5C4JJ

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c4jJ00
4XICA 1GVDA 1UMQA 3ZQHA 2DA3A 2RAEA 1JKRC 2E2IJ 2O9LA 1GV5A 1ZKGA 5FKKA 3ZQCA 2B63J 2NS7A 3FKIJ 4X6AJ 1X58A 3JREA 1WH5A 3MKLA 2L9RA 3BTIA 5IP6A 2GM4A 2NVYJ 1TWAJ 2DMQA 1NK3P 4A3JJ 1ZR4A 1OCTC 4A3FJ 1XG1A 1WCMJ 4D7NA 5F0HA 2LR8A 3S16J 4C3JJ 1MNMC 3QPSA 1ETXA 2JJ7A 1U9NA 3VPRA 2EZIA 3PO3J 1MBKA 4L5EA 3JRGA 2OPTA 1E3OC 2DA6A 4AUXA 3O8GA 5HODA 1XC5A 1Z0XA 3ZOBA 2TCTA 1IJWC 3CDLA 1X2MA 3DCFA 4UUTA 5EDNA 3H3VK 1MH3A 1JKOC 2LTPA 4MFEA 1H8AC 9ANTA 1WPKA 1JUPA 1VF9A 1HF0A 2L7FP 5C4XJ 4Y7NJ 1A5JA 3HM5A 2JA6J 2KDZA 4J19A 1IUFA 1U8BA 1NK2P 1RKTA 1FIAA 5F0CA 3LOCA 5J3LA 4AC0A 1ZTRA 3OOUA 5FKLA 1ENHA 1P7JA 4DZPA 4BXXJ 2L7ZA 1RETA 2HYJA 1ZR2A 4XIDA 1OFCX 5IYBJ 4RDUA 2WB1N 3ZQLA 5M5XJ 4M3DA 3H0GJ 3TW6A 2IEKA 3JRFA 5FKMA 2VUMJ 1ITYA 2E2JJ 3HOUJ 3JRAA 1IGNA 2JN6A 2TRTA 4A3BJ 4ABZA 3FK6A 4A3EJ 1B72B 1S7EA 2EBIA 2QF7A 2DA5A 1B72A 3JRCA 3M4OJ 2LD5A 5GPAA 1MBEA 3BQZA 1XS9A 2DTZA 1H89C 1IDZA 3JR9A 4C3IJ 3OSGA 3BR2A 3S15J 3I4NJ 3ZQIA 1LFUP 4IHVA 3S1MJ 1MH4A 4FE7A 2JK3A 3Q0VA 3GTKJ 3S1NJ 1FTTA 5IOZA 1W0UA 5F08A 5E3MA 1UHSA 1TWCJ 5FJ8J 2ID3A 1ZK8A 1EF4A 1I3QJ 3GTGJ 4V2GA 1MSFC 1WH7A 2IAIA 2NVTJ 5BNGA 2CU7A 3IH3A 1ORKA 5GPCA 4IEJA 1B8IB 3BR1A 3JRIA 2CJJA 3RZDJ 1B8IA 4M6VA 2IBDA 2D5VA 4IHWA 3GTQJ 5FKOA 1JTYA 2XB5A 1TC3C 2DA1A 3BR0A 4DZJA 1ETVA 1GV2A 2DMUA 5GP9A 3MN2A 1ZGWA 2Y0SN 3Q0WA 2ZB9A 2L0KA 5IP9J 2R5YB 5C3EJ 4S0HB 4C2MJ 1QVUA 3G1LA 2R5YA 2HXIA 4A3DJ 5M3MJ 5E3OA 1MBJA 4NDLA 1IG7A 3IH4A 3RZOJ 1F43A 1TWHJ 3MVPA 5EG0B 2N8GA 4BY1J 1LFBA 5EG0A 5EF6A 4UUSB 1SFOJ 3BR3A 1ETYA 2R5ZB 4UUSA 2HI3A 2R5ZA 2EH3A 3A03A 2K40A 2ME6A 5E3LA 3GTPJ 3CCYA 2O8KA 2M9HA 1ZQ3P 1WI3A 3C2BA 2GBYA 3A01B 5EZGA 3JRDA 3HGYA 1Z77A 3O8HA 2PMZN 1SANA 3Q0UA 3A01A 1JGGA 2H1KA 2XGEA 4XK4A 3CMYA 4C3HJ 4MLOA 4BBSJ 3BR6A 5F04A 3ZQFA 2HOAA 4W1UA 3TP0A 5M5YJ 4CYCB 4BBRJ 2XPWA 2Y9YA 3HGGA 4XRSA 4A3MJ 1AU7A 1FJLA 4HNVA 2X48A 5IOYA 4CYCA 4D5CA 2DMNA 5C44J 1JUSA 5K7FA 2COBA 3GTOJ 3HOWJ 4JX5A 3L1PA 3PO2J 3OSFA 1JT6A 4FISA 4EEFG 2EQRA 3NAUA 3I4MJ 2CQQA 5F0FA 4IHXA 3FIWA 5EEAA 2MSYA 2HOTA 3OIOA 3B6CA 4LOCA 2AHQA 2EZKA 2JMWA 2XGDA 2LY9A 1K61A 4JP0A 2P81A 1D5YA 3IV5A 4DW6A 2ELKA 3K7AJ 2XPUA 2VPRA 2X6OA 2M34A 4MO7A 4MFDA 1CQTA 5M3FJ 4B1RA 5IP7J 4DYRA 2ECCA 1ETKA 1HLVA 1POGA 2E19A 3UKGA 1LE8B 1RKWA 4A3IJ 3S1QJ 1LE8A 1GT0C 3W6VA 4A3GJ 1JUMA 5IYCJ 1JTXA 2XRLA 3RQIA 2DA7A 4M3EA 3GBGA 1MBHA 2M0CA 2K9SA 2K9NA 2QCOA 1AHDP 3M3YJ 4A3CJ 1APLC 2XB0X 3QPLA 2XSDC 3GTJJ 4X1EA 1IV6A 4A3KJ 2EZHA 1HDPA 2DMTA 4D5FA 1T56A 3IH2A 1FTZA 4AYBN 4M3BA 3HDDA 2M2EA 2R92J 1RR7A 5K7ZA 1R9TJ 3BTLA 1HDDC 2HQ5A 1IRZA 4XRMA 2HDDA 1T33A 1I6HJ 3F0CA 4D7MA 2Y31A 2DN0A 2M8GX 1VNDA 5JLWA 3HOVJ 1BJZA 2MG4A 1QVTA 5EZHA 2NVQJ 1F36A 4W97A 3SDGA 2WAQN 1HOMA 3PM1A 5F27A 2ECBA 1U78A 1JJ6C 2FX0A 4I76A 1K83J 2JWTA 3A02A 3JRBA 3HOZJ 1GUUA 5DS9A 2LVSA 2AO9A 2XGCA 5E3NA 1PUFB 1ETQA 5IYDJ 3SJMA 3E7LA 1PUFA 2DA2A 4A69C 4B3AA 1W0TA 2Y2ZA 1TWGJ 3S1RJ 2NOGA 5FLVA 5C4JJ 4FCYA 1JT0A 1UG2A 2ME0A 1HCRA 2G0EA 1FEXA 5EYRA 1RESA 1FIPA 1BW6A 2Y30A 3S2DJ 5M5WJ 2O7OA 1IDYA 3BR5A 4QTRA 2K9QA 2R0QC 2KT0A 2OF7A 1WGXA 5JLXA 2R93J 1MBFA 3BG5A 3BG3A 2ID6A 3HOXJ 5FKNA 4DYCA 2MW8A 2H8RA 1VI0A 1TWFJ 3QQAA 5FLMJ 2JA7J 1Y1VJ 3JRHA 3CQZJ 3WHCA 2FQ4A 2I10A 1H88C 3BG9A 4GFBA 5DTDA 3LSJA 3K2AA 4M3FA 3HEFA 3D1NI 4BKXA 1GDTA 1G2HA 4M3GA 2NVXJ 3TW7A 2YS9A 2LLKA 1MSEC 4BY7J 3HB9A 1A6IA 3HBLA 3LSRA 4V2FA 2VKEA 4JYKA 4A93J 4DYQA 1I50J 1OCPA 2LFBA 3TEDA 5J1YA 1X2NA 3FISA 1DU0A 2MGQA 2CUFA 1P7IA 2E1OA 4MIMA 3B6AA 2X9DA 2HXOA 5F1JA 1OJLA 2LKXA 2HOSA 5J1RA 3HOYJ 4QIWN 1ETWA 5IPAA 4FE4A 4XRSG 1JJ8C 2YU9J 3SFIA 2W48A 4I6ZA 1O4XA 1Q1VA 2VI6A 1RPWA 1NTCA 1DU6A 2E2HJ 4B4CA 3TP3A 4A3LJ 4QSHA 2YUSA 2LP0A 2Y9ZA 2FJ1A 2GLOA 3LNQA 2WV1A 1BA5A 3G1MA 4IHYA 2CQXA 3S14J 2XPVA 2CUEA 4Y52J 3BTCA 4G12A 4FTHA 2VKVA 1JKPC 4JX4A 1AKHB 2JA8J 3RKQA 2JA5J 1AKHA 2L7MP 3DEWA 1QRYA 1BW5A 2DMPA 4RBOA 1IC8A 3BT9A 1MBGA 3LSGA 2CRGA 5J1UA 5K7HA 1U9OA 5EGOB 2R7ZJ 2LK2A 1VFCA 3G1OA 5EGOA 1YRNB 3Q3SA 2EZLA 1YRNA 1Y1WJ 2FD5A 3LSPA 3GTLJ 3ZQGA 1JKQC 3BTJA 4JX6A 1QPIA 3S17J 3WHBA 2DA4A 3NARA 1ETOA 2DJNA 2NS8A 3HKZN 3BQYA 3S2HJ 3GTMJ 3FK7A 1BL0A
chains in the Genus database with same CATH superfamily
3BOQA 4B09A 3CLQA 4L0ZB 3MWMA 4HPQA 4XICA 1UMQA 1HSTA 1VTNC 2E2IJ 2O9LA 1GV5A 1R49A 2XAQA 2EIKH 2W7NA 3RYPA 5AIQA 5FKKA 4IX7A 4Q5SF 1P6RA 3D5SC 3CJNA 3OY9A 4LITA 3IL2A 4HX4A 1X58A 3FKJA 3JREA 1BC8C 3MKLA 5IP6A 4BE1A 5DM6F 2GM4A 1W1WE 4HQMA 3PIOF 5JHUA 1SVMA 4N9IA 3P9CA 3LAJA 5IT9Z 3DBHB 3T5XA 3QPSA 2WTEA 1TT0A 2E7WA 3CTAA 4GYGA 1E3OC 3GEZA 2O5RA 1NG7A 1S72I 1XGNA 3OYMA 4CUGA 3L09A 4QLCU 1G6NA 2FNAA 1ZHFA 3CDLA 2ZO4A 4HW0A 4UUTA 2VE9A 3ZQ7A 4HV6A 1FY7A 2Y0SA 3LSTA 3RDIA 3GX4X 4EJUA 5GTIC 2KZGA 2JQ7A 1WPKA 1JUPA 4O3MA 2GXAA 1XSXA 1KZHA 1O3QA 2L7FP 3HM5A 1EV7A 1IV8A 1V5FA 4GYIA 4KICA 1FLIA 4OMZA 1V5GA 2XVCA 5D5WB 3WTWC 3K70D 4AD9A 4F55A 1QBJA 1ZREA 2VJ5A 4MEXF 3CD6I 1ZTRA 5DUKA 3LL7A 2JUCA 1P7JA 4OWRB 1ZYRF 2HYJA 4LLNA 4S05A 4RDUA 5KAIC 3S32A 5LHHA 2X6XA 1R58A 5K5OA 2WB1N 4HZFA 1WJAA 4IQ4A 3M9AA 2H6CA 2VUMJ 3GUDA 1Y39A 1FP2A 4BACA 4IHWA 2DT7B 3A2KA 3S2WA 1YFHA 3LSIA 2M3AA 3CJTB 2IVMA 2L7KA 1RRJA 1M1EB 2ZJQF 2QEXI 1PJRA 4ZDLA 2LD5A 3M4OJ 5FD6A 1MBEA 2DTZA 4IOAF 1WWXA 3WTZA 2A61A 4C3IJ 3JR9A 2Z33A 2ADUA 2ZBKA 4XLNF 1LFUP 3ERED 4ZYEA 1OCZH 2ZMEB 4UVBA 3VDXA 1SFXA 1P92A 2Q2EB 1MH4A 3NRVA 4FE7A 3VYTB 5B5EC 3ZP5A 3C2GA 2ZMEA 2QSFX 2Q2EA 1W0UA 3R61A 4HLYA 2EA2A 4HOBA 2O61A 1EF4A 2I8DA 3W2WA 1MSFC 1LDKB 4WWCA 1MJBA 2LF8A 1QQIA 3BWGA 3K70C 2DXIA 1V4RA 2HKOA 1NG6A 3BR1A 2CH0A 4U0WA 2JT1A 3DF8A 1XD7A 2LC2A 4MEYF 4XOTA 3M8JA 4UV9A 1TBXA 2A5YB 4L9VA 2XB5A 5FKOA 1WSUA 3H0DA 3DQVC 4XN0A 3PNTA 1ETVA 4BL0B 2DMUA 1D1AA 3B02A 1BIBA 3ZGKA 4BQOA 1VQKI 1G59A 1PVEA 1ZGWA 1U3EM 2IS6A 3I54A 2L0KA 5IP9J 3DTEA 4XSXF 4MHGA 4C2MJ 5TJJA 1QVUA 2HXIA 3WG7H 4A3DJ 2JRTA 4BXUA 4NDLA 3GLLA 1IG7A 2IGMA 5FROA 1F43A 2IA1A 1SFUA 1WJDA 4M9XA 4LG3A 3OWTA 3RSNA 4IQJA 2JPCA 3E5XA 1JHHA 2P8TA 2WBMA 2HI3A 2KLOA 2WY7Q 1SFEA 3ULQB 1ZG1A 1FYLA 2K40A 2ME6A 2M87A 3CCYA 3V7RA 3BLYA 3HTUA 3Q9SA 3WE2A 5CVVA 3HGYA 4WX9A 1Z77A 3O8HA 4L5IA 1SANA 1X1BA 3GYHX 1JGGA 5FRMA 2OBPA 1Q1HA 1P4XA 5DM7F 2CWEA 2ACJA 4BBSJ 5BPIA 4WK8F 4HX7A 2HOAA 1B9NA 1MKMA 2HS5A 4W1UA 4RB2C 3K4JA 1AU7A 2XPWA 4R8HA 2DODA 4XRSA 5LHIA 2X48A 2V79A 4DIQA 3O2PE 1W5CC 4ENNA 2G7HA 2DMNA 3P7NA 3W6JB 1QA6A 2FNPA 3L7WA 4BJTA 1MGTA 3M8EA 1JUSA 5K7FA 4ZZDA 3OOPA 2FBHA 1OCOH 3PFYA 4NC8A 3PO2J 2O3FA 2QA4I 3CMAI 3RCOA 3W2VA 3OSFA 2O6GE 5LGUA 1JT6A 1R7JA 1FOKA 1J7KA 4L5JA 2Z16A 1DQUA 2H09A 4YIIA 2E36A 2M0MA 4ESBA 2W00A 2O0YA 3B6CA 5BMZA 2K27A 1OYWA 3IHUA 4PGGA 3RKYA 2IS4A 4YEJA 3QU3A 2NVUB 1R22A 3F72A 2I5UA 4JP0A 2QGUA 2R7FA 1WFXA 1D5YA 4DW6A 3WU1B 3M07A 3KETA 2ZCWA 2HYGD 1GXPA 1V5EA 1FPQA 2VPRA 4PCQA 1FYKA 1K7AA 3H36A 3J80Z 5IP7J 4KT5C 1H9TA 3TL4X 5JI6A 3HXLA 4DYRA 3E5UA 3K1PA 1ODDA 3HOTA 2OQRA 2Z9OA 1RKWA 3VODA 3LQRA 3JTHA 3R60A 4A3GJ 3WTSC 5TRDA 3R6SA 5KK1A 4GXOA 2VOPA 4FT8A 2LKPA 2ESNA 1R36A 4WXCA 4M3EA 1MBHA 3FXQA 3IP4B 4LLLA 2VN2A 3EETA 5HS8A 1ERDA 2K4JA 4I09A 4F7ZA 3BJ6A 2QQ8A 3KLOA 4L9NA 2ZJ2A 4XRFA 2R7VA 4X1EA 4N4NB 2HTSA 1T0FA 4A3KJ 3BCBA 2DMTA 5A2QK 2WV0A 4YFNF 4AYBN 3KZZA 2MABA 4U7DA 3HSRA 1EH7A 1N25A 1IRZA 3CP2A 3H35A 1Z05A 3IRQA 4GRIA 3CDHA 2OUMA 1WJ5A 4CCOA 1I6HJ 3F0CA 3NEUA 2LY1A 2BY0A 5JR3A 1WVRA 3I9V2 2QENA 5KCMA 2LBFB 2DFEA 2M7BA 2W57A 2MG4A 1QVTA 2LBFA 1OLTA 3X2QH 4ZTJA 3WTVC 4RB1A 2WAQN 4XKVA 1LVAA 1U5TC 3J7AY 3PM1A 1WJFA 5F27A 4BU2A 2PLYA 1R5GA 3ABLH 2VONA 3HOZJ 1GUUA 3K4BA 3KP7A 2XGCA 3QU6A 1ETQA 1VQLI 5IYDJ 1IZ1A 2P7CB 3CMMA 1R6RA 1ZGAA 1WHUA 3WU2C 1W0TA 3G71I 4Z2YA 3U21A 2NOGA 3HTSB 4FCYA 5DEQA 4WF2A 1Z67A 3OR1C 4EV0A 1UAAA 3CDIA 4E7KA 1LDJA 3S2DJ 4YG2F 3IKVA 4P5OA 5M5WJ 4QTRA 2EFNA 1W5SA 1WZ2A 4I7HA 3CCJI 3K1MA 2MA3A 2E1MB 1DGRM 2EIMH 2KT0A 5J40A 1D3YA 2WC2A 2R93J 3RPQA 1MBFA 3BG5A 1TQMA 5FKNA 4DYCA 2MW8A 4LLGF 2HVRA 2OC6A 5FLMJ 3LQQA 2JA7J 2XV4S 1YJNI 2FQ4A 4OIQF 1FSHA 5DTDA 3LSJA 1N78A 3I59A 3GF2A 3K2AA 1LUJB 4RS8A 1GDTA 4M3GA 2NVXJ 3TW7A 2XKPA 4CH7A 3J7YJ 1XDSA 4CZCA 3HB9A 2L4MA 3HBLA 4LB6B 1XX5A 4A93J 2M1BA 1BI0A 1FOXA 3U9GA 1TL8A 2QBYB 3FISA 3OS2A 1DU0A 4UVCA 3OYEA 1J59A 1P7IA 5IT3A 2QBYA 2E1OA 3ML6A 4EJOA 2F4MB 5J8FA 2K86A 2WWYA 3LA3A 3P5JA 2HOSA 5F1RA 3SZTA 1LNWA 3ABMH 1L3LA 2GQQA 4QIWN 1BN5A 5IPAA 4XRSG 4EVIA 1MDMB 2YU9J 4N9HA 3L2RA 2W48A 2KJBA 4G7HF 1Q1VA 1MDMA 1RPWA 1NTCA 2VBXA 2ELHA 4AIHA 2LP0A 1P4AA 2VC0A 3OL3A 2WV1A 1A36A 2HOEA 3OYGA 2PQ8A 2KMUA 4IHYA 1XN7A 3CP8A 2M30A 2XPVA 5TGTA 1ZRDA 