2P7CB

Solution structure of the bacillus licheniformis blai monomeric form in complex with the blap half-operator.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESDYIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational and thermodynamic changes of the repressor/DNA operator complex upon monomerization shed new light on regulation mechanisms of bacterial resistance against beta-lactam antibiotics.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Transcription regulator
molecule keywords Strand 1 of Twelve base-pair DNA
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p7cB00
1FP1D 5HDGA 1LJ9A 2PMHA 1O3SA 3CO7C 2IP2A 3NQOA 4EM0B 3J81Z 3EYYA 4Z2YA 2ZJ2A 1H9TA 4ZZDA 1JHHA 2D2WA 1QPMA 2XHKA 1Q1HA 2OD5A 2KJCA 2BV6A 4M74A 1TTYA 1W7PA 5DD4A 4LB6B 2A61A 4A5NA 2A3SA 4YFKF 3AAFA 1QQIA 2JSCA 1FPQA 2O03A 3BOQA 1ZN2A 3EUHA 2FBIA 4L9TA 2MA3A 3B02A 3RPUA 2VBYA 3DEUA 3HRTA 1OKRA 2QVOA 2VXZA 2F5CA 3F8CA 3F23A 2NNNA 4QWQA 4BXUA 4LLLA 4BAYA 4CXFA 1B1BA 1FBUA 4HA8A 2ZCWA 4UV9A 3M8FA 5DYMA 1E17A 2GA1A 2W25A 3F6OA 3TOBA 3TO6A 2PFBA 4U0VA 1SAXA 2QENA 2KIMA 5FD6A 3ABTA 4I98B 2RDPA 2A5YB 4K2EA 2XUBA 1Z1DA 3F3XA 3R4KA 1UHMA 4UXNA 1TQMA 5FB2A 3LAJA 1IXCA 2X0LA 1R1TA 2QQAA 1D8JA 3ZMVA 2YR2A 2DK8A 3ECHA 3RI4A 4UVBA 3NEUA 3I5UA 2FE3A 1J0RA 1DPRA 2DW4A 4Q4ZF 4KNYA 2K4JA 1YLFA 1D5VA 2PG4A 4U0WA 2KIUA 4R1HA 1YO5C 3ZPLA 4M71A 4IF4A 3MQ0A 3WTUC 2G9WA 1REPC 5DCMA 3MCZA 1FBQA 1OYWA 3FF5A 3KP3A 2DLLA 4HX7A 2MLKA 4ZYDA 4RGRA 4PGHA 2D1VA 4HDVA 1HKSA 4WXHA 1BN5A 3F8MA 1XSDA 2QZ8A 4HV6A 4HX4A 1IN6A 3WU1B 2UXNA 5D4SA 1KU3A 4NB5A 3MAJA 2CQKA 1FBSA 1YTYA 1HKTA 2EA4A 1FY7A 2ZO4A 2UXXA 2MC3A 3V8KA 2HZTA 1FOKA 2AXLA 3COAC 5JI6A 4XSZF 3BP8A 5F64A 2O6GE 3BDDA 4IHTA 3L2CA 5LGUA 2P5LC 3R61A 4ZYGA 1O57A 1S7OA 3FM5A 3FM3A 3K69A 2XV4S 1RNLA 3U1DA 1FYMA 3TO7A 3I71A 1J75A 4G7ZF 1T38A 4B09A 4LJZF 2HKXA 4MNUA 1T98A 5BPDA 4OMZA 2PLYA 4YIFA 1J9IA 3J80Z 4L18B 2ACJA 2D1HA 2YU3A 2FXAA 5CVUA 1HSJA 1Z05A 4EVIA 2O8XA 3LAPA 5CVJA 3H92A 1U2WA 1RI7A 2GAUA 1USSA 4CYDA 1A04A 4ZH4F 5DDGA 3GUDA 2PI0A 2HTJA 3G3ZA 1JHFA 4IJAA 4PGGA 2P5VA 1FLIA 4L0YB 5ILSA 3GYHX 3E6DA 1X3UA 3K9TA 1IF1A 2XASA 4YG2F 1U78A 2W84A 1SFXA 1LEAA 1YG2A 1HSTA 4IRHA 3ROUA 5H6RA 2VBXA 3TDZC 1WI9A 2H09A 2EFOA 2LSOA 2MH2A 1S3JA 3ZQ7A 4EGZA 5D6EA 4KA4A 5A2QZ 3SHFA 4MEXF 2A69F 5LRRA 2V1DA 4F7ZA 4CDGA 1GVJA 3WU0A 3GFIA 2MD5A 3KEQA 4I01A 3KETA 1Z9CA 1YW8A 4EM1A 4GXOA 1KQ8A 3GW2A 4UVAA 4ON0A 1B59A 1B4AA 2EK5A 2FEZA 3TGNA 3R60A 2RNJA 4BHCA 3KP7A 1DDNA 2W85A 5D4RA 1PUEE 1P4AA 4IRIA 2O3FA 4EJWA 2R3SA 1TLHB 4RAYA 5HLHA 1IN5A 1MDMB 1IW7F 4IHSA 2DPUA 3HSRA 1WSUA 4CGZA 2EJRA 3LWFA 1I1GA 4M9XA 2P7VB 1QGPA 2GXBA 5L3FA 1P92A 3HOSA 2K7LA 3ABUA 3CUOA 3ZN1A 1Z6TA 4MEYF 1JXSA 1FP2A 2UZKA 5TRDA 2FNPA 1HQCA 3J80K 3F8NA 1XCBA 1KU2A 4GYIA 1CF7B 5E8GA 1TQPA 5DUKA 1S6LA 1XGSA 3LA7A 4AWXB 5D8KB 2DAOA 5FFXA 4BHPA 4I7HA 5DD8A 2ETHA 1BOAA 2V9VA 5HS7A 4I0BA 3B73A 2VOOA 1FWZA 2PBIA 4ASNA 5JFRA 5JVTA 2B0LA 3V7RA 1ON1A 4G7OF 1STZA 1G3TA 3RIRA 5FLXK 1QNTA 2H6BA 5ICEA 2XROA 3DPTA 2M30A 4HW0A 4RB1A 3HRSA 2ESNA 5HS9A 3GZ6A 4HV5A 4U88A 1RIOH 3I54A 1LEBA 2O0YA 1K78A 1O3RA 1ZHFA 2C6YA 2XKPA 1USTA 4UUVA 2MLGA 3HOTA 1FT9A 4A5MA 1BI3A 2IPQX 2ZNYA 1ONVA 3KEOA 1R36A 3CUQC 3WGGA 1BI0A 1SFEA 3I59A 3E3VA 2ISZA 1S29A 5IT9K 4A12A 3GX4X 3HRMA 2P8TA 1R58A 3GEZA 4JBAA 4WWCA 5K5QA 3K1PA 2EV5A 3F6VA 3ELKA 2QQ9A 3ZMDA 2VE9A 1G3SA 2H6CA 3E5XA 1R00A 2IRFG 5HDKA 3CUQA 4ENJA 2E7XA 1MJ9A 3WGHA 1KU9A 3QAHA 4NQWA 5E20A 3IRQA 1U5TC 3LA2A 5HS8A 1EH6A 2YX4A 2HWVA 4ESBA 2XRNA 1HW1A 3VODA 1BC7C 3R0AA 3IWZA 1ZLKA 3TOAA 1LDDA 4CHUA 2VT2A 4KICA 4DNCA 1ZGJA 1XSVA 1T0FA 2BGCA 4CZZA 1OR7A 1EH8A 1U5TB 1IN7A 4RB0A 5D5VB 1XDUA 1QZYA 1U6GA 2H27A 2PEXA 1V4RA 3BY6A 1K79A 4FX0A 4JQFA 1F1ZA 3HSFA 2HKOA 2JTVA 4KDPA 1G3WA 3KP2A 4KIFA 5J8FA 3M9AA 1RUOA 2PMUA 3U2RA 2XIGA 3JAMK 2ZXJA 1I1SA 2EFPA 3QPTA 3KFWX 5L3DA 4BH9A 5K1YA 2YPRA 4I0AA 3C1DA 5H6QA 2EV0A 2JZYA 3H3UA 4I2OA 1FNNA 3FHZA 4LK1F 1Z6RA 3SFZA 3CJNA 2Z33A 4KN4X 3P9KA 4Q48A 1TNSA 3DKWA 5LHIA 3GLXA 3HHHA 2IVMA 4FX4A 1IRFA 1KU7A 5ILVA 2M8EA 5FD5A 1SFUA 2V6CA 3CTAA 5LEKA 3GXOA 4I09A 3SQNA 3ZMTA 5AONA 3KZYA 4EM2A 4ZYHA 3L7WA 2K4BA 4RB3C 4A6DA 1S8NA 3GFJA 3V8JA 5L3EA 4A0YA 3VEPA 3E6CC 5HDNA 2XGXA 3IRRA 2Y75A 2Z99A 1V3FA 4YFXF 3WG9A 3I59B 4LG0B 3TDUC 4QLCU 1YIOA 3LQQA 3BZ6A 3DQVC 4OIPF 1I27A 4UNOA 3ECOA 1L3LA 2W24A 2VT3A 2G7HA 4HOBA 5D5UB 4A0XA 2IW5A 2ZNZA 3CUQB 4LGWA 4ENKA 5EEHA 2L4MA 2Z5UA 3W6KB 2ZMEB 4ENMA 3ISPA 1ZREA 3TQNA 1PP8F 2WV0A 3D0SA 5E1XA 3E6BA 1BIBA 3ZN0A 2WWYA 3P9CA 3T1BA 4HF1A 2FRHA 2CO5A 3FMSA 3MFKA 4MTDA 2VE8A 4HX8A 3F8FA 1WRJA 5HLGA 3WTXC 2UWMA 2VN2A 1XB4A 4LB5A 3Q9SA 6PAXA 2L01A 4EGYA 2AS5F 3WTWC 4EV0A 2OQGA 1OPCA 4DQ2A 2W57A 3V7CA 2BE5F 5DCMB 5FGMA 2DQLA 2XAJA 1R1VA 3E97A 2VOPA 4R79A 4LK0F 2FQ3A 1TW3A 3VB2A 2DI3A 3QU6A 4MGRA 1XGOA 3FZVA 4M9ZA 3S2WA 2VC0A 5LGNA 3U9GA 1WWXA 2HQNA 3JTHA 4AIKA 4OIQF 5CLSA 2OZ6A 3D5LA 3ZMUA 2OAZA 4ZZLA 2JPBA 2CG4A 1SD7A 4Q5SF 5E1WA 1YW7A 1XMAA 1K7AA 3PFIA 2WTEA 4N9IA 3BWGA 2ELHA 2OA4A 2DFIA 1FSEA 1OYYA 5KK1A 2E1CA 3RPQA 4U7BA 2FBKA 1IUYA 1UFMA 2A6EF 2IA0A 3FX3A 4AIJA 2K27A 3WTVC 2F2EA 3N97A 2WC2A 4ENNA 3EETA 4PCQA 3TKYA 3I4PA 2PJPA 5ED4A 1XD7A 3IC7A 5HOOA 4L5IA 2A6HF 1B9NA 3G73A 4ESJA 1O7LA 2XAGA 2ADUA 4LLGF 1XGMA 5IT9Z 4I02A 2R7DA 1XDSA 3IKTA 4L9VA 2EWNA 4A2UA 1XGNA 3IHUA 3OOPA 2QWWA 5ICFA 2RKHA 4IPAA 1ZG3A 3CDHA 4N9HA 2M45A 3BROA 1I6XA 3T8RA 1FSHA 2BEOA 5LEJA 1SD4A 3L09A 1I5ZA 4LLNA 3ML6A 2PQ8A 1IRGA 3ZP5A 3E5UA 4KYWA 1YQAA 4M9SA 4LG0A 3R0JA 3WTYC 1F9NA 3GZ5A 1LDKB 1R23A 3CLOA 2F5DA 4G6DA 1KYWA 1T39A 1ZARA 1ZGAA 2XKOA 1ZG5A 3BPVA 3JSOA 2HGCA 3WE3A 3FMQA 4O5VA 5EEGA 3QP6A 3HHGA 1J2XA 2VODA 2XAFA 1XSXA 2M1BA 3E6MA 2EV6A 4OINF 1KQ0A 3BJ6A 1IZ1A 1R22A 1DUXC 1OYIA 2Z3YA 2QBYB 2GWRA 1GXPA 2ZFWA 4M73A 4CO8A 3KLNA 3KP5A 1Y0UA 5HVQC 4FHTA 2QUFA 1IN8A 5ICGA 3RKXA 4YIIA 3H3ZA 2QYOA 4HDUA 3N4MA 4KMUX 3V8LA 1SMYF 2JPCA 3GFMA 1IN4A 2CSOA 3V4GA 1ZRCA 4BHBA 4M72A 2PN6A 2F5EA 1BJAA 2L4AA 1MD0A 2V79A 2GIVA 2Y0MA 4HAMA 2HEOA 5E17F 2Q0OA 4OU0A 5L3CA 3I58A 1W5TA 1TNTA 4UVCA 5E1ZB 4MTEA 4XSXF 3BJAA 2FU4A 5FO5A 4BYYA 2L3DA 3HUGA 1PP7U 5DCFA 5J8CA 2HS5A 1F4KA 5L3GA 2E1NA 4FT8A 3JTGA 1AOYA 2KKOA 2RV8A 1RUNA 1UB9A 1QO0D 3SZTA 1W4MA 3R6SA 2EFWA 4LFUA 2Q8KA 4EJOA 3KZZA 1WKMA 3WODF 2RVCA 3BPXA 3QU3A 4JK1X 1G4DA 3JSPA 3WTTC 1FYKA 3RKYA 4WCGA 2VBWA 1NHAA 3DFGA 3E5QA 4GCVA 1UCRA 5FFZA 5BMZA 1TW2A 4OMYA 5CJ9A 1ZG1A 4KIBA 3O3KA 3ZMSA 2R7FA 2HDCA 4IRGA 3RYRA 1J5YA 3IL2A 3GFLA 5DEQA 4RS8A 1SD6A 2ISYA 4MHGA 4WF2A 3L00A 2OQRA 1XCVA 5ILUA 1FZPB 3LSTA 2CGPA 2OZUA 3DP7A 3RDIA 3C7JA 4A6EA 4XLPF 5LLQA 1AWCA 3PQJA 2DQRA 1GHCA 2FMYA 3HSEA 4Y13A 4AIHA 3RTRA 2GZWA 2QM3A 1ULYA 2CWEA 4RGUA 1HXDA 2DU9A 1CGPA 5D5XB 3QP5A 2BYVE 2XVCA 3FXRA 2IJLA 1EV7A 1D3YA 2XAHA 3K1MA 1Z91A 5J6XA 3BJOA 4HQEA 2CYYA 2HYFA 1S7AA 3T8TA 4OIRF 5D8LB 3DXJF 5HLIA 5TJJA 2A07F 5K5OA 1QBJA 3KP6A 3M8EA 5CVIA 4TV7A 5AIPA 1DPUA 2MBFA 4U0YA 3GF2A 1Z7UA 1KYZA 4WXDA 4P9FA 2BBYA 1FYLA 4G7HF 1HBXG 5JR3A 3WE2A 2K86A 3DF8A 2NNYA 3HYIA 1HKQA 5A2QK 2KIFA 1UHWA 3HIFA 4LMYA 1HW5A 5H20A 1JGSA 4UV8A 1U8RA 4Q47A 2V1UA 5E8IA 2GQQA 1P6RA 1L0OC 2RN7A 1MJAA 2STTA 3LQRA 2HOEA 1MKMA 3P7NA 4WXCA 3JW4A 4NHJA 2DK5A 3RJPA 4G9YA 5K5RA 3REOA 2H94A 1U5TA 2LDUA 4U7DA 5CVVA 4P55A 1SD5A 1T6SA 2STWA 1ZYRF 2ZBKA 3F72A 1KA8A 4HZFA 1VTNC 2EFNA 3F8BA 4L9NA 1WQ2A 3GVAA 4LD5A 3RYPA 2L54A 2P6TA 3RKWA 3HRUA 1DP7P 2P6SA 5BQTA 1XMKA 2LF8A 3QOPA 3QRFF 3KE2A 1G3YA 1U3EM 2L02A 3KCCA 5LBQA 4EMSA 5ICCA 4L0ZB 2ESHA 2DBBA 2ZMEA 2M5WA 1GXQA 3J81K 1YFHA 1R7JA 1P4XA 2HYGD 1YS6A 3VFZA 2KJBA 3MZHA 3EQLF 4BNCA 1SMTA 3KP4A 5D6FA 1R1UA 2NAZA 1R5GA 1BI1A 2X4HA 1K6OA 4A0ZA 2RC4A 4P5OA 3P9IA 4IVNA 2DPDA 5DUIA 3K1NA 3Q9VA 1LDJA 4RGSA 1XN7A 2J5OA 2NS0A 3FWEA 4HQMA 2XAQA 3F22A 1YW9A 3HTSB 4P9UA 4L9JA 2KRFA 2ZKZA 4PDKA 4PZJA 4OIOF 1FX7A 3I0TA 1O3QA 5LRSA 4YFNF 4E70A 2CW0F 4MQVA 4WK8F 1MJBA 1TBXA 3WTZA 1ODDA 4RB2C 2EA2A 2GA2A 3SZPA 2IA2A 4GO1A 4KT5C 1ZRDA 2IA1A 2J5PA 3W6JB 2QLZA 1ZH5A 3FXQA 1MDMA 4HLYA 5L3BA 3HTUA 5CYVA 2GXGA 2Z9OA 4O3MA 2FSWA 2HR3A 5LGTA 2P7CB 2LF7A 4WX9A 3KLOA 2FF4A 1BM9A 2FOKA 5BPIA 2COMA 3T0YA 3C3WA 2MH9A 4HYEA 4RAZA 1D8KA 3GO5A 3MEXA 4O6JA 1CF7A 3M1EA 3DV8A 1BBYA 1ZAOA 5D5WB 1BC8C 1J59A 3PQKA 1FC3A 3C18A 5F1RA 4EJUA 4B8XA 2NYXA 1W5SA 4M6YA 4R8HA 4Y17A 1LNWA 1IXRC 2EFQA 5LHGA 2VBZA 1ZRFA 2DT5A 5BS6A 1OMIA 2DO7A 3K0LA 3MZYA 4S05A 1H9GA 4KIGA 1R5HA 1QZZA 3CO6C 1HW2A 4L5JA 3OV8A 3SXYA 1IXSB 1G6NA 3M7GA 3O2PE 2QQBA 4UHTA 4G94A 3JAMZ 2YSRA 2HQRA 2Q2EA 1LB2A 1K78B 4GGGA 4HBLA 4RGXA 4N0BA 1BI2A 3V7SA 2JT1A 4H0EA 3O6BB 2JRTA 1RZ4A 3Q5FA 4BQAA 1H0MA 3LFKA 4ETSA 3K2ZA 1J7KA 2CFXA 2OBPA 3TO9A 4KUMA 2EB7A 4AVPA 1O7FA 3I64A 3DPLC 3F21A 3EYIA 5F6FA 5LHHA 5BOXA 3FXUA 3MWMA 1W7PD 4KMFA 4ESFA 2LKPA 1PDNC 4ZYEA 4D0PA 3I53A 2FNAA 3GWZA 1KGSA 4HF2A 4KN7X 2QBYA 1IAWA 4HLXA 2VONA 2YX7A 2IT0A 2A68F 5CVRA 2Y48A 3NRVA 2RGVA 3LA3A 4MQ9F 1B9MA 2FBHA 4OOIA 1JE8A 4GYGA 4G8XA 3IWFA 2LNBA 3QPHA 2E7WA 1LVAA 4XLNF 3J7AO 1P4WA 3T5XA 4Y15A 1P2FA 1E2XA 4EJTA 2P5KA 1O3TA 5E18F 1W7PB 1F5TA 3WGIA 3ERED 4M6XA 1T2KA 1MGTA 5DV5A 2D45A 2OU2A 2V1XA 2P4WA 1MZBA 2O61A 3VOEA 2K02A 2HTSA 2TDXA 4EJVA 4IXAA 3WTSC 4S04A 1BIAA 1EH7A 1LQ1A 2DTRA 4KFCA 1YS7A 3EDPA 5JHUA 1C0WA 5IT3A 2VC1A 5KVRA 2HFHA 2FA5A 3ULQB 1ON2A 2M87A 4XBFA 4CICA 4P96A 1YYVA 5FLXZ 3ZMZA 3FMRA 2FMLA 3L9FA 1TQIA 3IKVA 2G7UA 5AIQA 2NRAC 4G6QA 4HF0A 4EQQA 5ERIA 1B6AA 1ZLJA 1KQ9A 2RQPA 2F5FA 4XRFA 4AD9A
chains in the Genus database with same CATH superfamily
4NQWB 1FP1D 2BVMA 3FDYA 5HDGA 3L2UA 1LJ9A 2PMHA 5JLXA 1ZQ3P 1O3SA 2HPIA 1KONA 1LVKA 2DYSH 3CO7C 4IHXA 2IP2A 3CQZJ 1QVUA 3ASOH 3NQOA 5J1YA 4EM0B 1GVDA 3J81Z 4NC7A 3EYYA 2ZJPF 4Z2YA 4MIMA 3H9GA 2X85A 3PL8A 2ZJ2A 2W48A 1H9TA 3BLYA 4ZZDA 1JHHA 2D2WA 3HPGA 2JA5J 1QPMA 2XHKA 2JRMA 1Q1HA 5EZGA 3KPHA 2OD5A 1QRYA 1X3WB 1DP3A 2KJCA 2BV6A 4M74A 3TP0A 3ABLH 2UUZA 1TTYA 1W7PA 5DD4A 4EEFG 4C2MJ 1JI8A 1YIJI 4LB6B 2A61A 1YX5A 3GCMA 2QQ8A 3FXOA 3VWBA 4A5NA 2A3SA 4YFKF 3AAFA 3AG2H 3LOCA 1QQIA 3D1NI 2JSCA 1FPQA 2O03A 3BOQA 3B6CA 1ZN2A 3EUHA 3KX2A 4N4NB 5EEAA 2R7RA 2FBIA 4L9TA 2MA3A 4XRSG 3TW7A 3B02A 4BJ6C 3RPUA 1BJZA 2VBYA 3DEUA 1WH5A 1OKRA 3HRTA 1TT0A 4PSXA 2QVOA 4BXXJ 3OYAA 2VXZA 4RA2A 4D9JA 1FEXA 3CJRB 2F5CA 3F8CA 3F23A 2NNNA 1V5FA 2EZKA 4QWQA 3HGGA 4M3BA 4LLLA 4BXUA 1N78A 4XONA 4BAYA 4CXFA 1B1BA 4JX4A 1ZR2A 2ZXWH 1FBUA 2K9NA 4C3IJ 1MSEC 4HA8A 2ZCWA 4UV9A 1LKXA 1TWGJ 1JT6A 3M8FA 1S5LC 1W0UA 3G6EI 3OYHA 5DYMA 2BY3A 2IS6A 4Y7NJ 1E17A 1E3OC 3MKLA 1VQ7I 1LPQA 1G2HA 2GA1A 2RAEA 1GUUA 2W25A 4XR6A 3F6OA 5EGOB 2PX9A 3Q0VA 3S3OA 3TOBA 5IYDJ 3K4KA 3TO6A 3HPHA 2PFBA 4U0VA 4KITB 1SAXA 3ZQQA 2E19A 2QENA 1WZ2A 1W36D 2KIMA 5FD6A 2XF5A 4XMYA 3ABTA 4ZTFA 4I98B 2RDPA 2A5YB 4K2EA 2XUBA 1Z1DA 3F3XA 1UZCA 4LG3A 3R4KA 1UHMA 4UXNA 1TQMA 5FB2A 3LAJA 3LSMA 1IXCA 2X0LA 3NAUA 1R1TA 2QQAA 2VQCA 1D8JA 3ZMVA 2YR2A 2DK8A 3ECHA 4HEA2 3RI4A 1ACIA 3QYEA 4UVBA 1PJRA 3NEUA 1JTYA 2GIZA 3HKZN 3I5UA 2FE3A 1J0RA 1DPRA 3VSLA 5HNFA 2DW4A 3C2BA 4M6VA 3MD2A 4B3AA 1WGXA 4Q4ZF 4KNYA 5JLWA 2DA1A 2K4JA 4RAGA 5KCMA 2QEXI 1YLFA 1D5VA 2PG4A 4U0WA 2KIUA 4R1HA 1YO5C 2AO9A 4M71A 3ZPLA 2NVTJ 4IF4A 1MSFC 3MQ0A 4AD9A 3WTUC 2G9WA 1VQPI 2HYJA 5J4VA 3LSJA 1REPC 4C2UA 3KEYA 5DCMA 2E2HJ 3CF2A 1U9NA 3MCZA 4LOCA 5CQEA 2LD5A 3ABKH 3FK6A 1CQTA 1FBQA 5B66C 1OYWA 3FF5A 3WG7H 3KP3A 3I4MJ 2DLLA 2V9PA 4HX7A 1SAUA 2MLKA 5GAGJ 4ZYDA 4RGRA 4PGHA 2JJ7A 2D1VA 4HDVA 1QA6A 3UKGA 4A3FJ 1HKSA 1K4TA 2WB1A 1T0FC 1WJFA 3DCFA 4WXHA 1BN5A 3F8MA 4OAYA 1XSDA 4BQQA 2QZ8A 4B3XA 4MFEA 4I99C 4HV6A 4HX4A 1IN6A 3WHCA 3FXLA 