3BJAA

Crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
GMNNRELYGNIRDVYHLLQKNLDKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKKHLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family, putative
publication title Crystal structure of putative MarR-like transcription regulator (NP_978771.1) from Bacillus cereus ATCC 10987 at 2.38 A resolution
rcsb
source organism Bacillus cereus
total genus 41
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bjaA00
2MD5A 1H0MA 4MNUA 5DV5A 1SD7A 3GX4X 3RJPA 4EV0A 1Z91A 5D6EA 1XGSA 4JQFA 2OQGA 4FX4A 4HQMA 1K7AA 1J75A 1I1SA 3CUQA 2HOEA 2FBKA 2XHKA 3JTGA 1VTNC 3TOBA 2Y75A 2W57A 1PP8F 1BJAA 2VOOA 5FO5A 1SMTA 2JT1A 1AOYA 3C7JA 2P4WA 3CO6C 2AS5F 2LDUA 1SMYF 4IF4A 2WV0A 3K69A 2ZMEA 2Y0MA 3FHZA 3E3VA 3CO7C 4HQEA 2PMUA 1G3SA 2RGVA 3E6BA 2GXBA 3DF8A 2IJLA 1Q1HA 2PLYA 1FSEA 4ESJA 4KIGA 3DPTA 3ECOA 1I6XA 1G3TA 2CO5A 1J59A 5HS7A 5DD4A 1GVJA 1FBSA 2ESHA 4KN7X 4K2EA 2K4BA 2VC0A 1YW7A 4HX4A 1WRJA 3WTYC 4G7HF 3RDIA 3Q9VA 1IF1A 4RB3C 1C0WA 5HDNA 1BN5A 1FY7A 2G7UA 4TV7A 1YYVA 4OIRF 4ZYEA 3WTSC 1U8RA 3MEXA 4KNYA 5E20A 5FFZA 2D1HA 1LNWA 3ML6A 1DP7P 1Z6RA 5LHGA 1BM9A 5DD8A 4IHTA 3J81Z 3EYIA 3K0LA 2VBZA 2O0YA 2RN7A 1GXQA 2WWYA 4ETSA 1MGTA 1P6RA 3G73A 5ILSA 3TQNA 4N0BA 2ELHA 2XAFA 3FF5A 5F64A 5K5OA 4YFNF 2STWA 2P5VA 4PGGA 3WODF 4BHBA 3RPUA 2Z9OA 5CVIA 1ONVA 2VXZA 1XGOA 3RKYA 3LAJA 3M7GA 3WGHA 2ISZA 5A2QZ 2ZXJA 3ABTA 4WF2A 4M9XA 2NS0A 4M6XA 1MZBA 1FBUA 1WKMA 4HDUA 5L3BA 3E97A 5DCFA 4MEYF 2EV6A 1UCRA 3ZMUA 3E6DA 5KK1A 5BOXA 4UHTA 3U9GA 4FHTA 1EH6A 3DP7A 3I59A 1TQIA 2HGCA 3F23A 4I09A 1BC8C 1OMIA 1QO0D 3HOTA 3BY6A 3HHHA 2IA1A 4LB6B 2ZFWA 5DYMA 3F8NA 4EM1A 1DPRA 3HRTA 3TO9A 4FX0A 3KLNA 2O61A 2BYVE 2V1XA 5CYVA 5H6QA 2FNPA 4OIPF 2ZNZA 5L3EA 3GFIA 4N9IA 5FGMA 2HTSA 2ZJ2A 2JSCA 3E6CC 1BC7C 4IHSA 4UVAA 2PBIA 2XAQA 4YFKF 4M73A 5E1XA 2Z3YA 3J81K 3TO7A 2O6GE 2EV0A 2XGXA 1ZG5A 2E1CA 3ZN1A 4ENMA 4IRGA 1MJAA 4AWXB 4HF0A 1KYZA 2QQ9A 3KLOA 5A2QK 5FLXK 1MKMA 1FX7A 2PN6A 4JK1X 1S3JA 3JW4A 4CYDA 4Q47A 3O6BB 3DQVC 1RIOH 1A04A 1B4AA 3GFLA 4Q5SF 1QNTA 2VONA 1D8KA 3WE3A 3V8JA 5BQTA 2CFXA 2M45A 1KU3A 3ZMSA 2EV5A 5K5RA 1R5HA 3IKVA 5BPDA 3WGGA 2FOKA 1QBJA 1U5TC 3WU0A 1IXRC 1HKSA 2QLZA 1U6GA 2XROA 3F6VA 3TGNA 1HSTA 2J5OA 4BQAA 4I01A 1MD0A 3T0YA 2EWNA 5BPIA 4KIFA 4GCVA 2FF4A 4HDVA 3T8TA 4M74A 3WTWC 1RI7A 4G7OF 2CWEA 3WTUC 3MFKA 1YLFA 5E18F 1HW5A 4N9HA 1TTYA 4L18B 2K7LA 3R0AA 2C6YA 2JTVA 5FD6A 3BROA 3WU1B 4ESBA 2E7XA 1ULYA 3M1EA 1IAWA 1NHAA 2ZO4A 4IVNA 2BEOA 2Q8KA 1TNTA 4A5NA 2H6BA 4B8XA 5ILVA 3SZPA 4WK8F 1MDMB 5LGUA 3NRVA 1XCBA 2EFOA 4GO1A 4I0AA 3DXJF 5DEQA 3EYYA 3BP8A 3JTHA 5D4SA 2W85A 3V8LA 3KCCA 4UV9A 4ZYDA 3IRRA 5EEHA 1XMAA 3H3ZA 1HW2A 2NNYA 5HLHA 3HOSA 5ICCA 2K27A 2DPDA 4XLNF 2KIMA 2LF8A 3LSTA 4UVCA 1O7FA 2LF7A 1LEBA 2UXXA 4PZJA 4ZZLA 3TKYA 3RI4A 3I4PA 2A6EF 3HRUA 4A12A 1SD6A 2RVCA 4IPAA 4U7DA 4ENJA 1OKRA 3SHFA 4MEXF 1ZAOA 1LQ1A 3GYHX 4WXHA 3DV8A 3HYIA 5D5WB 2L4MA 4OIQF 1QPMA 4MQ9F 4GYGA 1ZRDA 2HFHA 3P9CA 4FT8A 3HSEA 3RPQA 4O3MA 5CVVA 2LNBA 2IRFG 1Z7UA 2HZTA 1SD5A 1BI2A 1IN6A 4HV6A 2VC1A 3FMSA 3BDDA 3GF2A 3F22A 5HLIA 3J7AO 3QU3A 2M87A 4KA4A 2M30A 1P4XA 1D3YA 4Z2YA 4ZH4F 1FYMA 3GZ6A 2DQRA 2CSOA 1P4WA 2EFWA 1W7PD 4BAYA 1J0RA 1Z05A 2XIGA 1B1BA 4A0ZA 1JE8A 3SFZA 2VBYA 1RUOA 4LGWA 5E1WA 2PQ8A 4HV5A 1IXSB 3CDHA 1JHFA 4EJUA 2V6CA 1R23A 4AIKA 4ENKA 2GAUA 1OYWA 3LA3A 4HX7A 4R8HA 2HTJA 4PDKA 2P7CB 2YR2A 1KYWA 2P5KA 3KEOA 1IUYA 3NEUA 6PAXA 3H3UA 1J5YA 2GIVA 4CICA 2H6CA 1GHCA 5LGTA 2PJPA 2K4JA 5E8GA 1WI9A 2QENA 1Z1DA 1B6AA 2JPBA 5LBQA 1T6SA 1ZLJA 2DBBA 3GFMA 2EB7A 2MA3A 2H09A 3HRSA 4OINF 3WGIA 3LQQA 3ULQB 4HF2A 5CVRA 2RDPA 2DK5A 1R1UA 2EJRA 1JHHA 3K1PA 2GQQA 3GFJA 3PFIA 4NQWA 3HRMA 1ZH5A 4IRIA 5E8IA 1LDKB 2PG4A 4WXCA 4IJAA 4P9FA 2DU9A 4BHCA 3VODA 2A5YB 5LHHA 4UV8A 1HKQA 1FSHA 4XSZF 2R3SA 4DQ2A 2RV8A 3O2PE 1K79A 3E5QA 2XKPA 2ESNA 3KZYA 3JSPA 2L01A 3SXYA 3EUHA 1R00A 3GO5A 1YIOA 4HZFA 1FT9A 5L3DA 2OA4A 4F7ZA 2D45A 2GZWA 2VE8A 1RUNA 2DT5A 2FQ3A 1FBQA 4S04A 4BYYA 1XDUA 3FZVA 3HTUA 3LA7A 2FBIA 4KMFA 5HVQC 1I1GA 1FOKA 1D5VA 1PP7U 1REPC 1WSUA 1IN5A 1G3WA 3FM5A 4LD5A 4Q4ZF 3CUQB 4YFXF 4YIIA 4L0YB 2L4AA 1XSDA 1S7AA 4EJVA 2W24A 3LWFA 5L3FA 2GA2A 2M8EA 1STZA 4P96A 5L3CA 3R60A 3BOQA 3IWZA 4AD9A 4LG0A 3D0SA 4L0ZB 3KP7A 5J6XA 3CJNA 2ZMEB 4A0YA 1YW9A 5D4RA 3DEUA 2F5CA 3JAMZ 3GW2A 1BIAA 4OMYA 4BNCA 2NYXA 2L02A 1F9NA 2R7DA 3I53A 3I54A 3KEQA 5CLSA 3LAPA 2ETHA 3C3WA 1U5TA 1YG2A 4G9YA 4I98B 4B09A 4M9SA 2QBYA 1YO5C 1IN4A 1F4KA 2O3FA 1FWZA 2STTA 3TDUC 4WX9A 2BE5F 1SFXA 4XRFA 1PDNC 4LLNA 5F6FA 2VOPA 3R61A 5LRSA 2IVMA 1G3YA 4U7BA 4LJZF 2IW5A 5CVUA 4HYEA 1XN7A 3IHUA 2FMYA 4XLPF 4RAYA 3O3KA 2DAOA 2QVOA 1YFHA 1W7PA 1XDSA 1GXPA 2Z5UA 3L2CA 4BHPA 2HR3A 1YS7A 1XCVA 4EGYA 3R4KA 3N4MA 4M71A 2KIUA 5FFXA 1K6OA 1IXCA 3RTRA 2RNJA 1TNSA 3GLXA 3KP2A 4ESFA 3IRQA 4ASNA 1QZZA 1HBXG 2OU2A 2BGCA 3GVAA 4EVIA 4LK1F 2CW0F 3V7SA 2GWRA 5J8CA 1R7JA 3REOA 3U2RA 1EV7A 1YS6A 2KJBA 4KIBA 5HLGA 4ON0A 4MTEA 4RS8A 3R0JA 4O6JA 2P8TA 3EETA 3JAMK 5ERIA 2FE3A 2VBXA 4HA8A 3GEZA 4MHGA 2DFIA 1B9NA 3F21A 2FA5A 2F5EA 3U1DA 3W6KB 1ZYRF 4QLCU 1HXDA 3ZMVA 4H0EA 4RB0A 3QPTA 2VT3A 4UVBA 2V79A 3KP6A 3VEPA 4MGRA 1UHMA 1AWCA 3QRFF 2MC3A 2D2WA 2G7HA 3CLOA 1H9GA 3K1MA 4G7ZF 3FXRA 5DCMB 1ZRCA 2A3SA 3HSFA 3WTZA 3Q5FA 2QWWA 4IXAA 3COAC 2YX4A 3ERED 1DDNA 3T8RA 2HQNA 3WTXC 1FP1D 2EFPA 1JGSA 4A6DA 2VODA 4XBFA 4P9UA 1MJBA 1TW2A 5AIPA 1Z9CA 3P7NA 1W5SA 2PEXA 2R7FA 1P92A 5FB2A 4U0VA 2AXLA 2FBHA 3V8KA 1IRGA 2PFBA 4KYWA 3QOPA 4HLXA 3RIRA 3GUDA 4M9ZA 5FD5A 3J80Z 4UXNA 1K78A 4RB1A 3IC7A 4HW0A 2UZKA 1KQ0A 3ZN0A 1USSA 3ROUA 1S6LA 3F8FA 1XSVA 1IZ1A 4RGUA 4I2OA 1ZN2A 2XAJA 4Y15A 3FXQA 5IT9Z 4QWQA 4U0YA 2FRHA 4KDPA 3ISPA 3OOPA 2A61A 4AIJA 1LEAA 3KP4A 4EM0B 2K02A 3BJ6A 4LB5A 2HKXA 2TDXA 2W25A 2HWVA 2J5PA 5D8LB 3CUOA 1J9IA 4ZYHA 4ZYGA 1O3TA 1FYKA 1OYYA 1TW3A 5JR3A 3OV8A 1KU7A 1CGPA 1BIBA 2LSOA 1X3UA 5AIQA 2IP2A 1XSXA 3LFKA 2P5LC 2L3DA 4RGXA 2CQKA 1BOAA 4CO8A 3LQRA 2O8XA 2YPRA 2EK5A 5TJJA 1T98A 1J7KA 1DPUA 2D1VA 1ZLKA 2FXAA 4M6YA 2Z33A 1HW1A 2VN2A 3HIFA 2FNAA 3V7CA 1O3SA 3EDPA 2FSWA 4R79A 4CHUA 4ENNA 1IW7F 4OMZA 2LKPA 4BH9A 3VB2A 2FEZA 3AAFA 2FMLA 3RYRA 3E5UA 4CZZA 3BPXA 1MJ9A 3J80K 3ECHA 3IL2A 4MTDA 1V3FA 2GXGA 2BV6A 1SFEA 1UB9A 3M9AA 3QP5A 1FLIA 3FMQA 3QPHA 3P9IA 2RKHA 1E2XA 3WTVC 5D5UB 1O3QA 1T39A 3MZHA 5D5XB 3ZMTA 3PQKA 5IT9K 1S8NA 2JRTA 3MQ0A 1UFMA 3GZ5A 1HQCA 2M5WA 2KRFA 2ZKZA 2OZUA 3FXUA 1CF7B 1IN7A 2A68F 3I58A 5HDKA 2IA0A 3L9FA 2A07F 1XD7A 4EM2A 2X4HA 5LHIA 4WCGA 1T0FA 2XRNA 5DDGA 4IRHA 4A0XA 4LFUA 5HOOA 4CXFA 1B9MA 1JXSA 4UUVA 5CJ9A 3QP6A 3E6MA 3BWGA 1BI1A 3TO6A 1BBYA 2BBYA 3PQJA 5JVTA 4A2UA 5D6FA 4U0WA 3QU6A 3P9KA 1QGPA 3B02A 2DO7A 1SD4A 1ZGAA 2V9VA 1U2WA 4HF1A 5JHUA 2WC2A 5ED4A 4D0PA 1W5TA 1F1ZA 3MWMA 4GYIA 2NNNA 3R6SA 1EH7A 2P6TA 1KU9A 2HDCA 1R36A 4RAZA 2DK8A 5LGNA 1FP2A 1SAXA 3MZYA 4LMYA 2XASA 4EMSA 2ZNYA 5K1YA 1FZPB 3I0TA 3SZTA 1RNLA 2HS5A 3FM3A 3K2ZA 3DPLC 4WXDA 3KE2A 4L9VA 1USTA 2QQAA 1S29A 4M72A 2PMHA 1ODDA 4Q48A 1LB2A 1I5ZA 1XMKA 1LDDA 1XGNA 2Z99A 5ILUA 4L9TA 3S2WA 4U88A 4KICA 3KETA 4EJTA 3HSRA 3MCZA 4S05A 2CG4A 4P5OA 3W6JB 1E17A 2FU4A 3LA2A 1SFUA 3CUQC 3RKXA 2KKOA 2Y48A 5FLXZ 1Y0UA 1O3RA 4G94A 3FX3A 2RC4A 3V4GA 1BI3A 2UWMA 5LLQA 2CYYA 3FMRA 4OOIA 3ZQ7A 3WE2A 1R5GA 2MH2A 2E7WA 5CVJA 4JBAA 1G4DA 5LEJA 2V1UA 3KFWX 4KFCA 5AONA 1KQ8A 3RYPA 2QYOA 2XV4S 2IPQX 2OQRA 1KGSA 4OU0A 2Q0OA 2OAZA 1W4MA 3VOEA 5KVRA 1KA8A 2NRAC 2IA2A 2F2EA 3F8MA 2Q2EA 3T5XA 5BMZA 2ZBKA 2XAHA 3D5LA 3HUGA 3ZMZA 4A6EA 2CGPA 2KJCA 1S7OA 5K5QA 4AVPA 2VBWA 4ZZDA 1B59A 1ZRFA 1TBXA 2HQRA 5BS6A 4LLLA 1G6NA 5DCMA 3K1NA 4G8XA 5ICGA 2HYFA 4L5JA 2ACJA 4GGGA 4MQVA 2KIFA 2K86A 1TLHB 4HX8A 3IKTA 1WQ2A 4KUMA 3F3XA 3C1DA 2EA2A 1ZG1A 4LLGF 5HS9A 1MDMA 3WTTC 5D5VB 1OYIA 1EH8A 4GXOA 3F8CA 2ADUA 3BJOA 1U3EM 2OBPA 4I0BA 4E70A 2OD5A 3GXOA 2JPCA 1ZG3A 4HAMA 3F8BA 1V4RA 1QQIA 4LG0B 3BZ6A 3BJAA 5LEKA 2P7VB 2QQBA 3L7WA 4NB5A 3VFZA 2B0LA 2OZ6A 2RQPA 4DNCA 2O03A 3T1BA 4R1HA 3HTSB 2QM3A 4KT5C 2M1BA 3IWFA 1L0OC 4HLYA 3FWEA 1J2XA 3I64A 4BXUA 1U5TB 1D8JA 1LDJA 1IRFA 3I59B 2QZ8A 2QBYB 2COMA 2X0LA 1PUEE 1KU2A 2A69F 1T38A 4L5IA 2HYGD 2NAZA 4RB2C 2PI0A 2XKOA 2F5DA 1KQ9A 1FC3A 2DPUA 5JFRA 3L00A 4LK0F 1HSJA 3KP5A 4NHJA 3K9TA 4I02A 2WTEA 3B73A 1Z6TA 4P55A 3G3ZA 1W7PB 2EFQA 5HDGA 2EFNA 1OPCA 4EGZA 3WG9A 1R1TA 3KZZA 3DFGA 3H92A 3I5UA 1TQMA 3N97A 2YU3A 1L3LA 3ZMDA 1OR7A 2W84A 1FYLA 4A5MA 1FPQA 2G9WA 3Q9SA 4I7HA 4YIFA 1T2KA 5L3GA 3RKWA 1YTYA 2E1NA 3DKWA 4KN4X 4RGSA 4YG2F 1YQAA 2DW4A 2MH9A 4G6QA 5DUKA 2HKOA 5JI6A 1U78A 3ABUA 5ICFA 3GWZA 4EQQA 3HHGA 3I71A 4L9NA 2JZYA 3KP3A 3CTAA 1HKTA 4WWCA 4O5VA 2XVCA 4PCQA 1ZARA 1TQPA 5E17F 1F5TA 3F72A 5D8KB 2DI3A 1ON1A 3EQLF 2L54A 3ELKA 2UXNA 5H20A 1XGMA 2XAGA 3M8EA 2VT2A 4G6DA 1ZHFA 5LRRA 1I27A 1R58A 1ZREA 4CDGA 4Y13A 5IT3A 2MLGA 1H9TA 1CF7A 3JSOA 1R1VA 1ZGJA 2VE9A 4KMUX 2F5FA 1LJ9A 5H6RA 2HEOA 4Y17A 2A6HF 4EJOA 2ZCWA 2IT0A 5F1RA 1P2FA 2H27A 4RGRA 4AIHA 2DQLA 3M8FA 3C18A 2ISYA 5J8FA 5TRDA 3BPVA 2H94A 2DLLA 5E1ZB 3ZPLA 4HOBA 1YW8A 5ICEA 4UNOA 5HS8A 3NQOA 4L9JA 3TDZC 2MLKA 2YSRA 2GA1A 4PGHA 2XUBA 1O57A 1P4AA 3SQNA 4CGZA 1UHWA 1WWXA 1QZYA 1RZ4A 2QUFA 1XB4A 5EEGA 4HBLA 1DUXC 1LVAA 2EA4A 4EJWA 1K78B 3V7RA 4XSXF 1FNNA 3QAHA 3TOAA 3E5XA 3MAJA 3ZP5A 5DUIA 3F6OA 2DTRA 1ON2A 2P6SA 4OIOF 1O7LA 2YX7A 2MBFA 1BI0A 1R22A 2V1DA 1IN8A 3L09A
chains in the Genus database with same CATH superfamily
2MD5A 1H0MA 4MNUA 4XKBA 5DV5A 1SD7A 3GX4X 3RJPA 4EV0A 5DS9A 1Z91A 2M2EA 5D6EA 1JUPA 2RREA 1XGSA 4GRIA 2OQGA 4JQFA 5GTIC 4FX4A 4HQMA 1K7AA 1J75A 1I1SA 3CUQA 2HOEA 2FBKA 3CDIA 2XHKA 3JTGA 1VTNC 3TOBA 2Y75A 2W57A 3VYSB 1PP8F 1BJAA 2VOOA 5FO5A 5B3SH 4IL6C 1SMTA 2G0EA 2DT7B 2VKDA 2JT1A 3BG6A 1HCRA 2L9SA 4CUGA 4CCKA 1APLC 3C7JA 2P4WA 1AOYA 5IYCJ 2R7RA 4ZJZA 3LMMA 3CO6C 2AS5F 2LDUA 2IS4A 1SMYF 3DPUA 2KDOA 4E7JA 4IF4A 2WV0A 3K69A 2LMDA 2ZMEA 2Y0MA 5EYRA 4B47A 3FHZA 3E3VA 4ZTJA 1R4NB 3CO7C 1P7JA 3CCUI 4HQEA 2PMUA 3K2AA 1G3SA 2IAIA 1PUFB 2X6OA 2RGVA 3E6BA 1V5EA 2BY2A 2GXBA 2R7UA 3DF8A 2IJLA 1I3AA 1Q1HA 2PLYA 1FSEA 4ESJA 1KONA 3JCUC 4KIGA 4ZC3A 3DPTA 2R7QA 5HNFA 2DODA 3ECOA 1I6XA 3HJEA 4RAFA 2IS6A 3ZGKA 3N05A 1G3TA 2ZSIB 2CO5A 3A01B 1J59A 5J3LA 3OYHA 1OCCH 4MLOA 1OISA 3OSFA 5HS7A 5DD4A 4PJLA 3W2WA 5IP9J 1GVJA 4XLHA 3DLAA 2ELJA 5K7ZA 1FBSA 2ESHA 1GT0C 4KN7X 4K2EA 2K4BA 1IRZA 2VC0A 3H1CA 3QPLA 4BJTA 1YW7A 2X1EA 4HX4A 1WRJA 3WTYC 4G7HF 3RDIA 2LTPA 2DOAA 3Q9VA 1IF1A 1OCPA 2DXIA 2KFDA 3PM1A 4RB3C 3F0CA 2M4GA 1C0WA 3OYNA 5K7FA 5HDNA 1BN5A 1FY7A 1VQ6I 2G7UA 4TV7A 4A3FJ 1YYVA 4OIRF 4ZYEA 3H9GA 4IKFA 3WTSC 2HOTA 2KQRA 1FJLA 3OOUA 1U8RA 3MEXA 1QZEA 5E20A 4KNYA 5FFZA 2D1HA 4XKCA 1JUMA 1LNWA 3IV5A 1VQLI 3ML6A 2LYCA 2VJ4A 2VPLA 1I50J 4A3MJ 1DP7P 2EIMH 2O5RA 1Z6RA 5E3NA 5LHGA 1BM9A 5DD8A 4IHTA 2EBIA 4W1UA 3J81Z 5EZHA 3HG9A 3EYIA 3K0LA 3K4LA 4DBQA 4CYCA 2VBZA 2O0YA 2RN7A 3LL7A 1GXQA 3CP8A 2WWYA 4C3IJ 4ETSA 1MGTA 1P6RA 3G73A 5ILSA 3TQNA 4HSTA 3CC4I 4N0BA 2ELHA 2XAFA 1MMDA 3FF5A 5F64A 5K5OA 4YFNF 3G71I 1X58A 1VQ8I 2STWA 2P5VA 5FKKA 4PGGA 3WODF 4BHBA 4RAGA 2EPFA 3RPUA 2Z9OA 5CVIA 1NH3A 1ONVA 2VXZA 1XGOA 2L7ZA 3RKYA 2GOMA 2CU7A 3LAJA 3M7GA 5FKLA 3WGHA 2ISZA 5A2QZ 1YX5A 3FK7A 3HOYJ 4A3GJ 2ZXJA 3ABTA 4IHWA 2P81A 4WF2A 2QSHX 3HXLA 2AO9A 4C30A 1K4TA 3GBGA 4M9XA 2NS0A 1DU6A 4M6XA 5E79C 1MZBA 4NQWB 1JUSA 1FBUA 2VJIA 1WKMA 4HDUA 5J1UA 1T56A 3HKZA 2DT6A 4BE0A 1RESA 3K4JA 5L3BA 2P0WA 2QEXI 1OCZH 3E97A 5DCFA 1MBEA 3DBLB 2FUG2 3L2WA 5LFAA 2CJJA 2ID3A 4MEYF 2OCEA 2EV6A 1UCRA 3WU2C 2EZHA 3ZMUA 3VYRB 3E6DA 5KK1A 5BOXA 2E60A 4UHTA 4FHTA 4XR6A 3U9GA 1EH6A 3A03A 3PIPF 3MN2A 