1BM9A

Replication terminator protein from bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
EEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REPLICATION TERMINATOR PROTEIN
publication title Crystal structure of the replication terminator protein from B. subtilis at 2.6 A.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 41
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bm9A00
2MBFA 5HLIA 2QBYA 1QZYA 4WX9A 4RGRA 5BPIA 2EWNA 5D6FA 4LG0A 3N4MA 2IA2A 2CW0F 4I98B 1DPUA 1BIBA 1IXRC 3KZZA 1IN4A 3HRTA 2M45A 2V6CA 4MGRA 3R0AA 5ERIA 1HW2A 4Y13A 2BGCA 2NNYA 3CUOA 3LA7A 1R23A 2RV8A 4EGZA 1Z9CA 2O03A 3F8FA 3LAJA 1UHMA 4A6EA 1RIOH 4HA8A 4EMSA 4ENMA 3KP5A 4EGYA 3WGHA 1LJ9A 2VBYA 1RI7A 3FMRA 3Q5FA 4U88A 2RVCA 1X3UA 2EJRA 1PP8F 3MAJA 4MTDA 1MJ9A 1YYVA 4AIHA 2VC1A 2PQ8A 4DQ2A 3FXUA 2KIMA 3M8EA 1YG2A 3R61A 1KU9A 1TNSA 3BP8A 1FSEA 4L9VA 2XUBA 5DDGA 1R5HA 1WWXA 2G9WA 5EEHA 2FXAA 1I5ZA 3V7CA 1G3WA 3CDHA 4M9SA 1D3YA 4WXHA 4S04A 4RAZA 5D5XB 1KYZA 5AIPA 2PLYA 3WGIA 2QUFA 5EEGA 5JVTA 5HOOA 1REPC 3VEPA 2K02A 3TOAA 1S6LA 5JR3A 4EJWA 3PFIA 3WTUC 4KYWA 3TKYA 5E18F 2KJBA 4BHBA 1HKSA 3P9CA 1RUOA 5CVRA 4KNYA 1HSTA 1XD7A 4EJVA 1QGPA 1K7AA 4WXCA 4A0ZA 2EA4A 5H6RA 5L3FA 3L2CA 3AAFA 3V8JA 1WSUA 2KIUA 2DLLA 1QO0D 1XCBA 5A2QK 4G7ZF 1J59A 3VOEA 3QRFF 4LG0B 1MJAA 2ZMEA 1K79A 4EJTA 1OPCA 1O3SA 4DNCA 1FZPB 1PP7U 2STTA 1UHWA 1NHAA 4HBLA 4IRHA 5HDNA 3JTHA 1XDUA 4ESFA 1U6GA 1YQAA 2Z9OA 5FLXZ 4I2OA 3HRSA 1JE8A 3WGGA 2PI0A 1H9TA 4RB0A 3C3WA 2M5WA 2M1BA 3PQJA 4KIGA 1P4WA 4OIPF 3IKTA 1HKTA 2XKPA 3CUQB 3GLXA 2HQRA 4MNUA 3ZMTA 1IN6A 1MGTA 3TGNA 4IJAA 1XCVA 1TNTA 4BXUA 3T1BA 1JGSA 1XSVA 1ON2A 2MA3A 3FMSA 4AD9A 2W25A 3BWGA 1ZHFA 3RDIA 2VODA 3R4KA 3GW2A 3E5XA 2FU4A 4L5JA 3DFGA 1CF7A 2H27A 3WTWC 1I6XA 5CVUA 3H3ZA 2F5EA 3QOPA 1KQ0A 1R58A 2P5VA 3ZMZA 2CO5A 4MHGA 4JBAA 3LA3A 2FF4A 4HX4A 4OINF 3MZHA 1EH6A 2UZKA 2GWRA 1Z05A 4LLLA 2DFIA 3SZPA 3DV8A 1OMIA 4XLPF 1FNNA 2W24A 1P6RA 4CGZA 3TQNA 3SFZA 1MJBA 1ZAOA 1ZRCA 5TJJA 5HLHA 3IHUA 3HOTA 3GFLA 4OMZA 1BI1A 1U8RA 4I01A 4FX0A 1FSHA 1F4KA 2P7CB 2LKPA 3WTZA 1GVJA 2D1VA 3KE2A 1XMAA 2ZMEB 4U0WA 2QQAA 2H09A 2YR2A 3WTXC 3V4GA 1XSDA 5DD4A 5D8KB 4LD5A 4WWCA 2A6EF 2L02A 1HQCA 3VODA 4CXFA 1H9GA 3KEOA 5LGTA 2ZXJA 4HYEA 2KIFA 3WE2A 1J5YA 3MZYA 4JK1X 1BC8C 1SMYF 1I27A 5D5VB 1P4XA 2P4WA 2M8EA 5CLSA 4GCVA 1W5TA 2OD5A 3CO6C 3J81K 2XGXA 1P4AA 2HR3A 4I7HA 5TRDA 2PBIA 3O3KA 3B02A 3ECOA 1IAWA 1ZARA 2RNJA 5ICGA 2XRNA 3ZMUA 4P96A 1CGPA 1CF7B 1MDMA 4U7DA 2FA5A 4TV7A 2XVCA 5D5WB 5BMZA 2H6CA 3TO7A 4M72A 3K2ZA 1U3EM 1WQ2A 2ESHA 4MEYF 1T38A 1XDSA 3ROUA 4M9ZA 5ILUA 4M74A 2QM3A 2F5FA 3T5XA 1S7AA 3CJNA 3HTSB 2TDXA 4ENKA 3I53A 1L3LA 2L01A 3ULQB 3FHZA 2E7WA 5DV5A 5JHUA 2MLGA 1C0WA 1ZLJA 3RKWA 4Q4ZF 4EVIA 5DYMA 1QZZA 4HZFA 1W4MA 3I54A 4KDPA 1ULYA 3KP6A 2RKHA 3WTVC 2FBKA 1IN7A 3R60A 1HXDA 3F22A 2DK8A 5FB2A 3Q9SA 5AIQA 3K1PA 2ELHA 3O2PE 2LF7A 3KLOA 3PQKA 2ZNYA 1T39A 2D2WA 1FWZA 2HKOA 3BY6A 2STWA 4Z2YA 3TDZC 4L5IA 4BHPA 4U0VA 3KP3A 1DUXC 4UNOA 5D5UB 4XBFA 1B4AA 2HTSA 1KU3A 4ZYGA 4UV8A 3LFKA 1KQ8A 2O61A 1OYWA 1B1BA 2VBXA 2FE3A 4YFNF 1YTYA 4BAYA 2IVMA 4F7ZA 5LBQA 2QENA 5H20A 3F6OA 3I58A 3M9AA 2RDPA 4ZYHA 2ZJ2A 1K6OA 1MDMB 3G73A 2L3DA 1R7JA 5L3BA 1WKMA 3CUQC 1LEBA 3K1MA 2HKXA 1BI0A 4LFUA 1R36A 5DCMA 2M87A 3KEQA 1STZA 3F21A 4Y15A 3NQOA 4IF4A 4R79A 2CFXA 2Y0MA 3ZMVA 4L0YB 4Q5SF 5BOXA 5HDGA 2XAFA 1O3QA 4Q47A 2A69F 3DQVC 2VE8A 2DK5A 4WCGA 2OZ6A 2AS5F 2K4JA 2ISYA 4Q48A 1YIOA 4WF2A 5KVRA 1R5GA 3GFMA 1WRJA 4IHSA 3KLNA 2FRHA 3EYIA 3RJPA 4AIKA 2WTEA 4QWQA 1K78A 3HIFA 4NHJA 3QU3A 2IJLA 3WE3A 2FEZA 5CVVA 3HSEA 5FFZA 4CO8A 1TW3A 1KU2A 3F8CA 2KRFA 2FSWA 4LLNA 2J5PA 3CUQA 3FXRA 5LHGA 4KFCA 1UFMA 4KMUX 2QYOA 4RS8A 2MLKA 5DUIA 1OYIA 3K69A 5CVJA 2G7UA 5J8FA 4ESBA 2FNAA 1LEAA 1T98A 5HLGA 3KFWX 1LDJA 3BJ6A 2WC2A 4YG2F 3KZYA 3KCCA 1O3TA 1J0RA 1R00A 3GFIA 3WG9A 2XHKA 1Z91A 1KA8A 3KP7A 2BEOA 1O7LA 2R7DA 1FC3A 2VBZA 1G3YA 2VC0A 1RNLA 2JTVA 5CVIA 4S05A 4HQEA 5K5RA 4IPAA 2Y48A 4BNCA 5J8CA 2CYYA 1D8JA 4LGWA 3ISPA 1MD0A 3FF5A 5D6EA 4N9IA 3GYHX 6PAXA 3GF2A 1JHFA 3J81Z 4A2UA 2IPQX 3GX4X 4EJOA 1A04A 3BJAA 3NEUA 1FYMA 3E6BA 4HDUA 1Z6TA 5DCMB 3EUHA 1W5SA 4G94A 2EFPA 3CTAA 2ZCWA 1HW1A 1BN5A 1FPQA 4AVPA 2EFOA 2A6HF 3OV8A 3I59A 4A5NA 1FLIA 2QVOA 4O5VA 4HLYA 1SFEA 1IRGA 3WODF 4I09A 5L3EA 1KYWA 3QP5A 1B9MA 2NAZA 2FOKA 4L18B 3HHGA 2BBYA 3BPVA 3E6MA 1K78B 2GQQA 4P9FA 3WU1B 1ZG5A 4MQ9F 1TTYA 3FXQA 1SMTA 3G3ZA 4GXOA 3ZMSA 2RGVA 2X4HA 2CSOA 4GGGA 3V7RA 1BM9A 2IP2A 2DBBA 4YFKF 3TO6A 2QLZA 2P8TA 3DPLC 2YX7A 1MKMA 5E1WA 3J7AO 2ACJA 5ICFA 3E6CC 1BC7C 2HS5A 2FBIA 2UXNA 3FM3A 1ZGAA 4P5OA 3WU0A 1IF1A 4K2EA 1YS7A 3KETA 1FP2A 3VB2A 4EQQA 5DD8A 1U2WA 1QPMA 2JRTA 3SZTA 5IT9K 2F5DA 1IXCA 5AONA 4G6QA 4ON0A 3ELKA 1J7KA 1HSJA 2W84A 3N97A 2Z33A 5KK1A 2FNPA 1USTA 5FD6A 2HQNA 1XMKA 2V1DA 3P7NA 2E1CA 4PGGA 3SQNA 1J2XA 1G6NA 2XAGA 4QLCU 1HKQA 2HFHA 2JPBA 1YW8A 2OA4A 4FT8A 3JSPA 1D8KA 2QZ8A 5LRSA 2HYGD 3I59B 3GWZA 2MH9A 3GVAA 1EV7A 4B8XA 5K5QA 3GUDA 2G7HA 2F2EA 3GZ6A 4A6DA 2K27A 3V8KA 3I5UA 1H0MA 4ETSA 3R0JA 4AIJA 4D0PA 2ZNZA 4BQAA 2ADUA 4XRFA 2D45A 2P6TA 4XSZF 4PDKA 2KJCA 1G3TA 4O3MA 3C7JA 2KKOA 3FM5A 3CO7C 3JTGA 1S3JA 2FBHA 1USSA 4A12A 3U2RA 3MQ0A 3LQRA 1ZRFA 4M71A 3D5LA 4UXNA 3HHHA 2XAQA 2V79A 2L4MA 5BPDA 3CLOA 2DQRA 4UVCA 3FX3A 3JAMK 5HDKA 3NRVA 3H92A 2ZBKA 3SHFA 2W85A 2F5CA 2DPDA 2X0LA 3F3XA 1O7FA 3RYRA 2K86A 1SD7A 2EFWA 2XAJA 2GA2A 1DPRA 4GYGA 1HW5A 3M7GA 2FQ3A 2HWVA 2VOPA 2HZTA 2C6YA 4IRIA 1EH8A 2GIVA 1BI2A 2XKOA 1LVAA 1AWCA 2OAZA 5E8GA 5D4RA 3W6KB 3DXJF 1XGNA 4U0YA 4GO1A 5F6FA 1B59A 3WTTC 5IT3A 4EJUA 4YIIA 1J75A 3ERED 1FBQA 4EV0A 1W7PD 2JPCA 4LJZF 5E8IA 2YSRA 3F23A 2BYVE 4HW0A 4PGHA 1IW7F 3U1DA 4RAYA 1GXPA 5L3CA 2EV6A 1G3SA 2IA0A 1BJAA 4N0BA 5HS9A 3JSOA 2DU9A 4KIBA 2LNBA 4YIFA 1G4DA 3T8TA 1DP7P 3E97A 2EB7A 5A2QZ 1OKRA 5LRRA 2VOOA 2EK5A 2ZKZA 2P5LC 4IRGA 1SD4A 4B09A 3K0LA 5E17F 3HRMA 5JI6A 5DUKA 2FMLA 2IW5A 3KP4A 4KN7X 3K1NA 2B0LA 4OOIA 4XLNF 1LDDA 2O0YA 3FMQA 5F1RA 3MCZA 4ZZDA 3LQQA 5ED4A 2HGCA 3EYYA 3LA2A 4CICA 1S7OA 2PMHA 1ZN2A 3RI4A 1QQIA 1T6SA 3MFKA 4G7HF 2Q2EA 1JHHA 4KMFA 1RZ4A 4ZYEA 4EM0B 1Y0UA 4HAMA 2XASA 4M6YA 1YLFA 2DI3A 1SD5A 4FHTA 1YFHA 2HEOA 1U5TC 4HDVA 4R1HA 1IXSB 4N9HA 1FY7A 1F1ZA 4L9NA 3COAC 5H6QA 1U78A 4KA4A 2GA1A 3F8NA 1SAXA 2Z3YA 1TQIA 1GHCA 2IA1A 1IN8A 3GZ5A 4FX4A 2R7FA 3FWEA 1YW9A 1F5TA 1ZLKA 2R3SA 3T0YA 4MTEA 3L7WA 3TOBA 5D8LB 2YX4A 3ZPLA 1ZGJA 4OIRF 3WTYC 2DPUA 3IRQA 3U9GA 2DAOA 4PZJA 3GXOA 4LK0F 1ZG1A 3I4PA 5IT9Z 4RB2C 4P9UA 3E6DA 3T8RA 3ZN0A 5LEKA 4OIOF 2CG4A 2ZO4A 3ZP5A 4BYYA 4NB5A 1TLHB 2J5OA 2A68F 5FO5A 3RIRA 2UXXA 1IN5A 1IUYA 2VONA 3JW4A 1U5TA 3J80K 2DQLA 4HV6A 3GFJA 1XGSA 1QNTA 3L00A 2OZUA 1FX7A 5LGNA 5FGMA 1BBYA 1XGMA 4CYDA 3C18A 4HX7A 3BZ6A 1R22A 3L9FA 2H6BA 4M6XA 2YPRA 2O8XA 5L3DA 2H94A 2A07F 1IRFA 3DEUA 2GZWA 3F8BA 3HYIA 3M1EA 1ON1A 4RGUA 1S29A 2FMYA 5ICCA 2VT2A 3WTSC 4BHCA 2EFQA 4ENNA 1O57A 4G6DA 1LDKB 4IHTA 1UCRA 3F8MA 5LHIA 4H0EA 4NQWA 4UUVA 2VT3A 2NS0A 3IL2A 3HSRA 4IVNA 4P55A 4LB6B 1BOAA 5DEQA 3DP7A 3ABTA 3DKWA 3IWFA 3RKXA 3HRUA 2Z99A 2VE9A 2XIGA 4I02A 4MEXF 3JAMZ 3KP2A 2QBYB 3TDUC 4ZH4F 1WI9A 3DPTA 4U7BA 2Y75A 3BPXA 5ILSA 2P5KA 4KICA 3QPTA 3ZN1A 2MC3A 4EM2A 2NNNA 4OMYA 1KU7A 4I0BA 2WWYA 1FBUA 2M30A 2XROA 3GO5A 3SXYA 5LEJA 5FD5A 3B73A 1FOKA 2HDCA 3H3UA 4OIQF 1FYKA 4R8HA 1P2FA 2ESNA 1TBXA 1PUEE 4GYIA 5ILVA 1AOYA 5LGUA 2ZFWA 1FBSA 4LK1F 1U5TB 1KQ9A 3BJOA 3D0SA 4RB3C 4G8XA 2LF8A 3DF8A 1PDNC 1HBXG 3Q9VA 4HV5A 4LB5A 2DO7A 4BH9A 1Z7UA 2GXGA 2MH2A 3W6JB 3BROA 2DTRA 1SFXA 5J6XA 2OBPA 1DDNA 1BIAA 2CGPA 5HVQC 4HQMA 1V3FA 1SFUA 3HSFA 1MZBA 4RB1A 2GXBA 2LDUA 3EETA 3QU6A 2Q8KA 2PEXA 5L3GA 2V1XA 3FZVA 3RPUA 1JXSA 1ZYRF 5E1ZB 1ZRDA 2P7VB 2QQBA 1J9IA 1Q1HA 3LSTA 1KGSA 2XAHA 4OU0A 3E5QA 1B6AA 2OU2A 1P92A 2PG4A 2JT1A 3LWFA 5D4SA 1LNWA 2AXLA 1F9NA 2CQKA 2YU3A 1T0FA 2EV5A 1I1GA 4UVAA 1B9NA 1TQPA 2JZYA 3ABUA 2O3FA 1ZG3A 3RPQA 3ML6A 2V9VA 5HS7A 2EA2A 1ZREA 3HTUA 4YFXF 1E17A 2JSCA 3QPHA 2COMA 2XV4S 2PMUA 2BE5F 3I0TA 3F72A 3P9IA 3E3VA 4HF0A 1E2XA 1R1TA 1GXQA 1UB9A 2ETHA 3F6VA 3MWMA 4RGSA 1FYLA 3IC7A 1ONVA 4HLXA 1I1SA 1Z6RA 4KN4X 1ODDA 2UWMA 4HX8A 3HOSA 3C1DA 3I71A 1QBJA 4WXDA 2MD5A 3VFZA 4CDGA 4IXAA 2Q0OA 4HF1A 3OOPA 2HYFA 2L54A 4JQFA 3E5UA 2E7XA 4M73A 3I64A 2OQGA 1YS6A 1TQMA 1W7PA 2A3SA 2O6GE 3RKYA 2DT5A 2PJPA 3RTRA 5JFRA 4G9YA 1RUNA 4UVBA 2IT0A 3S2WA 2ISZA 3IRRA 4E70A 5BQTA 4UHTA 1XSXA 4ENJA 1S8NA 2A61A 3J80Z 2GAUA 2HOEA 4EM1A 1R1VA 4XSXF 1IZ1A 4ZZLA 4UV9A 3BDDA 5FLXK 1XB4A 3M8FA 1Z1DA 3L09A 4HF2A 4PCQA 4WK8F 4ZYDA 4LLGF 2NRAC 1YO5C 3ZMDA 4MQVA 4CHUA 4L0ZB 2HTJA 1SD6A 5E1XA 5BS6A 1OR7A 3RYPA 2DW4A 5DCFA 2WV0A 5CYVA 1FT9A 1LB2A 1XGOA 3QAHA 3QP6A 4ASNA 2K7LA 1XN7A 3ZQ7A 2NYXA 2K4BA 2EFNA 3ECHA 3P9KA 3O6BB 2D1HA 2V1UA 3MEXA 4KT5C 1FP1D 2VBWA 1T2KA 2W57A 4G7OF 1LQ1A 2CWEA 1YW7A 2VXZA 2BV6A 3HUGA 5CJ9A 5ICEA 3IWZA 2PFBA 4ESJA 3V7SA 4CZZA 4Y17A 2EV0A 3GEZA 3REOA 5FFXA 2QWWA 2E1NA 3R6SA 1OYYA 4KIFA 4A0XA 2PN6A 4A5MA 1O3RA 2A5YB 3K9TA 5E20A 5K1YA 4RGXA 1D5VA 3EQLF 2RN7A 1BI3A 3EDPA 2Z5UA 1TW2A 5HS8A 3IKVA 1L0OC 5LLQA 2OQRA 4O6JA 1W7PB 2QQ9A 5F64A 4AWXB 4M9XA 3V8LA 4L9JA 4LMYA 3LAPA 1V4RA 2RC4A 1ZH5A 3BOQA 3TO9A 4HOBA 1R1UA 2LSOA 2VN2A 5K5OA 1EH7A 2L4AA 2P6SA 5LHHA 4KUMA 4A0YA 1VTNC 4L9TA 2RQPA 2IRFG 4I0AA
chains in the Genus database with same CATH superfamily
2MBFA 5HLIA 3CQZJ 2QBYA 1V55H 2X1EA 4XRMA 2X51A 2VQHA 1QZYA 4WX9A 4RGRA 4UB6C 3PSIA 3PIOF 2DODA 4QTRA 2JWTA 5J1UA 5BPIA 3RSNA 1QHHD 2IGOA 3OWTA 2EWNA 5D6FA 4LG0A 3TMOA 5M3FJ 3FXKA 3G71I 3N4MA 3HB9A 3LSPA 2IA2A 2CW0F 2O5RA 4I98B 1K83J 1D5YA 1DPUA 3OOUA 4NDLA 1BIBA 1AKHA 1IXRC 3KZZA 1IN4A 3CMEI 3HRTA 2M45A 2V6CA 2HVRA 3DBRB 3L2QA 4MGRA 1R4MB 3R0AA 5ERIA 1ETKA 4A3IJ 2HPIA 1HW2A 1FJLA 1S5LC 2AHQA 2IS4A 2XB0X 1GDTA 3FXLA 4I76A 4Y13A 2CUFA 2BGCA 4C3HJ 3ZQQA 2W1OA 1ERDA 2NNYA 2DMQA 3CUOA 3CMMA 2G0EA 3LA7A 4D5CA 3OS1A 2K3FA 1R23A 2RV8A 5FKMA 2F4MB 5M5YJ 2O03A 4EGZA 4B48A 1Z9CA 4RMNA 1AU7A 1J09A 3TW6A 3MKZA 3F8FA 4B3XA 3LAJA 1UHMA 2L7KA 5GTIC 2W7NA 2JN6A 4ABZA 4A6EA 1RIOH 3WG7H 2DYRH 4HA8A 2VKEA 2HYJA 4PJMA 2VKVA 4EMSA 4ENMA 2JA6J 3KP5A 4EGYA 1YE9A 3WGHA 1LJ9A 2VBYA 2L9SA 1Y1WJ 2F48A 1RI7A 3GTJJ 2MFZA 3BQZA 3FMRA 3Q5FA 4E7ZA 4FASD 4U88A 1WHUA 2RVCA 1X3UA 3BTJA 2EJRA 3HUGB 2R93J 2OTLI 2QEXI 1PP8F 3MAJA 4BACA 4MTDA 1MJ9A 1YYVA 2MGQA 4AIHA 1N75A 2WADA 2VC1A 3S3OA 4LIVA 2PQ8A 4DQ2A 1JUMA 3FXUA 2JJ7A 2L9NA 4DYQA 2ZSHB 2KIMA 3M8EA 2JK3A 1QU3A 3RQIA 1YG2A 3R61A 1KU9A 1TNSA 2ZMEC 3BP8A 2L9RA 3HBLA 1FSEA 4L9VA 2XUBA 3D5RC 5DDGA 1R5HA 1WWXA 4BE1A 2R7UA 2R7RA 2CUZA 2G9WA 5EEHA 2FXAA 3O8GA 4H4KC 4CCMA 1I5ZA 3V7CA 1G3WA 3CDHA 2OF7A 4M9SA 3JRIA 1D3YA 4WXHA 3DTKA 4S04A 3H0DA 4RAZA 1SFKA 2IS1A 1QPIA 5D5XB 1KYZA 4A3EJ 4IQ4A 1X2NA 3S3NA 4M3DA 5AIPA 4IEJA 2PLYA 3WGIA 4BEHB 1WVRA 2FQ4A 2QUFA 3K4MA 5EEGA 5JVTA 3PNTA 5HOOA 1REPC 3VEPA 1ZR4A 2K02A 3TOAA 1S6LA 5JR3A 3PO2J 3TBIA 5KNLA 4EJWA 2BY0A 2MG4A 2H1KA 3PFIA 3WTUC 4XR6A 4KYWA 3TKYA 5EGOB 1Y8QB 4B44A 4G6TB 5E18F 2KJBA 4BHBA 1HKSA 2OPTA 2ME0A 3P9CA 1RUOA 5CVRA 4KNYA 1VQ5I 1HSTA 1XD7A 2CRGA 4EJVA 1QGPA 3OYIA 1K7AA 1AA7A 2KPMA 2Y0SA 4WXCA 5FROA 4A0ZA 1GV5A 2EA4A 3KZIC 2A5WA 5H6RA 1D0XA 3KX2A 5L3FA 2I8DA 3L2CA 3AAFA 2JA7J 4II3A 3V8JA 1WSUA 2KIUA 1Z0XA 5E79C 2DLLA 1OCCH 4FE7A 1QO0D 1XCBA 5A2QK 4G7ZF 1J59A 2Y31A 3VOEA 3QRFF 2GM4A 5HNHA 4LG0B 3GTLJ 1MJAA 2ZMEA 4F92B 2LRDA 1K79A 1O4XA 4EJTA 1T33A 4JX4A 1OPCA 5KAIC 4DNCA 1O3SA 1FZPB 3QYEA 3X2QH 3P5JA 3VSLA 1AKHB 1PP7U 1RPWA 3LMMA 2STTA 4IHYA 2PMZA 1UHWA 1X3WB 1NHAA 4HBLA 4IRHA 1YHQI 2R4GA 4A93J 5M5WJ 5HDNA 4UUSA 1MBEA 3JTHA 