1ETVA

The crystal structure of e. coli fis mutant g72a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
75
Chain Sequence
DVLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRANQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 75
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etvA00
2L7MP 1AKHA 1ZR4A 3BT9A 5C44J 5EG0B 3M3YJ 4BKXA 3BQYA 2JMWA 1LFBA 3JRGA 1K61A 1FEXA 1ETYA 5EEAA 1JJ6C 1YRNA 3LSGA 4MIMA 4JP0A 2MSYA 4A3JJ 4I76A 3ZQLA 3BG9A 1H89C 3DEWA 3GTJJ 1W0UA 1XC5A 2FJ1A 4D5FA 4EEFG 1F43A 2HXIA 1CQTA 2XRLA 2XB5A 2EZHA 5FLMJ 1NTCA 4BBRJ 2LP0A 2ECCA 4RDUA 1O4XA 2R5ZB 1ZGWA 2PMZN 2DMPA 3B6AA 2HOSA 2GM4A 1IDYA 1I50J 1VF9A 4FTHA 1WH7A 4X1EA 2L7FP 2W48A 3Q0VA 3HOXJ 2XPWA 3JRIA 5M5WJ 2OPTA 1Y1WJ 3A03A 5IP9J 1GDTA 1ETXA 4XRSG 2JA5J 3FISA 3RKQA 1PUFB 3JR9A 4A3FJ 3GTOJ 1U8BA 1UHSA 3ZOBA 2HDDA 3JRCA 3RQIA 4X6AJ 1LE8A 2FD5A 3L1PA 3ZQCA 5F08A 5IYBJ 3ZQGA 4DYQA 2M8GX 1A5JA 2R5YA 1MBEA 1MBHA 3OSFA 2DA1A 1HF0A 2ME0A 5C4XJ 2M34A 3FK6A 3HGYA 2DMQA 3VPRA 4AC0A 4QTRA 1OCTC 3F0CA 3QPLA 3GTQJ 2WB1N 4B3AA 2Y31A 3OOUA 3S17J 1RR7A 1VFCA 3ZQHA 1H88C 1JKOC 1IGNA 4JX6A 2LY9A 4IHVA 3SFIA 2AHQA 1JJ8C 3S14J 1FIPA 1IRZA 3A01A 2Y30A 1NK2P 1QVTA 3G1OA 1MBJA 1HOMA 2O8KA 2XPUA 5E3LA 4A3EJ 1IUFA 3GTKJ 1GUUA 2X6OA 4AYBN 3BTIA 5K7FA 2HXOA 3S1RJ 1SFOJ 1BA5A 5EGOA 1POGA 2LFBA 4IHWA 2K9QA 3B6CA 2Y9YA 5FLVA 4ABZA 1BW5A 3HB9A 4UUTA 4D5CA 3G1MA 4XRMA 3FK7A 3FIWA 3NARA 1Z77A 1RKTA 4I6ZA 2EQRA 3S1NJ 1QVUA 4MLOA 2DMNA 4UUSA 2XSDC 2M2EA 2JN6A 5K7ZA 1AHDP 1JUPA 1DU6A 3JRHA 2OF7A 1GV2A 5M3MJ 1JKRC 2TRTA 5IOZA 1D5YA 5EGOB 3HOVJ 1WGXA 2NS7A 3TW6A 2JA8J 2VKVA 2ELKA 1HCRA 1ETWA 2KDZA 3GTMJ 4V2FA 1HLVA 1RKWA 4B1RA 2HQ5A 2K9NA 4NDLA 4XIDA 1MH4A 1U9NA 2LTPA 3M4OJ 3HOYJ 3MKLA 5J1RA 4DZPA 2DTZA 3FKIJ 2XGCA 1HDDC 4J19A 1GVDA 3HEFA 4V2GA 1NK3P 2HOTA 2EH3A 4DYRA 1LFUP 2LKXA 2E19A 4A3MJ 1ZTRA 1VNDA 5K7HA 3JRBA 3JREA 5HODA 1A6IA 1WCMJ 2R92J 4DW6A 2LLKA 2HOAA 5EF6A 4A3KJ 2NVTJ 1MNMC 4FISA 3BG3A 3CCYA 1HDPA 5C3EJ 3WHBA 1AKHB 4M3FA 4A3DJ 4XK4A 5DTDA 2ECBA 1VI0A 4A3LJ 3H3VK 3IH2A 2M9HA 5JLXA 4HNVA 4Y52J 3HM5A 1ZK8A 1T33A 1YRNB 2DA3A 2X48A 3TW7A 1DU0A 2ID6A 4BY1J 2B63J 3QPSA 4BXXJ 1BJZA 2YUSA 1P7IA 3BR2A 1Q1VA 4MO7A 1UMQA 3HDDA 1U78A 3K7AJ 4Y7NJ 2LK2A 1MBKA 3BR1A 3H0GJ 1WI3A 2ID3A 3HOUJ 1P7JA 2CJJA 4LOCA 5GP9A 1FJLA 2P81A 3MN2A 5FKLA 1WH5A 1FIAA 3TP0A 1B72A 2CRGA 2XPVA 2R7ZJ 4D7MA 1RESA 1TWCJ 9ANTA 5BNGA 1ITYA 5IP6A 2MW8A 4DYCA 3BR0A 2JA6J 2O9LA 1FTZA 1IJWC 4XRSA 3OIOA 2DA7A 3E7LA 3BG5A 5IOYA 3Q0UA 2D5VA 5GPAA 3BR3A 5FJ8J 1X2NA 1LE8B 3RZDJ 1G2HA 2L9RA 1IDZA 5M5XJ 1BW6A 3BTLA 3HOWJ 3MVPA 2R5YB 3IV5A 2Y0SN 3W6VA 2GLOA 2EBIA 2DMUA 5J3LA 3JRAA 1B72B 1GV5A 3BTJA 2NVXJ 1B8IA 4CYCA 5M5YJ 1F36A 2MGQA 3LSPA 1ETOA 1JUMA 4M3EA 1Y1VJ 3C2BA 2VKEA 4JYKA 2COBA 2JWTA 3A01B 1IV6A 2XB0X 3TEDA 3BR6A 1UG2A 1JT0A 2K40A 2IAIA 4S0HB 4B4CA 4C2MJ 2E1OA 1H8AC 2N8GA 5EG0A 1ETQA 5F27A 3CDLA 2O7OA 4AUXA 2NOGA 5IYCJ 2WAQN 4W1UA 1ETKA 2HI3A 3HGGA 2E2HJ 4BBSJ 4C3IJ 2XGDA 3LSJA 2LR8A 2CU7A 1OFCX 4FE4A 1E3OC 4IHXA 1JGGA 3PO2J 2DMTA 4QIWN 5EYRA 4A69C 4CYCB 5C4JJ 4IEJA 2R5ZA 2XGEA 1RPWA 1MBGA 4UUSB 2L0KA 2FX0A 2GBYA 2R93J 1I3QJ 1TWAJ 2CUEA 2VUMJ 3SDGA 1X58A 2JK3A 1ORKA 1TWGJ 4GFBA 5M3FJ 1PUFA 2H8RA 3S15J 2DJNA 2NVYJ 5EZHA 1R9TJ 1XS9A 1QPIA 3GTGJ 5IP7J 2H1KA 5IYDJ 4JX4A 1JT6A 3A02A 3BTCA 3PO3J 2QF7A 1APLC 3S1MJ 2LVSA 5FKNA 4M3GA 1TC3C 5JLWA 1EF4A 3OSGA 2VI6A 3UKGA 2K9SA 2MG4A 2KT0A 4QSHA 4D7NA 4L5EA 3IH4A 1TWFJ 3S2HJ 3BR5A 2EZKA 2X9DA 5IPAA 4MFDA 1T56A 3GTPJ 4W97A 4G12A 2Y9ZA 1WPKA 5FKKA 5EDNA 2R0QC 1JUSA 2HYJA 3I4NJ 1AU7A 1ENHA 5F0HA 3K2AA 5E3MA 3DCFA 5GPCA 5FKOA 3GTLJ 5EZGA 2CUFA 2DA5A 1FTTA 2I10A 1MH3A 5F1JA 1W0TA 2TCTA 2ZB9A 4FCYA 2DN0A 3JRDA 1U9OA 1QRYA 3HBLA 2LD5A 3S16J 2YS9A 3LNQA 3S1QJ 2CQXA 3ZQIA 1IG7A 1ZR2A 3ZQFA 4A3GJ 3CQZJ 4JX5A 1I6HJ 3HOZJ 3D1NI 3HKZN 2VPRA 4FE7A 4C3JJ 2EZIA 4A93J 2NS8A 2G0EA 4DZJA 2DA2A 4M3DA 2Y2ZA 1X2MA 3CMYA 1XG1A 3LSRA 1JTYA 2L7ZA 3S2DJ 1OCPA 1Z0XA 5E3OA 3SJMA 5F04A 3WHCA 4A3BJ 1MSEC 5J1UA 5DS9A 4A3CJ 3GBGA 3PM1A 1ZQ3P 5FKMA 3O8GA 1JTXA 5F0FA 3RZOJ 2DA4A 2FQ4A 1GT0C 3QQAA 4RBOA 3BQZA 1OJLA 1JKQC 3NAUA 3I4MJ 2M0CA 3IH3A 2NVQJ 2JJ7A 2YU9J 1TWHJ 2AO9A 1S7EA 3JRFA 1BL0A 3O8HA 2IEKA 1RETA 2WV1A 3Q0WA 2ME6A 4MFEA 1IC8A 2CQQA 4M6VA 4BY7J 2JA7J 1SANA 2RAEA 4M3BA 2E2JJ 3LOCA 2IBDA 4IHYA 2E2IJ 1MSFC 1JKPC 1B8IB 5F0CA 4C3HJ 4XICA 1ETVA 5J1YA 1K83J 1MBFA 2QCOA 5E3NA 3Q3SA 4A3IJ 1ZKGA 2EZLA 3G1LA 2DA6A 3TP3A
chains in the Genus database with same CATH superfamily
2L7MP 2IT0A 2XAHA 3ZP5A 4Y4RA 2JTVA 3ZMSA 4EV0A 2GOXB 4IRIA 1YG2A 3OR1C 4B09A 2JMWA 5H6RA 3JTGA 1T8IA 3LA2A 1ETYA 3VFZA 5EEAA 1JJ6C 2NRAC 3ZR8X 5D6FA 2W85A 3GFJA 3BG9A 1Y6IA 3CJQB 1UZCA 3DEWA 1H89C 3R4KA 4RAZA 2VXDA 2R7QA 1YITI 3W3CA 4YFNF 3MKWB 2OA4A 2HXIA 2XAFA 4IJAA 2FQ3A 2V4JC 3CF5F 1LVAA 2B0LA 2QKMB 2ZO4A 2EZHA 1NTCA 4GCVA 4HZFA 1O4XA 4RAGA 1ZGWA 1PDNC 2NVUB 5D5UB 2BXZA 2DMPA 3B6AA 4DBQA 2GM4A 4L9VA 1WH7A 2L7FP 1S5LC 2K27A 3MEXA 2WAFA 3QODA 2Z9OA 4LLGF 5FLXZ 5BPIA 2OPTA 1Y1WJ 3OYLA 1TLHB 3PQKA 5IP9J 4U7DA 4IRHA 2JA5J 4Q5SF 1A31A 3TMOA 1U8BA 1UHSA 2ISYA 2HNHA 1J59A 3JRCA 2ELJA 3BLYA 1QA6A 1SD6A 3GO5A 3N4MA 4PFOA 4UY8I 3I59A 4IVNA 2BBYA 4F55A 1ONVA 1JE8A 4BGDA 3UR3C 4DYQA 1ACIA 2DA1A 2ME0A 3BROA 3EQLF 4IRGA 4AC0A 3Q9VA 4B3AA 2B9SA 2Y31A 2BY1A 3OOUA 5CVUA 4EM2A 5HNHA 4RB1A 2OQGA 2LBFB 4B3XA 1H88C 3DPTA 1W5CC 1IGNA 4JX6A 4EVIA 4IQJA 3ASNH 2A5YB 2O6GE 1T95A 3CP2A 3SFIA 1JJ8C 3LAJA 2VT3A 2JSPA 2Z5UA 4HV6A 5J47A 1Y8RB 2O61A 2F5EA 1KU3A 4YEJA 4AU7A 3GFIA 1IUFA 2G7HA 3GTKJ 4FX4A 3S1RJ 3L2VA 1J09A 4ZH4F 3CUOA 2E1MB 3W2VA 5EGOA 2QGUA 1UFMA 1D1AA 2HKXA 1WKMA 1BBYA 3AL0B 4AVZA 3BJOA 4D5CA 3J7AO 2O0YA 1BOAA 3IC7A 1ZG1A 4M9XA 2M0MA 3NARA 3L2CA 3WODF 3S3NA 3F23A 1UAAA 3BPVA 2EQRA 3FM5A 4FHTA 3F8MA 1ZG3A 4HW0A 2ETHA 4LGWA 2DMNA 2UWMA 4AVPA 2A69F 3HUGA 4HLXA 2RKHA 5L3DA 1A36A 2CSOA 4ZJZA 5F6FA 1JUPA 3M8EA 4LIVA 3F6VA 1QHGA 1ZREA 4XONA 3HSFA 3OR2C 2A07F 4B48A 1U3EM 1JKRC 2V1NA 4I09A 3GMEA 3O3KA 4XL9A 2RN7A 1HCRA 2KDZA 4V2FA 4J00A 4B1RA 3M1EA 5HS7A 3ABLH 2HPMA 1G59A 1EH8A 3M4OJ 2X6WA 2FOWA 3MKLA 5HS9A 4DZPA 1HDDC 5CVIA 3ELKA 4BS9A 2DT6A 3RDIA 4BEHB 1Y39A 1LFUP 1T38A 3CMAI 1MMNA 2E19A 3S3MA 5GAEJ 4PJJA 2E36A 4HF1A 2F5CA 1SC7A 1XGOA 3JREA 2ADUA 5KAIC 1A6IA 3HC7A 4M73A 4EM1A 2NNYA 2LY1A 1XX5A 1Z7LA 5HS8A 1IO2A 2XV4S 2NVTJ 3SZTA 3BG3A 4R79A 4HRIA 3CCYA 4PGHA 3WHBA 1AKHB 3KP7A 4M3FA 4LIUA 2ECBA 3LA3A 5CLSA 1WJEA 4A3LJ 2HEOA 2M9HA 1VQOI 2XKPA 1QPMA 3U1KA 3O6BB 2PEXA 2DA3A 2R7TA 4ITVA 4BY1J 4G6DA 2LNBA 4BXXJ 5F64A 3F3XA 1IXRC 2YUSA 3L2RA 1P7IA 4B43A 4NQWA 5DUKA 1Q1VA 4MO7A 2CV2A 4BJ6C 1U78A 3K7AJ 5IT9Z 2OCEA 2LK2A 4CGZA 1G8XA 5E1XA 2HPIA 4NNJA 1ZYRF 3DLLF 1TP4A 2H1LA 1HKQA 2OD5A 1EH6A 1XCBA 1WH5A 3JTHA 1KYZA 1DDNA 3TP0A 2GZWA 4RB2C 3R0AA 2R7ZJ 4D7MA 1WHUA 5BNGA 3WTYC 4WXCA 2KHMA 2O9LA 1CF7B 3MQ0A 2E71A 2IXSA 2DPDA 3ECHA 3HHGA 2DA7A 3U21A 3BG5A 2KZVA 3G73A 3KLNA 3DPUA 5GPAA 1H9GA 5FJ8J 2L9RA 4HF0A 4HYEA 1FOKA 1HKSA 3FXQA 2P4WA 2VT2A 3HJEA 3IV5A 2DT5A 4LK1F 4GO1A 4RMNA 3KZIC 4CH7A 5L3CA 3K4LA 1D1CA 2RREA 4NC6A 3L2WA 3CP8A 2KMUA 3LSKA 3BPXA 3WG7H 2EINH 3U2RA 2V7FA 1J7KA 5DM7F 4CYCA 2KRFA 2LMDA 3J80K 1F36A 3FMQA 1G4DA 3LSPA 2A3SA 3ABMH 3CDHA 3OL4A 3S32A 4I98B 4JYKA 2COBA 2DK8A 1S9HA 1PP8F 3BR6A 1UG2A 4AIHA 2IAIA 2E1OA 2GAUA 2N8GA 1H8AC 3SQNA 2VB6A 5GTIC 1ETQA 1J0RA 3NWTA 3L2UA 1ETKA 5LHIA 4Y3OA 4I7HA 4MTEA 4Z2YA 3ONQA 4G7ZF 3DKXA 4BBSJ 3KEYA 3DF8A 1C0WA 1D1BA 5L3FA 4DJAA 3F72A 3H3ZA 5DUIA 4FE4A 4IHXA 1IN5A 3ABTA 3PFIA 5EYRA 2XUBA 4IEJA 2XGEA 1RPWA 4GRIA 4ASNA 4LB6B 2FX0A 1GLNA 2O8XA 2CQ7A 2R93J 1R7JA 3H9QA 1MDMA 3W6KB 3SDGA 2ZSHB 1P9QC 1X58A 2JSCA 1OPCA 1T2KA 4UNOA 3RPQA 5CPRB 3TDZC 5JVTA 4ZZDA 1DPRA 1ORKA 5K5OA 2DQLA 3A1YA 5FD5A 4GFBA 2FBKA 5ICFA 3OS1A 2H8RA 1ON2A 2EV5A 5D8KB 1XS9A 1TW3A 3H1CA 2M5WA 5DD4A 3WGGA 3PO3J 2JPBA 1BOBA 3BY6A 3V8KA 1APLC 2HQNA 2MH2A 4LK0F 3I5UA 5FKNA 4OIRF 1TC3C 1YW8A 5JLWA 2O3FA 3VEPA 1R5HA 4IOAF 2A68F 2GA1A 2XAUA 1ZELA 4QSHA 1X3UA 3S2HJ 3CCJI 2VE8A 1JXSA 2EZKA 3GXOA 5LHHA 3CCVI 1LPQA 4MFDA 4KFCA 2MLGA 1ULYA 4W97A 5BMZA 5FRMA 1KA8A 3OYFA 4EJWA 2CFXA 1JUSA 1HA8A 2CMPA 1P92A 2P7CB 2KIUA 3DCFA 5FKOA 5EZGA 4XLNF 2CUFA 2DA5A 1FTTA 2I10A 1MH3A 3EUKL 1OYYA 1YW9A 1MGTA 4IXAA 4XRFA 2DW4A 4FCYA 5E17F 1ODDA 3K70D 2JVHA 2EIMH 4OIPF 3HBLA 5L3GA 1OCRH 1UJ8A 2L9NA 3LNQA 2D1VA 1S3JA 3QU6A 3ZQIA 2IGOA 4EJVA 2K5CA 5B66C 3G4SI 2IS1A 1IG7A 1HC8A 4RS8A 2Q2EA 4M9SA 2L9VA 2JVGA 4XLCA 4CCMA 3IRRA 3D1NI 1HW2A 1I6HJ 4FE7A 1OQYA 3MFKA 2D1HA 2V6CA 2QWWA 2G0EA 2FF4A 1BR2A 2Z99A 2EIKH 3TOBA 4MNUA 3LSRA 3FBNB 1OCPA 4HQMA 3CJTB 2RC4A 3WHCA 2RVCA 