4ESFA

Crystal structure of padr-like transcriptional regulator (bce3449) from bacillus cereus strain atcc 10987
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
100
Chain Sequence
NLTEMLKGSLEGCVLEIISRRETYGYEITRHLNDLGFTEVVEGTVYTILVRLEKKKLVNIEKKPPRKFYSLNEAGRQELELFWKKWDFVSSKINVLKSSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PadR-like transcriptional regulator
publication title Crystal Structures of Two Transcriptional Regulators from Bacillus cereus Define the Conserved Structural Features of a PadR Subfamily.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transcription
total genus 39
structure length 100
sequence length 105
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esfA00
5J6XA 4KA4A 1FT9A 1FBQA 4EGYA 3E6CC 4ENJA 1ON1A 2O0YA 3CUQA 4ESJA 5EEHA 4AIKA 3WU0A 3H3ZA 1YO5C 1HXDA 3BJAA 2WC2A 3MFKA 3R61A 2CQKA 2CYYA 1MJ9A 3I71A 1SD6A 1WQ2A 2KIUA 1Q1HA 3R60A 4ZZLA 2NYXA 5FB2A 2GAUA 1HSJA 1SFEA 1B1BA 2WWYA 5HLHA 4WXDA 2ZNZA 4UNOA 3ELKA 3ZN0A 4ENNA 1XSDA 2EK5A 2R3SA 5ICFA 2FRHA 2IA0A 4GGGA 1Z6TA 1YIOA 2GXGA 4KFCA 2QM3A 4P55A 4GYGA 3IL2A 5KK1A 2M87A 4UV9A 1G3SA 3LQRA 2PG4A 3HRMA 4NHJA 4PZJA 1LQ1A 5FFXA 5L3BA 2HOEA 1TQIA 1YG2A 4BAYA 3V4GA 1Z9CA 2FNPA 1U6GA 1XN7A 4M72A 3WTXC 1TNSA 4UXNA 4G6DA 4HX4A 2ISZA 2E1CA 4Q5SF 3HTSB 4EM1A 3LAJA 5JR3A 4I01A 1OR7A 2ZCWA 5FLXK 2FMYA 3DEUA 5E8IA 1RUNA 4M71A 3WGIA 1ZARA 2BV6A 3E97A 4I7HA 3FZVA 4LFUA 1FP1D 1WRJA 4JBAA 4XRFA 2ZMEB 4ZYHA 3SZPA 3F23A 3J81K 3E3VA 4IRHA 1WKMA 3FWEA 4EJWA 4RAYA 3ECOA 3E6BA 1D8KA 2P8TA 1PDNC 4KICA 5LHGA 3WGGA 4I98B 1HKQA 2DQRA 3DV8A 3FXQA 2GA1A 4HBLA 3Q9SA 3FF5A 5FO5A 1QGPA 3T8RA 1OMIA 1E17A 3T1BA 3ROUA 4N9HA 2AXLA 5DD4A 3IC7A 2P5LC 3BP8A 3EUHA 4U7DA 3GFIA 1I1SA 5FD5A 4HF2A 1FOKA 3BZ6A 2K86A 1KYWA 3F6OA 5E1WA 1ZG5A 1F1ZA 3KP2A 1V3FA 2IW5A 1O3TA 3K0LA 2XASA 2OQGA 3LA2A 1PUEE 3GVAA 3V7CA 2OBPA 2QWWA 3DQVC 5HDGA 2EV5A 4UUVA 3R6SA 1XGNA 4LB5A 3M8EA 4UV8A 1JGSA 3VEPA 1I1GA 2GXBA 1ZLKA 4RB0A 4OIQF 2YX4A 2FE3A 2JTVA 5ICCA 2H6CA 2O8XA 2QUFA 5IT9Z 3ZMSA 4M9XA 2H94A 3T8TA 3AAFA 1FLIA 1Z91A 5J8CA 2Y75A 2A61A 3C3WA 3E6DA 3HSFA 1K7AA 1T98A 2EFWA 3F72A 1IXSB 4ZZDA 3E5UA 3TO9A 3RYRA 4KUMA 3DPTA 2ETHA 5E17F 3RYPA 3N4MA 1W7PB 2DPUA 1MDMB 5HS9A 1BN5A 3F8CA 5L3EA 1BI0A 3TO6A 2X4HA 3I58A 2W85A 3ZMTA 5BOXA 4EV0A 4GXOA 3F21A 2HYFA 3NEUA 3DKWA 1TNTA 4M73A 3ULQB 1XD7A 4AD9A 2ISYA 1YYVA 1W7PA 2STTA 2Z99A 3RIRA 4Q4ZF 4EJUA 5HDKA 4A12A 2FNAA 3I4PA 4JQFA 2OA4A 1MJAA 1TW2A 3MQ0A 1F5TA 4AVPA 3ML6A 4OIRF 4BHCA 4WXCA 2RVCA 5TJJA 3RPQA 4U88A 4BQAA 3R0AA 5K1YA 4CO8A 4MNUA 1T0FA 5D8LB 4A0XA 1EH8A 2HR3A 3QPHA 3GZ6A 2BE5F 3L9FA 3JAMZ 3RI4A 4G7OF 3U1DA 3C18A 3CUOA 2DU9A 3JSOA 3HHGA 4KIFA 2UWMA 4M6YA 3K2ZA 4UVAA 2VC1A 4Q47A 4KMUX 5CJ9A 1R23A 1GXPA 3JW4A 5JVTA 2B0LA 1S6LA 2L4MA 2VBWA 2R7DA 4IJAA 4YIIA 3FM5A 1R58A 5DYMA 2C6YA 4ESBA 3HTUA 2ADUA 5D6FA 1ZH5A 1W5TA 2XHKA 4S04A 2A6EF 1E2XA 5E20A 1JXSA 3GX4X 1IF1A 3MWMA 1S7OA 1B4AA 4CXFA 1GXQA 3KLNA 1LDJA 2FF4A 5KVRA 1REPC 2PI0A 3TOBA 3FXUA 4KYWA 1NHAA 2XAJA 2IRFG 2XAHA 2A68F 3WTZA 2J5PA 1IW7F 3WTTC 3KCCA 3ECHA 4G9YA 3BROA 3GXOA 4HF0A 1XCBA 4Y13A 4A0YA 2KIMA 3CUQC 1KGSA 4Y15A 3F6VA 3COAC 1PP7U 3B02A 3WU1B 3P9KA 4LG0A 2MBFA 3I59A 3GFMA 1ZLJA 1B6AA 2HQRA 1FNNA 4LMYA 2P6SA 4A5NA 1SD5A 1XGOA 5ICGA 1JHFA 1QNTA 4MQVA 2IA1A 2HFHA 4TV7A 1BJAA 2ZO4A 3K1MA 2JPCA 4HQEA 5FLXZ 2MLGA 3WTUC 3TGNA 3KETA 4OMZA 2HWVA 5E18F 1K6OA 3PQKA 1KU7A 1O3QA 4JK1X 2K7LA 5HVQC 4L9TA 5DUIA 5D4SA 5HS8A 4BHBA 1KQ0A 1JE8A 3J81Z 4EMSA 4OINF 1XSXA 3O2PE 4M9ZA 2Q2EA 3CUQB 4A5MA 1GHCA 4L5IA 3QOPA 1L3LA 2XRNA 1G3WA 5CVJA 3I0TA 4M9SA 4IRGA 4UVBA 2RQPA 2LF8A 4XLNF 2W24A 4B09A 4HZFA 3HIFA 3GUDA 2OAZA 3V8JA 1GVJA 3TKYA 1IN6A 2EV0A 4G7ZF 4EM2A 3U9GA 2DO7A 3V7SA 2F5CA 2KRFA 5A2QK 4KIGA 4U7BA 4A6EA 3WTSC 4YFXF 5BQTA 1DPRA 5ED4A 1I5ZA 5CVRA 5LHIA 2VODA 1T38A 3ABTA 4O6JA 5H20A 1STZA 4RAZA 1BC7C 4I0AA 3SXYA 4KMFA 2VOPA 4FX0A 2FA5A 4L0ZB 3WE2A 3E5XA 4HDVA 3JTGA 4K2EA 1ZYRF 1W5SA 3MCZA 1RNLA 2QYOA 3BJ6A 3VODA 1TQPA 2VBXA 4RB1A 5L3GA 1ODDA 3WTYC 4S05A 2A5YB 1FBUA 4KDPA 4A2UA 5CLSA 3QAHA 3TDZC 2D1HA 4BYYA 4LB6B 2IT0A 1F9NA 1I27A 2PQ8A 3J7AO 3GO5A 4IXAA 5ILUA 3BWGA 1S8NA 2RNJA 3KP4A 4GCVA 3WGHA 2IPQX 3L2CA 1Z1DA 2O3FA 1R36A 4PDKA 1ZGJA 2DPDA 2G9WA 2F5FA 3KP7A 3SHFA 5DCMA 2H09A 3I64A 2PEXA 1S7AA 4G8XA 3RPUA 1FYKA 4MEXF 3N97A 2MH9A 2VBZA 2O61A 3EDPA 4U0YA 3VOEA 5HDNA 2ZFWA 4ENKA 1VTNC 3FXRA 4RB3C 1S3JA 2K02A 3HUGA 3KZZA 1LB2A 1Z05A 1ZRDA 2O6GE 1LEAA 1ZG3A 4QLCU 3JTHA 1FSHA 3ISPA 3F8MA 3U2RA 2V1UA 1HKTA 2PFBA 4HF1A 2GA2A 4MGRA 1B9NA 4LK0F 1T39A 1IRGA 3C1DA 3IWZA 1J75A 2ZKZA 5DCFA 4H0EA 2PLYA 2ESHA 4RB2C 1K79A 3WTWC 2QBYA 1EH6A 3HSRA 1IN4A 4HV5A 2Z9OA 3HYIA 1HQCA 2XIGA 3F8NA 4D0PA 1A04A 5EEGA 3HRUA 1XSVA 4EJTA 4OIOF 4MTEA 5JHUA 4Y17A 5HLIA 4LLGF 4AIHA 2NNNA 5J8FA 2YX7A 2M30A 4HX8A 5LLQA 5D5VB 3F8BA 1YW9A 4G94A 4ZH4F 4PGGA 1U5TA 4I2OA 3WE3A 3M1EA 2CG4A 2DAOA 2IVMA 1SFUA 4HA8A 4B8XA 3E6MA 4ASNA 2QQ9A 2EFQA 1U8RA 3CJNA 1HW5A 2AS5F 5JI6A 3MZHA 3BY6A 1BIAA 3M8FA 4XSZF 1P6RA 1YTYA 2VONA 3KP6A 2NNYA 1EH7A 1AWCA 3S2WA 2HKXA 3KZYA 4AWXB 2XV4S 3W6JB 5LEKA 4FX4A 2KIFA 4P96A 1USTA 2LKPA 5LGNA 1YQAA 1BI1A 4CICA 1U3EM 2L4AA 3D0SA 2Z5UA 4YFKF 5L3CA 3BOQA 1S29A 2J5OA 3SZTA 3VB2A 3W6KB 2LNBA 4CGZA 5E1XA 1BBYA 2BYVE 2V6CA 3V7RA 5LRSA 2VE8A 2DBBA 2EA4A 3M9AA 2Q0OA 2H27A 1ONVA 2LF7A 4KN4X 1FZPB 3ABUA 2XROA 4EJVA 5CVIA 5JFRA 3ZMUA 2BBYA 5AIPA 2K4BA 2EA2A 4KN7X 4LD5A 4EJOA 3FHZA 1SFXA 2F5EA 5FGMA 4I09A 3V8KA 3IRRA 2FSWA 2VT2A 3VFZA 3RTRA 3QP6A 2DI3A 4KNYA 2QZ8A 5AONA 2FBIA 3LQQA 2RN7A 4Z2YA 2CGPA 4LLNA 1XMAA 4L0YB 3RKWA 3QPTA 3ZQ7A 3K1PA 2XGXA 3ZPLA 2WTEA 2Y0MA 1YS7A 5ICEA 2YPRA 4HAMA 2ZXJA 1JHHA 5A2QZ 2LDUA 2JRTA 1FY7A 4ON0A 3IKTA 1KU9A 5K5RA 2Z33A 1ZN2A 1O7FA 4WXHA 3L00A 4ETSA 4ZYEA 4PGHA 2EB7A 1EV7A 5ILVA 2O03A 2D2WA 1SMTA 4OOIA 1G3TA 5LHHA 1H9GA 2DK8A 2G7HA 5BPDA 2M8EA 3KP5A 2Q8KA 4N9IA 1ZG1A 1IRFA 3EYIA 1P2FA 2UXXA 2RKHA 1Y0UA 2P5VA 1U78A 1Z6RA 1KA8A 3DPLC 4LG0B 1H0MA 3LA3A 4NB5A 1XB4A 3D5LA 3BPVA 2OU2A 3RDIA 4LGWA 3DXJF 1BI2A 3I59B 1WSUA 1DDNA 1X3UA 2HYGD 1QZZA 3P7NA 2DK5A 1I6XA 2JPBA 4YFNF 4G7HF 3F22A 3QRFF 2NAZA 1BIBA 1TBXA 1ZAOA 2XAGA 4EGZA 2V1XA 3DP7A 1W4MA 1G6NA 3MEXA 1T2KA 4M74A 3EQLF 1KYZA 4HDUA 1C0WA 3ZMZA 4A6DA 1KU2A 3KP3A 3V8LA 4P5OA 4EQQA 1IN7A 2QQAA 4ZYGA 1P4XA 3F3XA 5E8GA 1MZBA 4IF4A 4WCGA 2YR2A 4RGSA 4I02A 1HW2A 2P7CB 1HSTA 2TDXA 1XGSA 4FT8A 4RGUA 4BNCA 1FYMA 1XDSA 1R1TA 3G3ZA 4MTDA 5LGUA 2E1NA 3O6BB 2EV6A 1ULYA 2UZKA 1BM9A 1HBXG 4NQWA 1PP8F 2GQQA 3SFZA 1FYLA 3HSEA 2JSCA 3FMRA 1D5VA 2V79A 2P6TA 4ENMA 1XGMA 3PQJA 4P9UA 1G4DA 3GZ5A 1DP7P 3KFWX 1B9MA 3DFGA 3O3KA 2E7XA 1L0OC 2EFPA 2ACJA 1RIOH 3PFIA 2IJLA 5DEQA 4WK8F 2HKOA 2QQBA 1J5YA 1XMKA 3IWFA 1P92A 2DQLA 1USSA 2MA3A 1H9TA 1YLFA 3J80K 2ESNA 1YW7A 3IRQA 5DV5A 4A0ZA 3REOA 2L54A 2CO5A 2L02A 3B73A 3GEZA 4HV6A 4RS8A 3C7JA 4CYDA 3KEOA 3CO7C 5BS6A 1R7JA 4RGRA 2BEOA 3P9CA 3TOAA 5D8KB 2P4WA 2PMUA 5BMZA 1TLHB 5BPIA 2FEZA 1O3SA 5L3DA 1V4RA 4HQMA 4HOBA 2IP2A 2VC0A 1MD0A 4KIBA 2VN2A 2P7VB 1F4KA 2ZNYA 1R00A 1IN5A 2V9VA 4E70A 1UFMA 5DCMB 1ZGAA 5H6RA 1KQ8A 1MGTA 2STWA 4HLXA 2CFXA 2RGVA 2KJCA 5LEJA 1OPCA 1D8JA 3L7WA 4HYEA 1KU3A 5AIQA 4MQ9F 1RZ4A 3WTVC 3TO7A 4LK1F 2EJRA 2E7WA 1U5TC 1DPUA 2COMA 1LDDA 1YW8A 1YS6A 1OKRA 2HDCA 1QQIA 4IPAA 2VBYA 4OMYA 4GO1A 4XBFA 2YSRA 2HEOA 1WI9A 3GFJA 5F6FA 3GF2A 2M5WA 2VXZA 2XVCA 5HS7A 5DUKA 1R1UA 1FC3A 5D6EA 1R5HA 2WV0A 4L9JA 2F5DA 3KEQA 5L3FA 3JSPA 2FU4A 2QBYB 5LBQA 3HRTA 1IN8A 3HHHA 3LA7A 2RV8A 2MLKA 2R7FA 1TQMA 4PCQA 4R1HA 4L5JA 2QVOA 4IVNA 1MKMA 1P4AA 1ZHFA 2L01A 2NS0A 2ZJ2A 4L9NA 1G3YA 2FMLA 4CZZA 1U5TB 3CTAA 2Z3YA 2VE9A 4IRIA 1LEBA 2GWRA 2PN6A 2PMHA 4CDGA 4KT5C 1QBJA 3Q9VA 1FBSA 4EVIA 4R79A 3GYHX 2ZMEA 1UB9A 1FPQA 4Q48A 4IHTA 1YFHA 2MD5A 2ELHA 5D4RA 2EWNA 4XSXF 3T5XA 5K5QA 1BI3A 4HLYA 1HKSA 2HZTA 2YU3A 2G7UA 4UHTA 2DLLA 1CGPA 5FFZA 1ON2A 1RI7A 3MAJA 3FMQA 5LGTA 1O57A 2L3DA 2A69F 3FMSA 1OYIA 1J0RA 3NQOA 5IT3A 2A3SA 3IHUA 3LWFA 1OYYA 3QU6A 5F64A 4L18B 1TW3A 3OOPA 3WG9A 2CWEA 2HS5A 5D5UB 1DUXC 1ZRCA 3GW2A 1XCVA 3BJOA 1O7LA 3H92A 3ZN1A 4O5VA 5D5WB 4DNCA 2PBIA 1P4WA 3GWZA 5TRDA 2A07F 3ZP5A 2W25A 3KE2A 4MEYF 3CO6C 1CF7B 1QZYA 2IA2A 1UCRA 2UXNA 2NRAC 1LVAA 3M7GA 2XKPA 4HX7A 3WODF 2FQ3A 3QP5A 3ZMDA 5CYVA 2GIVA 3LFKA 3K1NA 3EETA 2D45A 4BH9A 3DF8A 3Q5FA 1WWXA 3IKVA 1CF7A 5E1ZB 1O3RA 2FXAA 2V1DA 4ZYDA 4M6XA 3FM3A 3LAPA 2HTSA 1R5GA 2QENA 5FD6A 1MDMA 1FX7A 3ZMVA 1RUOA 5LRRA 4BXUA 2HQNA 3HRSA 4R8HA 1IXRC 4U0VA 4AIJA 2OZ6A 5ERIA 4WWCA 2Y48A 2DFIA 4FHTA 3FX3A 3BPXA 2D1VA 3CDHA 3HOTA 4OIPF 4YIFA 2XUBA 5D5XB 3I5UA 3GFLA 6PAXA 4U0WA 3CLOA 1AOYA 3I54A 4YG2F 4RGXA 2XAFA 5CVVA 4O3MA 3EYYA 3H3UA 1W7PD 2GZWA 1T6SA 4UVCA 1KQ9A 1SAXA 3R0JA 1XDUA 3K9TA 4QWQA 1OYWA 1UHWA 1SD7A 2RDPA 2CW0F 2XAQA 2K27A 3SQNA 4LJZF 3J80Z 4DQ2A 4G6QA 5H6QA 2PJPA 3F8FA 2OQRA 3T0YA 2K4JA 2M45A 1IUYA 4OU0A 2RC4A 2W57A 4P9FA 2HGCA 1IAWA 1TTYA 3BDDA 3GLXA 1SD4A 1QO0D 5CVUA 2EFOA 3RJPA 4WX9A 3HOSA 2OZUA 1J59A 1ZRFA 1LJ9A 2JZYA 2EFNA 2M1BA 1Z7UA 4BHPA 5HOOA 2ZBKA 5IT9K 1UHMA 5DD8A 1FP2A 4EM0B 1K78B 1IZ1A 4N0BA 4ESFA 5K5OA 1IXCA 1FSEA 3E5QA 2W84A 3RKYA 1SMYF 3ERED 1FWZA 2VOOA 5F1RA 3RKXA 3NRVA 4IHSA 3TDUC 1B59A 2H6BA 1R22A 1MJBA 2CSOA 5DDGA 1K78A 2FOKA 4I0BA 2X0LA 4GYIA 1LDKB 2F2EA 2OD5A 3QU3A 1HW1A 2P5KA 2BGCA 3KLOA 3LSTA 3K69A 4CHUA 4MHGA 2MC3A 4WF2A 3OV8A 4L9VA 1QPMA 4F7ZA 1BOAA 3G73A 2DTRA 1J7KA 2KJBA 5HLGA 1J9IA 2A6HF 1ZREA 2HTJA 2JT1A 2KKOA 2QLZA 2LSOA 2FBHA 2XKOA 2FBKA 3L09A 2MH2A 3I53A 3TQNA 2VT3A 1BC8C 1U2WA 4XLPF 1LNWA 1R1VA 3R4KA 5ILSA 4HW0A 3MZYA 1D3YA 2DT5A 4LLLA 1J2XA 3JAMK 3P9IA 2DW4A
chains in the Genus database with same CATH superfamily
5J6XA 2VB6A 2BZTA 1ERDA 4KA4A 1FT9A 4BBRJ 1ZKGA 3PUFA 2KRHA 1FBQA 3OS2A 4EGYA 3E6CC 2KISA 1OISA 4ENJA 1ON1A 2O0YA 4BKXA 3CUQA 4ESJA 5EEHA 2OJED 4AIKA 3WU0A 2CUFA 1POGA 3H3ZA 3IP4B 2DODA 5GPAA 3GTLJ 1YO5C 1HXDA 1I6HJ 5KAIC 5JLXA 3BJAA 3AKZA 2WC2A 2R7QA 2WY8Q 3MFKA 3R61A 2CQKA 1VQMI 1YHQI 2CYYA 5M5YJ 1D0YA 4AC0A 3BR6A 1MJ9A 2R7OA 3I71A 1Y56A 3CCRI 1SD6A 3A1YA 2R7VA 3VDXA 4C9YA 1WQ2A 2KIUA 1Q1HA 3ABLH 1FEXA 1GDTA 3R60A 2CFOA 3CJQB 3QPSA 2LY9A 4ZZLA 2UUZA 2HNHA 2LK2A 2ICWG 2NYXA 3DLAA 5FB2A 1FMVA 4M3BA 3OR1C 2GAUA 1HSJA 1SFEA 4F91B 4RA2A 1B1BA 2WWYA 1VNDA 5HLHA 3VWBA 1GV5A 2HU9A 3OYIA 4WXDA 2CQQA 1N78A 4N4OB 4BE1A 3ZQCA 2ZNZA 4UNOA 3ELKA 3ZN0A 2H1LA 1MMNA 4ENNA 1XSDA 1VQNI 2EK5A 4JX6A 4PJJA 2X6XA 2IAIA 2VPLA 2R3SA 1MH4A 5ICFA 3K70D 2FRHA 2IA0A 4GGGA 4A3CJ 1Z6TA 2HQAA 3A0HC 1YIOA 2GXGA 2O5RA 1VQLI 1YE9A 2IGMA 1WZ2A 2MG4A 3H9QA 3S2HJ 4KFCA 3ZQGA 2QM3A 4HSRA 2EZLA 4P55A 4GYGA 2R7ZJ 2ZMEC 3IL2A 1VQOI 5KK1A 4CCLA 2Y9YA 2NVXJ 2M87A 3CF5F 1SANA 4UV9A 1G3SA 4L5EA 3LQRA 2PG4A 2CUZA 3HRMA 4NHJA 4LG3A 4PZJA 1G59A 1LQ1A 5FFXA 5L3BA 2HOEA 3FXKA 2QF7A 1TQIA 1YG2A 4BAYA 3V4GA 5EGOA 2FD5A 4PFOA 4LG0B 1Z9CA 2FNPA 1U6GA 1XN7A 4M72A 5C44J 3WTXC 1TNSA 1MNMC 4FE7A 3QQAA 2HOSA 2QSHX 4UXNA 4G6DA 3A4CA 4HX4A 2ISZA 1Z21A 2E1CA 4Q5SF 4LIVA 3OL4A 3HTSB 1LVKA 1I3QJ 3BG6A 2RQQA 2R0QC 1KZHA 4EM1A 2IBDA 3LAJA 5JR3A 4D5FA 3M3YJ 4I01A 1OR7A 2ZCWA 2LYCA 5J1UA 4KITB 4F92B 5BNGA 5FLXK 2FMYA 3DEUA 5E8IA 1RUNA 1H89C 3HPGA 4M71A 3WGIA 2H8RA 1WI3A 5FKMA 1ZARA 1Z67A 2BV6A 3E97A 3PO2J 2E5ZA 4I7HA 3FZVA 3OOUA 5J40A 4LFUA 1FP1D 1WRJA 3HEFA 4JBAA 1DU0A 3U1KA 3OSFA 4XRFA 1LUJB 1X3ZB 2JSPA 1S72I 4B44A 3L2UA 1PUFA 4J01A 2ZMEB 3BR1A 5E79C 4ZYHA 3SZPA 3F23A 3J81K 1IGNA 3E3VA 1R6RA 1D0XA 2I8DA 4IRHA 4E7LA 5J3LA 1WKMA 3FWEA 2NS7A 3RPUD 4C2MJ 3OYMA 2F6CA 4EJWA 4RAYA 3ECOA 3E6BA 1D8KA 2DFEA 2P8TA 1PDNC 1X1AA 1Y39A 4A3DJ 3RZOJ 4KICA 2HDWA 3CP2A 5LHGA 3WGGA 4I98B 1HKQA 2DQRA 2CH0A 