4ESFA

Crystal structure of padr-like transcriptional regulator (bce3449) from bacillus cereus strain atcc 10987
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
100
Chain Sequence
b'NLTEMLKGSLEGCVLEIISRRETYGYEITRHLNDLGFTEVVEGTVYTILVRLEKKKLVNIEKKPPRKFYSLNEAGRQELELFWKKWDFVSSKINVLKSSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PadR-like transcriptional regulator
publication title Crystal Structures of Two Transcriptional Regulators from Bacillus cereus Define the Conserved Structural Features of a PadR Subfamily.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transcription
total genus 39
structure length 100
sequence length 105
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esfA00
1T98A 1J59A 3V8JA 3SHFA 3DPLC 2XGXA 1U2WA 4LLLA 3GF2A 1QZZA 3HHHA 3CJNA 1HW2A 5CVJA 1BC8C 5FFXA 5J6XA 3S2WA 3WGGA 3D5LA 2P6TA 2J5OA 2XHKA 3KZZA 2DT5A 2LSOA 3FWEA 5F1RA 4RGRA 1BIAA 4I02A 2PMHA 3M9AA 2RNJA 3L00A 1NHAA 4M9XA 2KJBA 1V3FA 1IN5A 3PQKA 3WE2A 2F5EA 4A2UA 2LDUA 5LGUA 3FX3A 1TW2A 4L9TA 1HKSA 2QM3A 4Y17A 2GZWA 5DD4A 3DF8A 2VOOA 4JK1X 1S7AA 1DPUA 2HGCA 3TQNA 1XB4A 4EJOA 4CZZA 1JXSA 1K6OA 2A68F 2R7DA 2CW0F 3QPHA 2MC3A 1WKMA 4FX4A 2P5LC 3RIRA 3RKXA 5ILUA 4BQAA 3Q9VA 3QP6A 1L3LA 1R1VA 3RPQA 1W5TA 3ZMSA 3GLXA 1KA8A 1XMAA 1XSXA 4JQFA 1WWXA 3HSEA 4YFXF 4FT8A 2BYVE 2VBZA 4OMYA 5FFZA 4GGGA 5AIQA 3ECHA 3KEQA 4LMYA 1T2KA 4IVNA 3CUOA 4KYWA 1DUXC 1SMYF 5DYMA 1Z6RA 4YIFA 2GA1A 5LEKA 1USTA 1Z1DA 3BZ6A 5HDGA 3SZPA 2STWA 1IRGA 4R8HA 1XCBA 5CVRA 2HKOA 1XD7A 4M6XA 3HRSA 1J2XA 2OD5A 2ELHA 2ETHA 1SAXA 2OQRA 4HYEA 1HXDA 1LVAA 1O3RA 1W7PD 4BHPA 3KP2A 1O3QA 4U88A 1R1UA 5DCFA 3K9TA 5E1XA 5LHGA 3BDDA 5L3BA 1UHWA 4Y13A 2CG4A 5JVTA 2M87A 4UNOA 3PFIA 4A6EA 4EJWA 5DDGA 4Q4ZF 1UHMA 1F9NA 2PJPA 1ZRCA 2Y48A 3KETA 2C6YA 2VBYA 3RPUA 5IT3A 1E17A 2QUFA 5BQTA 1K78B 1P4AA 2J5PA 1S7OA 2P5VA 4L5IA 1BI0A 4HDVA 2DK5A 3WU0A 1LDJA 1B4AA 1FP2A 1I1GA 4G6QA 1RI7A 2QWWA 5HS9A 1IRFA 3WTUC 2OZ6A 5EEHA 4L18B 4AWXB 1U8RA 2UWMA 4NQWA 3V7SA 3GX4X 3F8BA 1FSEA 3REOA 3JSOA 4ZZLA 4BHBA 1BIBA 1GXQA 1HBXG 1ULYA 3T8TA 3ABUA 1U5TB 3ROUA 5H20A 5J8FA 2EFQA 2MLGA 2PLYA 3ZMTA 3C1DA 4P5OA 2HEOA 4UVCA 3HTSB 2OA4A 4ASNA 4JBAA 1PP8F 1W7PA 4M9ZA 2P4WA 3I53A 3OV8A 2M8EA 2DQRA 5LHHA 1O3SA 4BHCA 1EH8A 4UHTA 1FP1D 1O7FA 1LQ1A 3F8NA 2FA5A 3N97A 3E6BA 4ESBA 1LEAA 2G7UA 2RKHA 1HKQA 3EYYA 3BJ6A 5AONA 3CUQC 2QVOA 3R0AA 3J81Z 3DPTA 1D5VA 2MH2A 2DQLA 1ON2A 1SD5A 3GFIA 3TO9A 2PBIA 2ZJ2A 4HX7A 2W25A 1JHFA 5ILVA 2IA1A 2XAJA 4IF4A 1LJ9A 3FXQA 5E8GA 5ERIA 1REPC 3KLNA 3LQRA 2LKPA 5BPIA 4WF2A 2FMLA 3WU1B 3ZMVA 2XKPA 3GO5A 2XKOA 2DLLA 2EK5A 3FMQA 3N4MA 4LB6B 4I7HA 5L3DA 4RGXA 2DW4A 4EJVA 4EMSA 3HTUA 3H92A 4HLYA 3TDZC 3DFGA 5CVVA 1OR7A 3L9FA 3Q9SA 4G9YA 4A5NA 1S8NA 1I6XA 2MA3A 1YLFA 3C7JA 1W5SA 3F8MA 2ADUA 1KU7A 1FWZA 3H3UA 3IC7A 1QZYA 3IL2A 4P9UA 4EGYA 2O6GE 1TW3A 2VXZA 3NQOA 1FSHA 4HQEA 4DQ2A 2X0LA 1FNNA 1RNLA 1H9GA 4KIGA 3ZMZA 2D45A 3DEUA 1B6AA 1H0MA 1I1SA 2IW5A 3WTSC 4WWCA 2GIVA 2ZNYA 1ZLJA 2AXLA 1ZYRF 5F6FA 1BI2A 3D0SA 2MD5A 2H6BA 2RDPA 3AAFA 2K4JA 4IRGA 1KGSA 3GVAA 2F5DA 1TNSA 4ENMA 2DPUA 3F8FA 1MJBA 2BBYA 2FBKA 2VE9A 3WTXC 4YIIA 4GXOA 2XASA 4EJTA 1OKRA 3TOBA 4KDPA 2WTEA 2Z33A 2HTJA 5LHIA 2RV8A 2FBIA 3MQ0A 3E3VA 2V79A 2XAGA 3O6BB 1PDNC 2LF7A 6PAXA 4PGGA 2IRFG 4P55A 1Z7UA 4XRFA 3J7AO 4MTEA 1RUNA 3B73A 3RKYA 3M8EA 3IWFA 5LBQA 1EH7A 1O57A 2ESHA 5BMZA 1YG2A 3KZYA 3ZQ7A 2QQAA 4FHTA 3PQJA 4R79A 1K78A 1C0WA 1ZLKA 1QNTA 4LB5A 4LK1F 2Y75A 3HOTA 2IA0A 3RTRA 2XAFA 4Q47A 1BN5A 5DEQA 2XRNA 2K27A 2V6CA 1BC7C 4M6YA 1G4DA 4IRIA 2KRFA 2EV6A 3BP8A 1YW7A 2X4HA 5A2QK 4YFKF 1WQ2A 3LA2A 5FB2A 1U5TA 2G9WA 3GWZA 1YS6A 2PG4A 2EFOA 2NNNA 1KU3A 1IN8A 2M5WA 2KIMA 4D0PA 3FF5A 3LFKA 1BM9A 4ZYDA 1PP7U 4L0ZB 3V4GA 4HV5A 1U3EM 1KYWA 4RGSA 5LRRA 2JSCA 1MJAA 4M73A 3G73A 2P7CB 3DP7A 3WG9A 4ZYGA 4GCVA 4OIRF 1Z6TA 2P7VB 4ZZDA 4L0YB 3WE3A 4B09A 3HRMA 5DCMA 4Q5SF 2ZBKA 2R7FA 2QENA 1XMKA 4LGWA 1D8KA 1I27A 2CYYA 1FLIA 1G3TA 4CXFA 2JZYA 4U0YA 2EA2A 3F8CA 3JAMK 5DD8A 3I71A 3BWGA 4EJUA 4KICA 2FBHA 1GHCA 4ENKA 3BJAA 5E1WA 3DV8A 3E6DA 5D8LB 4ETSA 4U7BA 4XSXF 4UUVA 4G7ZF 1R1TA 3CO7C 3SQNA 5LRSA 4I0AA 1RUOA 1TNTA 4HX4A 2L4AA 1F4KA 4G6DA 1EH6A 1WI9A 4MGRA 5BS6A 1P4WA 3E6MA 3ECOA 1LEBA 2YU3A 4M71A 4BXUA 1R58A 2CO5A 4WXDA 3IWZA 1G3SA 2R3SA 3IHUA 4LG0A 2E7XA 2P8TA 3KP3A 3FXRA 1O7LA 3F6VA 2MBFA 5D5UB 1RIOH 3QOPA 3F6OA 2FXAA 4O5VA 5KK1A 3I0TA 1YW9A 1BOAA 4IJAA 5BOXA 2L3DA 1Q1HA 4RS8A 2CFXA 3E5UA 4A0YA 4KN7X 5ICCA 5D8KB 3B02A 4G94A 2M45A 1LDKB 1IN6A 3NRVA 1Z05A 1U6GA 1FX7A 2QZ8A 2ZFWA 4OU0A 2HFHA 1J75A 5E8IA 4AIJA 1P92A 2GQQA 4DNCA 2IVMA 1R23A 5FLXZ 3SFZA 4HQMA 4O6JA 1J5YA 3FZVA 5TJJA 1OMIA 2O03A 4CGZA 3LA7A 1WSUA 4I01A 2VBWA 3F23A 3KE2A 3E6CC 1HQCA 1XDSA 5D6EA 2VT3A 4N9IA 3U9GA 2B0LA 3FMSA 1K7AA 3M8FA 1F1ZA 3GW2A 4M72A 1S6LA 1Z91A 2FE3A 2O8XA 5IT9Z 1WRJA 3E5XA 2EV0A 5D5WB 2A69F 1Z9CA 2CSOA 1CGPA 1I5ZA 4XLNF 3TOAA 4EV0A 4TV7A 2WV0A 2ZKZA 4IRHA 4FX0A 5CLSA 4GO1A 2V1XA 2EFWA 2VODA 3DKWA 5E18F 3HUGA 1F5TA 3L2CA 2PFBA 3I64A 3R0JA 3GFMA 2IPQX 1XN7A 4P96A 1ZH5A 3MAJA 4U0WA 4A0XA 1YFHA 2RN7A 3WGIA 2V1DA 1ZG5A 1ODDA 4OIQF 2QQ9A 2L01A 2VN2A 3RKWA 1R7JA 5DCMB 1S3JA 3ELKA 4GYGA 4IPAA 3J80Z 4BYYA 1P6RA 3LAJA 3ISPA 2OU2A 5D4SA 3MZHA 3P7NA 1FBSA 4ZYEA 1YS7A 3FXUA 5LLQA 1Y0UA 4HAMA 1R5HA 2VE8A 3FM3A 2F2EA 3FMRA 4Y15A 1HKTA 1MGTA 1IN7A 3MWMA 1ZARA 2V1UA 2EV5A 3WTVC 4K2EA 5LEJA 2MH9A 1HSJA 1XGMA 2ZMEA 4KNYA 1SFUA 3EDPA 5JHUA 2VT2A 1YO5C 4AIHA 4YFNF 1QBJA 1FY7A 3BJOA 2EB7A 1LDDA 1R36A 4KUMA 3E5QA 4O3MA 1ZGJA 2Z9OA 4LD5A 2UXNA 3LSTA 2QLZA 3WODF 3HOSA 1FBQA 5H6RA 3QU3A 4N9HA 1R00A 1GXPA 4LJZF 1P4XA 1YIOA 1STZA 5AIPA 3V7RA 2BEOA 4AVPA 4LG0B 5DUKA 2VC0A 1UFMA 4YG2F 1UB9A 3TO7A 3F21A 3LWFA 4WCGA 2FMYA 3HRTA 3W6JB 4RAZA 2Z99A 1KQ9A 2YSRA 4KIFA 2GWRA 3ZN1A 1A04A 2W84A 4KMFA 2HTSA 3HSFA 4OIOF 4UV8A 2JTVA 4RGUA 5HDKA 4LFUA 5IT9K 1OPCA 2STTA 1XDUA 2OBPA 3IRRA 2COMA 4CO8A 2IJLA 1PUEE 2XUBA 2NAZA 3KCCA 5EEGA 4EVIA 2DO7A 2ISZA 4MEXF 4H0EA 1B59A 3CTAA 3GXOA 4HBLA 4A0ZA 5D4RA 1IXCA 2HYGD 3ZP5A 1HW5A 1IF1A 3V8KA 1IW7F 1AWCA 5K5RA 2YR2A 1TQIA 5ICFA 3L7WA 4WXCA 1FYLA 4RB3C 4BNCA 3J81K 5HLHA 1JGSA 1XSVA 1ZN2A 3BPXA 1LNWA 5ICEA 4PGHA 3U2RA 3HHGA 3I5UA 2KIUA 2RVCA 3GUDA 1FOKA 1X3UA 4B8XA 2RQPA 1SFEA 3RJPA 5CVUA 3QU6A 3T5XA 1G3WA 2E7WA 3HYIA 1KU2A 3JTHA 1G3YA 1GVJA 3CDHA 2HQNA 2PQ8A 3K2ZA 2A07F 3EUHA 3ML6A 3IKTA 5K5QA 3K1NA 2XROA 4F7ZA 4Q48A 2P6SA 1QGPA 4L9VA 3WTTC 3SXYA 3IRQA 2JT1A 1T6SA 2VOPA 2D2WA 2NYXA 2WWYA 4LLNA 4G7OF 3LA3A 1JHHA 1T0FA 3DXJF 1MDMA 1B9MA 2ACJA 4OIPF 3I4PA 2CQKA 2DPDA 1FT9A 2VBXA 3COAC 2XAQA 4QWQA 4MHGA 4E70A 4AD9A 4IHSA 2FQ3A 2AS5F 3LAPA 4MQVA 5ED4A 1H9TA 3CLOA 3P9IA 2K7LA 3GEZA 1IXRC 3G3ZA 1ZG3A 2JPCA 4HDUA 1FPQA 2FEZA 2K02A 3NEUA 1LB2A 2H94A 3KLOA 4L9JA 2DI3A 2ZMEB 2RC4A 2FOKA 3C18A 4HOBA 2O3FA 3KP4A 5HVQC 1IUYA 4UXNA 5HOOA 1KQ8A 3E97A 4RB1A 3VFZA 1KQ0A 3ZMDA 5CVIA 3F72A 1ZRFA 2EFNA 2F5CA 4NHJA 3TKYA 3VODA 5LGNA 3R60A 2M30A 1O3TA 1P2FA 3Q5FA 5F64A 1JE8A 2YPRA 1XGOA 3ULQB 4ESFA 1EV7A 1MZBA 2DAOA 3O2PE 3T0YA 2W85A 4EM0B 1J9IA 1K79A 4EQQA 5HLGA 3K1MA 2H27A 2PMUA 4XBFA 2QQBA 3I54A 2UXXA 3GFLA 2D1HA 3CUQA 1SD6A 3WTYC 2MLKA 4M74A 1XCVA 1ZREA 2EJRA 3WGHA 5JR3A 1OYIA 3JW4A 3HRUA 2FSWA 3QRFF 3BY6A 1IXSB 1ZGAA 2XIGA 2DU9A 2HWVA 4HF0A 1YW8A 1SFXA 1V4RA 3R6SA 4HV6A 3RYRA 1TTYA 3T8RA 4ZH4F 2HR3A 1DP7P 3QPTA 4WK8F 2A6EF 3KP6A 3KP5A 2ZXJA 2NS0A 3ZN0A 5D5VB 2DBBA 4AIKA 5D6FA 4UVBA 2XAHA 1L0OC 2XVCA 2GXBA 2ISYA 3EQLF 1CF7A 1SMTA 2HYFA 2IA2A 5E1ZB 3TO6A 3LQQA 3ABTA 1S29A 2L4MA 4UVAA 5DV5A 3ERED 1B9NA 4WXHA 2H09A 3GYHX 4OINF 2TDXA 2O0YA 2HS5A 3KP7A 2LNBA 4Z2YA 3P9KA 2GAUA 1ON1A 4HX8A 2KKOA 2Y0MA 2GXGA 3P9CA 1TBXA 2ZNZA 1U5TC 4ESJA 3MEXA 5L3FA 4IHTA 5K1YA 4I98B 4XLPF 2IP2A 4RB2C 2IT0A 1J0RA 4M9SA 4CHUA 1FZPB 2OZUA 3H3ZA 1UCRA 1USSA 2EFPA 1D8JA 3VOEA 1FYMA 3I59A 2NRAC 2OAZA 3M7GA 1MDMB 3L09A 5FD6A 5FO5A 3WTZA 5FGMA 4QLCU 1IZ1A 5E20A 5L3EA 1ZG1A 3JTGA 2FNPA 2QBYA 2HKXA 1BJAA 1TQPA 4S05A 1U78A 4KN4X 1R22A 5J8CA 2O61A 1MD0A 4UV9A 4MTDA 1QPMA 1FBUA 4OMZA 5HLIA 2PN6A 3RDIA 4KT5C 2BE5F 4CYDA 4HA8A 1BI3A 2ZO4A 3C3WA 5CYVA 3TGNA 4G7HF 2Z5UA 3RI4A 4BAYA 4WX9A 3EETA 1MKMA 4EM2A 2A5YB 2Q8KA 1HW1A 5D5XB 2A61A 1BI1A 3K1PA 2PEXA 4KMUX 2CWEA 3F22A 2DFIA 2G7HA 2P5KA 4HZFA 4EM1A 4PZJA 2FU4A 3VB2A 5JI6A 3U1DA 3GFJA 1TQMA 4ON0A 3SZTA 1YQAA 3VEPA 2KJCA 1FYKA 2NNYA 4EGZA 1QO0D 4A5MA 2BGCA 1IN4A 1YYVA 4RB0A 1ZAOA 5HS8A 4N0BA 4R1HA 2FF4A 2E1NA 2VC1A 5CJ9A 1IAWA 2QYOA 4A12A 2PI0A 2F5FA 3KFWX 1RZ4A 4MQ9F 4MNUA 1KU9A 1AOYA 1BBYA 5L3GA 4HW0A 3CUQB 1ZHFA 3HSRA 4BH9A 1KYZA 1FC3A 4ZYHA 3FM5A 2FRHA 1ZRDA 2EWNA 2HDCA 4HF1A 5FD5A 3WTWC 3BOQA 2Q0OA 4P9FA 1G6NA 1MJ9A 2JRTA 2KIFA 2A3SA 2K86A 1HSTA 4U7DA 5A2QZ 3M1EA 4KIBA 2HOEA 5FLXK 3T1BA 4PDKA 5JFRA 2DK8A 2H6CA 2WC2A 4I0BA 3QAHA 4I2OA 5ICGA 1T38A 3K69A 3HIFA 3MZYA 4NB5A 4HLXA 4MEYF 2M1BA 2JPBA 4RAYA 5E17F 1ONVA 3BROA 4XSZF 4L5JA 3TDUC 2L54A 2GA2A 2LF8A 2ZCWA 5H6QA 1CF7B 5BPDA 3CO6C 1OYYA 4ENNA 2DTRA 3F3XA 4CDGA 1D3YA 5ILSA 3EYIA 5TRDA 3OOPA 2HQRA 5LGTA 1R5GA 2Z3YA 4U0VA 2D1VA 5K5OA 2HZTA 1QQIA 4KA4A 3GZ5A 1W4MA 1T39A 4A6DA 2K4BA 2W57A 1XGNA 1OYWA 4G8XA 3R61A 1SD4A 4LLGF 3V8LA 5HDNA 5KVRA 3JSPA 1TLHB 3I58A 4GYIA 2L02A 2OQGA 3QP5A 3ZPLA 3RYPA 3V7CA 3JAMZ 1B1BA 2V9VA 3KEOA 3I59B 4I09A 4LK0F 3J80K 5HS7A 3ZMUA 3W6KB 4PCQA 4HF2A 2EA4A 5L3CA 2W24A 1XGSA 2XV4S 2VONA 4S04A 2CGPA 4L9NA 2QBYB 2A6HF 4IXAA 2BV6A 2Q2EA 4OOIA 4KFCA 1J7KA 3IKVA 1DDNA 1VTNC 1YTYA 1DPRA 3MFKA 3K0LA 4ENJA 2RGVA 3FHZA 3GZ6A 1XSDA 1SD7A 2ESNA 2UZKA 3DQVC 1W7PB 2FNAA 3R4KA 4CICA 2YX4A 3O3KA 2E1CA 1E2XA 5DUIA 3BPVA 2YX7A 3MCZA
chains in the Genus database with same CATH superfamily
2TCTA 1T98A 1J59A 2W4SA 3K4JA 2ZMEC 3V8JA 4XKCA 3KEYA 2JN6A 3SYTA 3GTJJ 1M1EB 3SHFA 3DPLC 2EZLA 4BKXA 2MABA 2XGXA 1U2WA 4LLLA 3GF2A 1JI8A 2DYRH 1QZZA 3HHHA 1FJLA 3CJNA 2O9LA 1T56A 1HW2A 2O5RA 2V26A 2K9SA 3TW6A 5CVJA 1BC8C 5FFXA 3JRBA 5J6XA 3RZOJ 3QOEA 2AQFA 3S2WA 1YX3A 3WGGA 2RQQA 3D5LA 2P6TA 3KIOA 2J5OA 2XHKA 4V2GA 3KZZA 2DT5A 2LSOA 3FWEA 3ZR8X 3VDXA 5F1RA 1S9HA 2V1NA 4NC8A 1D0XA 4RGRA 1BIAA 1HLVA 2EIMH 4I02A 2PMHA 3M9AA 2RNJA 3A02A 3L00A 2CUJA 1NHAA 2HNHA 1VQ8I 1FMVA 5IP7J 5GPCA 4M9XA 4Y52J 3K4NA 5HLTA 3M07A 2ZJPF 1UMQA 2KJBA 1V3FA 1IN5A 3PQKA 5J3LA 4QIWN 3K10A 3WE2A 1OQYA 2F5EA 1SVMA 3WU2C 3ZQFA 2HVRA 4A2UA 2LDUA 1Y1VJ 4F55A 5LGUA 2DDAA 3FX3A 1TW2A 4L9TA 1HKSA 3I4MJ 3WHBA 2QM3A 3AG2H 1SAUA 4Y17A 2GZWA 5DD4A 3DF8A 5F0CA 2VOOA 1JT0A 4JK1X 1QVUA 1S7AA 1DPUA 2QF7A 2HGCA 3OIQA 2CQ7A 3TQNA 1XB4A 4EJOA 4CZZA 1JXSA 1WFXA 1K6OA 1Y8QB 3DWLE 2A68F 2R7DA 2CW0F 3QPHA 5M3MJ 2MC3A 4BL0B 5EZGA 1YI2I 4JOMA 3BQYA 2KL4A 3AKZA 4M3GA 1WKMA 4FX4A 1LVKA 2P5LC 3RIRA 3RKXA 1GUUA 4CA0A 3HOXJ 2PJRB 3C2HA 5ILUA 4BQAA 3K4CA 4Y4RA 2CUZA 3Q9VA 4LIUA 4IHWA 2LBFB 3DPUA 1TL8A 1VQ6I 5GPAA 3CZ6A 3QP6A 1RPWA 2BHZA 3SEQA 4A3EJ 1L3LA 1QRYA 3QPLA 1R1VA 4XORA 5K7FA 3RPQA 3OIPA 1KONA 1W5TA 3ZMSA 1IUFA 2BXYA 3GLXA 1LKXA 1KA8A 1XMAA 1XSXA 4JQFA 3W3CA 1H8AC 5FRMA 2OF7A 1WWXA 1GLNA 2CS3A 3HSEA 4ZDLA 4ZJZA 1WPKA 3PNTA 3G71I 4YFXF 2FUG2 4V2FA 4FT8A 2BYVE 2XB5A 2BY2A 2VBZA 3TP3A 2IS4A 2KIQA 4RBOA 4XM3A 1IRXA 4OMYA 4X0GA 5F27A 5C4JJ 5FFZA 4GGGA 3OYDA 4BQOA 1LFBA 3U1KA 2RREA 5AIQA 5FJ8J 3ECHA 3KEQA 4LMYA 5HODA 1T2KA 3DKYA 4IVNA 4B3AA 2LREA 3CUOA 4KYWA 4HEA2 1DUXC 4HNTA 1MH3A 2W48A 4PSWA 3OS1A 1SMYF 5DYMA 1SVOA 1Z6RA 4BEHB 1ORKA 4C3JJ 1QPIA 3GTGJ 4Z6YA 1H89C 2QKLB 4YIFA 2GA1A 2M2EA 5LEKA 1USTA 3NWSA 5K7ZA 1Z1DA 3BZ6A 5HDGA 3SZPA 2STWA 4IHVA 1IRGA 4R8HA 3ZQHA 1XCBA 5CQEA 2XPWA 5CVRA 2E2IJ 2HKOA 1XD7A 2B9SA 4M6XA 3P5JA 2L7KA 3HRSA 3TBIA 3JRCA 1J2XA 1VQ5I 2OD5A 2X6OA 2ELHA 