3BJAA

Crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
GMNNRELYGNIRDVYHLLQKNLDKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKKHLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative MarR-like transcription regulator (NP_978771.1) from Bacillus cereus ATCC 10987 at 2.38 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family, putative
total genus 41
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bjaA00
2FBHA 3KE2A 1I1GA 3BJOA 4L9VA 2EWNA 4ZH4F 1WSUA 4B8XA 2P5VA 3I59B 4MTDA 3HHGA 3KP7A 3CUQA 5FLXZ 1DP7P 2RGVA 2ESHA 5DYMA 3LQQA 1FSEA 4P96A 4OU0A 4M71A 4XSZF 5CVUA 1KQ0A 2RDPA 3QAHA 3O3KA 3FM3A 2KIMA 1IXCA 5LEKA 1K78A 3MWMA 1B59A 4HX4A 2GQQA 2FMLA 2UZKA 4YFNF 2QQAA 3HHHA 1FY7A 4ESFA 1ZRCA 2UWMA 1IAWA 3V8KA 4DQ2A 3DFGA 1TQIA 3M8EA 2EJRA 1BIAA 3WTSC 3RKYA 1K6OA 1O3RA 3CLOA 4BHBA 5FFZA 5L3BA 4BYYA 1SFXA 5LGNA 4LJZF 2EFNA 3TO7A 3CTAA 5ED4A 1HW5A 3RPQA 6PAXA 3P9IA 3KLOA 4B09A 3F6VA 2A61A 5L3GA 4UVCA 2DQLA 3M8FA 3E5UA 1H9GA 4WXHA 4OMYA 4MEXF 4KN7X 2FOKA 2FXAA 3W6KB 3WTVC 1SFUA 4I2OA 4JK1X 1FNNA 4H0EA 4A5NA 1J7KA 4BAYA 4ZYGA 3J81K 4Q4ZF 1HQCA 5CVRA 2M8EA 1MDMA 3KFWX 2MBFA 1E17A 2HYFA 2XKOA 3G3ZA 5E20A 1U5TB 5D4SA 2CFXA 1SFEA 1QPMA 4EVIA 4U0YA 2J5OA 4FX0A 2GZWA 1ZRDA 3KLNA 2PMHA 1K79A 4HV5A 1Z7UA 1KQ9A 2HGCA 4MTEA 4LLNA 2IJLA 2VONA 1CF7B 3QU3A 2LKPA 1Z1DA 2STTA 1JXSA 2A69F 4HBLA 1R58A 3FZVA 4I01A 1R1TA 4I09A 2XRNA 5TJJA 5AONA 2NNNA 3I58A 1ZN2A 1U8RA 4OMZA 1XGMA 1QZYA 1ONVA 1XSXA 4UV9A 5JHUA 2L3DA 3HRUA 4HDUA 2NRAC 3FHZA 1TNSA 2G7HA 4UHTA 3F23A 4M6YA 4LGWA 5E8GA 5TRDA 4LG0B 1P2FA 1T0FA 2A5YB 3F3XA 2QUFA 3BZ6A 1OYYA 3ZPLA 3U2RA 2JRTA 2A3SA 4IJAA 4OIOF 3D0SA 1ODDA 2P6TA 1J9IA 2IVMA 2WTEA 2RQPA 3HOSA 2QZ8A 3REOA 1BM9A 3ISPA 1WRJA 3H3UA 2Z99A 1A04A 2GWRA 1JE8A 3WTUC 1Y0UA 5K5OA 5DD8A 5DD4A 2HS5A 4MQ9F 2BYVE 2OQGA 1W7PB 1QO0D 3COAC 1FYKA 3L7WA 2ETHA 4LK1F 3L09A 1HBXG 1IN4A 1PDNC 1QNTA 1STZA 1G3SA 2MC3A 3KEQA 3L00A 3JW4A 2YU3A 3OOPA 1KU2A 4BXUA 1D5VA 2K27A 4OIQF 2YR2A 4HQEA 4L5JA 1BBYA 4R8HA 1HXDA 1ZARA 4YFXF 1RUNA 2QQBA 1T98A 1TQPA 2ESNA 1OYWA 5J8CA 1LNWA 4U0WA 3SZTA 1ZGJA 3BJ6A 3CUOA 5BOXA 3CO6C 5JFRA 3JAMZ 2IA1A 4LK0F 4AD9A 1B6AA 2J5PA 3J7AO 4M9XA 5HLIA 1D8KA 5DCFA 2R3SA 2H6BA 1O3SA 3IC7A 1R1UA 3E6BA 2EV0A 3HTSB 3C3WA 3QPTA 2ZJ2A 4HOBA 3ZMDA 2ZNYA 3M9AA 3O2PE 2XASA 2RVCA 3KP5A 2L4MA 2ELHA 2LF7A 2VBYA 3GFLA 4RB1A 1B9MA 1YTYA 4NQWA 1IRGA 3VFZA 3WE2A 3V8LA 1ULYA 2E1NA 3WTWC 3J81Z 3E6CC 1IW7F 3ECHA 3K9TA 4UVBA 2MH2A 2YX4A 3WU1B 2VN2A 4KMFA 4HAMA 4QWQA 2IPQX 3R0AA 3KZZA 4P9FA 2E1CA 3FMSA 1IZ1A 2HTSA 2M45A 3DV8A 4PGHA 4L9NA 4Y17A 2CO5A 4AVPA 2PN6A 2CQKA 1S6LA 2IA0A 1BOAA 1P92A 4FX4A 1YQAA 1ZRFA 5FGMA 1TBXA 1MD0A 2HWVA 3WG9A 3G73A 2ZO4A 2HR3A 1S3JA 3FF5A 1DPRA 1QGPA 2WV0A 2VT3A 1HW2A 3MFKA 1ON2A 2JZYA 2NYXA 3Q9SA 4AIKA 2OA4A 2FNAA 3VODA 1JHFA 5J6XA 3M7GA 2IT0A 2VC1A 2WWYA 2QBYA 1F1ZA 1R5HA 2CYYA 3K1NA 1HKQA 1FT9A 4IHTA 2VOOA 1MJ9A 5HS7A 2VE8A 4RS8A 1ZG3A 2PBIA 2A6EF 2EV5A 4TV7A 3I64A 2VE9A 5LBQA 2V1UA 1IXSB 1YG2A 4U0VA 3F8MA 5ICGA 3FX3A 3KP4A 4RGRA 1IXRC 1SMYF 3IWZA 4LLGF 1B1BA 2MLKA 4M6XA 5DV5A 1F5TA 1R00A 3C18A 1RZ4A 3T8RA 4KYWA 4Y15A 3QP6A 2Z33A 3IKTA 5DCMA 2Y0MA 5E1ZB 3M1EA 2ZBKA 4GYIA 5L3DA 2EFOA 2JTVA 1LJ9A 4HV6A 4N9HA 1FYLA 1FSHA 2QENA 4YIIA 5F1RA 5DUIA 4CICA 3NRVA 1U5TC 2JPBA 3ROUA 5D5WB 4M74A 4MQVA 1G6NA 1UCRA 1HSJA 3RTRA 4EJVA 1D8JA 1JHHA 3HOTA 1AOYA 4KDPA 2OD5A 4MNUA 4KN4X 2DAOA 2ADUA 4R79A 1FBQA 3B02A 4CGZA 2W25A 2L02A 4KNYA 5LEJA 2PEXA 1AWCA 3MQ0A 2RV8A 2FSWA 3ZQ7A 1IUYA 4WWCA 3JAMK 1WQ2A 1QQIA 3RYPA 3WODF 4GCVA 5D5XB 4O3MA 2H27A 2ZXJA 4Y13A 3LA3A 1FOKA 2BV6A 2DT5A 2W24A 2R7FA 3E5QA 1BJAA 5E18F 3SFZA 4ZYDA 2DO7A 1TLHB 1I5ZA 5HVQC 3EYYA 4HYEA 1R22A 3L2CA 2VC0A 3CUQB 3ML6A 2K86A 2OZ6A 3DQVC 1USTA 1XD7A 1W7PA 4KMUX 3TDUC 3QRFF 3V4GA 2VBZA 1QZZA 4HX7A 3E5XA 2XAFA 3KEOA 3GLXA 1SD6A 1U6GA 2COMA 1XCVA 2MA3A 3IRRA 3ABUA 2YSRA 2FNPA 4XBFA 4WX9A 2AS5F 5IT3A 5ERIA 2FA5A 2HKOA 3ELKA 1XSVA 1Z05A 2KJCA 2KIUA 4GXOA 1BIBA 1J75A 3R61A 1R1VA 5CLSA 1YW9A 2DLLA 3TKYA 2V1DA 5HS9A 1U2WA 1EH7A 2ISZA 1ZLJA 5HOOA 1YFHA 1Z6TA 4UV8A 3BY6A 4HZFA 3TDZC 5F64A 2PJPA 2W85A 5DEQA 1CGPA 4G7HF 4G8XA 5A2QK 1I27A 3GVAA 4M9ZA 1SMTA 4LMYA 4E70A 1FPQA 3K2ZA 1Z9CA 2VT2A 4IRHA 2STWA 1FBUA 4ZZLA 4R1HA 4RGSA 2IP2A 2D1HA 3HTUA 5HDKA 2BBYA 3ZN0A 1WWXA 3ZMZA 2DTRA 3ZMUA 5A2QZ 1YYVA 1OKRA 3F22A 2Q8KA 1Q1HA 4HX8A 5BS6A 3GWZA 2HYGD 1T39A 1XSDA 3TOAA 4EGYA 2K7LA 4RB2C 2GAUA 1F4KA 2ZKZA 1TQMA 2KIFA 3OV8A 1ZG5A 2VBXA 1RIOH 5JVTA 3LQRA 4I7HA 2RKHA 2P6SA 5CVIA 2F2EA 3IHUA 2Y48A 4XLPF 4EGZA 1O3QA 4ENMA 3BDDA 3R60A 3BPXA 1RNLA 1XB4A 3BPVA 5D8LB 1XMKA 2HEOA 3SHFA 4ENKA 3JSOA 1ZHFA 3IKVA 4A0YA 3V7CA 3HSRA 3TO9A 1XN7A 3Q5FA 2LSOA 2P5LC 4BNCA 4WCGA 5ILUA 3E6DA 2L01A 1SD7A 4BQAA 4G9YA 2Q0OA 4ASNA 4ESBA 4S04A 4PDKA 3EYIA 2FBKA 2Z9OA 2GA2A 2TDXA 5BPDA 1X3UA 3GZ5A 1FP1D 3ZMSA 5DDGA 5BQTA 5K5RA 3QP5A 4UXNA 2ZMEA 1XGNA 3HSFA 2GA1A 1ZGAA 3NQOA 1R23A 3HUGA 3I5UA 4KIFA 2HQRA 5E17F 4HDVA 2KJBA 4PZJA 4HLYA 1DPUA 1W5SA 2UXNA 2ISYA 3HIFA 4GYGA 5FD6A 3DKWA 1C0WA 1REPC 1KA8A 5DCMB 3NEUA 2OU2A 4HF0A 4P55A 1K78B 3EUHA 5ILVA 3BOQA 2F5EA 2FRHA 4RGUA 1E2XA 2HZTA 3PQKA 4ENJA 5LGTA 1P6RA 3HRSA 4Q48A 1R5GA 3V7RA 1YW8A 1ZREA 3S2WA 5FD5A 3T8TA 4MHGA 3HRTA 1W5TA 4YG2F 1HW1A 1H0MA 1L3LA 3WTZA 5LGUA 1BI3A 2M5WA 2O61A 1D3YA 1NHAA 3FXUA 1R36A 4KUMA 3I0TA 3MZHA 3L9FA 4N0BA 1GXQA 1SD4A 4EJUA 3N4MA 2XHKA 3E97A 2QBYB 1W4MA 5CVJA 3GX4X 3BWGA 4U88A 2A6HF 2QM3A 3EDPA 4A5MA 3LSTA 1IN5A 3VEPA 3RJPA 3HRMA 3C1DA 3WTXC 1MDMB 2HDCA 4HF2A 4EM0B 4I98B 4EJOA 3U9GA 4ENNA 2EFPA 4IHSA 2DQRA 2E7WA 2VBWA 4KFCA 4RAZA 2CG4A 2X4HA 4GO1A 2DFIA 2L4AA 1HKSA 1LEAA 4RGXA 1ZYRF 3PQJA 3MAJA 2O03A 4M72A 2M1BA 1G4DA 1DDNA 3WTTC 5ICCA 2L54A 1G3WA 1FC3A 3T0YA 3KCCA 3ZN1A 2OQRA 3QOPA 2EFQA 2VOPA 5KVRA 1ZH5A 1FWZA 3J80K 2XROA 1O7FA 1W7PD 2XV4S 4OINF 5L3EA 5CVVA 4OIRF 1XGOA 4NHJA 2XGXA 2H6CA 2XAGA 1SD5A 1OR7A 4L5IA 1XGSA 1IN6A 2IRFG 3R4KA 3JTHA 1K7AA 1GHCA 2VXZA 3H3ZA 3I71A 2PFBA 2JPCA 3MEXA 1DUXC 4EMSA 3JTGA 4FHTA 3GXOA 3ABTA 1O57A 2EV6A 1JGSA 1ZLKA 3KETA 3WGHA 3V8JA 3RKWA 2AXLA 3FXRA 2O6GE 1FP2A 3T5XA 3TOBA 2QVOA 1UHMA 3K0LA 2FQ3A 1LDDA 2K02A 1KU3A 2UXXA 2QYOA 1WI9A 3GZ6A 4KIBA 2V79A 1Z6RA 3GFJA 3I53A 3F8CA 2H09A 5F6FA 5IT9Z 4LG0A 3SXYA 3P9CA 5D4RA 3QPHA 3EETA 5JR3A 3FWEA 3I54A 3IRQA 1TW2A 1I6XA 3GO5A 2XVCA 5H20A 1KYWA 3VOEA 5E1WA 1S7AA 5HLHA 2Y75A 5LRSA 5D6FA 5AIPA 4NB5A 3TGNA 1KU9A 1S29A 4A6DA 3LWFA 2DPDA 3CO7C 5BPIA 2X0LA 2C6YA 1P4WA 1SAXA 1ZG1A 5ICFA 2ZNZA 1MKMA 4L0YB 2DW4A 1KYZA 1USSA 4WF2A 5JI6A 2VODA 4KIGA 2K4JA 3P9KA 2MD5A 1FLIA 2DBBA 4P9UA 3CJNA 4KICA 4RAYA 3GEZA 5HS8A 1GXPA 2YX7A 3DPTA 3DEUA 1XDUA 2Q2EA 1U5TA 4Q47A 5FB2A 2ZFWA 2W57A 4EM1A 1YS6A 3H92A 4EQQA 3U1DA 4HA8A 1ON1A 3AAFA 2FE3A 2O8XA 2XUBA 4JBAA 3MZYA 2DI3A 4ZYHA 1J5YA 1WKMA 4YFKF 2BE5F 2JT1A 3FMRA 3K1MA 3F8NA 3GYHX 5D5VB 2DPUA 2FU4A 3FM5A 2JSCA 3W6JB 2CSOA 4HF1A 2CGPA 2FBIA 2A68F 1BN5A 3GUDA 4ZZDA 3LFKA 1LQ1A 1LEBA 3DPLC 3K69A 4IPAA 2ZCWA 1O3TA 2CW0F 2CWEA 3GFMA 4ZYEA 2BGCA 4A6EA 1IN7A 3E3VA 2RNJA 1CF7A 5LHGA 1IRFA 4WXCA 4Z2YA 1O7LA 4HLXA 2O3FA 3Q9VA 1IN8A 3BJAA 4G6DA 2F5CA 3GF2A 5K5QA 4EJTA 4XRFA 2LDUA 5BMZA 5HLGA 4UVAA 2IW5A 5FLXK 5E1XA 1U3EM 1V3FA 5HDNA 2DK5A 4UNOA 2LF8A 4PGGA 1YO5C 2DK8A 2Z5UA 1KU7A 3R0JA 1LDJA 4A2UA 1PP8F 5LLQA 4FT8A 2YPRA 1OMIA 4EM2A 1EH6A 4KT5C 2GXGA 1KQ8A 2P4WA 5EEGA 1U78A 4S05A 5D6EA 4LB6B 5E8IA 2EFWA 3P7NA 3J80Z 4I0AA 5HDGA 3V7SA 3EQLF 3KP2A 5D5UB 3SQNA 2RC4A 5LRRA 2KRFA 3RDIA 1BC8C 1XDSA 2HTJA 3GFIA 2HFHA 4UUVA 3ULQB 4BH9A 3DXJF 3D5LA 5DUKA 4CZZA 5L3CA 4LB5A 1TNTA 1J0RA 3TQNA 3LAJA 3HSEA 4I02A 1YIOA 1I1SA 1VTNC 5IT9K 1LVAA 4OOIA 1YS7A 1HSTA 3FMQA 2XAHA 2V6CA 4ESJA 2LNBA 2P7VB 2A07F 4A0XA 2KKOA 4IRIA 3GW2A 4A12A 3F21A 1UFMA 2D1VA 1MZBA 3HYIA 5LHIA 4AWXB 1EH8A 1B4AA 4XLNF 4CDGA 3K1PA 3O6BB 4G7OF 3CUQC 5CJ9A 4L18B 3I59A 1T38A 4GGGA 2HQNA 1R7JA 1EV7A 3JSPA 3WGGA 3ECOA 3WGIA 1T6SA 5L3FA 1MJAA 1BI0A 1PUEE 4G94A 4HQMA 3R6SA 1P4XA 3N97A 3B73A 3TO6A 4F7ZA 5D8KB 5ILSA 2PMUA 4WK8F 1UHWA 3I4PA 2MLGA 3KZYA 4JQFA 1GVJA 2IA2A 1FZPB 4LFUA 2D45A 1QBJA 1J59A 3ERED 2M30A 1FBSA 2B0LA 1L0OC 4ON0A 1XCBA 1TW3A 4RB0A 2W84A 4BHCA 3MCZA 1P4AA 2NAZA 1FX7A 1MJBA 1BC7C 2GXBA 2XAJA 3E6MA 2ACJA 4M73A 4IXAA 2OBPA 1RUOA 1KGSA 3T1BA 1G3YA 2V9VA 2Z3YA 5H6QA 4EV0A 4CHUA 3VB2A 5FFXA 4G6QA 3F8FA 3RYRA 3LA2A 2H94A 4N9IA 1BI2A 2E7XA 4D0PA 2EA4A 3IL2A 2EA2A 5AIQA 5K1YA 4DNCA 3PFIA 2XIGA 2PLYA 4K2EA 4RB3C 1LB2A 3LAPA 4U7BA 2P7CB 3ZP5A 1S7OA 2XAQA 3FXQA 5ICEA 3RI4A 4IF4A 1T2KA 2P5KA 2OZUA 4Q5SF 1ZAOA 2WC2A 2XKPA 2M87A 1XMAA 4CYDA 3BROA 5FO5A 4P5OA 2G7UA 4IVNA 3RIRA 4I0BA 1OYIA 1LDKB 4IRGA 3IWFA 5CYVA 4AIHA 2GIVA 3F8BA 3C7JA 4WXDA 2EB7A 5KK1A 1Z91A 2NS0A 3DF8A 1IF1A 3ZMTA 4PCQA 3RPUA 4O6JA 3RKXA 2D2WA 2O0YA 4A0ZA 3WTYC 5EEHA 4MEYF 1FYMA 4L9JA 4G7ZF 2F5FA 2HOEA 4CXFA 4OIPF 3F6OA 2R7DA 1S8NA 5J8FA 1H9TA 2P8TA 2QLZA 1RI7A 4LD5A 4QLCU 1J2XA 2HKXA 4KA4A 2DU9A 4MGRA 2F5DA 2PQ8A 4HW0A 3KP3A 5H6RA 1MGTA 2PG4A 2QQ9A 2FEZA 1B9NA 3QU6A 1HKTA 1YLFA 3WE3A 3CDHA 2RN7A 4EJWA 4ETSA 3LA7A 2OAZA 1OPCA 2G9WA 2FF4A 4L9TA 1TTYA 4LLLA 3DP7A 3BP8A 4O5VA 1UB9A 5LHHA 4AIJA 3F72A 1BI1A 2FMYA 1PP7U 2MH9A 3WU0A 3SZPA 2QWWA 2EK5A 4CO8A 1YW7A 2PI0A 4BHPA 4M9SA 2NNYA 3KP6A 3ZMVA 2K4BA 4YIFA 2ZMEB 2V1XA 1V4RA 4XSXF 1F9NA 2BEOA 4U7DA 4L0ZB 1G3TA
chains in the Genus database with same CATH superfamily
1OCCH 2FBHA 3BZCA 3KE2A 3PUBA 4CA0A 1ERDA 1W36D 1I1GA 3BJOA 4L9VA 2A05A 2EWNA 2O9LA 4ZH4F 2LOOA 3BR6A 2I8DA 2FJ1A 2XSDC 1WSUA 1IG7A 3RSNA 5CQGA 2DA7A 3PO3J 4B8XA 2P5VA 1YRNB 3I59B 1JJ8C 4MTDA 2R5ZB 3HHGA 4A3MJ 3KP7A 3CUQA 5FLXZ 1DP7P 5EJCA 1XPXA 2I10A 4I76A 2RGVA 2ESHA 5DYMA 3LQQA 1FSEA 4P96A 4OU0A 3IH3A 3FXKA 3CESA 1Z3YA 3K6GA 4M71A 4XSZF 2X6XA 5CVUA 3H9GA 3GTMJ 1KQ0A 1HDPA 1X1PA 3G1MA 2RDPA 3QAHA 1LKXA 4KT6A 1B8IB 3O3KA 3CP2A 4W97A 3FM3A 2ZFUA 5HODA 3BG3A 2KIMA 1IXCA 2HVQA 2KFDA 5LEKA 1K78A 1N75A 1FEXA 3MMYB 2ME6A 3MWMA 1B59A 4HX4A 1OFCX 2GQQA 2FMLA 1Z77A 4LG3A 3HOUJ 2UZKA 4YFNF 2VPLA 4ZDPA 4XKCA 1N25A 2QQAA 3HHHA 1FY7A 4ESFA 1ZRCA 4F3QA 2UWMA 4A3CJ 1IAWA 2LBFB 3V8KA 3TW6A 4DQ2A 3DFGA 1TQIA 5CQEA 2H8WA 3M8EA 2EJRA 1BIAA 3WTSC 2FD5A 1UHSA 3D5RC 3CDLA 3RKYA 1K6OA 1I3AA 2CQXA 2CFOA 4MLOA 4MFDA 3UR3C 2XC7A 1O3RA 1VQ4I 3CLOA 4XL9A 1V5EA 2EIKH 4BHBA 2DJNA 5FFZA 3IAS2 4BYYA 5L3BA 1SFXA 4LIVA 2IS6A 4RAGA 3H5RA 3CCSI 3OY9A 1ACIA 2DMQA 3BTIA 2MSYA 4UB6C 5LGNA 1X1CA 4LJZF 1WH5A 4XLHA 2EFNA 3CZ6A 3TO7A 3CTAA 1F43A 5ED4A 1HW5A 2DOEA 1V5FA 4BY1J 3RPQA 2QGUA 2DMNA 4MO7A 6PAXA 4XOPA 3P9IA 4BXFA 1MSEC 3KLOA 1D0YA 4B09A 3F6VA 2A61A 3MZ8A 3J7AY 1SVLA 1FOYA 4UVCA 5L3GA 2DQLA 4XORA 2M7AA 4XLAA 3M8FA 3E5UA 1H9GA 3PUFA 4FQGA 4WXHA 2JN6A 4DYRA 3BG9A 2MGQA 2UUZA 1QPIA 4OMYA 4MEXF 2E2IJ 4KN7X 2FOKA 3OS1A 3JRBA 3W2AA 2FXAA 3W6KB 3HG9A 3WTVC 4PJJA 1A6QA 1FJLA 1SFUA 1R71A 4I2OA 4JK1X 1FNNA 1MSFC 1JT0A 4A5NA 3PNVA 1J7KA 4BAYA 4H0EA 1RC9A 2DFHA 3LSMA 4ZYGA 3J81K 2R7UA 1W36C 1VQOI 1MBGA 2FUG2 4Q4ZF 2OC6A 1HQCA 5CVRA 2M8EA 1MDMA 3AL0B 3KFWX 2MBFA 3HOVJ 1E17A 3ASNH 3ZQFA 2HYFA 2RQQA 2XKOA 3G3ZA 5E20A 1OCZH 2KP6A 1U5TB 2Y9YA 4B4CA 5D4SA 3ZQHA 2W7NA 3LSJA 2CFXA 3PM1A 1SFEA 1QPMA 3NAUA 2FOWA 4V2GA 4EVIA 4U0YA 2J5OA 1ETWA 4FX0A 3H9JA 3DPUA 2GZWA 2HYJA 1ZRDA 3F9KA 3KLNA 2PMHA 2KIQA 2DODA 1K79A 4PFPA 1WJ5A 4HV5A 4B1RA 3A1YA 5EEAA 1Z7UA 1A5JA 2R7XA 1KQ9A 2EH3A 2HGCA 2XPUA 4MTEA 4LLNA 2IJLA 2VONA 2KL4A 1CF7B 3QU3A 3M3YJ 3BR1A 2LKPA 1ETQA 2LY9A 1T08B 1Z1DA 2STTA 3PFYA 1JXSA 2A69F 4HBLA 4F93B 2NVXJ 1R58A 3FZVA 1X2NA 4I01A 4QTRA 1R1TA 2M4GA 2V26A 1RKTA 4I09A 2XRNA 1APLC 5TJJA 4CCOA 4BGDA 5AONA 2NNNA 