1A35A 4A3CJ 2ESNA 3I4PA 1JHFA 1N75A 4IO9F 5FKMA 4CZCA 1SVMA 5J8CA 3C3WA 2DA4A 4NC7A 3QQAA 2HFHA 1QO0D 3G71I 1IXCA 5HVQC 1TNSA 1ZRCA 1OJLA 3OYJA 5KAFC 3MKZA 2LSOA 1FYLA 2YU9J 1TWHJ 3FMSA 2RQQA 1T0FC 1X1BA 2WV1A 4EGYA 1IC8A 4M6VA 4BY7J 2QA4I 2QKLB 2W4SA 1O7LA 5B5EC 1IN8A 3KP2A 4C3HJ 1F1ZA 1ETVA 1XGMA 3DKYA 1YJWI 1ZRDA 5FRNA 5E20A 3Q3SA 4A3IJ 1ZKGA 3ZMTA 3G1LA 2OTJI 4UV8A 4PGGA 1FP1D 2IA1A 3PUFA 2JUCA 3LA7A 3M3YJ 3GCMA 5HDNA 3BQYA 3RI4A 1FWZA 4AIKA 4NBQA 3LSGA 4RGXA 2MSYA 6PAXA 3JCUC 3V7CA 1PVEA 3ZQLA 2F4OB 3OYGA 5LEJA 1XC5A 4D5FA 1B4AA 1X3WB 4EEFG 4U7BA 2K3FA 1R1TA 2LF7A 1STZA 3M07A 5FLMJ 1E0EA 3EYYA 2M7AA 3D5RC 4RDUA 1JI8A 3RYPA 3EUHC 2O03A 3ZGKA 2DK5A 1W5TA 2PMZN 3SZGA 2HOSA 1WQ2A 4FASD 2JPCA 3E97A 2BY3A 2FOKA 4L18B 1VF9A 1WJ5A 4X1EA 3EUAA 4RGRA 1USSA 4Y33A 5HOOA 2W48A 3QOEA 1DGWY 4PJMA 4XKCA 3KZYA 2XPWA 1KQ0A 1SD7A 1V55H 1WJBA 3V4GA 3X2QH 4II3A 1K78A 2HWVA 2CGPA 5CVJA 1D0XA 2W25A 3FISA 3OWTA 2JZYA 3RKQA 3HRSA 3I0TA 1T39A 1J5YA 5FFXA 1XPXA 1FSHA 4KN7X 4BE1A 2ZFUA 2KL4A 1IRFA 2QENA 4XR6A 4X6AJ 2OV7A 3PJRA 2FD5A 2HVQA 1X1CA 3ZQCA 4YIIA 4WXDA 3G3ZA 1UCRA 1WJDA 1Z67A 5H6QA 3ZQGA 4DNCA 1HQCA 3QRFF 2VBYA 1MBHA 1HF0A 4RLQA 3FK6A 3VPRA 2DMQA 2QEXI 1OCTC 3QPLA 3JAMK 2VODA 3WU2C 2W7NA 5B1AH 3ZQHA 4EJTA 4LG0A 1LQ1A 3PL8A 4U0WA 3PNTA 1FLIA 2KIMA 2M1BA 2AHQA 3S14J 4E7LA 4P96A 3A01A 1IRZA 2Y30A 4I02A 1B9MA 3VSLA 3OYAA 1HOMA 2O8KA 2V9PA 3MAJA 3WG9A 4A3EJ 5BPDA 2JA2A 1WRJA 2LF8A 3MKYB 1N77A 2EILH 2X6OA 4AYBN 3I59B 3BTIA 3P5JA 2HXOA 5K7FA 2VQGA 1SFOJ 3RIRA 2HR3A 2CV0A 1X4PA 1POGA 4M72A 2FRHA 4BAYA 1RR8C 3B6CA 3CCQI 2DPUA 5DCMA 5FLVA 1S7AA 4LLNA 3HB9A 2L01A 3HTSB 3EUHA 2ZJ2A 3G1MA 1BR4A 4IX7A 2KISA 3DLAA 1YJNI 2X6YA 2PN6A 4ZYGA 2STTA 4KNYA 2GA2A 1R00A 1RKTA 3BCAA 5FGMA 3S1NJ 1G3TA 4PFPA 2NOJB 4MLOA 2XF5A 4UUSA 2PJRA 2XSDC 1T6SA 4OMZA 2JN6A 2GWRA 1DU6A 5L3BA 3SXYA 2ISZA 3KE2A 3R6SA 5ILSA 4KIGA 3KYCB 5BQTA 5M3MJ 1DGRM 1ZAOA 2PMZA 1P2FA 3P9CA 3KYLA 1V5EA 5EGOB 3R0JA 3EDPA 2FU4A 1WGXA 3TW6A 4B47A 5ILUA 3CCUI 2BOLA 3BWGA 2OAZA 1RKWA 3M8JA 5E1ZB 4KISA 4A12A 4UV9A 2X85A 2LKSA 4IKFA 1IRGA 1R36A 2XGCA 1GVDA 2R3SA 1I6XA 3K1PA 3QU3A 2EH3A 4FT8A 3P9KA 3W2AA 3K10A 1ZTRA 2LH9A 4A0ZA 5K7HA 2DFEA 3JRBA 5ICGA 3PQJA 3VYTB 5HODA 4M71A 1OYIA 5A2QK 1WCMJ 1W36C 2EFPA 3BG6A 2EA2A 3HSRA 3NWSA 1FY7A 2HOAA 1W7PB 5EF6A 5J40A 2G7UA 4BE0A 4A3KJ 3T8TA 4XNFA 1IW7F 2ZMEA 3BG7A 5DTDA 1U0JA 4N4OB 2QQ9A 3J81K 4JK1X 2WBMA 1IN4A 2M4KA 1VI0A 1SAUA 4HNVA 5JHFA 2H6BA 1TTYA 3HSEA 1YI2I 3SEZA 1KQ9A 2CH0A 2L4MA 1ZK8A 1T33A 1YRNB 4L0ZB 2BW3A 3FX3A 5LLQA 2B63J 2MYSA 3QP6A 1TBXA 4ZDOA 1I1GA 4H4KC 2L4AA 2VONA 3B73A 3P9IA 1WFXA 3PSIA 1S29A 2MC4A 4AYBA 2XDVA 1UMQA 3HDDA 4ZYAA 2ZJRF 4E7JA 4CHUA 3H0GJ 1WI3A 2DTRA 1P7JA 2CJJA 2FSWA 2HOEA 2HZTA 5GP9A 1W36D 1FJLA 3MN2A 2K4BA 2DO7A 3QYEA 5L3EA 3OS2A 1OCOH 2CRGA 1F9NA 2XPVA 1RESA 3M8FA 3BP8A 3F6OA 1PYVA 2JT1A 2VJIA 3N05A 3ESWB 2HS5A 1KZHA 2QM3A 3WTTC 4HX4A 1BI0A 3E6CC 1U5TB 1RUOA 2FNAA 1T08B 3OIOA 1BIAA 3FXRA 2IA2A 2Z33A 2F4MB 2CW8A 3AG1H 2DAOA 1LE8B 1VZ0A 1G2HA 3RZDJ 1LKXA 3VODA 4OINF 1I39A 4KJZA 3CESA 1BW6A 4RGSA 3HOWJ 4RLFA 4EGZA 2R5YB 4RB3C 3SHFA 2K9MA 3W6VA 2EBIA 1JHHA 2DMUA 3IWZA 1HSJA 2NNNA 5J3LA 4AD9A 3JRAA 2WTEA 3DFGA 4U88A 5FROA 1GV5A 2RNJA 3V42A 1DUXC 2L3DA 5JR3A 2BY0A 1B8IA 2CW7A 3M7GA 1ETOA 4LLLA 2HDCA 4ZYDA 4JQFA 2IS6A 1LVKA 3QP5A 4BXFA 4R8HA 3B02A 3ABKH 5KCMA 2CWEA 4B4CA 4C2MJ 1F5TA 2ZXWH 3MZ8A 4BDYA 4P9FA 1YIJI 1WZ2A 3CDLA 4RB0A 2O7OA 3JSOA 1EJ9A 4JBAA 4AUXA 2NOGA 5IYCJ 4HX8A 3H92A 4M6YA 4C3IJ 1REPC 4AIJA 2WWYA 1VQKI 1TL8A 2LR8A 5LD2C 2CU7A 2DBBA 3WTVC 4HNTA 2RQPA 1OFCX 2E1MC 3BCBA 1O3SA 1QBJA 4NC8A 3MZYA 2MC3A 4HDUA 3HRTA 4QIWN 1I27A 4A69C 4CYCB 5C4JJ 4BU2A 3AL0C 4KN4X 4UUVA 1MBGA 1J75A 2L0KA 1Y0NA 1I3QJ 2IS4A 2CUEA 4Y13A 2HVSA 2B7EA 1CGPA 3GFLA 2E1NA 5AIPA 1WJFA 2WC2A 1H9TA 3OYNA 3D0SA 4BQOA 3KETA 3DKWA 3OIQA 3LFUA 2DJNA 4IF4A 5EZHA 3EYIA 3GF2A 1E3HA 1AA7A 3KP3A 5IP7J 2H1KA 5GADJ 2QZ8A 2EK5A 4JX4A 1JT6A 3A02A 3BTCA 3SZPA 4J01A 4M3GA 3DTEA 3PSFA 1MNEA 3HRUA 1QZEA 2XC7A 4MEXF 4M6XA 2R4GA 1IZ1A 3ASOH 3FZVA 3HIFA 4UVCA 3PIOF 2MG4A 3CC2I 2KT0A 2L2OA 5LGNA 4D7NA 2DOFA 4L5EA 4G94A 2KLOA 1V5FA 4L5JA 4BH9A 2LBFA 3CJNA 4BUPA 4KICA 5D8LB 2X9DA 5IPAA 4P55A 1RRJA 2VJ5A 3T0YA 2DYRH 4KDPA 1VQ5I 4QWQA 2EFNA 4G12A 2BYVE 3WTZA 4CSWA 3GWZA 3IKTA 1R22A 5HLGA 4B44A 3IAM2 3QPTA 3KFWX 3I4NJ 3ZMVA 4B8XA 3GLXA 3K2AA 4CXFA 2QQBA 1XDUA 3GTLJ 4TV7A 3OYKA 3E3VA 4EM0B 2UUZA 4G7HF 2IRFG 2QBYA 2BVMA 3O2PE 1W0TA 2TCTA 2ZB9A 3KIOA 2DN0A 3JRDA 4KT5C 1VQ9I 1E17A 2Y69H 3I3LA 3HHHA 2MLKA 4OAYA 2CQXA 4G8XA 2DYSH 2GXAA 1ZR2A 3ZQFA 3KLOA 4BYYA 4JX5A 3QYFA 1LDDA 3F8FA 1SFUA 3PNYA 3ZMZA 3W2WA 3HKZN 2VPRA 2HTJA 3U9GA 5FLXK 2EZIA 4D1QA 1X4OA 2HQAA 1TW2A 2D2WA 1J2XA 5E1WA 3HOTA 4A6DA 4DZJA 2Y2ZA 4LMYA 3GLLA 4BQAA 1JTYA 5DCFA 2EFWA 2VN2A 3PFYA 5E3OA 3IL2A 3SJMA 5F04A 2CQKA 2H09A 4A3BJ 4KYWA 3GZ5A 1MSEC 3PM1A 3I56I 1ZQ3P 1IRXA 1PP7U 5K5RA 3RZOJ 3H36A 4A2UA 1GT0C 1MJBA 1P4XA 4PJNA 4YELA 1Z3YA 2IJLA 4WF2A 1KYWA 3VSKA 2GIZA 3ZPLA 1JKQC 2R7SA 2VKHA 5J4YA 2XAQA 3I4MJ 1WJAA 3IH3A 2ZKZA 4E7HA 3BJ6A 2AO9A 1BL0A 2F5VA 3O8HA 2A6HF 4IPAA 1YHQI 2XIGA 4BEHA 2BGCA 2EIJH 2JA7J 5DDGA 3RQ4A 4M3BA 2QQ8A 2MA3A 2OZ6A 3LOCA 3TDUC 1HKTA 3LAPA 1IXSB 5KNLA 3T5XA 5E8IA 4N4NB 1HW1A 2AQFA 2XF7A 5D5VB 2R7RA 4BACA 3ISPA 3WE3A 5J1YA 2MD5A 1MBFA 2XAJA 1GXPA 2UV1A 3JW4A 1AKHA 1ZR4A 2IA0A 5C44J 5EG0B 2E1CA 4IL6C 2DU9A 3LSTA 1TNTA 2DQRA 1IN6A 2HQRA 4IQ4A 4ZDLA 4BJTA 2LOOA 1AOYA 1U8RA 2P0WA 3ZCOA 1BJAA 3DP7A 4JP0A 4BJ5C 4A3JJ 2ZSIB 3F22A 3GTJJ 1EH7A 2DODA 5ICCA 1RC9A 2FJ1A 2XGXA 4BE2A 3RKYA 3K69A 1CQTA 3CTAA 2X1CA 5TGTA 3CUQB 2ZJQF 2XRLA 1Z9CA 2XB5A 1VQ6I 4LITA 4BBRJ 2LP0A 2X4HA 3ERED 5K5QA 2R5ZB 4ESBA 4EATA 1UHWA 1R58A 4KT6A 1NH3A 2HTSA 1SEUA 3H0DA 3AG3H 2WAEA 4AM3A 2DCEA 4HG2A 4E6KG 2AXLA 4CZZA 3OYIA 5M5WJ 5H2FC 3HKZA 2E34A 1X1DA 1ETXA 3GX4X 1PUFB 3JR9A 5CQGA 4A3FJ 3WGHA 1YO5C 2ESHA 1MIJA 3GTOJ 4CUGA 3ZOBA 1K79A 2BHZA 3E5QA 3RQIA 4YRVA 5DYMA 5HDKA 2PMUA 3L1PA 1EA3A 4CCOA 1LFPA 2L7KA 1QU3A 1ZARA 1SVOA 3I64A 5F08A 1XMXA 3GYHX 1A5JA 2VLAA 2DOAA 4XKBA 2M34A 4Q4ZF 1QGPA 2IW5A 3F0CA 1IV8A 3GTQJ 2WB1N 2MFZA 2Z2SB 4A0XA 3RTRA 2KPMA 3A2KA 4RAYA 2IGNA 4P5OA 4XM3A 2QSFX 3DBHB 4IHVA 5B1BH 1HXDA 1SFKA 1K7AA 1EV7A 1QQIA 2EV6A 3UNGC 1FIPA 1D5VA 2P8TA 5LRSA 1O3RA 1NK2P 3KEOA 1GHCA 1MBJA 3AAFA 2PX9A 4RA2A 2XPUA 2LY2A 4MHGA 5E3LA 3C1DA 4F93B 1BI2A 1BA5A 2IPQX 3CCSI 2IGKA 1QHHD 4GDFA 3RPUD 4ESJA 1VQ7I 4IHWA 2QSGX 3F8BA 2LYCA 3PUBA 1ZGAA 3LWFA 5IT9K 4YIRX 1KU9A 3CLOA 4UUTA 4IHTA 2AS5F 3H3UA 5DV5A 4XRMA 2QQAA 3Q9SA 4I2OA 4LG0B 1FOYA 1Z77A 3E6MA 2MBFA 5HNFA 2IP2A 4UB8C 2E5ZA 5LRRA 4EQQA 4XMYA 1QVUA 2ZXHA 2M7BA 2XASA 2W84A 2FMLA 4BL0B 3FHZA 1AHDP 3FDYA 4PDKA 2CQNA 5IT3A 1SD4A 2VQCA 2OU2A 3FWEA 5IOZA 3QPHA 3HOVJ 3RPUA 2NS7A 2PG4A 3H5RA 4F7ZA 2JA8J 2ELKA 3CMEI 3GTMJ 3BJAA 4NDLA 3L09A 2VKDA 2MH9A 3KZZA 3CCEI 1R6RA 1XSXA 2I5UA 4XORA 2FEZA 4L9JA 1RZ4A 2DTZA 2V26A 5J1RA 4J19A 3PNVA 3D5LA 2HOTA 2F6CA 3GUDA 4YFXF 2VBWA 1YOVB 2VJ4A 4HOBA 2LKXA 5KK1A 2L9SA 4N9HA 2TDXA 1R4NB 4D9JA 3FXLA 2UXNA 5JHUA 2ELHA 1XGSA 2R92J 2F5DA 2XKOA 3FXJA 4O5VA 4DW6A 1DQUA 2LLKA 2Y48A 2VOPA 1Q1HA 4BHBA 2PMHA 2KJBA 3V8LA 4X0GA 2WB1A 2FE3A 1WWXA 4NB5A 4CDGA 1HDPA 5C3EJ 2J5OA 3OYDA 4XK4A 2YX4A 1B6AA 1SMYF 1TQPA 1V5GA 2KIQA 5EJCA 3F9KA 1RI7A 1R71A 4Y52J 5KVRA 3HM5A 4IOCF 4OIQF 2P6SA 2RNGA 2VBXA 3FXOA 2V79A 1QZZA 4UVAA 2P7VB 2OBPA 1XMAA 1P4AA 2KDOA 2ID6A 2VQLA 1G3SA 4ON0A 1TT0A 3BR2A 1T0FA 4KMUX 3L00A 4XBFA 1YJ9I 3FHNA 4FX0A 1MBKA 4Y7NJ 4XKWA 4KIFA 4XKVA 2ID3A 3HOUJ 2OZUA 3I71A 2P81A 4HEA2 3CD6I 1FIAA 1Z91A 1BI1A 2ZFWA 1B72A 2V1UA 2ZMEB 2K7LA 4HA8A 1TWCJ 5DD8A 9ANTA 2QUFA 2BEOA 1E2XA 1R1UA 2MW8A 2X1DA 4DYCA 4KMFA 4WX9A 3BR0A 2JA6J 4PSWA 5ERIA 3DXJF 1FTZA 1IJWC 3A0BC 3KP4A 2RV8A 4OIOF 1LNWA 3OS0A 3RSNA 1LDKB 3EETA 1FMWA 3HYIA 3BR3A 1X2NA 4PJ0C 1KQ8A 2CG4A 5IY5H 1VQ4I 5M5XJ 1MKMA 3I54A 3BTLA 1R23A 3OV8A 1OKRA 3MVPA 1DP3A 4OOIA 1HW5A 3HOSA 5AIQA 4NHJA 4PJLA 3I58A 3R61A 2VJJA 1MD0A 3F21A 1ZRFA 2PFBA 2HU9A 1K4TA 3RKWA 2EWNA 1UB9A 2NVXJ 2Z1DA 2FBHA 1P4WA 2UXXA 5H20A 5LBQA 5M5YJ 2KFDA 2MGQA 1RNLA 3K4BA 1XMKA 1Y1VJ 3C18A 2Y75A 4PK4A 2VKEA 5D5WB 1NHAA 1IV6A 2XB0X 3DPLC 3K4KA 5TISC 3TEDA 2HKOA 2K40A 2KJCA 2ZCWA 4XLHA 5CYVA 3VYUB 4S0HB 2CO5A 5LGUA 3OYMA 1LEAA 3E6DA 4U0VA 3ZXSA 3CCLI 1FBSA 2K3PA 2HYFA 3KEQA 4OMYA 3CO7C 2EV0A 4LB5A 2M8EA 2K9LA 4ESFA 3BZCA 1V3FA 2E2HJ 2E5NA 2E35A 2K02A 4DQ2A 4G6TB 2V1DA 1DPUA 2LRDA 3REOA 3GFMA 2YPRA 1UELB 2XGDA 4ENMA 1YIOA 2YSRA 4A5NA 2K4JA 2AXTC 1FOXA 2VC1A 3TO9A 1WVRA 2D45A 1FT9A 2HDWA 3SEQA 1JGGA 3H9GA 2DMTA 1E3PA 2VOOA 3AKZA 2F48A 4WK8F 