4ESFA

Crystal structure of padr-like transcriptional regulator (bce3449) from bacillus cereus strain atcc 10987
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
100
Chain Sequence
NLTEMLKGSLEGCVLEIISRRETYGYEITRHLNDLGFTEVVEGTVYTILVRLEKKKLVNIEKKPPRKFYSLNEAGRQELELFWKKWDFVSSKINVLKSSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PadR-like transcriptional regulator
publication title Crystal Structures of Two Transcriptional Regulators from Bacillus cereus Define the Conserved Structural Features of a PadR Subfamily.
pubmed doi rcsb
source organism Bacillus cereus
total genus 39
structure length 100
sequence length 105
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esfA00
2G7HA 2PJPA 4Q5SF 3FXRA 2L02A 5D8LB 2HYGD 1JXSA 1FZPB 2A3SA 2X0LA 1FYKA 3L7WA 2OU2A 4KN7X 1LDKB 4OOIA 1YS6A 4A2UA 3QOPA 1U3EM 4IJAA 1UFMA 1KYZA 4HLXA 5FGMA 3HRSA 2ISZA 3T8TA 1XN7A 1ZLKA 4KDPA 2VN2A 3I0TA 1IN8A 2XAJA 3KP4A 4BXUA 2VOOA 2VOPA 2L54A 2QVOA 2RQPA 3I4PA 3GZ5A 3HSFA 3M8FA 5BQTA 5KK1A 1SAXA 2RC4A 3BROA 4KA4A 5CYVA 4N9HA 2RVCA 3KP7A 3WTSC 1MZBA 4IRGA 4XLNF 1IZ1A 5D5VB 2Z99A 2L3DA 5FFZA 3M9AA 2HEOA 4UVBA 3FM5A 5ED4A 1J5YA 2DK8A 2K02A 4M6YA 4LG0B 5CVUA 5L3DA 2XAHA 2H6CA 4LK0F 4A0XA 2GA1A 5CLSA 3GLXA 4ON0A 3GYHX 1O3QA 2OBPA 3B02A 1USSA 3K9TA 1R1TA 5FLXK 3E97A 5D6EA 1MDMB 4O5VA 5KVRA 4ESBA 1DPUA 2JPBA 2ZNZA 4RGUA 1S7AA 3HTSB 2AS5F 4ZZLA 3GFMA 1BJAA 3DFGA 2FSWA 4KYWA 2W25A 5TJJA 4U0YA 2RDPA 4EM2A 2UZKA 2G7UA 2L4AA 1B1BA 5J8CA 5D8KB 4YIFA 2XAGA 3TKYA 1KU7A 3KE2A 4MNUA 1BOAA 2K27A 2IP2A 3HOTA 5DD8A 4E70A 3LA3A 2STTA 1IAWA 2R3SA 3LQRA 2IA1A 3ZMTA 4O3MA 2P5LC 1G3SA 2FMYA 4KMFA 1RI7A 5DV5A 1ZG1A 2NNNA 3AAFA 2KKOA 2M45A 4U0WA 2XKPA 2XAFA 1B9NA 1GXQA 3ABTA 1YFHA 4KIBA 2MLKA 4L18B 1SFUA 1WSUA 3M1EA 2F5CA 4MTEA 3BJAA 4M6XA 1IUYA 3O2PE 2DQLA 3MEXA 5A2QZ 5HS9A 1YG2A 1SD7A 1O3SA 2BEOA 2VBZA 4XRFA 1IN5A 4BQAA 2HFHA 1ZG3A 1R5HA 3WODF 3BOQA 3KCCA 1LB2A 3I5UA 2JRTA 3ERED 3FF5A 4ESFA 2VT3A 1BN5A 2QQ9A 1FSHA 1YQAA 4LLNA 2BGCA 3I54A 2QM3A 3IKVA 4R79A 1EV7A 1UCRA 3IHUA 3Q5FA 2V1DA 1YW7A 5FB2A 3HIFA 2EFWA 2FEZA 3V8KA 1LQ1A 3E6MA 2B0LA 1R00A 2C6YA 3QU3A 2HTJA 3F8CA 5ERIA 4CO8A 1R23A 1TNSA 5L3CA 1ON1A 3TOBA 1IXRC 2KJBA 2VONA 2AXLA 1KA8A 4Y13A 2GZWA 1YO5C 2EWNA 1IN4A 1OMIA 2QBYB 4ZZDA 4HDUA 2DO7A 1B4AA 2M5WA 3J81Z 1FT9A 4WX9A 3CUQB 1PP7U 2FOKA 2K4BA 5F64A 4GO1A 2GQQA 1XD7A 4HZFA 4U0VA 3KP3A 3KZYA 3TGNA 2D1HA 2JPCA 3KZZA 5DCMA 3J80K 3ZQ7A 1WI9A 4WWCA 4FHTA 3GW2A 1W4MA 4CHUA 4P96A 4RB0A 3HSRA 4ENNA 3ELKA 4HX7A 3SXYA 1MJ9A 1SMTA 2Z33A 4A0YA 4RAZA 4FT8A 5LRSA 1L3LA 4M9ZA 1IN6A 2ETHA 4B09A 4LJZF 3ZN0A 2O8XA 5ICFA 1KQ8A 5D5UB 3DV8A 3GXOA 2YX4A 3TO6A 2ZMEB 4FX0A 4Y15A 2DBBA 4G7ZF 5LGUA 2KJCA 1Q1HA 1FBQA 2DPDA 3P9IA 3FXUA 1LDDA 2VBXA 4EJWA 4KICA 5LGNA 1HW2A 2FU4A 2ADUA 1SFEA 2QUFA 2LSOA 5E1XA 4HBLA 1HQCA 5IT9K 1UHWA 3C3WA 5LEKA 2GXBA 3PQKA 3N4MA 3HSEA 2GWRA 2V9VA 1FYLA 2PLYA 4HF2A 4S05A 1JHFA 5EEHA 3FHZA 1FSEA 1IRFA 5E18F 2OQRA 4L5IA 3JTGA 5DEQA 1L0OC 5FD5A 5E17F 5ICCA 3F21A 4MTDA 4KUMA 4HV6A 4IHTA 1TQMA 2FBKA 3V8JA 3DQVC 1BI1A 3BJOA 2E1NA 4HF1A 2V1UA 1ZN2A 2CGPA 2GAUA 1CF7A 4YFKF 3Q9VA 5L3EA 3F8FA 1Z6RA 5E1ZB 3K1PA 4A0ZA 3N97A 2DU9A 3DKWA 1QZYA 3IWZA 2A6HF 3JAMZ 3ZPLA 3IWFA 3RDIA 1Y0UA 1LEBA 3G3ZA 2ZO4A 1HKQA 2PBIA 2IA0A 5EEGA 5E8IA 1O7LA 2H6BA 5TRDA 3I59B 3C7JA 4M73A 4FX4A 4IPAA 4G94A 2EFNA 5H20A 3R61A 4UVCA 1R1VA 1YIOA 3JTHA 1FBUA 2H09A 2P8TA 4G8XA 1ZREA 1D8KA 4GYIA 1YW9A 1FP2A 1FOKA 4HAMA 3HYIA 2CO5A 2H94A 5LBQA 1XGOA 1G6NA 4ENKA 2X4HA 4ENMA 3U1DA 4BHPA 3L9FA 3IRRA 4EGZA 1BC7C 3LAJA 1OYIA 4YG2F 5JHUA 4IRHA 4ETSA 5JR3A 2VT2A 2MH2A 1T38A 4HA8A 2XUBA 3E5QA 5HOOA 2ZBKA 1J0RA 1IXCA 2XASA 1ZRDA 3GFJA 4JK1X 4A12A 3LFKA 2A07F 4HV5A 1LNWA 5BPIA 3V7RA 1DDNA 2R7DA 3LWFA 3WGIA 2HS5A 2A69F 1XMKA 2EV6A 2Y75A 4ZYEA 4A5MA 4R8HA 4O6JA 1MGTA 5BOXA 2ACJA 3SHFA 2XKOA 4WK8F 3ZMZA 2QQAA 4LG0A 4M74A 2PG4A 2DW4A 1EH8A 1WWXA 3DPLC 2KIFA 3IL2A 2OD5A 2ZKZA 5DDGA 2LF8A 3VODA 4ASNA 2Q8KA 2EK5A 2ZXJA 3I64A 3FMRA 4EJVA 3FX3A 2Y0MA 3KETA 4CICA 3E3VA 4LGWA 3C18A 1MDMA 2VC0A 4UHTA 2BYVE 3WTVC 1S3JA 3HRMA 2ZFWA 2NRAC 2OZ6A 3VEPA 1MJBA 4EM0B 1T98A 2JZYA 2XGXA 4WXDA 3F8BA 3MZHA 1KU2A 1TW3A 3BP8A 2EJRA 3CLOA 2FMLA 4I01A 4AIKA 1K7AA 3R4KA 4XSZF 3HHHA 4WCGA 1E2XA 1KQ0A 1K6OA 4L0YB 4RB3C 3ML6A 2VBWA 4N9IA 4MEYF 1B6AA 3SQNA 2E1CA 2PQ8A 4AIHA 1A04A 3GUDA 4A6DA 3HOSA 1P4WA 2D45A 5LHGA 2JT1A 1XGSA 3E6BA 5LGTA 2W85A 4LK1F 1W7PD 5AIQA 4CGZA 3M8EA 4BHBA 2FA5A 3BPVA 4GCVA 1USTA 1SD4A 4N0BA 1U5TC 1EH7A 4OMYA 3R60A 2MBFA 1ZH5A 3TO7A 2K7LA 3TOAA 3DP7A 3KP6A 3NEUA 4MEXF 1XGMA 4HLYA 1TTYA 3KLNA 4G7HF 2DTRA 4UUVA 3GVAA 2IJLA 3COAC 1WKMA 1FPQA 2EV0A 3FZVA 2P7CB 1O7FA 3CO7C 1J59A 1LEAA 2MC3A 2J5PA 4Q47A 2CYYA 3E6CC 4L9NA 1OR7A 4ZYGA 3QU6A 1YS7A 2L01A 2WV0A 1REPC 3ZMVA 2RV8A 1B59A 3L2CA 4IXAA 1HBXG 1ZG5A 4MQ9F 1JGSA 3F72A 4P55A 2QLZA 1Z1DA 3WTTC 4BNCA 1TQPA 1I27A 3K0LA 4KNYA 2UXNA 2O61A 2FQ3A 1R1UA 3FMSA 1O3TA 5A2QK 2F5DA 3T5XA 1W7PA 4NHJA 4U7BA 4Y17A 1MD0A 5CVVA 3ZMSA 4L0ZB 1P92A 3F6VA 4YIIA 3RI4A 3PFIA 3WG9A 2P5VA 1TW2A 1Z6TA 3LAPA 1Z7UA 3U2RA 2XRNA 3JSPA 3D0SA 2MH9A 5L3FA 4HX8A 2VODA 3WE2A 4IRIA 5JVTA 4QWQA 3KEOA 2XV4S 1IN7A 4BH9A 1YTYA 4IHSA 4P5OA 1TNTA 5DD4A 2VE9A 3WGHA 4HQMA 4IVNA 5E8GA 5FO5A 2XAQA 3Q9SA 4OIOF 1DUXC 1I1SA 3W6JB 2O0YA 4EMSA 1Z91A 1TQIA 5E1WA 4M71A 3RKXA 4HDVA 2HQRA 4KIGA 2ZNYA 1WQ2A 3K1MA 4CZZA 2A68F 4LFUA 4XSXF 2YR2A 2HZTA 4LB6B 1BC8C 4A6EA 3I58A 1XCVA 4GGGA 3QPHA 1K78B 3GO5A 1JE8A 1K79A 5DCMB 2XROA 4MHGA 3MFKA 2GA2A 1HW5A 5CVRA 2XHKA 4L9TA 2R7FA 3J81K 1BBYA 4M9XA 4KFCA 4M72A 1U2WA 5D5XB 2IRFG 4Z2YA 1SD5A 2F5FA 3RYRA 3T8RA 3ULQB 1J2XA 2Q0OA 3WTXC 4CXFA 3HRTA 3ZP5A 3H3UA 3R0JA 4Q48A 2EFOA 1S8NA 4LB5A 3R0AA 2LNBA 2DQRA 3T1BA 5JI6A 4UVAA 1S6LA 4BYYA 1RIOH 2VBYA 1Z9CA 4EVIA 2D1VA 3V7CA 5IT3A 2P7VB 1XGNA 1ZRFA 4PZJA 2P5KA 2LF7A 3EUHA 3SZPA 1XMAA 4EQQA 2FBIA 2ESNA 3F8NA 4XBFA 4EV0A 3WTWC 3FM3A 2MD5A 2MA3A 2O3FA 5J6XA 1O3RA 4KN4X 4NB5A 5ICGA 3WTZA 4JBAA 5HDGA 3V8LA 1ZGAA 3ECOA 2BV6A 2HKOA 1ULYA 4WF2A 2PEXA 4OU0A 3WU0A 1ZGJA 3ZN1A 1P2FA 3FXQA 5BMZA 1LVAA 2DLLA 2MLGA 3D5LA 3ZMUA 5HVQC 4OIPF 2YU3A 3RPQA 4D0PA 1G4DA 2VC1A 3OOPA 3TDZC 4OMZA 3EDPA 1QO0D 1NHAA 2YX7A 2A5YB 1P4XA 4MQVA 3B73A 3DEUA 3I59A 1YW8A 2V1XA 2A61A 2WWYA 2O03A 3CUQC 2QQBA 3V7SA 2P4WA 5K5OA 1U5TA 4PCQA 1D3YA 2W24A 3H3ZA 1QGPA 2CSOA 2XVCA 2OA4A 4PDKA 1P6RA 5LRRA 2IVMA 1R36A 2K4JA 4DNCA 5LLQA 3LA2A 2RKHA 3DF8A 3TO9A 4I7HA 1B9MA 3P9KA 4ZYDA 1T0FA 5LHHA 1D5VA 1QPMA 2K86A 1TBXA 5AONA 3JAMK 1F9NA 3ZMDA 1MKMA 1ZRCA 1FX7A 2QWWA 4WXCA 3KP2A 1AOYA 2EA2A 4K2EA 5K5RA 2EFQA 2KIMA 3O3KA 2BE5F 3G73A 5HLHA 2FBHA 2DPUA 3E5XA 2CWEA 2OAZA 1H9GA 1T2KA 4Q4ZF 3BY6A 5F6FA 3VOEA 5H6RA 2L4MA 4LLLA 4NQWA 2HTSA 1IW7F 2OZUA 4L5JA 6PAXA 5E20A 1H9TA 4PGHA 4EJTA 4ENJA 2WTEA 3HUGA 4YFNF 1XSXA 1XCBA 3EQLF 2WC2A 1KYWA 4HYEA 1F4KA 3LQQA 5FLXZ 3I53A 3F22A 3E5UA 2GIVA 4I0BA 2FF4A 2UXXA 1EH6A 1UHMA 3CTAA 2HYFA 4I0AA 2Y48A 1KU9A 1LJ9A 5J8FA 1R7JA 3NQOA 1RUOA 3L00A 3BZ6A 2ISYA 3M7GA 1YYVA 2HGCA 2YSRA 1CGPA 1GHCA 1J7KA 1PP8F 3RKWA 4BAYA 1BM9A 1FNNA 1I6XA 3S2WA 1KU3A 4IF4A 2HKXA 4CYDA 3ECHA 3JSOA 1QNTA 5CJ9A 5ILSA 3KLOA 2H27A 4L9JA 3QRFF 5L3GA 1T6SA 1YLFA 4EGYA 4CDGA 5DUIA 1W5TA 2CW0F 3CUOA 4HOBA 2HOEA 3GX4X 3WTUC 1KGSA 2UWMA 2FE3A 2KRFA 2IW5A 5DUKA 2W84A 1O57A 4ZYHA 3EYIA 2P6SA 1X3UA 1J75A 4EJUA 1RUNA 1H0MA 4TV7A 1BIBA 2CG4A 2ESHA 2PMHA 4M9SA 2PMUA 4UXNA 1J9IA 1P4AA 2DT5A 1SFXA 3DPTA 2COMA 2DAOA 5DCFA 4UV9A 4AWXB 1RZ4A 3GEZA 3WGGA 4MGRA 1GXPA 2VXZA 1BI3A 3FMQA 1W5SA 4KMUX 2QZ8A 1UB9A 2ZCWA 3JW4A 2M87A 1E17A 1XB4A 4GYGA 3MZYA 3LA7A 3IKTA 3RJPA 4F7ZA 2XIGA 4H0EA 1ON2A 2PFBA 4UNOA 3ISPA 3W6KB 5FD6A 3FWEA 1Z05A 1ZARA 3K2ZA 1FP1D 1G3WA 3V4GA 4AD9A 1OYWA 5D4SA 3O6BB 3P9CA 2DK5A 2Q2EA 4I09A 2PI0A 3I71A 2IA2A 3VB2A 2STWA 4YFXF 4EJOA 1ODDA 1T39A 5HDNA 2V6CA 3HHGA 1QQIA 1I5ZA 2BBYA 5ILVA 4HX4A 1BI0A 2NS0A 1BI2A 3ROUA 2P6TA 1SD6A 4L9VA 5DYMA 5F1RA 2EV5A 4RS8A 1PDNC 2QENA 4P9UA 1HKTA 3BPXA 1WRJA 1TLHB 4QLCU 1IRGA 3R6SA 4DQ2A 3C1DA 3F6OA 1FYMA 3J80Z 5BPDA 2QBYA 3PQJA 5D5WB 3QAHA 2M8EA 4B8XA 1RNLA 1HSTA 5HLIA 3TDUC 3DXJF 3RPUA 1BIAA 3MCZA 2NAZA 3CUQA 4LLGF 3QPTA 1I1GA 2RGVA 4LMYA 3CDHA 5ILUA 1FWZA 2EFPA 2OQGA 4U7DA 1IF1A 1W7PB 2QYOA 1DPRA 2M30A 3F8MA 1FLIA 4HF0A 2RNJA 1R58A 5JFRA 1GVJA 1U6GA 1AWCA 4RGXA 4AIJA 2DFIA 3ABUA 4RGSA 2A6EF 2ZJ2A 1ZHFA 4WXHA 5LHIA 1K78A 2IT0A 1VTNC 4RB2C 2V79A 4I02A 4JQFA 1S7OA 2F5EA 2W57A 4G6QA 3QP6A 4XLPF 5H6QA 4PGGA 3RYPA 1V3FA 1D8JA 2D2WA 2VE8A 2TDXA 2ZMEA 3RKYA 3IRQA 3SFZA 2IPQX 1ZLJA 4RAYA 1C0WA 5IT9Z 1R22A 1PUEE 4G9YA 1R5GA 4I98B 4RB1A 2Z9OA 2DI3A 3OV8A 1ONVA 1XSDA 4A5NA 3GWZA 2RN7A 3F3XA 1OPCA 3CJNA 1SMYF 2JSCA 3E6DA 2HWVA 4KIFA 5K1YA 1HSJA 5L3BA 2LDUA 2EA4A 1HW1A 3BWGA 1FBSA 2FRHA 5CVIA 2FXAA 2E7XA 3MWMA 1ZYRF 3RTRA 3NRVA 4LD5A 4UV8A 3EYYA 3GZ6A 1ZAOA 4EM1A 2NYXA 2FNPA 1MJAA 5LEJA 1XDSA 1XDUA 2HDCA 1QZZA 3MQ0A 4G7OF 2J5OA 5HS7A 2O6GE 2HQNA 2HR3A 1OYYA 4HQEA 1LDJA 4GXOA 3IC7A 3KP5A 5ICEA 3P7NA 5BS6A 2PN6A 2YPRA 2JTVA 2E7WA 5HS8A 2CQKA 3K1NA 3U9GA 3WU1B 2LKPA 1HXDA 3HRUA 3BDDA 1FY7A 4P9FA 3MAJA 1HKSA 5FFXA 3RIRA 5D4RA 1F1ZA 4ESJA 3J7AO 3REOA 3K69A 4BHCA 3KEQA 1U8RA 1G3TA 2GXGA 5K5QA 1G3YA 3EETA 2F2EA 3SZTA 4RGRA 4U88A 1DP7P 4KT5C 4S04A 4R1HA 1U78A 1V4RA 3VFZA 3CO6C 1IXSB 2ELHA 1QBJA 2G9WA 1CF7B 3GFLA 3LSTA 3GF2A 4G6DA 2M1BA 1FC3A 5HLGA 4AVPA 4OIQF 4I2OA 5HDKA 3WTYC 2FNAA 3QP5A 3F23A 3KFWX 1XSVA 2CFXA 3HTUA 5AIPA 1OKRA 3WE3A 5D6FA 1STZA 3T0YA 4OINF 1F5TA 1S29A 2EB7A 1U5TB 3GFIA 1JHHA 3H92A 3BJ6A 4ZH4F 4OIRF 5CVJA 2NNYA 4HW0A 2Z3YA 3TQNA 3L09A 2Z5UA 1KQ9A 2KIUA