4A0ZA 4G12A 4UHTA 3WGGA 3W3CA 4IOCF 1B9MA 4KMFA 1IO2A 3E6BA 3RJPA 2AQFA 4ZYGA 4EATA 2JA8J 3OYCA 2P6TA 2FEZA 2JA5J 1SD4A 2HU9A 4A0YA 4AIJA 3FWEA 3HRMA 1IC8A 4BE2A 2RC4A 4LJZF 5J1UA 5K7HA 2JVHA 3RPUA 2LK2A 1F9NA 3T0YA 4CO8A 1ON2A 3Q3SA 1IXCA 2EZLA 1Y1WJ 2FD5A 2WB1A 2IS2A 2KRFA 2XDVA 3BTJA 5JVGF 1X1PA 2E7XA 4CHUA 2CFOA 1YIJI 2V1XA 4JX6A 5ICCA 3TO6A 2IS1A 1AOYA 3WHBA 2FUG2 4M6XA 5D5XB 4RLQA 4U88A 2MLGA 1ETOA 3HKZN 3FM3A 1YW8A 4I99C 2R7XA 3F8MA 5HNHA 3M8FA 4N4OB 1FMVA 2W84A 1BL0A 3CO7C 1XPXA 2BGCA 1PP8F 3ZQHA 1DP7P 1ZKGA 3QP5A 1K4TA 1D1CA 1X1DA 2CW0F 1REPC 1IXSB 4I0BA 5GADJ 2L01A 2B63J 4XN3A 2VPLA 5J4YA 2YX7A 3KZIC 3BG7A 3DTIA 5E8GA 3LMMA 4E4HA 1OR7A 4LG0B 1WH5A 4IRIA 2L9RA 2VXZA 2GA1A 3BTIA 4LG0A 4HLXA 1YG2A 1EH6A 2DMQA 4BYYA 4H4KC 4A3JJ 2STWA 1BR2A 4P1WA 2CSOA 4A3FJ 1XG1A 3CUOA 4RGXA 3GZNB 2GZWA 2LR8A 2RREA 5E8IA 3O3KA 4BQQA 3S16J 2JJ7A 3QWLA 1U9NA 2NNYA 2EZIA 2E35A 2V6CA 2JSPA 2MD5A 2OPTA 2DA6A 4EGZA 1H0MA 4BHPA 4A6EA 3MQ0A 1XC5A 4P9UA 5HODA 5CQGA 3KYLA 1ZG5A 2VODA 1MH3A 2LTPA 1AA7A 4MFEA 1H8AC 3LA7A 3CCEI 1QO0D 3P9KA 4PK4A 4XL9A 5HOOA 3J81K 1I27A 4Y7NJ 4H0EA 1K79A 2F5EA 2JA6J 1RUNA 1S7AA 1LDDA 4KIFA 5HLTA 2OU2A 1NK2P 1RKTA 3DBLB 2HQRA 3I3LA 3LOCA 5J3LA 4AC0A 3KEYA 3QYFA 2VQCA 1PYVA 5HNFA 1ENHA 1MD0A 2RDPA 4MNUA 3HPHA 4A0XA 5HDNA 4BXXJ 4ZDOA 1ZR2A 4XIDA 5JVTA 4F91B 1I6XA 1S8NA 1J09A 4A12A 1LEBA 3E5QA 4RM2A 1W4MA 2ZSIB 2KIFA 3VYSB 1IRXA 5LGTA 2LNBA 3JRAA 1YYVA 1SAUA 4HEA2 1G3YA 4EGYA 1KU2A 1G3TA 4A3EJ 2X6YA 4PJMA 4U7BA 2BVLA 2EBIA 2MC4A 2DA5A 5DYMA 1TQPA 3RKXA 4ETSA 5GPAA 4MQ9F 3ZMVA 2VQHA 5DD4A 1E0EA 4C2UA 1O57A 2A69F 3I4NJ 4OIRF 3ZQIA 3OYDA 1S6LA 4NNJA 1XGOA 4BJ6C 1W7PB 2WAFA 3S1MJ 3GMEA 1WRJA 1YLFA 2Q8KA 4BNCA 1W7PA 3AG4H 2KPMA 1R71A 1UHSA 4AU7A 1RUOA 3A0BC 1ZK8A 1MIJA 2V4JC 4KIBA 1I3QJ 3SYTA 4AVPA 4AVZA 5DUIA 5LEJA 1F4KA 3GTGJ 2IAIA 3AL0B 2NVTJ 3FMSA 5BNGA 2K3FA 4HNTA 1X3ZB 2DYSH 2QVOA 4E6KG 2FU4A 4G7ZF 4RB3C 2V6EA 2CJJA 1GLNA 3RZDJ 2KDOA 3GTQJ 2VXDA 2D5VA 2LYCA 4KN4X 1LVKA 2R7WA 4B43A 3HOSA 5LFAA 2AS5F 1GV2A 4M73A 2P0WA 4UXNA 1X19A 4Q48A 5FFZA 1SMYF 3MN2A 5GAEJ 1HBXG 3Q0WA 2FOWA 5FFXA 4Z6YA 4BGDA 2VASA 2ZC2A 2DQRA 3GCMA 2DAOA 2L2OA 3MVPA 1QZYA 5EG0B 2CV0A 4BQNA 4EMSA 4A6DA 5EF6A 5EG0A 3MZ8A 4UUSB 1ULYA 1OYYA 5L3EA 2R5ZB 4DBQA 3TGNA 3RPUD 4UUSA 1FOWA 4XM3A 1LFPA 2BXYA 1RZ4A 2O8XA 4C9YA 2R7QA 2R7RA 2R5ZA 1TP4A 3A03A 1FP1D 4CICA 1BI2A 2O8KA 1YJ9I 1LPQA 1KU7A 1HKTA 2GBYA 3A01B 1USSA 1OKRA 2QSGX 3BDDA 5ILVA 2ZFUA 2PMZN 3Q0UA 1NH3A 2ZXJA 3A01A 3OYIA 5HLIA 1HSJA 1IW7F 3NQOA 3TOAA 4AYBA 4MLOA 5F64A 3BJAA 2DPDA 2X1CA 5F04A 3TP0A 2XROA 4CYCB 2X4HA 4K2EA 4DGWB 2H27A 2ZFWA 4CYCA 4D5CA 3PQJA 4NC7A 2IA2A 5C44J 2DFFA 1ZH5A 3R0AA 5J47A 4BH9A 5K1YA 2XF5A 3HOWJ 3GZ5A 4RLFA 5H6QA 2WAQA 2CQ7A 1RR8C 3NWTA 1YW7A 2LREA 2A05A 2EQRA 3CJRB 4HNUA 2QQBA 3FF5A 3KYDB 3IRRA 3I4MJ 2CQQA 3WU0A 3FIWA 1YS6A 3EUHC 2AHQA 4NBQA 3JW4A 2CV1A 3CCSI 1K61A 2CO5A 4OIPF 1ZRFA 2ZXWH 4G8XA 1BR1A 1QGPA 4G94A 2ELKA 2RKHA 4LIUA 2EPFA 1A6QA 2KP6A 2HNHA 4N0BA 5AONA 1CQTA 3MMYB 5D4RA 2ECCA 4KA4A 1ETKA 3F3XA 2QLZA 4JK1X 4RGRA 2DFHA 3S1QJ 1L0OC 4PFPA 2KRHA 4J01A 4E7SA 1JTXA 2XRLA 3FBNB 3ISPA 2DA7A 4UB6C 2PN6A 2M0CA 5ILSA 4FQGA 5LD2C 2E1NA 3SZPA 5BOXA 4XORA 2ZXHA 3ZPLA 4YFKF 4RGSA 2FE3A 4Y4RA 1SD7A 3DBRB 3GWZA 4RB0A 2OCEA 2XSDC 4BQAA 3TDZC 1IV6A 3QPHA 1HDPA 2KJCA 1KGSA 4B47A 1SAXA 2R7TA 4IRHA 2R92J 1RR7A 1R9TJ 4X0GA 3S3MA 2OTJI 1RNLA 4XRMA 3E6MA 2ZJRF 2QZ8A 3U1DA 5JLWA 4HAMA 2W1OA 3OYKA 2ZSHB 3HSEA 2P7VB 1T98A 2ZKZA 3BJOA 3SDGA 1W7PD 3ZQQA 1HOMA 2AXLA 4EM0B 2A5WA 3OS1A 1U78A 3G4SI 2KISA 2GOXB 4CXFA 2CG4A 3AG1H 3KLNA 3CC7I 4BDZA 2AO9A 2VT3A 1F5TA 2WY8Q 2CMPA 4Y33A 1PUFB 3R0JA 2E5ZA 2XF7A 2P6SA 1PUFA 4A69C 4B3AA 2LG4A 3S1RJ 2MYSA 5C4JJ 1JT0A 1UG2A 4PZJA 4YRVA 2G0EA 3KCCA 3PQKA 1RESA 2D45A 5FB2A 2EV0A 1KONA 3FHZA 1IDYA 4XR6A 2EA4A 2KRCA 4ZDPA 2ZNYA 5CVJA 4RGUA 1O3RA 5FLXK 4PUSA 3PSIA 2R0QC 2E60A 2OF7A 5JLXA 4HF2A 1Z3YA 3FMQA 5E18F 3BG3A 2ID6A 4E7JA 3M1EA 1KA8A 2XUBA 1T39A 2H8RA 3IUOA 1O3SA 1G3SA 2OZ6A 4JQFA 2VOOA 3OYBA 3HKZA 3GW2A 3CQZJ 3LWFA 1S29A 4UY8I 2I10A 1H88C 4XNFA 1TNTA 3H5RA 2CS3A 1J0RA 3D1NI 5KAFC 2M4GA 3MZYA 3AAFA 4XLHA 4MTEA 4YELA 3JAMZ 1R00A 2YS9A 3EPZA 2DDAA 3KEOA 3UNGC 2VKEA 3N05A 2OCCH 1VQ4I 4M9ZA 5BPDA 4R1HA 1I50J 3FXOA 1X2NA 3OL4A 2LF7A 5H2FC 2CUFA 2MC3A 1ZLJA 3V42A 3AL0C 2F5DA 3KP4A 2R7UA 5HDKA 1W5TA 2BBYA 4PSWA 4G6DA 3ZCOA 2HXOA 4OMYA 5F1JA 3H3UA 2LKXA 4CA0A 1QZEA 1VQ5I 2NS0A 3VFZA 3HOYJ 2HQNA 3L2UA 4PGHA 2NRAC 5BQTA 1YO5C 1MNDA 4A2UA 3ESWB 1UHWA 2VI6A 3KX2A 1DU6A 1XTAA 4B4CA 3CCVI 3TP3A 4XKWA 4A3LJ 2YUSA 2MFZA 2F6CA 2FJ1A 2GLOA 3BROA 3LNQA 2IGOA 3BZKA 4KFCA 3HG9A 1BA5A 5EEGA 3G1MA 3IAM2 2CQXA 3ERMA 2CUEA 2FF4A 2VKVA 1JKPC 5D8KB 3BZ6A 3MZHA 3RKQA 3QAHA 3VEPA 4BJ5C 1TTYA 1A35A 2GOMA 2X6WA 3DEWA 2DBBA 1QRYA 2DMPA 2L4AA 4LK0F 3OYJA 3SHFA 1YS7A 3CCMI 1MBGA 4ENJA 1I1SA 4CZZA 2CRGA 4ZYHA 3CC4I 2COMA 3NWSA 3EYYA 2QUFA 3ECOA 1OYIA 5CKTA 4YIFA 3GTLJ 3ZMTA 1LEAA 2DW4A 2UV1A 3S17J 3LSHA 1R4MB 4ASNA 3S3NA 2OD5A 5ERIA 4J00A 1OMIA 3RI4A 1G4DA 2HR3A 2DJNA 3EUKL 2NS8A 2VJIA 3KPHA 2DK8A 3S2HJ 3WTTC 2AQEA 3GTMJ 4HYEA 1BM9A 3FK7A 1A31A 1O7FA 3FXLA 1UELB 2DU9A 5BS6A 3ABUA 1GVDA 3MCZA 4ESJA 2DA3A 2RAEA 2HWVA 2V9KA 3E3VA 3M7GA 1XMKA 1RI7A 3K10A 1U2WA 1FZPB 2HQAA 4I01A 1SVLA 3OYHA 3DKXA 1UZCA 2XHKA 4X6AJ 3A0HC 2Y75A 5E1WA 1GXQA 2DQLA 4UV8A 4G6QA 3PFIA 4ZYDA 5DCMB 2HPMA 1ZR4A 3MEXA 1WCMJ 5DCMA 3F21A 1BI3A 4ZJZA 1ETXA 4HSTA 1S9HA 3VPRA 2XAGA 2A6TA 1VQ9I 1MBKA 4L5EA 1Y0UA 1YE9A 5DV5A 2QQ9A 3ZOBA 1R1TA 3W2AA 1X2MA 2M45A 1P2FA 3DCFA 1FYMA 3I59B 2XAJA 2P5LC 1ZLKA 1FOYA 4XMYA 1JKOC 4UNOA 1W36D 9ANTA 2PFBA 1J9IA 2GIZA 1VF9A 1CF7B 1YHQI 2CGPA 3V8LA 5C4XJ 4C30A 1A5JA 4XONA 2PJRB 3HIFA 1CF7A 2ZMEC 2H6BA 2B0LA 5EEHA 2BVMA 2HVQA 1U8BA 2PJRA 3H5AA 3I56I 1FIAA 4Y3OA 5IT9K 1OQYA 3HHGA 2C6YA 4WXDA 3PL8A 3ECHA 2VL8A 2XSJC 5FGMA 3MFKA 3OOUA 2Z99A 4IKFA 3FM5A 3ZMSA 2MH2A 4CCLA 3E6CC 1LJ9A 5IYBJ 5HS9A 1XMAA 2DO7A 5B1BH 4A5NA 5M5XJ 4ENMA 4B3XA 4M71A 4M3DA 1SVOA 1TZLA 1D0XA 3HC7A 3TW6A 2IEKA 3JRFA 5FKMA 1IF1A 4E7LA 3HOUJ 2VQLA 4BXFA 2JN6A 2TRTA 4F93B 4A3BJ 1GVJA 1JHFA 2W25A 1TLHB 3HSFA 1B72B 3IC7A 2BOLA 2QF7A 5GTHC 1B72A 2R3SA 3JRCA 1ZN2A 3K0LA 3F8NA 3BQZA 2M4KA 1H89C 2V9PA 3OSGA 1XSVA 4OU0A 2IXSA 3KEQA 3S3OA 4IHVA 2D1HA 4HF1A 2JK3A 3Q0VA 3GTKJ 1FTTA 2W4SA 3LSMA 4HG2A 1PP7U 5F08A 3BCAA 1TWCJ 1ZARA 4FX0A 2XAHA 1HXDA 5FJ8J 1BR4A 4M72A 2GWRA 2VT2A 1MMSA 2LSOA 4WCGA 1EA3A 2CU7A 3ASOH 3IH3A 3QYBA 4E70A 5J6XA 1TT5B 4XKCA 5GPCA 4QWQA 1E3PA 2BZTA 3PUFA 1B8IB 3K4CA 3G2BA 1B8IA 4M6VA 1G8XA 2B7EA 4FETA 3CLOA 5HVQC 1TC3C 1JTYA 2KIMA 2DA1A 2FQ3A 3BR0A 3BZCA 1QPMA 2LY2A 1KYZA 1UJ8A 4RAYA 2VKHA 2HGCA 2BEOA 2OAZA 3I55I 2ZB9A 2R5YB 1SEUA 2XRNA 4S0HB 1J5YA 4XLEA 4L9JA 2R5YA 1UCRA 1Y8QB 2W24A 5E3OA 4DJAA 1MBJA 4CCKA 3FXUA 3A1YA 3IH4A 5D6EA 2N8GA 5CVIA 3K69A 1LFBA 2V9VA 4MQVA 3K2ZA 2E34A 5KHDA 2A6HF 2GA2A 1ZAOA 3GFIA 2LOOA 2EH3A 1F1ZA 3GFMA 4RAFA 5GAGJ 3ABKH 3GTPJ 2L9VA 2PMHA 2L9NA 3EYIA 2M9HA 3DP7A 3K4MA 2IPQX 3RIRA 1ZQ3P 1TQIA 2OTLI 3C2BA 2MLKA 5EZGA 4NB5A 3JRDA 1D0ZA 3F8BA 2CW8A 3MKWB 1WQ2A 2XGEA 4JOMA 4XK4A 3CMYA 4C3HJ 2Z3YA 1DGWY 4KISA 2FA5A 3LFKA 2Y48A 3BR6A 4KJZA 3ZQFA 3DKYA 4IVNA 2WA0A 2VKDA 4PSXA 4EM2A 5M5YJ 4D1QA 1I3AA 4BBRJ 3AFHA 1FJLA 4HNVA 1JE8A 3G73A 2H94A 2DOFA 3B73A 3RKWA 5E79C 4GDFA 4XLPF 2X85A 4OAZA 4RMNA 2E71A 5K5QA 3GTOJ 1IAWA 3ABTA 1YX5A 3L1PA 4U0VA 2GIVA 1LKXA 3DEUA 3COAC 2HZDA 4FISA 3TO9A 4ZTFA 2DK5A 2VBYA 4PDKA 1S7OA 2EIJH 2D2WA 2X0LA 3VWBA 1T0FC 3DU5A 2BY1A 2K02A 1B59A 4GGGA 1X1CA 5EEAA 3GZ6A 1YTYA 1YITI 4L0YB 4LK1F 4HQEA 1T8IA 1WI9A 1IN5A 2D1VA 2MSYA 2NAZA 3OIOA 2HOTA 3J7AO 4LOCA 4II2A 3WG9A 4CGZA 2EZKA 2XGDA 2LY9A 4I98B 4P9FA 3MKYB 3RQ4A 1YX3A 4OOIA 3WTXC 4EJWA 2EFOA 1V54H 3TDUC 3IV5A 1QZZA 4KUMA 2ELJA 3HZJA 3K7AJ 3WE3A 2XPUA 3DTKA 3H9QA 4BAYA 4F52A 3WTUC 1D8JA 2X6OA 2M34A 4MO7A 4B1RA 2DJIA 4IJAA 3I4PA 1B6AA 5A2QZ 4LD5A 1HLVA 5K5RA 2E19A 3H92A 1LE8B 5TISC 2EINH 1D5VA 5JFRA 1FX7A 2AXTC 2R7OA 1GT0C 1LE8A 3W6VA 3M1CA 3J7ZI 5IYCJ 3C18A 2YX4A 4HBLA 2EFQA 4BEHB 2VLAA 2QKLB 2DPUA 4FASD 2FSWA 4BEHA 4LGWA 2K9NA 4OINF 1AHDP 5LRRA 3WTYC 3M3YJ 4ZC3A 5LGNA 2UXXA 4A3CJ 1Z1DA 2ZJPF 3IAS2 2EK5A 3QPLA 2O03A 3REOA 1G3WA 1IRFA 2JPBA 3DXJF 4FX4A 3J80K 1VQ7I 3S93A 2F4IA 4D5FA 3I58A 2RN7A 4HX8A 4UVAA 2JUGA 2STTA 5K7ZA 3FBIB 2RQQA 1HDDC 2HQ5A 1OCRH 2PJPA 4S04A 4FHTA 2HDDA 1T33A 3V7SA 2E1MC 2CV2A 3KP6A 4D7MA 1J2XA 4LMYA 2Y31A 2DN0A 2W82A 2IW5A 3SXYA 2M8GX 4HV5A 1FMWA 1TW2A 3HOVJ 2VJ4A 4HF0A 3VYUB 2UXNA 3S8PA 1HQCA 2MD0A 3LA2A 1ON1A 2LH9A 2M7AA 1Z7UA 3CC2I 3ZMZA 4UUVA 1JJ6C 2JWTA 