2ZXIA 3DV8A 3FXQA 2GA1A 1MMSA 4XNFA 2KMUA 3GMEA 4HBLA 3Q9SA 3FF5A 5FO5A 2H8WA 1QGPA 3T8RA 1OMIA 1E17A 3P5JA 1X3WB 3T1BA 4A93J 3ROUA 4ZTJA 4N9HA 4D7NA 4BE0A 4BJ6C 1AKHA 2AXLA 4CA0A 5DD4A 3IC7A 3LMMA 2M3AA 2KFDA 2P5LC 1TP4A 3BP8A 1UHSA 2W82A 3NWSA 3SEZA 2CV0A 3EUHA 4U7DA 3GFIA 1QU3A 2ZB9A 2M9HA 3CCSI 1I1SA 5FD5A 4HF2A 2L9RA 1FOKA 1NG6A 3BZ6A 1DP3A 2K86A 1KYWA 3OYDA 4XLHA 3D1NI 3F6OA 5E1WA 5C3EJ 1F1ZA 1ZG5A 3KP2A 1V3FA 2IW5A 1TWHJ 3EPZA 3GBGA 1A35A 1O3TA 3K0LA 2XASA 2OQGA 3LA2A 1PUEE 1T56A 2LY1A 3GVAA 3KX2A 2OBPA 3TL4X 3V7CA 3M8JA 1V54H 2QWWA 3DQVC 5HDGA 2EV5A 4UUVA 3R6SA 4E6KG 1XGNA 1M1EB 3CJRB 4C2TA 4LB5A 4E7IA 3M8EA 1K6YA 4UV8A 1WCMJ 1JGSA 3VEPA 1I1GA 3VSKA 2CV1A 3BG5A 2P81A 2GXBA 1ZLKA 2AXTC 4RB0A 1N77A 3QODA 4OIQF 2YX4A 4XORA 2FE3A 1ZTRA 2JTVA 5DM6F 1U8BA 5ICCA 2E2JJ 2H6CA 5IYDJ 2R5ZB 2O8XA 2QUFA 5IT9Z 2CS3A 2ZC2A 3ZMSA 3LSRA 4ABZA 4M9XA 2H94A 3T8TA 1ZGWA 1UAAA 1Z3XA 3AAFA 1FLIA 1Z91A 3CCLI 5J8CA 2Y75A 2A61A 4AIDA 4OAYA 3ESWB 5FKLA 3C3WA 3E6DA 2JUCA 2HVRA 1Y1WJ 3HSFA 1K7AA 2M0MA 1T98A 3LSMA 4ZJZA 2HOAA 3HC7A 2EFWA 3F72A 1IXSB 4ZZDA 4DBRA 3E5UA 4XKWA 2MC4A 3TO9A 1Q1VA 4NBQA 5GADJ 3NWTA 4KUMA 3RYRA 3DPTA 2VJIA 3VYRB 2ETHA 2R5ZA 5E17F 3RYPA 2L7ZA 3CCQI 4PJ0C 1Y6IA 2ECCA 3N4MA 1W7PB 3EUKL 2DPUA 3E0JB 4BEHB 1MDMB 1X1DA 5HS9A 1BN5A 3F8CA 5L3EA 1BI0A 1ETXA 3TO6A 2X4HA 3OYEA 2E36A 3I58A 2W85A 1FMWA 3ZMTA 4A3MJ 2KP6A 5BOXA 1ORKA 1Z77A 4EV0A 4GXOA 3F21A 2LBFA 2HYFA 3NEUA 2W1OA 3LSJA 3DKWA 1TNTA 4ZDOA 1MMDA 4M73A 3VYSB 1QA6A 3ULQB 1XD7A 3CMYA 3DTKA 3LSKA 3BLYA 4AD9A 4D7MA 2ISYA 1YYVA 1W7PA 2STTA 3KYCB 2WB1A 2E60A 2Z99A 3RIRA 4NDLA 3W2VA 5B1BH 4Q4ZF 2CJJA 4EJUA 5HDKA 2FNAA 3I4PA 4A12A 4JQFA 3FKJA 4MLOA 2EZIA 2OA4A 1MJAA 1TW2A 3MQ0A 3PL8A 2R7TA 2QQ8A 3RKQA 2DA6A 1F5TA 4AVPA 3ML6A 4OIRF 5DTDA 2YU9J 2WADA 5J1RA 4BHCA 4WXCA 2RVCA 5TJJA 3A2KA 3BG9A 4RDUA 2X85A 2BHZA 3RPQA 2W7NA 1Z3YA 4U88A 2VJ4A 4BQNA 3HPHA 4BQAA 1VQPI 3WHBA 3R0AA 5K1YA 2VQCA 4CO8A 5B66C 4MNUA 1T0FA 3JR9A 2LMDA 5D8LB 2X51A 4A0XA 1EH8A 5IP9J 2HR3A 3LSIA 3QPHA 2DMTA 2VKHA 3GZ6A 2BE5F 3L9FA 4II3A 5IOYA 3TEDA 3JAMZ 3BR2A 3RI4A 4G7OF 2PMZN 3U1DA 3VPRA 1W36D 4Y33A 3C18A 3CUOA 1ENHA 2DU9A 2DYSH 2BW3A 2KDZA 5FKOA 3JSOA 1IRXA 3HHGA 4KIFA 2VUMJ 3JRFA 2UWMA 4M6YA 3K2ZA 4UVAA 3OYNA 2VC1A 4Q47A 2E19A 4KMUX 2EZKA 5CJ9A 1R23A 3CDLA 3S15J 1BA5A 3PIOF 1GXPA 4Y3OA 3JW4A 2VQLA 5JVTA 1JTYA 2B0LA 1S6LA 3PO3J 3MZ8A 2L4MA 3OYJA 2VBWA 3RZDJ 2R7DA 2F4MB 4IJAA 4YIIA 3UKGA 3H35A 4A3IJ 3OWTA 3FM5A 4E7KA 1R58A 2JUGA 4XKCA 5DYMA 1ETVA 1LFBA 3BC8A 2C6YA 1WH5A 1YJNI 4ESBA 1S9HA 3HDDA 3HTUA 3Q0WA 2ADUA 2GBYA 5K7FA 5D6FA 1ZH5A 2JQ7A 1W5TA 2K40A 2XHKA 1X1PA 4B4CA 5J4YA 4S04A 4BDYA 3RQIA 2A6EF 2K5CA 2XB5A 2XPVA 1E2XA 5E20A 1JXSA 2NVYJ 2VASA 3GX4X 1IF1A 3MWMA 4KJZA 3SEQA 1S7OA 3HOWJ 1B4AA 4CXFA 1GXQA 4D5CA 3KLNA 4PSXA 2RNGA 2D5VA 3RSNA 1G8XA 1LDJA 2GIZA 4B47A 3FXLA 2FF4A 3G1MA 2JRMA 5KVRA 4CH7A 1REPC 2PI0A 3TOBA 3FXUA 1YI2I 4KYWA 1MMGA 1NHAA 2XAJA 2IRFG 2XAHA 2A68F 3WTZA 2J5PA 4HRIA 1IW7F 1TZLA 3WTTC 3KCCA 3ECHA 4G9YA 3BROA 2F4OB 2I10A 3CLQA 3GXOA 3DPUA 4C3HJ 2HPIA 4HF0A 1XCBA 2V9KA 4Y13A 1IG7A 4A0YA 1PJRA 3C2HA 2GM4A 4AU7A 2KIMA 1VQ6I 2QEXI 3CUQC 1KGSA 2CQXA 4CCKA 4Y15A 3WG7H 3F6VA 1VF9A 3OYHA 3COAC 1Y1VJ 2HDDA 2KQRA 1PP7U 2EILH 5LD2C 3B02A 3WU1B 4RM2A 4I76A 3SDBA 4F3QA 3P9KA 5IOZA 4LG0A 4YELA 4M6VA 2MBFA 3I59A 1Y0NA 4IEJA 4GRIA 4A3GJ 1RC9A 2JA5J 3GFMA 4V2GA 1ZLJA 1B6AA 3BTIA 3K70C 3HOYJ 2HQRA 1FNNA 4XLEA 3S16J 4LMYA 2P6SA 1X58A 3DWLE 4A5NA 1SD5A 2HXIA 1XGOA 3LL7A 5ICGA 3E7LA 1JHFA 1QNTA 4MO7A 4MQVA 2IA1A 2HFHA 2IGKA 3BTLA 4TV7A 3Q0UA 3DU5A 4XRSA 1BJAA 2ZO4A 3H9GA 3K1MA 1WGXA 2JPCA 4HQEA 5FLXZ 1VQ5I 2MLGA 1MBEA 4BXFA 3TGNA 1JUMA 3WTUC 4OMZA 2HWVA 3KETA 5E18F 1K6OA 2DA7A 1KONA 3PQKA 1EKEA 1HOMA 1KU7A 1O3QA 1XS9A 4UUSA 3PUBA 4JK1X 3L1PA 2K7LA 2DFFA 3MN2A 5HVQC 1IUFA 4L9TA 2IS4A 2FUG2 2TCTA 5DUIA 1H8AC 1UELB 5D4SA 2JWTA 4IO9F 2F5VA 1NK3P 5HS8A 4BHBA 1KQ0A 2BOLA 1JE8A 3J81Z 4EMSA 4G6TB 5JVGF 3I4MJ 4OINF 5GTIC 1XSXA 3O2PE 4M9ZA 2Q2EA 3CUQB 3OL3A 4A5MA 4PJNA 2Y0SA 1GHCA 3TBIA 4L5IA 1UG0A 2LRDA 2VI6A 1IO2A 2XRNA 1G3WA 3QOPA 1L3LA 2E2IJ 5CVJA 4XRSG 4B1RA 4IOAF 3I0TA 4PSWA 4IQJA 3HB9A 4M9SA 3ZRGA 4IRGA 4UVBA 3SFIA 2DTZA 2RQPA 4UY8I 2LF8A 4XLNF 1OCCH 3IH4A 2W24A 4B09A 4HZFA 3HIFA 3GUDA 2CQ7A 2OAZA 1VQ9I 4E7JA 3V8JA 1GVJA 3BG7A 3TKYA 1IN6A 1IC8A 5FROA 5HNHA 2EV0A 2HI3A 4G7ZF 4EM2A 4RM3A 2Y2ZA 3U9GA 2CRGA 2DO7A 4ZYAA 3V7SA 4AYBA 3KZIC 2F5CA 1MNEA 2KRFA 5A2QK 4KIGA 1RPWA 4U7BA 1X4OA 4A6EA 5GAHJ 3S1MJ 2EINH 4M3EA 3WTSC 5E3NA 4YFXF 5BQTA 3A01A 4DIQA 1DPRA 2E34A 1ETWA 1I5ZA 1X1CA 5CVRA 5LHIA 5ED4A 2VODA 1YX5A 1T38A 5F27A 3ABTA 4O6JA 3HGYA 1OR7C 5H20A 1STZA 5EEAA 4RAZA 3QYFA 1BC7C 1FOXA 4I0AA 4CYCA 3BTJA 3SXYA 4KMFA 3BR0A 3CCVI 4XOPA 1H88C 2VOPA 3JRHA 2YUSA 1OQYA 4FX0A 2L9SA 2FA5A 4L0ZB 3WE2A 3JRIA 2QKLB 3E5XA 4HDVA 5H2FC 3JTGA 2OCCH 4K2EA 1ZYRF 1W5SA 3MCZA 3S1QJ 1RNLA 2QYOA 3BJ6A 3VODA 1TQPA 3ZOBA 2VBXA 3HJEA 4RB1A 5L3GA 2XDVA 5F0HA 1E3OC 1ETYA 1ODDA 2NOGA 3RQ4A 3OIOA 3WTYC 1FIAA 4S05A 5FKKA 3PFYA 2KIQA 2A5YB 1FBUA 5EGOB 4KDPA 4A2UA 5CLSA 3QAHA 3TDZC 2D1HA 4BYYA 4LB6B 2NVTJ 2IT0A 1ZR4A 1F9NA 1I27A 2PQ8A 3WHCA 1FTTA 3J7AO 3GO5A 4IXAA 1SVOA 5ILUA 4PJMA 2O9LA 3BWGA 1S8NA 3HKZA 2RNJA 3DBLB 3KP4A 3NARA 1FTZA 4GCVA 2QKMB 3WGHA 2MGQA 2IPQX 3L2CA 1Z1DA 2K85A 2JA2A 2O3FA 1R36A 2KRCA 4PDKA 4EATA 1RETA 4V2FA 1ZGJA 4DW6A 1LPQA 4A3EJ 2G9WA 2DPDA 2F5FA 2IS6A 3EUHC 3KP7A 4XONA 1WVRA 2K9SA 3SHFA 1VI0A 2XGEA 1XMXA 2YS9A 5DCMA 4X0GA 3JRDA 2H09A 3I64A 5HLTA 2PEXA 1S7AA 2XF7A 4Y52J 4G8XA 3RPUA 1DGRM 1VQ4I 1FYKA 3ZGKA 4MEXF 1PUFB 1SAUA 1XPXA 2ZSIB 3N97A 3IH2A 2MH9A 2VBZA 2LD5A 2O61A 3EDPA 4KISA 3CC2I 1QVTA 4U0YA 3VOEA 5HDNA 2ZFWA 4IQ4A 4ENKA 3FXRA 1VTNC 4RB3C 5EZHA 1S3JA 2K02A 3HUGA 3KZZA 1LB2A 3Q0VA 3FXOA 1Z05A 1ZRDA 2O6GE 4A3FJ 1LEAA 4IHWA 1ZG3A 4QLCU 3JTHA 2NVQJ 1FSHA 3ISPA 3F8MA 4A69C 3U2RA 4DYQA 2V1UA 2NXNB 1HKTA 4IKFA 3GZNB 3K4CA 3H3VK 2PFBA 3DEEA 4HF1A 1AA7A 2GA2A 3DEWA 4MGRA 1AKHB 1B9NA 2XF5A 1DQUA 4LK0F 1T39A 3OYAA 1IRGA 3C1DA 1U9NA 3IWZA 3ZQIA 5F1JA 1B8IA 1ACIA 1J75A 2ZKZA 5DCFA 1E3HA 4HPQA 1WPKA 4H0EA 2PLYA 3K4NA 2DA2A 2ESHA 3ZQFA 1W5CC 2UV1A 1I39A 2WAQA 4RB2C 1YJWI 4IOCF 1W1WE 1K79A 3PSIA 3WTWC 4CCNA 2QBYA 3FXJA 1EH6A 3HSRA 1IN4A 4HV5A 2Z9OA 5E3OA 4PK4A 3HYIA 3ZQQA 3OYGA 1HQCA 2XIGA 1YRNA 4DOZA 1O4XA 3F8NA 1A6QA 2DT6A 4D0PA 1IRZA 2DXIA 4GFBA 3PSFA 1A04A 5EEGA 4HG2A 3KIOA 3HRUA 1XSVA 4JOMA 4EJTA 4OIOF 4Y4RA 4MTEA 5JHUA 3L2QA 4Y17A 5HLIA 4LLGF 4AIHA 1BR2A 2IXSA 1R4MB 2NNNA 5J8FA 2YX7A 2M30A 2ZXHA 3JRBA 5GAGJ 4HX8A 5EF6A 5LLQA 5D5VB 2ELKA 3F8BA 1YW9A 4G94A 3G4SI 4ZH4F 4PGGA 3L2RA 3BCBA 3OYKA 2O7OA 1U5TA 3A0BC 3ZXSA 3JCUC 4G12A 4I2OA 3M1EA 3WE3A 1RKWA 2CG4A 2DAOA 2IVMA 2N8GA 4YIRX 4FTHA 4HA8A 1SFUA 1W36C 2IS2A 3BZKA 4B8XA 3A03A 2ECBA 3GCMA 2VJJA 4NC6A 3E6MA 4IHXA 4ASNA 2W48A 2LVSA 2OC6A 2QQ9A 2EFQA 4AM3A 1U8RA 1SVLA 3CJNA 1UZCA 4P1WA 3I9V2 3CMEI 1HW5A 3G6EI 1AHDP 1MSFC 4XK4A 2AS5F 3DU6A 1XC5A 3QPLA 5JI6A 3MZHA 5FRMA 1B72B 1LKXA 3BY6A 1G2HA 2K9NA 1BIAA 3M8FA 3JRCA 2V4JC 4XSZF 5M3FJ 1P6RA 1YTYA 1T0FC 2OCEA 2VONA 5JHFA 3KP6A 4LITA 5KNLA 2EIJH 3AG4H 3HZJA 1BJZA 3ERMA 5EG0B 2WV1A 2MABA 2NNYA 1TL8A 4OAZA 5B1AH 3IAS2 1EH7A 5EDNA 1AWCA 4B3AA 4X1EA 3S2WA 2M4GA 2HKXA 2DA3A 4KT6A 2ME0A 3FBIB 3KZYA 4AWXB 2XV4S 3W6JB 5LEKA 2LBFB 4FX4A 1JKPC 1MBFA 1B72A 2KIFA 2Z2SB 3H1CA 4P96A 1USTA 2LKPA 2OF7A 5LGNA 1YQAA 1BI1A 2BXZA 4U87A 4CICA 1U3EM 1QHHD 2L4AA 3D0SA 1T95A 2Z5UA 3FK7A 4HSTA 4RLQA 2FQ4A 4YFKF 1CQTA 5K7ZA 3ZR8X 5L3CA 5F08A 3BOQA 1S29A 5EG0A 1MBKA 3JRAA 2J5OA 1RESA 1MNDA 4BJ5C 2M4KA 3SZTA 3VB2A 2WY7Q 3W6KB 2K3FA 2LNBA 4CGZA 5E1XA 1BBYA 3M4OJ 3GLLA 2BYVE 2V6CA 3V7RA 5EJCA 2VLAA 5LRSA 5FLVA 4Z6YA 2VE8A 2DBBA 2EA4A 3M9AA 4FETA 2DA1A 2Q0OA 2H27A 1ONVA 2LF7A 2GLOA 1PYVA 4KN4X 3JRGA 1FZPB 3CF2A 5GPCA 3ABUA 2XROA 4BQOA 1TT5B 1BR1A 3D5RC 4EJVA 1YITI 5CVIA 2WAEA 4NC7A 5JFRA 4BDZA 3ZMUA 3E1SA 2K9LA 2BBYA 5AIPA 3HL2A 2K4BA 1ITYA 2EA2A 2BXYA 3OYFA 3ZCOA 1MBJA 2L9VA 1K4SA 4KN7X 1IJWC 1T08B 4LD5A 4CZCA 2F48A 2MW8A 4DYCA 3CC7I 4EJOA 3FHZA 1WJBA 1SFXA 2F5EA 5JLWA 5FGMA 4I09A 3V8KA 4XN0A 3IRRA 2FSWA 2BW3B 3MKZA 4DZPA 2LLKA 2ZJQF 2VT2A 4DZJA 4LIUA 3BR3A 5EZGA 4BU2A 3VFZA 3RTRA 5FJ8J 1BR4A 1JKRC 3QP6A 2DI3A 2QGUA 5J1YA 2EZHA 1OCOH 4J00A 2I5UA 3S3NA 4KNYA 2QZ8A 5AONA 3ABKH 2FBIA 3FBNB 1ETQA 3LQQA 2RN7A 3B6AA 1GLNA 4Z2YA 2CGPA 2DMNA 1Y8QB 4LLNA 4HNUA 1XMAA 2K9MA 4BBSJ 3EUAA 4L0YB 2R7XA 4HNVA 3RKWA 4FISA 4RAFA 4ZDPA 2JA8J 3QPTA 1FJLA 3ZQ7A 3K1PA 3PIPF 1QVUA 2P0WA 2XGXA 2Z1DA 3F0CA 2WTEA 1D1AA 4FQGA 3ZPLA 1SC7A 2NOJB 2Y0MA 1YS7A 3KYLA 4RAGA 3CD6I 5ICEA 2EIKH 2YPRA 4HAMA 1OCZH 5C4XJ 2ZXJA 1JHHA 2M8GX 2JVHA 3I55I 5A2QZ 2LDUA 5IYCJ 2R7SA 3S17J 1U0JA 2JRTA 2OPTA 3AG1H 1MMAA 3B6CA 3BQYA 2Y9ZA 4M3DA 1W0UA 3CMMA 1FY7A 4ON0A 3IKTA 1KU9A 5K5RA 2Z33A 2VKEA 1ZN2A 1O7FA 4WXHA 2B9SA 3L00A 4ETSA 3GTQJ 4ZYEA 3A02A 4PGHA 2FOWA 4D1QA 2EB7A 4XL9A 1IDZA 4S0HB 1D1BA 3DKYA 2ME6A 1EV7A 1T8IA 2X48A 3FXMA 5ILVA 4BQQA 2O03A 1SMTA 2D2WA 4OOIA 1G3TA 5LHHA 1H9GA 2DK8A 3BG3A 5GP9A 1FOWA 3VYTB 2HZDA 2G7HA 3TP3A 2VKDA 5BPDA 1HF0A 2L7FP 1P9QC 4F93B 2M8EA 3F9KA 5TGTA 3W3CA 1WH7A 3KP5A 1R71A 4IHVA 2Q8KA 2LG4A 1OCRH 2LFBA 4N9IA 1ZG1A 1TC3C 1HDDC 1IRFA 4RBOA 3EYIA 2VJ5A 4CCJA 4XLAA 1P2FA 2BVLA 2DJIA 2UXXA 3CCEI 2RKHA 1Y0UA 1HA8A 2P5VA 4FE4A 4XN3A 3RCOA 2X1CA 1U78A 3OSGA 3GTOJ 2LY2A 1Z6RA 1KA8A 3DPLC 2E5NA 1H0MA 3LA3A 4NB5A 1GT0C 1XB4A 3D5LA 3BPVA 4BGDA 3C2BA 1JJ6C 1X4PA 2OU2A 2R7UA 3RDIA 4LGWA 3DXJF 1BI2A 3I59B 3BR5A 2FX0A 3OIQA 1WSUA 1DDNA 5FRNA 3OYBA 1X3UA 2HYGD 1QZZA 2L9NA 2EIMH 3ABMH 3P7NA 2DK5A 2VQGA 1D5YA 1MH3A 1I6XA 2JPBA 4XLFA 5IP7J 3OS1A 3JREA 2E2HJ 1R4NB 4YFNF 2F4IA 4G7HF 3F22A 3J7ZI 1X19A 3TW7A 2R93J 3H9JA 3QRFF 2NAZA 3PNYA 5B3SH 1BIBA 2DN0A 1TBXA 3BQZA 2EBIA 1ZAOA 3ASOH 2RREA 2M7AA 2XAGA 2ID3A 2E35A 4EGZA 2HXOA 2V1XA 3DP7A 4UUSB 1W4MA 1G6NA 2LH9A 2G0EA 3MEXA 5LFAA 1T2KA 3AG3H 4M74A 3S93A 3EQLF 1KYZA 4HDUA 1C0WA 1F43A 2H1KA 3BT9A 3ZMZA 4A6DA 3LOCA 4B48A 1KU2A 3KYDB 2JA7J 3OR2C 3KP3A 3V8LA 1D1CA 4P5OA 2Q2EB 4EQQA 4GDFA 1IN7A 1GVDA 1EJ9A 1K83J 2QQAA 4ZYGA 1P4XA 1OJLA 2JK3A 3H0GJ 3F3XA 5E8GA 2DDBA 4UB8C 1MZBA 2OTJI 4IF4A 1LE8A 4WCGA 2YR2A 4C3IJ 4A3KJ 4RGSA 4I02A 4NQWB 1HW2A 4MFDA 2P7CB 1HSTA 2TDXA 1JJ8C 3GTKJ 5EYRA 4C3JJ 2OTLI 1XGSA 4HNTA 4BJTA 4FT8A 4RGUA 4BNCA 1FYMA 1XDSA 1VQ7I 1R1TA 2VL8A 2VXDA 3G3ZA 5LGUA 2M2EA 4MTDA 2E1NA 1RKTA 3S1NJ 4DGWB 1WJEA 3DBRB 1ZELA 3O6BB 4BS9A 1XTAA 4UB6C 3BTCA 2A5WA 2CW8A 2EV6A 1VQ8I 5FLMJ 4W97A 1ULYA 2L7MP 2UZKA 3AFHA 2V7FA 4BL0B 1BM9A 1HBXG 4NQWA 3SZGA 3L2VA 1PP8F 2GQQA 2BHYA 3DCFA 2MFZA 3SFZA 1FYLA 3HSEA 3A01B 2JSCA 1D0ZA 3FMRA 4IZZA 4BE2A 2IGOA 1D5VA 2M7BA 2V79A 2P6TA 2DOEA 4ENMA 1XGMA 3PQJA 4J19A 4P9UA 3SDGA 4CYCB 1G4DA 3GZ5A 1DP7P 2Q1ZB 3KFWX 1B9MA 3DFGA 4ANJA 3O3KA 2E7XA 1L0OC 2EFPA 3K10A 2ACJA 4XOTA 2KLOA 1K4TA 1RIOH 4JX5A 3PFIA 2IJLA 4N4NB 5DEQA 4WK8F 1JUSA 1E0EA 2HKOA 2VPRA 2QQBA 1J5YA 1XMKA 3IWFA 3K4JA 1MBHA 3ONQA 2CQNA 1P92A 1S5LC 2NVUB 2EH3A 1EA3A 1SFKA 2MD0A 2DQLA 1USSA 2MA3A 3G1LA 3HOXJ 3FHNA 1H9TA 2VQHA 3HBLA 3DBHB 1YLFA 1TT0A 3J80K 2ESNA 2XSDC 2L0KA 3PNTA 1OCPA 1YW7A 3IRQA 2LKXA 2IGNA 1V5GA 1JKQC 2MSYA 5DV5A 1MIJA 4A0ZA 2Y30A 3REOA 4ITVA 3CMAI 2L54A 2CO5A 2L02A 3B73A 3GEZA 3QWLA 4HV6A 4RS8A 3C7JA 4QPQA 2XPWA 3KEOA 4CYDA 3CO7C 1SFOJ 2XGCA 5BS6A 1IV8A 2PMZA 1JT6A 1R7JA 4RGRA 4XICA 1ETKA 2DMQA 2BEOA 5CQGA 2LKSA 3P9CA 3TOAA 5D8KB 2P4WA 1FOYA 2PMUA 4XMYA 5BMZA 3J7AY 1TLHB 4B43A 4Y7NJ 1WHUA 5BPIA 3CCYA 3W2AA 3KEYA 5J4VA 2FEZA 4CCMA 2CU7A 1O3SA 5L3DA 1V4RA 4HQMA 4HOBA 4XKVA 2IP2A 2VC0A 3I4NJ 2DDAA 1MD0A 3NAUA 4KIBA 2X1DA 2VN2A 2P7VB 2XGDA 1F4KA 