1X4OA

Solution structure of surp domain in splicing factor 4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
GSSGSSGKVSPPEDEEAKNLAEKLARFIADGGPEVETIALQNNRENQAFSFLYDPNSQGYRYYRQKLDEFRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Splicing factor 4
publication title Solution structure of SURP domain in splicing factor 4
rcsb
source organism Mus musculus
total genus 16
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1x4oA00
1UG0A 1X4OA 2DT6A 2DT7B 2E60A 4DGWB 1X4PA 2E5ZA
chains in the Genus database with same CATH superfamily
3FF5A 1R4NB 4AIJA 4XR6A 1YTYA 2KZVA 2R7QA 4GCVA 2X4HA 4FT8A 3RSNA 3PM1A 2WAQN 2HTSA 2H8WA 2PFBA 3U1DA 4CH7A 5B66C 1R49A 4HV5A 3DPTA 3MKZA 2VODA 1G3YA 2XPUA 2VQCA 4YRVA 2KP6A 4ENMA 4ETSA 3KETA 4PSWA 3VDXA 4UNOA 1RUOA 2E2JJ 2DOEA 4EGYA 4JBAA 2V1DA 4XIDA 2Y48A 2HDWA 3DTEA 3HKZN 4A3MJ 3DP7A 3TW6A 1SFEA 1Z7UA 4D1QA 3JRIA 3CCYA 3WU2C 1H9TA 2EA2A 2JZYA 4L18B 2DMNA 2M87A 3UKGA 4CHUA 5D8KB 3DQVC 1UHWA 3TW7A 2Q8KA 1BJAA 3GMEA 1W7PB 2HKOA 4HDUA 3ZQQA 2L01A 1WFXA 3HRUA 5DYMA 4M74A 3Q5FA 3ZN1A 1ODDA 1I27A 1S3JA 2B9SA 1PYVA 1L3LA 1MGTA 3ECHA 2PX9A 1E17A 4E4HA 3AAFA 1T98A 4FTHA 2O8XA 3C2HA 3H5RA 3RKXA 4NHJA 3JAMZ 1JT6A 2JA8J 3S16J 4AU7A 4XSXF 3IAS2 4UUSA 2DJNA 1IGNA 1ZKGA 1U5TB 3PQJA 3OYDA 3S1RJ 1VQ4I 2JA6J 2EFOA 2VB6A 3F0CA 1HXDA 4FQGA 2XGCA 4JOMA 1J9IA 2DMPA 4ESFA 2C6YA 4XOPA 2ZBKA 3FXLA 1WJEA 3REOA 3C2BA 2X1EA 3K70C 4A69C 4ZTJA 2JUCA 1TQMA 2QA4I 2LC2A 3WGHA 1SVOA 1N75A 2ZXWH 5HNHA 1O57A 5JR3A 4D5CA 1MBJA 3D5RC 4IXAA 2V9VA 1P2FA 2E7XA 3KE2A 1YS6A 2EH3A 2M7AA 4JYKA 4J00A 1WJBA 2E7WA 3D0SA 1IXRC 1DGWY 5EEHA 5EZHA 3IHUA 4HQEA 2KISA 4MEYF 4IHSA 3M07A 4U0WA 5BOXA 1MJAA 3HIFA 5DUKA 3ASOH 3CUOA 1R23A 1IN4A 3O6BB 2V1XA 1QNTA 1IV8A 2FBIA 1HDDC 2HOAA 2GIZA 3L2QA 4HNUA 2VJ4A 5FD5A 2AS5F 5B3SH 3K0LA 2EFQA 3A0HC 5IOYA 3GYHX 2X48A 1OCCH 4I7HA 1XTAA 1EH6A 3WE3A 4G6TB 4BQQA 3DBHB 2E19A 2K27A 1GUUA 2P5KA 3MZYA 5LRRA 2NVTJ 1EF4A 3H3VK 5E20A 4BE2A 1HW2A 1YJNI 2FSWA 2CG4A 4LLNA 1H9GA 2E34A 2RDPA 2CQNA 3FXKA 2E60A 2CSOA 3VSKA 2K4JA 1T8IA 2XGDA 1O3QA 2FD5A 2MA3A 2VKHA 4NNJA 2HI3A 2R7XA 2VKEA 2DA2A 1V5EA 4P9UA 1DUXC 2M8GX 4AIDA 1L0OC 1VQNI 4D7MA 2ZSHB 2JSCA 1FMWA 4HF0A 1Z77A 2O6GE 4Q47A 3T0YA 1VQMI 3I59B 1HOMA 4Q48A 4RMNA 1P4XA 1FBUA 5GADJ 2CUFA 4BUPA 2HOTA 3J7AY 1D3YA 1JT0A 2IGOA 3QODA 2XAQA 4V2FA 3ZQFA 2P7CB 2XIGA 2J5OA 3HUGB 2A5YB 2RGVA 3FK7A 3JRDA 1SFUA 1R5GA 2XPVA 4YG2F 2EFPA 3S15J 3BR2A 1ITYA 1YX5A 2XAUA 3CP8A 1P4AA 5KAIC 5F0HA 1GVJA 4B43A 4PFPA 4UVBA 4DYQA 2NS7A 2D1HA 3S3NA 5EYRA 4F92B 3UNGC 1OQYA 3BR3A 1N78A 4XORA 2EZLA 3PNVA 4B1RA 2VN2A 2ZMEB 4CCLA 4RS8A 5FB2A 4EEFG 1ZRCA 2K7LA 4XSZF 5H6QA 5ICFA 2DODA 2D5VA 1Z67A 3GCMA 3D1NI 2IW5A 5J47A 3Q0WA 2OBPA 4XLPF 3M9AA 3DPLC 4Y52J 2BXYA 2E71A 1BW5A 3FISA 3JREA 3GLLA 3J81Z 4RAFA 3LA2A 5BS6A 3BQYA 3RYPA 5LD2C 3HSFA 3SZPA 4HA8A 5J4VA 1ENHA 3L09A 4G6DA 5DTDA 4A3LJ 4X0GA 4HRIA 2VE8A 4CXFA 5FKNA 1JUMA 3GFMA 4B09A 2HOEA 1E3OC 1KQ8A 1SMYF 1VF9A 2TCTA 4OU0A 1FEXA 4DBRA 3ZR8X 1F5TA 2HR3A 1K83J 1S6LA 3R4KA 3KP6A 3H9JA 3I5UA 2BVMA 1SAXA 3VFZA 3FM3A 1BOBA 3CUQC 4ZZLA 3GLXA 4Y7NJ 5ILUA 1U9NA 2W85A 3JCUC 4LG0B 4ZTFA 2OTJI 4HSTA 1BI2A 1SANA 4DYCA 3NQOA 3QQAA 4UUVA 1V54H 3MWMA 4DBQA 2NYXA 3SJMA 3O8GA 3P9KA 1T95A 3CC4I 3OYMA 1MH4A 2YPRA 2Y69H 1D0XA 1MBFA 4L5IA 1ETXA 1JKRC 1G3WA 2YSRA 1DU6A 4P9FA 2K85A 3WG7H 3CO6C 2FNPA 3D5SC 3ABUA 2IS2A 3GWZA 5A2QZ 1X2MA 3K4BA 3GZ5A 3W6JB 2DCEA 1XCVA 5GPCA 2HZDA 1KA8A 4HX4A 5L3GA 4V19K 3CCSI 2LNBA 4I0BA 2ELJA 3F6OA 2XASA 1W5CC 2WY8Q 1R4MB 5D4SA 1Z91A 2VJIA 2PJRA 4HNVA 1JTYA 2ZJ2A 3K2ZA 3HDDA 4KFCA 3ZQGA 2EWNA 1IRXA 1I3AA 3F8CA 1FWZA 1IRZA 3CDLA 3L00A 4FCYA 4PJJA 3G2BA 2AO9A 2BW3B 4G9YA 1KU3A 3W3CA 2FE3A 3MVPA 3M4OJ 5BQTA 5EGOB 1P7IA 3KP2A 3HM5A 2HQ5A 2VQHA 2KJCA 1IUFA 4JX4A 4ENNA 2ZXJA 4Y3OA 5L3DA 1OFCX 2DLLA 3I56I 3EUHC 4LB6B 1ZG5A 5B1BH 2JWTA 3K10A 1WGXA 3S2DJ 1HDPA 3NEUA 1O4XA 2IS6A 1Y0NA 1YG2A 4P96A 1LVKA 4LITA 3ZXSA 1X1BA 1Y0UA 2ISYA 5F04A 3MKLA 3SDBA 1TZLA 2MC4A 3CDHA 1HW5A 3RZDJ 5IT9Z 1ETVA 2KT0A 2OAZA 4WXHA 5D5WB 2Q2EA 1JHFA 4XLHA 5H20A 2QUFA 5GAEJ 3BTCA 1R58A 5ILVA 1RR7A 4BH9A 2O9LA 2HXOA 1S7AA 2NOJB 1U0JA 4PK4A 2V6EA 3Q0VA 2V26A 2MABA 4YIRX 5BPIA 2HEOA 1F1ZA 2Y9ZA 1JGSA 3O8HA 3ERED 2H09A 2XKPA 2M1BA 1B72B 2FU4A 3FMQA 1PP8F 1WSUA 1R1VA 1SD4A 4RM2A 4Y33A 5TJJA 4PJ0C 1VQLI 5HNFA 3B73A 1OLTA 4IRGA 5ILSA 1RC9A 5DCMB 3BOQA 2L5QA 2V1UA 3J80Z 3G1OA 3K4KA 1XGMA 4OIPF 4ZDLA 3TL4X 1WRJA 4F3QA 2UV1A 4IVNA 4EM0B 1W0UA 4ZDPA 3PIOF 2F4IA 1A6IA 4I09A 1YRNA 2ZCWA 4II2A 1AWCA 4A5NA 4IHVA 2BOLA 2LH9A 1QZYA 2P5VA 5HDNA 1TW3A 2H1KA 3GFJA 3DLAA 1A04A 2RNGA 2O61A 2ECBA 2Y0SN 4E7ZA 1TL8A 4R1HA 3OV8A 2HOSA 3QP5A 4M6VA 3BPVA 5FKMA 3KFWX 1XMAA 2MFZA 2VOOA 3NAUA 2LKPA 3JR9A 3OOPA 3KZYA 2DDBA 3IAM2 4H4KC 3GTMJ 3ASNH 1TLHB 5BMZA 2XPWA 4XLFA 3MCZA 4B48A 1I1SA 3WGIA 2EV6A 3H1CA 1FP2A 4I98B 5AIPA 1UHSA 1XSVA 1O3SA 3DXJF 5LHGA 3DU5A 1C0WA 2VONA 4BE0A 3L2UA 2HDDA 3S1MJ 2ZFWA 5TRDA 1FYMA 5HDGA 2LR8A 2FXAA 2QQ8A 2FMYA 2R5ZA 1QA6A 2IJLA 3RKWA 3OYCA 4W1UA 3GTGJ 4M3FA 2ZXHA 1PUEE 4P5OA 3CF5F 3MQ0A 2L9RA 1QRYA 3U2RA 2VPLA 1AKHA 5DUIA 2OQRA 5IP6A 1WH5A 2Y2ZA 3W2VA 2L0KA 3JRHA 1JGGA 1ZLKA 2PLYA 1IZ1A 2VJJA 3BG7A 4WX9A 3LSKA 4PFOA 2CQXA 1R22A 3W6KB 2EV0A 4AD9A 2WAQA 2BHYA 3PO2J 2PQ8A 1S7EA 2EZHA 2FF4A 2E36A 3K70D 3CCLI 5E3LA 4XN3A 1GXPA 2QQAA 4XL9A 3Q3SA 2QBYA 4J19A 1H0MA 3IRQA 1BI1A 2B0LA 5E8IA 2W48A 4G94A 3CDIA 2DFEA 1I3QJ 3QPHA 3S93A 3T8RA 4BY1J 4IRHA 1T0FC 3F8NA 1QQIA 4UV8A 1ACIA 1O3RA 4BXXJ 5J8FA 2QZ8A 5M5WJ 3R60A 4XM3A 3RPUD 5FLXZ 4I6ZA 4HLYA 1Z9CA 1QHGA 2GXGA 1HC8A 2OD5A 3P9CA 3DF8A 3T1BA 4C2MJ 2KIMA 3F8FA 4N4NB 5F1RA 1V55H 3F8BA 3WODF 4O6JA 1BR1A 4CUGA 1E0EA 3OYJA 3K1NA 1LDDA 5ED4A 5HS9A 2R0QC 3IP4B 3PUBA 1JUSA 1RNLA 1D8JA 3WTTC 1S72I 2DXIA 3ZMVA 2JA5J 1DPUA 1JJ6C 2ZJQF 2LBFB 1B4AA 2WWYA 2MW8A 2Q0OA 3FWEA 1LPQA 1G2HA 2N8GA 4OAZA 2O7OA 4CGZA 2DMQA 5JVGF 1W7PA 1P7JA 3QU6A 4PJMA 1YFHA 2OQGA 3JRBA 3CMYA 3PL8A 5DM6F 1UJ8A 1KGSA 4PJNA 3T8TA 3GFIA 5CKTA 5L3BA 3OYGA 4S04A 2IGMA 2WAEA 1V4RA 1FPQA 1MKMA 2DOAA 1WQ2A 3ZMSA 4F55A 4DOZA 3J7YJ 1LFBA 1N25A 2HYFA 1D8KA 1YW9A 3S14J 1K4TA 4ANJA 2PN6A 1YLFA 4RA2A 1D0ZA 5LLQA 2Z33A 3FKIJ 2K40A 1R9TJ 2O8KA 5E79C 2Y9YA 3K4NA 3GTJJ 1X1CA 2MLKA 1J5YA 1YOVB 3H3ZA 3G73A 2COMA 1MBKA 2Z1DA 4LK0F 4P1WA 4IHYA 3LAJA 1OR7C 3AG2H 2UWMA 2H6BA 3KP5A 4KICA 2R5YA 4RBOA 1I6HJ 1P6RA 3TOAA 5DV5A 3K7AJ 2CMPA 3M8JA 4G8XA 3FXQA 4MIMA 3KYLA 4GYGA 2IAIA 2W4SA 2IGNA 2MSYA 5EDNA 5EEAA 1P92A 3SZGA 5IP9J 4LJZF 2MH2A 3QAHA 3V4GA 2EPFA 4KT6A 5JI6A 1MNDA 4A0YA 5HS8A 1NG7A 2LSOA 1YI2I 2JSPA 2EJRA 3JTHA 1Z3YA 4E6KG 3ZN0A 4KISA 4KIGA 2I5UA 5EJCA 2HPIA 4C3HJ 3BR1A 3HL2A 4KMFA 5GPAA 3JRCA 2K3FA 1IJWC 2DYSH 2ZB9A 4CICA 2IA1A 5IY5H 2CRGA 5D6FA 3BG6A 3JW4A 1VQ9I 1JTXA 1UHMA 3BTLA 1QPIA 3A2KA 5CQGA 2PMHA 3TO9A 1G6NA 1HW1A 3I4PA 4LIVA 4P55A 1H8AC 2GLOA 1REPC 2GA2A 2NNNA 1B8IB 1T08B 2JTVA 2OC6A 3QWLA 1DDNA 5EEGA 2R7VA 1MMDA 3F9KA 4CYCB 3DU6A 4QPQA 2Y30A 2RAEA 3VYSB 2PMZA 2M30A 3LL7A 4D9JA 1Y56A 1ZK8A 5LGUA 3QPTA 2CWEA 4IL6C 1GVDA 3U9GA 4NQWA 3N97A 1B9MA 3RCOA 4QIWN 3TEDA 3V8KA 2JJ7A 1FYLA 2DTRA 2D2WA 2Z5UA 2DA4A 4KN4X 5F27A 4BEHB 3CQZJ 1NTCA 1Y8QB 2WY7Q 4BJTA 3CD6I 3G3ZA 2K9NA 1GLNA 1XC5A 1SVMA 3GTKJ 3H92A 4XKVA 3HUGA 3ECOA 3HPHA 2CV2A 1WVRA 2E5NA 1FJLA 3OIOA 2DDAA 4DIQA 5TISC 3GVAA 2B63J 1LKXA 3MKYB 4A3FJ 2Z99A 2ZJPF 2GM4A 4DGWB 2FRHA 4CZZA 2EILH 4XKCA 1X4PA 3I58A 