1WJ5A 2MGQA 1X19A 3DEWA 2ETHA 1LPQA 1SAXA 2RAEA 2OQRA 1Z0XA 1A35A 2IGKA 4HYEA 3W2VA 1V5EA 4C2UA 2L7FP 1HXDA 1W0TA 1W5CC 4PJLA 3EUHC 1LVAA 1O3RA 4XQFA 1W7PD 1R5ID 4BHPA 4OAZA 3KP2A 2R92J 1O3QA 2DA1A 2ZXHA 3K7AJ 4U88A 2ELKA 1R1UA 5DCFA 4CCMA 3MVPA 2NOGA 3K9TA 5E1XA 5LHGA 3BDDA 3EUKL 4N4OB 5FKNA 2OJED 1UHWA 4Y13A 1Z3XA 5L3BA 1YRNA 1MNMC 4CSWA 2CG4A 1DU6A 1FIPA 2X85A 5JVTA 4DGWB 3HZJA 2M87A 4UNOA 2CQXA 3H5NA 3PFIA 4A6EA 1A5JA 3K2AA 1JKOC 2Q2EB 4EJWA 5DDGA 4Q4ZF 1UHMA 1F9NA 2PJPA 1ZRCA 2R7WA 1T0FC 2E34A 2Y48A 2GXAA 2KDZA 3VYSB 2EINH 3Q3SA 3RCOA 3KETA 1IC8A 2VBYA 3RPUA 5IT3A 2C6YA 1E17A 3ESWB 3PJRA 2QUFA 5BQTA 1K78B 1ZK8A 1P4AA 2J5PA 4E7JA 1S7OA 1WJEA 2P5VA 3D5RC 4L5IA 4UUSA 1BI0A 4HDVA 2DK5A 3WU0A 1OCZH 1P7IA 2XC7A 1LDJA 1B4AA 1FP2A 1SC7A 1I1GA 4G6QA 2DYSH 2E1MC 4W1UA 1K83J 1RI7A 5EGOB 2QWWA 2VASA 5HS9A 1ZR2A 1YJNI 3K4BA 1S7EA 1R71A 2HXOA 5IP6A 1IRFA 3WTUC 2OZ6A 1RR8C 5EEHA 3S15J 3AG3H 1Y56A 2DFEA 1PYVA 4B47A 4U87A 3O8GA 4L18B 3IP4B 4AWXB 1U8RA 2PMZA 2UWMA 4NQWA 3V7SA 3GX4X 3F8BA 1FSEA 3SDBA 3REOA 3JSOA 2ME6A 4BHBA 2VL8A 4ZZLA 3LMMA 1WHUA 2FQ4A 1JTYA 2DA7A 1E3OC 1BIBA 1A6IA 4MFDA 1GXQA 1V5GA 3CCYA 1HBXG 1ULYA 3T8TA 2IEKA 3ABUA 1U5TB 2BW3B 3ROUA 5H20A 2DOAA 1OLTA 3A01A 3RQIA 2F4IA 2EFQA 5J8FA 1XPXA 3FK7A 2MLGA 5E3MA 3ZMTA 2PLYA 3C1DA 2W1OA 3CCVI 3ERMA 3HC7A 1UZCA 2YS9A 4P5OA 2F4OB 4A3GJ 4DYRA 4LG3A 2HEOA 4N4NB 4UVCA 3HTSB 2OA4A 4RAFA 4ASNA 3L2UA 1D1AA 4JBAA 1PP8F 3A0BC 2LTPA 1W7PA 3M4OJ 3UNGC 2IS2A 1SFKA 2XF5A 3ZXSA 4M9ZA 2P4WA 3V42A 3CMEI 2KRCA 4EEFG 1RRJA 2BVLA 2CUEA 3I53A 3OV8A 2M8EA 4M3FA 2DQRA 1BR2A 5LHHA 1O3SA 1VQ4I 2K3FA 2L0KA 2R5ZB 4BHCA 1EH8A 4UHTA 1FP1D 1O7FA 2ECCA 1LQ1A 3F8NA 2GBYA 4AYBN 2FA5A 2R7ZJ 3N97A 3E6BA 3HKZN 4ESBA 1LEAA 2G7UA 2RKHA 1HKQA 3S93A 3BG5A 2DCEA 3EYYA 3OR2C 3BJ6A 4ABZA 5AONA 3CUQC 3C2BA 2QVOA 4XOPA 3FXJA 3R0AA 3BQZA 3J81Z 1VF9A 4E7SA 3DPTA 2ZFUA 1D5VA 2MH2A 1YX5A 2DQLA 1ON2A 1RKWA 2O7OA 1SD5A 3GFIA 3TO9A 3TW7A 2PBIA 2ZJ2A 4HRIA 5M3FJ 4HX7A 2W25A 1JHFA 5ILVA 2IA1A 3PNYA 5TGTA 1BJZA 2XAJA 4IF4A 4XLHA 2HYJA 1X1PA 1IRZA 2DTZA 3IAS2 1LJ9A 3FXQA 4XKVA 1UG2A 2EZHA 5E8GA 3MKWB 2LYCA 5ERIA 3DU6A 5EG0B 2HPMA 1REPC 3KLNA 4IOAF 2JA6J 3LQRA 1LUJB 2LKPA 1GDTA 2DN0A 1LFPA 5BPIA 1NK2P 5F04A 4WF2A 2FMLA 3WU1B 3ZMVA 5IYBJ 2XKPA 3GO5A 2XKOA 3W2WA 2DLLA 2EK5A 2VQGA 3FMQA 4BXFA 1D0YA 3N4MA 3K6GA 4BDYA 4LB6B 2VKDA 3H5AA 1DGRM 3OYKA 3GMEA 4I7HA 2NVQJ 5L3DA 4RGXA 2DW4A 2K85A 4EJVA 3L2QA 1Y39A 1X3WB 4EMSA 3HTUA 2R7VA 1N75A 3H92A 5DTDA 2CH0A 3CD6I 3D1NI 3TDZC 3DFGA 5CVVA 1OR7A 4HLYA 4C9YA 3L9FA 4PJNA 4S0HB 3CJRB 2M9HA 3Q9SA 2HVSA 3L2VA 5LD2C 4G9YA 4BJ6C 3IH2A 3DLAA 4A5NA 1VQLI 1S8NA 1I6XA 4PJJA 2MA3A 1YLFA 3C7JA 1GT0C 1MMAA 2WADA 1W5SA 3F8MA 2HDWA 2ADUA 2BVMA 1KU7A 1FWZA 3H3UA 3X2QH 1IGNA 2IS6A 2R7XA 1R49A 3IC7A 1V5FA 1QZYA 1X4PA 2VIXA 3IL2A 4P9UA 2LY1A 1FOWA 4EGYA 3OYMA 2O6GE 5F08A 1FTZA 3PSIA 1TW3A 2VXZA 1JKPC 2ICWG 3LSPA 3DCFA 1Y8RB 5HNHA 3GTMJ 4DYCA 3NQOA 4BBRJ 1FSHA 4HQEA 1WJFA 3A03A 4DQ2A 2X0LA 2KZGA 1FNNA 2CW8A 3HOZJ 1BA5A 4PSXA 4B3XA 1RNLA 4C2MJ 1H9GA 4OWRB 5GAHJ 3CP2A 4KIGA 1PUFA 3ZMZA 2D45A 1EF4A 3DEUA 1B6AA 1H0MA 3BR3A 1I1SA 2IW5A 3WTSC 5IP9J 4WWCA 2GIVA 2ZNYA 4XKWA 4E7ZA 1ZLJA 2AXLA 1ZYRF 5F6FA 4RLQA 1BI2A 5KAIC 1ETKA 3D0SA 2MD5A 2H6BA 2RDPA 5IOZA 3AAFA 4ZTJA 4KT6A 2K4JA 4BEHA 4XNFA 1MBEA 4IRGA 2LMDA 1KGSA 3GVAA 1YJWI 2F5DA 1TNSA 4ENMA 1WJDA 1AKHB 2DPUA 2K40A 3S17J 2KDOA 2M3AA 1MJBA 3F8FA 4NBQA 4RA2A 2BBYA 2JWTA 2FBKA 1OJLA 2Y0SN 2VE9A 2PX9A 2V6EA 3WTXC 4YIIA 4GXOA 1WH7A 3K70D 2K3PA 4UUTA 3CCUI 2XASA 4EJTA 1OKRA 3TOBA 4UUSB 4KDPA 3NARA 4OAYA 2WTEA 2VKHA 2Z33A 2HTJA 3CJTB 5LHIA 1U0JA 2LC2A 2RV8A 2KISA 1WZ2A 2FBIA 2X9DA 3MQ0A 5JHFA 3E3VA 2FJ1A 2G0EA 2V79A 3LSIA 4BY1J 1T95A 2XAGA 2XSJC 3O6BB 1PDNC 2KQRA 2LF7A 6PAXA 4PGGA 2IRFG 4P55A 1Z7UA 4XRFA 3J7AO 5K7HA 4MTEA 1RUNA 3B73A 1VI0A 4D1QA 2M8GX 3OYAA 2JUGA 4XN3A 2E36A 1QU3A 3PIPF 3RKYA 3VWBA 3IH3A 3M8EA 1F43A 1A6QA 2LP0A 3IWFA 5LBQA 1EH7A 2VB6A 2FOWA 5DM6F 2MW8A 1O57A 2ESHA 5BMZA 1LFUP 3NAUA 1DU0A 2KHMA 4BQQA 1YG2A 3KZYA 3ZQ7A 2MC4A 2QQAA 4FHTA 3PQJA 4R79A 3A01B 1K78A 1C0WA 4ZYAA 1VQOI 2NVTJ 4DZPA 2DMQA 5CPRB 1ZLKA 1QNTA 4LB5A 4LK1F 5J40A 2VJ5A 2Y75A 4C3IJ 3HOTA 2LD5A 3H9QA 2IA0A 3RTRA 2XAFA 1R6RA 4Q47A 3IAM2 1BN5A 4FE4A 3BCBA 5DEQA 3Q0VA 2ZJRF 2XRNA 2EIJH 2K27A 2V6CA 1XTAA 3Q0UA 4QPOA 4A3KJ 1BC7C 4M6YA 2NXNB 2ELJA 1G4DA 1BW5A 4IRIA 3QWLA 3OS2A 2KRFA 3OYBA 2HQ5A 4A93J 1WVRA 2EV6A 3HBLA 4V19K 2E19A 3CCMI 1OISA 5JVGF 3TEDA 1YOVB 1U9OA 1XMXA 2D5VA 3BP8A 2L2OA 1OCCH 1YW7A 2X4HA 2HZDA 5A2QK 3OYNA 4YFKF 1WQ2A 3LA2A 5FB2A 3E7LA 1U5TA 3H9GA 2BW3A 2G9WA 3K4KA 3GWZA 1SVLA 2ZSHB 1YS6A 2E60A 2PG4A 5IOYA 2EFOA 2NNNA 4DBRA 3U21A 1KU3A 1IN8A 2M5WA 2EZIA 2KIMA 2COBA 4XMYA 4D0PA 1T33A 2E71A 2X1DA 3LSJA 4D5CA 3FF5A 1ITYA 2ME0A 3LFKA 2VPLA 1BM9A 4ZYDA 1PP7U 4L0ZB 4FASD 3V4GA 1MH4A 2R7RA 4BDZA 2IAIA 4HV5A 1U3EM 3LNQA 3K4MA 3H35A 2R5ZA 1KYWA 4KISA 1FIAA 2CJJA 4RGSA 2JA8J 3GTPJ 5LRRA 2JSCA 1MJAA 1I50J 4F92B 4M73A 3I3LA 3G73A 4D7NA 2P7CB 3DP7A 3WG9A 3HL2A 4ZYGA 4GCVA 4OIRF 1Z6TA 2P7VB 4ZZDA 4L0YB 3S8PA 4F52A 3WE3A 2CQNA 4B09A 3HRMA 4HSRA 1VZ0A 1MBJA 1QZEA 1I39A 5DCMA 4Q5SF 3M1CA 1Z3YA 1HDDC 2ZBKA 1Z67A 4BE2A 2LK2A 3H9JA 3A0HC 2R7FA 3K4LA 2QENA 1XMKA 4LGWA 4IZZA 1D8KA 1UJ8A 1DP3A 3O8HA 1MIJA 1I27A 1S5LC 1TWCJ 2WY8Q 1ETQA 2CYYA 5EG0A 3GZNB 3C2GA 2LOOA 2QSFX 1FLIA 1OCPA 1B72A 1G3TA 1G2HA 2XDVA 2WAFA 2DJNA 4CXFA 2JZYA 2JSPA 4U0YA 2EA2A 3F8CA 3RPUD 3JAMK 1YE9A 5DD8A 2ZJQF 3I71A 2CMPA 3G1LA 3BWGA 5J47A 4EJUA 4KICA 2FBHA 1GHCA 4ENKA 3BJAA 5E1WA 3I55I 1EKEA 3DV8A 3E6DA 4RM2A 5D8LB 4ETSA 1TWGJ 2VQHA 4U7BA 2DA6A 1PUFB 2VI6A 4XSXF 4UUVA 2Y69H 5FKLA 3IH4A 4G7ZF 1W36C 1R1TA 4B4CA 3CO7C 3SQNA 5LRSA 4I0AA 1RUOA 1TNTA 1NG7A 2UUZA 4HX4A 2L4AA 1F4KA 1B8IA 5J1YA 4G6DA 1EH6A 4PJMA 3PFYA 1WI9A 3FIWA 4MGRA 5BS6A 4HPQA 1P4WA 3E6MA 3ECOA 2X48A 3HG9A 4RAGA 1LEBA 1MBHA 5B66C 3N05A 2YU3A 4M71A 4BXUA 3AFHA 1WJBA 2CU7A 4NC6A 1R58A 5H2FC 2CO5A 4WXDA 3IWZA 1G3SA 2R3SA 3IHUA 4LG0A 2W7NA 2E7XA 2ZB9A 3DKXA 2IGNA 1A36A 2LVSA 2VJJA 2P8TA 4MLOA 1PJRA 3KP3A 3H3VK 3FXRA 1O7LA 2EQRA 2MBFA 3F6VA 1OCRH 3PSFA 2GIZA 1ZTRA 3AG4H 5D5UB 1RIOH 3QOPA 3JRDA 3F6OA 1BR4A 4M3BA 3F0CA 2FXAA 4O5VA 2HOTA 2W00A 1N78A 5KK1A 3DBRB 3HOVJ 1I3QJ 3I0TA 1YW9A 1D5YA 1BOAA 4IJAA 3SZGA 5GAGJ 2L7ZA 3BR0A 1X1BA 3FBNB 2L3DA 2R4GA 5BOXA 1Q1HA 4RS8A 2CFXA 2GLOA 3FDYA 3E5UA 2ZC2A 4A0YA 3G4SI 3S1NJ 4KN7X 2HU9A 5ICCA 1IG7A 5D8KB 1G8XA 3B02A 1YHQI 4G94A 3OYLA 2YU9J 1AKHA 2M45A 4CCNA 1LDKB 1IN6A 3NRVA 3QYBA 2H1KA 1Z05A 4C30A 3VYUB 2R7UA 1U6GA 1FX7A 2QZ8A 2ZFWA 4OU0A 4ZTFA 2HFHA 1J75A 5E8IA 3ZCOA 1K61A 4AIJA 2LKXA 2IBDA 1P92A 2E5NA 2GQQA 4DNCA 2IVMA 3FKJA 3AL0C 1R23A 4JX5A 1FOXA 5FLXZ 1A31A 3SFZA 1NTCA 4HQMA 2VQCA 4CZCA 1ENHA 4O6JA 3RQ4A 1J5YA 3FZVA 4F93B 5TJJA 4XRMA 1OMIA 4XKBA 3DEEA 2O03A 5IYCJ 4CGZA 2A6TA 3LA7A 2HOSA 1WSUA 2WY7Q 4DOZA 4MFEA 4I01A 2VBWA 3F23A 3KE2A 3E6CC 1HQCA 1XDSA 1O4XA 5D6EA 2VT3A 4N9IA 5KHDA 5EEAA 3U9GA 2B0LA 3FMSA 1K7AA 3M8FA 1F1ZA 2OCCH 3GW2A 4BBSJ 3HKZA 4G6TB 3SDGA 1I6HJ 4BXXJ 1AA7A 4M72A 5C4XJ 2MFZA 4I76A 1S6LA 1Z91A 2FE3A 1ACIA 2O8XA 1J09A 5FKMA 1RR7A 5IT9Z 4CCOA 1WRJA 3E5XA 2EV0A 5D5WB 1PVEA 2A69F 1Z9CA 2CSOA 2WA0A 1CGPA 1I5ZA 2M0MA 5IPAA 4XLNF 1X1CA 3TOAA 4EV0A 4TV7A 2WV0A 4PK4A 1UAAA 2ZKZA 4IRHA 4FX0A 3PNVA 5CLSA 4GO1A 5GADJ 2V1XA 3J7AY 4RLFA 2EFWA 1UHSA 2VODA 4DZJA 3ABLH 3CCRI 4XRSA 3DKWA 4H4KC 5E18F 1IDZA 3HUGA 1F5TA 2V4JC 3L2CA 4M3DA 2HOAA 2DT6A 2K9NA 5JLXA 2PFBA 3I64A 3R0JA 3GFMA 2MD0A 4XK4A 2WAEA 2F6CA 3HXLA 2QGUA 2IPQX 3BTJA 1XN7A 4P96A 1ZH5A 3MAJA 4U0WA 4A0XA 1YFHA 2RN7A 4ZC3A 3WGIA 2V1DA 5DM7F 1ZG5A 4A3DJ 1TC3C 1ODDA 4A3JJ 2L9SA 4OIQF 2QQ9A 2L01A 2VN2A 2X1EA 2CRGA 1R7JA 2V7FA 3RKWA 3CP8A 5DCMB 3BT9A 1S3JA 3ELKA 4GYGA 4F3QA 2EZKA 4IPAA 3J80Z 4BYYA 2E35A 1P6RA 1KZHA 3JRFA 3LAJA 3ISPA 2OU2A 5D4SA 3MZHA 3P7NA 5FROA 1FBSA 4UB8C 4ZYEA 3OL3A 3VPRA 1YS7A 3FXUA 4IO9F 5LLQA 1Y0UA 3H36A 4HAMA 1R5HA 3KPHA 2VE8A 3FM3A 2F2EA 5KCMA 1B72B 3FMRA 4Y15A 3S1QJ 1HKTA 4MIMA 4E7LA 4DBQA 2KZVA 1MGTA 1IN7A 3MWMA 1ZARA 2Z2SB 2V1UA 3LSGA 2EV5A 3WTVC 4K2EA 1ETXA 5LEJA 1TP4A 2MH9A 2WB1N 1TZLA 1HSJA 4XLCA 5EZHA 1XGMA 2ZMEA 2YUSA 4KNYA 4ZDPA 1SFUA 3EDPA 4XRSG 5JHUA 2R5YA 4IHYA 1MW7A 2VT2A 1YO5C 3ONQA 4AIHA 2M0CA 4YFNF 1QBJA 1FY7A 3BJOA 2EB7A 3BR5A 3HB9A 1LDDA 1R36A 1U9NA 3BTCA 4KUMA 2CV0A 3E5QA 2M7AA 2VQLA 4O3MA 1ZGJA 5B3SH 2Z9OA 4LD5A 1MMNA 2UXNA 3LSTA 2QLZA 3WODF 2VLAA 2R7TA 2VJIA 3HOSA 3VSKA 1FBQA 5H6RA 1IO2A 3BR2A 4B43A 3PO3J 1D1BA 3DBLB 3IV5A 3OY9A 1Z21A 1MMGA 2JA2A 4FTHA 1B8IB 3OYFA 3QU3A 4N9HA 2DMUA 2R7QA 1R00A 1GXPA 3H0DA 4LJZF 3ABMH 1P4XA 3S2DJ 2MSYA 5GP9A 1YIOA 1STZA 2M7BA 3OYGA 5AIPA 4LIVA 3V7RA 3G1MA 3BCAA 2QQ8A 1Y6IA 2BEOA 4AVPA 5CQGA 4BGDA 2RNGA 1ZR4A 5DUKA 1XS9A 4LG0B 2VC0A 4M6VA 1HCRA 2Y0SA 1RKTA 2R0QC 3HGGA 1UFMA 4J19A 4YG2F 4RDUA 1UB9A 1CQTA 2GM4A 1TWAJ 3TO7A 4II3A 2DOEA 3F21A 2DODA 4UY8I 3LWFA 3CC2I 4WCGA 2FMYA 3HRTA 3W6JB 4RAZA 1BL0A 2Z99A 1MBFA 1KQ9A 2YSRA 4IHXA 5M5YJ 3CCQI 1S72I 4KIFA 2GWRA 1VQ7I 3ZN1A 2CUFA 2OCEA 5M5WJ 4IL6C 1A04A 2W84A 4KMFA 2HTSA 3KYCB 2DFHA 3PUFA 3HSFA 4OIOF 4UV8A 2ID6A 2LH9A 4AVZA 1MSEC 2QA4I 2JTVA 1AHDP 3MZ8A 4M3EA 4RGUA 4J01A 5HDKA 3LSKA 4LFUA 5IT9K 3S32A 1OPCA 5E3NA 2STTA 1TWFJ 3OYJA 1TWHJ 1MBGA 1XDUA 2OBPA 5DS9A 2XRLA 3FHNA 3IRRA 3FKIJ 4FCYA 2COMA 4CO8A 2R7SA 2IJLA 1PUEE 2KRHA 2XUBA 2NAZA 5CKTA 5C3EJ 3KCCA 5EEGA 3WG7H 4EVIA 4DIQA 1DGWY 5M5XJ 4CCJA 2DO7A 2ISZA 3GCMA 1N77A 2JA5J 5EJCA 4E7IA 4MEXF 1POGA 3OSFA 1VQ9I 2DT7B 1ETYA 4H0EA 4E7KA 1OCTC 1B59A 3CTAA 3GXOA 1QVTA 3HEFA 4HBLA 2FD5A 4RM3A 4DYQA 4A0ZA 2NVUB 5D4RA 2Z16A 4BACA 2DXIA 1ZGWA 1IXCA 2HYGD 1D1CA 3ZP5A 2CW7A 1HW5A 3CCEI 1IF1A 2XF6A 3V8KA 1IW7F 4KITB 1JT6A 4AU7A 1AWCA 1W0UA 5K5RA 3DBHB 9ANTA 2X6WA 2YR2A 1TQIA 5ICFA 3DU5A 3L7WA 4WXCA 1FYLA 5E79C 4YRVA 3ZQGA 4RB3C 2KP6A 4BNCA 3J81K 3BG3A 2XGCA 5HLHA 3AG1H 4UB6C 4HNUA 1JGSA 1XSVA 1ZN2A 3BPXA 1LNWA 5ICEA 2XGDA 5J4VA 4PGHA 1Z7LA 3U2RA 2B63J 3BLYA 4NUBA 3HHGA 2HXIA 1HC8A 3I5UA 2KIUA 3GTOJ 5C44J 1JGGA 1MNEA 2JJ7A 2RVCA 2XB0X 3CF2A 3GUDA 3OMYA 1FOKA 4E7HA 2QKMB 1X1AA 2L7MP 1X3UA 4B8XA 2RQPA 1UG0A 1V54H 1SFEA 3RJPA 5FLVA 5CVUA 3QU6A 4IEJA 3T5XA 1GV2A 4YELA 1G3WA 2L5QA 2E7WA 3HYIA 1E3HA 3F9KA 5FKOA 1KU2A 3JTHA 1G3YA 1GVJA 3CDHA 2DA5A 3H1CA 2HQNA 2PQ8A 3K2ZA 5J1RA 3CESA 1JJ8C 2A07F 3EUHA 3ML6A 3IKTA 4PFPA 2NOJB 5K5QA 3CC7I 2M34A 3K1NA 2XROA 4F7ZA 4XONA 4Q48A 2OPTA 3HUGB 2P6SA 2TRTA 3HJEA 1QGPA 3PM1A 2DA4A 4L9VA 3WTTC 1DQUA 1VQNI 3CCLI 3G1OA 3JRIA 3SXYA 3IRQA 3CC4I 2JT1A 2X6YA 4XIDA 1T6SA 2VOPA 2D2WA 4X1EA 1UELB 2NYXA 2WWYA 4LLNA 3OYHA 3HOUJ 2A5WA 4G7OF 3LA3A 3LFUA 1JHHA 2MG4A 2EPFA 2GOXB 4XR6A 5EYRA 1T0FA 3DXJF 3M8JA 5F0HA 4BE1A 1MDMA 1GV5A 4XN0A 3I4NJ 1B9MA 3LL7A 3KYDB 4JX6A 2ACJA 4OIPF 3I4PA 2CQKA 2VXDA 2DPDA 1FT9A 2VBXA 3J7ZI 2A05A 4P1WA 3COAC 2XAQA 4YIRX 4A3BJ 4QWQA 4MHGA 2E5ZA 4I99C 4E70A 2LFBA 4AD9A 4IHSA 2FQ3A 4BS9A 2OTJI 1OR7C 4F91B 1JE8A 2AS5F 3LAPA 4MQVA 2AXTC 2WAQN 5ED4A 1D0ZA 2OC6A 3OL4A 1H9TA 2HDDA 3CLOA 3P9IA 2DJIA 2K7LA 3S1RJ 3GEZA 1IXRC 3G3ZA 1ZG3A 2E2JJ 3S3NA 2JPCA 4HDUA 2M4GA 1FPQA 2FEZA 2K02A 3NEUA 4E6KG 2H94A 1LB2A 3KLOA 1FOYA 4L9JA 2DI3A 2HI3A 2ZMEB 2RC4A 4GFBA 2FOKA 2R5YB 3C18A 3ZQIA 4HOBA 3KX2A 4W97A 2O3FA 3KP4A 5HVQC 3KZIC 4Y7NJ 1IUYA 3EPZA 4UXNA 5HOOA 3SFIA 1R4NB 1KQ8A 4KJZA 3E97A 4RB1A 3VFZA 1KQ0A 3ZMDA 1YIJI 1EJ9A 5CVIA 3F72A 1ZRFA 3JRHA 2E2HJ 5FRNA 2K5CA 1K4SA 2EFNA 3ZRGA 3ZQQA 3OYCA 1JKRC 3OWTA 2F5CA 4NHJA 2LKSA 1X2MA 3TKYA 3VODA 5LGNA 1MNDA 1X1DA 4XL9A 2I10A 3R60A 2M30A 3LOCA 5JLWA 1O3TA 2KLOA 1P2FA 1JUMA 3BR6A 3Q5FA 1MSFC 3HDDA 3BG6A 5F64A 2YPRA 1XGOA 2NS7A 4MO7A 3TL4X 