2ZNYA 3AL0C 1R00A 2A6TA 1BW6A 1IN5A 2V9VA 4E70A 1UFMA 5DCMB 2CW7A 3V42A 4F52A 1MBGA 4A3BJ 2Y69H 1EF4A 1ZGAA 5H6RA 3W6VA 1KQ8A 1MGTA 2STWA 3ASNH 4HLXA 2CFXA 1HCRA 2WB1N 2RGVA 3OMYA 2KJCA 3DLLF 1U9OA 1A31A 3LSPA 5LEJA 1JKOC 3CJTB 1W0TA 1OPCA 2CMPA 4DYRA 3OS0A 1D8JA 1F36A 3HUGB 3L7WA 3IAM2 4HYEA 3ZQHA 1KU3A 5AIQA 3FIWA 1DU6A 4JP0A 5K7HA 5GTHC 1TWGJ 4MQ9F 1RZ4A 3WTVC 1WJFA 3TO7A 4LK1F 4C30A 4PUSA 2EJRA 2E7WA 2B63J 4MFEA 1U5TC 1DPUA 1WFXA 2COMA 4LOCA 1LDDA 1YW8A 1YS6A 1OKRA 2GOXB 4HEA2 2HDCA 1QQIA 4IPAA 2KDOA 4H4KC 2VBYA 2X6WA 4OMYA 1QRYA 2ID6A 4GO1A 2KL4A 1UG2A 2YSRA 4XBFA 2XC7A 1HLVA 2HEOA 1WI9A 3GFJA 5F6FA 2OV7A 1B8IB 2M34A 3GF2A 2RAEA 2M5WA 3GTJJ 3LFUA 2VXZA 2XVCA 5HS7A 3OYLA 4NNJA 5DUKA 1S7EA 3W2WA 5HNFA 1R1UA 1FC3A 5D6EA 3AL0B 3ZQLA 1R5HA 2V6EA 2WV0A 2QSFX 4L9JA 2F5DA 3KEQA 1RR7A 4NC8A 5L3FA 4YRVA 2R5YB 3CC4I 3JSPA 2FU4A 2QBYB 2AO9A 2LTPA 5LBQA 2M0CA 1IN8A 3HRTA 3H5NA 3D5SC 2CV2A 1YRNB 3HOUJ 3HHHA 4I99C 3LA7A 2RV8A 2MLKA 2X9DA 3TW6A 2PJRB 2R7FA 2L7KA 1TQMA 2XF6A 4PCQA 4R1HA 3MKLA 4L5JA 2QVOA 5CQEA 3S14J 3UNGC 4IVNA 1V55H 1MKMA 4XIDA 3HM5A 4BACA 3PM1A 1P4AA 2XRLA 1ZHFA 2HVSA 2R5YA 2L01A 2DMUA 1E3PA 2NS0A 2ZJ2A 4B3XA 1UMQA 4L9NA 1G3YA 2FMLA 4CZZA 1U5TB 3K7AJ 3CTAA 2Z3YA 2DCEA 2VE9A 4IRIA 1LEBA 1X2MA 2GWRA 2JVGA 2PN6A 4ZTFA 2PJRA 2PMHA 1QHGA 1VFCA 4CDGA 4KT5C 1QBJA 1N25A 3Q9VA 1ZR2A 1RR8C 1FBSA 2BVMA 2VIXA 4EVIA 4R79A 3GYHX 2ZMEA 4BUPA 1HC8A 2W4SA 1UB9A 1FPQA 3AG2H 4Q48A 4IHTA 1YFHA 3BZCA 2MD5A 2ELHA 5D4RA 2TRTA 2EWNA 3H5RA 1LFPA 1N75A 1FIPA 1TWAJ 3HG9A 3KPHA 4XSXF 3T5XA 5K5QA 1BI3A 2HOTA 4HLYA 1NTCA 1HKSA 2HZTA 2YU3A 5TISC 2G7UA 2JN6A 2V1NA 3H36A 3BCAA 2DLLA 4UHTA 1DGWY 5F04A 4XKBA 3DTIA 1CGPA 5FFZA 1ON2A 2AQEA 2XAUA 1RI7A 1I50J 3MAJA 3LNQA 1YX3A 3FMQA 5LGTA 1SEUA 1O57A 2L3DA 5DS9A 2A69F 2XB0X 3FMSA 1OYIA 1UJ8A 1VZ0A 4DJAA 1J0RA 3NQOA 1JTXA 5IT3A 1RRJA 2A3SA 3IHUA 3LWFA 1OYYA 3QU6A 5F64A 4L18B 3MMYB 3QYEA 1TW3A 3OOPA 3WG9A 2CWEA 2HS5A 5D5UB 1DUXC 9ANTA 1YOVB 1ZRCA 2LC2A 3K2AA 3GW2A 1XCVA 3BJOA 5KAFC 1NK2P 1O7LA 1OFCX 3DTEA 1LFUP 3H92A 2R7WA 3ZN1A 4O5VA 5D5WB 4DNCA 1WJCA 2DOFA 2ZSHB 3S3OA 2PBIA 1YIJI 3I3LA 1P4WA 3GWZA 1PVEA 3I56I 5TRDA 2A07F 3ZP5A 3H5AA 2W25A 3KE2A 2PX9A 2WBMA 4MEYF 3CO6C 4IHYA 2KZGA 1ETOA 1P7IA 1CF7B 1QZYA 2IA2A 3HOZJ 1Z7LA 1UCRA 2UXNA 3K4BA 2XPUA 2NRAC 1LVAA 3M7GA 4D9JA 2ZFUA 2XKPA 4HX7A 3WODF 1APLC 3G1OA 4M3GA 4BXXJ 2FQ3A 5E3LA 3QP5A 5IYBJ 5CYVA 3ZMDA 2GIVA 3CZ6A 3LFKA 3K1NA 3EETA 2D45A 4BH9A 5HODA 2WAFA 1A6IA 3H0DA 4A3LJ 3DF8A 3Q5FA 3O8GA 5FKNA 1IV6A 1WWXA 3IKVA 1X2NA 2Z16A 2GOMA 1CF7A 1YJ9I 4FCYA 2Y0SN 3CCJI 3HGGA 2E1OA 5J47A 5CKTA 2VKVA 5E1ZB 5F0FA 2BY3A 4XM3A 3DKXA 3WU2C 1O3RA 4UUTA 2GXAA 2FXAA 3LSGA 3K4MA 4IX7A 2V1DA 5B5EC 4ZYDA 4E7ZA 4M6XA 2JJ7A 2V26A 2IEKA 3FM3A 3LAPA 2LREA 1V5FA 2HTSA 1R5GA 2K9QA 3UR3C 2DMPA 5M5XJ 2QENA 5FD6A 2COBA 4BEHA 1MDMA 2ZXWH 5C4JJ 1FX7A 3M07A 4QPOA 3ZMVA 1RUOA 4EEFG 2R4GA 4AYBN 4E7SA 1BOBA 2CUEA 5LRRA 3VYUB 4BXUA 2HQNA 3HRSA 4R8HA 2AHQA 1IXRC 4U0VA 4AIJA 2BY0A 2OZ6A 5ERIA 4WWCA 2X6OA 1ZQ3P 4I6ZA 4X6AJ 3S2DJ 2Y48A 5KHDA 1R49A 3N05A 2XSJC 3GTPJ 2ELJA 2DFIA 4FHTA 4QSHA 3FX3A 3BPXA 2D1VA 2NS8A 3G2BA 4XLCA 3CDHA 2A05A 3HOTA 4OIPF 4YIFA 2XUBA 3MKYB 3VSLA 3S3MA 5D5XB 3I5UA 4F55A 3GFLA 6PAXA 4U0WA 2QCOA 3CLOA 1AOYA 3I54A 4YG2F 4RGXA 2V9PA 2DJNA 2XAFA 5CVVA 4O3MA 2CUJA 3EYYA 1W7PD 2GZWA 3H3UA 4YEJA 1AU7A 1T6SA 4XR6A 1JT0A 4UVCA 1KQ9A 3K6GA 1SAXA 3R0JA 1XDUA 3CCMI 3K9TA 4QWQA 1OYWA 1QZEA 1A36A 1UHWA 1SD7A 1ZK8A 2DOAA 2RDPA 2CW0F 2XAQA 2ZJPF 2LR8A 2K27A 4XQFA 4CUGA 3S8PA 4W1UA 3SQNA 4A3JJ 4RLFA 3CP8A 1GUUA 2HYJA 3QYBA 4LJZF 2EPFA 4M3FA 5M5WJ 3J80Z 3QOEA 3M1CA 4DQ2A 1BL0A 4NUBA 3U21A 4G6QA 5H6QA 2PJPA 3F8FA 1JUPA 2OQRA 2KPMA 2E1MC 3T0YA 1Y8RB 1OLTA 2K4JA 1OCTC 2M45A 1IUYA 3HKZN 4ZC3A 1MW7A 4OU0A 5IY5H 3OIPA 2RC4A 2W57A 4P9FA 2HGCA 3IH3A 2X6YA 4V19K 2HQ5A 1IAWA 1TTYA 2DFHA 3BDDA 3GLXA 1TWFJ 1SVMA 1MSEC 3MVPA 1A5JA 1SD4A 2LP0A 4JYKA 4DBQA 4BY1J 1QO0D 5CVUA 2EFOA 3RJPA 2JMWA 4JX4A 5M3MJ 4WX9A 3HOSA 2OZUA 1T33A 4BY7J 2MYSA 1JGGA 3CQZJ 3FK6A 1J59A 1ZRFA 3IUOA 1LJ9A 1WJ5A 2JZYA 4CSWA 2EFNA 2BY1A 2M1BA 1Z7UA 4BHPA 2B7EA 3O8HA 5GAEJ 2EQRA 3J7YJ 3GTGJ 5HOOA 1K61A 2ZBKA 1X1BA 3HOVJ 5IT9K 1UHMA 2QSGX 3GTMJ 2HPMA 2R92J 5DD8A 1FP2A 2AQFA 4EM0B 2KT0A 3CESA 4QTRA 2R7RA 3PJRA 1K78B 2L2OA 4PFPA 1IZ1A 2X1EA 3OY9A 4N0BA 5E3MA 3K4LA 4ESFA 5K5OA 4AUXA 5F0CA 1IXCA 1JI8A 1FSEA 3E5QA 1LE8B 2W84A 2E1MB 3FDYA 3RKYA 1SMYF 4PJLA 2L5QA 3ERED 1FWZA 2VOOA 3CDIA 2DA5A 5F1RA 3RKXA 3NRVA 4OWRB 4IHSA 1Z0XA 3Q3SA 3TDUC 3X2QH 1B59A 3SJMA 2DT7B 2H6BA 1R22A 4QIWN 4FASD 1MJBA 2CSOA 5DDGA 3FISA 4IL6C 3S32A 1NH3A 3IV5A 4E7HA 2O8KA 2KHMA 1K78A 4II2A 2FOKA 4I0BA 2WA0A 3FKIJ 2X0LA 4GYIA 2ZJRF 2WAQN 1VQKI 5IP6A 1LDKB 2F2EA 2OD5A 1NG7A 1WJAA 2HVQA 3QU3A 1R5ID 3TMOA 4E4HA 4RMNA 1HW1A 2P5KA 4XRMA 4C2UA 2BGCA 5DM7F 3KLOA 1IDYA 1BW5A 3LSTA 3K69A 4CHUA 4MHGA 2MC3A 3C2GA 4WF2A 3OV8A 5KCMA 4L9VA 1QPMA 2W00A 4F7ZA 1TWCJ 1BOAA 1P7JA 3K4KA 4ZDLA 3G73A 2DTRA 3TP0A 1J7KA 2KJBA 2DA4A 2QA4I 2K3PA 5HLGA 2DYRH 3MD2A 3PNVA 2OUMA 1J9IA 2A6HF 1ZREA 1J09A 2HTJA 2JT1A 3LSHA 2KKOA 2QLZA 5IPAA 2LSOA 2KZVA 1GV2A 2FJ1A 2FBHA 2XKOA 1R9TJ 3HXLA 4AVZA 1V5EA 2FBKA 2Y31A 3OYCA 3L09A 1HDPA 2MH2A 1WJDA 3I53A 3TQNA 2VT3A 1BC8C 1QPIA 1XG1A 1U2WA 5CPRB 4XLPF 1LNWA 1R1VA 3SYTA 3MKWB 3R4KA 3G71I 2IS1A 5ILSA 4HW0A 2JA6J 2E71A 3MZYA 4CCOA 1D3YA 1I3AA 4MIMA 2BY2A 2DT5A 3CCUI 3L2WA 4LLLA 1J2XA 3JAMK 2LOOA 3S1RJ 3P9IA 2DW4A 1XX5A
chains in the Genus database with same CATH topology
5J6XA 4KA4A 1FT9A 1FBQA 4EGYA 3E6CC 4ENJA 1ON1A 2O0YA 3CUQA 4ESJA 5EEHA 4AIKA 3WU0A 3H3ZA 1YO5C 1HXDA 3BJAA 2WC2A 3MFKA 3R61A 2CQKA 2CYYA 1MJ9A 3I71A 1SD6A 1WQ2A 2KIUA 1Q1HA 3R60A 4ZZLA 2NYXA 5FB2A 2GAUA 1HSJA 1SFEA 1B1BA 2WWYA 5HLHA 4WXDA 2ZNZA 4UNOA 3ELKA 3ZN0A 4ENNA 1XSDA 2EK5A 2R3SA 5ICFA 2FRHA 2IA0A 4GGGA 1Z6TA 1YIOA 2GXGA 4KFCA 2QM3A 4P55A 4GYGA 3IL2A 5KK1A 2M87A 4UV9A 1G3SA 3LQRA 2PG4A 3HRMA 4NHJA 4PZJA 1LQ1A 5FFXA 5L3BA 2HOEA 1TQIA 1YG2A 4BAYA 3V4GA 1Z9CA 2FNPA 1U6GA 1XN7A 4M72A 3WTXC 1TNSA 4UXNA 4G6DA 4HX4A 2ISZA 2E1CA 4Q5SF 3HTSB 4EM1A 3LAJA 5JR3A 4I01A 1OR7A 2ZCWA 5FLXK 2FMYA 3DEUA 5E8IA 1RUNA 4M71A 3WGIA 1ZARA 2BV6A 3E97A 4I7HA 3FZVA 4LFUA 1FP1D 1WRJA 4JBAA 4XRFA 2ZMEB 4ZYHA 3SZPA 3F23A 3J81K 3E3VA 4IRHA 1WKMA 3FWEA 4EJWA 4RAYA 3ECOA 3E6BA 1D8KA 2P8TA 1PDNC 4KICA 5LHGA 3WGGA 4I98B 1HKQA 2DQRA 3DV8A 3FXQA 2GA1A 4HBLA 3Q9SA 3FF5A 5FO5A 1QGPA 3T8RA 1OMIA 1E17A 3T1BA 3ROUA 4N9HA 2AXLA 5DD4A 3IC7A 2P5LC 3BP8A 3EUHA 4U7DA 3GFIA 1I1SA 5FD5A 4HF2A 1FOKA 3BZ6A 2K86A 1KYWA 3F6OA 5E1WA 1ZG5A 1F1ZA 3KP2A 1V3FA 2IW5A 1O3TA 3K0LA 2XASA 2OQGA 3LA2A 1PUEE 3GVAA 3V7CA 2OBPA 2QWWA 3DQVC 5HDGA 2EV5A 4UUVA 3R6SA 1XGNA 4LB5A 3M8EA 4UV8A 1JGSA 3VEPA 1I1GA 2GXBA 1ZLKA 4RB0A 4OIQF 2YX4A 2FE3A 2JTVA 5ICCA 2H6CA 2O8XA 2QUFA 5IT9Z 3ZMSA 4M9XA 2H94A 3T8TA 3AAFA 1FLIA 1Z91A 5J8CA 2Y75A 2A61A 3C3WA 3E6DA 3HSFA 1K7AA 1T98A 2EFWA 3F72A 1IXSB 4ZZDA 3E5UA 3TO9A 3RYRA 4KUMA 3DPTA 2ETHA 5E17F 3RYPA 3N4MA 1W7PB 2DPUA 1MDMB 5HS9A 1BN5A 3F8CA 5L3EA 1BI0A 3TO6A 2X4HA 3I58A 2W85A 3ZMTA 5BOXA 4EV0A 4GXOA 3F21A 2HYFA 3NEUA 3DKWA 1TNTA 4M73A 3ULQB 1XD7A 4AD9A 2ISYA 1YYVA 1W7PA 2STTA 2Z99A 3RIRA 4Q4ZF 4EJUA 5HDKA 4A12A 2FNAA 3I4PA 4JQFA 2OA4A 1MJAA 1TW2A 3MQ0A 1F5TA 4AVPA 3ML6A 4OIRF 4BHCA 4WXCA 2RVCA 5TJJA 3RPQA 4U88A 4BQAA 3R0AA 5K1YA 4CO8A 4MNUA 1T0FA 5D8LB 4A0XA 1EH8A 2HR3A 3QPHA 3GZ6A 2BE5F 3L9FA 3JAMZ 3RI4A 4G7OF 3U1DA 3C18A 3CUOA 2DU9A 3JSOA 3HHGA 4KIFA 2UWMA 4M6YA 3K2ZA 4UVAA 2VC1A 4Q47A 4KMUX 5CJ9A 1R23A 1GXPA 3JW4A 5JVTA 2B0LA 1S6LA 2L4MA 2VBWA 2R7DA 4IJAA 4YIIA 3FM5A 1R58A 5DYMA 2C6YA 4ESBA 3HTUA 2ADUA 5D6FA 1ZH5A 1W5TA 2XHKA 4S04A 2A6EF 1E2XA 5E20A 1JXSA 3GX4X 1IF1A 3MWMA 1S7OA 1B4AA 4CXFA 1GXQA 3KLNA 1LDJA 2FF4A 5KVRA 1REPC 2PI0A 3TOBA 3FXUA 4KYWA 1NHAA 2XAJA 2IRFG 2XAHA 2A68F 3WTZA 2J5PA 1IW7F 3WTTC 3KCCA 3ECHA 4G9YA 3BROA 3GXOA 4HF0A 1XCBA 4Y13A 4A0YA 2KIMA 3CUQC 1KGSA 4Y15A 3F6VA 3COAC 1PP7U 3B02A 3WU1B 3P9KA 4LG0A 2MBFA 3I59A 3GFMA 1ZLJA 1B6AA 2HQRA 1FNNA 4LMYA 2P6SA 4A5NA 1SD5A 1XGOA 5ICGA 1JHFA 1QNTA 4MQVA 2IA1A 2HFHA 4TV7A 1BJAA 2ZO4A 3K1MA 2JPCA 4HQEA 5FLXZ 2MLGA 3WTUC 3TGNA 3KETA 4OMZA 2HWVA 5E18F 1K6OA 3PQKA 1KU7A 1O3QA 4JK1X 2K7LA 5HVQC 4L9TA 5DUIA 5D4SA 5HS8A 4BHBA 1KQ0A 1JE8A 3J81Z 4EMSA 4OINF 1XSXA 3O2PE 4M9ZA 2Q2EA 3CUQB 4A5MA 1GHCA 4L5IA 3QOPA 1L3LA 2XRNA 1G3WA 5CVJA 3I0TA 4M9SA 4IRGA 4UVBA 2RQPA 2LF8A 4XLNF 2W24A 4B09A 4HZFA 3HIFA 3GUDA 2OAZA 3V8JA 1GVJA 3TKYA 1IN6A 2EV0A 4G7ZF 4EM2A 3U9GA 2DO7A 3V7SA 2F5CA 2KRFA 5A2QK 4KIGA 4U7BA 4A6EA 3WTSC 4YFXF 5BQTA 1DPRA 5ED4A 1I5ZA 5CVRA 5LHIA 2VODA 1T38A 3ABTA 4O6JA 5H20A 1STZA 4RAZA 1BC7C 4I0AA 3SXYA 4KMFA 2VOPA 4FX0A 2FA5A 4L0ZB 3WE2A 3E5XA 4HDVA 3JTGA 4K2EA 1ZYRF 1W5SA 3MCZA 1RNLA 2QYOA 3BJ6A 3VODA 1TQPA 2VBXA 4RB1A 5L3GA 1ODDA 3WTYC 4S05A 2A5YB 1FBUA 4KDPA 4A2UA 5CLSA 3QAHA 3TDZC 2D1HA 4BYYA 4LB6B 2IT0A 1F9NA 1I27A 2PQ8A 3J7AO 3GO5A 4IXAA 5ILUA 3BWGA 1S8NA 2RNJA 3KP4A 4GCVA 3WGHA 2IPQX 3L2CA 1Z1DA 2O3FA 1R36A 4PDKA 1ZGJA 2DPDA 2G9WA 2F5FA 3KP7A 3SHFA 5DCMA 2H09A 3I64A 2PEXA 1S7AA 4G8XA 3RPUA 1FYKA 4MEXF 3N97A 2MH9A 2VBZA 2O61A 3EDPA 4U0YA 3VOEA 5HDNA 2ZFWA 4ENKA 1VTNC 3FXRA 4RB3C 1S3JA 2K02A 3HUGA 3KZZA 1LB2A 1Z05A 1ZRDA 2O6GE 1LEAA 1ZG3A 4QLCU 3JTHA 1FSHA 3ISPA 3F8MA 3U2RA 2V1UA 1HKTA 2PFBA 4HF1A 2GA2A 4MGRA 1B9NA 4LK0F 1T39A 1IRGA 3C1DA 3IWZA 1J75A 2ZKZA 5DCFA 4H0EA 2PLYA 2ESHA 4RB2C 1K79A 3WTWC 2QBYA 1EH6A 3HSRA 1IN4A 4HV5A 2Z9OA 3HYIA 1HQCA 2XIGA 3F8NA 4D0PA 1A04A 5EEGA 3HRUA 1XSVA 4EJTA 4OIOF 4MTEA 5JHUA 4Y17A 5HLIA 4LLGF 4AIHA 2NNNA 5J8FA 2YX7A 2M30A 4HX8A 5LLQA 5D5VB 3F8BA 1YW9A 4G94A 4ZH4F 4PGGA 1U5TA 4I2OA 3WE3A 3M1EA 2CG4A 2DAOA 2IVMA 1SFUA 4HA8A 4B8XA 3E6MA 4ASNA 2QQ9A 2EFQA 1U8RA 3CJNA 1HW5A 2AS5F 5JI6A 3MZHA 3BY6A 1BIAA 3M8FA 4XSZF 1P6RA 1YTYA 2VONA 3KP6A 2NNYA 1EH7A 1AWCA 3S2WA 2HKXA 3KZYA 4AWXB 2XV4S 3W6JB 5LEKA 4FX4A 2KIFA 4P96A 1USTA 2LKPA 5LGNA 1YQAA 1BI1A 4CICA 1U3EM 2L4AA 3D0SA 2Z5UA 4YFKF 5L3CA 3BOQA 1S29A 2J5OA 3SZTA 3VB2A 3W6KB 2LNBA 4CGZA 5E1XA 1BBYA 2BYVE 2V6CA 3V7RA 5LRSA 2VE8A 2DBBA 2EA4A 3M9AA 2Q0OA 2H27A 1ONVA 2LF7A 4KN4X 1FZPB 3ABUA 2XROA 4EJVA 5CVIA 5JFRA 3ZMUA 2BBYA 5AIPA 2K4BA 2EA2A 4KN7X 4LD5A 4EJOA 3FHZA 1SFXA 2F5EA 5FGMA 4I09A 3V8KA 3IRRA 2FSWA 2VT2A 3VFZA 3RTRA 3QP6A 2DI3A 4KNYA 2QZ8A 5AONA 2FBIA 3LQQA 2RN7A 4Z2YA 2CGPA 4LLNA 1XMAA 4L0YB 3RKWA 3QPTA 3ZQ7A 3K1PA 2XGXA 3ZPLA 2WTEA 2Y0MA 1YS7A 5ICEA 2YPRA 4HAMA 2ZXJA 1JHHA 5A2QZ 2LDUA 2JRTA 1FY7A 4ON0A 3IKTA 1KU9A 5K5RA 2Z33A 1ZN2A 1O7FA 4WXHA 3L00A 4ETSA 4ZYEA 4PGHA 2EB7A 1EV7A 5ILVA 2O03A 2D2WA 1SMTA 4OOIA 1G3TA 5LHHA 1H9GA 2DK8A 2G7HA 5BPDA 2M8EA 3KP5A 2Q8KA 4N9IA 1ZG1A 1IRFA 3EYIA 1P2FA 2UXXA 2RKHA 1Y0UA 2P5VA 1U78A 1Z6RA 1KA8A 3DPLC 4LG0B 1H0MA 3LA3A 4NB5A 1XB4A 3D5LA 3BPVA 2OU2A 3RDIA 4LGWA 3DXJF 1BI2A 3I59B 1WSUA 1DDNA 1X3UA 2HYGD 1QZZA 3P7NA 2DK5A 1I6XA 2JPBA 4YFNF 4G7HF 3F22A 3QRFF 2NAZA 1BIBA 1TBXA 1ZAOA 2XAGA 4EGZA 2V1XA 3DP7A 1W4MA 1G6NA 3MEXA 1T2KA 4M74A 3EQLF 1KYZA 4HDUA 1C0WA 3ZMZA 4A6DA 1KU2A 3KP3A 3V8LA 4P5OA 4EQQA 1IN7A 2QQAA 4ZYGA 1P4XA 3F3XA 5E8GA 1MZBA 4IF4A 4WCGA 2YR2A 4RGSA 4I02A 1HW2A 2P7CB 1HSTA 2TDXA 1XGSA 4FT8A 4RGUA 4BNCA 1FYMA 1XDSA 1R1TA 3G3ZA 4MTDA 5LGUA 2E1NA 3O6BB 2EV6A 1ULYA 2UZKA 1BM9A 1HBXG 4NQWA 1PP8F 2GQQA 3SFZA 1FYLA 3HSEA 2JSCA 3FMRA 1D5VA 2V79A 2P6TA 4ENMA 1XGMA 3PQJA 4P9UA 1G4DA 3GZ5A 1DP7P 3KFWX 1B9MA 3DFGA 3O3KA 2E7XA 1L0OC 2EFPA 2ACJA 1RIOH 3PFIA 2IJLA 5DEQA 4WK8F 2HKOA 2QQBA 1J5YA 1XMKA 3IWFA 1P92A 2DQLA 1USSA 2MA3A 1H9TA 1YLFA 3J80K 2ESNA 1YW7A 3IRQA 5DV5A 4A0ZA 3REOA 2L54A 2CO5A 2L02A 3B73A 3GEZA 4HV6A 