5C4JJ

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c4jJ00
1Z0XA 4A3IJ 3MN2A 2RAEA 3HOWJ 2FD5A 5FKMA 3JRHA 5FKNA 1P7JA 1X2MA 1B8IB 3TP3A 5IYCJ 2X9DA 1RKTA 2PMZN 2H8RA 4A3CJ 2DA6A 2FX0A 1ZR4A 2TRTA 5F0FA 2E2JJ 2LFBA 4XICA 2KT0A 3JR9A 1MBHA 2NVYJ 1MH3A 3TW6A 2R5ZB 2NS8A 1AKHB 3ZQIA 3M4OJ 3SFIA 1ETQA 3BTIA 1YRNA 4DYCA 5F27A 4UUSA 3JRGA 2LVSA 2Y31A 4A69C 3LSGA 2VKVA 2ECBA 2XGCA 1E3OC 1VI0A 1VNDA 3A03A 1IC8A 1QVUA 4BBSJ 3ZOBA 1TWGJ 1K83J 4UUTA 1HLVA 3IH3A 5IOZA 1MBEA 2JWTA 4A3DJ 1IG7A 2XB0X 4FE4A 4BY7J 3HB9A 1H8AC 3HOYJ 2LD5A 4UUSB 3BTCA 2LP0A 4XK4A 1LFUP 2JA8J 1HDPA 2K9QA 5M3MJ 1CQTA 2LK2A 3RZOJ 2CUFA 3NARA 2YS9A 2LTPA 2Y9YA 2ID3A 1WH5A 3S14J 2CQQA 1ZGWA 3LSJA 4XRMA 1BA5A 2JMWA 2O8KA 2EZHA 1UG2A 2NVQJ 2DJNA 1P7IA 4FCYA 1JT6A 3ZQCA 3A02A 2LKXA 4DZJA 2Y2ZA 5E3NA 2GBYA 3F0CA 2O9LA 3FK7A 2O7OA 4A3JJ 2TCTA 5EGOB 4MO7A 3PO3J 5K7HA 2R0QC 3GTLJ 4C3JJ 5JLXA 4EEFG 1A6IA 1VF9A 3B6AA 2Y0SN 2XGEA 4XIDA 2DMQA 3BG5A 1QRYA 2JA7J 2Y9ZA 1Q1VA 3PO2J 2N8GA 1VFCA 3ZQLA 3QPLA 4JX5A 4IEJA 2M0CA 2EZLA 2IBDA 1ORKA 5M3FJ 3GTOJ 2COBA 2JJ7A 4D7MA 4L5EA 5EZGA 5IOYA 3HOVJ 2I10A 1JT0A 4C2MJ 1LE8A 3A01A 1WCMJ 3OOUA 1SFOJ 4AC0A 5C44J 3G1LA 5J1YA 3BR5A 1ETKA 3S1QJ 2VPRA 3K7AJ 2OPTA 5EF6A 4M6VA 2E19A 1ETOA 4G12A 5IP6A 5IYBJ 5F0CA 3BR1A 4I76A 4C3HJ 2M9HA 3A01B 2E1OA 2IAIA 3BR3A 3CMYA 1ETWA 1MBFA 3H3VK 2VKEA 3LOCA 4X6AJ 2NS7A 5J1RA 3CDLA 2FQ4A 3QPSA 1W0TA 1APLC 2QCOA 5F04A 2LY9A 1IRZA 2M8GX 2L0KA 3BQYA 1Y1VJ 2K9NA 3NAUA 2HDDA 1PUFA 2MG4A 1UHSA 5GPAA 1DU6A 2AHQA 1GT0C 2GM4A 3IH4A 4B4CA 4MIMA 1JUPA 3FKIJ 4W97A 1FIAA 3JRIA 4DYRA 5GPCA 1T33A 1IJWC 5FLVA 1IDYA 3WHCA 1OCPA 5E3MA 3JRFA 1TWHJ 4A3KJ 1QPIA 3IV5A 3M3YJ 2JA6J 2HI3A 5F08A 1PUFB 1T56A 1ZKGA 3QQAA 4V2FA 4NDLA 3BG3A 4RBOA 3HOZJ 4J19A 1Y1WJ 5M5WJ 1IV6A 2D5VA 2K9SA 3BG9A 4M3GA 1ZK8A 1A5JA 4MFEA 3O8HA 4MLOA 5EZHA 1RKWA 2NVTJ 4QIWN 1JUMA 1TWAJ 5EGOA 5IYDJ 3HM5A 4M3FA 3RQIA 3K2AA 3VPRA 2EZIA 3GTMJ 1MH4A 1X2NA 1GV5A 2L7FP 2B63J 4D5FA 1MBKA 4A3BJ 3JRDA 2YU9J 2R7ZJ 4JP0A 5FJ8J 2E2IJ 1BW6A 4BY1J 1I6HJ 1ETVA 1ENHA 1S7EA 1XC5A 4CYCB 1JUSA 3BTJA 1XG1A 2DA5A 3DEWA 1ZTRA 2CQXA 3TP0A 4Y52J 1I3QJ 2MW8A 5EG0B 2WB1N 2KDZA 1AHDP 1B72B 2ME0A 1O4XA 5C4JJ 2DA3A 2DN0A 2CUEA 1F43A 2LR8A 1U8BA 2XB5A 3BQZA 1OFCX 3BR6A 3UKGA 2DMUA 1WPKA 1XS9A 3BT9A 1D5YA 3S15J 2ELKA 2AO9A 2EQRA 4ABZA 3LNQA 3O8GA 4HNVA 4A93J 2DA1A 3IH2A 1BJZA 3CQZJ 2XPVA 4JX4A 4BKXA 2HYJA 1FTZA 4XRSA 1G2HA 2NOGA 1WH7A 3LSPA 1AU7A 1GDTA 1JKQC 2EZKA 4RDUA 3BR2A 4D5CA 3JREA 5EYRA 5IP9J 2HOSA 3S1NJ 1U78A 1HOMA 4IHWA 1BW5A 4AYBN 2L9RA 4IHXA 3MVPA 2X6OA 2M34A 2DA2A 2XPWA 4Y7NJ 1RPWA 4QSHA 1FJLA 3HOUJ 2HQ5A 3MKLA 3LSRA 3HKZN 3FISA 3L1PA 5EEAA 4FTHA 2R93J 3FK6A 1IDZA 4A3FJ 4DZPA 1I50J 3S17J 2K40A 2OF7A 3OSFA 4IHVA 2L7ZA 1HF0A 3HEFA 5FKKA 2ZB9A 2DTZA 2WAQN 5J1UA 3S2DJ 2DMPA 1IUFA 5F0HA 3BTLA 3JRAA 1ZR2A 1Z77A 1JTXA 1FIPA 9ANTA 4M3DA 3PM1A 4B1RA 3BR0A 5EDNA 2ME6A 4GFBA 2P81A 2CU7A 2EBIA 3Q0UA 1UMQA 4BBRJ 4B3AA 1F36A 2CJJA 1MBJA 2JN6A 1RETA 4V2GA 5IPAA 2DA4A 3I4MJ 3C2BA 2R5YB 3FIWA 1H88C 1SANA 5J3LA 1WI3A 2HXOA 1JJ6C 1NK2P 5C4XJ 2W48A 2X48A 3S16J 1RR7A 3I4NJ 2MSYA 2VI6A 2ECCA 3Q0VA 5K7FA 3GTGJ 4DW6A 1MNMC 1POGA 4A3LJ 3S1RJ 2Y30A 2DMTA 4CYCA 5DTDA 1HDDC 2NVXJ 2JK3A 3ZQGA 5DS9A 3HDDA 1QVTA 3G1OA 1NK3P 4W1UA 2JA5J 4FISA 5EG0A 4A3MJ 2XGDA 3H0GJ 1BL0A 3RKQA 3HOXJ 3D1NI 1B72A 1YRNB 5K7ZA 1MBGA 3HGGA 5BNGA 1TWCJ 4D7NA 1GUUA 4QTRA 1U9OA 5JLWA 2VUMJ 5F1JA 4C3IJ 1ETYA 3JRCA 2MGQA 4IHYA 2IEKA 2EH3A 1OCTC 2M2EA 1DU0A 5GP9A 3DCFA 2E2HJ 3HGYA 1R9TJ 1LFBA 1WGXA 2XSDC 3GTKJ 1JTYA 5FLMJ 3OSGA 5FKOA 3TEDA 1JGGA 1H89C 2DMNA 1OJLA 3Q0WA 4AUXA 2CRGA 2R92J 1RESA 1EF4A 5IP7J 2ID6A 2DA7A 1HCRA 1FEXA 1JKRC 1TC3C 5HODA 3RZDJ 4S0HB 3CCYA 3Q3SA 5E3OA 4FE7A 1JJ8C 1K61A 3SJMA 3E7LA 2LLKA 2FJ1A 3ZQHA 2G0EA 4M3BA 3GBGA 3GTPJ 4A3GJ 3OIOA 1GVDA 4JYKA 2L7MP 1NTCA 4M3EA 3WHBA 1JKOC 3S1MJ 2QF7A 5E3LA 3TW7A 1MSFC 1JKPC 2WV1A 1U9NA 2YUSA 3W6VA 3G1MA 4DYQA 2H1KA 4MFDA 1X58A 2HOTA 4JX6A 3ZQFA 5M5YJ 3HBLA 1FTTA 3B6CA 1GV2A 1MSEC 5C3EJ 2XPUA 3GTQJ 2HOAA 4X1EA 2HXIA 1ZQ3P 2XRLA 4XRSG 4I6ZA 1B8IA 3JRBA 4LOCA 4BXXJ 3S2HJ 3GTJJ 1IGNA 1TWFJ 5M5XJ 2R5YA 1W0UA 1LE8B 2GLOA 1ETXA 3SDGA 1ITYA 2R5ZA 5FKLA 1AKHA 4A3EJ
chains in the Genus database with same CATH superfamily
2BOLA 4AIHA 1XCVA 5KHDA 2KIMA 2PJPA 3MWMA 2IA0A 5FKMA 1HKQA 5FKNA 2Y69H 3JRHA 3R0JA 2FBIA 3TP3A 1UG0A 4RLFA 1RKTA 2PMZN 2FF4A 4L18B 4XICA 2KT0A 4YFNF 3RIRA 1XX5A 2DOFA 3HRTA 2MC3A 2IA2A 3MKZA 1J09A 1REPC 3KEQA 1AKHB 1G3WA 2ELHA 2OV7A 3ZMTA 2IGKA 2BGCA 3KZYA 3BTIA 4UUSA 2GXAA 2UV1A 4D0PA 3EQLF 2ECBA 4CZCA 4Q4ZF 3LAPA 2V7FA 2Z5UA 5DCMB 4BJ5C 1D0XA 3M8FA 1IC8A 2VE8A 2H09A 1LVKA 3IH3A 1MBEA 5EEHA 1FMVA 2XB0X 3BC8A 1D1BA 1QBJA 3ONQA 3I55I 3HOYJ 4I0AA 2LD5A 2PEXA 3BTCA 3CDIA 2K9QA 3OL4A 1CQTA 3MZYA 4L0ZB 1XD7A 2YS9A 2LTPA 1S7AA 1WH5A 4EM1A 4IRHA 1J2XA 3WTUC 4BDZA 2BY0A 1PYVA 2X1DA 1I6XA 1UG2A 4E7KA 2ZSHB 3NWSA 3WE3A 1T38A 4KIBA 4BQOA 3Q9SA 4YG2F 3ZQCA 3FX3A 3L2UA 3VFZA 3J7YJ 1TQMA 1V3FA 1E3PA 3F8FA 4LD5A 2O7OA 4A3JJ 2YX7A 3OMYA 5FLXZ 4U0VA 4F92B 2LYCA 3PO3J 1I5ZA 2R0QC 3C1DA 3BZ6A 4EEFG 1VF9A 2NOJB 3T5XA 2JTVA 1N75A 3B6AA 2Y0SN 5D5WB 4BUPA 4XIDA 3HUGB 3VSLA 4M9XA 4O6JA 4HX7A 2VASA 3MQ0A 3BG5A 1QRYA 2VODA 1Q1VA 2JRTA 3FXKA 1OISA 1ZH5A 3DKXA 3VYRB 5LEJA 1LUJB 2HQRA 4I99C 1OR7C 3G71I 3BZKA 2HDWA 2DCEA 4ESJA 5IOYA 4E7ZA 4CCLA 2I10A 4C2MJ 4L9TA 3SHFA 1WCMJ 2F4MB 3CC7I 3LSHA 5LGTA 1YIJI 1RZ4A 5E8GA 3KLNA 2O0YA 3QU3A 1R49A 3BWGA 5J1YA 4IHTA 3NQOA 4EGYA 1I1SA 1O7LA 2E5ZA 1I3AA 4LLNA 1IRGA 3K7AJ 3K4CA 4M6VA 2JPBA 3LWFA 1AWCA 1ZN2A 4KIGA 4OINF 2DK8A 3L7WA 4CCJA 2MBFA 2CFXA 3TL4X 3CC2I 2M9HA 2R7XA 4ZDOA 2E1OA 2X85A 3QPTA 4KICA 2PMHA 4HNTA 3CMAI 1V5EA 5ICFA 3W2WA 3V8LA 2VXDA 1WI9A 5AIQA 3H3VK 2VKEA 4C30A 5ERIA 1YO5C 2NS7A 3QPHA 3ZRGA 3OYLA 3CDLA 3OYNA 2FQ4A 3L2RA 5F04A 1QZZA 1OYWA 2M8GX 2QZ8A 2W25A 4GGGA 1PUFA 4UV8A 4OMYA 4XLFA 3TO6A 2GM4A 3TBIA 4IJAA 3IH4A 3F8CA 1W5CC 5TISC 3JSPA 4AU7A 2FOWA 4DYRA 5GPCA 4N4OB 3S93A 2A6EF 2EILH 3JRFA 1QPIA 1WJBA 3R6SA 2JA6J 1QHGA 2JUCA 3K70C 1YQAA 1ZKGA 2RGVA 2D1HA 5IT9Z 4I7HA 1FOKA 1W36C 4GYIA 4BEHA 2K9SA 2XIGA 4M3GA 2ELJA 2RV8A 5HLHA 1TNTA 3CO6C 5FB2A 2HDCA 4NB5A 1A5JA 3ZQ7A 1Q1HA 6PAXA 4MLOA 1TT5B 5EZHA 2STWA 1O3TA 3K2AA 3QYEA 3OOPA 3WTSC 1N78A 2L7FP 3HL2A 3Q9VA 4KDPA 1YG2A 1IN6A 3JRDA 2V26A 3CP8A 1BOBA 3ABMH 2ZMEC 5FJ8J 4KITB 4JOMA 4YIRX 4GXOA 3W3CA 2Q0OA 1ENHA 1S7EA 4CYCB 2QKLB 2QBYA 5HVQC 3QYBA 1ZLJA 4KMFA 2DA5A 1BR2A 4H0EA 3CUOA 2CQXA 1WJAA 2KPMA 2MW8A 3E6MA 2NNYA 4I09A 2F5DA 5CJ9A 1W5SA 5H20A 1AHDP 1SVMA 5GADJ 2P7CB 2BYVE 3HPGA 1D8JA 2LR8A 2CQ7A 4ZTFA 3UKGA 4XOPA 4MEYF 2KL4A 4WWCA 4BHCA 2EV5A 1XS9A 1D5YA 4UVAA 3F8NA 1YITI 3PSFA 2ZMEB 1FSEA 4EM0B 3PFIA 2X6XA 1W1WE 1J9IA 3V7CA 5KAFC 3J80Z 3OYKA 3H5NA 3SZPA 1S29A 2O8XA 3T8RA 1LQ1A 3DTKA 4ENKA 1DPUA 4MGRA 2G9WA 3EDPA 2HYJA 4MNUA 1G2HA 4WK8F 1R4MB 1JKQC 1ZYRF 2XKOA 3BR2A 4D5CA 3JREA 1IN8A 2E1CA 3E5QA 1YE9A 1S8NA 2X51A 1T08B 2AQFA 4HAMA 3REOA 5GAGJ 1BW5A 4AYBN 2L9RA 4IVNA 3COAC 5FROA 4WXCA 1YHQI 1Y6IA 2DA2A 2XPWA 4XKWA 4Y7NJ 5DEQA 4Q48A 3ZQQA 4CZZA 1TW2A 2GA1A 2EWNA 3RCOA 4E70A 2HQ5A 3EYYA 5LHHA 2W4SA 3OYIA 2L54A 5KVRA 5HDNA 4J00A 3ECOA 2VPLA 3H5AA 4FTHA 4PFPA 3FK6A 3CUQA 2R93J 2OTJI 4A3FJ 4ESBA 1SC7A 2OF7A 4B47A 3OSFA 1R1VA 3KEOA 4BHPA 1XGMA 2P7VB 3DF8A 1HF0A 2OAZA 2DODA 2DTZA 2WAQN 2Q1ZB 3S2WA 3ZPLA 5TGTA 2JRMA 2K4JA 3LSKA 1VQ8I 3CLQA 2DTRA 5F0HA 1ZR2A 5D8LB 1JI8A 1JTXA 4M3DA 1RR8C 5EDNA 2LF8A 4BACA 1RUNA 1DP7P 5DUKA 1ZGJA 3WTTC 3OYFA 2CJJA 3DWLE 1YS7A 4V2GA 5IPAA 5L3CA 3I4MJ 3B02A 1R58A 3FIWA 1PDNC 4UNOA 2QQ8A 1SANA 1R36A 3FBIB 4C2TA 2W48A 1H9TA 5AONA 4LIVA 5L3GA 3GFMA 3MAJA 1EH8A 4PCQA 3Q0VA 1TQPA 3CESA 4GDFA 3LMMA 4OU0A 4X0GA 4A3LJ 2H8WA 1U2WA 3HHGA 1LDJA 2AXTC 4U87A 4PFOA 1LDDA 3G1OA 4OIPF 1OKRA 3LSTA 4TV7A 1BC7C 2M87A 4R79A 2IT0A 2XGDA 2A5YB 3O2PE 3CCSI 3HOXJ 4A12A 1ZAOA 1T6SA 2WY7Q 1BC8C 4RAZA 4PJMA 2P0WA 1YX5A 1MBGA 2YR2A 4DBRA 5BNGA 3FXLA 3M7GA 1UHWA 4GCVA 2VLAA 2GIZA 2OCCH 2ISZA 3F22A 2BXZA 3RPUD 2VQGA 5F1JA 1OQYA 1MDMB 4CYDA 2MGQA 3G73A 4NC6A 2EH3A 2KIFA 1FYKA 5GP9A 3IRRA 2RDPA 3HGYA 1LFBA 4MTDA 2Z33A 5J8FA 4ZDLA 2HOEA 4DJAA 2OUMA 3HIFA 1MIJA 5FGMA 1TLHB 1GXQA 1RC9A 3DPLC 3Q0WA 2RNJA 2R92J 1WJCA 1O3SA 2HGCA 3FWEA 1HCRA 3QP6A 1FEXA 5CVJA 2E1NA 5E8IA 5HODA 3RZDJ 2EPFA 3U2RA 4S0HB 4E6KG 1BIBA 4ZTJA 3P9IA 3DKWA 2L7KA 2JVHA 4ASNA 3GZNB 2MFZA 1ON2A 4M3BA 1L0OC 5LRRA 1WSUA 4F52A 4A3GJ 3FXRA 1NTCA 3J7AY 2ZNYA 2V6CA 3WHBA 2DFFA 1FMWA 2QF7A 4LG3A 3GYHX 1QA6A 1U9NA 1SMYF 4RGRA 2VQLA 3C18A 2LDUA 4MFDA 3S32A 4JX6A 2IS6A 2VXZA 2QLZA 3RQ4A 1QO0D 3ZMVA 2MA3A 