4ESFA

Crystal structure of padr-like transcriptional regulator (bce3449) from bacillus cereus strain atcc 10987
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
100
Chain Sequence
NLTEMLKGSLEGCVLEIISRRETYGYEITRHLNDLGFTEVVEGTVYTILVRLEKKKLVNIEKKPPRKFYSLNEAGRQELELFWKKWDFVSSKINVLKSSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PadR-like transcriptional regulator
publication title Crystal Structures of Two Transcriptional Regulators from Bacillus cereus Define the Conserved Structural Features of a PadR Subfamily.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transcription
total genus 39
structure length 100
sequence length 105
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esfA00
1W7PA 1K79A 2L3DA 3RKXA 2L02A 3KP4A 3QOPA 2H09A 5KVRA 2RN7A 4NB5A 2DPUA 1MGTA 1P92A 5F6FA 5HDNA 1T38A 5E8GA 1J5YA 2ZJ2A 2OQRA 3LA2A 2H6BA 4FX0A 1R7JA 3WTZA 1XMAA 5D8KB 4L9VA 3TQNA 4PCQA 1BIBA 4M6YA 4XLPF 2HOEA 2OZ6A 2HS5A 4KN7X 2WC2A 2O8XA 4GXOA 2VT3A 3QRFF 1O3RA 2H94A 2HR3A 2M87A 2Z99A 1HW5A 2MH9A 2A07F 4HV6A 1SD7A 3HSRA 3N97A 1OYWA 3H3UA 1R5HA 1ZG5A 4YIIA 4I7HA 1BI0A 4KMFA 2EK5A 2JRTA 1HQCA 3M7GA 4L5IA 2HGCA 1B6AA 4LB6B 1K7AA 1BC7C 2NAZA 3GW2A 4CZZA 1FBSA 2HTSA 3WTTC 1U5TC 2KIMA 3EETA 3WODF 1G4DA 4BHCA 1ZH5A 4G9YA 4KMUX 3LWFA 1MD0A 2NRAC 5LBQA 4WXDA 5DDGA 5DEQA 2QWWA 3FXRA 1D3YA 4BHBA 3V8LA 3MAJA 2XAQA 2DI3A 5L3CA 2PJPA 4EM0B 2QQAA 2L4MA 4LGWA 2F2EA 4GGGA 4RGXA 4HX8A 4AIHA 1IN6A 3O3KA 3U2RA 3I71A 3TKYA 3C18A 4M9ZA 3KZZA 1SMTA 3W6JB 3MWMA 3K1MA 4WF2A 4GCVA 1IXRC 2K4JA 4F7ZA 4HBLA 4LK0F 2XUBA 2D1HA 1J9IA 2QM3A 4A0YA 1C0WA 2FBIA 2Y0MA 4KIFA 1IZ1A 5LEKA 1SFUA 1O7FA 3HRTA 4B09A 3GWZA 2MA3A 1ZG3A 1LB2A 2PEXA 5HLGA 3T5XA 2EFWA 1YS7A 5CYVA 2ZFWA 3L00A 2Q0OA 1XCBA 4AVPA 4OIPF 1R1VA 2STTA 1KU3A 1TNTA 2OQGA 2WTEA 1FZPB 1XDSA 5LEJA 4RAZA 1P6RA 2EV6A 3FXQA 2M5WA 5HLIA 1DDNA 2CW0F 3MZYA 4WXCA 3QPTA 2V79A 3P9KA 2BV6A 1KU7A 4A0ZA 3RKYA 1Q1HA 2A61A 1R1TA 1PUEE 1K78B 1LVAA 1OKRA 3TGNA 1V3FA 3ZP5A 3ZN0A 2E7XA 3V7CA 5IT9Z 1B9MA 3SQNA 3U9GA 3ZN1A 3LQRA 3K1PA 4G6QA 4L9TA 3IKVA 1TLHB 3V8JA 3IRQA 2HKXA 2P5KA 4XSXF 2R7FA 1BBYA 4MGRA 2Z5UA 3WGGA 5FFZA 4S04A 1IUYA 2RQPA 3DKWA 2ZO4A 4RGSA 2GQQA 4KUMA 2P6TA 2XAJA 2QVOA 4BHPA 2RVCA 3ZMVA 3KEQA 4GO1A 3ELKA 4G6DA 4S05A 1FLIA 4EM1A 2MLGA 2XRNA 2FMLA 1S3JA 2HZTA 1NHAA 4P5OA 3F8MA 4Q5SF 5AIQA 1RI7A 1O57A 1R22A 3PQKA 3I53A 1TW2A 4HW0A 2P5LC 1SAXA 1TQMA 3FX3A 3GF2A 3T1BA 3TDZC 4WWCA 1OYIA 1QZYA 3WE3A 4ENKA 4YFNF 3HUGA 4A6EA 1HKQA 3GVAA 4KIGA 2DQLA 3KFWX 5FO5A 4K2EA 1L3LA 4LJZF 5CVUA 1WQ2A 5J8CA 5K1YA 2ACJA 2O6GE 4QLCU 3KP7A 1UHMA 1J7KA 3CLOA 4M73A 5EEGA 5LHGA 3WTUC 1I5ZA 5BPDA 2IA0A 4LK1F 4EJOA 4Z2YA 2Y75A 3LQQA 4JBAA 2OD5A 3BWGA 1YW9A 4RB2C 3BZ6A 3TOAA 1S7OA 2W85A 1W5TA 2CG4A 2CWEA 1FOKA 5E20A 4ESFA 3F6OA 4MEXF 5CLSA 1JE8A 4D0PA 5LLQA 1BI3A 2DW4A 2ISYA 4RGRA 2IVMA 4ZYEA 2HKOA 1XGMA 4Q47A 2C6YA 3S2WA 5ICCA 1FBUA 3GFMA 3ML6A 4RAYA 2P7VB 5A2QZ 1BC8C 2HFHA 1K78A 4EJVA 2EB7A 1IRFA 4LLGF 1XCVA 1QQIA 3L2CA 3WGIA 4WXHA 5DCFA 2OZUA 1ZGAA 4EJUA 4BNCA 1F5TA 4HF2A 4WK8F 4HX4A 4ENNA 4UNOA 3WTXC 3P9IA 2VBZA 2JPBA 1X3UA 3MZHA 1LDDA 1ZN2A 4IRHA 1S6LA 3I54A 2QZ8A 1Z9CA 3T8RA 3OV8A 4R79A 3Q9SA 2XGXA 3WTSC 4JQFA 2IT0A 4U88A 4KN4X 2W57A 4EJTA 2DU9A 3K2ZA 5HDGA 3W6KB 3KP5A 2XAHA 5BPIA 2J5OA 1P4XA 3R0AA 4L0ZB 1FSHA 3DP7A 2NNYA 5D5WB 4MTEA 1WSUA 3VODA 4RS8A 2GXGA 2QQBA 4LMYA 2FXAA 3QP6A 1QPMA 2V6CA 4OOIA 2PN6A 2JPCA 2ZNZA 1FP1D 2DAOA 4CYDA 5E1WA 4IRGA 2K27A 3BY6A 3SZTA 4OIQF 2J5PA 4UUVA 1E17A 1XMKA 4LFUA 2OAZA 3HOTA 2RNJA 3KLOA 3F3XA 2FF4A 1KYWA 3F72A 2XAFA 3P7NA 4FX4A 5LGNA 3L7WA 1TQPA 3M1EA 1IN8A 1R23A 2AXLA 3JTHA 3KE2A 5A2QK 4MTDA 1KU2A 4O3MA 1G3YA 1U5TB 1V4RA 1J2XA 5JI6A 3FMSA 1BJAA 1YW7A 2IW5A 3ZMDA 1B4AA 3ZMTA 1F1ZA 5H6QA 1ZARA 2Q2EA 4AIJA 4R8HA 3F23A 5FB2A 4LG0B 1LJ9A 4ZYGA 4EQQA 4UV9A 2QLZA 1F9NA 4IXAA 1H9GA 1SD6A 3BJAA 5BS6A 3WE2A 2QBYB 1IN7A 2XVCA 4B8XA 1W5SA 4JK1X 4RGUA 1YQAA 3KP2A 5L3BA 2GZWA 3EDPA 2V1XA 3RJPA 2H6CA 4ZZLA 3E6BA 1S29A 1YS6A 3JSOA 4U7DA 2FNAA 5BQTA 1YLFA 5FD5A 4I0AA 2VBYA 3REOA 2RDPA 5FGMA 3RDIA 5EEHA 1P4AA 2UXXA 2K7LA 4LLLA 3M8FA 3JSPA 5E8IA 3I4PA 4O5VA 1WI9A 3GFJA 2IA1A 3C3WA 1KQ9A 3J7AO 3CUQC 2FU4A 4R1HA 2EWNA 4IF4A 3FMRA 3PFIA 5AONA 1FYLA 4A6DA 4I2OA 1R5GA 1H0MA 3BOQA 1R00A 2RV8A 2P4WA 3NQOA 2G9WA 2FQ3A 4MQVA 1YYVA 2JTVA 1DP7P 3B02A 4M9XA 1R36A 3KP3A 3D5LA 4P9UA 1S7AA 1KYZA 3M8EA 5HDKA 3DPTA 4ZYDA 1IAWA 1W4MA 1FSEA 3CJNA 2DQRA 2HYFA 1KGSA 2CO5A 4G8XA 2VBXA 4EVIA 3IL2A 4EGZA 1ULYA 3F6VA 2EA4A 4PGGA 1LEBA 2VE9A 2GA1A 3K9TA 1CF7B 2O0YA 4LD5A 2XIGA 3HSEA 1U5TA 4GYGA 3GFIA 1B1BA 2D2WA 4G7OF 3JAMZ 4Y17A 1ZAOA 1MDMB 3QU6A 3TOBA 1LDJA 3L09A 2L4AA 2YX7A 1QBJA 2TDXA 3FZVA 5DYMA 4LG0A 2V9VA 3WGHA 2ZXJA 3OOPA 4UVCA 4MNUA 1Z6RA 2VT2A 4AWXB 4G7HF 3IKTA 2BYVE 5K5RA 3C1DA 1VTNC 5L3GA 2A69F 4ZZDA 5JFRA 2WWYA 2QBYA 1LEAA 1FWZA 3K69A 5E18F 1AOYA 2FE3A 2P7CB 3J81Z 2UWMA 5FLXZ 2G7HA 3BJ6A 1OYYA 3I59B 2KIUA 3T0YA 3ZQ7A 4FT8A 3CTAA 2OBPA 4L9NA 4HQMA 4BAYA 2KJCA 1IN5A 1Z6TA 4IRIA 1QNTA 1XSDA 2ZMEB 3R4KA 1O3TA 1IRGA 1EH8A 3L9FA 3K0LA 4LLNA 3CUOA 2M8EA 1I27A 3TO6A 4ENJA 1ON1A 5J6XA 4HX7A 2X0LA 1XGNA 3KLNA 3CO7C 4KA4A 1QGPA 1IN4A 3H92A 1FYMA 2RC4A 3ERED 3LSTA 5JVTA 3IHUA 1ZREA 2XAGA 3P9CA 4BYYA 2ZCWA 1G3WA 1YTYA 2VC1A 1IXCA 3N4MA 5FFXA 4HLYA 1JGSA 3LAJA 2XROA 2Z3YA 2DTRA 5E1ZB 4HDUA 1U6GA 2EFQA 3GUDA 3EYIA 2BEOA 4M74A 1EH6A 4P96A 3E6CC 2FEZA 4L18B 1BOAA 3M9AA 2EV0A 2HQRA 3KP6A 1H9TA 5HVQC 4BH9A 1MKMA 3QU3A 4KYWA 3FF5A 2PI0A 1FC3A 3NRVA 1G3TA 4Y13A 2XKOA 2FSWA 5D6EA 3ROUA 1MZBA 2XKPA 2EA2A 2KKOA 4LB5A 4CDGA 3C7JA 3J80Z 2HEOA 2A6EF 5IT9K 5TJJA 2CGPA 1ZRFA 3VOEA 3HRUA 1U2WA 5CVVA 4EV0A 2NNNA 3NEUA 4KICA 4G7ZF 1CF7A 3KEOA 2IA2A 1E2XA 4HF0A 3F8NA 4L9JA 3WG9A 4YG2F 1U8RA 1F4KA 3ISPA 1MDMA 3IWFA 1OMIA 4HZFA 2Y48A 1ZRDA 4I09A 4CXFA 4I0BA 2LKPA 3ECOA 5JR3A 1XSXA 3I5UA 1JXSA 3GO5A 4NHJA 4PGHA 1YG2A 3ULQB 3FM3A 1D8JA 4ESJA 3DFGA 5DCMB 3DF8A 4CICA 3R60A 3ABUA 1T6SA 2VOOA 4DNCA 1ONVA 2HDCA 5CJ9A 2ESHA 5ICGA 3I59A 1J0RA 1YO5C 3F22A 1BI2A 4O6JA 3BDDA 1HW2A 2KRFA 2ESNA 1USTA 1HKSA 5L3DA 2ZMEA 5D8LB 3CO6C 3FXUA 2Z9OA 4AIKA 5CVJA 4OINF 1HKTA 3HHHA 2GAUA 4ON0A 2L54A 2ISZA 4ESBA 5LHIA 1RUNA 2DK5A 2ADUA 4HV5A 5F64A 5ICEA 1SFXA 3HSFA 3E5QA 5IT3A 1G6NA 4YIFA 3HOSA 2W84A 2M1BA 1MJBA 4CHUA 2G7UA 1RNLA 2F5FA 1XN7A 3PQJA 2MD5A 4FHTA 1FT9A 3B73A 2O61A 3I64A 1O3QA 1Z91A 2D1VA 1FP2A 2O3FA 5BMZA 2CQKA 1BM9A 3IWZA 5E17F 3SFZA 5D5VB 3RYPA 4P9FA 5HS7A 3H3ZA 4XRFA 2FBKA 1DPUA 2PMUA 5ED4A 4A2UA 3GX4X 5L3EA 4A0XA 1QZZA 2H27A 2W25A 3KZYA 1SD5A 3F21A 1K6OA 3O2PE 5CVRA 2GWRA 4IHTA 1ZRCA 2PQ8A 1P4WA 1FNNA 5LRSA 1Z05A 3DQVC 1GXQA 3COAC 1LQ1A 4HOBA 4KFCA 2EFOA 1LDKB 1JHFA 3ZMUA 5K5OA 3RTRA 4ASNA 2K4BA 2PBIA 1REPC 5KK1A 2VODA 3F8CA 3BPVA 1O7LA 3DEUA 4MHGA 1J75A 4RB0A 3LA7A 2HYGD 1HSJA 4A5MA 1D8KA 2VOPA 2ELHA 2MC3A 2XASA 4MQ9F 3CUQB 3ZPLA 3RYRA 5F1RA 2V1DA 5DV5A 4YFXF 2A5YB 3MFKA 1XGSA 1JHHA 1T39A 4ZH4F 2BE5F 2QQ9A 3HHGA 2YPRA 1ZLJA 4M71A 2CSOA 4OIRF 5DCMA 1G3SA 4ZYHA 1CGPA 1FYKA 4CGZA 1DUXC 3TO9A 1PP7U 4PDKA 2OU2A 1SFEA 5DUKA 1MJ9A 3TO7A 3MEXA 1YIOA 2QENA 4U0VA 5LGTA 1STZA 1UB9A 2X4HA 1XDUA 2BGCA 2DBBA 2CFXA 3MCZA 3GYHX 6PAXA 3BROA 2IPQX 1T98A 4BQAA 2DLLA 4E70A 1WKMA 1FY7A 2Q8KA 2YU3A 4OMZA 4HF1A 2Z33A 5ERIA 3QP5A 2CYYA 2ETHA 1Y0UA 1KA8A 1KQ8A 5D4SA 1J59A 5L3FA 2K86A 2E1NA 4UVAA 3ZMZA 1L0OC 2VN2A 4IJAA 5ILUA 1TBXA 5LGUA 1WWXA 2FMYA 1DPRA 1W7PD 2DT5A 5H6RA 1SD4A 2FNPA 1B59A 2O03A 2A68F 4PZJA 1AWCA 2VBWA 3HTSB 2F5EA 2HQNA 2LF7A 4UVBA 2K02A 3EYYA 4U0WA 4YFKF 3GEZA 1ZGJA 3DPLC 5D5UB 1YW8A 4ETSA 1KQ0A 2B0LA 4XLNF 1HW1A 1UCRA 4UV8A 1RUOA 2RKHA 2PFBA 1B9NA 1HSTA 3WTWC 2UXNA 1BIAA 2VXZA 4L5JA 2PLYA 2OA4A 5ILVA 5E1XA 5D6FA 4RB1A 1D5VA 2FOKA 2GA2A 2JSCA 1U78A 2L01A 3GFLA 2R3SA 2EJRA 1OR7A 2HWVA 1PDNC 4CO8A 4A5NA 3LAPA 2GIVA 1I6XA 4EMSA 4XBFA 2W24A 4EM2A 4Y15A 2FRHA 3Q9VA 3V7SA 3E5XA 1ODDA 3EUHA 3VFZA 2VE8A 4BXUA 4Q4ZF 2P5VA 2KJBA 4OU0A 2NS0A 3EQLF 3DXJF 4EGYA 4G94A 5LRRA 2EV5A 4KT5C 5BOXA 4KDPA 3RIRA 1EH7A 1QO0D 3GXOA 2IRFG 2UZKA 4MEYF 3RI4A 1PP8F 4L0YB 1TQIA 1USSA 3CUQA 2DPDA 4I02A 2D45A 4NQWA 5HS9A 3SHFA 2E7WA 5J8FA 4OMYA 4M6XA 1GVJA 3CDHA 1T2KA 4N9HA 2DK8A 4HDVA 3JW4A 3O6BB 1P2FA 3F8FA 2A6HF 4M72A 1FBQA 4OIOF 2HTJA 2EFPA 2AS5F 3HRMA 3I0TA 3D0SA 2FA5A 1SMYF 3HYIA 3F8BA 4HQEA 4I98B 1ZYRF 5HS8A 3FHZA 4N9IA 4WCGA 2JZYA 3SXYA 3R6SA 2F5CA 3WU1B 2P8TA 4U7BA 2LSOA 4I01A 1XGOA 2KIFA 2YX4A 2NYXA 2E1CA 3I58A 3ZMSA 4DQ2A 2R7DA 2VC0A 3E3VA 1O3SA 2ZNYA 1Z1DA 2YR2A 2LDUA 4KIBA 2DFIA 5DD4A 3WTYC 3WU0A 5TRDA 2YSRA 3FWEA 3DV8A 3MQ0A 2MLKA 3BP8A 4XSZF 1GXPA 3HIFA 4TV7A 1XD7A 1I1GA 4HA8A 2STWA 5FD6A 3G3ZA 2GXBA 1ZG1A 3V8KA 5DD8A 1I1SA 5K5QA 1HXDA 2JT1A 4UHTA 3Q5FA 2F5DA 3SZPA 2VONA 1OPCA 1W7PB 1MJAA 3E97A 3JAMK 1IW7F 3R61A 5DUIA 4UXNA 4H0EA 3KCCA 3RPUA 5D4RA 3QPHA 2IP2A 3BJOA 3U1DA 1BI1A 1EV7A 2RGVA 2MH2A 3GLXA 3T8TA 5HLHA 3R0JA 3BPXA 2M45A 1TTYA 3WTVC 3FM5A 1TNSA 2V1UA 1ZHFA 3V7RA 3IC7A 3J81K 1HBXG 2DO7A 5FLXK 3GZ5A 3RKWA 2M30A 3E6DA 1ZLKA 1TW3A 3QAHA 4IPAA 1XSVA 1U3EM 1WRJA 1ON2A 4HLXA 4RB3C 4GYIA 1LNWA 3TDUC 3K1NA 2A3SA 5JHUA 3ABTA 2QUFA 1YFHA 1BN5A 1FPQA 4M9SA 2P6SA 4EJWA 2BBYA 2XHKA 5D5XB 1T0FA 3IRRA 4QWQA 1UFMA 2PG4A 2MBFA 1FX7A 5H20A 3HTUA 2ZBKA 3V4GA 3HRSA 2IJLA 2ZKZA 2XV4S 3JTGA 1XB4A 3ECHA 1IF1A 1A04A 4N0BA 4HYEA 2FBHA 3LFKA 1GHCA 5ICFA 3RPQA 4U0YA 5LHHA 5AIPA 1R1UA 2LF8A 4IVNA 4P55A 4ENMA 1S8NA 2QYOA 2WV0A 4KNYA 2PMHA 2COMA 1RZ4A 3E5UA 3GZ6A 3KETA 1KU9A 3LA3A 4A12A 3AAFA 5CVIA 4WX9A 3J80K 3FMQA 3VEPA 1Z7UA 4Q48A 3VB2A 2LNBA 1R58A 4AD9A 4HAMA 3G73A 1RIOH 4IHSA 2EFNA 1UHWA 5ILSA 1IXSB 5HOOA 3E6MA
chains in the Genus database with same CATH superfamily
1W7PA 2LY1A 3IUOA 1K79A 1TT0A 2E19A 2L3DA 3RKXA 4AM3A 2L02A 3KP4A 5IPAA 4UY8I 3M1CA 3QOPA 2H09A 3A03A 4XM3A 5KVRA 2RN7A 1U8BA 4NB5A 1ENHA 2DPUA 5J1UA 1MGTA 1P92A 5F6FA 5HDNA 2EQRA 3ONQA 4XLFA 2F48A 1T38A 5E8GA 3C2HA 1J5YA 2ZJ2A 2BZTA 2E1MC 4AYBN 2OQRA 1V5FA 2X6OA 2BHZA 2CU7A 3TW7A 4CH7A 3LA2A 2H6BA 4FX0A 4C2MJ 3PO3J 1R7JA 3WTZA 1XMAA 3D5RC 5D8KB 3DCFA 2L9RA 4L9VA 3TQNA 1A36A 1GVDA 4PCQA 1BIBA 4M6YA 4XLPF 3ZQQA 2HOEA 2OZ6A 2VKVA 2YUSA 3OYKA 2HS5A 4KN7X 3JRGA 4MFEA 5JLWA 3K4BA 2WC2A 2O8XA 3S93A 3OL4A 4GXOA 4BY7J 4BS9A 2VT3A 3WU2C 4IQ4A 3QRFF 1O3RA 2H94A 2EH3A 2F6CA 2HR3A 1IUFA 2M87A 1MMSA 1LE8A 2WY8Q 1ETKA 2Z99A 1TWCJ 1HW5A 2JA6J 1F36A 2MH9A 2A07F 4HG2A 1VQMI 4HV6A 3VYUB 1SD7A 2R7WA 3HSRA 3N97A 1APLC 4A3IJ 1OYWA 3H3UA 2XF5A 2DYRH 5M5YJ 4HNUA 3CJRB 1R5HA 1ZG5A 4YIIA 3L1PA 3H1CA 1XS9A 2KT0A 4I7HA 3MN2A 1BI0A 1IG7A 4KMFA 1X1AA 2EK5A 2JRTA 1SVMA 1HQCA 3M7GA 4L5IA 2YS9A 3IP4B 2HGCA 1B6AA 4LB6B 3BG7A 1PYVA 2DN0A 1K7AA 1VQ6I 1BC7C 4BEHA 3VWBA 2NAZA 3GW2A 4CZZA 1FBSA 1S9HA 2WAQA 2HTSA 2O8KA 2OCEA 3WTTC 1RKWA 4BBRJ 4ZC3A 1U5TC 2KIMA 2WB1N 3EETA 4BACA 3A01A 3WODF 1G4DA 1MNEA 3PSFA 2HXOA 4BHCA 4GRIA 4NUBA 1ZH5A 4G9YA 5KHDA 4KMUX 2K85A 3LWFA 1MD0A 1OCTC 2EIMH 2NRAC 5C4XJ 4RBOA 3BZCA 5LBQA 1T8IA 3K4JA 4X0GA 3CCQI 4WXDA 5DDGA 3GTLJ 5DEQA 2QWWA 3FXRA 4CA0A 1D3YA 2LMDA 2OTJI 1BR2A 3QPLA 3S3MA 4BHBA 3V8LA 3MAJA 1RR7A 2XAQA 2DI3A 5L3CA 3CCVI 2PJPA 4EM0B 1OCPA 3HOUJ 1GT0C 3GLLA 4MLOA 3OYBA 2QQAA 2Y9ZA 2HNHA 3M8JA 4YEJA 2L4MA 2Z1DA 1VZ0A 3CDLA 1DQUA 4M3GA 4LGWA 5DS9A 2F2EA 1D1BA 4GGGA 2EZLA 4RGXA 2Y31A 3KYDB 3JRAA 4E7IA 4HX8A 3S1MJ 3HB9A 4AIHA 1IN6A 1X1CA 3I9V2 3O3KA 1YIJI 3U2RA 3I71A 4YRVA 3TKYA 3C18A 3LSKA 5JLXA 5E3MA 4M9ZA 2V6EA 3K4LA 3KZZA 4A3DJ 1SMTA 3W6JB 5B5EC 3MWMA 2JUGA 3K1MA 4WF2A 4GCVA 3OIPA 1IXRC 4XKBA 3HUGB 2Y2ZA 3FXJA 4J00A 1TP4A 2K4JA 4F7ZA 2RAEA 1VQKI 2ZJQF 3CC7I 2VUMJ 4DZPA 4FASD 4HBLA 3IH3A 4LK0F 2XUBA 3ZOBA 2D1HA 2O5RA 2QM3A 