3DP7A 5GP9A 5GPAA 3I59A 2R93J 2WAQN 1TQIA 3AL0C 2F4MB 3CZ6A 2HGCA 3F23A 3S14J 4W97A 1RRJA 1N78A 4I09A 1BC8C 1OMIA 1QO0D 1HOMA 2XF6A 1EJ9A 3I3LA 3HOTA 3BY6A 5F04A 1MIJA 2CH0A 3HHHA 2IA1A 4PJMA 4LB6B 3UKGA 3M4OJ 1GVDA 2ZFWA 5DYMA 3F8NA 4EM1A 5CQGA 4CCOA 1DPRA 5EG0A 1E3PA 1JT6A 3HRTA 3TO9A 4FX0A 2VUMJ 3KLNA 2O61A 5EJCA 2BYVE 4FE7A 3PUFA 1U9OA 3QYFA 1I3QJ 2XGDA 2BZTA 3EUHC 2V1XA 4ITVA 4Y7NJ 2DJIA 5CYVA 5H6QA 4GDFA 3OR2C 2FNPA 4OIPF 3GTOJ 2NXNB 2ZNZA 1T33A 1UELB 1LFUP 4BDYA 5L3EA 3GFIA 4N9IA 3OSGA 1UG2A 1WCMJ 2HTSA 3OIQA 5FGMA 2ZJ2A 2JSCA 3E6CC 5DM7F 1BC7C 2IS2A 1MW7A 4IHSA 3BLYA 4UVAA 2PBIA 4KJZA 1MMGA 1X2MA 2XAQA 4IHYA 2OJED 4YFKF 4AU7A 2XSJC 3CCRI 3TMOA 4M73A 1FMVA 4CCNA 5E1XA 2Z3YA 2D5VA 5GAEJ 5J4YA 3J81K 2HNHA 1S7EA 4FTHA 3TO7A 3CF2A 2O6GE 2EV0A 2XGXA 1ETVA 2WB1A 1ZG5A 4V2FA 2NVQJ 1YRNA 1DGWY 2E1CA 3ZN1A 4BUPA 3NARA 2K9LA 2X48A 4ENMA 4IRGA 3SEZA 1MJAA 4AWXB 3DU6A 3DTEA 4HF0A 4A3EJ 1MBJA 1Y1WJ 1OJLA 1KYZA 2QQ9A 4MFEA 3KLOA 1D0ZA 5A2QK 2CUEA 5FLXK 3JRCA 1MKMA 1XS9A 3PO2J 3H5RA 2CS3A 1FX7A 3MKZA 2PN6A 4JK1X 1QA6A 1D1AA 3ZQLA 1S3JA 2IGOA 1V5FA 3HL2A 3JW4A 1WJCA 4CYDA 4FQGA 2I10A 4Q47A 3K4MA 4QPQA 3O6BB 2QSFX 3DQVC 1V55H 1RIOH 1A04A 1B4AA 3BG9A 3GFLA 4Q5SF 1QNTA 4CZCA 2VONA 1D8KA 4HNVA 3WE3A 2JUCA 3V8JA 3GTGJ 5BQTA 4Y4RA 2CFXA 2M45A 1KU3A 1X1CA 2R7WA 3ZMSA 2EV5A 5K5RA 4Y33A 1R5HA 3CF5F 3SJMA 3IKVA 1ZELA 5BPDA 3WGGA 3CLQA 2LD5A 2FOKA 4Z6YA 1QBJA 1U5TC 3WU0A 1QU3A 1IXRC 1HKSA 2QLZA 1U6GA 2XROA 5GTHC 2X9DA 2WAEA 5IP6A 3F6VA 3TGNA 1HSTA 2J5OA 2KPMA 1MNMC 3C2HA 4BQAA 4I01A 1MD0A 3T0YA 2EWNA 5BPIA 4KIFA 4GCVA 2EH3A 2KRCA 4UUTA 3OYBA 2V4JC 5FRMA 1FOYA 2EZKA 2FF4A 4HDVA 3T8TA 4M74A 3HOVJ 2CUZA 3CCVI 3WTWC 2LKXA 3HGGA 1RI7A 4G7OF 2CWEA 2BVMA 3WTUC 3MFKA 1YLFA 4XORA 2W7NA 3CMYA 5E18F 2Y31A 1HW5A 4N9HA 1TTYA 4L18B 2K7LA 1TL8A 1Z21A 2XPUA 1BL0A 3R0AA 2VL8A 3MVPA 2L9VA 1X1DA 1ETKA 1SVOA 2C6YA 4HNTA 2I8DA 1RR7A 5IYDJ 2JTVA 2YUSA 5FD6A 3BROA 3WU1B 4ESBA 2E7XA 1ULYA 4BE1A 1YIJI 3OYFA 3M1EA 2WADA 1IAWA 3JREA 1NHAA 1ZR2A 1GUUA 3WG7H 2ZO4A 4IVNA 2BEOA 2Q8KA 3J7YJ 4D1QA 4F3QA 4IOCF 4XKVA 1TNTA 4A5NA 2H6BA 4B8XA 4UB8C 5ILVA 3SZPA 4WK8F 1MDMB 4F93B 2CUFA 5LGUA 3NRVA 3SFIA 2MD0A 2XF7A 5M5XJ 1XCBA 2GOXB 2E35A 2JWTA 4E7ZA 3M3YJ 3FIWA 3VYUB 4D7NA 2HPMA 4IZZA 2EFOA 1OCRH 4GO1A 4I0AA 1VNDA 3ESWB 4C2TA 4MFDA 1UAAA 4JX5A 3DXJF 5HLTA 1TZLA 1WJ5A 5DEQA 4D9JA 4F91B 3EYYA 1YITI 3W2AA 1FOXA 3BP8A 3JTHA 1JKPC 5D4SA 2W85A 2CFOA 4BKXA 2VQLA 3V8LA 5GAGJ 2FX0A 2IBDA 3KCCA 4UV9A 4YRVA 1S9HA 3IAS2 4ZYDA 3IRRA 3MMYB 5EEHA 1XMAA 3H3ZA 1HW2A 2NNYA 5HLHA 3HOSA 5ICCA 2K27A 2DMQA 3CMAI 2DPDA 4XLNF 4N4OB 2KIMA 2LF8A 3HOXJ 2WV1A 2KZVA 3LSTA 1O7FA 2MFZA 2LF7A 4UVCA 5HODA 9ANTA 1LEBA 4XL9A 2KLOA 2UXXA 4PZJA 4A3BJ 1SFKA 4ZZLA 1ZKGA 4AUXA 2M8GX 3TKYA 2COBA 3RI4A 2LFBA 3I4PA 2A6EF 3HRUA 1OCOH 2W48A 4A12A 1ZGWA 3BR1A 1SD6A 2LR8A 4M6VA 4XOPA 2RVCA 4IPAA 3UR3C 2R7VA 3NWTA 5EGOB 4U7DA 1ETWA 4ENJA 1OKRA 3SHFA 3CJTB 4MEXF 2M7AA 2DDBA 3ERMA 2DA2A 2V26A 2ME0A 1IRXA 4QTRA 1ZAOA 2M0MA 3LSGA 4DBRA 5B5EC 3GYHX 1IC8A 1LQ1A 4WXHA 3DV8A 4NNJA 3HYIA 5D5WB 2L4MA 4IEJA 2LP0A 1RPWA 3E1SA 1QPMA 4OIQF 4MQ9F 2DA5A 4GYGA 1D5YA 1ZRDA 2HFHA 1SAUA 3P9CA 4FT8A 3I4NJ 2JVHA 3U1KA 4A93J 3HSEA 3RPQA 4O3MA 5CVVA 3RQIA 1WFXA 2LNBA 3BG7A 4IQ4A 2IRFG 1Z7UA 1PVEA 2HZTA 1SD5A 1RKWA 2OC6A 3KYDB 4CCJA 1BI2A 1IN6A 4RM2A 3OY9A 3CESA 4HV6A 3MKYB 2CUJA 3H35A 2HVRA 2VC1A 3FMSA 4PJJA 3BDDA 1K83J 3GF2A 3F22A 2LKSA 5HLIA 1PUFA 3J7AO 3QU3A 1VQOI 2M87A 5J40A 3QPSA 4KA4A 2M30A 2JK3A 3W3CA 5JLWA 1D1CA 1P4XA 2DFEA 1D3YA 2RQQA 3HBLA 1WH7A 4Z2YA 4ZH4F 1FYMA 1F43A 2WAQA 4XN3A 1R6RA 2OCCH 3GZ6A 1VF9A 1BW6A 2GXAA 2DQRA 1B72B 3SDGA 2CSOA 1P4WA 1FIPA 4XRSA 2EFWA 1W7PD 4B4CA 3G2BA 4BAYA 1J0RA 1Z05A 2X6YA 2OPTA 3S32A 2XIGA 1B1BA 4A0ZA 1JE8A 3SFZA 2VBYA 2DOFA 2ZSHB 1RUOA 4XONA 4LGWA 2LH9A 2DFHA 3CCEI 1HDDC 5E1WA 2PQ8A 4HV5A 1Z0XA 4B3AA 3LSIA 1IXSB 4H4KC 3CDHA 1JHFA 4EJUA 4AVZA 2V6CA 2XGEA 3CCMI 1R23A 4AIKA 3ONQA 4F92B 1Z67A 3LSMA 2JA5J 1ACIA 5IYBJ 4ENKA 2GAUA 1OYWA 1VI0A 3LA3A 4HX7A 4R8HA 2HTJA 4LG3A 4PDKA 4RLQA 5F0HA 2P7CB 2YR2A 1KYWA 2P5KA 3KEOA 1Y8RB 1IUYA 2DTZA 3NEUA 4M3BA 1SVLA 3H3UA 3VWBA 6PAXA 1K4SA 1J5YA 2GIVA 4CICA 2H6CA 3FKJA 1GHCA 5LGTA 2PJPA 4XM3A 2K4JA 5E8GA 3OYMA 5J1RA 1HLVA 2N8GA 1WI9A 2QENA 1Z1DA 3JRAA 1B6AA 1DU0A 2JPBA 5LBQA 4PFPA 2CQNA 4D5FA 1T6SA 1ZLJA 4XLFA 1B8IB 1WGXA 4B48A 2XGCA 2DBBA 2XPWA 3GFMA 4ZDPA 2E2HJ 5IOYA 2EB7A 2MA3A 3F9KA 2JA2A 2H09A 2IGNA 3L2UA 3HRSA 2X85A 3LSHA 4OINF 3WGIA 3LQQA 3FK6A 1AKHA 3ULQB 2L9NA 3DBHB 4HF2A 3PSFA 5CVRA 4BQNA 2X1CA 1IUFA 3DLLF 2CRGA 2RDPA 1YHQI 2DK5A 1R1UA 1ZQ3P 1LFBA 3LNQA 2ICWG 1VQNI 2EJRA 3TP3A 1JHHA 1LFPA 3KYLA 5FLMJ 1T8IA 3K1PA 2X51A 2XAUA 2GQQA 3GFJA 3PFIA 4NQWA 3HRMA 1ZH5A 4BS9A 4IRIA 5E8IA 2O7OA 4BXXJ 3FHNA 1LDKB 2PG4A 2VPRA 4WXCA 4IJAA 4P9FA 4IHVA 5JHFA 2DU9A 2LY2A 4BHCA 3L2VA 3VODA 2A5YB 5LHHA 4UV8A 4EATA 3BR5A 1BOBA 1HKQA 1FSHA 4XSZF 2R3SA 4DQ2A 2R5ZA 1XX5A 2RV8A 1JJ6C 3O2PE 2JSPA 1K79A 3E5QA 2XKPA 4DJAA 3G6EI 1NTCA 3S1RJ 4M3EA 3CJQB 4C3JJ 2ESNA 4ANJA 3HOZJ 3KZYA 2Y9ZA 2F4IA 3JSPA 1QVTA 1JKQC 2L01A 3SXYA 3EUHA 1R00A 3BR2A 3GO5A 1YIOA 4HZFA 1FT9A 3ABKH 5L3DA 5KHDA 4A3IJ 2OA4A 4F7ZA 2D45A 2CQXA 1MSEC 3Q3SA 4M3GA 2GZWA 2VE8A 4BL0B 3DU5A 1NK2P 1RUNA 5BNGA 2DT5A 2RNGA 1IDZA 3IP4B 2FQ3A 1G59A 3VSKA 1FBQA 3BZCA 4S04A 3I56I 4DGWB 4BYYA 3VDXA 4XQFA 2I5UA 1XDUA 3FZVA 3HTUA 3LA7A 2KP6A 3ASNH 2FBIA 4KMFA 2W82A 4BQOA 3TEDA 3Q0UA 1I1GA 5HVQC 1FOKA 3G4SI 1D5VA 1PP7U 5C4XJ 1REPC 1WSUA 1MBFA 1IN5A 3Q0WA 1G3WA 3FM5A 4LD5A 3S93A 4Q4ZF 1JJ8C 3S3NA 1MNDA 3GMEA 3CUQB 1SEUA 3AKZA 2H8WA 4YFXF 4YIIA 4L0YB 3GCMA 2HOSA 1XG1A 1ERDA 2L4AA 1XSDA 2WBMA 1G8XA 2R0QC 2Y0SA 1S7AA 1VZ0A 4EJVA 2W24A 3LWFA 1IDYA 5L3FA 2GA2A 2M8EA 1STZA 4P96A 5L3CA 3OYJA 3R60A 3BOQA 1A35A 1X3ZB 3IWZA 4AD9A 4LG0A 1FIAA 3D0SA 3PNVA 3K4NA 3KP7A 4L0ZB 2LY1A 5J6XA 3CJNA 3SYTA 2R5YA 2ZMEB 4A0YA 1YW9A 3FXOA 3QYEA 3OIPA 1H88C 5D4RA 3DEUA 2F5CA 1T0FC 3JAMZ 2Z1DA 1BIAA 3GW2A 4OMYA 1A31A 4BNCA 2NYXA 3BR6A 1S72I 2L02A 1F9NA 2R7DA 3I53A 4BXFA 3OYGA 4KT6A 1H89C 2OF7A 3I54A 3KEQA 5CLSA 4HNUA 3LAPA 3VSLA 2ETHA 3O8GA 5M3FJ 4ABZA 3C3WA 1U5TA 1JKRC 1YG2A 1E3HA 4G9YA 1I39A 2DJNA 4I98B 4BEHB 4B09A 4D7MA 2JN6A 4M9SA 1JT0A 2RAEA 2QBYA 1FTZA 1YO5C 4C9YA 1IN4A 1F4KA 5GADJ 1N77A 1MBKA 2O3FA 4LITA 1X2NA 1FWZA 5JLXA 3TP0A 3CMEI 1XC5A 3CCYA 4OWRB 4AC0A 2STTA 2JA7J 3PIOF 3TDUC 4WX9A 2BE5F 4DOZA 3LOCA 1SFXA 2ZC2A 2BY3A 4XRFA 2LOOA 3ABLH 3BTCA 3PL8A 1PDNC 5HNHA 3MZ8A 3M1CA 4LLNA 5F6FA 3JRDA 5JVGF 2PJRA 2VOPA 3R61A 5LRSA 4UUSA 2IVMA 1G3YA 4U7BA 4LJZF 2IW5A 5CVUA 1DP3A 2DFFA 4HYEA 2HI3A 2XRLA 4A69C 1XN7A 3IHUA 2ECCA 4X1EA 2FMYA 4XLPF 3RZDJ 1X1PA 2VI6A 4RAYA 3O3KA 1AHDP 2DAOA 2E5ZA 1QVUA 1X1AA 2ZXIA 2QVOA 1UJ8A 1YFHA 1W7PA 1XDSA 1CQTA 2E36A 4XKWA 1GXPA 3DTIA 1WJBA 4ZDOA 2Z5UA 3L2CA 2IGMA 2JQ7A 4E4HA 1VQ9I 4BHPA 2HR3A 4LIVA 2TRTA 2DYRH 1VQPI 1GV2A 2M9HA 1YJ9I 3HPHA 4J01A 4BQQA 1YS7A 1XCVA 1R49A 5FRNA 1LKXA 2E2JJ 4Y52J 4EGYA 3R4KA 3N4MA 3SDBA 4M71A 1MSFC 2KIUA 3RKQA 1GDTA 1U9NA 3ZQCA 1WJEA 5FFXA 2NOGA 1K6OA 1TT0A 1IXCA 3IH3A 3RTRA 2RNJA 1BR4A 3MKWB 1TNSA 2NOJB 2F48A 3GLXA 3KP2A 4ESFA 3IRQA 2DA3A 4ASNA 1QZZA 2AXTC 2BW3B 3GTLJ 1HBXG 4G12A 2DMUA 2OU2A 2BGCA 3GVAA 4EVIA 4LK1F 3BC8A 5K7HA 2CW0F 3V7SA 2GWRA 3BQYA 5J8CA 1R7JA 2VASA 4HPQA 4XOTA 3REOA 3U2RA 1EV7A 1YS6A 1Z3XA 2KJBA 4KIBA 2KL4A 2V9PA 4CSWA 5HLGA 1X4PA 4ON0A 3I9V2 4BY1J 1P7IA 4C2UA 4MTEA 2LK2A 3EUKL 3GTJJ 1VQKI 2HU9A 3CC7I 3AG4H 1IV8A 4A3KJ 4RS8A 5FKOA 3RCOA 1K6YA 3R0JA 4DZJA 5IOZA 4O6JA 2VQGA 1GLNA 2P8TA 4C2MJ 3E0JB 3LSKA 3EETA 3JAMK 3FKIJ 1F36A 5ERIA 2FE3A 2QCOA 2VBXA 2X6XA 2NVTJ 4ZTFA 4HA8A 3GEZA 4MHGA 2DFIA 1ORKA 3GLLA 2ZFUA 4OAYA 1B9NA 1EF4A 3H5AA 3ZCOA 5KAFC 3F21A 2FA5A 4E6KG 2F5EA 2Q2EB 3U1DA 3W6KB 1ZYRF 4QLCU 5F08A 3M8JA 2VJ5A 3HUGB 1HXDA 3ZMVA 4H0EA 3ZR8X 3OS2A 4RB0A 3QPTA 1K61A 1Y1VJ 1SFOJ 2VT3A 4JP0A 4UVBA 2EILH 4E7KA 2V79A 3KP6A 5DM6F 3VEPA 1UHSA 5EGOA 4MGRA 2OUMA 1JI8A 2DN0A 4JYKA 1UHMA 5FJ8J 2X1DA 4KITB 1AWCA 3QRFF 5EG0B 2MC3A 2D2WA 2G7HA 3CLOA 5FROA 5IY5H 1QPIA 4NC7A 3A02A 1YI2I 4G6TB 1H9GA 3K1MA 3DKXA 4G7ZF 3FXRA 4XICA 3HZJA 4RBOA 5DCMB 3GTQJ 1ZRCA 2A3SA 3HSFA 3WTZA 3Q5FA 1J09A 1I6HJ 3GZNB 2QWWA 4IXAA 3L1PA 4BBRJ 3COAC 2YX4A 3V42A 5IPAA 3ERED 1DDNA 4PJNA 1X4OA 1VQMI 3T8RA 2DA1A 2HQNA 3TL4X 3WTXC 1FP1D 3OYCA 2GIZA 3UNGC 3Q0VA 5C44J 4V2GA 2EFPA 1JGSA 1A6QA 2LBFB 2MGQA 4A6DA 3L2RA 2F6CA 3ZOBA 4BU2A 2TCTA 3OS1A 2VODA 1NK3P 3JRIA 4XBFA 4P9UA 1MJBA 1TW2A 2BXZA 1FEXA 1LVKA 5AIPA 2FJ1A 3OIOA 2K9NA 1Z9CA 3P7NA 2E34A 1W5SA 2PEXA 1BJZA 2R7FA 1P92A 5FB2A 4U0VA 2AXLA 2FBHA 1YRNB 3A2KA 4X6AJ 3V8KA 5J4VA 1DGRM 1IRGA 2PFBA 4KYWA 3QOPA 4HLXA 3D1NI 3RIRA 2DDAA 3JRBA 2KISA 4BBSJ 3VYTB 3FXMA 3GUDA 4M9ZA 5FD5A 3J80Z 2K9SA 4UXNA 4RB1A 3K70C 3IC7A 1K78A 4HW0A 2UZKA 1KQ0A 2O9LA 4XNFA 3CDLA 3ZN0A 3B6CA 1USSA 5H2FC 1YJNI 3EUAA 4YELA 5FKMA 4AYBN 1YOVB 2VQHA 3ROUA 3S1QJ 1S6LA 3F8FA 4CH7A 1XSVA 1A6IA 3BTLA 3HOUJ 2QKLB 1IZ1A 2HQ5A 4RGUA 5FLVA 4I2OA 1ZN2A 3HKZN 2W00A 2XAJA 4Y15A 5CQEA 3FXQA 5IT9Z 4XN0A 4QWQA 4U0YA 1WJAA 1LE8A 2E1OA 2FRHA 2ZJRF 1P9QC 5F0CA 3SZGA 2BY0A 1UG0A 4KDPA 2EINH 2EIJH 3A1YA 4XLEA 4DYRA 1ETOA 3ISPA 3OOPA 5CPRB 2A61A 3CMMA 4NDLA 1LEAA 2DA4A 2E71A 4AIJA 3KP4A 4EM0B 2K02A 3BJ6A 3HPGA 2E2IJ 4LB5A 2HKXA 2EZIA 3C2GA 2TDXA 2W25A 4I99C 2VJJA 4B43A 3CC2I 3I4MJ 2FD5A 2HWVA 3ZQHA 2J5PA 2WY8Q 5D8LB 3K4CA 3CUOA 1WZ2A 3H9JA 3O8HA 1J9IA 2E19A 3K4KA 4QSHA 4ZYHA 2K85A 1B8IA 4ZYGA 3G1OA 4EEFG 3JRFA 1O3TA 1TWAJ 1OYYA 2BHZA 4II3A 4NBQA 1FYKA 1RKTA 1YE9A 1TW3A 5JR3A 3OV8A 2KMUA 1BR1A 1KU7A 1XMXA 1CGPA 1BIBA 2LSOA 1ITYA 1X3UA 1W0TA 5AIQA 3SEQA 5KNLA 2IP2A 4LIUA 2VB6A 2DMNA 3NWSA 1XSXA 1EA3A 3LFKA 4BE2A 3CP2A 2P5LC 2L7FP 2UUZA 4B3XA 2L3DA 2OTJI 4RGXA 2LRDA 1FOWA 2HDWA 2CQKA 4XLCA 1BOAA 1ZR4A 1Y39A 4BY7J 1S5LC 4CO8A 4IHXA 3LQRA 2O8XA 2YPRA 4BJ6C 2BVLA 4ZYAA 2FOWA 2L5QA 2EK5A 5TJJA 1RR8C 1T98A 3G1MA 1J7KA 3LFUA 3H0DA 1AU7A 2L7MP 1DPUA 2D1VA 3DCFA 3S2DJ 1ZLKA 1LPQA 3A01A 2FXAA 4F52A 5J1YA 2DOEA 4M6YA 2Z33A 1HW1A 2VN2A 3BCAA 3HIFA 2FNAA 3V7CA 1O3SA 3EDPA 2FSWA 1W36C 3RSNA 4R79A 1W1WE 4CHUA 4ENNA 1IW7F 4OMZA 2LKPA 4BH9A 3VB2A 2FEZA 2Z2SB 3AAFA 5E3MA 2KRHA 1OR7C 2FMLA 1W5CC 3CCQI 1MBHA 3KIOA 3IUOA 2Y69H 3EPZA 4JX6A 3RYRA 4II2A 3HOWJ 2CQQA 3E5UA 4CZZA 3BPXA 1MJ9A 3J80K 2QKMB 3ECHA 4B44A 3IL2A 4E7SA 1DQUA 3JRGA 4MTDA 2OTLI 1V3FA 1IO2A 4A3JJ 2E5NA 2GXGA 3K70D 4PK4A 2DMTA 2BV6A 1SFEA 5E3OA 3OYEA 1UB9A 3M9AA 3QP5A 1FLIA 2A6TA 2KT0A 3FMQA 1TWCJ 2QQ8A 3BCBA 3QPHA 3BZKA 4S0HB 3P9IA 3BG5A 1V54H 3C2BA 1FTTA 2RKHA 1E2XA 3WTVC 5D5UB 1O3QA 1T39A 3MZHA 1R9TJ 2L9RA 3OMYA 5D5XB 3ZMTA 3PQKA 3D5SC 5IT9K 3H0GJ 1S8NA 2AQFA 1TP4A 5F1JA 2JRTA 3MQ0A 1UFMA 3BTIA 1HQCA 3GZ5A 2M5WA 4DYCA 2KRFA 3TBIA 2ELKA 3WHCA 2ZKZA 1OLTA 2OZUA 3FXUA 1CF7B 3FBNB 2IGKA 1IN7A 4CCLA 2ZXHA 1WVRA 2A68F 3I58A 3AFHA 5HDKA 3BR3A 2IA0A 3OYDA 1X3WB 3LSJA 3IH2A 3L9FA 2M7BA 1TWHJ 3PNTA 2A07F 1XD7A 4EM2A 3U21A 4J19A 2X4HA 5LHIA 2K3FA 2H8RA 4WCGA 2H1LA 3BQZA 1T0FA 2XRNA 2K9MA 5DDGA 1IG7A 3X2QH 4IRHA 4A0XA 2VIXA 2EQRA 4LFUA 1MMAA 3DWLE 1PYVA 5C4JJ 5HOOA 1OCTC 4CXFA 2VQCA 1B9MA 1JXSA 4UUVA 2GBYA 5CJ9A 3QP6A 3B6AA 3E6MA 3J7ZI 3BWGA 1BI1A 1MMNA 4FISA 2BHYA 4RDUA 3TO6A 1BBYA 1MNEA 2BBYA 3OYAA 3PQJA 2Z16A 4A2UA 5JVTA 4BACA 5D6FA 2ZJQF 4U0WA 3QU6A 2JUGA 3P9KA 1IJWC 2NVXJ 3ZQIA 1D0XA 1QGPA 2MYSA 3B02A 2CW7A 2DO7A 2HDDA 4RLFA 1SD4A 2DA7A 1ZGAA 3CCLI 2V9VA 1U2WA 4HF1A 1MH3A 5JHUA 2WC2A 5ED4A 4D0PA 1W5TA 1LUJB 1F1ZA 3MWMA 4GYIA 5EEAA 4U87A 4A3LJ 1Z7LA 2NNNA 3R6SA 1EH7A 4IO9F 4BEHA 1QRYA 3GTMJ 2HXOA 2P6TA 3A4CA 1KU9A 1HDPA 4HRIA 2HDCA 1R36A 2JVGA 3HGYA 