3CJRB 4G6DA 1FWZA 1B9NA 5CVRA 4E7IA 4XOTA 1KU3A 4HSTA 4U0WA 2XRLA 4XRSG 2K3FA 3DBHB 3QP5A 3QOPA 1IXSB 2HPMA 1IGNA 4J01A 3AG3H 5F6FA 5TRDA 3RKXA 4NQWB 3KX2A 2IA1A 5LHGA 4MEXF 2XAFA 5FD6A 2MC4A 3DLAA 4AVZA 5FKLA 1QQIA 2FNPA 4XLHA 4A3EJ 1AKHA 3MN2A 1BR1A 3BPVA 4LG0B 3HOWJ 2FD5A 3DBLB 1T8IA 1MMNA 1MZBA 4BJTA 3ABKH 2X9DA 3AFHA 1ZR4A 2TRTA 1YX3A 2OTLI 5CPRB 5DCMA 4YIFA 2E2JJ 2DXIA 3K2ZA 3JR9A 3DPUA 2QSHX 2NVYJ 1MH3A 1D8KA 4BXFA 5BPDA 4BQNA 3OY9A 1YRNA 2BV6A 5F27A 1E17A 1TZLA 3RJPA 4EATA 2Y31A 2CUZA 1Z6TA 1VQ9I 2XGCA 3PQJA 1VNDA 2HKOA 5CVIA 1U3EM 2OQGA 3ZOBA 1TWGJ 2UXNA 2VT2A 2ETHA 5IOZA 2EIJH 3J7AO 3I54A 1GXPA 3CCUI 1WQ2A 4FE4A 2EIMH 4BY7J 3S3OA 3F72A 4IF4A 1HSJA 1CF7A 1H8AC 4AIJA 1B1BA 2LP0A 1HDPA 3KE2A 3OYAA 3KP4A 5M3MJ 1X1DA 2LK2A 2ZCWA 4UVBA 4A6EA 4KNYA 4BDYA 1HQCA 3O3KA 4BL0B 1KA8A 3S14J 2VOPA 3RKWA 1Y0UA 5B1AH 2XF5A 2K9MA 4M6XA 1BA5A 2O8KA 3K4LA 4RAYA 3AKZA 3CD6I 2GIVA 2A68F 1X4PA 1BI3A 1ZARA 2LMDA 2DJNA 1IN4A 5IY5H 3AG4H 1Z7UA 3FHNA 2DW4A 4P96A 2WTEA 3ABTA 3L2WA 4D1QA 4JQFA 1P4AA 3BG7A 4HLYA 2VT3A 4XM3A 5EGOB 1ZRCA 4ZZLA 2QGUA 4R8HA 1UAAA 5DD4A 4FETA 2ISYA 4HA8A 5JLXA 1BI1A 3GLXA 2DT6A 1A6QA 1JHHA 1XMKA 2DMQA 2HS5A 1UB9A 2HFHA 3WU1B 2Y9ZA 2EFPA 1WRJA 1XTAA 4M72A 1VFCA 2BY3A 3ZQLA 3QPLA 5B1BH 3WTWC 2LREA 4ZH4F 2IBDA 1Z3YA 1ORKA 3H9GA 4BYYA 2COBA 2YPRA 2OQRA 1YW8A 2R7VA 3NWTA 4CGZA 1WJ5A 4UV9A 2Z9OA 2VN2A 2C6YA 4RGXA 3LA3A 3VB2A 2VJ4A 4ZJZA 1JT0A 4NHJA 2ZNZA 1LE8A 3PFYA 3LL7A 3X2QH 5D5VB 4AC0A 2CQKA 2B7EA 2V1NA 5CQGA 2KRFA 2ZSIB 3BR5A 1ETKA 5ED4A 2KRHA 2OA4A 5EF6A 2E19A 3K10A 4G12A 2FXAA 3OYJA 2BEOA 4I01A 2RREA 2CW7A 2F5CA 4G94A 2KJCA 3CCVI 2A07F 1I1GA 3C7JA 2EIKH 1WFXA 2FUG2 3A01B 5HS9A 3GW2A 3B73A 1RI7A 3BR3A 1SFXA 1Y0NA 2OZ6A 4PDKA 2PJRB 3W6KB 1MBFA 3PNYA 4FASD 3LOCA 5EEGA 3RTRA 3GVAA 3I59B 3FMRA 3IC7A 5DYMA 3QPSA 3H0DA 4G7ZF 1YTYA 1ZLKA 3GZ5A 1NH3A 2LY9A 1IRZA 4KJZA 3NAUA 2E1MC 1UHSA 5GPAA 2L9VA 2IVMA 4LLLA 2AHQA 4IO9F 2CW8A 4Z6YA 4MIMA 1Y56A 1FIAA 3OWTA 3JRIA 2OC6A 3V42A 1NG7A 1IJWC 2HYGD 1OCPA 5E3MA 5GTIC 1P9QC 3M3YJ 1LNWA 2XAGA 1VQ6I 1FX7A 3FF5A 2DDBA 3ABLH 2DFEA 2KRCA 2HYFA 1ZRDA 1T56A 1V5GA 3BCBA 4UVCA 5HS8A 4V2FA 2VQCA 3BG3A 1KONA 2HTJA 3HOZJ 5LLQA 3P5JA 1IV6A 2E1MB 1VZ0A 3H92A 4LLGF 2JZYA 2WBMA 1IW7F 3DV8A 3ERMA 3M07A 2O3FA 2M5WA 3I58A 3OYEA 3O8HA 1P4WA 5BS6A 1RKWA 4BAYA 2NVTJ 4FX4A 3HM5A 3N4MA 2HWVA 3P7NA 4HF1A 3BJAA 2CV0A 1GV5A 5F1RA 1XGOA 3FBNB 2HU9A 2LNBA 3SZGA 2B63J 3HPHA 3VDXA 2YU9J 3IUOA 2R7ZJ 4JP0A 1R6RA 1BW6A 3KYLA 2CS3A 3SZTA 2E2IJ 4E7LA 4AM3A 1I6HJ 5ILVA 3W6JB 4WXDA 1I39A 1JUSA 1XG1A 5DDGA 2FA5A 2XKPA 3M8JA 4HX4A 4IHSA 5CKTA 1T0FC 4Y52J 2ZMEA 2M30A 4KA4A 3RPQA 3AL0C 4HSRA 4IZZA 5CYVA 2HTSA 1B72B 2P6TA 2ME0A 4PGGA 5C4JJ 2DN0A 2CUEA 5DM6F 1F43A 1G4DA 2BHZA 3BQZA 2WV0A 4DOZA 4E7HA 3DTIA 3FXMA 2DMUA 1ON1A 4ZC3A 4HNUA 3FXOA 3WGIA 3S15J 1EJ9A 1XDSA 3DQVC 2VJIA 2AO9A 3AAFA 4FT8A 3BPXA 3TDUC 4ABZA 1YJWI 4EJTA 3BDDA 3LNQA 3LAJA 2L4MA 2ZXHA 1QZEA 3D0SA 4B48A 4BKXA 1BIAA 1R4NB 3EPZA 3AL0B 1FTZA 4I02A 1T2KA 4XRSA 4BE0A 2X1CA 4CHUA 3LSPA 1AU7A 1K6YA 4HEA2 3R4KA 3ZMZA 2Z99A 2QENA 3S1NJ 4RB3C 2X4HA 1V54H 4KN7X 1HOMA 1ULYA 1R23A 2F48A 3OS1A 2DOEA 1MMSA 3MVPA 2M34A 2VOOA 1IRFA 2BVMA 2HEOA 3W2VA 4HBLA 2L4AA 2DI3A 4QSHA 1SD5A 2XUBA 3HOUJ 1VQ4I 2EFNA 3LSRA 2OD5A 1Z7LA 2DPDA 3FISA 1HBXG 3TDZC 2W7NA 1W7PD 2QA4I 5FO5A 3W2AA 2HPIA 1Y39A 3S17J 1VQNI 5A2QZ 3H1CA 4E7JA 4NUBA 2CV1A 4XNFA 3S2DJ 3BTLA 3JRAA 1D5VA 3IP4B 1R00A 3ABUA 2IGOA 2EV6A 2LOOA 2PG4A 5JHUA 3BR0A 1KGSA 2DLLA 4MQ9F 4OIRF 4GFBA 2KIUA 3CP2A 3T1BA 4N0BA 1UMQA 2A5WA 1F36A 3SEQA 1SEUA 3CCMI 5K5OA 1KU7A 1OCZH 3L00A 3PNVA 4NC7A 2PFBA 2M4KA 2DFIA 5DUIA 4CDGA 4BH9A 2HQAA 3PNTA 5E17F 5C4XJ 1M1EB 3EUKL 5H6QA 2VI6A 2ECCA 4AWXB 4DW6A 2EFQA 3PL8A 1SAXA 2H94A 1S6LA 3I0TA 3I71A 1YLFA 5JFRA 4ENJA 2Y30A 4B3XA 2FOKA 1HDDC 2OCEA 3R0AA 3ZQGA 1S3JA 3JAMK 3FHZA 3HDDA 3IWZA 5L3DA 3FMQA 1MDMA 4W1UA 1ZG3A 5D6FA 1MJAA 2F4IA 1K79A 5EG0A 2OBPA 4A3MJ 1HW2A 1J0RA 3K0LA 3RKQA 1QNTA 4IX7A 3WU0A 1BI2A 2RNGA 2L3DA 2MH2A 1KU9A 3HHHA 3WG9A 1OCOH 1TWCJ 4D7NA 3IAM2 2QSFX 1KQ9A 3IAS2 3V8JA 1P2FA 2Z3YA 4LJZF 1ETYA 3ESWB 3HKZA 1DPRA 1PP8F 2RC4A 2P5LC 1B59A 2IEKA 2VBXA 3WGGA 4ANJA 3DEEA 3PUFA 4RA2A 4Y3OA 4U7BA 4HRIA 3OYDA 2XSDC 4L9NA 2RVCA 2Z1DA 4O5VA 4Q47A 5CLSA 2H1LA 1AA7A 4CCOA 2LBFA 1P92A 5D5UB 4AIKA 1H89C 3CJTB 2V1XA 2DMNA 3MZHA 2HZDA 2LC2A 1F1ZA 3SQNA 1RESA 3DKYA 4HZFA 2WADA 1TC3C 1MMAA 2E60A 1KU2A 3R61A 3J81K 5GAHJ 1K4TA 3QRFF 3KP2A 2GQQA 1JJ8C 1K61A 5E20A 5GTHC 1X3UA 3LFUA 3ZQHA 2G0EA 2W1OA 3GTPJ 2IGNA 5ILSA 4JYKA 4Q5SF 3ZGKA 1T39A 5D5XB 1JKOC 4F93B 3MEXA 2VE9A 5HLTA 4DYQA 4P9UA 2VQHA 2HOTA 2VBYA 1R71A 1F9NA 1IXCA 4R1HA 3BLYA 4NQWA 4A0YA 1G8XA 1QZYA 2X6YA 5FD5A 1FYMA 3B6CA 1GV2A 3TQNA 3KZIC 1MSEC 4XQFA 4B44A 4N9IA 3OYHA 2XPUA 4LG0A 3K4BA 1VQ5I 1W5TA 5JR3A 4KMUX 4X1EA 2HXIA 4I6ZA 3I64A 3TKYA 4BXXJ 4EGZA 1ACIA 2KJBA 4ZYAA 1VQPI 4PZJA 3KETA 2DYSH 1TWFJ 1ZELA 2KZGA 3BJ6A 5M5XJ 2QEXI 2HNHA 2R5YA 5D8KB 2KHMA 2ZJPF 3JCUC 2W57A 2GLOA 1ETXA 3SDGA 1FOYA 1Z1DA 1ITYA 4G8XA 2NYXA 1VQ7I 1Z0XA 2A6HF 4CCKA 4A3IJ 4OAYA 2RAEA 3PUBA 3BROA 1IV8A 4Z2YA 2K5CA 4Y15A 5JHFA 5BOXA 1X2MA 5IYCJ 4PJLA 4HOBA 4A3CJ 2DA6A 3EETA 5LGUA 3J7ZI 2ZXJA 3WU2C 1YFHA 1DGWY 2L5QA 2GXGA 1MBHA 2FQ3A 1PUEE 2DFHA 2E35A 2J5OA 2DBBA 3PQKA 3TW6A 2NS8A 2UWMA 3M4OJ 3SFIA 1ETQA 3T0YA 4DQ2A 5E1XA 1TT0A 3R60A 3I53A 1N25A 2JSCA 2JSPA 3DLLF 4OIOF 1X1CA 4A69C 2FBKA 2LKSA 5F64A 4EJWA 2TDXA 1E3OC 1EV7A 1VQMI 3UNGC 3L2CA 4ETSA 2UUZA 4BBSJ 3KCCA 2VKHA 4UUTA 1KYZA 3HTSB 2UZKA 4NC8A 3WTVC 2JWTA 1IG7A 3OR1C 3CO7C 2R7RA 1VQLI 1G3SA 2FNAA 2E34A 3GCMA 3KIOA 3HB9A 2K7LA 2M0MA 3CCLI 2JA8J 2YU3A 2XAQA 2CG4A 4IOCF 2CUFA 3NARA 2QVOA 3K4MA 4RS8A 2CQQA 4IKFA 4B09A 4XRMA 2L9SA 2JMWA 2LY1A 2XAJA 3M9AA 5K5RA 2ACJA 2NVQJ 3GWZA 4M73A 4FCYA 1JT6A 2IS4A 4PSWA 3A02A 2LKXA 2IW5A 5K1YA 2Y2ZA 5E3NA 2GBYA 2XROA 3F0CA 2O9LA 1YS6A 2X0LA 1FP1D 3ZXSA 4MO7A 3PIOF 4IQ4A 4PGHA 1Z6RA 5K7HA 3GTLJ 4FQGA 4XLPF 3HRSA 1A6IA 1BOAA 2F5FA 2XGEA 2CQNA 2R7TA 3LFKA 1BBYA 2X6WA 2HZTA 5J4YA 3ASOH 1IXRC 2CO5A 1YYVA 3K1PA 4S04A 2K02A 3WE2A 2NVUB 3LSIA 2CUJA 4XN0A 2QBYB 5L3EA 2JA7J 2IXSA 3PO2J 2N8GA 3E6CC 1X3ZB 5DD8A 1T98A 1UELB 1D3YA 3E1SA 1RNLA 3GTOJ 2DOAA 2JJ7A 1TTYA 4D7MA 2VC1A 2L2OA 3L09A 2F5VA 2V9KA 4BGDA 5K5QA 4AIDA 3HOVJ 2Y0MA 3RKYA 3A01A 3RDIA 1USTA 3H3ZA 3OOUA 4L9VA 1IRXA 3ASNH 3N05A 3FDYA 2E36A 3E5XA 2ZJQF 1HW5A 5C44J 4P55A 3G1LA 3GXOA 4S05A 3S1QJ 2VPRA 5KCMA 4CO8A 1ETOA 1AOYA 5IP6A 1B9MA 3NRVA 5IYBJ 4EJUA 2DQLA 4I76A 4C3HJ 3JSOA 3CUQC 1Z21A 4D9JA 1RRJA 2WY8Q 2R7WA 2IAIA 3ULQB 5TJJA 2OU2A 3CCEI 3L9FA 3CMYA 1ETWA 2FMLA 1KQ0A 1Z05A 4X6AJ 3OIPA 5J1RA 4MQVA 3DBRB 1K78B 1D1AA 2OJED 1A31A 1APLC 4GYGA 2MABA 1NHAA 2HDDA 2MG4A 5FLXK 2B9SA 3BJOA 4UUVA 4YRVA 3MCZA 2QM3A 1G3YA 2IPQX 3KYDB 3I5UA 1JUPA 2H27A 1MW7A 4P5OA 4ZDPA 3F23A 4M74A 3CUQB 3LA7A 4XBFA 3J81Z 4A3KJ 3IV5A 3S3MA 2KISA 1YW9A 2JT1A 2D45A 1FOXA 2V9VA 1DQUA 5FRNA 4F91B 3QQAA 2GAUA 2LSOA 2D1VA 2HQNA 4NDLA 5FFZA 3LSMA 2EFWA 1XCBA 2Z2SB 4UB6C 2A3SA 2PMUA 4J19A 4LB5A 5M5WJ 2QYOA 1UFMA 2R4GA 3BG9A 2ADUA 2IGMA 4BS9A 1J75A 4YELA 5ICEA 5HOOA 2R3SA 2F2EA 1SD7A 3LA2A 4HPQA 4MFEA 3GUDA 4QIWN 1JUMA 2NRAC 5FRMA 2VJJA 2G7UA 1V55H 4M3FA 4Y33A 3OYMA 3CCRI 3VPRA 2EB7A 2EZIA 3EUAA 3GTMJ 5LEKA 3H5RA 5ICCA 1G59A 5AIPA 1LKXA 4A3BJ 3HUGA 2FRHA 4C2UA 4C9YA 1FBQA 3NEUA 2QUFA 4BY1J 4II2A 3CF5F 1FT9A 1X1BA 4AVPA 2AXLA 1S7OA 4QPQA 1G3TA 3BTJA 4K2EA 4U88A 3DTEA 3JTHA 5FFXA 1ZTRA 2VJ5A 1X3WB 1F5TA 4Y13A 4P1WA 2QQAA 2OZUA 3MMYB 2KDZA 3HC7A 1FOWA 1QGPA 2B0LA 2K85A 1O4XA 2DT7B 2Y75A 2DA3A 2JUGA 4II3A 2EJRA 1OFCX 2XF7A 1U5TC 3DEUA 4ZYHA 2LRDA 3RSNA 5E79C 3BR6A 2D2WA 2PX9A 4OWRB 2JPCA 3BT9A 1R22A 3DU5A 3E6DA 3WG7H 3WGHA 2ELKA 1LVAA 1MNDA 3KLOA 2E71A 4G7OF 2EQRA 1IUYA 2M45A 3JW4A 4UXNA 3RYPA 3O8GA 4QLCU 3P9KA 1BJZA 5DM7F 1O57A 1MMDA 2XPVA 3K69A 3V7RA 2DDAA 2DU9A 3H9JA 3DU6A 1A35A 2NOGA 1OR7A 3G2BA 5L3BA 3VOEA 1WH7A 2K9LA 3OYBA 1GDTA 1XDUA 2DT5A 2LH9A 2EZKA 5D4RA 1LB2A 1L3LA 5EYRA 2HOSA 2FBHA 4WX9A 3CDHA 2DPUA 3BY6A 1U78A 1IAWA 1U5TB 4XSZF 3CMEI 1Z91A 2X6OA 1A04A 1RPWA 4PJJA 3IHUA 1WJDA 2PBIA 4G6QA 4XKCA 3L2VA 1H9GA 3FXUA 4XKVA 2XASA 5HDKA 5LBQA 4O3MA 4LB6B 2RKHA 3HKZN 1FY7A 1OLTA 1J5YA 1E0EA 1Z3XA 1IDZA 1LEBA 1OCRH 1XGNA 4DZPA 1I50J 4YFXF 1B4AA 5D6EA 2CV2A 2XAHA 2HVQA 4IHVA 3HEFA 5FKKA 1PP7U 2DQRA 3A2KA 4XLCA 3G3ZA 1SAUA 5J1UA 2BW3B 2KQRA 1IUFA 2WB1A 3OL3A 1FIPA 9ANTA 4B1RA 3PM1A 3OS2A 2V79A 2VKDA 2XV4S 3A0BC 1XPXA 2P81A 2CU7A 2ZKZA 3LQQA 3Q0UA 4MTEA 4BNCA 2CWEA 4B3AA 1Z67A 2JN6A 1MBJA 3D5LA 1RETA 4IRGA 1GHCA 2DA4A 2XRNA 2ZFUA 3OS0A 1FLIA 