chains in the Genus database with same CATH superfamily
1TWGJ 2G7HA 2PJPA 1LE8A 5BNGA 4MO7A 3FXRA 4Q5SF 2L02A 2BW3B 3BTCA 5D8LB 1GVDA 1TWCJ 4AYBN 5DM7F 2HYGD 1GV2A 5C4XJ 1JXSA 3CCYA 3H0GJ 1FZPB 2A3SA 2X0LA 3ZQHA 1FYKA 4BDZA 1B72A 4Y7NJ 3L7WA 1WJFA 2OU2A 1LFBA 4KN7X 1LDKB 4OOIA 1YS6A 4A2UA 3QOPA 2ZXHA 4J01A 1JGGA 1U3EM 3HOZJ 4QSHA 4IJAA 1UFMA 1KYZA 2EIJH 4HLXA 5FGMA 2R92J 4A3LJ 3K4BA 4HG2A 3HRSA 3VDXA 2ISZA 2EBIA 3T8TA 1XN7A 1ZLKA 4KDPA 4I76A 2VN2A 3GBGA 3I0TA 1IN8A 2XAJA 1YHQI 3KP4A 4BXUA 2XGCA 3VYUB 2F4OB 5EG0A 2VOOA 2VOPA 2L54A 3BG7A 2QVOA 2RQPA 2X9DA 2FD5A 3I4PA 3JR9A 2IGNA 3UKGA 3GZ5A 4F91B 1WJ5A 3HSFA 1Y8RB 5J47A 3M8FA 5BQTA 5GADJ 5KK1A 4NQWB 1JTXA 1SAXA 2R5YB 5GAGJ 2RC4A 2X6XA 2IS2A 3BROA 2Q1ZB 2JVHA 2ZJPF 2X1CA 4KA4A 5CYVA 4N9HA 2RVCA 3KP7A 3WTSC 1MZBA 4IRGA 2HQ5A 4XLNF 2DYRH 1IZ1A 5D5VB 4XLEA 3HUGB 1MNDA 1DP3A 2B9SA 2Z99A 2L3DA 2M9HA 2FOWA 5FFZA 4CCOA 3M9AA 3K70C 2HEOA 3GTMJ 4UVBA 2VASA 4JX5A 3FM5A 5ED4A 1J5YA 2DK8A 4BGDA 2K02A 3KIOA 4M6YA 4BY1J 4LG0B 5CVUA 1MMNA 1FIAA 5FKKA 5L3DA 2GOXB 2H6CA 2XAHA 1S9HA 1JUMA 4LK0F 2LFBA 4XNFA 3S1MJ 4A0XA 2GA1A 1WCMJ 5CLSA 3GLXA 1JTYA 4ON0A 3HPHA 1AKHA 3LSIA 1XC5A 4LG3A 3GYHX 1O3QA 1O4XA 2OBPA 3B02A 1UAAA 1USSA 2E1MB 3K9TA 4CCKA 2DTZA 4RBOA 2LY2A 4ZJZA 3I56I 1VF9A 1R1TA 3CCEI 2HPMA 5FLXK 3E97A 1YX3A 5D6EA 1AU7A 1MDMB 2NOJB 4DOZA 2Y31A 4O5VA 1OISA 1A6IA 4PSWA 2DDBA 5KVRA 4ESBA 2VKDA 1JKOC 2OF7A 1VQ6I 1DPUA 3GLLA 1VQKI 4M3FA 2JPBA 2ZNZA 4RGUA 5F04A 3V42A 5FRMA 2K3FA 1S7AA 2F4MB 3RSNA 2AS5F 3HTSB 5C4JJ 2Y2ZA 1WJAA 2JN6A 2M0MA 4ZZLA 1ZGWA 4F93B 3GFMA 1BJAA 3DFGA 1W1WE 2FSWA 2KMUA 4KYWA 2W25A 5GPAA 1D0ZA 3G1OA 3W3CA 2JJ7A 5TJJA 4U0YA 2RDPA 4EM2A 3PSFA 2UZKA 2G7UA 2L4AA 1B1BA 3DKXA 5J8CA 1HLVA 2WY8Q 5D8KB 4YIFA 3C2HA 2XAGA 3TKYA 1IJWC 3KE2A 1KU7A 4MNUA 2GLOA 1BOAA 3BG6A 4XOPA 2K27A 1FMWA 2IP2A 2BZTA 1IC8A 2KT0A 3HOTA 5DD8A 4E70A 3CCSI 4LITA 3LA3A 2JA7J 2VXDA 1IAWA 2R3SA 1B8IB 2STTA 3LQRA 4C3IJ 2IA1A 4P1WA 3ZMTA 4O3MA 2KDOA 2P5LC 2DA5A 2KISA 3W6VA 1G3SA 1F36A 2IGOA 5B3SH 2FMYA 4KMFA 1RI7A 5DV5A 2KRCA 1R49A 5J1YA 1ZG1A 2NNNA 1JI8A 3AAFA 2KKOA 2M45A 2R7XA 3ASOH 9ANTA 4U0WA 2XKPA 2XAFA 4X6AJ 4ZC3A 1B9NA 1GXQA 3ABTA 1YFHA 4KIBA 2MLKA 4L18B 3PO3J 1SVOA 3Q0UA 1SFUA 1VZ0A 1JT6A 1WSUA 3M1EA 2F5CA 3MZ8A 4MTEA 2DMTA 4CYCB 1X4PA 3BJAA 4M6XA 4OAYA 1IUYA 3HGGA 2DQLA 3MEXA 3O2PE 3ZQFA 4XN0A 5HS9A 5A2QZ 1W0UA 1YG2A 1SD7A 3QPSA 1O3SA 4PUSA 2X6YA 2XPVA 3BZKA 2BEOA 1W36C 2LKSA 2VBZA 4XRFA 3LFUA 3FK7A 1LUJB 3IV5A 1N25A 3BCAA 1DQUA 4N4OB 3J7AY 1IN5A 4IHVA 1IDYA 4XORA 4BQAA 2HFHA 1ZG3A 3OYEA 3HM5A 1R5HA 3WODF 2HVRA 2IS1A 3WU2C 5M5XJ 3BOQA 2QSFX 3KCCA 2QQ8A 1LB2A 3I5UA 1S72I 2DOFA 2EZIA 2JRTA 3OL4A 5IYDJ 3ERED 3FF5A 3OIPA 4ESFA 2VT3A 2HPIA 3IAS2 3CMYA 1Y0NA 4PJMA 4J00A 2XSDC 1NG6A 2XF6A 1BN5A 5J4YA 2QQ9A 2LOOA 4B4CA 4JOMA 1FSHA 1YQAA 1ETYA 5IPAA 4LLNA 2BGCA 1EF4A 3I54A 1ENHA 3JRGA 2X1DA 2QM3A 3H5RA 1RKWA 3IKVA 3KZIC 4R79A 1DGRM 1EV7A 1UCRA 3IHUA 3I4MJ 3BQYA 3Q5FA 2V1DA 5DTDA 1LFUP 2F5VA 1YW7A 3ESWB 5FB2A 3HIFA 2EFWA 4UUSA 1FIPA 1TWFJ 2BY3A 2LKXA 2FEZA 2GXAA 3V8KA 1LQ1A 2JWTA 2WY7Q 3F9KA 3E6MA 2B0LA 2E35A 1R00A 5JLXA 2C6YA 1RR7A 3QU3A 2HTJA 3F8CA 2PMZN 5ERIA 4CO8A 1R23A 1TNSA 5C44J 3HB9A 1Z7LA 3G2BA 5L3CA 2YU9J 1ON1A 3TOBA 3W2WA 1IXRC 2R7SA 2KJBA 2HVQA 2VONA 2NS8A 2AXLA 1KA8A 4Y13A 2GZWA 1YO5C 3Q0WA 2EWNA 1IN4A 1X2MA 1OMIA 1S5LC 4B44A 4ZZDA 2QBYB 1BR2A 3K70D 4HDUA 2DO7A 1B4AA 3PNVA 1X3ZB 4UB8C 1SAUA 2M5WA 2E5NA 2EZLA 3J81Z 1FT9A 4WX9A 3CUQB 1PP7U 5HODA 2FOKA 5JVGF 2K4BA 5F64A 4GO1A 2K9SA 1QA6A 2GQQA 1MMSA 1XD7A 3FHNA 1F43A 2XF5A 4HZFA 4U0VA 2F6CA 3KP3A 3KZYA 1RESA 3TGNA 2D1HA 2Y0SN 4DW6A 5M3MJ 3LSPA 2LY1A 2JPCA 3KZZA 4FISA 3DWLE 1GDTA 5DCMA 3J80K 3H5NA 1WI9A 3ZQ7A 4WWCA 1EJ9A 2W82A 4AYBA 3K10A 4FHTA 3GW2A 2OC6A 3S14J 1W4MA 2HI3A 4CHUA 4P96A 2M7BA 2MABA 3HSRA 4RB0A 3WG7H 4S0HB 4ENNA 4XMYA 4E7ZA 2O9LA 4A3DJ 2DA6A 2DDAA 3ELKA 4HX7A 4QPQA 4BQNA 3OS2A 1A36A 4E7LA 1BJZA 3SXYA 3M4OJ 1MJ9A 1SMTA 2Z33A 4A0YA 3CJQB 4RAZA 4FT8A 1WFXA 5F27A 5J4VA 1DGWY 1OFCX 3QYEA 5LRSA 1L3LA 4M9ZA 1IN6A 2ETHA 2EZKA 2JUGA 4FE4A 3ZQGA 2LG4A 2KLOA 4B09A 4LJZF 3ZN0A 5J1RA 2O8XA 5ICFA 4XLAA 1KQ8A 5D5UB 4C2UA 3DV8A 1HDDC 3GXOA 2HDDA 2AQEA 5FKOA 3HBLA 4NBQA 2GM4A 2L7FP 2ZFUA 1XMXA 2YX4A 3TO6A 3QPLA 2ZMEB 2GIZA 3QOEA 2DT6A 5JLWA 2W7NA 3TEDA 4FX0A 3HOYJ 4Y15A 2DBBA 4G7ZF 5LGUA 2E1OA 2KJCA 2E71A 2Y30A 2VQLA 3J7YJ 1Q1HA 1FBQA 2DPDA 3P9IA 3FXUA 1LDDA 2LTPA 4E7HA 2VBXA 3G1LA 4RM2A 4F92B 2M0CA 4EJWA 4KICA 5LGNA 1HW2A 2FU4A 2ADUA 3KEYA 2NVTJ 4BEHB 4FASD 3BR6A 4A69C 1TT0A 2HVSA 1XG1A 2GOMA 1SFEA 5B1BH 1MIJA 2QUFA 4BJTA 2M3AA 3DBLB 3HL2A 2LSOA 3CCMI 5E1XA 4HBLA 2QEXI 2KQRA 1HQCA 5GAHJ 5IT9K 3DEWA 1UHWA 1POGA 2DA4A 1GV5A 5GAEJ 3C3WA 5LEKA 2GXBA 4PJLA 3PQKA 4HSTA 2FX0A 3N4MA 3HSEA 2GWRA 2L9RA 4B1RA 1VQOI 3GTPJ 2HNHA 2V9VA 4N4NB 1FYLA 3A01B 3BCBA 2PLYA 4HF2A 3OMYA 4S05A 1JHFA 5EEHA 4DZPA 3FHZA 1FSEA 1KZHA 1OR7C 2DODA 1IRFA 4X0GA 5E18F 2OQRA 5F08A 1ZQ3P 4L5IA 3JTGA 1A6QA 3RCOA 1MMDA 5DEQA 2EH3A 1L0OC 5B66C 3DCFA 3H35A 5E3MA 5FD5A 5E17F 5ICCA 2DOAA 3F21A 2V9PA 2LR8A 4MTDA 4DGWB 4XKCA 4KUMA 1FJLA 4HV6A 4IHTA 1TQMA 2XDVA 5HLTA 2FBKA 3V8JA 3DQVC 4M3DA 1BI1A 1ZKGA 3BJOA 1IRZA 5EEAA 1G8XA 1GT0C 3BG9A 2E1NA 1D0XA 1X2NA 2V1UA 1ZN2A 4HF1A 2CGPA 3BG5A 1MBFA 2GAUA 1CF7A 2OTJI 4YFKF 3Q9VA 4XICA 3EUAA 5L3EA 5DS9A 3F8FA 1NH3A 3ASNH 4E7JA 3FBIB 3K4CA 1Z6RA 1BR4A 5E1ZB 3K1PA 4A0ZA 3N97A 2DU9A 3DKWA 1R5ID 1QZYA 3IWZA 3KX2A 3PFYA 2A6HF 1MNMC 2GBYA 5E79C 3K4KA 3JAMZ 3MKZA 3PJRA 5GP9A 3CC7I 3ZPLA 3IWFA 3SEQA 4KJZA 3RDIA 1Y0UA 1LEBA 2NVUB 3G3ZA 2EZHA 2ZO4A 4V2FA 3FXJA 1OCPA 1HKQA 3JRBA 1JJ6C 2PBIA 3IH2A 4BE2A 2CV1A 2IA0A 5EEGA 5E8IA 1O7LA 2H6BA 5TRDA 3I59B 4ZYAA 2UUZA 3C7JA 4M73A 4FX4A 5C3EJ 4XM3A 3FKIJ 4IPAA 4G94A 3TMOA 5EGOA 2EFNA 5H20A 3R61A 4UVCA 1R1VA 2R5ZA 3LSMA 1YIOA 3CC4I 1RPWA 3JTHA 1FBUA 2H09A 2P8TA 2DJIA 4G8XA 1ZREA 2JA2A 1D8KA 1HDPA 2DMUA 2ICWG 2LBFB 4GYIA 1YW9A 5EDNA 1FP2A 2OPTA 3W2AA 1FOKA 4FTHA 5FLVA 2ZC2A 1NK2P 4HAMA 2BW3A 3AG1H 3HYIA 3OYHA 1X1BA 2CO5A 2H94A 2EIMH 5LBQA 1XGOA 1G6NA 4XKBA 4ENKA 2X4HA 4ENMA 4F3QA 4RMNA 3U1DA 2LLKA 2WAEA 4BHPA 2BXYA 1K61A 4A3KJ 5JHFA 3L9FA 3IRRA 4EGZA 1FEXA 4J19A 3S1NJ 1BC7C 1T33A 1ZK8A 4BS9A 3HXLA 3LAJA 3H1CA 1OYIA 5LFAA 4YG2F 5HNHA 5JHUA 4IRHA 1RETA 4ETSA 5JR3A 4FQGA 1APLC 2VT2A 2MH2A 1YJ9I 1T38A 1K6YA 2EIKH 4HA8A 4W97A 2JVGA 3ZGKA 2XUBA 3E5QA 5CQGA 1K4TA 3ABMH 5HOOA 2ZBKA 1J0RA 3JRDA 1YJWI 1IXCA 2XASA 2VKHA 1ZRDA 3JRIA 3GFJA 4JK1X 4PJ0C 3LFKA 4A12A 3OIQA 2A07F 4HV5A 1LNWA 2BOLA 1S7EA 1LE8B 5BPIA 1OCOH 1OCRH 2E19A 1BW5A 3V7RA 2PMZA 4BJ5C 1DDNA 2M34A 2R7DA 4M3BA 3CP2A 2FUG2 4BXXJ 3LWFA 3WGIA 2HS5A 1OJLA 2A69F 1B72B 1XMKA 4X1EA 2EV6A 1FOWA 3GTOJ 3GZNB 2Y75A 3QWLA 2KIQA 2V9KA 4ZYEA 1T8IA 3S1QJ 4A5MA 4R8HA 4O6JA 2JA5J 1MGTA 5BOXA 1ETWA 2ACJA 3SHFA 2XKOA 4WK8F 1WJDA 3ZMZA 2QQAA 4LG0A 2CW8A 3CJRB 4M74A 2K5CA 2XGDA 3G4SI 4II3A 2PG4A 1LKXA 2DW4A 2L9NA 2VUMJ 1RC9A 1X1DA 2BY0A 2M4GA 3F0CA 3BR0A 5E3LA 1EH8A 1WWXA 2KPMA 3DPLC 1GLNA 2KIFA 3IL2A 2CW7A 2OD5A 2ZKZA 4HNVA 2LF8A 3VODA 5DDGA 5HNFA 3K4MA 4ASNA 2Y0SA 3S1RJ 3PUBA 2Q8KA 2EK5A 1R4MB 2CQQA 2ZXJA 3I64A 1JUSA 1D0YA 3FMRA 2AQFA 3Q0VA 3S8PA 4EJVA 3EUHC 3FX3A 2Y0MA 3KETA 4CICA 1VI0A 4BBRJ 3E3VA 4LGWA 3CF2A 3IH4A 3C18A 4AUXA 1MDMA 2VC0A 2H1KA 4UHTA 2BYVE 3WTVC 2IEKA 1S3JA 3HRMA 2ZFWA 3LSGA 1JKQC 2NRAC 2OZ6A 3VEPA 1MJBA 4EM0B 3GTJJ 1T98A 2JZYA 2XGXA 4WXDA 3F8BA 4XN3A 3MZHA 1KU2A 2R7UA 1TW3A 4BE1A 2DFHA 2E2HJ 3BR1A 3BP8A 2EJRA 4ZDLA 4Y52J 3CLOA 2K40A 1FMVA 2FMLA 4I01A 3H9GA 4C3HJ 4AIKA 1K7AA 3R4KA 4XSZF 2B7EA 2KHMA 2OUMA 3HHHA 3VSLA 1XPXA 4WCGA 1IV8A 4ZTFA 2PX9A 1RRJA 1E2XA 5B5EC 1KQ0A 1K6OA 1D1CA 4L0YB 4RB3C 3ML6A 2VBWA 4N9IA 1AKHB 3HG9A 1HCRA 1TP4A 4MEYF 1B6AA 3SQNA 3BTIA 3BLYA 3TBIA 2PQ8A 4Y3OA 4AIHA 4BY7J 1A04A 1NTCA 2E1CA 1V54H 3GUDA 3OR2C 1MBEA 4A6DA 3HOSA 1P4WA 2D45A 1WGXA 1NK3P 1P7JA 5LHGA 2EINH 2PJRA 3G1MA 1B8IA 2OCCH 2JT1A 3RZDJ 1XGSA 2VQCA 2R0QC 3E6BA 2QGUA 5LGTA 2W85A 4LK1F 1TZLA 1W7PD 2JUCA 5AIQA 4CGZA 5M3FJ 5IYBJ 2JRMA 3S3OA 1QVTA 1X1AA 3M8EA 3ZR8X 4BHBA 2QA4I 3DTKA 2VB6A 2FA5A 3BPVA 4D9JA 3CCLI 4GCVA 3VSKA 1USTA 1SD4A 3AL0B 2X6WA 4N0BA 3E0JB 1FOYA 3OWTA 1ZELA 3EUKL 1WJCA 2HXIA 4B3XA 1U5TC 1EH7A 3CMEI 4OMYA 3R60A 3PO2J 2MBFA 4CYCA 1ZH5A 1Y8QB 1Z77A 2LK2A 3TO7A 2K7LA 3DLLF 2VKVA 2G0EA 3TOAA 3AG3H 1IG7A 3DP7A 3KP6A 5J3LA 3NEUA 4BJ6C 2XB0X 1ETKA 4MEXF 1XGMA 3UR3C 4HLYA 4KITB 1TTYA 2V4JC 3LSHA 3IH3A 4V2GA 3KLNA 1ETQA 4G7HF 2DTRA 4UUVA 1W5CC 4LIUA 3GVAA 2IJLA 3COAC 3DBRB 2B63J 1WKMA 1FPQA 1T0FC 2EV0A 3FZVA 2P7CB 4BL0B 3DU6A 1O7FA 4A3IJ 3CO7C 1J59A 2IAIA 2DA2A 1LEAA 5EF6A 3FISA 2MC3A 2J5PA 1T08B 2P0WA 4PSXA 4DZJA 4Q47A 3QYFA 2CYYA 3E6CC 4L9NA 5FLMJ 1OR7A 4ZYGA 1RKTA 1SVMA 3QU6A 4DYQA 1YS7A 2L01A 2WV0A 1REPC 3ZMVA 1YX5A 1RR8C 3KPHA 1UJ8A 2RV8A 1B59A 2BY2A 3H36A 2ME6A 2KDZA 5IYCJ 3L2CA 1JKRC 4IXAA 5H2FC 3VWBA 3FXOA 1HBXG 1ZG5A 4FCYA 4MQ9F 3OSFA 3K4NA 3VPRA 1JGSA 3F72A 4P55A 3H5AA 2Q2EB 2CQ7A 4M6VA 2QLZA 4D1QA 4BE0A 1Z1DA 3K4LA 2Y69H 3WTTC 4BNCA 1TQPA 3A2KA 1I27A 3K0LA 3PM1A 2XF7A 4KNYA 2UXNA 1GUUA 3D1NI 4HSRA 