2J5PA 1I3AA 2JRMA 3FXUA 3NRVA 4A6EA 2A61A 4ZC3A 2E7XA 2JQ7A 3NEUA 3HUGB 1OCZH 4MEYF 4S05A 3KP5A 3GZ6A 3IHUA 3ZRGA 4RM2A 3KPHA 4BXUA 3F8CA 4UHTA 1VQPI 2PJPA 3AFHA 2FNPA 1O7FA 2JK3A 3V7RA 2PQ8A 1K4SA 3TGNA 5M3FJ 2X51A 2I8DA 2BV6A 3DU5A 3KP6A 3HG9A 3J7ZI 1R9TJ 1QPIA 3GTGJ 1S7OA 2DFHA 2NAZA 2RDPA 2H94A 2O5RA 1K6OA 2H8WA 3K4NA 1B1BA 3OYEA 2LVSA 2VIXA 3C7JA 1ZG5A 2C6YA 2VL8A 2DDBA 3HZJA 3N97A 1EF4A 3OSGA 2DDAA 2VI6A 3BC8A 2K9SA 3UKGA 2OC6A 4EJOA 3L7WA 2X0LA 2EJRA 2R7DA 3H35A 4U0YA 1J9IA 1TWFJ 4L5IA 2KQRA 3MZHA 1YX3A 1YQAA 4HPQA 4U87A 4ZZLA 1ZH5A 2KRCA 3GTPJ 3EPZA 2PBIA 2R7UA 2FMYA 4BQQA 2FBIA 3J80Z 4N0BA 2R0QC 4E7IA 3LSIA 4OWRB 1XD7A 2HYJA 5CQEA 5AONA 1AU7A 4PZJA 4FQGA 5F0HA 5E3MA 3ERMA 2HVRA 5GPCA 3K4JA 2P5VA 4P1WA 3ZQQA 5F1JA 1X1AA 3LMMA 3E6BA 1N78A 3DBRB 4HSTA 3QWLA 1FYKA 4NQWB 4Q48A 3LQRA 2YS9A 5J6XA 1D3YA 2VBZA 5LEKA 4OU0A 3TL4X 3J7YJ 3K4CA 4XLFA 3OYHA 2F5FA 2V9KA 5KHDA 1QNTA 2WY7Q 4A93J 4QPOA 2NS8A 2BVLA 2DA2A 4RM3A 1X2MA 4E7SA 2EB7A 1XG1A 1LB2A 2L7ZA 1EKEA 4XQFA 1GXQA 1XB4A 4XLPF 1UHMA 1W7PD 1FBUA 5J1UA 5DS9A 4C2UA 1X19A 1R1VA 2QBYB 1QZYA 3O8GA 4GGGA 2FQ4A 5CVRA 5FB2A 3K1NA 1ZN2A 3FMRA 1FZPB 3WE2A 2PLYA 1M1EB 1MNDA 1VQNI 1U5TC 4PCQA 4I0BA 4RAFA 1OYWA 4CYDA 2IS2A 4LFUA 1SVLA 1ZHFA 2W00A 1S7EA 2E60A 3WGIA 1RETA 2ME6A 1O57A 4FETA 4V19K 1SANA 2E2JJ 1OR7C 4LG3A 3ZQ7A 4HF2A 4PUSA 5EEHA 1JKPC 5F0CA 4KA4A 4JOMA 3ML6A 1KONA 1MMAA 1S6LA 1W7PA 3FKJA 3IKVA 3R60A 3WU0A 2F2EA 2QCOA 5F1RA 5E3NA 1S8NA 1D8KA 2EZLA 3S3OA 2OCCH 1YS6A 1YYVA 2Z3YA 4Q47A 3VDXA 3BT9A 1USTA 5GTHC 3LL7A 1HBXG 2DJIA 4BKXA 1WJCA 2XF6A 2DXIA 3JRGA 1LFBA 1K61A 1FEXA 1YRNA 1MMGA 4MIMA 4A5MA 1OLTA 4I76A 5LFAA 1W0UA 4ETSA 3KYDB 2FUG2 1N25A 2ZJPF 1F43A 4IHSA 3K1MA 3DTIA 2BY2A 2CUZA 1YW7A 4F91B 2ECCA 2V9VA 3ZN0A 2DFIA 4E7ZA 4L9NA 1BIBA 4HX7A 1IDYA 1I50J 1VTNC 1MDMB 4ZDPA 4FTHA 3RYRA 2AQEA 2Q1ZB 3FM3A 2W24A 1FC3A 3CC4I 3Q0VA 2CS3A 2XHKA 3HOXJ 4CICA 3JRIA 3FXMA 3V8JA 3LSMA 3A03A 2KRHA 5TRDA 4ZTFA 1GDTA 4XRSG 4C2TA 2Y0MA 1U5TA 4G9YA 5HDGA 1TQMA 2CYYA 4BHPA 4WWCA 4DOZA 2H6CA 1U6GA 1TT5B 2HDDA 2HGCA 1GVJA 5CKTA 1LE8A 5JI6A 1KGSA 4HV5A 4XN3A 4HBLA 1OR7A 1P6RA 3CDIA 1BC8C 2A5WA 4ENNA 5IYBJ 2M8GX 3P7NA 2R5YA 5J4VA 1MBEA 3OSFA 2CV1A 5C4XJ 4ANJA 4QTRA 1R4MB 3HGYA 2A6EF 1O3TA 3C2GA 1BM9A 4A0YA 3S17J 1RR7A 2VXZA 2ACJA 1VFCA 2GIVA 3ABUA 1IAWA 1WI9A 3K2ZA 5DEQA 1JKOC 4WCGA 3VYRB 1XTAA 3OYCA 2W82A 2YX7A 2ZBKA 2LY9A 4I0AA 5FD6A 3CCRI 4CA0A 3PIPF 2W1OA 4MQ9F 2BHYA 5D4RA 3WTSC 1V4RA 3QAHA 1QVTA 3CJRB 3G1OA 1ERDA 2ZC2A 4QLCU 4MGRA 1ON1A 3VB2A 3S8PA 4BDZA 3G2BA 1GUUA 2G9WA 4HQEA 3DQVC 2V6EA 2LFBA 4HSRA 2DFFA 3E1SA 2K9QA 2WY8Q 2Y9YA 4ABZA 1BW5A 4E70A 2A05A 4I01A 2STWA 3FIWA 3FK7A 2VASA 3RCOA 5DM6F 2ZXIA 2EPFA 2OJED 4IZZA 2Q2EB 4XLEA 4I6ZA 3CCMI 5E79C 2NYXA 4LD5A 1ZLJA 2EFOA 1SFEA 2KKOA 3TO6A 2M2EA 5K7ZA 4OAZA 3TOAA 3JRHA 3G6EI 1FOWA 1BR1A 5K1YA 4RGUA 2OF7A 3WTUC 1GV2A 1MW7A 3FF5A 4M74A 2X1EA 3D5SC 2TRTA 1BI3A 1D5YA 3ZN1A 3M9AA 5JFRA 1L0OC 2VKVA 4I99C 1YFHA 1ETWA 2R7VA 1HLVA 2HQ5A 1Z3XA 2K9NA 4XIDA 3LSHA 2E7WA 3NQOA 1MH4A 1U9NA 2LTPA 4GYGA 4ENJA 2H27A 1Z1DA 3FBIB 3HOYJ 3VWBA 2GXBA 3GVAA 4XOPA 3FKIJ 4WXHA 1YX5A 3HEFA 5JVGF 1MZBA 3L9FA 4V2GA 5E8GA 3HL2A 1NK3P 4DYRA 4G7OF 4F92B 2WADA 2DOEA 1ZGJA 5BS6A 1T98A 2MABA 4DGWB 1B9NA 4A3MJ 1VNDA 4LJZF 1Z7UA 1FP2A 3OYBA 1G6NA 1AWCA 2BXYA 1IUYA 1K6YA 3JAMZ 3DEUA 2IGMA 3E5UA 3SDBA 1MNMC 2RGVA 4FISA 4BHCA 4UB6C 1W1WE 3H9JA 3KCCA 4A3DJ 4GYIA 4D0PA 4M9ZA 1XSDA 3K4MA 1PUEE 2XSJC 4CCLA 3H3VK 3IH2A 5JLXA 2NXNB 1ZLKA 4H0EA 3OIPA 2WA0A 3TQNA 3H5NA 1CF7A 3QOPA 2XROA 1XSVA 2V1XA 2ICWG 2X48A 3TW7A 4PSXA 1DU0A 4CCNA 3K70C 3GW2A 3QPSA 1IF1A 3JSPA 3IWFA 5HLHA 1BJZA 5GAHJ 2KZGA 2OUMA 2ZNYA 1D0YA 2CUJA 4O3MA 3F8NA 3VOEA 1Y8QB 2CW0F 2JRTA 3BR1A 2M3AA 3ECOA 4CO8A 1Y0UA 3MWMA 4LOCA 3CZ6A 3SFZA 1VQ8I 3I55I 2HZDA 5FKLA 3ROUA 3CO6C 5ICEA 3U1DA 3GZNB 3CUQC 2L5QA 2M30A 4R1HA 4XSZF 3OY9A 1RIOH 5CVVA 1MJ9A 1BN5A 4DIQA 2YU3A 2QSHX 3K9TA 2KIFA 4E7KA 5IP6A 1K78B 2OTLI 3C2HA 1ITYA 4HNUA 4G6QA 1VQLI 1H0MA 1W4MA 2COMA 1B59A 2DT7B 4XRSA 5J8FA 5LHGA 3COAC 3LFKA 4P9UA 4K2EA 3H5AA 4S04A 3E7LA 3DWLE 3MD2A 3KX2A 5IOYA 3Q0UA 1WSUA 2D5VA 3IP4B 4Y15A 1DP7P 1IDZA 3MCZA 5HLTA 3I53A 4EJUA 3BOQA 1D0ZA 4UVBA 2Q0OA 2L02A 1XCVA 3M1CA 3V7SA 2QLZA 2ZNZA 2Y0SN 2GLOA 1G3WA 1YS7A 1OMIA 4F3QA 1B72B 2JUGA 2L54A 5E18F 3A0HC 3K6GA 3BTJA 2DLLA 3DBLB 1PJRA 1U2WA 4YG2F 2LC2A 5EEGA 1YTYA 1YLFA 2M87A 2DI3A 4M3EA 1JUMA 3I9V2 1UG0A 3C2BA 2FA5A 3TKYA 2XAGA 3OMYA 2JWTA 4XLAA 4YFKF 2XRNA 5A2QZ 1R5ID 1FSEA 3A01B 3CF2A 1JT0A 2VQHA 5ILVA 2R7XA 4KITB 1A6QA 4ZTJA 5EG0A 1I5ZA 5F27A 2ZXJA 3LQQA 2YR2A 3BDDA 5FFZA 3T1BA 3J7AY 2WAQN 4W1UA 2LREA 3AG2H 2HI3A 3HGGA 3J81Z 4KIBA 1XN7A 2HYGD 2LKPA 2Z16A 5FO5A 1I1SA 5DCMB 4ZYEA 3LSJA 3WTXC 3WTWC 1E3OC 3CUQA 1LJ9A 3PO2J 1X1PA 2R7WA 2VPLA 3GEZA 2R5ZA 4O6JA 5TJJA 4UUSB 2PJRB 5D5XB 2GBYA 1TWAJ 4CCKA 1Z6RA 3DV8A 5GAGJ 2EA4A 2VUMJ 1LEBA 1RUNA 4Y17A 4ZYHA 3IAS2 2VC0A 3K0LA 1G3YA 2P5KA 1SD5A 3RKXA 3S2WA 1YE9A 4E4HA 3RJPA 1TWGJ 1Z6TA 3VYSB 1D8JA 3SYTA 1PUFA 3WU1B 3S15J 1Z21A 2NVYJ 2KP6A 4XSXF 3OL3A 5IYDJ 1XGNA 5D4SA 2QF7A 4HAMA 3S1MJ 3BZKA 2A6TA 2QYOA 1TQIA 1HSTA 1Z05A 1FMVA 4AIDA 2K86A 1JGSA 1R5GA 5ED4A 4Z6YA 1SAXA 4C9YA 4HDVA 1IN7A 3HRMA 3T8RA 2M45A 2FXAA 1KU2A 3IH4A 5CJ9A 1R49A 3BR5A 2GQQA 1FX7A 2Y0SA 1T56A 3E0JB 4F52A 2R7OA 3TBIA 4UXNA 2P5LC 1BC7C 4L0YB 2Y9ZA 3ULQB 4BQNA 1WPKA 5FKKA 2BZTA 3S93A 4AWXB 5LGTA 5EDNA 2CFOA 1ENHA 1NG7A 4XN0A 2PI0A 3ZMDA 2IVMA 4QPQA 3HTUA 2BW3B 3AG4H 4MQVA 3IUOA 1F4KA 3CLQA 1LUJB 1V54H 3DTKA 4BNCA 1FNNA 1A04A 3BZ6A 1U9OA 1QRYA 3FXKA 3HPHA 5B3SH 2LD5A 3S16J 2GXGA 4KUMA 3IRQA 2UZKA 1FYMA 3S1QJ 2WAQA 2LG4A 2LDUA 5BOXA 2EFQA 1SMTA 4A3GJ 1SFXA 3CQZJ 1XDSA 1FPQA 3HOZJ 2Q8KA 3DU6A 2OQRA 2P6TA 2F4IA 4C3JJ 1LDJA 1OISA 3OOPA 2NS0A 2X6XA 3L2QA 4M3DA 3CMYA 4II2A 3S2DJ 4L9TA 2M4GA 3ZMUA 4EMSA 3HXLA 1Z0XA 4GXOA 1Y56A 1KU7A 4MTDA 3W6JB 2BE5F 2ZMEC 1O3QA 3GBGA 2MD0A 5F0FA 1JTXA 3DEEA 4N9IA 2W57A 2QVOA 3CMMA 4RBOA 1W5SA 2R7FA 3BQZA 1L3LA 1X3ZB 4CCJA 1MMDA 3HPGA 4XOTA 2GOMA 3NAUA 1FBQA 2M0CA 2NVQJ 2JJ7A 2VE9A 2XVCA 3JRFA 3E5XA 3A4CA 1NG6A 2IEKA 3MMYB 3Q0WA 4MFEA 3Q5FA 2CQQA 2RAEA 4YIFA 3QYBA 1TZLA 2IBDA 4IHYA 2K85A 4HLYA 5D6EA 3TO7A 2E2IJ 1MSFC 3CC7I 1B8IB 1VQMI 4XICA 1S72I 2WV0A 4DBRA 4ENKA 1OCCH 4C30A 1K83J 1MMSA 1MJAA 4NUBA 2DA6A 3TP3A 5HLIA
chains in the Genus database with same CATH topology
2L7MP 1AKHA 1ZR4A 3BT9A 5C44J 5EG0B 3M3YJ 4BKXA 3BQYA 2JMWA 1LFBA 3JRGA 1K61A 1FEXA 1ETYA 5EEAA 1JJ6C 1YRNA 3LSGA 4MIMA 4JP0A 2MSYA 4A3JJ 4I76A 3ZQLA 3BG9A 1H89C 3DEWA 3GTJJ 1W0UA 1XC5A 2FJ1A 4D5FA 4EEFG 1F43A 2HXIA 1CQTA 2XRLA 2XB5A 2EZHA 5FLMJ 1NTCA 4BBRJ 2LP0A 2ECCA 4RDUA 1O4XA 2R5ZB 1ZGWA 2PMZN 2DMPA 3B6AA 2HOSA 2GM4A 1IDYA 1I50J 1VF9A 4FTHA 1WH7A 4X1EA 2L7FP 2W48A 3Q0VA 3HOXJ 2XPWA 3JRIA 5M5WJ 2OPTA 1Y1WJ 3A03A 5IP9J 1GDTA 1ETXA 4XRSG 2JA5J 3FISA 3RKQA 1PUFB 3JR9A 4A3FJ 3GTOJ 1U8BA 1UHSA 3ZOBA 2HDDA 3JRCA 3RQIA 4X6AJ 1LE8A 2FD5A 3L1PA 3ZQCA 5F08A 5IYBJ 3ZQGA 4DYQA 2M8GX 1A5JA 2R5YA 1MBEA 1MBHA 3OSFA 2DA1A 1HF0A 2ME0A 5C4XJ 2M34A 3FK6A 3HGYA 2DMQA 3VPRA 4AC0A 4QTRA 1OCTC 3F0CA 3QPLA 3GTQJ 2WB1N 4B3AA 2Y31A 3OOUA 3S17J 1RR7A 1VFCA 3ZQHA 1H88C 1JKOC 1IGNA 4JX6A 2LY9A 4IHVA 3SFIA 2AHQA 1JJ8C 3S14J 1FIPA 1IRZA 3A01A 2Y30A 1NK2P 1QVTA 3G1OA 1MBJA 1HOMA 2O8KA 2XPUA 5E3LA 4A3EJ 1IUFA 3GTKJ 1GUUA 2X6OA 4AYBN 3BTIA 5K7FA 2HXOA 3S1RJ 1SFOJ 1BA5A 5EGOA 1POGA 2LFBA 4IHWA 2K9QA 3B6CA 2Y9YA 5FLVA 4ABZA 1BW5A 3HB9A 4UUTA 4D5CA 3G1MA 4XRMA 3FK7A 3FIWA 3NARA 1Z77A 1RKTA 4I6ZA 2EQRA 3S1NJ 1QVUA 4MLOA 2DMNA 4UUSA 2XSDC 2M2EA 2JN6A 5K7ZA 1AHDP 1JUPA 1DU6A 3JRHA 2OF7A 1GV2A 5M3MJ 1JKRC 2TRTA 5IOZA 1D5YA 5EGOB 3HOVJ 1WGXA 2NS7A 3TW6A 2JA8J 2VKVA 2ELKA 1HCRA 1ETWA 2KDZA 3GTMJ 4V2FA 1HLVA 1RKWA 4B1RA 2HQ5A 2K9NA 4NDLA 4XIDA 1MH4A 1U9NA 2LTPA 3M4OJ 3HOYJ 3MKLA 5J1RA 4DZPA 2DTZA 3FKIJ 2XGCA 1HDDC 4J19A 1GVDA 3HEFA 4V2GA 1NK3P 2HOTA 2EH3A 4DYRA 1LFUP 2LKXA 2E19A 4A3MJ 1ZTRA 1VNDA 5K7HA 3JRBA 3JREA 5HODA 1A6IA 1WCMJ 2R92J 4DW6A 2LLKA 2HOAA 5EF6A 4A3KJ 2NVTJ 1MNMC 4FISA 3BG3A 3CCYA 1HDPA 5C3EJ 3WHBA 1AKHB 4M3FA 4A3DJ 4XK4A 5DTDA 2ECBA 1VI0A 4A3LJ 3H3VK 3IH2A 2M9HA 5JLXA 4HNVA 4Y52J 3HM5A 1ZK8A 1T33A 1YRNB 2DA3A 2X48A 3TW7A 1DU0A 2ID6A 4BY1J 2B63J 3QPSA 4BXXJ 1BJZA 2YUSA 1P7IA 3BR2A 1Q1VA 4MO7A 1UMQA 3HDDA 1U78A 3K7AJ 4Y7NJ 2LK2A 1MBKA 3BR1A 3H0GJ 1WI3A 2ID3A 3HOUJ 1P7JA 2CJJA 4LOCA 5GP9A 1FJLA 2P81A 3MN2A 5FKLA 1WH5A 1FIAA 3TP0A 1B72A 2CRGA 2XPVA 2R7ZJ 4D7MA 1RESA 1TWCJ 9ANTA 5BNGA 1ITYA 5IP6A 2MW8A 4DYCA 3BR0A 2JA6J 2O9LA 1FTZA 1IJWC 4XRSA 3OIOA 2DA7A 3E7LA 3BG5A 5IOYA 3Q0UA 2D5VA 5GPAA 3BR3A 5FJ8J 1X2NA 