4RAFA 3OR1C 1J9IA 4A0YA 3DBHB 2P0WA 1C0WA 1MBFA 2FBIA 2Y0MA 4KIFA 4RDUA 4XRSA 3FIWA 2CFOA 1IZ1A 5LEKA 2ME0A 5EDNA 1SFUA 4BJTA 2OUMA 2WV1A 4LOCA 1LFUP 3BR1A 1O7FA 3HRTA 2IGOA 4B09A 2L7KA 2WA0A 3AL0B 4M3FA 3GWZA 2MA3A 1IV8A 1ZG3A 1LB2A 2GIZA 3K2AA 4M3DA 5IYCJ 2PEXA 3T5XA 5HLGA 3JR9A 2EFWA 4QPOA 1YS7A 2EINH 5CYVA 1Y1WJ 2ZFWA 3L00A 2Q0OA 3L2UA 1XCBA 4AVPA 2M3AA 3SYTA 1Z77A 4E6KG 4OIPF 3B6CA 1R1VA 2STTA 2DA5A 1KU3A 1H88C 1TNTA 2OQGA 2ECCA 2WTEA 1FZPB 4PJNA 1WJCA 1XDSA 5LEJA 5FKOA 4RAZA 1P6RA 3W2WA 2EV6A 3FXQA 2M5WA 2Z16A 5HLIA 1DDNA 2CW0F 5IY5H 3MZYA 3S1NJ 4WXCA 2DDAA 3A02A 3QPTA 2IGNA 2V79A 1K61A 3P9KA 5DM6F 4II2A 2BV6A 1KU7A 2DT6A 3BG3A 4A0ZA 3RKYA 4CCKA 1Q1HA 2ZSIB 3CCUI 4NNJA 2A61A 3M3YJ 1R1TA 2K3PA 3JRDA 1K78B 1PUEE 1LVAA 1OKRA 2DXIA 3S1QJ 3TGNA 1NK3P 3HPHA 1V3FA 3ZP5A 3ZN0A 3GTMJ 2E7XA 3TP3A 3V7CA 5IT9Z 1B9MA 1PVEA 2OJED 3HDDA 4M3EA 4I6ZA 1A5JA 3SQNA 3U9GA 2NS7A 5F27A 1JT0A 3ZN1A 3LQRA 3K1PA 2F4MB 4G6QA 4L9TA 3IKVA 1TLHB 3V8JA 1AHDP 2X51A 1Z7LA 3IRQA 3QYBA 2HKXA 2P5KA 1FMVA 4XSXF 2R7FA 1BBYA 3HOVJ 4MGRA 1RR8C 2L7FP 2Z5UA 2CW8A 3WGGA 5FFZA 4S04A 1IUYA 4XKCA 2RQPA 3DKWA 2ZO4A 2NVYJ 4RGSA 2D5VA 2GQQA 4XN3A 5E3LA 2VIXA 4KUMA 1RC9A 4XONA 2P6TA 3H5NA 3TEDA 2XAJA 3HOXJ 2QVOA 2JK3A 4BHPA 2RVCA 5IP9J 3ZMVA 2LR8A 3KEQA 4GO1A 3ELKA 4G6DA 1QHGA 4S05A 1ITYA 1FLIA 4EM1A 4IOCF 2JJ7A 2MLGA 2R7SA 2XRNA 2K40A 2FMLA 1S3JA 4A93J 3KEYA 2EIKH 1ZELA 2HZTA 1VF9A 1NHAA 4P5OA 3F8MA 3QYEA 4Q5SF 4BQQA 1XC5A 2UV1A 3BR0A 5AIQA 5KNLA 2H8RA 1RI7A 2ID6A 1O57A 1R22A 3PQKA 2PMZN 1DP3A 3I53A 5FKMA 3OR2C 1TW2A 3BR5A 4HW0A 4NDLA 2R5YB 2P5LC 3DEWA 3HGGA 2LVSA 1SAXA 4OAYA 1JKOC 1TZLA 1TQMA 5B3SH 3FX3A 3GF2A 3SEQA 3T1BA 1VQNI 2K3FA 3TDZC 4DW6A 4WWCA 3Q0WA 2RREA 1OYIA 1HDPA 1QZYA 3WE3A 1S5LC 3TL4X 2LOOA 2FJ1A 1VNDA 3LSJA 1BW6A 4ENKA 4YFNF 4C30A 1T08B 2KRHA 2R0QC 3MD2A 3HUGA 1MBGA 3CCYA 4A6EA 1HKQA 3GVAA 4KIGA 2DQLA 3NAUA 3KFWX 5FO5A 4K2EA 1L3LA 3S17J 4LJZF 4BJ6C 5CVUA 1WQ2A 2ZMEC 1MW7A 5J8CA 5K1YA 2ACJA 2O6GE 4QLCU 3KP7A 1UHMA 2KLOA 3SJMA 4C2UA 5F08A 1J7KA 2XPUA 3X2QH 3F0CA 3PIPF 3CLOA 4M73A 5EEGA 2DA3A 3LSIA 3CCJI 1X4PA 5LHGA 3WTUC 1G8XA 1I5ZA 5BPDA 1DU6A 5J4YA 2IA0A 2CV0A 4LK1F 3GZNB 3K10A 1K4TA 2FUG2 3VSKA 4EJOA 2VKDA 4D5CA 4Z2YA 2Y75A 3LQQA 5M3MJ 3QPSA 3MKZA 4JBAA 4ZDLA 2OD5A 1HF0A 2KRCA 3BWGA 2L7MP 1YW9A 1QA6A 3ESWB 4RB2C 3BZ6A 3TOAA 2XDVA 1S7OA 2W85A 1W5TA 1FEXA 2CG4A 2CWEA 1FOKA 5E20A 2MD0A 3ZQHA 2HQAA 4ESFA 3K4CA 3F6OA 4MEXF 2OC6A 1OQYA 5CLSA 5F0CA 1JE8A 3K4KA 4D0PA 2EIJH 2DA6A 5K7ZA 5FJ8J 2Q2EB 1VI0A 4HPQA 1WHUA 5LLQA 1BI3A 5B1BH 2DW4A 1MNDA 1FMWA 3DLAA 3RZOJ 2ISYA 2HU9A 1WCMJ 2IVMA 2HKOA 4RGRA 2EILH 4ZYEA 1XGMA 4Q47A 4YIRX 2C6YA 1FTZA 3S2WA 5ICCA 1FBUA 3GFMA 3ML6A 4PFPA 3RKQA 4RAYA 2P7VB 5A2QZ 2L9NA 1BC8C 1OISA 3A0BC 2HFHA 3FKJA 1K78A 4BQOA 4NC6A 4EJVA 1E3HA 5KAIC 4PJ0C 2R7ZJ 2EB7A 1IRFA 4LLGF 1XCVA 1QQIA 5EGOB 1BW5A 4CCLA 3L2CA 1JJ6C 2XAUA 3JCUC 3MKLA 3H9JA 3WGIA 1Y0NA 4WXHA 5DCFA 2OZUA 4YELA 3BR3A 2MGQA 3K70D 1ZGAA 4EJUA 4BNCA 1R5ID 2ZXWH 1F5TA 4HF2A 4WK8F 1VQ5I 2ZXIA 4HX4A 1KZHA 3VYTB 4ENNA 4UNOA 3H9QA 3WTXC 3P9IA 2VBZA 4ZYAA 4V2GA 4B4CA 1UJ8A 2JPBA 3HXLA 1X3UA 1Y6IA 4CCJA 4A3EJ 3MZHA 1B8IB 1LDDA 4GFBA 4E7HA 1ZN2A 1MIJA 3BCAA 4A3JJ 4IRHA 1WI3A 1S6LA 3I54A 2QZ8A 2BY0A 1Z9CA 2L9VA 4QSHA 3T8RA 1Y56A 3OV8A 4R79A 3Q9SA 2XGXA 3WTSC 2E36A 1TC3C 4JQFA 2QEXI 2IT0A 4U88A 1BOBA 5EF6A 4KN4X 1ZQ3P 2CQQA 2X6WA 1G2HA 2CW7A 2W57A 2WAEA 2DU9A 4XR6A 4EJTA 3K2ZA 5HDGA 3W6KB 3KP5A 2N8GA 3PNVA 2CUZA 2XAHA 1WPKA 1RPWA 5BPIA 2J5OA 2DCEA 1P4XA 3R0AA 3CC4I 3QODA 4W1UA 4L0ZB 5GTHC 4I76A 1OJLA 2EZHA 2IEKA 1X58A 1FSHA 3DP7A 2NNYA 5D5WB 4MTEA 1WSUA 3VODA 2LC2A 3A0HC 1X3ZB 4RS8A 2BW3B 2E1MB 1D0YA 2GXGA 2QQBA 4LMYA 2R5YA 2VJJA 2FXAA 3ZQIA 1FOWA 1WJBA 3GTPJ 4FISA 3QP6A 1QPMA 1RETA 3ZQLA 2V6CA 1JTYA 4OOIA 3BG5A 2PN6A 2JPCA 1GUUA 2ZNZA 3BTJA 2MW8A 2VJ4A 2A05A 2QCOA 1FP1D 4N4OB 2DAOA 4CYDA 4MFDA 5E1WA 4IRGA 4QTRA 2K27A 3SZGA 3BY6A 3SZTA 4X1EA 3RPUD 3CDIA 4BL0B 3FXOA 1VQ7I 1P7JA 3SFIA 4ZJZA 4OIQF 1OCCH 3DU6A 2J5PA 4UUVA 1E17A 2W1OA 3ZGKA 3G1OA 1J09A 1ZR2A 1XMKA 5EZGA 4DGWB 2VJ5A 4LFUA 5J3LA 2BXYA 2KISA 1RESA 2OAZA 3HOTA 2RNJA 3KLOA 3OYFA 1BL0A 1X3WB 2GOMA 3F3XA 1A6IA 2FF4A 3HGYA 1KYWA 2ZJRF 1Y1VJ 3F72A 2XAFA 2L7ZA 3P7NA 3QYFA 1W36C 4FX4A 1BR1A 1MMDA 5LGNA 3L7WA 3F9KA 1TQPA 3M1EA 3OYDA 1IN8A 1R23A 1N75A 2AXLA 3JTHA 5JVGF 3KE2A 4PJJA 5A2QK 2HPMA 4MTDA 1VQLI 3CMYA 2XSJC 1OCRH 1KU2A 4O3MA 1G3YA 4Y52J 1U5TB 1V4RA 1J2XA 5JI6A 2R7RA 1XTAA 2W7NA 5F04A 3EUKL 4RAGA 4ZDOA 3FMSA 1BJAA 1YW7A 2IW5A 2QKMB 3ZMDA 1B4AA 3NARA 4XLAA 3ZMTA 4D9JA 1F1ZA 5H6QA 1ZARA 2Q2EA 4AIJA 4R8HA 4EATA 5FKKA 3F23A 5FB2A 1AA7A 1SFKA 2CQNA 3HG9A 5FLVA 3I55I 2HDDA 4UB6C 2M4KA 4LG0B 1LJ9A 4ZYGA 1W1WE 4EQQA 4UV9A 2NVXJ 2QLZA 1WFXA 2JA2A 4C3HJ 1F9NA 2PJRB 4PK4A 1HDDC 4IXAA 1H9GA 1FJLA 1SD6A 2LP0A 3BJAA 5BS6A 3WE2A 2E2HJ 2QBYB 4ANJA 1IN7A 3GTGJ 2W00A 2XVCA 5EGOA 4B8XA 4E4HA 1W5SA 5E3OA 4JK1X 4RGUA 2IS1A 5IOYA 1YQAA 3KP2A 5L3BA 3JRFA 1OR7C 4J19A 4PSXA 3PNTA 2GZWA 3EDPA 2R93J 2V1XA 2JUCA 2X85A 4A3MJ 3RJPA 2H6CA 3QWLA 4AU7A 4ZZLA 4CUGA 3E6BA 1S29A 2VASA 3EUHC 3FXKA 1K83J 1YS6A 1R71A 1VQ9I 3FK6A 3JSOA 4U7DA 2FNAA 2V26A 5BQTA 1YLFA 1B8IA 5IP6A 5FD5A 4I0AA 2VBYA 2MABA 5J40A 2RDPA 5FGMA 2X1CA 3REOA 3RDIA 5EEHA 3L2WA 1MH4A 1HOMA 5FRMA 1P4AA 3QOEA 1ETOA 1ETQA 1JTXA 1UAAA 3A1YA 3CMMA 1JUSA 2UXXA 5FLMJ 2NOGA 3FK7A 3AG1H 2M8GX 1P9QC 3GTQJ 2O9LA 2K7LA 4LLLA 2XF7A 2Y69H 3M8FA 3JSPA 3C2BA 5E8IA 3I4PA 4O5VA 1WI9A 3GFJA 2IA1A 1Z0XA 3C3WA 1KQ9A 3CF5F 1TT5B 3J7AO 4DBRA 3RCOA 2XGCA 3CUQC 2FU4A 4R1HA 2EWNA 4IF4A 1IRZA 3FMRA 3PO2J 3GMEA 3PM1A 3PFIA 1BJZA 5AONA 1FYLA 1JGGA 4A6DA 5CKTA 4I2OA 1Z3XA 1R5GA 1ZKGA 4AUXA 2BW3A 2KFDA 2KPMA 2V4JC 4BKXA 1QRYA 3O8HA 1H0MA 2P81A 3BOQA 1I39A 1R00A 2LG4A 3BT9A 3OYAA 4IKFA 2F5VA 5GAHJ 2DMUA 2RV8A 2P4WA 3NQOA 2G9WA 4XRSG 2JSPA 2FQ3A 1BA5A 2BXZA 4MQVA 4B43A 1YYVA 4B44A 2JTVA 2M2EA 3IAS2 1DP7P 3B02A 2DJNA 2MFZA 5GAEJ 3JRIA 4GDFA 4M9XA 1R36A 2HOTA 3KP3A 3D5LA 4P9UA 1S7AA 2L0KA 5E3NA 1KYZA 3M8EA 4UUSB 5HDKA 4XMYA 3DPTA 3K70C 4ZYDA 1IAWA 1W4MA 2ZSHB 2ZC2A 2L2OA 1FSEA 3CJNA 4LG3A 2Z2SB 2DQRA 3ZRGA 2HYFA 1KGSA 2CO5A 4G8XA 2VBXA 4EVIA 4FETA 3Q3SA 4CCNA 3IL2A 4EGZA 1ULYA 3F6VA 2EA4A 4PGGA 1LEBA 2VE9A 4DZJA 3J7YJ 3LSPA 2GA1A 2E34A 3K9TA 4XQFA 2O0YA 1CF7B 4LD5A 2XIGA 3HSEA 2R92J 1U5TA 2V9PA 4GYGA 1Z3YA 5FKLA 3GFIA 1B1BA 2D2WA 1HA8A 4G7OF 3JAMZ 3S8PA 2RNGA 1SVLA 4Y17A 1ZAOA 1MDMB 2LRDA 5KCMA 3D1NI 3QU6A 4U87A 3TOBA 1LDJA 1EA3A 2NVTJ 3L09A 1WZ2A 2L4AA 4V2FA 2YX7A 1QBJA 2TDXA 3FZVA 4XORA 4DBQA 2E71A 4N4NB 4KT6A 2K9MA 3I4MJ 1IDZA 2LK2A 5DYMA 1T33A 4LG0A 2V9VA 1TL8A 4UUTA 3HKZA 4J01A 3WGHA 1SFOJ 3E1SA 2ZXJA 2W4SA 1IJWC 1MNMC 3OOPA 2IS6A 2DA2A 3BZKA 3CQZJ 4UVCA 2HDWA 3MZ8A 4MNUA 1Z6RA 2VT2A 4AWXB 4AVZA 4G7HF 2PJRA 1U0JA 3H0GJ 4QIWN 2DOEA 3IKTA 2BYVE 5K5RA 3C1DA 5L3GA 2A69F 1VTNC 4ZZDA 5JFRA 2WWYA 4DYCA 2QBYA 1LEAA 3ERMA 3BR6A 1FWZA 3K69A 2LH9A 3CLQA 3WHCA 5E18F 4E7KA 1AOYA 2FE3A 2P7CB 3J81Z 1PJRA 2XGDA 2UWMA 5FLXZ 2G7HA 1SEUA 1WJ5A 3BJ6A 4F52A 1OYYA 1K6YA 2KIUA 3I59B 3T0YA 3LOCA 1W36D 3DBRB 1UMQA 4FT8A 3ZQ7A 2PX9A 4BDZA 2KMUA 1Z67A 3CTAA 2BVMA 2OBPA 3DKXA 3GTJJ 4L9NA 1GLNA 3GCMA 4RM3A 2QA4I 4HQMA 1QZEA 4BAYA 5EG0B 2KJCA 1IN5A 1V55H 1Z6TA 4RA2A 1H89C 4IRIA 3DPUA 3IH4A 1QNTA 3MVPA 4XLHA 2LTPA 4BU2A 2LKSA 1XSDA 2JVHA 2ZMEB 3R4KA 1O3TA 1IRGA 5TGTA 3VDXA 3KIOA 4KJZA 1EH8A 4LIUA 3L9FA 3GTKJ 2XB5A 3K0LA 2AQFA 2VJIA 4LLNA 4JOMA 4DYRA 4FQGA 3CUOA 1GV5A 4CCOA 2M8EA 1I27A 3VYSB 4DYQA 3CD6I 3TO6A 4ENJA 2B9SA 2Y0SA 1ON1A 5J6XA 4HX7A 2X0LA 1YE9A 1XGNA 2XB0X 3KLNA 3NWSA 3TP0A 1DGWY 3OYLA 3CO7C 1YJNI 4KA4A 1QGPA 4XOPA 1IN4A 3H92A 4JP0A 1FYMA 2RC4A 4BBSJ 3ERED 3LSTA 5JVTA 1M1EB 3IHUA 1ZREA 2XAGA 3P9CA 1XMXA 2E60A 4G6TB 4B3AA 4BYYA 2ZCWA 1G3WA 5CPRB 1YTYA 3LMMA 2ZJPF 2VC1A 1IXCA 3N4MA 5FFXA 9ANTA 4HLYA 1JGSA 3LNQA 3LAJA 1GDTA 2F4OB 2K9SA 2XROA 4F3QA 3H9GA 2Z3YA 4PUSA 2DTRA 2WAQN 3H5RA 1F43A 1X1DA 5E1ZB 4HDUA 1U6GA 2EFQA 3GUDA 3EYIA 2BEOA 4M74A 5B66C 1EH6A 3AKZA 4P96A 2JRMA 3E6CC 2FEZA 3OL3A 3OS0A 4L18B 1BOAA 2M0MA 1T0FC 1P7IA 3AG3H 5K7FA 3M9AA 3OMYA 5IYBJ 2GM4A 2EV0A 3K6GA 2WBMA 2HQRA 3KP6A 3CMAI 3M07A 2W82A 1H9TA 4C2TA 5HVQC 4BH9A 1MKMA 3QU3A 4KYWA 5K7HA 5F0HA 3K4MA 3FF5A 2PI0A 4UUSA 2NVUB 1FC3A 2DMQA 3NRVA 1G3TA 2KIQA 4C3IJ 4Y13A 2XKOA 1AU7A 2FSWA 5D6EA 2WADA 3EUAA 2FQ4A 4B1RA 2AXTC 3S16J 2R4GA 3W3CA 3CP2A 4A3KJ 3ROUA 1SC7A 1MZBA 2XKPA 2EA2A 3S32A 2KKOA 1X1PA 4A69C 2IXSA 5IOZA 4LB5A 4CDGA 3BTLA 1YHQI 1EF4A 3BG9A 2TRTA 3C7JA 3J80Z 1D1CA 2KL4A 4XICA 1I6HJ 2HEOA 2A6EF 1ACIA 4KISA 2IS4A 2KHMA 5TJJA 5IT9K 2CGPA 1ZRFA 3VOEA 4C3JJ 3HRUA 1U2WA 4E7LA 2DFHA 5CVVA 2M9HA 4EV0A 2NNNA 3NEUA 4HNVA 4KICA 4G7ZF 1CF7A 4NC8A 3KEOA 2IA2A 3GBGA 1E2XA 2LLKA 2NS8A 4HF0A 4PJLA 3GTOJ 2Y30A 3F8NA 4L9JA 5GAGJ 3WG9A 4YG2F 1RKTA 5HODA 1U8RA 1F4KA 3FKIJ 2L5QA 3O8GA 1LFPA 3ISPA 4NC7A 1MDMA 1ERDA 2HVQA 3IWFA 1OMIA 4HZFA 4ZTJA 1G59A 1V5GA 3CZ6A 2Y48A 4LITA 1ZRDA 4I09A 3S2HJ 4NBQA 4CXFA 4I0BA 2V1NA 2LKPA 3ECOA 1A35A 3CJQB 2CMPA 2HXIA 2X6XA 5JR3A 1XSXA 3I5UA 1JXSA 4BY1J 1HCRA 3GO5A 4NHJA 2M34A 5EJCA 4PGHA 4E7JA 1D1AA 1YG2A 3Q0UA 4ITVA 4KITB 2UUZA 2VQCA 2X6YA 3ULQB 4CSWA 2CH0A 2VI6A 4XLCA 3CESA 4CZCA 2JMWA 3FM3A 3G1MA 1D8JA 3VYRB 3S2DJ 4ESJA 2LD5A 3DFGA 3E7LA 5DCMB 4I99C 2DJIA 3DF8A 4CICA 1ETXA 2R7UA 3R60A 3FBIB 3ABUA 1T6SA 2VOOA 3CCLI 2NOJB 4FE7A 3H5AA 1D0ZA 1ORKA 4DNCA 3OIQA 2NVQJ 4AC0A 1ONVA 3B6AA 2HDCA 2XRLA 1MH3A 5CJ9A 3OS2A 5B1AH 2ESHA 5ICGA 3I59A 1J0RA 2LBFB 4BXXJ 1YO5C 3F22A 1BI2A 1HC8A 4O6JA 5J1YA 2K9LA 3UR3C 5EG0A 3BDDA 1VFCA 1HW2A 1ETVA 5HLTA 4IHVA 1NG6A 2KRFA 3W2AA 2ESNA 1USTA 2TCTA 1HKSA 5L3DA 2ZMEA 5D8LB 3CO6C 3FXUA 2GXAA 2Z9OA 1QU3A 1UHSA 2W48A 4AIKA 2DODA 5CVJA 4OINF 4DIQA 4F93B 1HKTA 3HHHA 2GAUA 1JJ8C 4ON0A 2XF6A 4DOZA 3FBNB 2L54A 2ISZA 4ESBA 5CQGA 5LHIA 2CUFA 1RUNA 2AQEA 2DK5A 2ME6A 2ADUA 1YITI 1UG0A 4HV5A 5F64A 5ICEA 1IV6A 1S7EA 1SFXA 3HSFA 3E5QA 5IT3A 1LKXA 4XN0A 1G6NA 4YIFA 3HOSA 4F91B 2VB6A 2W84A 2JVGA 3JRBA 2M1BA 4XLEA 1MJBA 1FTTA 2GLOA 4CHUA 2G7UA 3E0JB 1VQ8I 3I3LA 1RNLA 1LUJB 3LSGA 2DOAA 4HNTA 2F5FA 2KQRA 3J7AY 1Q1VA 1XN7A 3PQJA 2H1LA 2MD5A 4FHTA 4HSTA 3HM5A 3L2VA 2Y9YA 1FT9A 3B73A 2O61A 3ABMH 3I64A 1O3QA 1Z91A 2D1VA 1FP2A 2Q1ZB 4L5EA 5HNHA 2O3FA 1DU0A 5BMZA 2CQKA 1BM9A 3IWZA 5E17F 2H1KA 2DA7A 2HPIA 3JRCA 3SFZA 5D5VB 2JA7J 3RYPA 4P9FA 2OV7A 5HS7A 3H3ZA 4XRFA 3IV5A 2FBKA 3OIOA 1DPUA 1ETYA 2QGUA 2VKEA 1XX5A 4BGDA 1YI2I 2JA8J 3BR2A 2PMUA 3SEZA 5ED4A 1XPXA 3BG6A 4A2UA 1MBHA 4Z6YA 3GX4X 3TBIA 5L3EA 2K9QA 4A0XA 1QZZA 2VXDA 2H27A 3DBLB 2W25A 3KZYA 4IEJA 2DTZA 3ZCOA 2YU9J 3FXLA 1SD5A 3F21A 1YRNB 5C44J 3S14J 1K6OA 1NK2P 3O2PE 1FIAA 5CVRA 2GWRA 4IHTA 2KP6A 1ETWA 1ZRCA 2VQHA 2VL8A 2A6TA 2PQ8A 3CF2A 3HZJA 2JA5J 1P4WA 1FNNA 5LRSA 3ZQGA 1Z05A 5IP7J 1WJFA 1EKEA 3BC8A 2VLAA 2IBDA 3DQVC 4UB8C 3WHBA 4A3CJ 1GXQA 2ZB9A 3COAC 1LQ1A 4HOBA 4KFCA 3U1KA 4F55A 1E3PA 3CCRI 2EFOA 1LDKB 1JHFA 3ZMUA 5K5OA 3RTRA 2XC7A 2BY3A 4IL6C 4ASNA 3HOZJ 1QVTA 3U21A 3OYIA 2DT7B 3ZR8X 2CQ7A 2K4BA 2PBIA 3M4OJ 1REPC 4HRIA 5KK1A 2VODA 3F8CA 3BPVA 1O7LA 3DEUA 3ASNH 4MHGA 1J75A 1V54H 5LD2C 4RB0A 2RQQA 3LA7A 2HYGD 1NH3A 1HSJA 2BOLA 4XNFA 4A5MA 1D8KA 2V7FA 3OWTA 2M7AA 2VOPA 3OS1A 2ELHA 2MC3A 2X48A 2XASA 4MQ9F 2AO9A 3CUQB 1FOXA 4NQWB 3ZPLA 4IHYA 3RYRA 5F1RA 2HVRA 3CCSI 2V1DA 3H36A 2BHYA 1W5CC 5DV5A 4YFXF 2A5YB 2VQLA 3MFKA 1XGSA 1JHHA 1T39A 3LSHA 4ZH4F 2BE5F 2QQ9A 3OY9A 3HHGA 2YPRA 1MBKA 2XPWA 1ZLJA 2PMZA 4JYKA 1E3OC 4M3BA 4M71A 2CSOA 5IYDJ 3VSLA 4OIRF 5CQEA 5DCMA 2LYCA 1G3SA 4ZYHA 3P5JA 1CGPA 1FYKA 4IOAF 2R7VA 1TWFJ 4BXFA 1NG7A 3KYCB 2ECBA 4CGZA 1OLTA 1DUXC 3TO9A 1PP7U 3DKYA 4PDKA 2OU2A 3FXMA 