2O61A 4B48A 2FQ3A 3BR3A 1MBGA 3CCJI 1R1UA 1TT5B 4DBQA 3FMSA 1O3TA 5A2QK 2F5DA 1AHDP 3T5XA 1FTZA 3A1YA 1W7PA 3A4CA 2CV0A 4NHJA 3DLAA 2M7AA 2AHQA 1VQ9I 2K9QA 2MD0A 5IOYA 4Y17A 2W00A 4U7BA 1MD0A 5CVVA 3ZMSA 1YRNA 4L0ZB 1P92A 5IP9J 3F6VA 4YIIA 3W2VA 3RI4A 2E36A 1DU0A 3X2QH 4EEFG 3PFIA 4FETA 3H0DA 4CUGA 1JKPC 3WG9A 1TWAJ 2P5VA 1TL8A 1TW2A 2Z16A 4BDYA 1Z6TA 2O5RA 3LAPA 2BVMA 2BXZA 1Z7UA 3U2RA 2XRNA 4BBSJ 3JSPA 3D0SA 2MH9A 3AG2H 2E1MC 2VJIA 5L3FA 2OCEA 1QHGA 4HX8A 2VODA 1R4NB 3WE2A 2ZSIB 4D5FA 5JVTA 4QWQA 4IRIA 3KEOA 1MSFC 2XV4S 1IN7A 4UUSB 4BH9A 1SVLA 1YTYA 1V5FA 5F0HA 2ID3A 4IHSA 4P5OA 1VQ7I 1TNTA 5DD4A 2VE9A 2BY1A 2WADA 3SZGA 1M1EB 3WGHA 4HQMA 4IVNA 1X19A 5E8GA 5FO5A 2XAQA 3Q9SA 1IV6A 3CC2I 4OIOF 1DUXC 1I1SA 2N8GA 1TC3C 3LSRA 3W6JB 2O0YA 3OYKA 4AM3A 4EMSA 1Z91A 1TQIA 3O8GA 1UG0A 4C3JJ 3CCRI 3L2WA 5E1WA 3MD2A 4M71A 3RKXA 4HDVA 2HQRA 4KIGA 1JJ8C 2ZNYA 1D5YA 1WQ2A 3K1MA 3MN2A 4CZZA 3CMAI 4XQFA 3CMMA 1K83J 2JA6J 5KNLA 1Y6IA 2A68F 1QHHD 4LFUA 3JRFA 4XSXF 3GTKJ 2YR2A 2HZTA 4LB6B 1BC8C 4A6EA 3S32A 4BKXA 4YEJA 2R7WA 4HRIA 3I58A 4HEA2 3DBHB 3OYLA 1VQ5I 1XCVA 5FKMA 5M5YJ 4GGGA 3QPHA 3L2QA 1WJEA 1K78B 1VNDA 2X51A 3GO5A 1JE8A 1K79A 2L9SA 5DCMB 2XROA 1ITYA 1OCTC 2JK3A 4MHGA 3MFKA 2GA2A 4HPQA 5KCMA 1HW5A 1ACIA 2HOAA 3BC8A 5CVRA 2XHKA 4L9TA 2R7FA 3J81K 1VQ8I 1BBYA 4M9XA 1U8BA 3OYIA 4D5CA 4KFCA 4M72A 1U2WA 5D5XB 1SC7A 2IRFG 4Z2YA 1ORKA 3VYTB 1SD5A 2F5FA 4GRIA 3HGYA 4BEHA 3RYRA 3T8RA 5KAFC 1MH3A 3ULQB 1J2XA 2Q0OA 3WTXC 2VQGA 3OIOA 5DM6F 4C2TA 4CXFA 3HRTA 3ZP5A 3JRAA 5F1JA 2A05A 3H3UA 3R0JA 4Q48A 1VQLI 3ABLH 2EFOA 2WA0A 3OS0A 2M2EA 2MSYA 1S8NA 4LB5A 4GDFA 3R0AA 2LNBA 4E7KA 2RNGA 3H9QA 1Z3XA 2DQRA 4PJNA 3T1BA 3FXLA 5JI6A 4UVAA 1SEUA 3VYRB 1Z3YA 1S6LA 1OQYA 3DTEA 4BYYA 2L2OA 2KRHA 2VJ4A 5TGTA 3FDYA 3TL4X 1VQNI 1RIOH 2VBYA 1Z9CA 4EVIA 4ZDPA 2D1VA 3V7CA 5IT3A 4QTRA 2P7VB 1XGNA 3O8HA 1ZRFA 2L0KA 3QYBA 4PZJA 2P5KA 3GCMA 2LF7A 4BQQA 3EUHA 2FJ1A 3SZPA 1XMAA 4EQQA 4CZCA 2FBIA 2ESNA 3F8NA 3FXKA 4XBFA 4EV0A 3WTWC 3CP8A 3A0BC 1P7IA 4E7SA 2MGQA 3MMYB 3QQAA 2K9LA 1UHSA 2DFFA 3FM3A 5E3NA 1MMGA 3LMMA 2MD5A 3SYTA 1PUFA 3K7AJ 1X1PA 3ABKH 1D1BA 2MA3A 2O3FA 5J6XA 1O3RA 1D1AA 4KN4X 4NB5A 5ICGA 3WTZA 4JBAA 4KISA 3OYAA 5HDGA 3OOUA 4XKVA 3V8LA 2ZSHB 1YE9A 1ZGAA 5FKNA 4IHYA 3ECOA 2BV6A 4XL9A 2HKOA 1ULYA 4WF2A 3NWTA 4E6KG 2DA1A 2PEXA 4OU0A 3WU0A 1IDZA 1ZGJA 3ZN1A 1P2FA 2OV7A 3KYCB 2VPLA 3FXQA 4YELA 5BMZA 4F52A 2DT7B 3P5JA 1LVAA 2DLLA 4ITVA 2Z2SB 2MLGA 3D5LA 3ZMUA 5HVQC 1WH7A 2XRLA 1WPKA 4OIPF 1ERDA 2YU3A 3RPQA 2CU7A 2DN0A 4D0PA 2WBMA 1G4DA 2VC1A 4KT6A 2NXNB 3JREA 1N77A 3OOPA 3S15J 3TDZC 4OMZA 4JX6A 3EDPA 3EPZA 3AG4H 2RREA 2QCOA 1QO0D 1NHAA 3BZCA 2DMNA 2QSGX 3KYDB 4QIWN 2YX7A 2A5YB 1P4XA 4MQVA 3B73A 3DEUA 3I59A 3NARA 1YW8A 4IZZA 2V1XA 2A61A 1BL0A 2WWYA 2DMQA 2O03A 5M5WJ 1R71A 3CUQC 2QQBA 3V7SA 2P4WA 2V6EA 5K5OA 3U1KA 1KONA 3CZ6A 4W1UA 2CQXA 1U5TA 5B1AH 3ZXSA 1ZTRA 4PCQA 3DEEA 4IOCF 1D3YA 1TWHJ 2W24A 3HOWJ 3H3ZA 1QGPA 2KP6A 4NUBA 3OYDA 2CSOA 1Y39A 2XVCA 2OA4A 4M3EA 4NC6A 4PDKA 2YUSA 3CCQI 1P9QC 3KYLA 3HOXJ 2JMWA 2NVYJ 1HA8A 3GTQJ 1P6RA 5LRRA 3DTIA 1SFKA 2IVMA 1R36A 1EA3A 2K4JA 4DNCA 5LLQA 3LA2A 3JRCA 4A3CJ 2RKHA 2XPWA 2MC4A 3DF8A 3PNTA 4I7HA 3TO9A 2E2JJ 1B9MA 3P9KA 5IP6A 2VJ5A 4ZYDA 3K4JA 1T0FA 1SANA 4XR6A 5LHHA 1D5VA 2R7VA 1VFCA 5GTHC 1QPMA 2K86A 1TBXA 5AONA 2BVLA 3PIPF 2R7RA 3JAMK 1F9NA 3BT9A 3WHBA 3HOUJ 1N78A 3ZMDA 1MKMA 2R5ZB 3SFIA 1ZRCA 4ABZA 4OWRB 3OYMA 1FX7A 2Y9YA 2QWWA 4WXCA 1V5EA 3CDLA 3KP2A 1AOYA 1R9TJ 4NC7A 2EA2A 2LMDA 4K2EA 2XB5A 5K5RA 3OYFA 2LY9A 2EFQA 2KIMA 3O3KA 5EZGA 2BE5F 3G73A 5HLHA 3ZQQA 2FBHA 4U87A 2DPUA 3E5XA 1LVKA 4LOCA 2CWEA 2OAZA 2ZMEC 4DBRA 2M8GX 2MYSA 4BU2A 1K4SA 1H9GA 4BXFA 1T2KA 3CCUI 4Q4ZF 4NNJA 2R93J 5J40A 3BY6A 5CQEA 4XIDA 2O7OA 5GPCA 5F6FA 3VOEA 5H6RA 4AU7A 2L4MA 4LLLA 5LD2C 1YITI 4NQWA 2R5YA 2HTSA 2HDWA 4MFEA 2H8RA 1IW7F 2OZUA 4L5JA 3BR2A 6PAXA 5E20A 3ZOBA 1H9TA 4PGHA 4EJTA 1BOBA 4IKFA 4ENJA 1EKEA 2E60A 3GTGJ 2WTEA 3HUGA 4YFNF 3CCVI 2HOTA 1XSXA 1XCBA 1A5JA 3EQLF 4XLFA 2JSPA 1MH4A 5EZHA 1UELB 4EATA 1XTAA 2WC2A 1KYWA 4HYEA 1F4KA 4UY8I 3LQQA 3CQZJ 5FLXZ 3I53A 3RQIA 4ANJA 3F22A 2MW8A 2F48A 2GIVA 3E5UA 4I0BA 2DJNA 2FF4A 1HC8A 2HZDA 2UXXA 1EH6A 1IGNA 1UHMA 3CTAA 3OS1A 2HYFA 4I0AA 2EILH 5K7HA 1MSEC 3HKZN 5F0FA 2K3PA 2Y48A 2VL8A 5EG0B 2ZJRF 1AA7A 2KZGA 1KU9A 1LJ9A 3C2BA 5J8FA 1R7JA 2QKLB 3NQOA 1RUOA 2WB1N 3L00A 3BZ6A 2H8WA 4Y4RA 2HXOA 2LC2A 2ISYA 3M7GA 3M3YJ 3TW6A 1YYVA 2XAUA 1WJBA 2HGCA 3HJEA 2X85A 2YSRA 1CGPA 1GHCA 2NVXJ 1BR1A 3E7LA 3G71I 4BACA 1QZEA 2VI6A 2ZXIA 1J7KA 2XSJC 1PP8F 3S2DJ 1HF0A 3RKWA 1BM9A 1FNNA 1I6XA 3S2WA 4BAYA 1KU3A 4IF4A 2HKXA 4CYDA 2VLAA 2CRGA 2DMPA 2EPFA 3ECHA 3JSOA 1QNTA 4XLHA 3A03A 5CJ9A 2WAFA 5ILSA 3KLOA 2WAQN 2COBA 3BQZA 3PIOF 2H27A 4L9JA 3QRFF 3FK6A 5L3GA 3I3LA 3QODA 1T6SA 1WHUA 1YLFA 2LRDA 3SJMA 2A5WA 5IP7J 4EGYA 2CJJA 4CDGA 5DUIA 1W5TA 1Q1VA 1U0JA 4B43A 2CW0F 2R7OA 3CUOA 5GTIC 4HOBA 2HOEA 2AXTC 2I5UA 4D7NA 1E0EA 3GX4X 3WTUC 1KGSA 3ZQIA 2UWMA 2CUZA 2IGKA 4D7MA 5FRNA 2FE3A 2KRFA 4MLOA 2QF7A 2IW5A 5DUKA 2W84A 1O57A 2CFOA 4ZYHA 3EYIA 2P6SA 1X3UA 1ZR4A 4EJUA 1J75A 1RUNA 1H0MA 4TV7A 1XS9A 4C30A 3ERMA 3CF5F 1BIBA 1T95A 2CG4A 2ESHA 2TRTA 4XLCA 1X3WB 2PMHA 2X48A 3D5SC 4M9SA 2PMUA 3OSGA 3MKLA 4UXNA 4M3GA 1J9IA 1P4AA 2DT5A 1ETOA 1SFXA 3DPTA 3RPUD 2COMA 4XK4A 2DAOA 5DCFA 4UV9A 4AWXB 4LIVA 4ZDOA 4NC8A 1RZ4A 2O8KA 2IBDA 1E3PA 4UUTA 3GEZA 2PJRB 3U21A 1E3HA 3WGGA 3OYNA 3S16J 2DA7A 4MGRA 4FE7A 1GXPA 2VXZA 1BI3A 3FMQA 1ETVA 1W5SA 4KMUX 2QZ8A 2W48A 1UB9A 1R6RA 1BW6A 2ZCWA 3JW4A 5EJCA 4Z6YA 3SDGA 3HPGA 3OY9A 2M87A 3ZQCA 1E17A 4IHXA 1XB4A 3A0HC 2CUJA 2R4GA 4GYGA 4V19K 3MZYA 1X58A 2L7KA 3LA7A 3HZJA 4I99C 2X6OA 3CLQA 3RJPA 3IKTA 4F7ZA 2XIGA 1X1CA 2R7ZJ 4H0EA 5FROA 2MFZA 1ON2A 2ECBA 2PFBA 4UNOA 1V55H 3ISPA 3W6KB 4OAZA 1IUFA 5FD6A 2WV1A 2DCEA 5FJ8J 5CPRB 1PJRA 3FWEA 4XRSA 3J7ZI 1Z67A 1Z05A 4A3BJ 1ZARA 3TW7A 3K2ZA 1FP1D 2KZVA 1G3WA 3V4GA 4H4KC 2A6TA 1OYWA 2HQAA 4AD9A 5D4SA 3O6BB 3P9CA 2UV1A 2DK5A 2Q2EA 4A3EJ 2DXIA 3JRHA 1MBKA 4I09A 2PI0A 5E3OA 2E2IJ 3I71A 2LVSA 2IA2A 3FBNB 1UG2A 3Q3SA 4E7IA 2L9VA 1MBHA 3VB2A 2STWA 4YFXF 4EJOA 1I3AA 1ODDA 2LREA 3K6GA 4UB6C 3RQ4A 4B47A 5HDNA 1T39A 2V6CA 3HHGA 3FKJA 1QQIA 1I5ZA 1OCZH 2BBYA 4MIMA 5ILVA 4HX4A 4DJAA 1BI0A 1ETXA 2VJJA 3WHCA 4RAFA 2BHZA 2K85A 2NS0A 3OYGA 2TCTA 1BI2A 2W4SA 2IS6A 3B6CA 3ROUA 2P6TA 1SD6A 1I50J 4L9VA 5DYMA 5F1RA 2EV5A 4RS8A 1PDNC 2QENA 4P9UA 1HKTA 4YRVA 3BPXA 2ME0A 1WRJA 1TLHB 4QLCU 4Y33A 3RKQA 3R6SA 1IRGA 4DQ2A 3LL7A 3C1DA 3LOCA 3F6OA 2LP0A 1FYMA 4CCJA 2FQ4A 5TISC 3J80Z 5BPDA 2QBYA 4IL6C 3PQJA 5D5WB 3QAHA 2M8EA 4B3AA 3M07A 4B8XA 1RNLA 1HSTA 5HLIA 4CA0A 3TDUC 3DXJF 2VQHA 3RPUA 3PL8A 1BIAA 4DYRA 2I8DA 3MCZA 2NAZA 3A02A 3CUQA 4G6TB 4LLGF 2NS7A 2R7TA 3QPTA 1I1GA 2LD5A 3AFHA 2RGVA 3BR5A 2L5QA 4LMYA 3CDHA 5ILUA 1FWZA 5J1UA 1SFOJ 3TP0A 4XONA 2EFPA 3IUOA 2OQGA 4U7DA 1IF1A 1W7PB 2CH0A 2QYOA 4PK4A 3ONQA 1UZCA 1DPRA 1QVUA 2M30A 3F8MA 4JP0A 1FLIA 3MVPA 3ZRGA 4HF0A 1JUPA 2JA8J 4RLQA 2RNJA 1R58A 2VIXA 5JFRA 1YRNB 1GVJA 1U6GA 3OYCA 2DFEA 3BG3A 1AWCA 3DU5A 2CQNA 2XPUA 4RGXA 4IO9F 3HEFA 4AIJA 2DFIA 3ABUA 4RGSA 2A6EF 2XC7A 1T56A 4F55A 1OLTA 2L7MP 2ZJ2A 1ZHFA 4WXHA 3AKZA 5LHIA 1K78A 2IT0A 2IGMA 4RB2C 1VTNC 5K7FA 4IQJA 3PNYA 2V79A 4I02A 4PFOA 4YIRX 3M8JA 4JQFA 1S7OA 2F5EA 3G6EI 3N05A 2W57A 1IRXA 2HYJA 3QP6A 4G6QA 4XLPF 1FOXA 1YOVB 4PGGA 5H6QA 3RYPA 5KHDA 2YS9A 1V3FA 1QU3A 1D8JA 2D2WA 2VE8A 2TDXA 1WH5A 2ZMEA 3S2HJ 2P81A 3RKYA 1LFPA 3IRQA 3SFZA 2IPQX 1E3OC 1ZLJA 3H9JA 4RAYA 1C0WA 2ECCA 2AO9A 4RAGA 1R22A 5IT9Z 1PUEE 2K9NA 3K2AA 4RA2A 4G9YA 2IS4A 3DPUA 1R5GA 4I98B 1WVRA 4RB1A 3AL0C 4AIDA 4A3FJ 2Z9OA 3IP4B 2CUFA 2DI3A 3HC7A 1QPIA 4AC0A 3OV8A 1U9OA 3CJTB 3HDDA 1ONVA 2F4IA 1XSDA 4A5NA 1BA5A 3GWZA 3MKYB 2H1LA 3PSIA 2RN7A 2DYSH 3OR1C 3F3XA 1V5GA 1OPCA 3CESA 3CJNA 3HKZA 1SMYF 2JSCA 5CKTA 1NG7A 3E6DA 2HWVA 3C2GA 4KIFA 3S17J 3DKYA 4RDUA 5K1YA 1QRYA 1HSJA 4JX4A 4PJJA 4HNUA 2R7QA 2CS3A 3L2UA 1OCCH 2WB1A 4JYKA 5L3BA 1G2HA 2LDUA 1I6HJ 2EA4A 3RZOJ 3VYSB 1HW1A 3BWGA 4CSWA 4CCLA 2HU9A 4RM3A 1Y1WJ 4IEJA 1FBSA 2FRHA 2JQ7A 5CVIA 4DIQA 1Z21A 2FXAA 3OYBA 2CUEA 2E7XA 3MWMA 1IO2A 2HOSA 1ZYRF 3RTRA 3NRVA 5EYRA 1W0TA 1MBJA 4LD5A 2L7ZA 2CV2A 4UV8A 3A01A 3EYYA 4C2MJ 3GZ6A 1U9NA 1ZAOA 4CCNA 5FKLA 3M1CA 4EM1A 5F0CA 2NYXA 2FNPA 1MJAA 4AVZA 5LEJA 1XDSA 1XDUA 1HOMA 2HDCA 3L2VA 3CDIA 1QZZA 3MQ0A 3TP3A 4G7OF 2J5OA 1A35A 2NVQJ 5IY5H 4QPOA 2X1EA 5HS7A 1N75A 2ZXWH 2WAQA 2O6GE 2QKMB 2HQNA 2HR3A 3I4NJ 1VQPI 1OYYA 2VPRA 4HQEA 3B6AA 1LDJA 4GXOA 3IC7A 3KP5A 5ICEA 3BTLA 1Y1VJ 2OJED 1W36D 3P7NA 5BS6A 2PN6A 2MG4A 2YPRA 3L1PA 4A3GJ 2JTVA 2LYCA 2E7WA 3JCUC 4L5EA 5HS8A 2CQKA 1X4OA 3S3MA 3K1NA 1CQTA 3U9GA 2NOGA 2CMPA 1A31A 3WU1B 3CD6I 2LKPA 1HXDA 3UNGC 1LPQA 4A93J 3HRUA 5KAIC 3BDDA 1J09A 4IQ4A 3MKWB 1G59A 1FY7A 4P9FA 3MAJA 1VQ4I 1HKSA 2Z1DA 5FFXA 3RIRA 2ELJA 2V7FA 5D4RA 1F1ZA 3LNQA 4ESJA 1MMAA 3J7AO 1MNEA 3REOA 3K69A 4BHCA 4XRMA 1PUFB 3KEQA 2E34A 1VQMI 4GFBA 3S3NA 1G3TA 3S93A 1U8RA 3E1SA 3PUFA 2GXGA 2VKEA 4BUPA 4II2A 3BTJA 5K5QA 1G3YA 4XRSG 3EETA 2F2EA 3SZTA 4I6ZA 4CH7A 4RGRA 4U88A 2Y9ZA 1DP7P 4KT5C 4DYCA 3H3VK 4S04A 4R1HA 1U78A 3GTLJ 1V4RA 3VFZA 4ZTJA 2M4KA 4C9YA 3CO6C 1IXSB 2ELHA 3I9V2 4NDLA 4BQOA 1QBJA 2G9WA 3L2RA 1CF7B 3GFLA 2D5VA 3LSTA 2KFDA 4IOAF 4G12A 1UMQA 3GF2A 2LBFA 4G6DA 2QSHX 2M1BA 1WZ2A 3D5RC 4CCMA 1PYVA 2RQQA 1I39A 1FC3A 4PFPA 5HLGA 4AVPA 1JT0A 4OIQF 4I2OA 5HDKA 2I10A 4RLFA 2W1OA 3NAUA 3WTYC 3HOVJ 3NWSA 2DA3A 2FNAA 4A3MJ 2KL4A 3QP5A 3FXMA 3F23A 3SDBA 1H88C 2XGEA 3KFWX 1XSVA 4A3JJ 1WI3A 2CFXA 3LSJA 3IAM2 3HTUA 2DOEA 5AIPA 1Y56A 1MW7A 2ZJQF 4XKWA 1YJNI 1OKRA 1XX5A 3WE3A 5D6FA 1STZA 3T0YA 4OINF 3I55I 2OTLI 4E4HA 1F5TA 2ELKA 2ZB9A 1ZR2A 2IXSA 2BHYA 2V26A 1Z0XA 2LH9A 2RAEA 1S29A 2V1NA 1YIJI 1YI2I 2EB7A 2K9MA 1PVEA 1U5TB 3GFIA 4HNTA 2E5ZA 1I3QJ 1JHHA 3H92A 3BJ6A 5EGOB 1H89C 4IX7A 4MFDA 4IHWA 3FIWA 2ID6A 2EQRA 3ZCOA 4XOTA 3SEZA 3LSKA 5K7ZA 1DU6A 4ZH4F 4OIRF 5CVJA 2NNYA 3ZQLA 5IOZA 3GMEA 3OL3A 4HW0A 1H8AC 2Z3YA 3TQNA 3L09A 3OYJA 1FTTA 2Z5UA 1KQ9A 2KIUA