3A02A 3GLXA 1KYWA 5DS9A 3CUQB 2LVSA 2K3PA 4QPOA 3IWFA 3CUQA 3QODA 5L3GA 1ZG3A 5CVUA 1IRGA 2Y0MA 2EJRA 3ZRGA 2K9MA 1VZ0A 2CYYA 2HKXA 5B66C 3A4CA 1HCRA 2ME0A 3KFWX 1FEXA 5EYRA 2F5CA 1FIPA 5FO5A 1I1GA 2FMYA 4XLAA 3OMYA 5D8LB 2O7OA 2JZYA 4EM1A 3K6GA 1BOAA 3SFZA 2HTJA 1FBQA 2NOJB 2K9LA 4B8XA 3H5NA 3V7CA 1SD5A 1WGXA 4TV7A 3SQNA 2DYRH 3KYCB 4KIGA 1HA8A 2ESHA 5DCFA 2FBIA 2OZUA 3HOXJ 3SEZA 3E97A 1RIOH 2VE8A 1XGSA 3QQAA 4GCVA 3SDBA 1Y1VJ 3IKTA 5D6FA 2L3DA 3JRHA 1U5TB 3F8CA 2R7DA 4IF4A 4GFBA 3I0TA 1U5TA 2K5CA 2M8EA 3SZGA 2CW7A 3ZMDA 1BI1A 2XGXA 1STZA 3I5UA 4BY7J 2PI0A 2KIUA 2L02A 4XQFA 3LSRA 1MMNA 3HUGB 4V2FA 5ICFA 3E1SA 3HUGA 4DYQA 4A5MA 1BOBA 5FD5A 5J1YA 4ZZLA 5E1ZB 3L2QA 3WGHA 4NUBA 3CZ6A 4Q47A 1YOVB 3B6AA 2X9DA 4IXAA 1HW1A 2ETHA 3FMRA 5CJ9A 1Y6IA 1OJLA 1N75A 2L5QA 1I5ZA 3L2VA 2E1CA 1VQOI 1ETWA 4RAGA 1JJ8C 1K4SA 3CF2A 3KZYA 1LQ1A 1O4XA 1Y8RB 2E2HJ 1O3TA 3QYEA 4KITB 5D5VB 2BV6A 3MD2A 1XB4A 4BS9A 3U1KA 4I2OA 5L3BA 3S14J 1X3WB 2JA2A 3L00A 3HRUA 3BY6A 4FTHA 3V8JA 2HEOA 4JX4A 2HDWA 4EQQA 2XIGA 3PNVA 5J4VA 3G3ZA 5HS7A 4Y17A 2PX9A 1VQ8I 3JSOA 3HRTA 3BG6A 1OR7C 1DUXC 1JI8A 1BC7C 1WJBA 2BE5F 1TNSA 3BT9A 4PJLA 3LSGA 2IGNA 5EGOB 2UUZA 2R7ZJ 4E7HA 4KMUX 4EJVA 1VFCA 3G1OA 5EGOA 4HDUA 3UR3C 2R7SA 3DLAA 4YIRX 3ZXSA 1SFKA 3LSPA 4ZH4F 3ZQGA 2KHMA 2V1UA 1JKQC 1BBYA 1X4PA 3CCQI 4I02A 4M74A 2DA4A 3HPGA 4XLFA 2JTVA 2J5PA 2QYOA 4WXHA 1QNTA 3VB2A 3ROUA 1IUYA 3H3ZA 3K4NA 4MTDA 1DDNA 3ASNH 4DOZA 3U2RA 3FXMA 1U0JA 2K4BA 1JXSA 4OAYA 4NQWB 3WGIA 1ZRCA 4O5VA 4XSZF 1JKRC 4Q4ZF 3LAPA 4NQWA 2QSHX 3HYIA 1D8KA 2OA4A 4HSRA 4UB8C 3JTGA 3ZQCA 1VQ6I 2KKOA 3D5RC 2RGVA 4RA2A 5ED4A 1E2XA 2NS7A 1ACIA 3FKIJ 3Q9VA 5E1XA 2YPRA 3E0JB 3J81Z 3TQNA 1KU3A 3DKWA 1K78B 2P5KA 3FDYA 2NVYJ 1TWAJ 5GAHJ 2HPIA 3KP5A 2QKMB 3KIOA 1NK3P 1K78A 1OCTC 1IN7A 4D7NA 3OIQA 5F0HA 2RNJA 4C3JJ 1UG0A 1MNMC 2PEXA 2HYFA 1X3UA 1Z21A 3PO3J 3JRGA 4AUXA 3I64A 3O8GA 2QQAA 2KZVA 1Z0XA 2TCTA 1IJWC 1RC9A 2X51A 5EDNA 3H3VK 1R4NB 3GFJA 1Z3XA 3D0SA 3HJEA 2HFHA 2JRMA 1HKQA 1Y0NA 3Q5FA 1XCVA 1OPCA 1HF0A 4C2TA 5B1AH 2KDZA 2CUJA 4J19A 1K6OA 2WAEA 1IUFA 3JSPA 4E7IA 1Z9CA 2RNGA 5ICEA 1T38A 4B48A 4D9JA 3N97A 5F0CA 3H1CA 2V7FA 2NXNB 1K6YA 1DPUA 2J5OA 5FKLA 2H8WA 4ITVA 4DZPA 2L7ZA 1RETA 3L2WA 2IRFG 3CJQB 3O6BB 1OFCX 3QPTA 2X1DA 3KP3A 3ZQLA 3LSKA 3OYNA 5E20A 4CCMA 1IXRC 1MNEA 3H0GJ 1Z6TA 5D5UB 1IN4A 2DLLA 1AWCA 1ITYA 1HW5A 2X1EA 2E2JJ 3LFUA 4KNYA 1IGNA 1HW2A 1OISA 1ZGJA 3AKZA 2ICWG 1UFMA 3AG3H 4ABZA 3FK6A 4IPAA 4II3A 3EQLF 3H9GA 1MZBA 1R1UA 1S7EA 3L9FA 2BW3B 3QRFF 2DOAA 2GAUA 1CGPA 4V19K 1XS9A 2BW3A 3DFGA 1IDZA 2EFPA 3BR2A 4RAZA 4L18B 3S15J 2OJED 5CLSA 3MAJA 2F5FA 2Z2SB 4R79A 3S1NJ 1C0WA 5IOZA 4KYWA 4ENKA 1LB2A 4DBRA 3DPTA 3PNYA 5E3MA 3OS0A 4BUPA 2ID3A 3CUQC 2FXAA 4V2GA 3DWLE 1WH7A 2K7LA 2FOKA 3T8RA 1ORKA 3C7JA 4EJTA 1FC3A 1R5ID 2GXGA 3FXKA 2IGKA 4IEJA 1HC8A 3JRIA 3V8KA 2F4OB 1YW9A 2BY2A 2IBDA 1X4OA 5H6RA 4DZJA 2IA0A 1BIAA 4L9TA 3OYLA 1ONVA 1D0YA 5GP9A 2Y0SN 2PG4A 1EJ9A 5C3EJ 2Q0OA 3SEQA 5DD8A 2KL4A 4KN7X 2EV5A 1FBSA 3G1LA 2FRHA 5H20A 3OR2C 5M3MJ 1P4WA 3P9IA 3R4KA 3QOPA 3TO7A 3RZOJ 2G7UA 1TWHJ 2FBKA 5HLHA 2P5VA 2VBZA 2BHYA 4BY1J 1YJWI 3BC8A 4LFUA 2DI3A 5DDGA 1UHMA 2G9WA 2YSRA 1SFOJ 2DCEA 3BR3A 2P4WA 1ETYA 4G7OF 2DTRA 5KNLA 1IN6A 3E6DA 5E3LA 2V1NA 3IWZA 3FZVA 4IL6C 3WODF 4KT6A 2A68F 1Y56A 1WI3A 4CSWA 4XLCA 4IO9F 2XASA 1FWZA 5AIPA 2BXZA 5CPRB 3TBIA 4LB5A 1TW3A 5CVRA 3TOBA 4AIKA 4HA8A 2H1KA 1V3FA 1YQAA 1GHCA 2OV7A 3OIPA 4IHTA 3V4GA 2UZKA 2ISZA 1FBUA 5JHFA 4G9YA 2F5VA 5LRSA 4A3MJ 3HGGA 2Y9YA 2VC1A 3C3WA 1A04A 5IOYA 2RQPA 2M5WA 1MMAA 5LLQA 2WADA 2COBA 1VQPI 5HDGA 2HDCA 1SMTA 2DT6A 1B1BA 4JX5A 2A07F 4PFOA 1J75A 2EFWA 4QPQA 2DFIA 1VQMI 4EEFG 3NAUA 2MH9A 5F0FA 4LIVA 4IHXA 3ELKA 3FX3A 2HVSA 3K4KA 3DU6A 3C1DA 2RV8A 1EH8A 2CUZA 2FMLA 1MJ9A 2JMWA 2PMZA 1I39A 3RTRA 3CCRI 3PJRA 2UWMA 3FXRA 4KDPA 2P81A 1SD6A 4ESFA 5ILUA 1NHAA 4DQ2A 2K85A 1WJCA 3PSFA 5L3DA 4AIDA 2XF6A 4I0AA 4MFDA 2A6EF 2Z5UA 5M3FJ 3CO6C 1T2KA 1H9GA 2VJJA 2V26A 3ZN1A 1POGA 3UKGA 3K4LA 3HL2A 4A3IJ 3F9KA 2LRDA 3CCLI 1JUMA 3BPXA 1W36C 2ZXIA 3RQIA 4ZYAA 3T1BA 3EUAA 3GBGA 3N4MA 2K9SA 3JCUC 2KFDA 3ONQA 4IZZA 2PBIA 2QCOA 4M9SA 2EWNA 2BYVE 2XB0X 1APLC 2MBFA 3G6EI 1S5LC 2DT5A 4M6YA 5HLGA 3GTJJ 3VYRB 1D1BA 1QHHD 2IT0A 2F48A 2EZHA 3BPVA 2XC7A 2CQNA 1T56A 3IH2A 1FTZA 1HKSA 1Z7LA 2KQRA 4M3BA 3HDDA 3EUHA 1KQ9A 2HZTA 1XMXA 2Y69H 2M2EA 4Y15A 2XAFA 3L2CA 5E17F 1SC7A 3CF5F 3BTLA 1T6SA 2VBWA 4GO1A 2F2EA 3D5LA 3DPUA 3OV8A 1MMDA 3FXJA 4PJNA 1R23A 1VNDA 3RYRA 4HRIA 1BJZA 5EZHA 3W6KB 2NVQJ 3VSKA 2L9SA 1F36A 2ZNZA 4W97A 2NYXA 2LKSA 5CQEA 3CMEI 3F23A 3T8TA 5B3SH 1E17A 4IRGA 2ECBA 5FLXZ 4IHSA 2FX0A 4I76A 1K83J 3PUBA 1QHGA 3JRBA 1WJEA 2XKOA 1JGSA 2GXBA 1T95A 3QP6A 3OYFA 5E3NA 3PIPF 2EV6A 3SJMA 3E7LA 2DA2A 1V55H 2KIQA 5L3FA 2Y2ZA 3K1NA 1TWGJ 4XKBA 5FLVA 3BP8A 3CCUI 2LDUA 3HRSA 3QOEA 2LMDA 3I71A 4DNCA 1BW6A 3VSLA 2Y30A 3GO5A 3DV8A 2IP2A 3KP2A 3BR5A 1DP3A 2K9QA 2JSCA 2QM3A 4BE0A 4CCNA 2ISYA 4U87A 5L3CA 2OQGA 1MMGA 1YI2I 2A3SA 1EKEA 1E3HA 3ZR8X 4D0PA 4F3QA 1VI0A 3F6VA 1TWFJ 5ICGA 3H9JA 1R5HA 1USTA 2E5NA 1U6GA 1FNNA 1MJAA 4U0YA 3WHCA 4AM3A 1XGMA 3K9TA 3BG9A 4F92B 2NNNA 2R4GA 4JBAA 3EDPA 4M3FA 3HEFA 3CESA 4BKXA 4CCJA 1G2HA 2XAUA 1R1VA 3FHNA 4RM3A 2BY3A 2LLKA 1MSEC 1A6IA 1FT9A 4G6TB 4JYKA 4XBFA 4NC6A 2Q1ZB 4ON0A 4NHJA 1OCPA 2LFBA 3TEDA 2H1LA 4MGRA 2MGQA 4BHBA 1YIOA 4O6JA 4MIMA 2RVCA 1UB9A 3C2HA 4CDGA 4XOPA 3KE2A 1VQNI 1B4AA 2JVGA 2CFXA 4ANJA 3GFLA 3VOEA 1IN8A 1MW7A 3F22A 2CQKA 5J1RA 2W85A 2V1DA 5LBQA 4P96A 1X1AA 1KQ8A 1XCBA 4FE4A 3SFIA 2TDXA 4I6ZA 2PMUA 1WKMA 3DEEA 3JAMK 2L54A 4QSHA 2Y9ZA 2B9SA 2QWWA 4CYDA 4BDYA 1QU3A 1XSDA 5IY5H 3F8FA 2VQGA 2YR2A 1KU9A 1Z6RA 2VB6A 3BTCA 4Y52J 4Y13A 5FRNA 4AWXB 3OYAA 1DPRA 3ZN0A 2BHZA 1AKHB 4HDVA 1AKHA 2L7MP 1BW5A 4RBOA 3GVAA 4PJJA 2VIXA 2YU3A 4B44A 4OIOF 1PDNC 1ZELA 3F6OA 5KVRA 5D4SA 2Z1DA 1T08B 1U9OA 4YFXF 3MKZA 4PJ0C 3TMOA 1YRNB 5F6FA 1OCCH 1U8RA 3ZMUA 4E7ZA 2EILH 1YRNA 1P9QC 5LHGA 5LEKA 4P55A 3AG2H 1Z91A 2EB7A 5EJCA 1BJAA 3I53A 1O7LA 3TKYA 1KQ0A 2DOEA 3HHHA 1QPIA 5J8CA 1N77A 2DDBA 3DPLC 3NARA 4BHCA 5CYVA 3BQYA 1PUEE 3DLLF 6PAXA 1FSEA 1S3JA 2IJLA 3GXOA 1XDUA
chains in the Genus database with same CATH topology
4XICA 1GVDA 1UMQA 3ZQHA 2DA3A 2RAEA 1JKRC 2E2IJ 2O9LA 1GV5A 1ZKGA 5FKKA 3ZQCA 2B63J 2NS7A 3FKIJ 4X6AJ 1X58A 3JREA 1WH5A 3MKLA 2L9RA 3BTIA 5IP6A 2GM4A 2NVYJ 1TWAJ 2DMQA 1NK3P 4A3JJ 1ZR4A 1OCTC 4A3FJ 1XG1A 1WCMJ 4D7NA 5F0HA 2LR8A 3S16J 4C3JJ 1MNMC 3QPSA 1ETXA 2JJ7A 1U9NA 3VPRA 2EZIA 3PO3J 1MBKA 4L5EA 3JRGA 2OPTA 1E3OC 2DA6A 4AUXA 3O8GA 5HODA 1XC5A 1Z0XA 3ZOBA 2TCTA 1IJWC 3CDLA 1X2MA 3DCFA 4UUTA 5EDNA 3H3VK 1MH3A 1JKOC 2LTPA 4MFEA 1H8AC 9ANTA 1WPKA 1JUPA 1VF9A 1HF0A 2L7FP 5C4XJ 4Y7NJ 1A5JA 3HM5A 2JA6J 2KDZA 4J19A 1IUFA 1U8BA 1NK2P 1RKTA 1FIAA 5F0CA 3LOCA 5J3LA 4AC0A 1ZTRA 3OOUA 5FKLA 1ENHA 1P7JA 4DZPA 4BXXJ 2L7ZA 1RETA 2HYJA 1ZR2A 4XIDA 1OFCX 5IYBJ 4RDUA 2WB1N 3ZQLA 5M5XJ 4M3DA 3H0GJ 3TW6A 2IEKA 3JRFA 5FKMA 2VUMJ 1ITYA 2E2JJ 3HOUJ 3JRAA 1IGNA 2JN6A 2TRTA 4A3BJ 4ABZA 3FK6A 4A3EJ 1B72B 1S7EA 2EBIA 2QF7A 2DA5A 1B72A 3JRCA 3M4OJ 2LD5A 5GPAA 1MBEA 3BQZA 1XS9A 2DTZA 1H89C 1IDZA 3JR9A 4C3IJ 3OSGA 3BR2A 3S15J 3I4NJ 3ZQIA 1LFUP 4IHVA 3S1MJ 1MH4A 4FE7A 2JK3A 3Q0VA 3GTKJ 3S1NJ 1FTTA 5IOZA 1W0UA 5F08A 5E3MA 1UHSA 1TWCJ 5FJ8J 2ID3A 1ZK8A 1EF4A 1I3QJ 3GTGJ 4V2GA 1MSFC 1WH7A 2IAIA 2NVTJ 5BNGA 2CU7A 3IH3A 1ORKA 5GPCA 4IEJA 1B8IB 3BR1A 3JRIA 2CJJA 3RZDJ 1B8IA 4M6VA 2IBDA 2D5VA 4IHWA 3GTQJ 5FKOA 1JTYA 2XB5A 1TC3C 2DA1A 3BR0A 4DZJA 1ETVA 1GV2A 2DMUA 5GP9A 3MN2A 1ZGWA 2Y0SN 3Q0WA 2ZB9A 2L0KA 5IP9J 2R5YB 5C3EJ 4S0HB 4C2MJ 1QVUA 3G1LA 2R5YA 2HXIA 4A3DJ 5M3MJ 5E3OA 1MBJA 4NDLA 1IG7A 3IH4A 3RZOJ 1F43A 1TWHJ 3MVPA 5EG0B 2N8GA 4BY1J 1LFBA 5EG0A 5EF6A 4UUSB 1SFOJ 3BR3A 1ETYA 2R5ZB 4UUSA 2HI3A 2R5ZA 2EH3A 3A03A 2K40A 2ME6A 5E3LA 3GTPJ 3CCYA 2O8KA 2M9HA 1ZQ3P 1WI3A 3C2BA 2GBYA 3A01B 5EZGA 3JRDA 3HGYA 1Z77A 3O8HA 2PMZN 1SANA 3Q0UA 3A01A 1JGGA 2H1KA 2XGEA 4XK4A 3CMYA 4C3HJ 4MLOA 4BBSJ 3BR6A 5F04A 3ZQFA 2HOAA 4W1UA 3TP0A 5M5YJ 4CYCB 4BBRJ 2XPWA 2Y9YA 3HGGA 4XRSA 4A3MJ 1AU7A 1FJLA 4HNVA 2X48A 5IOYA 4CYCA 4D5CA 2DMNA 5C44J 1JUSA 5K7FA 2COBA 3GTOJ 3HOWJ 4JX5A 3L1PA 3PO2J 3OSFA 1JT6A 4FISA 4EEFG 2EQRA 3NAUA 3I4MJ 2CQQA 5F0FA 4IHXA 3FIWA 5EEAA 2MSYA 2HOTA 3OIOA 3B6CA 4LOCA 2AHQA 2EZKA 2JMWA 2XGDA 2LY9A 1K61A 4JP0A 2P81A 1D5YA 3IV5A 4DW6A 2ELKA 3K7AJ 2XPUA 2VPRA 2X6OA 2M34A 4MO7A 4MFDA 1CQTA 5M3FJ 4B1RA 5IP7J 4DYRA 2ECCA 1ETKA 1HLVA 1POGA 2E19A 3UKGA 1LE8B 1RKWA 4A3IJ 3S1QJ 1LE8A 1GT0C 3W6VA 4A3GJ 1JUMA 5IYCJ 1JTXA 2XRLA 3RQIA 2DA7A 4M3EA 3GBGA 1MBHA 2M0CA 2K9SA 2K9NA 