3BJAA

Crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
GMNNRELYGNIRDVYHLLQKNLDKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKKHLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family, putative
publication title Crystal structure of putative MarR-like transcription regulator (NP_978771.1) from Bacillus cereus ATCC 10987 at 2.38 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transcription regulator
total genus 41
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bjaA00
3QOPA 3WTZA 1RI7A 3FMQA 4HDUA 2JTVA 2P4WA 3F23A 1ZGAA 3GFLA 4P5OA 2STWA 3L00A 3R6SA 4Q48A 1R7JA 2F5FA 3ZMTA 3F6OA 2FU4A 4UNOA 2WTEA 1BJAA 2FBIA 3KCCA 2F5EA 3O6BB 3VODA 3IRQA 4KIBA 2NAZA 2E7XA 3EUHA 1S8NA 4M6XA 1TNSA 1ZAOA 2PI0A 3KZZA 4UV9A 4QWQA 1P4XA 1WWXA 2JSCA 2AS5F 2VE9A 2IT0A 2F2EA 1UCRA 5KVRA 1EH8A 2H6BA 4ZYDA 4L0ZB 4E70A 1D8JA 3PQJA 2EWNA 4HX7A 5AIPA 2GXGA 2C6YA 5DUIA 5E8GA 3TKYA 4KA4A 3CUQC 1BIAA 2QBYA 1UHMA 4HV6A 3R61A 2QBYB 2NRAC 4RB3C 3T1BA 2W24A 3ZP5A 1K7AA 2PMUA 3WTVC 4L9JA 1WKMA 3WTTC 4HLYA 4ZZDA 2XKOA 5LHIA 5FD5A 4R1HA 1O57A 2QZ8A 3WGHA 2O61A 1W7PA 4LMYA 2YR2A 2YX7A 2YU3A 3E6CC 1KYWA 2ZBKA 1KA8A 4JBAA 3ELKA 5KK1A 4AVPA 4H0EA 1I1GA 1P4WA 5DYMA 1KQ0A 1YFHA 3U9GA 2FE3A 3I64A 4Y15A 3FXUA 1U78A 1IRFA 1I1SA 4WF2A 1HKQA 2L02A 2CG4A 1ZLKA 1ZRFA 1USTA 4WCGA 5CVUA 2DFIA 4LD5A 5L3FA 2HYGD 3ZMVA 3COAC 1KGSA 4HBLA 5D6EA 2ZCWA 2CGPA 4FT8A 4LLLA 3WGGA 3V8LA 3VB2A 4ENKA 2K27A 4RB0A 5CLSA 4BHCA 1Z9CA 1DUXC 2V1XA 1XGOA 1I27A 4HYEA 5CVIA 4I0AA 2DQRA 2EFNA 1I5ZA 3V8JA 1L3LA 4U7BA 3ISPA 5DDGA 4WXCA 2P8TA 3T5XA 1IN5A 1XDSA 1R22A 2ETHA 3K1PA 1B9NA 4UXNA 1R1UA 4EV0A 1PP8F 4G94A 1HSTA 2V1DA 3DQVC 1FOKA 2VE8A 2G7UA 4WXHA 3ZN1A 3HIFA 4I0BA 2L4AA 4PDKA 2MH9A 4U0YA 4B8XA 2XIGA 3J80Z 2ZMEA 1HXDA 2Q8KA 4KUMA 3C18A 3RTRA 3Q9SA 4U0VA 3ML6A 2Y0MA 1EV7A 4IHTA 1OKRA 4LB5A 4GXOA 2W84A 5LRSA 1B59A 2BE5F 4O5VA 1OPCA 1W4MA 4LJZF 2XHKA 3FZVA 1BIBA 1G3TA 2PQ8A 1QO0D 3P9IA 3R0JA 4L9TA 5ICCA 2X0LA 3CUQB 3RI4A 3ZMUA 4G7ZF 1DP7P 1UB9A 2Y75A 5E20A 2EB7A 3E6MA 5FFZA 2EA4A 5DUKA 4EJTA 3D0SA 4AIKA 1OYWA 2K4BA 4OMYA 2X4HA 1TQPA 4NQWA 4P9FA 3V7SA 3SQNA 3P9KA 2P5LC 4MHGA 3TDUC 1HQCA 2FNPA 5JFRA 2IA1A 1ZHFA 3ZPLA 3B73A 2ZXJA 1MGTA 4UVAA 2BGCA 3KP2A 1IUYA 1FYMA 4WXDA 1XMKA 2Y48A 3EQLF 3K0LA 5IT9K 2O8XA 2OU2A 1DPUA 2IJLA 1J9IA 1F5TA 4XSZF 3DXJF 4L18B 2HQRA 2ISZA 3KP5A 3I59A 5J8CA 4A12A 3RPQA 1ZARA 3I59B 4B09A 2DK8A 1KU9A 2NS0A 1YW7A 5IT3A 2HS5A 1SD6A 1O7FA 4YIFA 2XAHA 2FOKA 2E1CA 5HVQC 4MTEA 2HFHA 3WODF 4IPAA 3SFZA 5HS7A 2K4JA 5LBQA 2J5OA 2MLGA 3ZMDA 3Q9VA 2FA5A 3V7CA 1ZN2A 4ESJA 5EEHA 1QNTA 4Q5SF 3ABTA 1T39A 1ON2A 4Q4ZF 1PUEE 1ZRCA 3F8FA 3F72A 5FGMA 4RAZA 3LA7A 1BC8C 5HDNA 5CJ9A 2EJRA 4M9XA 1YQAA 2V1UA 1IN7A 1QGPA 4BAYA 4R8HA 2RQPA 2FNAA 2EV6A 2GIVA 1BOAA 2ZFWA 3KE2A 2EFPA 1ZH5A 4TV7A 5L3CA 4YG2F 2WWYA 3BOQA 1A04A 3O3KA 3GX4X 2PFBA 1O7LA 2RN7A 2RNJA 1G3SA 1FC3A 5LGUA 4N9IA 3DPTA 2R7DA 2IP2A 4I02A 5D5WB 1YW8A 4IJAA 4HX4A 3OV8A 1K78B 3TGNA 2E7WA 2D45A 3T8TA 3GUDA 4RGUA 1BM9A 1C0WA 2L4MA 4XLNF 3KETA 3SHFA 3SZTA 3GO5A 3WE2A 1TQMA 3V8KA 3HRTA 4LB6B 3LA2A 4G6DA 1FT9A 1YTYA 5AIQA 1YS6A 1IRGA 2YX4A 2A6EF 1WQ2A 4QLCU 1V3FA 1GVJA 3QPTA 4A2UA 4L0YB 1U5TA 5ERIA 2L3DA 1ONVA 3HRUA 4UHTA 1YLFA 1TW2A 5HOOA 4EM1A 2XKPA 1HW1A 2F5CA 4HOBA 1J2XA 2FF4A 2QWWA 4EJVA 4CZZA 2VBYA 1OMIA 1FX7A 2O0YA 1TQIA 2DAOA 3HOTA 3MZHA 1U6GA 5DCMA 3L2CA 1S6LA 2HKXA 4BHPA 5DCMB 4M9SA 1LVAA 4YFNF 4ENNA 3MQ0A 2ZJ2A 1HKTA 1KU3A 3HUGA 3M1EA 3IWZA 1D5VA 6PAXA 2BBYA 1ZREA 4Z2YA 1P6RA 5CVVA 4RGXA 2ZNZA 2H09A 3FXQA 2A07F 4P55A 1TTYA 4UV8A 1BI0A 3ECOA 1LNWA 5HS9A 1U2WA 3H3UA 2XVCA 4PCQA 2HDCA 1B6AA 1YIOA 2PLYA 1W7PD 4XRFA 3ROUA 3N97A 3EYYA 5FFXA 2FRHA 2HTSA 1NHAA 1I6XA 3I0TA 1G3WA 4ESBA 3I54A 4HQMA 2DU9A 3QRFF 3J81Z 4M71A 4CICA 4G8XA 3U2RA 2KKOA 5JHUA 4EQQA 2RDPA 2IRFG 4KN7X 2TDXA 4G9YA 1SFUA 3M8FA 4KICA 1DPRA 4I01A 1P4AA 2D1VA 3B02A 2VODA 2XUBA 5L3BA 3ULQB 1Z91A 1RUNA 1STZA 2Z99A 2G7HA 1O3TA 1ZGJA 5E1WA 4D0PA 4IXAA 5HLGA 1Z6TA 1LDDA 3I58A 4GCVA 3J7AO 4L9NA 1MZBA 2HTJA 2GWRA 1FY7A 2JPCA 1PDNC 2MD5A 3K9TA 1J0RA 2M87A 4UVBA 1W7PB 3DEUA 1QZZA 2XGXA 3BDDA 4HF2A 2HOEA 2A5YB 3DF8A 1RIOH 3TOAA 3AAFA 1IZ1A 2LKPA 1F4KA 1T6SA 1KQ8A 2EV5A 3CDHA 2OAZA 3K1NA 5D6FA 3IRRA 1XB4A 1FWZA 3CO6C 4HQEA 3CUOA 5L3GA 1YS7A 1X3UA 1Y0UA 2MBFA 4ZYGA 1T2KA 4MQVA 4IRHA 1H0MA 2XRNA 1PP7U 1FP1D 3G73A 2O03A 2PEXA 3K2ZA 3LQRA 4LK0F 4U7DA 2XASA 2RV8A 2Z9OA 2JZYA 4WX9A 1G6NA 3W6JB 4XBFA 1XGMA 3E5QA 2QLZA 3BJ6A 1IN6A 3CJNA 3R4KA 1XN7A 4KIGA 5E1XA 5J6XA 5TJJA 3JAMK 3P9CA 2PBIA 1J75A 1FYLA 3JTGA 4BXUA 2DI3A 2P6TA 3T0YA 2HWVA 4OIRF 4CGZA 3WE3A 5K1YA 1P2FA 1D3YA 5BOXA 5JI6A 2DPDA 3BZ6A 3IKTA 2VT2A 4MQ9F 1WSUA 2YSRA 3IWFA 1B9MA 4CYDA 1YG2A 2HEOA 4MTDA 3HTUA 3F8BA 5LHHA 2XROA 2ZMEB 2KIMA 2VBZA 4EM2A 1R00A 5LEJA 1JHHA 3JSPA 2K86A 5FLXK 4G7OF 5H6QA 5BPIA 3RYRA 4CDGA 3MZYA 1EH6A 1GXPA 1JE8A 3F21A 1UFMA 2OZUA 1SAXA 1T98A 3GVAA 2WV0A 2VOPA 1R23A 3K69A 2VOOA 1RUOA 3DV8A 1JGSA 4CO8A 4HF1A 1FZPB 2W25A 4S05A 4PGGA 1HSJA 2VC0A 2O6GE 3JW4A 4ZH4F 2FEZA 5ICGA 4ZYHA 1GHCA 2QM3A 1U5TC 4FX0A 3M8EA 4Q47A 2A3SA 3M7GA 1OYYA 1XGNA 3RYPA 1TW3A 3QPHA 1VTNC 1QPMA 1IXCA 5JR3A 1TBXA 2M5WA 2JPBA 4RGRA 2B0LA 4U88A 4LG0A 1JXSA 1Q1HA 1O3QA 2DW4A 3MCZA 4M9ZA 1XDUA 4L5IA 2Z5UA 5F64A 2NNYA 3PFIA 3KEOA 3TO6A 2GA1A 1XMAA 2L54A 2IW5A 4A5MA 3MEXA 2HZTA 3GEZA 1XSVA 2EFOA 5F1RA 1F9NA 4L9VA 2UZKA 5LGNA 1ODDA 1BC7C 2RVCA 3F3XA 2FBHA 5EEGA 4FHTA 1HKSA 5F6FA 5E17F 3TO7A 3GFMA 1WI9A 5CVRA 2BV6A 3H3ZA 4KNYA 4BNCA 3BP8A 5DCFA 3FXRA 2EA2A 1R36A 4G6QA 4ENJA 2ADUA 1R1VA 4EMSA 2FQ3A 4U0WA 1KYZA 2W85A 4WWCA 1YYVA 2KIFA 1RNLA 1K6OA 1H9GA 2PMHA 2MH2A 2XAGA 3CLOA 4JK1X 1LDKB 3ECHA 4OIQF 1FSHA 1FBUA 5LLQA 4IRGA 5IT9Z 2KJBA 4HDVA 1S7OA 4ESFA 2IVMA 3F6VA 3VFZA 1E2XA 4AIHA 4P9UA 1L0OC 2HYFA 3DP7A 5BMZA 5LEKA 2COMA 2DPUA 4UUVA 1REPC 3KEQA 2EFWA 3TOBA 2V9VA 1TNTA 4Y13A 3SZPA 3F8CA 2EFQA 4Y17A 2GA2A 3LAJA 4A5NA 4M73A 3PQKA 1LEBA 3G3ZA 2H6CA 4HF0A 1S7AA 4LFUA 4GYIA 4EJWA 3GXOA 3S2WA 2IPQX 1OYIA 5D5XB 1W5TA 2ISYA 3KLOA 4JQFA 3ZMSA 4DNCA 2L01A 5K5RA 1OR7A 1ZYRF 4XSXF 3WTXC 5DD4A 5FB2A 5LHGA 3T8RA 3NQOA 4R79A 2DO7A 2XAQA 1U5TB 1MJBA 5K5QA 2FSWA 3BROA 2RKHA 3RKWA 3L09A 3ERED 4YIIA 3KZYA 5E18F 1U8RA 1O3RA 3IKVA 1CGPA 1QQIA 2ACJA 3GZ5A 2M30A 4IVNA 4P96A 2K02A 4K2EA 3KP6A 3F22A 2OZ6A 2UXXA 1AOYA 1FSEA 1FNNA 3RKXA 4HA8A 3WTUC 3GWZA 2W57A 3ZQ7A 2D1HA 2KIUA 3BPVA 4BHBA 1KU7A 2Z3YA 2CO5A 2QUFA 5LRRA 4M74A 3FM3A 4OIOF 2IA2A 5JVTA 1K79A 1QBJA 1G3YA 3D5LA 3HRSA 5FO5A 1SD5A 2JRTA 2O3FA 2V6CA 5D5VB 4IF4A 3IHUA 5BQTA 3QP6A 2UXNA 5CVJA 2P7VB 3P7NA 4O3MA 1B1BA 3V7RA 3FHZA 2OBPA 1IAWA 4HW0A 3QU6A 3HYIA 2FXAA 3QP5A 5DEQA 2VONA 3R60A 1XCBA 1R5HA 2E1NA 3Q5FA 2Q0OA 2GXBA 3KLNA 2J5PA 2QQAA 4A0YA 5K5OA 3GLXA 4RB2C 3JTHA 3U1DA 4EVIA 3ZN0A 3REOA 1V4RA 2H94A 4WK8F 2P7CB 3FF5A 1MDMA 4GYGA 1IXRC 4S04A 2FMLA 3JSOA 1HW2A 1MDMB 1Z7UA 3GW2A 1IW7F 2LNBA 3LSTA 3FX3A 3KP7A 1J5YA 1XSXA 3IL2A 3TQNA 2NNNA 1JHFA 3WTSC 5E8IA 1O3SA 2MC3A 2MLKA 2R7FA 5J8FA 2GAUA 4DQ2A 3WU0A 2GQQA 1ULYA 3EETA 4KFCA 4YFKF 3LAPA 3I5UA 2BYVE 2LDUA 2YPRA 1RZ4A 3E3VA 1BBYA 1LJ9A 4KN4X 3RIRA 3WTYC 2M8EA 4O6JA 2OA4A 2UWMA 4ON0A 4HV5A 2VXZA 2OQRA 1IXSB 3EYIA 3F8NA 3BJOA 3J80K 5CYVA 1FP2A 4HLXA 1BI1A 4HZFA 5ICFA 1SD4A 3HSFA 2CWEA 2P6SA 3E5XA 4MNUA 3GZ6A 1TLHB 2Z33A 4LLNA 1SD7A 4F7ZA 1SMYF 2H27A 1S29A 4KIFA 1Z6RA 1FLIA 4EJOA 5L3EA 3IC7A 3I71A 3E5UA 3DFGA 3GFJA 3HHGA 3I53A 1FBSA 4I98B 3E6DA 2AXLA 4MEXF 2A69F 3CO7C 2A6HF 2MA3A 5TRDA 4M6YA 3KFWX 2CW0F 2CSOA 5DD8A 3L9FA 3MAJA 3C1DA 4AWXB 2ESHA 1UHWA 2M45A 4ENMA 3GYHX 1T38A 2ESNA 2HR3A 1ZG1A 3M9AA 4HAMA 4I7HA 3HHHA 2K7LA 1DDNA 1HBXG 3RPUA 1MKMA 3FM5A 4LK1F 5L3DA 1J59A 4BQAA 1BN5A 4A6DA 2WC2A 1U3EM 2A61A 2G9WA 4ASNA 3R0AA 3MFKA 2VT3A 3O2PE 2EK5A 3JAMZ 1R5GA 2VN2A 3H92A 4EGYA 5AONA 3FMRA 3CUQA 1XD7A 2OD5A 2LF7A 2STTA 2RC4A 2FMYA 1LEAA 4UVCA 3VEPA 1MD0A 2LSOA 2DLLA 3OOPA 4OINF 3BWGA 4RB1A 3GFIA 4OMZA 1G4DA 3BY6A 3BPXA 4KDPA 3WGIA 3LA3A 3CTAA 3C7JA 2DBBA 5HDGA 5ILSA 2R3SA 2CYYA 3FWEA 4LG0B 2D2WA 5ILUA 4N0BA 1R1TA 4CXFA 3LFKA 5D5UB 5D4RA 3HOSA 1XGSA 1MJAA 5FLXZ 2VBXA 2PN6A 1FBQA 2CFXA 4N9HA 1ZRDA 3FMSA 1KQ9A 3HSEA 4RS8A 2DK5A 3TO9A 4HX8A 4A6EA 4GO1A 4BH9A 4GGGA 2HKOA 1HW5A 1IN4A 1IN8A 2XV4S 5D8LB 1ON1A 4OOIA 4IRIA 5HDKA 3E6BA 3VOEA 1ZLJA 2M1BA 3K1MA 4XLPF 4OIPF 3I4PA 3MWMA 1F1ZA 4CHUA 4AD9A 2IA0A 1D8KA 3LWFA 3BJAA 1IF1A 4A0XA 3WTWC 1J7KA 2JT1A 1SFEA 2BEOA 2KJCA 3QAHA 3HRMA 4LGWA 4RAYA 4L5JA 3E97A 2LF8A 1CF7A 1KU2A 2Q2EA 3KP3A 3RKYA 2QQBA 4YFXF 3DKWA 2EV0A 3SXYA 4EM0B 1CF7B 5HLIA 1LQ1A 2QENA 2XAFA 4PGHA 3HTSB 4RGSA 3C3WA 2KRFA 2QYOA 1ZG3A 4M72A 2HGCA 5A2QK 1XCVA 5ILVA 3L7WA 3F8MA 1E17A 2ZNYA 4NB5A 5DV5A 4KT5C 1Z1DA 1S3JA 4MEYF 4BYYA 3GF2A 1K78A 4G7HF 4I09A 4KYWA 2QQ9A 1SFXA 2DT5A 1ZG5A 3LQQA 1FPQA 4PZJA 4LLGF 1B4AA 4OU0A 1AWCA 5HS8A 4KMFA 5E1ZB 2PJPA 4FX4A 5BPDA 3RJPA 2DQLA 3DPLC 3RDIA 3WU1B 1W5SA 4KMUX 2VC1A 1WRJA 2VBWA 1FYKA 5ED4A 4ZZLA 2OQGA 1SMTA 1BI3A 2DTRA 3EDPA 5HLHA 2ZKZA 3V4GA 1H9TA 1USSA 2FBKA 1T0FA 2ELHA 1LB2A 4MGRA 1YO5C 4IHSA 3J81K 1BI2A 1GXQA 3KP4A 5H6RA 3W6KB 3WG9A 4ETSA 4NHJA 2A68F 1EH7A 4AIJA 2CQKA 3NRVA 1Z05A 3ABUA 1LDJA 5H20A 5A2QZ 2QVOA 2XAJA 2PG4A 1P92A 5FD6A 1YW9A 1R58A 5BS6A 4EGZA 3ZMZA 3HSRA 2P5KA 3NEUA 5D8KB 1QZYA 5D4SA 4EJUA 4I2OA 4ZYEA 3N4MA 2P5VA 3TDZC 2GZWA 2NYXA 2V79A 5LGTA 1MJ9A 4A0ZA 5ICEA 2HQNA 3QU3A 1XSDA 2ZO4A 2F5DA 2RGVA
chains in the Genus database with same CATH superfamily
1FTTA 3PM1A 2COBA 3QOPA 3WTZA 1RI7A 1XMXA 3FMQA 4HDUA 1K4SA 1MBEA 1X1PA 4CCNA 2JSPA 2JTVA 2P4WA 3F23A 1Y1WJ 2ICWG 1ZGAA 2AHQA 3GFLA 4PJJA 1R5ID 3S3MA 3H9GA 4P5OA 2ECCA 2STWA 1E3OC 3L00A 3H5RA 3R6SA 3I9V2 5JLXA 4Q48A 5CPRB 1LKXA 1R7JA 2DA1A 4F93B 2F5FA 4XKCA 3ZMTA 2RQQA 3F6OA 2FU4A 3DTIA 4UNOA 5FKLA 2WTEA 3L2WA 3TW7A 5FLMJ 1OCPA 1BJAA 2FBIA 2K5CA 2F5EA 3CJRB 3GLLA 3KCCA 3O6BB 3ZXSA 4KITB 1PYVA 2KZVA 3VODA 5E79C 3IRQA 4KIBA 2NAZA 3JRAA 2E7XA 3EUHA 1S8NA 4M6XA 1BA5A 2HZDA 1TNSA 1ZAOA 3CF5F 2PI0A 3KZZA 4UV9A 4QWQA 1JUPA 3OYLA 1P4XA 2L9NA 2A05A 4OAZA 1WWXA 2JSCA 3TP0A 4ANJA 2AS5F 2VE9A 1S72I 2IT0A 1QRYA 2F2EA 4C30A 1UCRA 5HLTA 4B3AA 5KVRA 1EH8A 1NG7A 4X0GA 4BY1J 2H6BA 4ZYDA 4L0ZB 2A5WA 2XPVA 4RM3A 3MD2A 4AVZA 4E70A 1D8JA 3PQJA 2EWNA 4HX7A 5AIPA 3TL4X 2GXGA 2M9HA 2LVSA 4NC8A 2C6YA 5DUIA 5E8GA 2P81A 3TKYA 3MMYB 4F3QA 1SVMA 4KA4A 1A31A 2I10A 3BR5A 2V26A 3CUQC 1BIAA 3KYDB 2DT6A 2QBYA 1LUJB 4HRIA 2VKHA 1YJNI 1UHMA 2DOEA 3K4LA 4HV6A 3R61A 1MBFA 2QBYB 2NRAC 1NG6A 4RB3C 3T1BA 5K7ZA 2W24A 2IGKA 3ZP5A 1Z3YA 2BY0A 1ZR4A 2PMUA 1K7AA 1VQ4I 3WTVC 2GOXB 2LREA 4L9JA 2PJRA 2IXSA 3PFYA 1WKMA 3QYFA 3FK7A 4BBRJ 3WTTC 3AG3H 3V42A 4XNFA 1TC3C 2PJRB 1ITYA 1P7IA 4HLYA 4ZZDA 2XKOA 5E3NA 5LHIA 5FD5A 3KYCB 2EIJH 2TRTA 2HVQA 1HDDC 4Y7NJ 4R1HA 1O57A 2QZ8A 3WGHA 2O61A 1H89C 4BE1A 1W7PA 4NDLA 4LMYA 2YR2A 2YX7A 2DFHA 2YU3A 3E6CC 1KYWA 2ZBKA 2BXZA 2CW8A 3GCMA 1TT0A 1KA8A 3ZQGA 4JBAA 3PIOF 5IOZA 3ELKA 2XPUA 2EPFA 2ZSIB 2KT0A 3CF2A 5KK1A 3OWTA 4AVPA 4H0EA 1I1GA 1P4WA 5FKMA 1ZK8A 5DYMA 1KQ0A 3IAM2 2DFFA 1YFHA 1K6YA 4M6VA 4ZC3A 3OYJA 4FQGA 3U9GA 1YRNA 4BXXJ 2FE3A 1PUFB 3I64A 3RPUD 4Y15A 3FXUA 1YRNB 1U78A 1IRFA 4ZDOA 1I1SA 4WF2A 3BG6A 1HKQA 2L02A 2CG4A 3JRDA 1ZLKA 1ZRFA 1FOXA 2BY2A 1USTA 4ZYAA 1FMVA 4WCGA 5CVUA 4XONA 1UG0A 2DFIA 4LD5A 5L3FA 1GT0C 2HYGD 3ZMVA 2P0WA 2Y2ZA 3COAC 3L2UA 4BY7J 1KGSA 4HBLA 3JRBA 1POGA 3VSKA 1ZKGA 3FXOA 2L7FP 5D6EA 3A0BC 2ZCWA 2CGPA 2LC2A 4FT8A 4LLLA 3V8LA 3WGGA 1V5FA 3VB2A 2E5ZA 4ENKA 5B5EC 2K27A 4RB0A 5CLSA 4BHCA 2K9NA 1Z9CA 1DUXC 2V1XA 4ZTJA 1XGOA 1I27A 4HYEA 5CVIA 4I0AA 1HC8A 2DQRA 2EFNA 1I5ZA 3V8JA 3JCUC 2R7QA 1VQOI 