4RAZA 2DK8A 4V19K 2LLKA 5LGNA 1FP2A 1SAXA 4UB6C 3MZYA 3VPRA 4LMYA 2XASA 2A5WA 4EMSA 2VKVA 3BG3A 2V1NA 2ZNYA 5K1YA 1FZPB 1A5JA 3HEFA 3OR1C 4FETA 3S1MJ 3I0TA 3SZTA 1RNLA 1N25A 2HS5A 2KIQA 3FM3A 5B1AH 1W36D 5B1BH 3K2ZA 3DPLC 2F4OB 1YJWI 2ID6A 4J00A 4WXDA 3KE2A 4L9VA 3AG1H 4NUBA 1USTA 1T08B 1WH5A 1R5ID 2QQAA 3TW7A 1S29A 4XLAA 4M72A 3I55I 2DCEA 2GM4A 2MG4A 3OYKA 2PMHA 1ODDA 1R71A 2JA8J 3S1NJ 4Q48A 1LB2A 1VQ4I 1I5ZA 1WI3A 3ASOH 3QYBA 3S3MA 1XMKA 5GAHJ 3P5JA 3OS0A 1LDDA 2YU9J 2IS1A 1XGNA 3KYCB 3BTJA 2Z99A 5ILUA 4L9TA 3S2WA 2FQ4A 4U88A 4KICA 3KETA 4EJTA 3HSRA 3QQAA 3MCZA 3ZRGA 4S05A 2CG4A 4P5OA 3W6JB 1E17A 1V5GA 2FU4A 3PUBA 3LA2A 1TWFJ 1ZK8A 1SFUA 2K5CA 3CUQC 3RKXA 3K10A 2KKOA 4I76A 2MC4A 2Y48A 5FLXZ 2BW3A 3BT9A 2CQ7A 2K40A 4X0GA 1AKHB 4NC6A 4F55A 1Y0UA 1SC7A 4G94A 1O3RA 4B1RA 3FX3A 2RC4A 3V4GA 1BI3A 2M3AA 1Y8QB 2PMZN 2UWMA 1VFCA 5LLQA 2CYYA 3FMRA 3M07A 4OOIA 3ZQ7A 4AYBA 3WE2A 1R5GA 2MH2A 3K7AJ 2E7WA 3J7AY 5CVJA 1HF0A 4BGDA 3QWLA 3CJRB 3DTKA 4JBAA 5EDNA 1G4DA 2OV7A 5LEJA 4L5EA 2ZMEC 2V1UA 2L0KA 3KFWX 4KFCA 5AONA 4CA0A 2A05A 3HM5A 1KQ8A 4PUSA 3RYPA 2E1MB 1W0UA 3CD6I 3AL0B 4AIDA 2QYOA 4A3CJ 3RQ4A 2R5ZB 2XV4S 2IPQX 2OQRA 2XB5A 2QGUA 1KGSA 4OU0A 2Q0OA 2OAZA 1W4MA 1VQ5I 4DYQA 2WAFA 3OYIA 3JR9A 1N75A 3VOEA 4YEJA 3CCJI 1AA7A 5KVRA 2E1MC 1KA8A 2NRAC 1SVMA 2IA2A 2F2EA 3F8MA 2Q2EA 4ZDLA 3T5XA 1QHHD 3H36A 5BMZA 2ZBKA 2Y30A 2XAHA 4HSRA 3D5LA 3HUGA 3JRHA 1E0EA 4E7IA 2WA0A 1HC8A 4JOMA 2BOLA 3AG2H 3ZMZA 4XMYA 4A6EA 5M5WJ 2CGPA 2KJCA 2HZDA 1S7OA 2VKHA 5K5QA 2QF7A 4IQJA 1M1EB 4AVPA 2VBWA 5LD2C 4ZZDA 1B59A 1KZHA 2H1KA 1ZRFA 2W1OA 1TBXA 2V7FA 2HQRA 5BS6A 3CQZJ 3E7LA 4LLLA 3MD2A 4DZPA 2V9KA 4A3DJ 4DIQA 1G6NA 5DCMA 3K1NA 2NS7A 3CCSI 4G8XA 3MKLA 3KX2A 4YIRX 3DKYA 5ICGA 1E3OC 2HYFA 2MABA 4JX4A 4CYCB 3FISA 3GTPJ 4L5JA 2JRMA 2ACJA 4GGGA 2B63J 3FXJA 1TC3C 4MQVA 2KIFA 3ZQFA 3S3OA 2K86A 3KZIC 1TLHB 4RMNA 1HA8A 2R7SA 4HX8A 3IKTA 1WQ2A 2LBFA 4KUMA 3TW6A 4I6ZA 1QHGA 3F3XA 3C1DA 1ETYA 2EA2A 1ZG1A 3S8PA 2EIKH 4LLGF 5HS9A 1MDMA 3WTTC 2K3PA 5D5VB 3PO3J 3HB9A 3HDDA 1OYIA 1EH8A 4GXOA 3F8CA 4IX7A 2CV1A 2ADUA 3BJOA 4P1WA 2M4KA 1U3EM 2OBPA 4I0BA 3QOEA 3OWTA 4E70A 2OD5A 3GXOA 2JPCA 4XRSG 1ZG3A 2JA6J 1O4XA 4HAMA 3FXLA 2Y9YA 1Z3YA 1JTYA 3F8BA 1V4RA 1QQIA 4LG0B 3BZ6A 3BJAA 5LEKA 2NVUB 3OL4A 4HG2A 2P7VB 3W2VA 2QQBA 3WHBA 5KAIC 1UZCA 2R5YB 3L7WA 4NB5A 3H3VK 3VFZA 2B0LA 2MW8A 4BDZA 2OZ6A 2RQPA 3HC7A 4DNCA 2O03A 4M3FA 3T1BA 4R1HA 2QSGX 3HTSB 1Q1VA 3ABMH 3NAUA 2QM3A 2WY7Q 4KT5C 2M1BA 1X1BA 3IWFA 1L0OC 2NVYJ 1Z77A 4HLYA 1PJRA 3FWEA 1J2XA 3I64A 4BXUA 1POGA 3GTKJ 5EZGA 1U5TB 2CV0A 1D8JA 1LDJA 1IRFA 3I59B 4GFBA 1ETXA 2QZ8A 2L2OA 2QBYB 2COMA 2X0LA 2YS9A 1KU2A 1PUEE 2R7ZJ 2A69F 5C3EJ 3LSRA 1T38A 1TWGJ 1UMQA 4L5IA 4XRMA 2HYGD 1T95A 2NAZA 2PX9A 3FBIB 3IH4A 5M3MJ 3FXKA 4RA2A 5TGTA 4RB2C 2PI0A 1G2HA 5F27A 4FASD 2XKOA 1WJFA 5TISC 4QPOA 2CW8A 2HQAA 3BR0A 2F5DA 2KDZA 2PJRB 2XSDC 4UUSB 1KQ9A 2XPVA 2M0CA 5IP7J 1FC3A 2VLAA 2HPIA 2DPUA 5JFRA 3L00A 4LK0F 1MMSA 4C3HJ 1HSJA 2IEKA 3KP5A 4NHJA 3K9TA 4I02A 3A0BC 2KZGA 5CKTA 5FKNA 5B66C 2WTEA 3B73A 1Z6TA 4P55A 2XC7A 3G3ZA 2VKEA 1W7PB 2EFQA 1Y56A 5HDGA 2EFNA 4M3DA 1OPCA 4EGZA 1MBGA 5M5YJ 5GPCA 2R7XA 3WG9A 1R1TA 2XF5A 2B7EA 5DTDA 2HOAA 3KZZA 2HVSA 1BR2A 3DFGA 3H92A 3I5UA 2XB0X 2JJ7A 1TQMA 3N97A 2YU3A 2LC2A 1L3LA 2QA4I 4AM3A 3ZMDA 3QODA 4XK4A 1OR7A 1SANA 2W84A 1B72A 1FYLA 1FMWA 4A5MA 1FPQA 2G9WA 2Y0SN 3Q9SA 4I7HA 4YIFA 3W6VA 1T2KA 2ME6A 5L3GA 1VQ7I 1OQYA 4PFOA 2X6WA 3RKWA 2B9SA 1YTYA 2E1NA 3DKWA 1TT5B 1A36A 3K4BA 2ZXWH 3PNYA 4KN4X 3A0HC 4FCYA 4RGSA 4YG2F 3G1LA 4DW6A 4E7HA 1YQAA 4Y3OA 4FE4A 3OYLA 2ZB9A 1NG7A 1R4MB 3RPUD 2DW4A 2CMPA 2MH9A 4G6QA 5DUKA 2HKOA 2ECBA 4PSXA 5JI6A 1U78A 3ABUA 5ICFA 1RETA 3GWZA 1XTAA 2Q1ZB 3HHGA 3I71A 4L9NA 4EQQA 2JZYA 3KP3A 3CTAA 3AG3H 4PJ0C 1HKTA 4CCMA 2HXIA 2LG4A 4NC8A 4WWCA 4O5VA 2XVCA 4PCQA 1EKEA 1ZARA 1TQPA 1YX3A 5E17F 2AQEA 2IXSA 1F5TA 3F72A 4N4NB 3KPHA 1X19A 5D8KB 3DEEA 2DI3A 3K6GA 3PSIA 1ON1A 3EQLF 1ZTRA 2L54A 3S17J 3ELKA 2LREA 2HVQA 2UXNA 2DA6A 4D5CA 5H20A 4OAZA 1XGMA 2XAGA 1JGGA 3M8EA 2VT2A 4G6DA 4BJ5C 1ZHFA 2ZJPF 4KISA 5LRRA 1I27A 1R58A 1U8BA 3LSPA 2R7OA 1ZREA 4CDGA 4Y13A 5IT3A 1RC9A 2MLGA 3S16J 2R7TA 1H9TA 1CF7A 3JSOA 1R1VA 1ZGJA 3L2QA 2VE9A 4KMUX 2K9QA 2O8KA 1WJDA 2F5FA 2W4SA 1LJ9A 1ENHA 5H6RA 4RM3A 2HEOA 1GV5A 4Y17A 2A6HF 4EJOA 3H9QA 2ZCWA 4PSWA 4HEA2 2IT0A 5F1RA 2PMZA 1P2FA 2H27A 4MO7A 4RGRA 4AIHA 2DQLA 3M8FA 1BW5A 1WPKA 2MSYA 2ISYA 3C18A 3PFYA 3D5RC 5J8FA 1WHUA 5TRDA 3BPVA 2H94A 2BXYA 1JKOC 2V6EA 4UY8I 2DLLA 4LOCA 5E1ZB 3ZPLA 4HOBA 3ZQQA 3PJRA 4E7LA 3ZQGA 3IAM2 1YW8A 5ICEA 2NS8A 2HYJA 1Y6IA 1BA5A 4UNOA 1JTXA 1NG6A 2BY1A 1IV6A 2VXDA 5HS8A 3NQOA 2EZLA 4L9JA 3TDZC 2R92J 2MLKA 2YSRA 5F0FA 4QIWN 2GA1A 4PGHA 2XUBA 1O57A 2DMPA 1H8AC 2WB1N 1P4AA 4IOAF 2XDVA 3SQNA 1D0YA 4CGZA 1UHWA 1WWXA 1QZYA 3S15J 1RZ4A 2QUFA 2L7KA 1XB4A 5J47A 5EEGA 4HBLA 2AHQA 1DUXC 1LVAA 2EA4A 4EJWA 1K78B 1ETQA 3ZXSA 4MIMA 3V7RA 2LY9A 4XSXF 2GLOA 1FNNA 3QAHA 3TOAA 1D1BA 2JMWA 2DYSH 3E5XA 3MAJA 4XIDA 3DEWA 1Y0NA 3ZP5A 3OL3A 2Y2ZA 5DUIA 2R4GA 2UV1A 2KHMA 3F6OA 2DTRA 1ON2A 2P6SA 3S2HJ 5KCMA 1XPXA 1U0JA 3RZOJ 1OFCX 2M34A 4OIOF 3FDYA 1O7LA 3H5NA 1MH4A 5E3LA 2YX7A 3DBRB 5EF6A 2MBFA 2CV2A 1BI0A 1LE8B 3KEYA 2F5VA 1R22A 1IGNA 2V1DA 1IN8A 2LVSA 3L09A
chains in the Genus database with same CATH topology
2MD5A 1H0MA 4MNUA 5DV5A 1SD7A 3GX4X 3RJPA 4EV0A 1Z91A 5D6EA 1XGSA 4JQFA 2OQGA 4FX4A 4HQMA 1K7AA 1J75A 1I1SA 3CUQA 2HOEA 2FBKA 2XHKA 3JTGA 1VTNC 3TOBA 2Y75A 2W57A 1PP8F 1BJAA 2VOOA 5FO5A 1SMTA 2JT1A 1AOYA 3C7JA 2P4WA 3CO6C 2AS5F 2LDUA 1SMYF 4IF4A 2WV0A 3K69A 2ZMEA 2Y0MA 3FHZA 3E3VA 3CO7C 4HQEA 2PMUA 1G3SA 2RGVA 3E6BA 2GXBA 3DF8A 2IJLA 1Q1HA 2PLYA 1FSEA 4ESJA 4KIGA 3DPTA 3ECOA 1I6XA 1G3TA 2CO5A 1J59A 5HS7A 5DD4A 1GVJA 1FBSA 2ESHA 4KN7X 4K2EA 2K4BA 2VC0A 1YW7A 4HX4A 1WRJA 3WTYC 4G7HF 3RDIA 3Q9VA 1IF1A 4RB3C 1C0WA 5HDNA 1BN5A 1FY7A 2G7UA 4TV7A 1YYVA 4OIRF 4ZYEA 3WTSC 1U8RA 3MEXA 4KNYA 5E20A 5FFZA 2D1HA 1LNWA 3ML6A 1DP7P 1Z6RA 5LHGA 1BM9A 5DD8A 4IHTA 3J81Z 3EYIA 3K0LA 2VBZA 2O0YA 2RN7A 1GXQA 2WWYA 4ETSA 1MGTA 1P6RA 3G73A 5ILSA 3TQNA 4N0BA 2ELHA 2XAFA 3FF5A 5F64A 5K5OA 4YFNF 2STWA 2P5VA 4PGGA 3WODF 4BHBA 3RPUA 2Z9OA 5CVIA 1ONVA 2VXZA 1XGOA 3RKYA 3LAJA 3M7GA 3WGHA 2ISZA 5A2QZ 2ZXJA 3ABTA 4WF2A 4M9XA 2NS0A 4M6XA 1MZBA 1FBUA 1WKMA 4HDUA 5L3BA 3E97A 5DCFA 4MEYF 2EV6A 1UCRA 3ZMUA 3E6DA 5KK1A 5BOXA 4UHTA 3U9GA 4FHTA 1EH6A 3DP7A 3I59A 1TQIA 2HGCA 3F23A 4I09A 1BC8C 1OMIA 1QO0D 3HOTA 3BY6A 3HHHA 2IA1A 4LB6B 2ZFWA 5DYMA 3F8NA 4EM1A 1DPRA 3HRTA 3TO9A 4FX0A 3KLNA 2O61A 2BYVE 2V1XA 5CYVA 5H6QA 2FNPA 4OIPF 2ZNZA 5L3EA 3GFIA 4N9IA 5FGMA 2HTSA 2ZJ2A 2JSCA 3E6CC 1BC7C 4IHSA 4UVAA 2PBIA 2XAQA 4YFKF 4M73A 5E1XA 2Z3YA 3J81K 3TO7A 2O6GE 2EV0A 2XGXA 1ZG5A 2E1CA 3ZN1A 4ENMA 4IRGA 1MJAA 4AWXB 4HF0A 1KYZA 2QQ9A 3KLOA 5A2QK 5FLXK 1MKMA 1FX7A 2PN6A 4JK1X 1S3JA 3JW4A 4CYDA 4Q47A 3O6BB 3DQVC 1RIOH 1A04A 1B4AA 3GFLA 4Q5SF 1QNTA 2VONA 1D8KA 3WE3A 3V8JA 5BQTA 2CFXA 2M45A 1KU3A 3ZMSA 2EV5A 5K5RA 1R5HA 3IKVA 5BPDA 3WGGA 2FOKA 1QBJA 1U5TC 3WU0A 1IXRC 1HKSA 2QLZA 1U6GA 2XROA 3F6VA 3TGNA 1HSTA 2J5OA 4BQAA 4I01A 1MD0A 3T0YA 2EWNA 5BPIA 4KIFA 4GCVA 2FF4A 4HDVA 3T8TA 4M74A 3WTWC 1RI7A 4G7OF 2CWEA 3WTUC 3MFKA 1YLFA 5E18F 1HW5A 4N9HA 1TTYA 4L18B 2K7LA 3R0AA 2C6YA 2JTVA 5FD6A 3BROA 3WU1B 4ESBA 2E7XA 1ULYA 3M1EA 1IAWA 1NHAA 2ZO4A 4IVNA 2BEOA 2Q8KA 1TNTA 4A5NA 2H6BA 4B8XA 5ILVA 3SZPA 4WK8F 1MDMB 5LGUA 3NRVA 1XCBA 2EFOA 4GO1A 4I0AA 3DXJF 5DEQA 3EYYA 3BP8A 3JTHA 5D4SA 2W85A 3V8LA 3KCCA 4UV9A 4ZYDA 3IRRA 5EEHA 1XMAA 3H3ZA 1HW2A 2NNYA 5HLHA 3HOSA 5ICCA 2K27A 2DPDA 4XLNF 2KIMA 2LF8A 3LSTA 4UVCA 1O7FA 2LF7A 1LEBA 2UXXA 4PZJA 4ZZLA 3TKYA 3RI4A 3I4PA 2A6EF 3HRUA 4A12A 1SD6A 2RVCA 4IPAA 4U7DA 4ENJA 1OKRA 3SHFA 4MEXF 1ZAOA 1LQ1A 3GYHX 4WXHA 3DV8A 3HYIA 5D5WB 2L4MA 4OIQF 1QPMA 4MQ9F 4GYGA 1ZRDA 2HFHA 3P9CA 4FT8A 3HSEA 3RPQA 4O3MA 5CVVA 2LNBA 2IRFG 1Z7UA 2HZTA 1SD5A 1BI2A 1IN6A 4HV6A 2VC1A 3FMSA 3BDDA 3GF2A 3F22A 5HLIA 3J7AO 3QU3A 2M87A 4KA4A 2M30A 1P4XA 1D3YA 4Z2YA 4ZH4F 1FYMA 3GZ6A 2DQRA 2CSOA 1P4WA 2EFWA 1W7PD 4BAYA 1J0RA 1Z05A 2XIGA 1B1BA 4A0ZA 1JE8A 3SFZA 2VBYA 1RUOA 4LGWA 5E1WA 2PQ8A 4HV5A 1IXSB 3CDHA 1JHFA 4EJUA 2V6CA 1R23A 4AIKA 4ENKA 2GAUA 1OYWA 3LA3A 4HX7A 4R8HA 2HTJA 4PDKA 2P7CB 2YR2A 1KYWA 2P5KA 3KEOA 1IUYA 3NEUA 6PAXA 3H3UA 1J5YA 2GIVA 4CICA 2H6CA 1GHCA 5LGTA 2PJPA 2K4JA 5E8GA 1WI9A 2QENA 1Z1DA 1B6AA 2JPBA 5LBQA 1T6SA 1ZLJA 2DBBA 3GFMA 2EB7A 2MA3A 2H09A 3HRSA 4OINF 3WGIA 3LQQA 3ULQB 4HF2A 5CVRA 2RDPA 2DK5A 1R1UA 2EJRA 1JHHA 3K1PA 2GQQA 3GFJA 3PFIA 4NQWA 3HRMA 1ZH5A 4IRIA 5E8IA 1LDKB 2PG4A 4WXCA 4IJAA 4P9FA 2DU9A 4BHCA 3VODA 2A5YB 5LHHA 4UV8A 1HKQA 1FSHA 4XSZF 2R3SA 4DQ2A 2RV8A 3O2PE 1K79A 3E5QA 2XKPA 2ESNA 3KZYA 3JSPA 2L01A 3SXYA 3EUHA 1R00A 3GO5A 1YIOA 4HZFA 1FT9A 5L3DA 2OA4A 4F7ZA 2D45A 2GZWA 2VE8A 1RUNA 2DT5A 2FQ3A 1FBQA 4S04A 4BYYA 1XDUA 3FZVA 3HTUA 3LA7A 2FBIA 4KMFA 5HVQC 1I1GA 1FOKA 1D5VA 1PP7U 1REPC 1WSUA 1IN5A 1G3WA 3FM5A 4LD5A 4Q4ZF 3CUQB 4YFXF 4YIIA 4L0YB 2L4AA 1XSDA 1S7AA 4EJVA 2W24A 3LWFA 5L3FA 2GA2A 2M8EA 1STZA 4P96A 5L3CA 3R60A 3BOQA 3IWZA 4AD9A 4LG0A 3D0SA 4L0ZB 3KP7A 5J6XA 3CJNA 2ZMEB 4A0YA 1YW9A 5D4RA 3DEUA 2F5CA 3JAMZ 3GW2A 1BIAA 4OMYA 4BNCA 2NYXA 2L02A 1F9NA 2R7DA 3I53A 3I54A 3KEQA 5CLSA 3LAPA 2ETHA 3C3WA 1U5TA 1YG2A 4G9YA 4I98B 4B09A 4M9SA 2QBYA 1YO5C 1IN4A 1F4KA 2O3FA 1FWZA 2STTA 3TDUC 4WX9A 2BE5F 1SFXA 4XRFA 1PDNC 4LLNA 5F6FA 2VOPA 3R61A 5LRSA 2IVMA 1G3YA 4U7BA 4LJZF 2IW5A 5CVUA 4HYEA 1XN7A 3IHUA 2FMYA 4XLPF 4RAYA 3O3KA 2DAOA 2QVOA 1YFHA 1W7PA 1XDSA 1GXPA 2Z5UA 3L2CA 4BHPA 2HR3A 1YS7A 1XCVA 4EGYA 3R4KA 3N4MA 4M71A 2KIUA 5FFXA 1K6OA 1IXCA 3RTRA 2RNJA 1TNSA 3GLXA 3KP2A 4ESFA 3IRQA 4ASNA 1QZZA 1HBXG 2OU2A 2BGCA 3GVAA 4EVIA 4LK1F 2CW0F 3V7SA 2GWRA 5J8CA 1R7JA 3REOA 3U2RA 1EV7A 1YS6A 2KJBA 4KIBA 5HLGA 4ON0A 4MTEA 4RS8A 3R0JA 4O6JA 2P8TA 3EETA 3JAMK 5ERIA 2FE3A 2VBXA 4HA8A 3GEZA 4MHGA 2DFIA 1B9NA 3F21A 2FA5A 2F5EA 3U1DA 3W6KB 1ZYRF 4QLCU 1HXDA 3ZMVA 4H0EA 4RB0A 3QPTA 2VT3A 4UVBA 2V79A 3KP6A 3VEPA 4MGRA 1UHMA 1AWCA 3QRFF 2MC3A 2D2WA 2G7HA 3CLOA 1H9GA 3K1MA 4G7ZF 3FXRA 5DCMB 1ZRCA 2A3SA 3HSFA 3WTZA 3Q5FA 2QWWA 4IXAA 3COAC 2YX4A 3ERED 1DDNA 3T8RA 2HQNA 3WTXC 1FP1D 2EFPA 1JGSA 4A6DA 2VODA 4XBFA 4P9UA 1MJBA 1TW2A 5AIPA 1Z9CA 3P7NA 1W5SA 2PEXA 2R7FA 1P92A 5FB2A 4U0VA 2AXLA 2FBHA 3V8KA 1IRGA 2PFBA 4KYWA 3QOPA 4HLXA 3RIRA 3GUDA 4M9ZA 5FD5A 3J80Z 4UXNA 1K78A 4RB1A 3IC7A 4HW0A 2UZKA 1KQ0A 3ZN0A 1USSA 3ROUA 1S6LA 3F8FA 1XSVA 1IZ1A 4RGUA 4I2OA 1ZN2A 2XAJA 4Y15A 3FXQA 5IT9Z 4QWQA 4U0YA 2FRHA 4KDPA 3ISPA 3OOPA 2A61A 4AIJA 1LEAA 3KP4A 4EM0B 2K02A 3BJ6A 4LB5A 2HKXA 2TDXA 2W25A 2HWVA 2J5PA 5D8LB 3CUOA 1J9IA 4ZYHA 4ZYGA 1O3TA 1FYKA 1OYYA 1TW3A 5JR3A 3OV8A 1KU7A 1CGPA 1BIBA 2LSOA 1X3UA 5AIQA 2IP2A 1XSXA 3LFKA 2P5LC 2L3DA 4RGXA 2CQKA 1BOAA 4CO8A 3LQRA 2O8XA 2YPRA 2EK5A 5TJJA 1T98A 1J7KA 1DPUA 2D1VA 1ZLKA 2FXAA 4M6YA 2Z33A 1HW1A 2VN2A 3HIFA 2FNAA 3V7CA 1O3SA 3EDPA 2FSWA 4R79A 4CHUA 4ENNA 1IW7F 4OMZA 2LKPA 4BH9A 3VB2A 2FEZA 3AAFA 2FMLA 3RYRA 3E5UA 4CZZA 3BPXA 1MJ9A 3J80K 3ECHA 3IL2A 4MTDA 1V3FA 2GXGA 2BV6A 1SFEA 1UB9A 3M9AA 3QP5A 1FLIA 3FMQA 3QPHA 3P9IA 2RKHA 1E2XA 3WTVC 5D5UB 1O3QA 1T39A 3MZHA 5D5XB 3ZMTA 3PQKA 5IT9K 1S8NA 2JRTA 3MQ0A 1UFMA 3GZ5A 1HQCA 2M5WA 2KRFA 2ZKZA 2OZUA 3FXUA 1CF7B 1IN7A 2A68F 3I58A 5HDKA 2IA0A 3L9FA 2A07F 1XD7A 4EM2A 2X4HA 5LHIA 4WCGA 1T0FA 2XRNA 5DDGA 4IRHA 4A0XA 4LFUA 5HOOA 4CXFA 1B9MA 1JXSA 4UUVA 5CJ9A 3QP6A 3E6MA 3BWGA 1BI1A 3TO6A 1BBYA 2BBYA 3PQJA 5JVTA 4A2UA 5D6FA 4U0WA 3QU6A 3P9KA 1QGPA 3B02A 2DO7A 1SD4A 1ZGAA 2V9VA 1U2WA 4HF1A 5JHUA 2WC2A 