3WU1B 3OYDA 4AU7A 5C44J 2B9SA 4Y4RA 2ZSHB 2LK2A 2A6TA 2UXNA 1MBEA 4BBRJ 5D4SA 5H2FC 1KU3A 1TP4A 4NB5A 3MAJA 2CQKA 3MKWB 2ID6A 2DDAA 1FBSA 3BTIA 1YTYA 1HKTA 2EA4A 2O8KA 4BDZA 5E79C 3H5NA 1RETA 3LSHA 1FY7A 2ZO4A 2UXXA 5EYRA 2DA2A 2M8GX 2MC3A 3V8KA 2HZTA 1FOKA 2AXLA 4IOCF 3AG3H 5JI6A 3COAC 5EG0B 4V2GA 2LC2A 3DU6A 4XSZF 1FOXA 2F6CA 1TWAJ 4L5EA 2X6WA 3BP8A 5F64A 2O6GE 3BDDA 4IHTA 3TMOA 5EGOA 3L2CA 2DFEA 5LGUA 2P5LC 3GTGJ 1P7IA 4CCLA 4XKCA 3R61A 4ZYGA 1MMNA 2E34A 4H4KC 2LH9A 1O57A 3SEQA 1S7OA 1UG0A 4DBRA 3FM5A 3FM3A 4M3GA 5FROA 5M3FJ 3K69A 2XV4S 1RNLA 3U1DA 1FYMA 3TO7A 3AKZA 3I71A 1WI3A 3PNVA 2HVSA 3PIPF 1J75A 1OQYA 2QKLB 4G7ZF 1T38A 1G59A 4B09A 4LJZF 3BG9A 2HKXA 3G71I 5IOYA 2ZJQF 1S72I 1H8AC 4MNUA 1T98A 2K85A 3F0CA 2DMPA 2LTPA 1SANA 5BPDA 2X9DA 4OMZA 1R4NB 5DTDA 2PLYA 2QKMB 4YIFA 1J9IA 3J80Z 4L18B 2ACJA 2D1HA 2YU3A 3A01A 2KDOA 4AVZA 2FXAA 5CVUA 1HSJA 2Y0SA 1Z05A 4EVIA 2O8XA 3VYTB 2HPMA 2XSDC 1OFCX 4OAZA 3LAPA 5CVJA 3HBLA 3H92A 2CQQA 1U2WA 2EH3A 1DQUA 1J09A 1RI7A 2GAUA 3SJMA 2DOFA 1USSA 4CYDA 1A04A 4ZH4F 5DDGA 3GUDA 2PI0A 4B44A 2HTJA 4ZJZA 3G3ZA 1JHFA 4IJAA 4PGGA 1A6QA 2OTLI 2P5VA 2RNGA 1FLIA 4L0YB 5ILSA 4XN0A 4I6ZA 3GYHX 2M4GA 4NBQA 4HSRA 1X19A 2FX0A 1JT0A 3E6DA 1X3UA 3K9TA 2DMUA 2ME6A 1IF1A 5GPAA 2XASA 3IP4B 4YG2F 2W84A 5GPCA 1U78A 4V19K 3LL7A 5FLMJ 2KISA 2EINH 1R49A 3OYGA 2X48A 1I3AA 2Y9YA 1SFXA 1LEAA 4LITA 2PJRA 1YG2A 1HSTA 3K70C 4IRHA 2GOMA 3ROUA 5H6RA 3H3VK 1IV8A 2VBXA 2M4KA 4BDYA 1RC9A 3TDZC 1YI2I 3S17J 1WI9A 2XF7A 1FOYA 2H09A 2EFOA 2LSOA 5IP6A 2MH2A 1WJAA 1S3JA 3ZQ7A 4E6KG 3W6VA 5HODA 3K70D 1RESA 3JCUC 5D6EA 4KA4A 4EGZA 4BE1A 5A2QZ 4FE7A 1BL0A 3SHFA 3ZXSA 4MEXF 3CCYA 2A69F 5LRRA 2V1DA 4E7JA 4F7ZA 4CDGA 2LYCA 1GVJA 2Y0SN 4OWRB 3WU0A 2A5WA 3GFIA 2K9SA 2MD5A 1GT0C 2R5YA 4BY1J 2N8GA 3KEQA 4I01A 1H88C 3E1SA 1X2NA 3TBIA 3KETA 1YW8A 1Z9CA 4EM1A 4GXOA 3I4NJ 1KQ8A 3GW2A 2HDWA 4UVAA 4ON0A 4YELA 1X1CA 1B59A 1B4AA 2EK5A 3VSKA 2FEZA 3BC8A 3TGNA 3R60A 2RNJA 4BHCA 2E5ZA 3D5RC 2R7XA 3KP7A 3VPRA 1DDNA 5DM6F 2W85A 5D4RA 4MO7A 1PUEE 1P4AA 3GZNB 2MG4A 3OSFA 4JYKA 4IRIA 3GMEA 2O3FA 4EJWA 2LVSA 5F27A 2BW3B 2R3SA 2ELKA 1TLHB 4RAYA 5HLHA 1IN5A 1YOVB 3CCLI 1MDMB 1IW7F 3ZQHA 4IHSA 2ZB9A 2DPUA 3HSRA 1ERDA 4MFDA 1WSUA 1A6IA 4BL0B 2LR8A 2ZXIA 4CGZA 2EJRA 4DOZA 3Q0WA 4W1UA 4XLAA 3LWFA 1I1GA 4M9XA 2P7VB 4JP0A 1QGPA 3SEZA 2GXBA 5L3FA 1P92A 2JA7J 3HOSA 3LNQA 3DLLF 2VI6A 2K7LA 3ABUA 3CUOA 3ZN1A 2PMZA 1Z6TA 4MEYF 1JXSA 4XLEA 1FP2A 3BZCA 2UZKA 5TRDA 5J40A 1V5GA 2FNPA 1HQCA 3J80K 3F8NA 1NK2P 1BOBA 1XCBA 1KU2A 4GYIA 1CF7B 5E8GA 4ZC3A 1HDPA 1TQPA 2DJNA 4GRIA 5DUKA 4A69C 1S6LA 1XGSA 3LA7A 3VYSB 2JA8J 3A0BC 4AWXB 5D8KB 4E7IA 2WAFA 4CCOA 5IYCJ 2DAOA 5FFXA 4BHPA 2OPTA 4FTHA 4I7HA 4PJ0C 3OR1C 3PSIA 5DD8A 2ETHA 2TCTA 1BOAA 2V9VA 2XC7A 3RKQA 5IPAA 1OJLA 5CKTA 3K4CA 5HS7A 2Z16A 4I0BA 3EUKL 3HDDA 2Z1DA 4PFOA 1YJ9I 3B6AA 3B73A 2VOOA 1PYVA 1FMWA 2JK3A 1FWZA 2PBIA 3OYFA 3DLAA 3TL4X 2FD5A 2H8WA 4ASNA 5JFRA 5JVTA 1MW7A 2B0LA 1X4PA 3V7RA 1ON1A 4G7OF 1NTCA 1STZA 1G3TA 3RIRA 1ZR4A 5FLXK 1QNTA 5EF6A 1FIPA 2H6BA 5ICEA 3S16J 1T33A 2XROA 3DPTA 3GBGA 2M30A 2A05A 4HW0A 4RB1A 1WH7A 3HRSA 1U8BA 2ESNA 3QYBA 5HS9A 3GZ6A 1VQ5I 4HV5A 1W1WE 3K4MA 4BGDA 1WCMJ 4U88A 1RIOH 3I54A 1LEBA 3ZQGA 3HEFA 5FJ8J 2O0YA 1K78A 1O3RA 1ZHFA 2DXIA 2C6YA 2XKPA 1USTA 3K4LA 4UUVA 2MLGA 3C2HA 3HOTA 1FT9A 1RR7A 3JRDA 3GTOJ 1MBFA 4RLFA 3CCUI 2MC4A 4A5MA 3ZQLA 1BI3A 2IPQX 2ZNYA 1ONVA 3KEOA 1R36A 2I10A 3CUQC 5EDNA 2WY8Q 3DWLE 3WGGA 1JJ6C 4XLHA 2P0WA 3HOUJ 2K5CA 2COBA 1SVMA 1BI0A 2OCCH 3H5AA 2HOSA 1SFEA 3PUFA 1VZ0A 3G2BA 1K6YA 3QPLA 3I59A 2L9VA 3E3VA 2ISZA 1S29A 2R5YB 5IT9K 4A12A 4CCMA 3GX4X 3HRMA 1VI0A 2EBIA 4UB8C 2P8TA 1R58A 3GEZA 3BG7A 4JBAA 4WWCA 2DTZA 5K5QA 1WJBA 3K1PA 2EV5A 5JVGF 3F6VA 3ELKA 3H9JA 2X51A 2QQ9A 3ZMDA 2VE9A 3DEEA 2VLAA 1Y39A 4CCNA 2X1EA 3A4CA 1G3SA 2NVXJ 2H6CA 2H1LA 2NXNB 4RLQA 3V42A 1SC7A 3DTEA 3E5XA 1R00A 3PUBA 2QGUA 1JKQC 2IRFG 2BOLA 3MZ8A 3JRCA 5HDKA 3CUQA 4F52A 4CZCA 4ENJA 2E7XA 2VASA 1MJ9A 4IL6C 2ZFUA 3U21A 4I76A 2ICWG 1RKTA 2HOAA 2XRLA 4KISA 3WGHA 1KU9A 1VQMI 5M5XJ 1O4XA 3QAHA 3OYIA 4NQWA 3I3LA 5E20A 3IRQA 4FE4A 2VQHA 1U5TC 1UG2A 2XB5A 2WBMA 1NH3A 3CLQA 3LA2A 5HS8A 1EH6A 2YX4A 2HWVA 4ESBA 1JUPA 4XORA 1IDYA 2XRNA 3ZOBA 2E36A 2E5NA 4N4OB 1HW1A 3VODA 2OTJI 2CUZA 2DN0A 1BC7C 3R0AA 3IWZA 4PFPA 4E7KA 2GBYA 1ZLKA 3TOAA 1LDDA 4A3GJ 1MNEA 4CHUA 2VT2A 4KICA 4DNCA 1ZGJA 1XSVA 4FISA 1T0FA 2BGCA 4CZZA 2W1OA 1OR7A 2DFFA 1EH8A 1U5TB 1HLVA 1XG1A 1IN7A 4RB0A 1AA7A 1Y1WJ 5D5VB 1QZEA 1XDUA 1QZYA 1HDDC 4HG2A 4W97A 4D7NA 1U6GA 1A36A 1ETYA 1N77A 4EATA 2H27A 2PEXA 2DJIA 2IAIA 3CMEI 2KZVA 2M9HA 1D1AA 4FETA 4XM3A 3GTKJ 1V4RA 4BXFA 3OYEA 3BY6A 1K79A 1MMDA 4FX0A 4JQFA 1ORKA 1F1ZA 4FQGA 4PJLA 3HSFA 1YX3A 3PO3J 5CQGA 2HKOA 2JTVA 4KDPA 1G3WA 3IAM2 3KP2A 4KIFA 4AYBN 5J8FA 3S1QJ 1WJDA 3M9AA 4AIDA 2PMUA 4C30A 3U2RA 1JKOC 1RUOA 3LSKA 3J7ZI 3ZQFA 2XIGA 1D1BA 2E35A 3JAMK 1MBJA 2ZXJA 1I1SA 2EFPA 3QPTA 3L2WA 4UUSA 3KFWX 1X4OA 2E1OA 2L5QA 5L3DA 1TWFJ 3GTPJ 1E3PA 4BH9A 2DYRH 5K1YA 2YPRA 4XKWA 4I0AA 3C1DA 1A31A 4E4HA 3IH4A 5H6QA 3BZKA 2EV0A 3ZQIA 4DYQA 5GTIC 2KIQA 1U0JA 2JZYA 3H3UA 4I2OA 2B63J 1FNNA 3FHZA 4LK1F 1X58A 1Z6RA 3SFZA 1QHHD 3GTMJ 3W2AA 3CJNA 2Z33A 4KN4X 3P9KA 4Q48A 4YIRX 1APLC 1TNSA 3DKWA 2EIJH 5LHIA 3GLXA 4XKBA 2EZIA 3HHHA 3ZR8X 2IVMA 3X2QH 3L1PA 4FX4A 1IRFA 2LY1A 3RSNA 1KU7A 5ILVA 2M8EA 5FD5A 1RPWA 4RMNA 1SFUA 2V6CA 3CTAA 5LEKA 2MFZA 3GXOA 4I09A 3SQNA 2WA0A 3ZMTA 5FRNA 2L7MP 1JGGA 5AONA 4QSHA 3KZYA 4EM2A 4ZYHA 3L7WA 2K4BA 4RB3C 4A6DA 5KHDA 1S8NA 3GFJA 3V8JA 5L3EA 4A0YA 4AYBA 2DOAA 2BY0A 3VEPA 3E6CC 3PM1A 3CJTB 2Z2SB 3M8JA 5HDNA 2XGXA 1VNDA 3IRRA 2Y75A 4ZDOA 2ME0A 2Z99A 2L9SA 2DA4A 5BNGA 1V3FA 4X0GA 1K61A 4YFXF 4E7ZA 3WG9A 1T8IA 3I59B 4LG0B 2MD0A 3OL3A 3SDBA 3TDUC 1TZLA 2GXAA 4QLCU 1YIOA 3LQQA 2M2EA 1IG7A 4B1RA 2R7ZJ 3BZ6A 4QTRA 3UNGC 2BXYA 2GM4A 3DQVC 2VKHA 4OIPF 3E7LA 1I27A 4UNOA 3JRAA 3ABMH 3ECOA 2LKSA 5K7FA 1L3LA 2W24A 3OYJA 2VT3A 2G7HA 4HOBA 5D5UB 4XLFA 3PNTA 3CCMI 4A0XA 3HOVJ 1MBHA 2IW5A 3TP3A 4ZTJA 2DA3A 4NDLA 3IH3A 3BG6A 2ZNZA 1RRJA 3CUQB 1XS9A 2CV1A 1V55H 4LGWA 4ENKA 5EEHA 4J19A 2L4MA 1ETVA 2Z5UA 3QWLA 3W6KB 2ZMEB 4ENMA 3ISPA 1JUMA 1BW5A 3OYKA 1ZREA 3FBNB 3TQNA 5GP9A 2WV0A 4LIUA 3HG9A 3D0SA 1PP8F 5E1XA 3L2RA 4DBQA 1I50J 3E6BA 3DKXA 1BIBA 3EUAA 3ZN0A 2WWYA 3P9CA 3RZDJ 4BS9A 3T1BA 2V6EA 5J1UA 2EILH 3S2HJ 2ZJRF 2K9LA 4HNVA 2FRHA 1JKRC 4HF1A 2CO5A 5E3LA 2EPFA 3FMSA 1E0EA 1KZHA 4D5CA 4CYCB 1T56A 3MFKA 4XL9A 2HDDA 2GLOA 1S9HA 2E1MB 3G1MA 4MTDA 4BE0A 2VE8A 2VIXA 4HX8A 3F8FA 1AU7A 3H5RA 1WRJA 3KZIC 5HLGA 3WTXC 2UWMA 5IY5H 2VN2A 1XB4A 4LB5A 1B72B 3Q9SA 2WV1A 6PAXA 2L01A 5JHFA 3OS1A 4EGYA 2AS5F 3WTWC 4EV0A 2OQGA 3L2QA 1OPCA 3FBIB 2HI3A 2E60A 4BJTA 1D0YA 1GV2A 3SYTA 4DQ2A 3J7AY 2IGKA 2JVGA 4X6AJ 3S1MJ 2W57A 1I39A 2NS8A 3V7CA 2BE5F 5DCMB 5FGMA 1WJCA 5IP7J 2DA5A 2DQLA 1A35A 1Z77A 4AC0A 2DT6A 2XAJA 1R1VA 3E97A 2VOPA 4R79A 4IEJA 4LK0F 1TW3A 2FQ3A 2DDBA 1XPXA 2JQ7A 3VB2A 1ZTRA 2DI3A 2DMQA 3AG1H 3JRFA 3K7AJ 3CF5F 3QU6A 4MGRA 1XGOA 2QF7A 3FZVA 4M9ZA 3S2WA 1OCOH 3MVPA 2VJIA 2VC0A 5LGNA 3U9GA 4J00A 1RKWA 1WWXA 4DW6A 4HNTA 1M1EB 2HQNA 3JTHA 2E71A 4JOMA 4AIKA 2FOWA 4OIQF 5CLSA 2OZ6A 3D5LA 1X3ZB 4F92B 2XPWA 2LBFB 2DMTA 4PJNA 2K3PA 3ZMUA 2KL4A 2X6XA 2OAZA 3NWTA 1K83J 3ZGKA 4BUPA 4YRVA 1LFPA 2KZGA 4ZZLA 2JPBA 1SVLA 4RAFA 4BACA 3BT9A 2CG4A 1SD7A 1RR8C 4Q5SF 1NG7A 1Y56A 2R7WA 5E1WA 2AQEA 4Y52J 2L9NA 1YW7A 4D1QA 1XMAA 1ZK8A 1K7AA 3OS2A 3PFIA 2WTEA 4N9IA 3CESA 3K6GA 3BWGA 2BY2A 2ELHA 2OA4A 2ECCA 4DYRA 4XQFA 1W0TA 3EPZA 3S1NJ 2DFIA 2Q1ZB 1WJ5A 2XGEA 3U1KA 1MMAA 1Y8QB 2R5ZA 1FSEA 2EZHA 1OYYA 1P7JA 5HLTA 3VDXA 1Z0XA 4QPOA 5KK1A 2E1CA 3RPQA 3Q0UA 4U7BA 2FBKA 1ETQA 1UFMA 2A6EF 5CPRB 1IUYA 2IA0A 1Z3XA 2ELJA 3JRGA 1Q1VA 2OF7A 3FX3A 1LFUP 2PJRB 3CMYA 1Y6IA 4AIJA 1MBKA 2K27A 3WTVC 2ZC2A 2F2EA 1MH3A 3N97A 2WC2A 3PIOF 4ENNA 2L9RA 3EETA 4PCQA 3TKYA 3I4PA 5K7ZA 1BW6A 2FJ1A 3A01B 2PJPA 5ED4A 3OSGA 3DBLB 3O8GA 1XD7A 3IC7A 5HOOA 4L5IA 2KRHA 2A6HF 1YJNI 3S2DJ 1B9NA 3G73A 5M3MJ 4ESJA 1O7LA 2OC6A 2XAGA 3CP8A 2JUGA 2ADUA 2WB1N 4II2A 4LLGF 1XGMA 3CC2I 2DA7A 5B1AH 5IT9Z 4I02A 3JREA 2OCEA 1FTZA 2R7DA 1XDSA 1GLNA 3IKTA 4L9VA 2EWNA 4A2UA 5IP9J 3BG5A 1XGNA 1G8XA 3OWTA 4CCKA 3IHUA 3OOPA 2QWWA 2XDVA 5EJCA 5ICFA 4Z6YA 2RKHA 4IPAA 1ZG3A 2XSJC 3CDHA 5J4YA 1R6RA 2D5VA 2JMWA 2JSPA 4N9HA 2M45A 3BROA 3Q3SA 3S14J 1I6XA 3T8RA 2ZSIB 3GLLA 1FSHA 2ID3A 2BEOA 5FKLA 5LEJA 1TWCJ 1SD4A 3L09A 3OL4A 1I5ZA 3HXLA 1PUFB 1YHQI 2HZDA 4LLNA 1LFBA 2HOTA 2Y9ZA 3ML6A 4HPQA 4IKFA 1FTTA 2PQ8A 1IRGA 3ZP5A 1JKPC 3E5UA 4KYWA 1YQAA 4M9SA 2ECBA 2VL8A 3QOEA 4LG0A 2HNHA 3R0JA 1EKEA 3A02A 3WTYC 1F9NA 1NG6A 4E7HA 5E3NA 3GZ5A 1LDKB 1R23A 2YUSA 3CLOA 3DEWA 2F5DA 5DM7F 4G6DA 3LFUA 1KYWA 1T39A 1ZARA 1ZGAA 2XKOA 1ZG5A 2G0EA 4ZYAA 3BPVA 4NNJA 2DMNA 3CC7I 5M5YJ 3JSOA 1AKHA 2HGCA 3WE3A 2EQRA 3FMQA 4O5VA 5EEGA 3M4OJ 2LY2A 3QP6A 3HHGA 1J2XA 2FQ4A 3CDLA 3RPUD 2VODA 1IDZA 2LLKA 2XAFA 1R5ID 3CMAI 1XSXA 2R7OA 2M1BA 4HNUA 3E6MA 2R7SA 2EV6A 4OINF 4XIDA 3H0DA 4IO9F 3ESWB 4UUSB 1KQ0A 3BJ6A 1IZ1A 1R22A 2VJJA 1DUXC 4XLCA 1GV5A 1OYIA 2Z3YA 3NARA 2QBYB 4IQJA 2GWRA 1HC8A 4F55A 3PNYA 3I55I 2VQGA 2EIKH 3CZ6A 3ZRGA 4B4CA 1GXPA 2BZTA 2ZFWA 4M73A 4A3IJ 4CO8A 1POGA 3KLNA 3KP5A 1Y0UA 5HVQC 3D5SC 1MMSA 2QSHX 4FHTA 2QUFA 2K9QA 1IN8A 4BQOA 5ICGA 3RKXA 2WY7Q 1W5CC 3FK7A 2H1KA 2L7FP 4YIIA 3H3ZA 2QYOA 4HDUA 3N4MA 2K9MA 2VKDA 3WU2C 4KMUX 3V8LA 1SMYF 2JPCA 3GFMA 1IN4A 3S1RJ 5C3EJ 2CSOA 2MW8A 1VQLI 3ONQA 3V4GA 1ZRCA 4BHBA 5LFAA 1UELB 4M72A 4XNFA 3HZJA 2KMUA 2PN6A 2F5EA 3OR2C 1BJAA 3HM5A 1B72A 2L4AA 1MD0A 1OCRH 2GIVA 2V79A 2Y0MA 4F93B 2F4MB 3FKJA 1DGWY 4HAMA 3OIQA 4HRIA 2HEOA 1BR2A 2X6OA 5E17F 1D1CA 4A93J 3FISA 2Q0OA 4OU0A 4IHWA 5L3CA 2V1NA 1GDTA 3I58A 1I6HJ 2RQQA 1W5TA 1Y0NA 1TNTA 4UVCA 1IV6A 1R9TJ 5E1ZB 1SFOJ 4MTEA 4XSXF 1R4MB 1K4SA 4A3MJ 1SFKA 4KT6A 3BJAA 3HJEA 1VFCA 2FU4A 5FRMA 5FO5A 2CS3A 4BYYA 2L3DA 3HUGA 3UR3C 1PP7U 2NVQJ 3J7YJ 4XKVA 4YEJA 5DCFA 5J8CA 2HS5A 1F4KA 1UAAA 5L3GA 3S93A 2E1NA 4BBSJ 1QVTA 1VQOI 3LSGA 4FT8A 3JTGA 1AOYA 2LBFA 3MKZA 1X1AA 3IAS2 2KKOA 2RV8A 2LMDA 5F0CA 5J3LA 3A2KA 3PO2J 1RUNA 1UB9A 1QO0D 2BY1A 3SZTA 1W4MA 1FMVA 2F4IA 3R6SA 2EFWA 4LFUA 2Q8KA 5IOZA 4EJOA 2AXTC 1OR7C 3KZZA 2LFBA 2IGNA 2EIMH 1WKMA 2KLOA 3WODF 2W00A 2RVCA 3BPXA 1A5JA 3LSPA 2IS1A 3QU3A 4JK1X 1G4DA 4Y33A 3JSPA 3WTTC 2DA6A 1ENHA 2I5UA 1FYKA 3RKYA 2LG4A 2W82A 4WCGA 4A3BJ 1F43A 3PSFA 2VBWA 1NHAA 4RBOA 1BR4A 2XPVA 3DFGA 3E5QA 4GCVA 4JX6A 2BW3A 5C4JJ 1UCRA 5FFZA 5BMZA 3CCEI 3ZQCA 4GDFA 1TW2A 4OMYA 4G6TB 5CJ9A 4CYCA 1ZG1A 2KP6A 4KIBA 3O3KA 3ZMSA 2KRCA 4J01A 1Z21A 2JA2A 2R7FA 3DBRB 2HDCA 4IRGA 1HCRA 2LREA 3RYRA 1J5YA 2NOGA 4C3HJ 3IL2A 5DS9A 3GFLA 5DEQA 5FKNA 2X1DA 4RS8A 1SD6A 2ISYA 2F48A 4MHGA 1V5EA 2DODA 4CUGA 4WF2A 3L00A 2OQRA 1XCVA 3MN2A 1VF9A 5ILUA 3HB9A 2VJ4A 1FZPB 3LSTA 2CGPA 2OZUA 3DP7A 3BR2A 1QU3A 3RDIA 3C7JA 1DGRM 4A6EA 2M34A 3MMYB 4XLPF 3OOUA 4ITVA 5LLQA 1AWCA 4IQ4A 4DZJA 3PQJA 1XC5A 3RQIA 5KAFC 3A0HC 2DQRA 1GHCA 3HL2A 5GAEJ 2FMYA 2V9KA 3HKZA 3GTJJ 3I9V2 3HSEA 2R7VA 3CCVI 4Y13A 4AIHA 2L7ZA 2KDZA 5TISC 3RTRA 2GZWA 2QM3A 1ULYA 2CWEA 4RGUA 4DYCA 1H89C 1HXDA 2Y30A 2DU9A 2QCOA 1CGPA 5D5XB 3QP5A 2BYVE 2XVCA 4PK4A 1YJWI 3O8HA 4IOAF 3FXRA 2IJLA 4ZDPA 3HOXJ 2JN6A 3SDGA 4P1WA 3M3YJ 1EV7A 2KT0A 2NS7A 1D3YA 1LUJB 1WVRA 2XAHA 1FIAA 4C3JJ 3G1OA 3K1MA 2NVYJ 4IZZA 2YS9A 2DCEA 1X1PA 1IJWC 5F0FA 1MNMC 1Z91A 2VJ5A 5J6XA 2XF6A 3BJOA 4HQEA 2CYYA 2FUG2 3GTQJ 2HYFA 2H8RA 3I56I 1WPKA 1S7AA 3T8TA 1QPIA 4OIRF 5D8LB 3DXJF 2F5VA 4PJJA 3DBHB 5HLIA 5TJJA 2A07F 3N05A 5K5OA 1QBJA 4BQNA 3OYCA 3KP6A 2MSYA 3DTKA 3M8EA 5CVIA 2CH0A 1YRNB 4TV7A 2CW7A 5AIPA 