1ETVA

The crystal structure of e. coli fis mutant g72a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
75
Chain Sequence
DVLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRANQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 28
structure length 75
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etvA00
9ANTA 2DA2A 2YU9J 1LFBA 2JA6J 1FTZA 4G12A 4M3BA 1AKHB 1U78A 4B3AA 5E3NA 4MFDA 2WAQN 2JMWA 1UG2A 3CQZJ 1AU7A 2ECBA 4BBRJ 2DJNA 4M3FA 1RESA 3CCYA 2R93J 5JLWA 2XGCA 3S1RJ 4BBSJ 3BR5A 3ZQGA 3A02A 2FQ4A 2JA5J 1F36A 1ZQ3P 3HEFA 2XRLA 3BR0A 3H0GJ 3M4OJ 3JRGA 2M8GX 1TWAJ 2XGDA 3RQIA 3NARA 3LNQA 1K61A 1HDPA 2QCOA 2DMQA 3BTLA 1YRNA 1LE8B 1I3QJ 1NTCA 4I76A 3JRBA 3PM1A 4DZPA 2KDZA 1ETQA 3JR9A 4A3MJ 1TWCJ 3JRDA 3Q0WA 3I4MJ 1U9OA 1OFCX 5F08A 4C3IJ 1R9TJ 2NVXJ 4IEJA 4XK4A 2HQ5A 4MLOA 5EEAA 4GFBA 3LSPA 3S2DJ 1FIPA 3JRCA 4V2FA 5IYCJ 3ZOBA 3OSGA 3LSGA 2COBA 2DA5A 4EEFG 2ME6A 4DZJA 1RETA 2H1KA 2NVQJ 1Y1VJ 5E3LA 5IYBJ 1ENHA 2DA6A 3GTOJ 1PUFA 4A3LJ 2HYJA 3RKQA 1AKHA 3DEWA 1QVUA 1UHSA 3IH2A 2EBIA 4RBOA 3ZQCA 1IDYA 1GV5A 4JX4A 5FKNA 2DA3A 5FLMJ 4QTRA 1IRZA 2L0KA 2R0QC 3TP3A 5M3FJ 5EF6A 1JT0A 3S1MJ 1HOMA 1ITYA 1MNMC 2K9NA 2CQXA 2VPRA 1GT0C 2HDDA 3NAUA 4LOCA 5K7HA 1B72B 1MBFA 3VPRA 2CUFA 2L7MP 3SFIA 3IV5A 2LK2A 1ETWA 1FEXA 4M3EA 4X6AJ 2WB1N 3HBLA 1ZR2A 2CJJA 4A69C 3GTGJ 2LP0A 2MGQA 4DYQA 3HOUJ 2R5YB 1HDDC 2NS8A 5M5YJ 3L1PA 2NS7A 3GTJJ 4BXXJ 2CUEA 5C4JJ 1B8IB 3RZDJ 1HCRA 1G2HA 4AC0A 3BR2A 1WCMJ 1WH7A 3MVPA 3PO3J 1GVDA 1X2NA 4HNVA 3ZQLA 3QPLA 5IPAA 1JKOC 2NVTJ 2NVYJ 4A3CJ 2OPTA 2JA7J 2E2IJ 3QPSA 1TC3C 3ZQFA 4UUTA 4W1UA 4FE4A 3TW6A 5EYRA 5F0CA 2B63J 1BJZA 2FX0A 2Y9ZA 1U8BA 4Y52J 4D5CA 2R5ZB 1OCPA 5F0FA 3BG3A 2WV1A 4S0HB 1ZKGA 3OOUA 3O8HA 3HOXJ 4A3FJ 4BKXA 3A01B 3CDLA 1QVTA 2GM4A 3HOYJ 3PO2J 2LY9A 1A6IA 2HXOA 5GPCA 3JRAA 3HGGA 2E19A 2Y31A 2R5YA 5EGOB 2X48A 2ZB9A 3TP0A 5E3MA 2XSDC 2DN0A 3S16J 3WHBA 2L7ZA 2AHQA 4JP0A 3HM5A 1ZR4A 5C3EJ 1MBEA 1XC5A 3B6AA 1WH5A 3WHCA 1IUFA 3W6VA 2DMTA 4IHWA 3FIWA 2CRGA 4UUSB 5EZGA 1CQTA 1U9NA 2ME0A 4QIWN 5IP9J 5FKOA 2XB5A 3TEDA 1FTTA 3LSJA 3BG9A 5GP9A 5EDNA 4MO7A 1ZK8A 1W0TA 2ID3A 1E3OC 1MBJA 4D5FA 1HF0A 3B6CA 3Q0VA 2H8RA 1JJ6C 1BA5A 3GTKJ 1T56A 3JRFA 1X2MA 1IGNA 2YS9A 1ETKA 5FLVA 3ZQIA 5FKLA 2IAIA 3IH4A 3JRHA 4RDUA 5FKKA 4A3IJ 3S1NJ 3A01A 1JUSA 5C44J 3A03A 2M0CA 2L7FP 5FJ8J 2IEKA 2EZLA 5IOYA 5IYDJ 3QQAA 1LFUP 5J1UA 4XRSG 3SJMA 1MH3A 3G1OA 2KT0A 1QRYA 5EGOA 3BQZA 1S7EA 4DW6A 1FIAA 4A3BJ 2TRTA 3HB9A 3TW7A 2AO9A 5FKMA 4XRSA 3BTCA 1LE8A 2Y2ZA 1X58A 1OCTC 1JTXA 2G0EA 4C2MJ 4ABZA 4CYCB 1TWGJ 4UUSA 2LKXA 5K7ZA 2M9HA 3BT9A 3C2BA 2LFBA 3BTJA 1WPKA 3MKLA 4A3JJ 2W48A 1JUMA 3FK6A 3F0CA 1WGXA 2X6OA 4L5EA 5IP6A 1IJWC 2JK3A 2JA8J 2DMPA 4M3GA 2DMUA 4A3EJ 5F0HA 2ECCA 5EG0B 4V2GA 2E2JJ 4BY1J 3HOVJ 1VFCA 1I50J 1RPWA 4D7NA 3HKZN 3DCFA 2Y0SN 2MW8A 3IH3A 4MIMA 4FE7A 4NDLA 1YRNB 3G1MA 2X9DA 2DA1A 2K40A 3S17J 4B4CA 4J19A 1F43A 4JYKA 2XPWA 4A3GJ 1QPIA 4QSHA 1JTYA 1AHDP 1JJ8C 1H8AC 1HLVA 1B72A 1P7JA 3FKIJ 3OSFA 3GTPJ 3GTLJ 1GDTA 1JT6A 1VF9A 1ETXA 2Y30A 4XICA 2O7OA 1H89C 5J1YA 1Y1WJ 3BR6A 2HI3A 1ETVA 5DTDA 2LD5A 3S14J 4W97A 5DS9A 1IG7A 5C4XJ 4CYCA 2R92J 1ZTRA 5J1RA 2VI6A 1PUFB 3GTMJ 2TCTA 1D5YA 4FISA 3LSRA 3CMYA 1BL0A 1MBGA 2M34A 4AYBN 1B8IA 1UMQA 2EZIA 1FJLA 3FISA 2CQQA 3BR3A 4FTHA 1XS9A 2RAEA 1POGA 4B1RA 3I4NJ 2K9QA 2JWTA 3S15J 3LOCA 5EG0A 2QF7A 1JGGA 3M3YJ 4M6VA 1DU6A 2GLOA 2M2EA 3OIOA 2XPUA 4DYRA 2E1OA 1ETOA 5EZHA 3JREA 1W0UA 1BW5A 3Q0UA 2O9LA 2ELKA 3ZQHA 2HOSA 3RZOJ 1O4XA 5F27A 1ZGWA 2EH3A 2R5ZA 5M5XJ 2E2HJ 4MFEA 3GBGA 3G1LA 2EZKA 1JUPA 4I6ZA 5F1JA 1T33A 1OJLA 2DTZA 2ID6A 3JRIA 5JLXA 3GTQJ 2DMNA 3FK7A 5E3OA 3H3VK 4IHXA 5HODA 2CU7A 4IHVA 2LLKA 1P7IA 1JKRC 1A5JA 2HOTA 2D5VA 4Y7NJ 1MSFC 3UKGA 1VNDA 2EQRA 3Q3SA 5F04A 1Z0XA 3K2AA 3SDGA 2R7ZJ 1RKWA 2P81A 1RKTA 2EZHA 2VKVA 3HGYA 2DA7A 4A3DJ 1NK3P 1ETYA 2NOGA 2DA4A 1BW6A 4IHYA 3S2HJ 1SANA 1XG1A 3K7AJ 1MBHA 3BG5A 1VI0A 4DYCA 4M3DA 2JN6A 1TWHJ 1K83J 2O8KA 2OF7A 2K9SA 1EF4A 2IBDA 3BTIA 4BY7J 4JX5A 2N8GA 1ORKA 2MG4A 1GUUA 4A3KJ 4A93J 2XB0X 1GV2A 2FJ1A 2HXIA 2I10A 5GPAA 1H88C 1NK2P 2VKEA 1MH4A 2LVSA 1Z77A 1I6HJ 1APLC 4C3JJ 3MN2A 2FD5A 3BQYA 3E7LA 1MBKA 1Q1VA 3HDDA 2Y9YA 1MSEC 2VUMJ 2YUSA 2PMZN 4JX6A 2GBYA 5IP7J 1RR7A 2LTPA 1JKQC 3O8GA 5IOZA 1TWFJ 2JJ7A 3BR1A 4D7MA 1IC8A 4XIDA 2MSYA 4XRMA 5M5WJ 2HOAA 2LR8A 3HOZJ 2XGEA 3D1NI 1WI3A 1JKPC 1SFOJ 4AUXA 3HOWJ 5K7FA 3S1QJ 4X1EA 5J3LA 1IV6A 4C3HJ 1DU0A 1IDZA 5BNGA 5M3MJ 2L9RA 4FCYA 2XPVA
chains in the Genus database with same CATH superfamily
2MBFA 2DA2A 2EFNA 4M74A 1FTZA 1Y39A 2DQRA 5KVRA 4FQGA 2JMWA 2ECBA 3G4SI 3RJPA 3KZYA 2XRNA 2HPIA 3CCYA 4P5OA 4G94A 3LFKA 5FB2A 3TDZC 2QYOA 3JTHA 5JHFA 5GADJ 2FQ4A 4XKWA 3Q9VA 3J7AY 2DOEA 3HEFA 2LMDA 4Q4ZF 2Q0OA 3FX3A 5ERIA 1TWAJ 5GTHC 5JVGF 3ZN1A 1K79A 1YX5A 1SFKA 5LLQA 1OPCA 2V7FA 1YO5C 4HSRA 2I5UA 5DV5A 2QLZA 3FXLA 3PFIA 3U2RA 4E7IA 3BTLA 3REOA 2F5CA 3TMOA 4FASD 2Z99A 3BLYA 1LVAA 2BXYA 2EIJH 1LE8B 5TISC 2OCEA 2KIQA 3P9CA 1NTCA 2XASA 4I76A 4LITA 4XL9A 3JRBA 3PM1A 4RM2A 5FRMA 1K6OA 2VC0A 3C2GA 2KDZA 4G8XA 4WF2A 4HPQA 2XAJA 1U9OA 5CVJA 4HG2A 4B09A 2NVXJ 1FIPA 3IP4B 3WTSC 5IYCJ 4R8HA 3J81K 4ENJA 1EH6A 2DA5A 1B9NA 4L0ZB 1XN7A 2IP2A 4Z6YA 2Z5UA 1WKMA 2UV1A 4DZJA 2NVQJ 3V7CA 5IYBJ 1T2KA 3GFLA 3E3VA 5DM7F 4M73A 2LYCA 3WTWC 1QVUA 1UHSA 5HLTA 3PJRA 1UZCA 2HU9A 1GV5A 3HUGB 4JX4A 4CH7A 4BQAA 5KAIC 3H1CA 5FLMJ 3AL0C 2WADA 3GZ5A 2R0QC 5M3FJ 2VB6A 5EF6A 1JT0A 1X3WB 1R5GA 3AKZA 5E8IA 3MKYB 3HRMA 3COAC 1ITYA 2GA1A 1MNMC 1DPUA 3F8MA 1ULYA 2VQLA 1FSHA 2HKXA 3OMYA 1X1CA 1GT0C 2HDDA 3NAUA 3GCMA 4XQFA 1VTNC 3M8JA 5E1XA 3DPUA 2L7MP 4AIHA 4M6XA 5HDKA 3BZCA 1IO2A 1ETWA 3ABUA 3K1NA 2Q1ZB 1KQ0A 2HDCA 4NHJA 3SZPA 4H4KC 1H9GA 3JTGA 3OS0A 1V5GA 3LQQA 3FBIB 3SEZA 3ZRGA 2LP0A 5CYVA 1W5TA 3F22A 1XDUA 2MGQA 2O3FA 5LHIA 5FROA 1HDDC 2NS8A 1LVKA 3C3WA 2EFQA 4EJOA 3CF2A 3OIQA 3BC8A 4OMYA 2H94A 3BG6A 1X3UA 1ZH5A 1WCMJ 3PO3J 3QPLA 5ILSA 2P5KA 4ZYEA 4IZZA 3ZQ7A 2B9SA 4MQ9F 4N4NB 2OA4A 2D45A 1KYWA 2OPTA 3MQ0A 4NNJA 4ZH4F 3AG3H 2OBPA 2Z9OA 3OV8A 4GRIA 3QYBA 2FEZA 3F9KA 4A6EA 5TJJA 1TC3C 2PJRB 3AL0B 2VJJA 3TW6A 2STWA 3K70C 1BJAA 4KDPA 1VQ5I 3NRVA 2B63J 2FNAA 3EPZA 1U8BA 2HTSA 4R1HA 2R5ZB 1X4OA 3FF5A 3L2RA 3MZYA 1ZKGA 3OOUA 1JXSA 4A3FJ 1XB4A 5H2FC 4BKXA 3LA2A 1LEAA 5HLGA 1KZHA 4NB5A 5GPCA 4EM0B 2Z3YA 5IY5H 5CKTA 2LNBA 2JT1A 2R5YA 2XSDC 5E3MA 4Z2YA 4E7KA 2FRHA 3S16J 1Z6RA 3BZ6A 4LG3A 1J9IA 4BE2A 2BVMA 1XC5A 2V26A 1OCZH 4A0ZA 1IUFA 2F5VA 3W6VA 4HV6A 3FIWA 1O3QA 3P9IA 5L3GA 3M1EA 1CQTA 2MYSA 3P5JA 3T0YA 1S29A 4QIWN 1TQIA 5KNLA 4KISA 2O03A 2M7BA 4UXNA 4XKBA 4HRIA 5EDNA 2VJ5A 3RI4A 1UG0A 1MBJA 5BS6A 1HF0A 1KU7A 2LKSA 3IHUA 2H8RA 1U8RA 2GXBA 3TOAA 1IN6A 3MZ8A 1BC8C 3GTKJ 2MA3A 1BA5A 3JRFA 1X2MA 2YS9A 3OR2C 5FLVA 5E17F 3ZQIA 4JK1X 3S32A 3JRHA 4RDUA 2V9PA 3VYSB 4Y15A 3DTIA 4UB6C 2JSCA 1R23A 4I98B 2F48A 3CZ6A 3DPLC 4CYDA 2PMUA 2P8TA 5E20A 5C44J 2K27A 3A03A 3CJTB 2L7FP 2K3FA 2MC3A 3K70D 3K4CA 1YHQI 2EZLA 1XGOA 1LFUP 2JA2A 2DAOA 1SFUA 4BQOA 4C30A 1MH3A 2NNNA 1QRYA 3LSHA 4BUPA 4A6DA 2E36A 1S7EA 3K4MA 3OYLA 1BC7C 4XRSA 5GAEJ 4L5IA 2VBXA 1LE8A 4V19K 3KYDB 2Y2ZA 1YQAA 1X58A 1OCTC 3DKYA 2G0EA 1TW2A 1U5TC 4CYCB 1OR7C 1B9MA 3L09A 2NXNB 1ZGJA 4BHPA 3GVAA 2H09A 2BEOA 2RDPA 2VC1A 4HX8A 2IT0A 1QU3A 1WGXA 2BY1A 5K5OA 5IP6A 1IN8A 2LG4A 3M8FA 2DMPA 4LIUA 4XONA 5EG0B 2M4KA 1H0MA 1Z7UA 2VJIA 3K4KA 2IGKA 3VOEA 4CZZA 1S7OA 1H9TA 2CQNA 2VQCA 1I50J 2A61A 4D7NA 4S05A 3J80K 3DCFA 2K9MA 3HUGA 1FX7A 2Y0SN 4UHTA 3IH3A 4AYBA 4BHCA 5CLSA 1YRNB 3G1MA 4BAYA 4KN4X 2K40A 4ON0A 2LH9A 3HZJA 4PJMA 4B4CA 3VWBA 4J19A 3QOPA 4JYKA 5IT3A 1AHDP 1JTYA 2D1HA 4MNUA 3ZMVA 2AXTC 2W1OA 3NWSA 3GTPJ 3QP6A 2RNJA 1P4XA 3VYTB 4P9FA 3R60A 3SYTA 2XKOA 4B43A 2KJBA 2O7OA 5H6RA 3OYFA 2DFEA 4U7BA 3ZMSA 1LB2A 3CP2A 4QLCU 2M8EA 4LFUA 3LMMA 3LSKA 5J1RA 1KU3A 3GTMJ 2HKOA 3HJEA 3W2WA 4FISA 3GEZA 5B5EC 4L9TA 5JHUA 2VOPA 3CMYA 2M34A 3RPUA 4Q47A 3I64A 2YSRA 3MZHA 2DDBA 1D1BA 2EZIA 1FJLA 1WZ2A 2CH0A 3QYEA 2RV8A 3FISA 5DD4A 2CQQA 3NWTA 1SVLA 3EUKL 1OKRA 3I4NJ 2JWTA 2ZXJA 1B1BA 1X1BA 2OCCH 1KYZA 3OYIA 2W24A 2FXAA 5D4RA 2KQRA 4EQQA 5D5XB 2M2EA 2J5PA 3OIOA 3CTAA 2YX4A 1S6LA 4M71A 4G9YA 5EZHA 3JREA 5ICFA 2VBZA 2XC7A 2KKOA 2O0YA 2IA1A 1V4RA 2EV0A 2XF5A 2O9LA 4IJAA 1XCBA 5F27A 2CO5A 4XRFA 5L3CA 3ZMDA 2R7TA 1SD7A 2R5ZA 5HLHA 3JAMK 1W36C 1ZG5A 2IGNA 2QEXI 4KYWA 2IJLA 4MEXF 4I6ZA 5F1JA 4ZC3A 2A6HF 4FHTA 2DTZA 2D1VA 1P6RA 5LRRA 2ZCWA 1K4SA 2V6EA 3GTQJ 4D0PA 1S9HA 4IHXA 5L3FA 3PIPF 1P7IA 4Y13A 2GIVA 2D5VA 4C9YA 2VBYA 1MSFC 2EQRA 4LLGF 2HOEA 1Z0XA 1BR1A 2VQHA 3CCJI 2P81A 2EZHA 3HGYA 3ZGKA 1BIBA 3V4GA 1FMVA 1ETYA 1SD4A 1BW6A 5GAGJ 