2P7CB

Solution structure of the bacillus licheniformis blai monomeric form in complex with the blap half-operator.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESDYIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational and thermodynamic changes of the repressor/DNA operator complex upon monomerization shed new light on regulation mechanisms of bacterial resistance against beta-lactam antibiotics.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Transcription regulator
molecule keywords Strand 1 of Twelve base-pair DNA
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p7cB00
5L3EA 2ZNZA 1L3LA 3V8JA 2GAUA 1U5TA 4KUMA 5TRDA 5HS8A 2L02A 3ROUA 2K7LA 1R58A 2OA4A 3TO9A 2QBYA 1W7PD 2JT1A 5D4SA 3E6DA 3CLOA 4FHTA 5BPDA 2XAFA 4HV5A 3GWZA 3TDZC 1P4AA 4RS8A 2VBYA 2Y48A 3RYRA 4CHUA 1ZHFA 1HKSA 3E6CC 5IT3A 1YIOA 3U1DA 3QAHA 1WRJA 1KU3A 3TDUC 3MZYA 2GXBA 3KP4A 4UVAA 4L9VA 1LDJA 2F5EA 3F8BA 1CGPA 1FY7A 1O57A 2ZCWA 5TJJA 4IJAA 3GVAA 2MC3A 3F8NA 4BQAA 5ED4A 5HLHA 2VT3A 4M9SA 1MJAA 3QP5A 5K5RA 4ZYDA 1Z6RA 1QO0D 5L3FA 2IPQX 2F2EA 1ODDA 5HDNA 4HX4A 2FMYA 4A0YA 4BHCA 3RDIA 1XN7A 2DI3A 5LRSA 4MGRA 5HOOA 4L9JA 1S7AA 4BNCA 2KJCA 2JZYA 1DP7P 1QZZA 1EH8A 1QZYA 5CJ9A 1S7OA 3SHFA 4HQEA 1KYWA 2HWVA 4XSXF 1R00A 4XLPF 3I5UA 4UXNA 1FPQA 1O3QA 3E97A 2Q8KA 1CF7B 4P9UA 3WGGA 5CVIA 3JW4A 4S04A 1YW7A 4KNYA 4XSZF 1BN5A 1XSVA 2QQBA 3L00A 3DPLC 1J2XA 3IHUA 4G8XA 2P7CB 3H3UA 2ZMEB 3WTWC 5DD8A 1O3TA 1ZLKA 4QWQA 2HDCA 1YQAA 4CICA 2PG4A 1IN6A 3L9FA 1SMTA 5J6XA 4BYYA 2EA2A 5JI6A 4EMSA 3J81Z 4N9IA 4IHTA 3WODF 4BHBA 3F8CA 1I1GA 5CVVA 2RGVA 2H94A 1WI9A 3M7GA 2PMUA 4LD5A 4ZYGA 3R60A 3C18A 2Q0OA 3B02A 2OZ6A 1S6LA 2FQ3A 2HQRA 1FYLA 1O7FA 2LF7A 2XASA 1FX7A 1U6GA 5HLIA 5DUIA 4ESBA 2Z99A 4A0ZA 1ZG3A 4N0BA 1TLHB 1Z05A 2A5YB 1DDNA 2Y75A 1YTYA 1J75A 4IVNA 1KQ9A 2NS0A 2JTVA 3RTRA 1FWZA 4S05A 3I71A 2O61A 4RGUA 4EJVA 3JAMK 3GFMA 4EJTA 4FX0A 4CO8A 2K27A 5LEJA 4RGRA 2E1NA 4G7OF 4EV0A 3GO5A 2ACJA 2QLZA 3R0JA 2BEOA 2R7FA 3C7JA 2EFOA 1G3SA 3ML6A 1GXPA 1HKTA 3F6VA 1BC8C 2HFHA 5DDGA 2YR2A 2QQAA 5D4RA 4P9FA 4OIOF 2V1XA 2NRAC 2PFBA 2F5DA 3WE2A 5D5VB 1G3YA 1XSXA 3BY6A 1LQ1A 1IN7A 3J7AO 5ILSA 3O3KA 1TW3A 4G9YA 4KICA 5BPIA 3BJOA 3JSPA 2GA1A 4LGWA 4XRFA 2A3SA 3FXUA 3E6BA 3V7SA 3IWFA 4CGZA 1IXRC 1XCBA 2OQGA 1QGPA 3H3ZA 3DEUA 2UXNA 3K1MA 5HS9A 2R7DA 3R6SA 4A5NA 2EA4A 3M8FA 4RGSA 4WCGA 1ZG5A 2J5OA 2DQRA 3HTUA 1D3YA 3ABUA 5FD6A 1W5TA 3ULQB 3VOEA 3SXYA 1HXDA 4R79A 3CDHA 4IXAA 3IC7A 5JVTA 1JGSA 1MGTA 5HDKA 1U2WA 2KJBA 1JE8A 3ABTA 3CUOA 3ERED 4CXFA 1IN5A 3TQNA 2ZBKA 1KU7A 4I0BA 3I53A 2VOPA 4IHSA 5FB2A 2ZO4A 1R5GA 1I27A 1P92A 4LB6B 5D5UB 2XUBA 1ZGAA 1BM9A 1ZAOA 4CDGA 2XAQA 2M45A 5DD4A 3FMRA 4IPAA 3QRFF 3T0YA 4OINF 2A6EF 1LEAA 3DKWA 1LDKB 1ZRDA 4HX8A 3BWGA 3GUDA 4LJZF 3HOSA 1UFMA 4GYGA 4HF1A 5LRRA 3NEUA 3MAJA 3SZTA 2FRHA 3E3VA 5ICGA 4A0XA 2QVOA 2DAOA 2W57A 2OZUA 1F1ZA 2XAJA 4O3MA 2J5PA 2XV4S 2QENA 2F5CA 3DV8A 2EV6A 2EK5A 3IWZA 5AONA 1K6OA 1DPUA 3ZPLA 4JK1X 1XB4A 3LA2A 4U0WA 3RI4A 1IF1A 2H6BA 3LAPA 4ENJA 4LMYA 5J8CA 4EGZA 4EM0B 4Y13A 3G73A 2P5VA 2QYOA 1C0WA 3F72A 4KIGA 1AOYA 5E17F 1OMIA 3VEPA 4U7DA 1D8JA 1B9MA 4B8XA 4OOIA 4M72A 1J7KA 1UHMA 4HDVA 2X0LA 4YIIA 2B0LA 1MD0A 1HSTA 4BXUA 2G7HA 2DK8A 4OIQF 2BE5F 1B9NA 5BOXA 1A04A 4YIFA 1TQPA 3ZN1A 3LSTA 5AIPA 3PQKA 3F6OA 3BPXA 2K4BA 2RKHA 3ZMVA 4PGHA 4I2OA 1P2FA 2QM3A 2A61A 3IKTA 1OR7A 1R7JA 2MH2A 1DPRA 3V7CA 2HYFA 2M30A 1R22A 2PBIA 1FBUA 4LK1F 3BOQA 3KLOA 5KVRA 4WWCA 1R23A 5F1RA 3JAMZ 3U2RA 2O8XA 2VODA 3FHZA 3ECHA 1K7AA 3K2ZA 1G6NA 1U8RA 2GWRA 3KP3A 1FP2A 3TOBA 4EVIA 1JXSA 1MKMA 3LWFA 2CWEA 1IZ1A 3K1NA 2L4AA 5E1WA 2ISYA 1R1UA 5DCMB 2GZWA 1TNTA 1SD5A 1O3SA 2XRNA 4MQ9F 1Z7UA 2ADUA 1RI7A 3GFIA 1EH7A 2KIFA 5F64A 3JTGA 2QZ8A 3ZMTA 3I59A 1ZRFA 4KDPA 3SZPA 3MCZA 1IXCA 3GF2A 2WTEA 2FBIA 3IL2A 2CG4A 3U9GA 1G4DA 2IVMA 4M6YA 1ZREA 1GHCA 1IUYA 3HRSA 3TO7A 1W7PA 1V4RA 1MZBA 1I5ZA 3CJNA 5DUKA 4LB5A 3DP7A 1OYYA 2H6CA 5CVUA 2Z33A 3TOAA 4I0AA 3L2CA 5CVRA 3W6JB 2W24A 3V7RA 3P9KA 5A2QZ 4G7HF 4L0ZB 3I54A 4RB0A 2HGCA 5LLQA 1I1SA 4HLYA 2HZTA 2ZNYA 3KE2A 5DV5A 2MH9A 2EWNA 3WU0A 2HKXA 3BROA 1NHAA 1UCRA 2KIMA 2XKOA 5LBQA 2DT5A 5LEKA 4HDUA 1FLIA 2FNAA 2STWA 4RB1A 2C6YA 2DQLA 5FLXZ 1USTA 2D2WA 1HQCA 4M9XA 4GXOA 3E6MA 2XROA 1Q1HA 2ZJ2A 1IXSB 2PN6A 1SFEA 4OIPF 3O2PE 5ILUA 3FF5A 2BGCA 3EYYA 4MNUA 3V4GA 4WK8F 3FWEA 4ON0A 1V3FA 1PUEE 3SFZA 3AAFA 3DF8A 1U5TB 3J80Z 2WC2A 3KCCA 2FE3A 2MBFA 1R36A 1PDNC 3GEZA 3HRUA 4ETSA 4OU0A 4XLNF 5E1ZB 3BPVA 1QQIA 4HBLA 4M71A 2EJRA 1T39A 2WV0A 4KN4X 3MWMA 4IRIA 2WWYA 5E1XA 3WE3A 3REOA 2Y0MA 3HTSB 5ERIA 1PP7U 1W7PB 2V1DA 2G7UA 1UB9A 3MFKA 1S8NA 3L09A 4MEXF 2G9WA 2P6TA 3MQ0A 3RKWA 4A6EA 5L3GA 1U5TC 4CZZA 1XMKA 2VC0A 1TNSA 3KEOA 2DK5A 3HRMA 2NNNA 4RGXA 2BV6A 3GZ5A 1SD6A 2RNJA 3QP6A 4PCQA 1YYVA 4H0EA 3BJAA 1HW5A 1KU9A 3SQNA 2EB7A 2ISZA 3KETA 5HS7A 4LG0B 1WQ2A 3RKYA 3C3WA 1ON1A 4ZYHA 1D5VA 1R5HA 1YW8A 4JBAA 4MEYF 1P4XA 3RYPA 1MDMA 4RAYA 2P8TA 3D0SA 4A12A 2NAZA 1B4AA 1MJBA 3DQVC 3GLXA 2FMLA 4EM1A 1LNWA 5KK1A 4L5IA 2D1HA 3N4MA 1W5SA 4YFXF 3DXJF 2H27A 2GA2A 4LFUA 2L01A 4XBFA 2BBYA 4ZYEA 5E18F 3EUHA 1T0FA 2RC4A 2MD5A 2VE9A 3CUQA 2W85A 1RNLA 4Y17A 3R0AA 3V8KA 2VOOA 3EDPA 4AIHA 1WWXA 4I09A 4UV9A 1BBYA 5AIQA 1YO5C 2IA1A 1S3JA 3KP6A 2UXXA 3F8FA 1SFXA 5D6EA 5DEQA 4AIKA 2L3DA 1B59A 3KZZA 4L9NA 3GW2A 2M8EA 1T98A 4P55A 4UHTA 2EFPA 3F22A 4A5MA 5K5OA 4RAZA 4UVCA 3Q5FA 2DW4A 2YPRA 4LG0A 2Z9OA 2PI0A 3COAC 1OPCA 1EH6A 1UHWA 3KFWX 3LA3A 3WGHA 1USSA 1WSUA 3KZYA 1XDSA 2FEZA 2E1CA 5ICFA 1E2XA 4Q5SF 2OBPA 2XAGA 4R1HA 5ICEA 2LF8A 1IN8A 2EFWA 4KA4A 2P5KA 3O6BB 2FOKA 1TW2A 4L9TA 2OQRA 3QU3A 3T5XA 3TO6A 1J9IA 1AWCA 2CO5A 3IRRA 2VC1A 2NYXA 4YG2F 2DFIA 3FX3A 3D5LA 1ZN2A 5CLSA 1Z9CA 4EJUA 3KLNA 3HUGA 4PDKA 3ZQ7A 5ILVA 2PEXA 3WTXC 1ZG1A 1D8KA 1SFUA 1Y0UA 3BP8A 5BQTA 2OU2A 5A2QK 3JTHA 4M74A 3HHGA 2IP2A 4F7ZA 3LAJA 4AWXB 3GXOA 1S29A 3CO7C 4I98B 1KU2A 3K9TA 3R4KA 2VN2A 2FBKA 3FMQA 3GFJA 2NNYA 1REPC 3OV8A 3T8TA 4U0VA 4KIBA 1PP8F 1J0RA 2VXZA 4GO1A 5CYVA 2ETHA 1XCVA 3K0LA 4P5OA 4L0YB 2IJLA 4HV6A 4UV8A 4HLXA 3WTTC 3PQJA 4D0PA 4O6JA 2ESHA 3NQOA 1FNNA 4DNCA 2RN7A 3VB2A 4I01A 4R8HA 3FMSA 4HX7A 3HOTA 4KMUX 2RQPA 5K5QA 2OD5A 2E7XA 4ENMA 1TQIA 1STZA 3FM5A 5D8KB 3PFIA 3BZ6A 5H6RA 4WXHA 1KQ0A 4HZFA 2VBXA 2W25A 2DBBA 2IA2A 2LKPA 3QPTA 3ZMSA 5L3DA 4HYEA 4EJWA 1L0OC 1SD4A 2YSRA 4EQQA 3I0TA 5HLGA 1I6XA 2V6CA 4G94A 1O3RA 1HW2A 1YG2A 4M9ZA 3CUQB 1XMAA 3BJ6A 3ZMDA 3F21A 4HQMA 1G3TA 2FXAA 2XGXA 3H92A 2GQQA 3T8RA 1TQMA 1F9NA 1TTYA 4MTEA 2PMHA 1HBXG 2VT2A 4P96A 2O3FA 2O6GE 3S2WA 1FOKA 4I7HA 5EEGA 4ZZDA 3HYIA 1MDMB 5H20A 2HTJA 2GXGA 3WGIA 4IRGA 2R3SA 1K79A 1YFHA 2P5LC 3HSFA 2FF4A 4LLGF 3RIRA 5H6QA 3NRVA 5DCMA 1SAXA 3RPQA 1JHHA 2P6SA 2M87A 3WTYC 1IRGA 3P9CA 2A69F 3FXRA 2OAZA 4L18B 2Z3YA 4O5VA 2IW5A 4A6DA 3VODA 3TGNA 1BC7C 1HKQA 1BJAA 1FSEA 5HDGA 5D6FA 2E7WA 3QOPA 5LGTA 2UWMA 3M1EA 4ZH4F 2V79A 2ZXJA 3P7NA 3L7WA 2KRFA 3F23A 1SD7A 5FFZA 2DPDA 3IRQA 4MHGA 2P7VB 4BHPA 1XSDA 2YU3A 4KN7X 4TV7A 2VONA 1G3WA 3LQRA 2M5WA 5LHHA 3KEQA 1ZLJA 2CGPA 3ZMZA 4QLCU 1HSJA 2EFQA 2CW0F 3QU6A 2VBZA 3ELKA 2BYVE 2COMA 4BH9A 1ZYRF 4Z2YA 1F4KA 2A07F 3HSEA 1FZPB 2PQ8A 3F8MA 4KFCA 4E70A 2EV0A 2LNBA 3E5XA 2VBWA 1YS7A 3WU1B 4IF4A 1ON2A 2FA5A 5LGUA 4U7BA 4KMFA 4AD9A 4ENKA 5D5WB 1BIBA 2MLKA 1OYWA 5FFXA 3EYIA 2KIUA 4U88A 1XDUA 1R1TA 2O0YA 5D5XB 4GCVA 2LSOA 1IW7F 3OOPA 3WG9A 4Q47A 3ISPA 2DPUA 2ESNA 1FBSA 1XGOA 1FYMA 4OIRF 2ZMEA 3M8EA 2IT0A 1ZARA 1W4MA 4NB5A 4GGGA 5F6FA 2JSCA 2FBHA 3EQLF 2JPCA 4LLNA 1FP1D 3TKYA 2W84A 2V1UA 1BI3A 2VE8A 3BDDA 3ZMUA 2QQ9A 1EV7A 3MEXA 1KYZA 1U3EM 5LGNA 3M9AA 2JRTA 4HA8A 2HS5A 2STTA 2GIVA 5ICCA 2DTRA 3I64A 4HAMA 3WTSC 3ZP5A 1X3UA 2A68F 3CUQC 3IKVA 1RUNA 3HRTA 5FO5A 5LHGA 1Z91A 3HIFA 3V8LA 5BS6A 1LB2A 5HVQC 1ZRCA 2H09A 4G7ZF 3WTVC 4UNOA 3KP2A 2EV5A 1XGSA 5J8FA 1LJ9A 3RJPA 3RKXA 2HQNA 2YX7A 2K4JA 3JSOA 1FSHA 1DUXC 4WX9A 2FU4A 3Q9SA 2ZKZA 5CVJA 1KQ8A 2JPBA 2XVCA 2XKPA 2FNPA 1GVJA 1QPMA 5IT9K 3N97A 2K86A 3I58A 4FT8A 4GYIA 1FBQA 5D8LB 4BAYA 1ONVA 2QUFA 2AS5F 3J81K 3LFKA 2HEOA 3RPUA 3W6KB 4YFKF 1LDDA 4ESFA 2HOEA 1KGSA 2Q2EA 4M73A 2DLLA 5L3CA 2RVCA 1H9GA 1KA8A 1FC3A 1VTNC 2LDUA 2CQKA 2QBYB 4KYWA 2YX4A 4K2EA 1U78A 1E17A 4OMZA 3FXQA 2CYYA 3I4PA 1BIAA 3HHHA 4CYDA 1HW1A 4A2UA 4EM2A 3QPHA 4AVPA 5LHIA 1QNTA 2HKOA 1JHFA 3EETA 1XGMA 4I02A 4EGYA 5E8IA 4Q48A 3CTAA 4JQFA 1IAWA 3K1PA 2XAHA 3I59B 4EJOA 5JFRA 5DCFA 5JR3A 1YLFA 6PAXA 2RDPA 2V9VA 1GXQA 1K78A 2RV8A 2DU9A 2F5FA 3G3ZA 3GX4X 2EFNA 1R1VA 1QBJA 4RB2C 1RIOH 4PGGA 1ULYA 1F5TA 4WF2A 5IT9Z 3CO6C 1MJ9A 1XGNA 1XD7A 3FZVA 4L5JA 4UVBA 3KP5A 3ECOA 4ASNA 5FLXK 1J5YA 1BI0A 4ZZLA 2XHKA 2CSOA 3FM3A 4LLLA 1CF7A 2K02A 4MQVA 1WKMA 1B1BA 3WTZA 2Z5UA 1Z1DA 1FYKA 3DFGA 4Q4ZF 4UUVA 3B73A 4HF2A 3P9IA 2X4HA 4DQ2A 4HF0A 3WTUC 1BOAA 1T2KA 3C1DA 1TBXA 5JHUA 2MA3A 4AIJA 3VFZA 2A6HF 1P6RA 4LK0F 5FGMA 4NHJA 3Q9VA 1B6AA 1H9TA 2O03A 4HOBA 1SMYF 1ZGJA 1K78B 1Z6TA 2TDXA 2MLGA 5K1YA 3T1BA 3E5QA 5L3BA 4KT5C 1H0MA 2UZKA 1BI1A 2FSWA 5DYMA 5FD5A 2IRFG 2L4MA 1BI2A 4M6XA 2ZFWA 3R61A 4KIFA 2L54A 3J80K 4G6DA 2PLYA 1RUOA 4NQWA 4WXDA 4G6QA 4B09A 3LA7A 3F3XA 1OKRA 2QWWA 4IRHA 4N9HA 3LQQA 2CFXA 4PZJA 3E5UA 1P4WA 1FT9A 2KKOA 3ZN0A 2D45A 4Y15A 1OYIA 3DPTA 2AXLA 2IA0A 5EEHA 1YW9A 4HW0A 1T6SA 1ZH5A 4OMYA 2PJPA 4WXCA 1IRFA 2ELHA 2D1VA 4RB3C 2M1BA 3HSRA 2HR3A 1O7LA 3GFLA 3K69A 4YFNF 5E20A 1LVAA 2DO7A 2P4WA 1LEBA 4MTDA 3GYHX 5BMZA 3KP7A 4ENNA 1YS6A 2HYGD 4ESJA 5E8GA 1T38A 4FX4A 1RZ4A 2HTSA 2XIGA 3MZHA 1J59A 4U0YA 1IN4A 3GZ6A
chains in the Genus database with same CATH superfamily
5L3EA 5E3MA 4M3FA 3NAUA 3JRIA 2ZNZA 1L3LA 3V8JA 2GAUA 3OYIA 1U5TA 3W2VA 4KUMA 5TRDA 5HS8A 2V6EA 2L02A 3ROUA 2K7LA 2KDOA 1R58A 2L5QA 2PMZA 2OA4A 1M1EB 3TO9A 3D1NI 1W7PD 2JT1A 2M7BA 2QBYA 1RETA 2WB1N 5D4SA 2XF5A 2HVRA 1ETVA 4AIDA 3HDDA 3E6DA 1OR7C 3CLOA 5HNFA 1RR8C 4JX5A 4IQ4A 3S14J 4FHTA 5BPDA 3GTGJ 3S93A 5M3FJ 2CV0A 1QHHD 2XAFA 4HV5A 3GWZA 3BLYA 3TDZC 1Z3YA 1P4AA 4RS8A 3A01B 2VBYA 2Y48A 3RYRA 2LC2A 4CHUA 1ZHFA 1AU7A 1HKSA 5E3LA 2XSDC 3E6CC 5IT3A 2CJJA 1YIOA 3U1DA 3QAHA 1TWGJ 4A3GJ 1WRJA 1KU3A 3QODA 3MZYA 3TDUC 3KP4A 2R4GA 4UVAA 4L9VA 1SC7A 2GXBA 3K70C 1LDJA 4J00A 2F5EA 3F8BA 2R93J 4XKBA 4E7JA 1R71A 1CGPA 3BG5A 1CQTA 1FY7A 1O57A 2ZCWA 4RLQA 2QSFX 3UKGA 2JVGA 5TJJA 4IJAA 3MMYB 2IGKA 4E6KG 3GVAA 2MC3A 3F8NA 4BQAA 5ED4A 4D9JA 4RM3A 5HLHA 2VT3A 4M9SA 1MJAA 2BZTA 4BDZA 3QP5A 5K5RA 1U0JA 4RBOA 4ZYDA 3MKLA 1Z6RA 1QO0D 5L3FA 2IPQX 5KCMA 4AU7A 1XC5A 1OCCH 1IC8A 3AG1H 2DA5A 2F2EA 1ODDA 1MSEC 4HPQA 1K61A 5HDNA 4HX4A 2FMYA 4DZPA 4A0YA 4BHCA 1MNEA 2EIKH 3RDIA 1JGGA 4X6AJ 1X3WB 3CCVI 2DI3A 1T33A 5LRSA 4MGRA 1OCZH 4A3DJ 2COBA 5HOOA 3FKIJ 1WJFA 2WAQA 1NTCA 3OYHA 4L9JA 3LSKA 1S7AA 1MBEA 4BNCA 2KJCA 3ZQQA 2JZYA 1N25A 1DP7P 1QZZA 1EH8A 3L2QA 2JUGA 2VQGA 3F9KA 5F1JA 1QZYA 5CJ9A 1KZHA 4M3GA 1S7OA 3SHFA 2CRGA 1JKQC 1A35A 4RM2A 4FETA 2O5RA 3QYEA 4HQEA 2W1OA 5CQEA 4CSWA 1WJBA 2DMPA 2CV2A 2B7EA 4PSWA 1QVTA 2EZLA 1KYWA 3I4NJ 3KIOA 2HWVA 4XSXF 2JA7J 1R00A 1VI0A 2WBMA 2LG4A 4XLPF 3I5UA 4XLCA 2R7WA 2KLOA 3FXJA 3FBIB 4UXNA 5HLTA 1FPQA 1SVMA 3CF2A 1O3QA 2KHMA 2R92J 3E97A 2Q8KA 3CCUI 4B3XA 1CF7B 4P9UA 3H35A 1XG1A 3WGGA 5CVIA 3JW4A 1UAAA 4S04A 1YW7A 4KNYA 2A05A 4IO9F 4XSZF 1BN5A 5B5EC 1YX3A 1XSVA 2DA3A 2QQBA 3L00A 3DPLC 4IHYA 3DBHB 1J2XA 5DM6F 3IHUA 4G8XA 4RAGA 2P7CB 2ECCA 3S1RJ 3H3UA 1YHQI 1ITYA 2ZMEB 3WTWC 5DD8A 1O3TA 2HOAA 3DEEA 3K4BA 1ZLKA 2HOTA 3PM1A 4QWQA 1LFUP 2HDCA 4KITB 1YQAA 2CFOA 1XS9A 4NUBA 3FDYA 1W0UA 4NQWB 3JRDA 4CICA 2KZGA 2PG4A 1IN6A 1K4TA 4BKXA 1AKHB 4A3IJ 1T56A 3L9FA 1SMTA 5J6XA 4BYYA 4C2MJ 2EA2A 3OL4A 4AC0A 4EMSA 5JI6A 4N9IA 3J81Z 