5ED4A 4D0PA 1W5TA 1F1ZA 3MWMA 4GYIA 2NNNA 3R6SA 1EH7A 2P6TA 1KU9A 2HDCA 1R36A 4RAZA 2DK8A 5LGNA 1FP2A 1SAXA 3MZYA 4LMYA 2XASA 4EMSA 2ZNYA 5K1YA 1FZPB 3I0TA 3SZTA 1RNLA 2HS5A 3FM3A 3K2ZA 3DPLC 4WXDA 3KE2A 4L9VA 1USTA 2QQAA 1S29A 4M72A 2PMHA 1ODDA 4Q48A 1LB2A 1I5ZA 1XMKA 1LDDA 1XGNA 2Z99A 5ILUA 4L9TA 3S2WA 4U88A 4KICA 3KETA 4EJTA 3HSRA 3MCZA 4S05A 2CG4A 4P5OA 3W6JB 1E17A 2FU4A 3LA2A 1SFUA 3CUQC 3RKXA 2KKOA 2Y48A 5FLXZ 1Y0UA 1O3RA 4G94A 3FX3A 2RC4A 3V4GA 1BI3A 2UWMA 5LLQA 2CYYA 3FMRA 4OOIA 3ZQ7A 3WE2A 1R5GA 2MH2A 2E7WA 5CVJA 4JBAA 1G4DA 5LEJA 2V1UA 3KFWX 4KFCA 5AONA 1KQ8A 3RYPA 2QYOA 2XV4S 2IPQX 2OQRA 1KGSA 4OU0A 2Q0OA 2OAZA 1W4MA 3VOEA 5KVRA 1KA8A 2NRAC 2IA2A 2F2EA 3F8MA 2Q2EA 3T5XA 5BMZA 2ZBKA 2XAHA 3D5LA 3HUGA 3ZMZA 4A6EA 2CGPA 2KJCA 1S7OA 5K5QA 4AVPA 2VBWA 4ZZDA 1B59A 1ZRFA 1TBXA 2HQRA 5BS6A 4LLLA 1G6NA 5DCMA 3K1NA 4G8XA 5ICGA 2HYFA 4L5JA 2ACJA 4GGGA 4MQVA 2KIFA 2K86A 1TLHB 4HX8A 3IKTA 1WQ2A 4KUMA 3F3XA 3C1DA 2EA2A 1ZG1A 4LLGF 5HS9A 1MDMA 3WTTC 5D5VB 1OYIA 1EH8A 4GXOA 3F8CA 2ADUA 3BJOA 1U3EM 2OBPA 4I0BA 4E70A 2OD5A 3GXOA 2JPCA 1ZG3A 4HAMA 3F8BA 1V4RA 1QQIA 4LG0B 3BZ6A 3BJAA 5LEKA 2P7VB 2QQBA 3L7WA 4NB5A 3VFZA 2B0LA 2OZ6A 2RQPA 4DNCA 2O03A 3T1BA 4R1HA 3HTSB 2QM3A 4KT5C 2M1BA 3IWFA 1L0OC 4HLYA 3FWEA 1J2XA 3I64A 4BXUA 1U5TB 1D8JA 1LDJA 1IRFA 3I59B 2QZ8A 2QBYB 2COMA 2X0LA 1PUEE 1KU2A 2A69F 1T38A 4L5IA 2HYGD 2NAZA 4RB2C 2PI0A 2XKOA 2F5DA 1KQ9A 1FC3A 2DPUA 5JFRA 3L00A 4LK0F 1HSJA 3KP5A 4NHJA 3K9TA 4I02A 2WTEA 3B73A 1Z6TA 4P55A 3G3ZA 1W7PB 2EFQA 5HDGA 2EFNA 1OPCA 4EGZA 3WG9A 1R1TA 3KZZA 3DFGA 3H92A 3I5UA 1TQMA 3N97A 2YU3A 1L3LA 3ZMDA 1OR7A 2W84A 1FYLA 4A5MA 1FPQA 2G9WA 3Q9SA 4I7HA 4YIFA 1T2KA 5L3GA 3RKWA 1YTYA 2E1NA 3DKWA 4KN4X 4RGSA 4YG2F 1YQAA 2DW4A 2MH9A 4G6QA 5DUKA 2HKOA 5JI6A 1U78A 3ABUA 5ICFA 3GWZA 4EQQA 3HHGA 3I71A 4L9NA 2JZYA 3KP3A 3CTAA 1HKTA 4WWCA 4O5VA 2XVCA 4PCQA 1ZARA 1TQPA 5E17F 1F5TA 3F72A 5D8KB 2DI3A 1ON1A 3EQLF 2L54A 3ELKA 2UXNA 5H20A 1XGMA 2XAGA 3M8EA 2VT2A 4G6DA 1ZHFA 5LRRA 1I27A 1R58A 1ZREA 4CDGA 4Y13A 5IT3A 2MLGA 1H9TA 1CF7A 3JSOA 1R1VA 1ZGJA 2VE9A 4KMUX 2F5FA 1LJ9A 5H6RA 2HEOA 4Y17A 2A6HF 4EJOA 2ZCWA 2IT0A 5F1RA 1P2FA 2H27A 4RGRA 4AIHA 2DQLA 3M8FA 3C18A 2ISYA 5J8FA 5TRDA 3BPVA 2H94A 2DLLA 5E1ZB 3ZPLA 4HOBA 1YW8A 5ICEA 4UNOA 5HS8A 3NQOA 4L9JA 3TDZC 2MLKA 2YSRA 2GA1A 4PGHA 2XUBA 1O57A 1P4AA 3SQNA 4CGZA 1UHWA 1WWXA 1QZYA 1RZ4A 2QUFA 1XB4A 5EEGA 4HBLA 1DUXC 1LVAA 2EA4A 4EJWA 1K78B 3V7RA 4XSXF 1FNNA 3QAHA 3TOAA 3E5XA 3MAJA 3ZP5A 5DUIA 3F6OA 2DTRA 1ON2A 2P6SA 4OIOF 1O7LA 2YX7A 2MBFA 1BI0A 1R22A 2V1DA 1IN8A 3L09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD5 A;  1H0M A;  4MNU A;  5DV5 A;  1SD7 A;  3GX4 X;  3RJP A;  4EV0 A;  1Z91 A;  5D6E A;  1XGS A;  4JQF A;  2OQG A;  4FX4 A;  4HQM A;  1K7A A;  1J75 A;  1I1S A;  3CUQ A;  2HOE A;  2FBK A;  2XHK A;  3JTG A;  1VTN C;  3TOB A;  2Y75 A;  2W57 A;  1PP8 F;  1BJA A;  2VOO A;  5FO5 A;  1SMT A;  2JT1 A;  1AOY A;  3C7J A;  2P4W A;  3CO6 C;  2AS5 F;  2LDU A;  1SMY F;  4IF4 A;  2WV0 A;  3K69 A;  2ZME A;  2Y0M A;  3FHZ A;  3E3V A;  3CO7 C;  4HQE A;  2PMU A;  1G3S A;  2RGV A;  3E6B A;  2GXB A;  3DF8 A;  2IJL A;  1Q1H A;  2PLY A;  1FSE A;  4ESJ A;  4KIG A;  3DPT A;  3ECO A;  1I6X A;  1G3T A;  2CO5 A;  1J59 A;  5HS7 A;  5DD4 A;  1GVJ A;  1FBS A;  2ESH A;  4KN7 X;  4K2E A;  2K4B A;  2VC0 A;  1YW7 A;  4HX4 A;  1WRJ A;  3WTY C;  4G7H F;  3RDI A;  3Q9V A;  1IF1 A;  4RB3 C;  1C0W A;  5HDN A;  1BN5 A;  1FY7 A;  2G7U A;  4TV7 A;  1YYV A;  4OIR F;  4ZYE A;  3WTS C;  1U8R A;  3MEX A;  4KNY A;  5E20 A;  5FFZ A;  2D1H A;  1LNW A;  3ML6 A;  1DP7 P;  1Z6R A;  5LHG A;  1BM9 A;  5DD8 A;  4IHT A;  3J81 Z;  3EYI A;  3K0L A;  2VBZ A;  2O0Y A;  2RN7 A;  1GXQ A;  2WWY A;  4ETS A;  1MGT A;  1P6R A;  3G73 A;  5ILS A;  3TQN A;  4N0B A;  2ELH A;  2XAF A;  3FF5 A;  5F64 A;  5K5O A;  4YFN F;  2STW A;  2P5V A;  4PGG A;  3WOD F;  4BHB A;  3RPU A;  2Z9O A;  5CVI A;  1ONV A;  2VXZ A;  1XGO A;  3RKY A;  3LAJ A;  3M7G A;  3WGH A;  2ISZ A;  5A2Q Z;  2ZXJ A;  3ABT A;  4WF2 A;  4M9X A;  2NS0 A;  4M6X A;  1MZB A;  1FBU A;  1WKM A;  4HDU A;  5L3B A;  3E97 A;  5DCF A;  4MEY F;  2EV6 A;  1UCR A;  3ZMU A;  3E6D A;  5KK1 A;  5BOX A;  4UHT A;  3U9G A;  4FHT A;  1EH6 A;  3DP7 A;  3I59 A;  1TQI A;  2HGC A;  3F23 A;  4I09 A;  1BC8 C;  1OMI A;  1QO0 D;  3HOT A;  3BY6 A;  3HHH A;  2IA1 A;  4LB6 B;  2ZFW A;  5DYM A;  3F8N A;  4EM1 A;  1DPR A;  3HRT A;  3TO9 A;  4FX0 A;  3KLN A;  2O61 A;  2BYV E;  2V1X A;  5CYV A;  5H6Q A;  2FNP A;  4OIP F;  2ZNZ A;  5L3E A;  3GFI A;  4N9I A;  5FGM A;  2HTS A;  2ZJ2 A;  2JSC A;  3E6C C;  1BC7 C;  4IHS A;  4UVA A;  2PBI A;  2XAQ A;  4YFK F;  4M73 A;  5E1X A;  2Z3Y A;  3J81 K;  3TO7 A;  2O6G E;  2EV0 A;  2XGX A;  1ZG5 A;  2E1C A;  3ZN1 A;  4ENM A;  4IRG A;  1MJA A;  4AWX B;  4HF0 A;  1KYZ A;  2QQ9 A;  3KLO A;  5A2Q K;  5FLX K;  1MKM A;  1FX7 A;  2PN6 A;  4JK1 X;  1S3J A;  3JW4 A;  4CYD A;  4Q47 A;  3O6B B;  3DQV C;  1RIO H;  1A04 A;  1B4A A;  3GFL A;  4Q5S F;  1QNT A;  2VON A;  1D8K A;  3WE3 A;  3V8J A;  5BQT A;  2CFX A;  2M45 A;  1KU3 A;  3ZMS A;  2EV5 A;  5K5R A;  1R5H A;  3IKV A;  5BPD A;  3WGG A;  2FOK A;  1QBJ A;  1U5T C;  3WU0 A;  1IXR C;  1HKS A;  2QLZ A;  1U6G A;  2XRO A;  3F6V A;  3TGN A;  1HST A;  2J5O A;  4BQA A;  4I01 A;  1MD0 A;  3T0Y A;  2EWN A;  5BPI A;  4KIF A;  4GCV A;  2FF4 A;  4HDV A;  3T8T A;  4M74 A;  3WTW C;  1RI7 A;  4G7O F;  2CWE A;  3WTU C;  3MFK A;  1YLF A;  5E18 F;  1HW5 A;  4N9H A;  1TTY A;  4L18 B;  2K7L A;  3R0A A;  2C6Y A;  2JTV A;  5FD6 A;  3BRO A;  3WU1 B;  4ESB A;  2E7X A;  1ULY A;  3M1E A;  1IAW A;  1NHA A;  2ZO4 A;  4IVN A;  2BEO A;  2Q8K A;  1TNT A;  4A5N A;  2H6B A;  4B8X A;  5ILV A;  3SZP A;  4WK8 F;  1MDM B;  5LGU A;  3NRV A;  1XCB A;  2EFO A;  4GO1 A;  4I0A A;  3DXJ F;  5DEQ A;  3EYY A;  3BP8 A;  3JTH A;  5D4S A;  2W85 A;  3V8L A;  3KCC A;  4UV9 A;  4ZYD A;  3IRR A;  5EEH A;  1XMA A;  3H3Z A;  1HW2 A;  2NNY A;  5HLH A;  3HOS A;  5ICC A;  2K27 A;  2DPD A;  4XLN F;  2KIM A;  2LF8 A;  3LST A;  4UVC A;  1O7F A;  2LF7 A;  1LEB A;  2UXX A;  4PZJ A;  4ZZL A;  3TKY A;  3RI4 A;  3I4P A;  2A6E F;  3HRU A;  4A12 A;  1SD6 A;  2RVC A;  4IPA A;  4U7D A;  4ENJ A;  1OKR A;  3SHF A;  4MEX F;  1ZAO A;  1LQ1 A;  3GYH X;  4WXH A;  3DV8 A;  3HYI A;  5D5W B;  2L4M A;  4OIQ F;  1QPM A;  4MQ9 F;  4GYG A;  1ZRD A;  2HFH A;  3P9C A;  4FT8 A;  3HSE A;  3RPQ A;  4O3M A;  5CVV A;  2LNB A;  2IRF G;  1Z7U A;  2HZT A;  1SD5 A;  1BI2 A;  1IN6 A;  4HV6 A;  2VC1 A;  3FMS A;  3BDD A;  3GF2 A;  3F22 A;  5HLI A;  3J7A O;  3QU3 A;  2M87 A;  4KA4 A;  2M30 A;  1P4X A;  1D3Y A;  4Z2Y A;  4ZH4 F;  1FYM A;  3GZ6 A;  2DQR A;  2CSO A;  1P4W A;  2EFW A;  1W7P D;  4BAY A;  1J0R A;  1Z05 A;  2XIG A;  1B1B A;  4A0Z A;  1JE8 A;  3SFZ A;  2VBY A;  1RUO A;  4LGW A;  5E1W A;  2PQ8 A;  4HV5 A;  1IXS B;  3CDH A;  1JHF A;  4EJU A;  2V6C A;  1R23 A;  4AIK A;  4ENK A;  2GAU A;  1OYW A;  3LA3 A;  4HX7 A;  4R8H A;  2HTJ A;  4PDK A;  2P7C B;  2YR2 A;  1KYW A;  2P5K A;  3KEO A;  1IUY A;  3NEU A;  6PAX A;  3H3U A;  1J5Y A;  2GIV A;  4CIC A;  2H6C A;  1GHC A;  5LGT A;  2PJP A;  2K4J A;  5E8G A;  1WI9 A;  2QEN A;  1Z1D A;  1B6A A;  2JPB A;  5LBQ A;  1T6S A;  1ZLJ A;  2DBB A;  3GFM A;  2EB7 A;  2MA3 A;  2H09 A;  3HRS A;  4OIN F;  3WGI A;  3LQQ A;  3ULQ B;  4HF2 A;  5CVR A;  2RDP A;  2DK5 A;  1R1U A;  2EJR A;  1JHH A;  3K1P A;  2GQQ A;  3GFJ A;  3PFI A;  4NQW A;  3HRM A;  1ZH5 A;  4IRI A;  5E8I A;  1LDK B;  2PG4 A;  4WXC A;  4IJA A;  4P9F A;  2DU9 A;  4BHC A;  3VOD A;  2A5Y B;  5LHH A;  4UV8 A;  1HKQ A;  1FSH A;  4XSZ F;  2R3S A;  4DQ2 A;  2RV8 A;  3O2P E;  1K79 A;  3E5Q A;  2XKP A;  2ESN A;  3KZY A;  3JSP A;  2L01 A;  3SXY A;  3EUH A;  1R00 A;  3GO5 A;  1YIO A;  4HZF A;  1FT9 A;  5L3D A;  2OA4 A;  4F7Z A;  2D45 A;  2GZW A;  2VE8 A;  1RUN A;  2DT5 A;  2FQ3 A;  1FBQ A;  4S04 A;  4BYY A;  1XDU A;  3FZV A;  3HTU A;  3LA7 A;  2FBI A;  4KMF A;  5HVQ C;  1I1G A;  1FOK A;  1D5V A;  1PP7 U;  1REP C;  1WSU A;  1IN5 A;  1G3W A;  3FM5 A;  4LD5 A;  4Q4Z F;  3CUQ B;  4YFX F;  4YII A;  4L0Y B;  2L4A A;  1XSD A;  1S7A A;  4EJV A;  2W24 A;  3LWF A;  5L3F A;  2GA2 A;  2M8E A;  1STZ A;  4P96 A;  5L3C A;  3R60 A;  3BOQ A;  3IWZ A;  4AD9 A;  4LG0 A;  3D0S A;  4L0Z B;  3KP7 A;  5J6X A;  3CJN A;  2ZME B;  4A0Y A;  1YW9 A;  5D4R A;  3DEU A;  2F5C A;  3JAM Z;  3GW2 A;  1BIA A;  4OMY A;  4BNC A;  2NYX A;  2L02 A;  1F9N A;  2R7D A;  3I53 A;  3I54 A;  3KEQ A;  5CLS A;  3LAP A;  2ETH A;  3C3W A;  1U5T A;  1YG2 A;  4G9Y A;  4I98 B;  4B09 A;  4M9S A;  2QBY A;  1YO5 C;  1IN4 A;  1F4K A;  2O3F A;  1FWZ A;  2STT A;  3TDU C;  4WX9 A;  2BE5 F;  1SFX A;  4XRF A;  1PDN C;  4LLN A;  5F6F A;  2VOP A;  3R61 A;  5LRS A;  2IVM A;  1G3Y A;  4U7B A;  4LJZ F;  2IW5 A;  5CVU A;  4HYE A;  1XN7 A;  3IHU A;  2FMY A;  4XLP F;  4RAY A;  3O3K A;  2DAO A;  2QVO A;  1YFH A;  1W7P A;  1XDS A;  1GXP A;  2Z5U A;  3L2C A;  4BHP A;  2HR3 A;  1YS7 A;  1XCV A;  4EGY A;  3R4K A;  3N4M A;  4M71 A;  2KIU A;  5FFX A;  1K6O A;  1IXC A;  3RTR A;  2RNJ A;  1TNS A;  3GLX A;  3KP2 A;  4ESF A;  3IRQ A;  4ASN A;  1QZZ A;  1HBX G;  2OU2 A;  2BGC A;  3GVA A;  4EVI A;  4LK1 F;  2CW0 F;  3V7S A;  2GWR A;  5J8C A;  1R7J A;  3REO A;  3U2R A;  1EV7 A;  1YS6 A;  2KJB A;  4KIB A;  5HLG A;  4ON0 A;  4MTE A;  4RS8 A;  3R0J A;  4O6J A;  2P8T A;  3EET A;  3JAM K;  5ERI A;  2FE3 A;  2VBX A;  4HA8 A;  3GEZ A;  4MHG A;  2DFI A;  1B9N A;  3F21 A;  2FA5 A;  2F5E A;  3U1D A;  3W6K B;  1ZYR F;  4QLC U;  1HXD A;  3ZMV A;  4H0E A;  4RB0 A;  3QPT A;  2VT3 A;  4UVB A;  2V79 A;  3KP6 A;  3VEP A;  4MGR A;  1UHM A;  1AWC A;  3QRF F;  2MC3 A;  2D2W A;  2G7H A;  3CLO A;  1H9G A;  3K1M A;  4G7Z F;  3FXR A;  5DCM B;  1ZRC A;  2A3S A;  3HSF A;  3WTZ A;  3Q5F A;  2QWW A;  4IXA A;  3COA C;  2YX4 A;  3ERE D;  1DDN A;  3T8R A;  2HQN A;  3WTX C;  1FP1 D;  2EFP A;  1JGS A;  4A6D A;  2VOD A;  4XBF A;  4P9U A;  1MJB A;  1TW2 A;  5AIP A;  1Z9C A;  3P7N A;  1W5S A;  2PEX A;  2R7F A;  1P92 A;  5FB2 A;  4U0V A;  2AXL A;  2FBH A;  3V8K A;  1IRG A;  2PFB A;  4KYW A;  3QOP A;  4HLX A;  3RIR A;  3GUD A;  4M9Z A;  5FD5 A;  3J80 Z;  4UXN A;  1K78 A;  4RB1 A;  3IC7 A;  4HW0 A;  2UZK A;  1KQ0 A;  3ZN0 A;  1USS A;  3ROU A;  1S6L A;  3F8F A;  1XSV A;  1IZ1 A;  4RGU A;  4I2O A;  1ZN2 A;  2XAJ A;  4Y15 A;  3FXQ A;  5IT9 Z;  4QWQ A;  4U0Y A;  2FRH A;  4KDP A;  3ISP A;  3OOP A;  2A61 A;  4AIJ A;  1LEA A;  3KP4 A;  4EM0 B;  2K02 A;  3BJ6 A;  4LB5 A;  2HKX A;  2TDX A;  2W25 A;  2HWV A;  2J5P A;  5D8L B;  3CUO A;  1J9I A;  4ZYH A;  4ZYG A;  1O3T A;  1FYK A;  1OYY A;  1TW3 A;  5JR3 A;  3OV8 A;  1KU7 A;  1CGP A;  1BIB A;  2LSO A;  1X3U A;  5AIQ A;  2IP2 A;  1XSX A;  3LFK A;  2P5L C;  2L3D A;  4RGX A;  2CQK A;  1BOA A;  4CO8 A;  3LQR A;  2O8X A;  2YPR A;  2EK5 A;  5TJJ A;  1T98 A;  1J7K A;  1DPU A;  2D1V A;  1ZLK A;  2FXA A;  4M6Y A;  2Z33 A;  1HW1 A;  2VN2 A;  3HIF A;  2FNA A;  3V7C A;  1O3S A;  3EDP A;  2FSW A;  4R79 A;  4CHU A;  4ENN A;  1IW7 F;  4OMZ A;  2LKP A;  4BH9 A;  3VB2 A;  2FEZ A;  3AAF A;  2FML A;  3RYR A;  3E5U A;  4CZZ A;  3BPX A;  1MJ9 A;  3J80 K;  3ECH A;  3IL2 A;  4MTD A;  1V3F A;  2GXG A;  2BV6 A;  1SFE A;  1UB9 A;  3M9A A;  3QP5 A;  1FLI A;  3FMQ A;  3QPH A;  3P9I A;  2RKH A;  1E2X A;  3WTV C;  5D5U B;  1O3Q A;  1T39 A;  3MZH A;  5D5X B;  3ZMT A;  3PQK A;  5IT9 K;  1S8N A;  2JRT A;  3MQ0 A;  1UFM A;  3GZ5 A;  1HQC A;  2M5W A;  2KRF A;  2ZKZ A;  2OZU A;  3FXU A;  1CF7 B;  1IN7 A;  2A68 