4IHYA 5D4SA 4IOCF 3WODF 1W5SA 1LJ9A 1VI0A 3E1SA 1TWHJ 1ERDA 1K83J 2GIZA 3MAJA 4B3XA 4BJTA 3HL2A 1D0YA 2IBDA 3CCRI 1UAAA 2F5DA 2L5QA 3FXMA 5EJCA 1HW1A 2R7XA 4IHTA 3LSMA 3FDYA 3RKWA 3G3ZA 2MG4A 3FHNA 3S93A 4ZYGA 2PLYA 4A3KJ 1IN7A 3N05A 1GV2A 4PCQA 1H88C 4I09A 1NK2P 2FBHA 2DDAA 4DNCA 2M3AA 2IS4A 1I6HJ 2A6EF 3SEQA 3MN2A 3ZPLA 2FD5A 1MBKA 3SZTA 3PUBA 1BR2A 2CQKA 3CCUI 3HDDA 1BI0A 4XLHA 5D5VB 1KONA 5KCMA 1P2FA 4IRGA 4CCJA 2EK5A 2QM3A 1R36A 1OQYA 4LK1F 1JKQC 5KK1A 2PN6A 4XLEA 2CUJA 2JVHA 5D8KB 2K85A 2G7HA 3K9TA 3CCEI 4IXAA 1TNSA 2HOAA 2GXAA 2JZYA 4I02A 1W36D 3D1NI 1A36A 2CUZA 1JKPC 5K7FA 2A5WA 3GLLA 1IDZA 3ISPA 1DU0A 3VFZA 1K7AA 4HQMA 2L9RA 2XPVA 1UFMA 3S3NA 2QQAA 4HA8A 1ZHFA 2KRCA 1U78A 4B3AA 2VQGA 1UG2A 1KQ9A 4BBRJ 4M3FA 2W4SA 2XGCA 3ROUA 4BBSJ 3N4MA 3GZ6A 3ZQGA 3A02A 1ZQ3P 2NOJB 1XD7A 5FRNA 1MZBA 2GQQA 1RZ4A 1R6RA 3BR0A 3M4OJ 2M8GX 1BR4A 1U6GA 4B48A 1Y6IA 1GLNA 1OYIA 4I0AA 2Y0MA 3NARA 1B6AA 1QZEA 1R00A 1XGNA 1HDPA 2QCOA 2DMQA 3HC7A 4UUVA 4XLNF 1QNTA 1YRNA 4ZTFA 5HNHA 3AAFA 3OYBA 5HNFA 4KN7X 3EUHA 5H20A 5LGUA 1KQ8A 2F2EA 2Z2SB 5FLXZ 1XDSA 1ETQA 4PGHA 4A3MJ 3KPHA 1IZ1A 2BY0A 2X6WA 2XVCA 1OFCX 4C3IJ 1O7FA 3ZQQA 4NBQA 4QWQA 5EEAA 2HVQA 2QA4I 1UHMA 2M30A 3OSGA 5E18F 1WFXA 1XCVA 4NC8A 3KYCB 2E1MC 2FQ3A 2WB1A 2X6YA 3U1DA 3V7SA 4BDZA 2COBA 3V8JA 5LGNA 3NEUA 2P4WA 2PFBA 2F4IA 1RETA 1Y1VJ 3K1MA 2WA0A 5E3LA 3F8FA 3W6KB 3R6SA 4UB8C 1UJ8A 2HYJA 2F5EA 2XIGA 3DEWA 1MMSA 3IH2A 2EBIA 2JTVA 4P96A 3H9GA 5L3DA 4BGDA 4XORA 3L9FA 2KPMA 3H9JA 1UHWA 3FMSA 1T0FA 1IV8A 1MNDA 1HOMA 3S3MA 2CSOA 3ABLH 4CUGA 3W2VA 3WE2A 2ELHA 4HBLA 4LOCA 1D8KA 1ON1A 5GTIC 1B72B 4PZJA 3LAJA 3SFIA 3IV5A 4IHSA 4KFCA 4I2OA 2DT7B 4E6KG 3KZIC 4X6AJ 2ZBKA 1HKSA 2VJ4A 3GX4X 1DUXC 1ZR2A 4YG2F 2BVLA 4JBAA 3GFMA 3OS2A 3IRQA 2R5YB 1MDMA 5HS8A 4CICA 4CCLA 2QUFA 2CUEA 5C4JJ 2MH9A 3RZDJ 1HCRA 1G2HA 2R7RA 2DFIA 2IGMA 3I5UA 3K2ZA 1WH7A 4RGXA 1GVDA 1X2NA 4BL0B 3ZQLA 2PQ8A 1YI2I 4XN0A 3OYMA 1LDKB 2NVTJ 4A3CJ 3HHGA 1J0RA 4CCNA 2E2IJ 4ZDLA 3QPSA 3CLOA 3WTVC 3IWZA 3TO7A 2DO7A 4FE4A 2RKHA 1V3FA 3DBRB 5EYRA 3C2HA 2DW4A 3BWGA 1BJZA 3E6DA 5AONA 3U21A 2HQAA 1A04A 4D5CA 5BOXA 4H0EA 2L9SA 2MD0A 3HOTA 1R1VA 2EFOA 3BG3A 4AWXB 4G6TB 2V4JC 2WV0A 3K0LA 3F72A 1USSA 1IRGA 2VKHA 3H0DA 2QGUA 1NHAA 1N77A 3PO2J 1Z67A 1Z21A 2BV6A 4O6JA 2OD5A 4BJ5C 2ZJ2A 3GWZA 2CYYA 4OINF 4Y4RA 4MHGA 1TQMA 4Y33A 1STZA 3J7YJ 3WHBA 4N9HA 3Q5FA 2IPQX 4BE0A 1VQLI 5C3EJ 1MBEA 5D5UB 1WH5A 1N75A 4QPOA 5HVQC 4EGYA 1GHCA 4N0BA 2HYGD 4IHWA 4JOMA 2LBFA 2P5LC 2CRGA 1Z05A 3C18A 4ITVA 2ME0A 4E7HA 1R5HA 2GAUA 2XB5A 2CFXA 3PNYA 2OZUA 1T8IA 3BG9A 3OR1C 1LEBA 2ID3A 2EA2A 3A0BC 4E7SA 1D1AA 2HVRA 4D5FA 3B6CA 1QBJA 1OYWA 4N4OB 5K1YA 2HFHA 3DTEA 4F92B 5LRSA 2FSWA 4KUMA 3E97A 3IH4A 2W00A 1YW9A 4U7DA 4A3IJ 1R58A 2OJED 2RVCA 5JVTA 3KP2A 4I7HA 3HHHA 3QODA 3A01A 2QKLB 4HNTA 1S5LC 1MJBA 2M0CA 2ZMEA 3H35A 3ASNH 3GMEA 1FBUA 4RAZA 5FJ8J 2IS6A 3PNVA 5IOYA 5IYDJ 3KIOA 3QQAA 5DCMA 1Z7LA 3HIFA 2L2OA 3SJMA 1AWCA 5ICCA 3I71A 2LSOA 1KU2A 4HEA2 4DW6A 4E7JA 4A3BJ 1J59A 3OIPA 3HB9A 3E6CC 3W3CA 2E5NA 2XAGA 2K4BA 4HW0A 1YIOA 1F5TA 2FOWA 2ZNYA 4ABZA 1TWGJ 4RMNA 3IAM2 5DUKA 5KHDA 2CWEA 4PJ0C 1BI1A 4IO9F 3BCBA 2OZ6A 3M1CA 2LKXA 1G3YA 2XAUA 3DLLF 5JR3A 3MKLA 4A3JJ 2CW7A 3FWEA 3G71I 4MGRA 4FETA 2Z1DA 4CDGA 1HA8A 2FA5A 2JPBA 2LY1A 2X6OA 2JK3A 4PK4A 3FXJA 4YIRX 1DP3A 2QQ8A 2DMUA 4PGGA 1ZN2A 3ZR8X 1MMAA 2MD5A 4JQFA 3HOVJ 5J40A 1J7KA 1VFCA 2IGOA 2XAHA 5HDNA 4ZTJA 2A68F 3M8EA 4MIMA 3WTUC 2B7EA 4NDLA 4BQQA 3D0SA 3QWLA 1T98A 4KIFA 1Z1DA 3H5NA 3S17J 2YR2A 4O5VA 4ESFA 4GDFA 4FX0A 4XOTA 1QPIA 2Y48A 1FZPB 1FLIA 1WJEA 4QPQA 1WI9A 1HLVA 1QZYA 1P7JA 2GZWA 4LG0A 2DU9A 1B72A 1ZLJA 3OSFA 2CV2A 2W57A 3QPHA 4LB6B 1GDTA 3GTLJ 1JT6A 2Y75A 3FXUA 1VF9A 2HWVA 1BM9A 1WJ5A 3DFGA 1ETXA 2Y30A 4BH9A 1A35A 3J7AO 2DCEA 1H89C 2WAFA 4GCVA 5K5QA 2BBYA 3BR6A 3KFWX 3CCVI 1I27A 3RQ4A 2IVMA 2ZSIB 3EETA 3QU3A 5DS9A 4AM3A 1ZTRA 2TCTA 3R4KA 2FUG2 4CA0A 1XMAA 4BYYA 4XKVA 4XLCA 1YW7A 3CP8A 4AYBN 3VYRB 4BXFA 1BBYA 4YRVA 3CMEI 1LDJA 4IX7A 2K5CA 4FTHA 4RB1A 2KP6A 4IRHA 4IQJA 1POGA 4C2UA 2E7XA 4Y3OA 2E7WA 3CDIA 1SFXA 1Y56A 5FFXA 4AVZA 2GLOA 4BEHB 1QQIA 1L3LA 1Y8QB 1YS7A 2XPUA 4DYRA 2LY2A 2JPCA 4KT6A 1YTYA 2OU2A 1Y0NA 2KZVA 2X4HA 3ZQHA 3FKJA 1EKEA 2P6TA 3ECHA 4NQWB 2EH3A 1DGRM 3A0HC 2Z16A 5B3SH 3QP5A 4MQVA 5IT9Z 2WWYA 5M5XJ 2IRFG 1BOAA 2DPDA 2V1NA 1L0OC 3GBGA 2O8XA 1SAUA 1OJLA 2ID6A 3TOBA 2MLGA 3KCCA 3DKWA 2ADUA 3EUHC 1HC8A 2M4GA 2G9WA 2OQGA 5JLXA 2H6BA 1Z3XA 2DMNA 3H3VK 1JKRC 1KU9A 1A5JA 2H6CA 4EJVA 1OLTA 2K86A 4OIQF 3D5SC 2X1EA 1ZREA 2HOTA 1X1AA 1S7AA 2K3PA 3Q3SA 4G6QA 3SDGA 4HDUA 1P9QC 3F23A 4A3DJ 4U88A 3WU1B 1NK3P 5J4YA 2NOGA 1R5ID 1T95A 1G3SA 1B4AA 2XV4S 4OIPF 1HQCA 3BG5A 2BGCA 1AA7A 2XROA 2ZJRF 3KETA 2QSGX 2VKDA 3CC2I 4ASNA 2DFFA 1T38A 4UVBA 2M1BA 2O8KA 2K9SA 4EJWA 3CC4I 1EF4A 2XAFA 5CQEA 1HKTA 1T0FC 5FLXK 1MD0A 1P92A 2QSFX 4JX5A 3FXKA 1RI7A 2UZKA 3T8TA 3BJOA 3WTTC 2ESHA 3DBLB 2FJ1A 5GPAA 1YW8A 2K9LA 2VKEA 3HYIA 4DBQA 2OUMA 2WAQA 1PUEE 2ZFUA 2K4JA 2QENA 3K4BA 2FOKA 1MNEA 2QVOA 1JHFA 3E7LA 2HYFA 2AQFA 4ZJZA 3F3XA 2ZFWA 2LF7A 1CF7A 4J00A 3WTZA 1RR7A 2LTPA 4CGZA 1EJ9A 3KZZA 2HZTA 5IOZA 1TWFJ 3BR1A 4AIDA 1J5YA 1IC8A 5DYMA 2VODA 4XIDA 2BE5F 3IUOA 2MLKA 4HF1A 3OYEA 1EV7A 3A1YA 1OMIA 1OYYA 5M5WJ 2J5OA 2P5VA 4RLFA 1K4TA 5L3EA 4OWRB 3OWTA 4AU7A 1W7PA 3S1QJ 2E1NA 2BY2A 2Q8KA 3WGHA 4G7ZF 5J3LA 1IV6A 4C3HJ 4O3MA 1FC3A 1IRZA 2NRAC 4EGZA 1MMGA 2EWNA 3WTXC 1LFBA 2QQ9A 5D6EA 3DEEA 4G12A 3L2QA 4WXCA 3OS1A 4FX4A 2UXNA 3H3UA 5DDGA 4MFDA 3PSIA 3CQZJ 4XSXF 4U0WA 3Q9SA 1N78A 2DJNA 1RNLA 1RESA 2CQ7A 2DT5A 2R93J 5JLWA 3S1RJ 3FM3A 1QHHD 1MIJA 3B73A 1XTAA 1F36A 1R22A 3RPQA 2XRLA 3H0GJ 3HRUA 4DJAA 5E1WA 5JFRA 3MKZA 2OAZA 3B02A 1EA3A 3ONQA 1TL8A 3OL4A 3OYCA 4MTDA 5FO5A 3VB2A 3TGNA 2RQQA 2YU3A 3FXOA 3DU6A 3LNQA 3T8RA 3TBIA 3F6OA 4UVCA 1P4WA 5CQGA 3N97A 2DJIA 5K5RA 2EA4A 3CC7I 1TW3A 2HGCA 4IVNA 4EJUA 2IS2A 5HLIA 5CVUA 4XM3A 4DZPA 3JR9A 1TWCJ 3JRDA 4A2UA 1U3EM 1MDMB 1DGWY 1R9TJ 1ZYRF 4L18B 2KHMA 4IEJA 4XK4A 4MLOA 4GFBA 1I1SA 3D5LA 1NG6A 3JRCA 3ZOBA 3LSGA 3LL7A 2VBWA 2VN2A 1XMXA 4EEFG 2YX7A 3K4LA 4BS9A 3H92A 3W6JB 3KYLA 2UUZA 1TTYA 4A5NA 4A3LJ 1AKHA 3H5RA 1RR8C 2AS5F 5LEJA 3ZQCA 1IDYA 4HX4A 5HS7A 1A31A 1HKQA 5BPIA 1OISA 2QBYB 3I59B 4NC6A 3TP3A 5FD5A 5CVRA 3S1MJ 3PUFA 5FD6A 1Q1HA 5ICEA 4GYGA 1FYLA 4RAYA 2K9NA 2CQXA 2F4OB 1ONVA 3CUQA 5B66C 2VPRA 4YEJA 4M9XA 4BEHA 4AVPA 3DU5A 4E70A 3KP5A 3VPRA 3L2WA 4YFKF 2VONA 3CCSI 1HW5A 4M3EA 2WB1N 2ZMEC 3T1BA 1O57A 3BP8A 4NQWA 5B1BH 2CJJA 4A69C 1WSUA 3WG9A 2RREA 3ERMA 4DGWB 2ESNA 3GTGJ 1WJFA 2E71A 4RB3C 1LUJB 3K4JA 2FMLA 3L1PA 2NS7A 3GTJJ 4P55A 2KLOA 3HRSA 4BXXJ 1VQ4I 4EV0A 3ZMTA 2PBIA 1KA8A 4AC0A 1Y8RB 3PNTA 3AG2H 5BMZA 3BR2A 4CZCA 1SAXA 3MFKA 4L9JA 2EB7A 2GWRA 4HNVA 2LBFB 4DQ2A 1R49A 2BW3A 2C6YA 2L02A 2P7CB 3GO5A 3KP3A 1ACIA 3TDUC 5F1RA 3DEUA 4NC7A 2JA7J 3R0JA 2RQPA 1S72I 1K78A 2A69F 3ZQFA 4M6YA 2R7QA 5F0CA 3HTUA 5E79C 1TQPA 2DOFA 3PIOF 3EYIA 2Y9ZA 2R7VA 4Y52J 1OCPA 4J01A 3FMQA 4P9UA 2G7UA 2WV1A 3CO7C 1NH3A 4S0HB 3HOXJ 3O8HA 4X0GA 2XSJC 3A01B 3CDLA 2DYRH 1QVTA 3HOYJ 3H36A 2ZMEB 1A6IA 2HXOA 4OAZA 3H5AA 2XF7A 3R0AA 3HGGA 2M0MA 5CPRB 5DCMB 1RUOA 3I58A 2GA2A 2X48A 2ZB9A 4ZYAA 1P4AA 3TP0A 4XLPF 4WK8F 2DN0A 3GZNB 3K10A 3GW2A 4RGRA 2CGPA 4FT8A 2M7AA 5HDGA 3SFZA 4HF2A 3G73A 2F4MB 1ZR4A 4BE1A 4GYIA 3IWFA 4II3A 1IF1A 3WHCA 1XGSA 3V42A 4F55A 4OOIA 1WRJA 3DXJF 3CD6I 1IW7F 4YIIA 3CUOA 3WG7H 2E1CA 5EZGA 2AXLA 5E1ZB 4MTEA 1W1WE 2BYVE 3TEDA 4A12A 1XPXA 4I99C 2ETHA 3L7WA 4E7LA 4D1QA 5GP9A 4MO7A 3I56I 4LK0F 4XNFA 5AIPA 1E3OC 4A5MA 2FMYA 2WBMA 3Q0VA 2ICWG 1JJ6C 2MC4A 4OAYA 5KAFC 1T56A 4ANJA 5FKLA 2IAIA 4B8XA 1EH7A 3GLXA 1REPC 3OOPA 3DWLE 2UXXA 2CV0A 2F5FA 5EEGA 1S3JA 1RC9A 3HSEA 1LQ1A 1TBXA 2NYXA 3O3KA 2ACJA 2X85A 4I01A 4ZZDA 1PP7U 2XKPA 4XRSG 3G1OA 2KT0A 4PSXA 4CXFA 4LG0B 3HKZA 5EGOA 3BQZA 3DF8A 1XSVA 1FIAA 1Z91A 4F91B 2WY8Q 5BPDA 3TW7A 2AO9A 5FKMA 1R1UA 4ENKA 2CW8A 2DODA 1SFEA 3IL2A 3CJQB 3OYHA 2PJPA 4LLLA 4HX7A 1FYMA 3IKTA 2P7VB 4C2MJ 1FBQA 1FWZA 2M45A 4OU0A 4UUSA 4KNYA 3GXOA 1D0ZA 2KDOA 5K7ZA 2M9HA 2W84A 4UNOA 1E17A 4RGUA 3C2BA 3CCQI 2OC6A 4BQNA 4BDYA 1VQMI 2W48A 3KP7A 3FK6A 3KEYA 3F0CA 2EILH 5DCFA 5IT9K 2MABA 2LF8A 4RA2A 4A3EJ 5F0HA 3QAHA 2ECCA 1IRXA 4V2GA 1SC7A 3MKWB 2JRTA 2IS1A 3CESA 3DLAA 1OCRH 1RPWA 3I54A 3F8CA 3WU0A 4A0XA 2IA0A 4ESJA 3MEXA 3RSNA 2Z33A 2O6GE 2QBYA 1VQ6I 4UY8I 1LNWA 2X9DA 1JE8A 2DA1A 3I59A 2R7FA 2XGXA 3A4CA 1TZLA 2EPFA 2WY7Q 2JUCA 1WQ2A 1F43A 4WCGA 3KLNA 2Q2EA 1D5VA 4QSHA 1GXQA 2GOXB 3SZGA 3K1PA 1JJ8C 2WTEA 2CMPA 3WGGA 4CCOA 1H8AC 2STTA 1D1CA 3ABMH 3K69A 2EV5A 2BY3A 4U87A 1FOWA 2W7NA 1SMYF 4BNCA 1PYVA 