1SFEA 5DUKA 3HC7A 1MJ9A 3TO7A 3MEXA 1YIOA 1R49A 3DTKA 4D1QA 2QENA 2LBFA 2JQ7A 3OYHA 2QSFX 3CMEI 2K5CA 4AIDA 5FRNA 3BQYA 4U0VA 5LGTA 1STZA 1UB9A 2X4HA 1XDUA 2X1DA 4BUPA 3PFYA 5C4JJ 1JKQC 4BJ5C 4D7NA 2BGCA 2KZVA 3D5SC 3OOUA 2DBBA 2CFXA 2DA1A 4W97A 3MCZA 1ZTRA 2QKLB 3GYHX 2CUEA 6PAXA 1N78A 3BROA 2IPQX 3EPZA 5LFAA 1T98A 2DMTA 4Y33A 4BQAA 2HOSA 2DLLA 3W2VA 4OAZA 4E70A 4BQNA 1WKMA 1FY7A 2Q8KA 1O4XA 2YU3A 4OMZA 4HF1A 2BY1A 2DFEA 2Z33A 5ERIA 1X2MA 3QP5A 1UG2A 2CYYA 2ETHA 1Y0UA 1KA8A 2M7BA 1V5EA 3BCBA 1DGRM 5C3EJ 1KQ8A 5D4SA 1J59A 5L3FA 4OWRB 3OYGA 2HVSA 2K86A 3CP8A 2E1NA 5M3FJ 4UVAA 1R4NB 1WVRA 2I5UA 1L0OC 2HOAA 2VN2A 4IJAA 3ZMZA 5ILUA 1TBXA 5J4VA 5LGUA 3PUBA 1WWXA 2FMYA 1DPRA 1W7PD 2DT5A 5H6RA 2I10A 4QPQA 1SD4A 2FNPA 2CV1A 1B59A 2O03A 2A68F 4A3FJ 4PZJA 1AWCA 4ABZA 2VBWA 3HTSB 2F5EA 3PL8A 2HQNA 2LF7A 4UVBA 2K02A 1LVKA 2B7EA 3EYYA 4U0WA 3L2QA 4YFKF 3S1RJ 2R7OA 2VQGA 3GEZA 1Y39A 1ZGJA 2DOFA 3DPLC 4D5FA 5D5UB 1YW8A 4ETSA 4RM2A 1KQ0A 2B0LA 4XLNF 1HW1A 1UCRA 2GBYA 3RSNA 4UV8A 1RUOA 1R6RA 4XK4A 2RKHA 1WJEA 2PFBA 2QSHX 1A6QA 1B9NA 1HSTA 2E35A 4ZDPA 3WTWC 4CYCB 2UXNA 2OCCH 1BIAA 4ZTFA 2F4IA 2VXZA 1SANA 4L5JA 3S15J 2PLYA 1QHHD 2OA4A 1JKRC 2EBIA 5ILVA 3ZQCA 2KDOA 1X2NA 5F1JA 5E1XA 5D6FA 3OYMA 3Q0VA 4RB1A 1D5VA 2FOKA 4XRMA 2GA2A 2JSCA 1U78A 1YRNA 2L01A 3GFLA 2R3SA 2EJRA 2VPRA 3G6EI 1OR7A 2HWVA 1PDNC 4CO8A 4A5NA 3LAPA 3HOWJ 2GIVA 1LFBA 3QQAA 1I6XA 4EMSA 3CJTB 3JRHA 4IZZA 4XBFA 2W24A 3DU5A 4EM2A 4X6AJ 2EZIA 4Y15A 1MMAA 2A5WA 2FRHA 3Q9VA 4V19K 1YX5A 2CQXA 4MO7A 1LPQA 2X9DA 3V7SA 3E5XA 3HOYJ 1ODDA 3LFUA 2VKHA 2COBA 3EUHA 1MSEC 2DMPA 1X19A 3BTIA 4B47A 2FX0A 3VFZA 2VE8A 3A4CA 3IH2A 4BXUA 2MYSA 3AG2H 4Q4ZF 5GADJ 3ASOH 3OYJA 3OSGA 4DJAA 1WJDA 2P5VA 2ELKA 2IGKA 2KJBA 4OU0A 1I3AA 2NS0A 1POGA 3EQLF 1JT6A 3DXJF 2AHQA 4EGYA 4G94A 5LRRA 2EV5A 4KT5C 5BOXA 1TWAJ 2XSDC 4KDPA 3RIRA 4FE4A 2H8WA 2ELJA 1EH7A 1QO0D 3GXOA 2IRFG 2EPFA 2HYJA 4IQJA 5GPAA 2UZKA 3BTCA 2ID3A 1CQTA 2WAFA 2XPVA 4MEYF 3RI4A 1PP8F 1JUMA 5HNFA 1MMNA 1B72B 5DTDA 1K4SA 4A3GJ 4L0YB 2CUJA 1TQIA 1USSA 4BDYA 3CUQA 3BLYA 2DPDA 4I02A 2LFBA 2D45A 1ZK8A 4NQWA 3PSIA 1OFCX 1MMGA 5HS9A 2CJJA 3DTIA 3SHFA 2E7WA 2R5ZB 5J8FA 3MMYB 4OMYA 4M6VA 4XL9A 4M6XA 1GVJA 3CDHA 4II3A 1T2KA 4N9HA 2DK8A 4Y4RA 4HDVA 3JW4A 4P1WA 3O6BB 1P2FA 3KPHA 1RRJA 2X1EA 3AL0C 1SAUA 3H35A 2E5NA 2LY9A 1WGXA 3F8FA 2A6HF 2CS3A 4M72A 4E7ZA 2I8DA 1FBQA 2HI3A 4OIOF 2HTJA 4XKVA 4RMNA 2GOXB 2EFPA 4XOTA 2AS5F 3A2KA 2IAIA 3HRMA 3I0TA 2WY7Q 3D0SA 2FA5A 3FHNA 1TWHJ 1SMYF 3HYIA 1R9TJ 1QVUA 3F8BA 4HQEA 3DLLF 4I98B 1ZYRF 5HS8A 1AKHB 2ICWG 3RQIA 3JREA 3NWTA 3FHZA 3G2BA 4N9IA 4XKWA 2JZYA 4WCGA 3I56I 5GTIC 3SXYA 4B48A 1YJ9I 2HQ5A 5EEAA 3R6SA 3RQ4A 3L2RA 2F5CA 4BE1A 3WU1B 2P8TA 2OTLI 4U7BA 3WG7H 2DFFA 2LSOA 1MBEA 4I01A 2ZFUA 1XG1A 1XGOA 4F92B 2KIFA 2YX4A 2R7QA 2NYXA 2DA4A 5J47A 3AFHA 3S3OA 2E1CA 2LY2A 3I58A 3G71I 3PJRA 2E2IJ 3ZMSA 4DQ2A 2R7DA 1SVOA 2VC0A 1IDYA 3E3VA 2E2JJ 1O3SA 2ZNYA 4BE2A 1VQ4I 4XIDA 1Z1DA 2YR2A 2LDUA 4KIBA 4PFOA 2MG4A 1UELB 2DFIA 4A3LJ 5DD4A 5GP9A 3WTYC 3WU0A 5TRDA 2YSRA 3FWEA 3DV8A 3MQ0A 1X4OA 2MLKA 3BP8A 4XSZF 4AYBA 1GXPA 3HIFA 4TV7A 4FTHA 4Y7NJ 1XD7A 4A3BJ 1I1GA 4HA8A 3H3VK 2STWA 5FD6A 2B63J 1MBJA 2L9SA 3G3ZA 4LIVA 1PUFB 2GXBA 3LSMA 1ZG1A 3V8KA 5DD8A 1I1SA 3SDGA 5K5QA 2R7TA 1HXDA 2JT1A 4UHTA 1Y8QB 3Q5FA 2F5DA 1JUPA 1KONA 1T95A 3H0DA 1Z21A 3LSRA 3G4SI 4JX5A 2KZGA 3SZPA 2VONA 1ZR4A 3AG4H 1OPCA 3OSFA 4CYCA 1EJ9A 1W7PB 1MJAA 3E97A 3JAMK 1IW7F 4C9YA 2QSGX 1MSFC 1IO2A 1TWGJ 3R61A 3OYCA 3KYLA 2FD5A 5DUIA 4UXNA 1YJWI 4IHWA 4H0EA 3MKYB 2BY2A 3KCCA 2DMNA 1ZGWA 3RPUA 2LKXA 4IX7A 5D4RA 5E79C 2CV2A 3G1LA 3CCEI 3QPHA 2IP2A 3BJOA 4HSRA 2V9KA 3U1DA 3TW6A 3OYNA 1BI1A 1IGNA 1W0TA 1EV7A 5J1RA 2RGVA 2MH2A 3GLXA 3T8TA 3BQZA 5HLHA 3R0JA 5M5WJ 1D5YA 1S72I 3BPXA 2M45A 1TTYA 3HL2A 2WB1A 3CCMI 3WTVC 2OPTA 3FM5A 2QF7A 1TNSA 5EZHA 2V1UA 2FOWA 3UKGA 1ZHFA 3V7RA 3ZXSA 3IC7A 3J81K 1W0UA 1HBXG 2DO7A 3MKWB 5FLXK 1IRXA 3GZ5A 1UZCA 4H4KC 3RKWA 2M30A 2NXNB 3E6DA 1WH5A 1WJAA 1LE8B 1ZLKA 2QQ8A 1TW3A 2JWTA 3QAHA 4IPAA 3K4NA 1I50J 1XSVA 1U3EM 5H2FC 1B72A 3K7AJ 1WRJA 3ABLH 1ON2A 3FDYA 3SDBA 4HLXA 4RB3C 1JKPC 4GYIA 1LNWA 3S3NA 3TMOA 1D0XA 4D7MA 3TDUC 3K1NA 1JI8A 2A3SA 2M4GA 3DTEA 5DM7F 5EYRA 2R5ZA 5JHUA 3ABTA 2QUFA 4S0HB 1YFHA 1BN5A 4PJMA 1FPQA 1QPIA 4M9SA 1FOYA 4PSWA 4Y3OA 1OCZH 2P6SA 3HEFA 1YX3A 3HJEA 4EJWA 4BEHB 2BBYA 2O7OA 5M5XJ 1E0EA 2IGMA 1X1BA 2DYSH 2IS2A 2MSYA 2EZKA 2XHKA 5FKNA 5D5XB 4CCMA 1T0FA 3IRRA 4QWQA 1UFMA 2PG4A 2CRGA 3HBLA 3A01B 2JN6A 2MBFA 2LREA 1FX7A 3IAM2 5H20A 2OF7A 2BVLA 1BR4A 1N25A 1AKHA 1YOVB 3V42A 3ABKH 4RLQA 3HTUA 1WH7A 2ZBKA 4JX6A 5F0FA 1T56A 3V4GA 1N77A 4IO9F 3HRSA 1FIPA 2IJLA 3KX2A 3HKZN 3CC2I 2ZKZA 2XV4S 4BE0A 3J7ZI 3JTGA 2G0EA 1XB4A 3FISA 1I3QJ 3ECHA 2KDZA 1IF1A 1Y8RB 1A04A 1VQPI 2M0CA 2HZDA 1H8AC 4RLFA 3DEEA 4N0BA 4IHXA 4HYEA 2FBHA 3LFKA 1GHCA 5ICFA 3RPQA 4U0YA 1R4MB 5LHHA 5FROA 5AIPA 1R1UA 3I4NJ 2LF8A 1GV2A 3N05A 1OCOH 2VPLA 4IVNA 3DWLE 3PIOF 2MC4A 4P55A 4ENMA 5BNGA 2E1OA 4G12A 4E7SA 1S8NA 1NTCA 2QYOA 3OYEA 2WV0A 2R7XA 4KNYA 4EEFG 3HPGA 2PMHA 2COMA 1RZ4A 1HLVA 3C2GA 3VPRA 1VQOI 3E5UA 3GZ6A 2E5ZA 3KETA 3UNGC 5GPCA 3LL7A 1KU9A 3LA3A 1U9NA 4A12A 3AAFA 5CVIA 4WX9A 1PUFA 1A31A 3ZQFA 5JHFA 3FMQA 3J80K 1U9OA 2XGEA 3VEPA 1Z7UA 2K9NA 4Q48A 3VB2A 5TISC 2LNBA 3W6VA 2ZXHA 1R58A 4AD9A 4MIMA 4HAMA 3G73A 1RIOH 4JX4A 1IC8A 2DDBA 4B3XA 4HEA2 3PNYA 2Y0SN 4IHSA 4FCYA 3KZIC 2EFNA 1UHWA 5ILSA 3PUFA 1IXSB 5KAFC 5HOOA 3RZDJ 3E6MA
chains in the Genus database with same CATH topology
1W7PA 1K79A 2L3DA 3RKXA 2L02A 3KP4A 3QOPA 2H09A 5KVRA 2RN7A 4NB5A 2DPUA 1MGTA 1P92A 5F6FA 5HDNA 1T38A 5E8GA 1J5YA 2ZJ2A 2OQRA 3LA2A 2H6BA 4FX0A 1R7JA 3WTZA 1XMAA 5D8KB 4L9VA 3TQNA 4PCQA 1BIBA 4M6YA 4XLPF 2HOEA 2OZ6A 2HS5A 4KN7X 2WC2A 2O8XA 4GXOA 2VT3A 3QRFF 1O3RA 2H94A 2HR3A 2M87A 2Z99A 1HW5A 2MH9A 2A07F 4HV6A 1SD7A 3HSRA 3N97A 1OYWA 3H3UA 1R5HA 1ZG5A 4YIIA 4I7HA 1BI0A 4KMFA 2EK5A 2JRTA 1HQCA 3M7GA 4L5IA 2HGCA 1B6AA 4LB6B 1K7AA 1BC7C 2NAZA 3GW2A 4CZZA 1FBSA 2HTSA 3WTTC 1U5TC 2KIMA 3EETA 3WODF 1G4DA 4BHCA 1ZH5A 4G9YA 4KMUX 3LWFA 1MD0A 2NRAC 5LBQA 4WXDA 5DDGA 5DEQA 2QWWA 3FXRA 1D3YA 4BHBA 3V8LA 3MAJA 2XAQA 2DI3A 5L3CA 2PJPA 4EM0B 2QQAA 2L4MA 4LGWA 2F2EA 4GGGA 4RGXA 4HX8A 4AIHA 1IN6A 3O3KA 3U2RA 3I71A 3TKYA 3C18A 4M9ZA 3KZZA 1SMTA 3W6JB 3MWMA 3K1MA 4WF2A 4GCVA 1IXRC 2K4JA 4F7ZA 4HBLA 4LK0F 2XUBA 2D1HA 1J9IA 2QM3A 4A0YA 1C0WA 2FBIA 2Y0MA 4KIFA 1IZ1A 5LEKA 1SFUA 1O7FA 3HRTA 4B09A 3GWZA 2MA3A 1ZG3A 1LB2A 2PEXA 5HLGA 3T5XA 2EFWA 1YS7A 5CYVA 2ZFWA 3L00A 2Q0OA 1XCBA 4AVPA 4OIPF 1R1VA 2STTA 1KU3A 1TNTA 2OQGA 2WTEA 1FZPB 1XDSA 5LEJA 4RAZA 1P6RA 2EV6A 3FXQA 2M5WA 5HLIA 1DDNA 2CW0F 3MZYA 4WXCA 3QPTA 2V79A 3P9KA 2BV6A 1KU7A 4A0ZA 3RKYA 1Q1HA 2A61A 1R1TA 1PUEE 1K78B 1LVAA 1OKRA 3TGNA 1V3FA 3ZP5A 3ZN0A 2E7XA 3V7CA 5IT9Z 1B9MA 3SQNA 3U9GA 3ZN1A 3LQRA 3K1PA 4G6QA 4L9TA 3IKVA 1TLHB 3V8JA 3IRQA 2HKXA 2P5KA 4XSXF 2R7FA 1BBYA 4MGRA 2Z5UA 3WGGA 5FFZA 4S04A 1IUYA 2RQPA 3DKWA 2ZO4A 4RGSA 2GQQA 4KUMA 2P6TA 2XAJA 2QVOA 4BHPA 2RVCA 3ZMVA 3KEQA 4GO1A 3ELKA 4G6DA 4S05A 1FLIA 4EM1A 2MLGA 2XRNA 2FMLA 1S3JA 2HZTA 1NHAA 4P5OA 3F8MA 4Q5SF 5AIQA 1RI7A 1O57A 1R22A 3PQKA 3I53A 1TW2A 4HW0A 2P5LC 1SAXA 1TQMA 3FX3A 3GF2A 3T1BA 3TDZC 4WWCA 1OYIA 1QZYA 3WE3A 4ENKA 4YFNF 3HUGA 4A6EA 1HKQA 3GVAA 4KIGA 2DQLA 3KFWX 5FO5A 4K2EA 1L3LA 4LJZF 5CVUA 1WQ2A 5J8CA 5K1YA 2ACJA 2O6GE 4QLCU 3KP7A 1UHMA 1J7KA 3CLOA 4M73A 5EEGA 5LHGA 3WTUC 1I5ZA 5BPDA 2IA0A 4LK1F 4EJOA 4Z2YA 2Y75A 3LQQA 4JBAA 2OD5A 3BWGA 1YW9A 4RB2C 3BZ6A 3TOAA 1S7OA 2W85A 1W5TA 2CG4A 2CWEA 1FOKA 5E20A 4ESFA 3F6OA 4MEXF 5CLSA 1JE8A 4D0PA 5LLQA 1BI3A 2DW4A 2ISYA 4RGRA 2IVMA 4ZYEA 2HKOA 1XGMA 4Q47A 2C6YA 3S2WA 5ICCA 1FBUA 3GFMA 3ML6A 4RAYA 2P7VB 5A2QZ 1BC8C 2HFHA 1K78A 4EJVA 2EB7A 1IRFA 4LLGF 1XCVA 1QQIA 3L2CA 3WGIA 4WXHA 5DCFA 2OZUA 1ZGAA 4EJUA 4BNCA 1F5TA 4HF2A 4WK8F 4HX4A 4ENNA 4UNOA 3WTXC 3P9IA 2VBZA 2JPBA 1X3UA 3MZHA 1LDDA 1ZN2A 4IRHA 1S6LA 3I54A 2QZ8A 1Z9CA 3T8RA 3OV8A 4R79A 3Q9SA 2XGXA 3WTSC 4JQFA 2IT0A 4U88A 4KN4X 2W57A 4EJTA 2DU9A 3K2ZA 5HDGA 3W6KB 3KP5A 2XAHA 5BPIA 2J5OA 1P4XA 3R0AA 4L0ZB 1FSHA 3DP7A 2NNYA 5D5WB 4MTEA 1WSUA 3VODA 4RS8A 2GXGA 2QQBA 4LMYA 2FXAA 3QP6A 1QPMA 2V6CA 4OOIA 2PN6A 2JPCA 2ZNZA 1FP1D 2DAOA 4CYDA 5E1WA 4IRGA 2K27A 3BY6A 3SZTA 4OIQF 2J5PA 4UUVA 1E17A 1XMKA 4LFUA 2OAZA 3HOTA 2RNJA 3KLOA 3F3XA 2FF4A 1KYWA 3F72A 2XAFA 3P7NA 4FX4A 5LGNA 3L7WA 1TQPA 3M1EA 1IN8A 1R23A 2AXLA 3JTHA 3KE2A 5A2QK 4MTDA 1KU2A 4O3MA 1G3YA 1U5TB 1V4RA 1J2XA 5JI6A 3FMSA 1BJAA 1YW7A 2IW5A 3ZMDA 1B4AA 3ZMTA 1F1ZA 5H6QA 1ZARA 2Q2EA 4AIJA 4R8HA 3F23A 5FB2A 4LG0B 1LJ9A 4ZYGA 4EQQA 4UV9A 2QLZA 1F9NA 4IXAA 1H9GA 1SD6A 3BJAA 5BS6A 3WE2A 2QBYB 1IN7A 2XVCA 4B8XA 1W5SA 4JK1X 4RGUA 1YQAA 3KP2A 5L3BA 2GZWA 3EDPA 2V1XA 3RJPA 2H6CA 4ZZLA 3E6BA 1S29A 1YS6A 3JSOA 4U7DA 2FNAA 5BQTA 1YLFA 5FD5A 4I0AA 2VBYA 3REOA 2RDPA 5FGMA 3RDIA 5EEHA 1P4AA 2UXXA 2K7LA 4LLLA 3M8FA 3JSPA 5E8IA 3I4PA 4O5VA 1WI9A 3GFJA 2IA1A 3C3WA 1KQ9A 3J7AO 3CUQC 2FU4A 4R1HA 2EWNA 4IF4A 3FMRA 3PFIA 5AONA 1FYLA 4A6DA 4I2OA 1R5GA 1H0MA 3BOQA 1R00A 2RV8A 2P4WA 3NQOA 2G9WA 2FQ3A 4MQVA 1YYVA 2JTVA 1DP7P 3B02A 4M9XA 1R36A 3KP3A 3D5LA 4P9UA 1S7AA 1KYZA 3M8EA 5HDKA 3DPTA 4ZYDA 1IAWA 1W4MA 1FSEA 3CJNA 2DQRA 2HYFA 1KGSA 2CO5A 4G8XA 2VBXA 4EVIA 3IL2A 4EGZA 1ULYA 3F6VA 2EA4A 4PGGA 1LEBA 2VE9A 2GA1A 3K9TA 1CF7B 2O0YA 4LD5A 2XIGA 3HSEA 1U5TA 4GYGA 3GFIA 1B1BA 2D2WA 4G7OF 3JAMZ 4Y17A 1ZAOA 1MDMB 3QU6A 3TOBA 1LDJA 3L09A 2L4AA 2YX7A 1QBJA 2TDXA 3FZVA 5DYMA 4LG0A 2V9VA 3WGHA 2ZXJA 3OOPA 4UVCA 4MNUA 1Z6RA 2VT2A 4AWXB 4G7HF 3IKTA 2BYVE 5K5RA 3C1DA 1VTNC 5L3GA 2A69F 4ZZDA 5JFRA 2WWYA 2QBYA 1LEAA 1FWZA 3K69A 5E18F 1AOYA 2FE3A 2P7CB 3J81Z 2UWMA 5FLXZ 2G7HA 3BJ6A 1OYYA 3I59B 2KIUA 3T0YA 3ZQ7A 4FT8A 3CTAA 2OBPA 4L9NA 4HQMA 4BAYA 2KJCA 1IN5A 1Z6TA 4IRIA 1QNTA 1XSDA 2ZMEB 3R4KA 1O3TA 1IRGA 1EH8A 3L9FA 3K0LA 4LLNA 3CUOA 2M8EA 1I27A 3TO6A 4ENJA 1ON1A 5J6XA 4HX7A 2X0LA 1XGNA 3KLNA 3CO7C 4KA4A 1QGPA 1IN4A 3H92A 1FYMA 2RC4A 3ERED 3LSTA 5JVTA 3IHUA 1ZREA 2XAGA 3P9CA 4BYYA 2ZCWA 1G3WA 1YTYA 2VC1A 1IXCA 3N4MA 5FFXA 4HLYA 1JGSA 3LAJA 2XROA 2Z3YA 2DTRA 5E1ZB 4HDUA 1U6GA 2EFQA 3GUDA 3EYIA 2BEOA 4M74A 1EH6A 4P96A 3E6CC 2FEZA 4L18B 1BOAA 3M9AA 2EV0A 2HQRA 3KP6A 1H9TA 5HVQC 4BH9A 1MKMA 3QU3A 4KYWA 3FF5A 2PI0A 1FC3A 3NRVA 1G3TA 4Y13A 2XKOA 2FSWA 5D6EA 3ROUA 1MZBA 2XKPA 2EA2A 2KKOA 4LB5A 4CDGA 3C7JA 3J80Z 2HEOA 2A6EF 5IT9K 5TJJA 2CGPA 1ZRFA 3VOEA 3HRUA 1U2WA 5CVVA 4EV0A 2NNNA 3NEUA 4KICA 4G7ZF 1CF7A 3KEOA 2IA2A 1E2XA 4HF0A 3F8NA 4L9JA 3WG9A 4YG2F 1U8RA 1F4KA 3ISPA 1MDMA 3IWFA 1OMIA 4HZFA 2Y48A 1ZRDA 4I09A 4CXFA 4I0BA 2LKPA 3ECOA 5JR3A 1XSXA 3I5UA 1JXSA 3GO5A 4NHJA 4PGHA 1YG2A 3ULQB 3FM3A 1D8JA 4ESJA 3DFGA 5DCMB 3DF8A 4CICA 3R60A 3ABUA 1T6SA 2VOOA 4DNCA 1ONVA 2HDCA 5CJ9A 2ESHA 5ICGA 3I59A 1J0RA 1YO5C 3F22A 1BI2A 4O6JA 3BDDA 1HW2A 2KRFA 2ESNA 1USTA 1HKSA 5L3DA 2ZMEA 5D8LB 3CO6C 3FXUA 2Z9OA 4AIKA 5CVJA 4OINF 1HKTA 3HHHA 2GAUA 4ON0A 2L54A 2ISZA 4ESBA 5LHIA 1RUNA 2DK5A 2ADUA 4HV5A 5F64A 5ICEA 1SFXA 3HSFA 3E5QA 5IT3A 1G6NA 4YIFA 3HOSA 2W84A 2M1BA 1MJBA 4CHUA 2G7UA 1RNLA 2F5FA 1XN7A 3PQJA 2MD5A 4FHTA 1FT9A 3B73A 2O61A 3I64A 1O3QA 1Z91A 2D1VA 1FP2A 2O3FA 5BMZA 2CQKA 1BM9A 3IWZA 5E17F 3SFZA 5D5VB 3RYPA 4P9FA 5HS7A 3H3ZA 4XRFA 2FBKA 1DPUA 2PMUA 5ED4A 4A2UA 3GX4X 5L3EA 4A0XA 1QZZA 2H27A 2W25A 3KZYA 1SD5A 3F21A 1K6OA 3O2PE 5CVRA 2GWRA 4IHTA 1ZRCA 2PQ8A 1P4WA 1FNNA 5LRSA 1Z05A 3DQVC 1GXQA 3COAC 1LQ1A 4HOBA 4KFCA 2EFOA 1LDKB 1JHFA 3ZMUA 5K5OA 3RTRA 4ASNA 2K4BA 2PBIA 1REPC 5KK1A 2VODA 3F8CA 3BPVA 1O7LA 3DEUA 4MHGA 1J75A 4RB0A 3LA7A 2HYGD 1HSJA 4A5MA 1D8KA 2VOPA 2ELHA 2MC3A 2XASA 