1XDUA 1MSFC 5J3LA 3PNYA 4ESFA 3BZCA 1U6GA 1YQAA 4B4CA 2E5ZA 4XNFA 2Z9OA 5FLXZ 4C2MJ 1V5FA 4I2OA 5F27A 3BQYA 1LFPA 3HRSA 1JE8A 3WGGA 2PI0A 1H9TA 4RB0A 2F5VA 3C3WA 1X4PA 2M5WA 4PSWA 2M1BA 5F1JA 2HXOA 3PQJA 4I99C 4KIGA 1P4WA 2LP0A 4OIPF 5JLWA 2EQRA 3IKTA 1HKTA 2XKPA 3CUQB 3GLXA 2HQRA 4E7KA 4MNUA 3ZMTA 1JUSA 4NUBA 1IN6A 1MGTA 3CDIA 3TGNA 1UMQA 2JUGA 4IJAA 2JVGA 1LPQA 1XCVA 2R5ZA 1WZ2A 3PIPF 4XL9A 1YITI 1TNTA 4BXXJ 3M8JA 4BXUA 3T1BA 3FKIJ 1JGSA 1XSVA 1ON2A 1LE8A 2MA3A 3FMSA 4EEFG 2LY9A 3FK7A 4AD9A 3CCMI 3W2AA 3CMAI 2W25A 3BWGA 3KPHA 1ZHFA 3RDIA 3CC7I 2VODA 4AUXA 3H1CA 3R4KA 3GW2A 3E5XA 1D1CA 2FU4A 2ID3A 4L5JA 3DFGA 2DMTA 1CF7A 2H27A 2GBYA 3WTWC 1I6XA 4NC8A 5CVUA 3H3ZA 2F5EA 3QOPA 1KQ0A 2CW7A 5FLMJ 2DN0A 2RAEA 1R58A 2P5VA 2NOJB 1VNDA 1EF4A 5TISC 1NK3P 3ZMZA 2CO5A 4MHGA 2HQ5A 4JBAA 4PUSA 2ELJA 3LA3A 2FF4A 4HX4A 2HQAA 3K70D 4OINF 2Z16A 3MZHA 1EH6A 2UZKA 2GWRA 3HJEA 4W1UA 1Z05A 4LLLA 2DFIA 1QHGA 3SZPA 3DV8A 1OMIA 4XLPF 4C2TA 1FNNA 1DGWY 1A5JA 2W24A 2W00A 3BTCA 3HDDA 2OV7A 1P6RA 1I3QJ 4FQGA 1MMSA 4CGZA 3TQNA 3SFZA 2QQ8A 2DA1A 5F0HA 3HZJA 1IDYA 1MJBA 1HF0A 1JKOC 3TEDA 1ZAOA 2W82A 1ZRCA 5TJJA 2DYSH 1SVLA 2KDOA 2VB6A 5HLHA 3IHUA 1TT5B 4D9JA 3HOTA 3GFLA 4Y3OA 4D7NA 4OMZA 1BI1A 4EATA 1P7IA 2M7AA 4Y7NJ 1U8RA 2DOFA 4I01A 4FX0A 1FSHA 2XF7A 1F4KA 2P7CB 2LKPA 2DT7B 3WTZA 1GVJA 2D1VA 4DYRA 1E3OC 1GUUA 3KE2A 1XMAA 4LOCA 3K4JA 2V26A 5EYRA 2ZMEB 4IOAF 4U0WA 2DA6A 1IJWC 2QQAA 2H09A 2AQFA 3H5RA 2XGEA 4N4OB 2YR2A 5E3OA 3WTXC 2R7ZJ 3V4GA 1XSDA 4XKWA 2BZTA 5DD4A 1NG6A 5D8KB 5M3MJ 4LD5A 4WWCA 3PUBA 3H0GJ 2R7WA 3W2WA 2A6EF 2L02A 1HQCA 3VODA 2HXIA 4CXFA 1H9GA 2ZC2A 3KEOA 4BL0B 5LGTA 2ZXJA 4HYEA 3CDLA 2UV1A 2HU9A 4UUSB 5H2FC 3A0HC 2KIFA 3WE2A 1J5YA 2M7BA 3MZYA 4JK1X 1IUFA 1BC8C 3LSKA 1W0UA 4DW6A 1SMYF 3AKZA 1I27A 5D5VB 1P4XA 3S93A 2P4WA 2ZJRF 3C2BA 1A35A 1ZGWA 2M8EA 1F43A 4XK4A 5CLSA 4GCVA 1W5TA 2OD5A 2MSYA 4MLOA 3CO6C 3J81K 3U1KA 5LD2C 5GPCA 3S15J 3CJTB 3HKZN 2EZLA 2XGXA 1P4AA 5J47A 3TP3A 4XKCA 2HR3A 4I7HA 5TRDA 2PBIA 3L2VA 2R5ZB 3O3KA 2Z1DA 4E7IA 3B02A 3ECOA 2X1DA 1IAWA 1NK2P 1ZARA 2RNJA 1TT0A 5ICGA 2WB1A 2XRNA 4HSTA 3VYUB 4BQNA 3ZMUA 1LE8B 3TP0A 1G2HA 3M3YJ 2DJIA 2KHMA 2KLOA 4P96A 1CGPA 4IHWA 4CSWA 4AYBN 1A31A 3H9JA 1CF7B 1MDMA 4U7DA 2FA5A 4TV7A 2XVCA 4A69C 5D5WB 1X19A 5BMZA 4AC0A 2H6CA 3TO7A 1K4TA 4M72A 3K2ZA 1U3EM 1WQ2A 2ESHA 4MEYF 1T38A 1XDSA 2BOLA 2BXZA 2VJ5A 2DA3A 2CV2A 1X4OA 2XF5A 3ROUA 5EG0B 3HOVJ 4M9ZA 4B1RA 5ILUA 4M74A 2MABA 2QM3A 3BCBA 2F5FA 2K5CA 3SDBA 4CCLA 3S16J 3T5XA 1S7AA 3CJNA 3K7AJ 1R49A 3S1RJ 3HTSB 2TDXA 3S32A 4DZJA 5LFAA 3G1OA 4ENKA 3I53A 3MZ8A 1L3LA 3DLLF 1FOWA 2L01A 4IL6C 4F3QA 3ULQB 5CPRB 1QVUA 5FJ8J 3FHZA 2E7WA 2AQEA 5DV5A 5JHUA 1K4SA 2MLGA 1UG2A 1C0WA 1NTCA 4M3BA 3VYRB 1ZLJA 3RKWA 3ZR8X 1PJRA 4V2GA 4Q4ZF 3L2WA 4IZZA 4EVIA 3CCEI 5DYMA 4RAGA 1QZZA 3D1NI 4HZFA 1W4MA 3CZ6A 3Q0VA 3I54A 4XKBA 2LD5A 2LG4A 4BY7J 2H1LA 4KDPA 1WH7A 3QYBA 2KFDA 3ZQLA 4IHVA 2E2JJ 1ULYA 3KP6A 3DEWA 1XS9A 2RKHA 2DOEA 3WTVC 2FBKA 4F93B 1IN7A 3R60A 1HXDA 3OYLA 3F22A 9ANTA 1WJCA 2CQ7A 1V54H 2DK8A 4XORA 5FB2A 2JMWA 3Q9SA 3ASNH 5AIQA 2DJNA 3K1PA 2ELHA 4AM3A 3O2PE 2LF7A 2CFOA 2JRMA 3QODA 3KLOA 2IEKA 3PQKA 2VKDA 1JGGA 4MFDA 3OYCA 2V4JC 2ZNYA 4MO7A 4XLHA 1B8IA 4Y52J 1T39A 2D2WA 4BQQA 4Y33A 1FWZA 3MVPA 1RR8C 2HKOA 3AG3H 3BY6A 2STWA 4C2UA 4Z2YA 2NOGA 4L5IA 3TDZC 5FKLA 4BHPA 4U0VA 3KP3A 5E3LA 1DUXC 1WFXA 4UNOA 5D5UB 1IV6A 4XBFA 1B4AA 2HTSA 3J7ZI 4PJNA 1KU3A 1Y6IA 4XN3A 4ZYGA 2BY1A 4UV8A 3LFKA 2IAIA 2LTPA 1KQ8A 2O61A 2E1MB 1OYWA 2CJJA 1FMVA 1B1BA 1RKTA 3FHNA 5J40A 1U8BA 2VBXA 3W2VA 3CJRB 1D0ZA 2M8GX 3DCFA 3IH3A 2FE3A 5K7FA 4YFNF 3OYFA 4XQFA 4BAYA 1YTYA 1MH3A 1X1AA 3BR6A 2IVMA 1G59A 4F7ZA 3PJRA 5EEAA 3D5SC 4ZDOA 5LBQA 1PUFA 1IO2A 2QENA 5H20A 5B3SH 2E60A 3F6OA 1S9HA 2ZXIA 3I58A 1U9NA 2X6OA 2NVQJ 4CCOA 3M9AA 4D7MA 2JUCA 2RDPA 4ZYHA 4HSRA 4BY1J 3H9QA 2ZJ2A 3IV5A 1K6OA 2XGDA 3G73A 1MDMB 2L3DA 3SZGA 1R7JA 5L3BA 4RA2A 1WKMA 3HG9A 1A6IA 1P9QC 1E0EA 4NC7A 3CUQC 1JJ8C 3CLQA 1LEBA 2E35A 2AO9A 3K1MA 3VYTB 1JKPC 2HKXA 1BI0A 4LFUA 4G12A 2DA4A 1R36A 5DCMA 5FRMA 1LFUP 2M87A 3KEQA 1LFBA 1STZA 3ESWB 4XKVA 2GLOA 3GBGA 3F21A 2TRTA 4Y15A 3NQOA 4IF4A 1ZR2A 4R79A 2CFXA 2Y0MA 2WBMA 2BY2A 1OJLA 3ZMVA 3BTIA 2Y0SN 3EUAA 4L0YB 1SVOA 2HI3A 5BOXA 1XPXA 4Q5SF 4OWRB 5HDGA 4BXFA 4IKFA 1MMAA 2XAFA 1MMGA 1O3QA 4Q47A 2A69F 2EIJH 2KISA 4ZDPA 2LY1A 2F4IA 3ASOH 3DQVC 3HXLA 2VE8A 2DK5A 4D5FA 3PL8A 4AIDA 4WCGA 4IO9F 2EZKA 2OZ6A 3QYFA 1UG0A 2AS5F 3DPUA 2K4JA 1IV8A 5KCMA 3S1QJ 2ISYA 4Q48A 1YIOA 4WF2A 5KVRA 5C4JJ 3BC8A 1R5GA 3GFMA 1WRJA 2PMZN 2Z2SB 3KLNA 4IHSA 1VQ6I 2FRHA 3GMEA 3EYIA 1DP3A 3RJPA 1Z3YA 4AIKA 2WTEA 4QWQA 1K78A 1V5GA 4LIUA 2R0QC 2LVSA 2LLKA 3HIFA 4NHJA 3QU3A 2IJLA 3WE3A 2FEZA 5CVVA 3HSEA 5FKOA 5FFZA 4CO8A 1TW3A 1KU2A 3F8CA 2KRFA 2FSWA 3BG7A 4DZPA 2M4GA 2R7TA 4LLNA 1YX5A 2J5PA 3GCMA 2F4OB 1TWFJ 5GPAA 5CQGA 3CUQA 3FXRA 5LHGA 4KFCA 2E19A 3BG3A 1UFMA 2K3PA 3LFUA 2DXIA 4KMUX 2QYOA 3FK6A 1OFCX 3BLYA 3RZDJ 4A3BJ 4LITA 4RS8A 2MLKA 2E5NA 5DUIA 1OYIA 4YIRX 3K69A 3EUHC 1B8IB 1X2MA 3K10A 2GOMA 2MYSA 2OCEA 5CVJA 2ZSIB 2KL4A 2G7UA 3FBIB 5J8FA 4ESBA 1JT0A 2FNAA 1LEAA 1T98A 5F04A 1I50J 3CC4I 5HLGA 1R9TJ 3W6VA 3KFWX 1LDJA 2M3AA 3BJ6A 2WC2A 4QIWN 4YG2F 3V42A 3ZQCA 3KZYA 4FISA 1M1EB 2CUEA 3KCCA 2RNGA 1O3TA 2K9MA 4X0GA 1J0RA 1R00A 4DOZA 3GFIA 3WG9A 2XHKA 1Z91A 1KA8A 3CCYA 3KP7A 2CS3A 2BEOA 1VQ7I 1VFCA 1VZ0A 3E0JB 1O7LA 2R7DA 1FC3A 2VBZA 2W48A 2BHYA 2BW3A 1G3YA 1TP4A 2VC0A 2EH3A 5IOZA 3S8PA 3LSHA 1RNLA 2JTVA 5CVIA 3ONQA 1PUFB 4S05A 1E3HA 4HQEA 5K5RA 4IPAA 2PJRA 2Y48A 4YRVA 4BNCA 5J8CA 2CYYA 1D8JA 1VI0A 1SC7A 4MEXF 1QRYA 1N77A 4LGWA 3ISPA 1Y1VJ 1MD0A 3FF5A 1MW7A 3GTPJ 5D6EA 4N9IA 4FTHA 3E1SA 3G1LA 2LY2A 3GYHX 6PAXA 3GF2A 1JHFA 3J81Z 2YS9A 1ZKGA 4A2UA 3K70C 1IRXA 4MFEA 2K9NA 2IPQX 1G8XA 3GX4X 3QWLA 4EJOA 1A04A 3BJAA 3NEUA 1PVEA 3SEZA 3E6BA 3WHBA 1Z6TA 3L2RA 4HDUA 1FYMA 5DCMB 4LG3A 2X6WA 1W5SA 3EUHA 4G94A 3JRDA 3CESA 1Y8RB 1WCMJ 4YELA 2EFPA 3CTAA 4I6ZA 4M3GA 1EA3A 2L7MP 2ZCWA 3LSJA 1HW1A 2BXYA 3G1MA 1BN5A 1FPQA 4AVPA 2R7VA 3CCRI 2EFOA 2A6HF 3OV8A 1WJ5A 3ZQGA 4AU7A 3I59A 4A5NA 4PJLA 3OYNA 3JCUC 1FLIA 2QVOA 4O5VA 4HLYA 1SFEA 3PM1A 2QSGX 1HCRA 5GTHC 1IRGA 3WODF 1OCTC 4I09A 2K85A 5L3EA 2B7EA 1KYWA 3VYSB 2Y69H 3QP5A 1B9MA 5HODA 3FISA 1ENHA 2NAZA 2FOKA 3JRGA 4L18B 3HHGA 2MC4A 2BBYA 3BPVA 3E6MA 1K78B 2GQQA 4P9FA 3WU1B 5IY5H 1ZG5A 4MQ9F 1TTYA 3FXQA 5B1BH 1HOMA 2L5QA 1SMTA 2BVMA 3G3ZA 4GXOA 4JP0A 4CYCA 1FEXA 3CMYA 2V9KA 2O7OA 2L7ZA 2RGVA 3ZMSA 2XRLA 2E34A 2X4HA 2MW8A 1AHDP 2CSOA 4GGGA 5C44J 4GDFA 3V7RA 1SFOJ 1BM9A 3GTKJ 2IP2A 2DBBA 4YFKF 5K7ZA 3TO6A 2XC7A 2LREA 5IPAA 2QLZA 2AXTC 3NARA 1RESA 1VF9A 2P8TA 2HDWA 3DPLC 2YX7A 2KP6A 2M34A 1MKMA 2I5UA 4CH7A 5E1WA 3J7AO 2Y9YA 2ACJA 3WHCA 5ICFA 3E6CC 1BC7C 3S2HJ 2XAUA 2HS5A 2FBIA 2UXNA 3FM3A 2VJJA 1ZGAA 3AL0C 4P5OA 2DT6A 3S1NJ 2LYCA 2WB1N 3WU0A 1IF1A 5IYDJ 3LSMA 1WPKA 4K2EA 1YS7A 3KETA 3FDYA 1FP2A 3VB2A 5DTDA 3JRHA 2MD0A 4EQQA 5DD8A 1U2WA 1QPMA 2BY3A 2JRTA 3ZQFA 5IOYA 3BT9A 3SZTA 2BW3B 1TWGJ 5IT9K 2Y30A 4DJAA 1BL0A 1QVTA 1FMWA 4N4NB 5JHFA 2F5DA 2EINH 5EG0A 1IXCA 5AONA 4G6QA 4X6AJ 3KYCB 1TWHJ 3MKLA 4ON0A 4JOMA 2PJRB 3ELKA 1J7KA 1X58A 1HSJA 2W84A 3N97A 2PX9A 2Z33A 2L0KA 5KK1A 2FNPA 1USTA 3KIOA 2LK2A 4DBRA 2HQNA 5FD6A 4A3GJ 3TW7A 1XMKA 1UHSA 3JRCA 3OIPA 1QA6A 5DM6F 1ITYA 2V1DA 1R4NB 3P7NA 1S72I 3BR2A 2E1MC 2R7OA 2E1CA 3SYTA 4PGGA 3AG4H 3SQNA 2W4SA 1J2XA 2LKSA 4XN0A 4F52A 3IP4B 1G6NA 2ZJPF 2XAGA 3CJQB 1POGA 2NVUB 1HKQA 2HFHA 4QLCU 1B72A 2JPBA 4HNTA 3K2AA 1X1CA 1YW8A 4QPQA 1Z67A 2OA4A 2L7FP 4FT8A 3JSPA 1D8KA 4F91B 3CCQI 3NWSA 2QZ8A 5LRSA 2HYGD 1VQPI 2DMPA 3I59B 3GWZA 2MH9A 3GVAA 4PFPA 1EV7A 3NWTA 3OSGA 4A3DJ 1RETA 5FRNA 4B8XA 5K5QA 3IH4A 3RPUD 3GUDA 2G7HA 2F2EA 3CP2A 2XB5A 4A6DA 3GZ6A 1JKRC 1X1PA 4ANJA 5FKKA 3A01A 2K27A 3V8KA 4CCNA 5EJCA 1MSEC 1LKXA 2VL8A 3I5UA 1H0MA 4ETSA 3R0JA 4AIJA 3GTGJ 4BE0A 4D0PA 1P7JA 2ZNZA 4BQAA 2ADUA 2GOXB 2WAQA 3F0CA 3F9KA 3I9V2 4XRFA 2D45A 1HDPA 2V6EA 2P6TA 4XSZF 4PDKA 4CYCB 2YUSA 2KJCA 4M3FA 1G3TA 4O3MA 3C7JA 2KKOA 1ZK8A 3FM5A 3CO7C 1Y39A 3JTGA 3AG2H 4HNUA 1YRNA 3HOYJ 3DLAA 1S3JA 2M0CA 2FBHA 1USSA 1VQLI 4A12A 2ECBA 2JSPA 1ETOA 3U2RA 3MQ0A 4BJ6C 2K9LA 1OCRH 3LQRA 3MN2A 2F6CA 4M71A 1JJ6C 3S3MA 1ZRFA 3D5LA 4UXNA 1MBGA 1VQNI 3HHHA 3DKYA 5BNGA 2XAQA 4V19K 2V79A 5J4VA 2L4MA 4Y4RA 1W5CC 5BPDA 3CLOA 2DQRA 4UVCA 3FX3A 2M9HA 3WU2C 3JAMK 3OIQA 3BTLA 3I55I 5HDKA 3NRVA 3DTIA 4RAFA 3H92A 2ZBKA 2DOAA 3SHFA 3DKXA 2W85A 2F5CA 2DPDA 1BOBA 3SDGA 2X0LA 3LSIA 1Z3XA 3F3XA 4E7JA 1O7FA 3RYRA 2NVTJ 2K86A 1D1BA 1DU6A 2WAFA 4QSHA 1SD7A 3A1YA 4RM2A 3MKYB 2D5VA 2EFWA 2VJIA 2XAJA 2GA2A 1DPRA 4V2FA 4GYGA 1HW5A 1OLTA 3EPZA 4GFBA 3M7GA 1FOYA 4JYKA 2FQ3A 1GV2A 2HWVA 2HZTA 2VOPA 2C6YA 1WH5A 5J4YA 1WGXA 3UKGA 4IRIA 1EH8A 3ZCOA 3K4NA 3CCLI 1NG7A 1BI2A 2GIVA 2XKOA 1LVAA 2EIKH 1AWCA 2OAZA 5E8GA 4XICA 1CQTA 2ID6A 2XF6A 5D4RA 3W6KB 3DXJF 1XGNA 3BCAA 4GO1A 4U0YA 5F6FA 1B59A 2CU7A 3CF2A 3WTTC 5IT3A 3ABLH 4BS9A 4EJUA 4YIIA 1J75A 2X48A 1RKWA 3ERED 5JVGF 3PO3J 5B1AH 3FBNB 1JI8A 1FBQA 4B47A 4EV0A 1W7PD 2JPCA 2DFFA 4LJZF 5E8IA 1B72B 1A36A 3JRFA 3K4KA 4II2A 3ERMA 2YSRA 3AL0B 3F23A 2BYVE 4ZJZA 4HW0A 4PGHA 1FIAA 1ZQ3P 4J01A 3M4OJ 4NC6A 1IW7F 3HOUJ 3U1DA 4CA0A 1OCZH 2CH0A 5DM7F 4RAYA 3L2UA 1GXPA 3ZOBA 5L3CA 2EV6A 1G3SA 4HEA2 2N8GA 2IA0A 1BJAA 1ETVA 3A01B 4XOPA 2X9DA 2QSFX 4UB8C 4N0BA 2EILH 1MH4A 3PFYA 5HS9A 3JSOA 2QGUA 4GRIA 2DU9A 4KIBA 2R5YA 3Q0WA 2LNBA 3FXOA 4YIFA 2XSDC 1G4DA 5GADJ 4UY8I 1W36D 3T8TA 1DP7P 1NH3A 3E97A 2EB7A 4E7HA 5A2QZ 3OYAA 1OKRA 3RCOA 5LRRA 3OYBA 4B3AA 2VOOA 2EK5A 2ZKZA 2JA2A 2P5LC 1MBHA 4IRGA 5EZGA 1SD4A 1YRNB 4B09A 4PFOA 3K0LA 2DA2A 5E17F 3HRMA 5JI6A 2QCOA 1MMNA 4CUGA 3OSFA 5DUKA 3GTMJ 3IAM2 1TWAJ 2KRHA 1TL8A 1K6YA 2FMLA 2IW5A 3KP4A 4KN7X 1H8AC 4A3LJ 3VWBA 3K1NA 2B0LA 4OOIA 4XLNF 1LDDA 4XOTA 4BGDA 1X3ZB 2OCCH 2O0YA 1OCPA 1Z77A 3FMQA 5F1RA 4BBSJ 3MCZA 4ZZDA 3LQQA 1IRZA 5ED4A 2HGCA 2OJED 3EYYA 3LA2A 3Q3SA 4CICA 3B6CA 3BR0A 1S7OA 2PMHA 1ZN2A 3RI4A 2P81A 3ABKH 3UNGC 3MMYB 2FX0A 3VDXA 1QQIA 1T6SA 3MFKA 4G7HF 2DTZA 2VQGA 2Q2EA 1JHHA 4KMFA 1RZ4A 4FETA 2YU9J 4ZYEA 4EM0B 1Y0UA 4HAMA 2XASA 4M6YA 2ECCA 1YLFA 5M5XJ 2DI3A 1SD5A 4FHTA 1YFHA 2HEOA 1TZLA 1U5TC 4HDVA 4R1HA 2QA4I 1IXSB 4N9HA 3K4LA 1FY7A 1F1ZA 4L9NA 3COAC 1Y56A 5H6QA 2LC2A 4OAYA 3KYLA 1U78A 4BU2A 4KA4A 2GA1A 2XPUA 2EBIA 3F8NA 1MNEA 1SAXA 4BUPA 2Z3YA 1TQIA 4S0HB 4B43A 3OL3A 2IA1A 1GHCA 1IN8A 2HNHA 3PUFA 1BR2A 3Q0UA 1YI2I 3GZ5A 4FX4A 2WY8Q 2R7FA 3FWEA 1YW9A 1F5TA 2BVLA 2LFBA 2FOWA 1ZLKA 2R3SA 3T0YA 3S1MJ 4MTEA 3HPGA 3L7WA 3TOBA 5D8LB 2HDDA 2YX4A 3ZPLA 3FXJA 5C4XJ 1YOVB 1S7EA 1ZGJA 4OIRF 3WTYC 2DPUA 3IRQA 2ME6A 3S17J 1HLVA 2KT0A 1APLC 4XIDA 1U9OA 3OL4A 3U9GA 3BG6A 3RZOJ 2DAOA 4PZJA 3GXOA 4LK0F 1ZG1A 4RLFA 2NS7A 3I4PA 5TGTA 3HOZJ 4RB2C 5IT9Z 4P9UA 4XM3A 1RR7A 3E6DA 3T8RA 3ZN0A 3LNQA 3A2KA 5LEKA 4OIOF 1YJ9I 2CG4A 2ZO4A 3ZP5A 3BR3A 4BYYA 1ETQA 2CQQA 3HC7A 2DMUA 1VQMI 4NB5A 2NS8A 1TLHB 2J5OA 2VUMJ 1A6QA 2A68F 1T08B 5FO5A 3ZQHA 3RIRA 3J7YJ 2UXXA 1IN5A 4XLEA 1IUYA 2VONA 5FLVA 3JW4A 4C9YA 1U5TA 1FTZA 3J80K 2DQLA 4HV6A 3GFJA 2QF7A 4CZCA 2R5YB 4ZTJA 2WV1A 1XGSA 1QNTA 3L00A 4E4HA 2OZUA 5J1RA 1WJEA 1HDDC 1QZEA 1FX7A 5LGNA 5FGMA 4PSXA 1BBYA 1XGMA 4CYDA 2BHZA 2VXDA 1FIPA 3C18A 4HX7A 4XMYA 2KQRA 2LH9A 5C3EJ 3BZ6A 4A3KJ 1R22A 3L9FA 3CP8A 4CCJA 5CKTA 2KZVA 2H6BA 2QKLB 4M6XA 1XMXA 3G4SI 4M3EA 2X6YA 1H89C 4X1EA 2YPRA 2O8XA 3MKWB 3BR1A 5L3DA 4E7SA 2H94A 1KONA 2A07F 1IRFA 4UUTA 3DEUA 2GZWA 3IAS2 3F8BA 3OMYA 3HYIA 3M1EA 2VQCA 4DGWB 1ON1A 4RGUA 2EZHA 1MNDA 1S29A 2FMYA 5ICCA 4ZYAA 2VT2A 3H36A 2VJ4A 3WTSC 4BHCA 2EFQA 4ENNA 