4XICA 1Y1WJ 1ZAOA 1X1DA 2LD5A 4EMSA 4W97A 2LKPA 1IG7A 2CW0F 1YJ9I 3ABTA 2HQRA 2MFZA 1PUFB 4L9VA 4UVAA 2LDUA 3V8LA 1YX3A 3LSRA 3UNGC 1LFPA 5DEQA 1MBGA 3K6GA 3EQLF 1LPQA 1UMQA 4HSTA 1QO0D 3M7GA 1PVEA 5J8CA 5A2QZ 1LDDA 3BR3A 3S8PA 3PQJA 1XS9A 3TKYA 3AFHA 3SXYA 1E0EA 1ZRDA 3S15J 2QF7A 4WXHA 2ZXIA 3M3YJ 3FZVA 4RGSA 4KITB 1TLHB 1DDNA 1ZRCA 1YLFA 3F6VA 3OYAA 1QHGA 2E1OA 3A2KA 4ZDOA 1ETOA 2L01A 3BCAA 3E5QA 1W0UA 1GXPA 1BW5A 4ZYHA 2NNYA 3VSLA 3CLQA 2ELKA 2HOSA 3RZOJ 1O4XA 2VPLA 4WWCA 3M9AA 4LB5A 2CV1A 4WX9A 1K6YA 2R7SA 2EIKH 2E2HJ 4MFEA 3RYPA 3T5XA 5DM6F 3CO6C 2KRFA 4XLFA 3G1LA 4P1WA 3MCZA 2JVGA 2LREA 1T33A 4XOPA 1SD5A 3MWMA 3JRIA 5D6FA 1J75A 3JW4A 1CF7B 2FE3A 2A07F 5E3OA 5J6XA 5HODA 2M5WA 3FXRA 1WHUA 2CU7A 3SQNA 4F3QA 2L7KA 2LLKA 4IHVA 3I0TA 1G3TA 4HLXA 4Y7NJ 2L4MA 2VASA 3HPHA 2DT6A 1S8NA 5F04A 3TO6A 3K2AA 4EJTA 2R7ZJ 5L3BA 4GO1A 1W7PB 1G6NA 1RKTA 2PMZA 2RGVA 2VKVA 2VT2A 1MJ9A 2LOOA 4K2EA 2FF4A 2DA4A 5LHHA 3W2AA 1QA6A 4CHUA 1SD6A 1XG1A 1MBHA 2ISYA 4DYCA 1ZARA 4M3DA 4EVIA 4R79A 2KIFA 4LJZF 4AIKA 2VT3A 3FBNB 4OIRF 3ERED 4G7OF 1W7PD 1N25A 4BY7J 2A3SA 1O7LA 2N8GA 3S2WA 4GXOA 5F64A 5ILUA 3DKXA 3CUQC 3WTYC 4N9IA 4EATA 2XB0X 2HXIA 2I10A 3OYDA 2LVSA 4HLYA 3RPUD 1OCCH 4DIQA 1IXSB 1IXRC 2EJRA 4C3JJ 3ZP5A 2HR3A 1SEUA 1MJAA 3V8KA 4RM3A 3HTSB 1USTA 2DBBA 2Y9YA 2VUMJ 2HEOA 5D8LB 3DP7A 2GBYA 4JX6A 2JRMA 5IP7J 3I55I 2QWWA 1TNTA 3O8GA 1I1GA 2JJ7A 1YOVB 1JI8A 4LD5A 2NVUB 1T39A 1IN4A 2R3SA 2DXIA 4XRMA 5D5WB 2WAEA 5TGTA 3C7JA 4YELA 1FOKA 1T6SA 3BDDA 4E7ZA 3FMRA 4KICA 4U0YA 1YIJI 5F6FA 1A6QA 1SFOJ 3G6EI 4ETSA 5CVVA 3PFYA 4M72A 4YFNF 1YITI 5HOOA 1PJRA 1VQ9I 2V6CA 1FSEA 9ANTA 2YU9J 2JA6J 3H3ZA 4XSZF 3WE3A 1TP4A 3LA7A 4M3BA 1AKHB 1QGPA 3U9GA 5E3NA 2L4AA 2PX9A 2V1DA 2WAQN 1F1ZA 3UR3C 2F6CA 1AU7A 2V1XA 4BACA 3LWFA 2GOMA 4ENNA 4I0BA 3KP6A 2UWMA 1Z3YA 2HZDA 3BR5A 3GF2A 5LFAA 3OY9A 2JA5J 3JRGA 3P9KA 1E2XA 1RIOH 3CUQB 2ZO4A 2R7UA 1ZG3A 2XGDA 3RQIA 1SMTA 1XX5A 2W25A 1K61A 3QPTA 1I5ZA 1VQNI 2W85A 3BPVA 4CO8A 3EDPA 1I3AA 2RN7A 1HSJA 1HSTA 3ESWB 4HF0A 1BN5A 1I3QJ 2X6XA 1RUNA 3FHZA 4UV8A 2KIUA 2X1CA 1I6XA 4LGWA 4ZYDA 1FYKA 1SVOA 1IN5A 2R7DA 4KT5C 2DK8A 2V9KA 3Q0WA 3I4MJ 5F08A 1DPRA 1AOYA 5ICGA 2HQ5A 2O61A 2K02A 3LSPA 3S2DJ 1IXCA 1TT0A 4EM2A 1R7JA 4V2FA 4YIFA 4WXDA 5LD2C 3MD2A 5H6QA 4ENMA 2ME6A 2X0LA 4F93B 2XAQA 4RB2C 2H1KA 1BI2A 1JGSA 1V5EA 2R4GA 3DQVC 1ENHA 4PDKA 2DA6A 2BW3B 4HNUA 1PUFA 3GTOJ 3RKQA 2COMA 2ZC2A 3FM5A 1QZZA 4RBOA 5FKNA 3DPTA 2Y69H 2DA3A 2E60A 2OQRA 3HXLA 4QTRA 5BQTA 3OYKA 1K78B 2L0KA 1PDNC 3RKXA 4HYEA 2OTLI 3HSRA 1ODDA 4YFXF 1R71A 4PJJA 2HS5A 4RAFA 2X51A 5K7HA 1C0WA 1MBFA 4BXUA 4HAMA 2CUFA 1ON2A 1V55H 3E6MA 2LK2A 1FEXA 1V5FA 3E5UA 3KP4A 1F9NA 3KEQA 3HBLA 1TT5B 3ECOA 3C1DA 2DTRA 3QRFF 3X2QH 3EYYA 1G3WA 1YFHA 2EIMH 3CMAI 4DYQA 5LBQA 3HOUJ 4IL6C 4IOAF 1O3RA 5M5YJ 2KIMA 2ZNZA 4RB0A 3L2UA 1MMDA 1B8IB 4ZDPA 1X4PA 1LKXA 3OL3A 3BJ6A 2ZJQF 3LQRA 4DOZA 2E5ZA 2JUGA 2IA2A 3IRRA 3MVPA 3BOQA 4L0YB 4ESBA 5IPAA 1IUYA 3ZXSA 3TQNA 1JKOC 1VQ8I 2R7WA 1NG7A 1XSDA 2QSHX 3RDIA 2HPMA 2BHZA 2NVYJ 3ML6A 1UCRA 1WWXA 3F21A 3BJAA 4NUBA 3LA3A 4C2TA 3D5RC 4UUTA 3HSFA 4W1UA 2KL4A 1MW7A 1XMKA 2QKMB 2H27A 2LRDA 2IW5A 4U0VA 3ZMUA 3ELKA 1R4MB 2FX0A 3JCUC 3J81Z 2P0WA 5F0FA 4XMYA 3HOSA 3BG7A 3E5XA 4PJLA 2BOLA 3SDBA 4LMYA 4RS8A 4KA4A 3MMYB 2DOAA 5DD8A 2FNPA 2GM4A 1FMWA 2LY9A 3EUAA 1QPMA 3E6BA 1X1PA 3O6BB 3ABKH 3J7ZI 1DP7P 4XKCA 2EV6A 3JRAA 1FT9A 2E19A 3I53A 1U5TB 2Y31A 2VL8A 3KLOA 5EGOB 3E0JB 3SHFA 4HQEA 1D0XA 1VZ0A 3I4PA 1BIAA 2MH2A 2HVSA 2HDWA 3TO9A 2L7ZA 2AHQA 4JP0A 4D9JA 3HM5A 4CCKA 2EFWA 4XN3A 4CCMA 3B6AA 2RC4A 4XR6A 4E4HA 2DMTA 3G2BA 3QYFA 1J2XA 2CG4A 1UELB 3IKVA 3R61A 1YS6A 1G59A 4B47A 4BU2A 1JHHA 4UUSB 4EM1A 1U9NA 3IAS2 3RKYA 1U0JA 3DBHB 5FKOA 5IP9J 3LSIA 3LSJA 1FTTA 2XHKA 2ZXHA 4IPAA 4PUSA 1BI3A 3S3OA 1W0TA 1WJCA 1ZK8A 4A0YA 2PJRA 2L9NA 2HNHA 2BHYA 4F7ZA 4KIBA 4OMZA 2M87A 3HPGA 4RLQA 4M9ZA 4F52A 1HBXG 1UB9A 1MGTA 1MKMA 1IGNA 1YYVA 1ETKA 2DLLA 1IAWA 2RNGA 5E8GA 5FKKA 3S1NJ 2JSPA 4B44A 2XUBA 4IRIA 1JUSA 5CVIA 2V9VA 1KGSA 1ZRFA 3ZCOA 1Z6TA 2IEKA 3GFIA 3WU2C 2Q2EB 5J1UA 4XBFA 1G4DA 3TL4X 5A2QK 4MEYF 2W82A 1R4NB 4HZFA 3BROA 2L9VA 2Y0SA 3AG1H 2TRTA 2EFPA 3P7NA 1Y0UA 2DFHA 3BTCA 2PMHA 5EEHA 3F8BA 1JTXA 5AIQA 1WJBA 6PAXA 1FP1D 1W5CC 4S04A 4G7HF 1FBSA 3BT9A 3CJNA 2LFBA 5TRDA 3I3LA 3BTJA 1WPKA 4UV9A 3BZKA 1JUMA 3WGIA 2R7OA 2A05A 3ULQB 2I8DA 2L3DA 4L9NA 4BJ6C 4L5EA 1W4MA 1IJWC 3BY6A 2JA8J 1FOXA 4L5JA 1RRJA 4M3GA 4IKFA 1IRFA 3L2CA 3CCMI 3VSKA 2E2JJ 4BY1J 1E3PA 2DK5A 2VIXA 4HDVA 2X1DA 3IC7A 1HW2A 1FP2A 3HKZN 2XF6A 4IF4A 2QZ8A 1WJDA 1BOBA 1FY7A 3GFJA 2MW8A 1VQPI 4KIGA 4FE7A 2NAZA 2L54A 1D8JA 5LHGA 1X19A 2HQNA 1Z9CA 5FGMA 2VLAA 3ZN0A 2H1LA 1ZLKA 2VE9A 1YG2A 1G8XA 4A3GJ 2XPWA 2XDVA 5JI6A 2BXZA 1OCOH 3QOEA 2D2WA 2DYSH 1FPQA 3H9QA 1DQUA 3VYUB 3FKIJ 4ZZLA 3RYRA 1YJWI 1XGMA 1ZELA 2VOOA 1GVJA 2BZTA 3L2VA 3VODA 3OYGA 1SVMA 5J1YA 1WJAA 2HI3A 1ETVA 5DTDA 3S14J 2ZKZA 5C4XJ 4CYCA 2R92J 3V7RA 3ASOH 2ZJPF 2VI6A 3L00A 4HOBA 3VEPA 4AD9A 2FU4A 1D5YA 1ZG1A 3OYJA 1B59A 1BL0A 4LIVA 1B8IA 2PI0A 2NS0A 1YE9A 2RAEA 4B1RA 1XSXA 2K9QA 2HTJA 3LOCA 5EG0A 4Y17A 3RTRA 1U2WA 2ZSHB 3QU6A 1JGGA 4M6VA 1DU6A 1O3SA 4HV5A 4IQ4A 4Q5SF 1CGPA 2DPUA 2VXDA 2A6TA 2DI3A 2P6SA 3Q0UA 3DTKA 5DUIA 2WC2A 3M07A 2O5RA 3PL8A 1M1EB 4RAGA 3LAPA 1ZGWA 3ZMZA 4M9SA 1YJNI 5ILVA 2EZKA 2VXZA 4PJNA 1JUPA 3GYHX 4DBRA 1F4KA 1HXDA 2OTJI 4KJZA 4KMUX 4KMFA 1ZGAA 2VE8A 3J80Z 3FK7A 3GUDA 2E34A 4OIOF 3KX2A 3FXQA 1U5TA 4CSWA 2E35A 3UKGA 1VNDA 2IXSA 5FFZA 4XLAA 1OR7A 2GXGA 2V1UA 1I39A 4PFPA 1RKWA 3NQOA 2ELJA 3RCOA 4BHBA 2QQBA 4II2A 2DA7A 4GGGA 5LEKA 1V54H 4AIJA 2ISZA 2FBKA 2V79A 3S2HJ 3LSTA 1SANA 3K7AJ 1T08B 2JN6A 1FOYA 2KRHA 2PG4A 3PQKA 5GAHJ 1PP8F 4LLNA 2OF7A 5HS9A 3BTIA 1O3TA 3KEOA 2KISA 5ED4A 2JQ7A 1EH8A 2KFDA 3LFUA 1ORKA 2YPRA 3AG4H 3BPXA 1GUUA 3DV8A 1E3HA 3HG9A 4A93J 3I9V2 3U1KA 5CJ9A 4G6DA 2H8WA 1MH4A 2DQLA 2KMUA 2OV7A 5J4VA 3CCLI 4TV7A 2KZGA 1R1TA 1Z77A 4PFOA 1D3YA 1APLC 3O2PE 3BQYA 2B0LA 3HRTA 1WVRA 1Q1VA 1MSEC 2FBIA 2YUSA 2PMZN 3CDHA 3VDXA 5J8FA 2AQEA 5B1AH 5LGTA 3CF5F 1X3ZB 2E1MB 2A5YB 4D7MA 5J47A 2CS3A 3RIRA 1FNNA 2MSYA 2LC2A 4PSWA 1VQKI 2KJCA 3OYNA 2LR8A 2CFOA 3K4NA 1VQOI 3JSPA 3PSFA 2XGEA 3JSOA 3HOZJ 2TDXA 1WI3A 3KE2A 2PEXA 4AUXA 3HOWJ 4Q48A 3F8NA 4X1EA 1VQ7I 2EINH 1MMNA 3JAMZ 1J09A 2K7LA 2ZXWH 3CJRB 3CMMA 5BNGA 5M3MJ 4FCYA
chains in the Genus database with same CATH topology
9ANTA 2DA2A 2YU9J 1LFBA 2JA6J 1FTZA 4G12A 4M3BA 1AKHB 1U78A 4B3AA 5E3NA 4MFDA 2WAQN 2JMWA 1UG2A 3CQZJ 1AU7A 2ECBA 4BBRJ 2DJNA 4M3FA 1RESA 3CCYA 2R93J 5JLWA 2XGCA 3S1RJ 4BBSJ 3BR5A 3ZQGA 3A02A 2FQ4A 2JA5J 1F36A 1ZQ3P 3HEFA 2XRLA 3BR0A 3H0GJ 3M4OJ 3JRGA 2M8GX 1TWAJ 2XGDA 3RQIA 3NARA 3LNQA 1K61A 1HDPA 2QCOA 2DMQA 3BTLA 1YRNA 1LE8B 1I3QJ 1NTCA 4I76A 3JRBA 3PM1A 4DZPA 2KDZA 1ETQA 3JR9A 4A3MJ 1TWCJ 3JRDA 3Q0WA 3I4MJ 1U9OA 1OFCX 5F08A 4C3IJ 1R9TJ 2NVXJ 4IEJA 4XK4A 2HQ5A 4MLOA 5EEAA 4GFBA 3LSPA 3S2DJ 1FIPA 3JRCA 4V2FA 5IYCJ 3ZOBA 3OSGA 3LSGA 2COBA 2DA5A 4EEFG 2ME6A 4DZJA 1RETA 2H1KA 2NVQJ 1Y1VJ 5E3LA 5IYBJ 1ENHA 2DA6A 3GTOJ 1PUFA 4A3LJ 2HYJA 3RKQA 1AKHA 3DEWA 1QVUA 1UHSA 3IH2A 2EBIA 4RBOA 3ZQCA 1IDYA 1GV5A 4JX4A 5FKNA 2DA3A 5FLMJ 4QTRA 1IRZA 2L0KA 2R0QC 3TP3A 5M3FJ 5EF6A 1JT0A 3S1MJ 1HOMA 1ITYA 1MNMC 2K9NA 2CQXA 2VPRA 1GT0C 2HDDA 3NAUA 4LOCA 5K7HA 1B72B 1MBFA 3VPRA 2CUFA 2L7MP 3SFIA 3IV5A 2LK2A 1ETWA 1FEXA 4M3EA 4X6AJ 2WB1N 3HBLA 1ZR2A 2CJJA 4A69C 3GTGJ 2LP0A 2MGQA 4DYQA 3HOUJ 2R5YB 1HDDC 2NS8A 5M5YJ 3L1PA 2NS7A 3GTJJ 4BXXJ 2CUEA 5C4JJ 1B8IB 3RZDJ 1HCRA 1G2HA 4AC0A 3BR2A 1WCMJ 1WH7A 3MVPA 3PO3J 1GVDA 1X2NA 4HNVA 3ZQLA 3QPLA 5IPAA 1JKOC 2NVTJ 2NVYJ 4A3CJ 2OPTA 2JA7J 2E2IJ 3QPSA 1TC3C 3ZQFA 4UUTA 4W1UA 4FE4A 3TW6A 5EYRA 5F0CA 2B63J 1BJZA 2FX0A 2Y9ZA 1U8BA 4Y52J 4D5CA 2R5ZB 1OCPA 5F0FA 3BG3A 2WV1A 4S0HB 1ZKGA 3OOUA 3O8HA 3HOXJ 4A3FJ 4BKXA 3A01B 3CDLA 1QVTA 2GM4A 3HOYJ 3PO2J 2LY9A 1A6IA 2HXOA 5GPCA 3JRAA 3HGGA 2E19A 2Y31A 2R5YA 5EGOB 2X48A 2ZB9A 3TP0A 5E3MA 2XSDC 2DN0A 3S16J 3WHBA 2L7ZA 2AHQA 4JP0A 3HM5A 1ZR4A 5C3EJ 1MBEA 1XC5A 3B6AA 1WH5A 3WHCA 1IUFA 3W6VA 2DMTA 4IHWA 3FIWA 2CRGA 4UUSB 5EZGA 1CQTA 1U9NA 2ME0A 4QIWN 5IP9J 5FKOA 2XB5A 3TEDA 1FTTA 3LSJA 3BG9A 5GP9A 5EDNA 4MO7A 1ZK8A 1W0TA 2ID3A 1E3OC 1MBJA 4D5FA 1HF0A 3B6CA 3Q0VA 2H8RA 1JJ6C 1BA5A 3GTKJ 1T56A 3JRFA 1X2MA 1IGNA 2YS9A 1ETKA 5FLVA 3ZQIA 5FKLA 2IAIA 3IH4A 3JRHA 4RDUA 5FKKA 4A3IJ 3S1NJ 3A01A 1JUSA 5C44J 3A03A 2M0CA 2L7FP 5FJ8J 2IEKA 2EZLA 5IOYA 5IYDJ 3QQAA 1LFUP 5J1UA 4XRSG 3SJMA 1MH3A 3G1OA 2KT0A 1QRYA 5EGOA 3BQZA 1S7EA 4DW6A 1FIAA 4A3BJ 2TRTA 3HB9A 3TW7A 2AO9A 5FKMA 4XRSA 3BTCA 1LE8A 2Y2ZA 1X58A 1OCTC 1JTXA 2G0EA 4C2MJ 