2QCOA 1AHDP 3M3YJ 4A3CJ 1APLC 2XB0X 3QPLA 2XSDC 3GTJJ 4X1EA 1IV6A 4A3KJ 2EZHA 1HDPA 2DMTA 4D5FA 1T56A 3IH2A 1FTZA 4AYBN 4M3BA 3HDDA 2M2EA 2R92J 1RR7A 5K7ZA 1R9TJ 3BTLA 1HDDC 2HQ5A 1IRZA 4XRMA 2HDDA 1T33A 1I6HJ 3F0CA 4D7MA 2Y31A 2DN0A 2M8GX 1VNDA 5JLWA 3HOVJ 1BJZA 2MG4A 1QVTA 5EZHA 2NVQJ 1F36A 4W97A 3SDGA 2WAQN 1HOMA 3PM1A 5F27A 2ECBA 1U78A 1JJ6C 2FX0A 4I76A 1K83J 2JWTA 3A02A 3JRBA 3HOZJ 1GUUA 5DS9A 2LVSA 2AO9A 2XGCA 5E3NA 1PUFB 1ETQA 5IYDJ 3SJMA 3E7LA 1PUFA 2DA2A 4A69C 4B3AA 1W0TA 2Y2ZA 1TWGJ 3S1RJ 2NOGA 5FLVA 5C4JJ 4FCYA 1JT0A 1UG2A 2ME0A 1HCRA 2G0EA 1FEXA 5EYRA 1RESA 1FIPA 1BW6A 2Y30A 3S2DJ 5M5WJ 2O7OA 1IDYA 3BR5A 4QTRA 2K9QA 2R0QC 2KT0A 2OF7A 1WGXA 5JLXA 2R93J 1MBFA 3BG5A 3BG3A 2ID6A 3HOXJ 5FKNA 4DYCA 2MW8A 2H8RA 1VI0A 1TWFJ 3QQAA 5FLMJ 2JA7J 1Y1VJ 3JRHA 3CQZJ 3WHCA 2FQ4A 2I10A 1H88C 3BG9A 4GFBA 5DTDA 3LSJA 3K2AA 4M3FA 3HEFA 3D1NI 4BKXA 1GDTA 1G2HA 4M3GA 2NVXJ 3TW7A 2YS9A 2LLKA 1MSEC 4BY7J 3HB9A 1A6IA 3HBLA 3LSRA 4V2FA 2VKEA 4JYKA 4A93J 4DYQA 1I50J 1OCPA 2LFBA 3TEDA 5J1YA 1X2NA 3FISA 1DU0A 2MGQA 2CUFA 1P7IA 2E1OA 4MIMA 3B6AA 2X9DA 2HXOA 5F1JA 1OJLA 2LKXA 2HOSA 5J1RA 3HOYJ 4QIWN 1ETWA 5IPAA 4FE4A 4XRSG 1JJ8C 2YU9J 3SFIA 2W48A 4I6ZA 1O4XA 1Q1VA 2VI6A 1RPWA 1NTCA 1DU6A 2E2HJ 4B4CA 3TP3A 4A3LJ 4QSHA 2YUSA 2LP0A 2Y9ZA 2FJ1A 2GLOA 3LNQA 2WV1A 1BA5A 3G1MA 4IHYA 2CQXA 3S14J 2XPVA 2CUEA 4Y52J 3BTCA 4G12A 4FTHA 2VKVA 1JKPC 4JX4A 1AKHB 2JA8J 3RKQA 2JA5J 1AKHA 2L7MP 3DEWA 1QRYA 1BW5A 2DMPA 4RBOA 1IC8A 3BT9A 1MBGA 3LSGA 2CRGA 5J1UA 5K7HA 1U9OA 5EGOB 2R7ZJ 2LK2A 1VFCA 3G1OA 5EGOA 1YRNB 3Q3SA 2EZLA 1YRNA 1Y1WJ 2FD5A 3LSPA 3GTLJ 3ZQGA 1JKQC 3BTJA 4JX6A 1QPIA 3S17J 3WHBA 2DA4A 3NARA 1ETOA 2DJNA 2NS8A 3HKZN 3BQYA 3S2HJ 3GTMJ 3FK7A 1BL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIC A;  1GVD A;  1UMQ A;  3ZQH A;  2DA3 A;  2RAE A;  1JKR C;  2E2I J;  2O9L A;  1GV5 A;  1ZKG A;  5FKK A;  3ZQC A;  2B63 J;  2NS7 A;  3FKI J;  4X6A J;  1X58 A;  3JRE A;  1WH5 A;  3MKL A;  2L9R A;  3BTI A;  5IP6 A;  2GM4 A;  2NVY J;  1TWA J;  2DMQ A;  1NK3 P;  4A3J J;  1ZR4 A;  1OCT C;  4A3F J;  1XG1 A;  1WCM J;  4D7N A;  5F0H A;  2LR8 A;  3S16 J;  4C3J J;  1MNM C;  3QPS A;  1ETX A;  2JJ7 A;  1U9N A;  3VPR A;  2EZI A;  3PO3 J;  1MBK A;  4L5E A;  3JRG A;  2OPT A;  1E3O C;  2DA6 A;  4AUX A;  3O8G A;  5HOD A;  1XC5 A;  1Z0X A;  3ZOB A;  2TCT A;  1IJW C;  3CDL A;  1X2M A;  3DCF A;  4UUT A;  5EDN A;  3H3V K;  1MH3 A;  1JKO C;  2LTP A;  4MFE A;  1H8A C;  9ANT A;  1WPK A;  1JUP A;  1VF9 A;  1HF0 A;  2L7F P;  5C4X J;  4Y7N J;  1A5J A;  3HM5 A;  2JA6 J;  2KDZ A;  4J19 A;  1IUF A;  1U8B A;  1NK2 P;  1RKT A;  1FIA A;  5F0C A;  3LOC A;  5J3L A;  4AC0 A;  1ZTR A;  3OOU A;  5FKL A;  1ENH A;  1P7J A;  4DZP A;  4BXX J;  2L7Z A;  1RET A;  2HYJ A;  1ZR2 A;  4XID A;  1OFC X;  5IYB J;  4RDU A;  2WB1 N;  3ZQL A;  5M5X J;  4M3D A;  3H0G J;  3TW6 A;  2IEK A;  3JRF A;  5FKM A;  2VUM J;  1ITY A;  2E2J J;  3HOU J;  3JRA A;  1IGN A;  2JN6 A;  2TRT A;  4A3B J;  4ABZ A;  3FK6 A;  4A3E J;  1B72 B;  1S7E A;  2EBI A;  2QF7 A;  2DA5 A;  1B72 A;  3JRC A;  3M4O J;  2LD5 A;  5GPA A;  1MBE A;  3BQZ A;  1XS9 A;  2DTZ A;  1H89 C;  1IDZ A;  3JR9 A;  4C3I J;  3OSG A;  3BR2 A;  3S15 J;  3I4N J;  3ZQI A;  1LFU P;  4IHV A;  3S1M J;  1MH4 A;  4FE7 A;  2JK3 A;  3Q0V A;  3GTK J;  3S1N J;  1FTT A;  5IOZ A;  1W0U A;  5F08 A;  5E3M A;  1UHS A;  1TWC J;  5FJ8 J;  2ID3 A;  1ZK8 A;  1EF4 A;  1I3Q J;  3GTG J;  4V2G A;  1MSF C;  1WH7 A;  2IAI A;  2NVT J;  5BNG A;  2CU7 A;  3IH3 A;  1ORK A;  5GPC A;  4IEJ A;  1B8I B;  3BR1 A;  3JRI A;  2CJJ A;  3RZD J;  1B8I A;  4M6V A;  2IBD A;  2D5V A;  4IHW A;  3GTQ J;  5FKO A;  1JTY A;  2XB5 A;  1TC3 C;  2DA1 A;  3BR0 A;  4DZJ A;  1ETV A;  1GV2 A;  2DMU A;  5GP9 A;  3MN2 A;  1ZGW A;  2Y0S N;  3Q0W A;  2ZB9 A;  2L0K A;  5IP9 J;  2R5Y B;  5C3E J;  4S0H B;  4C2M J;  1QVU A;  3G1L A;  2R5Y A;  2HXI A;  4A3D J;  5M3M J;  5E3O A;  1MBJ A;  4NDL A;  1IG7 A;  3IH4 A;  3RZO J;  1F43 A;  1TWH J;  3MVP A;  5EG0 B;  2N8G A;  4BY1 J;  1LFB A;  5EG0 A;  5EF6 A;  4UUS B;  1SFO J;  3BR3 A;  1ETY A;  2R5Z B;  4UUS A;  2HI3 A;  2R5Z A;  2EH3 A;  3A03 A;  2K40 A;  2ME6 A;  5E3L A;  3GTP J;  3CCY A;  2O8K A;  2M9H A;  1ZQ3 P;  1WI3 A;  3C2B A;  2GBY A;  3A01 B;  5EZG A;  3JRD A;  3HGY A;  1Z77 A;  3O8H A;  2PMZ N;  1SAN A;  3Q0U A;  3A01 A;  1JGG A;  2H1K A;  2XGE A;  4XK4 A;  3CMY A;  4C3H J;  4MLO A;  4BBS J;  3BR6 A;  5F04 A;  3ZQF A;  2HOA A;  4W1U A;  3TP0 A;  5M5Y J;  4CYC B;  4BBR J;  2XPW A;  2Y9Y A;  3HGG A;  4XRS A;  4A3M J;  1AU7 A;  1FJL A;  4HNV A;  2X48 A;  5IOY A;  4CYC A;  4D5C A;  2DMN A;  5C44 J;  1JUS A;  5K7F A;  2COB A;  3GTO J;  3HOW J;  4JX5 A;  3L1P A;  3PO2 J;  3OSF A;  1JT6 A;  4FIS A;  4EEF G;  2EQR A;  3NAU A;  3I4M J;  2CQQ A;  5F0F A;  4IHX A;  3FIW A;  5EEA A;  2MSY A;  2HOT A;  3OIO A;  3B6C A;  4LOC A;  2AHQ A;  2EZK A;  2JMW A;  2XGD A;  2LY9 A;  1K61 A;  4JP0 A;  2P81 A;  1D5Y A;  3IV5 A;  4DW6 A;  2ELK A;  3K7A J;  2XPU A;  2VPR A;  2X6O A;  2M34 A;  4MO7 A;  4MFD A;  1CQT A;  5M3F J;  4B1R A;  5IP7 J;  4DYR A;  2ECC A;  1ETK A;  1HLV A;  1POG A;  2E19 A;  3UKG A;  1LE8 B;  1RKW A;  4A3I J;  3S1Q J;  1LE8 A;  1GT0 C;  3W6V A;  4A3G J;  1JUM A;  5IYC J;  1JTX A;  2XRL A;  3RQI A;  2DA7 A;  4M3E A;  3GBG A;  1MBH A;  2M0C A;  2K9S A;  2K9N A;  2QCO A;  1AHD P;  3M3Y J;  4A3C J;  1APL C;  2XB0 X;  3QPL A;  2XSD C;  3GTJ J;  4X1E A;  1IV6 A;  4A3K J;  2EZH A;  1HDP A;  2DMT A;  4D5F A;  1T56 A;  3IH2 A;  1FTZ A;  4AYB N;  4M3B A;  3HDD A;  2M2E A;  2R92 J;  1RR7 A;  5K7Z A;  1R9T J;  3BTL A;  1HDD C;  2HQ5 A;  1IRZ A;  4XRM A;  2HDD A;  1T33 A;  1I6H J;  3F0C A;  4D7M A;  2Y31 A;  2DN0 A;  2M8G X;  1VND A;  5JLW A;  3HOV J;  1BJZ A;  2MG4 A;  1QVT A;  5EZH A;  2NVQ J;  1F36 A;  4W97 A;  3SDG A;  2WAQ N;  1HOM A;  3PM1 A;  5F27 A;  2ECB A;  1U78 A;  1JJ6 C;  2FX0 A;  4I76 A;  1K83 J;  2JWT A;  3A02 A;  3JRB A;  3HOZ J;  1GUU A;  5DS9 A;  2LVS A;  2AO9 A;  2XGC A;  5E3N A;  1PUF B;  1ETQ A;  5IYD J;  3SJM A;  3E7L A;  1PUF A;  2DA2 A;  4A69 C;  4B3A A;  1W0T A;  2Y2Z A;  1TWG J;  3S1R J;  2NOG A;  5FLV A;  5C4J J;  4FCY A;  1JT0 A;  1UG2 A;  2ME0 A;  1HCR A;  2G0E A;  1FEX A;  5EYR A;  1RES A;  1FIP A;  1BW6 A;  2Y30 A;  3S2D J;  5M5W J;  2O7O A;  1IDY A;  3BR5 A;  4QTR A;  2K9Q A;  2R0Q C;  2KT0 A;  2OF7 A;  1WGX A;  5JLX A;  2R93 J;  1MBF A;  3BG5 A;  3BG3 A;  2ID6 A;  3HOX J;  5FKN A;  4DYC A;  2MW8 A;  2H8R A;  1VI0 A;  1TWF J;  3QQA A;  5FLM J;  2JA7 J;  1Y1V J;  3JRH A;  3CQZ J;  3WHC A;  2FQ4 A;  2I10 A;  1H88 C;  3BG9 A;  4GFB A;  5DTD A;  3LSJ A;  3K2A A;  4M3F A;  3HEF A;  3D1N I;  4BKX A;  1GDT A;  1G2H A;  4M3G A;  2NVX J;  3TW7 A;  2YS9 A;  2LLK A;  1MSE C;  4BY7 J;  3HB9 A;  1A6I A;  3HBL A;  3LSR A;  4V2F A;  2VKE A;  4JYK A;  4A93 J;  4DYQ A;  1I50 J;  1OCP A;  2LFB A;  3TED A;  5J1Y A;  1X2N A;  3FIS A;  1DU0 A;  2MGQ A;  2CUF A;  1P7I A;  2E1O A;  4MIM A;  3B6A A;  2X9D A;  2HXO A;  5F1J A;  1OJL A;  2LKX A;  2HOS A;  5J1R A;  3HOY J;  4QIW N;  1ETW A;  5IPA A;  4FE4 A;  4XRS G;  1JJ8 C;  2YU9 J;  3SFI A;  2W48 A;  4I6Z A;  1O4X A;  1Q1V A;  2VI6 A;  1RPW A;  1NTC A;  1DU6 A;  2E2H J;  4B4C A;  3TP3 A;  4A3L J;  4QSH A;  2YUS A;  2LP0 A;  2Y9Z A;  2FJ1 A;  2GLO A;  3LNQ A;  2WV1 A;  1BA5 A;  3G1M A;  4IHY A;  2CQX A;  3S14 J;  2XPV A;  2CUE A;  4Y52 J;  3BTC A;  4G12 A;  4FTH A;  2VKV A;  1JKP C;  4JX4 A;  1AKH B;  2JA8 J;  3RKQ A;  2JA5 J;  1AKH A;  2L7M P;  3DEW A;  1QRY A;  1BW5 A;  2DMP A;  4RBO A;  1IC8 A;  3BT9 A;  1MBG A;  3LSG A;  2CRG A;  5J1U A;  5K7H A;  1U9O A;  5EGO B;  2R7Z J;  2LK2 A;  1VFC A;  3G1O A;  5EGO A;  1YRN B;  3Q3S A;  2EZL A;  1YRN A;  1Y1W J;  2FD5 A;  3LSP A;  3GTL J;  3ZQG A;  1JKQ C;  3BTJ A;  4JX6 A;  1QPI A;  3S17 J;  3WHB A;  2DA4 A;  3NAR A;  1ETO A;  2DJN A;  2NS8 A;  3HKZ N;  3BQY A;  3S2H J;  3GTM J;  3FK7 A;  1BL0 A; 
#chains in the Genus database with same CATH topology