4MQ9F 3CUQB 3ZPLA 3RYRA 5F1RA 2V1DA 5DV5A 4YFXF 2A5YB 3MFKA 1XGSA 1JHHA 1T39A 4ZH4F 2BE5F 2QQ9A 3HHGA 2YPRA 1ZLJA 4M71A 2CSOA 4OIRF 5DCMA 1G3SA 4ZYHA 1CGPA 1FYKA 4CGZA 1DUXC 3TO9A 1PP7U 4PDKA 2OU2A 1SFEA 5DUKA 1MJ9A 3TO7A 3MEXA 1YIOA 2QENA 4U0VA 5LGTA 1STZA 1UB9A 2X4HA 1XDUA 2BGCA 2DBBA 2CFXA 3MCZA 3GYHX 6PAXA 3BROA 2IPQX 1T98A 4BQAA 2DLLA 4E70A 1WKMA 1FY7A 2Q8KA 2YU3A 4OMZA 4HF1A 2Z33A 5ERIA 3QP5A 2CYYA 2ETHA 1Y0UA 1KA8A 1KQ8A 5D4SA 1J59A 5L3FA 2K86A 2E1NA 4UVAA 3ZMZA 1L0OC 2VN2A 4IJAA 5ILUA 1TBXA 5LGUA 1WWXA 2FMYA 1DPRA 1W7PD 2DT5A 5H6RA 1SD4A 2FNPA 1B59A 2O03A 2A68F 4PZJA 1AWCA 2VBWA 3HTSB 2F5EA 2HQNA 2LF7A 4UVBA 2K02A 3EYYA 4U0WA 4YFKF 3GEZA 1ZGJA 3DPLC 5D5UB 1YW8A 4ETSA 1KQ0A 2B0LA 4XLNF 1HW1A 1UCRA 4UV8A 1RUOA 2RKHA 2PFBA 1B9NA 1HSTA 3WTWC 2UXNA 1BIAA 2VXZA 4L5JA 2PLYA 2OA4A 5ILVA 5E1XA 5D6FA 4RB1A 1D5VA 2FOKA 2GA2A 2JSCA 1U78A 2L01A 3GFLA 2R3SA 2EJRA 1OR7A 2HWVA 1PDNC 4CO8A 4A5NA 3LAPA 2GIVA 1I6XA 4EMSA 4XBFA 2W24A 4EM2A 4Y15A 2FRHA 3Q9VA 3V7SA 3E5XA 1ODDA 3EUHA 3VFZA 2VE8A 4BXUA 4Q4ZF 2P5VA 2KJBA 4OU0A 2NS0A 3EQLF 3DXJF 4EGYA 4G94A 5LRRA 2EV5A 4KT5C 5BOXA 4KDPA 3RIRA 1EH7A 1QO0D 3GXOA 2IRFG 2UZKA 4MEYF 3RI4A 1PP8F 4L0YB 1TQIA 1USSA 3CUQA 2DPDA 4I02A 2D45A 4NQWA 5HS9A 3SHFA 2E7WA 5J8FA 4OMYA 4M6XA 1GVJA 3CDHA 1T2KA 4N9HA 2DK8A 4HDVA 3JW4A 3O6BB 1P2FA 3F8FA 2A6HF 4M72A 1FBQA 4OIOF 2HTJA 2EFPA 2AS5F 3HRMA 3I0TA 3D0SA 2FA5A 1SMYF 3HYIA 3F8BA 4HQEA 4I98B 1ZYRF 5HS8A 3FHZA 4N9IA 4WCGA 2JZYA 3SXYA 3R6SA 2F5CA 3WU1B 2P8TA 4U7BA 2LSOA 4I01A 1XGOA 2KIFA 2YX4A 2NYXA 2E1CA 3I58A 3ZMSA 4DQ2A 2R7DA 2VC0A 3E3VA 1O3SA 2ZNYA 1Z1DA 2YR2A 2LDUA 4KIBA 2DFIA 5DD4A 3WTYC 3WU0A 5TRDA 2YSRA 3FWEA 3DV8A 3MQ0A 2MLKA 3BP8A 4XSZF 1GXPA 3HIFA 4TV7A 1XD7A 1I1GA 4HA8A 2STWA 5FD6A 3G3ZA 2GXBA 1ZG1A 3V8KA 5DD8A 1I1SA 5K5QA 1HXDA 2JT1A 4UHTA 3Q5FA 2F5DA 3SZPA 2VONA 1OPCA 1W7PB 1MJAA 3E97A 3JAMK 1IW7F 3R61A 5DUIA 4UXNA 4H0EA 3KCCA 3RPUA 5D4RA 3QPHA 2IP2A 3BJOA 3U1DA 1BI1A 1EV7A 2RGVA 2MH2A 3GLXA 3T8TA 5HLHA 3R0JA 3BPXA 2M45A 1TTYA 3WTVC 3FM5A 1TNSA 2V1UA 1ZHFA 3V7RA 3IC7A 3J81K 1HBXG 2DO7A 5FLXK 3GZ5A 3RKWA 2M30A 3E6DA 1ZLKA 1TW3A 3QAHA 4IPAA 1XSVA 1U3EM 1WRJA 1ON2A 4HLXA 4RB3C 4GYIA 1LNWA 3TDUC 3K1NA 2A3SA 5JHUA 3ABTA 2QUFA 1YFHA 1BN5A 1FPQA 4M9SA 2P6SA 4EJWA 2BBYA 2XHKA 5D5XB 1T0FA 3IRRA 4QWQA 1UFMA 2PG4A 2MBFA 1FX7A 5H20A 3HTUA 2ZBKA 3V4GA 3HRSA 2IJLA 2ZKZA 2XV4S 3JTGA 1XB4A 3ECHA 1IF1A 1A04A 4N0BA 4HYEA 2FBHA 3LFKA 1GHCA 5ICFA 3RPQA 4U0YA 5LHHA 5AIPA 1R1UA 2LF8A 4IVNA 4P55A 4ENMA 1S8NA 2QYOA 2WV0A 4KNYA 2PMHA 2COMA 1RZ4A 3E5UA 3GZ6A 3KETA 1KU9A 3LA3A 4A12A 3AAFA 5CVIA 4WX9A 3J80K 3FMQA 3VEPA 1Z7UA 4Q48A 3VB2A 2LNBA 1R58A 4AD9A 4HAMA 3G73A 1RIOH 4IHSA 2EFNA 1UHWA 5ILSA 1IXSB 5HOOA 3E6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7P A;  1K79 A;  2L3D A;  3RKX A;  2L02 A;  3KP4 A;  3QOP A;  2H09 A;  5KVR A;  2RN7 A;  4NB5 A;  2DPU A;  1MGT A;  1P92 A;  5F6F A;  5HDN A;  1T38 A;  5E8G A;  1J5Y A;  2ZJ2 A;  2OQR A;  3LA2 A;  2H6B A;  4FX0 A;  1R7J A;  3WTZ A;  1XMA A;  5D8K B;  4L9V A;  3TQN A;  4PCQ A;  1BIB A;  4M6Y A;  4XLP F;  2HOE A;  2OZ6 A;  2HS5 A;  4KN7 X;  2WC2 A;  2O8X A;  4GXO A;  2VT3 A;  3QRF F;  1O3R A;  2H94 A;  2HR3 A;  2M87 A;  2Z99 A;  1HW5 A;  2MH9 A;  2A07 F;  4HV6 A;  1SD7 A;  3HSR A;  3N97 A;  1OYW A;  3H3U A;  1R5H A;  1ZG5 A;  4YII A;  4I7H A;  1BI0 A;  4KMF A;  2EK5 A;  2JRT A;  1HQC A;  3M7G A;  4L5I A;  2HGC A;  1B6A A;  4LB6 B;  1K7A A;  1BC7 C;  2NAZ A;  3GW2 A;  4CZZ A;  1FBS A;  2HTS A;  3WTT C;  1U5T C;  2KIM A;  3EET A;  3WOD F;  1G4D A;  4BHC A;  1ZH5 A;  4G9Y A;  4KMU X;  3LWF A;  1MD0 A;  2NRA C;  5LBQ A;  4WXD A;  5DDG A;  5DEQ A;  2QWW A;  3FXR A;  1D3Y A;  4BHB A;  3V8L A;  3MAJ A;  2XAQ A;  2DI3 A;  5L3C A;  2PJP A;  4EM0 B;  2QQA A;  2L4M A;  4LGW A;  2F2E A;  4GGG A;  4RGX A;  4HX8 A;  4AIH A;  1IN6 A;  3O3K A;  3U2R A;  3I71 A;  3TKY A;  3C18 A;  4M9Z A;  3KZZ A;  1SMT A;  3W6J B;  3MWM A;  3K1M A;  4WF2 A;  4GCV A;  1IXR C;  2K4J A;  4F7Z A;  4HBL A;  4LK0 F;  2XUB A;  2D1H A;  1J9I A;  2QM3 A;  4A0Y A;  1C0W A;  2FBI A;  2Y0M A;  4KIF A;  1IZ1 A;  5LEK A;  1SFU A;  1O7F A;  3HRT A;  4B09 A;  3GWZ A;  2MA3 A;  1ZG3 A;  1LB2 A;  2PEX A;  5HLG A;  3T5X A;  2EFW A;  1YS7 A;  5CYV A;  2ZFW A;  3L00 A;  2Q0O A;  1XCB A;  4AVP A;  4OIP F;  1R1V A;  2STT A;  1KU3 A;  1TNT A;  2OQG A;  2WTE A;  1FZP B;  1XDS A;  5LEJ A;  4RAZ A;  1P6R A;  2EV6 A;  3FXQ A;  2M5W A;  5HLI A;  1DDN A;  2CW0 F;  3MZY A;  4WXC A;  3QPT A;  2V79 A;  3P9K A;  2BV6 A;  1KU7 A;  4A0Z A;  3RKY A;  1Q1H A;  2A61 A;  1R1T A;  1PUE E;  1K78 B;  1LVA A;  1OKR A;  3TGN A;  1V3F A;  3ZP5 A;  3ZN0 A;  2E7X A;  3V7C A;  5IT9 Z;  1B9M A;  3SQN A;  3U9G A;  3ZN1 A;  3LQR A;  3K1P A;  4G6Q A;  4L9T A;  3IKV A;  1TLH B;  3V8J A;  3IRQ A;  2HKX A;  2P5K A;  4XSX F;  2R7F A;  1BBY A;  4MGR A;  2Z5U A;  3WGG A;  5FFZ A;  4S04 A;  1IUY A;  2RQP A;  3DKW A;  2ZO4 A;  4RGS A;  2GQQ A;  4KUM A;  2P6T A;  2XAJ A;  2QVO A;  4BHP A;  2RVC A;  3ZMV A;  3KEQ A;  4GO1 A;  3ELK A;  4G6D A;  4S05 A;  1FLI A;  4EM1 A;  2MLG A;  2XRN A;  2FML A;  1S3J A;  2HZT A;  1NHA A;  4P5O A;  3F8M A;  4Q5S F;  5AIQ A;  1RI7 A;  1O57 A;  1R22 A;  3PQK A;  3I53 A;  1TW2 A;  4HW0 A;  2P5L C;  1SAX A;  1TQM A;  3FX3 A;  3GF2 A;  3T1B A;  3TDZ C;  4WWC A;  1OYI A;  1QZY A;  3WE3 A;  4ENK A;  4YFN F;  3HUG A;  4A6E A;  1HKQ A;  3GVA A;  4KIG A;  2DQL A;  3KFW X;  5FO5 A;  4K2E A;  1L3L A;  4LJZ F;  5CVU A;  1WQ2 A;  5J8C A;  5K1Y A;  2ACJ A;  2O6G E;  4QLC U;  3KP7 A;  1UHM A;  1J7K A;  3CLO A;  4M73 A;  5EEG A;  5LHG A;  3WTU C;  1I5Z A;  5BPD A;  2IA0 A;  4LK1 F;  4EJO A;  4Z2Y A;  2Y75 A;  3LQQ A;  4JBA A;  2OD5 A;  3BWG A;  1YW9 A;  4RB2 C;  3BZ6 A;  3TOA A;  1S7O A;  2W85 A;  1W5T A;  2CG4 A;  2CWE A;  1FOK A;  5E20 A;  4ESF A;  3F6O A;  4MEX F;  5CLS A;  1JE8 A;  4D0P A;  5LLQ A;  1BI3 A;  2DW4 A;  2ISY A;  4RGR A;  2IVM A;  4ZYE A;  2HKO A;  1XGM A;  4Q47 A;  2C6Y A;  3S2W A;  5ICC A;  1FBU A;  3GFM A;  3ML6 A;  4RAY A;  2P7V B;  5A2Q Z;  1BC8 C;  2HFH A;  1K78 A;  4EJV A;  2EB7 A;  1IRF A;  4LLG F;  1XCV A;  1QQI A;  3L2C A;  3WGI A;  4WXH A;  5DCF A;  2OZU A;  1ZGA A;  4EJU A;  4BNC A;  1F5T A;  4HF2 A;  4WK8 F;  4HX4 A;  4ENN A;  4UNO A;  3WTX C;  3P9I A;  2VBZ A;  2JPB A;  1X3U A;  3MZH A;  1LDD A;  1ZN2 A;  4IRH A;  1S6L A;  3I54 A;  2QZ8 A;  1Z9C A;  3T8R A;  3OV8 A;  4R79 A;  3Q9S A;  2XGX A;  3WTS C;  4JQF A;  2IT0 A;  4U88 A;  4KN4 X;  2W57 A;  4EJT A;  2DU9 A;  3K2Z A;  5HDG A;  3W6K B;  3KP5 A;  2XAH A;  5BPI A;  2J5O A;  1P4X A;  3R0A A;  4L0Z B;  1FSH A;  3DP7 A;  2NNY A;  5D5W B;  4MTE A;  1WSU A;  3VOD A;  4RS8 A;  2GXG A;  2QQB A;  4LMY A;  2FXA A;  3QP6 A;  1QPM A;  2V6C A;  4OOI A;  2PN6 A;  2JPC A;  2ZNZ A;  1FP1 D;  2DAO A;  4CYD A;  5E1W A;  4IRG A;  2K27 A;  3BY6 A;  3SZT A;  4OIQ F;  2J5P A;  4UUV A;  1E17 A;  1XMK A;  4LFU A;  2OAZ A;  3HOT A;  2RNJ A;  3KLO A;  3F3X A;  2FF4 A;  1KYW A;  3F72 A;  2XAF A;  3P7N A;  4FX4 A;  5LGN A;  3L7W A;  1TQP A;  3M1E A;  1IN8 A;  1R23 A;  2AXL A;  3JTH A;  3KE2 A;  5A2Q K;  4MTD A;  1KU2 A;  4O3M A;  1G3Y A;  1U5T B;  1V4R A;  1J2X A;  5JI6 A;  3FMS A;  1BJA A;  1YW7 A;  2IW5 A;  3ZMD A;  1B4A A;  3ZMT A;  1F1Z A;  5H6Q A;  1ZAR A;  2Q2E A;  4AIJ A;  4R8H A;  3F23 A;  5FB2 A;  4LG0 B;  1LJ9 A;  4ZYG A;  4EQQ A;  4UV9 A;  2QLZ A;  1F9N A;  4IXA A;  1H9G A;  1SD6 A;  3BJA A;  5BS6 A;  3WE2 A;  2QBY B;  1IN7 A;  2XVC A;  4B8X A;  1W5S A;  4JK1 X;  4RGU A;  1YQA A;  3KP2 A;  5L3B A;  2GZW A;  3EDP A;  2V1X A;  3RJP A;  2H6C A;  4ZZL A;  3E6B A;  1S29 A;  1YS6 A;  3JSO A;  4U7D A;  2FNA A;  5BQT A;  1YLF A;  5FD5 A;  4I0A A;  2VBY A;  3REO A;  2RDP A;  5FGM A;  3RDI A;  5EEH A;  1P4A A;  2UXX A;  2K7L A;  4LLL A;  3M8F A;  3JSP A;  5E8I A;  3I4P A;  4O5V A;  1WI9 A;  3GFJ A;  2IA1 A;  3C3W A;  1KQ9 A;  3J7A O;  3CUQ C;  2FU4 A;  4R1H A;  2EWN A;  4IF4 A;  3FMR A;  3PFI A;  5AON A;  1FYL A;  4A6D A;  4I2O A;  1R5G A;  1H0M A;  3BOQ A;  1R00 A;  2RV8 A;  2P4W A;  3NQO A;  2G9W A;  2FQ3 A;  4MQV A;  1YYV A;  2JTV A;  1DP7 P;  3B02 A;  4M9X A;  1R36 A;  3KP3 A;  3D5L A;  4P9U A;  1S7A A;  1KYZ A;  3M8E A;  5HDK A;  3DPT A;  4ZYD A;  1IAW A;  1W4M A;  1FSE A;  3CJN A;  2DQR A;  2HYF A;  1KGS A;  2CO5 A;  4G8X A;  2VBX A;  4EVI A;  3IL2 A;  4EGZ A;  1ULY A;  3F6V A;  2EA4 A;  4PGG A;  1LEB A;  2VE9 A;  2GA1 A;  3K9T A;  1CF7 B;  2O0Y A;  4LD5 A;  2XIG A;  3HSE A;  1U5T A;  4GYG A;  3GFI A;  1B1B A;  2D2W A;  4G7O F;  3JAM Z;  4Y17 A;  1ZAO A;  1MDM B;  3QU6 A;  3TOB A;  1LDJ A;  3L09 A;  2L4A A;  2YX7 A;  1QBJ A;  2TDX A;  3FZV A;  5DYM A;  4LG0 A;  2V9V A;  3WGH A;  2ZXJ A;  3OOP A;  4UVC A;  4MNU A;  1Z6R A;  2VT2 A;  4AWX B;  4G7H F;  3IKT A;  2BYV E;  5K5R A;  3C1D A;  1VTN C;  5L3G A;  2A69 F;  4ZZD A;  5JFR A;  2WWY A;  2QBY A;  1LEA A;  1FWZ A;  3K69 A;  5E18 F;  1AOY A;  2FE3 A;  2P7C B;  3J81 Z;  2UWM A;  5FLX Z;  2G7H A;  3BJ6 A;  1OYY A;  3I59 B;  2KIU A;  3T0Y A;  3ZQ7 A;  4FT8 A;  3CTA A;  2OBP A;  4L9N A;  4HQM A;  4BAY A;  2KJC A;  1IN5 A;  1Z6T A;  4IRI A;  1QNT A;  1XSD A;  2ZME B;  3R4K A;  1O3T A;  1IRG A;  1EH8 A;  3L9F A;  3K0L A;  4LLN A;  3CUO A;  2M8E A;  1I27 A;  3TO6 A;  4ENJ A;  1ON1 A;  5J6X A;  4HX7 A;  2X0L A;  1XGN A;  3KLN A;  3CO7 C;  4KA4 A;  1QGP A;  1IN4 A;  3H92 A;  1FYM A;  2RC4 A;  3ERE D;  3LST A;  5JVT A;  3IHU A;  1ZRE A;  2XAG A;  3P9C A;  4BYY A;  2ZCW A;  1G3W A;  1YTY A;  2VC1 A;  1IXC A;  3N4M A;  5FFX A;  4HLY A;  1JGS A;  3LAJ A;  2XRO A;  2Z3Y A;  2DTR A;  5E1Z B;  4HDU A;  1U6G A;  2EFQ A;  3GUD A;  3EYI A;  2BEO A;  4M74 A;  1EH6 A;  4P96 A;  3E6C C;  2FEZ A;  4L18 B;  1BOA A;  3M9A A;  2EV0 A;  2HQR A;  3KP6 A;  1H9T A;  5HVQ C;  4BH9 A;  1MKM A;  3QU3 A;  4KYW A;  3FF5 A;  2PI0 A;  1FC3 A;  3NRV A;  1G3T A;  4Y13 A;  2XKO A;  2FSW A;  5D6E A;  3ROU A;  1MZB A;  2XKP A;  2EA2 A;  2KKO A;  4LB5 A;  4CDG A;  3C7J A;  3J80 Z;  2HEO A;  2A6E F;  5IT9 K;  5TJJ A;  2CGP A;  1ZRF A;  3VOE A;  3HRU A;  1U2W A;  5CVV A;  4EV0 A;  2NNN A;  3NEU A;  4KIC A;  4G7Z F;  1CF7 A;  3KEO A;  2IA2 A;  1E2X A;  4HF0 A;  3F8N A;  4L9J A;  3WG9 A;  4YG2 F;  1U8R A;  1F4K A;  3ISP A;  1MDM A;  3IWF A;  1OMI A;  4HZF A;  2Y48 A;  1ZRD A;  4I09 A;  4CXF A;  4I0B A;  2LKP A;  3ECO A;  5JR3 A;  1XSX A;  3I5U A;  1JXS A;  3GO5 A;  4NHJ A;  4PGH A;  1YG2 A;  3ULQ B;  3FM3 A;  1D8J A;  4ESJ A;  3DFG A;  5DCM B;  3DF8 A;  4CIC A;  3R60 A;  3ABU A;  1T6S A;  2VOO A;  4DNC A;  1ONV A;  2HDC A;  5CJ9 A;  2ESH A;  5ICG A;  3I59 A;  1J0R A;  1YO5 C;  3F22 A;  1BI2 A;  4O6J A;  3BDD A;  1HW2 A;  2KRF A;  2ESN A;  1UST A;  1HKS A;  5L3D A;  2ZME A;  5D8L B;  3CO6 C;  3FXU A;  2Z9O A;  4AIK A;  5CVJ A;  4OIN F;  1HKT A;  3HHH A;  2GAU A;  4ON0 A;  2L54 A;  2ISZ A;  4ESB A;  5LHI A;  1RUN A;  2DK5 A;  2ADU A;  4HV5 A;  5F64 A;  5ICE A;  1SFX A;  3HSF A;  3E5Q A;  5IT3 A;  1G6N A;  4YIF A;  3HOS A;  2W84 A;  2M1B A;  1MJB A;  4CHU A;  2G7U A;  1RNL A;  2F5F A;  1XN7 A;  3PQJ A;  2MD5 A;  4FHT A;  1FT9 A;  3B73 A;  2O61 A;  3I64 A;  1O3Q A;  1Z91 A;  2D1V A;  1FP2 A;  2O3F A;  5BMZ A;  2CQK A;  1BM9 A;  3IWZ A;  5E17 F;  3SFZ A;  5D5V B;  3RYP A;  4P9F A;  5HS7 A;  3H3Z A;  4XRF A;  2FBK A;  1DPU A;  2PMU A;  5ED4 A;  4A2U A;  3GX4 X;  5L3E A;  4A0X A;  1QZZ A;  2H27 A;  2W25 A;  3KZY A;  1SD5 A;  3F21 A;  1K6O A;  3O2P E;  5CVR A;  2GWR A;  4IHT A;  1ZRC A;  2PQ8 A;  1P4W A;  1FNN A;  5LRS