4XKBA 1FY7A 4IEJA 3I3LA 3PJRA 1QGPA 3RQ4A 4C2TA 4KMUX 3GW2A 1YW7A 4BY7J 1JKOC 1OYYA 1WCMJ 1R71A 2KIUA 1W36C 4RB2C 1NG6A 2QSHX 1YE9A 1U3EM 4L5JA 1IN5A 2XUBA 3J7AO 2FNAA 5GAHJ 2E1OA 2M4KA 2JVHA 4ASNA 1ZGAA 4BACA 4FETA 3KEOA 2HPMA 4WK8F 1KYWA 3N4MA 2QQBA 5F08A 3K69A 1UAAA 2CJJA 1TBXA 2PBIA 1MH3A 3G4SI 4GGGA 1FZPB 2V6CA 5AONA 2Z16A 1BI3A 2KFDA 4I01A 2DTZA 2XC7A 2F5DA 2HTJA 1QU3A 4MTEA 3E5UA 3C2GA 2DA6A 2CV0A 2LYCA 2A6TA 4MFDA 1GDTA 2HQRA 4HNTA 2NXNB 4A3JJ 1BIAA 1JI8A 3LSTA 2IRFG 2M45A 3PUFA 2L4MA 1KQ9A 4UB6C 2MH9A 1D5VA 5D8LB 4CA0A 1Z6RA 2UZKA 2XF6A 3JRGA 1IDZA 4S0HB 1ZR2A 5IYBJ 4LD5A 2RQQA 4UV9A 2W57A 4F52A 2X1DA 4F93B 3I55I 6PAXA 1XDSA 2WV0A 3GUDA 4GFBA 4QSHA 4U7DA 4BYYA 3CCJI 2A69F 4YFKF 1H88C 5HDKA 2GZWA 5HOOA 2CQQA 2JA7J 4L9JA 3TQNA 3WU1B 1M1EB 1U6GA 4CDGA 5E18F 4DNCA 3EETA 4ZH4F 1ZAOA 3H0DA 3CCVI 1VFCA 5KCMA 4HEA2 4QTRA 1AHDP 5GTHC 1OKRA 4JX6A 2Z9OA 4RLFA 3S32A 1R7JA 3TO6A 1HCRA 2ZXIA 5FFZA 5L3EA 3CUQB 4A3IJ 2BW3A 2KRFA 2VOPA 4CSWA 1LB2A 5EGOA 2CU7A 2ZSIB 3R6SA 2CYYA 4A5MA 2ELKA 1Y39A 1D1CA 1Y1WJ 2A6HF 2XF5A 1FNNA 5GTIC 5C44J 2DOFA 1XPXA 2QLZA 2JQ7A 4EJWA 4XICA 1KONA 4LMYA 2AHQA 1A36A 2PMZN 1GV5A 3DEEA 3EYIA 4FX0A 5J6XA 1LVAA 1PJRA 2M4GA 2NNYA 3WHCA 2FBHA 4RLQA 1HKTA 1J2XA 4IO9F 2X1CA 3DBRB 4DW6A 4EM2A 1NH3A 3P5JA 2VBYA 4M9SA 5FO5A 2HYGD 3A02A 4S05A 5ERIA 1A6QA 2GBYA 4A12A 1E3PA 3MN2A 1TT5B 1WJDA 4D5FA 4BGDA 1POGA 4RB3C 1XS9A 3IL2A 3KX2A 4EGZA 1N77A 3NWSA 1MNMC 1B72A 1IUYA 1BIBA 2F5EA 5D5VB 3AG3H 4M6XA 5FJ8J 2W1OA 4XLCA 4ZDOA 1UB9A 3K4CA 1LEAA 4LLGF 3OYHA 2Y0SA 1RESA 2UUZA 2HGCA 3F3XA 4X1EA 1JJ8C 3DWLE 4E7HA 4RDUA 3OSGA 4JP0A 5IT3A 2X0LA 4HX7A 1I1GA 2IA0A 5BNGA 4HDVA 4R79A 3FXJA 2KKOA 4XOTA 2XGEA 4LOCA 4M72A 1JE8A 2X6YA 3EQLF 2VBWA 1BI0A 1GHCA 4BL0B 1K7AA 3RPQA 1ZHFA 3S1QJ 4L5EA 1Z7LA 2M34A 1WKMA 5FRMA 5C3EJ 3KIOA 3DEUA 3K2AA 4IF4A 5JHFA 1OJLA 2EK5A 3HPGA 2ID3A 1MDMA 2DA7A 3V7CA 4CO8A 2QEXI 5KNLA 1EA3A 2DA5A 5LRSA 1IG7A 2VXZA 2JRTA 1DQUA 2E1MC 2XAHA 3D5LA 1X1AA 4PUSA 4IZZA 1U8BA 4A0XA 2GOXB 3SHFA 3AFHA 4MLOA 1T2KA 2I8DA 3F23A 1I39A 3RZOJ 3FMRA 3G71I 2P7VB 2R7DA 2XSDC 5F6FA 3IUOA 3E6MA 1R1TA 3P9IA 5J1RA 3CP2A 2RNJA 4I2OA 3Q9SA 4E7SA 4YIFA 3WTXC 5DS9A 1W0TA 2LG4A 3HOWJ 5L3FA 2DQRA 3CESA 1BA5A 2F5CA 1PVEA 1OYWA 1VI0A 3BR0A 2OJED 5CVVA 4C30A 1E3HA 4ENKA 2VQGA 1HF0A 2HS5A 3BZKA 2VKVA 2QKMB 4A3GJ 3KP7A 2AXTC 2QQ9A 2ZO4A 2WBMA 3S2HJ 3DKWA 3EYYA 4I02A 2Z3YA 3OYIA 2VUMJ 2VT3A 2EIMH 3PSIA 1XCBA 2LY1A 3GXOA 4M3DA 2FBKA 2G7HA 1FOXA 2L54A 4C3JJ 3BP8A 4HOBA 2DYRH 5E3OA 2K9QA 1TP4A 3M1EA 3K1PA 1YJWI 1W1WE 3OYNA 5HVQC 4WF2A 3EUKL 1VZ0A 2YR2A 5LGNA 1JUPA 4OWRB 1BN5A 1XB4A 3M8FA 1H89C 3ZQ7A 3KP3A 4BXFA 3F22A 3DEWA 3QYEA 4HAMA 1WHUA 4BHBA 3L7WA 3QU3A 4NB5A 5DEQA 1K61A 2IPQX 3ZOBA 1XMXA 2EINH 2RREA 4MEXF 4A2UA 4LIUA 3BJ6A 2OA4A 2GQQA 1SD6A 3FX3A 1LE8B 1WJAA 4CCMA 3MZ8A 4BE1A 5EF6A 1ON1A 4KIFA 4M9ZA 1FTZA 5LEJA 4A3CJ 3LQQA 4DQ2A 3DTIA 4XKWA 2DA1A 4OOIA 3ZMDA 2PI0A 3KYCB 4NDLA 2G9WA 2LBFA 3C7JA 3LA3A 2DT5A 2DW4A 3TP3A 3KEQA 1VQOI 4EJVA 3C1DA 1HKQA 2QWWA 1OISA 4NUBA 4Y4RA 1RIOH 2LF8A 3HB9A 3IH3A 1X3ZB 4U88A 3C18A 3TDZC 1TWFJ 4TV7A 1S5LC 4KIBA 2KDOA 1JXSA 3BR6A 3U21A 3AL0C 1OYIA 1SMTA 2L7KA 1R1UA 5F0CA 2E5ZA 1Z3XA 1SAUA 3V7SA 4ZZDA 4E7JA 4EMSA 3OS0A 5DDGA 3LAPA 3JSPA 2K4BA 1EKEA 4GDFA 2OV7A 3OSFA 5FRNA 2F5FA 2X6XA 3I4NJ 3PIPF 5CVIA 2DPDA 4YIIA 1BBYA 1IXCA 3K4LA 3OS2A 3CF2A 2BV6A 2STWA 5HODA 4UVAA 2P4WA 2XAJA 1D1BA 2XAGA 3VB2A 4YFNF 1YYVA 3TBIA 4A3BJ 1F43A 2JA2A 2EIKH 3ML6A 3IV5A 1WZ2A 1VTNC 5DD4A 1WWXA 4YELA 4ABZA 1MMNA 3OWTA 1TW2A 1T33A 5CYVA 1W36D 4WCGA 1BR2A 3ABTA 2VE9A 3KCCA 3ZQCA 2WC2A 2W84A 3K4MA 2BEOA 2EIJH 3PFYA 1XGOA 3PNTA 4BBSJ 5FFXA 1P9QC 2GAUA 1X1PA 1QHHD 3LSRA 2VPRA 3V42A 2O3FA 4IHTA 2VT2A 5L3CA 3LNQA 3ULQB 2IA2A 1XMKA 1NK2P 3CC2I 3SFIA 4A6DA 2BY0A 2QSFX 1KQ0A 1LDKB 2EV5A 3DCFA 2E1NA 3FXOA 1QVUA 1BM9A 4PGHA 5JHUA 3FBIB 3ONQA 2WAFA 1OCPA 1ZELA 2LRDA 2PJRB 3DFGA 1EJ9A 3SDGA 2DAOA 2R7TA 5CPRB 2K9LA 3EPZA 3DLLF 4CZCA 2W82A 3L9FA 3HTUA 3CCQI 4G7ZF 1RPWA 1TWGJ 4YFXF 2EFNA 2MC3A 3BR5A 1EH8A 1IDYA 1TNSA 5HLTA 9ANTA 1XDUA 1JKQC 4CYCA 3PO3J 1S29A 4UY8I 4HQMA 4WWCA 4O5VA 2VC1A 3SQNA 1STZA 3BG5A 2A61A 3KPHA 2ZJRF 4AUXA 2QVOA 2WB1A 3SEQA 1RKWA 2ME6A 3CMEI 2ID6A 2NOGA 5FD6A 2QKLB 3JRFA 4N9IA 5B5EC 1LFPA 4JK1X 1D5YA 2EZIA 4WXCA 3TGNA 2Y0MA 3W2WA 3RKYA 2R7ZJ 3FK6A 1ZRDA 1IN8A 2YX4A 2VASA 5KAFC 2FOWA 4AC0A 1RI7A 3OYFA 3G6EI 4RAZA 2MG4A 3HGGA 4Y13A 2PG4A 2Q2EB 2CQKA 4EV0A 3AKZA 1XGSA 2IP2A 2JPCA 4FISA 1BW6A 3ZPLA 2A05A 2V9PA 3IKVA 1QPMA 1ORKA 4U87A 2V7FA 1ZARA 2D45A 3CO7C 3HC7A 1K79A 1BL0A 2EFWA 1V3FA 3ZQLA 2UXNA 5DCFA 5JFRA 3Q0UA 4MNUA 2F6CA 3H0GJ 3GTQJ 2K02A 4BAYA 3HSEA 2XHKA 1UMQA 2G7UA 3I64A 3LFKA 3H5NA 4JX5A 4KA4A 2CO5A 4RAGA 2STTA 2FOKA 1A35A 2E2HJ 1R00A 2FX0A 5LHHA 2P5LC 5J3LA 1YJ9I 1VQ8I 4B3XA 5LFAA 1ZRFA 1B9NA 2G0EA 3JSOA 3B02A 2F5VA 1XG1A 3KYDB 1Z0XA 3H3UA 3CC7I 1I50J 4HW0A 3MEXA 3FIWA 1KU2A 1S7OA 4LLLA 4EQQA 5E1ZB 2LY2A 4L9VA 2ECCA 3BZCA 1U5TA 2DK8A 4UUTA 3ROUA 2ADUA 2RV8A 2CW8A 3BZ6A 2JMWA 5DD8A 3F8MA 3QRFF 3VYRB 3U1KA 1MJ9A 1VQKI 3H5AA 2XB0X 3DBLB 3BT9A 2DFFA 2ZC2A 5K7FA 1RRJA 3ZCOA 1TWCJ 1G8XA 2COBA 2CW0F 3DKYA 3TOBA 3LSHA 4KITB 4A3EJ 2LKSA 3COAC 2AQEA 3BCBA 4GYIA 4DJAA 2LF7A 2W7NA 2IXSA 4E70A 3GO5A 1FTTA 1KYZA 4GXOA 2QF7A 1Q1VA 3J7ZI 1WI3A 3HHHA 4AWXB 2YU9J 3CJTB 3LSMA 3H35A 2PJPA 3TP0A 4BDZA 3B6CA 2LK2A 4IOCF 2NAZA 1SEUA 2YUSA 4L9TA 4OAYA 3MZHA 3FM5A 2DBBA 2RVCA 4RGSA 3E5QA 1TQIA 3RDIA 3DTKA 2GXAA 3WTUC 3A01B 1BOAA 2LVSA 2J5PA 4H0EA 2V1NA 4V2GA 3HOXJ 4XN0A 5ICGA 1XSDA 2R5ZB 1OCOH 2M8EA 3O3KA 2JN6A 4IPAA 1ZREA 2DI3A 3KZZA 4LFUA 1QZZA 1TQPA 1JHHA 3ERMA 3TMOA 1K4SA 2EQRA 5LGTA 4QLCU 2QYOA 1QVTA 2E2IJ 2WV1A 2A3SA 5K1YA 3HJEA 2HQAA 1Z21A 3ESWB 4NC6A 2EB7A 2NVUB 1LFUP 5K7HA 2L9NA 4PGGA 4MTDA 2OPTA 1F9NA 4QPOA 2LMDA 3ZP5A 4LGWA 2K3PA 3DPUA 1XD7A 3W2AA 5M5XJ 3HG9A 2MD5A 4BJ5C 3QPSA 1LJ9A 5M3FJ 2VC0A 2MBFA 3G1MA 2M9HA 4HF2A 1DP7P 4ON0A 2KRHA 4IJAA 4B44A 2QENA 3S17J 3I59A 3P7NA 4B8XA 4Q4ZF 1XSXA 1CGPA 2L7ZA 2KIQA 4BQAA 1MSEC 3M3YJ 5J4YA 3BTJA 3CCEI 3W6VA 3BG9A 2AQFA 3RYRA 3QYBA 3IWZA 3OR1C 1U9OA 2MLGA 1FMVA 3I71A 4GO1A 1G3SA 2M5WA 4PZJA 2LDUA 2O03A 3SEZA 2L2OA 2VKDA 2HVRA 1FP1D 2GIVA 1USTA 2DMUA 1J59A 2WB1N 5HLHA 1K78B 4BHCA 3R61A 1X58A 1FBQA 2JVGA 4MGRA 2K86A 4RM3A 4ZYEA 4IX7A 4M3EA 2Y75A 2OCCH 3BQZA 3JRAA 2JK3A 2DU9A 4BNCA 2BY1A 4A93J 1MBGA 3CMMA 1FSHA 1WJ5A 2CQ7A 2F2EA 2HXIA 4Z6YA 1MIJA 4NBQA 1PUFB 3QYFA 5FKOA 2CUZA 4BXUA 2DPUA 1TTYA 2Y31A 4HZFA 3VEPA 1MMGA 2ZMEA 4LK1F 4XLAA 5D4RA 4RAYA 4BDYA 4G6QA 2LD5A 1EH7A 4A3DJ 1RR8C 3WE2A 4II3A 1SFXA 1X3WB 3WTWC 4XLEA 3CJNA 1NK3P 1MJBA 4UHTA 4KYWA 2F48A 2XB5A 2BY2A 3IC7A 1QZEA 4K2EA 5J1YA 4B3AA 2X6WA 3EUHA 3QOPA 5JLWA 3L2WA 1LNWA 3CCUI 4IOAF 2A5WA 2XAFA 3M7GA 2XSJC 3IH2A 5KHDA 2M3AA 4XRSG 1VQ7I 2HQNA 3OIQA 1IF1A 3WGGA 2LY9A 4PSXA 4PCQA 1LDJA 2GOMA 1UCRA 3H9QA 3K6GA 3MFKA 1R5ID 3BTIA 1MMSA 2R5YB 3GTOJ 5H2FC 2KRCA 4E7KA 1GT0C 4LG0A 1HLVA 2LP0A 1ZLJA 4RB0A 5FGMA 2VXDA 5H6RA 2IT0A 3IKTA 1ZG3A 4MHGA 3RQIA 2ETHA 3BC8A 2FQ3A 3X2QH 3FZVA 3HBLA 1WI9A 3L2CA 3HOSA 2A68F 1T38A 3NRVA 2F4OB 2F4MB 4EATA 4C2UA 4KDPA 2DJIA 1YIJI 1CF7B 4HBLA 5F0FA 1Z1DA 4FHTA 1J75A 2CS3A 3VPRA 2WA0A 5EG0B 1FOWA 1GXQA 2FJ1A 5BPDA 1F4KA 4IQ4A 1T56A 3S3OA 1ZGWA 1FOYA 1FC3A 1XX5A 2HKXA 4BQNA 5C4XJ 1IRFA 3RTRA 4EJOA 2R7RA 2P6SA 2R4GA 2R93J 3FBNB 3CCMI 2ESNA 3I4MJ 3R0JA 5LBQA 4MQVA 1WJCA 3KEYA 3OYAA 4HPQA 3FKJA 