3BCAA 5F04A 3I58A 2H1KA 1KONA 1Z67A 2CQNA 1ZN2A 1U8RA 4OMZA 4XKWA 1XGMA 2BY1A 5FKKA 1QZYA 1ONVA 1XSXA 4UV9A 5JHUA 2L3DA 3HRUA 3SDGA 2YS9A 4HDUA 1FMVA 1QA6A 2NRAC 3FHZA 3HL2A 1TNSA 1QHHD 2EZLA 2DA5A 2G7HA 4CCKA 4ZDLA 3PNYA 4UHTA 2VASA 3F23A 5FRNA 4M6YA 1JT6A 4LGWA 5E8GA 5TRDA 4LG0B 2B9SA 1MBJA 1P2FA 1G59A 1T0FA 2K9NA 2A5YB 1WGXA 2QUFA 3F3XA 3BZ6A 1OYYA 4C3JJ 3DLLF 3ZPLA 3U2RA 2JRTA 3GTJJ 2A3SA 4IJAA 4OIOF 3D0SA 1ODDA 2P6TA 1J9IA 4DBQA 2V9PA 3KZIC 2IVMA 3S93A 1TT5B 2WTEA 4XM3A 2RQPA 2QQ8A 3FHNA 3HOSA 4IHXA 2QZ8A 4PSWA 4QPOA 5C4XJ 2ZJQF 4YELA 2KDZA 4A3JJ 3D5SC 3A01B 3LSRA 3DTKA 3REOA 1MMNA 1BM9A 2BHYA 2R7ZJ 3ISPA 2F48A 1GUUA 1WRJA 2R7SA 3H3UA 3ZQQA 2Z99A 1A04A 2GOMA 2GWRA 1JE8A 3OSFA 2JA2A 3WTUC 1Y0UA 1UG2A 5K5OA 5DD8A 5DD4A 2HS5A 4MQ9F 2BYVE 3SYTA 2OQGA 1W7PB 1QO0D 3COAC 1FYKA 2KRHA 3L7WA 3G1OA 2R7RA 2W00A 2GLOA 2ETHA 5DM7F 4LK1F 4DYCA 3L09A 3CCRI 1HBXG 3ZQCA 1IN4A 1PDNC 1QNTA 2RNGA 3CCVI 3FBNB 5GTIC 1STZA 3WHCA 1MBKA 1G3SA 2MC3A 3KEQA 1XMXA 3AG4H 3L00A 5IOZA 3JW4A 2YU3A 3OOPA 4F52A 1KU2A 4UUTA 2RAEA 3OWTA 4BXUA 3DKYA 3FIWA 1WPKA 1D5VA 1IDYA 2K27A 4OIQF 2QKLB 2YR2A 4HQEA 5FRMA 3WU2C 4L5JA 2VJ5A 4M3FA 1BBYA 1LVKA 2LYCA 2UV1A 1MMDA 2E71A 2XRLA 1TWHJ 3JCUC 4CCNA 4XRSA 3K70C 3ASOH 4R8HA 1HXDA 1FOXA 1ZARA 3G1LA 4C2UA 4YFXF 3S3OA 1RUNA 2QQBA 4V2FA 1JGGA 2X85A 2WB1N 1T98A 3BC8A 3S3NA 4KITB 4HNVA 1TQPA 2GXAA 2ESNA 2CH0A 2PMZN 9ANTA 3CCEI 1OYWA 5J8CA 4RM3A 2G0EA 1LNWA 1TP4A 4BL0B 1SC7A 4U0WA 3SZTA 1ZGJA 4ZYAA 2HOTA 3BJ6A 3CUOA 5DM6F 5BOXA 3CO6C 5JFRA 3JAMZ 4FE4A 2IA1A 4LK0F 4AD9A 3KEYA 1B6AA 3ESWB 2J5PA 3J7AO 4M9XA 5HLIA 1D8KA 2M8GX 3ZRGA 5E3LA 5JVGF 1D0XA 5DCFA 3VYRB 2R3SA 5J1RA 2H6BA 1O3SA 3IC7A 1R1UA 3E6BA 3AL0C 2EV0A 3HTSB 3C3WA 3QPTA 1UZCA 2XB5A 2ZJ2A 4HOBA 3PJRA 2OPTA 1IRXA 1S7EA 1IV8A 3ZMDA 2ZNYA 1Y0NA 1SEUA 3M9AA 3FXLA 1SVOA 4HNTA 3O2PE 1FIPA 2RVCA 2XASA 4Y52J 3KP5A 2L4MA 3AG2H 3FK6A 2ELHA 3CMMA 2EZKA 2LF7A 2VBYA 3GFLA 2LC2A 5KAIC 2NS7A 2DCEA 4RB1A 1B9MA 4IHWA 1YTYA 2LLKA 4DYQA 4NQWA 1ZELA 2DMUA 3IP4B 4BE0A 1IRGA 3VFZA 3WE2A 1OCPA 1YOVB 3FXOA 2ZC2A 3V8LA 1ULYA 2E1NA 3WTWC 3J81Z 1P9QC 3E6CC 1YX3A 1IW7F 3ECHA 2VQHA 5M5YJ 3K9TA 4UVBA 2COBA 2DMPA 2MH2A 2YX4A 2OTJI 4XN0A 3LNQA 3WU1B 2VN2A 4KMFA 2WV1A 4HAMA 5F08A 4Y7NJ 1GDTA 4CH7A 4QWQA 1SVMA 2IPQX 2K3FA 3KZZA 3R0AA 4II2A 4P9FA 1TWCJ 4BKXA 2E1CA 3ABKH 1P7JA 3FMSA 1IZ1A 2HTSA 2KT0A 2M45A 3BTJA 3CJTB 3DV8A 5F27A 5GTHC 4PGHA 4L9NA 4Y17A 3H9QA 1X1AA 1Z3XA 2CO5A 4AVPA 2PN6A 1W1WE 3DKXA 2CQKA 1S6LA 2IA0A 1BOAA 2M7BA 1P92A 3ZXSA 4FX4A 4EEFG 1YQAA 1ZRFA 5FGMA 1TBXA 4JX6A 1MD0A 2W1OA 4NC6A 2HWVA 3S1NJ 3WG9A 3G73A 2NOJB 2ZO4A 1WJCA 3V42A 2HR3A 1S3JA 3FF5A 5F0FA 1DPRA 3S3MA 2HXIA 1JUPA 2O5RA 5FROA 1QGPA 1QZEA 1EA3A 2WV0A 4JYKA 2VT3A 4XLFA 1HW2A 4UB8C 3MFKA 4X1EA 1ON2A 1BR4A 2JZYA 2NYXA 3DBHB 3OS2A 1WJAA 3Q9SA 2NVTJ 4AIKA 2OA4A 2FNAA 3VODA 5C4JJ 3CJQB 1JHFA 5J6XA 4RAFA 3M7GA 1YIJI 2ECCA 2IT0A 1I3QJ 4M6VA 2VC1A 2PJRA 2WWYA 2QBYA 2LP0A 1F1ZA 2E35A 1R5HA 2CYYA 2E2JJ 3K1NA 3GTLJ 1HKQA 1FT9A 1V5GA 4IHTA 2VOOA 3JRGA 3BR3A 2XB0X 1MJ9A 4XLEA 4M3BA 3EPZA 5HS7A 4I99C 2CS3A 2VE8A 4RS8A 2BXYA 1ZG3A 2PBIA 2A6EF 2EV5A 4TV7A 2CW7A 3I64A 1IO2A 3HZJA 2VE9A 2ECBA 5LBQA 2XGDA 3RZDJ 2X48A 3HOWJ 4A93J 1DGWY 2V1UA 4LITA 1IXSB 1YG2A 4U0VA 3F8MA 5ICGA 3FX3A 3KP4A 3S2HJ 4RGRA 1IXRC 1SMYF 3HPHA 3IWZA 4LLGF 3FBIB 4N4OB 1B1BA 4Y33A 4GFBA 3L2UA 2MLKA 4M6XA 3BQYA 2ZJPF 1V55H 5DV5A 4AIDA 5B1AH 1F5TA 2VIXA 5EF6A 1YJWI 1R00A 3C18A 3NARA 2BY2A 1GVDA 1RZ4A 3CF5F 4D7NA 4EATA 4ZDOA 3T8RA 2ID6A 4KYWA 4Y15A 3QP6A 4CYCA 2Z33A 4XR6A 5FKLA 4RLQA 3Q3SA 2LTPA 5F0CA 3IKTA 3OIPA 2DA2A 3HJEA 5IY5H 1X4PA 5DCMA 2Y0MA 5E1ZB 2JRMA 3M1EA 2EPFA 2ZBKA 2V9KA 2LKXA 4HSTA 2EBIA 3AG3H 4GYIA 5EYRA 5L3DA 3S1RJ 2EFOA 2WAQN 2IS2A 2JTVA 1LJ9A 4HV6A 4N9HA 1FYLA 2BW3B 2JA7J 5IYDJ 2E36A 3LSHA 1FSHA 2QENA 2R4GA 4YIIA 4OAZA 5F1RA 5DUIA 4CICA 1A31A 3W2VA 1U8BA 2M0CA 3NRVA 1U5TC 3S1MJ 2CQ7A 2JPBA 2HDDA 3ROUA 2WADA 1N78A 3ZOBA 4N4NB 4BEHA 5D5WB 4M74A 4AUXA 4MQVA 1G6NA 4DIQA 2LY1A 1NH3A 1ETXA 3K7AJ 2W48A 4CUGA 5HNHA 5IYBJ 1K4TA 2EIMH 3P5JA 2D5VA 5J4YA 4Y3OA 4XONA 1UCRA 1HSJA 2ZMEC 3NWSA 3UKGA 3CC2I 1LFUP 3RTRA 4EJVA 1D8JA 1JHHA 3HOTA 2XAUA 3VDXA 1AOYA 3SZGA 4KDPA 1W0UA 3OYLA 2KZVA 3DTIA 3OYIA 1PYVA 2OD5A 2WA0A 2WY7Q 4MNUA 4BEHB 2R93J 2XSJC 4KN4X 2DAOA 2VXDA 2ADUA 2GBYA 4OWRB 4R79A 2DFFA 3S8PA 1FBQA 1YJ9I 1ORKA 3LSIA 1E3HA 3B02A 4GRIA 5J1UA 1X1DA 4CGZA 2W25A 2L02A 4KNYA 2CUZA 5LEJA 2PEXA 3CCUI 1BR2A 2M34A 1AWCA 3MQ0A 3K4KA 2RV8A 3LOCA 2FSWA 3ZQ7A 2B7EA 2PJRB 3S16J 1IUYA 4WWCA 3ZGKA 1IJWC 3JAMK 1WQ2A 4CYCB 1QQIA 1S5LC 4KISA 3RYPA 3WODF 1DU0A 4GCVA 5D5XB 4O3MA 2H27A 2VQCA 4C30A 2ZXJA 4C3HJ 2O8KA 4FE7A 4Y13A 3LA3A 1FOKA 3GBGA 4E7JA 2BV6A 2DT5A 2W24A 2AO9A 2R7FA 3GTKJ 3E5QA 1BJAA 5E18F 3SFZA 4ZYDA 2DO7A 1TLHB 3S32A 1I5ZA 5HVQC 3WHBA 2VKHA 3EYYA 3TBIA 4HYEA 5H2FC 2DT7B 1R22A 3L2CA 2VC0A 2E19A 3CUQB 3ML6A 1AA7A 2K86A 2OZ6A 4DOZA 3DQVC 4NNJA 1USTA 3OYCA 4BQNA 1VQ9I 1XD7A 1W7PA 3LFUA 4KMUX 3M8JA 3TDUC 3QRFF 2X6OA 3ZR8X 3LSKA 2VBZA 3V4GA 1QZZA 4HX7A 2JUCA 3E5XA 3W6VA 3RPUD 5E3NA 1TWAJ 2XAFA 1RR8C 3KEOA 3GLXA 1UJ8A 1SD6A 1JKRC 1U6GA 2COMA 1XCVA 2MA3A 3IRRA 4BBRJ 2DFEA 3ABUA 2YSRA 2FNPA 4XBFA 4WX9A 3ERMA 2DDBA 2V7FA 2AS5F 5IT3A 2LR8A 5ERIA 2FA5A 2HKOA 3ELKA 2YU9J 1XSVA 1Z05A 3IUOA 4B48A 4CSWA 2KJCA 1JTXA 2KIUA 1ZR4A 4GXOA 3JREA 1BIBA 1J75A 1T95A 2DOAA 3R61A 3Q0WA 1R1VA 5CLSA 5CKTA 3K70D 3VPRA 3BT9A 1YW9A 2DLLA 3TKYA 2V1DA 1CQTA 5HS9A 1U2WA 3CJRB 4BDYA 1EH7A 3JR9A 3EUAA 3I9V2 3C2HA 5GAGJ 3OYHA 3S15J 3K4LA 4II3A 2ISZA 1ZLJA 3HM5A 1WI3A 5HOOA 1YFHA 1Z6TA 4UV8A 1YHQI 3BY6A 4HZFA 4Z6YA 3TDZC 5F64A 4B44A 4E4HA 3OS0A 3FKIJ 1JJ6C 5EZGA 3OYFA 2PJPA 2W85A 5DEQA 2QA4I 3EUHC 1CGPA 3LSPA 3MN2A 4G7HF 4A3DJ 1YE9A 2MABA 2OV7A 4IQJA 3H0DA 4G8XA 4ZC3A 5A2QK 1I27A 2R7OA 3GVAA 2AXTC 3A4CA 3K10A 4M9ZA 1SMTA 5KCMA 4LMYA 2VB6A 1FPQA 4E70A 3K2ZA 1Z9CA 2IAIA 2VT2A 2DDAA 4IRHA 3OSGA 2STWA 1FBUA 4ZZLA 4R1HA 5IYCJ 3DBRB 4RGSA 3BTCA 3JRCA 2IP2A 2EQRA 3MKZA 3ABMH 2D1HA 3HTUA 5HDKA 5K7FA 2BBYA 4RA2A 3BZKA 3ZN0A 1WWXA 3ZMZA 2DTRA 1R4NB 3ZMUA 5A2QZ 1OLTA 1YYVA 1OKRA 4A3LJ 3F22A 2Q8KA 1Q1HA 4HX8A 5BS6A 4QSHA 4F92B 3DU6A 3GWZA 1VFCA 2HYGD 1T39A 1XSDA 3PL8A 3TOAA 2K7LA 4EGYA 1X4OA 4RB2C 5K7ZA 2GAUA 2ZKZA 1F4KA 1TQMA 3K4BA 2KIFA 3OV8A 3A2KA 3OYBA 1ZG5A 2VBXA 1RIOH 5M5WJ 5JVTA 2HQAA 3LQRA 4I7HA 2RKHA 2MW8A 2P6SA 1G8XA 5CVIA 2F2EA 3IHUA 2KZGA 2Y48A 3KYCB 2R0QC 1IDZA 2AQFA 5FLMJ 3K4NA 2HZDA 4XLPF 4A3KJ 4EGZA 2DYRH 1MMGA 3ONQA 2VI6A 3BDDA 4E7HA 4ENMA 1O3QA 3R60A 2PMZA 1X3ZB 3BPXA 2L9RA 2N8GA 3BPVA 1RNLA 1XB4A 3QWLA 4FTHA 2EINH 5D8LB 2K40A 1XMKA 2HEOA 1B8IA 3SHFA 4ENKA 2CV0A 4PFOA 3JSOA 1ETKA 1ZHFA 4BQOA 3CCLI 4BJ6C 3IKVA 4A0YA 4A3FJ 3V7CA 2CV1A 3HSRA 3TO9A 1XN7A 1WJBA 3Q5FA 1MH4A 1Z7LA 2LSOA 2P5LC 4BNCA 4WCGA 2E1MB 5ILUA 3E6DA 4J00A 4D9JA 1NTCA 3H35A 3G2BA 2L01A 1SD7A 4BQAA 4G9YA 2Q0OA 1M1EB 4ASNA 4ESBA 4S04A 3Q0VA 4PDKA 1D1AA 2FQ4A 2DA6A 1A6IA 3EYIA 2DA3A 4ITVA 2FBKA 2Z9OA 2GA2A 2TDXA 5BPDA 2LMDA 4CZCA 3I56I 1SANA 1X3UA 3LMMA 2ZXHA 1MBFA 1FP1D 3GZ5A 2B63J 3IH4A 3ZMSA 5DDGA 5BQTA 5K5RA 3JRFA 3QP5A 1U0JA 4A3EJ 4UXNA 2E1MC 3BG6A 2LFBA 2ZMEA 5M3MJ 1XGNA 3M07A 1POGA 4JX5A 3HSFA 2JA5J 3PIOF 2XPWA 1D1BA 2GA1A 4FASD 3L1PA 1ZGAA 3NQOA 1R23A 3HUGA 3I5UA 4KIFA 2HQRA 3FKJA 5E17F 2OCEA 1XC5A 5DTDA 4AYBA 1K4SA 2PX9A 4HDVA 2E5ZA 2KJBA 1Y8QB 4PZJA 2NOGA 2M0MA 4HLYA 4IO9F 3ZQIA 1DPUA 1W5SA 2UXNA 2ISYA 3HIFA 4GYGA 5FD6A 2NVUB 3DKWA 1TL8A 1C0WA 1REPC 4XNFA 1KA8A 3E1SA 5DCMB 4B47A 4E7LA 4S0HB 3DTEA 3NEUA 1H89C 2OU2A 4HF0A 4P55A 3GMEA 2LKSA 4BUPA 1K78B 3BR2A 2QCOA 3SDBA 3EUHA 5FKOA 5IPAA 5ILVA 3KIOA 3BOQA 2F5EA 2LREA 2FRHA 4RGUA 3QPSA 1R9TJ 2DMTA 1E2XA 2A5WA 2HZTA 3HEFA 3PQKA 4PJLA 4RLFA 4XN3A 3JRAA 3CCQI 4ENJA 1JKOC 1AHDP 5LGTA 5KAFC 1UMQA 1P6RA 4FETA 2HNHA 1K6YA 3BLYA 3HRSA 4Q48A 1R5GA 4A3BJ 3V7RA 1YW8A 1ZREA 3S2WA 4PJNA 5FD5A 3T8TA 1LFBA 4MHGA 4DJAA 1FTTA 3HRTA 1WVRA 1W5TA 4YG2F 5EG0A 1HW1A 3PSIA 1H0MA 3PIPF 4BJTA 1L3LA 1YRNA 2BZTA 3WTZA 5LGUA 2X51A 2ELKA 1BI3A 2M5WA 2O61A 1D3YA 1Z21A 1NHAA 3FXUA 1R36A 1TC3C 4KUMA 3I0TA 4QIWN 3D1NI 1RRJA 2R7VA 1HDDC 3MZHA 3L9FA 4N0BA 3CDIA 1GXQA 1SD4A 3GTOJ 1X1BA 1NG7A 4A3IJ 4XICA 5J47A 4EJUA 2XHKA 4DBRA 3N4MA 1MNMC 3E97A 2QBYB 1W4MA 5CVJA 3RQ4A 3GTQJ 1RETA 4KJZA 2L0KA 3GX4X 3BWGA 4MFEA 4HEA2 2IGKA 4HG2A 2X6YA 2A6HF 4U88A 4FISA 3HKZA 2Y2ZA 2QM3A 4RDUA 3QYFA 3EDPA 4A5MA 2DA4A 3RZOJ 1VQNI 3LSTA 1IN5A 3VEPA 3RJPA 4GDFA 1LE8A 4ZTFA 5BNGA 5B5EC 3HRMA 2DA1A 3C1DA 3WTXC 4B43A 3CMEI 1MDMB 3HGGA 2LRDA 2Z2SB 1EJ9A 2HDCA 3DWLE 4HF2A 2W82A 4EM0B 1X2MA 4I98B 4EJOA 3U9GA 4ENNA 2EFPA 2JK3A 3VYUB 2XPVA 4IHSA 1X58A 2DQRA 1J09A 2E7WA 2KDOA 3SEQA 2VBWA 4KFCA 4RAZA 3CD6I 2MG4A 4PJ0C 2CG4A 1Y1VJ 2GIZA 2X4HA 4GO1A 2DFIA 2L4AA 4D7MA 1MW7A 1HKSA 1LEAA 1BOBA 4RGXA 1ZYRF 1BJZA 3PQJA 4JX4A 3U21A 3SJMA 3MAJA 1R6RA 2O03A 5J1YA 5F0HA 2VKVA 4M72A 4BU2A 4HNUA 2M1BA 1G4DA 5IOYA 1DDNA 3WTTC 5B1BH 5ICCA 4M3GA 1X19A 5IP7J 2L54A 2KLOA 3DLAA 3L2RA 5C44J 1G3WA 2IGMA 1FC3A 3ZQLA 2Y69H 3CCMI 2K5CA 3T0YA 3KCCA 1TZLA 3CMAI 4IX7A 3ZN1A 2OQRA 2Y9ZA 3QOPA 2EFQA 2VOPA 5KVRA 1ZH5A 2WY8Q 1FWZA 2JVHA 2QSHX 3J80K 1XTAA 4YEJA 2FX0A 2XROA 1FTZA 5GAHJ 1VQMI 1O7FA 1BW5A 1Y8RB 1W7PD 2XV4S 3S2DJ 4PSXA 4OINF 3OR1C 1S9HA 5L3EA 5CVVA 4OIRF 3OYAA 4XMYA 1XGOA 3TP3A 2IXSA 4NHJA 2XGXA 2BW3A 2H6CA 2XAGA 1SD5A 1OR7A 1IC8A 3UNGC 4L5IA 1XGSA 1PJRA 3BTLA 1IN6A 3TMOA 2IRFG 3R4KA 4NQWB 3JTHA 1K7AA 1GHCA 2VXZA 2BVMA 4J19A 2H8RA 3H3ZA 3I71A 2AQEA 1B72A 2WAQA 2Y0SN 4J01A 2PFBA 2JPCA 3MEXA 1DUXC 1DQUA 3J7YJ 4EMSA 4XRMA 2HDWA 3JTGA 5DS9A 3FDYA 4FHTA 3GXOA 3OYMA 1GT0C 3OIQA 3ABTA 1WH7A 4HSRA 5F1JA 1O57A 5J40A 1FIAA 2EV6A 3H0GJ 3TL4X 1JGSA 4ANJA 1H88C 1ZLKA 3KETA 3WGHA 2ZXWH 3V8JA 3RKWA 1VQLI 2AXLA 3FXRA 2NXNB 2O6GE 3HB9A 3TP0A 1FP2A 4OAYA 1LPQA 3HDDA 3T5XA 3CC4I 3TOBA 2QVOA 1UHMA 4B3AA 3K0LA 3CLQA 1LDDA 2FQ3A 2K02A 1KU3A 3HKZN 1VQKI 2R7TA 4XIDA 2UXXA 2QYOA 1WI9A 3GZ6A 2X9DA 4KIBA 2F4OB 3FK7A 2V79A 1Z6RA 2E34A 3MKLA 3GFJA 2LBFA 4ABZA 1MBHA 3I53A 1X3WB 2KMUA 3F8CA 3VYSB 3CC7I 2H09A 4AM3A 5F6FA 1MNDA 1I6HJ 1O4XA 5IT9Z 4LG0A 3SXYA 4D5CA 3P9CA 5D4RA 5M3FJ 3QPHA 2X1EA 2CQQA 2WB1A 3EETA 5JR3A 3AKZA 3FWEA 3I54A 4HRIA 2VJ4A 3IRQA 1TW2A 5KNLA 1OR7C 5B66C 1I6XA 3MKWB 3GO5A 2H1LA 2XVCA 5H20A 5KHDA 1VQ5I 1KYWA 2VLAA 4W1UA 3VOEA 5E1WA 5JHFA 5HLTA 1S7AA 5HLHA 1ITYA 4D1QA 2Y75A 5LRSA 1LFPA 5EDNA 4YIRX 5D6FA 5AIPA 3IV5A 1GV2A 4JOMA 3CF2A 4NB5A 3TGNA 3CP8A 1KU9A 1S29A 5GP9A 4A6DA 3LWFA 2CU7A 2ME0A 3QPLA 3A0BC 2DPDA 2JUGA 3CO7C 2Z1DA 5BPIA 2X0LA 1PUFB 2C6YA 1P4WA 2K9SA 1Q1VA 1SAXA 5ICFA 4QPQA 1ZG1A 2ZNZA 4BS9A 1MKMA 4L0YB 2ZJRF 2DW4A 1KYZA 2ZSHB 1USSA 1HC8A 1MH3A 1NK3P 1XX5A 4WF2A 2CRGA 1WFXA 1DGRM 5JI6A 1Y56A 2DOFA 1SFOJ 2ID3A 2VODA 1R4MB 4KIGA 1A36A 2K4JA 1HCRA 3P9KA 2DT6A 2MD5A 1FLIA 2LG4A 1ZKGA 2DBBA 2IGOA 1BR1A 4P9UA 1EKEA 2OJED 2ZSIB 3CJNA 3BR0A 4KICA 3A03A 1RR7A 3GEZA 2VKDA 4RAYA 5HS8A 1GXPA 1A35A 2YX7A 1TWGJ 1QRYA 2GOXB 3DPTA 1OISA 2JMWA 3DEUA 3A01A 1XDUA 2K85A 2Q2EA 2A6TA 4E7IA 1U5TA 2CUEA 3AFHA 4Q47A 1YI2I 1Y39A 5FB2A 2ZFWA 2W57A 4EM1A 3KX2A 1YS6A 1ZTRA 3H92A 4EQQA 3U1DA 4HA8A 1ON1A 1HLVA 2VQLA 2V1NA 2VPRA 3K4CA 3AAFA 2FE3A 2W4SA 1T0FC 2O8XA 3DBLB 2XUBA 4JBAA 3MZYA 2DI3A 4ZYHA 4PJMA 1J5YA 3HOYJ 2OUMA 1WKMA 1XG1A 2QSGX 1I39A 3QODA 2EIJH 3C2BA 4YFKF 2BE5F 3GCMA 3JRDA 3H1CA 2JT1A 3FMRA 2VQGA 3K1MA 1QHGA 3GTGJ 3F8NA 3GYHX 1VI0A 5D5VB 3L2QA 2FU4A 2DPUA 3FM5A 2JSCA 3W6JB 2CSOA 4HF1A 2L2OA 1U9NA 2R5YB 4LOCA 1VQ6I 2K9MA 2CGPA 3W2WA 2FBIA 2A68F 3G6EI 5E3MA 1BN5A 3GUDA 2JVGA 3LFKA 4C9YA 4ZZDA 1LQ1A 1LEBA 3DPLC 4NDLA 3K69A 2QEXI 4IPAA 4LIUA 3J7ZI 