4AUXA 1DPUA 2MBFA 4M3EA 1XMXA 4U0YA 3GF2A 4IX7A 5IYBJ 1Z7UA 1KYZA 4WXDA 1S7EA 4P9FA 1ETOA 5C4XJ 2BBYA 1FYLA 2XGCA 2JUCA 2L7KA 4ABZA 4M3DA 4G7HF 5JR3A 1HBXG 1TC3C 3WE2A 5GTHC 3JRBA 5FKOA 2K86A 3BQYA 3DF8A 3HYIA 3K4BA 2NNYA 5LD2C 4IHVA 1HKQA 4JX5A 5A2QK 2KIFA 3H9QA 1UHWA 3HIFA 4LMYA 1HW5A 5H20A 1VQNI 3OY9A 1JGSA 4UV8A 1U8RA 4Q47A 2VB6A 2CJJA 2V1UA 2QSFX 5E8IA 1MNDA 2GQQA 1P6RA 2LRDA 2R4GA 2Q2EB 1L0OC 3OYLA 2RN7A 1MJAA 3OS0A 1NK3P 2CQ7A 1FOWA 1UJ8A 4XN3A 2STTA 3LQRA 2HOEA 1MKMA 3P7NA 2CW8A 4WXCA 2CQNA 1HF0A 3JW4A 4NHJA 1N75A 2DK5A 3NWSA 1OISA 3RJPA 3TEDA 1EF4A 4G9YA 4M3FA 3BR3A 5K5RA 3REOA 2H94A 4C9YA 1U5TA 2BHZA 3CD6I 5KNLA 4A3DJ 2LDUA 4U87A 5FKKA 4U7DA 5CVVA 3AFHA 1DU6A 4P55A 1SD5A 1T6SA 5J1RA 5EZHA 2STWA 4QPQA 1ZYRF 1Z3YA 2ZBKA 4DIQA 4II3A 3F72A 1KA8A 4HZFA 4UY8I 1JUSA 2HXIA 2EFNA 3ERMA 2BXZA 3F8BA 4BE2A 1VTNC 4L9NA 1WQ2A 4FCYA 2R7TA 3GVAA 4LD5A 2OUMA 1IO2A 4Y3OA 3RYPA 1U9OA 3QPSA 2IGMA 2L54A 3K4NA 2LOOA 2P6TA 2K40A 3DTIA 3HRUA 3RKWA 5F1JA 1DP7P 1MH4A 1E3HA 2Y69H 2P6SA 5BQTA 2AHQA 3OMYA 3OIOA 1XMKA 2LF8A 3QOPA 4A3EJ 2I8DA 3QRFF 3KE2A 1G3YA 1U3EM 3JRIA 2L02A 2B7EA 3KCCA 5LBQA 4EMSA 5ICCA 4L0ZB 2ESHA 3HOWJ 2DBBA 2O9LA 2ZMEA 2M5WA 1SVOA 1GXQA 3J81K 1YFHA 1R7JA 1P4XA 2HYGD 3KYCB 1IRXA 1YS6A 3VFZA 2XB0X 2CU7A 2KJBA 3MZHA 3DU5A 3EQLF 4BEHB 1WFXA 3VYRB 4BNCA 3CCJI 1SMTA 4PJMA 4XK4A 3KP4A 1MMGA 5D6FA 1R1UA 2NAZA 2CMPA 1R5GA 1BI1A 2X4HA 3LSRA 2CV2A 1K6OA 4A0ZA 2RC4A 4P5OA 2OJED 1OCZH 2M7AA 3P9IA 4UUTA 1VQ4I 1MIJA 4IVNA 4RM3A 1X1DA 2X1CA 2DPDA 4X1EA 5DUIA 3WHBA 3K1NA 4BY7J 3Q9VA 1LDJA 4RGSA 5EG0A 2W7NA 2RREA 1XN7A 2HQ5A 2J5OA 4G12A 2QSGX 2NS0A 3FWEA 2NOJB 4HQMA 1WJEA 4PUSA 2XAQA 3F22A 1YW9A 3HTSB 4P9UA 3BCBA 3HOYJ 2LP0A 3HGYA 4BU2A 4L9JA 3CCRI 2KRFA 2ZKZA 4PDKA 4PZJA 2Y31A 4C2TA 4OIOF 1WHUA 1FX7A 3I0TA 1X2MA 3LMMA 3S3MA 3CC4I 3HC7A 1O3QA 2V26A 2WADA 5LRSA 1T08B 4YFNF 1ITYA 1OCTC 5F04A 4E70A 2CW0F 3JRHA 1BA5A 2OV7A 4MQVA 4WK8F 1MJBA 1TBXA 2MGQA 3WTZA 1ODDA 4RB2C 2EA2A 5B3SH 2L2OA 2GA2A 3SZPA 2IA2A 4BKXA 1TT5B 4GO1A 4KT5C 2BVLA 1ZRDA 2IA1A 2J5PA 3H1CA 3W6JB 2QLZA 1ZH5A 2IS2A 3FXQA 2TRTA 2BHYA 1MDMA 1V54H 4HLYA 2V7FA 5L3BA 1IC8A 3EUHC 3HTUA 5CYVA 3IV5A 1B8IA 3CCSI 3BG3A 3SFIA 3H36A 3DKYA 1P9QC 4XOTA 2GXGA 4XOPA 9ANTA 3H35A 3S3NA 2Z9OA 1Y8RB 4O3MA 1UHSA 3KIOA 1XTAA 2FSWA 2HR3A 5FKMA 5LGTA 2P7CB 1VQKI 4ANJA 1HA8A 2LF7A 4WX9A 3BR6A 3RZOJ 1HOMA 2KQRA 2UV1A 2WAQA 4PSWA 2IEKA 3KLOA 2FF4A 1BM9A 2FOKA 5BPIA 3QODA 4ZDLA 1T95A 1W36C 2COMA 1IGNA 2HVQA 2M7BA 2MH9A 2V4JC 3C3WA 3M07A 4HYEA 3T0YA 1BR1A 4RAZA 4RM2A 3L2VA 4CA0A 1D8KA 3GO5A 3MEXA 4O6JA 1CF7A 3AG4H 3QYFA 1LE8A 4XRMA 2JA6J 3M1EA 2Y2ZA 2P81A 3BR0A 3DV8A 1BBYA 2CFOA 2XGDA 1ETXA 1ZAOA 5B1BH 5D5WB 1BC8C 3S32A 1J59A 3M1CA 3BTJA 2EZLA 3PQKA 1FC3A 2XAUA 3C18A 5F1RA 1F36A 4EJUA 4B8XA 5M5WJ 2CQXA 2NYXA 3QQAA 2IS4A 3OYNA 1W5SA 3OYMA 3FXKA 1D5YA 4M6YA 4R8HA 4Y17A 1LNWA 1IXRC 1UMQA 2EFQA 1Z7LA 5LHGA 2VBZA 5KAIC 1ZRFA 1YRNA 2DT5A 1X1BA 4V2FA 3SZGA 1OMIA 4MLOA 4QIWN 5BS6A 2DO7A 4B47A 3K0LA 4NC6A 3RCOA 1OLTA 1N25A 3FIWA 3MZYA 2CUEA 4S05A 1H9GA 4RDUA 2VPLA 3H0GJ 1VQ6I 2DOEA 1R5HA 4KIGA 5GADJ 4FASD 1QZZA 1ETKA 3KYLA 3CO6C 3RQ4A 2DT7B 2IGOA 1HW2A 4L5JA 3G4SI 3OV8A 4B48A 3SXYA 1IXSB 4HSTA 1IUFA 1G6NA 3CDIA 4IHYA 4DGWB 1AHDP 5TGTA 3TW6A 3M7GA 3O2PE 2QQBA 4UHTA 4DJAA 4G94A 3FHNA 3JAMZ 2YSRA 4KJZA 2HQRA 2Q2EA 1LB2A 4GFBA 1K78B 2YU9J 3FXMA 4GGGA 4HBLA 2X6YA 3JR9A 3KYDB 4RGXA 4N0BA 3BTLA 3W3CA 1BI2A 3V7SA 2JT1A 1XX5A 4BEHA 4H0EA 3O6BB 2LY9A 2VUMJ 2JRTA 1RZ4A 3DPUA 5FLVA 3IUOA 3Q5FA 4BQAA 3PJRA 3AL0C 1H0MA 1ZKGA 2JWTA 2LKXA 3CJQB 3LFKA 4ETSA 3K2ZA 2KHMA 2DFHA 1J7KA 2CFXA 2OBPA 3BR1A 3IH2A 3TO9A 3C2GA 4KUMA 4NUBA 5F08A 3K2AA 2EB7A 2R7QA 4AVPA 2CRGA 1O7FA 3I64A 2CUJA 3P5JA 4A3KJ 3DPLC 3F21A 1AKHB 5F6FA 5LHHA 3EYIA 4AM3A 2O5RA 5BOXA 4DZPA 3FXUA 3G1LA 3MWMA 2K3FA 1W7PD 4KMFA 2HVRA 4ESFA 2LKPA 1PDNC 4ZYEA 2NVUB 1SEUA 2VKEA 3LSIA 4D0PA 4A3LJ 2IBDA 3CMMA 3I53A 2QA4I 2FNAA 2M0MA 2HQAA 3GWZA 1I3QJ 1KGSA 3A03A 2HU9A 3BQZA 2ZMEC 4HF2A 4KN7X 4E7LA 1IAWA 2QBYA 4HLXA 1OCCH 2VKVA 2VONA 1VQ9I 2YX7A 2IT0A 2A68F 5CVRA 2Y48A 2E2IJ 5B5EC 3NRVA 2RGVA 3K10A 2R0QC 1LE8B 3GTLJ 2GOXB 2M3AA 3LA3A 2KFDA 1QHGA 4MQ9F 1PUFA 1VQ8I 1B9MA 2FBHA 1TWHJ 2MYSA 4OOIA 3F9KA 1JE8A 2R93J 4GYGA 4G8XA 3IWFA 1DU0A 2LNBA 2E1MC 3QPHA 3VYUB 2E7WA 2F4OB 3A1YA 3ASNH 1TL8A 1B8IB 1LVAA 4XLNF 3FXJA 1ETWA 3E0JB 1JTXA 3J7AO 1P4WA 3T5XA 4Y15A 1P2FA 3ZCOA 1E2XA 4EJTA 2P5KA 3PFYA 1O3TA 1D0XA 5E18F 1W7PB 2M0CA 3BCAA 3W2VA 2R5ZB 1EJ9A 2PMZN 1F5TA 3WGIA 2WAEA 5K7HA 4D5FA 3ERED 5E3MA 2ZXHA 1ZELA 4M6XA 2XPUA 2VQLA 4D7MA 1MGTA 4B43A 5DV5A 2D45A 1T2KA 2OU2A 2AQFA 3W2WA 2V1XA 2O7OA 4XICA 2P4WA 1MZBA 1FJLA 3S15J 3BTCA 2R7UA 2W4SA 2O61A 3AL0B 1OCPA 1Z67A 3VOEA 3OIPA 2K02A 4F91B 2HTSA 4A3JJ 2TDXA 3CP2A 4CCJA 4EJVA 4IXAA 4BJ5C 3WTSC 1R71A 4S04A 3OYBA 1BIAA 3HUGB 4F3QA 1EH7A 1LQ1A 2DTRA 2R92J 4KFCA 1YS7A 3CCQI 3EDPA 3S8PA 5E3OA 5JHUA 1C0WA 5IT3A 5J47A 2VC1A 4UB6C 5KVRA 2KPMA 2HFHA 2FA5A 3ULQB 2VXDA 2MABA 2L0KA 2WAQN 1JJ8C 1ON2A 2M87A 4XBFA 4CICA 1ZGWA 4P96A 4A3CJ 1YYVA 2CUFA 1YITI 4NC8A 4CH7A 1MBGA 1D0ZA 5FLXZ 4XRSA 3ZMZA 3FMRA 2FMLA 3BR5A 1TQIA 3L9FA 3IKVA 2G7UA 4E7SA 5AIQA 2NRAC 4LIVA 2VPRA 2HXOA 1EA3A 4G6QA 4HF0A 5ERIA 4EQQA 2E2JJ 1YE9A 1PVEA 4CSWA 2CV0A 3MKYB 1B6AA 3HOZJ 2IXSA 1Y1VJ 5GAHJ 4S0HB 5F0HA 1IRZA 1ZLJA 1KQ9A 2RQPA 2F5FA 3K4JA 5HNHA 4XRFA 2JVHA 3FKIJ
chains in the Genus database with same CATH topology
1FP1D 5HDGA 1LJ9A 2PMHA 1O3SA 3CO7C 2IP2A 3NQOA 4EM0B 3J81Z 3EYYA 4Z2YA 2ZJ2A 1H9TA 4ZZDA 1JHHA 2D2WA 1QPMA 2XHKA 1Q1HA 2OD5A 2KJCA 2BV6A 4M74A 1TTYA 1W7PA 5DD4A 4LB6B 2A61A 4A5NA 2A3SA 4YFKF 3AAFA 1QQIA 2JSCA 1FPQA 2O03A 3BOQA 1ZN2A 3EUHA 2FBIA 4L9TA 2MA3A 3B02A 3RPUA 2VBYA 3DEUA 3HRTA 1OKRA 2QVOA 2VXZA 2F5CA 3F8CA 3F23A 2NNNA 4QWQA 4BXUA 4LLLA 4BAYA 4CXFA 1B1BA 1FBUA 4HA8A 2ZCWA 4UV9A 3M8FA 5DYMA 1E17A 2GA1A 2W25A 3F6OA 3TOBA 3TO6A 2PFBA 4U0VA 1SAXA 2QENA 2KIMA 5FD6A 3ABTA 4I98B 2RDPA 2A5YB 4K2EA 2XUBA 1Z1DA 3F3XA 3R4KA 1UHMA 4UXNA 1TQMA 5FB2A 3LAJA 1IXCA 2X0LA 1R1TA 2QQAA 1D8JA 3ZMVA 2YR2A 2DK8A 3ECHA 3RI4A 4UVBA 3NEUA 3I5UA 2FE3A 1J0RA 1DPRA 2DW4A 4Q4ZF 4KNYA 2K4JA 1YLFA 1D5VA 2PG4A 4U0WA 2KIUA 4R1HA 1YO5C 3ZPLA 4M71A 4IF4A 3MQ0A 3WTUC 2G9WA 1REPC 5DCMA 3MCZA 1FBQA 1OYWA 3FF5A 3KP3A 2DLLA 4HX7A 2MLKA 4ZYDA 4RGRA 4PGHA 2D1VA 4HDVA 1HKSA 4WXHA 1BN5A 3F8MA 1XSDA 2QZ8A 4HV6A 4HX4A 1IN6A 3WU1B 2UXNA 5D4SA 1KU3A 4NB5A 3MAJA 2CQKA 1FBSA 1YTYA 1HKTA 2EA4A 1FY7A 2ZO4A 2UXXA 2MC3A 3V8KA 2HZTA 1FOKA 2AXLA 3COAC 5JI6A 4XSZF 3BP8A 5F64A 2O6GE 3BDDA 4IHTA 3L2CA 5LGUA 2P5LC 3R61A 4ZYGA 1O57A 1S7OA 3FM5A 3FM3A 3K69A 2XV4S 1RNLA 3U1DA 1FYMA 3TO7A 3I71A 1J75A 4G7ZF 1T38A 4B09A 4LJZF 2HKXA 4MNUA 1T98A 5BPDA 4OMZA 2PLYA 4YIFA 1J9IA 3J80Z 4L18B 2ACJA 2D1HA 2YU3A 2FXAA 5CVUA 1HSJA 1Z05A 4EVIA 2O8XA 3LAPA 5CVJA 3H92A 1U2WA 1RI7A 2GAUA 1USSA 4CYDA 1A04A 4ZH4F 5DDGA 3GUDA 2PI0A 2HTJA 3G3ZA 1JHFA 4IJAA 4PGGA 2P5VA 1FLIA 4L0YB 5ILSA 3GYHX 3E6DA 1X3UA 3K9TA 1IF1A 2XASA 4YG2F 1U78A 2W84A 1SFXA 1LEAA 1YG2A 1HSTA 4IRHA 3ROUA 5H6RA 2VBXA 3TDZC 1WI9A 2H09A 2EFOA 2LSOA 2MH2A 1S3JA 3ZQ7A 4EGZA 5D6EA 4KA4A 5A2QZ 3SHFA 4MEXF 2A69F 5LRRA 2V1DA 4F7ZA 4CDGA 1GVJA 3WU0A 3GFIA 2MD5A 3KEQA 4I01A 3KETA 1Z9CA 1YW8A 4EM1A 4GXOA 1KQ8A 3GW2A 4UVAA 4ON0A 1B59A 1B4AA 2EK5A 2FEZA 3TGNA 3R60A 2RNJA 4BHCA 3KP7A 1DDNA 2W85A 5D4RA 1PUEE 1P4AA 4IRIA 2O3FA 4EJWA 2R3SA 1TLHB 4RAYA 5HLHA 1IN5A 1MDMB 1IW7F 4IHSA 2DPUA 3HSRA 1WSUA 4CGZA 2EJRA 3LWFA 1I1GA 4M9XA 2P7VB 1QGPA 2GXBA 5L3FA 1P92A 3HOSA 2K7LA 3ABUA 3CUOA 3ZN1A 1Z6TA 4MEYF 1JXSA 1FP2A 2UZKA 5TRDA 2FNPA 1HQCA 3J80K 3F8NA 1XCBA 1KU2A 4GYIA 1CF7B 5E8GA 1TQPA 5DUKA 1S6LA 1XGSA 3LA7A 4AWXB 5D8KB 2DAOA 5FFXA 4BHPA 4I7HA 5DD8A 2ETHA 1BOAA 2V9VA 5HS7A 4I0BA 3B73A 2VOOA 1FWZA 2PBIA 4ASNA 5JFRA 5JVTA 2B0LA 3V7RA 1ON1A 4G7OF 1STZA 1G3TA 3RIRA 5FLXK 1QNTA 2H6BA 5ICEA 2XROA 3DPTA 2M30A 4HW0A 4RB1A 3HRSA 2ESNA 5HS9A 3GZ6A 4HV5A 4U88A 1RIOH 3I54A 1LEBA 2O0YA 1K78A 1O3RA 1ZHFA 2C6YA 2XKPA 1USTA 4UUVA 2MLGA 3HOTA 1FT9A 4A5MA 1BI3A 2IPQX 2ZNYA 1ONVA 3KEOA 1R36A 3CUQC 3WGGA 1BI0A 1SFEA 3I59A 3E3VA 2ISZA 1S29A 5IT9K 4A12A 3GX4X 3HRMA 2P8TA 1R58A 3GEZA 4JBAA 4WWCA 5K5QA 3K1PA 2EV5A 3F6VA 3ELKA 2QQ9A 3ZMDA 2VE9A 1G3SA 2H6CA 3E5XA 1R00A 2IRFG 5HDKA 3CUQA 4ENJA 2E7XA 1MJ9A 3WGHA 1KU9A 3QAHA 4NQWA 5E20A 3IRQA 1U5TC 3LA2A 5HS8A 1EH6A 2YX4A 2HWVA 4ESBA 2XRNA 1HW1A 3VODA 1BC7C 3R0AA 3IWZA 1ZLKA 3TOAA 1LDDA 4CHUA 2VT2A 4KICA 4DNCA 1ZGJA 1XSVA 1T0FA 2BGCA 4CZZA 1OR7A 1EH8A 1U5TB 1IN7A 4RB0A 5D5VB 1XDUA 1QZYA 1U6GA 2H27A 2PEXA 1V4RA 3BY6A 1K79A 4FX0A 4JQFA 1F1ZA 3HSFA 2HKOA 2JTVA 4KDPA 1G3WA 3KP2A 4KIFA 5J8FA 3M9AA 1RUOA 2PMUA 3U2RA 2XIGA 3JAMK 2ZXJA 1I1SA 2EFPA 3QPTA 3KFWX 5L3DA 4BH9A 5K1YA 2YPRA 4I0AA 3C1DA 5H6QA 2EV0A 2JZYA 3H3UA 4I2OA 1FNNA 3FHZA 4LK1F 1Z6RA 3SFZA 3CJNA 2Z33A 4KN4X 3P9KA 4Q48A 1TNSA 3DKWA 5LHIA 3GLXA 3HHHA 2IVMA 4FX4A 1IRFA 1KU7A 5ILVA 2M8EA 5FD5A 1SFUA 2V6CA 3CTAA 5LEKA 3GXOA 4I09A 3SQNA 3ZMTA 5AONA 3KZYA 4EM2A 4ZYHA 3L7WA 2K4BA 4RB3C 4A6DA 1S8NA 3GFJA 3V8JA 5L3EA 4A0YA 3VEPA 3E6CC 5HDNA 2XGXA 3IRRA 2Y75A 2Z99A 1V3FA 4YFXF 3WG9A 3I59B 4LG0B 3TDUC 4QLCU 1YIOA 3LQQA 3BZ6A 3DQVC 4OIPF 1I27A 4UNOA 3ECOA 1L3LA 2W24A 2VT3A 2G7HA 4HOBA 5D5UB 4A0XA 2IW5A 2ZNZA 3CUQB 4LGWA 4ENKA 5EEHA 2L4MA 2Z5UA 3W6KB 2ZMEB 4ENMA 3ISPA 1ZREA 3TQNA 1PP8F 2WV0A 3D0SA 5E1XA 3E6BA 1BIBA 3ZN0A 2WWYA 3P9CA 3T1BA 4HF1A 2FRHA 2CO5A 3FMSA 3MFKA 4MTDA 2VE8A 4HX8A 3F8FA 1WRJA 5HLGA 3WTXC 2UWMA 2VN2A 1XB4A 4LB5A 3Q9SA 6PAXA 2L01A 4EGYA 2AS5F 3WTWC 4EV0A 2OQGA 1OPCA 4DQ2A 2W57A 3V7CA 2BE5F 5DCMB 5FGMA 2DQLA 2XAJA 1R1VA 3E97A 2VOPA 4R79A 4LK0F 2FQ3A 1TW3A 3VB2A 2DI3A 3QU6A 4MGRA 1XGOA 3FZVA 4M9ZA 3S2WA 2VC0A 5LGNA 3U9GA 1WWXA 2HQNA 3JTHA 4AIKA 4OIQF 5CLSA 2OZ6A 3D5LA 3ZMUA 2OAZA 4ZZLA 2JPBA 2CG4A 1SD7A 4Q5SF 5E1WA 1YW7A 1XMAA 1K7AA 3PFIA 2WTEA 4N9IA 3BWGA 2ELHA 2OA4A 2DFIA 1FSEA 1OYYA 5KK1A 2E1CA 3RPQA 4U7BA 2FBKA 1IUYA 1UFMA 2A6EF 2IA0A 3FX3A 4AIJA 2K27A 3WTVC 2F2EA 3N97A 2WC2A 4ENNA 3EETA 4PCQA 3TKYA 3I4PA 2PJPA 5ED4A 1XD7A 3IC7A 5HOOA 4L5IA 2A6HF 1B9NA 3G73A 4ESJA 1O7LA 2XAGA 2ADUA 4LLGF 1XGMA 5IT9Z 4I02A 2R7DA 1XDSA 3IKTA 4L9VA 2EWNA 4A2UA 1XGNA 3IHUA 3OOPA 2QWWA 5ICFA 2RKHA 4IPAA 1ZG3A 3CDHA 4N9HA 2M45A 3BROA 1I6XA 3T8RA 1FSHA 2BEOA 5LEJA 1SD4A 3L09A 1I5ZA 4LLNA 3ML6A 2PQ8A 1IRGA 3ZP5A 3E5UA 4KYWA 1YQAA 4M9SA 4LG0A 3R0JA 3WTYC 1F9NA 3GZ5A 1LDKB 1R23A 3CLOA 2F5DA 4G6DA 1KYWA 1T39A 1ZARA 1ZGAA 2XKOA 1ZG5A 3BPVA 3JSOA 2HGCA 3WE3A 3FMQA 4O5VA 5EEGA 3QP6A 3HHGA 1J2XA 2VODA 2XAFA 1XSXA 2M1BA 3E6MA 2EV6A 4OINF 1KQ0A 3BJ6A 1IZ1A 1R22A 1DUXC 1OYIA 2Z3YA 2QBYB 2GWRA 1GXPA 2ZFWA 4M73A 4CO8A 3KLNA 3KP5A 1Y0UA 5HVQC 4FHTA 2QUFA 1IN8A 5ICGA 3RKXA 4YIIA 3H3ZA 2QYOA 4HDUA 3N4MA 4KMUX 3V8LA 1SMYF 2JPCA 3GFMA 1IN4A 2CSOA 3V4GA 1ZRCA 4BHBA 4M72A 2PN6A 2F5EA 1BJAA 2L4AA 1MD0A 2V79A 2GIVA 2Y0MA 4HAMA 2HEOA 5E17F 2Q0OA 4OU0A 5L3CA 3I58A 1W5TA 1TNTA 4UVCA 5E1ZB 4MTEA 4XSXF 3BJAA 2FU4A 5FO5A 4BYYA 2L3DA 3HUGA 1PP7U 5DCFA 5J8CA 2HS5A 1F4KA 5L3GA 2E1NA 4FT8A 3JTGA 1AOYA 2KKOA 2RV8A 1RUNA 1UB9A 1QO0D 3SZTA 1W4MA 3R6SA 2EFWA 4LFUA 2Q8KA 4EJOA 3KZZA 1WKMA 3WODF 2RVCA 3BPXA 3QU3A 4JK1X 1G4DA 3JSPA 3WTTC 1FYKA 3RKYA 4WCGA 2VBWA 1NHAA 3DFGA 3E5QA 4GCVA 1UCRA 5FFZA 5BMZA 1TW2A 4OMYA 5CJ9A 1ZG1A 4KIBA 3O3KA 3ZMSA 2R7FA 2HDCA 4IRGA 3RYRA 1J5YA 3IL2A 3GFLA 5DEQA 4RS8A 1SD6A 2ISYA 4MHGA 4WF2A 3L00A 2OQRA 1XCVA 5ILUA 1FZPB 3LSTA 2CGPA 2OZUA 3DP7A 3RDIA 3C7JA 4A6EA 4XLPF 5LLQA 1AWCA 3PQJA 2DQRA 1GHCA 2FMYA 3HSEA 4Y13A 4AIHA 3RTRA 2GZWA 2QM3A 1ULYA 2CWEA 4RGUA 1HXDA 2DU9A 1CGPA 5D5XB 3QP5A 2BYVE 2XVCA 3FXRA 2IJLA 1EV7A 