4RS8A 3C7JA 4CYDA 3KEOA 3CO7C 5BS6A 1R7JA 4RGRA 2BEOA 3P9CA 3TOAA 5D8KB 2P4WA 2PMUA 5BMZA 1TLHB 5BPIA 2FEZA 1O3SA 5L3DA 1V4RA 4HQMA 4HOBA 2IP2A 2VC0A 1MD0A 4KIBA 2VN2A 2P7VB 1F4KA 2ZNYA 1R00A 1IN5A 2V9VA 4E70A 1UFMA 5DCMB 1ZGAA 5H6RA 1KQ8A 1MGTA 2STWA 4HLXA 2CFXA 2RGVA 2KJCA 5LEJA 1OPCA 1D8JA 3L7WA 4HYEA 1KU3A 5AIQA 4MQ9F 1RZ4A 3WTVC 3TO7A 4LK1F 2EJRA 2E7WA 1U5TC 1DPUA 2COMA 1LDDA 1YW8A 1YS6A 1OKRA 2HDCA 1QQIA 4IPAA 2VBYA 4OMYA 4GO1A 4XBFA 2YSRA 2HEOA 1WI9A 3GFJA 5F6FA 3GF2A 2M5WA 2VXZA 2XVCA 5HS7A 5DUKA 1R1UA 1FC3A 5D6EA 1R5HA 2WV0A 4L9JA 2F5DA 3KEQA 5L3FA 3JSPA 2FU4A 2QBYB 5LBQA 3HRTA 1IN8A 3HHHA 3LA7A 2RV8A 2MLKA 2R7FA 1TQMA 4PCQA 4R1HA 4L5JA 2QVOA 4IVNA 1MKMA 1P4AA 1ZHFA 2L01A 2NS0A 2ZJ2A 4L9NA 1G3YA 2FMLA 4CZZA 1U5TB 3CTAA 2Z3YA 2VE9A 4IRIA 1LEBA 2GWRA 2PN6A 2PMHA 4CDGA 4KT5C 1QBJA 3Q9VA 1FBSA 4EVIA 4R79A 3GYHX 2ZMEA 1UB9A 1FPQA 4Q48A 4IHTA 1YFHA 2MD5A 2ELHA 5D4RA 2EWNA 4XSXF 3T5XA 5K5QA 1BI3A 4HLYA 1HKSA 2HZTA 2YU3A 2G7UA 4UHTA 2DLLA 1CGPA 5FFZA 1ON2A 1RI7A 3MAJA 3FMQA 5LGTA 1O57A 2L3DA 2A69F 3FMSA 1OYIA 1J0RA 3NQOA 5IT3A 2A3SA 3IHUA 3LWFA 1OYYA 3QU6A 5F64A 4L18B 1TW3A 3OOPA 3WG9A 2CWEA 2HS5A 5D5UB 1DUXC 1ZRCA 3GW2A 1XCVA 3BJOA 1O7LA 3H92A 3ZN1A 4O5VA 5D5WB 4DNCA 2PBIA 1P4WA 3GWZA 5TRDA 2A07F 3ZP5A 2W25A 3KE2A 4MEYF 3CO6C 1CF7B 1QZYA 2IA2A 1UCRA 2UXNA 2NRAC 1LVAA 3M7GA 2XKPA 4HX7A 3WODF 2FQ3A 3QP5A 3ZMDA 5CYVA 2GIVA 3LFKA 3K1NA 3EETA 2D45A 4BH9A 3DF8A 3Q5FA 1WWXA 3IKVA 1CF7A 5E1ZB 1O3RA 2FXAA 2V1DA 4ZYDA 4M6XA 3FM3A 3LAPA 2HTSA 1R5GA 2QENA 5FD6A 1MDMA 1FX7A 3ZMVA 1RUOA 5LRRA 4BXUA 2HQNA 3HRSA 4R8HA 1IXRC 4U0VA 4AIJA 2OZ6A 5ERIA 4WWCA 2Y48A 2DFIA 4FHTA 3FX3A 3BPXA 2D1VA 3CDHA 3HOTA 4OIPF 4YIFA 2XUBA 5D5XB 3I5UA 3GFLA 6PAXA 4U0WA 3CLOA 1AOYA 3I54A 4YG2F 4RGXA 2XAFA 5CVVA 4O3MA 3EYYA 3H3UA 1W7PD 2GZWA 1T6SA 4UVCA 1KQ9A 1SAXA 3R0JA 1XDUA 3K9TA 4QWQA 1OYWA 1UHWA 1SD7A 2RDPA 2CW0F 2XAQA 2K27A 3SQNA 4LJZF 3J80Z 4DQ2A 4G6QA 5H6QA 2PJPA 3F8FA 2OQRA 3T0YA 2K4JA 2M45A 1IUYA 4OU0A 2RC4A 2W57A 4P9FA 2HGCA 1IAWA 1TTYA 3BDDA 3GLXA 1SD4A 1QO0D 5CVUA 2EFOA 3RJPA 4WX9A 3HOSA 2OZUA 1J59A 1ZRFA 1LJ9A 2JZYA 2EFNA 2M1BA 1Z7UA 4BHPA 5HOOA 2ZBKA 5IT9K 1UHMA 5DD8A 1FP2A 4EM0B 1K78B 1IZ1A 4N0BA 4ESFA 5K5OA 1IXCA 1FSEA 3E5QA 2W84A 3RKYA 1SMYF 3ERED 1FWZA 2VOOA 5F1RA 3RKXA 3NRVA 4IHSA 3TDUC 1B59A 2H6BA 1R22A 1MJBA 2CSOA 5DDGA 1K78A 2FOKA 4I0BA 2X0LA 4GYIA 1LDKB 2F2EA 2OD5A 3QU3A 1HW1A 2P5KA 2BGCA 3KLOA 3LSTA 3K69A 4CHUA 4MHGA 2MC3A 4WF2A 3OV8A 4L9VA 1QPMA 4F7ZA 1BOAA 3G73A 2DTRA 1J7KA 2KJBA 5HLGA 1J9IA 2A6HF 1ZREA 2HTJA 2JT1A 2KKOA 2QLZA 2LSOA 2FBHA 2XKOA 2FBKA 3L09A 2MH2A 3I53A 3TQNA 2VT3A 1BC8C 1U2WA 4XLPF 1LNWA 1R1VA 3R4KA 5ILSA 4HW0A 3MZYA 1D3YA 2DT5A 4LLLA 1J2XA 3JAMK 3P9IA 2DW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J6X A;  4KA4 A;  1FT9 A;  1FBQ A;  4EGY A;  3E6C C;  4ENJ A;  1ON1 A;  2O0Y A;  3CUQ A;  4ESJ A;  5EEH A;  4AIK A;  3WU0 A;  3H3Z A;  1YO5 C;  1HXD A;  3BJA A;  2WC2 A;  3MFK A;  3R61 A;  2CQK A;  2CYY A;  1MJ9 A;  3I71 A;  1SD6 A;  1WQ2 A;  2KIU A;  1Q1H A;  3R60 A;  4ZZL A;  2NYX A;  5FB2 A;  2GAU A;  1HSJ A;  1SFE A;  1B1B A;  2WWY A;  5HLH A;  4WXD A;  2ZNZ A;  4UNO A;  3ELK A;  3ZN0 A;  4ENN A;  1XSD A;  2EK5 A;  2R3S A;  5ICF A;  2FRH A;  2IA0 A;  4GGG A;  1Z6T A;  1YIO A;  2GXG A;  4KFC A;  2QM3 A;  4P55 A;  4GYG A;  3IL2 A;  5KK1 A;  2M87 A;  4UV9 A;  1G3S A;  3LQR A;  2PG4 A;  3HRM A;  4NHJ A;  4PZJ A;  1LQ1 A;  5FFX A;  5L3B A;  2HOE A;  1TQI A;  1YG2 A;  4BAY A;  3V4G A;  1Z9C A;  2FNP A;  1U6G A;  1XN7 A;  4M72 A;  3WTX C;  1TNS A;  4UXN A;  4G6D A;  4HX4 A;  2ISZ A;  2E1C A;  4Q5S F;  3HTS B;  4EM1 A;  3LAJ A;  5JR3 A;  4I01 A;  1OR7 A;  2ZCW A;  5FLX K;  2FMY A;  3DEU A;  5E8I A;  1RUN A;  4M71 A;  3WGI A;  1ZAR A;  2BV6 A;  3E97 A;  4I7H A;  3FZV A;  4LFU A;  1FP1 D;  1WRJ A;  4JBA A;  4XRF A;  2ZME B;  4ZYH A;  3SZP A;  3F23 A;  3J81 K;  3E3V A;  4IRH A;  1WKM A;  3FWE A;  4EJW A;  4RAY A;  3ECO A;  3E6B A;  1D8K A;  2P8T A;  1PDN C;  4KIC A;  5LHG A;  3WGG A;  4I98 B;  1HKQ A;  2DQR A;  3DV8 A;  3FXQ A;  2GA1 A;  4HBL A;  3Q9S A;  3FF5 A;  5FO5 A;  1QGP A;  3T8R A;  1OMI A;  1E17 A;  3T1B A;  3ROU A;  4N9H A;  2AXL A;  5DD4 A;  3IC7 A;  2P5L C;  3BP8 A;  3EUH A;  4U7D A;  3GFI A;  1I1S A;  5FD5 A;  4HF2 A;  1FOK A;  3BZ6 A;  2K86 A;  1KYW A;  3F6O A;  5E1W A;  1ZG5 A;  1F1Z A;  3KP2 A;  1V3F A;  2IW5 A;  1O3T A;  3K0L A;  2XAS A;  2OQG A;  3LA2 A;  1PUE E;  3GVA A;  3V7C A;  2OBP A;  2QWW A;  3DQV C;  5HDG A;  2EV5 A;  4UUV A;  3R6S A;  1XGN A;  4LB5 A;  3M8E A;  4UV8 A;  1JGS A;  3VEP A;  1I1G A;  2GXB A;  1ZLK A;  4RB0 A;  4OIQ F;  2YX4 A;  2FE3 A;  2JTV A;  5ICC A;  2H6C A;  2O8X A;  2QUF A;  5IT9 Z;  3ZMS A;  4M9X A;  2H94 A;  3T8T A;  3AAF A;  1FLI A;  1Z91 A;  5J8C A;  2Y75 A;  2A61 A;  3C3W A;  3E6D A;  3HSF A;  1K7A A;  1T98 A;  2EFW A;  3F72 A;  1IXS B;  4ZZD A;  3E5U A;  3TO9 A;  3RYR A;  4KUM A;  3DPT A;  2ETH A;  5E17 F;  3RYP A;  3N4M A;  1W7P B;  2DPU A;  1MDM B;  5HS9 A;  1BN5 A;  3F8C A;  5L3E A;  1BI0 A;  3TO6 A;  2X4H A;  3I58 A;  2W85 A;  3ZMT A;  5BOX A;  4EV0 A;  4GXO A;  3F21 A;  2HYF A;  3NEU A;  3DKW A;  1TNT A;  4M73 A;  3ULQ B;  1XD7 A;  4AD9 A;  2ISY A;  1YYV A;  1W7P A;  2STT A;  2Z99 A;  3RIR A;  4Q4Z F;  4EJU A;  5HDK A;  4A12 A;  2FNA A;  3I4P A;  4JQF A;  2OA4 A;  1MJA A;  1TW2 A;  3MQ0 A;  1F5T A;  4AVP A;  3ML6 A;  4OIR F;  4BHC A;  4WXC A;  2RVC A;  5TJJ A;  3RPQ A;  4U88 A;  4BQA A;  3R0A A;  5K1Y A;  4CO8 A;  4MNU A;  1T0F A;  5D8L B;  4A0X A;  1EH8 A;  2HR3 A;  3QPH A;  3GZ6 A;  2BE5 F;  3L9F A;  3JAM Z;  3RI4 A;  4G7O F;  3U1D A;  3C18 A;  3CUO A;  2DU9 A;  3JSO A;  3HHG A;  4KIF A;  2UWM A;  4M6Y A;  3K2Z A;  4UVA A;  2VC1 A;  4Q47 A;  4KMU X;  5CJ9 A;  1R23 A;  1GXP A;  3JW4 A;  5JVT A;  2B0L A;  1S6L A;  2L4M A;  2VBW A;  2R7D A;  4IJA A;  4YII A;  3FM5 A;  1R58 A;  5DYM A;  2C6Y A;  4ESB A;  3HTU A;  2ADU A;  5D6F A;  1ZH5 A;  1W5T A;  2XHK A;  4S04 A;  2A6E F;  1E2X A;  5E20 A;  1JXS A;  3GX4 X;  1IF1 A;  3MWM A;  1S7O A;  1B4A A;  4CXF A;  1GXQ A;  3KLN A;  1LDJ A;  2FF4 A;  5KVR A;  1REP C;  2PI0 A;  3TOB A;  3FXU A;  4KYW A;  1NHA A;  2XAJ A;  2IRF G;  2XAH A;  2A68 F;  3WTZ A;  2J5P A;  1IW7 F;  3WTT C;  3KCC A;  3ECH A;  4G9Y A;  3BRO A;  3GXO A;  4HF0 A;  1XCB A;  4Y13 A;  4A0Y A;  2KIM A;  3CUQ C;  1KGS A;  4Y15 A;  3F6V A;  3COA C;  1PP7 U;  3B02 A;  3WU1 B;  3P9K A;  4LG0 A;  2MBF A;  3I59 A;  3GFM A;  1ZLJ A;  1B6A A;  2HQR A;  1FNN A;  4LMY A;  2P6S A;  4A5N A;  1SD5 A;  1XGO A;  5ICG A;  1JHF A;  1QNT A;  4MQV A;  2IA1 A;  2HFH A;  4TV7 A;  1BJA A;  2ZO4 A;  3K1M A;  2JPC A;  4HQE A;  5FLX Z;  2MLG A;  3WTU C;  3TGN A;  3KET A;  4OMZ A;  2HWV A;  5E18 F;  1K6O A;  3PQK A;  1KU7 A;  1O3Q A;  4JK1 X;  2K7L A;  5HVQ C;  4L9T A;  5DUI A;  5D4S A;  5HS8 A;  4BHB A;  1KQ0 A;  1JE8 A;  3J81 Z;  4EMS A;  4OIN F;  1XSX A;  3O2P E;  4M9Z A;  2Q2E A;  3CUQ B;  4A5M A;  1GHC A;  4L5I A;  3QOP A;  1L3L A;  2XRN A;  1G3W A;  5CVJ A;  3I0T A;  4M9S A;  4IRG A;  4UVB A;  2RQP A;  2LF8 A;  4XLN F;  2W24 A;  4B09 A;  4HZF A;  3HIF A;  3GUD A;  2OAZ A;  3V8J A;  1GVJ A;  3TKY A;  1IN6 A;  2EV0 A;  4G7Z F;  4EM2 A;  3U9G A;  2DO7 A;  3V7S A;  2F5C A;  2KRF A;  5A2Q K;  4KIG A;  4U7B A;  4A6E A;  3WTS C;  4YFX F;  5BQT A;  1DPR A;  5ED4 A;  1I5Z A;  5CVR A;  5LHI A;  2VOD A;  1T38 A;  3ABT A;  4O6J A;  5H20 A;  1STZ A;  4RAZ A;  1BC7 C;  4I0A A;  3SXY A;  4KMF A;  2VOP A;  4FX0 A;  2FA5 A;  4L0Z B;  3WE2 A;  3E5X A;  4HDV A;  3JTG A;  4K2E A;  1ZYR F;  1W5S A;  3MCZ A;  1RNL A;  2QYO A;  3BJ6 A;  3VOD A;  1TQP A;  2VBX A;  4RB1 A;  5L3G A;  1ODD A;  3WTY C;  4S05 A;  2A5Y B;  1FBU A;  4KDP A;  4A2U A;  5CLS A;  3QAH A;  3TDZ C;  2D1H A;  4BYY A;  4LB6 B;  2IT0 A;  1F9N A;  1I27 A;  2PQ8 A;  3J7A O;  3GO5 A;  4IXA A;  5ILU A;  3BWG A;  1S8N A;  2RNJ A;  3KP4 A;  4GCV A;  3WGH A;  2IPQ X;  3L2C A;  1Z1D A;  2O3F A;  1R36 A;  4PDK A;  1ZGJ A;  2DPD A;  2G9W A;  2F5F A;  3KP7 A;  3SHF A;  5DCM A;  2H09 A;  3I64 A;  2PEX A;  1S7A A;  4G8X A;  3RPU A;  1FYK A;  4MEX F;  3N97 A;  2MH9 A;  2VBZ A;  2O61 A;  3EDP A;  4U0Y A;  3VOE A;  5HDN A;  2ZFW A;  4ENK A;  1VTN C;  3FXR A;  4RB3 C;  1S3J A;  2K02 A;  3HUG A;  3KZZ A;  1LB2 A;  1Z05 A;  1ZRD A;  2O6G E;  1LEA A;  1ZG3 A;  4QLC U;  3JTH A;  1FSH A;  3ISP A;  3F8M A;  3U2R A;  2V1U A;  1HKT A;  2PFB A;  4HF1 A;  2GA2 A;  4MGR A;  1B9N A;  4LK0 F;  1T39 A;  1IRG A;  3C1D A;  3IWZ A;  1J75 A;  2ZKZ A;  5DCF A;  4H0E A;  2PLY A;  2ESH A;  4RB2 C;  1K79 A;  3WTW C;  2QBY A;  1EH6 A;  3HSR A;  1IN4 A;  4HV5 A;  2Z9O A;  3HYI A;  1HQC A;  2XIG A;  3F8N A;  4D0P A;  1A04 A;  5EEG A;  3HRU A;  1XSV A;  4EJT A;  4OIO F;  4MTE A;  5JHU A;  4Y17 A;  5HLI A;  4LLG F;  4AIH A;  2NNN A;  5J8F A;  2YX7 A;  2M30 A;  4HX8 A;  5LLQ A;  5D5V B;  3F8B A;  1YW9 A;  4G94 A;  4ZH4 F;  4PGG A;  1U5T A;  4I2O A;  3WE3 A;  3M1E A;  2CG4 A;  2DAO A;  2IVM A;  1SFU A;  4HA8 A;  4B8X A;  3E6M A;  4ASN A;  2QQ9 A;  2EFQ A;  1U8R A;  3CJN A;  1HW5 A;  2AS5 F;  5JI6 A;  3MZH A;  3BY6 A;  1BIA A;  3M8F A;  4XSZ F;  1P6R A;  1YTY A;  2VON A;  3KP6 A;  2NNY A;  1EH7 A;  1AWC A;  3S2W A;  2HKX A;  3KZY A;  4AWX B;  2XV4 S;  3W6J B;  5LEK A;  4FX4 A;  2KIF A;  4P96 A;  1UST A;  2LKP A;  5LGN A;  1YQA A;  1BI1 A;  4CIC A;  1U3E M;  2L4A A;  3D0S A;  2Z5U A;  4YFK F;  5L3C A;  3BOQ A;  1S29 A;  2J5O A;  3SZT A;  3VB2 A;  3W6K B;  2LNB A;  4CGZ A;  5E1X A;  1BBY A;  2BYV E;  2V6C A;  3V7R A;  5LRS A;  2VE8 A;  2DBB A;  2EA4 A;  3M9A A;  2Q0O A;  2H27 A;  1ONV A;  2LF7 A;  4KN4 X;  1FZP B;  3ABU A;  2XRO A;  4EJV A;  5CVI A;  5JFR A;  3ZMU A;  2BBY A;  5AIP A;  2K4B A;  2EA2 A;  4KN7 X;  4LD5 A;  4EJO A;  3FHZ A;  1SFX A;  2F5E A;  5FGM A;  4I09 A;  3V8K A;  3IRR A;  2FSW A;  2VT2 A;  3VFZ A;  3RTR A;  3QP6 A;  2DI3 A;  4KNY A;  2QZ8 A;  5AON A;  2FBI A;  3LQQ A;  2RN7 A;  4Z2Y A;  2CGP A;  4LLN A;  1XMA A;  4L0Y B;  3RKW A;  3QPT A;  3ZQ7 A;  3K1P A;  2XGX A;  3ZPL A;  2WTE A;  2Y0M A;  1YS7 A;  5ICE A;  2YPR A;  4HAM A;  2ZXJ A;  1JHH A;  5A2Q Z;  2LDU A;  2JRT A;  1FY7 A;  4ON0 A;  3IKT A;  1KU9 A;  5K5R A;  2Z33 A;  1ZN2 A;  1O7F A;  4WXH A;  3L00 A;  4ETS A;  4ZYE A;  4PGH A;  2EB7 A;  1EV7 A;  5ILV A;  2O03 A;  2D2W A;  1SMT A;  4OOI A;  1G3T A;  5LHH A;  1H9G A;  2DK8 A;  2G7H A;  5BPD A;  2M8E A;  3KP5 A;  2Q8K A;  4N9I A;  1ZG1 A;  1IRF A;  3EYI A;  1P2F A;  2UXX A;  2RKH A;  1Y0U A;  2P5V A;  1U78 A;  1Z6R A;  1KA8 A;  3DPL C;  4LG0 B;  1H0M A;  3LA3 A;  4NB5 A;  1XB4 A;  3D5L A;  3BPV A;  2OU2 A;  3RDI A;  4LGW A;  3DXJ F;  1BI2 A;  3I59 B;  1WSU A;  1DDN A;  1X3U A;  2HYG D;  1QZZ A;  3P7N A;  2DK5 A;  1I6X A;  2JPB A;  4YFN F;  4G7H F;  3F22 A;  3QRF F;  2NAZ A;  1BIB A;  1TBX A;  1ZAO A;  2XAG A;  4EGZ A;  2V1X A;  3DP7 A;  1W4M A;  1G6N A;  3MEX A;  1T2K A;  4M74 A;  3EQL F;  1KYZ A;  4HDU A;  1C0W A;  3ZMZ A;  4A6D A;  1KU2 A;  3KP3 A;  3V8L A;  4P5O A;  4EQQ A;  1IN7 A;  2QQA A;  4ZYG A;  1P4X A;  3F3X A;  5E8G A;  1MZB A;  4IF4 A;  4WCG A;  2YR2 A;  4RGS A;  4I02 A;  1HW2 A;  2P7C B;  1HST A;  2TDX A;  1XGS A;  4FT8 A;  4RGU A;  4BNC A;  1FYM A;  1XDS A;  1R1T A;  3G3Z A;  4MTD A;  5LGU A;  2E1N A;  3O6B B;  2EV6 A;  1ULY A;  2UZK A;  1BM9 A;  1HBX G;  4NQW A;  1PP8 F;  2GQQ A;  3SFZ A;  1FYL A;  3HSE A;  2JSC A;  3FMR A;  1D5V A;  2V79 A;  2P6T A;  4ENM A;  1XGM A;  3PQJ A;  4P9U A;  1G4D A;  3GZ5 A;  1DP7 P;  3KFW X;  1B9M