2NVQJ 1IV6A 4KN7X 3GFLA 4I0AA 4X6AJ 3HGYA 2L7MP 1IXSB 4Y15A 1ETOA 1KU7A 4AYBA 3A0BC 1JKPC 4MQ9F 2O0YA 2LFBA 3A4CA 2BYVE 3QPLA 2BGCA 4XMYA 4XONA 4DZPA 2E1MB 4ZYDA 5TGTA 3HHGA 4PJLA 3KLOA 4NQWB 1VQ6I 3LOCA 4OINF 4FE7A 2R7UA 1G3TA 3BCAA 1YS7A 2DK5A 3ZQIA 3BG3A 4E7LA 5DM7F 4ENJA 1U5TC 1IN6A 2FEZA 2L3DA 4I76A 4CCNA 2BZTA 2BBYA 4A6EA 3LSIA 3GTLJ 3SYTA 4BBRJ 2ESHA 2XVCA 3IWFA 1G4DA 3E3VA 3FXRA 3UR3C 4AVZA 3F21A 3L2VA 4EJUA 2MYSA 1APLC 3A03A 2MGQA 1HQCA 4OMZA 3C3WA 3E5XA 3FHNA 4XBFA 4C3IJ 1F36A 5J40A 5LEKA 3JAMK 1LE8A 3G1LA 2L4AA 1D0YA 1YW8A 4HG2A 1HA8A 4FE4A 2DT6A 3V8JA 5IOZA 1Q1HA 1FX7A 1V5FA 3HOZJ 2VL8A 2A6EF 1OPCA 1IAWA 5DCMA 4EJTA 1FOKA 1X1DA 2HZTA 2OUMA 1X19A 3S8PA 3OYKA 2CV1A 4M3GA 3NWTA 3DV8A 4XLNF 3K4JA 1RZ4A 1Z6TA 3BWGA 3TDUC 4E7IA 2XV4S 1S8NA 3ZMUA 2HVQA 3E6BA 1I5ZA 2FMLA 2RQPA 2D1VA 4UUSB 1T0FA 5IYCJ 1UELB 1FYKA 5K7ZA 2XRNA 2PEXA 2P8TA 3LSPA 2IVMA 2X51A 3MAJA 4XQFA 4G12A 4CYDA 1YQAA 2R7OA 5CVRA 1FSEA 2QM3A 2H8RA 1AA7A 4B47A 1Y6IA 2QSGX 3PNYA 3VOEA 3EDPA 2P0WA 1QBJA 4M6YA 3SFZA 3ABKH 2R7SA 4N4OB 2XROA 1PDNC 4B4CA 2OCEA 1ZQ3P 1ZGJA 4EVIA 1K6YA 2RKHA 3OOUA 2KLOA 1G59A 4HLXA 1TWAJ 3ISPA 2R3SA 5LHIA 2B7EA 1X3UA 3LFUA 2ZNZA 3CJQB 3BROA 1J0RA 1R5HA 2ACJA 2HVSA 2WTEA 2CFXA 2UXXA 4JQFA 3OY9A 1MSFC 2OU2A 2VQLA 3AL0B 1SD7A 3GZ6A 4XRFA 2CGPA 3S3MA 1I6XA 3GTPJ 3I54A 2L9SA 4ZC3A 4PDKA 3HOVJ 3SZTA 2R7FA 2DN0A 5IYDJ 1OR7A 1FLIA 3E0JB 4D7NA 2ZMEC 5EZGA 5E1XA 2X6OA 2AXLA 2P6TA 2DO7A 5JLXA 5B1AH 5D5UB 2ZNYA 1SD5A 3OR2C 3Q9VA 2K9MA 2V9KA 2FUG2 2ICWG 1J7KA 2XF7A 4BJ6C 3HOTA 1D1AA 3VYUB 4I99C 4YEJA 3LSJA 2IS1A 2IBDA 1OCTC 4LG3A 1J09A 4AYBN 3VWBA 1ETYA 3WTSC 3BPXA 5CQEA 4XNFA 4XRMA 3CMAI 2LKXA 1A5JA 5E3MA 1SFOJ 1BC7C 4Y17A 1O7FA 3MMYB 2LREA 1BJZA 1B59A 4ZYHA 5FLVA 3VODA 1MNEA 2LTPA 1ULYA 3E1SA 4KJZA 4M3BA 4DYRA 3WHBA 2I10A 1ZTRA 4M73A 1YO5C 4AVPA 4HF1A 3O2PE 4M71A 5CJ9A 2BXZA 1R6RA 3OYLA 1T6SA 3ZMZA 4UVCA 5FROA 4BKXA 3TKYA 1MD0A 4UXNA 5GP9A 4U0VA 3FMSA 3OIPA 2HDCA 1SVLA 2JUGA 1DPRA 4NC7A 1O7LA 3HOYJ 3J81K 3VYTB 1HSTA 2XKOA 3RJPA 2DMTA 3GBGA 1ON2A 2RN7A 1FBSA 1ZN2A 2NVXJ 3LMMA 1UZCA 2GWRA 4IQJA 3TO7A 5AIQA 4CCJA 4Q5SF 4N9HA 4DZJA 1V5GA 1T39A 3WU0A 3LWFA 1TNTA 4G7HF 2EBIA 3MKWB 3ABMH 3H36A 5M3MJ 4RGUA 3S1NJ 3OYEA 1Y8RB 3E6DA 2O5RA 1VNDA 2E35A 2OF7A 3T5XA 3F72A 3WG9A 2NVYJ 1ZYRF 4UB8C 5E1WA 3LA7A 5C4JJ 2YS9A 2HNHA 2E1CA 1LQ1A 2VI6A 3WTYC 2ME0A 2FQ4A 2H94A 2M0MA 3HZJA 4C9YA 3QP6A 5KVRA 4ZYGA 4L0ZB 3QOEA 2HYJA 1WH7A 2H6CA 1W4MA 2JT1A 1RETA 4ITVA 1UG0A 4ZYAA 1O3TA 5IPAA 3GX4X 4A0ZA 5J8CA 5F1JA 3E7LA 3F6VA 2ZKZA 1IW7F 2KIFA 3M8EA 5ICCA 1ETKA 2QCOA 1AU7A 2CUEA 4IHWA 3I53A 3RKQA 2FA5A 5A2QK 4A3KJ 3HYIA 5K5OA 5JVTA 4QWQA 1KU9A 4RGXA 2KPMA 3MD2A 3HRTA 4IRIA 4FASD 1MDMB 5IP7J 3NARA 3E6CC 1MZBA 3LSGA 1BR4A 2X9DA 4ESJA 2TRTA 1ONVA 5K5RA 1MMAA 2KDZA 1YHQI 1SFKA 3B6AA 3CCRI 1OCRH 2VIXA 3I9V2 5E8GA 3L2RA 2H1LA 1P4WA 1MW7A 4OIOF 4HYEA 3JTGA 3FDYA 2M2EA 5CVJA 5HLIA 3A01A 2JRMA 1X2NA 2VLAA 3FXMA 2NS0A 3LQRA 1R36A 2XRLA 3FXUA 4RGRA 3AG1H 5FLMJ 1RKTA 5GAGJ 3WTZA 2HFHA 1YITI 3CJRB 2EZKA 2IGKA 4BHPA 5ICEA 1LEBA 3FHZA 4HSRA 4R8HA 5E3NA 3PSFA 2XDVA 2YU3A 3CLQA 2R92J 1ERDA 3HEFA 3I0TA 4BQOA 1XN7A 1U78A 5D5XB 2V4JC 3EUAA 2L9VA 1B8IA 5IT9K 3IH4A 1VQPI 3GZNB 2DT7B 3DKXA 3PFIA 1K6OA 4L0YB 1EV7A 2ISZA 2WADA 3HTSB 1DU0A 1MBHA 1DGRM 4KUMA 2MD0A 1OCZH 2IS4A 4MO7A 5HLGA 1HBXG 1BC8C 2H27A 1IO2A 3SXYA 4OIRF 1A31A 1NHAA 3RPUA 2X85A 4BEHA 4LB5A 2BHZA 5J1UA 3RI4A 3ABLH 3HKZA 1ETWA 3RIRA 2Z2SB 2L7FP 2TDXA 2Q1ZB 3IRRA 4AIHA 2RC4A 4XRSA 5KK1A 4F7ZA 3KLNA 1SC7A 3ZRGA 2R7WA 5FKLA 4EM1A 1PP7U 3BLYA 3J80K 1WJFA 4M9XA 1CQTA 2LLKA 1B1BA 4D0PA 2K5CA 2KZGA 5D6EA 4NC8A 1K78A 3V8LA 1OMIA 4Z2YA 2BVLA 2P81A 3H9GA 4GRIA 4IKFA 4XK4A 1ZG1A 1QO0D 2IEKA 4FX4A 4HX8A 1DP3A 1U2WA 1Y1VJ 2NS8A 2YX7A 1W7PD 3ELKA 2XGXA 4F91B 4J01A 3CTAA 1PUFA 3OL4A 3K9TA 2PMUA 3BJAA 4AM3A 2DA3A 3N05A 2BE5F 4BU2A 3ZMTA 1Z05A 3ZGKA 2KHMA 5E17F 1X4OA 3E97A 2HWVA 4CCOA 4OIQF 3K1MA 2W24A 3CZ6A 1LUJB 1B6AA 3BY6A 3OYBA 5M5YJ 2GA1A 1RUNA 2CH0A 1HSJA 1YRNB 3ZQHA 3HSRA 2CUJA 1FIPA 5F64A 1MBEA 2EA4A 1S9HA 1IC8A 1IN7A 3HXLA 4L9NA 5HS7A 3AG4H 2OZUA 1ETQA 5K5QA 3A1YA 2CFOA 4ZJZA 1TWHJ 2DFIA 1ZR4A 3CLOA 2VJ5A 1IRGA 1KZHA 2A07F 2KMUA 4N0BA 4HV6A 1HKSA 3PQKA 3S2WA 3GEZA 2VBXA 3KP4A 3M1CA 2V79A 2OTLI 2OZ6A 3V7RA 3WTVC 1TC3C 2M7BA 4WXDA 3OL3A 1FT9A 3OMYA 1USSA 1TT0A 5CVUA 4W97A 3OS1A 2KJBA 2ZFUA 1YIOA 4KT5C 2VBZA 2DFHA 2KL4A 2JPBA 5CLSA 2BY3A 1CF7A 4IHXA 1U8RA 2ELHA 4MFEA 1FIAA 2DQLA 4BS9A 3KZIC 2QGUA 4U0YA 1AKHB 1VQ5I 5EG0A 4G7OF 4ESBA 1YX3A 4AIKA 3GF2A 3HRMA 2K9SA 4O3MA 5FKKA 2HU9A 3VSLA 2L02A 3BDDA 1AOYA 2W25A 3HOUJ 4U7BA 4KNYA 2M0CA 4RB1A 2KQRA 1XGNA 2CW7A 1W5TA 3L1PA 1W5SA 2W00A 2NRAC 1UG2A 5FLXK 2QBYB 3BJOA 4CCKA 2LOOA 3HRSA 1E2XA 3R0AA 3CUQA 1GV2A 2GXBA 1UFMA 1ZH5A 1WPKA 4OMYA
chains in the Genus database with same CATH topology
4XR6A 3A4CA 2KZVA 2R7QA 3RSNA 4XMYA 3S93A 3OYNA 4XONA 2E1MB 5HVQC 5TGTA 1T0FC 4PJLA 3EUKL 1VZ0A 4NQWB 4CH7A 3DPTA 2R7UA 3BCAA 3MKZA 4OWRB 2VQCA 4YRVA 4E7LA 4BXFA 2KP6A 4XM3A 3RPUD 3QYEA 4PSWA 4CCNA 3VDXA 3LSIA 1QHGA 3SYTA 2RREA 3UR3C 4N4NB 4LIUA 4AVZA 3L2VA 2HDWA 3DTEA 2MYSA 1BR1A 1WJAA 4D1QA 4CUGA 4CCMA 4BE1A 3FHNA 3OYJA 1HA8A 1D0YA 3IP4B 3PUBA 4HG2A 2DT6A 2DXIA 3DQVC 3DTIA 4XKWA 2LBFB 1V5FA 2VL8A 4OAZA 3ZQQA 2LBFA 1WFXA 1X1DA 2OUMA 3S8PA 1X19A 3OYKA 4PJMA 2CV1A 3NWTA 3K4JA 3PL8A 4PJNA 5CKTA 4NUBA 4Y4RA 3OYGA 2IGMA 1PYVA 2WAEA 4E7IA 2DOAA 4F55A 4DOZA 4E4HA 2HVQA 4ANJA 1D0ZA 2KDOA 3C2HA 3H5RA 1UELB 3U21A 3AL0C 4AU7A 2L7KA 3IAS2 1E0EA 3K4NA 3OYDA 1X1CA 2E5ZA 2VB6A 1Z3XA 1SAUA 4JOMA 4E7JA 3OS0A 2X51A 4XQFA 4XOPA 2Z1DA 1WJEA 4P1WA 2X1EA 2OV7A 3K70C 4ZTJA 1OR7C 2R7OA 2UWMA 5FRNA 2LC2A 2X6XA 1N75A 5HNHA 1AA7A 4B47A 1Y6IA 3D5RC 3K4LA 3PNYA 3CF2A 3OS2A 3M8JA 2CMPA 2M7AA 2P0WA 3KYLA 4J00A 1WJBA 1D1BA 2R7SA 4N4OB 1DGWY 2W4SA 2IGNA 3TBIA 1K6YA 2JA2A 3OOUA 3SZGA 2KLOA 4KT6A 1G59A 1MNDA 1NG7A 4YELA 1MMNA 3OWTA 2JSPA 1W36D 1Z3YA 4HNUA 3L2QA 1BR2A 2VJ4A 4E6KG 3LFUA 3CJQB 4KISA 3K4MA 2HPIA 3PFYA 3PNTA 3HL2A 2HVSA 1P9QC 1QHHD 3V42A 4JQFA 3OY9A 4G6TB 4BQQA 2VQLA 3AL0B 3BG6A 3S3MA 1LDKB 2L9SA 4BE2A 3A2KA 4ZC3A 3FBIB 3ONQA 2WAFA 5CQGA 1ZELA 4LIVA 2LRDA 2PJRB 2R7TA 5CPRB 2K9LA 3EPZA 4CZCA 2OC6A 2W82A 3E0JB 2E60A 3VSKA 2R7VA 2R7XA 1MMDA 2VKHA 3F9KA 4NNJA 3OR2C 2K9MA 3DU6A 2V9KA 1V5EA 4QPQA 2FUG2 3VYSB 2PMZA 2XF7A 3LL7A 4BJ6C 4D9JA 5HLTA 1Y56A 1D1AA 3HOTA 2ZSHB 1FMWA 3VYUB 4YEJA 2IS1A 4LG3A 1J09A 3RCOA 3VWBA 5CQEA 4XNFA 2WB1A 3SEQA 4RMNA 3MMYB 4BUPA 2LREA 2QKLB 4BEHB 3J7AY 1MNEA 1LFPA 2IGOA 3QODA 2WY7Q 3E1SA 4KJZA 3W2WA 4BJTA 3HUGB 2VASA 3OYLA 1R6RA 1GLNA 3OYFA 4XKVA 5FROA 3HPHA 2CV2A 2Q2EB 3AKZA 3OIPA 2JUGA 2E5NA 1YX5A 4DIQA 2XAUA 3CP8A 1LKXA 4NC7A 4U87A 2V7FA 3VYTB 3HC7A 3MKYB 4B43A 3GBGA 4DGWB 4PFPA 4XKCA 1X4PA 3LMMA 4XKBA 4IQJA 3S3NA 2F6CA 4F92B 4CCJA 3UNGC 3I3LA 3PJRA 1N78A 3H5NA 4XORA 3RQ4A 3PNVA 4C2TA 1V5GA 4CCLA 4B3XA 5LFAA 1W36C 3MKWB 1NG6A 1YE9A 2F5VA 3OYEA 2O5RA 3DPLC 2M4KA 2JVHA 2HPMA 4BACA 4FETA 2LY2A 5LD2C 1UAAA 2HNHA 2CW8A 4C9YA 2M0MA 4X0GA 4HRIA 3QOEA 3VYRB 2Z16A 1QU3A 2XC7A 3H5AA 4ZYAA 4ITVA 1UG0A 3C2GA 2CV0A 4DBRA 2LYCA 3ZCOA 1G8XA 3ZR8X 3DKYA 4KITB 3LSHA 2A6TA 3H9JA 2AQEA 3BCBA 4DJAA 4HNTA 2BVMA 2IXSA 2W7NA 1BOBA 1JI8A 2KPMA 3MD2A 4ZTFA 3LSMA 3H35A 4HSTA 4FASD 4BDZA 4DBQA 4OAYA 3LSGA 1BR4A 4CA0A 1MMAA 2XF6A 1SFKA 1T95A 3DTKA 3OYMA 2VIXA 3I9V2 3L2RA 1D0XA 1MW7A 2V1NA 3FDYA 4XN0A 2VLAA 4F52A 