1D3YA 2XAHA 3K1MA 1Z91A 5J6XA 3BJOA 4HQEA 2CYYA 2HYFA 1S7AA 3T8TA 4OIRF 5D8LB 3DXJF 5HLIA 5TJJA 2A07F 5K5OA 1QBJA 3KP6A 3M8EA 5CVIA 4TV7A 5AIPA 1DPUA 2MBFA 4U0YA 3GF2A 1Z7UA 1KYZA 4WXDA 4P9FA 2BBYA 1FYLA 4G7HF 1HBXG 5JR3A 3WE2A 2K86A 3DF8A 2NNYA 3HYIA 1HKQA 5A2QK 2KIFA 1UHWA 3HIFA 4LMYA 1HW5A 5H20A 1JGSA 4UV8A 1U8RA 4Q47A 2V1UA 5E8IA 2GQQA 1P6RA 1L0OC 2RN7A 1MJAA 2STTA 3LQRA 2HOEA 1MKMA 3P7NA 4WXCA 3JW4A 4NHJA 2DK5A 3RJPA 4G9YA 5K5RA 3REOA 2H94A 1U5TA 2LDUA 4U7DA 5CVVA 4P55A 1SD5A 1T6SA 2STWA 1ZYRF 2ZBKA 3F72A 1KA8A 4HZFA 1VTNC 2EFNA 3F8BA 4L9NA 1WQ2A 3GVAA 4LD5A 3RYPA 2L54A 2P6TA 3RKWA 3HRUA 1DP7P 2P6SA 5BQTA 1XMKA 2LF8A 3QOPA 3QRFF 3KE2A 1G3YA 1U3EM 2L02A 3KCCA 5LBQA 4EMSA 5ICCA 4L0ZB 2ESHA 2DBBA 2ZMEA 2M5WA 1GXQA 3J81K 1YFHA 1R7JA 1P4XA 2HYGD 1YS6A 3VFZA 2KJBA 3MZHA 3EQLF 4BNCA 1SMTA 3KP4A 5D6FA 1R1UA 2NAZA 1R5GA 1BI1A 2X4HA 1K6OA 4A0ZA 2RC4A 4P5OA 3P9IA 4IVNA 2DPDA 5DUIA 3K1NA 3Q9VA 1LDJA 4RGSA 1XN7A 2J5OA 2NS0A 3FWEA 4HQMA 2XAQA 3F22A 1YW9A 3HTSB 4P9UA 4L9JA 2KRFA 2ZKZA 4PDKA 4PZJA 4OIOF 1FX7A 3I0TA 1O3QA 5LRSA 4YFNF 4E70A 2CW0F 4MQVA 4WK8F 1MJBA 1TBXA 3WTZA 1ODDA 4RB2C 2EA2A 2GA2A 3SZPA 2IA2A 4GO1A 4KT5C 1ZRDA 2IA1A 2J5PA 3W6JB 2QLZA 1ZH5A 3FXQA 1MDMA 4HLYA 5L3BA 3HTUA 5CYVA 2GXGA 2Z9OA 4O3MA 2FSWA 2HR3A 5LGTA 2P7CB 2LF7A 4WX9A 3KLOA 2FF4A 1BM9A 2FOKA 5BPIA 2COMA 3T0YA 3C3WA 2MH9A 4HYEA 4RAZA 1D8KA 3GO5A 3MEXA 4O6JA 1CF7A 3M1EA 3DV8A 1BBYA 1ZAOA 5D5WB 1BC8C 1J59A 3PQKA 1FC3A 3C18A 5F1RA 4EJUA 4B8XA 2NYXA 1W5SA 4M6YA 4R8HA 4Y17A 1LNWA 1IXRC 2EFQA 5LHGA 2VBZA 1ZRFA 2DT5A 5BS6A 1OMIA 2DO7A 3K0LA 3MZYA 4S05A 1H9GA 4KIGA 1R5HA 1QZZA 3CO6C 1HW2A 4L5JA 3OV8A 3SXYA 1IXSB 1G6NA 3M7GA 3O2PE 2QQBA 4UHTA 4G94A 3JAMZ 2YSRA 2HQRA 2Q2EA 1LB2A 1K78B 4GGGA 4HBLA 4RGXA 4N0BA 1BI2A 3V7SA 2JT1A 4H0EA 3O6BB 2JRTA 1RZ4A 3Q5FA 4BQAA 1H0MA 3LFKA 4ETSA 3K2ZA 1J7KA 2CFXA 2OBPA 3TO9A 4KUMA 2EB7A 4AVPA 1O7FA 3I64A 3DPLC 3F21A 3EYIA 5F6FA 5LHHA 5BOXA 3FXUA 3MWMA 1W7PD 4KMFA 4ESFA 2LKPA 1PDNC 4ZYEA 4D0PA 3I53A 2FNAA 3GWZA 1KGSA 4HF2A 4KN7X 2QBYA 1IAWA 4HLXA 2VONA 2YX7A 2IT0A 2A68F 5CVRA 2Y48A 3NRVA 2RGVA 3LA3A 4MQ9F 1B9MA 2FBHA 4OOIA 1JE8A 4GYGA 4G8XA 3IWFA 2LNBA 3QPHA 2E7WA 1LVAA 4XLNF 3J7AO 1P4WA 3T5XA 4Y15A 1P2FA 1E2XA 4EJTA 2P5KA 1O3TA 5E18F 1W7PB 1F5TA 3WGIA 3ERED 4M6XA 1T2KA 1MGTA 5DV5A 2D45A 2OU2A 2V1XA 2P4WA 1MZBA 2O61A 3VOEA 2K02A 2HTSA 2TDXA 4EJVA 4IXAA 3WTSC 4S04A 1BIAA 1EH7A 1LQ1A 2DTRA 4KFCA 1YS7A 3EDPA 5JHUA 1C0WA 5IT3A 2VC1A 5KVRA 2HFHA 2FA5A 3ULQB 1ON2A 2M87A 4XBFA 4CICA 4P96A 1YYVA 5FLXZ 3ZMZA 3FMRA 2FMLA 3L9FA 1TQIA 3IKVA 2G7UA 5AIQA 2NRAC 4G6QA 4HF0A 4EQQA 5ERIA 1B6AA 1ZLJA 1KQ9A 2RQPA 2F5FA 4XRFA 4AD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FP1 D;  5HDG A;  1LJ9 A;  2PMH A;  1O3S A;  3CO7 C;  2IP2 A;  3NQO A;  4EM0 B;  3J81 Z;  3EYY A;  4Z2Y A;  2ZJ2 A;  1H9T A;  4ZZD A;  1JHH A;  2D2W A;  1QPM A;  2XHK A;  1Q1H A;  2OD5 A;  2KJC A;  2BV6 A;  4M74 A;  1TTY A;  1W7P A;  5DD4 A;  4LB6 B;  2A61 A;  4A5N A;  2A3S A;  4YFK F;  3AAF A;  1QQI A;  2JSC A;  1FPQ A;  2O03 A;  3BOQ A;  1ZN2 A;  3EUH A;  2FBI A;  4L9T A;  2MA3 A;  3B02 A;  3RPU A;  2VBY A;  3DEU A;  3HRT A;  1OKR A;  2QVO A;  2VXZ A;  2F5C A;  3F8C A;  3F23 A;  2NNN A;  4QWQ A;  4BXU A;  4LLL A;  4BAY A;  4CXF A;  1B1B A;  1FBU A;  4HA8 A;  2ZCW A;  4UV9 A;  3M8F A;  5DYM A;  1E17 A;  2GA1 A;  2W25 A;  3F6O A;  3TOB A;  3TO6 A;  2PFB A;  4U0V A;  1SAX A;  2QEN A;  2KIM A;  5FD6 A;  3ABT A;  4I98 B;  2RDP A;  2A5Y B;  4K2E A;  2XUB A;  1Z1D A;  3F3X A;  3R4K A;  1UHM A;  4UXN A;  1TQM A;  5FB2 A;  3LAJ A;  1IXC A;  2X0L A;  1R1T A;  2QQA A;  1D8J A;  3ZMV A;  2YR2 A;  2DK8 A;  3ECH A;  3RI4 A;  4UVB A;  3NEU A;  3I5U A;  2FE3 A;  1J0R A;  1DPR A;  2DW4 A;  4Q4Z F;  4KNY A;  2K4J A;  1YLF A;  1D5V A;  2PG4 A;  4U0W A;  2KIU A;  4R1H A;  1YO5 C;  3ZPL A;  4M71 A;  4IF4 A;  3MQ0 A;  3WTU C;  2G9W A;  1REP C;  5DCM A;  3MCZ A;  1FBQ A;  1OYW A;  3FF5 A;  3KP3 A;  2DLL A;  4HX7 A;  2MLK A;  4ZYD A;  4RGR A;  4PGH A;  2D1V A;  4HDV A;  1HKS A;  4WXH A;  1BN5 A;  3F8M A;  1XSD A;  2QZ8 A;  4HV6 A;  4HX4 A;  1IN6 A;  3WU1 B;  2UXN A;  5D4S A;  1KU3 A;  4NB5 A;  3MAJ A;  2CQK A;  1FBS A;  1YTY A;  1HKT A;  2EA4 A;  1FY7 A;  2ZO4 A;  2UXX A;  2MC3 A;  3V8K A;  2HZT A;  1FOK A;  2AXL A;  3COA C;  5JI6 A;  4XSZ F;  3BP8 A;  5F64 A;  2O6G E;  3BDD A;  4IHT A;  3L2C A;  5LGU A;  2P5L C;  3R61 A;  4ZYG A;  1O57 A;  1S7O A;  3FM5 A;  3FM3 A;  3K69 A;  2XV4 S;  1RNL A;  3U1D A;  1FYM A;  3TO7 A;  3I71 A;  1J75 A;  4G7Z F;  1T38 A;  4B09 A;  4LJZ F;  2HKX A;  4MNU A;  1T98 A;  5BPD A;  4OMZ A;  2PLY A;  4YIF A;  1J9I A;  3J80 Z;  4L18 B;  2ACJ A;  2D1H A;  2YU3 A;  2FXA A;  5CVU A;  1HSJ A;  1Z05 A;  4EVI A;  2O8X A;  3LAP A;  5CVJ A;  3H92 A;  1U2W A;  1RI7 A;  2GAU A;  1USS A;  4CYD A;  1A04 A;  4ZH4 F;  5DDG A;  3GUD A;  2PI0 A;  2HTJ A;  3G3Z A;  1JHF A;  4IJA A;  4PGG A;  2P5V A;  1FLI A;  4L0Y B;  5ILS A;  3GYH X;  3E6D A;  1X3U A;  3K9T A;  1IF1 A;  2XAS A;  4YG2 F;  1U78 A;  2W84 A;  1SFX A;  1LEA A;  1YG2 A;  1HST A;  4IRH A;  3ROU A;  5H6R A;  2VBX A;  3TDZ C;  1WI9 A;  2H09 A;  2EFO A;  2LSO A;  2MH2 A;  1S3J A;  3ZQ7 A;  4EGZ A;  5D6E A;  4KA4 A;  5A2Q Z;  3SHF A;  4MEX F;  2A69 F;  5LRR A;  2V1D A;  4F7Z A;  4CDG A;  1GVJ A;  3WU0 A;  3GFI A;  2MD5 A;  3KEQ A;  4I01 A;  3KET A;  1Z9C A;  1YW8 A;  4EM1 A;  4GXO A;  1KQ8 A;  3GW2 A;  4UVA A;  4ON0 A;  1B59 A;  1B4A A;  2EK5 A;  2FEZ A;  3TGN A;  3R60 A;  2RNJ A;  4BHC A;  3KP7 A;  1DDN A;  2W85 A;  5D4R A;  1PUE E;  1P4A A;  4IRI A;  2O3F A;  4EJW A;  2R3S A;  1TLH B;  4RAY A;  5HLH A;  1IN5 A;  1MDM B;  1IW7 F;  4IHS A;  2DPU A;  3HSR A;  1WSU A;  4CGZ A;  2EJR A;  3LWF A;  1I1G A;  4M9X A;  2P7V B;  1QGP A;  2GXB A;  5L3F A;  1P92 A;  3HOS A;  2K7L A;  3ABU A;  3CUO A;  3ZN1 A;  1Z6T A;  4MEY F;  1JXS A;  1FP2 A;  2UZK A;  5TRD A;  2FNP A;  1HQC A;  3J80 K;  3F8N A;  1XCB A;  1KU2 A;  4GYI A;  1CF7 B;  5E8G A;  1TQP A;  5DUK A;  1S6L A;  1XGS A;  3LA7 A;  4AWX B;  5D8K B;  2DAO A;  5FFX A;  4BHP A;  4I7H A;  5DD8 A;  2ETH A;  1BOA A;  2V9V A;  5HS7 A;  4I0B A;  3B73 A;  2VOO A;  1FWZ A;  2PBI A;  4ASN A;  5JFR A;  5JVT A;  2B0L A;  3V7R A;  1ON1 A;  4G7O F;  1STZ A;  1G3T A;  3RIR A;  5FLX K;  1QNT A;  2H6B A;  5ICE A;  2XRO A;  3DPT A;  2M30 A;  4HW0 A;  4RB1 A;  3HRS A;  2ESN A;  5HS9 A;  3GZ6 A;  4HV5 A;  4U88 A;  1RIO H;  3I54 A;  1LEB A;  2O0Y A;  1K78 A;  1O3R A;  1ZHF A;  2C6Y A;  2XKP A;  1UST A;  4UUV A;  2MLG A;  3HOT A;  1FT9 A;  4A5M A;  1BI3 A;  2IPQ X;  2ZNY A;  1ONV A;  3KEO A;  1R36 A;  3CUQ C;  3WGG A;  1BI0 A;  1SFE A;  3I59 A;  3E3V A;  2ISZ A;  1S29 A;  5IT9 K;  4A12 A;  3GX4 X;  3HRM A;  2P8T A;  1R58 A;  3GEZ A;  4JBA A;  4WWC A;  5K5Q A;  3K1P A;  2EV5 A;  3F6V A;  3ELK A;  2QQ9 A;  3ZMD A;  2VE9 A;  1G3S A;  2H6C A;  3E5X A;  1R00 A;  2IRF G;  5HDK A;  3CUQ A;  4ENJ A;  2E7X A;  1MJ9 A;  3WGH A;  1KU9 A;  3QAH A;  4NQW A;  5E20 A;  3IRQ A;  1U5T C;  3LA2 A;  5HS8 A;  1EH6 A;  2YX4 A;  2HWV A;  4ESB A;  2XRN A;  1HW1 A;  3VOD A;  1BC7 C;  3R0A A;  3IWZ A;  1ZLK A;  3TOA A;  1LDD A;  4CHU A;  2VT2 A;  4KIC A;  4DNC A;  1ZGJ A;  1XSV A;  1T0F A;  2BGC A;  4CZZ A;  1OR7 A;  1EH8 A;  1U5T B;  1IN7 A;  4RB0 A;  5D5V B;  1XDU A;  1QZY A;  1U6G A;  2H27 A;  2PEX A;  1V4R A;  3BY6 A;  1K79 A;  4FX0 A;  4JQF A;  1F1Z A;  3HSF A;  2HKO A;  2JTV A;  4KDP A;  1G3W A;  3KP2 A;  4KIF A;  5J8F A;  3M9A A;  1RUO A;  2PMU A;  3U2R A;  2XIG A;  3JAM K;  2ZXJ A;  1I1S A;  2EFP A;  3QPT A;  3KFW X;  5L3D A;  4BH9 A;  5K1Y A;  2YPR A;  4I0A A;  3C1D A;  5H6Q A;  2EV0 A;  2JZY A;  3H3U A;  4I2O A;  1FNN A;  3FHZ A;  4LK1 F;  1Z6R A;  3SFZ A;  3CJN A;  2Z33 A;  4KN4 X;  3P9K A;  4Q48 A;  1TNS A;  3DKW A;  5LHI A;  3GLX A;  3HHH A;  2IVM A;  4FX4 A;  1IRF A;  1KU7 A;  5ILV A;  2M8E A;  5FD5 A;  1SFU A;  2V6C A;  3CTA A;  5LEK A;  3GXO A;  4I09 A;  3SQN A;  3ZMT A;  5AON A;  3KZY A;  4EM2 A;  4ZYH A;  3L7W A;  2K4B A;  4RB3 C;  4A6D A;  1S8N A;  3GFJ A;  3V8J A;  5L3E A;  4A0Y A;  3VEP A;  3E6C C;  5HDN A;  2XGX A;  3IRR A;  2Y75 A;  2Z99 A;  1V3F A;  4YFX F;  3WG9 A;  3I59 B;  4LG0 B;  3TDU C;  4QLC U;  1YIO A;  3LQQ A;  3BZ6 A;  3DQV C;  4OIP F;  1I27 A;  4UNO A;  3ECO A;  1L3L A;  2W24 A;  2VT3 A;  2G7H A;  4HOB A;  5D5U B;  4A0X A;  2IW5 A;  2ZNZ A;  3CUQ B;  4LGW A;  4ENK A;  5EEH A;  2L4M A;  2Z5U A;  3W6K B;  2ZME B;  4ENM A;  3ISP A;  1ZRE A;  3TQN A;  1PP8 F;  2WV0 A;  3D0S A;  5E1X A;  3E6B A;  1BIB A;  3ZN0 A;  2WWY A;  3P9C A;  3T1B A;  4HF1 A;  2FRH A;  2CO5 A;  3FMS A;  3MFK A;  4MTD A;  2VE8 A;  4HX8 A;  3F8F A;  1WRJ A;  5HLG A;  3WTX C;  2UWM A;  2VN2 A;  1XB4 A;  4LB5 A;  3Q9S A;  6PAX A;  2L01 A;  4EGY A;  2AS5 F;  3WTW C;  4EV0 A;  2OQG A;  1OPC A;  4DQ2 A;  2W57 A;  3V7C A;  2BE5 F;  5DCM B;  5FGM A;  2DQL A;  2XAJ A;  1R1V A;  3E97 A;  2VOP A;  4R79 A;  4LK0 F;  2FQ3 A;  1TW3 A;  3VB2 A;  2DI3 A;  3QU6 A;  4MGR A;  1XGO A;  3FZV A;  4M9Z A;  3S2W A;  2VC0 A;  5LGN A;  3U9G A;  1WWX A;  2HQN A;  3JTH A;  4AIK A;  4OIQ F;  5CLS A;  2OZ6 A;  3D5L A;  3ZMU A;  2OAZ A;  4ZZL A;  2JPB A;  2CG4 A;  1SD7 A;  4Q5S F;  5E1W A;  1YW7 A;  1XMA A;  1K7A A;  3PFI A;  2WTE A;  4N9I A;  3BWG A;  2ELH A;  2OA4 A;  2DFI A;  1FSE A;  1OYY A;  5KK1 A;  2E1C A;  3RPQ A;  4U7B A;  2FBK A;  1IUY A;  1UFM A;  2A6E F;  2IA0 A;  3FX3 A;  4AIJ A;  2K27 A;  3WTV C;  2F2E A;  3N97 A;  2WC2 A;  4ENN A;  3EET A;  4PCQ A;  3TKY A;  3I4P A;  2PJP A;  5ED4 A;  1XD7 A;  3IC7 A;  5HOO A;  4L5I A;  2A6H F;  1B9N A;  3G73 A;  4ESJ A;  1O7L A;  2XAG A;  2ADU A;  4LLG F;  1XGM A;  5IT9 Z;  4I02 A;  2R7D A;  1XDS A;  3IKT A;  4L9V A;  2EWN A;  4A2U A;  1XGN A;  3IHU A;  3OOP A;  2QWW A;  5ICF A;  2RKH A;  4IPA A;  1ZG3 A;  3CDH A;  4N9H A;  2M45 A;  3BRO A;  1I6X A;  3T8R A;  1FSH A;  2BEO A;  5LEJ A;  1SD4 A;  3L09 A;  1I5Z A;  4LLN A;  3ML6 A;  2PQ8 A;  1IRG A;  3ZP5 A;  3E5U A;  4KYW A;  1YQA A;  4M9S A;  4LG0 A;  3R0J A;  3WTY C;  1F9N A;  3GZ5 A;  1LDK B;  1R23 A;  3CLO A;  2F5D A;  4G6D A;  1KYW A;  1T39 A;  1ZAR A;  1ZGA A;  2XKO A;  1ZG5 A;  3BPV A;  3JSO A;  2HGC A;  3WE3 A;  3FMQ A;  4O5V A;  5EEG A;  3QP6 A;  3HHG A;  1J2X A;  2VOD A;  2XAF A;  1XSX A;  2M1B A;  3E6M A;  2EV6 A;  4OIN F;  1KQ0 A;  3BJ6 A;  1IZ1 A;  1R22 A;  1DUX C;  1OYI A;  2Z3Y A;  2QBY B;  2GWR A;  1GXP A;  2ZFW A;  4M73 A;  4CO8 A;  3KLN A;  3KP5 A;  1Y0U A;  5HVQ C;  4FHT A;  2QUF A;  1IN8 A;  5ICG A;  3RKX A;  4YII A;  3H3Z A;  2QYO A;  4HDU A;  3N4M A;  4KMU X;  3V8L A;  1SMY F;  2JPC A;  3GFM A;  1IN4 A;  2CSO A;  3V4G A;  1ZRC A;  4BHB A;  4M72 A;  2PN6 A;  2F5E A;  1BJA A;  2L4A A;  1MD0 A;  2V79 A;  2GIV A;  2Y0M A;  4HAM A;  2HEO A;  5E17 F;  2Q0O A;  4OU0 A;  5L3C A;  3I58 A;  1W5T A;  1TNT A;  4UVC A;  5E1Z B;  4MTE A;  4XSX F;  3BJA A;  2FU4 A;  5FO5 A;  4BYY A;  2L3D A;  3HUG A;  1PP7 U;  5DCF A;  5J8C A;  2HS5 A;  1F4K A;  5L3G A;  2E1N A;  4FT8 A;  3JTG A;  1AOY A;  2KKO A;  2RV8 A;  1RUN A;  1UB9 A;  1QO0 D;  3SZT A;  1W4M A;  3R6S A;  2EFW A;  4LFU A;  2Q8K A;  4EJO A;  3KZZ A;  1WKM A;  3WOD F;  2RVC A;  3BPX A;  3QU3 A;  4JK1 X;  1G4D A;  3JSP A;  3WTT C;  1FYK A;  3RKY A;  4WCG A;  2VBW A;  1NHA A;  3DFG A;  3E5Q A;  4GCV A;  1UCR A;  5FFZ A;  5BMZ A;  1TW2 A;  4OMY A;  5CJ9 A;  1ZG1 A;  4KIB A;  3O3K A;  3ZMS A;  2R7F A;  2HDC A;  4IRG A;  3RYR A;  1J5Y A;  3IL2 A;  3GFL A;  5DEQ A;  4RS8 A;  1SD6 A;  2ISY