F;  3I58 A;  5HDK A;  2IA0 A;  3L9F A;  2A07 F;  1XD7 A;  4EM2 A;  2X4H A;  5LHI A;  4WCG A;  1T0F A;  2XRN A;  5DDG A;  4IRH A;  4A0X A;  4LFU A;  5HOO A;  4CXF A;  1B9M A;  1JXS A;  4UUV A;  5CJ9 A;  3QP6 A;  3E6M A;  3BWG A;  1BI1 A;  3TO6 A;  1BBY A;  2BBY A;  3PQJ A;  5JVT A;  4A2U A;  5D6F A;  4U0W A;  3QU6 A;  3P9K A;  1QGP A;  3B02 A;  2DO7 A;  1SD4 A;  1ZGA A;  2V9V A;  1U2W A;  4HF1 A;  5JHU A;  2WC2 A;  5ED4 A;  4D0P A;  1W5T A;  1F1Z A;  3MWM A;  4GYI A;  2NNN A;  3R6S A;  1EH7 A;  2P6T A;  1KU9 A;  2HDC A;  1R36 A;  4RAZ A;  2DK8 A;  5LGN A;  1FP2 A;  1SAX A;  3MZY A;  4LMY A;  2XAS A;  4EMS A;  2ZNY A;  5K1Y A;  1FZP B;  3I0T A;  3SZT A;  1RNL A;  2HS5 A;  3FM3 A;  3K2Z A;  3DPL C;  4WXD A;  3KE2 A;  4L9V A;  1UST A;  2QQA A;  1S29 A;  4M72 A;  2PMH A;  1ODD A;  4Q48 A;  1LB2 A;  1I5Z A;  1XMK A;  1LDD A;  1XGN A;  2Z99 A;  5ILU A;  4L9T A;  3S2W A;  4U88 A;  4KIC A;  3KET A;  4EJT A;  3HSR A;  3MCZ A;  4S05 A;  2CG4 A;  4P5O A;  3W6J B;  1E17 A;  2FU4 A;  3LA2 A;  1SFU A;  3CUQ C;  3RKX A;  2KKO A;  2Y48 A;  5FLX Z;  1Y0U A;  1O3R A;  4G94 A;  3FX3 A;  2RC4 A;  3V4G A;  1BI3 A;  2UWM A;  5LLQ A;  2CYY A;  3FMR A;  4OOI A;  3ZQ7 A;  3WE2 A;  1R5G A;  2MH2 A;  2E7W A;  5CVJ A;  4JBA A;  1G4D A;  5LEJ A;  2V1U A;  3KFW X;  4KFC A;  5AON A;  1KQ8 A;  3RYP A;  2QYO A;  2XV4 S;  2IPQ X;  2OQR A;  1KGS A;  4OU0 A;  2Q0O A;  2OAZ A;  1W4M A;  3VOE A;  5KVR A;  1KA8 A;  2NRA C;  2IA2 A;  2F2E A;  3F8M A;  2Q2E A;  3T5X A;  5BMZ A;  2ZBK A;  2XAH A;  3D5L A;  3HUG A;  3ZMZ A;  4A6E A;  2CGP A;  2KJC A;  1S7O A;  5K5Q A;  4AVP A;  2VBW A;  4ZZD A;  1B59 A;  1ZRF A;  1TBX A;  2HQR A;  5BS6 A;  4LLL A;  1G6N A;  5DCM A;  3K1N A;  4G8X A;  5ICG A;  2HYF A;  4L5J A;  2ACJ A;  4GGG A;  4MQV A;  2KIF A;  2K86 A;  1TLH B;  4HX8 A;  3IKT A;  1WQ2 A;  4KUM A;  3F3X A;  3C1D A;  2EA2 A;  1ZG1 A;  4LLG F;  5HS9 A;  1MDM A;  3WTT C;  5D5V B;  1OYI A;  1EH8 A;  4GXO A;  3F8C A;  2ADU A;  3BJO A;  1U3E M;  2OBP A;  4I0B A;  4E70 A;  2OD5 A;  3GXO A;  2JPC A;  1ZG3 A;  4HAM A;  3F8B A;  1V4R A;  1QQI A;  4LG0 B;  3BZ6 A;  3BJA A;  5LEK A;  2P7V B;  2QQB A;  3L7W A;  4NB5 A;  3VFZ A;  2B0L A;  2OZ6 A;  2RQP A;  4DNC A;  2O03 A;  3T1B A;  4R1H A;  3HTS B;  2QM3 A;  4KT5 C;  2M1B A;  3IWF A;  1L0O C;  4HLY A;  3FWE A;  1J2X A;  3I64 A;  4BXU A;  1U5T B;  1D8J A;  1LDJ A;  1IRF A;  3I59 B;  2QZ8 A;  2QBY B;  2COM A;  2X0L A;  1PUE E;  1KU2 A;  2A69 F;  1T38 A;  4L5I A;  2HYG D;  2NAZ A;  4RB2 C;  2PI0 A;  2XKO A;  2F5D A;  1KQ9 A;  1FC3 A;  2DPU A;  5JFR A;  3L00 A;  4LK0 F;  1HSJ A;  3KP5 A;  4NHJ A;  3K9T A;  4I02 A;  2WTE A;  3B73 A;  1Z6T A;  4P55 A;  3G3Z A;  1W7P B;  2EFQ A;  5HDG A;  2EFN A;  1OPC A;  4EGZ A;  3WG9 A;  1R1T A;  3KZZ A;  3DFG A;  3H92 A;  3I5U A;  1TQM A;  3N97 A;  2YU3 A;  1L3L A;  3ZMD A;  1OR7 A;  2W84 A;  1FYL A;  4A5M A;  1FPQ A;  2G9W A;  3Q9S A;  4I7H A;  4YIF A;  1T2K A;  5L3G A;  3RKW A;  1YTY A;  2E1N A;  3DKW A;  4KN4 X;  4RGS A;  4YG2 F;  1YQA A;  2DW4 A;  2MH9 A;  4G6Q A;  5DUK A;  2HKO A;  5JI6 A;  1U78 A;  3ABU A;  5ICF A;  3GWZ A;  4EQQ A;  3HHG A;  3I71 A;  4L9N A;  2JZY A;  3KP3 A;  3CTA A;  1HKT A;  4WWC A;  4O5V A;  2XVC A;  4PCQ A;  1ZAR A;  1TQP A;  5E17 F;  1F5T A;  3F72 A;  5D8K B;  2DI3 A;  1ON1 A;  3EQL F;  2L54 A;  3ELK A;  2UXN A;  5H20 A;  1XGM A;  2XAG A;  3M8E A;  2VT2 A;  4G6D A;  1ZHF A;  5LRR A;  1I27 A;  1R58 A;  1ZRE A;  4CDG A;  4Y13 A;  5IT3 A;  2MLG A;  1H9T A;  1CF7 A;  3JSO A;  1R1V A;  1ZGJ A;  2VE9 A;  4KMU X;  2F5F A;  1LJ9 A;  5H6R A;  2HEO A;  4Y17 A;  2A6H F;  4EJO A;  2ZCW A;  2IT0 A;  5F1R A;  1P2F A;  2H27 A;  4RGR A;  4AIH A;  2DQL A;  3M8F A;  3C18 A;  2ISY A;  5J8F A;  5TRD A;  3BPV A;  2H94 A;  2DLL A;  5E1Z B;  3ZPL A;  4HOB A;  1YW8 A;  5ICE A;  4UNO A;  5HS8 A;  3NQO A;  4L9J A;  3TDZ C;  2MLK A;  2YSR A;  2GA1 A;  4PGH A;  2XUB A;  1O57 A;  1P4A A;  3SQN A;  4CGZ A;  1UHW A;  1WWX A;  1QZY A;  1RZ4 A;  2QUF A;  1XB4 A;  5EEG A;  4HBL A;  1DUX C;  1LVA A;  2EA4 A;  4EJW A;  1K78 B;  3V7R A;  4XSX F;  1FNN A;  3QAH A;  3TOA A;  3E5X A;  3MAJ A;  3ZP5 A;  5DUI A;  3F6O A;  2DTR A;  1ON2 A;  2P6S A;  4OIO F;  1O7L A;  2YX7 A;  2MBF A;  1BI0 A;  1R22 A;  2V1D A;  1IN8 A;  3L09 A; 
#chains in the Genus database with same CATH topology
 2MD5 A;  1H0M A;  4MNU A;  4XKB A;  5DV5 A;  1SD7 A;  3GX4 X;  3RJP A;  4EV0 A;  5DS9 A;  1Z91 A;  2M2E A;  5D6E A;  1JUP A;  2RRE A;  1XGS A;  4GRI A;  2OQG A;  4JQF A;  5GTI C;  4FX4 A;  4HQM A;  1K7A A;  1J75 A;  1I1S A;  3CUQ A;  2HOE A;  2FBK A;  3CDI A;  2XHK A;  3JTG A;  1VTN C;  3TOB A;  2Y75 A;  2W57 A;  3VYS B;  1PP8 F;  1BJA A;  2VOO A;  5FO5 A;  5B3S H;  4IL6 C;  1SMT A;  2G0E A;  2DT7 B;  2VKD A;  2JT1 A;  3BG6 A;  1HCR A;  2L9S A;  4CUG A;  4CCK A;  1APL C;  3C7J A;  2P4W A;  1AOY A;  5IYC J;  2R7R A;  4ZJZ A;  3LMM A;  3CO6 C;  2AS5 F;  2LDU A;  2IS4 A;  1SMY F;  3DPU A;  2KDO A;  4E7J A;  4IF4 A;  2WV0 A;  3K69 A;  2LMD A;  2ZME A;  2Y0M A;  5EYR A;  4B47 A;  3FHZ A;  3E3V A;  4ZTJ A;  1R4N B;  3CO7 C;  1P7J A;  3CCU I;  4HQE A;  2PMU A;  3K2A A;  1G3S A;  2IAI A;  1PUF B;  2X6O A;  2RGV A;  3E6B A;  1V5E A;  2BY2 A;  2GXB A;  2R7U A;  3DF8 A;  2IJL A;  1I3A A;  1Q1H A;  2PLY A;  1FSE A;  4ESJ A;  1KON A;  3JCU C;  4KIG A;  4ZC3 A;  3DPT A;  2R7Q A;  5HNF A;  2DOD A;  3ECO A;  1I6X A;  3HJE A;  4RAF A;  2IS6 A;  3ZGK A;  3N05 A;  1G3T A;  2ZSI B;  2CO5 A;  3A01 B;  1J59 A;  5J3L A;  3OYH A;  1OCC H;  4MLO A;  1OIS A;  3OSF A;  5HS7 A;  5DD4 A;  4PJL A;  3W2W A;  5IP9 J;  1GVJ A;  4XLH A;  3DLA A;  2ELJ A;  5K7Z A;  1FBS A;  2ESH A;  1GT0 C;  4KN7 X;  4K2E A;  2K4B A;  1IRZ A;  2VC0 A;  3H1C A;  3QPL A;  4BJT A;  1YW7 A;  2X1E A;  4HX4 A;  1WRJ A;  3WTY C;  4G7H F;  3RDI A;  2LTP A;  2DOA A;  3Q9V A;  1IF1 A;  1OCP A;  2DXI A;  2KFD A;  3PM1 A;  4RB3 C;  3F0C A;  2M4G A;  1C0W A;  3OYN A;  5K7F A;  5HDN A;  1BN5 A;  1FY7 A;  1VQ6 I;  2G7U A;  4TV7 A;  4A3F J;  1YYV A;  4OIR F;  4ZYE A;  3H9G A;  4IKF A;  3WTS C;  2HOT A;  2KQR A;  1FJL A;  3OOU A;  1U8R A;  3MEX A;  1QZE A;  5E20 A;  4KNY A;  5FFZ A;  2D1H A;  4XKC A;  1JUM A;  1LNW A;  3IV5 A;  1VQL I;  3ML6 A;  2LYC A;  2VJ4 A;  2VPL A;  1I50 J;  4A3M J;  1DP7 P;  2EIM H;  2O5R A;  1Z6R A;  5E3N A;  5LHG A;  1BM9 A;  5DD8 A;  4IHT A;  2EBI A;  4W1U A;  3J81 Z;  5EZH A;  3HG9 A;  3EYI A;  3K0L A;  3K4L A;  4DBQ A;  4CYC A;  2VBZ A;  2O0Y A;  2RN7 A;  3LL7 A;  1GXQ A;  3CP8 A;  2WWY A;  4C3I J;  4ETS A;  1MGT A;  1P6R A;  3G73 A;  5ILS A;  3TQN A;  4HST A;  3CC4 I;  4N0B A;  2ELH A;  2XAF A;  1MMD A;  3FF5 A;  5F64 A;  5K5O A;  4YFN F;  3G71 I;  1X58 A;  1VQ8 I;  2STW A;  2P5V A;  5FKK A;  4PGG A;  3WOD F;  4BHB A;  4RAG A;  2EPF A;  3RPU A;  2Z9O A;  5CVI A;  1NH3 A;  1ONV A;  2VXZ A;  1XGO A;  2L7Z A;  3RKY A;  2GOM A;  2CU7 A;  3LAJ A;  3M7G A;  5FKL A;  3WGH A;  2ISZ A;  5A2Q Z;  1YX5 A;  3FK7 A;  3HOY J;  4A3G J;  2ZXJ A;  3ABT A;  4IHW A;  2P81 A;  4WF2 A;  2QSH X;  3HXL A;  2AO9 A;  4C30 A;  1K4T A;  3GBG A;  4M9X A;  2NS0 A;  1DU6 A;  4M6X A;  5E79 C;  1MZB A;  4NQW B;  1JUS A;  1FBU A;  2VJI A;  1WKM A;  4HDU A;  5J1U A;  1T56 A;  3HKZ A;  2DT6 A;  4BE0 A;  1RES A;  3K4J A;  5L3B A;  2P0W A;  2QEX I;  1OCZ H;  3E97 A;  5DCF A;  1MBE A;  3DBL B;  2FUG 2;  3L2W A;  5LFA A;  2CJJ A;  2ID3 A;  4MEY F;  2OCE A;  2EV6 A;  1UCR A;  3WU2 C;  2EZH A;  3ZMU A;  3VYR B;  3E6D A;  5KK1 A;  5BOX A;  2E60 A;  4UHT A;  4FHT A;  4XR6 A;  3U9G A;  1EH6 A;  3A03 A;  3PIP F;  3MN2 A;  3DP7 A;  5GP9 A;  5GPA A;  3I59 A;  2R93 J;  2WAQ N;  1TQI A;  3AL0 C;  2F4M B;  3CZ6 A;  2HGC A;  3F23 A;  3S14 J;  4W97 A;  1RRJ A;  1N78 A;  4I09 A;  1BC8 C;  1OMI A;  1QO0 D;  1HOM A;  2XF6 A;  1EJ9 A;  3I3L A;  3HOT A;  3BY6 A;  5F04 A;  1MIJ A;  2CH0 A;  3HHH A;  2IA1 A;  4PJM A;  4LB6 B;  3UKG A;  3M4O J;  1GVD A;  2ZFW A;  5DYM A;  3F8N A;  4EM1 A;  5CQG A;  4CCO A;  1DPR A;  5EG0 A;  1E3P A;  1JT6 A;  3HRT A;  3TO9 A;  4FX0 A;  2VUM J;  3KLN A;  2O61 A;  5EJC A;  2BYV E;  4FE7 A;  3PUF A;  1U9O A;  3QYF A;  1I3Q J;  2XGD A;  2BZT A;  3EUH C;  2V1X A;  4ITV A;  4Y7N J;  2DJI A;  5CYV A;  5H6Q A;  4GDF A;  3OR2 C;  2FNP A;  4OIP F;  3GTO J;  2NXN B;  2ZNZ A;  1T33 A;  1UEL B;  1LFU P;  4BDY A;  5L3E A;  3GFI A;  4N9I A;  3OSG A;  1UG2 A;  1WCM J;  2HTS A;  3OIQ A;  5FGM A;  2ZJ2 A;  2JSC A;  3E6C C;  5DM7 F;  1BC7 C;  2IS2 A;  1MW7 A;  4IHS A;  3BLY A;  4UVA A;  2PBI A;  4KJZ A;  1MMG A;  1X2M A;  2XAQ A;  4IHY A;  2OJE D;  4YFK F;  4AU7 A;  2XSJ C;  3CCR I;  3TMO A;  4M73 A;  1FMV A;  4CCN A;  5E1X A;  2Z3Y A;  2D5V A;  5GAE J;  5J4Y A;  3J81 K;  2HNH A;  1S7E A;  4FTH A;  3TO7 A;  3CF2 A;  2O6G E;  2EV0 A;  2XGX A;  1ETV A;  2WB1 A;  1ZG5 A;  4V2F A;  2NVQ J;  1YRN A;  1DGW Y;  2E1C A;  3ZN1 A;  4BUP A;  3NAR A;  2K9L A;  2X48 A;  4ENM A;  4IRG A;  3SEZ A;  1MJA A;  4AWX B;  3DU6 A;  3DTE A;  4HF0 A;  4A3E J;  1MBJ A;  1Y1W J;  1OJL A;  1KYZ A;  2QQ9 A;  4MFE A;  3KLO A;  1D0Z A;  5A2Q K;  2CUE A;  5FLX K;  3JRC A;  1MKM A;  1XS9 A;  3PO2 J;  3H5R A;  2CS3 A;  1FX7 A;  3MKZ A;  2PN6 A;  4JK1 X;  1QA6 A;  1D1A A;  3ZQL A;  1S3J A;  2IGO A;  1V5F A;  3HL2 A;  3JW4 A;  1WJC A;  4CYD A;  4FQG A;  2I10 A;  4Q47 A;  3K4M A;  4QPQ A;  3O6B B;  2QSF X;  3DQV C;  1V55 H;  1RIO H;  1A04 A;  1B4A A;  3BG9 A;  3GFL A;  4Q5S F;  1QNT A;  4CZC A;  2VON A;  1D8K A;  4HNV A;  3WE3 A;  2JUC A;  3V8J A;  3GTG J;  5BQT A;  4Y4R A;  2CFX A;  2M45 A;  1KU3 A;  1X1C A;  2R7W A;  3ZMS A;  2EV5 A;  5K5R A;  4Y33 A;  1R5H A;  3CF5 F;  3SJM A;  3IKV A;  1ZEL A;  5BPD A;  3WGG A;  3CLQ A;  2LD5 A;  2FOK A;  4Z6Y A;  1QBJ A;  1U5T C;  3WU0 A;  1QU3 A;  1IXR C;  1HKS A;  2QLZ A;  1U6G A;  2XRO A;  5GTH C;  2X9D A;  2WAE A;  5IP6 A;  3F6V A;  3TGN A;  1HST A;  2J5O A;  2KPM A;  1MNM C;  3C2H A;  4BQA A;  4I01 A;  1MD0 A;  3T0Y A;  2EWN A;  5BPI A;  4KIF A;  4GCV A;  2EH3 A;  2KRC A;  4UUT A;  3OYB A;  2V4J C;  5FRM A;  1FOY A;  2EZK A;  2FF4 A;  4HDV A;  3T8T A;  4M74 A;  3HOV J;  2CUZ A;  3CCV I;  3WTW C;  2LKX A;  3HGG A;  1RI7 A;  4G7O F;  2CWE A;  2BVM A;  3WTU C;  3MFK A;  1YLF A;  4XOR A;  2W7N A;  3CMY A;  5E18 F;  2Y31 A;  1HW5 A;  4N9H A;  1TTY A;  4L18 B;  2K7L A;  1TL8 A;  1Z21 A;  2XPU A;  1BL0 A;  3R0A A;  2VL8 A;  3MVP A;  2L9V A;  1X1D A;  1ETK A;  1SVO A;  2C6Y A;  4HNT A;  2I8D A;  1RR7 A;  5IYD J;  2JTV A;  2YUS A;  5FD6 A;  3BRO A;  3WU1 B;  4ESB A;  2E7X A;  1ULY A;  4BE1 A;  1YIJ I;  3OYF A;  3M1E A;  2WAD A;  1IAW A;  3JRE A;  1NHA A;  1ZR2 A;  1GUU A;  3WG7 H;  2ZO4 A;  4IVN A;  2BEO A;  2Q8K A;  3J7Y J;  4D1Q A;  4F3Q A;  4IOC F;  4XKV A;  1TNT A;  4A5N A;  2H6B A;  4B8X A;  4UB8 C;  5ILV A;  3SZP A;  4WK8 F;  1MDM B;  4F93 B;  2CUF A;  5LGU A;  3NRV A;  3SFI A;  2MD0 A;  2XF7 A;  5M5X J;  1XCB A;  2GOX B;  2E35 A;  2JWT A;  4E7Z A;  3M3Y J;  3FIW A;  3VYU B;  4D7N A;  2HPM A;  4IZZ A;  2EFO A;  1OCR H;  4GO1 A;  4I0A A;  1VND A;  3ESW B;  4C2T A;  4MFD A;  1UAA A;  4JX5 A;  3DXJ F;  5HLT A;  1TZL A;  1WJ5 A;  5DEQ A;  4D9J A;  4F91 B;  3EYY A;  1YIT I;  3W2A A;  1FOX A;  3BP8 A;  3JTH A;  1JKP C;  5D4S A;  2W85 A;  2CFO A;  4BKX A;  2VQL A;  3V8L A;  5GAG J;  2FX0 A;  2IBD A;  3KCC A;  4UV9 A;  4YRV A;  1S9H A;  3IAS 2;  4ZYD A;  3IRR A;  3MMY B;  5EEH A;  1XMA A;  3H3Z A;  1HW2 A;  2NNY A;  5HLH A;  3HOS A;  5ICC A;  2K27 A;  2DMQ A;  3CMA I;  2DPD