A;  3DFG A;  3O3K A;  2E7X A;  1L0O C;  2EFP A;  2ACJ A;  1RIO H;  3PFI A;  2IJL A;  5DEQ A;  4WK8 F;  2HKO A;  2QQB A;  1J5Y A;  1XMK A;  3IWF A;  1P92 A;  2DQL A;  1USS A;  2MA3 A;  1H9T A;  1YLF A;  3J80 K;  2ESN A;  1YW7 A;  3IRQ A;  5DV5 A;  4A0Z A;  3REO A;  2L54 A;  2CO5 A;  2L02 A;  3B73 A;  3GEZ A;  4HV6 A;  4RS8 A;  3C7J A;  4CYD A;  3KEO A;  3CO7 C;  5BS6 A;  1R7J A;  4RGR A;  2BEO A;  3P9C A;  3TOA A;  5D8K B;  2P4W A;  2PMU A;  5BMZ A;  1TLH B;  5BPI A;  2FEZ A;  1O3S A;  5L3D A;  1V4R A;  4HQM A;  4HOB A;  2IP2 A;  2VC0 A;  1MD0 A;  4KIB A;  2VN2 A;  2P7V B;  1F4K A;  2ZNY A;  1R00 A;  1IN5 A;  2V9V A;  4E70 A;  1UFM A;  5DCM B;  1ZGA A;  5H6R A;  1KQ8 A;  1MGT A;  2STW A;  4HLX A;  2CFX A;  2RGV A;  2KJC A;  5LEJ A;  1OPC A;  1D8J A;  3L7W A;  4HYE A;  1KU3 A;  5AIQ A;  4MQ9 F;  1RZ4 A;  3WTV C;  3TO7 A;  4LK1 F;  2EJR A;  2E7W A;  1U5T C;  1DPU A;  2COM A;  1LDD A;  1YW8 A;  1YS6 A;  1OKR A;  2HDC A;  1QQI A;  4IPA A;  2VBY A;  4OMY A;  4GO1 A;  4XBF A;  2YSR A;  2HEO A;  1WI9 A;  3GFJ A;  5F6F A;  3GF2 A;  2M5W A;  2VXZ A;  2XVC A;  5HS7 A;  5DUK A;  1R1U A;  1FC3 A;  5D6E A;  1R5H A;  2WV0 A;  4L9J A;  2F5D A;  3KEQ A;  5L3F A;  3JSP A;  2FU4 A;  2QBY B;  5LBQ A;  3HRT A;  1IN8 A;  3HHH A;  3LA7 A;  2RV8 A;  2MLK A;  2R7F A;  1TQM A;  4PCQ A;  4R1H A;  4L5J A;  2QVO A;  4IVN A;  1MKM A;  1P4A A;  1ZHF A;  2L01 A;  2NS0 A;  2ZJ2 A;  4L9N A;  1G3Y A;  2FML A;  4CZZ A;  1U5T B;  3CTA A;  2Z3Y A;  2VE9 A;  4IRI A;  1LEB A;  2GWR A;  2PN6 A;  2PMH A;  4CDG A;  4KT5 C;  1QBJ A;  3Q9V A;  1FBS A;  4EVI A;  4R79 A;  3GYH X;  2ZME A;  1UB9 A;  1FPQ A;  4Q48 A;  4IHT A;  1YFH A;  2MD5 A;  2ELH A;  5D4R A;  2EWN A;  4XSX F;  3T5X A;  5K5Q A;  1BI3 A;  4HLY A;  1HKS A;  2HZT A;  2YU3 A;  2G7U A;  4UHT A;  2DLL A;  1CGP A;  5FFZ A;  1ON2 A;  1RI7 A;  3MAJ A;  3FMQ A;  5LGT A;  1O57 A;  2L3D A;  2A69 F;  3FMS A;  1OYI A;  1J0R A;  3NQO A;  5IT3 A;  2A3S A;  3IHU A;  3LWF A;  1OYY A;  3QU6 A;  5F64 A;  4L18 B;  1TW3 A;  3OOP A;  3WG9 A;  2CWE A;  2HS5 A;  5D5U B;  1DUX C;  1ZRC A;  3GW2 A;  1XCV A;  3BJO A;  1O7L A;  3H92 A;  3ZN1 A;  4O5V A;  5D5W B;  4DNC A;  2PBI A;  1P4W A;  3GWZ A;  5TRD A;  2A07 F;  3ZP5 A;  2W25 A;  3KE2 A;  4MEY F;  3CO6 C;  1CF7 B;  1QZY A;  2IA2 A;  1UCR A;  2UXN A;  2NRA C;  1LVA A;  3M7G A;  2XKP A;  4HX7 A;  3WOD F;  2FQ3 A;  3QP5 A;  3ZMD A;  5CYV A;  2GIV A;  3LFK A;  3K1N A;  3EET A;  2D45 A;  4BH9 A;  3DF8 A;  3Q5F A;  1WWX A;  3IKV A;  1CF7 A;  5E1Z B;  1O3R A;  2FXA A;  2V1D A;  4ZYD A;  4M6X A;  3FM3 A;  3LAP A;  2HTS A;  1R5G A;  2QEN A;  5FD6 A;  1MDM A;  1FX7 A;  3ZMV A;  1RUO A;  5LRR A;  4BXU A;  2HQN A;  3HRS A;  4R8H A;  1IXR C;  4U0V A;  4AIJ A;  2OZ6 A;  5ERI A;  4WWC A;  2Y48 A;  2DFI A;  4FHT A;  3FX3 A;  3BPX A;  2D1V A;  3CDH A;  3HOT A;  4OIP F;  4YIF A;  2XUB A;  5D5X B;  3I5U A;  3GFL A;  6PAX A;  4U0W A;  3CLO A;  1AOY A;  3I54 A;  4YG2 F;  4RGX A;  2XAF A;  5CVV A;  4O3M A;  3EYY A;  3H3U A;  1W7P D;  2GZW A;  1T6S A;  4UVC A;  1KQ9 A;  1SAX A;  3R0J A;  1XDU A;  3K9T A;  4QWQ A;  1OYW A;  1UHW A;  1SD7 A;  2RDP A;  2CW0 F;  2XAQ A;  2K27 A;  3SQN A;  4LJZ F;  3J80 Z;  4DQ2 A;  4G6Q A;  5H6Q A;  2PJP A;  3F8F A;  2OQR A;  3T0Y A;  2K4J A;  2M45 A;  1IUY A;  4OU0 A;  2RC4 A;  2W57 A;  4P9F A;  2HGC A;  1IAW A;  1TTY A;  3BDD A;  3GLX A;  1SD4 A;  1QO0 D;  5CVU A;  2EFO A;  3RJP A;  4WX9 A;  3HOS A;  2OZU A;  1J59 A;  1ZRF A;  1LJ9 A;  2JZY A;  2EFN A;  2M1B A;  1Z7U A;  4BHP A;  5HOO A;  2ZBK A;  5IT9 K;  1UHM A;  5DD8 A;  1FP2 A;  4EM0 B;  1K78 B;  1IZ1 A;  4N0B A;  4ESF A;  5K5O A;  1IXC A;  1FSE A;  3E5Q A;  2W84 A;  3RKY A;  1SMY F;  3ERE D;  1FWZ A;  2VOO A;  5F1R A;  3RKX A;  3NRV A;  4IHS A;  3TDU C;  1B59 A;  2H6B A;  1R22 A;  1MJB A;  2CSO A;  5DDG A;  1K78 A;  2FOK A;  4I0B A;  2X0L A;  4GYI A;  1LDK B;  2F2E A;  2OD5 A;  3QU3 A;  1HW1 A;  2P5K A;  2BGC A;  3KLO A;  3LST A;  3K69 A;  4CHU A;  4MHG A;  2MC3 A;  4WF2 A;  3OV8 A;  4L9V A;  1QPM A;  4F7Z A;  1BOA A;  3G73 A;  2DTR A;  1J7K A;  2KJB A;  5HLG A;  1J9I A;  2A6H F;  1ZRE A;  2HTJ A;  2JT1 A;  2KKO A;  2QLZ A;  2LSO A;  2FBH A;  2XKO A;  2FBK A;  3L09 A;  2MH2 A;  3I53 A;  3TQN A;  2VT3 A;  1BC8 C;  1U2W A;  4XLP F;  1LNW A;  1R1V A;  3R4K A;  5ILS A;  4HW0 A;  3MZY A;  1D3Y A;  2DT5 A;  4LLL A;  1J2X A;  3JAM K;  3P9I A;  2DW4 A; 
#chains in the Genus database with same CATH topology
 5J6X A;  2VB6 A;  2BZT A;  1ERD A;  4KA4 A;  1FT9 A;  4BBR J;  1ZKG A;  3PUF A;  2KRH A;  1FBQ A;  3OS2 A;  4EGY A;  3E6C C;  2KIS A;  1OIS A;  4ENJ A;  1ON1 A;  2O0Y A;  4BKX A;  3CUQ A;  4ESJ A;  5EEH A;  2OJE D;  4AIK A;  3WU0 A;  2CUF A;  1POG A;  3H3Z A;  3IP4 B;  2DOD A;  5GPA A;  3GTL J;  1YO5 C;  1HXD A;  1I6H J;  5KAI C;  5JLX A;  3BJA A;  3AKZ A;  2WC2 A;  2R7Q A;  2WY8 Q;  3MFK A;  3R61 A;  2CQK A;  1VQM I;  1YHQ I;  2CYY A;  5M5Y J;  1D0Y A;  4AC0 A;  3BR6 A;  1MJ9 A;  2R7O A;  3I71 A;  1Y56 A;  3CCR I;  1SD6 A;  3A1Y A;  2R7V A;  3VDX A;  4C9Y A;  1WQ2 A;  2KIU A;  1Q1H A;  3ABL H;  1FEX A;  1GDT A;  3R60 A;  2CFO A;  3CJQ B;  3QPS A;  2LY9 A;  4ZZL A;  2UUZ A;  2HNH A;  2LK2 A;  2ICW G;  2NYX A;  3DLA A;  5FB2 A;  1FMV A;  4M3B A;  3OR1 C;  2GAU A;  1HSJ A;  1SFE A;  4F91 B;  4RA2 A;  1B1B A;  2WWY A;  1VND A;  5HLH A;  3VWB A;  1GV5 A;  2HU9 A;  3OYI A;  4WXD A;  2CQQ A;  1N78 A;  4N4O B;  4BE1 A;  3ZQC A;  2ZNZ A;  4UNO A;  3ELK A;  3ZN0 A;  2H1L A;  1MMN A;  4ENN A;  1XSD A;  1VQN I;  2EK5 A;  4JX6 A;  4PJJ A;  2X6X A;  2IAI A;  2VPL A;  2R3S A;  1MH4 A;  5ICF A;  3K70 D;  2FRH A;  2IA0 A;  4GGG A;  4A3C J;  1Z6T A;  2HQA A;  3A0H C;  1YIO A;  2GXG A;  2O5R A;  1VQL I;  1YE9 A;  2IGM A;  1WZ2 A;  2MG4 A;  3H9Q A;  3S2H J;  4KFC A;  3ZQG A;  2QM3 A;  4HSR A;  2EZL A;  4P55 A;  4GYG A;  2R7Z J;  2ZME C;  3IL2 A;  1VQO I;  5KK1 A;  4CCL A;  2Y9Y A;  2NVX J;  2M87 A;  3CF5 F;  1SAN A;  4UV9 A;  1G3S A;  4L5E A;  3LQR A;  2PG4 A;  2CUZ A;  3HRM A;  4NHJ A;  4LG3 A;  4PZJ A;  1G59 A;  1LQ1 A;  5FFX A;  5L3B A;  2HOE A;  3FXK A;  2QF7 A;  1TQI A;  1YG2 A;  4BAY A;  3V4G A;  5EGO A;  2FD5 A;  4PFO A;  4LG0 B;  1Z9C A;  2FNP A;  1U6G A;  1XN7 A;  4M72 A;  5C44 J;  3WTX C;  1TNS A;  1MNM C;  4FE7 A;  3QQA A;  2HOS A;  2QSH X;  4UXN A;  4G6D A;  3A4C A;  4HX4 A;  2ISZ A;  1Z21 A;  2E1C A;  4Q5S F;  4LIV A;  3OL4 A;  3HTS B;  1LVK A;  1I3Q J;  3BG6 A;  2RQQ A;  2R0Q C;  1KZH A;  4EM1 A;  2IBD A;  3LAJ A;  5JR3 A;  4D5F A;  3M3Y J;  4I01 A;  1OR7 A;  2ZCW A;  2LYC A;  5J1U A;  4KIT B;  4F92 B;  5BNG A;  5FLX K;  2FMY A;  3DEU A;  5E8I A;  1RUN A;  1H89 C;  3HPG A;  4M71 A;  3WGI A;  2H8R A;  1WI3 A;  5FKM A;  1ZAR A;  1Z67 A;  2BV6 A;  3E97 A;  3PO2 J;  2E5Z A;  4I7H A;  3FZV A;  3OOU A;  5J40 A;  4LFU A;  1FP1 D;  1WRJ A;  3HEF A;  4JBA A;  1DU0 A;  3U1K A;  3OSF A;  4XRF A;  1LUJ B;  1X3Z B;  2JSP A;  1S72 I;  4B44 A;  3L2U A;  1PUF A;  4J01 A;  2ZME B;  3BR1 A;  5E79 C;  4ZYH A;  3SZP A;  3F23 A;  3J81 K;  1IGN A;  3E3V A;  1R6R A;  1D0X A;  2I8D A;  4IRH A;  4E7L A;  5J3L A;  1WKM A;  3FWE A;  2NS7 A;  3RPU D;  4C2M J;  3OYM A;  2F6C A;  4EJW A;  4RAY A;  3ECO A;  3E6B A;  1D8K A;  2DFE A;  2P8T A;  1PDN C;  1X1A A;  1Y39 A;  4A3D J;  3RZO J;  4KIC A;  2HDW A;  3CP2 A;  5LHG A;  3WGG A;  4I98 B;  1HKQ A;  2DQR A;  2CH0 A;  2ZXI A;  3DV8 A;  3FXQ A;  2GA1 A;  1MMS A;  4XNF A;  2KMU A;  3GME A;  4HBL A;  3Q9S A;  3FF5 A;  5FO5 A;  2H8W A;  1QGP A;  3T8R A;  1OMI A;  1E17 A;  3P5J A;  1X3W B;  3T1B A;  4A93 J;  3ROU A;  4ZTJ A;  4N9H A;  4D7N A;  4BE0 A;  4BJ6 C;  1AKH A;  2AXL A;  4CA0 A;  5DD4 A;  3IC7 A;  3LMM A;  2M3A A;  2KFD A;  2P5L C;  1TP4 A;  3BP8 A;  1UHS A;  2W82 A;  3NWS A;  3SEZ A;  2CV0 A;  3EUH A;  4U7D A;  3GFI A;  1QU3 A;  2ZB9 A;  2M9H A;  3CCS I;  1I1S A;  5FD5 A;  4HF2 A;  2L9R A;  1FOK A;  1NG6 A;  3BZ6 A;  1DP3 A;  2K86 A;  1KYW A;  3OYD A;  4XLH A;  3D1N I;  3F6O A;  5E1W A;  5C3E J;  1F1Z A;  1ZG5 A;  3KP2 A;  1V3F A;  2IW5 A;  1TWH J;  3EPZ A;  3GBG A;  1A35 A;  1O3T A;  3K0L A;  2XAS A;  2OQG A;  3LA2 A;  1PUE E;  1T56 A;  2LY1 A;  3GVA A;  3KX2 A;  2OBP A;  3TL4 X;  3V7C A;  3M8J A;  1V54 H;  2QWW A;  3DQV C;  5HDG A;  2EV5 A;  4UUV A;  3R6S A;  4E6K G;  1XGN A;  1M1E B;  3CJR B;  4C2T A;  4LB5 A;  4E7I A;  3M8E A;  1K6Y A;  4UV8 A;  1WCM J;  1JGS A;  3VEP A;  1I1G A;  3VSK A;  2CV1 A;  3BG5 A;  2P81 A;  2GXB A;  1ZLK A;  2AXT C;  4RB0 A;  1N77 A;  3QOD A;  4OIQ F;  2YX4 A;  4XOR A;  2FE3 A;  1ZTR A;  2JTV A;  5DM6 F;  1U8B A;  5ICC A;  2E2J J;  2H6C A;  5IYD J;  2R5Z B;  2O8X A;  2QUF A;  5IT9 Z;  2CS3 A;  2ZC2 A;  3ZMS A;  3LSR A;  4ABZ A;  4M9X A;  2H94 A;  3T8T A;  1ZGW A;  1UAA A;  1Z3X A;  3AAF A;  1FLI A;  1Z91 A;  3CCL I;  5J8C A;  2Y75 A;  2A61 A;  4AID A;  4OAY A;  3ESW B;  5FKL A;  3C3W A;  3E6D A;  2JUC A;  2HVR A;  1Y1W J;  3HSF A;  1K7A A;  2M0M A;  1T98 A;  3LSM A;  4ZJZ A;  2HOA A;  3HC7 A;  2EFW A;  3F72 A;  1IXS B;  4ZZD A;  4DBR A;  3E5U A;  4XKW A;  2MC4 A;  3TO9 A;  1Q1V A;  4NBQ A;  5GAD J;  3NWT A;  4KUM A;  3RYR A;  3DPT A;  2VJI A;  3VYR B;  2ETH A;  2R5Z A;  5E17 F;  3RYP A;  2L7Z A;  3CCQ I;  4PJ0 C;  1Y6I A;  2ECC A;  3N4M A;  1W7P B;  3EUK L;  2DPU A;  3E0J B;  4BEH B;  1MDM B;  1X1D A;  5HS9 A;  1BN5 A;  3F8C A;  5L3E A;  1BI0 A;  1ETX A;  3TO6 A;  2X4H A;  3OYE A;  2E36 A;  3I58 A;  2W85 A;  1FMW A;  3ZMT A;  4A3M J;  2KP6 A;  5BOX A;  1ORK A;  1Z77 A;  4EV0 A;  4GXO A;  3F21 A;  2LBF A;  2HYF A;  3NEU A;  2W1O A;  3LSJ A;  3DKW A;  1TNT A;  4ZDO A;  1MMD A;  4M73 A;  3VYS B;  1QA6 A;  3ULQ B;  1XD7 A;  3CMY A;  3DTK A;  3LSK A;  3BLY A;  4AD9 A;  4D7M A;  2ISY A;  1YYV A;  1W7P A;  2STT A;  3KYC B;  2WB1 A;  2E60 A;  2Z99 A;  3RIR A;  4NDL A;  3W2V A;  5B1B H;  4Q4Z F;  2CJJ A;  4EJU A;  5HDK A;  2FNA A;  3I4P A;  4A12 A;  4JQF A;  3FKJ A;  4MLO A;  2EZI A;  2OA4 A;  1MJA A;  1TW2 A;  3MQ0 A;  3PL8 A;  2R7T A;  2QQ8 A;  3RKQ A;  2DA6 A;  1F5T A;  4AVP A;  3ML6 A;  4OIR F;  5DTD A;  2YU9 J;  2WAD A;  5J1R A;  4BHC A;  4WXC A;  2RVC A;  5TJJ A;  3A2K A;  3BG9 A;  4RDU A;  2X85 A;  2BHZ A;  3RPQ A;  2W7N A;  1Z3Y A;  4U88 A;  2VJ4 A;  4BQN A;  3HPH A;  4BQA A;  1VQP I;  3WHB A;  3R0A A;  5K1Y A;  2VQC A;  4CO8 A;  5B66 C;  4MNU A;  1T0F A;  3JR9 A;  2LMD A;  5D8L B;  2X51 A;  4A0X A;  1EH8 A;  5IP9 J;  2HR3 A;  3LSI A;  3QPH A;  2DMT A;  2VKH A;  3GZ6 A;  2BE5 F;  3L9F A;  4II3 A;  5IOY A;  3TED A;  3JAM Z;  3BR2 A;  3RI4 A;  4G7O F;  2PMZ N;  3U1D A;  3VPR A;  1W36 D;  4Y33 A;  3C18 A;  3CUO A;  1ENH A;  2DU9 A;  2DYS H;  2BW3 A;  2KDZ A;  5FKO A;  3JSO A;  1IRX A;  3HHG A;  4KIF A;  2VUM J;  3JRF A;  2UWM A;  4M6Y A;  3K2Z A;  4UVA A;  3OYN A;  2VC1 A;  4Q47 A;  2E19 A;  4KMU X;  2EZK A;  5CJ9 A;  1R23 A;  3CDL A;  3S15 J;  1BA5 A;  3PIO F;  1GXP A;  4Y3O A;  3JW4 A;  2VQL A;  5JVT A;  1JTY A;  2B0L A;  1S6L A;  3PO3 J;  3MZ8 A;  2L4M A;  3OYJ A;  2VBW A;  3RZD J;  2R7D A;  2F4M B;  4IJA A;  4YII A;  3UKG A;  3H35 A;  4A3I J;  3OWT A;  3FM5 A;  4E7K A;  1R58 A;  2JUG A;  4XKC A;  5DYM A;  1ETV A;  1LFB A;  3BC8 A;  2C6Y A;  1WH5 A;  1YJN I;  4ESB A;  1S9H A;  3HDD A;  3HTU A;  3Q0W A;  2ADU A;  2GBY A;  5K7F A;  5D6F A;  1ZH5 A;  2JQ7 A;  1W5T A;  2K40 A;  2XHK A;  1X1P A;  4B4C A;  5J4Y A;  4S04 A;  4BDY A;  3RQI A;  2A6E F;  2K5C A;  2XB5 A;  2XPV A;  1E2X A;  5E20 A;  1JXS A;  2NVY J;  2VAS A;  3GX4 X;  1IF1 A;  3MWM A;  4KJZ A;  3SEQ A;  1S7O A;  3HOW J;  1B4A A;  4CXF A;  1GXQ A;  4D5C A;  3KLN A;  4PSX A;  2RNG A;  2D5V A;  3RSN A;  1G8X A;  1LDJ A;  2GIZ A;  4B47 A;  3FXL A;  2FF4 A;  3G1M A;  2JRM A;  5KVR A;  4CH7 A;  1REP C;  2PI0 A;  3TOB A;  3FXU A;  1YI2 I;  4KYW A;  1MMG A;  1NHA A;  2XAJ A;  2IRF G;  2XAH A;  2A68 F;  3WTZ A;  2J5P A;  4HRI A;  1IW7 F;  1TZL A;  3WTT C;  3KCC A;  3ECH A;  4G9Y A;  3BRO A;  2F4O B;  2I10 A;  3CLQ A;  3GXO A;  3DPU A;  4C3H J;  2HPI A;  4HF0 A;  1XCB A;  2V9K A;  4Y13 A;  1IG7 A;  4A0Y A;  1PJR A;  3C2H A;  2GM4 A;  4AU7 A;  2KIM A;  1VQ6 I;  2QEX I;  3CUQ C;  1KGS A;  2CQX A;  4CCK A;  4Y15 A;  3WG7 H;  3F6V A;  1VF9 A;  3OYH A;  3COA C;  1Y1V J;  2HDD A;  2KQR A;  1PP7 U;  2EIL H;  5LD2 C;  3B02 A;  3WU1 B;  4RM2 A;  4I76 A;  3SDB A;  4F3Q A;  3P9K A;  5IOZ A;  4LG0 A;  4YEL A;  4M6V A;  2MBF A;  3I59 A;  1Y0N A;  4IEJ A;  4GRI A;  4A3G J;  1RC9 A;  2JA5 J;  3GFM A;  4V2G A;  1ZLJ A;  1B6A A;  3BTI A;  3K70 C;  3HOY J;  2HQR A;  1FNN A;  4XLE A;  3S16 J;  4LMY A;  2P6S A;  1X58 A;  3DWL E;  4A5N A;  1SD5 A;  2HXI A;  1XGO A;  3LL7 A;  5ICG A;  3E7L A;  1JHF A;  1QNT A;  4MO7 A;  4MQV A;  2IA1 A;  2HFH A;  2IGK A;  3BTL A;  4TV7 A;  3Q0U A;  3DU5 A;  4XRS A;  1BJA A;  2ZO4 A;  3H9G A;  3K1M A;  1WGX A;  2JPC A;  4HQE A;  5FLX Z;  1VQ5 I;  2MLG A;  1MBE A;  4BXF A;  3TGN A;  1JUM A;  3WTU C;  4OMZ A;  2HWV A;  3KET A;  5E18 F;  1K6O A;  2DA7 A;  1KON A;  3PQK A;  1EKE A;  1HOM A;  1KU7 A;  1O3Q A;  1XS9 A;  4UUS A;  3PUB A;  4JK1 X;  3L1P A;  2K7L A;  2DFF A;  3MN2 A;  5HVQ C;  1IUF A;  4L9T A;  2IS4 A;  2FUG 2;  2TCT A;  5DUI A;  1H8A C;  1UEL B;  5D4S A;  2JWT A;  4IO9 F;  2F5V A;  1NK3 P;  5HS8 A;  4BHB A;  1KQ0 A;  2BOL A;  1JE8 A;  3J81 Z;  4EMS A;  4G6T B;  5JVG F;  3I4M J;  4OIN F;  5GTI C;  1XSX A;  3O2P E;  4M9Z A;  2Q2E A;  3CUQ B;  3OL3 A;  4A5M A;  4PJN A;  2Y0S A;  1GHC A;  3TBI A;  4L5I A;  1UG0 A;  2LRD A;  2VI6 A;  1IO2 A;  2XRN A;  1G3W A;  3QOP A;  1L3L A;  2E2I J;  5CVJ A;  4XRS G;  4B1R A;  4IOA F;  3I0T A;  4PSW A;  4IQJ A;  3HB9 A;  4M9S A;  3ZRG A;  4IRG A;  4UVB A;  3SFI A;  2DTZ A;  2RQP A;  4UY8 I;  2LF8 A;  4XLN F;  1OCC H;  3IH4 A;  2W24 A;  4B09 A;  4HZF A;  3HIF A;  3GUD A;  2CQ7 A;  2OAZ A;  1VQ9 I;  4E7J A;  3V8J A;  1GVJ A;  3BG7 A;  3TKY A;  1IN6 A;  1IC8 A;  5FRO A;  5HNH A;  2EV0 A;  2HI3 A;  4G7Z F;  4EM2 A;  4RM3 A;  2Y2Z A;  3U9G A;  2CRG A;  2DO7 A;  4ZYA A;  3V7S A;  4AYB A;  3KZI C;  2F5C A;  1MNE A;  2KRF A;  5A2Q K;  4KIG A;  1RPW A;  4U7B A;  1X4O A;  4A6E A;  5GAH J;  3S1M J;  2EIN H;  4M3E A;  3WTS C;  5E3N A;  4YFX F;  5BQT A;  3A01 A;  4DIQ A;  1DPR A;  2E34 A;  1ETW A;  1I5Z A;  1X1C A;  5CVR A;  5LHI A;  5ED4 A;  2VOD A;  1YX5 A;  1T38 A;  5F27 A;  3ABT A;  4O6J A;  3HGY A;  1OR7 C;  5H20 A;  1STZ A;  5EEA A;  4RAZ A;  3QYF A;  1BC7 C;  1FOX A;  4I0A A;  4CYC A;  3BTJ A;  3SXY A;  4KMF A;  3BR0 A;  3CCV I;  4XOP A;  1H88 C;  2VOP A;  3JRH A;  2YUS A;  1OQY A;  4FX0 A;  2L9S A;  2FA5 A;  4L0Z B;  3WE2 A;  3JRI A;  2QKL B;  3E5X A;  4HDV A;  5H2F C;  3JTG A;  2OCC H;  4K2E A;  1ZYR F;  1W5S A;  3MCZ A;  3S1Q J;  1RNL A;  2QYO A;  3BJ6 A;  3VOD A;  1TQP A;  3ZOB A;  2VBX A;  3HJE A;  4RB1 A;  5L3G A;  2XDV A;  5F0H A;  1E3O C;  1ETY A;  1ODD A;  2NOG A;  3RQ4 A;  3OIO A;  3WTY C;  1FIA A;  4S05 A;  5FKK A;  3PFY A;  2KIQ A;  2A5Y B;  1FBU A;  5EGO B;  4KDP A;  4A2U A;  5CLS A;  3QAH A;  3TDZ C;  2D1H A;  4BYY A;  4LB6 B;  2NVT J;  2IT0 A;  1ZR4 A;  1F9N A;  1I27 A;  2PQ8 A;  3WHC A;  1FTT A;  3J7A O;  3GO5 A;  4IXA A;  1SVO A;  5ILU A;  4PJM A;  2O9L A;  3BWG A;  1S8N A;  3HKZ A;  2RNJ A;  3DBL B;  3KP4 A;  3NAR A;  1FTZ A;  4GCV A;  2QKM B;  3WGH A;  2MGQ A;  2IPQ X;  3L2C A;  1Z1D A;  2K85 A;  2JA2 A;  2O3F A;  1R36 A;  2KRC A;  4PDK A;  4EAT A;  1RET A;  4V2F A;  1ZGJ A;  4DW6 A;  1LPQ A;  4A3E J;  2G9W A;  2DPD A;  2F5F A;  2IS6 A;  3EUH C;  3KP7 A;  4XON A;  1WVR A;  2K9S A;  3SHF A;  1VI0 A;  2XGE A;  1XMX A;  2YS9 A;  5DCM A;  4X0G A;  3JRD A;  2H09 A;  3I64 A;  5HLT A;  2PEX A;  1S7A A;  2XF7 A;  4Y52 J;  4G8X A;  3RPU A;  1DGR M;  1VQ4 I;  1FYK A;  3ZGK A;  4MEX F;  1PUF B;  1SAU A;  1XPX A;  2ZSI B;  3N97 A;  3IH2 A;  2MH9 A;  2VBZ A;  2LD5 A;  2O61 A;  3EDP A;  4KIS A;  3CC2 I;  1QVT A;  4U0Y A;  3VOE A;  5HDN A;  2ZFW A;  4IQ4 A;  4ENK A;  3FXR A;  1VTN C;  4RB3 C;  5EZH A;  1S3J A;  2K02 A;  3HUG A;  3KZZ A;  1LB2 A;  3Q0V A;  3FXO A;  1Z05 A;  1ZRD A;  2O6G E;  4A3F J;  1LEA A;  4IHW A;  1ZG3 A;  4QLC U;  3JTH A;  2NVQ J;  1FSH A;  3ISP A;  3F8M A;  4A69 C;  3U2R A;  4DYQ A;  2V1U A;  2NXN B;  1HKT A;  4IKF A;  3GZN B;  3K4C A;  3H3V K;  2PFB A;  3DEE A;  4HF1 A;  1AA7 A;  2GA2 A;  3DEW A;  4MGR A;  1AKH B;  1B9N A;  2XF5 A;  1DQU A;  4LK0 F;  1T39 A;  3OYA A;  1IRG A;  3C1D A;  1U9N A;  3IWZ A;  3ZQI A;  5F1J A;  1B8I A;  1ACI A;  1J75 A;  2ZKZ A;  5DCF A;  1E3H A;  4HPQ A;  1WPK A;  4H0E A;  2PLY A;  3K4N A;  2DA2 A;  2ESH A;  3ZQF A;  1W5C C;  2UV1 A;  1I39 A;  2WAQ A;  4RB2 C;  1YJW I;  4IOC F;  1W1W E;  1K79 A;  3PSI A;  3WTW C;  4CCN A;  2QBY A;  3FXJ A;  1EH6 A;  3HSR A;  1IN4 A;  4HV5 A;  2Z9O A;  5E3O A;  4PK4 A;  3HYI A;  3ZQQ A;  3OYG A;  1HQC A;  2XIG A;  1YRN A;  4DOZ A;  1O4X A;  3F8N A;  1A6Q A;  2DT6 A;  4D0P A;  1IRZ A;  2DXI A;  4GFB A;  3PSF A;  1A04 A;  5EEG A;  4HG2 A;  3KIO A;  3HRU A;  1XSV A;  4JOM A;  4EJT A;  4OIO F;  4Y4R A;  4MTE A;  5JHU A;  3L2Q A;  4Y17 A;  5HLI A;  4LLG F;  4AIH A;  1BR2 A;  2IXS A;  1R4M B;  2NNN A;  5J8F A;  2YX7 A;  2M30 A;  2ZXH A;  3JRB A;  5GAG J;  4HX8 A;  5EF6 A;  5LLQ A;  5D5V B;  2ELK A;  3F8B A;  1YW9 A;  4G94 A;  3G4S I;  4ZH4 F;  4PGG A;  3L2R A;  3BCB A;  3OYK A;  2O7O A;  1U5T A;  3A0B C;  3ZXS A;  3JCU C;  4G12 A;  4I2O A;  3M1E A;  3WE3 A;  1RKW A;  2CG4 A;  2DAO A;  2IVM A;  2N8G A;  4YIR X;  4FTH A;  4HA8 A;  1SFU A;  1W36 C;  2IS2 A;  3BZK A;  4B8X A;  3A03 A;  2ECB A;  3GCM A;  2VJJ A;  4NC6 A;  3E6M A;  4IHX A;  4ASN A;  2W48 A;  2LVS A;  2OC6 A;  2QQ9 A;  2EFQ A;  4AM3 A;  1U8R A;  1SVL A;  3CJN A;  1UZC A;  4P1W A;  3I9V 2;  3CME I;  1HW5 A;  3G6E I;  1AHD P;  1MSF C;  4XK4 A;  2AS5 F;  3DU6 A;  1XC5 A;  3QPL A;  5JI6 A;  3MZH A;  5FRM A;  1B72 B;  1LKX A;  3BY6 A;  1G2H A;  2K9N A;  1BIA A;  3M8F A;  3JRC A;  2V4J C;  4XSZ F;  5M3F J;  1P6R A;  1YTY A;  1T0F C;  2OCE A;  2VON A;  5JHF A;  3KP6 A;  4LIT A;  5KNL A;  2EIJ H;  3AG4 H;  3HZJ A;  1BJZ A;  3ERM A;  5EG0 B;  2WV1 A;  2MAB A;  2NNY A;  1TL8 A;  4OAZ A;  5B1A H;  3IAS 2;  1EH7 A;  5EDN A;  1AWC A;  4B3A A;  4X1E A;  3S2W A;  2M4G A;  2HKX A;  2DA3 A;  4KT6 A;  2ME0 A;  3FBI B;  3KZY A;  4AWX B;  2XV4 S;  3W6J B;  5LEK A;  2LBF B;  4FX4 A;  1JKP C;  1MBF A;  1B72 A;  2KIF A;  2Z2S B;  3H1C A;  4P96 A;  1UST A;  2LKP A;  2OF7 A;  5LGN A;  1YQA A;  1BI1 A;  2BXZ A;  4U87 A;  4CIC A;  1U3E M;  1QHH D;  2L4A A;  3D0S A;  1T95 A;  2Z5U A;  3FK7 A;  4HST A;  4RLQ A;  2FQ4 A;  4YFK F;  1CQT A;  5K7Z A;  3ZR8 X;  5L3C A;  5F08 A;  3BOQ A;  1S29 A;  5EG0 A;  1MBK A;  3JRA A;  2J5O A;  1RES A;  1MND A;  4BJ5 C;  2M4K A;  3SZT A;  3VB2 A;  2WY7 Q;  3W6K B;  2K3F A;  2LNB A;  4CGZ A;  5E1X A;  1BBY A;  3M4O J;  3GLL A;  2BYV E;  2V6C A;  3V7R A;  5EJC A;  2VLA A;  5LRS A;  5FLV A;  4Z6Y A;  2VE8 A;  2DBB A;  2EA4 A;  3M9A A;  4FET A;  2DA1 A;  2Q0O A;  2H27 A;  1ONV A;  2LF7 A;  2GLO A;  1PYV A;  4KN4 X;  3JRG A;  1FZP B;  3CF2 A;  5GPC A;  3ABU A;  2XRO A;  4BQO A;  1TT5 B;  1BR1 A;  3D5R C;  4EJV A;  1YIT I;  5CVI A;  2WAE A;  4NC7 A;  5JFR A;  4BDZ A;  3ZMU A;  3E1S A;  2K9L A;  2BBY A;  5AIP A;  3HL2 A;  2K4B A;  1ITY A;  2EA2 A;  2BXY A;  3OYF A;  3ZCO A;  1MBJ A;  2L9V A;  1K4S A;  4KN7 X;  1IJW C;  1T08 B;  4LD5 A;  4CZC A;  2F48 A;  2MW8 A;  4DYC A;  3CC7 I;  4EJO A;  3FHZ A;  1WJB A;  1SFX A;  2F5E A;  5JLW A;  5FGM A;  4I09 A;  3V8K A;  4XN0 A;  3IRR A;  2FSW A;  2BW3 B;  3MKZ A;  4DZP A;  2LLK A;  2ZJQ F;  2VT2 A;  4DZJ A;  4LIU A;  3BR3 A;  5EZG A;  4BU2 A;  3VFZ A;  3RTR A;  5FJ8 J;  1BR4 A;  1JKR C;  3QP6 A;  2DI3 A;  2QGU A;  5J1Y A;  2EZH A;  1OCO H;  4J00 A;  2I5U A;  3S3N A;  4KNY A;  2QZ8 A;  5AON A;  3ABK H;  2FBI A;  3FBN B;  1ETQ A;  3LQQ A;  2RN7 A;  3B6A A;  1GLN A;  4Z2Y A;  2CGP A;  2DMN A;  1Y8Q B;  4LLN A;  4HNU A;  1XMA A;  2K9M A;  4BBS J;  3EUA A;  4L0Y B;  2R7X A;  4HNV A;  3RKW A;  4FIS A;  4RAF A;  4ZDP A;  2JA8 J;  3QPT A;  1FJL A;  3ZQ7 A;  3K1P A;  3PIP F;  1QVU A;  2P0W A;  2XGX A;  2Z1D A;  3F0C A;  2WTE A;  1D1A A;  4FQG A;  3ZPL A;  1SC7 A;  2NOJ B;  2Y0M A;  1YS7 A;  3KYL A;  4RAG A;  3CD6 I;  5ICE A;  2EIK H;  2YPR A;  4HAM A;  1OCZ H;  5C4X J;  2ZXJ A;  1JHH A;  2M8G X;  2JVH A;  3I55 I;  5A2Q Z;  2LDU A;  5IYC J;  2R7S A;  3S17 J;  1U0J A;  2JRT A;  2OPT A;  3AG1 H;  1MMA A;  3B6C A;  3BQY A;  2Y9Z A;  4M3D A;  1W0U A;  3CMM A;  1FY7 A;  4ON0 A;  3IKT A;  1KU9 A;  5K5R A;  2Z33 A;  2VKE A;  1ZN2 A;  1O7F A;  4WXH A;  2B9S A;  3L00 A;  4ETS A;  3GTQ J;  4ZYE A;  3A02 A;  4PGH A;  2FOW A;  4D1Q A;  2EB7 A;  4XL9 A;  1IDZ A;  4S0H B;  1D1B A;  3DKY A;  2ME6 A;  1EV7 A;  1T8I A;  2X48 A;  3FXM A;  5ILV A;  4BQQ A;  2O03 A;  1SMT A;  2D2W A;  4OOI A;  1G3T A;  5LHH A;  1H9G A;  2DK8 A;  3BG3 A;  5GP9 A;  1FOW A;  3VYT B;  2HZD A;  2G7H A;  3TP3 A;  2VKD A;  5BPD A;  1HF0 A;  2L7F P;  1P9Q C;  4F93 B;  2M8E A;  3F9K A;  5TGT A;  3W3C A;  1WH7 A;  3KP5 A;  1R71 A;  4IHV A;  2Q8K A;  2LG4 A;  1OCR H;  2LFB A;  4N9I A;  1ZG1 A;  1TC3 C;  1HDD C;  1IRF A;  4RBO A;  3EYI A;  2VJ5 A;  4CCJ A;  4XLA A;  1P2F A;  2BVL A;  2DJI A;  2UXX A;  3CCE I;  2RKH A;  1Y0U A;  1HA8 A;  2P5V A;  4FE4 A;  4XN3 A;  3RCO A;  2X1C A;  1U78 A;  3OSG A;  3GTO J;  2LY2 A;  1Z6R A;  1KA8 A;  3DPL C;  2E5N A;  1H0M A;  3LA3 A;  4NB5 A;  1GT0 C;  1XB4 A;  3D5L A;  3BPV A;  4BGD A;  3C2B A;  1JJ6 C;  1X4P A;  2OU2 A;  2R7U A;  3RDI A;  4LGW A;  3DXJ F;  1BI2 A;  3I59 B;  3BR5 A;  2FX0 A;  3OIQ A;  1WSU A;  1DDN A;  5FRN A;  3OYB A;  1X3U A;  2HYG D;  1QZZ A;  2L9N A;  2EIM H;  3ABM H;  3P7N A;  2DK5 A;  2VQG A;  1D5Y A;  1MH3 A;  1I6X A;  2JPB A;  4XLF A;  5IP7 J;  3OS1 A;  3JRE A;  2E2H J;  1R4N B;  4YFN F;  2F4I A;  4G7H F;  3F22 A;  3J7Z I;  1X19 A;  3TW7 A;  2R93 J;  3H9J A;  3QRF F;  2NAZ A;  3PNY A;  5B3S H;  1BIB A;  2DN0 A;  1TBX A;  3BQZ A;  2EBI A;  1ZAO A;  3ASO H;  2RRE A;  2M7A A;  2XAG A;  2ID3 A;  2E35 A;  4EGZ A;  2HXO A;  2V1X A;  3DP7 A;  4UUS B;  1W4M A;  1G6N A;  2LH9 A;  2G0E A;  3MEX A;  5LFA A;  1T2K A;  3AG3 H;  4M74 A;  3S93 A;  3EQL F;  1KYZ A;  4HDU A;  1C0W A;  1F43 A;  2H1K A;  3BT9 A;  3ZMZ A;  4A6D A;  3LOC A;  4B48 A;  1KU2 A;  3KYD B;  2JA7 J;  3OR2 C;  3KP3 A;  3V8L A;  1D1C A;  4P5O A;  2Q2E B;  4EQQ A;  4GDF A;  1IN7 A;  1GVD A;  1EJ9 A;  1K83 J;  2QQA A;  4ZYG A;  1P4X A;  1OJL A;  2JK3 A;  3H0G J;  3F3X A;  5E8G A;  2DDB A;  4UB8 C;  1MZB A;  2OTJ I;  4IF4 A;  1LE8 A;  4WCG A;  2YR2 A;  4C3I J;  4A3K J;  4RGS A;  4I02 A;  4NQW B;  1HW2 A;  4MFD A;  2P7C B;  1HST A;  2TDX A;  1JJ8 C;  3GTK J;  5EYR A;  4C3J J;  2OTL I;  1XGS A;  4HNT A;  4BJT A;  4FT8 A;  4RGU A;  4BNC A;  1FYM A;  1XDS A;  1VQ7 I;  1R1T A;  2VL8 A;  2VXD A;  3G3Z A;  5LGU A;  2M2E A;  4MTD A;  2E1N A;  1RKT A;  3S1N J;  4DGW B;  1WJE A;  3DBR B;  1ZEL A;  3O6B B;  4BS9 A;  1XTA A;  4UB6 C;  3BTC A;  2A5W A;  2CW8 A;  2EV6 A;  1VQ8 I;  5FLM J;  4W97 A;  1ULY A;  2L7M P;  2UZK A;  3AFH A;  2V7F A;  4BL0 