A;  4MHG A;  4WF2 A;  3L00 A;  2OQR A;  1XCV A;  5ILU A;  1FZP B;  3LST A;  2CGP A;  2OZU A;  3DP7 A;  3RDI A;  3C7J A;  4A6E A;  4XLP F;  5LLQ A;  1AWC A;  3PQJ A;  2DQR A;  1GHC A;  2FMY A;  3HSE A;  4Y13 A;  4AIH A;  3RTR A;  2GZW A;  2QM3 A;  1ULY A;  2CWE A;  4RGU A;  1HXD A;  2DU9 A;  1CGP A;  5D5X B;  3QP5 A;  2BYV E;  2XVC A;  3FXR A;  2IJL A;  1EV7 A;  1D3Y A;  2XAH A;  3K1M A;  1Z91 A;  5J6X A;  3BJO A;  4HQE A;  2CYY A;  2HYF A;  1S7A A;  3T8T A;  4OIR F;  5D8L B;  3DXJ F;  5HLI A;  5TJJ A;  2A07 F;  5K5O A;  1QBJ A;  3KP6 A;  3M8E A;  5CVI A;  4TV7 A;  5AIP A;  1DPU A;  2MBF A;  4U0Y A;  3GF2 A;  1Z7U A;  1KYZ A;  4WXD A;  4P9F A;  2BBY A;  1FYL A;  4G7H F;  1HBX G;  5JR3 A;  3WE2 A;  2K86 A;  3DF8 A;  2NNY A;  3HYI A;  1HKQ A;  5A2Q K;  2KIF A;  1UHW A;  3HIF A;  4LMY A;  1HW5 A;  5H20 A;  1JGS A;  4UV8 A;  1U8R A;  4Q47 A;  2V1U A;  5E8I A;  2GQQ A;  1P6R A;  1L0O C;  2RN7 A;  1MJA A;  2STT A;  3LQR A;  2HOE A;  1MKM A;  3P7N A;  4WXC A;  3JW4 A;  4NHJ A;  2DK5 A;  3RJP A;  4G9Y A;  5K5R A;  3REO A;  2H94 A;  1U5T A;  2LDU A;  4U7D A;  5CVV A;  4P55 A;  1SD5 A;  1T6S A;  2STW A;  1ZYR F;  2ZBK A;  3F72 A;  1KA8 A;  4HZF A;  1VTN C;  2EFN A;  3F8B A;  4L9N A;  1WQ2 A;  3GVA A;  4LD5 A;  3RYP A;  2L54 A;  2P6T A;  3RKW A;  3HRU A;  1DP7 P;  2P6S A;  5BQT A;  1XMK A;  2LF8 A;  3QOP A;  3QRF F;  3KE2 A;  1G3Y A;  1U3E M;  2L02 A;  3KCC A;  5LBQ A;  4EMS A;  5ICC A;  4L0Z B;  2ESH A;  2DBB A;  2ZME A;  2M5W A;  1GXQ A;  3J81 K;  1YFH A;  1R7J A;  1P4X A;  2HYG D;  1YS6 A;  3VFZ A;  2KJB A;  3MZH A;  3EQL F;  4BNC A;  1SMT A;  3KP4 A;  5D6F A;  1R1U A;  2NAZ A;  1R5G A;  1BI1 A;  2X4H A;  1K6O A;  4A0Z A;  2RC4 A;  4P5O A;  3P9I A;  4IVN A;  2DPD A;  5DUI A;  3K1N A;  3Q9V A;  1LDJ A;  4RGS A;  1XN7 A;  2J5O A;  2NS0 A;  3FWE A;  4HQM A;  2XAQ A;  3F22 A;  1YW9 A;  3HTS B;  4P9U A;  4L9J A;  2KRF A;  2ZKZ A;  4PDK A;  4PZJ A;  4OIO F;  1FX7 A;  3I0T A;  1O3Q A;  5LRS A;  4YFN F;  4E70 A;  2CW0 F;  4MQV A;  4WK8 F;  1MJB A;  1TBX A;  3WTZ A;  1ODD A;  4RB2 C;  2EA2 A;  2GA2 A;  3SZP A;  2IA2 A;  4GO1 A;  4KT5 C;  1ZRD A;  2IA1 A;  2J5P A;  3W6J B;  2QLZ A;  1ZH5 A;  3FXQ A;  1MDM A;  4HLY A;  5L3B A;  3HTU A;  5CYV A;  2GXG A;  2Z9O A;  4O3M A;  2FSW A;  2HR3 A;  5LGT A;  2P7C B;  2LF7 A;  4WX9 A;  3KLO A;  2FF4 A;  1BM9 A;  2FOK A;  5BPI A;  2COM A;  3T0Y A;  3C3W A;  2MH9 A;  4HYE A;  4RAZ A;  1D8K A;  3GO5 A;  3MEX A;  4O6J A;  1CF7 A;  3M1E A;  3DV8 A;  1BBY A;  1ZAO A;  5D5W B;  1BC8 C;  1J59 A;  3PQK A;  1FC3 A;  3C18 A;  5F1R A;  4EJU A;  4B8X A;  2NYX A;  1W5S A;  4M6Y A;  4R8H A;  4Y17 A;  1LNW A;  1IXR C;  2EFQ A;  5LHG A;  2VBZ A;  1ZRF A;  2DT5 A;  5BS6 A;  1OMI A;  2DO7 A;  3K0L A;  3MZY A;  4S05 A;  1H9G A;  4KIG A;  1R5H A;  1QZZ A;  3CO6 C;  1HW2 A;  4L5J A;  3OV8 A;  3SXY A;  1IXS B;  1G6N A;  3M7G A;  3O2P E;  2QQB A;  4UHT A;  4G94 A;  3JAM Z;  2YSR A;  2HQR A;  2Q2E A;  1LB2 A;  1K78 B;  4GGG A;  4HBL A;  4RGX A;  4N0B A;  1BI2 A;  3V7S A;  2JT1 A;  4H0E A;  3O6B B;  2JRT A;  1RZ4 A;  3Q5F A;  4BQA A;  1H0M A;  3LFK A;  4ETS A;  3K2Z A;  1J7K A;  2CFX A;  2OBP A;  3TO9 A;  4KUM A;  2EB7 A;  4AVP A;  1O7F A;  3I64 A;  3DPL C;  3F21 A;  3EYI A;  5F6F A;  5LHH A;  5BOX A;  3FXU A;  3MWM A;  1W7P D;  4KMF A;  4ESF A;  2LKP A;  1PDN C;  4ZYE A;  4D0P A;  3I53 A;  2FNA A;  3GWZ A;  1KGS A;  4HF2 A;  4KN7 X;  2QBY A;  1IAW A;  4HLX A;  2VON A;  2YX7 A;  2IT0 A;  2A68 F;  5CVR A;  2Y48 A;  3NRV A;  2RGV A;  3LA3 A;  4MQ9 F;  1B9M A;  2FBH A;  4OOI A;  1JE8 A;  4GYG A;  4G8X A;  3IWF A;  2LNB A;  3QPH A;  2E7W A;  1LVA A;  4XLN F;  3J7A O;  1P4W A;  3T5X A;  4Y15 A;  1P2F A;  1E2X A;  4EJT A;  2P5K A;  1O3T A;  5E18 F;  1W7P B;  1F5T A;  3WGI A;  3ERE D;  4M6X A;  1T2K A;  1MGT A;  5DV5 A;  2D45 A;  2OU2 A;  2V1X A;  2P4W A;  1MZB A;  2O61 A;  3VOE A;  2K02 A;  2HTS A;  2TDX A;  4EJV A;  4IXA A;  3WTS C;  4S04 A;  1BIA A;  1EH7 A;  1LQ1 A;  2DTR A;  4KFC A;  1YS7 A;  3EDP A;  5JHU A;  1C0W A;  5IT3 A;  2VC1 A;  5KVR A;  2HFH A;  2FA5 A;  3ULQ B;  1ON2 A;  2M87 A;  4XBF A;  4CIC A;  4P96 A;  1YYV A;  5FLX Z;  3ZMZ A;  3FMR A;  2FML A;  3L9F A;  1TQI A;  3IKV A;  2G7U A;  5AIQ A;  2NRA C;  4G6Q A;  4HF0 A;  4EQQ A;  5ERI A;  1B6A A;  1ZLJ A;  1KQ9 A;  2RQP A;  2F5F A;  4XRF A;  4AD9 A; 
#chains in the Genus database with same CATH topology
 4NQW B;  1FP1 D;  2BVM A;  3FDY A;  5HDG A;  3L2U A;  1LJ9 A;  2PMH A;  5JLX A;  1ZQ3 P;  1O3S A;  2HPI A;  1KON A;  1LVK A;  2DYS H;  3CO7 C;  4IHX A;  2IP2 A;  3CQZ J;  1QVU A;  3ASO H;  3NQO A;  5J1Y A;  4EM0 B;  1GVD A;  3J81 Z;  4NC7 A;  3EYY A;  2ZJP F;  4Z2Y A;  4MIM A;  3H9G A;  2X85 A;  3PL8 A;  2ZJ2 A;  2W48 A;  1H9T A;  3BLY A;  4ZZD A;  1JHH A;  2D2W A;  3HPG A;  2JA5 J;  1QPM A;  2XHK A;  2JRM A;  1Q1H A;  5EZG A;  3KPH A;  2OD5 A;  1QRY A;  1X3W B;  1DP3 A;  2KJC A;  2BV6 A;  4M74 A;  3TP0 A;  3ABL H;  2UUZ A;  1TTY A;  1W7P A;  5DD4 A;  4EEF G;  4C2M J;  1JI8 A;  1YIJ I;  4LB6 B;  2A61 A;  1YX5 A;  3GCM A;  2QQ8 A;  3FXO A;  3VWB A;  4A5N A;  2A3S A;  4YFK F;  3AAF A;  3AG2 H;  3LOC A;  1QQI A;  3D1N I;  2JSC A;  1FPQ A;  2O03 A;  3BOQ A;  3B6C A;  1ZN2 A;  3EUH A;  3KX2 A;  4N4N B;  5EEA A;  2R7R A;  2FBI A;  4L9T A;  2MA3 A;  4XRS G;  3TW7 A;  3B02 A;  4BJ6 C;  3RPU A;  1BJZ A;  2VBY A;  3DEU A;  1WH5 A;  1OKR A;  3HRT A;  1TT0 A;  4PSX A;  2QVO A;  4BXX J;  3OYA A;  2VXZ A;  4RA2 A;  4D9J A;  1FEX A;  3CJR B;  2F5C A;  3F8C A;  3F23 A;  2NNN A;  1V5F A;  2EZK A;  4QWQ A;  3HGG A;  4M3B A;  4LLL A;  4BXU A;  1N78 A;  4XON A;  4BAY A;  4CXF A;  1B1B A;  4JX4 A;  1ZR2 A;  2ZXW H;  1FBU A;  2K9N A;  4C3I J;  1MSE C;  4HA8 A;  2ZCW A;  4UV9 A;  1LKX A;  1TWG J;  1JT6 A;  3M8F A;  1S5L C;  1W0U A;  3G6E I;  3OYH A;  5DYM A;  2BY3 A;  2IS6 A;  4Y7N J;  1E17 A;  1E3O C;  3MKL A;  1VQ7 I;  1LPQ A;  1G2H A;  2GA1 A;  2RAE A;  1GUU A;  2W25 A;  4XR6 A;  3F6O A;  5EGO B;  2PX9 A;  3Q0V A;  3S3O A;  3TOB A;  5IYD J;  3K4K A;  3TO6 A;  3HPH A;  2PFB A;  4U0V A;  4KIT B;  1SAX A;  3ZQQ A;  2E19 A;  2QEN A;  1WZ2 A;  1W36 D;  2KIM A;  5FD6 A;  2XF5 A;  4XMY A;  3ABT A;  4ZTF A;  4I98 B;  2RDP A;  2A5Y B;  4K2E A;  2XUB A;  1Z1D A;  3F3X A;  1UZC A;  4LG3 A;  3R4K A;  1UHM A;  4UXN A;  1TQM A;  5FB2 A;  3LAJ A;  3LSM A;  1IXC A;  2X0L A;  3NAU A;  1R1T A;  2QQA A;  2VQC A;  1D8J A;  3ZMV A;  2YR2 A;  2DK8 A;  3ECH A;  4HEA 2;  3RI4 A;  1ACI A;  3QYE A;  4UVB A;  1PJR A;  3NEU A;  1JTY A;  2GIZ A;  3HKZ N;  3I5U A;  2FE3 A;  1J0R A;  1DPR A;  3VSL A;  5HNF A;  2DW4 A;  3C2B A;  4M6V A;  3MD2 A;  4B3A A;  1WGX A;  4Q4Z F;  4KNY A;  5JLW A;  2DA1 A;  2K4J A;  4RAG A;  5KCM A;  2QEX I;  1YLF A;  1D5V A;  2PG4 A;  4U0W A;  2KIU A;  4R1H A;  1YO5 C;  2AO9 A;  4M71 A;  3ZPL A;  2NVT J;  4IF4 A;  1MSF C;  3MQ0 A;  4AD9 A;  3WTU C;  2G9W A;  1VQP I;  2HYJ A;  5J4V A;  3LSJ A;  1REP C;  4C2U A;  3KEY A;  5DCM A;  2E2H J;  3CF2 A;  1U9N A;  3MCZ A;  4LOC A;  5CQE A;  2LD5 A;  3ABK H;  3FK6 A;  1CQT A;  1FBQ A;  5B66 C;  1OYW A;  3FF5 A;  3WG7 H;  3KP3 A;  3I4M J;  2DLL A;  2V9P A;  4HX7 A;  1SAU A;  2MLK A;  5GAG J;  4ZYD A;  4RGR A;  4PGH A;  2JJ7 A;  2D1V A;  4HDV A;  1QA6 A;  3UKG A;  4A3F J;  1HKS A;  1K4T A;  2WB1 A;  1T0F C;  1WJF A;  3DCF A;  4WXH A;  1BN5 A;  3F8M A;  4OAY A;  1XSD A;  4BQQ A;  2QZ8 A;  4B3X A;  4MFE A;  4I99 C;  4HV6 A;  4HX4 A;  1IN6 A;  3WHC A;  3FXL A;  3WU1 B;  3OYD A;  4AU7 A;  5C44 J;  2B9S A;  4Y4R A;  2ZSH B;  2LK2 A;  2A6T A;  2UXN A;  1MBE A;  4BBR J;  5D4S A;  5H2F C;  1KU3 A;  1TP4 A;  4NB5 A;  3MAJ A;  2CQK A;  3MKW B;  2ID6 A;  2DDA A;  1FBS A;  3BTI A;  1YTY A;  1HKT A;  2EA4 A;  2O8K A;  4BDZ A;  5E79 C;  3H5N A;  1RET A;  3LSH A;  1FY7 A;  2ZO4 A;  2UXX A;  5EYR A;  2DA2 A;  2M8G X;  2MC3 A;  3V8K A;  2HZT A;  1FOK A;  2AXL A;  4IOC F;  3AG3 H;  5JI6 A;  3COA C;  5EG0 B;  4V2G A;  2LC2 A;  3DU6 A;  4XSZ F;  1FOX A;  2F6C A;  1TWA J;  4L5E A;  2X6W A;  3BP8 A;  5F64 A;  2O6G E;  3BDD A;  4IHT A;  3TMO A;  5EGO A;  3L2C A;  2DFE A;  5LGU A;  2P5L C;  3GTG J;  1P7I A;  4CCL A;  4XKC A;  3R61 A;  4ZYG A;  1MMN A;  2E34 A;  4H4K C;  2LH9 A;  1O57 A;  3SEQ A;  1S7O A;  1UG0 A;  4DBR A;  3FM5 A;  3FM3 A;  4M3G A;  5FRO A;  5M3F J;  3K69 A;  2XV4 S;  1RNL A;  3U1D A;  1FYM A;  3TO7 A;  3AKZ A;  3I71 A;  1WI3 A;  3PNV A;  2HVS A;  3PIP F;  1J75 A;  1OQY A;  2QKL B;  4G7Z F;  1T38 A;  1G59 A;  4B09 A;  4LJZ F;  3BG9 A;  2HKX A;  3G71 I;  5IOY A;  2ZJQ F;  1S72 I;  1H8A C;  4MNU A;  1T98 A;  2K85 A;  3F0C A;  2DMP A;  2LTP A;  1SAN A;  5BPD A;  2X9D A;  4OMZ A;  1R4N B;  5DTD A;  2PLY A;  2QKM B;  4YIF A;  1J9I A;  3J80 Z;  4L18 B;  2ACJ A;  2D1H A;  2YU3 A;  3A01 A;  2KDO A;  4AVZ A;  2FXA A;  5CVU A;  1HSJ A;  2Y0S A;  1Z05 A;  4EVI A;  2O8X A;  3VYT B;  2HPM A;  2XSD C;  1OFC X;  4OAZ A;  3LAP A;  5CVJ A;  3HBL A;  3H92 A;  2CQQ A;  1U2W A;  2EH3 A;  1DQU A;  1J09 A;  1RI7 A;  2GAU A;  3SJM A;  2DOF A;  1USS A;  4CYD A;  1A04 A;  4ZH4 F;  5DDG A;  3GUD A;  2PI0 A;  4B44 A;  2HTJ A;  4ZJZ A;  3G3Z A;  1JHF A;  4IJA A;  4PGG A;  1A6Q A;  2OTL I;  2P5V A;  2RNG A;  1FLI A;  4L0Y B;  5ILS A;  4XN0 A;  4I6Z A;  3GYH X;  2M4G A;  4NBQ A;  4HSR A;  1X19 A;  2FX0 A;  1JT0 A;  3E6D A;  1X3U A;  3K9T A;  2DMU A;  2ME6 A;  1IF1 A;  5GPA A;  2XAS A;  3IP4 B;  4YG2 F;  2W84 A;  5GPC A;  1U78 A;  4V19 K;  3LL7 A;  5FLM J;  2KIS A;  2EIN H;  1R49 A;  3OYG A;  2X48 A;  1I3A A;  2Y9Y A;  1SFX A;  1LEA A;  4LIT A;  2PJR A;  1YG2 A;  1HST A;  3K70 C;  4IRH A;  2GOM A;  3ROU A;  5H6R A;  3H3V K;  1IV8 A;  2VBX A;  2M4K A;  4BDY A;  1RC9 A;  3TDZ C;  1YI2 I;  3S17 J;  1WI9 A;  2XF7 A;  1FOY A;  2H09 A;  2EFO A;  2LSO A;  5IP6 A;  2MH2 A;  1WJA A;  1S3J A;  3ZQ7 A;  4E6K G;  3W6V A;  5HOD A;  3K70 D;  1RES A;  3JCU C;  5D6E A;  4KA4 A;  4EGZ A;  4BE1 A;  5A2Q Z;  4FE7 A;  1BL0 A;  3SHF A;  3ZXS A;  4MEX F;  3CCY A;  2A69 F;  5LRR A;  2V1D A;  4E7J A;  4F7Z A;  4CDG A;  2LYC A;  1GVJ A;  2Y0S N;  4OWR B;  3WU0 A;  2A5W A;  3GFI A;  2K9S A;  2MD5 A;  1GT0 C;  2R5Y A;  4BY1 J;  2N8G A;  3KEQ A;  4I01 A;  1H88 C;  3E1S A;  1X2N A;  3TBI A;  3KET A;  1YW8 A;  1Z9C A;  4EM1 A;  4GXO A;  3I4N J;  1KQ8 A;  3GW2 A;  2HDW A;  4UVA A;  4ON0 A;  4YEL A;  1X1C A;  1B59 A;  1B4A A;  2EK5 A;  3VSK A;  2FEZ A;  3BC8 A;  3TGN A;  3R60 A;  2RNJ A;  4BHC A;  2E5Z A;  3D5R C;  2R7X A;  3KP7 A;  3VPR A;  1DDN A;  5DM6 F;  2W85 A;  5D4R A;  4MO7 A;  1PUE E;  1P4A A;  3GZN B;  2MG4 A;  3OSF A;  4JYK A;  4IRI A;  3GME A;  2O3F A;  4EJW A;  2LVS A;  5F27 A;  2BW3 B;  2R3S A;  2ELK A;  1TLH B;  4RAY A;  5HLH A;  1IN5 A;  1YOV B;  3CCL I;  1MDM B;  1IW7 F;  3ZQH A;  4IHS A;  2ZB9 A;  2DPU A;  3HSR A;  1ERD A;  4MFD A;  1WSU A;  1A6I A;  4BL0 B;  2LR8 A;  2ZXI A;  4CGZ A;  2EJR A;  4DOZ A;  3Q0W A;  4W1U A;  4XLA A;  3LWF A;  1I1G A;  4M9X A;  2P7V B;  4JP0 A;  1QGP A;  3SEZ A;  2GXB A;  5L3F A;  1P92 A;  2JA7 J;  3HOS A;  3LNQ A;  3DLL F;  2VI6 A;  2K7L A;  3ABU A;  3CUO A;  3ZN1 A;  2PMZ A;  1Z6T A;  4MEY F;  1JXS A;  4XLE A;  1FP2 A;  3BZC A;  2UZK A;  5TRD A;  5J40 A;  1V5G A;  2FNP A;  1HQC A;  3J80 K;  3F8N A;  1NK2 P;  1BOB A;  1XCB A;  1KU2 A;  4GYI A;  1CF7 B;  5E8G A;  4ZC3 A;  1HDP A;  1TQP A;  2DJN A;  4GRI A;  5DUK A;  4A69 C;  1S6L A;  1XGS A;  3LA7 A;  3VYS B;  2JA8 J;  3A0B C;  4AWX B;  5D8K B;  4E7I A;  2WAF A;  4CCO A;  5IYC J;  2DAO A;  5FFX A;  