A;  4XLN F;  4N4O B;  2KIM A;  2LF8 A;  3HOX J;  2WV1 A;  2KZV A;  3LST A;  1O7F A;  2MFZ A;  2LF7 A;  4UVC A;  5HOD A;  9ANT A;  1LEB A;  4XL9 A;  2KLO A;  2UXX A;  4PZJ A;  4A3B J;  1SFK A;  4ZZL A;  1ZKG A;  4AUX A;  2M8G X;  3TKY A;  2COB A;  3RI4 A;  2LFB A;  3I4P A;  2A6E F;  3HRU A;  1OCO H;  2W48 A;  4A12 A;  1ZGW A;  3BR1 A;  1SD6 A;  2LR8 A;  4M6V A;  4XOP A;  2RVC A;  4IPA A;  3UR3 C;  2R7V A;  3NWT A;  5EGO B;  4U7D A;  1ETW A;  4ENJ A;  1OKR A;  3SHF A;  3CJT B;  4MEX F;  2M7A A;  2DDB A;  3ERM A;  2DA2 A;  2V26 A;  2ME0 A;  1IRX A;  4QTR A;  1ZAO A;  2M0M A;  3LSG A;  4DBR A;  5B5E C;  3GYH X;  1IC8 A;  1LQ1 A;  4WXH A;  3DV8 A;  4NNJ A;  3HYI A;  5D5W B;  2L4M A;  4IEJ A;  2LP0 A;  1RPW A;  3E1S A;  1QPM A;  4OIQ F;  4MQ9 F;  2DA5 A;  4GYG A;  1D5Y A;  1ZRD A;  2HFH A;  1SAU A;  3P9C A;  4FT8 A;  3I4N J;  2JVH A;  3U1K A;  4A93 J;  3HSE A;  3RPQ A;  4O3M A;  5CVV A;  3RQI A;  1WFX A;  2LNB A;  3BG7 A;  4IQ4 A;  2IRF G;  1Z7U A;  1PVE A;  2HZT A;  1SD5 A;  1RKW A;  2OC6 A;  3KYD B;  4CCJ A;  1BI2 A;  1IN6 A;  4RM2 A;  3OY9 A;  3CES A;  4HV6 A;  3MKY B;  2CUJ A;  3H35 A;  2HVR A;  2VC1 A;  3FMS A;  4PJJ A;  3BDD A;  1K83 J;  3GF2 A;  3F22 A;  2LKS A;  5HLI A;  1PUF A;  3J7A O;  3QU3 A;  1VQO I;  2M87 A;  5J40 A;  3QPS A;  4KA4 A;  2M30 A;  2JK3 A;  3W3C A;  5JLW A;  1D1C A;  1P4X A;  2DFE A;  1D3Y A;  2RQQ A;  3HBL A;  1WH7 A;  4Z2Y A;  4ZH4 F;  1FYM A;  1F43 A;  2WAQ A;  4XN3 A;  1R6R A;  2OCC H;  3GZ6 A;  1VF9 A;  1BW6 A;  2GXA A;  2DQR A;  1B72 B;  3SDG A;  2CSO A;  1P4W A;  1FIP A;  4XRS A;  2EFW A;  1W7P D;  4B4C A;  3G2B A;  4BAY A;  1J0R A;  1Z05 A;  2X6Y A;  2OPT A;  3S32 A;  2XIG A;  1B1B A;  4A0Z A;  1JE8 A;  3SFZ A;  2VBY A;  2DOF A;  2ZSH B;  1RUO A;  4XON A;  4LGW A;  2LH9 A;  2DFH A;  3CCE I;  1HDD C;  5E1W A;  2PQ8 A;  4HV5 A;  1Z0X A;  4B3A A;  3LSI A;  1IXS B;  4H4K C;  3CDH A;  1JHF A;  4EJU A;  4AVZ A;  2V6C A;  2XGE A;  3CCM I;  1R23 A;  4AIK A;  3ONQ A;  4F92 B;  1Z67 A;  3LSM A;  2JA5 J;  1ACI A;  5IYB J;  4ENK A;  2GAU A;  1OYW A;  1VI0 A;  3LA3 A;  4HX7 A;  4R8H A;  2HTJ A;  4LG3 A;  4PDK A;  4RLQ A;  5F0H A;  2P7C B;  2YR2 A;  1KYW A;  2P5K A;  3KEO A;  1Y8R B;  1IUY A;  2DTZ A;  3NEU A;  4M3B A;  1SVL A;  3H3U A;  3VWB A;  6PAX A;  1K4S A;  1J5Y A;  2GIV A;  4CIC A;  2H6C A;  3FKJ A;  1GHC A;  5LGT A;  2PJP A;  4XM3 A;  2K4J A;  5E8G A;  3OYM A;  5J1R A;  1HLV A;  2N8G A;  1WI9 A;  2QEN A;  1Z1D A;  3JRA A;  1B6A A;  1DU0 A;  2JPB A;  5LBQ A;  4PFP A;  2CQN A;  4D5F A;  1T6S A;  1ZLJ A;  4XLF A;  1B8I B;  1WGX A;  4B48 A;  2XGC A;  2DBB A;  2XPW A;  3GFM A;  4ZDP A;  2E2H J;  5IOY A;  2EB7 A;  2MA3 A;  3F9K A;  2JA2 A;  2H09 A;  2IGN A;  3L2U A;  3HRS A;  2X85 A;  3LSH A;  4OIN F;  3WGI A;  3LQQ A;  3FK6 A;  1AKH A;  3ULQ B;  2L9N A;  3DBH B;  4HF2 A;  3PSF A;  5CVR A;  4BQN A;  2X1C A;  1IUF A;  3DLL F;  2CRG A;  2RDP A;  1YHQ I;  2DK5 A;  1R1U A;  1ZQ3 P;  1LFB A;  3LNQ A;  2ICW G;  1VQN I;  2EJR A;  3TP3 A;  1JHH A;  1LFP A;  3KYL A;  5FLM J;  1T8I A;  3K1P A;  2X51 A;  2XAU A;  2GQQ A;  3GFJ A;  3PFI A;  4NQW A;  3HRM A;  1ZH5 A;  4BS9 A;  4IRI A;  5E8I A;  2O7O A;  4BXX J;  3FHN A;  1LDK B;  2PG4 A;  2VPR A;  4WXC A;  4IJA A;  4P9F A;  4IHV A;  5JHF A;  2DU9 A;  2LY2 A;  4BHC A;  3L2V A;  3VOD A;  2A5Y B;  5LHH A;  4UV8 A;  4EAT A;  3BR5 A;  1BOB A;  1HKQ A;  1FSH A;  4XSZ F;  2R3S A;  4DQ2 A;  2R5Z A;  1XX5 A;  2RV8 A;  1JJ6 C;  3O2P E;  2JSP A;  1K79 A;  3E5Q A;  2XKP A;  4DJA A;  3G6E I;  1NTC A;  3S1R J;  4M3E A;  3CJQ B;  4C3J J;  2ESN A;  4ANJ A;  3HOZ J;  3KZY A;  2Y9Z A;  2F4I A;  3JSP A;  1QVT A;  1JKQ C;  2L01 A;  3SXY A;  3EUH A;  1R00 A;  3BR2 A;  3GO5 A;  1YIO A;  4HZF A;  1FT9 A;  3ABK H;  5L3D A;  5KHD A;  4A3I J;  2OA4 A;  4F7Z A;  2D45 A;  2CQX A;  1MSE C;  3Q3S A;  4M3G A;  2GZW A;  2VE8 A;  4BL0 B;  3DU5 A;  1NK2 P;  1RUN A;  5BNG A;  2DT5 A;  2RNG A;  1IDZ A;  3IP4 B;  2FQ3 A;  1G59 A;  3VSK A;  1FBQ A;  3BZC A;  4S04 A;  3I56 I;  4DGW B;  4BYY A;  3VDX A;  4XQF A;  2I5U A;  1XDU A;  3FZV A;  3HTU A;  3LA7 A;  2KP6 A;  3ASN H;  2FBI A;  4KMF A;  2W82 A;  4BQO A;  3TED A;  3Q0U A;  1I1G A;  5HVQ C;  1FOK A;  3G4S I;  1D5V A;  1PP7 U;  5C4X J;  1REP C;  1WSU A;  1MBF A;  1IN5 A;  3Q0W A;  1G3W A;  3FM5 A;  4LD5 A;  3S93 A;  4Q4Z F;  1JJ8 C;  3S3N A;  1MND A;  3GME A;  3CUQ B;  1SEU A;  3AKZ A;  2H8W A;  4YFX F;  4YII A;  4L0Y B;  3GCM A;  2HOS A;  1XG1 A;  1ERD A;  2L4A A;  1XSD A;  2WBM A;  1G8X A;  2R0Q C;  2Y0S A;  1S7A A;  1VZ0 A;  4EJV A;  2W24 A;  3LWF A;  1IDY A;  5L3F A;  2GA2 A;  2M8E A;  1STZ A;  4P96 A;  5L3C A;  3OYJ A;  3R60 A;  3BOQ A;  1A35 A;  1X3Z B;  3IWZ A;  4AD9 A;  4LG0 A;  1FIA A;  3D0S A;  3PNV A;  3K4N A;  3KP7 A;  4L0Z B;  2LY1 A;  5J6X A;  3CJN A;  3SYT A;  2R5Y A;  2ZME B;  4A0Y A;  1YW9 A;  3FXO A;  3QYE A;  3OIP A;  1H88 C;  5D4R A;  3DEU A;  2F5C A;  1T0F C;  3JAM Z;  2Z1D A;  1BIA A;  3GW2 A;  4OMY A;  1A31 A;  4BNC A;  2NYX A;  3BR6 A;  1S72 I;  2L02 A;  1F9N A;  2R7D A;  3I53 A;  4BXF A;  3OYG A;  4KT6 A;  1H89 C;  2OF7 A;  3I54 A;  3KEQ A;  5CLS A;  4HNU A;  3LAP A;  3VSL A;  2ETH A;  3O8G A;  5M3F J;  4ABZ A;  3C3W A;  1U5T A;  1JKR C;  1YG2 A;  1E3H A;  4G9Y A;  1I39 A;  2DJN A;  4I98 B;  4BEH B;  4B09 A;  4D7M A;  2JN6 A;  4M9S A;  1JT0 A;  2RAE A;  2QBY A;  1FTZ A;  1YO5 C;  4C9Y A;  1IN4 A;  1F4K A;  5GAD J;  1N77 A;  1MBK A;  2O3F A;  4LIT A;  1X2N A;  1FWZ A;  5JLX A;  3TP0 A;  3CME I;  1XC5 A;  3CCY A;  4OWR B;  4AC0 A;  2STT A;  2JA7 J;  3PIO F;  3TDU C;  4WX9 A;  2BE5 F;  4DOZ A;  3LOC A;  1SFX A;  2ZC2 A;  2BY3 A;  4XRF A;  2LOO A;  3ABL H;  3BTC A;  3PL8 A;  1PDN C;  5HNH A;  3MZ8 A;  3M1C A;  4LLN A;  5F6F A;  3JRD A;  5JVG F;  2PJR A;  2VOP A;  3R61 A;  5LRS A;  4UUS A;  2IVM A;  1G3Y A;  4U7B A;  4LJZ F;  2IW5 A;  5CVU A;  1DP3 A;  2DFF A;  4HYE A;  2HI3 A;  2XRL A;  4A69 C;  1XN7 A;  3IHU A;  2ECC A;  4X1E A;  2FMY A;  4XLP F;  3RZD J;  1X1P A;  2VI6 A;  4RAY A;  3O3K A;  1AHD P;  2DAO A;  2E5Z A;  1QVU A;  1X1A A;  2ZXI A;  2QVO A;  1UJ8 A;  1YFH A;  1W7P A;  1XDS A;  1CQT A;  2E36 A;  4XKW A;  1GXP A;  3DTI A;  1WJB A;  4ZDO A;  2Z5U A;  3L2C A;  2IGM A;  2JQ7 A;  4E4H A;  1VQ9 I;  4BHP A;  2HR3 A;  4LIV A;  2TRT A;  2DYR H;  1VQP I;  1GV2 A;  2M9H A;  1YJ9 I;  3HPH A;  4J01 A;  4BQQ A;  1YS7 A;  1XCV A;  1R49 A;  5FRN A;  1LKX A;  2E2J J;  4Y52 J;  4EGY A;  3R4K A;  3N4M A;  3SDB A;  4M71 A;  1MSF C;  2KIU A;  3RKQ A;  1GDT A;  1U9N A;  3ZQC A;  1WJE A;  5FFX A;  2NOG A;  1K6O A;  1TT0 A;  1IXC A;  3IH3 A;  3RTR A;  2RNJ A;  1BR4 A;  3MKW B;  1TNS A;  2NOJ B;  2F48 A;  3GLX A;  3KP2 A;  4ESF A;  3IRQ A;  2DA3 A;  4ASN A;  1QZZ A;  2AXT C;  2BW3 B;  3GTL J;  1HBX G;  4G12 A;  2DMU A;  2OU2 A;  2BGC A;  3GVA A;  4EVI A;  4LK1 F;  3BC8 A;  5K7H A;  2CW0 F;  3V7S A;  2GWR A;  3BQY A;  5J8C A;  1R7J A;  2VAS A;  4HPQ A;  4XOT A;  3REO A;  3U2R A;  1EV7 A;  1YS6 A;  1Z3X A;  2KJB A;  4KIB A;  2KL4 A;  2V9P A;  4CSW A;  5HLG A;  1X4P A;  4ON0 A;  3I9V 2;  4BY1 J;  1P7I A;  4C2U A;  4MTE A;  2LK2 A;  3EUK L;  3GTJ J;  1VQK I;  2HU9 A;  3CC7 I;  3AG4 H;  1IV8 A;  4A3K J;  4RS8 A;  5FKO A;  3RCO A;  1K6Y A;  3R0J A;  4DZJ A;  5IOZ A;  4O6J A;  2VQG A;  1GLN A;  2P8T A;  4C2M J;  3E0J B;  3LSK A;  3EET A;  3JAM K;  3FKI J;  1F36 A;  5ERI A;  2FE3 A;  2QCO A;  2VBX A;  2X6X A;  2NVT J;  4ZTF A;  4HA8 A;  3GEZ A;  4MHG A;  2DFI A;  1ORK A;  3GLL A;  2ZFU A;  4OAY A;  1B9N A;  1EF4 A;  3H5A A;  3ZCO A;  5KAF C;  3F21 A;  2FA5 A;  4E6K G;  2F5E A;  2Q2E B;  3U1D A;  3W6K B;  1ZYR F;  4QLC U;  5F08 A;  3M8J A;  2VJ5 A;  3HUG B;  1HXD A;  3ZMV A;  4H0E A;  3ZR8 X;  3OS2 A;  4RB0 A;  3QPT A;  1K61 A;  1Y1V J;  1SFO J;  2VT3 A;  4JP0 A;  4UVB A;  2EIL H;  4E7K A;  2V79 A;  3KP6 A;  5DM6 F;  3VEP A;  1UHS A;  5EGO A;  4MGR A;  2OUM A;  1JI8 A;  2DN0 A;  4JYK A;  1UHM A;  5FJ8 J;  2X1D A;  4KIT B;  1AWC A;  3QRF F;  5EG0 B;  2MC3 A;  2D2W A;  2G7H A;  3CLO A;  5FRO A;  5IY5 H;  1QPI A;  4NC7 A;  3A02 A;  1YI2 I;  4G6T B;  1H9G A;  3K1M A;  3DKX A;  4G7Z F;  3FXR A;  4XIC A;  3HZJ A;  4RBO A;  5DCM B;  3GTQ J;  1ZRC A;  2A3S A;  3HSF A;  3WTZ A;  3Q5F A;  1J09 A;  1I6H J;  3GZN B;  2QWW A;  4IXA A;  3L1P A;  4BBR J;  3COA C;  2YX4 A;  3V42 A;  5IPA A;  3ERE D;  1DDN A;  4PJN A;  1X4O A;  1VQM I;  3T8R A;  2DA1 A;  2HQN A;  3TL4 X;  3WTX C;  1FP1 D;  3OYC A;  2GIZ A;  3UNG C;  3Q0V A;  5C44 J;  4V2G A;  2EFP A;  1JGS A;  1A6Q A;  2LBF B;  2MGQ A;  4A6D A;  3L2R A;  2F6C A;  3ZOB A;  4BU2 A;  2TCT A;  3OS1 A;  2VOD A;  1NK3 P;  3JRI A;  4XBF A;  4P9U A;  1MJB A;  1TW2 A;  2BXZ A;  1FEX A;  1LVK A;  5AIP A;  2FJ1 A;  3OIO A;  2K9N A;  1Z9C A;  3P7N A;  2E34 A;  1W5S A;  2PEX A;  1BJZ A;  2R7F A;  1P92 A;  5FB2 A;  4U0V A;  2AXL A;  2FBH A;  1YRN B;  3A2K A;  4X6A J;  3V8K A;  5J4V A;  1DGR M;  1IRG A;  2PFB A;  4KYW A;  3QOP A;  4HLX A;  3D1N I;  3RIR A;  2DDA A;  3JRB A;  2KIS A;  4BBS J;  3VYT B;  3FXM A;  3GUD A;  4M9Z A;  5FD5 A;  3J80 Z;  2K9S A;  4UXN A;  4RB1 A;  3K70 C;  3IC7 A;  1K78 A;  4HW0 A;  2UZK A;  1KQ0 A;  2O9L A;  4XNF A;  3CDL A;  3ZN0 A;  3B6C A;  1USS A;  5H2F C;  1YJN I;  3EUA A;  4YEL A;  5FKM A;  4AYB N;  1YOV B;  2VQH A;  3ROU A;  3S1Q J;  1S6L A;  3F8F A;  4CH7 A;  1XSV A;  1A6I A;  3BTL A;  3HOU J;  2QKL B;  1IZ1 A;  2HQ5 A;  4RGU A;  5FLV A;  4I2O A;  1ZN2 A;  3HKZ N;  2W00 A;  2XAJ A;  4Y15 A;  5CQE A;  3FXQ A;  5IT9 Z;  4XN0 A;  4QWQ A;  4U0Y A;  1WJA A;  1LE8 A;  2E1O A;  2FRH A;  2ZJR F;  1P9Q C;  5F0C A;  3SZG A;  2BY0 A;  1UG0 A;  4KDP A;  2EIN H;  2EIJ H;  3A1Y A;  4XLE A;  4DYR A;  1ETO A;  3ISP A;  3OOP A;  5CPR B;  2A61 A;  3CMM A;  4NDL A;  1LEA A;  2DA4 A;  2E71 A;  4AIJ A;  3KP4 A;  4EM0 B;  2K02 A;  3BJ6 A;  3HPG A;  2E2I J;  4LB5 A;  2HKX A;  2EZI A;  3C2G A;  2TDX A;  2W25 A;  4I99 C;  2VJJ A;  4B43 A;  3CC2 I;  3I4M J;  2FD5 A;  2HWV A;  3ZQH A;  2J5P A;  2WY8 Q;  5D8L B;  3K4C A;  3CUO A;  1WZ2 A;  3H9J A;  3O8H A;  1J9I A;  2E19 A;  3K4K A;  4QSH A;  4ZYH A;  2K85 A;  1B8I A;  4ZYG A;  3G1O A;  4EEF G;  3JRF A;  1O3T A;  1TWA J;  1OYY A;  2BHZ A;  4II3 A;  4NBQ A;  1FYK A;  1RKT A;  1YE9 A;  1TW3 A;  5JR3 A;  3OV8 A;  2KMU A;  1BR1 A;  1KU7 A;  1XMX A;  1CGP A;  1BIB A;  2LSO A;  1ITY A;  1X3U A;  1W0T A;  5AIQ A;  3SEQ A;  5KNL A;  2IP2 A;  4LIU A;  2VB6 A;  2DMN A;  3NWS A;  1XSX A;  1EA3 A;  3LFK A;  4BE2 A;  3CP2 A;  2P5L C;  2L7F P;  2UUZ A;  4B3X A;  2L3D A;  2OTJ I;  4RGX A;  2LRD A;  1FOW A;  2HDW A;  2CQK A;  4XLC A;  1BOA A;  1ZR4 A;  1Y39 A;  4BY7 J;  1S5L C;  4CO8 A;  4IHX A;  3LQR A;  2O8X A;  2YPR A;  4BJ6 C;  2BVL A;  4ZYA A;  2FOW A;  2L5Q A;  2EK5 A;  5TJJ A;  1RR8 C;  1T98 A;  3G1M A;  1J7K A;  3LFU A;  3H0D A;  1AU7 A;  2L7M P;  1DPU A;  2D1V A;  3DCF A;  3S2D J;  1ZLK A;  1LPQ A;  3A01 A;  2FXA A;  4F52 A;  5J1Y A;  2DOE A;  4M6Y A;  2Z33 A;  1HW1 A;  2VN2 A;  3BCA A;  3HIF A;  2FNA A;  3V7C A;  1O3S A;  3EDP A;  2FSW A;  1W36 C;  3RSN A;  4R79 A;  1W1W E;  4CHU A;  4ENN A;  1IW7 F;  4OMZ A;  2LKP A;  4BH9 A;  3VB2 A;  2FEZ A;  2Z2S B;  3AAF A;  5E3M A;  2KRH A;  1OR7 C;  2FML A;  1W5C C;  3CCQ I;  1MBH A;  3KIO A;  3IUO A;  2Y69 H;  3EPZ A;  4JX6 A;  3RYR A;  4II2 A;  3HOW J;  2CQQ A;  3E5U A;  4CZZ A;  3BPX A;  1MJ9 A;  3J80 K;  2QKM B;  3ECH A;  4B44 A;  3IL2 A;  4E7S A;  1DQU A;  3JRG A;  4MTD A;  2OTL I;  1V3F A;  