3BJAA

Crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
b'GMNNRELYGNIRDVYHLLQKNLDKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKKHLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family, putative
publication title Crystal structure of putative MarR-like transcription regulator (NP_978771.1) from Bacillus cereus ATCC 10987 at 2.38 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transcription regulator
total genus 41
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bjaA00
1MKMA 4MNUA 3TGNA 1J7KA 3D5LA 4IXAA 5DUIA 5F1RA 2Z9OA 1R58A 3F6OA 4BHCA 4PGHA 1G3TA 5FLXK 3LA2A 3MZYA 1FNNA 4LD5A 2WV0A 5HDGA 5ICCA 2P7CB 1SFXA 2O0YA 3QP5A 1HSJA 3CUQB 5ICFA 1W7PA 3C18A 3M9AA 1TNSA 5FO5A 3T8RA 2OBPA 1TW3A 3V8JA 2FEZA 4RGXA 3T1BA 2YX4A 3N4MA 3TO6A 2IW5A 4OIOF 4KIFA 5DD4A 2O3FA 3MFKA 4AWXB 2D1VA 5E1WA 3P9CA 4G7ZF 3PQKA 4XSZF 3VFZA 1Z9CA 1ZHFA 2FU4A 4HF0A 3KP5A 1LEBA 1USSA 3K1PA 4A6EA 2HR3A 3K69A 4HF2A 4EM0B 4ESJA 3AAFA 3IWZA 4L9TA 4BYYA 1V3FA 3ZMUA 3IHUA 4G6QA 3IC7A 1O57A 5H20A 2HYGD 4FX4A 2V6CA 3HOSA 1JHHA 1FT9A 1YLFA 3RIRA 2F5CA 3LQRA 4L0YB 5JI6A 3M8FA 1MDMA 4AIKA 3RKYA 1ZGJA 5ICEA 1Z91A 3E6BA 4OMYA 3FF5A 2VONA 4EJVA 1G3WA 2BV6A 2VT2A 5D8LB 4ZYEA 1EH7A 2XHKA 2QBYB 5BQTA 1XDUA 2A5YB 5AIQA 1QGPA 2KIUA 2ZMEB 4NHJA 3BPXA 4HQMA 1B1BA 3WE3A 3WGGA 4DQ2A 2QBYA 1HKSA 1S6LA 3FHZA 3RKXA 5H6QA 4PCQA 2ZMEA 2FSWA 4EJTA 1U5TB 4AIHA 2V1XA 2YSRA 4GO1A 5D5WB 2EFOA 2L01A 4A0ZA 1IN4A 4RGUA 2XAQA 3HHHA 3GW2A 3V4GA 2OA4A 2ZO4A 1U5TC 2EK5A 5IT9Z 1W4MA 4BXUA 2FA5A 1H0MA 3O6BB 1O3SA 4O5VA 2PJPA 1QQIA 5FD6A 3E5UA 4KT5C 3HHGA 5LLQA 2W57A 4A0XA 1WI9A 5E8IA 3FXRA 2HTJA 2VOOA 1PP7U 1OMIA 4ENMA 2VBXA 3TDUC 2HDCA 2VBYA 2KRFA 1U6GA 1GHCA 3ZMVA 3E6MA 4LLNA 3RDIA 4Q5SF 3HYIA 1IRFA 2H6BA 3GYHX 5E8GA 1F9NA 3QPTA 2FE3A 2LNBA 1STZA 3DEUA 1T38A 3FX3A 2EA2A 4G6DA 3ECOA 5TRDA 1YYVA 5ERIA 5L3BA 1RUOA 5K5OA 3P9IA 3Q9VA 2P4WA 1SD7A 1Z7UA 5LEKA 3BDDA 4A0YA 4KFCA 3FZVA 2EWNA 3DF8A 4G9YA 2VBZA 3T8TA 2M30A 3WGHA 2JTVA 4MEYF 1YS7A 4IRGA 4OIQF 4AIJA 1BIAA 1KU7A 5BOXA 3MAJA 1I6XA 4AVPA 1S29A 1HSTA 2DW4A 4Z2YA 2MA3A 3J80K 4ETSA 2HKXA 3B02A 3F22A 3IL2A 2H6CA 4MTEA 2RGVA 3E5QA 1O3RA 3F8MA 1G6NA 3GFMA 4KDPA 1TBXA 3KCCA 1BI0A 2M87A 1OYIA 2PLYA 1S7OA 1T39A 2BEOA 3NQOA 4MTDA 4RB1A 4AD9A 4HX8A 1D3YA 2QYOA 4Q47A 2WC2A 4M6XA 1WQ2A 1ON1A 3M8EA 2MH9A 4M9ZA 1USTA 1TQMA 4KUMA 5K1YA 2DAOA 1J0RA 4IRHA 4UVCA 4A6DA 2CSOA 2Y75A 5HS7A 2CQKA 2AXLA 3HUGA 3VOEA 3WTZA 3IWFA 4UVAA 2VC1A 2DT5A 2KIMA 5ED4A 2RDPA 1TQIA 1W5SA 3BWGA 1SMTA 3C1DA 3MCZA 2IA1A 3OV8A 2B0LA 3CDHA 1BN5A 2OQRA 2PFBA 2K27A 2QVOA 1IN7A 5TJJA 4MGRA 4ZYDA 2ISYA 2BBYA 3I64A 3K2ZA 1U78A 3ML6A 4PDKA 2OU2A 2K02A 2ZNZA 4UHTA 4YFKF 1K79A 1FSEA 1LNWA 4NB5A 4HDVA 4ZZDA 2IA0A 2L02A 4MEXF 4WXCA 1XCBA 5JVTA 5HVQC 3P9KA 2D45A 1MJBA 2Q8KA 5F64A 2HWVA 2ZXJA 5J8CA 3GUDA 5DUKA 4L5IA 1J75A 2MH2A 3HRUA 5D5UB 3S2WA 2DTRA 1O7FA 5DYMA 4Y17A 3I0TA 4G7OF 2GZWA 1KU9A 3IKTA 2XAJA 2IRFG 2PG4A 5LGUA 3J81K 1QPMA 3VB2A 4LLLA 3DP7A 1B4AA 4LLGF 3NEUA 2QWWA 2COMA 3I54A 3DKWA 5FFXA 5HLIA 5D6FA 1KQ0A 2JT1A 4KA4A 4GYIA 1MGTA 5L3DA 2Z3YA 1L3LA 4OOIA 4Q48A 5LGTA 4BNCA 3HSFA 1P92A 3WTYC 1Y0UA 4WXDA 4EJUA 3JTHA 5FLXZ 2LKPA 3F3XA 4M73A 1R1TA 2O8XA 4R8HA 4ZZLA 3TOAA 3V8KA 2QQAA 3FM5A 1J59A 2L4MA 3KZZA 3V7CA 1SFUA 4I01A 2UXXA 3H3ZA 2RKHA 4RGRA 1ZLKA 5J6XA 2W85A 2QM3A 2KJCA 3ZMTA 3F8CA 5H6RA 4S04A 1XMAA 1RUNA 4EM1A 3Q9SA 3CUOA 1Z6TA 3GZ6A 5FB2A 3W6JB 3T5XA 2L3DA 2L54A 4N9HA 1VTNC 4U88A 2AS5F 2UXNA 5FGMA 2DPDA 3F72A 3ECHA 1FP2A 4LB5A 2STWA 3BJAA 4CICA 3K1NA 2E1CA 3F6VA 1B59A 1K6OA 3CO7C 2CYYA 2FMLA 2V79A 4XLNF 4I0BA 1KGSA 4UVBA 2ESHA 3MZHA 4L18B 1ZG3A 4MQVA 4ZYHA 2VN2A 5LRRA 5CJ9A 4I0AA 4M9XA 5CYVA 1XSXA 2C6YA 3HRSA 1SD4A 4IF4A 5CVIA 1T0FA 3WGIA 5L3CA 1RNLA 2HEOA 3K0LA 3EDPA 2MLGA 5IT3A 4IRIA 2IA2A 5J8FA 1IW7F 3WU0A 3CUQA 4CYDA 2P6TA 3N97A 5K5RA 2OZ6A 5JR3A 3CUQC 3V7SA 5LRSA 5ILSA 1TW2A 3ZN1A 2RN7A 2D1HA 3TQNA 3E5XA 2W84A 5HLHA 5E17F 1MJ9A 1LQ1A 2VE8A 1YTYA 5L3GA 4LGWA 4OIRF 1LVAA 1MZBA 1HKQA 1FPQA 5HLGA 4RS8A 1LB2A 1RI7A 1D8JA 4RB2C 3WTXC 1ONVA 1D8KA 1DPRA 2DI3A 5DCMB 3GO5A 2P7VB 5DCFA 3KEQA 2H27A 2VC0A 4I7HA 2O61A 2E7XA 1EV7A 4D0PA 4FT8A 3LAJA 2HQNA 3V8LA 3EUHA 3SXYA 1XCVA 5AIPA 2LSOA 1O3QA 3ZN0A 1H9GA 4CHUA 4K2EA 3J7AO 1KA8A 1E2XA 1BI3A 2ELHA 1FWZA 2X4HA 3QPHA 3HTUA 2LDUA 3FMRA 4XRFA 5DEQA 3U9GA 3QP6A 5ILVA 1U5TA 1WSUA 5CLSA 1ODDA 3QU6A 2Z99A 4BQAA 2D2WA 2FBHA 5KVRA 3KP2A 3FXUA 1IUYA 1P4XA 4P9FA 2L4AA 1XSVA 3FXQA 1B6AA 2E7WA 5BPIA 1DPUA 3J80Z 4KN7X 1BJAA 1UCRA 2HS5A 1BI1A 1ZN2A 1R5GA 2DFIA 4I2OA 3KZYA 2FNPA 4LMYA 2HGCA 1X3UA 2E1NA 1AWCA 3WTUC 2QZ8A 1S8NA 1BC8C 1Q1HA 2PI0A 2DK8A 4M9SA 4P55A 1SAXA 1WWXA 3FMSA 3H92A 2Y0MA 4S05A 3IRQA 1PUEE 2PMHA 2RVCA 4ESFA 2M5WA 4YFNF 5AONA 2ZFWA 4R1HA 2IPQX 1XGSA 1R5HA 4ON0A 1OYWA 3I5UA 2MBFA 4U0YA 1PDNC 2QQBA 1QZYA 5CVVA 2R7FA 2GWRA 2R3SA 3I59B 1T6SA 1ZRDA 3JSOA 2Z33A 3V7RA 4GXOA 4JBAA 2BYVE 2IT0A 4EMSA 2Q2EA 2K7LA 3F8FA 1S3JA 2NS0A 1FX7A 2X0LA 3I59A 4A12A 3E6CC 4L0ZB 1R00A 2XRNA 2RQPA 3BROA 4CDGA 2DQRA 3KFWX 1FBUA 1LDKB 2ADUA 4WCGA 1MD0A 4EV0A 2FF4A 2P6SA 2XASA 2O6GE 4KMFA 1QNTA 1OYYA 2YPRA 5HDNA 4PGGA 1BIBA 1T98A 4UUVA 2IJLA 2GAUA 2VODA 1U2WA 2IVMA 2DU9A 5E18F 1FBSA 3J81Z 1O3TA 3E6DA 3G73A 5CVRA 1V4RA 4O6JA 1IF1A 1IZ1A 3CTAA 4IVNA 2GA2A 2QUFA 3HIFA 3JW4A 1TQPA 4FX0A 3TO7A 2F5FA 5JHUA 1HW5A 1AOYA 2XKOA 4JK1X 1G3SA 4ZYGA 3ZMSA 4QWQA 1NHAA 1R36A 3PFIA 3WE2A 5LHGA 3GF2A 2JPCA 1YIOA 4P5OA 4XLPF 3P7NA 3HSEA 4KMUX 1FYLA 1XGMA 3RYRA 3KP7A 3RKWA 2XV4S 6PAXA 2A68F 5KK1A 4G7HF 1FY7A 1FOKA 1UHWA 4LB6B 4PZJA 5BMZA 4U7BA 1G3YA 5L3FA 1F5TA 3R61A 1RIOH 1W5TA 1R1UA 3LQQA 2VXZA 3TDZC 1OKRA 4OIPF 2XAGA 3GLXA 3WU1B 4LK0F 4XSXF 4EQQA 2DO7A 2FBIA 2GIVA 5HS9A 4FHTA 1Z1DA 2Q0OA 2FMYA 4ASNA 4TV7A 3BPVA 2EA4A 2PN6A 2VBWA 2NNYA 1G4DA 3ABUA 1RZ4A 3GZ5A 3LSTA 3Q5FA 5LBQA 2CO5A 3SQNA 2HFHA 3TKYA 4DNCA 2ZJ2A 2R7DA 4UV9A 4U7DA 1WRJA 2V1UA 2G7UA 3KLNA 2OD5A 5CVJA 3RJPA 5HS8A 5BPDA 4M71A 2F5EA 2XAHA 3DV8A 3F8NA 1JGSA 4HDUA 1ZREA 4N0BA 2W24A 1YS6A 1P2FA 1JXSA 2DQLA 1D5VA 5LEJA 1IN8A 1XGNA 3EETA 5DD8A 1R1VA 3JAMK 3COAC 2NRAC 4R79A 4JQFA 3SHFA 4RB3C 3FWEA 4ENNA 2XIGA 2V9VA 3TO9A 3DFGA 5D5VB 4O3MA 4BHBA 4EGYA 2M45A 2JRTA 2ZNYA 1ZLJA 3IKVA 2P8TA 3GWZA 5CVUA 3QRFF 1I1GA 3BJ6A 2ZCWA 1XDSA 1QBJA 1KYWA 3DPTA 5HOOA 4I09A 1ZG1A 4HLYA 1SFEA 3GX4X 1P4AA 3QOPA 3M7GA 4L9NA 2WWYA 2HOEA 2PQ8A 3REOA 1ZGAA 1R23A 4B09A 2GXGA 2MD5A 1P6RA 3NRVA 3WTWC 3JTGA 2A07F 3BOQA 3R60A 1GVJA 2XUBA 5D5XB 1XGOA 5EEGA 3MEXA 2VT3A 1YO5C 2JPBA 3JSPA 3GVAA 1R7JA 4M72A 4LFUA 2TDXA 1LJ9A 4HQEA 4ZH4F 4G8XA 4OMZA 5A2QK 2DLLA 5JFRA 2KIFA 1WKMA 1W7PB 3KP6A 3RPUA 2ACJA 2RC4A 3ZQ7A 4MHGA 4HX7A 5D4SA 1ZYRF 1PP8F 2W25A 3WODF 4YIIA 2P5KA 1CGPA 1KU2A 1O7LA 2CWEA 3OOPA 4KNYA 4EJOA 2HYFA 2G7HA 1CF7B 1UB9A 4EGZA 4UNOA 4WF2A 3D0SA 3DQVC 3IRRA 5BS6A 2K86A 1R22A 2A6HF 2XGXA 3LWFA 1CF7A 2HZTA 4L5JA 3KP3A 1ZG5A 5L3EA 2BGCA 1ON2A 2GXBA 2QENA 1ULYA 2MLKA 1FSHA 4LG0B 2J5OA 5D4RA 3VEPA 4CZZA 1C0WA 5DDGA 1MDMB 4IHSA 5FFZA 1FYKA 3ZMZA 1DDNA 4LG0A 4HV6A 3BY6A 4HZFA 2H09A 5DCMA 5E1XA 1E17A 2K4JA 3FMQA 2OZUA 4NQWA 2UZKA 1HBXG 3RYPA 4L9VA 2FXAA 4GYGA 2RV8A 4KIBA 3ZP5A 3RPQA 1ZRFA 3K1MA 1J5YA 3PQJA 2XROA 2YU3A 3ABTA 4HW0A 1JE8A 2F2EA 4HOBA 5EEHA 4RAZA 2CW0F 3LA7A 3R0AA 2A69F 2ETHA 1YFHA 2LF7A 1I1SA 1U3EM 4KN4X 5HDKA 4P96A 2STTA 1GXPA 4M74A 1IN6A 2HKOA 5K5QA 1IRGA 1FC3A 2FRHA 1OPCA 3GFLA 3L7WA 4E70A 2KKOA 3GXOA 3QU3A 5D8KB 3L9FA 2G9WA 4HF1A 3LA3A 4LJZF 4HLXA 1SMYF 3KLOA 4WX9A 2BE5F 1P4WA 2K4BA 1JHFA 1EH6A 2PMUA 3I58A 2XAFA 1GXQA 3HOTA 3F8BA 2DPUA 1Z05A 3ELKA 1A04A 5LGNA 4WK8F 4A5MA 4N9IA 4P9UA 1B9NA 3HRMA 3U1DA 4H0EA 3SZPA 4OINF 1HQCA 2M1BA 2P5VA 4HYEA 4BH9A 3KE2A 1TTYA 4EVIA 4L9JA 3GFJA 2EFQA 1YG2A 3LAPA 1DP7P 3F21A 3EYIA 2WTEA 3QAHA 4WWCA 1YW7A 2P5LC 4KYWA 1UHMA 2EV6A 4A2UA 1XSDA 3E97A 1W7PD 4HV5A 4KICA 3GEZA 4RB0A 2OAZA 3CO6C 4UV8A 4ESBA 3MQ0A 1T2KA 2EFWA 4M6YA 3O3KA 4QLCU 5IT9K 3WG9A 1XN7A 2EV0A 3I71A 3KP4A 2IP2A 4KIGA 1LDDA 2KJBA 3R6SA 1KU3A 4BHPA 1OR7A 3WTTC 5LHIA 4CGZA 1BM9A 4U0VA 1XMKA 3WTSC 2GA1A 2PBIA 1FBQA 1K78B 1YW9A 4ENJA 2NNNA 5ILUA 3B73A 3F23A 3SFZA 2NYXA 2HTSA 2OQGA 1KQ8A 1K78A 3BZ6A 3EQLF 1YW8A 4EM2A 1S7AA 3T0YA 2FQ3A 4IHTA 4I98B 3E3VA 1ZH5A 2FBKA 4CXFA 3ERED 4RAYA 2H94A 3M1EA 3KETA 2JZYA 4IJAA 5FD5A 4YFXF 1FP1D 1BOAA 3H3UA 4IPAA 4UXNA 1IXSB 5LHHA 4HX4A 1IXCA 1HKTA 1SD5A 1F1ZA 2ZBKA 1J2XA 4B8XA 1Z6RA 1TLHB 1U8RA 1REPC 3DXJF 3W6KB 1ZRCA 1J9IA 3CJNA 1IN5A 2ESNA 4GGGA 1I27A 2JSCA 1LDJA 2NAZA 4F7ZA 1ZARA 2MC3A 3JAMZ 5ICGA 1TNTA 3HRTA 2GQQA 3ZPLA 4Q4ZF 4HA8A 4EJWA 2DBBA 2YR2A 2EJRA 2F5DA 3CLOA 2YX7A 1FZPB 2FOKA 3C3WA 2QLZA 2CFXA 2LF8A 4WXHA 2FNAA 1BI2A 5E1ZB 4ENKA 2HQRA 1FLIA 3GFIA 3SZTA 4GCVA 2DK5A 3DPLC 3I4PA 1SD6A 2EFPA 1KQ9A 3U2RA 3L09A 4BAYA 1EH8A 3ISPA 2VOPA 3BP8A 3ULQB 2V1DA 3C7JA 4LK1F 1B9MA 2CG4A 1QO0D 5A2QZ 5D6EA 4RGSA 3L2CA 2ZKZA 3HSRA 3RI4A 1HXDA 3ZMDA 1QZZA 2Z5UA 3FM3A 1XD7A 3WTVC 4HAMA 1K7AA 3KEOA 2VE9A 2Y48A 2XKPA 4Y13A 4YIFA 4OU0A 1IAWA 4MQ9F 5F6FA 1H9TA 1FYMA 3HTSB 1ZAOA 5E20A 2J5PA 3I53A 1MJAA 4HBLA 4G94A 4U0WA 4XBFA 3R0JA 3MWMA 1DUXC 2A61A 1I5ZA 1BBYA 2O03A 1KYZA 3RTRA 2CGPA 2EB7A 2A6EF 2EV5A 3LFKA 2M8EA 4A5NA 3G3ZA 1HW1A 2PEXA 2EFNA 3K9TA 3VODA 2QQ9A 3BJOA 3EYYA 3ROUA 2A3SA 1UFMA 2RNJA 2XVCA 1YQAA 1XB4A 4CO8A 1BC7C 1LEAA 1IXRC 5DV5A 2UWMA 4I02A 1HW2A 1F4KA 3R4KA 3L00A 4YG2F 3TOBA 4Y15A 2ISZA 3O2PE 1L0OC
chains in the Genus database with same CATH superfamily
2DOEA 1MKMA 3HKZA 2QQ8A 2JVHA 4MNUA 2R5ZB 3TGNA 4IHYA 1J7KA 2HOAA 3I56I 3D5LA 5B5EC 1ZR4A 4XKBA 4IXAA 5DUIA 5F1RA 2Z9OA 1QHGA 1T08B 4HNVA 2Y9YA 1R58A 3F6OA 2Z16A 4RAFA 3KZIC 4BHCA 4PGHA 2Y9ZA 2P0WA 1ZGWA 4DGWB 2KQRA 1G3TA 5FLXK 2K9QA 3LA2A 2AHQA 1OJLA 3MZYA 1G8XA 1FNNA 1MBGA 4LD5A 3ZGKA 2WV0A 5HDGA 5ICCA 1WH5A 2P7CB 1T0FC 1SFXA 2O0YA 3QP5A 1HSJA 3CUQB 1JKPC 5ICFA 2ZJQF 1W7PA 3C18A 3M9AA 1TNSA 5FO5A 1TC3C 1DGRM 3T8RA 2OBPA 1NK2P 3M1CA 1TW3A 3CP2A 2NOGA 3V8JA 2FEZA 2R7TA 1Y39A 4RGXA 2R4GA 3T1BA 2Q1ZB 2YX4A 3N4MA 3TO6A 2IW5A 4OIOF 4KIFA 4NNJA 3FXKA 3K4LA 2O3FA 5DD4A 3MFKA 1WJFA 3LSJA 4AWXB 2D1VA 1ZR2A 4E7LA 5E1WA 3MN2A 3P9CA 2HPMA 3M3YJ 3HB9A 4G7ZF 1T8IA 3PQKA 1MMNA 4XSZF 3VFZA 3AG3H 1ZHFA 2E1MB 2FU4A 1Z9CA 4HF0A 3KP5A 1LEBA 4XORA 1USSA 2AQEA 3K1PA 4A6EA 2HR3A 3OSGA 3HEFA 3K69A 3W2VA 4HF2A 4EM0B 4ESJA 3AAFA 3IWZA 1ETWA 2X1CA 5GADJ 4XLCA 2WAQA 4L9TA 2L7MP 4XONA 4BYYA 5IOZA 5F0CA 1A36A 1V3FA 1RPWA 3ZMUA 3IHUA 4G6QA 3MVPA 3HOYJ 3IC7A 1O57A 3L2UA 2X6XA 4IQJA 5H20A 2HYGD 4FX4A 2E1MC 2V6CA 3HOSA 1LFBA 2LKSA 1JHHA 1FT9A 1YLFA 3ONQA 3RIRA 4C2TA 2F5CA 3CESA 3LQRA 3FHNA 2VKDA 2HQ5A 4XOTA 3TBIA 1VQ5I 4L0YB 4A3JJ 5JI6A 1XX5A 3M8FA 2H8RA 1MDMA 4IHVA 3EUKL 5KAIC 4AIKA 3RKYA 1ZGJA 3LSRA 4C2UA 5ICEA 1Z91A 4LIUA 3E6BA 4S0HB 3FF5A 2X85A 4OMYA 1W0TA 2VONA 4EJVA 1VF9A 4KITB 1G3WA 1T56A 2BV6A 2VT2A 2MG4A 5D8LB 4ZYEA 2VKVA 3FBIB 1DU6A 2CH0A 1EH7A 3CDIA 2XHKA 5TGTA 4XKWA 2QBYB 5BQTA 2BY0A 1XDUA 2A5YB 2HOTA 5AIQA 3VYUB 1QGPA 2KIUA 2ZMEB 4NHJA 4CCOA 2L7ZA 3BPXA 1CQTA 4HQMA 1B1BA 2CRGA 3V42A 3WE3A 3WGGA 4DQ2A 3MMYB 2QBYA 1JUMA 1HKSA 1S6LA 3FHZA 3RKXA 5H6QA 4PCQA 1A6QA 4KJZA 2ZMEA 4OAZA 4AYBN 2FSWA 4EJTA 1U5TB 4AIHA 2V1XA 3H5AA 4G6TB 2YSRA 3E0JB 2ZMEC 4GO1A 3S14J 2YUSA 5D5WB 2EFOA 1HOMA 2L01A 2HDDA 4A0ZA 1IN4A 2DYRH 2FQ4A 4RGUA 2XAQA 3HHHA 3GW2A 3V4GA 3BR3A 1IDZA 1LUJB 2OA4A 3EPZA 1JKQC 2ZO4A 3DLLF 2CV1A 1U5TC 1Z0XA 2EK5A 5IT9Z 1W4MA 4BXUA 1MBKA 3B6CA 2FA5A 2B63J 3OYCA 4II3A 1H0MA 3O6BB 1DP3A 1O3SA 4O5VA 2PJPA 1QQIA 3BCBA 5E3MA 1GVDA 5FD6A 2HZDA 2XC7A 1R4NB 3HC7A 3E5UA 4KT5C 4AYBA 1SEUA 2DN0A 4J01A 3G1OA 3HHGA 2XB0X 2ZJPF 5LLQA 2W57A 