2Z9O A;  5LGT A;  1I27 A;  1JHF A;  5FGM A;  2PN6 A;  5H20 A;  2V9V A;  1ZGA A;  3E6C C;  2JZY A;  1D8J A;  2QBY A;  2F5D A;  3FF5 A;  1RNL A;  2F5C A;  3C3W A;  2WTE A;  5ICE A;  3RI4 A;  2IP2 A;  1LDD A;  5H6R A;  3TDU C;  1I5Z A;  4OIN F;  3LQR A;  1HW1 A;  4HAM A;  2QEN A;  2ZKZ A;  3HHH A;  2BEO A;  5FD5 A;  1FX7 A;  5CLS A;  2XIG A;  4KN7 X;  1KYW A;  4EJT A;  3BWG A;  1SFU A;  2GWR A;  1EH8 A;  3KFW X;  3CO6 C;  2ESH A;  3DFG A;  3V7R A;  3ZMS A;  6PAX A;  4ENN A;  2IPQ X;  3WU0 A;  2L02 A;  1HW5 A;  3GFL A;  5LHH A;  4Y15 A;  1HQC A;  4M71 A;  3I59 B;  2Z33 A;  4GO1 A;  2VN2 A;  2RGV A;  2FF4 A;  2VE8 A;  3JTH A;  1IW7 F;  5FB2 A;  4M9S A;  4CYD A;  4AWX B;  3ZQ7 A;  4DQ2 A;  1YS7 A;  1YG2 A;  2WV0 A;  1ONV A;  4CZZ A;  4HQE A;  2JT1 A;  1C0W A;  2PMU A;  2XAS A;  4WXD A;  2A6H F;  2NNN A;  4YFN F;  2MH9 A;  2ISY A;  4LK0 F;  5BQT A;  1ON1 A;  3M7G A;  3WTY C;  4B8X A;  1O57 A;  4HZF A;  3E6M A;  1R1U A;  3E5U A;  1LDK B;  3DKW A;  4I0A A;  4QLC U;  2XAH A;  3V7C A;  1G4D A;  4HLY A;  3WOD F;  4CO8 A;  5JR3 A;  1OMI A;  4EV0 A;  3OOP A;  3GYH X;  3LQQ A;  2DI3 A;  3GF2 A;  4U0Y A;  2L4M A;  3I5U A;  3HTU A;  1KQ0 A;  2M5W A;  3GX4 X;  5F6F A;  2QQ9 A;  2EFP A;  2YX4 A;  2L4A A;  5H6Q A;  3WGI A;  4YIF A;  4XSZ F;  3J80 K;  1TLH B;  3HOT A;  1HKT A;  1DDN A;  4BQA A;  2IA2 A;  1TNT A;  2QYO A;  2P5L C;  4ENM A;  1YQA A;  5AIQ A;  2Y48 A;  2DQR A;  2Q2E A;  4WCG A;  1R5G A;  2O8X A;  3I53 A;  4UVC A;  4EJV A;  3HSF A;  4KMU X;  2RDP A;  4M9Z A;  2YR2 A;  3F8F A;  2BV6 A;  2E7W A;  5DCM B;  1R7J A;  2L54 A;  3QAH A;  1BC8 C;  4P5O A;  2XRN A;  3OV8 A;  4Z2Y A;  3J81 Z;  1CF7 B;  1F9N A;  4IHT A;  4FT8 A;  2H6B A;  3C1D A;  3L09 A;  5LHG A;  1S3J A;  5HS9 A;  3CJN A;  5JHU A;  4UNO A;  2M30 A;  3TO7 A;  3I58 A;  2COM A;  2G7U A;  1UFM A;  3QP5 A;  4MGR A;  2HFH A;  1XGN A;  2XV4 S;  1BI1 A;  1MJ9 A;  4KA4 A;  3BDD A;  1IN5 A;  2FQ3 A;  5HLH A;  2EK5 A;  3E3V A;  4M72 A;  2X4H A;  3N4M A;  2A6E F;  4PCQ A;  1LVA A;  2NNY A;  4HDU A;  3K1N A;  5ILU A;  4R79 A;  3RYR A;  5K1Y A;  3WG9 A;  4HA8 A;  1D5V A;  2W57 A;  5LGU A;  2C6Y A;  3O6B B;  4YII A;  4CXF A;  3ZMU A;  3WE3 A;  4RGX A;  4P9U