4IHTA 4KJZA 3WODF 4BHBA 3F8CA 4OAZA 1I1GA 4XN3A 3FIWA 5CVVA 2RGVA 2H94A 2Y31A 1WI9A 3M7GA 4PJNA 1GVDA 2XGDA 3CMYA 2PMUA 4LD5A 4ZYGA 2LY1A 3R60A 3K4MA 4BDYA 3C18A 1LE8B 2X51A 2Q0OA 3PUBA 4XLEA 3W6VA 3B02A 4F92B 2HDWA 2OZ6A 1S6LA 2ZJRF 2FUG2 3CCMI 2F4IA 2FQ3A 2HQRA 1FYLA 1O7FA 2LF7A 2XASA 2ZXWH 3LSRA 1YITI 4BJ5C 1X1PA 1WJ5A 4EATA 1FX7A 1U6GA 5HLIA 5DUIA 4ESBA 3ZGKA 2GIZA 2HVSA 2Z99A 4A0ZA 3RSNA 3H5AA 1ZG3A 4RMNA 3CDIA 2IGOA 3OYEA 4N0BA 1TLHB 2NVQJ 1Z05A 2IS1A 2A5YB 2K40A 1DDNA 2Y75A 2EQRA 1YTYA 2DDBA 1J75A 2I5UA 2VJ5A 4IVNA 1MMSA 1KQ9A 5EG0B 2X85A 2NS0A 3NWTA 1BOBA 2F6CA 2M34A 2JTVA 3RTRA 1FWZA 4DYQA 2ZJPF 4S05A 3I71A 3OR2C 2M8GX 4MFEA 2O61A 4RGUA 3CMAI 1VFCA 3OIOA 4EJVA 3JAMK 1ZTRA 3GFMA 1VQLI 3GTJJ 4E4HA 4EJTA 4DGWB 4FX0A 4A3FJ 4CO8A 2E2HJ 5CPRB 2DT7B 2K27A 3HM5A 5LEJA 1HOMA 2X6YA 3PNTA 4RGRA 1YRNA 2E1NA 2OTJI 4G7OF 3HGGA 1W5CC 1MBJA 3GO5A 4EV0A 4NDLA 2ACJA 5IP7J 2GXAA 2QLZA 4NC7A 3R0JA 1FIAA 2BEOA 2R7FA 3C7JA 2EFOA 1G3SA 4L5EA 3ML6A 3SZGA 1GXPA 1K83J 3BQZA 1VQ6I 1HKTA 5J47A 2KISA 4F55A 3JRBA 3F6VA 1BC8C 2HFHA 5DDGA 3HOUJ 2YR2A 2QQAA 2FQ4A 1RKTA 1E0EA 5D4RA 4P9FA 4OIOF 2V1XA 5F04A 2NRAC 2DTZA 2PFBA 1I6HJ 3ZQLA 2F5DA 3WE2A 1Z77A 5D5VB 3A0HC 1G3YA 1XSXA 3BY6A 2P81A 1LQ1A 3G1LA 2QEXI 3A2KA 1IN7A 3J7AO 2E1OA 5ILSA 3O3KA 1VZ0A 1ZK8A 2EBIA 1TW3A 2MW8A 1H88C 2IBDA 3OIPA 4OAYA 4G9YA 4CA0A 4KICA 3PNYA 5BPIA 3BJOA 3JSPA 3QQAA 1MH4A 1LFBA 4BQQA 1K4SA 2GA1A 2AHQA 2LD5A 4LGWA 4XRFA 3BC8A 4NC8A 5DTDA 2A3SA 3FXUA 3E6BA 1BR4A 3V7SA 2LVSA 3H1CA 1NG7A 3IWFA 4XM3A 4CGZA 4BE1A 1IXRC 2M2EA 1D0XA 2Z2SB 2OV7A 1Y6IA 1XCBA 2OQGA 1QGPA 3ZQCA 3H3ZA 3DEUA 2UXNA 3K1MA 1LUJB 1WHUA 5HS9A 1WJEA 3OL3A 5E3NA 4XRSG 3JRGA 3H0DA 3DLAA 2R7DA 3R6SA 4A5NA 1V5EA 2EA4A 2XF6A 3M8FA 4RGSA 1FMVA 3I9V2 4WCGA 2IS2A 1ZG5A 1V5FA 4FE4A 2J5OA 1MSFC 4E7HA 4C2TA 2DQRA 3HTUA 2IS6A 1D3YA 2K9SA 3ABUA 5FD6A 4PUSA 1W5TA 3ULQB 3VOEA 3OYLA 4PJLA 3SXYA 1HXDA 2NOGA 4R79A 1S9HA 3QWLA 1IV8A 3CDHA 2R7SA 1EKEA 2GM4A 2E5NA 4IXAA 1O4XA 2ZC2A 3IC7A 3A4CA 5JVTA 5M5YJ 5J1UA 3AL0B 1JGSA 1MGTA 2UV1A 5HDKA 1U2WA 2KJBA 3GZNB 4HEA2 1JE8A 1A6IA 3ABTA 2DODA 2ZFUA 3WHCA 2KFDA 3CUOA 3CDLA 3ERED 1D5YA 3BTIA 1IN5A 1MW7A 4M3DA 3TQNA 4CXFA 2ZBKA 3A01A 1OCOH 2X1DA 4M3BA 4QSHA 2PX9A 1KU7A 2FJ1A 2R7XA 4S0HB 3IP4B 4I0BA 3VPRA 3I53A 2VOPA 4IHSA 1YX5A 5FB2A 2ZO4A 1WZ2A 1R5GA 1X2NA 1R9TJ 5IPAA 1S5LC 4ITVA 1YI2I 2A6TA 1I27A 1P92A 4LB6B 3KEYA 1F43A 5D5UB 2VJIA 2XUBA 1ZGAA 2MFZA 1BM9A 1T95A 2OC6A 1ZAOA 5C4JJ 4CDGA 2XAQA 2M45A 3TMOA 5DD4A 3L2WA 3FMRA 1TWCJ 1VQOI 4IPAA 3QRFF 3T0YA 4OINF 3U21A 2A6EF 2EPFA 5IYBJ 2KQRA 3Q0UA 3WG7H 2I8DA 1LEAA 3DKWA 2MC4A 3OOUA 1LDKB 1ZRDA 4HX8A 4LOCA 3BWGA 1U8BA 3GUDA 2DA2A 4LJZF 4XL9A 3HOSA 3KX2A 1UFMA 3CMMA 1ZR4A 4GYGA 1HA8A 2LY2A 2PMZN 3E7LA 4BGDA 4HF1A 3K4CA 5LRRA 3NEUA 1T8IA 3MAJA 3SZTA 3TW6A 2DYRH 2FRHA 3E3VA 5ICGA 4A0XA 2QVOA 1JTYA 2DAOA 4RA2A 2W57A 2CUEA 2LKXA 4MO7A 2OZUA 1F1ZA 4BE2A 2XAJA 3DTEA 4O3MA 2J5PA 2XV4S 4J19A 2LFBA 3K4LA 3L2VA 3C2HA 4PFOA 2QENA 2F5CA 2DCEA 3DV8A 1G8XA 2OCEA 1YJ9I 2P0WA 3OS2A 3OYNA 2VXDA 2DFFA 1EA3A 2EV6A 1Z7LA 2EK5A 4GDFA 3IWZA 5AONA 3LFUA 1J09A 1K6OA 1DPUA 2XB0X 5FJ8J 3ZPLA 2VASA 4HRIA 1K6YA 3CCYA 3RCOA 4JK1X 3X2QH 3OYAA 4C2UA 3QPSA 1XB4A 1UMQA 1MMNA 3LA2A 4U0WA 3RI4A 1IF1A 2H6BA 3LAPA 3KYLA 2HYJA 4ENJA 4LMYA 4FISA 5J8CA 1NK3P 4EGZA 2VQLA 4EM0B 4HSTA 2HNHA 4Y13A 2MYSA 3HL2A 3PSFA 3G73A 2P5VA 2QYOA 4QIWN 4JOMA 1C0WA 3SDGA 3RZDJ 3F72A 3K4JA 5IYCJ 2DA4A 3D5RC 4KIGA 5KHDA 2WB1A 3SEZA 1AOYA 3MKZA 5E17F 1B8IB 1N77A 1OMIA 3VEPA 4PJMA 4U7DA 1E3OC 1B9MA 1D8JA 2OCCH 4B8XA 2ELJA 1AHDP 4OOIA 5B66C 3LSMA 4C3HJ 4BUPA 3O8GA 2WA0A 4M72A 3GBGA 1J7KA 3J7ZI 2VPLA 2ID6A 1X4PA 1UHMA 4HDVA 2HPMA 2X0LA 3FXLA 3LOCA 4YIIA 2B0LA 3ABLH 1MD0A 1HSTA 1WH7A 4BXUA 4ZYAA 1ETXA 2G7HA 2DK8A 4OIQF 2BE5F 2IGMA 1B9NA 1QHGA 1NG6A 3GMEA 5BOXA 1A04A 4YIFA 1TQPA 3ZN1A 3LSTA 5AIPA 2M0MA 3Q3SA 3PQKA 1QVUA 4II2A 3F6OA 1D0YA 2E71A 3BPXA 1TZLA 2K4BA 2RKHA 2QF7A 2V9PA 3ZMVA 4D7MA 2BOLA 4FASD 4PGHA 3I3LA 1JI8A 2LY9A 4I2OA 1P2FA 5B1BH 5DS9A 2QM3A 5GPCA 2A61A 4XKVA 3BR0A 3IKTA 2W48A 1DGWY 4IHXA 1E3PA 1QRYA 1OR7A 1R7JA 2MH2A 1DPRA 3V7CA 3H36A 1ERDA 2HYFA 3CCRI 2M30A 1H8AC 1R22A 2AO9A 2PBIA 1FBUA 2KL4A 2QQ8A 2B63J 4LK1F 3BOQA 3JRFA 3KLOA 3MVPA 2K5CA 5KVRA 4WWCA 1R23A 5F1RA 3JAMZ 3DTKA 3U2RA 2NVUB 2O8XA 2VODA 3FHZA 3ECHA 2WAEA 4U87A 4CCKA 1K7AA 3K2ZA 2JVHA 1I3AA 2IS4A 1G6NA 1Q1VA 3M8JA 4HSRA 2KIQA 1U8RA 3ZQGA 2GWRA 2X6OA 3KP3A 1OQYA 1VQ9I 2MGQA 4UB6C 4X1EA 1X19A 3G1OA 1FP2A 3TOBA 2H1KA 4EVIA 1RPWA 4CYCA 4XKWA 1JXSA 1MKMA 2M7AA 3LWFA 4Y3OA 2CWEA 2LH9A 1IZ1A 3K1NA 2LOOA 2L4AA 3CCSI 2QKMB 5E1WA 3ERMA 2ISYA 3OSGA 1R1UA 5DCMB 2L7MP 4V2GA 3VYSB 4B43A 1TNTA 2GZWA 4ZDLA 1DP3A 1SD5A 1A31A 1O3SA 2XRNA 4MQ9F 1Z7UA 2ADUA 1ORKA 1RI7A 3GFIA 4BXFA 3BZCA 1EH7A 3DTIA 2XC7A 2O8KA 2KIFA 1SVOA 1TT0A 1X3ZB 5F64A 3JTGA 3K70D 1U9NA 1OISA 2QZ8A 3ZMTA 5M3MJ 3I59A 1ZRFA 4KDPA 3BR3A 3SZPA 2K9QA 1IRXA 3MCZA 1IXCA 3GF2A 2WTEA 2GOMA 2FBIA 3IL2A 2CG4A 3U9GA 1G4DA 2IVMA 3FK6A 4M6YA 3BTCA 1JT0A 3AG2H 3EUHC 1ZREA 1GHCA 1IUYA 3HRSA 2XPWA 2QSHX 3TO7A 1W7PA 1V4RA 3DPUA 1MZBA 4JP0A 1I5ZA 2ME0A 2V9KA 3CJNA 3G4SI 2W00A 3W3CA 1UHSA 5DUKA 4LB5A 3DP7A 2ZSIB 2L7KA 1OYYA 2H6CA 5CVUA 1SVLA 2Z33A 2L9NA 3TOAA 4I0AA 3L2CA 5CVRA 5LD2C 5EF6A 3W6JB 4DJAA 5IY5H 4DBRA 2W24A 2VIXA 2XDVA 3V7RA 2CS3A 2RAEA 3P9KA 4ZDOA 4AYBA 2O7OA 5A2QZ 4G7HF 4L0ZB 3I54A 3A02A 3JR9A 1U9OA 3BT9A 4RB0A 2CQNA 3E0JB 1ZQ3P 1IGNA 2VI6A 1UZCA 3GTMJ 4DIQA 2HGCA 2R7TA 3OYKA 1V54H 3MZ8A 2X6XA 3ZOBA 5LLQA 4HLYA 1I1SA 3OYCA 2HZTA 2ZNYA 3KE2A 1ETOA 5DV5A 2MH9A 3CESA 2EWNA 3WU0A 1VQ8I 2HKXA 3BROA 1MNMC 4XR6A 1NHAA 2HI3A 5F0CA 3CD6I 1UCRA 2KIMA 2XKOA 5LBQA 3TP3A 2DT5A 4BEHA 3HPGA 2JWTA 5LEKA 4HDUA 1FLIA 2FNAA 2STWA 1GUUA 4RB1A 3GTPJ 1PVEA 3PSIA 5B3SH 2C6YA 2DQLA 5FLXZ 1USTA 3OSFA 2D2WA 1HQCA 2Y9YA 2XRLA 1NH3A 4XRMA 5GTIC 2BY0A 1A5JA 4M9XA 4A3JJ 2BXYA 4GXOA 2ZXIA 3E6MA 2XROA 1Q1HA 2ZJ2A 5JVGF 5H2FC 1IXSB 2PN6A 1POGA 1SFEA 4OIPF 3HZJA 3O2PE 3CC7I 5ILUA 3FF5A 1IRZA 1GV5A 2BGCA 3DLLF 3EYYA 1YIJI 1HLVA 3ABKH 1H89C 2NS8A 4MNUA 3GTOJ 2KT0A 3V4GA 4WK8F 3FWEA 2DMUA 4ON0A 1RR7A 1V3FA 3CP2A 3DCFA 1PUEE 2LP0A 2R5YB 2HQAA 1YJNI 4IL6C 3SFZA 3AAFA 3DF8A 1U5TB 3J80Z 1BR1A 2WC2A 2XSJC 3DKYA 2L9VA 3KCCA 3LSGA 2FE3A 3V42A 2MBFA 2EIJH 3LMMA 3Q0WA 4I99C 1R36A 1BJZA 3HGYA 3GEZA 3UR3C 1WH5A 1PDNC 5FRNA 3HRUA 4ETSA 4OU0A 4XLNF 3W2AA 3PIPF 5E1ZB 3BPVA 2FD5A 3B6AA 1QQIA 4HBLA 1RC9A 3DWLE 4M71A 2ZJQF 5JLXA 2EJRA 3VSLA 2OTLI 2LMDA 1T39A 2WV0A 4KN4X 1QA6A 1VQ7I 3MWMA 4IRIA 2KRHA 2WWYA 5E1XA 3HXLA 3WE3A 3REOA 4BJTA 3VYTB 2Y0MA 1A36A 4GFBA 1PJRA 5FKLA 3HTSB 1E3HA 3S15J 5ERIA 2K3PA 2NXNB 4FCYA 1PP7U 2E34A 1W7PB 3VYUB 2V1DA 3PO2J 2G7UA 1UB9A 2AQFA 3MFKA 1S8NA 3IAM2 4JX4A 3VWBA 3L09A 4MEXF 2G9WA 2P6TA 3MQ0A 1SFKA 4PJ0C 3CLQA 3RKWA 2DFHA 2ELKA 3ASNH 4M6VA 1JKPC 4A6EA 2CU7A 3O8HA 4B3AA 4HNUA 3K6GA 2XGCA 5L3GA 4W1UA 1U5TC 4UUSA 3OIQA 1P7JA 2HXOA 3OYJA 3CC2I 4E7KA 4CCLA 2W7NA 4CZZA 1XMKA 2VC0A 3S1QJ 3BZKA 1P7IA 1TNSA 3KEOA 1S72I 2DK5A 1PUFB 2X9DA 5BNGA 4DYRA 3HRMA 2NNNA 1I3QJ 2OF7A 4RGXA 2R5ZB 2BV6A 1R4MB 3GZ5A 1TC3C 1SD6A 2RNJA 2WV1A 3S1NJ 3QP6A 1SAUA 4PCQA 2X1EA 1YYVA 4H0EA 2CV1A 3BJAA 1HW5A 3LL7A 1KU9A 3SQNA 2DN0A 2K3FA 3ZQIA 2EB7A 2ZSHB 2ISZA 3KETA 5HS7A 4KISA 2EZKA 2Z1DA 4LG0B 2DMQA 3MN2A 1PUFA 3RQ4A 2XF7A 2F5VA 1WQ2A 3RKYA 2KMUA 3BTJA 3BR5A 3C3WA 1ON1A 4ZYHA 1D5VA 2Y0SN 3H9JA 1R5HA 1YW8A 4JBAA 4MEYF 1P4XA 4A69C 1VQNI 3BG6A 3DBLB 3KPHA 3RYPA 2L9RA 3H5RA 1MDMA 4RAYA 1YE9A 1R4NB 1T08B 1DU6A 3ESWB 2P8TA 4BBSJ 2QCOA 3D0SA 3BTLA 2CH0A 4A12A 2K85A 4F91B 4Y7NJ 2NAZA 2A5WA 3HPHA 2XPUA 3NWSA 1B4AA 1MJBA 1I50J 3DQVC 3GLXA 3HJEA 2FMLA 4EM1A 1QPIA 1LNWA 4RB3C 5KK1A 5GAEJ 4L5IA 2D1HA 3N4MA 2IAIA 3TL4X 1LKXA 1W5SA 4YFXF 4LG3A 4E7LA 3DXJF 2H27A 2GA2A 4MLOA 3EUAA 1D1BA 4LFUA 3OMYA 4C3JJ 2L01A 1FIPA 3BG9A 4XBFA 2BBYA 4ZYEA 3U1KA 2JQ7A 5E18F 3A03A 3EUHA 3IH3A 1T0FA 2RC4A 5TGTA 2MD5A 4B47A 4HNTA 5IOYA 2VE9A 3CUQA 2W85A 1RNLA 4Y17A 3CJRB 1BR2A 3R0AA 1Z3XA 4QPOA 3V8KA 2VOOA 3EDPA 4AIHA 3F0CA 1HC8A 1WWXA 4Y52J 4I09A 4UV9A 3J7AY 2DA1A 3IH4A 1BBYA 1UG2A 5AIQA 4HNVA 3GTLJ 3BCBA 2IA1A 1YO5C 1EF4A 5E79C 1XX5A 4G12A 1S3JA 4W97A 3DU5A 4ABZA 3KP6A 2UXXA 3TBIA 3ZXSA 1LPQA 1MMGA 3F8FA 2HPIA 3ZR8X 1SFXA 3J7YJ 1ZGWA 1HCRA 5D6EA 5DEQA 3HKZN 2L3DA 1B59A 3KZZA 5FKKA 4AIKA 4L9NA 2E35A 4IZZA 3GW2A 2M8EA 2M4GA 1JKOC 1T98A 2CW8A 1MBHA 4P55A 2EFPA 4UHTA 3F22A 1YJWI 3W2WA 4A5MA 5K5OA 4RAZA 1RKWA 4UVCA 3Q5FA 2DW4A 3B6CA 2YPRA 2L7FP 4LG0A 2HU9A 3QOEA 2Z9OA 3AFHA 2PI0A 2JUCA 3I55I 3COAC 1OPCA 2JRMA 1SFOJ 4Y33A 1EH6A 1UHWA 1MNDA 3KFWX 3HB9A 3LA3A 3WGHA 1USSA 2E60A 1WSUA 1XMXA 3KZYA 1XDSA 5EGOB 2FEZA 2JN6A 2ZB9A 2E1CA 2OUMA 3FBNB 2QA4I 5ICFA 1E2XA 2VUMJ 2R7RA 1RESA 4Q5SF 2OBPA 3RPUD 2XAGA 1FTTA 4R1HA 5ICEA 4QTRA 4P1WA 2LF8A 3K4NA 4LIVA 1VQ5I 1IN8A 3TEDA 4IHVA 5CKTA 2EFWA 4KA4A 1FMWA 2P5KA 3SYTA 3O6BB 2FOKA 1TW2A 1SEUA 1FOWA 2L0KA 4PSXA 3K10A 5F27A 4L9TA 4BS9A 2OQRA 3BQYA 3QU3A 4X0GA 3T5XA 3TO6A 3OYMA 1D1CA 3I56I 1AWCA 3AKZA 2CO5A 3IRRA 1J9IA 2VC1A 2NYXA 1MMDA 2I10A 2ID3A 3QYBA 3S2DJ 4YG2F 2DFIA 5EEAA 3FX3A 3D5LA 1ZN2A 2UUZA 5CLSA 1Z9CA 4EJUA 2E1MB 4C9YA 3KLNA 3GCMA 3HUGA 4PDKA 3KYCB 3ZQ7A 5ILVA 2PEXA 3C2GA 3WTXC 1D8KA 1ZG1A 1SFUA 1Y0UA 2JMWA 2YUSA 3BP8A 5BQTA 4CUGA 2OU2A 1IJWC 4BACA 5A2QK 4A3KJ 4I6ZA 1W36D 2BHZA 2M9HA 3A0BC 1NK2P 3IV5A 1FJLA 3JRAA 3JTHA 2VPRA 4M74A 3OYDA 2BW3A 4YEJA 3HHGA 2IP2A 2FOWA 3PL8A 4F7ZA 3MKYB 3LAJA 4AWXB 3GXOA 1S29A 3CO7C 4CCNA 3HBLA 1Z0XA 3A1YA 1JUPA 5EZHA 1S7EA 5EZGA 3ZQHA 2WAFA 2KRCA 4I98B 3S8PA 2L2OA 1KU2A 2MD0A 3K9TA 2R0QC 2LRDA 3R4KA 2VN2A 3E1SA 2FBKA 2PJRA 3FMQA 3GFJA 2NNYA 1REPC 2CQQA 3OV8A 3FKJA 3T8TA 3SFIA 2H8RA 1I39A 4U0VA 4E7SA 2R5ZA 2E36A 4KIBA 1PP8F 1J0RA 2VXZA 4GO1A 5CYVA 2ETHA 1ZELA 1XCVA 3K0LA 2VKDA 3CCEI 3KYDB 5JHFA 2L7ZA 3MD2A 4B48A 4P5OA 1V5GA 2OJED 2JSPA 4L0YB 2L9SA 3IAS2 2IJLA 4HV6A 4UV8A 4HLXA 2Q1ZB 3S17J 3WTTC 1JKRC 3M1CA 3PQJA 4D0PA 3OYGA 4O6JA 2ESHA 3NQOA 1FNNA 4DNCA 2RN7A 3VB2A 1ZR2A 4I01A 4R8HA 3FMSA 4A3LJ 2GBYA 2NOJB 4HX7A 3HOTA 4KMUX 2RQPA 5K5QA 3S3OA 4AVZA 4N4NB 2OD5A 1W1WE 2E7XA 4ENMA 2VJ4A 1WI3A 1TQIA 1STZA 3FM5A 4A93J 5D8KB 3OS0A 1AA7A 1X1DA 3PFIA 1XPXA 3BZ6A 1IDYA 5H6RA 1G2HA 1ETWA 4JYKA 4WXHA 1KQ0A 4HZFA 2VBXA 3TP0A 1X58A 1VF9A 2W25A 2DBBA 2IA2A 2VKEA 2LKPA 4CYCB 3D5SC 3LSIA 3QPTA 2XAUA 4MIMA 2VJJA 3N05A 3ZMSA 5L3DA 4XN0A 4UUTA 4HYEA 3S2HJ 5IP6A 4EJWA 3VSKA 1L0OC 3WHBA 1SD4A 2LYCA 4YELA 2YSRA 1IG7A 4EQQA 3I0TA 3VDXA 2F4MB 5HLGA 1I6XA 2V6CA 4G94A 5J4YA 1O3RA 1HW2A 2CQ7A 1YG2A 2AXTC 1Y8RB 4M9ZA 3CUQB 1XMAA 2BXZA 3BJ6A 3H0GJ 3ZMDA 3F21A 4HQMA 1G3TA 2KDZA 2FXAA 4DBQA 1HF0A 2XGXA 3H92A 2GQQA 3FHNA 4PJJA 3T8RA 1TQMA 4KT6A 1F9NA 1TTYA 4MTEA 2PMHA 1VQ4I 1HBXG 2BY3A 2BW3B 3DU6A 1F36A 3RQIA 3ZRGA 1WPKA 1B8IA 2VT2A 1IV6A 2K9LA 4P96A 2TRTA 2O3FA 1OJLA 2DA6A 2O6GE 3S2WA 1FOKA 1RRJA 4I7HA 4CCJA 5EEGA 3HOVJ 4ZZDA 1UJ8A 3HYIA 3GTKJ 1MDMB 5H20A 2HTJA 2GXGA 1WJDA 1DQUA 3WGIA 4IRGA 2R3SA 3GZ6A 1K79A 3S1MJ 1YFHA 2P5LC 3HSFA 1JT6A 2WY8Q 4FE7A 5EYRA 2FF4A 2G0EA 1R6RA 5FLVA 4LLGF 3RIRA 2V7FA 5H6QA 3NRVA 5DCMA 1SAXA 3PO3J 2KP6A 4UB8C 1JUSA 3RPQA 1JHHA 3G1MA 4XICA 3CC4I 5CQGA 2P6SA 3VYRB 2M87A 3WTYC 1D0ZA 2Y69H 4IQJA 1IRGA 3P9CA 3CQZJ 2A69F 1R5ID 3FXRA 4IEJA 2OAZA 4L18B 4V2FA 4CCMA 2Z3YA 5FRMA 4O5VA 2Y30A 4B44A 2IW5A 2ZMEC 3JCUC 5K7FA 4A6DA 3AG3H 3VODA 3TGNA 2HOSA 5EGOA 1OLTA 1BC7C 2DJNA 1HKQA 5HODA 2NVYJ 1B72B 1BJAA 2WAQN 2Y0SA 1FSEA 3OS1A 5HDGA 2BVLA 1WGXA 3HOWJ 1Y39A 2GLOA 5D6FA 2E7WA 2ME6A 2DJIA 3QOPA 5LGTA 1GT0C 2UWMA 2EINH 2CW7A 3M1EA 4ZH4F 3CP8A 4BBRJ 2V79A 2GOXB 2R7VA 2ZXJA 4AYBN 4RDUA 3P7NA 3L7WA 