2P7CB

Solution structure of the bacillus licheniformis blai monomeric form in complex with the blap half-operator.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESDYIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Strand 1 of Twelve base-pair DNA
publication title Conformational and thermodynamic changes of the repressor/DNA operator complex upon monomerization shed new light on regulation mechanisms of bacterial resistance against beta-lactam antibiotics.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p7cB00
3SZPA 5LBQA 3JSPA 1Z6TA 2VBZA 4L5JA 5D5VB 2L54A 2MLGA 2XUBA 3C18A 3IC7A 1L3LA 2KJBA 2PI0A 3HIFA 5DCMA 2BEOA 2D1VA 4HLXA 3LSTA 3F22A 2OA4A 1OR7A 5D5UB 3QP5A 1TBXA 1E2XA 4WF2A 1PDNC 1BIAA 4A12A 1T2KA 3O3KA 3QP6A 1SD5A 4HA8A 3ZMDA 2UXNA 2COMA 4ZYGA 3LA3A 4L9JA 1TW3A 2QQ9A 2K27A 3RJPA 4YFXF 3HYIA 1MDMA 5JVTA 4IXAA 4HDVA 1BC8C 6PAXA 3J7AO 2JZYA 1I6XA 1GHCA 3WTZA 2DW4A 4ENJA 2YPRA 5LEKA 3TO7A 1KU9A 1STZA 2XKOA 2H94A 3OV8A 2J5PA 4MQVA 2GXBA 3REOA 2A68F 2FE3A 2XROA 1MD0A 1QBJA 4U7DA 5CVUA 2HS5A 3GFJA 3U1DA 4S05A 4Q5SF 1CF7A 3IHUA 4DQ2A 3FMQA 2OZUA 4LK1F 1K79A 2L01A 3C7JA 5D6EA 3HTUA 1D8KA 2JPBA 5HLGA 3IRRA 1SD4A 5L3EA 2ACJA 3ZMUA 4IPAA 1J7KA 4M71A 5H6RA 3Q9SA 1XB4A 3E5QA 4UXNA 2IP2A 4OIQF 2LF8A 3PQJA 1FBQA 3GFIA 3T8TA 4BYYA 2EB7A 2NRAC 2MLKA 4M72A 3GFLA 1IW7F 1QQIA 1XSVA 3F3XA 1ZRCA 4CYDA 3LFKA 3WGGA 1IN8A 3E5UA 1ZRDA 2W84A 2WV0A 3I54A 4I0AA 1TNTA 2VBYA 1S3JA 1YIOA 3CLOA 4Y17A 3CJNA 4M6YA 2KIFA 3GXOA 5IT3A 2HKOA 1WI9A 2DAOA 1FP1D 1UFMA 4EM1A 3JTHA 2L4MA 1JHFA 1IXCA 1XD7A 2V1DA 1U5TA 1KU7A 2NNNA 5HS7A 5K5QA 5D8LB 3WTXC 4ZZDA 1YS7A 4GGGA 3B02A 1WQ2A 4LJZF 2FBIA 1P4AA 1RIOH 1LJ9A 4RAYA 2FF4A 3ZN1A 2EK5A 4BQAA 1S7OA 2FSWA 4BNCA 1T39A 1B1BA 2Y0MA 1F1ZA 3BROA 5TRDA 5ICFA 3ZPLA 1B9MA 4LMYA 2KJCA 3V8KA 4AIHA 3KEOA 1G4DA 2XV4S 3L09A 2HYGD 2RQPA 2GIVA 3ML6A 5EEHA 3JW4A 3QPHA 2DO7A 2V79A 5CVIA 3OOPA 4U88A 2AXLA 5IT9Z 2DI3A 2VODA 2XAFA 3H3UA 3F72A 2OD5A 3FXQA 4MGRA 4B8XA 2PJPA 2QQBA 1GXQA 3MFKA 4BHCA 1HQCA 5CVVA 1RNLA 5LGUA 3RI4A 1P6RA 2GXGA 2STWA 3P9IA 4HAMA 3HHGA 5CLSA 1XMKA 2YU3A 1G3TA 1K78A 2W24A 2NS0A 3R4KA 4HLYA 4KDPA 1KU2A 3TGNA 3KP6A 5DD4A 1HBXG 1FYMA 3FHZA 4N9IA 3TO9A 2G7UA 3B73A 4JBAA 1R1VA 2XASA 3MZHA 3HOTA 3F6VA 1AWCA 1YTYA 3WODF 1S6LA 2PN6A 1T6SA 1SD7A 1ZG1A 2AS5F 4Y13A 1T38A 4HF2A 4P96A 1I1GA 1DUXC 4YIIA 5K5RA 2EJRA 1LEAA 1BC7C 1MZBA 2FMLA 1WWXA 2ZKZA 3LA7A 3T0YA 2VOOA 4L0ZB 1KU3A 3G3ZA 2FQ3A 1ZRFA 2KKOA 2ISZA 3MAJA 3S2WA 3MZYA 4ENKA 3L7WA 4G9YA 1S7AA 3IRQA 2G7HA 4OIRF 2O8XA 5E17F 1BOAA 2KIUA 5E8IA 1WSUA 1YW7A 3CO6C 2XRNA 2C6YA 1B9NA 4EM2A 1RI7A 4FX0A 2QWWA 4A0ZA 3TOAA 1HSJA 3R61A 1BIBA 1LDJA 1FSHA 2ESHA 1W5SA 4I98B 4WXDA 5A2QK 4Y15A 4ZH4F 1DPRA 2VT2A 2FOKA 1HW5A 1HXDA 2A69F 2HQNA 1SFEA 1IF1A 4KIGA 2LNBA 3VFZA 5FD5A 4I09A 2G9WA 3NQOA 1ZG3A 1WKMA 1AOYA 4EJOA 1C0WA 2XKPA 2Z33A 4RGSA 3NEUA 4CGZA 1FPQA 3PFIA 3DFGA 3WU1B 1JGSA 3RYPA 1XDUA 1MJBA 4BXUA 5DDGA 1IUYA 1ZHFA 4HOBA 3F8BA 5LGNA 1PUEE 1W7PB 3ISPA 3MCZA 4G94A 3VB2A 4LG0A 4IHSA 1XDSA 1O7FA 1EV7A 1F4KA 1P92A 1MGTA 1TW2A 2L4AA 3K0LA 2K02A 2EV5A 4A5MA 2FU4A 4G7OF 3SFZA 2GAUA 4HW0A 5LRRA 1FBSA 4KYWA 2XAHA 3G73A 4AD9A 1A04A 1JHHA 2IA1A 4ESFA 3SZTA 4RB2C 4CHUA 1KA8A 3TOBA 2Z5UA 4QLCU 3K1MA 2H27A 1ZAOA 1VTNC 5ED4A 1TLHB 2ZXJA 3SXYA 3E6CC 2EFWA 4MNUA 3KLOA 4IF4A 3C3WA 4HX7A 3T5XA 4I7HA 4U0WA 5JR3A 3KE2A 3FXUA 1S29A 4H0EA 2DBBA 3EDPA 2E1NA 5AIPA 4MEYF 3HHHA 2ADUA 4G7HF 3WTUC 2M30A 4L9NA 2H09A 2DK5A 4R79A 1LDDA 3LAPA 4YFKF 1DPUA 1TQPA 2WC2A 2ZO4A 2ESNA 3GX4X 5F1RA 4D0PA 4WX9A 4UUVA 2RVCA 2JRTA 3FZVA 1XGOA 4CICA 5D4RA 4UV9A 3J81Z 4P55A 3CUQC 3BY6A 2ZNYA 4PGHA 4WK8F 3HOSA 3GYHX 1USSA 4IRGA 1IN6A 1F9NA 5BS6A 3T8RA 4ENNA 4KNYA 2Q8KA 5L3FA 2YX7A 4L18B 3RDIA 2VXZA 4EMSA 2CWEA 4HBLA 3KP2A 2IA2A 5HVQC 3W6JB 4OINF 4RGUA 2Y48A 2ZMEB 3HRUA 4QWQA 1O57A 2K4JA 4HDUA 2Y75A 2PBIA 3KP5A 2X4HA 3LQRA 1XSDA 2ETHA 3DF8A 4LFUA 4ZYHA 2HFHA 2DTRA 2Z99A 3F6OA 3H92A 3I59B 1G3WA 1MKMA 2O03A 5FD6A 2VONA 5ILVA 3CTAA 1H9GA 5D5XB 1TTYA 3F8CA 3J81K 4HF1A 2A61A 2FNPA 2B0LA 2M5WA 1BI3A 2F5FA 1W7PD 3R0JA 5L3CA 3ERED 4MHGA 3EUHA 3TO6A 4KFCA 1XN7A 2ISYA 4KIFA 5E1WA 3GWZA 1G6NA 1OMIA 4KT5C 1ZGAA 1SFXA 3BJOA 3ECOA 4KICA 1EH6A 3V7RA 4U0VA 3L9FA 2GZWA 4GYGA 3TDUC 3N97A 5LRSA 5HDKA 3CDHA 1QO0D 2VT3A 3R60A 2E7XA 5ICGA 2XVCA 2BBYA 4PZJA 3F8NA 4EVIA 3ZMVA 1BI0A 1ZLJA 2EFNA 2HYFA 4AVPA 2EFPA 3V8JA 3ZN0A 2HDCA 4ZYEA 3F8MA 3KP7A 4M74A 5D6FA 2KIMA 4KN7X 5K1YA 3TDZC 2F2EA 3ZMZA 4RB0A 4KA4A 3IKVA 2GA1A 2RDPA 3HUGA 4LGWA 1NHAA 1FX7A 5HOOA 3M1EA 4A0YA 3U2RA 3GFMA 1P4WA 1USTA 3BPXA 3KP3A 1FP2A 4EJUA 2IRFG 1S8NA 4HV6A 4GYIA 3RKYA 1XMAA 1OYWA 3HSFA 2QZ8A 1PP8F 1OPCA 3DEUA 1ONVA 2CO5A 3WU0A 2D2WA 3KLNA 3JSOA 3GF2A 3GVAA 2HWVA 4EQQA 1YO5C 2HR3A 3MWMA 5D4SA 1V3FA 2RKHA 2YR2A 3DV8A 1FYLA 2XIGA 3JAMZ 2PFBA 2DLLA 1PP7U 2LSOA 2V1XA 3MQ0A 1K78B 3PQKA 3M9AA 2BYVE 1FC3A 5FFXA 3QOPA 2UZKA 4EJWA 1ZYRF 4M9XA 4UNOA 1QPMA 1OYIA 2XHKA 1FYKA 2P7CB 1R23A 2PEXA 1SMTA 4UHTA 2QENA 1D5VA 1UCRA 5FLXZ 4A6EA 3RTRA 1U3EM 4WXCA 4UVCA 5D8KB 2CGPA 2XGXA 4ETSA 1RUOA 1HSTA 1U5TC 4HX8A 4XBFA 4OMZA 2L02A 3QRFF 1SD6A 4O3MA 4PCQA 1J2XA 1UB9A 1IRGA 5HDGA 3F21A 4MTEA 2M87A 2MBFA 2VBXA 4EJVA 3I0TA 2NAZA 5IT9K 1KQ0A 2W85A 1IN4A 2YX4A 2QBYA 3FM3A 2LF7A 2XAQA 4M73A 4MTDA 4P5OA 4CDGA 1HW2A 5BOXA 2HTJA 2QQAA 1J0RA 5K5OA 1W5TA 4BHPA 1B6AA 5J6XA 3FWEA 3HRSA 2PQ8A 1SMYF 4IRIA 3WE3A 4EJTA 1KYWA 4P9FA 4FHTA 1R22A 1QNTA 1WRJA 4IJAA 1RZ4A 4LK0F 3P9CA 3VEPA 2R7FA 5FLXK 2F5DA 3WTTC 4GO1A 3J80Z 1DP7P 3HTSB 2DQLA 1IN5A 3QU6A 3M8EA 5CYVA 1I5ZA 1DDNA 1FZPB 3GW2A 3D0SA 2RN7A 1O3RA 2JPCA 3NRVA 3IKTA 1TQIA 1LQ1A 3DXJF 4EGYA 1LEBA 3R0AA 2CG4A 3QAHA 4OU0A 5E18F 4KN4X 3ECHA 1U2WA 1QZZA 2BGCA 4G7ZF 4AIKA 3D5LA 2VN2A 3RPUA 2PMHA 4EGZA 2PMUA 3CUQB 1R7JA 1I1SA 1QGPA 3LQQA 2L3DA 2OQRA 2E7WA 4RGXA 4G6DA 2D1HA 1BJAA 2R7DA 5DCFA 4L5IA 2H6BA 4JQFA 1U6GA 2P6TA 3CUOA 2TDXA 3TQNA 2P4WA 4ON0A 1YG2A 2VE9A 3IWZA 4LD5A 1ULYA 4ESBA 3C1DA 2Q2EA 1W7PA 2DT5A 5E1XA 3HRMA 1J9IA 2BE5F 1BN5A 4O5VA 4XSXF 2OQGA 2RC4A 5AIQA 5F6FA 3F23A 1JXSA 3V7SA 2EFQA 1XCBA 3BJAA 3GO5A 5E20A 2STTA 3QU3A 1SFUA 5F64A 3RIRA 5ICCA 5H20A 4IHTA 2QLZA 5LHHA 3LAJA 1EH8A 4FT8A 1KQ9A 2XAGA 2MH9A 5LEJA 3RYRA 1B59A 3WGHA 2V1UA 1FY7A 3GEZA 3U9GA 3BDDA 5DCMB 3WTSC 2EA2A 1OKRA 2ELHA 4U0YA 3ABUA 2LDUA 2IPQX 5ILSA 2LKPA 3LWFA 1Z9CA 2ZBKA 1LB2A 3DPLC 1GXPA 4ESJA 3TKYA 1IZ1A 4I02A 4LLNA 1R00A 4XSZF 5E1ZB 5KVRA 3KETA 2DK8A 3SQNA 5L3GA 1Z7UA 4O6JA 4HQEA 2HGCA 2QYOA 1MDMB 3N4MA 3ZMTA 4L9TA 3DQVC 1XCVA 1FT9A 3KZZA 3COAC 1QZYA 2EWNA 3M8FA 1SAXA 2O61A 4LB6B 3KEQA 2HKXA 3K9TA 2FXAA 4DNCA 1KYZA 1FLIA 2F5CA 5HLHA 4MEXF 1O7LA 1XGMA 3DP7A 1MJAA 1GVJA 3ZP5A 5LHGA 4RGRA 1ZLKA 2ZJ2A 1ZN2A 2RV8A 5FB2A 3I64A 3WTWC 3FMRA 5BMZA 3I5UA 2PLYA 1P2FA 1IXRC 2CFXA 1J5YA 1FWZA 1HW1A 3KCCA 4GCVA 1ZGJA 1BM9A 3EYIA 4ENMA 5CVJA 4R8HA 3VODA 3I53A 2HTSA 2MC3A 2D45A 2FNAA 2ZMEA 2VOPA 2FRHA 3EYYA 2V6CA 3BPVA 1CF7B 1BI1A 2IW5A 1B4AA 2K86A 4Q48A 2JT1A 3FF5A 3I71A 1L0OC 1IAWA 5E8GA 1R1UA 1TNSA 1Z91A 3FXRA 3ZMSA 5ERIA 3I59A 4JK1X 3EETA 4ASNA 2GQQA 2O3FA 1BBYA 3KFWX 1XGSA 1LNWA 4IRHA 2K4BA 3SHFA 3ROUA 4M9SA 2XAJA 1IRFA 4WCGA 3IL2A 3ULQB 1P4XA 5CJ9A 4OIPF 1W4MA 5DV5A 3T1BA 1T98A 2MH2A 4K2EA 4KUMA 5LGTA 2NNYA 4A2UA 2Z3YA 2HEOA 4S04A 2M8EA 5HDNA 5BPIA 2HOEA 2FBKA 2GA2A 2Z9OA 4ZYDA 2A3SA 4HF0A 1EH7A 2DFIA 4ZZLA 3AAFA 5JFRA 1U78A 4KMFA 2YSRA 3BP8A 5KK1A 2NYXA 5FFZA 1Y0UA 3E6DA 3E5XA 1ZG5A 2P5LC 2DQRA 1U5TB 1LDKB 3P9KA 2W57A 3Q5FA 3GZ5A 2DU9A 5HS9A 4A6DA 1YFHA 1HKSA 3FM5A 5AONA 4YFNF 2R3SA 1ZH5A 1X3UA 3O2PE 2IVMA 2P6SA 3K69A 4UVAA 4LB5A 2DPUA 1ON1A 4HZFA 5HLIA 2CYYA 5J8FA 2VE8A 1I27A 1OYYA 2IJLA 2MA3A 4NHJA 4RB3C 2FA5A 1R5HA 1T0FA 2P5VA 3WTYC 5DD8A 2FBHA 1KQ8A 3L00A 4B09A 2W25A 1YS6A 3HSEA 2VBWA 2JSCA 1U8RA 4L9VA 3E3VA 4HQMA 1YW8A 2V9VA 5H6QA 3K1PA 5HS8A 2HZTA 4I2OA 1Q1HA 2O6GE 4P9UA 1J75A 4I01A 1R5GA 4G6QA 2EV0A 2JTVA 2F5EA 2EV6A 1ZREA 3CO7C 1BI2A 4RAZA 5JI6A 1ON2A 4NB5A 4CO8A 4EV0A 3EQLF 1R58A 2J5OA 5DEQA 3F8FA 3LA2A 2OBPA 1Z05A 2P8TA 4CXFA 4Z2YA 3BOQA 4L0YB 4CZZA 1ODDA 2EFOA 3ELKA 4XLNF 4HYEA 3KP4A 2E1CA 3ABTA 3RKWA 3GUDA 2WWYA 1Z6RA 4OOIA 4R1HA 3BJ6A 1FSEA 2Q0OA 5BPDA 2HQRA 2FMYA 3V4GA 5DUKA 4PGGA 3V8LA 3K2ZA 2QBYB 1LVAA 3M7GA 2IT0A 2OU2A 4BH9A 3L2CA 1XSXA 3RKXA 1H0MA 4Q4ZF 4EM0B 2IA0A 3WE2A 3WGIA 2KRFA 3JAMK 3H3ZA 1UHMA 1K6OA 4N0BA 3VOEA 3GLXA 3R6SA 4KMUX 1REPC 4WWCA 3FX3A 1YYVA 5A2QZ 2CQKA 2FEZA 2CSOA 2PG4A 1YQAA 2QM3A 3DKWA 1UHWA 5JHUA 4MQ9F 1O3QA 2UXXA 2GWRA 1FOKA 5ILUA 4KIBA 4OMYA 3ZQ7A 4FX4A 4UV8A 2P7VB 3DPTA 2M1BA 3RPQA 2RNJA 5LLQA 5L3DA 5EEGA 3JTGA 4OIOF 1R1TA 4TV7A 5TJJA 5FO5A 5FGMA 1JE8A 3W6KB 2O0YA 2ZNZA 5DYMA 5J8CA 2A6HF 4LLGF 4UVBA 1XGNA 2ZFWA 4XRFA 3E6BA 3P7NA 2WTEA 1HKQA 4WXHA 2CW0F 4RB1A 3V7CA 1V4RA 1IXSB 4LG0B 4YG2F 3HSRA 1E17A 5CVRA 1H9TA 2K7LA 3E6MA 2OZ6A 1FBUA 4AWXB 3FMSA 4M6XA 3E97A 1KGSA 1F5TA 2P5KA 4NQWA 3J80K 1D8JA 5L3BA 4PDKA 2DPDA 3Q9VA 4F7ZA 3GZ6A 2M45A 1IN7A 2VC0A 1TQMA 1HKTA 3I58A 4HV5A 3CUQA 2QUFA 3I4PA 2ZCWA 3KZYA 4U7BA 1FNNA 4YIFA 3QPTA 4XLPF 2A07F 4E70A 1CGPA 4N9HA 1YLFA 5LHIA 1O3TA 4IVNA 4GXOA 2H6CA 1YW9A 3O6BB 2RGVA 1Z1DA 1D3YA 4A0XA 1ZARA 2A6EF 2BV6A 4G8XA 4AIJA 1MJ9A 2A5YB 1J59A 5BQTA 2VC1A 3BWGA 1K7AA 2MD5A 2EA4A 3WG9A 4I0BA 4RS8A 1G3SA 3WTVC 1RUNA 3MEXA 4Q47A 1O3SA 3K1NA 3HRTA 1R36A 2QVOA 3IWFA 2UWMA 4M9ZA 2OAZA 4BHBA 5DUIA 1G3YA 3BZ6A 5D5WB 5ICEA 4A5NA 2X0LA 4BAYA 4HX4A 4LLLA
chains in the Genus database with same CATH superfamily
2L7ZA 3SZPA 1VQLI 5LBQA 3JSPA 1Z6TA 1VQMI 4C3HJ 2VBZA 4L5JA 4LIVA 1IO2A 5D5VB 1YITI 1D1CA 1D5YA 2L54A 2MLGA 2XUBA 5EG0A 2NVYJ 2JUCA 4XMYA 2AQFA 3C18A 3MMYB 5C3EJ 3IC7A 1L3LA 2KJBA 2PI0A 3HIFA 5DCMA 2BEOA 2D1VA 1YRNB 4ZTFA 4DYCA 3ZRGA 4A3LJ 1ERDA 4B48A 4A3DJ 3A0HC 2NVUB 1ETKA 1D0ZA 4HLXA 3LSTA 3F22A 1MSFC 1D1AA 2OA4A 1OR7A 5D5UB 3QP5A 2F4MB 3H0GJ 5B5EC 3JRIA 1Z77A 3NARA 1TBXA 2BVLA 1E2XA 3ESWB 4WF2A 2OTLI 4F55A 1PDNC 1BIAA 4NC7A 3KX2A 1JGGA 1MSEC 3BT9A 2QKMB 4A12A 1T2KA 3O3KA 3J7ZI 3OR1C 3QP6A 3QYBA 1SD5A 4HA8A 1A36A 3ZMDA 2DJNA 4XIDA 2UXNA 2I5UA 3PIPF 2COMA 1M1EB 1N77A 4ZYGA 3JCUC 1MBFA 3AL0B 3LA3A 1MBGA 4L9JA 1TW3A 2QQ9A 2IBDA 2K27A 1UELB 2KIQA 3CJRB 4PFPA 1OCTC 3E0JB 3RJPA 3BG5A 4YFXF 3TEDA 3HYIA 1MDMA 4QPQA 5JVTA 3KIOA 4IXAA 2E60A 4KT6A 4HDVA 1BC8C 6PAXA 1WI3A 3J7AO 2JZYA 2L7KA 4OAZA 1ZGWA 1I6XA 1T8IA 1GHCA 1HLVA 3WTZA 2DW4A 4ENJA 1TWGJ 2YPRA 2EQRA 1DU0A 1OCZH 2LKXA 3A03A 3K4BA 1ETWA 3HB9A 2V26A 1ACIA 1R9TJ 4PFOA 1FEXA 4M3DA 2AHQA 2HI3A 5HODA 5LEKA 4IZZA 4BY7J 5K7FA 4E7KA 3TO7A 2VUMJ 1KU9A 1STZA 1YHQI 3M8JA 2XKOA 2CFOA 2H94A 2Y9YA 2K9MA 1RETA 2DN0A 1B72A 3OV8A 1XX5A 2J5PA 1IRZA 5EJCA 1MBHA 2IGMA 3BTIA 4MQVA 4XLEA 1MMGA 2GXBA 3REOA 2A68F 2OCEA 2CW8A 3BTCA 2DYSH 2FE3A 1Y1WJ 2XROA 1MD0A 4F52A 2LK2A 1QBJA 4DYQA 1S72I 2ZJQF 4U7DA 2LY2A 5HNFA 5CVUA 2HS5A 2JRMA 3GFJA 1X1CA 2VJIA 3U1DA 5E3MA 1HF0A 1POGA 4S05A 4BDZA 4DW6A 1CQTA 4ABZA 2ECBA 4Q5SF 1CF7A 3IHUA 4DQ2A 3FMQA 2OZUA 4LK1F 1K79A 2L01A 3C7JA 2DT7B 5D6EA 3HTUA 2DA5A 1D8KA 2JPBA 5HLGA 3IRRA 3S1RJ 2DDBA 1RESA 2TRTA 4EEFG 1SD4A 5L3EA 4I76A 2ACJA 4Y33A 5F27A 3WHCA 3ZMUA 4BQQA 4IPAA 1OR7C 1J7KA 4BJ5C 4M71A 5H6RA 2DA4A 4XLFA 1XPXA 3Q9SA 4PJLA 1XB4A 3E5QA 3A02A 4UXNA 1QU3A 2IP2A 4OIQF 1OLTA 2LF8A 2HXIA 2NVXJ 3PQJA 5FJ8J 1FBQA 3GFIA 2JA6J 1WJCA 1Z0XA 3T8TA 2EB7A 4BYYA 4XRMA 2XSDC 2NRAC 4J19A 2MLKA 4M72A 3GFLA 1FOYA 1MH3A 1IW7F 1QQIA 2E1MB 2YUSA 2EH3A 1XSVA 3F3XA 1Z3YA 3S93A 1ETQA 1ZRCA 2OF7A 4CYDA 4UY8I 4DOZA 3LFKA 1AU7A 3QODA 5FRNA 1K6YA 3HUGB 3JRDA 2G0EA 3WGGA 2EBIA 2FD5A 4A3BJ 1GVDA 1IN8A 3E5UA 2B7EA 1ZRDA 2W84A 4XKVA 1QRYA 2WV0A 