1L3LA 3KZIC 3LSHA 5J1UA 5EZHA 5EF6A 4U7BA 3ISPA 3H9JA 1E3HA 3WU2C 3VYRB 5DDGA 3PSFA 4WXCA 2P8TA 3A02A 2R92J 2X6WA 1RETA 2PMZN 3T5XA 1IN5A 1XDSA 3C2GA 1R22A 2ETHA 3K1PA 4ITVA 1B9NA 4UXNA 1NH3A 1R1UA 1ZQ3P 4EV0A 2KHMA 4XLEA 3VYUB 3AKZA 2BY3A 3ZCOA 2K9QA 1PP8F 2HOSA 4G94A 1HSTA 5F27A 4BACA 3FISA 2JA2A 2V1DA 3K4BA 2DJNA 4II2A 3DQVC 3BTLA 1FOKA 2PX9A 4PJMA 3IH4A 1VI0A 2VE8A 2X51A 2G7UA 4WXHA 3ZN1A 4GDFA 1FOYA 5KNLA 3HIFA 5FKKA 2IS4A 4I0BA 2L4AA 4PDKA 4G6TB 4E7ZA 2MH9A 4U0YA 2VPRA 4XLCA 3H0GJ 4B8XA 2XIGA 3J80Z 3SDBA 2O8KA 4DW6A 2ZMEA 1HXDA 2Q8KA 4KUMA 3C18A 2BW3A 3FIWA 3RTRA 1V5EA 3Q9SA 4U0VA 1F43A 3K70C 2VB6A 2BW3B 3ML6A 2VI6A 4D5CA 2Y0MA 1EV7A 1SFOJ 2VQHA 4IHTA 3OYBA 1OKRA 4LB5A 2LKSA 2L5QA 4GXOA 2CW7A 3MKWB 2W84A 5LRSA 1B59A 2BE5F 4O5VA 1OPCA 1W4MA 4LJZF 1X4PA 2XHKA 4X6AJ 3FZVA 1BIBA 3BLYA 1ETXA 3HGGA 1G3TA 2ME6A 2PQ8A 1QO0D 1JGGA 2OV7A 3P9IA 1GV2A 2QSHX 3FKJA 2DTZA 1D1CA 3R0JA 4L9TA 2ZJQF 3QOEA 1U9NA 2HYJA 5ICCA 2UV1A 2X0LA 3CUQB 3RI4A 3ZMUA 1JT0A 4G7ZF 1DP7P 5M3FJ 4DGWB 1UB9A 1IV6A 4JOMA 2Y75A 5E20A 2EB7A 3E6MA 2QEXI 5FFZA 2EA4A 2QSFX 1TZLA 5DUKA 1K83J 3CCEI 4EJTA 1ERDA 3C2BA 4E7SA 3D0SA 4AIKA 1OYWA 2K4BA 1IC8A 4OMYA 2X4HA 1TQPA 2F5VA 4NQWA 4P9FA 2CUZA 3V7SA 3SQNA 3P9KA 1U9OA 1XX5A 4C2UA 3IP4B 2WADA 2R7WA 2P5LC 4MHGA 2CUEA 3TDUC 5DTDA 1HQCA 2CU7A 2FNPA 3S3OA 5JFRA 2IA1A 2IS6A 1T0FC 5J4VA 1ZHFA 2RNGA 3K4JA 2CFOA 3LSIA 3S14J 3S15J 1EF4A 1BR2A 3ZPLA 3B73A 5F04A 2ZXJA 1MGTA 4UVAA 2BGCA 1Y8RB 3KP2A 2R5ZB 1IUYA 1FYMA 4WXDA 5EG0A 2DA5A 1XMKA 4HSTA 1A6QA 2Y48A 3EQLF 3K0LA 3GTPJ 2JN6A 4OWRB 2NOJB 3HBLA 5IT9K 2O8XA 1Y0NA 3M8JA 2OU2A 1DPUA 2AQEA 2IJLA 3BCAA 1AKHA 5J4YA 1J9IA 3RQ4A 3K70D 4B4CA 2WAQN 2DMQA 1F5TA 3ZQFA 2V9PA 2W48A 4BQOA 5GPAA 2GLOA 4XSZF 1AKHB 5F0CA 3PUBA 2FD5A 3DXJF 3RZOJ 4IHYA 4L18B 4FISA 2QA4I 4RM2A 1YJWI 2HQRA 2ISZA 3KP5A 3HKZA 1O4XA 3I59A 5J8CA 3SEQA 4A12A 2L0KA 3QPLA 3RPQA 1ZARA 1XS9A 1OLTA 3I59B 4B09A 2DK8A 3FBIB 1DGWY 2DA6A 4QPOA 1R49A 1KU9A 2NS0A 3BZKA 2JUCA 1WJAA 1YW7A 2DMUA 5IT3A 2HS5A 4C3JJ 2OTLI 1SD6A 3OYHA 1O7FA 4YIFA 2LK2A 3L2RA 2XAHA 3RSNA 2IGOA 2FOKA 2E1CA 2NXNB 5HVQC 3EPZA 4F91B 4JX5A 1BOBA 4MTEA 4Y52J 2HFHA 1Y39A 3LMMA 3WODF 4IPAA 1X1DA 3CJTB 3SFZA 4RBOA 3MN2A 5HS7A 3EUAA 3N05A 1W36C 2K4JA 4DYRA 1JJ6C 5LBQA 2J5OA 2MLGA 3ZMDA 5GTHC 3Q9VA 2FA5A 1YX5A 3V7CA 1ZN2A 4ESJA 3VWBA 4E7KA 4IHWA 5EEHA 2HQAA 1QNTA 3JRIA 4Q5SF 2NOGA 2CV1A 3ABTA 1T39A 1ON2A 4Q4ZF 1PUEE 3GTOJ 1WJBA 4NC6A 5IYBJ 5DM7F 1ZRCA 4KT6A 2XF6A 4B1RA 2XB0X 3EUHC 4UUSB 3F8FA 3F72A 5FGMA 2EZKA 4RAZA 3LA7A 1BC8C 3ZRGA 2Q2EB 5CJ9A 2EJRA 5HDNA 4M9XA 3CC4I 3PNYA 3JRCA 1YQAA 5DS9A 2JVGA 3IAS2 2V1UA 1IN7A 1QGPA 4BAYA 4R8HA 2RQPA 2FNAA 2EV6A 2GIVA 1BOAA 2KZGA 2ZFWA 3KE2A 2EFPA 1ZH5A 4TV7A 1RKTA 3L1PA 5L3CA 4YG2F 2WWYA 2B63J 2NVQJ 3BOQA 1A04A 2OUMA 5J47A 3FDYA 3O3KA 2LTPA 4DBQA 2PFBA 3GX4X 3GMEA 3CC7I 1WJDA 2EH3A 1O7LA 1SVLA 2RN7A 2RNJA 3BR3A 1G3SA 1FC3A 4QPQA 5KHDA 5LGUA 3H5AA 4N9IA 3DPTA 2K85A 2R7DA 2IP2A 4I02A 3HG9A 2DA2A 5D5WB 4II3A 2Y31A 3BG9A 1M1EB 1YW8A 3G71I 4IJAA 4HX4A 3OV8A 1K78B 3JRFA 2QGUA 3TGNA 1PVEA 2E7WA 2D45A 3IH3A 3GUDA 4RGUA 3T8TA 1BM9A 1C0WA 2L4MA 4XLNF 3KETA 3HEFA 3SHFA 3SZTA 4C2TA 2LLKA 1MMAA 3DEEA 3GO5A 5IYDJ 4D7NA 3WE2A 3E7LA 1TQMA 3V8KA 4E7LA 3HRTA 4LB6B 1VQ5I 3LA2A 3OYMA 3LOCA 4G6DA 1FT9A 1YTYA 1IRZA 5AIQA 1YS6A 1IRGA 2YX4A 2A6EF 1WQ2A 4QLCU 1V3FA 1GVJA 2R5YA 4UB6C 4XN0A 3CQZJ 1G2HA 3LSRA 3QPTA 2VKEA 1W36D 4A2UA 4L0YB 1J09A 2R5YB 1U5TA 2VQLA 2IEKA 2L3DA 5ERIA 1DGRM 1ETVA 4IL6C 1ONVA 3HRUA 2WA0A 4UHTA 1YLFA 1TW2A 5HOOA 3CC2I 4EM1A 2WB1A 3DKXA 2Y30A 2XKPA 1HW1A 1DQUA 2F5CA 1GDTA 1X2MA 1J2XA 2FF4A 2FQ4A 4HOBA 5B1BH 2QWWA 4AYBN 4EJVA 1H88C 2YUSA 3GTLJ 2KPMA 1V55H 1IV8A 4CZZA 2VBYA 1OMIA 3S3NA 2M8GX 2M0CA 1MMGA 3H35A 1FX7A 2O0YA 1TQIA 2WB1N 1BW5A 3KPHA 2DAOA 3I3LA 3KYLA 1LVKA 3CDIA 3HOTA 1FJLA 3MZHA 1YIJI 1U6GA 3GBGA 1Y6IA 5DCMA 3L2CA 1FMWA 5KAFC 4CCJA 1S6LA 3VYTB 3FKIJ 2HKXA 4BHPA 5H2FC 5DCMB 4M9SA 3IV5A 1LVAA 3S32A 3OL3A 4YFNF 2KRCA 4ENNA 1MSEC 3MQ0A 2ZJ2A 4A3JJ 1HKTA 1KU3A 3HUGA 3TW6A 3M1EA 3IWZA 1D5VA 6PAXA 2BBYA 3H9QA 2XGEA 1ZREA 4Z2YA 1P6RA 5CVVA 4RGXA 2ZNZA 2H09A 3FXQA 2EZIA 2A07F 3CP2A 3NARA 4P55A 4BU2A 4A3MJ 3BQYA 1TTYA 3S17J 4UV8A 1BI0A 4IOCF 3ECOA 1LNWA 5HS9A 2IS1A 1U2WA 4B48A 2IAIA 3H3UA 2XVCA 4G12A 3LSGA 4PCQA 2HDCA 3GTGJ 1UZCA 1B6AA 3BR6A 2QSGX 5IOYA 2DJIA 1YIOA 3E0JB 2V6EA 2PLYA 1W7PD 3UKGA 4XRFA 1W1WE 3ROUA 3N97A 3EYYA 5FFXA 2VJJA 2FRHA 2HTSA 2OC6A 3S1NJ 4DIQA 1NHAA 1I6XA 3I0TA 1G3WA 4XQFA 3QYEA 4ESBA 3I54A 3OIQA 4HQMA 1SEUA 2DU9A 3QRFF 3K4MA 3BG5A 4D9JA 2NS8A 2ZMEC 3J81Z 4M71A 4CICA 2WV1A 3A4CA 3I4MJ 4G8XA 3U2RA 2KKOA 5JHUA 4EQQA 2I8DA 1JT6A 2RDPA 2IRFG 4KN7X 2IGNA 2TDXA 4G9YA 1SFUA 3M8FA 4KICA 3K4KA 1DPRA 1VZ0A 4I01A 5DM6F 1P4AA 4C2MJ 2D1VA 3B02A 3RKQA 2VODA 2XUBA 4XICA 3WHCA 5L3BA 5FKNA 3ULQB 4LG3A 5IY5H 1Z91A 1KZHA 3VYSB 1RUNA 2GXAA 1STZA 3AL0C 5GP9A 2Z99A 1YJ9I 2G7HA 1N25A 3D1NI 2EZLA 4ZDLA 1O3TA 3UNGC 4HNUA 1SAUA 1ZGJA 5E1WA 3DPUA 2LBFA 3OYFA 2FJ1A 4D0PA 1JI8A 4IXAA 4NBQA 3DLAA 4BS9A 5HLGA 5EJCA 4A69C 5CQEA 1Z6TA 1LDDA 4Y4RA 1X4OA 3HZJA 2JA6J 2WY8Q 3I58A 4ZDPA 4GCVA 1S5LC 3J7AO 4L9NA 2M4KA 1MZBA 4BBSJ 2HTJA 2GWRA 1FY7A 1Q1VA 3G1OA 2Y0SN 2JPCA 3TBIA 1PDNC 2MD5A 3K9TA 1J0RA 3BTJA 3M07A 4X1EA 1WJEA 1RKWA 2JWTA 2M87A 2OPTA 2V9KA 4UVBA 3FK6A 1W7PB 3DEUA 2HU9A 2ZFUA 2ZJRF 2Z2SB 1QZZA 3B6AA 2KDZA 2HVRA 1VQNI 2XGXA 3BDDA 1I3AA 4A3KJ 4HF2A 2HOEA 2A5YB 3DF8A 1RIOH 1WH5A 3W3CA 3QWLA 1Y8QB 3TOAA 2MG4A 3AAFA 1IZ1A 3HB9A 2E1OA 2Q1ZB 1YITI 2LKPA 1F4KA 1T6SA 4HG2A 4XKWA 2EV5A 5JVGF 1KQ8A 1YOVB 3DTEA 3CCMI 4M3DA 3CDHA 2OAZA 3K1NA 5D6FA 2DA4A 4YELA 5EEAA 5K7HA 3JREA 3NWTA 3IRRA 2FOWA 1XB4A 1FWZA 4L5EA 3CO6C 4HQEA 1OJLA 3CUOA 1P7JA 1MNEA 2DOAA 3OR2C 1K4TA 3OSGA 5L3GA 1SANA 1YS7A 2IBDA 4AM3A 4ZJZA 2BVMA 1X3UA 1Y0UA 1OCRH 2MBFA 3VSLA 4ZYGA 1QVTA 4XM3A 1T2KA 2CQQA 1WI3A 4RAFA 2KFDA 4MQVA 4IRHA 4BE0A 1H0MA 2XRNA 4DZJA 2MGQA 1PP7U 3M4OJ 1FP1D 2NS7A 3G73A 2O03A 1I39A 2PEXA 3K2ZA 3LQRA 4E4HA 4LK0F 2RREA 4M3GA 2XASA 4U7DA 2RV8A 5GADJ 2Z9OA 3KIOA 3OS0A 2PMZA 2JZYA 4LITA 3QYBA 3DWLE 4WX9A 2VJ5A 1G6NA 2F4MB 4XKBA 4XBFA 3W6JB 5C44J 5HODA 1XGMA 1OCCH 2XF5A 2E1MC 2YS9A 4V19K 1BJZA 3E5QA 4FTHA 2QLZA 2X6OA 3BJ6A 4CCKA 1IN6A 3CJNA 3K4CA 3R4KA 4XOTA 2ZC2A 1XN7A 4KIGA 5E1XA 5J6XA 5TJJA 3SZGA 1QZEA 3JAMK 3DLLF 2DXIA 3CDLA 3P9CA 2PBIA 1J75A 3LFUA 1FYLA 2F4IA 3JTGA 4BXUA 1AU7A 2O5RA 1S7EA 3MKYB 2DI3A 2P6TA 3T0YA 2AO9A 2HWVA 4OIRF 4CGZA 3WE3A 1GVDA 3C2HA 5K1YA 1P2FA 1D3YA 5KAIC 1VNDA 5EGOA 1OISA 5BOXA 5JI6A 4HSRA 1BL0A 2DPDA 3BZ6A 4IEJA 2CS3A 2IGMA 1T8IA 3CD6I 3IKTA 2VT2A 4MQ9F 3X2QH 1WSUA 2YSRA 3IWFA 1B9MA 4CYDA 1YG2A 1QA6A 2HEOA 4MTDA 4A3IJ 1XC5A 3HTUA 1X1CA 3F8BA 4D7MA 1CQTA 5LHHA 3BC8A 3DEWA 4N4OB 2XROA 3G4SI 2ZMEB 2KIMA 1VQ8I 2VBZA 4PJ0C 4EM2A 1TWGJ 4BDYA 4RDUA 1R00A 5FROA 5LEJA 3KEYA 3BZCA 2CMPA 1JHHA 5E3LA 4RLQA 3DBLB 3JSPA 2WAFA 2K86A 5FLXK 4G7OF 5H6QA 5BPIA 1KONA 3RYRA 4CDGA 2LY9A 1IGNA 3OIPA 2BY1A 3MZYA 3IH2A 1LFUP 3AL0B 2VQGA 1EH6A 1JKQC 1NTCA 3LSKA 1X1AA 4IQ4A 2X1EA 1GXPA 2EIKH 3CCYA 4M3EA 4NUBA 4D5FA 1JE8A 1Y1VJ 3F21A 1UFMA 2JA5J 2OZUA 1SAXA 1T98A 3GVAA 4I76A 2WV0A 3BR1A 2VOPA 1R23A 3K69A 2EIMH 2VOOA 1RUOA 3DV8A 1JGSA 4CO8A 1JKPC 4HF1A 4J00A 1FZPB 2W00A 2VQCA 2W25A 3S8PA 3CMEI 2R7OA 3H1CA 3DU5A 1EKEA 2X1DA 4S05A 4PGGA 2Z1DA 1D1BA 3MKZA 1HSJA 2VC0A 2F6CA 3K2AA 1WJ5A 2O6GE 3JW4A 4ZH4F 2FEZA 5ICGA 4ZYHA 1GHCA 4RA2A 4NQWB 2R0QC 2QM3A 2BHYA 1U5TC 2NVXJ 1IRXA 4FX0A 4JP0A 4M3FA 3M8EA 4Q47A 3K4NA 4QIWN 3OIOA 2A3SA 3M7GA 1OYYA 1XGNA 3RYPA 2X85A 3PSIA 1TW3A 3QPHA 1LE8A 1VTNC 1QPMA 1IXCA 3MKLA 2WAQA 5JR3A 1TBXA 5HNFA 1IDYA 1R9TJ 2M5WA 2JPBA 4RGRA 2B0LA 4U88A 4LG0A 4XL9A 4A3FJ 2MABA 1MH4A 1UAAA 1JXSA 4BXFA 1Q1HA 2OCEA 5EG0B 3NWSA 5CQGA 3CCRI 1O3QA 2JK3A 2DW4A 2XAUA 5IP9J 3MCZA 3KX2A 4M9ZA 1XDUA 4PJLA 2NVUB 4L5IA 3D5RC 1B8IA 2HOTA 4IQJA 2Z5UA 5F64A 2CRGA 4I99C 2NNYA 3PFIA 3KEOA 3TO6A 1B8IB 1WCMJ 2GA1A 4F55A 2TCTA 2X1CA 1XMAA 2L54A 2IW5A 1WVRA 5C4XJ 4W97A 4FE7A 4A5MA 3MEXA 2HZTA 2H1KA 4ZTFA 3GEZA 1TWFJ 1XSVA 2EFOA 5F1RA 4XRMA 4DYQA 3TP3A 1F9NA 4L9VA 2M3AA 2UZKA 4MFEA 1MW7A 5LGNA 1ODDA 2JA7J 1ZELA 3K7AJ 2JA8J 1IDZA 3FBNB 1BC7C 2RVCA 3F3XA 2FBHA 2X48A 5EEGA 2N8GA 4FHTA 1VQKI 1HKSA 2O7OA 2E1MB 3B6CA 5F6FA 3OOUA 3OMYA 4CSWA 4AUXA 3TO7A 5E17F 3GFMA 1WI9A 4CZCA 1EJ9A 5CVRA 2BV6A 2MW8A 2E71A 2XSJC 1DU0A 3H3ZA 4KNYA 4PK4A 1ZGWA 3DBRB 2K9LA 3ZR8X 2LKXA 3BP8A 2DDBA 4BNCA 2R93J 3RZDJ 2KISA 5DCFA 2W1OA 3FXRA 1R36A 2EA2A 4G6QA 4PFOA 2L9VA 4ENJA 5BNGA 2ADUA 4UB8C 1R1VA 4EMSA 1HA8A 4PSWA 2FQ3A 2QQ8A 4U0WA 1A6IA 4AIDA 1KYZA 4J01A 2AXTC 2W85A 4WWCA 1YYVA 2KIFA 2M7BA 1RNLA 4B44A 1K6OA 1H9GA 3J7ZI 3OY9A 2PMHA 3VDXA 4CA0A 5IPAA 4XRSA 2MH2A 2XAGA 1Y56A 3CLOA 4AU7A 4JK1X 4I6ZA 2ELKA 3AG1H 4CH7A 1LDKB 3ECHA 4OIQF 1FSHA 4UUTA 5E3OA 1ETQA 1IO2A 1FBUA 1RRJA 1IJWC 2BZTA 4XK4A 2JQ7A 3PL8A 1D1AA 3EUKL 2GM4A 1MBJA 3J7YJ 5LLQA 2R7XA 5JHFA 4IRGA 5IT9Z 2KJBA 2E2HJ 4HDVA 1QU3A 3LSPA 4H4KC 1S7OA 4PUSA 2KMUA 4ESFA 2IVMA 1BR4A 3F6VA 3VFZA 5GAEJ 1E2XA 2CQ7A 2KLOA 4AIHA 1X3WB 2CH0A 4P9UA 1L0OC 4IHVA 2HYFA 3HOXJ 2BVLA 3DP7A 3MZ8A 2K40A 5BMZA 5LEKA 2COMA 3AG4H 4CYCA 2DPUA 2LD5A 4UUVA 2LMDA 1REPC 3KEQA 2EFWA 3TOBA 2V9VA 1TNTA 2K9MA 4Y13A 1ZTRA 4Z6YA 3SZPA 4IHXA 2GBYA 2EFQA 3F8CA 4Y17A 3O8HA 2GA2A 3LAJA 4A3BJ 4A5NA 3DU6A 4M73A 3PQKA 1LEBA 2LR8A 2CUFA 2H6CA 3G3ZA 4HF0A 1S7AA 4B43A 1R71A 1X19A 2BHZA 1FEXA 3OYEA 4LFUA 4GYIA 4HEA2 4EJWA 1AA7A 3GXOA 1RR8C 3S2WA 2IPQX 1OYIA 5D5XB 1Z0XA 2R7VA 1W5TA 1RESA 2ISYA 3KLOA 1IG7A 3CCVI 4JQFA 3VPRA 3ZMSA 4DNCA 4LIUA 9ANTA 2L01A 3HGYA 5K5RA 3H0DA 1OR7A 1ZYRF 2W82A 2MFZA 4MFDA 1UMQA 3HOYJ 2G0EA 3OL4A 4XSXF 3WTXC 5DD4A 5FB2A 4XR6A 5LHGA 3T8RA 5GPCA 3WHBA 3I55I 3NQOA 4AYBA 1QHGA 2DO7A 3UR3C 4R79A 2I5UA 3FXMA 3LSJA 3CCQI 2E60A 2L7ZA 2XAQA 4NNJA 1U5TB 1XG1A 1MJBA 3CCLI 3BG7A 3H36A 5K5QA 2QKLB 3OR1C 2E2IJ 1X58A 1VQ6I 3PIPF 1WJFA 2FSWA 3S16J 3BROA 2RKHA 3RKWA 3L09A 1W5CC 3ERED 4YIIA 2EQRA 2ZXWH 1D5YA 2OJED 3KZYA 1WH7A 5E18F 1U8RA 1B72A 1O3RA 3S2HJ 3ABKH 3QODA 5EDNA 3IKVA 1I6HJ 1G8XA 1MBKA 1B72B 1CGPA 5B1AH 3MVPA 2DMTA 1QQIA 2W4SA 3FXJA 2ACJA 2HXIA 3GZ5A 2M30A 2MSYA 2ZB9A 4IVNA 4V2GA 2V4JC 1WFXA 2H1LA 2K02A 4P96A 3OS1A 5B3SH 4K2EA 2HDDA 3KP6A 3F22A 2OZ6A 2UXXA 3OYGA 3JRHA 4QSHA 1WPKA 3GTJJ 1AOYA 1FSEA 1FNNA 3RKXA 5C4JJ 2QKMB 3BR2A 4BUPA 4HA8A 3WTUC 3K10A 2VASA 3GWZA 4BGDA 5LFAA 2W57A 3ZQ7A 2D1HA 2VL8A 2KIUA 3GTQJ 2JRMA 3BPVA 4RMNA 4BHBA 1RR7A 1KU7A 4XLFA 2Z3YA 2LH9A 2CO5A 2DA3A 2K3FA 2QUFA 1JTYA 3A0HC 3HUGB 3W2VA 5LRRA 4M74A 3FM3A 4OIOF 2IA2A 2CV2A 1QHHD 5JVTA 1K79A 2M34A 2Z16A 1Z67A 4KJZA 3JR9A 1NK3P 1QPIA 1AHDP 1QBJA 4E6KG 1G3YA 2O9LA 2HXOA 3ZQIA 3D5LA 3HRSA 3L2QA 5FO5A 2W7NA 1YHQI 3W2WA 4IX7A 1UJ8A 4BL0B 1SD5A 4IO9F 2JRTA 2O3FA 2ELJA 1RC9A 3PUFA 4MLOA 2HQ5A 1YX3A 1MMNA 3HDDA 2KL4A 1DU6A 2JVHA 2V6CA 4C9YA 2WAEA 2KDOA 5D5VB 2DDAA 5M5XJ 3ERMA 4IF4A 1I50J 2ID3A 3A1YA 3CJQB 2DODA 3IHUA 5BQTA 3QP6A 2UXNA 5CVJA 4BJTA 2P7VB 3P7NA 2XDVA 2OF7A 3SEZA 4O3MA 1OFCX 4YEJA 1B1BA 3V7RA 3FHZA 1D0YA 2OBPA 1IAWA 4HW0A 3QU6A 1SC7A 3HYIA 3HXLA 2FXAA 3OS2A 3S2DJ 2JMWA 4XOPA 1OCZH 3QP5A 5DEQA 2VONA 1GV5A 3R60A 3LNQA 1XCBA 1VQMI 4J19A 1ETKA 1R5HA 1A36A 2E1NA 5KCMA 2Q0OA 3Q5FA 1SFKA 1LFBA 2GXBA 2NVTJ 3KLNA 2CQXA 2J5PA 2QQAA 4A0YA 3AG2H 3GLXA 5K5OA 4RB2C 3JTHA 3U1DA 4EEFG 4FASD 4EVIA 3ZN0A 3REOA 1V4RA 2H94A 4WK8F 2P7CB 3FF5A 1MDMA 2FUG2 2Y0SA 4GYGA 1IXRC 4S04A 2BOLA 2JJ7A 2LBFB 2FMLA 3JSOA 1HW2A 2ZJPF 1MDMB 1Z7UA 3RQIA 3GW2A 1IW7F 2LNBA 3LSTA 1X1BA 1X2NA 3FX3A 1Z77A 3KP7A 1R6RA 1J5YA 1XSXA 1X3ZB 3S1RJ 3IL2A 2XGCA 3TQNA 2NNNA 1JHFA 3WTSC 5E8IA 2DT7B 