3FXMA 3SJMA 1MBKA 2DXIA 3DBRB 4H4KC 4E7ZA 2KRFA 3F23A 3LSJA 2LBFA 4RAFA 1SD7A 5FFZA 4ZDPA 3IRQA 2DPDA 4MHGA 3H9GA 2K9MA 2P7VB 4BHPA 3BG3A 4IX7A 2YU3A 4KN7X 4TV7A 1XSDA 1BA5A 2H8WA 2VONA 1G3WA 3LQRA 4A3CJ 3EUKL 2W4SA 2M5WA 3KEQA 5LHHA 1ZLJA 4XONA 4BE0A 2CGPA 4F3QA 3OY9A 2DYSH 3ZMZA 2NVXJ 2E1MC 4QLCU 1HSJA 2EFQA 1IUFA 2CW0F 2DMNA 3GLLA 2Q2EB 3QU6A 2YS9A 2JJ7A 3H3VK 2VBZA 1X2MA 5M5WJ 2R7UA 2ICWG 3ELKA 1Z67A 2BYVE 2COMA 4BH9A 2W82A 1ZYRF 1VQPI 5FKMA 4Z2YA 2ZXHA 5IOZA 5J4VA 3PJRA 3PUFA 5K7HA 1F4KA 2HDDA 1APLC 2A07F 4LITA 3K7AJ 3HSEA 1FZPB 2PQ8A 2IGNA 3F8MA 4PFPA 4KFCA 5K7ZA 4OWRB 4GRIA 4C3IJ 2MG4A 4E70A 2EV0A 2LNBA 4YRVA 2VQHA 3E5XA 2VBWA 1YS7A 4BQOA 3HOXJ 1FOYA 3NARA 3M3YJ 4II3A 3WU1B 3G2BA 3HKZA 1DU0A 3SDBA 1TP4A 4IF4A 1ON2A 3HG9A 1GV2A 2DOFA 2FA5A 2H1LA 5LGUA 4U7BA 4KMFA 4AD9A 4ENKA 5D5WB 4AUXA 1BIBA 3RKQA 2V1NA 3ONQA 2YU9J 5C4XJ 2MLKA 5KAIC 3I4MJ 1OYWA 1T0FC 5FFXA 3EYIA 2KIUA 2WY7Q 4XKCA 4U88A 3JRHA 1XDUA 4A3MJ 1R1TA 2O0YA 1MBFA 5D5XB 4GCVA 4FQGA 4BU2A 2LSOA 3HOYJ 1TWHJ 5FLMJ 1IW7F 3OOPA 3WG9A 1TWAJ 3H9QA 2M3AA 4Q47A 3ISPA 4CCOA 2DPUA 3C2BA 4J01A 3CZ6A 2ESNA 5KNLA 1FBSA 1XGOA 1FYMA 4OIRF 2ZMEA 3M8EA 2NS7A 1ZARA 2R7OA 1Y8QB 4YIRX 2LLKA 3CMEI 2IT0A 2JA8J 1W4MA 4NB5A 4GGGA 2BHYA 5F6FA 2LKSA 2JSCA 2DOEA 2FBHA 5F08A 3EQLF 3JREA 5J40A 5IP9J 2JPCA 4LLNA 1FP1D 3TKYA 2W84A 2V1UA 1BI3A 4HG2A 2VE8A 3BDDA 3L2RA 3S3NA 3ZMUA 2QQ9A 4XIDA 1EV7A 2D5VA 2N8GA 1X1CA 1KYZA 3MEXA 5LGNA 1A6QA 1U3EM 1MIJA 3M9AA 1JJ6C 5JLWA 2JRTA 4HA8A 4RLFA 1KONA 1X4OA 5E3OA 3BR6A 2HS5A 2RREA 2OPTA 2STTA 3AL0C 3M07A 2GIVA 5ICCA 4I76A 2DTRA 3I64A 4HAMA 5HNHA 3WTSC 3ZP5A 2HXIA 1TT5B 2TCTA 3S16J 1X3UA 2A68F 1JTXA 1X1AA 2LK2A 3CUQC 3WU2C 3IKVA 1RUNA 2EH3A 3RZOJ 3HRTA 2O9LA 5GTHC 5FO5A 2CUFA 5LHGA 4XOPA 1Z91A 3HIFA 5FKNA 4B4CA 3V8LA 5BS6A 1LB2A 5HVQC 2QGUA 1ZRCA 5EG0A 2H09A 4G7ZF 2R7QA 4A3BJ 3WTVC 4UNOA 1GDTA 3KP2A 2EV5A 4NBQA 1XGSA 5J8FA 1UG0A 2XGEA 4ZC3A 1LJ9A 3RJPA 3RKXA 2HQNA 2YX7A 2K4JA 2LBFB 4MFDA 3JSOA 2DDAA 3HC7A 1DUXC 1FSHA 3CJTB 2EZHA 2LTPA 4WX9A 2FU4A 3Q9SA 2E2IJ 2ZKZA 5CVJA 2HQ5A 4BL0B 1YRNB 1KQ8A 2JPBA 4D1QA 2XVCA 3M4OJ 1W36C 4Z6YA 2XKPA 5FKOA 2FNPA 1GVJA 1QPMA 4DW6A 5IT9K 3N97A 1Y1WJ 2K86A 3I58A 4FT8A 4GYIA 4DYCA 5LFAA 1FBQA 5D8LB 2JA5J 1Y0NA 2IXSA 4BAYA 1ONVA 2QUFA 3LNQA 2AS5F 3J81K 4XRSA 3LFKA 5EJCA 2HEOA 2QKLB 2IEKA 4B1RA 2BY2A 3RPUA 3W6KB 2R7ZJ 4XQFA 4YFKF 1LDDA 4ESFA 2HOEA 1N78A 1WFXA 1KGSA 3QYFA 2Q2EA 4M73A 4NC6A 2DLLA 2PJRB 5L3CA 3CJQB 2RVCA 2MSYA 1H9GA 1KA8A 2X48A 3K4KA 3OR1C 3FISA 1FC3A 1VTNC 1V55H 2LDUA 2CQKA 2QBYB 4KYWA 2YX4A 4K2EA 5M5XJ 1U78A 1E17A 5KAFC 4OMZA 1X1BA 3FXQA 3GTQJ 4PK4A 2CYYA 4NNJA 3I4PA 1BIAA 3JRCA 2V26A 4IOAF 2M4KA 9ANTA 5GADJ 3S3MA 2NVTJ 2BY1A 3HHHA 4CYDA 4DZJA 1HW1A 4A2UA 4EM2A 3QPHA 1WJCA 4AVPA 5LHIA 1QNTA 2KPMA 2HKOA 3FXOA 1LE8A 1JHFA 2Y2ZA 3MKWB 1OCRH 4XLAA 2VQCA 3EETA 1XGMA 4I02A 1XTAA 4EGYA 5E8IA 4Q48A 3CCQI 1Y1VJ 3CTAA 4JQFA 1WVRA 4DOZA 3UNGC 3EPZA 1IAWA 1UELB 3K1PA 5DM7F 2XAHA 3I59B 1YOVB 3DKXA 4EJOA 5JFRA 1B72A 4XNFA 2VKHA 1BL0A 4XORA 1LVKA 1MMAA 5DCFA 1QZEA 4F93B 3L2UA 5JR3A 1YLFA 1IDZA 1P9QC 3AG4H 6PAXA 2RDPA 2JK3A 2V9VA 2FX0A 3OYBA 3FXKA 4BY7J 1GXQA 4D5FA 1K78A 2RV8A 2DU9A 2X1CA 2DOAA 2F5FA 3ABMH 4BJ6C 3G3ZA 1FEXA 3GX4X 2EFNA 1D1AA 1R1VA 3CCLI 3HUGB 1QBJA 1OFCX 1SANA 3TW7A 4RB2C 4C30A 1RIOH 4PGGA 1ULYA 4ANJA 2B9SA 1F5TA 5F0FA 5GAGJ 4WF2A 4QPQA 5IT9Z 3IH2A 3CO6C 1MJ9A 2DFEA 3PFYA 2F4OB 1XGNA 1XD7A 1Z21A 2ECBA 3FZVA 4L5JA 4UVBA 5EDNA 3KP5A 3ECOA 2VL8A 4ASNA 5FLXK 4XLHA 3BCAA 1W0TA 1J5YA 1BI0A 1QU3A 4ZZLA 2XHKA 2CSOA 3QPLA 3BR2A 3FM3A 4LLLA 1CF7A 5F0HA 2QSGX 2K02A 4XK4A 4MQVA 2R5YA 1WKMA 1B1BA 4BY1J 1JJ8C 3WTZA 1WCMJ 2RQQA 2KZVA 2Z5UA 4F52A 1BW5A 1GLNA 1MH3A 1Z1DA 4Y4RA 1FYKA 1G59A 3DFGA 5B1AH 4IOCF 5J3LA 2E5ZA 4Q4ZF 2HVQA 3CCJI 1VQMI 4UUVA 4G6TB 3B73A 4HF2A 3P9IA 2X4HA 4DQ2A 2VKVA 4HF0A 1HDDC 4V19K 5FROA 3WTUC 2EZIA 1BOAA 1PYVA 4ZJZA 1R49A 4BXXJ 2LREA 3S32A 1IO2A 1T2KA 3C1DA 1TBXA 5JHUA 4E7IA 2MA3A 4AIJA 3LSHA 1OCPA 1ETQA 4EEFG 5GAHJ 3VFZA 3P5JA 5GP9A 2A6HF 4BQNA 5J1RA 3ZQFA 5IYDJ 1P6RA 4LK0F 5FGMA 3HEFA 4ZTJA 1N75A 4NHJA 3K2AA 3Q9VA 1B6AA 1H9TA 2O03A 3DEWA 4HOBA 1SMYF 4XOTA 2F48A 1ZGJA 5TISC 2BVMA 1VNDA 3IUOA 4A3EJ 1K78B 1MBGA 4BEHB 1Z6TA 1FTZA 2TDXA 3KZIC 2MLGA 5K1YA 3T1BA 3E5QA 3L1PA 5L3BA 4JX6A 4KT5C 2X6WA 2XB5A 4N4OB 5C44J 2AQEA 1H0MA 2UZKA 1BI1A 4D7NA 2FSWA 1HDPA 2VLAA 2CUZA 5DYMA 5FD5A 2IRFG 2L4MA 1BI2A 4M6XA 4XLFA 2ZFWA 3R61A 4KIFA 1BW6A 2L54A 3J80K 1ACIA 4G6DA 1WJAA 2PLYA 3PIOF 1RUOA 2JA6J 4NQWA 4WXDA 4G6QA 2DMTA 3OYFA 5J1YA 4B09A 3LA7A 4CH7A 3BG7A 1AKHA 3F3XA 2HZDA 1OKRA 3ZCOA 2QWWA 2V4JC 4IRHA 2E2JJ 4N9HA 3LQQA 3HOZJ 2CFXA 4PZJA 3ASOH 3BR1A 3E5UA 2K9NA 1P4WA 1FT9A 3PNVA 2KKOA 3ZN0A 2Z16A 1VQKI 2D45A 2M0CA 4Y15A 4D5CA 3G6EI 1OYIA 3DPTA 1JUMA 2AXLA 2IA0A 5EEHA 4IKFA 2E19A 3LSPA 1TL8A 4XMYA 4ZTFA 1ZKGA 3OWTA 2LR8A 3SEQA 4LIUA 4UY8I 1FOXA 1YW9A 4HW0A 4IHWA 1T6SA 1ZH5A 4OMYA 2XPVA 1LFPA 1TWFJ 1ETYA 2PJPA 3H5NA 4WXCA 1IRFA 2ELHA 2D1VA 4CZCA 2CQXA 2EILH 2WADA 2M1BA 1Y56A 2VB6A 3Q0VA 2CUJA 4M3EA 2JA2A 3HSRA 5GPAA 4UUSB 2HR3A 3G71I 1O7LA 1DGRM 3GFLA 2CMPA 3K69A 2MABA 4YFNF 2Y9ZA 5E20A 1LVAA 2DO7A 2P4WA 3CF5F 1LEBA 4MTDA 2DT6A 2EIMH 2DA7A 3GYHX 5BMZA 3KP7A 3FK7A 1ENHA 4ENNA 1YS6A 2HYGD 4ESJA 5E8GA 1T38A 4FTHA 2RNGA 1OCTC 4AM3A 4FX4A 1RZ4A 2HTSA 2XIGA 3MZHA 1ETKA 1J59A 1EJ9A 4U0YA 1IN4A 5C3EJ 1XN7A
chains in the Genus database with same CATH topology
5L3EA 2ZNZA 1L3LA 3V8JA 2GAUA 1U5TA 4KUMA 5TRDA 5HS8A 2L02A 3ROUA 2K7LA 1R58A 2OA4A 3TO9A 2QBYA 1W7PD 2JT1A 5D4SA 3E6DA 3CLOA 4FHTA 5BPDA 2XAFA 4HV5A 3GWZA 3TDZC 1P4AA 4RS8A 2VBYA 2Y48A 3RYRA 4CHUA 1ZHFA 1HKSA 3E6CC 5IT3A 1YIOA 3U1DA 3QAHA 1WRJA 1KU3A 3TDUC 3MZYA 2GXBA 3KP4A 4UVAA 4L9VA 1LDJA 2F5EA 3F8BA 1CGPA 1FY7A 1O57A 2ZCWA 5TJJA 4IJAA 3GVAA 2MC3A 3F8NA 4BQAA 5ED4A 5HLHA 2VT3A 4M9SA 1MJAA 3QP5A 5K5RA 4ZYDA 1Z6RA 1QO0D 5L3FA 2IPQX 2F2EA 1ODDA 5HDNA 4HX4A 2FMYA 4A0YA 4BHCA 3RDIA 1XN7A 2DI3A 5LRSA 4MGRA 5HOOA 4L9JA 1S7AA 4BNCA 2KJCA 2JZYA 1DP7P 1QZZA 1EH8A 1QZYA 5CJ9A 1S7OA 3SHFA 4HQEA 1KYWA 2HWVA 4XSXF 1R00A 4XLPF 3I5UA 4UXNA 1FPQA 1O3QA 3E97A 2Q8KA 1CF7B 4P9UA 3WGGA 5CVIA 3JW4A 4S04A 1YW7A 4KNYA 4XSZF 1BN5A 1XSVA 2QQBA 3L00A 3DPLC 1J2XA 3IHUA 4G8XA 2P7CB 3H3UA 2ZMEB 3WTWC 5DD8A 1O3TA 1ZLKA 4QWQA 2HDCA 1YQAA 4CICA 2PG4A 1IN6A 3L9FA 1SMTA 5J6XA 4BYYA 2EA2A 5JI6A 4EMSA 3J81Z 4N9IA 4IHTA 3WODF 4BHBA 3F8CA 1I1GA 5CVVA 2RGVA 2H94A 1WI9A 3M7GA 2PMUA 4LD5A 4ZYGA 3R60A 3C18A 2Q0OA 3B02A 2OZ6A 1S6LA 2FQ3A 2HQRA 1FYLA 1O7FA 2LF7A 2XASA 1FX7A 1U6GA 5HLIA 5DUIA 4ESBA 2Z99A 4A0ZA 1ZG3A 4N0BA 1TLHB 1Z05A 2A5YB 1DDNA 2Y75A 1YTYA 1J75A 4IVNA 1KQ9A 2NS0A 2JTVA 3RTRA 1FWZA 4S05A 3I71A 2O61A 4RGUA 4EJVA 3JAMK 3GFMA 4EJTA 4FX0A 4CO8A 2K27A 5LEJA 4RGRA 2E1NA 4G7OF 4EV0A 3GO5A 2ACJA 2QLZA 3R0JA 2BEOA 2R7FA 3C7JA 2EFOA 1G3SA 3ML6A 1GXPA 1HKTA 3F6VA 1BC8C 2HFHA 5DDGA 2YR2A 2QQAA 5D4RA 4P9FA 4OIOF 2V1XA 2NRAC 2PFBA 2F5DA 3WE2A 5D5VB 1G3YA 1XSXA 3BY6A 1LQ1A 1IN7A 3J7AO 5ILSA 3O3KA 1TW3A 4G9YA 4KICA 5BPIA 3BJOA 3JSPA 2GA1A 4LGWA 4XRFA 2A3SA 3FXUA 3E6BA 3V7SA 3IWFA 4CGZA 1IXRC 1XCBA 2OQGA 1QGPA 3H3ZA 3DEUA 2UXNA 3K1MA 5HS9A 2R7DA 3R6SA 4A5NA 2EA4A 3M8FA 4RGSA 4WCGA 1ZG5A 2J5OA 2DQRA 3HTUA 1D3YA 3ABUA 5FD6A 1W5TA 3ULQB 3VOEA 3SXYA 1HXDA 4R79A 3CDHA 4IXAA 3IC7A 5JVTA 1JGSA 1MGTA 5HDKA 1U2WA 2KJBA 1JE8A 3ABTA 3CUOA 3ERED 4CXFA 1IN5A 3TQNA 2ZBKA 1KU7A 4I0BA 3I53A 2VOPA 4IHSA 5FB2A 2ZO4A 1R5GA 1I27A 1P92A 4LB6B 5D5UB 2XUBA 1ZGAA 1BM9A 1ZAOA 4CDGA 2XAQA 2M45A 5DD4A 3FMRA 4IPAA 3QRFF 3T0YA 4OINF 2A6EF 1LEAA 3DKWA 1LDKB 1ZRDA 4HX8A 3BWGA 3GUDA 4LJZF 3HOSA 1UFMA 4GYGA 4HF1A 5LRRA 3NEUA 3MAJA 3SZTA 2FRHA 3E3VA 5ICGA 4A0XA 2QVOA 2DAOA 2W57A 2OZUA 1F1ZA 2XAJA 4O3MA 2J5PA 2XV4S 2QENA 2F5CA 3DV8A 2EV6A 2EK5A 3IWZA 5AONA 1K6OA 1DPUA 3ZPLA 4JK1X 1XB4A 3LA2A 4U0WA 3RI4A 1IF1A 2H6BA 3LAPA 4ENJA 4LMYA 5J8CA 4EGZA 4EM0B 4Y13A 3G73A 2P5VA 2QYOA 1C0WA 3F72A 4KIGA 1AOYA 5E17F 1OMIA 3VEPA 4U7DA 1D8JA 1B9MA 4B8XA 4OOIA 4M72A 1J7KA 1UHMA 4HDVA 2X0LA 4YIIA 2B0LA 1MD0A 1HSTA 4BXUA 2G7HA 2DK8A 4OIQF 2BE5F 1B9NA 5BOXA 1A04A 4YIFA 1TQPA 3ZN1A 3LSTA 5AIPA 3PQKA 3F6OA 3BPXA 2K4BA 2RKHA 3ZMVA 4PGHA 4I2OA 1P2FA 2QM3A 2A61A 3IKTA 1OR7A 1R7JA 2MH2A 1DPRA 3V7CA 2HYFA 2M30A 1R22A 2PBIA 1FBUA 4LK1F 3BOQA 3KLOA 5KVRA 4WWCA 1R23A 5F1RA 3JAMZ 3U2RA 2O8XA 2VODA 3FHZA 3ECHA 1K7AA 3K2ZA 1G6NA 1U8RA 2GWRA 3KP3A 1FP2A 3TOBA 4EVIA 1JXSA 1MKMA 3LWFA 2CWEA 1IZ1A 3K1NA 2L4AA 5E1WA 2ISYA 1R1UA 5DCMB 2GZWA 1TNTA 1SD5A 1O3SA 2XRNA 4MQ9F 1Z7UA 2ADUA 1RI7A 3GFIA 1EH7A 2KIFA 5F64A 3JTGA 2QZ8A 3ZMTA 3I59A 1ZRFA 4KDPA 3SZPA 3MCZA 1IXCA 3GF2A 2WTEA 2FBIA 3IL2A 2CG4A 3U9GA 1G4DA 2IVMA 4M6YA 1ZREA 1GHCA 1IUYA 3HRSA 3TO7A 1W7PA 1V4RA 1MZBA 1I5ZA 3CJNA 5DUKA 4LB5A 3DP7A 1OYYA 2H6CA 5CVUA 2Z33A 3TOAA 4I0AA 3L2CA 5CVRA 3W6JB 2W24A 3V7RA 3P9KA 5A2QZ 4G7HF 4L0ZB 3I54A 4RB0A 2HGCA 5LLQA 1I1SA 4HLYA 2HZTA 2ZNYA 3KE2A 5DV5A 2MH9A 2EWNA 3WU0A 2HKXA 3BROA 1NHAA 1UCRA 2KIMA 2XKOA 5LBQA 2DT5A 5LEKA 4HDUA 1FLIA 2FNAA 2STWA 4RB1A 2C6YA 2DQLA 5FLXZ 1USTA 2D2WA 1HQCA 4M9XA 4GXOA 3E6MA 2XROA 1Q1HA 2ZJ2A 1IXSB 2PN6A 1SFEA 4OIPF 3O2PE 5ILUA 3FF5A 2BGCA 3EYYA 4MNUA 3V4GA 4WK8F 3FWEA 4ON0A 1V3FA 1PUEE 3SFZA 3AAFA 3DF8A 1U5TB 3J80Z 2WC2A 3KCCA 2FE3A 2MBFA 1R36A 1PDNC 3GEZA 3HRUA 4ETSA 4OU0A 4XLNF 5E1ZB 3BPVA 1QQIA 4HBLA 4M71A 2EJRA 1T39A 2WV0A 4KN4X 3MWMA 4IRIA 2WWYA 5E1XA 3WE3A 3REOA 2Y0MA 3HTSB 5ERIA 1PP7U 1W7PB 2V1DA 2G7UA 1UB9A 3MFKA 1S8NA 3L09A 4MEXF 2G9WA 2P6TA 3MQ0A 3RKWA 4A6EA 5L3GA 1U5TC 4CZZA 1XMKA 2VC0A 1TNSA 3KEOA 2DK5A 3HRMA 2NNNA 4RGXA 2BV6A 3GZ5A 1SD6A 2RNJA 3QP6A 4PCQA 1YYVA 4H0EA 3BJAA 1HW5A 1KU9A 3SQNA 2EB7A 2ISZA 3KETA 5HS7A 4LG0B 1WQ2A 3RKYA 3C3WA 1ON1A 4ZYHA 1D5VA 1R5HA 1YW8A 4JBAA 4MEYF 1P4XA 3RYPA 1MDMA 4RAYA 2P8TA 3D0SA 4A12A 2NAZA 1B4AA 1MJBA 3DQVC 3GLXA 2FMLA 4EM1A 1LNWA 5KK1A 4L5IA 2D1HA 3N4MA 1W5SA 4YFXF 3DXJF 2H27A 2GA2A 4LFUA 2L01A 4XBFA 2BBYA 4ZYEA 5E18F 3EUHA 1T0FA 2RC4A 2MD5A 2VE9A 3CUQA 2W85A 1RNLA 4Y17A 3R0AA 3V8KA 2VOOA 3EDPA 4AIHA 1WWXA 4I09A 4UV9A 1BBYA 5AIQA 1YO5C 2IA1A 1S3JA 3KP6A 2UXXA 3F8FA 1SFXA 5D6EA 5DEQA 4AIKA 2L3DA 1B59A 3KZZA 4L9NA 3GW2A 2M8EA 1T98A 4P55A 4UHTA 2EFPA 3F22A 4A5MA 5K5OA 4RAZA 4UVCA 3Q5FA 2DW4A 2YPRA 4LG0A 2Z9OA 2PI0A 3COAC 1OPCA 1EH6A 1UHWA 3KFWX 3LA3A 3WGHA 1USSA 1WSUA 3KZYA 1XDSA 2FEZA 2E1CA 5ICFA 1E2XA 4Q5SF 2OBPA 2XAGA 4R1HA 5ICEA 2LF8A 1IN8A 2EFWA 4KA4A 2P5KA 3O6BB 2FOKA 1TW2A 4L9TA 2OQRA 3QU3A 3T5XA 3TO6A 1J9IA 1AWCA 2CO5A 3IRRA 2VC1A 2NYXA 4YG2F 2DFIA 3FX3A 3D5LA 1ZN2A 5CLSA 1Z9CA 4EJUA 3KLNA 3HUGA 4PDKA 3ZQ7A 5ILVA 2PEXA 3WTXC 1ZG1A 1D8KA 1SFUA 1Y0UA 3BP8A 5BQTA 2OU2A 5A2QK 3JTHA 4M74A 3HHGA 2IP2A 4F7ZA 3LAJA 4AWXB 3GXOA 1S29A 3CO7C 4I98B 1KU2A 3K9TA 3R4KA 2VN2A 2FBKA 3FMQA 3GFJA 2NNYA 1REPC 3OV8A 3T8TA 4U0VA 4KIBA 1PP8F 1J0RA 2VXZA 4GO1A 5CYVA 2ETHA 1XCVA 3K0LA 4P5OA 4L0YB 2IJLA 4HV6A 4UV8A 4HLXA 3WTTC 3PQJA 4D0PA 4O6JA 2ESHA 3NQOA 1FNNA 4DNCA 2RN7A 3VB2A 4I01A 4R8HA 3FMSA 4HX7A 3HOTA 4KMUX 2RQPA 5K5QA 2OD5A 2E7XA 4ENMA 1TQIA 1STZA 3FM5A 5D8KB 3PFIA 3BZ6A 5H6RA 4WXHA 1KQ0A 4HZFA 2VBXA 2W25A 2DBBA 2IA2A 2LKPA 3QPTA 3ZMSA 5L3DA 4HYEA 4EJWA 1L0OC 1SD4A 2YSRA 4EQQA 3I0TA 5HLGA 1I6XA 2V6CA 4G94A 1O3RA 1HW2A 1YG2A 4M9ZA 3CUQB 1XMAA 3BJ6A 3ZMDA 3F21A 4HQMA 1G3TA 2FXAA 2XGXA 3H92A 2GQQA 3T8RA 1TQMA 1F9NA 1TTYA 4MTEA 2PMHA 1HBXG 2VT2A 4P96A 2O3FA 2O6GE 3S2WA 1FOKA 4I7HA 5EEGA 4ZZDA 3HYIA 1MDMB 5H20A 2HTJA 2GXGA 3WGIA 4IRGA 2R3SA 1K79A 1YFHA 2P5LC 3HSFA 2FF4A 4LLGF 3RIRA 5H6QA 3NRVA 5DCMA 1SAXA 3RPQA 1JHHA 2P6SA 2M87A 3WTYC 1IRGA 3P9CA 2A69F 3FXRA 2OAZA 4L18B 2Z3YA 4O5VA 2IW5A 4A6DA 3VODA 