chains in the Genus database with same CATH topology
2G7HA 2PJPA 4Q5SF 3FXRA 2L02A 5D8LB 2HYGD 1JXSA 1FZPB 2A3SA 2X0LA 1FYKA 3L7WA 2OU2A 4KN7X 1LDKB 4OOIA 1YS6A 4A2UA 3QOPA 1U3EM 4IJAA 1UFMA 1KYZA 4HLXA 5FGMA 3HRSA 2ISZA 3T8TA 1XN7A 1ZLKA 4KDPA 2VN2A 3I0TA 1IN8A 2XAJA 3KP4A 4BXUA 2VOOA 2VOPA 2L54A 2QVOA 2RQPA 3I4PA 3GZ5A 3HSFA 3M8FA 5BQTA 5KK1A 1SAXA 2RC4A 3BROA 4KA4A 5CYVA 4N9HA 2RVCA 3KP7A 3WTSC 1MZBA 4IRGA 4XLNF 1IZ1A 5D5VB 2Z99A 2L3DA 5FFZA 3M9AA 2HEOA 4UVBA 3FM5A 5ED4A 1J5YA 2DK8A 2K02A 4M6YA 4LG0B 5CVUA 5L3DA 2XAHA 2H6CA 4LK0F 4A0XA 2GA1A 5CLSA 3GLXA 4ON0A 3GYHX 1O3QA 2OBPA 3B02A 1USSA 3K9TA 1R1TA 5FLXK 3E97A 5D6EA 1MDMB 4O5VA 5KVRA 4ESBA 1DPUA 2JPBA 2ZNZA 4RGUA 1S7AA 3HTSB 2AS5F 4ZZLA 3GFMA 1BJAA 3DFGA 2FSWA 4KYWA 2W25A 5TJJA 4U0YA 2RDPA 4EM2A 2UZKA 2G7UA 2L4AA 1B1BA 5J8CA 5D8KB 4YIFA 2XAGA 3TKYA 1KU7A 3KE2A 4MNUA 1BOAA 2K27A 2IP2A 3HOTA 5DD8A 4E70A 3LA3A 2STTA 1IAWA 2R3SA 3LQRA 2IA1A 3ZMTA 4O3MA 2P5LC 1G3SA 2FMYA 4KMFA 1RI7A 5DV5A 1ZG1A 2NNNA 3AAFA 2KKOA 2M45A 4U0WA 2XKPA 2XAFA 1B9NA 1GXQA 3ABTA 1YFHA 4KIBA 2MLKA 4L18B 1SFUA 1WSUA 3M1EA 2F5CA 4MTEA 3BJAA 4M6XA 1IUYA 3O2PE 2DQLA 3MEXA 5A2QZ 5HS9A 1YG2A 1SD7A 1O3SA 2BEOA 2VBZA 4XRFA 1IN5A 4BQAA 2HFHA 1ZG3A 1R5HA 3WODF 3BOQA 3KCCA 1LB2A 3I5UA 2JRTA 3ERED 3FF5A 4ESFA 2VT3A 1BN5A 2QQ9A 1FSHA 1YQAA 4LLNA 2BGCA 3I54A 2QM3A 3IKVA 4R79A 1EV7A 1UCRA 3IHUA 3Q5FA 2V1DA 1YW7A 5FB2A 3HIFA 2EFWA 2FEZA 3V8KA 1LQ1A 3E6MA 2B0LA 1R00A 2C6YA 3QU3A 2HTJA 3F8CA 5ERIA 4CO8A 1R23A 1TNSA 5L3CA 1ON1A 3TOBA 1IXRC 2KJBA 2VONA 2AXLA 1KA8A 4Y13A 2GZWA 1YO5C 2EWNA 1IN4A 1OMIA 2QBYB 4ZZDA 4HDUA 2DO7A 1B4AA 2M5WA 3J81Z 1FT9A 4WX9A 3CUQB 1PP7U 2FOKA 2K4BA 5F64A 4GO1A 2GQQA 1XD7A 4HZFA 4U0VA 3KP3A 3KZYA 3TGNA 2D1HA 2JPCA 3KZZA 5DCMA 3J80K 3ZQ7A 1WI9A 4WWCA 4FHTA 3GW2A 1W4MA 4CHUA 4P96A 4RB0A 3HSRA 4ENNA 3ELKA 4HX7A 3SXYA 1MJ9A 1SMTA 2Z33A 4A0YA 4RAZA 4FT8A 5LRSA 1L3LA 4M9ZA 1IN6A 2ETHA 4B09A 4LJZF 3ZN0A 2O8XA 5ICFA 1KQ8A 5D5UB 3DV8A 3GXOA 2YX4A 3TO6A 2ZMEB 4FX0A 4Y15A 2DBBA 4G7ZF 5LGUA 2KJCA 1Q1HA 1FBQA 2DPDA 3P9IA 3FXUA 1LDDA 2VBXA 4EJWA 4KICA 5LGNA 1HW2A 2FU4A 2ADUA 1SFEA 2QUFA 2LSOA 5E1XA 4HBLA 1HQCA 5IT9K 1UHWA 3C3WA 5LEKA 2GXBA 3PQKA 3N4MA 3HSEA 2GWRA 2V9VA 1FYLA 2PLYA 4HF2A 4S05A 1JHFA 5EEHA 3FHZA 1FSEA 1IRFA 5E18F 2OQRA 4L5IA 3JTGA 5DEQA 1L0OC 5FD5A 5E17F 5ICCA 3F21A 4MTDA 4KUMA 4HV6A 4IHTA 1TQMA 2FBKA 3V8JA 3DQVC 1BI1A 3BJOA 2E1NA 4HF1A 2V1UA 1ZN2A 2CGPA 2GAUA 1CF7A 4YFKF 3Q9VA 5L3EA 3F8FA 1Z6RA 5E1ZB 3K1PA 4A0ZA 3N97A 2DU9A 3DKWA 1QZYA 3IWZA 2A6HF 3JAMZ 3ZPLA 3IWFA 3RDIA 1Y0UA 1LEBA 3G3ZA 2ZO4A 1HKQA 2PBIA 2IA0A 5EEGA 5E8IA 1O7LA 2H6BA 5TRDA 3I59B 3C7JA 4M73A 4FX4A 4IPAA 4G94A 2EFNA 5H20A 3R61A 4UVCA 1R1VA 1YIOA 3JTHA 1FBUA 2H09A 2P8TA 4G8XA 1ZREA 1D8KA 4GYIA 1YW9A 1FP2A 1FOKA 4HAMA 3HYIA 2CO5A 2H94A 5LBQA 1XGOA 1G6NA 4ENKA 2X4HA 4ENMA 3U1DA 4BHPA 3L9FA 3IRRA 4EGZA 1BC7C 3LAJA 1OYIA 4YG2F 5JHUA 4IRHA 4ETSA 5JR3A 2VT2A 2MH2A 1T38A 4HA8A 2XUBA 3E5QA 5HOOA 2ZBKA 1J0RA 1IXCA 2XASA 1ZRDA 3GFJA 4JK1X 4A12A 3LFKA 2A07F 4HV5A 1LNWA 5BPIA 3V7RA 1DDNA 2R7DA 3LWFA 3WGIA 2HS5A 2A69F 1XMKA 2EV6A 2Y75A 4ZYEA 4A5MA 4R8HA 4O6JA 1MGTA 5BOXA 2ACJA 3SHFA 2XKOA 4WK8F 3ZMZA 2QQAA 4LG0A 4M74A 2PG4A 2DW4A 1EH8A 1WWXA 3DPLC 2KIFA 3IL2A 2OD5A 2ZKZA 5DDGA 2LF8A 3VODA 4ASNA 2Q8KA 2EK5A 2ZXJA 3I64A 3FMRA 4EJVA 3FX3A 2Y0MA 3KETA 4CICA 3E3VA 4LGWA 3C18A 1MDMA 2VC0A 4UHTA 2BYVE 3WTVC 1S3JA 3HRMA 2ZFWA 2NRAC 2OZ6A 3VEPA 1MJBA 4EM0B 1T98A 2JZYA 2XGXA 4WXDA 3F8BA 3MZHA 1KU2A 1TW3A 3BP8A 2EJRA 3CLOA 2FMLA 4I01A 4AIKA 1K7AA 3R4KA 4XSZF 3HHHA 4WCGA 1E2XA 1KQ0A 1K6OA 4L0YB 4RB3C 3ML6A 2VBWA 4N9IA 4MEYF 1B6AA 3SQNA 2E1CA 2PQ8A 4AIHA 1A04A 3GUDA 4A6DA 3HOSA 1P4WA 2D45A 5LHGA 2JT1A 1XGSA 3E6BA 5LGTA 2W85A 4LK1F 1W7PD 5AIQA 4CGZA 3M8EA 4BHBA 2FA5A 3BPVA 4GCVA 1USTA 1SD4A 4N0BA 1U5TC 1EH7A 4OMYA 3R60A 2MBFA 1ZH5A 3TO7A 2K7LA 3TOAA 3DP7A 3KP6A 3NEUA 4MEXF 1XGMA 4HLYA 1TTYA 3KLNA 4G7HF 2DTRA 4UUVA 3GVAA 2IJLA 3COAC 1WKMA 1FPQA 2EV0A 3FZVA 2P7CB 1O7FA 3CO7C 1J59A 1LEAA 2MC3A 2J5PA 4Q47A 2CYYA 3E6CC 4L9NA 1OR7A 4ZYGA 3QU6A 1YS7A 2L01A 2WV0A 1REPC 3ZMVA 2RV8A 1B59A 3L2CA 4IXAA 1HBXG 1ZG5A 4MQ9F 1JGSA 3F72A 4P55A 2QLZA 1Z1DA 3WTTC 4BNCA 1TQPA 1I27A 3K0LA 4KNYA 2UXNA 2O61A 2FQ3A 1R1UA 3FMSA 1O3TA 5A2QK 2F5DA 3T5XA 1W7PA 4NHJA 4U7BA 4Y17A 1MD0A 5CVVA 3ZMSA 4L0ZB 1P92A 3F6VA 4YIIA 3RI4A 3PFIA 3WG9A 2P5VA 1TW2A 1Z6TA 3LAPA 1Z7UA 3U2RA 2XRNA 3JSPA 3D0SA 2MH9A 5L3FA 4HX8A 2VODA 3WE2A 4IRIA 5JVTA 4QWQA 3KEOA 2XV4S 1IN7A 4BH9A 1YTYA 4IHSA 4P5OA 1TNTA 5DD4A 2VE9A 3WGHA 4HQMA 4IVNA 5E8GA 5FO5A 2XAQA 3Q9SA 4OIOF 1DUXC 1I1SA 3W6JB 2O0YA 4EMSA 1Z91A 1TQIA 5E1WA 4M71A 3RKXA 4HDVA 2HQRA 4KIGA 2ZNYA 1WQ2A 3K1MA 4CZZA 2A68F 4LFUA 4XSXF 2YR2A 2HZTA 4LB6B 1BC8C 4A6EA 3I58A 1XCVA 4GGGA 3QPHA 1K78B 3GO5A 1JE8A 1K79A 5DCMB 2XROA 4MHGA 3MFKA 2GA2A 1HW5A 5CVRA 2XHKA 4L9TA 2R7FA 3J81K 1BBYA 4M9XA 4KFCA 4M72A 1U2WA 5D5XB 2IRFG 4Z2YA 1SD5A 2F5FA 3RYRA 3T8RA 3ULQB 1J2XA 2Q0OA 3WTXC 4CXFA 3HRTA 3ZP5A 3H3UA 3R0JA 4Q48A 2EFOA 1S8NA 4LB5A 3R0AA 2LNBA 2DQRA 3T1BA 5JI6A 4UVAA 1S6LA 4BYYA 1RIOH 2VBYA 1Z9CA 4EVIA 2D1VA 3V7CA 5IT3A 2P7VB 1XGNA 1ZRFA 4PZJA 2P5KA 2LF7A 3EUHA 3SZPA 1XMAA 4EQQA 2FBIA 2ESNA 3F8NA 4XBFA 4EV0A 3WTWC 3FM3A 2MD5A 2MA3A 2O3FA 5J6XA 1O3RA 4KN4X 4NB5A 5ICGA 3WTZA 4JBAA 5HDGA 3V8LA 1ZGAA 3ECOA 2BV6A 2HKOA 1ULYA 4WF2A 2PEXA 4OU0A 3WU0A 1ZGJA 3ZN1A 1P2FA 3FXQA 5BMZA 1LVAA 2DLLA 2MLGA 3D5LA 3ZMUA 5HVQC 4OIPF 2YU3A 3RPQA 4D0PA 1G4DA 2VC1A 3OOPA 3TDZC 4OMZA 3EDPA 1QO0D 1NHAA 2YX7A 2A5YB 1P4XA 4MQVA 3B73A 3DEUA 3I59A 1YW8A 2V1XA 2A61A 2WWYA 2O03A 3CUQC 2QQBA 3V7SA 2P4WA 5K5OA 1U5TA 4PCQA 1D3YA 2W24A 3H3ZA 1QGPA 2CSOA 2XVCA 2OA4A 4PDKA 1P6RA 5LRRA 2IVMA 1R36A 2K4JA 4DNCA 5LLQA 3LA2A 2RKHA 3DF8A 3TO9A 4I7HA 1B9MA 3P9KA 4ZYDA 1T0FA 5LHHA 1D5VA 1QPMA 2K86A 1TBXA 5AONA 3JAMK 1F9NA 3ZMDA 1MKMA 1ZRCA 1FX7A 2QWWA 4WXCA 3KP2A 1AOYA 2EA2A 4K2EA 5K5RA 2EFQA 2KIMA 3O3KA 2BE5F 3G73A 5HLHA 2FBHA 2DPUA 3E5XA 2CWEA 2OAZA 1H9GA 1T2KA 4Q4ZF 3BY6A 5F6FA 3VOEA 5H6RA 2L4MA 4LLLA 4NQWA 2HTSA 1IW7F 2OZUA 4L5JA 6PAXA 5E20A 1H9TA 4PGHA 4EJTA 4ENJA 2WTEA 3HUGA 4YFNF 1XSXA 1XCBA 3EQLF 2WC2A 1KYWA 4HYEA 1F4KA 3LQQA 5FLXZ 3I53A 3F22A 3E5UA 2GIVA 4I0BA 2FF4A 2UXXA 1EH6A 1UHMA 3CTAA 2HYFA 4I0AA 2Y48A 1KU9A 1LJ9A 5J8FA 1R7JA 3NQOA 1RUOA 3L00A 3BZ6A 2ISYA 3M7GA 1YYVA 2HGCA 2YSRA 1CGPA 1GHCA 1J7KA 1PP8F 3RKWA 4BAYA 1BM9A 1FNNA 1I6XA 3S2WA 1KU3A 4IF4A 2HKXA 4CYDA 3ECHA 3JSOA 1QNTA 5CJ9A 5ILSA 3KLOA 2H27A 4L9JA 3QRFF 5L3GA 1T6SA 1YLFA 4EGYA 4CDGA 5DUIA 1W5TA 2CW0F 3CUOA 4HOBA 2HOEA 3GX4X 3WTUC 1KGSA 2UWMA 2FE3A 2KRFA 2IW5A 5DUKA 2W84A 1O57A 4ZYHA 3EYIA 2P6SA 1X3UA 1J75A 4EJUA 1RUNA 1H0MA 4TV7A 1BIBA 2CG4A 2ESHA 2PMHA 4M9SA 2PMUA 4UXNA 1J9IA 1P4AA 2DT5A 1SFXA 3DPTA 2COMA 2DAOA 5DCFA 4UV9A 4AWXB 1RZ4A 3GEZA 3WGGA 4MGRA 1GXPA 2VXZA 1BI3A 3FMQA 1W5SA 4KMUX 2QZ8A 1UB9A 2ZCWA 3JW4A 2M87A 1E17A 1XB4A 4GYGA 3MZYA 3LA7A 3IKTA 3RJPA 4F7ZA 2XIGA 4H0EA 1ON2A 2PFBA 4UNOA 3ISPA 3W6KB 5FD6A 3FWEA 1Z05A 1ZARA 3K2ZA 1FP1D 1G3WA 3V4GA 4AD9A 1OYWA 5D4SA 3O6BB 3P9CA 2DK5A 2Q2EA 4I09A 2PI0A 3I71A 2IA2A 3VB2A 2STWA 4YFXF 4EJOA 1ODDA 1T39A 5HDNA 2V6CA 3HHGA 1QQIA 1I5ZA 2BBYA 5ILVA 4HX4A 1BI0A 2NS0A 1BI2A 3ROUA 2P6TA 1SD6A 4L9VA 5DYMA 5F1RA 2EV5A 4RS8A 1PDNC 2QENA 4P9UA 1HKTA 3BPXA 1WRJA 1TLHB 4QLCU 1IRGA 3R6SA 4DQ2A 3C1DA 3F6OA 1FYMA 3J80Z 5BPDA 2QBYA 3PQJA 5D5WB 3QAHA 2M8EA 4B8XA 1RNLA 1HSTA 5HLIA 3TDUC 3DXJF 3RPUA 1BIAA 3MCZA 2NAZA 3CUQA 4LLGF 3QPTA 1I1GA 2RGVA 4LMYA 3CDHA 5ILUA 1FWZA 2EFPA 2OQGA 4U7DA 1IF1A 1W7PB 2QYOA 1DPRA 2M30A 3F8MA 1FLIA 4HF0A 2RNJA 1R58A 5JFRA 1GVJA 1U6GA 1AWCA 4RGXA 4AIJA 2DFIA 3ABUA 4RGSA 2A6EF 2ZJ2A 1ZHFA 4WXHA 5LHIA 1K78A 2IT0A 1VTNC 4RB2C 2V79A 4I02A 4JQFA 1S7OA 2F5EA 2W57A 4G6QA 3QP6A 4XLPF 5H6QA 4PGGA 3RYPA 1V3FA 1D8JA 2D2WA 2VE8A 2TDXA 2ZMEA 3RKYA 3IRQA 3SFZA 2IPQX 1ZLJA 4RAYA 1C0WA 5IT9Z 1R22A 1PUEE 4G9YA 1R5GA 4I98B 4RB1A 2Z9OA 2DI3A 3OV8A 1ONVA 1XSDA 4A5NA 3GWZA 2RN7A 3F3XA 1OPCA 3CJNA 1SMYF 2JSCA 3E6DA 2HWVA 4KIFA 5K1YA 1HSJA 5L3BA 2LDUA 2EA4A 1HW1A 3BWGA 1FBSA 2FRHA 5CVIA 2FXAA 2E7XA 3MWMA 1ZYRF 3RTRA 3NRVA 4LD5A 4UV8A 3EYYA 3GZ6A 1ZAOA 4EM1A 2NYXA 2FNPA 1MJAA 5LEJA 1XDSA 1XDUA 2HDCA 1QZZA 3MQ0A 4G7OF 2J5OA 5HS7A 2O6GE 2HQNA 2HR3A 1OYYA 4HQEA 1LDJA 4GXOA 3IC7A 3KP5A 5ICEA 3P7NA 5BS6A 2PN6A 2YPRA 2JTVA 2E7WA 5HS8A 2CQKA 3K1NA 3U9GA 3WU1B 2LKPA 1HXDA 3HRUA 3BDDA 1FY7A 4P9FA 3MAJA 1HKSA 5FFXA 3RIRA 5D4RA 1F1ZA 4ESJA 3J7AO 3REOA 3K69A 4BHCA 3KEQA 1U8RA 1G3TA 2GXGA 5K5QA 1G3YA 3EETA 2F2EA 3SZTA 4RGRA 4U88A 1DP7P 4KT5C 4S04A 4R1HA 1U78A 1V4RA 3VFZA 3CO6C 1IXSB 2ELHA 1QBJA 2G9WA 1CF7B 3GFLA 