1WI3A 2HXOA 3A0HC 4XR6A 1JJ6C 1NK2P 4A0XA 5J40A 1YIOA 1RR7A 3J80K 3OYCA 3SDBA 3GTGJ 1ERDA 5LHIA 1XSXA 3F9KA 4JK1X 3E5UA 1MJ9A 2K86A 1R7JA 2P5VA 4KYWA 2F6CA 5J8CA 4CYCA 5DTDA 2NVXJ 2JK3A 2AS5F 5DS9A 1XSDA 1P6RA 1NK3P 3F3XA 4KUMA 3SFZA 1FYLA 3KZZA 2JA5J 3H0GJ 1LDKB 4FHTA 1HKSA 2HKXA 1YRNB 3HTUA 2O03A 1SD4A 1HW1A 2E5NA 3HGGA 4QTRA 2EA4A 5JLWA 1HXDA 5E18F 4I2OA 2A6TA 4OOIA 3TO7A 4UHTA 4N9HA 3JRCA 4IHYA 1FBSA 2WAFA 2NXNB 3ISPA 3CJQB 2E2HJ 1Z9CA 1U6GA 2W85A 3TOBA 3RYRA 1WGXA 1J59A 3KP5A 1JTYA 1CF7B 3GTKJ 5FLMJ 3SYTA 2F5EA 1WVRA 3TEDA 1R5ID 1JGGA 4YEJA 4XN3A 1B6AA 2M7BA 4IPAA 2COMA 2LY2A 1OJLA 4AUXA 3VSKA 2CRGA 5CVVA 2R7SA 4RAGA 5HLGA 1EF4A 5IP7J 2FMYA 1JHFA 2DA7A 4XLEA 3EUHC 2W84A 3S3NA 1BM9A 2GA2A 2MD5A 3GO5A 2A69F 3L2QA 3CCYA 3Q3SA 4PJ0C 3GX4X 1HC8A 5E3OA 2WC2A 4HF2A 1KZHA 2XHKA 2RQPA 1UJ8A 1ZRFA 3E7LA 2V1DA 2FJ1A 1WJFA 1SFUA 3GBGA 3OIOA 1DUXC 2L7MP 5J6XA 3MD2A 4RB1A 3S1MJ 3TW7A 2DYRH 1MSFC 3U1DA 4HG2A 2WV1A 1JKPC 3MKYB 1YOVB 2IJLA 2STTA 2YUSA 2ZJRF 4EJVA 2R7QA 2H1KA 1USSA 1X58A 3TOAA 1O3QA 2GXBA 2ZJ2A 3ZQFA 5M5YJ 2XSJC 1X1AA 4LIUA 1OCCH 1XSVA 2VC0A 4KN4X 3V4GA 2VBZA 2Q2EB 3HZJA 3HOTA 2A61A 4LFUA 2CFOA 1O3RA 2DK5A 2ZXWH 3HRUA 5C3EJ 3MFKA 2IS2A 2HOAA 1U8RA 3TMOA 4ZYEA 3KP3A 4RB0A 5EJCA 3S2HJ 3GTJJ 1HSTA 2LF7A 1BR4A 5LFAA 4CSWA 1LE8B 1E2XA 1TL8A 3DFGA 1MMGA 3KFWX 5LGNA 2KFDA 3WODF 3HRMA 1STZA 4XORA 2EV0A 3GF2A 4A5MA 1P7JA 2L01A 1B8IB 2XVCA 3ECHA 2H8RA 2FX0A 5F0FA 4ZYDA 1K7AA 2LFBA 1R1UA 3DXJF 4E4HA 3I9V2 3H36A 3OV8A 3JTGA 1KYWA 3PIPF 4IRIA 1RIOH 2R5ZB 3K4NA 1W7PB 1K6OA 2EFOA 2EINH 5E1WA 3ZQIA 1XMAA 5JVGF 3E97A 4GRIA 3F21A 4DYCA 1Y8RB 2NNNA 3JRGA 2LVSA 4BE1A 2O6GE 2QQ9A 3LSGA 2VKVA 3QU6A 1TP4A 2BY2A 1S9HA 1VI0A 2GWRA 2W82A 3A03A 1I27A 2W00A 2ZC2A 3K70D 5BMZA 1QVUA 1K83J 3RI4A 1HLVA 3GFJA 3U21A 1W36D 3ZCOA 4A3DJ 2P8TA 1IO2A 3K1MA 2M3AA 4UUSB 2YSRA 4KISA 4EVIA 4XK4A 4ENNA 5JI6A 1LFUP 1FSHA 3FM5A 1D1CA 3RZOJ 2L9NA 4EJOA 2WWYA 1XN7A 2Y9YA 2ID3A 2CSOA 4HF0A 1ZGWA 5ILUA 2CGPA 2V4JC 3LSJA 2JVGA 2VL8A 4UY8I 2EZHA 4G7HF 3QYFA 5CQEA 1P7IA 1NG6A 4GO1A 3RPUA 2ZO4A 4DZJA 4OMZA 2VONA 2QKMB 2XC7A 3IWFA 3FK7A 2G7HA 2IRFG 3G4SI 2TCTA 1UHMA 3I56I 1K4SA 4EM2A 4C3JJ 2O5RA 2PMZA 3MZ8A 1GVJA 3CCJI 4CA0A 2ESHA 1W4MA 1VQKI 3LQRA 4AD9A 2QWWA 5GAEJ 5KK1A 4BXUA 3BOQA 4M71A 3M1CA 4BJ6C 1SD6A 2K3PA 3ZN0A 1OYIA 1YI2I 1EH7A 3IL2A 4JX5A 4IEJA 2M0CA 2EZLA 2BE5F 2VIXA 1MKMA 5M3FJ 3C2GA 2BZTA 3IKVA 3K9TA 1TNSA 4RB2C 3K4JA 4L5EA 2BVLA 5EZGA 4M6YA 2MLKA 2R7OA 3MKWB 4RM2A 2K27A 3WTZA 3WTYC 2E7XA 4PUSA 4BU2A 2PLYA 5HS7A 1LPQA 3E3VA 1SFOJ 4LMYA 4BE2A 1ZHFA 3BZCA 2L02A 5HLIA 1K78A 2OPTA 1SMTA 2MH9A 1N77A 1LEAA 1J7KA 4QWQA 5F0CA 3BR1A 4F7ZA 2VBWA 3D5RC 1DP3A 1FNNA 1D0ZA 1SVOA 3OIQA 4ENMA 2UXXA 4LK1F 3ZN1A 2IS1A 4XONA 5BQTA 2M8EA 4DBQA 2GZWA 4XL9A 2J5PA 3BCAA 3CZ6A 3KP6A 1R5GA 1W0TA 2QCOA 1MGTA 1IZ1A 2AQEA 2L0KA 3BQYA 1Y1VJ 1X19A 2BBYA 2K9NA 3ZR8X 4ESFA 4KIFA 2W24A 1DU6A 2I8DA 4KFCA 5KAIC 4I0BA 1GT0C 4B4CA 2Y0SA 1FPQA 4EV0A 3FKIJ 2A05A 3U1KA 4W97A 1R1TA 1SFEA 2KP6A 3GZ6A 1T33A 2KKOA 4LITA 1IDYA 3WHCA 5FLVA 3BG6A 4LGWA 2P5KA 4PJNA 1TWHJ 2O61A 1HA8A 4XLNF 3ROUA 3TO9A 3KEYA 2HI3A 1F4KA 2V6EA 1XMXA 5F08A 1PUFB 4PK4A 3FMSA 4Y4RA 3CCQI 4RBOA 4I98B 3CJNA 3UR3C 5B3SH 1E3HA 2ZBKA 5D4SA 1Y1WJ 5E1ZB 1MNEA 2DJIA 3WTXC 2D5VA 1ZK8A 4WXHA 2F4OB 3FM3A 1IF1A 2H6BA 4RM3A 2MD0A 3CTAA 3QOEA 3K4KA 3VEPA 2YX4A 1TWAJ 5EGOA 5IYDJ 4HQEA 3RQIA 4U7DA 3ZP5A 1D0YA 1MH4A 1X2NA 4BEHB 3OR2C 3K6GA 1FBUA 3G6EI 1ZG5A 1HKTA 4D5FA 1MBKA 2EA2A 2X1EA 3F6OA 1WHUA 3I4PA 5L3FA 1ETVA 1XC5A 4G9YA 3DEWA 3ML6A 4CXFA 3I3LA 2IP2A 3TP0A 1I3QJ 1PVEA 2KLOA 5EG0B 2R7DA 3VODA 4IQJA 2VB6A 1SVLA 2WB1N 2LKPA 3A4CA 4KT6A 2XDVA 5DCFA 2LG4A 2RQQA 4CUGA 4BQQA 2E7WA 1U8BA 5HNFA 3DPTA 1ZREA 2XB5A 4EMSA 3TGNA 2BXYA 2P4WA 1WPKA 1QPMA 1O7FA 1R5HA 1UCRA 3KPHA 3HJEA 1CGPA 4HYEA 3FZVA 1MD0A 3GLLA 1U5TA 4BHBA 4H4KC 3H35A 1X4OA 1XGSA 4NNJA 5J4VA 4HNVA 3OYGA 3Q5FA 1RUOA 4A93J 2DA1A 3IH2A 4Y17A 2LBFB 2R7UA 3CQZJ 3F6VA 4JX4A 1FZPB 4OIQF 2BY1A 4CH7A 5JVTA 3BP8A 4B43A 3HOSA 1WKMA 4YIIA 2M1BA 3JAMZ 2CMPA 3F8MA 2PJRA 4RDUA 4L5JA 1C0WA 2ZXIA 5IP9J 1QU3A 5LRSA 1EH6A 4CCNA 1H0MA 3I59A 5ICGA 2HVRA 4IHWA 4IHXA 3O6BB 3IRQA 2Y48A 4L0YB 2BW3A 3HSFA 3AG2H 1FJLA 3CF2A 2H6CA 2KIQA 3MKLA 3SEZA 1WWXA 2DO7A 3L1PA 1DDNA 5EEAA 2NAZA 3HSRA 3KYCB 4BQAA 4G6TB 5IT3A 3SXYA 2XAUA 1GLNA 2K40A 2XGXA 4XKBA 2L7ZA 2GOMA 5DV5A 2ZB9A 4FX0A 1EKEA 1WZ2A 3AG1H 4HDVA 2MLGA 3H3UA 4A2UA 1VTNC 2DMPA 4M9ZA 1Z77A 1MJBA 5H2FC 4HLXA 2V1UA 2JQ7A 3GMEA 2KDOA 4F3QA 1VQOI 2ME6A 2P6SA 4RMNA 1EA3A 2EBIA 1LFPA 4BBRJ 3ERED 2Z16A 4OAZA 1BJAA 3VYSB 4IXAA 3EYIA 3C2BA 1V4RA 3E6BA 2R5YB 1G6NA 4DGWB 1H88C 5J3LA 5B66C 2M7AA 3KP7A 4JBAA 5H6RA 4ZYGA 1FP2A 1V5FA 4L9JA 4LK0F 2X48A 2HVSA 3S16J 1A36A 3I4NJ 2MSYA 4MHGA 2CH0A 3IKTA 3M8EA 5K7FA 2EK5A 1MNMC 1DGRM 1POGA 1OMIA 3S1RJ 2DMTA 1OPCA 4HDUA 2BHYA 3C2HA 4PSXA 1QVTA 3M1EA 3ZMDA 4ZZDA 1JGSA 4RAFA 4FISA 3HYIA 1BL0A 4B8XA 4AYBA 4E7SA 3A1YA 3P9CA 3D1NI 5LD2C 5BPIA 1B72A 1TW3A 3VWBA 2DAOA 3DP7A 5K7ZA 4HV5A 4HX8A 2HR3A 2FSWA 1GUUA 1U9OA 1FC3A 3E0JB 4EQQA 2CYYA 2JA2A 1LJ9A 5B5EC 2KZVA 2NS0A 2VUMJ 2FE3A 4C3IJ 1ZGAA 5KNLA 4ITVA 3ZMUA 2KMUA 4WCGA 3PJRA 1OCTC 2XF6A 2M2EA 2Q8KA 1DU0A 3DCFA 4KT5C 5HNHA 1R9TJ 1OYYA 1IN5A 3V7SA 4CCMA 4N4NB 5A2QK 3OSGA 5FKOA 2WAQA 4CICA 3T8TA 4RGUA 1SFKA 3C3WA 2M4GA 1T0FA 3VYTB 1WJEA 1S5LC 1ZG1A 1ONVA 2K4BA 2ICWG 2ZFWA 1KQ8A 2ID6A 2R5ZA 1JKRC 1T95A 1UZCA 1XB4A 2CW0F 4XRFA 1BN5A 4QPOA 2FU4A 3H9QA 4FE7A 4HQMA 4RLQA 3HG9A 3SJMA 2MYSA 4HV6A 4XLAA 2LLKA 3EUHA 3U9GA 4A0ZA 4DNCA 4NBQA 2RN7A 3V8KA 3FXJA 2WAEA 3VYUB 1S72I 4IOAF 3N97A 1GVDA 4HW0A 2PI0A 5IT9K 3CMMA 2Q2EA 4M3EA 2QSGX 3GFLA 4XSXF 5E3LA 4V19K 4YFKF 1Y8QB 2ESNA 2V9PA 3HXLA 2FEZA 1QHHD 3QAHA 4F55A 1PJRA 5CVUA 3GFIA 3G1MA 3W6VA 4L5IA 3ZMSA 4RGSA 1TQIA 4A5NA 2GOXB 3D5SC 4M9SA 1TBXA 5HDGA 1YW7A 3HBLA 1FTTA 3ELKA 3FKJA 1YJ9I 1ODDA 4U0YA 1X1PA 4P9FA 4A6DA 2R7FA 3K1NA 1JE8A 2I5UA 3QODA 4XMYA 3PSIA 3GTQJ 4WF2A 1BI0A 1ZQ3P 1B8IA 4IL6C 3JRBA 2PQ8A 4LOCA 1P4XA 1U0JA 3HSEA 5J47A 2PN6A 3S8PA 3CC4I 4DIQA 3FXQA 4ON0A 1IN7A 3CLOA 1JXSA 2WA0A 1YJNI 1W0UA 3QWLA 3F8BA 3GEZA 4UB8C 1W7PA 2QQBA
chains in the Genus database with same CATH topology
1Z0XA 4A3IJ 3MN2A 2RAEA 3HOWJ 2FD5A 5FKMA 3JRHA 5FKNA 1P7JA 1X2MA 1B8IB 3TP3A 5IYCJ 2X9DA 1RKTA 2PMZN 2H8RA 4A3CJ 2DA6A 2FX0A 1ZR4A 2TRTA 5F0FA 2E2JJ 2LFBA 4XICA 2KT0A 3JR9A 1MBHA 2NVYJ 1MH3A 3TW6A 2R5ZB 2NS8A 1AKHB 3ZQIA 3M4OJ 3SFIA 1ETQA 3BTIA 1YRNA 4DYCA 5F27A 4UUSA 3JRGA 2LVSA 2Y31A 4A69C 3LSGA 2VKVA 2ECBA 2XGCA 1E3OC 1VI0A 1VNDA 3A03A 1IC8A 1QVUA 4BBSJ 3ZOBA 1TWGJ 1K83J 4UUTA 1HLVA 3IH3A 5IOZA 1MBEA 2JWTA 4A3DJ 1IG7A 2XB0X 4FE4A 4BY7J 3HB9A 1H8AC 3HOYJ 2LD5A 4UUSB 3BTCA 2LP0A 4XK4A 1LFUP 2JA8J 1HDPA 2K9QA 5M3MJ 1CQTA 2LK2A 3RZOJ 2CUFA 3NARA 2YS9A 2LTPA 2Y9YA 2ID3A 1WH5A 3S14J 2CQQA 1ZGWA 3LSJA 4XRMA 1BA5A 2JMWA 2O8KA 2EZHA 1UG2A 2NVQJ 2DJNA 1P7IA 4FCYA 1JT6A 3ZQCA 3A02A 2LKXA 4DZJA 2Y2ZA 5E3NA 2GBYA 3F0CA 2O9LA 3FK7A 2O7OA 4A3JJ 2TCTA 5EGOB 4MO7A 3PO3J 5K7HA 2R0QC 3GTLJ 4C3JJ 5JLXA 4EEFG 1A6IA 1VF9A 3B6AA 2Y0SN 2XGEA 4XIDA 2DMQA 3BG5A 1QRYA 2JA7J 2Y9ZA 1Q1VA 3PO2J 2N8GA 1VFCA 3ZQLA 3QPLA 4JX5A 4IEJA 2M0CA 2EZLA 2IBDA 1ORKA 5M3FJ 3GTOJ 2COBA 2JJ7A 4D7MA 4L5EA 5EZGA 5IOYA 3HOVJ 2I10A 1JT0A 4C2MJ 1LE8A 3A01A 1WCMJ 3OOUA 1SFOJ 4AC0A 5C44J 3G1LA 5J1YA 3BR5A 1ETKA 3S1QJ 2VPRA 3K7AJ 2OPTA 5EF6A 4M6VA 2E19A 1ETOA 4G12A 5IP6A 5IYBJ 5F0CA 3BR1A 4I76A 4C3HJ 2M9HA 3A01B 2E1OA 2IAIA 3BR3A 3CMYA 1ETWA 1MBFA 3H3VK 2VKEA 3LOCA 4X6AJ 2NS7A 5J1RA 3CDLA 2FQ4A 3QPSA 1W0TA 1APLC 2QCOA 5F04A 2LY9A 1IRZA 2M8GX 2L0KA 3BQYA 1Y1VJ 2K9NA 3NAUA 2HDDA 1PUFA 2MG4A 1UHSA 5GPAA 1DU6A 2AHQA 1GT0C 2GM4A 3IH4A 4B4CA 4MIMA 1JUPA 3FKIJ 4W97A 1FIAA 3JRIA 4DYRA 5GPCA 1T33A 1IJWC 5FLVA 1IDYA 3WHCA 1OCPA 5E3MA 3JRFA 1TWHJ 4A3KJ 1QPIA 3IV5A 3M3YJ 2JA6J 2HI3A 5F08A 1PUFB 1T56A 1ZKGA 3QQAA 4V2FA 4NDLA 3BG3A 4RBOA 3HOZJ 4J19A 1Y1WJ 5M5WJ 1IV6A 2D5VA 2K9SA 3BG9A 4M3GA 1ZK8A 1A5JA 4MFEA 3O8HA 4MLOA 5EZHA 1RKWA 2NVTJ 4QIWN 1JUMA 1TWAJ 5EGOA 5IYDJ 3HM5A 4M3FA 3RQIA 3K2AA 3VPRA 2EZIA 3GTMJ 1MH4A 1X2NA 1GV5A 2L7FP 2B63J 4D5FA 1MBKA 4A3BJ 3JRDA 2YU9J 2R7ZJ 4JP0A 5FJ8J 2E2IJ 1BW6A 4BY1J 1I6HJ 1ETVA 1ENHA 1S7EA 1XC5A 4CYCB 1JUSA 3BTJA 1XG1A 2DA5A 3DEWA 1ZTRA 2CQXA 3TP0A 4Y52J 1I3QJ 2MW8A 5EG0B 2WB1N 2KDZA 1AHDP 1B72B 2ME0A 1O4XA 5C4JJ 2DA3A 2DN0A 2CUEA 1F43A 2LR8A 1U8BA 2XB5A 3BQZA 1OFCX 3BR6A 3UKGA 2DMUA 1WPKA 1XS9A 3BT9A 1D5YA 3S15J 2ELKA 2AO9A 2EQRA 4ABZA 3LNQA 3O8GA 4HNVA 4A93J 2DA1A 3IH2A 1BJZA 3CQZJ 2XPVA 4JX4A 4BKXA 2HYJA 1FTZA 4XRSA 1G2HA 2NOGA 1WH7A 3LSPA 1AU7A 1GDTA 