2RQQA 2X1DA 4F93B 3D5SC 2IS2A 3K4BA 3CJRB 3TMOA 2IGKA 5HOOA 2DCEA 2HZDA 2HQAA 4HSRA 1Z21A 2ELJA 3PSFA 2XDVA 1ERDA 2WY8Q 2L9NA 2VJIA 2PJRA 4BQOA 3H0DA 2V4JC 3EUAA 4QPOA 5KCMA 2K3PA 3DPUA 4HEA2 1IRXA 3W2AA 2DT7B 3DKXA 4RLFA 4PJJA 3G2BA 3HG9A 2BW3B 3W3CA 3S32A 4BJ5C 2ZXIA 2WADA 2BW3A 2VQHA 1DGRM 4CSWA 2MD0A 2ZSIB 2IS4A 2KRHA 4Y3OA 4B44A 1D1CA 3EUHC 2XF5A 3K10A 4BEHA 2X85A 2IS6A 1KONA 3HKZA 1LVKA 4LITA 2AQFA 3ZXSA 1X1BA 3QYBA 2Z2SB 3OR1C 1FMVA 3SDBA 1TZLA 2MC4A 3DEEA 2Q1ZB 3ZRGA 3SEZA 1PJRA 2R7WA 2L2OA 2VKDA 2HVRA 2M4GA 3BLYA 4RLQA 4XLHA 1WJFA 2X1CA 2JVGA 2K5CA 4RM3A 4IX7A 2NOJB 4NC8A 1U0JA 4PK4A 2V6EA 2V26A 2BVLA 3H9GA 4GRIA 4IKFA 2MABA 1WJDA 3CMMA 4BGDA 1WJ5A 1DP3A 3KX2A 3QYFA 2CUZA 1N77A 4RM2A 3NWSA 4Y33A 4F91B 1MMGA 4J01A 4XLAA 5HNFA 3OL4A 4BDYA 4ZDOA 1OLTA 2W1OA 4XLCA 3K4CA 3N05A 4II3A 4BU2A 3OYHA 2Y0SA 2L5QA 3ZGKA 2KHMA 2UUZA 1X4OA 3K4KA 4CCOA 4XLEA 4ZDLA 3CZ6A 3TL4X 3DWLE 3OYBA 4E7HA 4F3QA 2CH0A 2UV1A 4ZDPA 2F4IA 2X6WA 3L2WA 2CUJA 4R79A 4XOTA 4II2A 2A5WA 2XSJC 2BOLA 5KHDA 1S9HA 2LH9A 2M3AA 3HXLA 2X6YA 3DLAA 2RNGA 3A1YA 2CFOA 4E7ZA 4ZJZA 3OIQA 4BL0B 2VJ5A 4PSXA 2KMUA 2GOMA 3H9QA 3K6GA 2MFZA 1Z7LA 5FRMA 3IAM2 4H4KC 3M1CA 2KRCA 4XLFA 5JHFA 4E7KA 4B48A 2M7BA 3HPGA 3OL3A 2VXDA 5KNLA 1EA3A 2VXZA 1DQUA 2E1MC 3D5LA 1X1AA 3BC8A 4PUSA 3OMYA 4IZZA 1TT0A 2GOXB 3HOSA 3DU5A 3AFHA 4MLOA 2I8DA 3OS1A 4BE0A 3L2UA 4EATA 4C2UA 2DJIA 2ZFUA 3IUOA 3CP2A 2KL4A 2CS3A 2WA0A 3OYCA 4E7SA 2ZXHA 2LG4A 4P5OA 4BS9A 3CESA 4IQ4A 3S3OA 4BQNA 2VPLA 1YX3A 3RTRA 2R7RA 2R4GA 4C30A 3FBNB 2VQGA 3W2VA 2HU9A 3VSLA 2QKMB 2VJJA 3BG7A 3LSKA 4PFOA 2WBMA 1WJCA 3KEYA 4U7BA 2KQRA 2CW7A 4HPQA 3OYAA 2WAQA 3FKJA 3OYIA 2W00A 3PSIA 3K70D 2LY1A 4XN3A 4AYBA 4CCKA 2LOOA 4XL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG0 A;  1X4O A;  2DT6 A;  2DT7 B;  2E60 A;  4DGW B;  1X4P A;  2E5Z A; 
#chains in the Genus database with same CATH topology
 3FF5 A;  1R4N B;  4AIJ A;  4XR6 A;  1YTY A;  2KZV A;  2R7Q A;  4GCV A;  2X4H A;  4FT8 A;  3RSN A;  3PM1 A;  2WAQ N;  2HTS A;  2H8W A;  2PFB A;  3U1D A;  4CH7 A;  5B66 C;  1R49 A;  4HV5 A;  3DPT A;  3MKZ A;  2VOD A;  1G3Y A;  2XPU A;  2VQC A;  4YRV A;  2KP6 A;  4ENM A;  4ETS A;  3KET A;  4PSW A;  3VDX A;  4UNO A;  1RUO A;  2E2J J;  2DOE A;  4EGY A;  4JBA A;  2V1D A;  4XID A;  2Y48 A;  2HDW A;  3DTE A;  3HKZ N;  4A3M J;  3DP7 A;  3TW6 A;  1SFE A;  1Z7U A;  4D1Q A;  3JRI A;  3CCY A;  3WU2 C;  1H9T A;  2EA2 A;  2JZY A;  4L18 B;  2DMN A;  2M87 A;  3UKG A;  4CHU A;  5D8K B;  3DQV C;  1UHW A;  3TW7 A;  2Q8K A;  1BJA A;  3GME A;  1W7P B;  2HKO A;  4HDU A;  3ZQQ A;  2L01 A;  1WFX A;  3HRU A;  5DYM A;  4M74 A;  3Q5F A;  3ZN1 A;  1ODD A;  1I27 A;  1S3J A;  2B9S A;  1PYV A;  1L3L A;  1MGT A;  3ECH A;  2PX9 A;  1E17 A;  4E4H A;  3AAF A;  1T98 A;  4FTH A;  2O8X A;  3C2H A;  3H5R A;  3RKX A;  4NHJ A;  3JAM Z;  1JT6 A;  2JA8 J;  3S16 J;  4AU7 A;  4XSX F;  3IAS 2;  4UUS A;  2DJN A;  1IGN A;  1ZKG A;  1U5T B;  3PQJ A;  3OYD A;  3S1R J;  1VQ4 I;  2JA6 J;  2EFO A;  2VB6 A;  3F0C A;  1HXD A;  4FQG A;  2XGC A;  4JOM A;  1J9I A;  2DMP A;  4ESF A;  2C6Y A;  4XOP A;  2ZBK A;  3FXL A;  1WJE A;  3REO A;  3C2B A;  2X1E A;  3K70 C;  4A69 C;  4ZTJ A;  2JUC A;  1TQM A;  2QA4 I;  2LC2 A;  3WGH A;  1SVO A;  1N75 A;  2ZXW H;  5HNH A;  1O57 A;  5JR3 A;  4D5C A;  1MBJ A;  3D5R C;  4IXA A;  2V9V A;  1P2F A;  2E7X A;  3KE2 A;  1YS6 A;  2EH3 A;  2M7A A;  4JYK A;  4J00 A;  1WJB A;  2E7W A;  3D0S A;  1IXR C;  1DGW Y;  5EEH A;  5EZH A;  3IHU A;  4HQE A;  2KIS A;  4MEY F;  4IHS A;  3M07 A;  4U0W A;  5BOX A;  1MJA A;  3HIF A;  5DUK A;  3ASO H;  3CUO A;  1R23 A;  1IN4 A;  3O6B B;  2V1X A;  1QNT A;  1IV8 A;  2FBI A;  1HDD C;  2HOA A;  2GIZ A;  3L2Q A;  4HNU A;  2VJ4 A;  5FD5 A;  2AS5 F;  5B3S H;  3K0L A;  2EFQ A;  3A0H C;  5IOY A;  3GYH X;  2X48 A;  1OCC H;  4I7H A;  1XTA A;  1EH6 A;  3WE3 A;  4G6T B;  4BQQ A;  3DBH B;  2E19 A;  2K27 A;  1GUU A;  2P5K A;  3MZY A;  5LRR A;  2NVT J;  1EF4 A;  3H3V K;  5E20 A;  4BE2 A;  1HW2 A;  1YJN I;  2FSW A;  2CG4 A;  4LLN A;  1H9G A;  2E34 A;  2RDP A;  2CQN A;  3FXK A;  2E60 A;  2CSO A;  3VSK A;  2K4J A;  1T8I A;  2XGD A;  1O3Q A;  2FD5 A;  2MA3 A;  2VKH A;  4NNJ A;  2HI3 A;  2R7X A;  2VKE A;  2DA2 A;  1V5E A;  4P9U A;  1DUX C;  2M8G X;  4AID A;  1L0O C;  1VQN I;  4D7M A;  2ZSH B;  2JSC A;  1FMW A;  4HF0 A;  1Z77 A;  2O6G E;  4Q47 A;  3T0Y A;  1VQM I;  3I59 B;  1HOM A;  4Q48 A;  4RMN A;  1P4X A;  1FBU A;  5GAD J;  2CUF A;  4BUP A;  2HOT A;  3J7A Y;  1D3Y A;  1JT0 A;  2IGO A;  3QOD A;  2XAQ A;  4V2F A;  3ZQF A;  2P7C B;  2XIG A;  2J5O A;  3HUG B;  2A5Y B;  2RGV A;  3FK7 A;  3JRD A;  1SFU A;  1R5G A;  2XPV A;  4YG2 F;  2EFP A;  3S15 J;  3BR2 A;  1ITY A;  1YX5 A;  2XAU A;  3CP8 A;  1P4A A;  5KAI C;  5F0H A;  1GVJ A;  4B43 A;  4PFP A;  4UVB A;  4DYQ A;  2NS7 A;  2D1H A;  3S3N A;  5EYR A;  4F92 B;  3UNG C;  1OQY A;  3BR3 A;  1N78 A;  4XOR A;  2EZL A;  3PNV A;  4B1R A;  2VN2 A;  2ZME B;  4CCL A;  4RS8 A;  5FB2 A;  4EEF G;  1ZRC A;  2K7L A;  4XSZ F;  5H6Q A;  5ICF A;  2DOD A;  2D5V A;  1Z67 A;  3GCM A;  3D1N I;  2IW5 A;  5J47 A;  3Q0W A;  2OBP A;  4XLP F;  3M9A A;  3DPL C;  4Y52 J;  2BXY A;  2E71 A;  1BW5 A;  3FIS A;  3JRE A;  3GLL A;  3J81 Z;  4RAF A;  3LA2 A;  5BS6 A;  3BQY A;  3RYP A;  5LD2 C;  3HSF A;  3SZP A;  4HA8 A;  5J4V A;  1ENH A;  3L09 A;  4G6D A;  5DTD A;  4A3L J;  4X0G A;  4HRI A;  2VE8 A;  4CXF A;  5FKN A;  1JUM A;  3GFM A;  4B09 A;  2HOE A;  1E3O C;  1KQ8 A;  1SMY F;  1VF9 A;  2TCT A;  4OU0 A;  1FEX A;  4DBR A;  3ZR8 X;  1F5T A;  2HR3 A;  1K83 J;  1S6L A;  3R4K A;  3KP6 A;  3H9J A;  3I5U A;  2BVM A;  1SAX A;  3VFZ A;  3FM3 A;  1BOB A;  3CUQ C;  4ZZL A;  3GLX A;  4Y7N J;  5ILU A;  1U9N A;  2W85 A;  3JCU C;  4LG0 B;  4ZTF A;  2OTJ I;  4HST A;  1BI2 A;  1SAN A;  4DYC A;  3NQO A;  3QQA A;  4UUV A;  1V54 H;  3MWM A;  4DBQ A;  2NYX A;  3SJM A;  3O8G A;  3P9K A;  1T95 A;  3CC4 I;  3OYM A;  1MH4 A;  2YPR A;  2Y69 H;  1D0X A;  1MBF A;  4L5I A;  1ETX A;  1JKR C;  1G3W A;  2YSR A;  1DU6 A;  4P9F A;  2K85 A;  3WG7 H;  3CO6 C;  2FNP A;  3D5S C;  3ABU A;  2IS2 A;  3GWZ A;  5A2Q Z;  1X2M A;  3K4B A;  3GZ5 A;  3W6J B;  2DCE A;  1XCV A;  5GPC A;  2HZD A;  1KA8 A;  4HX4 A;  5L3G A;  4V19 K;  3CCS I;  2LNB A;  4I0B A;  2ELJ A;  3F6O A;  2XAS A;  1W5C C;  2WY8 Q;  1R4M B;  5D4S A;  1Z91 A;  2VJI A;  2PJR A;  4HNV A;  1JTY A;  2ZJ2 A;  3K2Z A;  3HDD A;  4KFC A;  3ZQG A;  2EWN A;  1IRX A;  1I3A A;  3F8C A;  1FWZ A;  1IRZ A;  3CDL A;  3L00 A;  4FCY A;  4PJJ A;  3G2B A;  2AO9 A;  2BW3 B;  4G9Y A;  1KU3 A;  3W3C A;  2FE3 A;  3MVP A;  3M4O J;  5BQT A;  5EGO B;  1P7I A;  3KP2 A;  3HM5 A;  2HQ5 A;  2VQH A;  2KJC A;  1IUF A;  4JX4 A;  4ENN A;  2ZXJ A;  4Y3O A;  5L3D A;  1OFC X;  2DLL A;  3I56 I;  3EUH C;  4LB6 B;  1ZG5 A;  5B1B H;  2JWT A;  3K10 A;  1WGX A;  3S2D J;  1HDP A;  3NEU A;  1O4X A;  2IS6 A;  1Y0N A;  1YG2 A;  4P96 A;  1LVK A;  4LIT A;  3ZXS A;  1X1B A;  1Y0U A;  2ISY A;  5F04 A;  3MKL A;  3SDB A;  1TZL A;  2MC4 A;  3CDH A;  1HW5 A;  3RZD J;  5IT9 Z;  1ETV A;  2KT0 A;  2OAZ A;  4WXH A;  5D5W B;  2Q2E A;  1JHF A;  4XLH A;  5H20 A;  2QUF A;  5GAE J;  3BTC A;  1R58 A;  5ILV A;  1RR7 A;  4BH9 A;  2O9L A;  2HXO A;  1S7A A;  2NOJ B;  1U0J A;  4PK4 A;  2V6E A;  3Q0V A;  2V26 A;  2MAB A;  4YIR X;  5BPI A;  2HEO A;  1F1Z A;  2Y9Z