 3BOQ A;  4B09 A;  3CLQ A;  4L0Z B;  3MWM A;  4HPQ A;  4XIC A;  1UMQ A;  1HST A;  1VTN C;  2E2I J;  2O9L A;  1GV5 A;  1R49 A;  2XAQ A;  2EIK H;  2W7N A;  3RYP A;  5AIQ A;  5FKK A;  4IX7 A;  4Q5S F;  1P6R A;  3D5S C;  3CJN A;  3OY9 A;  4LIT A;  3IL2 A;  4HX4 A;  1X58 A;  3FKJ A;  3JRE A;  1BC8 C;  3MKL A;  5IP6 A;  4BE1 A;  5DM6 F;  2GM4 A;  1W1W E;  4HQM A;  3PIO F;  5JHU A;  1SVM A;  4N9I A;  3P9C A;  3LAJ A;  5IT9 Z;  3DBH B;  3T5X A;  3QPS A;  2WTE A;  1TT0 A;  2E7W A;  3CTA A;  4GYG A;  1E3O C;  3GEZ A;  2O5R A;  1NG7 A;  1S72 I;  1XGN A;  3OYM A;  4CUG A;  3L09 A;  4QLC U;  1G6N A;  2FNA A;  1ZHF A;  3CDL A;  2ZO4 A;  4HW0 A;  4UUT A;  2VE9 A;  3ZQ7 A;  4HV6 A;  1FY7 A;  2Y0S A;  3LST A;  3RDI A;  3GX4 X;  4EJU A;  5GTI C;  2KZG A;  2JQ7 A;  1WPK A;  1JUP A;  4O3M A;  2GXA A;  1XSX A;  1KZH A;  1O3Q A;  2L7F P;  3HM5 A;  1EV7 A;  1IV8 A;  1V5F A;  4GYI A;  4KIC A;  1FLI A;  4OMZ A;  1V5G A;  2XVC A;  5D5W B;  3WTW C;  3K70 D;  4AD9 A;  4F55 A;  1QBJ A;  1ZRE A;  2VJ5 A;  4MEX F;  3CD6 I;  1ZTR A;  5DUK A;  3LL7 A;  2JUC A;  1P7J A;  4OWR B;  1ZYR F;  2HYJ A;  4LLN A;  4S05 A;  4RDU A;  5KAI C;  3S32 A;  5LHH A;  2X6X A;  1R58 A;  5K5O A;  2WB1 N;  4HZF A;  1WJA A;  4IQ4 A;  3M9A A;  2H6C A;  2VUM J;  3GUD A;  1Y39 A;  1FP2 A;  4BAC A;  4IHW A;  2DT7 B;  3A2K A;  3S2W A;  1YFH A;  3LSI A;  2M3A A;  3CJT B;  2IVM A;  2L7K A;  1RRJ A;  1M1E B;  2ZJQ F;  2QEX I;  1PJR A;  4ZDL A;  2LD5 A;  3M4O J;  5FD6 A;  1MBE A;  2DTZ A;  4IOA F;  1WWX A;  3WTZ A;  2A61 A;  4C3I J;  3JR9 A;  2Z33 A;  2ADU A;  2ZBK A;  4XLN F;  1LFU P;  3ERE D;  4ZYE A;  1OCZ H;  2ZME B;  4UVB A;  3VDX A;  1SFX A;  1P92 A;  2Q2E B;  1MH4 A;  3NRV A;  4FE7 A;  3VYT B;  5B5E C;  3ZP5 A;  3C2G A;  2ZME A;  2QSF X;  2Q2E A;  1W0U A;  3R61 A;  4HLY A;  2EA2 A;  4HOB A;  2O61 A;  1EF4 A;  2I8D A;  3W2W A;  1MSF C;  1LDK B;  4WWC A;  1MJB A;  2LF8 A;  1QQI A;  3BWG A;  3K70 C;  2DXI A;  1V4R A;  2HKO A;  1NG6 A;  3BR1 A;  2CH0 A;  4U0W A;  2JT1 A;  3DF8 A;  1XD7 A;  2LC2 A;  4MEY F;  4XOT A;  3M8J A;  4UV9 A;  1TBX A;  2A5Y B;  4L9V A;  2XB5 A;  5FKO A;  1WSU A;  3H0D A;  3DQV C;  4XN0 A;  3PNT A;  1ETV A;  4BL0 B;  2DMU A;  1D1A A;  3B02 A;  1BIB A;  3ZGK A;  4BQO A;  1VQK I;  1G59 A;  1PVE A;  1ZGW A;  1U3E M;  2IS6 A;  3I54 A;  2L0K A;  5IP9 J;  3DTE A;  4XSX F;  4MHG A;  4C2M J;  5TJJ A;  1QVU A;  2HXI A;  3WG7 H;  4A3D J;  2JRT A;  4BXU A;  4NDL A;  3GLL A;  1IG7 A;  2IGM A;  5FRO A;  1F43 A;  2IA1 A;  1SFU A;  1WJD A;  4M9X A;  4LG3 A;  3OWT A;  3RSN A;  4IQJ A;  2JPC A;  3E5X A;  1JHH A;  2P8T A;  2WBM A;  2HI3 A;  2KLO A;  2WY7 Q;  1SFE A;  3ULQ B;  1ZG1 A;  1FYL A;  2K40 A;  2ME6 A;  2M87 A;  3CCY A;  3V7R A;  3BLY A;  3HTU A;  3Q9S A;  3WE2 A;  5CVV A;  3HGY A;  4WX9 A;  1Z77 A;  3O8H A;  4L5I A;  1SAN A;  1X1B A;  3GYH X;  1JGG A;  5FRM A;  2OBP A;  1Q1H A;  1P4X A;  5DM7 F;  2CWE A;  2ACJ A;  4BBS J;  5BPI A;  4WK8 F;  4HX7 A;  2HOA A;  1B9N A;  1MKM A;  2HS5 A;  4W1U A;  4RB2 C;  3K4J A;  1AU7 A;  2XPW A;  4R8H A;  2DOD A;  4XRS A;  5LHI A;  2X48 A;  2V79 A;  4DIQ A;  3O2P E;  1W5C C;  4ENN A;  2G7H A;  2DMN A;  3P7N A;  3W6J B;  1QA6 A;  2FNP A;  3L7W A;  4BJT A;  1MGT A;  3M8E A;  1JUS A;  5K7F A;  4ZZD A;  3OOP A;  2FBH A;  1OCO H;  3PFY A;  4NC8 A;  3PO2 J;  2O3F A;  2QA4 I;  3CMA I;  3RCO A;  3W2V A;  3OSF A;  2O6G E;  5LGU A;  1JT6 A;  1R7J A;  1FOK A;  1J7K A;  4L5J A;  2Z16 A;  1DQU A;  2H09 A;  4YII A;  2E36 A;  2M0M A;  4ESB A;  2W00 A;  2O0Y A;  3B6C A;  5BMZ A;  2K27 A;  1OYW A;  3IHU A;  4PGG A;  3RKY A;  2IS4 A;  4YEJ A;  3QU3 A;  2NVU B;  1R22 A;  3F72 A;  2I5U A;  4JP0 A;  2QGU A;  2R7F A;  1WFX A;  1D5Y A;  4DW6 A;  3WU1 B;  3M07 A;  3KET A;  2ZCW A;  2HYG D;  1GXP A;  1V5E A;  1FPQ A;  2VPR A;  4PCQ A;  1FYK A;  1K7A A;  3H36 A;  3J80 Z;  5IP7 J;  4KT5 C;  1H9T A;  3TL4 X;  5JI6 A;  3HXL A;  4DYR A;  3E5U A;  3K1P A;  1ODD A;  3HOT A;  2OQR A;  2Z9O A;  1RKW A;  3VOD A;  3LQR A;  3JTH A;  3R60 A;  4A3G J;  3WTS C;  5TRD A;  3R6S A;  5KK1 A;  4GXO A;  2VOP A;  4FT8 A;  2LKP A;  2ESN A;  1R36 A;  4WXC A;  4M3E A;  1MBH A;  3FXQ A;  3IP4 B;  4LLL A;  2VN2 A;  3EET A;  5HS8 A;  1ERD A;  2K4J A;  4I09 A;  4F7Z A;  3BJ6 A;  2QQ8 A;  3KLO A;  4L9N A;  2ZJ2 A;  4XRF A;  2R7V A;  4X1E A;  4N4N B;  2HTS A;  1T0F A;  4A3K J;  3BCB A;  2DMT A;  5A2Q K;  2WV0 A;  4YFN F;  4AYB N;  3KZZ A;  2MAB A;  4U7D A;  3HSR A;  1EH7 A;  1N25 A;  1IRZ A;  3CP2 A;  3H35 A;  1Z05 A;  3IRQ A;  4GRI A;  3CDH A;  2OUM A;  1WJ5 A;  4CCO A;  1I6H J;  3F0C A;  3NEU A;  2LY1 A;  2BY0 A;  5JR3 A;  1WVR A;  3I9V 2;  2QEN A;  5KCM A;  2LBF B;  2DFE A;  2M7B A;  2W57 A;  2MG4 A;  1QVT A;  2LBF A;  1OLT A;  3X2Q H;  4ZTJ A;  3WTV C;  4RB1 A;  2WAQ N;  4XKV A;  1LVA A;  1U5T C;  3J7A Y;  3PM1 A;  1WJF A;  5F27 A;  4BU2 A;  2PLY A;  1R5G A;  3ABL H;  2VON A;  3HOZ J;  1GUU A;  3K4B A;  3KP7 A;  2XGC A;  3QU6 A;  1ETQ A;  1VQL I;  5IYD J;  1IZ1 A;  2P7C B;  3CMM A;  1R6R A;  1ZGA A;  1WHU A;  3WU2 C;  1W0T A;  3G71 I;  4Z2Y A;  3U21 A;  2NOG A;  3HTS B;  4FCY A;  5DEQ A;  4WF2 A;  1Z67 A;  3OR1 C;  4EV0 A;  1UAA A;  3CDI A;  4E7K A;  1LDJ A;  3S2D J;  4YG2 F;  3IKV A;  4P5O A;  5M5W J;  4QTR A;  2EFN A;  1W5S A;  1WZ2 A;  4I7H A;  3CCJ I;  3K1M A;  2MA3 A;  2E1M B;  1DGR M;  2EIM H;  2KT0 A;  5J40 A;  1D3Y A;  2WC2 A;  2R93 J;  3RPQ A;  1MBF A;  3BG5 A;  1TQM A;  5FKN A;  4DYC A;  2MW8 A;  4LLG F;  2HVR A;  2OC6 A;  5FLM J;  3LQQ A;  2JA7 J;  2XV4 S;  1YJN I;  2FQ4 A;  4OIQ F;  1FSH A;  5DTD A;  3LSJ A;  1N78 A;  3I59 A;  3GF2 A;  3K2A A;  1LUJ B;  4RS8 A;  1GDT A;  4M3G A;  2NVX J;  3TW7 A;  2XKP A;  4CH7 A;  3J7Y J;  1XDS A;  4CZC A;  3HB9 A;  2L4M A;  3HBL A;  4LB6 B;  1XX5 A;  4A93 J;  2M1B A;  1BI0 A;  1FOX A;  3U9G A;  1TL8 A;  2QBY B;  3FIS A;  3OS2 A;  1DU0 A;  4UVC A;  3OYE A;  1J59 A;  1P7I A;  5IT3 A;  2QBY A;  2E1O A;  3ML6 A;  4EJO A;  2F4M B;  5J8F A;  2K86 A;  2WWY A;  3LA3 A;  3P5J A;  2HOS A;  5F1R A;  3SZT A;  1LNW A;  3ABM H;  1L3L A;  2GQQ A;  4QIW N;  1BN5 A;  5IPA A;  4XRS G;  4EVI A;  1MDM B;  2YU9 J;  4N9H A;  3L2R A;  2W48 A;  2KJB A;  4G7H F;  1Q1V A;  1MDM A;  1RPW A;  1NTC A;  2VBX A;  2ELH A;  4AIH A;  2LP0 A;  1P4A A;  2VC0 A;  3OL3 A;  2WV1 A;  1A36 A;  2HOE A;  3OYG A;  2PQ8 A;  2KMU A;  4IHY A;  1XN7 A;  3CP8 A;  2M30 A;  2XPV A;  5TGT A;  1ZRD A;  4A0Z A;  4G12 A;  4UHT A;  3WGG A;  3W3C A;  4IOC F;  1B9M A;  4KMF A;  1IO2 A;  3E6B A;  3RJP A;  2AQF A;  4ZYG A;  4EAT A;  2JA8 J;  3OYC A;  2P6T A;  2FEZ A;  2JA5 J;  1SD4 A;  2HU9 A;  4A0Y A;  4AIJ A;  3FWE A;  3HRM A;  1IC8 A;  4BE2 A;  2RC4 A;  4LJZ F;  5J1U A;  5K7H A;  2JVH A;  3RPU A;  2LK2 A;  1F9N A;  3T0Y A;  4CO8 A;  1ON2 A;  3Q3S A;  1IXC A;  2EZL A;  1Y1W J;  2FD5 A;  2WB1 A;  2IS2 A;  2KRF A;  2XDV A;  3BTJ A;  5JVG F;  1X1P A;  2E7X A;  4CHU A;  2CFO A;  1YIJ I;  2V1X A;  4JX6 A;  5ICC A;  3TO6 A;  2IS1 A;  1AOY A;  3WHB A;  2FUG 2;  4M6X A;  5D5X B;  4RLQ A;  4U88 A;  2MLG A;  1ETO A;  3HKZ N;  3FM3 A;  1YW8 A;  4I99 C;  2R7X A;  3F8M A;  5HNH A;  3M8F A;  4N4O B;  1FMV A;  2W84 A;  1BL0 A;  3CO7 C;  1XPX A;  2BGC A;  1PP8 F;  3ZQH A;  1DP7 P;  1ZKG A;  3QP5 A;  1K4T A;  1D1C A;  1X1D A;  2CW0 F;  1REP C;  1IXS B;  4I0B A;  5GAD J;  2L01 A;  2B63 J;  4XN3 A;  2VPL A;  5J4Y A;  2YX7 A;  3KZI C;  3BG7 A;  3DTI A;  5E8G A;  3LMM A;  4E4H A;  1OR7 A;  4LG0 B;  1WH5 A;  4IRI A;  2L9R A;  2VXZ A;  2GA1 A;  3BTI A;  4LG0 A;  4HLX A;  1YG2 A;  1EH6 A;  2DMQ A;  4BYY A;  4H4K C;  4A3J J;  2STW A;  1BR2 A;  4P1W A;  2CSO A;  4A3F J;  1XG1 A;  3CUO A;  4RGX A;  3GZN B;  2GZW A;  2LR8 A;  2RRE A;  5E8I A;  3O3K A;  4BQQ A;  3S16 J;  2JJ7 A;  3QWL A;  1U9N A;  2NNY A;  2EZI A;  2E35 A;  2V6C A;  2JSP A;  2MD5 A;  2OPT A;  2DA6 A;  4EGZ A;  1H0M A;  4BHP A;  4A6E A;  3MQ0 A;  1XC5 A;  4P9U A;  5HOD A;  5CQG A;  3KYL A;  1ZG5 A;  2VOD A;  1MH3 A;  2LTP A;  1AA7 A;  4MFE A;  1H8A C;  3LA7 A;  3CCE I;  1QO0 D;  3P9K A;  4PK4 A;  4XL9 A;  5HOO A;  3J81 K;  1I27 A;  4Y7N J;  4H0E A;  1K79 A;  2F5E A;  2JA6 J;  1RUN A;  1S7A A;  1LDD A;  4KIF A;  5HLT A;  2OU2 A;  1NK2 P;  1RKT A;  3DBL B;  2HQR A;  3I3L A;  3LOC A;  5J3L A;  4AC0 A;  3KEY A;  3QYF A;  2VQC A;  1PYV A;  5HNF A;  1ENH A;  1MD0 A;  2RDP A;  4MNU A;  3HPH A;  4A0X A;  5HDN A;  4BXX J;  4ZDO A;  1ZR2 A;  4XID A;  5JVT A;  4F91 B;  1I6X A;  1S8N A;  1J09 A;  4A12 A;  1LEB A;  3E5Q A;  4RM2 A;  1W4M A;  2ZSI B;  2KIF A;  3VYS B;  1IRX A;  5LGT A;  2LNB A;  3JRA A;  1YYV A;  1SAU A;  4HEA 2;  1G3Y A;  4EGY A;  1KU2 A;  1G3T A;  4A3E J;  2X6Y A;  4PJM A;  4U7B A;  2BVL A;  2EBI A;  2MC4 A;  2DA5 A;  5DYM A;  1TQP A;  3RKX A;  4ETS A;  5GPA A;  4MQ9 F;  3ZMV A;  2VQH A;  5DD4 A;  1E0E A;  4C2U A;  1O57 A;  2A69 F;  3I4N J;  4OIR F;  3ZQI A;  3OYD A;  1S6L A;  4NNJ A;  1XGO A;  4BJ6 C;  1W7P B;  2WAF A;  3S1M J;  3GME A;  1WRJ A;  1YLF A;  2Q8K A;  4BNC A;  1W7P A;  3AG4 H;  2KPM A;  1R71 A;  1UHS A;  