3ULQB 1EV7A 3VSLA 4ESFA 1MZBA 2BOLA 2DAOA 3O2PE 3T0YA 2W85A 4EM0B 1MBKA 1J9IA 2K9LA 1K79A 5EDNA 3VYTB 3BR1A 3ASOH 4EQQA 5HLGA 3K1MA 2H27A 2PMUA 1VQPI 4XBFA 2QQBA 3I54A 2UXXA 3GFLA 4HNVA 1TT5B 4IKFA 3BC8A 1FTTA 4A3CJ 2D1HA 5B5EC 2HQAA 3CUQA 1SD6A 3WTYC 5IY5H 2EIKH 3L1PA 2CV1A 4BJTA 2Y9YA 2MLKA 4M74A 3OYEA 2XPUA 1XCVA 3ZQCA 1ZREA 2EJRA 2XAUA 3WGHA 5JR3A 4A69C 1OYIA 3PL8A 3JW4A 2QEXI 4JX4A 5E3OA 3HRUA 2FSWA 3QRFF 3BY6A 1BOBA 1QA6A 3B6AA 4Y33A 3A2KA 1IXSB 1ZGAA 2XIGA 3CMYA 2DU9A 2HWVA 4HF0A 1Y1WJ 1YW8A 3CCSI 2XGEA 1SFXA 1JTXA 1V4RA 2Y30A 2LY2A 3R6SA 2VKVA 3JR9A 3E0JB 2OTLI 4HV6A 2Q1ZB 3RYRA 1H88C 2EBIA 1TTYA 4XLAA 3T8RA 1WJAA 4ZH4F 2JMWA 2HR3A 4IX7A 3OS0A 2KT0A 5J4YA 3RKQA 4B1RA 1DP7P 3I9V2 3QPTA 2BY1A 2K9QA 2A6EF 4WK8F 2VKEA 3KP6A 3KP5A 4G12A 3LSRA 2OV7A 2ZXJA 2NS0A 3ZN0A 3B6CA 5D5VB 2DBBA 2JQ7A 5KNLA 1ETOA 2IXSA 1X3ZB 4BQNA 4AIKA 1FEXA 5D6FA 3CMAI 4UVBA 2XAHA 1L0OC 3HPGA 2XVCA 3H5RA 2IS1A 2GXBA 2ISYA 3EQLF 1NH3A 1CF7A 1SMTA 2HYFA 2IA2A 2ECBA 5E1ZB 3TO6A 3SEZA 3LQQA 3ABTA 1S29A 2L4MA 3GTKJ 4UVAA 5DV5A 1HDPA 2X51A 3ERED 4GDFA 1IJWC 1B9NA 1LE8A 3QYFA 4WXHA 2H09A 5F0FA 3GYHX 3JCUC 1ZELA 2H1LA 3OOUA 1R9TJ 2L9NA 3Q0WA 4OINF 2TDXA 2R93J 2O0YA 2HS5A 3KP7A 4CUGA 2AHQA 1BW6A 1X2NA 2LNBA 4Z2YA 1G59A 3HOYJ 3P9KA 3FXMA 3BTLA 2GAUA 1ON1A 4HX8A 3MKZA 2BXZA 2KKOA 4A3FJ 1IDYA 2I5UA 3DTKA 2Y0MA 2GXGA 2I8DA 3P9CA 1TBXA 2ZNZA 3BZKA 4XLFA 1U5TC 4ESJA 4CYCA 3MEXA 2JUCA 5L3FA 3K70C 2KFDA 3BG7A 3A4CA 4IHTA 3FXLA 5EF6A 5K1YA 3CQZJ 4I98B 4XLPF 1FMWA 2IP2A 2XF7A 3FXOA 4YEJA 4RB2C 2IT0A 1RC9A 1J0RA 4M9SA 4CHUA 4IQ4A 1FZPB 1W1WE 2M4KA 2OZUA 2DOFA 3H3ZA 4EATA 2P0WA 1UCRA 1USSA 2DA3A 2R7OA 5GAEJ 3QYEA 2EFPA 3HOWJ 1D8JA 1R4MB 3VOEA 1FYMA 4QPQA 5HNFA 3S3OA 4AYBA 3I59A 3OR1C 4D5FA 2NRAC 1WH5A 2AO9A 4I6ZA 2OAZA 3M7GA 4C3HJ 1MDMB 1SFOJ 3L09A 5FD6A 1Q1VA 5FO5A 2X1CA 3WTZA 5FGMA 4QLCU 1IZ1A 5E20A 1N25A 5L3EA 2V9PA 2JVGA 3MD2A 1ZG1A 3JTGA 2FNPA 2QBYA 1P9QC 2HKXA 1BJAA 1TQPA 1JJ6C 4S05A 3S2HJ 1U78A 3AL0B 4KN4X 2E1MB 5GTHC 1R22A 3L2RA 1HOMA 2KPMA 5J8CA 2O61A 3M3YJ 1MD0A 4QTRA 1SEUA 4UV9A 3HPHA 4MTDA 3VYRB 1QPMA 3FK6A 1FBUA 4OMZA 4PJ0C 1HA8A 2HVQA 5HLIA 2BHYA 5LFAA 3EUAA 3S14J 3DTIA 2PN6A 3RDIA 4KT5C 4BY7J 1NK3P 2BE5F 4IOCF 4CYDA 4HA8A 1BI3A 2ZO4A 3C3WA 3GLLA 5CYVA 3TGNA 4G7HF 2V9KA 2Z5UA 4BE0A 3RI4A 4BAYA 4WX9A 3EETA 1MKMA 4EM2A 2A5YB 2JK3A 2WB1A 4RMNA 2Q8KA 1YJ9I 3UKGA 2Y31A 1HW1A 5D5XB 2A61A 1K6YA 1BI1A 3K1PA 2PEXA 2KMUA 4HSTA 3KYLA 3CF5F 2PMZN 2NVYJ 5E3LA 4KMUX 2CWEA 3F22A 5FLMJ 1VQMI 1WCMJ 2DFIA 4XLEA 2G7HA 2P5KA 4HZFA 4EM1A 4FISA 3LSHA 3CLQA 4II2A 3BG9A 4PZJA 5FKKA 2UV1A 2FU4A 3NWTA 3VB2A 2K9MA 4GRIA 3U1DA 5JI6A 3I56I 3GFJA 3S1MJ 1XC5A 2ZXIA 1ZKGA 3BZCA 3JRGA 4BUPA 1VQKI 5IYDJ 1TQMA 3IUOA 4ON0A 3SZTA 3MKLA 1YQAA 2CFOA 4J00A 1E3PA 2ZSIB 3VEPA 4HG2A 2KJCA 1FYKA 2NNYA 1X4OA 1X58A 4EGZA 2DFFA 1QO0D 1Z77A 2BGCA 2ID3A 4A5MA 3W6VA 3LSMA 1IN4A 1YYVA 2HPIA 4LITA 3MN2A 3OIOA 4QSHA 3RZDJ 1AU7A 4RB0A 1ZAOA 5HS8A 4N0BA 4XOTA 4R1HA 4C2TA 3S16J 2FF4A 4B48A 1OCOH 4PUSA 2E1NA 2VC1A 5CJ9A 1YITI 3CMMA 1IAWA 2IGOA 3CJQB 3J7YJ 1TT0A 2QYOA 4A12A 2PI0A 2F5FA 3G6EI 4DJAA 4JP0A 2Z1DA 3KFWX 1RZ4A 4MQ9F 4MNUA 1KU9A 2JRMA 1AOYA 1BBYA 5L3GA 4HW0A 1E0EA 3GTLJ 3CUQB 1ZHFA 2JA7J 3HSRA 4BH9A 1KYZA 1FC3A 2MYSA 3S3MA 4ZYHA 3FM5A 4BJ5C 3ABKH 1JUPA 1MMDA 2FRHA 1ZRDA 2EWNA 2WV1A 2HDCA 2H8RA 4HF1A 4Y3OA 5FD5A 4FQGA 4XICA 2ZXWH 3WTWC 1W36D 3MKYB 1ERDA 3BOQA 2Q0OA 3OYIA 4P9FA 1G6NA 3GTQJ 2EILH 3ZGKA 1K4TA 1MJ9A 5KAFC 2JRTA 2KIFA 2A3SA 2WBMA 5B1BH 2K86A 1T8IA 2LLKA 3GBGA 3L2WA 1HSTA 5F1JA 5A2QZ 4U7DA 3M1EA 1XX5A 4KIBA 4CCLA 2HOEA 4LOCA 5FLXK 3T1BA 2PJRA 4PDKA 3CCJI 1BR1A 5JFRA 2LBFA 1ETVA 3E1SA 2DK8A 2H6CA 2IGMA 2QSHX 2XSDC 4DW6A 2BZTA 2WC2A 4I0BA 2VPRA 3QAHA 5ICGA 4I2OA 2QSGX 1T38A 4AM3A 3K69A 4AIDA 3HIFA 3MZYA 2LR8A 2GOMA 4NB5A 3ZOBA 2XPVA 4HLXA 4A3MJ 4MEYF 1JUSA 2M1BA 2JPBA 4RAYA 2DMTA 2BY0A 1GVDA 4AC0A 2Y9ZA 5E17F 1ONVA 3BROA 4NNJA 4XSZF 4L5JA 4JYKA 3TDUC 4CCKA 4IQJA 2L54A 4B44A 2GA2A 1WI3A 2LF8A 2ZCWA 5H6QA 1CF7B 5BPDA 3CO6C 1QHGA 1OYYA 3PIOF 4ENNA 2DTRA 3SJMA 1MMSA 3F3XA 4CDGA 1D3YA 5ILSA 3EYIA 1LE8B 2W82A 1SANA 1NG6A 1WJCA 2VUMJ 2JVHA 5TRDA 2L9RA 1EA3A 3OOPA 2HQRA 2F5VA 5LGTA 1QHHD 4FE7A 3JREA 1R5GA 3MMYB 3UR3C 2Z3YA 2LY9A 1YRNB 4U0VA 2D1VA 3FXKA 5K5OA 2HZTA 3W2AA 4E4HA 1QQIA 4KA4A 5BNGA 3GZ5A 3QODA 3FISA 1W4MA 1APLC 1T39A 1ETWA 4A6DA 2K4BA 5TISC 2BY3A 1XGNA 2LRDA 2W57A 3DTEA 1OYWA 4CYCB 2H8WA 1P7JA 1V55H 4G8XA 3ASNH 3R61A 4NDLA 1T08B 1RETA 2CQQA 3G2BA 1SD4A 4LLGF 3QQAA 2DMPA 4ITVA 3V8LA 5HDNA 3OSGA 1VNDA 4PFOA 5J1UA 5KVRA 3TP0A 1WGXA 3JSPA 1TLHB 1VFCA 3HM5A 3I58A 4GYIA 4A3LJ 2L02A 2OQGA 2NS8A 3QP5A 4D9JA 3ZPLA 2EH3A 2FX0A 2OUMA 3RYPA 3V7CA 3JAMZ 2O8KA 3QPSA 1B1BA 2DDBA 2N8GA 2QCOA 2V9VA 4AUXA 3KEOA 1U8BA 4X6AJ 3FBIB 3H0GJ 3D5SC 3I59B 4I09A 4LK0F 3J80K 5HS7A 1ZQ3P 1IV8A 3ZMUA 3HGYA 2F48A 3W6KB 4BU2A 3DLLF 4PCQA 4HF2A 2EA4A 2F4MB 5L3CA 3A1YA 4D7MA 2W24A 4NQWB 2B7EA 3BTIA 1JKQC 1XGSA 1XG1A 3PUBA 2XV4S 2VONA 4S04A 2CGPA 4L9NA 1RESA 2QBYB 3WHCA 2A6HF 1F36A 4IXAA 2BV6A 2DA2A 2Q2EA 4CH7A 5GTIC 4OOIA 4KFCA 2E1OA 1Y0NA 3PO2J 1J7KA 3IKVA 1DDNA 4A3IJ 3CDLA 1VTNC 2VJ4A 3RSNA 1YTYA 4L5EA 1HF0A 1OFCX 1DPRA 3MFKA 3K0LA 4ENJA 2RGVA 3FHZA 3GZ6A 4ZDOA 2NVXJ 1XSDA 2WAQA 1SD7A 4ANJA 2ESNA 4FETA 2DMNA 2AQEA 2UZKA 3CDIA 3DQVC 5EGOA 2LG4A 1W7PB 2FNAA 1IV6A 2CV2A 2Y2ZA 3R4KA 4CICA 3ZQLA 2YX4A 3O3KA 2E1CA 5B1AH 1E2XA 1I3AA 3JRAA 2L9VA 2X6XA 4NC7A 5DUIA 2P81A 3BPVA 2YX7A 3MCZA 3TMOA
chains in the Genus database with same CATH topology
1T98A 1J59A 3V8JA 3SHFA 3DPLC 2XGXA 1U2WA 4LLLA 3GF2A 1QZZA 3HHHA 3CJNA 1HW2A 5CVJA 1BC8C 5FFXA 5J6XA 3S2WA 3WGGA 3D5LA 2P6TA 2J5OA 2XHKA 3KZZA 2DT5A 2LSOA 3FWEA 5F1RA 4RGRA 1BIAA 4I02A 2PMHA 3M9AA 2RNJA 3L00A 1NHAA 4M9XA 2KJBA 1V3FA 1IN5A 3PQKA 3WE2A 2F5EA 4A2UA 2LDUA 5LGUA 3FX3A 1TW2A 4L9TA 1HKSA 2QM3A 4Y17A 2GZWA 5DD4A 3DF8A 2VOOA 4JK1X 1S7AA 1DPUA 2HGCA 3TQNA 1XB4A 4EJOA 4CZZA 1JXSA 1K6OA 2A68F 2R7DA 2CW0F 3QPHA 2MC3A 1WKMA 4FX4A 2P5LC 3RIRA 3RKXA 5ILUA 4BQAA 3Q9VA 3QP6A 1L3LA 1R1VA 3RPQA 1W5TA 3ZMSA 3GLXA 1KA8A 1XMAA 1XSXA 4JQFA 1WWXA 3HSEA 4YFXF 4FT8A 2BYVE 2VBZA 4OMYA 5FFZA 4GGGA 5AIQA 3ECHA 3KEQA 4LMYA 1T2KA 4IVNA 3CUOA 4KYWA 1DUXC 1SMYF 5DYMA 1Z6RA 4YIFA 2GA1A 5LEKA 1USTA 1Z1DA 3BZ6A 5HDGA 3SZPA 2STWA 1IRGA 4R8HA 1XCBA 5CVRA 2HKOA 1XD7A 4M6XA 3HRSA 1J2XA 2OD5A 2ELHA 2ETHA 1SAXA 2OQRA 4HYEA 1HXDA 1LVAA 1O3RA 1W7PD 4BHPA 3KP2A 1O3QA 4U88A 1R1UA 5DCFA 3K9TA 5E1XA 5LHGA 3BDDA 5L3BA 1UHWA 4Y13A 2CG4A 5JVTA 2M87A 4UNOA 3PFIA 4A6EA 4EJWA 5DDGA 4Q4ZF 1UHMA 1F9NA 2PJPA 1ZRCA 2Y48A 3KETA 2C6YA 2VBYA 3RPUA 5IT3A 1E17A 2QUFA 5BQTA 1K78B 1P4AA 2J5PA 1S7OA 2P5VA 4L5IA 1BI0A 4HDVA 2DK5A 3WU0A 1LDJA 1B4AA 1FP2A 1I1GA 4G6QA 1RI7A 2QWWA 5HS9A 1IRFA 3WTUC 2OZ6A 5EEHA 4L18B 4AWXB 1U8RA 2UWMA 4NQWA 3V7SA 3GX4X 3F8BA 1FSEA 3REOA 3JSOA 4ZZLA 4BHBA 1BIBA 1GXQA 1HBXG 1ULYA 3T8TA 3ABUA 1U5TB 3ROUA 5H20A 5J8FA 2EFQA 2MLGA 2PLYA 3ZMTA 3C1DA 4P5OA 2HEOA 4UVCA 3HTSB 2OA4A 4ASNA 4JBAA 1PP8F 1W7PA 4M9ZA 2P4WA 3I53A 3OV8A 2M8EA 2DQRA 5LHHA 1O3SA 4BHCA 1EH8A 4UHTA 1FP1D 1O7FA 1LQ1A 3F8NA 2FA5A 3N97A 3E6BA 4ESBA 1LEAA 2G7UA 2RKHA 1HKQA 3EYYA 3BJ6A 5AONA 3CUQC 2QVOA 3R0AA 3J81Z 3DPTA 1D5VA 2MH2A 2DQLA 1ON2A 1SD5A 3GFIA 3TO9A 2PBIA 2ZJ2A 4HX7A 2W25A 1JHFA 5ILVA 2IA1A 2XAJA 4IF4A 1LJ9A 3FXQA 5E8GA 5ERIA 1REPC 3KLNA 3LQRA 2LKPA 5BPIA 4WF2A 2FMLA 3WU1B 3ZMVA 2XKPA 3GO5A 2XKOA 2DLLA 2EK5A 3FMQA 3N4MA 4LB6B 4I7HA 5L3DA 4RGXA 2DW4A 4EJVA 4EMSA 3HTUA 3H92A 4HLYA 3TDZC 3DFGA 5CVVA 1OR7A 3L9FA 3Q9SA 4G9YA 4A5NA 1S8NA 1I6XA 2MA3A 1YLFA 3C7JA 1W5SA 3F8MA 2ADUA 1KU7A 1FWZA 3H3UA 3IC7A 1QZYA 3IL2A 4P9UA 4EGYA 2O6GE 1TW3A 2VXZA 3NQOA 1FSHA 4HQEA 4DQ2A 2X0LA 1FNNA 1RNLA 1H9GA 4KIGA 3ZMZA 2D45A 3DEUA 1B6AA 1H0MA 1I1SA 2IW5A 3WTSC 4WWCA 2GIVA 2ZNYA 1ZLJA 2AXLA 1ZYRF 5F6FA 1BI2A 3D0SA 2MD5A 2H6BA 2RDPA 3AAFA 2K4JA 4IRGA 1KGSA 3GVAA 2F5DA 1TNSA 4ENMA 2DPUA 3F8FA 1MJBA 2BBYA 2FBKA 2VE9A 3WTXC 4YIIA 4GXOA 2XASA 4EJTA 1OKRA 3TOBA 4KDPA 2WTEA 2Z33A 2HTJA 5LHIA 2RV8A 2FBIA 3MQ0A 3E3VA 2V79A 2XAGA 3O6BB 1PDNC 2LF7A 6PAXA 4PGGA 2IRFG 4P55A 1Z7UA 4XRFA 3J7AO 4MTEA 1RUNA 3B73A 3RKYA 3M8EA 3IWFA 5LBQA 1EH7A 1O57A 2ESHA 5BMZA 1YG2A 3KZYA 3ZQ7A 2QQAA 4FHTA 3PQJA 4R79A 1K78A 1C0WA 1ZLKA 1QNTA 4LB5A 4LK1F 2Y75A 3HOTA 2IA0A 3RTRA 2XAFA 4Q47A 1BN5A 5DEQA 2XRNA 2K27A 2V6CA 1BC7C 4M6YA 1G4DA 4IRIA 2KRFA 2EV6A 3BP8A 1YW7A 2X4HA 5A2QK 4YFKF 1WQ2A 3LA2A 5FB2A 1U5TA 2G9WA 3GWZA 1YS6A 2PG4A 2EFOA 2NNNA 1KU3A 1IN8A 2M5WA 2KIMA 4D0PA 3FF5A 3LFKA 1BM9A 4ZYDA 1PP7U 4L0ZB 3V4GA 4HV5A 1U3EM 1KYWA 4RGSA 5LRRA 2JSCA 1MJAA 4M73A 3G73A 2P7CB 3DP7A 3WG9A 4ZYGA 4GCVA 4OIRF 1Z6TA 2P7VB 4ZZDA 4L0YB 3WE3A 4B09A 3HRMA 5DCMA 4Q5SF 2ZBKA 2R7FA 2QENA 1XMKA 4LGWA 1D8KA 1I27A 2CYYA 1FLIA 1G3TA 4CXFA 2JZYA 4U0YA 2EA2A 3F8CA 3JAMK 5DD8A 3I71A 3BWGA 4EJUA 4KICA 2FBHA 1GHCA 4ENKA 3BJAA 5E1WA 3DV8A 3E6DA 5D8LB 4ETSA 4U7BA 4XSXF 4UUVA 4G7ZF 1R1TA 3CO7C 3SQNA 5LRSA 4I0AA 1RUOA 1TNTA 4HX4A 2L4AA 1F4KA 4G6DA 1EH6A 1WI9A 4MGRA 5BS6A 1P4WA 3E6MA 3ECOA 1LEBA 2YU3A 4M71A 4BXUA 1R58A 2CO5A 4WXDA 3IWZA 1G3SA 2R3SA 3IHUA 4LG0A 2E7XA 2P8TA 3KP3A 3FXRA 1O7LA 3F6VA 2MBFA 5D5UB 1RIOH 3QOPA 3F6OA 2FXAA 4O5VA 5KK1A 3I0TA 1YW9A 1BOAA 4IJAA 5BOXA 2L3DA 1Q1HA 4RS8A 2CFXA 3E5UA 4A0YA 4KN7X 5ICCA 5D8KB 3B02A 4G94A 2M45A 1LDKB 1IN6A 3NRVA 1Z05A 1U6GA 1FX7A 2QZ8A 2ZFWA 4OU0A 2HFHA 1J75A 5E8IA 4AIJA 1P92A 2GQQA 4DNCA 2IVMA 1R23A 5FLXZ 3SFZA 4HQMA 4O6JA 1J5YA 3FZVA 5TJJA 1OMIA 2O03A 4CGZA 3LA7A 1WSUA 4I01A 2VBWA 3F23A 3KE2A 3E6CC 1HQCA 1XDSA 5D6EA 2VT3A 4N9IA 3U9GA 2B0LA 3FMSA 1K7AA 3M8FA 1F1ZA 3GW2A 4M72A 1S6LA 1Z91A 2FE3A 2O8XA 5IT9Z 1WRJA 3E5XA 2EV0A 5D5WB 2A69F 1Z9CA 2CSOA 1CGPA 1I5ZA 4XLNF 3TOAA 4EV0A 4TV7A 2WV0A 2ZKZA 4IRHA 4FX0A 5CLSA 4GO1A 2V1XA 2EFWA 2VODA 3DKWA 5E18F 3HUGA 1F5TA 3L2CA 2PFBA 3I64A 3R0JA 3GFMA 2IPQX 1XN7A 4P96A 1ZH5A 3MAJA 4U0WA 4A0XA 1YFHA 2RN7A 3WGIA 2V1DA 1ZG5A 1ODDA 4OIQF 2QQ9A 2L01A 2VN2A 3RKWA 1R7JA 5DCMB 1S3JA 3ELKA 4GYGA 4IPAA 3J80Z 4BYYA 1P6RA 3LAJA 3ISPA 2OU2A 5D4SA 3MZHA 3P7NA 1FBSA 4ZYEA 1YS7A 3FXUA 5LLQA 1Y0UA 4HAMA 1R5HA 2VE8A 3FM3A 2F2EA 3FMRA 4Y15A 1HKTA 1MGTA 1IN7A 3MWMA 1ZARA 2V1UA 2EV5A 3WTVC 4K2EA 5LEJA 2MH9A 1HSJA 1XGMA 2ZMEA 4KNYA 1SFUA 3EDPA 5JHUA 2VT2A 1YO5C 4AIHA 4YFNF 1QBJA 1FY7A 3BJOA 2EB7A 1LDDA 1R36A 4KUMA 3E5QA 4O3MA 1ZGJA 2Z9OA 4LD5A 2UXNA 3LSTA 2QLZA 3WODF 3HOSA 1FBQA 5H6RA 3QU3A 4N9HA 1R00A 1GXPA 4LJZF 1P4XA 1YIOA 1STZA 5AIPA 3V7RA 2BEOA 4AVPA 4LG0B 5DUKA 2VC0A 1UFMA 4YG2F 1UB9A 3TO7A 3F21A 3LWFA 4WCGA 2FMYA 3HRTA 3W6JB 4RAZA 2Z99A 1KQ9A 2YSRA 4KIFA 2GWRA 3ZN1A 1A04A 2W84A 4KMFA 2HTSA 3HSFA 4OIOF 4UV8A 2JTVA 4RGUA 5HDKA 4LFUA 5IT9K 1OPCA 2STTA 1XDUA 2OBPA 3IRRA 2COMA 4CO8A 2IJLA 1PUEE 2XUBA 2NAZA 3KCCA 5EEGA 4EVIA 2DO7A 2ISZA 4MEXF 4H0EA 1B59A 3CTAA 3GXOA 4HBLA 4A0ZA 5D4RA 1IXCA 2HYGD 3ZP5A 1HW5A 1IF1A 3V8KA 1IW7F 1AWCA 5K5RA 2YR2A 1TQIA 5ICFA 3L7WA 4WXCA 1FYLA 4RB3C 4BNCA 3J81K 5HLHA 1JGSA 1XSVA 1ZN2A 3BPXA 1LNWA 5ICEA 4PGHA 3U2RA 3HHGA 3I5UA 2KIUA 2RVCA 3GUDA 1FOKA 1X3UA 4B8XA 2RQPA 1SFEA 3RJPA 5CVUA 3QU6A 3T5XA 1G3WA 2E7WA 3HYIA 1KU2A 3JTHA 1G3YA 1GVJA 3CDHA 2HQNA 2PQ8A 3K2ZA 2A07F 3EUHA 3ML6A 3IKTA 5K5QA 3K1NA 2XROA 4F7ZA 4Q48A 2P6SA 1QGPA 4L9VA 3WTTC 3SXYA 3IRQA 2JT1A 1T6SA 2VOPA 2D2WA 2NYXA 2WWYA 4LLNA 4G7OF 3LA3A 1JHHA 1T0FA 3DXJF 1MDMA 1B9MA 2ACJA 4OIPF 3I4PA 2CQKA 2DPDA 1FT9A 2VBXA 3COAC 2XAQA 4QWQA 4MHGA 4E70A 4AD9A 4IHSA 2FQ3A 2AS5F 3LAPA 4MQVA 5ED4A 1H9TA 3CLOA 3P9IA 2K7LA 3GEZA 1IXRC 3G3ZA 1ZG3A 2JPCA 4HDUA 1FPQA 2FEZA 2K02A 3NEUA 1LB2A 2H94A 3KLOA 4L9JA 2DI3A 2ZMEB 2RC4A 2FOKA 3C18A 4HOBA 2O3FA 3KP4A 5HVQC 1IUYA 4UXNA 5HOOA 