1JKQC 2EZKA 4RDUA 3BR2A 4D5CA 3JREA 5EYRA 5IP9J 2HOSA 3S1NJ 1U78A 1HOMA 4IHWA 1BW5A 4AYBN 2L9RA 4IHXA 3MVPA 2X6OA 2M34A 2DA2A 2XPWA 4Y7NJ 1RPWA 4QSHA 1FJLA 3HOUJ 2HQ5A 3MKLA 3LSRA 3HKZN 3FISA 3L1PA 5EEAA 4FTHA 2R93J 3FK6A 1IDZA 4A3FJ 4DZPA 1I50J 3S17J 2K40A 2OF7A 3OSFA 4IHVA 2L7ZA 1HF0A 3HEFA 5FKKA 2ZB9A 2DTZA 2WAQN 5J1UA 3S2DJ 2DMPA 1IUFA 5F0HA 3BTLA 3JRAA 1ZR2A 1Z77A 1JTXA 1FIPA 9ANTA 4M3DA 3PM1A 4B1RA 3BR0A 5EDNA 2ME6A 4GFBA 2P81A 2CU7A 2EBIA 3Q0UA 1UMQA 4BBRJ 4B3AA 1F36A 2CJJA 1MBJA 2JN6A 1RETA 4V2GA 5IPAA 2DA4A 3I4MJ 3C2BA 2R5YB 3FIWA 1H88C 1SANA 5J3LA 1WI3A 2HXOA 1JJ6C 1NK2P 5C4XJ 2W48A 2X48A 3S16J 1RR7A 3I4NJ 2MSYA 2VI6A 2ECCA 3Q0VA 5K7FA 3GTGJ 4DW6A 1MNMC 1POGA 4A3LJ 3S1RJ 2Y30A 2DMTA 4CYCA 5DTDA 1HDDC 2NVXJ 2JK3A 3ZQGA 5DS9A 3HDDA 1QVTA 3G1OA 1NK3P 4W1UA 2JA5J 4FISA 5EG0A 4A3MJ 2XGDA 3H0GJ 1BL0A 3RKQA 3HOXJ 3D1NI 1B72A 1YRNB 5K7ZA 1MBGA 3HGGA 5BNGA 1TWCJ 4D7NA 1GUUA 4QTRA 1U9OA 5JLWA 2VUMJ 5F1JA 4C3IJ 1ETYA 3JRCA 2MGQA 4IHYA 2IEKA 2EH3A 1OCTC 2M2EA 1DU0A 5GP9A 3DCFA 2E2HJ 3HGYA 1R9TJ 1LFBA 1WGXA 2XSDC 3GTKJ 1JTYA 5FLMJ 3OSGA 5FKOA 3TEDA 1JGGA 1H89C 2DMNA 1OJLA 3Q0WA 4AUXA 2CRGA 2R92J 1RESA 1EF4A 5IP7J 2ID6A 2DA7A 1HCRA 1FEXA 1JKRC 1TC3C 5HODA 3RZDJ 4S0HB 3CCYA 3Q3SA 5E3OA 4FE7A 1JJ8C 1K61A 3SJMA 3E7LA 2LLKA 2FJ1A 3ZQHA 2G0EA 4M3BA 3GBGA 3GTPJ 4A3GJ 3OIOA 1GVDA 4JYKA 2L7MP 1NTCA 4M3EA 3WHBA 1JKOC 3S1MJ 2QF7A 5E3LA 3TW7A 1MSFC 1JKPC 2WV1A 1U9NA 2YUSA 3W6VA 3G1MA 4DYQA 2H1KA 4MFDA 1X58A 2HOTA 4JX6A 3ZQFA 5M5YJ 3HBLA 1FTTA 3B6CA 1GV2A 1MSEC 5C3EJ 2XPUA 3GTQJ 2HOAA 4X1EA 2HXIA 1ZQ3P 2XRLA 4XRSG 4I6ZA 1B8IA 3JRBA 4LOCA 4BXXJ 3S2HJ 3GTJJ 1IGNA 1TWFJ 5M5XJ 2R5YA 1W0UA 1LE8B 2GLOA 1ETXA 3SDGA 1ITYA 2R5ZA 5FKLA 1AKHA 4A3EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0X A;  4A3I J;  3MN2 A;  2RAE A;  3HOW J;  2FD5 A;  5FKM A;  3JRH A;  5FKN A;  1P7J A;  1X2M A;  1B8I B;  3TP3 A;  5IYC J;  2X9D A;  1RKT A;  2PMZ N;  2H8R A;  4A3C J;  2DA6 A;  2FX0 A;  1ZR4 A;  2TRT A;  5F0F A;  2E2J J;  2LFB A;  4XIC A;  2KT0 A;  3JR9 A;  1MBH A;  2NVY J;  1MH3 A;  3TW6 A;  2R5Z B;  2NS8 A;  1AKH B;  3ZQI A;  3M4O J;  3SFI A;  1ETQ A;  3BTI A;  1YRN A;  4DYC A;  5F27 A;  4UUS A;  3JRG A;  2LVS A;  2Y31 A;  4A69 C;  3LSG A;  2VKV A;  2ECB A;  2XGC A;  1E3O C;  1VI0 A;  1VND A;  3A03 A;  1IC8 A;  1QVU A;  4BBS J;  3ZOB A;  1TWG J;  1K83 J;  4UUT A;  1HLV A;  3IH3 A;  5IOZ A;  1MBE A;  2JWT A;  4A3D J;  1IG7 A;  2XB0 X;  4FE4 A;  4BY7 J;  3HB9 A;  1H8A C;  3HOY J;  2LD5 A;  4UUS B;  3BTC A;  2LP0 A;  4XK4 A;  1LFU P;  2JA8 J;  1HDP A;  2K9Q A;  5M3M J;  1CQT A;  2LK2 A;  3RZO J;  2CUF A;  3NAR A;  2YS9 A;  2LTP A;  2Y9Y A;  2ID3 A;  1WH5 A;  3S14 J;  2CQQ A;  1ZGW A;  3LSJ A;  4XRM A;  1BA5 A;  2JMW A;  2O8K A;  2EZH A;  1UG2 A;  2NVQ J;  2DJN A;  1P7I A;  4FCY A;  1JT6 A;  3ZQC A;  3A02 A;  2LKX A;  4DZJ A;  2Y2Z A;  5E3N A;  2GBY A;  3F0C A;  2O9L A;  3FK7 A;  2O7O A;  4A3J J;  2TCT A;  5EGO B;  4MO7 A;  3PO3 J;  5K7H A;  2R0Q C;  3GTL J;  4C3J J;  5JLX A;  4EEF G;  1A6I A;  1VF9 A;  3B6A A;  2Y0S N;  2XGE A;  4XID A;  2DMQ A;  3BG5 A;  1QRY A;  2JA7 J;  2Y9Z A;  1Q1V A;  3PO2 J;  2N8G A;  1VFC A;  3ZQL A;  3QPL A;  4JX5 A;  4IEJ A;  2M0C A;  2EZL A;  2IBD A;  1ORK A;  5M3F J;  3GTO J;  2COB A;  2JJ7 A;  4D7M A;  4L5E A;  5EZG A;  5IOY A;  3HOV J;  2I10 A;  1JT0 A;  4C2M J;  1LE8 A;  3A01 A;  1WCM J;  3OOU A;  1SFO J;  4AC0 A;  5C44 J;  3G1L A;  5J1Y A;  3BR5 A;  1ETK A;  3S1Q J;  2VPR A;  3K7A J;  2OPT A;  5EF6 A;  4M6V A;  2E19 A;  1ETO A;  4G12 A;  5IP6 A;  5IYB J;  5F0C A;  3BR1 A;  4I76 A;  4C3H J;  2M9H A;  3A01 B;  2E1O A;  2IAI A;  3BR3 A;  3CMY A;  1ETW A;  1MBF A;  3H3V K;  2VKE A;  3LOC A;  4X6A J;  2NS7 A;  5J1R A;  3CDL A;  2FQ4 A;  3QPS A;  1W0T A;  1APL C;  2QCO A;  5F04 A;  2LY9 A;  1IRZ A;  2M8G X;  2L0K A;  3BQY A;  1Y1V J;  2K9N A;  3NAU A;  2HDD A;  1PUF A;  2MG4 A;  1UHS A;  5GPA A;  1DU6 A;  2AHQ A;  1GT0 C;  2GM4 A;  3IH4 A;  4B4C A;  4MIM A;  1JUP A;  3FKI J;  4W97 A;  1FIA A;  3JRI A;  4DYR A;  5GPC A;  1T33 A;  1IJW C;  5FLV A;  1IDY A;  3WHC A;  1OCP A;  5E3M A;  3JRF A;  1TWH J;  4A3K J;  1QPI A;  3IV5 A;  3M3Y J;  2JA6 J;  2HI3 A;  5F08 A;  1PUF B;  1T56 A;  1ZKG A;  3QQA A;  4V2F A;  4NDL A;  3BG3 A;  4RBO A;  3HOZ J;  4J19 A;  1Y1W J;  5M5W J;  1IV6 A;  2D5V A;  2K9S A;  3BG9 A;  4M3G A;  1ZK8 A;  1A5J A;  4MFE A;  3O8H A;  4MLO A;  5EZH A;  1RKW A;  2NVT J;  4QIW N;  1JUM A;  1TWA J;  5EGO A;  5IYD J;  3HM5 A;  4M3F A;  3RQI A;  3K2A A;  3VPR A;  2EZI A;  3GTM J;  1MH4 A;  1X2N A;  1GV5 A;  2L7F P;  2B63 J;  4D5F A;  1MBK A;  4A3B J;  3JRD A;  2YU9 J;  2R7Z J;  4JP0 A;  5FJ8 J;  2E2I J;  1BW6 A;  4BY1 J;  1I6H J;  1ETV A;  1ENH A;  1S7E A;  1XC5 A;  4CYC B;  1JUS A;  3BTJ A;  1XG1 A;  2DA5 A;  3DEW A;  1ZTR A;  2CQX A;  3TP0 A;  4Y52 J;  1I3Q J;  2MW8 A;  5EG0 B;  2WB1 N;  2KDZ A;  1AHD P;  1B72 B;  2ME0 A;  1O4X A;  5C4J J;  2DA3 A;  2DN0 A;  2CUE A;  1F43 A;  2LR8 A;  1U8B A;  2XB5 A;  3BQZ A;  1OFC X;  3BR6 A;  3UKG A;  2DMU A;  1WPK A;  1XS9 A;  3BT9 A;  1D5Y A;  3S15 J;  2ELK A;  2AO9 A;  2EQR A;  4ABZ A;  3LNQ A;  3O8G A;  4HNV A;  4A93 J;  2DA1 A;  3IH2 A;  1BJZ A;  3CQZ J;  2XPV A;  4JX4 A;  4BKX A;  2HYJ A;  1FTZ A;  4XRS A;  1G2H A;  2NOG A;  1WH7 A;  3LSP A;  1AU7 A;  1GDT A;  1JKQ C;  2EZK A;  4RDU A;  3BR2 A;  4D5C A;  3JRE A;  5EYR A;  5IP9 J;  2HOS A;  3S1N J;  1U78 A;  1HOM A;  4IHW A;  1BW5 A;  4AYB N;  2L9R A;  4IHX A;  3MVP A;  2X6O A;  2M34 A;  2DA2 A;  2XPW A;  4Y7N J;  1RPW A;  4QSH A;  1FJL A;  3HOU J;  2HQ5 A;  3MKL A;  3LSR A;  3HKZ N;  3FIS A;  3L1P A;  5EEA A;  4FTH A;  2R93 J;  3FK6 A;  1IDZ A;  4A3F J;  4DZP A;  1I50 J;  3S17 J;  2K40 A;  2OF7 A;  3OSF A;  4IHV A;  2L7Z A;  1HF0 A;  3HEF A;  5FKK A;  2ZB9 A;  2DTZ A;  2WAQ N;  5J1U A;  3S2D J;  2DMP A;  1IUF A;  5F0H A;  3BTL A;  3JRA A;  1ZR2 A;  1Z77 A;  1JTX A;  1FIP A;  9ANT A;  4M3D A;  3PM1 A;  4B1R A;  3BR0 A;  5EDN A;  2ME6 A;  4GFB A;  2P81 A;  2CU7 A;  2EBI A;  3Q0U A;  1UMQ A;  4BBR J;  4B3A A;  1F36 A;  2CJJ A;  1MBJ A;  2JN6 A;  1RET A;  4V2G A;  5IPA A;  2DA4 A;  3I4M J;  3C2B A;  2R5Y B;  3FIW A;  1H88 C;  1SAN A;  5J3L A;  1WI3 A;  2HXO A;  1JJ6 C;  1NK2 P;  5C4X J;  2W48 A;  2X48 A;  3S16 J;  1RR7 A;  3I4N J;  2MSY A;  2VI6 A;  2ECC A;  3Q0V A;  5K7F A;  3GTG J;  4DW6 A;  1MNM C;  1POG A;  4A3L J;  3S1R J;  2Y30 A;  2DMT A;  4CYC A;  5DTD A;  1HDD C;  2NVX J;  2JK3 A;  3ZQG A;  5DS9 A;  3HDD A;  1QVT A;  3G1O A;  1NK3 P;  4W1U A;  2JA5 J;  4FIS A;  5EG0 A;  4A3M J;  2XGD A;  3H0G J;  1BL0 A;  3RKQ A;  3HOX J;  3D1N I;  1B72 A;  1YRN B;  5K7Z A;  1MBG A;  3HGG A;  5BNG A;  1TWC J;  4D7N A;  1GUU A;  4QTR A;  1U9O A;  5JLW A;  2VUM J;  5F1J A;  4C3I J;  1ETY A;  3JRC A;  2MGQ A;  4IHY A;  2IEK A;  2EH3 A;  1OCT C;  2M2E A;  1DU0 A;  5GP9 A;  3DCF A;  2E2H J;  3HGY A;  1R9T J;  1LFB A;  1WGX A;  2XSD C;  3GTK J;  1JTY A;  5FLM J;  3OSG A;  5FKO A;  3TED A;  1JGG A;  1H89 C;  2DMN A;  1OJL A;  3Q0W A;  4AUX A;  2CRG A;  2R92 J;  1RES A;  1EF4 A;  5IP7 J;  2ID6 A;  2DA7 A;  1HCR A;  1FEX A;  1JKR C;  1TC3 C;  5HOD A;  3RZD J;  4S0H B;  3CCY A;  3Q3S A;  5E3O A;  4FE7 A;  1JJ8 C;  1K61 A;  3SJM A;  3E7L A;  2LLK A;  2FJ1 A;  3ZQH A;  2G0E A;  4M3B A;  3GBG A;  3GTP J;  4A3G J;  3OIO A;  1GVD A;  4JYK A;  2L7M P;  1NTC A;  4M3E A;  3WHB A;  1JKO C;  3S1M J;  2QF7 A;  5E3L A;  3TW7 A;  1MSF C;  1JKP C;  2WV1 A;  1U9N A;  2YUS A;  3W6V A;  3G1M A;  4DYQ A;  2H1K A;  4MFD A;  1X58 A;  2HOT A;  4JX6 A;  3ZQF A;  5M5Y J;  3HBL A;  1FTT A;  3B6C A;  1GV2 A;  1MSE C;  5C3E J;  2XPU A;  3GTQ J;  2HOA A;  4X1E A;  2HXI A;  1ZQ3 P;  2XRL A;  4XRS G;  4I6Z A;  1B8I A;  3JRB A;  4LOC A;  4BXX J;  3S2H J;  3GTJ J;  1IGN A;  1TWF J;  5M5X J;  2R5Y A;  1W0U A;  1LE8 B;  2GLO A;  1ETX A;  3SDG A;  1ITY A;  2R5Z A;  5FKL A;  1AKH A;  4A3E J; 
#chains in the Genus database with same CATH topology