2XPWA 1O57A 4G6DA 1Y0NA 2DA5A 1LDKB 4IHTA 1UCRA 4AVZA 3F8MA 2VI6A 4BE2A 2Q2EB 2P0WA 1DGRM 5LHIA 2R92J 1XX5A 4H0EA 2DCEA 2IBDA 4NQWA 4UUVA 2VT3A 2NS0A 3IL2A 3HSRA 4IVNA 3SFIA 1OCOH 4P55A 2WY7Q 1BA5A 2M4KA 4LB6B 1BOAA 1I3AA 4IQJA 3DP7A 5DEQA 3ABTA 3OYGA 3K4CA 2K9QA 3DKWA 1SEUA 2OTJI 3IWFA 1I39A 3UR3C 4C30A 3RKXA 3HRUA 2Z99A 5F0FA 2GIZA 4HPQA 4IOCF 1EJ9A 3N05A 4KJZA 1X1BA 2VE9A 2JA5J 2KMUA 3K6GA 2XIGA 4I02A 1Z21A 1D1AA 2ELKA 1T56A 2XSJC 5IYBJ 1WJAA 3JAMZ 1W1WE 2RREA 3KP2A 2NVXJ 2QBYB 3PNVA 2M2EA 4PK4A 3TDUC 4ZH4F 3JRAA 2ZXWH 1WI9A 1WJDA 3DPTA 5KHDA 4U7BA 2Y75A 3BPXA 5ILSA 2P5KA 2X85A 3I3LA 3OYJA 1MBJA 4KICA 3I4MJ 3QPTA 3ZN1A 3O8HA 2MC3A 4EM2A 3BG5A 2NNNA 1VQOI 4OMYA 1KU7A 2B9SA 3LOCA 5GP9A 4I0BA 5F0CA 1XTAA 2LBFA 2WWYA 1FBUA 2M30A 3U21A 5IP7J 4J00A 2XROA 3GO5A 1R71A 3SXYA 5LEJA 3CF5F 5FD5A 1VQ9I 3B73A 1FOKA 1VQ8I 2HDCA 2VASA 3H3UA 4OIQF 2CW8A 2NVYJ 1XG1A 2WA0A 1FYKA 1JTYA 2WAQN 3BG9A 4ITVA 2EPFA 3S2DJ 3OR1C 1SVMA 4R8HA 1P2FA 2ESNA 2CUJA 1TBXA 2VKHA 3HOXJ 2B63J 3J7AY 1SANA 4GYIA 5ILVA 1WJBA 5LGUA 1PUEE 2ZFWA 1AOYA 1FBSA 4KITB 2DFHA 1IC8A 4LK1F 3OR2C 1T95A 4W97A 4E6KG 3QPSA 1U5TB 1LVKA 1KQ9A 2LOOA 3BJOA 3LL7A 3D0SA 4RB3C 4G8XA 2LF8A 3DF8A 1PDNC 1HBXG 3Q9VA 2V9PA 3CC2I 4HV5A 2DFEA 2L2OA 4LB5A 3G6EI 3HOWJ 2DO7A 3HM5A 3DWLE 4BH9A 1Z7UA 2GXGA 4XLCA 2MH2A 5EZHA 3W6JB 1FOXA 1T0FC 3IUOA 2IGKA 3BROA 2DTRA 1SFXA 5IP9J 2IS6A 1PYVA 1WI3A 4OAZA 5J6XA 1JT6A 2OBPA 1DDNA 1BIAA 2CGPA 5HVQC 3JRBA 4HQMA 2I10A 1V3FA 1SFUA 1V5EA 3HSFA 1MZBA 3H5AA 1BW6A 3BR5A 2OC6A 4RB1A 2GXBA 2LDUA 3EETA 3FXMA 5HNFA 3C2GA 2E2IJ 1I6HJ 3QU6A 4RDUA 2VQLA 2Q8KA 3HGYA 3ZRGA 2A6TA 4KT6A 3OY9A 3K4BA 2PEXA 5L3GA 3HL2A 2V1XA 3FZVA 3RPUA 1JXSA 2GXAA 5E3MA 1UZCA 3QOEA 5GAEJ 1ZYRF 5E1ZB 1ZRDA 2P7VB 1IG7A 2ZJQF 4QPOA 2H8WA 2QQBA 4NQWB 1J9IA 4C3JJ 2ZB9A 3OYHA 2JVHA 1MBKA 3KEYA 1Q1HA 4JX5A 1GLNA 1KGSA 3LSTA 4F55A 3JR9A 2CQNA 4FCYA 2E2HJ 3GTOJ 2XGCA 2OUMA 2KDZA 2XAHA 4YEJA 1LUJB 3PSFA 4OU0A 3TL4X 3LSGA 2E71A 2KRCA 3A0BC 1RRJA 2QSHX 2WAEA 3GLLA 2VPLA 3E5QA 1B6AA 3M1CA 4BJTA 1YX3A 3B6AA 2OU2A 1P92A 2PG4A 2JT1A 3LWFA 4BJ5C 5D4SA 2EZIA 1LNWA 2AXLA 3GTQJ 1F9NA 2CQKA 3MD2A 4PJJA 2YU3A 1ORKA 1JUPA 1T0FA 5FKNA 3JREA 2EV5A 1TC3C 1I1GA 4UVAA 1B9NA 1TQPA 1BR4A 2JZYA 2NXNB 1YJWI 3ABUA 3E7LA 2DMNA 2EIMH 2O3FA 3RKQA 1ZG3A 2ZXHA 4ZTFA 1UAAA 3H5NA 3RPQA 3ML6A 2V9VA 5HS7A 2EA2A 4RM3A 4XRSA 1ZREA 3HTUA 1T8IA 2COBA 2VPRA 2Y9ZA 3FIWA 4ZDLA 4YFXF 2LBFB 2LKXA 1E17A 2R7QA 1R6RA 1XC5A 2JSCA 3QPHA 2COMA 3DBHB 4DYCA 2E1OA 2XV4S 1BW5A 3ZQIA 2PMUA 2BE5F 2IXSA 3I0TA 1VQKI 2FUG2 2DA7A 3F72A 3FKJA 3P9IA 3E3VA 3OYDA 4HF0A 2XDVA 1HA8A 1IGNA 3M07A 4MIMA 1E2XA 1R1TA 1GXQA 1UB9A 3L1PA 2ETHA 3F6VA 3RQ4A 3MWMA 1WJFA 3OIOA 4RGSA 1FYLA 3IC7A 1W36C 1ONVA 4HLXA 3H35A 1X1DA 3I4NJ 1I1SA 1Z6RA 4KN4X 1ODDA 2HVSA 2UWMA 4HX8A 1N25A 3HOSA 4J19A 2DDBA 1N78A 4XRSG 3C1DA 3I71A 1YIJI 1QBJA 4P1WA 2HVQA 2MD5A 4WXDA 3VFZA 2CMPA 4IXAA 4CDGA 4BDZA 1TWCJ 2Q0OA 4HF1A 3I56I 3OOPA 2HYFA 2L54A 5F08A 3G2BA 1D0YA 1OR7C 3E5UA 2E7XA 4JQFA 4M73A 3I64A 2E36A 2DDAA 2OQGA 5EDNA 1MBFA 2RQQA 1YS6A 1TQMA 1W7PA 2A3SA 2HOTA 2O6GE 3RKYA 2DT5A 2CV0A 4NNJA 2PJPA 3RTRA 5JFRA 5B66C 4G9YA 5J1YA 1RUNA 4UVBA 2IT0A 5JLXA 4L5EA 3S2WA 4HNVA 3CCVI 2ISZA 3IRRA 5DS9A 4E70A 3HEFA 1MNMC 2R7XA 5BQTA 4UHTA 3H9GA 4M6VA 1XSXA 2LMDA 1S8NA 5IYCJ 4ENJA 2A61A 3J80Z 2GAUA 3A4CA 2HOEA 4PJ0C 4EM1A 3VSKA 2IGMA 1W0TA 5IP6A 1R1VA 2QKMB 4XSXF 4A3CJ 3GZNB 1OISA 1IZ1A 4ZZLA 4UV9A 3DU5A 3BDDA 4A3FJ 4A3JJ 1JKQC 3IH2A 1Z7LA 3S14J 5FLXK 1XB4A 3EUKL 3M8FA 2HZDA 2UUZA 2CQXA 5CQEA 4E7LA 2Y2ZA 1Z1DA 3W3CA 3ABMH 4XLAA 2IS2A 1YJNI 5E3NA 1KZHA 3L09A 1OQYA 4HF2A 4IX7A 1U0JA 3DBLB 4PCQA 2FJ1A 3DTEA 3QQAA 4WK8F 3ZXSA 4LLGF 1RC9A 4ZYDA 2VLAA 2NRAC 1YO5C 4BKXA 3ZMDA 4MQVA 4CHUA 4L0ZB 2HTJA 1SD6A 5E1XA 4U87A 5BS6A 3KYDB 1OR7A 3SEQA 3RYPA 2IGNA 2ICWG 2DW4A 2HPMA 2K9SA 4XLFA 5DCFA 4JX6A 3OYMA 1JTXA 2Q1ZB 1DQUA 2WV0A 3CCJI 2LR8A 5CYVA 5K7HA 1FT9A 2K40A 1VQ4I 2H8RA 1LB2A 1XGOA 3QPLA 2HOAA 3QAHA 3QP6A 4ASNA 1K61A 3DU6A 2K7LA 1XN7A 3ZQ7A 2NYXA 2K4BA 2CV1A 2EFNA 2L9VA 3ECHA 4KISA 2V7FA 3P9KA 3O6BB 1DU0A 2KIQA 3DEEA 4DBQA 2D1HA 2V1UA 2HOSA 4HG2A 2VIXA 3MEXA 3C2HA 4CCKA 3NAUA 3HPHA 4KT5C 1FP1D 1F36A 3AG1H 2VBWA 1T2KA 2W57A 4G7OF 1Q1VA 1UELB 1LQ1A 1ZTRA 2CWEA 1YW7A 2VXZA 3HGGA 2O8KA 2TCTA 2BV6A 2O9LA 3HUGA 5CJ9A 5ICEA 4A3MJ 5HLTA 3IWZA 2PFBA 4ZC3A 4ESJA 3V7SA 2JQ7A 4CZZA 4Y17A 4BBRJ 2EV0A 3AFHA 3GEZA 3REOA 3CCUI 3CCSI 5FFXA 3LSRA 3OS0A 5EF6A 4DIQA 1ETYA 2QWWA 2E1NA 3R6SA 1EKEA 1OYYA 1R5ID 1E3PA 4KIFA 1GT0C 4A0XA 2PN6A 4A5MA 3HKZA 1O3RA 2A5YB 2M0MA 2X6XA 4FE4A 1HC8A 4Z6YA 4IHXA 3K9TA 5E20A 5K1YA 4RGXA 1D5VA 1ZELA 1MMDA 1SAUA 3EQLF 2V1NA 2RN7A 3BZKA 3CD6I 1BI3A 2JA8J 2ZFUA 1IDZA 3EDPA 2Z5UA 4BQOA 2R7SA 1TW2A 5HS8A 3IKVA 4HRIA 1GVDA 2XPVA 1L0OC 5LLQA 2OQRA 4O6JA 1W7PB 2QQ9A 1MIJA 5F64A 1ETWA 4RLQA 4AWXB 4M9XA 4NBQA 3V8LA 4C3IJ 3OYKA 4L9JA 4BEHA 4LMYA 4AYBA 3LAPA 1V4RA 2RC4A 3A03A 2A05A 3A02A 1ZH5A 3BOQA 3TO9A 2FD5A 4HOBA 1R1UA 1FTTA 1ACIA 4D1QA 1ETXA 1H88C 4XONA 5KAFC 5EGOA 2LSOA 2KZGA 3OYEA 4BDYA 2VN2A 1BR1A 3VPRA 1EH7A 2L4AA 5K5OA 3SJMA 2P6SA 5GAGJ 5LHHA 4KUMA 3ZGKA 1UJ8A 2X1CA 4A0YA 3H3VK 3OS2A 1VTNC 1BJZA 5B5EC 4L9TA 2RQPA 2IRFG 4RBOA 5GAHJ 4I0AA
chains in the Genus database with same CATH topology
2MBFA 5HLIA 2QBYA 1QZYA 4WX9A 4RGRA 5BPIA 2EWNA 5D6FA 4LG0A 3N4MA 2IA2A 2CW0F 4I98B 1DPUA 1BIBA 1IXRC 3KZZA 1IN4A 3HRTA 2M45A 2V6CA 4MGRA 3R0AA 5ERIA 1HW2A 4Y13A 2BGCA 2NNYA 3CUOA 3LA7A 1R23A 2RV8A 4EGZA 1Z9CA 2O03A 3F8FA 3LAJA 1UHMA 4A6EA 1RIOH 4HA8A 4EMSA 4ENMA 3KP5A 4EGYA 3WGHA 1LJ9A 2VBYA 1RI7A 3FMRA 3Q5FA 4U88A 2RVCA 1X3UA 2EJRA 1PP8F 3MAJA 4MTDA 1MJ9A 1YYVA 4AIHA 2VC1A 2PQ8A 4DQ2A 3FXUA 2KIMA 3M8EA 1YG2A 3R61A 1KU9A 1TNSA 3BP8A 1FSEA 4L9VA 2XUBA 5DDGA 1R5HA 1WWXA 2G9WA 5EEHA 2FXAA 1I5ZA 3V7CA 1G3WA 3CDHA 4M9SA 1D3YA 4WXHA 4S04A 4RAZA 5D5XB 1KYZA 5AIPA 2PLYA 3WGIA 2QUFA 5EEGA 5JVTA 5HOOA 1REPC 3VEPA 2K02A 3TOAA 1S6LA 5JR3A 4EJWA 3PFIA 3WTUC 4KYWA 3TKYA 5E18F 2KJBA 4BHBA 1HKSA 3P9CA 1RUOA 5CVRA 4KNYA 1HSTA 1XD7A 4EJVA 1QGPA 1K7AA 4WXCA 4A0ZA 2EA4A 5H6RA 5L3FA 3L2CA 3AAFA 3V8JA 1WSUA 2KIUA 2DLLA 1QO0D 1XCBA 5A2QK 4G7ZF 1J59A 3VOEA 3QRFF 4LG0B 1MJAA 2ZMEA 1K79A 4EJTA 1OPCA 1O3SA 4DNCA 1FZPB 1PP7U 2STTA 1UHWA 1NHAA 4HBLA 4IRHA 5HDNA 3JTHA 1XDUA 4ESFA 1U6GA 1YQAA 2Z9OA 5FLXZ 4I2OA 3HRSA 1JE8A 3WGGA 2PI0A 1H9TA 4RB0A 3C3WA 2M5WA 2M1BA 3PQJA 4KIGA 1P4WA 4OIPF 3IKTA 1HKTA 2XKPA 3CUQB 3GLXA 2HQRA 4MNUA 3ZMTA 1IN6A 1MGTA 3TGNA 4IJAA 1XCVA 1TNTA 4BXUA 3T1BA 1JGSA 1XSVA 1ON2A 2MA3A 3FMSA 4AD9A 2W25A 3BWGA 1ZHFA 3RDIA 2VODA 3R4KA 3GW2A 3E5XA 2FU4A 4L5JA 3DFGA 1CF7A 2H27A 3WTWC 1I6XA 5CVUA 3H3ZA 2F5EA 3QOPA 1KQ0A 1R58A 2P5VA 3ZMZA 2CO5A 4MHGA 4JBAA 3LA3A 2FF4A 4HX4A 4OINF 3MZHA 1EH6A 2UZKA 2GWRA 1Z05A 4LLLA 2DFIA 3SZPA 3DV8A 1OMIA 4XLPF 1FNNA 2W24A 1P6RA 4CGZA 3TQNA 3SFZA 1MJBA 1ZAOA 1ZRCA 5TJJA 5HLHA 3IHUA 3HOTA 3GFLA 4OMZA 1BI1A 1U8RA 4I01A 4FX0A 1FSHA 1F4KA 2P7CB 2LKPA 3WTZA 1GVJA 2D1VA 3KE2A 1XMAA 2ZMEB 4U0WA 2QQAA 2H09A 2YR2A 3WTXC 3V4GA 1XSDA 5DD4A 5D8KB 4LD5A 4WWCA 2A6EF 2L02A 1HQCA 3VODA 4CXFA 1H9GA 3KEOA 5LGTA 2ZXJA 4HYEA 2KIFA 3WE2A 1J5YA 3MZYA 4JK1X 1BC8C 1SMYF 1I27A 5D5VB 1P4XA 2P4WA 2M8EA 5CLSA 4GCVA 1W5TA 2OD5A 3CO6C 3J81K 2XGXA 1P4AA 2HR3A 4I7HA 5TRDA 2PBIA 3O3KA 3B02A 3ECOA 1IAWA 1ZARA 2RNJA 5ICGA 2XRNA 3ZMUA 4P96A 1CGPA 1CF7B 1MDMA 4U7DA 2FA5A 4TV7A 2XVCA 5D5WB 5BMZA 2H6CA 3TO7A 4M72A 3K2ZA 1U3EM 1WQ2A 2ESHA 4MEYF 1T38A 1XDSA 3ROUA 4M9ZA 5ILUA 4M74A 2QM3A 2F5FA 3T5XA 1S7AA 3CJNA 3HTSB 2TDXA 4ENKA 3I53A 1L3LA 2L01A 3ULQB 3FHZA 2E7WA 5DV5A 5JHUA 2MLGA 1C0WA 1ZLJA 3RKWA 4Q4ZF 4EVIA 5DYMA 1QZZA 4HZFA 1W4MA 3I54A 4KDPA 1ULYA 3KP6A 2RKHA 3WTVC 2FBKA 1IN7A 3R60A 1HXDA 3F22A 2DK8A 5FB2A 3Q9SA 5AIQA 3K1PA 2ELHA 3O2PE 2LF7A 3KLOA 3PQKA 2ZNYA 1T39A 2D2WA 1FWZA 2HKOA 3BY6A 2STWA 4Z2YA 3TDZC 4L5IA 4BHPA 4U0VA 3KP3A 1DUXC 4UNOA 5D5UB 4XBFA 1B4AA 2HTSA 1KU3A 4ZYGA 4UV8A 3LFKA 1KQ8A 2O61A 1OYWA 1B1BA 2VBXA 2FE3A 4YFNF 1YTYA 4BAYA 2IVMA 4F7ZA 5LBQA 2QENA 5H20A 3F6OA 3I58A 3M9AA 2RDPA 4ZYHA 2ZJ2A 1K6OA 1MDMB 3G73A 2L3DA 1R7JA 5L3BA 1WKMA 3CUQC 1LEBA 3K1MA 2HKXA 1BI0A 4LFUA 1R36A 5DCMA 2M87A 3KEQA 1STZA 3F21A 4Y15A 3NQOA 4IF4A 4R79A 2CFXA 2Y0MA 3ZMVA 4L0YB 4Q5SF 5BOXA 5HDGA 2XAFA 1O3QA 4Q47A 2A69F 3DQVC 2VE8A 2DK5A 4WCGA 2OZ6A 2AS5F 2K4JA 2ISYA 4Q48A 1YIOA 4WF2A 5KVRA 1R5GA 3GFMA 1WRJA 4IHSA 3KLNA 2FRHA 3EYIA 3RJPA 4AIKA 2WTEA 4QWQA 1K78A 3HIFA 4NHJA 3QU3A 2IJLA 3WE3A 2FEZA 5CVVA 3HSEA 5FFZA 4CO8A 1TW3A 1KU2A 3F8CA 2KRFA 2FSWA 4LLNA 2J5PA 3CUQA 3FXRA 5LHGA 4KFCA 1UFMA 4KMUX 2QYOA 4RS8A 2MLKA 5DUIA 1OYIA 3K69A 5CVJA 2G7UA 5J8FA 4ESBA 2FNAA 1LEAA 1T98A 5HLGA 3KFWX 1LDJA 3BJ6A 2WC2A 4YG2F 3KZYA 3KCCA 1O3TA 1J0RA 1R00A 3GFIA 3WG9A 2XHKA 1Z91A 1KA8A 3KP7A 2BEOA 1O7LA 2R7DA 1FC3A 2VBZA 1G3YA 2VC0A 1RNLA 2JTVA 5CVIA 4S05A 4HQEA 5K5RA 4IPAA 2Y48A 4BNCA 5J8CA 2CYYA 1D8JA 4LGWA 3ISPA 1MD0A 3FF5A 5D6EA 4N9IA 3GYHX 6PAXA 3GF2A 1JHFA 3J81Z 4A2UA 2IPQX 3GX4X 4EJOA 1A04A 3BJAA 3NEUA 1FYMA 3E6BA 4HDUA 1Z6TA 5DCMB 3EUHA 1W5SA 4G94A 2EFPA 3CTAA 2ZCWA 1HW1A 1BN5A 1FPQA 4AVPA 2EFOA 2A6HF 3OV8A 3I59A 4A5NA 1FLIA 2QVOA 4O5VA 4HLYA 1SFEA 1IRGA 3WODF 4I09A 5L3EA 1KYWA 3QP5A 1B9MA 2NAZA 2FOKA 4L18B 3HHGA 2BBYA 3BPVA 3E6MA 1K78B 2GQQA 4P9FA 3WU1B 1ZG5A 4MQ9F 1TTYA 3FXQA 1SMTA 3G3ZA 4GXOA 3ZMSA 2RGVA 2X4HA 2CSOA 4GGGA 3V7RA 1BM9A 2IP2A 2DBBA 4YFKF 3TO6A 2QLZA 2P8TA 3DPLC 2YX7A 1MKMA 5E1WA 3J7AO 2ACJA 5ICFA 3E6CC 1BC7C 2HS5A 2FBIA 2UXNA 3FM3A 1ZGAA 4P5OA 3WU0A 1IF1A 4K2EA 1YS7A 3KETA 1FP2A 3VB2A 4EQQA 5DD8A 1U2WA 1QPMA 2JRTA 3SZTA 5IT9K 2F5DA 1IXCA 5AONA 4G6QA 4ON0A 3ELKA 1J7KA 1HSJA 2W84A 3N97A 2Z33A 5KK1A 2FNPA 1USTA 5FD6A 2HQNA 1XMKA 2V1DA 3P7NA 2E1CA 4PGGA 3SQNA 1J2XA 1G6NA 2XAGA 4QLCU 1HKQA 2HFHA 2JPBA 1YW8A 2OA4A 4FT8A 3JSPA 1D8KA 2QZ8A 5LRSA 2HYGD 3I59B 3GWZA 2MH9A 3GVAA 1EV7A 4B8XA 5K5QA 3GUDA 2G7HA 2F2EA 3GZ6A 4A6DA 2K27A 3V8KA 3I5UA 1H0MA 4ETSA 3R0JA 4AIJA 4D0PA 2ZNZA 4BQAA 2ADUA 4XRFA 2D45A 2P6TA 4XSZF 4PDKA 2KJCA 1G3TA 4O3MA 3C7JA 2KKOA 3FM5A 3CO7C 3JTGA 1S3JA 2FBHA 1USSA 4A12A 3U2RA 3MQ0A 3LQRA 1ZRFA 4M71A 3D5LA 4UXNA 3HHHA 2XAQA 2V79A 2L4MA 5BPDA 3CLOA 2DQRA 4UVCA 3FX3A 3JAMK 5HDKA 3NRVA 3H92A 2ZBKA 3SHFA 2W85A 2F5CA 2DPDA 2X0LA 3F3XA 1O7FA 3RYRA 2K86A 1SD7A 2EFWA 2XAJA 2GA2A 1DPRA 4GYGA 1HW5A 3M7GA 2FQ3A 2HWVA 2VOPA 2HZTA 2C6YA 4IRIA 1EH8A 2GIVA 1BI2A 2XKOA 1LVAA 1AWCA 2OAZA 5E8GA 5D4RA 3W6KB 3DXJF 1XGNA 4U0YA 4GO1A 5F6FA 1B59A 3WTTC 5IT3A 4EJUA 4YIIA 1J75A 3ERED 1FBQA 4EV0A 1W7PD 2JPCA 4LJZF 5E8IA 2YSRA 3F23A 2BYVE 4HW0A 4PGHA 1IW7F 3U1DA 4RAYA 1GXPA 5L3CA 2EV6A 1G3SA 2IA0A 1BJAA 4N0BA 5HS9A 3JSOA 2DU9A 4KIBA 2LNBA 4YIFA 1G4DA 3T8TA 1DP7P 3E97A 2EB7A 5A2QZ 1OKRA 5LRRA 2VOOA 2EK5A 2ZKZA 2P5LC 4IRGA 1SD4A 4B09A 3K0LA 5E17F 3HRMA 5JI6A 5DUKA 2FMLA 2IW5A 3KP4A 4KN7X 3K1NA 2B0LA 4OOIA 4XLNF 1LDDA 2O0YA 3FMQA 5F1RA 3MCZA 4ZZDA 3LQQA 5ED4A 2HGCA 3EYYA 3LA2A 4CICA 1S7OA 2PMHA 1ZN2A 3RI4A 1QQIA 1T6SA 3MFKA 4G7HF 2Q2EA 1JHHA 4KMFA 1RZ4A 4ZYEA 4EM0B 1Y0UA 4HAMA 2XASA 4M6YA 1YLFA 2DI3A 1SD5A 4FHTA 1YFHA 2HEOA 1U5TC 4HDVA 4R1HA 1IXSB 4N9HA 1FY7A 1F1ZA 4L9NA 3COAC 5H6QA 1U78A 4KA4A 2GA1A 3F8NA 1SAXA 2Z3YA 1TQIA 1GHCA 2IA1A 1IN8A 3GZ5A 4FX4A 2R7FA 3FWEA 1YW9A 1F5TA 1ZLKA 2R3SA 3T0YA 4MTEA 3L7WA 3TOBA 5D8LB 2YX4A 3ZPLA 1ZGJA 4OIRF 3WTYC 2DPUA 3IRQA 3U9GA 2DAOA 4PZJA 3GXOA 4LK0F 1ZG1A 3I4PA 5IT9Z 4RB2C 4P9UA 3E6DA 3T8RA 3ZN0A 5LEKA 4OIOF 2CG4A 2ZO4A 3ZP5A 4BYYA 4NB5A 1TLHB 2J5OA 2A68F 5FO5A 3RIRA 2UXXA 1IN5A 1IUYA 2VONA 3JW4A 1U5TA 3J80K 2DQLA 4HV6A 3GFJA 1XGSA 1QNTA 3L00A 2OZUA 1FX7A 5LGNA 5FGMA 1BBYA 