3A0HC 5HNFA 2ZCWA 3DCFA 4DGWB 1O3TA 2CW0F 2CWEA 2P0WA 3GFMA 1HA8A 2HI3A 2TCTA 4ZYEA 1JKPC 2BGCA 4A6EA 1IN7A 3A02A 3X2QH 4V19K 3E3VA 1F36A 2RNJA 1CF7A 5B3SH 2HOAA 3Q0UA 5LHGA 1IRFA 4E7SA 4WXCA 4BXXJ 3HXLA 4Z2YA 1O7LA 4HLXA 3RCOA 2R92J 2MD0A 2CJJA 2EZHA 3RKQA 4U87A 4B3XA 2O3FA 3Q9VA 1SFKA 1IN8A 1QU3A 3SFIA 5FLVA 3BJAA 2L5QA 4G6DA 2F5CA 3GF2A 2Q1ZB 5K5QA 4EJTA 3PNTA 3HC7A 4X0GA 4XRFA 2LDUA 5BMZA 3I55I 2IGNA 5HLGA 4UVAA 2IW5A 3GLLA 5FLXK 2XDVA 5E1XA 1U3EM 1V3FA 5HDNA 1YJNI 4XK4A 2IS4A 2DK5A 4UY8I 3TEDA 3MD2A 1Z0XA 4X6AJ 1Y1WJ 4UNOA 2LF8A 4PGGA 4IOAF 1YO5C 2DK8A 2Z5UA 1KU7A 3R0JA 5EGOB 2LD5A 3C2GA 1LDJA 2XF6A 1AU7A 4A2UA 4YRVA 3I3LA 2HOSA 1PP8F 5LLQA 3VSLA 1RKWA 2KQRA 2YPRA 4FT8A 1R5ID 5E3OA 1UAAA 1OMIA 3I4MJ 4EM2A 1ENHA 3KYLA 4FCYA 4D5FA 1EH6A 3IAM2 1WCMJ 4KT5C 2GXGA 1KQ8A 2M9HA 4XKBA 4DZPA 2E2HJ 2P4WA 2VJJA 5EEGA 2HVRA 3N05A 3ZCOA 4NC7A 1MIJA 1U78A 2MYSA 4S05A 2CUFA 5D6EA 4LB6B 5E8IA 2EFWA 2HQ5A 3P7NA 3J80Z 2O7OA 1FMWA 4I0AA 4IHYA 5EZHA 3VWBA 2Y31A 1HF0A 5HDGA 3S14J 3V7SA 3JRHA 3EQLF 4BY7J 3KP2A 3HPGA 3SQNA 5D5UB 2RC4A 5LRRA 2KRFA 5IP9J 3RDIA 1BC8C 4NUBA 2OCCH 3OL3A 3FXMA 1XDSA 1TT0A 2HTJA 3GFIA 2MFZA 3HBLA 3RQIA 2HFHA 4UUVA 4AYBN 3K2AA 3ULQB 4BH9A 3HGYA 1SAUA 2K9QA 2VUMJ 3DXJF 3H36A 4BDZA 5J3LA 4AU7A 4XRSG 4IZZA 3D5LA 5DUKA 3F0CA 2JA8J 1AKHA 4CZZA 5L3CA 3O8HA 1NK2P 1TNTA 1RESA 4LB5A 5LD2C 1J0RA 2IS1A 3TQNA 3OIOA 3LAJA 1K83J 3HSEA 4I02A 1ZR2A 2JQ7A 1YIOA 4JP0A 1I1SA 1VTNC 4I6ZA 4BQQA 5IT9K 2ICWG 4M3EA 1LVAA 4OOIA 2F4MB 2CW8A 1GV5A 1YS7A 1HSTA 3FMQA 3QYEA 1VQPI 4UUSA 2XAHA 2V6CA 4ESJA 2LNBA 2P7VB 1QVTA 2A07F 4A0XA 2KKOA 3L2WA 1JI8A 2Y30A 2HPIA 4BACA 5GADJ 4IRIA 1BA5A 2L7FP 1XS9A 1MMAA 3GW2A 1G2HA 2L7ZA 3F21A 1UFMA 2D1VA 1MZBA 1OQYA 1ZK8A 3HYIA 4A12A 4DZJA 2XF5A 2GM4A 5LHIA 3EUKL 4AWXB 2WAFA 1EH8A 1B4AA 3FISA 3BG5A 4XLNF 5IP6A 4IOCF 5FJ8J 1UELB 4CDGA 3K1PA 3O6BB 4G7OF 1QVUA 3CUQC 2R5ZA 5CJ9A 3G71I 4L18B 3I59A 1T38A 4GGGA 3ZQGA 5GPCA 2HQNA 2R5YA 2R7WA 3H3VK 1R7JA 1EV7A 2X1DA 3JSPA 1HOMA 2XGEA 1LE8B 1MMSA 3WGGA 3BG7A 3ECOA 3LSGA 4C3IJ 3WGIA 3CCJI 4BJ5C 2OTLI 1MNEA 2E60A 3DEEA 1UG0A 1T6SA 2KISA 5L3FA 3MVPA 1KZHA 1MJAA 3OYEA 3CQZJ 2V6EA 1BI0A 4IHVA 1PUEE 4PUSA 4G94A 4HQMA 3U1KA 4NC8A 3R6SA 1P4XA 1IRZA 3N97A 3B73A 3TO6A 4F7ZA 5JLXA 4H4KC 5D8KB 3CMYA 5ILSA 2PMUA 4WK8F 3OYNA 3E7LA 2Z16A 2MC4A 2Y0SA 2VKEA 3G4SI 2E1OA 1UHWA 2M3AA 3I4PA 4IQ4A 2M2EA 5CPRB 2MLGA 1JKQC 3KZYA 3B6CA 1DU6A 3E0JB 2ELJA 4G6TB 4JQFA 1T8IA 2X6WA 1ETYA 2XF7A 2X1CA 4CCJA 1GVJA 2K3PA 2ZB9A 2IA2A 5EG0B 1FZPB 1VQ8I 4LFUA 1JTYA 2CMPA 2D45A 1QBJA 5J4VA 2NS8A 3PO2J 1E0EA 1J59A 1D5YA 3OR2C 2EILH 3OYJA 2AHQA 3OOUA 2M30A 3ERED 3W3CA 1FBSA 5M5XJ 2B0LA 1L0OC 3M1CA 4PK4A 2E5NA 2K9LA 2BXZA 4A69C 4C2MJ 3DU5A 1N77A 1ETOA 3VYTB 1WJFA 4ON0A 5K7HA 2LK2A 1XCBA 1TW3A 4RB0A 2W84A 3HOXJ 3FXJA 4E7ZA 3AG1H 4BHCA 3MCZA 5C3EJ 1P4AA 2NAZA 1FX7A 2HPMA 1MJBA 1B72B 1BC7C 2GXBA 1EF4A 4F55A 2XAJA 3E6MA 3MKYB 3LL7A 1NG6A 2BY0A 3HOZJ 2ACJA 1K61A 4M73A 4IXAA 2OBPA 5EGOA 1RUOA 1KGSA 3T1BA 1G3YA 1VZ0A 2V9VA 4DW6A 1AKHB 2JSPA 4AC0A 1BL0A 2Z3YA 2HVSA 1GLNA 5H6QA 2L7MP 4CCMA 4EV0A 2QF7A 4NBQA 2NVQJ 1H8AC 4RM2A 4CHUA 1JUSA 1R49A 2L7KA 2OF7A 3VB2A 5FFXA 4ZJZA 4G6QA 3F8FA 1ZQ3P 3IH2A 3RYRA 3HUGB 4A3GJ 3LA2A 2H94A 4N9IA 1BI2A 1RPWA 2E7XA 3JRIA 3DEWA 1U9OA 5E79C 2QSFX 2EA4A 2M4KA 4D0PA 4M3DA 4IKFA 2KPMA 1ETVA 5GAEJ 3B6AA 3IL2A 2EA2A 5AIQA 2IBDA 5K1YA 4DNCA 3PFIA 2VJIA 2XIGA 4ZTJA 2PLYA 4HPQA 3ABLH 2BOLA 3H5NA 4BBSJ 4K2EA 4RB3C 1LB2A 3LAPA 4U7BA 1Y6IA 2P7CB 3CCYA 3ZP5A 3H5AA 1IUFA 1D0ZA 1S7OA 2VL8A 2XAQA 3FXQA 5ICEA 3I4NJ 2XGCA 3RI4A 3BQZA 3O8GA 1WJEA 4IF4A 3GTPJ 1IGNA 1T2KA 2P5KA 4C2TA 2OZUA 3SEZA 2EZIA 4Q5SF 2KRCA 1ZAOA 4G12A 2WC2A 2XKPA 2M87A 2F6CA 1XMAA 4RMNA 1JUMA 2CUJA 2JJ7A 2LY2A 4CYDA 1ZGWA 1V54H 3BROA 5FO5A 4P5OA 2G7UA 4IVNA 3RIRA 2BY3A 4I0BA 1OYIA 1LDKB 1OCRH 1I50J 3OYKA 2F5VA 4IRGA 4F91B 4IL6C 3QOEA 2JA6J 3IWFA 5CYVA 4AIHA 2GIVA 3F8BA 3L2VA 3S1QJ 3C7JA 4XKVA 1T56A 5JLWA 2F4IA 1WJDA 4WXDA 2EB7A 2L9SA 4BE1A 5KK1A 1Z91A 1W0TA 1YITI 2TRTA 1VNDA 2KHMA 1E3PA 2NS0A 3DF8A 4BE2A 4RBOA 2WAEA 2NVYJ 1IF1A 1PVEA 3ZMTA 1OCTC 2LH9A 1MBEA 4PCQA 3RPUA 3PSFA 2WBMA 4O6JA 2D2WA 3RKXA 2DXIA 1OCOH 2O0YA 5FKMA 3M4OJ 1P7IA 4XQFA 4A0ZA 4XOTA 4E6KG 5EEHA 3WTYC 4MEYF 1FYMA 2Q2EB 4L9JA 4G7ZF 2F5FA 2HOEA 3OMYA 4L5EA 4CXFA 4OIPF 3F6OA 2R7DA 1VF9A 1D1CA 1S8NA 5J8FA 1H9TA 2P8TA 3K4MA 2QLZA 2V4JC 1RI7A 2DTZA 3KYDB 4LD5A 4AVZA 4QLCU 1J2XA 2HKXA 3OL4A 5TGTA 4KA4A 1DP3A 2DU9A 4MGRA 1LUJB 2DYSH 2IEKA 3OYGA 2F5DA 2PQ8A 3OYDA 2ZXIA 4HW0A 3KP3A 4XLCA 2BVLA 5H6RA 1MGTA 2PG4A 4Y4RA 4UUSB 2QQ9A 2DJIA 2LVSA 2FEZA 1B9NA 2YUSA 3QU6A 1E3OC 2CV2A 4E7KA 1HKTA 1YLFA 2L9NA 2BHZA 1WZ2A 1WHUA 1S72I 3WE3A 1T33A 3GZNB 5LFAA 3CDHA 3QQAA 1PUFA 2HU9A 1BW6A 2RN7A 4EJWA 2P81A 3K4JA 4ETSA 2RREA 4CCLA 3LA7A 2OAZA 4P1WA 1OPCA 2G9WA 2FF4A 4L9TA 3WG7H 1W5CC 3QYBA 1TTYA 4LLLA 3NWTA 3DP7A 3BP8A 1OJLA 4O5VA 1UB9A 3VSKA 5LHHA 4AIJA 3F72A 3KPHA 1BI1A 2FMYA 1PP7U 2MH9A 3WU0A 5FKNA 3SZPA 2QWWA 2EK5A 3BCBA 2QKMB 4MIMA 4CO8A 1YW7A 2PI0A 4BHPA 2JWTA 4M9SA 2DN0A 2HXOA 2NNYA 2L9VA 3KP6A 4IEJA 2I5UA 5GPAA 3ZMVA 2K4BA 3BR5A 1YX5A 1TWFJ 5TISC 1FOWA 4YIFA 1IV6A 2ZMEB 2R7QA 2V1XA 1V4RA 3S17J 3TW7A 4XSXF 1VQ7I 1F9NA 2BEOA 4U7DA 4L0ZB 1G3TA
chains in the Genus database with same CATH topology
2FBHA 3KE2A 1I1GA 3BJOA 4L9VA 2EWNA 4ZH4F 1WSUA 4B8XA 2P5VA 3I59B 4MTDA 3HHGA 3KP7A 3CUQA 5FLXZ 1DP7P 2RGVA 2ESHA 5DYMA 3LQQA 1FSEA 4P96A 4OU0A 4M71A 4XSZF 5CVUA 1KQ0A 2RDPA 3QAHA 3O3KA 3FM3A 2KIMA 1IXCA 5LEKA 1K78A 3MWMA 1B59A 4HX4A 2GQQA 2FMLA 2UZKA 4YFNF 2QQAA 3HHHA 1FY7A 4ESFA 1ZRCA 2UWMA 1IAWA 3V8KA 4DQ2A 3DFGA 1TQIA 3M8EA 2EJRA 1BIAA 3WTSC 3RKYA 1K6OA 1O3RA 3CLOA 4BHBA 5FFZA 5L3BA 4BYYA 1SFXA 5LGNA 4LJZF 2EFNA 3TO7A 3CTAA 5ED4A 1HW5A 3RPQA 6PAXA 3P9IA 3KLOA 4B09A 3F6VA 2A61A 5L3GA 4UVCA 2DQLA 3M8FA 3E5UA 1H9GA 4WXHA 4OMYA 4MEXF 4KN7X 2FOKA 2FXAA 3W6KB 3WTVC 1SFUA 4I2OA 4JK1X 1FNNA 4H0EA 4A5NA 1J7KA 4BAYA 4ZYGA 3J81K 4Q4ZF 1HQCA 5CVRA 2M8EA 1MDMA 3KFWX 2MBFA 1E17A 2HYFA 2XKOA 3G3ZA 5E20A 1U5TB 5D4SA 2CFXA 1SFEA 1QPMA 4EVIA 4U0YA 2J5OA 4FX0A 2GZWA 1ZRDA 3KLNA 2PMHA 1K79A 4HV5A 1Z7UA 1KQ9A 2HGCA 4MTEA 4LLNA 2IJLA 2VONA 1CF7B 3QU3A 2LKPA 1Z1DA 2STTA 1JXSA 2A69F 4HBLA 1R58A 3FZVA 4I01A 1R1TA 4I09A 2XRNA 5TJJA 5AONA 2NNNA 3I58A 1ZN2A 1U8RA 4OMZA 1XGMA 1QZYA 1ONVA 1XSXA 4UV9A 5JHUA 2L3DA 3HRUA 4HDUA 2NRAC 3FHZA 1TNSA 2G7HA 4UHTA 3F23A 4M6YA 4LGWA 5E8GA 5TRDA 4LG0B 1P2FA 1T0FA 2A5YB 3F3XA 2QUFA 3BZ6A 1OYYA 3ZPLA 3U2RA 2JRTA 2A3SA 4IJAA 4OIOF 3D0SA 1ODDA 2P6TA 1J9IA 2IVMA 2WTEA 2RQPA 3HOSA 2QZ8A 3REOA 1BM9A 3ISPA 1WRJA 3H3UA 2Z99A 1A04A 2GWRA 1JE8A 3WTUC 1Y0UA 5K5OA 5DD8A 5DD4A 2HS5A 4MQ9F 2BYVE 2OQGA 1W7PB 1QO0D 3COAC 1FYKA 3L7WA 2ETHA 4LK1F 3L09A 1HBXG 1IN4A 1PDNC 1QNTA 1STZA 1G3SA 2MC3A 3KEQA 3L00A 3JW4A 2YU3A 3OOPA 1KU2A 4BXUA 1D5VA 2K27A 4OIQF 2YR2A 4HQEA 4L5JA 1BBYA 4R8HA 1HXDA 1ZARA 4YFXF 1RUNA 2QQBA 1T98A 1TQPA 2ESNA 1OYWA 5J8CA 1LNWA 4U0WA 3SZTA 1ZGJA 3BJ6A 3CUOA 5BOXA 3CO6C 5JFRA 3JAMZ 2IA1A 4LK0F 4AD9A 1B6AA 2J5PA 3J7AO 4M9XA 5HLIA 1D8KA 5DCFA 2R3SA 2H6BA 1O3SA 3IC7A 1R1UA 3E6BA 2EV0A 3HTSB 3C3WA 3QPTA 2ZJ2A 4HOBA 3ZMDA 2ZNYA 3M9AA 3O2PE 2XASA 2RVCA 3KP5A 2L4MA 2ELHA 2LF7A 2VBYA 3GFLA 4RB1A 1B9MA 1YTYA 4NQWA 1IRGA 3VFZA 3WE2A 3V8LA 1ULYA 2E1NA 3WTWC 3J81Z 3E6CC 1IW7F 3ECHA 3K9TA 4UVBA 2MH2A 2YX4A 3WU1B 2VN2A 4KMFA 4HAMA 4QWQA 2IPQX 3R0AA 3KZZA 4P9FA 2E1CA 3FMSA 1IZ1A 2HTSA 2M45A 3DV8A 4PGHA 4L9NA 4Y17A 2CO5A 4AVPA 2PN6A 2CQKA 1S6LA 2IA0A 1BOAA 1P92A 4FX4A 1YQAA 1ZRFA 5FGMA 1TBXA 1MD0A 2HWVA 3WG9A 3G73A 2ZO4A 2HR3A 1S3JA 3FF5A 1DPRA 1QGPA 2WV0A 2VT3A 1HW2A 3MFKA 1ON2A 2JZYA 2NYXA 3Q9SA 4AIKA 2OA4A 2FNAA 3VODA 1JHFA 5J6XA 3M7GA 2IT0A 2VC1A 2WWYA 2QBYA 1F1ZA 1R5HA 2CYYA 3K1NA 1HKQA 1FT9A 4IHTA 2VOOA 1MJ9A 5HS7A 2VE8A 4RS8A 1ZG3A 2PBIA 2A6EF 2EV5A 4TV7A 3I64A 2VE9A 5LBQA 2V1UA 1IXSB 1YG2A 4U0VA 3F8MA 5ICGA 3FX3A 3KP4A 4RGRA 1IXRC 1SMYF 3IWZA 4LLGF 1B1BA 2MLKA 4M6XA 5DV5A 1F5TA 1R00A 3C18A 1RZ4A 3T8RA 4KYWA 4Y15A 3QP6A 2Z33A 3IKTA 5DCMA 2Y0MA 5E1ZB 3M1EA 2ZBKA 4GYIA 5L3DA 2EFOA 2JTVA 1LJ9A 4HV6A 4N9HA 1FYLA 1FSHA 2QENA 4YIIA 5F1RA 5DUIA 4CICA 3NRVA 1U5TC 2JPBA 3ROUA 5D5WB 4M74A 4MQVA 1G6NA 1UCRA 1HSJA 3RTRA 4EJVA 1D8JA 1JHHA 3HOTA 1AOYA 4KDPA 2OD5A 4MNUA 4KN4X 2DAOA 2ADUA 4R79A 1FBQA 3B02A 4CGZA 2W25A 2L02A 4KNYA 5LEJA 2PEXA 1AWCA 3MQ0A 2RV8A 2FSWA 3ZQ7A 1IUYA 4WWCA 3JAMK 1WQ2A 1QQIA 3RYPA 3WODF 4GCVA 5D5XB 4O3MA 2H27A 2ZXJA 4Y13A 3LA3A 1FOKA 2BV6A 2DT5A 2W24A 2R7FA 3E5QA 1BJAA 5E18F 3SFZA 4ZYDA 2DO7A 1TLHB 1I5ZA 5HVQC 3EYYA 4HYEA 1R22A 3L2CA 2VC0A 3CUQB 3ML6A 2K86A 2OZ6A 3DQVC 1USTA 1XD7A 1W7PA 4KMUX 3TDUC 3QRFF 3V4GA 2VBZA 1QZZA 4HX7A 3E5XA 2XAFA 3KEOA 3GLXA 1SD6A 1U6GA 2COMA 1XCVA 2MA3A 3IRRA 3ABUA 2YSRA 2FNPA 4XBFA 4WX9A 2AS5F 5IT3A 5ERIA 2FA5A 2HKOA 3ELKA 1XSVA 1Z05A 2KJCA 2KIUA 4GXOA 1BIBA 1J75A 3R61A 1R1VA 5CLSA 1YW9A 2DLLA 3TKYA 2V1DA 5HS9A 1U2WA 1EH7A 2ISZA 1ZLJA 5HOOA 1YFHA 1Z6TA 4UV8A 3BY6A 4HZFA 3TDZC 5F64A 2PJPA 2W85A 5DEQA 1CGPA 4G7HF 4G8XA 5A2QK 1I27A 3GVAA 4M9ZA 1SMTA 4LMYA 4E70A 1FPQA 3K2ZA 1Z9CA 2VT2A 4IRHA 2STWA 1FBUA 4ZZLA 4R1HA 4RGSA 2IP2A 2D1HA 3HTUA 5HDKA 2BBYA 3ZN0A 1WWXA 3ZMZA 2DTRA 3ZMUA 5A2QZ 1YYVA 1OKRA 3F22A 2Q8KA 1Q1HA 4HX8A 5BS6A 3GWZA 2HYGD 1T39A 1XSDA 3TOAA 4EGYA 2K7LA 4RB2C 2GAUA 1F4KA 2ZKZA 1TQMA 2KIFA 3OV8A 1ZG5A 2VBXA 1RIOH 5JVTA 3LQRA 4I7HA 2RKHA 2P6SA 5CVIA 2F2EA 3IHUA 2Y48A 4XLPF 4EGZA 1O3QA 4ENMA 3BDDA 3R60A 3BPXA 1RNLA 1XB4A 3BPVA 5D8LB 1XMKA 2HEOA 3SHFA 4ENKA 3JSOA 1ZHFA 3IKVA 4A0YA 3V7CA 3HSRA 3TO9A 1XN7A 3Q5FA 2LSOA 2P5LC 4BNCA 4WCGA 5ILUA 3E6DA 2L01A 1SD7A 4BQAA 4G9YA 2Q0OA 4ASNA 4ESBA 4S04A 4PDKA 3EYIA 2FBKA 2Z9OA 2GA2A 2TDXA 5BPDA 1X3UA 3GZ5A 1FP1D 3ZMSA 5DDGA 5BQTA 5K5RA 3QP5A 4UXNA 2ZMEA 1XGNA 3HSFA 2GA1A 1ZGAA 3NQOA 1R23A 3HUGA 3I5UA 4KIFA 2HQRA 5E17F 4HDVA 2KJBA 4PZJA 4HLYA 1DPUA 1W5SA 2UXNA 2ISYA 3HIFA 4GYGA 5FD6A 3DKWA 1C0WA 1REPC 1KA8A 5DCMB 3NEUA 2OU2A 4HF0A 4P55A 1K78B 3EUHA 5ILVA 3BOQA 2F5EA 2FRHA 4RGUA 1E2XA 2HZTA 3PQKA 4ENJA 5LGTA 1P6RA 3HRSA 4Q48A 1R5GA 3V7RA 1YW8A 1ZREA 3S2WA 5FD5A 3T8TA 4MHGA 3HRTA 1W5TA 4YG2F 1HW1A 1H0MA 1L3LA 3WTZA 5LGUA 1BI3A 2M5WA 2O61A 1D3YA 1NHAA 3FXUA 1R36A 4KUMA 3I0TA 3MZHA 3L9FA 4N0BA 1GXQA 1SD4A 4EJUA 3N4MA 2XHKA 3E97A 2QBYB 1W4MA 5CVJA 3GX4X 3BWGA 4U88A 2A6HF 2QM3A 3EDPA 4A5MA 3LSTA 1IN5A 3VEPA 3RJPA 3HRMA 3C1DA 3WTXC 1MDMB 2HDCA 4HF2A 4EM0B 4I98B 4EJOA 3U9GA 4ENNA 2EFPA 4IHSA 2DQRA 2E7WA 2VBWA 4KFCA 4RAZA 2CG4A 2X4HA 4GO1A 2DFIA 2L4AA 1HKSA 1LEAA 4RGXA 1ZYRF 3PQJA 3MAJA 2O03A 4M72A 2M1BA 1G4DA 1DDNA 3WTTC 5ICCA 2L54A 1G3WA 1FC3A 3T0YA 3KCCA 3ZN1A 2OQRA 3QOPA 2EFQA 2VOPA 5KVRA 1ZH5A 1FWZA 3J80K 2XROA 1O7FA 1W7PD 2XV4S 4OINF 5L3EA 5CVVA 4OIRF 1XGOA 4NHJA 2XGXA 2H6CA 2XAGA 1SD5A 1OR7A 4L5IA 1XGSA 1IN6A 2IRFG 3R4KA 3JTHA 1K7AA 1GHCA 2VXZA 3H3ZA 3I71A 2PFBA 2JPCA 3MEXA 1DUXC 4EMSA 3JTGA 4FHTA 3GXOA 3ABTA 1O57A 2EV6A 1JGSA 1ZLKA 3KETA 3WGHA 3V8JA 3RKWA 2AXLA 3FXRA 2O6GE 1FP2A 3T5XA 3TOBA 2QVOA 1UHMA 3K0LA 2FQ3A 1LDDA 2K02A 1KU3A 2UXXA 2QYOA 1WI9A 3GZ6A 4KIBA 2V79A 1Z6RA 3GFJA 3I53A 3F8CA 2H09A 5F6FA 5IT9Z 4LG0A 3SXYA 3P9CA 5D4RA 3QPHA 3EETA 5JR3A 3FWEA 3I54A 3IRQA 1TW2A 1I6XA 3GO5A 2XVCA 5H20A 1KYWA 3VOEA 5E1WA 1S7AA 5HLHA 2Y75A 5LRSA 5D6FA 5AIPA 4NB5A 3TGNA 1KU9A 1S29A 4A6DA 3LWFA 2DPDA 3CO7C 5BPIA 2X0LA 2C6YA 1P4WA 1SAXA 1ZG1A 5ICFA 2ZNZA 1MKMA 4L0YB 2DW4A 1KYZA 1USSA 4WF2A 5JI6A 2VODA 4KIGA 2K4JA 3P9KA 2MD5A 1FLIA 2DBBA 4P9UA 3CJNA 4KICA 4RAYA 3GEZA 5HS8A 1GXPA 2YX7A 3DPTA 3DEUA 1XDUA 2Q2EA 1U5TA 4Q47A 5FB2A 2ZFWA 2W57A 4EM1A 1YS6A 3H92A 4EQQA 3U1DA 