4AU7 A;  1RUO A;  3A0B C;  1ZK8 A;  1MIJ A;  2V4J C;  4KIB A;  1I3Q J;  3SYT A;  4AVP A;  4AVZ A;  5DUI A;  5LEJ A;  1F4K A;  3GTG J;  2IAI A;  3AL0 B;  2NVT J;  3FMS A;  5BNG A;  2K3F A;  4HNT A;  1X3Z B;  2DYS H;  2QVO A;  4E6K G;  2FU4 A;  4G7Z F;  4RB3 C;  2V6E A;  2CJJ A;  1GLN A;  3RZD J;  2KDO A;  3GTQ J;  2VXD A;  2D5V A;  2LYC A;  4KN4 X;  1LVK A;  2R7W A;  4B43 A;  3HOS A;  5LFA A;  2AS5 F;  1GV2 A;  4M73 A;  2P0W A;  4UXN A;  1X19 A;  4Q48 A;  5FFZ A;  1SMY F;  3MN2 A;  5GAE J;  1HBX G;  3Q0W A;  2FOW A;  5FFX A;  4Z6Y A;  4BGD A;  2VAS A;  2ZC2 A;  2DQR A;  3GCM A;  2DAO A;  2L2O A;  3MVP A;  1QZY A;  5EG0 B;  2CV0 A;  4BQN A;  4EMS A;  4A6D A;  5EF6 A;  5EG0 A;  3MZ8 A;  4UUS B;  1ULY A;  1OYY A;  5L3E A;  2R5Z B;  4DBQ A;  3TGN A;  3RPU D;  4UUS A;  1FOW A;  4XM3 A;  1LFP A;  2BXY A;  1RZ4 A;  2O8X A;  4C9Y A;  2R7Q A;  2R7R A;  2R5Z A;  1TP4 A;  3A03 A;  1FP1 D;  4CIC A;  1BI2 A;  2O8K A;  1YJ9 I;  1LPQ A;  1KU7 A;  1HKT A;  2GBY A;  3A01 B;  1USS A;  1OKR A;  2QSG X;  3BDD A;  5ILV A;  2ZFU A;  2PMZ N;  3Q0U A;  1NH3 A;  2ZXJ A;  3A01 A;  3OYI A;  5HLI A;  1HSJ A;  1IW7 F;  3NQO A;  3TOA A;  4AYB A;  4MLO A;  5F64 A;  3BJA A;  2DPD A;  2X1C A;  5F04 A;  3TP0 A;  2XRO A;  4CYC B;  2X4H A;  4K2E A;  4DGW B;  2H27 A;  2ZFW A;  4CYC A;  4D5C A;  3PQJ A;  4NC7 A;  2IA2 A;  5C44 J;  2DFF A;  1ZH5 A;  3R0A A;  5J47 A;  4BH9 A;  5K1Y A;  2XF5 A;  3HOW J;  3GZ5 A;  4RLF A;  5H6Q A;  2WAQ A;  2CQ7 A;  1RR8 C;  3NWT A;  1YW7 A;  2LRE A;  2A05 A;  2EQR A;  3CJR B;  4HNU A;  2QQB A;  3FF5 A;  3KYD B;  3IRR A;  3I4M J;  2CQQ A;  3WU0 A;  3FIW A;  1YS6 A;  3EUH C;  2AHQ A;  4NBQ A;  3JW4 A;  2CV1 A;  3CCS I;  1K61 A;  2CO5 A;  4OIP F;  1ZRF A;  2ZXW H;  4G8X A;  1BR1 A;  1QGP A;  4G94 A;  2ELK A;  2RKH A;  4LIU A;  2EPF A;  1A6Q A;  2KP6 A;  2HNH A;  4N0B A;  5AON A;  1CQT A;  3MMY B;  5D4R A;  2ECC A;  4KA4 A;  1ETK A;  3F3X A;  2QLZ A;  4JK1 X;  4RGR A;  2DFH A;  3S1Q J;  1L0O C;  4PFP A;  2KRH A;  4J01 A;  4E7S A;  1JTX A;  2XRL A;  3FBN B;  3ISP A;  2DA7 A;  4UB6 C;  2PN6 A;  2M0C A;  5ILS A;  4FQG A;  5LD2 C;  2E1N A;  3SZP A;  5BOX A;  4XOR A;  2ZXH A;  3ZPL A;  4YFK F;  4RGS A;  2FE3 A;  4Y4R A;  1SD7 A;  3DBR B;  3GWZ A;  4RB0 A;  2OCE A;  2XSD C;  4BQA A;  3TDZ C;  1IV6 A;  3QPH A;  1HDP A;  2KJC A;  1KGS A;  4B47 A;  1SAX A;  2R7T A;  4IRH A;  2R92 J;  1RR7 A;  1R9T J;  4X0G A;  3S3M A;  2OTJ I;  1RNL A;  4XRM A;  3E6M A;  2ZJR F;  2QZ8 A;  3U1D A;  5JLW A;  4HAM A;  2W1O A;  3OYK A;  2ZSH B;  3HSE A;  2P7V B;  1T98 A;  2ZKZ A;  3BJO A;  3SDG A;  1W7P D;  3ZQQ A;  1HOM A;  2AXL A;  4EM0 B;  2A5W A;  3OS1 A;  1U78 A;  3G4S I;  2KIS A;  2GOX B;  4CXF A;  2CG4 A;  3AG1 H;  3KLN A;  3CC7 I;  4BDZ A;  2AO9 A;  2VT3 A;  1F5T A;  2WY8 Q;  2CMP A;  4Y33 A;  1PUF B;  3R0J A;  2E5Z A;  2XF7 A;  2P6S A;  1PUF A;  4A69 C;  4B3A A;  2LG4 A;  3S1R J;  2MYS A;  5C4J J;  1JT0 A;  1UG2 A;  4PZJ A;  4YRV A;  2G0E A;  3KCC A;  3PQK A;  1RES A;  2D45 A;  5FB2 A;  2EV0 A;  1KON A;  3FHZ A;  1IDY A;  4XR6 A;  2EA4 A;  2KRC A;  4ZDP A;  2ZNY A;  5CVJ A;  4RGU A;  1O3R A;  5FLX K;  4PUS A;  3PSI A;  2R0Q C;  2E60 A;  2OF7 A;  5JLX A;  4HF2 A;  1Z3Y A;  3FMQ A;  5E18 F;  3BG3 A;  2ID6 A;  4E7J A;  3M1E A;  1KA8 A;  2XUB A;  1T39 A;  2H8R A;  3IUO A;  1O3S A;  1G3S A;  2OZ6 A;  4JQF A;  2VOO A;  3OYB A;  3HKZ A;  3GW2 A;  3CQZ J;  3LWF A;  1S29 A;  4UY8 I;  2I10 A;  1H88 C;  4XNF A;  1TNT A;  3H5R A;  2CS3 A;  1J0R A;  3D1N I;  5KAF C;  2M4G A;  3MZY A;  3AAF A;  4XLH A;  4MTE A;  4YEL A;  3JAM Z;  1R00 A;  2YS9 A;  3EPZ A;  2DDA A;  3KEO A;  3UNG C;  2VKE A;  3N05 A;  2OCC H;  1VQ4 I;  4M9Z A;  5BPD A;  4R1H A;  1I50 J;  3FXO A;  1X2N A;  3OL4 A;  2LF7 A;  5H2F C;  2CUF A;  2MC3 A;  1ZLJ A;  3V42 A;  3AL0 C;  2F5D A;  3KP4 A;  2R7U A;  5HDK A;  1W5T A;  2BBY A;  4PSW A;  4G6D A;  3ZCO A;  2HXO A;  4OMY A;  5F1J A;  3H3U A;  2LKX A;  4CA0 A;  1QZE A;  1VQ5 I;  2NS0 A;  3VFZ A;  3HOY J;  2HQN A;  3L2U A;  4PGH A;  2NRA C;  5BQT A;  1YO5 C;  1MND A;  4A2U A;  3ESW B;  1UHW A;  2VI6 A;  3KX2 A;  1DU6 A;  1XTA A;  4B4C A;  3CCV I;  3TP3 A;  4XKW A;  4A3L J;  2YUS A;  2MFZ A;  2F6C A;  2FJ1 A;  2GLO A;  3BRO A;  3LNQ A;  2IGO A;  3BZK A;  4KFC A;  3HG9 A;  1BA5 A;  5EEG A;  3G1M A;  3IAM 2;  2CQX A;  3ERM A;  2CUE A;  2FF4 A;  2VKV A;  1JKP C;  5D8K B;  3BZ6 A;  3MZH A;  3RKQ A;  3QAH A;  3VEP A;  4BJ5 C;  1TTY A;  1A35 A;  2GOM A;  2X6W A;  3DEW A;  2DBB A;  1QRY A;  2DMP A;  2L4A A;  4LK0 F;  3OYJ A;  3SHF A;  1YS7 A;  3CCM I;  1MBG A;  4ENJ A;  1I1S A;  4CZZ A;  2CRG A;  4ZYH A;  3CC4 I;  2COM A;  3NWS A;  3EYY A;  2QUF A;  3ECO A;  1OYI A;  5CKT A;  4YIF A;  3GTL J;  3ZMT A;  1LEA A;  2DW4 A;  2UV1 A;  3S17 J;  3LSH A;  1R4M B;  4ASN A;  3S3N A;  2OD5 A;  5ERI A;  4J00 A;  1OMI A;  3RI4 A;  1G4D A;  2HR3 A;  2DJN A;  3EUK L;  2NS8 A;  2VJI A;  3KPH A;  2DK8 A;  3S2H J;  3WTT C;  2AQE A;  3GTM J;  4HYE A;  1BM9 A;  3FK7 A;  1A31 A;  1O7F A;  3FXL A;  1UEL B;  2DU9 A;  5BS6 A;  3ABU A;  1GVD A;  3MCZ A;  4ESJ A;  2DA3 A;  2RAE A;  2HWV A;  2V9K A;  3E3V A;  3M7G A;  1XMK A;  1RI7 A;  3K10 A;  1U2W A;  1FZP B;  2HQA A;  4I01 A;  1SVL A;  3OYH A;  3DKX A;  1UZC A;  2XHK A;  4X6A J;  3A0H C;  2Y75 A;  5E1W A;  1GXQ A;  2DQL A;  4UV8 A;  4G6Q A;  3PFI A;  4ZYD A;  5DCM B;  2HPM A;  1ZR4 A;  3MEX A;  1WCM J;  5DCM A;  3F21 A;  1BI3 A;  4ZJZ A;  1ETX A;  4HST A;  1S9H A;  3VPR A;  2XAG A;  2A6T A;  1VQ9 I;  1MBK A;  4L5E A;  1Y0U A;  1YE9 A;  5DV5 A;  2QQ9 A;  3ZOB A;  1R1T A;  3W2A A;  1X2M A;  2M45 A;  1P2F A;  3DCF A;  1FYM A;  3I59 B;  2XAJ A;  2P5L C;  1ZLK A;  1FOY A;  4XMY A;  1JKO C;  4UNO A;  1W36 D;  9ANT A;  2PFB A;  1J9I A;  2GIZ A;  1VF9 A;  1CF7 B;  1YHQ I;  2CGP A;  3V8L A;  5C4X J;  4C30 A;  1A5J A;  4XON A;  2PJR B;  3HIF A;  1CF7 A;  2ZME C;  2H6B A;  2B0L A;  5EEH A;  2BVM A;  2HVQ A;  1U8B A;  2PJR A;  3H5A A;  3I56 I;  1FIA A;  4Y3O A;  5IT9 K;  1OQY A;  3HHG A;  2C6Y A;  4WXD A;  3PL8 A;  3ECH A;  2VL8 A;  2XSJ C;  5FGM A;  3MFK A;  3OOU A;  2Z99 A;  4IKF A;  3FM5 A;  3ZMS A;  2MH2 A;  4CCL A;  3E6C C;  1LJ9 A;  5IYB J;  5HS9 A;  1XMA A;  2DO7 A;  5B1B H;  4A5N A;  5M5X J;  4ENM A;  4B3X A;  4M71 A;  4M3D A;  1SVO A;  1TZL A;  1D0X A;  3HC7 A;  3TW6 A;  2IEK A;  3JRF A;  5FKM A;  1IF1 A;  4E7L A;  3HOU J;  2VQL A;  4BXF A;  2JN6 A;  2TRT A;  4F93 B;  4A3B J;  1GVJ A;  1JHF A;  2W25 A;  1TLH B;  3HSF A;  1B72 B;  3IC7 A;  2BOL A;  2QF7 A;  5GTH C;  1B72 A;  2R3S A;  3JRC A;  1ZN2 A;  3K0L A;  3F8N A;  3BQZ A;  2M4K A;  1H89 C;  2V9P A;  3OSG A;  1XSV A;  4OU0 A;  2IXS A;  3KEQ A;  3S3O A;  4IHV A;  2D1H A;  4HF1 A;  2JK3 A;  3Q0V A;  3GTK J;  1FTT A;  2W4S A;  3LSM A;  4HG2 A;  1PP7 U;  5F08 A;  3BCA A;  1TWC J;  1ZAR A;  4FX0 A;  2XAH A;  1HXD A;  5FJ8 J;  1BR4 A;  4M72 A;  2GWR A;  2VT2 A;  1MMS A;  2LSO A;  4WCG A;  1EA3 A;  2CU7 A;  3ASO H;  3IH3 A;  3QYB A;  4E70 A;  5J6X A;  1TT5 B;  4XKC A;  5GPC A;  4QWQ A;  1E3P A;  2BZT A;  3PUF A;  1B8I B;  3K4C A;  3G2B A;  1B8I A;  4M6V A;  1G8X A;  2B7E A;  4FET A;  3CLO A;  5HVQ C;  1TC3 C;  1JTY A;  2KIM A;  2DA1 A;  2FQ3 A;  3BR0 A;  3BZC A;  1QPM A;  2LY2 A;  1KYZ A;  1UJ8 A;  4RAY A;  2VKH A;  2HGC A;  2BEO A;  2OAZ A;  3I55 I;  2ZB9 A;  2R5Y B;  1SEU A;  2XRN A;  4S0H B;  1J5Y A;  4XLE A;  4L9J A;  2R5Y A;  1UCR A;  1Y8Q B;  2W24 A;  5E3O A;  4DJA A;  1MBJ A;  4CCK A;  3FXU A;  3A1Y A;  3IH4 A;  5D6E A;  2N8G A;  5CVI A;  3K69 A;  1LFB A;  2V9V A;  4MQV A;  3K2Z A;  2E34 A;  5KHD A;  2A6H F;  2GA2 A;  1ZAO A;  3GFI A;  2LOO A;  2EH3 A;  1F1Z A;  3GFM A;  4RAF A;  5GAG J;  3ABK H;  3GTP J;  2L9V A;  2PMH A;  2L9N A;  3EYI A;  2M9H A;  3DP7 A;  3K4M A;  2IPQ X;  3RIR A;  1ZQ3 P;  1TQI A;  2OTL I;  3C2B A;  2MLK A;  5EZG A;  4NB5 A;  3JRD A;  1D0Z A;  3F8B A;  2CW8 A;  3MKW B;  1WQ2 A;  2XGE A;  4JOM A;  4XK4 A;  3CMY A;  4C3H J;  2Z3Y A;  1DGW Y;  4KIS A;  2FA5 A;  3LFK A;  2Y48 A;  3BR6 A;  4KJZ A;  3ZQF A;  3DKY A;  4IVN A;  2WA0 A;  2VKD A;  4PSX A;  4EM2 A;  5M5Y J;  4D1Q A;  1I3A A;  4BBR J;  3AFH A;  1FJL A;  4HNV A;  1JE8 A;  3G73 A;  2H94 A;  2DOF A;  3B73 A;  3RKW A;  5E79 C;  4GDF A;  4XLP F;  2X85 A;  4OAZ A;  4RMN A;  2E71 A;  5K5Q A;  3GTO J;  1IAW A;  3ABT A;  1YX5 A;  3L1P A;  4U0V A;  2GIV A;  1LKX A;  3DEU A;  3COA C;  2HZD A;  4FIS A;  3TO9 A;  4ZTF A;  2DK5 A;  2VBY A;  4PDK A;  1S7O A;  2EIJ H;  2D2W A;  2X0L A;  