4A0XA 1WI9A 4ZDPA 5E8IA 3FXRA 2HTJA 2VOOA 2NVUB 1PP7U 1S5LC 4Y3OA 1OMIA 3OS2A 4ENMA 4XLEA 3CLQA 2XF6A 2VBXA 3TDUC 1LPQA 2HDCA 2LBFB 2VBYA 2FOWA 2LVSA 4RLQA 2KRFA 5EZGA 1U6GA 1GHCA 2AXTC 2OC6A 4XNFA 4I6ZA 3ZMVA 3E6MA 3K4BA 3PNVA 2DJIA 3F9KA 4X1EA 2MC4A 1I39A 4LLNA 3GBGA 3H5NA 3RDIA 3QQAA 4IOAF 1P7IA 1OFCX 4Q5SF 1LE8A 4AUXA 4P1WA 2LBFA 4MO7A 1N75A 3HYIA 2R7SA 1IRFA 5J47A 2H6BA 5E8GA 3GYHX 1F9NA 3G71I 1HA8A 3QPTA 2FE3A 3HZJA 2LNBA 1JT0A 1R71A 1LVKA 1STZA 1YIJI 3BR6A 3JRDA 3DEUA 3BG5A 2NS7A 1T38A 1WVRA 3FX3A 2EA2A 2M4KA 3SEQA 2N8GA 4G12A 4G6DA 5J4VA 1R9TJ 3ECOA 5TRDA 1YYVA 5ERIA 5L3BA 2EZKA 5GPAA 1RUOA 5B3SH 5K5OA 2MW8A 2K85A 3P9IA 5EEAA 3Q9VA 2P4WA 4CCJA 5FLVA 1SD7A 1Z7UA 2M2EA 4V2GA 5LEKA 1VQLI 3BDDA 1IRZA 4A0YA 1X4OA 2QGUA 4E7JA 3DBHB 3FZVA 4KFCA 3OY9A 5IOYA 3AKZA 2Q2EB 2EWNA 1WJAA 3DF8A 4G9YA 2VBZA 5M3MJ 3T8TA 2M30A 3WGHA 2JTVA 4MEYF 3S8PA 1YS7A 3CMYA 4IRGA 2V4JC 3G6EI 4OIQF 4BS9A 4AIJA 1BIAA 1KU7A 3HDDA 5BOXA 2JVGA 3MAJA 1I6XA 3IH3A 2NVXJ 4J00A 4AVPA 1S29A 1HSTA 3ZRGA 2DW4A 4Z2YA 2XGCA 3CCSI 2MA3A 1HDPA 3K4MA 3J80K 1OCTC 3CCJI 1HLVA 1U9OA 1W36D 4ETSA 2E60A 2HKXA 2K9SA 3B02A 4BXFA 4CA0A 3F22A 3IL2A 4PSWA 2H6CA 3HXLA 3U21A 4JX5A 4MTEA 2QCOA 1IC8A 2RGVA 3E5QA 1O3RA 3F8MA 1WHUA 3DKXA 3H0DA 1G6NA 4BEHA 3GFMA 3CC2I 3RQIA 4UUSB 4KDPA 3BTJA 1TBXA 1E3HA 3KCCA 2DA5A 1GUUA 1BI0A 2QEXI 4B47A 2TCTA 3PIPF 2M87A 1OYIA 2PLYA 1S7OA 1T39A 4HNUA 2OCEA 4RDUA 2BEOA 4RAGA 3BZCA 3GZNB 3NQOA 3CCQI 1BW5A 1EF4A 2XSDC 4MTDA 4RB1A 4AD9A 4X6AJ 4PJNA 4HX8A 1D3YA 2QYOA 1UMQA 3RKQA 2LFBA 4Q47A 2WC2A 4M6XA 1WQ2A 2R0QC 2Y0SN 2ID6A 4KT6A 4XLAA 1SFKA 2WADA 1UG2A 2CW8A 1ON1A 3M8EA 3GTLJ 4BJ5C 2BXYA 2W00A 2MH9A 2L7FP 4M9ZA 1UHSA 2DJNA 2LRDA 1OCOH 1USTA 3HUGB 1TQMA 3HOUJ 4KUMA 5K1YA 2DAOA 1X3ZB 1J0RA 4IRHA 4FQGA 4UVCA 4A6DA 4B3XA 2VASA 2CSOA 3CCRI 2Y75A 5HS7A 2VQCA 4D1QA 2CQKA 3TW7A 2AXLA 3HUGA 3VOEA 3WTZA 3KX2A 4HNTA 3IWFA 2V26A 2VC1A 4UVAA 4FCYA 2DT5A 2F4OB 2KIMA 5ED4A 2RDPA 1TQIA 2LYCA 4DOZA 3IV5A 4XQFA 1W5SA 3BWGA 3VWBA 4W1UA 1SMTA 3C1DA 3MCZA 2IA1A 5EG0B 1D0XA 4NC7A 5JVGF 1WJEA 1RETA 2KHMA 3OV8A 2B0LA 3CDHA 3VSLA 2Y0SA 1VQ7I 1BN5A 2OQRA 5IYCJ 2PFBA 1T95A 2LOOA 2JUGA 2VKEA 5KNLA 2K27A 2QVOA 1YE9A 3BR0A 3PUBA 4PFPA 5EZHA 1IN7A 2VL8A 5TJJA 1V55H 2VJ5A 4MGRA 4ZYDA 4IZZA 2ISYA 2BBYA 2M0MA 4BACA 2HDWA 3I64A 1FIPA 3K2ZA 1U78A 3LSGA 3ML6A 4PDKA 2BZTA 3CCMI 2OU2A 2K02A 2ZNZA 4UHTA 3PJRA 4YFKF 1K79A 3L2RA 1MSEC 1FSEA 1LNWA 1NH3A 3RZDJ 4NB5A 4HDVA 2Z1DA 4ZZDA 2IA0A 2L02A 3O8HA 2KL4A 5J1YA 4MEXF 4WXCA 1XCBA 5JVTA 1YHQI 3TL4X 2EQRA 5HVQC 3P9KA 2D45A 3OYLA 1MJBA 2Q8KA 3W3CA 2CU7A 2HYJA 1IO2A 5F64A 2HWVA 2ZXJA 5J8CA 4ABZA 3CC7I 3GUDA 5DUKA 3OMYA 4L5IA 1J75A 2E2IJ 2MH2A 3HRUA 5D5UB 3I9V2 3S2WA 3SEZA 2CFOA 2DTRA 4M3DA 2Y69H 1O7FA 5DYMA 4Y17A 4XICA 3I0TA 4BJ6C 1MNDA 5FJ8J 4G7OF 5K7ZA 2GZWA 3CZ6A 1KU9A 2CV0A 3ZQQA 3K7AJ 3IKTA 2XAJA 4FISA 2IRFG 2PG4A 3Q0WA 3QPSA 1ZKGA 5LGUA 1D0YA 5IP9J 3J81K 1QPMA 3VB2A 2WA0A 4UB6C 4JP0A 4LLLA 2BHYA 1IG7A 3DP7A 3JREA 2KISA 5C4JJ 1B4AA 4OWRB 4LLGF 4RM3A 3NEUA 2QWWA 1JKOC 2COMA 3I54A 1B8IA 3DKWA 1FIAA 3OYEA 4QPOA 5FFXA 5HLIA 2ZSHB 5D6FA 2HVQA 1KQ0A 2JT1A 4UUTA 4KA4A 4GYIA 2I10A 5CPRB 1MGTA 5L3DA 2Z3YA 1L3LA 4IHWA 3ZXSA 3H9JA 4OOIA 2EILH 5DTDA 4DBQA 4Q48A 5LGTA 4BNCA 4XOPA 3HSFA 3OYIA 1NTCA 1P92A 2VQGA 2X51A 3WTYC 2TRTA 3FXJA 1A35A 1Y0UA 3H36A 4WXDA 4EJUA 3BR2A 3JTHA 5FLXZ 2LKPA 3F3XA 2HXOA 2VJJA 2PX9A 1R1TA 2O8XA 4M73A 3GTJJ 1FTTA 4R8HA 4ZZLA 2V6EA 2DODA 3TOAA 3V8KA 1W1WE 2QQAA 3FM5A 1J59A 2QKMB 2L4MA 3KZZA 3V7CA 1SFUA 4I01A 2UXXA 3ASOH 3JRAA 3H3ZA 2RKHA 4RGRA 3NWTA 1ZLKA 5J6XA 2QSHX 2W85A 4BL0B 3OR2C 2JRMA 2QM3A 2KJCA 4JX6A 4BUPA 1BJZA 3ZMTA 2HNHA 3F8CA 5H6RA 4S04A 1AHDP 1XMAA 1RUNA 4EM1A 2CUJA 2XDVA 3Q9SA 3CUOA 1Z6TA 3UNGC 3GZ6A 4IO9F 1YITI 3AG1H 5FB2A 2GOMA 3W6JB 1MH4A 3T5XA 3HOWJ 1P9QC 2L3DA 1UAAA 1QHHD 2L54A 4N9HA 1VTNC 4DYQA 4O3MA 1MH3A 4U88A 1YRNB 2AS5F 2UXNA 1OCCH 5FGMA 2DPDA 3F72A 3ECHA 5J1UA 3JRCA 5M5WJ 3CCYA 4BE2A 1FP2A 4LB5A 2STWA 3DTIA 2X9DA 1Y6IA 3BJAA 4LITA 4CICA 5F08A 3K1NA 4GDFA 4A3DJ 2E1CA 3CJQB 3F6VA 3CCUI 2H1LA 1B59A 3K4KA 1K6OA 2YS9A 3D5RC 2A05A 3CO7C 4PUSA 2CYYA 2FMLA 2V79A 4XLNF 3PFYA 4I0BA 3OYAA 2CUEA 1KGSA 1TWHJ 2L9VA 4MLOA 4UVBA 3H3VK 2ESHA 3MZHA 4L18B 5E3NA 4AIDA 3JCUC 3C2BA 1ZG3A 2F4IA 3SDBA 2HVRA 2BVMA 4MQVA 2VN2A 4ZYHA 4F55A 1RR7A 5LRRA 5CJ9A 4LG3A 4C3IJ 4I0AA 3MD2A 1ZTRA 4M9XA 3L1PA 2PJRA 3FK6A 5EGOB 5CYVA 5FKMA 5F27A 1XSXA 2MSYA 4F93B 2R5ZA 5IP6A 2C6YA 3MKWB 3HRSA 1ETVA 1SD4A 3FDYA 2OTLI 4IF4A 5CVIA 3FIWA 2F5VA 1T0FA 2VXDA 3WGIA 3KYCB 5L3CA 3GTOJ 4GFBA 1RNLA 2HEOA 2E35A 3OL4A 3K4CA 3K0LA 4RA2A 3EDPA 3UR3C 4XIDA 1PUFB 1H89C 4BKXA 2MLGA 2L0KA 5IT3A 4IRIA 4Y7NJ 4W97A 5F0HA 2IA2A 3NARA 5J8FA 1Z21A 1IW7F 3WU0A 1WJBA 3CUQA 4CYDA 2P6TA 2EZIA 3N97A 5K5RA 5IYBJ 3HGGA 4YEJA 2OZ6A 4NC6A 1RKWA 5JR3A 1D1AA 3PO3J 2IGMA 1OCPA 3CDLA 2B7EA 4B43A 3CUQC 3KIOA 3V7SA 2E1OA 3K10A 5LRSA 1K61A 5ILSA 1TW2A 4A3KJ 3ZN1A 2QSFX 4UB8C 2PMZN 2RN7A 4IEJA 3S3MA 3ZR8X 2D1HA 2VQLA 3TQNA 3E5XA 1V54H 3GTPJ 2OCCH 5CQGA 2W84A 5HLHA 1U0JA 2KRCA 1NG6A 3PM1A 4D5CA 4A3CJ 5E17F 2DA7A 1MJ9A 1A5JA 1W36C 4GRIA 1LQ1A 4B3AA 2VE8A 1YTYA 4E7IA 1QPIA 5L3GA 2K9MA 3I3LA 2D5VA 5IY5H 4FETA 4LGWA 4ZTFA 4OIRF 2GM4A 1LVAA 1I3QJ 1MZBA 3F0CA 1HKQA 1FPQA 2JA8J 5HLGA 3HOZJ 4RS8A 5B1AH 5HNFA 1LB2A 2IS2A 1RI7A 5LFAA 1S72I 1WJDA 1X1DA 3OS1A 1D8JA 4DIQA 4IKFA 4RB2C 4F3QA 1VI0A 1ONVA 3WTXC 3GMEA 2Y30A 1D8KA 1R5ID 2BVLA 1DPRA 2DI3A 3OOUA 3GO5A 3DU5A 5DCMB 2ELJA 2P7VB 5DCFA 1POGA 1WI3A 3KEQA 3C2HA 4A69C 2H27A 4M3FA 3CMAI 2COBA 2VC0A 3W2AA 1FMWA 3DU6A 3MKLA 3IH4A 4I7HA 2M7BA 2O61A 3K2AA 2E7XA 5IPAA 3NAUA 4E7SA 2VPRA 1EV7A 4D0PA 2VKHA 4FT8A 2ZSIB 4HPQA 3LAJA 2HQNA 2KIQA 3V8LA 3EUHA 3SXYA 1XCVA 5AIPA 2LSOA 3BR1A 1U9NA 3OYNA 1O3QA 2OPTA 2DCEA 3ZN0A 3EUHC 1H9GA 4CHUA 4K2EA 3J7AO 1KA8A 1E2XA 1BI3A 3DEEA 3H35A 2LY1A 2OJED 4BU2A 2ELHA 2HVSA 2JA5J 2UUZA 2OTJI 1FWZA 2X4HA 3LSIA 2JA7J 4C2MJ 3QPHA 5LD2C 3HTUA 2LDUA 3FMRA 4XRFA 2LMDA 5DEQA 5FKOA 3U9GA 4C3HJ 4BQQA 3QP6A 2KT0A 5ILVA 1U5TA 3HPHA 4MIMA 4D9JA 1WSUA 3PUFA 3VSKA 2ZXIA 5GAHJ 5CLSA 1ODDA 3QU6A 1N25A 2XB5A 2Z99A 3A0HC 4BQAA 2D2WA 2FBHA 5KVRA 1E3OC 3KP2A 3FXUA 4U87A 1IUYA 1BOBA 1P4XA 1HCRA 2L9SA 1Y0NA 4P9FA 2L4AA 5EJCA 1XSVA 3FXQA 1B6AA 2R7XA 1BR1A 3OYDA 2E7WA 5BPIA 1DPUA 3J80Z 2EPFA 2EIJH 4D7MA 1TWFJ 2ME0A 4KN7X 1BJAA 5FLMJ 1UCRA 2HS5A 1BI1A 1ZN2A 3OYHA 5FKLA 1R5GA 2JA2A 2DFIA 4I2OA 2Y2ZA 2CUZA 3ESWB 3KZYA 2FNPA 2HI3A 2BXZA 3ABMH 4LMYA 1SVLA 2HGCA 4DW6A 1X3UA 1WH7A 2E1NA 3A1YA 1AWCA 3WTUC 2QZ8A 3FXOA 1S8NA 2DMPA 2LK2A 3LOCA 1BC8C 4JX4A 1Q1HA 4DJAA 1G59A 2G0EA 2JWTA 1YX5A 3CP8A 2PI0A 2DK8A 2KDZA 4M9SA 4P55A 2LY2A 1J09A 2FD5A 1SAXA 1WWXA 2KP6A 4CSWA 2IS1A 3FMSA 3LSMA 3H92A 2Y0MA 4S05A 3IRQA 1PUEE 2PMHA 2RVCA 1W5CC 1ITYA 1D1BA 4ESFA 1T33A 3A4CA 5IYDJ 5K7FA 2EZLA 1M1EB 2M5WA 5AONA 2ZFWA 4R1HA 2IPQX 3FKJA 4D5FA 4YFNF 3CCEI 1XGSA 1R5HA 1AU7A 2EBIA 4ON0A 1OYWA 3I5UA 2HOSA 3PNYA 2CJJA 2MBFA 3OYJA 2OUMA 4U0YA 1IRXA 1ENHA 2QQBA 1PDNC 1QZYA 4NC8A 5CVVA 2R7VA 2R7FA 3IAM2 2GWRA 3RPUD 2R3SA 4FE7A 3ASNH 3I59B 4N4NB 2WV1A 4IQ4A 1T6SA 2DDBA 4E7HA 4XKVA 1ZRDA 3JSOA 2L2OA 2IGOA 3V7RA 2Z33A 1N77A 5FROA 4GXOA 4JBAA 3NWSA 3HM5A 2NVYJ 2BYVE 2IS4A 3ERMA 4DZJA 2IT0A 4PJMA 2Q2EA 1KONA 4EMSA 2K7LA 3F8FA 1S3JA 2NS0A 1FX7A 2ECCA 2X0LA 3I59A 2CV2A 3IP4B 2R7OA 2KRHA 4EATA 1NK3P 4A12A 3HOXJ 3OYGA 3E6CC 2DMUA 4L0ZB 5JLWA 1R00A 2O7OA 3LFUA 1DU0A 2XRNA 4CH7A 3DKYA 2RQPA 3BROA 4CDGA 2DQRA 3CD6I 3KFWX 4M3BA 1R49A 1FBUA 1PVEA 1LDKB 1Z3YA 2ADUA 5GAGJ 3J7YJ 2V7FA 3A0BC 4WCGA 1MD0A 2EH3A 4EV0A 3RSNA 2FF4A 2P6SA 2K40A 2XASA 2O6GE 1OCRH 4KMFA 3D5SC 1QNTA 2IS6A 3OYFA 1OYYA 2CUFA 4XN0A 2XGDA 4UUSA 1F43A 4A93J 2YPRA 5HDNA 4PGGA 1BIBA 4DZPA 1T98A 5H2FC 2JMWA 4UUVA 2IJLA 4ZYAA 3FXMA 2LD5A 2GAUA 2JK3A 5B66C 2CQQA 2VODA 1U2WA 3H1CA 2IVMA 3M8JA 2DU9A 3WG7H 3MKYB 5E18F 1FBSA 2AQFA 3J81Z 1O3TA 3E6DA 3HG9A 3G73A 1V5FA 1ETXA 3J7ZI 2JUCA 3BCAA 5CVRA 2VUMJ 1GT0C 1V4RA 2ICWG 1QU3A 4O6JA 1X4PA 1IF1A 4LOCA 3OYMA 3ABLH 2UV1A 1R4MB 1IZ1A 3CTAA 4IVNA 2QA4I 2GA2A 2QUFA 3HIFA 3JW4A 1EKEA 3S2DJ 2DA1A 1TQPA 4UY8I 4FX0A 5E79C 2F48A 3TO7A 2F5FA 5JHUA 1HF0A 4Y33A 1HW5A 1AOYA 2DOAA 2FUG2 3U1KA 3DPUA 1XPXA 4KISA 3B6AA 2XKOA 4JK1X 2IEKA 3S15J 1IDYA 2F6CA 4A3MJ 2NS8A 1G3SA 2M34A 4IL6C 4ZYGA 5GAEJ 3ZMSA 4QWQA 5EG0A 2HU9A 1NHAA 4F91B 2HXIA 1R36A 4IX7A 3PFIA 3WE2A 5LHGA 3BTCA 3GF2A 2XPVA 3DWLE 2JPCA 4CYCB 2KMUA 3ZQFA 2KLOA 2YU9J 2WAFA 1FOYA 1YIOA 4P5OA 4XLPF 3OR1C 3P7NA 3RZOJ 3HSEA 4KMUX 2E5ZA 1FYLA 1XGMA 3RYRA 3QYBA 3KP7A 3RKWA 2BY3A 2ZB9A 2XV4S 3KYLA 6PAXA 2A68F 3BG9A 4YIRX 3ZQCA 5KK1A 4JYKA 2M8GX 1XMXA 2DFFA 2LY9A 1R6RA 1FY7A 4G7HF 1FOKA 2Z2SB 3TMOA 1UHWA 4LB6B 1MBFA 4PZJA 5BMZA 4U7BA 5M3FJ 1G3YA 2LTPA 1GV5A 2ZXHA 3HBLA 4XM3A 4BQOA 5L3FA 5CQEA 1F5TA 3R61A 1RIOH 3CF5F 3OIQA 1W5TA 1R1UA 3LQQA 4XL9A 2W4SA 2VXZA 3TDZC 1VQPI 4A3GJ 1A6IA 1OKRA 4OIPF 1X1PA 3IUOA 1Y56A 2XAGA 5TISC 3W2WA 3GLXA 1RESA 3FBNB 3WU1B 4LK0F 4XSXF 1TL8A 4EQQA 4YRVA 2DO7A 1EA3A 1PJRA 2FBIA 2GIVA 5EYRA 5HS9A 3VYSB 4FHTA 5JLXA 1Z1DA 2Q0OA 1TP4A 4II2A 2FMYA 4ASNA 1SVMA 4TV7A 3BPVA 2EA4A 3OYBA 1S9HA 1JTYA 3Q3SA 2PN6A 2VBWA 2NNYA 1G4DA 3ABUA 1S7EA 2WY8Q 4BDZA 1RZ4A 2GIZA 3GZ5A 3LSTA 3Q5FA 2MFZA 4HSTA 5LBQA 2K9LA 2CO5A 1VQOI 3SQNA 2IGNA 2HFHA 3TKYA 4DNCA 2CMPA 2ZJ2A 2R7DA 2I5UA 1WPKA 3A2KA 4BJTA 3S16J 1GDTA 1X2NA 4UV9A 4U7DA 1WRJA 1FJLA 2V1UA 3BT9A 2G7UA 1ORKA 3KLNA 2AO9A 2OD5A 3QOEA 5CVJA 3RJPA 5HS8A 5BPDA 2V9KA 4M71A 1DGWY 2F5EA 1H88C 3G4SI 2XAHA 3DV8A 3F8NA 1JGSA 4HDUA 1ZREA 4N0BA 3L2QA 3J7AY 3S17J 1IUFA 1BR4A 2FJ1A 2W24A 4H4KC 3D1NI 1YS6A 1B72B 2ECBA 1P2FA 1ETYA 1D1CA 1JXSA 2DQLA 1D5VA 1WJCA 1G2HA 3K6GA 1SANA 3ABKH 4XLFA 5LEJA 3GTGJ 1IN8A 4XLHA 3H9QA 1MBJA 1XGNA 3EETA 5DD8A 1R1VA 3JAMK 3COAC 3TW6A 4R79A 4JQFA 2NRAC 1DQUA 1V5GA 2KDOA 2MABA 3FWEA 3SHFA 3ZQIA 4RB3C 3JRIA 3ZOBA 4ENNA 2XIGA 2E2HJ 2V9VA 2JN6A 2O5RA 1ACIA 3TO9A 3DFGA 5D5VB 2M4GA 2VJ4A 1VFCA 4BHBA 4EGYA 3FK7A 2M45A 2XAUA 4FTHA 2DOFA 3TEDA 2R7QA 3S93A 2JRTA 2ZNYA 4EEFG 3OSFA 1YRNA 1ZLJA 3IKVA 2P8TA 4PK4A 4XMYA 2XPUA 3WHBA 2M3AA 2ZFUA 3GWZA 1LFUP 5CVUA 3QRFF 1I1GA 3BJ6A 2ZCWA 1FTZA 1XDSA 3BG7A 1QBJA 2JSPA 1KYWA 5HNHA 4CZCA 3KYDB 2I8DA 4QPQA 2LP0A 3DPTA 3GCMA 2DFEA 5HOOA 4I09A 1MNEA 1ZG1A 3FXLA 3FISA 4HLYA 1SFEA 3GX4X 5J40A 1JKRC 5J4YA 1MNMC 2DT6A 3VYRB 1P4AA 3QOPA 2QF7A 3M7GA 4L9NA 4NBQA 2WWYA 3K4JA 2HOEA 4XR6A 2PQ8A 3REOA 1ZGAA 1R23A 4I99C 4B09A 2GXGA 2MD5A 1P6RA 3NRVA 3OIPA 3WTWC 2DXIA 1Y1WJ 3OYKA 3CMMA 3JTGA 3CF2A 2A07F 2LKXA 3BOQA 2DTZA 3R60A 1GVJA 2XUBA 5D5XB 1VQ6I 5EGOA 2MYSA 5DM6F 1XGOA 5EEGA 3A01B 3LL7A 1YOVB 3MEXA 2VT3A 1YO5C 4BDYA 1Z3XA 2JPBA 1PYVA 3JSPA 3GVAA 4M6VA 1R7JA 4M72A 4LFUA 2TDXA 1LJ9A 4HQEA 1GLNA 4G8XA 4OMZA 4ZH4F 5A2QK 2DLLA 3GTKJ 3AG2H 4PJLA 3IAS2 3A01A 5E3LA 5JFRA 1JT6A 1UG0A 2KIFA 1FOWA 1IV6A 1WKMA 1RC9A 1W7PB 1XTAA 4A3EJ 3KP6A 1PUFA 2IBDA 3RPUA 4ITVA 3W6VA 2ACJA 2RC4A 3EUAA 1WZ2A 3ZQ7A 4MHGA 4HX7A 5D4SA 1WJ5A 1ZYRF 1X58A 2FX0A 2WAQN 1PP8F 1OISA 5BNGA 2W25A 2ID3A 3WODF 4YIIA 3DTEA 2P5KA 1CGPA 1KU2A 1O7LA 1APLC 2CWEA 3OOPA 4KNYA 3PNTA 3MZ8A 4QTRA 4EJOA 2KPMA 1WCMJ 3QODA 2HYFA 2VI6A 5FRNA 5C4XJ 2G7HA 1YI2I 1CF7B 1UB9A 1JGGA 4EGZA 4UNOA 4WF2A 3D0SA 4YELA 4N4OB 3DQVC 3IRRA 2R7WA 5BS6A 2K86A 2BY2A 1O4XA 2L9RA 1TZLA 2LR8A 1R22A 3ZQLA 3HOVJ 2W1OA 1D5YA 1H8AC 2A6HF 2XGXA 3G1LA 3LWFA 1CF7A 1XG1A 1I50J 3I4MJ 2HZTA 4L5JA 2VPLA 3KP3A 1ZG5A 5L3EA 2BGCA 1ON2A 4Z6YA 3H5RA 2GXBA 2QENA 5F0FA 2PMZA 3MKZA 3BTLA 1ULYA 1XC5A 1IV8A 3PL8A 1JUSA 2E2JJ 2MLKA 3VDXA 2R7ZJ 1ERDA 1FEXA 1FSHA 1I6HJ 4LG0B 2J5OA 5D4RA 3VEPA 5M5XJ 4HEA2 3HJEA 4CZZA 