3LSTA 3GF2A 4G6DA 2M1BA 1FC3A 5HLGA 4AVPA 4OIQF 4I2OA 5HDKA 3WTYC 2FNAA 3QP5A 3F23A 3KFWX 1XSVA 2CFXA 3HTUA 5AIPA 1OKRA 3WE3A 5D6FA 1STZA 3T0YA 4OINF 1F5TA 1S29A 2EB7A 1U5TB 3GFIA 1JHHA 3H92A 3BJ6A 4ZH4F 4OIRF 5CVJA 2NNYA 4HW0A 2Z3YA 3TQNA 3L09A 2Z5UA 1KQ9A 2KIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7H A;  2PJP A;  4Q5S F;  3FXR A;  2L02 A;  5D8L B;  2HYG D;  1JXS A;  1FZP B;  2A3S A;  2X0L A;  1FYK A;  3L7W A;  2OU2 A;  4KN7 X;  1LDK B;  4OOI A;  1YS6 A;  4A2U A;  3QOP A;  1U3E M;  4IJA A;  1UFM A;  1KYZ A;  4HLX A;  5FGM A;  3HRS A;  2ISZ A;  3T8T A;  1XN7 A;  1ZLK A;  4KDP A;  2VN2 A;  3I0T A;  1IN8 A;  2XAJ A;  3KP4 A;  4BXU A;  2VOO A;  2VOP A;  2L54 A;  2QVO A;  2RQP A;  3I4P A;  3GZ5 A;  3HSF A;  3M8F A;  5BQT A;  5KK1 A;  1SAX A;  2RC4 A;  3BRO A;  4KA4 A;  5CYV A;  4N9H A;  2RVC A;  3KP7 A;  3WTS C;  1MZB A;  4IRG A;  4XLN F;  1IZ1 A;  5D5V B;  2Z99 A;  2L3D A;  5FFZ A;  3M9A A;  2HEO A;  4UVB A;  3FM5 A;  5ED4 A;  1J5Y A;  2DK8 A;  2K02 A;  4M6Y A;  4LG0 B;  5CVU A;  5L3D A;  2XAH A;  2H6C A;  4LK0 F;  4A0X A;  2GA1 A;  5CLS A;  3GLX A;  4ON0 A;  3GYH X;  1O3Q A;  2OBP A;  3B02 A;  1USS A;  3K9T A;  1R1T A;  5FLX K;  3E97 A;  5D6E A;  1MDM B;  4O5V A;  5KVR A;  4ESB A;  1DPU A;  2JPB A;  2ZNZ A;  4RGU A;  1S7A A;  3HTS B;  2AS5 F;  4ZZL A;  3GFM A;  1BJA A;  3DFG A;  2FSW A;  4KYW A;  2W25 A;  5TJJ A;  4U0Y A;  2RDP A;  4EM2 A;  2UZK A;  2G7U A;  2L4A A;  1B1B A;  5J8C A;  5D8K B;  4YIF A;  2XAG A;  3TKY A;  1KU7 A;  3KE2 A;  4MNU A;  1BOA A;  2K27 A;  2IP2 A;  3HOT A;  5DD8 A;  4E70 A;  3LA3 A;  2STT A;  1IAW A;  2R3S A;  3LQR A;  2IA1 A;  3ZMT A;  4O3M A;  2P5L C;  1G3S A;  2FMY A;  4KMF A;  1RI7 A;  5DV5 A;  1ZG1 A;  2NNN A;  3AAF A;  2KKO A;  2M45 A;  4U0W A;  2XKP A;  2XAF A;  1B9N A;  1GXQ A;  3ABT A;  1YFH A;  4KIB A;  2MLK A;  4L18 B;  1SFU A;  1WSU A;  3M1E A;  2F5C A;  4MTE A;  3BJA A;  4M6X A;  1IUY A;  3O2P E;  2DQL A;  3MEX A;  5A2Q Z;  5HS9 A;  1YG2 A;  1SD7 A;  1O3S A;  2BEO A;  2VBZ A;  4XRF A;  1IN5 A;  4BQA A;  2HFH A;  1ZG3 A;  1R5H A;  3WOD F;  3BOQ A;  3KCC A;  1LB2 A;  3I5U A;  2JRT A;  3ERE D;  3FF5 A;  4ESF A;  2VT3 A;  1BN5 A;  2QQ9 A;  1FSH A;  1YQA A;  4LLN A;  2BGC A;  3I54 A;  2QM3 A;  3IKV A;  4R79 A;  1EV7 A;  1UCR A;  3IHU A;  3Q5F A;  2V1D A;  1YW7 A;  5FB2 A;  3HIF A;  2EFW A;  2FEZ A;  3V8K A;  1LQ1 A;  3E6M A;  2B0L A;  1R00 A;  2C6Y A;  3QU3 A;  2HTJ A;  3F8C A;  5ERI A;  4CO8 A;  1R23 A;  1TNS A;  5L3C A;  1ON1 A;  3TOB A;  1IXR C;  2KJB A;  2VON A;  2AXL A;  1KA8 A;  4Y13 A;  2GZW A;  1YO5 C;  2EWN A;  1IN4 A;  1OMI A;  2QBY B;  4ZZD A;  4HDU A;  2DO7 A;  1B4A A;  2M5W A;  3J81 Z;  1FT9 A;  4WX9 A;  3CUQ B;  1PP7 U;  2FOK A;  2K4B A;  5F64 A;  4GO1 A;  2GQQ A;  1XD7 A;  4HZF A;  4U0V A;  3KP3 A;  3KZY A;  3TGN A;  2D1H A;  2JPC A;  3KZZ A;  5DCM A;  3J80 K;  3ZQ7 A;  1WI9 A;  4WWC A;  4FHT A;  3GW2 A;  1W4M A;  4CHU A;  4P96 A;  4RB0 A;  3HSR A;  4ENN A;  3ELK A;  4HX7 A;  3SXY A;  1MJ9 A;  1SMT A;  2Z33 A;  4A0Y A;  4RAZ A;  4FT8 A;  5LRS A;  1L3L A;  4M9Z A;  1IN6 A;  2ETH A;  4B09 A;  4LJZ F;  3ZN0 A;  2O8X A;  5ICF A;  1KQ8 A;  5D5U B;  3DV8 A;  3GXO A;  2YX4 A;  3TO6 A;  2ZME B;  4FX0 A;  4Y15 A;  2DBB A;  4G7Z F;  5LGU A;  2KJC A;  1Q1H A;  1FBQ A;  2DPD A;  3P9I A;  3FXU A;  1LDD A;  2VBX A;  4EJW A;  4KIC A;  5LGN A;  1HW2 A;  2FU4 A;  2ADU A;  1SFE A;  2QUF A;  2LSO A;  5E1X A;  4HBL A;  1HQC A;  5IT9 K;  1UHW A;  3C3W A;  5LEK A;  2GXB A;  3PQK A;  3N4M A;  3HSE A;  2GWR A;  2V9V A;  1FYL A;  2PLY A;  4HF2 A;  4S05 A;  1JHF A;  5EEH A;  3FHZ A;  1FSE A;  1IRF A;  5E18 F;  2OQR A;  4L5I A;  3JTG A;  5DEQ A;  1L0O C;  5FD5 A;  5E17 F;  5ICC A;  3F21 A;  4MTD A;  4KUM A;  4HV6 A;  4IHT A;  1TQM A;  2FBK A;  3V8J A;  3DQV C;  1BI1 A;  3BJO A;  2E1N A;  4HF1 A;  2V1U A;  1ZN2 A;  2CGP A;  2GAU A;  1CF7 A;  4YFK F;  3Q9V A;  5L3E A;  3F8F A;  1Z6R A;  5E1Z B;  3K1P A;  4A0Z A;  3N97 A;  2DU9 A;  3DKW A;  1QZY A;  3IWZ A;  2A6H F;  3JAM Z;  3ZPL A;  3IWF A;  3RDI A;  1Y0U A;  1LEB A;  3G3Z A;  2ZO4 A;  1HKQ A;  2PBI A;  2IA0 A;  5EEG A;  5E8I A;  1O7L A;  2H6B A;  5TRD A;  3I59 B;  3C7J A;  4M73 A;  4FX4 A;  4IPA A;  4G94 A;  2EFN A;  5H20 A;  3R61 A;  4UVC A;  1R1V A;  1YIO A;  3JTH A;  1FBU A;  2H09 A;  2P8T A;  4G8X A;  1ZRE A;  1D8K A;  4GYI A;  1YW9 A;  1FP2 A;  1FOK A;  4HAM A;  3HYI A;  2CO5 A;  2H94 A;  5LBQ A;  1XGO A;  1G6N A;  4ENK A;  2X4H A;  4ENM A;  3U1D A;  4BHP A;  3L9F A;  3IRR A;  4EGZ A;  1BC7 C;  3LAJ A;  1OYI A;  4YG2 F;  5JHU A;  4IRH A;  4ETS A;  5JR3 A;  2VT2 A;  2MH2 A;  1T38 A;  4HA8 A;  2XUB A;  3E5Q A;  5HOO A;  2ZBK A;  1J0R A;  1IXC A;  2XAS A;  1ZRD A;  3GFJ A;  4JK1 X;  4A12 A;  3LFK A;  2A07 F;  4HV5 A;  1LNW A;  5BPI A;  3V7R A;  1DDN A;  2R7D A;  3LWF A;  3WGI A;  2HS5 A;  2A69 F;  1XMK A;  2EV6 A;  2Y75 A;  4ZYE A;  4A5M A;  4R8H A;  4O6J A;  1MGT A;  5BOX A;  2ACJ A;  3SHF A;  2XKO A;  4WK8 F;  3ZMZ A;  2QQA A;  4LG0 A;  4M74 A;  2PG4 A;  2DW4 A;  1EH8 A;  1WWX A;  3DPL C;  2KIF A;  3IL2 A;  2OD5 A;  2ZKZ A;  5DDG A;  2LF8 A;  3VOD A;  4ASN A;  2Q8K A;  2EK5 A;  2ZXJ A;  3I64 A;  3FMR A;  4EJV A;  3FX3 A;  2Y0M A;  3KET A;  4CIC A;  3E3V A;  4LGW A;  3C18 A;  1MDM A;  2VC0 A;  4UHT A;  2BYV E;  3WTV C;  1S3J A;  3HRM A;  2ZFW A;  2NRA C;  2OZ6 A;  3VEP A;  1MJB A;  4EM0 B;  1T98 A;  2JZY A;  2XGX A;  4WXD A;  3F8B A;  3MZH A;  1KU2 A;  1TW3 A;  3BP8 A;  2EJR A;  3CLO A;  2FML A;  4I01 A;  4AIK A;  1K7A A;  3R4K A;  4XSZ F;  3HHH A;  4WCG A;  1E2X A;  1KQ0 A;  1K6O A;  4L0Y B;  4RB3 C;  3ML6 A;  2VBW A;  4N9I A;  4MEY F;  1B6A A;  3SQN A;  2E1C A;  2PQ8 A;  4AIH A;  1A04 A;  3GUD A;  4A6D A;  3HOS A;  1P4W A;  2D45 A;  5LHG A;  2JT1 A;  1XGS A;  3E6B A;  5LGT A;  2W85 A;  4LK1 F;  1W7P D;  5AIQ A;  4CGZ A;  3M8E A;  4BHB A;  2FA5 A;  3BPV A;  4GCV A;  1UST A;  1SD4 A;  4N0B A;  1U5T C;  1EH7 A;  4OMY A;  3R60 A;  2MBF A;  1ZH5 A;  3TO7 A;  2K7L A;  3TOA A;  3DP7 A;  3KP6 A;  3NEU A;  4MEX F;  1XGM A;  4HLY A;  1TTY A;  3KLN A;  4G7H F;  2DTR A;  4UUV A;  3GVA A;  2IJL A;  3COA C;  1WKM A;  1FPQ A;  2EV0 A;  3FZV A;  2P7C B;  1O7F A;  3CO7 C;  1J59 A;  1LEA A;  2MC3 A;  2J5P A;  4Q47 A;  2CYY A;  3E6C C;  4L9N A;  1OR7 A;  4ZYG A;  3QU6 A;  1YS7 A;  2L01 A;  2WV0 A;  1REP C;  3ZMV A;  2RV8 A;  1B59 A;  3L2C A;  4IXA A;  1HBX G;  1ZG5 A;  4MQ9 F;  1JGS A;  3F72 A;  4P55 A;  2QLZ A;  1Z1D A;  3WTT C;  4BNC A;  1TQP A;  1I27 A;  3K0L A;  4KNY A;  2UXN A;  2O61 A;  2FQ3 A;  1R1U A;  3FMS A;  1O3T A;  5A2Q K;  2F5D A;  3T5X A;  1W7P A;  4NHJ A;  4U7B A;  4Y17 A;  1MD0 A;  5CVV A;  3ZMS A;  4L0Z B;  1P92 A;  3F6V A;  4YII A;  3RI4 A;  3PFI A;  3WG9 A;  2P5V A;  1TW2 A;  1Z6T A;  3LAP A;  1Z7U A;  3U2R A;  2XRN A;  3JSP A;  3D0S A;  2MH9 A;  5L3F A;  4HX8 A;  2VOD A;  3WE2 A;  4IRI A;  5JVT A;  4QWQ A;  3KEO A;  2XV4 S;  1IN7 A;  4BH9 A;  1YTY A;  4IHS A;  4P5O A;  1TNT A;  5DD4 A;  2VE9 A;  3WGH A;  4HQM A;  4IVN A;  5E8G A;  5FO5 A;  2XAQ A;  3Q9S A;  4OIO F;  1DUX C;  1I1S A;  3W6J B;  2O0Y A;  4EMS A;  1Z91 A;  1TQI A;  5E1W A;  4M71 A;  3RKX A;  4HDV A;  2HQR A;  4KIG A;  2ZNY A;  1WQ2 A;  3K1M A;  4CZZ A;  2A68 F;  4LFU A;  4XSX F;  2YR2 A;  2HZT A;  4LB6 B;  1BC8 C;  4A6E A;  3I58 A;  1XCV A;  4GGG A;  3QPH A;  1K78 B;  3GO5 A;  1JE8 A;  1K79 A;  5DCM B;  2XRO A;  4MHG A;  3MFK A;  2GA2 A;  1HW5 A;  5CVR A;  2XHK A;  4L9T A;  2R7F A;  3J81 K;  1BBY A;  4M9X A;  4KFC A;  4M72 A;  1U2W A;  5D5X B;  2IRF G;  4Z2Y A;  1SD5 A;  2F5F A;  3RYR A;  3T8R A;  3ULQ B;  1J2X A;  2Q0O A;  3WTX C;  4CXF A;  3HRT A;  3ZP5 A;  3H3U A;  3R0J A;  4Q48 A;  2EFO A;  1S8N A;  4LB5 A;  3R0A A;  2LNB A;  2DQR A;  3T1B A;  5JI6 A;  4UVA A;  1S6L A;  4BYY A;  1RIO H;  2VBY A;  1Z9C A;  4EVI A;  2D1V A;  3V7C A;  5IT3 A;  2P7V B;  1XGN A;  1ZRF A;  4PZJ A;  2P5K A;  2LF7 A;  3EUH A;  3SZP A;  1XMA A;  4EQQ A;  2FBI A;  2ESN A;  3F8N A;  4XBF A;  4EV0 A;  3WTW C;  3FM3 A;  2MD5 A;  2MA3 A;  2O3F A;  5J6X A;  1O3R A;  4KN4 X;  4NB5 A;  5ICG A;  3WTZ A;  4JBA A;  5HDG A;  3V8L A;  1ZGA A;  3ECO A;  2BV6 A;  2HKO A;  1ULY A;  4WF2 A;  2PEX A;  4OU0 A;  3WU0 A;  1ZGJ A;  3ZN1 A;  1P2F A;  3FXQ A;  5BMZ A;  1LVA A;  2DLL A;  2MLG A;  3D5L A;  3ZMU A;  5HVQ C;  4OIP F;  2YU3 A;  3RPQ A;  4D0P A;  1G4D A;  2VC1 A;  3OOP A;  3TDZ C;  4OMZ A;  3EDP A;  1QO0 D;  1NHA A;  2YX7 A;  2A5Y B;  1P4X A;  4MQV A;  3B73 A;  3DEU A;  3I59 A;  1YW8 A;  2V1X A;  2A61 A;  2WWY A;  2O03 A;  3CUQ C;  2QQB A;  3V7S A;  2P4W A;  5K5O A;  1U5T A;  4PCQ A;  1D3Y A;  2W24 A;  3H3Z A;  1QGP A;  2CSO A;  2XVC A;  2OA4 A;  4PDK A;  1P6R A;  5LRR A;  2IVM A;  1R36 A;  2K4J A;  4DNC A;  5LLQ A;  3LA2 A;  2RKH A;  3DF8 A;  3TO9 A;  4I7H A;  1B9M A;  3P9K A;  4ZYD A;  1T0F A;  5LHH A;  1D5V A;  1QPM A;  2K86 A;  1TBX A;  5AON A;  3JAM K;  1F9N A;  3ZMD A;  1MKM A;  1ZRC A;  1FX7 A;  2QWW A;  4WXC A;  3KP2 A;  1AOY A;  2EA2 A;  4K2E A;  5K5R A;  2EFQ A;  2KIM A;  3O3K A;  2BE5 F;  3G73 A;  5HLH A;  2FBH A;  2DPU A;  3E5X A;  2CWE A;  2OAZ A;  1H9G A;  1T2K A;  4Q4Z F;  3BY6 A;  5F6F A;  3VOE A;  5H6R A;  2L4M A;  4LLL A;  4NQW A;  2HTS A;  