3AFHA 1O3SA 2MC3A 5HNHA 2MLKA 2R7FA 3HOUJ 5J8FA 3G6EI 2GAUA 5EZGA 4DQ2A 2XC7A 3WU0A 1A35A 2GQQA 1ULYA 3PNVA 3EETA 2WY7Q 4RAGA 3HOZJ 2LY2A 4KFCA 4CCLA 4YFKF 2XGDA 1T08B 2UUZA 3LAPA 3W6VA 5FKOA 3I5UA 2BYVE 1PJRA 2LDUA 2HPMA 4KISA 4MIMA 3BTIA 2YPRA 3OYNA 5FRMA 1RZ4A 1NK2P 3E3VA 1BBYA 1LJ9A 4KN4X 4NC7A 3LL7A 3RIRA 3ASNH 3WTYC 2M8EA 4O6JA 2JUGA 1Z3XA 2OA4A 2UWMA 2NVYJ 4ON0A 4HV5A 2VXZA 2OQRA 1ACIA 1HLVA 4XORA 3FHNA 1Z21A 1H8AC 2QCOA 5GTIC 1PUFA 5FLVA 1IXSB 3EYIA 2KRHA 3F8NA 3BJOA 2OCCH 3BT9A 3HC7A 5CYVA 3J80K 1FP2A 1TWCJ 4PJNA 1TL8A 1VQ9I 4HLXA 1BI1A 2ZSHB 4B3XA 4GFBA 4HZFA 5ICFA 1SD4A 2Y9ZA 3HSFA 3HM5A 2CWEA 1T56A 3A2KA 2DYRH 2FX0A 2P6SA 3Q0VA 3E5XA 4MNUA 4DOZA 3GZ6A 3HOVJ 2EZHA 2X6YA 2E19A 3HJEA 1TLHB 2Z33A 4LLNA 1SD7A 4F7ZA 1SMYF 2DMNA 2L7MP 3NAUA 4IZZA 3CCUI 3CCJI 1ETOA 2H27A 1S29A 4YIRX 4KIFA 2VKVA 1I3QJ 3WG7H 1Z6RA 1FLIA 4UY8I 4OAYA 4CCOA 2K3PA 3O8GA 4LIVA 4EJOA 1WZ2A 5L3EA 2LRDA 3IC7A 3I71A 3E5UA 3DFGA 3GFJA 5J1YA 5IYCJ 3OYAA 3HHGA 4XMYA 4FCYA 3I53A 2LG4A 1FBSA 1MNDA 4I98B 2H8RA 2YU9J 5FJ8J 1FIPA 3E6DA 1D0XA 2LY1A 1YE9A 2AXLA 4MEXF 3PO2J 5LD2C 1Z7LA 2A69F 3CO7C 2A6HF 2MA3A 4FETA 3G1LA 5TRDA 5TGTA 3S1MJ 4M6YA 1T95A 2KQRA 5EGOB 3KFWX 5IP6A 2CW0F 4HNVA 2CSOA 5DD8A 4EATA 4GRIA 3L9FA 3MAJA 3C1DA 1MMSA 4AWXB 2ESHA 1UHWA 2L2OA 2M45A 4ENMA 3GYHX 5GAGJ 1T38A 2ESNA 2HR3A 1ZG1A 3M9AA 4FE4A 2DFEA 4HAMA 4I7HA 4S0HB 2ZXIA 1MMDA 3GZNB 3CP8A 2VKDA 3HHHA 2K7LA 1FIAA 5B66C 3Q0WA 1DDNA 3ZQHA 1U0JA 1BW6A 2E36A 1ETWA 1HBXG 3RPUA 1MKMA 3FM5A 4LK1F 5L3DA 3K6GA 1J59A 4BQAA 3OYKA 2DOFA 3JRGA 1BN5A 2E35A 4A6DA 2WC2A 1VQ7I 3GTKJ 1YI2I 2XB5A 1U3EM 4BJ5C 2F48A 2A61A 2G9WA 2MYSA 4ASNA 3DBHB 3R0AA 2F4OB 2VXDA 3MFKA 3BCBA 2MD0A 2VT3A 1MH3A 4V2FA 3O2PE 2MC4A 2LP0A 2OTJI 2CV0A 2EK5A 5C3EJ 3ZQCA 3F9KA 5J3LA 3JAMZ 1R5GA 2VN2A 1VQLI 2DCEA 3H92A 4A3DJ 3S93A 4AC0A 3J7AY 2R7RA 4XLHA 4EGYA 5F08A 5AONA 3FMRA 4PSXA 3CUQA 1XD7A 2OD5A 2LF7A 3E1SA 2STTA 1OR7C 2RC4A 4HPQA 3S1QJ 2FMYA 5FRNA 4JX4A 1LEAA 1N75A 4UVCA 3VEPA 4U87A 4IOAF 1MD0A 2LSOA 3RCOA 4P1WA 3BTCA 3A03A 2DLLA 3OOPA 5F0FA 2L7KA 4OINF 4XRSG 3BWGA 4RB1A 3GFIA 1FTZA 2EILH 4F92B 4OMZA 3ZOBA 3OSFA 2HVSA 1G4DA 1SVOA 5F0HA 3I4NJ 3BY6A 1ETYA 5IP7J 3ONQA 3BPXA 4KDPA 3IUOA 1P9QC 1LE8B 4BEHA 3WGIA 2R7SA 3CZ6A 3LA3A 3CTAA 3C7JA 2DBBA 5HDGA 5ILSA 4BEHB 2R3SA 2CYYA 3FWEA 2Y9YA 4LG0B 2D2WA 2V7FA 4A3LJ 5ILUA 4N0BA 2R5ZA 1R1TA 2HI3A 2H8WA 4CXFA 3DTKA 3LFKA 5D5UB 5D4RA 3HOSA 2L9RA 1WHUA 1MJAA 1XGSA 4BKXA 5FLXZ 4E7HA 2VBXA 2PN6A 4E7IA 1FBQA 2LOOA 2CFXA 4N9HA 3TMOA 1ZRDA 1ORKA 3CLQA 3FMSA 4MO7A 3FXLA 1KQ9A 5M5WJ 3HSEA 4LOCA 4RS8A 2DK5A 5TISC 3TO9A 5CKTA 2K9SA 3ZQLA 4HX8A 1MBGA 1HDPA 1WJCA 2DMPA 4C3HJ 4A6EA 5K7FA 5JLWA 3OYDA 4GO1A 4BH9A 4GGGA 2HKOA 2VJ4A 3GTMJ 1HW5A 2M7AA 2ZXHA 2VLAA 1V5GA 1IN4A 2EBIA 3CCSI 1U8BA 1IN8A 3U1KA 2DN0A 4BDZA 2M2EA 2XV4S 5D8LB 2D5VA 1ON1A 2HOAA 1JKRC 4PFPA 1VQPI 4OOIA 4C3IJ 4IRIA 2BXYA 3ESWB 5HDKA 3H5NA 4A3EJ 3E6BA 2R7ZJ 3VOEA 1ZLJA 2M1BA 2ME0A 1GLNA 1ENHA 3K1MA 4XLPF 1E0EA 3ZGKA 3I4PA 4OIPF 1D0ZA 1JTXA 1A5JA 3MWMA 4JYKA 4BQQA 2LFBA 3HKZN 1F1ZA 4CHUA 1V54H 2GIZA 4AD9A 2IA0A 3SJMA 2CJJA 1D8KA 3LWFA 1UHSA 3PNTA 3BJAA 3CESA 2R4GA 1IF1A 1OCOH 4A0XA 4RLFA 3PO3J 3QPSA 2HPIA 3WTWC 1J7KA 2JT1A 2LYCA 1TWHJ 3BR0A 2VJIA 2E5NA 1SFEA 2DYSH 1R4NB 2VIXA 2BEOA 2KJCA 2L9SA 2IS2A 3QAHA 3HPGA 1IUFA 2EINH 3F0CA 4IKFA 3HRMA 4LGWA 1UELB 4B47A 1BR1A 4RAYA 3FXKA 4UUSA 4L5JA 4DBRA 3OYCA 1XPXA 3E97A 2LF8A 1E3PA 3HOWJ 3HPHA 3ABMH 1CF7A 1KU2A 2Q2EA 3KP3A 3RKYA 1TP4A 2XF7A 1OCTC 2QQBA 2Y69H 4YFXF 3CMAI 3DKWA 2EV0A 3L2VA 5J40A 3SXYA 1OQYA 4EM0B 1CF7B 3SFIA 1N78A 2V1NA 1LPQA 5HLIA 4A3GJ 1LQ1A 2QENA 2XAFA 4PGHA 4BE2A 3HTSB 4RGSA 3C3WA 5E3MA 2KRFA 2QYOA 1ZG3A 4N4NB 4CYCB 4M72A 4BJ6C 2HGCA 5A2QK 2X6XA 1XCVA 5ILVA 2HDWA 3L7WA 3HL2A 3F8MA 1E17A 2KIQA 2ZNYA 5M3MJ 3Q0UA 4NB5A 5DV5A 3SDGA 4KT5C 1Z1DA 1S3JA 3D5SC 4MEYF 4E7JA 1JJ8C 2M4GA 4BYYA 1MNMC 2VPLA 2R7TA 4Y3OA 3GF2A 1K78A 1MSFC 4G7HF 4I09A 4ABZA 4KYWA 4D1QA 2QQ9A 4XN3A 1JUSA 1SFXA 2DT5A 2XRLA 1ZG5A 3BG3A 3CMMA 3LQQA 1FPQA 2ECBA 3OYIA 4PZJA 4LLGF 3DCFA 1UG2A 1B4AA 1HCRA 4OU0A 1W0UA 4CUGA 1VFCA 1AWCA 4XKVA 4JX6A 1EA3A 3ZQQA 1FOWA 3M3YJ 2DA7A 2E34A 4DYCA 5HS8A 5GAHJ 4KMFA 5E1ZB 1WGXA 1TWAJ 4CCMA 2PJPA 4FX4A 5BPDA 1S9HA 3RJPA 2DQLA 3DPLC 3RDIA 3WU1B 1QVUA 5J1RA 3H3VK 1T33A 1W5SA 4KMUX 2VC1A 1WRJA 2VBWA 1DP3A 1FYKA 5ED4A 4ZZLA 1N77A 2OQGA 4W1UA 2B7EA 2RAEA 4F52A 1SMTA 1BI3A 2B9SA 2AQFA 2DTRA 3EDPA 4M3BA 5HLHA 2ZKZA 3V4GA 1H9TA 3SYTA 4XLAA 1USSA 3G1MA 5EYRA 2FBKA 3TEDA 1F36A 2XPWA 4QTRA 1T0FA 5F1JA 2KP6A 2ELHA 1LB2A 3Q3SA 4MGRA 1YO5C 2CUJA 1APLC 4IHSA 3J81K 1BI2A 4YRVA 1GXQA 3KP4A 5H6RA 3W6KB 3WG9A 4A93J 1TT5B 2VUMJ 4ETSA 4NHJA 2R7UA 1G59A 2X9DA 3G2BA 2A68F 1JUMA 1EH7A 3ABLH 2CQKA 3NRVA 4AIJA 3W2AA 1Z05A 2ID6A 1LDJA 3ABUA 5H20A 5A2QZ 2QVOA 2XAJA 2PG4A 3P5JA 1P92A 5FD6A 1YW9A 1R58A 1JKOC 1XTAA 5BS6A 4EGZA 3ZMZA 3HSRA 2P5KA 3NEUA 3U21A 5D8KB 1QZYA 1MBHA 5D4SA 4EJUA 2CQNA 4A3CJ 4I2OA 4ZYEA 4BQNA 3N4MA 2P5VA 1ZR2A 3TDZC 2GZWA 2GOMA 3QQAA 4XIDA 3I56I 1GUUA 2NYXA 2QF7A 1MIJA 1R4MB 4HNTA 5M5YJ 1W0TA 2V79A 3ASOH 5LGTA 1MJ9A 3LSMA 1HOMA 4Y33A 3BQZA 4A0ZA 1VF9A 2XSDC 1LFPA 3M1CA 3DKYA 5ICEA 3CMYA 2HQNA 2M0MA 1K61A 3A01A 2WBMA 4DJAA 3QU3A 1XSDA 2HNHA 1RPWA 2E2JJ 4DZPA 3A01B 2ZO4A 3PJRA 2F5DA 1HF0A 2RGVA 2A6TA
chains in the Genus database with same CATH topology
3QOPA 3WTZA 1RI7A 3FMQA 4HDUA 2JTVA 2P4WA 3F23A 1ZGAA 3GFLA 4P5OA 2STWA 3L00A 3R6SA 4Q48A 1R7JA 2F5FA 3ZMTA 3F6OA 2FU4A 4UNOA 2WTEA 1BJAA 2FBIA 3KCCA 2F5EA 3O6BB 3VODA 3IRQA 4KIBA 2NAZA 2E7XA 3EUHA 1S8NA 4M6XA 1TNSA 1ZAOA 2PI0A 3KZZA 4UV9A 4QWQA 1P4XA 1WWXA 2JSCA 2AS5F 2VE9A 2IT0A 2F2EA 1UCRA 5KVRA 1EH8A 2H6BA 4ZYDA 4L0ZB 4E70A 1D8JA 3PQJA 2EWNA 4HX7A 5AIPA 2GXGA 2C6YA 5DUIA 5E8GA 3TKYA 4KA4A 3CUQC 1BIAA 2QBYA 1UHMA 4HV6A 3R61A 2QBYB 2NRAC 4RB3C 3T1BA 2W24A 3ZP5A 1K7AA 2PMUA 3WTVC 4L9JA 1WKMA 3WTTC 4HLYA 4ZZDA 2XKOA 5LHIA 5FD5A 4R1HA 1O57A 2QZ8A 3WGHA 2O61A 1W7PA 4LMYA 2YR2A 2YX7A 2YU3A 3E6CC 1KYWA 2ZBKA 1KA8A 4JBAA 3ELKA 5KK1A 4AVPA 4H0EA 1I1GA 1P4WA 5DYMA 1KQ0A 1YFHA 3U9GA 2FE3A 3I64A 4Y15A 3FXUA 1U78A 1IRFA 1I1SA 4WF2A 1HKQA 2L02A 2CG4A 1ZLKA 1ZRFA 1USTA 4WCGA 5CVUA 2DFIA 4LD5A 5L3FA 2HYGD 3ZMVA 3COAC 1KGSA 4HBLA 5D6EA 2ZCWA 2CGPA 4FT8A 4LLLA 3WGGA 3V8LA 3VB2A 4ENKA 2K27A 4RB0A 5CLSA 4BHCA 1Z9CA 1DUXC 2V1XA 1XGOA 1I27A 4HYEA 5CVIA 4I0AA 2DQRA 2EFNA 1I5ZA 3V8JA 1L3LA 4U7BA 3ISPA 5DDGA 4WXCA 2P8TA 3T5XA 1IN5A 1XDSA 1R22A 2ETHA 3K1PA 1B9NA 4UXNA 1R1UA 4EV0A 1PP8F 4G94A 1HSTA 2V1DA 3DQVC 1FOKA 2VE8A 2G7UA 4WXHA 3ZN1A 3HIFA 4I0BA 2L4AA 4PDKA 2MH9A 4U0YA 4B8XA 2XIGA 3J80Z 2ZMEA 1HXDA 2Q8KA 4KUMA 3C18A 3RTRA 3Q9SA 4U0VA 3ML6A 2Y0MA 1EV7A 4IHTA 1OKRA 4LB5A 4GXOA 2W84A 5LRSA 1B59A 2BE5F 4O5VA 1OPCA 1W4MA 4LJZF 2XHKA 3FZVA 1BIBA 1G3TA 2PQ8A 1QO0D 3P9IA 3R0JA 4L9TA 5ICCA 2X0LA 3CUQB 3RI4A 3ZMUA 4G7ZF 1DP7P 1UB9A 2Y75A 5E20A 2EB7A 3E6MA 5FFZA 2EA4A 5DUKA 4EJTA 3D0SA 4AIKA 1OYWA 2K4BA 4OMYA 2X4HA 1TQPA 4NQWA 4P9FA 3V7SA 3SQNA 3P9KA 2P5LC 4MHGA 3TDUC 1HQCA 2FNPA 5JFRA 2IA1A 1ZHFA 3ZPLA 3B73A 2ZXJA 1MGTA 4UVAA 2BGCA 3KP2A 1IUYA 1FYMA 4WXDA 1XMKA 2Y48A 3EQLF 3K0LA 5IT9K 2O8XA 2OU2A 1DPUA 2IJLA 1J9IA 1F5TA 4XSZF 3DXJF 4L18B 2HQRA 2ISZA 3KP5A 3I59A 5J8CA 4A12A 3RPQA 1ZARA 3I59B 4B09A 2DK8A 1KU9A 2NS0A 1YW7A 5IT3A 2HS5A 1SD6A 1O7FA 4YIFA 2XAHA 2FOKA 2E1CA 5HVQC 4MTEA 2HFHA 3WODF 4IPAA 3SFZA 5HS7A 2K4JA 5LBQA 2J5OA 2MLGA 3ZMDA 3Q9VA 2FA5A 3V7CA 1ZN2A 4ESJA 5EEHA 1QNTA 4Q5SF 3ABTA 1T39A 1ON2A 4Q4ZF 1PUEE 1ZRCA 3F8FA 3F72A 5FGMA 4RAZA 3LA7A 1BC8C 5HDNA 5CJ9A 2EJRA 4M9XA 1YQAA 2V1UA 1IN7A 1QGPA 4BAYA 4R8HA 2RQPA 2FNAA 2EV6A 2GIVA 1BOAA 2ZFWA 3KE2A 2EFPA 1ZH5A 4TV7A 5L3CA 4YG2F 2WWYA 3BOQA 1A04A 3O3KA 3GX4X 2PFBA 1O7LA 2RN7A 2RNJA 1G3SA 1FC3A 5LGUA 4N9IA 3DPTA 2R7DA 2IP2A 4I02A 5D5WB 1YW8A 4IJAA 4HX4A 3OV8A 1K78B 3TGNA 2E7WA 2D45A 3T8TA 3GUDA 4RGUA 1BM9A 1C0WA 2L4MA 4XLNF 3KETA 3SHFA 3SZTA 3GO5A 3WE2A 1TQMA 3V8KA 3HRTA 4LB6B 3LA2A 4G6DA 1FT9A 1YTYA 5AIQA 1YS6A 1IRGA 2YX4A 2A6EF 1WQ2A 4QLCU 1V3FA 1GVJA 3QPTA 4A2UA 4L0YB 1U5TA 5ERIA 2L3DA 1ONVA 3HRUA 4UHTA 1YLFA 1TW2A 5HOOA 4EM1A 2XKPA 1HW1A 2F5CA 4HOBA 1J2XA 2FF4A 2QWWA 4EJVA 4CZZA 2VBYA 1OMIA 1FX7A 2O0YA 1TQIA 2DAOA 3HOTA 3MZHA 1U6GA 5DCMA 3L2CA 1S6LA 2HKXA 4BHPA 5DCMB 4M9SA 1LVAA 4YFNF 4ENNA 3MQ0A 2ZJ2A 1HKTA 1KU3A 3HUGA 3M1EA 3IWZA 1D5VA 6PAXA 2BBYA 1ZREA 4Z2YA 1P6RA 5CVVA 4RGXA 2ZNZA 2H09A 3FXQA 2A07F 4P55A 1TTYA 4UV8A 1BI0A 3ECOA 1LNWA 5HS9A 1U2WA 3H3UA 2XVCA 4PCQA 2HDCA 1B6AA 1YIOA 2PLYA 1W7PD 4XRFA 3ROUA 3N97A 3EYYA 5FFXA 2FRHA 2HTSA 1NHAA 1I6XA 3I0TA 1G3WA 4ESBA 3I54A 4HQMA 2DU9A 3QRFF 3J81Z 4M71A 4CICA 4G8XA 3U2RA 2KKOA 5JHUA 4EQQA 2RDPA 2IRFG 4KN7X 2TDXA 4G9YA 1SFUA 3M8FA 4KICA 1DPRA 4I01A 1P4AA 2D1VA 3B02A 2VODA 2XUBA 5L3BA 3ULQB 1Z91A 1RUNA 1STZA 2Z99A 2G7HA 1O3TA 1ZGJA 5E1WA 4D0PA 4IXAA 5HLGA 1Z6TA 1LDDA 3I58A 4GCVA 3J7AO 4L9NA 1MZBA 2HTJA 2GWRA 1FY7A 2JPCA 1PDNC 2MD5A 3K9TA 1J0RA 2M87A 4UVBA 1W7PB 3DEUA 1QZZA 2XGXA 3BDDA 4HF2A 2HOEA 2A5YB 3DF8A 1RIOH 3TOAA 3AAFA 1IZ1A 2LKPA 1F4KA 1T6SA 1KQ8A 2EV5A 3CDHA 2OAZA 3K1NA 5D6FA 3IRRA 1XB4A 1FWZA 3CO6C 4HQEA 3CUOA 5L3GA 1YS7A 1X3UA 1Y0UA 2MBFA 4ZYGA 1T2KA 4MQVA 4IRHA 1H0MA 2XRNA 1PP7U 1FP1D 3G73A 2O03A 2PEXA 3K2ZA 3LQRA 4LK0F 4U7DA 2XASA 2RV8A 2Z9OA 2JZYA 4WX9A 1G6NA 3W6JB 4XBFA 1XGMA 3E5QA 2QLZA 3BJ6A 1IN6A 3CJNA 3R4KA 1XN7A 4KIGA 5E1XA 5J6XA 5TJJA 3JAMK 3P9CA 2PBIA 1J75A 1FYLA 3JTGA 4BXUA 2DI3A 2P6TA 3T0YA 2HWVA 4OIRF 4CGZA 3WE3A 5K1YA 1P2FA 1D3YA 5BOXA 5JI6A 2DPDA 3BZ6A 3IKTA 2VT2A 4MQ9F 1WSUA 2YSRA 3IWFA 1B9MA 4CYDA 1YG2A 2HEOA 4MTDA 3HTUA 3F8BA 5LHHA 2XROA 2ZMEB 2KIMA 2VBZA 4EM2A 1R00A 5LEJA 1JHHA 3JSPA 2K86A 5FLXK 4G7OF 5H6QA 5BPIA 3RYRA 4CDGA 3MZYA 1EH6A 1GXPA 1JE8A 3F21A 1UFMA 2OZUA 1SAXA 1T98A 3GVAA 2WV0A 2VOPA 1R23A 3K69A 2VOOA 1RUOA 3DV8A 1JGSA 4CO8A 4HF1A 1FZPB 2W25A 4S05A 4PGGA 1HSJA 2VC0A 2O6GE 3JW4A 4ZH4F 2FEZA 5ICGA 4ZYHA 1GHCA 2QM3A 1U5TC 4FX0A 3M8EA 4Q47A 2A3SA 3M7GA 1OYYA 1XGNA 3RYPA 1TW3A 3QPHA 1VTNC 1QPMA 1IXCA 5JR3A 1TBXA 2M5WA 2JPBA 4RGRA 2B0LA 4U88A 4LG0A 1JXSA 1Q1HA 1O3QA 2DW4A 3MCZA 4M9ZA 1XDUA 4L5IA 2Z5UA 5F64A 2NNYA 3PFIA 3KEOA 3TO6A 2GA1A 1XMAA 2L54A 2IW5A 4A5MA 3MEXA 2HZTA 3GEZA 1XSVA 2EFOA 5F1RA 1F9NA 4L9VA 2UZKA 5LGNA 1ODDA 1BC7C 2RVCA 3F3XA 2FBHA 5EEGA 4FHTA 1HKSA 5F6FA 5E17F 3TO7A 3GFMA 1WI9A 5CVRA 2BV6A 3H3ZA 4KNYA 4BNCA 3BP8A 5DCFA 3FXRA 2EA2A 1R36A 4G6QA 4ENJA 2ADUA 1R1VA 4EMSA 2FQ3A 4U0WA 1KYZA 2W85A 4WWCA 1YYVA 2KIFA 1RNLA 1K6OA 1H9GA 2PMHA 2MH2A 2XAGA 3CLOA 4JK1X 1LDKB 3ECHA 4OIQF 1FSHA 1FBUA 5LLQA 4IRGA 5IT9Z 2KJBA 4HDVA 1S7OA 4ESFA 2IVMA 3F6VA 3VFZA 1E2XA 4AIHA 4P9UA 1L0OC 2HYFA 3DP7A 5BMZA 5LEKA 2COMA 2DPUA 4UUVA 1REPC 3KEQA 2EFWA 3TOBA 2V9VA 1TNTA 4Y13A 3SZPA 3F8CA 2EFQA 4Y17A 2GA2A 3LAJA 4A5NA 4M73A 3PQKA 1LEBA 3G3ZA 2H6CA 4HF0A 1S7AA 4LFUA 4GYIA 4EJWA 3GXOA 3S2WA 2IPQX 1OYIA 5D5XB 1W5TA 2ISYA 3KLOA 4JQFA 3ZMSA 4DNCA 2L01A 5K5RA 1OR7A 1ZYRF 4XSXF 3WTXC 5DD4A 5FB2A 5LHGA 3T8RA 3NQOA 4R79A 2DO7A 2XAQA 1U5TB 1MJBA 5K5QA 2FSWA 3BROA 2RKHA 3RKWA 3L09A 3ERED 4YIIA 3KZYA 5E18F 1U8RA 1O3RA 3IKVA 1CGPA 1QQIA 2ACJA 3GZ5A 2M30A 4IVNA 4P96A 2K02A 4K2EA 3KP6A 3F22A 2OZ6A 2UXXA 1AOYA 1FSEA 1FNNA 3RKXA 4HA8A 3WTUC 3GWZA 2W57A 3ZQ7A 2D1HA 2KIUA 3BPVA 4BHBA 1KU7A 2Z3YA 2CO5A 2QUFA 5LRRA 4M74A 3FM3A 4OIOF 2IA2A 5JVTA 1K79A 1QBJA 1G3YA 3D5LA 3HRSA 5FO5A 1SD5A 2JRTA 2O3FA 2V6CA 5D5VB 4IF4A 3IHUA 5BQTA 3QP6A 2UXNA 5CVJA 2P7VB 3P7NA 4O3MA 1B1BA 3V7RA 3FHZA 2OBPA 1IAWA 4HW0A 3QU6A 3HYIA 2FXAA 3QP5A 5DEQA 2VONA 3R60A 1XCBA 1R5HA 2E1NA 3Q5FA 2Q0OA 2GXBA 3KLNA 2J5PA 2QQAA 4A0YA 5K5OA 3GLXA 4RB2C 