4ABZA 4CYCB 1TWGJ 4UUSA 2LKXA 5K7ZA 2M9HA 3BT9A 3C2BA 2LFBA 3BTJA 1WPKA 3MKLA 4A3JJ 2W48A 1JUMA 3FK6A 3F0CA 1WGXA 2X6OA 4L5EA 5IP6A 1IJWC 2JK3A 2JA8J 2DMPA 4M3GA 2DMUA 4A3EJ 5F0HA 2ECCA 5EG0B 4V2GA 2E2JJ 4BY1J 3HOVJ 1VFCA 1I50J 1RPWA 4D7NA 3HKZN 3DCFA 2Y0SN 2MW8A 3IH3A 4MIMA 4FE7A 4NDLA 1YRNB 3G1MA 2X9DA 2DA1A 2K40A 3S17J 4B4CA 4J19A 1F43A 4JYKA 2XPWA 4A3GJ 1QPIA 4QSHA 1JTYA 1AHDP 1JJ8C 1H8AC 1HLVA 1B72A 1P7JA 3FKIJ 3OSFA 3GTPJ 3GTLJ 1GDTA 1JT6A 1VF9A 1ETXA 2Y30A 4XICA 2O7OA 1H89C 5J1YA 1Y1WJ 3BR6A 2HI3A 1ETVA 5DTDA 2LD5A 3S14J 4W97A 5DS9A 1IG7A 5C4XJ 4CYCA 2R92J 1ZTRA 5J1RA 2VI6A 1PUFB 3GTMJ 2TCTA 1D5YA 4FISA 3LSRA 3CMYA 1BL0A 1MBGA 2M34A 4AYBN 1B8IA 1UMQA 2EZIA 1FJLA 3FISA 2CQQA 3BR3A 4FTHA 1XS9A 2RAEA 1POGA 4B1RA 3I4NJ 2K9QA 2JWTA 3S15J 3LOCA 5EG0A 2QF7A 1JGGA 3M3YJ 4M6VA 1DU6A 2GLOA 2M2EA 3OIOA 2XPUA 4DYRA 2E1OA 1ETOA 5EZHA 3JREA 1W0UA 1BW5A 3Q0UA 2O9LA 2ELKA 3ZQHA 2HOSA 3RZOJ 1O4XA 5F27A 1ZGWA 2EH3A 2R5ZA 5M5XJ 2E2HJ 4MFEA 3GBGA 3G1LA 2EZKA 1JUPA 4I6ZA 5F1JA 1T33A 1OJLA 2DTZA 2ID6A 3JRIA 5JLXA 3GTQJ 2DMNA 3FK7A 5E3OA 3H3VK 4IHXA 5HODA 2CU7A 4IHVA 2LLKA 1P7IA 1JKRC 1A5JA 2HOTA 2D5VA 4Y7NJ 1MSFC 3UKGA 1VNDA 2EQRA 3Q3SA 5F04A 1Z0XA 3K2AA 3SDGA 2R7ZJ 1RKWA 2P81A 1RKTA 2EZHA 2VKVA 3HGYA 2DA7A 4A3DJ 1NK3P 1ETYA 2NOGA 2DA4A 1BW6A 4IHYA 3S2HJ 1SANA 1XG1A 3K7AJ 1MBHA 3BG5A 1VI0A 4DYCA 4M3DA 2JN6A 1TWHJ 1K83J 2O8KA 2OF7A 2K9SA 1EF4A 2IBDA 3BTIA 4BY7J 4JX5A 2N8GA 1ORKA 2MG4A 1GUUA 4A3KJ 4A93J 2XB0X 1GV2A 2FJ1A 2HXIA 2I10A 5GPAA 1H88C 1NK2P 2VKEA 1MH4A 2LVSA 1Z77A 1I6HJ 1APLC 4C3JJ 3MN2A 2FD5A 3BQYA 3E7LA 1MBKA 1Q1VA 3HDDA 2Y9YA 1MSEC 2VUMJ 2YUSA 2PMZN 4JX6A 2GBYA 5IP7J 1RR7A 2LTPA 1JKQC 3O8GA 5IOZA 1TWFJ 2JJ7A 3BR1A 4D7MA 1IC8A 4XIDA 2MSYA 4XRMA 5M5WJ 2HOAA 2LR8A 3HOZJ 2XGEA 3D1NI 1WI3A 1JKPC 1SFOJ 4AUXA 3HOWJ 5K7FA 3S1QJ 4X1EA 5J3LA 1IV6A 4C3HJ 1DU0A 1IDZA 5BNGA 5M3MJ 2L9RA 4FCYA 2XPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ANT A;  2DA2 A;  2YU9 J;  1LFB A;  2JA6 J;  1FTZ A;  4G12 A;  4M3B A;  1AKH B;  1U78 A;  4B3A A;  5E3N A;  4MFD A;  2WAQ N;  2JMW A;  1UG2 A;  3CQZ J;  1AU7 A;  2ECB A;  4BBR J;  2DJN A;  4M3F A;  1RES A;  3CCY A;  2R93 J;  5JLW A;  2XGC A;  3S1R J;  4BBS J;  3BR5 A;  3ZQG A;  3A02 A;  2FQ4 A;  2JA5 J;  1F36 A;  1ZQ3 P;  3HEF A;  2XRL A;  3BR0 A;  3H0G J;  3M4O J;  3JRG A;  2M8G X;  1TWA J;  2XGD A;  3RQI A;  3NAR A;  3LNQ A;  1K61 A;  1HDP A;  2QCO A;  2DMQ A;  3BTL A;  1YRN A;  1LE8 B;  1I3Q J;  1NTC A;  4I76 A;  3JRB A;  3PM1 A;  4DZP A;  2KDZ A;  1ETQ A;  3JR9 A;  4A3M J;  1TWC J;  3JRD A;  3Q0W A;  3I4M J;  1U9O A;  1OFC X;  5F08 A;  4C3I J;  1R9T J;  2NVX J;  4IEJ A;  4XK4 A;  2HQ5 A;  4MLO A;  5EEA A;  4GFB A;  3LSP A;  3S2D J;  1FIP A;  3JRC A;  4V2F A;  5IYC J;  3ZOB A;  3OSG A;  3LSG A;  2COB A;  2DA5 A;  4EEF G;  2ME6 A;  4DZJ A;  1RET A;  2H1K A;  2NVQ J;  1Y1V J;  5E3L A;  5IYB J;  1ENH A;  2DA6 A;  3GTO J;  1PUF A;  4A3L J;  2HYJ A;  3RKQ A;  1AKH A;  3DEW A;  1QVU A;  1UHS A;  3IH2 A;  2EBI A;  4RBO A;  3ZQC A;  1IDY A;  1GV5 A;  4JX4 A;  5FKN A;  2DA3 A;  5FLM J;  4QTR A;  1IRZ A;  2L0K A;  2R0Q C;  3TP3 A;  5M3F J;  5EF6 A;  1JT0 A;  3S1M J;  1HOM A;  1ITY A;  1MNM C;  2K9N A;  2CQX A;  2VPR A;  1GT0 C;  2HDD A;  3NAU A;  4LOC A;  5K7H A;  1B72 B;  1MBF A;  3VPR A;  2CUF A;  2L7M P;  3SFI A;  3IV5 A;  2LK2 A;  1ETW A;  1FEX A;  4M3E A;  4X6A J;  2WB1 N;  3HBL A;  1ZR2 A;  2CJJ A;  4A69 C;  3GTG J;  2LP0 A;  2MGQ A;  4DYQ A;  3HOU J;  2R5Y B;  1HDD C;  2NS8 A;  5M5Y J;  3L1P A;  2NS7 A;  3GTJ J;  4BXX J;  2CUE A;  5C4J J;  1B8I B;  3RZD J;  1HCR A;  1G2H A;  4AC0 A;  3BR2 A;  1WCM J;  1WH7 A;  3MVP A;  3PO3 J;  1GVD A;  1X2N A;  4HNV A;  3ZQL A;  3QPL A;  5IPA A;  1JKO C;  2NVT J;  2NVY J;  4A3C J;  2OPT A;  2JA7 J;  2E2I J;  3QPS A;  1TC3 C;  3ZQF A;  4UUT A;  4W1U A;  4FE4 A;  3TW6 A;  5EYR A;  5F0C A;  2B63 J;  1BJZ A;  2FX0 A;  2Y9Z A;  1U8B A;  4Y52 J;  4D5C A;  2R5Z B;  1OCP A;  5F0F A;  3BG3 A;  2WV1 A;  4S0H B;  1ZKG A;  3OOU A;  3O8H A;  3HOX J;  4A3F J;  4BKX A;  3A01 B;  3CDL A;  1QVT A;  2GM4 A;  3HOY J;  3PO2 J;  2LY9 A;  1A6I A;  2HXO A;  5GPC A;  3JRA A;  3HGG A;  2E19 A;  2Y31 A;  2R5Y A;  5EGO B;  2X48 A;  2ZB9 A;  3TP0 A;  5E3M A;  2XSD C;  2DN0 A;  3S16 J;  3WHB A;  2L7Z A;  2AHQ A;  4JP0 A;  3HM5 A;  1ZR4 A;  5C3E J;  1MBE A;  1XC5 A;  3B6A A;  1WH5 A;  3WHC A;  1IUF A;  3W6V A;  2DMT A;  4IHW A;  3FIW A;  2CRG A;  4UUS B;  5EZG A;  1CQT A;  1U9N A;  2ME0 A;  4QIW N;  5IP9 J;  5FKO A;  2XB5 A;  3TED A;  1FTT A;  3LSJ A;  3BG9 A;  5GP9 A;  5EDN A;  4MO7 A;  1ZK8 A;  1W0T A;  2ID3 A;  1E3O C;  1MBJ A;  4D5F A;  1HF0 A;  3B6C A;  3Q0V A;  2H8R A;  1JJ6 C;  1BA5 A;  3GTK J;  1T56 A;  3JRF A;  1X2M A;  1IGN A;  2YS9 A;  1ETK A;  5FLV A;  3ZQI A;  5FKL A;  2IAI A;  3IH4 A;  3JRH A;  4RDU A;  5FKK A;  4A3I J;  3S1N J;  3A01 A;  1JUS A;  5C44 J;  3A03 A;  2M0C A;  2L7F P;  5FJ8 J;  2IEK A;  2EZL A;  5IOY A;  5IYD J;  3QQA A;  1LFU P;  5J1U A;  4XRS G;  3SJM A;  1MH3 A;  3G1O A;  2KT0 A;  1QRY A;  5EGO A;  3BQZ A;  1S7E A;  4DW6 A;  1FIA A;  4A3B J;  2TRT A;  3HB9 A;  3TW7 A;  2AO9 A;  5FKM A;  4XRS A;  3BTC A;  1LE8 A;  2Y2Z A;  1X58 A;  1OCT C;  1JTX A;  2G0E A;  4C2M J;  4ABZ A;  4CYC B;  1TWG J;  4UUS A;  2LKX A;  5K7Z A;  2M9H A;  3BT9 A;  3C2B A;  2LFB A;  3BTJ A;  1WPK A;  3MKL A;  4A3J J;  2W48 A;  1JUM A;  3FK6 A;  3F0C A;  1WGX A;  2X6O A;  4L5E A;  5IP6 A;  1IJW C;  2JK3 A;  2JA8 J;  2DMP A;  4M3G A;  2DMU A;  4A3E J;  5F0H A;  2ECC A;  5EG0 B;  4V2G A;  2E2J J;  4BY1 J;  3HOV J;  1VFC A;  1I50 J;  1RPW A;  4D7N A;  3HKZ N;  3DCF A;  2Y0S N;  2MW8 A;  3IH3 A;  4MIM A;  4FE7 A;  4NDL A;  1YRN B;  3G1M A;  2X9D A;  2DA1 A;  2K40 A;  3S17 J;  4B4C A;  4J19 A;  1F43 A;  4JYK A;  2XPW A;  4A3G J;  1QPI A;  4QSH A;  1JTY A;  1AHD P;  1JJ8 C;  1H8A C;  1HLV A;  1B72 A;  1P7J A;  3FKI J;  3OSF A;  3GTP J;  3GTL J;  1GDT A;  1JT6 A;  1VF9 A;  1ETX A;  2Y30 A;  4XIC A;  2O7O A;  1H89 C;  5J1Y A;  1Y1W J;  3BR6 A;  2HI3 A;  1ETV A;  5DTD A;  2LD5 A;  3S14 J;  4W97 A;  5DS9 A;  1IG7 A;  5C4X J;  4CYC A;  2R92 J;  1ZTR A;  5J1R A;  2VI6 A;  1PUF B;  3GTM J;  2TCT A;  1D5Y A;  4FIS A;  3LSR A;  3CMY A;  1BL0 A;  1MBG A;  2M34 A;  4AYB N;  1B8I A;  1UMQ A;  2EZI A;  1FJL A;  3FIS A;  2CQQ A;  3BR3 A;  4FTH A;  1XS9 A;  2RAE A;  1POG A;  4B1R A;  3I4N J;  2K9Q A;  2JWT A;  3S15 J;  3LOC A;  5EG0 A;  2QF7 A;  1JGG A;  3M3Y J;  4M6V A;  1DU6 A;  2GLO A;  2M2E A;  3OIO A;  2XPU A;  4DYR A;  2E1O A;  1ETO A;  5EZH A;  3JRE A;  1W0U A;  1BW5 A;  3Q0U A;  2O9L A;  2ELK A;  3ZQH A;  2HOS A;  3RZO J;  1O4X A;  5F27 A;  1ZGW A;  2EH3 A;  2R5Z A;  5M5X J;  2E2H J;  4MFE A;  3GBG A;  3G1L A;  2EZK A;  1JUP A;  4I6Z A;  5F1J A;  1T33 A;  1OJL A;  2DTZ A;  2ID6 A;  3JRI A;  5JLX A;  3GTQ J;  2DMN A;  3FK7 A;  5E3O A;  3H3V K;  4IHX A;  5HOD A;  2CU7 A;  4IHV A;  2LLK A;  1P7I A;  1JKR C;  1A5J A;  2HOT A;  2D5V A;  4Y7N J;  1MSF C;  3UKG A;  1VND A;  2EQR A;  3Q3S A;  5F04 A;  1Z0X A;  3K2A A;  3SDG A;  2R7Z J;  1RKW A;  2P81 A;  1RKT A;  2EZH A;  2VKV A;  3HGY A;  2DA7 A;  4A3D J;  1NK3 P;  1ETY A;  2NOG A;  2DA4 A;  1BW6 A;  4IHY A;  3S2H J;  1SAN A;  1XG1 A;  3K7A J;  1MBH A;  3BG5 A;  1VI0 A;  4DYC A;  4M3D A;  2JN6 A;  1TWH J;  1K83 J;  2O8K A;  2OF7 A;  2K9S A;  1EF4 A;  2IBD A;  3BTI A;  4BY7 J;  4JX5 A;  2N8G A;  1ORK A;  2MG4 A;  1GUU A;  4A3K J;  4A93 J;  2XB0 X;  1GV2 A;  2FJ1 A;  2HXI A;  2I10 A;  5GPA A;  1H88 C;  1NK2 P;  2VKE A;  1MH4 A;  2LVS A;  1Z77 A;  1I6H J;  1APL C;  4C3J J;  3MN2 A;  2FD5 A;  3BQY A;  3E7L A;  1MBK A;  1Q1V A;  3HDD A;  2Y9Y A;  1MSE C;  2VUM J;  2YUS A;  2PMZ N;  4JX6 A;  2GBY A;  5IP7 J;  1RR7 A;  2LTP A;  1JKQ C;  3O8G A;  5IOZ A;  1TWF J;  2JJ7 A;  3BR1 A;  4D7M A;  1IC8 A;  4XID A;  2MSY A;  4XRM A;  5M5W J;  2HOA A;  2LR8 A;  3HOZ J;  2XGE A;  3D1N I;  1WI3 A;  1JKP C;  1SFO J;  4AUX A;  3HOW J;  5K7F A;  3S1Q J;  4X1E A;  5J3L A;  1IV6 A;  4C3H J;  1DU0 A;  1IDZ A;  5BNG A;  5M3M J;  2L9R A;  4FCY A;  2XPV A; 
#chains in the Genus database with same CATH topology