A;  5KVR A;  2HEO A;  3H92 A;  1R00 A;  3CUQ B;  4L0Z B;  1O3Q A;  4GXO A;  5E18 F;  4BYY A;  3KLO A;  4RGS A;  4ASN A;  5TRD A;  3HRT A;  2PJP A;  5L3F A;  1Q1H A;  2PBI A;  3ERE D;  1HXD A;  1IRG A;  5DUI A;  4KIG A;  3RIR A;  3GLX A;  3LAJ A;  3KE2 A;  3P9C A;  3KLN A;  1OYW A;  2XAG A;  1ZHF A;  3CUO A;  3P9K A;  1U78 A;  3L7W A;  1U3E M;  4A2U A;  1UCR A;  3RKW A;  1FBQ A;  2STT A;  2EV0 A;  3HRM A;  3QU3 A;  5DUK A;  2LF7 A;  4G9Y A;  1E2X A;  2FBI A;  4G7H F;  4JK1 X;  2XRO A;  1P6R A;  3GFI A;  1SMY F;  2VOD A;  2P6T A;  1MD0 A;  4P55 A;  1FZP B;  4KNY A;  3TOA A;  4HX8 A;  1YW7 A;  2K4J A;  3KP5 A;  2D45 A;  1MKM A;  4I02 A;  2IT0 A;  3FXU A;  1FPQ A;  3TOB A;  4IRH A;  1K6O A;  2DFI A;  3NRV A;  4GYI A;  2YSR A;  2O6G E;  1UB9 A;  2FNA A;  1S7A A;  3FHZ A;  2H27 A;  2ZO4 A;  3F72 A;  2HQN A;  4LFU A;  3JSP A;  2AXL A;  3WGH A;  4RGR A;  3K1M A;  1XGO A;  2Z5U A;  3R0A A;  4BNC A;  3KP3 A;  4BXU A;  3J81 K;  3FXQ A;  5EEG A;  5DEQ A;  1PDN C;  2IA1 A;  4G8X A;  2LF8 A;  4K2E A;  3BOQ A;  1ZRF A;  2JPC A;  4WXH A;  2CYY A;  3LST A;  1SD4 A;  4MQ9 F;  5L3E A;  4MQV A;  2W84 A;  4EVI A;  4LLL A;  2QBY B;  3M8F A;  2OZU A;  1ZLK A;  4UVA A;  2ZXJ A;  5HDG A;  1DP7 P;  1V3F A;  5HS8 A;  2PI0 A;  4EM0 B;  2EV5 A;  2K4B A;  5D5X B;  1QBJ A;  2HKX A;  5CYV A;  4G7Z F;  2Y0M A;  4A0Y A;  5KK1 A;  3SFZ A;  3ZP5 A;  1IN4 A;  2HOE A;  1USS A;  1K7A A;  4L5I A;  5E1X A;  2A68 F;  4N9H A;  1SAX A;  4I2O A;  3V8J A;  1XD7 A;  3ML6 A;  4N9I A;  5LEK A;  3Q5F A;  4HF2 A;  4MTD A;  2VBZ A;  4MTE A;  1ZN2 A;  3EUH A;  1G3S A;  4S05 A;  1F4K A;  1B1B A;  2ZFW A;  5DV5 A;  1FLI A;  2FXA A;  3E5Q A;  4PGG A;  3H3Z A;  2RKH A;  2FMY A;  3KEQ A;  2PMH A;  1Y0U A;  2CSO A;  3Q9S A;  1FP1 D;  4GCV A;  5D5V B;  2R7F A;  2XAJ A;  4KYW A;  2V79 A;  3DEU A;  5CVR A;  3ABT A;  3EDP A;  4CGZ A;  2ACJ A;  3O3K A;  4IVN A;  1HKQ A;  1T39 A;  5ILS A;  1FSH A;  4U88 A;  3TO9 A;  2MA3 A;  2OU2 A;  4A12 A;  1UHM A;  1SFX A;  4L5J A;  3Q9V A;  1MJA A;  1SMT A;  1J2X A;  4LLN A;  2PFB A;  1YLF A;  1Z9C A;  3I0T A;  4HQM A;  4ZZL A;  3JAM K;  5F1R A;  3TKY A;  4UXN A;  5JFR A;  1FY7 A;  2EFO A;  1MGT A;  1BIB A;  2K27 