1KQ8A 3E97A 4RB1A 3VFZA 1KQ0A 3ZMDA 5CVIA 3F72A 1ZRFA 2EFNA 2F5CA 4NHJA 3TKYA 3VODA 5LGNA 3R60A 2M30A 1O3TA 1P2FA 3Q5FA 5F64A 1JE8A 2YPRA 1XGOA 3ULQB 4ESFA 1EV7A 1MZBA 2DAOA 3O2PE 3T0YA 2W85A 4EM0B 1J9IA 1K79A 4EQQA 5HLGA 3K1MA 2H27A 2PMUA 4XBFA 2QQBA 3I54A 2UXXA 3GFLA 2D1HA 3CUQA 1SD6A 3WTYC 2MLKA 4M74A 1XCVA 1ZREA 2EJRA 3WGHA 5JR3A 1OYIA 3JW4A 3HRUA 2FSWA 3QRFF 3BY6A 1IXSB 1ZGAA 2XIGA 2DU9A 2HWVA 4HF0A 1YW8A 1SFXA 1V4RA 3R6SA 4HV6A 3RYRA 1TTYA 3T8RA 4ZH4F 2HR3A 1DP7P 3QPTA 4WK8F 2A6EF 3KP6A 3KP5A 2ZXJA 2NS0A 3ZN0A 5D5VB 2DBBA 4AIKA 5D6FA 4UVBA 2XAHA 1L0OC 2XVCA 2GXBA 2ISYA 3EQLF 1CF7A 1SMTA 2HYFA 2IA2A 5E1ZB 3TO6A 3LQQA 3ABTA 1S29A 2L4MA 4UVAA 5DV5A 3ERED 1B9NA 4WXHA 2H09A 3GYHX 4OINF 2TDXA 2O0YA 2HS5A 3KP7A 2LNBA 4Z2YA 3P9KA 2GAUA 1ON1A 4HX8A 2KKOA 2Y0MA 2GXGA 3P9CA 1TBXA 2ZNZA 1U5TC 4ESJA 3MEXA 5L3FA 4IHTA 5K1YA 4I98B 4XLPF 2IP2A 4RB2C 2IT0A 1J0RA 4M9SA 4CHUA 1FZPB 2OZUA 3H3ZA 1UCRA 1USSA 2EFPA 1D8JA 3VOEA 1FYMA 3I59A 2NRAC 2OAZA 3M7GA 1MDMB 3L09A 5FD6A 5FO5A 3WTZA 5FGMA 4QLCU 1IZ1A 5E20A 5L3EA 1ZG1A 3JTGA 2FNPA 2QBYA 2HKXA 1BJAA 1TQPA 4S05A 1U78A 4KN4X 1R22A 5J8CA 2O61A 1MD0A 4UV9A 4MTDA 1QPMA 1FBUA 4OMZA 5HLIA 2PN6A 3RDIA 4KT5C 2BE5F 4CYDA 4HA8A 1BI3A 2ZO4A 3C3WA 5CYVA 3TGNA 4G7HF 2Z5UA 3RI4A 4BAYA 4WX9A 3EETA 1MKMA 4EM2A 2A5YB 2Q8KA 1HW1A 5D5XB 2A61A 1BI1A 3K1PA 2PEXA 4KMUX 2CWEA 3F22A 2DFIA 2G7HA 2P5KA 4HZFA 4EM1A 4PZJA 2FU4A 3VB2A 5JI6A 3U1DA 3GFJA 1TQMA 4ON0A 3SZTA 1YQAA 3VEPA 2KJCA 1FYKA 2NNYA 4EGZA 1QO0D 4A5MA 2BGCA 1IN4A 1YYVA 4RB0A 1ZAOA 5HS8A 4N0BA 4R1HA 2FF4A 2E1NA 2VC1A 5CJ9A 1IAWA 2QYOA 4A12A 2PI0A 2F5FA 3KFWX 1RZ4A 4MQ9F 4MNUA 1KU9A 1AOYA 1BBYA 5L3GA 4HW0A 3CUQB 1ZHFA 3HSRA 4BH9A 1KYZA 1FC3A 4ZYHA 3FM5A 2FRHA 1ZRDA 2EWNA 2HDCA 4HF1A 5FD5A 3WTWC 3BOQA 2Q0OA 4P9FA 1G6NA 1MJ9A 2JRTA 2KIFA 2A3SA 2K86A 1HSTA 4U7DA 5A2QZ 3M1EA 4KIBA 2HOEA 5FLXK 3T1BA 4PDKA 5JFRA 2DK8A 2H6CA 2WC2A 4I0BA 3QAHA 4I2OA 5ICGA 1T38A 3K69A 3HIFA 3MZYA 4NB5A 4HLXA 4MEYF 2M1BA 2JPBA 4RAYA 5E17F 1ONVA 3BROA 4XSZF 4L5JA 3TDUC 2L54A 2GA2A 2LF8A 2ZCWA 5H6QA 1CF7B 5BPDA 3CO6C 1OYYA 4ENNA 2DTRA 3F3XA 4CDGA 1D3YA 5ILSA 3EYIA 5TRDA 3OOPA 2HQRA 5LGTA 1R5GA 2Z3YA 4U0VA 2D1VA 5K5OA 2HZTA 1QQIA 4KA4A 3GZ5A 1W4MA 1T39A 4A6DA 2K4BA 2W57A 1XGNA 1OYWA 4G8XA 3R61A 1SD4A 4LLGF 3V8LA 5HDNA 5KVRA 3JSPA 1TLHB 3I58A 4GYIA 2L02A 2OQGA 3QP5A 3ZPLA 3RYPA 3V7CA 3JAMZ 1B1BA 2V9VA 3KEOA 3I59B 4I09A 4LK0F 3J80K 5HS7A 3ZMUA 3W6KB 4PCQA 4HF2A 2EA4A 5L3CA 2W24A 1XGSA 2XV4S 2VONA 4S04A 2CGPA 4L9NA 2QBYB 2A6HF 4IXAA 2BV6A 2Q2EA 4OOIA 4KFCA 1J7KA 3IKVA 1DDNA 1VTNC 1YTYA 1DPRA 3MFKA 3K0LA 4ENJA 2RGVA 3FHZA 3GZ6A 1XSDA 1SD7A 2ESNA 2UZKA 3DQVC 1W7PB 2FNAA 3R4KA 4CICA 2YX4A 3O3KA 2E1CA 1E2XA 5DUIA 3BPVA 2YX7A 3MCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T98 A;  1J59 A;  3V8J A;  3SHF A;  3DPL C;  2XGX A;  1U2W A;  4LLL A;  3GF2 A;  1QZZ A;  3HHH A;  3CJN A;  1HW2 A;  5CVJ A;  1BC8 C;  5FFX A;  5J6X A;  3S2W A;  3WGG A;  3D5L A;  2P6T A;  2J5O A;  2XHK A;  3KZZ A;  2DT5 A;  2LSO A;  3FWE A;  5F1R A;  4RGR A;  1BIA A;  4I02 A;  2PMH A;  3M9A A;  2RNJ A;  3L00 A;  1NHA A;  4M9X A;  2KJB A;  1V3F A;  1IN5 A;  3PQK A;  3WE2 A;  2F5E A;  4A2U A;  2LDU A;  5LGU A;  3FX3 A;  1TW2 A;  4L9T A;  1HKS A;  2QM3 A;  4Y17 A;  2GZW A;  5DD4 A;  3DF8 A;  2VOO A;  4JK1 X;  1S7A A;  1DPU A;  2HGC A;  3TQN A;  1XB4 A;  4EJO A;  4CZZ A;  1JXS A;  1K6O A;  2A68 F;  2R7D A;  2CW0 F;  3QPH A;  2MC3 A;  1WKM A;  4FX4 A;  2P5L C;  3RIR A;  3RKX A;  5ILU A;  4BQA A;  3Q9V A;  3QP6 A;  1L3L A;  1R1V A;  3RPQ A;  1W5T A;  3ZMS A;  3GLX A;  1KA8 A;  1XMA A;  1XSX A;  4JQF A;  1WWX A;  3HSE A;  4YFX F;  4FT8 A;  2BYV E;  2VBZ A;  4OMY A;  5FFZ A;  4GGG A;  5AIQ A;  3ECH A;  3KEQ A;  4LMY A;  1T2K A;  4IVN A;  3CUO A;  4KYW A;  1DUX C;  1SMY F;  5DYM A;  1Z6R A;  4YIF A;  2GA1 A;  5LEK A;  1UST A;  1Z1D A;  3BZ6 A;  5HDG A;  3SZP A;  2STW A;  1IRG A;  4R8H A;  1XCB A;  5CVR A;  2HKO A;  1XD7 A;  4M6X A;  3HRS A;  1J2X A;  2OD5 A;  2ELH A;  2ETH A;  1SAX A;  2OQR A;  4HYE A;  1HXD A;  1LVA A;  1O3R A;  1W7P D;  4BHP A;  3KP2 A;  1O3Q A;  4U88 A;  1R1U A;  5DCF A;  3K9T A;  5E1X A;  5LHG A;  3BDD A;  5L3B A;  1UHW A;  4Y13 A;  2CG4 A;  5JVT A;  2M87 A;  4UNO A;  3PFI A;  4A6E A;  4EJW A;  5DDG A;  4Q4Z F;  1UHM A;  1F9N A;  2PJP A;  1ZRC A;  2Y48 A;  3KET A;  2C6Y A;  2VBY A;  3RPU A;  5IT3 A;  1E17 A;  2QUF A;  5BQT A;  1K78 B;  1P4A A;  2J5P A;  1S7O A;  2P5V A;  4L5I A;  1BI0 A;  4HDV A;  2DK5 A;  3WU0 A;  1LDJ A;  1B4A A;  1FP2 A;  1I1G A;  4G6Q A;  1RI7 A;  2QWW A;  5HS9 A;  1IRF A;  3WTU C;  2OZ6 A;  5EEH A;  4L18 B;  4AWX B;  1U8R A;  2UWM A;  4NQW A;  3V7S A;  3GX4 X;  3F8B A;  1FSE A;  3REO A;  3JSO A;  4ZZL A;  4BHB A;  1BIB A;  1GXQ A;  1HBX G;  1ULY A;  3T8T A;  3ABU A;  1U5T B;  3ROU A;  5H20 A;  5J8F A;  2EFQ A;  2MLG A;  2PLY A;  3ZMT A;  3C1D A;  4P5O A;  2HEO A;  4UVC A;  3HTS B;  2OA4 A;  4ASN A;  4JBA A;  1PP8 F;  1W7P A;  4M9Z A;  2P4W A;  3I53 A;  3OV8 A;  2M8E A;  2DQR A;  5LHH A;  1O3S A;  4BHC A;  1EH8 A;  4UHT A;  1FP1 D;  1O7F A;  1LQ1 A;  3F8N A;  2FA5 A;  3N97 A;  3E6B A;  4ESB A;  1LEA A;  2G7U A;  2RKH A;  1HKQ A;  3EYY A;  3BJ6 A;  5AON A;  3CUQ C;  2QVO A;  3R0A A;  3J81 Z;  3DPT A;  1D5V A;  2MH2 A;  2DQL A;  1ON2 A;  1SD5 A;  3GFI A;  3TO9 A;  2PBI A;  2ZJ2 A;  4HX7 A;  2W25 A;  1JHF A;  5ILV A;  2IA1 A;  2XAJ A;  4IF4 A;  1LJ9 A;  3FXQ A;  5E8G A;  5ERI A;  1REP C;  3KLN A;  3LQR A;  2LKP A;  5BPI A;  4WF2 A;  2FML A;  3WU1 B;  3ZMV A;  2XKP A;  3GO5 A;  2XKO A;  2DLL A;  2EK5 A;  3FMQ A;  3N4M A;  4LB6 B;  4I7H A;  5L3D A;  4RGX A;  2DW4 A;  4EJV A;  4EMS A;  3HTU A;  3H92 A;  4HLY A;  3TDZ C;  3DFG A;  5CVV A;  1OR7 A;  3L9F A;  3Q9S A;  4G9Y A;  4A5N A;  1S8N A;  1I6X A;  2MA3 A;  1YLF A;  3C7J A;  1W5S A;  3F8M A;  2ADU A;  1KU7 A;  1FWZ A;  3H3U A;  3IC7 A;  1QZY A;  3IL2 A;  4P9U A;  4EGY A;  2O6G E;  1TW3 A;  2VXZ A;  3NQO A;  1FSH A;  4HQE A;  4DQ2 A;  2X0L A;  1FNN A;  1RNL A;  1H9G A;  4KIG A;  3ZMZ A;  2D45 A;  3DEU A;  1B6A A;  1H0M A;  1I1S A;  2IW5 A;  3WTS C;  4WWC A;  2GIV A;  2ZNY A;  1ZLJ A;  2AXL A;  1ZYR F;  5F6F A;  1BI2 A;  3D0S A;  2MD5 A;  2H6B A;  2RDP A;  3AAF A;  2K4J A;  4IRG A;  1KGS A;  3GVA A;  2F5D A;  1TNS A;  4ENM A;  2DPU A;  3F8F A;  1MJB A;  2BBY A;  2FBK A;  2VE9 A;  3WTX C;  4YII A;  4GXO A;  2XAS A;  4EJT A;  1OKR A;  3TOB A;  4KDP A;  2WTE A;  2Z33 A;  2HTJ A;  5LHI A;  2RV8 A;  2FBI A;  3MQ0 A;  3E3V A;  2V79 A;  2XAG A;  3O6B B;  1PDN C;  2LF7 A;  6PAX A;  4PGG A;  2IRF G;  4P55 A;  1Z7U A;  4XRF A;  3J7A O;  4MTE A;  1RUN A;  3B73 A;  3RKY A;  3M8E A;  3IWF A;  5LBQ A;  1EH7 A;  1O57 A;  2ESH A;  5BMZ A;  1YG2 A;  3KZY A;  3ZQ7 A;  2QQA A;  4FHT A;  3PQJ A;  4R79 A;  1K78 A;  1C0W A;  1ZLK A;  1QNT A;  4LB5 A;  4LK1 F;  2Y75 A;  3HOT A;  2IA0 A;  3RTR A;  2XAF A;  4Q47 A;  1BN5 A;  5DEQ A;  2XRN A;  2K27 A;  2V6C A;  1BC7 C;  4M6Y A;  1G4D A;  4IRI A;  2KRF A;  2EV6 A;  3BP8 A;  1YW7 A;  2X4H A;  5A2Q K;  4YFK F;  1WQ2 A;  3LA2 A;  5FB2 A;  1U5T A;  2G9W A;  3GWZ A;  1YS6 A;  2PG4 A;  2EFO A;  2NNN A;  1KU3 A;  1IN8 A;  2M5W A;  2KIM A;  4D0P A;  3FF5 A;  3LFK A;  1BM9 A;  4ZYD A;  1PP7 U;  4L0Z B;  3V4G A;  4HV5 A;  1U3E M;  1KYW A;  4RGS A;  5LRR A;  2JSC A;  1MJA A;  4M73 A;  3G73 A;  2P7C B;  3DP7 A;  3WG9 A;  4ZYG A;  4GCV A;  4OIR F;  1Z6T A;  2P7V B;  4ZZD A;  4L0Y B;  3WE3 A;  4B09 A;  3HRM A;  5DCM A;  4Q5S F;  2ZBK A;  2R7F A;  2QEN A;  1XMK A;  4LGW A;  1D8K A;  1I27 A;  2CYY A;  1FLI A;  1G3T A;  4CXF A;  2JZY A;  4U0Y A;  2EA2 A;  3F8C A;  3JAM K;  5DD8 A;  3I71 A;  3BWG A;  4EJU A;  4KIC A;  2FBH A;  1GHC A;  4ENK A;  3BJA A;  5E1W A;  3DV8 A;  3E6D A;  5D8L B;  4ETS A;  4U7B A;  4XSX F;  4UUV A;  4G7Z F;  1R1T A;  3CO7 C;  3SQN A;  5LRS A;  4I0A A;  1RUO A;  1TNT A;  4HX4 A;  2L4A A;  1F4K A;  4G6D A;  1EH6 A;  1WI9 A;  4MGR A;  5BS6 A;  1P4W A;  3E6M A;  3ECO A;  1LEB A;  2YU3 A;  4M71 A;  4BXU A;  1R58 A;  2CO5 A;  4WXD A;  3IWZ A;  1G3S A;  2R3S A;  3IHU A;  4LG0 A;  2E7X A;  2P8T A;  3KP3 A;  3FXR A;  1O7L A;  3F6V A;  2MBF A;  5D5U B;  1RIO H;  3QOP A;  3F6O A;  2FXA A;  4O5V A;  5KK1 A;  3I0T A;  1YW9 A;  1BOA A;  4IJA A;  5BOX A;  2L3D A;  1Q1H A;  4RS8 A;  2CFX A;  3E5U A;  4A0Y A;  4KN7 X;  5ICC A;  5D8K B;  3B02 A;  4G94 A;  2M45 A;  1LDK B;  1IN6 A;  3NRV A;  1Z05 A;  1U6G A;  1FX7 A;  2QZ8 A;  2ZFW A;  4OU0 A;  2HFH A;  1J75 A;  5E8I A;  4AIJ A;  1P92 A;  2GQQ A;  4DNC A;  2IVM A;  1R23 A;  5FLX Z;  3SFZ A;  4HQM A;  4O6J A;  1J5Y A;  3FZV A;  5TJJ A;  1OMI A;  2O03 A;  4CGZ A;  3LA7 A;  1WSU A;  4I01 A;  2VBW A;  3F23 A;  3KE2 A;  3E6C C;  1HQC A;  1XDS A;  5D6E A;  2VT3 A;  4N9I A;  3U9G A;  2B0L A;  3FMS A;  1K7A A;  3M8F A;  1F1Z A;  3GW2 A;  4M72 A;  1S6L A;  1Z91 A;  2FE3 A;  2O8X A;  5IT9 Z;  1WRJ A;  3E5X A;  2EV0 A;  5D5W B;  2A69 F;  1Z9C A;  2CSO A;  1CGP A;  1I5Z A;  4XLN F;  3TOA A;  4EV0 A;  4TV7 A;  2WV0 A;  2ZKZ A;  4IRH A;  4FX0 A;  5CLS A;  4GO1 A;  2V1X A;  2EFW A;  2VOD A;  3DKW A;  5E18 F;  3HUG A;  1F5T A;  3L2C A;  2PFB A;  3I64 A;  3R0J A;  3GFM A;  2IPQ X;  1XN7 A;  4P96 A;  1ZH5 A;  3MAJ A;  4U0W A;  4A0X A;  1YFH A;  2RN7 A;  3WGI A;  2V1D A;  1ZG5 A;  1ODD A;  4OIQ F;  2QQ9 A;  2L01 A;  2VN2 A;  3RKW A;  1R7J A;  5DCM B;  1S3J A;  3ELK A;  4GYG A;  4IPA A;  3J80 Z;  4BYY A;  1P6R A;  3LAJ A;  3ISP A;  2OU2 A;  5D4S A;  3MZH A;  3P7N A;  1FBS A;  4ZYE A;  1YS7 A;  3FXU A;  5LLQ A;  1Y0U A;  4HAM A;  1R5H A;  2VE8 A;  3FM3 A;  2F2E A;  3FMR A;  4Y15 A;  1HKT A;  1MGT A;  1IN7 A;  3MWM A;  1ZAR A;  2V1U A;  2EV5 A;  3WTV C;  4K2E A;  5LEJ A;  2MH9 A;  1HSJ A;  1XGM A;  2ZME A;  4KNY A;  1SFU A;  3EDP A;  5JHU A;  2VT2 A;  1YO5 C;  4AIH A;  4YFN F;  1QBJ A;  1FY7 A;  3BJO A;  2EB7 A;  1LDD A;  1R36 A;  4KUM A;  3E5Q A;  4O3M A;  1ZGJ A;  2Z9O A;  4LD5 A;  2UXN A;  3LST A;  2QLZ A;  3WOD F;  3HOS A;  1FBQ A;  5H6R A;  3QU3 A;  4N9H A;  1R00 A;  1GXP A;  4LJZ F;  1P4X A;  1YIO A;  1STZ A;  5AIP A;  3V7R A;  2BEO A;  4AVP A;  4LG0 B;  5DUK A;  2VC0 A;  1UFM A;  4YG2 F;  1UB9 A;  3TO7 A;  3F21 A;  3LWF A;  4WCG A;  2FMY A;  3HRT A;  3W6J B;  4RAZ A;  2Z99 A;  1KQ9 A;  2YSR A;  4KIF A;  2GWR A;  3ZN1 A;  1A04 A;  2W84 A;  4KMF A;  2HTS A;  3HSF A;  4OIO F;  4UV8 A;  2JTV A;  4RGU A;  5HDK A;  4LFU A;  5IT9 K;  1OPC A;  2STT A;  1XDU A;  2OBP A;  3IRR A;  2COM A;  4CO8 A;  2IJL A;  1PUE E;  2XUB A;  2NAZ A;  3KCC A;  5EEG A;  4EVI A;  2DO7 A;  2ISZ A;  4MEX F;  4H0E A;  1B59 A;  3CTA A;  3GXO A;  4HBL A;  4A0Z A;  5D4R A;  1IXC A;  2HYG D;  3ZP5 A;  1HW5 A;  1IF1 A;  3V8K A;  1IW7 F;  1AWC A;  5K5R A;  2YR2 A;  1TQI A;  5ICF A;  3L7W A;  4WXC A;  1FYL A;  4RB3 C;  4BNC A;  3J81 K;  5HLH A;  1JGS A;  1XSV A;  1ZN2 A;  3BPX A;  1LNW A;  5ICE A;  4PGH A;  3U2R A;  3HHG A;  3I5U A;  2KIU A;  2RVC A;  3GUD A;  1FOK A;  1X3U A;  4B8X A;  2RQP A;  1SFE A;  3RJP A;  5CVU A;  3QU6 A;  3T5X A;  1G3W A;  2E7W A;  3HYI A;  1KU2 A;  3JTH A;  1G3Y A;  1GVJ A;  3CDH A;  2HQN A;  2PQ8 A;  3K2Z A;  2A07 F;  3EUH A;  3ML6 A;  3IKT A;  5K5Q A;  3K1N A;  2XRO A;  4F7Z A;  4Q48 A;  2P6S A;  1QGP A;  4L9V A;  3WTT C;  3SXY A;  3IRQ A;  2JT1 A;  1T6S A;  2VOP A;  2D2W A;  2NYX A;  2WWY A;  4LLN A;  4G7O F;  3LA3 A;  1JHH A;  1T0F A;  3DXJ F;  1MDM A;  1B9M A;  2ACJ A;  4OIP F;  3I4P A;  2CQK A;  2DPD A;  1FT9 A;  2VBX A;  3COA C;  2XAQ A;  4QWQ A;  4MHG A;  4E70 A;  4AD9 A;  4IHS