 2MBF A;  2DA2 A;  2EFN A;  4M74 A;  1FTZ A;  1Y39 A;  2DQR A;  5KVR A;  4FQG A;  2JMW A;  2ECB A;  3G4S I;  3RJP A;  3KZY A;  2XRN A;  2HPI A;  3CCY A;  4P5O A;  4G94 A;  3LFK A;  5FB2 A;  3TDZ C;  2QYO A;  3JTH A;  5JHF A;  5GAD J;  2FQ4 A;  4XKW A;  3Q9V A;  3J7A Y;  2DOE A;  3HEF A;  2LMD A;  4Q4Z F;  2Q0O A;  3FX3 A;  5ERI A;  1TWA J;  5GTH C;  5JVG F;  3ZN1 A;  1K79 A;  1YX5 A;  1SFK A;  5LLQ A;  1OPC A;  2V7F A;  1YO5 C;  4HSR A;  2I5U A;  5DV5 A;  2QLZ A;  3FXL A;  3PFI A;  3U2R A;  4E7I A;  3BTL A;  3REO A;  2F5C A;  3TMO A;  4FAS D;  2Z99 A;  3BLY A;  1LVA A;  2BXY A;  2EIJ H;  1LE8 B;  5TIS C;  2OCE A;  2KIQ A;  3P9C A;  1NTC A;  2XAS A;  4I76 A;  4LIT A;  4XL9 A;  3JRB A;  3PM1 A;  4RM2 A;  5FRM A;  1K6O A;  2VC0 A;  3C2G A;  2KDZ A;  4G8X A;  4WF2 A;  4HPQ A;  2XAJ A;  1U9O A;  5CVJ A;  4HG2 A;  4B09 A;  2NVX J;  1FIP A;  3IP4 B;  3WTS C;  5IYC J;  4R8H A;  3J81 K;  4ENJ A;  1EH6 A;  2DA5 A;  1B9N A;  4L0Z B;  1XN7 A;  2IP2 A;  4Z6Y A;  2Z5U A;  1WKM A;  2UV1 A;  4DZJ A;  2NVQ J;  3V7C A;  5IYB J;  1T2K A;  3GFL A;  3E3V A;  5DM7 F;  4M73 A;  2LYC A;  3WTW C;  1QVU A;  1UHS A;  5HLT A;  3PJR A;  1UZC A;  2HU9 A;  1GV5 A;  3HUG B;  4JX4 A;  4CH7 A;  4BQA A;  5KAI C;  3H1C A;  5FLM J;  3AL0 C;  2WAD A;  3GZ5 A;  2R0Q C;  5M3F J;  2VB6 A;  5EF6 A;  1JT0 A;  1X3W B;  1R5G A;  3AKZ A;  5E8I A;  3MKY B;  3HRM A;  3COA C;  1ITY A;  2GA1 A;  1MNM C;  1DPU A;  3F8M A;  1ULY A;  2VQL A;  1FSH A;  2HKX A;  3OMY A;  1X1C A;  1GT0 C;  2HDD A;  3NAU A;  3GCM A;  4XQF A;  1VTN C;  3M8J A;  5E1X A;  3DPU A;  2L7M P;  4AIH A;  4M6X A;  5HDK A;  3BZC A;  1IO2 A;  1ETW A;  3ABU A;  3K1N A;  2Q1Z B;  1KQ0 A;  2HDC A;  4NHJ A;  3SZP A;  4H4K C;  1H9G A;  3JTG A;  3OS0 A;  1V5G A;  3LQQ A;  3FBI B;  3SEZ A;  3ZRG A;  2LP0 A;  5CYV A;  1W5T A;  3F22 A;  1XDU A;  2MGQ A;  2O3F A;  5LHI A;  5FRO A;  1HDD C;  2NS8 A;  1LVK A;  3C3W A;  2EFQ A;  4EJO A;  3CF2 A;  3OIQ A;  3BC8 A;  4OMY A;  2H94 A;  3BG6 A;  1X3U A;  1ZH5 A;  1WCM J;  3PO3 J;  3QPL A;  5ILS A;  2P5K A;  4ZYE A;  4IZZ A;  3ZQ7 A;  2B9S A;  4MQ9 F;  4N4N B;  2OA4 A;  2D45 A;  1KYW A;  2OPT A;  3MQ0 A;  4NNJ A;  4ZH4 F;  3AG3 H;  2OBP A;  2Z9O A;  3OV8 A;  4GRI A;  3QYB A;  2FEZ A;  3F9K A;  4A6E A;  5TJJ A;  1TC3 C;  2PJR B;  3AL0 B;  2VJJ A;  3TW6 A;  2STW A;  3K70 C;  1BJA A;  4KDP A;  1VQ5 I;  3NRV A;  2B63 J;  2FNA A;  3EPZ A;  1U8B A;  2HTS A;  4R1H A;  2R5Z B;  1X4O A;  3FF5 A;  3L2R A;  3MZY A;  1ZKG A;  3OOU A;  1JXS A;  4A3F J;  1XB4 A;  5H2F C;  4BKX A;  3LA2 A;  1LEA A;  5HLG A;  1KZH A;  4NB5 A;  5GPC A;  4EM0 B;  2Z3Y A;  5IY5 H;  5CKT A;  2LNB A;  2JT1 A;  2R5Y A;  2XSD C;  5E3M A;  4Z2Y A;  4E7K A;  2FRH A;  3S16 J;  1Z6R A;  3BZ6 A;  4LG3 A;  1J9I A;  4BE2 A;  2BVM A;  1XC5 A;  2V26 A;  1OCZ H;  4A0Z A;  1IUF A;  2F5V A;  3W6V A;  4HV6 A;  3FIW A;  1O3Q A;  3P9I A;  5L3G A;  3M1E A;  1CQT A;  2MYS A;  3P5J A;  3T0Y A;  1S29 A;  4QIW N;  1TQI A;  5KNL A;  4KIS A;  2O03 A;  2M7B A;  4UXN A;  4XKB A;  4HRI A;  5EDN A;  2VJ5 A;  3RI4 A;  1UG0 A;  1MBJ A;  5BS6 A;  1HF0 A;  1KU7 A;  2LKS A;  3IHU A;  2H8R A;  1U8R A;  2GXB A;  3TOA A;  1IN6 A;  3MZ8 A;  1BC8 C;  3GTK J;  2MA3 A;  1BA5 A;  3JRF A;  1X2M A;  2YS9 A;  3OR2 C;  5FLV A;  5E17 F;  3ZQI A;  4JK1 X;  3S32 A;  3JRH A;  4RDU A;  2V9P A;  3VYS B;  4Y15 A;  3DTI A;  4UB6 C;  2JSC A;  1R23 A;  4I98 B;  2F48 A;  3CZ6 A;  3DPL C;  4CYD A;  2PMU A;  2P8T A;  5E20 A;  5C44 J;  2K27 A;  3A03 A;  3CJT B;  2L7F P;  2K3F A;  2MC3 A;  3K70 D;  3K4C A;  1YHQ I;  2EZL A;  1XGO A;  1LFU P;  2JA2 A;  2DAO A;  1SFU A;  4BQO A;  4C30 A;  1MH3 A;  2NNN A;  1QRY A;  3LSH A;  4BUP A;  4A6D A;  2E36 A;  1S7E A;  3K4M A;  3OYL A;  1BC7 C;  4XRS A;  5GAE J;  4L5I A;  2VBX A;  1LE8 A;  4V19 K;  3KYD B;  2Y2Z A;  1YQA A;  1X58 A;  1OCT C;  3DKY A;  2G0E A;  1TW2 A;  1U5T C;  4CYC B;  1OR7 C;  1B9M A;  3L09 A;  2NXN B;  1ZGJ A;  4BHP A;  3GVA A;  2H09 A;  2BEO A;  2RDP A;  2VC1 A;  4HX8 A;  2IT0 A;  1QU3 A;  1WGX A;  2BY1 A;  5K5O A;  5IP6 A;  1IN8 A;  2LG4 A;  3M8F A;  2DMP A;  4LIU A;  4XON A;  5EG0 B;  2M4K A;  1H0M A;  1Z7U A;  2VJI A;  3K4K A;  2IGK A;  3VOE A;  4CZZ A;  1S7O A;  1H9T A;  2CQN A;  2VQC A;  1I50 J;  2A61 A;  4D7N A;  4S05 A;  3J80 K;  3DCF A;  2K9M A;  3HUG A;  1FX7 A;  2Y0S N;  4UHT A;  3IH3 A;  4AYB A;  4BHC A;  5CLS A;  1YRN B;  3G1M A;  4BAY A;  4KN4 X;  2K40 A;  4ON0 A;  2LH9 A;  3HZJ A;  4PJM A;  4B4C A;  3VWB A;  4J19 A;  3QOP A;  4JYK A;  5IT3 A;  1AHD P;  1JTY A;  2D1H A;  4MNU A;  3ZMV A;  2AXT C;  2W1O A;  3NWS A;  3GTP J;  3QP6 A;  2RNJ A;  1P4X A;  3VYT B;  4P9F A;  3R60 A;  3SYT A;  2XKO A;  4B43 A;  2KJB A;  2O7O A;  5H6R A;  3OYF A;  2DFE A;  4U7B A;  3ZMS A;  1LB2 A;  3CP2 A;  4QLC U;  2M8E A;  4LFU A;  3LMM A;  3LSK A;  5J1R A;  1KU3 A;  3GTM J;  2HKO A;  3HJE A;  3W2W A;  4FIS A;  3GEZ A;  5B5E C;  4L9T A;  5JHU A;  2VOP A;  3CMY A;  2M34 A;  3RPU A;  4Q47 A;  3I64 A;  2YSR A;  3MZH A;  2DDB A;  1D1B A;  2EZI A;  1FJL A;  1WZ2 A;  2CH0 A;  3QYE A;  2RV8 A;  3FIS A;  5DD4 A;  2CQQ A;  3NWT A;  1SVL A;  3EUK L;  1OKR A;  3I4N J;  2JWT A;  2ZXJ A;  1B1B A;  1X1B A;  2OCC H;  1KYZ A;  3OYI A;  2W24 A;  2FXA A;  5D4R A;  2KQR A;  4EQQ A;  5D5X B;  2M2E A;  2J5P A;  3OIO A;  3CTA A;  2YX4 A;  1S6L A;  4M71 A;  4G9Y A;  5EZH A;  3JRE A;  5ICF A;  2VBZ A;  2XC7 A;  2KKO A;  2O0Y A;  2IA1 A;  1V4R A;  2EV0 A;  2XF5 A;  2O9L A;  4IJA A;  1XCB A;  5F27 A;  2CO5 A;  4XRF A;  5L3C A;  3ZMD A;  2R7T A;  1SD7 A;  2R5Z A;  5HLH A;  3JAM K;  1W36 C;  1ZG5 A;  2IGN A;  2QEX I;  4KYW A;  2IJL A;  4MEX F;  4I6Z A;  5F1J A;  4ZC3 A;  2A6H F;  4FHT A;  2DTZ A;  2D1V A;  1P6R A;  5LRR A;  2ZCW A;  1K4S A;  2V6E A;  3GTQ J;  4D0P A;  1S9H A;  4IHX A;  5L3F A;  3PIP F;  1P7I A;  4Y13 A;  2GIV A;  2D5V A;  4C9Y A;  2VBY A;  1MSF C;  2EQR A;  4LLG F;  2HOE A;  1Z0X A;  1BR1 A;  2VQH A;  3CCJ I;  2P81 A;  2EZH A;  3HGY A;  3ZGK A;  1BIB A;  3V4G A;  1FMV A;  1ETY A;  1SD4 A;  1BW6 A;  5GAG J;  4IHY A;  5D4S A;  4IOC F;  3WOD F;  1W5S A;  1LJ9 A;  1VI0 A;  3E1S A;  1TWH J;  1ERD A;  1K83 J;  2GIZ A;  3MAJ A;  4B3X A;  4BJT A;  3HL2 A;  1D0Y A;  2IBD A;  3CCR I;  1UAA A;  2F5D A;  2L5Q A;  3FXM A;  5EJC A;  1HW1 A;  2R7X A;  4IHT A;  3LSM A;  3FDY A;  3RKW A;  3G3Z A;  2MG4 A;  3FHN A;  3S93 A;  4ZYG A;  2PLY A;  4A3K J;  1IN7 A;  3N05 A;  1GV2 A;  4PCQ A;  1H88 C;  4I09 A;  1NK2 P;  2FBH A;  2DDA A;  4DNC A;  2M3A A;  2IS4 A;  1I6H J;  2A6E F;  3SEQ A;  3MN2 A;  3ZPL A;  2FD5 A;  1MBK A;  3SZT A;  3PUB A;  1BR2 A;  2CQK A;  3CCU I;  3HDD A;  1BI0 A;  4XLH A;  5D5V B;  1KON A;  5KCM A;  1P2F A;  4IRG A;  4CCJ A;  2EK5 A;  2QM3 A;  1R36 A;  1OQY A;  4LK1 F;  1JKQ C;  5KK1 A;  2PN6 A;  4XLE A;  2CUJ A;  2JVH A;  5D8K B;  2K85 A;  2G7H A;  3K9T A;  3CCE I;  4IXA A;  1TNS A;  2HOA A;  2GXA A;  2JZY A;  4I02 A;  1W36 D;  3D1N I;  1A36 A;  2CUZ A;  1JKP C;  5K7F A;  2A5W A;  3GLL A;  1IDZ A;  3ISP A;  1DU0 A;  3VFZ A;  1K7A A;  4HQM A;  2L9R A;  2XPV A;  1UFM A;  3S3N A;  2QQA A;  4HA8 A;  1ZHF A;  2KRC A;  1U78 A;  4B3A A;  2VQG A;  1UG2 A;  1KQ9 A;  4BBR J;  4M3F A;  2W4S A;  2XGC A;  3ROU A;  4BBS J;  3N4M A;  3GZ6 A;  3ZQG A;  3A02 A;  1ZQ3 P;  2NOJ B;  1XD7 A;  5FRN A;  1MZB A;  2GQQ A;  1RZ4 A;  1R6R A;  3BR0 A;  3M4O J;  2M8G X;  1BR4 A;  1U6G A;  4B48 A;  1Y6I A;  1GLN A;  1OYI A;  4I0A A;  2Y0M A;  3NAR A;  1B6A A;  1QZE A;  1R00 A;  1XGN A;  1HDP A;  2QCO A;  2DMQ A;  3HC7 A;  4UUV A;  4XLN F;  1QNT A;  1YRN A;  4ZTF A;  5HNH A;  3AAF A;  3OYB A;  5HNF A;  4KN7 X;  3EUH A;  5H20 A;  5LGU A;  1KQ8 A;  2F2E A;  2Z2S B;  5FLX Z;  1XDS A;  1ETQ A;  4PGH A;  4A3M J;  3KPH A;  1IZ1 A;  2BY0 A;  2X6W A;  2XVC A;  1OFC X;  4C3I J;  1O7F A;  3ZQQ A;  4NBQ A;  4QWQ A;  5EEA A;  2HVQ A;  2QA4 I;  1UHM A;  2M30 A;  3OSG A;  5E18 F;  1WFX A;  1XCV A;  4NC8 A;  3KYC B;  2E1M C;  2FQ3 A;  2WB1 A;  2X6Y A;  3U1D A;  3V7S A;  4BDZ A;  2COB A;  3V8J A;  5LGN A;  3NEU A;  2P4W A;  2PFB A;  2F4I A;  1RET A;  1Y1V J;  3K1M A;  2WA0 A;  5E3L A;  3F8F A;  3W6K B;  3R6S A;  4UB8 C;  1UJ8 A;  2HYJ A;  2F5E A;  2XIG A;  3DEW A;  1MMS A;  3IH2 A;  2EBI A;  2JTV A;  4P96 A;  3H9G A;  5L3D A;  4BGD A;  4XOR A;  3L9F A;  2KPM A;  3H9J A;  1UHW A;  3FMS A;  1T0F A;  1IV8 A;  1MND A;  1HOM A;  3S3M A;  2CSO A;  3ABL H;  4CUG A;  3W2V A;  3WE2 A;  2ELH A;  4HBL A;  4LOC A;  1D8K A;  1ON1 A;  5GTI C;  1B72 B;  4PZJ A;  3LAJ A;  3SFI A;  3IV5 A;  4IHS A;  4KFC A;  4I2O A;  2DT7 B;  4E6K G;  3KZI C;  4X6A J;  2ZBK A;  1HKS A;  2VJ4 A;  3GX4 X;  1DUX C;  1ZR2 A;  4YG2 F;  2BVL A;  4JBA A;  3GFM A;  3OS2 A;  3IRQ A;  2R5Y B;  1MDM A;  5HS8 A;  4CIC A;  4CCL A;  2QUF A;  2CUE A;  5C4J J;  2MH9 A;  3RZD J;  1HCR A;  1G2H A;  2R7R A;  2DFI A;  2IGM A;  3I5U A;  3K2Z A;  1WH7 A;  4RGX A;  1GVD A;  1X2N A;  4BL0 B;  3ZQL A;  2PQ8 A;  1YI2 I;  4XN0 A;  3OYM A;  1LDK B;  2NVT J;  4A3C J;  3HHG A;  1J0R A;  4CCN A;  2E2I J;  4ZDL A;  3QPS A;  3CLO A;  3WTV C;  3IWZ A;  3TO7 A;  2DO7 A;  4FE4 A;  2RKH A;  1V3F A;  3DBR B;  5EYR A;  3C2H A;  2DW4 A;  3BWG A;  1BJZ A;  3E6D A;  5AON A;  3U21 A;  2HQA A;  1A04 A;  4D5C A;  5BOX A;  4H0E A;  2L9S A;  2MD0 A;  3HOT A;  1R1V A;  2EFO A;  3BG3 A;  4AWX B;  4G6T B;  2V4J C;  2WV0 A;  3K0L A;  3F72 A;  1USS A;  1IRG A;  2VKH A;  3H0D A;  2QGU A;  1NHA A;  1N77 A;  3PO2 J;  1Z67 A;  1Z21 A;  2BV6 A;  4O6J A;  2OD5 A;  4BJ5 C;  2ZJ2 A;  3GWZ A;  2CYY A;  4OIN F;  4Y4R A;  4MHG A;  1TQM A;  4Y33 A;  1STZ A;  3J7Y J;  3WHB A;  4N9H A;  3Q5F A;  2IPQ X;  4BE0 A;  1VQL I;  5C3E J;  1MBE A;  5D5U B;  1WH5 A;  1N75 A;  4QPO A;  5HVQ C;  4EGY A;  1GHC A;  4N0B A;  2HYG D;  4IHW A;  4JOM A;  2LBF A;  2P5L C;  2CRG A;  1Z05 A;  3C18 A;  4ITV A;  2ME0 A;  4E7H A;  1R5H A;  2GAU A;  2XB5 A;  2CFX A;  3PNY A;  2OZU A;  1T8I A;  3BG9 A;  3OR1 C;  1LEB A;  2ID3 A;  2EA2 A;  3A0B C;  4E7S A;  1D1A A;  2HVR A;  4D5F A;  3B6C A;  1QBJ A;  1OYW A;  4N4O B;  5K1Y A;  2HFH A;  3DTE A;  4F92 B;  5LRS A;  2FSW A;  4KUM A;  3E97 A;  3IH4 A;  2W00 A;  1YW9 A;  4U7D A;  4A3I J;  1R58 A;  2OJE D;  2RVC A;  5JVT A;  3KP2 A;  4I7H A;  3HHH A;  3QOD A;  3A01 A;  2QKL B;  4HNT A;  1S5L C;  1MJB A;  2M0C A;  2ZME A;  3H35 A;  3ASN H;  3GME A;  1FBU A;  4RAZ A;  5FJ8 J;  2IS6 A;  3PNV A;  5IOY A;  5IYD J;  3KIO A;  3QQA A;  5DCM A;  1Z7L A;  3HIF A;  2L2O A;  3SJM A;  1AWC A;  5ICC A;  3I71 A;  2LSO A;  1KU2 A;  4HEA 2;  4DW6 A;  4E7J A;  4A3B J;  1J59 A;  3OIP A;  3HB9 A;  3E6C C;  3W3C A;  2E5N A;  2XAG A;  2K4B A;  4HW0 A;  1YIO A;  1F5T A;  2FOW A;  2ZNY A;  4ABZ A;  1TWG J;  4RMN A;  3IAM 2;  5DUK A;  5KHD A;  2CWE A;  4PJ0 C;  1BI1 A;  4IO9 F;  3BCB A;  2OZ6 A;  3M1C A;  2LKX A;  1G3Y A;  2XAU A;  3DLL F;  5JR3 A;  3MKL A;  4A3J J;  2CW7 A;  3FWE A;  3G71 I;  4MGR A;  4FET A;  2Z1D A;  4CDG A;  1HA8 A;  2FA5 A;  2JPB A;  2LY1 A;  2X6O A;  2JK3 A;  4PK4 A;  3FXJ A;  4YIR X;  1DP3 A;  2QQ8 A;  2DMU A;  4PGG A;  1ZN2 A;  3ZR8 X;  1MMA A;  2MD5 A;  4JQF A;  3HOV J;  5J40 A;  1J7K A;  1VFC A;  2IGO A;  2XAH A;  5HDN A;  4ZTJ A;  2A68 F;  3M8E A;  4MIM A;  3WTU C;  2B7E A;  4NDL A;  4BQQ A;  3D0S A;  3QWL A;  1T98 A;  4KIF A;  1Z1D A;  3H5N A;  3S17 J;  2YR2 A;  4O5V A;  4ESF A;  4GDF A;  4FX0 A;  4XOT A;  1QPI A;  2Y48 A;  1FZP B;  1FLI A;  1WJE A;  4QPQ A;  1WI9 A;  1HLV A;  1QZY A;  1P7J A;  2GZW A;  4LG0 A;  2DU9 A;  1B72 A;  1ZLJ A;  3OSF A;  2CV2 A;  2W57 A;  3QPH A;  4LB6 B;  1GDT A;  3GTL J;  1JT6 A;  2Y75 A;  3FXU A;  1VF9 A;  2HWV A;  1BM9 A;  1WJ5 A;  3DFG A;  1ETX A;  2Y30 A;  4BH9 A;  1A35 A;  3J7A O;  2DCE A;  1H89 C;  2WAF A;  4GCV A;  5K5Q A;  2BBY A;  3BR6 A;  3KFW X;  3CCV I;  1I27 A;  3RQ4 A;  2IVM A;  2ZSI B;  3EET A;  3QU3 A;  5DS9 A;  4AM3 A;  1ZTR A;  2TCT A;  3R4K A;  2FUG 2;  4CA0 A;  1XMA A;  4BYY A;  4XKV A;  4XLC A;  1YW7 A;  3CP8 A;  4AYB N;  3VYR B;  4BXF A;  1BBY A;  4YRV A;  3CME I;  1LDJ A;  4IX7 A;  2K5C A;  4FTH A;  4RB1 A;  2KP6 A;  4IRH A;  4IQJ A;  1POG A;  4C2U A;  2E7X A;  4Y3O A;  2E7W A;  3CDI A;  1SFX A;  1Y56 A;  5FFX A;  4AVZ A;  2GLO A;  4BEH B;  1QQI A;  1L3L A;  1Y8Q B;  1YS7 A;  2XPU A;  4DYR A;  2LY2 A;  2JPC A;  4KT6 A;  1YTY A;  2OU2 A;  1Y0N A;  2KZV A;  2X4H A;  3ZQH A;  3FKJ A;  1EKE A;  2P6T A;  3ECH A;  4NQW B;  2EH3 A;  1DGR M;  3A0H C;  2Z16 A;  5B3S H;  3QP5 A;  4MQV A;  5IT9 Z;  2WWY A;  5M5X J;  2IRF G;  1BOA A;  2DPD A;  2V1N A;  1L0O C;  3GBG A;  2O8X A;  1SAU A;  1OJL A;  2ID6 A;  3TOB A;  2MLG A;  3KCC A;  3DKW A;  2ADU A;  3EUH C;  1HC8 A;  2M4G A;  2G9W A;  2OQG A;  5JLX A;  2H6B A;  1Z3X A;  2DMN A;  3H3V K;  1JKR C;  1KU9 A;  1A5J A;  2H6C A;  4EJV A;  1OLT A;  2K86 A;  4OIQ F;  3D5S C;  2X1E A;  1ZRE A;  2HOT A;  1X1A A;  1S7A A;  2K3P A;  3Q3S A;  4G6Q A;  3SDG A;  4HDU A;  1P9Q C;  3F23 A;  4A3D J;  4U88 A;  3WU1 B;  1NK3 P;  5J4Y A;  2NOG A;  1R5I D;  1T95 A;  1G3S A;  1B4A A;  2XV4 S;  4OIP F;  1HQC A;  3BG5 A;  2BGC A;  1AA7 A;  2XRO A;  2ZJR F;  3KET A;  2QSG X;  2VKD A;  3CC2 I;  4ASN A;  2DFF A;  1T38 A;  4UVB A;  2M1B A;  2O8K A;  2K9S A;  4EJW A;  3CC4 I;  1EF4 A;  2XAF A;  5CQE A;  1HKT A;  1T0F C;  5FLX K;  1MD0 A;  1P92 A;  2QSF X;  4JX5 A;  3FXK A;  1RI7 A;  2UZK A;  3T8T A;  3BJO A;  3WTT C;  2ESH A;  3DBL B;  2FJ1 A;  5GPA A;  1YW8 A;  2K9L A;  2VKE A;  3HYI A;  4DBQ A;  2OUM A;  2WAQ A;  1PUE E;  2ZFU A;  2K4J A;  2QEN A;  3K4B A;  2FOK A;  1MNE A;  2QVO A;  1JHF A;  3E7L A;  2HYF A;  2AQF A;  4ZJZ A;  3F3X A;  2ZFW A;  2LF7 A;  1CF7 A;  4J00 A;  3WTZ A;  1RR7 A;  2LTP A;  4CGZ A;  1EJ9 A;  3KZZ A;  2HZT A;  5IOZ A;  1TWF J;  3BR1 A;  4AID A;  1J5Y A;  1IC8 A;  5DYM A;  2VOD A;  4XID A;  2BE5 F;  3IUO A;  2MLK A;  4HF1 A;  3OYE A;  1EV7 A;  3A1Y A;  1OMI A;  1OYY A;  5M5W J;  2J5O A;  2P5V A;  4RLF A;  1K4T A;  5L3E A;  4OWR B;  3OWT A;  4AU7 A;  1W7P A;  3S1Q J;  2E1N A;  2BY2 A;  2Q8K A;  3WGH A;  4G7Z F;  5J3L A;  1IV6 A;  4C3H J;  4O3M A;  1FC3 A;  1IRZ A;  2NRA C;  4EGZ A;  1MMG A;  2EWN A;  3WTX C;  1LFB A;  2QQ9 A;  5D6E A;  3DEE A;  4G12 A;  3L2Q A;  4WXC A;  3OS1 A;  4FX4 A;  2UXN A;  3H3U A;  5DDG A;  4MFD A;  3PSI A;  3CQZ J;  4XSX F;  4U0W A;  3Q9S A;  1N78 A;  2DJN A;  1RNL A;  1RES A;  2CQ7 A;  2DT5 A;  2R93 J;  5JLW A;  3S1R J;  3FM3 A;  1QHH D;  1MIJ A;  3B73 A;  1XTA A;  1F36 A;  1R22 A;  3RPQ A;  2XRL A;  3H0G J;  3HRU A;  4DJA A;  5E1W A;  5JFR A;  3MKZ A;  2OAZ A;  3B02 A;  1EA3 A;  3ONQ A;  1TL8 A;  3OL4 A;  3OYC A;  4MTD A;  5FO5 A;  3VB2 A;  3TGN A;  2RQQ A;  2YU3 A;  3FXO A;  3DU6 A;  3LNQ A;  3T8R A;  3TBI A;  3F6O A;  4UVC A;  1P4W A;  5CQG A;  3N97 A;  2DJI A;  5K5R A;  2EA4 A;  3CC7 I;  1TW3 A;  2HGC A;  4IVN A;  4EJU A;  2IS2 A;  5HLI A;  5CVU A;  4XM3 A;  4DZP A;  3JR9 A;  1TWC J;  3JRD A;  4A2U A;  1U3E M;  1MDM B;  1DGW Y;  1R9T J;  1ZYR F;  4L18 B;  2KHM A;  4IEJ A;  4XK4 A;  4MLO A;  4GFB A;  1I1S A;  3D5L A;  1NG6 A;  3JRC A;  3ZOB A;  3LSG A;  3LL7 A;  2VBW A;  2VN2 A;  1XMX A;  4EEF G;  2YX7 A;  3K4L A;  4BS9 A;  3H92 A;  3W6J B;  3KYL A;  2UUZ A;  1TTY A;  4A5N A;  4A3L J;  1AKH A;  3H5R A;  1RR8 C;  2AS5 F;  5LEJ A;  3ZQC A;  1IDY A;  4HX4 A;  5HS7 A;  1A31 A;  1HKQ A;  5BPI A;  1OIS A;  2QBY B;  3I59 B;  4NC6 A;  3TP3 A;  5FD5 A;  5CVR A;  3S1M J;  3PUF A;  5FD6 A;  1Q1H A;  5ICE A;  4GYG A;  1FYL A;  4RAY A;  2K9N A;  2CQX A;  2F4O B;  1ONV A;  3CUQ A;  5B66 C;  2VPR A;  4YEJ A;  4M9X A;  4BEH A;  4AVP A;  3DU5 A;  4E70 A;  3KP5 A;  3VPR A;  3L2W A;  4YFK F;  2VON A;  3CCS I;  1HW5 A;  4M3E A;  2WB1 N;  2ZME C;  3T1B A;  1O57 A;  3BP8 A;  4NQW A;  5B1B H;  2CJJ A;  4A69 C;  1WSU A;  3WG9 A;  2RRE A;  3ERM A;  4DGW B;  2ESN A;  3GTG J;  1WJF A;  2E71 A;  4RB3 C;  1LUJ B;  3K4J A;  2FML A;  3L1P A;  2NS7 A;  3GTJ J;  4P55 A;  2KLO A;  3HRS A;  4BXX J;  1VQ4 I;  4EV0 A;  3ZMT A;  2PBI A;  1KA8 A;  4AC0 A;  1Y8R B;  3PNT A;  3AG2 H;  5BMZ A;  3BR2 A;  4CZC A;  1SAX A;  3MFK A;  4L9J A;  2EB7 A;  2GWR A;  4HNV A;  2LBF B;  4DQ2 A;  1R49 A;  2BW3 A;  2C6Y A;  2L02 A;  2P7C B;  3GO5 A;  3KP3 A;  1ACI A;  3TDU C;  5F1R A;  3DEU A;  4NC7 A;  2JA7 J;  3R0J A;  2RQP A;  1S72 I;  1K78 A;  2A69 F;  3ZQF A;  4M6Y A;  2R7Q A;  5F0C A;  3HTU A;  5E79 C;  1TQP A;  2DOF A;  3PIO F;  3EYI A;  2Y9Z A;  2R7V A;  4Y52 J;  1OCP A;  4J01 A;  3FMQ A;  4P9U A;  2G7U A;  2WV1 A;  3CO7 C;  1NH3 A;  4S0H B;  3HOX J;  3O8H A;  4X0G A;  2XSJ C;  3A01 B;  3CDL A;  2DYR H;  1QVT A;  3HOY J;  3H36 A;  2ZME B;  1A6I A;  2HXO A;  4OAZ A;  3H5A A;  2XF7 A;  3R0A A;  3HGG A;  2M0M A;  5CPR B;  5DCM B;  1RUO A;  3I58 A;  2GA2 A;  2X48 A;  2ZB9 A;  4ZYA A;  1P4A A;  3TP0 A;  4XLP F;  4WK8 F;  2DN0 A;  3GZN B;  3K10 A;  3GW2 A;  4RGR A;  2CGP A;  4FT8 A;  2M7A A;  5HDG A;  3SFZ A;  4HF2 A;  3G73 A;  2F4M B;  1ZR4 A;  4BE1 A;  4GYI A;  3IWF A;  4II3 A;  1IF1 A;  3WHC A;  1XGS A;  3V42 A;  4F55 A;  4OOI A;  1WRJ A;  3DXJ F;  3CD6 I;  1IW7 F;  4YII A;  3CUO A;  3WG7 H;  2E1C A;  5EZG A;  2AXL A;  5E1Z B;  4MTE A;  1W1W E;  2BYV E;  3TED A;  4A12 A;  1XPX A;  4I99 C;  2ETH A;  3L7W A;  4E7L A;  4D1Q A;  5GP9 A;  4MO7 A;  3I56 I;  4LK0 F;  4XNF A;  5AIP A;  1E3O C;  4A5M A;  2FMY A;  2WBM A;  3Q0V A;  2ICW G;  1JJ6 C;  2MC4 A;  4OAY A;  5KAF C;  1T56 A;  4ANJ A;  5FKL A;  2IAI A;  4B8X A;  1EH7 A;  3GLX A;  1REP C;  3OOP A;  3DWL E;  2UXX A;  2CV0 A;  