3I54A 3S3OA 3OS2A 1JT6A 4I0AA 1TNTA 4V19K 2VBYA 3FK6A 2VKDA 2WAFA 1S3JA 1P7JA 1YIOA 3CLOA 4Y17A 1ETYA 5IP6A 3FXKA 3CJNA 4M6YA 2M0CA 2KIFA 3GXOA 5IT3A 2WB1A 2HKOA 1WI9A 2CH0A 4HNVA 2DAOA 1FP1D 1UFMA 4EM1A 1WJDA 3QQAA 3JTHA 3SFIA 3EPZA 2L4MA 1JHFA 1IXCA 1XD7A 1MNEA 2V1DA 4BS9A 1U5TA 1KU7A 3HBLA 2NNNA 5HS7A 2LOOA 3KYCB 5D8LB 5K5QA 5C4JJ 1E0EA 1AKHA 3JRHA 2ECCA 3WTXC 2LRDA 4ZZDA 1YS7A 2R7WA 2NVTJ 3FDYA 4GGGA 3LNQA 3B02A 1SVOA 1WQ2A 4LJZF 5M5XJ 1VQ8I 1YJWI 2DJIA 2VJ5A 2FBIA 1P4AA 1RIOH 1D0YA 2XGEA 1LJ9A 4RAYA 2FF4A 3ZN1A 4IHYA 2EK5A 2ELJA 4BQAA 5C44J 1BOBA 1S7OA 2FSWA 2LC2A 4BNCA 1T39A 1I3QJ 3M1CA 1ZELA 4B4CA 3EUAA 1B1BA 1NTCA 2Y0MA 4PK4A 1GDTA 4LIUA 3OL4A 1F1ZA 3G1OA 4CYCA 3BROA 5TRDA 5ICFA 5GTIC 3BR3A 3ZPLA 5B1BH 1B9MA 4LMYA 2KJCA 3V8KA 4AIHA 1A31A 3KEOA 2V4JC 2BHYA 1Y39A 2DA2A 1G4DA 2XV4S 3Q0VA 4BGDA 2JSPA 2K5CA 2CUJA 4B47A 3L09A 3FBIB 4DGWB 2HYGD 5LD2C 2RQPA 3MKZA 3N05A 1K61A 2GIVA 3ZQFA 3ML6A 5EEHA 3JW4A 2Z16A 4PJ0C 3QPHA 4DIQA 4C2TA 2DO7A 3BC8A 2V79A 5CVIA 3MKLA 3K7AJ 2L9VA 3OOPA 4YIRX 1TC3C 4PSWA 4U88A 4XLAA 2AXLA 5IT9Z 2DI3A 2X1EA 2VODA 1T95A 2XAFA 1Y56A 2CW7A 4D7MA 1W0TA 1LUJB 3H3UA 3L2VA 1EA3A 4ZDLA 3PSFA 3F72A 2OD5A 5HLTA 3PUFA 1W36C 3FXQA 4MGRA 4B8XA 2PJPA 2QQBA 1GXQA 3MFKA 4BHCA 1HQCA 2WBMA 1XMXA 5CVVA 2CJJA 2VPLA 1RNLA 3QOEA 5LGUA 2E34A 4E7LA 3ZQIA 3RI4A 3I9V2 3CC7I 1P6RA 2GXGA 3HJEA 2STWA 3P9IA 4HAMA 3OYEA 4D9JA 3HHGA 2FX0A 5CLSA 1XMKA 3ZQQA 2YU3A 1G3TA 1K78A 2W24A 2NS0A 2KZVA 2R7SA 3R4KA 4HLYA 4KDPA 2IS1A 2OPTA 4IQJA 1A35A 3ZQGA 2IXSA 1KU2A 3DTEA 2PMZA 2ZXIA 3TGNA 3JR9A 3KP6A 5DD4A 1HBXG 4CCMA 1FYMA 2JVGA 2LREA 3FHZA 4N9IA 4XN0A 2R5YA 2P81A 3TO9A 2G7UA 4Y3OA 2OCCH 3B73A 5IYBJ 2LMDA 1R1VA 2VIXA 2XASA 3BCBA 4JBAA 2R0QC 3HOTA 3MZHA 1K83J 3P5JA 5FROA 2QEXI 1RC9A 3F6VA 2Y69H 1AWCA 1JKOC 1HA8A 3S8PA 4FE4A 2CV0A 2X1DA 5GPCA 5EDNA 1YTYA 3WODF 3K70D 1JUMA 1S6LA 2FJ1A 2PN6A 2CV1A 1T6SA 1SD7A 3H3VK 2I10A 2IGNA 1MNMC 4FISA 1B8IB 1LFBA 1ZG1A 4PSXA 2AS5F 4IKFA 3HM5A 1A6IA 4Y13A 1T38A 2KMUA 3M3YJ 3CDLA 4QPOA 4XKCA 1I1GA 4P96A 3OYAA 2QA4I 1NH3A 1VF9A 4IOCF 1DUXC 4IHXA 3HZJA 1OFCX 1X1AA 4YIIA 5K5RA 3LSPA 2EJRA 1LEAA 1BC7C 1JUSA 1MZBA 1SFOJ 2HU9A 2FMLA 1WWXA 3AG4H 3MD2A 2ZKZA 1W36D 3LA7A 4W97A 3DU6A 3T0YA 1TZLA 2JA2A 2Z2SB 4L0ZB 2VOOA 3RSNA 1KU3A 3G3ZA 1WHUA 4AYBA 2R5ZA 3GTPJ 3GTMJ 2DOFA 1H8AC 2FQ3A 1ZRFA 2KKOA 2ISZA 2KPMA 3MAJA 3S2WA 1YI2I 3MZYA 2XPUA 2QSGX 1TP4A 2Y0SN 4PJNA 2MGQA 3L7WA 4ENKA 4G9YA 1S7AA 3IRQA 1JT0A 1LKXA 2G7HA 3OMYA 2V9PA 4OIRF 1ITYA 5EGOB 2L9SA 2O8XA 5E17F 4PJJA 4XNFA 1BOAA 2KIUA 1K4SA 5E8IA 1WSUA 1YW7A 2BW3B 2L5QA 2XRNA 1OCPA 3CO6C 4BJ6C 2C6YA 4XKBA 5FKMA 1B9NA 4EM2A 2BY1A 1YJ9I 1HC8A 2KT0A 1RI7A 4FX0A 5DS9A 2HQ5A 4BUPA 2QWWA 4A0ZA 2LTPA 3TOAA 5IOZA 1HSJA 3KPHA 2RAEA 1MIJA 3R61A 2VL8A 1BIBA 1LDJA 1FSHA 2ESHA 1W5SA 4I98B 4WXDA 1QPIA 2IGOA 4Y15A 5GP9A 5A2QK 3CC2I 1F36A 4ZH4F 1DPRA 1YX5A 2VT2A 4XONA 2FOKA 1HW5A 1RRJA 2CQNA 4KJZA 1HXDA 2A69F 4XRSA 2HQNA 1SFEA 4DBQA 1IF1A 1F43A 4KIGA 3OR2C 2LNBA 4CZCA 3VFZA 2DMNA 5FD5A 1IC8A 4I09A 1I50J 2BY3A 2G9WA 3BG6A 3H9JA 2M4GA 3NQOA 3ZQHA 1ZG3A 1WKMA 1AOYA 4EJOA 1C0WA 2XKPA 3OL3A 2LY1A 2Z33A 4RGSA 3NEUA 3UR3C 4CGZA 1FPQA 3BTJA 4NC8A 3B6CA 3PFIA 3DFGA 5FKLA 3OYJA 1ZQ3P 1X1PA 3WU1B 1JGSA 3RYPA 1UHSA 1XDUA 2EZLA 4W1UA 3HKZN 2VKHA 1RR8C 3CMMA 1MJBA 1Z67A 4BXUA 5DDGA 1IUYA 1ZHFA 4XN3A 5J40A 3DCFA 2DA1A 4HOBA 2R7VA 3F8BA 5LGNA 1PUEE 2Q2EB 1W7PB 4FE7A 3ISPA 3MCZA 2L9NA 4G94A 4LG0A 3VB2A 4D1QA 4IHSA 2WAQA 1XDSA 4ITVA 5GTHC 1O7FA 5JHFA 1EV7A 4EATA 1P92A 1MGTA 1F4KA 1TW2A 1FMVA 3OYIA 2L4AA 3K0LA 3HPGA 2K02A 2EV5A 4A3KJ 4A5MA 2FU4A 4DBRA 4M3GA 2E2HJ 2DCEA 1T33A 4IHVA 4G7OF 3SFZA 1S9HA 2GAUA 3ZXSA 2VQHA 4HW0A 3PSIA 9ANTA 4KISA 5LRRA 1FBSA 4KYWA 3W3CA 2ID3A 1PUFA 1UG0A 3IH4A 1TT0A 2X1CA 3PNTA 2XAHA 1V5FA 3G73A 4AD9A 1A04A 1JHHA 2IA1A 4F91B 4ZDOA 4ESFA 3SZTA 1H89C 1QA6A 1EKEA 4HNUA 2M0MA 4RB2C 3CD6I 4CHUA 2M7AA 1KA8A 3TOBA 2Z5UA 4QLCU 4GFBA 3ERMA 1WGXA 3K1MA 4M3FA 1MBKA 3PNYA 1ZAOA 2H27A 3AG1H 5GAGJ 1VI0A 4BXFA 5ED4A 4MFEA 1VTNC 4C2MJ 3IH2A 3IUOA 1TLHB 4DJAA 2ZXJA 3SXYA 3E6CC 2EFWA 1X2NA 3DWLE 3KLOA 4MNUA 4IF4A 3FK7A 1OISA 3C3WA 3HXLA 4HX7A 3PL8A 4HPQA 3T5XA 4I7HA 4U0WA 4LITA 2JQ7A 5JR3A 3KE2A 3FXUA 1S29A 1JKPC 5M3FJ 4H0EA 2LVSA 3QYEA 2R4GA 2DBBA 3EDPA 4BDYA 3H5NA 3QPSA 2E1NA 1WJAA 1N78A 2E19A 3A4CA 5AIPA 3RQ4A 4MEYF 3HHHA 4XM3A 2ADUA 3WU2C 4G7HF 4MIMA 3WTUC 2M30A 3S17J 3I56I 3CC4I 2ZXHA 1WVRA 4L9NA 2H09A 3HEFA 2DYRH 2O9LA 2DMUA 2DK5A 4R79A 1FOWA 1LDDA 3FXMA 4LOCA 3LAPA 3D1NI 4YFKF 1DPUA 1VQKI 4Y52J 3VWBA 1TQPA 5FKKA 4D5FA 2OJED 4P1WA 3A01A 1EJ9A 2DA3A 2WC2A 2ZO4A 2DXIA 5GAHJ 4BBRJ 1VQ4I 2ESNA 3GX4X 5F1RA 4D0PA 5F0CA 4WX9A 2QF7A 1TWCJ 4IL6C 4E6KG 4UUVA 2RVCA 3VSLA 2JRTA 2VQLA 3FZVA 1BR2A 1XGOA 2PJRB 4CICA 2KRHA 5D4RA 4UV9A 2JWTA 3J81Z 3BG3A 4P55A 3CUQC 2V7FA 4XLHA 3GMEA 3BY6A 2ZNYA 4PGHA 4WK8F 3NWSA 2LH9A 1P9QC 4RAGA 3HOSA 3GYHX 2B9SA 2DOAA 2WB1N 2X6XA 3IV5A 1USSA 1YRNA 4IRGA 1IN6A 1W1WE 1F9NA 4XQFA 3F9KA 3T8RA 5BS6A 4ENNA 4KNYA 2CRGA 2Q8KA 5L3FA 2YX7A 4L18B 1VQ6I 2TCTA 2VXDA 3RDIA 1IJWC 2VXZA 3HPHA 2MG4A 3CDIA 1MBEA 4EMSA 2CWEA 4HBLA 3CCMI 2EIMH 4N4NB 3CCVI 1Y8RB 3KP2A 4A69C 3RCOA 4F92B 5FLMJ 2IA2A 5HVQC 3W6JB 4OINF 4RGUA 2Y48A 2ZMEB 5C4XJ 2QSHX 3HRUA 4QWQA 3CP2A 1O57A 3RPUD 2VKEA 2K4JA 4HDUA 1O4XA 1VQ7I 2Y75A 3NWTA 2PBIA 3KP5A 2X4HA 3BZKA 3LQRA 1XSDA 1LFPA 2ETHA 3DF8A 1RKWA 2DMTA 4LFUA 4ZYHA 2HFHA 1E3HA 2DTRA 2Z99A 3F6OA 3H92A 3I59B 1G3WA 3VSKA 1MKMA 3I4MJ 2A05A 2O03A 5FD6A 1VZ0A 2VONA 3CLQA 5ILVA 3CTAA 1U9NA 2X6OA 1H9GA 4RAFA 5D5XB 1TTYA 3F8CA 3J81K 4HF1A 4J00A 4NDLA 2O7OA 2A61A 2FNPA 3S3NA 1GV2A 1SC7A 4IEJA 1I39A 2B0LA 2E35A 3BLYA 4MFDA 4GRIA 2BY0A 4A3JJ 2M5WA 5M5YJ 1BI3A 2K3PA 4JX4A 2ZJPF 2VKVA 4ZDPA 4V2FA 1UMQA 2F5FA 4OWRB 1W7PD 3Q0UA 3V42A 5J47A 3R0JA 5L3CA 3K4NA 2CQQA 1E3PA 4M6VA 1TL8A 3ERED 4MHGA 2K3FA 3EUHA 3TO6A 4KFCA 1XN7A 2ISYA 4KIFA 3PJRA 5E1WA 2MFZA 3HDDA 3GWZA 1G6NA 3E7LA 5E3OA 1OMIA 4KT5C 2AXTC 1ZGAA 2KRCA 1S7EA 2B63J 1SFXA 3WHBA 3BJOA 3ECOA 4KICA 4BE2A 3W2AA 1JKQC 1EH6A 2V9KA 1BW5A 3V7RA 4U0VA 4G6TB 3L9FA 4UUSA 3CCLI 3I55I 2GZWA 4GYGA 2VJ4A 3TDUC 3TBIA 2VQGA 1IDZA 3S1MJ 1D0XA 3KYDB 5HDKA 5LRSA 3CDHA 3N97A 1QO0D 1WJEA 2L7MP 1JUPA 3FKIJ 3S1NJ 2VT3A 3R60A 4OAYA 2E7XA 5E3LA 1TWAJ 5ICGA 2XVCA 2BZTA 2EIJH 2BBYA 1WJFA 4CCNA 5J4YA 3CP8A 4PZJA 3S3MA 4FASD 1YE9A 2OC6A 3BR2A 3F8NA 4I99C 4EVIA 3ZMVA 1BI0A 4RM3A 2M2EA 1MMSA 1ZLJA 2EFNA 2HYFA 2VB6A 4AVPA 2EFPA 2LBFB 3V8JA 2ZSHB 4XLCA 2VI6A 4NNJA 3ZN0A 4AU7A 2HDCA 4ZYEA 3HOVJ 4LG3A 3M4OJ 3K6GA 4II3A 3F8MA 2M4KA 1S5LC 3KP7A 3A2KA 4M74A 1Y8QB 1YOVB 5D6FA 3OYHA 2KIMA 4KN7X 5K1YA 3TDZC 2F2EA 3ZMZA 4RB0A 4CUGA 4KA4A 3IKVA 2R7XA 2GA1A 1WPKA 1D1BA 2HXOA 2RDPA 4XR6A 3HUGA 4LGWA 1NHAA 1FX7A 3ONQA 2GXAA 5HOOA 3GTKJ 3M1EA 4A0YA 3I3LA 4FTHA 1WCMJ 1APLC 2HDDA 2CUEA 3LSRA 5F04A 3U2RA 2QSFX 3GFMA 1P4WA 4KITB 1USTA 4BY1J 4H4KC 1X1DA 5DM7F 3BPXA 3KP3A 4BL0B 3PO2J 1FP2A 2K9NA 2OUMA 2HPMA 4AIDA 4EJUA 2IRFG 1X1BA 2BVMA 4AM3A 3VYRB 1X2MA 3MZ8A 1S8NA 5J1UA 4HV6A 2Z1DA 4AVZA 4GYIA 2ZFUA 3H5RA 3RKYA 1XMAA 3RZOJ 1OYWA 3GLLA 3B6AA 2BHZA 3HSFA 2HVQA 2QZ8A 3EUHC 1PP8F 1P7IA 1OPCA 3DEUA 1ONVA 3GTLJ 3GTGJ 1ETOA 2CO5A 1UG2A 4BEHA 2XAUA 4C2UA 1Z3XA 3BCAA 2DA6A 3WU0A 2D2WA 3KLNA 3JSOA 3GF2A 4B44A 2LY9A 3GVAA 1EF4A 2HWVA 2QQ8A 3FKJA 4EQQA 1YO5C 2HR3A 3CCYA 3MWMA 4B43A 5K7ZA 3G6EI 2V6EA 3OY9A 5D4SA 1V3FA 2DOEA 1IV6A 4CCKA 3G1LA 1VQ9I 4HSTA 2R92J 2RKHA 3L2RA 2YR2A 3DV8A 1FYLA 3PO3J 2VJJA 2XIGA 3DLLF 3SZGA 3JAMZ 1QHGA 1XTAA 2PFBA 2WY8Q 1Z7LA 2DLLA 1PP7U 2LSOA 2V1XA 1SVLA 3HGGA 3MQ0A 1K78B 5E3NA 2R93J 3PQKA 3M9AA 2I8DA 1J09A 2BYVE 2QKLB 3C2GA 1FC3A 5FFXA 2JK3A 3QOPA 2UZKA 3AG3H 3TL4X 4EJWA 4HEA2 1ZYRF 1BA5A 4M9XA 2LP0A 1ORKA 4UNOA 3J7AY 1QPMA 1OYIA 2XHKA 2A6TA 1FYKA 2P7CB 1R23A 2PEXA 3S16J 3C2HA 1SMTA 2E1MC 2R5YB 2HZDA 5CKTA 2R7UA 4UHTA 2E1OA 2QENA 1D5VA 4JOMA 1UCRA 3H9GA 5FLXZ 3BG7A 4A6EA 3RTRA 1U3EM 1X4PA 4WXCA 4UVCA 5D8KB 3TMOA 2CGPA 1K4TA 2XGXA 1FTZA 3CCSI 4ETSA 1RUOA 2E36A 1HSTA 1U5TC 4HX8A 4XBFA 5J4VA 1LE8B 3H9QA 3HOXJ 4OMZA 1WFXA 2L02A 3FXOA 3OIQA 1SD6A 3QRFF 4O3MA 4PCQA 1J2XA 2KLOA 2WY7Q 1UB9A 1IRGA 2WAEA 1MMAA 1W0UA 5HDGA 3F21A 1WJ5A 3GTQJ 4MTEA 4F93B 2M87A 2MBFA 2W48A 2VBXA 4C30A 4EJVA 2RQQA 3I0TA 3MKYB 2NAZA 4ZYAA 5KCMA 5IT9K 1KQ0A 2W85A 1IN4A 2YX4A 4XKWA 4BQOA 1FMWA 4DZPA 2QBYA 4A3CJ 3FM3A 4J01A 1R5ID 2LF7A 2XAQA 4M73A 4MTDA 1DQUA 4P5OA 4CDGA 1HW2A 5BOXA 3LL7A 2X6WA 2HTJA 2QQAA 1J0RA 2BOLA 2CUZA 5K5OA 2CS3A 1W5TA 4BHPA 1B6AA 5FKNA 3M07A 5DM6F 4RLFA 5J6XA 3FWEA 3CZ6A 3HRSA 2KFDA 2PQ8A 1SMYF 1BR4A 4IRIA 3DTIA 3WE3A 1FIPA 4EJTA 1KYWA 4P9FA 4FHTA 1R22A 1HCRA 1QNTA 1WRJA 4IJAA 4BJTA 1RZ4A 3S1QJ 2ZXWH 3OYNA 1B8IA 3BZCA 2XPWA 4C3IJ 4LK0F 3P9CA 2Y9ZA 2XRLA 5TISC 3VEPA 2X85A 2R7FA 5F08A 5FLXK 2F5DA 3WTTC 2LYCA 2RNGA 4GO1A 3J80Z 3G1MA 1DP7P 1NG6A 3ABLH 2N8GA 3HTSB 2DQLA 1IN5A 4XRSG 3QU6A 3M8EA 1YJNI 4ANJA 5CYVA 1I5ZA 2COBA 1DDNA 3OS0A 1FZPB 5IYDJ 4RMNA 3GW2A 4BACA 3D0SA 2RN7A 1O3RA 2JPCA 2W82A 3NRVA 1IV8A 3IKTA 1TQIA 1LQ1A 2R7TA 4M3BA 1JI8A 3DXJF 4EGYA 2LG4A 1LEBA 3K10A 3R0AA 3WG7H 4NQWB 5EGOA 2CG4A 3L2UA 3QAHA 4OU0A 5E18F 4KN4X 3ECHA 1U2WA 3O8GA 3X2QH 1QZZA 1R71A 2BGCA 3QYFA 2XC7A 4G7ZF 1ZK8A 4BU2A 2BW3A 5KAIC 4AIKA 3D5LA 2VN2A 2DFHA 3RPUA 1T08B 2PMHA 4BE0A 4EGZA 2PMUA 3CUQB 2Q1ZB 3H5AA 4CCLA 3HL2A 1R7JA 3IH3A 4E4HA 1I1SA 5GAEJ 1XC5A 2D5VA 3BQZA 2XF6A 5FKOA 1QGPA 2E71A 3LQQA 1I6HJ 2ICWG 2L3DA 2OQRA 2E7WA 4RGXA 4G6DA 5KNLA 2D1HA 3LFUA 4A3FJ 2LLKA 1BJAA 1LVKA 2R7DA 4L5IA 2H6BA 5DCFA 4JQFA 1U6GA 2P6TA 2WV1A 3CUOA 4X0GA 2TDXA 3TQNA 2WA0A 2P4WA 4ON0A 1YG2A 2MC4A 2VE9A 2AO9A 3IWZA 4C3JJ 4LD5A 1ULYA 4ESBA 2WADA 3HC7A 3C1DA 2Q2EA 1W7PA 2DT5A 5E1XA 3HRMA 3ZQCA 2FQ4A 1J9IA 2F4OB 3OYDA 1AHDP 2BE5F 3LSJA 2E5NA 3OSGA 1BN5A 4O5VA 4XSXF 2OQGA 2RC4A 5AIQA 5F6FA 3F23A 1G2HA 2E2JJ 2MABA 1JXSA 3V7SA 2EFQA 1XCBA 2M8GX 2DMPA 2CQ7A 2OTJI 2MW8A 4RLQA 1SFKA 2NXNB 4YRVA 2LR8A 3BJAA 3GO5A 5J1RA 5E20A 2STTA 3EUKL 3QU3A 2H1KA 1YX3A 2E5ZA 3JRBA 1SFUA 5JVGF 2X51A 5F64A 4DZJA 1OQYA 2DDAA 3GBGA 5IOYA 3RIRA 5ICCA 5H20A 1XS9A 4IHTA 2JA7J 2QLZA 2QCOA 2K40A 5LHHA 3LAJA 3CF2A 4GDFA 2A5WA 1EH8A 4FT8A 1R6RA 4IHWA 2NOJB 1KQ9A 4JX5A 2XAGA 3G4SI 1KZHA 1A5JA 2FUG2 2QGUA 1RR7A 2JJ7A 2YS9A 2MH9A 5EG0B 2AQEA 5K7HA 5LEJA 3RYRA 1JJ8C 3CMAI 1B59A 3WGHA 1FTTA 2L2OA 2DODA 3I4NJ 3K2AA 2V1UA 1FY7A 2ME0A 3GEZA 3U9GA 3BDDA 5DCMB 1X4OA 3WTSC 2EA2A 1OKRA 2ELHA 3A01B 2LD5A 4U0YA 3ABUA 2LDUA 2IPQX 2CV2A 5JLWA 5ILSA 4IQ4A 4E7IA 3BG9A 1GUUA 3PM1A 5F1JA 2Y0SA 2DA7A 2LKPA 3LSGA 3LWFA 1Z9CA 3G71I 2ZBKA 2MD0A 1VQPI 1LB2A 3HOYJ 2NS8A 1OCCH 4NC6A 3DPLC 1GXPA 2XB5A 4ESJA 3FISA 3TKYA 1IZ1A 4I02A 4LLNA 1R00A 2P0WA 4XSZF 5E1ZB 2DFEA 5KVRA 3KETA 2DK8A 3SQNA 4A93J 5L3GA 1Z7UA 4BXXJ 4B3AA 2HDWA 5J1YA 4O6JA 2M9HA 4HQEA 2KISA 2HGCA 2QYOA 1MDMB 3N4MA 3ZMTA 4L9TA 3DQVC 1XCVA 1FT9A 3KZZA 4XOTA 3COAC 2PX9A 1QZYA 2EWNA 3M8FA 1TT5B 1SAXA 2O61A 2XF5A 2E2IJ 4LB6B 5HNHA 3DKXA 3KEQA 3LSKA 2BXZA 3FBNB 3ZR8X 4BE1A 2HKXA 2HNHA 3K9TA 2FXAA 4DNCA 1KYZA 3QWLA 4PUSA 3GZNB 1JTYA 2GIZA 3S32A 1FLIA 2F5CA 1U8BA 5HLHA 2PJRA 5GADJ 5B3SH 4MEXF 3AG2H 1X58A 4RM2A 3CESA 1O7LA 1UAAA 1U0JA 1YIJI 1XGMA 3DP7A 1MJAA 1GVJA 3HKZA 3IAM2 2KHMA 4CH7A 4E7ZA 3ZOBA 3ZP5A 2DMQA 5LHGA 1MMDA 4RGRA 1ETVA 1ZLKA 3K4KA 1ZR4A 2ZJ2A 1B72B 1ZN2A 3VPRA 1ZKGA 2RV8A 5FB2A 3I64A 3WTWC 3FMRA 3OOUA 3PNVA 5BMZA 2O8KA 3L2WA 3I5UA 2PLYA 3TP3A 1P2FA 2ZC2A 1IXRC 1MBJA 3HOUJ 2CFXA 1J5YA 4QIWN 1FWZA 2LFBA 1HW1A 1Q1VA 1HDPA 1ENHA 3KCCA 4GCVA 1ZGJA 3VYTB 1BM9A 3OYMA 3EYIA 4ENMA 5CVJA 4R8HA 3K4MA 3VODA 3I53A 4DYRA 2K85A 3DBHB 4HSRA 2HTSA 2MC3A 2D45A 2FNAA 2ZMEA 3OWTA 2FRHA 