3JTHA 3U1DA 4EVIA 3ZN0A 3REOA 1V4RA 2H94A 4WK8F 2P7CB 3FF5A 1MDMA 4GYGA 1IXRC 4S04A 2FMLA 3JSOA 1HW2A 1MDMB 1Z7UA 3GW2A 1IW7F 2LNBA 3LSTA 3FX3A 3KP7A 1J5YA 1XSXA 3IL2A 3TQNA 2NNNA 1JHFA 3WTSC 5E8IA 1O3SA 2MC3A 2MLKA 2R7FA 5J8FA 2GAUA 4DQ2A 3WU0A 2GQQA 1ULYA 3EETA 4KFCA 4YFKF 3LAPA 3I5UA 2BYVE 2LDUA 2YPRA 1RZ4A 3E3VA 1BBYA 1LJ9A 4KN4X 3RIRA 3WTYC 2M8EA 4O6JA 2OA4A 2UWMA 4ON0A 4HV5A 2VXZA 2OQRA 1IXSB 3EYIA 3F8NA 3BJOA 3J80K 5CYVA 1FP2A 4HLXA 1BI1A 4HZFA 5ICFA 1SD4A 3HSFA 2CWEA 2P6SA 3E5XA 4MNUA 3GZ6A 1TLHB 2Z33A 4LLNA 1SD7A 4F7ZA 1SMYF 2H27A 1S29A 4KIFA 1Z6RA 1FLIA 4EJOA 5L3EA 3IC7A 3I71A 3E5UA 3DFGA 3GFJA 3HHGA 3I53A 1FBSA 4I98B 3E6DA 2AXLA 4MEXF 2A69F 3CO7C 2A6HF 2MA3A 5TRDA 4M6YA 3KFWX 2CW0F 2CSOA 5DD8A 3L9FA 3MAJA 3C1DA 4AWXB 2ESHA 1UHWA 2M45A 4ENMA 3GYHX 1T38A 2ESNA 2HR3A 1ZG1A 3M9AA 4HAMA 4I7HA 3HHHA 2K7LA 1DDNA 1HBXG 3RPUA 1MKMA 3FM5A 4LK1F 5L3DA 1J59A 4BQAA 1BN5A 4A6DA 2WC2A 1U3EM 2A61A 2G9WA 4ASNA 3R0AA 3MFKA 2VT3A 3O2PE 2EK5A 3JAMZ 1R5GA 2VN2A 3H92A 4EGYA 5AONA 3FMRA 3CUQA 1XD7A 2OD5A 2LF7A 2STTA 2RC4A 2FMYA 1LEAA 4UVCA 3VEPA 1MD0A 2LSOA 2DLLA 3OOPA 4OINF 3BWGA 4RB1A 3GFIA 4OMZA 1G4DA 3BY6A 3BPXA 4KDPA 3WGIA 3LA3A 3CTAA 3C7JA 2DBBA 5HDGA 5ILSA 2R3SA 2CYYA 3FWEA 4LG0B 2D2WA 5ILUA 4N0BA 1R1TA 4CXFA 3LFKA 5D5UB 5D4RA 3HOSA 1XGSA 1MJAA 5FLXZ 2VBXA 2PN6A 1FBQA 2CFXA 4N9HA 1ZRDA 3FMSA 1KQ9A 3HSEA 4RS8A 2DK5A 3TO9A 4HX8A 4A6EA 4GO1A 4BH9A 4GGGA 2HKOA 1HW5A 1IN4A 1IN8A 2XV4S 5D8LB 1ON1A 4OOIA 4IRIA 5HDKA 3E6BA 3VOEA 1ZLJA 2M1BA 3K1MA 4XLPF 4OIPF 3I4PA 3MWMA 1F1ZA 4CHUA 4AD9A 2IA0A 1D8KA 3LWFA 3BJAA 1IF1A 4A0XA 3WTWC 1J7KA 2JT1A 1SFEA 2BEOA 2KJCA 3QAHA 3HRMA 4LGWA 4RAYA 4L5JA 3E97A 2LF8A 1CF7A 1KU2A 2Q2EA 3KP3A 3RKYA 2QQBA 4YFXF 3DKWA 2EV0A 3SXYA 4EM0B 1CF7B 5HLIA 1LQ1A 2QENA 2XAFA 4PGHA 3HTSB 4RGSA 3C3WA 2KRFA 2QYOA 1ZG3A 4M72A 2HGCA 5A2QK 1XCVA 5ILVA 3L7WA 3F8MA 1E17A 2ZNYA 4NB5A 5DV5A 4KT5C 1Z1DA 1S3JA 4MEYF 4BYYA 3GF2A 1K78A 4G7HF 4I09A 4KYWA 2QQ9A 1SFXA 2DT5A 1ZG5A 3LQQA 1FPQA 4PZJA 4LLGF 1B4AA 4OU0A 1AWCA 5HS8A 4KMFA 5E1ZB 2PJPA 4FX4A 5BPDA 3RJPA 2DQLA 3DPLC 3RDIA 3WU1B 1W5SA 4KMUX 2VC1A 1WRJA 2VBWA 1FYKA 5ED4A 4ZZLA 2OQGA 1SMTA 1BI3A 2DTRA 3EDPA 5HLHA 2ZKZA 3V4GA 1H9TA 1USSA 2FBKA 1T0FA 2ELHA 1LB2A 4MGRA 1YO5C 4IHSA 3J81K 1BI2A 1GXQA 3KP4A 5H6RA 3W6KB 3WG9A 4ETSA 4NHJA 2A68F 1EH7A 4AIJA 2CQKA 3NRVA 1Z05A 3ABUA 1LDJA 5H20A 5A2QZ 2QVOA 2XAJA 2PG4A 1P92A 5FD6A 1YW9A 1R58A 5BS6A 4EGZA 3ZMZA 3HSRA 2P5KA 3NEUA 5D8KB 1QZYA 5D4SA 4EJUA 4I2OA 4ZYEA 3N4MA 2P5VA 3TDZC 2GZWA 2NYXA 2V79A 5LGTA 1MJ9A 4A0ZA 5ICEA 2HQNA 3QU3A 1XSDA 2ZO4A 2F5DA 2RGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOP A;  3WTZ A;  1RI7 A;  3FMQ A;  4HDU A;  2JTV A;  2P4W A;  3F23 A;  1ZGA A;  3GFL A;  4P5O A;  2STW A;  3L00 A;  3R6S A;  4Q48 A;  1R7J A;  2F5F A;  3ZMT A;  3F6O A;  2FU4 A;  4UNO A;  2WTE A;  1BJA A;  2FBI A;  3KCC A;  2F5E A;  3O6B B;  3VOD A;  3IRQ A;  4KIB A;  2NAZ A;  2E7X A;  3EUH A;  1S8N A;  4M6X A;  1TNS A;  1ZAO A;  2PI0 A;  3KZZ A;  4UV9 A;  4QWQ A;  1P4X A;  1WWX A;  2JSC A;  2AS5 F;  2VE9 A;  2IT0 A;  2F2E A;  1UCR A;  5KVR A;  1EH8 A;  2H6B A;  4ZYD A;  4L0Z B;  4E70 A;  1D8J A;  3PQJ A;  2EWN A;  4HX7 A;  5AIP A;  2GXG A;  2C6Y A;  5DUI A;  5E8G A;  3TKY A;  4KA4 A;  3CUQ C;  1BIA A;  2QBY A;  1UHM A;  4HV6 A;  3R61 A;  2QBY B;  2NRA C;  4RB3 C;  3T1B A;  2W24 A;  3ZP5 A;  1K7A A;  2PMU A;  3WTV C;  4L9J A;  1WKM A;  3WTT C;  4HLY A;  4ZZD A;  2XKO A;  5LHI A;  5FD5 A;  4R1H A;  1O57 A;  2QZ8 A;  3WGH A;  2O61 A;  1W7P A;  4LMY A;  2YR2 A;  2YX7 A;  2YU3 A;  3E6C C;  1KYW A;  2ZBK A;  1KA8 A;  4JBA A;  3ELK A;  5KK1 A;  4AVP A;  4H0E A;  1I1G A;  1P4W A;  5DYM A;  1KQ0 A;  1YFH A;  3U9G A;  2FE3 A;  3I64 A;  4Y15 A;  3FXU A;  1U78 A;  1IRF A;  1I1S A;  4WF2 A;  1HKQ A;  2L02 A;  2CG4 A;  1ZLK A;  1ZRF A;  1UST A;  4WCG A;  5CVU A;  2DFI A;  4LD5 A;  5L3F A;  2HYG D;  3ZMV A;  3COA C;  1KGS A;  4HBL A;  5D6E A;  2ZCW A;  2CGP A;  4FT8 A;  4LLL A;  3WGG A;  3V8L A;  3VB2 A;  4ENK A;  2K27 A;  4RB0 A;  5CLS A;  4BHC A;  1Z9C A;  1DUX C;  2V1X A;  1XGO A;  1I27 A;  4HYE A;  5CVI A;  4I0A A;  2DQR A;  2EFN A;  1I5Z A;  3V8J A;  1L3L A;  4U7B A;  3ISP A;  5DDG A;  4WXC A;  2P8T A;  3T5X A;  1IN5 A;  1XDS A;  1R22 A;  2ETH A;  3K1P A;  1B9N A;  4UXN A;  1R1U A;  4EV0 A;  1PP8 F;  4G94 A;  1HST A;  2V1D A;  3DQV C;  1FOK A;  2VE8 A;  2G7U A;  4WXH A;  3ZN1 A;  3HIF A;  4I0B A;  2L4A A;  4PDK A;  2MH9 A;  4U0Y A;  4B8X A;  2XIG A;  3J80 Z;  2ZME A;  1HXD A;  2Q8K A;  4KUM A;  3C18 A;  3RTR A;  3Q9S A;  4U0V A;  3ML6 A;  2Y0M A;  1EV7 A;  4IHT A;  1OKR A;  4LB5 A;  4GXO A;  2W84 A;  5LRS A;  1B59 A;  2BE5 F;  4O5V A;  1OPC A;  1W4M A;  4LJZ F;  2XHK A;  3FZV A;  1BIB A;  1G3T A;  2PQ8 A;  1QO0 D;  3P9I A;  3R0J A;  4L9T A;  5ICC A;  2X0L A;  3CUQ B;  3RI4 A;  3ZMU A;  4G7Z F;  1DP7 P;  1UB9 A;  2Y75 A;  5E20 A;  2EB7 A;  3E6M A;  5FFZ A;  2EA4 A;  5DUK A;  4EJT A;  3D0S A;  4AIK A;  1OYW A;  2K4B A;  4OMY A;  2X4H A;  1TQP A;  4NQW A;  4P9F A;  3V7S A;  3SQN A;  3P9K A;  2P5L C;  4MHG A;  3TDU C;  1HQC A;  2FNP A;  5JFR A;  2IA1 A;  1ZHF A;  3ZPL A;  3B73 A;  2ZXJ A;  1MGT A;  4UVA A;  2BGC A;  3KP2 A;  1IUY A;  1FYM A;  4WXD A;  1XMK A;  2Y48 A;  3EQL F;  3K0L A;  5IT9 K;  2O8X A;  2OU2 A;  1DPU A;  2IJL A;  1J9I A;  1F5T A;  4XSZ F;  3DXJ F;  4L18 B;  2HQR A;  2ISZ A;  3KP5 A;  3I59 A;  5J8C A;  4A12 A;  3RPQ A;  1ZAR A;  3I59 B;  4B09 A;  2DK8 A;  1KU9 A;  2NS0 A;  1YW7 A;  5IT3 A;  2HS5 A;  1SD6 A;  1O7F A;  4YIF A;  2XAH A;  2FOK A;  2E1C A;  5HVQ C;  4MTE A;  2HFH A;  3WOD F;  4IPA A;  3SFZ A;  5HS7 A;  2K4J A;  5LBQ A;  2J5O A;  2MLG A;  3ZMD A;  3Q9V A;  2FA5 A;  3V7C A;  1ZN2 A;  4ESJ A;  5EEH A;  1QNT A;  4Q5S F;  3ABT A;  1T39 A;  1ON2 A;  4Q4Z F;  1PUE E;  1ZRC A;  3F8F A;  3F72 A;  5FGM A;  4RAZ A;  3LA7 A;  1BC8 C;  5HDN A;  5CJ9 A;  2EJR A;  4M9X A;  1YQA A;  2V1U A;  1IN7 A;  1QGP A;  4BAY A;  4R8H A;  2RQP A;  2FNA A;  2EV6 A;  2GIV A;  1BOA A;  2ZFW A;  3KE2 A;  2EFP A;  1ZH5 A;  4TV7 A;  5L3C A;  4YG2 F;  2WWY A;  3BOQ A;  1A04 A;  3O3K A;  3GX4 X;  2PFB A;  1O7L A;  2RN7 A;  2RNJ A;  1G3S A;  1FC3 A;  5LGU A;  4N9I A;  3DPT A;  2R7D A;  2IP2 A;  4I02 A;  5D5W B;  1YW8 A;  4IJA A;  4HX4 A;  3OV8 A;  1K78 B;  3TGN A;  2E7W A;  2D45 A;  3T8T A;  3GUD A;  4RGU A;  1BM9 A;  1C0W A;  2L4M A;  4XLN F;  3KET A;  3SHF A;  3SZT A;  3GO5 A;  3WE2 A;  1TQM A;  3V8K A;  3HRT A;  4LB6 B;  3LA2 A;  4G6D A;  1FT9 A;  1YTY A;  5AIQ A;  1YS6 A;  1IRG A;  2YX4 A;  2A6E F;  1WQ2 A;  4QLC U;  1V3F A;  1GVJ A;  3QPT A;  4A2U A;  4L0Y B;  1U5T A;  5ERI A;  2L3D A;  1ONV A;  3HRU A;  4UHT A;  1YLF A;  1TW2 A;  5HOO A;  4EM1 A;  2XKP A;  1HW1 A;  2F5C A;  4HOB A;  1J2X A;  2FF4 A;  2QWW A;  4EJV A;  4CZZ A;  2VBY A;  1OMI A;  1FX7 A;  2O0Y A;  1TQI A;  2DAO A;  3HOT A;  3MZH A;  1U6G A;  5DCM A;  3L2C A;  1S6L A;  2HKX A;  4BHP A;  5DCM B;  4M9S A;  1LVA A;  4YFN F;  4ENN A;  3MQ0 A;  2ZJ2 A;  1HKT A;  1KU3 A;  3HUG A;  3M1E A;  3IWZ A;  1D5V A;  6PAX A;  2BBY A;  1ZRE A;  4Z2Y A;  1P6R A;  5CVV A;  4RGX A;  2ZNZ A;  2H09 A;  3FXQ A;  2A07 F;  4P55 A;  1TTY A;  4UV8 A;  1BI0 A;  3ECO A;  1LNW A;  5HS9 A;  1U2W A;  3H3U A;  2XVC A;  4PCQ A;  2HDC A;  1B6A A;  1YIO A;  2PLY A;  1W7P D;  4XRF A;  3ROU A;  3N97 A;  3EYY A;  5FFX A;  2FRH A;  2HTS A;  1NHA A;  1I6X A;  3I0T A;  1G3W A;  4ESB A;  3I54 A;  4HQM A;  2DU9 A;  3QRF F;  3J81 Z;  4M71 A;  4CIC A;  4G8X A;  3U2R A;  2KKO A;  5JHU A;  4EQQ A;  2RDP A;  2IRF G;  4KN7 X;  2TDX A;  4G9Y A;  1SFU A;  3M8F A;  4KIC A;  1DPR A;  4I01 A;  1P4A A;  2D1V A;  3B02 A;  2VOD A;  2XUB A;  5L3B A;  3ULQ B;  1Z91 A;  1RUN A;  1STZ A;  2Z99 A;  2G7H A;  1O3T A;  1ZGJ A;  5E1W A;  4D0P A;  4IXA A;  5HLG A;  1Z6T A;  1LDD A;  3I58 A;  4GCV A;  3J7A O;  4L9N A;  1MZB A;  2HTJ A;  2GWR A;  1FY7 A;  2JPC A;  1PDN C;  2MD5 A;  3K9T A;  1J0R A;  2M87 A;  4UVB A;  1W7P B;  3DEU A;  1QZZ A;  2XGX A;  3BDD A;  4HF2 A;  2HOE A;  2A5Y B;  3DF8 A;  1RIO H;  3TOA A;  3AAF A;  1IZ1 A;  2LKP A;  1F4K A;  1T6S A;  1KQ8 A;  2EV5 A;  3CDH A;  2OAZ A;  3K1N A;  5D6F A;  3IRR A;  1XB4 A;  1FWZ A;  3CO6 C;  4HQE A;  3CUO A;  5L3G A;  1YS7 A;  1X3U A;  1Y0U A;  2MBF A;  4ZYG A;  1T2K A;  4MQV A;  4IRH A;  1H0M A;  2XRN A;  1PP7 U;  1FP1 D;  3G73 A;  2O03 A;  2PEX A;  3K2Z A;  3LQR A;  4LK0 F;  4U7D A;  2XAS A;  2RV8 A;  2Z9O A;  2JZY A;  4WX9 A;  1G6N A;  3W6J B;  4XBF A;  1XGM A;  3E5Q A;  2QLZ A;  3BJ6 A;  1IN6 A;  3CJN A;  3R4K A;  1XN7 A;  4KIG A;  5E1X A;  5J6X A;  5TJJ A;  3JAM K;  3P9C A;  2PBI A;  1J75 A;  1FYL A;  3JTG A;  4BXU A;  2DI3 A;  2P6T A;  3T0Y A;  2HWV A;  4OIR F;  4CGZ A;  3WE3 A;  5K1Y A;  1P2F A;  1D3Y A;  5BOX A;  5JI6 A;  2DPD A;  3BZ6 A;  3IKT A;  2VT2 A;  4MQ9 F;  1WSU A;  2YSR A;  3IWF A;  1B9M A;  4CYD A;  1YG2 A;  2HEO A;  4MTD A;  3HTU A;  3F8B A;  5LHH A;  2XRO A;  2ZME B;  2KIM A;  2VBZ A;  4EM2 A;  1R00 A;  5LEJ A;  1JHH A;  3JSP A;  2K86 A;  5FLX K;  4G7O F;  5H6Q A;  5BPI A;  3RYR A;  4CDG A;  3MZY A;  1EH6 A;  1GXP A;  1JE8 A;  3F21 A;  1UFM A;  2OZU A;  1SAX A;  1T98 A;  3GVA A;  2WV0 A;  2VOP A;  1R23 A;  3K69 A;  2VOO A;  1RUO A;  3DV8 A;  1JGS A;  4CO8 A;  4HF1 A;  1FZP B;  2W25 A;  4S05 A;  4PGG A;  1HSJ A;  2VC0 A;  2O6G E;  3JW4 A;  4ZH4 F;  2FEZ A;  5ICG A;  4ZYH A;  1GHC A;  2QM3 A;  1U5T C;  4FX0 A;  3M8E A;  4Q47 A;  2A3S A;  3M7G A;  1OYY A;  1XGN A;  3RYP A;  1TW3 A;  3QPH A;  1VTN C;  1QPM A;  1IXC A;  5JR3 A;  1TBX A;  2M5W A;  2JPB A;  4RGR A;  2B0L A;  4U88 A;  4LG0 A;  1JXS A;  1Q1H A;  1O3Q A;  2DW4 A;  3MCZ A;  4M9Z A;  1XDU A;  4L5I A;  2Z5U A;  5F64 A;  2NNY A;  3PFI A;  3KEO A;  3TO6 A;  2GA1 A;  1XMA A;  2L54 A;  2IW5 A;  4A5M A;  3MEX A;  2HZT A;  3GEZ A;  1XSV A;  2EFO A;  5F1R A;  1F9N A;  4L9V A;  2UZK A;  5LGN A;  1ODD A;  1BC7 C;  2RVC A;  3F3X A;  2FBH A;  5EEG A;  4FHT A;  1HKS A;  5F6F A;  5E17 F;  3TO7 A;  3GFM A;  1WI9 A;  5CVR A;  2BV6 A;  3H3Z A;  4KNY A;  4BNC A;  3BP8 A;  5DCF A;  3FXR A;  2EA2 A;  1R36 A;  4G6Q A;  4ENJ A;  2ADU A;  1R1V A;  4EMS A;  2FQ3 A;  4U0W A;  1KYZ A;  2W85 A;  4WWC A;  1YYV A;  2KIF A;  1RNL A;  1K6O A;  1H9G A;  2PMH A;  2MH2 A;  2XAG A;  3CLO A;  4JK1 X;  1LDK B;  3ECH A;  4OIQ F;  1FSH A;  1FBU A;  5LLQ A;  4IRG A;  5IT9 Z;  2KJB A;  4HDV A;  1S7O A;  4ESF A;  2IVM A;  3F6V A;  3VFZ A;  1E2X A;  4AIH A;  4P9U A;  1L0O C;  2HYF A;  3DP7 A;  5BMZ A;  5LEK A;  2COM A;  2DPU A;  4UUV A;  1REP C;  3KEQ A;  2EFW A;  3TOB A;  2V9V A;  1TNT A;  4Y13 A;  3SZP A;  3F8C A;  2EFQ A;  4Y17 A;  2GA2 A;  3LAJ A;  4A5N A;  4M73 A;  3PQK A;  1LEB A;  3G3Z A;  2H6C A;  4HF0 A;  1S7A A;  4LFU A;  4GYI A;  4EJW A;  3GXO A;  3S2W A;  2IPQ X;  1OYI A;  5D5X B;  1W5T A;  2ISY A;  3KLO A;  4JQF A;  3ZMS A;  4DNC A;  2L01 A;  5K5R A;  1OR7 A;  1ZYR F;  4XSX F;  3WTX C;  5DD4 A;  5FB2 A;  5LHG A;  3T8R A;  3NQO A;  4R79 A;  2DO7 A;  2XAQ A;  1U5T B;  1MJB A;  5K5Q A;  2FSW A;  3BRO A;  2RKH A;  3RKW A;  3L09 A;  3ERE D;  4YII A;  3KZY A;  5E18 F;  1U8R A;  1O3R A;  3IKV A;  1CGP A;  1QQI A;  2ACJ A;  3GZ5 A;  2M30 A;  4IVN A;  4P96 A;  2K02 A;  4K2E A;  3KP6 A;  3F22 A;  2OZ6 A;  2UXX A;  1AOY A;  1FSE A;  1FNN A;  3RKX A;  4HA8 A;  3WTU C;  3GWZ A;  2W57 A;  3ZQ7 A;  2D1H A;  2KIU A;  3BPV A;  4BHB A;  1KU7 A;  2Z3Y A;  2CO5 A;  2QUF A;  5LRR A;  4M74 A;  3FM3 A;  4OIO F;  2IA2 A;  5JVT A;  1K79 A;  