1XGMA 4CYDA 3C18A 4HX7A 3BZ6A 1R22A 3L9FA 2H6BA 4M6XA 2YPRA 2O8XA 5L3DA 2H94A 2A07F 1IRFA 3DEUA 2GZWA 3F8BA 3HYIA 3M1EA 1ON1A 4RGUA 1S29A 2FMYA 5ICCA 2VT2A 3WTSC 4BHCA 2EFQA 4ENNA 1O57A 4G6DA 1LDKB 4IHTA 1UCRA 3F8MA 5LHIA 4H0EA 4NQWA 4UUVA 2VT3A 2NS0A 3IL2A 3HSRA 4IVNA 4P55A 4LB6B 1BOAA 5DEQA 3DP7A 3ABTA 3DKWA 3IWFA 3RKXA 3HRUA 2Z99A 2VE9A 2XIGA 4I02A 4MEXF 3JAMZ 3KP2A 2QBYB 3TDUC 4ZH4F 1WI9A 3DPTA 4U7BA 2Y75A 3BPXA 5ILSA 2P5KA 4KICA 3QPTA 3ZN1A 2MC3A 4EM2A 2NNNA 4OMYA 1KU7A 4I0BA 2WWYA 1FBUA 2M30A 2XROA 3GO5A 3SXYA 5LEJA 5FD5A 3B73A 1FOKA 2HDCA 3H3UA 4OIQF 1FYKA 4R8HA 1P2FA 2ESNA 1TBXA 1PUEE 4GYIA 5ILVA 1AOYA 5LGUA 2ZFWA 1FBSA 4LK1F 1U5TB 1KQ9A 3BJOA 3D0SA 4RB3C 4G8XA 2LF8A 3DF8A 1PDNC 1HBXG 3Q9VA 4HV5A 4LB5A 2DO7A 4BH9A 1Z7UA 2GXGA 2MH2A 3W6JB 3BROA 2DTRA 1SFXA 5J6XA 2OBPA 1DDNA 1BIAA 2CGPA 5HVQC 4HQMA 1V3FA 1SFUA 3HSFA 1MZBA 4RB1A 2GXBA 2LDUA 3EETA 3QU6A 2Q8KA 2PEXA 5L3GA 2V1XA 3FZVA 3RPUA 1JXSA 1ZYRF 5E1ZB 1ZRDA 2P7VB 2QQBA 1J9IA 1Q1HA 3LSTA 1KGSA 2XAHA 4OU0A 3E5QA 1B6AA 2OU2A 1P92A 2PG4A 2JT1A 3LWFA 5D4SA 1LNWA 2AXLA 1F9NA 2CQKA 2YU3A 1T0FA 2EV5A 1I1GA 4UVAA 1B9NA 1TQPA 2JZYA 3ABUA 2O3FA 1ZG3A 3RPQA 3ML6A 2V9VA 5HS7A 2EA2A 1ZREA 3HTUA 4YFXF 1E17A 2JSCA 3QPHA 2COMA 2XV4S 2PMUA 2BE5F 3I0TA 3F72A 3P9IA 3E3VA 4HF0A 1E2XA 1R1TA 1GXQA 1UB9A 2ETHA 3F6VA 3MWMA 4RGSA 1FYLA 3IC7A 1ONVA 4HLXA 1I1SA 1Z6RA 4KN4X 1ODDA 2UWMA 4HX8A 3HOSA 3C1DA 3I71A 1QBJA 4WXDA 2MD5A 3VFZA 4CDGA 4IXAA 2Q0OA 4HF1A 3OOPA 2HYFA 2L54A 4JQFA 3E5UA 2E7XA 4M73A 3I64A 2OQGA 1YS6A 1TQMA 1W7PA 2A3SA 2O6GE 3RKYA 2DT5A 2PJPA 3RTRA 5JFRA 4G9YA 1RUNA 4UVBA 2IT0A 3S2WA 2ISZA 3IRRA 4E70A 5BQTA 4UHTA 1XSXA 4ENJA 1S8NA 2A61A 3J80Z 2GAUA 2HOEA 4EM1A 1R1VA 4XSXF 1IZ1A 4ZZLA 4UV9A 3BDDA 5FLXK 1XB4A 3M8FA 1Z1DA 3L09A 4HF2A 4PCQA 4WK8F 4ZYDA 4LLGF 2NRAC 1YO5C 3ZMDA 4MQVA 4CHUA 4L0ZB 2HTJA 1SD6A 5E1XA 5BS6A 1OR7A 3RYPA 2DW4A 5DCFA 2WV0A 5CYVA 1FT9A 1LB2A 1XGOA 3QAHA 3QP6A 4ASNA 2K7LA 1XN7A 3ZQ7A 2NYXA 2K4BA 2EFNA 3ECHA 3P9KA 3O6BB 2D1HA 2V1UA 3MEXA 4KT5C 1FP1D 2VBWA 1T2KA 2W57A 4G7OF 1LQ1A 2CWEA 1YW7A 2VXZA 2BV6A 3HUGA 5CJ9A 5ICEA 3IWZA 2PFBA 4ESJA 3V7SA 4CZZA 4Y17A 2EV0A 3GEZA 3REOA 5FFXA 2QWWA 2E1NA 3R6SA 1OYYA 4KIFA 4A0XA 2PN6A 4A5MA 1O3RA 2A5YB 3K9TA 5E20A 5K1YA 4RGXA 1D5VA 3EQLF 2RN7A 1BI3A 3EDPA 2Z5UA 1TW2A 5HS8A 3IKVA 1L0OC 5LLQA 2OQRA 4O6JA 1W7PB 2QQ9A 5F64A 4AWXB 4M9XA 3V8LA 4L9JA 4LMYA 3LAPA 1V4RA 2RC4A 1ZH5A 3BOQA 3TO9A 4HOBA 1R1UA 2LSOA 2VN2A 5K5OA 1EH7A 2L4AA 2P6SA 5LHHA 4KUMA 4A0YA 1VTNC 4L9TA 2RQPA 2IRFG 4I0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBF A;  5HLI A;  2QBY A;  1QZY A;  4WX9 A;  4RGR A;  5BPI A;  2EWN A;  5D6F A;  4LG0 A;  3N4M A;  2IA2 A;  2CW0 F;  4I98 B;  1DPU A;  1BIB A;  1IXR C;  3KZZ A;  1IN4 A;  3HRT A;  2M45 A;  2V6C A;  4MGR A;  3R0A A;  5ERI A;  1HW2 A;  4Y13 A;  2BGC A;  2NNY A;  3CUO A;  3LA7 A;  1R23 A;  2RV8 A;  4EGZ A;  1Z9C A;  2O03 A;  3F8F A;  3LAJ A;  1UHM A;  4A6E A;  1RIO H;  4HA8 A;  4EMS A;  4ENM A;  3KP5 A;  4EGY A;  3WGH A;  1LJ9 A;  2VBY A;  1RI7 A;  3FMR A;  3Q5F A;  4U88 A;  2RVC A;  1X3U A;  2EJR A;  1PP8 F;  3MAJ A;  4MTD A;  1MJ9 A;  1YYV A;  4AIH A;  2VC1 A;  2PQ8 A;  4DQ2 A;  3FXU A;  2KIM A;  3M8E A;  1YG2 A;  3R61 A;  1KU9 A;  1TNS A;  3BP8 A;  1FSE A;  4L9V A;  2XUB A;  5DDG A;  1R5H A;  1WWX A;  2G9W A;  5EEH A;  2FXA A;  1I5Z A;  3V7C A;  1G3W A;  3CDH A;  4M9S A;  1D3Y A;  4WXH A;  4S04 A;  4RAZ A;  5D5X B;  1KYZ A;  5AIP A;  2PLY A;  3WGI A;  2QUF A;  5EEG A;  5JVT A;  5HOO A;  1REP C;  3VEP A;  2K02 A;  3TOA A;  1S6L A;  5JR3 A;  4EJW A;  3PFI A;  3WTU C;  4KYW A;  3TKY A;  5E18 F;  2KJB A;  4BHB A;  1HKS A;  3P9C A;  1RUO A;  5CVR A;  4KNY A;  1HST A;  1XD7 A;  4EJV A;  1QGP A;  1K7A A;  4WXC A;  4A0Z A;  2EA4 A;  5H6R A;  5L3F A;  3L2C A;  3AAF A;  3V8J A;  1WSU A;  2KIU A;  2DLL A;  1QO0 D;  1XCB A;  5A2Q K;  4G7Z F;  1J59 A;  3VOE A;  3QRF F;  4LG0 B;  1MJA A;  2ZME A;  1K79 A;  4EJT A;  1OPC A;  1O3S A;  4DNC A;  1FZP B;  1PP7 U;  2STT A;  1UHW A;  1NHA A;  4HBL A;  4IRH A;  5HDN A;  3JTH A;  1XDU A;  4ESF A;  1U6G A;  1YQA A;  2Z9O A;  5FLX Z;  4I2O A;  3HRS A;  1JE8 A;  3WGG A;  2PI0 A;  1H9T A;  4RB0 A;  3C3W A;  2M5W A;  2M1B A;  3PQJ A;  4KIG A;  1P4W A;  4OIP F;  3IKT A;  1HKT A;  2XKP A;  3CUQ B;  3GLX A;  2HQR A;  4MNU A;  3ZMT A;  1IN6 A;  1MGT A;  3TGN A;  4IJA A;  1XCV A;  1TNT A;  4BXU A;  3T1B A;  1JGS A;  1XSV A;  1ON2 A;  2MA3 A;  3FMS A;  4AD9 A;  2W25 A;  3BWG A;  1ZHF A;  3RDI A;  2VOD A;  3R4K A;  3GW2 A;  3E5X A;  2FU4 A;  4L5J A;  3DFG A;  1CF7 A;  2H27 A;  3WTW C;  1I6X A;  5CVU A;  3H3Z A;  2F5E A;  3QOP A;  1KQ0 A;  1R58 A;  2P5V A;  3ZMZ A;  2CO5 A;  4MHG A;  4JBA A;  3LA3 A;  2FF4 A;  4HX4 A;  4OIN F;  3MZH A;  1EH6 A;  2UZK A;  2GWR A;  1Z05 A;  4LLL A;  2DFI A;  3SZP A;  3DV8 A;  1OMI A;  4XLP F;  1FNN A;  2W24 A;  1P6R A;  4CGZ A;  3TQN A;  3SFZ A;  1MJB A;  1ZAO A;  1ZRC A;  5TJJ A;  5HLH A;  3IHU A;  3HOT A;  3GFL A;  4OMZ A;  1BI1 A;  1U8R A;  4I01 A;  4FX0 A;  1FSH A;  1F4K A;  2P7C B;  2LKP A;  3WTZ A;  1GVJ A;  2D1V A;  3KE2 A;  1XMA A;  2ZME B;  4U0W A;  2QQA A;  2H09 A;  2YR2 A;  3WTX C;  3V4G A;  1XSD A;  5DD4 A;  5D8K B;  4LD5 A;  4WWC A;  2A6E F;  2L02 A;  1HQC A;  3VOD A;  4CXF A;  1H9G A;  3KEO A;  5LGT A;  2ZXJ A;  4HYE A;  2KIF A;  3WE2 A;  1J5Y A;  3MZY A;  4JK1 X;  1BC8 C;  1SMY F;  1I27 A;  5D5V B;  1P4X A;  2P4W A;  2M8E A;  5CLS A;  4GCV A;  1W5T A;  2OD5 A;  3CO6 C;  3J81 K;  2XGX A;  1P4A A;  2HR3 A;  4I7H A;  5TRD A;  2PBI A;  3O3K A;  3B02 A;  3ECO A;  1IAW A;  1ZAR A;  2RNJ A;  5ICG A;  2XRN A;  3ZMU A;  4P96 A;  1CGP A;  1CF7 B;  1MDM A;  4U7D A;  2FA5 A;  4TV7 A;  2XVC A;  5D5W B;  5BMZ A;  2H6C A;  3TO7 A;  4M72 A;  3K2Z A;  1U3E M;  1WQ2 A;  2ESH A;  4MEY F;  1T38 A;  1XDS A;  3ROU A;  4M9Z A;  5ILU A;  4M74 A;  2QM3 A;  2F5F A;  3T5X A;  1S7A A;  3CJN A;  3HTS B;  2TDX A;  4ENK A;  3I53 A;  1L3L A;  2L01 A;  3ULQ B;  3FHZ A;  2E7W A;  5DV5 A;  5JHU A;  2MLG A;  1C0W A;  1ZLJ A;  3RKW A;  4Q4Z F;  4EVI A;  5DYM A;  1QZZ A;  4HZF A;  1W4M A;  3I54 A;  4KDP A;  1ULY A;  3KP6 A;  2RKH A;  3WTV C;  2FBK A;  1IN7 A;  3R60 A;  1HXD A;  3F22 A;  2DK8 A;  5FB2 A;  3Q9S A;  5AIQ A;  3K1P A;  2ELH A;  3O2P E;  2LF7 A;  3KLO A;  3PQK A;  2ZNY A;  1T39 A;  2D2W A;  1FWZ A;  2HKO A;  3BY6 A;  2STW A;  4Z2Y A;  3TDZ C;  4L5I A;  4BHP A;  4U0V A;  3KP3 A;  1DUX C;  4UNO A;  5D5U B;  4XBF A;  1B4A A;  2HTS A;  1KU3 A;  4ZYG A;  4UV8 A;  3LFK A;  1KQ8 A;  2O61 A;  1OYW A;  1B1B A;  2VBX A;  2FE3 A;  4YFN F;  1YTY A;  4BAY A;  2IVM A;  4F7Z A;  5LBQ A;  2QEN A;  5H20 A;  3F6O A;  3I58 A;  3M9A A;  2RDP A;  4ZYH A;  2ZJ2 A;  1K6O A;  1MDM B;  3G73 A;  2L3D A;  1R7J A;  5L3B A;  1WKM A;  3CUQ C;  1LEB A;  3K1M A;  2HKX A;  1BI0 A;  4LFU A;  1R36 A;  5DCM A;  2M87 A;  3KEQ A;  1STZ A;  3F21 A;  4Y15 A;  3NQO A;  4IF4 A;  4R79 A;  2CFX A;  2Y0M A;  3ZMV A;  4L0Y B;  4Q5S F;  5BOX A;  5HDG A;  2XAF A;  1O3Q A;  4Q47 A;  2A69 F;  3DQV C;  2VE8 A;  2DK5 A;  4WCG A;  2OZ6 A;  2AS5 F;  2K4J A;  2ISY A;  4Q48 A;  1YIO A;  4WF2 A;  5KVR A;  1R5G A;  3GFM A;  1WRJ A;  4IHS A;  3KLN A;  2FRH A;  3EYI A;  3RJP A;  4AIK A;  2WTE A;  4QWQ A;  1K78 A;  3HIF A;  4NHJ A;  3QU3 A;  2IJL A;  3WE3 A;  2FEZ A;  5CVV A;  3HSE A;  5FFZ A;  4CO8 A;  1TW3 A;  1KU2 A;  3F8C A;  2KRF A;  2FSW A;  4LLN A;  2J5P A;  3CUQ A;  3FXR A;  5LHG A;  4KFC A;  1UFM A;  4KMU X;  2QYO A;  4RS8 A;  2MLK A;  5DUI A;  1OYI A;  3K69 A;  5CVJ A;  2G7U A;  5J8F A;  4ESB A;  2FNA A;  1LEA A;  1T98 A;  5HLG A;  3KFW X;  1LDJ A;  3BJ6 A;  2WC2 A;  4YG2 F;  3KZY A;  3KCC A;  1O3T A;  1J0R A;  1R00 A;  3GFI A;  3WG9 A;  2XHK A;  1Z91 A;  1KA8 A;  3KP7 A;  2BEO A;  1O7L A;  2R7D A;  1FC3 A;  2VBZ A;  1G3Y A;  2VC0 A;  1RNL A;  2JTV A;  5CVI A;  4S05 A;  4HQE A;  5K5R A;  4IPA A;  2Y48 A;  4BNC A;  5J8C A;  2CYY A;  1D8J A;  4LGW A;  3ISP A;  1MD0 A;  3FF5 A;  5D6E A;  4N9I A;  3GYH X;  6PAX A;  3GF2 A;  1JHF A;  3J81 Z;  4A2U A;  2IPQ X;  3GX4 X;  4EJO A;  1A04 A;  3BJA A;  3NEU A;  1FYM A;  3E6B A;  4HDU A;  1Z6T A;  5DCM B;  3EUH A;  1W5S A;  4G94 A;  2EFP A;  3CTA A;  2ZCW A;  1HW1 A;  1BN5 A;  1FPQ A;  4AVP A;  2EFO A;  2A6H F;  3OV8 A;  3I59 A;  4A5N A;  1FLI A;  2QVO A;  4O5V A;  4HLY A;  1SFE A;  1IRG A;  3WOD F;  4I09 A;  5L3E A;  1KYW A;  3QP5 A;  1B9M A;  2NAZ A;  2FOK A;  4L18 B;  3HHG A;  2BBY A;  3BPV A;  3E6M A;  1K78 B;  2GQQ A;  4P9F A;  3WU1 B;  1ZG5 A;  4MQ9 F;  1TTY A;  3FXQ A;  1SMT A;  3G3Z A;  4GXO A;  3ZMS A;  2RGV A;  2X4H A;  2CSO A;  4GGG A;  3V7R A;  1BM9 A;  2IP2 A;  2DBB A;  4YFK F;  3TO6 A;  2QLZ A;  2P8T A;  3DPL C;  2YX7 A;  1MKM A;  5E1W A;  3J7A O;  2ACJ A;  5ICF A;  3E6C C;  1BC7 C;  2HS5 A;  2FBI A;  2UXN A;  3FM3 A;  1ZGA A;  4P5O A;  3WU0 A;  1IF1 A;  4K2E A;  1YS7 A;  3KET A;  1FP2 A;  3VB2 A;  4EQQ A;  5DD8 A;  1U2W A;  1QPM A;  2JRT A;  3SZT A;  5IT9 K;  2F5D A;  1IXC A;  5AON A;  4G6Q A;  4ON0 A;  3ELK A;  1J7K A;  1HSJ A;  2W84 A;  3N97 A;  2Z33 A;  5KK1 A;  2FNP A;  1UST A;  5FD6 A;  2HQN A;  1XMK A;  2V1D A;  3P7N A;  2E1C A;  4PGG A;  3SQN A;  1J2X A;  1G6N A;  2XAG A;  4QLC U;  1HKQ A;  2HFH A;  2JPB A;  1YW8 A;  2OA4 A;  4FT8 A;  3JSP A;  1D8K A;  2QZ8 A;  5LRS A;  2HYG D;  3I59 B;  3GWZ A;  2MH9 A;  3GVA A;  1EV7 A;  4B8X A;  5K5Q A;  3GUD A;  2G7H A;  2F2E A;  3GZ6 A;  4A6D A;  2K27 A;  3V8K A;  3I5U A;  1H0M A;  4ETS A;  3R0J A;  4AIJ A;  4D0P A;  2ZNZ A;  4BQA A;  2ADU A;  4XRF A;  2D45 A;  2P6T A;  4XSZ F;  4PDK A;  2KJC A;  1G3T A;  4O3M A;  3C7J A;  2KKO A;  3FM5 A;  3CO7 C;  3JTG A;  1S3J A;  2FBH A;  1USS A;  4A12 A;  3U2R A;  3MQ0 A;  3LQR A;  1ZRF A;  4M71 A;  3D5L A;  4UXN A;  3HHH A;  2XAQ A;  2V79 A;  2L4M A;  5BPD A;  3CLO A;  2DQR A;  4UVC A;  3FX3 A;  3JAM K;  5HDK A;  3NRV A;  3H92 A;  2ZBK A;  3SHF A;  2W85 A;  2F5C A;  2DPD A;  2X0L A;  3F3X A;  1O7F A;  3RYR A;  2K86 A;  1SD7 A;  2EFW A;  2XAJ A;  2GA2 A;  1DPR A;  4GYG A;  1HW5 A;  3M7G A;  2FQ3 A;  2HWV A;  2VOP A;  2HZT A;  2C6Y A;  4IRI A;  1EH8 A;  2GIV A;  1BI2 A;  2XKO A;  1LVA A;  1AWC A;  2OAZ A;  5E8G A;  5D4R A;  3W6K B;  3DXJ F;  1XGN A;  4U0Y A;  4GO1 A;  5F6F A;  1B59 A;  3WTT C;  5IT3 A;  4EJU A;  4YII A;  1J75 A;  3ERE D;  1FBQ A;  4EV0 A;  1W7P D;  2JPC A;  4LJZ F;  5E8I A;  2YSR A;  3F23 A;  2BYV E;  4HW0 A;  4PGH A;  1IW7 F;  3U1D A;  4RAY A;  1GXP A;  5L3C A;  2EV6 A;  1G3S A;  2IA0 A;  1BJA A;  4N0B A;  5HS9 A;  3JSO A;  2DU9 A;  4KIB A;  2LNB A;  4YIF A;  1G4D A;  3T8T A;  1DP7 P;  3E97 A;  2EB7 A;  5A2Q Z;  1OKR A;  5LRR A;  2VOO A;  2EK5 A;  2ZKZ A;  2P5L C;  4IRG A;  1SD4 A;  4B09 A;  3K0L A;  5E17 F;  3HRM A;  5JI6 A;  5DUK A;  2FML A;  2IW5 A;  3KP4 A;  4KN7 X;  3K1N A;  2B0L A;  4OOI A;  4XLN F;  1LDD A;  2O0Y A;  3FMQ A;  5F1R A;  3MCZ A;  4ZZD A;  3LQQ A;  5ED4 A;  2HGC A;  3EYY A;  3LA2 A;  4CIC A;  1S7O A;  2PMH A;  1ZN2 A;  3RI4 A;  1QQI A;  1T6S A;  3MFK A;  4G7H F;  2Q2E A;  1JHH A;  4KMF A;  1RZ4 A;  4ZYE A;  4EM0 B;  1Y0U A;  4HAM A;  2XAS A;  4M6Y A;  1YLF A;  2DI3 A;  1SD5 A;  4FHT A;  1YFH A;  2HEO A;  1U5T C;  4HDV A;  4R1H A;  1IXS B;  4N9H A;  1FY7 A;  1F1Z A;  4L9N A;  3COA C;  5H6Q A;  1U78 A;  4KA4 A;  2GA1 A;  3F8N A;  1SAX A;  2Z3Y A;  1TQI A;  1GHC A;  2IA1 A;  1IN8 A;  3GZ5 A;  4FX4 A;  2R7F A;  3FWE A;  1YW9 A;  1F5T A;  1ZLK A;  2R3S A;  3T0Y A;  4MTE A;  3L7W A;  3TOB A;  5D8L