3VWB A;  1T0F C;  3DU5 A;  2BY1 A;  2K02 A;  1B59 A;  4GGG A;  1X1C A;  5EEA A;  3GZ6 A;  1YTY A;  1YIT I;  4L0Y B;  4LK1 F;  4HQE A;  1T8I A;  1WI9 A;  1IN5 A;  2D1V A;  2MSY A;  2NAZ A;  3OIO A;  2HOT A;  3J7A O;  4LOC A;  4II2 A;  3WG9 A;  4CGZ A;  2EZK A;  2XGD A;  2LY9 A;  4I98 B;  4P9F A;  3MKY B;  3RQ4 A;  1YX3 A;  4OOI A;  3WTX C;  4EJW A;  2EFO A;  1V54 H;  3TDU C;  3IV5 A;  1QZZ A;  4KUM A;  2ELJ A;  3HZJ A;  3K7A J;  3WE3 A;  2XPU A;  3DTK A;  3H9Q A;  4BAY A;  4F52 A;  3WTU C;  1D8J A;  2X6O A;  2M34 A;  4MO7 A;  4B1R A;  2DJI A;  4IJA A;  3I4P A;  1B6A A;  5A2Q Z;  4LD5 A;  1HLV A;  5K5R A;  2E19 A;  3H92 A;  1LE8 B;  5TIS C;  2EIN H;  1D5V A;  5JFR A;  1FX7 A;  2AXT C;  2R7O A;  1GT0 C;  1LE8 A;  3W6V A;  3M1C A;  3J7Z I;  5IYC J;  3C18 A;  2YX4 A;  4HBL A;  2EFQ A;  4BEH B;  2VLA A;  2QKL B;  2DPU A;  4FAS D;  2FSW A;  4BEH A;  4LGW A;  2K9N A;  4OIN F;  1AHD P;  5LRR A;  3WTY C;  3M3Y J;  4ZC3 A;  5LGN A;  2UXX A;  4A3C J;  1Z1D A;  2ZJP F;  3IAS 2;  2EK5 A;  3QPL A;  2O03 A;  3REO A;  1G3W A;  1IRF A;  2JPB A;  3DXJ F;  4FX4 A;  3J80 K;  1VQ7 I;  3S93 A;  2F4I A;  4D5F A;  3I58 A;  2RN7 A;  4HX8 A;  4UVA A;  2JUG A;  2STT A;  5K7Z A;  3FBI B;  2RQQ A;  1HDD C;  2HQ5 A;  1OCR H;  2PJP A;  4S04 A;  4FHT A;  2HDD A;  1T33 A;  3V7S A;  2E1M C;  2CV2 A;  3KP6 A;  4D7M A;  1J2X A;  4LMY A;  2Y31 A;  2DN0 A;  2W82 A;  2IW5 A;  3SXY A;  2M8G X;  4HV5 A;  1FMW A;  1TW2 A;  3HOV J;  2VJ4 A;  4HF0 A;  3VYU B;  2UXN A;  3S8P A;  1HQC A;  2MD0 A;  3LA2 A;  1ON1 A;  2LH9 A;  2M7A A;  1Z7U A;  3CC2 I;  3ZMZ A;  4UUV A;  1JJ6 C;  2JWT A;  3A02 A;  3GLX A;  1KYW A;  5DS9 A;  3CUQ B;  2LVS A;  2K3P A;  4QPO A;  3IWF A;  3CUQ A;  3QOD A;  5L3G A;  1ZG3 A;  5CVU A;  1IRG A;  2Y0M A;  2EJR A;  3ZRG A;  2K9M A;  1VZ0 A;  2CYY A;  2HKX A;  5B66 C;  3A4C A;  1HCR A;  2ME0 A;  3KFW X;  1FEX A;  5EYR A;  2F5C A;  1FIP A;  5FO5 A;  1I1G A;  2FMY A;  4XLA A;  3OMY A;  5D8L B;  2O7O A;  2JZY A;  4EM1 A;  3K6G A;  1BOA A;  3SFZ A;  2HTJ A;  1FBQ A;  2NOJ B;  2K9L A;  4B8X A;  3H5N A;  3V7C A;  1SD5 A;  1WGX A;  4TV7 A;  3SQN A;  2DYR H;  3KYC B;  4KIG A;  1HA8 A;  2ESH A;  5DCF A;  2FBI A;  2OZU A;  3HOX J;  3SEZ A;  3E97 A;  1RIO H;  2VE8 A;  1XGS A;  3QQA A;  4GCV A;  3SDB A;  1Y1V J;  3IKT A;  5D6F A;  2L3D A;  3JRH A;  1U5T B;  3F8C A;  2R7D A;  4IF4 A;  4GFB A;  3I0T A;  1U5T A;  2K5C A;  2M8E A;  3SZG A;  2CW7 A;  3ZMD A;  1BI1 A;  2XGX A;  1STZ A;  3I5U A;  4BY7 J;  2PI0 A;  2KIU A;  2L02 A;  4XQF A;  3LSR A;  1MMN A;  3HUG B;  4V2F A;  5ICF A;  3E1S A;  3HUG A;  4DYQ A;  4A5M A;  1BOB A;  5FD5 A;  5J1Y A;  4ZZL A;  5E1Z B;  3L2Q A;  3WGH A;  4NUB A;  3CZ6 A;  4Q47 A;  1YOV B;  3B6A A;  2X9D A;  4IXA A;  1HW1 A;  2ETH A;  3FMR A;  5CJ9 A;  1Y6I A;  1OJL A;  1N75 A;  2L5Q A;  1I5Z A;  3L2V A;  2E1C A;  1VQO I;  1ETW A;  4RAG A;  1JJ8 C;  1K4S A;  3CF2 A;  3KZY A;  1LQ1 A;  1O4X A;  1Y8R B;  2E2H J;  1O3T A;  3QYE A;  4KIT B;  5D5V B;  2BV6 A;  3MD2 A;  1XB4 A;  4BS9 A;  3U1K A;  4I2O A;  5L3B A;  3S14 J;  1X3W B;  2JA2 A;  3L00 A;  3HRU A;  3BY6 A;  4FTH A;  3V8J A;  2HEO A;  4JX4 A;  2HDW A;  4EQQ A;  2XIG A;  3PNV A;  5J4V A;  3G3Z A;  5HS7 A;  4Y17 A;  2PX9 A;  1VQ8 I;  3JSO A;  3HRT A;  3BG6 A;  1OR7 C;  1DUX C;  1JI8 A;  1BC7 C;  1WJB A;  2BE5 F;  1TNS A;  3BT9 A;  4PJL A;  3LSG A;  2IGN A;  5EGO B;  2UUZ A;  2R7Z J;  4E7H A;  4KMU X;  4EJV A;  1VFC A;  3G1O A;  5EGO A;  4HDU A;  3UR3 C;  2R7S A;  3DLA A;  4YIR X;  3ZXS A;  1SFK A;  3LSP A;  4ZH4 F;  3ZQG A;  2KHM A;  2V1U A;  1JKQ C;  1BBY A;  1X4P A;  3CCQ I;  4I02 A;  4M74 A;  2DA4 A;  3HPG A;  4XLF A;  2JTV A;  2J5P A;  2QYO A;  4WXH A;  1QNT A;  3VB2 A;  3ROU A;  1IUY A;  3H3Z A;  3K4N A;  4MTD A;  1DDN A;  3ASN H;  4DOZ A;  3U2R A;  3FXM A;  1U0J A;  2K4B A;  1JXS A;  4OAY A;  4NQW B;  3WGI A;  1ZRC A;  4O5V A;  4XSZ F;  1JKR C;  4Q4Z F;  3LAP A;  4NQW A;  2QSH X;  3HYI A;  1D8K A;  2OA4 A;  4HSR A;  4UB8 C;  3JTG A;  3ZQC A;  1VQ6 I;  2KKO A;  3D5R C;  2RGV A;  4RA2 A;  5ED4 A;  1E2X A;  2NS7 A;  1ACI A;  3FKI J;  3Q9V A;  5E1X A;  2YPR A;  3E0J B;  3J81 Z;  3TQN A;  1KU3 A;  3DKW A;  1K78 B;  2P5K A;  3FDY A;  2NVY J;  1TWA J;  5GAH J;  2HPI A;  3KP5 A;  2QKM B;  3KIO A;  1NK3 P;  1K78 A;  1OCT C;  1IN7 A;  4D7N A;  3OIQ A;  5F0H A;  2RNJ A;  4C3J J;  1UG0 A;  1MNM C;  2PEX A;  2HYF A;  1X3U A;  1Z21 A;  3PO3 J;  3JRG A;  4AUX A;  3I64 A;  3O8G A;  2QQA A;  2KZV A;  1Z0X A;  2TCT A;  1IJW C;  1RC9 A;  2X51 A;  5EDN A;  3H3V K;  1R4N B;  3GFJ A;  1Z3X A;  3D0S A;  3HJE A;  2HFH A;  2JRM A;  1HKQ A;  1Y0N A;  3Q5F A;  1XCV A;  1OPC A;  1HF0 A;  4C2T A;  5B1A H;  2KDZ A;  2CUJ A;  4J19 A;  1K6O A;  2WAE A;  1IUF A;  3JSP A;  4E7I A;  1Z9C A;  2RNG A;  5ICE A;  1T38 A;  4B48 A;  4D9J A;  3N97 A;  5F0C A;  3H1C A;  2V7F A;  2NXN B;  1K6Y A;  1DPU A;  2J5O A;  5FKL A;  2H8W A;  4ITV A;  4DZP A;  2L7Z A;  1RET A;  3L2W A;  2IRF G;  3CJQ B;  3O6B B;  1OFC X;  3QPT A;  2X1D A;  3KP3 A;  3ZQL A;  3LSK A;  3OYN A;  5E20 A;  4CCM A;  1IXR C;  1MNE A;  3H0G J;  1Z6T A;  5D5U B;  1IN4 A;  2DLL A;  1AWC A;  1ITY A;  1HW5 A;  2X1E A;  2E2J J;  3LFU A;  4KNY A;  1IGN A;  1HW2 A;  1OIS A;  1ZGJ A;  3AKZ A;  2ICW G;  1UFM A;  3AG3 H;  4ABZ A;  3FK6 A;  4IPA A;  4II3 A;  3EQL F;  3H9G A;  1MZB A;  1R1U A;  1S7E A;  3L9F A;  2BW3 B;  3QRF F;  2DOA A;  2GAU A;  1CGP A;  4V19 K;  1XS9 A;  2BW3 A;  3DFG A;  1IDZ A;  2EFP A;  3BR2 A;  4RAZ A;  4L18 B;  3S15 J;  2OJE D;  5CLS A;  3MAJ A;  2F5F A;  2Z2S B;  4R79 A;  3S1N J;  1C0W A;  5IOZ A;  4KYW A;  4ENK A;  1LB2 A;  4DBR A;  3DPT A;  3PNY A;  5E3M A;  3OS0 A;  4BUP A;  2ID3 A;  3CUQ C;  2FXA A;  4V2G A;  3DWL E;  1WH7 A;  2K7L A;  2FOK A;  3T8R A;  1ORK A;  3C7J A;  4EJT A;  1FC3 A;  1R5I D;  2GXG A;  3FXK A;  2IGK A;  4IEJ A;  1HC8 A;  3JRI A;  3V8K A;  2F4O B;  1YW9 A;  2BY2 A;  2IBD A;  1X4O A;  5H6R A;  4DZJ A;  2IA0 A;  1BIA A;  4L9T A;  3OYL A;  1ONV A;  1D0Y A;  5GP9 A;  2Y0S N;  2PG4 A;  1EJ9 A;  5C3E J;  2Q0O A;  3SEQ A;  5DD8 A;  2KL4 A;  4KN7 X;  2EV5 A;  1FBS A;  3G1L A;  2FRH A;  5H20 A;  3OR2 C;  5M3M J;  1P4W A;  3P9I A;  3R4K A;  3QOP A;  3TO7 A;  3RZO J;  2G7U A;  1TWH J;  2FBK A;  5HLH A;  2P5V A;  2VBZ A;  2BHY A;  4BY1 J;  1YJW I;  3BC8 A;  4LFU A;  2DI3 A;  5DDG A;  1UHM A;  2G9W A;  2YSR A;  1SFO J;  2DCE A;  3BR3 A;  2P4W A;  1ETY A;  4G7O F;  2DTR A;  5KNL A;  1IN6 A;  3E6D A;  5E3L A;  2V1N A;  3IWZ A;  3FZV A;  4IL6 C;  3WOD F;  4KT6 A;  2A68 F;  1Y56 A;  1WI3 A;  4CSW A;  4XLC A;  4IO9 F;  2XAS A;  1FWZ A;  5AIP A;  2BXZ A;  5CPR B;  3TBI A;  4LB5 A;  1TW3 A;  5CVR A;  3TOB A;  4AIK A;  4HA8 A;  2H1K A;  1V3F A;  1YQA A;  1GHC A;  2OV7 A;  3OIP A;  4IHT A;  3V4G A;  2UZK A;  2ISZ A;  1FBU A;  5JHF A;  4G9Y A;  2F5V A;  5LRS A;  4A3M J;  3HGG A;  2Y9Y A;  2VC1 A;  3C3W A;  1A04 A;  5IOY A;  2RQP A;  2M5W A;  1MMA A;  5LLQ A;  2WAD A;  2COB A;  1VQP I;  5HDG A;  2HDC A;  1SMT A;  2DT6 A;  1B1B A;  4JX5 A;  2A07 F;  4PFO A;  1J75 A;  2EFW A;  4QPQ A;  2DFI A;  1VQM I;  4EEF G;  3NAU A;  2MH9 A;  5F0F A;  4LIV A;  4IHX A;  3ELK A;  3FX3 A;  2HVS A;  3K4K A;  3DU6 A;  3C1D A;  2RV8 A;  1EH8 A;  2CUZ A;  2FML A;  1MJ9 A;  2JMW A;  2PMZ A;  1I39 A;  3RTR A;  3CCR I;  3PJR A;  2UWM A;  3FXR A;  4KDP A;  2P81 A;  1SD6 A;  4ESF A;  5ILU A;  1NHA A;  4DQ2 A;  2K85 A;  1WJC A;  3PSF A;  5L3D A;  4AID A;  2XF6 A;  4I0A A;  4MFD A;  2A6E F;  2Z5U A;  5M3F J;  3CO6 C;  1T2K A;  1H9G A;  2VJJ A;  2V26 A;  3ZN1 A;  1POG A;  3UKG A;  3K4L A;  3HL2 A;  4A3I J;  3F9K A;  2LRD A;  3CCL I;  1JUM A;  3BPX A;  1W36 C;  2ZXI A;  3RQI A;  4ZYA A;  3T1B A;  3EUA A;  3GBG A;  3N4M A;  2K9S A;  3JCU C;  2KFD A;  3ONQ A;  4IZZ A;  2PBI A;  2QCO A;  4M9S A;  2EWN A;  2BYV E;  2XB0 X;  1APL C;  2MBF A;  3G6E I;  1S5L C;  2DT5 A;  4M6Y A;  5HLG A;  3GTJ J;  3VYR B;  1D1B A;  1QHH D;  2IT0 A;  2F48 A;  2EZH A;  3BPV A;  2XC7 A;  2CQN A;  1T56 A;  3IH2 A;  1FTZ A;  1HKS A;  1Z7L A;  2KQR A;  4M3B A;  3HDD A;  3EUH A;  1KQ9 A;  2HZT A;  1XMX A;  2Y69 H;  2M2E A;  4Y15 A;  2XAF A;  3L2C A;  5E17 F;  1SC7 A;  3CF5 F;  3BTL A;  1T6S A;  2VBW A;  4GO1 A;  2F2E A;  3D5L A;  3DPU A;  3OV8 A;  1MMD A;  3FXJ A;  4PJN A;  1R23 A;  1VND A;  3RYR A;  4HRI A;  1BJZ A;  5EZH A;  3W6K B;  2NVQ J;  3VSK A;  2L9S A;  1F36 A;  2ZNZ A;  4W97 A;  2NYX A;  2LKS A;  5CQE A;  3CME I;  3F23 A;  3T8T A;  5B3S H;  1E17 A;  4IRG A;  2ECB