3S3NA 1C0WA 5DDGA 2VB6A 1MDMB 4IHSA 2R93J 4CCLA 1ZQ3P 1JI8A 2KZGA 5FFZA 3SDGA 1FYKA 1KZHA 1TWAJ 2NOJB 1ZELA 3ZMZA 1DDNA 4LG0A 4NQWB 1WFXA 4HV6A 4AVZA 3BY6A 1RR8C 4XRSA 1MMSA 4FASD 4HZFA 2JQ7A 2M0CA 2H09A 5DCMA 5E1XA 1HDDC 3IH2A 1E17A 4XRSG 2K4JA 2OV7A 3FMQA 2OZUA 4NQWA 2UZKA 2NVTJ 1F36A 1HBXG 1Y8RB 3RYPA 4B4CA 1V5EA 4A3BJ 2H1KA 4L9VA 2FXAA 4ANJA 4GYGA 2R7UA 2RV8A 4KIBA 4F92B 4HG2A 1BW6A 3RPQA 3ZP5A 2E34A 1ZRFA 2ELKA 3K1MA 1J5YA 3PQJA 4BY1J 2HQAA 2GOXB 2XROA 3JR9A 2O8KA 2YU3A 2JA6J 3BLYA 3ABTA 4HW0A 1JE8A 2F2EA 4HOBA 4XN3A 1XS9A 4E7ZA 2IAIA 2M9HA 5EEHA 1MBEA 2CW0F 4RAZA 3LA7A 3R0AA 1BR2A 2ZXWH 2A69F 2MD0A 2ETHA 5DM7F 4PJJA 2X6WA 4RBOA 3S1MJ 1YFHA 4E4HA 2XF7A 2L9NA 3I4NJ 2EIKH 2W48A 3JRGA 3S32A 4BBRJ 2LF7A 3S1RJ 1I1SA 2QKLB 1U3EM 4KN4X 5HDKA 4P96A 2STTA 1GXPA 4M74A 1IN6A 2RNGA 4B1RA 2HKOA 5K5QA 5K7HA 1IRGA 1FC3A 2FRHA 1OPCA 1VNDA 3GFLA 3L7WA 4E70A 1JUPA 4A3LJ 3HGYA 3VPRA 1JJ8C 2KKOA 3GXOA 3QU3A 5D8KB 3SZGA 5C3EJ 1ZK8A 2WY7Q 3L9FA 3JRBA 1U8BA 2G9WA 3OL3A 4E6KG 4HF1A 2LC2A 3QPLA 2GBYA 3LA3A 4LJZF 4HLXA 1SMYF 4C3JJ 2GXAA 3KLOA 3Q0VA 5J1RA 4WX9A 1K6YA 2BE5F 1P4WA 2K4BA 3HL2A 3ZCOA 4CCNA 1P7JA 3QWLA 2DMNA 1JHFA 1EH6A 2PMUA 4MFDA 2X1DA 3I58A 2DMQA 2XAFA 3OS0A 1GXQA 3HOTA 2WB1N 3F8BA 2DPUA 4M3EA 1UJ8A 2OF7A 2VLAA 1Z05A 1SC7A 3G2BA 1I3AA 4XK4A 3PSFA 3SYTA 4BBSJ 3ELKA 1A04A 5EF6A 2BHZA 1LE8B 5LGNA 1QVTA 4WK8F 4A5MA 4N9IA 1ETQA 2ZJRF 2RQQA 4P9UA 5F04A 2W7NA 1MMGA 1B9NA 3HRMA 3U1DA 4V19K 3QYFA 3BTIA 4H0EA 1BL0A 3SZPA 1Z67A 2CW7A 4OINF 3JRFA 1HQCA 2M1BA 1Q1VA 2XGEA 2P5VA 4HYEA 4BH9A 4D7NA 3KE2A 3M07A 4RMNA 4BE1A 1TTYA 4EVIA 5HLTA 4L9JA 3GFJA 2EFQA 5GTHC 1YG2A 2XSJC 3LAPA 1DP7P 3F21A 1SVOA 3EYIA 5KAFC 2Y31A 2WTEA 3QAHA 4JOMA 3K70C 5E3OA 2X1EA 2WB1A 3L2WA 2R7RA 4WWCA 2ZC2A 2LG4A 1E0EA 1YW7A 2F4MB 3E1SA 1FOXA 4CCMA 2P5LC 5FKKA 4KYWA 1IJWC 4PFOA 2EIMH 4ZJZA 3A03A 1UHMA 2EV6A 2NVQJ 4A2UA 1XSDA 1HC8A 3E97A 3SFIA 1W7PD 2RREA 3CCLI 2R5YB 4HV5A 4KICA 1Y1VJ 3GEZA 4RB0A 1Z7LA 2OAZA 3I55I 3CO6C 3N05A 1VQ8I 4UV8A 4ESBA 1UZCA 2DA2A 3MQ0A 1T2KA 2EFWA 4M6YA 1VQMI 2BW3B 4M3GA 3O3KA 1OCZH 1OLTA 4QLCU 1SFOJ 4E7KA 2R5YA 4AU7A 2E71A 5IT9K 3WG9A 1XN7A 2EV0A 3I71A 4IOCF 1W0UA 3KP4A 4MFEA 1TWGJ 2IP2A 2BOLA 2BW3A 4KIGA 2L7KA 3OWTA 3RQ4A 1LDDA 2WBMA 4XRMA 4BEHB 1JTXA 2KJBA 3R6SA 1KU3A 2IXSA 4BHPA 1YJ9I 1OR7A 1YJWI 3WTTC 3CCVI 5LHIA 2A5WA 3S2HJ 3UKGA 1BM9A 3S3OA 4U0VA 4CGZA 4AC0A 1OR7C 1XMKA 3KPHA 3WTSC 2GA1A 4HRIA 1LKXA 3GTQJ 3BQYA 2PBIA 1FBQA 1QRYA 4ZC3A 2V1NA 3ZQHA 5GP9A 1K78B 1MMAA 1YW9A 4ENJA 2K3FA 5KHDA 2NNNA 5ILUA 3B73A 1LFPA 3F23A 2DA6A 3SFZA 4A3IJ 2NYXA 2HTSA 2OQGA 3O8GA 2XPWA 1KQ8A 1K78A 3BZ6A 3EQLF 1YW8A 4EM2A 1S7AA 3SJMA 3T0YA 1VQKI 2FQ3A 1AKHB 2HPIA 5F1JA 4IHTA 3BG3A 4I98B 3E3VA 3ZQGA 1ZH5A 2FBKA 4CXFA 3ERED 2IGKA 4C9YA 4AM3A 3CC4I 4RAYA 2H94A 3M1EA 3KETA 5JHFA 1AKHA 3G1MA 1TT5B 2JZYA 3DBRB 4IJAA 4CUGA 5GTIC 5FD5A 3LNQA 3QYEA 1MMDA 4YFXF 2CS3A 1X3WB 1FP1D 1BOAA 1X1BA 4QIWN 1K4TA 1AA7A 1GV2A 3LSKA 2X6YA 3H3UA 4DYRA 4ZTJA 4IPAA 1UELB 1IXSB 2E5NA 4UXNA 3PSIA 5LHHA 4HX4A 3DLAA 1X1AA 1IXCA 4HSRA 1HKTA 1SD5A 2WAEA 3AG4H 3TP3A 4A3FJ 1F1ZA 3HPGA 2ZBKA 1K83J 4DYCA 1VQ4I 2ME6A 5B1BH 1J2XA 4B8XA 3FKIJ 3X2QH 1Z6RA 1JJ6C 2P81A 1TLHB 1VQNI 2V9PA 4F52A 1U8RA 1N78A 4CYCA 2DYSH 3DTKA 4NDLA 2L5QA 3BQZA 4XKCA 1REPC 3C2GA 3DXJF 5M5YJ 5CKTA 3W6KB 5EDNA 2JJ7A 1ZRCA 1ETOA 3CJNA 5DS9A 1IN5A 1J9IA 4RLFA 2ESNA 4GGGA 3CMEI 1I27A 2XRLA 1MW7A 2K5CA 4RM2A 5GPCA 2DA4A 1FMVA 2JSCA 4BE0A 4C30A 1LDJA 2NAZA 4F7ZA 1ZARA 2MC3A 3JAMZ 5ICGA 1TNTA 3S1QJ 3HRTA 4L5EA 2O9LA 2GQQA 2E19A 3ZPLA 1NG7A 1Y8QB 4Q4ZF 2MGQA 4HA8A 4EJWA 2DBBA 2YR2A 3JRHA 1X1CA 2EJRA 2F5DA 3P5JA 9ANTA 3CLOA 3GLLA 1TT0A 2YX7A 2LH9A 1EJ9A 1SAUA 2X6OA 1FZPB 2QSGX 1RRJA 4Y4RA 2FOKA 3KEYA 3DCFA 1QA6A 3BR5A 2DT7B 3C3WA 3AL0B 2QLZA 2CFXA 4PSXA 4B48A 1B8IB 3H0GJ 2XF5A 2LF8A 4WXHA 1YJNI 2FNAA 1QVUA 3RCOA 2CQNA 3L2VA 2DA3A 1MIJA 2NXNB 1BI2A 5E1ZB 4J19A 2GLOA 4ENKA 3GTMJ 2HQRA 1OQYA 1FLIA 3GFIA 3SZTA 4GCVA 2DK5A 3AL0C 3E7LA 3K70D 1MSFC 1MBHA 3DPLC 3H9GA 2DFHA 3I4PA 1ETKA 1SD6A 1D0ZA 1TWCJ 4FE4A 3M4OJ 2X48A 2EFPA 1A31A 2R92J 3S1NJ 1KQ9A 3U2RA 3L09A 4BAYA 1EH8A 2E36A 2M7AA 4I76A 2VJIA 3ISPA 2VOPA 3BP8A 4LIVA 3ULQB 2V1DA 3C7JA 4CCKA 1QZEA 4LK1F 1B9MA 2CG4A 2K3PA 1VQ9I 1QO0D 5HODA 5A2QZ 5D6EA 1X19A 2VQHA 4RGSA 3L2CA 2ZKZA 3CJTB 3HSRA 1VZ0A 4QSHA 3RI4A 1HXDA 2RAEA 5KCMA 3ZMDA 1QZZA 2Z5UA 2BY1A 1IGNA 3FM3A 1XD7A 3A02A 3WTVC 2DDAA 3LMMA 4HAMA 1K4SA 1K7AA 3KEOA 3LSPA 3BC8A 3BZKA 2KFDA 2VE9A 1YX3A 2LREA 2VIXA 2Y48A 4X0GA 2XKPA 4Y13A 4YIFA 3PIOF 4OU0A 1RKTA 4DBRA 4MQ9F 1IAWA 5F6FA 1BA5A 5FRMA 1H9TA 3CJRB 1FYMA 3OIOA 3HTSB 4BGDA 1ZAOA 5E20A 2J5PA 1B72A 3I53A 1MJAA 4HBLA 3K4NA 4G94A 3WU2C 2DMTA 4U0WA 4XBFA 4IHXA 3R0JA 3MWMA 4BXXJ 2KZVA 1DUXC 2A61A 1I5ZA 4OAYA 4NUBA 1BBYA 3AFHA 2O03A 1KYZA 1Z77A 3HKZN 3RTRA 4ZDLA 3Q0UA 2CGPA 2EB7A 2A6EF 2A6TA 1WGXA 2EV5A 2M8EA 3LFKA 2LLKA 4A5NA 3WHCA 4V2FA 3G3ZA 5J3LA 1HW1A 2PEXA 5FKNA 1E3PA 2EZHA 2EFNA 3K9TA 2B9SA 4BY7J 3VODA 3VYTB 2QQ9A 3BJOA 3EYYA 3DEWA 4B44A 3BG6A 3ROUA 2A3SA 5C44J 1UFMA 1X2MA 2RNJA 4ZDOA 2W82A 3DBLB 2XVCA 1YQAA 1XB4A 4Y52J 2CQ7A 4CO8A 1BC7C 1LEAA 2H8WA 1IXRC 5DV5A 2UWMA 5IP7J 2K9NA 3PO2J 4I02A 1HW2A 2EINH 1F4KA 3CQZJ 3L00A 3R4KA 4YG2F 3LSHA 3TP0A 3TOBA 4Y15A 2ISZA 2CQXA 2PJRB 4PJ0C 4BQNA 3O2PE 1L0OC
chains in the Genus database with same CATH topology
1MKMA 4MNUA 3TGNA 1J7KA 3D5LA 4IXAA 5DUIA 5F1RA 2Z9OA 1R58A 3F6OA 4BHCA 4PGHA 1G3TA 5FLXK 3LA2A 3MZYA 1FNNA 4LD5A 2WV0A 5HDGA 5ICCA 2P7CB 1SFXA 2O0YA 3QP5A 1HSJA 3CUQB 5ICFA 1W7PA 3C18A 3M9AA 1TNSA 5FO5A 3T8RA 2OBPA 1TW3A 3V8JA 2FEZA 4RGXA 3T1BA 2YX4A 3N4MA 3TO6A 2IW5A 4OIOF 4KIFA 5DD4A 2O3FA 3MFKA 4AWXB 2D1VA 5E1WA 3P9CA 4G7ZF 3PQKA 4XSZF 3VFZA 1Z9CA 1ZHFA 2FU4A 4HF0A 3KP5A 1LEBA 1USSA 3K1PA 4A6EA 2HR3A 3K69A 4HF2A 4EM0B 4ESJA 3AAFA 3IWZA 4L9TA 4BYYA 1V3FA 3ZMUA 3IHUA 4G6QA 3IC7A 1O57A 5H20A 2HYGD 4FX4A 2V6CA 3HOSA 1JHHA 1FT9A 1YLFA 3RIRA 2F5CA 3LQRA 4L0YB 5JI6A 3M8FA 1MDMA 4AIKA 3RKYA 1ZGJA 5ICEA 1Z91A 3E6BA 4OMYA 3FF5A 2VONA 4EJVA 1G3WA 2BV6A 2VT2A 5D8LB 4ZYEA 1EH7A 2XHKA 2QBYB 5BQTA 1XDUA 2A5YB 5AIQA 1QGPA 2KIUA 2ZMEB 4NHJA 3BPXA 4HQMA 1B1BA 3WE3A 3WGGA 4DQ2A 2QBYA 1HKSA 1S6LA 3FHZA 3RKXA 5H6QA 4PCQA 2ZMEA 2FSWA 4EJTA 1U5TB 4AIHA 2V1XA 2YSRA 4GO1A 5D5WB 2EFOA 2L01A 4A0ZA 1IN4A 4RGUA 2XAQA 3HHHA 3GW2A 3V4GA 2OA4A 2ZO4A 1U5TC 2EK5A 5IT9Z 1W4MA 4BXUA 2FA5A 1H0MA 3O6BB 1O3SA 4O5VA 2PJPA 1QQIA 5FD6A 3E5UA 4KT5C 3HHGA 5LLQA 2W57A 4A0XA 1WI9A 5E8IA 3FXRA 2HTJA 2VOOA 1PP7U 1OMIA 4ENMA 2VBXA 3TDUC 2HDCA 2VBYA 2KRFA 1U6GA 1GHCA 3ZMVA 3E6MA 4LLNA 3RDIA 4Q5SF 3HYIA 1IRFA 2H6BA 3GYHX 5E8GA 1F9NA 3QPTA 2FE3A 2LNBA 1STZA 3DEUA 1T38A 3FX3A 2EA2A 4G6DA 3ECOA 5TRDA 1YYVA 5ERIA 5L3BA 1RUOA 5K5OA 3P9IA 3Q9VA 2P4WA 1SD7A 1Z7UA 5LEKA 3BDDA 4A0YA 4KFCA 3FZVA 2EWNA 3DF8A 4G9YA 2VBZA 3T8TA 2M30A 3WGHA 2JTVA 4MEYF 1YS7A 4IRGA 4OIQF 4AIJA 1BIAA 1KU7A 5BOXA 3MAJA 1I6XA 4AVPA 1S29A 1HSTA 2DW4A 4Z2YA 2MA3A 3J80K 4ETSA 2HKXA 3B02A 3F22A 3IL2A 2H6CA 4MTEA 2RGVA 3E5QA 1O3RA 3F8MA 1G6NA 3GFMA 4KDPA 1TBXA 3KCCA 1BI0A 2M87A 1OYIA 2PLYA 1S7OA 1T39A 2BEOA 3NQOA 4MTDA 4RB1A 4AD9A 4HX8A 1D3YA 2QYOA 4Q47A 2WC2A 4M6XA 1WQ2A 1ON1A 3M8EA 2MH9A 4M9ZA 1USTA 1TQMA 4KUMA 5K1YA 2DAOA 1J0RA 4IRHA 4UVCA 4A6DA 2CSOA 2Y75A 5HS7A 2CQKA 2AXLA 3HUGA 3VOEA 3WTZA 3IWFA 4UVAA 2VC1A 2DT5A 2KIMA 5ED4A 2RDPA 1TQIA 1W5SA 3BWGA 1SMTA 3C1DA 3MCZA 2IA1A 3OV8A 2B0LA 3CDHA 1BN5A 2OQRA 2PFBA 2K27A 2QVOA 1IN7A 5TJJA 4MGRA 4ZYDA 2ISYA 2BBYA 3I64A 3K2ZA 1U78A 3ML6A 4PDKA 2OU2A 2K02A 2ZNZA 4UHTA 4YFKF 1K79A 1FSEA 1LNWA 4NB5A 4HDVA 4ZZDA 2IA0A 2L02A 4MEXF 4WXCA 1XCBA 5JVTA 5HVQC 3P9KA 2D45A 1MJBA 2Q8KA 5F64A 2HWVA 2ZXJA 5J8CA 3GUDA 5DUKA 4L5IA 1J75A 2MH2A 3HRUA 5D5UB 3S2WA 2DTRA 1O7FA 5DYMA 4Y17A 3I0TA 4G7OF 2GZWA 1KU9A 3IKTA 2XAJA 2IRFG 2PG4A 5LGUA 3J81K 1QPMA 3VB2A 4LLLA 3DP7A 1B4AA 4LLGF 3NEUA 2QWWA 2COMA 3I54A 3DKWA 5FFXA 5HLIA 5D6FA 1KQ0A 2JT1A 4KA4A 4GYIA 1MGTA 5L3DA 2Z3YA 1L3LA 4OOIA 4Q48A 5LGTA 4BNCA 3HSFA 1P92A 3WTYC 1Y0UA 4WXDA 4EJUA 3JTHA 5FLXZ 2LKPA 3F3XA 4M73A 1R1TA 2O8XA 4R8HA 4ZZLA 3TOAA 3V8KA 2QQAA 3FM5A 1J59A 2L4MA 3KZZA 3V7CA 1SFUA 4I01A 2UXXA 3H3ZA 2RKHA 4RGRA 1ZLKA 5J6XA 2W85A 2QM3A 2KJCA 3ZMTA 3F8CA 5H6RA 4S04A 1XMAA 1RUNA 4EM1A 3Q9SA 3CUOA 1Z6TA 3GZ6A 5FB2A 3W6JB 3T5XA 2L3DA 2L54A 4N9HA 1VTNC 4U88A 2AS5F 2UXNA 5FGMA 2DPDA 3F72A 3ECHA 1FP2A 4LB5A 2STWA 3BJAA 4CICA 3K1NA 2E1CA 3F6VA 1B59A 1K6OA 3CO7C 2CYYA 2FMLA 2V79A 4XLNF 4I0BA 1KGSA 4UVBA 2ESHA 3MZHA 4L18B 1ZG3A 4MQVA 4ZYHA 2VN2A 5LRRA 5CJ9A 4I0AA 4M9XA 5CYVA 1XSXA 2C6YA 3HRSA 1SD4A 4IF4A 5CVIA 1T0FA 3WGIA 5L3CA 1RNLA 2HEOA 3K0LA 3EDPA 2MLGA 5IT3A 4IRIA 2IA2A 5J8FA 1IW7F 3WU0A 3CUQA 4CYDA 2P6TA 3N97A 5K5RA 2OZ6A 5JR3A 3CUQC 3V7SA 5LRSA 5ILSA 1TW2A 3ZN1A 2RN7A 2D1HA 3TQNA 3E5XA 2W84A 5HLHA 5E17F 1MJ9A 1LQ1A 2VE8A 1YTYA 5L3GA 4LGWA 4OIRF 1LVAA 1MZBA 1HKQA 1FPQA 5HLGA 4RS8A 1LB2A 1RI7A 1D8JA 4RB2C 3WTXC 1ONVA 1D8KA 1DPRA 2DI3A 5DCMB 3GO5A 2P7VB 5DCFA 3KEQA 2H27A 2VC0A 4I7HA 2O61A 2E7XA 1EV7A 4D0PA 4FT8A 3LAJA 2HQNA 3V8LA 3EUHA 3SXYA 1XCVA 5AIPA 2LSOA 1O3QA 3ZN0A 1H9GA 4CHUA 4K2EA 3J7AO 1KA8A 1E2XA 1BI3A 2ELHA 1FWZA 2X4HA 3QPHA 3HTUA 2LDUA 3FMRA 4XRFA 5DEQA 3U9GA 3QP6A 5ILVA 1U5TA 1WSUA 5CLSA 1ODDA 3QU6A 2Z99A 4BQAA 2D2WA 2FBHA 5KVRA 3KP2A 3FXUA 1IUYA 1P4XA 4P9FA 2L4AA 1XSVA 3FXQA 1B6AA 2E7WA 5BPIA 1DPUA 3J80Z 4KN7X 1BJAA 1UCRA 2HS5A 1BI1A 1ZN2A 1R5GA 2DFIA 4I2OA 3KZYA 2FNPA 4LMYA 2HGCA 1X3UA 2E1NA 1AWCA 3WTUC 2QZ8A 1S8NA 1BC8C 1Q1HA 2PI0A 2DK8A 4M9SA 4P55A 1SAXA 1WWXA 3FMSA 3H92A 2Y0MA 4S05A 3IRQA 1PUEE 2PMHA 2RVCA 4ESFA 2M5WA 4YFNF 5AONA 2ZFWA 4R1HA 2IPQX 1XGSA 1R5HA 4ON0A 1OYWA 3I5UA 2MBFA 4U0YA 1PDNC 2QQBA 1QZYA 5CVVA 2R7FA 2GWRA 2R3SA 3I59B 1T6SA 1ZRDA 3JSOA 2Z33A 3V7RA 4GXOA 4JBAA 2BYVE 2IT0A 4EMSA 2Q2EA 2K7LA 3F8FA 1S3JA 2NS0A 1FX7A 2X0LA 3I59A 4A12A 3E6CC 4L0ZB 1R00A 2XRNA 2RQPA 3BROA 4CDGA 2DQRA 3KFWX 1FBUA 1LDKB 2ADUA 4WCGA 1MD0A 4EV0A 2FF4A 2P6SA 2XASA 2O6GE 4KMFA 1QNTA 1OYYA 2YPRA 5HDNA 4PGGA 1BIBA 1T98A 4UUVA 2IJLA 2GAUA 2VODA 1U2WA 2IVMA 2DU9A 5E18F 1FBSA 3J81Z 1O3TA 3E6DA 3G73A 5CVRA 1V4RA 4O6JA 1IF1A 1IZ1A 3CTAA 4IVNA 2GA2A 2QUFA 3HIFA 3JW4A 1TQPA 4FX0A 3TO7A 2F5FA 5JHUA 1HW5A 1AOYA 2XKOA 4JK1X 1G3SA 4ZYGA 3ZMSA 4QWQA 1NHAA 1R36A 3PFIA 3WE2A 5LHGA 3GF2A 2JPCA 1YIOA 4P5OA 4XLPF 3P7NA 3HSEA 4KMUX 1FYLA 1XGMA 3RYRA 3KP7A 3RKWA 2XV4S 6PAXA 2A68F 5KK1A 4G7HF 1FY7A 1FOKA 1UHWA 4LB6B 4PZJA 5BMZA 4U7BA 1G3YA 5L3FA 1F5TA 3R61A 1RIOH 1W5TA 1R1UA 3LQQA 2VXZA 3TDZC 1OKRA 4OIPF 2XAGA 3GLXA 3WU1B 4LK0F 4XSXF 4EQQA 2DO7A 2FBIA 2GIVA 5HS9A 4FHTA 1Z1DA 2Q0OA 2FMYA 4ASNA 4TV7A 3BPVA 2EA4A 2PN6A 2VBWA 2NNYA 1G4DA 3ABUA 1RZ4A 3GZ5A 3LSTA 3Q5FA 5LBQA 2CO5A 3SQNA 2HFHA 3TKYA 4DNCA 2ZJ2A 2R7DA 4UV9A 4U7DA 1WRJA 2V1UA 2G7UA 3KLNA 2OD5A 5CVJA 3RJPA 5HS8A 5BPDA 4M71A 2F5EA 2XAHA 3DV8A 3F8NA 1JGSA 4HDUA 1ZREA 4N0BA 2W24A 1YS6A 1P2FA 1JXSA 2DQLA 1D5VA 5LEJA 1IN8A 1XGNA 3EETA 5DD8A 1R1VA 3JAMK 3COAC 2NRAC 4R79A 4JQFA 3SHFA 4RB3C 3FWEA 4ENNA 2XIGA 2V9VA 3TO9A 3DFGA 5D5VB 4O3MA 4BHBA 4EGYA 2M45A 2JRTA 2ZNYA 1ZLJA 3IKVA 2P8TA 3GWZA 5CVUA 3QRFF 1I1GA 3BJ6A 2ZCWA 1XDSA 1QBJA 1KYWA 3DPTA 5HOOA 4I09A 1ZG1A 4HLYA 1SFEA 3GX4X 1P4AA 3QOPA 3M7GA 4L9NA 2WWYA 2HOEA 2PQ8A 3REOA 1ZGAA 1R23A 4B09A 2GXGA 2MD5A 1P6RA 3NRVA 3WTWC 3JTGA 2A07F 3BOQA 3R60A 1GVJA 2XUBA 5D5XB 1XGOA 5EEGA 3MEXA 2VT3A 1YO5C 2JPBA 3JSPA 3GVAA 1R7JA 4M72A 4LFUA 2TDXA 1LJ9A 4HQEA 4ZH4F 4G8XA 4OMZA 5A2QK 2DLLA 5JFRA 2KIFA 1WKMA 1W7PB 3KP6A 3RPUA 2ACJA 2RC4A 3ZQ7A 4MHGA 4HX7A 5D4SA 1ZYRF 1PP8F 2W25A 3WODF 4YIIA 2P5KA 1CGPA 1KU2A 1O7LA 2CWEA 3OOPA 4KNYA 4EJOA 