A;  1Z05 A;  3DQV C;  1GXQ A;  3COA C;  1LQ1 A;  4HOB A;  4KFC A;  2EFO A;  1LDK B;  1JHF A;  3ZMU A;  5K5O A;  3RTR A;  4ASN A;  2K4B A;  2PBI A;  1REP C;  5KK1 A;  2VOD A;  3F8C A;  3BPV A;  1O7L A;  3DEU A;  4MHG A;  1J75 A;  4RB0 A;  3LA7 A;  2HYG D;  1HSJ A;  4A5M A;  1D8K A;  2VOP A;  2ELH A;  2MC3 A;  2XAS A;  4MQ9 F;  3CUQ B;  3ZPL A;  3RYR A;  5F1R A;  2V1D A;  5DV5 A;  4YFX F;  2A5Y B;  3MFK A;  1XGS A;  1JHH A;  1T39 A;  4ZH4 F;  2BE5 F;  2QQ9 A;  3HHG A;  2YPR A;  1ZLJ A;  4M71 A;  2CSO A;  4OIR F;  5DCM A;  1G3S A;  4ZYH A;  1CGP A;  1FYK A;  4CGZ A;  1DUX C;  3TO9 A;  1PP7 U;  4PDK A;  2OU2 A;  1SFE A;  5DUK A;  1MJ9 A;  3TO7 A;  3MEX A;  1YIO A;  2QEN A;  4U0V A;  5LGT A;  1STZ A;  1UB9 A;  2X4H A;  1XDU A;  2BGC A;  2DBB A;  2CFX A;  3MCZ A;  3GYH X;  6PAX A;  3BRO A;  2IPQ X;  1T98 A;  4BQA A;  2DLL A;  4E70 A;  1WKM A;  1FY7 A;  2Q8K A;  2YU3 A;  4OMZ A;  4HF1 A;  2Z33 A;  5ERI A;  3QP5 A;  2CYY A;  2ETH A;  1Y0U A;  1KA8 A;  1KQ8 A;  5D4S A;  1J59 A;  5L3F A;  2K86 A;  2E1N A;  4UVA A;  3ZMZ A;  1L0O C;  2VN2 A;  4IJA A;  5ILU A;  1TBX A;  5LGU A;  1WWX A;  2FMY A;  1DPR A;  1W7P D;  2DT5 A;  5H6R A;  1SD4 A;  2FNP A;  1B59 A;  2O03 A;  2A68 F;  4PZJ A;  1AWC A;  2VBW A;  3HTS B;  2F5E A;  2HQN A;  2LF7 A;  4UVB A;  2K02 A;  3EYY A;  4U0W A;  4YFK F;  3GEZ A;  1ZGJ A;  3DPL C;  5D5U B;  1YW8 A;  4ETS A;  1KQ0 A;  2B0L A;  4XLN F;  1HW1 A;  1UCR A;  4UV8 A;  1RUO A;  2RKH A;  2PFB A;  1B9N A;  1HST A;  3WTW C;  2UXN A;  1BIA A;  2VXZ A;  4L5J A;  2PLY A;  2OA4 A;  5ILV A;  5E1X A;  5D6F A;  4RB1 A;  1D5V A;  2FOK A;  2GA2 A;  2JSC A;  1U78 A;  2L01 A;  3GFL A;  2R3S A;  2EJR A;  1OR7 A;  2HWV A;  1PDN C;  4CO8 A;  4A5N A;  3LAP A;  2GIV A;  1I6X A;  4EMS A;  4XBF A;  2W24 A;  4EM2 A;  4Y15 A;  2FRH A;  3Q9V A;  3V7S A;  3E5X A;  1ODD A;  3EUH A;  3VFZ A;  2VE8 A;  4BXU A;  4Q4Z F;  2P5V A;  2KJB A;  4OU0 A;  2NS0 A;  3EQL F;  3DXJ F;  4EGY A;  4G94 A;  5LRR A;  2EV5 A;  4KT5 C;  5BOX A;  4KDP A;  3RIR A;  1EH7 A;  1QO0 D;  3GXO A;  2IRF G;  2UZK A;  4MEY F;  3RI4 A;  1PP8 F;  4L0Y B;  1TQI A;  1USS A;  3CUQ A;  2DPD A;  4I02 A;  2D45 A;  4NQW A;  5HS9 A;  3SHF A;  2E7W A;  5J8F A;  4OMY A;  4M6X A;  1GVJ A;  3CDH A;  1T2K A;  4N9H A;  2DK8 A;  4HDV A;  3JW4 A;  3O6B B;  1P2F A;  3F8F A;  2A6H F;  4M72 A;  1FBQ A;  4OIO F;  2HTJ A;  2EFP A;  2AS5 F;  3HRM A;  3I0T A;  3D0S A;  2FA5 A;  1SMY F;  3HYI A;  3F8B A;  4HQE A;  4I98 B;  1ZYR F;  5HS8 A;  3FHZ A;  4N9I A;  4WCG A;  2JZY A;  3SXY A;  3R6S A;  2F5C A;  3WU1 B;  2P8T A;  4U7B A;  2LSO A;  4I01 A;  1XGO A;  2KIF A;  2YX4 A;  2NYX A;  2E1C A;  3I58 A;  3ZMS A;  4DQ2 A;  2R7D A;  2VC0 A;  3E3V A;  1O3S A;  2ZNY A;  1Z1D A;  2YR2 A;  2LDU A;  4KIB A;  2DFI A;  5DD4 A;  3WTY C;  3WU0 A;  5TRD A;  2YSR A;  3FWE A;  3DV8 A;  3MQ0 A;  2MLK A;  3BP8 A;  4XSZ F;  1GXP A;  3HIF A;  4TV7 A;  1XD7 A;  1I1G A;  4HA8 A;  2STW A;  5FD6 A;  3G3Z A;  2GXB A;  1ZG1 A;  3V8K A;  5DD8 A;  1I1S A;  5K5Q A;  1HXD A;  2JT1 A;  4UHT A;  3Q5F A;  2F5D A;  3SZP A;  2VON A;  1OPC A;  1W7P B;  1MJA A;  3E97 A;  3JAM K;  1IW7 F;  3R61 A;  5DUI A;  4UXN A;  4H0E A;  3KCC A;  3RPU A;  5D4R A;  3QPH A;  2IP2 A;  3BJO A;  3U1D A;  1BI1 A;  1EV7 A;  2RGV A;  2MH2 A;  3GLX A;  3T8T A;  5HLH A;  3R0J A;  3BPX A;  2M45 A;  1TTY A;  3WTV C;  3FM5 A;  1TNS A;  2V1U A;  1ZHF A;  3V7R A;  3IC7 A;  3J81 K;  1HBX G;  2DO7 A;  5FLX K;  3GZ5 A;  3RKW A;  2M30 A;  3E6D A;  1ZLK A;  1TW3 A;  3QAH A;  4IPA A;  1XSV A;  1U3E M;  1WRJ A;  1ON2 A;  4HLX A;  4RB3 C;  4GYI A;  1LNW A;  3TDU C;  3K1N A;  2A3S A;  5JHU A;  3ABT A;  2QUF A;  1YFH A;  1BN5 A;  1FPQ A;  4M9S A;  2P6S A;  4EJW A;  2BBY A;  2XHK A;  5D5X B;  1T0F A;  3IRR A;  4QWQ A;  1UFM A;  2PG4 A;  2MBF A;  1FX7 A;  5H20 A;  3HTU A;  2ZBK A;  3V4G A;  3HRS A;  2IJL A;  2ZKZ A;  2XV4 S;  3JTG A;  1XB4 A;  3ECH A;  1IF1 A;  1A04 A;  4N0B A;  4HYE A;  2FBH A;  3LFK A;  1GHC A;  5ICF A;  3RPQ A;  4U0Y A;  5LHH A;  5AIP A;  1R1U A;  2LF8 A;  4IVN A;  4P55 A;  4ENM A;  1S8N A;  2QYO A;  2WV0 A;  4KNY A;  2PMH A;  2COM A;  1RZ4 A;  3E5U A;  3GZ6 A;  3KET A;  1KU9 A;  3LA3 A;  4A12 A;  3AAF A;  5CVI A;  4WX9 A;  3J80 K;  3FMQ A;  3VEP A;  1Z7U A;  4Q48 A;  3VB2 A;  2LNB A;  1R58 A;  4AD9 A;  4HAM A;  3G73 A;  1RIO H;  4IHS A;  2EFN A;  1UHW A;  5ILS A;  1IXS B;  5HOO A;  3E6M A; 
#chains in the Genus database with same CATH topology
 1W7P A;  2LY1 A;  3IUO A;  1K79 A;  1TT0 A;  2E19 A;  2L3D A;  3RKX A;  4AM3 A;  2L02 A;  3KP4 A;  5IPA A;  4UY8 I;  3M1C A;  3QOP A;  2H09 A;  3A03 A;  4XM3 A;  5KVR A;  2RN7 A;  1U8B A;  4NB5 A;  1ENH A;  2DPU A;  5J1U A;  1MGT A;  1P92 A;  5F6F A;  5HDN A;  2EQR A;  3ONQ A;  4XLF A;  2F48 A;  1T38 A;  5E8G A;  3C2H A;  1J5Y A;  2ZJ2 A;  2BZT A;  2E1M C;  4AYB N;  2OQR A;  1V5F A;  2X6O A;  2BHZ A;  2CU7 A;  3TW7 A;  4CH7 A;  3LA2 A;  2H6B A;  4FX0 A;  4C2M J;  3PO3 J;  1R7J A;  3WTZ A;  1XMA A;  3D5R C;  5D8K B;  3DCF A;  2L9R A;  4L9V A;  3TQN A;  1A36 A;  1GVD A;  4PCQ A;  1BIB A;  4M6Y A;  4XLP F;  3ZQQ A;  2HOE A;  2OZ6 A;  2VKV A;  2YUS A;  3OYK A;  2HS5 A;  4KN7 X;  3JRG A;  4MFE A;  5JLW A;  3K4B A;  2WC2 A;  2O8X A;  3S93 A;  3OL4 A;  4GXO A;  4BY7 J;  4BS9 A;  2VT3 A;  3WU2 C;  4IQ4 A;  3QRF F;  1O3R A;  2H94 A;  2EH3 A;  2F6C A;  2HR3 A;  1IUF A;  2M87 A;  1MMS A;  1LE8 A;  2WY8 Q;  1ETK A;  2Z99 A;  1TWC J;  1HW5 A;  2JA6 J;  1F36 A;  2MH9 A;  2A07 F;  4HG2 A;  1VQM I;  4HV6 A;  3VYU B;  1SD7 A;  2R7W A;  3HSR A;  3N97 A;  1APL C;  4A3I J;  1OYW A;  3H3U A;  2XF5 A;  2DYR H;  5M5Y J;  4HNU A;  3CJR B;  1R5H A;  1ZG5 A;  4YII A;  3L1P A;  3H1C A;  1XS9 A;  2KT0 A;  4I7H A;  3MN2 A;  1BI0 A;  1IG7 A;  4KMF A;  1X1A A;  2EK5 A;  2JRT A;  1SVM A;  1HQC A;  3M7G A;  4L5I A;  2YS9 A;  3IP4 B;  2HGC A;  1B6A A;  4LB6 B;  3BG7 A;  1PYV A;  2DN0 A;  1K7A A;  1VQ6 I;  1BC7 C;  4BEH A;  3VWB A;  2NAZ A;  3GW2 A;  4CZZ A;  1FBS A;  1S9H A;  2WAQ A;  2HTS A;  2O8K A;  2OCE A;  3WTT C;  1RKW A;  4BBR J;  4ZC3 A;  1U5T C;  2KIM A;  2WB1 N;  3EET A;  4BAC A;  3A01 A;  3WOD F;  1G4D A;  1MNE A;  3PSF A;  2HXO A;  4BHC A;  4GRI A;  4NUB A;  1ZH5 A;  4G9Y A;  5KHD A;  4KMU X;  2K85 A;  3LWF A;  1MD0 A;  1OCT C;  2EIM H;  2NRA C;  5C4X J;  4RBO A;  3BZC A;  5LBQ A;  1T8I A;  3K4J A;  4X0G A;  3CCQ I;  4WXD A;  5DDG A;  3GTL J;  5DEQ A;  2QWW A;  3FXR A;  4CA0 A;  1D3Y A;  2LMD A;  2OTJ I;  1BR2 A;  3QPL A;  3S3M A;  4BHB A;  3V8L A;  3MAJ A;  1RR7 A;  2XAQ A;  2DI3 A;  5L3C A;  3CCV I;  2PJP A;  4EM0 B;  1OCP A;  3HOU J;  1GT0 C;  3GLL A;  4MLO A;  3OYB A;  2QQA A;  2Y9Z A;  2HNH A;  3M8J A;  4YEJ A;  2L4M A;  2Z1D A;  1VZ0 A;  3CDL A;  1DQU A;  4M3G A;  4LGW A;  5DS9 A;  2F2E A;  1D1B A;  4GGG A;  2EZL A;  4RGX A;  2Y31 A;  3KYD B;  3JRA A;  4E7I A;  4HX8 A;  3S1M J;  3HB9 A;  4AIH A;  1IN6 A;  1X1C A;  3I9V 2;  3O3K A;  1YIJ I;  3U2R A;  3I71 A;  4YRV A;  3TKY A;  3C18 A;  3LSK A;  5JLX A;  5E3M A;  4M9Z A;  2V6E A;  3K4L A;  3KZZ A;  4A3D J;  1SMT A;  3W6J B;  5B5E C;  3MWM A;  2JUG A;  3K1M A;  4WF2 A;  4GCV A;  3OIP A;  1IXR C;  4XKB A;  3HUG B;  2Y2Z A;  3FXJ A;  4J00 A;  1TP4 A;  2K4J A;  4F7Z A;  2RAE A;  1VQK I;  2ZJQ F;  3CC7 I;  2VUM J;  4DZP A;  4FAS D;  4HBL A;  3IH3 A;  4LK0 F;  2XUB A;  3ZOB A;  2D1H A;  2O5R A;  2QM3 A;  4RAF A;  3OR1 C;  1J9I A;  4A0Y A;  3DBH B;  2P0W A;  1C0W A;  1MBF A;  2FBI A;  2Y0M A;  4KIF A;  4RDU A;  4XRS A;  3FIW A;  2CFO A;  1IZ1 A;  5LEK A;  2ME0 A;  5EDN A;  1SFU A;  4BJT A;  2OUM A;  2WV1 A;  4LOC A;  1LFU P;  3BR1 A;  1O7F A;  3HRT A;  2IGO A;  4B09 A;  2L7K A;  2WA0 A;  3AL0 B;  4M3F A;  3GWZ A;  2MA3 A;  1IV8 A;  1ZG3 A;  1LB2 A;  2GIZ A;  3K2A A;  4M3D A;  5IYC J;  2PEX A;  3T5X A;  5HLG A;  3JR9 A;  2EFW A;  4QPO A;  1YS7 A;  2EIN H;  5CYV A;  1Y1W J;  2ZFW A;  3L00 A;  2Q0O A;  3L2U A;  1XCB A;  4AVP A;  2M3A A;  3SYT A;  1Z77 A;  4E6K G;  4OIP F;  3B6C A;  1R1V A;  2STT A;  2DA5 A;  1KU3 A;  1H88 C;  1TNT A;  2OQG A;  2ECC A;  2WTE A;  1FZP B;  4PJN A;  1WJC A;  1XDS A;  5LEJ A;  5FKO A;  4RAZ A;  1P6R A;  3W2W A;  2EV6 A;  3FXQ A;  2M5W A;  2Z16 A;  5HLI A;  1DDN A;  2CW0 F;  5IY5 H;  3MZY A;  3S1N J;  4WXC A;  2DDA A;  3A02 A;  3QPT A;  2IGN A;  2V79 A;  1K61 A;  3P9K A;  5DM6 F;  4II2 A;  2BV6 A;  1KU7 A;  2DT6 A;  3BG3 A;  4A0Z A;  3RKY A;  4CCK A;  1Q1H A;  2ZSI B;  3CCU I;  4NNJ A;  2A61 A;  3M3Y J;  1R1T A;  2K3P A;  3JRD A;  1K78 B;  1PUE E;  1LVA A;  1OKR A;  2DXI A;  3S1Q J;  3TGN A;  1NK3 P;  3HPH A;  1V3F A;  3ZP5 A;  3ZN0 A;  3GTM J;  2E7X A;  3TP3 A;  3V7C A;  5IT9 Z;  1B9M A;  1PVE A;  2OJE D;  3HDD A;  4M3E A;  4I6Z A;  1A5J A;  3SQN A;  3U9G A;  2NS7 A;  5F27 A;  1JT0 A;  3ZN1 A;  3LQR A;  3K1P A;  2F4M B;  4G6Q A;  4L9T A;  3IKV A;  1TLH B;  3V8J A;  1AHD P;  2X51 A;  1Z7L A;  3IRQ A;  3QYB A;  2HKX A;  2P5K A;  1FMV A;  4XSX F;  2R7F A;  1BBY A;  3HOV J;  4MGR A;  1RR8 C;  2L7F P;  2Z5U A;  2CW8 A;  3WGG A;  5FFZ A;  4S04 A;  1IUY A;  4XKC A;  2RQP A;  3DKW A;  2ZO4 A;  2NVY J;  4RGS A;  2D5V A;  2GQQ A;  4XN3 A;  5E3L A;  2VIX A;  4KUM A;  1RC9 A;  4XON A;  2P6T A;  3H5N A;  3TED A;  2XAJ A;  3HOX J;  2QVO A;  2JK3 A;  4BHP A;  2RVC A;  5IP9 J;  3ZMV A;  2LR8 A;  3KEQ A;  4GO1 A;  3ELK A;  4G6D A;  1QHG A;  4S05 A;  1ITY A;  1FLI A;  4EM1 A;  4IOC F;  2JJ7 A;  2MLG A;  2R7S A;  2XRN A;  2K40 A;  2FML A;  1S3J A;  4A93 J;  3KEY A;  2EIK H;  1ZEL A;  2HZT A;  1VF9 A;  1NHA A;  4P5O A;  3F8M A;  3QYE A;  4Q5S F;  4BQQ A;  1XC5 A;  2UV1 A;  3BR0 A;  5AIQ A;  5KNL A;  2H8R A;  1RI7 A;  2ID6 A;  1O57 A;  1R22 A;  3PQK A;  2PMZ N;  1DP3 A;  3I53 A;  5FKM A;  3OR2 C;  1TW2 A;  3BR5 A;  4HW0 A;  4NDL A;  2R5Y B;  2P5L C;  3DEW A;  3HGG A;  2LVS A;  1SAX A;  4OAY A;  1JKO C;  1TZL A;  1TQM A;  5B3S H;  3FX3 A;  3GF2 A;  3SEQ A;  3T1B A;  1VQN I;  2K3F A;  3TDZ C;  4DW6 A;  4WWC A;  3Q0W A;  2RRE A;  1OYI A;  1HDP A;  1QZY A;  3WE3 A;  1S5L C;  3TL4 X;  2LOO A;  2FJ1 A;  1VND A;  3LSJ A;  1BW6 A;  4ENK A;  4YFN F;  4C30 A;  1T08 B;  2KRH A;  2R0Q C;  3MD2 A;  3HUG A;  1MBG A;  3CCY A;  4A6E A;  1HKQ A;  3GVA A;  4KIG A;  2DQL A;  3NAU A;  3KFW X;  5FO5 A;  4K2E A;  1L3L A;  3S17 J;  4LJZ F;  4BJ6 C;  5CVU A;  1WQ2 A;  2ZME C;  1MW7 A;  5J8C A;  5K1Y A;  2ACJ A;  2O6G E;  4QLC U;  3KP7 A;  1UHM A;  2KLO A;  3SJM A;  4C2U A;  5F08 A;  1J7K A;  2XPU A;  3X2Q H;  3F0C A;  3PIP F;  3CLO A;  4M73 A;  5EEG A;  2DA3 A;  3LSI A;  3CCJ I;  1X4P A;  5LHG A;  3WTU C;  1G8X A;  1I5Z A;  5BPD A;  1DU6 A;  5J4Y A;  2IA0 A;  2CV0 A;  4LK1 F;  3GZN B;  3K10 A;  1K4T A;  2FUG 2;  3VSK A;  4EJO A;  2VKD A;  4D5C A;  4Z2Y A;  2Y75 A;  3LQQ A;  5M3M J;  3QPS A;  3MKZ A;  4JBA A;  4ZDL A;  2OD5 A;  1HF0 A;  2KRC A;  3BWG A;  2L7M P;  1YW9 A;  1QA6 A;  3ESW B;  4RB2 C;  3BZ6 A;  3TOA A;  2XDV A;  1S7O A;  2W85 A;  1W5T A;  1FEX A;  2CG4 A;  2CWE A;  1FOK A;  5E20 A;  2MD0 A;  3ZQH A;  2HQA A;  4ESF A;  3K4C A;  3F6O A;  4MEX F;  2OC6 A;  1OQY A;  5CLS A;  5F0C A;  1JE8 A;  3K4K A;  4D0P A;  2EIJ H;  2DA6 A;  5K7Z A;  5FJ8 J;  2Q2E B;  1VI0 A;  4HPQ A;  1WHU A;  5LLQ A;  1BI3 A;  5B1B H;  2DW4 A;  1MND A;  1FMW A;  3DLA A;  3RZO J;  2ISY A;  2HU9 A;  1WCM J;  2IVM A;  2HKO A;  4RGR A;  2EIL H;  4ZYE A;  1XGM A;  4Q47 A;  4YIR X;  2C6Y A;  1FTZ A;  3S2W A;  5ICC A;  1FBU A;  3GFM A;  3ML6 A;  4PFP A;  3RKQ A;  4RAY A;  2P7V B;  5A2Q Z;  2L9N A;  1BC8 C;  1OIS A;  3A0B