1QBJ A;  1G3Y A;  3D5L A;  3HRS A;  5FO5 A;  1SD5 A;  2JRT A;  2O3F A;  2V6C A;  5D5V B;  4IF4 A;  3IHU A;  5BQT A;  3QP6 A;  2UXN A;  5CVJ A;  2P7V B;  3P7N A;  4O3M A;  1B1B A;  3V7R A;  3FHZ A;  2OBP A;  1IAW A;  4HW0 A;  3QU6 A;  3HYI A;  2FXA A;  3QP5 A;  5DEQ A;  2VON A;  3R60 A;  1XCB A;  1R5H A;  2E1N A;  3Q5F A;  2Q0O A;  2GXB A;  3KLN A;  2J5P A;  2QQA A;  4A0Y A;  5K5O A;  3GLX A;  4RB2 C;  3JTH A;  3U1D A;  4EVI A;  3ZN0 A;  3REO A;  1V4R A;  2H94 A;  4WK8 F;  2P7C B;  3FF5 A;  1MDM A;  4GYG A;  1IXR C;  4S04 A;  2FML A;  3JSO A;  1HW2 A;  1MDM B;  1Z7U A;  3GW2 A;  1IW7 F;  2LNB A;  3LST A;  3FX3 A;  3KP7 A;  1J5Y A;  1XSX A;  3IL2 A;  3TQN A;  2NNN A;  1JHF A;  3WTS C;  5E8I A;  1O3S A;  2MC3 A;  2MLK A;  2R7F A;  5J8F A;  2GAU A;  4DQ2 A;  3WU0 A;  2GQQ A;  1ULY A;  3EET A;  4KFC A;  4YFK F;  3LAP A;  3I5U A;  2BYV E;  2LDU A;  2YPR A;  1RZ4 A;  3E3V A;  1BBY A;  1LJ9 A;  4KN4 X;  3RIR A;  3WTY C;  2M8E A;  4O6J A;  2OA4 A;  2UWM A;  4ON0 A;  4HV5 A;  2VXZ A;  2OQR A;  1IXS B;  3EYI A;  3F8N A;  3BJO A;  3J80 K;  5CYV A;  1FP2 A;  4HLX A;  1BI1 A;  4HZF A;  5ICF A;  1SD4 A;  3HSF A;  2CWE A;  2P6S A;  3E5X A;  4MNU A;  3GZ6 A;  1TLH B;  2Z33 A;  4LLN A;  1SD7 A;  4F7Z A;  1SMY F;  2H27 A;  1S29 A;  4KIF A;  1Z6R A;  1FLI A;  4EJO A;  5L3E A;  3IC7 A;  3I71 A;  3E5U A;  3DFG A;  3GFJ A;  3HHG A;  3I53 A;  1FBS A;  4I98 B;  3E6D A;  2AXL A;  4MEX F;  2A69 F;  3CO7 C;  2A6H F;  2MA3 A;  5TRD A;  4M6Y A;  3KFW X;  2CW0 F;  2CSO A;  5DD8 A;  3L9F A;  3MAJ A;  3C1D A;  4AWX B;  2ESH A;  1UHW A;  2M45 A;  4ENM A;  3GYH X;  1T38 A;  2ESN A;  2HR3 A;  1ZG1 A;  3M9A A;  4HAM A;  4I7H A;  3HHH A;  2K7L A;  1DDN A;  1HBX G;  3RPU A;  1MKM A;  3FM5 A;  4LK1 F;  5L3D A;  1J59 A;  4BQA A;  1BN5 A;  4A6D A;  2WC2 A;  1U3E M;  2A61 A;  2G9W A;  4ASN A;  3R0A A;  3MFK A;  2VT3 A;  3O2P E;  2EK5 A;  3JAM Z;  1R5G A;  2VN2 A;  3H92 A;  4EGY A;  5AON A;  3FMR A;  3CUQ A;  1XD7 A;  2OD5 A;  2LF7 A;  2STT A;  2RC4 A;  2FMY A;  1LEA A;  4UVC A;  3VEP A;  1MD0 A;  2LSO A;  2DLL A;  3OOP A;  4OIN F;  3BWG A;  4RB1 A;  3GFI A;  4OMZ A;  1G4D A;  3BY6 A;  3BPX A;  4KDP A;  3WGI A;  3LA3 A;  3CTA A;  3C7J A;  2DBB A;  5HDG A;  5ILS A;  2R3S A;  2CYY A;  3FWE A;  4LG0 B;  2D2W A;  5ILU A;  4N0B A;  1R1T A;  4CXF A;  3LFK A;  5D5U B;  5D4R A;  3HOS A;  1XGS A;  1MJA A;  5FLX Z;  2VBX A;  2PN6 A;  1FBQ A;  2CFX A;  4N9H A;  1ZRD A;  3FMS A;  1KQ9 A;  3HSE A;  4RS8 A;  2DK5 A;  3TO9 A;  4HX8 A;  4A6E A;  4GO1 A;  4BH9 A;  4GGG A;  2HKO A;  1HW5 A;  1IN4 A;  1IN8 A;  2XV4 S;  5D8L B;  1ON1 A;  4OOI A;  4IRI A;  5HDK A;  3E6B A;  3VOE A;  1ZLJ A;  2M1B A;  3K1M A;  4XLP F;  4OIP F;  3I4P A;  3MWM A;  1F1Z A;  4CHU A;  4AD9 A;  2IA0 A;  1D8K A;  3LWF A;  3BJA A;  1IF1 A;  4A0X A;  3WTW C;  1J7K A;  2JT1 A;  1SFE A;  2BEO A;  2KJC A;  3QAH A;  3HRM A;  4LGW A;  4RAY A;  4L5J A;  3E97 A;  2LF8 A;  1CF7 A;  1KU2 A;  2Q2E A;  3KP3 A;  3RKY A;  2QQB A;  4YFX F;  3DKW A;  2EV0 A;  3SXY A;  4EM0 B;  1CF7 B;  5HLI A;  1LQ1 A;  2QEN A;  2XAF A;  4PGH A;  3HTS B;  4RGS A;  3C3W A;  2KRF A;  2QYO A;  1ZG3 A;  4M72 A;  2HGC A;  5A2Q K;  1XCV A;  5ILV A;  3L7W A;  3F8M A;  1E17 A;  2ZNY A;  4NB5 A;  5DV5 A;  4KT5 C;  1Z1D A;  1S3J A;  4MEY F;  4BYY A;  3GF2 A;  1K78 A;  4G7H F;  4I09 A;  4KYW A;  2QQ9 A;  1SFX A;  2DT5 A;  1ZG5 A;  3LQQ A;  1FPQ A;  4PZJ A;  4LLG F;  1B4A A;  4OU0 A;  1AWC A;  5HS8 A;  4KMF A;  5E1Z B;  2PJP A;  4FX4 A;  5BPD A;  3RJP A;  2DQL A;  3DPL C;  3RDI A;  3WU1 B;  1W5S A;  4KMU X;  2VC1 A;  1WRJ A;  2VBW A;  1FYK A;  5ED4 A;  4ZZL A;  2OQG A;  1SMT A;  1BI3 A;  2DTR A;  3EDP A;  5HLH A;  2ZKZ A;  3V4G A;  1H9T A;  1USS A;  2FBK A;  1T0F A;  2ELH A;  1LB2 A;  4MGR A;  1YO5 C;  4IHS A;  3J81 K;  1BI2 A;  1GXQ A;  3KP4 A;  5H6R A;  3W6K B;  3WG9 A;  4ETS A;  4NHJ A;  2A68 F;  1EH7 A;  4AIJ A;  2CQK A;  3NRV A;  1Z05 A;  3ABU A;  1LDJ A;  5H20 A;  5A2Q Z;  2QVO A;  2XAJ A;  2PG4 A;  1P92 A;  5FD6 A;  1YW9 A;  1R58 A;  5BS6 A;  4EGZ A;  3ZMZ A;  3HSR A;  2P5K A;  3NEU A;  5D8K B;  1QZY A;  5D4S A;  4EJU A;  4I2O A;  4ZYE A;  3N4M A;  2P5V A;  3TDZ C;  2GZW A;  2NYX A;  2V79 A;  5LGT A;  1MJ9 A;  4A0Z A;  5ICE A;  2HQN A;  3QU3 A;  1XSD A;  2ZO4 A;  2F5D A;  2RGV A; 
#chains in the Genus database with same CATH topology
 1FTT A;  3PM1 A;  2COB A;  3QOP A;  3WTZ A;  1RI7 A;  1XMX A;  3FMQ A;  4HDU A;  1K4S A;  1MBE A;  1X1P A;  4CCN A;  2JSP A;  2JTV A;  2P4W A;  3F23 A;  1Y1W J;  2ICW G;  1ZGA A;  2AHQ A;  3GFL A;  4PJJ A;  1R5I D;  3S3M A;  3H9G A;  4P5O A;  2ECC A;  2STW A;  1E3O C;  3L00 A;  3H5R A;  3R6S A;  3I9V 2;  5JLX A;  4Q48 A;  5CPR B;  1LKX A;  1R7J A;  2DA1 A;  4F93 B;  2F5F A;  4XKC A;  3ZMT A;  2RQQ A;  3F6O A;  2FU4 A;  3DTI A;  4UNO A;  5FKL A;  2WTE A;  3L2W A;  3TW7 A;  5FLM J;  1OCP A;  1BJA A;  2FBI A;  2K5C A;  2F5E A;  3CJR B;  3GLL A;  3KCC A;  3O6B B;  3ZXS A;  4KIT B;  1PYV A;  2KZV A;  3VOD A;  5E79 C;  3IRQ A;  4KIB A;  2NAZ A;  3JRA A;  2E7X A;  3EUH A;  1S8N A;  4M6X A;  1BA5 A;  2HZD A;  1TNS A;  1ZAO A;  3CF5 F;  2PI0 A;  3KZZ A;  4UV9 A;  4QWQ A;  1JUP A;  3OYL A;  1P4X A;  2L9N A;  2A05 A;  4OAZ A;  1WWX A;  2JSC A;  3TP0 A;  4ANJ A;  2AS5 F;  2VE9 A;  1S72 I;  2IT0 A;  1QRY A;  2F2E A;  4C30 A;  1UCR A;  5HLT A;  4B3A A;  5KVR A;  1EH8 A;  1NG7 A;  4X0G A;  4BY1 J;  2H6B A;  4ZYD A;  4L0Z B;  2A5W A;  2XPV A;  4RM3 A;  3MD2 A;  4AVZ A;  4E70 A;  1D8J A;  3PQJ A;  2EWN A;  4HX7 A;  5AIP A;  3TL4 X;  2GXG A;  2M9H A;  2LVS A;  4NC8 A;  2C6Y A;  5DUI A;  5E8G A;  2P81 A;  3TKY A;  3MMY B;  4F3Q A;  1SVM A;  4KA4 A;  1A31 A;  2I10 A;  3BR5 A;  2V26 A;  3CUQ C;  1BIA A;  3KYD B;  2DT6 A;  2QBY A;  1LUJ B;  4HRI A;  2VKH A;  1YJN I;  1UHM A;  2DOE A;  3K4L A;  4HV6 A;  3R61 A;  1MBF A;  2QBY B;  2NRA C;  1NG6 A;  4RB3 C;  3T1B A;  5K7Z A;  2W24 A;  2IGK A;  3ZP5 A;  1Z3Y A;  2BY0 A;  1ZR4 A;  2PMU A;  1K7A A;  1VQ4 I;  3WTV C;  2GOX B;  2LRE A;  4L9J A;  2PJR A;  2IXS A;  3PFY A;  1WKM A;  3QYF A;  3FK7 A;  4BBR J;  3WTT C;  3AG3 H;  3V42 A;  4XNF A;  1TC3 C;  2PJR B;  1ITY A;  1P7I A;  4HLY A;  4ZZD A;  2XKO A;  5E3N A;  5LHI A;  5FD5 A;  3KYC B;  2EIJ H;  2TRT A;  2HVQ A;  1HDD C;  4Y7N J;  4R1H A;  1O57 A;  2QZ8 A;  3WGH A;  2O61 A;  1H89 C;  4BE1 A;  1W7P A;  4NDL A;  4LMY A;  2YR2 A;  2YX7 A;  2DFH A;  2YU3 A;  3E6C C;  1KYW A;  2ZBK A;  2BXZ A;  2CW8 A;  3GCM A;  1TT0 A;  1KA8 A;  3ZQG A;  4JBA A;  3PIO F;  5IOZ A;  3ELK A;  2XPU A;  2EPF A;  2ZSI B;  2KT0 A;  3CF2 A;  5KK1 A;  3OWT A;  4AVP A;  4H0E A;  1I1G A;  1P4W A;  5FKM A;  1ZK8 A;  5DYM A;  1KQ0 A;  3IAM 2;  2DFF A;  1YFH A;  1K6Y A;  4M6V A;  4ZC3 A;  3OYJ A;  4FQG A;  3U9G A;  1YRN A;  4BXX J;  2FE3 A;  1PUF B;  3I64 A;  3RPU D;  4Y15 A;  3FXU A;  1YRN B;  1U78 A;  1IRF A;  4ZDO A;  1I1S A;  4WF2 A;  3BG6 A;  1HKQ A;  2L02 A;  2CG4 A;  3JRD A;  1ZLK A;  1ZRF A;  1FOX A;  2BY2 A;  1UST A;  4ZYA A;  1FMV A;  4WCG A;  5CVU A;  4XON A;  1UG0 A;  2DFI A;  4LD5 A;  5L3F A;  1GT0 C;  2HYG D;  3ZMV A;  2P0W A;  2Y2Z A;  3COA C;  3L2U A;  4BY7 J;  1KGS A;  4HBL A;  3JRB A;  1POG A;  3VSK A;  1ZKG A;  3FXO A;  2L7F P;  5D6E A;  3A0B C;  2ZCW A;  2CGP A;  2LC2 A;  4FT8 A;  4LLL A;  3V8L A;  3WGG A;  1V5F A;  3VB2 A;  2E5Z A;  4ENK A;  5B5E C;  2K27 A;  4RB0 A;  5CLS A;  4BHC A;  2K9N A;  1Z9C A;  1DUX C;  2V1X A;  4ZTJ A;  1XGO A;  1I27 A;  4HYE A;  5CVI A;  4I0A A;  1HC8 A;  2DQR A;  2EFN A;  1I5Z A;  3V8J A;  3JCU C;  2R7Q A;  1VQO I;  1L3L A;  3KZI C;  3LSH A;  5J1U A;  5EZH A;  5EF6 A;  4U7B A;  3ISP A;  3H9J A;  1E3H A;  3WU2 C;  3VYR B;  5DDG A;  3PSF A;  4WXC A;  2P8T A;  3A02 A;  2R92 J;  2X6W A;  1RET A;  2PMZ N;  3T5X A;  1IN5 A;  1XDS A;  3C2G A;  1R22 A;  2ETH A;  3K1P A;  4ITV A;  1B9N A;  4UXN A;  1NH3 A;  1R1U A;  1ZQ3 P;  4EV0 A;  2KHM A;  4XLE A;  3VYU B;  3AKZ A;  2BY3 A;  3ZCO A;  2K9Q A;  1PP8 F;  2HOS A;  4G94 A;  1HST A;  5F27 A;  4BAC A;  3FIS A;  2JA2 A;  2V1D A;  3K4B A;  2DJN A;  4II2 A;  3DQV C;  3BTL A;  1FOK A;  2PX9 A;  4PJM A;  3IH4 A;  1VI0 A;  2VE8 A;  2X51 A;  2G7U A;  4WXH A;  3ZN1 A;  4GDF A;  1FOY A;  5KNL A;  3HIF A;  5FKK A;  2IS4 A;  4I0B A;  2L4A A;  4PDK A;  4G6T B;  4E7Z A;  2MH9 A;  4U0Y A;  2VPR A;  4XLC A;  3H0G J;  4B8X A;  2XIG A;  3J80 Z;  3SDB A;  2O8K A;  4DW6 A;  2ZME A;  1HXD A;  2Q8K A;  4KUM A;  3C18 A;  2BW3 A;  3FIW A;  3RTR A;  1V5E A;  3Q9S A;  4U0V A;  1F43 A;  3K70 C;  2VB6 A;  2BW3 B;  3ML6 A;  2VI6 A;  4D5C A;  2Y0M A;  1EV7 A;  1SFO J;  2VQH A;  4IHT A;  3OYB A;  1OKR A;  4LB5 A;  2LKS A;  2L5Q A;  4GXO A;  2CW7 A;  3MKW B;  2W84 A;  5LRS A;  1B59 A;  2BE5 F;  4O5V A;  1OPC A;  1W4M A;  4LJZ F;  1X4P A;  2XHK A;  4X6A J;  3FZV A;  1BIB A;  3BLY A;  1ETX A;  3HGG A;  1G3T A;  2ME6 A;  2PQ8 A;  1QO0 D;  1JGG A;  2OV7 A;  3P9I A;  1GV2 A;  2QSH X;  3FKJ A;  2DTZ A;  1D1C A;  3R0J A;  4L9T A;  2ZJQ F;  3QOE A;  1U9N A;  2HYJ A;  5ICC A;  2UV1 A;  2X0L A;  3CUQ B;  3RI4 A;  3ZMU A;  1JT0 A;  4G7Z F;  1DP7 P;  5M3F J;  4DGW B;  1UB9 A;  1IV6 A;  4JOM A;  2Y75 A;  5E20 A;  2EB7 A;  3E6M A;  2QEX I;  5FFZ A;  2EA4 A;  2QSF X;  1TZL A;  5DUK A;  1K83 J;  3CCE I;  4EJT A;  1ERD A;  3C2B A;  4E7S A;  3D0S A;  4AIK A;  1OYW A;  2K4B A;  1IC8 A;  4OMY A;  2X4H A;  1TQP A;  2F5V A;  4NQW A;  4P9F A;  2CUZ A;  3V7S A;  3SQN A;  3P9K A;  1U9O A;  1XX5 A;  4C2U A;  3IP4 B;  2WAD A;  2R7W A;  2P5L C;  4MHG A;  2CUE A;  3TDU C;  5DTD A;  1HQC A;  2CU7 A;  2FNP A;  3S3O A;  5JFR A;  2IA1 A;  2IS6 A;  1T0F C;  5J4V A;  1ZHF A;  2RNG A;  3K4J A;  2CFO A;  3LSI A;  3S14 J;  3S15 J;  1EF4 A;  1BR2 A;  3ZPL A;  3B73 A;  5F04 A;  2ZXJ A;  1MGT A;  4UVA A;  2BGC A;  1Y8R B;  3KP2 A;  2R5Z B;  1IUY A;  1FYM A;  4WXD A;  5EG0 A;  2DA5 A;  1XMK A;  4HST A;  1A6Q A;  2Y48 A;  3EQL F;  3K0L A;  3GTP J;  2JN6 A;  4OWR B;  2NOJ B;  3HBL A;  5IT9 K;  2O8X A;  1Y0N A;  3M8J A;  2OU2 A;  1DPU A;  2AQE A;  2IJL A;  3BCA A;  1AKH A;  5J4Y A;  1J9I A;  3RQ4 A;  3K70 D;  4B4C A;  2WAQ N;  2DMQ A;  1F5T A;  3ZQF A;  2V9P A;  2W48 A;  4BQO A;  5GPA A;  2GLO A;  4XSZ F;  1AKH B;  5F0C A;  3PUB A;  2FD5 A;  3DXJ F;  3RZO J;  4IHY A;  4L18 B;  4FIS A;  2QA4 I;  4RM2 A;  1YJW I;  2HQR A;  2ISZ A;  3KP5 A;  3HKZ A;  1O4X A;  3I59 A;  5J8C A;  3SEQ A;  4A12 A;  2L0K A;  3QPL A;  3RPQ A;  1ZAR A;  1XS9 A;  1OLT A;  3I59 B;  4B09 A;  2DK8 A;  3FBI B;  1DGW Y;  2DA6 A;  4QPO A;  1R49 A;  1KU9 A;  2NS0 A;  3BZK A;  2JUC A;  1WJA A;  1YW7 A;  2DMU A;  5IT3 A;  2HS5 A;  4C3J J;  2OTL I;  1SD6 A;  3OYH A;  1O7F A;  4YIF A;  2LK2 A;  3L2R A;  2XAH A;  3RSN A;  2IGO A;  2FOK A;  2E1C A;  2NXN B;  5HVQ C;  3EPZ A;  4F91 B;  4JX5 A;  1BOB A;  4MTE A;  4Y52 J;  2HFH A;  1Y39 A;  3LMM A;  3WOD F;  4IPA A;  1X1D A;  3CJT B;  3SFZ A;  4RBO A;  3MN2 A;  5HS7 A;  3EUA A;  3N05 A;  1W36 C;  2K4J A;  4DYR A;  1JJ6 C;  5LBQ A;  2J5O A;  2MLG A;  3ZMD A;  5GTH C;  3Q9V A;  2FA5 A;  1YX5 A;  3V7C A;  1ZN2 A;  4ESJ A;  3VWB A;  4E7K A;  4IHW A;  5EEH A;  2HQA A;  1QNT A;  3JRI A;  4Q5S F;  2NOG A;  2CV1 A;  3ABT A;  1T39 A;  1ON2 A;  4Q4Z F;  1PUE E;  3GTO J;  1WJB A;  4NC6 A;  5IYB J;  5DM7 F;  1ZRC A;  4KT6 A;  2XF6 A;  4B1R A;  2XB0 X;  3EUH C;  4UUS B;  3F8F A;  3F72 A;  5FGM A;  2EZK A;  4RAZ A;  3LA7 A;  1BC8 C;  3ZRG A;  2Q2E B;  5CJ9 A;  2EJR A;  5HDN A;  4M9X A;  3CC4 I;  3PNY A;  3JRC A;  1YQA A;  5DS9 A;  