A;  2GQQ A;  5CVU A;  3T5X A;  1QNT A;  4WWC A;  1XN7 A;  1B6A A;  3HTS B;  3M1E A;  1VTN C;  1WQ2 A;  5CJ9 A;  1P4A A;  1P4X A;  2CG4 A;  3ECO A;  1G3T A;  5TJJ A;  4UHT A;  2GXB A;  1YW8 A;  4YFX F;  1J75 A;  5AIP A;  3L00 A;  2EFQ A;  4M73 A;  1WWX A;  2YPR A;  1J59 A;  2CFX A;  2DAO A;  2MC3 A;  1FC3 A;  3SZT A;  1ZLJ A;  5IT3 A;  4OU0 A;  1YYV A;  5J8F A;  3WTU C;  1XDU A;  2ADU A;  3L9F A;  1S7O A;  1J9I A;  2DLL A;  4RAY A;  3W6K B;  1P92 A;  1XGS A;  3K0L A;  2G9W A;  2OBP A;  5E8I A;  2ZBK A;  4I01 A;  4L9J A;  4LB5 A;  1PP8 F;  3VB2 A;  5ED4 A;  2J5P A;  2QUF A;  1KA8 A;  1IXS B;  3LWF A;  4KIF A;  2FBH A;  2DTR A;  2HYG D;  4AIH A;  3IWF A;  4PGH A;  4WK8 F;  2DO7 A;  3RTR A;  2A61 A;  3QPT A;  2P5K A;  4O3M A;  2X0L A;  1HST A;  1WI9 A;  3R60 A;  4IF4 A;  1J0R A;  1KU7 A;  1LEB A;  3KZZ A;  3C18 A;  3IWZ A;  4XRF A;  3E6B A;  4RS8 A;  1R36 A;  5FLX K;  4BHC A;  4FX4 A;  1ZG5 A;  2ESN A;  3GZ5 A;  3ZMT A;  1SD5 A;  1R22 A;  4BAY A;  5E20 A;  4XBF A;  3F8C A;  3DF8 A;  1B4A A;  3E97 A;  3I4P A;  4O5V A;  1W4M A;  4TV7 A;  1KQ9 A;  3T0Y A;  1CGP A;  4PZJ A;  4BHB A;  3PQJ A;  4KIC A;  3FMR A;  2CO5 A;  2IW5 A;  1B59 A;  5FD6 A;  3TGN A;  1ODD A;  4ZH4 F;  3TQN A;  3GFM A;  2UWM A;  2M1B A;  4KN4 X;  3F3X A;  5BPI A;  1FP2 A;  2A69 F;  3BJA A;  2F5F A;  5A2Q Z;  5HVQ C;  1AWC A;  1Z1D A;  3L2C A;  5LRS A;  1L0O C;  3VFZ A;  1AOY A;  1P4W A;  4EM2 A;  1T98 A;  5HLI A;  3HSE A;  1IXR C;  1Z6R A;  3KP7 A;  3LA2 A;  4IJA A;  3WTW C;  2K02 A;  4L9V A;  3IKV A;  3J7A O;  3CTA A;  1RUN A;  5FO5 A;  4U0W A;  1QZY A;  2O03 A;  1IN7 A;  5CVI A;  4CIC A;  4YFK F;  2KJC A;  1T2K A;  4F7Z A;  4GYG A;  1L3L A;  3KET A;  3GXO A;  1QQI A;  1FBU A;  2JSC A;  3JW4 A;  4L18 B;  3GFJ A;  2M87 A;  3QPH A;  3VOE A;  2O0Y A;  1ZYR F;  3MAJ A;  4KMF A;  3K2Z A;  3FM5 A;  2Q8K A;  2L01 A;  4ESF A;  1G3Y A;  2W24 A;  4L9T A;  4ZYG A;  3R6S A;  4BHP A;  1I1S A;  4ZYE A;  3GVA A;  2V1U A;  1KYZ A;  4WF2 A;  1YFH A;  1SFE A;  3V8L A;  1MDM A;  3SHF A;  1BIA A;  4XLP F;  2ZME A;  4G7O F;  1ZRD A;  1D8K A;  4LGW A;  1ZG1 A;  2XGX A;  1FSE A;  2P8T A;  1KU2 A;  5D6F A;  3ZMZ A;  2GA1 A;  3COA C;  3R61 A;  4OMY A;  