C;  2HFH A;  3FKJ A;  1K78 A;  4BQO A;  4NC6 A;  4EJV A;  1E3H A;  5KAI C;  4PJ0 C;  2R7Z J;  2EB7 A;  1IRF A;  4LLG F;  1XCV A;  1QQI A;  5EGO B;  1BW5 A;  4CCL A;  3L2C A;  1JJ6 C;  2XAU A;  3JCU C;  3MKL A;  3H9J A;  3WGI A;  1Y0N A;  4WXH A;  5DCF A;  2OZU A;  4YEL A;  3BR3 A;  2MGQ A;  3K70 D;  1ZGA A;  4EJU A;  4BNC A;  1R5I D;  2ZXW H;  1F5T A;  4HF2 A;  4WK8 F;  1VQ5 I;  2ZXI A;  4HX4 A;  1KZH A;  3VYT B;  4ENN A;  4UNO A;  3H9Q A;  3WTX C;  3P9I A;  2VBZ A;  4ZYA A;  4V2G A;  4B4C A;  1UJ8 A;  2JPB A;  3HXL A;  1X3U A;  1Y6I A;  4CCJ A;  4A3E J;  3MZH A;  1B8I B;  1LDD A;  4GFB A;  4E7H A;  1ZN2 A;  1MIJ A;  3BCA A;  4A3J J;  4IRH A;  1WI3 A;  1S6L A;  3I54 A;  2QZ8 A;  2BY0 A;  1Z9C A;  2L9V A;  4QSH A;  3T8R A;  1Y56 A;  3OV8 A;  4R79 A;  3Q9S A;  2XGX A;  3WTS C;  2E36 A;  1TC3 C;  4JQF A;  2QEX I;  2IT0 A;  4U88 A;  1BOB A;  5EF6 A;  4KN4 X;  1ZQ3 P;  2CQQ A;  2X6W A;  1G2H A;  2CW7 A;  2W57 A;  2WAE A;  2DU9 A;  4XR6 A;  4EJT A;  3K2Z A;  5HDG A;  3W6K B;  3KP5 A;  2N8G A;  3PNV A;  2CUZ A;  2XAH A;  1WPK A;  1RPW A;  5BPI A;  2J5O A;  2DCE A;  1P4X A;  3R0A A;  3CC4 I;  3QOD A;  4W1U A;  4L0Z B;  5GTH C;  4I76 A;  1OJL A;  2EZH A;  2IEK A;  1X58 A;  1FSH A;  3DP7 A;  2NNY A;  5D5W B;  4MTE A;  1WSU A;  3VOD A;  2LC2 A;  3A0H C;  1X3Z B;  4RS8 A;  2BW3 B;  2E1M B;  1D0Y A;  2GXG A;  2QQB A;  4LMY A;  2R5Y A;  2VJJ A;  2FXA A;  3ZQI A;  1FOW A;  1WJB A;  3GTP J;  4FIS A;  3QP6 A;  1QPM A;  1RET A;  3ZQL A;  2V6C A;  1JTY A;  4OOI A;  3BG5 A;  2PN6 A;  2JPC A;  1GUU A;  2ZNZ A;  3BTJ A;  2MW8 A;  2VJ4 A;  2A05 A;  2QCO A;  1FP1 D;  4N4O B;  2DAO A;  4CYD A;  4MFD A;  5E1W A;  4IRG A;  4QTR A;  2K27 A;  3SZG A;  3BY6 A;  3SZT A;  4X1E A;  3RPU D;  3CDI A;  4BL0 B;  3FXO A;  1VQ7 I;  1P7J A;  3SFI A;  4ZJZ A;  4OIQ F;  1OCC H;  3DU6 A;  2J5P A;  4UUV A;  1E17 A;  2W1O A;  3ZGK A;  3G1O A;  1J09 A;  1ZR2 A;  1XMK A;  5EZG A;  4DGW B;  2VJ5 A;  4LFU A;  5J3L A;  2BXY A;  2KIS A;  1RES A;  2OAZ A;  3HOT A;  2RNJ A;  3KLO A;  3OYF A;  1BL0 A;  1X3W B;  2GOM A;  3F3X A;  1A6I A;  2FF4 A;  3HGY A;  1KYW A;  2ZJR F;  1Y1V J;  3F72 A;  2XAF A;  2L7Z A;  3P7N A;  3QYF A;  1W36 C;  4FX4 A;  1BR1 A;  1MMD A;  5LGN A;  3L7W A;  3F9K A;  1TQP A;  3M1E A;  3OYD A;  1IN8 A;  1R23 A;  1N75 A;  2AXL A;  3JTH A;  5JVG F;  3KE2 A;  4PJJ A;  5A2Q K;  2HPM A;  4MTD A;  1VQL I;  3CMY A;  2XSJ C;  1OCR H;  1KU2 A;  4O3M A;  1G3Y A;  4Y52 J;  1U5T B;  1V4R A;  1J2X A;  5JI6 A;  2R7R A;  1XTA A;  2W7N A;  5F04 A;  3EUK L;  4RAG A;  4ZDO A;  3FMS A;  1BJA A;  1YW7 A;  2IW5 A;  2QKM B;  3ZMD A;  1B4A A;  3NAR A;  4XLA A;  3ZMT A;  4D9J A;  1F1Z A;  5H6Q A;  1ZAR A;  2Q2E A;  4AIJ A;  4R8H A;  4EAT A;  5FKK A;  3F23 A;  5FB2 A;  1AA7 A;  1SFK A;  2CQN A;  3HG9 A;  5FLV A;  3I55 I;  2HDD A;  4UB6 C;  2M4K A;  4LG0 B;  1LJ9 A;  4ZYG A;  1W1W E;  4EQQ A;  4UV9 A;  2NVX J;  2QLZ A;  1WFX A;  2JA2 A;  4C3H J;  1F9N A;  2PJR B;  4PK4 A;  1HDD C;  4IXA A;  1H9G A;  1FJL A;  1SD6 A;  2LP0 A;  3BJA A;  5BS6 A;  3WE2 A;  2E2H J;  2QBY B;  4ANJ A;  1IN7 A;  3GTG J;  2W00 A;  2XVC A;  5EGO A;  4B8X A;  4E4H A;  1W5S A;  5E3O A;  4JK1 X;  4RGU A;  2IS1 A;  5IOY A;  1YQA A;  3KP2 A;  5L3B A;  3JRF A;  1OR7 C;  4J19 A;  4PSX A;  3PNT A;  2GZW A;  3EDP A;  2R93 J;  2V1X A;  2JUC A;  2X85 A;  4A3M J;  3RJP A;  2H6C A;  3QWL A;  4AU7 A;  4ZZL A;  4CUG A;  3E6B A;  1S29 A;  2VAS A;  3EUH C;  3FXK A;  1K83 J;  1YS6 A;  1R71 A;  1VQ9 I;  3FK6 A;  3JSO A;  4U7D A;  2FNA A;  2V26 A;  5BQT A;  1YLF A;  1B8I A;  5IP6 A;  5FD5 A;  4I0A A;  2VBY A;  2MAB A;  5J40 A;  2RDP A;  5FGM A;  2X1C A;  3REO A;  3RDI A;  5EEH A;  3L2W A;  1MH4 A;  1HOM A;  5FRM A;  1P4A A;  3QOE A;  1ETO A;  1ETQ A;  1JTX A;  1UAA A;  3A1Y A;  3CMM A;  1JUS A;  2UXX A;  5FLM J;  2NOG A;  3FK7 A;  3AG1 H;  2M8G X;  1P9Q C;  3GTQ J;  2O9L A;  2K7L A;  4LLL A;  2XF7 A;  2Y69 H;  3M8F A;  3JSP A;  3C2B A;  5E8I A;  3I4P A;  4O5V A;  1WI9 A;  3GFJ A;  2IA1 A;  1Z0X A;  3C3W A;  1KQ9 A;  3CF5 F;  1TT5 B;  3J7A O;  4DBR A;  3RCO A;  2XGC A;  3CUQ C;  2FU4 A;  4R1H A;  2EWN A;  4IF4 A;  1IRZ A;  3FMR A;  3PO2 J;  3GME A;  3PM1 A;  3PFI A;  1BJZ A;  5AON A;  1FYL A;  1JGG A;  4A6D A;  5CKT A;  4I2O A;  1Z3X A;  1R5G A;  1ZKG A;  4AUX A;  2BW3 A;  2KFD A;  2KPM A;  2V4J C;  4BKX A;  1QRY A;  3O8H A;  1H0M A;  2P81 A;  3BOQ A;  1I39 A;  1R00 A;  2LG4 A;  3BT9 A;  3OYA A;  4IKF A;  2F5V A;  5GAH J;  2DMU A;  2RV8 A;  2P4W A;  3NQO A;  2G9W A;  4XRS G;  2JSP A;  2FQ3 A;  1BA5 A;  2BXZ A;  4MQV A;  4B43 A;  1YYV A;  4B44 A;  2JTV A;  2M2E A;  3IAS 2;  1DP7 P;  3B02 A;  2DJN A;  2MFZ A;  5GAE J;  3JRI A;  4GDF A;  4M9X A;  1R36 A;  2HOT A;  3KP3 A;  3D5L A;  4P9U A;  1S7A A;  2L0K A;  5E3N A;  1KYZ A;  3M8E A;  4UUS B;  5HDK A;  4XMY A;  3DPT A;  3K70 C;  4ZYD A;  1IAW A;  1W4M A;  2ZSH B;  2ZC2 A;  2L2O A;  1FSE A;  3CJN A;  4LG3 A;  2Z2S B;  2DQR A;  3ZRG A;  2HYF A;  1KGS A;  2CO5 A;  4G8X A;  2VBX A;  4EVI A;  4FET A;  3Q3S A;  4CCN A;  3IL2 A;  4EGZ A;  1ULY A;  3F6V A;  2EA4 A;  4PGG A;  1LEB A;  2VE9 A;  4DZJ A;  3J7Y J;  3LSP A;  2GA1 A;  2E34 A;  3K9T A;  4XQF A;  2O0Y A;  1CF7 B;  4LD5 A;  2XIG A;  3HSE A;  2R92 J;  1U5T A;  2V9P A;  4GYG A;  1Z3Y A;  5FKL A;  3GFI A;  1B1B A;  2D2W A;  1HA8 A;  4G7O F;  3JAM Z;  3S8P A;  2RNG A;  1SVL A;  4Y17 A;  1ZAO A;  1MDM B;  2LRD A;  5KCM A;  3D1N I;  3QU6 A;  4U87 A;  3TOB A;  1LDJ A;  1EA3 A;  2NVT J;  3L09 A;  1WZ2 A;  2L4A A;  4V2F A;  2YX7 A;  1QBJ A;  2TDX A;  3FZV A;  4XOR A;  4DBQ A;  2E71 A;  4N4N B;  4KT6 A;  2K9M A;  3I4M J;  1IDZ A;  2LK2 A;  5DYM A;  1T33 A;  4LG0 A;  2V9V A;  1TL8 A;  4UUT A;  3HKZ A;  4J01 A;  3WGH A;  1SFO J;  3E1S A;  2ZXJ A;  2W4S A;  1IJW C;  1MNM C;  3OOP A;  2IS6 A;  2DA2 A;  3BZK A;  3CQZ J;  4UVC A;  2HDW A;  3MZ8 A;  4MNU A;  1Z6R A;  2VT2 A;  4AWX B;  4AVZ A;  4G7H F;  2PJR A;  1U0J A;  3H0G J;  4QIW N;  2DOE A;  3IKT A;  2BYV E;  5K5R A;  3C1D A;  5L3G A;  2A69 F;  1VTN C;  4ZZD A;  5JFR A;  2WWY A;  4DYC A;  2QBY A;  1LEA A;  3ERM A;  3BR6 A;  1FWZ A;  3K69 A;  2LH9 A;  3CLQ A;  3WHC A;  5E18 F;  4E7K A;  1AOY A;  2FE3 A;  2P7C B;  3J81 Z;  1PJR A;  2XGD A;  2UWM A;  5FLX Z;  2G7H A;  1SEU A;  1WJ5 A;  3BJ6 A;  4F52 A;  1OYY A;  1K6Y A;  2KIU A;  3I59 B;  3T0Y A;  3LOC A;  1W36 D;  3DBR B;  1UMQ A;  4FT8 A;  3ZQ7 A;  2PX9 A;  4BDZ A;  2KMU A;  1Z67 A;  3CTA A;  2BVM A;  2OBP A;  3DKX A;  3GTJ J;  4L9N A;  1GLN A;  3GCM A;  4RM3 A;  2QA4 I;  4HQM A;  1QZE A;  4BAY A;  5EG0 B;  2KJC A;  1IN5 A;  1V55 H;  1Z6T A;  4RA2 A;  1H89 C;  4IRI A;  3DPU A;  3IH4 A;  1QNT A;  3MVP A;  4XLH A;  2LTP A;  4BU2 A;  2LKS A;  1XSD A;  2JVH A;  2ZME B;  3R4K A;  1O3T A;  1IRG A;  5TGT A;  3VDX A;  3KIO A;  4KJZ A;  1EH8 A;  4LIU A;  3L9F A;  3GTK J;  2XB5 A;  3K0L A;  2AQF A;  2VJI A;  4LLN A;  4JOM A;  4DYR A;  4FQG A;  3CUO A;  1GV5 A;  4CCO A;  2M8E A;  1I27 A;  3VYS B;  4DYQ A;  3CD6 I;  3TO6 A;  4ENJ A;  2B9S A;  2Y0S A;  1ON1 A;  5J6X A;  4HX7 A;  2X0L A;  1YE9 A;  1XGN A;  2XB0 X;  3KLN A;  3NWS A;  3TP0 A;  1DGW Y;  3OYL A;  3CO7 C;  1YJN I;  4KA4 A;  1QGP A;  4XOP A;  1IN4 A;  3H92 A;  4JP0 A;  1FYM A;  2RC4 A;  4BBS J;  3ERE D;  3LST A;  5JVT A;  1M1E B;  3IHU A;  1ZRE A;  2XAG A;  3P9C A;  1XMX A;  2E60 A;  4G6T B;  4B3A A;  4BYY A;  2ZCW A;  1G3W A;  5CPR B;  1YTY A;  3LMM A;  2ZJP F;  2VC1 A;  1IXC A;  3N4M A;  5FFX A;  9ANT A;  4HLY A;  1JGS A;  3LNQ A;  3LAJ A;  1GDT A;  2F4O B;  2K9S A;  2XRO A;  4F3Q A;  3H9G A;  2Z3Y A;  4PUS A;  2DTR A;  2WAQ N;  3H5R A;  1F43 A;  1X1D A;  5E1Z B;  4HDU A;  1U6G A;  2EFQ A;  3GUD A;  3EYI A;  2BEO A;  4M74 A;  5B66 C;  1EH6 A;  3AKZ A;  4P96 A;  2JRM A;  3E6C C;  2FEZ A;  3OL3 A;  3OS0 A;  4L18 B;  1BOA A;  2M0M A;  1T0F C;  1P7I A;  3AG3 H;  5K7F A;  3M9A A;  3OMY A;  5IYB J;  2GM4 A;  2EV0 A;  3K6G A;  2WBM A;  2HQR A;  3KP6 A;  3CMA I;  3M07 A;  2W82 A;  1H9T A;  4C2T A;  5HVQ C;  4BH9 A;  1MKM A;  3QU3 A;  4KYW A;  5K7H A;  5F0H A;  3K4M A;  3FF5 A;  2PI0 A;  4UUS A;  2NVU B;  1FC3 A;  2DMQ A;  3NRV A;  1G3T A;  2KIQ A;  4C3I J;  4Y13 A;  2XKO A;  1AU7 A;  2FSW A;  5D6E A;  2WAD A;  3EUA A;  2FQ4 A;  4B1R A;  2AXT C;  3S16 J;  2R4G A;  3W3C A;  3CP2 A;  4A3K J;  3ROU A;  1SC7 A;  1MZB A;  2XKP A;  2EA2 A;  3S32 A;  2KKO A;  1X1P A;  4A69 C;  2IXS A;  5IOZ A;  4LB5 A;  4CDG A;  3BTL A;  1YHQ I;  1EF4 A;  3BG9 A;  2TRT A;  3C7J A;  3J80 Z;  1D1C A;  2KL4 A;  4XIC A;  1I6H J;  2HEO A;  2A6E F;  1ACI A;  4KIS A;  2IS4 A;  2KHM A;  5TJJ A;  5IT9 K;  2CGP A;  1ZRF A;  3VOE A;  4C3J J;  3HRU A;  1U2W A;  4E7L A;  2DFH A;  5CVV A;  2M9H A;  4EV0 A;  2NNN A;  3NEU A;  4HNV A;  4KIC A;  4G7Z F;  1CF7 A;  4NC8 A;  3KEO A;  2IA2 A;  3GBG A;  1E2X A;  2LLK A;  2NS8 A;  4HF0 A;  4PJL A;  3GTO J;  2Y30 A;  3F8N A;  4L9J A;  5GAG J;  3WG9 A;  4YG2 F;  1RKT A;  5HOD A;  1U8R A;  1F4K A;  3FKI J;  2L5Q A;  3O8G A;  1LFP A;  3ISP A;  4NC7 A;  1MDM A;  1ERD A;  2HVQ A;  3IWF A;  1OMI A;  4HZF A;  4ZTJ A;  1G59 A;  1V5G A;  3CZ6 A;  2Y48 A;  4LIT A;  1ZRD A;  4I09 A;  3S2H J;  4NBQ A;  4CXF A;  4I0B A;  2V1N A;  2LKP A;  3ECO A;  1A35 A;  3CJQ B;  2CMP A;  2HXI A;  2X6X A;  5JR3 A;  1XSX A;  3I5U A;  1JXS A;  4BY1 J;  1HCR A;  3GO5 A;  4NHJ A;  2M34 A;  5EJC A;  4PGH A;  4E7J A;  1D1A A;  1YG2 A;  3Q0U A;  4ITV A;  4KIT B;  2UUZ A;  2VQC A;  2X6Y A;  3ULQ B;  4CSW A;  2CH0 A;  2VI6 A;  4XLC A;  3CES A;  4CZC A;  2JMW A;  3FM3 A;  3G1M A;  1D8J A;  3VYR B;  3S2D J;  4ESJ A;  2LD5 A;  3DFG A;  3E7L A;  5DCM B;  4I99 C;  2DJI A;  3DF8 A;  4CIC A;  1ETX A;  2R7U A;  3R60 A;  3FBI B;  3ABU A;  1T6S A;  2VOO A;  3CCL I;  2NOJ B;  4FE7 A;  3H5A A;  1D0Z A;  1ORK A;  4DNC A;  3OIQ A;  2NVQ J;  4AC0 A;  1ONV A;  3B6A A;  2HDC A;  2XRL A;  1MH3 A;  5CJ9 A;  3OS2 A;  5B1A H;  2ESH A;  5ICG A;  3I59 A;  1J0R A;  2LBF B;  4BXX J;  1YO5 C;  3F22 A;  1BI2 A;  1HC8 A;  4O6J A;  5J1Y A;  2K9L A;  3UR3 C;  5EG0 A;  3BDD A;  1VFC A;  1HW2 A;  1ETV A;  5HLT A;  4IHV A;  1NG6 A;  2KRF A;  3W2A A;  2ESN A;  1UST A;  2TCT A;  1HKS A;  5L3D A;  2ZME A;  5D8L B;  3CO6 C;  3FXU A;  2GXA A;  2Z9O A;  1QU3 A;  1UHS A;  2W48 A;  4AIK A;  2DOD A;  5CVJ A;  4OIN F;  4DIQ A;  4F93 B;  1HKT A;  3HHH A;  2GAU A;  1JJ8 C;  4ON0 A;  2XF6 A;  4DOZ A;  3FBN B;  2L54 A;  2ISZ A;  4ESB A;  5CQG A;  5LHI A;  2CUF A;  1RUN A;  2AQE A;  2DK5 A;  2ME6 A;  2ADU A;  1YIT I;  1UG0 A;  4HV5 A;  5F64 A;  5ICE A;  1IV6 A;  1S7E A;  1SFX A;  3HSF A;  3E5Q A;  5IT3 A;  1LKX A;  4XN0 A;  1G6N A;  4YIF A;  3HOS A;  4F91 B;  2VB6 A;  2W84 A;  2JVG A;  3JRB A;  2M1B A;  4XLE A;  1MJB A;  1FTT A;  2GLO A;  4CHU A;  2G7U A;  3E0J B;  1VQ8 I;  3I3L A;  1RNL A;  1LUJ B;  3LSG A;  2DOA A;  4HNT A;  2F5F A;  2KQR A;  3J7A Y;  1Q1V A;  1XN7 A;  3PQJ A;  2H1L A;  2MD5 A;  4FHT A;  4HST A;  3HM5 A;  3L2V A;  2Y9Y A;  1FT9 A;  3B73 A;  2O61 A;  3ABM H;  3I64 A;  1O3Q A;  1Z91 A;  2D1V A;  1FP2 A;  2Q1Z B;  4L5E A;  5HNH A;  2O3F A;  1DU0 A;  5BMZ A;  2CQK A;  1BM9 A;  3IWZ A;  5E17 F;  2H1K A;  2DA7 A;  2HPI A;  3JRC A;  3SFZ A;  5D5V B;  2JA7 J;  3RYP A;  4P9F A;  2OV7 A;  5HS7 A;  3H3Z A;  4XRF A;  3IV5 A;  2FBK A;  3OIO A;  1DPU A;  1ETY A;  2QGU A;  2VKE A;  1XX5 A;  4BGD A;  1YI2 I;  2JA8 J;  3BR2 A;  2PMU A;  3SEZ A;  5ED4 A;  1XPX A;  3BG6 A;  4A2U A;  1MBH A;  4Z6Y A;  3GX4 X;  3TBI A;  5L3E A;  2K9Q A;  4A0X A;  1QZZ A;  2VXD A;  2H27 