2VOPA 3EYYA 1BR1A 2V6CA 5LFAA 2XB0X 3BPVA 1CF7B 1BI1A 3H0DA 2IW5A 3ZGKA 5TGTA 1B4AA 2K86A 1KONA 4Q48A 4A3EJ 2JT1A 3FF5A 3I71A 5EYRA 1L0OC 1IAWA 3CMEI 3W6VA 5E8GA 2BXYA 1R1UA 1TNSA 2XDVA 1Z91A 3FXRA 1U9OA 3ZMSA 4IX7A 5ERIA 3I59A 4JK1X 3EETA 3SJMA 3S2DJ 3D5RC 2IAIA 4ASNA 2GQQA 3SYTA 2O3FA 4CCOA 1BBYA 4XL9A 3KFWX 1XGSA 1LNWA 3LMMA 3LSMA 3H1CA 3BR6A 3DKYA 2K4BA 4IRHA 3SHFA 3ROUA 4UUSB 4M9SA 3BR0A 4F3QA 2XAJA 3OYGA 3SDGA 1IRFA 4Y7NJ 4WCGA 3IL2A 3ULQB 1QZEA 1P4XA 5CJ9A 4OIPF 4RA2A 1W4MA 5DV5A 2EILH 3T1BA 2EZKA 1T98A 2MH2A 2Y2ZA 4K2EA 1WZ2A 3LSIA 1PYVA 4KUMA 5LGTA 2NNYA 4A2UA 2Z3YA 1X3ZB 2HEOA 4E7HA 4S04A 2M8EA 1Y1VJ 5HDNA 2HOSA 5BPIA 4FQGA 2PMZN 2HOEA 3OIPA 3HOWJ 2FBKA 2GA2A 3FHNA 1FOXA 3C2BA 2NVQJ 1A6QA 1IDYA 2Z9OA 4ZYDA 4ZTJA 2JA8J 2A3SA 4HF0A 1EH7A 1X3WB 2DFIA 1R49A 4AUXA 4ZZLA 3AAFA 5JFRA 1U78A 4KMFA 2YSRA 1UZCA 3BP8A 4G12A 5KK1A 2NYXA 2XGCA 2CU7A 2DT6A 5FFZA 2CQXA 3IAS2 3CCUI 2IS4A 1Y0UA 4A3GJ 3E6DA 3E5XA 1ZG5A 2P5LC 2XPVA 2DTZA 3CMYA 2BY2A 2DQRA 2LKSA 4CA0A 3AL0C 1G8XA 1U5TB 1LDKB 3P9KA 1VFCA 2W57A 3Q5FA 2HOTA 1AKHB 2GBYA 3GZ5A 2DU9A 5HS9A 1V55H 2ID6A 4A6DA 3OYLA 4D7NA 4X6AJ 2CUFA 1YFHA 5CQGA 4X1EA 1HKSA 3FM5A 5AONA 4YFNF 2R3SA 2LBFA 3DU5A 1ZH5A 2F5VA 4V2GA 3PIOF 1X3UA 3O2PE 1Y0NA 2IVMA 2K9LA 2P6SA 2X48A 2O5RA 2ZMEC 4AYBN 4CYCB 3K69A 3U1KA 4UVAA 4LB5A 2DPUA 5FLVA 1ON1A 5F0HA 2W7NA 1RPWA 4HZFA 5HLIA 3IP4B 2CYYA 5J8FA 3DBLB 2VE8A 1TWFJ 1I27A 3RKQA 1OYYA 2IJLA 4MLOA 5H2FC 2RREA 3L1PA 2MA3A 4NHJA 4RB3C 2FA5A 4BEHB 3KEYA 1IUFA 1R5HA 1T0FA 4CSWA 2L7FP 3CF5F 4HRIA 1ETXA 2P5VA 3WTYC 5DD8A 2GLOA 2EIKH 3CCEI 5M3MJ 2FBHA 1KQ8A 1OJLA 1DU6A 2H1LA 1JJ6C 3L00A 5GPAA 4B09A 2F6CA 2W25A 1YS6A 3HSEA 2GM4A 2VBWA 1IRXA 2JSCA 3BQYA 3GTOJ 4L5EA 3Q0WA 1U8RA 2W00A 4UB6C 4L9VA 3E3VA 4HQMA 3ZCOA 1LFUP 4B3XA 1YW8A 2V9VA 3G2BA 5EZGA 5H6QA 3K1PA 5HS8A 2HZTA 4I2OA 1Q1HA 4NUBA 2EZIA 2JN6A 4P9UA 3UKGA 2O6GE 1J75A 4I01A 1R5GA 4G6QA 2EV0A 2JTVA 3OSFA 2XSJC 2F5EA 2EV6A 3VDXA 3OIOA 1T56A 3CO7C 1ZREA 1BI2A 2EPFA 4RAZA 2JMWA 2ELKA 2EINH 3HGYA 5JI6A 1FIAA 3E1SA 5DTDA 3K4JA 1ON2A 3D5SC 4NB5A 3S2HJ 3O8HA 3J7YJ 3A0BC 4CO8A 3CCRI 4EV0A 3K70C 1GV5A 2XGDA 3EQLF 4RDUA 1R58A 3BTLA 2J5OA 5DEQA 3F8FA 3ABKH 3LA2A 4C9YA 2VPRA 5IPAA 2OBPA 1Z05A 2P8TA 4CXFA 1QVUA 2H8WA 4XOPA 4Z2YA 5EF6A 3TW6A 3BOQA 4L0YB 4CZZA 2W1OA 1VQOI 4XK4A 2ZJRF 2WAQN 2Y30A 1ODDA 3GTJJ 1V5EA 2EFOA 3ELKA 5IP9J 4A3IJ 4XLNF 4HYEA 5IY5H 3BR5A 2K9SA 3KP4A 3OYCA 2E1CA 1NK2P 2OV7A 3ABTA 3RKWA 3GUDA 2M3AA 2WWYA 1Z6RA 1HOMA 4OOIA 4R1HA 5FRMA 3BJ6A 2HYJA 3VYUB 2Y31A 1FSEA 3Q3SA 4XICA 3JREA 2Q0OA 5BPDA 2HQRA 5JLXA 2FMYA 1V5GA 3V4GA 5DUKA 4PGGA 5E79C 3V8LA 3AKZA 3K2ZA 4MO7A 3NAUA 2QBYB 1LVAA 2ZSIB 3M7GA 2NS7A 1E3OC 2IT0A 2OU2A 2L0KA 4BH9A 3L2CA 3FXLA 1IG7A 4YELA 1XSXA 2R7RA 5CPRB 2IGKA 3RKXA 1H0MA 3DTKA 4Q4ZF 4EM0B 1N25A 2IA0A 3WE2A 3WGIA 2KRFA 3JAMK 2NOGA 3H3ZA 1UHMA 1JTXA 1Z21A 1R4NB 4N0BA 1K6OA 3VOEA 2R5ZB 4E7JA 3GLXA 1T0FC 3R6SA 2HPIA 4KMUX 1REPC 1LE8A 3MKWB 2F48A 3MVPA 1N75A 3SEQA 1SANA 4FETA 1AA7A 4WWCA 3FX3A 1YYVA 5KHDA 5A2QZ 2CQKA 2FEZA 2IS2A 2CSOA 3FXJA 2PG4A 1YQAA 2QM3A 3DKWA 5IYCJ 3VYSB 3MN2A 4QTRA 1VQ5I 1UHWA 5JHUA 3A1YA 2IS6A 4MQ9F 1O3QA 2UXXA 2KP6A 1LPQA 2GWRA 2VASA 4CCJA 3OYFA 1FOKA 3RZDJ 2ZB9A 4KIBA 5ILUA 4OMYA 1H88C 3ZQ7A 2UV1A 2W4SA 4FX4A 4UV8A 2HVRA 2UUZA 2KQRA 2P7VB 2R7QA 3DPTA 2M1BA 3RPQA 1W5CC 2RNJA 4ZJZA 5LLQA 5L3DA 5EEGA 4FCYA 3CCQI 5EZHA 3JTGA 4OIOF 1R1TA 4TV7A 2L9RA 5TJJA 5FO5A 4II2A 1BJZA 5FGMA 1JE8A 1XG1A 2MYSA 3W6KB 2KZGA 3FIWA 2KDZA 2O0YA 3OS1A 2ZNZA 3TW7A 1SAUA 5DYMA 1JKRC 1IGNA 3W2VA 1BW6A 2A6HF 4Z6YA 5J8CA 3S14J 4LLGF 2HQAA 3OYKA 2HVSA 4UVBA 3U21A 1XGNA 2M7BA 2ZFWA 3ASNH 3DBRB 4IO9F 4XRFA 1V54H 3KZIC 1TWHJ 5CQEA 4NBQA 3ZQLA 2FOWA 3E6BA 3P7NA 1WH5A 2WTEA 4HNTA 1MH4A 5B1AH 1HKQA 2DFFA 4WXHA 2CW0F 3HG9A 1PVEA 4RB1A 3V7CA 3W2WA 1UJ8A 1V4RA 1IXSB 4LG0B 1GLNA 4YG2F 1FJLA 5IP7J 3HSRA 1E17A 1DGWY 2X9DA 1DP3A 3CJQB 2KL4A 1G59A 4JX6A 4IOAF 5CVRA 5J3LA 1H9TA 2HOAA 2K7LA 3K4LA 3E6MA 2OZ6A 1FBUA 4AWXB 2GOXB 3FMSA 4M6XA 4Y4RA 2ME6A 3E97A 5KAFC 1KGSA 1F5TA 2P5KA 4U87A 4ZC3A 1MNDA 1R4MB 3QPLA 4NQWA 4N4OB 2R7ZJ 2MSYA 3J80K 4HF2A 1D8JA 2R7OA 5F0FA 5L3BA 4PDKA 2DPDA 3RQIA 4M3EA 3Q9VA 4F7ZA 1PUFB 2JA5J 3GZ6A 4JYKA 3ASOH 2M45A 1DGRM 3AFHA 4BQNA 1IN7A 2VC0A 1TQMA 4BKXA 2EZHA 3H36A 1HKTA 3SDBA 1NK3P 3I58A 4HV5A 3CUQA 1MMNA 2QUFA 3DPUA 3I4PA 3CQZJ 2ZCWA 3KZYA 4XORA 3JRAA 4U7BA 1FNNA 1WJBA 4YIFA 4JP0A 2VLAA 2GOMA 3QPTA 4XLPF 3JRGA 1HDDC 2CMPA 2A07F 4E70A 1OCOH 5B66C 1CGPA 4N9HA 3PFYA 1YLFA 2K9QA 5LHIA 1NG7A 1O3TA 4IVNA 1SEUA 1PJRA 3LOCA 4GXOA 2H6CA 3SEZA 1YW9A 3HOZJ 3UNGC 3TP0A 2H8RA 2XF7A 3DEEA 3O6BB 3PUBA 3JRCA 2RGVA 1Z1DA 1D3YA 4HG2A 4A0XA 5M5WJ 1ZARA 2A6EF 4A3MJ 3CCJI 2BV6A 4G8XA 4S0HB 4BBSJ 3KYLA 2F4IA 4AIJA 4B1RA 2JUGA 1MJ9A 2A5YB 1Y6IA 1MW7A 1QHHD 1J59A 1GT0C 3ABMH 4UB8C 3K4CA 4PJMA 3OYBA 3JRFA 3H35A 1OCRH 5BQTA 5EEAA 2VC1A 1BL0A 3BWGA 1K7AA 2M34A 2MD5A 2VQCA 2EA4A 3DLAA 3WG9A 4I6ZA 2V1NA 4I0BA 1WH7A 4RS8A 1QVTA 2IEKA 4D5CA 1G3SA 1ZTRA 3WTVC 3GCMA 1RUNA 3MEXA 4Q47A 1X19A 1VQNI 4YEJA 1O3SA 2YU9J 1VNDA 4UUTA 5BNGA 2JVHA 3S15J 3DEWA 3HRTA 3K1NA 1R36A 2X6YA 3F0CA 1ZR2A 2QVOA 4E7SA 3IWFA 3BR1A 2UWMA 1I3AA 3L2QA 4M9ZA 1SVMA 2OAZA 3CJTB 4BHBA 1G3YA 2KDOA 3BZ6A 4AC0A 5DUIA 4QSHA 4RBOA 5D5WB 1RKTA 5ICEA 4A5NA 2X0LA 4BAYA 4HX4A 3LSHA 4LLLA
chains in the Genus database with same CATH topology
3SZPA 5LBQA 3JSPA 1Z6TA 2VBZA 4L5JA 5D5VB 2L54A 2MLGA 2XUBA 3C18A 3IC7A 1L3LA 2KJBA 2PI0A 3HIFA 5DCMA 2BEOA 2D1VA 4HLXA 3LSTA 3F22A 2OA4A 1OR7A 5D5UB 3QP5A 1TBXA 1E2XA 4WF2A 1PDNC 1BIAA 4A12A 1T2KA 3O3KA 3QP6A 1SD5A 4HA8A 3ZMDA 2UXNA 2COMA 4ZYGA 3LA3A 4L9JA 1TW3A 2QQ9A 2K27A 3RJPA 4YFXF 3HYIA 1MDMA 5JVTA 4IXAA 4HDVA 1BC8C 6PAXA 3J7AO 2JZYA 1I6XA 1GHCA 3WTZA 2DW4A 4ENJA 2YPRA 5LEKA 3TO7A 1KU9A 1STZA 2XKOA 2H94A 3OV8A 2J5PA 4MQVA 2GXBA 3REOA 2A68F 2FE3A 2XROA 1MD0A 1QBJA 4U7DA 5CVUA 2HS5A 3GFJA 3U1DA 4S05A 4Q5SF 1CF7A 3IHUA 4DQ2A 3FMQA 2OZUA 4LK1F 1K79A 2L01A 3C7JA 5D6EA 3HTUA 1D8KA 2JPBA 5HLGA 3IRRA 1SD4A 5L3EA 2ACJA 3ZMUA 4IPAA 1J7KA 4M71A 5H6RA 3Q9SA 1XB4A 3E5QA 4UXNA 2IP2A 4OIQF 2LF8A 3PQJA 1FBQA 3GFIA 3T8TA 4BYYA 2EB7A 2NRAC 2MLKA 4M72A 3GFLA 1IW7F 1QQIA 1XSVA 3F3XA 1ZRCA 4CYDA 3LFKA 3WGGA 1IN8A 3E5UA 1ZRDA 2W84A 2WV0A 3I54A 4I0AA 1TNTA 2VBYA 1S3JA 1YIOA 3CLOA 4Y17A 3CJNA 4M6YA 2KIFA 3GXOA 5IT3A 2HKOA 1WI9A 2DAOA 1FP1D 1UFMA 4EM1A 3JTHA 2L4MA 1JHFA 1IXCA 1XD7A 2V1DA 1U5TA 1KU7A 2NNNA 5HS7A 5K5QA 5D8LB 3WTXC 4ZZDA 1YS7A 4GGGA 3B02A 1WQ2A 4LJZF 2FBIA 1P4AA 1RIOH 1LJ9A 4RAYA 2FF4A 3ZN1A 2EK5A 4BQAA 1S7OA 2FSWA 4BNCA 1T39A 1B1BA 2Y0MA 1F1ZA 3BROA 5TRDA 5ICFA 3ZPLA 1B9MA 4LMYA 2KJCA 3V8KA 4AIHA 3KEOA 1G4DA 2XV4S 3L09A 2HYGD 2RQPA 2GIVA 3ML6A 5EEHA 3JW4A 3QPHA 2DO7A 2V79A 5CVIA 3OOPA 4U88A 2AXLA 5IT9Z 2DI3A 2VODA 2XAFA 3H3UA 3F72A 2OD5A 3FXQA 4MGRA 4B8XA 2PJPA 2QQBA 1GXQA 3MFKA 4BHCA 1HQCA 5CVVA 1RNLA 5LGUA 3RI4A 1P6RA 2GXGA 2STWA 3P9IA 4HAMA 3HHGA 5CLSA 1XMKA 2YU3A 1G3TA 1K78A 2W24A 2NS0A 3R4KA 4HLYA 4KDPA 1KU2A 3TGNA 3KP6A 5DD4A 1HBXG 1FYMA 3FHZA 4N9IA 3TO9A 2G7UA 3B73A 4JBAA 1R1VA 2XASA 3MZHA 3HOTA 3F6VA 1AWCA 1YTYA 3WODF 1S6LA 2PN6A 1T6SA 1SD7A 1ZG1A 2AS5F 4Y13A 1T38A 4HF2A 4P96A 1I1GA 1DUXC 4YIIA 5K5RA 2EJRA 1LEAA 1BC7C 1MZBA 2FMLA 1WWXA 2ZKZA 3LA7A 3T0YA 2VOOA 4L0ZB 1KU3A 3G3ZA 2FQ3A 1ZRFA 2KKOA 2ISZA 3MAJA 3S2WA 3MZYA 4ENKA 3L7WA 4G9YA 1S7AA 3IRQA 2G7HA 4OIRF 2O8XA 5E17F 1BOAA 2KIUA 5E8IA 1WSUA 1YW7A 3CO6C 2XRNA 2C6YA 1B9NA 4EM2A 1RI7A 4FX0A 2QWWA 4A0ZA 3TOAA 1HSJA 3R61A 1BIBA 1LDJA 1FSHA 2ESHA 1W5SA 4I98B 4WXDA 5A2QK 4Y15A 4ZH4F 1DPRA 2VT2A 2FOKA 1HW5A 1HXDA 2A69F 2HQNA 1SFEA 1IF1A 4KIGA 2LNBA 3VFZA 5FD5A 4I09A 2G9WA 3NQOA 1ZG3A 1WKMA 1AOYA 4EJOA 1C0WA 2XKPA 2Z33A 4RGSA 3NEUA 4CGZA 1FPQA 3PFIA 3DFGA 3WU1B 1JGSA 3RYPA 1XDUA 1MJBA 4BXUA 5DDGA 1IUYA 1ZHFA 4HOBA 3F8BA 5LGNA 1PUEE 1W7PB 3ISPA 3MCZA 4G94A 3VB2A 4LG0A 4IHSA 1XDSA 1O7FA 1EV7A 1F4KA 1P92A 1MGTA 1TW2A 2L4AA 3K0LA 2K02A 2EV5A 4A5MA 2FU4A 4G7OF 3SFZA 2GAUA 4HW0A 5LRRA 1FBSA 4KYWA 2XAHA 3G73A 4AD9A 1A04A 1JHHA 2IA1A 4ESFA 3SZTA 4RB2C 4CHUA 1KA8A 3TOBA 2Z5UA 4QLCU 3K1MA 2H27A 1ZAOA 1VTNC 5ED4A 1TLHB 2ZXJA 3SXYA 3E6CC 2EFWA 4MNUA 3KLOA 4IF4A 3C3WA 4HX7A 3T5XA 4I7HA 4U0WA 5JR3A 3KE2A 3FXUA 1S29A 4H0EA 2DBBA 3EDPA 2E1NA 5AIPA 4MEYF 3HHHA 2ADUA 4G7HF 3WTUC 2M30A 4L9NA 2H09A 2DK5A 4R79A 1LDDA 3LAPA 4YFKF 1DPUA 1TQPA 2WC2A 2ZO4A 2ESNA 3GX4X 5F1RA 4D0PA 4WX9A 4UUVA 2RVCA 2JRTA 3FZVA 1XGOA 4CICA 5D4RA 4UV9A 3J81Z 4P55A 3CUQC 3BY6A 2ZNYA 4PGHA 4WK8F 3HOSA 3GYHX 1USSA 4IRGA 1IN6A 1F9NA 5BS6A 3T8RA 4ENNA 4KNYA 2Q8KA 5L3FA 2YX7A 4L18B 3RDIA 2VXZA 4EMSA 2CWEA 4HBLA 3KP2A 2IA2A 5HVQC 3W6JB 4OINF 4RGUA 2Y48A 2ZMEB 3HRUA 4QWQA 1O57A 2K4JA 4HDUA 2Y75A 2PBIA 3KP5A 2X4HA 3LQRA 1XSDA 2ETHA 3DF8A 4LFUA 4ZYHA 2HFHA 2DTRA 2Z99A 3F6OA 3H92A 3I59B 1G3WA 1MKMA 2O03A 5FD6A 2VONA 5ILVA 3CTAA 1H9GA 5D5XB 1TTYA 3F8CA 3J81K 4HF1A 2A61A 2FNPA 2B0LA 2M5WA 1BI3A 2F5FA 1W7PD 3R0JA 5L3CA 3ERED 4MHGA 3EUHA 3TO6A 4KFCA 1XN7A 2ISYA 4KIFA 5E1WA 3GWZA 1G6NA 1OMIA 4KT5C 1ZGAA 1SFXA 3BJOA 3ECOA 4KICA 1EH6A 3V7RA 4U0VA 3L9FA 2GZWA 4GYGA 3TDUC 3N97A 5LRSA 5HDKA 3CDHA 1QO0D 2VT3A 3R60A 2E7XA 5ICGA 2XVCA 2BBYA 4PZJA 3F8NA 4EVIA 3ZMVA 1BI0A 1ZLJA 2EFNA 2HYFA 4AVPA 2EFPA 3V8JA 3ZN0A 2HDCA 4ZYEA 3F8MA 3KP7A 4M74A 5D6FA 2KIMA 4KN7X 5K1YA 3TDZC 2F2EA 3ZMZA 4RB0A 4KA4A 3IKVA 2GA1A 2RDPA 3HUGA 4LGWA 1NHAA 1FX7A 5HOOA 3M1EA 4A0YA 3U2RA 3GFMA 1P4WA 1USTA 3BPXA 3KP3A 1FP2A 4EJUA 2IRFG 1S8NA 4HV6A 4GYIA 3RKYA 1XMAA 1OYWA 3HSFA 2QZ8A 1PP8F 1OPCA 3DEUA 1ONVA 2CO5A 3WU0A 2D2WA 3KLNA 3JSOA 3GF2A 3GVAA 2HWVA 4EQQA 1YO5C 2HR3A 3MWMA 5D4SA 1V3FA 2RKHA 2YR2A 3DV8A 1FYLA 2XIGA 3JAMZ 2PFBA 2DLLA 1PP7U 2LSOA 2V1XA 3MQ0A 1K78B 3PQKA 3M9AA 2BYVE 1FC3A 5FFXA 3QOPA 2UZKA 4EJWA 1ZYRF 4M9XA 4UNOA 1QPMA 1OYIA 2XHKA 1FYKA 2P7CB 1R23A 2PEXA 1SMTA 4UHTA 2QENA 1D5VA 1UCRA 5FLXZ 4A6EA 3RTRA 1U3EM 4WXCA 4UVCA 5D8KB 2CGPA 2XGXA 4ETSA 1RUOA 1HSTA 1U5TC 4HX8A 4XBFA 4OMZA 2L02A 3QRFF 1SD6A 4O3MA 4PCQA 1J2XA 1UB9A 1IRGA 5HDGA 3F21A 4MTEA 2M87A 2MBFA 2VBXA 4EJVA 3I0TA 2NAZA 5IT9K 1KQ0A 2W85A 1IN4A 2YX4A 2QBYA 3FM3A 2LF7A 2XAQA 4M73A 4MTDA 4P5OA 4CDGA 1HW2A 5BOXA 2HTJA 2QQAA 1J0RA 5K5OA 1W5TA 4BHPA 1B6AA 5J6XA 3FWEA 3HRSA 2PQ8A 1SMYF 4IRIA 3WE3A 4EJTA 1KYWA 4P9FA 4FHTA 1R22A 1QNTA 1WRJA 4IJAA 1RZ4A 4LK0F 3P9CA 3VEPA 2R7FA 5FLXK 2F5DA 3WTTC 4GO1A 3J80Z 1DP7P 3HTSB 2DQLA 1IN5A 3QU6A 3M8EA 5CYVA 1I5ZA 1DDNA 1FZPB 3GW2A 3D0SA 2RN7A 1O3RA 2JPCA 3NRVA 3IKTA 1TQIA 1LQ1A 3DXJF 4EGYA 1LEBA 3R0AA 2CG4A 3QAHA 4OU0A 5E18F 4KN4X 3ECHA 1U2WA 1QZZA 2BGCA 4G7ZF 4AIKA 3D5LA 2VN2A 3RPUA 2PMHA 4EGZA 2PMUA 3CUQB 1R7JA 1I1SA 1QGPA 3LQQA 2L3DA 2OQRA 2E7WA 4RGXA 4G6DA 2D1HA 1BJAA 2R7DA 5DCFA 4L5IA 2H6BA 4JQFA 1U6GA 2P6TA 3CUOA 2TDXA 3TQNA 2P4WA 4ON0A 1YG2A 2VE9A 3IWZA 4LD5A 1ULYA 4ESBA 3C1DA 2Q2EA 1W7PA 2DT5A 5E1XA 3HRMA 1J9IA 2BE5F 1BN5A 4O5VA 4XSXF 2OQGA 2RC4A 5AIQA 5F6FA 3F23A 1JXSA 3V7SA 2EFQA 1XCBA 3BJAA 3GO5A 5E20A 2STTA 3QU3A 1SFUA 5F64A 3RIRA 5ICCA 5H20A 4IHTA 2QLZA 5LHHA 3LAJA 1EH8A 4FT8A 1KQ9A 2XAGA 2MH9A 5LEJA 3RYRA 1B59A 3WGHA 2V1UA 1FY7A 3GEZA 3U9GA 3BDDA 5DCMB 3WTSC 2EA2A 1OKRA 2ELHA 4U0YA 3ABUA 2LDUA 2IPQX 5ILSA 2LKPA 3LWFA 1Z9CA 2ZBKA 1LB2A 3DPLC 1GXPA 4ESJA 3TKYA 1IZ1A 4I02A 4LLNA 1R00A 4XSZF 5E1ZB 5KVRA 3KETA 2DK8A 3SQNA 5L3GA 1Z7UA 4O6JA 4HQEA 2HGCA 2QYOA 1MDMB 3N4MA 3ZMTA 4L9TA 3DQVC 1XCVA 1FT9A 3KZZA 3COAC 1QZYA 2EWNA 3M8FA 1SAXA 2O61A 4LB6B 3KEQA 2HKXA 3K9TA 2FXAA 4DNCA 1KYZA 1FLIA 2F5CA 5HLHA 4MEXF 1O7LA 1XGMA 3DP7A 1MJAA 1GVJA 3ZP5A 5LHGA 4RGRA 1ZLKA 2ZJ2A 1ZN2A 2RV8A 5FB2A 3I64A 3WTWC 3FMRA 5BMZA 3I5UA 2PLYA 