B;  1BM9 A;  1HBX G;  4NQW A;  3SZG A;  3L2V A;  1PP8 F;  2GQQ A;  2BHY A;  3DCF A;  2MFZ A;  3SFZ A;  1FYL A;  3HSE A;  3A01 B;  2JSC A;  1D0Z A;  3FMR A;  4IZZ A;  4BE2 A;  2IGO A;  1D5V A;  2M7B A;  2V79 A;  2P6T A;  2DOE A;  4ENM A;  1XGM A;  3PQJ A;  4J19 A;  4P9U A;  3SDG A;  4CYC B;  1G4D A;  3GZ5 A;  1DP7 P;  2Q1Z B;  3KFW X;  1B9M A;  3DFG A;  4ANJ A;  3O3K A;  2E7X A;  1L0O C;  2EFP A;  3K10 A;  2ACJ A;  4XOT A;  2KLO A;  1K4T A;  1RIO H;  4JX5 A;  3PFI A;  2IJL A;  4N4N B;  5DEQ A;  4WK8 F;  1JUS A;  1E0E A;  2HKO A;  2VPR A;  2QQB A;  1J5Y A;  1XMK A;  3IWF A;  3K4J A;  1MBH A;  3ONQ A;  2CQN A;  1P92 A;  1S5L C;  2NVU B;  2EH3 A;  1EA3 A;  1SFK A;  2MD0 A;  2DQL A;  1USS A;  2MA3 A;  3G1L A;  3HOX J;  3FHN A;  1H9T A;  2VQH A;  3HBL A;  3DBH B;  1YLF A;  1TT0 A;  3J80 K;  2ESN A;  2XSD C;  2L0K A;  3PNT A;  1OCP A;  1YW7 A;  3IRQ A;  2LKX A;  2IGN A;  1V5G A;  1JKQ C;  2MSY A;  5DV5 A;  1MIJ A;  4A0Z A;  2Y30 A;  3REO A;  4ITV A;  3CMA I;  2L54 A;  2CO5 A;  2L02 A;  3B73 A;  3GEZ A;  3QWL A;  4HV6 A;  4RS8 A;  3C7J A;  4QPQ A;  2XPW A;  3KEO A;  4CYD A;  3CO7 C;  1SFO J;  2XGC A;  5BS6 A;  1IV8 A;  2PMZ A;  1JT6 A;  1R7J A;  4RGR A;  4XIC A;  1ETK A;  2DMQ A;  2BEO A;  5CQG A;  2LKS A;  3P9C A;  3TOA A;  5D8K B;  2P4W A;  1FOY A;  2PMU A;  4XMY A;  5BMZ A;  3J7A Y;  1TLH B;  4B43 A;  4Y7N J;  1WHU A;  5BPI A;  3CCY A;  3W2A A;  3KEY A;  5J4V A;  2FEZ A;  4CCM A;  2CU7 A;  1O3S A;  5L3D A;  1V4R A;  4HQM A;  4HOB A;  4XKV A;  2IP2 A;  2VC0 A;  3I4N J;  2DDA A;  1MD0 A;  3NAU A;  4KIB A;  2X1D A;  2VN2 A;  2P7V B;  2XGD A;  1F4K A;  2ZNY A;  3AL0 C;  1R00 A;  2A6T A;  1BW6 A;  1IN5 A;  2V9V A;  4E70 A;  1UFM A;  5DCM B;  2CW7 A;  3V42 A;  4F52 A;  1MBG A;  4A3B J;  2Y69 H;  1EF4 A;  1ZGA A;  5H6R A;  3W6V A;  1KQ8 A;  1MGT A;  2STW A;  3ASN H;  4HLX A;  2CFX A;  1HCR A;  2WB1 N;  2RGV A;  3OMY A;  2KJC A;  3DLL F;  1U9O A;  1A31 A;  3LSP A;  5LEJ A;  1JKO C;  3CJT B;  1W0T A;  1OPC A;  2CMP A;  4DYR A;  3OS0 A;  1D8J A;  1F36 A;  3HUG B;  3L7W A;  3IAM 2;  4HYE A;  3ZQH A;  1KU3 A;  5AIQ A;  3FIW A;  1DU6 A;  4JP0 A;  5K7H A;  5GTH C;  1TWG J;  4MQ9 F;  1RZ4 A;  3WTV C;  1WJF A;  3TO7 A;  4LK1 F;  4C30 A;  4PUS A;  2EJR A;  2E7W A;  2B63 J;  4MFE A;  1U5T C;  1DPU A;  1WFX A;  2COM A;  4LOC A;  1LDD A;  1YW8 A;  1YS6 A;  1OKR A;  2GOX B;  4HEA 2;  2HDC A;  1QQI A;  4IPA A;  2KDO A;  4H4K C;  2VBY A;  2X6W A;  4OMY A;  1QRY A;  2ID6 A;  4GO1 A;  2KL4 A;  1UG2 A;  2YSR A;  4XBF A;  2XC7 A;  1HLV A;  2HEO A;  1WI9 A;  3GFJ A;  5F6F A;  2OV7 A;  1B8I B;  2M34 A;  3GF2 A;  2RAE A;  2M5W A;  3GTJ J;  3LFU A;  2VXZ A;  2XVC A;  5HS7 A;  3OYL A;  4NNJ A;  5DUK A;  1S7E A;  3W2W A;  5HNF A;  1R1U A;  1FC3 A;  5D6E A;  3AL0 B;  3ZQL A;  1R5H A;  2V6E A;  2WV0 A;  2QSF X;  4L9J A;  2F5D A;  3KEQ A;  1RR7 A;  4NC8 A;  5L3F A;  4YRV A;  2R5Y B;  3CC4 I;  3JSP A;  2FU4 A;  2QBY B;  2AO9 A;  2LTP A;  5LBQ A;  2M0C A;  1IN8 A;  3HRT A;  3H5N A;  3D5S C;  2CV2 A;  1YRN B;  3HOU J;  3HHH A;  4I99 C;  3LA7 A;  2RV8 A;  2MLK A;  2X9D A;  3TW6 A;  2PJR B;  2R7F A;  2L7K A;  1TQM A;  2XF6 A;  4PCQ A;  4R1H A;  3MKL A;  4L5J A;  2QVO A;  5CQE A;  3S14 J;  3UNG C;  4IVN A;  1V55 H;  1MKM A;  4XID A;  3HM5 A;  4BAC A;  3PM1 A;  1P4A A;  2XRL A;  1ZHF A;  2HVS A;  2R5Y A;  2L01 A;  2DMU A;  1E3P A;  2NS0 A;  2ZJ2 A;  4B3X A;  1UMQ A;  4L9N A;  1G3Y A;  2FML A;  4CZZ A;  1U5T B;  3K7A J;  3CTA A;  2Z3Y A;  2DCE A;  2VE9 A;  4IRI A;  1LEB A;  1X2M A;  2GWR A;  2JVG A;  2PN6 A;  4ZTF A;  2PJR A;  2PMH A;  1QHG A;  1VFC A;  4CDG A;  4KT5 C;  1QBJ A;  1N25 A;  3Q9V A;  1ZR2 A;  1RR8 C;  1FBS A;  2BVM A;  2VIX A;  4EVI A;  4R79 A;  3GYH X;  2ZME A;  4BUP A;  1HC8 A;  2W4S A;  1UB9 A;  1FPQ A;  3AG2 H;  4Q48 A;  4IHT A;  1YFH A;  3BZC A;  2MD5 A;  2ELH A;  5D4R A;  2TRT A;  2EWN A;  3H5R A;  1LFP A;  1N75 A;  1FIP A;  1TWA J;  3HG9 A;  3KPH A;  4XSX F;  3T5X A;  5K5Q A;  1BI3 A;  2HOT A;  4HLY A;  1NTC A;  1HKS A;  2HZT A;  2YU3 A;  5TIS C;  2G7U A;  2JN6 A;  2V1N A;  3H36 A;  3BCA A;  2DLL A;  4UHT A;  1DGW Y;  5F04 A;  4XKB A;  3DTI A;  1CGP A;  5FFZ A;  1ON2 A;  2AQE A;  2XAU A;  1RI7 A;  1I50 J;  3MAJ A;  3LNQ A;  1YX3 A;  3FMQ A;  5LGT A;  1SEU A;  1O57 A;  2L3D A;  5DS9 A;  2A69 F;  2XB0 X;  3FMS A;  1OYI A;  1UJ8 A;  1VZ0 A;  4DJA A;  1J0R A;  3NQO A;  1JTX A;  5IT3 A;  1RRJ A;  2A3S A;  3IHU A;  3LWF A;  1OYY A;  3QU6 A;  5F64 A;  4L18 B;  3MMY B;  3QYE A;  1TW3 A;  3OOP A;  3WG9 A;  2CWE A;  2HS5 A;  5D5U B;  1DUX C;  9ANT A;  1YOV B;  1ZRC A;  2LC2 A;  3K2A A;  3GW2 A;  1XCV A;  3BJO A;  5KAF C;  1NK2 P;  1O7L A;  1OFC X;  3DTE A;  1LFU P;  3H92 A;  2R7W A;  3ZN1 A;  4O5V A;  5D5W B;  4DNC A;  1WJC A;  2DOF A;  2ZSH B;  3S3O A;  2PBI A;  1YIJ I;  3I3L A;  1P4W A;  3GWZ A;  1PVE A;  3I56 I;  5TRD A;  2A07 F;  3ZP5 A;  3H5A A;  2W25 A;  3KE2 A;  2PX9 A;  2WBM A;  4MEY F;  3CO6 C;  4IHY A;  2KZG A;  1ETO A;  1P7I A;  1CF7 B;  1QZY A;  2IA2 A;  3HOZ J;  1Z7L A;  1UCR A;  2UXN A;  3K4B A;  2XPU A;  2NRA C;  1LVA A;  3M7G A;  4D9J A;  2ZFU A;  2XKP A;  4HX7 A;  3WOD F;  1APL C;  3G1O A;  4M3G A;  4BXX J;  2FQ3 A;  5E3L A;  3QP5 A;  5IYB J;  5CYV A;  3ZMD A;  2GIV A;  3CZ6 A;  3LFK A;  3K1N A;  3EET A;  2D45 A;  4BH9 A;  5HOD A;  2WAF A;  1A6I A;  3H0D A;  4A3L J;  3DF8 A;  3Q5F A;  3O8G A;  5FKN A;  1IV6 A;  1WWX A;  3IKV A;  1X2N A;  2Z16 A;  2GOM A;  1CF7 A;  1YJ9 I;  4FCY A;  2Y0S N;  3CCJ I;  3HGG A;  2E1O A;  5J47 A;  5CKT A;  2VKV A;  5E1Z B;  5F0F A;  2BY3 A;  4XM3 A;  3DKX A;  3WU2 C;  1O3R A;  4UUT A;  2GXA A;  2FXA A;  3LSG A;  3K4M A;  4IX7 A;  2V1D A;  5B5E C;  4ZYD A;  4E7Z A;  4M6X A;  2JJ7 A;  2V26 A;  2IEK A;  3FM3 A;  3LAP A;  2LRE A;  1V5F A;  2HTS A;  1R5G A;  2K9Q A;  3UR3 C;  2DMP A;  5M5X J;  2QEN A;  5FD6 A;  2COB A;  4BEH A;  1MDM A;  2ZXW H;  5C4J J;  1FX7 A;  3M07 A;  4QPO A;  3ZMV A;  1RUO A;  4EEF G;  2R4G A;  4AYB N;  4E7S A;  1BOB A;  2CUE A;  5LRR A;  3VYU B;  4BXU A;  2HQN A;  3HRS A;  4R8H A;  2AHQ A;  1IXR C;  4U0V A;  4AIJ A;  2BY0 A;  2OZ6 A;  5ERI A;  4WWC A;  2X6O A;  1ZQ3 P;  4I6Z A;  4X6A J;  3S2D J;  2Y48 A;  5KHD A;  1R49 A;  3N05 A;  2XSJ C;  3GTP J;  2ELJ A;  2DFI A;  4FHT A;  4QSH A;  3FX3 A;  3BPX A;  2D1V A;  2NS8 A;  3G2B A;  4XLC A;  3CDH A;  2A05 A;  3HOT A;  4OIP F;  4YIF A;  2XUB A;  3MKY B;  3VSL A;  3S3M A;  5D5X B;  3I5U A;  4F55 A;  3GFL A;  6PAX A;  4U0W A;  2QCO A;  3CLO A;  1AOY A;  3I54 A;  4YG2 F;  4RGX A;  2V9P A;  2DJN A;  2XAF A;  5CVV A;  4O3M A;  2CUJ A;  3EYY A;  1W7P D;  2GZW A;  3H3U A;  4YEJ A;  1AU7 A;  1T6S A;  4XR6 A;  1JT0 A;  4UVC A;  1KQ9 A;  3K6G A;  1SAX A;  3R0J A;  1XDU A;  3CCM I;  3K9T A;  4QWQ A;  1OYW A;  1QZE A;  1A36 A;  1UHW A;  1SD7 A;  1ZK8 A;  2DOA A;  2RDP A;  2CW0 F;  2XAQ A;  2ZJP F;  2LR8 A;  2K27 A;  4XQF A;  4CUG A;  3S8P A;  4W1U A;  3SQN A;  4A3J J;  4RLF A;  3CP8 A;  1GUU A;  2HYJ A;  3QYB A;  4LJZ F;  2EPF A;  4M3F A;  5M5W J;  3J80 Z;  3QOE A;  3M1C A;  4DQ2 A;  1BL0 A;  4NUB A;  3U21 A;  4G6Q A;  5H6Q A;  2PJP A;  3F8F A;  1JUP A;  2OQR A;  2KPM A;  2E1M C;  3T0Y A;  1Y8R B;  1OLT A;  2K4J A;  1OCT C;  2M45 A;  1IUY A;  3HKZ N;  4ZC3 A;  1MW7 A;  4OU0 A;  5IY5 H;  3OIP A;  2RC4 A;  2W57 A;  4P9F A;  2HGC A;  3IH3 A;  2X6Y A;  4V19 K;  2HQ5 A;  1IAW A;  1TTY A;  2DFH A;  3BDD A;  3GLX A;  1TWF J;  1SVM A;  1MSE C;  3MVP A;  1A5J A;  1SD4 A;  2LP0 A;  4JYK A;  4DBQ A;  4BY1 J;  1QO0 D;  5CVU A;  2EFO A;  3RJP A;  2JMW A;  4JX4 A;  5M3M J;  4WX9 A;  3HOS A;  2OZU A;  1T33 A;  4BY7 J;  2MYS A;  1JGG A;  3CQZ J;  3FK6 A;  1J59 A;  1ZRF A;  3IUO A;  1LJ9 A;  1WJ5 A;  2JZY A;  4CSW A;  2EFN A;  2BY1 A;  2M1B A;  1Z7U A;  4BHP A;  2B7E A;  3O8H A;  5GAE J;  2EQR A;  3J7Y J;  3GTG J;  5HOO A;  1K61 A;  2ZBK A;  1X1B A;  3HOV J;  5IT9 K;  1UHM A;  2QSG X;  3GTM J;  2HPM A;  2R92 J;  5DD8 A;  1FP2 A;  2AQF A;  4EM0 B;  2KT0 A;  3CES A;  4QTR A;  2R7R A;  3PJR A;  1K78 B;  2L2O A;  4PFP A;  1IZ1 A;  2X1E A;  3OY9 A;  4N0B A;  5E3M A;  3K4L A;  4ESF A;  5K5O A;  4AUX A;  5F0C A;  1IXC A;  1JI8 A;  1FSE A;  3E5Q A;  1LE8 B;  2W84 A;  2E1M B;  3FDY A;  3RKY A;  1SMY F;  4PJL A;  2L5Q A;  3ERE D;  1FWZ A;  2VOO A;  3CDI A;  2DA5 A;  5F1R A;  3RKX A;  3NRV A;  4OWR B;  4IHS A;  1Z0X A;  3Q3S A;  3TDU C;  3X2Q H;  1B59 A;  3SJM A;  2DT7 B;  2H6B A;  1R22 A;  4QIW N;  4FAS D;  1MJB A;  2CSO A;  5DDG A;  3FIS A;  4IL6 C;  3S32 A;  1NH3 A;  3IV5 A;  4E7H A;  2O8K A;  2KHM A;  1K78 A;  4II2 A;  2FOK A;  4I0B A;  2WA0 A;  3FKI J;  2X0L A;  4GYI A;  2ZJR F;  2WAQ N;  1VQK I;  5IP6 A;  1LDK B;  2F2E A;  2OD5 A;  1NG7 A;  1WJA A;  2HVQ A;  3QU3 A;  1R5I D;  3TMO A;  4E4H A;  4RMN A;  1HW1 A;  2P5K A;  4XRM A;  4C2U A;  2BGC A;  5DM7 F;  3KLO A;  1IDY A;  1BW5 A;  3LST A;  3K69 A;  4CHU A;  4MHG A;  2MC3 A;  3C2G A;  4WF2 A;  3OV8 A;  5KCM A;  4L9V A;  1QPM A;  2W00 A;  4F7Z A;  1TWC J;  1BOA A;  1P7J A;  3K4K A;  4ZDL A;  3G73 A;  2DTR A;  3TP0 A;  1J7K A;  2KJB A;  2DA4 A;  2QA4 I;  2K3P A;  5HLG A;  2DYR H;  3MD2 A;  3PNV A;  2OUM A;  1J9I A;  2A6H F;  1ZRE A;  1J09 A;  2HTJ A;  2JT1 A;  3LSH A;  2KKO A;  2QLZ A;  5IPA A;  2LSO A;  2KZV A;  1GV2 A;  2FJ1 A;  2FBH A;  2XKO A;  1R9T J;  3HXL A;  4AVZ A;  1V5E A;  2FBK A;  2Y31 A;  3OYC A;  3L09 A;  1HDP A;  2MH2 A;  1WJD A;  3I53 A;  3TQN A;  2VT3 A;  1BC8 C;  1QPI A;  1XG1 A;  1U2W A;  5CPR B;  4XLP F;  1LNW A;  1R1V A;  3SYT A;  3MKW B;  3R4K A;  3G71 I;  2IS1 A;  5ILS A;  4HW0 A;  2JA6 J;  2E71 A;  3MZY A;  4CCO A;  1D3Y A;  1I3A A;  4MIM A;  2BY2 A;  2DT5 A;  3CCU I;  3L2W A;  4LLL A;  1J2X A;  3JAM K;  2LOO A;  3S1R J;  3P9I A;  2DW4 A;  1XX5 A; 
#chains in the Genus database with same CATH homology