A;  2FQ3 A;  2AS5 F;  3LAP A;  4MQV A;  5ED4 A;  1H9T A;  3CLO A;  3P9I A;  2K7L A;  3GEZ A;  1IXR C;  3G3Z A;  1ZG3 A;  2JPC A;  4HDU A;  1FPQ A;  2FEZ A;  2K02 A;  3NEU A;  1LB2 A;  2H94 A;  3KLO A;  4L9J A;  2DI3 A;  2ZME B;  2RC4 A;  2FOK A;  3C18 A;  4HOB A;  2O3F A;  3KP4 A;  5HVQ C;  1IUY A;  4UXN A;  5HOO A;  1KQ8 A;  3E97 A;  4RB1 A;  3VFZ A;  1KQ0 A;  3ZMD A;  5CVI A;  3F72 A;  1ZRF A;  2EFN A;  2F5C A;  4NHJ A;  3TKY A;  3VOD A;  5LGN A;  3R60 A;  2M30 A;  1O3T A;  1P2F A;  3Q5F A;  5F64 A;  1JE8 A;  2YPR A;  1XGO A;  3ULQ B;  4ESF A;  1EV7 A;  1MZB A;  2DAO A;  3O2P E;  3T0Y A;  2W85 A;  4EM0 B;  1J9I A;  1K79 A;  4EQQ A;  5HLG A;  3K1M A;  2H27 A;  2PMU A;  4XBF A;  2QQB A;  3I54 A;  2UXX A;  3GFL A;  2D1H A;  3CUQ A;  1SD6 A;  3WTY C;  2MLK A;  4M74 A;  1XCV A;  1ZRE A;  2EJR A;  3WGH A;  5JR3 A;  1OYI A;  3JW4 A;  3HRU A;  2FSW A;  3QRF F;  3BY6 A;  1IXS B;  1ZGA A;  2XIG A;  2DU9 A;  2HWV A;  4HF0 A;  1YW8 A;  1SFX A;  1V4R A;  3R6S A;  4HV6 A;  3RYR A;  1TTY A;  3T8R A;  4ZH4 F;  2HR3 A;  1DP7 P;  3QPT A;  4WK8 F;  2A6E F;  3KP6 A;  3KP5 A;  2ZXJ A;  2NS0 A;  3ZN0 A;  5D5V B;  2DBB A;  4AIK A;  5D6F A;  4UVB A;  2XAH A;  1L0O C;  2XVC A;  2GXB A;  2ISY A;  3EQL F;  1CF7 A;  1SMT A;  2HYF A;  2IA2 A;  5E1Z B;  3TO6 A;  3LQQ A;  3ABT A;  1S29 A;  2L4M A;  4UVA A;  5DV5 A;  3ERE D;  1B9N A;  4WXH A;  2H09 A;  3GYH X;  4OIN F;  2TDX A;  2O0Y A;  2HS5 A;  3KP7 A;  2LNB A;  4Z2Y A;  3P9K A;  2GAU A;  1ON1 A;  4HX8 A;  2KKO A;  2Y0M A;  2GXG A;  3P9C A;  1TBX A;  2ZNZ A;  1U5T C;  4ESJ A;  3MEX A;  5L3F A;  4IHT A;  5K1Y A;  4I98 B;  4XLP F;  2IP2 A;  4RB2 C;  2IT0 A;  1J0R A;  4M9S A;  4CHU A;  1FZP B;  2OZU A;  3H3Z A;  1UCR A;  1USS A;  2EFP A;  1D8J A;  3VOE A;  1FYM A;  3I59 A;  2NRA C;  2OAZ A;  3M7G A;  1MDM B;  3L09 A;  5FD6 A;  5FO5 A;  3WTZ A;  5FGM A;  4QLC U;  1IZ1 A;  5E20 A;  5L3E A;  1ZG1 A;  3JTG A;  2FNP A;  2QBY A;  2HKX A;  1BJA A;  1TQP A;  4S05 A;  1U78 A;  4KN4 X;  1R22 A;  5J8C A;  2O61 A;  1MD0 A;  4UV9 A;  4MTD A;  1QPM A;  1FBU A;  4OMZ A;  5HLI A;  2PN6 A;  3RDI A;  4KT5 C;  2BE5 F;  4CYD A;  4HA8 A;  1BI3 A;  2ZO4 A;  3C3W A;  5CYV A;  3TGN A;  4G7H F;  2Z5U A;  3RI4 A;  4BAY A;  4WX9 A;  3EET A;  1MKM A;  4EM2 A;  2A5Y B;  2Q8K A;  1HW1 A;  5D5X B;  2A61 A;  1BI1 A;  3K1P A;  2PEX A;  4KMU X;  2CWE A;  3F22 A;  2DFI A;  2G7H A;  2P5K A;  4HZF A;  4EM1 A;  4PZJ A;  2FU4 A;  3VB2 A;  5JI6 A;  3U1D A;  3GFJ A;  1TQM A;  4ON0 A;  3SZT A;  1YQA A;  3VEP A;  2KJC A;  1FYK A;  2NNY A;  4EGZ A;  1QO0 D;  4A5M A;  2BGC A;  1IN4 A;  1YYV A;  4RB0 A;  1ZAO A;  5HS8 A;  4N0B A;  4R1H A;  2FF4 A;  2E1N A;  2VC1 A;  5CJ9 A;  1IAW A;  2QYO A;  4A12 A;  2PI0 A;  2F5F A;  3KFW X;  1RZ4 A;  4MQ9 F;  4MNU A;  1KU9 A;  1AOY A;  1BBY A;  5L3G A;  4HW0 A;  3CUQ B;  1ZHF A;  3HSR A;  4BH9 A;  1KYZ A;  1FC3 A;  4ZYH A;  3FM5 A;  2FRH A;  1ZRD A;  2EWN A;  2HDC A;  4HF1 A;  5FD5 A;  3WTW C;  3BOQ A;  2Q0O A;  4P9F A;  1G6N A;  1MJ9 A;  2JRT A;  2KIF A;  2A3S A;  2K86 A;  1HST A;  4U7D A;  5A2Q Z;  3M1E A;  4KIB A;  2HOE A;  5FLX K;  3T1B A;  4PDK A;  5JFR A;  2DK8 A;  2H6C A;  2WC2 A;  4I0B A;  3QAH A;  4I2O A;  5ICG A;  1T38 A;  3K69 A;  3HIF A;  3MZY A;  4NB5 A;  4HLX A;  4MEY F;  2M1B A;  2JPB A;  4RAY A;  5E17 F;  1ONV A;  3BRO A;  4XSZ F;  4L5J A;  3TDU C;  2L54 A;  2GA2 A;  2LF8 A;  2ZCW A;  5H6Q A;  1CF7 B;  5BPD A;  3CO6 C;  1OYY A;  4ENN A;  2DTR A;  3F3X A;  4CDG A;  1D3Y A;  5ILS A;  3EYI A;  5TRD A;  3OOP A;  2HQR A;  5LGT A;  1R5G A;  2Z3Y A;  4U0V A;  2D1V A;  5K5O A;  2HZT A;  1QQI A;  4KA4 A;  3GZ5 A;  1W4M A;  1T39 A;  4A6D A;  2K4B A;  2W57 A;  1XGN A;  1OYW A;  4G8X A;  3R61 A;  1SD4 A;  4LLG F;  3V8L A;  5HDN A;  5KVR A;  3JSP A;  1TLH B;  3I58 A;  4GYI A;  2L02 A;  2OQG A;  3QP5 A;  3ZPL A;  3RYP A;  3V7C A;  3JAM Z;  1B1B A;  2V9V A;  3KEO A;  3I59 B;  4I09 A;  4LK0 F;  3J80 K;  5HS7 A;  3ZMU A;  3W6K B;  4PCQ A;  4HF2 A;  2EA4 A;  5L3C A;  2W24 A;  1XGS A;  2XV4 S;  2VON A;  4S04 A;  2CGP A;  4L9N A;  2QBY B;  2A6H F;  4IXA A;  2BV6 A;  2Q2E A;  4OOI A;  4KFC A;  1J7K A;  3IKV A;  1DDN A;  1VTN C;  1YTY A;  1DPR A;  3MFK A;  3K0L A;  4ENJ A;  2RGV A;  3FHZ A;  3GZ6 A;  1XSD A;  1SD7 A;  2ESN A;  2UZK A;  3DQV C;  1W7P B;  2FNA A;  3R4K A;  4CIC A;  2YX4 A;  3O3K A;  2E1C A;  1E2X A;  5DUI A;  3BPV A;  2YX7 A;  3MCZ A; 
#chains in the Genus database with same CATH topology
 2TCT A;  1T98 A;  1J59 A;  2W4S A;  3K4J A;  2ZME C;  3V8J A;  4XKC A;  3KEY A;  2JN6 A;  3SYT A;  3GTJ J;  1M1E B;  3SHF A;  3DPL C;  2EZL A;  4BKX A;  2MAB A;  2XGX A;  1U2W A;  4LLL A;  3GF2 A;  1JI8 A;  2DYR H;  1QZZ A;  3HHH A;  1FJL A;  3CJN A;  2O9L A;  1T56 A;  1HW2 A;  2O5R A;  2V26 A;  2K9S A;  3TW6 A;  5CVJ A;  1BC8 C;  5FFX A;  3JRB A;  5J6X A;  3RZO J;  3QOE A;  2AQF A;  3S2W A;  1YX3 A;  3WGG A;  2RQQ A;  3D5L A;  2P6T A;  3KIO A;  2J5O A;  2XHK A;  4V2G A;  3KZZ A;  2DT5 A;  2LSO A;  3FWE A;  3ZR8 X;  3VDX A;  5F1R A;  1S9H A;  2V1N A;  4NC8 A;  1D0X A;  4RGR A;  1BIA A;  1HLV A;  2EIM H;  4I02 A;  2PMH A;  3M9A A;  2RNJ A;  3A02 A;  3L00 A;  2CUJ A;  1NHA A;  2HNH A;  1VQ8 I;  1FMV A;  5IP7 J;  5GPC A;  4M9X A;  4Y52 J;  3K4N A;  5HLT A;  3M07 A;  2ZJP F;  1UMQ A;  2KJB A;  1V3F A;  1IN5 A;  3PQK A;  5J3L A;  4QIW N;  3K10 A;  3WE2 A;  1OQY A;  2F5E A;  1SVM A;  3WU2 C;  3ZQF A;  2HVR A;  4A2U A;  2LDU A;  1Y1V J;  4F55 A;  5LGU A;  2DDA A;  3FX3 A;  1TW2 A;  4L9T A;  1HKS A;  3I4M J;  3WHB A;  2QM3 A;  3AG2 H;  1SAU A;  4Y17 A;  2GZW A;  5DD4 A;  3DF8 A;  5F0C A;  2VOO A;  1JT0 A;  4JK1 X;  1QVU A;  1S7A A;  1DPU A;  2QF7 A;  2HGC A;  3OIQ A;  2CQ7 A;  3TQN A;  1XB4 A;  4EJO A;  4CZZ A;  1JXS A;  1WFX A;  1K6O A;  1Y8Q B;  3DWL E;  2A68 F;  2R7D A;  2CW0 F;  3QPH A;  5M3M J;  2MC3 A;  4BL0 B;  5EZG A;  1YI2 I;  4JOM A;  3BQY A;  2KL4 A;  3AKZ A;  4M3G A;  1WKM A;  4FX4 A;  1LVK A;  2P5L C;  3RIR A;  3RKX A;  1GUU A;  4CA0 A;  3HOX J;  2PJR B;  3C2H A;  5ILU A;  4BQA A;  3K4C A;  4Y4R A;  2CUZ A;  3Q9V A;  4LIU A;  4IHW A;  2LBF B;  3DPU A;  1TL8 A;  1VQ6 I;  5GPA A;  3CZ6 A;  3QP6 A;  1RPW A;  2BHZ A;  3SEQ A;  4A3E J;  1L3L A;  1QRY A;  3QPL A;  1R1V A;  4XOR A;  5K7F A;  3RPQ A;  3OIP A;  1KON A;  1W5T A;  3ZMS A;  1IUF A;  2BXY A;  3GLX A;  1LKX A;  1KA8 A;  1XMA A;  1XSX A;  4JQF A;  3W3C A;  1H8A C;  5FRM A;  2OF7 A;  1WWX A;  1GLN A;  2CS3 A;  3HSE A;  4ZDL A;  4ZJZ A;  1WPK A;  3PNT A;  3G71 I;  4YFX F;  2FUG 2;  4V2F A;  4FT8 A;  2BYV E;  2XB5 A;  2BY2 A;  2VBZ A;  3TP3 A;  2IS4 A;  2KIQ A;  4RBO A;  4XM3 A;  1IRX A;  4OMY A;  4X0G A;  5F27 A;  5C4J J;  5FFZ A;  4GGG A;  3OYD A;  4BQO A;  1LFB A;  3U1K A;  2RRE A;  5AIQ A;  5FJ8 J;  3ECH A;  3KEQ A;  4LMY A;  5HOD A;  1T2K A;  3DKY A;  4IVN A;  4B3A A;  2LRE A;  3CUO A;  4KYW A;  4HEA 2;  1DUX C;  4HNT A;  1MH3 A;  2W48 A;  4PSW A;  3OS1 A;  1SMY F;  5DYM A;  1SVO A;  1Z6R A;  4BEH B;  1ORK A;  4C3J J;  1QPI A;  3GTG J;  4Z6Y A;  1H89 C;  2QKL B;  4YIF A;  2GA1 A;  2M2E A;  5LEK A;  1UST A;  3NWS A;  5K7Z A;  1Z1D A;  3BZ6 A;  5HDG A;  3SZP A;  2STW A;  4IHV A;  1IRG A;  4R8H A;  3ZQH A;  1XCB A;  5CQE A;  2XPW A;  5CVR A;  2E2I J;  2HKO A;  1XD7 A;  2B9S A;  4M6X A;  3P5J A;  2L7K A;  3HRS A;  3TBI A;  3JRC A;  1J2X A;  1VQ5 I;  2OD5 A;  2X6O A;  2ELH A;  1WJ5 A;  2MGQ A;  1X19 A;  3DEW A;  2ETH A;  1LPQ A;  1SAX A;  2RAE A;  2OQR A;  1Z0X A;  1A35 A;  2IGK A;  4HYE A;  3W2V A;  1V5E A;  4C2U A;  2L7F P;  1HXD A;  1W0T A;  1W5C C;  4PJL A;  3EUH C;  1LVA A;  1O3R A;  4XQF A;  1W7P D;  1R5I D;  4BHP A;  4OAZ A;  3KP2 A;  2R92 J;  1O3Q A;  2DA1 A;  2ZXH A;  3K7A J;  4U88 A;  2ELK A;  1R1U A;  5DCF A;  4CCM A;  3MVP A;  2NOG A;  3K9T A;  5E1X A;  5LHG A;  3BDD A;  3EUK L;  4N4O B;  5FKN A;  2OJE D;  1UHW A;  4Y13 A;  1Z3X A;  5L3B A;  1YRN A;  1MNM C;  4CSW A;  2CG4 A;  1DU6 A;  1FIP A;  2X85 A;  5JVT A;  4DGW B;  3HZJ A;  2M87 A;  4UNO A;  2CQX A;  3H5N A;  3PFI A;  4A6E A;  1A5J A;  3K2A A;  1JKO C;  2Q2E B;  4EJW A;  5DDG A;  4Q4Z F;  1UHM A;  1F9N A;  2PJP A;  1ZRC A;  2R7W A;  1T0F C;  2E34 A;  2Y48 A;  2GXA A;  2KDZ A;  3VYS B;  2EIN H;  3Q3S A;  3RCO A;  3KET A;  1IC8 A;  2VBY A;  3RPU A;  5IT3 A;  2C6Y A;  1E17 A;  3ESW B;  3PJR A;  2QUF A;  5BQT A;  1K78 B;  1ZK8 A;  1P4A A;  2J5P A;  4E7J A;  1S7O A;  1WJE A;  2P5V A;  3D5R C;  4L5I A;  4UUS A;  1BI0 A;  4HDV A;  2DK5 A;  3WU0 A;  1OCZ H;  1P7I A;  2XC7 A;  1LDJ A;  1B4A A;  1FP2 A;  1SC7 A;  1I1G A;  4G6Q A;  2DYS H;  2E1M C;  4W1U A;  1K83 J;  1RI7 A;  5EGO B;  2QWW A;  2VAS A;  5HS9 A;  1ZR2 A;  1YJN I;  3K4B A;  1S7E A;  1R71 A;  2HXO A;  5IP6 A;  1IRF A;  3WTU C;  2OZ6 A;  1RR8 C;  5EEH A;  3S15 J;  3AG3 H;  1Y56 A;  2DFE A;  1PYV A;  4B47 A;  4U87 A;  3O8G A;  4L18 B;  3IP4 B;  4AWX B;  1U8R A;  2PMZ A;  2UWM A;  4NQW A;  3V7S A;  3GX4 X;  3F8B A;  1FSE A;  3SDB A;  3REO A;  3JSO A;  2ME6 A;  4BHB A;  2VL8 A;  4ZZL A;  3LMM A;  1WHU A;  2FQ4 A;  1JTY A;  2DA7 A;  1E3O C;  1BIB A;  1A6I A;  4MFD A;  1GXQ A;  1V5G A;  3CCY A;  1HBX G;  1ULY A;  3T8T A;  2IEK A;  3ABU A;  1U5T B;  2BW3 B;  3ROU A;  5H20 A;  2DOA A;  1OLT A;  3A01 A;  3RQI A;  2F4I A;  2EFQ A;  5J8F A;  1XPX A;  3FK7 A;  2MLG A;  5E3M A;  3ZMT A;  2PLY A;  3C1D A;  2W1O A;  3CCV I;  3ERM A;  3HC7 A;  1UZC A;  2YS9 A;  4P5O A;  2F4O B;  4A3G J;  4DYR A;  4LG3 A;  2HEO A;  4N4N B;  4UVC A;  3HTS B;  2OA4 A;  4RAF A;  4ASN A;  3L2U A;  1D1A A;  4JBA A;  1PP8 F;  3A0B C;  2LTP A;  1W7P A;  3M4O J;  3UNG C;  2IS2 A;  1SFK A;  2XF5 A;  3ZXS A;  4M9Z A;  2P4W A;  3V42 A;  3CME I;  2KRC A;  4EEF G;  1RRJ A;  2BVL A;  2CUE A;  3I53 A;  3OV8 A;  2M8E A;  4M3F A;  2DQR A;  1BR2 A;  5LHH A;  1O3S A;  1VQ4 I;  2K3F A;  2L0K A;  2R5Z B;  4BHC A;  1EH8 A;  4UHT A;  1FP1 D;  1O7F A;  2ECC A;  1LQ1 A;  3F8N A;  2GBY A;  4AYB N;  2FA5 A;  2R7Z J;  3N97 A;  3E6B A;  3HKZ N;  4ESB A;  1LEA A;  2G7U A;  2RKH A;  1HKQ A;  3S93 A;  3BG5 A;  2DCE A;  3EYY A;  3OR2 C;  3BJ6 A;  4ABZ A;  5AON A;  3CUQ C;  3C2B A;  2QVO A;  4XOP A;  3FXJ A;  3R0A A;  3BQZ A;  3J81 Z;  1VF9 A;  4E7S A;  3DPT A;  2ZFU A;  1D5V A;  2MH2 A;  1YX5 A;  2DQL A;  1ON2 A;  1RKW A;  2O7O A;  1SD5 A;  3GFI A;  3TO9 A;  3TW7 A;  2PBI A;  2ZJ2 A;  4HRI A;  5M3F J;  4HX7 A;  2W25 A;  1JHF A;  5ILV A;  2IA1 A;  3PNY A;  5TGT A;  1BJZ A;  2XAJ A;  4IF4 A;  4XLH A;  2HYJ A;  1X1P A;  1IRZ A;  2DTZ A;  3IAS 2;  1LJ9 A;  3FXQ A;  4XKV A;  1UG2 A;  2EZH A;  5E8G A;  3MKW B;  2LYC A;  5ERI A;  3DU6 A;  5EG0 B;  2HPM A;  1REP C;  3KLN A;  4IOA F;  2JA6 J;  3LQR A;  1LUJ B;  2LKP A;  1GDT A;  2DN0 A;  1LFP A;  5BPI A;  1NK2 P;  5F04 A;  4WF2 A;  2FML A;  3WU1 B;  3ZMV A;  5IYB J;  2XKP A;  3GO5 A;  2XKO A;  3W2W A;  2DLL A;  2EK5 A;  2VQG A;  3FMQ A;  4BXF A;  1D0Y A;  3N4M A;  3K6G A;  4BDY A;  4LB6 B;  2VKD A;  3H5A A;  1DGR M;  3OYK A;  3GME A;  4I7H A;  2NVQ J;  5L3D A;  4RGX A;  2DW4 A;  2K85 A;  4EJV A;  3L2Q A;  1Y39 A;  1X3W B;  4EMS A;  3HTU A;  2R7V A;  1N75 A;  3H92 A;  5DTD A;  2CH0 A;  3CD6 I;  3D1N I;  3TDZ C;  3DFG A;  5CVV A;  1OR7 A;  4HLY A;  4C9Y A;  3L9F A;  4PJN A;  4S0H B;  3CJR B;  2M9H A;  3Q9S A;  2HVS A;  3L2V A;  5LD2 C;  4G9Y A;  4BJ6 C;  3IH2 A;  3DLA A;  4A5N A;  1VQL I;  1S8N A;  1I6X A;  4PJJ A;  2MA3 A;  1YLF A;  3C7J A;  1GT0 C;  1MMA A;  2WAD A;  1W5S A;  3F8M A;  2HDW A;  2ADU A;  2BVM A;  1KU7 A;  1FWZ A;  3H3U A;  3X2Q H;  1IGN