2F5F A;  5EEG A;  1S3J A;  1RC9 A;  3HSE A;  1LQ1 A;  1TBX A;  2NYX A;  3O3K A;  2ACJ A;  2X85 A;  4I01 A;  4ZZD A;  1PP7 U;  2XKP A;  4XRS G;  3G1O A;  2KT0 A;  4PSX A;  4CXF A;  4LG0 B;  3HKZ A;  5EGO A;  3BQZ A;  3DF8 A;  1XSV A;  1FIA A;  1Z91 A;  4F91 B;  2WY8 Q;  5BPD A;  3TW7 A;  2AO9 A;  5FKM A;  1R1U A;  4ENK A;  2CW8 A;  2DOD A;  1SFE A;  3IL2 A;  3CJQ B;  3OYH A;  2PJP A;  4LLL A;  4HX7 A;  1FYM A;  3IKT A;  2P7V B;  4C2M J;  1FBQ A;  1FWZ A;  2M45 A;  4OU0 A;  4UUS A;  4KNY A;  3GXO A;  1D0Z A;  2KDO A;  5K7Z A;  2M9H A;  2W84 A;  4UNO A;  1E17 A;  4RGU A;  3C2B A;  3CCQ I;  2OC6 A;  4BQN A;  4BDY A;  1VQM I;  2W48 A;  3KP7 A;  3FK6 A;  3KEY A;  3F0C A;  2EIL H;  5DCF A;  5IT9 K;  2MAB A;  2LF8 A;  4RA2 A;  4A3E J;  5F0H A;  3QAH A;  2ECC A;  1IRX A;  4V2G A;  1SC7 A;  3MKW B;  2JRT A;  2IS1 A;  3CES A;  3DLA A;  1OCR H;  1RPW A;  3I54 A;  3F8C A;  3WU0 A;  4A0X A;  2IA0 A;  4ESJ A;  3MEX A;  3RSN A;  2Z33 A;  2O6G E;  2QBY A;  1VQ6 I;  4UY8 I;  1LNW A;  2X9D A;  1JE8 A;  2DA1 A;  3I59 A;  2R7F A;  2XGX A;  3A4C A;  1TZL A;  2EPF A;  2WY7 Q;  2JUC A;  1WQ2 A;  1F43 A;  4WCG A;  3KLN A;  2Q2E A;  1D5V A;  4QSH A;  1GXQ A;  2GOX B;  3SZG A;  3K1P A;  1JJ8 C;  2WTE A;  2CMP A;  3WGG A;  4CCO A;  1H8A C;  2STT A;  1D1C A;  3ABM H;  3K69 A;  2EV5 A;  2BY3 A;  4U87 A;  1FOW A;  2W7N A;  1SMY F;  4BNC A;  1PYV A;  4XIC A;  1Y1W J;  1ZAO A;  1X1D A;  2LD5 A;  4EMS A;  4W97 A;  2LKP A;  1IG7 A;  2CW0 F;  1YJ9 I;  3ABT A;  2HQR A;  2MFZ A;  1PUF B;  4L9V A;  4UVA A;  2LDU A;  3V8L A;  1YX3 A;  3LSR A;  3UNG C;  1LFP A;  5DEQ A;  1MBG A;  3K6G A;  3EQL F;  1LPQ A;  1UMQ A;  4HST A;  1QO0 D;  3M7G A;  1PVE A;  5J8C A;  5A2Q Z;  1LDD A;  3BR3 A;  3S8P A;  3PQJ A;  1XS9 A;  3TKY A;  3AFH A;  3SXY A;  1E0E A;  1ZRD A;  3S15 J;  2QF7 A;  4WXH A;  2ZXI A;  3M3Y J;  3FZV A;  4RGS A;  4KIT B;  1TLH B;  1DDN A;  1ZRC A;  1YLF A;  3F6V A;  3OYA A;  1QHG A;  2E1O A;  3A2K A;  4ZDO A;  1ETO A;  2L01 A;  3BCA A;  3E5Q A;  1W0U A;  1GXP A;  1BW5 A;  4ZYH A;  2NNY A;  3VSL A;  3CLQ A;  2ELK A;  2HOS A;  3RZO J;  1O4X A;  2VPL A;  4WWC A;  3M9A A;  4LB5 A;  2CV1 A;  4WX9 A;  1K6Y A;  2R7S A;  2EIK H;  2E2H J;  4MFE A;  3RYP A;  3T5X A;  5DM6 F;  3CO6 C;  2KRF A;  4XLF A;  3G1L A;  4P1W A;  3MCZ A;  2JVG A;  2LRE A;  1T33 A;  4XOP A;  1SD5 A;  3MWM A;  3JRI A;  5D6F A;  1J75 A;  3JW4 A;  1CF7 B;  2FE3 A;  2A07 F;  5E3O A;  5J6X A;  5HOD A;  2M5W A;  3FXR A;  1WHU A;  2CU7 A;  3SQN A;  4F3Q A;  2L7K A;  2LLK A;  4IHV A;  3I0T A;  1G3T A;  4HLX A;  4Y7N J;  2L4M A;  2VAS A;  3HPH A;  2DT6 A;  1S8N A;  5F04 A;  3TO6 A;  3K2A A;  4EJT A;  2R7Z J;  5L3B A;  4GO1 A;  1W7P B;  1G6N A;  1RKT A;  2PMZ A;  2RGV A;  2VKV A;  2VT2 A;  1MJ9 A;  2LOO A;  4K2E A;  2FF4 A;  2DA4 A;  5LHH A;  3W2A A;  1QA6 A;  4CHU A;  1SD6 A;  1XG1 A;  1MBH A;  2ISY A;  4DYC A;  1ZAR A;  4M3D A;  4EVI A;  4R79 A;  2KIF A;  4LJZ F;  4AIK A;  2VT3 A;  3FBN B;  4OIR F;  3ERE D;  4G7O F;  1W7P D;  1N25 A;  4BY7 J;  2A3S A;  1O7L A;  2N8G A;  3S2W A;  4GXO A;  5F64 A;  5ILU A;  3DKX A;  3CUQ C;  3WTY C;  4N9I A;  4EAT A;  2XB0 X;  2HXI A;  2I10 A;  3OYD A;  2LVS A;  4HLY A;  3RPU D;  1OCC H;  4DIQ A;  1IXS B;  1IXR C;  2EJR A;  4C3J J;  3ZP5 A;  2HR3 A;  1SEU A;  1MJA A;  3V8K A;  4RM3 A;  3HTS B;  1UST A;  2DBB A;  2Y9Y A;  2VUM J;  2HEO A;  5D8L B;  3DP7 A;  2GBY A;  4JX6 A;  2JRM A;  5IP7 J;  3I55 I;  2QWW A;  1TNT A;  3O8G A;  1I1G A;  2JJ7 A;  1YOV B;  1JI8 A;  4LD5 A;  2NVU B;  1T39 A;  1IN4 A;  2R3S A;  2DXI A;  4XRM A;  5D5W B;  2WAE A;  5TGT A;  3C7J A;  4YEL A;  1FOK A;  1T6S A;  3BDD A;  4E7Z A;  3FMR A;  4KIC A;  4U0Y A;  1YIJ I;  5F6F A;  1A6Q A;  1SFO J;  3G6E I;  4ETS A;  5CVV A;  3PFY A;  4M72 A;  4YFN F;  1YIT I;  5HOO A;  1PJR A;  1VQ9 I;  2V6C A;  1FSE A;  9ANT A;  2YU9 J;  2JA6 J;  3H3Z A;  4XSZ F;  3WE3 A;  1TP4 A;  3LA7 A;  4M3B A;  1AKH B;  1QGP A;  3U9G A;  5E3N A;  2L4A A;  2PX9 A;  2V1D A;  2WAQ N;  1F1Z A;  3UR3 C;  2F6C A;  1AU7 A;  2V1X A;  4BAC A;  3LWF A;  2GOM A;  4ENN A;  4I0B A;  3KP6 A;  2UWM A;  1Z3Y A;  2HZD A;  3BR5 A;  3GF2 A;  5LFA A;  3OY9 A;  2JA5 J;  3JRG A;  3P9K A;  1E2X A;  1RIO H;  3CUQ B;  2ZO4 A;  2R7U A;  1ZG3 A;  2XGD A;  3RQI A;  1SMT A;  1XX5 A;  2W25 A;  1K61 A;  3QPT A;  1I5Z A;  1VQN I;  2W85 A;  3BPV A;  4CO8 A;  3EDP A;  1I3A A;  2RN7 A;  1HSJ A;  1HST A;  3ESW B;  4HF0 A;  1BN5 A;  1I3Q J;  2X6X A;  1RUN A;  3FHZ A;  4UV8 A;  2KIU A;  2X1C A;  1I6X A;  4LGW A;  4ZYD A;  1FYK A;  1SVO A;  1IN5 A;  2R7D A;  4KT5 C;  2DK8 A;  2V9K A;  3Q0W A;  3I4M J;  5F08 A;  1DPR A;  1AOY A;  5ICG A;  2HQ5 A;  2O61 A;  2K02 A;  3LSP A;  3S2D J;  1IXC A;  1TT0 A;  4EM2 A;  1R7J A;  4V2F A;  4YIF A;  4WXD A;  5LD2 C;  3MD2 A;  5H6Q A;  4ENM A;  2ME6 A;  2X0L A;  4F93 B;  2XAQ A;  4RB2 C;  2H1K A;  1BI2 A;  1JGS A;  1V5E A;  2R4G A;  3DQV C;  1ENH A;  4PDK A;  2DA6 A;  2BW3 B;  4HNU A;  1PUF A;  3GTO J;  3RKQ A;  2COM A;  2ZC2 A;  3FM5 A;  1QZZ A;  4RBO A;  5FKN A;  3DPT A;  2Y69 H;  2DA3 A;  2E60 A;  2OQR A;  3HXL A;  4QTR A;  5BQT A;  3OYK A;  1K78 B;  2L0K A;  1PDN C;  3RKX A;  4HYE A;  2OTL I;  3HSR A;  1ODD A;  4YFX F;  1R71 A;  4PJJ A;  2HS5 A;  4RAF A;  2X51 A;  5K7H A;  1C0W A;  1MBF A;  4BXU A;  4HAM A;  2CUF A;  1ON2 A;  1V55 H;  3E6M A;  2LK2 A;  1FEX A;  1V5F A;  3E5U A;  3KP4 A;  1F9N A;  3KEQ A;  3HBL A;  1TT5 B;  3ECO A;  3C1D A;  2DTR A;  3QRF F;  3X2Q H;  3EYY A;  1G3W A;  1YFH A;  2EIM H;  3CMA I;  4DYQ A;  5LBQ A;  3HOU J;  4IL6 C;  4IOA F;  1O3R A;  5M5Y J;  2KIM A;  2ZNZ A;  4RB0 A;  3L2U A;  1MMD A;  1B8I B;  4ZDP A;  1X4P A;  1LKX A;  3OL3 A;  3BJ6 A;  2ZJQ F;  3LQR A;  4DOZ A;  2E5Z A;  2JUG A;  2IA2 A;  3IRR A;  3MVP A;  3BOQ A;  4L0Y B;  4ESB A;  5IPA A;  1IUY A;  3ZXS A;  3TQN A;  1JKO C;  1VQ8 I;  2R7W A;  1NG7 A;  1XSD A;  2QSH X;  3RDI A;  2HPM A;  2BHZ A;  2NVY J;  3ML6 A;  1UCR A;  1WWX A;  3F21 A;  3BJA A;  4NUB A;  3LA3 A;  4C2T A;  3D5R C;  4UUT A;  3HSF A;  4W1U A;  2KL4 A;  1MW7 A;  1XMK A;  2QKM B;  2H27 A;  2LRD A;  2IW5 A;  4U0V A;  3ZMU A;  3ELK A;  1R4M B;  2FX0 A;  3JCU C;  3J81 Z;  2P0W A;  5F0F A;  4XMY A;  3HOS A;  3BG7 A;  3E5X A;  4PJL A;  2BOL A;  3SDB A;  4LMY A;  4RS8 A;  4KA4 A;  3MMY B;  2DOA A;  5DD8 A;  2FNP A;  2GM4 A;  1FMW A;  2LY9 A;  3EUA A;  1QPM A;  3E6B A;  1X1P A;  3O6B B;  3ABK H;  3J7Z I;  1DP7 P;  4XKC A;  2EV6 A;  3JRA A;  1FT9 A;  2E19 A;  3I53 A;  1U5T B;  2Y31 A;  2VL8 A;  3KLO A;  5EGO B;  3E0J B;  3SHF A;  4HQE A;  1D0X A;  1VZ0 A;  3I4P A;  1BIA A;  2MH2 A;  2HVS A;  2HDW A;  3TO9 A;  2L7Z A;  2AHQ A;  4JP0 A;  4D9J A;  3HM5 A;  4CCK A;  2EFW A;  4XN3 A;  4CCM A;  3B6A A;  2RC4 A;  4XR6 A;  4E4H A;  2DMT A;  3G2B A;  3QYF A;  1J2X A;  2CG4 A;  1UEL B;  3IKV A;  3R61 A;  1YS6 A;  1G59 A;  4B47 A;  4BU2 A;  1JHH A;  4UUS B;  4EM1 A;  1U9N A;  3IAS 2;  3RKY A;  1U0J A;  3DBH B;  5FKO A;  5IP9 J;  3LSI A;  3LSJ A;  1FTT A;  2XHK A;  2ZXH A;  4IPA A;  4PUS A;  1BI3 A;  3S3O A;  1W0T A;  1WJC A;  1ZK8 A;  4A0Y A;  2PJR A;  2L9N A;  2HNH A;  2BHY A;  4F7Z A;  4KIB A;  4OMZ A;  2M87 A;  3HPG A;  4RLQ A;  4M9Z A;  4F52 A;  1HBX G;  1UB9 A;  1MGT A;  1MKM A;  1IGN A;  1YYV A;  1ETK A;  2DLL A;  1IAW A;  2RNG A;  5E8G A;  5FKK A;  3S1N J;  2JSP A;  4B44 A;  2XUB A;  4IRI A;  1JUS A;  5CVI A;  2V9V A;  1KGS A;  1ZRF A;  3ZCO A;  1Z6T A;  2IEK A;  3GFI A;  3WU2 C;  2Q2E B;  5J1U A;  4XBF A;  1G4D A;  3TL4 X;  5A2Q K;  4MEY F;  2W82 A;  1R4N B;  4HZF A;  3BRO A;  2L9V A;  2Y0S A;  3AG1 H;  2TRT A;  2EFP A;  3P7N A;  1Y0U A;  2DFH A;  3BTC A;  2PMH A;  5EEH A;  3F8B A;  1JTX A;  5AIQ A;  1WJB A;  6PAX A;  1FP1 D;  1W5C C;  4S04 A;  4G7H F;  1FBS A;  3BT9 A;  3CJN A;  2LFB A;  5TRD A;  3I3L A;  3BTJ A;  1WPK A;  4UV9 A;  3BZK A;  1JUM A;  3WGI A;  2R7O A;  2A05 A;  3ULQ B;  2I8D A;  2L3D A;  4L9N A;  4BJ6 C;  4L5E A;  1W4M A;  1IJW C;  3BY6 A;  2JA8 J;  1FOX A;  4L5J A;  1RRJ A;  4M3G A;  4IKF A;  1IRF A;  3L2C A;  3CCM I;  3VSK A;  2E2J J;  4BY1 J;  1E3P A;  2DK5 A;  2VIX A;  4HDV A;  2X1D A;  3IC7 A;  1HW2 A;  1FP2 A;  3HKZ N;  2XF6 A;  4IF4 A;  2QZ8 A;  1WJD A;  1BOB A;  1FY7 A;  3GFJ A;  2MW8 A;  1VQP I;  4KIG A;  4FE7 A;  2NAZ A;  2L54 A;  1D8J A;  5LHG A;  1X19 A;  2HQN A;  1Z9C A;  5FGM A;  2VLA A;  3ZN0 A;  2H1L A;  1ZLK A;  2VE9 A;  1YG2 A;  1G8X A;  4A3G J;  2XPW A;  2XDV A;  5JI6 A;  2BXZ A;  1OCO H;  3QOE A;  2D2W A;  2DYS H;  1FPQ A;  3H9Q A;  1DQU A;  3VYU B;  