2HYFA 2G7HA 1CF7B 1UB9A 4EGZA 4UNOA 4WF2A 3D0SA 3DQVC 3IRRA 5BS6A 2K86A 1R22A 2A6HF 2XGXA 3LWFA 1CF7A 2HZTA 4L5JA 3KP3A 1ZG5A 5L3EA 2BGCA 1ON2A 2GXBA 2QENA 1ULYA 2MLKA 1FSHA 4LG0B 2J5OA 5D4RA 3VEPA 4CZZA 1C0WA 5DDGA 1MDMB 4IHSA 5FFZA 1FYKA 3ZMZA 1DDNA 4LG0A 4HV6A 3BY6A 4HZFA 2H09A 5DCMA 5E1XA 1E17A 2K4JA 3FMQA 2OZUA 4NQWA 2UZKA 1HBXG 3RYPA 4L9VA 2FXAA 4GYGA 2RV8A 4KIBA 3ZP5A 3RPQA 1ZRFA 3K1MA 1J5YA 3PQJA 2XROA 2YU3A 3ABTA 4HW0A 1JE8A 2F2EA 4HOBA 5EEHA 4RAZA 2CW0F 3LA7A 3R0AA 2A69F 2ETHA 1YFHA 2LF7A 1I1SA 1U3EM 4KN4X 5HDKA 4P96A 2STTA 1GXPA 4M74A 1IN6A 2HKOA 5K5QA 1IRGA 1FC3A 2FRHA 1OPCA 3GFLA 3L7WA 4E70A 2KKOA 3GXOA 3QU3A 5D8KB 3L9FA 2G9WA 4HF1A 3LA3A 4LJZF 4HLXA 1SMYF 3KLOA 4WX9A 2BE5F 1P4WA 2K4BA 1JHFA 1EH6A 2PMUA 3I58A 2XAFA 1GXQA 3HOTA 3F8BA 2DPUA 1Z05A 3ELKA 1A04A 5LGNA 4WK8F 4A5MA 4N9IA 4P9UA 1B9NA 3HRMA 3U1DA 4H0EA 3SZPA 4OINF 1HQCA 2M1BA 2P5VA 4HYEA 4BH9A 3KE2A 1TTYA 4EVIA 4L9JA 3GFJA 2EFQA 1YG2A 3LAPA 1DP7P 3F21A 3EYIA 2WTEA 3QAHA 4WWCA 1YW7A 2P5LC 4KYWA 1UHMA 2EV6A 4A2UA 1XSDA 3E97A 1W7PD 4HV5A 4KICA 3GEZA 4RB0A 2OAZA 3CO6C 4UV8A 4ESBA 3MQ0A 1T2KA 2EFWA 4M6YA 3O3KA 4QLCU 5IT9K 3WG9A 1XN7A 2EV0A 3I71A 3KP4A 2IP2A 4KIGA 1LDDA 2KJBA 3R6SA 1KU3A 4BHPA 1OR7A 3WTTC 5LHIA 4CGZA 1BM9A 4U0VA 1XMKA 3WTSC 2GA1A 2PBIA 1FBQA 1K78B 1YW9A 4ENJA 2NNNA 5ILUA 3B73A 3F23A 3SFZA 2NYXA 2HTSA 2OQGA 1KQ8A 1K78A 3BZ6A 3EQLF 1YW8A 4EM2A 1S7AA 3T0YA 2FQ3A 4IHTA 4I98B 3E3VA 1ZH5A 2FBKA 4CXFA 3ERED 4RAYA 2H94A 3M1EA 3KETA 2JZYA 4IJAA 5FD5A 4YFXF 1FP1D 1BOAA 3H3UA 4IPAA 4UXNA 1IXSB 5LHHA 4HX4A 1IXCA 1HKTA 1SD5A 1F1ZA 2ZBKA 1J2XA 4B8XA 1Z6RA 1TLHB 1U8RA 1REPC 3DXJF 3W6KB 1ZRCA 1J9IA 3CJNA 1IN5A 2ESNA 4GGGA 1I27A 2JSCA 1LDJA 2NAZA 4F7ZA 1ZARA 2MC3A 3JAMZ 5ICGA 1TNTA 3HRTA 2GQQA 3ZPLA 4Q4ZF 4HA8A 4EJWA 2DBBA 2YR2A 2EJRA 2F5DA 3CLOA 2YX7A 1FZPB 2FOKA 3C3WA 2QLZA 2CFXA 2LF8A 4WXHA 2FNAA 1BI2A 5E1ZB 4ENKA 2HQRA 1FLIA 3GFIA 3SZTA 4GCVA 2DK5A 3DPLC 3I4PA 1SD6A 2EFPA 1KQ9A 3U2RA 3L09A 4BAYA 1EH8A 3ISPA 2VOPA 3BP8A 3ULQB 2V1DA 3C7JA 4LK1F 1B9MA 2CG4A 1QO0D 5A2QZ 5D6EA 4RGSA 3L2CA 2ZKZA 3HSRA 3RI4A 1HXDA 3ZMDA 1QZZA 2Z5UA 3FM3A 1XD7A 3WTVC 4HAMA 1K7AA 3KEOA 2VE9A 2Y48A 2XKPA 4Y13A 4YIFA 4OU0A 1IAWA 4MQ9F 5F6FA 1H9TA 1FYMA 3HTSB 1ZAOA 5E20A 2J5PA 3I53A 1MJAA 4HBLA 4G94A 4U0WA 4XBFA 3R0JA 3MWMA 1DUXC 2A61A 1I5ZA 1BBYA 2O03A 1KYZA 3RTRA 2CGPA 2EB7A 2A6EF 2EV5A 3LFKA 2M8EA 4A5NA 3G3ZA 1HW1A 2PEXA 2EFNA 3K9TA 3VODA 2QQ9A 3BJOA 3EYYA 3ROUA 2A3SA 1UFMA 2RNJA 2XVCA 1YQAA 1XB4A 4CO8A 1BC7C 1LEAA 1IXRC 5DV5A 2UWMA 4I02A 1HW2A 1F4KA 3R4KA 3L00A 4YG2F 3TOBA 4Y15A 2ISZA 3O2PE 1L0OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MKM A;  4MNU A;  3TGN A;  1J7K A;  3D5L A;  4IXA A;  5DUI A;  5F1R A;  2Z9O A;  1R58 A;  3F6O A;  4BHC A;  4PGH A;  1G3T A;  5FLX K;  3LA2 A;  3MZY A;  1FNN A;  4LD5 A;  2WV0 A;  5HDG A;  5ICC A;  2P7C B;  1SFX A;  2O0Y A;  3QP5 A;  1HSJ A;  3CUQ B;  5ICF A;  1W7P A;  3C18 A;  3M9A A;  1TNS A;  5FO5 A;  3T8R A;  2OBP A;  1TW3 A;  3V8J A;  2FEZ A;  4RGX A;  3T1B A;  2YX4 A;  3N4M A;  3TO6 A;  2IW5 A;  4OIO F;  4KIF A;  5DD4 A;  2O3F A;  3MFK A;  4AWX B;  2D1V A;  5E1W A;  3P9C A;  4G7Z F;  3PQK A;  4XSZ F;  3VFZ A;  1Z9C A;  1ZHF A;  2FU4 A;  4HF0 A;  3KP5 A;  1LEB A;  1USS A;  3K1P A;  4A6E A;  2HR3 A;  3K69 A;  4HF2 A;  4EM0 B;  4ESJ A;  3AAF A;  3IWZ A;  4L9T A;  4BYY A;  1V3F A;  3ZMU A;  3IHU A;  4G6Q A;  3IC7 A;  1O57 A;  5H20 A;  2HYG D;  4FX4 A;  2V6C A;  3HOS A;  1JHH A;  1FT9 A;  1YLF A;  3RIR A;  2F5C A;  3LQR A;  4L0Y B;  5JI6 A;  3M8F A;  1MDM A;  4AIK A;  3RKY A;  1ZGJ A;  5ICE A;  1Z91 A;  3E6B A;  4OMY A;  3FF5 A;  2VON A;  4EJV A;  1G3W A;  2BV6 A;  2VT2 A;  5D8L B;  4ZYE A;  1EH7 A;  2XHK A;  2QBY B;  5BQT A;  1XDU A;  2A5Y B;  5AIQ A;  1QGP A;  2KIU A;  2ZME B;  4NHJ A;  3BPX A;  4HQM A;  1B1B A;  3WE3 A;  3WGG A;  4DQ2 A;  2QBY A;  1HKS A;  1S6L A;  3FHZ A;  3RKX A;  5H6Q A;  4PCQ A;  2ZME A;  2FSW A;  4EJT A;  1U5T B;  4AIH A;  2V1X A;  2YSR A;  4GO1 A;  5D5W B;  2EFO A;  2L01 A;  4A0Z A;  1IN4 A;  4RGU A;  2XAQ A;  3HHH A;  3GW2 A;  3V4G A;  2OA4 A;  2ZO4 A;  1U5T C;  2EK5 A;  5IT9 Z;  1W4M A;  4BXU A;  2FA5 A;  1H0M A;  3O6B B;  1O3S A;  4O5V A;  2PJP A;  1QQI A;  5FD6 A;  3E5U A;  4KT5 C;  3HHG A;  5LLQ A;  2W57 A;  4A0X A;  1WI9 A;  5E8I A;  3FXR A;  2HTJ A;  2VOO A;  1PP7 U;  1OMI A;  4ENM A;  2VBX A;  3TDU C;  2HDC A;  2VBY A;  2KRF A;  1U6G A;  1GHC A;  3ZMV A;  3E6M A;  4LLN A;  3RDI A;  4Q5S F;  3HYI A;  1IRF A;  2H6B A;  3GYH X;  5E8G A;  1F9N A;  3QPT A;  2FE3 A;  2LNB A;  1STZ A;  3DEU A;  1T38 A;  3FX3 A;  2EA2 A;  4G6D A;  3ECO A;  5TRD A;  1YYV A;  5ERI A;  5L3B A;  1RUO A;  5K5O A;  3P9I A;  3Q9V A;  2P4W A;  1SD7 A;  1Z7U A;  5LEK A;  3BDD A;  4A0Y A;  4KFC A;  3FZV A;  2EWN A;  3DF8 A;  4G9Y A;  2VBZ A;  3T8T A;  2M30 A;  3WGH A;  2JTV A;  4MEY F;  1YS7 A;  4IRG A;  4OIQ F;  4AIJ A;  1BIA A;  1KU7 A;  5BOX A;  3MAJ A;  1I6X A;  4AVP A;  1S29 A;  1HST A;  2DW4 A;  4Z2Y A;  2MA3 A;  3J80 K;  4ETS A;  2HKX A;  3B02 A;  3F22 A;  3IL2 A;  2H6C A;  4MTE A;  2RGV A;  3E5Q A;  1O3R A;  3F8M A;  1G6N A;  3GFM A;  4KDP A;  1TBX A;  3KCC A;  1BI0 A;  2M87 A;  1OYI A;  2PLY A;  1S7O A;  1T39 A;  2BEO A;  3NQO A;  4MTD A;  4RB1 A;  4AD9 A;  4HX8 A;  1D3Y A;  2QYO A;  4Q47 A;  2WC2 A;  4M6X A;  1WQ2 A;  1ON1 A;  3M8E A;  2MH9 A;  4M9Z A;  1UST A;  1TQM A;  4KUM A;  5K1Y A;  2DAO A;  1J0R A;  4IRH A;  4UVC A;  4A6D A;  2CSO A;  2Y75 A;  5HS7 A;  2CQK A;  2AXL A;  3HUG A;  3VOE A;  3WTZ A;  3IWF A;  4UVA A;  2VC1 A;  2DT5 A;  2KIM A;  5ED4 A;  2RDP A;  1TQI A;  1W5S A;  3BWG A;  1SMT A;  3C1D A;  3MCZ A;  2IA1 A;  3OV8 A;  2B0L A;  3CDH A;  1BN5 A;  2OQR A;  2PFB A;  2K27 A;  2QVO A;  1IN7 A;  5TJJ A;  4MGR A;  4ZYD A;  2ISY A;  2BBY A;  3I64 A;  3K2Z A;  1U78 A;  3ML6 A;  4PDK A;  2OU2 A;  2K02 A;  2ZNZ A;  4UHT A;  4YFK F;  1K79 A;  1FSE A;  1LNW A;  4NB5 A;  4HDV A;  4ZZD A;  2IA0 A;  2L02 A;  4MEX F;  4WXC A;  1XCB A;  5JVT A;  5HVQ C;  3P9K A;  2D45 A;  1MJB A;  2Q8K A;  5F64 A;  2HWV A;  2ZXJ A;  5J8C A;  3GUD A;  5DUK A;  4L5I A;  1J75 A;  2MH2 A;  3HRU A;  5D5U B;  3S2W A;  2DTR A;  1O7F A;  5DYM A;  4Y17 A;  3I0T A;  4G7O F;  2GZW A;  1KU9 A;  3IKT A;  2XAJ A;  2IRF G;  2PG4 A;  5LGU A;  3J81 K;  1QPM A;  3VB2 A;  4LLL A;  3DP7 A;  1B4A A;  4LLG F;  3NEU A;  2QWW A;  2COM A;  3I54 A;  3DKW A;  5FFX A;  5HLI A;  5D6F A;  1KQ0 A;  2JT1 A;  4KA4 A;  4GYI A;  1MGT A;  5L3D A;  2Z3Y A;  1L3L A;  4OOI A;  4Q48 A;  5LGT A;  4BNC A;  3HSF A;  1P92 A;  3WTY C;  1Y0U A;  4WXD A;  4EJU A;  3JTH A;  5FLX Z;  2LKP A;  3F3X A;  4M73 A;  1R1T A;  2O8X A;  4R8H A;  4ZZL A;  3TOA A;  3V8K A;  2QQA A;  3FM5 A;  1J59 A;  2L4M A;  3KZZ A;  3V7C A;  1SFU A;  4I01 A;  2UXX A;  3H3Z A;  2RKH A;  4RGR A;  1ZLK A;  5J6X A;  2W85 A;  2QM3 A;  2KJC A;  3ZMT A;  3F8C A;  5H6R A;  4S04 A;  1XMA A;  1RUN A;  4EM1 A;  3Q9S A;  3CUO A;  1Z6T A;  3GZ6 A;  5FB2 A;  3W6J B;  3T5X A;  2L3D A;  2L54 A;  4N9H A;  1VTN C;  4U88 A;  2AS5 F;  2UXN A;  5FGM A;  2DPD A;  3F72 A;  3ECH A;  1FP2 A;  4LB5 A;  2STW A;  3BJA A;  4CIC A;  3K1N A;  2E1C A;  3F6V A;  1B59 A;  1K6O A;  3CO7 C;  2CYY A;  2FML A;  2V79 A;  4XLN F;  4I0B A;  1KGS A;  4UVB A;  2ESH A;  3MZH A;  4L18 B;  1ZG3 A;  4MQV A;  4ZYH A;  2VN2 A;  5LRR A;  5CJ9 A;  4I0A A;  4M9X A;  5CYV A;  1XSX A;  2C6Y A;  3HRS A;  1SD4 A;  4IF4 A;  5CVI A;  1T0F A;  3WGI A;  5L3C A;  1RNL A;  2HEO A;  3K0L A;  3EDP A;  2MLG A;  5IT3 A;  4IRI A;  2IA2 A;  5J8F A;  1IW7 F;  3WU0 A;  3CUQ A;  4CYD A;  2P6T A;  3N97 A;  5K5R A;  2OZ6 A;  5JR3 A;  3CUQ C;  3V7S A;  5LRS A;  5ILS A;  1TW2 A;  3ZN1 A;  2RN7 A;  2D1H A;  3TQN A;  3E5X A;  2W84 A;  5HLH A;  5E17 F;  1MJ9 A;  1LQ1 A;  2VE8 A;  1YTY A;  5L3G A;  4LGW A;  4OIR F;  1LVA A;  1MZB A;  1HKQ A;  1FPQ A;  5HLG A;  4RS8 A;  1LB2 A;  1RI7 A;  1D8J A;  4RB2 C;  3WTX C;  1ONV A;  1D8K A;  1DPR A;  2DI3 A;  5DCM B;  3GO5 A;  2P7V B;  5DCF A;  3KEQ A;  2H27 A;  2VC0 A;  4I7H A;  2O61 A;  2E7X A;  1EV7 A;  4D0P A;  4FT8 A;  3LAJ A;  2HQN A;  3V8L A;  3EUH A;  3SXY A;  1XCV A;  5AIP A;  2LSO A;  1O3Q A;  3ZN0 A;  1H9G A;  4CHU A;  4K2E A;  3J7A O;  1KA8 A;  1E2X A;  1BI3 A;  2ELH A;  1FWZ A;  2X4H A;  3QPH A;  3HTU A;  2LDU A;  3FMR A;  4XRF A;  5DEQ A;  3U9G A;  3QP6 A;  5ILV A;  1U5T A;  1WSU A;  5CLS A;  1ODD A;  3QU6 A;  2Z99 A;  4BQA A;  2D2W A;  2FBH A;  5KVR A;  3KP2 A;  3FXU A;  1IUY A;  1P4X A;  4P9F A;  2L4A A;  1XSV A;  3FXQ A;  1B6A A;  2E7W A;  5BPI A;  1DPU A;  3J80 Z;  4KN7 X;  1BJA A;  1UCR A;  2HS5 A;  1BI1 A;  1ZN2 A;  1R5G A;  2DFI A;  4I2O A;  3KZY A;  2FNP A;  4LMY A;  2HGC A;  1X3U A;  2E1N A;  1AWC A;  3WTU C;  2QZ8 A;  1S8N A;  1BC8 C;  1Q1H A;  2PI0 A;  2DK8 A;  4M9S A;  4P55 A;  1SAX A;  1WWX A;  3FMS A;  3H92 A;  2Y0M A;  4S05 A;  3IRQ A;  1PUE E;  2PMH A;  2RVC A;  4ESF A;  2M5W A;  4YFN F;  5AON A;  2ZFW A;  4R1H A;  2IPQ X;  1XGS A;  1R5H A;  4ON0 A;  1OYW A;  3I5U A;  2MBF A;  4U0Y A;  1PDN C;  2QQB A;  1QZY A;  5CVV A;  2R7F A;  2GWR A;  2R3S A;  3I59 B;  1T6S A;  1ZRD A;  3JSO A;  2Z33 A;  3V7R A;  4GXO A;  4JBA A;  2BYV E;  2IT0 A;  4EMS A;  2Q2E A;  2K7L A;  3F8F A;  1S3J A;  2NS0 A;  1FX7 A;  2X0L A;  3I59 A;  4A12 A;  3E6C C;  4L0Z B;  1R00 A;  2XRN A;  2RQP A;  3BRO A;  4CDG A;  2DQR A;  3KFW X;  1FBU A;  1LDK B;  2ADU A;  4WCG A;  1MD0 A;  4EV0 A;  2FF4 A;  2P6S A;  2XAS A;  2O6G E;  4KMF A;  1QNT A;  1OYY A;  2YPR A;  5HDN A;  4PGG A;  1BIB A;  1T98 A;  4UUV A;  2IJL A;  2GAU A;  2VOD A;  1U2W A;  2IVM A;  2DU9 A;  5E18 F;  1FBS A;  3J81 Z;  1O3T A;  3E6D A;  3G73 A;  5CVR A;  1V4R A;  4O6J A;  1IF1 A;  1IZ1 A;  3CTA A;  4IVN A;  2GA2 A;  2QUF A;  3HIF A;  3JW4 A;  1TQP A;  4FX0 A;  3TO7 A;  2F5F A;  5JHU A;  1HW5 A;  1AOY A;  2XKO A;  4JK1 X;  1G3S A;  4ZYG A;  3ZMS A;  4QWQ A;  1NHA A;  1R36 A;  3PFI A;  3WE2 A;  5LHG A;  3GF2 A;  2JPC A;  1YIO A;  4P5O A;  4XLP F;  3P7N A;  3HSE A;  4KMU X;  1FYL A;  1XGM A;  3RYR A;  3KP7 A;  3RKW A;  2XV4 S;  6PAX A;  2A68 F;  5KK1 A;  4G7H F;  1FY7 A;  1FOK A;  1UHW A;  4LB6 B;  4PZJ A;  5BMZ A;  4U7B A;  1G3Y A;  5L3F A;  1F5T A;  3R61 A;  1RIO H;  1W5T A;  1R1U A;  3LQQ A;  2VXZ A;  3TDZ C;  1OKR A;  4OIP F;  2XAG A;  3GLX A;  3WU1 B;  4LK0 F;  4XSX F;  4EQQ A;  2DO7 A;  2FBI A;  2GIV A;  5HS9 A;  4FHT A;  1Z1D A;  2Q0O A;  2FMY A;  4ASN A;  4TV7 A;  3BPV A;  2EA4 A;  2PN6 A;  2VBW A;  2NNY A;  1G4D A;  3ABU A;  1RZ4 A;  3GZ5 A;  3LST A;  3Q5F A;  5LBQ A;  2CO5 A;  3SQN A;  2HFH A;  3TKY A;  4DNC A;  2ZJ2 A;  2R7D A;  4UV9 A;  4U7D A;  1WRJ A;  2V1U A;  2G7U A;  3KLN A;  2OD5 A;  5CVJ A;  3RJP A;  5HS8 A;  5BPD A;  4M71 A;  2F5E A;  2XAH A;  3DV8 A;  3F8N A;  1JGS A;  4HDU A;  1ZRE A;  4N0B A;  2W24 A;  1YS6 A;  1P2F A;  1JXS A;  2DQL A;  1D5V A;  5LEJ A;  1IN8 A;  1XGN A;  3EET A;  5DD8 A;  1R1V A;  3JAM K;  3COA C;  2NRA C;  4R79 A;  4JQF A;  3SHF A;  4RB3 C;  3FWE A;  4ENN A;  2XIG A;  2V9V A;  3TO9 A;  3DFG A;  5D5V B;  4O3M A;  4BHB A;  4EGY A;  2M45 A;  2JRT A;  2ZNY A;  1ZLJ A;  3IKV A;  2P8T A;  3GWZ A;  5CVU A;  3QRF F;  1I1G A;  3BJ6 A;  2ZCW A;  1XDS A;  1QBJ A;  1KYW A;  3DPT A;  5HOO A;  4I09 A;  1ZG1 A;  4HLY A;  1SFE A;  3GX4 X;  1P4A A;  3QOP A;  3M7G A;  4L9N A;  2WWY A;  2HOE A;  2PQ8 A;  3REO A;  1ZGA A;  1R23 A;  4B09 A;  2GXG A;  2MD5 A;  1P6R A;  3NRV A;  3WTW C;  3JTG A;  2A07 F;  3BOQ A;  3R60 A;  1GVJ A;  2XUB A;  