A;  5FLX Z;  4IHS A;  2FX0 A;  4I76 A;  1K83 J;  3PUB A;  1QHG A;  3JRB A;  1WJE A;  2XKO A;  1JGS A;  2GXB A;  1T95 A;  3QP6 A;  3OYF A;  5E3N A;  3PIP F;  2EV6 A;  3SJM A;  3E7L A;  2DA2 A;  1V55 H;  2KIQ A;  5L3F A;  2Y2Z A;  3K1N A;  1TWG J;  4XKB A;  5FLV A;  3BP8 A;  3CCU I;  2LDU A;  3HRS A;  3QOE A;  2LMD A;  3I71 A;  4DNC A;  1BW6 A;  3VSL A;  2Y30 A;  3GO5 A;  3DV8 A;  2IP2 A;  3KP2 A;  3BR5 A;  1DP3 A;  2K9Q A;  2JSC A;  2QM3 A;  4BE0 A;  4CCN A;  2ISY A;  4U87 A;  5L3C A;  2OQG A;  1MMG A;  1YI2 I;  2A3S A;  1EKE A;  1E3H A;  3ZR8 X;  4D0P A;  4F3Q A;  1VI0 A;  3F6V A;  1TWF J;  5ICG A;  3H9J A;  1R5H A;  1UST A;  2E5N A;  1U6G A;  1FNN A;  1MJA A;  4U0Y A;  3WHC A;  4AM3 A;  1XGM A;  3K9T A;  3BG9 A;  4F92 B;  2NNN A;  2R4G A;  4JBA A;  3EDP A;  4M3F A;  3HEF A;  3CES A;  4BKX A;  4CCJ A;  1G2H A;  2XAU A;  1R1V A;  3FHN A;  4RM3 A;  2BY3 A;  2LLK A;  1MSE C;  1A6I A;  1FT9 A;  4G6T B;  4JYK A;  4XBF A;  4NC6 A;  2Q1Z B;  4ON0 A;  4NHJ A;  1OCP A;  2LFB A;  3TED A;  2H1L A;  4MGR A;  2MGQ A;  4BHB A;  1YIO A;  4O6J A;  4MIM A;  2RVC A;  1UB9 A;  3C2H A;  4CDG A;  4XOP A;  3KE2 A;  1VQN I;  1B4A A;  2JVG A;  2CFX A;  4ANJ A;  3GFL A;  3VOE A;  1IN8 A;  1MW7 A;  3F22 A;  2CQK A;  5J1R A;  2W85 A;  2V1D A;  5LBQ A;  4P96 A;  1X1A A;  1KQ8 A;  1XCB A;  4FE4 A;  3SFI A;  2TDX A;  4I6Z A;  2PMU A;  1WKM A;  3DEE A;  3JAM K;  2L54 A;  4QSH A;  2Y9Z A;  2B9S A;  2QWW A;  4CYD A;  4BDY A;  1QU3 A;  1XSD A;  5IY5 H;  3F8F A;  2VQG A;  2YR2 A;  1KU9 A;  1Z6R A;  2VB6 A;  3BTC A;  4Y52 J;  4Y13 A;  5FRN A;  4AWX B;  3OYA A;  1DPR A;  3ZN0 A;  2BHZ A;  1AKH B;  4HDV A;  1AKH A;  2L7M P;  1BW5 A;  4RBO A;  3GVA A;  4PJJ A;  2VIX A;  2YU3 A;  4B44 A;  4OIO F;  1PDN C;  1ZEL A;  3F6O A;  5KVR A;  5D4S A;  2Z1D A;  1T08 B;  1U9O A;  4YFX F;  3MKZ A;  4PJ0 C;  3TMO A;  1YRN B;  5F6F A;  1OCC H;  1U8R A;  3ZMU A;  4E7Z A;  2EIL H;  1YRN A;  1P9Q C;  5LHG A;  5LEK A;  4P55 A;  3AG2 H;  1Z91 A;  2EB7 A;  5EJC A;  1BJA A;  3I53 A;  1O7L A;  3TKY A;  1KQ0 A;  2DOE A;  3HHH A;  1QPI A;  5J8C A;  1N77 A;  2DDB A;  3DPL C;  3NAR A;  4BHC A;  5CYV A;  3BQY A;  1PUE E;  3DLL F;  6PAX A;  1FSE A;  1S3J A;  2IJL A;  3GXO A;  1XDU A; 
#chains in the Genus database with same CATH homology
 4XIC A;  1GVD A;  1UMQ A;  3ZQH A;  2DA3 A;  2RAE A;  1JKR C;  2E2I J;  2O9L A;  1GV5 A;  1ZKG A;  5FKK A;  3ZQC A;  2B63 J;  2NS7 A;  3FKI J;  4X6A J;  1X58 A;  3JRE A;  1WH5 A;  3MKL A;  2L9R A;  3BTI A;  5IP6 A;  2GM4 A;  2NVY J;  1TWA J;  2DMQ A;  1NK3 P;  4A3J J;  1ZR4 A;  1OCT C;  4A3F J;  1XG1 A;  1WCM J;  4D7N A;  5F0H A;  2LR8 A;  3S16 J;  4C3J J;  1MNM C;  3QPS A;  1ETX A;  2JJ7 A;  1U9N A;  3VPR A;  2EZI A;  3PO3 J;  1MBK A;  4L5E A;  3JRG A;  2OPT A;  1E3O C;  2DA6 A;  4AUX A;  3O8G A;  5HOD A;  1XC5 A;  1Z0X A;  3ZOB A;  2TCT A;  1IJW C;  3CDL A;  1X2M A;  3DCF A;  4UUT A;  5EDN A;  3H3V K;  1MH3 A;  1JKO C;  2LTP A;  4MFE A;  1H8A C;  9ANT A;  1WPK A;  1JUP A;  1VF9 A;  1HF0 A;  2L7F P;  5C4X J;  4Y7N J;  1A5J A;  3HM5 A;  2JA6 J;  2KDZ A;  4J19 A;  1IUF A;  1U8B A;  1NK2 P;  1RKT A;  1FIA A;  5F0C A;  3LOC A;  5J3L A;  4AC0 A;  1ZTR A;  3OOU A;  5FKL A;  1ENH A;  1P7J A;  4DZP A;  4BXX J;  2L7Z A;  1RET A;  2HYJ A;  1ZR2 A;  4XID A;  1OFC X;  5IYB J;  4RDU A;  2WB1 N;  3ZQL A;  5M5X J;  4M3D A;  3H0G J;  3TW6 A;  2IEK A;  3JRF A;  5FKM A;  2VUM J;  1ITY A;  2E2J J;  3HOU J;  3JRA A;  1IGN A;  2JN6 A;  2TRT A;  4A3B J;  4ABZ A;  3FK6 A;  4A3E J;  1B72 B;  1S7E A;  2EBI A;  2QF7 A;  2DA5 A;  1B72 A;  3JRC A;  3M4O J;  2LD5 A;  5GPA A;  1MBE A;  3BQZ A;  1XS9 A;  2DTZ A;  1H89 C;  1IDZ A;  3JR9 A;  4C3I J;  3OSG A;  3BR2 A;  3S15 J;  3I4N J;  3ZQI A;  1LFU P;  4IHV A;  3S1M J;  1MH4 A;  4FE7 A;  2JK3 A;  3Q0V A;  3GTK J;  3S1N J;  1FTT A;  5IOZ A;  1W0U A;  5F08 A;  5E3M A;  1UHS A;  1TWC J;  5FJ8 J;  2ID3 A;  1ZK8 A;  1EF4 A;  1I3Q J;  3GTG J;  4V2G A;  1MSF C;  1WH7 A;  2IAI A;  2NVT J;  5BNG A;  2CU7 A;  3IH3 A;  1ORK A;  5GPC A;  4IEJ A;  1B8I B;  3BR1 A;  3JRI A;  2CJJ A;  3RZD J;  1B8I A;  4M6V A;  2IBD A;  2D5V A;  4IHW A;  3GTQ J;  5FKO A;  1JTY A;  2XB5 A;  1TC3 C;  2DA1 A;  3BR0 A;  4DZJ A;  1ETV A;  1GV2 A;  2DMU A;  5GP9 A;  3MN2 A;  1ZGW A;  2Y0S N;  3Q0W A;  2ZB9 A;  2L0K A;  5IP9 J;  2R5Y B;  5C3E J;  4S0H B;  4C2M J;  1QVU A;  3G1L A;  2R5Y A;  2HXI A;  4A3D J;  5M3M J;  5E3O A;  1MBJ A;  4NDL A;  1IG7 A;  3IH4 A;  3RZO J;  1F43 A;  1TWH J;  3MVP A;  5EG0 B;  2N8G A;  4BY1 J;  1LFB A;  5EG0 A;  5EF6 A;  4UUS B;  1SFO J;  3BR3 A;  1ETY A;  2R5Z B;  4UUS A;  2HI3 A;  2R5Z A;  2EH3 A;  3A03 A;  2K40 A;  2ME6 A;  5E3L A;  3GTP J;  3CCY A;  2O8K A;  2M9H A;  1ZQ3 P;  1WI3 A;  3C2B A;  2GBY A;  3A01 B;  5EZG A;  3JRD A;  3HGY A;  1Z77 A;  3O8H A;  2PMZ N;  1SAN A;  3Q0U A;  3A01 A;  1JGG A;  2H1K A;  2XGE A;  4XK4 A;  3CMY A;  4C3H J;  4MLO A;  4BBS J;  3BR6 A;  5F04 A;  3ZQF A;  2HOA A;  4W1U A;  3TP0 A;  5M5Y J;  4CYC B;  4BBR J;  2XPW A;  2Y9Y A;  3HGG A;  4XRS A;  4A3M J;  1AU7 A;  1FJL A;  4HNV A;  2X48 A;  5IOY A;  4CYC A;  4D5C A;  2DMN A;  5C44 J;  1JUS A;  5K7F A;  2COB A;  3GTO J;  3HOW J;  4JX5 A;  3L1P A;  3PO2 J;  3OSF A;  1JT6 A;  4FIS A;  4EEF G;  2EQR A;  3NAU A;  3I4M J;  2CQQ A;  5F0F A;  4IHX A;  3FIW A;  5EEA A;  2MSY A;  2HOT A;  3OIO A;  3B6C A;  4LOC A;  2AHQ A;  2EZK A;  2JMW A;  2XGD A;  2LY9 A;  1K61 A;  4JP0 A;  2P81 A;  1D5Y A;  3IV5 A;  4DW6 A;  2ELK A;  3K7A J;  2XPU A;  2VPR A;  2X6O A;  2M34 A;  4MO7 A;  4MFD A;  1CQT A;  5M3F J;  4B1R A;  5IP7 J;  4DYR A;  2ECC A;  1ETK A;  1HLV A;  1POG A;  2E19 A;  3UKG A;  1LE8 B;  1RKW A;  4A3I J;  3S1Q J;  1LE8 A;  1GT0 C;  3W6V A;  4A3G J;  1JUM A;  5IYC J;  1JTX A;  2XRL A;  3RQI A;  2DA7 A;  4M3E A;  3GBG A;  1MBH A;  2M0C A;  2K9S A;  2K9N A;  2QCO A;  1AHD P;  3M3Y J;  4A3C J;  1APL C;  2XB0 X;  3QPL A;  2XSD C;  3GTJ J;  4X1E A;  1IV6 A;  4A3K J;  2EZH A;  1HDP A;  2DMT A;  4D5F A;  1T56 A;  3IH2 A;  1FTZ A;  4AYB N;  4M3B A;  3HDD A;  2M2E A;  2R92 J;  1RR7 A;  5K7Z A;  1R9T J;  3BTL A;  1HDD C;  2HQ5 A;  1IRZ A;  4XRM A;  2HDD A;  1T33 A;  1I6H J;  3F0C A;  4D7M A;  2Y31 A;  2DN0 A;  2M8G X;  1VND A;  5JLW A;  3HOV J;  1BJZ A;  2MG4 A;  1QVT A;  5EZH A;  2NVQ J;  1F36 A;  4W97 A;  3SDG A;  2WAQ N;  1HOM A;  3PM1 A;  5F27 A;  2ECB A;  1U78 A;  1JJ6 C;  2FX0 A;  4I76 A;  1K83 J;  2JWT A;  3A02 A;  3JRB A;  3HOZ J;  1GUU A;  5DS9 A;  2LVS A;  2AO9 A;  2XGC A;  5E3N A;  1PUF B;  1ETQ A;  5IYD J;  3SJM A;  3E7L A;  1PUF A;  2DA2 A;  4A69 C;  4B3A A;  1W0T A;  2Y2Z A;  1TWG J;  3S1R J;  2NOG A;  5FLV A;  5C4J J;  4FCY A;  1JT0 A;  1UG2 A;  2ME0 A;  1HCR A;  2G0E A;  1FEX A;  5EYR A;  1RES A;  1FIP A;  1BW6 A;  2Y30 A;  3S2D J;  5M5W J;  2O7O A;  1IDY A;  3BR5 A;  4QTR A;  2K9Q A;  2R0Q C;  2KT0 A;  2OF7 A;  1WGX A;  5JLX A;  2R93 J;  1MBF A;  3BG5 A;  3BG3 A;  2ID6 A;  3HOX J;  5FKN A;  4DYC A;  2MW8 A;  2H8R A;  1VI0 A;  1TWF J;  3QQA A;  5FLM J;  2JA7 J;  1Y1V J;  3JRH A;  3CQZ J;  3WHC A;  2FQ4 A;  2I10 A;  1H88 C;  3BG9 A;  4GFB A;  5DTD A;  3LSJ A;  3K2A A;  4M3F A;  3HEF A;  3D1N I;  4BKX A;  1GDT A;  1G2H A;  4M3G A;  2NVX J;  3TW7 A;  2YS9 A;  2LLK A;  1MSE C;  4BY7 J;  3HB9 A;  1A6I A;  3HBL A;  3LSR A;  4V2F A;  2VKE A;  4JYK A;  4A93 J;  4DYQ A;  1I50 J;  1OCP A;  2LFB A;  3TED A;  5J1Y A;  1X2N A;  3FIS A;  1DU0 A;  2MGQ A;  2CUF A;  1P7I A;  2E1O A;  4MIM A;  3B6A A;  2X9D A;  2HXO A;  5F1J A;  1OJL A;  2LKX A;  2HOS A;  5J1R A;  3HOY J;  4QIW N;  1ETW A;  5IPA A;  4FE4 A;  4XRS G;  1JJ8 C;  2YU9 J;  3SFI A;  2W48 A;  4I6Z A;  1O4X A;  1Q1V A;  2VI6 A;  1RPW A;  1NTC A;  1DU6 A;  2E2H J;  4B4C A;  3TP3 A;  4A3L J;  4QSH A;  2YUS A;  2LP0 A;  2Y9Z A;  2FJ1 A;  2GLO A;  3LNQ A;  2WV1 A;  1BA5 A;  3G1M A;  4IHY A;  2CQX A;  3S14 J;  2XPV A;  2CUE A;  4Y52 J;  3BTC A;  4G12 A;  4FTH A;  2VKV A;  1JKP C;  4JX4 A;  1AKH B;  2JA8 J;  3RKQ A;  2JA5 J;  1AKH A;  2L7M P;  3DEW A;  1QRY A;  1BW5 A;  2DMP A;  4RBO A;  1IC8 A;  3BT9 A;  1MBG A;  3LSG A;  2CRG A;  5J1U A;  5K7H A;  1U9O A;  5EGO B;  2R7Z J;  2LK2 A;  1VFC A;  3G1O A;  5EGO A;  1YRN B;  3Q3S A;  2EZL A;  1YRN A;  1Y1W J;  2FD5 A;  3LSP A;  3GTL J;  3ZQG A;  1JKQ C;  3BTJ A;  4JX6 A;  1QPI A;  3S17 J;  3WHB A;  2DA4 A;  3NAR A;  1ETO A;  2DJN A;  2NS8 A;  3HKZ N;  3BQY A;  3S2H J;  3GTM J;  3FK7 A;  1BL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...