1IW7 F;  2OZU A;  4L5J A;  6PAX A;  5E20 A;  1H9T A;  4PGH A;  4EJT A;  4ENJ A;  2WTE A;  3HUG A;  4YFN F;  1XSX A;  1XCB A;  3EQL F;  2WC2 A;  1KYW A;  4HYE A;  1F4K A;  3LQQ A;  5FLX Z;  3I53 A;  3F22 A;  3E5U A;  2GIV A;  4I0B A;  2FF4 A;  2UXX A;  1EH6 A;  1UHM A;  3CTA A;  2HYF A;  4I0A A;  2Y48 A;  1KU9 A;  1LJ9 A;  5J8F A;  1R7J A;  3NQO A;  1RUO A;  3L00 A;  3BZ6 A;  2ISY A;  3M7G A;  1YYV A;  2HGC A;  2YSR A;  1CGP A;  1GHC A;  1J7K A;  1PP8 F;  3RKW A;  4BAY A;  1BM9 A;  1FNN A;  1I6X A;  3S2W A;  1KU3 A;  4IF4 A;  2HKX A;  4CYD A;  3ECH A;  3JSO A;  1QNT A;  5CJ9 A;  5ILS A;  3KLO A;  2H27 A;  4L9J A;  3QRF F;  5L3G A;  1T6S A;  1YLF A;  4EGY A;  4CDG A;  5DUI A;  1W5T A;  2CW0 F;  3CUO A;  4HOB A;  2HOE A;  3GX4 X;  3WTU C;  1KGS A;  2UWM A;  2FE3 A;  2KRF A;  2IW5 A;  5DUK A;  2W84 A;  1O57 A;  4ZYH A;  3EYI A;  2P6S A;  1X3U A;  1J75 A;  4EJU A;  1RUN A;  1H0M A;  4TV7 A;  1BIB A;  2CG4 A;  2ESH A;  2PMH A;  4M9S A;  2PMU A;  4UXN A;  1J9I A;  1P4A A;  2DT5 A;  1SFX A;  3DPT A;  2COM A;  2DAO A;  5DCF A;  4UV9 A;  4AWX B;  1RZ4 A;  3GEZ A;  3WGG A;  4MGR A;  1GXP A;  2VXZ A;  1BI3 A;  3FMQ A;  1W5S A;  4KMU X;  2QZ8 A;  1UB9 A;  2ZCW A;  3JW4 A;  2M87 A;  1E17 A;  1XB4 A;  4GYG A;  3MZY A;  3LA7 A;  3IKT A;  3RJP A;  4F7Z A;  2XIG A;  4H0E A;  1ON2 A;  2PFB A;  4UNO A;  3ISP A;  3W6K B;  5FD6 A;  3FWE A;  1Z05 A;  1ZAR A;  3K2Z A;  1FP1 D;  1G3W A;  3V4G A;  4AD9 A;  1OYW A;  5D4S A;  3O6B B;  3P9C A;  2DK5 A;  2Q2E A;  4I09 A;  2PI0 A;  3I71 A;  2IA2 A;  3VB2 A;  2STW A;  4YFX F;  4EJO A;  1ODD A;  1T39 A;  5HDN A;  2V6C A;  3HHG A;  1QQI A;  1I5Z A;  2BBY A;  5ILV A;  4HX4 A;  1BI0 A;  2NS0 A;  1BI2 A;  3ROU A;  2P6T A;  1SD6 A;  4L9V A;  5DYM A;  5F1R A;  2EV5 A;  4RS8 A;  1PDN C;  2QEN A;  4P9U A;  1HKT A;  3BPX A;  1WRJ A;  1TLH B;  4QLC U;  1IRG A;  3R6S A;  4DQ2 A;  3C1D A;  3F6O A;  1FYM A;  3J80 Z;  5BPD A;  2QBY A;  3PQJ A;  5D5W B;  3QAH A;  2M8E A;  4B8X A;  1RNL A;  1HST A;  5HLI A;  3TDU C;  3DXJ F;  3RPU A;  1BIA A;  3MCZ A;  2NAZ A;  3CUQ A;  4LLG F;  3QPT A;  1I1G A;  2RGV A;  4LMY A;  3CDH A;  5ILU A;  1FWZ A;  2EFP A;  2OQG A;  4U7D A;  1IF1 A;  1W7P B;  2QYO A;  1DPR A;  2M30 A;  3F8M A;  1FLI A;  4HF0 A;  2RNJ A;  1R58 A;  5JFR A;  1GVJ A;  1U6G A;  1AWC A;  4RGX A;  4AIJ A;  2DFI A;  3ABU A;  4RGS A;  2A6E F;  2ZJ2 A;  1ZHF A;  4WXH A;  5LHI A;  1K78 A;  2IT0 A;  1VTN C;  4RB2 C;  2V79 A;  4I02 A;  4JQF A;  1S7O A;  2F5E A;  2W57 A;  4G6Q A;  3QP6 A;  4XLP F;  5H6Q A;  4PGG A;  3RYP A;  1V3F A;  1D8J A;  2D2W A;  2VE8 A;  2TDX A;  2ZME A;  3RKY A;  3IRQ A;  3SFZ A;  2IPQ X;  1ZLJ A;  4RAY A;  1C0W A;  5IT9 Z;  1R22 A;  1PUE E;  4G9Y A;  1R5G A;  4I98 B;  4RB1 A;  2Z9O A;  2DI3 A;  3OV8 A;  1ONV A;  1XSD A;  4A5N A;  3GWZ A;  2RN7 A;  3F3X A;  1OPC A;  3CJN A;  1SMY F;  2JSC A;  3E6D A;  2HWV A;  4KIF A;  5K1Y A;  1HSJ A;  5L3B A;  2LDU A;  2EA4 A;  1HW1 A;  3BWG A;  1FBS A;  2FRH A;  5CVI A;  2FXA A;  2E7X A;  3MWM A;  1ZYR F;  3RTR A;  3NRV A;  4LD5 A;  4UV8 A;  3EYY A;  3GZ6 A;  1ZAO A;  4EM1 A;  2NYX A;  2FNP A;  1MJA A;  5LEJ A;  1XDS A;  1XDU A;  2HDC A;  1QZZ A;  3MQ0 A;  4G7O F;  2J5O A;  5HS7 A;  2O6G E;  2HQN A;  2HR3 A;  1OYY A;  4HQE A;  1LDJ A;  4GXO A;  3IC7 A;  3KP5 A;  5ICE A;  3P7N A;  5BS6 A;  2PN6 A;  2YPR A;  2JTV A;  2E7W A;  5HS8 A;  2CQK A;  3K1N A;  3U9G A;  3WU1 B;  2LKP A;  1HXD A;  3HRU A;  3BDD A;  1FY7 A;  4P9F A;  3MAJ A;  1HKS A;  5FFX A;  3RIR A;  5D4R A;  1F1Z A;  4ESJ A;  3J7A O;  3REO A;  3K69 A;  4BHC A;  3KEQ A;  1U8R A;  1G3T A;  2GXG A;  5K5Q A;  1G3Y A;  3EET A;  2F2E A;  3SZT A;  4RGR A;  4U88 A;  1DP7 P;  4KT5 C;  4S04 A;  4R1H A;  1U78 A;  1V4R A;  3VFZ A;  3CO6 C;  1IXS B;  2ELH A;  1QBJ A;  2G9W A;  1CF7 B;  3GFL A;  3LST A;  3GF2 A;  4G6D A;  2M1B A;  1FC3 A;  5HLG A;  4AVP A;  4OIQ F;  4I2O A;  5HDK A;  3WTY C;  2FNA A;  3QP5 A;  3F23 A;  3KFW X;  1XSV A;  2CFX A;  3HTU A;  5AIP A;  1OKR A;  3WE3 A;  5D6F A;  1STZ A;  3T0Y A;  4OIN F;  1F5T A;  1S29 A;  2EB7 A;  1U5T B;  3GFI A;  1JHH A;  3H92 A;  3BJ6 A;  4ZH4 F;  4OIR F;  5CVJ A;  2NNY A;  4HW0 A;  2Z3Y A;  3TQN A;  3L09 A;  2Z5U A;  1KQ9 A;  2KIU A; 
#chains in the Genus database with same CATH topology
 1TWG J;  2G7H A;  2PJP A;  1LE8 A;  5BNG A;  4MO7 A;  3FXR A;  4Q5S F;  2L02 A;  2BW3 B;  3BTC A;  5D8L B;  1GVD A;  1TWC J;  4AYB N;  5DM7 F;  2HYG D;  1GV2 A;  5C4X J;  1JXS A;  3CCY A;  3H0G J;  1FZP B;  2A3S A;  2X0L A;  3ZQH A;  1FYK A;  4BDZ A;  1B72 A;  4Y7N J;  3L7W A;  1WJF A;  2OU2 A;  1LFB A;  4KN7 X;  1LDK B;  4OOI A;  1YS6 A;  4A2U A;  3QOP A;  2ZXH A;  4J01 A;  1JGG A;  1U3E M;  3HOZ J;  4QSH A;  4IJA A;  1UFM A;  1KYZ A;  2EIJ H;  4HLX A;  5FGM A;  2R92 J;  4A3L J;  3K4B A;  4HG2 A;  3HRS A;  3VDX A;  2ISZ A;  2EBI A;  3T8T A;  1XN7 A;  1ZLK A;  4KDP A;  4I76 A;  2VN2 A;  3GBG A;  3I0T A;  1IN8 A;  2XAJ A;  1YHQ I;  3KP4 A;  4BXU A;  2XGC A;  3VYU B;  2F4O B;  5EG0 A;  2VOO A;  2VOP A;  2L54 A;  3BG7 A;  2QVO A;  2RQP A;  2X9D A;  2FD5 A;  3I4P A;  3JR9 A;  2IGN A;  3UKG A;  3GZ5 A;  4F91 B;  1WJ5 A;  3HSF A;  1Y8R B;  5J47 A;  3M8F A;  5BQT A;  5GAD J;  5KK1 A;  4NQW B;  1JTX A;  1SAX A;  2R5Y B;  5GAG J;  2RC4 A;  2X6X A;  2IS2 A;  3BRO A;  2Q1Z B;  2JVH A;  2ZJP F;  2X1C A;  4KA4 A;  5CYV A;  4N9H A;  2RVC A;  3KP7 A;  3WTS C;  1MZB A;  4IRG A;  2HQ5 A;  4XLN F;  2DYR H;  1IZ1 A;  5D5V B;  4XLE A;  3HUG B;  1MND A;  1DP3 A;  2B9S A;  2Z99 A;  2L3D A;  2M9H A;  2FOW A;  5FFZ A;  4CCO A;  3M9A A;  3K70 C;  2HEO A;  3GTM J;  4UVB A;  2VAS A;  4JX5 A;  3FM5 A;  5ED4 A;  1J5Y A;  2DK8 A;  4BGD A;  2K02 A;  3KIO A;  4M6Y A;  4BY1 J;  4LG0 B;  5CVU A;  1MMN A;  1FIA A;  5FKK A;  5L3D A;  2GOX B;  2H6C A;  2XAH A;  1S9H A;  1JUM A;  4LK0 F;  2LFB A;  4XNF A;  3S1M J;  4A0X A;  2GA1 A;  1WCM J;  5CLS A;  3GLX A;  1JTY A;  4ON0 A;  3HPH A;  1AKH A;  3LSI A;  1XC5 A;  4LG3 A;  3GYH X;  1O3Q A;  1O4X A;  2OBP A;  3B02 A;  1UAA A;  1USS A;  2E1M B;  3K9T A;  4CCK A;  2DTZ A;  4RBO A;  2LY2 A;  4ZJZ A;  3I56 I;  1VF9 A;  1R1T A;  3CCE I;  2HPM A;  5FLX K;  3E97 A;  1YX3 A;  5D6E A;  1AU7 A;  1MDM B;  2NOJ B;  4DOZ A;  2Y31 A;  4O5V A;  1OIS A;  1A6I A;  4PSW A;  2DDB A;  5KVR A;  4ESB A;  2VKD A;  1JKO C;  2OF7 A;  1VQ6 I;  1DPU A;  3GLL A;  1VQK I;  4M3F A;  2JPB A;  2ZNZ A;  4RGU A;  5F04 A;  3V42 A;  5FRM A;  2K3F A;  1S7A A;  2F4M B;  3RSN A;  2AS5 F;  3HTS B;  5C4J J;  2Y2Z A;  1WJA A;  2JN6 A;  2M0M A;  4ZZL A;  1ZGW A;  4F93 B;  3GFM A;  1BJA A;  3DFG A;  1W1W E;  2FSW A;  2KMU A;  4KYW A;  2W25 A;  5GPA A;  1D0Z A;  3G1O A;  3W3C A;  2JJ7 A;  5TJJ A;  4U0Y A;  2RDP A;  4EM2 A;  3PSF A;  2UZK A;  2G7U A;  2L4A A;  1B1B A;  3DKX A;  5J8C A;  1HLV A;  2WY8 Q;  5D8K B;  4YIF A;  3C2H A;  2XAG A;  3TKY A;  1IJW C;  3KE2 A;  1KU7 A;  4MNU A;  2GLO A;  1BOA A;  3BG6 A;  4XOP A;  2K27 A;  1FMW A;  2IP2 A;  2BZT A;  1IC8 A;  2KT0 A;  3HOT A;  5DD8 A;  4E70 A;  3CCS I;  4LIT A;  3LA3 A;  2JA7 J;  2VXD A;  1IAW A;  2R3S A;  1B8I B;  2STT A;  3LQR A;  4C3I J;  2IA1 A;  4P1W A;  3ZMT A;  4O3M A;  2KDO A;  2P5L C;  2DA5 A;  2KIS A;  3W6V A;  1G3S A;  1F36 A;  2IGO A;  5B3S H;  2FMY A;  4KMF A;  1RI7 A;  5DV5 A;  2KRC A;  1R49 A;  5J1Y A;  1ZG1 A;  2NNN A;  1JI8 A;  3AAF A;  2KKO A;  2M45 A;  2R7X A;  3ASO H;  9ANT A;  4U0W A;  2XKP A;  2XAF A;  4X6A J;  4ZC3 A;  1B9N A;  1GXQ A;  3ABT A;  1YFH A;  4KIB A;  2MLK A;  4L18 B;  3PO3 J;  1SVO A;  3Q0U A;  1SFU A;  1VZ0 A;  1JT6 A;  1WSU A;  3M1E A;  2F5C A;  3MZ8 A;  4MTE A;  2DMT A;  4CYC B;  1X4P A;  3BJA A;  4M6X A;  4OAY A;  1IUY A;  3HGG A;  2DQL A;  3MEX A;  3O2P E;  3ZQF A;  4XN0 A;  5HS9 A;  5A2Q Z;  1W0U A;  1YG2 A;  1SD7 A;  3QPS A;  1O3S A;  4PUS A;  2X6Y A;  2XPV A;  3BZK A;  2BEO A;  1W36 C;  2LKS A;  2VBZ A;  4XRF A;  3LFU A;  3FK7 A;  1LUJ B;  3IV5 A;  1N25 A;  3BCA A;  1DQU A;  4N4O B;  3J7A Y;  1IN5 A;  4IHV A;  1IDY A;  4XOR A;  4BQA A;  2HFH A;  1ZG3 A;  3OYE A;  3HM5 A;  1R5H A;  3WOD F;  2HVR A;  2IS1 A;  3WU2 C;  5M5X J;  3BOQ A;  2QSF X;  3KCC A;  2QQ8 A;  1LB2 A;  3I5U A;  1S72 I;  2DOF A;  2EZI A;  2JRT A;  3OL4 A;  5IYD J;  3ERE D;  3FF5 A;  3OIP A;  4ESF A;  2VT3 A;  2HPI A;  3IAS 2;  3CMY A;  1Y0N A;  4PJM A;  4J00 A;  2XSD C;  1NG6 A;  2XF6 A;  1BN5 A;  5J4Y A;  2QQ9 A;  2LOO A;  4B4C A;  4JOM A;  1FSH A;  1YQA A;  1ETY A;  5IPA A;  4LLN A;  2BGC A;  1EF4 A;  3I54 A;  1ENH A;  3JRG A;  2X1D A;  2QM3 A;  3H5R A;  1RKW A;  3IKV A;  3KZI C;  4R79 A;  1DGR M;  1EV7 A;  1UCR A;  3IHU A;  3I4M J;  3BQY A;  3Q5F A;  2V1D A;  5DTD A;  1LFU P;  2F5V A;  1YW7 A;  3ESW B;  5FB2 A;  3HIF A;  2EFW A;  4UUS A;  1FIP A;  1TWF J;  2BY3 A;  2LKX A;  2FEZ A;  2GXA A;  3V8K A;  1LQ1 A;  2JWT A;  2WY7 Q;  3F9K A;  3E6M A;  2B0L A;  2E35 A;  1R00 A;  5JLX A;  2C6Y A;  1RR7 A;  3QU3 A;  2HTJ A;  3F8C A;  2PMZ N;  5ERI A;  4CO8 A;  1R23 A;  1TNS A;  5C44 J;  3HB9 A;  1Z7L A;  3G2B A;  5L3C A;  2YU9 J;  1ON1 A;  3TOB A;  3W2W A;  1IXR C;  2R7S A;  2KJB A;  2HVQ A;  2VON A;  2NS8 A;  2AXL A;  1KA8 A;  4Y13 A;  2GZW A;  1YO5 C;  3Q0W A;  2EWN A;  1IN4 A;  1X2M A;  1OMI A;  1S5L C;  4B44 A;  4ZZD A;  