A;  2IS6 A;  2R7X A;  1R49 A;  3IC7 A;  1V5F A;  1QZY A;  1X4P A;  2VIX A;  3IL2 A;  4P9U A;  2LY1 A;  1FOW A;  4EGY A;  3OYM A;  2O6G E;  5F08 A;  1FTZ A;  3PSI A;  1TW3 A;  2VXZ A;  1JKP C;  2ICW G;  3LSP A;  3DCF A;  1Y8R B;  5HNH A;  3GTM J;  4DYC A;  3NQO A;  4BBR J;  1FSH A;  4HQE A;  1WJF A;  3A03 A;  4DQ2 A;  2X0L A;  2KZG A;  1FNN A;  2CW8 A;  3HOZ J;  1BA5 A;  4PSX A;  4B3X A;  1RNL A;  4C2M J;  1H9G A;  4OWR B;  5GAH J;  3CP2 A;  4KIG A;  1PUF A;  3ZMZ A;  2D45 A;  1EF4 A;  3DEU A;  1B6A A;  1H0M A;  3BR3 A;  1I1S A;  2IW5 A;  3WTS C;  5IP9 J;  4WWC A;  2GIV A;  2ZNY A;  4XKW A;  4E7Z A;  1ZLJ A;  2AXL A;  1ZYR F;  5F6F A;  4RLQ A;  1BI2 A;  5KAI C;  1ETK A;  3D0S A;  2MD5 A;  2H6B A;  2RDP A;  5IOZ A;  3AAF A;  4ZTJ A;  4KT6 A;  2K4J A;  4BEH A;  4XNF A;  1MBE A;  4IRG A;  2LMD A;  1KGS A;  3GVA A;  1YJW I;  2F5D A;  1TNS A;  4ENM A;  1WJD A;  1AKH B;  2DPU A;  2K40 A;  3S17 J;  2KDO A;  2M3A A;  1MJB A;  3F8F A;  4NBQ A;  4RA2 A;  2BBY A;  2JWT A;  2FBK A;  1OJL A;  2Y0S N;  2VE9 A;  2PX9 A;  2V6E A;  3WTX C;  4YII A;  4GXO A;  1WH7 A;  3K70 D;  2K3P A;  4UUT A;  3CCU I;  2XAS A;  4EJT A;  1OKR A;  3TOB A;  4UUS B;  4KDP A;  3NAR A;  4OAY A;  2WTE A;  2VKH A;  2Z33 A;  2HTJ A;  3CJT B;  5LHI A;  1U0J A;  2LC2 A;  2RV8 A;  2KIS A;  1WZ2 A;  2FBI A;  2X9D A;  3MQ0 A;  5JHF A;  3E3V A;  2FJ1 A;  2G0E A;  2V79 A;  3LSI A;  4BY1 J;  1T95 A;  2XAG A;  2XSJ C;  3O6B B;  1PDN C;  2KQR A;  2LF7 A;  6PAX A;  4PGG A;  2IRF G;  4P55 A;  1Z7U A;  4XRF A;  3J7A O;  5K7H A;  4MTE A;  1RUN A;  3B73 A;  1VI0 A;  4D1Q A;  2M8G X;  3OYA A;  2JUG A;  4XN3 A;  2E36 A;  1QU3 A;  3PIP F;  3RKY A;  3VWB A;  3IH3 A;  3M8E A;  1F43 A;  1A6Q A;  2LP0 A;  3IWF A;  5LBQ A;  1EH7 A;  2VB6 A;  2FOW A;  5DM6 F;  2MW8 A;  1O57 A;  2ESH A;  5BMZ A;  1LFU P;  3NAU A;  1DU0 A;  2KHM A;  4BQQ A;  1YG2 A;  3KZY A;  3ZQ7 A;  2MC4 A;  2QQA A;  4FHT A;  3PQJ A;  4R79 A;  3A01 B;  1K78 A;  1C0W A;  4ZYA A;  1VQO I;  2NVT J;  4DZP A;  2DMQ A;  5CPR B;  1ZLK A;  1QNT A;  4LB5 A;  4LK1 F;  5J40 A;  2VJ5 A;  2Y75 A;  4C3I J;  3HOT A;  2LD5 A;  3H9Q A;  2IA0 A;  3RTR A;  2XAF A;  1R6R A;  4Q47 A;  3IAM 2;  1BN5 A;  4FE4 A;  3BCB A;  5DEQ A;  3Q0V A;  2ZJR F;  2XRN A;  2EIJ H;  2K27 A;  2V6C A;  1XTA A;  3Q0U A;  4QPO A;  4A3K J;  1BC7 C;  4M6Y A;  2NXN B;  2ELJ A;  1G4D A;  1BW5 A;  4IRI A;  3QWL A;  3OS2 A;  2KRF A;  3OYB A;  2HQ5 A;  4A93 J;  1WVR A;  2EV6 A;  3HBL A;  4V19 K;  2E19 A;  3CCM I;  1OIS A;  5JVG F;  3TED A;  1YOV B;  1U9O A;  1XMX A;  2D5V A;  3BP8 A;  2L2O A;  1OCC H;  1YW7 A;  2X4H A;  2HZD A;  5A2Q K;  3OYN A;  4YFK F;  1WQ2 A;  3LA2 A;  5FB2 A;  3E7L A;  1U5T A;  3H9G A;  2BW3 A;  2G9W A;  3K4K A;  3GWZ A;  1SVL A;  2ZSH B;  1YS6 A;  2E60 A;  2PG4 A;  5IOY A;  2EFO A;  2NNN A;  4DBR A;  3U21 A;  1KU3 A;  1IN8 A;  2M5W A;  2EZI A;  2KIM A;  2COB A;  4XMY A;  4D0P A;  1T33 A;  2E71 A;  2X1D A;  3LSJ A;  4D5C A;  3FF5 A;  1ITY A;  2ME0 A;  3LFK A;  2VPL A;  1BM9 A;  4ZYD A;  1PP7 U;  4L0Z B;  4FAS D;  3V4G A;  1MH4 A;  2R7R A;  4BDZ A;  2IAI A;  4HV5 A;  1U3E M;  3LNQ A;  3K4M A;  3H35 A;  2R5Z A;  1KYW A;  4KIS A;  1FIA A;  2CJJ A;  4RGS A;  2JA8 J;  3GTP J;  5LRR A;  2JSC A;  1MJA A;  1I50 J;  4F92 B;  4M73 A;  3I3L A;  3G73 A;  4D7N A;  2P7C B;  3DP7 A;  3WG9 A;  3HL2 A;  4ZYG A;  4GCV A;  4OIR F;  1Z6T A;  2P7V B;  4ZZD A;  4L0Y B;  3S8P A;  4F52 A;  3WE3 A;  2CQN A;  4B09 A;  3HRM A;  4HSR A;  1VZ0 A;  1MBJ A;  1QZE A;  1I39 A;  5DCM A;  4Q5S F;  3M1C A;  1Z3Y A;  1HDD C;  2ZBK A;  1Z67 A;  4BE2 A;  2LK2 A;  3H9J A;  3A0H C;  2R7F A;  3K4L A;  2QEN A;  1XMK A;  4LGW A;  4IZZ A;  1D8K A;  1UJ8 A;  1DP3 A;  3O8H A;  1MIJ A;  1I27 A;  1S5L C;  1TWC J;  2WY8 Q;  1ETQ A;  2CYY A;  5EG0 A;  3GZN B;  3C2G A;  2LOO A;  2QSF X;  1FLI A;  1OCP A;  1B72 A;  1G3T A;  1G2H A;  2XDV A;  2WAF A;  2DJN A;  4CXF A;  2JZY A;  2JSP A;  4U0Y A;  2EA2 A;  3F8C A;  3RPU D;  3JAM K;  1YE9 A;  5DD8 A;  2ZJQ F;  3I71 A;  2CMP A;  3G1L A;  3BWG A;  5J47 A;  4EJU A;  4KIC A;  2FBH A;  1GHC A;  4ENK A;  3BJA A;  5E1W A;  3I55 I;  1EKE A;  3DV8 A;  3E6D A;  4RM2 A;  5D8L B;  4ETS A;  1TWG J;  2VQH A;  4U7B A;  2DA6 A;  1PUF B;  2VI6 A;  4XSX F;  4UUV A;  2Y69 H;  5FKL A;  3IH4 A;  4G7Z F;  1W36 C;  1R1T A;  4B4C A;  3CO7 C;  3SQN A;  5LRS A;  4I0A A;  1RUO A;  1TNT A;  1NG7 A;  2UUZ A;  4HX4 A;  2L4A A;  1F4K A;  1B8I A;  5J1Y A;  4G6D A;  1EH6 A;  4PJM A;  3PFY A;  1WI9 A;  3FIW A;  4MGR A;  5BS6 A;  4HPQ A;  1P4W A;  3E6M A;  3ECO A;  2X48 A;  3HG9 A;  4RAG A;  1LEB A;  1MBH A;  5B66 C;  3N05 A;  2YU3 A;  4M71 A;  4BXU A;  3AFH A;  1WJB A;  2CU7 A;  4NC6 A;  1R58 A;  5H2F C;  2CO5 A;  4WXD A;  3IWZ A;  1G3S A;  2R3S A;  3IHU A;  4LG0 A;  2W7N A;  2E7X A;  2ZB9 A;  3DKX A;  2IGN A;  1A36 A;  2LVS A;  2VJJ A;  2P8T A;  4MLO A;  1PJR A;  3KP3 A;  3H3V K;  3FXR A;  1O7L A;  2EQR A;  2MBF A;  3F6V A;  1OCR H;  3PSF A;  2GIZ A;  1ZTR A;  3AG4 H;  5D5U B;  1RIO H;  3QOP A;  3JRD A;  3F6O A;  1BR4 A;  4M3B A;  3F0C A;  2FXA A;  4O5V A;  2HOT A;  2W00 A;  1N78 A;  5KK1 A;  3DBR B;  3HOV J;  1I3Q J;  3I0T A;  1YW9 A;  1D5Y A;  1BOA A;  4IJA A;  3SZG A;  5GAG J;  2L7Z A;  3BR0 A;  1X1B A;  3FBN B;  2L3D A;  2R4G A;  5BOX A;  1Q1H A;  4RS8 A;  2CFX A;  2GLO A;  3FDY A;  3E5U A;  2ZC2 A;  4A0Y A;  3G4S I;  3S1N J;  4KN7 X;  2HU9 A;  5ICC A;  1IG7 A;  5D8K B;  1G8X A;  3B02 A;  1YHQ I;  4G94 A;  3OYL A;  2YU9 J;  1AKH A;  2M45 A;  4CCN A;  1LDK B;  1IN6 A;  3NRV A;  3QYB A;  2H1K A;  1Z05 A;  4C30 A;  3VYU B;  2R7U A;  1U6G A;  1FX7 A;  2QZ8 A;  2ZFW A;  4OU0 A;  4ZTF A;  2HFH A;  1J75 A;  5E8I A;  3ZCO A;  1K61 A;  4AIJ A;  2LKX A;  2IBD A;  1P92 A;  2E5N A;  2GQQ A;  4DNC A;  2IVM A;  3FKJ A;  3AL0 C;  1R23 A;  4JX5 A;  1FOX A;  5FLX Z;  1A31 A;  3SFZ A;  1NTC A;  4HQM A;  2VQC A;  4CZC A;  1ENH A;  4O6J A;  3RQ4 A;  1J5Y A;  3FZV A;  4F93 B;  5TJJ A;  4XRM A;  1OMI A;  4XKB A;  3DEE A;  2O03 A;  5IYC J;  4CGZ A;  2A6T A;  3LA7 A;  2HOS A;  1WSU A;  2WY7 Q;  4DOZ A;  4MFE A;  4I01 A;  2VBW A;  3F23 A;  3KE2 A;  3E6C C;  1HQC A;  1XDS A;  1O4X A;  5D6E A;  2VT3 A;  4N9I A;  5KHD A;  5EEA A;  3U9G A;  2B0L A;  3FMS A;  1K7A A;  3M8F A;  1F1Z A;  2OCC H;  3GW2 A;  4BBS J;  3HKZ A;  4G6T B;  3SDG A;  1I6H J;  4BXX J;  1AA7 A;  4M72 A;  5C4X J;  2MFZ A;  4I76 A;  1S6L A;  1Z91 A;  2FE3 A;  1ACI A;  2O8X A;  1J09 A;  5FKM A;  1RR7 A;  5IT9 Z;  4CCO A;  1WRJ A;  3E5X A;  2EV0 A;  5D5W B;  1PVE A;  2A69 F;  1Z9C A;  2CSO A;  2WA0 A;  1CGP A;  1I5Z A;  2M0M A;  5IPA A;  4XLN F;  1X1C A;  3TOA A;  4EV0 A;  4TV7 A;  2WV0 A;  4PK4 A;  1UAA A;  2ZKZ A;  4IRH A;  4FX0 A;  3PNV A;  5CLS A;  4GO1 A;  5GAD J;  2V1X A;  3J7A Y;  4RLF A;  2EFW A;  1UHS A;  2VOD A;  4DZJ A;  3ABL H;  3CCR I;  4XRS A;  3DKW A;  4H4K C;  5E18 F;  1IDZ A;  3HUG A;  1F5T A;  2V4J C;  3L2C A;  4M3D A;  2HOA A;  2DT6 A;  2K9N A;  5JLX A;  2PFB A;  3I64 A;  3R0J A;  3GFM A;  2MD0 A;  4XK4 A;  2WAE A;  2F6C A;  3HXL A;  2QGU A;  2IPQ X;  3BTJ A;  1XN7 A;  4P96 A;  1ZH5 A;  3MAJ A;  4U0W A;  4A0X A;  1YFH A;  2RN7 A;  4ZC3 A;  3WGI A;  2V1D A;  5DM7 F;  1ZG5 A;  4A3D J;  1TC3 C;  1ODD A;  4A3J J;  2L9S A;  4OIQ F;  2QQ9 A;  2L01 A;  2VN2 A;  2X1E A;  2CRG A;  1R7J A;  2V7F A;  3RKW A;  3CP8 A;  5DCM B;  3BT9 A;  1S3J A;  3ELK A;  4GYG A;  4F3Q A;  2EZK A;  4IPA A;  3J80 Z;  4BYY A;  2E35 A;  1P6R A;  1KZH A;  3JRF A;  3LAJ A;  3ISP A;  2OU2 A;  5D4S A;  3MZH A;  3P7N A;  5FRO A;  1FBS A;  4UB8 C;  4ZYE A;  3OL3 A;  3VPR A;  1YS7 A;  3FXU A;  4IO9 F;  5LLQ A;  1Y0U A;  3H36 A;  4HAM A;  1R5H A;  3KPH A;  2VE8 A;  3FM3 A;  2F2E A;  5KCM A;  1B72 B;  3FMR A;  4Y15 A;  3S1Q J;  1HKT A;  4MIM A;  4E7L A;  4DBQ A;  2KZV A;  1MGT A;  1IN7 A;  3MWM A;  1ZAR A;  2Z2S B;  2V1U A;  3LSG A;  2EV5 A;  3WTV C;  4K2E A;  1ETX A;  5LEJ A;  1TP4 A;  2MH9 A;  2WB1 N;  1TZL A;  1HSJ A;  4XLC A;  5EZH A;  1XGM A;  2ZME A;  2YUS A;  4KNY A;  4ZDP A;  1SFU A;  3EDP A;  4XRS G;  5JHU A;  2R5Y A;  4IHY A;  1MW7 A;  2VT2 A;  1YO5 C;  3ONQ A;  4AIH A;  2M0C A;  4YFN F;  1QBJ A;  1FY7 A;  3BJO A;  2EB7 A;  3BR5 A;  3HB9 A;  1LDD A;  1R36 A;  1U9N A;  3BTC A;  4KUM A;  2CV0 A;  3E5Q A;  2M7A A;  2VQL A;  4O3M A;  1ZGJ A;  5B3S H;  2Z9O A;  4LD5 A;  1MMN A;  2UXN A;  3LST A;  2QLZ A;  3WOD F;  2VLA A;  2R7T A;  2VJI A;  3HOS A;  3VSK A;  1FBQ A;  5H6R A;  1IO2 A;  3BR2 A;  4B43 A;  3PO3 J;  1D1B A;  3DBL B;  3IV5 A;  3OY9 A;  1Z21 A;  1MMG A;  2JA2 A;  4FTH A;  1B8I B;  3OYF A;  3QU3 A;  4N9H A;  2DMU A;  2R7Q A;  1R00 A;  1GXP A;  3H0D A;  4LJZ F;  3ABM H;  1P4X A;  3S2D J;  2MSY A;  5GP9 A;  1YIO A;  1STZ A;  2M7B A;  3OYG A;  5AIP A;  4LIV A;  3V7R A;  3G1M A;  3BCA A;  2QQ8 A;  1Y6I A;  2BEO A;  4AVP A;  5CQG A;  4BGD A;  2RNG A;  1ZR4 A;  5DUK A;  1XS9 A;  4LG0 B;  2VC0 A;  4M6V A;  1HCR A;  2Y0S A;  1RKT A;  2R0Q C;  3HGG A;  1UFM A;  4J19 A;  4YG2 F;  4RDU A;  1UB9 A;  1CQT A;  2GM4 A;  1TWA J;  3TO7 A;  4II3 A;  2DOE A;  3F21 A;  2DOD A;  4UY8 I;  3LWF A;  3CC2 I;  4WCG A;  2FMY A;  3HRT A;  3W6J B;  4RAZ A;  1BL0 A;  2Z99 A;  1MBF A;  1KQ9 A;  2YSR A;  4IHX A;  5M5Y J;  3CCQ I;  1S72 I;  4KIF A;  2GWR A;  1VQ7 I;  3ZN1 A;  2CUF A;  2OCE A;  5M5W J;  4IL6 C;  1A04 A;  2W84 A;  4KMF A;  2HTS A;  3KYC B;  2DFH A;  3PUF A;  3HSF A;  4OIO F;  4UV8 A;  2ID6 A;  2LH9 A;  4AVZ A;  1MSE C;  2QA4 I;  2JTV A;  1AHD P;  3MZ8 A;  4M3E A;  4RGU A;  4J01 A;  5HDK A;  3LSK A;  4LFU A;  5IT9 K;  3S32 A;  1OPC A;  5E3N A;  2STT A;  1TWF J;  3OYJ A;  1TWH J;  1MBG A;  1XDU A;  2OBP A;  5DS9 A;  2XRL A;  3FHN A;  3IRR A;  3FKI J;  4FCY A;  2COM A;  4CO8 A;  2R7S A;  2IJL A;  1PUE E;  2KRH A;  2XUB A;  2NAZ A;  5CKT A;  5C3E J;  3KCC A;  5EEG A;  3WG7 H;  4EVI A;  4DIQ A;  1DGW Y;  5M5X J;  4CCJ A;  2DO7 A;  2ISZ A;  3GCM A;  1N77 A;  2JA5 J;  5EJC A;  4E7I A;  4MEX F;  1POG A;  3OSF A;  1VQ9 I;  2DT7 B;  1ETY A;  4H0E A;  4E7K A;  1OCT C;  1B59 A;  3CTA A;  3GXO A;  1QVT A;  3HEF A;  4HBL A;  2FD5 A;  4RM3 A;  4DYQ A;  4A0Z A;  2NVU B;  5D4R A;  2Z16 A;  4BAC A;  2DXI A;  1ZGW A;  1IXC A;  2HYG D;  1D1C A;  3ZP5 A;  2CW7 A;  1HW5 A;  3CCE I;  1IF1 A;  2XF6 A;  3V8K A;  1IW7 F;  4KIT B;  1JT6 A;  4AU7 A;  1AWC A;  1W0U A;  5K5R A;  3DBH B;  9ANT A;  2X6W A;  2YR2 A;  1TQI A;  5ICF A;  3DU5 A;  3L7W A;  4WXC A;  1FYL A;  5E79 C;  4YRV A;  3ZQG A;  4RB3 C;  2KP6 A;  4BNC A;  3J81 K;  3BG3 A;  2XGC A;  5HLH A;  3AG1 H;  4UB6 C;  4HNU A;  1JGS A;  1XSV A;  1ZN2 A;  3BPX A;  1LNW A;  5ICE A;  2XGD A;  5J4V A;  4PGH A;  1Z7L A;  3U2R A;  2B63 J;  3BLY A;  4NUB A;  3HHG A;  2HXI A;  1HC8 A;  3I5U A;  2KIU A;  3GTO J;  5C44 J;  1JGG A;  1MNE A;  2JJ7 A;  2RVC A;  2XB0 X;  3CF2 A;  3GUD A;  3OMY A;  1FOK A;  4E7H A;  2QKM B;  1X1A A;  2L7M P;  1X3U A;  4B8X A;  2RQP A;  1UG0 A;  1V54 H;  1SFE A;  3RJP A;  5FLV A;  5CVU A;  3QU6 A;  4IEJ A;  3T5X A;  1GV2 A;  4YEL A;  1G3W A;  2L5Q A;  2E7W A;  3HYI A;  1E3H A;  3F9K A;  5FKO A;  1KU2 A;  3JTH A;  1G3Y A;  1GVJ A;  3CDH A;  2DA5 A;  3H1C A;  2HQN A;  2PQ8 A;  3K2Z A;  5J1R A;  3CES A;  1JJ8 C;  2A07 F;  3EUH A;  3ML6 A;  3IKT A;  4PFP A;  2NOJ B;  5K5Q A;  3CC7 I;  2M34 A;  3K1N A;  2XRO A;  4F7Z A;  4XON A;  4Q48 A;  2OPT A;  3HUG B;  2P6S A;  2TRT A;  3HJE A;  1QGP A;  3PM1 A;  2DA4 A;  4L9V A;  3WTT C;  1DQU A;  1VQN I;  3CCL I;  3G1O A;  3JRI A;  3SXY A;  3IRQ A;  3CC4 I;  2JT1 A;  2X6Y A;  4XID