B;  2YX4 A;  3ZPL A;  1ZGJ A;  4OIR F;  3WTY C;  2DPU A;  3IRQ A;  3U9G A;  2DAO A;  4PZJ A;  3GXO A;  4LK0 F;  1ZG1 A;  3I4P A;  5IT9 Z;  4RB2 C;  4P9U A;  3E6D A;  3T8R A;  3ZN0 A;  5LEK A;  4OIO F;  2CG4 A;  2ZO4 A;  3ZP5 A;  4BYY A;  4NB5 A;  1TLH B;  2J5O A;  2A68 F;  5FO5 A;  3RIR A;  2UXX A;  1IN5 A;  1IUY A;  2VON A;  3JW4 A;  1U5T A;  3J80 K;  2DQL A;  4HV6 A;  3GFJ A;  1XGS A;  1QNT A;  3L00 A;  2OZU A;  1FX7 A;  5LGN A;  5FGM A;  1BBY A;  1XGM A;  4CYD A;  3C18 A;  4HX7 A;  3BZ6 A;  1R22 A;  3L9F A;  2H6B A;  4M6X A;  2YPR A;  2O8X A;  5L3D A;  2H94 A;  2A07 F;  1IRF A;  3DEU A;  2GZW A;  3F8B A;  3HYI A;  3M1E A;  1ON1 A;  4RGU A;  1S29 A;  2FMY A;  5ICC A;  2VT2 A;  3WTS C;  4BHC A;  2EFQ A;  4ENN A;  1O57 A;  4G6D A;  1LDK B;  4IHT A;  1UCR A;  3F8M A;  5LHI A;  4H0E A;  4NQW A;  4UUV A;  2VT3 A;  2NS0 A;  3IL2 A;  3HSR A;  4IVN A;  4P55 A;  4LB6 B;  1BOA A;  5DEQ A;  3DP7 A;  3ABT A;  3DKW A;  3IWF A;  3RKX A;  3HRU A;  2Z99 A;  2VE9 A;  2XIG A;  4I02 A;  4MEX F;  3JAM Z;  3KP2 A;  2QBY B;  3TDU C;  4ZH4 F;  1WI9 A;  3DPT A;  4U7B A;  2Y75 A;  3BPX A;  5ILS A;  2P5K A;  4KIC A;  3QPT A;  3ZN1 A;  2MC3 A;  4EM2 A;  2NNN A;  4OMY A;  1KU7 A;  4I0B A;  2WWY A;  1FBU A;  2M30 A;  2XRO A;  3GO5 A;  3SXY A;  5LEJ A;  5FD5 A;  3B73 A;  1FOK A;  2HDC A;  3H3U A;  4OIQ F;  1FYK A;  4R8H A;  1P2F A;  2ESN A;  1TBX A;  1PUE E;  4GYI A;  5ILV A;  1AOY A;  5LGU A;  2ZFW A;  1FBS A;  4LK1 F;  1U5T B;  1KQ9 A;  3BJO A;  3D0S A;  4RB3 C;  4G8X A;  2LF8 A;  3DF8 A;  1PDN C;  1HBX G;  3Q9V A;  4HV5 A;  4LB5 A;  2DO7 A;  4BH9 A;  1Z7U A;  2GXG A;  2MH2 A;  3W6J B;  3BRO A;  2DTR A;  1SFX A;  5J6X A;  2OBP A;  1DDN A;  1BIA A;  2CGP A;  5HVQ C;  4HQM A;  1V3F A;  1SFU A;  3HSF A;  1MZB A;  4RB1 A;  2GXB A;  2LDU A;  3EET A;  3QU6 A;  2Q8K A;  2PEX A;  5L3G A;  2V1X A;  3FZV A;  3RPU A;  1JXS A;  1ZYR F;  5E1Z B;  1ZRD A;  2P7V B;  2QQB A;  1J9I A;  1Q1H A;  3LST A;  1KGS A;  2XAH A;  4OU0 A;  3E5Q A;  1B6A A;  2OU2 A;  1P92 A;  2PG4 A;  2JT1 A;  3LWF A;  5D4S A;  1LNW A;  2AXL A;  1F9N A;  2CQK A;  2YU3 A;  1T0F A;  2EV5 A;  1I1G A;  4UVA A;  1B9N A;  1TQP A;  2JZY A;  3ABU A;  2O3F A;  1ZG3 A;  3RPQ A;  3ML6 A;  2V9V A;  5HS7 A;  2EA2 A;  1ZRE A;  3HTU A;  4YFX F;  1E17 A;  2JSC A;  3QPH A;  2COM A;  2XV4 S;  2PMU A;  2BE5 F;  3I0T A;  3F72 A;  3P9I A;  3E3V A;  4HF0 A;  1E2X A;  1R1T A;  1GXQ A;  1UB9 A;  2ETH A;  3F6V A;  3MWM A;  4RGS A;  1FYL A;  3IC7 A;  1ONV A;  4HLX A;  1I1S A;  1Z6R A;  4KN4 X;  1ODD A;  2UWM A;  4HX8 A;  3HOS A;  3C1D A;  3I71 A;  1QBJ A;  4WXD A;  2MD5 A;  3VFZ A;  4CDG A;  4IXA A;  2Q0O A;  4HF1 A;  3OOP A;  2HYF A;  2L54 A;  4JQF A;  3E5U A;  2E7X A;  4M73 A;  3I64 A;  2OQG A;  1YS6 A;  1TQM A;  1W7P A;  2A3S A;  2O6G E;  3RKY A;  2DT5 A;  2PJP A;  3RTR A;  5JFR A;  4G9Y A;  1RUN A;  4UVB A;  2IT0 A;  3S2W A;  2ISZ A;  3IRR A;  4E70 A;  5BQT A;  4UHT A;  1XSX A;  4ENJ A;  1S8N A;  2A61 A;  3J80 Z;  2GAU A;  2HOE A;  4EM1 A;  1R1V A;  4XSX F;  1IZ1 A;  4ZZL A;  4UV9 A;  3BDD A;  5FLX K;  1XB4 A;  3M8F A;  1Z1D A;  3L09 A;  4HF2 A;  4PCQ A;  4WK8 F;  4ZYD A;  4LLG F;  2NRA C;  1YO5 C;  3ZMD A;  4MQV A;  4CHU A;  4L0Z B;  2HTJ A;  1SD6 A;  5E1X A;  5BS6 A;  1OR7 A;  3RYP A;  2DW4 A;  5DCF A;  2WV0 A;  5CYV A;  1FT9 A;  1LB2 A;  1XGO A;  3QAH A;  3QP6 A;  4ASN A;  2K7L A;  1XN7 A;  3ZQ7 A;  2NYX A;  2K4B A;  2EFN A;  3ECH A;  3P9K A;  3O6B B;  2D1H A;  2V1U A;  3MEX A;  4KT5 C;  1FP1 D;  2VBW A;  1T2K A;  2W57 A;  4G7O F;  1LQ1 A;  2CWE A;  1YW7 A;  2VXZ A;  2BV6 A;  3HUG A;  5CJ9 A;  5ICE A;  3IWZ A;  2PFB A;  4ESJ A;  3V7S A;  4CZZ A;  4Y17 A;  2EV0 A;  3GEZ A;  3REO A;  5FFX A;  2QWW A;  2E1N A;  3R6S A;  1OYY A;  4KIF A;  4A0X A;  2PN6 A;  4A5M A;  1O3R A;  2A5Y B;  3K9T A;  5E20 A;  5K1Y A;  4RGX A;  1D5V A;  3EQL F;  2RN7 A;  1BI3 A;  3EDP A;  2Z5U A;  1TW2 A;  5HS8 A;  3IKV A;  1L0O C;  5LLQ A;  2OQR A;  4O6J A;  1W7P B;  2QQ9 A;  5F64 A;  4AWX B;  4M9X A;  3V8L A;  4L9J A;  4LMY A;  3LAP A;  1V4R A;  2RC4 A;  1ZH5 A;  3BOQ A;  3TO9 A;  4HOB A;  1R1U A;  2LSO A;  2VN2 A;  5K5O A;  1EH7 A;  2L4A A;  2P6S A;  5LHH A;  4KUM A;  4A0Y A;  1VTN C;  4L9T A;  2RQP A;  2IRF G;  4I0A A; 
#chains in the Genus database with same CATH topology
 2MBF A;  5HLI A;  3CQZ J;  2QBY A;  1V55 H;  2X1E A;  4XRM A;  2X51 A;  2VQH A;  1QZY A;  4WX9 A;  4RGR A;  4UB6 C;  3PSI A;  3PIO F;  2DOD A;  4QTR A;  2JWT A;  5J1U A;  5BPI A;  3RSN A;  1QHH D;  2IGO A;  3OWT A;  2EWN A;  5D6F A;  4LG0 A;  3TMO A;  5M3F J;  3FXK A;  3G71 I;  3N4M A;  3HB9 A;  3LSP A;  2IA2 A;  2CW0 F;  2O5R A;  4I98 B;  1K83 J;  1D5Y A;  1DPU A;  3OOU A;  4NDL A;  1BIB A;  1AKH A;  1IXR C;  3KZZ A;  1IN4 A;  3CME I;  3HRT A;  2M45 A;  2V6C A;  2HVR A;  3DBR B;  3L2Q A;  4MGR A;  1R4M B;  3R0A A;  5ERI A;  1ETK A;  4A3I J;  2HPI A;  1HW2 A;  1FJL A;  1S5L C;  2AHQ A;  2IS4 A;  2XB0 X;  1GDT A;  3FXL A;  4I76 A;  4Y13 A;  2CUF A;  2BGC A;  4C3H J;  3ZQQ A;  2W1O A;  1ERD A;  2NNY A;  2DMQ A;  3CUO A;  3CMM A;  2G0E A;  3LA7 A;  4D5C A;  3OS1 A;  2K3F A;  1R23 A;  2RV8 A;  5FKM A;  2F4M B;  5M5Y J;  2O03 A;  4EGZ A;  4B48 A;  1Z9C A;  4RMN A;  1AU7 A;  1J09 A;  3TW6 A;  3MKZ A;  3F8F A;  4B3X A;  3LAJ A;  1UHM A;  2L7K A;  5GTI C;  2W7N A;  2JN6 A;  4ABZ A;  4A6E A;  1RIO H;  3WG7 H;  2DYR H;  4HA8 A;  2VKE A;  2HYJ A;  4PJM A;  2VKV A;  4EMS A;  4ENM A;  2JA6 J;  3KP5 A;  4EGY A;  1YE9 A;  3WGH A;  1LJ9 A;  2VBY A;  2L9S A;  1Y1W J;  2F48 A;  1RI7 A;  3GTJ J;  2MFZ A;  3BQZ A;  3FMR A;  3Q5F A;  4E7Z A;  4FAS D;  4U88 A;  1WHU A;  2RVC A;  1X3U A;  3BTJ A;  2EJR A;  3HUG B;  2R93 J;  2OTL I;  2QEX I;  1PP8 F;  3MAJ A;  4BAC A;  4MTD A;  1MJ9 A;  1YYV A;  2MGQ A;  4AIH A;  1N75 A;  2WAD A;  2VC1 A;  3S3O A;  4LIV A;  2PQ8 A;  4DQ2 A;  1JUM A;  3FXU A;  2JJ7 A;  2L9N A;  4DYQ A;  2ZSH B;  2KIM A;  3M8E A;  2JK3 A;  1QU3 A;  3RQI A;  1YG2 A;  3R61 A;  1KU9 A;  1TNS A;  2ZME C;  3BP8 A;  2L9R A;  3HBL A;  1FSE A;  4L9V A;  2XUB A;  3D5R C;  5DDG A;  1R5H A;  1WWX A;  4BE1 A;  2R7U A;  2R7R A;  2CUZ A;  2G9W A;  5EEH A;  2FXA A;  3O8G A;  4H4K C;  4CCM A;  1I5Z A;  3V7C A;  1G3W A;  3CDH A;  2OF7 A;  4M9S A;  3JRI A;  1D3Y A;  4WXH A;  3DTK A;  4S04 A;  3H0D A;  4RAZ A;  1SFK A;  2IS1 A;  1QPI A;  5D5X B;  1KYZ A;  4A3E J;  4IQ4 A;  1X2N A;  3S3N A;  4M3D A;  5AIP A;  4IEJ A;  2PLY A;  3WGI A;  4BEH B;  1WVR A;  2FQ4 A;  2QUF A;  3K4M A;  5EEG A;  5JVT A;  3PNT A;  5HOO A;  1REP C;  3VEP A;  1ZR4 A;  2K02 A;  3TOA A;  1S6L A;  5JR3 A;  3PO2 J;  3TBI A;  5KNL A;  4EJW A;  2BY0 A;  2MG4 A;  2H1K A;  3PFI A;  3WTU C;  4XR6 A;  4KYW A;  3TKY A;  5EGO B;  1Y8Q B;  4B44 A;  4G6T B;  5E18 F;  2KJB A;  4BHB A;  1HKS A;  2OPT A;  2ME0 A;  3P9C A;  1RUO A;  5CVR A;  4KNY A;  1VQ5 I;  1HST A;  1XD7 A;  2CRG A;  4EJV A;  1QGP A;  3OYI A;  1K7A A;  1AA7 A;  2KPM A;  2Y0S A;  4WXC A;  5FRO A;  4A0Z A;  1GV5 A;  2EA4 A;  3KZI C;  2A5W A;  5H6R A;  1D0X A;  3KX2 A;  5L3F A;  2I8D A;  3L2C A;  3AAF A;  2JA7 J;  4II3 A;  3V8J A;  1WSU A;  2KIU A;  1Z0X A;  5E79 C;  2DLL A;  1OCC H;  4FE7 A;  1QO0 D;  1XCB A;  5A2Q K;  4G7Z F;  1J59 A;  2Y31 A;  3VOE A;  3QRF F;  2GM4 A;  5HNH A;  4LG0 B;  3GTL J;  1MJA A;  2ZME A;  4F92 B;  2LRD A;  1K79 A;  1O4X A;  4EJT A;  1T33 A;  4JX4 A;  1OPC A;  5KAI C;  4DNC A;  1O3S A;  1FZP B;  3QYE A;  3X2Q H;  3P5J A;  3VSL A;  1AKH B;  1PP7 U;  1RPW A;  3LMM A;  2STT A;  4IHY A;  2PMZ A;  1UHW A;  1X3W B;  1NHA A;  4HBL A;  4IRH A;  1YHQ I;  2R4G A;  4A93 J;  5M5W J;  5HDN A;  4UUS A;  1MBE A;  3JTH A;  1XDU A;  1MSF C;  5J3L A;  3PNY A;  4ESF A;  3BZC A;  1U6G A;  1YQA A;  4B4C A;  2E5Z A;  4XNF A;  2Z9O A;  5FLX Z;  4C2M J;  1V5F A;  4I2O A;  5F27 A;  3BQY A;  1LFP A;  3HRS A;  1JE8 A;  3WGG A;  2PI0 A;  1H9T A;  4RB0 A;  2F5V A;  3C3W A;  1X4P A;  2M5W A;  4PSW A;  2M1B A;  5F1J A;  2HXO A;  3PQJ A;  4I99 C;  4KIG A;  1P4W A;  2LP0 A;  4OIP F;  5JLW A;  2EQR A;  3IKT A;  1HKT A;  2XKP A;  3CUQ B;  3GLX A;  2HQR A;  4E7K A;  4MNU A;  3ZMT A;  1JUS A;  4NUB A;  1IN6 A;  1MGT A;  3CDI A;  3TGN A;  1UMQ A;  2JUG A;  4IJA A;  2JVG A;  1LPQ A;  1XCV A;  2R5Z A;  1WZ2 A;  3PIP F;  4XL9 A;  1YIT I;  1TNT A;  4BXX J;  3M8J A;  4BXU A;  3T1B A;  3FKI J;  1JGS A;  1XSV A;  1ON2 A;  1LE8 A;  2MA3 A;  3FMS A;  4EEF G;  2LY9 A;  3FK7 A;  4AD9 A;  3CCM I;  3W2A A;  3CMA I;  2W25 A;  3BWG A;  3KPH A;  1ZHF A;  3RDI A;  3CC7 I;  2VOD A;  4AUX A;  3H1C A;  3R4K A;  3GW2 A;  3E5X A;  1D1C A;  2FU4 A;  2ID3 A;  4L5J A;  3DFG A;  2DMT A;  1CF7 A;  2H27 A;  2GBY A;  3WTW C;  1I6X A;  4NC8 A;  5CVU A;  3H3Z A;  2F5E A;  3QOP A;  1KQ0 A;  2CW7 A;  5FLM J;  2DN0 A;  2RAE A;  1R58 A;  2P5V A;  2NOJ B;  1VND A;  1EF4 A;  5TIS C;  1NK3 P;  3ZMZ A;  2CO5 A;  4MHG A;  2HQ5 A;  4JBA A;  4PUS A;  2ELJ A;  3LA3 A;  2FF4 A;  4HX4 A;  2HQA A;  3K70 D;  4OIN F;  2Z16 A;  3MZH A;  1EH6 A;  2UZK A;  2GWR A;  3HJE A;  4W1U A;  1Z05 A;  4LLL A;  2DFI A;  1QHG A;  3SZP A;  3DV8 A;  1OMI A;  4XLP F;  4C2T A;  1FNN A;  1DGW Y;  1A5J A;  2W24 A;  2W00 A;  3BTC A;  3HDD A;  2OV7 A;  1P6R A;  1I3Q J;  4FQG A;  1MMS A;  4CGZ A;  3TQN A;  3SFZ A;  2QQ8 A;  2DA1 A;  5F0H A;  3HZJ A;  1IDY A;  1MJB A;  1HF0 A;  1JKO C;  3TED A;  1ZAO A;  2W82 A;  1ZRC A;  5TJJ A;  2DYS H;  1SVL A;  2KDO A;  2VB6 A;  5HLH A;  3IHU A;  1TT5 B;  4D9J A;  3HOT A;  3GFL A;  4Y3O A;  4D7N A;  4OMZ A;  1BI1 A;  4EAT A;  1P7I A;  2M7A A;  4Y7N J;  1U8R A;  2DOF A;  4I01 A;  4FX0 A;  1FSH A;  2XF7 A;  1F4K A;  2P7C B;  2LKP A;  2DT7 B;  3WTZ A;  1GVJ A;  2D1V A;  4DYR A;  1E3O C;  1GUU A;  3KE2 A;  1XMA A;  4LOC A;  3K4J A;  2V26 A;  5EYR A;  2ZME B;  4IOA F;  4U0W A;  2DA6 A;  1IJW C;  2QQA A;  2H09 A;  2AQF A;  3H5R A;  2XGE A;  4N4O B;  2YR2 A;  5E3O A;  3WTX C;  2R7Z J;  3V4G A;  1XSD A;  4XKW A;  2BZT A;  5DD4 A;  1NG6 A;  5D8K B;  5M3M J;  4LD5 A;  4WWC A;  3PUB A;  3H0G J;  2R7W A;  3W2W A;  2A6E F;  2L02 A;  1HQC A;  3VOD A;  2HXI A;  4CXF A;  1H9G A;  2ZC2 A;  3KEO A;  4BL0 B;  5LGT A;  2ZXJ A;  4HYE A;  3CDL A;  2UV1 A;  2HU9 A;  4UUS B;  5H2F C;  3A0H C;  2KIF A;  3WE2 A;  1J5Y A;  2M7B A;  3MZY A;  4JK1 X;  1IUF A;  1BC8 C;  3LSK A;  1W0U A;  4DW6 A;  1SMY F;  3AKZ A;  1I27 A;  5D5V B;  1P4X A;  3S93 A;  2P4W A;  2ZJR F;  3C2B A;  1A35 A;  1ZGW A;  2M8E A;  1F43 A;  4XK4 A;  5CLS A;  4GCV A;  1W5T A;  2OD5 A;  2MSY A;  4MLO A;  3CO6 C;  3J81 K;  3U1K A;  5LD2 C;  5GPC A;  3S15 J;  3CJT B;  3HKZ N;  2EZL A;  2XGX A;  1P4A A;  5J47 A;  3TP3 A;  4XKC A;  2HR3 A;  4I7H A;  5TRD A;  2PBI A;  3L2V A;  2R5Z B;  3O3K A;  2Z1D A;  4E7I A;  3B02 A;  3ECO A;  2X1D A;  1IAW A;  1NK2 P;  1ZAR A;  2RNJ A;  1TT0 A;  5ICG A;  2WB1 A;  2XRN A;  4HST A;  3VYU B;  4BQN A;  3ZMU A;  1LE8 B;  3TP0 A;  1G2H A;  3M3Y J;  2DJI A;  2KHM A;  2KLO A;  4P96 A;  1CGP A;  4IHW A;  4CSW A;  4AYB N;  1A31 A;  3H9J A;  1CF7 B;  1MDM A;  4U7D A;  2FA5 A;  4TV7 A;  2XVC A;  4A69 C;  5D5W B;  1X19 A;  5BMZ A;  4AC0 A;  2H6C A;  3TO7 A;  1K4T A;  4M72 A;  3K2Z A;  1U3E M;  1WQ2 A;  2ESH A;  4MEY F;  1T38 A;  1XDS A;  2BOL A;  2BXZ A;  2VJ5 A;  2DA3 A;  2CV2 A;  1X4O A;  2XF5 A;  3ROU A;  5EG0 B;  3HOV J;  4M9Z A;  4B1R A;  5ILU A;  4M74 A;  2MAB A;  2QM3 A;  3BCB A;  2F5F A;  2K5C A;  3SDB A;  4CCL A;  3S16 J;  3T5X A;  1S7A A;  3CJN A;  3K7A J;  1R49 A;  3S1R J;  3HTS B;  2TDX A;  3S32 