 2BOL A;  4AIH A;  1XCV A;  5KHD A;  2KIM A;  2PJP A;  3MWM A;  2IA0 A;  5FKM A;  1HKQ A;  5FKN A;  2Y69 H;  3JRH A;  3R0J A;  2FBI A;  3TP3 A;  1UG0 A;  4RLF A;  1RKT A;  2PMZ N;  2FF4 A;  4L18 B;  4XIC A;  2KT0 A;  4YFN F;  3RIR A;  1XX5 A;  2DOF A;  3HRT A;  2MC3 A;  2IA2 A;  3MKZ A;  1J09 A;  1REP C;  3KEQ A;  1AKH B;  1G3W A;  2ELH A;  2OV7 A;  3ZMT A;  2IGK A;  2BGC A;  3KZY A;  3BTI A;  4UUS A;  2GXA A;  2UV1 A;  4D0P A;  3EQL F;  2ECB A;  4CZC A;  4Q4Z F;  3LAP A;  2V7F A;  2Z5U A;  5DCM B;  4BJ5 C;  1D0X A;  3M8F A;  1IC8 A;  2VE8 A;  2H09 A;  1LVK A;  3IH3 A;  1MBE A;  5EEH A;  1FMV A;  2XB0 X;  3BC8 A;  1D1B A;  1QBJ A;  3ONQ A;  3I55 I;  3HOY J;  4I0A A;  2LD5 A;  2PEX A;  3BTC A;  3CDI A;  2K9Q A;  3OL4 A;  1CQT A;  3MZY A;  4L0Z B;  1XD7 A;  2YS9 A;  2LTP A;  1S7A A;  1WH5 A;  4EM1 A;  4IRH A;  1J2X A;  3WTU C;  4BDZ A;  2BY0 A;  1PYV A;  2X1D A;  1I6X A;  1UG2 A;  4E7K A;  2ZSH B;  3NWS A;  3WE3 A;  1T38 A;  4KIB A;  4BQO A;  3Q9S A;  4YG2 F;  3ZQC A;  3FX3 A;  3L2U A;  3VFZ A;  3J7Y J;  1TQM A;  1V3F A;  1E3P A;  3F8F A;  4LD5 A;  2O7O A;  4A3J J;  2YX7 A;  3OMY A;  5FLX Z;  4U0V A;  4F92 B;  2LYC A;  3PO3 J;  1I5Z A;  2R0Q C;  3C1D A;  3BZ6 A;  4EEF G;  1VF9 A;  2NOJ B;  3T5X A;  2JTV A;  1N75 A;  3B6A A;  2Y0S N;  5D5W B;  4BUP A;  4XID A;  3HUG B;  3VSL A;  4M9X A;  4O6J A;  4HX7 A;  2VAS A;  3MQ0 A;  3BG5 A;  1QRY A;  2VOD A;  1Q1V A;  2JRT A;  3FXK A;  1OIS A;  1ZH5 A;  3DKX A;  3VYR B;  5LEJ A;  1LUJ B;  2HQR A;  4I99 C;  1OR7 C;  3G71 I;  3BZK A;  2HDW A;  2DCE A;  4ESJ A;  5IOY A;  4E7Z A;  4CCL A;  2I10 A;  4C2M J;  4L9T A;  3SHF A;  1WCM J;  2F4M B;  3CC7 I;  3LSH A;  5LGT A;  1YIJ I;  1RZ4 A;  5E8G A;  3KLN A;  2O0Y A;  3QU3 A;  1R49 A;  3BWG A;  5J1Y A;  4IHT A;  3NQO A;  4EGY A;  1I1S A;  1O7L A;  2E5Z A;  1I3A A;  4LLN A;  1IRG A;  3K7A J;  3K4C A;  4M6V A;  2JPB A;  3LWF A;  1AWC A;  1ZN2 A;  4KIG A;  4OIN F;  2DK8 A;  3L7W A;  4CCJ A;  2MBF A;  2CFX A;  3TL4 X;  3CC2 I;  2M9H A;  2R7X A;  4ZDO A;  2E1O A;  2X85 A;  3QPT A;  4KIC A;  2PMH A;  4HNT A;  3CMA I;  1V5E A;  5ICF A;  3W2W A;  3V8L A;  2VXD A;  1WI9 A;  5AIQ A;  3H3V K;  2VKE A;  4C30 A;  5ERI A;  1YO5 C;  2NS7 A;  3QPH A;  3ZRG A;  3OYL A;  3CDL A;  3OYN A;  2FQ4 A;  3L2R A;  5F04 A;  1QZZ A;  1OYW A;  2M8G X;  2QZ8 A;  2W25 A;  4GGG A;  1PUF A;  4UV8 A;  4OMY A;  4XLF A;  3TO6 A;  2GM4 A;  3TBI A;  4IJA A;  3IH4 A;  3F8C A;  1W5C C;  5TIS C;  3JSP A;  4AU7 A;  2FOW A;  4DYR A;  5GPC A;  4N4O B;  3S93 A;  2A6E F;  2EIL H;  3JRF A;  1QPI A;  1WJB A;  3R6S A;  2JA6 J;  1QHG A;  2JUC A;  3K70 C;  1YQA A;  1ZKG A;  2RGV A;  2D1H A;  5IT9 Z;  4I7H A;  1FOK A;  1W36 C;  4GYI A;  4BEH A;  2K9S A;  2XIG A;  4M3G A;  2ELJ A;  2RV8 A;  5HLH A;  1TNT A;  3CO6 C;  5FB2 A;  2HDC A;  4NB5 A;  1A5J A;  3ZQ7 A;  1Q1H A;  6PAX A;  4MLO A;  1TT5 B;  5EZH A;  2STW A;  1O3T A;  3K2A A;  3QYE A;  3OOP A;  3WTS C;  1N78 A;  2L7F P;  3HL2 A;  3Q9V A;  4KDP A;  1YG2 A;  1IN6 A;  3JRD A;  2V26 A;  3CP8 A;  1BOB A;  3ABM H;  2ZME C;  5FJ8 J;  4KIT B;  4JOM A;  4YIR X;  4GXO A;  3W3C A;  2Q0O A;  1ENH A;  1S7E A;  4CYC B;  2QKL B;  2QBY A;  5HVQ C;  3QYB A;  1ZLJ A;  4KMF A;  2DA5 A;  1BR2 A;  4H0E A;  3CUO A;  2CQX A;  1WJA A;  2KPM A;  2MW8 A;  3E6M A;  2NNY A;  4I09 A;  2F5D A;  5CJ9 A;  1W5S A;  5H20 A;  1AHD P;  1SVM A;  5GAD J;  2P7C B;  2BYV E;  3HPG A;  1D8J A;  2LR8 A;  2CQ7 A;  4ZTF A;  3UKG A;  4XOP A;  4MEY F;  2KL4 A;  4WWC A;  4BHC A;  2EV5 A;  1XS9 A;  1D5Y A;  4UVA A;  3F8N A;  1YIT I;  3PSF A;  2ZME B;  1FSE A;  4EM0 B;  3PFI A;  2X6X A;  1W1W E;  1J9I A;  3V7C A;  5KAF C;  3J80 Z;  3OYK A;  3H5N A;  3SZP A;  1S29 A;  2O8X A;  3T8R A;  1LQ1 A;  3DTK A;  4ENK A;  1DPU A;  4MGR A;  2G9W A;  3EDP A;  2HYJ A;  4MNU A;  1G2H A;  4WK8 F;  1R4M B;  1JKQ C;  1ZYR F;  2XKO A;  3BR2 A;  4D5C A;  3JRE A;  1IN8 A;  2E1C A;  3E5Q A;  1YE9 A;  1S8N A;  2X51 A;  1T08 B;  2AQF A;  4HAM A;  3REO A;  5GAG J;  1BW5 A;  4AYB N;  2L9R A;  4IVN A;  3COA C;  5FRO A;  4WXC A;  1YHQ I;  1Y6I A;  2DA2 A;  2XPW A;  4XKW A;  4Y7N J;  5DEQ A;  4Q48 A;  3ZQQ A;  4CZZ A;  1TW2 A;  2GA1 A;  2EWN A;  3RCO A;  4E70 A;  2HQ5 A;  3EYY A;  5LHH A;  2W4S A;  3OYI A;  2L54 A;  5KVR A;  5HDN A;  4J00 A;  3ECO A;  2VPL A;  3H5A A;  4FTH A;  4PFP A;  3FK6 A;  3CUQ A;  2R93 J;  2OTJ I;  4A3F J;  4ESB A;  1SC7 A;  2OF7 A;  4B47 A;  3OSF A;  1R1V A;  3KEO A;  4BHP A;  1XGM A;  2P7V B;  3DF8 A;  1HF0 A;  2OAZ A;  2DOD A;  2DTZ A;  2WAQ N;  2Q1Z B;  3S2W A;  3ZPL A;  5TGT A;  2JRM A;  2K4J A;  3LSK A;  1VQ8 I;  3CLQ A;  2DTR A;  5F0H A;  1ZR2 A;  5D8L B;  1JI8 A;  1JTX A;  4M3D A;  1RR8 C;  5EDN A;  2LF8 A;  4BAC A;  1RUN A;  1DP7 P;  5DUK A;  1ZGJ A;  3WTT C;  3OYF A;  2CJJ A;  3DWL E;  1YS7 A;  4V2G A;  5IPA A;  5L3C A;  3I4M J;  3B02 A;  1R58 A;  3FIW A;  1PDN C;  4UNO A;  2QQ8 A;  1SAN A;  1R36 A;  3FBI B;  4C2T A;  2W48 A;  1H9T A;  5AON A;  4LIV A;  5L3G A;  3GFM A;  3MAJ A;  1EH8 A;  4PCQ A;  3Q0V A;  1TQP A;  3CES A;  4GDF A;  3LMM A;  4OU0 A;  4X0G A;  4A3L J;  2H8W A;  1U2W A;  3HHG A;  1LDJ A;  2AXT C;  4U87 A;  4PFO A;  1LDD A;  3G1O A;  4OIP F;  1OKR A;  3LST A;  4TV7 A;  1BC7 C;  2M87 A;  4R79 A;  2IT0 A;  2XGD A;  2A5Y B;  3O2P E;  3CCS I;  3HOX J;  4A12 A;  1ZAO A;  1T6S A;  2WY7 Q;  1BC8 C;  4RAZ A;  4PJM A;  2P0W A;  1YX5 A;  1MBG A;  2YR2 A;  4DBR A;  5BNG A;  3FXL A;  3M7G A;  1UHW A;  4GCV A;  2VLA A;  2GIZ A;  2OCC H;  2ISZ A;  3F22 A;  2BXZ A;  3RPU D;  2VQG A;  5F1J A;  1OQY A;  1MDM B;  4CYD A;  2MGQ A;  3G73 A;  4NC6 A;  2EH3 A;  2KIF A;  1FYK A;  5GP9 A;  3IRR A;  2RDP A;  3HGY A;  1LFB A;  4MTD A;  2Z33 A;  5J8F A;  4ZDL A;  2HOE A;  4DJA A;  2OUM A;  3HIF A;  1MIJ A;  5FGM A;  1TLH B;  1GXQ A;  1RC9 A;  3DPL C;  3Q0W A;  2RNJ A;  2R92 J;  1WJC A;  1O3S A;  2HGC A;  3FWE A;  1HCR A;  3QP6 A;  1FEX A;  5CVJ A;  2E1N A;  5E8I A;  5HOD A;  3RZD J;  2EPF A;  3U2R A;  4S0H B;  4E6K G;  1BIB A;  4ZTJ A;  3P9I A;  3DKW A;  2L7K A;  2JVH A;  4ASN A;  3GZN B;  2MFZ A;  1ON2 A;  4M3B A;  1L0O C;  5LRR A;  1WSU A;  4F52 A;  4A3G J;  3FXR A;  1NTC A;  3J7A Y;  2ZNY A;  2V6C A;  3WHB A;  2DFF A;  1FMW A;  2QF7 A;  4LG3 A;  3GYH X;  1QA6 A;  1U9N A;  1SMY F;  4RGR A;  2VQL A;  3C18 A;  2LDU A;  4MFD A;  3S32 A;  4JX6 A;  2IS6 A;  2VXZ A;  2QLZ A;  3RQ4 A;  1QO0 D;  3ZMV A;  2MA3 A;  3CJR B;  4G6D A;  1FWZ A;  1B9N A;  5CVR A;  4E7I A;  4XOT A;  1KU3 A;  4HST A;  4U0W A;  2XRL A;  4XRS G;  2K3F A;  3DBH B;  3QP5 A;  3QOP A;  1IXS B;  2HPM A;  1IGN A;  4J01 A;  3AG3 H;  5F6F A;  5TRD A;  3RKX A;  4NQW B;  3KX2 A;  2IA1 A;  5LHG A;  4MEX F;  2XAF A;  5FD6 A;  2MC4 A;  3DLA A;  4AVZ A;  5FKL A;  1QQI A;  2FNP A;  4XLH A;  4A3E J;  1AKH A;  3MN2 A;  1BR1 A;  3BPV A;  4LG0 B;  3HOW J;  2FD5 A;  3DBL B;  1T8I A;  1MMN A;  1MZB A;  4BJT A;  3ABK H;  2X9D A;  3AFH A;  1ZR4 A;  2TRT A;  1YX3 A;  2OTL I;  5CPR B;  5DCM A;  4YIF A;  2E2J J;  2DXI A;  3K2Z A;  3JR9 A;  3DPU A;  2QSH X;  2NVY J;  1MH3 A;  1D8K A;  4BXF A;  5BPD A;  4BQN A;  3OY9 A;  1YRN A;  2BV6 A;  5F27 A;  1E17 A;  1TZL A;  3RJP A;  4EAT A;  2Y31 A;  2CUZ A;  1Z6T A;  1VQ9 I;  2XGC A;  3PQJ A;  1VND A;  2HKO A;  5CVI A;  1U3E M;  2OQG A;  3ZOB A;  1TWG J;  2UXN A;  2VT2 A;  2ETH A;  5IOZ A;  2EIJ H;  3J7A O;  3I54 A;  1GXP A;  3CCU I;  1WQ2 A;  4FE4 A;  2EIM H;  4BY7 J;  3S3O A;  3F72 A;  4IF4 A;  1HSJ A;  1CF7 A;  1H8A C;  4AIJ A;  1B1B A;  2LP0 A;  1HDP A;  3KE2 A;  3OYA A;  3KP4 A;  5M3M J;  1X1D A;  2LK2 A;  2ZCW A;  4UVB A;  4A6E A;  4KNY A;  4BDY A;  1HQC A;  3O3K A;  4BL0 B;  1KA8 A;  3S14 J;  2VOP A;  3RKW A;  1Y0U A;  5B1A H;  2XF5 A;  2K9M A;  4M6X A;  1BA5 A;  2O8K A;  3K4L A;  4RAY A;  3AKZ A;  3CD6 I;  2GIV A;  2A68 F;  1X4P A;  1BI3 A;  1ZAR A;  2LMD A;  2DJN A;  1IN4 A;  5IY5 H;  3AG4 H;  1Z7U A;  3FHN A;  2DW4 A;  4P96 A;  2WTE A;  3ABT A;  3L2W A;  4D1Q A;  4JQF A;  1P4A A;  3BG7 A;  4HLY A;  2VT3 A;  4XM3 A;  5EGO B;  1ZRC A;  4ZZL A;  2QGU A;  4R8H A;  1UAA A;  5DD4 A;  4FET A;  2ISY A;  4HA8 A;  5JLX A;  1BI1 A;  3GLX A;  2DT6 A;  1A6Q A;  1JHH A;  1XMK A;  2DMQ A;  2HS5 A;  1UB9 A;  2HFH A;  3WU1 B;  2Y9Z A;  2EFP A;  1WRJ A;  1XTA A;  4M72 A;  1VFC A;  2BY3 A;  3ZQL A;  3QPL A;  5B1B H;  3WTW C;  2LRE A;  4ZH4 F;  2IBD A;  1Z3Y A;  1ORK A;  3H9G A;  4BYY A;  2COB A;  2YPR A;  2OQR A;  1YW8 A;  2R7V A;  3NWT A;  4CGZ A;  1WJ5 A;  4UV9 A;  2Z9O A;  2VN2 A;  2C6Y A;  4RGX A;  3LA3 A;  3VB2 A;  2VJ4 A;  4ZJZ A;  1JT0 A;  4NHJ A;  2ZNZ A;  1LE8 A;  3PFY A;  3LL7 A;  3X2Q H;  5D5V B;  4AC0 A;  2CQK A;  2B7E A;  2V1N A;  5CQG A;  2KRF A;  2ZSI B;  3BR5 A;  1ETK A;  5ED4 A;  2KRH A;  2OA4 A;  5EF6 A;  2E19 A;  3K10 A;  4G12 A;  2FXA A;  3OYJ A;  2BEO A;  4I01 A;  2RRE A;  2CW7 A;  2F5C A;  4G94 A;  2KJC A;  3CCV I;  2A07 F;  1I1G A;  3C7J A;  2EIK H;  1WFX A;  2FUG 2;  3A01 B;  5HS9 A;  3GW2 A;  3B73 A;  1RI7 A;  3BR3 A;  1SFX A;  1Y0N A;  2OZ6 A;  4PDK A;  2PJR B;  