1P2FA 1IXRC 2CFXA 1J5YA 1FWZA 1HW1A 3KCCA 4GCVA 1ZGJA 1BM9A 3EYIA 4ENMA 5CVJA 4R8HA 3VODA 3I53A 2HTSA 2MC3A 2D45A 2FNAA 2ZMEA 2VOPA 2FRHA 3EYYA 2V6CA 3BPVA 1CF7B 1BI1A 2IW5A 1B4AA 2K86A 4Q48A 2JT1A 3FF5A 3I71A 1L0OC 1IAWA 5E8GA 1R1UA 1TNSA 1Z91A 3FXRA 3ZMSA 5ERIA 3I59A 4JK1X 3EETA 4ASNA 2GQQA 2O3FA 1BBYA 3KFWX 1XGSA 1LNWA 4IRHA 2K4BA 3SHFA 3ROUA 4M9SA 2XAJA 1IRFA 4WCGA 3IL2A 3ULQB 1P4XA 5CJ9A 4OIPF 1W4MA 5DV5A 3T1BA 1T98A 2MH2A 4K2EA 4KUMA 5LGTA 2NNYA 4A2UA 2Z3YA 2HEOA 4S04A 2M8EA 5HDNA 5BPIA 2HOEA 2FBKA 2GA2A 2Z9OA 4ZYDA 2A3SA 4HF0A 1EH7A 2DFIA 4ZZLA 3AAFA 5JFRA 1U78A 4KMFA 2YSRA 3BP8A 5KK1A 2NYXA 5FFZA 1Y0UA 3E6DA 3E5XA 1ZG5A 2P5LC 2DQRA 1U5TB 1LDKB 3P9KA 2W57A 3Q5FA 3GZ5A 2DU9A 5HS9A 4A6DA 1YFHA 1HKSA 3FM5A 5AONA 4YFNF 2R3SA 1ZH5A 1X3UA 3O2PE 2IVMA 2P6SA 3K69A 4UVAA 4LB5A 2DPUA 1ON1A 4HZFA 5HLIA 2CYYA 5J8FA 2VE8A 1I27A 1OYYA 2IJLA 2MA3A 4NHJA 4RB3C 2FA5A 1R5HA 1T0FA 2P5VA 3WTYC 5DD8A 2FBHA 1KQ8A 3L00A 4B09A 2W25A 1YS6A 3HSEA 2VBWA 2JSCA 1U8RA 4L9VA 3E3VA 4HQMA 1YW8A 2V9VA 5H6QA 3K1PA 5HS8A 2HZTA 4I2OA 1Q1HA 2O6GE 4P9UA 1J75A 4I01A 1R5GA 4G6QA 2EV0A 2JTVA 2F5EA 2EV6A 1ZREA 3CO7C 1BI2A 4RAZA 5JI6A 1ON2A 4NB5A 4CO8A 4EV0A 3EQLF 1R58A 2J5OA 5DEQA 3F8FA 3LA2A 2OBPA 1Z05A 2P8TA 4CXFA 4Z2YA 3BOQA 4L0YB 4CZZA 1ODDA 2EFOA 3ELKA 4XLNF 4HYEA 3KP4A 2E1CA 3ABTA 3RKWA 3GUDA 2WWYA 1Z6RA 4OOIA 4R1HA 3BJ6A 1FSEA 2Q0OA 5BPDA 2HQRA 2FMYA 3V4GA 5DUKA 4PGGA 3V8LA 3K2ZA 2QBYB 1LVAA 3M7GA 2IT0A 2OU2A 4BH9A 3L2CA 1XSXA 3RKXA 1H0MA 4Q4ZF 4EM0B 2IA0A 3WE2A 3WGIA 2KRFA 3JAMK 3H3ZA 1UHMA 1K6OA 4N0BA 3VOEA 3GLXA 3R6SA 4KMUX 1REPC 4WWCA 3FX3A 1YYVA 5A2QZ 2CQKA 2FEZA 2CSOA 2PG4A 1YQAA 2QM3A 3DKWA 1UHWA 5JHUA 4MQ9F 1O3QA 2UXXA 2GWRA 1FOKA 5ILUA 4KIBA 4OMYA 3ZQ7A 4FX4A 4UV8A 2P7VB 3DPTA 2M1BA 3RPQA 2RNJA 5LLQA 5L3DA 5EEGA 3JTGA 4OIOF 1R1TA 4TV7A 5TJJA 5FO5A 5FGMA 1JE8A 3W6KB 2O0YA 2ZNZA 5DYMA 5J8CA 2A6HF 4LLGF 4UVBA 1XGNA 2ZFWA 4XRFA 3E6BA 3P7NA 2WTEA 1HKQA 4WXHA 2CW0F 4RB1A 3V7CA 1V4RA 1IXSB 4LG0B 4YG2F 3HSRA 1E17A 5CVRA 1H9TA 2K7LA 3E6MA 2OZ6A 1FBUA 4AWXB 3FMSA 4M6XA 3E97A 1KGSA 1F5TA 2P5KA 4NQWA 3J80K 1D8JA 5L3BA 4PDKA 2DPDA 3Q9VA 4F7ZA 3GZ6A 2M45A 1IN7A 2VC0A 1TQMA 1HKTA 3I58A 4HV5A 3CUQA 2QUFA 3I4PA 2ZCWA 3KZYA 4U7BA 1FNNA 4YIFA 3QPTA 4XLPF 2A07F 4E70A 1CGPA 4N9HA 1YLFA 5LHIA 1O3TA 4IVNA 4GXOA 2H6CA 1YW9A 3O6BB 2RGVA 1Z1DA 1D3YA 4A0XA 1ZARA 2A6EF 2BV6A 4G8XA 4AIJA 1MJ9A 2A5YB 1J59A 5BQTA 2VC1A 3BWGA 1K7AA 2MD5A 2EA4A 3WG9A 4I0BA 4RS8A 1G3SA 3WTVC 1RUNA 3MEXA 4Q47A 1O3SA 3K1NA 3HRTA 1R36A 2QVOA 3IWFA 2UWMA 4M9ZA 2OAZA 4BHBA 5DUIA 1G3YA 3BZ6A 5D5WB 5ICEA 4A5NA 2X0LA 4BAYA 4HX4A 4LLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZP A;  5LBQ A;  3JSP A;  1Z6T A;  2VBZ A;  4L5J A;  5D5V B;  2L54 A;  2MLG A;  2XUB A;  3C18 A;  3IC7 A;  1L3L A;  2KJB A;  2PI0 A;  3HIF A;  5DCM A;  2BEO A;  2D1V A;  4HLX A;  3LST A;  3F22 A;  2OA4 A;  1OR7 A;  5D5U B;  3QP5 A;  1TBX A;  1E2X A;  4WF2 A;  1PDN C;  1BIA A;  4A12 A;  1T2K A;  3O3K A;  3QP6 A;  1SD5 A;  4HA8 A;  3ZMD A;  2UXN A;  2COM A;  4ZYG A;  3LA3 A;  4L9J A;  1TW3 A;  2QQ9 A;  2K27 A;  3RJP A;  4YFX F;  3HYI A;  1MDM A;  5JVT A;  4IXA A;  4HDV A;  1BC8 C;  6PAX A;  3J7A O;  2JZY A;  1I6X A;  1GHC A;  3WTZ A;  2DW4 A;  4ENJ A;  2YPR A;  5LEK A;  3TO7 A;  1KU9 A;  1STZ A;  2XKO A;  2H94 A;  3OV8 A;  2J5P A;  4MQV A;  2GXB A;  3REO A;  2A68 F;  2FE3 A;  2XRO A;  1MD0 A;  1QBJ A;  4U7D A;  5CVU A;  2HS5 A;  3GFJ A;  3U1D A;  4S05 A;  4Q5S F;  1CF7 A;  3IHU A;  4DQ2 A;  3FMQ A;  2OZU A;  4LK1 F;  1K79 A;  2L01 A;  3C7J A;  5D6E A;  3HTU A;  1D8K A;  2JPB A;  5HLG A;  3IRR A;  1SD4 A;  5L3E A;  2ACJ A;  3ZMU A;  4IPA A;  1J7K A;  4M71 A;  5H6R A;  3Q9S A;  1XB4 A;  3E5Q A;  4UXN A;  2IP2 A;  4OIQ F;  2LF8 A;  3PQJ A;  1FBQ A;  3GFI A;  3T8T A;  4BYY A;  2EB7 A;  2NRA C;  2MLK A;  4M72 A;  3GFL A;  1IW7 F;  1QQI A;  1XSV A;  3F3X A;  1ZRC A;  4CYD A;  3LFK A;  3WGG A;  1IN8 A;  3E5U A;  1ZRD A;  2W84 A;  2WV0 A;  3I54 A;  4I0A A;  1TNT A;  2VBY A;  1S3J A;  1YIO A;  3CLO A;  4Y17 A;  3CJN A;  4M6Y A;  2KIF A;  3GXO A;  5IT3 A;  2HKO A;  1WI9 A;  2DAO A;  1FP1 D;  1UFM A;  4EM1 A;  3JTH A;  2L4M A;  1JHF A;  1IXC A;  1XD7 A;  2V1D A;  1U5T A;  1KU7 A;  2NNN A;  5HS7 A;  5K5Q A;  5D8L B;  3WTX C;  4ZZD A;  1YS7 A;  4GGG A;  3B02 A;  1WQ2 A;  4LJZ F;  2FBI A;  1P4A A;  1RIO H;  1LJ9 A;  4RAY A;  2FF4 A;  3ZN1 A;  2EK5 A;  4BQA A;  1S7O A;  2FSW A;  4BNC A;  1T39 A;  1B1B A;  2Y0M A;  1F1Z A;  3BRO A;  5TRD A;  5ICF A;  3ZPL A;  1B9M A;  4LMY A;  2KJC A;  3V8K A;  4AIH A;  3KEO A;  1G4D A;  2XV4 S;  3L09 A;  2HYG D;  2RQP A;  2GIV A;  3ML6 A;  5EEH A;  3JW4 A;  3QPH A;  2DO7 A;  2V79 A;  5CVI A;  3OOP A;  4U88 A;  2AXL A;  5IT9 Z;  2DI3 A;  2VOD A;  2XAF A;  3H3U A;  3F72 A;  2OD5 A;  3FXQ A;  4MGR A;  4B8X A;  2PJP A;  2QQB A;  1GXQ A;  3MFK A;  4BHC A;  1HQC A;  5CVV A;  1RNL A;  5LGU A;  3RI4 A;  1P6R A;  2GXG A;  2STW A;  3P9I A;  4HAM A;  3HHG A;  5CLS A;  1XMK A;  2YU3 A;  1G3T A;  1K78 A;  2W24 A;  2NS0 A;  3R4K A;  4HLY A;  4KDP A;  1KU2 A;  3TGN A;  3KP6 A;  5DD4 A;  1HBX G;  1FYM A;  3FHZ A;  4N9I A;  3TO9 A;  2G7U A;  3B73 A;  4JBA A;  1R1V A;  2XAS A;  3MZH A;  3HOT A;  3F6V A;  1AWC A;  1YTY A;  3WOD F;  1S6L A;  2PN6 A;  1T6S A;  1SD7 A;  1ZG1 A;  2AS5 F;  4Y13 A;  1T38 A;  4HF2 A;  4P96 A;  1I1G A;  1DUX C;  4YII A;  5K5R A;  2EJR A;  1LEA A;  1BC7 C;  1MZB A;  2FML A;  1WWX A;  2ZKZ A;  3LA7 A;  3T0Y A;  2VOO A;  4L0Z B;  1KU3 A;  3G3Z A;  2FQ3 A;  1ZRF A;  2KKO A;  2ISZ A;  3MAJ A;  3S2W A;  3MZY A;  4ENK A;  3L7W A;  4G9Y A;  1S7A A;  3IRQ A;  2G7H A;  4OIR F;  2O8X A;  5E17 F;  1BOA A;  2KIU A;  5E8I A;  1WSU A;  1YW7 A;  3CO6 C;  2XRN A;  2C6Y A;  1B9N A;  4EM2 A;  1RI7 A;  4FX0 A;  2QWW A;  4A0Z A;  3TOA A;  1HSJ A;  3R61 A;  1BIB A;  1LDJ A;  1FSH A;  2ESH A;  1W5S A;  4I98 B;  4WXD A;  5A2Q K;  4Y15 A;  4ZH4 F;  1DPR A;  2VT2 A;  2FOK A;  1HW5 A;  1HXD A;  2A69 F;  2HQN A;  1SFE A;  1IF1 A;  4KIG A;  2LNB A;  3VFZ A;  5FD5 A;  4I09 A;  2G9W A;  3NQO A;  1ZG3 A;  1WKM A;  1AOY A;  4EJO A;  1C0W A;  2XKP A;  2Z33 A;  4RGS A;  3NEU A;  4CGZ A;  1FPQ A;  3PFI A;  3DFG A;  3WU1 B;  1JGS A;  3RYP A;  1XDU A;  1MJB A;  4BXU A;  5DDG A;  1IUY A;  1ZHF A;  4HOB A;  3F8B A;  5LGN A;  1PUE E;  1W7P B;  3ISP A;  3MCZ A;  4G94 A;  3VB2 A;  4LG0 A;  4IHS A;  1XDS A;  1O7F A;  1EV7 A;  1F4K A;  1P92 A;  1MGT A;  1TW2 A;  2L4A A;  3K0L A;  2K02 A;  2EV5 A;  4A5M A;  2FU4 A;  4G7O F;  3SFZ A;  2GAU A;  4HW0 A;  5LRR A;  1FBS A;  4KYW A;  2XAH A;  3G73 A;  4AD9 A;  1A04 A;  1JHH A;  2IA1 A;  4ESF A;  3SZT A;  4RB2 C;  4CHU A;  1KA8 A;  3TOB A;  2Z5U A;  4QLC U;  3K1M A;  2H27 A;  1ZAO A;  1VTN C;  5ED4 A;  1TLH B;  2ZXJ A;  3SXY A;  3E6C C;  2EFW A;  4MNU A;  3KLO A;  4IF4 A;  3C3W A;  4HX7 A;  3T5X A;  4I7H A;  4U0W A;  5JR3 A;  3KE2 A;  3FXU A;  1S29 A;  4H0E A;  2DBB A;  3EDP A;  2E1N A;  5AIP A;  4MEY F;  3HHH A;  2ADU A;  4G7H F;  3WTU C;  2M30 A;  4L9N A;  2H09 A;  2DK5 A;  4R79 A;  1LDD A;  3LAP A;  4YFK F;  1DPU A;  1TQP A;  2WC2 A;  2ZO4 A;  2ESN A;  3GX4 X;  5F1R A;  4D0P A;  4WX9 A;  4UUV A;  2RVC A;  2JRT A;  3FZV A;  1XGO A;  4CIC A;  5D4R A;  4UV9 A;  3J81 Z;  4P55 A;  3CUQ C;  3BY6 A;  2ZNY A;  4PGH A;  4WK8 F;  3HOS A;  3GYH X;  1USS A;  4IRG A;  1IN6 A;  1F9N A;  5BS6 A;  3T8R A;  4ENN A;  4KNY A;  2Q8K A;  5L3F A;  2YX7 A;  4L18 B;  3RDI A;  2VXZ A;  4EMS A;  2CWE A;  4HBL A;  3KP2 A;  2IA2 A;  5HVQ C;  3W6J B;  4OIN F;  4RGU A;  2Y48 A;  2ZME B;  3HRU A;  4QWQ A;  1O57 A;  2K4J A;  4HDU A;  2Y75 A;  2PBI A;  3KP5 A;  2X4H A;  3LQR A;  1XSD A;  2ETH A;  3DF8 A;  4LFU A;  4ZYH A;  2HFH A;  2DTR A;  2Z99 A;  3F6O A;  3H92 A;  3I59 B;  1G3W A;  1MKM A;  2O03 A;  5FD6 A;  2VON A;  5ILV A;  3CTA A;  1H9G A;  5D5X B;  1TTY A;  3F8C A;  3J81 K;  4HF1 A;  2A61 A;  2FNP A;  2B0L A;  2M5W A;  1BI3 A;  2F5F A;  1W7P D;  3R0J A;  5L3C A;  3ERE D;  4MHG A;  3EUH A;  3TO6 A;  4KFC A;  1XN7 A;  2ISY A;  4KIF A;  5E1W A;  3GWZ A;  1G6N A;  1OMI A;  4KT5 C;  1ZGA A;  1SFX A;  3BJO A;  3ECO A;  4KIC A;  1EH6 A;  3V7R A;  4U0V A;  3L9F A;  2GZW A;  4GYG A;  3TDU C;  3N97 A;  5LRS A;  5HDK A;  3CDH A;  1QO0 D;  2VT3 A;  3R60 A;  2E7X A;  5ICG A;  2XVC A;  2BBY A;  4PZJ A;  3F8N A;  4EVI A;  3ZMV A;  1BI0 A;  1ZLJ A;  2EFN A;  2HYF A;  4AVP A;  2EFP A;  3V8J A;  3ZN0 A;  2HDC A;  4ZYE A;  3F8M A;  3KP7 A;  4M74 A;  5D6F A;  2KIM A;  4KN7 X;  5K1Y A;  3TDZ C;  2F2E A;  3ZMZ A;  4RB0 A;  4KA4 A;  3IKV A;  2GA1 A;  2RDP A;  3HUG A;  4LGW A;  1NHA A;  1FX7 A;  5HOO A;  3M1E A;  4A0Y A;  3U2R A;  3GFM A;  1P4W A;  1UST A;  3BPX A;  3KP3 A;  1FP2 A;  4EJU A;  2IRF G;  1S8N A;  4HV6 A;  4GYI A;  3RKY A;  1XMA A;  1OYW A;  3HSF A;  2QZ8 A;  1PP8 F;  1OPC A;  3DEU A;  1ONV A;  2CO5 A;  3WU0 A;  2D2W A;  3KLN A;  3JSO A;  3GF2 A;  3GVA A;  2HWV A;  4EQQ A;  1YO5 C;  2HR3 A;  3MWM A;  5D4S A;  1V3F A;  2RKH A;  2YR2 A;  3DV8 A;  1FYL A;  2XIG A;  3JAM Z;  2PFB A;  2DLL A;  1PP7 U;  2LSO A;  2V1X A;  3MQ0 A;  1K78 B;  3PQK A;  3M9A A;  2BYV E;  1FC3 A;  5FFX A;  3QOP A;  2UZK A;  4EJW A;  1ZYR F;  4M9X A;  4UNO A;  1QPM A;  1OYI A;  2XHK A;  1FYK A;  2P7C B;  1R23 A;  2PEX A;  1SMT A;  4UHT A;  2QEN A;  1D5V A;  1UCR A;  5FLX Z;  4A6E A;  3RTR A;  1U3E M;  4WXC A;  4UVC A;  5D8K B;  2CGP A;  2XGX A;  4ETS A;  1RUO A;  1HST A;  1U5T C;  4HX8 A;  4XBF A;  4OMZ A;  2L02 A;  3QRF F;  1SD6 A;  4O3M A;  4PCQ A;  1J2X A;  1UB9 A;  1IRG A;  5HDG A;  3F21 A;  4MTE A;  2M87 A;  2MBF A;  2VBX A;  4EJV A;  3I0T A;  2NAZ A;  5IT9 K;  1KQ0 A;  2W85 A;  1IN4 A;  2YX4 A;  2QBY A;  3FM3 A;  2LF7 A;  2XAQ A;  4M73 A;  4MTD A;  4P5O A;  4CDG A;  1HW2 A;  5BOX A;  2HTJ A;  2QQA A;  1J0R A;  5K5O A;  1W5T A;  4BHP A;  1B6A A;  5J6X A;  3FWE A;  3HRS A;  2PQ8 A;  1SMY F;  4IRI A;  3WE3 A;  4EJT A;  1KYW A;  4P9F A;  4FHT A;  1R22 A;  1QNT A;  1WRJ A;  4IJA A;  1RZ4 A;  4LK0 F;  3P9C A;  3VEP A;  2R7F A;  5FLX K;  2F5D A;  3WTT C;  4GO1 A;  3J80 Z;  1DP7 P;  3HTS B;  2DQL A;  1IN5 A;  3QU6 A;  3M8E A;  5CYV A;  1I5Z A;  1DDN A;  1FZP B;  3GW2 A;  3D0S A;  2RN7 A;  1O3R A;  2JPC A;  3NRV A;  3IKT A;  1TQI A;  1LQ1 A;  3DXJ F;  4EGY A;  1LEB A;  3R0A A;  2CG4 A;  3QAH A;  4OU0 A;  5E18 F;  4KN4 X;  3ECH A;  1U2W A;  1QZZ A;  2BGC A;  4G7Z F;  4AIK A;  3D5L A;  2VN2 A;  3RPU A;  2PMH A;  4EGZ A;  2PMU A;  3CUQ B;  1R7J A;  1I1S A;  1QGP A;  3LQQ A;  2L3D A;  2OQR A;  2E7W A;  4RGX A;  4G6D A;  2D1H A;  1BJA A;  2R7D A;  5DCF A;  4L5I A;  2H6B A;  4JQF A;  1U6G A;  2P6T A;  3CUO A;  2TDX A;  3TQN A;  2P4W A;  4ON0 A;  1YG2 A;  2VE9 A;  3IWZ A;  4LD5 A;  1ULY A;  4ESB A;  3C1D A;  2Q2E A;  1W7P A;  2DT5 A;  5E1X A;  3HRM A;  1J9I A;  2BE5 F;  1BN5 A;  4O5V A;  4XSX F;  2OQG A;  2RC4 A;  5AIQ A;  5F6F A;  3F23 A;  1JXS A;  3V7S A;  2EFQ A;  1XCB A;  3BJA A;  3GO5 A;  5E20 A;  2STT A;  3QU3 A;  1SFU A;  5F64 A;  3RIR A;  5ICC A;  5H20 A;  4IHT A;  2QLZ A;  5LHH A;  3LAJ A;  1EH8 A;  4FT8 A;  1KQ9 A;  2XAG A;  2MH9 A;  5LEJ A;  3RYR A;  1B59 A;  3WGH A;  2V1U A;  1FY7 A;  3GEZ A;  3U9G A;  3BDD A;  5DCM B;  3WTS C;  2EA2 A;  1OKR A;  2ELH A;  4U0Y A;  3ABU A;  2LDU A;  2IPQ X;  5ILS A;  2LKP A;  3LWF A;  1Z9C A;  2ZBK A;  1LB2 A;  3DPL C;  1GXP A;  4ESJ A;  3TKY A;  1IZ1 A;  4I02 A;  4LLN A;  1R00 A;  4XSZ F;  5E1Z B;  5KVR A;  3KET A;  2DK8 A;  3SQN A;  5L3G A;  1Z7U A;  4O6J A;  4HQE A;  2HGC A;  2QYO A;  1MDM B;  3N4M A;  3ZMT A;  4L9T A;  3DQV C;  1XCV A;  1FT9 A;  3KZZ A;  3COA C;  1QZY A;  2EWN A;  3M8F A;  1SAX A;  2O61 A;  4LB6 B;  3KEQ A;  2HKX A;  3K9T A;  2FXA A;  4DNC A;  1KYZ A;  1FLI A;  2F5C A;  5HLH A;  4MEX F;  1O7L A;  1XGM A;  3DP7 A;  1MJA A;  1GVJ A;  3ZP5 A;  5LHG A;  4RGR A;  1ZLK A;  2ZJ2 A;  1ZN2 A;  2RV8 A;  5FB2 A;  3I64 A;  3WTW C;  3FMR A;  5BMZ A;  3I5U A;  2PLY A;  1P2F A;  1IXR C;  2CFX A;  1J5Y A;  1FWZ A;  1HW1 A;  3KCC A;  4GCV A;  1ZGJ A;  1BM9 A;  3EYI A;  4ENM A;  5CVJ A;  4R8H A;  3VOD A;  3I53 A;  2HTS A;  2MC3 A;  2D45 A;  2FNA A;  2ZME A;  2VOP A;  2FRH A;  3EYY A;  2V6C A;  3BPV A;  1CF7 B;  1BI1 A;  2IW5 A;  1B4A A;  2K86 A;  4Q48 A;  2JT1 A;  3FF5 A;  3I71 A;  1L0O C;  1IAW A;  5E8G A;  1R1U A;  1TNS A;  1Z91 A;  3FXR A;  3ZMS A;  5ERI A;  3I59 A;  4JK1 X;  3EET A;  4ASN A;  2GQQ A;  2O3F A;  1BBY A;  3KFW X;  1XGS A;  1LNW A;  4IRH A;  2K4B A;  3SHF A;  3ROU A;  4M9S A;  2XAJ A;  1IRF A;  4WCG A;  3IL2 A;  3ULQ B;  1P4X A;  5CJ9 A;  4OIP F;  1W4M A;  5DV5 A;  3T1B A;  1T98 A;  2MH2 A;  4K2E A;  4KUM A;  5LGT A;  2NNY A;  4A2U A;  2Z3Y A;  2HEO A;  4S04 A;  2M8E A;  5HDN A;  5BPI A;  2HOE A;  2FBK A;  2GA2 A;  2Z9O A;  4ZYD A;  2A3S A;  4HF0 A;  1EH7 A;  2DFI A;  4ZZL A;  3AAF A;  5JFR A;  1U78 A;  4KMF A;  2YSR A;  3BP8 A;  5KK1 A;  2NYX A;  5FFZ A;  1Y0U A;  3E6D A;  3E5X A;  1ZG5 A;  2P5L C;  2DQR A;  1U5T B;  1LDK B;  3P9K A;  2W57 A;  3Q5F A;  3GZ5 A;  2DU9 A;  5HS9 A;  4A6D A;  1YFH A;  1HKS A;  3FM5 A;  5AON A;  4YFN F;  2R3S A;  1ZH5 A;  1X3U A;  3O2P E;  2IVM A;  2P6S A;  3K69 A;  4UVA A;  4LB5 A;  2DPU A;  1ON1 A;  4HZF A;  5HLI A;  2CYY A;  5J8F A;  2VE8 A;  1I27 A;  1OYY A;  2IJL A;  2MA3 A;  4NHJ A;  4RB3 C;  2FA5 A;  1R5H A;  1T0F A;  2P5V A;  3WTY C;  5DD8 A;  2FBH A;  1KQ8 A;  3L00 A;  4B09 A;  2W25 A;  1YS6 A;  3HSE A;  2VBW A;  2JSC A;  1U8R A;  4L9V A;  3E3V A;  4HQM A;  1YW8 A;  2V9V A;  5H6Q A;  3K1P A;  5HS8 A;  2HZT A;  4I2O A;  1Q1H A;  2O6G E;  4P9U A;  1J75 A;  4I01 A;  1R5G A;  4G6Q A;  2EV0 A;  2JTV A;  2F5E A;  2EV6 A;  1ZRE A;  3CO7 C;  1BI2 A;  4RAZ A;  5JI6 A;  1ON2 A;  4NB5 A;  4CO8 A;  4EV0 A;  3EQL F;  1R58 A;  2J5O A;  5DEQ A;  3F8F A;  3LA2 A;  2OBP A;  1Z05 A;  2P8T A;  4CXF A;  4Z2Y A;  3BOQ A;  4L0Y B;  4CZZ A;  1ODD A;  2EFO A;  3ELK A;  4XLN F;  4HYE A;  3KP4 A;  2E1C A;  3ABT A;  3RKW A;  3GUD A;  2WWY A;  1Z6R A;  4OOI A;  4R1H A;  3BJ6 A;  1FSE A;  2Q0O A;  5BPD A;  2HQR A;  2FMY A;  3V4G A;  5DUK A;  4PGG A;  3V8L A;  3K2Z A;  2QBY B;  1LVA A;  3M7G A;  2IT0 A;  2OU2 A;  4BH9 A;  3L2C A;  1XSX A;  3RKX A;  1H0M A;  4Q4Z F;  4EM0 B;  2IA0 A;  3WE2 A;  3WGI A;  2KRF A;  3JAM K;  3H3Z A;  1UHM A;  1K6O A;  4N0B A;  3VOE A;  3GLX A;  3R6S A;  4KMU X;  1REP C;  4WWC A;  3FX3 A;  1YYV A;  5A2Q Z;  2CQK A;  2FEZ A;  2CSO A;  2PG4 A;  1YQA A;  2QM3 A;  3DKW A;  1UHW A;  5JHU A;  4MQ9 F;  1O3Q A;  2UXX A;  2GWR A;  1FOK A;  5ILU A;  4KIB A;  4OMY A;  3ZQ7 A;  4FX4 A;  4UV8 A;  2P7V B;  3DPT A;  2M1B A;  3RPQ A;  2RNJ A;  5LLQ A;  5L3D A;  5EEG A;  3JTG A;  4OIO F;  1R1T A;  4TV7 A;  5TJJ A;  5FO5 A;  5FGM A;  1JE8 A;  3W6K B;  2O0Y A;  2ZNZ A;  5DYM A;  5J8C A;  2A6H F;  4LLG F;  4UVB A;  1XGN A;  2ZFW A;  4XRF A;  3E6B A;  3P7N A;  2WTE A;  1HKQ A;  4WXH A;  2CW0 F;  4RB1 A;  3V7C A;  1V4R A;  1IXS B;  4LG0 B;  4YG2 F;  3HSR A;  1E17 A;  5CVR A;  1H9T A;  2K7L A;  3E6M A;  2OZ6 A;  1FBU A;  4AWX B;  3FMS A;  4M6X A;  3E97 A;  1KGS A;  1F5T A;  2P5K A;  4NQW A;  3J80 K;  1D8J A;  5L3B A;  4PDK A;  2DPD A;  3Q9V A;  4F7Z A;  3GZ6 A;  2M45 A;  1IN7 A;  2VC0 A;  1TQM A;  1HKT A;  3I58 A;  4HV5 A;  3CUQ A;  2QUF A;  3I4P A;  2ZCW A;  3KZY A;  4U7B A;  1FNN A;  4YIF A;  3QPT A;  4XLP F;  2A07 F;  4E70 A;  1CGP A;  4N9H A;  1YLF A;  5LHI A;  1O3T A;  4IVN A;  4GXO A;  2H6C A;  1YW9 A;  3O6B B;  2RGV A;  1Z1D A;  1D3Y A;  4A0X A;  1ZAR A;  2A6E F;  2BV6 A;  4G8X A;  4AIJ A;  1MJ9 A;  2A5Y B;  1J59 A;  5BQT A;  2VC1 A;  3BWG A;  1K7A A;  2MD5 A;  2EA4 A;  3WG9 A;  4I0B A;  4RS8 A;  1G3S A;  3WTV C;  1RUN A;  3MEX A;  4Q47 A;  1O3S A;  3K1N A;  3HRT A;  1R36 A;  2QVO A;  3IWF A;  2UWM A;  4M9Z A;  2OAZ A;  4BHB A;  5DUI A;  1G3Y A;  3BZ6 A;  5D5W B;  5ICE A;  4A5N A;  2X0L A;  4BAY A;  4HX4 A;  4LLL A; 
#chains in the Genus database with same CATH topology
 2L7Z A;  3SZP A;  1VQL I;  5LBQ A;  3JSP A;  1Z6T A;  1VQM I;  4C3H J;  2VBZ A;  4L5J A;  4LIV A;  1IO2 A;  5D5V B;  1YIT I;  1D1C A;  1D5Y A;  2L54 A;  2MLG A;  2XUB A;  5EG0 A;  2NVY J;  2JUC A;  4XMY A;  2AQF A;  3C18 A;  3MMY B;  5C3E J;  3IC7 A;  1L3L A;  2KJB A;  2PI0 A;  3HIF A;  5DCM A;  2BEO A;  2D1V A;  1YRN B;  4ZTF A;  4DYC A;  3ZRG A;  4A3L J;  1ERD A;  4B48 A;  4A3D J;  3A0H C;  2NVU B;  1ETK A;  1D0Z A;  4HLX A;  3LST A;  3F22 A;  1MSF C;  1D1A A;  2OA4 A;  1OR7 A;  5D5U B;  3QP5 A;  2F4M B;  3H0G J;  5B5E C;  3JRI A;  1Z77 A;  3NAR A;  1TBX A;  2BVL A;  1E2X A;  3ESW B;  4WF2 A;  2OTL I;  4F55 A;  1PDN C;  1BIA A;  4NC7 A;  3KX2 A;  1JGG A;  1MSE C;  3BT9 A;  2QKM B;  4A12 A;  1T2K A;  3O3K A;  3J7Z I;  3OR1 C;  3QP6 A;  3QYB A;  1SD5 A;  4HA8 A;  1A36 A;  3ZMD A;  2DJN A;  4XID A;  2UXN A;  2I5U A;  3PIP F;  2COM A;  1M1E B;  1N77 A;  4ZYG A;  3JCU C;  1MBF A;  3AL0 B;  3LA3 A;  1MBG A;  4L9J A;  1TW3 A;  2QQ9 A;  2IBD A;  2K27 A;  1UEL B;  2KIQ A;  3CJR B;  4PFP A;  1OCT C;  3E0J B;  3RJP A;  3BG5 A;  4YFX F;  3TED A;  3HYI A;  1MDM A;  4QPQ A;  5JVT A;  3KIO A;  4IXA A;  2E60 A;  4KT6 A;  4HDV A;  1BC8 C;  6PAX A;  1WI3 A;  3J7A O;  2JZY A;  2L7K A;  4OAZ A;  1ZGW A;  1I6X A;  1T8I A;  1GHC A;  1HLV A;  3WTZ A;  2DW4 A;  4ENJ A;  1TWG J;  2YPR A;  2EQR A;  1DU0 A;  1OCZ H;  2LKX A;  3A03 A;  3K4B A;  1ETW A;  3HB9 A;  2V26 A;  1ACI A;  1R9T J;  4PFO A;  1FEX A;  4M3D A;  2AHQ A;  2HI3 A;  5HOD A;  5LEK A;  4IZZ A;  4BY7 J;  5K7F A;  4E7K A;  3TO7 A;  2VUM J;  1KU9 A;  1STZ A;  1YHQ I;  3M8J A;  2XKO A;  2CFO A;  2H94 A;  2Y9Y A;  2K9M A;  1RET A;  2DN0 A;  1B72 A;  3OV8 A;  1XX5 A;  2J5P A;  1IRZ A;  5EJC A;  1MBH A;  2IGM A;  3BTI A;  4MQV A;  4XLE A;  1MMG A;  2GXB A;  3REO A;  2A68 F;  2OCE A;  2CW8 A;  3BTC A;  2DYS H;  2FE3 A;  1Y1W J;  2XRO A;  1MD0 A;  4F52 A;  2LK2 A;  1QBJ A;  4DYQ A;  1S72 I;  2ZJQ F;  4U7D A;  2LY2 A;  5HNF A;  5CVU A;  2HS5 A;  2JRM A;  3GFJ A;  1X1C A;  2VJI A;  3U1D A;  5E3M A;  1HF0 A;  1POG A;  4S05 A;  4BDZ A;  4DW6 A;  1CQT A;  4ABZ A;  2ECB A;  4Q5S F;  1CF7 A;  3IHU A;  4DQ2 A;  3FMQ A;  2OZU A;  4LK1 F;  1K79 A;  2L01 A;  3C7J A;  2DT7 B;  5D6E A;  3HTU A;  2DA5 A;  1D8K A;  2JPB A;  5HLG A;  3IRR A;  3S1R J;  2DDB A;  1RES A;  2TRT A;  4EEF G;  1SD4 A;  5L3E A;  4I76 A;  2ACJ A;  4Y33 A;  5F27 A;  3WHC A;  3ZMU A;  4BQQ A;  4IPA A;  1OR7 C;  1J7K A;  4BJ5 C;  4M71 A;  5H6R A;  2DA4 A;  4XLF A;  1XPX A;  3Q9S A;  4PJL A;  1XB4 A;  3E5Q A;  3A02 A;  4UXN A;  1QU3 A;  2IP2 A;  4OIQ F;  1OLT A;  2LF8 A;  2HXI A;  2NVX J;  3PQJ A;  5FJ8 J;  1FBQ A;  3GFI A;  2JA6 J;  1WJC A;  1Z0X A;  3T8T A;  2EB7 A;  4BYY A;  4XRM A;  2XSD C;  2NRA C;  4J19 A;  2MLK A;  4M72 A;  3GFL A;  1FOY A;  1MH3 A;  1IW7 F;  1QQI A;  2E1M B;  2YUS A;  2EH3 A;  1XSV A;  3F3X A;  1Z3Y A;  3S93 A;  1ETQ A;  1ZRC A;  2OF7 A;  4CYD A;  4UY8 I;  4DOZ A;  3LFK A;  1AU7 A;  3QOD A;  5FRN A;  1K6Y A;  3HUG B;  3JRD A;  2G0E A;  3WGG A;  2EBI A;  2FD5 A;  4A3B J;  1GVD A;  1IN8 A;  3E5U A;  2B7E A;  1ZRD A;  2W84 A;  4XKV A;  1QRY A;  2WV0 A;  3I54 A;  3S3O A;  3OS2 A;  1JT6 A;  4I0A A;  1TNT A;  4V19 K;  2VBY A;  3FK6 A;  2VKD A;  2WAF A;  1S3J A;  1P7J A;  1YIO A;  3CLO A;  4Y17 A;  1ETY A;  5IP6 A;  3FXK A;  3CJN A;  4M6Y A;  2M0C A;  2KIF A;  3GXO A;  5IT3 A;  2WB1 A;  2HKO A;  1WI9 A;  2CH0 A;  4HNV A;  2DAO A;  1FP1 D;  1UFM A;  4EM1 A;  1WJD A;  3QQA A;  3JTH A;  3SFI A;  3EPZ A;  2L4M A;  1JHF A;  1IXC A;  1XD7 A;  1MNE A;  2V1D A;  4BS9 A;  1U5T A;  1KU7 A;  3HBL A;  2NNN A;  5HS7 A;  2LOO A;  3KYC B;  5D8L B;  5K5Q A;  5C4J J;  1E0E A;  1AKH A;  3JRH A;  2ECC A;  3WTX C;  2LRD A;  4ZZD A;  1YS7 A;  2R7W A;  2NVT J;  3FDY A;  4GGG A;  3LNQ A;  3B02 A;  1SVO A;  1WQ2 A;  4LJZ F;  5M5X J;  1VQ8 I;  1YJW I;  2DJI A;  2VJ5 A;  2FBI A;  1P4A A;  1RIO H;  1D0Y A;  2XGE A;  1LJ9 A;  4RAY A;  2FF4 A;  3ZN1 A;  4IHY A;  2EK5 A;  2ELJ A;  4BQA A;  5C44 J;  1BOB A;  1S7O A;  2FSW A;  2LC2 A;  4BNC A;  1T39 A;  1I3Q J;  3M1C A;  1ZEL A;  4B4C A;  3EUA A;  1B1B A;  1NTC A;  2Y0M A;  4PK4 A;  1GDT A;  4LIU A;  3OL4 A;  1F1Z A;  3G1O A;  4CYC A;  3BRO A;  5TRD A;  5ICF A;  5GTI C;  3BR3 A;  3ZPL A;  5B1B H;  1B9M A;  4LMY A;  2KJC A;  3V8K A;  4AIH A;  1A31 A;  3KEO A;  2V4J C;  2BHY A;  1Y39 A;  2DA2 A;  1G4D A;  2XV4 S;  3Q0V A;  4BGD A;  2JSP A;  2K5C A;  2CUJ A;  4B47 A;  3L09 A;  3FBI B;  4DGW B;  2HYG D;  5LD2 C;  2RQP A;  3MKZ A;  3N05 A;  1K61 A;  2GIV A;  3ZQF A;  3ML6 A;  5EEH A;  3JW4 A;  2Z16 A;  4PJ0 C;  3QPH A;  4DIQ A;  4C2T A;  2DO7 A;  3BC8 A;  2V79 A;  5CVI A;  3MKL A;  3K7A J;  2L9V A;  3OOP A;  4YIR X;  1TC3 C;  4PSW A;  4U88 A;  4XLA A;  2AXL A;  5IT9 Z;  2DI3 A;  2X1E A;  2VOD A;  1T95 A;  2XAF A;  1Y56 A;  2CW7 A;  4D7M A;  1W0T A;  1LUJ B;  3H3U A;  3L2V A;  1EA3 A;  4ZDL A;  3PSF A;  3F72 A;  2OD5 A;  5HLT A;  3PUF A;  1W36 C;  3FXQ A;  4MGR A;  4B8X A;  2PJP A;  2QQB A;  1GXQ A;  3MFK A;  4BHC A;  1HQC A;  2WBM A;  1XMX A;  5CVV A;  2CJJ A;  2VPL A;  1RNL A;  3QOE A;  5LGU A;  2E34 A;  4E7L A;  3ZQI A;  3RI4 A;  3I9V 2;  3CC7 I;  1P6R A;  2GXG A;  3HJE A;  2STW A;  3P9I A;  4HAM A;  3OYE A;  4D9J A;  3HHG A;  2FX0 A;  5CLS A;  1XMK A;  3ZQQ A;  2YU3 A;  1G3T A;  1K78 A;  2W24 A;  2NS0 A;  2KZV A;  2R7S A;  3R4K A;  4HLY A;  4KDP A;  2IS1 A;  2OPT A;  4IQJ A;  1A35 A;  3ZQG A;  2IXS A;  1KU2 A;  3DTE A;  2PMZ A;  2ZXI A;  3TGN A;  3JR9 A;  3KP6 A;  5DD4 A;  1HBX G;  4CCM A;  1FYM A;  2JVG A;  2LRE A;  3FHZ A;  4N9I A;  4XN0 A;  2R5Y A;  2P81 A;  3TO9 A;  2G7U A;  4Y3O A;  2OCC H;  3B73 A;  5IYB J;  2LMD A;  1R1V A;  2VIX A;  2XAS A;  3BCB A;  4JBA A;  2R0Q C;  3HOT A;  3MZH A;  1K83 J;  3P5J A;  5FRO A;  2QEX I;  1RC9 A;  3F6V A;  2Y69 H;  1AWC A;  1JKO C;  1HA8 A;  3S8P A;  4FE4 A;  2CV0 A;  2X1D A;  5GPC A;  5EDN A;  1YTY A;  3WOD F;  3K70 D;  1JUM A;  1S6L A;  2FJ1 A;  2PN6 A;  2CV1 A;  1T6S A;  1SD7 A;  3H3V K;  2I10 A;  2IGN A;  1MNM C;  4FIS A;  1B8I B;  1LFB A;  1ZG1 A;  4PSX A;  2AS5 F;  4IKF A;  3HM5 A;  1A6I A;  4Y13 A;  1T38 A;  2KMU A;  3M3Y J;  3CDL A;  4QPO A;  4XKC A;  1I1G A;  4P96 A;  3OYA A;  2QA4 I;  1NH3 A;  1VF9 A;  4IOC F;  1DUX C;  4IHX A;  3HZJ A;  1OFC X;  1X1A A;  4YII A;  5K5R A;  3LSP A;  2EJR A;  1LEA A;  1BC7 C;  1JUS A;  1MZB A;  1SFO J;  2HU9 A;  2FML A;  1WWX A;  3AG4 H;  3MD2 A;  2ZKZ A;  1W36 D;  3LA7 A;  4W97 A;  3DU6 A;  3T0Y A;  1TZL A;  2JA2 A;  2Z2S B;  4L0Z B;  2VOO A;  3RSN A;  1KU3 A;  3G3Z A;  1WHU A;  4AYB A;  2R5Z A;  3GTP J;  3GTM J;  2DOF A;  1H8A C;  2FQ3 A;  1ZRF A;  2KKO A;  2ISZ A;  2KPM A;  3MAJ A;  3S2W A;  1YI2 I;  3MZY A;  2XPU A;  2QSG X;  1TP4 A;  2Y0S N;  4PJN A;  2MGQ A;  3L7W A;  4ENK A;  4G9Y A;  1S7A A;  3IRQ A;  1JT0 A;  1LKX A;  2G7H A;  3OMY A;  2V9P A;  4OIR F;  1ITY A;  5EGO B;  2L9S A;  2O8X A;  5E17 F;  4PJJ A;  4XNF A;  1BOA A;  2KIU A;  1K4S A;  5E8I A;  1WSU A;  1YW7 A;  2BW3 B;  2L5Q A;  2XRN A;  1OCP A;  3CO6 C;  4BJ6 C;  2C6Y A;  4XKB A;  5FKM A;  1B9N A;  