A;  4DZJ A;  5LFA A;  3G1O A;  4ENK A;  3I53 A;  3MZ8 A;  1L3L A;  3DLL F;  1FOW A;  2L01 A;  4IL6 C;  4F3Q A;  3ULQ B;  5CPR B;  1QVU A;  5FJ8 J;  3FHZ A;  2E7W A;  2AQE A;  5DV5 A;  5JHU A;  1K4S A;  2MLG A;  1UG2 A;  1C0W A;  1NTC A;  4M3B A;  3VYR B;  1ZLJ A;  3RKW A;  3ZR8 X;  1PJR A;  4V2G A;  4Q4Z F;  3L2W A;  4IZZ A;  4EVI A;  3CCE I;  5DYM A;  4RAG A;  1QZZ A;  3D1N I;  4HZF A;  1W4M A;  3CZ6 A;  3Q0V A;  3I54 A;  4XKB A;  2LD5 A;  2LG4 A;  4BY7 J;  2H1L A;  4KDP A;  1WH7 A;  3QYB A;  2KFD A;  3ZQL A;  4IHV A;  2E2J J;  1ULY A;  3KP6 A;  3DEW A;  1XS9 A;  2RKH A;  2DOE A;  3WTV C;  2FBK A;  4F93 B;  1IN7 A;  3R60 A;  1HXD A;  3OYL A;  3F22 A;  9ANT A;  1WJC A;  2CQ7 A;  1V54 H;  2DK8 A;  4XOR A;  5FB2 A;  2JMW A;  3Q9S A;  3ASN H;  5AIQ A;  2DJN A;  3K1P A;  2ELH A;  4AM3 A;  3O2P E;  2LF7 A;  2CFO A;  2JRM A;  3QOD A;  3KLO A;  2IEK A;  3PQK A;  2VKD A;  1JGG A;  4MFD A;  3OYC A;  2V4J C;  2ZNY A;  4MO7 A;  4XLH A;  1B8I A;  4Y52 J;  1T39 A;  2D2W A;  4BQQ A;  4Y33 A;  1FWZ A;  3MVP A;  1RR8 C;  2HKO A;  3AG3 H;  3BY6 A;  2STW A;  4C2U A;  4Z2Y A;  2NOG A;  4L5I A;  3TDZ C;  5FKL A;  4BHP A;  4U0V A;  3KP3 A;  5E3L A;  1DUX C;  1WFX A;  4UNO A;  5D5U B;  1IV6 A;  4XBF A;  1B4A A;  2HTS A;  3J7Z I;  4PJN A;  1KU3 A;  1Y6I A;  4XN3 A;  4ZYG A;  2BY1 A;  4UV8 A;  3LFK A;  2IAI A;  2LTP A;  1KQ8 A;  2O61 A;  2E1M B;  1OYW A;  2CJJ A;  1FMV A;  1B1B A;  1RKT A;  3FHN A;  5J40 A;  1U8B A;  2VBX A;  3W2V A;  3CJR B;  1D0Z A;  2M8G X;  3DCF A;  3IH3 A;  2FE3 A;  5K7F A;  4YFN F;  3OYF A;  4XQF A;  4BAY A;  1YTY A;  1MH3 A;  1X1A A;  3BR6 A;  2IVM A;  1G59 A;  4F7Z A;  3PJR A;  5EEA A;  3D5S C;  4ZDO A;  5LBQ A;  1PUF A;  1IO2 A;  2QEN A;  5H20 A;  5B3S H;  2E60 A;  3F6O A;  1S9H A;  2ZXI A;  3I58 A;  1U9N A;  2X6O A;  2NVQ J;  4CCO A;  3M9A A;  4D7M A;  2JUC A;  2RDP A;  4ZYH A;  4HSR A;  4BY1 J;  3H9Q A;  2ZJ2 A;  3IV5 A;  1K6O A;  2XGD A;  3G73 A;  1MDM B;  2L3D A;  3SZG A;  1R7J A;  5L3B A;  4RA2 A;  1WKM A;  3HG9 A;  1A6I A;  1P9Q C;  1E0E A;  4NC7 A;  3CUQ C;  1JJ8 C;  3CLQ A;  1LEB A;  2E35 A;  2AO9 A;  3K1M A;  3VYT B;  1JKP C;  2HKX A;  1BI0 A;  4LFU A;  4G12 A;  2DA4 A;  1R36 A;  5DCM A;  5FRM A;  1LFU P;  2M87 A;  3KEQ A;  1LFB A;  1STZ A;  3ESW B;  4XKV A;  2GLO A;  3GBG A;  3F21 A;  2TRT A;  4Y15 A;  3NQO A;  4IF4 A;  1ZR2 A;  4R79 A;  2CFX A;  2Y0M A;  2WBM A;  2BY2 A;  1OJL A;  3ZMV A;  3BTI A;  2Y0S N;  3EUA A;  4L0Y B;  1SVO A;  2HI3 A;  5BOX A;  1XPX A;  4Q5S F;  4OWR B;  5HDG A;  4BXF A;  4IKF A;  1MMA A;  2XAF A;  1MMG A;  1O3Q A;  4Q47 A;  2A69 F;  2EIJ H;  2KIS A;  4ZDP A;  2LY1 A;  2F4I A;  3ASO H;  3DQV C;  3HXL A;  2VE8 A;  2DK5 A;  4D5F A;  3PL8 A;  4AID A;  4WCG A;  4IO9 F;  2EZK A;  2OZ6 A;  3QYF A;  1UG0 A;  2AS5 F;  3DPU A;  2K4J A;  1IV8 A;  5KCM A;  3S1Q J;  2ISY A;  4Q48 A;  1YIO A;  4WF2 A;  5KVR A;  5C4J J;  3BC8 A;  1R5G A;  3GFM A;  1WRJ A;  2PMZ N;  2Z2S B;  3KLN A;  4IHS A;  1VQ6 I;  2FRH A;  3GME A;  3EYI A;  1DP3 A;  3RJP A;  1Z3Y A;  4AIK A;  2WTE A;  4QWQ A;  1K78 A;  1V5G A;  4LIU A;  2R0Q C;  2LVS A;  2LLK A;  3HIF A;  4NHJ A;  3QU3 A;  2IJL A;  3WE3 A;  2FEZ A;  5CVV A;  3HSE A;  5FKO A;  5FFZ A;  4CO8 A;  1TW3 A;  1KU2 A;  3F8C A;  2KRF A;  2FSW A;  3BG7 A;  4DZP A;  2M4G A;  2R7T A;  4LLN A;  1YX5 A;  2J5P A;  3GCM A;  2F4O B;  1TWF J;  5GPA A;  5CQG A;  3CUQ A;  3FXR A;  5LHG A;  4KFC A;  2E19 A;  3BG3 A;  1UFM A;  2K3P A;  3LFU A;  2DXI A;  4KMU X;  2QYO A;  3FK6 A;  1OFC X;  3BLY A;  3RZD J;  4A3B J;  4LIT A;  4RS8 A;  2MLK A;  2E5N A;  5DUI A;  1OYI A;  4YIR X;  3K69 A;  3EUH C;  1B8I B;  1X2M A;  3K10 A;  2GOM A;  2MYS A;  2OCE A;  5CVJ A;  2ZSI B;  2KL4 A;  2G7U A;  3FBI B;  5J8F A;  4ESB A;  1JT0 A;  2FNA A;  1LEA A;  1T98 A;  5F04 A;  1I50 J;  3CC4 I;  5HLG A;  1R9T J;  3W6V A;  3KFW X;  1LDJ A;  2M3A A;  3BJ6 A;  2WC2 A;  4QIW N;  4YG2 F;  3V42 A;  3ZQC A;  3KZY A;  4FIS A;  1M1E B;  2CUE A;  3KCC A;  2RNG A;  1O3T A;  2K9M A;  4X0G A;  1J0R A;  1R00 A;  4DOZ A;  3GFI A;  3WG9 A;  2XHK A;  1Z91 A;  1KA8 A;  3CCY A;  3KP7 A;  2CS3 A;  2BEO A;  1VQ7 I;  1VFC A;  1VZ0 A;  3E0J B;  1O7L A;  2R7D A;  1FC3 A;  2VBZ A;  2W48 A;  2BHY A;  2BW3 A;  1G3Y A;  1TP4 A;  2VC0 A;  2EH3 A;  5IOZ A;  3S8P A;  3LSH A;  1RNL A;  2JTV A;  5CVI A;  3ONQ A;  1PUF B;  4S05 A;  1E3H A;  4HQE A;  5K5R A;  4IPA A;  2PJR A;  2Y48 A;  4YRV A;  4BNC A;  5J8C A;  2CYY A;  1D8J A;  1VI0 A;  1SC7 A;  4MEX F;  1QRY A;  1N77 A;  4LGW A;  3ISP A;  1Y1V J;  1MD0 A;  3FF5 A;  1MW7 A;  3GTP J;  5D6E A;  4N9I A;  4FTH A;  3E1S A;  3G1L A;  2LY2 A;  3GYH X;  6PAX A;  3GF2 A;  1JHF A;  3J81 Z;  2YS9 A;  1ZKG A;  4A2U A;  3K70 C;  1IRX A;  4MFE A;  2K9N A;  2IPQ X;  1G8X A;  3GX4 X;  3QWL A;  4EJO A;  1A04 A;  3BJA A;  3NEU A;  1PVE A;  3SEZ A;  3E6B A;  3WHB A;  1Z6T A;  3L2R A;  4HDU A;  1FYM A;  5DCM B;  4LG3 A;  2X6W A;  1W5S A;  3EUH A;  4G94 A;  3JRD A;  3CES A;  1Y8R B;  1WCM J;  4YEL A;  2EFP A;  3CTA A;  4I6Z A;  4M3G A;  1EA3 A;  2L7M P;  2ZCW A;  3LSJ A;  1HW1 A;  2BXY A;  3G1M A;  1BN5 A;  1FPQ A;  4AVP A;  2R7V A;  3CCR I;  2EFO A;  2A6H F;  3OV8 A;  1WJ5 A;  3ZQG A;  4AU7 A;  3I59 A;  4A5N A;  4PJL A;  3OYN A;  3JCU C;  1FLI A;  2QVO A;  4O5V A;  4HLY A;  1SFE A;  3PM1 A;  2QSG X;  1HCR A;  5GTH C;  1IRG A;  3WOD F;  1OCT C;  4I09 A;  2K85 A;  5L3E A;  2B7E A;  1KYW A;  3VYS B;  2Y69 H;  3QP5 A;  1B9M A;  5HOD A;  3FIS A;  1ENH A;  2NAZ A;  2FOK A;  3JRG A;  4L18 B;  3HHG A;  2MC4 A;  2BBY A;  3BPV A;  3E6M A;  1K78 B;  2GQQ A;  4P9F A;  3WU1 B;  5IY5 H;  1ZG5 A;  4MQ9 F;  1TTY A;  3FXQ A;  5B1B H;  1HOM A;  2L5Q A;  1SMT A;  2BVM A;  3G3Z A;  4GXO A;  4JP0 A;  4CYC A;  1FEX A;  3CMY A;  2V9K A;  2O7O A;  2L7Z A;  2RGV A;  3ZMS A;  2XRL A;  2E34 A;  2X4H A;  2MW8 A;  1AHD P;  2CSO A;  4GGG A;  5C44 J;  4GDF A;  3V7R A;  1SFO J;  1BM9 A;  3GTK J;  2IP2 A;  2DBB A;  4YFK F;  5K7Z A;  3TO6 A;  2XC7 A;  2LRE A;  5IPA A;  2QLZ A;  2AXT C;  3NAR A;  1RES A;  1VF9 A;  2P8T A;  2HDW A;  3DPL C;  2YX7 A;  2KP6 A;  2M34 A;  1MKM A;  2I5U A;  4CH7 A;  5E1W A;  3J7A O;  2Y9Y A;  2ACJ A;  3WHC A;  5ICF A;  3E6C C;  1BC7 C;  3S2H J;  2XAU A;  2HS5 A;  2FBI A;  2UXN A;  3FM3 A;  2VJJ A;  1ZGA A;  3AL0 C;  4P5O A;  2DT6 A;  3S1N J;  2LYC A;  2WB1 N;  3WU0 A;  1IF1 A;  5IYD J;  3LSM A;  1WPK A;  4K2E A;  1YS7 A;  3KET A;  3FDY A;  1FP2 A;  3VB2 A;  5DTD A;  3JRH A;  2MD0 A;  4EQQ A;  5DD8 A;  1U2W A;  1QPM A;  2BY3 A;  2JRT A;  3ZQF A;  5IOY A;  3BT9 A;  3SZT A;  2BW3 B;  1TWG J;  5IT9 K;  2Y30 A;  4DJA A;  1BL0 A;  1QVT A;  1FMW A;  4N4N B;  5JHF A;  2F5D A;  2EIN H;  5EG0 A;  1IXC A;  5AON A;  4G6Q A;  4X6A J;  3KYC B;  1TWH J;  3MKL A;  4ON0 A;  4JOM A;  2PJR B;  3ELK A;  1J7K A;  1X58 A;  1HSJ A;  2W84 A;  3N97 A;  2PX9 A;  2Z33 A;  2L0K A;  5KK1 A;  2FNP A;  1UST A;  3KIO A;  2LK2 A;  4DBR A;  2HQN A;  5FD6 A;  4A3G J;  3TW7 A;  1XMK A;  1UHS A;  3JRC A;  3OIP A;  1QA6 A;  5DM6 F;  1ITY A;  2V1D A;  1R4N B;  3P7N A;  1S72 I;  3BR2 A;  2E1M C;  2R7O A;  2E1C A;  3SYT A;  4PGG A;  3AG4 H;  3SQN A;  2W4S A;  1J2X A;  2LKS A;  4XN0 A;  4F52 A;  3IP4 B;  1G6N A;  2ZJP F;  2XAG A;  3CJQ B;  1POG A;  2NVU B;  1HKQ A;  2HFH A;  4QLC U;  1B72 A;  2JPB A;  4HNT A;  3K2A A;  1X1C A;  1YW8 A;  4QPQ A;  1Z67 A;  2OA4 A;  2L7F P;  4FT8 A;  3JSP A;  1D8K A;  4F91 B;  3CCQ I;  3NWS A;  2QZ8 A;  5LRS A;  2HYG D;  1VQP I;  2DMP A;  3I59 B;  3GWZ A;  2MH9 A;  3GVA A;  4PFP A;  1EV7 A;  3NWT A;  3OSG A;  4A3D J;  1RET A;  5FRN A;  4B8X A;  5K5Q A;  3IH4 A;  3RPU D;  3GUD A;  2G7H A;  2F2E A;  3CP2 A;  2XB5 A;  4A6D A;  3GZ6 A;  1JKR C;  1X1P A;  4ANJ A;  5FKK A;  3A01 A;  2K27 A;  3V8K A;  4CCN A;  5EJC A;  1MSE C;  1LKX A;  2VL8 A;  3I5U A;  1H0M A;  4ETS A;  3R0J A;  4AIJ A;  3GTG J;  4BE0 A;  4D0P A;  1P7J A;  2ZNZ A;  4BQA A;  2ADU A;  2GOX B;  2WAQ A;  3F0C A;  3F9K A;  3I9V 2;  4XRF A;  2D45 A;  1HDP A;  2V6E A;  2P6T A;  4XSZ F;  4PDK A;  4CYC B;  2YUS A;  2KJC A;  4M3F A;  1G3T A;  4O3M A;  3C7J A;  2KKO A;  1ZK8 A;  3FM5 A;  3CO7 C;  1Y39 A;  3JTG A;  3AG2 H;  4HNU A;  1YRN A;  3HOY J;  3DLA A;  1S3J A;  2M0C A;  2FBH A;  1USS A;  1VQL I;  4A12 A;  2ECB A;  2JSP A;  1ETO A;  3U2R A;  3MQ0 A;  4BJ6 C;  2K9L A;  1OCR H;  3LQR A;  3MN2 A;  2F6C A;  4M71 A;  1JJ6 C;  3S3M A;  1ZRF A;  3D5L A;  4UXN A;  1MBG A;  1VQN I;  3HHH A;  3DKY A;  5BNG A;  2XAQ A;  4V19 K;  2V79 A;  5J4V A;  2L4M A;  4Y4R A;  1W5C C;  5BPD A;  3CLO A;  2DQR A;  4UVC A;  3FX3 A;  2M9H A;  3WU2 C;  3JAM K;  3OIQ A;  3BTL A;  3I55 I;  5HDK A;  3NRV A;  3DTI A;  4RAF A;  3H92 A;  2ZBK A;  2DOA A;  3SHF A;  3DKX A;  2W85 A;  2F5C A;  2DPD A;  1BOB A;  3SDG A;  2X0L A;  3LSI A;  1Z3X A;  3F3X A;  4E7J A;  1O7F A;  3RYR A;  2NVT J;  2K86 A;  1D1B A;  1DU6 A;  2WAF A;  4QSH A;  1SD7 A;  3A1Y A;  4RM2 A;  3MKY B;  2D5V A;  2EFW A;  2VJI A;  2XAJ A;  2GA2 A;  1DPR A;  4V2F A;  4GYG A;  1HW5 A;  1OLT A;  3EPZ A;  4GFB A;  3M7G A;  1FOY A;  4JYK A;  2FQ3 A;  1GV2 A;  2HWV A;  2HZT A;  2VOP A;  2C6Y A;  1WH5 A;  5J4Y A;  1WGX A;  3UKG A;  4IRI A;  1EH8 A;  3ZCO A;  3K4N A;  3CCL I;  1NG7 A;  1BI2 A;  2GIV A;  2XKO A;  1LVA A;  2EIK H;  1AWC A;  2OAZ A;  5E8G A;  4XIC A;  1CQT A;  2ID6 A;  2XF6 A;  5D4R A;  3W6K B;  3DXJ F;  1XGN A;  3BCA A;  4GO1 A;  4U0Y A;  5F6F A;  1B59 A;  2CU7 A;  3CF2 A;  3WTT C;  5IT3 A;  3ABL H;  4BS9 A;  4EJU A;  4YII A;  1J75 A;  2X48 A;  1RKW A;  3ERE D;  5JVG F;  3PO3 J;  5B1A H;  3FBN B;  1JI8 A;  1FBQ A;  4B47 A;  4EV0 A;  1W7P D;  2JPC A;  2DFF A;  4LJZ F;  5E8I A;  1B72 B;  1A36 A;  3JRF A;  3K4K A;  4II2 A;  3ERM A;  2YSR A;  3AL0 B;  3F23 A;  2BYV E;  4ZJZ A;  4HW0 A;  4PGH A;  1FIA A;  1ZQ3 P;  4J01 A;  3M4O J;  4NC6 A;  1IW7 F;  3HOU J;  3U1D A;  4CA0 A;  1OCZ H;  2CH0 A;  5DM7 F;  4RAY A;  3L2U A;  1GXP A;  3ZOB A;  5L3C A;  2EV6 A;  1G3S A;  4HEA 2;  2N8G A;  2IA0 A;  1BJA A;  1ETV A;  3A01 B;  4XOP A;  2X9D A;  2QSF X;  4UB8 C;  4N0B A;  2EIL H;  1MH4 A;  3PFY A;  5HS9 A;  3JSO A;  2QGU A;  4GRI A;  2DU9 A;  4KIB A;  2R5Y A;  3Q0W A;  2LNB A;  3FXO A;  4YIF A;  2XSD C;  1G4D A;  5GAD J;  4UY8 I;  1W36 D;  3T8T A;  1DP7 P;  1NH3 A;  3E97 A;  2EB7 A;  4E7H A;  5A2Q Z;  3OYA A;  1OKR A;  3RCO A;  5LRR A;  3OYB A;  4B3A A;  2VOO A;  2EK5 A;  2ZKZ A;  2JA2 A;  2P5L C;  1MBH A;  4IRG A;  5EZG A;  1SD4 A;  1YRN B;  4B09 A;  4PFO A;  3K0L A;  2DA2 A;  5E17 F;  3HRM A;  5JI6 A;  2QCO A;  1MMN A;  4CUG A;  3OSF A;  5DUK A;  3GTM J;  3IAM 2;  1TWA J;  2KRH A;  1TL8 A;  1K6Y A;  2FML A;  2IW5 A;  3KP4 A;  4KN7 X;  1H8A C;  4A3L J;  3VWB A;  3K1N A;  2B0L A;  4OOI A;  4XLN F;  1LDD A;  4XOT A;  4BGD A;  1X3Z B;  2OCC H;  2O0Y A;  1OCP A;  1Z77 A;  3FMQ A;  5F1R A;  4BBS J;  3MCZ A;  4ZZD A;  3LQQ A;  1IRZ A;  5ED4 A;  2HGC A;  2OJE D;  3EYY A;  3LA2 A;  3Q3S A;  4CIC A;  3B6C A;  3BR0 A;  1S7O A;  2PMH A;  1ZN2 A;  3RI4 A;  2P81 A;  3ABK H;  3UNG C;  3MMY B;  2FX0 A;  3VDX A;  1QQI A;  1T6S A;  3MFK A;  4G7H F;  2DTZ A;  2VQG A;  2Q2E A;  1JHH A;  4KMF A;  1RZ4 A;  4FET A;  2YU9 J;  4ZYE A;  4EM0 B;  1Y0U A;  4HAM A;  2XAS A;  4M6Y A;  2ECC A;  1YLF A;  5M5X J;  2DI3 A;  1SD5 A;  4FHT A;  1YFH A;  2HEO A;  1TZL A;  1U5T C;  4HDV A;  4R1H A;  2QA4 I;  1IXS B;  4N9H A;  3K4L A;  1FY7 A;  1F1Z A;  4L9N A;  3COA C;  1Y56 A;  5H6Q A;  2LC2 A;  4OAY A;  3KYL A;  1U78 A;  4BU2 A;  