3W6K B;  1MBF A;  3PNY A;  4FAS D;  3LOC A;  5EEG A;  3RTR A;  3GVA A;  3I59 B;  3FMR A;  3IC7 A;  5DYM A;  3QPS A;  3H0D A;  4G7Z F;  1YTY A;  1ZLK A;  3GZ5 A;  1NH3 A;  2LY9 A;  1IRZ A;  4KJZ A;  3NAU A;  2E1M C;  1UHS A;  5GPA A;  2L9V A;  2IVM A;  4LLL A;  2AHQ A;  4IO9 F;  2CW8 A;  4Z6Y A;  4MIM A;  1Y56 A;  1FIA A;  3OWT A;  3JRI A;  2OC6 A;  3V42 A;  1NG7 A;  1IJW C;  2HYG D;  1OCP A;  5E3M A;  5GTI C;  1P9Q C;  3M3Y J;  1LNW A;  2XAG A;  1VQ6 I;  1FX7 A;  3FF5 A;  2DDB A;  3ABL H;  2DFE A;  2KRC A;  2HYF A;  1ZRD A;  1T56 A;  1V5G A;  3BCB A;  4UVC A;  5HS8 A;  4V2F A;  2VQC A;  3BG3 A;  1KON A;  2HTJ A;  3HOZ J;  5LLQ A;  3P5J A;  1IV6 A;  2E1M B;  1VZ0 A;  3H92 A;  4LLG F;  2JZY A;  2WBM A;  1IW7 F;  3DV8 A;  3ERM A;  3M07 A;  2O3F A;  2M5W A;  3I58 A;  3OYE A;  3O8H A;  1P4W A;  5BS6 A;  1RKW A;  4BAY A;  2NVT J;  4FX4 A;  3HM5 A;  3N4M A;  2HWV A;  3P7N A;  4HF1 A;  3BJA A;  2CV0 A;  1GV5 A;  5F1R A;  1XGO A;  3FBN B;  2HU9 A;  2LNB A;  3SZG A;  2B63 J;  3HPH A;  3VDX A;  2YU9 J;  3IUO A;  2R7Z J;  4JP0 A;  1R6R A;  1BW6 A;  3KYL A;  2CS3 A;  3SZT A;  2E2I J;  4E7L A;  4AM3 A;  1I6H J;  5ILV A;  3W6J B;  4WXD A;  1I39 A;  1JUS A;  1XG1 A;  5DDG A;  2FA5 A;  2XKP A;  3M8J A;  4HX4 A;  4IHS A;  5CKT A;  1T0F C;  4Y52 J;  2ZME A;  2M30 A;  4KA4 A;  3RPQ A;  3AL0 C;  4HSR A;  4IZZ A;  5CYV A;  2HTS A;  1B72 B;  2P6T A;  2ME0 A;  4PGG A;  5C4J J;  2DN0 A;  2CUE A;  5DM6 F;  1F43 A;  1G4D A;  2BHZ A;  3BQZ A;  2WV0 A;  4DOZ A;  4E7H A;  3DTI A;  3FXM A;  2DMU A;  1ON1 A;  4ZC3 A;  4HNU A;  3FXO A;  3WGI A;  3S15 J;  1EJ9 A;  1XDS A;  3DQV C;  2VJI A;  2AO9 A;  3AAF A;  4FT8 A;  3BPX A;  3TDU C;  4ABZ A;  1YJW I;  4EJT A;  3BDD A;  3LNQ A;  3LAJ A;  2L4M A;  2ZXH A;  1QZE A;  3D0S A;  4B48 A;  4BKX A;  1BIA A;  1R4N B;  3EPZ A;  3AL0 B;  1FTZ A;  4I02 A;  1T2K A;  4XRS A;  4BE0 A;  2X1C A;  4CHU A;  3LSP A;  1AU7 A;  1K6Y A;  4HEA 2;  3R4K A;  3ZMZ A;  2Z99 A;  2QEN A;  3S1N J;  4RB3 C;  2X4H A;  1V54 H;  4KN7 X;  1HOM A;  1ULY A;  1R23 A;  2F48 A;  3OS1 A;  2DOE A;  1MMS A;  3MVP A;  2M34 A;  2VOO A;  1IRF A;  2BVM A;  2HEO A;  3W2V A;  4HBL A;  2L4A A;  2DI3 A;  4QSH A;  1SD5 A;  2XUB A;  3HOU J;  1VQ4 I;  2EFN A;  3LSR A;  2OD5 A;  1Z7L A;  2DPD A;  3FIS A;  1HBX G;  3TDZ C;  2W7N A;  1W7P D;  2QA4 I;  5FO5 A;  3W2A A;  2HPI A;  1Y39 A;  3S17 J;  1VQN I;  5A2Q Z;  3H1C A;  4E7J A;  4NUB A;  2CV1 A;  4XNF A;  3S2D J;  3BTL A;  3JRA A;  1D5V A;  3IP4 B;  1R00 A;  3ABU A;  2IGO A;  2EV6 A;  2LOO A;  2PG4 A;  5JHU A;  3BR0 A;  1KGS A;  2DLL A;  4MQ9 F;  4OIR F;  4GFB A;  2KIU A;  3CP2 A;  3T1B A;  4N0B A;  1UMQ A;  2A5W A;  1F36 A;  3SEQ A;  1SEU A;  3CCM I;  5K5O A;  1KU7 A;  1OCZ H;  3L00 A;  3PNV A;  4NC7 A;  2PFB A;  2M4K A;  2DFI A;  5DUI A;  4CDG A;  4BH9 A;  2HQA A;  3PNT A;  5E17 F;  5C4X J;  1M1E B;  3EUK L;  5H6Q A;  2VI6 A;  2ECC A;  4AWX B;  4DW6 A;  2EFQ A;  3PL8 A;  1SAX A;  2H94 A;  1S6L A;  3I0T A;  3I71 A;  1YLF A;  5JFR A;  4ENJ A;  2Y30 A;  4B3X A;  2FOK A;  1HDD C;  2OCE A;  3R0A A;  3ZQG A;  1S3J A;  3JAM K;  3FHZ A;  3HDD A;  3IWZ A;  5L3D A;  3FMQ A;  1MDM A;  4W1U A;  1ZG3 A;  5D6F A;  1MJA A;  2F4I A;  1K79 A;  5EG0 A;  2OBP A;  4A3M J;  1HW2 A;  1J0R A;  3K0L A;  3RKQ A;  1QNT A;  4IX7 A;  3WU0 A;  1BI2 A;  2RNG A;  2L3D A;  2MH2 A;  1KU9 A;  3HHH A;  3WG9 A;  1OCO H;  1TWC J;  4D7N A;  3IAM 2;  2QSF X;  1KQ9 A;  3IAS 2;  3V8J A;  1P2F A;  2Z3Y A;  4LJZ F;  1ETY A;  3ESW B;  3HKZ A;  1DPR A;  1PP8 F;  2RC4 A;  2P5L C;  1B59 A;  2IEK A;  2VBX A;  3WGG A;  4ANJ A;  3DEE A;  3PUF A;  4RA2 A;  4Y3O A;  4U7B A;  4HRI A;  3OYD A;  2XSD C;  4L9N A;  2RVC A;  2Z1D A;  4O5V A;  4Q47 A;  5CLS A;  2H1L A;  1AA7 A;  4CCO A;  2LBF A;  1P92 A;  5D5U B;  4AIK A;  1H89 C;  3CJT B;  2V1X A;  2DMN A;  3MZH A;  2HZD A;  2LC2 A;  1F1Z A;  3SQN A;  1RES A;  3DKY A;  4HZF A;  2WAD A;  1TC3 C;  1MMA A;  2E60 A;  1KU2 A;  3R61 A;  3J81 K;  5GAH J;  1K4T A;  3QRF F;  3KP2 A;  2GQQ A;  1JJ8 C;  1K61 A;  5E20 A;  5GTH C;  1X3U A;  3LFU A;  3ZQH A;  2G0E A;  2W1O A;  3GTP J;  2IGN A;  5ILS A;  4JYK A;  4Q5S F;  3ZGK A;  1T39 A;  5D5X B;  1JKO C;  4F93 B;  3MEX A;  2VE9 A;  5HLT A;  4DYQ A;  4P9U A;  2VQH A;  2HOT A;  2VBY A;  1R71 A;  1F9N A;  1IXC A;  4R1H A;  3BLY A;  4NQW A;  4A0Y A;  1G8X A;  1QZY A;  2X6Y A;  5FD5 A;  1FYM A;  3B6C A;  1GV2 A;  3TQN A;  3KZI C;  1MSE C;  4XQF A;  4B44 A;  4N9I A;  3OYH A;  2XPU A;  4LG0 A;  3K4B A;  1VQ5 I;  1W5T A;  5JR3 A;  4KMU X;  4X1E A;  2HXI A;  4I6Z A;  3I64 A;  3TKY A;  4BXX J;  4EGZ A;  1ACI A;  2KJB A;  4ZYA A;  1VQP I;  4PZJ A;  3KET A;  2DYS H;  1TWF J;  1ZEL A;  2KZG A;  3BJ6 A;  5M5X J;  2QEX I;  2HNH A;  2R5Y A;  5D8K B;  2KHM A;  2ZJP F;  3JCU C;  2W57 A;  2GLO A;  1ETX A;  3SDG A;  1FOY A;  1Z1D A;  1ITY A;  4G8X A;  2NYX A;  1VQ7 I;  1Z0X A;  2A6H F;  4CCK A;  4A3I J;  4OAY A;  2RAE A;  3PUB A;  3BRO A;  1IV8 A;  4Z2Y A;  2K5C A;  4Y15 A;  5JHF A;  5BOX A;  1X2M A;  5IYC J;  4PJL A;  4HOB A;  4A3C J;  2DA6 A;  3EET A;  5LGU A;  3J7Z I;  2ZXJ A;  3WU2 C;  1YFH A;  1DGW Y;  2L5Q A;  2GXG A;  1MBH A;  2FQ3 A;  1PUE E;  2DFH A;  2E35 A;  2J5O A;  2DBB A;  3PQK A;  3TW6 A;  2NS8 A;  2UWM A;  3M4O J;  3SFI A;  1ETQ A;  3T0Y A;  4DQ2 A;  5E1X A;  1TT0 A;  3R60 A;  3I53 A;  1N25 A;  2JSC A;  2JSP A;  3DLL F;  4OIO F;  1X1C A;  4A69 C;  2FBK A;  2LKS A;  5F64 A;  4EJW A;  2TDX A;  1E3O C;  1EV7 A;  1VQM I;  3UNG C;  3L2C A;  4ETS A;  2UUZ A;  4BBS J;  3KCC A;  2VKH A;  4UUT A;  1KYZ A;  3HTS B;  2UZK A;  4NC8 A;  3WTV C;  2JWT A;  1IG7 A;  3OR1 C;  3CO7 C;  2R7R A;  1VQL I;  1G3S A;  2FNA A;  2E34 A;  3GCM A;  3KIO A;  3HB9 A;  2K7L A;  2M0M A;  3CCL I;  2JA8 J;  2YU3 A;  2XAQ A;  2CG4 A;  4IOC F;  2CUF A;  3NAR A;  2QVO A;  3K4M A;  4RS8 A;  2CQQ A;  4IKF A;  4B09 A;  4XRM A;  2L9S A;  2JMW A;  2LY1 A;  2XAJ A;  3M9A A;  5K5R A;  2ACJ A;  2NVQ J;  3GWZ A;  4M73 A;  4FCY A;  1JT6 A;  2IS4 A;  4PSW A;  3A02 A;  2LKX A;  2IW5 A;  5K1Y A;  2Y2Z A;  5E3N A;  2GBY A;  2XRO A;  3F0C A;  2O9L A;  1YS6 A;  2X0L A;  1FP1 D;  3ZXS A;  4MO7 A;  3PIO F;  4IQ4 A;  4PGH A;  1Z6R A;  5K7H A;  3GTL J;  4FQG A;  4XLP F;  3HRS A;  1A6I A;  1BOA A;  2F5F A;  2XGE A;  2CQN A;  2R7T A;  3LFK A;  1BBY A;  2X6W A;  2HZT A;  5J4Y A;  3ASO H;  1IXR C;  2CO5 A;  1YYV A;  3K1P A;  4S04 A;  2K02 A;  3WE2 A;  2NVU B;  3LSI A;  2CUJ A;  4XN0 A;  2QBY B;  5L3E A;  2JA7 J;  2IXS A;  3PO2 J;  2N8G A;  3E6C C;  1X3Z B;  5DD8 A;  1T98 A;  1UEL B;  1D3Y A;  3E1S A;  1RNL A;  3GTO J;  2DOA A;  2JJ7 A;  1TTY A;  4D7M A;  2VC1 A;  2L2O A;  3L09 A;  2F5V A;  2V9K A;  4BGD A;  5K5Q A;  4AID A;  3HOV J;  2Y0M A;  3RKY A;  3A01 A;  3RDI A;  1UST A;  3H3Z A;  3OOU A;  4L9V A;  1IRX A;  3ASN H;  3N05 A;  3FDY A;  2E36 A;  3E5X A;  2ZJQ F;  1HW5 A;  5C44 J;  4P55 A;  3G1L A;  3GXO A;  4S05 A;  3S1Q J;  2VPR A;  5KCM A;  4CO8 A;  1ETO A;  1AOY A;  5IP6 A;  1B9M A;  3NRV A;  5IYB J;  4EJU A;  2DQL A;  4I76 A;  4C3H J;  3JSO A;  3CUQ C;  1Z21 A;  4D9J A;  1RRJ A;  2WY8 Q;  2R7W A;  2IAI A;  3ULQ B;  5TJJ A;  2OU2 A;  3CCE I;  3L9F A;  3CMY A;  1ETW A;  2FML A;  1KQ0 A;  1Z05 A;  4X6A J;  3OIP A;  5J1R A;  4MQV A;  3DBR B;  1K78 B;  1D1A A;  2OJE D;  1A31 A;  1APL C;  4GYG A;  2MAB A;  1NHA A;  2HDD A;  2MG4 A;  5FLX K;  2B9S A;  3BJO A;  4UUV A;  4YRV A;  3MCZ A;  2QM3 A;  1G3Y A;  2IPQ X;  3KYD B;  3I5U A;  1JUP A;  2H27 A;  1MW7 A;  4P5O A;  4ZDP A;  3F23 A;  4M74 A;  3CUQ B;  3LA7 A;  4XBF A;  3J81 Z;  4A3K J;  3IV5 A;  3S3M A;  2KIS A;  1YW9 A;  2JT1 A;  2D45 A;  1FOX A;  2V9V A;  1DQU A;  5FRN A;  4F91 B;  3QQA A;  2GAU A;  2LSO A;  2D1V A;  2HQN A;  4NDL A;  5FFZ A;  3LSM A;  2EFW A;  1XCB A;  2Z2S B;  4UB6 C;  2A3S A;  2PMU A;  4J19 A;  4LB5 A;  5M5W J;  2QYO A;  1UFM A;  2R4G A;  3BG9 A;  2ADU A;  2IGM A;  4BS9 A;  1J75 A;  4YEL A;  5ICE A;  5HOO A;  2R3S A;  2F2E A;  1SD7 A;  3LA2 A;  4HPQ A;  4MFE A;  3GUD A;  4QIW N;  1JUM A;  2NRA C;  5FRM A;  2VJJ A;  2G7U A;  1V55 H;  4M3F A;  4Y33 A;  3OYM A;  3CCR I;  3VPR A;  2EB7 A;  2EZI A;  3EUA A;  3GTM J;  5LEK A;  3H5R A;  5ICC A;  1G59 A;  5AIP A;  1LKX A;  4A3B J;  3HUG A;  2FRH A;  4C2U A;  4C9Y A;  1FBQ A;  3NEU A;  2QUF A;  4BY1 J;  4II2 A;  3CF5 F;  1FT9 A;  1X1B A;  4AVP A;  2AXL A;  1S7O A;  4QPQ A;  1G3T A;  3BTJ A;  4K2E A;  4U88 A;  3DTE A;  3JTH A;  5FFX A;  1ZTR A;  2VJ5 A;  1X3W B;  1F5T A;  4Y13 A;  4P1W A;  