4EM2 A;  2BY1 A;  1YJ9 I;  1HC8 A;  2KT0 A;  1RI7 A;  4FX0 A;  5DS9 A;  2HQ5 A;  4BUP A;  2QWW A;  4A0Z A;  2LTP A;  3TOA A;  5IOZ A;  1HSJ A;  3KPH A;  2RAE A;  1MIJ A;  3R61 A;  2VL8 A;  1BIB A;  1LDJ A;  1FSH A;  2ESH A;  1W5S A;  4I98 B;  4WXD A;  1QPI A;  2IGO A;  4Y15 A;  5GP9 A;  5A2Q K;  3CC2 I;  1F36 A;  4ZH4 F;  1DPR A;  1YX5 A;  2VT2 A;  4XON A;  2FOK A;  1HW5 A;  1RRJ A;  2CQN A;  4KJZ A;  1HXD A;  2A69 F;  4XRS A;  2HQN A;  1SFE A;  4DBQ A;  1IF1 A;  1F43 A;  4KIG A;  3OR2 C;  2LNB A;  4CZC A;  3VFZ A;  2DMN A;  5FD5 A;  1IC8 A;  4I09 A;  1I50 J;  2BY3 A;  2G9W A;  3BG6 A;  3H9J A;  2M4G A;  3NQO A;  3ZQH A;  1ZG3 A;  1WKM A;  1AOY A;  4EJO A;  1C0W A;  2XKP A;  3OL3 A;  2LY1 A;  2Z33 A;  4RGS A;  3NEU A;  3UR3 C;  4CGZ A;  1FPQ A;  3BTJ A;  4NC8 A;  3B6C A;  3PFI A;  3DFG A;  5FKL A;  3OYJ A;  1ZQ3 P;  1X1P A;  3WU1 B;  1JGS A;  3RYP A;  1UHS A;  1XDU A;  2EZL A;  4W1U A;  3HKZ N;  2VKH A;  1RR8 C;  3CMM A;  1MJB A;  1Z67 A;  4BXU A;  5DDG A;  1IUY A;  1ZHF A;  4XN3 A;  5J40 A;  3DCF A;  2DA1 A;  4HOB A;  2R7V A;  3F8B A;  5LGN A;  1PUE E;  2Q2E B;  1W7P B;  4FE7 A;  3ISP A;  3MCZ A;  2L9N A;  4G94 A;  4LG0 A;  3VB2 A;  4D1Q A;  4IHS A;  2WAQ A;  1XDS A;  4ITV A;  5GTH C;  1O7F A;  5JHF A;  1EV7 A;  4EAT A;  1P92 A;  1MGT A;  1F4K A;  1TW2 A;  1FMV A;  3OYI A;  2L4A A;  3K0L A;  3HPG A;  2K02 A;  2EV5 A;  4A3K J;  4A5M A;  2FU4 A;  4DBR A;  4M3G A;  2E2H J;  2DCE A;  1T33 A;  4IHV A;  4G7O F;  3SFZ A;  1S9H A;  2GAU A;  3ZXS A;  2VQH A;  4HW0 A;  3PSI A;  9ANT A;  4KIS A;  5LRR A;  1FBS A;  4KYW A;  3W3C A;  2ID3 A;  1PUF A;  1UG0 A;  3IH4 A;  1TT0 A;  2X1C A;  3PNT A;  2XAH A;  1V5F A;  3G73 A;  4AD9 A;  1A04 A;  1JHH A;  2IA1 A;  4F91 B;  4ZDO A;  4ESF A;  3SZT A;  1H89 C;  1QA6 A;  1EKE A;  4HNU A;  2M0M A;  4RB2 C;  3CD6 I;  4CHU A;  2M7A A;  1KA8 A;  3TOB A;  2Z5U A;  4QLC U;  4GFB A;  3ERM A;  1WGX A;  3K1M A;  4M3F A;  1MBK A;  3PNY A;  1ZAO A;  2H27 A;  3AG1 H;  5GAG J;  1VI0 A;  4BXF A;  5ED4 A;  4MFE A;  1VTN C;  4C2M J;  3IH2 A;  3IUO A;  1TLH B;  4DJA A;  2ZXJ A;  3SXY A;  3E6C C;  2EFW A;  1X2N A;  3DWL E;  3KLO A;  4MNU A;  4IF4 A;  3FK7 A;  1OIS A;  3C3W A;  3HXL A;  4HX7 A;  3PL8 A;  4HPQ A;  3T5X A;  4I7H A;  4U0W A;  4LIT A;  2JQ7 A;  5JR3 A;  3KE2 A;  3FXU A;  1S29 A;  1JKP C;  5M3F J;  4H0E A;  2LVS A;  3QYE A;  2R4G A;  2DBB A;  3EDP A;  4BDY A;  3H5N A;  3QPS A;  2E1N A;  1WJA A;  1N78 A;  2E19 A;  3A4C A;  5AIP A;  3RQ4 A;  4MEY F;  3HHH A;  4XM3 A;  2ADU A;  3WU2 C;  4G7H F;  4MIM A;  3WTU C;  2M30 A;  3S17 J;  3I56 I;  3CC4 I;  2ZXH A;  1WVR A;  4L9N A;  2H09 A;  3HEF A;  2DYR H;  2O9L A;  2DMU A;  2DK5 A;  4R79 A;  1FOW A;  1LDD A;  3FXM A;  4LOC A;  3LAP A;  3D1N I;  4YFK F;  1DPU A;  1VQK I;  4Y52 J;  3VWB A;  1TQP A;  5FKK A;  4D5F A;  2OJE D;  4P1W A;  3A01 A;  1EJ9 A;  2DA3 A;  2WC2 A;  2ZO4 A;  2DXI A;  5GAH J;  4BBR J;  1VQ4 I;  2ESN A;  3GX4 X;  5F1R A;  4D0P A;  5F0C A;  4WX9 A;  2QF7 A;  1TWC J;  4IL6 C;  4E6K G;  4UUV A;  2RVC A;  3VSL A;  2JRT A;  2VQL A;  3FZV A;  1BR2 A;  1XGO A;  2PJR B;  4CIC A;  2KRH A;  5D4R A;  4UV9 A;  2JWT A;  3J81 Z;  3BG3 A;  4P55 A;  3CUQ C;  2V7F A;  4XLH A;  3GME A;  3BY6 A;  2ZNY A;  4PGH A;  4WK8 F;  3NWS A;  2LH9 A;  1P9Q C;  4RAG A;  3HOS A;  3GYH X;  2B9S A;  2DOA A;  2WB1 N;  2X6X A;  3IV5 A;  1USS A;  1YRN A;  4IRG A;  1IN6 A;  1W1W E;  1F9N A;  4XQF A;  3F9K A;  3T8R A;  5BS6 A;  4ENN A;  4KNY A;  2CRG A;  2Q8K A;  5L3F A;  2YX7 A;  4L18 B;  1VQ6 I;  2TCT A;  2VXD A;  3RDI A;  1IJW C;  2VXZ A;  3HPH A;  2MG4 A;  3CDI A;  1MBE A;  4EMS A;  2CWE A;  4HBL A;  3CCM I;  2EIM H;  4N4N B;  3CCV I;  1Y8R B;  3KP2 A;  4A69 C;  3RCO A;  4F92 B;  5FLM J;  2IA2 A;  5HVQ C;  3W6J B;  4OIN F;  4RGU A;  2Y48 A;  2ZME B;  5C4X J;  2QSH X;  3HRU A;  4QWQ A;  3CP2 A;  1O57 A;  3RPU D;  2VKE A;  2K4J A;  4HDU A;  1O4X A;  1VQ7 I;  2Y75 A;  3NWT A;  2PBI A;  3KP5 A;  2X4H A;  3BZK A;  3LQR A;  1XSD A;  1LFP A;  2ETH A;  3DF8 A;  1RKW A;  2DMT A;  4LFU A;  4ZYH A;  2HFH A;  1E3H A;  2DTR A;  2Z99 A;  3F6O A;  3H92 A;  3I59 B;  1G3W A;  3VSK A;  1MKM A;  3I4M J;  2A05 A;  2O03 A;  5FD6 A;  1VZ0 A;  2VON A;  3CLQ A;  5ILV A;  3CTA A;  1U9N A;  2X6O A;  1H9G A;  4RAF A;  5D5X B;  1TTY A;  3F8C A;  3J81 K;  4HF1 A;  4J00 A;  4NDL A;  2O7O A;  2A61 A;  2FNP A;  3S3N A;  1GV2 A;  1SC7 A;  4IEJ A;  1I39 A;  2B0L A;  2E35 A;  3BLY A;  4MFD A;  4GRI A;  2BY0 A;  4A3J J;  2M5W A;  5M5Y J;  1BI3 A;  2K3P A;  4JX4 A;  2ZJP F;  2VKV A;  4ZDP A;  4V2F A;  1UMQ A;  2F5F A;  4OWR B;  1W7P D;  3Q0U A;  3V42 A;  5J47 A;  3R0J A;  5L3C A;  3K4N A;  2CQQ A;  1E3P A;  4M6V A;  1TL8 A;  3ERE D;  4MHG A;  2K3F A;  3EUH A;  3TO6 A;  4KFC A;  1XN7 A;  2ISY A;  4KIF A;  3PJR A;  5E1W A;  2MFZ A;  3HDD A;  3GWZ A;  1G6N A;  3E7L A;  5E3O A;  1OMI A;  4KT5 C;  2AXT C;  1ZGA A;  2KRC A;  1S7E A;  2B63 J;  1SFX A;  3WHB A;  3BJO A;  3ECO A;  4KIC A;  4BE2 A;  3W2A A;  1JKQ C;  1EH6 A;  2V9K A;  1BW5 A;  3V7R A;  4U0V A;  4G6T B;  3L9F A;  4UUS A;  3CCL I;  3I55 I;  2GZW A;  4GYG A;  2VJ4 A;  3TDU C;  3TBI A;  2VQG A;  1IDZ A;  3S1M J;  1D0X A;  3KYD B;  5HDK A;  5LRS A;  3CDH A;  3N97 A;  1QO0 D;  1WJE A;  2L7M P;  1JUP A;  3FKI J;  3S1N J;  2VT3 A;  3R60 A;  4OAY A;  2E7X A;  5E3L A;  1TWA J;  5ICG A;  2XVC A;  2BZT A;  2EIJ H;  2BBY A;  1WJF A;  4CCN A;  5J4Y A;  3CP8 A;  4PZJ A;  3S3M A;  4FAS D;  1YE9 A;  2OC6 A;  3BR2 A;  3F8N A;  4I99 C;  4EVI A;  3ZMV A;  1BI0 A;  4RM3 A;  2M2E A;  1MMS A;  1ZLJ A;  2EFN A;  2HYF A;  2VB6 A;  4AVP A;  2EFP A;  2LBF B;  3V8J A;  2ZSH B;  4XLC A;  2VI6 A;  4NNJ A;  3ZN0 A;  4AU7 A;  2HDC A;  4ZYE A;  3HOV J;  4LG3 A;  3M4O J;  3K6G A;  4II3 A;  3F8M A;  2M4K A;  1S5L C;  3KP7 A;  3A2K A;  4M74 A;  1Y8Q B;  1YOV B;  5D6F A;  3OYH A;  2KIM A;  4KN7 X;  5K1Y A;  3TDZ C;  2F2E A;  3ZMZ A;  4RB0 A;  4CUG A;  4KA4 A;  3IKV A;  2R7X A;  2GA1 A;  1WPK A;  1D1B A;  2HXO A;  2RDP A;  4XR6 A;  3HUG A;  4LGW A;  1NHA A;  1FX7 A;  3ONQ A;  2GXA A;  5HOO A;  3GTK J;  3M1E A;  4A0Y A;  3I3L A;  4FTH A;  1WCM J;  1APL C;  2HDD A;  2CUE A;  3LSR A;  5F04 A;  3U2R A;  2QSF X;  3GFM A;  1P4W A;  4KIT B;  1UST A;  4BY1 J;  4H4K C;  1X1D A;  5DM7 F;  3BPX A;  3KP3 A;  4BL0 B;  3PO2 J;  1FP2 A;  2K9N A;  2OUM A;  2HPM A;  4AID A;  4EJU A;  2IRF G;  1X1B A;  2BVM A;  4AM3 A;  3VYR B;  1X2M A;  3MZ8 A;  1S8N A;  5J1U A;  4HV6 A;  2Z1D A;  4AVZ A;  4GYI A;  2ZFU A;  3H5R A;  3RKY A;  1XMA A;  3RZO J;  1OYW A;  3GLL A;  3B6A A;  2BHZ A;  3HSF A;  2HVQ A;  2QZ8 A;  3EUH C;  1PP8 F;  1P7I A;  1OPC A;  3DEU A;  1ONV A;  3GTL J;  3GTG J;  1ETO A;  2CO5 A;  1UG2 A;  4BEH A;  2XAU A;  4C2U A;  1Z3X A;  3BCA A;  2DA6 A;  3WU0 A;  2D2W A;  3KLN A;  3JSO A;  3GF2 A;  4B44 A;  2LY9 A;  3GVA A;  1EF4 A;  2HWV A;  2QQ8 A;  3FKJ A;  4EQQ A;  1YO5 C;  2HR3 A;  3CCY A;  3MWM A;  4B43 A;  5K7Z A;  3G6E I;  2V6E A;  3OY9 A;  5D4S A;  1V3F A;  2DOE A;  1IV6 A;  4CCK A;  3G1L A;  1VQ9 I;  4HST A;  2R92 J;  2RKH A;  3L2R A;  2YR2 A;  3DV8 A;  1FYL A;  3PO3 J;  2VJJ A;  2XIG A;  3DLL F;  3SZG A;  3JAM Z;  1QHG A;  1XTA A;  2PFB A;  2WY8 Q;  1Z7L A;  2DLL A;  1PP7 U;  2LSO A;  2V1X A;  1SVL A;  3HGG A;  3MQ0 A;  1K78 B;  5E3N A;  2R93 J;  3PQK A;  3M9A A;  2I8D A;  1J09 A;  2BYV E;  2QKL B;  3C2G A;  1FC3 A;  5FFX A;  2JK3 A;  3QOP A;  2UZK A;  3AG3 H;  3TL4 X;  4EJW A;  4HEA 2;  1ZYR F;  1BA5 A;  4M9X A;  2LP0 A;  1ORK A;  4UNO A;  3J7A Y;  1QPM A;  1OYI A;  2XHK A;  2A6T A;  1FYK A;  2P7C B;  1R23 A;  2PEX A;  3S16 J;  3C2H A;  1SMT A;  2E1M C;  2R5Y B;  2HZD A;  5CKT A;  2R7U A;  4UHT A;  2E1O A;  2QEN A;  1D5V A;  4JOM A;  1UCR A;  3H9G A;  5FLX Z;  3BG7 A;  4A6E A;  3RTR A;  1U3E M;  1X4P A;  4WXC A;  4UVC A;  5D8K B;  3TMO A;  2CGP A;  1K4T A;  2XGX A;  1FTZ A;  3CCS I;  4ETS A;  1RUO A;  2E36 A;  1HST A;  1U5T C;  4HX8 A;  4XBF A;  5J4V A;  1LE8 B;  3H9Q A;  3HOX J;  4OMZ A;  1WFX A;  2L02 A;  3FXO A;  3OIQ A;  1SD6 A;  3QRF F;  4O3M A;  4PCQ A;  1J2X A;  2KLO A;  2WY7 Q;  1UB9 A;  1IRG A;  2WAE A;  1MMA A;  1W0U A;  5HDG A;  3F21 A;  1WJ5 A;  3GTQ J;  4MTE A;  4F93 B;  2M87 A;  2MBF A;  2W48 A;  2VBX A;  4C30 A;  4EJV A;  2RQQ A;  3I0T A;  3MKY B;  2NAZ A;  4ZYA A;  5KCM A;  5IT9 K;  1KQ0 A;  2W85 A;  1IN4 A;  2YX4 A;  4XKW A;  4BQO A;  1FMW A;  4DZP A;  2QBY A;  4A3C J;  3FM3 A;  4J01 A;  1R5I D;  2LF7 A;  2XAQ A;  4M73 A;  4MTD A;  1DQU A;  4P5O A;  4CDG A;  1HW2 A;  5BOX A;  3LL7 A;  2X6W A;  2HTJ A;  2QQA A;  1J0R A;  2BOL A;  2CUZ A;  5K5O A;  2CS3 A;  1W5T A;  4BHP A;  1B6A A;  5FKN A;  3M07 A;  5DM6 F;  4RLF A;  5J6X A;  3FWE A;  3CZ6 A;  3HRS A;  2KFD A;  2PQ8 A;  1SMY F;  1BR4 A;  4IRI A;  3DTI A;  3WE3 A;  1FIP A;  4EJT A;  1KYW A;  4P9F A;  4FHT A;  1R22 A;  1HCR A;  1QNT A;  1WRJ A;  4IJA A;  4BJT A;  1RZ4 A;  3S1Q J;  2ZXW H;  3OYN A;  1B8I A;  3BZC A;  2XPW A;  4C3I J;  4LK0 F;  3P9C A;  2Y9Z A;  2XRL A;  5TIS C;  3VEP A;  2X85 A;  2R7F A;  5F08 A;  5FLX K;  2F5D A;  3WTT C;  2LYC A;  2RNG A;  4GO1 A;  3J80 Z;  3G1M A;  1DP7 P;  1NG6 A;  3ABL H;  2N8G A;  3HTS B;  2DQL A;  1IN5 A;  4XRS G;  3QU6 A;  3M8E A;  1YJN I;  4ANJ A;  5CYV A;  1I5Z A;  2COB A;  1DDN A;  3OS0 A;  1FZP B;  5IYD J;  4RMN A;  3GW2 A;  4BAC A;  3D0S A;  2RN7 A;  1O3R A;  2JPC A;  2W82 A;  3NRV A;  1IV8 A;  3IKT A;  1TQI A;  1LQ1 A;  2R7T A;  4M3B A;  1JI8 A;  3DXJ F;  4EGY A;  2LG4 A;  1LEB A;  3K10 A;  3R0A A;  3WG7 H;  4NQW B;  5EGO A;  2CG4 A;  3L2U A;  3QAH A;  4OU0 A;  5E18 F;  4KN4 X;  3ECH A;  1U2W A;  3O8G A;  3X2Q H;  1QZZ A;  1R71 A;  2BGC A;  3QYF A;  2XC7 A;  4G7Z F;  1ZK8 A;  4BU2 A;  2BW3 A;  5KAI C;  4AIK A;  3D5L A;  2VN2 A;  2DFH A;  3RPU A;  1T08 B;  2PMH A;  4BE0 A;  4EGZ A;  2PMU A;  3CUQ B;  2Q1Z B;  3H5A A;  4CCL A;  3HL2 A;  1R7J A;  3IH3 A;  4E4H A;  1I1S A;  5GAE J;  1XC5 A;  2D5V A;  3BQZ A;  2XF6 A;  5FKO A;  1QGP A;  2E71 A;  3LQQ A;  1I6H J;  2ICW G;  2L3D A;  2OQR A;  2E7W A;  4RGX A;  4G6D A;  5KNL A;  2D1H A;  3LFU A;  4A3F J;  2LLK A;  1BJA A;  1LVK A;  2R7D A;  4L5I A;  2H6B A;  5DCF A;  4JQF A;  1U6G A;  2P6T A;  2WV1 A;  3CUO A;  4X0G A;  2TDX A;  3TQN A;  2WA0 A;  2P4W A;  4ON0 A;  1YG2 A;  2MC4 A;  2VE9 A;  2AO9 A;  3IWZ A;  4C3J J;  4LD5 A;  1ULY A;  4ESB A;  2WAD A;  3HC7 A;  3C1D A;  2Q2E A;  1W7P A;  2DT5 A;  5E1X A;  3HRM A;  3ZQC A;  2FQ4 A;  1J9I A;  2F4O B;  3OYD A;  1AHD P;  2BE5 F;  3LSJ A;  2E5N A;  3OSG A;  1BN5 A;  4O5V A;  4XSX F;  2OQG A;  2RC4 A;  5AIQ A;  5F6F A;  3F23 A;  1G2H A;  2E2J J;  2MAB A;  1JXS A;  3V7S A;  2EFQ A;  1XCB A;  2M8G X;  2DMP A;  2CQ7 A;  2OTJ I;  2MW8 A;  4RLQ A;  1SFK A;  2NXN B;  4YRV A;  2LR8 A;  3BJA A;  3GO5 A;  5J1R A;  5E20 A;  2STT A;  3EUK L;  3QU3 A;  2H1K A;  1YX3 A;  2E5Z A;  3JRB A;  1SFU A;  5JVG F;  2X51 A;  5F64 A;  4DZJ A;  1OQY A;  2DDA A;  3GBG A;  5IOY A;  3RIR A;  5ICC A;  5H20 A;  1XS9 A;  4IHT A;  2JA7 J;  2QLZ A;  2QCO A;  2K40 A;  5LHH A;  3LAJ A;  3CF2 A;  4GDF A;  2A5W A;  1EH8 A;  4FT8 A;  1R6R A;  4IHW A;  2NOJ B;  1KQ9 A;  4JX5 A;  2XAG A;  3G4S I;  1KZH A;  1A5J A;  2FUG 2;  2QGU A;  1RR7 A;  2JJ7 A;  2YS9 A;  2MH9 A;  5EG0 B;  2AQE A;  5K7H A;  5LEJ A;  3RYR A;  1JJ8 C;  3CMA I;  1B59 A;  3WGH A;  1FTT A;  2L2O A;  2DOD A;  3I4N J;  3K2A A;  2V1U A;  1FY7 A;  2ME0 A;  3GEZ A;  3U9G A;  3BDD A;  5DCM B;  1X4O A;  3WTS C;  2EA2 A;  1OKR A;  2ELH A;  3A01 