3FKI J;  4ZZL A;  3RYR A;  1YJW I;  1XGM A;  1ZEL A;  2VOO A;  1GVJ A;  2BZT A;  3L2V A;  3VOD A;  3OYG A;  1SVM A;  5J1Y A;  1WJA A;  2HI3 A;  1ETV A;  5DTD A;  3S14 J;  2ZKZ A;  5C4X J;  4CYC A;  2R92 J;  3V7R A;  3ASO H;  2ZJP F;  2VI6 A;  3L00 A;  4HOB A;  3VEP A;  4AD9 A;  2FU4 A;  1D5Y A;  1ZG1 A;  3OYJ A;  1B59 A;  1BL0 A;  4LIV A;  1B8I A;  2PI0 A;  2NS0 A;  1YE9 A;  2RAE A;  4B1R A;  1XSX A;  2K9Q A;  2HTJ A;  3LOC A;  5EG0 A;  4Y17 A;  3RTR A;  1U2W A;  2ZSH B;  3QU6 A;  1JGG A;  4M6V A;  1DU6 A;  1O3S A;  4HV5 A;  4IQ4 A;  4Q5S F;  1CGP A;  2DPU A;  2VXD A;  2A6T A;  2DI3 A;  2P6S A;  3Q0U A;  3DTK A;  5DUI A;  2WC2 A;  3M07 A;  2O5R A;  3PL8 A;  1M1E B;  4RAG A;  3LAP A;  1ZGW A;  3ZMZ A;  4M9S A;  1YJN I;  5ILV A;  2EZK A;  2VXZ A;  4PJN A;  1JUP A;  3GYH X;  4DBR A;  1F4K A;  1HXD A;  2OTJ I;  4KJZ A;  4KMU X;  4KMF A;  1ZGA A;  2VE8 A;  3J80 Z;  3FK7 A;  3GUD A;  2E34 A;  4OIO F;  3KX2 A;  3FXQ A;  1U5T A;  4CSW A;  2E35 A;  3UKG A;  1VND A;  2IXS A;  5FFZ A;  4XLA A;  1OR7 A;  2GXG A;  2V1U A;  1I39 A;  4PFP A;  1RKW A;  3NQO A;  2ELJ A;  3RCO A;  4BHB A;  2QQB A;  4II2 A;  2DA7 A;  4GGG A;  5LEK A;  1V54 H;  4AIJ A;  2ISZ A;  2FBK A;  2V79 A;  3S2H J;  3LST A;  1SAN A;  3K7A J;  1T08 B;  2JN6 A;  1FOY A;  2KRH A;  2PG4 A;  3PQK A;  5GAH J;  1PP8 F;  4LLN A;  2OF7 A;  5HS9 A;  3BTI A;  1O3T A;  3KEO A;  2KIS A;  5ED4 A;  2JQ7 A;  1EH8 A;  2KFD A;  3LFU A;  1ORK A;  2YPR A;  3AG4 H;  3BPX A;  1GUU A;  3DV8 A;  1E3H A;  3HG9 A;  4A93 J;  3I9V 2;  3U1K A;  5CJ9 A;  4G6D A;  2H8W A;  1MH4 A;  2DQL A;  2KMU A;  2OV7 A;  5J4V A;  3CCL I;  4TV7 A;  2KZG A;  1R1T A;  1Z77 A;  4PFO A;  1D3Y A;  1APL C;  3O2P E;  3BQY A;  2B0L A;  3HRT A;  1WVR A;  1Q1V A;  1MSE C;  2FBI A;  2YUS A;  2PMZ N;  3CDH A;  3VDX A;  5J8F A;  2AQE A;  5B1A H;  5LGT A;  3CF5 F;  1X3Z B;  2E1M B;  2A5Y B;  4D7M A;  5J47 A;  2CS3 A;  3RIR A;  1FNN A;  2MSY A;  2LC2 A;  4PSW A;  1VQK I;  2KJC A;  3OYN A;  2LR8 A;  2CFO A;  3K4N A;  1VQO I;  3JSP A;  3PSF A;  2XGE A;  3JSO A;  3HOZ J;  2TDX A;  1WI3 A;  3KE2 A;  2PEX A;  4AUX A;  3HOW J;  4Q48 A;  3F8N A;  4X1E A;  1VQ7 I;  2EIN H;  1MMN A;  3JAM Z;  1J09 A;  2K7L A;  2ZXW H;  3CJR B;  3CMM A;  5BNG A;  5M3M J;  4FCY A; 
#chains in the Genus database with same CATH homology
 9ANT A;  2DA2 A;  2YU9 J;  1LFB A;  2JA6 J;  1FTZ A;  4G12 A;  4M3B A;  1AKH B;  1U78 A;  4B3A A;  5E3N A;  4MFD A;  2WAQ N;  2JMW A;  1UG2 A;  3CQZ J;  1AU7 A;  2ECB A;  4BBR J;  2DJN A;  4M3F A;  1RES A;  3CCY A;  2R93 J;  5JLW A;  2XGC A;  3S1R J;  4BBS J;  3BR5 A;  3ZQG A;  3A02 A;  2FQ4 A;  2JA5 J;  1F36 A;  1ZQ3 P;  3HEF A;  2XRL A;  3BR0 A;  3H0G J;  3M4O J;  3JRG A;  2M8G X;  1TWA J;  2XGD A;  3RQI A;  3NAR A;  3LNQ A;  1K61 A;  1HDP A;  2QCO A;  2DMQ A;  3BTL A;  1YRN A;  1LE8 B;  1I3Q J;  1NTC A;  4I76 A;  3JRB A;  3PM1 A;  4DZP A;  2KDZ A;  1ETQ A;  3JR9 A;  4A3M J;  1TWC J;  3JRD A;  3Q0W A;  3I4M J;  1U9O A;  1OFC X;  5F08 A;  4C3I J;  1R9T J;  2NVX J;  4IEJ A;  4XK4 A;  2HQ5 A;  4MLO A;  5EEA A;  4GFB A;  3LSP A;  3S2D J;  1FIP A;  3JRC A;  4V2F A;  5IYC J;  3ZOB A;  3OSG A;  3LSG A;  2COB A;  2DA5 A;  4EEF G;  2ME6 A;  4DZJ A;  1RET A;  2H1K A;  2NVQ J;  1Y1V J;  5E3L A;  5IYB J;  1ENH A;  2DA6 A;  3GTO J;  1PUF A;  4A3L J;  2HYJ A;  3RKQ A;  1AKH A;  3DEW A;  1QVU A;  1UHS A;  3IH2 A;  2EBI A;  4RBO A;  3ZQC A;  1IDY A;  1GV5 A;  4JX4 A;  5FKN A;  2DA3 A;  5FLM J;  4QTR A;  1IRZ A;  2L0K A;  2R0Q C;  3TP3 A;  5M3F J;  5EF6 A;  1JT0 A;  3S1M J;  1HOM A;  1ITY A;  1MNM C;  2K9N A;  2CQX A;  2VPR A;  1GT0 C;  2HDD A;  3NAU A;  4LOC A;  5K7H A;  1B72 B;  1MBF A;  3VPR A;  2CUF A;  2L7M P;  3SFI A;  3IV5 A;  2LK2 A;  1ETW A;  1FEX A;  4M3E A;  4X6A J;  2WB1 N;  3HBL A;  1ZR2 A;  2CJJ A;  4A69 C;  3GTG J;  2LP0 A;  2MGQ A;  4DYQ A;  3HOU J;  2R5Y B;  1HDD C;  2NS8 A;  5M5Y J;  3L1P A;  2NS7 A;  3GTJ J;  4BXX J;  2CUE A;  5C4J J;  1B8I B;  3RZD J;  1HCR A;  1G2H A;  4AC0 A;  3BR2 A;  1WCM J;  1WH7 A;  3MVP A;  3PO3 J;  1GVD A;  1X2N A;  4HNV A;  3ZQL A;  3QPL A;  5IPA A;  1JKO C;  2NVT J;  2NVY J;  4A3C J;  2OPT A;  2JA7 J;  2E2I J;  3QPS A;  1TC3 C;  3ZQF A;  4UUT A;  4W1U A;  4FE4 A;  3TW6 A;  5EYR A;  5F0C A;  2B63 J;  1BJZ A;  2FX0 A;  2Y9Z A;  1U8B A;  4Y52 J;  4D5C A;  2R5Z B;  1OCP A;  5F0F A;  3BG3 A;  2WV1 A;  4S0H B;  1ZKG A;  3OOU A;  3O8H A;  3HOX J;  4A3F J;  4BKX A;  3A01 B;  3CDL A;  1QVT A;  2GM4 A;  3HOY J;  3PO2 J;  2LY9 A;  1A6I A;  2HXO A;  5GPC A;  3JRA A;  3HGG A;  2E19 A;  2Y31 A;  2R5Y A;  5EGO B;  2X48 A;  2ZB9 A;  3TP0 A;  5E3M A;  2XSD C;  2DN0 A;  3S16 J;  3WHB A;  2L7Z A;  2AHQ A;  4JP0 A;  3HM5 A;  1ZR4 A;  5C3E J;  1MBE A;  1XC5 A;  3B6A A;  1WH5 A;  3WHC A;  1IUF A;  3W6V A;  2DMT A;  4IHW A;  3FIW A;  2CRG A;  4UUS B;  5EZG A;  1CQT A;  1U9N A;  2ME0 A;  4QIW N;  5IP9 J;  5FKO A;  2XB5 A;  3TED A;  1FTT A;  3LSJ A;  3BG9 A;  5GP9 A;  5EDN A;  4MO7 A;  1ZK8 A;  1W0T A;  2ID3 A;  1E3O C;  1MBJ A;  4D5F A;  1HF0 A;  3B6C A;  3Q0V A;  2H8R A;  1JJ6 C;  1BA5 A;  3GTK J;  1T56 A;  3JRF A;  1X2M A;  1IGN A;  2YS9 A;  1ETK A;  5FLV A;  3ZQI A;  5FKL A;  2IAI A;  3IH4 A;  3JRH A;  4RDU A;  5FKK A;  4A3I J;  3S1N J;  3A01 A;  1JUS A;  5C44 J;  3A03 A;  2M0C A;  2L7F P;  5FJ8 J;  2IEK A;  2EZL A;  5IOY A;  5IYD J;  3QQA A;  1LFU P;  5J1U A;  4XRS G;  3SJM A;  1MH3 A;  3G1O A;  2KT0 A;  1QRY A;  5EGO A;  3BQZ A;  1S7E A;  4DW6 A;  1FIA A;  4A3B J;  2TRT A;  3HB9 A;  3TW7 A;  2AO9 A;  5FKM A;  4XRS A;  3BTC A;  1LE8 A;  2Y2Z A;  1X58 A;  1OCT C;  1JTX A;  2G0E A;  4C2M J;  4ABZ A;  4CYC B;  1TWG J;  4UUS A;  2LKX A;  5K7Z A;  2M9H A;  3BT9 A;  3C2B A;  2LFB A;  3BTJ A;  1WPK A;  3MKL A;  4A3J J;  2W48 A;  1JUM A;  3FK6 A;  3F0C A;  1WGX A;  2X6O A;  4L5E A;  5IP6 A;  1IJW C;  2JK3 A;  2JA8 J;  2DMP A;  4M3G A;  2DMU A;  4A3E J;  5F0H A;  2ECC A;  5EG0 B;  4V2G A;  2E2J J;  4BY1 J;  3HOV J;  1VFC A;  1I50 J;  1RPW A;  4D7N A;  3HKZ N;  3DCF A;  2Y0S N;  2MW8 A;  3IH3 A;  4MIM A;  4FE7 A;  4NDL A;  1YRN B;  3G1M A;  2X9D A;  2DA1 A;  2K40 A;  3S17 J;  4B4C A;  4J19 A;  1F43 A;  4JYK A;  2XPW A;  4A3G J;  1QPI A;  4QSH A;  1JTY A;  1AHD P;  1JJ8 C;  1H8A C;  1HLV A;  1B72 A;  1P7J A;  3FKI J;  3OSF A;  3GTP J;  3GTL J;  1GDT A;  1JT6 A;  1VF9 A;  1ETX A;  2Y30 A;  4XIC A;  2O7O A;  1H89 C;  5J1Y A;  1Y1W J;  3BR6 A;  2HI3 A;  1ETV A;  5DTD A;  2LD5 A;  3S14 J;  4W97 A;  5DS9 A;  1IG7 A;  5C4X J;  4CYC A;  2R92 J;  1ZTR A;  5J1R A;  2VI6 A;  1PUF B;  3GTM J;  2TCT A;  1D5Y A;  4FIS A;  3LSR A;  3CMY A;  1BL0 A;  1MBG A;  2M34 A;  4AYB N;  1B8I A;  1UMQ A;  2EZI A;  1FJL A;  3FIS A;  2CQQ A;  3BR3 A;  4FTH A;  1XS9 A;  2RAE A;  1POG A;  4B1R A;  3I4N J;  2K9Q A;  2JWT A;  3S15 J;  3LOC A;  5EG0 A;  2QF7 A;  1JGG A;  3M3Y J;  4M6V A;  1DU6 A;  2GLO A;  2M2E A;  3OIO A;  2XPU A;  4DYR A;  2E1O A;  1ETO A;  5EZH A;  3JRE A;  1W0U A;  1BW5 A;  3Q0U A;  2O9L A;  2ELK A;  3ZQH A;  2HOS A;  3RZO J;  1O4X A;  5F27 A;  1ZGW A;  2EH3 A;  2R5Z A;  5M5X J;  2E2H J;  4MFE A;  3GBG A;  3G1L A;  2EZK A;  1JUP A;  4I6Z A;  5F1J A;  1T33 A;  1OJL A;  2DTZ A;  2ID6 A;  3JRI A;  5JLX A;  3GTQ J;  2DMN A;  3FK7 A;  5E3O A;  3H3V K;  4IHX A;  5HOD A;  2CU7 A;  4IHV A;  2LLK A;  1P7I A;  1JKR C;  1A5J A;  2HOT A;  2D5V A;  4Y7N J;  1MSF C;  3UKG A;  1VND A;  2EQR A;  3Q3S A;  5F04 A;  1Z0X A;  3K2A A;  3SDG A;  2R7Z J;  1RKW A;  2P81 A;  1RKT A;  2EZH A;  2VKV A;  3HGY A;  2DA7 A;  4A3D J;  1NK3 P;  1ETY A;  2NOG A;  2DA4 A;  1BW6 A;  4IHY A;  3S2H J;  1SAN A;  1XG1 A;  3K7A J;  1MBH A;  3BG5 A;  1VI0 A;  4DYC A;  4M3D A;  2JN6 A;  1TWH J;  1K83 J;  2O8K A;  2OF7 A;  2K9S A;  1EF4 A;  2IBD A;  3BTI A;  4BY7 J;  4JX5 A;  2N8G A;  1ORK A;  2MG4 A;  1GUU A;  4A3K J;  4A93 J;  2XB0 X;  1GV2 A;  2FJ1 A;  2HXI A;  2I10 A;  5GPA A;  1H88 C;  1NK2 P;  2VKE A;  1MH4 A;  2LVS A;  1Z77 A;  1I6H J;  1APL C;  4C3J J;  3MN2 A;  2FD5 A;  3BQY A;  3E7L A;  1MBK A;  1Q1V A;  3HDD A;  2Y9Y A;  1MSE C;  2VUM J;  2YUS A;  2PMZ N;  4JX6 A;  2GBY A;  5IP7 J;  1RR7 A;  2LTP A;  1JKQ C;  3O8G A;  5IOZ A;  1TWF J;  2JJ7 A;  3BR1 A;  4D7M A;  1IC8 A;  4XID A;  2MSY A;  4XRM A;  5M5W J;  2HOA A;  2LR8 A;  3HOZ J;  2XGE A;  3D1N I;  1WI3 A;  1JKP C;  1SFO J;  4AUX A;  3HOW J;  5K7F A;  3S1Q J;  4X1E A;  5J3L A;  1IV6 A;  4C3H J;  1DU0 A;  1IDZ A;  5BNG A;  5M3M J;  2L9R A;  4FCY A;  2XPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...