A;  1JGS A;  3O8H A;  3ERE D;  2H09 A;  2XKP A;  2M1B A;  1B72 B;  2FU4 A;  3FMQ A;  1PP8 F;  1WSU A;  1R1V A;  1SD4 A;  4RM2 A;  4Y33 A;  5TJJ A;  4PJ0 C;  1VQL I;  5HNF A;  3B73 A;  1OLT A;  4IRG A;  5ILS A;  1RC9 A;  5DCM B;  3BOQ A;  2L5Q A;  2V1U A;  3J80 Z;  3G1O A;  3K4K A;  1XGM A;  4OIP F;  4ZDL A;  3TL4 X;  1WRJ A;  4F3Q A;  2UV1 A;  4IVN A;  4EM0 B;  1W0U A;  4ZDP A;  3PIO F;  2F4I A;  1A6I A;  4I09 A;  1YRN A;  2ZCW A;  4II2 A;  1AWC A;  4A5N A;  4IHV A;  2BOL A;  2LH9 A;  1QZY A;  2P5V A;  5HDN A;  1TW3 A;  2H1K A;  3GFJ A;  3DLA A;  1A04 A;  2RNG A;  2O61 A;  2ECB A;  2Y0S N;  4E7Z A;  1TL8 A;  4R1H A;  3OV8 A;  2HOS A;  3QP5 A;  4M6V A;  3BPV A;  5FKM A;  3KFW X;  1XMA A;  2MFZ A;  2VOO A;  3NAU A;  2LKP A;  3JR9 A;  3OOP A;  3KZY A;  2DDB A;  3IAM 2;  4H4K C;  3GTM J;  3ASN H;  1TLH B;  5BMZ A;  2XPW A;  4XLF A;  3MCZ A;  4B48 A;  1I1S A;  3WGI A;  2EV6 A;  3H1C A;  1FP2 A;  4I98 B;  5AIP A;  1UHS A;  1XSV A;  1O3S A;  3DXJ F;  5LHG A;  3DU5 A;  1C0W A;  2VON A;  4BE0 A;  3L2U A;  2HDD A;  3S1M J;  2ZFW A;  5TRD A;  1FYM A;  5HDG A;  2LR8 A;  2FXA A;  2QQ8 A;  2FMY A;  2R5Z A;  1QA6 A;  2IJL A;  3RKW A;  3OYC A;  4W1U A;  3GTG J;  4M3F A;  2ZXH A;  1PUE E;  4P5O A;  3CF5 F;  3MQ0 A;  2L9R A;  1QRY A;  3U2R A;  2VPL A;  1AKH A;  5DUI A;  2OQR A;  5IP6 A;  1WH5 A;  2Y2Z A;  3W2V A;  2L0K A;  3JRH A;  1JGG A;  1ZLK A;  2PLY A;  1IZ1 A;  2VJJ A;  3BG7 A;  4WX9 A;  3LSK A;  4PFO A;  2CQX A;  1R22 A;  3W6K B;  2EV0 A;  4AD9 A;  2WAQ A;  2BHY A;  3PO2 J;  2PQ8 A;  1S7E A;  2EZH A;  2FF4 A;  2E36 A;  3K70 D;  3CCL I;  5E3L A;  4XN3 A;  1GXP A;  2QQA A;  4XL9 A;  3Q3S A;  2QBY A;  4J19 A;  1H0M A;  3IRQ A;  1BI1 A;  2B0L A;  5E8I A;  2W48 A;  4G94 A;  3CDI A;  2DFE A;  1I3Q J;  3QPH A;  3S93 A;  3T8R A;  4BY1 J;  4IRH A;  1T0F C;  3F8N A;  1QQI A;  4UV8 A;  1ACI A;  1O3R A;  4BXX J;  5J8F A;  2QZ8 A;  5M5W J;  3R60 A;  4XM3 A;  3RPU D;  5FLX Z;  4I6Z A;  4HLY A;  1Z9C A;  1QHG A;  2GXG A;  1HC8 A;  2OD5 A;  3P9C A;  3DF8 A;  3T1B A;  4C2M J;  2KIM A;  3F8F A;  4N4N B;  5F1R A;  1V55 H;  3F8B A;  3WOD F;  4O6J A;  1BR1 A;  4CUG A;  1E0E A;  3OYJ A;  3K1N A;  1LDD A;  5ED4 A;  5HS9 A;  2R0Q C;  3IP4 B;  3PUB A;  1JUS A;  1RNL A;  1D8J A;  3WTT C;  1S72 I;  2DXI A;  3ZMV A;  2JA5 J;  1DPU A;  1JJ6 C;  2ZJQ F;  2LBF B;  1B4A A;  2WWY A;  2MW8 A;  2Q0O A;  3FWE A;  1LPQ A;  1G2H A;  2N8G A;  4OAZ A;  2O7O A;  4CGZ A;  2DMQ A;  5JVG F;  1W7P A;  1P7J A;  3QU6 A;  4PJM A;  1YFH A;  2OQG A;  3JRB A;  3CMY A;  3PL8 A;  5DM6 F;  1UJ8 A;  1KGS A;  4PJN A;  3T8T A;  3GFI A;  5CKT A;  5L3B A;  3OYG A;  4S04 A;  2IGM A;  2WAE A;  1V4R A;  1FPQ A;  1MKM A;  2DOA A;  1WQ2 A;  3ZMS A;  4F55 A;  4DOZ A;  3J7Y J;  1LFB A;  1N25 A;  2HYF A;  1D8K A;  1YW9 A;  3S14 J;  1K4T A;  4ANJ A;  2PN6 A;  1YLF A;  4RA2 A;  1D0Z A;  5LLQ A;  2Z33 A;  3FKI J;  2K40 A;  1R9T J;  2O8K A;  5E79 C;  2Y9Y A;  3K4N A;  3GTJ J;  1X1C A;  2MLK A;  1J5Y A;  1YOV B;  3H3Z A;  3G73 A;  2COM A;  1MBK A;  2Z1D A;  4LK0 F;  4P1W A;  4IHY A;  3LAJ A;  1OR7 C;  3AG2 H;  2UWM A;  2H6B A;  3KP5 A;  4KIC A;  2R5Y A;  4RBO A;  1I6H J;  1P6R A;  3TOA A;  5DV5 A;  3K7A J;  2CMP A;  3M8J A;  4G8X A;  3FXQ A;  4MIM A;  3KYL A;  4GYG A;  2IAI A;  2W4S A;  2IGN A;  2MSY A;  5EDN A;  5EEA A;  1P92 A;  3SZG A;  5IP9 J;  4LJZ F;  2MH2 A;  3QAH A;  3V4G A;  2EPF A;  4KT6 A;  5JI6 A;  1MND A;  4A0Y A;  5HS8 A;  1NG7 A;  2LSO A;  1YI2 I;  2JSP A;  2EJR A;  3JTH A;  1Z3Y A;  4E6K G;  3ZN0 A;  4KIS A;  4KIG A;  2I5U A;  5EJC A;  2HPI A;  4C3H J;  3BR1 A;  3HL2 A;  4KMF A;  5GPA A;  3JRC A;  2K3F A;  1IJW C;  2DYS H;  2ZB9 A;  4CIC A;  2IA1 A;  5IY5 H;  2CRG A;  5D6F A;  3BG6 A;  3JW4 A;  1VQ9 I;  1JTX A;  1UHM A;  3BTL A;  1QPI A;  3A2K A;  5CQG A;  2PMH A;  3TO9 A;  1G6N A;  1HW1 A;  3I4P A;  4LIV A;  4P55 A;  1H8A C;  2GLO A;  1REP C;  2GA2 A;  2NNN A;  1B8I B;  1T08 B;  2JTV A;  2OC6 A;  3QWL A;  1DDN A;  5EEG A;  2R7V A;  1MMD A;  3F9K A;  4CYC B;  3DU6 A;  4QPQ A;  2Y30 A;  2RAE A;  3VYS B;  2PMZ A;  2M30 A;  3LL7 A;  4D9J A;  1Y56 A;  1ZK8 A;  5LGU A;  3QPT A;  2CWE A;  4IL6 C;  1GVD A;  3U9G A;  4NQW A;  3N97 A;  1B9M A;  3RCO A;  4QIW N;  3TED A;  3V8K A;  2JJ7 A;  1FYL A;  2DTR A;  2D2W A;  2Z5U A;  2DA4 A;  4KN4 X;  5F27 A;  4BEH B;  3CQZ J;  1NTC A;  1Y8Q B;  2WY7 Q;  4BJT A;  3CD6 I;  3G3Z A;  2K9N A;  1GLN A;  1XC5 A;  1SVM A;  3GTK J;  3H92 A;  4XKV A;  3HUG A;  3ECO A;  3HPH A;  2CV2 A;  1WVR A;  2E5N A;  1FJL A;  3OIO A;  2DDA A;  4DIQ A;  5TIS C;  3GVA A;  2B63 J;  1LKX A;  3MKY B;  4A3F J;  2Z99 A;  2ZJP F;  2GM4 A;  4DGW B;  2FRH A;  4CZZ A;  2EIL H;  4XKC A;  1X4P A;  3I58 A;  4XKB A;  1FY7 A;  4IEJ A;  3I3L A;  3PJR A;  1QGP A;  3RQ4 A;  4C2T A;  4KMU X;  3GW2 A;  1YW7 A;  4BY7 J;  1JKO C;  1OYY A;  1WCM J;  1R71 A;  2KIU A;  1W36 C;  4RB2 C;  1NG6 A;  2QSH X;  1YE9 A;  1U3E M;  4L5J A;  1IN5 A;  2XUB A;  3J7A O;  2FNA A;  5GAH J;  2E1O A;  2M4K A;  2JVH A;  4ASN A;  1ZGA A;  4BAC A;  4FET A;  3KEO A;  2HPM A;  4WK8 F;  1KYW A;  3N4M A;  2QQB A;  5F08 A;  3K69 A;  1UAA A;  2CJJ A;  1TBX A;  2PBI A;  1MH3 A;  3G4S I;  4GGG A;  1FZP B;  2V6C A;  5AON A;  2Z16 A;  1BI3 A;  2KFD A;  4I01 A;  2DTZ A;  2XC7 A;  2F5D A;  2HTJ A;  1QU3 A;  4MTE A;  3E5U A;  3C2G A;  2DA6 A;  2CV0 A;  2LYC A;  2A6T A;  4MFD A;  1GDT A;  2HQR A;  4HNT A;  2NXN B;  4A3J J;  1BIA A;  1JI8 A;  3LST A;  2IRF G;  2M45 A;  3PUF A;  2L4M A;  1KQ9 A;  4UB6 C;  2MH9 A;  1D5V A;  5D8L B;  4CA0 A;  1Z6R A;  2UZK A;  2XF6 A;  3JRG A;  1IDZ A;  4S0H B;  1ZR2 A;  5IYB J;  4LD5 A;  2RQQ A;  4UV9 A;  2W57 A;  4F52 A;  2X1D A;  4F93 B;  3I55 I;  6PAX A;  1XDS A;  2WV0 A;  3GUD A;  4GFB A;  4QSH A;  4U7D A;  4BYY A;  3CCJ I;  2A69 F;  4YFK F;  1H88 C;  5HDK A;  2GZW A;  5HOO A;  2CQQ A;  2JA7 J;  4L9J A;  3TQN A;  3WU1 B;  1M1E B;  1U6G A;  4CDG A;  5E18 F;  4DNC A;  3EET A;  4ZH4 F;  1ZAO A;  3H0D A;  3CCV I;  1VFC A;  5KCM A;  4HEA 2;  4QTR A;  1AHD P;  5GTH C;  1OKR A;  4JX6 A;  2Z9O A;  4RLF A;  3S32 A;  1R7J A;  3TO6 A;  1HCR A;  2ZXI A;  5FFZ A;  5L3E A;  3CUQ B;  4A3I J;  2BW3 A;  2KRF A;  2VOP A;  4CSW A;  1LB2 A;  5EGO A;  2CU7 A;  2ZSI B;  3R6S A;  2CYY A;  4A5M A;  2ELK A;  1Y39 A;  1D1C A;  1Y1W J;  2A6H F;  2XF5 A;  1FNN A;  5GTI C;  5C44 J;  2DOF A;  1XPX A;  2QLZ A;  2JQ7 A;  4EJW A;  4XIC A;  1KON A;  4LMY A;  2AHQ A;  1A36 A;  2PMZ N;  1GV5 A;  3DEE A;  3EYI A;  4FX0 A;  5J6X A;  1LVA A;  1PJR A;  2M4G A;  2NNY A;  3WHC A;  2FBH A;  4RLQ A;  1HKT A;  1J2X A;  4IO9 F;  2X1C A;  3DBR B;  4DW6 A;  4EM2 A;  1NH3 A;  3P5J A;  2VBY A;  4M9S A;  5FO5 A;  2HYG D;  3A02 A;  4S05 A;  5ERI A;  1A6Q A;  2GBY A;  4A12 A;  1E3P A;  3MN2 A;  1TT5 B;  1WJD A;  4D5F A;  4BGD A;  1POG A;  4RB3 C;  1XS9 A;  3IL2 A;  3KX2 A;  4EGZ A;  1N77 A;  3NWS A;  1MNM C;  1B72 A;  1IUY A;  1BIB A;  2F5E A;  5D5V B;  3AG3 H;  4M6X A;  5FJ8 J;  2W1O A;  4XLC A;  4ZDO A;  1UB9 A;  3K4C A;  1LEA A;  4LLG F;  3OYH A;  2Y0S A;  1RES A;  2UUZ A;  2HGC A;  3F3X A;  4X1E A;  1JJ8 C;  3DWL E;  4E7H A;  4RDU A;  3OSG A;  4JP0 A;  5IT3 A;  2X0L A;  4HX7 A;  1I1G A;  2IA0 A;  5BNG A;  4HDV A;  4R79 A;  3FXJ A;  2KKO A;  4XOT A;  2XGE A;  4LOC A;  4M72 A;  1JE8 A;  2X6Y A;  3EQL F;  2VBW A;  1BI0 A;  1GHC