A;  3DBL B;  2W25 A;  3KZY A;  4IEJ A;  2DTZ A;  3ZCO A;  2YU9 J;  3FXL A;  1SD5 A;  3F21 A;  1YRN B;  5C44 J;  3S14 J;  1K6O A;  1NK2 P;  3O2P E;  1FIA A;  5CVR A;  2GWR A;  4IHT A;  2KP6 A;  1ETW A;  1ZRC A;  2VQH A;  2VL8 A;  2A6T A;  2PQ8 A;  3CF2 A;  3HZJ A;  2JA5 J;  1P4W A;  1FNN A;  5LRS A;  3ZQG A;  1Z05 A;  5IP7 J;  1WJF A;  1EKE A;  3BC8 A;  2VLA A;  2IBD A;  3DQV C;  4UB8 C;  3WHB A;  4A3C J;  1GXQ A;  2ZB9 A;  3COA C;  1LQ1 A;  4HOB A;  4KFC A;  3U1K A;  4F55 A;  1E3P A;  3CCR I;  2EFO A;  1LDK B;  1JHF A;  3ZMU A;  5K5O A;  3RTR A;  2XC7 A;  2BY3 A;  4IL6 C;  4ASN A;  3HOZ J;  1QVT A;  3U21 A;  3OYI A;  2DT7 B;  3ZR8 X;  2CQ7 A;  2K4B A;  2PBI A;  3M4O J;  1REP C;  4HRI A;  5KK1 A;  2VOD A;  3F8C A;  3BPV A;  1O7L A;  3DEU A;  3ASN H;  4MHG A;  1J75 A;  1V54 H;  5LD2 C;  4RB0 A;  2RQQ A;  3LA7 A;  2HYG D;  1NH3 A;  1HSJ A;  2BOL A;  4XNF A;  4A5M A;  1D8K A;  2V7F A;  3OWT A;  2M7A A;  2VOP A;  3OS1 A;  2ELH A;  2MC3 A;  2X48 A;  2XAS A;  4MQ9 F;  2AO9 A;  3CUQ B;  1FOX A;  4NQW B;  3ZPL A;  4IHY A;  3RYR A;  5F1R A;  2HVR A;  3CCS I;  2V1D A;  3H36 A;  2BHY A;  1W5C C;  5DV5 A;  4YFX F;  2A5Y B;  2VQL A;  3MFK A;  1XGS A;  1JHH A;  1T39 A;  3LSH A;  4ZH4 F;  2BE5 F;  2QQ9 A;  3OY9 A;  3HHG A;  2YPR A;  1MBK A;  2XPW A;  1ZLJ A;  2PMZ A;  4JYK A;  1E3O C;  4M3B A;  4M71 A;  2CSO A;  5IYD J;  3VSL A;  4OIR F;  5CQE A;  5DCM A;  2LYC A;  1G3S A;  4ZYH A;  3P5J A;  1CGP A;  1FYK A;  4IOA F;  2R7V A;  1TWF J;  4BXF A;  1NG7 A;  3KYC B;  2ECB A;  4CGZ A;  1OLT A;  1DUX C;  3TO9 A;  1PP7 U;  3DKY A;  4PDK A;  2OU2 A;  3FXM A;  1SFE A;  5DUK A;  3HC7 A;  1MJ9 A;  3TO7 A;  3MEX A;  1YIO A;  1R49 A;  3DTK A;  4D1Q A;  2QEN A;  2LBF A;  2JQ7 A;  3OYH A;  2QSF X;  3CME I;  2K5C A;  4AID A;  5FRN A;  3BQY A;  4U0V A;  5LGT A;  1STZ A;  1UB9 A;  2X4H A;  1XDU A;  2X1D A;  4BUP A;  3PFY A;  5C4J J;  1JKQ C;  4BJ5 C;  4D7N A;  2BGC A;  2KZV A;  3D5S C;  3OOU A;  2DBB A;  2CFX A;  2DA1 A;  4W97 A;  3MCZ A;  1ZTR A;  2QKL B;  3GYH X;  2CUE A;  6PAX A;  1N78 A;  3BRO A;  2IPQ X;  3EPZ A;  5LFA A;  1T98 A;  2DMT A;  4Y33 A;  4BQA A;  2HOS A;  2DLL A;  3W2V A;  4OAZ A;  4E70 A;  4BQN A;  1WKM A;  1FY7 A;  2Q8K A;  1O4X A;  2YU3 A;  4OMZ A;  4HF1 A;  2BY1 A;  2DFE A;  2Z33 A;  5ERI A;  1X2M A;  3QP5 A;  1UG2 A;  2CYY A;  2ETH A;  1Y0U A;  1KA8 A;  2M7B A;  1V5E A;  3BCB A;  1DGR M;  5C3E J;  1KQ8 A;  5D4S A;  1J59 A;  5L3F A;  4OWR B;  3OYG A;  2HVS A;  2K86 A;  3CP8 A;  2E1N A;  5M3F J;  4UVA A;  1R4N B;  1WVR A;  2I5U A;  1L0O C;  2HOA A;  2VN2 A;  4IJA A;  3ZMZ A;  5ILU A;  1TBX A;  5J4V A;  5LGU A;  3PUB A;  1WWX A;  2FMY A;  1DPR A;  1W7P D;  2DT5 A;  5H6R A;  2I10 A;  4QPQ A;  1SD4 A;  2FNP A;  2CV1 A;  1B59 A;  2O03 A;  2A68 F;  4A3F J;  4PZJ A;  1AWC A;  4ABZ A;  2VBW A;  3HTS B;  2F5E A;  3PL8 A;  2HQN A;  2LF7 A;  4UVB A;  2K02 A;  1LVK A;  2B7E A;  3EYY A;  4U0W A;  3L2Q A;  4YFK F;  3S1R J;  2R7O A;  2VQG A;  3GEZ A;  1Y39 A;  1ZGJ A;  2DOF A;  3DPL C;  4D5F A;  5D5U B;  1YW8 A;  4ETS A;  4RM2 A;  1KQ0 A;  2B0L A;  4XLN F;  1HW1 A;  1UCR A;  2GBY A;  3RSN A;  4UV8 A;  1RUO A;  1R6R A;  4XK4 A;  2RKH A;  1WJE A;  2PFB A;  2QSH X;  1A6Q A;  1B9N A;  1HST A;  2E35 A;  4ZDP A;  3WTW C;  4CYC B;  2UXN A;  2OCC H;  1BIA A;  4ZTF A;  2F4I A;  2VXZ A;  1SAN A;  4L5J A;  3S15 J;  2PLY A;  1QHH D;  2OA4 A;  1JKR C;  2EBI A;  5ILV A;  3ZQC A;  2KDO A;  1X2N A;  5F1J A;  5E1X A;  5D6F A;  3OYM A;  3Q0V A;  4RB1 A;  1D5V A;  2FOK A;  4XRM A;  2GA2 A;  2JSC A;  1U78 A;  1YRN A;  2L01 A;  3GFL A;  2R3S A;  2EJR A;  2VPR A;  3G6E I;  1OR7 A;  2HWV A;  1PDN C;  4CO8 A;  4A5N A;  3LAP A;  3HOW J;  2GIV A;  1LFB A;  3QQA A;  1I6X A;  4EMS A;  3CJT B;  3JRH A;  4IZZ A;  4XBF A;  2W24 A;  3DU5 A;  4EM2 A;  4X6A J;  2EZI A;  4Y15 A;  1MMA A;  2A5W A;  2FRH A;  3Q9V A;  4V19 K;  1YX5 A;  2CQX A;  4MO7 A;  1LPQ A;  2X9D A;  3V7S A;  3E5X A;  3HOY J;  1ODD A;  3LFU A;  2VKH A;  2COB A;  3EUH A;  1MSE C;  2DMP A;  1X19 A;  3BTI A;  4B47 A;  2FX0 A;  3VFZ A;  2VE8 A;  3A4C A;  3IH2 A;  4BXU A;  2MYS A;  3AG2 H;  4Q4Z F;  5GAD J;  3ASO H;  3OYJ A;  3OSG A;  4DJA A;  1WJD A;  2P5V A;  2ELK A;  2IGK A;  2KJB A;  4OU0 A;  1I3A A;  2NS0 A;  1POG A;  3EQL F;  1JT6 A;  3DXJ F;  2AHQ A;  4EGY A;  4G94 A;  5LRR A;  2EV5 A;  4KT5 C;  5BOX A;  1TWA J;  2XSD C;  4KDP A;  3RIR A;  4FE4 A;  2H8W A;  2ELJ A;  1EH7 A;  1QO0 D;  3GXO A;  2IRF G;  2EPF A;  2HYJ A;  4IQJ A;  5GPA A;  2UZK A;  3BTC A;  2ID3 A;  1CQT A;  2WAF A;  2XPV A;  4MEY F;  3RI4 A;  1PP8 F;  1JUM A;  5HNF A;  1MMN A;  1B72 B;  5DTD A;  1K4S A;  4A3G J;  4L0Y B;  2CUJ A;  1TQI A;  1USS A;  4BDY A;  3CUQ A;  3BLY A;  2DPD A;  4I02 A;  2LFB A;  2D45 A;  1ZK8 A;  4NQW A;  3PSI A;  1OFC X;  1MMG A;  5HS9 A;  2CJJ A;  3DTI A;  3SHF A;  2E7W A;  2R5Z B;  5J8F A;  3MMY B;  4OMY A;  4M6V A;  4XL9 A;  4M6X A;  1GVJ A;  3CDH A;  4II3 A;  1T2K A;  4N9H A;  2DK8 A;  4Y4R A;  4HDV A;  3JW4 A;  4P1W A;  3O6B B;  1P2F A;  3KPH A;  1RRJ A;  2X1E A;  3AL0 C;  1SAU A;  3H35 A;  2E5N A;  2LY9 A;  1WGX A;  3F8F A;  2A6H F;  2CS3 A;  4M72 A;  4E7Z A;  2I8D A;  1FBQ A;  2HI3 A;  4OIO F;  2HTJ A;  4XKV A;  4RMN A;  2GOX B;  2EFP A;  4XOT A;  2AS5 F;  3A2K A;  2IAI A;  3HRM A;  3I0T A;  2WY7 Q;  3D0S A;  2FA5 A;  3FHN A;  1TWH J;  1SMY F;  3HYI A;  1R9T J;  1QVU A;  3F8B A;  4HQE A;  3DLL F;  4I98 B;  1ZYR F;  5HS8 A;  1AKH B;  2ICW G;  3RQI A;  3JRE A;  3NWT A;  3FHZ A;  3G2B A;  4N9I A;  4XKW A;  2JZY A;  4WCG A;  3I56 I;  5GTI C;  3SXY A;  4B48 A;  1YJ9 I;  2HQ5 A;  5EEA A;  3R6S A;  3RQ4 A;  3L2R A;  2F5C A;  4BE1 A;  3WU1 B;  2P8T A;  2OTL I;  4U7B A;  3WG7 H;  2DFF A;  2LSO A;  1MBE A;  4I01 A;  2ZFU A;  1XG1 A;  1XGO A;  4F92 B;  2KIF A;  2YX4 A;  2R7Q A;  2NYX A;  2DA4 A;  5J47 A;  3AFH A;  3S3O A;  2E1C A;  2LY2 A;  3I58 A;  3G71 I;  3PJR A;  2E2I J;  3ZMS A;  4DQ2 A;  2R7D A;  1SVO A;  2VC0 A;  1IDY A;  3E3V A;  2E2J J;  1O3S A;  2ZNY A;  4BE2 A;  1VQ4 I;  4XID A;  1Z1D A;  2YR2 A;  2LDU A;  4KIB A;  4PFO A;  2MG4 A;  1UEL B;  2DFI A;  4A3L J;  5DD4 A;  5GP9 A;  3WTY C;  3WU0 A;  5TRD A;  2YSR A;  3FWE A;  3DV8 A;  3MQ0 A;  1X4O A;  2MLK A;  3BP8 A;  4XSZ F;  4AYB A;  1GXP A;  3HIF A;  4TV7 A;  4FTH A;  4Y7N J;  1XD7 A;  4A3B J;  1I1G A;  4HA8 A;  3H3V K;  2STW A;  5FD6 A;  2B63 J;  1MBJ A;  2L9S A;  3G3Z A;  4LIV A;  1PUF B;  2GXB A;  3LSM A;  1ZG1 A;  3V8K A;  5DD8 A;  1I1S A;  3SDG A;  5K5Q A;  2R7T A;  1HXD A;  2JT1 A;  4UHT A;  1Y8Q B;  3Q5F A;  2F5D A;  1JUP A;  1KON A;  1T95 A;  3H0D A;  1Z21 A;  3LSR A;  3G4S I;  4JX5 A;  2KZG A;  3SZP A;  2VON A;  1ZR4 A;  3AG4 H;  1OPC A;  3OSF A;  4CYC A;  1EJ9 A;  1W7P B;  1MJA A;  3E97 A;  3JAM K;  1IW7 F;  4C9Y A;  2QSG X;  1MSF C;  1IO2 A;  1TWG J;  3R61 A;  3OYC A;  3KYL A;  2FD5 A;  5DUI A;  4UXN A;  1YJW I;  4IHW A;  4H0E A;  3MKY B;  2BY2 A;  3KCC A;  2DMN A;  1ZGW A;  3RPU A;  2LKX A;  4IX7 A;  5D4R A;  5E79 C;  2CV2 A;  3G1L A;  3CCE I;  3QPH A;  2IP2 A;  3BJO A;  4HSR A;  2V9K A;  3U1D A;  3TW6 A;  3OYN A;  1BI1 A;  1IGN A;  1W0T A;  1EV7 A;  5J1R A;  2RGV A;  2MH2 A;  3GLX A;  3T8T A;  3BQZ A;  5HLH A;  3R0J A;  5M5W J;  1D5Y A;  1S72 I;  3BPX A;  2M45 A;  1TTY A;  3HL2 A;  2WB1 A;  3CCM I;  3WTV C;  2OPT A;  3FM5 A;  2QF7 A;  1TNS A;  5EZH A;  2V1U A;  2FOW A;  3UKG A;  1ZHF A;  3V7R A;  3ZXS A;  3IC7 A;  3J81 K;  1W0U A;  1HBX G;  2DO7 A;  3MKW B;  5FLX K;  1IRX A;  3GZ5 A;  1UZC A;  4H4K C;  3RKW A;  2M30 A;  2NXN B;  3E6D A;  1WH5 A;  1WJA A;  1LE8 B;  1ZLK A;  2QQ8 A;  1TW3 A;  2JWT A;  3QAH A;  4IPA A;  3K4N A;  1I50 J;  1XSV A;  1U3E M;  5H2F C;  1B72 A;  3K7A J;  1WRJ A;  3ABL H;  1ON2 A;  3FDY A;  3SDB A;  4HLX A;  4RB3 C;  1JKP C;  4GYI A;  1LNW A;  3S3N A;  3TMO A;  1D0X A;  4D7M A;  3TDU C;  3K1N A;  1JI8 A;  2A3S A;  2M4G A;  3DTE A;  5DM7 F;  5EYR A;  2R5Z A;  5JHU A;  3ABT A;  2QUF A;  4S0H B;  1YFH A;  1BN5 A;  4PJM A;  1FPQ A;  1QPI A;  4M9S A;  1FOY A;  4PSW A;  4Y3O A;  1OCZ H;  2P6S A;  3HEF A;  1YX3 A;  3HJE A;  4EJW A;  4BEH B;  2BBY A;  2O7O A;  5M5X J;  1E0E A;  2IGM A;  1X1B A;  2DYS H;  2IS2 A;  2MSY A;  2EZK A;  2XHK A;  5FKN A;  5D5X B;  4CCM A;  1T0F A;  3IRR A;  4QWQ A;  1UFM A;  2PG4 A;  2CRG A;  3HBL A;  3A01 B;  2JN6 A;  2MBF A;  2LRE A;  1FX7 A;  3IAM 2;  5H20 A;  2OF7 A;  2BVL A;  1BR4 A;  1N25 A;  1AKH A;  1YOV B;  3V42 A;  3ABK H;  4RLQ A;  3HTU A;  1WH7 A;  2ZBK A;  4JX6 A;  5F0F A;  1T56 A;  3V4G A;  1N77 A;  4IO9 F;  3HRS A;  1FIP A;  2IJL A;  3KX2 A;  3HKZ N;  3CC2 I;  2ZKZ A;  2XV4 S;  4BE0 A;  3J7Z I;  3JTG A;  2G0E A;  1XB4 A;  3FIS A;  1I3Q J;  3ECH A;  2KDZ A;  1IF1 A;  1Y8R B;  1A04 A;  1VQP I;  2M0C A;  2HZD A;  1H8A C;  4RLF A;  3DEE A;  4N0B A;  4IHX A;  4HYE A;  2FBH A;  3LFK A;  1GHC A;  5ICF A;  3RPQ A;  4U0Y A;  1R4M B;  5LHH A;  5FRO A;  5AIP A;  1R1U A;  3I4N J;  2LF8 A;  1GV2 A;  3N05 A;  1OCO H;  2VPL A;  4IVN A;  3DWL E;  3PIO F;  2MC4 A;  4P55 A;  4ENM A;  5BNG A;  2E1O A;  4G12 A;  4E7S A;  1S8N A;  1NTC A;  2QYO A;  3OYE A;  2WV0 A;  2R7X A;  4KNY A;  4EEF G;  3HPG A;  2PMH A;  2COM A;  1RZ4 A;  1HLV A;  3C2G A;  3VPR A;  1VQO I;  3E5U A;  3GZ6 A;  2E5Z A;  3KET A;  3UNG C;  5GPC A;  3LL7 A;  1KU9 A;  3LA3 A;  1U9N A;  4A12 A;  3AAF A;  5CVI A;  4WX9 A;  1PUF A;  1A31 A;  3ZQF A;  5JHF A;  3FMQ A;  3J80 K;  1U9O A;  2XGE A;  3VEP A;  1Z7U A;  2K9N A;  4Q48 A;  3VB2 A;  5TIS C;  2LNB A;  3W6V A;  2ZXH A;  1R58 A;  4AD9 A;  4MIM A;  4HAM A;  3G73 A;  1RIO H;  4JX4 A;  1IC8 A;  2DDB A;  4B3X A;  4HEA 2;  3PNY A;  2Y0S N;  4IHS A;  4FCY A;  3KZI C;  2EFN A;  1UHW A;  5ILS A;  3PUF A;  1IXS B;  5KAF C;  5HOO A;  3RZD J;  3E6M A; 
#chains in the Genus database with same CATH homology