1LE8B 3RZDJ 1G2HA 2L9RA 1IDZA 5M5XJ 1BW6A 3BTLA 3HOWJ 3MVPA 2R5YB 3IV5A 2Y0SN 3W6VA 2GLOA 2EBIA 2DMUA 5J3LA 3JRAA 1B72B 1GV5A 3BTJA 2NVXJ 1B8IA 4CYCA 5M5YJ 1F36A 2MGQA 3LSPA 1ETOA 1JUMA 4M3EA 1Y1VJ 3C2BA 2VKEA 4JYKA 2COBA 2JWTA 3A01B 1IV6A 2XB0X 3TEDA 3BR6A 1UG2A 1JT0A 2K40A 2IAIA 4S0HB 4B4CA 4C2MJ 2E1OA 1H8AC 2N8GA 5EG0A 1ETQA 5F27A 3CDLA 2O7OA 4AUXA 2NOGA 5IYCJ 2WAQN 4W1UA 1ETKA 2HI3A 3HGGA 2E2HJ 4BBSJ 4C3IJ 2XGDA 3LSJA 2LR8A 2CU7A 1OFCX 4FE4A 1E3OC 4IHXA 1JGGA 3PO2J 2DMTA 4QIWN 5EYRA 4A69C 4CYCB 5C4JJ 4IEJA 2R5ZA 2XGEA 1RPWA 1MBGA 4UUSB 2L0KA 2FX0A 2GBYA 2R93J 1I3QJ 1TWAJ 2CUEA 2VUMJ 3SDGA 1X58A 2JK3A 1ORKA 1TWGJ 4GFBA 5M3FJ 1PUFA 2H8RA 3S15J 2DJNA 2NVYJ 5EZHA 1R9TJ 1XS9A 1QPIA 3GTGJ 5IP7J 2H1KA 5IYDJ 4JX4A 1JT6A 3A02A 3BTCA 3PO3J 2QF7A 1APLC 3S1MJ 2LVSA 5FKNA 4M3GA 1TC3C 5JLWA 1EF4A 3OSGA 2VI6A 3UKGA 2K9SA 2MG4A 2KT0A 4QSHA 4D7NA 4L5EA 3IH4A 1TWFJ 3S2HJ 3BR5A 2EZKA 2X9DA 5IPAA 4MFDA 1T56A 3GTPJ 4W97A 4G12A 2Y9ZA 1WPKA 5FKKA 5EDNA 2R0QC 1JUSA 2HYJA 3I4NJ 1AU7A 1ENHA 5F0HA 3K2AA 5E3MA 3DCFA 5GPCA 5FKOA 3GTLJ 5EZGA 2CUFA 2DA5A 1FTTA 2I10A 1MH3A 5F1JA 1W0TA 2TCTA 2ZB9A 4FCYA 2DN0A 3JRDA 1U9OA 1QRYA 3HBLA 2LD5A 3S16J 2YS9A 3LNQA 3S1QJ 2CQXA 3ZQIA 1IG7A 1ZR2A 3ZQFA 4A3GJ 3CQZJ 4JX5A 1I6HJ 3HOZJ 3D1NI 3HKZN 2VPRA 4FE7A 4C3JJ 2EZIA 4A93J 2NS8A 2G0EA 4DZJA 2DA2A 4M3DA 2Y2ZA 1X2MA 3CMYA 1XG1A 3LSRA 1JTYA 2L7ZA 3S2DJ 1OCPA 1Z0XA 5E3OA 3SJMA 5F04A 3WHCA 4A3BJ 1MSEC 5J1UA 5DS9A 4A3CJ 3GBGA 3PM1A 1ZQ3P 5FKMA 3O8GA 1JTXA 5F0FA 3RZOJ 2DA4A 2FQ4A 1GT0C 3QQAA 4RBOA 3BQZA 1OJLA 1JKQC 3NAUA 3I4MJ 2M0CA 3IH3A 2NVQJ 2JJ7A 2YU9J 1TWHJ 2AO9A 1S7EA 3JRFA 1BL0A 3O8HA 2IEKA 1RETA 2WV1A 3Q0WA 2ME6A 4MFEA 1IC8A 2CQQA 4M6VA 4BY7J 2JA7J 1SANA 2RAEA 4M3BA 2E2JJ 3LOCA 2IBDA 4IHYA 2E2IJ 1MSFC 1JKPC 1B8IB 5F0CA 4C3HJ 4XICA 1ETVA 5J1YA 1K83J 1MBFA 2QCOA 5E3NA 3Q3SA 4A3IJ 1ZKGA 2EZLA 3G1LA 2DA6A 3TP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7M P;  1AKH A;  1ZR4 A;  3BT9 A;  5C44 J;  5EG0 B;  3M3Y J;  4BKX A;  3BQY A;  2JMW A;  1LFB A;  3JRG A;  1K61 A;  1FEX A;  1ETY A;  5EEA A;  1JJ6 C;  1YRN A;  3LSG A;  4MIM A;  4JP0 A;  2MSY A;  4A3J J;  4I76 A;  3ZQL A;  3BG9 A;  1H89 C;  3DEW A;  3GTJ J;  1W0U A;  1XC5 A;  2FJ1 A;  4D5F A;  4EEF G;  1F43 A;  2HXI A;  1CQT A;  2XRL A;  2XB5 A;  2EZH A;  5FLM J;  1NTC A;  4BBR J;  2LP0 A;  2ECC A;  4RDU A;  1O4X A;  2R5Z B;  1ZGW A;  2PMZ N;  2DMP A;  3B6A A;  2HOS A;  2GM4 A;  1IDY A;  1I50 J;  1VF9 A;  4FTH A;  1WH7 A;  4X1E A;  2L7F P;  2W48 A;  3Q0V A;  3HOX J;  2XPW A;  3JRI A;  5M5W J;  2OPT A;  1Y1W J;  3A03 A;  5IP9 J;  1GDT A;  1ETX A;  4XRS G;  2JA5 J;  3FIS A;  3RKQ A;  1PUF B;  3JR9 A;  4A3F J;  3GTO J;  1U8B A;  1UHS A;  3ZOB A;  2HDD A;  3JRC A;  3RQI A;  4X6A J;  1LE8 A;  2FD5 A;  3L1P A;  3ZQC A;  5F08 A;  5IYB J;  3ZQG A;  4DYQ A;  2M8G X;  1A5J A;  2R5Y A;  1MBE A;  1MBH A;  3OSF A;  2DA1 A;  1HF0 A;  2ME0 A;  5C4X J;  2M34 A;  3FK6 A;  3HGY A;  2DMQ A;  3VPR A;  4AC0 A;  4QTR A;  1OCT C;  3F0C A;  3QPL A;  3GTQ J;  2WB1 N;  4B3A A;  2Y31 A;  3OOU A;  3S17 J;  1RR7 A;  1VFC A;  3ZQH A;  1H88 C;  1JKO C;  1IGN A;  4JX6 A;  2LY9 A;  4IHV A;  3SFI A;  2AHQ A;  1JJ8 C;  3S14 J;  1FIP A;  1IRZ A;  3A01 A;  2Y30 A;  1NK2 P;  1QVT A;  3G1O A;  1MBJ A;  1HOM A;  2O8K A;  2XPU A;  5E3L A;  4A3E J;  1IUF A;  3GTK J;  1GUU A;  2X6O A;  4AYB N;  3BTI A;  5K7F A;  2HXO A;  3S1R J;  1SFO J;  1BA5 A;  5EGO A;  1POG A;  2LFB A;  4IHW A;  2K9Q A;  3B6C A;  2Y9Y A;  5FLV A;  4ABZ A;  1BW5 A;  3HB9 A;  4UUT A;  4D5C A;  3G1M A;  4XRM A;  3FK7 A;  3FIW A;  3NAR A;  1Z77 A;  1RKT A;  4I6Z A;  2EQR A;  3S1N J;  1QVU A;  4MLO A;  2DMN A;  4UUS A;  2XSD C;  2M2E A;  2JN6 A;  5K7Z A;  1AHD P;  1JUP A;  1DU6 A;  3JRH A;  2OF7 A;  1GV2 A;  5M3M J;  1JKR C;  2TRT A;  5IOZ A;  1D5Y A;  5EGO B;  3HOV J;  1WGX A;  2NS7 A;  3TW6 A;  2JA8 J;  2VKV A;  2ELK A;  1HCR A;  1ETW A;  2KDZ A;  3GTM J;  4V2F A;  1HLV A;  1RKW A;  4B1R A;  2HQ5 A;  2K9N A;  4NDL A;  4XID A;  1MH4 A;  1U9N A;  2LTP A;  3M4O J;  3HOY J;  3MKL A;  5J1R A;  4DZP A;  2DTZ A;  3FKI J;  2XGC A;  1HDD C;  4J19 A;  1GVD A;  3HEF A;  4V2G A;  1NK3 P;  2HOT A;  2EH3 A;  4DYR A;  1LFU P;  2LKX A;  2E19 A;  4A3M J;  1ZTR A;  1VND A;  5K7H A;  3JRB A;  3JRE A;  5HOD A;  1A6I A;  1WCM J;  2R92 J;  4DW6 A;  2LLK A;  2HOA A;  5EF6 A;  4A3K J;  2NVT J;  1MNM C;  4FIS A;  3BG3 A;  3CCY A;  1HDP A;  5C3E J;  3WHB A;  1AKH B;  4M3F A;  4A3D J;  4XK4 A;  5DTD A;  2ECB A;  1VI0 A;  4A3L J;  3H3V K;  3IH2 A;  2M9H A;  5JLX A;  4HNV A;  4Y52 J;  3HM5 A;  1ZK8 A;  1T33 A;  1YRN B;  2DA3 A;  2X48 A;  3TW7 A;  1DU0 A;  2ID6 A;  4BY1 J;  2B63 J;  3QPS A;  4BXX J;  1BJZ A;  2YUS A;  1P7I A;  3BR2 A;  1Q1V A;  4MO7 A;  1UMQ A;  3HDD A;  1U78 A;  3K7A J;  4Y7N J;  2LK2 A;  1MBK A;  3BR1 A;  3H0G J;  1WI3 A;  2ID3 A;  3HOU J;  1P7J A;  2CJJ A;  4LOC A;  5GP9 A;  1FJL A;  2P81 A;  3MN2 A;  5FKL A;  1WH5 A;  1FIA A;  3TP0 A;  1B72 A;  2CRG A;  2XPV A;  2R7Z J;  4D7M A;  1RES A;  1TWC J;  9ANT A;  5BNG A;  1ITY A;  5IP6 A;  2MW8 A;  4DYC A;  3BR0 A;  2JA6 J;  2O9L A;  1FTZ A;  1IJW C;  4XRS A;  3OIO A;  2DA7 A;  3E7L A;  3BG5 A;  5IOY A;  3Q0U A;  2D5V A;  5GPA A;  3BR3 A;  5FJ8 J;  1X2N A;  1LE8 B;  3RZD J;  1G2H A;  2L9R A;  1IDZ A;  5M5X J;  1BW6 A;  3BTL A;  3HOW J;  3MVP A;  2R5Y B;  3IV5 A;  2Y0S N;  3W6V A;  2GLO A;  2EBI A;  2DMU A;  5J3L A;  3JRA A;  1B72 B;  1GV5 A;  3BTJ A;  2NVX J;  1B8I A;  4CYC A;  5M5Y J;  1F36 A;  2MGQ A;  3LSP A;  1ETO A;  1JUM A;  4M3E A;  1Y1V J;  3C2B A;  2VKE A;  4JYK A;  2COB A;  2JWT A;  3A01 B;  1IV6 A;  2XB0 X;  3TED A;  3BR6 A;  1UG2 A;  1JT0 A;  2K40 A;  2IAI A;  4S0H B;  4B4C A;  4C2M J;  2E1O A;  1H8A C;  2N8G A;  5EG0 A;  1ETQ A;  5F27 A;  3CDL A;  2O7O A;  4AUX A;  2NOG A;  5IYC J;  2WAQ N;  4W1U A;  1ETK A;  2HI3 A;  3HGG A;  2E2H J;  4BBS J;  4C3I J;  2XGD A;  3LSJ A;  2LR8 A;  2CU7 A;  1OFC X;  4FE4 A;  1E3O C;  4IHX A;  1JGG A;  3PO2 J;  2DMT A;  4QIW N;  5EYR A;  4A69 C;  4CYC B;  5C4J J;  4IEJ A;  2R5Z A;  2XGE A;  1RPW A;  1MBG A;  4UUS B;  2L0K A;  2FX0 A;  2GBY A;  2R93 J;  1I3Q J;  1TWA J;  2CUE A;  2VUM J;  3SDG A;  1X58 A;  2JK3 A;  1ORK A;  1TWG J;  4GFB A;  5M3F J;  1PUF A;  2H8R A;  3S15 J;  2DJN A;  2NVY J;  5EZH A;  1R9T J;  1XS9 A;  1QPI A;  3GTG J;  5IP7 J;  2H1K A;  5IYD J;  4JX4 A;  1JT6 A;  3A02 A;  3BTC A;  3PO3 J;  2QF7 A;  1APL C;  3S1M J;  2LVS A;  5FKN A;  4M3G A;  1TC3 C;  5JLW A;  1EF4 A;  3OSG A;  2VI6 A;  3UKG A;  2K9S A;  2MG4 A;  2KT0 A;  4QSH A;  4D7N A;  4L5E A;  3IH4 A;  1TWF J;  3S2H J;  3BR5 A;  2EZK A;  2X9D A;  5IPA A;  4MFD A;  1T56 A;  3GTP J;  4W97 A;  4G12 A;  2Y9Z A;  1WPK A;  5FKK A;  5EDN A;  2R0Q C;  1JUS A;  2HYJ A;  3I4N J;  1AU7 A;  1ENH A;  5F0H A;  3K2A A;  5E3M A;  3DCF A;  5GPC A;  5FKO A;  3GTL J;  5EZG A;  2CUF A;  2DA5 A;  1FTT A;  2I10 A;  1MH3 A;  5F1J A;  1W0T A;  2TCT A;  2ZB9 A;  4FCY A;  2DN0 A;  3JRD A;  1U9O A;  1QRY A;  3HBL A;  2LD5 A;  3S16 J;  2YS9 A;  3LNQ A;  3S1Q J;  2CQX A;  3ZQI A;  1IG7 A;  1ZR2 A;  3ZQF A;  4A3G J;  3CQZ J;  4JX5 A;  1I6H J;  3HOZ J;  3D1N I;  3HKZ N;  2VPR A;  4FE7 A;  4C3J J;  2EZI A;  4A93 J;  2NS8 A;  2G0E A;  4DZJ A;  2DA2 A;  4M3D A;  2Y2Z A;  1X2M A;  3CMY A;  1XG1 A;  3LSR A;  1JTY A;  2L7Z A;  3S2D J;  1OCP A;  1Z0X A;  5E3O A;  3SJM A;  5F04 A;  3WHC A;  4A3B J;  1MSE C;  5J1U A;  5DS9 A;  4A3C J;  3GBG A;  3PM1 A;  1ZQ3 P;  5FKM A;  3O8G A;  1JTX A;  5F0F A;  3RZO J;  2DA4 A;  2FQ4 A;  1GT0 C;  3QQA A;  4RBO A;  3BQZ A;  1OJL A;  1JKQ C;  3NAU A;  3I4M J;  2M0C A;  3IH3 A;  2NVQ J;  2JJ7 A;  2YU9 J;  1TWH J;  2AO9 A;  1S7E A;  3JRF A;  1BL0 A;  3O8H A;  2IEK A;  1RET A;  2WV1 A;  3Q0W A;  2ME6 A;  4MFE A;  1IC8 A;  2CQQ A;  4M6V A;  4BY7 J;  2JA7 J;  1SAN A;  2RAE A;  4M3B A;  2E2J J;  3LOC A;  2IBD A;  4IHY A;  2E2I J;  1MSF C;  1JKP C;  1B8I B;  5F0C A;  4C3H J;  4XIC A;  1ETV A;  5J1Y A;  1K83 J;  1MBF A;  2QCO A;  5E3N A;  3Q3S A;  4A3I J;  1ZKG A;  2EZL A;  3G1L A;  2DA6 A;  3TP3 A; 
#chains in the Genus database with same CATH topology