 5J6X A;  4KA4 A;  1FT9 A;  1FBQ A;  4EGY A;  3E6C C;  4ENJ A;  1ON1 A;  2O0Y A;  3CUQ A;  4ESJ A;  5EEH A;  4AIK A;  3WU0 A;  3H3Z A;  1YO5 C;  1HXD A;  3BJA A;  2WC2 A;  3MFK A;  3R61 A;  2CQK A;  2CYY A;  1MJ9 A;  3I71 A;  1SD6 A;  1WQ2 A;  2KIU A;  1Q1H A;  3R60 A;  4ZZL A;  2NYX A;  5FB2 A;  2GAU A;  1HSJ A;  1SFE A;  1B1B A;  2WWY A;  5HLH A;  4WXD A;  2ZNZ A;  4UNO A;  3ELK A;  3ZN0 A;  4ENN A;  1XSD A;  2EK5 A;  2R3S A;  5ICF A;  2FRH A;  2IA0 A;  4GGG A;  1Z6T A;  1YIO A;  2GXG A;  4KFC A;  2QM3 A;  4P55 A;  4GYG A;  3IL2 A;  5KK1 A;  2M87 A;  4UV9 A;  1G3S A;  3LQR A;  2PG4 A;  3HRM A;  4NHJ A;  4PZJ A;  1LQ1 A;  5FFX A;  5L3B A;  2HOE A;  1TQI A;  1YG2 A;  4BAY A;  3V4G A;  1Z9C A;  2FNP A;  1U6G A;  1XN7 A;  4M72 A;  3WTX C;  1TNS A;  4UXN A;  4G6D A;  4HX4 A;  2ISZ A;  2E1C A;  4Q5S F;  3HTS B;  4EM1 A;  3LAJ A;  5JR3 A;  4I01 A;  1OR7 A;  2ZCW A;  5FLX K;  2FMY A;  3DEU A;  5E8I A;  1RUN A;  4M71 A;  3WGI A;  1ZAR A;  2BV6 A;  3E97 A;  4I7H A;  3FZV A;  4LFU A;  1FP1 D;  1WRJ A;  4JBA A;  4XRF A;  2ZME B;  4ZYH A;  3SZP A;  3F23 A;  3J81 K;  3E3V A;  4IRH A;  1WKM A;  3FWE A;  4EJW A;  4RAY A;  3ECO A;  3E6B A;  1D8K A;  2P8T A;  1PDN C;  4KIC A;  5LHG A;  3WGG A;  4I98 B;  1HKQ A;  2DQR A;  3DV8 A;  3FXQ A;  2GA1 A;  4HBL A;  3Q9S A;  3FF5 A;  5FO5 A;  1QGP A;  3T8R A;  1OMI A;  1E17 A;  3T1B A;  3ROU A;  4N9H A;  2AXL A;  5DD4 A;  3IC7 A;  2P5L C;  3BP8 A;  3EUH A;  4U7D A;  3GFI A;  1I1S A;  5FD5 A;  4HF2 A;  1FOK A;  3BZ6 A;  2K86 A;  1KYW A;  3F6O A;  5E1W A;  1ZG5 A;  1F1Z A;  3KP2 A;  1V3F A;  2IW5 A;  1O3T A;  3K0L A;  2XAS A;  2OQG A;  3LA2 A;  1PUE E;  3GVA A;  3V7C A;  2OBP A;  2QWW A;  3DQV C;  5HDG A;  2EV5 A;  4UUV A;  3R6S A;  1XGN A;  4LB5 A;  3M8E A;  4UV8 A;  1JGS A;  3VEP A;  1I1G A;  2GXB A;  1ZLK A;  4RB0 A;  4OIQ F;  2YX4 A;  2FE3 A;  2JTV A;  5ICC A;  2H6C A;  2O8X A;  2QUF A;  5IT9 Z;  3ZMS A;  4M9X A;  2H94 A;  3T8T A;  3AAF A;  1FLI A;  1Z91 A;  5J8C A;  2Y75 A;  2A61 A;  3C3W A;  3E6D A;  3HSF A;  1K7A A;  1T98 A;  2EFW A;  3F72 A;  1IXS B;  4ZZD A;  3E5U A;  3TO9 A;  3RYR A;  4KUM A;  3DPT A;  2ETH A;  5E17 F;  3RYP A;  3N4M A;  1W7P B;  2DPU A;  1MDM B;  5HS9 A;  1BN5 A;  3F8C A;  5L3E A;  1BI0 A;  3TO6 A;  2X4H A;  3I58 A;  2W85 A;  3ZMT A;  5BOX A;  4EV0 A;  4GXO A;  3F21 A;  2HYF A;  3NEU A;  3DKW A;  1TNT A;  4M73 A;  3ULQ B;  1XD7 A;  4AD9 A;  2ISY A;  1YYV A;  1W7P A;  2STT A;  2Z99 A;  3RIR A;  4Q4Z F;  4EJU A;  5HDK A;  4A12 A;  2FNA A;  3I4P A;  4JQF A;  2OA4 A;  1MJA A;  1TW2 A;  3MQ0 A;  1F5T A;  4AVP A;  3ML6 A;  4OIR F;  4BHC A;  4WXC A;  2RVC A;  5TJJ A;  3RPQ A;  4U88 A;  4BQA A;  3R0A A;  5K1Y A;  4CO8 A;  4MNU A;  1T0F A;  5D8L B;  4A0X A;  1EH8 A;  2HR3 A;  3QPH A;  3GZ6 A;  2BE5 F;  3L9F A;  3JAM Z;  3RI4 A;  4G7O F;  3U1D A;  3C18 A;  3CUO A;  2DU9 A;  3JSO A;  3HHG A;  4KIF A;  2UWM A;  4M6Y A;  3K2Z A;  4UVA A;  2VC1 A;  4Q47 A;  4KMU X;  5CJ9 A;  1R23 A;  1GXP A;  3JW4 A;  5JVT A;  2B0L A;  1S6L A;  2L4M A;  2VBW A;  2R7D A;  4IJA A;  4YII A;  3FM5 A;  1R58 A;  5DYM A;  2C6Y A;  4ESB A;  3HTU A;  2ADU A;  5D6F A;  1ZH5 A;  1W5T A;  2XHK A;  4S04 A;  2A6E F;  1E2X A;  5E20 A;  1JXS A;  3GX4 X;  1IF1 A;  3MWM A;  1S7O A;  1B4A A;  4CXF A;  1GXQ A;  3KLN A;  1LDJ A;  2FF4 A;  5KVR A;  1REP C;  2PI0 A;  3TOB A;  3FXU A;  4KYW A;  1NHA A;  2XAJ A;  2IRF G;  2XAH A;  2A68 F;  3WTZ A;  2J5P A;  1IW7 F;  3WTT C;  3KCC A;  3ECH A;  4G9Y A;  3BRO A;  3GXO A;  4HF0 A;  1XCB A;  4Y13 A;  4A0Y A;  2KIM A;  3CUQ C;  1KGS A;  4Y15 A;  3F6V A;  3COA C;  1PP7 U;  3B02 A;  3WU1 B;  3P9K A;  4LG0 A;  2MBF A;  3I59 A;  3GFM A;  1ZLJ A;  1B6A A;  2HQR A;  1FNN A;  4LMY A;  2P6S A;  4A5N A;  1SD5 A;  1XGO A;  5ICG A;  1JHF A;  1QNT A;  4MQV A;  2IA1 A;  2HFH A;  4TV7 A;  1BJA A;  2ZO4 A;  3K1M A;  2JPC A;  4HQE A;  5FLX Z;  2MLG A;  3WTU C;  3TGN A;  3KET A;  4OMZ A;  2HWV A;  5E18 F;  1K6O A;  3PQK A;  1KU7 A;  1O3Q A;  4JK1 X;  2K7L A;  5HVQ C;  4L9T A;  5DUI A;  5D4S A;  5HS8 A;  4BHB A;  1KQ0 A;  1JE8 A;  3J81 Z;  4EMS A;  4OIN F;  1XSX A;  3O2P E;  4M9Z A;  2Q2E A;  3CUQ B;  4A5M A;  1GHC A;  4L5I A;  3QOP A;  1L3L A;  2XRN A;  1G3W A;  5CVJ A;  3I0T A;  4M9S A;  4IRG A;  4UVB A;  2RQP A;  2LF8 A;  4XLN F;  2W24 A;  4B09 A;  4HZF A;  3HIF A;  3GUD A;  2OAZ A;  3V8J A;  1GVJ A;  3TKY A;  1IN6 A;  2EV0 A;  4G7Z F;  4EM2 A;  3U9G A;  2DO7 A;  3V7S A;  2F5C A;  2KRF A;  5A2Q K;  4KIG A;  4U7B A;  4A6E A;  3WTS C;  4YFX F;  5BQT A;  1DPR A;  5ED4 A;  1I5Z A;  5CVR A;  5LHI A;  2VOD A;  1T38 A;  3ABT A;  4O6J A;  5H20 A;  1STZ A;  4RAZ A;  1BC7 C;  4I0A A;  3SXY A;  4KMF A;  2VOP A;  4FX0 A;  2FA5 A;  4L0Z B;  3WE2 A;  3E5X A;  4HDV A;  3JTG A;  4K2E A;  1ZYR F;  1W5S A;  3MCZ A;  1RNL A;  2QYO A;  3BJ6 A;  3VOD A;  1TQP A;  2VBX A;  4RB1 A;  5L3G A;  1ODD A;  3WTY C;  4S05 A;  2A5Y B;  1FBU A;  4KDP A;  4A2U A;  5CLS A;  3QAH A;  3TDZ C;  2D1H A;  4BYY A;  4LB6 B;  2IT0 A;  1F9N A;  1I27 A;  2PQ8 A;  3J7A O;  3GO5 A;  4IXA A;  5ILU A;  3BWG A;  1S8N A;  2RNJ A;  3KP4 A;  4GCV A;  3WGH A;  2IPQ X;  3L2C A;  1Z1D A;  2O3F A;  1R36 A;  4PDK A;  1ZGJ A;  2DPD A;  2G9W A;  2F5F A;  3KP7 A;  3SHF A;  5DCM A;  2H09 A;  3I64 A;  2PEX A;  1S7A A;  4G8X A;  3RPU A;  1FYK A;  4MEX F;  3N97 A;  2MH9 A;  2VBZ A;  2O61 A;  3EDP A;  4U0Y A;  3VOE A;  5HDN A;  2ZFW A;  4ENK A;  1VTN C;  3FXR A;  4RB3 C;  1S3J A;  2K02 A;  3HUG A;  3KZZ A;  1LB2 A;  1Z05 A;  1ZRD A;  2O6G E;  1LEA A;  1ZG3 A;  4QLC U;  3JTH A;  1FSH A;  3ISP A;  3F8M A;  3U2R A;  2V1U A;  1HKT A;  2PFB A;  4HF1 A;  2GA2 A;  4MGR A;  1B9N A;  4LK0 F;  1T39 A;  1IRG A;  3C1D A;  3IWZ A;  1J75 A;  2ZKZ A;  5DCF A;  4H0E A;  2PLY A;  2ESH A;  4RB2 C;  1K79 A;  3WTW C;  2QBY A;  1EH6 A;  3HSR A;  1IN4 A;  4HV5 A;  2Z9O A;  3HYI A;  1HQC A;  2XIG A;  3F8N A;  4D0P A;  1A04 A;  5EEG A;  3HRU A;  1XSV A;  4EJT A;  4OIO F;  4MTE A;  5JHU A;  4Y17 A;  5HLI A;  4LLG F;  4AIH A;  2NNN A;  5J8F A;  2YX7 A;  2M30 A;  4HX8 A;  5LLQ A;  5D5V B;  3F8B A;  1YW9 A;  4G94 A;  4ZH4 F;  4PGG A;  1U5T A;  4I2O A;  3WE3 A;  3M1E A;  2CG4 A;  2DAO A;  2IVM A;  1SFU A;  4HA8 A;  4B8X A;  3E6M A;  4ASN A;  2QQ9 A;  2EFQ A;  1U8R A;  3CJN A;  1HW5 A;  2AS5 F;  5JI6 A;  3MZH A;  3BY6 A;  1BIA A;  3M8F A;  4XSZ F;  1P6R A;  1YTY A;  2VON A;  3KP6 A;  2NNY A;  1EH7 A;  1AWC A;  3S2W A;  2HKX A;  3KZY A;  4AWX B;  2XV4 S;  3W6J B;  5LEK A;  4FX4 A;  2KIF A;  4P96 A;  1UST A;  2LKP A;  5LGN A;  1YQA A;  1BI1 A;  4CIC A;  1U3E M;  2L4A A;  3D0S A;  2Z5U A;  4YFK F;  5L3C A;  3BOQ A;  1S29 A;  2J5O A;  3SZT A;  3VB2 A;  3W6K B;  2LNB A;  4CGZ A;  5E1X A;  1BBY A;  2BYV E;  2V6C A;  3V7R A;  5LRS A;  2VE8 A;  2DBB A;  2EA4 A;  3M9A A;  2Q0O A;  2H27 A;  1ONV A;  2LF7 A;  4KN4 X;  1FZP B;  3ABU A;  2XRO A;  4EJV A;  5CVI A;  5JFR A;  3ZMU A;  2BBY A;  5AIP A;  2K4B A;  2EA2 A;  4KN7 X;  4LD5 A;  4EJO A;  3FHZ A;  1SFX A;  2F5E A;  5FGM A;  4I09 A;  3V8K A;  3IRR A;  2FSW A;  2VT2 A;  3VFZ A;  3RTR A;  3QP6 A;  2DI3 A;  4KNY A;  2QZ8 A;  5AON A;  2FBI A;  3LQQ A;  2RN7 A;  4Z2Y A;  2CGP A;  4LLN A;  1XMA A;  4L0Y B;  3RKW A;  3QPT A;  3ZQ7 A;  3K1P A;  2XGX A;  3ZPL A;  2WTE A;  2Y0M A;  1YS7 A;  5ICE A;  2YPR A;  4HAM A;  2ZXJ A;  1JHH A;  5A2Q Z;  2LDU A;  2JRT A;  1FY7 A;  4ON0 A;  3IKT A;  1KU9 A;  5K5R A;  2Z33 A;  1ZN2 A;  1O7F A;  4WXH A;  3L00 A;  4ETS A;  4ZYE A;  4PGH A;  2EB7 A;  1EV7 A;  5ILV A;  2O03 A;  2D2W A;  1SMT A;  4OOI A;  1G3T A;  5LHH A;  1H9G A;  2DK8 A;  2G7H A;  5BPD A;  2M8E A;  3KP5 A;  2Q8K A;  4N9I A;  1ZG1 A;  1IRF A;  3EYI A;  1P2F A;  2UXX A;  2RKH A;  1Y0U A;  2P5V A;  1U78 A;  1Z6R A;  1KA8 A;  3DPL C;  4LG0 B;  1H0M A;  3LA3 A;  4NB5 A;  1XB4 A;  3D5L A;  3BPV A;  2OU2 A;  3RDI A;  4LGW A;  3DXJ F;  1BI2 A;  3I59 B;  1WSU A;  1DDN A;  1X3U A;  2HYG D;  1QZZ A;  3P7N A;  2DK5 A;  1I6X A;  2JPB A;  4YFN F;  4G7H F;  3F22 A;  3QRF F;  2NAZ A;  1BIB A;  1TBX A;  1ZAO A;  2XAG A;  4EGZ A;  2V1X A;  3DP7 A;  1W4M A;  1G6N A;  3MEX A;  1T2K A;  4M74 A;  3EQL F;  1KYZ A;  4HDU A;  1C0W A;  3ZMZ A;  4A6D A;  1KU2 A;  3KP3 A;  3V8L A;  4P5O A;  4EQQ A;  1IN7 A;  2QQA A;  4ZYG A;  1P4X A;  3F3X A;  5E8G A;  1MZB A;  4IF4 A;  4WCG A;  2YR2 A;  4RGS A;  4I02 A;  1HW2 A;  2P7C B;  1HST A;  2TDX A;  1XGS A;  4FT8 A;  4RGU A;  4BNC A;  1FYM A;  1XDS A;  1R1T A;  3G3Z A;  4MTD A;  5LGU A;  2E1N A;  3O6B B;  2EV6 A;  1ULY A;  2UZK A;  1BM9 A;  1HBX G;  4NQW A;  1PP8 F;  2GQQ A;  3SFZ A;  1FYL A;  3HSE A;  2JSC A;  3FMR A;  1D5V A;  2V79 A;  2P6T A;  4ENM A;  1XGM A;  3PQJ A;  4P9U A;  1G4D A;  3GZ5 A;  1DP7 P;  3KFW X;  1B9M A;  3DFG A;  3O3K A;  2E7X A;  1L0O C;  2EFP A;  2ACJ A;  1RIO H;  3PFI A;  2IJL A;  5DEQ A;  4WK8 F;  2HKO A;  2QQB A;  1J5Y A;  1XMK A;  3IWF A;  1P92 A;  2DQL A;  1USS A;  2MA3 A;  1H9T A;  1YLF A;  3J80 K;  2ESN A;  1YW7 A;  3IRQ A;  5DV5 A;  4A0Z A;  3REO A;  2L54 A;  2CO5 A;  2L02 A;  3B73 A;  3GEZ A;  4HV6 A;  4RS8 A;  3C7J A;  4CYD A;  3KEO A;  3CO7 C;  5BS6 A;  1R7J A;  4RGR A;  2BEO A;  3P9C A;  3TOA A;  5D8K B;  2P4W A;  2PMU A;  5BMZ A;  1TLH B;  5BPI A;  2FEZ A;  1O3S A;  5L3D A;  1V4R A;  4HQM A;  4HOB A;  2IP2 A;  2VC0 A;  1MD0 A;  4KIB A;  2VN2 A;  2P7V B;  1F4K A;  2ZNY A;  1R00 A;  1IN5 A;  2V9V A;  4E70 A;  1UFM A;  5DCM B;  1ZGA A;  5H6R A;  1KQ8 A;  1MGT A;  2STW A;  4HLX A;  2CFX A;  2RGV A;  2KJC A;  5LEJ A;  1OPC A;  1D8J A;  3L7W A;  4HYE A;  1KU3 A;  5AIQ A;  4MQ9 F;  1RZ4 A;  3WTV C;  3TO7 A;  4LK1 F;  2EJR A;  2E7W A;  1U5T C;  1DPU A;  2COM A;  1LDD A;  1YW8 A;  1YS6 A;  1OKR A;  2HDC A;  1QQI A;  4IPA A;  2VBY A;  4OMY A;  4GO1 A;  4XBF A;  2YSR A;  2HEO A;  1WI9 A;  3GFJ A;  5F6F A;  3GF2 A;  2M5W A;  2VXZ A;  2XVC A;  5HS7 A;  5DUK A;  1R1U A;  1FC3 A;  5D6E A;  1R5H A;  2WV0 A;  4L9J A;  2F5D A;  3KEQ A;  5L3F A;  3JSP A;  2FU4 A;  2QBY B;  5LBQ A;  3HRT A;  1IN8 A;  3HHH A;  3LA7 A;  2RV8 A;  2MLK A;  2R7F A;  1TQM A;  4PCQ A;  4R1H A;  4L5J A;  2QVO A;  4IVN A;  1MKM A;  1P4A A;  1ZHF A;  2L01 A;  2NS0 A;  2ZJ2 A;  4L9N A;  1G3Y A;  2FML A;  4CZZ A;  1U5T B;  3CTA A;  2Z3Y A;  2VE9 A;  4IRI A;  1LEB A;  2GWR A;  2PN6 A;  2PMH A;  4CDG A;  4KT5 C;  1QBJ A;  3Q9V A;  1FBS A;  4EVI A;  4R79 A;  3GYH X;  2ZME A;  1UB9 A;  1FPQ A;  4Q48 A;  4IHT A;  1YFH A;  2MD5 A;  2ELH A;  5D4R A;  2EWN A;  4XSX F;  3T5X A;  5K5Q A;  1BI3 A;  4HLY A;  1HKS A;  2HZT A;  2YU3 A;  2G7U A;  4UHT A;  2DLL A;  1CGP A;  5FFZ A;  1ON2 A;  1RI7 A;  3MAJ A;  3FMQ A;  5LGT A;  1O57 A;  2L3D A;  2A69 F;  3FMS A;  1OYI A;  1J0R A;  3NQO A;  5IT3 A;  2A3S A;  3IHU A;  3LWF A;  1OYY A;  3QU6 A;  5F64 A;  4L18 B;  1TW3 A;  3OOP A;  3WG9 A;  2CWE A;  2HS5 A;  5D5U B;  1DUX C;  1ZRC A;  3GW2 A;  1XCV A;  3BJO A;  1O7L A;  3H92 A;  3ZN1 A;  4O5V A;  5D5W B;  4DNC A;  2PBI A;  1P4W A;  3GWZ A;  5TRD A;  2A07 F;  3ZP5 A;  2W25 A;  3KE2 A;  4MEY F;  3CO6 C;  1CF7 B;  1QZY A;  2IA2 A;  1UCR A;  2UXN A;  2NRA C;  1LVA A;  3M7G A;  2XKP A;  4HX7 A;  3WOD F;  2FQ3 A;  3QP5 A;  3ZMD A;  5CYV A;  2GIV A;  3LFK A;  3K1N A;  3EET A;  2D45 A;  4BH9 A;  3DF8 A;  3Q5F A;  1WWX A;  3IKV A;  1CF7 A;  5E1Z B;  1O3R A;  2FXA A;  2V1D A;  4ZYD A;  4M6X A;  3FM3 A;  3LAP A;  2HTS A;  1R5G A;  2QEN A;  5FD6 A;  1MDM A;  1FX7 A;  3ZMV A;  1RUO A;  5LRR A;  4BXU A;  2HQN A;  3HRS A;  4R8H A;  1IXR C;  4U0V A;  4AIJ A;  2OZ6 A;  5ERI A;  4WWC A;  2Y48 A;  2DFI A;  4FHT A;  3FX3 A;  3BPX A;  2D1V A;  3CDH A;  3HOT A;  4OIP F;  4YIF A;  2XUB A;  5D5X B;  3I5U A;  3GFL A;  6PAX A;  4U0W A;  3CLO A;  1AOY A;  3I54 A;  4YG2 F;  4RGX A;  2XAF A;  5CVV A;  4O3M A;  3EYY A;  3H3U A;  1W7P D;  2GZW A;  1T6S A;  4UVC A;  1KQ9 A;  1SAX A;  3R0J A;  1XDU A;  3K9T A;  4QWQ A;  1OYW A;  1UHW A;  1SD7 A;  2RDP A;  2CW0 F;  2XAQ A;  2K27 A;  3SQN A;  4LJZ F;  3J80 Z;  4DQ2 A;  4G6Q A;  5H6Q A;  2PJP A;  3F8F A;  2OQR A;  3T0Y A;  2K4J A;  2M45 A;  1IUY A;  4OU0 A;  2RC4 A;  2W57 A;  4P9F A;  2HGC A;  1IAW A;  1TTY A;  3BDD A;  3GLX A;  1SD4 A;  1QO0 D;  5CVU A;  2EFO A;  3RJP A;  4WX9 A;  3HOS A;  2OZU A;  1J59 A;  1ZRF A;  1LJ9 A;  2JZY A;  2EFN A;  2M1B A;  1Z7U A;  4BHP A;  5HOO A;  2ZBK A;  5IT9 K;  1UHM A;  5DD8 A;  1FP2 A;  4EM0 B;  1K78 B;  1IZ1 A;  4N0B A;  4ESF A;  5K5O A;  1IXC A;  1FSE A;  3E5Q A;  2W84 A;  3RKY A;  1SMY F;  3ERE D;  1FWZ A;  2VOO A;  5F1R A;  3RKX A;  3NRV A;  4IHS A;  3TDU C;  1B59 A;  2H6B A;  1R22 A;  1MJB A;  2CSO A;  5DDG A;  1K78 A;  2FOK A;  4I0B A;  2X0L A;  4GYI A;  1LDK B;  2F2E A;  2OD5 A;  3QU3 A;  1HW1 A;  2P5K A;  2BGC A;  3KLO A;  3LST A;  3K69 A;  4CHU A;  4MHG A;  2MC3 A;  4WF2 A;  3OV8 A;  4L9V A;  1QPM A;  4F7Z A;  1BOA A;  3G73 A;  2DTR A;  1J7K A;  2KJB A;  5HLG A;  1J9I A;  2A6H F;  1ZRE A;  2HTJ A;  2JT1 A;  2KKO A;  2QLZ A;  2LSO A;  2FBH A;  2XKO A;  2FBK A;  3L09 A;  2MH2 A;  3I53 A;  3TQN A;  2VT3 A;  1BC8 C;  1U2W A;  4XLP F;  1LNW A;  1R1V A;  3R4K A;  5ILS A;  4HW0 A;  3MZY A;  1D3Y A;  2DT5 A;  4LLL A;  1J2X A;  3JAM K;  3P9I A;  2DW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...