A;  4BL0 B;  1K7A A;  3RPQ A;  1ZHF A;  3S1Q J;  4L5E A;  1Z7L A;  2M34 A;  1WKM A;  5FRM A;  5C3E J;  3KIO A;  3DEU A;  3K2A A;  4IF4 A;  5JHF A;  1OJL A;  2EK5 A;  3HPG A;  2ID3 A;  1MDM A;  2DA7 A;  3V7C A;  4CO8 A;  2QEX I;  5KNL A;  1EA3 A;  2DA5 A;  5LRS A;  1IG7 A;  2VXZ A;  2JRT A;  1DQU A;  2E1M C;  2XAH A;  3D5L A;  1X1A A;  4PUS A;  4IZZ A;  1U8B A;  4A0X A;  2GOX B;  3SHF A;  3AFH A;  4MLO A;  1T2K A;  2I8D A;  3F23 A;  1I39 A;  3RZO J;  3FMR A;  3G71 I;  2P7V B;  2R7D A;  2XSD C;  5F6F A;  3IUO A;  3E6M A;  1R1T A;  3P9I A;  5J1R A;  3CP2 A;  2RNJ A;  4I2O A;  3Q9S A;  4E7S A;  4YIF A;  3WTX C;  5DS9 A;  1W0T A;  2LG4 A;  3HOW J;  5L3F A;  2DQR A;  3CES A;  1BA5 A;  2F5C A;  1PVE A;  1OYW A;  1VI0 A;  3BR0 A;  2OJE D;  5CVV A;  4C30 A;  1E3H A;  4ENK A;  2VQG A;  1HF0 A;  2HS5 A;  3BZK A;  2VKV A;  2QKM B;  4A3G J;  3KP7 A;  2AXT C;  2QQ9 A;  2ZO4 A;  2WBM A;  3S2H J;  3DKW A;  3EYY A;  4I02 A;  2Z3Y A;  3OYI A;  2VUM J;  2VT3 A;  2EIM H;  3PSI A;  1XCB A;  2LY1 A;  3GXO A;  4M3D A;  2FBK A;  2G7H A;  1FOX A;  2L54 A;  4C3J J;  3BP8 A;  4HOB A;  2DYR H;  5E3O A;  2K9Q A;  1TP4 A;  3M1E A;  3K1P A;  1YJW I;  1W1W E;  3OYN A;  5HVQ C;  4WF2 A;  3EUK L;  1VZ0 A;  2YR2 A;  5LGN A;  1JUP A;  4OWR B;  1BN5 A;  1XB4 A;  3M8F A;  1H89 C;  3ZQ7 A;  3KP3 A;  4BXF A;  3F22 A;  3DEW A;  3QYE A;  4HAM A;  1WHU A;  4BHB A;  3L7W A;  3QU3 A;  4NB5 A;  5DEQ A;  1K61 A;  2IPQ X;  3ZOB A;  1XMX A;  2EIN H;  2RRE A;  4MEX F;  4A2U A;  4LIU A;  3BJ6 A;  2OA4 A;  2GQQ A;  1SD6 A;  3FX3 A;  1LE8 B;  1WJA A;  4CCM A;  3MZ8 A;  4BE1 A;  5EF6 A;  1ON1 A;  4KIF A;  4M9Z A;  1FTZ A;  5LEJ A;  4A3C J;  3LQQ A;  4DQ2 A;  3DTI A;  4XKW A;  2DA1 A;  4OOI A;  3ZMD A;  2PI0 A;  3KYC B;  4NDL A;  2G9W A;  2LBF A;  3C7J A;  3LA3 A;  2DT5 A;  2DW4 A;  3TP3 A;  3KEQ A;  1VQO I;  4EJV A;  3C1D A;  1HKQ A;  2QWW A;  1OIS A;  4NUB A;  4Y4R A;  1RIO H;  2LF8 A;  3HB9 A;  3IH3 A;  1X3Z B;  4U88 A;  3C18 A;  3TDZ C;  1TWF J;  4TV7 A;  1S5L C;  4KIB A;  2KDO A;  1JXS A;  3BR6 A;  3U21 A;  3AL0 C;  1OYI A;  1SMT A;  2L7K A;  1R1U A;  5F0C A;  2E5Z A;  1Z3X A;  1SAU A;  3V7S A;  4ZZD A;  4E7J A;  4EMS A;  3OS0 A;  5DDG A;  3LAP A;  3JSP A;  2K4B A;  1EKE A;  4GDF A;  2OV7 A;  3OSF A;  5FRN A;  2F5F A;  2X6X A;  3I4N J;  3PIP F;  5CVI A;  2DPD A;  4YII A;  1BBY A;  1IXC A;  3K4L A;  3OS2 A;  3CF2 A;  2BV6 A;  2STW A;  5HOD A;  4UVA A;  2P4W A;  2XAJ A;  1D1B A;  2XAG A;  3VB2 A;  4YFN F;  1YYV A;  3TBI A;  4A3B J;  1F43 A;  2JA2 A;  2EIK H;  3ML6 A;  3IV5 A;  1WZ2 A;  1VTN C;  5DD4 A;  1WWX A;  4YEL A;  4ABZ A;  1MMN A;  3OWT A;  1TW2 A;  1T33 A;  5CYV A;  1W36 D;  4WCG A;  1BR2 A;  3ABT A;  2VE9 A;  3KCC A;  3ZQC A;  2WC2 A;  2W84 A;  3K4M A;  2BEO A;  2EIJ H;  3PFY A;  1XGO A;  3PNT A;  4BBS J;  5FFX A;  1P9Q C;  2GAU A;  1X1P A;  1QHH D;  3LSR A;  2VPR A;  3V42 A;  2O3F A;  4IHT A;  2VT2 A;  5L3C A;  3LNQ A;  3ULQ B;  2IA2 A;  1XMK A;  1NK2 P;  3CC2 I;  3SFI A;  4A6D A;  2BY0 A;  2QSF X;  1KQ0 A;  1LDK B;  2EV5 A;  3DCF A;  2E1N A;  3FXO A;  1QVU A;  1BM9 A;  4PGH A;  5JHU A;  3FBI B;  3ONQ A;  2WAF A;  1OCP A;  1ZEL A;  2LRD A;  2PJR B;  3DFG A;  1EJ9 A;  3SDG A;  2DAO A;  2R7T A;  5CPR B;  2K9L A;  3EPZ A;  3DLL F;  4CZC A;  2W82 A;  3L9F A;  3HTU A;  3CCQ I;  4G7Z F;  1RPW A;  1TWG J;  4YFX F;  2EFN A;  2MC3 A;  3BR5 A;  1EH8 A;  1IDY A;  1TNS A;  5HLT A;  9ANT A;  1XDU A;  1JKQ C;  4CYC A;  3PO3 J;  1S29 A;  4UY8 I;  4HQM A;  4WWC A;  4O5V A;  2VC1 A;  3SQN A;  1STZ A;  3BG5 A;  2A61 A;  3KPH A;  2ZJR F;  4AUX A;  2QVO A;  2WB1 A;  3SEQ A;  1RKW A;  2ME6 A;  3CME I;  2ID6 A;  2NOG A;  5FD6 A;  2QKL B;  3JRF A;  4N9I A;  5B5E C;  1LFP A;  4JK1 X;  1D5Y A;  2EZI A;  4WXC A;  3TGN A;  2Y0M A;  3W2W A;  3RKY A;  2R7Z J;  3FK6 A;  1ZRD A;  1IN8 A;  2YX4 A;  2VAS A;  5KAF C;  2FOW A;  4AC0 A;  1RI7 A;  3OYF A;  3G6E I;  4RAZ A;  2MG4 A;  3HGG A;  4Y13 A;  2PG4 A;  2Q2E B;  2CQK A;  4EV0 A;  3AKZ A;  1XGS A;  2IP2 A;  2JPC A;  4FIS A;  1BW6 A;  3ZPL A;  2A05 A;  2V9P A;  3IKV A;  1QPM A;  1ORK A;  4U87 A;  2V7F A;  1ZAR A;  2D45 A;  3CO7 C;  3HC7 A;  1K79 A;  1BL0 A;  2EFW A;  1V3F A;  3ZQL A;  2UXN A;  5DCF A;  5JFR A;  3Q0U A;  4MNU A;  2F6C A;  3H0G J;  3GTQ J;  2K02 A;  4BAY A;  3HSE A;  2XHK A;  1UMQ A;  2G7U A;  3I64 A;  3LFK A;  3H5N A;  4JX5 A;  4KA4 A;  2CO5 A;  4RAG A;  2STT A;  2FOK A;  1A35 A;  2E2H J;  1R00 A;  2FX0 A;  5LHH A;  2P5L C;  5J3L A;  1YJ9 I;  1VQ8 I;  4B3X A;  5LFA A;  1ZRF A;  1B9N A;  2G0E A;  3JSO A;  3B02 A;  2F5V A;  1XG1 A;  3KYD B;  1Z0X A;  3H3U A;  3CC7 I;  1I50 J;  4HW0 A;  3MEX A;  3FIW A;  1KU2 A;  1S7O A;  4LLL A;  4EQQ A;  5E1Z B;  2LY2 A;  4L9V A;  2ECC A;  3BZC A;  1U5T A;  2DK8 A;  4UUT A;  3ROU A;  2ADU A;  2RV8 A;  2CW8 A;  3BZ6 A;  2JMW A;  5DD8 A;  3F8M A;  3QRF F;  3VYR B;  3U1K A;  1MJ9 A;  1VQK I;  3H5A A;  2XB0 X;  3DBL B;  3BT9 A;  2DFF A;  2ZC2 A;  5K7F A;  1RRJ A;  3ZCO A;  1TWC J;  1G8X A;  2COB A;  2CW0 F;  3DKY A;  3TOB A;  3LSH A;  4KIT B;  4A3E J;  2LKS A;  3COA C;  2AQE A;  3BCB A;  4GYI A;  4DJA A;  2LF7 A;  2W7N A;  2IXS A;  4E70 A;  3GO5 A;  1FTT A;  1KYZ A;  4GXO A;  2QF7 A;  1Q1V A;  3J7Z I;  1WI3 A;  3HHH A;  4AWX B;  2YU9 J;  3CJT B;  3LSM A;  3H35 A;  2PJP A;  3TP0 A;  4BDZ A;  3B6C A;  2LK2 A;  4IOC F;  2NAZ A;  1SEU A;  2YUS A;  4L9T A;  4OAY A;  3MZH A;  3FM5 A;  2DBB A;  2RVC A;  4RGS A;  3E5Q A;  1TQI A;  3RDI A;  3DTK A;  2GXA A;  3WTU C;  3A01 B;  1BOA A;  2LVS A;  2J5P A;  4H0E A;  2V1N A;  4V2G A;  3HOX J;  4XN0 A;  5ICG A;  1XSD A;  2R5Z B;  1OCO H;  2M8E A;  3O3K A;  2JN6 A;  4IPA A;  1ZRE A;  2DI3 A;  3KZZ A;  4LFU A;  1QZZ A;  1TQP A;  1JHH A;  3ERM A;  3TMO A;  1K4S A;  2EQR A;  5LGT A;  4QLC U;  2QYO A;  1QVT A;  2E2I J;  2WV1 A;  2A3S A;  5K1Y A;  3HJE A;  2HQA A;  1Z21 A;  3ESW B;  4NC6 A;  2EB7 A;  2NVU B;  1LFU P;  5K7H A;  2L9N A;  4PGG A;  4MTD A;  2OPT A;  1F9N A;  4QPO A;  2LMD A;  3ZP5 A;  4LGW A;  2K3P A;  3DPU A;  1XD7 A;  3W2A A;  5M5X J;  3HG9 A;  2MD5 A;  4BJ5 C;  3QPS A;  1LJ9 A;  5M3F J;  2VC0 A;  2MBF A;  3G1M A;  2M9H A;  4HF2 A;  1DP7 P;  4ON0 A;  2KRH A;  4IJA A;  4B44 A;  2QEN A;  3S17 J;  3I59 A;  3P7N A;  4B8X A;  4Q4Z F;  1XSX A;  1CGP A;  2L7Z A;  2KIQ A;  4BQA A;  1MSE C;  3M3Y J;  5J4Y A;  3BTJ A;  3CCE I;  3W6V A;  3BG9 A;  2AQF A;  3RYR A;  3QYB A;  3IWZ A;  3OR1 C;  1U9O A;  2MLG A;  1FMV A;  3I71 A;  4GO1 A;  1G3S A;  2M5W A;  4PZJ A;  2LDU A;  2O03 A;  3SEZ A;  2L2O A;  2VKD A;  2HVR A;  1FP1 D;  2GIV A;  1UST A;  2DMU A;  1J59 A;  2WB1 N;  5HLH A;  1K78 B;  4BHC A;  3R61 A;  1X58 A;  1FBQ A;  2JVG A;  4MGR A;  2K86 A;  4RM3 A;  4ZYE A;  4IX7 A;  4M3E A;  2Y75 A;  2OCC H;  3BQZ A;  3JRA A;  2JK3 A;  2DU9 A;  4BNC A;  2BY1 A;  4A93 J;  1MBG A;  3CMM A;  1FSH A;  1WJ5 A;  2CQ7 A;  2F2E A;  2HXI A;  4Z6Y A;  1MIJ A;  4NBQ A;  1PUF B;  3QYF A;  5FKO A;  2CUZ A;  4BXU A;  2DPU A;  1TTY A;  2Y31 A;  4HZF A;  3VEP A;  1MMG A;  2ZME A;  4LK1 F;  4XLA A;  5D4R A;  4RAY A;  4BDY A;  4G6Q A;  2LD5 A;  1EH7 A;  4A3D J;  1RR8 C;  3WE2 A;  4II3 A;  1SFX A;  1X3W B;  3WTW C;  4XLE A;  3CJN A;  1NK3 P;  1MJB A;  4UHT A;  4KYW A;  2F48 A;  2XB5 A;  2BY2 A;  3IC7 A;  1QZE A;  4K2E A;  5J1Y A;  4B3A A;  2X6W A;  3EUH A;  3QOP A;  