3TGNA 1BC7C 1HKQA 1BJAA 1FSEA 5HDGA 5D6FA 2E7WA 3QOPA 5LGTA 2UWMA 3M1EA 4ZH4F 2V79A 2ZXJA 3P7NA 3L7WA 2KRFA 3F23A 1SD7A 5FFZA 2DPDA 3IRQA 4MHGA 2P7VB 4BHPA 1XSDA 2YU3A 4KN7X 4TV7A 2VONA 1G3WA 3LQRA 2M5WA 5LHHA 3KEQA 1ZLJA 2CGPA 3ZMZA 4QLCU 1HSJA 2EFQA 2CW0F 3QU6A 2VBZA 3ELKA 2BYVE 2COMA 4BH9A 1ZYRF 4Z2YA 1F4KA 2A07F 3HSEA 1FZPB 2PQ8A 3F8MA 4KFCA 4E70A 2EV0A 2LNBA 3E5XA 2VBWA 1YS7A 3WU1B 4IF4A 1ON2A 2FA5A 5LGUA 4U7BA 4KMFA 4AD9A 4ENKA 5D5WB 1BIBA 2MLKA 1OYWA 5FFXA 3EYIA 2KIUA 4U88A 1XDUA 1R1TA 2O0YA 5D5XB 4GCVA 2LSOA 1IW7F 3OOPA 3WG9A 4Q47A 3ISPA 2DPUA 2ESNA 1FBSA 1XGOA 1FYMA 4OIRF 2ZMEA 3M8EA 2IT0A 1ZARA 1W4MA 4NB5A 4GGGA 5F6FA 2JSCA 2FBHA 3EQLF 2JPCA 4LLNA 1FP1D 3TKYA 2W84A 2V1UA 1BI3A 2VE8A 3BDDA 3ZMUA 2QQ9A 1EV7A 3MEXA 1KYZA 1U3EM 5LGNA 3M9AA 2JRTA 4HA8A 2HS5A 2STTA 2GIVA 5ICCA 2DTRA 3I64A 4HAMA 3WTSC 3ZP5A 1X3UA 2A68F 3CUQC 3IKVA 1RUNA 3HRTA 5FO5A 5LHGA 1Z91A 3HIFA 3V8LA 5BS6A 1LB2A 5HVQC 1ZRCA 2H09A 4G7ZF 3WTVC 4UNOA 3KP2A 2EV5A 1XGSA 5J8FA 1LJ9A 3RJPA 3RKXA 2HQNA 2YX7A 2K4JA 3JSOA 1FSHA 1DUXC 4WX9A 2FU4A 3Q9SA 2ZKZA 5CVJA 1KQ8A 2JPBA 2XVCA 2XKPA 2FNPA 1GVJA 1QPMA 5IT9K 3N97A 2K86A 3I58A 4FT8A 4GYIA 1FBQA 5D8LB 4BAYA 1ONVA 2QUFA 2AS5F 3J81K 3LFKA 2HEOA 3RPUA 3W6KB 4YFKF 1LDDA 4ESFA 2HOEA 1KGSA 2Q2EA 4M73A 2DLLA 5L3CA 2RVCA 1H9GA 1KA8A 1FC3A 1VTNC 2LDUA 2CQKA 2QBYB 4KYWA 2YX4A 4K2EA 1U78A 1E17A 4OMZA 3FXQA 2CYYA 3I4PA 1BIAA 3HHHA 4CYDA 1HW1A 4A2UA 4EM2A 3QPHA 4AVPA 5LHIA 1QNTA 2HKOA 1JHFA 3EETA 1XGMA 4I02A 4EGYA 5E8IA 4Q48A 3CTAA 4JQFA 1IAWA 3K1PA 2XAHA 3I59B 4EJOA 5JFRA 5DCFA 5JR3A 1YLFA 6PAXA 2RDPA 2V9VA 1GXQA 1K78A 2RV8A 2DU9A 2F5FA 3G3ZA 3GX4X 2EFNA 1R1VA 1QBJA 4RB2C 1RIOH 4PGGA 1ULYA 1F5TA 4WF2A 5IT9Z 3CO6C 1MJ9A 1XGNA 1XD7A 3FZVA 4L5JA 4UVBA 3KP5A 3ECOA 4ASNA 5FLXK 1J5YA 1BI0A 4ZZLA 2XHKA 2CSOA 3FM3A 4LLLA 1CF7A 2K02A 4MQVA 1WKMA 1B1BA 3WTZA 2Z5UA 1Z1DA 1FYKA 3DFGA 4Q4ZF 4UUVA 3B73A 4HF2A 3P9IA 2X4HA 4DQ2A 4HF0A 3WTUC 1BOAA 1T2KA 3C1DA 1TBXA 5JHUA 2MA3A 4AIJA 3VFZA 2A6HF 1P6RA 4LK0F 5FGMA 4NHJA 3Q9VA 1B6AA 1H9TA 2O03A 4HOBA 1SMYF 1ZGJA 1K78B 1Z6TA 2TDXA 2MLGA 5K1YA 3T1BA 3E5QA 5L3BA 4KT5C 1H0MA 2UZKA 1BI1A 2FSWA 5DYMA 5FD5A 2IRFG 2L4MA 1BI2A 4M6XA 2ZFWA 3R61A 4KIFA 2L54A 3J80K 4G6DA 2PLYA 1RUOA 4NQWA 4WXDA 4G6QA 4B09A 3LA7A 3F3XA 1OKRA 2QWWA 4IRHA 4N9HA 3LQQA 2CFXA 4PZJA 3E5UA 1P4WA 1FT9A 2KKOA 3ZN0A 2D45A 4Y15A 1OYIA 3DPTA 2AXLA 2IA0A 5EEHA 1YW9A 4HW0A 1T6SA 1ZH5A 4OMYA 2PJPA 4WXCA 1IRFA 2ELHA 2D1VA 4RB3C 2M1BA 3HSRA 2HR3A 1O7LA 3GFLA 3K69A 4YFNF 5E20A 1LVAA 2DO7A 2P4WA 1LEBA 4MTDA 3GYHX 5BMZA 3KP7A 4ENNA 1YS6A 2HYGD 4ESJA 5E8GA 1T38A 4FX4A 1RZ4A 2HTSA 2XIGA 3MZHA 1J59A 4U0YA 1IN4A 3GZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3E A;  2ZNZ A;  1L3L A;  3V8J A;  2GAU A;  1U5T A;  4KUM A;  5TRD A;  5HS8 A;  2L02 A;  3ROU A;  2K7L A;  1R58 A;  2OA4 A;  3TO9 A;  2QBY A;  1W7P D;  2JT1 A;  5D4S A;  3E6D A;  3CLO A;  4FHT A;  5BPD A;  2XAF A;  4HV5 A;  3GWZ A;  3TDZ C;  1P4A A;  4RS8 A;  2VBY A;  2Y48 A;  3RYR A;  4CHU A;  1ZHF A;  1HKS A;  3E6C C;  5IT3 A;  1YIO A;  3U1D A;  3QAH A;  1WRJ A;  1KU3 A;  3TDU C;  3MZY A;  2GXB A;  3KP4 A;  4UVA A;  4L9V A;  1LDJ A;  2F5E A;  3F8B A;  1CGP A;  1FY7 A;  1O57 A;  2ZCW A;  5TJJ A;  4IJA A;  3GVA A;  2MC3 A;  3F8N A;  4BQA A;  5ED4 A;  5HLH A;  2VT3 A;  4M9S A;  1MJA A;  3QP5 A;  5K5R A;  4ZYD A;  1Z6R A;  1QO0 D;  5L3F A;  2IPQ X;  2F2E A;  1ODD A;  5HDN A;  4HX4 A;  2FMY A;  4A0Y A;  4BHC A;  3RDI A;  1XN7 A;  2DI3 A;  5LRS A;  4MGR A;  5HOO A;  4L9J A;  1S7A A;  4BNC A;  2KJC A;  2JZY A;  1DP7 P;  1QZZ A;  1EH8 A;  1QZY A;  5CJ9 A;  1S7O A;  3SHF A;  4HQE A;  1KYW A;  2HWV A;  4XSX F;  1R00 A;  4XLP F;  3I5U A;  4UXN A;  1FPQ A;  1O3Q A;  3E97 A;  2Q8K A;  1CF7 B;  4P9U A;  3WGG A;  5CVI A;  3JW4 A;  4S04 A;  1YW7 A;  4KNY A;  4XSZ F;  1BN5 A;  1XSV A;  2QQB A;  3L00 A;  3DPL C;  1J2X A;  3IHU A;  4G8X A;  2P7C B;  3H3U A;  2ZME B;  3WTW C;  5DD8 A;  1O3T A;  1ZLK A;  4QWQ A;  2HDC A;  1YQA A;  4CIC A;  2PG4 A;  1IN6 A;  3L9F A;  1SMT A;  5J6X A;  4BYY A;  2EA2 A;  5JI6 A;  4EMS A;  3J81 Z;  4N9I A;  4IHT A;  3WOD F;  4BHB A;  3F8C A;  1I1G A;  5CVV A;  2RGV A;  2H94 A;  1WI9 A;  3M7G A;  2PMU A;  4LD5 A;  4ZYG A;  3R60 A;  3C18 A;  2Q0O A;  3B02 A;  2OZ6 A;  1S6L A;  2FQ3 A;  2HQR A;  1FYL A;  1O7F A;  2LF7 A;  2XAS A;  1FX7 A;  1U6G A;  5HLI A;  5DUI A;  4ESB A;  2Z99 A;  4A0Z A;  1ZG3 A;  4N0B A;  1TLH B;  1Z05 A;  2A5Y B;  1DDN A;  2Y75 A;  1YTY A;  1J75 A;  4IVN A;  1KQ9 A;  2NS0 A;  2JTV A;  3RTR A;  1FWZ A;  4S05 A;  3I71 A;  2O61 A;  4RGU A;  4EJV A;  3JAM K;  3GFM A;  4EJT A;  4FX0 A;  4CO8 A;  2K27 A;  5LEJ A;  4RGR A;  2E1N A;  4G7O F;  4EV0 A;  3GO5 A;  2ACJ A;  2QLZ A;  3R0J A;  2BEO A;  2R7F A;  3C7J A;  2EFO A;  1G3S A;  3ML6 A;  1GXP A;  1HKT A;  3F6V A;  1BC8 C;  2HFH A;  5DDG A;  2YR2 A;  2QQA A;  5D4R A;  4P9F A;  4OIO F;  2V1X A;  2NRA C;  2PFB A;  2F5D A;  3WE2 A;  5D5V B;  1G3Y A;  1XSX A;  3BY6 A;  1LQ1 A;  1IN7 A;  3J7A O;  5ILS A;  3O3K A;  1TW3 A;  4G9Y A;  4KIC A;  5BPI A;  3BJO A;  3JSP A;  2GA1 A;  4LGW A;  4XRF A;  2A3S A;  3FXU A;  3E6B A;  3V7S A;  3IWF A;  4CGZ A;  1IXR C;  1XCB A;  2OQG A;  1QGP A;  3H3Z A;  3DEU A;  2UXN A;  3K1M A;  5HS9 A;  2R7D A;  3R6S A;  4A5N A;  2EA4 A;  3M8F A;  4RGS A;  4WCG A;  1ZG5 A;  2J5O A;  2DQR A;  3HTU A;  1D3Y A;  3ABU A;  5FD6 A;  1W5T A;  3ULQ B;  3VOE A;  3SXY A;  1HXD A;  4R79 A;  3CDH A;  4IXA A;  3IC7 A;  5JVT A;  1JGS A;  1MGT A;  5HDK A;  1U2W A;  2KJB A;  1JE8 A;  3ABT A;  3CUO A;  3ERE D;  4CXF A;  1IN5 A;  3TQN A;  2ZBK A;  1KU7 A;  4I0B A;  3I53 A;  2VOP A;  4IHS A;  5FB2 A;  2ZO4 A;  1R5G A;  1I27 A;  1P92 A;  4LB6 B;  5D5U B;  2XUB A;  1ZGA A;  1BM9 A;  1ZAO A;  4CDG A;  2XAQ A;  2M45 A;  5DD4 A;  3FMR A;  4IPA A;  3QRF F;  3T0Y A;  4OIN F;  2A6E F;  1LEA A;  3DKW A;  1LDK B;  1ZRD A;  4HX8 A;  3BWG A;  3GUD A;  4LJZ F;  3HOS A;  1UFM A;  4GYG A;  4HF1 A;  5LRR A;  3NEU A;  3MAJ A;  3SZT A;  2FRH A;  3E3V A;  5ICG A;  4A0X A;  2QVO A;  2DAO A;  2W57 A;  2OZU A;  1F1Z A;  2XAJ A;  4O3M A;  2J5P A;  2XV4 S;  2QEN A;  2F5C A;  3DV8 A;  2EV6 A;  2EK5 A;  3IWZ A;  5AON A;  1K6O A;  1DPU A;  3ZPL A;  4JK1 X;  1XB4 A;  3LA2 A;  4U0W A;  3RI4 A;  1IF1 A;  2H6B A;  3LAP A;  4ENJ A;  4LMY A;  5J8C A;  4EGZ A;  4EM0 B;  4Y13 A;  3G73 A;  2P5V A;  2QYO A;  1C0W A;  3F72 A;  4KIG A;  1AOY A;  5E17 F;  1OMI A;  3VEP A;  4U7D A;  1D8J A;  1B9M A;  4B8X A;  4OOI A;  4M72 A;  1J7K A;  1UHM A;  4HDV A;  2X0L A;  4YII A;  2B0L A;  1MD0 A;  1HST A;  4BXU A;  2G7H A;  2DK8 A;  4OIQ F;  2BE5 F;  1B9N A;  5BOX A;  1A04 A;  4YIF A;  1TQP A;  3ZN1 A;  3LST A;  5AIP A;  3PQK A;  3F6O A;  3BPX A;  2K4B A;  2RKH A;  3ZMV A;  4PGH A;  4I2O A;  1P2F A;  2QM3 A;  2A61 A;  3IKT A;  1OR7 A;  1R7J A;  2MH2 A;  1DPR A;  3V7C A;  2HYF A;  2M30 A;  1R22 A;  2PBI A;  1FBU A;  4LK1 F;  3BOQ A;  3KLO A;  5KVR A;  4WWC A;  1R23 A;  5F1R A;  3JAM Z;  3U2R A;  2O8X A;  2VOD A;  3FHZ A;  3ECH A;  1K7A A;  3K2Z A;  1G6N A;  1U8R A;  2GWR A;  3KP3 A;  1FP2 A;  3TOB A;  4EVI A;  1JXS A;  1MKM A;  3LWF A;  2CWE A;  1IZ1 A;  3K1N A;  2L4A A;  5E1W A;  2ISY A;  1R1U A;  5DCM B;  2GZW A;  1TNT A;  1SD5 A;  1O3S A;  2XRN A;  4MQ9 F;  1Z7U A;  2ADU A;  1RI7 A;  3GFI A;  1EH7 A;  2KIF A;  5F64 A;  3JTG A;  2QZ8 A;  3ZMT A;  3I59 A;  1ZRF A;  4KDP A;  3SZP A;  3MCZ A;  1IXC A;  3GF2 A;  2WTE A;  2FBI A;  3IL2 A;  2CG4 A;  3U9G A;  1G4D A;  2IVM A;  4M6Y A;  1ZRE A;  1GHC A;  1IUY A;  3HRS A;  3TO7 A;  1W7P A;  1V4R A;  1MZB A;  1I5Z A;  3CJN A;  5DUK A;  4LB5 A;  3DP7 A;  1OYY A;  2H6C A;  5CVU A;  2Z33 A;  3TOA A;  4I0A A;  3L2C A;  5CVR A;  3W6J B;  2W24 A;  3V7R A;  3P9K A;  5A2Q Z;  4G7H F;  4L0Z B;  3I54 A;  4RB0 A;  2HGC A;  5LLQ A;  1I1S A;  4HLY A;  2HZT A;  2ZNY A;  3KE2 A;  5DV5 A;  2MH9 A;  2EWN A;  3WU0 A;  2HKX A;  3BRO A;  1NHA A;  1UCR A;  2KIM A;  2XKO A;  5LBQ A;  2DT5 A;  5LEK A;  4HDU A;  1FLI A;  2FNA A;  2STW A;  4RB1 A;  2C6Y A;  2DQL A;  5FLX Z;  1UST A;  2D2W A;  1HQC A;  4M9X A;  4GXO A;  3E6M A;  2XRO A;  1Q1H A;  2ZJ2 A;  1IXS B;  2PN6 A;  1SFE A;  4OIP F;  3O2P E;  5ILU A;  3FF5 A;  2BGC A;  3EYY A;  4MNU A;  3V4G A;  4WK8 F;  3FWE A;  4ON0 A;  1V3F A;  1PUE E;  3SFZ A;  3AAF A;  3DF8 A;  1U5T B;  3J80 Z;  2WC2 A;  3KCC A;  2FE3 A;  2MBF A;  1R36 A;  1PDN C;  3GEZ A;  3HRU A;  4ETS A;  4OU0 A;  4XLN F;  5E1Z B;  3BPV A;  1QQI A;  4HBL A;  4M71 A;  2EJR A;  1T39 A;  2WV0 A;  4KN4 X;  3MWM A;  4IRI A;  2WWY A;  5E1X A;  3WE3 A;  3REO A;  2Y0M A;  3HTS B;  5ERI A;  1PP7 U;  1W7P B;  2V1D A;  2G7U A;  1UB9 A;  3MFK A;  1S8N A;  3L09 A;  4MEX F;  2G9W A;  2P6T A;  3MQ0 A;  3RKW A;  4A6E A;  5L3G A;  1U5T C;  4CZZ A;  1XMK A;  2VC0 A;  1TNS A;  3KEO A;  2DK5 A;  3HRM A;  2NNN A;  4RGX A;  2BV6 A;  3GZ5 A;  1SD6 A;  2RNJ A;  3QP6 A;  4PCQ A;  1YYV A;  4H0E A;  3BJA A;  1HW5 A;  1KU9 A;  3SQN A;  2EB7 A;  2ISZ A;  3KET A;  5HS7 A;  4LG0 B;  1WQ2 A;  3RKY A;  3C3W A;  1ON1 A;  4ZYH A;  1D5V A;  1R5H A;  1YW8 A;  4JBA A;  4MEY F;  1P4X A;  3RYP A;  1MDM A;  4RAY A;  2P8T A;  3D0S A;  4A12 A;  2NAZ A;  1B4A A;  1MJB A;  3DQV C;  3GLX A;  2FML A;  4EM1 A;  1LNW A;  5KK1 A;  4L5I A;  2D1H A;  3N4M A;  1W5S A;  4YFX F;  3DXJ F;  2H27 A;  2GA2 A;  4LFU A;  2L01 A;  4XBF A;  2BBY A;  4ZYE A;  5E18 F;  3EUH A;  1T0F A;  2RC4 A;  2MD5 A;  2VE9 A;  3CUQ A;  2W85 A;  1RNL A;  4Y17 A;  3R0A A;  3V8K A;  2VOO A;  3EDP A;  4AIH A;  1WWX A;  4I09 A;  4UV9 A;  1BBY A;  5AIQ A;  1YO5 C;  2IA1 A;  1S3J A;  3KP6 A;  2UXX A;  3F8F A;  1SFX A;  5D6E A;  5DEQ A;  4AIK A;  2L3D A;  1B59 A;  3KZZ A;  4L9N A;  3GW2 A;  2M8E A;  1T98 A;  4P55 A;  4UHT A;  2EFP A;  3F22 A;  4A5M A;  5K5O A;  4RAZ A;  4UVC A;  3Q5F A;  2DW4 A;  2YPR A;  4LG0 A;  2Z9O A;  2PI0 A;  3COA C;  1OPC A;  1EH6 A;  1UHW A;  3KFW X;  3LA3 A;  3WGH A;  1USS A;  1WSU A;  3KZY A;  1XDS A;  2FEZ A;  2E1C A;  5ICF A;  1E2X A;  4Q5S F;  2OBP A;  2XAG A;  4R1H A;  5ICE A;  2LF8 A;  1IN8 A;  2EFW A;  4KA4 A;  2P5K A;  3O6B B;  2FOK A;  1TW2 A;  4L9T A;  2OQR A;  3QU3 A;  3T5X A;  3TO6 A;  1J9I A;  1AWC A;  2CO5 A;  3IRR A;  2VC1 A;  2NYX A;  4YG2 F;  2DFI A;  3FX3 A;  3D5L A;  1ZN2 A;  5CLS A;  1Z9C A;  4EJU A;  3KLN A;  3HUG A;  4PDK A;  3ZQ7 A;  5ILV A;  2PEX A;  3WTX C;  1ZG1 A;  1D8K A;  1SFU A;  1Y0U A;  3BP8 A;  5BQT A;  2OU2 A;  5A2Q K;  3JTH A;  4M74 A;  3HHG A;  2IP2 A;  4F7Z A;  3LAJ A;  4AWX B;  3GXO A;  1S29 A;  3CO7 C;  4I98 B;  1KU2 A;  3K9T A;  3R4K A;  2VN2 A;  2FBK A;  3FMQ A;  3GFJ A;  2NNY A;  1REP C;  3OV8 A;  3T8T A;  4U0V A;  4KIB A;  1PP8 F;  1J0R A;  2VXZ A;  4GO1 A;  5CYV A;  2ETH A;  1XCV A;  3K0L A;  4P5O A;  4L0Y B;  2IJL A;  4HV6 A;  4UV8 A;  4HLX A;  3WTT C;  3PQJ A;  4D0P A;  4O6J A;  2ESH A;  3NQO A;  1FNN A;  4DNC A;  2RN7 A;  3VB2 A;  4I01 A;  4R8H A;  3FMS A;  4HX7 A;  3HOT A;  4KMU X;  2RQP A;  5K5Q A;  2OD5 A;  2E7X A;  4ENM A;  1TQI A;  1STZ A;  3FM5 A;  5D8K B;  3PFI A;  3BZ6 A;  5H6R A;  4WXH A;  1KQ0 A;  4HZF A;  2VBX A;  2W25 A;  2DBB A;  2IA2 A;  2LKP A;  3QPT A;  3ZMS A;  5L3D A;  4HYE A;  4EJW A;  1L0O C;  1SD4 A;  2YSR A;  4EQQ A;  3I0T A;  5HLG A;  1I6X A;  2V6C A;  4G94 A;  1O3R A;  1HW2 A;  1YG2 A;  4M9Z A;  3CUQ B;  1XMA A;  3BJ6 A;  3ZMD A;  3F21 A;  4HQM A;  1G3T A;  2FXA A;  2XGX A;  3H92 A;  2GQQ A;  3T8R A;  1TQM A;  1F9N A;  1TTY A;  4MTE A;  2PMH A;  1HBX G;  2VT2 A;  4P96 A;  2O3F A;  2O6G