4BHP A;  2OPT A;  4FTH A;  4I7H A;  4PJ0 C;  3OR1 C;  3PSI A;  5DD8 A;  2ETH A;  2TCT A;  1BOA A;  2V9V A;  2XC7 A;  3RKQ A;  5IPA A;  1OJL A;  5CKT A;  3K4C A;  5HS7 A;  2Z16 A;  4I0B A;  3EUK L;  3HDD A;  2Z1D A;  4PFO A;  1YJ9 I;  3B6A A;  3B73 A;  2VOO A;  1PYV A;  1FMW A;  2JK3 A;  1FWZ A;  2PBI A;  3OYF A;  3DLA A;  3TL4 X;  2FD5 A;  2H8W A;  4ASN A;  5JFR A;  5JVT A;  1MW7 A;  2B0L A;  1X4P A;  3V7R A;  1ON1 A;  4G7O F;  1NTC A;  1STZ A;  1G3T A;  3RIR A;  1ZR4 A;  5FLX K;  1QNT A;  5EF6 A;  1FIP A;  2H6B A;  5ICE A;  3S16 J;  1T33 A;  2XRO A;  3DPT A;  3GBG A;  2M30 A;  2A05 A;  4HW0 A;  4RB1 A;  1WH7 A;  3HRS A;  1U8B A;  2ESN A;  3QYB A;  5HS9 A;  3GZ6 A;  1VQ5 I;  4HV5 A;  1W1W E;  3K4M A;  4BGD A;  1WCM J;  4U88 A;  1RIO H;  3I54 A;  1LEB A;  3ZQG A;  3HEF A;  5FJ8 J;  2O0Y A;  1K78 A;  1O3R A;  1ZHF A;  2DXI A;  2C6Y A;  2XKP A;  1UST A;  3K4L A;  4UUV A;  2MLG A;  3C2H A;  3HOT A;  1FT9 A;  1RR7 A;  3JRD A;  3GTO J;  1MBF A;  4RLF A;  3CCU I;  2MC4 A;  4A5M A;  3ZQL A;  1BI3 A;  2IPQ X;  2ZNY A;  1ONV A;  3KEO A;  1R36 A;  2I10 A;  3CUQ C;  5EDN A;  2WY8 Q;  3DWL E;  3WGG A;  1JJ6 C;  4XLH A;  2P0W A;  3HOU J;  2K5C A;  2COB A;  1SVM A;  1BI0 A;  2OCC H;  3H5A A;  2HOS A;  1SFE A;  3PUF A;  1VZ0 A;  3G2B A;  1K6Y A;  3QPL A;  3I59 A;  2L9V A;  3E3V A;  2ISZ A;  1S29 A;  2R5Y B;  5IT9 K;  4A12 A;  4CCM A;  3GX4 X;  3HRM A;  1VI0 A;  2EBI A;  4UB8 C;  2P8T A;  1R58 A;  3GEZ A;  3BG7 A;  4JBA A;  4WWC A;  2DTZ A;  5K5Q A;  1WJB A;  3K1P A;  2EV5 A;  5JVG F;  3F6V A;  3ELK A;  3H9J A;  2X51 A;  2QQ9 A;  3ZMD A;  2VE9 A;  3DEE A;  2VLA A;  1Y39 A;  4CCN A;  2X1E A;  3A4C A;  1G3S A;  2NVX J;  2H6C A;  2H1L A;  2NXN B;  4RLQ A;  3V42 A;  1SC7 A;  3DTE A;  3E5X A;  1R00 A;  3PUB A;  2QGU A;  1JKQ C;  2IRF G;  2BOL A;  3MZ8 A;  3JRC A;  5HDK A;  3CUQ A;  4F52 A;  4CZC A;  4ENJ A;  2E7X A;  2VAS A;  1MJ9 A;  4IL6 C;  2ZFU A;  3U21 A;  4I76 A;  2ICW G;  1RKT A;  2HOA A;  2XRL A;  4KIS A;  3WGH A;  1KU9 A;  1VQM I;  5M5X J;  1O4X A;  3QAH A;  3OYI A;  4NQW A;  3I3L A;  5E20 A;  3IRQ A;  4FE4 A;  2VQH A;  1U5T C;  1UG2 A;  2XB5 A;  2WBM A;  1NH3 A;  3CLQ A;  3LA2 A;  5HS8 A;  1EH6 A;  2YX4 A;  2HWV A;  4ESB A;  1JUP A;  4XOR A;  1IDY A;  2XRN A;  3ZOB A;  2E36 A;  2E5N A;  4N4O B;  1HW1 A;  3VOD A;  2OTJ I;  2CUZ A;  2DN0 A;  1BC7 C;  3R0A A;  3IWZ A;  4PFP A;  4E7K A;  2GBY A;  1ZLK A;  3TOA A;  1LDD A;  4A3G J;  1MNE A;  4CHU A;  2VT2 A;  4KIC A;  4DNC A;  1ZGJ A;  1XSV A;  4FIS A;  1T0F A;  2BGC A;  4CZZ A;  2W1O A;  1OR7 A;  2DFF A;  1EH8 A;  1U5T B;  1HLV A;  1XG1 A;  1IN7 A;  4RB0 A;  1AA7 A;  1Y1W J;  5D5V B;  1QZE A;  1XDU A;  1QZY A;  1HDD C;  4HG2 A;  4W97 A;  4D7N A;  1U6G A;  1A36 A;  1ETY A;  1N77 A;  4EAT A;  2H27 A;  2PEX A;  2DJI A;  2IAI A;  3CME I;  2KZV A;  2M9H A;  1D1A A;  4FET A;  4XM3 A;  3GTK J;  1V4R A;  4BXF A;  3OYE A;  3BY6 A;  1K79 A;  1MMD A;  4FX0 A;  4JQF A;  1ORK A;  1F1Z A;  4FQG A;  4PJL A;  3HSF A;  1YX3 A;  3PO3 J;  5CQG A;  2HKO A;  2JTV A;  4KDP A;  1G3W A;  3IAM 2;  3KP2 A;  4KIF A;  4AYB N;  5J8F A;  3S1Q J;  1WJD A;  3M9A A;  4AID A;  2PMU A;  4C30 A;  3U2R A;  1JKO C;  1RUO A;  3LSK A;  3J7Z I;  3ZQF A;  2XIG A;  1D1B A;  2E35 A;  3JAM K;  1MBJ A;  2ZXJ A;  1I1S A;  2EFP A;  3QPT A;  3L2W A;  4UUS A;  3KFW X;  1X4O A;  2E1O A;  2L5Q A;  5L3D A;  1TWF J;  3GTP J;  1E3P A;  4BH9 A;  2DYR H;  5K1Y A;  2YPR A;  4XKW A;  4I0A A;  3C1D A;  1A31 A;  4E4H A;  3IH4 A;  5H6Q A;  3BZK A;  2EV0 A;  3ZQI A;  4DYQ A;  5GTI C;  2KIQ A;  1U0J A;  2JZY A;  3H3U A;  4I2O A;  2B63 J;  1FNN A;  3FHZ A;  4LK1 F;  1X58 A;  1Z6R A;  3SFZ A;  1QHH D;  3GTM J;  3W2A A;  3CJN A;  2Z33 A;  4KN4 X;  3P9K A;  4Q48 A;  4YIR X;  1APL C;  1TNS A;  3DKW A;  2EIJ H;  5LHI A;  3GLX A;  4XKB A;  2EZI A;  3HHH A;  3ZR8 X;  2IVM A;  3X2Q H;  3L1P A;  4FX4 A;  1IRF A;  2LY1 A;  3RSN A;  1KU7 A;  5ILV A;  2M8E A;  5FD5 A;  1RPW A;  4RMN A;  1SFU A;  2V6C A;  3CTA A;  5LEK A;  2MFZ A;  3GXO A;  4I09 A;  3SQN A;  2WA0 A;  3ZMT A;  5FRN A;  2L7M P;  1JGG A;  5AON A;  4QSH A;  3KZY A;  4EM2 A;  4ZYH A;  3L7W A;  2K4B A;  4RB3 C;  4A6D A;  5KHD A;  1S8N A;  3GFJ A;  3V8J A;  5L3E A;  4A0Y A;  4AYB A;  2DOA A;  2BY0 A;  3VEP A;  3E6C C;  3PM1 A;  3CJT B;  2Z2S B;  3M8J A;  5HDN A;  2XGX A;  1VND A;  3IRR A;  2Y75 A;  4ZDO A;  2ME0 A;  2Z99 A;  2L9S A;  2DA4 A;  5BNG A;  1V3F A;  4X0G A;  1K61 A;  4YFX F;  4E7Z A;  3WG9 A;  1T8I A;  3I59 B;  4LG0 B;  2MD0 A;  3OL3 A;  3SDB A;  3TDU C;  1TZL A;  2GXA A;  4QLC U;  1YIO A;  3LQQ A;  2M2E A;  1IG7 A;  4B1R A;  2R7Z J;  3BZ6 A;  4QTR A;  3UNG C;  2BXY A;  2GM4 A;  3DQV C;  2VKH A;  4OIP F;  3E7L A;  1I27 A;  4UNO A;  3JRA A;  3ABM H;  3ECO A;  2LKS A;  5K7F A;  1L3L A;  2W24 A;  3OYJ A;  2VT3 A;  2G7H A;  4HOB A;  5D5U B;  4XLF A;  3PNT A;  3CCM I;  4A0X A;  3HOV J;  1MBH A;  2IW5 A;  3TP3 A;  4ZTJ A;  2DA3 A;  4NDL A;  3IH3 A;  3BG6 A;  2ZNZ A;  1RRJ A;  3CUQ B;  1XS9 A;  2CV1 A;  1V55 H;  4LGW A;  4ENK A;  5EEH A;  4J19 A;  2L4M A;  1ETV A;  2Z5U A;  3QWL A;  3W6K B;  2ZME B;  4ENM A;  3ISP A;  1JUM A;  1BW5 A;  3OYK A;  1ZRE A;  3FBN B;  3TQN A;  5GP9 A;  2WV0 A;  4LIU A;  3HG9 A;  3D0S A;  1PP8 F;  5E1X A;  3L2R A;  4DBQ A;  1I50 J;  3E6B A;  3DKX A;  1BIB A;  3EUA A;  3ZN0 A;  2WWY A;  3P9C A;  3RZD J;  4BS9 A;  3T1B A;  2V6E A;  5J1U A;  2EIL H;  3S2H J;  2ZJR F;  2K9L A;  4HNV A;  2FRH A;  1JKR C;  4HF1 A;  2CO5 A;  5E3L A;  2EPF A;  3FMS A;  1E0E A;  1KZH A;  4D5C A;  4CYC B;  1T56 A;  3MFK A;  4XL9 A;  2HDD A;  2GLO A;  1S9H A;  2E1M B;  3G1M A;  4MTD A;  4BE0 A;  2VE8 A;  2VIX A;  4HX8 A;  3F8F A;  1AU7 A;  3H5R A;  1WRJ A;  3KZI C;  5HLG A;  3WTX C;  2UWM A;  5IY5 H;  2VN2 A;  1XB4 A;  4LB5 A;  1B72 B;  3Q9S A;  2WV1 A;  6PAX A;  2L01 A;  5JHF A;  3OS1 A;  4EGY A;  2AS5 F;  3WTW C;  4EV0 A;  2OQG A;  3L2Q A;  1OPC A;  3FBI B;  2HI3 A;  2E60 A;  4BJT A;  1D0Y A;  1GV2 A;  3SYT A;  4DQ2 A;  3J7A Y;  2IGK A;  2JVG A;  4X6A J;  3S1M J;  2W57 A;  1I39 A;  2NS8 A;  3V7C A;  2BE5 F;  5DCM B;  5FGM A;  1WJC A;  5IP7 J;  2DA5 A;  2DQL A;  1A35 A;  1Z77 A;  4AC0 A;  2DT6 A;  2XAJ A;  1R1V A;  3E97 A;  2VOP A;  4R79 A;  4IEJ A;  4LK0 F;  1TW3 A;  2FQ3 A;  2DDB A;  1XPX A;  2JQ7 A;  3VB2 A;  1ZTR A;  2DI3 A;  2DMQ A;  3AG1 H;  3JRF A;  3K7A J;  3CF5 F;  3QU6 A;  4MGR A;  1XGO A;  2QF7 A;  3FZV A;  4M9Z A;  3S2W A;  1OCO H;  3MVP A;  2VJI A;  2VC0 A;  5LGN A;  3U9G A;  4J00 A;  1RKW A;  1WWX A;  4DW6 A;  4HNT A;  1M1E B;  2HQN A;  3JTH A;  2E71 A;  4JOM A;  4AIK A;  2FOW A;  4OIQ F;  5CLS A;  2OZ6 A;  3D5L A;  1X3Z B;  4F92 B;  2XPW A;  2LBF B;  2DMT A;  4PJN A;  2K3P A;  3ZMU A;  2KL4 A;  2X6X A;  2OAZ A;  3NWT A;  1K83 J;  3ZGK A;  4BUP A;  4YRV A;  1LFP A;  2KZG A;  4ZZL A;  2JPB A;  1SVL A;  4RAF A;  4BAC A;  3BT9 A;  2CG4 A;  1SD7 A;  1RR8 C;  4Q5S F;  1NG7 A;  1Y56 A;  2R7W A;  5E1W A;  2AQE A;  4Y52 J;  2L9N A;  1YW7 A;  4D1Q A;  1XMA A;  1ZK8 A;  1K7A A;  3OS2 A;  3PFI A;  2WTE A;  4N9I A;  3CES A;  3K6G A;  3BWG A;  2BY2 A;  2ELH A;  2OA4 A;  2ECC A;  4DYR A;  4XQF A;  1W0T A;  3EPZ A;  3S1N J;  2DFI A;  2Q1Z B;  1WJ5 A;  2XGE A;  3U1K A;  1MMA A;  1Y8Q B;  2R5Z A;  1FSE A;  2EZH A;  1OYY A;  1P7J A;  5HLT A;  3VDX A;  1Z0X A;  4QPO A;  5KK1 A;  2E1C A;  3RPQ A;  3Q0U A;  4U7B A;  2FBK A;  1ETQ A;  1UFM A;  2A6E F;  5CPR B;  1IUY A;  2IA0 A;  1Z3X A;  2ELJ A;  3JRG A;  1Q1V A;  2OF7 A;  3FX3 A;  1LFU P;  2PJR B;  3CMY A;  1Y6I A;  4AIJ A;  1MBK A;  2K27 A;  3WTV C;  2ZC2 A;  2F2E A;  1MH3 A;  3N97 A;  2WC2 A;  3PIO F;  4ENN A;  2L9R A;  3EET A;  4PCQ A;  3TKY A;  3I4P A;  5K7Z A;  1BW6 A;  2FJ1 A;  3A01 B;  2PJP A;  5ED4 A;  3OSG A;  3DBL B;  3O8G A;  1XD7 A;  3IC7 A;  5HOO A;  4L5I A;  2KRH A;  2A6H F;  1YJN I;  3S2D J;  1B9N A;  3G73 A;  5M3M J;  4ESJ A;  1O7L A;  2OC6 A;  2XAG A;  3CP8 A;  2JUG A;  2ADU A;  2WB1 N;  4II2 A;  4LLG F;  1XGM A;  3CC2 I;  2DA7 A;  5B1A H;  5IT9 Z;  4I02 A;  3JRE A;  2OCE A;  1FTZ A;  2R7D A;  1XDS A;  1GLN A;  3IKT A;  4L9V A;  2EWN A;  4A2U A;  5IP9 J;  3BG5 A;  1XGN A;  1G8X A;  3OWT A;  4CCK A;  3IHU A;  3OOP A;  2QWW A;  2XDV A;  5EJC A;  5ICF A;  4Z6Y A;  2RKH A;  4IPA A;  1ZG3 A;  2XSJ C;  3CDH A;  5J4Y A;  1R6R A;  2D5V A;  2JMW A;  2JSP A;  4N9H A;  2M45 A;  3BRO A;  3Q3S A;  3S14 J;  1I6X A;  3T8R A;  2ZSI B;  3GLL A;  1FSH A;  2ID3 A;  2BEO A;  5FKL A;  5LEJ A;  1TWC J;  1SD4 A;  3L09 A;  3OL4 A;  1I5Z A;  3HXL A;  1PUF B;  1YHQ I;  2HZD A;  4LLN A;  1LFB A;  2HOT A;  2Y9Z A;  3ML6 A;  4HPQ A;  4IKF A;  1FTT A;  2PQ8 A;  1IRG A;  3ZP5 A;  1JKP C;  3E5U A;  4KYW A;  1YQA A;  4M9S A;  2ECB A;  2VL8 A;  3QOE A;  4LG0 A;  2HNH A;  3R0J A;  1EKE A;  3A02 A;  3WTY C;  1F9N A;  1NG6 A;  4E7H A;  5E3N A;  3GZ5 A;  1LDK B;  1R23 A;  2YUS A;  3CLO A;  3DEW A;  2F5D A;  5DM7 F;  4G6D A;  3LFU A;  1KYW A;  1T39 A;  1ZAR A;  1ZGA A;  2XKO A;  1ZG5 A;  2G0E A;  4ZYA A;  3BPV A;  4NNJ A;  2DMN A;  3CC7 I;  5M5Y J;  3JSO A;  1AKH A;  2HGC A;  3WE3 A;  2EQR A;  3FMQ A;  4O5V A;  5EEG A;  3M4O J;  2LY2 A;  3QP6 A;  3HHG A;  1J2X A;  2FQ4 A;  3CDL A;  3RPU D;  2VOD A;  1IDZ A;  2LLK A;  2XAF A;  1R5I D;  3CMA I;  1XSX A;  2R7O A;  2M1B A;  4HNU A;  3E6M A;  2R7S A;  2EV6 A;  4OIN F;  4XID A;  3H0D A;  4IO9 F;  3ESW B;  4UUS B;  1KQ0 A;  3BJ6 A;  1IZ1 A;  1R22 A;  2VJJ A;  1DUX C;  4XLC A;  1GV5 A;  1OYI A;  2Z3Y A;  3NAR A;  2QBY B;  4IQJ A;  2GWR A;  1HC8 A;  4F55 A;  3PNY A;  3I55 I;  2VQG A;  2EIK H;  3CZ6 A;  3ZRG A;  4B4C A;  1GXP A;  2BZT A;  2ZFW A;  4M73 A;  4A3I J;  4CO8 A;  1POG A;  3KLN A;  3KP5 A;  1Y0U A;  5HVQ C;  3D5S C;  1MMS A;  2QSH X;  4FHT A;  2QUF A;  2K9Q A;  1IN8 A;  4BQO A;  5ICG A;  3RKX A;  2WY7 Q;  1W5C C;  3FK7 A;  2H1K A;  2L7F P;  4YII A;  3H3Z A;  2QYO A;  4HDU A;  3N4M A;  2K9M A;  2VKD A;  3WU2 C;  4KMU X;  3V8L A;  1SMY F;  2JPC A;  3GFM A;  1IN4 A;  3S1R J;  5C3E J;  2CSO A;  2MW8 A;  1VQL I;  3ONQ A;  3V4G A;  1ZRC A;  4BHB A;  5LFA A;  1UEL B;  4M72 A;  4XNF A;  3HZJ A;  2KMU A;  2PN6 A;  2F5E A;  3OR2 C;  1BJA A;  3HM5 A;  1B72 A;  2L4A A;  1MD0 A;  1OCR H;  2GIV A;  2V79 A;  2Y0M A;  4F93 B;  2F4M B;  3FKJ A;  1DGW Y;  4HAM A;  3OIQ A;  4HRI A;  2HEO A;  1BR2 A;  2X6O A;  5E17 F;  1D1C A;  4A93 J;  3FIS A;  2Q0O A;  4OU0 A;  4IHW A;  5L3C A;  2V1N A;  1GDT A;  3I58 A;  1I6H J;  2RQQ A;  1W5T A;  1Y0N A;  1TNT A;  4UVC A;  1IV6 A;  1R9T J;  5E1Z B;  1SFO J;  4MTE A;  4XSX F;  1R4M B;  1K4S A;  4A3M J;  1SFK A;  4KT6 A;  3BJA A;  3HJE A;  1VFC A;  2FU4 A;  5FRM A;  5FO5 A;  2CS3 A;  4BYY A;  2L3D A;  3HUG A;  3UR3 C;  1PP7 U;  2NVQ J;  3J7Y J;  4XKV A;  4YEJ A;  5DCF A;  5J8C A;  2HS5 A;  1F4K A;  1UAA A;  5L3G A;  3S93 A;  2E1N A;  4BBS J;  1QVT A;  1VQO I;  3LSG A;  4FT8 A;  3JTG A;  1AOY A;  2LBF A;  3MKZ A;  1X1A A;  3IAS 2;  2KKO A;  2RV8 A;  2LMD A;  5F0C A;  5J3L A;  3A2K A;  3PO2 J;  1RUN A;  1UB9 A;  1QO0 D;  2BY1 A;  3SZT A;  1W4M A;  1FMV A;  2F4I A;  3R6S A;  2EFW A;  4LFU A;  2Q8K A;  5IOZ A;  4EJO A;  2AXT C;  1OR7 C;  3KZZ A;  2LFB A;  2IGN A;  2EIM H;  1WKM A;  2KLO A;  3WOD F;  2W00 A;  2RVC A;  3BPX A;  1A5J A;  3LSP A;  2IS1 A;  3QU3 A;  4JK1 X;  1G4D A;  4Y33 A;  3JSP A;  3WTT C;  2DA6 A;  1ENH A;  2I5U A;  1FYK A;  3RKY A;  2LG4 A;  2W82 A;  4WCG A;  4A3B J;  1F43 A;  3PSF A;  2VBW A;  1NHA A;  4RBO A;  1BR4 A;  2XPV A;  3DFG A;  3E5Q A;  4GCV A;  4JX6 A;  2BW3 