2JVG A;  3IAS 2;  2V1U A;  1IN7 A;  1QGP A;  4BAY A;  4R8H A;  2RQP A;  2FNA A;  2EV6 A;  2GIV A;  1BOA A;  2KZG A;  2ZFW A;  3KE2 A;  2EFP A;  1ZH5 A;  4TV7 A;  1RKT A;  3L1P A;  5L3C A;  4YG2 F;  2WWY A;  2B63 J;  2NVQ J;  3BOQ A;  1A04 A;  2OUM A;  5J47 A;  3FDY A;  3O3K A;  2LTP A;  4DBQ A;  2PFB A;  3GX4 X;  3GME A;  3CC7 I;  1WJD A;  2EH3 A;  1O7L A;  1SVL A;  2RN7 A;  2RNJ A;  3BR3 A;  1G3S A;  1FC3 A;  4QPQ A;  5KHD A;  5LGU A;  3H5A A;  4N9I A;  3DPT A;  2K85 A;  2R7D A;  2IP2 A;  4I02 A;  3HG9 A;  2DA2 A;  5D5W B;  4II3 A;  2Y31 A;  3BG9 A;  1M1E B;  1YW8 A;  3G71 I;  4IJA A;  4HX4 A;  3OV8 A;  1K78 B;  3JRF A;  2QGU A;  3TGN A;  1PVE A;  2E7W A;  2D45 A;  3IH3 A;  3GUD A;  4RGU A;  3T8T A;  1BM9 A;  1C0W A;  2L4M A;  4XLN F;  3KET A;  3HEF A;  3SHF A;  3SZT A;  4C2T A;  2LLK A;  1MMA A;  3DEE A;  3GO5 A;  5IYD J;  4D7N A;  3WE2 A;  3E7L A;  1TQM A;  3V8K A;  4E7L A;  3HRT A;  4LB6 B;  1VQ5 I;  3LA2 A;  3OYM A;  3LOC A;  4G6D A;  1FT9 A;  1YTY A;  1IRZ A;  5AIQ A;  1YS6 A;  1IRG A;  2YX4 A;  2A6E F;  1WQ2 A;  4QLC U;  1V3F A;  1GVJ A;  2R5Y A;  4UB6 C;  4XN0 A;  3CQZ J;  1G2H A;  3LSR A;  3QPT A;  2VKE A;  1W36 D;  4A2U A;  4L0Y B;  1J09 A;  2R5Y B;  1U5T A;  2VQL A;  2IEK A;  2L3D A;  5ERI A;  1DGR M;  1ETV A;  4IL6 C;  1ONV A;  3HRU A;  2WA0 A;  4UHT A;  1YLF A;  1TW2 A;  5HOO A;  3CC2 I;  4EM1 A;  2WB1 A;  3DKX A;  2Y30 A;  2XKP A;  1HW1 A;  1DQU A;  2F5C A;  1GDT A;  1X2M A;  1J2X A;  2FF4 A;  2FQ4 A;  4HOB A;  5B1B H;  2QWW A;  4AYB N;  4EJV A;  1H88 C;  2YUS A;  3GTL J;  2KPM A;  1V55 H;  1IV8 A;  4CZZ A;  2VBY A;  1OMI A;  3S3N A;  2M8G X;  2M0C A;  1MMG A;  3H35 A;  1FX7 A;  2O0Y A;  1TQI A;  2WB1 N;  1BW5 A;  3KPH A;  2DAO A;  3I3L A;  3KYL A;  1LVK A;  3CDI A;  3HOT A;  1FJL A;  3MZH A;  1YIJ I;  1U6G A;  3GBG A;  1Y6I A;  5DCM A;  3L2C A;  1FMW A;  5KAF C;  4CCJ A;  1S6L A;  3VYT B;  3FKI J;  2HKX A;  4BHP A;  5H2F C;  5DCM B;  4M9S A;  3IV5 A;  1LVA A;  3S32 A;  3OL3 A;  4YFN F;  2KRC A;  4ENN A;  1MSE C;  3MQ0 A;  2ZJ2 A;  4A3J J;  1HKT A;  1KU3 A;  3HUG A;  3TW6 A;  3M1E A;  3IWZ A;  1D5V A;  6PAX A;  2BBY A;  3H9Q A;  2XGE A;  1ZRE A;  4Z2Y A;  1P6R A;  5CVV A;  4RGX A;  2ZNZ A;  2H09 A;  3FXQ A;  2EZI A;  2A07 F;  3CP2 A;  3NAR A;  4P55 A;  4BU2 A;  4A3M J;  3BQY A;  1TTY A;  3S17 J;  4UV8 A;  1BI0 A;  4IOC F;  3ECO A;  1LNW A;  5HS9 A;  2IS1 A;  1U2W A;  4B48 A;  2IAI A;  3H3U A;  2XVC A;  4G12 A;  3LSG A;  4PCQ A;  2HDC A;  3GTG J;  1UZC A;  1B6A A;  3BR6 A;  2QSG X;  5IOY A;  2DJI A;  1YIO A;  3E0J B;  2V6E A;  2PLY A;  1W7P D;  3UKG A;  4XRF A;  1W1W E;  3ROU A;  3N97 A;  3EYY A;  5FFX A;  2VJJ A;  2FRH A;  2HTS A;  2OC6 A;  3S1N J;  4DIQ A;  1NHA A;  1I6X A;  3I0T A;  1G3W A;  4XQF A;  3QYE A;  4ESB A;  3I54 A;  3OIQ A;  4HQM A;  1SEU A;  2DU9 A;  3QRF F;  3K4M A;  3BG5 A;  4D9J A;  2NS8 A;  2ZME C;  3J81 Z;  4M71 A;  4CIC A;  2WV1 A;  3A4C A;  3I4M J;  4G8X A;  3U2R A;  2KKO A;  5JHU A;  4EQQ A;  2I8D A;  1JT6 A;  2RDP A;  2IRF G;  4KN7 X;  2IGN A;  2TDX A;  4G9Y A;  1SFU A;  3M8F A;  4KIC A;  3K4K A;  1DPR A;  1VZ0 A;  4I01 A;  5DM6 F;  1P4A A;  4C2M J;  2D1V A;  3B02 A;  3RKQ A;  2VOD A;  2XUB A;  4XIC A;  3WHC A;  5L3B A;  5FKN A;  3ULQ B;  4LG3 A;  5IY5 H;  1Z91 A;  1KZH A;  3VYS B;  1RUN A;  2GXA A;  1STZ A;  3AL0 C;  5GP9 A;  2Z99 A;  1YJ9 I;  2G7H A;  1N25 A;  3D1N I;  2EZL A;  4ZDL A;  1O3T A;  3UNG C;  4HNU A;  1SAU A;  1ZGJ A;  5E1W A;  3DPU A;  2LBF A;  3OYF A;  2FJ1 A;  4D0P A;  1JI8 A;  4IXA A;  4NBQ A;  3DLA A;  4BS9 A;  5HLG A;  5EJC A;  4A69 C;  5CQE A;  1Z6T A;  1LDD A;  4Y4R A;  1X4O A;  3HZJ A;  2JA6 J;  2WY8 Q;  3I58 A;  4ZDP A;  4GCV A;  1S5L C;  3J7A O;  4L9N A;  2M4K A;  1MZB A;  4BBS J;  2HTJ A;  2GWR A;  1FY7 A;  1Q1V A;  3G1O A;  2Y0S N;  2JPC A;  3TBI A;  1PDN C;  2MD5 A;  3K9T A;  1J0R A;  3BTJ A;  3M07 A;  4X1E A;  1WJE A;  1RKW A;  2JWT A;  2M87 A;  2OPT A;  2V9K A;  4UVB A;  3FK6 A;  1W7P B;  3DEU A;  2HU9 A;  2ZFU A;  2ZJR F;  2Z2S B;  1QZZ A;  3B6A A;  2KDZ A;  2HVR A;  1VQN I;  2XGX A;  3BDD A;  1I3A A;  4A3K J;  4HF2 A;  2HOE A;  2A5Y B;  3DF8 A;  1RIO H;  1WH5 A;  3W3C A;  3QWL A;  1Y8Q B;  3TOA A;  2MG4 A;  3AAF A;  1IZ1 A;  3HB9 A;  2E1O A;  2Q1Z B;  1YIT I;  2LKP A;  1F4K A;  1T6S A;  4HG2 A;  4XKW A;  2EV5 A;  5JVG F;  1KQ8 A;  1YOV B;  3DTE A;  3CCM I;  4M3D A;  3CDH A;  2OAZ A;  3K1N A;  5D6F A;  2DA4 A;  4YEL A;  5EEA A;  5K7H A;  3JRE A;  3NWT A;  3IRR A;  2FOW A;  1XB4 A;  1FWZ A;  4L5E A;  3CO6 C;  4HQE A;  1OJL A;  3CUO A;  1P7J A;  1MNE A;  2DOA A;  3OR2 C;  1K4T A;  3OSG A;  5L3G A;  1SAN A;  1YS7 A;  2IBD A;  4AM3 A;  4ZJZ A;  2BVM A;  1X3U A;  1Y0U A;  1OCR H;  2MBF A;  3VSL A;  4ZYG A;  1QVT A;  4XM3 A;  1T2K A;  2CQQ A;  1WI3 A;  4RAF A;  2KFD A;  4MQV A;  4IRH A;  4BE0 A;  1H0M A;  2XRN A;  4DZJ A;  2MGQ A;  1PP7 U;  3M4O J;  1FP1 D;  2NS7 A;  3G73 A;  2O03 A;  1I39 A;  2PEX A;  3K2Z A;  3LQR A;  4E4H A;  4LK0 F;  2RRE A;  4M3G A;  2XAS A;  4U7D A;  2RV8 A;  5GAD J;  2Z9O A;  3KIO A;  3OS0 A;  2PMZ A;  2JZY A;  4LIT A;  3QYB A;  3DWL E;  4WX9 A;  2VJ5 A;  1G6N A;  2F4M B;  4XKB A;  4XBF A;  3W6J B;  5C44 J;  5HOD A;  1XGM A;  1OCC H;  2XF5 A;  2E1M C;  2YS9 A;  4V19 K;  1BJZ A;  3E5Q A;  4FTH A;  2QLZ A;  2X6O A;  3BJ6 A;  4CCK A;  1IN6 A;  3CJN A;  3K4C A;  3R4K A;  4XOT A;  2ZC2 A;  1XN7 A;  4KIG A;  5E1X A;  5J6X A;  5TJJ A;  3SZG A;  1QZE A;  3JAM K;  3DLL F;  2DXI A;  3CDL A;  3P9C A;  2PBI A;  1J75 A;  3LFU A;  1FYL A;  2F4I A;  3JTG A;  4BXU A;  1AU7 A;  2O5R A;  1S7E A;  3MKY B;  2DI3 A;  2P6T A;  3T0Y A;  2AO9 A;  2HWV A;  4OIR F;  4CGZ A;  3WE3 A;  1GVD A;  3C2H A;  5K1Y A;  1P2F A;  1D3Y A;  5KAI C;  1VND A;  5EGO A;  1OIS A;  5BOX A;  5JI6 A;  4HSR A;  1BL0 A;  2DPD A;  3BZ6 A;  4IEJ A;  2CS3 A;  2IGM A;  1T8I A;  3CD6 I;  3IKT A;  2VT2 A;  4MQ9 F;  3X2Q H;  1WSU A;  2YSR A;  3IWF A;  1B9M A;  4CYD A;  1YG2 A;  1QA6 A;  2HEO A;  4MTD A;  4A3I J;  1XC5 A;  3HTU A;  1X1C A;  3F8B A;  4D7M A;  1CQT A;  5LHH A;  3BC8 A;  3DEW A;  4N4O B;  2XRO A;  3G4S I;  2ZME B;  2KIM A;  1VQ8 I;  2VBZ A;  4PJ0 C;  4EM2 A;  1TWG J;  4BDY A;  4RDU A;  1R00 A;  5FRO A;  5LEJ A;  3KEY A;  3BZC A;  2CMP A;  1JHH A;  5E3L A;  4RLQ A;  3DBL B;  3JSP A;  2WAF A;  2K86 A;  5FLX K;  4G7O F;  5H6Q A;  5BPI A;  1KON A;  3RYR A;  4CDG A;  2LY9 A;  1IGN A;  3OIP A;  2BY1 A;  3MZY A;  3IH2 A;  1LFU P;  3AL0 B;  2VQG A;  1EH6 A;  1JKQ C;  1NTC A;  3LSK A;  1X1A A;  4IQ4 A;  2X1E A;  1GXP A;  2EIK H;  3CCY A;  4M3E A;  4NUB A;  4D5F A;  1JE8 A;  1Y1V J;  3F21 A;  1UFM A;  2JA5 J;  2OZU A;  1SAX A;  1T98 A;  3GVA A;  4I76 A;  2WV0 A;  3BR1 A;  2VOP A;  1R23 A;  3K69 A;  2EIM H;  2VOO A;  1RUO A;  3DV8 A;  1JGS A;  4CO8 A;  1JKP C;  4HF1 A;  4J00 A;  1FZP B;  2W00 A;  2VQC A;  2W25 A;  3S8P A;  3CME I;  2R7O A;  3H1C A;  3DU5 A;  1EKE A;  2X1D A;  4S05 A;  4PGG A;  2Z1D A;  1D1B A;  3MKZ A;  1HSJ A;  2VC0 A;  2F6C A;  3K2A A;  1WJ5 A;  2O6G E;  3JW4 A;  4ZH4 F;  2FEZ A;  5ICG A;  4ZYH A;  1GHC A;  4RA2 A;  4NQW B;  2R0Q C;  2QM3 A;  2BHY A;  1U5T C;  2NVX J;  1IRX A;  4FX0 A;  4JP0 A;  4M3F A;  3M8E A;  4Q47 A;  3K4N A;  4QIW N;  3OIO A;  2A3S A;  3M7G A;  1OYY A;  1XGN A;  3RYP A;  2X85 A;  3PSI A;  1TW3 A;  3QPH A;  1LE8 A;  1VTN C;  1QPM A;  1IXC A;  3MKL A;  2WAQ A;  5JR3 A;  1TBX A;  5HNF A;  1IDY A;  1R9T J;  2M5W A;  2JPB A;  4RGR A;  2B0L A;  4U88 A;  4LG0 A;  4XL9 A;  4A3F J;  2MAB A;  1MH4 A;  1UAA A;  1JXS A;  4BXF A;  1Q1H A;  2OCE A;  5EG0 B;  3NWS A;  5CQG A;  3CCR I;  1O3Q A;  2JK3 A;  2DW4 A;  2XAU A;  5IP9 J;  3MCZ A;  3KX2 A;  4M9Z A;  1XDU A;  4PJL A;  2NVU B;  4L5I A;  3D5R C;  1B8I A;  2HOT A;  4IQJ A;  2Z5U A;  5F64 A;  2CRG A;  4I99 C;  2NNY A;  3PFI A;  3KEO A;  3TO6 A;  1B8I B;  1WCM J;  2GA1 A;  4F55 A;  2TCT A;  2X1C A;  1XMA A;  2L54 A;  2IW5 A;  1WVR A;  5C4X J;  4W97 A;  4FE7 A;  4A5M A;  3MEX A;  2HZT A;  2H1K A;  4ZTF A;  3GEZ A;  1TWF J;  1XSV A;  2EFO A;  5F1R A;  4XRM A;  4DYQ A;  3TP3 A;  1F9N A;  4L9V A;  2M3A A;  2UZK A;  4MFE A;  1MW7 A;  5LGN A;  1ODD A;  2JA7 J;  1ZEL A;  3K7A J;  2JA8 J;  1IDZ A;  3FBN B;  1BC7 C;  2RVC A;  3F3X A;  2FBH A;  2X48 A;  5EEG A;  2N8G A;  4FHT A;  1VQK I;  1HKS A;  2O7O A;  2E1M B;  3B6C A;  5F6F A;  3OOU A;  3OMY A;  4CSW A;  4AUX A;  3TO7 A;  5E17 F;  3GFM A;  1WI9 A;  4CZC A;  1EJ9 A;  5CVR A;  2BV6 A;  2MW8 A;  2E71 A;  2XSJ C;  1DU0 A;  3H3Z A;  4KNY A;  4PK4 A;  1ZGW A;  3DBR B;  2K9L A;  3ZR8 X;  2LKX A;  3BP8 A;  2DDB A;  4BNC A;  2R93 J;  3RZD J;  2KIS A;  5DCF A;  2W1O A;  3FXR A;  1R36 A;  2EA2 A;  4G6Q A;  4PFO A;  2L9V A;  4ENJ A;  5BNG A;  2ADU A;  4UB8 C;  1R1V A;  4EMS A;  1HA8 A;  4PSW A;  2FQ3 A;  2QQ8 A;  4U0W A;  1A6I A;  4AID A;  1KYZ A;  4J01 A;  2AXT C;  2W85 A;  4WWC A;  1YYV A;  2KIF A;  2M7B A;  1RNL A;  4B44 A;  1K6O A;  1H9G A;  3J7Z I;  3OY9 A;  2PMH A;  3VDX A;  4CA0 A;  5IPA A;  4XRS A;  2MH2 A;  2XAG A;  1Y56 A;  3CLO A;  4AU7 A;  4JK1 X;  4I6Z A;  2ELK A;  3AG1 H;  4CH7 A;  1LDK B;  3ECH A;  4OIQ F;  1FSH A;  4UUT A;  5E3O A;  1ETQ A;  1IO2 A;  1FBU A;  1RRJ A;  1IJW C;  2BZT A;  4XK4 A;  2JQ7 A;  3PL8 A;  1D1A A;  3EUK L;  2GM4 A;  1MBJ A;  3J7Y J;  5LLQ A;  2R7X A;  5JHF A;  4IRG A;  5IT9 Z;  2KJB A;  2E2H J;  4HDV A;  1QU3 A;  3LSP A;  4H4K C;  1S7O A;  4PUS A;  2KMU A;  4ESF A;  2IVM A;  1BR4 A;  3F6V A;  3VFZ A;  5GAE J;  1E2X A;  2CQ7 A;  2KLO A;  4AIH A;  1X3W B;  2CH0 A;  4P9U A;  1L0O C;  4IHV A;  2HYF A;  3HOX J;  2BVL A;  3DP7 A;  3MZ8 A;  2K40 A;  5BMZ A;  5LEK A;  2COM A;  3AG4 H;  4CYC A;  2DPU A;  2LD5 A;  4UUV A;  2LMD A;  1REP C;  3KEQ A;  2EFW A;  3TOB A;  2V9V A;  1TNT A;  2K9M A;  4Y13 A;  1ZTR A;  4Z6Y A;  3SZP A;  4IHX A;  2GBY A;  2EFQ A;  3F8C A;  4Y17 A;  3O8H A;  2GA2 A;  3LAJ A;  4A3B J;  4A5N A;  3DU6 A;  4M73 A;  3PQK A;  1LEB A;  2LR8 A;  2CUF A;  2H6C A;  3G3Z A;  4HF0 A;  1S7A A;  4B43 A;  1R71 A;  1X19 A;  2BHZ A;  1FEX A;  3OYE A;  4LFU A;  4GYI A;  4HEA 2;  4EJW A;  1AA7 A;  3GXO A;  1RR8 C;  3S2W A;  2IPQ X;  1OYI A;  5D5X B;  1Z0X A;  2R7V A;  1W5T A;  1RES A;  2ISY A;  3KLO A;  1IG7 A;  3CCV I;  4JQF A;  3VPR A;  3ZMS A;  4DNC A;  4LIU A;  9ANT A;  2L01 A;  3HGY A;  5K5R A;  3H0D A;  1OR7 A;  1ZYR F;  2W82 A;  2MFZ A;  4MFD A;  1UMQ A;  3HOY J;  2G0E A;  3OL4 A;  4XSX F;  3WTX C;  5DD4 A;  5FB2 A;  4XR6 A;  5LHG A;  3T8R A;  5GPC A;  3WHB A;  3I55 I;  3NQO A;  4AYB A;  1QHG A;  2DO7 A;  3UR3 C;  4R79 A;  2I5U A;  3FXM A;  3LSJ A;  3CCQ I;  2E60 A;  2L7Z A;  2XAQ A;  4NNJ A;  1U5T B;  1XG1 A;  1MJB A;  3CCL I;  3BG7 A;  3H36 A;  5K5Q A;  2QKL B;  3OR1 C;  2E2I J;  1X58 A;  1VQ6 I;  3PIP F;  1WJF A;  2FSW A;  3S16 J;  3BRO A;  2RKH A;  3RKW A;  3L09 A;  1W5C C;  3ERE D;  4YII A;  2EQR A;  2ZXW H;  1D5Y A;  2OJE D;  3KZY A;  1WH7 A;  5E18 F;  1U8R A;  1B72 A;  1O3R A;  3S2H J;  3ABK H;  3QOD A;  5EDN A;  3IKV A;  1I6H J;  1G8X A;  1MBK A;  1B72 B;  1CGP A;  5B1A H;  3MVP A;  2DMT A;  1QQI A;  2W4S A;  3FXJ A;  2ACJ A;  2HXI A;  3GZ5 A;  2M30 A;  2MSY A;  2ZB9 A;  4IVN A;  4V2G A;  2V4J C;  1WFX A;  2H1L A;  2K02 A;  4P96 A;  3OS1 A;  5B3S H;  4K2E A;  2HDD A;  3KP6 A;  3F22 A;  2OZ6 A;  2UXX A;  3OYG A;  3JRH A;  4QSH A;  1WPK A;  3GTJ J;  1AOY A;  1FSE A;  1FNN A;  3RKX A;  5C4J J;  2QKM B;  3BR2 A;  4BUP A;  4HA8 A;  3WTU C;  3K10 A;  2VAS A;  3GWZ A;  4BGD A;  5LFA A;  2W57 A;  3ZQ7 