E;  3S2W A;  1FOK A;  4I7H A;  5EEG A;  4ZZD A;  3HYI A;  1MDM B;  5H20 A;  2HTJ A;  2GXG A;  3WGI A;  4IRG A;  2R3S A;  1K79 A;  1YFH A;  2P5L C;  3HSF A;  2FF4 A;  4LLG F;  3RIR A;  5H6Q A;  3NRV A;  5DCM A;  1SAX A;  3RPQ A;  1JHH A;  2P6S A;  2M87 A;  3WTY C;  1IRG A;  3P9C A;  2A69 F;  3FXR A;  2OAZ A;  4L18 B;  2Z3Y A;  4O5V A;  2IW5 A;  4A6D A;  3VOD A;  3TGN A;  1BC7 C;  1HKQ A;  1BJA A;  1FSE A;  5HDG A;  5D6F A;  2E7W A;  3QOP A;  5LGT A;  2UWM A;  3M1E A;  4ZH4 F;  2V79 A;  2ZXJ A;  3P7N A;  3L7W A;  2KRF A;  3F23 A;  1SD7 A;  5FFZ A;  2DPD A;  3IRQ A;  4MHG A;  2P7V B;  4BHP A;  1XSD A;  2YU3 A;  4KN7 X;  4TV7 A;  2VON A;  1G3W A;  3LQR A;  2M5W A;  5LHH A;  3KEQ A;  1ZLJ A;  2CGP A;  3ZMZ A;  4QLC U;  1HSJ A;  2EFQ A;  2CW0 F;  3QU6 A;  2VBZ A;  3ELK A;  2BYV E;  2COM A;  4BH9 A;  1ZYR F;  4Z2Y A;  1F4K A;  2A07 F;  3HSE A;  1FZP B;  2PQ8 A;  3F8M A;  4KFC A;  4E70 A;  2EV0 A;  2LNB A;  3E5X A;  2VBW A;  1YS7 A;  3WU1 B;  4IF4 A;  1ON2 A;  2FA5 A;  5LGU A;  4U7B A;  4KMF A;  4AD9 A;  4ENK A;  5D5W B;  1BIB A;  2MLK A;  1OYW A;  5FFX A;  3EYI A;  2KIU A;  4U88 A;  1XDU A;  1R1T A;  2O0Y A;  5D5X B;  4GCV A;  2LSO A;  1IW7 F;  3OOP A;  3WG9 A;  4Q47 A;  3ISP A;  2DPU A;  2ESN A;  1FBS A;  1XGO A;  1FYM A;  4OIR F;  2ZME A;  3M8E A;  2IT0 A;  1ZAR A;  1W4M A;  4NB5 A;  4GGG A;  5F6F A;  2JSC A;  2FBH A;  3EQL F;  2JPC A;  4LLN A;  1FP1 D;  3TKY A;  2W84 A;  2V1U A;  1BI3 A;  2VE8 A;  3BDD A;  3ZMU A;  2QQ9 A;  1EV7 A;  3MEX A;  1KYZ A;  1U3E M;  5LGN A;  3M9A A;  2JRT A;  4HA8 A;  2HS5 A;  2STT A;  2GIV A;  5ICC A;  2DTR A;  3I64 A;  4HAM A;  3WTS C;  3ZP5 A;  1X3U A;  2A68 F;  3CUQ C;  3IKV A;  1RUN A;  3HRT A;  5FO5 A;  5LHG A;  1Z91 A;  3HIF A;  3V8L A;  5BS6 A;  1LB2 A;  5HVQ C;  1ZRC A;  2H09 A;  4G7Z F;  3WTV C;  4UNO A;  3KP2 A;  2EV5 A;  1XGS A;  5J8F A;  1LJ9 A;  3RJP A;  3RKX A;  2HQN A;  2YX7 A;  2K4J A;  3JSO A;  1FSH A;  1DUX C;  4WX9 A;  2FU4 A;  3Q9S A;  2ZKZ A;  5CVJ A;  1KQ8 A;  2JPB A;  2XVC A;  2XKP A;  2FNP A;  1GVJ A;  1QPM A;  5IT9 K;  3N97 A;  2K86 A;  3I58 A;  4FT8 A;  4GYI A;  1FBQ A;  5D8L B;  4BAY A;  1ONV A;  2QUF A;  2AS5 F;  3J81 K;  3LFK A;  2HEO A;  3RPU A;  3W6K B;  4YFK F;  1LDD A;  4ESF A;  2HOE A;  1KGS A;  2Q2E A;  4M73 A;  2DLL A;  5L3C A;  2RVC A;  1H9G A;  1KA8 A;  1FC3 A;  1VTN C;  2LDU A;  2CQK A;  2QBY B;  4KYW A;  2YX4 A;  4K2E A;  1U78 A;  1E17 A;  4OMZ A;  3FXQ A;  2CYY A;  3I4P A;  1BIA A;  3HHH A;  4CYD A;  1HW1 A;  4A2U A;  4EM2 A;  3QPH A;  4AVP A;  5LHI A;  1QNT A;  2HKO A;  1JHF A;  3EET A;  1XGM A;  4I02 A;  4EGY A;  5E8I A;  4Q48 A;  3CTA A;  4JQF A;  1IAW A;  3K1P A;  2XAH A;  3I59 B;  4EJO A;  5JFR A;  5DCF A;  5JR3 A;  1YLF A;  6PAX A;  2RDP A;  2V9V A;  1GXQ A;  1K78 A;  2RV8 A;  2DU9 A;  2F5F A;  3G3Z A;  3GX4 X;  2EFN A;  1R1V A;  1QBJ A;  4RB2 C;  1RIO H;  4PGG A;  1ULY A;  1F5T A;  4WF2 A;  5IT9 Z;  3CO6 C;  1MJ9 A;  1XGN A;  1XD7 A;  3FZV A;  4L5J A;  4UVB A;  3KP5 A;  3ECO A;  4ASN A;  5FLX K;  1J5Y A;  1BI0 A;  4ZZL A;  2XHK A;  2CSO A;  3FM3 A;  4LLL A;  1CF7 A;  2K02 A;  4MQV A;  1WKM A;  1B1B A;  3WTZ A;  2Z5U A;  1Z1D A;  1FYK A;  3DFG A;  4Q4Z F;  4UUV A;  3B73 A;  4HF2 A;  3P9I A;  2X4H A;  4DQ2 A;  4HF0 A;  3WTU C;  1BOA A;  1T2K A;  3C1D A;  1TBX A;  5JHU A;  2MA3 A;  4AIJ A;  3VFZ A;  2A6H F;  1P6R A;  4LK0 F;  5FGM A;  4NHJ A;  3Q9V A;  1B6A A;  1H9T A;  2O03 A;  4HOB A;  1SMY F;  1ZGJ A;  1K78 B;  1Z6T A;  2TDX A;  2MLG A;  5K1Y A;  3T1B A;  3E5Q A;  5L3B A;  4KT5 C;  1H0M A;  2UZK A;  1BI1 A;  2FSW A;  5DYM A;  5FD5 A;  2IRF G;  2L4M A;  1BI2 A;  4M6X A;  2ZFW A;  3R61 A;  4KIF A;  2L54 A;  3J80 K;  4G6D A;  2PLY A;  1RUO A;  4NQW A;  4WXD A;  4G6Q A;  4B09 A;  3LA7 A;  3F3X A;  1OKR A;  2QWW A;  4IRH A;  4N9H A;  3LQQ A;  2CFX A;  4PZJ A;  3E5U A;  1P4W A;  1FT9 A;  2KKO A;  3ZN0 A;  2D45 A;  4Y15 A;  1OYI A;  3DPT A;  2AXL A;  2IA0 A;  5EEH A;  1YW9 A;  4HW0 A;  1T6S A;  1ZH5 A;  4OMY A;  2PJP A;  4WXC A;  1IRF A;  2ELH A;  2D1V A;  4RB3 C;  2M1B A;  3HSR A;  2HR3 A;  1O7L A;  3GFL A;  3K69 A;  4YFN F;  5E20 A;  1LVA A;  2DO7 A;  2P4W A;  1LEB A;  4MTD A;  3GYH X;  5BMZ A;  3KP7 A;  4ENN A;  1YS6 A;  2HYG D;  4ESJ A;  5E8G A;  1T38 A;  4FX4 A;  1RZ4 A;  2HTS A;  2XIG A;  3MZH A;  1J59 A;  4U0Y A;  1IN4 A;  3GZ6 A; 
#chains in the Genus database with same CATH topology
 5L3E A;  5E3M A;  4M3F A;  3NAU A;  3JRI A;  2ZNZ A;  1L3L A;  3V8J A;  2GAU A;  3OYI A;  1U5T A;  3W2V A;  4KUM A;  5TRD A;  5HS8 A;  2V6E A;  2L02 A;  3ROU A;  2K7L A;  2KDO A;  1R58 A;  2L5Q A;  2PMZ A;  2OA4 A;  1M1E B;  3TO9 A;  3D1N I;  1W7P D;  2JT1 A;  2M7B A;  2QBY A;  1RET A;  2WB1 N;  5D4S A;  2XF5 A;  2HVR A;  1ETV A;  4AID A;  3HDD A;  3E6D A;  1OR7 C;  3CLO A;  5HNF A;  1RR8 C;  4JX5 A;  4IQ4 A;  3S14 J;  4FHT A;  5BPD A;  3GTG J;  3S93 A;  5M3F J;  2CV0 A;  1QHH D;  2XAF A;  4HV5 A;  3GWZ A;  3BLY A;  3TDZ C;  1Z3Y A;  1P4A A;  4RS8 A;  3A01 B;  2VBY A;  2Y48 A;  3RYR A;  2LC2 A;  4CHU A;  1ZHF A;  1AU7 A;  1HKS A;  5E3L A;  2XSD C;  3E6C C;  5IT3 A;  2CJJ A;  1YIO A;  3U1D A;  3QAH A;  1TWG J;  4A3G J;  1WRJ A;  1KU3 A;  3QOD A;  3MZY A;  3TDU C;  3KP4 A;  2R4G A;  4UVA A;  4L9V A;  1SC7 A;  2GXB A;  3K70 C;  1LDJ A;  4J00 A;  2F5E A;  3F8B A;  2R93 J;  4XKB A;  4E7J A;  1R71 A;  1CGP A;  3BG5 A;  1CQT A;  1FY7 A;  1O57 A;  2ZCW A;  4RLQ A;  2QSF X;  3UKG A;  2JVG A;  5TJJ A;  4IJA A;  3MMY B;  2IGK A;  4E6K G;  3GVA A;  2MC3 A;  3F8N A;  4BQA A;  5ED4 A;  4D9J A;  4RM3 A;  5HLH A;  2VT3 A;  4M9S A;  1MJA A;  2BZT A;  4BDZ A;  3QP5 A;  5K5R A;  1U0J A;  4RBO A;  4ZYD A;  3MKL A;  1Z6R A;  1QO0 D;  5L3F A;  2IPQ X;  5KCM A;  4AU7 A;  1XC5 A;  1OCC H;  1IC8 A;  3AG1 H;  2DA5 A;  2F2E A;  1ODD A;  1MSE C;  4HPQ A;  1K61 A;  5HDN A;  4HX4 A;  2FMY A;  4DZP A;  4A0Y A;  4BHC A;  1MNE A;  2EIK H;  3RDI A;  1JGG A;  4X6A J;  1X3W B;  3CCV I;  2DI3 A;  1T33 A;  5LRS A;  4MGR A;  1OCZ H;  4A3D J;  2COB A;  5HOO A;  3FKI J;  1WJF A;  2WAQ A;  1NTC A;  3OYH A;  4L9J A;  3LSK A;  1S7A A;  1MBE A;  4BNC A;  2KJC A;  3ZQQ A;  2JZY A;  1N25 A;  1DP7 P;  1QZZ A;  1EH8 A;  3L2Q A;  2JUG A;  2VQG A;  3F9K A;  5F1J A;  1QZY A;  5CJ9 A;  1KZH A;  4M3G A;  1S7O A;  3SHF A;  2CRG A;  1JKQ C;  1A35 A;  4RM2 A;  4FET A;  2O5R A;  3QYE A;  4HQE A;  2W1O A;  5CQE A;  4CSW A;  1WJB A;  2DMP A;  2CV2 A;  2B7E A;  4PSW A;  1QVT A;  2EZL A;  1KYW A;  3I4N J;  3KIO A;  2HWV A;  4XSX F;  2JA7 J;  1R00 A;  1VI0 A;  2WBM A;  2LG4 A;  4XLP F;  3I5U A;  4XLC A;  2R7W A;  2KLO A;  3FXJ A;  3FBI B;  4UXN A;  5HLT A;  1FPQ A;  1SVM A;  3CF2 A;  1O3Q A;  2KHM A;  2R92 J;  3E97 A;  2Q8K A;  3CCU I;  4B3X A;  1CF7 B;  4P9U A;  3H35 A;  1XG1 A;  3WGG A;  5CVI A;  3JW4 A;  1UAA A;  4S04 A;  1YW7 A;  4KNY A;  2A05 A;  4IO9 F;  4XSZ F;  1BN5 A;  5B5E C;  1YX3 A;  1XSV A;  2DA3 A;  2QQB A;  3L00 A;  3DPL C;  4IHY A;  3DBH B;  1J2X A;  5DM6 F;  3IHU A;  4G8X A;  4RAG A;  2P7C B;  2ECC A;  3S1R J;  3H3U A;  1YHQ I;  1ITY A;  2ZME B;  3WTW C;  5DD8 A;  1O3T A;  2HOA A;  3DEE A;  3K4B A;  1ZLK A;  2HOT A;  3PM1 A;  4QWQ A;  1LFU P;  2HDC A;  4KIT B;  1YQA A;  2CFO A;  1XS9 A;  4NUB A;  3FDY A;  1W0U A;  4NQW B;  3JRD A;  4CIC A;  2KZG A;  2PG4 A;  1IN6 A;  1K4T A;  4BKX A;  1AKH B;  4A3I J;  1T56 A;  3L9F A;  1SMT A;  5J6X A;  4BYY A;  4C2M J;  2EA2 A;  3OL4 A;  4AC0 A;  4EMS A;  5JI6 A;  4N9I A;  3J81 Z;  4IHT A;  4KJZ A;  3WOD F;  4BHB A;  3F8C A;  4OAZ A;  1I1G A;  4XN3 A;  3FIW A;  5CVV A;  2RGV A;  2H94 A;  2Y31 A;  1WI9 A;  3M7G A;  4PJN A;  1GVD A;  2XGD A;  3CMY A;  2PMU A;  4LD5 A;  4ZYG A;  2LY1 A;  3R60 A;  3K4M A;  4BDY A;  3C18 A;  1LE8 B;  2X51 A;  2Q0O A;  3PUB A;  4XLE A;  3W6V A;  3B02 A;  4F92 B;  2HDW A;  2OZ6 A;  1S6L A;  2ZJR F;  2FUG 2;  3CCM I;  2F4I A;  2FQ3 A;  2HQR A;  1FYL A;  1O7F A;  2LF7 A;  2XAS A;  2ZXW H;  3LSR A;  1YIT I;  4BJ5 C;  1X1P A;  1WJ5 A;  4EAT A;  1FX7 A;  1U6G A;  5HLI A;  5DUI A;  4ESB A;  3ZGK A;  2GIZ A;  2HVS A;  2Z99 A;  4A0Z A;  3RSN A;  3H5A A;  1ZG3 A;  4RMN A;  3CDI A;  2IGO A;  3OYE A;  4N0B A;  1TLH B;  2NVQ J;  1Z05 A;  2IS1 A;  2A5Y B;  2K40 A;  1DDN A;  2Y75 A;  2EQR A;  1YTY A;  2DDB A;  1J75 A;  2I5U A;  2VJ5 A;  4IVN A;  1MMS A;  1KQ9 A;  5EG0 B;  2X85 A;  2NS0 A;  3NWT A;  1BOB A;  2F6C A;  2M34 A;  2JTV A;  3RTR A;  1FWZ A;  4DYQ A;  2ZJP F;  4S05 A;  3I71 A;  3OR2 C;  2M8G X;  4MFE A;  2O61 A;  4RGU A;  3CMA I;  1VFC A;  3OIO A;  4EJV A;  3JAM K;  1ZTR A;  3GFM A;  1VQL I;  3GTJ J;  4E4H A;  4EJT A;  4DGW B;  4FX0 A;  4A3F J;  4CO8 A;  2E2H J;  5CPR B;  2DT7 B;  2K27 A;  3HM5 A;  5LEJ A;  1HOM A;  2X6Y A;  3PNT A;  4RGR A;  1YRN A;  2E1N A;  2OTJ I;  4G7O F;  3HGG A;  1W5C C;  1MBJ A;  3GO5 A;  4EV0 A;  4NDL A;  2ACJ A;  5IP7 J;  2GXA A;  2QLZ A;  4NC7 A;  3R0J A;  1FIA A;  2BEO A;  2R7F A;  3C7J A;  2EFO A;  1G3S A;  4L5E A;  3ML6 A;  3SZG A;  1GXP A;  1K83 J;  3BQZ A;  1VQ6 I;  1HKT A;  5J47 A;  2KIS A;  4F55 A;  3JRB A;  3F6V A;  1BC8 C;  2HFH A;  5DDG A;  3HOU J;  2YR2 A;  2QQA A;  2FQ4 A;  1RKT A;  1E0E A;  5D4R A;  4P9F A;  4OIO F;  2V1X A;  5F04 A;  2NRA C;  2DTZ A;  2PFB A;  1I6H J;  3ZQL A;  2F5D A;  3WE2 A;  1Z77 A;  5D5V B;  3A0H C;  1G3Y A;  1XSX A;  3BY6 A;  2P81 A;  1LQ1 A;  3G1L A;  2QEX I;  3A2K A;  1IN7 A;  3J7A O;  2E1O A;  5ILS A;  3O3K A;  1VZ0 A;  1ZK8 A;  2EBI A;  1TW3 A;  2MW8 A;  1H88 C;  2IBD A;  3OIP A;  4OAY A;  4G9Y A;  4CA0 A;  4KIC A;  3PNY A;  5BPI A;  3BJO A;  3JSP A;  3QQA A;  1MH4 A;  1LFB A;  4BQQ A;  1K4S A;  2GA1 A;  2AHQ A;  2LD5 A;  4LGW A;  4XRF A;  3BC8 A;  4NC8 A;  5DTD A;  2A3S A;  3FXU A;  3E6B A;  1BR4 A;  3V7S A;  2LVS A;  3H1C A;  1NG7 A;  3IWF A;  4XM3 A;  4CGZ A;  4BE1 A;  1IXR C;  2M2E A;  1D0X A;  2Z2S B;  2OV7 A;  1Y6I A;  1XCB A;  2OQG A;  1QGP A;  3ZQC A;  3H3Z A;  3DEU A;  2UXN A;  3K1M A;  1LUJ B;  1WHU A;  5HS9 A;  1WJE A;  3OL3 A;  5E3N A;  4XRS G;  3JRG A;  3H0D A;  3DLA A;  2R7D A;  3R6S A;  4A5N A;  1V5E A;  2EA4 A;  2XF6 A;  3M8F A;  4RGS A;  1FMV A;  3I9V 2;  4WCG A;  2IS2 A;  1ZG5 A;  1V5F A;  4FE4 A;  2J5O A;  1MSF C;  4E7H A;  4C2T A;  2DQR A;  3HTU A;  2IS6 A;  1D3Y A;  2K9S A;  3ABU A;  5FD6 A;  4PUS A;  1W5T A;  3ULQ B;  3VOE A;  3OYL A;  4PJL A;  3SXY A;  1HXD A;  2NOG A;  4R79 A;  1S9H A;  3QWL A;  1IV8 A;  3CDH A;  2R7S A;  1EKE A;  2GM4 A;  2E5N A;  4IXA A;  1O4X A;  2ZC2 A;  3IC7 A;  3A4C A;  5JVT A;  5M5Y J;  5J1U A;  3AL0 B;  1JGS A;  1MGT A;  2UV1 A;  5HDK A;  1U2W A;  2KJB A;  3GZN B;  4HEA 2;  1JE8 A;  1A6I A;  3ABT A;  2DOD A;  2ZFU A;  3WHC A;  2KFD A;  3CUO A;  3CDL A;  3ERE D;  1D5Y A;  3BTI A;  1IN5 A;  1MW7 A;  4M3D A;  3TQN A;  4CXF A;  2ZBK A;  3A01 A;  1OCO H;  2X1D A;  4M3B A;  4QSH A;  2PX9 A;  1KU7 A;  2FJ1 A;  2R7X A;  4S0H B;  3IP4 B;  4I0B A;  3VPR A;  3I53 A;  2VOP A;  4IHS A;  1YX5 A;  5FB2 A;  2ZO4 A;  1WZ2 A;  1R5G A;  1X2N A;  1R9T J;  5IPA A;  1S5L C;  4ITV A;  1YI2 I;  2A6T A;  1I27 A;  1P92 A;  4LB6 B;  3KEY A;  1F43 A;  5D5U B;  2VJI A;  2XUB A;  1ZGA A;  2MFZ A;  1BM9 A;  1T95 A;  2OC6 A;  1ZAO A;  5C4J J;  4CDG A;  2XAQ A;  2M45 A;  3TMO A;  5DD4 A;  3L2W A;  3FMR A;  1TWC J;  1VQO I;  4IPA A;  3QRF F;  3T0Y A;  4OIN F;  3U21 A;  2A6E F;  2EPF A;  5IYB J;  2KQR A;  3Q0U A;  3WG7 H;  2I8D A;  1LEA A;  3DKW A;  2MC4 A;  3OOU A;  1LDK B;  1ZRD A;  4HX8 A;  4LOC A;  3BWG A;  1U8B A;  3GUD A;  2DA2 A;  4LJZ F;  