1IO2 A;  4A3J J;  2E5N A;  2GXG A;  3K70 D;  4PK4 A;  2DMT A;  2BV6 A;  1SFE A;  5E3O A;  3OYE A;  1UB9 A;  3M9A A;  3QP5 A;  1FLI A;  2A6T A;  2KT0 A;  3FMQ A;  1TWC J;  2QQ8 A;  3BCB A;  3QPH A;  3BZK A;  4S0H B;  3P9I A;  3BG5 A;  1V54 H;  3C2B A;  1FTT A;  2RKH A;  1E2X A;  3WTV C;  5D5U B;  1O3Q A;  1T39 A;  3MZH A;  1R9T J;  2L9R A;  3OMY A;  5D5X B;  3ZMT A;  3PQK A;  3D5S C;  5IT9 K;  3H0G J;  1S8N A;  2AQF A;  1TP4 A;  5F1J A;  2JRT A;  3MQ0 A;  1UFM A;  3BTI A;  1HQC A;  3GZ5 A;  2M5W A;  4DYC A;  2KRF A;  3TBI A;  2ELK A;  3WHC A;  2ZKZ A;  1OLT A;  2OZU A;  3FXU A;  1CF7 B;  3FBN B;  2IGK A;  1IN7 A;  4CCL A;  2ZXH A;  1WVR A;  2A68 F;  3I58 A;  3AFH A;  5HDK A;  3BR3 A;  2IA0 A;  3OYD A;  1X3W B;  3LSJ A;  3IH2 A;  3L9F A;  2M7B A;  1TWH J;  3PNT A;  2A07 F;  1XD7 A;  4EM2 A;  3U21 A;  4J19 A;  2X4H A;  5LHI A;  2K3F A;  2H8R A;  4WCG A;  2H1L A;  3BQZ A;  1T0F A;  2XRN A;  2K9M A;  5DDG A;  1IG7 A;  3X2Q H;  4IRH A;  4A0X A;  2VIX A;  2EQR A;  4LFU A;  1MMA A;  3DWL E;  1PYV A;  5C4J J;  5HOO A;  1OCT C;  4CXF A;  2VQC A;  1B9M A;  1JXS A;  4UUV A;  2GBY A;  5CJ9 A;  3QP6 A;  3B6A A;  3E6M A;  3J7Z I;  3BWG A;  1BI1 A;  1MMN A;  4FIS A;  2BHY A;  4RDU A;  3TO6 A;  1BBY A;  1MNE A;  2BBY A;  3OYA A;  3PQJ A;  2Z16 A;  4A2U A;  5JVT A;  4BAC A;  5D6F A;  2ZJQ F;  4U0W A;  3QU6 A;  2JUG A;  3P9K A;  1IJW C;  2NVX J;  3ZQI A;  1D0X A;  1QGP A;  2MYS A;  3B02 A;  2CW7 A;  2DO7 A;  2HDD A;  4RLF A;  1SD4 A;  2DA7 A;  1ZGA A;  3CCL I;  2V9V A;  1U2W A;  4HF1 A;  1MH3 A;  5JHU A;  2WC2 A;  5ED4 A;  4D0P A;  1W5T A;  1LUJ B;  1F1Z A;  3MWM A;  4GYI A;  5EEA A;  4U87 A;  4A3L J;  1Z7L A;  2NNN A;  3R6S A;  1EH7 A;  4IO9 F;  4BEH A;  1QRY A;  3GTM J;  2HXO A;  2P6T A;  3A4C A;  1KU9 A;  1HDP A;  4HRI A;  2HDC A;  1R36 A;  2JVG A;  3HGY A;  4RAZ A;  2DK8 A;  4V19 K;  2LLK A;  5LGN A;  1FP2 A;  1SAX A;  4UB6 C;  3MZY A;  3VPR A;  4LMY A;  2XAS A;  2A5W A;  4EMS A;  2VKV A;  3BG3 A;  2V1N A;  2ZNY A;  5K1Y A;  1FZP B;  1A5J A;  3HEF A;  3OR1 C;  4FET A;  3S1M J;  3I0T A;  3SZT A;  1RNL A;  1N25 A;  2HS5 A;  2KIQ A;  3FM3 A;  5B1A H;  1W36 D;  5B1B H;  3K2Z A;  3DPL C;  2F4O B;  1YJW I;  2ID6 A;  4J00 A;  4WXD A;  3KE2 A;  4L9V A;  3AG1 H;  4NUB A;  1UST A;  1T08 B;  1WH5 A;  1R5I D;  2QQA A;  3TW7 A;  1S29 A;  4XLA A;  4M72 A;  3I55 I;  2DCE A;  2GM4 A;  2MG4 A;  3OYK A;  2PMH A;  1ODD A;  1R71 A;  2JA8 J;  3S1N J;  4Q48 A;  1LB2 A;  1VQ4 I;  1I5Z A;  1WI3 A;  3ASO H;  3QYB A;  3S3M A;  1XMK A;  5GAH J;  3P5J A;  3OS0 A;  1LDD A;  2YU9 J;  2IS1 A;  1XGN A;  3KYC B;  3BTJ A;  2Z99 A;  5ILU A;  4L9T A;  3S2W A;  2FQ4 A;  4U88 A;  4KIC A;  3KET A;  4EJT A;  3HSR A;  3QQA A;  3MCZ A;  3ZRG A;  4S05 A;  2CG4 A;  4P5O A;  3W6J B;  1E17 A;  1V5G A;  2FU4 A;  3PUB A;  3LA2 A;  1TWF J;  1ZK8 A;  1SFU A;  2K5C A;  3CUQ C;  3RKX A;  3K10 A;  2KKO A;  4I76 A;  2MC4 A;  2Y48 A;  5FLX Z;  2BW3 A;  3BT9 A;  2CQ7 A;  2K40 A;  4X0G A;  1AKH B;  4NC6 A;  4F55 A;  1Y0U A;  1SC7 A;  4G94 A;  1O3R A;  4B1R A;  3FX3 A;  2RC4 A;  3V4G A;  1BI3 A;  2M3A A;  1Y8Q B;  2PMZ N;  2UWM A;  1VFC A;  5LLQ A;  2CYY A;  3FMR A;  3M07 A;  4OOI A;  3ZQ7 A;  4AYB A;  3WE2 A;  1R5G A;  2MH2 A;  3K7A J;  2E7W A;  3J7A Y;  5CVJ A;  1HF0 A;  4BGD A;  3QWL A;  3CJR B;  3DTK A;  4JBA A;  5EDN A;  1G4D A;  2OV7 A;  5LEJ A;  4L5E A;  2ZME C;  2V1U A;  2L0K A;  3KFW X;  4KFC A;  5AON A;  4CA0 A;  2A05 A;  3HM5 A;  1KQ8 A;  4PUS A;  3RYP A;  2E1M B;  1W0U A;  3CD6 I;  3AL0 B;  4AID A;  2QYO A;  4A3C J;  3RQ4 A;  2R5Z B;  2XV4 S;  2IPQ X;  2OQR A;  2XB5 A;  2QGU A;  1KGS A;  4OU0 A;  2Q0O A;  2OAZ A;  1W4M A;  1VQ5 I;  4DYQ A;  2WAF A;  3OYI A;  3JR9 A;  1N75 A;  3VOE A;  4YEJ A;  3CCJ I;  1AA7 A;  5KVR A;  2E1M C;  1KA8 A;  2NRA C;  1SVM A;  2IA2 A;  2F2E A;  3F8M A;  2Q2E A;  4ZDL A;  3T5X A;  1QHH D;  3H36 A;  5BMZ A;  2ZBK A;  2Y30 A;  2XAH A;  4HSR A;  3D5L A;  3HUG A;  3JRH A;  1E0E A;  4E7I A;  2WA0 A;  1HC8 A;  4JOM A;  2BOL A;  3AG2 H;  3ZMZ A;  4XMY A;  4A6E A;  5M5W J;  2CGP A;  2KJC A;  2HZD A;  1S7O A;  2VKH A;  5K5Q A;  2QF7 A;  4IQJ A;  1M1E B;  4AVP A;  2VBW A;  5LD2 C;  4ZZD A;  1B59 A;  1KZH A;  2H1K A;  1ZRF A;  2W1O A;  1TBX A;  2V7F A;  2HQR A;  5BS6 A;  3CQZ J;  3E7L A;  4LLL A;  3MD2 A;  4DZP A;  2V9K A;  4A3D J;  4DIQ A;  1G6N A;  5DCM A;  3K1N A;  2NS7 A;  3CCS I;  4G8X A;  3MKL A;  3KX2 A;  4YIR X;  3DKY A;  5ICG A;  1E3O C;  2HYF A;  2MAB A;  4JX4 A;  4CYC B;  3FIS A;  3GTP J;  4L5J A;  2JRM A;  2ACJ A;  4GGG A;  2B63 J;  3FXJ A;  1TC3 C;  4MQV A;  2KIF A;  3ZQF A;  3S3O A;  2K86 A;  3KZI C;  1TLH B;  4RMN A;  1HA8 A;  2R7S A;  4HX8 A;  3IKT A;  1WQ2 A;  2LBF A;  4KUM A;  3TW6 A;  4I6Z A;  1QHG A;  3F3X A;  3C1D A;  1ETY A;  2EA2 A;  1ZG1 A;  3S8P A;  2EIK H;  4LLG F;  5HS9 A;  1MDM A;  3WTT C;  2K3P A;  5D5V B;  3PO3 J;  3HB9 A;  3HDD A;  1OYI A;  1EH8 A;  4GXO A;  3F8C A;  4IX7 A;  2CV1 A;  2ADU A;  3BJO A;  4P1W A;  2M4K A;  1U3E M;  2OBP A;  4I0B A;  3QOE A;  3OWT A;  4E70 A;  2OD5 A;  3GXO A;  2JPC A;  4XRS G;  1ZG3 A;  2JA6 J;  1O4X A;  4HAM A;  3FXL A;  2Y9Y A;  1Z3Y A;  1JTY A;  3F8B A;  1V4R A;  1QQI A;  4LG0 B;  3BZ6 A;  3BJA A;  5LEK A;  2NVU B;  3OL4 A;  4HG2 A;  2P7V B;  3W2V A;  2QQB A;  3WHB A;  5KAI C;  1UZC A;  2R5Y B;  3L7W A;  4NB5 A;  3H3V K;  3VFZ A;  2B0L A;  2MW8 A;  4BDZ A;  2OZ6 A;  2RQP A;  3HC7 A;  4DNC A;  2O03 A;  4M3F A;  3T1B A;  4R1H A;  2QSG X;  3HTS B;  1Q1V A;  3ABM H;  3NAU A;  2QM3 A;  2WY7 Q;  4KT5 C;  2M1B A;  1X1B A;  3IWF A;  1L0O C;  2NVY J;  1Z77 A;  4HLY A;  1PJR A;  3FWE A;  1J2X A;  3I64 A;  4BXU A;  1POG A;  3GTK J;  5EZG A;  1U5T B;  2CV0 A;  1D8J A;  1LDJ A;  1IRF A;  3I59 B;  4GFB A;  1ETX A;  2QZ8 A;  2L2O A;  2QBY B;  2COM A;  2X0L A;  2YS9 A;  1KU2 A;  1PUE E;  2R7Z J;  2A69 F;  5C3E J;  3LSR A;  1T38 A;  1TWG J;  1UMQ A;  4L5I A;  4XRM A;  2HYG D;  1T95 A;  2NAZ A;  2PX9 A;  3FBI B;  3IH4 A;  5M3M J;  3FXK A;  4RA2 A;  5TGT A;  4RB2 C;  2PI0 A;  1G2H A;  5F27 A;  4FAS D;  2XKO A;  1WJF A;  5TIS C;  4QPO A;  2CW8 A;  2HQA A;  3BR0 A;  2F5D A;  2KDZ A;  2PJR B;  2XSD C;  4UUS B;  1KQ9 A;  2XPV A;  2M0C A;  5IP7 J;  1FC3 A;  2VLA A;  2HPI A;  2DPU A;  5JFR A;  3L00 A;  4LK0 F;  1MMS A;  4C3H J;  1HSJ A;  2IEK A;  3KP5 A;  4NHJ A;  3K9T A;  4I02 A;  3A0B C;  2KZG A;  5CKT A;  5FKN A;  5B66 C;  2WTE A;  3B73 A;  1Z6T A;  4P55 A;  2XC7 A;  3G3Z A;  2VKE A;  1W7P B;  2EFQ A;  1Y56 A;  5HDG A;  2EFN A;  4M3D A;  1OPC A;  4EGZ A;  1MBG A;  5M5Y J;  5GPC A;  2R7X A;  3WG9 A;  1R1T A;  2XF5 A;  2B7E A;  5DTD A;  2HOA A;  3KZZ A;  2HVS A;  1BR2 A;  3DFG A;  3H92 A;  3I5U A;  2XB0 X;  2JJ7 A;  1TQM A;  3N97 A;  2YU3 A;  2LC2 A;  1L3L A;  2QA4 I;  4AM3 A;  3ZMD A;  3QOD A;  4XK4 A;  1OR7 A;  1SAN A;  2W84 A;  1B72 A;  1FYL A;  1FMW A;  4A5M A;  1FPQ A;  2G9W A;  2Y0S N;  3Q9S A;  4I7H A;  4YIF A;  3W6V A;  1T2K A;  2ME6 A;  5L3G A;  1VQ7 I;  1OQY A;  4PFO A;  2X6W A;  3RKW A;  2B9S A;  1YTY A;  2E1N A;  3DKW A;  1TT5 B;  1A36 A;  3K4B A;  2ZXW H;  3PNY A;  4KN4 X;  3A0H C;  4FCY A;  4RGS A;  4YG2 F;  3G1L A;  4DW6 A;  4E7H A;  1YQA A;  4Y3O A;  4FE4 A;  3OYL A;  2ZB9 A;  1NG7 A;  1R4M B;  3RPU D;  2DW4 A;  2CMP A;  2MH9 A;  4G6Q A;  5DUK A;  2HKO A;  2ECB A;  4PSX A;  5JI6 A;  1U78 A;  3ABU A;  5ICF A;  1RET A;  3GWZ A;  1XTA A;  2Q1Z B;  3HHG A;  3I71 A;  4L9N A;  4EQQ A;  2JZY A;  3KP3 A;  3CTA A;  3AG3 H;  4PJ0 C;  1HKT A;  4CCM A;  2HXI A;  2LG4 A;  4NC8 A;  4WWC A;  4O5V A;  2XVC A;  4PCQ A;  1EKE A;  1ZAR A;  1TQP A;  1YX3 A;  5E17 F;  2AQE A;  2IXS A;  1F5T A;  3F72 A;  4N4N B;  3KPH A;  1X19 A;  5D8K B;  3DEE A;  2DI3 A;  3K6G A;  3PSI A;  1ON1 A;  3EQL F;  1ZTR A;  2L54 A;  3S17 J;  3ELK A;  2LRE A;  2HVQ A;  2UXN A;  2DA6 A;  4D5C A;  5H20 A;  4OAZ A;  1XGM A;  2XAG A;  1JGG A;  3M8E A;  2VT2 A;  4G6D A;  4BJ5 C;  1ZHF A;  2ZJP F;  4KIS A;  5LRR A;  1I27 A;  1R58 A;  1U8B A;  3LSP A;  2R7O A;  1ZRE A;  4CDG A;  4Y13 A;  5IT3 A;  1RC9 A;  2MLG A;  3S16 J;  2R7T A;  1H9T A;  1CF7 A;  3JSO A;  1R1V A;  1ZGJ A;  3L2Q A;  2VE9 A;  4KMU X;  2K9Q A;  2O8K A;  1WJD A;  2F5F A;  2W4S A;  1LJ9 A;  1ENH A;  5H6R A;  4RM3 A;  2HEO A;  1GV5 A;  4Y17 A;  2A6H F;  4EJO A;  3H9Q A;  2ZCW A;  4PSW A;  4HEA 2;  2IT0 A;  5F1R A;  2PMZ A;  1P2F A;  2H27 A;  4MO7 A;  4RGR A;  4AIH A;  2DQL A;  3M8F A;  1BW5 A;  1WPK A;  2MSY A;  2ISY A;  3C18 A;  3PFY A;  3D5R C;  5J8F A;  1WHU A;  5TRD A;  3BPV A;  2H94 A;  2BXY A;  1JKO C;  2V6E A;  4UY8 I;  2DLL A;  4LOC A;  5E1Z B;  3ZPL A;  4HOB A;  3ZQQ A;  3PJR A;  4E7L A;  3ZQG A;  3IAM 2;  1YW8 A;  5ICE A;  2NS8 A;  2HYJ A;  1Y6I A;  1BA5 A;  4UNO A;  1JTX A;  1NG6 A;  2BY1 A;  1IV6 A;  2VXD A;  5HS8 A;  3NQO A;  2EZL A;  4L9J A;  3TDZ C;  2R92 J;  2MLK A;  2YSR A;  5F0F A;  4QIW N;  2GA1 A;  4PGH A;  2XUB A;  1O57 A;  2DMP A;  1H8A C;  2WB1 N;  1P4A A;  4IOA F;  2XDV A;  3SQN A;  1D0Y A;  4CGZ A;  1UHW A;  1WWX A;  1QZY A;  3S15 J;  1RZ4 A;  2QUF A;  2L7K A;  1XB4 A;  5J47 A;  5EEG A;  4HBL A;  2AHQ A;  1DUX C;  1LVA A;  2EA4 A;  4EJW A;  1K78 B;  1ETQ A;  3ZXS A;  4MIM A;  3V7R A;  2LY9 A;  4XSX F;  2GLO A;  1FNN A;  3QAH A;  3TOA A;  1D1B A;  2JMW A;  2DYS H;  3E5X A;  3MAJ A;  4XID A;  3DEW A;  1Y0N A;  3ZP5 A;  3OL3 A;  2Y2Z A;  5DUI A;  2R4G A;  2UV1 A;  2KHM A;  3F6O A;  2DTR A;  1ON2 A;  2P6S A;  3S2H J;  5KCM A;  1XPX A;  1U0J A;  3RZO J;  1OFC X;  2M34 A;  4OIO F;  3FDY A;  1O7L A;  3H5N A;  1MH4 A;  5E3L A;  2YX7 A;  3DBR B;  5EF6 A;  2MBF A;  2CV2 A;  1BI0 A;  1LE8 B;  3KEY A;  2F5V A;  1R22 A;  1IGN A;  2V1D A;  1IN8 A;  2LVS A;  3L09 A; 
#chains in the Genus database with same CATH homology
 2MD5 A;  1H0M A;  4MNU A;  5DV5 A;  1SD7 A;  3GX4 X;  3RJP A;  4EV0 A;  1Z91 A;  5D6E A;  1XGS A;  4JQF A;  2OQG A;  4FX4 A;  4HQM A;  1K7A A;  1J75 A;  1I1S A;  3CUQ A;  2HOE A;  2FBK A;  2XHK A;  3JTG A;  1VTN C;  3TOB A;  2Y75 A;  2W57 A;  1PP8 F;  1BJA A;  2VOO A;  5FO5 A;  1SMT A;  2JT1 A;  1AOY A;  3C7J A;  2P4W A;  3CO6 C;  2AS5 F;  2LDU A;  1SMY F;  4IF4 A;  2WV0 A;  3K69 A;  2ZME A;  2Y0M A;  3FHZ A;  3E3V A;  3CO7 C;  4HQE A;  2PMU A;  1G3S A;  2RGV A;  3E6B A;  2GXB A;  3DF8 A;  2IJL A;  1Q1H A;  2PLY A;  1FSE A;  4ESJ A;  4KIG A;  3DPT A;  3ECO A;  1I6X A;  1G3T A;  2CO5 A;  1J59 A;  5HS7 A;  5DD4 A;  1GVJ A;  1FBS A;  2ESH A;  4KN7 X;  4K2E A;  2K4B A;  2VC0 A;  1YW7 A;  4HX4 A;  1WRJ A;  3WTY C;  4G7H F;  3RDI A;  3Q9V A;  1IF1 A;  4RB3 C;  1C0W A;  5HDN A;  1BN5 A;  1FY7 A;  2G7U A;  4TV7 A;  1YYV A;  4OIR F;  4ZYE A;  3WTS C;  1U8R A;  3MEX A;  4KNY A;  5E20 A;  5FFZ A;  2D1H A;  1LNW A;  3ML6 A;  1DP7 P;  1Z6R A;  5LHG A;  1BM9 A;  5DD8 A;  4IHT A;  3J81 Z;  3EYI A;  3K0L A;  2VBZ A;  2O0Y A;  2RN7 A;  1GXQ A;  2WWY A;  4ETS A;  1MGT A;  1P6R A;  3G73 A;  5ILS A;  3TQN A;  4N0B A;  2ELH A;  2XAF A;  3FF5 A;  5F64 A;  5K5O A;  4YFN F;  2STW A;  2P5V A;  4PGG A;  3WOD F;  4BHB A;  3RPU A;  2Z9O A;  5CVI A;  1ONV A;  2VXZ A;  1XGO A;  3RKY A;  3LAJ A;  3M7G A;  3WGH A;  2ISZ A;  5A2Q Z;  2ZXJ A;  3ABT A;  4WF2 A;  4M9X A;  2NS0 A;  4M6X A;  1MZB A;  1FBU A;  1WKM A;  4HDU A;  5L3B A;  3E97 A;  5DCF A;  4MEY F;  2EV6 A;  1UCR A;  3ZMU A;  3E6D A;  5KK1 A;  5BOX A;  4UHT A;  3U9G A;  4FHT A;  1EH6 A;  3DP7 A;  3I59 A;  1TQI A;  2HGC A;  3F23 A;  4I09 A;  1BC8 C;  1OMI A;  1QO0 D;  3HOT A;  3BY6 A;  3HHH A;  2IA1 A;  