5D5X B;  1XGO A;  5EEG A;  3MEX A;  2VT3 A;  1YO5 C;  2JPB A;  3JSP A;  3GVA A;  1R7J A;  4M72 A;  4LFU A;  2TDX A;  1LJ9 A;  4HQE A;  4ZH4 F;  4G8X A;  4OMZ A;  5A2Q K;  2DLL A;  5JFR A;  2KIF A;  1WKM A;  1W7P B;  3KP6 A;  3RPU A;  2ACJ A;  2RC4 A;  3ZQ7 A;  4MHG A;  4HX7 A;  5D4S A;  1ZYR F;  1PP8 F;  2W25 A;  3WOD F;  4YII A;  2P5K A;  1CGP A;  1KU2 A;  1O7L A;  2CWE A;  3OOP A;  4KNY A;  4EJO A;  2HYF A;  2G7H A;  1CF7 B;  1UB9 A;  4EGZ A;  4UNO A;  4WF2 A;  3D0S A;  3DQV C;  3IRR A;  5BS6 A;  2K86 A;  1R22 A;  2A6H F;  2XGX A;  3LWF A;  1CF7 A;  2HZT A;  4L5J A;  3KP3 A;  1ZG5 A;  5L3E A;  2BGC A;  1ON2 A;  2GXB A;  2QEN A;  1ULY A;  2MLK A;  1FSH A;  4LG0 B;  2J5O A;  5D4R A;  3VEP A;  4CZZ A;  1C0W A;  5DDG A;  1MDM B;  4IHS A;  5FFZ A;  1FYK A;  3ZMZ A;  1DDN A;  4LG0 A;  4HV6 A;  3BY6 A;  4HZF A;  2H09 A;  5DCM A;  5E1X A;  1E17 A;  2K4J A;  3FMQ A;  2OZU A;  4NQW A;  2UZK A;  1HBX G;  3RYP A;  4L9V A;  2FXA A;  4GYG A;  2RV8 A;  4KIB A;  3ZP5 A;  3RPQ A;  1ZRF A;  3K1M A;  1J5Y A;  3PQJ A;  2XRO A;  2YU3 A;  3ABT A;  4HW0 A;  1JE8 A;  2F2E A;  4HOB A;  5EEH A;  4RAZ A;  2CW0 F;  3LA7 A;  3R0A A;  2A69 F;  2ETH A;  1YFH A;  2LF7 A;  1I1S A;  1U3E M;  4KN4 X;  5HDK A;  4P96 A;  2STT A;  1GXP A;  4M74 A;  1IN6 A;  2HKO A;  5K5Q A;  1IRG A;  1FC3 A;  2FRH A;  1OPC A;  3GFL A;  3L7W A;  4E70 A;  2KKO A;  3GXO A;  3QU3 A;  5D8K B;  3L9F A;  2G9W A;  4HF1 A;  3LA3 A;  4LJZ F;  4HLX A;  1SMY F;  3KLO A;  4WX9 A;  2BE5 F;  1P4W A;  2K4B A;  1JHF A;  1EH6 A;  2PMU A;  3I58 A;  2XAF A;  1GXQ A;  3HOT A;  3F8B A;  2DPU A;  1Z05 A;  3ELK A;  1A04 A;  5LGN A;  4WK8 F;  4A5M A;  4N9I A;  4P9U A;  1B9N A;  3HRM A;  3U1D A;  4H0E A;  3SZP A;  4OIN F;  1HQC A;  2M1B A;  2P5V A;  4HYE A;  4BH9 A;  3KE2 A;  1TTY A;  4EVI A;  4L9J A;  3GFJ A;  2EFQ A;  1YG2 A;  3LAP A;  1DP7 P;  3F21 A;  3EYI A;  2WTE A;  3QAH A;  4WWC A;  1YW7 A;  2P5L C;  4KYW A;  1UHM A;  2EV6 A;  4A2U A;  1XSD A;  3E97 A;  1W7P D;  4HV5 A;  4KIC A;  3GEZ A;  4RB0 A;  2OAZ A;  3CO6 C;  4UV8 A;  4ESB A;  3MQ0 A;  1T2K A;  2EFW A;  4M6Y A;  3O3K A;  4QLC U;  5IT9 K;  3WG9 A;  1XN7 A;  2EV0 A;  3I71 A;  3KP4 A;  2IP2 A;  4KIG A;  1LDD A;  2KJB A;  3R6S A;  1KU3 A;  4BHP A;  1OR7 A;  3WTT C;  5LHI A;  4CGZ A;  1BM9 A;  4U0V A;  1XMK A;  3WTS C;  2GA1 A;  2PBI A;  1FBQ A;  1K78 B;  1YW9 A;  4ENJ A;  2NNN A;  5ILU A;  3B73 A;  3F23 A;  3SFZ A;  2NYX A;  2HTS A;  2OQG A;  1KQ8 A;  1K78 A;  3BZ6 A;  3EQL F;  1YW8 A;  4EM2 A;  1S7A A;  3T0Y A;  2FQ3 A;  4IHT A;  4I98 B;  3E3V A;  1ZH5 A;  2FBK A;  4CXF A;  3ERE D;  4RAY A;  2H94 A;  3M1E A;  3KET A;  2JZY A;  4IJA A;  5FD5 A;  4YFX F;  1FP1 D;  1BOA A;  3H3U A;  4IPA A;  4UXN A;  1IXS B;  5LHH A;  4HX4 A;  1IXC A;  1HKT A;  1SD5 A;  1F1Z A;  2ZBK A;  1J2X A;  4B8X A;  1Z6R A;  1TLH B;  1U8R A;  1REP C;  3DXJ F;  3W6K B;  1ZRC A;  1J9I A;  3CJN A;  1IN5 A;  2ESN A;  4GGG A;  1I27 A;  2JSC A;  1LDJ A;  2NAZ A;  4F7Z A;  1ZAR A;  2MC3 A;  3JAM Z;  5ICG A;  1TNT A;  3HRT A;  2GQQ A;  3ZPL A;  4Q4Z F;  4HA8 A;  4EJW A;  2DBB A;  2YR2 A;  2EJR A;  2F5D A;  3CLO A;  2YX7 A;  1FZP B;  2FOK A;  3C3W A;  2QLZ A;  2CFX A;  2LF8 A;  4WXH A;  2FNA A;  1BI2 A;  5E1Z B;  4ENK A;  2HQR A;  1FLI A;  3GFI A;  3SZT A;  4GCV A;  2DK5 A;  3DPL C;  3I4P A;  1SD6 A;  2EFP A;  1KQ9 A;  3U2R A;  3L09 A;  4BAY A;  1EH8 A;  3ISP A;  2VOP A;  3BP8 A;  3ULQ B;  2V1D A;  3C7J A;  4LK1 F;  1B9M A;  2CG4 A;  1QO0 D;  5A2Q Z;  5D6E A;  4RGS A;  3L2C A;  2ZKZ A;  3HSR A;  3RI4 A;  1HXD A;  3ZMD A;  1QZZ A;  2Z5U A;  3FM3 A;  1XD7 A;  3WTV C;  4HAM A;  1K7A A;  3KEO A;  2VE9 A;  2Y48 A;  2XKP A;  4Y13 A;  4YIF A;  4OU0 A;  1IAW A;  4MQ9 F;  5F6F A;  1H9T A;  1FYM A;  3HTS B;  1ZAO A;  5E20 A;  2J5P A;  3I53 A;  1MJA A;  4HBL A;  4G94 A;  4U0W A;  4XBF A;  3R0J A;  3MWM A;  1DUX C;  2A61 A;  1I5Z A;  1BBY A;  2O03 A;  1KYZ A;  3RTR A;  2CGP A;  2EB7 A;  2A6E F;  2EV5 A;  3LFK A;  2M8E A;  4A5N A;  3G3Z A;  1HW1 A;  2PEX A;  2EFN A;  3K9T A;  3VOD A;  2QQ9 A;  3BJO A;  3EYY A;  3ROU A;  2A3S A;  1UFM A;  2RNJ A;  2XVC A;  1YQA A;  1XB4 A;  4CO8 A;  1BC7 C;  1LEA A;  1IXR C;  5DV5 A;  2UWM A;  4I02 A;  1HW2 A;  1F4K A;  3R4K A;  3L00 A;  4YG2 F;  3TOB A;  4Y15 A;  2ISZ A;  3O2P E;  1L0O C; 
#chains in the Genus database with same CATH topology
 2DOE A;  1MKM A;  3HKZ A;  2QQ8 A;  2JVH A;  4MNU A;  2R5Z B;  3TGN A;  4IHY A;  1J7K A;  2HOA A;  3I56 I;  3D5L A;  5B5E C;  1ZR4 A;  4XKB A;  4IXA A;  5DUI A;  5F1R A;  2Z9O A;  1QHG A;  1T08 B;  4HNV A;  2Y9Y A;  1R58 A;  3F6O A;  2Z16 A;  4RAF A;  3KZI C;  4BHC A;  4PGH A;  2Y9Z A;  2P0W A;  1ZGW A;  4DGW B;  2KQR A;  1G3T A;  5FLX K;  2K9Q A;  3LA2 A;  2AHQ A;  1OJL A;  3MZY A;  1G8X A;  1FNN A;  1MBG A;  4LD5 A;  3ZGK A;  2WV0 A;  5HDG A;  5ICC A;  1WH5 A;  2P7C B;  1T0F C;  1SFX A;  2O0Y A;  3QP5 A;  1HSJ A;  3CUQ B;  1JKP C;  5ICF A;  2ZJQ F;  1W7P A;  3C18 A;  3M9A A;  1TNS A;  5FO5 A;  1TC3 C;  1DGR M;  3T8R A;  2OBP A;  1NK2 P;  3M1C A;  1TW3 A;  3CP2 A;  2NOG A;  3V8J A;  2FEZ A;  2R7T A;  1Y39 A;  4RGX A;  2R4G A;  3T1B A;  2Q1Z B;  2YX4 A;  3N4M A;  3TO6 A;  2IW5 A;  4OIO F;  4KIF A;  4NNJ A;  3FXK A;  3K4L A;  2O3F A;  5DD4 A;  3MFK A;  1WJF A;  3LSJ A;  4AWX B;  2D1V A;  1ZR2 A;  4E7L A;  5E1W A;  3MN2 A;  3P9C A;  2HPM A;  3M3Y J;  3HB9 A;  4G7Z F;  1T8I A;  3PQK A;  1MMN A;  4XSZ F;  3VFZ A;  3AG3 H;  1ZHF A;  2E1M B;  2FU4 A;  1Z9C A;  4HF0 A;  3KP5 A;  1LEB A;  4XOR A;  1USS A;  2AQE A;  3K1P A;  4A6E A;  2HR3 A;  3OSG A;  3HEF A;  3K69 A;  3W2V A;  4HF2 A;  4EM0 B;  4ESJ A;  3AAF A;  3IWZ A;  1ETW A;  2X1C A;  5GAD J;  4XLC A;  2WAQ A;  4L9T A;  2L7M P;  4XON A;  4BYY A;  5IOZ A;  5F0C A;  1A36 A;  1V3F A;  1RPW A;  3ZMU A;  3IHU A;  4G6Q A;  3MVP A;  3HOY J;  3IC7 A;  1O57 A;  3L2U A;  2X6X A;  4IQJ A;  5H20 A;  2HYG D;  4FX4 A;  2E1M C;  2V6C A;  3HOS A;  1LFB A;  2LKS A;  1JHH A;  1FT9 A;  1YLF A;  3ONQ A;  3RIR A;  4C2T A;  2F5C A;  3CES A;  3LQR A;  3FHN A;  2VKD A;  2HQ5 A;  4XOT A;  3TBI A;  1VQ5 I;  4L0Y B;  4A3J J;  5JI6 A;  1XX5 A;  3M8F A;  2H8R A;  1MDM A;  4IHV A;  3EUK L;  5KAI C;  4AIK A;  3RKY A;  1ZGJ A;  3LSR A;  4C2U A;  5ICE A;  1Z91 A;  4LIU A;  3E6B A;  4S0H B;  3FF5 A;  2X85 A;  4OMY A;  1W0T A;  2VON A;  4EJV A;  1VF9 A;  4KIT B;  1G3W A;  1T56 A;  2BV6 A;  2VT2 A;  2MG4 A;  5D8L B;  4ZYE A;  2VKV A;  3FBI B;  1DU6 A;  2CH0 A;  1EH7 A;  3CDI A;  2XHK A;  5TGT A;  4XKW A;  2QBY B;  5BQT A;  2BY0 A;  1XDU A;  2A5Y B;  2HOT A;  5AIQ A;  3VYU B;  1QGP A;  2KIU A;  2ZME B;  4NHJ A;  4CCO A;  2L7Z A;  3BPX A;  1CQT A;  4HQM A;  1B1B A;  2CRG A;  3V42 A;  3WE3 A;  3WGG A;  4DQ2 A;  3MMY B;  2QBY A;  1JUM A;  1HKS A;  1S6L A;  3FHZ A;  3RKX A;  5H6Q A;  4PCQ A;  1A6Q A;  4KJZ A;  2ZME A;  4OAZ A;  4AYB N;  2FSW A;  4EJT A;  1U5T B;  4AIH A;  2V1X A;  3H5A A;  4G6T B;  2YSR A;  3E0J B;  2ZME C;  4GO1 A;  3S14 J;  2YUS A;  5D5W B;  2EFO A;  1HOM A;  2L01 A;  2HDD A;  4A0Z A;  1IN4 A;  2DYR H;  2FQ4 A;  4RGU A;  2XAQ A;  3HHH A;  3GW2 A;  3V4G A;  3BR3 A;  1IDZ A;  1LUJ B;  2OA4 A;  3EPZ A;  1JKQ C;  2ZO4 A;  3DLL F;  2CV1 A;  1U5T C;  1Z0X A;  2EK5 A;  5IT9 Z;  1W4M A;  4BXU A;  1MBK A;  3B6C A;  2FA5 A;  2B63 J;  3OYC A;  4II3 A;  1H0M A;  3O6B B;  1DP3 A;  1O3S A;  4O5V A;  2PJP A;  1QQI A;  3BCB A;  5E3M A;  1GVD A;  5FD6 A;  2HZD A;  2XC7 A;  1R4N B;  3HC7 A;  3E5U A;  4KT5 C;  4AYB A;  1SEU A;  2DN0 A;  4J01 A;  3G1O A;  3HHG A;  2XB0 X;  2ZJP F;  5LLQ A;  2W57 A;  4A0X A;  1WI9 A;  4ZDP A;  5E8I A;  3FXR A;  2HTJ A;  2VOO A;  2NVU B;  1PP7 U;  1S5L C;  4Y3O A;  1OMI A;  3OS2 A;  4ENM A;  4XLE A;  3CLQ A;  2XF6 A;  2VBX A;  3TDU C;  1LPQ A;  2HDC A;  2LBF B;  2VBY A;  2FOW A;  2LVS A;  4RLQ A;  2KRF A;  5EZG A;  1U6G A;  1GHC A;  2AXT C;  2OC6 A;  4XNF A;  4I6Z A;  3ZMV A;  3E6M A;  3K4B A;  3PNV A;  2DJI A;  3F9K A;  4X1E A;  2MC4 A;  1I39 A;  4LLN A;  3GBG A;  3H5N A;  3RDI A;  3QQA A;  4IOA F;  1P7I A;  1OFC X;  4Q5S F;  1LE8 A;  4AUX A;  4P1W A;  2LBF A;  4MO7 A;  1N75 A;  3HYI A;  2R7S A;  1IRF A;  5J47 A;  2H6B A;  5E8G A;  3GYH X;  1F9N A;  3G71 I;  1HA8 A;  3QPT A;  2FE3 A;  3HZJ A;  2LNB A;  1JT0 A;  1R71 A;  1LVK A;  1STZ A;  1YIJ I;  3BR6 A;  3JRD A;  3DEU A;  3BG5 A;  2NS7 A;  1T38 A;  1WVR A;  3FX3 A;  2EA2 A;  2M4K A;  3SEQ A;  2N8G A;  4G12 A;  4G6D A;  5J4V A;  1R9T J;  3ECO A;  5TRD A;  1YYV A;  5ERI A;  5L3B A;  2EZK A;  5GPA A;  1RUO A;  5B3S H;  5K5O A;  2MW8 A;  2K85 A;  3P9I A;  5EEA A;  3Q9V A;  2P4W A;  4CCJ A;  5FLV A;  1SD7 A;  1Z7U A;  2M2E A;  4V2G A;  5LEK A;  1VQL I;  3BDD A;  1IRZ A;  4A0Y A;  1X4O A;  2QGU A;  4E7J A;  3DBH B;  3FZV A;  4KFC A;  3OY9 A;  5IOY A;  3AKZ A;  2Q2E B;  2EWN A;  1WJA A;  3DF8 A;  4G9Y A;  2VBZ A;  5M3M J;  3T8T A;  2M30 A;  3WGH A;  2JTV A;  4MEY F;  3S8P A;  1YS7 A;  3CMY A;  4IRG A;  2V4J C;  3G6E I;  4OIQ F;  4BS9 A;  4AIJ A;  1BIA A;  1KU7 A;  3HDD A;  5BOX A;  2JVG A;  3MAJ A;  1I6X A;  3IH3 A;  2NVX J;  4J00 A;  4AVP A;  1S29 A;  1HST A;  3ZRG A;  2DW4 A;  4Z2Y A;  2XGC A;  3CCS I;  2MA3 A;  1HDP A;  3K4M A;  3J80 K;  1OCT C;  3CCJ I;  1HLV A;  1U9O A;  1W36 D;  4ETS A;  2E60 A;  2HKX A;  2K9S A;  3B02 A;  4BXF A;  4CA0 A;  3F22 A;  3IL2 A;  4PSW A;  2H6C A;  3HXL A;  3U21 A;  4JX5 A;  4MTE A;  2QCO A;  1IC8 A;  2RGV A;  3E5Q A;  1O3R A;  3F8M A;  1WHU A;  3DKX A;  3H0D A;  1G6N A;  4BEH A;  3GFM A;  3CC2 I;  3RQI A;  4UUS B;  4KDP A;  3BTJ A;  1TBX A;  1E3H A;  3KCC A;  2DA5 A;  1GUU A;  1BI0 A;  2QEX I;  4B47 A;  2TCT A;  3PIP F;  2M87 A;  1OYI A;  2PLY A;  1S7O A;  1T39 A;  4HNU A;  2OCE A;  4RDU A;  2BEO A;  4RAG A;  3BZC A;  3GZN B;  3NQO A;  3CCQ I;  1BW5 A;  1EF4 A;  2XSD C;  4MTD A;  4RB1 A;  4AD9 A;  4X6A J;  4PJN A;  4HX8 A;  1D3Y A;  2QYO A;  1UMQ A;  3RKQ A;  2LFB A;  4Q47 A;  2WC2 A;  4M6X A;  1WQ2 A;  2R0Q C;  2Y0S N;  2ID6 A;  4KT6 A;  4XLA A;  1SFK A;  2WAD A;  1UG2 A;  2CW8 A;  1ON1 A;  3M8E A;  3GTL J;  4BJ5 C;  2BXY A;  2W00 A;  2MH9 A;  2L7F P;  4M9Z A;  1UHS A;  2DJN A;  2LRD A;  1OCO H;  1UST A;  3HUG B;  1TQM A;  3HOU J;  4KUM A;  5K1Y A;  2DAO A;  1X3Z B;  1J0R A;  4IRH A;  4FQG A;  4UVC A;  4A6D A;  4B3X A;  2VAS A;  2CSO A;  3CCR I;  2Y75 A;  5HS7 A;  2VQC A;  4D1Q A;  2CQK A;  3TW7 A;  2AXL A;  3HUG A;  3VOE A;  3WTZ A;  3KX2 A;  4HNT A;  3IWF A;  2V26 A;  2VC1 A;  4UVA A;  4FCY A;  2DT5 A;  2F4O B;  2KIM A;  5ED4 A;  2RDP A;  1TQI A;  2LYC A;  4DOZ A;  3IV5 A;  4XQF A;  1W5S A;  3BWG A;  3VWB A;  4W1U A;  1SMT A;  3C1D A;  3MCZ A;  2IA1 A;  5EG0 B;  1D0X A;  4NC7 A;  5JVG F;  1WJE A;  1RET A;  2KHM A;  3OV8 A;  2B0L A;  3CDH A;  3VSL A;  2Y0S A;  1VQ7 I;  1BN5 A;  2OQR A;  5IYC J;  2PFB A;  1T95 A;  2LOO A;  2JUG A;  2VKE A;  5KNL A;  2K27 A;  2QVO A;  1YE9 A;  3BR0 A;  3PUB A;  4PFP A;  5EZH A;  1IN7 A;  2VL8 A;  5TJJ A;  1V55 H;  2VJ5 A;  4MGR A;  4ZYD A;  4IZZ A;  2ISY A;  2BBY A;  2M0M A;  4BAC A;  2HDW A;  3I64 A;  1FIP A;  3K2Z A;  1U78 A;  3LSG A;  3ML6 A;  4PDK A;  2BZT A;  3CCM I;  2OU2 A;  2K02 A;  2ZNZ A;  4UHT A;  3PJR A;  4YFK F;  1K79 A;  3L2R A;  1MSE C;  1FSE A;  1LNW A;  1NH3 A;  3RZD J;  4NB5 A;  4HDV A;  2Z1D A;  4ZZD A;  2IA0 A;  2L02 A;  3O8H A;  2KL4 A;  5J1Y A;  4MEX F;  4WXC A;  1XCB A;  5JVT A;  1YHQ I;  3TL4 X;  2EQR A;  5HVQ C;  3P9K A;  2D45 A;  3OYL A;  1MJB A;  2Q8K A;  3W3C A;  2CU7 A;  2HYJ A;  1IO2 A;  5F64 A;  