4XL9 A;  3HOS A;  3KX2 A;  1UFM A;  3CMM A;  1ZR4 A;  4GYG A;  1HA8 A;  2LY2 A;  2PMZ N;  3E7L A;  4BGD A;  4HF1 A;  3K4C A;  5LRR A;  3NEU A;  1T8I A;  3MAJ A;  3SZT A;  3TW6 A;  2DYR H;  2FRH A;  3E3V A;  5ICG A;  4A0X A;  2QVO A;  1JTY A;  2DAO A;  4RA2 A;  2W57 A;  2CUE A;  2LKX A;  4MO7 A;  2OZU A;  1F1Z A;  4BE2 A;  2XAJ A;  3DTE A;  4O3M A;  2J5P A;  2XV4 S;  4J19 A;  2LFB A;  3K4L A;  3L2V A;  3C2H A;  4PFO A;  2QEN A;  2F5C A;  2DCE A;  3DV8 A;  1G8X A;  2OCE A;  1YJ9 I;  2P0W A;  3OS2 A;  3OYN A;  2VXD A;  2DFF A;  1EA3 A;  2EV6 A;  1Z7L A;  2EK5 A;  4GDF A;  3IWZ A;  5AON A;  3LFU A;  1J09 A;  1K6O A;  1DPU A;  2XB0 X;  5FJ8 J;  3ZPL A;  2VAS A;  4HRI A;  1K6Y A;  3CCY A;  3RCO A;  4JK1 X;  3X2Q H;  3OYA A;  4C2U A;  3QPS A;  1XB4 A;  1UMQ A;  1MMN A;  3LA2 A;  4U0W A;  3RI4 A;  1IF1 A;  2H6B A;  3LAP A;  3KYL A;  2HYJ A;  4ENJ A;  4LMY A;  4FIS A;  5J8C A;  1NK3 P;  4EGZ A;  2VQL A;  4EM0 B;  4HST A;  2HNH A;  4Y13 A;  2MYS A;  3HL2 A;  3PSF A;  3G73 A;  2P5V A;  2QYO A;  4QIW N;  4JOM A;  1C0W A;  3SDG A;  3RZD J;  3F72 A;  3K4J A;  5IYC J;  2DA4 A;  3D5R C;  4KIG A;  5KHD A;  2WB1 A;  3SEZ A;  1AOY A;  3MKZ A;  5E17 F;  1B8I B;  1N77 A;  1OMI A;  3VEP A;  4PJM A;  4U7D A;  1E3O C;  1B9M A;  1D8J A;  2OCC H;  4B8X A;  2ELJ A;  1AHD P;  4OOI A;  5B66 C;  3LSM A;  4C3H J;  4BUP A;  3O8G A;  2WA0 A;  4M72 A;  3GBG A;  1J7K A;  3J7Z I;  2VPL A;  2ID6 A;  1X4P A;  1UHM A;  4HDV A;  2HPM A;  2X0L A;  3FXL A;  3LOC A;  4YII A;  2B0L A;  3ABL H;  1MD0 A;  1HST A;  1WH7 A;  4BXU A;  4ZYA A;  1ETX A;  2G7H A;  2DK8 A;  4OIQ F;  2BE5 F;  2IGM A;  1B9N A;  1QHG A;  1NG6 A;  3GME A;  5BOX A;  1A04 A;  4YIF A;  1TQP A;  3ZN1 A;  3LST A;  5AIP A;  2M0M A;  3Q3S A;  3PQK A;  1QVU A;  4II2 A;  3F6O A;  1D0Y A;  2E71 A;  3BPX A;  1TZL A;  2K4B A;  2RKH A;  2QF7 A;  2V9P A;  3ZMV A;  4D7M A;  2BOL A;  4FAS D;  4PGH A;  3I3L A;  1JI8 A;  2LY9 A;  4I2O A;  1P2F A;  5B1B H;  5DS9 A;  2QM3 A;  5GPC A;  2A61 A;  4XKV A;  3BR0 A;  3IKT A;  2W48 A;  1DGW Y;  4IHX A;  1E3P A;  1QRY A;  1OR7 A;  1R7J A;  2MH2 A;  1DPR A;  3V7C A;  3H36 A;  1ERD A;  2HYF A;  3CCR I;  2M30 A;  1H8A C;  1R22 A;  2AO9 A;  2PBI A;  1FBU A;  2KL4 A;  2QQ8 A;  2B63 J;  4LK1 F;  3BOQ A;  3JRF A;  3KLO A;  3MVP A;  2K5C A;  5KVR A;  4WWC A;  1R23 A;  5F1R A;  3JAM Z;  3DTK A;  3U2R A;  2NVU B;  2O8X A;  2VOD A;  3FHZ A;  3ECH A;  2WAE A;  4U87 A;  4CCK A;  1K7A A;  3K2Z A;  2JVH A;  1I3A A;  2IS4 A;  1G6N A;  1Q1V A;  3M8J A;  4HSR A;  2KIQ A;  1U8R A;  3ZQG A;  2GWR A;  2X6O A;  3KP3 A;  1OQY A;  1VQ9 I;  2MGQ A;  4UB6 C;  4X1E A;  1X19 A;  3G1O A;  1FP2 A;  3TOB A;  2H1K A;  4EVI A;  1RPW A;  4CYC A;  4XKW A;  1JXS A;  1MKM A;  2M7A A;  3LWF A;  4Y3O A;  2CWE A;  2LH9 A;  1IZ1 A;  3K1N A;  2LOO A;  2L4A A;  3CCS I;  2QKM B;  5E1W A;  3ERM A;  2ISY A;  3OSG A;  1R1U A;  5DCM B;  2L7M P;  4V2G A;  3VYS B;  4B43 A;  1TNT A;  2GZW A;  4ZDL A;  1DP3 A;  1SD5 A;  1A31 A;  1O3S A;  2XRN A;  4MQ9 F;  1Z7U A;  2ADU A;  1ORK A;  1RI7 A;  3GFI A;  4BXF A;  3BZC A;  1EH7 A;  3DTI A;  2XC7 A;  2O8K A;  2KIF A;  1SVO A;  1TT0 A;  1X3Z B;  5F64 A;  3JTG A;  3K70 D;  1U9N A;  1OIS A;  2QZ8 A;  3ZMT A;  5M3M J;  3I59 A;  1ZRF A;  4KDP A;  3BR3 A;  3SZP A;  2K9Q A;  1IRX A;  3MCZ A;  1IXC A;  3GF2 A;  2WTE A;  2GOM A;  2FBI A;  3IL2 A;  2CG4 A;  3U9G A;  1G4D A;  2IVM A;  3FK6 A;  4M6Y A;  3BTC A;  1JT0 A;  3AG2 H;  3EUH C;  1ZRE A;  1GHC A;  1IUY A;  3HRS A;  2XPW A;  2QSH X;  3TO7 A;  1W7P A;  1V4R A;  3DPU A;  1MZB A;  4JP0 A;  1I5Z A;  2ME0 A;  2V9K A;  3CJN A;  3G4S I;  2W00 A;  3W3C A;  1UHS A;  5DUK A;  4LB5 A;  3DP7 A;  2ZSI B;  2L7K A;  1OYY A;  2H6C A;  5CVU A;  1SVL A;  2Z33 A;  2L9N A;  3TOA A;  4I0A A;  3L2C A;  5CVR A;  5LD2 C;  5EF6 A;  3W6J B;  4DJA A;  5IY5 H;  4DBR A;  2W24 A;  2VIX A;  2XDV A;  3V7R A;  2CS3 A;  2RAE A;  3P9K A;  4ZDO A;  4AYB A;  2O7O A;  5A2Q Z;  4G7H F;  4L0Z B;  3I54 A;  3A02 A;  3JR9 A;  1U9O A;  3BT9 A;  4RB0 A;  2CQN A;  3E0J B;  1ZQ3 P;  1IGN A;  2VI6 A;  1UZC A;  3GTM J;  4DIQ A;  2HGC A;  2R7T A;  3OYK A;  1V54 H;  3MZ8 A;  2X6X A;  3ZOB A;  5LLQ A;  4HLY A;  1I1S A;  3OYC A;  2HZT A;  2ZNY A;  3KE2 A;  1ETO A;  5DV5 A;  2MH9 A;  3CES A;  2EWN A;  3WU0 A;  1VQ8 I;  2HKX A;  3BRO A;  1MNM C;  4XR6 A;  1NHA A;  2HI3 A;  5F0C A;  3CD6 I;  1UCR A;  2KIM A;  2XKO A;  5LBQ A;  3TP3 A;  2DT5 A;  4BEH A;  3HPG A;  2JWT A;  5LEK A;  4HDU A;  1FLI A;  2FNA A;  2STW A;  1GUU A;  4RB1 A;  3GTP J;  1PVE A;  3PSI A;  5B3S H;  2C6Y A;  2DQL A;  5FLX Z;  1UST A;  3OSF A;  2D2W A;  1HQC A;  2Y9Y A;  2XRL A;  1NH3 A;  4XRM A;  5GTI C;  2BY0 A;  1A5J A;  4M9X A;  4A3J J;  2BXY A;  4GXO A;  2ZXI A;  3E6M A;  2XRO A;  1Q1H A;  2ZJ2 A;  5JVG F;  5H2F C;  1IXS B;  2PN6 A;  1POG A;  1SFE A;  4OIP F;  3HZJ A;  3O2P E;  3CC7 I;  5ILU A;  3FF5 A;  1IRZ A;  1GV5 A;  2BGC A;  3DLL F;  3EYY A;  1YIJ I;  1HLV A;  3ABK H;  1H89 C;  2NS8 A;  4MNU A;  3GTO J;  2KT0 A;  3V4G A;  4WK8 F;  3FWE A;  2DMU A;  4ON0 A;  1RR7 A;  1V3F A;  3CP2 A;  3DCF A;  1PUE E;  2LP0 A;  2R5Y B;  2HQA A;  1YJN I;  4IL6 C;  3SFZ A;  3AAF A;  3DF8 A;  1U5T B;  3J80 Z;  1BR1 A;  2WC2 A;  2XSJ C;  3DKY A;  2L9V A;  3KCC A;  3LSG A;  2FE3 A;  3V42 A;  2MBF A;  2EIJ H;  3LMM A;  3Q0W A;  4I99 C;  1R36 A;  1BJZ A;  3HGY A;  3GEZ A;  3UR3 C;  1WH5 A;  1PDN C;  5FRN A;  3HRU A;  4ETS A;  4OU0 A;  4XLN F;  3W2A A;  3PIP F;  5E1Z B;  3BPV A;  2FD5 A;  3B6A A;  1QQI A;  4HBL A;  1RC9 A;  3DWL E;  4M71 A;  2ZJQ F;  5JLX A;  2EJR A;  3VSL A;  2OTL I;  2LMD A;  1T39 A;  2WV0 A;  4KN4 X;  1QA6 A;  1VQ7 I;  3MWM A;  4IRI A;  2KRH A;  2WWY A;  5E1X A;  3HXL A;  3WE3 A;  3REO A;  4BJT A;  3VYT B;  2Y0M A;  1A36 A;  4GFB A;  1PJR A;  5FKL A;  3HTS B;  1E3H A;  3S15 J;  5ERI A;  2K3P A;  2NXN B;  4FCY A;  1PP7 U;  2E34 A;  1W7P B;  3VYU B;  2V1D A;  3PO2 J;  2G7U A;  1UB9 A;  2AQF A;  3MFK A;  1S8N A;  3IAM 2;  4JX4 A;  3VWB A;  3L09 A;  4MEX F;  2G9W A;  2P6T A;  3MQ0 A;  1SFK A;  4PJ0 C;  3CLQ A;  3RKW A;  2DFH A;  2ELK A;  3ASN H;  4M6V A;  1JKP C;  4A6E A;  2CU7 A;  3O8H A;  4B3A A;  4HNU A;  3K6G A;  2XGC A;  5L3G A;  4W1U A;  1U5T C;  4UUS A;  3OIQ A;  1P7J A;  2HXO A;  3OYJ A;  3CC2 I;  4E7K A;  4CCL A;  2W7N A;  4CZZ A;  1XMK A;  2VC0 A;  3S1Q J;  3BZK A;  1P7I A;  1TNS A;  3KEO A;  1S72 I;  2DK5 A;  1PUF B;  2X9D A;  5BNG A;  4DYR A;  3HRM A;  2NNN A;  1I3Q J;  2OF7 A;  4RGX A;  2R5Z B;  2BV6 A;  1R4M B;  3GZ5 A;  1TC3 C;  1SD6 A;  2RNJ A;  2WV1 A;  3S1N J;  3QP6 A;  1SAU A;  4PCQ A;  2X1E A;  1YYV A;  4H0E A;  2CV1 A;  3BJA A;  1HW5 A;  3LL7 A;  1KU9 A;  3SQN A;  2DN0 A;  2K3F A;  3ZQI A;  2EB7 A;  2ZSH B;  2ISZ A;  3KET A;  5HS7 A;  4KIS A;  2EZK A;  2Z1D A;  4LG0 B;  2DMQ A;  3MN2 A;  1PUF A;  3RQ4 A;  2XF7 A;  2F5V A;  1WQ2 A;  3RKY A;  2KMU A;  3BTJ A;  3BR5 A;  3C3W A;  1ON1 A;  4ZYH A;  1D5V A;  2Y0S N;  3H9J A;  1R5H A;  1YW8 A;  4JBA A;  4MEY F;  1P4X A;  4A69 C;  1VQN I;  3BG6 A;  3DBL B;  3KPH A;  3RYP A;  2L9R A;  3H5R A;  1MDM A;  4RAY A;  1YE9 A;  1R4N B;  1T08 B;  1DU6 A;  3ESW B;  2P8T A;  4BBS J;  2QCO A;  3D0S A;  3BTL A;  2CH0 A;  4A12 A;  2K85 A;  4F91 B;  4Y7N J;  2NAZ A;  2A5W A;  3HPH A;  2XPU A;  3NWS A;  1B4A A;  1MJB A;  1I50 J;  3DQV C;  3GLX A;  3HJE A;  2FML A;  4EM1 A;  1QPI A;  1LNW A;  4RB3 C;  5KK1 A;  5GAE J;  4L5I A;  2D1H A;  3N4M A;  2IAI A;  3TL4 X;  1LKX A;  1W5S A;  4YFX F;  4LG3 A;  4E7L A;  3DXJ F;  2H27 A;  2GA2 A;  4MLO A;  3EUA A;  1D1B A;  4LFU A;  3OMY A;  4C3J J;  2L01 A;  1FIP A;  3BG9 A;  4XBF A;  2BBY A;  4ZYE A;  3U1K A;  2JQ7 A;  5E18 F;  3A03 A;  3EUH A;  3IH3 A;  1T0F A;  2RC4 A;  5TGT A;  2MD5 A;  4B47 A;  4HNT A;  5IOY A;  2VE9 A;  3CUQ A;  2W85 A;  1RNL A;  4Y17 A;  3CJR B;  1BR2 A;  3R0A A;  1Z3X A;  4QPO A;  3V8K A;  2VOO A;  3EDP A;  4AIH A;  3F0C A;  1HC8 A;  1WWX A;  4Y52 J;  4I09 A;  4UV9 A;  3J7A Y;  2DA1 A;  3IH4 A;  1BBY A;  1UG2 A;  5AIQ A;  4HNV A;  3GTL J;  3BCB A;  2IA1 A;  1YO5 C;  1EF4 A;  5E79 C;  1XX5 A;  4G12 A;  1S3J A;  4W97 A;  3DU5 A;  4ABZ A;  3KP6 A;  2UXX A;  3TBI A;  3ZXS A;  1LPQ A;  1MMG A;  3F8F A;  2HPI A;  3ZR8 X;  1SFX A;  3J7Y J;  1ZGW A;  1HCR A;  5D6E A;  5DEQ A;  3HKZ N;  2L3D A;  1B59 A;  3KZZ A;  5FKK A;  4AIK A;  4L9N A;  2E35 A;  4IZZ A;  3GW2 A;  2M8E A;  2M4G A;  1JKO C;  1T98 A;  2CW8 A;  1MBH A;  4P55 A;  2EFP A;  4UHT A;  3F22 A;  1YJW I;  3W2W A;  4A5M A;  5K5O A;  4RAZ A;  1RKW A;  4UVC A;  3Q5F A;  2DW4 A;  3B6C A;  2YPR A;  2L7F P;  4LG0 A;  2HU9 A;  3QOE A;  2Z9O A;  3AFH A;  2PI0 A;  2JUC A;  3I55 I;  3COA C;  1OPC A;  2JRM A;  1SFO J;  4Y33 A;  1EH6 A;  1UHW A;  1MND A;  3KFW X;  3HB9 A;  3LA3 A;  3WGH A;  1USS A;  2E60 A;  1WSU A;  1XMX A;  3KZY A;  1XDS A;  5EGO B;  2FEZ A;  2JN6 A;  2ZB9 A;  2E1C A;  2OUM A;  3FBN B;  2QA4 I;  5ICF A;  1E2X A;  2VUM J;  2R7R A;  1RES A;  4Q5S F;  2OBP A;  3RPU D;  2XAG A;  1FTT A;  4R1H A;  5ICE A;  4QTR A;  4P1W A;  2LF8 A;  3K4N A;  4LIV A;  1VQ5 I;  1IN8 A;  3TED A;  4IHV A;  5CKT A;  2EFW A;  4KA4 A;  1FMW A;  2P5K A;  3SYT A;  3O6B B;  2FOK A;  1TW2 A;  1SEU A;  1FOW A;  2L0K A;  4PSX A;  3K10 A;  5F27 A;  4L9T A;  4BS9 A;  2OQR A;  3BQY A;  3QU3 A;  4X0G A;  3T5X A;  3TO6 A;  3OYM A;  1D1C A;  3I56 I;  1AWC A;  3AKZ A;  2CO5 A;  3IRR A;  1J9I A;  2VC1 A;  2NYX A;  1MMD A;  2I10 A;  2ID3 A;  3QYB A;  3S2D J;  4YG2 F;  2DFI A;  5EEA A;  3FX3 A;  3D5L A;  1ZN2 A;  2UUZ A;  5CLS A;  1Z9C A;  4EJU A;  2E1M B;  4C9Y A;  3KLN A;  3GCM A;  3HUG A;  4PDK A;  3KYC B;  3ZQ7 A;  5ILV A;  2PEX A;  3C2G A;  3WTX C;  1D8K A;  1ZG1 A;  1SFU A;  1Y0U A;  2JMW A;  2YUS A;  3BP8 A;  5BQT A;  4CUG A;  2OU2 A;  1IJW C;  4BAC A;  5A2Q K;  4A3K J;  4I6Z A;  1W36 D;  2BHZ A;  2M9H A;  3A0B C;  1NK2 P;  3IV5 A;  1FJL A;  3JRA A;  3JTH A;  2VPR A;  4M74 A;  3OYD A;  2BW3 A;  4YEJ A;  3HHG A;  2IP2 A;  2FOW A;  3PL8 A;  4F7Z A;  3MKY B;  3LAJ A;  4AWX B;  3GXO A;  1S29 A;  3CO7 C;  4CCN A;  3HBL A;  1Z0X A;  3A1Y A;  1JUP A;  5EZH A;  1S7E A;  5EZG A;  3ZQH A;  2WAF A;  2KRC A;  4I98 B;  3S8P A;  2L2O A;  1KU2 A;  2MD0 A;  3K9T A;  2R0Q C;  2LRD A;  3R4K A;  2VN2 A;  3E1S A;  2FBK A;  2PJR A;  3FMQ A;  3GFJ A;  2NNY A;  1REP C;  2CQQ A;  3OV8 A;  3FKJ A;  3T8T A;  3SFI A;  2H8R A;  1I39 A;  4U0V A;  4E7S A;  2R5Z A;  2E36 A;  4KIB A;  1PP8 F;  1J0R A;  2VXZ A;  4GO1 A;  5CYV A;  2ETH A;  1ZEL A;  1XCV A;  3K0L A;  2VKD A;  3CCE I;  3KYD B;  5JHF A;  2L7Z A;  3MD2 A;  4B48 A;  4P5O A;  1V5G A;  2OJE D;  2JSP A;  4L0Y B;  2L9S A;  3IAS 2;  2IJL A;  4HV6 A;  4UV8 A;  4HLX A;  2Q1Z B;  3S17 J;  3WTT C;  1JKR C;  3M1C A;  3PQJ A;  4D0P A;  3OYG A;  4O6J A;  2ESH A;  3NQO A;  1FNN A;  4DNC A;  2RN7 A;  3VB2 A;  1ZR2 A;  4I01 A;  4R8H A;  3FMS A;  4A3L J;  2GBY A;  2NOJ B;  4HX7 A;  3HOT A;  4KMU X;  2RQP A;  5K5Q A;  3S3O A;  4AVZ A;  4N4N B;  2OD5 A;  1W1W E;  2E7X A;  4ENM A;  2VJ4 A;  1WI3 A;  1TQI A;  1STZ A;  3FM5 A;  4A93 J;  5D8K B;  3OS0 A;  1AA7 A;  1X1D A;  3PFI A;  1XPX A;  3BZ6 A;  1IDY A;  5H6R A;  1G2H A;  1ETW A;  4JYK A;  4WXH A;  1KQ0 A;  4HZF A;  2VBX A;  3TP0 A;  1X58 A;  1VF9 A;  2W25 A;  2DBB A;  2IA2 A;  2VKE A;  2LKP A;  4CYC B;  3D5S C;  3LSI A;  3QPT A;  2XAU A;  4MIM A;  2VJJ A;  3N05 A;  3ZMS A;  5L3D A;  4XN0 A;  4UUT A;  4HYE A;  3S2H J;  5IP6 A;  4EJW A;  3VSK A;  1L0O C;  3WHB A;  1SD4 A;  2LYC A;  4YEL A;  2YSR A;  1IG7 