B;  2LD5 A;  4U0Y A;  3ABU A;  2LDU A;  2IPQ X;  2CV2 A;  5JLW A;  5ILS A;  4IQ4 A;  4E7I A;  3BG9 A;  1GUU A;  3PM1 A;  5F1J A;  2Y0S A;  2DA7 A;  2LKP A;  3LSG A;  3LWF A;  1Z9C A;  3G71 I;  2ZBK A;  2MD0 A;  1VQP I;  1LB2 A;  3HOY J;  2NS8 A;  1OCC H;  4NC6 A;  3DPL C;  1GXP A;  2XB5 A;  4ESJ A;  3FIS A;  3TKY A;  1IZ1 A;  4I02 A;  4LLN A;  1R00 A;  2P0W A;  4XSZ F;  5E1Z B;  2DFE A;  5KVR A;  3KET A;  2DK8 A;  3SQN A;  4A93 J;  5L3G A;  1Z7U A;  4BXX J;  4B3A A;  2HDW A;  5J1Y A;  4O6J A;  2M9H A;  4HQE A;  2KIS A;  2HGC A;  2QYO A;  1MDM B;  3N4M A;  3ZMT A;  4L9T A;  3DQV C;  1XCV A;  1FT9 A;  3KZZ A;  4XOT A;  3COA C;  2PX9 A;  1QZY A;  2EWN A;  3M8F A;  1TT5 B;  1SAX A;  2O61 A;  2XF5 A;  2E2I J;  4LB6 B;  5HNH A;  3DKX A;  3KEQ A;  3LSK A;  2BXZ A;  3FBN B;  3ZR8 X;  4BE1 A;  2HKX A;  2HNH A;  3K9T A;  2FXA A;  4DNC A;  1KYZ A;  3QWL A;  4PUS A;  3GZN B;  1JTY A;  2GIZ A;  3S32 A;  1FLI A;  2F5C A;  1U8B A;  5HLH A;  2PJR A;  5GAD J;  5B3S H;  4MEX F;  3AG2 H;  1X58 A;  4RM2 A;  3CES A;  1O7L A;  1UAA A;  1U0J A;  1YIJ I;  1XGM A;  3DP7 A;  1MJA A;  1GVJ A;  3HKZ A;  3IAM 2;  2KHM A;  4CH7 A;  4E7Z A;  3ZOB A;  3ZP5 A;  2DMQ A;  5LHG A;  1MMD A;  4RGR A;  1ETV A;  1ZLK A;  3K4K A;  1ZR4 A;  2ZJ2 A;  1B72 B;  1ZN2 A;  3VPR A;  1ZKG A;  2RV8 A;  5FB2 A;  3I64 A;  3WTW C;  3FMR A;  3OOU A;  3PNV A;  5BMZ A;  2O8K A;  3L2W A;  3I5U A;  2PLY A;  3TP3 A;  1P2F A;  2ZC2 A;  1IXR C;  1MBJ A;  3HOU J;  2CFX A;  1J5Y A;  4QIW N;  1FWZ A;  2LFB A;  1HW1 A;  1Q1V A;  1HDP A;  1ENH A;  3KCC A;  4GCV A;  1ZGJ A;  3VYT B;  1BM9 A;  3OYM A;  3EYI A;  4ENM A;  5CVJ A;  4R8H A;  3K4M A;  3VOD A;  3I53 A;  4DYR A;  2K85 A;  3DBH B;  4HSR A;  2HTS A;  2MC3 A;  2D45 A;  2FNA A;  2ZME A;  3OWT A;  2FRH A;  2VOP A;  3EYY A;  1BR1 A;  2V6C A;  5LFA A;  2XB0 X;  3BPV A;  1CF7 B;  1BI1 A;  3H0D A;  2IW5 A;  3ZGK A;  5TGT A;  1B4A A;  2K86 A;  1KON A;  4Q48 A;  4A3E J;  2JT1 A;  3FF5 A;  3I71 A;  5EYR A;  1L0O C;  1IAW A;  3CME I;  3W6V A;  5E8G A;  2BXY A;  1R1U A;  1TNS A;  2XDV A;  1Z91 A;  3FXR A;  1U9O A;  3ZMS A;  4IX7 A;  5ERI A;  3I59 A;  4JK1 X;  3EET A;  3SJM A;  3S2D J;  3D5R C;  2IAI A;  4ASN A;  2GQQ A;  3SYT A;  2O3F A;  4CCO A;  1BBY A;  4XL9 A;  3KFW X;  1XGS A;  1LNW A;  3LMM A;  3LSM A;  3H1C A;  3BR6 A;  3DKY A;  2K4B A;  4IRH A;  3SHF A;  3ROU A;  4UUS B;  4M9S A;  3BR0 A;  4F3Q A;  2XAJ A;  3OYG A;  3SDG A;  1IRF A;  4Y7N J;  4WCG A;  3IL2 A;  3ULQ B;  1QZE A;  1P4X A;  5CJ9 A;  4OIP F;  4RA2 A;  1W4M A;  5DV5 A;  2EIL H;  3T1B A;  2EZK A;  1T98 A;  2MH2 A;  2Y2Z A;  4K2E A;  1WZ2 A;  3LSI A;  1PYV A;  4KUM A;  5LGT A;  2NNY A;  4A2U A;  2Z3Y A;  1X3Z B;  2HEO A;  4E7H A;  4S04 A;  2M8E A;  1Y1V J;  5HDN A;  2HOS A;  5BPI A;  4FQG A;  2PMZ N;  2HOE A;  3OIP A;  3HOW J;  2FBK A;  2GA2 A;  3FHN A;  1FOX A;  3C2B A;  2NVQ J;  1A6Q A;  1IDY A;  2Z9O A;  4ZYD A;  4ZTJ A;  2JA8 J;  2A3S A;  4HF0 A;  1EH7 A;  1X3W B;  2DFI A;  1R49 A;  4AUX A;  4ZZL A;  3AAF A;  5JFR A;  1U78 A;  4KMF A;  2YSR A;  1UZC A;  3BP8 A;  4G12 A;  5KK1 A;  2NYX A;  2XGC A;  2CU7 A;  2DT6 A;  5FFZ A;  2CQX A;  3IAS 2;  3CCU I;  2IS4 A;  1Y0U A;  4A3G J;  3E6D A;  3E5X A;  1ZG5 A;  2P5L C;  2XPV A;  2DTZ A;  3CMY A;  2BY2 A;  2DQR A;  2LKS A;  4CA0 A;  3AL0 C;  1G8X A;  1U5T B;  1LDK B;  3P9K A;  1VFC A;  2W57 A;  3Q5F A;  2HOT A;  1AKH B;  2GBY A;  3GZ5 A;  2DU9 A;  5HS9 A;  1V55 H;  2ID6 A;  4A6D A;  3OYL A;  4D7N A;  4X6A J;  2CUF A;  1YFH A;  5CQG A;  4X1E A;  1HKS A;  3FM5 A;  5AON A;  4YFN F;  2R3S A;  2LBF A;  3DU5 A;  1ZH5 A;  2F5V A;  4V2G A;  3PIO F;  1X3U A;  3O2P E;  1Y0N A;  2IVM A;  2K9L A;  2P6S A;  2X48 A;  2O5R A;  2ZME C;  4AYB N;  4CYC B;  3K69 A;  3U1K A;  4UVA A;  4LB5 A;  2DPU A;  5FLV A;  1ON1 A;  5F0H A;  2W7N A;  1RPW A;  4HZF A;  5HLI A;  3IP4 B;  2CYY A;  5J8F A;  3DBL B;  2VE8 A;  1TWF J;  1I27 A;  3RKQ A;  1OYY A;  2IJL A;  4MLO A;  5H2F C;  2RRE A;  3L1P A;  2MA3 A;  4NHJ A;  4RB3 C;  2FA5 A;  4BEH B;  3KEY A;  1IUF A;  1R5H A;  1T0F A;  4CSW A;  2L7F P;  3CF5 F;  4HRI A;  1ETX A;  2P5V A;  3WTY C;  5DD8 A;  2GLO A;  2EIK H;  3CCE I;  5M3M J;  2FBH A;  1KQ8 A;  1OJL A;  1DU6 A;  2H1L A;  1JJ6 C;  3L00 A;  5GPA A;  4B09 A;  2F6C A;  2W25 A;  1YS6 A;  3HSE A;  2GM4 A;  2VBW A;  1IRX A;  2JSC A;  3BQY A;  3GTO J;  4L5E A;  3Q0W A;  1U8R A;  2W00 A;  4UB6 C;  4L9V A;  3E3V A;  4HQM A;  3ZCO A;  1LFU P;  4B3X A;  1YW8 A;  2V9V A;  3G2B A;  5EZG A;  5H6Q A;  3K1P A;  5HS8 A;  2HZT A;  4I2O A;  1Q1H A;  4NUB A;  2EZI A;  2JN6 A;  4P9U A;  3UKG A;  2O6G E;  1J75 A;  4I01 A;  1R5G A;  4G6Q A;  2EV0 A;  2JTV A;  3OSF A;  2XSJ C;  2F5E A;  2EV6 A;  3VDX A;  3OIO A;  1T56 A;  3CO7 C;  1ZRE A;  1BI2 A;  2EPF A;  4RAZ A;  2JMW A;  2ELK A;  2EIN H;  3HGY A;  5JI6 A;  1FIA A;  3E1S A;  5DTD A;  3K4J A;  1ON2 A;  3D5S C;  4NB5 A;  3S2H J;  3O8H A;  3J7Y J;  3A0B C;  4CO8 A;  3CCR I;  4EV0 A;  3K70 C;  1GV5 A;  2XGD A;  3EQL F;  4RDU A;  1R58 A;  3BTL A;  2J5O A;  5DEQ A;  3F8F A;  3ABK H;  3LA2 A;  4C9Y A;  2VPR A;  5IPA A;  2OBP A;  1Z05 A;  2P8T A;  4CXF A;  1QVU A;  2H8W A;  4XOP A;  4Z2Y A;  5EF6 A;  3TW6 A;  3BOQ A;  4L0Y B;  4CZZ A;  2W1O A;  1VQO I;  4XK4 A;  2ZJR F;  2WAQ N;  2Y30 A;  1ODD A;  3GTJ J;  1V5E A;  2EFO A;  3ELK A;  5IP9 J;  4A3I J;  4XLN F;  4HYE A;  5IY5 H;  3BR5 A;  2K9S A;  3KP4 A;  3OYC A;  2E1C A;  1NK2 P;  2OV7 A;  3ABT A;  3RKW A;  3GUD A;  2M3A A;  2WWY A;  1Z6R A;  1HOM A;  4OOI A;  4R1H A;  5FRM A;  3BJ6 A;  2HYJ A;  3VYU B;  2Y31 A;  1FSE A;  3Q3S A;  4XIC A;  3JRE A;  2Q0O A;  5BPD A;  2HQR A;  5JLX A;  2FMY A;  1V5G A;  3V4G A;  5DUK A;  4PGG A;  5E79 C;  3V8L A;  3AKZ A;  3K2Z A;  4MO7 A;  3NAU A;  2QBY B;  1LVA A;  2ZSI B;  3M7G A;  2NS7 A;  1E3O C;  2IT0 A;  2OU2 A;  2L0K A;  4BH9 A;  3L2C A;  3FXL A;  1IG7 A;  4YEL A;  1XSX A;  2R7R A;  5CPR B;  2IGK A;  3RKX A;  1H0M A;  3DTK A;  4Q4Z F;  4EM0 B;  1N25 A;  2IA0 A;  3WE2 A;  3WGI A;  2KRF A;  3JAM K;  2NOG A;  3H3Z A;  1UHM A;  1JTX A;  1Z21 A;  1R4N B;  4N0B A;  1K6O A;  3VOE A;  2R5Z B;  4E7J A;  3GLX A;  1T0F C;  3R6S A;  2HPI A;  4KMU X;  1REP C;  1LE8 A;  3MKW B;  2F48 A;  3MVP A;  1N75 A;  3SEQ A;  1SAN A;  4FET A;  1AA7 A;  4WWC A;  3FX3 A;  1YYV A;  5KHD A;  5A2Q Z;  2CQK A;  2FEZ A;  2IS2 A;  2CSO A;  3FXJ A;  2PG4 A;  1YQA A;  2QM3 A;  3DKW A;  5IYC J;  3VYS B;  3MN2 A;  4QTR A;  1VQ5 I;  1UHW A;  5JHU A;  3A1Y A;  2IS6 A;  4MQ9 F;  1O3Q A;  2UXX A;  2KP6 A;  1LPQ A;  2GWR A;  2VAS A;  4CCJ A;  3OYF A;  1FOK A;  3RZD J;  2ZB9 A;  4KIB A;  5ILU A;  4OMY A;  1H88 C;  3ZQ7 A;  2UV1 A;  2W4S A;  4FX4 A;  4UV8 A;  2HVR A;  2UUZ A;  2KQR A;  2P7V B;  2R7Q A;  3DPT A;  2M1B A;  3RPQ A;  1W5C C;  2RNJ A;  4ZJZ A;  5LLQ A;  5L3D A;  5EEG A;  4FCY A;  3CCQ I;  5EZH A;  3JTG A;  4OIO F;  1R1T A;  4TV7 A;  2L9R A;  5TJJ A;  5FO5 A;  4II2 A;  1BJZ A;  5FGM A;  1JE8 A;  1XG1 A;  2MYS A;  3W6K B;  2KZG A;  3FIW A;  2KDZ A;  2O0Y A;  3OS1 A;  2ZNZ A;  3TW7 A;  1SAU A;  5DYM A;  1JKR C;  1IGN A;  3W2V A;  1BW6 A;  2A6H F;  4Z6Y A;  5J8C A;  3S14 J;  4LLG F;  2HQA A;  3OYK A;  2HVS A;  4UVB A;  3U21 A;  1XGN A;  2M7B A;  2ZFW A;  3ASN H;  3DBR B;  4IO9 F;  4XRF A;  1V54 H;  3KZI C;  1TWH J;  5CQE A;  4NBQ A;  3ZQL A;  2FOW A;  3E6B A;  3P7N A;  1WH5 A;  2WTE A;  4HNT A;  1MH4 A;  5B1A H;  1HKQ A;  2DFF A;  4WXH A;  2CW0 F;  3HG9 A;  1PVE A;  4RB1 A;  3V7C A;  3W2W A;  1UJ8 A;  1V4R A;  1IXS B;  4LG0 B;  1GLN A;  4YG2 F;  1FJL A;  5IP7 J;  3HSR A;  1E17 A;  1DGW Y;  2X9D A;  1DP3 A;  3CJQ B;  2KL4 A;  1G59 A;  4JX6 A;  4IOA F;  5CVR A;  5J3L A;  1H9T A;  2HOA A;  2K7L A;  3K4L A;  3E6M A;  2OZ6 A;  1FBU A;  4AWX B;  2GOX B;  3FMS A;  4M6X A;  4Y4R A;  2ME6 A;  3E97 A;  5KAF C;  1KGS A;  1F5T A;  2P5K A;  4U87 A;  4ZC3 A;  1MND A;  1R4M B;  3QPL A;  4NQW A;  4N4O B;  2R7Z J;  2MSY A;  3J80 K;  4HF2 A;  1D8J A;  2R7O A;  5F0F A;  5L3B A;  4PDK A;  2DPD A;  3RQI A;  4M3E A;  3Q9V A;  4F7Z A;  1PUF B;  2JA5 J;  3GZ6 A;  4JYK A;  3ASO H;  2M45 A;  1DGR M;  3AFH A;  4BQN A;  1IN7 A;  2VC0 A;  1TQM A;  4BKX A;  2EZH A;  3H36 A;  1HKT A;  3SDB A;  1NK3 P;  3I58 A;  4HV5 A;  3CUQ A;  1MMN A;  2QUF A;  3DPU A;  3I4P A;  3CQZ J;  2ZCW A;  3KZY A;  4XOR A;  3JRA A;  4U7B A;  1FNN A;  1WJB A;  4YIF A;  4JP0 A;  2VLA A;  2GOM A;  3QPT A;  4XLP F;  3JRG A;  1HDD C;  2CMP A;  2A07 F;  4E70 A;  1OCO H;  5B66 C;  1CGP A;  4N9H A;  3PFY A;  1YLF A;  2K9Q A;  5LHI A;  1NG7 A;  1O3T A;  4IVN A;  1SEU A;  1PJR A;  3LOC A;  4GXO A;  2H6C A;  3SEZ A;  1YW9 A;  3HOZ J;  3UNG C;  3TP0 A;  2H8R A;  2XF7 A;  3DEE A;  3O6B B;  3PUB A;  3JRC A;  2RGV A;  1Z1D A;  1D3Y A;  4HG2 A;  4A0X A;  5M5W J;  1ZAR A;  2A6E F;  4A3M J;  3CCJ I;  2BV6 A;  4G8X A;  4S0H B;  4BBS J;  3KYL A;  2F4I A;  4AIJ A;  4B1R A;  2JUG A;  1MJ9 A;  2A5Y B;  1Y6I A;  1MW7 A;  1QHH D;  1J59 A;  1GT0 C;  3ABM H;  4UB8 C;  3K4C A;  4PJM A;  3OYB A;  3JRF A;  3H35 A;  1OCR H;  5BQT A;  5EEA A;  2VC1 A;  1BL0 A;  3BWG A;  1K7A A;  2M34 A;  2MD5 A;  2VQC A;  2EA4 A;  3DLA A;  3WG9 A;  4I6Z A;  2V1N A;  4I0B A;  1WH7 A;  4RS8 A;  1QVT A;  2IEK A;  4D5C A;  1G3S A;  1ZTR A;  3WTV C;  3GCM A;  1RUN A;  3MEX A;  4Q47 A;  1X19 A;  1VQN I;  4YEJ A;  1O3S A;  2YU9 J;  1VND A;  4UUT A;  5BNG A;  2JVH A;  3S15 J;  3DEW A;  3HRT A;  3K1N A;  1R36 A;  2X6Y A;  3F0C A;  1ZR2 A;  2QVO A;  4E7S A;  3IWF A;  3BR1 A;  2UWM A;  1I3A A;  3L2Q A;  4M9Z A;  1SVM A;  2OAZ A;  3CJT B;  4BHB A;  1G3Y A;  2KDO A;  3BZ6 A;  4AC0 A;  5DUI A;  4QSH A;  4RBO A;  5D5W B;  1RKT A;  5ICE A;  4A5N A;  2X0L A;  4BAY A;  4HX4 A;  3LSH A;  4LLL A; 
#chains in the Genus database with same CATH homology