2HWV A;  2ZXJ A;  5J8C A;  4ABZ A;  3CC7 I;  3GUD A;  5DUK A;  3OMY A;  4L5I A;  1J75 A;  2E2I J;  2MH2 A;  3HRU A;  5D5U B;  3I9V 2;  3S2W A;  3SEZ A;  2CFO A;  2DTR A;  4M3D A;  2Y69 H;  1O7F A;  5DYM A;  4Y17 A;  4XIC A;  3I0T A;  4BJ6 C;  1MND A;  5FJ8 J;  4G7O F;  5K7Z A;  2GZW A;  3CZ6 A;  1KU9 A;  2CV0 A;  3ZQQ A;  3K7A J;  3IKT A;  2XAJ A;  4FIS A;  2IRF G;  2PG4 A;  3Q0W A;  3QPS A;  1ZKG A;  5LGU A;  1D0Y A;  5IP9 J;  3J81 K;  1QPM A;  3VB2 A;  2WA0 A;  4UB6 C;  4JP0 A;  4LLL A;  2BHY A;  1IG7 A;  3DP7 A;  3JRE A;  2KIS A;  5C4J J;  1B4A A;  4OWR B;  4LLG F;  4RM3 A;  3NEU A;  2QWW A;  1JKO C;  2COM A;  3I54 A;  1B8I A;  3DKW A;  1FIA A;  3OYE A;  4QPO A;  5FFX A;  5HLI A;  2ZSH B;  5D6F A;  2HVQ A;  1KQ0 A;  2JT1 A;  4UUT A;  4KA4 A;  4GYI A;  2I10 A;  5CPR B;  1MGT A;  5L3D A;  2Z3Y A;  1L3L A;  4IHW A;  3ZXS A;  3H9J A;  4OOI A;  2EIL H;  5DTD A;  4DBQ A;  4Q48 A;  5LGT A;  4BNC A;  4XOP A;  3HSF A;  3OYI A;  1NTC A;  1P92 A;  2VQG A;  2X51 A;  3WTY C;  2TRT A;  3FXJ A;  1A35 A;  1Y0U A;  3H36 A;  4WXD A;  4EJU A;  3BR2 A;  3JTH A;  5FLX Z;  2LKP A;  3F3X A;  2HXO A;  2VJJ A;  2PX9 A;  1R1T A;  2O8X A;  4M73 A;  3GTJ J;  1FTT A;  4R8H A;  4ZZL A;  2V6E A;  2DOD A;  3TOA A;  3V8K A;  1W1W E;  2QQA A;  3FM5 A;  1J59 A;  2QKM B;  2L4M A;  3KZZ A;  3V7C A;  1SFU A;  4I01 A;  2UXX A;  3ASO H;  3JRA A;  3H3Z A;  2RKH A;  4RGR A;  3NWT A;  1ZLK A;  5J6X A;  2QSH X;  2W85 A;  4BL0 B;  3OR2 C;  2JRM A;  2QM3 A;  2KJC A;  4JX6 A;  4BUP A;  1BJZ A;  3ZMT A;  2HNH A;  3F8C A;  5H6R A;  4S04 A;  1AHD P;  1XMA A;  1RUN A;  4EM1 A;  2CUJ A;  2XDV A;  3Q9S A;  3CUO A;  1Z6T A;  3UNG C;  3GZ6 A;  4IO9 F;  1YIT I;  3AG1 H;  5FB2 A;  2GOM A;  3W6J B;  1MH4 A;  3T5X A;  3HOW J;  1P9Q C;  2L3D A;  1UAA A;  1QHH D;  2L54 A;  4N9H A;  1VTN C;  4DYQ A;  4O3M A;  1MH3 A;  4U88 A;  1YRN B;  2AS5 F;  2UXN A;  1OCC H;  5FGM A;  2DPD A;  3F72 A;  3ECH A;  5J1U A;  3JRC A;  5M5W J;  3CCY A;  4BE2 A;  1FP2 A;  4LB5 A;  2STW A;  3DTI A;  2X9D A;  1Y6I A;  3BJA A;  4LIT A;  4CIC A;  5F08 A;  3K1N A;  4GDF A;  4A3D J;  2E1C A;  3CJQ B;  3F6V A;  3CCU I;  2H1L A;  1B59 A;  3K4K A;  1K6O A;  2YS9 A;  3D5R C;  2A05 A;  3CO7 C;  4PUS A;  2CYY A;  2FML A;  2V79 A;  4XLN F;  3PFY A;  4I0B A;  3OYA A;  2CUE A;  1KGS A;  1TWH J;  2L9V A;  4MLO A;  4UVB A;  3H3V K;  2ESH A;  3MZH A;  4L18 B;  5E3N A;  4AID A;  3JCU C;  3C2B A;  1ZG3 A;  2F4I A;  3SDB A;  2HVR A;  2BVM A;  4MQV A;  2VN2 A;  4ZYH A;  4F55 A;  1RR7 A;  5LRR A;  5CJ9 A;  4LG3 A;  4C3I J;  4I0A A;  3MD2 A;  1ZTR A;  4M9X A;  3L1P A;  2PJR A;  3FK6 A;  5EGO B;  5CYV A;  5FKM A;  5F27 A;  1XSX A;  2MSY A;  4F93 B;  2R5Z A;  5IP6 A;  2C6Y A;  3MKW B;  3HRS A;  1ETV A;  1SD4 A;  3FDY A;  2OTL I;  4IF4 A;  5CVI A;  3FIW A;  2F5V A;  1T0F A;  2VXD A;  3WGI A;  3KYC B;  5L3C A;  3GTO J;  4GFB A;  1RNL A;  2HEO A;  2E35 A;  3OL4 A;  3K4C A;  3K0L A;  4RA2 A;  3EDP A;  3UR3 C;  4XID A;  1PUF B;  1H89 C;  4BKX A;  2MLG A;  2L0K A;  5IT3 A;  4IRI A;  4Y7N J;  4W97 A;  5F0H A;  2IA2 A;  3NAR A;  5J8F A;  1Z21 A;  1IW7 F;  3WU0 A;  1WJB A;  3CUQ A;  4CYD A;  2P6T A;  2EZI A;  3N97 A;  5K5R A;  5IYB J;  3HGG A;  4YEJ A;  2OZ6 A;  4NC6 A;  1RKW A;  5JR3 A;  1D1A A;  3PO3 J;  2IGM A;  1OCP A;  3CDL A;  2B7E A;  4B43 A;  3CUQ C;  3KIO A;  3V7S A;  2E1O A;  3K10 A;  5LRS A;  1K61 A;  5ILS A;  1TW2 A;  4A3K J;  3ZN1 A;  2QSF X;  4UB8 C;  2PMZ N;  2RN7 A;  4IEJ A;  3S3M A;  3ZR8 X;  2D1H A;  2VQL A;  3TQN A;  3E5X A;  1V54 H;  3GTP J;  2OCC H;  5CQG A;  2W84 A;  5HLH A;  1U0J A;  2KRC A;  1NG6 A;  3PM1 A;  4D5C A;  4A3C J;  5E17 F;  2DA7 A;  1MJ9 A;  1A5J A;  1W36 C;  4GRI A;  1LQ1 A;  4B3A A;  2VE8 A;  1YTY A;  4E7I A;  1QPI A;  5L3G A;  2K9M A;  3I3L A;  2D5V A;  5IY5 H;  4FET A;  4LGW A;  4ZTF A;  4OIR F;  2GM4 A;  1LVA A;  1I3Q J;  1MZB A;  3F0C A;  1HKQ A;  1FPQ A;  2JA8 J;  5HLG A;  3HOZ J;  4RS8 A;  5B1A H;  5HNF A;  1LB2 A;  2IS2 A;  1RI7 A;  5LFA A;  1S72 I;  1WJD A;  1X1D A;  3OS1 A;  1D8J A;  4DIQ A;  4IKF A;  4RB2 C;  4F3Q A;  1VI0 A;  1ONV A;  3WTX C;  3GME A;  2Y30 A;  1D8K A;  1R5I D;  2BVL A;  1DPR A;  2DI3 A;  3OOU A;  3GO5 A;  3DU5 A;  5DCM B;  2ELJ A;  2P7V B;  5DCF A;  1POG A;  1WI3 A;  3KEQ A;  3C2H A;  4A69 C;  2H27 A;  4M3F A;  3CMA I;  2COB A;  2VC0 A;  3W2A A;  1FMW A;  3DU6 A;  3MKL A;  3IH4 A;  4I7H A;  2M7B A;  2O61 A;  3K2A A;  2E7X A;  5IPA A;  3NAU A;  4E7S A;  2VPR A;  1EV7 A;  4D0P A;  2VKH A;  4FT8 A;  2ZSI B;  4HPQ A;  3LAJ A;  2HQN A;  2KIQ A;  3V8L A;  3EUH A;  3SXY A;  1XCV A;  5AIP A;  2LSO A;  3BR1 A;  1U9N A;  3OYN A;  1O3Q A;  2OPT A;  2DCE A;  3ZN0 A;  3EUH C;  1H9G A;  4CHU A;  4K2E A;  3J7A O;  1KA8 A;  1E2X A;  1BI3 A;  3DEE A;  3H35 A;  2LY1 A;  2OJE D;  4BU2 A;  2ELH A;  2HVS A;  2JA5 J;  2UUZ A;  2OTJ I;  1FWZ A;  2X4H A;  3LSI A;  2JA7 J;  4C2M J;  3QPH A;  5LD2 C;  3HTU A;  2LDU A;  3FMR A;  4XRF A;  2LMD A;  5DEQ A;  5FKO A;  3U9G A;  4C3H J;  4BQQ A;  3QP6 A;  2KT0 A;  5ILV A;  1U5T A;  3HPH A;  4MIM A;  4D9J A;  1WSU A;  3PUF A;  3VSK A;  2ZXI A;  5GAH J;  5CLS A;  1ODD A;  3QU6 A;  1N25 A;  2XB5 A;  2Z99 A;  3A0H C;  4BQA A;  2D2W A;  2FBH A;  5KVR A;  1E3O C;  3KP2 A;  3FXU A;  4U87 A;  1IUY A;  1BOB A;  1P4X A;  1HCR A;  2L9S A;  1Y0N A;  4P9F A;  2L4A A;  5EJC A;  1XSV A;  3FXQ A;  1B6A A;  2R7X A;  1BR1 A;  3OYD A;  2E7W A;  5BPI A;  1DPU A;  3J80 Z;  2EPF A;  2EIJ H;  4D7M A;  1TWF J;  2ME0 A;  4KN7 X;  1BJA A;  5FLM J;  1UCR A;  2HS5 A;  1BI1 A;  1ZN2 A;  3OYH A;  5FKL A;  1R5G A;  2JA2 A;  2DFI A;  4I2O A;  2Y2Z A;  2CUZ A;  3ESW B;  3KZY A;  2FNP A;  2HI3 A;  2BXZ A;  3ABM H;  4LMY A;  1SVL A;  2HGC A;  4DW6 A;  1X3U A;  1WH7 A;  2E1N A;  3A1Y A;  1AWC A;  3WTU C;  2QZ8 A;  3FXO A;  1S8N A;  2DMP A;  2LK2 A;  3LOC A;  1BC8 C;  4JX4 A;  1Q1H A;  4DJA A;  1G59 A;  2G0E A;  2JWT A;  1YX5 A;  3CP8 A;  2PI0 A;  2DK8 A;  2KDZ A;  4M9S A;  4P55 A;  2LY2 A;  1J09 A;  2FD5 A;  1SAX A;  1WWX A;  2KP6 A;  4CSW A;  2IS1 A;  3FMS A;  3LSM A;  3H92 A;  2Y0M A;  4S05 A;  3IRQ A;  1PUE E;  2PMH A;  2RVC A;  1W5C C;  1ITY A;  1D1B A;  4ESF A;  1T33 A;  3A4C A;  5IYD J;  5K7F A;  2EZL A;  1M1E B;  2M5W A;  5AON A;  2ZFW A;  4R1H A;  2IPQ X;  3FKJ A;  4D5F A;  4YFN F;  3CCE I;  1XGS A;  1R5H A;  1AU7 A;  2EBI A;  4ON0 A;  1OYW A;  3I5U A;  2HOS A;  3PNY A;  2CJJ A;  2MBF A;  3OYJ A;  2OUM A;  4U0Y A;  1IRX A;  1ENH A;  2QQB A;  1PDN C;  1QZY A;  4NC8 A;  5CVV A;  2R7V A;  2R7F A;  3IAM 2;  2GWR A;  3RPU D;  2R3S A;  4FE7 A;  3ASN H;  3I59 B;  4N4N B;  2WV1 A;  4IQ4 A;  1T6S A;  2DDB A;  4E7H A;  4XKV A;  1ZRD A;  3JSO A;  2L2O A;  2IGO A;  3V7R A;  2Z33 A;  1N77 A;  5FRO A;  4GXO A;  4JBA A;  3NWS A;  3HM5 A;  2NVY J;  2BYV E;  2IS4 A;  3ERM A;  4DZJ A;  2IT0 A;  4PJM A;  2Q2E A;  1KON A;  4EMS A;  2K7L A;  3F8F A;  1S3J A;  2NS0 A;  1FX7 A;  2ECC A;  2X0L A;  3I59 A;  2CV2 A;  3IP4 B;  2R7O A;  2KRH A;  4EAT A;  1NK3 P;  4A12 A;  3HOX J;  3OYG A;  3E6C C;  2DMU A;  4L0Z B;  5JLW A;  1R00 A;  2O7O A;  3LFU A;  1DU0 A;  2XRN A;  4CH7 A;  3DKY A;  2RQP A;  3BRO A;  4CDG A;  2DQR A;  3CD6 I;  3KFW X;  4M3B A;  1R49 A;  1FBU A;  1PVE A;  1LDK B;  1Z3Y A;  2ADU A;  5GAG J;  3J7Y J;  2V7F A;  3A0B C;  4WCG A;  1MD0 A;  2EH3 A;  4EV0 A;  3RSN A;  2FF4 A;  2P6S A;  2K40 A;  2XAS A;  2O6G E;  1OCR H;  4KMF A;  3D5S C;  1QNT A;  2IS6 A;  3OYF A;  1OYY A;  2CUF A;  4XN0 A;  2XGD A;  4UUS A;  1F43 A;  4A93 J;  2YPR A;  5HDN A;  4PGG A;  1BIB A;  4DZP A;  1T98 A;  5H2F C;  2JMW A;  4UUV A;  2IJL A;  4ZYA A;  3FXM A;  2LD5 A;  2GAU A;  2JK3 A;  5B66 C;  2CQQ A;  2VOD A;  1U2W A;  3H1C A;  2IVM A;  3M8J A;  2DU9 A;  3WG7 H;  3MKY B;  5E18 F;  1FBS A;  2AQF A;  3J81 Z;  1O3T A;  3E6D A;  3HG9 A;  3G73 A;  1V5F A;  1ETX A;  3J7Z I;  2JUC A;  3BCA A;  5CVR A;  2VUM J;  1GT0 C;  1V4R A;  2ICW G;  1QU3 A;  4O6J A;  1X4P A;  1IF1 A;  4LOC A;  3OYM A;  3ABL H;  2UV1 A;  1R4M B;  1IZ1 A;  3CTA A;  4IVN A;  2QA4 I;  2GA2 A;  2QUF A;  3HIF A;  3JW4 A;  1EKE A;  3S2D J;  2DA1 A;  1TQP A;  4UY8 I;  4FX0 A;  5E79 C;  2F48 A;  3TO7 A;  2F5F A;  5JHU A;  1HF0 A;  4Y33 A;  1HW5 A;  1AOY A;  2DOA A;  2FUG 2;  3U1K A;  3DPU A;  1XPX A;  4KIS A;  3B6A A;  2XKO A;  4JK1 X;  2IEK A;  3S15 J;  1IDY A;  2F6C A;  4A3M J;  2NS8 A;  1G3S A;  2M34 A;  4IL6 C;  4ZYG A;  5GAE J;  3ZMS A;  4QWQ A;  5EG0 A;  2HU9 A;  1NHA A;  4F91 B;  2HXI A;  1R36 A;  4IX7 A;  3PFI A;  3WE2 A;  5LHG A;  3BTC A;  3GF2 A;  2XPV A;  3DWL E;  2JPC A;  4CYC B;  2KMU A;  3ZQF A;  2KLO A;  2YU9 J;  2WAF A;  1FOY A;  1YIO A;  4P5O A;  4XLP F;  3OR1 C;  3P7N A;  3RZO J;  3HSE A;  4KMU X;  2E5Z A;  1FYL A;  1XGM A;  3RYR A;  3QYB A;  3KP7 A;  3RKW A;  2BY3 A;  2ZB9 A;  2XV4 S;  3KYL A;  6PAX A;  2A68 F;  3BG9 A;  4YIR X;  3ZQC A;  5KK1 A;  4JYK A;  2M8G X;  1XMX A;  2DFF A;  2LY9 A;  1R6R A;  1FY7 A;  4G7H F;  1FOK A;  2Z2S B;  3TMO A;  1UHW A;  4LB6 B;  1MBF A;  4PZJ A;  5BMZ A;  4U7B A;  5M3F J;  1G3Y A;  2LTP A;  1GV5 A;  2ZXH A;  3HBL A;  4XM3 A;  4BQO A;  5L3F A;  5CQE A;  1F5T A;  3R61 A;  1RIO H;  3CF5 F;  3OIQ A;  1W5T A;  1R1U A;  3LQQ A;  4XL9 A;  2W4S A;  2VXZ A;  3TDZ C;  1VQP I;  4A3G J;  1A6I A;  1OKR A;  4OIP F;  1X1P A;  3IUO A;  1Y56 A;  2XAG A;  5TIS C;  3W2W A;  3GLX A;  1RES A;  3FBN B;  3WU1 B;  4LK0 F;  4XSX F;  1TL8 A;  4EQQ A;  4YRV A;  2DO7 A;  1EA3 A;  1PJR A;  2FBI A;  2GIV A;  5EYR A;  5HS9 A;  3VYS B;  4FHT A;  5JLX A;  1Z1D A;  2Q0O A;  1TP4 A;  4II2 A;  2FMY A;  4ASN A;  1SVM A;  4TV7 A;  3BPV A;  2EA4 A;  3OYB A;  1S9H A;  1JTY A;  3Q3S A;  2PN6 A;  2VBW A;  2NNY A;  1G4D A;  3ABU A;  1S7E A;  2WY8 Q;  4BDZ A;  1RZ4 A;  2GIZ A;  3GZ5 A;  3LST A;  3Q5F A;  2MFZ A;  4HST A;  5LBQ A;  2K9L A;  2CO5 A;  1VQO I;  3SQN A;  2IGN A;  2HFH A;  3TKY A;  4DNC A;  2CMP A;  2ZJ2 A;  2R7D A;  2I5U A;  1WPK A;  3A2K A;  4BJT A;  3S16 J;  1GDT A;  1X2N A;  4UV9 A;  4U7D A;  1WRJ A;  1FJL A;  2V1U A;  3BT9 A;  2G7U A;  1ORK A;  3KLN A;  2AO9 A;  2OD5 A;  3QOE A;  5CVJ A;  3RJP A;  5HS8 A;  5BPD A;  2V9K A;  4M71 A;  1DGW Y;  2F5E A;  1H88 C;  3G4S I;  2XAH A;  3DV8 A;  3F8N A;  1JGS A;  4HDU A;  1ZRE A;  4N0B A;  3L2Q A;  3J7A Y;  3S17 J;  1IUF A;  1BR4 A;  2FJ1 A;  2W24 A;  4H4K C;  3D1N I;  1YS6 A;  1B72 B;  2ECB A;  1P2F A;  1ETY A;  1D1C A;  1JXS A;  2DQL A;  1D5V A;  1WJC A;  1G2H A;  3K6G A;  1SAN A;  3ABK H;  4XLF A;  5LEJ A;  3GTG J;  1IN8 A;  4XLH A;  3H9Q A;  1MBJ A;  1XGN A;  3EET A;  5DD8 A;  1R1V A;  3JAM K;  3COA C;  3TW6 A;  4R79 A;  4JQF A;  2NRA C;  1DQU A;  1V5G A;  2KDO A;  2MAB A;  3FWE A;  3SHF A;  3ZQI A;  4RB3 C;  3JRI A;  3ZOB A;  4ENN A;  2XIG A;  2E2H J;  2V9V A;  2JN6 A;  2O5R A;  1ACI A;  3TO9 A;  3DFG A;  5D5V B;  2M4G A;  2VJ4 A;  1VFC A;  4BHB A;  4EGY A;  3FK7 A;  2M45 A;  2XAU A;  4FTH A;  2DOF A;  3TED A;  2R7Q A;  3S93 A;  2JRT A;  2ZNY A;  4EEF G;  3OSF A;  1YRN A;  1ZLJ A;  3IKV A;  2P8T A;  4PK4 A;  4XMY A;  2XPU A;  3WHB A;  2M3A A;  2ZFU A;  3GWZ A;  1LFU P;  5CVU A;  3QRF F;  1I1G A;  3BJ6 A;  2ZCW A;  1FTZ A;  1XDS A;  3BG7 A;  1QBJ A;  2JSP A;  1KYW A;  5HNH A;  4CZC A;  3KYD B;  2I8D A;  4QPQ A;  2LP0 A;  3DPT A;  3GCM A;  2DFE A;  5HOO A;  4I09 A;  1MNE A;  1ZG1 A;  3FXL A;  3FIS A;  4HLY A;  1SFE A;  3GX4 X;  5J40 A;  1JKR C;  5J4Y A;  1MNM C;  2DT6 A;  3VYR B;  1P4A A;  3QOP A;  2QF7 A;  3M7G A;  4L9N A;  4NBQ A;  2WWY A;  3K4J A;  2HOE