A;  4EQQ A;  3I0T A;  3VDX A;  2F4M B;  5HLG A;  1I6X A;  2V6C A;  4G94 A;  5J4Y A;  1O3R A;  1HW2 A;  2CQ7 A;  1YG2 A;  2AXT C;  1Y8R B;  4M9Z A;  3CUQ B;  1XMA A;  2BXZ A;  3BJ6 A;  3H0G J;  3ZMD A;  3F21 A;  4HQM A;  1G3T A;  2KDZ A;  2FXA A;  4DBQ A;  1HF0 A;  2XGX A;  3H92 A;  2GQQ A;  3FHN A;  4PJJ A;  3T8R A;  1TQM A;  4KT6 A;  1F9N A;  1TTY A;  4MTE A;  2PMH A;  1VQ4 I;  1HBX G;  2BY3 A;  2BW3 B;  3DU6 A;  1F36 A;  3RQI A;  3ZRG A;  1WPK A;  1B8I A;  2VT2 A;  1IV6 A;  2K9L A;  4P96 A;  2TRT A;  2O3F A;  1OJL A;  2DA6 A;  2O6G E;  3S2W A;  1FOK A;  1RRJ A;  4I7H A;  4CCJ A;  5EEG A;  3HOV J;  4ZZD A;  1UJ8 A;  3HYI A;  3GTK J;  1MDM B;  5H20 A;  2HTJ A;  2GXG A;  1WJD A;  1DQU A;  3WGI A;  4IRG A;  2R3S A;  3GZ6 A;  1K79 A;  3S1M J;  1YFH A;  2P5L C;  3HSF A;  1JT6 A;  2WY8 Q;  4FE7 A;  5EYR A;  2FF4 A;  2G0E A;  1R6R A;  5FLV A;  4LLG F;  3RIR A;  2V7F A;  5H6Q A;  3NRV A;  5DCM A;  1SAX A;  3PO3 J;  2KP6 A;  4UB8 C;  1JUS A;  3RPQ A;  1JHH A;  3G1M A;  4XIC A;  3CC4 I;  5CQG A;  2P6S A;  3VYR B;  2M87 A;  3WTY C;  1D0Z A;  2Y69 H;  4IQJ A;  1IRG A;  3P9C A;  3CQZ J;  2A69 F;  1R5I D;  3FXR A;  4IEJ A;  2OAZ A;  4L18 B;  4V2F A;  4CCM A;  2Z3Y A;  5FRM A;  4O5V A;  2Y30 A;  4B44 A;  2IW5 A;  2ZME C;  3JCU C;  5K7F A;  4A6D A;  3AG3 H;  3VOD A;  3TGN A;  2HOS A;  5EGO A;  1OLT A;  1BC7 C;  2DJN A;  1HKQ A;  5HOD A;  2NVY J;  1B72 B;  1BJA A;  2WAQ N;  2Y0S A;  1FSE A;  3OS1 A;  5HDG A;  2BVL A;  1WGX A;  3HOW J;  1Y39 A;  2GLO A;  5D6F A;  2E7W A;  2ME6 A;  2DJI A;  3QOP A;  5LGT A;  1GT0 C;  2UWM A;  2EIN H;  2CW7 A;  3M1E A;  4ZH4 F;  3CP8 A;  4BBR J;  2V79 A;  2GOX B;  2R7V A;  2ZXJ A;  4AYB N;  4RDU A;  3P7N A;  3L7W A;  3FXM A;  3SJM A;  1MBK A;  2DXI A;  3DBR B;  4H4K C;  4E7Z A;  2KRF A;  3F23 A;  3LSJ A;  2LBF A;  4RAF A;  1SD7 A;  5FFZ A;  4ZDP A;  3IRQ A;  2DPD A;  4MHG A;  3H9G A;  2K9M A;  2P7V B;  4BHP A;  3BG3 A;  4IX7 A;  2YU3 A;  4KN7 X;  4TV7 A;  1XSD A;  1BA5 A;  2H8W A;  2VON A;  1G3W A;  3LQR A;  4A3C J;  3EUK L;  2W4S A;  2M5W A;  3KEQ A;  5LHH A;  1ZLJ A;  4XON A;  4BE0 A;  2CGP A;  4F3Q A;  3OY9 A;  2DYS H;  3ZMZ A;  2NVX J;  2E1M C;  4QLC U;  1HSJ A;  2EFQ A;  1IUF A;  2CW0 F;  2DMN A;  3GLL A;  2Q2E B;  3QU6 A;  2YS9 A;  2JJ7 A;  3H3V K;  2VBZ A;  1X2M A;  5M5W J;  2R7U A;  2ICW G;  3ELK A;  1Z67 A;  2BYV E;  2COM A;  4BH9 A;  2W82 A;  1ZYR F;  1VQP I;  5FKM A;  4Z2Y A;  2ZXH A;  5IOZ A;  5J4V A;  3PJR A;  3PUF A;  5K7H A;  1F4K A;  2HDD A;  1APL C;  2A07 F;  4LIT A;  3K7A J;  3HSE A;  1FZP B;  2PQ8 A;  2IGN A;  3F8M A;  4PFP A;  4KFC A;  5K7Z A;  4OWR B;  4GRI A;  4C3I J;  2MG4 A;  4E70 A;  2EV0 A;  2LNB A;  4YRV A;  2VQH A;  3E5X A;  2VBW A;  1YS7 A;  4BQO A;  3HOX J;  1FOY A;  3NAR A;  3M3Y J;  4II3 A;  3WU1 B;  3G2B A;  3HKZ A;  1DU0 A;  3SDB A;  1TP4 A;  4IF4 A;  1ON2 A;  3HG9 A;  1GV2 A;  2DOF A;  2FA5 A;  2H1L A;  5LGU A;  4U7B A;  4KMF A;  4AD9 A;  4ENK A;  5D5W B;  4AUX A;  1BIB A;  3RKQ A;  2V1N A;  3ONQ A;  2YU9 J;  5C4X J;  2MLK A;  5KAI C;  3I4M J;  1OYW A;  1T0F C;  5FFX A;  3EYI A;  2KIU A;  2WY7 Q;  4XKC A;  4U88 A;  3JRH A;  1XDU A;  4A3M J;  1R1T A;  2O0Y A;  1MBF A;  5D5X B;  4GCV A;  4FQG A;  4BU2 A;  2LSO A;  3HOY J;  1TWH J;  5FLM J;  1IW7 F;  3OOP A;  3WG9 A;  1TWA J;  3H9Q A;  2M3A A;  4Q47 A;  3ISP A;  4CCO A;  2DPU A;  3C2B A;  4J01 A;  3CZ6 A;  2ESN A;  5KNL A;  1FBS A;  1XGO A;  1FYM A;  4OIR F;  2ZME A;  3M8E A;  2NS7 A;  1ZAR A;  2R7O A;  1Y8Q B;  4YIR X;  2LLK A;  3CME I;  2IT0 A;  2JA8 J;  1W4M A;  4NB5 A;  4GGG A;  2BHY A;  5F6F A;  2LKS A;  2JSC A;  2DOE A;  2FBH A;  5F08 A;  3EQL F;  3JRE A;  5J40 A;  5IP9 J;  2JPC A;  4LLN A;  1FP1 D;  3TKY A;  2W84 A;  2V1U A;  1BI3 A;  4HG2 A;  2VE8 A;  3BDD A;  3L2R A;  3S3N A;  3ZMU A;  2QQ9 A;  4XID A;  1EV7 A;  2D5V A;  2N8G A;  1X1C A;  1KYZ A;  3MEX A;  5LGN A;  1A6Q A;  1U3E M;  1MIJ A;  3M9A A;  1JJ6 C;  5JLW A;  2JRT A;  4HA8 A;  4RLF A;  1KON A;  1X4O A;  5E3O A;  3BR6 A;  2HS5 A;  2RRE A;  2OPT A;  2STT A;  3AL0 C;  3M07 A;  2GIV A;  5ICC A;  4I76 A;  2DTR A;  3I64 A;  4HAM A;  5HNH A;  3WTS C;  3ZP5 A;  2HXI A;  1TT5 B;  2TCT A;  3S16 J;  1X3U A;  2A68 F;  1JTX A;  1X1A A;  2LK2 A;  3CUQ C;  3WU2 C;  3IKV A;  1RUN A;  2EH3 A;  3RZO J;  3HRT A;  2O9L A;  5GTH C;  5FO5 A;  2CUF A;  5LHG A;  4XOP A;  1Z91 A;  3HIF A;  5FKN A;  4B4C A;  3V8L A;  5BS6 A;  1LB2 A;  5HVQ C;  2QGU A;  1ZRC A;  5EG0 A;  2H09 A;  4G7Z F;  2R7Q A;  4A3B J;  3WTV C;  4UNO A;  1GDT A;  3KP2 A;  2EV5 A;  4NBQ A;  1XGS A;  5J8F A;  1UG0 A;  2XGE A;  4ZC3 A;  1LJ9 A;  3RJP A;  3RKX A;  2HQN A;  2YX7 A;  2K4J A;  2LBF B;  4MFD A;  3JSO A;  2DDA A;  3HC7 A;  1DUX C;  1FSH A;  3CJT B;  2EZH A;  2LTP A;  4WX9 A;  2FU4 A;  3Q9S A;  2E2I J;  2ZKZ A;  5CVJ A;  2HQ5 A;  4BL0 B;  1YRN B;  1KQ8 A;  2JPB A;  4D1Q A;  2XVC A;  3M4O J;  1W36 C;  4Z6Y A;  2XKP A;  5FKO A;  2FNP A;  1GVJ A;  1QPM A;  4DW6 A;  5IT9 K;  3N97 A;  1Y1W J;  2K86 A;  3I58 A;  4FT8 A;  4GYI A;  4DYC A;  5LFA A;  1FBQ A;  5D8L B;  2JA5 J;  1Y0N A;  2IXS A;  4BAY A;  1ONV A;  2QUF A;  3LNQ A;  2AS5 F;  3J81 K;  4XRS A;  3LFK A;  5EJC A;  2HEO A;  2QKL B;  2IEK A;  4B1R A;  2BY2 A;  3RPU A;  3W6K B;  2R7Z J;  4XQF A;  4YFK F;  1LDD A;  4ESF A;  2HOE A;  1N78 A;  1WFX A;  1KGS A;  3QYF A;  2Q2E A;  4M73 A;  4NC6 A;  2DLL A;  2PJR B;  5L3C A;  3CJQ B;  2RVC A;  2MSY A;  1H9G A;  1KA8 A;  2X48 A;  3K4K A;  3OR1 C;  3FIS A;  1FC3 A;  1VTN C;  1V55 H;  2LDU A;  2CQK A;  2QBY B;  4KYW A;  2YX4 A;  4K2E A;  5M5X J;  1U78 A;  1E17 A;  5KAF C;  4OMZ A;  1X1B A;  3FXQ A;  3GTQ J;  4PK4 A;  2CYY A;  4NNJ A;  3I4P A;  1BIA A;  3JRC A;  2V26 A;  4IOA F;  2M4K A;  9ANT A;  5GAD J;  3S3M A;  2NVT J;  2BY1 A;  3HHH A;  4CYD A;  4DZJ A;  1HW1 A;  4A2U A;  4EM2 A;  3QPH A;  1WJC A;  4AVP A;  5LHI A;  1QNT A;  2KPM A;  2HKO A;  3FXO A;  1LE8 A;  1JHF A;  2Y2Z A;  3MKW B;  1OCR H;  4XLA A;  2VQC A;  3EET A;  1XGM A;  4I02 A;  1XTA A;  4EGY A;  5E8I A;  4Q48 A;  3CCQ I;  1Y1V J;  3CTA A;  4JQF A;  1WVR A;  4DOZ A;  3UNG C;  3EPZ A;  1IAW A;  1UEL B;  3K1P A;  5DM7 F;  2XAH A;  3I59 B;  1YOV B;  3DKX A;  4EJO A;  5JFR A;  1B72 A;  4XNF A;  2VKH A;  1BL0 A;  4XOR A;  1LVK A;  1MMA A;  5DCF A;  1QZE A;  4F93 B;  3L2U A;  5JR3 A;  1YLF A;  1IDZ A;  1P9Q C;  3AG4 H;  6PAX A;  2RDP A;  2JK3 A;  2V9V A;  2FX0 A;  3OYB A;  3FXK A;  4BY7 J;  1GXQ A;  4D5F A;  1K78 A;  2RV8 A;  2DU9 A;  2X1C A;  2DOA A;  2F5F A;  3ABM H;  4BJ6 C;  3G3Z A;  1FEX A;  3GX4 X;  2EFN A;  1D1A A;  1R1V A;  3CCL I;  3HUG B;  1QBJ A;  1OFC X;  1SAN A;  3TW7 A;  4RB2 C;  4C30 A;  1RIO H;  4PGG A;  1ULY A;  4ANJ A;  2B9S A;  1F5T A;  5F0F A;  5GAG J;  4WF2 A;  4QPQ A;  5IT9 Z;  3IH2 A;  3CO6 C;  1MJ9 A;  2DFE A;  3PFY A;  2F4O B;  1XGN A;  1XD7 A;  1Z21 A;  2ECB A;  3FZV A;  4L5J A;  4UVB A;  5EDN A;  3KP5 A;  3ECO A;  2VL8 A;  4ASN A;  5FLX K;  4XLH A;  3BCA A;  1W0T A;  1J5Y A;  1BI0 A;  1QU3 A;  4ZZL A;  2XHK A;  2CSO A;  3QPL A;  3BR2 A;  3FM3 A;  4LLL A;  1CF7 A;  5F0H A;  2QSG X;  2K02 A;  4XK4 A;  4MQV A;  2R5Y A;  1WKM A;  1B1B A;  4BY1 J;  1JJ8 C;  3WTZ A;  1WCM J;  2RQQ A;  2KZV A;  2Z5U A;  4F52 A;  1BW5 A;  1GLN A;  1MH3 A;  1Z1D A;  4Y4R A;  1FYK A;  1G59 A;  3DFG A;  5B1A H;  4IOC F;  5J3L A;  2E5Z A;  4Q4Z F;  2HVQ A;  3CCJ I;  1VQM I;  4UUV A;  4G6T B;  3B73 A;  4HF2 A;  3P9I A;  2X4H A;  4DQ2 A;  2VKV A;  4HF0 A;  1HDD C;  4V19 K;  5FRO A;  3WTU C;  2EZI A;  1BOA A;  1PYV A;  4ZJZ A;  1R49 A;  4BXX J;  2LRE A;  3S32 A;  1IO2 A;  1T2K A;  3C1D A;  1TBX A;  5JHU A;  4E7I A;  2MA3 A;  4AIJ A;  3LSH A;  1OCP A;  1ETQ A;  4EEF G;  5GAH J;  3VFZ A;  3P5J A;  5GP9 A;  2A6H F;  4BQN A;  5J1R A;  3ZQF A;  5IYD J;  1P6R A;  4LK0 F;  5FGM A;  3HEF A;  4ZTJ A;  1N75 A;  4NHJ A;  3K2A A;  3Q9V A;  1B6A A;  1H9T A;  2O03 A;  3DEW A;  4HOB A;  1SMY F;  4XOT A;  2F48 A;  1ZGJ A;  5TIS C;  2BVM A;  1VND A;  3IUO A;  4A3E J;  1K78 B;  1MBG A;  4BEH B;  1Z6T A;  1FTZ A;  2TDX A;  3KZI C;  2MLG A;  5K1Y A;  3T1B A;  3E5Q A;  3L1P A;  5L3B A;  4JX6 A;  4KT5 C;  2X6W A;  2XB5 A;  4N4O B;  5C44 J;  2AQE A;  1H0M A;  2UZK A;  1BI1 A;  4D7N A;  2FSW A;  1HDP A;  2VLA A;  2CUZ A;  5DYM A;  5FD5 A;  2IRF G;  2L4M A;  1BI2 A;  4M6X A;  4XLF A;  2ZFW A;  3R61 A;  4KIF A;  1BW6 A;  2L54 A;  3J80 K;  1ACI A;  4G6D A;  1WJA A;  2PLY A;  3PIO F;  1RUO A;  2JA6 J;  4NQW A;  4WXD A;  4G6Q A;  2DMT A;  3OYF A;  5J1Y A;  4B09 A;  3LA7 A;  4CH7 A;  3BG7 A;  1AKH A;  3F3X A;  2HZD A;  1OKR A;  3ZCO A;  2QWW A;  2V4J C;  4IRH A;  2E2J J;  4N9H A;  3LQQ A;  3HOZ J;  2CFX A;  4PZJ A;  3ASO H;  3BR1 A;  3E5U A;  2K9N A;  1P4W A;  1FT9 A;  3PNV A;  2KKO A;  3ZN0 A;  2Z16 A;  1VQK I;  2D45 A;  2M0C A;  4Y15 A;  4D5C A;  3G6E I;  1OYI A;  3DPT A;  1JUM A;  2AXL A;  2IA0 A;  5EEH A;  4IKF A;  2E19 A;  3LSP A;  1TL8 A;  4XMY A;  4ZTF A;  1ZKG A;  3OWT A;  2LR8 A;  3SEQ A;  4LIU A;  4UY8 I;  1FOX A;  1YW9 A;  4HW0 A;  4IHW A;  1T6S A;  1ZH5 A;  4OMY A;  2XPV A;  1LFP A;  1TWF J;  1ETY A;  2PJP A;  3H5N A;  4WXC A;  1IRF A;  2ELH A;  2D1V A;  4CZC A;  2CQX A;  2EIL H;  2WAD A;  2M1B A;  1Y56 A;  2VB6 A;  3Q0V A;  2CUJ A;  4M3E A;  2JA2 A;  3HSR A;  5GPA A;  4UUS B;  2HR3 A;  3G71 I;  1O7L A;  1DGR M;  3GFL A;  2CMP A;  3K69 A;  2MAB A;  4YFN F;  2Y9Z A;  5E20 A;  1LVA A;  2DO7 A;  2P4W A;  3CF5 F;  1LEB A;  4MTD A;  2DT6 A;  2EIM H;  2DA7 A;  3GYH X;  5BMZ A;  3KP7 A;  3FK7 A;  1ENH A;  4ENN A;  1YS6 A;  2HYG D;  4ESJ A;  5E8G A;  1T38 A;  4FTH A;  2RNG A;  1OCT C;  4AM3 A;  4FX4 A;  1RZ4 A;  2HTS A;  2XIG A;  3MZH A;  1ETK A;  1J59 A;  1EJ9 A;  4U0Y A;  1IN4 A;  5C3E J;  1XN7 A; 
#chains in the Genus database with same CATH homology