4LB6 B;  2ZFW A;  5DYM A;  3F8N A;  4EM1 A;  1DPR A;  3HRT A;  3TO9 A;  4FX0 A;  3KLN A;  2O61 A;  2BYV E;  2V1X A;  5CYV A;  5H6Q A;  2FNP A;  4OIP F;  2ZNZ A;  5L3E A;  3GFI A;  4N9I A;  5FGM A;  2HTS A;  2ZJ2 A;  2JSC A;  3E6C C;  1BC7 C;  4IHS A;  4UVA A;  2PBI A;  2XAQ A;  4YFK F;  4M73 A;  5E1X A;  2Z3Y A;  3J81 K;  3TO7 A;  2O6G E;  2EV0 A;  2XGX A;  1ZG5 A;  2E1C A;  3ZN1 A;  4ENM A;  4IRG A;  1MJA A;  4AWX B;  4HF0 A;  1KYZ A;  2QQ9 A;  3KLO A;  5A2Q K;  5FLX K;  1MKM A;  1FX7 A;  2PN6 A;  4JK1 X;  1S3J A;  3JW4 A;  4CYD A;  4Q47 A;  3O6B B;  3DQV C;  1RIO H;  1A04 A;  1B4A A;  3GFL A;  4Q5S F;  1QNT A;  2VON A;  1D8K A;  3WE3 A;  3V8J A;  5BQT A;  2CFX A;  2M45 A;  1KU3 A;  3ZMS A;  2EV5 A;  5K5R A;  1R5H A;  3IKV A;  5BPD A;  3WGG A;  2FOK A;  1QBJ A;  1U5T C;  3WU0 A;  1IXR C;  1HKS A;  2QLZ A;  1U6G A;  2XRO A;  3F6V A;  3TGN A;  1HST A;  2J5O A;  4BQA A;  4I01 A;  1MD0 A;  3T0Y A;  2EWN A;  5BPI A;  4KIF A;  4GCV A;  2FF4 A;  4HDV A;  3T8T A;  4M74 A;  3WTW C;  1RI7 A;  4G7O F;  2CWE A;  3WTU C;  3MFK A;  1YLF A;  5E18 F;  1HW5 A;  4N9H A;  1TTY A;  4L18 B;  2K7L A;  3R0A A;  2C6Y A;  2JTV A;  5FD6 A;  3BRO A;  3WU1 B;  4ESB A;  2E7X A;  1ULY A;  3M1E A;  1IAW A;  1NHA A;  2ZO4 A;  4IVN A;  2BEO A;  2Q8K A;  1TNT A;  4A5N A;  2H6B A;  4B8X A;  5ILV A;  3SZP A;  4WK8 F;  1MDM B;  5LGU A;  3NRV A;  1XCB A;  2EFO A;  4GO1 A;  4I0A A;  3DXJ F;  5DEQ A;  3EYY A;  3BP8 A;  3JTH A;  5D4S A;  2W85 A;  3V8L A;  3KCC A;  4UV9 A;  4ZYD A;  3IRR A;  5EEH A;  1XMA A;  3H3Z A;  1HW2 A;  2NNY A;  5HLH A;  3HOS A;  5ICC A;  2K27 A;  2DPD A;  4XLN F;  2KIM A;  2LF8 A;  3LST A;  4UVC A;  1O7F A;  2LF7 A;  1LEB A;  2UXX A;  4PZJ A;  4ZZL A;  3TKY A;  3RI4 A;  3I4P A;  2A6E F;  3HRU A;  4A12 A;  1SD6 A;  2RVC A;  4IPA A;  4U7D A;  4ENJ A;  1OKR A;  3SHF A;  4MEX F;  1ZAO A;  1LQ1 A;  3GYH X;  4WXH A;  3DV8 A;  3HYI A;  5D5W B;  2L4M A;  4OIQ F;  1QPM A;  4MQ9 F;  4GYG A;  1ZRD A;  2HFH A;  3P9C A;  4FT8 A;  3HSE A;  3RPQ A;  4O3M A;  5CVV A;  2LNB A;  2IRF G;  1Z7U A;  2HZT A;  1SD5 A;  1BI2 A;  1IN6 A;  4HV6 A;  2VC1 A;  3FMS A;  3BDD A;  3GF2 A;  3F22 A;  5HLI A;  3J7A O;  3QU3 A;  2M87 A;  4KA4 A;  2M30 A;  1P4X A;  1D3Y A;  4Z2Y A;  4ZH4 F;  1FYM A;  3GZ6 A;  2DQR A;  2CSO A;  1P4W A;  2EFW A;  1W7P D;  4BAY A;  1J0R A;  1Z05 A;  2XIG A;  1B1B A;  4A0Z A;  1JE8 A;  3SFZ A;  2VBY A;  1RUO A;  4LGW A;  5E1W A;  2PQ8 A;  4HV5 A;  1IXS B;  3CDH A;  1JHF A;  4EJU A;  2V6C A;  1R23 A;  4AIK A;  4ENK A;  2GAU A;  1OYW A;  3LA3 A;  4HX7 A;  4R8H A;  2HTJ A;  4PDK A;  2P7C B;  2YR2 A;  1KYW A;  2P5K A;  3KEO A;  1IUY A;  3NEU A;  6PAX A;  3H3U A;  1J5Y A;  2GIV A;  4CIC A;  2H6C A;  1GHC A;  5LGT A;  2PJP A;  2K4J A;  5E8G A;  1WI9 A;  2QEN A;  1Z1D A;  1B6A A;  2JPB A;  5LBQ A;  1T6S A;  1ZLJ A;  2DBB A;  3GFM A;  2EB7 A;  2MA3 A;  2H09 A;  3HRS A;  4OIN F;  3WGI A;  3LQQ A;  3ULQ B;  4HF2 A;  5CVR A;  2RDP A;  2DK5 A;  1R1U A;  2EJR A;  1JHH A;  3K1P A;  2GQQ A;  3GFJ A;  3PFI A;  4NQW A;  3HRM A;  1ZH5 A;  4IRI A;  5E8I A;  1LDK B;  2PG4 A;  4WXC A;  4IJA A;  4P9F A;  2DU9 A;  4BHC A;  3VOD A;  2A5Y B;  5LHH A;  4UV8 A;  1HKQ A;  1FSH A;  4XSZ F;  2R3S A;  4DQ2 A;  2RV8 A;  3O2P E;  1K79 A;  3E5Q A;  2XKP A;  2ESN A;  3KZY A;  3JSP A;  2L01 A;  3SXY A;  3EUH A;  1R00 A;  3GO5 A;  1YIO A;  4HZF A;  1FT9 A;  5L3D A;  2OA4 A;  4F7Z A;  2D45 A;  2GZW A;  2VE8 A;  1RUN A;  2DT5 A;  2FQ3 A;  1FBQ A;  4S04 A;  4BYY A;  1XDU A;  3FZV A;  3HTU A;  3LA7 A;  2FBI A;  4KMF A;  5HVQ C;  1I1G A;  1FOK A;  1D5V A;  1PP7 U;  1REP C;  1WSU A;  1IN5 A;  1G3W A;  3FM5 A;  4LD5 A;  4Q4Z F;  3CUQ B;  4YFX F;  4YII A;  4L0Y B;  2L4A A;  1XSD A;  1S7A A;  4EJV A;  2W24 A;  3LWF A;  5L3F A;  2GA2 A;  2M8E A;  1STZ A;  4P96 A;  5L3C A;  3R60 A;  3BOQ A;  3IWZ A;  4AD9 A;  4LG0 A;  3D0S A;  4L0Z B;  3KP7 A;  5J6X A;  3CJN A;  2ZME B;  4A0Y A;  1YW9 A;  5D4R A;  3DEU A;  2F5C A;  3JAM Z;  3GW2 A;  1BIA A;  4OMY A;  4BNC A;  2NYX A;  2L02 A;  1F9N A;  2R7D A;  3I53 A;  3I54 A;  3KEQ A;  5CLS A;  3LAP A;  2ETH A;  3C3W A;  1U5T A;  1YG2 A;  4G9Y A;  4I98 B;  4B09 A;  4M9S A;  2QBY A;  1YO5 C;  1IN4 A;  1F4K A;  2O3F A;  1FWZ A;  2STT A;  3TDU C;  4WX9 A;  2BE5 F;  1SFX A;  4XRF A;  1PDN C;  4LLN A;  5F6F A;  2VOP A;  3R61 A;  5LRS A;  2IVM A;  1G3Y A;  4U7B A;  4LJZ F;  2IW5 A;  5CVU A;  4HYE A;  1XN7 A;  3IHU A;  2FMY A;  4XLP F;  4RAY A;  3O3K A;  2DAO A;  2QVO A;  1YFH A;  1W7P A;  1XDS A;  1GXP A;  2Z5U A;  3L2C A;  4BHP A;  2HR3 A;  1YS7 A;  1XCV A;  4EGY A;  3R4K A;  3N4M A;  4M71 A;  2KIU A;  5FFX A;  1K6O A;  1IXC A;  3RTR A;  2RNJ A;  1TNS A;  3GLX A;  3KP2 A;  4ESF A;  3IRQ A;  4ASN A;  1QZZ A;  1HBX G;  2OU2 A;  2BGC A;  3GVA A;  4EVI A;  4LK1 F;  2CW0 F;  3V7S A;  2GWR A;  5J8C A;  1R7J A;  3REO A;  3U2R A;  1EV7 A;  1YS6 A;  2KJB A;  4KIB A;  5HLG A;  4ON0 A;  4MTE A;  4RS8 A;  3R0J A;  4O6J A;  2P8T A;  3EET A;  3JAM K;  5ERI A;  2FE3 A;  2VBX A;  4HA8 A;  3GEZ A;  4MHG A;  2DFI A;  1B9N A;  3F21 A;  2FA5 A;  2F5E A;  3U1D A;  3W6K B;  1ZYR F;  4QLC U;  1HXD A;  3ZMV A;  4H0E A;  4RB0 A;  3QPT A;  2VT3 A;  4UVB A;  2V79 A;  3KP6 A;  3VEP A;  4MGR A;  1UHM A;  1AWC A;  3QRF F;  2MC3 A;  2D2W A;  2G7H A;  3CLO A;  1H9G A;  3K1M A;  4G7Z F;  3FXR A;  5DCM B;  1ZRC A;  2A3S A;  3HSF A;  3WTZ A;  3Q5F A;  2QWW A;  4IXA A;  3COA C;  2YX4 A;  3ERE D;  1DDN A;  3T8R A;  2HQN A;  3WTX C;  1FP1 D;  2EFP A;  1JGS A;  4A6D A;  2VOD A;  4XBF A;  4P9U A;  1MJB A;  1TW2 A;  5AIP A;  1Z9C A;  3P7N A;  1W5S A;  2PEX A;  2R7F A;  1P92 A;  5FB2 A;  4U0V A;  2AXL A;  2FBH A;  3V8K A;  1IRG A;  2PFB A;  4KYW A;  3QOP A;  4HLX A;  3RIR A;  3GUD A;  4M9Z A;  5FD5 A;  3J80 Z;  4UXN A;  1K78 A;  4RB1 A;  3IC7 A;  4HW0 A;  2UZK A;  1KQ0 A;  3ZN0 A;  1USS A;  3ROU A;  1S6L A;  3F8F A;  1XSV A;  1IZ1 A;  4RGU A;  4I2O A;  1ZN2 A;  2XAJ A;  4Y15 A;  3FXQ A;  5IT9 Z;  4QWQ A;  4U0Y A;  2FRH A;  4KDP A;  3ISP A;  3OOP A;  2A61 A;  4AIJ A;  1LEA A;  3KP4 A;  4EM0 B;  2K02 A;  3BJ6 A;  4LB5 A;  2HKX A;  2TDX A;  2W25 A;  2HWV A;  2J5P A;  5D8L B;  3CUO A;  1J9I A;  4ZYH A;  4ZYG A;  1O3T A;  1FYK A;  1OYY A;  1TW3 A;  5JR3 A;  3OV8 A;  1KU7 A;  1CGP A;  1BIB A;  2LSO A;  1X3U A;  5AIQ A;  2IP2 A;  1XSX A;  3LFK A;  2P5L C;  2L3D A;  4RGX A;  2CQK A;  1BOA A;  4CO8 A;  3LQR A;  2O8X A;  2YPR A;  2EK5 A;  5TJJ A;  1T98 A;  1J7K A;  1DPU A;  2D1V A;  1ZLK A;  2FXA A;  4M6Y A;  2Z33 A;  1HW1 A;  2VN2 A;  3HIF A;  2FNA A;  3V7C A;  1O3S A;  3EDP A;  2FSW A;  4R79 A;  4CHU A;  4ENN A;  1IW7 F;  4OMZ A;  2LKP A;  4BH9 A;  3VB2 A;  2FEZ A;  3AAF A;  2FML A;  3RYR A;  3E5U A;  4CZZ A;  3BPX A;  1MJ9 A;  3J80 K;  3ECH A;  3IL2 A;  4MTD A;  1V3F A;  2GXG A;  2BV6 A;  1SFE A;  1UB9 A;  3M9A A;  3QP5 A;  1FLI A;  3FMQ A;  3QPH A;  3P9I A;  2RKH A;  1E2X A;  3WTV C;  5D5U B;  1O3Q A;  1T39 A;  3MZH A;  5D5X B;  3ZMT A;  3PQK A;  5IT9 K;  1S8N A;  2JRT A;  3MQ0 A;  1UFM A;  3GZ5 A;  1HQC A;  2M5W A;  2KRF A;  2ZKZ A;  2OZU A;  3FXU A;  1CF7 B;  1IN7 A;  2A68 F;  3I58 A;  5HDK A;  2IA0 A;  3L9F A;  2A07 F;  1XD7 A;  4EM2 A;  2X4H A;  5LHI A;  4WCG A;  1T0F A;  2XRN A;  5DDG A;  4IRH A;  4A0X A;  4LFU A;  5HOO A;  4CXF A;  1B9M A;  1JXS A;  4UUV A;  5CJ9 A;  3QP6 A;  3E6M A;  3BWG A;  1BI1 A;  3TO6 A;  1BBY A;  2BBY A;  3PQJ A;  5JVT A;  4A2U A;  5D6F A;  4U0W A;  3QU6 A;  3P9K A;  1QGP A;  3B02 A;  2DO7 A;  1SD4 A;  1ZGA A;  2V9V A;  1U2W A;  4HF1 A;  5JHU A;  2WC2 A;  5ED4 A;  4D0P A;  1W5T A;  1F1Z A;  3MWM A;  4GYI A;  2NNN A;  3R6S A;  1EH7 A;  2P6T A;  1KU9 A;  2HDC A;  1R36 A;  4RAZ A;  2DK8 A;  5LGN A;  1FP2 A;  1SAX A;  3MZY A;  4LMY A;  2XAS A;  4EMS A;  2ZNY A;  5K1Y A;  1FZP B;  3I0T A;  3SZT A;  1RNL A;  2HS5 A;  3FM3 A;  3K2Z A;  3DPL C;  4WXD A;  3KE2 A;  4L9V A;  1UST A;  2QQA A;  1S29 A;  4M72 A;  2PMH A;  1ODD A;  4Q48 A;  1LB2 A;  1I5Z A;  1XMK A;  1LDD A;  1XGN A;  2Z99 A;  5ILU A;  4L9T A;  3S2W A;  4U88 A;  4KIC A;  3KET A;  4EJT A;  3HSR A;  3MCZ A;  4S05 A;  2CG4 A;  4P5O A;  3W6J B;  1E17 A;  2FU4 A;  3LA2 A;  1SFU A;  3CUQ C;  3RKX A;  2KKO A;  2Y48 A;  5FLX Z;  1Y0U A;  1O3R A;  4G94 A;  3FX3 A;  2RC4 A;  3V4G A;  1BI3 A;  2UWM A;  5LLQ A;  2CYY A;  3FMR A;  4OOI A;  3ZQ7 A;  3WE2 A;  1R5G A;  2MH2 A;  2E7W A;  5CVJ A;  4JBA A;  1G4D A;  5LEJ A;  2V1U A;  3KFW X;  4KFC A;  5AON A;  1KQ8 A;  3RYP A;  2QYO A;  2XV4 S;  2IPQ X;  2OQR A;  1KGS A;  4OU0 A;  2Q0O A;  2OAZ A;  1W4M A;  3VOE A;  5KVR A;  1KA8 A;  2NRA C;  2IA2 A;  2F2E A;  3F8M A;  2Q2E A;  3T5X A;  5BMZ A;  2ZBK A;  2XAH A;  3D5L A;  3HUG A;  3ZMZ A;  4A6E A;  2CGP A;  2KJC A;  1S7O A;  5K5Q A;  4AVP A;  2VBW A;  4ZZD A;  1B59 A;  1ZRF A;  1TBX A;  2HQR A;  5BS6 A;  4LLL A;  1G6N A;  5DCM A;  3K1N A;  4G8X A;  5ICG A;  2HYF A;  4L5J A;  2ACJ A;  4GGG A;  4MQV A;  2KIF A;  2K86 A;  1TLH B;  4HX8 A;  3IKT A;  1WQ2 A;  4KUM A;  3F3X A;  3C1D A;  2EA2 A;  1ZG1 A;  4LLG F;  5HS9 A;  1MDM A;  3WTT C;  5D5V B;  1OYI A;  1EH8 A;  4GXO A;  3F8C A;  2ADU A;  3BJO A;  1U3E M;  2OBP A;  4I0B A;  4E70 A;  2OD5 A;  3GXO A;  2JPC A;  1ZG3 A;  4HAM A;  3F8B A;  1V4R A;  1QQI A;  4LG0 B;  3BZ6 A;  3BJA A;  5LEK A;  2P7V B;  2QQB A;  3L7W A;  4NB5 A;  3VFZ A;  2B0L A;  2OZ6 A;  2RQP A;  4DNC A;  2O03 A;  3T1B A;  4R1H A;  3HTS B;  2QM3 A;  4KT5 C;  2M1B A;  3IWF A;  1L0O C;  4HLY A;  3FWE A;  1J2X A;  3I64 A;  4BXU A;  1U5T B;  1D8J A;  1LDJ A;  1IRF A;  3I59 B;  2QZ8 A;  2QBY B;  2COM A;  2X0L A;  1PUE E;  1KU2 A;  2A69 F;  1T38 A;  4L5I A;  2HYG D;  2NAZ A;  4RB2 C;  2PI0 A;  2XKO A;  2F5D A;  1KQ9 A;  1FC3 A;  2DPU A;  5JFR A;  3L00 A;  4LK0 F;  1HSJ A;  3KP5 A;  4NHJ A;  3K9T A;  4I02 A;  2WTE A;  3B73 A;  1Z6T A;  4P55 A;  3G3Z A;  1W7P B;  2EFQ A;  5HDG A;  2EFN A;  1OPC A;  4EGZ A;  3WG9 A;  1R1T A;  3KZZ A;  3DFG A;  3H92 A;  3I5U A;  1TQM A;  3N97 A;  2YU3 A;  1L3L A;  3ZMD A;  1OR7 A;  2W84 A;  1FYL A;  4A5M A;  1FPQ A;  2G9W A;  3Q9S A;  4I7H A;  4YIF A;  1T2K A;  5L3G A;  3RKW A;  1YTY A;  2E1N A;  3DKW A;  4KN4 X;  4RGS A;  4YG2 F;  1YQA A;  2DW4 A;  2MH9 A;  4G6Q A;  5DUK A;  2HKO A;  5JI6 A;  1U78 A;  3ABU A;  5ICF A;  3GWZ A;  4EQQ A;  3HHG A;  3I71 A;  4L9N A;  2JZY A;  3KP3 A;  3CTA A;  1HKT A;  4WWC A;  4O5V A;  2XVC A;  4PCQ A;  1ZAR A;  1TQP A;  5E17 F;  1F5T A;  3F72 A;  5D8K B;  2DI3 A;  1ON1 A;  3EQL F;  2L54 A;  3ELK A;  2UXN A;  5H20 A;  1XGM A;  2XAG A;  3M8E A;  2VT2 A;  4G6D A;  1ZHF A;  5LRR A;  1I27 A;  1R58 A;  1ZRE A;  4CDG A;  4Y13 A;  5IT3 A;  2MLG A;  1H9T A;  1CF7 A;  3JSO A;  1R1V A;  1ZGJ A;  2VE9 A;  4KMU X;  2F5F A;  1LJ9 A;  5H6R A;  2HEO A;  4Y17 A;  2A6H F;  4EJO A;  2ZCW A;  2IT0 A;  5F1R A;  1P2F A;  2H27 A;  4RGR A;  4AIH A;  2DQL A;  3M8F A;  3C18 A;  2ISY A;  5J8F A;  5TRD A;  3BPV A;  2H94 A;  2DLL A;  5E1Z B;  3ZPL A;  4HOB A;  1YW8 A;  5ICE A;  4UNO A;  5HS8 A;  3NQO A;  4L9J A;  3TDZ C;  2MLK A;  2YSR A;  2GA1 A;  4PGH A;  2XUB A;  1O57 A;  1P4A A;  3SQN A;  4CGZ A;  1UHW A;  1WWX A;  1QZY A;  1RZ4 A;  2QUF A;  1XB4 A;  5EEG A;  4HBL A;  1DUX C;  1LVA A;  2EA4 A;  4EJW A;  1K78 B;  3V7R A;  4XSX F;  1FNN A;  3QAH A;  3TOA A;  3E5X A;  3MAJ A;  3ZP5 A;  5DUI A;  3F6O A;  2DTR A;  1ON2 A;  2P6S A;  4OIO F;  1O7L A;  2YX7 A;  2MBF A;  1BI0 A;  1R22 A;  2V1D A;  1IN8 A;  3L09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...