4HA8A 1ON1A 3AAFA 2FE3A 2O8XA 2XUBA 4JBAA 3MZYA 2DI3A 4ZYHA 1J5YA 1WKMA 4YFKF 2BE5F 2JT1A 3FMRA 3K1MA 3F8NA 3GYHX 5D5VB 2DPUA 2FU4A 3FM5A 2JSCA 3W6JB 2CSOA 4HF1A 2CGPA 2FBIA 2A68F 1BN5A 3GUDA 4ZZDA 3LFKA 1LQ1A 1LEBA 3DPLC 3K69A 4IPAA 2ZCWA 1O3TA 2CW0F 2CWEA 3GFMA 4ZYEA 2BGCA 4A6EA 1IN7A 3E3VA 2RNJA 1CF7A 5LHGA 1IRFA 4WXCA 4Z2YA 1O7LA 4HLXA 2O3FA 3Q9VA 1IN8A 3BJAA 4G6DA 2F5CA 3GF2A 5K5QA 4EJTA 4XRFA 2LDUA 5BMZA 5HLGA 4UVAA 2IW5A 5FLXK 5E1XA 1U3EM 1V3FA 5HDNA 2DK5A 4UNOA 2LF8A 4PGGA 1YO5C 2DK8A 2Z5UA 1KU7A 3R0JA 1LDJA 4A2UA 1PP8F 5LLQA 4FT8A 2YPRA 1OMIA 4EM2A 1EH6A 4KT5C 2GXGA 1KQ8A 2P4WA 5EEGA 1U78A 4S05A 5D6EA 4LB6B 5E8IA 2EFWA 3P7NA 3J80Z 4I0AA 5HDGA 3V7SA 3EQLF 3KP2A 5D5UB 3SQNA 2RC4A 5LRRA 2KRFA 3RDIA 1BC8C 1XDSA 2HTJA 3GFIA 2HFHA 4UUVA 3ULQB 4BH9A 3DXJF 3D5LA 5DUKA 4CZZA 5L3CA 4LB5A 1TNTA 1J0RA 3TQNA 3LAJA 3HSEA 4I02A 1YIOA 1I1SA 1VTNC 5IT9K 1LVAA 4OOIA 1YS7A 1HSTA 3FMQA 2XAHA 2V6CA 4ESJA 2LNBA 2P7VB 2A07F 4A0XA 2KKOA 4IRIA 3GW2A 4A12A 3F21A 1UFMA 2D1VA 1MZBA 3HYIA 5LHIA 4AWXB 1EH8A 1B4AA 4XLNF 4CDGA 3K1PA 3O6BB 4G7OF 3CUQC 5CJ9A 4L18B 3I59A 1T38A 4GGGA 2HQNA 1R7JA 1EV7A 3JSPA 3WGGA 3ECOA 3WGIA 1T6SA 5L3FA 1MJAA 1BI0A 1PUEE 4G94A 4HQMA 3R6SA 1P4XA 3N97A 3B73A 3TO6A 4F7ZA 5D8KB 5ILSA 2PMUA 4WK8F 1UHWA 3I4PA 2MLGA 3KZYA 4JQFA 1GVJA 2IA2A 1FZPB 4LFUA 2D45A 1QBJA 1J59A 3ERED 2M30A 1FBSA 2B0LA 1L0OC 4ON0A 1XCBA 1TW3A 4RB0A 2W84A 4BHCA 3MCZA 1P4AA 2NAZA 1FX7A 1MJBA 1BC7C 2GXBA 2XAJA 3E6MA 2ACJA 4M73A 4IXAA 2OBPA 1RUOA 1KGSA 3T1BA 1G3YA 2V9VA 2Z3YA 5H6QA 4EV0A 4CHUA 3VB2A 5FFXA 4G6QA 3F8FA 3RYRA 3LA2A 2H94A 4N9IA 1BI2A 2E7XA 4D0PA 2EA4A 3IL2A 2EA2A 5AIQA 5K1YA 4DNCA 3PFIA 2XIGA 2PLYA 4K2EA 4RB3C 1LB2A 3LAPA 4U7BA 2P7CB 3ZP5A 1S7OA 2XAQA 3FXQA 5ICEA 3RI4A 4IF4A 1T2KA 2P5KA 2OZUA 4Q5SF 1ZAOA 2WC2A 2XKPA 2M87A 1XMAA 4CYDA 3BROA 5FO5A 4P5OA 2G7UA 4IVNA 3RIRA 4I0BA 1OYIA 1LDKB 4IRGA 3IWFA 5CYVA 4AIHA 2GIVA 3F8BA 3C7JA 4WXDA 2EB7A 5KK1A 1Z91A 2NS0A 3DF8A 1IF1A 3ZMTA 4PCQA 3RPUA 4O6JA 3RKXA 2D2WA 2O0YA 4A0ZA 3WTYC 5EEHA 4MEYF 1FYMA 4L9JA 4G7ZF 2F5FA 2HOEA 4CXFA 4OIPF 3F6OA 2R7DA 1S8NA 5J8FA 1H9TA 2P8TA 2QLZA 1RI7A 4LD5A 4QLCU 1J2XA 2HKXA 4KA4A 2DU9A 4MGRA 2F5DA 2PQ8A 4HW0A 3KP3A 5H6RA 1MGTA 2PG4A 2QQ9A 2FEZA 1B9NA 3QU6A 1HKTA 1YLFA 3WE3A 3CDHA 2RN7A 4EJWA 4ETSA 3LA7A 2OAZA 1OPCA 2G9WA 2FF4A 4L9TA 1TTYA 4LLLA 3DP7A 3BP8A 4O5VA 1UB9A 5LHHA 4AIJA 3F72A 1BI1A 2FMYA 1PP7U 2MH9A 3WU0A 3SZPA 2QWWA 2EK5A 4CO8A 1YW7A 2PI0A 4BHPA 4M9SA 2NNYA 3KP6A 3ZMVA 2K4BA 4YIFA 2ZMEB 2V1XA 1V4RA 4XSXF 1F9NA 2BEOA 4U7DA 4L0ZB 1G3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBH A;  3KE2 A;  1I1G A;  3BJO A;  4L9V A;  2EWN A;  4ZH4 F;  1WSU A;  4B8X A;  2P5V A;  3I59 B;  4MTD A;  3HHG A;  3KP7 A;  3CUQ A;  5FLX Z;  1DP7 P;  2RGV A;  2ESH A;  5DYM A;  3LQQ A;  1FSE A;  4P96 A;  4OU0 A;  4M71 A;  4XSZ F;  5CVU A;  1KQ0 A;  2RDP A;  3QAH A;  3O3K A;  3FM3 A;  2KIM A;  1IXC A;  5LEK A;  1K78 A;  3MWM A;  1B59 A;  4HX4 A;  2GQQ A;  2FML A;  2UZK A;  4YFN F;  2QQA A;  3HHH A;  1FY7 A;  4ESF A;  1ZRC A;  2UWM A;  1IAW A;  3V8K A;  4DQ2 A;  3DFG A;  1TQI A;  3M8E A;  2EJR A;  1BIA A;  3WTS C;  3RKY A;  1K6O A;  1O3R A;  3CLO A;  4BHB A;  5FFZ A;  5L3B A;  4BYY A;  1SFX A;  5LGN A;  4LJZ F;  2EFN A;  3TO7 A;  3CTA A;  5ED4 A;  1HW5 A;  3RPQ A;  6PAX A;  3P9I A;  3KLO A;  4B09 A;  3F6V A;  2A61 A;  5L3G A;  4UVC A;  2DQL A;  3M8F A;  3E5U A;  1H9G A;  4WXH A;  4OMY A;  4MEX F;  4KN7 X;  2FOK A;  2FXA A;  3W6K B;  3WTV C;  1SFU A;  4I2O A;  4JK1 X;  1FNN A;  4H0E A;  4A5N A;  1J7K A;  4BAY A;  4ZYG A;  3J81 K;  4Q4Z F;  1HQC A;  5CVR A;  2M8E A;  1MDM A;  3KFW X;  2MBF A;  1E17 A;  2HYF A;  2XKO A;  3G3Z A;  5E20 A;  1U5T B;  5D4S A;  2CFX A;  1SFE A;  1QPM A;  4EVI A;  4U0Y A;  2J5O A;  4FX0 A;  2GZW A;  1ZRD A;  3KLN A;  2PMH A;  1K79 A;  4HV5 A;  1Z7U A;  1KQ9 A;  2HGC A;  4MTE A;  4LLN A;  2IJL A;  2VON A;  1CF7 B;  3QU3 A;  2LKP A;  1Z1D A;  2STT A;  1JXS A;  2A69 F;  4HBL A;  1R58 A;  3FZV A;  4I01 A;  1R1T A;  4I09 A;  2XRN A;  5TJJ A;  5AON A;  2NNN A;  3I58 A;  1ZN2 A;  1U8R A;  4OMZ A;  1XGM A;  1QZY A;  1ONV A;  1XSX A;  4UV9 A;  5JHU A;  2L3D A;  3HRU A;  4HDU A;  2NRA C;  3FHZ A;  1TNS A;  2G7H A;  4UHT A;  3F23 A;  4M6Y A;  4LGW A;  5E8G A;  5TRD A;  4LG0 B;  1P2F A;  1T0F A;  2A5Y B;  3F3X A;  2QUF A;  3BZ6 A;  1OYY A;  3ZPL A;  3U2R A;  2JRT A;  2A3S A;  4IJA A;  4OIO F;  3D0S A;  1ODD A;  2P6T A;  1J9I A;  2IVM A;  2WTE A;  2RQP A;  3HOS A;  2QZ8 A;  3REO A;  1BM9 A;  3ISP A;  1WRJ A;  3H3U A;  2Z99 A;  1A04 A;  2GWR A;  1JE8 A;  3WTU C;  1Y0U A;  5K5O A;  5DD8 A;  5DD4 A;  2HS5 A;  4MQ9 F;  2BYV E;  2OQG A;  1W7P B;  1QO0 D;  3COA C;  1FYK A;  3L7W A;  2ETH A;  4LK1 F;  3L09 A;  1HBX G;  1IN4 A;  1PDN C;  1QNT A;  1STZ A;  1G3S A;  2MC3 A;  3KEQ A;  3L00 A;  3JW4 A;  2YU3 A;  3OOP A;  1KU2 A;  4BXU A;  1D5V A;  2K27 A;  4OIQ F;  2YR2 A;  4HQE A;  4L5J A;  1BBY A;  4R8H A;  1HXD A;  1ZAR A;  4YFX F;  1RUN A;  2QQB A;  1T98 A;  1TQP A;  2ESN A;  1OYW A;  5J8C A;  1LNW A;  4U0W A;  3SZT A;  1ZGJ A;  3BJ6 A;  3CUO A;  5BOX A;  3CO6 C;  5JFR A;  3JAM Z;  2IA1 A;  4LK0 F;  4AD9 A;  1B6A A;  2J5P A;  3J7A O;  4M9X A;  5HLI A;  1D8K A;  5DCF A;  2R3S A;  2H6B A;  1O3S A;  3IC7 A;  1R1U A;  3E6B A;  2EV0 A;  3HTS B;  3C3W A;  3QPT A;  2ZJ2 A;  4HOB A;  3ZMD A;  2ZNY A;  3M9A A;  3O2P E;  2XAS A;  2RVC A;  3KP5 A;  2L4M A;  2ELH A;  2LF7 A;  2VBY A;  3GFL A;  4RB1 A;  1B9M A;  1YTY A;  4NQW A;  1IRG A;  3VFZ A;  3WE2 A;  3V8L A;  1ULY A;  2E1N A;  3WTW C;  3J81 Z;  3E6C C;  1IW7 F;  3ECH A;  3K9T A;  4UVB A;  2MH2 A;  2YX4 A;  3WU1 B;  2VN2 A;  4KMF A;  4HAM A;  4QWQ A;  2IPQ X;  3R0A A;  3KZZ A;  4P9F A;  2E1C A;  3FMS A;  1IZ1 A;  2HTS A;  2M45 A;  3DV8 A;  4PGH A;  4L9N A;  4Y17 A;  2CO5 A;  4AVP A;  2PN6 A;  2CQK A;  1S6L A;  2IA0 A;  1BOA A;  1P92 A;  4FX4 A;  1YQA A;  1ZRF A;  5FGM A;  1TBX A;  1MD0 A;  2HWV A;  3WG9 A;  3G73 A;  2ZO4 A;  2HR3 A;  1S3J A;  3FF5 A;  1DPR A;  1QGP A;  2WV0 A;  2VT3 A;  1HW2 A;  3MFK A;  1ON2 A;  2JZY A;  2NYX A;  3Q9S A;  4AIK A;  2OA4 A;  2FNA A;  3VOD A;  1JHF A;  5J6X A;  3M7G A;  2IT0 A;  2VC1 A;  2WWY A;  2QBY A;  1F1Z A;  1R5H A;  2CYY A;  3K1N A;  1HKQ A;  1FT9 A;  4IHT A;  2VOO A;  1MJ9 A;  5HS7 A;  2VE8 A;  4RS8 A;  1ZG3 A;  2PBI A;  2A6E F;  2EV5 A;  4TV7 A;  3I64 A;  2VE9 A;  5LBQ A;  2V1U A;  1IXS B;  1YG2 A;  4U0V A;  3F8M A;  5ICG A;  3FX3 A;  3KP4 A;  4RGR A;  1IXR C;  1SMY F;  3IWZ A;  4LLG F;  1B1B A;  2MLK A;  4M6X A;  5DV5 A;  1F5T A;  1R00 A;  3C18 A;  1RZ4 A;  3T8R A;  4KYW A;  4Y15 A;  3QP6 A;  2Z33 A;  3IKT A;  5DCM A;  2Y0M A;  5E1Z B;  3M1E A;  2ZBK A;  4GYI A;  5L3D A;  2EFO A;  2JTV A;  1LJ9 A;  4HV6 A;  4N9H A;  1FYL A;  1FSH A;  2QEN A;  4YII A;  5F1R A;  5DUI A;  4CIC A;  3NRV A;  1U5T C;  2JPB A;  3ROU A;  5D5W B;  4M74 A;  4MQV A;  1G6N A;  1UCR A;  1HSJ A;  3RTR A;  4EJV A;  1D8J A;  1JHH A;  3HOT A;  1AOY A;  4KDP A;  2OD5 A;  4MNU A;  4KN4 X;  2DAO A;  2ADU A;  4R79 A;  1FBQ A;  3B02 A;  4CGZ A;  2W25 A;  2L02 A;  4KNY A;  5LEJ A;  2PEX A;  1AWC A;  3MQ0 A;  2RV8 A;  2FSW A;  3ZQ7 A;  1IUY A;  4WWC A;  3JAM K;  1WQ2 A;  1QQI A;  3RYP A;  3WOD F;  4GCV A;  5D5X B;  4O3M A;  2H27 A;  2ZXJ A;  4Y13 A;  3LA3 A;  1FOK A;  2BV6 A;  2DT5 A;  2W24 A;  2R7F A;  3E5Q A;  1BJA A;  5E18 F;  3SFZ A;  4ZYD A;  2DO7 A;  1TLH B;  1I5Z A;  5HVQ C;  3EYY A;  4HYE A;  1R22 A;  3L2C A;  2VC0 A;  3CUQ B;  3ML6 A;  2K86 A;  2OZ6 A;  3DQV C;  1UST A;  1XD7 A;  1W7P A;  4KMU X;  3TDU C;  3QRF F;  3V4G A;  2VBZ A;  1QZZ A;  4HX7 A;  3E5X A;  2XAF A;  3KEO A;  3GLX A;  1SD6 A;  1U6G A;  2COM A;  1XCV A;  2MA3 A;  3IRR A;  3ABU A;  2YSR A;  2FNP A;  4XBF A;  4WX9 A;  2AS5 F;  5IT3 A;  5ERI A;  2FA5 A;  2HKO A;  3ELK A;  1XSV A;  1Z05 A;  2KJC A;  2KIU A;  4GXO A;  1BIB A;  1J75 A;  3R61 A;  1R1V A;  5CLS A;  1YW9 A;  2DLL A;  3TKY A;  2V1D A;  5HS9 A;  1U2W A;  1EH7 A;  2ISZ A;  1ZLJ A;  5HOO A;  1YFH A;  1Z6T A;  4UV8 A;  3BY6 A;  4HZF A;  3TDZ C;  5F64 A;  2PJP A;  2W85 A;  5DEQ A;  1CGP A;  4G7H F;  4G8X A;  5A2Q K;  1I27 A;  3GVA A;  4M9Z A;  1SMT A;  4LMY A;  4E70 A;  1FPQ A;  3K2Z A;  1Z9C A;  2VT2 A;  4IRH A;  2STW A;  1FBU A;  4ZZL A;  4R1H A;  4RGS A;  2IP2 A;  2D1H A;  3HTU A;  5HDK A;  2BBY A;  3ZN0 A;  1WWX A;  3ZMZ A;  2DTR A;  3ZMU A;  5A2Q Z;  1YYV A;  1OKR A;  3F22 A;  2Q8K A;  1Q1H A;  4HX8 A;  5BS6 A;  3GWZ A;  2HYG D;  1T39 A;  1XSD A;  3TOA A;  4EGY A;  2K7L A;  4RB2 C;  2GAU A;  1F4K A;  2ZKZ A;  1TQM A;  2KIF A;  3OV8 A;  1ZG5 A;  2VBX A;  1RIO H;  5JVT A;  3LQR A;  4I7H A;  2RKH A;  2P6S A;  5CVI A;  2F2E A;  3IHU A;  2Y48 A;  4XLP F;  4EGZ A;  1O3Q A;  4ENM A;  3BDD A;  3R60 A;  3BPX A;  1RNL A;  1XB4 A;  3BPV A;  5D8L B;  1XMK A;  2HEO A;  3SHF A;  4ENK A;  3JSO A;  1ZHF A;  3IKV A;  4A0Y A;  3V7C A;  3HSR A;  3TO9 A;  1XN7 A;  3Q5F A;  2LSO A;  2P5L C;  4BNC A;  4WCG A;  5ILU A;  3E6D A;  2L01 A;  1SD7 A;  4BQA A;  4G9Y A;  2Q0O A;  4ASN A;  4ESB A;  4S04 A;  4PDK A;  3EYI A;  2FBK A;  2Z9O A;  2GA2 A;  2TDX A;  5BPD A;  1X3U A;  3GZ5 A;  1FP1 D;  3ZMS A;  5DDG A;  5BQT A;  5K5R A;  3QP5 A;  4UXN A;  2ZME A;  1XGN A;  3HSF A;  2GA1 A;  1ZGA A;  3NQO A;  1R23 A;  3HUG A;  3I5U A;  4KIF A;  2HQR A;  5E17 F;  4HDV A;  2KJB A;  4PZJ A;  4HLY A;  1DPU A;  1W5S A;  2UXN A;  2ISY A;  3HIF A;  4GYG A;  5FD6 A;  3DKW A;  1C0W A;  1REP C;  1KA8 A;  5DCM B;  3NEU A;  2OU2 A;  4HF0 A;  4P55 A;  1K78 B;  3EUH A;  5ILV A;  3BOQ A;  2F5E A;  2FRH A;  4RGU A;  1E2X A;  2HZT A;  3PQK A;  4ENJ A;  5LGT A;  1P6R A;  3HRS A;  4Q48 A;  1R5G A;  3V7R A;  1YW8 A;  1ZRE A;  3S2W A;  5FD5 A;  3T8T A;  4MHG A;  3HRT A;  1W5T A;  4YG2 F;  1HW1 A;  1H0M A;  1L3L A;  3WTZ A;  5LGU A;  1BI3 A;  2M5W A;  2O61 A;  1D3Y A;  1NHA A;  3FXU A;  1R36 A;  4KUM A;  3I0T A;  3MZH A;  3L9F A;  4N0B A;  1GXQ A;  1SD4 A;  4EJU A;  3N4M A;  2XHK A;  3E97 A;  2QBY B;  1W4M A;  5CVJ A;  3GX4 X;  3BWG A;  4U88 A;  2A6H F;  2QM3 A;  3EDP A;  4A5M A;  3LST A;  1IN5 A;  3VEP A;  3RJP A;  3HRM A;  3C1D A;  3WTX C;  1MDM B;  2HDC A;  4HF2 A;  4EM0 B;  4I98 B;  4EJO A;  3U9G A;  4ENN A;  2EFP A;  4IHS A;  2DQR A;  2E7W A;  2VBW A;  4KFC A;  4RAZ A;  2CG4 A;  2X4H A;  4GO1 A;  2DFI A;  2L4A A;  1HKS A;  1LEA A;  4RGX A;  1ZYR F;  3PQJ A;  3MAJ A;  2O03 A;  4M72 A;  2M1B A;  1G4D A;  1DDN A;  3WTT C;  5ICC A;  2L54 A;  1G3W A;  1FC3 A;  3T0Y A;  3KCC A;  3ZN1 A;  2OQR A;  3QOP A;  2EFQ A;  2VOP A;  5KVR A;  1ZH5 A;  1FWZ A;  3J80 K;  2XRO A;  1O7F A;  1W7P D;  2XV4 S;  4OIN F;  5L3E A;  5CVV A;  4OIR F;  1XGO A;  4NHJ A;  2XGX A;  2H6C A;  2XAG A;  1SD5 A;  1OR7 A;  4L5I A;  1XGS A;  1IN6 A;  2IRF G;  3R4K A;  3JTH A;  1K7A A;  1GHC A;  2VXZ A;  3H3Z A;  3I71 A;  2PFB A;  2JPC A;  3MEX A;  1DUX C;  4EMS A;  3JTG A;  4FHT A;  3GXO A;  3ABT A;  1O57 A;  2EV6 A;  1JGS A;  1ZLK A;  3KET A;  3WGH A;  3V8J A;  3RKW A;  2AXL A;  3FXR A;  2O6G E;  1FP2 A;  3T5X A;  3TOB A;  2QVO A;  1UHM A;  3K0L A;  2FQ3 A;  1LDD A;  2K02 A;  1KU3 A;  2UXX A;  2QYO A;  1WI9 A;  3GZ6 A;  4KIB A;  2V79 A;  1Z6R A;  3GFJ A;  3I53 A;  3F8C A;  2H09 A;  5F6F A;  5IT9 Z;  4LG0 A;  3SXY A;  3P9C A;  5D4R A;  3QPH A;  3EET A;  5JR3 A;  3FWE A;  3I54 A;  3IRQ A;  1TW2 A;  1I6X A;  3GO5 A;  2XVC A;  5H20 A;  1KYW A;  3VOE A;  5E1W A;  1S7A A;  5HLH A;  2Y75 A;  5LRS A;  5D6F A;  5AIP A;  4NB5 A;  3TGN A;  1KU9 A;  1S29 