4KA4 A;  2GA1 A;  2XPU A;  2EBI A;  3F8N A;  1MNE A;  1SAX A;  4BUP A;  2Z3Y A;  1TQI A;  4S0H B;  4B43 A;  3OL3 A;  2IA1 A;  1GHC A;  1IN8 A;  2HNH A;  3PUF A;  1BR2 A;  3Q0U A;  1YI2 I;  3GZ5 A;  4FX4 A;  2WY8 Q;  2R7F A;  3FWE A;  1YW9 A;  1F5T A;  2BVL A;  2LFB A;  2FOW A;  1ZLK A;  2R3S A;  3T0Y A;  3S1M J;  4MTE A;  3HPG A;  3L7W A;  3TOB A;  5D8L B;  2HDD A;  2YX4 A;  3ZPL A;  3FXJ A;  5C4X J;  1YOV B;  1S7E A;  1ZGJ A;  4OIR F;  3WTY C;  2DPU A;  3IRQ A;  2ME6 A;  3S17 J;  1HLV A;  2KT0 A;  1APL C;  4XID A;  1U9O A;  3OL4 A;  3U9G A;  3BG6 A;  3RZO J;  2DAO A;  4PZJ A;  3GXO A;  4LK0 F;  1ZG1 A;  4RLF A;  2NS7 A;  3I4P A;  5TGT A;  3HOZ J;  4RB2 C;  5IT9 Z;  4P9U A;  4XM3 A;  1RR7 A;  3E6D A;  3T8R A;  3ZN0 A;  3LNQ A;  3A2K A;  5LEK A;  4OIO F;  1YJ9 I;  2CG4 A;  2ZO4 A;  3ZP5 A;  3BR3 A;  4BYY A;  1ETQ A;  2CQQ A;  3HC7 A;  2DMU A;  1VQM I;  4NB5 A;  2NS8 A;  1TLH B;  2J5O A;  2VUM J;  1A6Q A;  2A68 F;  1T08 B;  5FO5 A;  3ZQH A;  3RIR A;  3J7Y J;  2UXX A;  1IN5 A;  4XLE A;  1IUY A;  2VON A;  5FLV A;  3JW4 A;  4C9Y A;  1U5T A;  1FTZ A;  3J80 K;  2DQL A;  4HV6 A;  3GFJ A;  2QF7 A;  4CZC A;  2R5Y B;  4ZTJ A;  2WV1 A;  1XGS A;  1QNT A;  3L00 A;  4E4H A;  2OZU A;  5J1R A;  1WJE A;  1HDD C;  1QZE A;  1FX7 A;  5LGN A;  5FGM A;  4PSX A;  1BBY A;  1XGM A;  4CYD A;  2BHZ A;  2VXD A;  1FIP A;  3C18 A;  4HX7 A;  4XMY A;  2KQR A;  2LH9 A;  5C3E J;  3BZ6 A;  4A3K J;  1R22 A;  3L9F A;  3CP8 A;  4CCJ A;  5CKT A;  2KZV A;  2H6B A;  2QKL B;  4M6X A;  1XMX A;  3G4S I;  4M3E A;  2X6Y A;  1H89 C;  4X1E A;  2YPR A;  2O8X A;  3MKW B;  3BR1 A;  5L3D A;  4E7S A;  2H94 A;  1KON A;  2A07 F;  1IRF A;  4UUT A;  3DEU A;  2GZW A;  3IAS 2;  3F8B A;  3OMY A;  3HYI A;  3M1E A;  2VQC A;  4DGW B;  1ON1 A;  4RGU A;  2EZH A;  1MND A;  1S29 A;  2FMY A;  5ICC A;  4ZYA A;  2VT2 A;  3H36 A;  2VJ4 A;  3WTS C;  4BHC A;  2EFQ A;  4ENN A;  2XPW A;  1O57 A;  4G6D A;  1Y0N A;  2DA5 A;  1LDK B;  4IHT A;  1UCR A;  4AVZ A;  3F8M A;  2VI6 A;  4BE2 A;  2Q2E B;  2P0W A;  1DGR M;  5LHI A;  2R92 J;  1XX5 A;  4H0E A;  2DCE A;  2IBD A;  4NQW A;  4UUV A;  2VT3 A;  2NS0 A;  3IL2 A;  3HSR A;  4IVN A;  3SFI A;  1OCO H;  4P55 A;  2WY7 Q;  1BA5 A;  2M4K A;  4LB6 B;  1BOA A;  1I3A A;  4IQJ A;  3DP7 A;  5DEQ A;  3ABT A;  3OYG A;  3K4C A;  2K9Q A;  3DKW A;  1SEU A;  2OTJ I;  3IWF A;  1I39 A;  3UR3 C;  4C30 A;  3RKX A;  3HRU A;  2Z99 A;  5F0F A;  2GIZ A;  4HPQ A;  4IOC F;  1EJ9 A;  3N05 A;  4KJZ A;  1X1B A;  2VE9 A;  2JA5 J;  2KMU A;  3K6G A;  2XIG A;  4I02 A;  1Z21 A;  1D1A A;  2ELK A;  1T56 A;  2XSJ C;  5IYB J;  1WJA A;  3JAM Z;  1W1W E;  2RRE A;  3KP2 A;  2NVX J;  2QBY B;  3PNV A;  2M2E A;  4PK4 A;  3TDU C;  4ZH4 F;  3JRA A;  2ZXW H;  1WI9 A;  1WJD A;  3DPT A;  5KHD A;  4U7B A;  2Y75 A;  3BPX A;  5ILS A;  2P5K A;  2X85 A;  3I3L A;  3OYJ A;  1MBJ A;  4KIC A;  3I4M J;  3QPT A;  3ZN1 A;  3O8H A;  2MC3 A;  4EM2 A;  3BG5 A;  2NNN A;  1VQO I;  4OMY A;  1KU7 A;  2B9S A;  3LOC A;  5GP9 A;  4I0B A;  5F0C A;  1XTA A;  2LBF A;  2WWY A;  1FBU A;  2M30 A;  3U21 A;  5IP7 J;  4J00 A;  2XRO A;  3GO5 A;  1R71 A;  3SXY A;  5LEJ A;  3CF5 F;  5FD5 A;  1VQ9 I;  3B73 A;  1FOK A;  1VQ8 I;  2HDC A;  2VAS A;  3H3U A;  4OIQ F;  2CW8 A;  2NVY J;  1XG1 A;  2WA0 A;  1FYK A;  1JTY A;  2WAQ N;  3BG9 A;  4ITV A;  2EPF A;  3S2D J;  3OR1 C;  1SVM A;  4R8H A;  1P2F A;  2ESN A;  2CUJ A;  1TBX A;  2VKH A;  3HOX J;  2B63 J;  3J7A Y;  1SAN A;  4GYI A;  5ILV A;  1WJB A;  5LGU A;  1PUE E;  2ZFW A;  1AOY A;  1FBS A;  4KIT B;  2DFH A;  1IC8 A;  4LK1 F;  3OR2 C;  1T95 A;  4W97 A;  4E6K G;  3QPS A;  1U5T B;  1LVK A;  1KQ9 A;  2LOO A;  3BJO A;  3LL7 A;  3D0S A;  4RB3 C;  4G8X A;  2LF8 A;  3DF8 A;  1PDN C;  1HBX G;  3Q9V A;  2V9P A;  3CC2 I;  4HV5 A;  2DFE A;  2L2O A;  4LB5 A;  3G6E I;  3HOW J;  2DO7 A;  3HM5 A;  3DWL E;  4BH9 A;  1Z7U A;  2GXG A;  4XLC A;  2MH2 A;  5EZH A;  3W6J B;  1FOX A;  1T0F C;  3IUO A;  2IGK A;  3BRO A;  2DTR A;  1SFX A;  5IP9 J;  2IS6 A;  1PYV A;  1WI3 A;  4OAZ A;  5J6X A;  1JT6 A;  2OBP A;  1DDN A;  1BIA A;  2CGP A;  5HVQ C;  3JRB A;  4HQM A;  2I10 A;  1V3F A;  1SFU A;  1V5E A;  3HSF A;  1MZB A;  3H5A A;  1BW6 A;  3BR5 A;  2OC6 A;  4RB1 A;  2GXB A;  2LDU A;  3EET A;  3FXM A;  5HNF A;  3C2G A;  2E2I J;  1I6H J;  3QU6 A;  4RDU A;  2VQL A;  2Q8K A;  3HGY A;  3ZRG A;  2A6T A;  4KT6 A;  3OY9 A;  3K4B A;  2PEX A;  5L3G A;  3HL2 A;  2V1X A;  3FZV A;  3RPU A;  1JXS A;  2GXA A;  5E3M A;  1UZC A;  3QOE A;  5GAE J;  1ZYR F;  5E1Z B;  1ZRD A;  2P7V B;  1IG7 A;  2ZJQ F;  4QPO A;  2H8W A;  2QQB A;  4NQW B;  1J9I A;  4C3J J;  2ZB9 A;  3OYH A;  2JVH A;  1MBK A;  3KEY A;  1Q1H A;  4JX5 A;  1GLN A;  1KGS A;  3LST A;  4F55 A;  3JR9 A;  2CQN A;  4FCY A;  2E2H J;  3GTO J;  2XGC A;  2OUM A;  2KDZ A;  2XAH A;  4YEJ A;  1LUJ B;  3PSF A;  4OU0 A;  3TL4 X;  3LSG A;  2E71 A;  2KRC A;  3A0B C;  1RRJ A;  2QSH X;  2WAE A;  3GLL A;  2VPL A;  3E5Q A;  1B6A A;  3M1C A;  4BJT A;  1YX3 A;  3B6A A;  2OU2 A;  1P92 A;  2PG4 A;  2JT1 A;  3LWF A;  4BJ5 C;  5D4S A;  2EZI A;  1LNW A;  2AXL A;  3GTQ J;  1F9N A;  2CQK A;  3MD2 A;  4PJJ A;  2YU3 A;  1ORK A;  1JUP A;  1T0F A;  5FKN A;  3JRE A;  2EV5 A;  1TC3 C;  1I1G A;  4UVA A;  1B9N A;  1TQP A;  1BR4 A;  2JZY A;  2NXN B;  1YJW I;  3ABU A;  3E7L A;  2DMN A;  2EIM H;  2O3F A;  3RKQ A;  1ZG3 A;  2ZXH A;  4ZTF A;  1UAA A;  3H5N A;  3RPQ A;  3ML6 A;  2V9V A;  5HS7 A;  2EA2 A;  4RM3 A;  4XRS A;  1ZRE A;  3HTU A;  1T8I A;  2COB A;  2VPR A;  2Y9Z A;  3FIW A;  4ZDL A;  4YFX F;  2LBF B;  2LKX A;  1E17 A;  2R7Q A;  1R6R A;  1XC5 A;  2JSC A;  3QPH A;  2COM A;  3DBH B;  4DYC A;  2E1O A;  2XV4 S;  1BW5 A;  3ZQI A;  2PMU A;  2BE5 F;  2IXS A;  3I0T A;  1VQK I;  2FUG 2;  2DA7 A;  3F72 A;  3FKJ A;  3P9I A;  3E3V A;  3OYD A;  4HF0 A;  2XDV A;  1HA8 A;  1IGN A;  3M07 A;  4MIM A;  1E2X A;  1R1T A;  1GXQ A;  1UB9 A;  3L1P A;  2ETH A;  3F6V A;  3RQ4 A;  3MWM A;  1WJF A;  3OIO A;  4RGS A;  1FYL A;  3IC7 A;  1W36 C;  1ONV A;  4HLX A;  3H35 A;  1X1D A;  3I4N J;  1I1S A;  1Z6R A;  4KN4 X;  1ODD A;  2HVS A;  2UWM A;  4HX8 A;  1N25 A;  3HOS A;  4J19 A;  2DDB A;  1N78 A;  4XRS G;  3C1D A;  3I71 A;  1YIJ I;  1QBJ A;  4P1W A;  2HVQ A;  2MD5 A;  4WXD A;  3VFZ A;  2CMP A;  4IXA A;  4CDG A;  4BDZ A;  1TWC J;  2Q0O A;  4HF1 A;  3I56 I;  3OOP A;  2HYF A;  2L54 A;  5F08 A;  3G2B A;  1D0Y A;  1OR7 C;  3E5U A;  2E7X A;  4JQF A;  4M73 A;  3I64 A;  2E36 A;  2DDA A;  2OQG A;  5EDN A;  1MBF A;  2RQQ A;  1YS6 A;  1TQM A;  1W7P A;  2A3S A;  2HOT A;  2O6G E;  3RKY A;  2DT5 A;  2CV0 A;  4NNJ A;  2PJP A;  3RTR A;  5JFR A;  5B66 C;  4G9Y A;  5J1Y A;  1RUN A;  4UVB A;  2IT0 A;  5JLX A;  4L5E A;  3S2W A;  4HNV A;  3CCV I;  2ISZ A;  3IRR A;  5DS9 A;  4E70 A;  3HEF A;  1MNM C;  2R7X A;  5BQT A;  4UHT A;  3H9G A;  4M6V A;  1XSX A;  2LMD A;  1S8N A;  5IYC J;  4ENJ A;  2A61 A;  3J80 Z;  2GAU A;  3A4C A;  2HOE A;  4PJ0 C;  4EM1 A;  3VSK A;  2IGM A;  1W0T A;  5IP6 A;  1R1V A;  2QKM B;  4XSX F;  4A3C J;  3GZN B;  1OIS A;  1IZ1 A;  4ZZL A;  4UV9 A;  3DU5 A;  3BDD A;  4A3F J;  4A3J J;  1JKQ C;  3IH2 A;  1Z7L A;  3S14 J;  5FLX K;  1XB4 A;  3EUK L;  3M8F A;  2HZD A;  2UUZ A;  2CQX A;  5CQE A;  4E7L A;  2Y2Z A;  1Z1D A;  3W3C A;  3ABM H;  4XLA A;  2IS2 A;  1YJN I;  5E3N A;  1KZH A;  3L09 A;  1OQY A;  4HF2 A;  4IX7 A;  1U0J A;  3DBL B;  4PCQ A;  2FJ1 A;  3DTE A;  3QQA A;  4WK8 F;  3ZXS A;  4LLG F;  1RC9 A;  4ZYD A;  2VLA A;  2NRA C;  1YO5 C;  4BKX A;  3ZMD A;  4MQV A;  4CHU A;  4L0Z B;  2HTJ A;  1SD6 A;  5E1X A;  4U87 A;  5BS6 A;  3KYD B;  1OR7 A;  3SEQ A;  3RYP A;  2IGN A;  2ICW G;  2DW4 A;  2HPM A;  2K9S A;  4XLF A;  5DCF A;  4JX6 A;  3OYM A;  1JTX A;  2Q1Z B;  1DQU A;  2WV0 A;  3CCJ I;  2LR8 A;  5CYV A;  5K7H A;  1FT9 A;  2K40 A;  1VQ4 I;  2H8R A;  1LB2 A;  1XGO A;  3QPL A;  2HOA A;  3QAH A;  3QP6 A;  4ASN A;  1K61 A;  3DU6 A;  2K7L A;  1XN7 A;  3ZQ7 A;  2NYX A;  2K4B A;  2CV1 A;  2EFN A;  2L9V A;  3ECH A;  4KIS A;  2V7F A;  3P9K A;  3O6B B;  1DU0 A;  2KIQ A;  3DEE A;  4DBQ A;  2D1H A;  2V1U A;  2HOS A;  4HG2 A;  2VIX A;  3MEX A;  3C2H A;  4CCK A;  3NAU A;  3HPH A;  4KT5 C;  1FP1 D;  1F36 A;  3AG1 H;  2VBW A;  1T2K A;  2W57 A;  4G7O F;  1Q1V A;  1UEL B;  1LQ1 A;  1ZTR A;  2CWE A;  1YW7 A;  2VXZ A;  3HGG A;  2O8K A;  2TCT A;  2BV6 A;  2O9L A;  3HUG A;  5CJ9 A;  5ICE A;  4A3M J;  5HLT A;  3IWZ A;  2PFB A;  4ZC3 A;  4ESJ A;  3V7S A;  2JQ7 A;  4CZZ A;  4Y17 A;  4BBR J;  2EV0 A;  3AFH A;  3GEZ A;  3REO A;  3CCU I;  3CCS I;  5FFX A;  3LSR A;  3OS0 A;  5EF6 A;  4DIQ A;  1ETY A;  2QWW A;  2E1N A;  3R6S A;  1EKE A;  1OYY A;  1R5I D;  1E3P A;  4KIF A;  1GT0 C;  4A0X A;  2PN6 A;  4A5M A;  3HKZ A;  1O3R A;  2A5Y B;  2M0M A;  2X6X A;  4FE4 A;  1HC8 A;  4Z6Y A;  4IHX A;  3K9T A;  5E20 A;  5K1Y A;  4RGX A;  1D5V A;  1ZEL A;  1MMD A;  1SAU A;  3EQL F;  2V1N A;  2RN7 A;  3BZK A;  3CD6 I;  1BI3 A;  2JA8 J;  2ZFU A;  1IDZ A;  3EDP A;  2Z5U A;  4BQO A;  2R7S A;  1TW2 A;  5HS8 A;  3IKV A;  4HRI A;  1GVD A;  2XPV A;  1L0O C;  5LLQ A;  2OQR A;  4O6J A;  1W7P B;  2QQ9 A;  1MIJ A;  5F64 A;  1ETW A;  4RLQ A;  4AWX B;  4M9X A;  4NBQ A;  3V8L A;  4C3I J;  3OYK A;  4L9J A;  4BEH A;  4LMY A;  4AYB A;  3LAP A;  1V4R A;  2RC4 A;  3A03 A;  2A05 A;  3A02 A;  1ZH5 A;  3BOQ A;  3TO9 A;  2FD5 A;  4HOB A;  1R1U A;  1FTT A;  1ACI A;  4D1Q A;  1ETX A;  1H88 C;  4XON A;  5KAF C;  5EGO A;  2LSO A;  2KZG A;  3OYE A;  4BDY A;  2VN2 A;  1BR1 A;  3VPR A;  1EH7 A;  2L4A A;  5K5O A;  3SJM A;  2P6S A;  5GAG J;  5LHH A;  4KUM A;  3ZGK A;  1UJ8 A;  2X1C A;  4A0Y A;  3H3V K;  3OS2 A;  1VTN C;  1BJZ A;  5B5E C;  4L9T A;  2RQP A;  2IRF G;  4RBO A;  5GAH J;  4I0A A; 
#chains in the Genus database with same CATH homology
 2MBF A;  5HLI A;  2QBY A;  1QZY A;  4WX9 A;  4RGR A;  5BPI A;  2EWN A;  5D6F A;  4LG0 A;  3N4M A;  2IA2 A;  2CW0 F;  4I98 B;  1DPU A;  1BIB A;  1IXR C;  3KZZ A;  1IN4 A;  3HRT A;  2M45 A;  2V6C A;  4MGR A;  3R0A A;  5ERI A;  1HW2 A;  4Y13 A;  2BGC A;  2NNY A;  3CUO A;  3LA7 A;  1R23 A;  2RV8 A;  4EGZ A;  1Z9C A;  2O03 A;  3F8F A;  3LAJ A;  1UHM A;  4A6E A;  1RIO H;  4HA8 A;  4EMS A;  4ENM A;  3KP5 A;  4EGY A;  3WGH A;  1LJ9 A;  2VBY A;  1RI7 A;  3FMR A;  3Q5F A;  4U88 A;  2RVC A;  1X3U A;  2EJR A;  1PP8 F;  3MAJ A;  4MTD A;  1MJ9 A;  1YYV A;  4AIH A;  2VC1 A;  2PQ8 A;  4DQ2 A;  3FXU A;  2KIM A;  3M8E A;  1YG2 A;  3R61 A;  1KU9 A;  1TNS A;  3BP8 A;  1FSE A;  4L9V A;  2XUB A;  5DDG A;  1R5H A;  1WWX A;  2G9W A;  5EEH A;  2FXA A;  1I5Z A;  3V7C A;  1G3W A;  3CDH A;  4M9S A;  1D3Y A;  4WXH A;  4S04 A;  4RAZ A;  5D5X B;  1KYZ A;  5AIP A;  2PLY A;  3WGI A;  2QUF A;  5EEG A;  5JVT A;  5HOO A;  1REP C;  3VEP A;  2K02 A;  3TOA A;  1S6L A;  5JR3 A;  4EJW A;  3PFI A;  3WTU C;  4KYW A;  3TKY A;  5E18 F;  2KJB A;  4BHB A;  1HKS A;  3P9C A;  1RUO A;  5CVR A;  4KNY A;  1HST A;  1XD7 A;  4EJV A;  1QGP A;  1K7A A;  4WXC A;  4A0Z A;  2EA4 A;  5H6R A;  5L3F A;  3L2C A;  3AAF A;  3V8J A;  1WSU A;  2KIU A;  2DLL A;  1QO0 D;  1XCB A;  5A2Q K;  4G7Z F;  1J59 A;  3VOE A;  3QRF F;  4LG0 B;  1MJA A;  2ZME A;  1K79 A;  4EJT A;  1OPC A;  1O3S A;  4DNC A;  1FZP B;  1PP7 U;  2STT A;  1UHW A;  1NHA A;  4HBL A;  4IRH A;  5HDN A;  3JTH A;  1XDU A;  4ESF A;  1U6G A;  1YQA A;  2Z9O A;  5FLX Z;  4I2O A;  3HRS A;  1JE8 A;  3WGG A;  2PI0 A;  1H9T A;  4RB0 A;  3C3W A;  2M5W A;  2M1B A;  3PQJ A;  4KIG A;  1P4W A;  4OIP F;  3IKT A;  1HKT A;  2XKP A;  3CUQ B;  3GLX A;  2HQR A;  