A;  1T6S A;  2VOP A;  2D2W A;  4X1E A;  1UEL B;  2NYX A;  2WWY A;  4LLN A;  3OYH A;  3HOU J;  2A5W A;  4G7O F;  3LA3 A;  3LFU A;  1JHH A;  2MG4 A;  2EPF A;  2GOX B;  4XR6 A;  5EYR A;  1T0F A;  3DXJ F;  3M8J A;  5F0H A;  4BE1 A;  1MDM A;  1GV5 A;  4XN0 A;  3I4N J;  1B9M A;  3LL7 A;  3KYD B;  4JX6 A;  2ACJ A;  4OIP F;  3I4P A;  2CQK A;  2VXD A;  2DPD A;  1FT9 A;  2VBX A;  3J7Z I;  2A05 A;  4P1W A;  3COA C;  2XAQ A;  4YIR X;  4A3B J;  4QWQ A;  4MHG A;  2E5Z A;  4I99 C;  4E70 A;  2LFB A;  4AD9 A;  4IHS A;  2FQ3 A;  4BS9 A;  2OTJ I;  1OR7 C;  4F91 B;  1JE8 A;  2AS5 F;  3LAP A;  4MQV A;  2AXT C;  2WAQ N;  5ED4 A;  1D0Z A;  2OC6 A;  3OL4 A;  1H9T A;  2HDD A;  3CLO A;  3P9I A;  2DJI A;  2K7L A;  3S1R J;  3GEZ A;  1IXR C;  3G3Z A;  1ZG3 A;  2E2J J;  3S3N A;  2JPC A;  4HDU A;  2M4G A;  1FPQ A;  2FEZ A;  2K02 A;  3NEU A;  4E6K G;  2H94 A;  1LB2 A;  3KLO A;  1FOY A;  4L9J A;  2DI3 A;  2HI3 A;  2ZME B;  2RC4 A;  4GFB A;  2FOK A;  2R5Y B;  3C18 A;  3ZQI A;  4HOB A;  3KX2 A;  4W97 A;  2O3F A;  3KP4 A;  5HVQ C;  3KZI C;  4Y7N J;  1IUY A;  3EPZ A;  4UXN A;  5HOO A;  3SFI A;  1R4N B;  1KQ8 A;  4KJZ A;  3E97 A;  4RB1 A;  3VFZ A;  1KQ0 A;  3ZMD A;  1YIJ I;  1EJ9 A;  5CVI A;  3F72 A;  1ZRF A;  3JRH A;  2E2H J;  5FRN A;  2K5C A;  1K4S A;  2EFN A;  3ZRG A;  3ZQQ A;  3OYC A;  1JKR C;  3OWT A;  2F5C A;  4NHJ A;  2LKS A;  1X2M A;  3TKY A;  3VOD A;  5LGN A;  1MND A;  1X1D A;  4XL9 A;  2I10 A;  3R60 A;  2M30 A;  3LOC A;  5JLW A;  1O3T A;  2KLO A;  1P2F A;  1JUM A;  3BR6 A;  3Q5F A;  1MSF C;  3HDD A;  3BG6 A;  5F64 A;  2YPR A;  1XGO A;  2NS7 A;  4MO7 A;  3TL4 X;  3ULQ B;  1EV7 A;  3VSL A;  4ESF A;  1MZB A;  2BOL A;  2DAO A;  3O2P E;  3T0Y A;  2W85 A;  4EM0 B;  1MBK A;  1J9I A;  2K9L A;  1K79 A;  5EDN A;  3VYT B;  3BR1 A;  3ASO H;  4EQQ A;  5HLG A;  3K1M A;  2H27 A;  2PMU A;  1VQP I;  4XBF A;  2QQB A;  3I54 A;  2UXX A;  3GFL A;  4HNV A;  1TT5 B;  4IKF A;  3BC8 A;  1FTT A;  4A3C J;  2D1H A;  5B5E C;  2HQA A;  3CUQ A;  1SD6 A;  3WTY C;  5IY5 H;  2EIK H;  3L1P A;  2CV1 A;  4BJT A;  2Y9Y A;  2MLK A;  4M74 A;  3OYE A;  2XPU A;  1XCV A;  3ZQC A;  1ZRE A;  2EJR A;  2XAU A;  3WGH A;  5JR3 A;  4A69 C;  1OYI A;  3PL8 A;  3JW4 A;  2QEX I;  4JX4 A;  5E3O A;  3HRU A;  2FSW A;  3QRF F;  3BY6 A;  1BOB A;  1QA6 A;  3B6A A;  4Y33 A;  3A2K A;  1IXS B;  1ZGA A;  2XIG A;  3CMY A;  2DU9 A;  2HWV A;  4HF0 A;  1Y1W J;  1YW8 A;  3CCS I;  2XGE A;  1SFX A;  1JTX A;  1V4R A;  2Y30 A;  2LY2 A;  3R6S A;  2VKV A;  3JR9 A;  3E0J B;  2OTL I;  4HV6 A;  2Q1Z B;  3RYR A;  1H88 C;  2EBI A;  1TTY A;  4XLA A;  3T8R A;  1WJA A;  4ZH4 F;  2JMW A;  2HR3 A;  4IX7 A;  3OS0 A;  2KT0 A;  5J4Y A;  3RKQ A;  4B1R A;  1DP7 P;  3I9V 2;  3QPT A;  2BY1 A;  2K9Q A;  2A6E F;  4WK8 F;  2VKE A;  3KP6 A;  3KP5 A;  4G12 A;  3LSR A;  2OV7 A;  2ZXJ A;  2NS0 A;  3ZN0 A;  3B6C A;  5D5V B;  2DBB A;  2JQ7 A;  5KNL A;  1ETO A;  2IXS A;  1X3Z B;  4BQN A;  4AIK A;  1FEX A;  5D6F A;  3CMA I;  4UVB A;  2XAH A;  1L0O C;  3HPG A;  2XVC A;  3H5R A;  2IS1 A;  2GXB A;  2ISY A;  3EQL F;  1NH3 A;  1CF7 A;  1SMT A;  2HYF A;  2IA2 A;  2ECB A;  5E1Z B;  3TO6 A;  3SEZ A;  3LQQ A;  3ABT A;  1S29 A;  2L4M A;  3GTK J;  4UVA A;  5DV5 A;  1HDP A;  2X51 A;  3ERE D;  4GDF A;  1IJW C;  1B9N A;  1LE8 A;  3QYF A;  4WXH A;  2H09 A;  5F0F A;  3GYH X;  3JCU C;  1ZEL A;  2H1L A;  3OOU A;  1R9T J;  2L9N A;  3Q0W A;  4OIN F;  2TDX A;  2R93 J;  2O0Y A;  2HS5 A;  3KP7 A;  4CUG A;  2AHQ A;  1BW6 A;  1X2N A;  2LNB A;  4Z2Y A;  1G59 A;  3HOY J;  3P9K A;  3FXM A;  3BTL A;  2GAU A;  1ON1 A;  4HX8 A;  3MKZ A;  2BXZ A;  2KKO A;  4A3F J;  1IDY A;  2I5U A;  3DTK A;  2Y0M A;  2GXG A;  2I8D A;  3P9C A;  1TBX A;  2ZNZ A;  3BZK A;  4XLF A;  1U5T C;  4ESJ A;  4CYC A;  3MEX A;  2JUC A;  5L3F A;  3K70 C;  2KFD A;  3BG7 A;  3A4C A;  4IHT A;  3FXL A;  5EF6 A;  5K1Y A;  3CQZ J;  4I98 B;  4XLP F;  1FMW A;  2IP2 A;  2XF7 A;  3FXO A;  4YEJ A;  4RB2 C;  2IT0 A;  1RC9 A;  1J0R A;  4M9S A;  4CHU A;  4IQ4 A;  1FZP B;  1W1W E;  2M4K A;  2OZU A;  2DOF A;  3H3Z A;  4EAT A;  2P0W A;  1UCR A;  1USS A;  2DA3 A;  2R7O A;  5GAE J;  3QYE A;  2EFP A;  3HOW J;  1D8J A;  1R4M B;  3VOE A;  1FYM A;  4QPQ A;  5HNF A;  3S3O A;  4AYB A;  3I59 A;  3OR1 C;  4D5F A;  2NRA C;  1WH5 A;  2AO9 A;  4I6Z A;  2OAZ A;  3M7G A;  4C3H J;  1MDM B;  1SFO J;  3L09 A;  5FD6 A;  1Q1V A;  5FO5 A;  2X1C A;  3WTZ A;  5FGM A;  4QLC U;  1IZ1 A;  5E20 A;  1N25 A;  5L3E A;  2V9P A;  2JVG A;  3MD2 A;  1ZG1 A;  3JTG A;  2FNP A;  2QBY A;  1P9Q C;  2HKX A;  1BJA A;  1TQP A;  1JJ6 C;  4S05 A;  3S2H J;  1U78 A;  3AL0 B;  4KN4 X;  2E1M B;  5GTH C;  1R22 A;  3L2R A;  1HOM A;  2KPM A;  5J8C A;  2O61 A;  3M3Y J;  1MD0 A;  4QTR A;  1SEU A;  4UV9 A;  3HPH A;  4MTD A;  3VYR B;  1QPM A;  3FK6 A;  1FBU A;  4OMZ A;  4PJ0 C;  1HA8 A;  2HVQ A;  5HLI A;  2BHY A;  5LFA A;  3EUA A;  3S14 J;  3DTI A;  2PN6 A;  3RDI A;  4KT5 C;  4BY7 J;  1NK3 P;  2BE5 F;  4IOC F;  4CYD A;  4HA8 A;  1BI3 A;  2ZO4 A;  3C3W A;  3GLL A;  5CYV A;  3TGN A;  4G7H F;  2V9K A;  2Z5U A;  4BE0 A;  3RI4 A;  4BAY A;  4WX9 A;  3EET A;  1MKM A;  4EM2 A;  2A5Y B;  2JK3 A;  2WB1 A;  4RMN A;  2Q8K A;  1YJ9 I;  3UKG A;  2Y31 A;  1HW1 A;  5D5X B;  2A61 A;  1K6Y A;  1BI1 A;  3K1P A;  2PEX A;  2KMU A;  4HST A;  3KYL A;  3CF5 F;  2PMZ N;  2NVY J;  5E3L A;  4KMU X;  2CWE A;  3F22 A;  5FLM J;  1VQM I;  1WCM J;  2DFI A;  4XLE A;  2G7H A;  2P5K A;  4HZF A;  4EM1 A;  4FIS A;  3LSH A;  3CLQ A;  4II2 A;  3BG9 A;  4PZJ A;  5FKK A;  2UV1 A;  2FU4 A;  3NWT A;  3VB2 A;  2K9M A;  4GRI A;  3U1D A;  5JI6 A;  3I56 I;  3GFJ A;  3S1M J;  1XC5 A;  2ZXI A;  1ZKG A;  3BZC A;  3JRG A;  4BUP A;  1VQK I;  5IYD J;  1TQM A;  3IUO A;  4ON0 A;  3SZT A;  3MKL A;  1YQA A;  2CFO A;  4J00 A;  1E3P A;  2ZSI B;  3VEP A;  4HG2 A;  2KJC A;  1FYK A;  2NNY A;  1X4O A;  1X58 A;  4EGZ A;  2DFF A;  1QO0 D;  1Z77 A;  2BGC A;  2ID3 A;  4A5M A;  3W6V A;  3LSM A;  1IN4 A;  1YYV A;  2HPI A;  4LIT A;  3MN2 A;  3OIO A;  4QSH A;  3RZD J;  1AU7 A;  4RB0 A;  1ZAO A;  5HS8 A;  4N0B A;  4XOT A;  4R1H A;  4C2T A;  3S16 J;  2FF4 A;  4B48 A;  1OCO H;  4PUS A;  2E1N A;  2VC1 A;  5CJ9 A;  1YIT I;  3CMM A;  1IAW A;  2IGO A;  3CJQ B;  3J7Y J;  1TT0 A;  2QYO A;  4A12 A;  2PI0 A;  2F5F A;  3G6E I;  4DJA A;  4JP0 A;  2Z1D A;  3KFW X;  1RZ4 A;  4MQ9 F;  4MNU A;  1KU9 A;  2JRM A;  1AOY A;  1BBY A;  5L3G A;  4HW0 A;  1E0E A;  3GTL J;  3CUQ B;  1ZHF A;  2JA7 J;  3HSR A;  4BH9 A;  1KYZ A;  1FC3 A;  2MYS A;  3S3M A;  4ZYH A;  3FM5 A;  4BJ5 C;  3ABK H;  1JUP A;  1MMD A;  2FRH A;  1ZRD A;  2EWN A;  2WV1 A;  2HDC A;  2H8R A;  4HF1 A;  4Y3O A;  5FD5 A;  4FQG A;  4XIC A;  2ZXW H;  3WTW C;  1W36 D;  3MKY B;  1ERD A;  3BOQ A;  2Q0O A;  3OYI A;  4P9F A;  1G6N A;  3GTQ J;  2EIL H;  3ZGK A;  1K4T A;  1MJ9 A;  5KAF C;  2JRT A;  2KIF A;  2A3S A;  2WBM A;  5B1B H;  2K86 A;  1T8I A;  2LLK A;  3GBG A;  3L2W A;  1HST A;  5F1J A;  5A2Q Z;  4U7D A;  3M1E A;  1XX5 A;  4KIB A;  4CCL A;  2HOE A;  4LOC A;  5FLX K;  3T1B A;  2PJR A;  4PDK A;  3CCJ I;  1BR1 A;  5JFR A;  2LBF A;  1ETV A;  3E1S A;  2DK8 A;  2H6C A;  2IGM A;  2QSH X;  2XSD C;  4DW6 A;  2BZT A;  2WC2 A;  4I0B A;  2VPR A;  3QAH A;  5ICG A;  4I2O A;  2QSG X;  1T38 A;  4AM3 A;  3K69 A;  4AID A;  3HIF A;  3MZY A;  2LR8 A;  2GOM A;  4NB5 A;  3ZOB A;  2XPV A;  4HLX A;  4A3M J;  4MEY F;  1JUS A;  2M1B A;  2JPB A;  4RAY A;  2DMT A;  2BY0 A;  1GVD A;  4AC0 A;  2Y9Z A;  5E17 F;  1ONV A;  3BRO A;  4NNJ A;  4XSZ F;  4L5J A;  4JYK A;  3TDU C;  4CCK A;  4IQJ A;  2L54 A;  4B44 A;  2GA2 A;  1WI3 A;  2LF8 A;  2ZCW A;  5H6Q A;  1CF7 B;  5BPD A;  3CO6 C;  1QHG A;  1OYY A;  3PIO F;  4ENN A;  2DTR A;  3SJM A;  1MMS A;  3F3X A;  4CDG A;  1D3Y A;  5ILS A;  3EYI A;  1LE8 B;  2W82 A;  1SAN A;  1NG6 A;  1WJC A;  2VUM J;  2JVH A;  5TRD A;  2L9R A;  1EA3 A;  3OOP A;  2HQR A;  2F5V A;  5LGT A;  1QHH D;  4FE7 A;  3JRE A;  1R5G A;  3MMY B;  3UR3 C;  2Z3Y A;  2LY9 A;  1YRN B;  4U0V A;  2D1V A;  3FXK A;  5K5O A;  2HZT A;  3W2A A;  4E4H A;  1QQI A;  4KA4 A;  5BNG A;  3GZ5 A;  3QOD A;  3FIS A;  1W4M A;  1APL C;  1T39 A;  1ETW A;  4A6D A;  2K4B A;  5TIS C;  2BY3 A;  1XGN A;  2LRD A;  2W57 A;  3DTE A;  1OYW A;  4CYC B;  2H8W A;  1P7J A;  1V55 H;  4G8X A;  3ASN H;  3R61 A;  4NDL A;  1T08 B;  1RET A;  2CQQ A;  3G2B A;  1SD4 A;  4LLG F;  3QQA A;  2DMP A;  4ITV A;  3V8L A;  5HDN A;  3OSG A;  1VND A;  4PFO A;  5J1U A;  5KVR A;  3TP0 A;  1WGX A;  3JSP A;  1TLH B;  1VFC A;  3HM5 A;  3I58 A;  4GYI A;  4A3L J;  2L02 A;  2OQG A;  2NS8 A;  3QP5 A;  4D9J A;  3ZPL A;  2EH3 A;  2FX0 A;  2OUM A;  3RYP A;  3V7C A;  3JAM Z;  2O8K A;  3QPS A;  1B1B A;  2DDB A;  2N8G A;  2QCO A;  2V9V A;  4AUX A;  3KEO A;  1U8B A;  4X6A J;  3FBI B;  3H0G J;  3D5S C;  3I59 B;  4I09 A;  4LK0 F;  3J80 K;  5HS7 A;  1ZQ3 P;  1IV8 A;  3ZMU A;  3HGY A;  2F48 A;  3W6K B;  4BU2 A;  3DLL F;  4PCQ A;  4HF2 A;  2EA4 A;  2F4M B;  5L3C A;  3A1Y A;  4D7M A;  2W24 A;  4NQW B;  2B7E A;  3BTI A;  1JKQ C;  1XGS A;  1XG1 A;  3PUB A;  2XV4 S;  2VON A;  4S04 A;  2CGP A;  4L9N A;  1RES A;  2QBY B;  3WHC A;  2A6H F;  1F36 A;  4IXA A;  2BV6 A;  2DA2 A;  2Q2E A;  4CH7 A;  5GTI C;  4OOI A;  4KFC A;  2E1O A;  1Y0N A;  3PO2 J;  1J7K A;  3IKV A;  1DDN A;  4A3I J;  3CDL A;  1VTN C;  2VJ4 A;  3RSN A;  1YTY A;  4L5E A;  1HF0 A;  1OFC X;  1DPR A;  3MFK A;  3K0L A;  4ENJ A;  2RGV A;  3FHZ A;  3GZ6 A;  4ZDO A;  2NVX J;  1XSD A;  2WAQ A;  1SD7 A;  4ANJ A;  2ESN A;  4FET A;  2DMN A;  2AQE A;  2UZK A;  3CDI A;  3DQV C;  5EGO A;  2LG4 A;  1W7P B;  2FNA A;  1IV6 A;  2CV2 A;  2Y2Z A;  3R4K A;  4CIC A;  3ZQL A;  2YX4 A;  3O3K A;  2E1C A;  5B1A H;  1E2X A;  1I3A A;  3JRA A;  2L9V A;  2X6X A;  4NC7 A;  5DUI A;  2P81 A;  3BPV A;  2YX7 A;  3MCZ A;  3TMO A; 
#chains in the Genus database with same CATH homology