A;  4A6D A;  3LWF A;  2DPD A;  3CO7 C;  5BPI A;  2X0L A;  2C6Y A;  1P4W A;  1SAX A;  1ZG1 A;  5ICF A;  2ZNZ A;  1MKM A;  4L0Y B;  2DW4 A;  1KYZ A;  1USS A;  4WF2 A;  5JI6 A;  2VOD A;  4KIG A;  2K4J A;  3P9K A;  2MD5 A;  1FLI A;  2DBB A;  4P9U A;  3CJN A;  4KIC A;  4RAY A;  3GEZ A;  5HS8 A;  1GXP A;  2YX7 A;  3DPT A;  3DEU A;  1XDU A;  2Q2E A;  1U5T A;  4Q47 A;  5FB2 A;  2ZFW A;  2W57 A;  4EM1 A;  1YS6 A;  3H92 A;  4EQQ A;  3U1D A;  4HA8 A;  1ON1 A;  3AAF A;  2FE3 A;  2O8X A;  2XUB A;  4JBA A;  3MZY A;  2DI3 A;  4ZYH A;  1J5Y A;  1WKM A;  4YFK F;  2BE5 F;  2JT1 A;  3FMR A;  3K1M A;  3F8N A;  3GYH X;  5D5V B;  2DPU A;  2FU4 A;  3FM5 A;  2JSC A;  3W6J B;  2CSO A;  4HF1 A;  2CGP A;  2FBI A;  2A68 F;  1BN5 A;  3GUD A;  4ZZD A;  3LFK A;  1LQ1 A;  1LEB A;  3DPL C;  3K69 A;  4IPA A;  2ZCW A;  1O3T A;  2CW0 F;  2CWE A;  3GFM A;  4ZYE A;  2BGC A;  4A6E A;  1IN7 A;  3E3V A;  2RNJ A;  1CF7 A;  5LHG A;  1IRF A;  4WXC A;  4Z2Y A;  1O7L A;  4HLX A;  2O3F A;  3Q9V A;  1IN8 A;  3BJA A;  4G6D A;  2F5C A;  3GF2 A;  5K5Q A;  4EJT A;  4XRF A;  2LDU A;  5BMZ A;  5HLG A;  4UVA A;  2IW5 A;  5FLX K;  5E1X A;  1U3E M;  1V3F A;  5HDN A;  2DK5 A;  4UNO A;  2LF8 A;  4PGG A;  1YO5 C;  2DK8 A;  2Z5U A;  1KU7 A;  3R0J A;  1LDJ A;  4A2U A;  1PP8 F;  5LLQ A;  4FT8 A;  2YPR A;  1OMI A;  4EM2 A;  1EH6 A;  4KT5 C;  2GXG A;  1KQ8 A;  2P4W A;  5EEG A;  1U78 A;  4S05 A;  5D6E A;  4LB6 B;  5E8I A;  2EFW A;  3P7N A;  3J80 Z;  4I0A A;  5HDG A;  3V7S A;  3EQL F;  3KP2 A;  5D5U B;  3SQN A;  2RC4 A;  5LRR A;  2KRF A;  3RDI A;  1BC8 C;  1XDS A;  2HTJ A;  3GFI A;  2HFH A;  4UUV A;  3ULQ B;  4BH9 A;  3DXJ F;  3D5L A;  5DUK A;  4CZZ A;  5L3C A;  4LB5 A;  1TNT A;  1J0R A;  3TQN A;  3LAJ A;  3HSE A;  4I02 A;  1YIO A;  1I1S A;  1VTN C;  5IT9 K;  1LVA A;  4OOI A;  1YS7 A;  1HST A;  3FMQ A;  2XAH A;  2V6C A;  4ESJ A;  2LNB A;  2P7V B;  2A07 F;  4A0X A;  2KKO A;  4IRI A;  3GW2 A;  4A12 A;  3F21 A;  1UFM A;  2D1V A;  1MZB A;  3HYI A;  5LHI A;  4AWX B;  1EH8 A;  1B4A A;  4XLN F;  4CDG A;  3K1P A;  3O6B B;  4G7O F;  3CUQ C;  5CJ9 A;  4L18 B;  3I59 A;  1T38 A;  4GGG A;  2HQN A;  1R7J A;  1EV7 A;  3JSP A;  3WGG A;  3ECO A;  3WGI A;  1T6S A;  5L3F A;  1MJA A;  1BI0 A;  1PUE E;  4G94 A;  4HQM A;  3R6S A;  1P4X A;  3N97 A;  3B73 A;  3TO6 A;  4F7Z A;  5D8K B;  5ILS A;  2PMU A;  4WK8 F;  1UHW A;  3I4P A;  2MLG A;  3KZY A;  4JQF A;  1GVJ A;  2IA2 A;  1FZP B;  4LFU A;  2D45 A;  1QBJ A;  1J59 A;  3ERE D;  2M30 A;  1FBS A;  2B0L A;  1L0O C;  4ON0 A;  1XCB A;  1TW3 A;  4RB0 A;  2W84 A;  4BHC A;  3MCZ A;  1P4A A;  2NAZ A;  1FX7 A;  1MJB A;  1BC7 C;  2GXB A;  2XAJ A;  3E6M A;  2ACJ A;  4M73 A;  4IXA A;  2OBP A;  1RUO A;  1KGS A;  3T1B A;  1G3Y A;  2V9V A;  2Z3Y A;  5H6Q A;  4EV0 A;  4CHU A;  3VB2 A;  5FFX A;  4G6Q A;  3F8F A;  3RYR A;  3LA2 A;  2H94 A;  4N9I A;  1BI2 A;  2E7X A;  4D0P A;  2EA4 A;  3IL2 A;  2EA2 A;  5AIQ A;  5K1Y A;  4DNC A;  3PFI A;  2XIG A;  2PLY A;  4K2E A;  4RB3 C;  1LB2 A;  3LAP A;  4U7B A;  2P7C B;  3ZP5 A;  1S7O A;  2XAQ A;  3FXQ A;  5ICE A;  3RI4 A;  4IF4 A;  1T2K A;  2P5K A;  2OZU A;  4Q5S F;  1ZAO A;  2WC2 A;  2XKP A;  2M87 A;  1XMA A;  4CYD A;  3BRO A;  5FO5 A;  4P5O A;  2G7U A;  4IVN A;  3RIR A;  4I0B A;  1OYI A;  1LDK B;  4IRG A;  3IWF A;  5CYV A;  4AIH A;  2GIV A;  3F8B A;  3C7J A;  4WXD A;  2EB7 A;  5KK1 A;  1Z91 A;  2NS0 A;  3DF8 A;  1IF1 A;  3ZMT A;  4PCQ A;  3RPU A;  4O6J A;  3RKX A;  2D2W A;  2O0Y A;  4A0Z A;  3WTY C;  5EEH A;  4MEY F;  1FYM A;  4L9J A;  4G7Z F;  2F5F A;  2HOE A;  4CXF A;  4OIP F;  3F6O A;  2R7D A;  1S8N A;  5J8F A;  1H9T A;  2P8T A;  2QLZ A;  1RI7 A;  4LD5 A;  4QLC U;  1J2X A;  2HKX A;  4KA4 A;  2DU9 A;  4MGR A;  2F5D A;  2PQ8 A;  4HW0 A;  3KP3 A;  5H6R A;  1MGT A;  2PG4 A;  2QQ9 A;  2FEZ A;  1B9N A;  3QU6 A;  1HKT A;  1YLF A;  3WE3 A;  3CDH A;  2RN7 A;  4EJW A;  4ETS A;  3LA7 A;  2OAZ A;  1OPC A;  2G9W A;  2FF4 A;  4L9T A;  1TTY A;  4LLL A;  3DP7 A;  3BP8 A;  4O5V A;  1UB9 A;  5LHH A;  4AIJ A;  3F72 A;  1BI1 A;  2FMY A;  1PP7 U;  2MH9 A;  3WU0 A;  3SZP A;  2QWW A;  2EK5 A;  4CO8 A;  1YW7 A;  2PI0 A;  4BHP A;  4M9S A;  2NNY A;  3KP6 A;  3ZMV A;  2K4B A;  4YIF A;  2ZME B;  2V1X A;  1V4R A;  4XSX F;  1F9N A;  2BEO A;  4U7D A;  4L0Z B;  1G3T A; 
#chains in the Genus database with same CATH topology
 1OCC H;  2FBH A;  3BZC A;  3KE2 A;  3PUB A;  4CA0 A;  1ERD A;  1W36 D;  1I1G A;  3BJO A;  4L9V A;  2A05 A;  2EWN A;  2O9L A;  4ZH4 F;  2LOO A;  3BR6 A;  2I8D A;  2FJ1 A;  2XSD C;  1WSU A;  1IG7 A;  3RSN A;  5CQG A;  2DA7 A;  3PO3 J;  4B8X A;  2P5V A;  1YRN B;  3I59 B;  1JJ8 C;  4MTD A;  2R5Z B;  3HHG A;  4A3M J;  3KP7 A;  3CUQ A;  5FLX Z;  1DP7 P;  5EJC A;  1XPX A;  2I10 A;  4I76 A;  2RGV A;  2ESH A;  5DYM A;  3LQQ A;  1FSE A;  4P96 A;  4OU0 A;  3IH3 A;  3FXK A;  3CES A;  1Z3Y A;  3K6G A;  4M71 A;  4XSZ F;  2X6X A;  5CVU A;  3H9G A;  3GTM J;  1KQ0 A;  1HDP A;  1X1P A;  3G1M A;  2RDP A;  3QAH A;  1LKX A;  4KT6 A;  1B8I B;  3O3K A;  3CP2 A;  4W97 A;  3FM3 A;  2ZFU A;  5HOD A;  3BG3 A;  2KIM A;  1IXC A;  2HVQ A;  2KFD A;  5LEK A;  1K78 A;  1N75 A;  1FEX A;  3MMY B;  2ME6 A;  3MWM A;  1B59 A;  4HX4 A;  1OFC X;  2GQQ A;  2FML A;  1Z77 A;  4LG3 A;  3HOU J;  2UZK A;  4YFN F;  2VPL A;  4ZDP A;  4XKC A;  1N25 A;  2QQA A;  3HHH A;  1FY7 A;  4ESF A;  1ZRC A;  4F3Q A;  2UWM A;  4A3C J;  1IAW A;  2LBF B;  3V8K A;  3TW6 A;  4DQ2 A;  3DFG A;  1TQI A;  5CQE A;  2H8W A;  3M8E A;  2EJR A;  1BIA A;  3WTS C;  2FD5 A;  1UHS A;  3D5R C;  3CDL A;  3RKY A;  1K6O A;  1I3A A;  2CQX A;  2CFO A;  4MLO A;  4MFD A;  3UR3 C;  2XC7 A;  1O3R A;  1VQ4 I;  3CLO A;  4XL9 A;  1V5E A;  2EIK H;  4BHB A;  2DJN A;  5FFZ A;  3IAS 2;  4BYY A;  5L3B A;  1SFX A;  4LIV A;  2IS6 A;  4RAG A;  3H5R A;  3CCS I;  3OY9 A;  1ACI A;  2DMQ A;  3BTI A;  2MSY A;  4UB6 C;  5LGN A;  1X1C A;  4LJZ F;  1WH5 A;  4XLH A;  2EFN A;  3CZ6 A;  3TO7 A;  3CTA A;  1F43 A;  5ED4 A;  1HW5 A;  2DOE A;  1V5F A;  4BY1 J;  3RPQ A;  2QGU A;  2DMN A;  4MO7 A;  6PAX A;  4XOP A;  3P9I A;  4BXF A;  1MSE C;  3KLO A;  1D0Y A;  4B09 A;  3F6V A;  2A61 A;  3MZ8 A;  3J7A Y;  1SVL A;  1FOY A;  4UVC A;  5L3G A;  2DQL A;  4XOR A;  2M7A A;  4XLA A;  3M8F A;  3E5U A;  1H9G A;  3PUF A;  4FQG A;  4WXH A;  2JN6 A;  4DYR A;  3BG9 A;  2MGQ A;  2UUZ A;  1QPI A;  4OMY A;  4MEX F;  2E2I J;  4KN7 X;  2FOK A;  3OS1 A;  3JRB A;  3W2A A;  2FXA A;  3W6K B;  3HG9 A;  3WTV C;  4PJJ A;  1A6Q A;  1FJL A;  1SFU A;  1R71 A;  4I2O A;  4JK1 X;  1FNN A;  1MSF C;  1JT0 A;  4A5N A;  3PNV A;  1J7K A;  4BAY A;  4H0E A;  1RC9 A;  2DFH A;  3LSM A;  4ZYG A;  3J81 K;  2R7U A;  1W36 C;  1VQO I;  1MBG A;  2FUG 2;  4Q4Z F;  2OC6 A;  1HQC A;  5CVR A;  2M8E A;  1MDM A;  3AL0 B;  3KFW X;  2MBF A;  3HOV J;  1E17 A;  3ASN H;  3ZQF A;  2HYF A;  2RQQ A;  2XKO A;  3G3Z A;  5E20 A;  1OCZ H;  2KP6 A;  1U5T B;  2Y9Y A;  4B4C A;  5D4S A;  3ZQH A;  2W7N A;  3LSJ A;  2CFX A;  3PM1 A;  1SFE A;  1QPM A;  3NAU A;  2FOW A;  4V2G A;  4EVI A;  4U0Y A;  2J5O A;  1ETW A;  4FX0 A;  3H9J A;  3DPU A;  2GZW A;  2HYJ A;  1ZRD A;  3F9K A;  3KLN A;  2PMH A;  2KIQ A;  2DOD A;  1K79 A;  4PFP A;  1WJ5 A;  4HV5 A;  4B1R A;  3A1Y A;  5EEA A;  1Z7U A;  1A5J A;  2R7X A;  1KQ9 A;  2EH3 A;  2HGC A;  2XPU A;  4MTE A;  4LLN A;  2IJL A;  2VON A;  2KL4 A;  1CF7 B;  3QU3 A;  3M3Y J;  3BR1 A;  2LKP A;  1ETQ A;  2LY9 A;  1T08 B;  1Z1D A;  2STT A;  3PFY A;  1JXS A;  2A69 F;  4HBL A;  4F93 B;  2NVX J;  1R58 A;  3FZV A;  1X2N A;  4I01 A;  4QTR A;  1R1T A;  2M4G A;  2V26 A;  1RKT A;  4I09 A;  2XRN A;  1APL C;  5TJJ A;  4CCO A;  4BGD A;  5AON A;  2NNN A;  3BCA A;  5F04 A;  3I58 A;  2H1K A;  1KON A;  1Z67 A;  2CQN A;  1ZN2 A;  1U8R A;  4OMZ A;  4XKW A;  1XGM A;  2BY1 A;  5FKK A;  1QZY A;  1ONV A;  1XSX A;  4UV9 A;  5JHU A;  2L3D A;  3HRU A;  3SDG A;  2YS9 A;  4HDU A;  1FMV A;  1QA6 A;  2NRA C;  3FHZ A;  3HL2 A;  1TNS A;  1QHH D;  2EZL A;  2DA5 A;  2G7H A;  4CCK A;  4ZDL A;  3PNY A;  4UHT A;  2VAS A;  3F23 A;  5FRN A;  4M6Y A;  1JT6 A;  4LGW A;  5E8G A;  5TRD A;  4LG0 B;  2B9S A;  1MBJ A;  1P2F A;  1G59 A;  1T0F A;  2K9N A;  2A5Y B;  1WGX A;  2QUF A;  3F3X A;  3BZ6 A;  1OYY A;  4C3J J;  3DLL F;  3ZPL A;  3U2R A;  2JRT A;  3GTJ J;  2A3S A;  4IJA A;  4OIO F;  3D0S A;  1ODD A;  2P6T A;  1J9I A;  4DBQ A;  2V9P A;  3KZI C;  2IVM A;  3S93 A;  1TT5 B;  2WTE A;  4XM3 A;  2RQP A;  2QQ8 A;  3FHN A;  3HOS A;  4IHX A;  2QZ8 A;  4PSW A;  4QPO A;  5C4X J;  2ZJQ F;  4YEL A;  2KDZ A;  4A3J J;  3D5S C;  3A01 B;  3LSR A;  3DTK A;  3REO A;  1MMN A;  1BM9 A;  2BHY A;  2R7Z J;  3ISP A;  2F48 A;  1GUU A;  1WRJ A;  2R7S A;  3H3U A;  3ZQQ A;  2Z99 A;  1A04 A;  2GOM A;  2GWR A;  1JE8 A;  3OSF A;  2JA2 A;  3WTU C;  1Y0U A;  1UG2 A;  5K5O A;  5DD8 A;  5DD4 A;  2HS5 A;  4MQ9 F;  2BYV E;  3SYT A;  2OQG A;  1W7P B;  1QO0 D;  3COA C;  1FYK A;  2KRH A;  3L7W A;  3G1O A;  2R7R A;  2W00 A;  2GLO A;  2ETH A;  5DM7 F;  4LK1 F;  4DYC A;  3L09 A;  3CCR I;  1HBX G;  3ZQC A;  1IN4 A;  1PDN C;  1QNT A;  2RNG A;  3CCV I;  3FBN B;  5GTI C;  1STZ A;  3WHC A;  1MBK A;  1G3S A;  2MC3 A;  3KEQ A;  1XMX A;  3AG4 H;  3L00 A;  5IOZ A;  3JW4 A;  2YU3 A;  3OOP A;  4F52 A;  1KU2 A;  4UUT A;  2RAE A;  3OWT A;  4BXU A;  3DKY A;  3FIW A;  1WPK A;  1D5V A;  1IDY A;  2K27 A;  4OIQ F;  2QKL B;  2YR2 A;  4HQE A;  5FRM A;  3WU2 C;  4L5J A;  2VJ5 A;  4M3F A;  1BBY A;  1LVK A;  2LYC A;  2UV1 A;  1MMD A;  2E71 A;  2XRL A;  1TWH J;  3JCU C;  4CCN A;  4XRS A;  3K70 C;  3ASO H;  4R8H A;  1HXD A;  1FOX A;  1ZAR A;  3G1L A;  4C2U A;  4YFX F;  3S3O A;  1RUN A;  2QQB A;  4V2F A;  1JGG A;  2X85 A;  2WB1 N;  1T98 A;  3BC8 A;  3S3N A;  4KIT B;  4HNV A;  1TQP A;  2GXA A;  2ESN A;  2CH0 A;  2PMZ N;  9ANT A;  3CCE I;  1OYW A;  5J8C A;  4RM3 A;  2G0E A;  1LNW A;  1TP4 A;  4BL0 B;  1SC7 A;  4U0W A;  3SZT A;  1ZGJ A;  4ZYA A;  2HOT A;  3BJ6 A;  3CUO A;  5DM6 F;  5BOX A;  3CO6 C;  5JFR A;  3JAM Z;  4FE4 A;  2IA1 A;  4LK0 F;  4AD9 A;  3KEY A;  1B6A A;  3ESW B;  2J5P A;  3J7A O;  4M9X A;  5HLI A;  1D8K A;  2M8G X;  3ZRG A;  5E3L A;  5JVG F;  1D0X A;  5DCF A;  3VYR B;  2R3S A;  5J1R A;  2H6B A;  1O3S A;  3IC7 A;  1R1U A;  3E6B A;  3AL0 C;  2EV0 A;  3HTS B;  3C3W A;  3QPT A;  1UZC A;  2XB5 A;  2ZJ2 A;  4HOB A;  3PJR A;  2OPT A;  1IRX A;  1S7E A;  1IV8 A;  3ZMD A;  2ZNY A;  1Y0N A;  1SEU A;  3M9A A;  3FXL A;  1SVO A;  4HNT A;  3O2P E;  1FIP A;  2RVC A;  2XAS A;  4Y52 J;  3KP5 A;  2L4M A;  3AG2 H;  3FK6 A;  2ELH A;  3CMM A;  2EZK A;  2LF7 A;  2VBY A;  3GFL A;  2LC2 A;  5KAI C;  2NS7 A;  2DCE A;  4RB1 A;  1B9M A;  4IHW A;  1YTY A;  2LLK A;  4DYQ A;  4NQW A;  1ZEL A;  2DMU A;  3IP4 B;  4BE0 A;  1IRG A;  3VFZ A;  3WE2 A;  1OCP A;  1YOV B;  3FXO A;  2ZC2 A;  3V8L A;  1ULY A;  2E1N A;  3WTW C;  3J81 Z;  1P9Q C;  3E6C C;  1YX3 A;  1IW7 F;  3ECH A;  2VQH A;  5M5Y J;  3K9T A;  4UVB A;  2COB A;  2DMP A;  2MH2 A;  2YX4 A;  2OTJ I;  4XN0 A;  3LNQ A;  3WU1 B;  2VN2 A;  4KMF A;  2WV1 A;  4HAM A;  5F08 A;  4Y7N J;  1GDT A;  4CH7 A;  4QWQ A;  1SVM A;  2IPQ X;  2K3F A;  3KZZ A;  3R0A A;  4II2 A;  4P9F A;  1TWC J;  4BKX A;  2E1C A;  3ABK H;  1P7J A;  3FMS A;  1IZ1 A;  2HTS A;  2KT0 A;  2M45 A;  3BTJ A;  3CJT B;  3DV8 A;  5F27 A;  5GTH C;  4PGH A;  4L9N A;  4Y17 A;  3H9Q A;  1X1A A;  1Z3X A;  2CO5 A;  4AVP A;  2PN6 A;  1W1W E;  3DKX A;  2CQK A;  1S6L A;  2IA0 A;  1BOA A;  2M7B A;  1P92 A;  3ZXS A;  4FX4 A;  4EEF G;  1YQA A;  1ZRF A;  5FGM A;  1TBX A;  4JX6 A;  1MD0 A;  2W1O A;  