4MNU A;  3ZMT A;  1IN6 A;  1MGT A;  3TGN A;  4IJA A;  1XCV A;  1TNT A;  4BXU A;  3T1B A;  1JGS A;  1XSV A;  1ON2 A;  2MA3 A;  3FMS A;  4AD9 A;  2W25 A;  3BWG A;  1ZHF A;  3RDI A;  2VOD A;  3R4K A;  3GW2 A;  3E5X A;  2FU4 A;  4L5J A;  3DFG A;  1CF7 A;  2H27 A;  3WTW C;  1I6X A;  5CVU A;  3H3Z A;  2F5E A;  3QOP A;  1KQ0 A;  1R58 A;  2P5V A;  3ZMZ A;  2CO5 A;  4MHG A;  4JBA A;  3LA3 A;  2FF4 A;  4HX4 A;  4OIN F;  3MZH A;  1EH6 A;  2UZK A;  2GWR A;  1Z05 A;  4LLL A;  2DFI A;  3SZP A;  3DV8 A;  1OMI A;  4XLP F;  1FNN A;  2W24 A;  1P6R A;  4CGZ A;  3TQN A;  3SFZ A;  1MJB A;  1ZAO A;  1ZRC A;  5TJJ A;  5HLH A;  3IHU A;  3HOT A;  3GFL A;  4OMZ A;  1BI1 A;  1U8R A;  4I01 A;  4FX0 A;  1FSH A;  1F4K A;  2P7C B;  2LKP A;  3WTZ A;  1GVJ A;  2D1V A;  3KE2 A;  1XMA A;  2ZME B;  4U0W A;  2QQA A;  2H09 A;  2YR2 A;  3WTX C;  3V4G A;  1XSD A;  5DD4 A;  5D8K B;  4LD5 A;  4WWC A;  2A6E F;  2L02 A;  1HQC A;  3VOD A;  4CXF A;  1H9G A;  3KEO A;  5LGT A;  2ZXJ A;  4HYE A;  2KIF A;  3WE2 A;  1J5Y A;  3MZY A;  4JK1 X;  1BC8 C;  1SMY F;  1I27 A;  5D5V B;  1P4X A;  2P4W A;  2M8E A;  5CLS A;  4GCV A;  1W5T A;  2OD5 A;  3CO6 C;  3J81 K;  2XGX A;  1P4A A;  2HR3 A;  4I7H A;  5TRD A;  2PBI A;  3O3K A;  3B02 A;  3ECO A;  1IAW A;  1ZAR A;  2RNJ A;  5ICG A;  2XRN A;  3ZMU A;  4P96 A;  1CGP A;  1CF7 B;  1MDM A;  4U7D A;  2FA5 A;  4TV7 A;  2XVC A;  5D5W B;  5BMZ A;  2H6C A;  3TO7 A;  4M72 A;  3K2Z A;  1U3E M;  1WQ2 A;  2ESH A;  4MEY F;  1T38 A;  1XDS A;  3ROU A;  4M9Z A;  5ILU A;  4M74 A;  2QM3 A;  2F5F A;  3T5X A;  1S7A A;  3CJN A;  3HTS B;  2TDX A;  4ENK A;  3I53 A;  1L3L A;  2L01 A;  3ULQ B;  3FHZ A;  2E7W A;  5DV5 A;  5JHU A;  2MLG A;  1C0W A;  1ZLJ A;  3RKW A;  4Q4Z F;  4EVI A;  5DYM A;  1QZZ A;  4HZF A;  1W4M A;  3I54 A;  4KDP A;  1ULY A;  3KP6 A;  2RKH A;  3WTV C;  2FBK A;  1IN7 A;  3R60 A;  1HXD A;  3F22 A;  2DK8 A;  5FB2 A;  3Q9S A;  5AIQ A;  3K1P A;  2ELH A;  3O2P E;  2LF7 A;  3KLO A;  3PQK A;  2ZNY A;  1T39 A;  2D2W A;  1FWZ A;  2HKO A;  3BY6 A;  2STW A;  4Z2Y A;  3TDZ C;  4L5I A;  4BHP A;  4U0V A;  3KP3 A;  1DUX C;  4UNO A;  5D5U B;  4XBF A;  1B4A A;  2HTS A;  1KU3 A;  4ZYG A;  4UV8 A;  3LFK A;  1KQ8 A;  2O61 A;  1OYW A;  1B1B A;  2VBX A;  2FE3 A;  4YFN F;  1YTY A;  4BAY A;  2IVM A;  4F7Z A;  5LBQ A;  2QEN A;  5H20 A;  3F6O A;  3I58 A;  3M9A A;  2RDP A;  4ZYH A;  2ZJ2 A;  1K6O A;  1MDM B;  3G73 A;  2L3D A;  1R7J A;  5L3B A;  1WKM A;  3CUQ C;  1LEB A;  3K1M A;  2HKX A;  1BI0 A;  4LFU A;  1R36 A;  5DCM A;  2M87 A;  3KEQ A;  1STZ A;  3F21 A;  4Y15 A;  3NQO A;  4IF4 A;  4R79 A;  2CFX A;  2Y0M A;  3ZMV A;  4L0Y B;  4Q5S F;  5BOX A;  5HDG A;  2XAF A;  1O3Q A;  4Q47 A;  2A69 F;  3DQV C;  2VE8 A;  2DK5 A;  4WCG A;  2OZ6 A;  2AS5 F;  2K4J A;  2ISY A;  4Q48 A;  1YIO A;  4WF2 A;  5KVR A;  1R5G A;  3GFM A;  1WRJ A;  4IHS A;  3KLN A;  2FRH A;  3EYI A;  3RJP A;  4AIK A;  2WTE A;  4QWQ A;  1K78 A;  3HIF A;  4NHJ A;  3QU3 A;  2IJL A;  3WE3 A;  2FEZ A;  5CVV A;  3HSE A;  5FFZ A;  4CO8 A;  1TW3 A;  1KU2 A;  3F8C A;  2KRF A;  2FSW A;  4LLN A;  2J5P A;  3CUQ A;  3FXR A;  5LHG A;  4KFC A;  1UFM A;  4KMU X;  2QYO A;  4RS8 A;  2MLK A;  5DUI A;  1OYI A;  3K69 A;  5CVJ A;  2G7U A;  5J8F A;  4ESB A;  2FNA A;  1LEA A;  1T98 A;  5HLG A;  3KFW X;  1LDJ A;  3BJ6 A;  2WC2 A;  4YG2 F;  3KZY A;  3KCC A;  1O3T A;  1J0R A;  1R00 A;  3GFI A;  3WG9 A;  2XHK A;  1Z91 A;  1KA8 A;  3KP7 A;  2BEO A;  1O7L A;  2R7D A;  1FC3 A;  2VBZ A;  1G3Y A;  2VC0 A;  1RNL A;  2JTV A;  5CVI A;  4S05 A;  4HQE A;  5K5R A;  4IPA A;  2Y48 A;  4BNC A;  5J8C A;  2CYY A;  1D8J A;  4LGW A;  3ISP A;  1MD0 A;  3FF5 A;  5D6E A;  4N9I A;  3GYH X;  6PAX A;  3GF2 A;  1JHF A;  3J81 Z;  4A2U A;  2IPQ X;  3GX4 X;  4EJO A;  1A04 A;  3BJA A;  3NEU A;  1FYM A;  3E6B A;  4HDU A;  1Z6T A;  5DCM B;  3EUH A;  1W5S A;  4G94 A;  2EFP A;  3CTA A;  2ZCW A;  1HW1 A;  1BN5 A;  1FPQ A;  4AVP A;  2EFO A;  2A6H F;  3OV8 A;  3I59 A;  4A5N A;  1FLI A;  2QVO A;  4O5V A;  4HLY A;  1SFE A;  1IRG A;  3WOD F;  4I09 A;  5L3E A;  1KYW A;  3QP5 A;  1B9M A;  2NAZ A;  2FOK A;  4L18 B;  3HHG A;  2BBY A;  3BPV A;  3E6M A;  1K78 B;  2GQQ A;  4P9F A;  3WU1 B;  1ZG5 A;  4MQ9 F;  1TTY A;  3FXQ A;  1SMT A;  3G3Z A;  4GXO A;  3ZMS A;  2RGV A;  2X4H A;  2CSO A;  4GGG A;  3V7R A;  1BM9 A;  2IP2 A;  2DBB A;  4YFK F;  3TO6 A;  2QLZ A;  2P8T A;  3DPL C;  2YX7 A;  1MKM A;  5E1W A;  3J7A O;  2ACJ A;  5ICF A;  3E6C C;  1BC7 C;  2HS5 A;  2FBI A;  2UXN A;  3FM3 A;  1ZGA A;  4P5O A;  3WU0 A;  1IF1 A;  4K2E A;  1YS7 A;  3KET A;  1FP2 A;  3VB2 A;  4EQQ A;  5DD8 A;  1U2W A;  1QPM A;  2JRT A;  3SZT A;  5IT9 K;  2F5D A;  1IXC A;  5AON A;  4G6Q A;  4ON0 A;  3ELK A;  1J7K A;  1HSJ A;  2W84 A;  3N97 A;  2Z33 A;  5KK1 A;  2FNP A;  1UST A;  5FD6 A;  2HQN A;  1XMK A;  2V1D A;  3P7N A;  2E1C A;  4PGG A;  3SQN A;  1J2X A;  1G6N A;  2XAG A;  4QLC U;  1HKQ A;  2HFH A;  2JPB A;  1YW8 A;  2OA4 A;  4FT8 A;  3JSP A;  1D8K A;  2QZ8 A;  5LRS A;  2HYG D;  3I59 B;  3GWZ A;  2MH9 A;  3GVA A;  1EV7 A;  4B8X A;  5K5Q A;  3GUD A;  2G7H A;  2F2E A;  3GZ6 A;  4A6D A;  2K27 A;  3V8K A;  3I5U A;  1H0M A;  4ETS A;  3R0J A;  4AIJ A;  4D0P A;  2ZNZ A;  4BQA A;  2ADU A;  4XRF A;  2D45 A;  2P6T A;  4XSZ F;  4PDK A;  2KJC A;  1G3T A;  4O3M A;  3C7J A;  2KKO A;  3FM5 A;  3CO7 C;  3JTG A;  1S3J A;  2FBH A;  1USS A;  4A12 A;  3U2R A;  3MQ0 A;  3LQR A;  1ZRF A;  4M71 A;  3D5L A;  4UXN A;  3HHH A;  2XAQ A;  2V79 A;  2L4M A;  5BPD A;  3CLO A;  2DQR A;  4UVC A;  3FX3 A;  3JAM K;  5HDK A;  3NRV A;  3H92 A;  2ZBK A;  3SHF A;  2W85 A;  2F5C A;  2DPD A;  2X0L A;  3F3X A;  1O7F A;  3RYR A;  2K86 A;  1SD7 A;  2EFW A;  2XAJ A;  2GA2 A;  1DPR A;  4GYG A;  1HW5 A;  3M7G A;  2FQ3 A;  2HWV A;  2VOP A;  2HZT A;  2C6Y A;  4IRI A;  1EH8 A;  2GIV A;  1BI2 A;  2XKO A;  1LVA A;  1AWC A;  2OAZ A;  5E8G A;  5D4R A;  3W6K B;  3DXJ F;  1XGN A;  4U0Y A;  4GO1 A;  5F6F A;  1B59 A;  3WTT C;  5IT3 A;  4EJU A;  4YII A;  1J75 A;  3ERE D;  1FBQ A;  4EV0 A;  1W7P D;  2JPC A;  4LJZ F;  5E8I A;  2YSR A;  3F23 A;  2BYV E;  4HW0 A;  4PGH A;  1IW7 F;  3U1D A;  4RAY A;  1GXP A;  5L3C A;  2EV6 A;  1G3S A;  2IA0 A;  1BJA A;  4N0B A;  5HS9 A;  3JSO A;  2DU9 A;  4KIB A;  2LNB A;  4YIF A;  1G4D A;  3T8T A;  1DP7 P;  3E97 A;  2EB7 A;  5A2Q Z;  1OKR A;  5LRR A;  2VOO A;  2EK5 A;  2ZKZ A;  2P5L C;  4IRG A;  1SD4 A;  4B09 A;  3K0L A;  5E17 F;  3HRM A;  5JI6 A;  5DUK A;  2FML A;  2IW5 A;  3KP4 A;  4KN7 X;  3K1N A;  2B0L A;  4OOI A;  4XLN F;  1LDD A;  2O0Y A;  3FMQ A;  5F1R A;  3MCZ A;  4ZZD A;  3LQQ A;  5ED4 A;  2HGC A;  3EYY A;  3LA2 A;  4CIC A;  1S7O A;  2PMH A;  1ZN2 A;  3RI4 A;  1QQI A;  1T6S A;  3MFK A;  4G7H F;  2Q2E A;  1JHH A;  4KMF A;  1RZ4 A;  4ZYE A;  4EM0 B;  1Y0U A;  4HAM A;  2XAS A;  4M6Y A;  1YLF A;  2DI3 A;  1SD5 A;  4FHT A;  1YFH A;  2HEO A;  1U5T C;  4HDV A;  4R1H A;  1IXS B;  4N9H A;  1FY7 A;  1F1Z A;  4L9N A;  3COA C;  5H6Q A;  1U78 A;  4KA4 A;  2GA1 A;  3F8N A;  1SAX A;  2Z3Y A;  1TQI A;  1GHC A;  2IA1 A;  1IN8 A;  3GZ5 A;  4FX4 A;  2R7F A;  3FWE A;  1YW9 A;  1F5T A;  1ZLK A;  2R3S A;  3T0Y A;  4MTE A;  3L7W A;  3TOB A;  5D8L B;  2YX4 A;  3ZPL A;  1ZGJ A;  4OIR F;  3WTY C;  2DPU A;  3IRQ A;  3U9G A;  2DAO A;  4PZJ A;  3GXO A;  4LK0 F;  1ZG1 A;  3I4P A;  5IT9 Z;  4RB2 C;  4P9U A;  3E6D A;  3T8R A;  3ZN0 A;  5LEK A;  4OIO F;  2CG4 A;  2ZO4 A;  3ZP5 A;  4BYY A;  4NB5 A;  1TLH B;  2J5O A;  2A68 F;  5FO5 A;  3RIR A;  2UXX A;  1IN5 A;  1IUY A;  2VON A;  3JW4 A;  1U5T A;  3J80 K;  2DQL A;  4HV6 A;  3GFJ A;  1XGS A;  1QNT A;  3L00 A;  2OZU A;  1FX7 A;  5LGN A;  5FGM A;  1BBY A;  1XGM A;  4CYD A;  3C18 A;  4HX7 A;  3BZ6 A;  1R22 A;  3L9F A;  2H6B A;  4M6X A;  2YPR A;  2O8X A;  5L3D A;  2H94 A;  2A07 F;  1IRF A;  3DEU A;  2GZW A;  3F8B A;  3HYI A;  3M1E A;  1ON1 A;  4RGU A;  1S29 A;  2FMY A;  5ICC A;  2VT2 A;  3WTS C;  4BHC A;  2EFQ A;  4ENN A;  1O57 A;  4G6D A;  1LDK B;  4IHT A;  1UCR A;  3F8M A;  5LHI A;  4H0E A;  4NQW A;  4UUV A;  2VT3 A;  2NS0 A;  3IL2 A;  3HSR A;  4IVN A;  4P55 A;  4LB6 B;  1BOA A;  5DEQ A;  3DP7 A;  3ABT A;  3DKW A;  3IWF A;  3RKX A;  3HRU A;  2Z99 A;  2VE9 A;  2XIG A;  4I02 A;  4MEX F;  3JAM Z;  3KP2 A;  2QBY B;  3TDU C;  4ZH4 F;  1WI9 A;  3DPT A;  4U7B A;  2Y75 A;  3BPX A;  5ILS A;  2P5K A;  4KIC A;  3QPT A;  3ZN1 A;  2MC3 A;  4EM2 A;  2NNN A;  4OMY A;  1KU7 A;  4I0B A;  2WWY A;  1FBU A;  2M30 A;  2XRO A;  3GO5 A;  3SXY A;  5LEJ A;  5FD5 A;  3B73 A;  1FOK A;  2HDC A;  3H3U A;  4OIQ F;  1FYK A;  4R8H A;  1P2F A;  2ESN A;  1TBX A;  1PUE E;  4GYI A;  5ILV A;  1AOY A;  5LGU A;  2ZFW A;  1FBS A;  4LK1 F;  1U5T B;  1KQ9 A;  3BJO A;  3D0S A;  4RB3 C;  4G8X A;  2LF8 A;  3DF8 A;  1PDN C;  1HBX G;  3Q9V A;  4HV5 A;  4LB5 A;  2DO7 A;  4BH9 A;  1Z7U A;  2GXG A;  2MH2 A;  3W6J B;  3BRO A;  2DTR A;  1SFX A;  5J6X A;  2OBP A;  1DDN A;  1BIA A;  2CGP A;  5HVQ C;  4HQM A;  1V3F A;  1SFU A;  3HSF A;  1MZB A;  4RB1 A;  2GXB A;  2LDU A;  3EET A;  3QU6 A;  2Q8K A;  2PEX A;  5L3G A;  2V1X A;  3FZV A;  3RPU A;  1JXS A;  1ZYR F;  5E1Z B;  1ZRD A;  2P7V B;  2QQB A;  1J9I A;  1Q1H A;  3LST A;  1KGS A;  2XAH A;  4OU0 A;  3E5Q A;  1B6A A;  2OU2 A;  1P92 A;  2PG4 A;  2JT1 A;  3LWF A;  5D4S A;  1LNW A;  2AXL A;  1F9N A;  2CQK A;  2YU3 A;  1T0F A;  2EV5 A;  1I1G A;  4UVA A;  1B9N A;  1TQP A;  2JZY A;  3ABU A;  2O3F A;  1ZG3 A;  3RPQ A;  3ML6 A;  2V9V A;  5HS7 A;  2EA2 A;  1ZRE A;  3HTU A;  4YFX F;  1E17 A;  2JSC A;  3QPH A;  2COM A;  2XV4 S;  2PMU A;  2BE5 F;  3I0T A;  3F72 A;  3P9I A;  3E3V A;  4HF0 A;  1E2X A;  1R1T A;  1GXQ A;  1UB9 A;  2ETH A;  3F6V A;  3MWM A;  4RGS A;  1FYL A;  3IC7 A;  1ONV A;  4HLX A;  1I1S A;  1Z6R A;  4KN4 X;  1ODD A;  2UWM A;  4HX8 A;  3HOS A;  3C1D A;  3I71 A;  1QBJ A;  4WXD A;  2MD5 A;  3VFZ A;  4CDG A;  4IXA A;  2Q0O A;  4HF1 A;  3OOP A;  2HYF A;  2L54 A;  4JQF A;  3E5U A;  2E7X A;  4M73 A;  3I64 A;  2OQG A;  1YS6 A;  1TQM A;  1W7P A;  2A3S A;  2O6G E;  3RKY A;  2DT5 A;  2PJP A;  3RTR A;  5JFR A;  4G9Y A;  1RUN A;  4UVB A;  2IT0 A;  3S2W A;  2ISZ A;  3IRR A;  4E70 A;  5BQT A;  4UHT A;  1XSX A;  4ENJ A;  1S8N A;  2A61 A;  3J80 Z;  2GAU A;  2HOE A;  4EM1 A;  1R1V A;  4XSX F;  1IZ1 A;  4ZZL A;  4UV9 A;  3BDD A;  5FLX K;  1XB4 A;  3M8F A;  1Z1D A;  3L09 A;  4HF2 A;  4PCQ A;  4WK8 F;  4ZYD A;  4LLG F;  2NRA C;  1YO5 C;  3ZMD A;  4MQV A;  4CHU A;  4L0Z B;  2HTJ A;  1SD6 A;  5E1X A;  5BS6 A;  1OR7 A;  3RYP A;  2DW4 A;  5DCF A;  2WV0 A;  5CYV A;  1FT9 A;  1LB2 A;  1XGO A;  3QAH A;  3QP6 A;  4ASN A;  2K7L A;  1XN7 A;  3ZQ7 A;  2NYX A;  2K4B A;  2EFN A;  3ECH A;  3P9K A;  3O6B B;  2D1H A;  2V1U A;  3MEX A;  4KT5 C;  1FP1 D;  2VBW A;  1T2K A;  2W57 A;  4G7O F;  1LQ1 A;  2CWE A;  1YW7 A;  2VXZ A;  2BV6 A;  3HUG A;  5CJ9 A;  5ICE A;  3IWZ A;  2PFB A;  4ESJ A;  3V7S A;  4CZZ A;  4Y17 A;  2EV0 A;  3GEZ A;  3REO A;  5FFX A;  2QWW A;  2E1N A;  3R6S A;  1OYY A;  4KIF A;  4A0X A;  2PN6 A;  4A5M A;  1O3R A;  2A5Y B;  3K9T A;  5E20 A;  5K1Y A;  4RGX A;  1D5V A;  3EQL F;  2RN7 A;  1BI3 A;  3EDP A;  2Z5U A;  1TW2 A;  5HS8 A;  3IKV A;  1L0O C;  5LLQ A;  2OQR A;  4O6J A;  1W7P B;  2QQ9 A;  5F64 A;  4AWX B;  4M9X A;  3V8L A;  4L9J A;  4LMY A;  3LAP A;  1V4R A;  2RC4 A;  1ZH5 A;  3BOQ A;  3TO9 A;  4HOB A;  1R1U A;  2LSO A;  2VN2 A;  5K5O A;  1EH7 A;  2L4A A;  2P6S A;  5LHH A;  4KUM A;  4A0Y A;  1VTN C;  4L9T A;  2RQP A;  2IRF G;  4I0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...