A;  2D1H A;  2VL8 A;  2KIU A;  3GTQ J;  2JRM A;  3BPV A;  4RMN A;  4BHB A;  1RR7 A;  1KU7 A;  4XLF A;  2Z3Y A;  2LH9 A;  2CO5 A;  2DA3 A;  2K3F A;  2QUF A;  1JTY A;  3A0H C;  3HUG B;  3W2V A;  5LRR A;  4M74 A;  3FM3 A;  4OIO F;  2IA2 A;  2CV2 A;  1QHH D;  5JVT A;  1K79 A;  2M34 A;  2Z16 A;  1Z67 A;  4KJZ A;  3JR9 A;  1NK3 P;  1QPI A;  1AHD P;  1QBJ A;  4E6K G;  1G3Y A;  2O9L A;  2HXO A;  3ZQI A;  3D5L A;  3HRS A;  3L2Q A;  5FO5 A;  2W7N A;  1YHQ I;  3W2W A;  4IX7 A;  1UJ8 A;  4BL0 B;  1SD5 A;  4IO9 F;  2JRT A;  2O3F A;  2ELJ A;  1RC9 A;  3PUF A;  4MLO A;  2HQ5 A;  1YX3 A;  1MMN A;  3HDD A;  2KL4 A;  1DU6 A;  2JVH A;  2V6C A;  4C9Y A;  2WAE A;  2KDO A;  5D5V B;  2DDA A;  5M5X J;  3ERM A;  4IF4 A;  1I50 J;  2ID3 A;  3A1Y A;  3CJQ B;  2DOD A;  3IHU A;  5BQT A;  3QP6 A;  2UXN A;  5CVJ A;  4BJT A;  2P7V B;  3P7N A;  2XDV A;  2OF7 A;  3SEZ A;  4O3M A;  1OFC X;  4YEJ A;  1B1B A;  3V7R A;  3FHZ A;  1D0Y A;  2OBP A;  1IAW A;  4HW0 A;  3QU6 A;  1SC7 A;  3HYI A;  3HXL A;  2FXA A;  3OS2 A;  3S2D J;  2JMW A;  4XOP A;  1OCZ H;  3QP5 A;  5DEQ A;  2VON A;  1GV5 A;  3R60 A;  3LNQ A;  1XCB A;  1VQM I;  4J19 A;  1ETK A;  1R5H A;  1A36 A;  2E1N A;  5KCM A;  2Q0O A;  3Q5F A;  1SFK A;  1LFB A;  2GXB A;  2NVT J;  3KLN A;  2CQX A;  2J5P A;  2QQA A;  4A0Y A;  3AG2 H;  3GLX A;  5K5O A;  4RB2 C;  3JTH A;  3U1D A;  4EEF G;  4FAS D;  4EVI A;  3ZN0 A;  3REO A;  1V4R A;  2H94 A;  4WK8 F;  2P7C B;  3FF5 A;  1MDM A;  2FUG 2;  2Y0S A;  4GYG A;  1IXR C;  4S04 A;  2BOL A;  2JJ7 A;  2LBF B;  2FML A;  3JSO A;  1HW2 A;  2ZJP F;  1MDM B;  1Z7U A;  3RQI A;  3GW2 A;  1IW7 F;  2LNB A;  3LST A;  1X1B A;  1X2N A;  3FX3 A;  1Z77 A;  3KP7 A;  1R6R A;  1J5Y A;  1XSX A;  1X3Z B;  3S1R J;  3IL2 A;  2XGC A;  3TQN A;  2NNN A;  1JHF A;  3WTS C;  5E8I A;  2DT7 B;  3AFH A;  1O3S A;  2MC3 A;  5HNH A;  2MLK A;  2R7F A;  3HOU J;  5J8F A;  3G6E I;  2GAU A;  5EZG A;  4DQ2 A;  2XC7 A;  3WU0 A;  1A35 A;  2GQQ A;  1ULY A;  3PNV A;  3EET A;  2WY7 Q;  4RAG A;  3HOZ J;  2LY2 A;  4KFC A;  4CCL A;  4YFK F;  2XGD A;  1T08 B;  2UUZ A;  3LAP A;  3W6V A;  5FKO A;  3I5U A;  2BYV E;  1PJR A;  2LDU A;  2HPM A;  4KIS A;  4MIM A;  3BTI A;  2YPR A;  3OYN A;  5FRM A;  1RZ4 A;  1NK2 P;  3E3V A;  1BBY A;  1LJ9 A;  4KN4 X;  4NC7 A;  3LL7 A;  3RIR A;  3ASN H;  3WTY C;  2M8E A;  4O6J A;  2JUG A;  1Z3X A;  2OA4 A;  2UWM A;  2NVY J;  4ON0 A;  4HV5 A;  2VXZ A;  2OQR A;  1ACI A;  1HLV A;  4XOR A;  3FHN A;  1Z21 A;  1H8A C;  2QCO A;  5GTI C;  1PUF A;  5FLV A;  1IXS B;  3EYI A;  2KRH A;  3F8N A;  3BJO A;  2OCC H;  3BT9 A;  3HC7 A;  5CYV A;  3J80 K;  1FP2 A;  1TWC J;  4PJN A;  1TL8 A;  1VQ9 I;  4HLX A;  1BI1 A;  2ZSH B;  4B3X A;  4GFB A;  4HZF A;  5ICF A;  1SD4 A;  2Y9Z A;  3HSF A;  3HM5 A;  2CWE A;  1T56 A;  3A2K A;  2DYR H;  2FX0 A;  2P6S A;  3Q0V A;  3E5X A;  4MNU A;  4DOZ A;  3GZ6 A;  3HOV J;  2EZH A;  2X6Y A;  2E19 A;  3HJE A;  1TLH B;  2Z33 A;  4LLN A;  1SD7 A;  4F7Z A;  1SMY F;  2DMN A;  2L7M P;  3NAU A;  4IZZ A;  3CCU I;  3CCJ I;  1ETO A;  2H27 A;  1S29 A;  4YIR X;  4KIF A;  2VKV A;  1I3Q J;  3WG7 H;  1Z6R A;  1FLI A;  4UY8 I;  4OAY A;  4CCO A;  2K3P A;  3O8G A;  4LIV A;  4EJO A;  1WZ2 A;  5L3E A;  2LRD A;  3IC7 A;  3I71 A;  3E5U A;  3DFG A;  3GFJ A;  5J1Y A;  5IYC J;  3OYA A;  3HHG A;  4XMY A;  4FCY A;  3I53 A;  2LG4 A;  1FBS A;  1MND A;  4I98 B;  2H8R A;  2YU9 J;  5FJ8 J;  1FIP A;  3E6D A;  1D0X A;  2LY1 A;  1YE9 A;  2AXL A;  4MEX F;  3PO2 J;  5LD2 C;  1Z7L A;  2A69 F;  3CO7 C;  2A6H F;  2MA3 A;  4FET A;  3G1L A;  5TRD A;  5TGT A;  3S1M J;  4M6Y A;  1T95 A;  2KQR A;  5EGO B;  3KFW X;  5IP6 A;  2CW0 F;  4HNV A;  2CSO A;  5DD8 A;  4EAT A;  4GRI A;  3L9F A;  3MAJ A;  3C1D A;  1MMS A;  4AWX B;  2ESH A;  1UHW A;  2L2O A;  2M45 A;  4ENM A;  3GYH X;  5GAG J;  1T38 A;  2ESN A;  2HR3 A;  1ZG1 A;  3M9A A;  4FE4 A;  2DFE A;  4HAM A;  4I7H A;  4S0H B;  2ZXI A;  1MMD A;  3GZN B;  3CP8 A;  2VKD A;  3HHH A;  2K7L A;  1FIA A;  5B66 C;  3Q0W A;  1DDN A;  3ZQH A;  1U0J A;  1BW6 A;  2E36 A;  1ETW A;  1HBX G;  3RPU A;  1MKM A;  3FM5 A;  4LK1 F;  5L3D A;  3K6G A;  1J59 A;  4BQA A;  3OYK A;  2DOF A;  3JRG A;  1BN5 A;  2E35 A;  4A6D A;  2WC2 A;  1VQ7 I;  3GTK J;  1YI2 I;  2XB5 A;  1U3E M;  4BJ5 C;  2F48 A;  2A61 A;  2G9W A;  2MYS A;  4ASN A;  3DBH B;  3R0A A;  2F4O B;  2VXD A;  3MFK A;  3BCB A;  2MD0 A;  2VT3 A;  1MH3 A;  4V2F A;  3O2P E;  2MC4 A;  2LP0 A;  2OTJ I;  2CV0 A;  2EK5 A;  5C3E J;  3ZQC A;  3F9K A;  5J3L A;  3JAM Z;  1R5G A;  2VN2 A;  1VQL I;  2DCE A;  3H92 A;  4A3D J;  3S93 A;  4AC0 A;  3J7A Y;  2R7R A;  4XLH A;  4EGY A;  5F08 A;  5AON A;  3FMR A;  4PSX A;  3CUQ A;  1XD7 A;  2OD5 A;  2LF7 A;  3E1S A;  2STT A;  1OR7 C;  2RC4 A;  4HPQ A;  3S1Q J;  2FMY A;  5FRN A;  4JX4 A;  1LEA A;  1N75 A;  4UVC A;  3VEP A;  4U87 A;  4IOA F;  1MD0 A;  2LSO A;  3RCO A;  4P1W A;  3BTC A;  3A03 A;  2DLL A;  3OOP A;  5F0F A;  2L7K A;  4OIN F;  4XRS G;  3BWG A;  4RB1 A;  3GFI A;  1FTZ A;  2EIL H;  4F92 B;  4OMZ A;  3ZOB A;  3OSF A;  2HVS A;  1G4D A;  1SVO A;  5F0H A;  3I4N J;  3BY6 A;  1ETY A;  5IP7 J;  3ONQ A;  3BPX A;  4KDP A;  3IUO A;  1P9Q C;  1LE8 B;  4BEH A;  3WGI A;  2R7S A;  3CZ6 A;  3LA3 A;  3CTA A;  3C7J A;  2DBB A;  5HDG A;  5ILS A;  4BEH B;  2R3S A;  2CYY A;  3FWE A;  2Y9Y A;  4LG0 B;  2D2W A;  2V7F A;  4A3L J;  5ILU A;  4N0B A;  2R5Z A;  1R1T A;  2HI3 A;  2H8W A;  4CXF A;  3DTK A;  3LFK A;  5D5U B;  5D4R A;  3HOS A;  2L9R A;  1WHU A;  1MJA A;  1XGS A;  4BKX A;  5FLX Z;  4E7H A;  2VBX A;  2PN6 A;  4E7I A;  1FBQ A;  2LOO A;  2CFX A;  4N9H A;  3TMO A;  1ZRD A;  1ORK A;  3CLQ A;  3FMS A;  4MO7 A;  3FXL A;  1KQ9 A;  5M5W J;  3HSE A;  4LOC A;  4RS8 A;  2DK5 A;  5TIS C;  3TO9 A;  5CKT A;  2K9S A;  3ZQL A;  4HX8 A;  1MBG A;  1HDP A;  1WJC A;  2DMP A;  4C3H J;  4A6E A;  5K7F A;  5JLW A;  3OYD A;  4GO1 A;  4BH9 A;  4GGG A;  2HKO A;  2VJ4 A;  3GTM J;  1HW5 A;  2M7A A;  2ZXH A;  2VLA A;  1V5G A;  1IN4 A;  2EBI A;  3CCS I;  1U8B A;  1IN8 A;  3U1K A;  2DN0 A;  4BDZ A;  2M2E A;  2XV4 S;  5D8L B;  2D5V A;  1ON1 A;  2HOA A;  1JKR C;  4PFP A;  1VQP I;  4OOI A;  4C3I J;  4IRI A;  2BXY A;  3ESW B;  5HDK A;  3H5N A;  4A3E J;  3E6B A;  2R7Z J;  3VOE A;  1ZLJ A;  2M1B A;  2ME0 A;  1GLN A;  1ENH A;  3K1M A;  4XLP F;  1E0E A;  3ZGK A;  3I4P A;  4OIP F;  1D0Z A;  1JTX A;  1A5J A;  3MWM A;  4JYK A;  4BQQ A;  2LFB A;  3HKZ N;  1F1Z A;  4CHU A;  1V54 H;  2GIZ A;  4AD9 A;  2IA0 A;  3SJM A;  2CJJ A;  1D8K A;  3LWF A;  1UHS A;  3PNT A;  3BJA A;  3CES A;  2R4G A;  1IF1 A;  1OCO H;  4A0X A;  4RLF A;  3PO3 J;  3QPS A;  2HPI A;  3WTW C;  1J7K A;  2JT1 A;  2LYC A;  1TWH J;  3BR0 A;  2VJI A;  2E5N A;  1SFE A;  2DYS H;  1R4N B;  2VIX A;  2BEO A;  2KJC A;  2L9S A;  2IS2 A;  3QAH A;  3HPG A;  1IUF A;  2EIN H;  3F0C A;  4IKF A;  3HRM A;  4LGW A;  1UEL B;  4B47 A;  1BR1 A;  4RAY A;  3FXK A;  4UUS A;  4L5J A;  4DBR A;  3OYC A;  1XPX A;  3E97 A;  2LF8 A;  1E3P A;  3HOW J;  3HPH A;  3ABM H;  1CF7 A;  1KU2 A;  2Q2E A;  3KP3 A;  3RKY A;  1TP4 A;  2XF7 A;  1OCT C;  2QQB A;  2Y69 H;  4YFX F;  3CMA I;  3DKW A;  2EV0 A;  3L2V A;  5J40 A;  3SXY A;  1OQY A;  4EM0 B;  1CF7 B;  3SFI A;  1N78 A;  2V1N A;  1LPQ A;  5HLI A;  4A3G J;  1LQ1 A;  2QEN A;  2XAF A;  4PGH A;  4BE2 A;  3HTS B;  4RGS A;  3C3W A;  5E3M A;  2KRF A;  2QYO A;  1ZG3 A;  4N4N B;  4CYC B;  4M72 A;  4BJ6 C;  2HGC A;  5A2Q K;  2X6X A;  1XCV A;  5ILV A;  2HDW A;  3L7W A;  3HL2 A;  3F8M A;  1E17 A;  2KIQ A;  2ZNY A;  5M3M J;  3Q0U A;  4NB5 A;  5DV5 A;  3SDG A;  4KT5 C;  1Z1D A;  1S3J A;  3D5S C;  4MEY F;  4E7J A;  1JJ8 C;  2M4G A;  4BYY A;  1MNM C;  2VPL A;  2R7T A;  4Y3O A;  3GF2 A;  1K78 A;  1MSF C;  4G7H F;  4I09 A;  4ABZ A;  4KYW A;  4D1Q A;  2QQ9 A;  4XN3 A;  1JUS A;  1SFX A;  2DT5 A;  2XRL A;  1ZG5 A;  3BG3 A;  3CMM A;  3LQQ A;  1FPQ A;  2ECB A;  3OYI A;  4PZJ A;  4LLG F;  3DCF A;  1UG2 A;  1B4A A;  1HCR A;  4OU0 A;  1W0U A;  4CUG A;  1VFC A;  1AWC A;  4XKV A;  4JX6 A;  1EA3 A;  3ZQQ A;  1FOW A;  3M3Y J;  2DA7 A;  2E34 A;  4DYC A;  5HS8 A;  5GAH J;  4KMF A;  5E1Z B;  1WGX A;  1TWA J;  4CCM A;  2PJP A;  4FX4 A;  5BPD A;  1S9H A;  3RJP A;  2DQL A;  3DPL C;  3RDI A;  3WU1 B;  1QVU A;  5J1R A;  3H3V K;  1T33 A;  1W5S A;  4KMU X;  2VC1 A;  1WRJ A;  2VBW A;  1DP3 A;  1FYK A;  5ED4 A;  4ZZL A;  1N77 A;  2OQG A;  4W1U A;  2B7E A;  2RAE A;  4F52 A;  1SMT A;  1BI3 A;  2B9S A;  2AQF A;  2DTR A;  3EDP A;  4M3B A;  5HLH A;  2ZKZ A;  3V4G A;  1H9T A;  3SYT A;  4XLA A;  1USS A;  3G1M A;  5EYR A;  2FBK A;  3TED A;  1F36 A;  2XPW A;  4QTR A;  1T0F A;  5F1J A;  2KP6 A;  2ELH A;  1LB2 A;  3Q3S A;  4MGR A;  1YO5 C;  2CUJ A;  1APL C;  4IHS A;  3J81 K;  1BI2 A;  4YRV A;  1GXQ A;  3KP4 A;  5H6R A;  3W6K B;  3WG9 A;  4A93 J;  1TT5 B;  2VUM J;  4ETS A;  4NHJ A;  2R7U A;  1G59 A;  2X9D A;  3G2B A;  2A68 F;  1JUM A;  1EH7 A;  3ABL H;  2CQK A;  3NRV A;  4AIJ A;  3W2A A;  1Z05 A;  2ID6 A;  1LDJ A;  3ABU A;  5H20 A;  5A2Q Z;  2QVO A;  2XAJ A;  2PG4 A;  3P5J A;  1P92 A;  5FD6 A;  1YW9 A;  1R58 A;  1JKO C;  1XTA A;  5BS6 A;  4EGZ A;  3ZMZ A;  3HSR A;  2P5K A;  3NEU A;  3U21 A;  5D8K B;  1QZY A;  1MBH A;  5D4S A;  4EJU A;  2CQN A;  4A3C J;  4I2O A;  4ZYE A;  4BQN A;  3N4M A;  2P5V A;  1ZR2 A;  3TDZ C;  2GZW A;  2GOM A;  3QQA A;  4XID A;  3I56 I;  1GUU A;  2NYX A;  2QF7 A;  1MIJ A;  1R4M B;  4HNT A;  5M5Y J;  1W0T A;  2V79 A;  3ASO H;  5LGT A;  1MJ9 A;  3LSM A;  1HOM A;  4Y33 A;  3BQZ A;  4A0Z A;  1VF9 A;  2XSD C;  1LFP A;  3M1C A;  3DKY A;  5ICE A;  3CMY A;  2HQN A;  2M0M A;  1K61 A;  3A01 A;  2WBM A;  4DJA A;  3QU3 A;  1XSD A;  2HNH A;  1RPW A;  2E2J J;  4DZP A;  3A01 B;  2ZO4 A;  3PJR A;  2F5D A;  1HF0 A;  2RGV A;  2A6T A; 
#chains in the Genus database with same CATH homology
 3QOP A;  3WTZ A;  1RI7 A;  3FMQ A;  4HDU A;  2JTV A;  2P4W A;  3F23 A;  1ZGA A;  3GFL A;  4P5O A;  2STW A;  3L00 A;  3R6S A;  4Q48 A;  1R7J A;  2F5F A;  3ZMT A;  3F6O A;  2FU4 A;  4UNO A;  2WTE A;  1BJA A;  2FBI A;  3KCC A;  2F5E A;  3O6B B;  3VOD A;  3IRQ A;  4KIB A;  2NAZ A;  2E7X A;  3EUH A;  1S8N A;  4M6X A;  1TNS A;  1ZAO A;  2PI0 A;  3KZZ A;  4UV9 A;  4QWQ A;  1P4X A;  1WWX A;  2JSC A;  2AS5 F;  2VE9 A;  2IT0 A;  2F2E A;  1UCR A;  5KVR A;  1EH8 A;  2H6B A;  4ZYD A;  4L0Z B;  4E70 A;  1D8J A;  3PQJ A;  2EWN A;  4HX7 A;  5AIP A;  2GXG A;  2C6Y A;  5DUI A;  5E8G A;  3TKY A;  4KA4 A;  3CUQ C;  1BIA A;  2QBY A;  1UHM A;  4HV6 A;  3R61 A;  2QBY B;  2NRA C;  4RB3 C;  3T1B A;  2W24 A;  3ZP5 A;  1K7A A;  2PMU A;  3WTV C;  4L9J A;  1WKM A;  3WTT C;  4HLY A;  4ZZD A;  2XKO A;  5LHI A;  5FD5 A;  4R1H A;  1O57 A;  2QZ8 A;  3WGH A;  2O61 A;  1W7P A;  4LMY A;  2YR2 A;  2YX7 A;  2YU3 A;  3E6C C;  1KYW A;  2ZBK A;  1KA8 A;  4JBA A;  3ELK A;  5KK1 A;  4AVP A;  4H0E A;  1I1G A;  1P4W A;  5DYM A;  1KQ0 A;  1YFH A;  3U9G A;  2FE3 A;  3I64 A;  4Y15 A;  3FXU A;  1U78 A;  1IRF A;  1I1S A;  4WF2 A;  1HKQ A;  2L02 A;  2CG4 A;  1ZLK A;  1ZRF A;  1UST A;  4WCG A;  5CVU A;  2DFI A;  4LD5 A;  5L3F A;  2HYG D;  3ZMV A;  3COA C;  1KGS A;  4HBL A;  5D6E A;  2ZCW A;  2CGP A;  4FT8 A;  4LLL A;  3WGG A;  3V8L A;  3VB2 A;  4ENK A;  2K27 A;  4RB0 A;  5CLS A;  4BHC A;  1Z9C A;  1DUX C;  2V1X A;  1XGO A;  1I27 A;  4HYE A;  5CVI A;  4I0A A;  2DQR A;  2EFN A;  1I5Z A;  3V8J A;  1L3L A;  4U7B A;  3ISP A;  5DDG A;  4WXC A;  2P8T A;  3T5X A;  1IN5 A;  1XDS A;  1R22 A;  2ETH A;  3K1P A;  1B9N A;  4UXN A;  1R1U A;  4EV0 A;  1PP8 F;  4G94 A;  1HST A;  2V1D A;  3DQV