2QQA A;  2OZU A;  3MMY B;  2KDZ A;  3HC7 A;  1FOW A;  1QGP A;  2B0L A;  2K85 A;  1O4X A;  2DT7 B;  2Y75 A;  2DA3 A;  2JUG A;  4II3 A;  2EJR A;  1OFC X;  2XF7 A;  1U5T C;  3DEU A;  4ZYH A;  2LRD A;  3RSN A;  5E79 C;  3BR6 A;  2D2W A;  2PX9 A;  4OWR B;  2JPC A;  3BT9 A;  1R22 A;  3DU5 A;  3E6D A;  3WG7 H;  3WGH A;  2ELK A;  1LVA A;  1MND A;  3KLO A;  2E71 A;  4G7O F;  2EQR A;  1IUY A;  2M45 A;  3JW4 A;  4UXN A;  3RYP A;  3O8G A;  4QLC U;  3P9K A;  1BJZ A;  5DM7 F;  1O57 A;  1MMD A;  2XPV A;  3K69 A;  3V7R A;  2DDA A;  2DU9 A;  3H9J A;  3DU6 A;  1A35 A;  2NOG A;  1OR7 A;  3G2B A;  5L3B A;  3VOE A;  1WH7 A;  2K9L A;  3OYB A;  1GDT A;  1XDU A;  2DT5 A;  2LH9 A;  2EZK A;  5D4R A;  1LB2 A;  1L3L A;  5EYR A;  2HOS A;  2FBH A;  4WX9 A;  3CDH A;  2DPU A;  3BY6 A;  1U78 A;  1IAW A;  1U5T B;  4XSZ F;  3CME I;  1Z91 A;  2X6O A;  1A04 A;  1RPW A;  4PJJ A;  3IHU A;  1WJD A;  2PBI A;  4G6Q A;  4XKC A;  3L2V A;  1H9G A;  3FXU A;  4XKV A;  2XAS A;  5HDK A;  5LBQ A;  4O3M A;  4LB6 B;  2RKH A;  3HKZ N;  1FY7 A;  1OLT A;  1J5Y A;  1E0E A;  1Z3X A;  1IDZ A;  1LEB A;  1OCR H;  1XGN A;  4DZP A;  1I50 J;  4YFX F;  1B4A A;  5D6E A;  2CV2 A;  2XAH A;  2HVQ A;  4IHV A;  3HEF A;  5FKK A;  1PP7 U;  2DQR A;  3A2K A;  4XLC A;  3G3Z A;  1SAU A;  5J1U A;  2BW3 B;  2KQR A;  1IUF A;  2WB1 A;  3OL3 A;  1FIP A;  9ANT A;  4B1R A;  3PM1 A;  3OS2 A;  2V79 A;  2VKD A;  2XV4 S;  3A0B C;  1XPX A;  2P81 A;  2CU7 A;  2ZKZ A;  3LQQ A;  3Q0U A;  4MTE A;  4BNC A;  2CWE A;  4B3A A;  1Z67 A;  2JN6 A;  1MBJ A;  3D5L A;  1RET A;  4IRG A;  1GHC A;  2DA4 A;  2XRN A;  2ZFU A;  3OS0 A;  1FLI A;  1WI3 A;  2HXO A;  3A0H C;  4XR6 A;  1JJ6 C;  1NK2 P;  4A0X A;  5J40 A;  1YIO A;  1RR7 A;  3J80 K;  3OYC A;  3SDB A;  3GTG J;  1ERD A;  5LHI A;  1XSX A;  3F9K A;  4JK1 X;  3E5U A;  1MJ9 A;  2K86 A;  1R7J A;  2P5V A;  4KYW A;  2F6C A;  5J8C A;  4CYC A;  5DTD A;  2NVX J;  2JK3 A;  2AS5 F;  5DS9 A;  1XSD A;  1P6R A;  1NK3 P;  3F3X A;  4KUM A;  3SFZ A;  1FYL A;  3KZZ A;  2JA5 J;  3H0G J;  1LDK B;  4FHT A;  1HKS A;  2HKX A;  1YRN B;  3HTU A;  2O03 A;  1SD4 A;  1HW1 A;  2E5N A;  3HGG A;  4QTR A;  2EA4 A;  5JLW A;  1HXD A;  5E18 F;  4I2O A;  2A6T A;  4OOI A;  3TO7 A;  4UHT A;  4N9H A;  3JRC A;  4IHY A;  1FBS A;  2WAF A;  2NXN B;  3ISP A;  3CJQ B;  2E2H J;  1Z9C A;  1U6G A;  2W85 A;  3TOB A;  3RYR A;  1WGX A;  1J59 A;  3KP5 A;  1JTY A;  1CF7 B;  3GTK J;  5FLM J;  3SYT A;  2F5E A;  1WVR A;  3TED A;  1R5I D;  1JGG A;  4YEJ A;  4XN3 A;  1B6A A;  2M7B A;  4IPA A;  2COM A;  2LY2 A;  1OJL A;  4AUX A;  3VSK A;  2CRG A;  5CVV A;  2R7S A;  4RAG A;  5HLG A;  1EF4 A;  5IP7 J;  2FMY A;  1JHF A;  2DA7 A;  4XLE A;  3EUH C;  2W84 A;  3S3N A;  1BM9 A;  2GA2 A;  2MD5 A;  3GO5 A;  2A69 F;  3L2Q A;  3CCY A;  3Q3S A;  4PJ0 C;  3GX4 X;  1HC8 A;  5E3O A;  2WC2 A;  4HF2 A;  1KZH A;  2XHK A;  2RQP A;  1UJ8 A;  1ZRF A;  3E7L A;  2V1D A;  2FJ1 A;  1WJF A;  1SFU A;  3GBG A;  3OIO A;  1DUX C;  2L7M P;  5J6X A;  3MD2 A;  4RB1 A;  3S1M J;  3TW7 A;  2DYR H;  1MSF C;  3U1D A;  4HG2 A;  2WV1 A;  1JKP C;  3MKY B;  1YOV B;  2IJL A;  2STT A;  2YUS A;  2ZJR F;  4EJV A;  2R7Q A;  2H1K A;  1USS A;  1X58 A;  3TOA A;  1O3Q A;  2GXB A;  2ZJ2 A;  3ZQF A;  5M5Y J;  2XSJ C;  1X1A A;  4LIU A;  1OCC H;  1XSV A;  2VC0 A;  4KN4 X;  3V4G A;  2VBZ A;  2Q2E B;  3HZJ A;  3HOT A;  2A61 A;  4LFU A;  2CFO A;  1O3R A;  2DK5 A;  2ZXW H;  3HRU A;  5C3E J;  3MFK A;  2IS2 A;  2HOA A;  1U8R A;  3TMO A;  4ZYE A;  3KP3 A;  4RB0 A;  5EJC A;  3S2H J;  3GTJ J;  1HST A;  2LF7 A;  1BR4 A;  5LFA A;  4CSW A;  1LE8 B;  1E2X A;  1TL8 A;  3DFG A;  1MMG A;  3KFW X;  5LGN A;  2KFD A;  3WOD F;  3HRM A;  1STZ A;  4XOR A;  2EV0 A;  3GF2 A;  4A5M A;  1P7J A;  2L01 A;  1B8I B;  2XVC A;  3ECH A;  2H8R A;  2FX0 A;  5F0F A;  4ZYD A;  1K7A A;  2LFB A;  1R1U A;  3DXJ F;  4E4H A;  3I9V 2;  3H36 A;  3OV8 A;  3JTG A;  1KYW A;  3PIP F;  4IRI A;  1RIO H;  2R5Z B;  3K4N A;  1W7P B;  1K6O A;  2EFO A;  2EIN H;  5E1W A;  3ZQI A;  1XMA A;  5JVG F;  3E97 A;  4GRI A;  3F21 A;  4DYC A;  1Y8R B;  2NNN A;  3JRG A;  2LVS A;  4BE1 A;  2O6G E;  2QQ9 A;  3LSG A;  2VKV A;  3QU6 A;  1TP4 A;  2BY2 A;  1S9H A;  1VI0 A;  2GWR A;  2W82 A;  3A03 A;  1I27 A;  2W00 A;  2ZC2 A;  3K70 D;  5BMZ A;  1QVU A;  1K83 J;  3RI4 A;  1HLV A;  3GFJ A;  3U21 A;  1W36 D;  3ZCO A;  4A3D J;  2P8T A;  1IO2 A;  3K1M A;  2M3A A;  4UUS B;  2YSR A;  4KIS A;  4EVI A;  4XK4 A;  4ENN A;  5JI6 A;  1LFU P;  1FSH A;  3FM5 A;  1D1C A;  3RZO J;  2L9N A;  4EJO A;  2WWY A;  1XN7 A;  2Y9Y A;  2ID3 A;  2CSO A;  4HF0 A;  1ZGW A;  5ILU A;  2CGP A;  2V4J C;  3LSJ A;  2JVG A;  2VL8 A;  4UY8 I;  2EZH A;  4G7H F;  3QYF A;  5CQE A;  1P7I A;  1NG6 A;  4GO1 A;  3RPU A;  2ZO4 A;  4DZJ A;  4OMZ A;  2VON A;  2QKM B;  2XC7 A;  3IWF A;  3FK7 A;  2G7H A;  2IRF G;  3G4S I;  2TCT A;  1UHM A;  3I56 I;  1K4S A;  4EM2 A;  4C3J J;  2O5R A;  2PMZ A;  3MZ8 A;  1GVJ A;  3CCJ I;  4CA0 A;  2ESH A;  1W4M A;  1VQK I;  3LQR A;  4AD9 A;  2QWW A;  5GAE J;  5KK1 A;  4BXU A;  3BOQ A;  4M71 A;  3M1C A;  4BJ6 C;  1SD6 A;  2K3P A;  3ZN0 A;  1OYI A;  1YI2 I;  1EH7 A;  3IL2 A;  4JX5 A;  4IEJ A;  2M0C A;  2EZL A;  2BE5 F;  2VIX A;  1MKM A;  5M3F J;  3C2G A;  2BZT A;  3IKV A;  3K9T A;  1TNS A;  4RB2 C;  3K4J A;  4L5E A;  2BVL A;  5EZG A;  4M6Y A;  2MLK A;  2R7O A;  3MKW B;  4RM2 A;  2K27 A;  3WTZ A;  3WTY C;  2E7X A;  4PUS A;  4BU2 A;  2PLY A;  5HS7 A;  1LPQ A;  3E3V A;  1SFO J;  4LMY A;  4BE2 A;  1ZHF A;  3BZC A;  2L02 A;  5HLI A;  1K78 A;  2OPT A;  1SMT A;  2MH9 A;  1N77 A;  1LEA A;  1J7K A;  4QWQ A;  5F0C A;  3BR1 A;  4F7Z A;  2VBW A;  3D5R C;  1DP3 A;  1FNN A;  1D0Z A;  1SVO A;  3OIQ A;  4ENM A;  2UXX A;  4LK1 F;  3ZN1 A;  2IS1 A;  4XON A;  5BQT A;  2M8E A;  4DBQ A;  2GZW A;  4XL9 A;  2J5P A;  3BCA A;  3CZ6 A;  3KP6 A;  1R5G A;  1W0T A;  2QCO A;  1MGT A;  1IZ1 A;  2AQE A;  2L0K A;  3BQY A;  1Y1V J;  1X19 A;  2BBY A;  2K9N A;  3ZR8 X;  4ESF A;  4KIF A;  2W24 A;  1DU6 A;  2I8D A;  4KFC A;  5KAI C;  4I0B A;  1GT0 C;  4B4C A;  2Y0S A;  1FPQ A;  4EV0 A;  3FKI J;  2A05 A;  3U1K A;  4W97 A;  1R1T A;  1SFE A;  2KP6 A;  3GZ6 A;  1T33 A;  2KKO A;  4LIT A;  1IDY A;  3WHC A;  5FLV A;  3BG6 A;  4LGW A;  2P5K A;  4PJN A;  1TWH J;  2O61 A;  1HA8 A;  4XLN F;  3ROU A;  3TO9 A;  3KEY A;  2HI3 A;  1F4K A;  2V6E A;  1XMX A;  5F08 A;  1PUF B;  4PK4 A;  3FMS A;  4Y4R A;  3CCQ I;  4RBO A;  4I98 B;  3CJN A;  3UR3 C;  5B3S H;  1E3H A;  2ZBK A;  5D4S A;  1Y1W J;  5E1Z B;  1MNE A;  2DJI A;  3WTX C;  2D5V A;  1ZK8 A;  4WXH A;  2F4O B;  3FM3 A;  1IF1 A;  2H6B A;  4RM3 A;  2MD0 A;  3CTA A;  3QOE A;  3K4K A;  3VEP A;  2YX4 A;  1TWA J;  5EGO A;  5IYD J;  4HQE A;  3RQI A;  4U7D A;  3ZP5 A;  1D0Y A;  1MH4 A;  1X2N A;  4BEH B;  3OR2 C;  3K6G A;  1FBU A;  3G6E I;  1ZG5 A;  1HKT A;  4D5F A;  1MBK A;  2EA2 A;  2X1E A;  3F6O A;  1WHU A;  3I4P A;  5L3F A;  1ETV A;  1XC5 A;  4G9Y A;  3DEW A;  3ML6 A;  4CXF A;  3I3L A;  2IP2 A;  3TP0 A;  1I3Q J;  1PVE A;  2KLO A;  5EG0 B;  2R7D A;  3VOD A;  4IQJ A;  2VB6 A;  1SVL A;  2WB1 N;  2LKP A;  3A4C A;  4KT6 A;  2XDV A;  5DCF A;  2LG4 A;  2RQQ A;  4CUG A;  4BQQ A;  2E7W A;  1U8B A;  5HNF A;  3DPT A;  1ZRE A;  2XB5 A;  4EMS A;  3TGN A;  2BXY A;  2P4W A;  1WPK A;  1QPM A;  1O7F A;  1R5H A;  1UCR A;  3KPH A;  3HJE A;  1CGP A;  4HYE A;  3FZV A;  1MD0 A;  3GLL A;  1U5T A;  4BHB A;  4H4K C;  3H35 A;  1X4O A;  1XGS A;  4NNJ A;  5J4V A;  4HNV A;  3OYG A;  3Q5F A;  1RUO A;  4A93 J;  2DA1 A;  3IH2 A;  4Y17 A;  2LBF B;  2R7U A;  3CQZ J;  3F6V A;  4JX4 A;  1FZP B;  4OIQ F;  2BY1 A;  4CH7 A;  5JVT A;  3BP8 A;  4B43 A;  3HOS A;  1WKM A;  4YII A;  2M1B A;  3JAM Z;  2CMP A;  3F8M A;  2PJR A;  4RDU A;  4L5J A;  1C0W A;  2ZXI A;  5IP9 J;  1QU3 A;  5LRS A;  1EH6 A;  4CCN A;  1H0M A;  3I59 A;  5ICG A;  2HVR A;  4IHW A;  4IHX A;  3O6B B;  3IRQ A;  2Y48 A;  4L0Y B;  2BW3 A;  3HSF A;  3AG2 H;  1FJL A;  3CF2 A;  2H6C A;  2KIQ A;  3MKL A;  3SEZ A;  1WWX A;  2DO7 A;  3L1P A;  1DDN A;  5EEA A;  2NAZ A;  3HSR A;  3KYC B;  4BQA A;  4G6T B;  5IT3 A;  3SXY A;  2XAU A;  1GLN A;  2K40 A;  2XGX A;  4XKB A;  2L7Z A;  2GOM A;  5DV5 A;  2ZB9 A;  4FX0 A;  1EKE A;  1WZ2 A;  3AG1 H;  4HDV A;  2MLG A;  3H3U A;  4A2U A;  1VTN C;  2DMP A;  4M9Z A;  1Z77 A;  1MJB A;  5H2F C;  4HLX A;  2V1U A;  2JQ7 A;  3GME A;  2KDO A;  4F3Q A;  1VQO I;  2ME6 A;  2P6S A;  4RMN A;  1EA3 A;  2EBI A;  1LFP A;  4BBR J;  3ERE D;  2Z16 A;  4OAZ A;  1BJA A;  3VYS B;  4IXA A;  3EYI A;  3C2B A;  1V4R A;  3E6B