 2L7M P;  2IT0 A;  2XAH A;  3ZP5 A;  4Y4R A;  2JTV A;  3ZMS A;  4EV0 A;  2GOX B;  4IRI A;  1YG2 A;  3OR1 C;  4B09 A;  2JMW A;  5H6R A;  3JTG A;  1T8I A;  3LA2 A;  1ETY A;  3VFZ A;  5EEA A;  1JJ6 C;  2NRA C;  3ZR8 X;  5D6F A;  2W85 A;  3GFJ A;  3BG9 A;  1Y6I A;  3CJQ B;  1UZC A;  3DEW A;  1H89 C;  3R4K A;  4RAZ A;  2VXD A;  2R7Q A;  1YIT I;  3W3C A;  4YFN F;  3MKW B;  2OA4 A;  2HXI A;  2XAF A;  4IJA A;  2FQ3 A;  2V4J C;  3CF5 F;  1LVA A;  2B0L A;  2QKM B;  2ZO4 A;  2EZH A;  1NTC A;  4GCV A;  4HZF A;  1O4X A;  4RAG A;  1ZGW A;  1PDN C;  2NVU B;  5D5U B;  2BXZ A;  2DMP A;  3B6A A;  4DBQ A;  2GM4 A;  4L9V A;  1WH7 A;  2L7F P;  1S5L C;  2K27 A;  3MEX A;  2WAF A;  3QOD A;  2Z9O A;  4LLG F;  5FLX Z;  5BPI A;  2OPT A;  1Y1W J;  3OYL A;  1TLH B;  3PQK A;  5IP9 J;  4U7D A;  4IRH A;  2JA5 J;  4Q5S F;  1A31 A;  3TMO A;  1U8B A;  1UHS A;  2ISY A;  2HNH A;  1J59 A;  3JRC A;  2ELJ A;  3BLY A;  1QA6 A;  1SD6 A;  3GO5 A;  3N4M A;  4PFO A;  4UY8 I;  3I59 A;  4IVN A;  2BBY A;  4F55 A;  1ONV A;  1JE8 A;  4BGD A;  3UR3 C;  4DYQ A;  1ACI A;  2DA1 A;  2ME0 A;  3BRO A;  3EQL F;  4IRG A;  4AC0 A;  3Q9V A;  4B3A A;  2B9S A;  2Y31 A;  2BY1 A;  3OOU A;  5CVU A;  4EM2 A;  5HNH A;  4RB1 A;  2OQG A;  2LBF B;  4B3X A;  1H88 C;  3DPT A;  1W5C C;  1IGN A;  4JX6 A;  4EVI A;  4IQJ A;  3ASN H;  2A5Y B;  2O6G E;  1T95 A;  3CP2 A;  3SFI A;  1JJ8 C;  3LAJ A;  2VT3 A;  2JSP A;  2Z5U A;  4HV6 A;  5J47 A;  1Y8R B;  2O61 A;  2F5E A;  1KU3 A;  4YEJ A;  4AU7 A;  3GFI A;  1IUF A;  2G7H A;  3GTK J;  4FX4 A;  3S1R J;  3L2V A;  1J09 A;  4ZH4 F;  3CUO A;  2E1M B;  3W2V A;  5EGO A;  2QGU A;  1UFM A;  1D1A A;  2HKX A;  1WKM A;  1BBY A;  3AL0 B;  4AVZ A;  3BJO A;  4D5C A;  3J7A O;  2O0Y A;  1BOA A;  3IC7 A;  1ZG1 A;  4M9X A;  2M0M A;  3NAR A;  3L2C A;  3WOD F;  3S3N A;  3F23 A;  1UAA A;  3BPV A;  2EQR A;  3FM5 A;  4FHT A;  3F8M A;  1ZG3 A;  4HW0 A;  2ETH A;  4LGW A;  2DMN A;  2UWM A;  4AVP A;  2A69 F;  3HUG A;  4HLX A;  2RKH A;  5L3D A;  1A36 A;  2CSO A;  4ZJZ A;  5F6F A;  1JUP A;  3M8E A;  4LIV A;  3F6V A;  1QHG A;  1ZRE A;  4XON A;  3HSF A;  3OR2 C;  2A07 F;  4B48 A;  1U3E M;  1JKR C;  2V1N A;  4I09 A;  3GME A;  3O3K A;  4XL9 A;  2RN7 A;  1HCR A;  2KDZ A;  4V2F A;  4J00 A;  4B1R A;  3M1E A;  5HS7 A;  3ABL H;  2HPM A;  1G59 A;  1EH8 A;  3M4O J;  2X6W A;  2FOW A;  3MKL A;  5HS9 A;  4DZP A;  1HDD C;  5CVI A;  3ELK A;  4BS9 A;  2DT6 A;  3RDI A;  4BEH B;  1Y39 A;  1LFU P;  1T38 A;  3CMA I;  1MMN A;  2E19 A;  3S3M A;  5GAE J;  4PJJ A;  2E36 A;  4HF1 A;  2F5C A;  1SC7 A;  1XGO A;  3JRE A;  2ADU A;  5KAI C;  1A6I A;  3HC7 A;  4M73 A;  4EM1 A;  2NNY A;  2LY1 A;  1XX5 A;  1Z7L A;  5HS8 A;  1IO2 A;  2XV4 S;  2NVT J;  3SZT A;  3BG3 A;  4R79 A;  4HRI A;  3CCY A;  4PGH A;  3WHB A;  1AKH B;  3KP7 A;  4M3F A;  4LIU A;  2ECB A;  3LA3 A;  5CLS A;  1WJE A;  4A3L J;  2HEO A;  2M9H A;  1VQO I;  2XKP A;  1QPM A;  3U1K A;  3O6B B;  2PEX A;  2DA3 A;  2R7T A;  4ITV A;  4BY1 J;  4G6D A;  2LNB A;  4BXX J;  5F64 A;  3F3X A;  1IXR C;  2YUS A;  3L2R A;  1P7I A;  4B43 A;  4NQW A;  5DUK A;  1Q1V A;  4MO7 A;  2CV2 A;  4BJ6 C;  1U78 A;  3K7A J;  5IT9 Z;  2OCE A;  2LK2 A;  4CGZ A;  1G8X A;  5E1X A;  2HPI A;  4NNJ A;  1ZYR F;  3DLL F;  1TP4 A;  2H1L A;  1HKQ A;  2OD5 A;  1EH6 A;  1XCB A;  1WH5 A;  3JTH A;  1KYZ A;  1DDN A;  3TP0 A;  2GZW A;  4RB2 C;  3R0A A;  2R7Z J;  4D7M A;  1WHU A;  5BNG A;  3WTY C;  4WXC A;  2KHM A;  2O9L A;  1CF7 B;  3MQ0 A;  2E71 A;  2IXS A;  2DPD A;  3ECH A;  3HHG A;  2DA7 A;  3U21 A;  3BG5 A;  2KZV A;  3G73 A;  3KLN A;  3DPU A;  5GPA A;  1H9G A;  5FJ8 J;  2L9R A;  4HF0 A;  4HYE A;  1FOK A;  1HKS A;  3FXQ A;  2P4W A;  2VT2 A;  3HJE A;  3IV5 A;  2DT5 A;  4LK1 F;  4GO1 A;  4RMN A;  3KZI C;  4CH7 A;  5L3C A;  3K4L A;  1D1C A;  2RRE A;  4NC6 A;  3L2W A;  3CP8 A;  2KMU A;  3LSK A;  3BPX A;  3WG7 H;  2EIN H;  3U2R A;  2V7F A;  1J7K A;  5DM7 F;  4CYC A;  2KRF A;  2LMD A;  3J80 K;  1F36 A;  3FMQ A;  1G4D A;  3LSP A;  2A3S A;  3ABM H;  3CDH A;  3OL4 A;  3S32 A;  4I98 B;  4JYK A;  2COB A;  2DK8 A;  1S9H A;  1PP8 F;  3BR6 A;  1UG2 A;  4AIH A;  2IAI A;  2E1O A;  2GAU A;  2N8G A;  1H8A C;  3SQN A;  2VB6 A;  5GTI C;  1ETQ A;  1J0R A;  3NWT A;  3L2U A;  1ETK A;  5LHI A;  4Y3O A;  4I7H A;  4MTE A;  4Z2Y A;  3ONQ A;  4G7Z F;  3DKX A;  4BBS J;  3KEY A;  3DF8 A;  1C0W A;  1D1B A;  5L3F A;  4DJA A;  3F72 A;  3H3Z A;  5DUI A;  4FE4 A;  4IHX A;  1IN5 A;  3ABT A;  3PFI A;  5EYR A;  2XUB A;  4IEJ A;  2XGE A;  1RPW A;  4GRI A;  4ASN A;  4LB6 B;  2FX0 A;  1GLN A;  2O8X A;  2CQ7 A;  2R93 J;  1R7J A;  3H9Q A;  1MDM A;  3W6K B;  3SDG A;  2ZSH B;  1P9Q C;  1X58 A;  2JSC A;  1OPC A;  1T2K A;  4UNO A;  3RPQ A;  5CPR B;  3TDZ C;  5JVT A;  4ZZD A;  1DPR A;  1ORK A;  5K5O A;  2DQL A;  3A1Y A;  5FD5 A;  4GFB A;  2FBK A;  5ICF A;  3OS1 A;  2H8R A;  1ON2 A;  2EV5 A;  5D8K B;  1XS9 A;  1TW3 A;  3H1C A;  2M5W A;  5DD4 A;  3WGG A;  3PO3 J;  2JPB A;  1BOB A;  3BY6 A;  3V8K A;  1APL C;  2HQN A;  2MH2 A;  4LK0 F;  3I5U A;  5FKN A;  4OIR F;  1TC3 C;  1YW8 A;  5JLW A;  2O3F A;  3VEP A;  1R5H A;  4IOA F;  2A68 F;  2GA1 A;  2XAU A;  1ZEL A;  4QSH A;  1X3U A;  3S2H J;  3CCJ I;  2VE8 A;  1JXS A;  2EZK A;  3GXO A;  5LHH A;  3CCV I;  1LPQ A;  4MFD A;  4KFC A;  2MLG A;  1ULY A;  4W97 A;  5BMZ A;  5FRM A;  1KA8 A;  3OYF A;  4EJW A;  2CFX A;  1JUS A;  1HA8 A;  2CMP A;  1P92 A;  2P7C B;  2KIU A;  3DCF A;  5FKO A;  5EZG A;  4XLN F;  2CUF A;  2DA5 A;  1FTT A;  2I10 A;  1MH3 A;  3EUK L;  1OYY A;  1YW9 A;  1MGT A;  4IXA A;  4XRF A;  2DW4 A;  4FCY A;  5E17 F;  1ODD A;  3K70 D;  2JVH A;  2EIM H;  4OIP F;  3HBL A;  5L3G A;  1OCR H;  1UJ8 A;  2L9N A;  3LNQ A;  2D1V A;  1S3J A;  3QU6 A;  3ZQI A;  2IGO A;  4EJV A;  2K5C A;  5B66 C;  3G4S I;  2IS1 A;  1IG7 A;  1HC8 A;  4RS8 A;  2Q2E A;  4M9S A;  2L9V A;  2JVG A;  4XLC A;  4CCM A;  3IRR A;  3D1N I;  1HW2 A;  1I6H J;  4FE7 A;  1OQY A;  3MFK A;  2D1H A;  2V6C A;  2QWW A;  2G0E A;  2FF4 A;  1BR2 A;  2Z99 A;  2EIK H;  3TOB A;  4MNU A;  3LSR A;  3FBN B;  1OCP A;  4HQM A;  3CJT B;  2RC4 A;  3WHC A;  2RVC A;  1A35 A;  4A3C J;  2ESN A;  3I4P A;  1JHF A;  1N75 A;  4IO9 F;  5FKM A;  4CZC A;  1SVM A;  5J8C A;  3C3W A;  2DA4 A;  4NC7 A;  3QQA A;  2HFH A;  1QO0 D;  3G71 I;  1IXC A;  5HVQ C;  1TNS A;  1ZRC A;  1OJL A;  3OYJ A;  5KAF C;  3MKZ A;  2LSO A;  1FYL A;  2YU9 J;  1TWH J;  3FMS A;  2RQQ A;  1T0F C;  1X1B A;  2WV1 A;  4EGY A;  1IC8 A;  4M6V A;  4BY7 J;  2QA4 I;  2QKL B;  2W4S A;  1O7L A;  5B5E C;  1IN8 A;  3KP2 A;  4C3H J;  1F1Z A;  1ETV A;  1XGM A;  3DKY A;  1YJW I;  1ZRD A;  5FRN A;  5E20 A;  3Q3S A;  4A3I J;  1ZKG A;  3ZMT A;  3G1L A;  2OTJ I;  4UV8 A;  4PGG A;  1FP1 D;  2IA1 A;  3PUF A;  2JUC A;  3LA7 A;  3M3Y J;  3GCM A;  5HDN A;  3BQY A;  3RI4 A;  1FWZ A;  4AIK A;  4NBQ A;  3LSG A;  4RGX A;  2MSY A;  6PAX A;  3JCU C;  3V7C A;  1PVE A;  3ZQL A;  2F4O B;  3OYG A;  5LEJ A;  1XC5 A;  4D5F A;  1B4A A;  1X3W B;  4EEF G;  4U7B A;  2K3F A;  1R1T A;  2LF7 A;  1STZ A;  3M07 A;  5FLM J;  1E0E A;  3EYY A;  2M7A A;  3D5R C;  4RDU A;  1JI8 A;  3RYP A;  3EUH C;  2O03 A;  3ZGK A;  2DK5 A;  1W5T A;  2PMZ N;  3SZG A;  2HOS A;  1WQ2 A;  4FAS D;  2JPC A;  3E97 A;  2BY3 A;  2FOK A;  4L18 B;  1VF9 A;  1WJ5 A;  4X1E A;  3EUA A;  4RGR A;  1USS A;  4Y33 A;  5HOO A;  2W48 A;  3QOE A;  1DGW Y;  4PJM A;  4XKC A;  3KZY A;  2XPW A;  1KQ0 A;  1SD7 A;  1V55 H;  1WJB A;  3V4G A;  3X2Q H;  4II3 A;  1K78 A;  2HWV A;  2CGP A;  5CVJ A;  1D0X A;  2W25 A;  3FIS A;  3OWT A;  2JZY A;  3RKQ A;  3HRS A;  3I0T A;  1T39 A;  1J5Y A;  5FFX A;  1XPX A;  1FSH A;  4KN7 X;  4BE1 A;  2ZFU A;  2KL4 A;  1IRF A;  2QEN A;  4XR6 A;  4X6A J;  2OV7 A;  3PJR A;  2FD5 A;  2HVQ A;  1X1C A;  3ZQC A;  4YII A;  4WXD A;  3G3Z A;  1UCR A;  1WJD A;  1Z67 A;  5H6Q A;  3ZQG A;  4DNC A;  1HQC A;  3QRF F;  2VBY A;  1MBH A;  1HF0 A;  4RLQ A;  3FK6 A;  3VPR A;  2DMQ A;  2QEX I;  1OCT C;  3QPL A;  3JAM K;  2VOD A;  3WU2 C;  2W7N A;  5B1A H;  3ZQH A;  4EJT A;  4LG0 A;  1LQ1 A;  3PL8 A;  4U0W A;  3PNT A;  1FLI A;  2KIM A;  2M1B A;  2AHQ A;  3S14 J;  4E7L A;  4P96 A;  3A01 A;  1IRZ A;  2Y30 A;  4I02 A;  1B9M A;  3VSL A;  3OYA A;  1HOM A;  2O8K A;  2V9P A;  3MAJ A;  3WG9 A;  4A3E J;  5BPD A;  2JA2 A;  1WRJ A;  2LF8 A;  3MKY B;  1N77 A;  2EIL H;  2X6O A;  4AYB N;  3I59 B;  3BTI A;  3P5J A;  2HXO A;  5K7F A;  2VQG A;  1SFO J;  3RIR A;  2HR3 A;  2CV0 A;  1X4P A;  1POG A;  4M72 A;  2FRH A;  4BAY A;  1RR8 C;  3B6C A;  3CCQ I;  2DPU A;  5DCM A;  5FLV A;  1S7A A;  4LLN A;  3HB9 A;  2L01 A;  3HTS B;  3EUH A;  2ZJ2 A;  3G1M A;  1BR4 A;  4IX7 A;  2KIS A;  3DLA A;  1YJN I;  2X6Y A;  2PN6 A;  4ZYG A;  2STT A;  4KNY A;  2GA2 A;  1R00 A;  1RKT A;  3BCA A;  5FGM A;  3S1N J;  1G3T A;  4PFP A;  2NOJ B;  4MLO A;  2XF5 A;  4UUS A;  2PJR A;  2XSD C;  1T6S A;  4OMZ A;  2JN6 A;  2GWR A;  1DU6 A;  5L3B A;  3SXY A;  2ISZ A;  3KE2 A;  3R6S A;  5ILS A;  4KIG A;  3KYC B;  5BQT A;  