C;  1FOK A;  2VE8 A;  2G7U A;  4WXH A;  3ZN1 A;  3HIF A;  4I0B A;  2L4A A;  4PDK A;  2MH9 A;  4U0Y A;  4B8X A;  2XIG A;  3J80 Z;  2ZME A;  1HXD A;  2Q8K A;  4KUM A;  3C18 A;  3RTR A;  3Q9S A;  4U0V A;  3ML6 A;  2Y0M A;  1EV7 A;  4IHT A;  1OKR A;  4LB5 A;  4GXO A;  2W84 A;  5LRS A;  1B59 A;  2BE5 F;  4O5V A;  1OPC A;  1W4M A;  4LJZ F;  2XHK A;  3FZV A;  1BIB A;  1G3T A;  2PQ8 A;  1QO0 D;  3P9I A;  3R0J A;  4L9T A;  5ICC A;  2X0L A;  3CUQ B;  3RI4 A;  3ZMU A;  4G7Z F;  1DP7 P;  1UB9 A;  2Y75 A;  5E20 A;  2EB7 A;  3E6M A;  5FFZ A;  2EA4 A;  5DUK A;  4EJT A;  3D0S A;  4AIK A;  1OYW A;  2K4B A;  4OMY A;  2X4H A;  1TQP A;  4NQW A;  4P9F A;  3V7S A;  3SQN A;  3P9K A;  2P5L C;  4MHG A;  3TDU C;  1HQC A;  2FNP A;  5JFR A;  2IA1 A;  1ZHF A;  3ZPL A;  3B73 A;  2ZXJ A;  1MGT A;  4UVA A;  2BGC A;  3KP2 A;  1IUY A;  1FYM A;  4WXD A;  1XMK A;  2Y48 A;  3EQL F;  3K0L A;  5IT9 K;  2O8X A;  2OU2 A;  1DPU A;  2IJL A;  1J9I A;  1F5T A;  4XSZ F;  3DXJ F;  4L18 B;  2HQR A;  2ISZ A;  3KP5 A;  3I59 A;  5J8C A;  4A12 A;  3RPQ A;  1ZAR A;  3I59 B;  4B09 A;  2DK8 A;  1KU9 A;  2NS0 A;  1YW7 A;  5IT3 A;  2HS5 A;  1SD6 A;  1O7F A;  4YIF A;  2XAH A;  2FOK A;  2E1C A;  5HVQ C;  4MTE A;  2HFH A;  3WOD F;  4IPA A;  3SFZ A;  5HS7 A;  2K4J A;  5LBQ A;  2J5O A;  2MLG A;  3ZMD A;  3Q9V A;  2FA5 A;  3V7C A;  1ZN2 A;  4ESJ A;  5EEH A;  1QNT A;  4Q5S F;  3ABT A;  1T39 A;  1ON2 A;  4Q4Z F;  1PUE E;  1ZRC A;  3F8F A;  3F72 A;  5FGM A;  4RAZ A;  3LA7 A;  1BC8 C;  5HDN A;  5CJ9 A;  2EJR A;  4M9X A;  1YQA A;  2V1U A;  1IN7 A;  1QGP A;  4BAY A;  4R8H A;  2RQP A;  2FNA A;  2EV6 A;  2GIV A;  1BOA A;  2ZFW A;  3KE2 A;  2EFP A;  1ZH5 A;  4TV7 A;  5L3C A;  4YG2 F;  2WWY A;  3BOQ A;  1A04 A;  3O3K A;  3GX4 X;  2PFB A;  1O7L A;  2RN7 A;  2RNJ A;  1G3S A;  1FC3 A;  5LGU A;  4N9I A;  3DPT A;  2R7D A;  2IP2 A;  4I02 A;  5D5W B;  1YW8 A;  4IJA A;  4HX4 A;  3OV8 A;  1K78 B;  3TGN A;  2E7W A;  2D45 A;  3T8T A;  3GUD A;  4RGU A;  1BM9 A;  1C0W A;  2L4M A;  4XLN F;  3KET A;  3SHF A;  3SZT A;  3GO5 A;  3WE2 A;  1TQM A;  3V8K A;  3HRT A;  4LB6 B;  3LA2 A;  4G6D A;  1FT9 A;  1YTY A;  5AIQ A;  1YS6 A;  1IRG A;  2YX4 A;  2A6E F;  1WQ2 A;  4QLC U;  1V3F A;  1GVJ A;  3QPT A;  4A2U A;  4L0Y B;  1U5T A;  5ERI A;  2L3D A;  1ONV A;  3HRU A;  4UHT A;  1YLF A;  1TW2 A;  5HOO A;  4EM1 A;  2XKP A;  1HW1 A;  2F5C A;  4HOB A;  1J2X A;  2FF4 A;  2QWW A;  4EJV A;  4CZZ A;  2VBY A;  1OMI A;  1FX7 A;  2O0Y A;  1TQI A;  2DAO A;  3HOT A;  3MZH A;  1U6G A;  5DCM A;  3L2C A;  1S6L A;  2HKX A;  4BHP A;  5DCM B;  4M9S A;  1LVA A;  4YFN F;  4ENN A;  3MQ0 A;  2ZJ2 A;  1HKT A;  1KU3 A;  3HUG A;  3M1E A;  3IWZ A;  1D5V A;  6PAX A;  2BBY A;  1ZRE A;  4Z2Y A;  1P6R A;  5CVV A;  4RGX A;  2ZNZ A;  2H09 A;  3FXQ A;  2A07 F;  4P55 A;  1TTY A;  4UV8 A;  1BI0 A;  3ECO A;  1LNW A;  5HS9 A;  1U2W A;  3H3U A;  2XVC A;  4PCQ A;  2HDC A;  1B6A A;  1YIO A;  2PLY A;  1W7P D;  4XRF A;  3ROU A;  3N97 A;  3EYY A;  5FFX A;  2FRH A;  2HTS A;  1NHA A;  1I6X A;  3I0T A;  1G3W A;  4ESB A;  3I54 A;  4HQM A;  2DU9 A;  3QRF F;  3J81 Z;  4M71 A;  4CIC A;  4G8X A;  3U2R A;  2KKO A;  5JHU A;  4EQQ A;  2RDP A;  2IRF G;  4KN7 X;  2TDX A;  4G9Y A;  1SFU A;  3M8F A;  4KIC A;  1DPR A;  4I01 A;  1P4A A;  2D1V A;  3B02 A;  2VOD A;  2XUB A;  5L3B A;  3ULQ B;  1Z91 A;  1RUN A;  1STZ A;  2Z99 A;  2G7H A;  1O3T A;  1ZGJ A;  5E1W A;  4D0P A;  4IXA A;  5HLG A;  1Z6T A;  1LDD A;  3I58 A;  4GCV A;  3J7A O;  4L9N A;  1MZB A;  2HTJ A;  2GWR A;  1FY7 A;  2JPC A;  1PDN C;  2MD5 A;  3K9T A;  1J0R A;  2M87 A;  4UVB A;  1W7P B;  3DEU A;  1QZZ A;  2XGX A;  3BDD A;  4HF2 A;  2HOE A;  2A5Y B;  3DF8 A;  1RIO H;  3TOA A;  3AAF A;  1IZ1 A;  2LKP A;  1F4K A;  1T6S A;  1KQ8 A;  2EV5 A;  3CDH A;  2OAZ A;  3K1N A;  5D6F A;  3IRR A;  1XB4 A;  1FWZ A;  3CO6 C;  4HQE A;  3CUO A;  5L3G A;  1YS7 A;  1X3U A;  1Y0U A;  2MBF A;  4ZYG A;  1T2K A;  4MQV A;  4IRH A;  1H0M A;  2XRN A;  1PP7 U;  1FP1 D;  3G73 A;  2O03 A;  2PEX A;  3K2Z A;  3LQR A;  4LK0 F;  4U7D A;  2XAS A;  2RV8 A;  2Z9O A;  2JZY A;  4WX9 A;  1G6N A;  3W6J B;  4XBF A;  1XGM A;  3E5Q A;  2QLZ A;  3BJ6 A;  1IN6 A;  3CJN A;  3R4K A;  1XN7 A;  4KIG A;  5E1X A;  5J6X A;  5TJJ A;  3JAM K;  3P9C A;  2PBI A;  1J75 A;  1FYL A;  3JTG A;  4BXU A;  2DI3 A;  2P6T A;  3T0Y A;  2HWV A;  4OIR F;  4CGZ A;  3WE3 A;  5K1Y A;  1P2F A;  1D3Y A;  5BOX A;  5JI6 A;  2DPD A;  3BZ6 A;  3IKT A;  2VT2 A;  4MQ9 F;  1WSU A;  2YSR A;  3IWF A;  1B9M A;  4CYD A;  1YG2 A;  2HEO A;  4MTD A;  3HTU A;  3F8B A;  5LHH A;  2XRO A;  2ZME B;  2KIM A;  2VBZ A;  4EM2 A;  1R00 A;  5LEJ A;  1JHH A;  3JSP A;  2K86 A;  5FLX K;  4G7O F;  5H6Q A;  5BPI A;  3RYR A;  4CDG A;  3MZY A;  1EH6 A;  1GXP A;  1JE8 A;  3F21 A;  1UFM A;  2OZU A;  1SAX A;  1T98 A;  3GVA A;  2WV0 A;  2VOP A;  1R23 A;  3K69 A;  2VOO A;  1RUO A;  3DV8 A;  1JGS A;  4CO8 A;  4HF1 A;  1FZP B;  2W25 A;  4S05 A;  4PGG A;  1HSJ A;  2VC0 A;  2O6G E;  3JW4 A;  4ZH4 F;  2FEZ A;  5ICG A;  4ZYH A;  1GHC A;  2QM3 A;  1U5T C;  4FX0 A;  3M8E A;  4Q47 A;  2A3S A;  3M7G A;  1OYY A;  1XGN A;  3RYP A;  1TW3 A;  3QPH A;  1VTN C;  1QPM A;  1IXC A;  5JR3 A;  1TBX A;  2M5W A;  2JPB A;  4RGR A;  2B0L A;  4U88 A;  4LG0 A;  1JXS A;  1Q1H A;  1O3Q A;  2DW4 A;  3MCZ A;  4M9Z A;  1XDU A;  4L5I A;  2Z5U A;  5F64 A;  2NNY A;  3PFI A;  3KEO A;  3TO6 A;  2GA1 A;  1XMA A;  2L54 A;  2IW5 A;  4A5M A;  3MEX A;  2HZT A;  3GEZ A;  1XSV A;  2EFO A;  5F1R A;  1F9N A;  4L9V A;  2UZK A;  5LGN A;  1ODD A;  1BC7 C;  2RVC A;  3F3X A;  2FBH A;  5EEG A;  4FHT A;  1HKS A;  5F6F A;  5E17 F;  3TO7 A;  3GFM A;  1WI9 A;  5CVR A;  2BV6 A;  3H3Z A;  4KNY A;  4BNC A;  3BP8 A;  5DCF A;  3FXR A;  2EA2 A;  1R36 A;  4G6Q A;  4ENJ A;  2ADU A;  1R1V A;  4EMS A;  2FQ3 A;  4U0W A;  1KYZ A;  2W85 A;  4WWC A;  1YYV A;  2KIF A;  1RNL A;  1K6O A;  1H9G A;  2PMH A;  2MH2 A;  2XAG A;  3CLO A;  4JK1 X;  1LDK B;  3ECH A;  4OIQ F;  1FSH A;  1FBU A;  5LLQ A;  4IRG A;  5IT9 Z;  2KJB A;  4HDV A;  1S7O A;  4ESF A;  2IVM A;  3F6V A;  3VFZ A;  1E2X A;  4AIH A;  4P9U A;  1L0O C;  2HYF A;  3DP7 A;  5BMZ A;  5LEK A;  2COM A;  2DPU A;  4UUV A;  1REP C;  3KEQ A;  2EFW A;  3TOB A;  2V9V A;  1TNT A;  4Y13 A;  3SZP A;  3F8C A;  2EFQ A;  4Y17 A;  2GA2 A;  3LAJ A;  4A5N A;  4M73 A;  3PQK A;  1LEB A;  3G3Z A;  2H6C A;  4HF0 A;  1S7A A;  4LFU A;  4GYI A;  4EJW A;  3GXO A;  3S2W A;  2IPQ X;  1OYI A;  5D5X B;  1W5T A;  2ISY A;  3KLO A;  4JQF A;  3ZMS A;  4DNC A;  2L01 A;  5K5R A;  1OR7 A;  1ZYR F;  4XSX F;  3WTX C;  5DD4 A;  5FB2 A;  5LHG A;  3T8R A;  3NQO A;  4R79 A;  2DO7 A;  2XAQ A;  1U5T B;  1MJB A;  5K5Q A;  2FSW A;  3BRO A;  2RKH A;  3RKW A;  3L09 A;  3ERE D;  4YII A;  3KZY A;  5E18 F;  1U8R A;  1O3R A;  3IKV A;  1CGP A;  1QQI A;  2ACJ A;  3GZ5 A;  2M30 A;  4IVN A;  4P96 A;  2K02 A;  4K2E A;  3KP6 A;  3F22 A;  2OZ6 A;  2UXX A;  1AOY A;  1FSE A;  1FNN A;  3RKX A;  4HA8 A;  3WTU C;  3GWZ A;  2W57 A;  3ZQ7 A;  2D1H A;  2KIU A;  3BPV A;  4BHB A;  1KU7 A;  2Z3Y A;  2CO5 A;  2QUF A;  5LRR A;  4M74 A;  3FM3 A;  4OIO F;  2IA2 A;  5JVT A;  1K79 A;  1QBJ A;  1G3Y A;  3D5L A;  3HRS A;  5FO5 A;  1SD5 A;  2JRT A;  2O3F A;  2V6C A;  5D5V B;  4IF4 A;  3IHU A;  5BQT A;  3QP6 A;  2UXN A;  5CVJ A;  2P7V B;  3P7N A;  4O3M A;  1B1B A;  3V7R A;  3FHZ A;  2OBP A;  1IAW A;  4HW0 A;  3QU6 A;  3HYI A;  2FXA A;  3QP5 A;  5DEQ A;  2VON A;  3R60 A;  1XCB A;  1R5H A;  2E1N A;  3Q5F A;  2Q0O A;  2GXB A;  3KLN A;  2J5P A;  2QQA A;  4A0Y A;  5K5O A;  3GLX A;  4RB2 C;  3JTH A;  3U1D A;  4EVI A;  3ZN0 A;  3REO A;  1V4R A;  2H94 A;  4WK8 F;  2P7C B;  3FF5 A;  1MDM A;  4GYG A;  1IXR C;  4S04 A;  2FML A;  3JSO A;  1HW2 A;  1MDM B;  1Z7U A;  3GW2 A;  1IW7 F;  2LNB A;  3LST A;  3FX3 A;  3KP7 A;  1J5Y A;  1XSX A;  3IL2 A;  3TQN A;  2NNN A;  1JHF A;  3WTS C;  5E8I A;  1O3S A;  2MC3 A;  2MLK A;  2R7F A;  5J8F A;  2GAU A;  4DQ2 A;  3WU0 A;  2GQQ A;  1ULY A;  3EET A;  4KFC A;  4YFK F;  3LAP A;  3I5U A;  2BYV E;  2LDU A;  2YPR A;  1RZ4 A;  3E3V A;  1BBY A;  1LJ9 A;  4KN4 X;  3RIR A;  3WTY C;  2M8E A;  4O6J A;  2OA4 A;  2UWM A;  4ON0 A;  4HV5 A;  2VXZ A;  2OQR A;  1IXS B;  3EYI A;  3F8N A;  3BJO A;  3J80 K;  5CYV A;  1FP2 A;  4HLX A;  1BI1 A;  4HZF A;  5ICF A;  1SD4 A;  3HSF A;  2CWE A;  2P6S A;  3E5X A;  4MNU A;  3GZ6 A;  1TLH B;  2Z33 A;  4LLN A;  1SD7 A;  4F7Z A;  1SMY F;  2H27 A;  1S29 A;  4KIF A;  1Z6R A;  1FLI A;  4EJO A;  5L3E A;  3IC7 A;  3I71 A;  3E5U A;  3DFG A;  3GFJ A;  3HHG A;  3I53 A;  1FBS A;  4I98 B;  3E6D A;  2AXL A;  4MEX F;  2A69 F;  3CO7 C;  2A6H F;  2MA3 A;  5TRD A;  4M6Y A;  3KFW X;  2CW0 F;  2CSO A;  5DD8 A;  3L9F A;  3MAJ A;  3C1D A;  4AWX B;  2ESH A;  1UHW A;  2M45 A;  4ENM A;  3GYH X;  1T38 A;  2ESN A;  2HR3 A;  1ZG1 A;  3M9A A;  4HAM A;  4I7H A;  3HHH A;  2K7L A;  1DDN A;  1HBX G;  3RPU A;  1MKM A;  3FM5 A;  4LK1 F;  5L3D A;  1J59 A;  4BQA A;  1BN5 A;  4A6D A;  2WC2 A;  1U3E M;  2A61 A;  2G9W A;  4ASN A;  3R0A A;  3MFK A;  2VT3 A;  3O2P E;  2EK5 A;  3JAM Z;  1R5G A;  2VN2 A;  3H92 A;  4EGY A;  5AON A;  3FMR A;  3CUQ A;  1XD7 A;  2OD5 A;  2LF7 A;  2STT A;  2RC4 A;  2FMY A;  1LEA A;  4UVC A;  3VEP A;  1MD0 A;  2LSO A;  2DLL A;  3OOP A;  4OIN F;  3BWG A;  4RB1 A;  3GFI A;  4OMZ A;  1G4D A;  3BY6 A;  3BPX A;  4KDP A;  3WGI A;  3LA3 A;  3CTA A;  3C7J A;  2DBB A;  5HDG A;  5ILS A;  2R3S A;  2CYY A;  3FWE A;  4LG0 B;  2D2W A;  5ILU A;  4N0B A;  1R1T A;  4CXF A;  3LFK A;  5D5U B;  5D4R A;  3HOS A;  1XGS A;  1MJA A;  5FLX Z;  2VBX A;  2PN6 A;  1FBQ A;  2CFX A;  4N9H A;  1ZRD A;  3FMS A;  1KQ9 A;  3HSE A;  4RS8 A;  2DK5 A;  3TO9 A;  4HX8 A;  4A6E A;  4GO1 A;  4BH9 A;  4GGG A;  2HKO A;  1HW5 A;  1IN4 A;  1IN8 A;  2XV4 S;  5D8L B;  1ON1 A;  4OOI A;  4IRI A;  5HDK A;  3E6B A;  3VOE A;  1ZLJ A;  2M1B A;  3K1M A;  4XLP F;  4OIP F;  3I4P A;  3MWM A;  1F1Z A;  4CHU A;  4AD9 A;  2IA0 A;  1D8K A;  3LWF A;  3BJA A;  1IF1 A;  4A0X A;  3WTW C;  1J7K A;  2JT1 A;  1SFE A;  2BEO A;  2KJC A;  3QAH A;  3HRM A;  4LGW A;  4RAY A;  4L5J A;  3E97 A;  2LF8 A;  1CF7 A;  1KU2 A;  2Q2E A;  3KP3 A;  3RKY A;  2QQB A;  4YFX F;  3DKW A;  2EV0 A;  3SXY A;  4EM0 B;  1CF7 B;  5HLI A;  1LQ1 A;  2QEN A;  2XAF A;  4PGH A;  3HTS B;  4RGS A;  3C3W A;  2KRF A;  2QYO A;  1ZG3 A;  4M72 A;  2HGC A;  5A2Q K;  1XCV A;  5ILV A;  3L7W A;  3F8M A;  1E17 A;  2ZNY A;  4NB5 A;  5DV5 A;  4KT5 C;  1Z1D A;  1S3J A;  4MEY F;  4BYY A;  3GF2 A;  1K78 A;  4G7H F;  4I09 A;  4KYW A;  2QQ9 A;  1SFX A;  2DT5 A;  1ZG5 A;  3LQQ A;  1FPQ A;  4PZJ A;  4LLG F;  1B4A A;  4OU0 A;  1AWC A;  5HS8 A;  4KMF A;  5E1Z B;  2PJP A;  4FX4 A;  5BPD A;  3RJP A;  2DQL A;  3DPL C;  3RDI A;  3WU1 B;  1W5S A;  4KMU X;  2VC1 A;  1WRJ A;  2VBW A;  1FYK A;  5ED4 A;  4ZZL A;  2OQG A;  1SMT A;  1BI3 A;  2DTR A;  3EDP A;  5HLH A;  2ZKZ A;  3V4G A;  1H9T A;  1USS A;  2FBK A;  1T0F A;  2ELH A;  1LB2 A;  4MGR A;  1YO5 C;  4IHS A;  3J81 K;  1BI2 A;  1GXQ A;  3KP4 A;  5H6R A;  3W6K B;  3WG9 A;  4ETS A;  4NHJ A;  2A68 F;  1EH7 A;  4AIJ A;  2CQK A;  3NRV A;  1Z05 A;  3ABU A;  1LDJ A;  5H20 A;  5A2Q Z;  2QVO A;  2XAJ A;  2PG4 A;  1P92 A;  5FD6 A;  1YW9 A;  1R58 A;  5BS6 A;  4EGZ A;  3ZMZ A;  3HSR A;  2P5K A;  3NEU A;  5D8K B;  1QZY A;  5D4S A;  4EJU A;  4I2O A;  4ZYE A;  3N4M A;  2P5V A;  3TDZ C;  2GZW A;  2NYX A;  2V79 A;  5LGT A;  1MJ9 A;  4A0Z A;  5ICE A;  2HQN A;  3QU3 A;  1XSD A;  2ZO4 A;  2F5D A;  2RGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...