 3SZP A;  5LBQ A;  3JSP A;  1Z6T A;  2VBZ A;  4L5J A;  5D5V B;  2L54 A;  2MLG A;  2XUB A;  3C18 A;  3IC7 A;  1L3L A;  2KJB A;  2PI0 A;  3HIF A;  5DCM A;  2BEO A;  2D1V A;  4HLX A;  3LST A;  3F22 A;  2OA4 A;  1OR7 A;  5D5U B;  3QP5 A;  1TBX A;  1E2X A;  4WF2 A;  1PDN C;  1BIA A;  4A12 A;  1T2K A;  3O3K A;  3QP6 A;  1SD5 A;  4HA8 A;  3ZMD A;  2UXN A;  2COM A;  4ZYG A;  3LA3 A;  4L9J A;  1TW3 A;  2QQ9 A;  2K27 A;  3RJP A;  4YFX F;  3HYI A;  1MDM A;  5JVT A;  4IXA A;  4HDV A;  1BC8 C;  6PAX A;  3J7A O;  2JZY A;  1I6X A;  1GHC A;  3WTZ A;  2DW4 A;  4ENJ A;  2YPR A;  5LEK A;  3TO7 A;  1KU9 A;  1STZ A;  2XKO A;  2H94 A;  3OV8 A;  2J5P A;  4MQV A;  2GXB A;  3REO A;  2A68 F;  2FE3 A;  2XRO A;  1MD0 A;  1QBJ A;  4U7D A;  5CVU A;  2HS5 A;  3GFJ A;  3U1D A;  4S05 A;  4Q5S F;  1CF7 A;  3IHU A;  4DQ2 A;  3FMQ A;  2OZU A;  4LK1 F;  1K79 A;  2L01 A;  3C7J A;  5D6E A;  3HTU A;  1D8K A;  2JPB A;  5HLG A;  3IRR A;  1SD4 A;  5L3E A;  2ACJ A;  3ZMU A;  4IPA A;  1J7K A;  4M71 A;  5H6R A;  3Q9S A;  1XB4 A;  3E5Q A;  4UXN A;  2IP2 A;  4OIQ F;  2LF8 A;  3PQJ A;  1FBQ A;  3GFI A;  3T8T A;  4BYY A;  2EB7 A;  2NRA C;  2MLK A;  4M72 A;  3GFL A;  1IW7 F;  1QQI A;  1XSV A;  3F3X A;  1ZRC A;  4CYD A;  3LFK A;  3WGG A;  1IN8 A;  3E5U A;  1ZRD A;  2W84 A;  2WV0 A;  3I54 A;  4I0A A;  1TNT A;  2VBY A;  1S3J A;  1YIO A;  3CLO A;  4Y17 A;  3CJN A;  4M6Y A;  2KIF A;  3GXO A;  5IT3 A;  2HKO A;  1WI9 A;  2DAO A;  1FP1 D;  1UFM A;  4EM1 A;  3JTH A;  2L4M A;  1JHF A;  1IXC A;  1XD7 A;  2V1D A;  1U5T A;  1KU7 A;  2NNN A;  5HS7 A;  5K5Q A;  5D8L B;  3WTX C;  4ZZD A;  1YS7 A;  4GGG A;  3B02 A;  1WQ2 A;  4LJZ F;  2FBI A;  1P4A A;  1RIO H;  1LJ9 A;  4RAY A;  2FF4 A;  3ZN1 A;  2EK5 A;  4BQA A;  1S7O A;  2FSW A;  4BNC A;  1T39 A;  1B1B A;  2Y0M A;  1F1Z A;  3BRO A;  5TRD A;  5ICF A;  3ZPL A;  1B9M A;  4LMY A;  2KJC A;  3V8K A;  4AIH A;  3KEO A;  1G4D A;  2XV4 S;  3L09 A;  2HYG D;  2RQP A;  2GIV A;  3ML6 A;  5EEH A;  3JW4 A;  3QPH A;  2DO7 A;  2V79 A;  5CVI A;  3OOP A;  4U88 A;  2AXL A;  5IT9 Z;  2DI3 A;  2VOD A;  2XAF A;  3H3U A;  3F72 A;  2OD5 A;  3FXQ A;  4MGR A;  4B8X A;  2PJP A;  2QQB A;  1GXQ A;  3MFK A;  4BHC A;  1HQC A;  5CVV A;  1RNL A;  5LGU A;  3RI4 A;  1P6R A;  2GXG A;  2STW A;  3P9I A;  4HAM A;  3HHG A;  5CLS A;  1XMK A;  2YU3 A;  1G3T A;  1K78 A;  2W24 A;  2NS0 A;  3R4K A;  4HLY A;  4KDP A;  1KU2 A;  3TGN A;  3KP6 A;  5DD4 A;  1HBX G;  1FYM A;  3FHZ A;  4N9I A;  3TO9 A;  2G7U A;  3B73 A;  4JBA A;  1R1V A;  2XAS A;  3MZH A;  3HOT A;  3F6V A;  1AWC A;  1YTY A;  3WOD F;  1S6L A;  2PN6 A;  1T6S A;  1SD7 A;  1ZG1 A;  2AS5 F;  4Y13 A;  1T38 A;  4HF2 A;  4P96 A;  1I1G A;  1DUX C;  4YII A;  5K5R A;  2EJR A;  1LEA A;  1BC7 C;  1MZB A;  2FML A;  1WWX A;  2ZKZ A;  3LA7 A;  3T0Y A;  2VOO A;  4L0Z B;  1KU3 A;  3G3Z A;  2FQ3 A;  1ZRF A;  2KKO A;  2ISZ A;  3MAJ A;  3S2W A;  3MZY A;  4ENK A;  3L7W A;  4G9Y A;  1S7A A;  3IRQ A;  2G7H A;  4OIR F;  2O8X A;  5E17 F;  1BOA A;  2KIU A;  5E8I A;  1WSU A;  1YW7 A;  3CO6 C;  2XRN A;  2C6Y A;  1B9N A;  4EM2 A;  1RI7 A;  4FX0 A;  2QWW A;  4A0Z A;  3TOA A;  1HSJ A;  3R61 A;  1BIB A;  1LDJ A;  1FSH A;  2ESH A;  1W5S A;  4I98 B;  4WXD A;  5A2Q K;  4Y15 A;  4ZH4 F;  1DPR A;  2VT2 A;  2FOK A;  1HW5 A;  1HXD A;  2A69 F;  2HQN A;  1SFE A;  1IF1 A;  4KIG A;  2LNB A;  3VFZ A;  5FD5 A;  4I09 A;  2G9W A;  3NQO A;  1ZG3 A;  1WKM A;  1AOY A;  4EJO A;  1C0W A;  2XKP A;  2Z33 A;  4RGS A;  3NEU A;  4CGZ A;  1FPQ A;  3PFI A;  3DFG A;  3WU1 B;  1JGS A;  3RYP A;  1XDU A;  1MJB A;  4BXU A;  5DDG A;  1IUY A;  1ZHF A;  4HOB A;  3F8B A;  5LGN A;  1PUE E;  1W7P B;  3ISP A;  3MCZ A;  4G94 A;  3VB2 A;  4LG0 A;  4IHS A;  1XDS A;  1O7F A;  1EV7 A;  1F4K A;  1P92 A;  1MGT A;  1TW2 A;  2L4A A;  3K0L A;  2K02 A;  2EV5 A;  4A5M A;  2FU4 A;  4G7O F;  3SFZ A;  2GAU A;  4HW0 A;  5LRR A;  1FBS A;  4KYW A;  2XAH A;  3G73 A;  4AD9 A;  1A04 A;  1JHH A;  2IA1 A;  4ESF A;  3SZT A;  4RB2 C;  4CHU A;  1KA8 A;  3TOB A;  2Z5U A;  4QLC U;  3K1M A;  2H27 A;  1ZAO A;  1VTN C;  5ED4 A;  1TLH B;  2ZXJ A;  3SXY A;  3E6C C;  2EFW A;  4MNU A;  3KLO A;  4IF4 A;  3C3W A;  4HX7 A;  3T5X A;  4I7H A;  4U0W A;  5JR3 A;  3KE2 A;  3FXU A;  1S29 A;  4H0E A;  2DBB A;  3EDP A;  2E1N A;  5AIP A;  4MEY F;  3HHH A;  2ADU A;  4G7H F;  3WTU C;  2M30 A;  4L9N A;  2H09 A;  2DK5 A;  4R79 A;  1LDD A;  3LAP A;  4YFK F;  1DPU A;  1TQP A;  2WC2 A;  2ZO4 A;  2ESN A;  3GX4 X;  5F1R A;  4D0P A;  4WX9 A;  4UUV A;  2RVC A;  2JRT A;  3FZV A;  1XGO A;  4CIC A;  5D4R A;  4UV9 A;  3J81 Z;  4P55 A;  3CUQ C;  3BY6 A;  2ZNY A;  4PGH A;  4WK8 F;  3HOS A;  3GYH X;  1USS A;  4IRG A;  1IN6 A;  1F9N A;  5BS6 A;  3T8R A;  4ENN A;  4KNY A;  2Q8K A;  5L3F A;  2YX7 A;  4L18 B;  3RDI A;  2VXZ A;  4EMS A;  2CWE A;  4HBL A;  3KP2 A;  2IA2 A;  5HVQ C;  3W6J B;  4OIN F;  4RGU A;  2Y48 A;  2ZME B;  3HRU A;  4QWQ A;  1O57 A;  2K4J A;  4HDU A;  2Y75 A;  2PBI A;  3KP5 A;  2X4H A;  3LQR A;  1XSD A;  2ETH A;  3DF8 A;  4LFU A;  4ZYH A;  2HFH A;  2DTR A;  2Z99 A;  3F6O A;  3H92 A;  3I59 B;  1G3W A;  1MKM A;  2O03 A;  5FD6 A;  2VON A;  5ILV A;  3CTA A;  1H9G A;  5D5X B;  1TTY A;  3F8C A;  3J81 K;  4HF1 A;  2A61 A;  2FNP A;  2B0L A;  2M5W A;  1BI3 A;  2F5F A;  1W7P D;  3R0J A;  5L3C A;  3ERE D;  4MHG A;  3EUH A;  3TO6 A;  4KFC A;  1XN7 A;  2ISY A;  4KIF A;  5E1W A;  3GWZ A;  1G6N A;  1OMI A;  4KT5 C;  1ZGA A;  1SFX A;  3BJO A;  3ECO A;  4KIC A;  1EH6 A;  3V7R A;  4U0V A;  3L9F A;  2GZW A;  4GYG A;  3TDU C;  3N97 A;  5LRS A;  5HDK A;  3CDH A;  1QO0 D;  2VT3 A;  3R60 A;  2E7X A;  5ICG A;  2XVC A;  2BBY A;  4PZJ A;  3F8N A;  4EVI A;  3ZMV A;  1BI0 A;  1ZLJ A;  2EFN A;  2HYF A;  4AVP A;  2EFP A;  3V8J A;  3ZN0 A;  2HDC A;  4ZYE A;  3F8M A;  3KP7 A;  4M74 A;  5D6F A;  2KIM A;  4KN7 X;  5K1Y A;  3TDZ C;  2F2E A;  3ZMZ A;  4RB0 A;  4KA4 A;  3IKV A;  2GA1 A;  2RDP A;  3HUG A;  4LGW A;  1NHA A;  1FX7 A;  5HOO A;  3M1E A;  4A0Y A;  3U2R A;  3GFM A;  1P4W A;  1UST A;  3BPX A;  3KP3 A;  1FP2 A;  4EJU A;  2IRF G;  1S8N A;  4HV6 A;  4GYI A;  3RKY A;  1XMA A;  1OYW A;  3HSF A;  2QZ8 A;  1PP8 F;  1OPC A;  3DEU A;  1ONV A;  2CO5 A;  3WU0 A;  2D2W A;  3KLN A;  3JSO A;  3GF2 A;  3GVA A;  2HWV A;  4EQQ A;  1YO5 C;  2HR3 A;  3MWM A;  5D4S A;  1V3F A;  2RKH A;  2YR2 A;  3DV8 A;  1FYL A;  2XIG A;  3JAM Z;  2PFB A;  2DLL A;  1PP7 U;  2LSO A;  2V1X A;  3MQ0 A;  1K78 B;  3PQK A;  3M9A A;  2BYV E;  1FC3 A;  5FFX A;  3QOP A;  2UZK A;  4EJW A;  1ZYR F;  4M9X A;  4UNO A;  1QPM A;  1OYI A;  2XHK A;  1FYK A;  2P7C B;  1R23 A;  2PEX A;  1SMT A;  4UHT A;  2QEN A;  1D5V A;  1UCR A;  5FLX Z;  4A6E A;  3RTR A;  1U3E M;  4WXC A;  4UVC A;  5D8K B;  2CGP A;  2XGX A;  4ETS A;  1RUO A;  1HST A;  1U5T C;  4HX8 A;  4XBF A;  4OMZ A;  2L02 A;  3QRF F;  1SD6 A;  4O3M A;  4PCQ A;  1J2X A;  1UB9 A;  1IRG A;  5HDG A;  3F21 A;  4MTE A;  2M87 A;  2MBF A;  2VBX A;  4EJV A;  3I0T A;  2NAZ A;  5IT9 K;  1KQ0 A;  2W85 A;  1IN4 A;  2YX4 A;  2QBY A;  3FM3 A;  2LF7 A;  2XAQ A;  4M73 A;  4MTD A;  4P5O A;  4CDG A;  1HW2 A;  5BOX A;  2HTJ A;  2QQA A;  1J0R A;  5K5O A;  1W5T A;  4BHP A;  1B6A A;  5J6X A;  3FWE A;  3HRS A;  2PQ8 A;  1SMY F;  4IRI A;  3WE3 A;  4EJT A;  1KYW A;  4P9F A;  4FHT A;  1R22 A;  1QNT A;  1WRJ A;  4IJA A;  1RZ4 A;  4LK0 F;  3P9C A;  3VEP A;  2R7F A;  5FLX K;  2F5D A;  3WTT C;  4GO1 A;  3J80 Z;  1DP7 P;  3HTS B;  2DQL A;  1IN5 A;  3QU6 A;  3M8E A;  5CYV A;  1I5Z A;  1DDN A;  1FZP B;  3GW2 A;  3D0S A;  2RN7 A;  1O3R A;  2JPC A;  3NRV A;  3IKT A;  1TQI A;  1LQ1 A;  3DXJ F;  4EGY A;  1LEB A;  3R0A A;  2CG4 A;  3QAH A;  4OU0 A;  5E18 F;  4KN4 X;  3ECH A;  1U2W A;  1QZZ A;  2BGC A;  4G7Z F;  4AIK A;  3D5L A;  2VN2 A;  3RPU A;  2PMH A;  4EGZ A;  2PMU A;  3CUQ B;  1R7J A;  1I1S A;  1QGP A;  3LQQ A;  2L3D A;  2OQR A;  2E7W A;  4RGX A;  4G6D A;  2D1H A;  1BJA A;  2R7D A;  5DCF A;  4L5I A;  2H6B A;  4JQF A;  1U6G A;  2P6T A;  3CUO A;  2TDX A;  3TQN A;  2P4W A;  4ON0 A;  1YG2 A;  2VE9 A;  3IWZ A;  4LD5 A;  1ULY A;  4ESB A;  3C1D A;  2Q2E A;  1W7P A;  2DT5 A;  5E1X A;  3HRM A;  1J9I A;  2BE5 F;  1BN5 A;  4O5V A;  4XSX F;  2OQG A;  2RC4 A;  5AIQ A;  5F6F A;  3F23 A;  1JXS A;  3V7S A;  2EFQ A;  1XCB A;  3BJA A;  3GO5 A;  5E20 A;  2STT A;  3QU3 A;  1SFU A;  5F64 A;  3RIR A;  5ICC A;  5H20 A;  4IHT A;  2QLZ A;  5LHH A;  3LAJ A;  1EH8 A;  4FT8 A;  1KQ9 A;  2XAG A;  2MH9 A;  5LEJ A;  3RYR A;  1B59 A;  3WGH A;  2V1U A;  1FY7 A;  3GEZ A;  3U9G A;  3BDD A;  5DCM B;  3WTS C;  2EA2 A;  1OKR A;  2ELH A;  4U0Y A;  3ABU A;  2LDU A;  2IPQ X;  5ILS A;  2LKP A;  3LWF A;  1Z9C A;  2ZBK A;  1LB2 A;  3DPL C;  1GXP A;  4ESJ A;  3TKY A;  1IZ1 A;  4I02 A;  4LLN A;  1R00 A;  4XSZ F;  5E1Z B;  5KVR A;  3KET A;  2DK8 A;  3SQN A;  5L3G A;  1Z7U A;  4O6J A;  4HQE A;  2HGC A;  2QYO A;  1MDM B;  3N4M A;  3ZMT A;  4L9T A;  3DQV C;  1XCV A;  1FT9 A;  3KZZ A;  3COA C;  1QZY A;  2EWN A;  3M8F A;  1SAX A;  2O61 A;  4LB6 B;  3KEQ A;  2HKX A;  3K9T A;  2FXA A;  4DNC A;  1KYZ A;  1FLI A;  2F5C A;  5HLH A;  4MEX F;  1O7L A;  1XGM A;  3DP7 A;  1MJA A;  1GVJ A;  3ZP5 A;  5LHG A;  4RGR A;  1ZLK A;  2ZJ2 A;  1ZN2 A;  2RV8 A;  5FB2 A;  3I64 A;  3WTW C;  3FMR A;  5BMZ A;  3I5U A;  2PLY A;  1P2F A;  1IXR C;  2CFX A;  1J5Y A;  1FWZ A;  1HW1 A;  3KCC A;  4GCV A;  1ZGJ A;  1BM9 A;  3EYI A;  4ENM A;  5CVJ A;  4R8H A;  3VOD A;  3I53 A;  2HTS A;  2MC3 A;  2D45 A;  2FNA A;  2ZME A;  2VOP A;  2FRH A;  3EYY A;  2V6C A;  3BPV A;  1CF7 B;  1BI1 A;  2IW5 A;  1B4A A;  2K86 A;  4Q48 A;  2JT1 A;  3FF5 A;  3I71 A;  1L0O C;  1IAW A;  5E8G A;  1R1U A;  1TNS A;  1Z91 A;  3FXR A;  3ZMS A;  5ERI A;  3I59 A;  4JK1 X;  3EET A;  4ASN A;  2GQQ A;  2O3F A;  1BBY A;  3KFW X;  1XGS A;  1LNW A;  4IRH A;  2K4B A;  3SHF A;  3ROU A;  4M9S A;  2XAJ A;  1IRF A;  4WCG A;  3IL2 A;  3ULQ B;  1P4X A;  5CJ9 A;  4OIP F;  1W4M A;  5DV5 A;  3T1B A;  1T98 A;  2MH2 A;  4K2E A;  4KUM A;  5LGT A;  2NNY A;  4A2U A;  2Z3Y A;  2HEO A;  4S04 A;  2M8E A;  5HDN A;  5BPI A;  2HOE A;  2FBK A;  2GA2 A;  2Z9O A;  4ZYD A;  2A3S A;  4HF0 A;  1EH7 A;  2DFI A;  4ZZL A;  3AAF A;  5JFR A;  1U78 A;  4KMF A;  2YSR A;  3BP8 A;  5KK1 A;  2NYX A;  5FFZ A;  1Y0U A;  3E6D A;  3E5X A;  1ZG5 A;  2P5L C;  2DQR A;  1U5T B;  1LDK B;  3P9K A;  2W57 A;  3Q5F A;  3GZ5 A;  2DU9 A;  5HS9 A;  4A6D A;  1YFH A;  1HKS A;  3FM5 A;  5AON A;  4YFN F;  2R3S A;  1ZH5 A;  1X3U A;  3O2P E;  2IVM A;  2P6S A;  3K69 A;  4UVA A;  4LB5 A;  2DPU A;  1ON1 A;  4HZF A;  5HLI A;  2CYY A;  5J8F A;  2VE8 A;  1I27 A;  1OYY A;  2IJL A;  2MA3 A;  4NHJ A;  4RB3 C;  2FA5 A;  1R5H A;  1T0F A;  2P5V A;  3WTY C;  5DD8 A;  2FBH A;  1KQ8 A;  3L00 A;  4B09 A;  2W25 A;  1YS6 A;  3HSE A;  2VBW A;  2JSC A;  1U8R A;  4L9V A;  3E3V A;  4HQM A;  1YW8 A;  2V9V A;  5H6Q A;  3K1P A;  5HS8 A;  2HZT A;  4I2O A;  1Q1H A;  2O6G E;  4P9U A;  1J75 A;  4I01 A;  1R5G A;  4G6Q A;  2EV0 A;  2JTV A;  2F5E A;  2EV6 A;  1ZRE A;  3CO7 C;  1BI2 A;  4RAZ A;  5JI6 A;  1ON2 A;  4NB5 A;  4CO8 A;  4EV0 A;  3EQL F;  1R58 A;  2J5O A;  5DEQ A;  3F8F A;  3LA2 A;  2OBP A;  1Z05 A;  2P8T A;  4CXF A;  4Z2Y A;  3BOQ A;  4L0Y B;  4CZZ A;  1ODD A;  2EFO A;  3ELK A;  4XLN F;  4HYE A;  3KP4 A;  2E1C A;  3ABT A;  3RKW A;  3GUD A;  2WWY A;  1Z6R A;  4OOI A;  4R1H A;  3BJ6 A;  1FSE A;  2Q0O A;  5BPD A;  2HQR A;  2FMY A;  3V4G A;  5DUK A;  4PGG A;  3V8L A;  3K2Z A;  2QBY B;  1LVA A;  3M7G A;  2IT0 A;  2OU2 A;  4BH9 A;  3L2C A;  1XSX A;  3RKX A;  1H0M A;  4Q4Z F;  4EM0 B;  2IA0 A;  3WE2 A;  3WGI A;  2KRF A;  3JAM K;  3H3Z A;  1UHM A;  1K6O A;  4N0B A;  3VOE A;  3GLX A;  3R6S A;  4KMU X;  1REP C;  4WWC A;  3FX3 A;  1YYV A;  5A2Q Z;  2CQK A;  2FEZ A;  2CSO A;  2PG4 A;  1YQA A;  2QM3 A;  3DKW A;  1UHW A;  5JHU A;  4MQ9 F;  1O3Q A;  2UXX A;  2GWR A;  1FOK A;  5ILU A;  4KIB A;  4OMY A;  3ZQ7 A;  4FX4 A;  4UV8 A;  2P7V B;  3DPT A;  2M1B A;  3RPQ A;  2RNJ A;  5LLQ A;  5L3D A;  5EEG A;  3JTG A;  4OIO F;  1R1T A;  4TV7 A;  5TJJ A;  5FO5 A;  5FGM A;  1JE8 A;  3W6K B;  2O0Y A;  2ZNZ A;  5DYM A;  5J8C A;  2A6H F;  4LLG F;  4UVB A;  1XGN A;  2ZFW A;  4XRF A;  3E6B A;  3P7N A;  2WTE A;  1HKQ A;  4WXH A;  2CW0 F;  4RB1 A;  3V7C A;  1V4R A;  1IXS B;  4LG0 B;  4YG2 F;  3HSR A;  1E17 A;  5CVR A;  1H9T A;  2K7L A;  3E6M A;  2OZ6 A;  1FBU A;  4AWX B;  3FMS A;  4M6X A;  3E97 A;  1KGS A;  1F5T A;  2P5K A;  4NQW A;  3J80 K;  1D8J A;  5L3B A;  4PDK A;  2DPD A;  3Q9V A;  4F7Z A;  3GZ6 A;  2M45 A;  1IN7 A;  2VC0 A;  1TQM A;  1HKT A;  3I58 A;  4HV5 A;  3CUQ A;  2QUF A;  3I4P A;  2ZCW A;  3KZY A;  4U7B A;  1FNN A;  4YIF A;  3QPT A;  4XLP F;  2A07 F;  4E70 A;  1CGP A;  4N9H A;  1YLF A;  5LHI A;  1O3T A;  4IVN A;  4GXO A;  2H6C A;  1YW9 A;  3O6B B;  2RGV A;  1Z1D A;  1D3Y A;  4A0X A;  1ZAR A;  2A6E F;  2BV6 A;  4G8X A;  4AIJ A;  1MJ9 A;  2A5Y B;  1J59 A;  5BQT A;  2VC1 A;  3BWG A;  1K7A A;  2MD5 A;  2EA4 A;  3WG9 A;  4I0B A;  4RS8 A;  1G3S A;  3WTV C;  1RUN A;  3MEX A;  4Q47 A;  1O3S A;  3K1N A;  3HRT A;  1R36 A;  2QVO A;  3IWF A;  2UWM A;  4M9Z A;  2OAZ A;  4BHB A;  5DUI A;  1G3Y A;  3BZ6 A;  5D5W B;  5ICE A;  4A5N A;  2X0L A;  4BAY A;  4HX4 A;  4LLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...