 1T98 A;  1J59 A;  3V8J A;  3SHF A;  3DPL C;  2XGX A;  1U2W A;  4LLL A;  3GF2 A;  1QZZ A;  3HHH A;  3CJN A;  1HW2 A;  5CVJ A;  1BC8 C;  5FFX A;  5J6X A;  3S2W A;  3WGG A;  3D5L A;  2P6T A;  2J5O A;  2XHK A;  3KZZ A;  2DT5 A;  2LSO A;  3FWE A;  5F1R A;  4RGR A;  1BIA A;  4I02 A;  2PMH A;  3M9A A;  2RNJ A;  3L00 A;  1NHA A;  4M9X A;  2KJB A;  1V3F A;  1IN5 A;  3PQK A;  3WE2 A;  2F5E A;  4A2U A;  2LDU A;  5LGU A;  3FX3 A;  1TW2 A;  4L9T A;  1HKS A;  2QM3 A;  4Y17 A;  2GZW A;  5DD4 A;  3DF8 A;  2VOO A;  4JK1 X;  1S7A A;  1DPU A;  2HGC A;  3TQN A;  1XB4 A;  4EJO A;  4CZZ A;  1JXS A;  1K6O A;  2A68 F;  2R7D A;  2CW0 F;  3QPH A;  2MC3 A;  1WKM A;  4FX4 A;  2P5L C;  3RIR A;  3RKX A;  5ILU A;  4BQA A;  3Q9V A;  3QP6 A;  1L3L A;  1R1V A;  3RPQ A;  1W5T A;  3ZMS A;  3GLX A;  1KA8 A;  1XMA A;  1XSX A;  4JQF A;  1WWX A;  3HSE A;  4YFX F;  4FT8 A;  2BYV E;  2VBZ A;  4OMY A;  5FFZ A;  4GGG A;  5AIQ A;  3ECH A;  3KEQ A;  4LMY A;  1T2K A;  4IVN A;  3CUO A;  4KYW A;  1DUX C;  1SMY F;  5DYM A;  1Z6R A;  4YIF A;  2GA1 A;  5LEK A;  1UST A;  1Z1D A;  3BZ6 A;  5HDG A;  3SZP A;  2STW A;  1IRG A;  4R8H A;  1XCB A;  5CVR A;  2HKO A;  1XD7 A;  4M6X A;  3HRS A;  1J2X A;  2OD5 A;  2ELH A;  2ETH A;  1SAX A;  2OQR A;  4HYE A;  1HXD A;  1LVA A;  1O3R A;  1W7P D;  4BHP A;  3KP2 A;  1O3Q A;  4U88 A;  1R1U A;  5DCF A;  3K9T A;  5E1X A;  5LHG A;  3BDD A;  5L3B A;  1UHW A;  4Y13 A;  2CG4 A;  5JVT A;  2M87 A;  4UNO A;  3PFI A;  4A6E A;  4EJW A;  5DDG A;  4Q4Z F;  1UHM A;  1F9N A;  2PJP A;  1ZRC A;  2Y48 A;  3KET A;  2C6Y A;  2VBY A;  3RPU A;  5IT3 A;  1E17 A;  2QUF A;  5BQT A;  1K78 B;  1P4A A;  2J5P A;  1S7O A;  2P5V A;  4L5I A;  1BI0 A;  4HDV A;  2DK5 A;  3WU0 A;  1LDJ A;  1B4A A;  1FP2 A;  1I1G A;  4G6Q A;  1RI7 A;  2QWW A;  5HS9 A;  1IRF A;  3WTU C;  2OZ6 A;  5EEH A;  4L18 B;  4AWX B;  1U8R A;  2UWM A;  4NQW A;  3V7S A;  3GX4 X;  3F8B A;  1FSE A;  3REO A;  3JSO A;  4ZZL A;  4BHB A;  1BIB A;  1GXQ A;  1HBX G;  1ULY A;  3T8T A;  3ABU A;  1U5T B;  3ROU A;  5H20 A;  5J8F A;  2EFQ A;  2MLG A;  2PLY A;  3ZMT A;  3C1D A;  4P5O A;  2HEO A;  4UVC A;  3HTS B;  2OA4 A;  4ASN A;  4JBA A;  1PP8 F;  1W7P A;  4M9Z A;  2P4W A;  3I53 A;  3OV8 A;  2M8E A;  2DQR A;  5LHH A;  1O3S A;  4BHC A;  1EH8 A;  4UHT A;  1FP1 D;  1O7F A;  1LQ1 A;  3F8N A;  2FA5 A;  3N97 A;  3E6B A;  4ESB A;  1LEA A;  2G7U A;  2RKH A;  1HKQ A;  3EYY A;  3BJ6 A;  5AON A;  3CUQ C;  2QVO A;  3R0A A;  3J81 Z;  3DPT A;  1D5V A;  2MH2 A;  2DQL A;  1ON2 A;  1SD5 A;  3GFI A;  3TO9 A;  2PBI A;  2ZJ2 A;  4HX7 A;  2W25 A;  1JHF A;  5ILV A;  2IA1 A;  2XAJ A;  4IF4 A;  1LJ9 A;  3FXQ A;  5E8G A;  5ERI A;  1REP C;  3KLN A;  3LQR A;  2LKP A;  5BPI A;  4WF2 A;  2FML A;  3WU1 B;  3ZMV A;  2XKP A;  3GO5 A;  2XKO A;  2DLL A;  2EK5 A;  3FMQ A;  3N4M A;  4LB6 B;  4I7H A;  5L3D A;  4RGX A;  2DW4 A;  4EJV A;  4EMS A;  3HTU A;  3H92 A;  4HLY A;  3TDZ C;  3DFG A;  5CVV A;  1OR7 A;  3L9F A;  3Q9S A;  4G9Y A;  4A5N A;  1S8N A;  1I6X A;  2MA3 A;  1YLF A;  3C7J A;  1W5S A;  3F8M A;  2ADU A;  1KU7 A;  1FWZ A;  3H3U A;  3IC7 A;  1QZY A;  3IL2 A;  4P9U A;  4EGY A;  2O6G E;  1TW3 A;  2VXZ A;  3NQO A;  1FSH A;  4HQE A;  4DQ2 A;  2X0L A;  1FNN A;  1RNL A;  1H9G A;  4KIG A;  3ZMZ A;  2D45 A;  3DEU A;  1B6A A;  1H0M A;  1I1S A;  2IW5 A;  3WTS C;  4WWC A;  2GIV A;  2ZNY A;  1ZLJ A;  2AXL A;  1ZYR F;  5F6F A;  1BI2 A;  3D0S A;  2MD5 A;  2H6B A;  2RDP A;  3AAF A;  2K4J A;  4IRG A;  1KGS A;  3GVA A;  2F5D A;  1TNS A;  4ENM A;  2DPU A;  3F8F A;  1MJB A;  2BBY A;  2FBK A;  2VE9 A;  3WTX C;  4YII A;  4GXO A;  2XAS A;  4EJT A;  1OKR A;  3TOB A;  4KDP A;  2WTE A;  2Z33 A;  2HTJ A;  5LHI A;  2RV8 A;  2FBI A;  3MQ0 A;  3E3V A;  2V79 A;  2XAG A;  3O6B B;  1PDN C;  2LF7 A;  6PAX A;  4PGG A;  2IRF G;  4P55 A;  1Z7U A;  4XRF A;  3J7A O;  4MTE A;  1RUN A;  3B73 A;  3RKY A;  3M8E A;  3IWF A;  5LBQ A;  1EH7 A;  1O57 A;  2ESH A;  5BMZ A;  1YG2 A;  3KZY A;  3ZQ7 A;  2QQA A;  4FHT A;  3PQJ A;  4R79 A;  1K78 A;  1C0W A;  1ZLK A;  1QNT A;  4LB5 A;  4LK1 F;  2Y75 A;  3HOT A;  2IA0 A;  3RTR A;  2XAF A;  4Q47 A;  1BN5 A;  5DEQ A;  2XRN A;  2K27 A;  2V6C A;  1BC7 C;  4M6Y A;  1G4D A;  4IRI A;  2KRF A;  2EV6 A;  3BP8 A;  1YW7 A;  2X4H A;  5A2Q K;  4YFK F;  1WQ2 A;  3LA2 A;  5FB2 A;  1U5T A;  2G9W A;  3GWZ A;  1YS6 A;  2PG4 A;  2EFO A;  2NNN A;  1KU3 A;  1IN8 A;  2M5W A;  2KIM A;  4D0P A;  3FF5 A;  3LFK A;  1BM9 A;  4ZYD A;  1PP7 U;  4L0Z B;  3V4G A;  4HV5 A;  1U3E M;  1KYW A;  4RGS A;  5LRR A;  2JSC A;  1MJA A;  4M73 A;  3G73 A;  2P7C B;  3DP7 A;  3WG9 A;  4ZYG A;  4GCV A;  4OIR F;  1Z6T A;  2P7V B;  4ZZD A;  4L0Y B;  3WE3 A;  4B09 A;  3HRM A;  5DCM A;  4Q5S F;  2ZBK A;  2R7F A;  2QEN A;  1XMK A;  4LGW A;  1D8K A;  1I27 A;  2CYY A;  1FLI A;  1G3T A;  4CXF A;  2JZY A;  4U0Y A;  2EA2 A;  3F8C A;  3JAM K;  5DD8 A;  3I71 A;  3BWG A;  4EJU A;  4KIC A;  2FBH A;  1GHC A;  4ENK A;  3BJA A;  5E1W A;  3DV8 A;  3E6D A;  5D8L B;  4ETS A;  4U7B A;  4XSX F;  4UUV A;  4G7Z F;  1R1T A;  3CO7 C;  3SQN A;  5LRS A;  4I0A A;  1RUO A;  1TNT A;  4HX4 A;  2L4A A;  1F4K A;  4G6D A;  1EH6 A;  1WI9 A;  4MGR A;  5BS6 A;  1P4W A;  3E6M A;  3ECO A;  1LEB A;  2YU3 A;  4M71 A;  4BXU A;  1R58 A;  2CO5 A;  4WXD A;  3IWZ A;  1G3S A;  2R3S A;  3IHU A;  4LG0 A;  2E7X A;  2P8T A;  3KP3 A;  3FXR A;  1O7L A;  3F6V A;  2MBF A;  5D5U B;  1RIO H;  3QOP A;  3F6O A;  2FXA A;  4O5V A;  5KK1 A;  3I0T A;  1YW9 A;  1BOA A;  4IJA A;  5BOX A;  2L3D A;  1Q1H A;  4RS8 A;  2CFX A;  3E5U A;  4A0Y A;  4KN7 X;  5ICC A;  5D8K B;  3B02 A;  4G94 A;  2M45 A;  1LDK B;  1IN6 A;  3NRV A;  1Z05 A;  1U6G A;  1FX7 A;  2QZ8 A;  2ZFW A;  4OU0 A;  2HFH A;  1J75 A;  5E8I A;  4AIJ A;  1P92 A;  2GQQ A;  4DNC A;  2IVM A;  1R23 A;  5FLX Z;  3SFZ A;  4HQM A;  4O6J A;  1J5Y A;  3FZV A;  5TJJ A;  1OMI A;  2O03 A;  4CGZ A;  3LA7 A;  1WSU A;  4I01 A;  2VBW A;  3F23 A;  3KE2 A;  3E6C C;  1HQC A;  1XDS A;  5D6E A;  2VT3 A;  4N9I A;  3U9G A;  2B0L A;  3FMS A;  1K7A A;  3M8F A;  1F1Z A;  3GW2 A;  4M72 A;  1S6L A;  1Z91 A;  2FE3 A;  2O8X A;  5IT9 Z;  1WRJ A;  3E5X A;  2EV0 A;  5D5W B;  2A69 F;  1Z9C A;  2CSO A;  1CGP A;  1I5Z A;  4XLN F;  3TOA A;  4EV0 A;  4TV7 A;  2WV0 A;  2ZKZ A;  4IRH A;  4FX0 A;  5CLS A;  4GO1 A;  2V1X A;  2EFW A;  2VOD A;  3DKW A;  5E18 F;  3HUG A;  1F5T A;  3L2C A;  2PFB A;  3I64 A;  3R0J A;  3GFM A;  2IPQ X;  1XN7 A;  4P96 A;  1ZH5 A;  3MAJ A;  4U0W A;  4A0X A;  1YFH A;  2RN7 A;  3WGI A;  2V1D A;  1ZG5 A;  1ODD A;  4OIQ F;  2QQ9 A;  2L01 A;  2VN2 A;  3RKW A;  1R7J A;  5DCM B;  1S3J A;  3ELK A;  4GYG A;  4IPA A;  3J80 Z;  4BYY A;  1P6R A;  3LAJ A;  3ISP A;  2OU2 A;  5D4S A;  3MZH A;  3P7N A;  1FBS A;  4ZYE A;  1YS7 A;  3FXU A;  5LLQ A;  1Y0U A;  4HAM A;  1R5H A;  2VE8 A;  3FM3 A;  2F2E A;  3FMR A;  4Y15 A;  1HKT A;  1MGT A;  1IN7 A;  3MWM A;  1ZAR A;  2V1U A;  2EV5 A;  3WTV C;  4K2E A;  5LEJ A;  2MH9 A;  1HSJ A;  1XGM A;  2ZME A;  4KNY A;  1SFU A;  3EDP A;  5JHU A;  2VT2 A;  1YO5 C;  4AIH A;  4YFN F;  1QBJ A;  1FY7 A;  3BJO A;  2EB7 A;  1LDD A;  1R36 A;  4KUM A;  3E5Q A;  4O3M A;  1ZGJ A;  2Z9O A;  4LD5 A;  2UXN A;  3LST A;  2QLZ A;  3WOD F;  3HOS A;  1FBQ A;  5H6R A;  3QU3 A;  4N9H A;  1R00 A;  1GXP A;  4LJZ F;  1P4X A;  1YIO A;  1STZ A;  5AIP A;  3V7R A;  2BEO A;  4AVP A;  4LG0 B;  5DUK A;  2VC0 A;  1UFM A;  4YG2 F;  1UB9 A;  3TO7 A;  3F21 A;  3LWF A;  4WCG A;  2FMY A;  3HRT A;  3W6J B;  4RAZ A;  2Z99 A;  1KQ9 A;  2YSR A;  4KIF A;  2GWR A;  3ZN1 A;  1A04 A;  2W84 A;  4KMF A;  2HTS A;  3HSF A;  4OIO F;  4UV8 A;  2JTV A;  4RGU A;  5HDK A;  4LFU A;  5IT9 K;  1OPC A;  2STT A;  1XDU A;  2OBP A;  3IRR A;  2COM A;  4CO8 A;  2IJL A;  1PUE E;  2XUB A;  2NAZ A;  3KCC A;  5EEG A;  4EVI A;  2DO7 A;  2ISZ A;  4MEX F;  4H0E A;  1B59 A;  3CTA A;  3GXO A;  4HBL A;  4A0Z A;  5D4R A;  1IXC A;  2HYG D;  3ZP5 A;  1HW5 A;  1IF1 A;  3V8K A;  1IW7 F;  1AWC A;  5K5R A;  2YR2 A;  1TQI A;  5ICF A;  3L7W A;  4WXC A;  1FYL A;  4RB3 C;  4BNC A;  3J81 K;  5HLH A;  1JGS A;  1XSV A;  1ZN2 A;  3BPX A;  1LNW A;  5ICE A;  4PGH A;  3U2R A;  3HHG A;  3I5U A;  2KIU A;  2RVC A;  3GUD A;  1FOK A;  1X3U A;  4B8X A;  2RQP A;  1SFE A;  3RJP A;  5CVU A;  3QU6 A;  3T5X A;  1G3W A;  2E7W A;  3HYI A;  1KU2 A;  3JTH A;  1G3Y A;  1GVJ A;  3CDH A;  2HQN A;  2PQ8 A;  3K2Z A;  2A07 F;  3EUH A;  3ML6 A;  3IKT A;  5K5Q A;  3K1N A;  2XRO A;  4F7Z A;  4Q48 A;  2P6S A;  1QGP A;  4L9V A;  3WTT C;  3SXY A;  3IRQ A;  2JT1 A;  1T6S A;  2VOP A;  2D2W A;  2NYX A;  2WWY A;  4LLN A;  4G7O F;  3LA3 A;  1JHH A;  1T0F A;  3DXJ F;  1MDM A;  1B9M A;  2ACJ A;  4OIP F;  3I4P A;  2CQK A;  2DPD A;  1FT9 A;  2VBX A;  3COA C;  2XAQ A;  4QWQ A;  4MHG A;  4E70 A;  4AD9 A;  4IHS A;  2FQ3 A;  2AS5 F;  3LAP A;  4MQV A;  5ED4 A;  1H9T A;  3CLO A;  3P9I A;  2K7L A;  3GEZ A;  1IXR C;  3G3Z A;  1ZG3 A;  2JPC A;  4HDU A;  1FPQ A;  2FEZ A;  2K02 A;  3NEU A;  1LB2 A;  2H94 A;  3KLO A;  4L9J A;  2DI3 A;  2ZME B;  2RC4 A;  2FOK A;  3C18 A;  4HOB A;  2O3F A;  3KP4 A;  5HVQ C;  1IUY A;  4UXN A;  5HOO A;  1KQ8 A;  3E97 A;  4RB1 A;  3VFZ A;  1KQ0 A;  3ZMD A;  5CVI A;  3F72 A;  1ZRF A;  2EFN A;  2F5C A;  4NHJ A;  3TKY A;  3VOD A;  5LGN A;  3R60 A;  2M30 A;  1O3T A;  1P2F A;  3Q5F A;  5F64 A;  1JE8 A;  2YPR A;  1XGO A;  3ULQ B;  4ESF A;  1EV7 A;  1MZB A;  2DAO A;  3O2P E;  3T0Y A;  2W85 A;  4EM0 B;  1J9I A;  1K79 A;  4EQQ A;  5HLG A;  3K1M A;  2H27 A;  2PMU A;  4XBF A;  2QQB A;  3I54 A;  2UXX A;  3GFL A;  2D1H A;  3CUQ A;  1SD6 A;  3WTY C;  2MLK A;  4M74 A;  1XCV A;  1ZRE A;  2EJR A;  3WGH A;  5JR3 A;  1OYI A;  3JW4 A;  3HRU A;  2FSW A;  3QRF F;  3BY6 A;  1IXS B;  1ZGA A;  2XIG A;  2DU9 A;  2HWV A;  4HF0 A;  1YW8 A;  1SFX A;  1V4R A;  3R6S A;  4HV6 A;  3RYR A;  1TTY A;  3T8R A;  4ZH4 F;  2HR3 A;  1DP7 P;  3QPT A;  4WK8 F;  2A6E F;  3KP6 A;  3KP5 A;  2ZXJ A;  2NS0 A;  3ZN0 A;  5D5V B;  2DBB A;  4AIK A;  5D6F A;  4UVB A;  2XAH A;  1L0O C;  2XVC A;  2GXB A;  2ISY A;  3EQL F;  1CF7 A;  1SMT A;  2HYF A;  2IA2 A;  5E1Z B;  3TO6 A;  3LQQ A;  3ABT A;  1S29 A;  2L4M A;  4UVA A;  5DV5 A;  3ERE D;  1B9N A;  4WXH A;  2H09 A;  3GYH X;  4OIN F;  2TDX A;  2O0Y A;  2HS5 A;  3KP7 A;  2LNB A;  4Z2Y A;  3P9K A;  2GAU A;  1ON1 A;  4HX8 A;  2KKO A;  2Y0M A;  2GXG A;  3P9C A;  1TBX A;  2ZNZ A;  1U5T C;  4ESJ A;  3MEX A;  5L3F A;  4IHT A;  5K1Y A;  4I98 B;  4XLP F;  2IP2 A;  4RB2 C;  2IT0 A;  1J0R A;  4M9S A;  4CHU A;  1FZP B;  2OZU A;  3H3Z A;  1UCR A;  1USS A;  2EFP A;  1D8J A;  3VOE A;  1FYM A;  3I59 A;  2NRA C;  2OAZ A;  3M7G A;  1MDM B;  3L09 A;  5FD6 A;  5FO5 A;  3WTZ A;  5FGM A;  4QLC U;  1IZ1 A;  5E20 A;  5L3E A;  1ZG1 A;  3JTG A;  2FNP A;  2QBY A;  2HKX A;  1BJA A;  1TQP A;  4S05 A;  1U78 A;  4KN4 X;  1R22 A;  5J8C A;  2O61 A;  1MD0 A;  4UV9 A;  4MTD A;  1QPM A;  1FBU A;  4OMZ A;  5HLI A;  2PN6 A;  3RDI A;  4KT5 C;  2BE5 F;  4CYD A;  4HA8 A;  1BI3 A;  2ZO4 A;  3C3W A;  5CYV A;  3TGN A;  4G7H F;  2Z5U A;  3RI4 A;  4BAY A;  4WX9 A;  3EET A;  1MKM A;  4EM2 A;  2A5Y B;  2Q8K A;  1HW1 A;  5D5X B;  2A61 A;  1BI1 A;  3K1P A;  2PEX A;  4KMU X;  2CWE A;  3F22 A;  2DFI A;  2G7H A;  2P5K A;  4HZF A;  4EM1 A;  4PZJ A;  2FU4 A;  3VB2 A;  5JI6 A;  3U1D A;  3GFJ A;  1TQM A;  4ON0 A;  3SZT A;  1YQA A;  3VEP A;  2KJC A;  1FYK A;  2NNY A;  4EGZ A;  1QO0 D;  4A5M A;  2BGC A;  1IN4 A;  1YYV A;  4RB0 A;  1ZAO A;  5HS8 A;  4N0B A;  4R1H A;  2FF4 A;  2E1N A;  2VC1 A;  5CJ9 A;  1IAW A;  2QYO A;  4A12 A;  2PI0 A;  2F5F A;  3KFW X;  1RZ4 A;  4MQ9 F;  4MNU A;  1KU9 A;  1AOY A;  1BBY A;  5L3G A;  4HW0 A;  3CUQ B;  1ZHF A;  3HSR A;  4BH9 A;  1KYZ A;  1FC3 A;  4ZYH A;  3FM5 A;  2FRH A;  1ZRD A;  2EWN A;  2HDC A;  4HF1 A;  5FD5 A;  3WTW C;  3BOQ A;  2Q0O A;  4P9F A;  1G6N A;  1MJ9 A;  2JRT A;  2KIF A;  2A3S A;  2K86 A;  1HST A;  4U7D A;  5A2Q Z;  3M1E A;  4KIB A;  2HOE A;  5FLX K;  3T1B A;  4PDK A;  5JFR A;  2DK8 A;  2H6C A;  2WC2 A;  4I0B A;  3QAH A;  4I2O A;  5ICG A;  1T38 A;  3K69 A;  3HIF A;  3MZY A;  4NB5 A;  4HLX A;  4MEY F;  2M1B A;  2JPB A;  4RAY A;  5E17 F;  1ONV A;  3BRO A;  4XSZ F;  4L5J A;  3TDU C;  2L54 A;  2GA2 A;  2LF8 A;  2ZCW A;  5H6Q A;  1CF7 B;  5BPD A;  3CO6 C;  1OYY A;  4ENN A;  2DTR A;  3F3X A;  4CDG A;  1D3Y A;  5ILS A;  3EYI A;  5TRD A;  3OOP A;  2HQR A;  5LGT A;  1R5G A;  2Z3Y A;  4U0V A;  2D1V A;  5K5O A;  2HZT A;  1QQI A;  4KA4 A;  3GZ5 A;  1W4M A;  1T39 A;  4A6D A;  2K4B A;  2W57 A;  1XGN A;  1OYW A;  4G8X A;  3R61 A;  1SD4 A;  4LLG F;  3V8L A;  5HDN A;  5KVR A;  3JSP A;  1TLH B;  3I58 A;  4GYI A;  2L02 A;  2OQG A;  3QP5 A;  3ZPL A;  3RYP A;  3V7C A;  3JAM Z;  1B1B A;  2V9V A;  3KEO A;  3I59 B;  4I09 A;  4LK0 F;  3J80 K;  5HS7 A;  3ZMU A;  3W6K B;  4PCQ A;  4HF2 A;  2EA4 A;  5L3C A;  2W24 A;  1XGS A;  2XV4 S;  2VON A;  4S04 A;  2CGP A;  4L9N A;  2QBY B;  2A6H F;  4IXA A;  2BV6 A;  2Q2E A;  4OOI A;  4KFC A;  1J7K A;  3IKV A;  1DDN A;  1VTN C;  1YTY A;  1DPR A;  3MFK A;  3K0L A;  4ENJ A;  2RGV A;  3FHZ A;  3GZ6 A;  1XSD A;  1SD7 A;  2ESN A;  2UZK A;  3DQV C;  1W7P B;  2FNA A;  3R4K A;  4CIC A;  2YX4 A;  3O3K A;  2E1C A;  1E2X A;  5DUI A;  3BPV A;  2YX7 A;  3MCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...