A;  2R5Y B;  1G6N A;  4DGW B;  1H88 C;  5J3L A;  5B66 C;  2M7A A;  3KP7 A;  4JBA A;  5H6R A;  4ZYG A;  1FP2 A;  1V5F A;  4L9J A;  4LK0 F;  2X48 A;  2HVS A;  3S16 J;  1A36 A;  3I4N J;  2MSY A;  4MHG A;  2CH0 A;  3IKT A;  3M8E A;  5K7F A;  2EK5 A;  1MNM C;  1DGR M;  1POG A;  1OMI A;  3S1R J;  2DMT A;  1OPC A;  4HDU A;  2BHY A;  3C2H A;  4PSX A;  1QVT A;  3M1E A;  3ZMD A;  4ZZD A;  1JGS A;  4RAF A;  4FIS A;  3HYI A;  1BL0 A;  4B8X A;  4AYB A;  4E7S A;  3A1Y A;  3P9C A;  3D1N I;  5LD2 C;  5BPI A;  1B72 A;  1TW3 A;  3VWB A;  2DAO A;  3DP7 A;  5K7Z A;  4HV5 A;  4HX8 A;  2HR3 A;  2FSW A;  1GUU A;  1U9O A;  1FC3 A;  3E0J B;  4EQQ A;  2CYY A;  2JA2 A;  1LJ9 A;  5B5E C;  2KZV A;  2NS0 A;  2VUM J;  2FE3 A;  4C3I J;  1ZGA A;  5KNL A;  4ITV A;  3ZMU A;  2KMU A;  4WCG A;  3PJR A;  1OCT C;  2XF6 A;  2M2E A;  2Q8K A;  1DU0 A;  3DCF A;  4KT5 C;  5HNH A;  1R9T J;  1OYY A;  1IN5 A;  3V7S A;  4CCM A;  4N4N B;  5A2Q K;  3OSG A;  5FKO A;  2WAQ A;  4CIC A;  3T8T A;  4RGU A;  1SFK A;  3C3W A;  2M4G A;  1T0F A;  3VYT B;  1WJE A;  1S5L C;  1ZG1 A;  1ONV A;  2K4B A;  2ICW G;  2ZFW A;  1KQ8 A;  2ID6 A;  2R5Z A;  1JKR C;  1T95 A;  1UZC A;  1XB4 A;  2CW0 F;  4XRF A;  1BN5 A;  4QPO A;  2FU4 A;  3H9Q A;  4FE7 A;  4HQM A;  4RLQ A;  3HG9 A;  3SJM A;  2MYS A;  4HV6 A;  4XLA A;  2LLK A;  3EUH A;  3U9G A;  4A0Z A;  4DNC A;  4NBQ A;  2RN7 A;  3V8K A;  3FXJ A;  2WAE A;  3VYU B;  1S72 I;  4IOA F;  3N97 A;  1GVD A;  4HW0 A;  2PI0 A;  5IT9 K;  3CMM A;  2Q2E A;  4M3E A;  2QSG X;  3GFL A;  4XSX F;  5E3L A;  4V19 K;  4YFK F;  1Y8Q B;  2ESN A;  2V9P A;  3HXL A;  2FEZ A;  1QHH D;  3QAH A;  4F55 A;  1PJR A;  5CVU A;  3GFI A;  3G1M A;  3W6V A;  4L5I A;  3ZMS A;  4RGS A;  1TQI A;  4A5N A;  2GOX B;  3D5S C;  4M9S A;  1TBX A;  5HDG A;  1YW7 A;  3HBL A;  1FTT A;  3ELK A;  3FKJ A;  1YJ9 I;  1ODD A;  4U0Y A;  1X1P A;  4P9F A;  4A6D A;  2R7F A;  3K1N A;  1JE8 A;  2I5U A;  3QOD A;  4XMY A;  3PSI A;  3GTQ J;  4WF2 A;  1BI0 A;  1ZQ3 P;  1B8I A;  4IL6 C;  3JRB A;  2PQ8 A;  4LOC A;  1P4X A;  1U0J A;  3HSE A;  5J47 A;  2PN6 A;  3S8P A;  3CC4 I;  4DIQ A;  3FXQ A;  4ON0 A;  1IN7 A;  3CLO A;  1JXS A;  2WA0 A;  1YJN I;  1W0U A;  3QWL A;  3F8B A;  3GEZ A;  4UB8 C;  1W7P A;  2QQB A; 
#chains in the Genus database with same CATH homology
 1Z0X A;  4A3I J;  3MN2 A;  2RAE A;  3HOW J;  2FD5 A;  5FKM A;  3JRH A;  5FKN A;  1P7J A;  1X2M A;  1B8I B;  3TP3 A;  5IYC J;  2X9D A;  1RKT A;  2PMZ N;  2H8R A;  4A3C J;  2DA6 A;  2FX0 A;  1ZR4 A;  2TRT A;  5F0F A;  2E2J J;  2LFB A;  4XIC A;  2KT0 A;  3JR9 A;  1MBH A;  2NVY J;  1MH3 A;  3TW6 A;  2R5Z B;  2NS8 A;  1AKH B;  3ZQI A;  3M4O J;  3SFI A;  1ETQ A;  3BTI A;  1YRN A;  4DYC A;  5F27 A;  4UUS A;  3JRG A;  2LVS A;  2Y31 A;  4A69 C;  3LSG A;  2VKV A;  2ECB A;  2XGC A;  1E3O C;  1VI0 A;  1VND A;  3A03 A;  1IC8 A;  1QVU A;  4BBS J;  3ZOB A;  1TWG J;  1K83 J;  4UUT A;  1HLV A;  3IH3 A;  5IOZ A;  1MBE A;  2JWT A;  4A3D J;  1IG7 A;  2XB0 X;  4FE4 A;  4BY7 J;  3HB9 A;  1H8A C;  3HOY J;  2LD5 A;  4UUS B;  3BTC A;  2LP0 A;  4XK4 A;  1LFU P;  2JA8 J;  1HDP A;  2K9Q A;  5M3M J;  1CQT A;  2LK2 A;  3RZO J;  2CUF A;  3NAR A;  2YS9 A;  2LTP A;  2Y9Y A;  2ID3 A;  1WH5 A;  3S14 J;  2CQQ A;  1ZGW A;  3LSJ A;  4XRM A;  1BA5 A;  2JMW A;  2O8K A;  2EZH A;  1UG2 A;  2NVQ J;  2DJN A;  1P7I A;  4FCY A;  1JT6 A;  3ZQC A;  3A02 A;  2LKX A;  4DZJ A;  2Y2Z A;  5E3N A;  2GBY A;  3F0C A;  2O9L A;  3FK7 A;  2O7O A;  4A3J J;  2TCT A;  5EGO B;  4MO7 A;  3PO3 J;  5K7H A;  2R0Q C;  3GTL J;  4C3J J;  5JLX A;  4EEF G;  1A6I A;  1VF9 A;  3B6A A;  2Y0S N;  2XGE A;  4XID A;  2DMQ A;  3BG5 A;  1QRY A;  2JA7 J;  2Y9Z A;  1Q1V A;  3PO2 J;  2N8G A;  1VFC A;  3ZQL A;  3QPL A;  4JX5 A;  4IEJ A;  2M0C A;  2EZL A;  2IBD A;  1ORK A;  5M3F J;  3GTO J;  2COB A;  2JJ7 A;  4D7M A;  4L5E A;  5EZG A;  5IOY A;  3HOV J;  2I10 A;  1JT0 A;  4C2M J;  1LE8 A;  3A01 A;  1WCM J;  3OOU A;  1SFO J;  4AC0 A;  5C44 J;  3G1L A;  5J1Y A;  3BR5 A;  1ETK A;  3S1Q J;  2VPR A;  3K7A J;  2OPT A;  5EF6 A;  4M6V A;  2E19 A;  1ETO A;  4G12 A;  5IP6 A;  5IYB J;  5F0C A;  3BR1 A;  4I76 A;  4C3H J;  2M9H A;  3A01 B;  2E1O A;  2IAI A;  3BR3 A;  3CMY A;  1ETW A;  1MBF A;  3H3V K;  2VKE A;  3LOC A;  4X6A J;  2NS7 A;  5J1R A;  3CDL A;  2FQ4 A;  3QPS A;  1W0T A;  1APL C;  2QCO A;  5F04 A;  2LY9 A;  1IRZ A;  2M8G X;  2L0K A;  3BQY A;  1Y1V J;  2K9N A;  3NAU A;  2HDD A;  1PUF A;  2MG4 A;  1UHS A;  5GPA A;  1DU6 A;  2AHQ A;  1GT0 C;  2GM4 A;  3IH4 A;  4B4C A;  4MIM A;  1JUP A;  3FKI J;  4W97 A;  1FIA A;  3JRI A;  4DYR A;  5GPC A;  1T33 A;  1IJW C;  5FLV A;  1IDY A;  3WHC A;  1OCP A;  5E3M A;  3JRF A;  1TWH J;  4A3K J;  1QPI A;  3IV5 A;  3M3Y J;  2JA6 J;  2HI3 A;  5F08 A;  1PUF B;  1T56 A;  1ZKG A;  3QQA A;  4V2F A;  4NDL A;  3BG3 A;  4RBO A;  3HOZ J;  4J19 A;  1Y1W J;  5M5W J;  1IV6 A;  2D5V A;  2K9S A;  3BG9 A;  4M3G A;  1ZK8 A;  1A5J A;  4MFE A;  3O8H A;  4MLO A;  5EZH A;  1RKW A;  2NVT J;  4QIW N;  1JUM A;  1TWA J;  5EGO A;  5IYD J;  3HM5 A;  4M3F A;  3RQI A;  3K2A A;  3VPR A;  2EZI A;  3GTM J;  1MH4 A;  1X2N A;  1GV5 A;  2L7F P;  2B63 J;  4D5F A;  1MBK A;  4A3B J;  3JRD A;  2YU9 J;  2R7Z J;  4JP0 A;  5FJ8 J;  2E2I J;  1BW6 A;  4BY1 J;  1I6H J;  1ETV A;  1ENH A;  1S7E A;  1XC5 A;  4CYC B;  1JUS A;  3BTJ A;  1XG1 A;  2DA5 A;  3DEW A;  1ZTR A;  2CQX A;  3TP0 A;  4Y52 J;  1I3Q J;  2MW8 A;  5EG0 B;  2WB1 N;  2KDZ A;  1AHD P;  1B72 B;  2ME0 A;  1O4X A;  5C4J J;  2DA3 A;  2DN0 A;  2CUE A;  1F43 A;  2LR8 A;  1U8B A;  2XB5 A;  3BQZ A;  1OFC X;  3BR6 A;  3UKG A;  2DMU A;  1WPK A;  1XS9 A;  3BT9 A;  1D5Y A;  3S15 J;  2ELK A;  2AO9 A;  2EQR A;  4ABZ A;  3LNQ A;  3O8G A;  4HNV A;  4A93 J;  2DA1 A;  3IH2 A;  1BJZ A;  3CQZ J;  2XPV A;  4JX4 A;  4BKX A;  2HYJ A;  1FTZ A;  4XRS A;  1G2H A;  2NOG A;  1WH7 A;  3LSP A;  1AU7 A;  1GDT A;  1JKQ C;  2EZK A;  4RDU A;  3BR2 A;  4D5C A;  3JRE A;  5EYR A;  5IP9 J;  2HOS A;  3S1N J;  1U78 A;  1HOM A;  4IHW A;  1BW5 A;  4AYB N;  2L9R A;  4IHX A;  3MVP A;  2X6O A;  2M34 A;  2DA2 A;  2XPW A;  4Y7N J;  1RPW A;  4QSH A;  1FJL A;  3HOU J;  2HQ5 A;  3MKL A;  3LSR A;  3HKZ N;  3FIS A;  3L1P A;  5EEA A;  4FTH A;  2R93 J;  3FK6 A;  1IDZ A;  4A3F J;  4DZP A;  1I50 J;  3S17 J;  2K40 A;  2OF7 A;  3OSF A;  4IHV A;  2L7Z A;  1HF0 A;  3HEF A;  5FKK A;  2ZB9 A;  2DTZ A;  2WAQ N;  5J1U A;  3S2D J;  2DMP A;  1IUF A;  5F0H A;  3BTL A;  3JRA A;  1ZR2 A;  1Z77 A;  1JTX A;  1FIP A;  9ANT A;  4M3D A;  3PM1 A;  4B1R A;  3BR0 A;  5EDN A;  2ME6 A;  4GFB A;  2P81 A;  2CU7 A;  2EBI A;  3Q0U A;  1UMQ A;  4BBR J;  4B3A A;  1F36 A;  2CJJ A;  1MBJ A;  2JN6 A;  1RET A;  4V2G A;  5IPA A;  2DA4 A;  3I4M J;  3C2B A;  2R5Y B;  3FIW A;  1H88 C;  1SAN A;  5J3L A;  1WI3 A;  2HXO A;  1JJ6 C;  1NK2 P;  5C4X J;  2W48 A;  2X48 A;  3S16 J;  1RR7 A;  3I4N J;  2MSY A;  2VI6 A;  2ECC A;  3Q0V A;  5K7F A;  3GTG J;  4DW6 A;  1MNM C;  1POG A;  4A3L J;  3S1R J;  2Y30 A;  2DMT A;  4CYC A;  5DTD A;  1HDD C;  2NVX J;  2JK3 A;  3ZQG A;  5DS9 A;  3HDD A;  1QVT A;  3G1O A;  1NK3 P;  4W1U A;  2JA5 J;  4FIS A;  5EG0 A;  4A3M J;  2XGD A;  3H0G J;  1BL0 A;  3RKQ A;  3HOX J;  3D1N I;  1B72 A;  1YRN B;  5K7Z A;  1MBG A;  3HGG A;  5BNG A;  1TWC J;  4D7N A;  1GUU A;  4QTR A;  1U9O A;  5JLW A;  2VUM J;  5F1J A;  4C3I J;  1ETY A;  3JRC A;  2MGQ A;  4IHY A;  2IEK A;  2EH3 A;  1OCT C;  2M2E A;  1DU0 A;  5GP9 A;  3DCF A;  2E2H J;  3HGY A;  1R9T J;  1LFB A;  1WGX A;  2XSD C;  3GTK J;  1JTY A;  5FLM J;  3OSG A;  5FKO A;  3TED A;  1JGG A;  1H89 C;  2DMN A;  1OJL A;  3Q0W A;  4AUX A;  2CRG A;  2R92 J;  1RES A;  1EF4 A;  5IP7 J;  2ID6 A;  2DA7 A;  1HCR A;  1FEX A;  1JKR C;  1TC3 C;  5HOD A;  3RZD J;  4S0H B;  3CCY A;  3Q3S A;  5E3O A;  4FE7 A;  1JJ8 C;  1K61 A;  3SJM A;  3E7L A;  2LLK A;  2FJ1 A;  3ZQH A;  2G0E A;  4M3B A;  3GBG A;  3GTP J;  4A3G J;  3OIO A;  1GVD A;  4JYK A;  2L7M P;  1NTC A;  4M3E A;  3WHB A;  1JKO C;  3S1M J;  2QF7 A;  5E3L A;  3TW7 A;  1MSF C;  1JKP C;  2WV1 A;  1U9N A;  2YUS A;  3W6V A;  3G1M A;  4DYQ A;  2H1K A;  4MFD A;  1X58 A;  2HOT A;  4JX6 A;  3ZQF A;  5M5Y J;  3HBL A;  1FTT A;  3B6C A;  1GV2 A;  1MSE C;  5C3E J;  2XPU A;  3GTQ J;  2HOA A;  4X1E A;  2HXI A;  1ZQ3 P;  2XRL A;  4XRS G;  4I6Z A;  1B8I A;  3JRB A;  4LOC A;  4BXX J;  3S2H J;  3GTJ J;  1IGN A;  1TWF J;  5M5X J;  2R5Y A;  1W0U A;  1LE8 B;  2GLO A;  1ETX A;  3SDG A;  1ITY A;  2R5Z A;  5FKL A;  1AKH A;  4A3E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...