4NC6 A;  2HWV A;  3S1N J;  3WG9 A;  3G73 A;  2NOJ B;  2ZO4 A;  1WJC A;  3V42 A;  2HR3 A;  1S3J A;  3FF5 A;  5F0F A;  1DPR A;  3S3M A;  2HXI A;  1JUP A;  2O5R A;  5FRO A;  1QGP A;  1QZE A;  1EA3 A;  2WV0 A;  4JYK A;  2VT3 A;  4XLF A;  1HW2 A;  4UB8 C;  3MFK A;  4X1E A;  1ON2 A;  1BR4 A;  2JZY A;  2NYX A;  3DBH B;  3OS2 A;  1WJA A;  3Q9S A;  2NVT J;  4AIK A;  2OA4 A;  2FNA A;  3VOD A;  5C4J J;  3CJQ B;  1JHF A;  5J6X A;  4RAF A;  3M7G A;  1YIJ I;  2ECC A;  2IT0 A;  1I3Q J;  4M6V A;  2VC1 A;  2PJR A;  2WWY A;  2QBY A;  2LP0 A;  1F1Z A;  2E35 A;  1R5H A;  2CYY A;  2E2J J;  3K1N A;  3GTL J;  1HKQ A;  1FT9 A;  1V5G A;  4IHT A;  2VOO A;  3JRG A;  3BR3 A;  2XB0 X;  1MJ9 A;  4XLE A;  4M3B A;  3EPZ A;  5HS7 A;  4I99 C;  2CS3 A;  2VE8 A;  4RS8 A;  2BXY A;  1ZG3 A;  2PBI A;  2A6E F;  2EV5 A;  4TV7 A;  2CW7 A;  3I64 A;  1IO2 A;  3HZJ A;  2VE9 A;  2ECB A;  5LBQ A;  2XGD A;  3RZD J;  2X48 A;  3HOW J;  4A93 J;  1DGW Y;  2V1U A;  4LIT A;  1IXS B;  1YG2 A;  4U0V A;  3F8M A;  5ICG A;  3FX3 A;  3KP4 A;  3S2H J;  4RGR A;  1IXR C;  1SMY F;  3HPH A;  3IWZ A;  4LLG F;  3FBI B;  4N4O B;  1B1B A;  4Y33 A;  4GFB A;  3L2U A;  2MLK A;  4M6X A;  3BQY A;  2ZJP F;  1V55 H;  5DV5 A;  4AID A;  5B1A H;  1F5T A;  2VIX A;  5EF6 A;  1YJW I;  1R00 A;  3C18 A;  3NAR A;  2BY2 A;  1GVD A;  1RZ4 A;  3CF5 F;  4D7N A;  4EAT A;  4ZDO A;  3T8R A;  2ID6 A;  4KYW A;  4Y15 A;  3QP6 A;  4CYC A;  2Z33 A;  4XR6 A;  5FKL A;  4RLQ A;  3Q3S A;  2LTP A;  5F0C A;  3IKT A;  3OIP A;  2DA2 A;  3HJE A;  5IY5 H;  1X4P A;  5DCM A;  2Y0M A;  5E1Z B;  2JRM A;  3M1E A;  2EPF A;  2ZBK A;  2V9K A;  2LKX A;  4HST A;  2EBI A;  3AG3 H;  4GYI A;  5EYR A;  5L3D A;  3S1R J;  2EFO A;  2WAQ N;  2IS2 A;  2JTV A;  1LJ9 A;  4HV6 A;  4N9H A;  1FYL A;  2BW3 B;  2JA7 J;  5IYD J;  2E36 A;  3LSH A;  1FSH A;  2QEN A;  2R4G A;  4YII A;  4OAZ A;  5F1R A;  5DUI A;  4CIC A;  1A31 A;  3W2V A;  1U8B A;  2M0C A;  3NRV A;  1U5T C;  3S1M J;  2CQ7 A;  2JPB A;  2HDD A;  3ROU A;  2WAD A;  1N78 A;  3ZOB A;  4N4N B;  4BEH A;  5D5W B;  4M74 A;  4AUX A;  4MQV A;  1G6N A;  4DIQ A;  2LY1 A;  1NH3 A;  1ETX A;  3K7A J;  2W48 A;  4CUG A;  5HNH A;  5IYB J;  1K4T A;  2EIM H;  3P5J A;  2D5V A;  5J4Y A;  4Y3O A;  4XON A;  1UCR A;  1HSJ A;  2ZME C;  3NWS A;  3UKG A;  3CC2 I;  1LFU P;  3RTR A;  4EJV A;  1D8J A;  1JHH A;  3HOT A;  2XAU A;  3VDX A;  1AOY A;  3SZG A;  4KDP A;  1W0U A;  3OYL A;  2KZV A;  3DTI A;  3OYI A;  1PYV A;  2OD5 A;  2WA0 A;  2WY7 Q;  4MNU A;  4BEH B;  2R93 J;  2XSJ C;  4KN4 X;  2DAO A;  2VXD A;  2ADU A;  2GBY A;  4OWR B;  4R79 A;  2DFF A;  3S8P A;  1FBQ A;  1YJ9 I;  1ORK A;  3LSI A;  1E3H A;  3B02 A;  4GRI A;  5J1U A;  1X1D A;  4CGZ A;  2W25 A;  2L02 A;  4KNY A;  2CUZ A;  5LEJ A;  2PEX A;  3CCU I;  1BR2 A;  2M34 A;  1AWC A;  3MQ0 A;  3K4K A;  2RV8 A;  3LOC A;  2FSW A;  3ZQ7 A;  2B7E A;  2PJR B;  3S16 J;  1IUY A;  4WWC A;  3ZGK A;  1IJW C;  3JAM K;  1WQ2 A;  4CYC B;  1QQI A;  1S5L C;  4KIS A;  3RYP A;  3WOD F;  1DU0 A;  4GCV A;  5D5X B;  4O3M A;  2H27 A;  2VQC A;  4C30 A;  2ZXJ A;  4C3H J;  2O8K A;  4FE7 A;  4Y13 A;  3LA3 A;  1FOK A;  3GBG A;  4E7J A;  2BV6 A;  2DT5 A;  2W24 A;  2AO9 A;  2R7F A;  3GTK J;  3E5Q A;  1BJA A;  5E18 F;  3SFZ A;  4ZYD A;  2DO7 A;  1TLH B;  3S32 A;  1I5Z A;  5HVQ C;  3WHB A;  2VKH A;  3EYY A;  3TBI A;  4HYE A;  5H2F C;  2DT7 B;  1R22 A;  3L2C A;  2VC0 A;  2E19 A;  3CUQ B;  3ML6 A;  1AA7 A;  2K86 A;  2OZ6 A;  4DOZ A;  3DQV C;  4NNJ A;  1UST A;  3OYC A;  4BQN A;  1VQ9 I;  1XD7 A;  1W7P A;  3LFU A;  4KMU X;  3M8J A;  3TDU C;  3QRF F;  2X6O A;  3ZR8 X;  3LSK A;  2VBZ A;  3V4G A;  1QZZ A;  4HX7 A;  2JUC A;  3E5X A;  3W6V A;  3RPU D;  5E3N A;  1TWA J;  2XAF A;  1RR8 C;  3KEO A;  3GLX A;  1UJ8 A;  1SD6 A;  1JKR C;  1U6G A;  2COM A;  1XCV A;  2MA3 A;  3IRR A;  4BBR J;  2DFE A;  3ABU A;  2YSR A;  2FNP A;  4XBF A;  4WX9 A;  3ERM A;  2DDB A;  2V7F A;  2AS5 F;  5IT3 A;  2LR8 A;  5ERI A;  2FA5 A;  2HKO A;  3ELK A;  2YU9 J;  1XSV A;  1Z05 A;  3IUO A;  4B48 A;  4CSW A;  2KJC A;  1JTX A;  2KIU A;  1ZR4 A;  4GXO A;  3JRE A;  1BIB A;  1J75 A;  1T95 A;  2DOA A;  3R61 A;  3Q0W A;  1R1V A;  5CLS A;  5CKT A;  3K70 D;  3VPR A;  3BT9 A;  1YW9 A;  2DLL A;  3TKY A;  2V1D A;  1CQT A;  5HS9 A;  1U2W A;  3CJR B;  4BDY A;  1EH7 A;  3JR9 A;  3EUA A;  3I9V 2;  3C2H A;  5GAG J;  3OYH A;  3S15 J;  3K4L A;  4II3 A;  2ISZ A;  1ZLJ A;  3HM5 A;  1WI3 A;  5HOO A;  1YFH A;  1Z6T A;  4UV8 A;  1YHQ I;  3BY6 A;  4HZF A;  4Z6Y A;  3TDZ C;  5F64 A;  4B44 A;  4E4H A;  3OS0 A;  3FKI J;  1JJ6 C;  5EZG A;  3OYF A;  2PJP A;  2W85 A;  5DEQ A;  2QA4 I;  3EUH C;  1CGP A;  3LSP A;  3MN2 A;  4G7H F;  4A3D J;  1YE9 A;  2MAB A;  2OV7 A;  4IQJ A;  3H0D A;  4G8X A;  4ZC3 A;  5A2Q K;  1I27 A;  2R7O A;  3GVA A;  2AXT C;  3A4C A;  3K10 A;  4M9Z A;  1SMT A;  5KCM A;  4LMY A;  2VB6 A;  1FPQ A;  4E70 A;  3K2Z A;  1Z9C A;  2IAI A;  2VT2 A;  2DDA A;  4IRH A;  3OSG A;  2STW A;  1FBU A;  4ZZL A;  4R1H A;  5IYC J;  3DBR B;  4RGS A;  3BTC A;  3JRC A;  2IP2 A;  2EQR A;  3MKZ A;  3ABM H;  2D1H A;  3HTU A;  5HDK A;  5K7F A;  2BBY A;  4RA2 A;  3BZK A;  3ZN0 A;  1WWX A;  3ZMZ A;  2DTR A;  1R4N B;  3ZMU A;  5A2Q Z;  1OLT A;  1YYV A;  1OKR A;  4A3L J;  3F22 A;  2Q8K A;  1Q1H A;  4HX8 A;  5BS6 A;  4QSH A;  4F92 B;  3DU6 A;  3GWZ A;  1VFC A;  2HYG D;  1T39 A;  1XSD A;  3PL8 A;  3TOA A;  2K7L A;  4EGY A;  1X4O A;  4RB2 C;  5K7Z A;  2GAU A;  2ZKZ A;  1F4K A;  1TQM A;  3K4B A;  2KIF A;  3OV8 A;  3A2K A;  3OYB A;  1ZG5 A;  2VBX A;  1RIO H;  5M5W J;  5JVT A;  2HQA A;  3LQR A;  4I7H A;  2RKH A;  2MW8 A;  2P6S A;  1G8X A;  5CVI A;  2F2E A;  3IHU A;  2KZG A;  2Y48 A;  3KYC B;  2R0Q C;  1IDZ A;  2AQF A;  5FLM J;  3K4N A;  2HZD A;  4XLP F;  4A3K J;  4EGZ A;  2DYR H;  1MMG A;  3ONQ A;  2VI6 A;  3BDD A;  4E7H A;  4ENM A;  1O3Q A;  3R60 A;  2PMZ A;  1X3Z B;  3BPX A;  2L9R A;  2N8G A;  3BPV A;  1RNL A;  1XB4 A;  3QWL A;  4FTH A;  2EIN H;  5D8L B;  2K40 A;  1XMK A;  2HEO A;  1B8I A;  3SHF A;  4ENK A;  2CV0 A;  4PFO A;  3JSO A;  1ETK A;  1ZHF A;  4BQO A;  3CCL I;  4BJ6 C;  3IKV A;  4A0Y A;  4A3F J;  3V7C A;  2CV1 A;  3HSR A;  3TO9 A;  1XN7 A;  1WJB A;  3Q5F A;  1MH4 A;  1Z7L A;  2LSO A;  2P5L C;  4BNC A;  4WCG A;  2E1M B;  5ILU A;  3E6D A;  4J00 A;  4D9J A;  1NTC A;  3H35 A;  3G2B A;  2L01 A;  1SD7 A;  4BQA A;  4G9Y A;  2Q0O A;  1M1E B;  4ASN A;  4ESB A;  4S04 A;  3Q0V A;  4PDK A;  1D1A A;  2FQ4 A;  2DA6 A;  1A6I A;  3EYI A;  2DA3 A;  4ITV A;  2FBK A;  2Z9O A;  2GA2 A;  2TDX A;  5BPD A;  2LMD A;  4CZC A;  3I56 I;  1SAN A;  1X3U A;  3LMM A;  2ZXH A;  1MBF A;  1FP1 D;  3GZ5 A;  2B63 J;  3IH4 A;  3ZMS A;  5DDG A;  5BQT A;  5K5R A;  3JRF A;  3QP5 A;  1U0J A;  4A3E J;  4UXN A;  2E1M C;  3BG6 A;  2LFB A;  2ZME A;  5M3M J;  1XGN A;  3M07 A;  1POG A;  4JX5 A;  3HSF A;  2JA5 J;  3PIO F;  2XPW A;  1D1B A;  2GA1 A;  4FAS D;  3L1P A;  1ZGA A;  3NQO A;  1R23 A;  3HUG A;  3I5U A;  4KIF A;  2HQR A;  3FKJ A;  5E17 F;  2OCE A;  1XC5 A;  5DTD A;  4AYB A;  1K4S A;  2PX9 A;  4HDV A;  2E5Z A;  2KJB A;  1Y8Q B;  4PZJ A;  2NOG A;  2M0M A;  4HLY A;  4IO9 F;  3ZQI A;  1DPU A;  1W5S A;  2UXN A;  2ISY A;  3HIF A;  4GYG A;  5FD6 A;  2NVU B;  3DKW A;  1TL8 A;  1C0W A;  1REP C;  4XNF A;  1KA8 A;  3E1S A;  5DCM B;  4B47 A;  4E7L A;  4S0H B;  3DTE A;  3NEU A;  1H89 C;  2OU2 A;  4HF0 A;  4P55 A;  3GME A;  2LKS A;  4BUP A;  1K78 B;  3BR2 A;  2QCO A;  3SDB A;  3EUH A;  5FKO A;  5IPA A;  5ILV A;  3KIO A;  3BOQ A;  2F5E A;  2LRE A;  2FRH A;  4RGU A;  3QPS A;  1R9T J;  2DMT A;  1E2X A;  2A5W A;  2HZT A;  3HEF A;  3PQK A;  4PJL A;  4RLF A;  4XN3 A;  3JRA A;  3CCQ I;  4ENJ A;  1JKO C;  1AHD P;  5LGT A;  5KAF C;  1UMQ A;  1P6R A;  4FET A;  2HNH A;  1K6Y A;  3BLY A;  3HRS A;  4Q48 A;  1R5G A;  4A3B J;  3V7R A;  1YW8 A;  1ZRE A;  3S2W A;  4PJN A;  5FD5 A;  3T8T A;  1LFB A;  4MHG A;  4DJA A;  1FTT A;  3HRT A;  1WVR A;  1W5T A;  4YG2 F;  5EG0 A;  1HW1 A;  3PSI A;  1H0M A;  3PIP F;  4BJT A;  1L3L A;  1YRN A;  2BZT A;  3WTZ A;  5LGU A;  2X51 A;  2ELK A;  1BI3 A;  2M5W A;  2O61 A;  1D3Y A;  1Z21 A;  1NHA A;  3FXU A;  1R36 A;  1TC3 C;  4KUM A;  3I0T A;  4QIW N;  3D1N I;  1RRJ A;  2R7V A;  1HDD C;  3MZH A;  3L9F A;  4N0B A;  3CDI A;  1GXQ A;  1SD4 A;  3GTO J;  1X1B A;  1NG7 A;  4A3I J;  4XIC A;  5J47 A;  4EJU A;  2XHK A;  4DBR A;  3N4M A;  1MNM C;  3E97 A;  2QBY B;  1W4M A;  5CVJ A;  3RQ4 A;  3GTQ J;  1RET A;  4KJZ A;  2L0K A;  3GX4 X;  3BWG A;  4MFE A;  4HEA 2;  2IGK A;  4HG2 A;  2X6Y A;  2A6H F;  4U88 A;  4FIS A;  3HKZ A;  2Y2Z A;  2QM3 A;  4RDU A;  3QYF A;  3EDP A;  4A5M A;  2DA4 A;  3RZO J;  1VQN I;  3LST A;  1IN5 A;  3VEP A;  3RJP A;  4GDF A;  1LE8 A;  4ZTF A;  5BNG A;  5B5E C;  3HRM A;  2DA1 A;  3C1D A;  3WTX C;  4B43 A;  3CME I;  1MDM B;  3HGG A;  2LRD A;  2Z2S B;  1EJ9 A;  2HDC A;  3DWL E;  4HF2 A;  2W82 A;  4EM0 B;  1X2M A;  4I98 B;  4EJO A;  3U9G A;  4ENN A;  2EFP A;  2JK3 A;  3VYU B;  2XPV A;  4IHS A;  1X58 A;  2DQR A;  1J09 A;  2E7W A;  2KDO A;  3SEQ A;  2VBW A;  4KFC A;  4RAZ A;  3CD6 I;  2MG4 A;  4PJ0 C;  2CG4 A;  1Y1V J;  2GIZ A;  2X4H A;  4GO1 A;  2DFI A;  2L4A A;  4D7M A;  1MW7 A;  1HKS A;  1LEA A;  1BOB A;  4RGX A;  1ZYR F;  1BJZ A;  3PQJ A;  4JX4 A;  3U21 A;  3SJM A;  3MAJ A;  1R6R A;  2O03 A;  5J1Y A;  5F0H A;  2VKV A;  4M72 A;  4BU2 A;  4HNU A;  2M1B A;  1G4D A;  5IOY A;  1DDN A;  3WTT C;  5B1B H;  5ICC A;  4M3G A;  1X19 A;  5IP7 J;  2L54 A;  2KLO A;  3DLA A;  3L2R A;  5C44 J;  1G3W A;  2IGM A;  1FC3 A;  3ZQL A;  2Y69 H;  3CCM I;  2K5C A;  3T0Y A;  3KCC A;  1TZL A;  3CMA I;  4IX7 A;  3ZN1 A;  2OQR A;  2Y9Z A;  3QOP A;  2EFQ A;  2VOP A;  5KVR A;  1ZH5 A;  2WY8 Q;  1FWZ A;  2JVH A;  2QSH X;  3J80 K;  1XTA A;  4YEJ A;  2FX0 A;  2XRO A;  1FTZ A;  5GAH J;  1VQM I;  1O7F A;  1BW5 A;  1Y8R B;  1W7P D;  2XV4 S;  3S2D J;  4PSX A;  4OIN F;  3OR1 C;  1S9H A;  5L3E A;  5CVV A;  4OIR F;  3OYA A;  4XMY A;  1XGO A;  3TP3 A;  2IXS A;  4NHJ A;  2XGX A;  2BW3 A;  2H6C A;  2XAG A;  1SD5 A;  1OR7 A;  1IC8 A;  3UNG C;  4L5I A;  1XGS A;  1PJR A;  3BTL A;  1IN6 A;  3TMO A;  2IRF G;  3R4K A;  4NQW B;  3JTH A;  1K7A A;  1GHC A;  2VXZ A;  2BVM A;  4J19 A;  2H8R A;  3H3Z A;  3I71 A;  2AQE A;  1B72 A;  2WAQ A;  2Y0S N;  4J01 A;  2PFB A;  2JPC A;  3MEX A;  1DUX C;  1DQU A;  3J7Y J;  4EMS A;  4XRM A;  2HDW A;  3JTG A;  5DS9 A;  3FDY A;  4FHT A;  3GXO A;  3OYM A;  1GT0 C;  3OIQ A;  3ABT A;  1WH7 A;  4HSR A;  5F1J A;  1O57 A;  5J40 A;  1FIA A;  2EV6 A;  3H0G J;  3TL4 X;  1JGS A;  4ANJ A;  1H88 C;  1ZLK A;  3KET A;  3WGH A;  2ZXW H;  3V8J A;  3RKW A;  1VQL I;  2AXL A;  3FXR A;  2NXN B;  2O6G E;  3HB9 A;  3TP0 A;  1FP2 A;  4OAY A;  1LPQ A;  3HDD A;  3T5X A;  3CC4 I;  3TOB A;  2QVO A;  1UHM A;  4B3A A;  3K0L A;  3CLQ A;  1LDD A;  2FQ3 A;  2K02 A;  1KU3 A;  3HKZ N;  1VQK I;  2R7T A;  4XID A;  2UXX A;  2QYO A;  1WI9 A;  3GZ6 A;  2X9D A;  4KIB A;  2F4O B;  3FK7 A;  2V79 A;  1Z6R A;  2E34 A;  3MKL A;  3GFJ A;  2LBF A;  4ABZ A;  1MBH A;  3I53 A;  1X3W B;  2KMU A;  3F8C A;  3VYS B;  3CC7 I;  2H09 A;  4AM3 A;  5F6F A;  1MND A;  1I6H J;  1O4X A;  5IT9 Z;  4LG0 A;  3SXY A;  4D5C A;  3P9C A;  5D4R A;  5M3F J;  3QPH A;  2X1E A;  2CQQ A;  2WB1 A;  3EET A;  5JR3 A;  3AKZ A;  3FWE A;  3I54 A;  4HRI A;  2VJ4 A;  3IRQ A;  1TW2 A;  5KNL A;  1OR7 C;  5B66 C;  1I6X A;  3MKW B;  3GO5 A;  2H1L A;  2XVC A;  5H20 A;  5KHD A;  1VQ5 I;  1KYW A;  2VLA A;  4W1U A;  3VOE A;  5E1W A;  5JHF A;  5HLT A;  1S7A A;  5HLH A;  