A;  4XR6 A;  2PQ8 A;  3REO A;  1ZGA A;  1R23 A;  4I99 C;  4B09 A;  2GXG A;  2MD5 A;  1P6R A;  3NRV A;  3OIP A;  3WTW C;  2DXI A;  1Y1W J;  3OYK A;  3CMM A;  3JTG A;  3CF2 A;  2A07 F;  2LKX A;  3BOQ A;  2DTZ A;  3R60 A;  1GVJ A;  2XUB A;  5D5X B;  1VQ6 I;  5EGO A;  2MYS A;  5DM6 F;  1XGO A;  5EEG A;  3A01 B;  3LL7 A;  1YOV B;  3MEX A;  2VT3 A;  1YO5 C;  4BDY A;  1Z3X A;  2JPB A;  1PYV A;  3JSP A;  3GVA A;  4M6V A;  1R7J A;  4M72 A;  4LFU A;  2TDX A;  1LJ9 A;  4HQE A;  1GLN A;  4G8X A;  4OMZ A;  4ZH4 F;  5A2Q K;  2DLL A;  3GTK J;  3AG2 H;  4PJL A;  3IAS 2;  3A01 A;  5E3L A;  5JFR A;  1JT6 A;  1UG0 A;  2KIF A;  1FOW A;  1IV6 A;  1WKM A;  1RC9 A;  1W7P B;  1XTA A;  4A3E J;  3KP6 A;  1PUF A;  2IBD A;  3RPU A;  4ITV A;  3W6V A;  2ACJ A;  2RC4 A;  3EUA A;  1WZ2 A;  3ZQ7 A;  4MHG A;  4HX7 A;  5D4S A;  1WJ5 A;  1ZYR F;  1X58 A;  2FX0 A;  2WAQ N;  1PP8 F;  1OIS A;  5BNG A;  2W25 A;  2ID3 A;  3WOD F;  4YII A;  3DTE A;  2P5K A;  1CGP A;  1KU2 A;  1O7L A;  1APL C;  2CWE A;  3OOP A;  4KNY A;  3PNT A;  3MZ8 A;  4QTR A;  4EJO A;  2KPM A;  1WCM J;  3QOD A;  2HYF A;  2VI6 A;  5FRN A;  5C4X J;  2G7H A;  1YI2 I;  1CF7 B;  1UB9 A;  1JGG A;  4EGZ A;  4UNO A;  4WF2 A;  3D0S A;  4YEL A;  4N4O B;  3DQV C;  3IRR A;  2R7W A;  5BS6 A;  2K86 A;  2BY2 A;  1O4X A;  2L9R A;  1TZL A;  2LR8 A;  1R22 A;  3ZQL A;  3HOV J;  2W1O A;  1D5Y A;  1H8A C;  2A6H F;  2XGX A;  3G1L A;  3LWF A;  1CF7 A;  1XG1 A;  1I50 J;  3I4M J;  2HZT A;  4L5J A;  2VPL A;  3KP3 A;  1ZG5 A;  5L3E A;  2BGC A;  1ON2 A;  4Z6Y A;  3H5R A;  2GXB A;  2QEN A;  5F0F A;  2PMZ A;  3MKZ A;  3BTL A;  1ULY A;  1XC5 A;  1IV8 A;  3PL8 A;  1JUS A;  2E2J J;  2MLK A;  3VDX A;  2R7Z J;  1ERD A;  1FEX A;  1FSH A;  1I6H J;  4LG0 B;  2J5O A;  5D4R A;  3VEP A;  5M5X J;  4HEA 2;  3HJE A;  4CZZ A;  3S3N A;  1C0W A;  5DDG A;  2VB6 A;  1MDM B;  4IHS A;  2R93 J;  4CCL A;  1ZQ3 P;  1JI8 A;  2KZG A;  5FFZ A;  3SDG A;  1FYK A;  1KZH A;  1TWA J;  2NOJ B;  1ZEL A;  3ZMZ A;  1DDN A;  4LG0 A;  4NQW B;  1WFX A;  4HV6 A;  4AVZ A;  3BY6 A;  1RR8 C;  4XRS A;  1MMS A;  4FAS D;  4HZF A;  2JQ7 A;  2M0C A;  2H09 A;  5DCM A;  5E1X A;  1HDD C;  3IH2 A;  1E17 A;  4XRS G;  2K4J A;  2OV7 A;  3FMQ A;  2OZU A;  4NQW A;  2UZK A;  2NVT J;  1F36 A;  1HBX G;  1Y8R B;  3RYP A;  4B4C A;  1V5E A;  4A3B J;  2H1K A;  4L9V A;  2FXA A;  4ANJ A;  4GYG A;  2R7U A;  2RV8 A;  4KIB A;  4F92 B;  4HG2 A;  1BW6 A;  3RPQ A;  3ZP5 A;  2E34 A;  1ZRF A;  2ELK A;  3K1M A;  1J5Y A;  3PQJ A;  4BY1 J;  2HQA A;  2GOX B;  2XRO A;  3JR9 A;  2O8K A;  2YU3 A;  2JA6 J;  3BLY A;  3ABT A;  4HW0 A;  1JE8 A;  2F2E A;  4HOB A;  4XN3 A;  1XS9 A;  4E7Z A;  2IAI A;  2M9H A;  5EEH A;  1MBE A;  2CW0 F;  4RAZ A;  3LA7 A;  3R0A A;  1BR2 A;  2ZXW H;  2A69 F;  2MD0 A;  2ETH A;  5DM7 F;  4PJJ A;  2X6W A;  4RBO A;  3S1M J;  1YFH A;  4E4H A;  2XF7 A;  2L9N A;  3I4N J;  2EIK H;  2W48 A;  3JRG A;  3S32 A;  4BBR J;  2LF7 A;  3S1R J;  1I1S A;  2QKL B;  1U3E M;  4KN4 X;  5HDK A;  4P96 A;  2STT A;  1GXP A;  4M74 A;  1IN6 A;  2RNG A;  4B1R A;  2HKO A;  5K5Q A;  5K7H A;  1IRG A;  1FC3 A;  2FRH A;  1OPC A;  1VND A;  3GFL A;  3L7W A;  4E70 A;  1JUP A;  4A3L J;  3HGY A;  3VPR A;  1JJ8 C;  2KKO A;  3GXO A;  3QU3 A;  5D8K B;  3SZG A;  5C3E J;  1ZK8 A;  2WY7 Q;  3L9F A;  3JRB A;  1U8B A;  2G9W A;  3OL3 A;  4E6K G;  4HF1 A;  2LC2 A;  3QPL A;  2GBY A;  3LA3 A;  4LJZ F;  4HLX A;  1SMY F;  4C3J J;  2GXA A;  3KLO A;  3Q0V A;  5J1R A;  4WX9 A;  1K6Y A;  2BE5 F;  1P4W A;  2K4B A;  3HL2 A;  3ZCO A;  4CCN A;  1P7J A;  3QWL A;  2DMN A;  1JHF A;  1EH6 A;  2PMU A;  4MFD A;  2X1D A;  3I58 A;  2DMQ A;  2XAF A;  3OS0 A;  1GXQ A;  3HOT A;  2WB1 N;  3F8B A;  2DPU A;  4M3E A;  1UJ8 A;  2OF7 A;  2VLA A;  1Z05 A;  1SC7 A;  3G2B A;  1I3A A;  4XK4 A;  3PSF A;  3SYT A;  4BBS J;  3ELK A;  1A04 A;  5EF6 A;  2BHZ A;  1LE8 B;  5LGN A;  1QVT A;  4WK8 F;  4A5M A;  4N9I A;  1ETQ A;  2ZJR F;  2RQQ A;  4P9U A;  5F04 A;  2W7N A;  1MMG A;  1B9N A;  3HRM A;  3U1D A;  4V19 K;  3QYF A;  3BTI A;  4H0E A;  1BL0 A;  3SZP A;  1Z67 A;  2CW7 A;  4OIN F;  3JRF A;  1HQC A;  2M1B A;  1Q1V A;  2XGE A;  2P5V A;  4HYE A;  4BH9 A;  4D7N A;  3KE2 A;  3M07 A;  4RMN A;  4BE1 A;  1TTY A;  4EVI A;  5HLT A;  4L9J A;  3GFJ A;  2EFQ A;  5GTH C;  1YG2 A;  2XSJ C;  3LAP A;  1DP7 P;  3F21 A;  1SVO A;  3EYI A;  5KAF C;  2Y31 A;  2WTE A;  3QAH A;  4JOM A;  3K70 C;  5E3O A;  2X1E A;  2WB1 A;  3L2W A;  2R7R A;  4WWC A;  2ZC2 A;  2LG4 A;  1E0E A;  1YW7 A;  2F4M B;  3E1S A;  1FOX A;  4CCM A;  2P5L C;  5FKK A;  4KYW A;  1IJW C;  4PFO A;  2EIM H;  4ZJZ A;  3A03 A;  1UHM A;  2EV6 A;  2NVQ J;  4A2U A;  1XSD A;  1HC8 A;  3E97 A;  3SFI A;  1W7P D;  2RRE A;  3CCL I;  2R5Y B;  4HV5 A;  4KIC A;  1Y1V J;  3GEZ A;  4RB0 A;  1Z7L A;  2OAZ A;  3I55 I;  3CO6 C;  3N05 A;  1VQ8 I;  4UV8 A;  4ESB A;  1UZC A;  2DA2 A;  3MQ0 A;  1T2K A;  2EFW A;  4M6Y A;  1VQM I;  2BW3 B;  4M3G A;  3O3K A;  1OCZ H;  1OLT A;  4QLC U;  1SFO J;  4E7K A;  2R5Y A;  4AU7 A;  2E71 A;  5IT9 K;  3WG9 A;  1XN7 A;  2EV0 A;  3I71 A;  4IOC F;  1W0U A;  3KP4 A;  4MFE A;  1TWG J;  2IP2 A;  2BOL A;  2BW3 A;  4KIG A;  2L7K A;  3OWT A;  3RQ4 A;  1LDD A;  2WBM A;  4XRM A;  4BEH B;  1JTX A;  2KJB A;  3R6S A;  1KU3 A;  2IXS A;  4BHP A;  1YJ9 I;  1OR7 A;  1YJW I;  3WTT C;  3CCV I;  5LHI A;  2A5W A;  3S2H J;  3UKG A;  1BM9 A;  3S3O A;  4U0V A;  4CGZ A;  4AC0 A;  1OR7 C;  1XMK A;  3KPH A;  3WTS C;  2GA1 A;  4HRI A;  1LKX A;  3GTQ J;  3BQY A;  2PBI A;  1FBQ A;  1QRY A;  4ZC3 A;  2V1N A;  3ZQH A;  5GP9 A;  1K78 B;  1MMA A;  1YW9 A;  4ENJ A;  2K3F A;  5KHD A;  2NNN A;  5ILU A;  3B73 A;  1LFP A;  3F23 A;  2DA6 A;  3SFZ A;  4A3I J;  2NYX A;  2HTS A;  2OQG A;  3O8G A;  2XPW A;  1KQ8 A;  1K78 A;  3BZ6 A;  3EQL F;  1YW8 A;  4EM2 A;  1S7A A;  3SJM A;  3T0Y A;  1VQK I;  2FQ3 A;  1AKH B;  2HPI A;  5F1J A;  4IHT A;  3BG3 A;  4I98 B;  3E3V A;  3ZQG A;  1ZH5 A;  2FBK A;  4CXF A;  3ERE D;  2IGK A;  4C9Y A;  4AM3 A;  3CC4 I;  4RAY A;  2H94 A;  3M1E A;  3KET A;  5JHF A;  1AKH A;  3G1M A;  1TT5 B;  2JZY A;  3DBR B;  4IJA A;  4CUG A;  5GTI C;  5FD5 A;  3LNQ A;  3QYE A;  1MMD A;  4YFX F;  2CS3 A;  1X3W B;  1FP1 D;  1BOA A;  1X1B A;  4QIW N;  1K4T A;  1AA7 A;  1GV2 A;  3LSK A;  2X6Y A;  3H3U A;  4DYR A;  4ZTJ A;  4IPA A;  1UEL B;  1IXS B;  2E5N A;  4UXN A;  3PSI A;  5LHH A;  4HX4 A;  3DLA A;  1X1A A;  1IXC A;  4HSR A;  1HKT A;  1SD5 A;  2WAE A;  3AG4 H;  3TP3 A;  4A3F J;  1F1Z A;  3HPG A;  2ZBK A;  1K83 J;  4DYC A;  1VQ4 I;  2ME6 A;  5B1B H;  1J2X A;  4B8X A;  3FKI J;  3X2Q H;  1Z6R A;  1JJ6 C;  2P81 A;  1TLH B;  1VQN I;  2V9P A;  4F52 A;  1U8R A;  1N78 A;  4CYC A;  2DYS H;  3DTK A;  4NDL A;  2L5Q A;  3BQZ A;  4XKC A;  1REP C;  3C2G A;  3DXJ F;  5M5Y J;  5CKT A;  3W6K B;  5EDN A;  2JJ7 A;  1ZRC A;  1ETO A;  3CJN A;  5DS9 A;  1IN5 A;  1J9I A;  4RLF A;  2ESN A;  4GGG A;  3CME I;  1I27 A;  2XRL A;  1MW7 A;  2K5C A;  4RM2 A;  5GPC A;  2DA4 A;  1FMV A;  2JSC A;  4BE0 A;  4C30 A;  1LDJ A;  2NAZ A;  4F7Z A;  1ZAR A;  2MC3 A;  3JAM Z;  5ICG A;  1TNT A;  3S1Q J;  3HRT A;  4L5E A;  2O9L A;  2GQQ A;  2E19 A;  3ZPL A;  1NG7 A;  1Y8Q B;  4Q4Z F;  2MGQ A;  4HA8 A;  4EJW A;  2DBB A;  2YR2 A;  3JRH A;  1X1C A;  2EJR A;  2F5D A;  3P5J A;  9ANT A;  3CLO A;  3GLL A;  1TT0 A;  2YX7 A;  2LH9 A;  1EJ9 A;  1SAU A;  2X6O A;  1FZP B;  2QSG X;  1RRJ A;  4Y4R A;  2FOK A;  3KEY A;  3DCF A;  1QA6 A;  3BR5 A;  2DT7 B;  3C3W A;  3AL0 B;  2QLZ A;  2CFX A;  4PSX A;  4B48 A;  1B8I B;  3H0G J;  2XF5 A;  2LF8 A;  4WXH A;  1YJN I;  2FNA A;  1QVU A;  3RCO A;  2CQN A;  3L2V A;  2DA3 A;  1MIJ A;  2NXN B;  1BI2 A;  5E1Z B;  4J19 A;  2GLO A;  4ENK A;  3GTM J;  2HQR A;  1OQY A;  1FLI A;  3GFI A;  3SZT A;  4GCV A;  2DK5 A;  3AL0 C;  3E7L A;  3K70 D;  1MSF C;  1MBH A;  3DPL C;  3H9G A;  2DFH A;  3I4P A;  1ETK A;  1SD6 A;  1D0Z A;  1TWC J;  4FE4 A;  3M4O J;  2X48 A;  2EFP A;  1A31 A;  2R92 J;  3S1N J;  1KQ9 A;  3U2R A;  3L09 A;  4BAY A;  1EH8 A;  2E36 A;  2M7A A;  4I76 A;  2VJI A;  3ISP A;  2VOP A;  3BP8 A;  4LIV A;  3ULQ B;  2V1D A;  3C7J A;  4CCK A;  1QZE A;  4LK1 F;  1B9M A;  2CG4 A;  2K3P A;  1VQ9 I;  1QO0 D;  5HOD A;  5A2Q Z;  5D6E A;  1X19 A;  2VQH A;  4RGS A;  3L2C A;  2ZKZ A;  3CJT B;  3HSR A;  1VZ0 A;  4QSH A;  3RI4 A;  1HXD A;  2RAE A;  5KCM A;  3ZMD A;  1QZZ A;  2Z5U A;  2BY1 A;  1IGN A;  3FM3 A;  1XD7 A;  3A02 A;  3WTV C;  2DDA A;  3LMM A;  4HAM A;  1K4S A;  1K7A A;  3KEO A;  3LSP A;  3BC8 A;  3BZK A;  2KFD A;  2VE9 A;  1YX3 A;  2LRE A;  2VIX A;  2Y48 A;  4X0G A;  2XKP A;  4Y13 A;  4YIF A;  3PIO F;  4OU0 A;  1RKT A;  4DBR A;  4MQ9 F;  1IAW A;  5F6F A;  1BA5 A;  5FRM A;  1H9T A;  3CJR B;  1FYM A;  3OIO A;  3HTS B;  4BGD A;  1ZAO A;  5E20 A;  2J5P A;  1B72 A;  3I53 A;  1MJA A;  4HBL A;  3K4N A;  4G94 A;  3WU2 C;  2DMT A;  4U0W A;  4XBF A;  4IHX A;  3R0J A;  3MWM A;  4BXX J;  2KZV A;  1DUX C;  2A61 A;  1I5Z A;  4OAY A;  4NUB A;  1BBY A;  3AFH A;  2O03 A;  1KYZ A;  1Z77 A;  3HKZ N;  3RTR A;  4ZDL A;  3Q0U A;  2CGP A;  2EB7 A;  2A6E F;  2A6T A;  1WGX A;  2EV5 A;  2M8E A;  3LFK A;  2LLK A;  4A5N A;  3WHC A;  4V2F A;  3G3Z A;  5J3L A;  1HW1 A;  2PEX A;  5FKN A;  1E3P A;  2EZH A;  2EFN A;  3K9T A;  2B9S A;  4BY7 J;  3VOD A;  3VYT B;  2QQ9 A;  3BJO A;  3EYY A;  3DEW A;  4B44 A;  3BG6 A;  3ROU A;  2A3S A;  5C44 J;  1UFM A;  1X2M A;  2RNJ A;  4ZDO A;  2W82 A;  3DBL B;  2XVC A;  1YQA A;  1XB4 A;  4Y52 J;  2CQ7 A;  4CO8 A;  1BC7 C;  1LEA A;  2H8W A;  1IXR C;  5DV5 A;  2UWM A;  5IP7 J;  2K9N A;  3PO2 J;  4I02 A;  1HW2 A;  2EIN H;  1F4K A;  3CQZ J;  3L00 A;  3R4K A;  4YG2 F;  3LSH A;  3TP0 A;  3TOB A;  4Y15 A;  2ISZ A;  2CQX A;  2PJR B;  4PJ0 C;  4BQN A;  3O2P E;  1L0O C; 
#chains in the Genus database with same CATH homology
 1MKM A;  4MNU A;  3TGN A;  1J7K A;  3D5L A;  4IXA A;  5DUI A;  5F1R A;  2Z9O A;  1R58 A;  3F6O A;  4BHC A;  4PGH A;  1G3T A;  5FLX K;  3LA2 A;  3MZY A;  1FNN A;  4LD5 A;  2WV0 A;  5HDG A;  5ICC A;  2P7C B;  1SFX A;  2O0Y A;  3QP5 A;  1HSJ A;  3CUQ B;  5ICF A;  1W7P A;  3C18 A;  3M9A A;  1TNS A;  5FO5 A;  3T8R A;  2OBP A;  1TW3 A;  3V8J A;  2FEZ A;  4RGX A;  3T1B A;  2YX4 A;  3N4M A;  3TO6 A;  2IW5 A;  4OIO F;  4KIF A;  5DD4 A;  2O3F A;  3MFK A;  4AWX B;  2D1V A;  5E1W A;  3P9C A;  4G7Z F;  3PQK A;  4XSZ F;  3VFZ A;  1Z9C A;  1ZHF A;  2FU4 A;  4HF0 A;  3KP5 A;  1LEB A;  1USS A;  3K1P A;  4A6E A;  2HR3 A;  3K69 A;  4HF2 A;  4EM0 B;  4ESJ A;  3AAF A;  3IWZ A;  4L9T A;  4BYY A;  1V3F A;  3ZMU A;  3IHU A;  4G6Q A;  3IC7 A;  1O57 A;  5H20 A;  2HYG D;  4FX4 A;  2V6C A;  3HOS A;  1JHH A;  1FT9 A;  1YLF A;  3RIR A;  2F5C A;  3LQR A;  4L0Y B;  5JI6 A;  3M8F A;  1MDM A;  4AIK A;  3RKY A;  1ZGJ A;  5ICE A;  1Z91 A;  3E6B A;  4OMY A;  3FF5 A;  2VON A;  4EJV A;  1G3W A;  2BV6 A;  2VT2 A;  5D8L B;  4ZYE A;  1EH7 A;  2XHK A;  2QBY B;  5BQT A;  1XDU A;  2A5Y B;  5AIQ A;  1QGP A;  2KIU A;  2ZME B;  4NHJ A;  3BPX A;  4HQM A;  1B1B A;  3WE3 A;  3WGG A;  4DQ2 A;  2QBY A;  1HKS A;  1S6L A;  3FHZ A;  3RKX A;  5H6Q A;  4PCQ A;  2ZME A;  2FSW A;  4EJT A;  1U5T B;  4AIH A;  2V1X A;  2YSR A;  4GO1 A;  5D5W B;  2EFO A;  2L01 A;  4A0Z A;  1IN4 A;  4RGU A;  2XAQ A;  3HHH A;  3GW2 A;  3V4G A;  2OA4 A;  2ZO4 A;  1U5T C;  2EK5 A;  5IT9 Z;  1W4M A;  4BXU A;  2FA5 A;  1H0M A;  3O6B B;  1O3S A;  4O5V A;  2PJP A;  1QQI A;  5FD6 A;  3E5U A;  4KT5 C;  3HHG A;  5LLQ A;  2W57 A;  4A0X A;  1WI9 A;  5E8I A;  3FXR A;  2HTJ A;  2VOO A;  1PP7 U;  1OMI A;  4ENM A;  2VBX