5M3M J;  1DGR M;  1ZAO A;  2PMZ A;  1P2F A;  3P9C A;  3KYL A;  1V5E A;  5EGO B;  3R0J A;  3EDP A;  2FU4 A;  1WGX A;  3TW6 A;  4B47 A;  5ILU A;  3CCU I;  2BOL A;  3BWG A;  2OAZ A;  1RKW A;  3M8J A;  5E1Z B;  4KIS A;  4A12 A;  4UV9 A;  2X85 A;  2LKS A;  4IKF A;  1IRG A;  1R36 A;  2XGC A;  1GVD A;  2R3S A;  1I6X A;  3K1P A;  3QU3 A;  2EH3 A;  4FT8 A;  3P9K A;  3W2A A;  3K10 A;  1ZTR A;  2LH9 A;  4A0Z A;  5K7H A;  2DFE A;  3JRB A;  5ICG A;  3PQJ A;  3VYT B;  5HOD A;  4M71 A;  1OYI A;  5A2Q K;  1WCM J;  1W36 C;  2EFP A;  3BG6 A;  2EA2 A;  3HSR A;  3NWS A;  1FY7 A;  2HOA A;  1W7P B;  5EF6 A;  5J40 A;  2G7U A;  4BE0 A;  4A3K J;  3T8T A;  4XNF A;  1IW7 F;  2ZME A;  3BG7 A;  5DTD A;  1U0J A;  4N4O B;  2QQ9 A;  3J81 K;  4JK1 X;  2WBM A;  1IN4 A;  2M4K A;  1VI0 A;  1SAU A;  4HNV A;  5JHF A;  2H6B A;  1TTY A;  3HSE A;  1YI2 I;  3SEZ A;  1KQ9 A;  2CH0 A;  2L4M A;  1ZK8 A;  1T33 A;  1YRN B;  4L0Z B;  2BW3 A;  3FX3 A;  5LLQ A;  2B63 J;  2MYS A;  3QP6 A;  1TBX A;  4ZDO A;  1I1G A;  4H4K C;  2L4A A;  2VON A;  3B73 A;  3P9I A;  1WFX A;  3PSI A;  1S29 A;  2MC4 A;  4AYB A;  2XDV A;  1UMQ A;  3HDD A;  4ZYA A;  2ZJR F;  4E7J A;  4CHU A;  3H0G J;  1WI3 A;  2DTR A;  1P7J A;  2CJJ A;  2FSW A;  2HOE A;  2HZT A;  5GP9 A;  1W36 D;  1FJL A;  3MN2 A;  2K4B A;  2DO7 A;  3QYE A;  5L3E A;  3OS2 A;  1OCO H;  2CRG A;  1F9N A;  2XPV A;  1RES A;  3M8F A;  3BP8 A;  3F6O A;  1PYV A;  2JT1 A;  2VJI A;  3N05 A;  3ESW B;  2HS5 A;  1KZH A;  2QM3 A;  3WTT C;  4HX4 A;  1BI0 A;  3E6C C;  1U5T B;  1RUO A;  2FNA A;  1T08 B;  3OIO A;  1BIA A;  3FXR A;  2IA2 A;  2Z33 A;  2F4M B;  2CW8 A;  3AG1 H;  2DAO A;  1LE8 B;  1VZ0 A;  1G2H A;  3RZD J;  1LKX A;  3VOD A;  4OIN F;  1I39 A;  4KJZ A;  3CES A;  1BW6 A;  4RGS A;  3HOW J;  4RLF A;  4EGZ A;  2R5Y B;  4RB3 C;  3SHF A;  2K9M A;  3W6V A;  2EBI A;  1JHH A;  2DMU A;  3IWZ A;  1HSJ A;  2NNN A;  5J3L A;  4AD9 A;  3JRA A;  2WTE A;  3DFG A;  4U88 A;  5FRO A;  1GV5 A;  2RNJ A;  3V42 A;  1DUX C;  2L3D A;  5JR3 A;  2BY0 A;  1B8I A;  2CW7 A;  3M7G A;  1ETO A;  4LLL A;  2HDC A;  4ZYD A;  4JQF A;  2IS6 A;  1LVK A;  3QP5 A;  4BXF A;  4R8H A;  3B02 A;  3ABK H;  5KCM A;  2CWE A;  4B4C A;  4C2M J;  1F5T A;  2ZXW H;  3MZ8 A;  4BDY A;  4P9F A;  1YIJ I;  1WZ2 A;  3CDL A;  4RB0 A;  2O7O A;  3JSO A;  1EJ9 A;  4JBA A;  4AUX A;  2NOG A;  5IYC J;  4HX8 A;  3H92 A;  4M6Y A;  4C3I J;  1REP C;  4AIJ A;  2WWY A;  1VQK I;  1TL8 A;  2LR8 A;  5LD2 C;  2CU7 A;  2DBB A;  3WTV C;  4HNT A;  2RQP A;  1OFC X;  2E1M C;  3BCB A;  1O3S A;  1QBJ A;  4NC8 A;  3MZY A;  2MC3 A;  4HDU A;  3HRT A;  4QIW N;  1I27 A;  4A69 C;  4CYC B;  5C4J J;  4BU2 A;  3AL0 C;  4KN4 X;  4UUV A;  1MBG A;  1J75 A;  2L0K A;  1Y0N A;  1I3Q J;  2IS4 A;  2CUE A;  4Y13 A;  2HVS A;  2B7E A;  1CGP A;  3GFL A;  2E1N A;  5AIP A;  1WJF A;  2WC2 A;  1H9T A;  3OYN A;  3D0S A;  4BQO A;  3KET A;  3DKW A;  3OIQ A;  3LFU A;  2DJN A;  4IF4 A;  5EZH A;  3EYI A;  3GF2 A;  1E3H A;  1AA7 A;  3KP3 A;  5IP7 J;  2H1K A;  5GAD J;  2QZ8 A;  2EK5 A;  4JX4 A;  1JT6 A;  3A02 A;  3BTC A;  3SZP A;  4J01 A;  4M3G A;  3DTE A;  3PSF A;  1MNE A;  3HRU A;  1QZE A;  2XC7 A;  4MEX F;  4M6X A;  2R4G A;  1IZ1 A;  3ASO H;  3FZV A;  3HIF A;  4UVC A;  3PIO F;  2MG4 A;  3CC2 I;  2KT0 A;  2L2O A;  5LGN A;  4D7N A;  2DOF A;  4L5E A;  4G94 A;  2KLO A;  1V5F A;  4L5J A;  4BH9 A;  2LBF A;  3CJN A;  4BUP A;  4KIC A;  5D8L B;  2X9D A;  5IPA A;  4P55 A;  1RRJ A;  2VJ5 A;  3T0Y A;  2DYR H;  4KDP A;  1VQ5 I;  4QWQ A;  2EFN A;  4G12 A;  2BYV E;  3WTZ A;  4CSW A;  3GWZ A;  3IKT A;  1R22 A;  5HLG A;  4B44 A;  3IAM 2;  3QPT A;  3KFW X;  3I4N J;  3ZMV A;  4B8X A;  3GLX A;  3K2A A;  4CXF A;  2QQB A;  1XDU A;  3GTL J;  4TV7 A;  3OYK A;  3E3V A;  4EM0 B;  2UUZ A;  4G7H F;  2IRF G;  2QBY A;  2BVM A;  3O2P E;  1W0T A;  2TCT A;  2ZB9 A;  3KIO A;  2DN0 A;  3JRD A;  4KT5 C;  1VQ9 I;  1E17 A;  2Y69 H;  3I3L A;  3HHH A;  2MLK A;  4OAY A;  2CQX A;  4G8X A;  2DYS H;  2GXA A;  1ZR2 A;  3ZQF A;  3KLO A;  4BYY A;  4JX5 A;  3QYF A;  1LDD A;  3F8F A;  1SFU A;  3PNY A;  3ZMZ A;  3W2W A;  3HKZ N;  2VPR A;  2HTJ A;  3U9G A;  5FLX K;  2EZI A;  4D1Q A;  1X4O A;  2HQA A;  1TW2 A;  2D2W A;  1J2X A;  5E1W A;  3HOT A;  4A6D A;  4DZJ A;  2Y2Z A;  4LMY A;  3GLL A;  4BQA A;  1JTY A;  5DCF A;  2EFW A;  2VN2 A;  3PFY A;  5E3O A;  3IL2 A;  3SJM A;  5F04 A;  2CQK A;  2H09 A;  4A3B J;  4KYW A;  3GZ5 A;  1MSE C;  3PM1 A;  3I56 I;  1ZQ3 P;  1IRX A;  1PP7 U;  5K5R A;  3RZO J;  3H36 A;  4A2U A;  1GT0 C;  1MJB A;  1P4X A;  4PJN A;  4YEL A;  1Z3Y A;  2IJL A;  4WF2 A;  1KYW A;  3VSK A;  2GIZ A;  3ZPL A;  1JKQ C;  2R7S A;  2VKH A;  5J4Y A;  2XAQ A;  3I4M J;  1WJA A;  3IH3 A;  2ZKZ A;  4E7H A;  3BJ6 A;  2AO9 A;  1BL0 A;  2F5V A;  3O8H A;  2A6H F;  4IPA A;  1YHQ I;  2XIG A;  4BEH A;  2BGC A;  2EIJ H;  2JA7 J;  5DDG A;  3RQ4 A;  4M3B A;  2QQ8 A;  2MA3 A;  2OZ6 A;  3LOC A;  3TDU C;  1HKT A;  3LAP A;  1IXS B;  5KNL A;  3T5X A;  5E8I A;  4N4N B;  1HW1 A;  2AQF A;  2XF7 A;  5D5V B;  2R7R A;  4BAC A;  3ISP A;  3WE3 A;  5J1Y A;  2MD5 A;  1MBF A;  2XAJ A;  1GXP A;  2UV1 A;  3JW4 A;  1AKH A;  1ZR4 A;  2IA0 A;  5C44 J;  5EG0 B;  2E1C A;  4IL6 C;  2DU9 A;  3LST A;  1TNT A;  2DQR A;  1IN6 A;  2HQR A;  4IQ4 A;  4ZDL A;  4BJT A;  2LOO A;  1AOY A;  1U8R A;  2P0W A;  3ZCO A;  1BJA A;  3DP7 A;  4JP0 A;  4BJ5 C;  4A3J J;  2ZSI B;  3F22 A;  3GTJ J;  1EH7 A;  2DOD A;  5ICC A;  1RC9 A;  2FJ1 A;  2XGX A;  4BE2 A;  3RKY A;  3K69 A;  1CQT A;  3CTA A;  2X1C A;  5TGT A;  3CUQ B;  2ZJQ F;  2XRL A;  1Z9C A;  2XB5 A;  1VQ6 I;  4LIT A;  4BBR J;  2LP0 A;  2X4H A;  3ERE D;  5K5Q A;  2R5Z B;  4ESB A;  4EAT A;  1UHW A;  1R58 A;  4KT6 A;  1NH3 A;  2HTS A;  1SEU A;  3H0D A;  3AG3 H;  2WAE A;  4AM3 A;  2DCE A;  4HG2 A;  4E6K G;  2AXL A;  4CZZ A;  3OYI A;  5M5W J;  5H2F C;  3HKZ A;  2E34 A;  1X1D A;  1ETX A;  3GX4 X;  1PUF B;  3JR9 A;  5CQG A;  4A3F J;  3WGH A;  1YO5 C;  2ESH A;  1MIJ A;  3GTO J;  4CUG A;  3ZOB A;  1K79 A;  2BHZ A;  3E5Q A;  3RQI A;  4YRV A;  5DYM A;  5HDK A;  2PMU A;  3L1P A;  1EA3 A;  4CCO A;  1LFP A;  2L7K A;  1QU3 A;  1ZAR A;  1SVO A;  3I64 A;  5F08 A;  1XMX A;  3GYH X;  1A5J A;  2VLA A;  2DOA A;  4XKB A;  2M34 A;  4Q4Z F;  1QGP A;  2IW5 A;  3F0C A;  1IV8 A;  3GTQ J;  2WB1 N;  2MFZ A;  2Z2S B;  4A0X A;  3RTR A;  2KPM A;  3A2K A;  4RAY A;  2IGN A;  4P5O A;  4XM3 A;  2QSF X;  3DBH B;  4IHV A;  5B1B H;  1HXD A;  1SFK A;  1K7A A;  1EV7 A;  1QQI A;  2EV6 A;  3UNG C;  1FIP A;  1D5V A;  2P8T A;  5LRS A;  1O3R A;  1NK2 P;  3KEO A;  1GHC A;  1MBJ A;  3AAF A;  2PX9 A;  4RA2 A;  2XPU A;  2LY2 A;  4MHG A;  5E3L A;  3C1D A;  4F93 B;  1BI2 A;  1BA5 A;  2IPQ X;  3CCS I;  2IGK A;  1QHH D;  4GDF A;  3RPU D;  4ESJ A;  1VQ7 I;  4IHW A;  2QSG X;  3F8B A;  2LYC A;  3PUB A;  1ZGA A;  3LWF A;  5IT9 K;  4YIR X;  1KU9 A;  3CLO A;  4UUT A;  4IHT A;  2AS5 F;  3H3U A;  5DV5 A;  4XRM A;  2QQA A;  3Q9S A;  4I2O A;  4LG0 B;  1FOY A;  1Z77 A;  3E6M A;  2MBF A;  5HNF A;  2IP2 A;  4UB8 C;  2E5Z A;  5LRR A;  4EQQ A;  4XMY A;  1QVU A;  2ZXH A;  2M7B A;  2XAS A;  2W84 A;  2FML A;  4BL0 B;  3FHZ A;  1AHD P;  3FDY A;  4PDK A;  2CQN A;  5IT3 A;  1SD4 A;  2VQC A;  2OU2 A;  3FWE A;  5IOZ A;  3QPH A;  3HOV J;  3RPU A;  2NS7 A;  2PG4 A;  3H5R A;  4F7Z A;  2JA8 J;  2ELK A;  3CME I;  3GTM J;  3BJA A;  4NDL A;  3L09 A;  2VKD A;  2MH9 A;  3KZZ A;  3CCE I;  1R6R A;  1XSX A;  2I5U A;  4XOR A;  2FEZ A;  4L9J A;  1RZ4 A;  2DTZ A;  2V26 A;  5J1R A;  4J19 A;  3PNV A;  3D5L A;  2HOT A;  2F6C A;  3GUD A;  4YFX F;  2VBW A;  1YOV B;  2VJ4 A;  4HOB A;  2LKX A;  5KK1 A;  2L9S A;  4N9H A;  2TDX A;  1R4N B;  4D9J A;  3FXL A;  2UXN A;  5JHU A;  2ELH A;  1XGS A;  2R92 J;  2F5D A;  2XKO A;  3FXJ A;  4O5V A;  4DW6 A;  1DQU A;  2LLK A;  2Y48 A;  2VOP A;  1Q1H A;  4BHB A;  2PMH A;  2KJB A;  3V8L A;  4X0G A;  2WB1 A;  2FE3 A;  1WWX A;  4NB5 A;  4CDG A;  1HDP A;  5C3E J;  2J5O A;  3OYD A;  4XK4 A;  2YX4 A;  1B6A A;  1SMY F;  1TQP A;  1V5G A;  2KIQ A;  5EJC A;  3F9K A;  1RI7 A;  1R71 A;  4Y52 J;  5KVR A;  3HM5 A;  4IOC F;  4OIQ F;  2P6S A;  2RNG A;  2VBX A;  3FXO A;  2V79 A;  1QZZ A;  4UVA A;  2P7V B;  2OBP A;  1XMA A;  1P4A A;  2KDO A;  2ID6 A;  2VQL A;  1G3S A;  4ON0 A;  1TT0 A;  3BR2 A;  1T0F A;  4KMU X;  3L00 A;  4XBF A;  1YJ9 I;  3FHN A;  4FX0 A;  1MBK A;  4Y7N J;  4XKW A;  4KIF A;  4XKV A;  2ID3 A;  3HOU J;  2OZU A;  3I71 A;  2P81 A;  4HEA 2;  3CD6 I;  1FIA A;  1Z91 A;  1BI1 A;  2ZFW A;  1B72 A;  2V1U A;  2ZME B;  2K7L A;  4HA8 A;  1TWC J;  5DD8 A;  9ANT A;  2QUF