 1W7P A;  1K79 A;  2L3D A;  3RKX A;  2L02 A;  3KP4 A;  3QOP A;  2H09 A;  5KVR A;  2RN7 A;  4NB5 A;  2DPU A;  1MGT A;  1P92 A;  5F6F A;  5HDN A;  1T38 A;  5E8G A;  1J5Y A;  2ZJ2 A;  2OQR A;  3LA2 A;  2H6B A;  4FX0 A;  1R7J A;  3WTZ A;  1XMA A;  5D8K B;  4L9V A;  3TQN A;  4PCQ A;  1BIB A;  4M6Y A;  4XLP F;  2HOE A;  2OZ6 A;  2HS5 A;  4KN7 X;  2WC2 A;  2O8X A;  4GXO A;  2VT3 A;  3QRF F;  1O3R A;  2H94 A;  2HR3 A;  2M87 A;  2Z99 A;  1HW5 A;  2MH9 A;  2A07 F;  4HV6 A;  1SD7 A;  3HSR A;  3N97 A;  1OYW A;  3H3U A;  1R5H A;  1ZG5 A;  4YII A;  4I7H A;  1BI0 A;  4KMF A;  2EK5 A;  2JRT A;  1HQC A;  3M7G A;  4L5I A;  2HGC A;  1B6A A;  4LB6 B;  1K7A A;  1BC7 C;  2NAZ A;  3GW2 A;  4CZZ A;  1FBS A;  2HTS A;  3WTT C;  1U5T C;  2KIM A;  3EET A;  3WOD F;  1G4D A;  4BHC A;  1ZH5 A;  4G9Y A;  4KMU X;  3LWF A;  1MD0 A;  2NRA C;  5LBQ A;  4WXD A;  5DDG A;  5DEQ A;  2QWW A;  3FXR A;  1D3Y A;  4BHB A;  3V8L A;  3MAJ A;  2XAQ A;  2DI3 A;  5L3C A;  2PJP A;  4EM0 B;  2QQA A;  2L4M A;  4LGW A;  2F2E A;  4GGG A;  4RGX A;  4HX8 A;  4AIH A;  1IN6 A;  3O3K A;  3U2R A;  3I71 A;  3TKY A;  3C18 A;  4M9Z A;  3KZZ A;  1SMT A;  3W6J B;  3MWM A;  3K1M A;  4WF2 A;  4GCV A;  1IXR C;  2K4J A;  4F7Z A;  4HBL A;  4LK0 F;  2XUB A;  2D1H A;  1J9I A;  2QM3 A;  4A0Y A;  1C0W A;  2FBI A;  2Y0M A;  4KIF A;  1IZ1 A;  5LEK A;  1SFU A;  1O7F A;  3HRT A;  4B09 A;  3GWZ A;  2MA3 A;  1ZG3 A;  1LB2 A;  2PEX A;  5HLG A;  3T5X A;  2EFW A;  1YS7 A;  5CYV A;  2ZFW A;  3L00 A;  2Q0O A;  1XCB A;  4AVP A;  4OIP F;  1R1V A;  2STT A;  1KU3 A;  1TNT A;  2OQG A;  2WTE A;  1FZP B;  1XDS A;  5LEJ A;  4RAZ A;  1P6R A;  2EV6 A;  3FXQ A;  2M5W A;  5HLI A;  1DDN A;  2CW0 F;  3MZY A;  4WXC A;  3QPT A;  2V79 A;  3P9K A;  2BV6 A;  1KU7 A;  4A0Z A;  3RKY A;  1Q1H A;  2A61 A;  1R1T A;  1PUE E;  1K78 B;  1LVA A;  1OKR A;  3TGN A;  1V3F A;  3ZP5 A;  3ZN0 A;  2E7X A;  3V7C A;  5IT9 Z;  1B9M A;  3SQN A;  3U9G A;  3ZN1 A;  3LQR A;  3K1P A;  4G6Q A;  4L9T A;  3IKV A;  1TLH B;  3V8J A;  3IRQ A;  2HKX A;  2P5K A;  4XSX F;  2R7F A;  1BBY A;  4MGR A;  2Z5U A;  3WGG A;  5FFZ A;  4S04 A;  1IUY A;  2RQP A;  3DKW A;  2ZO4 A;  4RGS A;  2GQQ A;  4KUM A;  2P6T A;  2XAJ A;  2QVO A;  4BHP A;  2RVC A;  3ZMV A;  3KEQ A;  4GO1 A;  3ELK A;  4G6D A;  4S05 A;  1FLI A;  4EM1 A;  2MLG A;  2XRN A;  2FML A;  1S3J A;  2HZT A;  1NHA A;  4P5O A;  3F8M A;  4Q5S F;  5AIQ A;  1RI7 A;  1O57 A;  1R22 A;  3PQK A;  3I53 A;  1TW2 A;  4HW0 A;  2P5L C;  1SAX A;  1TQM A;  3FX3 A;  3GF2 A;  3T1B A;  3TDZ C;  4WWC A;  1OYI A;  1QZY A;  3WE3 A;  4ENK A;  4YFN F;  3HUG A;  4A6E A;  1HKQ A;  3GVA A;  4KIG A;  2DQL A;  3KFW X;  5FO5 A;  4K2E A;  1L3L A;  4LJZ F;  5CVU A;  1WQ2 A;  5J8C A;  5K1Y A;  2ACJ A;  2O6G E;  4QLC U;  3KP7 A;  1UHM A;  1J7K A;  3CLO A;  4M73 A;  5EEG A;  5LHG A;  3WTU C;  1I5Z A;  5BPD A;  2IA0 A;  4LK1 F;  4EJO A;  4Z2Y A;  2Y75 A;  3LQQ A;  4JBA A;  2OD5 A;  3BWG A;  1YW9 A;  4RB2 C;  3BZ6 A;  3TOA A;  1S7O A;  2W85 A;  1W5T A;  2CG4 A;  2CWE A;  1FOK A;  5E20 A;  4ESF A;  3F6O A;  4MEX F;  5CLS A;  1JE8 A;  4D0P A;  5LLQ A;  1BI3 A;  2DW4 A;  2ISY A;  4RGR A;  2IVM A;  4ZYE A;  2HKO A;  1XGM A;  4Q47 A;  2C6Y A;  3S2W A;  5ICC A;  1FBU A;  3GFM A;  3ML6 A;  4RAY A;  2P7V B;  5A2Q Z;  1BC8 C;  2HFH A;  1K78 A;  4EJV A;  2EB7 A;  1IRF A;  4LLG F;  1XCV A;  1QQI A;  3L2C A;  3WGI A;  4WXH A;  5DCF A;  2OZU A;  1ZGA A;  4EJU A;  4BNC A;  1F5T A;  4HF2 A;  4WK8 F;  4HX4 A;  4ENN A;  4UNO A;  3WTX C;  3P9I A;  2VBZ A;  2JPB A;  1X3U A;  3MZH A;  1LDD A;  1ZN2 A;  4IRH A;  1S6L A;  3I54 A;  2QZ8 A;  1Z9C A;  3T8R A;  3OV8 A;  4R79 A;  3Q9S A;  2XGX A;  3WTS C;  4JQF A;  2IT0 A;  4U88 A;  4KN4 X;  2W57 A;  4EJT A;  2DU9 A;  3K2Z A;  5HDG A;  3W6K B;  3KP5 A;  2XAH A;  5BPI A;  2J5O A;  1P4X A;  3R0A A;  4L0Z B;  1FSH A;  3DP7 A;  2NNY A;  5D5W B;  4MTE A;  1WSU A;  3VOD A;  4RS8 A;  2GXG A;  2QQB A;  4LMY A;  2FXA A;  3QP6 A;  1QPM A;  2V6C A;  4OOI A;  2PN6 A;  2JPC A;  2ZNZ A;  1FP1 D;  2DAO A;  4CYD A;  5E1W A;  4IRG A;  2K27 A;  3BY6 A;  3SZT A;  4OIQ F;  2J5P A;  4UUV A;  1E17 A;  1XMK A;  4LFU A;  2OAZ A;  3HOT A;  2RNJ A;  3KLO A;  3F3X A;  2FF4 A;  1KYW A;  3F72 A;  2XAF A;  3P7N A;  4FX4 A;  5LGN A;  3L7W A;  1TQP A;  3M1E A;  1IN8 A;  1R23 A;  2AXL A;  3JTH A;  3KE2 A;  5A2Q K;  4MTD A;  1KU2 A;  4O3M A;  1G3Y A;  1U5T B;  1V4R A;  1J2X A;  5JI6 A;  3FMS A;  1BJA A;  1YW7 A;  2IW5 A;  3ZMD A;  1B4A A;  3ZMT A;  1F1Z A;  5H6Q A;  1ZAR A;  2Q2E A;  4AIJ A;  4R8H A;  3F23 A;  5FB2 A;  4LG0 B;  1LJ9 A;  4ZYG A;  4EQQ A;  4UV9 A;  2QLZ A;  1F9N A;  4IXA A;  1H9G A;  1SD6 A;  3BJA A;  5BS6 A;  3WE2 A;  2QBY B;  1IN7 A;  2XVC A;  4B8X A;  1W5S A;  4JK1 X;  4RGU A;  1YQA A;  3KP2 A;  5L3B A;  2GZW A;  3EDP A;  2V1X A;  3RJP A;  2H6C A;  4ZZL A;  3E6B A;  1S29 A;  1YS6 A;  3JSO A;  4U7D A;  2FNA A;  5BQT A;  1YLF A;  5FD5 A;  4I0A A;  2VBY A;  3REO A;  2RDP A;  5FGM A;  3RDI A;  5EEH A;  1P4A A;  2UXX A;  2K7L A;  4LLL A;  3M8F A;  3JSP A;  5E8I A;  3I4P A;  4O5V A;  1WI9 A;  3GFJ A;  2IA1 A;  3C3W A;  1KQ9 A;  3J7A O;  3CUQ C;  2FU4 A;  4R1H A;  2EWN A;  4IF4 A;  3FMR A;  3PFI A;  5AON A;  1FYL A;  4A6D A;  4I2O A;  1R5G A;  1H0M A;  3BOQ A;  1R00 A;  2RV8 A;  2P4W A;  3NQO A;  2G9W A;  2FQ3 A;  4MQV A;  1YYV A;  2JTV A;  1DP7 P;  3B02 A;  4M9X A;  1R36 A;  3KP3 A;  3D5L A;  4P9U A;  1S7A A;  1KYZ A;  3M8E A;  5HDK A;  3DPT A;  4ZYD A;  1IAW A;  1W4M A;  1FSE A;  3CJN A;  2DQR A;  2HYF A;  1KGS A;  2CO5 A;  4G8X A;  2VBX A;  4EVI A;  3IL2 A;  4EGZ A;  1ULY A;  3F6V A;  2EA4 A;  4PGG A;  1LEB A;  2VE9 A;  2GA1 A;  3K9T A;  1CF7 B;  2O0Y A;  4LD5 A;  2XIG A;  3HSE A;  1U5T A;  4GYG A;  3GFI A;  1B1B A;  2D2W A;  4G7O F;  3JAM Z;  4Y17 A;  1ZAO A;  1MDM B;  3QU6 A;  3TOB A;  1LDJ A;  3L09 A;  2L4A A;  2YX7 A;  1QBJ A;  2TDX A;  3FZV A;  5DYM A;  4LG0 A;  2V9V A;  3WGH A;  2ZXJ A;  3OOP A;  4UVC A;  4MNU A;  1Z6R A;  2VT2 A;  4AWX B;  4G7H F;  3IKT A;  2BYV E;  5K5R A;  3C1D A;  1VTN C;  5L3G A;  2A69 F;  4ZZD A;  5JFR A;  2WWY A;  2QBY A;  1LEA A;  1FWZ A;  3K69 A;  5E18 F;  1AOY A;  2FE3 A;  2P7C B;  3J81 Z;  2UWM A;  5FLX Z;  2G7H A;  3BJ6 A;  1OYY A;  3I59 B;  2KIU A;  3T0Y A;  3ZQ7 A;  4FT8 A;  3CTA A;  2OBP A;  4L9N A;  4HQM A;  4BAY A;  2KJC A;  1IN5 A;  1Z6T A;  4IRI A;  1QNT A;  1XSD A;  2ZME B;  3R4K A;  1O3T A;  1IRG A;  1EH8 A;  3L9F A;  3K0L A;  4LLN A;  3CUO A;  2M8E A;  1I27 A;  3TO6 A;  4ENJ A;  1ON1 A;  5J6X A;  4HX7 A;  2X0L A;  1XGN A;  3KLN A;  3CO7 C;  4KA4 A;  1QGP A;  1IN4 A;  3H92 A;  1FYM A;  2RC4 A;  3ERE D;  3LST A;  5JVT A;  3IHU A;  1ZRE A;  2XAG A;  3P9C A;  4BYY A;  2ZCW A;  1G3W A;  1YTY A;  2VC1 A;  1IXC A;  3N4M A;  5FFX A;  4HLY A;  1JGS A;  3LAJ A;  2XRO A;  2Z3Y A;  2DTR A;  5E1Z B;  4HDU A;  1U6G A;  2EFQ A;  3GUD A;  3EYI A;  2BEO A;  4M74 A;  1EH6 A;  4P96 A;  3E6C C;  2FEZ A;  4L18 B;  1BOA A;  3M9A A;  2EV0 A;  2HQR A;  3KP6 A;  1H9T A;  5HVQ C;  4BH9 A;  1MKM A;  3QU3 A;  4KYW A;  3FF5 A;  2PI0 A;  1FC3 A;  3NRV A;  1G3T A;  4Y13 A;  2XKO A;  2FSW A;  5D6E A;  3ROU A;  1MZB A;  2XKP A;  2EA2 A;  2KKO A;  4LB5 A;  4CDG A;  3C7J A;  3J80 Z;  2HEO A;  2A6E F;  5IT9 K;  5TJJ A;  2CGP A;  1ZRF A;  3VOE A;  3HRU A;  1U2W A;  5CVV A;  4EV0 A;  2NNN A;  3NEU A;  4KIC A;  4G7Z F;  1CF7 A;  3KEO A;  2IA2 A;  1E2X A;  4HF0 A;  3F8N A;  4L9J A;  3WG9 A;  4YG2 F;  1U8R A;  1F4K A;  3ISP A;  1MDM A;  3IWF A;  1OMI A;  4HZF A;  2Y48 A;  1ZRD A;  4I09 A;  4CXF A;  4I0B A;  2LKP A;  3ECO A;  5JR3 A;  1XSX A;  3I5U A;  1JXS A;  3GO5 A;  4NHJ A;  4PGH A;  1YG2 A;  3ULQ B;  3FM3 A;  1D8J A;  4ESJ A;  3DFG A;  5DCM B;  3DF8 A;  4CIC A;  3R60 A;  3ABU A;  1T6S A;  2VOO A;  4DNC A;  1ONV A;  2HDC A;  5CJ9 A;  2ESH A;  5ICG A;  3I59 A;  1J0R A;  1YO5 C;  3F22 A;  1BI2 A;  4O6J A;  3BDD A;  1HW2 A;  2KRF A;  2ESN A;  1UST A;  1HKS A;  5L3D A;  2ZME A;  5D8L B;  3CO6 C;  3FXU A;  2Z9O A;  4AIK A;  5CVJ A;  4OIN F;  1HKT A;  3HHH A;  2GAU A;  4ON0 A;  2L54 A;  2ISZ A;  4ESB A;  5LHI A;  1RUN A;  2DK5 A;  2ADU A;  4HV5 A;  5F64 A;  5ICE A;  1SFX A;  3HSF A;  3E5Q A;  5IT3 A;  1G6N A;  4YIF A;  3HOS A;  2W84 A;  2M1B A;  1MJB A;  4CHU A;  2G7U A;  1RNL A;  2F5F A;  1XN7 A;  3PQJ A;  2MD5 A;  4FHT A;  1FT9 A;  3B73 A;  2O61 A;  3I64 A;  1O3Q A;  1Z91 A;  2D1V A;  1FP2 A;  2O3F A;  5BMZ A;  2CQK A;  1BM9 A;  3IWZ A;  5E17 F;  3SFZ A;  5D5V B;  3RYP A;  4P9F A;  5HS7 A;  3H3Z A;  4XRF A;  2FBK A;  1DPU A;  2PMU A;  5ED4 A;  4A2U A;  3GX4 X;  5L3E A;  4A0X A;  1QZZ A;  2H27 A;  2W25 A;  3KZY A;  1SD5 A;  3F21 A;  1K6O A;  3O2P E;  5CVR A;  2GWR A;  4IHT A;  1ZRC A;  2PQ8 A;  1P4W A;  1FNN A;  5LRS A;  1Z05 A;  3DQV C;  1GXQ A;  3COA C;  1LQ1 A;  4HOB A;  4KFC A;  2EFO A;  1LDK B;  1JHF A;  3ZMU A;  5K5O A;  3RTR A;  4ASN A;  2K4B A;  2PBI A;  1REP C;  5KK1 A;  2VOD A;  3F8C A;  3BPV A;  1O7L A;  3DEU A;  4MHG A;  1J75 A;  4RB0 A;  3LA7 A;  2HYG D;  1HSJ A;  4A5M A;  1D8K A;  2VOP A;  2ELH A;  2MC3 A;  2XAS A;  4MQ9 F;  3CUQ B;  3ZPL A;  3RYR A;  5F1R A;  2V1D A;  5DV5 A;  4YFX F;  2A5Y B;  3MFK A;  1XGS A;  1JHH A;  1T39 A;  4ZH4 F;  2BE5 F;  2QQ9 A;  3HHG A;  2YPR A;  1ZLJ A;  4M71 A;  2CSO A;  4OIR F;  5DCM A;  1G3S A;  4ZYH A;  1CGP A;  1FYK A;  4CGZ A;  1DUX C;  3TO9 A;  1PP7 U;  4PDK A;  2OU2 A;  1SFE A;  5DUK A;  1MJ9 A;  3TO7 A;  3MEX A;  1YIO A;  2QEN A;  4U0V A;  5LGT A;  1STZ A;  1UB9 A;  2X4H A;  1XDU A;  2BGC A;  2DBB A;  2CFX A;  3MCZ A;  3GYH X;  6PAX A;  3BRO A;  2IPQ X;  1T98 A;  4BQA A;  2DLL A;  4E70 A;  1WKM A;  1FY7 A;  2Q8K A;  2YU3 A;  4OMZ A;  4HF1 A;  2Z33 A;  5ERI A;  3QP5 A;  2CYY A;  2ETH A;  1Y0U A;  1KA8 A;  1KQ8 A;  5D4S A;  1J59 A;  5L3F A;  2K86 A;  2E1N A;  4UVA A;  3ZMZ A;  1L0O C;  2VN2 A;  4IJA A;  5ILU A;  1TBX A;  5LGU A;  1WWX A;  2FMY A;  1DPR A;  1W7P D;  2DT5 A;  5H6R A;  1SD4 A;  2FNP A;  1B59 A;  2O03 A;  2A68 F;  4PZJ A;  1AWC A;  2VBW A;  3HTS B;  2F5E A;  2HQN A;  2LF7 A;  4UVB A;  2K02 A;  3EYY A;  4U0W A;  4YFK F;  3GEZ A;  1ZGJ A;  3DPL C;  5D5U B;  1YW8 A;  4ETS A;  1KQ0 A;  2B0L A;  4XLN F;  1HW1 A;  1UCR A;  4UV8 A;  1RUO A;  2RKH A;  2PFB A;  1B9N A;  1HST A;  3WTW C;  2UXN A;  1BIA A;  2VXZ A;  4L5J A;  2PLY A;  2OA4 A;  5ILV A;  5E1X A;  5D6F A;  4RB1 A;  1D5V A;  2FOK A;  2GA2 A;  2JSC A;  1U78 A;  2L01 A;  3GFL A;  2R3S A;  2EJR A;  1OR7 A;  2HWV A;  1PDN C;  4CO8 A;  4A5N A;  3LAP A;  2GIV A;  1I6X A;  4EMS A;  4XBF A;  2W24 A;  4EM2 A;  4Y15 A;  2FRH A;  3Q9V A;  3V7S A;  3E5X A;  1ODD A;  3EUH A;  3VFZ A;  2VE8 A;  4BXU A;  4Q4Z F;  2P5V A;  2KJB A;  4OU0 A;  2NS0 A;  3EQL F;  3DXJ F;  4EGY A;  4G94 A;  5LRR A;  2EV5 A;  4KT5 C;  5BOX A;  4KDP A;  3RIR A;  1EH7 A;  1QO0 D;  3GXO A;  2IRF G;  2UZK A;  4MEY F;  3RI4 A;  1PP8 F;  4L0Y B;  1TQI A;  1USS A;  3CUQ A;  2DPD A;  4I02 A;  2D45 A;  4NQW A;  5HS9 A;  3SHF A;  2E7W A;  5J8F A;  4OMY A;  4M6X A;  1GVJ A;  3CDH A;  1T2K A;  4N9H A;  2DK8 A;  4HDV A;  3JW4 A;  3O6B B;  1P2F A;  3F8F A;  2A6H F;  4M72 A;  1FBQ A;  4OIO F;  2HTJ A;  2EFP A;  2AS5 F;  3HRM A;  3I0T A;  3D0S A;  2FA5 A;  1SMY F;  3HYI A;  3F8B A;  4HQE A;  4I98 B;  1ZYR F;  5HS8 A;  3FHZ A;  4N9I A;  4WCG A;  2JZY A;  3SXY A;  3R6S A;  2F5C A;  3WU1 B;  2P8T A;  4U7B A;  2LSO A;  4I01 A;  1XGO A;  2KIF A;  2YX4 A;  2NYX A;  2E1C A;  3I58 A;  3ZMS A;  4DQ2 A;  2R7D A;  2VC0 A;  3E3V A;  1O3S A;  2ZNY A;  1Z1D A;  2YR2 A;  2LDU A;  4KIB A;  2DFI A;  5DD4 A;  3WTY C;  3WU0 A;  5TRD A;  2YSR A;  3FWE A;  3DV8 A;  3MQ0 A;  2MLK A;  3BP8 A;  4XSZ F;  1GXP A;  3HIF A;  4TV7 A;  1XD7 A;  1I1G A;  4HA8 A;  2STW A;  5FD6 A;  3G3Z A;  2GXB A;  1ZG1 A;  3V8K A;  5DD8 A;  1I1S A;  5K5Q A;  1HXD A;  2JT1 A;  4UHT A;  3Q5F A;  2F5D A;  3SZP A;  2VON A;  1OPC A;  1W7P B;  1MJA A;  3E97 A;  3JAM K;  1IW7 F;  3R61 A;  5DUI A;  4UXN A;  4H0E A;  3KCC A;  3RPU A;  5D4R A;  3QPH A;  2IP2 A;  3BJO A;  3U1D A;  1BI1 A;  1EV7 A;  2RGV A;  2MH2 A;  3GLX A;  3T8T A;  5HLH A;  3R0J A;  3BPX A;  2M45 A;  1TTY A;  3WTV C;  3FM5 A;  1TNS A;  2V1U A;  1ZHF A;  3V7R A;  3IC7 A;  3J81 K;  1HBX G;  2DO7 A;  5FLX K;  3GZ5 A;  3RKW A;  2M30 A;  3E6D A;  1ZLK A;  1TW3 A;  3QAH A;  4IPA A;  1XSV A;  1U3E M;  1WRJ A;  1ON2 A;  4HLX A;  4RB3 C;  4GYI A;  1LNW A;  3TDU C;  3K1N A;  2A3S A;  5JHU A;  3ABT A;  2QUF A;  1YFH A;  1BN5 A;  1FPQ A;  4M9S A;  2P6S A;  4EJW A;  2BBY A;  2XHK A;  5D5X B;  1T0F A;  3IRR A;  4QWQ A;  1UFM A;  2PG4 A;  2MBF A;  1FX7 A;  5H20 A;  3HTU A;  2ZBK A;  3V4G A;  3HRS A;  2IJL A;  2ZKZ A;  2XV4 S;  3JTG A;  1XB4 A;  3ECH A;  1IF1 A;  1A04 A;  4N0B A;  4HYE A;  2FBH A;  3LFK A;  1GHC A;  5ICF A;  3RPQ A;  4U0Y A;  5LHH A;  5AIP A;  1R1U A;  2LF8 A;  4IVN A;  4P55 A;  4ENM A;  1S8N A;  2QYO A;  2WV0 A;  4KNY A;  2PMH A;  2COM A;  1RZ4 A;  3E5U A;  3GZ6 A;  3KET A;  1KU9 A;  3LA3 A;  4A12 A;  3AAF A;  5CVI A;  4WX9 A;  3J80 K;  3FMQ A;  3VEP A;  1Z7U A;  4Q48 A;  3VB2 A;  2LNB A;  1R58 A;  4AD9 A;  4HAM A;  3G73 A;  1RIO H;  4IHS A;  2EFN A;  1UHW A;  5ILS A;  1IXS B;  5HOO A;  3E6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...