1ITY A;  4D1Q A;  2Y75 A;  5LRS A;  1LFP A;  5EDN A;  4YIR X;  5D6F A;  5AIP A;  3IV5 A;  1GV2 A;  4JOM A;  3CF2 A;  4NB5 A;  3TGN A;  3CP8 A;  1KU9 A;  1S29 A;  5GP9 A;  4A6D A;  3LWF A;  2CU7 A;  2ME0 A;  3QPL A;  3A0B C;  2DPD A;  2JUG A;  3CO7 C;  2Z1D A;  5BPI A;  2X0L A;  1PUF B;  2C6Y A;  1P4W A;  2K9S A;  1Q1V A;  1SAX A;  5ICF A;  4QPQ A;  1ZG1 A;  2ZNZ A;  4BS9 A;  1MKM A;  4L0Y B;  2ZJR F;  2DW4 A;  1KYZ A;  2ZSH B;  1USS A;  1HC8 A;  1MH3 A;  1NK3 P;  1XX5 A;  4WF2 A;  2CRG A;  1WFX A;  1DGR M;  5JI6 A;  1Y56 A;  2DOF A;  1SFO J;  2ID3 A;  2VOD A;  1R4M B;  4KIG A;  1A36 A;  2K4J A;  1HCR A;  3P9K A;  2DT6 A;  2MD5 A;  1FLI A;  2LG4 A;  1ZKG A;  2DBB A;  2IGO A;  1BR1 A;  4P9U A;  1EKE A;  2OJE D;  2ZSI B;  3CJN A;  3BR0 A;  4KIC A;  3A03 A;  1RR7 A;  3GEZ A;  2VKD A;  4RAY A;  5HS8 A;  1GXP A;  1A35 A;  2YX7 A;  1TWG J;  1QRY A;  2GOX B;  3DPT A;  1OIS A;  2JMW A;  3DEU A;  3A01 A;  1XDU A;  2K85 A;  2Q2E A;  2A6T A;  4E7I A;  1U5T A;  2CUE A;  3AFH A;  4Q47 A;  1YI2 I;  1Y39 A;  5FB2 A;  2ZFW A;  2W57 A;  4EM1 A;  3KX2 A;  1YS6 A;  1ZTR A;  3H92 A;  4EQQ A;  3U1D A;  4HA8 A;  1ON1 A;  1HLV A;  2VQL A;  2V1N A;  2VPR A;  3K4C A;  3AAF A;  2FE3 A;  2W4S A;  1T0F C;  2O8X A;  3DBL B;  2XUB A;  4JBA A;  3MZY A;  2DI3 A;  4ZYH A;  4PJM A;  1J5Y A;  3HOY J;  2OUM A;  1WKM A;  1XG1 A;  2QSG X;  1I39 A;  3QOD A;  2EIJ H;  3C2B A;  4YFK F;  2BE5 F;  3GCM A;  3JRD A;  3H1C A;  2JT1 A;  3FMR A;  2VQG A;  3K1M A;  1QHG A;  3GTG J;  3F8N A;  3GYH X;  1VI0 A;  5D5V B;  3L2Q A;  2FU4 A;  2DPU A;  3FM5 A;  2JSC A;  3W6J B;  2CSO A;  4HF1 A;  2L2O A;  1U9N A;  2R5Y B;  4LOC A;  1VQ6 I;  2K9M A;  2CGP A;  3W2W A;  2FBI A;  2A68 F;  3G6E I;  5E3M A;  1BN5 A;  3GUD A;  2JVG A;  3LFK A;  4C9Y A;  4ZZD A;  1LQ1 A;  1LEB A;  3DPL C;  4NDL A;  3K69 A;  2QEX I;  4IPA A;  4LIU A;  3J7Z I;  3A0H C;  5HNF A;  2ZCW A;  3DCF A;  4DGW B;  1O3T A;  2CW0 F;  2CWE A;  2P0W A;  3GFM A;  1HA8 A;  2HI3 A;  2TCT A;  4ZYE A;  1JKP C;  2BGC A;  4A6E A;  1IN7 A;  3A02 A;  3X2Q H;  4V19 K;  3E3V A;  1F36 A;  2RNJ A;  1CF7 A;  5B3S H;  2HOA A;  3Q0U A;  5LHG A;  1IRF A;  4E7S A;  4WXC A;  4BXX J;  3HXL A;  4Z2Y A;  1O7L A;  4HLX A;  3RCO A;  2R92 J;  2MD0 A;  2CJJ A;  2EZH A;  3RKQ A;  4U87 A;  4B3X A;  2O3F A;  3Q9V A;  1SFK A;  1IN8 A;  1QU3 A;  3SFI A;  5FLV A;  3BJA A;  2L5Q A;  4G6D A;  2F5C A;  3GF2 A;  2Q1Z B;  5K5Q A;  4EJT A;  3PNT A;  3HC7 A;  4X0G A;  4XRF A;  2LDU A;  5BMZ A;  3I55 I;  2IGN A;  5HLG A;  4UVA A;  2IW5 A;  3GLL A;  5FLX K;  2XDV A;  5E1X A;  1U3E M;  1V3F A;  5HDN A;  1YJN I;  4XK4 A;  2IS4 A;  2DK5 A;  4UY8 I;  3TED A;  3MD2 A;  1Z0X A;  4X6A J;  1Y1W J;  4UNO A;  2LF8 A;  4PGG A;  4IOA F;  1YO5 C;  2DK8 A;  2Z5U A;  1KU7 A;  3R0J A;  5EGO B;  2LD5 A;  3C2G A;  1LDJ A;  2XF6 A;  1AU7 A;  4A2U A;  4YRV A;  3I3L A;  2HOS A;  1PP8 F;  5LLQ A;  3VSL A;  1RKW A;  2KQR A;  2YPR A;  4FT8 A;  1R5I D;  5E3O A;  1UAA A;  1OMI A;  3I4M J;  4EM2 A;  1ENH A;  3KYL A;  4FCY A;  4D5F A;  1EH6 A;  3IAM 2;  1WCM J;  4KT5 C;  2GXG A;  1KQ8 A;  2M9H A;  4XKB A;  4DZP A;  2E2H J;  2P4W A;  2VJJ A;  5EEG A;  2HVR A;  3N05 A;  3ZCO A;  4NC7 A;  1MIJ A;  1U78 A;  2MYS A;  4S05 A;  2CUF A;  5D6E A;  4LB6 B;  5E8I A;  2EFW A;  2HQ5 A;  3P7N A;  3J80 Z;  2O7O A;  1FMW A;  4I0A A;  4IHY A;  5EZH A;  3VWB A;  2Y31 A;  1HF0 A;  5HDG A;  3S14 J;  3V7S A;  3JRH A;  3EQL F;  4BY7 J;  3KP2 A;  3HPG A;  3SQN A;  5D5U B;  2RC4 A;  5LRR A;  2KRF A;  5IP9 J;  3RDI A;  1BC8 C;  4NUB A;  2OCC H;  3OL3 A;  3FXM A;  1XDS A;  1TT0 A;  2HTJ A;  3GFI A;  2MFZ A;  3HBL A;  3RQI A;  2HFH A;  4UUV A;  4AYB N;  3K2A A;  3ULQ B;  4BH9 A;  3HGY A;  1SAU A;  2K9Q A;  2VUM J;  3DXJ F;  3H36 A;  4BDZ A;  5J3L A;  4AU7 A;  4XRS G;  4IZZ A;  3D5L A;  5DUK A;  3F0C A;  2JA8 J;  1AKH A;  4CZZ A;  5L3C A;  3O8H A;  1NK2 P;  1TNT A;  1RES A;  4LB5 A;  5LD2 C;  1J0R A;  2IS1 A;  3TQN A;  3OIO A;  3LAJ A;  1K83 J;  3HSE A;  4I02 A;  1ZR2 A;  2JQ7 A;  1YIO A;  4JP0 A;  1I1S A;  1VTN C;  4I6Z A;  4BQQ A;  5IT9 K;  2ICW G;  4M3E A;  1LVA A;  4OOI A;  2F4M B;  2CW8 A;  1GV5 A;  1YS7 A;  1HST A;  3FMQ A;  3QYE A;  1VQP I;  4UUS A;  2XAH A;  2V6C A;  4ESJ A;  2LNB A;  2P7V B;  1QVT A;  2A07 F;  4A0X A;  2KKO A;  3L2W A;  1JI8 A;  2Y30 A;  2HPI A;  4BAC A;  5GAD J;  4IRI A;  1BA5 A;  2L7F P;  1XS9 A;  1MMA A;  3GW2 A;  1G2H A;  2L7Z A;  3F21 A;  1UFM A;  2D1V A;  1MZB A;  1OQY A;  1ZK8 A;  3HYI A;  4A12 A;  4DZJ A;  2XF5 A;  2GM4 A;  5LHI A;  3EUK L;  4AWX B;  2WAF A;  1EH8 A;  1B4A A;  3FIS A;  3BG5 A;  4XLN F;  5IP6 A;  4IOC F;  5FJ8 J;  1UEL B;  4CDG A;  3K1P A;  3O6B B;  4G7O F;  1QVU A;  3CUQ C;  2R5Z A;  5CJ9 A;  3G71 I;  4L18 B;  3I59 A;  1T38 A;  4GGG A;  3ZQG A;  5GPC A;  2HQN A;  2R5Y A;  2R7W A;  3H3V K;  1R7J A;  1EV7 A;  2X1D A;  3JSP A;  1HOM A;  2XGE A;  1LE8 B;  1MMS A;  3WGG A;  3BG7 A;  3ECO A;  3LSG A;  4C3I J;  3WGI A;  3CCJ I;  4BJ5 C;  2OTL I;  1MNE A;  2E60 A;  3DEE A;  1UG0 A;  1T6S A;  2KIS A;  5L3F A;  3MVP A;  1KZH A;  1MJA A;  3OYE A;  3CQZ J;  2V6E A;  1BI0 A;  4IHV A;  1PUE E;  4PUS A;  4G94 A;  4HQM A;  3U1K A;  4NC8 A;  3R6S A;  1P4X A;  1IRZ A;  3N97 A;  3B73 A;  3TO6 A;  4F7Z A;  5JLX A;  4H4K C;  5D8K B;  3CMY A;  5ILS A;  2PMU A;  4WK8 F;  3OYN A;  3E7L A;  2Z16 A;  2MC4 A;  2Y0S A;  2VKE A;  3G4S I;  2E1O A;  1UHW A;  2M3A A;  3I4P A;  4IQ4 A;  2M2E A;  5CPR B;  2MLG A;  1JKQ C;  3KZY A;  3B6C A;  1DU6 A;  3E0J B;  2ELJ A;  4G6T B;  4JQF A;  1T8I A;  2X6W A;  1ETY A;  2XF7 A;  2X1C A;  4CCJ A;  1GVJ A;  2K3P A;  2ZB9 A;  2IA2 A;  5EG0 B;  1FZP B;  1VQ8 I;  4LFU A;  1JTY A;  2CMP A;  2D45 A;  1QBJ A;  5J4V A;  2NS8 A;  3PO2 J;  1E0E A;  1J59 A;  1D5Y A;  3OR2 C;  2EIL H;  3OYJ A;  2AHQ A;  3OOU A;  2M30 A;  3ERE D;  3W3C A;  1FBS A;  5M5X J;  2B0L A;  1L0O C;  3M1C A;  4PK4 A;  2E5N A;  2K9L A;  2BXZ A;  4A69 C;  4C2M J;  3DU5 A;  1N77 A;  1ETO A;  3VYT B;  1WJF A;  4ON0 A;  5K7H A;  2LK2 A;  1XCB A;  1TW3 A;  4RB0 A;  2W84 A;  3HOX J;  3FXJ A;  4E7Z A;  3AG1 H;  4BHC A;  3MCZ A;  5C3E J;  1P4A A;  2NAZ A;  1FX7 A;  2HPM A;  1MJB A;  1B72 B;  1BC7 C;  2GXB A;  1EF4 A;  4F55 A;  2XAJ A;  3E6M A;  3MKY B;  3LL7 A;  1NG6 A;  2BY0 A;  3HOZ J;  2ACJ A;  1K61 A;  4M73 A;  4IXA A;  2OBP A;  5EGO A;  1RUO A;  1KGS A;  3T1B A;  1G3Y A;  1VZ0 A;  2V9V A;  4DW6 A;  1AKH B;  2JSP A;  4AC0 A;  1BL0 A;  2Z3Y A;  2HVS A;  1GLN A;  5H6Q A;  2L7M P;  4CCM A;  4EV0 A;  2QF7 A;  4NBQ A;  2NVQ J;  1H8A C;  4RM2 A;  4CHU A;  1JUS A;  1R49 A;  2L7K A;  2OF7 A;  3VB2 A;  5FFX A;  4ZJZ A;  4G6Q A;  3F8F A;  1ZQ3 P;  3IH2 A;  3RYR A;  3HUG B;  4A3G J;  3LA2 A;  2H94 A;  4N9I A;  1BI2 A;  1RPW A;  2E7X A;  3JRI A;  3DEW A;  1U9O A;  5E79 C;  2QSF X;  2EA4 A;  2M4K A;  4D0P A;  4M3D A;  4IKF A;  2KPM A;  1ETV A;  5GAE J;  3B6A A;  3IL2 A;  2EA2 A;  5AIQ A;  2IBD A;  5K1Y A;  4DNC A;  3PFI A;  2VJI A;  2XIG A;  4ZTJ A;  2PLY A;  4HPQ A;  3ABL H;  2BOL A;  3H5N A;  4BBS J;  4K2E A;  4RB3 C;  1LB2 A;  3LAP A;  4U7B A;  1Y6I A;  2P7C B;  3CCY A;  3ZP5 A;  3H5A A;  1IUF A;  1D0Z A;  1S7O A;  2VL8 A;  2XAQ A;  3FXQ A;  5ICE A;  3I4N J;  2XGC A;  3RI4 A;  3BQZ A;  3O8G A;  1WJE A;  4IF4 A;  3GTP J;  1IGN A;  1T2K A;  2P5K A;  4C2T A;  2OZU A;  3SEZ A;  2EZI A;  4Q5S F;  2KRC A;  1ZAO A;  4G12 A;  2WC2 A;  2XKP A;  2M87 A;  2F6C A;  1XMA A;  4RMN A;  1JUM A;  2CUJ A;  2JJ7 A;  2LY2 A;  4CYD A;  1ZGW A;  1V54 H;  3BRO A;  5FO5 A;  4P5O A;  2G7U A;  4IVN A;  3RIR A;  2BY3 A;  4I0B A;  1OYI A;  1LDK B;  1OCR H;  1I50 J;  3OYK A;  2F5V A;  4IRG A;  4F91 B;  4IL6 C;  3QOE A;  2JA6 J;  3IWF A;  5CYV A;  4AIH A;  2GIV A;  3F8B A;  3L2V A;  3S1Q J;  3C7J A;  4XKV A;  1T56 A;  5JLW A;  2F4I A;  1WJD A;  4WXD A;  2EB7 A;  2L9S A;  4BE1 A;  5KK1 A;  1Z91 A;  1W0T A;  1YIT I;  2TRT A;  1VND A;  2KHM A;  1E3P A;  2NS0 A;  3DF8 A;  4BE2 A;  4RBO A;  2WAE A;  2NVY J;  1IF1 A;  1PVE A;  3ZMT A;  1OCT C;  2LH9 A;  1MBE A;  4PCQ A;  3RPU A;  3PSF A;  2WBM A;  4O6J A;  2D2W A;  3RKX A;  2DXI A;  1OCO H;  2O0Y A;  5FKM A;  3M4O J;  1P7I A;  4XQF A;  4A0Z A;  4XOT A;  4E6K G;  5EEH A;  3WTY C;  4MEY F;  1FYM A;  2Q2E B;  4L9J A;  4G7Z F;  2F5F A;  2HOE A;  3OMY A;  4L5E A;  4CXF A;  4OIP F;  3F6O A;  2R7D A;  1VF9 A;  1D1C A;  1S8N A;  5J8F A;  1H9T A;  2P8T A;  3K4M A;  2QLZ A;  2V4J C;  1RI7 A;  2DTZ A;  3KYD B;  4LD5 A;  4AVZ A;  4QLC U;  1J2X A;  2HKX A;  3OL4 A;  5TGT A;  4KA4 A;  1DP3 A;  2DU9 A;  4MGR A;  1LUJ B;  2DYS H;  2IEK A;  3OYG A;  2F5D A;  2PQ8 A;  3OYD A;  2ZXI A;  4HW0 A;  3KP3 A;  4XLC A;  2BVL A;  5H6R A;  1MGT A;  2PG4 A;  4Y4R A;  4UUS B;  2QQ9 A;  2DJI A;  2LVS A;  2FEZ A;  1B9N A;  2YUS A;  3QU6 A;  1E3O C;  2CV2 A;  4E7K A;  1HKT A;  1YLF A;  2L9N A;  2BHZ A;  1WZ2 A;  1WHU A;  1S72 I;  3WE3 A;  1T33 A;  3GZN B;  5LFA A;  3CDH A;  3QQA A;  1PUF A;  2HU9 A;  1BW6 A;  2RN7 A;  4EJW A;  2P81 A;  3K4J A;  4ETS A;  2RRE A;  4CCL A;  3LA7 A;  2OAZ A;  4P1W A;  1OPC A;  2G9W A;  2FF4 A;  4L9T A;  3WG7 H;  1W5C C;  3QYB A;  1TTY A;  4LLL A;  3NWT A;  3DP7 A;  3BP8 A;  1OJL A;  4O5V A;  1UB9 A;  3VSK A;  5LHH A;  4AIJ A;  3F72 A;  3KPH A;  1BI1 A;  2FMY A;  1PP7 U;  2MH9 A;  3WU0 A;  5FKN A;  3SZP A;  2QWW A;  2EK5 A;  3BCB A;  2QKM B;  4MIM A;  4CO8 A;  1YW7 A;  2PI0 A;  4BHP A;  2JWT A;  4M9S A;  2DN0 A;  2HXO A;  2NNY A;  2L9V A;  3KP6 A;  4IEJ A;  2I5U A;  5GPA A;  3ZMV A;  2K4B A;  3BR5 A;  1YX5 A;  1TWF J;  5TIS C;  1FOW A;  4YIF A;  1IV6 A;  2ZME B;  2R7Q A;  2V1X A;  1V4R A;  3S17 J;  3TW7 A;  4XSX F;  1VQ7 I;  1F9N A;  2BEO A;  4U7D A;  4L0Z B;  1G3T A; 
#chains in the Genus database with same CATH homology
 2FBH A;  3KE2 A;  1I1G A;  3BJO A;  4L9V A;  2EWN A;  4ZH4 F;  1WSU A;  4B8X A;  2P5V A;  3I59 B;  4MTD A;  3HHG A;  3KP7 A;  3CUQ A;  5FLX Z;  1DP7 P;  2RGV A;  2ESH A;  5DYM A;  3LQQ A;  1FSE A;  4P96 A;  4OU0 A;  4M71 A;  4XSZ F;  5CVU A;  1KQ0 A;  2RDP A;  3QAH A;  3O3K A;  3FM3 A;  2KIM A;  1IXC A;  5LEK A;  1K78 A;  3MWM A;  1B59 A;  4HX4 A;  2GQQ A;  2FML A;  2UZK A;  4YFN F;  2QQA A;  3HHH A;  1FY7 A;  4ESF A;  1ZRC A;  2UWM A;  1IAW A;  3V8K A;  4DQ2 A;  3DFG A;  1TQI A;  3M8E A;  2EJR A;  1BIA A;  3WTS C;  3RKY A;  1K6O A;  1O3R A;  3CLO A;  4BHB A;  5FFZ A;  5L3B A;  4BYY A;  1SFX A;  5LGN A;  4LJZ F;  2EFN A;  3TO7 A;  3CTA A;  5ED4 A;  1HW5 A;  3RPQ A;  6PAX A;  3P9I A;  3KLO A;  4B09 A;  3F6V A;  2A61 A;  5L3G A;  4UVC A;  2DQL A;  3M8F A;  3E5U A;  1H9G A;  4WXH A;  4OMY A;  4MEX F;  4KN7 X;  2FOK A;  2FXA A;  3W6K B;  3WTV C;  1SFU A;  4I2O A;  4JK1 X;  1FNN A;  4H0E A;  4A5N A;  1J7K A;  4BAY A;  4ZYG A;  3J81 K;  4Q4Z F;  1HQC A;  5CVR A;  2M8E A;  1MDM A;  3KFW X;  2MBF A;  1E17 A;  2HYF A;  2XKO A;  3G3Z A;  5E20 A;  1U5T B;  5D4S A;  2CFX A;  1SFE A;  1QPM A;  4EVI A;  4U0Y A;  2J5O A;  4FX0 A;  2GZW A;  1ZRD A;  3KLN A;  2PMH A;  1K79 A;  4HV5 A;  1Z7U A;  1KQ9 A;  2HGC A;  4MTE A;  4LLN A;  2IJL A;  2VON A;  1CF7 B;  3QU3 A;  2LKP A;  1Z1D A;  2STT A;  1JXS A;  2A69 F;  4HBL A;  1R58 A;  3FZV A;  4I01 A;  1R1T A;  4I09 A;  2XRN A;  5TJJ A;  5AON A;  2NNN A;  3I58 A;  1ZN2 A;  1U8R A;  4OMZ A;  1XGM A;  1QZY A;  1ONV A;  1XSX A;  4UV9 A;  5JHU A;  2L3D A;  3HRU A;  4HDU A;  2NRA C;  3FHZ A;  1TNS A;  2G7H A;  4UHT A;  3F23 A;  4M6Y A;  4LGW A;  5E8G A;  5TRD A;  4LG0 B;  1P2F A;  1T0F A;  2A5Y B;  3F3X A;  2QUF