 5L3E A;  2ZNZ A;  1L3L A;  3V8J A;  2GAU A;  1U5T A;  4KUM A;  5TRD A;  5HS8 A;  2L02 A;  3ROU A;  2K7L A;  1R58 A;  2OA4 A;  3TO9 A;  2QBY A;  1W7P D;  2JT1 A;  5D4S A;  3E6D A;  3CLO A;  4FHT A;  5BPD A;  2XAF A;  4HV5 A;  3GWZ A;  3TDZ C;  1P4A A;  4RS8 A;  2VBY A;  2Y48 A;  3RYR A;  4CHU A;  1ZHF A;  1HKS A;  3E6C C;  5IT3 A;  1YIO A;  3U1D A;  3QAH A;  1WRJ A;  1KU3 A;  3TDU C;  3MZY A;  2GXB A;  3KP4 A;  4UVA A;  4L9V A;  1LDJ A;  2F5E A;  3F8B A;  1CGP A;  1FY7 A;  1O57 A;  2ZCW A;  5TJJ A;  4IJA A;  3GVA A;  2MC3 A;  3F8N A;  4BQA A;  5ED4 A;  5HLH A;  2VT3 A;  4M9S A;  1MJA A;  3QP5 A;  5K5R A;  4ZYD A;  1Z6R A;  1QO0 D;  5L3F A;  2IPQ X;  2F2E A;  1ODD A;  5HDN A;  4HX4 A;  2FMY A;  4A0Y A;  4BHC A;  3RDI A;  1XN7 A;  2DI3 A;  5LRS A;  4MGR A;  5HOO A;  4L9J A;  1S7A A;  4BNC A;  2KJC A;  2JZY A;  1DP7 P;  1QZZ A;  1EH8 A;  1QZY A;  5CJ9 A;  1S7O A;  3SHF A;  4HQE A;  1KYW A;  2HWV A;  4XSX F;  1R00 A;  4XLP F;  3I5U A;  4UXN A;  1FPQ A;  1O3Q A;  3E97 A;  2Q8K A;  1CF7 B;  4P9U A;  3WGG A;  5CVI A;  3JW4 A;  4S04 A;  1YW7 A;  4KNY A;  4XSZ F;  1BN5 A;  1XSV A;  2QQB A;  3L00 A;  3DPL C;  1J2X A;  3IHU A;  4G8X A;  2P7C B;  3H3U A;  2ZME B;  3WTW C;  5DD8 A;  1O3T A;  1ZLK A;  4QWQ A;  2HDC A;  1YQA A;  4CIC A;  2PG4 A;  1IN6 A;  3L9F A;  1SMT A;  5J6X A;  4BYY A;  2EA2 A;  5JI6 A;  4EMS A;  3J81 Z;  4N9I A;  4IHT A;  3WOD F;  4BHB A;  3F8C A;  1I1G A;  5CVV A;  2RGV A;  2H94 A;  1WI9 A;  3M7G A;  2PMU A;  4LD5 A;  4ZYG A;  3R60 A;  3C18 A;  2Q0O A;  3B02 A;  2OZ6 A;  1S6L A;  2FQ3 A;  2HQR A;  1FYL A;  1O7F A;  2LF7 A;  2XAS A;  1FX7 A;  1U6G A;  5HLI A;  5DUI A;  4ESB A;  2Z99 A;  4A0Z A;  1ZG3 A;  4N0B A;  1TLH B;  1Z05 A;  2A5Y B;  1DDN A;  2Y75 A;  1YTY A;  1J75 A;  4IVN A;  1KQ9 A;  2NS0 A;  2JTV A;  3RTR A;  1FWZ A;  4S05 A;  3I71 A;  2O61 A;  4RGU A;  4EJV A;  3JAM K;  3GFM A;  4EJT A;  4FX0 A;  4CO8 A;  2K27 A;  5LEJ A;  4RGR A;  2E1N A;  4G7O F;  4EV0 A;  3GO5 A;  2ACJ A;  2QLZ A;  3R0J A;  2BEO A;  2R7F A;  3C7J A;  2EFO A;  1G3S A;  3ML6 A;  1GXP A;  1HKT A;  3F6V A;  1BC8 C;  2HFH A;  5DDG A;  2YR2 A;  2QQA A;  5D4R A;  4P9F A;  4OIO F;  2V1X A;  2NRA C;  2PFB A;  2F5D A;  3WE2 A;  5D5V B;  1G3Y A;  1XSX A;  3BY6 A;  1LQ1 A;  1IN7 A;  3J7A O;  5ILS A;  3O3K A;  1TW3 A;  4G9Y A;  4KIC A;  5BPI A;  3BJO A;  3JSP A;  2GA1 A;  4LGW A;  4XRF A;  2A3S A;  3FXU A;  3E6B A;  3V7S A;  3IWF A;  4CGZ A;  1IXR C;  1XCB A;  2OQG A;  1QGP A;  3H3Z A;  3DEU A;  2UXN A;  3K1M A;  5HS9 A;  2R7D A;  3R6S A;  4A5N A;  2EA4 A;  3M8F A;  4RGS A;  4WCG A;  1ZG5 A;  2J5O A;  2DQR A;  3HTU A;  1D3Y A;  3ABU A;  5FD6 A;  1W5T A;  3ULQ B;  3VOE A;  3SXY A;  1HXD A;  4R79 A;  3CDH A;  4IXA A;  3IC7 A;  5JVT A;  1JGS A;  1MGT A;  5HDK A;  1U2W A;  2KJB A;  1JE8 A;  3ABT A;  3CUO A;  3ERE D;  4CXF A;  1IN5 A;  3TQN A;  2ZBK A;  1KU7 A;  4I0B A;  3I53 A;  2VOP A;  4IHS A;  5FB2 A;  2ZO4 A;  1R5G A;  1I27 A;  1P92 A;  4LB6 B;  5D5U B;  2XUB A;  1ZGA A;  1BM9 A;  1ZAO A;  4CDG A;  2XAQ A;  2M45 A;  5DD4 A;  3FMR A;  4IPA A;  3QRF F;  3T0Y A;  4OIN F;  2A6E F;  1LEA A;  3DKW A;  1LDK B;  1ZRD A;  4HX8 A;  3BWG A;  3GUD A;  4LJZ F;  3HOS A;  1UFM A;  4GYG A;  4HF1 A;  5LRR A;  3NEU A;  3MAJ A;  3SZT A;  2FRH A;  3E3V A;  5ICG A;  4A0X A;  2QVO A;  2DAO A;  2W57 A;  2OZU A;  1F1Z A;  2XAJ A;  4O3M A;  2J5P A;  2XV4 S;  2QEN A;  2F5C A;  3DV8 A;  2EV6 A;  2EK5 A;  3IWZ A;  5AON A;  1K6O A;  1DPU A;  3ZPL A;  4JK1 X;  1XB4 A;  3LA2 A;  4U0W A;  3RI4 A;  1IF1 A;  2H6B A;  3LAP A;  4ENJ A;  4LMY A;  5J8C A;  4EGZ A;  4EM0 B;  4Y13 A;  3G73 A;  2P5V A;  2QYO A;  1C0W A;  3F72 A;  4KIG A;  1AOY A;  5E17 F;  1OMI A;  3VEP A;  4U7D A;  1D8J A;  1B9M A;  4B8X A;  4OOI A;  4M72 A;  1J7K A;  1UHM A;  4HDV A;  2X0L A;  4YII A;  2B0L A;  1MD0 A;  1HST A;  4BXU A;  2G7H A;  2DK8 A;  4OIQ F;  2BE5 F;  1B9N A;  5BOX A;  1A04 A;  4YIF A;  1TQP A;  3ZN1 A;  3LST A;  5AIP A;  3PQK A;  3F6O A;  3BPX A;  2K4B A;  2RKH A;  3ZMV A;  4PGH A;  4I2O A;  1P2F A;  2QM3 A;  2A61 A;  3IKT A;  1OR7 A;  1R7J A;  2MH2 A;  1DPR A;  3V7C A;  2HYF A;  2M30 A;  1R22 A;  2PBI A;  1FBU A;  4LK1 F;  3BOQ A;  3KLO A;  5KVR A;  4WWC A;  1R23 A;  5F1R A;  3JAM Z;  3U2R A;  2O8X A;  2VOD A;  3FHZ A;  3ECH A;  1K7A A;  3K2Z A;  1G6N A;  1U8R A;  2GWR A;  3KP3 A;  1FP2 A;  3TOB A;  4EVI A;  1JXS A;  1MKM A;  3LWF A;  2CWE A;  1IZ1 A;  3K1N A;  2L4A A;  5E1W A;  2ISY A;  1R1U A;  5DCM B;  2GZW A;  1TNT A;  1SD5 A;  1O3S A;  2XRN A;  4MQ9 F;  1Z7U A;  2ADU A;  1RI7 A;  3GFI A;  1EH7 A;  2KIF A;  5F64 A;  3JTG A;  2QZ8 A;  3ZMT A;  3I59 A;  1ZRF A;  4KDP A;  3SZP A;  3MCZ A;  1IXC A;  3GF2 A;  2WTE A;  2FBI A;  3IL2 A;  2CG4 A;  3U9G A;  1G4D A;  2IVM A;  4M6Y A;  1ZRE A;  1GHC A;  1IUY A;  3HRS A;  3TO7 A;  1W7P A;  1V4R A;  1MZB A;  1I5Z A;  3CJN A;  5DUK A;  4LB5 A;  3DP7 A;  1OYY A;  2H6C A;  5CVU A;  2Z33 A;  3TOA A;  4I0A A;  3L2C A;  5CVR A;  3W6J B;  2W24 A;  3V7R A;  3P9K A;  5A2Q Z;  4G7H F;  4L0Z B;  3I54 A;  4RB0 A;  2HGC A;  5LLQ A;  1I1S A;  4HLY A;  2HZT A;  2ZNY A;  3KE2 A;  5DV5 A;  2MH9 A;  2EWN A;  3WU0 A;  2HKX A;  3BRO A;  1NHA A;  1UCR A;  2KIM A;  2XKO A;  5LBQ A;  2DT5 A;  5LEK A;  4HDU A;  1FLI A;  2FNA A;  2STW A;  4RB1 A;  2C6Y A;  2DQL A;  5FLX Z;  1UST A;  2D2W A;  1HQC A;  4M9X A;  4GXO A;  3E6M A;  2XRO A;  1Q1H A;  2ZJ2 A;  1IXS B;  2PN6 A;  1SFE A;  4OIP F;  3O2P E;  5ILU A;  3FF5 A;  2BGC A;  3EYY A;  4MNU A;  3V4G A;  4WK8 F;  3FWE A;  4ON0 A;  1V3F A;  1PUE E;  3SFZ A;  3AAF A;  3DF8 A;  1U5T B;  3J80 Z;  2WC2 A;  3KCC A;  2FE3 A;  2MBF A;  1R36 A;  1PDN C;  3GEZ A;  3HRU A;  4ETS A;  4OU0 A;  4XLN F;  5E1Z B;  3BPV A;  1QQI A;  4HBL A;  4M71 A;  2EJR A;  1T39 A;  2WV0 A;  4KN4 X;  3MWM A;  4IRI A;  2WWY A;  5E1X A;  3WE3 A;  3REO A;  2Y0M A;  3HTS B;  5ERI A;  1PP7 U;  1W7P B;  2V1D A;  2G7U A;  1UB9 A;  3MFK A;  1S8N A;  3L09 A;  4MEX F;  2G9W A;  2P6T A;  3MQ0 A;  3RKW A;  4A6E A;  5L3G A;  1U5T C;  4CZZ A;  1XMK A;  2VC0 A;  1TNS A;  3KEO A;  2DK5 A;  3HRM A;  2NNN A;  4RGX A;  2BV6 A;  3GZ5 A;  1SD6 A;  2RNJ A;  3QP6 A;  4PCQ A;  1YYV A;  4H0E A;  3BJA A;  1HW5 A;  1KU9 A;  3SQN A;  2EB7 A;  2ISZ A;  3KET A;  5HS7 A;  4LG0 B;  1WQ2 A;  3RKY A;  3C3W A;  1ON1 A;  4ZYH A;  1D5V A;  1R5H A;  1YW8 A;  4JBA A;  4MEY F;  1P4X A;  3RYP A;  1MDM A;  4RAY A;  2P8T A;  3D0S A;  4A12 A;  2NAZ A;  1B4A A;  1MJB A;  3DQV C;  3GLX A;  2FML A;  4EM1 A;  1LNW A;  5KK1 A;  4L5I A;  2D1H A;  3N4M A;  1W5S A;  4YFX F;  3DXJ F;  2H27 A;  2GA2 A;  4LFU A;  2L01 A;  4XBF A;  2BBY A;  4ZYE A;  5E18 F;  3EUH A;  1T0F A;  2RC4 A;  2MD5 A;  2VE9 A;  3CUQ A;  2W85 A;  1RNL A;  4Y17 A;  3R0A A;  3V8K A;  2VOO A;  3EDP A;  4AIH A;  1WWX A;  4I09 A;  4UV9 A;  1BBY A;  5AIQ A;  1YO5 C;  2IA1 A;  1S3J A;  3KP6 A;  2UXX A;  3F8F A;  1SFX A;  5D6E A;  5DEQ A;  4AIK A;  2L3D A;  1B59 A;  3KZZ A;  4L9N A;  3GW2 A;  2M8E A;  1T98 A;  4P55 A;  4UHT A;  2EFP A;  3F22 A;  4A5M A;  5K5O A;  4RAZ A;  4UVC A;  3Q5F A;  2DW4 A;  2YPR A;  4LG0 A;  2Z9O A;  2PI0 A;  3COA C;  1OPC A;  1EH6 A;  1UHW A;  3KFW X;  3LA3 A;  3WGH A;  1USS A;  1WSU A;  3KZY A;  1XDS A;  2FEZ A;  2E1C A;  5ICF A;  1E2X A;  4Q5S F;  2OBP A;  2XAG A;  4R1H A;  5ICE A;  2LF8 A;  1IN8 A;  2EFW A;  4KA4 A;  2P5K A;  3O6B B;  2FOK A;  1TW2 A;  4L9T A;  2OQR A;  3QU3 A;  3T5X A;  3TO6 A;  1J9I A;  1AWC A;  2CO5 A;  3IRR A;  2VC1 A;  2NYX A;  4YG2 F;  2DFI A;  3FX3 A;  3D5L A;  1ZN2 A;  5CLS A;  1Z9C A;  4EJU A;  3KLN A;  3HUG A;  4PDK A;  3ZQ7 A;  5ILV A;  2PEX A;  3WTX C;  1ZG1 A;  1D8K A;  1SFU A;  1Y0U A;  3BP8 A;  5BQT A;  2OU2 A;  5A2Q K;  3JTH A;  4M74 A;  3HHG A;  2IP2 A;  4F7Z A;  3LAJ A;  4AWX B;  3GXO A;  1S29 A;  3CO7 C;  4I98 B;  1KU2 A;  3K9T A;  3R4K A;  2VN2 A;  2FBK A;  3FMQ A;  3GFJ A;  2NNY A;  1REP C;  3OV8 A;  3T8T A;  4U0V A;  4KIB A;  1PP8 F;  1J0R A;  2VXZ A;  4GO1 A;  5CYV A;  2ETH A;  1XCV A;  3K0L A;  4P5O A;  4L0Y B;  2IJL A;  4HV6 A;  4UV8 A;  4HLX A;  3WTT C;  3PQJ A;  4D0P A;  4O6J A;  2ESH A;  3NQO A;  1FNN A;  4DNC A;  2RN7 A;  3VB2 A;  4I01 A;  4R8H A;  3FMS A;  4HX7 A;  3HOT A;  4KMU X;  2RQP A;  5K5Q A;  2OD5 A;  2E7X A;  4ENM A;  1TQI A;  1STZ A;  3FM5 A;  5D8K B;  3PFI A;  3BZ6 A;  5H6R A;  4WXH A;  1KQ0 A;  4HZF A;  2VBX A;  2W25 A;  2DBB A;  2IA2 A;  2LKP A;  3QPT A;  3ZMS A;  5L3D A;  4HYE A;  4EJW A;  1L0O C;  1SD4 A;  2YSR A;  4EQQ A;  3I0T A;  5HLG A;  1I6X A;  2V6C A;  4G94 A;  1O3R A;  1HW2 A;  1YG2 A;  4M9Z A;  3CUQ B;  1XMA A;  3BJ6 A;  3ZMD A;  3F21 A;  4HQM A;  1G3T A;  2FXA A;  2XGX A;  3H92 A;  2GQQ A;  3T8R A;  1TQM A;  1F9N A;  1TTY A;  4MTE A;  2PMH A;  1HBX G;  2VT2 A;  4P96 A;  2O3F A;  2O6G E;  3S2W A;  1FOK A;  4I7H A;  5EEG A;  4ZZD A;  3HYI A;  1MDM B;  5H20 A;  2HTJ A;  2GXG A;  3WGI A;  4IRG A;  2R3S A;  1K79 A;  1YFH A;  2P5L C;  3HSF A;  2FF4 A;  4LLG F;  3RIR A;  5H6Q A;  3NRV A;  5DCM A;  1SAX A;  3RPQ A;  1JHH A;  2P6S A;  2M87 A;  3WTY C;  1IRG A;  3P9C A;  2A69 F;  3FXR A;  2OAZ A;  4L18 B;  2Z3Y A;  4O5V A;  2IW5 A;  4A6D A;  3VOD A;  3TGN A;  1BC7 C;  1HKQ A;  1BJA A;  1FSE A;  5HDG A;  5D6F A;  2E7W A;  3QOP A;  5LGT A;  2UWM A;  3M1E A;  4ZH4 F;  2V79 A;  2ZXJ A;  3P7N A;  3L7W A;  2KRF A;  3F23 A;  1SD7 A;  5FFZ A;  2DPD A;  3IRQ A;  4MHG A;  2P7V B;  4BHP A;  1XSD A;  2YU3 A;  4KN7 X;  4TV7 A;  2VON A;  1G3W A;  3LQR A;  2M5W A;  5LHH A;  3KEQ A;  1ZLJ A;  2CGP A;  3ZMZ A;  4QLC U;  1HSJ A;  2EFQ A;  2CW0 F;  3QU6 A;  2VBZ A;  3ELK A;  2BYV E;  2COM A;  4BH9 A;  1ZYR F;  4Z2Y A;  1F4K A;  2A07 F;  3HSE A;  1FZP B;  2PQ8 A;  3F8M A;  4KFC A;  4E70 A;  2EV0 A;  2LNB A;  3E5X A;  2VBW A;  1YS7 A;  3WU1 B;  4IF4 A;  1ON2 A;  2FA5 A;  5LGU A;  4U7B A;  4KMF A;  4AD9 A;  4ENK A;  5D5W B;  1BIB A;  2MLK A;  1OYW A;  5FFX A;  3EYI A;  2KIU A;  4U88 A;  1XDU A;  1R1T A;  2O0Y A;  5D5X B;  4GCV A;  2LSO A;  1IW7 F;  3OOP A;  3WG9 A;  4Q47 A;  3ISP A;  2DPU A;  2ESN A;  1FBS A;  1XGO A;  1FYM A;  4OIR F;  2ZME A;  3M8E A;  2IT0 A;  1ZAR A;  1W4M A;  4NB5 A;  4GGG A;  5F6F A;  2JSC A;  2FBH A;  3EQL F;  2JPC A;  4LLN A;  1FP1 D;  3TKY A;  2W84 A;  2V1U A;  1BI3 A;  2VE8 A;  3BDD A;  3ZMU A;  2QQ9 A;  1EV7 A;  3MEX A;  1KYZ A;  1U3E M;  5LGN A;  3M9A A;  2JRT A;  4HA8 A;  2HS5 A;  2STT A;  2GIV A;  5ICC A;  2DTR A;  3I64 A;  4HAM A;  3WTS C;  3ZP5 A;  1X3U A;  2A68 F;  3CUQ C;  3IKV A;  1RUN A;  3HRT A;  5FO5 A;  5LHG A;  1Z91 A;  3HIF A;  3V8L A;  5BS6 A;  1LB2 A;  5HVQ C;  1ZRC A;  2H09 A;  4G7Z F;  3WTV C;  4UNO A;  3KP2 A;  2EV5 A;  1XGS A;  5J8F A;  1LJ9 A;  3RJP A;  3RKX A;  2HQN A;  2YX7 A;  2K4J A;  3JSO A;  1FSH A;  1DUX C;  4WX9 A;  2FU4 A;  3Q9S A;  2ZKZ A;  5CVJ A;  1KQ8 A;  2JPB A;  2XVC A;  2XKP A;  2FNP A;  1GVJ A;  1QPM A;  5IT9 K;  3N97 A;  2K86 A;  3I58 A;  4FT8 A;  4GYI A;  1FBQ A;  5D8L B;  4BAY A;  1ONV A;  2QUF A;  2AS5 F;  3J81 K;  3LFK A;  2HEO A;  3RPU A;  3W6K B;  4YFK F;  1LDD A;  4ESF A;  2HOE A;  1KGS A;  2Q2E A;  4M73 A;  2DLL A;  5L3C A;  2RVC A;  1H9G A;  1KA8 A;  1FC3 A;  1VTN C;  2LDU A;  2CQK A;  2QBY B;  4KYW A;  2YX4 A;  4K2E A;  1U78 A;  1E17 A;  4OMZ A;  3FXQ A;  2CYY A;  3I4P A;  1BIA A;  3HHH A;  4CYD A;  1HW1 A;  4A2U A;  4EM2 A;  3QPH A;  4AVP A;  5LHI A;  1QNT A;  2HKO A;  1JHF A;  3EET A;  1XGM A;  4I02 A;  4EGY A;  5E8I A;  4Q48 A;  3CTA A;  4JQF A;  1IAW A;  3K1P A;  2XAH A;  3I59 B;  4EJO A;  5JFR A;  5DCF A;  5JR3 A;  1YLF A;  6PAX A;  2RDP A;  2V9V A;  1GXQ A;  1K78 A;  2RV8 A;  2DU9 A;  2F5F A;  3G3Z A;  3GX4 X;  2EFN A;  1R1V A;  1QBJ A;  4RB2 C;  1RIO H;  4PGG A;  1ULY A;  1F5T A;  4WF2 A;  5IT9 Z;  3CO6 C;  1MJ9 A;  1XGN A;  1XD7 A;  3FZV A;  4L5J A;  4UVB A;  3KP5 A;  3ECO A;  4ASN A;  5FLX K;  1J5Y A;  1BI0 A;  4ZZL A;  2XHK A;  2CSO A;  3FM3 A;  4LLL A;  1CF7 A;  2K02 A;  4MQV A;  1WKM A;  1B1B A;  3WTZ A;  2Z5U A;  1Z1D A;  1FYK A;  3DFG A;  4Q4Z F;  4UUV A;  3B73 A;  4HF2 A;  3P9I A;  2X4H A;  4DQ2 A;  4HF0 A;  3WTU C;  1BOA A;  1T2K A;  3C1D A;  1TBX A;  5JHU A;  2MA3 A;  4AIJ A;  3VFZ A;  2A6H F;  1P6R A;  4LK0 F;  5FGM A;  4NHJ A;  3Q9V A;  1B6A A;  1H9T A;  2O03 A;  4HOB A;  1SMY F;  1ZGJ A;  1K78 B;  1Z6T A;  2TDX A;  2MLG A;  5K1Y A;  3T1B A;  3E5Q A;  5L3B A;  4KT5 C;  1H0M A;  2UZK A;  1BI1 A;  2FSW A;  5DYM A;  5FD5 A;  2IRF G;  2L4M A;  1BI2 A;  4M6X A;  2ZFW A;  3R61 A;  4KIF A;  2L54 A;  3J80 K;  4G6D A;  2PLY A;  1RUO A;  4NQW A;  4WXD A;  4G6Q A;  4B09 A;  3LA7 A;  3F3X A;  1OKR A;  2QWW A;  4IRH A;  4N9H A;  3LQQ A;  2CFX A;  4PZJ A;  3E5U A;  1P4W A;  1FT9 A;  2KKO A;  3ZN0 A;  2D45 A;  4Y15 A;  1OYI A;  3DPT A;  2AXL A;  2IA0 A;  5EEH A;  1YW9 A;  4HW0 A;  1T6S A;  1ZH5 A;  4OMY A;  2PJP A;  4WXC A;  1IRF A;  2ELH A;  2D1V A;  4RB3 C;  2M1B A;  3HSR A;  2HR3 A;  1O7L A;  3GFL A;  3K69 A;  4YFN F;  5E20 A;  1LVA A;  2DO7 A;  2P4W A;  1LEB A;  4MTD A;  3GYH X;  5BMZ A;  3KP7 A;  4ENN A;  1YS6 A;  2HYG D;  4ESJ A;  5E8G A;  1T38 A;  4FX4 A;  1RZ4 A;  2HTS A;  2XIG A;  3MZH A;  1J59 A;  4U0Y A;  1IN4 A;  3GZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...