5JLW A;  3L2W A;  1LNW A;  3CCU I;  4IOA F;  2A5W A;  2XAF A;  3M7G A;  2XSJ C;  3IH2 A;  5KHD A;  2M3A A;  4XRS G;  1VQ7 I;  2HQN A;  3OIQ A;  1IF1 A;  3WGG A;  2LY9 A;  4PSX A;  4PCQ A;  1LDJ A;  2GOM A;  1UCR A;  3H9Q A;  3K6G A;  3MFK A;  1R5I D;  3BTI A;  1MMS A;  2R5Y B;  3GTO J;  5H2F C;  2KRC A;  4E7K A;  1GT0 C;  4LG0 A;  1HLV A;  2LP0 A;  1ZLJ A;  4RB0 A;  5FGM A;  2VXD A;  5H6R A;  2IT0 A;  3IKT A;  1ZG3 A;  4MHG A;  3RQI A;  2ETH A;  3BC8 A;  2FQ3 A;  3X2Q H;  3FZV A;  3HBL A;  1WI9 A;  3L2C A;  3HOS A;  2A68 F;  1T38 A;  3NRV A;  2F4O B;  2F4M B;  4EAT A;  4C2U A;  4KDP A;  2DJI A;  1YIJ I;  1CF7 B;  4HBL A;  5F0F A;  1Z1D A;  4FHT A;  1J75 A;  2CS3 A;  3VPR A;  2WA0 A;  5EG0 B;  1FOW A;  1GXQ A;  2FJ1 A;  5BPD A;  1F4K A;  4IQ4 A;  1T56 A;  3S3O A;  1ZGW A;  1FOY A;  1FC3 A;  1XX5 A;  2HKX A;  4BQN A;  5C4X J;  1IRF A;  3RTR A;  4EJO A;  2R7R A;  2P6S A;  2R4G A;  2R93 J;  3FBN B;  3CCM I;  2ESN A;  3I4M J;  3R0J A;  5LBQ A;  4MQV A;  1WJC A;  3KEY A;  3OYA A;  4HPQ A;  3FKJ A;  2NVQ J;  1IV6 A;  4KN7 X;  3GFL A;  4I0A A;  4X6A J;  3HGY A;  2L7M P;  1IXS B;  4Y15 A;  1ETO A;  1KU7 A;  4AYB A;  3A0B C;  1JKP C;  4MQ9 F;  2O0Y A;  2LFB A;  3A4C A;  2BYV E;  3QPL A;  2BGC A;  4XMY A;  4XON A;  4DZP A;  2E1M B;  4ZYD A;  5TGT A;  3HHG A;  4PJL A;  3KLO A;  4NQW B;  1VQ6 I;  3LOC A;  4OIN F;  4FE7 A;  2R7U A;  1G3T A;  3BCA A;  1YS7 A;  2DK5 A;  3ZQI A;  3BG3 A;  4E7L A;  5DM7 F;  4ENJ A;  1U5T C;  1IN6 A;  2FEZ A;  2L3D A;  4I76 A;  4CCN A;  2BZT A;  2BBY A;  4A6E A;  3LSI A;  3GTL J;  3SYT A;  4BBR J;  2ESH A;  2XVC A;  3IWF A;  1G4D A;  3E3V A;  3FXR A;  3UR3 C;  4AVZ A;  3F21 A;  3L2V A;  4EJU A;  2MYS A;  1APL C;  3A03 A;  2MGQ A;  1HQC A;  4OMZ A;  3C3W A;  3E5X A;  3FHN A;  4XBF A;  4C3I J;  1F36 A;  5J40 A;  5LEK A;  3JAM K;  1LE8 A;  3G1L A;  2L4A A;  1D0Y A;  1YW8 A;  4HG2 A;  1HA8 A;  4FE4 A;  2DT6 A;  3V8J A;  5IOZ A;  1Q1H A;  1FX7 A;  1V5F A;  3HOZ J;  2VL8 A;  2A6E F;  1OPC A;  1IAW A;  5DCM A;  4EJT A;  1FOK A;  1X1D A;  2HZT A;  2OUM A;  1X19 A;  3S8P A;  3OYK A;  2CV1 A;  4M3G A;  3NWT A;  3DV8 A;  4XLN F;  3K4J A;  1RZ4 A;  1Z6T A;  3BWG A;  3TDU C;  4E7I A;  2XV4 S;  1S8N A;  3ZMU A;  2HVQ A;  3E6B A;  1I5Z A;  2FML A;  2RQP A;  2D1V A;  4UUS B;  1T0F A;  5IYC J;  1UEL B;  1FYK A;  5K7Z A;  2XRN A;  2PEX A;  2P8T A;  3LSP A;  2IVM A;  2X51 A;  3MAJ A;  4XQF A;  4G12 A;  4CYD A;  1YQA A;  2R7O A;  5CVR A;  1FSE A;  2QM3 A;  2H8R A;  1AA7 A;  4B47 A;  1Y6I A;  2QSG X;  3PNY A;  3VOE A;  3EDP A;  2P0W A;  1QBJ A;  4M6Y A;  3SFZ A;  3ABK H;  2R7S A;  4N4O B;  2XRO A;  1PDN C;  4B4C A;  2OCE A;  1ZQ3 P;  1ZGJ A;  4EVI A;  1K6Y A;  2RKH A;  3OOU A;  2KLO A;  1G59 A;  4HLX A;  1TWA J;  3ISP A;  2R3S A;  5LHI A;  2B7E A;  1X3U A;  3LFU A;  2ZNZ A;  3CJQ B;  3BRO A;  1J0R A;  1R5H A;  2ACJ A;  2HVS A;  2WTE A;  2CFX A;  2UXX A;  4JQF A;  3OY9 A;  1MSF C;  2OU2 A;  2VQL A;  3AL0 B;  1SD7 A;  3GZ6 A;  4XRF A;  2CGP A;  3S3M A;  1I6X A;  3GTP J;  3I54 A;  2L9S A;  4ZC3 A;  4PDK A;  3HOV J;  3SZT A;  2R7F A;  2DN0 A;  5IYD J;  1OR7 A;  1FLI A;  3E0J B;  4D7N A;  2ZME C;  5EZG A;  5E1X A;  2X6O A;  2AXL A;  2P6T A;  2DO7 A;  5JLX A;  5B1A H;  5D5U B;  2ZNY A;  1SD5 A;  3OR2 C;  3Q9V A;  2K9M A;  2V9K A;  2FUG 2;  2ICW G;  1J7K A;  2XF7 A;  4BJ6 C;  3HOT A;  1D1A A;  3VYU B;  4I99 C;  4YEJ A;  3LSJ A;  2IS1 A;  2IBD A;  1OCT C;  4LG3 A;  1J09 A;  4AYB N;  3VWB A;  1ETY A;  3WTS C;  3BPX A;  5CQE A;  4XNF A;  4XRM A;  3CMA I;  2LKX A;  1A5J A;  5E3M A;  1SFO J;  1BC7 C;  4Y17 A;  1O7F A;  3MMY B;  2LRE A;  1BJZ A;  1B59 A;  4ZYH A;  5FLV A;  3VOD A;  1MNE A;  2LTP A;  1ULY A;  3E1S A;  4KJZ A;  4M3B A;  4DYR A;  3WHB A;  2I10 A;  1ZTR A;  4M73 A;  1YO5 C;  4AVP A;  4HF1 A;  3O2P E;  4M71 A;  5CJ9 A;  2BXZ A;  1R6R A;  3OYL A;  1T6S A;  3ZMZ A;  4UVC A;  5FRO A;  4BKX A;  3TKY A;  1MD0 A;  4UXN A;  5GP9 A;  4U0V A;  3FMS A;  3OIP A;  2HDC A;  1SVL A;  2JUG A;  1DPR A;  4NC7 A;  1O7L A;  3HOY J;  3J81 K;  3VYT B;  1HST A;  2XKO A;  3RJP A;  2DMT A;  3GBG A;  1ON2 A;  2RN7 A;  1FBS A;  1ZN2 A;  2NVX J;  3LMM A;  1UZC A;  2GWR A;  4IQJ A;  3TO7 A;  5AIQ A;  4CCJ A;  4Q5S F;  4N9H A;  4DZJ A;  1V5G A;  1T39 A;  3WU0 A;  3LWF A;  1TNT A;  4G7H F;  2EBI A;  3MKW B;  3ABM H;  3H36 A;  5M3M J;  4RGU A;  3S1N J;  3OYE A;  1Y8R B;  3E6D A;  2O5R A;  1VND A;  2E35 A;  2OF7 A;  3T5X A;  3F72 A;  3WG9 A;  2NVY J;  1ZYR F;  4UB8 C;  5E1W A;  3LA7 A;  5C4J J;  2YS9 A;  2HNH A;  2E1C A;  1LQ1 A;  2VI6 A;  3WTY C;  2ME0 A;  2FQ4 A;  2H94 A;  2M0M A;  3HZJ A;  4C9Y A;  3QP6 A;  5KVR A;  4ZYG A;  4L0Z B;  3QOE A;  2HYJ A;  1WH7 A;  2H6C A;  1W4M A;  2JT1 A;  1RET A;  4ITV A;  1UG0 A;  4ZYA A;  1O3T A;  5IPA A;  3GX4 X;  4A0Z A;  5J8C A;  5F1J A;  3E7L A;  3F6V A;  2ZKZ A;  1IW7 F;  2KIF A;  3M8E A;  5ICC A;  1ETK A;  2QCO A;  1AU7 A;  2CUE A;  4IHW A;  3I53 A;  3RKQ A;  2FA5 A;  5A2Q K;  4A3K J;  3HYI A;  5K5O A;  5JVT A;  4QWQ A;  1KU9 A;  4RGX A;  2KPM A;  3MD2 A;  3HRT A;  4IRI A;  4FAS D;  1MDM B;  5IP7 J;  3NAR A;  3E6C C;  1MZB A;  3LSG A;  1BR4 A;  2X9D A;  4ESJ A;  2TRT A;  1ONV A;  5K5R A;  1MMA A;  2KDZ A;  1YHQ I;  1SFK A;  3B6A A;  3CCR I;  1OCR H;  2VIX A;  3I9V 2;  5E8G A;  3L2R A;  2H1L A;  1P4W A;  1MW7 A;  4OIO F;  4HYE A;  3JTG A;  3FDY A;  2M2E A;  5CVJ A;  5HLI A;  3A01 A;  2JRM A;  1X2N A;  2VLA A;  3FXM A;  2NS0 A;  3LQR A;  1R36 A;  2XRL A;  3FXU A;  4RGR A;  3AG1 H;  5FLM J;  1RKT A;  5GAG J;  3WTZ A;  2HFH A;  1YIT I;  3CJR B;  2EZK A;  2IGK A;  4BHP A;  5ICE A;  1LEB A;  3FHZ A;  4HSR A;  4R8H A;  5E3N A;  3PSF A;  2XDV A;  2YU3 A;  3CLQ A;  2R92 J;  1ERD A;  3HEF A;  3I0T A;  4BQO A;  1XN7 A;  1U78 A;  5D5X B;  2V4J C;  3EUA A;  2L9V A;  1B8I A;  5IT9 K;  3IH4 A;  1VQP I;  3GZN B;  2DT7 B;  3DKX A;  3PFI A;  1K6O A;  4L0Y B;  1EV7 A;  2ISZ A;  2WAD A;  3HTS B;  1DU0 A;  1MBH A;  1DGR M;  4KUM A;  2MD0 A;  1OCZ H;  2IS4 A;  4MO7 A;  5HLG A;  1HBX G;  1BC8 C;  2H27 A;  1IO2 A;  3SXY A;  4OIR F;  1A31 A;  1NHA A;  3RPU A;  2X85 A;  4BEH A;  4LB5 A;  2BHZ A;  5J1U A;  3RI4 A;  3ABL H;  3HKZ A;  1ETW A;  3RIR A;  2Z2S B;  2L7F P;  2TDX A;  2Q1Z B;  3IRR A;  4AIH A;  2RC4 A;  4XRS A;  5KK1 A;  4F7Z A;  3KLN A;  1SC7 A;  3ZRG A;  2R7W A;  5FKL A;  4EM1 A;  1PP7 U;  3BLY A;  3J80 K;  1WJF A;  4M9X A;  1CQT A;  2LLK A;  1B1B A;  4D0P A;  2K5C A;  2KZG A;  5D6E A;  4NC8 A;  1K78 A;  3V8L A;  1OMI A;  4Z2Y A;  2BVL A;  2P81 A;  3H9G A;  4GRI A;  4IKF A;  4XK4 A;  1ZG1 A;  1QO0 D;  2IEK A;  4FX4 A;  4HX8 A;  1DP3 A;  1U2W A;  1Y1V J;  2NS8 A;  2YX7 A;  1W7P D;  3ELK A;  2XGX A;  4F91 B;  4J01 A;  3CTA A;  1PUF A;  3OL4 A;  3K9T A;  2PMU A;  3BJA A;  4AM3 A;  2DA3 A;  3N05 A;  2BE5 F;  4BU2 A;  3ZMT A;  1Z05 A;  3ZGK A;  2KHM A;  5E17 F;  1X4O A;  3E97 A;  2HWV A;  4CCO A;  4OIQ F;  3K1M A;  2W24 A;  3CZ6 A;  1LUJ B;  1B6A A;  3BY6 A;  3OYB A;  5M5Y J;  2GA1 A;  1RUN A;  2CH0 A;  1HSJ A;  1YRN B;  3ZQH A;  3HSR A;  2CUJ A;  1FIP A;  5F64 A;  1MBE A;  2EA4 A;  1S9H A;  1IC8 A;  1IN7 A;  3HXL A;  4L9N A;  5HS7 A;  3AG4 H;  2OZU A;  1ETQ A;  5K5Q A;  3A1Y A;  2CFO A;  4ZJZ A;  1TWH J;  2DFI A;  1ZR4 A;  3CLO A;  2VJ5 A;  1IRG A;  1KZH A;  2A07 F;  2KMU A;  4N0B A;  4HV6 A;  1HKS A;  3PQK A;  3S2W A;  3GEZ A;  2VBX A;  3KP4 A;  3M1C A;  2V79 A;  2OTL I;  2OZ6 A;  3V7R A;  3WTV C;  1TC3 C;  2M7B A;  4WXD A;  3OL3 A;  1FT9 A;  3OMY A;  1USS A;  1TT0 A;  5CVU A;  4W97 A;  3OS1 A;  2KJB A;  2ZFU A;  1YIO A;  4KT5 C;  2VBZ A;  2DFH A;  2KL4 A;  2JPB A;  5CLS A;  2BY3 A;  1CF7 A;  4IHX A;  1U8R A;  2ELH A;  4MFE A;  1FIA A;  2DQL A;  4BS9 A;  3KZI C;  2QGU A;  4U0Y A;  1AKH B;  1VQ5 I;  5EG0 A;  4G7O F;  4ESB A;  1YX3 A;  4AIK A;  3GF2 A;  3HRM A;  2K9S A;  4O3M A;  5FKK A;  2HU9 A;  3VSL A;  2L02 A;  3BDD A;  1AOY A;  2W25 A;  3HOU J;  4U7B A;  4KNY A;  2M0C A;  4RB1 A;  2KQR A;  1XGN A;  2CW7 A;  1W5T A;  3L1P A;  1W5S A;  2W00 A;  2NRA C;  1UG2 A;  5FLX K;  2QBY B;  3BJO A;  4CCK A;  2LOO A;  3HRS A;  1E2X A;  3R0A A;  3CUQ A;  1GV2 A;  2GXB A;  1UFM A;  1ZH5 A;  1WPK A;  4OMY A; 