A;  2BEO A;  1E2X A;  1R1U A;  2MW8 A;  2X1D A;  4DYC A;  4KMF A;  4WX9 A;  3BR0 A;  2JA6 J;  4PSW A;  5ERI A;  3DXJ F;  1FTZ A;  1IJW C;  3A0B C;  3KP4 A;  2RV8 A;  4OIO F;  1LNW A;  3OS0 A;  3RSN A;  1LDK B;  3EET A;  1FMW A;  3HYI A;  3BR3 A;  1X2N A;  4PJ0 C;  1KQ8 A;  2CG4 A;  5IY5 H;  1VQ4 I;  5M5X J;  1MKM A;  3I54 A;  3BTL A;  1R23 A;  3OV8 A;  1OKR A;  3MVP A;  1DP3 A;  4OOI A;  1HW5 A;  3HOS A;  5AIQ A;  4NHJ A;  4PJL A;  3I58 A;  3R61 A;  2VJJ A;  1MD0 A;  3F21 A;  1ZRF A;  2PFB A;  2HU9 A;  1K4T A;  3RKW A;  2EWN A;  1UB9 A;  2NVX J;  2Z1D A;  2FBH A;  1P4W A;  2UXX A;  5H20 A;  5LBQ A;  5M5Y J;  2KFD A;  2MGQ A;  1RNL A;  3K4B A;  1XMK A;  1Y1V J;  3C18 A;  2Y75 A;  4PK4 A;  2VKE A;  5D5W B;  1NHA A;  1IV6 A;  2XB0 X;  3DPL C;  3K4K A;  5TIS C;  3TED A;  2HKO A;  2K40 A;  2KJC A;  2ZCW A;  4XLH A;  5CYV A;  3VYU B;  4S0H B;  2CO5 A;  5LGU A;  3OYM A;  1LEA A;  3E6D A;  4U0V A;  3ZXS A;  3CCL I;  1FBS A;  2K3P A;  2HYF A;  3KEQ A;  4OMY A;  3CO7 C;  2EV0 A;  4LB5 A;  2M8E A;  2K9L A;  4ESF A;  3BZC A;  1V3F A;  2E2H J;  2E5N A;  2E35 A;  2K02 A;  4DQ2 A;  4G6T B;  2V1D A;  1DPU A;  2LRD A;  3REO A;  3GFM A;  2YPR A;  1UEL B;  2XGD A;  4ENM A;  1YIO A;  2YSR A;  4A5N A;  2K4J A;  2AXT C;  1FOX A;  2VC1 A;  3TO9 A;  1WVR A;  2D45 A;  1FT9 A;  2HDW A;  3SEQ A;  1JGG A;  3H9G A;  2DMT A;  1E3P A;  2VOO A;  3AKZ A;  2F48 A;  4WK8 F;  2J5P A;  1I3A A;  2JRM A;  3FXU A;  3NRV A;  4A6E A;  2A61 A;  4ZC3 A;  2E7X A;  2JQ7 A;  3NEU A;  3HUG B;  1OCZ H;  4MEY F;  4S05 A;  3KP5 A;  3GZ6 A;  3IHU A;  3ZRG A;  4RM2 A;  3KPH A;  4BXU A;  3F8C A;  4UHT A;  1VQP I;  2PJP A;  3AFH A;  2FNP A;  1O7F A;  2JK3 A;  3V7R A;  2PQ8 A;  1K4S A;  3TGN A;  5M3F J;  2X51 A;  2I8D A;  2BV6 A;  3DU5 A;  3KP6 A;  3HG9 A;  3J7Z I;  1R9T J;  1QPI A;  3GTG J;  1S7O A;  2DFH A;  2NAZ A;  2RDP A;  2H94 A;  2O5R A;  1K6O A;  2H8W A;  3K4N A;  1B1B A;  3OYE A;  2LVS A;  2VIX A;  3C7J A;  1ZG5 A;  2C6Y A;  2VL8 A;  2DDB A;  3HZJ A;  3N97 A;  1EF4 A;  3OSG A;  2DDA A;  2VI6 A;  3BC8 A;  2K9S A;  3UKG A;  2OC6 A;  4EJO A;  3L7W A;  2X0L A;  2EJR A;  2R7D A;  3H35 A;  4U0Y A;  1J9I A;  1TWF J;  4L5I A;  2KQR A;  3MZH A;  1YX3 A;  1YQA A;  4HPQ A;  4U87 A;  4ZZL A;  1ZH5 A;  2KRC A;  3GTP J;  3EPZ A;  2PBI A;  2R7U A;  2FMY A;  4BQQ A;  2FBI A;  3J80 Z;  4N0B A;  2R0Q C;  4E7I A;  3LSI A;  4OWR B;  1XD7 A;  2HYJ A;  5CQE A;  5AON A;  1AU7 A;  4PZJ A;  4FQG A;  5F0H A;  5E3M A;  3ERM A;  2HVR A;  5GPC A;  3K4J A;  2P5V A;  4P1W A;  3ZQQ A;  5F1J A;  1X1A A;  3LMM A;  3E6B A;  1N78 A;  3DBR B;  4HST A;  3QWL A;  1FYK A;  4NQW B;  4Q48 A;  3LQR A;  2YS9 A;  5J6X A;  1D3Y A;  2VBZ A;  5LEK A;  4OU0 A;  3TL4 X;  3J7Y J;  3K4C A;  4XLF A;  3OYH A;  2F5F A;  2V9K A;  5KHD A;  1QNT A;  2WY7 Q;  4A93 J;  4QPO A;  2NS8 A;  2BVL A;  2DA2 A;  4RM3 A;  1X2M A;  4E7S A;  2EB7 A;  1XG1 A;  1LB2 A;  2L7Z A;  1EKE A;  4XQF A;  1GXQ A;  1XB4 A;  4XLP F;  1UHM A;  1W7P D;  1FBU A;  5J1U A;  5DS9 A;  4C2U A;  1X19 A;  1R1V A;  2QBY B;  1QZY A;  3O8G A;  4GGG A;  2FQ4 A;  5CVR A;  5FB2 A;  3K1N A;  1ZN2 A;  3FMR A;  1FZP B;  3WE2 A;  2PLY A;  1M1E B;  1MND A;  1VQN I;  1U5T C;  4PCQ A;  4I0B A;  4RAF A;  1OYW A;  4CYD A;  2IS2 A;  4LFU A;  1SVL A;  1ZHF A;  2W00 A;  1S7E A;  2E60 A;  3WGI A;  1RET A;  2ME6 A;  1O57 A;  4FET A;  4V19 K;  1SAN A;  2E2J J;  1OR7 C;  4LG3 A;  3ZQ7 A;  4HF2 A;  4PUS A;  5EEH A;  1JKP C;  5F0C A;  4KA4 A;  4JOM A;  3ML6 A;  1KON A;  1MMA A;  1S6L A;  1W7P A;  3FKJ A;  3IKV A;  3R60 A;  3WU0 A;  2F2E A;  2QCO A;  5F1R A;  5E3N A;  1S8N A;  1D8K A;  2EZL A;  3S3O A;  2OCC H;  1YS6 A;  1YYV A;  2Z3Y A;  4Q47 A;  3VDX A;  3BT9 A;  1UST A;  5GTH C;  3LL7 A;  1HBX G;  2DJI A;  4BKX A;  1WJC A;  2XF6 A;  2DXI A;  3JRG A;  1LFB A;  1K61 A;  1FEX A;  1YRN A;  1MMG A;  4MIM A;  4A5M A;  1OLT A;  4I76 A;  5LFA A;  1W0U A;  4ETS A;  3KYD B;  2FUG 2;  1N25 A;  2ZJP F;  1F43 A;  4IHS A;  3K1M A;  3DTI A;  2BY2 A;  2CUZ A;  1YW7 A;  4F91 B;  2ECC A;  2V9V A;  3ZN0 A;  2DFI A;  4E7Z A;  4L9N A;  1BIB A;  4HX7 A;  1IDY A;  1I50 J;  1VTN C;  1MDM B;  4ZDP A;  4FTH A;  3RYR A;  2AQE A;  2Q1Z B;  3FM3 A;  2W24 A;  1FC3 A;  3CC4 I;  3Q0V A;  2CS3 A;  2XHK A;  3HOX J;  4CIC A;  3JRI A;  3FXM A;  3V8J A;  3LSM A;  3A03 A;  2KRH A;  5TRD A;  4ZTF A;  1GDT A;  4XRS G;  4C2T A;  2Y0M A;  1U5T A;  4G9Y A;  5HDG A;  1TQM A;  2CYY A;  4BHP A;  4WWC A;  4DOZ A;  2H6C A;  1U6G A;  1TT5 B;  2HDD A;  2HGC A;  1GVJ A;  5CKT A;  1LE8 A;  5JI6 A;  1KGS A;  4HV5 A;  4XN3 A;  4HBL A;  1OR7 A;  1P6R A;  3CDI A;  1BC8 C;  2A5W A;  4ENN A;  5IYB J;  2M8G X;  3P7N A;  2R5Y A;  5J4V A;  1MBE A;  3OSF A;  2CV1 A;  5C4X J;  4ANJ A;  4QTR A;  1R4M B;  3HGY A;  2A6E F;  1O3T A;  3C2G A;  1BM9 A;  4A0Y A;  3S17 J;  1RR7 A;  2VXZ A;  2ACJ A;  1VFC A;  2GIV A;  3ABU A;  1IAW A;  1WI9 A;  3K2Z A;  5DEQ A;  1JKO C;  4WCG A;  3VYR B;  1XTA A;  3OYC A;  2W82 A;  2YX7 A;  2ZBK A;  2LY9 A;  4I0A A;  5FD6 A;  3CCR I;  4CA0 A;  3PIP F;  2W1O A;  4MQ9 F;  2BHY A;  5D4R A;  3WTS C;  1V4R A;  3QAH A;  1QVT A;  3CJR B;  3G1O A;  1ERD A;  2ZC2 A;  4QLC U;  4MGR A;  1ON1 A;  3VB2 A;  3S8P A;  4BDZ A;  3G2B A;  1GUU A;  2G9W A;  4HQE A;  3DQV C;  2V6E A;  2LFB A;  4HSR A;  2DFF A;  3E1S A;  2K9Q A;  2WY8 Q;  2Y9Y A;  4ABZ A;  1BW5 A;  4E70 A;  2A05 A;  4I01 A;  2STW A;  3FIW A;  3FK7 A;  2VAS A;  3RCO A;  5DM6 F;  2ZXI A;  2EPF A;  2OJE D;  4IZZ A;  2Q2E B;  4XLE A;  4I6Z A;  3CCM I;  5E79 C;  2NYX A;  4LD5 A;  1ZLJ A;  2EFO A;  1SFE A;  2KKO A;  3TO6 A;  2M2E A;  5K7Z A;  4OAZ A;  3TOA A;  3JRH A;  3G6E I;  1FOW A;  1BR1 A;  5K1Y A;  4RGU A;  2OF7 A;  3WTU C;  1GV2 A;  1MW7 A;  3FF5 A;  4M74 A;  2X1E A;  3D5S C;  2TRT A;  1BI3 A;  1D5Y A;  3ZN1 A;  3M9A A;  5JFR A;  1L0O C;  2VKV A;  4I99 C;  1YFH A;  1ETW A;  2R7V A;  1HLV A;  2HQ5 A;  1Z3X A;  2K9N A;  4XID A;  3LSH A;  2E7W A;  3NQO A;  1MH4 A;  1U9N A;  2LTP A;  4GYG A;  4ENJ A;  2H27 A;  1Z1D A;  3FBI B;  3HOY J;  3VWB A;  2GXB A;  3GVA A;  4XOP A;  3FKI J;  4WXH A;  1YX5 A;  3HEF A;  5JVG F;  1MZB A;  3L9F A;  4V2G A;  5E8G A;  3HL2 A;  1NK3 P;  4DYR A;  4G7O F;  4F92 B;  2WAD A;  2DOE A;  1ZGJ A;  5BS6 A;  1T98 A;  2MAB A;  4DGW B;  1B9N A;  4A3M J;  1VND A;  4LJZ F;  1Z7U A;  1FP2 A;  3OYB A;  1G6N A;  1AWC A;  2BXY A;  1IUY A;  1K6Y A;  3JAM Z;  3DEU A;  2IGM A;  3E5U A;  3SDB A;  1MNM C;  2RGV A;  4FIS A;  4BHC A;  4UB6 C;  1W1W E;  3H9J A;  3KCC A;  4A3D J;  4GYI A;  4D0P A;  4M9Z A;  1XSD A;  3K4M A;  1PUE E;  2XSJ C;  4CCL A;  3H3V K;  3IH2 A;  5JLX A;  2NXN B;  1ZLK A;  4H0E A;  3OIP A;  2WA0 A;  3TQN A;  3H5N A;  1CF7 A;  3QOP A;  2XRO A;  1XSV A;  2V1X A;  2ICW G;  2X48 A;  3TW7 A;  4PSX A;  1DU0 A;  4CCN A;  3K70 C;  3GW2 A;  3QPS A;  1IF1 A;  3JSP A;  3IWF A;  5HLH A;  1BJZ A;  5GAH J;  2KZG A;  2OUM A;  2ZNY A;  1D0Y A;  2CUJ A;  4O3M A;  3F8N A;  3VOE A;  1Y8Q B;  2CW0 F;  2JRT A;  3BR1 A;  2M3A A;  3ECO A;  4CO8 A;  1Y0U A;  3MWM A;  4LOC A;  3CZ6 A;  3SFZ A;  1VQ8 I;  3I55 I;  2HZD A;  5FKL A;  3ROU A;  3CO6 C;  5ICE A;  3U1D A;  3GZN B;  3CUQ C;  2L5Q A;  2M30 A;  4R1H A;  4XSZ F;  3OY9 A;  1RIO H;  5CVV A;  1MJ9 A;  1BN5 A;  4DIQ A;  2YU3 A;  2QSH X;  3K9T A;  2KIF A;  4E7K A;  5IP6 A;  1K78 B;  2OTL I;  3C2H A;  1ITY A;  4HNU A;  4G6Q A;  1VQL I;  1H0M A;  1W4M A;  2COM A;  1B59 A;  2DT7 B;  4XRS A;  5J8F A;  5LHG A;  3COA C;  3LFK A;  4P9U A;  4K2E A;  3H5A A;  4S04 A;  3E7L A;  3DWL E;  3MD2 A;  3KX2 A;  5IOY A;  3Q0U A;  1WSU A;  2D5V A;  3IP4 B;  4Y15 A;  1DP7 P;  1IDZ A;  3MCZ A;  5HLT A;  3I53 A;  4EJU A;  3BOQ A;  1D0Z A;  4UVB A;  2Q0O A;  2L02 A;  1XCV A;  3M1C A;  3V7S A;  2QLZ A;  2ZNZ A;  2Y0S N;  2GLO A;  1G3W A;  1YS7 A;  1OMI A;  4F3Q A;  1B72 B;  2JUG A;  2L54 A;  5E18 F;  3A0H C;  3K6G A;  3BTJ A;  2DLL A;  3DBL B;  1PJR A;  1U2W A;  4YG2 F;  2LC2 A;  5EEG A;  1YTY A;  1YLF A;  2M87 A;  2DI3 A;  4M3E A;  1JUM A;  3I9V 2;  1UG0 A;  3C2B A;  2FA5 A;  3TKY A;  2XAG A;  3OMY A;  2JWT A;  4XLA A;  4YFK F;  2XRN A;  5A2Q Z;  1R5I D;  1FSE A;  3A01 B;  3CF2 A;  1JT0 A;  2VQH A;  5ILV A;  2R7X A;  4KIT B;  1A6Q A;  4ZTJ A;  5EG0 A;  1I5Z A;  5F27 A;  2ZXJ A;  3LQQ A;  2YR2 A;  3BDD A;  5FFZ A;  3T1B A;  3J7A Y;  2WAQ N;  4W1U A;  2LRE A;  3AG2 H;  2HI3 A;  3HGG A;  3J81 Z;  4KIB A;  1XN7 A;  2HYG D;  2LKP A;  2Z16 A;  5FO5 A;  1I1S A;  5DCM B;  4ZYE A;  3LSJ A;  3WTX C;  3WTW C;  1E3O C;  3CUQ A;  1LJ9 A;  3PO2 J;  