A;  3BZ6 A;  1OYY A;  3ZPL A;  3U2R A;  2JRT A;  2A3S A;  4IJA A;  4OIO F;  3D0S A;  1ODD A;  2P6T A;  1J9I A;  2IVM A;  2WTE A;  2RQP A;  3HOS A;  2QZ8 A;  3REO A;  1BM9 A;  3ISP A;  1WRJ A;  3H3U A;  2Z99 A;  1A04 A;  2GWR A;  1JE8 A;  3WTU C;  1Y0U A;  5K5O A;  5DD8 A;  5DD4 A;  2HS5 A;  4MQ9 F;  2BYV E;  2OQG A;  1W7P B;  1QO0 D;  3COA C;  1FYK A;  3L7W A;  2ETH A;  4LK1 F;  3L09 A;  1HBX G;  1IN4 A;  1PDN C;  1QNT A;  1STZ A;  1G3S A;  2MC3 A;  3KEQ A;  3L00 A;  3JW4 A;  2YU3 A;  3OOP A;  1KU2 A;  4BXU A;  1D5V A;  2K27 A;  4OIQ F;  2YR2 A;  4HQE A;  4L5J A;  1BBY A;  4R8H A;  1HXD A;  1ZAR A;  4YFX F;  1RUN A;  2QQB A;  1T98 A;  1TQP A;  2ESN A;  1OYW A;  5J8C A;  1LNW A;  4U0W A;  3SZT A;  1ZGJ A;  3BJ6 A;  3CUO A;  5BOX A;  3CO6 C;  5JFR A;  3JAM Z;  2IA1 A;  4LK0 F;  4AD9 A;  1B6A A;  2J5P A;  3J7A O;  4M9X A;  5HLI A;  1D8K A;  5DCF A;  2R3S A;  2H6B A;  1O3S A;  3IC7 A;  1R1U A;  3E6B A;  2EV0 A;  3HTS B;  3C3W A;  3QPT A;  2ZJ2 A;  4HOB A;  3ZMD A;  2ZNY A;  3M9A A;  3O2P E;  2XAS A;  2RVC A;  3KP5 A;  2L4M A;  2ELH A;  2LF7 A;  2VBY A;  3GFL A;  4RB1 A;  1B9M A;  1YTY A;  4NQW A;  1IRG A;  3VFZ A;  3WE2 A;  3V8L A;  1ULY A;  2E1N A;  3WTW C;  3J81 Z;  3E6C C;  1IW7 F;  3ECH A;  3K9T A;  4UVB A;  2MH2 A;  2YX4 A;  3WU1 B;  2VN2 A;  4KMF A;  4HAM A;  4QWQ A;  2IPQ X;  3R0A A;  3KZZ A;  4P9F A;  2E1C A;  3FMS A;  1IZ1 A;  2HTS A;  2M45 A;  3DV8 A;  4PGH A;  4L9N A;  4Y17 A;  2CO5 A;  4AVP A;  2PN6 A;  2CQK A;  1S6L A;  2IA0 A;  1BOA A;  1P92 A;  4FX4 A;  1YQA A;  1ZRF A;  5FGM A;  1TBX A;  1MD0 A;  2HWV A;  3WG9 A;  3G73 A;  2ZO4 A;  2HR3 A;  1S3J A;  3FF5 A;  1DPR A;  1QGP A;  2WV0 A;  2VT3 A;  1HW2 A;  3MFK A;  1ON2 A;  2JZY A;  2NYX A;  3Q9S A;  4AIK A;  2OA4 A;  2FNA A;  3VOD A;  1JHF A;  5J6X A;  3M7G A;  2IT0 A;  2VC1 A;  2WWY A;  2QBY A;  1F1Z A;  1R5H A;  2CYY A;  3K1N A;  1HKQ A;  1FT9 A;  4IHT A;  2VOO A;  1MJ9 A;  5HS7 A;  2VE8 A;  4RS8 A;  1ZG3 A;  2PBI A;  2A6E F;  2EV5 A;  4TV7 A;  3I64 A;  2VE9 A;  5LBQ A;  2V1U A;  1IXS B;  1YG2 A;  4U0V A;  3F8M A;  5ICG A;  3FX3 A;  3KP4 A;  4RGR A;  1IXR C;  1SMY F;  3IWZ A;  4LLG F;  1B1B A;  2MLK A;  4M6X A;  5DV5 A;  1F5T A;  1R00 A;  3C18 A;  1RZ4 A;  3T8R A;  4KYW A;  4Y15 A;  3QP6 A;  2Z33 A;  3IKT A;  5DCM A;  2Y0M A;  5E1Z B;  3M1E A;  2ZBK A;  4GYI A;  5L3D A;  2EFO A;  2JTV A;  1LJ9 A;  4HV6 A;  4N9H A;  1FYL A;  1FSH A;  2QEN A;  4YII A;  5F1R A;  5DUI A;  4CIC A;  3NRV A;  1U5T C;  2JPB A;  3ROU A;  5D5W B;  4M74 A;  4MQV A;  1G6N A;  1UCR A;  1HSJ A;  3RTR A;  4EJV A;  1D8J A;  1JHH A;  3HOT A;  1AOY A;  4KDP A;  2OD5 A;  4MNU A;  4KN4 X;  2DAO A;  2ADU A;  4R79 A;  1FBQ A;  3B02 A;  4CGZ A;  2W25 A;  2L02 A;  4KNY A;  5LEJ A;  2PEX A;  1AWC A;  3MQ0 A;  2RV8 A;  2FSW A;  3ZQ7 A;  1IUY A;  4WWC A;  3JAM K;  1WQ2 A;  1QQI A;  3RYP A;  3WOD F;  4GCV A;  5D5X B;  4O3M A;  2H27 A;  2ZXJ A;  4Y13 A;  3LA3 A;  1FOK A;  2BV6 A;  2DT5 A;  2W24 A;  2R7F A;  3E5Q A;  1BJA A;  5E18 F;  3SFZ A;  4ZYD A;  2DO7 A;  1TLH B;  1I5Z A;  5HVQ C;  3EYY A;  4HYE A;  1R22 A;  3L2C A;  2VC0 A;  3CUQ B;  3ML6 A;  2K86 A;  2OZ6 A;  3DQV C;  1UST A;  1XD7 A;  1W7P A;  4KMU X;  3TDU C;  3QRF F;  3V4G A;  2VBZ A;  1QZZ A;  4HX7 A;  3E5X A;  2XAF A;  3KEO A;  3GLX A;  1SD6 A;  1U6G A;  2COM A;  1XCV A;  2MA3 A;  3IRR A;  3ABU A;  2YSR A;  2FNP A;  4XBF A;  4WX9 A;  2AS5 F;  5IT3 A;  5ERI A;  2FA5 A;  2HKO A;  3ELK A;  1XSV A;  1Z05 A;  2KJC A;  2KIU A;  4GXO A;  1BIB A;  1J75 A;  3R61 A;  1R1V A;  5CLS A;  1YW9 A;  2DLL A;  3TKY A;  2V1D A;  5HS9 A;  1U2W A;  1EH7 A;  2ISZ A;  1ZLJ A;  5HOO A;  1YFH A;  1Z6T A;  4UV8 A;  3BY6 A;  4HZF A;  3TDZ C;  5F64 A;  2PJP A;  2W85 A;  5DEQ A;  1CGP A;  4G7H F;  4G8X A;  5A2Q K;  1I27 A;  3GVA A;  4M9Z A;  1SMT A;  4LMY A;  4E70 A;  1FPQ A;  3K2Z A;  1Z9C A;  2VT2 A;  4IRH A;  2STW A;  1FBU A;  4ZZL A;  4R1H A;  4RGS A;  2IP2 A;  2D1H A;  3HTU A;  5HDK A;  2BBY A;  3ZN0 A;  1WWX A;  3ZMZ A;  2DTR A;  3ZMU A;  5A2Q Z;  1YYV A;  1OKR A;  3F22 A;  2Q8K A;  1Q1H A;  4HX8 A;  5BS6 A;  3GWZ A;  2HYG D;  1T39 A;  1XSD A;  3TOA A;  4EGY A;  2K7L A;  4RB2 C;  2GAU A;  1F4K A;  2ZKZ A;  1TQM A;  2KIF A;  3OV8 A;  1ZG5 A;  2VBX A;  1RIO H;  5JVT A;  3LQR A;  4I7H A;  2RKH A;  2P6S A;  5CVI A;  2F2E A;  3IHU A;  2Y48 A;  4XLP F;  4EGZ A;  1O3Q A;  4ENM A;  3BDD A;  3R60 A;  3BPX A;  1RNL A;  1XB4 A;  3BPV A;  5D8L B;  1XMK A;  2HEO A;  3SHF A;  4ENK A;  3JSO A;  1ZHF A;  3IKV A;  4A0Y A;  3V7C A;  3HSR A;  3TO9 A;  1XN7 A;  3Q5F A;  2LSO A;  2P5L C;  4BNC A;  4WCG A;  5ILU A;  3E6D A;  2L01 A;  1SD7 A;  4BQA A;  4G9Y A;  2Q0O A;  4ASN A;  4ESB A;  4S04 A;  4PDK A;  3EYI A;  2FBK A;  2Z9O A;  2GA2 A;  2TDX A;  5BPD A;  1X3U A;  3GZ5 A;  1FP1 D;  3ZMS A;  5DDG A;  5BQT A;  5K5R A;  3QP5 A;  4UXN A;  2ZME A;  1XGN A;  3HSF A;  2GA1 A;  1ZGA A;  3NQO A;  1R23 A;  3HUG A;  3I5U A;  4KIF A;  2HQR A;  5E17 F;  4HDV A;  2KJB A;  4PZJ A;  4HLY A;  1DPU A;  1W5S A;  2UXN A;  2ISY A;  3HIF A;  4GYG A;  5FD6 A;  3DKW A;  1C0W A;  1REP C;  1KA8 A;  5DCM B;  3NEU A;  2OU2 A;  4HF0 A;  4P55 A;  1K78 B;  3EUH A;  5ILV A;  3BOQ A;  2F5E A;  2FRH A;  4RGU A;  1E2X A;  2HZT A;  3PQK A;  4ENJ A;  5LGT A;  1P6R A;  3HRS A;  4Q48 A;  1R5G A;  3V7R A;  1YW8 A;  1ZRE A;  3S2W A;  5FD5 A;  3T8T A;  4MHG A;  3HRT A;  1W5T A;  4YG2 F;  1HW1 A;  1H0M A;  1L3L A;  3WTZ A;  5LGU A;  1BI3 A;  2M5W A;  2O61 A;  1D3Y A;  1NHA A;  3FXU A;  1R36 A;  4KUM A;  3I0T A;  3MZH A;  3L9F A;  4N0B A;  1GXQ A;  1SD4 A;  4EJU A;  3N4M A;  2XHK A;  3E97 A;  2QBY B;  1W4M A;  5CVJ A;  3GX4 X;  3BWG A;  4U88 A;  2A6H F;  2QM3 A;  3EDP A;  4A5M A;  3LST A;  1IN5 A;  3VEP A;  3RJP A;  3HRM A;  3C1D A;  3WTX C;  1MDM B;  2HDC A;  4HF2 A;  4EM0 B;  4I98 B;  4EJO A;  3U9G A;  4ENN A;  2EFP A;  4IHS A;  2DQR A;  2E7W A;  2VBW A;  4KFC A;  4RAZ A;  2CG4 A;  2X4H A;  4GO1 A;  2DFI A;  2L4A A;  1HKS A;  1LEA A;  4RGX A;  1ZYR F;  3PQJ A;  3MAJ A;  2O03 A;  4M72 A;  2M1B A;  1G4D A;  1DDN A;  3WTT C;  5ICC A;  2L54 A;  1G3W A;  1FC3 A;  3T0Y A;  3KCC A;  3ZN1 A;  2OQR A;  3QOP A;  2EFQ A;  2VOP A;  5KVR A;  1ZH5 A;  1FWZ A;  3J80 K;  2XRO A;  1O7F A;  1W7P D;  2XV4 S;  4OIN F;  5L3E A;  5CVV A;  4OIR F;  1XGO A;  4NHJ A;  2XGX A;  2H6C A;  2XAG A;  1SD5 A;  1OR7 A;  4L5I A;  1XGS A;  1IN6 A;  2IRF G;  3R4K A;  3JTH A;  1K7A A;  1GHC A;  2VXZ A;  3H3Z A;  3I71 A;  2PFB A;  2JPC A;  3MEX A;  1DUX C;  4EMS A;  3JTG A;  4FHT A;  3GXO A;  3ABT A;  1O57 A;  2EV6 A;  1JGS A;  1ZLK A;  3KET A;  3WGH A;  3V8J A;  3RKW A;  2AXL A;  3FXR A;  2O6G E;  1FP2 A;  3T5X A;  3TOB A;  2QVO A;  1UHM A;  3K0L A;  2FQ3 A;  1LDD A;  2K02 A;  1KU3 A;  2UXX A;  2QYO A;  1WI9 A;  3GZ6 A;  4KIB A;  2V79 A;  1Z6R A;  3GFJ A;  3I53 A;  3F8C A;  2H09 A;  5F6F A;  5IT9 Z;  4LG0 A;  3SXY A;  3P9C A;  5D4R A;  3QPH A;  3EET A;  5JR3 A;  3FWE A;  3I54 A;  3IRQ A;  1TW2 A;  1I6X A;  3GO5 A;  2XVC A;  5H20 A;  1KYW A;  3VOE A;  5E1W A;  1S7A A;  5HLH A;  2Y75 A;  5LRS A;  5D6F A;  5AIP A;  4NB5 A;  3TGN A;  1KU9 A;  1S29 A;  4A6D A;  3LWF A;  2DPD A;  3CO7 C;  5BPI A;  2X0L A;  2C6Y A;  1P4W A;  1SAX A;  1ZG1 A;  5ICF A;  2ZNZ A;  1MKM A;  4L0Y B;  2DW4 A;  1KYZ A;  1USS A;  4WF2 A;  5JI6 A;  2VOD A;  4KIG A;  2K4J A;  3P9K A;  2MD5 A;  1FLI A;  2DBB A;  4P9U A;  3CJN A;  4KIC A;  4RAY A;  3GEZ A;  5HS8 A;  1GXP A;  2YX7 A;  3DPT A;  3DEU A;  1XDU A;  2Q2E A;  1U5T A;  4Q47 A;  5FB2 A;  2ZFW A;  2W57 A;  4EM1 A;  1YS6 A;  3H92 A;  4EQQ A;  3U1D A;  4HA8 A;  1ON1 A;  3AAF A;  2FE3 A;  2O8X A;  2XUB A;  4JBA A;  3MZY A;  2DI3 A;  4ZYH A;  1J5Y A;  1WKM A;  4YFK F;  2BE5 F;  2JT1 A;  3FMR A;  3K1M A;  3F8N A;  3GYH X;  5D5V B;  2DPU A;  2FU4 A;  3FM5 A;  2JSC A;  3W6J B;  2CSO A;  4HF1 A;  2CGP A;  2FBI A;  2A68 F;  1BN5 A;  3GUD A;  4ZZD A;  3LFK A;  1LQ1 A;  1LEB A;  3DPL C;  3K69 A;  4IPA A;  2ZCW A;  1O3T A;  2CW0 F;  2CWE A;  3GFM A;  4ZYE A;  2BGC A;  4A6E A;  1IN7 A;  3E3V A;  2RNJ A;  1CF7 A;  5LHG A;  1IRF A;  4WXC A;  4Z2Y A;  1O7L A;  4HLX A;  2O3F A;  3Q9V A;  1IN8 A;  3BJA A;  4G6D A;  2F5C A;  3GF2 A;  5K5Q A;  4EJT A;  4XRF A;  2LDU A;  5BMZ A;  5HLG A;  4UVA A;  2IW5 A;  5FLX K;  5E1X A;  1U3E M;  1V3F A;  5HDN A;  2DK5 A;  4UNO A;  2LF8 A;  4PGG A;  1YO5 C;  2DK8 A;  2Z5U A;  1KU7 A;  3R0J A;  1LDJ A;  4A2U A;  1PP8 F;  5LLQ A;  4FT8 A;  2YPR A;  1OMI A;  4EM2 A;  1EH6 A;  4KT5 C;  2GXG A;  1KQ8 A;  2P4W A;  5EEG A;  1U78 A;  4S05 A;  5D6E A;  4LB6 B;  5E8I A;  2EFW A;  3P7N A;  3J80 Z;  4I0A A;  5HDG A;  3V7S A;  3EQL F;  3KP2 A;  5D5U B;  3SQN A;  2RC4 A;  5LRR A;  2KRF A;  3RDI A;  1BC8 C;  1XDS A;  2HTJ A;  3GFI A;  2HFH A;  4UUV A;  3ULQ B;  4BH9 A;  3DXJ F;  3D5L A;  5DUK A;  4CZZ A;  5L3C A;  4LB5 A;  1TNT A;  1J0R A;  3TQN A;  3LAJ A;  3HSE A;  4I02 A;  1YIO A;  1I1S A;  1VTN C;  5IT9 K;  1LVA A;  4OOI A;  1YS7 A;  1HST A;  3FMQ A;  2XAH A;  2V6C A;  4ESJ A;  2LNB A;  2P7V B;  2A07 F;  4A0X A;  2KKO A;  4IRI A;  3GW2 A;  4A12 A;  3F21 A;  1UFM A;  2D1V A;  1MZB A;  3HYI A;  5LHI A;  4AWX B;  1EH8 A;  1B4A A;  4XLN F;  4CDG A;  3K1P A;  3O6B B;  4G7O F;  3CUQ C;  5CJ9 A;  4L18 B;  3I59 A;  1T38 A;  4GGG A;  2HQN A;  1R7J A;  1EV7 A;  3JSP A;  3WGG A;  3ECO A;  3WGI A;  1T6S A;  5L3F A;  1MJA A;  1BI0 A;  1PUE E;  4G94 A;  4HQM A;  3R6S A;  1P4X A;  3N97 A;  3B73 A;  3TO6 A;  4F7Z A;  5D8K B;  5ILS A;  2PMU A;  4WK8 F;  1UHW A;  3I4P A;  2MLG A;  3KZY A;  4JQF A;  1GVJ A;  2IA2 A;  1FZP B;  4LFU A;  2D45 A;  1QBJ A;  1J59 A;  3ERE D;  2M30 A;  1FBS A;  2B0L A;  1L0O C;  4ON0 A;  1XCB A;  1TW3 A;  4RB0 A;  2W84 A;  4BHC A;  3MCZ A;  1P4A A;  2NAZ A;  1FX7 A;  1MJB A;  1BC7 C;  2GXB A;  2XAJ A;  3E6M A;  2ACJ A;  4M73 A;  4IXA A;  2OBP A;  1RUO A;  1KGS A;  3T1B A;  1G3Y A;  2V9V A;  2Z3Y A;  5H6Q A;  4EV0 A;  4CHU A;  3VB2 A;  5FFX A;  4G6Q A;  3F8F A;  3RYR A;  3LA2 A;  2H94 A;  4N9I A;  1BI2 A;  2E7X A;  4D0P A;  2EA4 A;  3IL2 A;  2EA2 A;  5AIQ A;  5K1Y A;  4DNC A;  3PFI A;  2XIG A;  2PLY A;  4K2E A;  4RB3 C;  1LB2 A;  3LAP A;  4U7B A;  2P7C B;  3ZP5 A;  1S7O A;  2XAQ A;  3FXQ A;  5ICE A;  3RI4 A;  4IF4 A;  1T2K A;  2P5K A;  2OZU A;  4Q5S F;  1ZAO A;  2WC2 A;  2XKP A;  2M87 A;  1XMA A;  4CYD A;  3BRO A;  5FO5 A;  4P5O A;  2G7U A;  4IVN A;  3RIR A;  4I0B A;  1OYI A;  1LDK B;  4IRG A;  3IWF A;  5CYV A;  4AIH A;  2GIV A;  3F8B A;  3C7J A;  4WXD A;  2EB7 A;  5KK1 A;  1Z91 A;  2NS0 A;  3DF8 A;  1IF1 A;  3ZMT A;  4PCQ A;  3RPU A;  4O6J A;  3RKX A;  2D2W A;  2O0Y A;  4A0Z A;  3WTY C;  5EEH A;  4MEY F;  1FYM A;  4L9J A;  4G7Z F;  2F5F A;  2HOE A;  4CXF A;  4OIP F;  3F6O A;  2R7D A;  1S8N A;  5J8F A;  1H9T A;  2P8T A;  2QLZ A;  1RI7 A;  4LD5 A;  4QLC U;  1J2X A;  2HKX A;  4KA4 A;  2DU9 A;  4MGR A;  2F5D A;  2PQ8 A;  4HW0 A;  3KP3 A;  5H6R A;  1MGT A;  2PG4 A;  2QQ9 A;  2FEZ A;  1B9N A;  3QU6 A;  1HKT A;  1YLF A;  3WE3 A;  3CDH A;  2RN7 A;  4EJW A;  4ETS A;  3LA7 A;  2OAZ A;  1OPC A;  2G9W A;  2FF4 A;  4L9T A;  1TTY A;  4LLL A;  3DP7 A;  3BP8 A;  4O5V A;  1UB9 A;  5LHH A;  4AIJ A;  3F72 A;  1BI1 A;  2FMY A;  1PP7 U;  2MH9 A;  3WU0 A;  3SZP A;  2QWW A;  2EK5 A;  4CO8 A;  1YW7 A;  2PI0 A;  4BHP A;  4M9S A;  2NNY A;  3KP6 A;  3ZMV A;  2K4B A;  4YIF A;  2ZME B;  2V1X A;  1V4R A;  4XSX F;  1F9N A;  2BEO A;  4U7D A;  4L0Z B;  1G3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...