A;  3TDU C;  2HDC A;  2VBY A;  2KRF A;  1U6G A;  1GHC A;  3ZMV A;  3E6M A;  4LLN A;  3RDI A;  4Q5S F;  3HYI A;  1IRF A;  2H6B A;  3GYH X;  5E8G A;  1F9N A;  3QPT A;  2FE3 A;  2LNB A;  1STZ A;  3DEU A;  1T38 A;  3FX3 A;  2EA2 A;  4G6D A;  3ECO A;  5TRD A;  1YYV A;  5ERI A;  5L3B A;  1RUO A;  5K5O A;  3P9I A;  3Q9V A;  2P4W A;  1SD7 A;  1Z7U A;  5LEK A;  3BDD A;  4A0Y A;  4KFC A;  3FZV A;  2EWN A;  3DF8 A;  4G9Y A;  2VBZ A;  3T8T A;  2M30 A;  3WGH A;  2JTV A;  4MEY F;  1YS7 A;  4IRG A;  4OIQ F;  4AIJ A;  1BIA A;  1KU7 A;  5BOX A;  3MAJ A;  1I6X A;  4AVP A;  1S29 A;  1HST A;  2DW4 A;  4Z2Y A;  2MA3 A;  3J80 K;  4ETS A;  2HKX A;  3B02 A;  3F22 A;  3IL2 A;  2H6C A;  4MTE A;  2RGV A;  3E5Q A;  1O3R A;  3F8M A;  1G6N A;  3GFM A;  4KDP A;  1TBX A;  3KCC A;  1BI0 A;  2M87 A;  1OYI A;  2PLY A;  1S7O A;  1T39 A;  2BEO A;  3NQO A;  4MTD A;  4RB1 A;  4AD9 A;  4HX8 A;  1D3Y A;  2QYO A;  4Q47 A;  2WC2 A;  4M6X A;  1WQ2 A;  1ON1 A;  3M8E A;  2MH9 A;  4M9Z A;  1UST A;  1TQM A;  4KUM A;  5K1Y A;  2DAO A;  1J0R A;  4IRH A;  4UVC A;  4A6D A;  2CSO A;  2Y75 A;  5HS7 A;  2CQK A;  2AXL A;  3HUG A;  3VOE A;  3WTZ A;  3IWF A;  4UVA A;  2VC1 A;  2DT5 A;  2KIM A;  5ED4 A;  2RDP A;  1TQI A;  1W5S A;  3BWG A;  1SMT A;  3C1D A;  3MCZ A;  2IA1 A;  3OV8 A;  2B0L A;  3CDH A;  1BN5 A;  2OQR A;  2PFB A;  2K27 A;  2QVO A;  1IN7 A;  5TJJ A;  4MGR A;  4ZYD A;  2ISY A;  2BBY A;  3I64 A;  3K2Z A;  1U78 A;  3ML6 A;  4PDK A;  2OU2 A;  2K02 A;  2ZNZ A;  4UHT A;  4YFK F;  1K79 A;  1FSE A;  1LNW A;  4NB5 A;  4HDV A;  4ZZD A;  2IA0 A;  2L02 A;  4MEX F;  4WXC A;  1XCB A;  5JVT A;  5HVQ C;  3P9K A;  2D45 A;  1MJB A;  2Q8K A;  5F64 A;  2HWV A;  2ZXJ A;  5J8C A;  3GUD A;  5DUK A;  4L5I A;  1J75 A;  2MH2 A;  3HRU A;  5D5U B;  3S2W A;  2DTR A;  1O7F A;  5DYM A;  4Y17 A;  3I0T A;  4G7O F;  2GZW A;  1KU9 A;  3IKT A;  2XAJ A;  2IRF G;  2PG4 A;  5LGU A;  3J81 K;  1QPM A;  3VB2 A;  4LLL A;  3DP7 A;  1B4A A;  4LLG F;  3NEU A;  2QWW A;  2COM A;  3I54 A;  3DKW A;  5FFX A;  5HLI A;  5D6F A;  1KQ0 A;  2JT1 A;  4KA4 A;  4GYI A;  1MGT A;  5L3D A;  2Z3Y A;  1L3L A;  4OOI A;  4Q48 A;  5LGT A;  4BNC A;  3HSF A;  1P92 A;  3WTY C;  1Y0U A;  4WXD A;  4EJU A;  3JTH A;  5FLX Z;  2LKP A;  3F3X A;  4M73 A;  1R1T A;  2O8X A;  4R8H A;  4ZZL A;  3TOA A;  3V8K A;  2QQA A;  3FM5 A;  1J59 A;  2L4M A;  3KZZ A;  3V7C A;  1SFU A;  4I01 A;  2UXX A;  3H3Z A;  2RKH A;  4RGR A;  1ZLK A;  5J6X A;  2W85 A;  2QM3 A;  2KJC A;  3ZMT A;  3F8C A;  5H6R A;  4S04 A;  1XMA A;  1RUN A;  4EM1 A;  3Q9S A;  3CUO A;  1Z6T A;  3GZ6 A;  5FB2 A;  3W6J B;  3T5X A;  2L3D A;  2L54 A;  4N9H A;  1VTN C;  4U88 A;  2AS5 F;  2UXN A;  5FGM A;  2DPD A;  3F72 A;  3ECH A;  1FP2 A;  4LB5 A;  2STW A;  3BJA A;  4CIC A;  3K1N A;  2E1C A;  3F6V A;  1B59 A;  1K6O A;  3CO7 C;  2CYY A;  2FML A;  2V79 A;  4XLN F;  4I0B A;  1KGS A;  4UVB A;  2ESH A;  3MZH A;  4L18 B;  1ZG3 A;  4MQV A;  4ZYH A;  2VN2 A;  5LRR A;  5CJ9 A;  4I0A A;  4M9X A;  5CYV A;  1XSX A;  2C6Y A;  3HRS A;  1SD4 A;  4IF4 A;  5CVI A;  1T0F A;  3WGI A;  5L3C A;  1RNL A;  2HEO A;  3K0L A;  3EDP A;  2MLG A;  5IT3 A;  4IRI A;  2IA2 A;  5J8F A;  1IW7 F;  3WU0 A;  3CUQ A;  4CYD A;  2P6T A;  3N97 A;  5K5R A;  2OZ6 A;  5JR3 A;  3CUQ C;  3V7S A;  5LRS A;  5ILS A;  1TW2 A;  3ZN1 A;  2RN7 A;  2D1H A;  3TQN A;  3E5X A;  2W84 A;  5HLH A;  5E17 F;  1MJ9 A;  1LQ1 A;  2VE8 A;  1YTY A;  5L3G A;  4LGW A;  4OIR F;  1LVA A;  1MZB A;  1HKQ A;  1FPQ A;  5HLG A;  4RS8 A;  1LB2 A;  1RI7 A;  1D8J A;  4RB2 C;  3WTX C;  1ONV A;  1D8K A;  1DPR A;  2DI3 A;  5DCM B;  3GO5 A;  2P7V B;  5DCF A;  3KEQ A;  2H27 A;  2VC0 A;  4I7H A;  2O61 A;  2E7X A;  1EV7 A;  4D0P A;  4FT8 A;  3LAJ A;  2HQN A;  3V8L A;  3EUH A;  3SXY A;  1XCV A;  5AIP A;  2LSO A;  1O3Q A;  3ZN0 A;  1H9G A;  4CHU A;  4K2E A;  3J7A O;  1KA8 A;  1E2X A;  1BI3 A;  2ELH A;  1FWZ A;  2X4H A;  3QPH A;  3HTU A;  2LDU A;  3FMR A;  4XRF A;  5DEQ A;  3U9G A;  3QP6 A;  5ILV A;  1U5T A;  1WSU A;  5CLS A;  1ODD A;  3QU6 A;  2Z99 A;  4BQA A;  2D2W A;  2FBH A;  5KVR A;  3KP2 A;  3FXU A;  1IUY A;  1P4X A;  4P9F A;  2L4A A;  1XSV A;  3FXQ A;  1B6A A;  2E7W A;  5BPI A;  1DPU A;  3J80 Z;  4KN7 X;  1BJA A;  1UCR A;  2HS5 A;  1BI1 A;  1ZN2 A;  1R5G A;  2DFI A;  4I2O A;  3KZY A;  2FNP A;  4LMY A;  2HGC A;  1X3U A;  2E1N A;  1AWC A;  3WTU C;  2QZ8 A;  1S8N A;  1BC8 C;  1Q1H A;  2PI0 A;  2DK8 A;  4M9S A;  4P55 A;  1SAX A;  1WWX A;  3FMS A;  3H92 A;  2Y0M A;  4S05 A;  3IRQ A;  1PUE E;  2PMH A;  2RVC A;  4ESF A;  2M5W A;  4YFN F;  5AON A;  2ZFW A;  4R1H A;  2IPQ X;  1XGS A;  1R5H A;  4ON0 A;  1OYW A;  3I5U A;  2MBF A;  4U0Y A;  1PDN C;  2QQB A;  1QZY A;  5CVV A;  2R7F A;  2GWR A;  2R3S A;  3I59 B;  1T6S A;  1ZRD A;  3JSO A;  2Z33 A;  3V7R A;  4GXO A;  4JBA A;  2BYV E;  2IT0 A;  4EMS A;  2Q2E A;  2K7L A;  3F8F A;  1S3J A;  2NS0 A;  1FX7 A;  2X0L A;  3I59 A;  4A12 A;  3E6C C;  4L0Z B;  1R00 A;  2XRN A;  2RQP A;  3BRO A;  4CDG A;  2DQR A;  3KFW X;  1FBU A;  1LDK B;  2ADU A;  4WCG A;  1MD0 A;  4EV0 A;  2FF4 A;  2P6S A;  2XAS A;  2O6G E;  4KMF A;  1QNT A;  1OYY A;  2YPR A;  5HDN A;  4PGG A;  1BIB A;  1T98 A;  4UUV A;  2IJL A;  2GAU A;  2VOD A;  1U2W A;  2IVM A;  2DU9 A;  5E18 F;  1FBS A;  3J81 Z;  1O3T A;  3E6D A;  3G73 A;  5CVR A;  1V4R A;  4O6J A;  1IF1 A;  1IZ1 A;  3CTA A;  4IVN A;  2GA2 A;  2QUF A;  3HIF A;  3JW4 A;  1TQP A;  4FX0 A;  3TO7 A;  2F5F A;  5JHU A;  1HW5 A;  1AOY A;  2XKO A;  4JK1 X;  1G3S A;  4ZYG A;  3ZMS A;  4QWQ A;  1NHA A;  1R36 A;  3PFI A;  3WE2 A;  5LHG A;  3GF2 A;  2JPC A;  1YIO A;  4P5O A;  4XLP F;  3P7N A;  3HSE A;  4KMU X;  1FYL A;  1XGM A;  3RYR A;  3KP7 A;  3RKW A;  2XV4 S;  6PAX A;  2A68 F;  5KK1 A;  4G7H F;  1FY7 A;  1FOK A;  1UHW A;  4LB6 B;  4PZJ A;  5BMZ A;  4U7B A;  1G3Y A;  5L3F A;  1F5T A;  3R61 A;  1RIO H;  1W5T A;  1R1U A;  3LQQ A;  2VXZ A;  3TDZ C;  1OKR A;  4OIP F;  2XAG A;  3GLX A;  3WU1 B;  4LK0 F;  4XSX F;  4EQQ A;  2DO7 A;  2FBI A;  2GIV A;  5HS9 A;  4FHT A;  1Z1D A;  2Q0O A;  2FMY A;  4ASN A;  4TV7 A;  3BPV A;  2EA4 A;  2PN6 A;  2VBW A;  2NNY A;  1G4D A;  3ABU A;  1RZ4 A;  3GZ5 A;  3LST A;  3Q5F A;  5LBQ A;  2CO5 A;  3SQN A;  2HFH A;  3TKY A;  4DNC A;  2ZJ2 A;  2R7D A;  4UV9 A;  4U7D A;  1WRJ A;  2V1U A;  2G7U A;  3KLN A;  2OD5 A;  5CVJ A;  3RJP A;  5HS8 A;  5BPD A;  4M71 A;  2F5E A;  2XAH A;  3DV8 A;  3F8N A;  1JGS A;  4HDU A;  1ZRE A;  4N0B A;  2W24 A;  1YS6 A;  1P2F A;  1JXS A;  2DQL A;  1D5V A;  5LEJ A;  1IN8 A;  1XGN A;  3EET A;  5DD8 A;  1R1V A;  3JAM K;  3COA C;  2NRA C;  4R79 A;  4JQF A;  3SHF A;  4RB3 C;  3FWE A;  4ENN A;  2XIG A;  2V9V A;  3TO9 A;  3DFG A;  5D5V B;  4O3M A;  4BHB A;  4EGY A;  2M45 A;  2JRT A;  2ZNY A;  1ZLJ A;  3IKV A;  2P8T A;  3GWZ A;  5CVU A;  3QRF F;  1I1G A;  3BJ6 A;  2ZCW A;  1XDS A;  1QBJ A;  1KYW A;  3DPT A;  5HOO A;  4I09 A;  1ZG1 A;  4HLY A;  1SFE A;  3GX4 X;  1P4A A;  3QOP A;  3M7G A;  4L9N A;  2WWY A;  2HOE A;  2PQ8 A;  3REO A;  1ZGA A;  1R23 A;  4B09 A;  2GXG A;  2MD5 A;  1P6R A;  3NRV A;  3WTW C;  3JTG A;  2A07 F;  3BOQ A;  3R60 A;  1GVJ A;  2XUB A;  5D5X B;  1XGO A;  5EEG A;  3MEX A;  2VT3 A;  1YO5 C;  2JPB A;  3JSP A;  3GVA A;  1R7J A;  4M72 A;  4LFU A;  2TDX A;  1LJ9 A;  4HQE A;  4ZH4 F;  4G8X A;  4OMZ A;  5A2Q K;  2DLL A;  5JFR A;  2KIF A;  1WKM A;  1W7P B;  3KP6 A;  3RPU A;  2ACJ A;  2RC4 A;  3ZQ7 A;  4MHG A;  4HX7 A;  5D4S A;  1ZYR F;  1PP8 F;  2W25 A;  3WOD F;  4YII A;  2P5K A;  1CGP A;  1KU2 A;  1O7L A;  2CWE A;  3OOP A;  4KNY A;  4EJO A;  2HYF A;  2G7H A;  1CF7 B;  1UB9 A;  4EGZ A;  4UNO A;  4WF2 A;  3D0S A;  3DQV C;  3IRR A;  5BS6 A;  2K86 A;  1R22 A;  2A6H F;  2XGX A;  3LWF A;  1CF7 A;  2HZT A;  4L5J A;  3KP3 A;  1ZG5 A;  5L3E A;  2BGC A;  1ON2 A;  2GXB A;  2QEN A;  1ULY A;  2MLK A;  1FSH A;  4LG0 B;  2J5O A;  5D4R A;  3VEP A;  4CZZ A;  1C0W A;  5DDG A;  1MDM B;  4IHS A;  5FFZ A;  1FYK A;  3ZMZ A;  1DDN A;  4LG0 A;  4HV6 A;  3BY6 A;  4HZF A;  2H09 A;  5DCM A;  5E1X A;  1E17 A;  2K4J A;  3FMQ A;  2OZU A;  4NQW A;  2UZK A;  1HBX G;  3RYP A;  4L9V A;  2FXA A;  4GYG A;  2RV8 A;  4KIB A;  3ZP5 A;  3RPQ A;  1ZRF A;  3K1M A;  1J5Y A;  3PQJ A;  2XRO A;  2YU3 A;  3ABT A;  4HW0 A;  1JE8 A;  2F2E A;  4HOB A;  5EEH A;  4RAZ A;  2CW0 F;  3LA7 A;  3R0A A;  2A69 F;  2ETH A;  1YFH A;  2LF7 A;  1I1S A;  1U3E M;  4KN4 X;  5HDK A;  4P96 A;  2STT A;  1GXP A;  4M74 A;  1IN6 A;  2HKO A;  5K5Q A;  1IRG A;  1FC3 A;  2FRH A;  1OPC A;  3GFL A;  3L7W A;  4E70 A;  2KKO A;  3GXO A;  3QU3 A;  5D8K B;  3L9F A;  2G9W A;  4HF1 A;  3LA3 A;  4LJZ F;  4HLX A;  1SMY F;  3KLO A;  4WX9 A;  2BE5 F;  1P4W A;  2K4B A;  1JHF A;  1EH6 A;  2PMU A;  3I58 A;  2XAF A;  1GXQ A;  3HOT A;  3F8B A;  2DPU A;  1Z05 A;  3ELK A;  1A04 A;  5LGN A;  4WK8 F;  4A5M A;  4N9I A;  4P9U A;  1B9N A;  3HRM A;  3U1D A;  4H0E A;  3SZP A;  4OIN F;  1HQC A;  2M1B A;  2P5V A;  4HYE A;  4BH9 A;  3KE2 A;  1TTY A;  4EVI A;  4L9J A;  3GFJ A;  2EFQ A;  1YG2 A;  3LAP A;  1DP7 P;  3F21 A;  3EYI A;  2WTE A;  3QAH A;  4WWC A;  1YW7 A;  2P5L C;  4KYW A;  1UHM A;  2EV6 A;  4A2U A;  1XSD A;  3E97 A;  1W7P D;  4HV5 A;  4KIC A;  3GEZ A;  4RB0 A;  2OAZ A;  3CO6 C;  4UV8 A;  4ESB A;  3MQ0 A;  1T2K A;  2EFW A;  4M6Y A;  3O3K A;  4QLC U;  5IT9 K;  3WG9 A;  1XN7 A;  2EV0 A;  3I71 A;  3KP4 A;  2IP2 A;  4KIG A;  1LDD A;  2KJB A;  3R6S A;  1KU3 A;  4BHP A;  1OR7 A;  3WTT C;  5LHI A;  4CGZ A;  1BM9 A;  4U0V A;  1XMK A;  3WTS C;  2GA1 A;  2PBI A;  1FBQ A;  1K78 B;  1YW9 A;  4ENJ A;  2NNN A;  5ILU A;  3B73 A;  3F23 A;  3SFZ A;  2NYX A;  2HTS A;  2OQG A;  1KQ8 A;  1K78 A;  3BZ6 A;  3EQL F;  1YW8 A;  4EM2 A;  1S7A A;  3T0Y A;  2FQ3 A;  4IHT A;  4I98 B;  3E3V A;  1ZH5 A;  2FBK A;  4CXF A;  3ERE D;  4RAY A;  2H94 A;  3M1E A;  3KET A;  2JZY A;  4IJA A;  5FD5 A;  4YFX F;  1FP1 D;  1BOA A;  3H3U A;  4IPA A;  4UXN A;  1IXS B;  5LHH A;  4HX4 A;  1IXC A;  1HKT A;  1SD5 A;  1F1Z A;  2ZBK A;  1J2X A;  4B8X A;  1Z6R A;  1TLH B;  1U8R A;  1REP C;  3DXJ F;  3W6K B;  1ZRC A;  1J9I A;  3CJN A;  1IN5 A;  2ESN A;  4GGG A;  1I27 A;  2JSC A;  1LDJ A;  2NAZ A;  4F7Z A;  1ZAR A;  2MC3 A;  3JAM Z;  5ICG A;  1TNT A;  3HRT A;  2GQQ A;  3ZPL A;  4Q4Z F;  4HA8 A;  4EJW A;  2DBB A;  2YR2 A;  2EJR A;  2F5D A;  3CLO A;  2YX7 A;  1FZP B;  2FOK A;  3C3W A;  2QLZ A;  2CFX A;  2LF8 A;  4WXH A;  2FNA A;  1BI2 A;  5E1Z B;  4ENK A;  2HQR A;  1FLI A;  3GFI A;  3SZT A;  4GCV A;  2DK5 A;  3DPL C;  3I4P A;  1SD6 A;  2EFP A;  1KQ9 A;  3U2R A;  3L09 A;  4BAY A;  1EH8 A;  3ISP A;  2VOP A;  3BP8 A;  3ULQ B;  2V1D A;  3C7J A;  4LK1 F;  1B9M A;  2CG4 A;  1QO0 D;  5A2Q Z;  5D6E A;  4RGS A;  3L2C A;  2ZKZ A;  3HSR A;  3RI4 A;  1HXD A;  3ZMD A;  1QZZ A;  2Z5U A;  3FM3 A;  1XD7 A;  3WTV C;  4HAM A;  1K7A A;  3KEO A;  2VE9 A;  2Y48 A;  2XKP A;  4Y13 A;  4YIF A;  4OU0 A;  1IAW A;  4MQ9 F;  5F6F A;  1H9T A;  1FYM A;  3HTS B;  1ZAO A;  5E20 A;  2J5P A;  3I53 A;  1MJA A;  4HBL A;  4G94 A;  4U0W A;  4XBF A;  3R0J A;  3MWM A;  1DUX C;  2A61 A;  1I5Z A;  1BBY A;  2O03 A;  1KYZ A;  3RTR A;  2CGP A;  2EB7 A;  2A6E F;  2EV5 A;  3LFK A;  2M8E A;  4A5N A;  3G3Z A;  1HW1 A;  2PEX A;  2EFN A;  3K9T A;  3VOD A;  2QQ9 A;  3BJO A;  3EYY A;  3ROU A;  2A3S A;  1UFM A;  2RNJ A;  2XVC A;  1YQA A;  1XB4 A;  4CO8 A;  1BC7 C;  1LEA A;  1IXR C;  5DV5 A;  2UWM A;  4I02 A;  1HW2 A;  1F4K A;  3R4K A;  3L00 A;  4YG2 F;  3TOB A;  4Y15 A;  2ISZ A;  3O2P E;  1L0O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...