1X1P A;  2R7W A;  2VPL A;  3GEZ A;  2R5Z A;  4O6J A;  5TJJ A;  4UUS B;  2PJR B;  5D5X B;  2GBY A;  1TWA J;  4CCK A;  1Z6R A;  3DV8 A;  5GAG J;  2EA4 A;  2VUM J;  1LEB A;  1RUN A;  4Y17 A;  4ZYH A;  3IAS 2;  2VC0 A;  3K0L A;  1G3Y A;  2P5K A;  1SD5 A;  3RKX A;  3S2W A;  1YE9 A;  4E4H A;  3RJP A;  1TWG J;  1Z6T A;  3VYS B;  1D8J A;  3SYT A;  1PUF A;  3WU1 B;  3S15 J;  1Z21 A;  2NVY J;  2KP6 A;  4XSX F;  3OL3 A;  5IYD J;  1XGN A;  5D4S A;  2QF7 A;  4HAM A;  3S1M J;  3BZK A;  2A6T A;  2QYO A;  1TQI A;  1HST A;  1Z05 A;  1FMV A;  4AID A;  2K86 A;  1JGS A;  1R5G A;  5ED4 A;  4Z6Y A;  1SAX A;  4C9Y A;  4HDV A;  1IN7 A;  3HRM A;  3T8R A;  2M45 A;  2FXA A;  1KU2 A;  3IH4 A;  5CJ9 A;  1R49 A;  3BR5 A;  2GQQ A;  1FX7 A;  2Y0S A;  1T56 A;  3E0J B;  4F52 A;  2R7O A;  3TBI A;  4UXN A;  2P5L C;  1BC7 C;  4L0Y B;  2Y9Z A;  3ULQ B;  4BQN A;  1WPK A;  5FKK A;  2BZT A;  3S93 A;  4AWX B;  5LGT A;  5EDN A;  2CFO A;  1ENH A;  1NG7 A;  4XN0 A;  2PI0 A;  3ZMD A;  2IVM A;  4QPQ A;  3HTU A;  2BW3 B;  3AG4 H;  4MQV A;  3IUO A;  1F4K A;  3CLQ A;  1LUJ B;  1V54 H;  3DTK A;  4BNC A;  1FNN A;  1A04 A;  3BZ6 A;  1U9O A;  1QRY A;  3FXK A;  3HPH A;  5B3S H;  2LD5 A;  3S16 J;  2GXG A;  4KUM A;  3IRQ A;  2UZK A;  1FYM A;  3S1Q J;  2WAQ A;  2LG4 A;  2LDU A;  5BOX A;  2EFQ A;  1SMT A;  4A3G J;  1SFX A;  3CQZ J;  1XDS A;  1FPQ A;  3HOZ J;  2Q8K A;  3DU6 A;  2OQR A;  2P6T A;  2F4I A;  4C3J J;  1LDJ A;  1OIS A;  3OOP A;  2NS0 A;  2X6X A;  3L2Q A;  4M3D A;  3CMY A;  4II2 A;  3S2D J;  4L9T A;  2M4G A;  3ZMU A;  4EMS A;  3HXL A;  1Z0X A;  4GXO A;  1Y56 A;  1KU7 A;  4MTD A;  3W6J B;  2BE5 F;  2ZME C;  1O3Q A;  3GBG A;  2MD0 A;  5F0F A;  1JTX A;  3DEE A;  4N9I A;  2W57 A;  2QVO A;  3CMM A;  4RBO A;  1W5S A;  2R7F A;  3BQZ A;  1L3L A;  1X3Z B;  4CCJ A;  1MMD A;  3HPG A;  4XOT A;  2GOM A;  3NAU A;  1FBQ A;  2M0C A;  2NVQ J;  2JJ7 A;  2VE9 A;  2XVC A;  3JRF A;  3E5X A;  3A4C A;  1NG6 A;  2IEK A;  3MMY B;  3Q0W A;  4MFE A;  3Q5F A;  2CQQ A;  2RAE A;  4YIF A;  3QYB A;  1TZL A;  2IBD A;  4IHY A;  2K85 A;  4HLY A;  5D6E A;  3TO7 A;  2E2I J;  1MSF C;  3CC7 I;  1B8I B;  1VQM I;  4XIC A;  1S72 I;  2WV0 A;  4DBR A;  4ENK A;  1OCC H;  4C30 A;  1K83 J;  1MMS A;  1MJA A;  4NUB A;  2DA6 A;  3TP3 A;  5HLI A; 
#chains in the Genus database with same CATH homology
 2L7M P;  1AKH A;  1ZR4 A;  3BT9 A;  5C44 J;  5EG0 B;  3M3Y J;  4BKX A;  3BQY A;  2JMW A;  1LFB A;  3JRG A;  1K61 A;  1FEX A;  1ETY A;  5EEA A;  1JJ6 C;  1YRN A;  3LSG A;  4MIM A;  4JP0 A;  2MSY A;  4A3J J;  4I76 A;  3ZQL A;  3BG9 A;  1H89 C;  3DEW A;  3GTJ J;  1W0U A;  1XC5 A;  2FJ1 A;  4D5F A;  4EEF G;  1F43 A;  2HXI A;  1CQT A;  2XRL A;  2XB5 A;  2EZH A;  5FLM J;  1NTC A;  4BBR J;  2LP0 A;  2ECC A;  4RDU A;  1O4X A;  2R5Z B;  1ZGW A;  2PMZ N;  2DMP A;  3B6A A;  2HOS A;  2GM4 A;  1IDY A;  1I50 J;  1VF9 A;  4FTH A;  1WH7 A;  4X1E A;  2L7F P;  2W48 A;  3Q0V A;  3HOX J;  2XPW A;  3JRI A;  5M5W J;  2OPT A;  1Y1W J;  3A03 A;  5IP9 J;  1GDT A;  1ETX A;  4XRS G;  2JA5 J;  3FIS A;  3RKQ A;  1PUF B;  3JR9 A;  4A3F J;  3GTO J;  1U8B A;  1UHS A;  3ZOB A;  2HDD A;  3JRC A;  3RQI A;  4X6A J;  1LE8 A;  2FD5 A;  3L1P A;  3ZQC A;  5F08 A;  5IYB J;  3ZQG A;  4DYQ A;  2M8G X;  1A5J A;  2R5Y A;  1MBE A;  1MBH A;  3OSF A;  2DA1 A;  1HF0 A;  2ME0 A;  5C4X J;  2M34 A;  3FK6 A;  3HGY A;  2DMQ A;  3VPR A;  4AC0 A;  4QTR A;  1OCT C;  3F0C A;  3QPL A;  3GTQ J;  2WB1 N;  4B3A A;  2Y31 A;  3OOU A;  3S17 J;  1RR7 A;  1VFC A;  3ZQH A;  1H88 C;  1JKO C;  1IGN A;  4JX6 A;  2LY9 A;  4IHV A;  3SFI A;  2AHQ A;  1JJ8 C;  3S14 J;  1FIP A;  1IRZ A;  3A01 A;  2Y30 A;  1NK2 P;  1QVT A;  3G1O A;  1MBJ A;  1HOM A;  2O8K A;  2XPU A;  5E3L A;  4A3E J;  1IUF A;  3GTK J;  1GUU A;  2X6O A;  4AYB N;  3BTI A;  5K7F A;  2HXO A;  3S1R J;  1SFO J;  1BA5 A;  5EGO A;  1POG A;  2LFB A;  4IHW A;  2K9Q A;  3B6C A;  2Y9Y A;  5FLV A;  4ABZ A;  1BW5 A;  3HB9 A;  4UUT A;  4D5C A;  3G1M A;  4XRM A;  3FK7 A;  3FIW A;  3NAR A;  1Z77 A;  1RKT A;  4I6Z A;  2EQR A;  3S1N J;  1QVU A;  4MLO A;  2DMN A;  4UUS A;  2XSD C;  2M2E A;  2JN6 A;  5K7Z A;  1AHD P;  1JUP A;  1DU6 A;  3JRH A;  2OF7 A;  1GV2 A;  5M3M J;  1JKR C;  2TRT A;  5IOZ A;  1D5Y A;  5EGO B;  3HOV J;  1WGX A;  2NS7 A;  3TW6 A;  2JA8 J;  2VKV A;  2ELK A;  1HCR A;  1ETW A;  2KDZ A;  3GTM J;  4V2F A;  1HLV A;  1RKW A;  4B1R A;  2HQ5 A;  2K9N A;  4NDL A;  4XID A;  1MH4 A;  1U9N A;  2LTP A;  3M4O J;  3HOY J;  3MKL A;  5J1R A;  4DZP A;  2DTZ A;  3FKI J;  2XGC A;  1HDD C;  4J19 A;  1GVD A;  3HEF A;  4V2G A;  1NK3 P;  2HOT A;  2EH3 A;  4DYR A;  1LFU P;  2LKX A;  2E19 A;  4A3M J;  1ZTR A;  1VND A;  5K7H A;  3JRB A;  3JRE A;  5HOD A;  1A6I A;  1WCM J;  2R92 J;  4DW6 A;  2LLK A;  2HOA A;  5EF6 A;  4A3K J;  2NVT J;  1MNM C;  4FIS A;  3BG3 A;  3CCY A;  1HDP A;  5C3E J;  3WHB A;  1AKH B;  4M3F A;  4A3D J;  4XK4 A;  5DTD A;  2ECB A;  1VI0 A;  4A3L J;  3H3V K;  3IH2 A;  2M9H A;  5JLX A;  4HNV A;  4Y52 J;  3HM5 A;  1ZK8 A;  1T33 A;  1YRN B;  2DA3 A;  2X48 A;  3TW7 A;  1DU0 A;  2ID6 A;  4BY1 J;  2B63 J;  3QPS A;  4BXX J;  1BJZ A;  2YUS A;  1P7I A;  3BR2 A;  1Q1V A;  4MO7 A;  1UMQ A;  3HDD A;  1U78 A;  3K7A J;  4Y7N J;  2LK2 A;  1MBK A;  3BR1 A;  3H0G J;  1WI3 A;  2ID3 A;  3HOU J;  1P7J A;  2CJJ A;  4LOC A;  5GP9 A;  1FJL A;  2P81 A;  3MN2 A;  5FKL A;  1WH5 A;  1FIA A;  3TP0 A;  1B72 A;  2CRG A;  2XPV A;  2R7Z J;  4D7M A;  1RES A;  1TWC J;  9ANT A;  5BNG A;  1ITY A;  5IP6 A;  2MW8 A;  4DYC A;  3BR0 A;  2JA6 J;  2O9L A;  1FTZ A;  1IJW C;  4XRS A;  3OIO A;  2DA7 A;  3E7L A;  3BG5 A;  5IOY A;  3Q0U A;  2D5V A;  5GPA A;  3BR3 A;  5FJ8 J;  1X2N A;  1LE8 B;  3RZD J;  1G2H A;  2L9R A;  1IDZ A;  5M5X J;  1BW6 A;  3BTL A;  3HOW J;  3MVP A;  2R5Y B;  3IV5 A;  2Y0S N;  3W6V A;  2GLO A;  2EBI A;  2DMU A;  5J3L A;  3JRA A;  1B72 B;  1GV5 A;  3BTJ A;  2NVX J;  1B8I A;  4CYC A;  5M5Y J;  1F36 A;  2MGQ A;  3LSP A;  1ETO A;  1JUM A;  4M3E A;  1Y1V J;  3C2B A;  2VKE A;  4JYK A;  2COB A;  2JWT A;  3A01 B;  1IV6 A;  2XB0 X;  3TED A;  3BR6 A;  1UG2 A;  1JT0 A;  2K40 A;  2IAI A;  4S0H B;  4B4C A;  4C2M J;  2E1O A;  1H8A C;  2N8G A;  5EG0 A;  1ETQ A;  5F27 A;  3CDL A;  2O7O A;  4AUX A;  2NOG A;  5IYC J;  2WAQ N;  4W1U A;  1ETK A;  2HI3 A;  3HGG A;  2E2H J;  4BBS J;  4C3I J;  2XGD A;  3LSJ A;  2LR8 A;  2CU7 A;  1OFC X;  4FE4 A;  1E3O C;  4IHX A;  1JGG A;  3PO2 J;  2DMT A;  4QIW N;  5EYR A;  4A69 C;  4CYC B;  5C4J J;  4IEJ A;  2R5Z A;  2XGE A;  1RPW A;  1MBG A;  4UUS B;  2L0K A;  2FX0 A;  2GBY A;  2R93 J;  1I3Q J;  1TWA J;  2CUE A;  2VUM J;  3SDG A;  1X58 A;  2JK3 A;  1ORK A;  1TWG J;  4GFB A;  5M3F J;  1PUF A;  2H8R A;  3S15 J;  2DJN A;  2NVY J;  5EZH A;  1R9T J;  1XS9 A;  1QPI A;  3GTG J;  5IP7 J;  2H1K A;  5IYD J;  4JX4 A;  1JT6 A;  3A02 A;  3BTC A;  3PO3 J;  2QF7 A;  1APL C;  3S1M J;  2LVS A;  5FKN A;  4M3G A;  1TC3 C;  5JLW A;  1EF4 A;  3OSG A;  2VI6 A;  3UKG A;  2K9S A;  2MG4 A;  2KT0 A;  4QSH A;  4D7N A;  4L5E A;  3IH4 A;  1TWF J;  3S2H J;  3BR5 A;  2EZK A;  2X9D A;  5IPA A;  4MFD A;  1T56 A;  3GTP J;  4W97 A;  4G12 A;  2Y9Z A;  1WPK A;  5FKK A;  5EDN A;  2R0Q C;  1JUS A;  2HYJ A;  3I4N J;  1AU7 A;  1ENH A;  5F0H A;  3K2A A;  5E3M A;  3DCF A;  5GPC A;  5FKO A;  3GTL J;  5EZG A;  2CUF A;  2DA5 A;  1FTT A;  2I10 A;  1MH3 A;  5F1J A;  1W0T A;  2TCT A;  2ZB9 A;  4FCY A;  2DN0 A;  3JRD A;  1U9O A;  1QRY A;  3HBL A;  2LD5 A;  3S16 J;  2YS9 A;  3LNQ A;  3S1Q J;  2CQX A;  3ZQI A;  1IG7 A;  1ZR2 A;  3ZQF A;  4A3G J;  3CQZ J;  4JX5 A;  1I6H J;  3HOZ J;  3D1N I;  3HKZ N;  2VPR A;  4FE7 A;  4C3J J;  2EZI A;  4A93 J;  2NS8 A;  2G0E A;  4DZJ A;  2DA2 A;  4M3D A;  2Y2Z A;  1X2M A;  3CMY A;  1XG1 A;  3LSR A;  1JTY A;  2L7Z A;  3S2D J;  1OCP A;  1Z0X A;  5E3O A;  3SJM A;  5F04 A;  3WHC A;  4A3B J;  1MSE C;  5J1U A;  5DS9 A;  4A3C J;  3GBG A;  3PM1 A;  1ZQ3 P;  5FKM A;  3O8G A;  1JTX A;  5F0F A;  3RZO J;  2DA4 A;  2FQ4 A;  1GT0 C;  3QQA A;  4RBO A;  3BQZ A;  1OJL A;  1JKQ C;  3NAU A;  3I4M J;  2M0C A;  3IH3 A;  2NVQ J;  2JJ7 A;  2YU9 J;  1TWH J;  2AO9 A;  1S7E A;  3JRF A;  1BL0 A;  3O8H A;  2IEK A;  1RET A;  2WV1 A;  3Q0W A;  2ME6 A;  4MFE A;  1IC8 A;  2CQQ A;  4M6V A;  4BY7 J;  2JA7 J;  1SAN A;  2RAE A;  4M3B A;  2E2J J;  3LOC A;  2IBD A;  4IHY A;  2E2I J;  1MSF C;  1JKP C;  1B8I B;  5F0C A;  4C3H J;  4XIC A;  1ETV A;  5J1Y A;  1K83 J;  1MBF A;  2QCO A;  5E3N A;  3Q3S A;  4A3I J;  1ZKG A;  2EZL A;  3G1L A;  2DA6 A;  3TP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...