A;  5C4J J;  1UCR A;  5FFZ A;  5BMZ A;  3CCE I;  3ZQC A;  4GDF A;  1TW2 A;  4OMY A;  4G6T B;  5CJ9 A;  4CYC A;  1ZG1 A;  2KP6 A;  4KIB A;  3O3K A;  3ZMS A;  2KRC A;  4J01 A;  1Z21 A;  2JA2 A;  2R7F A;  3DBR B;  2HDC A;  4IRG A;  1HCR A;  2LRE A;  3RYR A;  1J5Y A;  2NOG A;  4C3H J;  3IL2 A;  5DS9 A;  3GFL A;  5DEQ A;  5FKN A;  2X1D A;  4RS8 A;  1SD6 A;  2ISY A;  2F48 A;  4MHG A;  1V5E A;  2DOD A;  4CUG A;  4WF2 A;  3L00 A;  2OQR A;  1XCV A;  3MN2 A;  1VF9 A;  5ILU A;  3HB9 A;  2VJ4 A;  1FZP B;  3LST A;  2CGP A;  2OZU A;  3DP7 A;  3BR2 A;  1QU3 A;  3RDI A;  3C7J A;  1DGR M;  4A6E A;  2M34 A;  3MMY B;  4XLP F;  3OOU A;  4ITV A;  5LLQ A;  1AWC A;  4IQ4 A;  4DZJ A;  3PQJ A;  1XC5 A;  3RQI A;  5KAF C;  3A0H C;  2DQR A;  1GHC A;  3HL2 A;  5GAE J;  2FMY A;  2V9K A;  3HKZ A;  3GTJ J;  3I9V 2;  3HSE A;  2R7V A;  3CCV I;  4Y13 A;  4AIH A;  2L7Z A;  2KDZ A;  5TIS C;  3RTR A;  2GZW A;  2QM3 A;  1ULY A;  2CWE A;  4RGU A;  4DYC A;  1H89 C;  1HXD A;  2Y30 A;  2DU9 A;  2QCO A;  1CGP A;  5D5X B;  3QP5 A;  2BYV E;  2XVC A;  4PK4 A;  1YJW I;  3O8H A;  4IOA F;  3FXR A;  2IJL A;  4ZDP A;  3HOX J;  2JN6 A;  3SDG A;  4P1W A;  3M3Y J;  1EV7 A;  2KT0 A;  2NS7 A;  1D3Y A;  1LUJ B;  1WVR A;  2XAH A;  1FIA A;  4C3J J;  3G1O A;  3K1M A;  2NVY J;  4IZZ A;  2YS9 A;  2DCE A;  1X1P A;  1IJW C;  5F0F A;  1MNM C;  1Z91 A;  2VJ5 A;  5J6X A;  2XF6 A;  3BJO A;  4HQE A;  2CYY A;  2FUG 2;  3GTQ J;  2HYF A;  2H8R A;  3I56 I;  1WPK A;  1S7A A;  3T8T A;  1QPI A;  4OIR F;  5D8L B;  3DXJ F;  2F5V A;  4PJJ A;  3DBH B;  5HLI A;  5TJJ A;  2A07 F;  3N05 A;  5K5O A;  1QBJ A;  4BQN A;  3OYC A;  3KP6 A;  2MSY A;  3DTK A;  3M8E A;  5CVI A;  2CH0 A;  1YRN B;  4TV7 A;  2CW7 A;  5AIP A;  4AUX A;  1DPU A;  2MBF A;  4M3E A;  1XMX A;  4U0Y A;  3GF2 A;  4IX7 A;  5IYB J;  1Z7U A;  1KYZ A;  4WXD A;  1S7E A;  4P9F A;  1ETO A;  5C4X J;  2BBY A;  1FYL A;  2XGC A;  2JUC A;  2L7K A;  4ABZ A;  4M3D A;  4G7H F;  5JR3 A;  1HBX G;  1TC3 C;  3WE2 A;  5GTH C;  3JRB A;  5FKO A;  2K86 A;  3BQY A;  3DF8 A;  3HYI A;  3K4B A;  2NNY A;  5LD2 C;  4IHV A;  1HKQ A;  4JX5 A;  5A2Q K;  2KIF A;  3H9Q A;  1UHW A;  3HIF A;  4LMY A;  1HW5 A;  5H20 A;  1VQN I;  3OY9 A;  1JGS A;  4UV8 A;  1U8R A;  4Q47 A;  2VB6 A;  2CJJ A;  2V1U A;  2QSF X;  5E8I A;  1MND A;  2GQQ A;  1P6R A;  2LRD A;  2R4G A;  2Q2E B;  1L0O C;  3OYL A;  2RN7 A;  1MJA A;  3OS0 A;  1NK3 P;  2CQ7 A;  1FOW A;  1UJ8 A;  4XN3 A;  2STT A;  3LQR A;  2HOE A;  1MKM A;  3P7N A;  2CW8 A;  4WXC A;  2CQN A;  1HF0 A;  3JW4 A;  4NHJ A;  1N75 A;  2DK5 A;  3NWS A;  1OIS A;  3RJP A;  3TED A;  1EF4 A;  4G9Y A;  4M3F A;  3BR3 A;  5K5R A;  3REO A;  2H94 A;  4C9Y A;  1U5T A;  2BHZ A;  3CD6 I;  5KNL A;  4A3D J;  2LDU A;  4U87 A;  5FKK A;  4U7D A;  5CVV A;  3AFH A;  1DU6 A;  4P55 A;  1SD5 A;  1T6S A;  5J1R A;  5EZH A;  2STW A;  4QPQ A;  1ZYR F;  1Z3Y A;  2ZBK A;  4DIQ A;  4II3 A;  3F72 A;  1KA8 A;  4HZF A;  4UY8 I;  1JUS A;  2HXI A;  2EFN A;  3ERM A;  2BXZ A;  3F8B A;  4BE2 A;  1VTN C;  4L9N A;  1WQ2 A;  4FCY A;  2R7T A;  3GVA A;  4LD5 A;  2OUM A;  1IO2 A;  4Y3O A;  3RYP A;  1U9O A;  3QPS A;  2IGM A;  2L54 A;  3K4N A;  2LOO A;  2P6T A;  2K40 A;  3DTI A;  3HRU A;  3RKW A;  5F1J A;  1DP7 P;  1MH4 A;  1E3H A;  2Y69 H;  2P6S A;  5BQT A;  2AHQ A;  3OMY A;  3OIO A;  1XMK A;  2LF8 A;  3QOP A;  4A3E J;  2I8D A;  3QRF F;  3KE2 A;  1G3Y A;  1U3E M;  3JRI A;  2L02 A;  2B7E A;  3KCC A;  5LBQ A;  4EMS A;  5ICC A;  4L0Z B;  2ESH A;  3HOW J;  2DBB A;  2O9L A;  2ZME A;  2M5W A;  1SVO A;  1GXQ A;  3J81 K;  1YFH A;  1R7J A;  1P4X A;  2HYG D;  3KYC B;  1IRX A;  1YS6 A;  3VFZ A;  2XB0 X;  2CU7 A;  2KJB A;  3MZH A;  3DU5 A;  3EQL F;  4BEH B;  1WFX A;  3VYR B;  4BNC A;  3CCJ I;  1SMT A;  4PJM A;  4XK4 A;  3KP4 A;  1MMG A;  5D6F A;  1R1U A;  2NAZ A;  2CMP A;  1R5G A;  1BI1 A;  2X4H A;  3LSR A;  2CV2 A;  1K6O A;  4A0Z A;  2RC4 A;  4P5O A;  2OJE D;  1OCZ H;  2M7A A;  3P9I A;  4UUT A;  1VQ4 I;  1MIJ A;  4IVN A;  4RM3 A;  1X1D A;  2X1C A;  2DPD A;  4X1E A;  5DUI A;  3WHB A;  3K1N A;  4BY7 J;  3Q9V A;  1LDJ A;  4RGS A;  5EG0 A;  2W7N A;  2RRE A;  1XN7 A;  2HQ5 A;  2J5O A;  4G12 A;  2QSG X;  2NS0 A;  3FWE A;  2NOJ B;  4HQM A;  1WJE A;  4PUS A;  2XAQ A;  3F22 A;  1YW9 A;  3HTS B;  4P9U A;  3BCB A;  3HOY J;  2LP0 A;  3HGY A;  4BU2 A;  4L9J A;  3CCR I;  2KRF A;  2ZKZ A;  4PDK A;  4PZJ A;  2Y31 A;  4C2T A;  4OIO F;  1WHU A;  1FX7 A;  3I0T A;  1X2M A;  3LMM A;  3S3M A;  3CC4 I;  3HC7 A;  1O3Q A;  2V26 A;  2WAD A;  5LRS A;  1T08 B;  4YFN F;  1ITY A;  1OCT C;  5F04 A;  4E70 A;  2CW0 F;  3JRH A;  1BA5 A;  2OV7 A;  4MQV A;  4WK8 F;  1MJB A;  1TBX A;  2MGQ A;  3WTZ A;  1ODD A;  4RB2 C;  2EA2 A;  5B3S H;  2L2O A;  2GA2 A;  3SZP A;  2IA2 A;  4BKX A;  1TT5 B;  4GO1 A;  4KT5 C;  2BVL A;  1ZRD A;  2IA1 A;  2J5P A;  3H1C A;  3W6J B;  2QLZ A;  1ZH5 A;  2IS2 A;  3FXQ A;  2TRT A;  2BHY A;  1MDM A;  1V54 H;  4HLY A;  2V7F A;  5L3B A;  1IC8 A;  3EUH C;  3HTU A;  5CYV A;  3IV5 A;  1B8I A;  3CCS I;  3BG3 A;  3SFI A;  3H36 A;  3DKY A;  1P9Q C;  4XOT A;  2GXG A;  4XOP A;  9ANT A;  3H35 A;  3S3N A;  2Z9O A;  1Y8R B;  4O3M A;  1UHS A;  3KIO A;  1XTA A;  2FSW A;  2HR3 A;  5FKM A;  5LGT A;  2P7C B;  1VQK I;  4ANJ A;  1HA8 A;  2LF7 A;  4WX9 A;  3BR6 A;  3RZO J;  1HOM A;  2KQR A;  2UV1 A;  2WAQ A;  4PSW A;  2IEK A;  3KLO A;  2FF4 A;  1BM9 A;  2FOK A;  5BPI A;  3QOD A;  4ZDL A;  1T95 A;  1W36 C;  2COM A;  1IGN A;  2HVQ A;  2M7B A;  2MH9 A;  2V4J C;  3C3W A;  3M07 A;  4HYE A;  3T0Y A;  1BR1 A;  4RAZ A;  4RM2 A;  3L2V A;  4CA0 A;  1D8K A;  3GO5 A;  3MEX A;  4O6J A;  1CF7 A;  3AG4 H;  3QYF A;  1LE8 A;  4XRM A;  2JA6 J;  3M1E A;  2Y2Z A;  2P81 A;  3BR0 A;  3DV8 A;  1BBY A;  2CFO A;  2XGD A;  1ETX A;  1ZAO A;  5B1B H;  5D5W B;  1BC8 C;  3S32 A;  1J59 A;  3M1C A;  3BTJ A;  2EZL A;  3PQK A;  1FC3 A;  2XAU A;  3C18 A;  5F1R A;  1F36 A;  4EJU A;  4B8X A;  5M5W J;  2CQX A;  2NYX A;  3QQA A;  2IS4 A;  3OYN A;  1W5S A;  3OYM A;  3FXK A;  1D5Y A;  4M6Y A;  4R8H A;  4Y17 A;  1LNW A;  1IXR C;  1UMQ A;  2EFQ A;  1Z7L A;  5LHG A;  2VBZ A;  5KAI C;  1ZRF A;  1YRN A;  2DT5 A;  1X1B A;  4V2F A;  3SZG A;  1OMI A;  4MLO A;  4QIW N;  5BS6 A;  2DO7 A;  4B47 A;  3K0L A;  4NC6 A;  3RCO A;  1OLT A;  1N25 A;  3FIW A;  3MZY A;  2CUE A;  4S05 A;  1H9G A;  4RDU A;  2VPL A;  3H0G J;  1VQ6 I;  2DOE A;  1R5H A;  4KIG A;  5GAD J;  4FAS D;  1QZZ A;  1ETK A;  3KYL A;  3CO6 C;  3RQ4 A;  2DT7 B;  2IGO A;  1HW2 A;  4L5J A;  3G4S I;  3OV8 A;  4B48 A;  3SXY A;  1IXS B;  4HST A;  1IUF A;  1G6N A;  3CDI A;  4IHY A;  4DGW B;  1AHD P;  5TGT A;  3TW6 A;  3M7G A;  3O2P E;  2QQB A;  4UHT A;  4DJA A;  4G94 A;  3FHN A;  3JAM Z;  2YSR A;  4KJZ A;  2HQR A;  2Q2E A;  1LB2 A;  4GFB A;  1K78 B;  2YU9 J;  3FXM A;  4GGG A;  4HBL A;  2X6Y A;  3JR9 A;  3KYD B;  4RGX A;  4N0B A;  3BTL A;  3W3C A;  1BI2 A;  3V7S A;  2JT1 A;  1XX5 A;  4BEH A;  4H0E A;  3O6B B;  2LY9 A;  2VUM J;  2JRT A;  1RZ4 A;  3DPU A;  5FLV A;  3IUO A;  3Q5F A;  4BQA A;  3PJR A;  3AL0 C;  1H0M A;  1ZKG A;  2JWT A;  2LKX A;  3CJQ B;  3LFK A;  4ETS A;  3K2Z A;  2KHM A;  2DFH A;  1J7K A;  2CFX A;  2OBP A;  3BR1 A;  3IH2 A;  3TO9 A;  3C2G A;  4KUM A;  4NUB A;  5F08 A;  3K2A A;  2EB7 A;  2R7Q A;  4AVP A;  2CRG A;  1O7F A;  3I64 A;  2CUJ A;  3P5J A;  4A3K J;  3DPL C;  3F21 A;  1AKH B;  5F6F A;  5LHH A;  3EYI A;  4AM3 A;  2O5R A;  5BOX A;  4DZP A;  3FXU A;  3G1L A;  3MWM A;  2K3F A;  1W7P D;  4KMF A;  2HVR A;  4ESF A;  2LKP A;  1PDN C;  4ZYE A;  2NVU B;  1SEU A;  2VKE A;  3LSI A;  4D0P A;  4A3L J;  2IBD A;  3CMM A;  3I53 A;  2QA4 I;  2FNA A;  2M0M A;  2HQA A;  3GWZ A;  1I3Q J;  1KGS A;  3A03 A;  2HU9 A;  3BQZ A;  2ZME C;  4HF2 A;  4KN7 X;  4E7L A;  1IAW A;  2QBY A;  4HLX A;  1OCC H;  2VKV A;  2VON A;  1VQ9 I;  2YX7 A;  2IT0 A;  2A68 F;  5CVR A;  2Y48 A;  2E2I J;  5B5E C;  3NRV A;  2RGV A;  3K10 A;  2R0Q C;  1LE8 B;  3GTL J;  2GOX B;  2M3A A;  3LA3 A;  2KFD A;  1QHG A;  4MQ9 F;  1PUF A;  1VQ8 I;  1B9M A;  2FBH A;  1TWH J;  2MYS A;  4OOI A;  3F9K A;  1JE8 A;  2R93 J;  4GYG A;  4G8X A;  3IWF A;  1DU0 A;  2LNB A;  2E1M C;  3QPH A;  3VYU B;  2E7W A;  2F4O B;  3A1Y A;  3ASN H;  1TL8 A;  1B8I B;  1LVA A;  4XLN F;  3FXJ A;  1ETW A;  3E0J B;  1JTX A;  3J7A O;  1P4W A;  3T5X A;  4Y15 A;  1P2F A;  3ZCO A;  1E2X A;  4EJT A;  2P5K A;  3PFY A;  1O3T A;  1D0X A;  5E18 F;  1W7P B;  2M0C A;  3BCA A;  3W2V A;  2R5Z B;  1EJ9 A;  2PMZ N;  1F5T A;  3WGI A;  2WAE A;  5K7H A;  4D5F A;  3ERE D;  5E3M A;  2ZXH A;  1ZEL A;  4M6X A;  2XPU A;  2VQL A;  4D7M A;  1MGT A;  4B43 A;  5DV5 A;  2D45 A;  1T2K A;  2OU2 A;  2AQF A;  3W2W A;  2V1X A;  2O7O A;  4XIC A;  2P4W A;  1MZB A;  1FJL A;  3S15 J;  3BTC A;  2R7U A;  2W4S A;  2O61 A;  3AL0 B;  1OCP A;  1Z67 A;  3VOE A;  3OIP A;  2K02 A;  4F91 B;  2HTS A;  4A3J J;  2TDX A;  3CP2 A;  4CCJ A;  4EJV A;  4IXA A;  4BJ5 C;  3WTS C;  1R71 A;  4S04 A;  3OYB A;  1BIA A;  3HUG B;  4F3Q A;  1EH7 A;  1LQ1 A;  2DTR A;  2R92 J;  4KFC A;  1YS7 A;  3CCQ I;  3EDP A;  3S8P A;  5E3O A;  5JHU A;  1C0W A;  5IT3 A;  5J47 A;  2VC1 A;  4UB6 C;  5KVR A;  2KPM A;  2HFH A;  2FA5 A;  3ULQ B;  2VXD A;  2MAB A;  2L0K A;  2WAQ N;  1JJ8 C;  1ON2 A;  2M87 A;  4XBF A;  4CIC A;  1ZGW A;  4P96 A;  4A3C J;  1YYV A;  2CUF A;  1YIT I;  4NC8 A;  4CH7 A;  1MBG A;  1D0Z A;  5FLX Z;  4XRS A;  3ZMZ A;  3FMR A;  2FML A;  3BR5 A;  1TQI A;  3L9F A;  3IKV A;  2G7U A;  4E7S A;  5AIQ A;  2NRA C;  4LIV A;  2VPR A;  2HXO A;  1EA3 A;  4G6Q A;  4HF0 A;  5ERI A;  4EQQ A;  2E2J J;  1YE9 A;  1PVE A;  4CSW A;  2CV0 A;  3MKY B;  1B6A A;  3HOZ J;  2IXS A;  1Y1V J;  5GAH J;  4S0H B;  5F0H A;  1IRZ A;  1ZLJ A;  1KQ9 A;  2RQP A;  2F5F A;  3K4J A;  5HNH A;  4XRF A;  2JVH A;  3FKI J; 
#chains in the Genus database with same CATH homology