4HOB A;  1S29 A;  3I71 A;  4L0Y B;  3M9A A;  1EH7 A;  1KU9 A;  2B0L A;  2DU9 A;  2VON A;  2FNP A;  2PQ8 A;  1OPC A;  3HOS A;  1IXC A;  3DPT A;  5D8L B;  2YX7 A;  2K7L A;  3RKX A;  2MLK A;  3V4G A;  2CW0 F;  4A6E A;  5E1W A;  1I6X A;  4NQW A;  3WTT C;  3ABU A;  3DP7 A;  1XCB A;  1BI0 A;  1A04 A;  4I98 B;  2QVO A;  4Q5S F;  3D5L A;  5A2Q K;  1KGS A;  2HDC A;  1MJB A;  1IAW A;  3MZH A;  1NHA A;  4MNU A;  1EH6 A;  3CDH A;  2VOO A;  4Q4Z F;  2XVC A;  2IVM A;  3FMQ A;  4ZYD A;  2VBW A;  1FOK A;  1STZ A;  2EA2 A;  4MEX F;  4XLN F;  3FM3 A;  2P7C B;  4G6Q A;  5HDK A;  3KCC A;  3U1D A;  1LQ1 A;  2DPD A;  3N97 A;  1IN8 A;  3H3U A;  4LMY A;  4ZYH A;  1TQM A;  5ICG A;  3ZN0 A;  2RVC A;  2ZNY A;  1W7P D;  4LJZ F;  3IHU A;  5CVJ A;  1B9N A;  3F23 A;  3K9T A;  3RJP A;  2FEZ A;  1XSV A;  3LA7 A;  5L3C A;  1TQI A;  3R4K A;  2FE3 A;  4HBL A;  2VC1 A;  2H09 A;  2GXG A;  2DK5 A;  5D4R A;  1S6L A;  2QM3 A;  3JSO A;  3T8T A;  1ZAR A;  2OA4 A;  2D1H A;  5FFZ A;  4B09 A;  1PP7 U;  2HKO A;  1U5T A;  4U7D A;  2UZK A;  1QPM A;  1G6N A;  2QWW A;  3RDI A;  4IRI A;  2LSO A;  4UUV A;  2H94 A;  5DYM A;  3BJO A;  1HBX G;  4WX9 A;  3KP2 A;  1Z6T A;  5K5O A;  2P6S A;  4IXA A;  2RN7 A;  4P96 A;  2BE5 F;  4QWQ A;  4HX4 A;  1EV7 A;  1R5H A;  2XKO A;  4RB1 A;  2CGP A;  3CUQ C;  1ON2 A;  1REP C;  4WXC A;  4EGZ A;  4R8H A;  4UV8 A;  1I1G A;  2NAZ A;  3IC7 A;  2PG4 A;  5E8G A;  3E5X A;  4L9N A;  3WU1 B;  2GZW A;  2VT3 A;  2CQK A;  2L3D A;  3DQV C;  3DPL C;  4HX7 A;  3FXR A;  1LNW A;  1BN5 A;  3ZPL A;  4LD5 A;  4YG2 F;  4RB3 C;  3ELK A;  1TTY A;  1V4R A;  1Z05 A;  2P5V A;  1GXQ A;  3G73 A;  2RC4 A;  4P9F A;  1T38 A;  4IRG A;  1LB2 A;  1E17 A;  4RB0 A;  2EWN A;  1W7P A;  3GUD A;  3GZ6 A;  3D0S A;  4MHG A;  1RIO H;  2Z3Y A;  3EQL F;  1TBX A;  3P9I A;  4LG0 A;  1JXS A;  2MD5 A;  3I54 A;  2HWV A;  3K1P A;  3QP6 A;  1HSJ A;  3KP6 A;  3BPX A;  3IRR A;  1LJ9 A;  1SD7 A;  3WTV C;  3RPQ A;  3P7N A;  4KDP A;  3QU6 A;  3GO5 A;  2KIU A;  2FML A;  2CWE A;  2BGC A;  3EET A;  1XSX A;  2BBY A;  1ZRC A;  3SQN A;  3CO7 C;  1WSU A;  2LNB A;  3BJ6 A;  2A3S A;  1BI3 A;  3GW2 A;  3ZMD A;  3ULQ B;  4EGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...