#chains in the Genus database with same CATH homology
 4XR6 A;  3A4C A;  2KZV A;  2R7Q A;  3RSN A;  4XMY A;  3S93 A;  3OYN A;  4XON A;  2E1M B;  5HVQ C;  5TGT A;  1T0F C;  4PJL A;  3EUK L;  1VZ0 A;  4NQW B;  4CH7 A;  3DPT A;  2R7U A;  3BCA A;  3MKZ A;  4OWR B;  2VQC A;  4YRV A;  4E7L A;  4BXF A;  2KP6 A;  4XM3 A;  3RPU D;  3QYE A;  4PSW A;  4CCN A;  3VDX A;  3LSI A;  1QHG A;  3SYT A;  2RRE A;  3UR3 C;  4N4N B;  4LIU A;  4AVZ A;  3L2V A;  2HDW A;  3DTE A;  2MYS A;  1BR1 A;  1WJA A;  4D1Q A;  4CUG A;  4CCM A;  4BE1 A;  3FHN A;  3OYJ A;  1HA8 A;  1D0Y A;  3IP4 B;  3PUB A;  4HG2 A;  2DT6 A;  2DXI A;  3DQV C;  3DTI A;  4XKW A;  2LBF B;  1V5F A;  2VL8 A;  4OAZ A;  3ZQQ A;  2LBF A;  1WFX A;  1X1D A;  2OUM A;  3S8P A;  1X19 A;  3OYK A;  4PJM A;  2CV1 A;  3NWT A;  3K4J A;  3PL8 A;  4PJN A;  5CKT A;  4NUB A;  4Y4R A;  3OYG A;  2IGM A;  1PYV A;  2WAE A;  4E7I A;  2DOA A;  4F55 A;  4DOZ A;  4E4H A;  2HVQ A;  4ANJ A;  1D0Z A;  2KDO A;  3C2H A;  3H5R A;  1UEL B;  3U21 A;  3AL0 C;  4AU7 A;  2L7K A;  3IAS 2;  1E0E A;  3K4N A;  3OYD A;  1X1C A;  2E5Z A;  2VB6 A;  1Z3X A;  1SAU A;  4JOM A;  4E7J A;  3OS0 A;  2X51 A;  4XQF A;  4XOP A;  2Z1D A;  1WJE A;  4P1W A;  2X1E A;  2OV7 A;  3K70 C;  4ZTJ A;  1OR7 C;  2R7O A;  2UWM A;  5FRN A;  2LC2 A;  2X6X A;  1N75 A;  5HNH A;  1AA7 A;  4B47 A;  1Y6I A;  3D5R C;  3K4L A;  3PNY A;  3CF2 A;  3OS2 A;  3M8J A;  2CMP A;  2M7A A;  2P0W A;  3KYL A;  4J00 A;  1WJB A;  1D1B A;  2R7S A;  4N4O B;  1DGW Y;  2W4S A;  2IGN A;  3TBI A;  1K6Y A;  2JA2 A;  3OOU A;  3SZG A;  2KLO A;  4KT6 A;  1G59 A;  1MND A;  1NG7 A;  4YEL A;  1MMN A;  3OWT A;  2JSP A;  1W36 D;  1Z3Y A;  4HNU A;  3L2Q A;  1BR2 A;  2VJ4 A;  4E6K G;  3LFU A;  3CJQ B;  4KIS A;  3K4M A;  2HPI A;  3PFY A;  3PNT A;  3HL2 A;  2HVS A;  1P9Q C;  1QHH D;  3V42 A;  4JQF A;  3OY9 A;  4G6T B;  4BQQ A;  2VQL A;  3AL0 B;  3BG6 A;  3S3M A;  1LDK B;  2L9S A;  4BE2 A;  3A2K A;  4ZC3 A;  3FBI B;  3ONQ A;  2WAF A;  5CQG A;  1ZEL A;  4LIV A;  2LRD A;  2PJR B;  2R7T A;  5CPR B;  2K9L A;  3EPZ A;  4CZC A;  2OC6 A;  2W82 A;  3E0J B;  2E60 A;  3VSK A;  2R7V A;  2R7X A;  1MMD A;  2VKH A;  3F9K A;  4NNJ A;  3OR2 C;  2K9M A;  3DU6 A;  2V9K A;  1V5E A;  4QPQ A;  2FUG 2;  3VYS B;  2PMZ A;  2XF7 A;  3LL7 A;  4BJ6 C;  4D9J A;  5HLT A;  1Y56 A;  1D1A A;  3HOT A;  2ZSH B;  1FMW A;  3VYU B;  4YEJ A;  2IS1 A;  4LG3 A;  1J09 A;  3RCO A;  3VWB A;  5CQE A;  4XNF A;  2WB1 A;  3SEQ A;  4RMN A;  3MMY B;  4BUP A;  2LRE A;  2QKL B;  4BEH B;  3J7A Y;  1MNE A;  1LFP A;  2IGO A;  3QOD A;  2WY7 Q;  3E1S A;  4KJZ A;  3W2W A;  4BJT A;  3HUG B;  2VAS A;  3OYL A;  1R6R A;  1GLN A;  3OYF A;  4XKV A;  5FRO A;  3HPH A;  2CV2 A;  2Q2E B;  3AKZ A;  3OIP A;  2JUG A;  2E5N A;  1YX5 A;  4DIQ A;  2XAU A;  3CP8 A;  1LKX A;  4NC7 A;  4U87 A;  2V7F A;  3VYT B;  3HC7 A;  3MKY B;  4B43 A;  3GBG A;  4DGW B;  4PFP A;  4XKC A;  1X4P A;  3LMM A;  4XKB A;  4IQJ A;  3S3N A;  2F6C A;  4F92 B;  4CCJ A;  3UNG C;  3I3L A;  3PJR A;  1N78 A;  3H5N A;  4XOR A;  3RQ4 A;  3PNV A;  4C2T A;  1V5G A;  4CCL A;  4B3X A;  5LFA A;  1W36 C;  3MKW B;  1NG6 A;  1YE9 A;  2F5V A;  3OYE A;  2O5R A;  3DPL C;  2M4K A;  2JVH A;  2HPM A;  4BAC A;  4FET A;  2LY2 A;  5LD2 C;  1UAA A;  2HNH A;  2CW8 A;  4C9Y A;  2M0M A;  4X0G A;  4HRI A;  3QOE A;  3VYR B;  2Z16 A;  1QU3 A;  2XC7 A;  3H5A A;  4ZYA A;  4ITV A;  1UG0 A;  3C2G A;  2CV0 A;  4DBR A;  2LYC A;  3ZCO A;  1G8X A;  3ZR8 X;  3DKY A;  4KIT B;  3LSH A;  2A6T A;  3H9J A;  2AQE A;  3BCB A;  4DJA A;  4HNT A;  2BVM A;  2IXS A;  2W7N A;  1BOB A;  1JI8 A;  2KPM A;  3MD2 A;  4ZTF A;  3LSM A;  3H35 A;  4HST A;  4FAS D;  4BDZ A;  4DBQ A;  4OAY A;  3LSG A;  1BR4 A;  4CA0 A;  1MMA A;  2XF6 A;  1SFK A;  1T95 A;  3DTK A;  3OYM A;  2VIX A;  3I9V 2;  3L2R A;  1D0X A;  1MW7 A;  2V1N A;  3FDY A;  4XN0 A;  2VLA A;  4F52 A;  2RQQ A;  2X1D A;  4F93 B;  3D5S C;  2IS2 A;  3K4B A;  3CJR B;  3TMO A;  2IGK A;  5HOO A;  2DCE A;  2HZD A;  2HQA A;  4HSR A;  1Z21 A;  2ELJ A;  3PSF A;  2XDV A;  1ERD A;  2WY8 Q;  2L9N A;  2VJI A;  2PJR A;  4BQO A;  3H0D A;  2V4J C;  3EUA A;  4QPO A;  5KCM A;  2K3P A;  3DPU A;  4HEA 2;  1IRX A;  3W2A A;  2DT7 B;  3DKX A;  4RLF A;  4PJJ A;  3G2B A;  3HG9 A;  2BW3 B;  3W3C A;  3S32 A;  4BJ5 C;  2ZXI A;  2WAD A;  2BW3 A;  2VQH A;  1DGR M;  4CSW A;  2MD0 A;  2ZSI B;  2IS4 A;  2KRH A;  4Y3O A;  4B44 A;  1D1C A;  3EUH C;  2XF5 A;  3K10 A;  4BEH A;  2X85 A;  2IS6 A;  1KON A;  3HKZ A;  1LVK A;  4LIT A;  2AQF A;  3ZXS A;  1X1B A;  3QYB A;  2Z2S B;  3OR1 C;  1FMV A;  3SDB A;  1TZL A;  2MC4 A;  3DEE A;  2Q1Z B;  3ZRG A;  3SEZ A;  1PJR A;  2R7W A;  2L2O A;  2VKD A;  2HVR A;  2M4G A;  3BLY A;  4RLQ A;  4XLH A;  1WJF A;  2X1C A;  2JVG A;  2K5C A;  4RM3 A;  4IX7 A;  2NOJ B;  4NC8 A;  1U0J A;  4PK4 A;  2V6E A;  2V26 A;  2BVL A;  3H9G A;  4GRI A;  4IKF A;  2MAB A;  1WJD A;  3CMM A;  4BGD A;  1WJ5 A;  1DP3 A;  3KX2 A;  3QYF A;  2CUZ A;  1N77 A;  4RM2 A;  3NWS A;  4Y33 A;  4F91 B;  1MMG A;  4J01 A;  4XLA A;  5HNF A;  3OL4 A;  4BDY A;  4ZDO A;  1OLT A;  2W1O A;  4XLC A;  3K4C A;  3N05 A;  4II3 A;  4BU2 A;  3OYH A;  2Y0S A;  2L5Q A;  3ZGK A;  2KHM A;  2UUZ A;  1X4O A;  3K4K A;  4CCO A;  4XLE A;  4ZDL A;  3CZ6 A;  3TL4 X;  3DWL E;  3OYB A;  4E7H A;  4F3Q A;  2CH0 A;  2UV1 A;  4ZDP A;  2F4I A;  2X6W A;  3L2W A;  2CUJ A;  4R79 A;  4XOT A;  4II2 A;  2A5W A;  2XSJ C;  2BOL A;  5KHD A;  1S9H A;  2LH9 A;  2M3A A;  3HXL A;  2X6Y A;  3DLA A;  2RNG A;  3A1Y A;  2CFO A;  4E7Z A;  4ZJZ A;  3OIQ A;  4BL0 B;  2VJ5 A;  4PSX A;  2KMU A;  2GOM A;  3H9Q A;  3K6G A;  2MFZ A;  1Z7L A;  5FRM A;  3IAM 2;  4H4K C;  3M1C A;  2KRC A;  4XLF A;  5JHF A;  4E7K A;  4B48 A;  2M7B A;  3HPG A;  3OL3 A;  2VXD A;  5KNL A;  1EA3 A;  2VXZ A;  1DQU A;  2E1M C;  3D5L A;  1X1A A;  3BC8 A;  4PUS A;  3OMY A;  4IZZ A;  1TT0 A;  2GOX B;  3HOS A;  3DU5 A;  3AFH A;  4MLO A;  2I8D A;  3OS1 A;  4BE0 A;  3L2U A;  4EAT A;  4C2U A;  2DJI A;  2ZFU A;  3IUO A;  3CP2 A;  2KL4 A;  2CS3 A;  2WA0 A;  3OYC A;  4E7S A;  2ZXH A;  2LG4 A;  4P5O A;  4BS9 A;  3CES A;  4IQ4 A;  3S3O A;  4BQN A;  2VPL A;  1YX3 A;  3RTR A;  2R7R A;  2R4G A;  4C30 A;  3FBN B;  2VQG A;  3W2V A;  2HU9 A;  3VSL A;  2QKM B;  2VJJ A;  3BG7 A;  3LSK A;  4PFO A;  2WBM A;  1WJC A;  3KEY A;  4U7B A;  2KQR A;  2CW7 A;  4HPQ A;  3OYA A;  2WAQ A;  3FKJ A;  3OYI A;  2W00 A;  3PSI A;  3K70 D;  2LY1 A;  4XN3 A;  4AYB A;  4CCK A;  2LOO A;  4XL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...