 1FP1 D;  5HDG A;  1LJ9 A;  2PMH A;  1O3S A;  3CO7 C;  2IP2 A;  3NQO A;  4EM0 B;  3J81 Z;  3EYY A;  4Z2Y A;  2ZJ2 A;  1H9T A;  4ZZD A;  1JHH A;  2D2W A;  1QPM A;  2XHK A;  1Q1H A;  2OD5 A;  2KJC A;  2BV6 A;  4M74 A;  1TTY A;  1W7P A;  5DD4 A;  4LB6 B;  2A61 A;  4A5N A;  2A3S A;  4YFK F;  3AAF A;  1QQI A;  2JSC A;  1FPQ A;  2O03 A;  3BOQ A;  1ZN2 A;  3EUH A;  2FBI A;  4L9T A;  2MA3 A;  3B02 A;  3RPU A;  2VBY A;  3DEU A;  3HRT A;  1OKR A;  2QVO A;  2VXZ A;  2F5C A;  3F8C A;  3F23 A;  2NNN A;  4QWQ A;  4BXU A;  4LLL A;  4BAY A;  4CXF A;  1B1B A;  1FBU A;  4HA8 A;  2ZCW A;  4UV9 A;  3M8F A;  5DYM A;  1E17 A;  2GA1 A;  2W25 A;  3F6O A;  3TOB A;  3TO6 A;  2PFB A;  4U0V A;  1SAX A;  2QEN A;  2KIM A;  5FD6 A;  3ABT A;  4I98 B;  2RDP A;  2A5Y B;  4K2E A;  2XUB A;  1Z1D A;  3F3X A;  3R4K A;  1UHM A;  4UXN A;  1TQM A;  5FB2 A;  3LAJ A;  1IXC A;  2X0L A;  1R1T A;  2QQA A;  1D8J A;  3ZMV A;  2YR2 A;  2DK8 A;  3ECH A;  3RI4 A;  4UVB A;  3NEU A;  3I5U A;  2FE3 A;  1J0R A;  1DPR A;  2DW4 A;  4Q4Z F;  4KNY A;  2K4J A;  1YLF A;  1D5V A;  2PG4 A;  4U0W A;  2KIU A;  4R1H A;  1YO5 C;  3ZPL A;  4M71 A;  4IF4 A;  3MQ0 A;  3WTU C;  2G9W A;  1REP C;  5DCM A;  3MCZ A;  1FBQ A;  1OYW A;  3FF5 A;  3KP3 A;  2DLL A;  4HX7 A;  2MLK A;  4ZYD A;  4RGR A;  4PGH A;  2D1V A;  4HDV A;  1HKS A;  4WXH A;  1BN5 A;  3F8M A;  1XSD A;  2QZ8 A;  4HV6 A;  4HX4 A;  1IN6 A;  3WU1 B;  2UXN A;  5D4S A;  1KU3 A;  4NB5 A;  3MAJ A;  2CQK A;  1FBS A;  1YTY A;  1HKT A;  2EA4 A;  1FY7 A;  2ZO4 A;  2UXX A;  2MC3 A;  3V8K A;  2HZT A;  1FOK A;  2AXL A;  3COA C;  5JI6 A;  4XSZ F;  3BP8 A;  5F64 A;  2O6G E;  3BDD A;  4IHT A;  3L2C A;  5LGU A;  2P5L C;  3R61 A;  4ZYG A;  1O57 A;  1S7O A;  3FM5 A;  3FM3 A;  3K69 A;  2XV4 S;  1RNL A;  3U1D A;  1FYM A;  3TO7 A;  3I71 A;  1J75 A;  4G7Z F;  1T38 A;  4B09 A;  4LJZ F;  2HKX A;  4MNU A;  1T98 A;  5BPD A;  4OMZ A;  2PLY A;  4YIF A;  1J9I A;  3J80 Z;  4L18 B;  2ACJ A;  2D1H A;  2YU3 A;  2FXA A;  5CVU A;  1HSJ A;  1Z05 A;  4EVI A;  2O8X A;  3LAP A;  5CVJ A;  3H92 A;  1U2W A;  1RI7 A;  2GAU A;  1USS A;  4CYD A;  1A04 A;  4ZH4 F;  5DDG A;  3GUD A;  2PI0 A;  2HTJ A;  3G3Z A;  1JHF A;  4IJA A;  4PGG A;  2P5V A;  1FLI A;  4L0Y B;  5ILS A;  3GYH X;  3E6D A;  1X3U A;  3K9T A;  1IF1 A;  2XAS A;  4YG2 F;  1U78 A;  2W84 A;  1SFX A;  1LEA A;  1YG2 A;  1HST A;  4IRH A;  3ROU A;  5H6R A;  2VBX A;  3TDZ C;  1WI9 A;  2H09 A;  2EFO A;  2LSO A;  2MH2 A;  1S3J A;  3ZQ7 A;  4EGZ A;  5D6E A;  4KA4 A;  5A2Q Z;  3SHF A;  4MEX F;  2A69 F;  5LRR A;  2V1D A;  4F7Z A;  4CDG A;  1GVJ A;  3WU0 A;  3GFI A;  2MD5 A;  3KEQ A;  4I01 A;  3KET A;  1Z9C A;  1YW8 A;  4EM1 A;  4GXO A;  1KQ8 A;  3GW2 A;  4UVA A;  4ON0 A;  1B59 A;  1B4A A;  2EK5 A;  2FEZ A;  3TGN A;  3R60 A;  2RNJ A;  4BHC A;  3KP7 A;  1DDN A;  2W85 A;  5D4R A;  1PUE E;  1P4A A;  4IRI A;  2O3F A;  4EJW A;  2R3S A;  1TLH B;  4RAY A;  5HLH A;  1IN5 A;  1MDM B;  1IW7 F;  4IHS A;  2DPU A;  3HSR A;  1WSU A;  4CGZ A;  2EJR A;  3LWF A;  1I1G A;  4M9X A;  2P7V B;  1QGP A;  2GXB A;  5L3F A;  1P92 A;  3HOS A;  2K7L A;  3ABU A;  3CUO A;  3ZN1 A;  1Z6T A;  4MEY F;  1JXS A;  1FP2 A;  2UZK A;  5TRD A;  2FNP A;  1HQC A;  3J80 K;  3F8N A;  1XCB A;  1KU2 A;  4GYI A;  1CF7 B;  5E8G A;  1TQP A;  5DUK A;  1S6L A;  1XGS A;  3LA7 A;  4AWX B;  5D8K B;  2DAO A;  5FFX A;  4BHP A;  4I7H A;  5DD8 A;  2ETH A;  1BOA A;  2V9V A;  5HS7 A;  4I0B A;  3B73 A;  2VOO A;  1FWZ A;  2PBI A;  4ASN A;  5JFR A;  5JVT A;  2B0L A;  3V7R A;  1ON1 A;  4G7O F;  1STZ A;  1G3T A;  3RIR A;  5FLX K;  1QNT A;  2H6B A;  5ICE A;  2XRO A;  3DPT A;  2M30 A;  4HW0 A;  4RB1 A;  3HRS A;  2ESN A;  5HS9 A;  3GZ6 A;  4HV5 A;  4U88 A;  1RIO H;  3I54 A;  1LEB A;  2O0Y A;  1K78 A;  1O3R A;  1ZHF A;  2C6Y A;  2XKP A;  1UST A;  4UUV A;  2MLG A;  3HOT A;  1FT9 A;  4A5M A;  1BI3 A;  2IPQ X;  2ZNY A;  1ONV A;  3KEO A;  1R36 A;  3CUQ C;  3WGG A;  1BI0 A;  1SFE A;  3I59 A;  3E3V A;  2ISZ A;  1S29 A;  5IT9 K;  4A12 A;  3GX4 X;  3HRM A;  2P8T A;  1R58 A;  3GEZ A;  4JBA A;  4WWC A;  5K5Q A;  3K1P A;  2EV5 A;  3F6V A;  3ELK A;  2QQ9 A;  3ZMD A;  2VE9 A;  1G3S A;  2H6C A;  3E5X A;  1R00 A;  2IRF G;  5HDK A;  3CUQ A;  4ENJ A;  2E7X A;  1MJ9 A;  3WGH A;  1KU9 A;  3QAH A;  4NQW A;  5E20 A;  3IRQ A;  1U5T C;  3LA2 A;  5HS8 A;  1EH6 A;  2YX4 A;  2HWV A;  4ESB A;  2XRN A;  1HW1 A;  3VOD A;  1BC7 C;  3R0A A;  3IWZ A;  1ZLK A;  3TOA A;  1LDD A;  4CHU A;  2VT2 A;  4KIC A;  4DNC A;  1ZGJ A;  1XSV A;  1T0F A;  2BGC A;  4CZZ A;  1OR7 A;  1EH8 A;  1U5T B;  1IN7 A;  4RB0 A;  5D5V B;  1XDU A;  1QZY A;  1U6G A;  2H27 A;  2PEX A;  1V4R A;  3BY6 A;  1K79 A;  4FX0 A;  4JQF A;  1F1Z A;  3HSF A;  2HKO A;  2JTV A;  4KDP A;  1G3W A;  3KP2 A;  4KIF A;  5J8F A;  3M9A A;  1RUO A;  2PMU A;  3U2R A;  2XIG A;  3JAM K;  2ZXJ A;  1I1S A;  2EFP A;  3QPT A;  3KFW X;  5L3D A;  4BH9 A;  5K1Y A;  2YPR A;  4I0A A;  3C1D A;  5H6Q A;  2EV0 A;  2JZY A;  3H3U A;  4I2O A;  1FNN A;  3FHZ A;  4LK1 F;  1Z6R A;  3SFZ A;  3CJN A;  2Z33 A;  4KN4 X;  3P9K A;  4Q48 A;  1TNS A;  3DKW A;  5LHI A;  3GLX A;  3HHH A;  2IVM A;  4FX4 A;  1IRF A;  1KU7 A;  5ILV A;  2M8E A;  5FD5 A;  1SFU A;  2V6C A;  3CTA A;  5LEK A;  3GXO A;  4I09 A;  3SQN A;  3ZMT A;  5AON A;  3KZY A;  4EM2 A;  4ZYH A;  3L7W A;  2K4B A;  4RB3 C;  4A6D A;  1S8N A;  3GFJ A;  3V8J A;  5L3E A;  4A0Y A;  3VEP A;  3E6C C;  5HDN A;  2XGX A;  3IRR A;  2Y75 A;  2Z99 A;  1V3F A;  4YFX F;  3WG9 A;  3I59 B;  4LG0 B;  3TDU C;  4QLC U;  1YIO A;  3LQQ A;  3BZ6 A;  3DQV C;  4OIP F;  1I27 A;  4UNO A;  3ECO A;  1L3L A;  2W24 A;  2VT3 A;  2G7H A;  4HOB A;  5D5U B;  4A0X A;  2IW5 A;  2ZNZ A;  3CUQ B;  4LGW A;  4ENK A;  5EEH A;  2L4M A;  2Z5U A;  3W6K B;  2ZME B;  4ENM A;  3ISP A;  1ZRE A;  3TQN A;  1PP8 F;  2WV0 A;  3D0S A;  5E1X A;  3E6B A;  1BIB A;  3ZN0 A;  2WWY A;  3P9C A;  3T1B A;  4HF1 A;  2FRH A;  2CO5 A;  3FMS A;  3MFK A;  4MTD A;  2VE8 A;  4HX8 A;  3F8F A;  1WRJ A;  5HLG A;  3WTX C;  2UWM A;  2VN2 A;  1XB4 A;  4LB5 A;  3Q9S A;  6PAX A;  2L01 A;  4EGY A;  2AS5 F;  3WTW C;  4EV0 A;  2OQG A;  1OPC A;  4DQ2 A;  2W57 A;  3V7C A;  2BE5 F;  5DCM B;  5FGM A;  2DQL A;  2XAJ A;  1R1V A;  3E97 A;  2VOP A;  4R79 A;  4LK0 F;  2FQ3 A;  1TW3 A;  3VB2 A;  2DI3 A;  3QU6 A;  4MGR A;  1XGO A;  3FZV A;  4M9Z A;  3S2W A;  2VC0 A;  5LGN A;  3U9G A;  1WWX A;  2HQN A;  3JTH A;  4AIK A;  4OIQ F;  5CLS A;  2OZ6 A;  3D5L A;  3ZMU A;  2OAZ A;  4ZZL A;  2JPB A;  2CG4 A;  1SD7 A;  4Q5S F;  5E1W A;  1YW7 A;  1XMA A;  1K7A A;  3PFI A;  2WTE A;  4N9I A;  3BWG A;  2ELH A;  2OA4 A;  2DFI A;  1FSE A;  1OYY A;  5KK1 A;  2E1C A;  3RPQ A;  4U7B A;  2FBK A;  1IUY A;  1UFM A;  2A6E F;  2IA0 A;  3FX3 A;  4AIJ A;  2K27 A;  3WTV C;  2F2E A;  3N97 A;  2WC2 A;  4ENN A;  3EET A;  4PCQ A;  3TKY A;  3I4P A;  2PJP A;  5ED4 A;  1XD7 A;  3IC7 A;  5HOO A;  4L5I A;  2A6H F;  1B9N A;  3G73 A;  4ESJ A;  1O7L A;  2XAG A;  2ADU A;  4LLG F;  1XGM A;  5IT9 Z;  4I02 A;  2R7D A;  1XDS A;  3IKT A;  4L9V A;  2EWN A;  4A2U A;  1XGN A;  3IHU A;  3OOP A;  2QWW A;  5ICF A;  2RKH A;  4IPA A;  1ZG3 A;  3CDH A;  4N9H A;  2M45 A;  3BRO A;  1I6X A;  3T8R A;  1FSH A;  2BEO A;  5LEJ A;  1SD4 A;  3L09 A;  1I5Z A;  4LLN A;  3ML6 A;  2PQ8 A;  1IRG A;  3ZP5 A;  3E5U A;  4KYW A;  1YQA A;  4M9S A;  4LG0 A;  3R0J A;  3WTY C;  1F9N A;  3GZ5 A;  1LDK B;  1R23 A;  3CLO A;  2F5D A;  4G6D A;  1KYW A;  1T39 A;  1ZAR A;  1ZGA A;  2XKO A;  1ZG5 A;  3BPV A;  3JSO A;  2HGC A;  3WE3 A;  3FMQ A;  4O5V A;  5EEG A;  3QP6 A;  3HHG A;  1J2X A;  2VOD A;  2XAF A;  1XSX A;  2M1B A;  3E6M A;  2EV6 A;  4OIN F;  1KQ0 A;  3BJ6 A;  1IZ1 A;  1R22 A;  1DUX C;  1OYI A;  2Z3Y A;  2QBY B;  2GWR A;  1GXP A;  2ZFW A;  4M73 A;  4CO8 A;  3KLN A;  3KP5 A;  1Y0U A;  5HVQ C;  4FHT A;  2QUF A;  1IN8 A;  5ICG A;  3RKX A;  4YII A;  3H3Z A;  2QYO A;  4HDU A;  3N4M A;  4KMU X;  3V8L A;  1SMY F;  2JPC A;  3GFM A;  1IN4 A;  2CSO A;  3V4G A;  1ZRC A;  4BHB A;  4M72 A;  2PN6 A;  2F5E A;  1BJA A;  2L4A A;  1MD0 A;  2V79 A;  2GIV A;  2Y0M A;  4HAM A;  2HEO A;  5E17 F;  2Q0O A;  4OU0 A;  5L3C A;  3I58 A;  1W5T A;  1TNT A;  4UVC A;  5E1Z B;  4MTE A;  4XSX F;  3BJA A;  2FU4 A;  5FO5 A;  4BYY A;  2L3D A;  3HUG A;  1PP7 U;  5DCF A;  5J8C A;  2HS5 A;  1F4K A;  5L3G A;  2E1N A;  4FT8 A;  3JTG A;  1AOY A;  2KKO A;  2RV8 A;  1RUN A;  1UB9 A;  1QO0 D;  3SZT A;  1W4M A;  3R6S A;  2EFW A;  4LFU A;  2Q8K A;  4EJO A;  3KZZ A;  1WKM A;  3WOD F;  2RVC A;  3BPX A;  3QU3 A;  4JK1 X;  1G4D A;  3JSP A;  3WTT C;  1FYK A;  3RKY A;  4WCG A;  2VBW A;  1NHA A;  3DFG A;  3E5Q A;  4GCV A;  1UCR A;  5FFZ A;  5BMZ A;  1TW2 A;  4OMY A;  5CJ9 A;  1ZG1 A;  4KIB A;  3O3K A;  3ZMS A;  2R7F A;  2HDC A;  4IRG A;  3RYR A;  1J5Y A;  3IL2 A;  3GFL A;  5DEQ A;  4RS8 A;  1SD6 A;  2ISY A;  4MHG A;  4WF2 A;  3L00 A;  2OQR A;  1XCV A;  5ILU A;  1FZP B;  3LST A;  2CGP A;  2OZU A;  3DP7 A;  3RDI A;  3C7J A;  4A6E A;  4XLP F;  5LLQ A;  1AWC A;  3PQJ A;  2DQR A;  1GHC A;  2FMY A;  3HSE A;  4Y13 A;  4AIH A;  3RTR A;  2GZW A;  2QM3 A;  1ULY A;  2CWE A;  4RGU A;  1HXD A;  2DU9 A;  1CGP A;  5D5X B;  3QP5 A;  2BYV E;  2XVC A;  3FXR A;  2IJL A;  1EV7 A;  1D3Y A;  2XAH A;  3K1M A;  1Z91 A;  5J6X A;  3BJO A;  4HQE A;  2CYY A;  2HYF A;  1S7A A;  3T8T A;  4OIR F;  5D8L B;  3DXJ F;  5HLI A;  5TJJ A;  2A07 F;  5K5O A;  1QBJ A;  3KP6 A;  3M8E A;  5CVI A;  4TV7 A;  5AIP A;  1DPU A;  2MBF A;  4U0Y A;  3GF2 A;  1Z7U A;  1KYZ A;  4WXD A;  4P9F A;  2BBY A;  1FYL A;  4G7H F;  1HBX G;  5JR3 A;  3WE2 A;  2K86 A;  3DF8 A;  2NNY A;  3HYI A;  1HKQ A;  5A2Q K;  2KIF A;  1UHW A;  3HIF A;  4LMY A;  1HW5 A;  5H20 A;  1JGS A;  4UV8 A;  1U8R A;  4Q47 A;  2V1U A;  5E8I A;  2GQQ A;  1P6R A;  1L0O C;  2RN7 A;  1MJA A;  2STT A;  3LQR A;  2HOE A;  1MKM A;  3P7N A;  4WXC A;  3JW4 A;  4NHJ A;  2DK5 A;  3RJP A;  4G9Y A;  5K5R A;  3REO A;  2H94 A;  1U5T A;  2LDU A;  4U7D A;  5CVV A;  4P55 A;  1SD5 A;  1T6S A;  2STW A;  1ZYR F;  2ZBK A;  3F72 A;  1KA8 A;  4HZF A;  1VTN C;  2EFN A;  3F8B A;  4L9N A;  1WQ2 A;  3GVA A;  4LD5 A;  3RYP A;  2L54 A;  2P6T A;  3RKW A;  3HRU A;  1DP7 P;  2P6S A;  5BQT A;  1XMK A;  2LF8 A;  3QOP A;  3QRF F;  3KE2 A;  1G3Y A;  1U3E M;  2L02 A;  3KCC A;  5LBQ A;  4EMS A;  5ICC A;  4L0Z B;  2ESH A;  2DBB A;  2ZME A;  2M5W A;  1GXQ A;  3J81 K;  1YFH A;  1R7J A;  1P4X A;  2HYG D;  1YS6 A;  3VFZ A;  2KJB A;  3MZH A;  3EQL F;  4BNC A;  1SMT A;  3KP4 A;  5D6F A;  1R1U A;  2NAZ A;  1R5G A;  1BI1 A;  2X4H A;  1K6O A;  4A0Z A;  2RC4 A;  4P5O A;  3P9I A;  4IVN A;  2DPD A;  5DUI A;  3K1N A;  3Q9V A;  1LDJ A;  4RGS A;  1XN7 A;  2J5O A;  2NS0 A;  3FWE A;  4HQM A;  2XAQ A;  3F22 A;  1YW9 A;  3HTS B;  4P9U A;  4L9J A;  2KRF A;  2ZKZ A;  4PDK A;  4PZJ A;  4OIO F;  1FX7 A;  3I0T A;  1O3Q A;  5LRS A;  4YFN F;  4E70 A;  2CW0 F;  4MQV A;  4WK8 F;  1MJB A;  1TBX A;  3WTZ A;  1ODD A;  4RB2 C;  2EA2 A;  2GA2 A;  3SZP A;  2IA2 A;  4GO1 A;  4KT5 C;  1ZRD A;  2IA1 A;  2J5P A;  3W6J B;  2QLZ A;  1ZH5 A;  3FXQ A;  1MDM A;  4HLY A;  5L3B A;  3HTU A;  5CYV A;  2GXG A;  2Z9O A;  4O3M A;  2FSW A;  2HR3 A;  5LGT A;  2P7C B;  2LF7 A;  4WX9 A;  3KLO A;  2FF4 A;  1BM9 A;  2FOK A;  5BPI A;  2COM A;  3T0Y A;  3C3W A;  2MH9 A;  4HYE A;  4RAZ A;  1D8K A;  3GO5 A;  3MEX A;  4O6J A;  1CF7 A;  3M1E A;  3DV8 A;  1BBY A;  1ZAO A;  5D5W B;  1BC8 C;  1J59 A;  3PQK A;  1FC3 A;  3C18 A;  5F1R A;  4EJU A;  4B8X A;  2NYX A;  1W5S A;  4M6Y A;  4R8H A;  4Y17 A;  1LNW A;  1IXR C;  2EFQ A;  5LHG A;  2VBZ A;  1ZRF A;  2DT5 A;  5BS6 A;  1OMI A;  2DO7 A;  3K0L A;  3MZY A;  4S05 A;  1H9G A;  4KIG A;  1R5H A;  1QZZ A;  3CO6 C;  1HW2 A;  4L5J A;  3OV8 A;  3SXY A;  1IXS B;  1G6N A;  3M7G A;  3O2P E;  2QQB A;  4UHT A;  4G94 A;  3JAM Z;  2YSR A;  2HQR A;  2Q2E A;  1LB2 A;  1K78 B;  4GGG A;  4HBL A;  4RGX A;  4N0B A;  1BI2 A;  3V7S A;  2JT1 A;  4H0E A;  3O6B B;  2JRT A;  1RZ4 A;  3Q5F A;  4BQA A;  1H0M A;  3LFK A;  4ETS A;  3K2Z A;  1J7K A;  2CFX A;  2OBP A;  3TO9 A;  4KUM A;  2EB7 A;  4AVP A;  1O7F A;  3I64 A;  3DPL C;  3F21 A;  3EYI A;  5F6F A;  5LHH A;  5BOX A;  3FXU A;  3MWM A;  1W7P D;  4KMF A;  4ESF A;  2LKP A;  1PDN C;  4ZYE A;  4D0P A;  3I53 A;  2FNA A;  3GWZ A;  1KGS A;  4HF2 A;  4KN7 X;  2QBY A;  1IAW A;  4HLX A;  2VON A;  2YX7 A;  2IT0 A;  2A68 F;  5CVR A;  2Y48 A;  3NRV A;  2RGV A;  3LA3 A;  4MQ9 F;  1B9M A;  2FBH A;  4OOI A;  1JE8 A;  4GYG A;  4G8X A;  3IWF A;  2LNB A;  3QPH A;  2E7W A;  1LVA A;  4XLN F;  3J7A O;  1P4W A;  3T5X A;  4Y15 A;  1P2F A;  1E2X A;  4EJT A;  2P5K A;  1O3T A;  5E18 F;  1W7P B;  1F5T A;  3WGI A;  3ERE D;  4M6X A;  1T2K A;  1MGT A;  5DV5 A;  2D45 A;  2OU2 A;  2V1X A;  2P4W A;  1MZB A;  2O61 A;  3VOE A;  2K02 A;  2HTS A;  2TDX A;  4EJV A;  4IXA A;  3WTS C;  4S04 A;  1BIA A;  1EH7 A;  1LQ1 A;  2DTR A;  4KFC A;  1YS7 A;  3EDP A;  5JHU A;  1C0W A;  5IT3 A;  2VC1 A;  5KVR A;  2HFH A;  2FA5 A;  3ULQ B;  1ON2 A;  2M87 A;  4XBF A;  4CIC A;  4P96 A;  1YYV A;  5FLX Z;  3ZMZ A;  3FMR A;  2FML A;  3L9F A;  1TQI A;  3IKV A;  2G7U A;  5AIQ A;  2NRA C;  4G6Q A;  4HF0 A;  4EQQ A;  5ERI A;  1B6A A;  1ZLJ A;  1KQ9 A;  2RQP A;  2F5F A;  4XRF A;  4AD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...