2QBY B;  1BR2 A;  3K70 D;  4HDU A;  2DO7 A;  1B4A A;  3PNV A;  1X3Z B;  4UB8 C;  1SAU A;  2M5W A;  2E5N A;  2EZL A;  3J81 Z;  1FT9 A;  4WX9 A;  3CUQ B;  1PP7 U;  5HOD A;  2FOK A;  5JVG F;  2K4B A;  5F64 A;  4GO1 A;  2K9S A;  1QA6 A;  2GQQ A;  1MMS A;  1XD7 A;  3FHN A;  1F43 A;  2XF5 A;  4HZF A;  4U0V A;  2F6C A;  3KP3 A;  3KZY A;  1RES A;  3TGN A;  2D1H A;  2Y0S N;  4DW6 A;  5M3M J;  3LSP A;  2LY1 A;  2JPC A;  3KZZ A;  4FIS A;  3DWL E;  1GDT A;  5DCM A;  3J80 K;  3H5N A;  1WI9 A;  3ZQ7 A;  4WWC A;  1EJ9 A;  2W82 A;  4AYB A;  3K10 A;  4FHT A;  3GW2 A;  2OC6 A;  3S14 J;  1W4M A;  2HI3 A;  4CHU A;  4P96 A;  2M7B A;  2MAB A;  3HSR A;  4RB0 A;  3WG7 H;  4S0H B;  4ENN A;  4XMY A;  4E7Z A;  2O9L A;  4A3D J;  2DA6 A;  2DDA A;  3ELK A;  4HX7 A;  4QPQ A;  4BQN A;  3OS2 A;  1A36 A;  4E7L A;  1BJZ A;  3SXY A;  3M4O J;  1MJ9 A;  1SMT A;  2Z33 A;  4A0Y A;  3CJQ B;  4RAZ A;  4FT8 A;  1WFX A;  5F27 A;  5J4V A;  1DGW Y;  1OFC X;  3QYE A;  5LRS A;  1L3L A;  4M9Z A;  1IN6 A;  2ETH A;  2EZK A;  2JUG A;  4FE4 A;  3ZQG A;  2LG4 A;  2KLO A;  4B09 A;  4LJZ F;  3ZN0 A;  5J1R A;  2O8X A;  5ICF A;  4XLA A;  1KQ8 A;  5D5U B;  4C2U A;  3DV8 A;  1HDD C;  3GXO A;  2HDD A;  2AQE A;  5FKO A;  3HBL A;  4NBQ A;  2GM4 A;  2L7F P;  2ZFU A;  1XMX A;  2YX4 A;  3TO6 A;  3QPL A;  2ZME B;  2GIZ A;  3QOE A;  2DT6 A;  5JLW A;  2W7N A;  3TED A;  4FX0 A;  3HOY J;  4Y15 A;  2DBB A;  4G7Z F;  5LGU A;  2E1O A;  2KJC A;  2E71 A;  2Y30 A;  2VQL A;  3J7Y J;  1Q1H A;  1FBQ A;  2DPD A;  3P9I A;  3FXU A;  1LDD A;  2LTP A;  4E7H A;  2VBX A;  3G1L A;  4RM2 A;  4F92 B;  2M0C A;  4EJW A;  4KIC A;  5LGN A;  1HW2 A;  2FU4 A;  2ADU A;  3KEY A;  2NVT J;  4BEH B;  4FAS D;  3BR6 A;  4A69 C;  1TT0 A;  2HVS A;  1XG1 A;  2GOM A;  1SFE A;  5B1B H;  1MIJ A;  2QUF A;  4BJT A;  2M3A A;  3DBL B;  3HL2 A;  2LSO A;  3CCM I;  5E1X A;  4HBL A;  2QEX I;  2KQR A;  1HQC A;  5GAH J;  5IT9 K;  3DEW A;  1UHW A;  1POG A;  2DA4 A;  1GV5 A;  5GAE J;  3C3W A;  5LEK A;  2GXB A;  4PJL A;  3PQK A;  4HST A;  2FX0 A;  3N4M A;  3HSE A;  2GWR A;  2L9R A;  4B1R A;  1VQO I;  3GTP J;  2HNH A;  2V9V A;  4N4N B;  1FYL A;  3A01 B;  3BCB A;  2PLY A;  4HF2 A;  3OMY A;  4S05 A;  1JHF A;  5EEH A;  4DZP A;  3FHZ A;  1FSE A;  1KZH A;  1OR7 C;  2DOD A;  1IRF A;  4X0G A;  5E18 F;  2OQR A;  5F08 A;  1ZQ3 P;  4L5I A;  3JTG A;  1A6Q A;  3RCO A;  1MMD A;  5DEQ A;  2EH3 A;  1L0O C;  5B66 C;  3DCF A;  3H35 A;  5E3M A;  5FD5 A;  5E17 F;  5ICC A;  2DOA A;  3F21 A;  2V9P A;  2LR8 A;  4MTD A;  4DGW B;  4XKC A;  4KUM A;  1FJL A;  4HV6 A;  4IHT A;  1TQM A;  2XDV A;  5HLT A;  2FBK A;  3V8J A;  3DQV C;  4M3D A;  1BI1 A;  1ZKG A;  3BJO A;  1IRZ A;  5EEA A;  1G8X A;  1GT0 C;  3BG9 A;  2E1N A;  1D0X A;  1X2N A;  2V1U A;  1ZN2 A;  4HF1 A;  2CGP A;  3BG5 A;  1MBF A;  2GAU A;  1CF7 A;  2OTJ I;  4YFK F;  3Q9V A;  4XIC A;  3EUA A;  5L3E A;  5DS9 A;  3F8F A;  1NH3 A;  3ASN H;  4E7J A;  3FBI B;  3K4C A;  1Z6R A;  1BR4 A;  5E1Z B;  3K1P A;  4A0Z A;  3N97 A;  2DU9 A;  3DKW A;  1R5I D;  1QZY A;  3IWZ A;  3KX2 A;  3PFY A;  2A6H F;  1MNM C;  2GBY A;  5E79 C;  3K4K A;  3JAM Z;  3MKZ A;  3PJR A;  5GP9 A;  3CC7 I;  3ZPL A;  3IWF A;  3SEQ A;  4KJZ A;  3RDI A;  1Y0U A;  1LEB A;  2NVU B;  3G3Z A;  2EZH A;  2ZO4 A;  4V2F A;  3FXJ A;  1OCP A;  1HKQ A;  3JRB A;  1JJ6 C;  2PBI A;  3IH2 A;  4BE2 A;  2CV1 A;  2IA0 A;  5EEG A;  5E8I A;  1O7L A;  2H6B A;  5TRD A;  3I59 B;  4ZYA A;  2UUZ A;  3C7J A;  4M73 A;  4FX4 A;  5C3E J;  4XM3 A;  3FKI J;  4IPA A;  4G94 A;  3TMO A;  5EGO A;  2EFN A;  5H20 A;  3R61 A;  4UVC A;  1R1V A;  2R5Z A;  3LSM A;  1YIO A;  3CC4 I;  1RPW A;  3JTH A;  1FBU A;  2H09 A;  2P8T A;  2DJI A;  4G8X A;  1ZRE A;  2JA2 A;  1D8K A;  1HDP A;  2DMU A;  2ICW G;  2LBF B;  4GYI A;  1YW9 A;  5EDN A;  1FP2 A;  2OPT A;  3W2A A;  1FOK A;  4FTH A;  5FLV A;  2ZC2 A;  1NK2 P;  4HAM A;  2BW3 A;  3AG1 H;  3HYI A;  3OYH A;  1X1B A;  2CO5 A;  2H94 A;  2EIM H;  5LBQ A;  1XGO A;  1G6N A;  4XKB A;  4ENK A;  2X4H A;  4ENM A;  4F3Q A;  4RMN A;  3U1D A;  2LLK A;  2WAE A;  4BHP A;  2BXY A;  1K61 A;  4A3K J;  5JHF A;  3L9F A;  3IRR A;  4EGZ A;  1FEX A;  4J19 A;  3S1N J;  1BC7 C;  1T33 A;  1ZK8 A;  4BS9 A;  3HXL A;  3LAJ A;  3H1C A;  1OYI A;  5LFA A;  4YG2 F;  5HNH A;  5JHU A;  4IRH A;  1RET A;  4ETS A;  5JR3 A;  4FQG A;  1APL C;  2VT2 A;  2MH2 A;  1YJ9 I;  1T38 A;  1K6Y A;  2EIK H;  4HA8 A;  4W97 A;  2JVG A;  3ZGK A;  2XUB A;  3E5Q A;  5CQG A;  1K4T A;  3ABM H;  5HOO A;  2ZBK A;  1J0R A;  3JRD A;  1YJW I;  1IXC A;  2XAS A;  2VKH A;  1ZRD A;  3JRI A;  3GFJ A;  4JK1 X;  4PJ0 C;  3LFK A;  4A12 A;  3OIQ A;  2A07 F;  4HV5 A;  1LNW A;  2BOL A;  1S7E A;  1LE8 B;  5BPI A;  1OCO H;  1OCR H;  2E19 A;  1BW5 A;  3V7R A;  2PMZ A;  4BJ5 C;  1DDN A;  2M34 A;  2R7D A;  4M3B A;  3CP2 A;  2FUG 2;  4BXX J;  3LWF A;  3WGI A;  2HS5 A;  1OJL A;  2A69 F;  1B72 B;  1XMK A;  4X1E A;  2EV6 A;  1FOW A;  3GTO J;  3GZN B;  2Y75 A;  3QWL A;  2KIQ A;  2V9K A;  4ZYE A;  1T8I A;  3S1Q J;  4A5M A;  4R8H A;  4O6J A;  2JA5 J;  1MGT A;  5BOX A;  1ETW A;  2ACJ A;  3SHF A;  2XKO A;  4WK8 F;  1WJD A;  3ZMZ A;  2QQA A;  4LG0 A;  2CW8 A;  3CJR B;  4M74 A;  2K5C A;  2XGD A;  3G4S I;  4II3 A;  2PG4 A;  1LKX A;  2DW4 A;  2L9N A;  2VUM J;  1RC9 A;  1X1D A;  2BY0 A;  2M4G A;  3F0C A;  3BR0 A;  5E3L A;  1EH8 A;  1WWX A;  2KPM A;  3DPL C;  1GLN A;  2KIF A;  3IL2 A;  2CW7 A;  2OD5 A;  2ZKZ A;  4HNV A;  2LF8 A;  3VOD A;  5DDG A;  5HNF A;  3K4M A;  4ASN A;  2Y0S A;  3S1R J;  3PUB A;  2Q8K A;  2EK5 A;  1R4M B;  2CQQ A;  2ZXJ A;  3I64 A;  1JUS A;  1D0Y A;  3FMR A;  2AQF A;  3Q0V A;  3S8P A;  4EJV A;  3EUH C;  3FX3 A;  2Y0M A;  3KET A;  4CIC A;  1VI0 A;  4BBR J;  3E3V A;  4LGW A;  3CF2 A;  3IH4 A;  3C18 A;  4AUX A;  1MDM A;  2VC0 A;  2H1K A;  4UHT A;  2BYV E;  3WTV C;  2IEK A;  1S3J A;  3HRM A;  2ZFW A;  3LSG A;  1JKQ C;  2NRA C;  2OZ6 A;  3VEP A;  1MJB A;  4EM0 B;  3GTJ J;  1T98 A;  2JZY A;  2XGX A;  4WXD A;  3F8B A;  4XN3 A;  3MZH A;  1KU2 A;  2R7U A;  1TW3 A;  4BE1 A;  2DFH A;  2E2H J;  3BR1 A;  3BP8 A;  2EJR A;  4ZDL A;  4Y52 J;  3CLO A;  2K40 A;  1FMV A;  2FML A;  4I01 A;  3H9G A;  4C3H J;  4AIK A;  1K7A A;  3R4K A;  4XSZ F;  2B7E A;  2KHM A;  2OUM A;  3HHH A;  3VSL A;  1XPX A;  4WCG A;  1IV8 A;  4ZTF A;  2PX9 A;  1RRJ A;  1E2X A;  5B5E C;  1KQ0 A;  1K6O A;  1D1C A;  4L0Y B;  4RB3 C;  3ML6 A;  2VBW A;  4N9I A;  1AKH B;  3HG9 A;  1HCR A;  1TP4 A;  4MEY F;  1B6A A;  3SQN A;  3BTI A;  3BLY A;  3TBI A;  2PQ8 A;  4Y3O A;  4AIH A;  4BY7 J;  1A04 A;  1NTC A;  2E1C A;  1V54 H;  3GUD A;  3OR2 C;  1MBE A;  4A6D A;  3HOS A;  1P4W A;  2D45 A;  1WGX A;  1NK3 P;  1P7J A;  5LHG A;  2EIN H;  2PJR A;  3G1M A;  1B8I A;  2OCC H;  2JT1 A;  3RZD J;  1XGS A;  2VQC A;  2R0Q C;  3E6B A;  2QGU A;  5LGT A;  2W85 A;  4LK1 F;  1TZL A;  1W7P D;  2JUC A;  5AIQ A;  4CGZ A;  5M3F J;  5IYB J;  2JRM A;  3S3O A;  1QVT A;  1X1A A;  3M8E A;  3ZR8 X;  4BHB A;  2QA4 I;  3DTK A;  2VB6 A;  2FA5 A;  3BPV A;  4D9J A;  3CCL I;  4GCV A;  3VSK A;  1UST A;  1SD4 A;  3AL0 B;  2X6W A;  4N0B A;  3E0J B;  1FOY A;  3OWT A;  1ZEL A;  3EUK L;  1WJC A;  2HXI A;  4B3X A;  1U5T C;  1EH7 A;  3CME I;  4OMY A;  3R60 A;  3PO2 J;  2MBF A;  4CYC A;  1ZH5 A;  1Y8Q B;  1Z77 A;  2LK2 A;  3TO7 A;  2K7L A;  3DLL F;  2VKV A;  2G0E A;  3TOA A;  3AG3 H;  1IG7 A;  3DP7 A;  3KP6 A;  5J3L A;  3NEU A;  4BJ6 C;  2XB0 X;  1ETK A;  4MEX F;  1XGM A;  3UR3 C;  4HLY A;  4KIT B;  1TTY A;  2V4J C;  3LSH A;  3IH3 A;  4V2G A;  3KLN A;  1ETQ A;  4G7H F;  2DTR A;  4UUV A;  1W5C C;  4LIU A;  3GVA A;  2IJL A;  3COA C;  3DBR B;  2B63 J;  1WKM A;  1FPQ A;  1T0F C;  2EV0 A;  3FZV A;  2P7C B;  4BL0 B;  3DU6 A;  1O7F A;  4A3I J;  3CO7 C;  1J59 A;  2IAI A;  2DA2 A;  1LEA A;  5EF6 A;  3FIS A;  2MC3 A;  2J5P A;  1T08 B;  2P0W A;  4PSX A;  4DZJ A;  4Q47 A;  3QYF A;  2CYY A;  3E6C C;  4L9N A;  5FLM J;  1OR7 A;  4ZYG A;  1RKT A;  1SVM A;  3QU6 A;  4DYQ A;  1YS7 A;  2L01 A;  2WV0 A;  1REP C;  3ZMV A;  1YX5 A;  1RR8 C;  3KPH A;  1UJ8 A;  2RV8 A;  1B59 A;  2BY2 A;  3H36 A;  2ME6 A;  2KDZ A;  5IYC J;  3L2C A;  1JKR C;  4IXA A;  5H2F C;  3VWB A;  3FXO A;  1HBX G;  1ZG5 A;  4FCY A;  4MQ9 F;  3OSF A;  3K4N A;  3VPR A;  1JGS A;  3F72 A;  4P55 A;  3H5A A;  2Q2E B;  2CQ7 A;  4M6V A;  2QLZ A;  4D1Q A;  4BE0 A;  1Z1D A;  3K4L A;  2Y69 H;  3WTT C;  4BNC A;  1TQP A;  3A2K A;  1I27 A;  3K0L A;  3PM1 A;  2XF7 A;  4KNY A;  2UXN A;  1GUU A;  3D1N I;  4HSR A;  2O61 A;  4B48 A;  2FQ3 A;  3BR3 A;  1MBG A;  3CCJ I;  1R1U A;  1TT5 B;  4DBQ A;  3FMS A;  1O3T A;  5A2Q K;  2F5D A;  1AHD P;  3T5X A;  1FTZ A;  3A1Y A;  1W7P A;  3A4C A;  2CV0 A;  4NHJ A;  3DLA A;  2M7A A;  2AHQ A;  1VQ9 I;  2K9Q A;  2MD0 A;  5IOY A;  4Y17 A;  2W00 A;  4U7B A;  1MD0 A;  5CVV A;  3ZMS A;  1YRN A;  4L0Z B;  1P92 A;  5IP9 J;  3F6V A;  4YII A;  3W2V A;  3RI4 A;  2E36 A;  1DU0 A;  3X2Q H;  4EEF G;  3PFI A;  4FET A;  3H0D A;  4CUG A;  1JKP C;  3WG9 A;  1TWA J;  2P5V A;  1TL8 A;  1TW2 A;  2Z16 A;  4BDY A;  1Z6T A;  2O5R A;  3LAP A;  2BVM A;  2BXZ A;  1Z7U A;  3U2R A;  2XRN A;  4BBS J;  3JSP A;  3D0S A;  2MH9 A;  3AG2 H;  2E1M C;  2VJI A;  5L3F A;  2OCE A;  1QHG A;  4HX8 A;  2VOD A;  1R4N B;  3WE2 A;  2ZSI B;  4D5F A;  5JVT A;  4QWQ A;  4IRI A;  3KEO A;  1MSF C;  2XV4 S;  1IN7 A;  4UUS B;  4BH9 A;  1SVL A;  1YTY A;  1V5F A;  5F0H A;  2ID3 A;  4IHS A;  4P5O A;  1VQ7 I;  1TNT A;  5DD4 A;  2VE9 A;  2BY1 A;  2WAD A;  3SZG A;  1M1E B;  3WGH A;  4HQM A;  4IVN A;  1X19 A;  5E8G A;  5FO5 A;  2XAQ A;  3Q9S A;  1IV6 A;  3CC2 I;  4OIO F;  1DUX C;  1I1S A;  2N8G A;  1TC3 C;  3LSR A;  3W6J B;  2O0Y A;  3OYK A;  4AM3 A;  4EMS A;  1Z91 A;  1TQI A;  3O8G A;  1UG0 A;  4C3J J;  3CCR I;  3L2W A;  5E1W A;  3MD2 A;  4M71 A;  3RKX A;  4HDV A;  2HQR A;  4KIG A;  1JJ8 C;  2ZNY A;  1D5Y A;  1WQ2 A;  3K1M A;  3MN2 A;  4CZZ A;  3CMA I;  4XQF A;  3CMM A;  1K83 J;  2JA6 J;  5KNL A;  1Y6I A;  2A68 F;  1QHH D;  4LFU A;  3JRF A;  4XSX F;  3GTK J;  2YR2 A;  2HZT A;  4LB6 B;  1BC8 C;  4A6E A;  3S32 A;  4BKX A;  4YEJ A;  2R7W A;  4HRI A;  3I58 A;  4HEA 2;  3DBH B;  3OYL A;  1VQ5 I;  1XCV A;  5FKM A;  5M5Y J;  4GGG A;  3QPH A;  3L2Q A;  1WJE A;  1K78 B;  1VND A;  2X51 A;  3GO5 A;  1JE8 A;  1K79 A;  2L9S A;  5DCM B;  2XRO A;  1ITY A;  1OCT C;  2JK3 A;  4MHG A;  3MFK A;  2GA2 A;  4HPQ A;  5KCM A;  1HW5 A;  1ACI A;  2HOA A;  3BC8 A;  5CVR A;  2XHK A;  4L9T A;  2R7F A;  3J81 K;  1VQ8 I;  1BBY A;  4M9X A;  1U8B A;  3OYI A;  4D5C A;  4KFC A;  4M72 A;  1U2W A;  5D5X B;  1SC7 A;  2IRF G;  4Z2Y A;  1ORK A;  3VYT B;  1SD5 A;  2F5F A;  4GRI A;  3HGY A;  4BEH A;  3RYR A;  3T8R A;  5KAF C;  1MH3 A;  3ULQ B;  1J2X A;  2Q0O A;  3WTX C;  2VQG A;  3OIO A;  5DM6 F;  4C2T A;  4CXF A;  3HRT A;  3ZP5 A;  3JRA A;  5F1J A;  2A05 A;  3H3U A;  3R0J A;  4Q48 A;  1VQL I;  3ABL H;  2EFO A;  2WA0 A;  3OS0 A;  2M2E A;  2MSY A;  1S8N A;  4LB5 A;  4GDF A;  3R0A A;  2LNB A;  4E7K A;  2RNG A;  3H9Q A;  1Z3X A;  2DQR A;  4PJN A;  3T1B A;  3FXL A;  5JI6 A;  4UVA A;  1SEU A;  3VYR B;  1Z3Y A;  1S6L A;  1OQY A;  3DTE A;  4BYY A;  2L2O A;  2KRH A;  2VJ4 A;  5TGT A;  3FDY A;  3TL4 X;  1VQN I;  1RIO H;  2VBY A;  1Z9C A;  4EVI A;  4ZDP A;  2D1V A;  3V7C A;  5IT3 A;  4QTR A;  2P7V B;  1XGN A;  3O8H A;  1ZRF A;  2L0K A;  3QYB A;  4PZJ A;  2P5K A;  3GCM A;  2LF7 A;  4BQQ A;  3EUH A;  2FJ1 A;  3SZP A;  1XMA A;  4EQQ A;  4CZC A;  2FBI A;  2ESN A;  3F8N A;  3FXK A;  4XBF A;  4EV0 A;  3WTW C;  3CP8 A;  3A0B C;  1P7I A;  4E7S A;  2MGQ A;  3MMY B;  3QQA A;  2K9L A;  1UHS A;  2DFF A;  3FM3 A;  5E3N A;  1MMG A;  3LMM A;  2MD5 A;  3SYT A;  1PUF A;  3K7A J;  1X1P A;  3ABK H;  1D1B A;  2MA3 A;  2O3F A;  5J6X A;  1O3R A;  1D1A A;  4KN4 X;  4NB5 A;  5ICG A;  3WTZ A;  4JBA A;  4KIS A;  3OYA A;  5HDG A;  3OOU A;  4XKV A;  3V8L A;  2ZSH B;  1YE9 A;  1ZGA A;  5FKN A;  4IHY A;  3ECO A;  2BV6 A;  4XL9 A;  2HKO A;  1ULY A;  4WF2 A;  3NWT A;  4E6K G;  2DA1 A;  2PEX A;  4OU0 A;  3WU0 A;  1IDZ A;  1ZGJ A;  3ZN1 A;  1P2F A;  2OV7 A;  3KYC B;  2VPL A;  3FXQ A;  4YEL A;  5BMZ A;  4F52 A;  2DT7 B;  3P5J A;  1LVA A;  2DLL A;  4ITV A;  2Z2S B;  2MLG A;  3D5L A;  3ZMU A;  5HVQ C;  1WH7 A;  2XRL A;  1WPK A;  4OIP F;  1ERD A;  2YU3 A;  3RPQ A;  2CU7 A;  2DN0 A;  4D0P A;  2WBM A;  1G4D A;  2VC1 A;  4KT6 A;  2NXN B;  3JRE A;  1N77 A;  3OOP A;  3S15 J;  3TDZ C;  4OMZ A;  4JX6 A;  3EDP A;  3EPZ A;  3AG4 H;  2RRE A;  2QCO A;  1QO0 D;  1NHA A;  3BZC A;  2DMN A;  2QSG X;  3KYD B;  4QIW N;  2YX7 A;  2A5Y B;  1P4X A;  4MQV A;  3B73 A;  3DEU A;  3I59 A;  3NAR A;  1YW8 A;  4IZZ A;  2V1X A;  2A61 A;  1BL0 A;  2WWY A;  2DMQ A;  2O03 A;  5M5W J;  1R71 A;  3CUQ C;  2QQB A;  3V7S A;  2P4W A;  2V6E A;  5K5O A;  3U1K A;  1KON A;  3CZ6 A;  4W1U A;  2CQX A;  1U5T A;  5B1A H;  3ZXS A;  1ZTR A;  4PCQ A;  3DEE A;  4IOC F;  1D3Y A;  1TWH J;  2W24 A;  3HOW J;  3H3Z A;  1QGP A;  2KP6 A;  4NUB A;  3OYD A;  2CSO A;  1Y39 A;  2XVC A;  2OA4 A;  4M3E A;  4NC6 A;  4PDK A;  2YUS A;  3CCQ I;  1P9Q C;  3KYL A;  3HOX J;  2JMW A;  2NVY J;  1HA8 A;  3GTQ J;  1P6R A;  5LRR A;  3DTI A;  1SFK A;  2IVM A;  1R36 A;  1EA3 A;  2K4J A;  4DNC A;  5LLQ A;  3LA2 A;  3JRC A;  4A3C J;  2RKH A;  2XPW A;  2MC4 A;  3DF8 A;  3PNT A;  4I7H A;  3TO9 A;  2E2J J;  1B9M A;  3P9K A;  5IP6 A;  2VJ5 A;  4ZYD A;  3K4J A;  1T0F A;  1SAN A;  4XR6 A;  5LHH A;  1D5V A;  2R7V A;  1VFC A;  5GTH C;  1QPM A;  2K86 A;  1TBX A;  5AON A;  2BVL A;  3PIP F;  2R7R A;  3JAM K;  1F9N A;  3BT9 A;  3WHB A;  3HOU J;  1N78 A;  3ZMD A;  1MKM A;  2R5Z B;  3SFI A;  1ZRC A;  4ABZ A;  4OWR B;  3OYM A;  1FX7 A;  2Y9Y A;  2QWW A;  4WXC A;  1V5E A;  3CDL A;  3KP2 A;  1AOY A;  1R9T J;  4NC7 A;  2EA2 A;  2LMD A;  4K2E A;  2XB5 A;  5K5R A;  3OYF A;  2LY9 A;  2EFQ A;  2KIM A;  3O3K A;  5EZG A;  2BE5 F;  3G73 A;  5HLH A;  3ZQQ A;  2FBH A;  4U87 A;  2DPU A;  3E5X A;  1LVK A;  4LOC A;  2CWE A;  2OAZ A;  2ZME C;  4DBR A;  2M8G X;  2MYS A;  4BU2 A;  1K4S A;  1H9G A;  4BXF A;  1T2K A;  3CCU I;  4Q4Z F;  4NNJ A;  2R93 J;  5J40 A;  3BY6 A;  5CQE A;  4XID A;  2O7O A;  5GPC A;  5F6F A;  3VOE A;  5H6R A;  4AU7 A;  2L4M A;  4LLL A;  5LD2 C;  1YIT I;  4NQW A;  2R5Y A;  2HTS A;  2HDW A;  4MFE A;  2H8R A;  1IW7 F;  2OZU A;  4L5J A;  3BR2 A;  6PAX A;  5E20 A;  3ZOB A;  1H9T A;  4PGH A;  4EJT A;  1BOB A;  4IKF A;  4ENJ A;  1EKE A;  2E60 A;  3GTG J;  2WTE A;  3HUG A;  4YFN F;  3CCV I;  2HOT A;  1XSX A;  1XCB A;  1A5J A;  3EQL F;  4XLF A;  2JSP A;  1MH4 A;  5EZH A;  1UEL B;  4EAT A;  1XTA A;  2WC2 A;  1KYW A;  4HYE A;  1F4K A;  4UY8 I;  3LQQ A;  3CQZ J;  5FLX Z;  3I53 A;  3RQI A;  4ANJ A;  3F22 A;  2MW8 A;  2F48 A;  2GIV A;  3E5U A;  4I0B A;  2DJN A;  2FF4 A;  1HC8 A;  2HZD A;  2UXX A;  1EH6 A;  1IGN A;  1UHM A;  3CTA A;  3OS1 A;  2HYF A;  4I0A A;  2EIL H;  5K7H A;  1MSE C;  3HKZ N;  5F0F A;  2K3P A;  2Y48 A;  2VL8 A;  5EG0 B;  2ZJR F;  1AA7 A;  2KZG A;  1KU9 A;  1LJ9 A;  3C2B A;  5J8F A;  1R7J A;  2QKL B;  3NQO A;  1RUO A;  2WB1 N;  3L00 A;  3BZ6 A;  2H8W A;  4Y4R A;  2HXO A;  2LC2 A;  2ISY A;  3M7G A;  3M3Y J;  3TW6 A;  1YYV A;  2XAU A;  1WJB A;  2HGC A;  3HJE A;  2X85 A;  2YSR A;  1CGP A;  1GHC A;  2NVX J;  1BR1 A;  3E7L A;  3G71 I;  4BAC A;  1QZE A;  2VI6 A;  2ZXI A;  1J7K A;  2XSJ C;  1PP8 F;  3S2D J;  1HF0 A;  3RKW A;  1BM9 A;  1FNN A;  1I6X A;  3S2W A;  4BAY A;  1KU3 A;  4IF4 A;  2HKX A;  4CYD A;  2VLA A;  2CRG A;  2DMP A;  2EPF A;  3ECH A;  3JSO A;  1QNT A;  4XLH A;  3A03 A;  5CJ9 A;  2WAF A;  5ILS A;  3KLO A;  2WAQ N;  2COB A;  3BQZ A;  3PIO F;  2H27 A;  4L9J A;  3QRF F;  3FK6 A;  5L3G A;  3I3L A;  3QOD A;  1T6S A;  1WHU A;  1YLF A;  2LRD A;  3SJM A;  2A5W A;  5IP7 J;  4EGY A;  2CJJ A;  4CDG A;  5DUI A;  1W5T A;  1Q1V A;  1U0J A;  4B43 A;  2CW0 F;  2R7O A;  3CUO A;  5GTI C;  4HOB A;  2HOE A;  2AXT C;  2I5U A;  4D7N A;  1E0E A;  3GX4 X;  3WTU C;  1KGS A;  3ZQI A;  2UWM A;  2CUZ A;  2IGK A;  4D7M A;  5FRN A;  2FE3 A;  2KRF A;  4MLO A;  2QF7 A;  2IW5 A;  5DUK A;  2W84 A;  1O57 A;  2CFO A;  4ZYH A;  3EYI A;  2P6S A;  1X3U A;  1ZR4 A;  4EJU A;  1J75 A;  1RUN A;  1H0M A;  4TV7 A;  1XS9 A;  4C30 A;  3ERM A;  3CF5 F;  1BIB A;  1T95 A;  2CG4 A;  2ESH A;  2TRT A;  4XLC A;  1X3W B;  2PMH A;  2X48 A;  3D5S C;  4M9S A;  2PMU A;  3OSG A;  3MKL A;  4UXN A;  4M3G A;  1J9I A;  1P4A A;  2DT5 A;  1ETO A;  1SFX A;  3DPT A;  3RPU D;  2COM A;  4XK4 A;  2DAO A;  5DCF A;  4UV9 A;  4AWX B;  4LIV A;  4ZDO A;  4NC8 A;  1RZ4 A;  2O8K A;  2IBD A;  1E3P A;  4UUT A;  3GEZ A;  2PJR B;  3U21 A;  1E3H A;  3WGG A;  3OYN A;  3S16 J;  2DA7 A;  4MGR A;  4FE7 A;  1GXP A;  2VXZ A;  1BI3 A;  3FMQ A;  1ETV A;  1W5S A;  4KMU X;  2QZ8 A;  2W48 A;  1UB9 A;  1R6R A;  1BW6 A;  2ZCW A;  3JW4 A;  5EJC A;  4Z6Y A;  3SDG A;  3HPG A;  3OY9 A;  2M87 A;  3ZQC A;  1E17 A;  4IHX A;  1XB4 A;  3A0H C;  2CUJ A;  2R4G A;  4GYG A;  4V19 K;  3MZY A;  1X58 A;  2L7K A;  3LA7 A;  3HZJ A;  4I99 C;  2X6O A;  3CLQ A;  3RJP A;  3IKT A;  4F7Z A;  2XIG A;  1X1C A;  2R7Z J;  4H0E A;  5FRO A;  2MFZ A;  1ON2 A;  2ECB A;  2PFB A;  4UNO A;  1V55 H;  3ISP A;  3W6K B;  4OAZ A;  1IUF A;  5FD6 A;  2WV1 A;  2DCE A;  5FJ8 J;  5CPR B;  1PJR A;  3FWE A;  4XRS A;  3J7Z I;  1Z67 A;  1Z05 A;  4A3B J;  1ZAR A;  3TW7 A;  3K2Z A;  1FP1 D;  2KZV A;  1G3W A;  3V4G A;  4H4K C;  2A6T A;  1OYW A;  2HQA A;  4AD9 A;  5D4S A;  3O6B B;  3P9C A;  2UV1 A;  2DK5 A;  2Q2E A;  4A3E J;  2DXI A;  3JRH A;  1MBK A;  4I09 A;  2PI0 A;  5E3O A;  2E2I J;  3I71 A;  2LVS A;  2IA2 A;  3FBN B;  1UG2 A;  3Q3S A;  4E7I A;  2L9V A;  1MBH A;  3VB2 A;  2STW A;  4YFX F;  4EJO A;  1I3A A;  1ODD A;  2LRE A;  3K6G A;  4UB6 C;  3RQ4 A;  4B47 A;  5HDN A;  1T39 A;  2V6C A;  3HHG A;  3FKJ A;  1QQI A;  1I5Z A;  1OCZ H;  2BBY A;  4MIM A;  5ILV A;  4HX4 A;  4DJA A;  1BI0 A;  1ETX A;  2VJJ A;  3WHC A;  4RAF A;  2BHZ A;  2K85 A;  2NS0 A;  3OYG A;  2TCT A;  1BI2 A;  2W4S A;  2IS6 A;  3B6C A;  3ROU A;  2P6T A;  1SD6 A;  1I50 J;  4L9V A;  5DYM A;  5F1R A;  2EV5 A;  4RS8 A;  1PDN C;  2QEN A;  4P9U A;  1HKT A;  4YRV A;  3BPX A;  2ME0 A;  1WRJ A;  1TLH B;  4QLC U;  4Y33 A;  3RKQ A;  3R6S A;  1IRG A;  4DQ2 A;  3LL7 A;  3C1D A;  3LOC A;  3F6O A;  2LP0 A;  1FYM A;  4CCJ A;  2FQ4 A;  5TIS C;  3J80 Z;  5BPD A;  2QBY A;  4IL6 C;  3PQJ A;  5D5W B;  3QAH A;  2M8E A;  4B3A A;  3M07 A;  4B8X A;  1RNL A;  1HST A;  5HLI A;  4CA0 A;  3TDU C;  3DXJ F;  2VQH A;  3RPU A;  3PL8 A;  1BIA A;  4DYR A;  2I8D A;  3MCZ A;  2NAZ A;  3A02 A;  3CUQ A;  4G6T B;  4LLG F;  2NS7 A;  2R7T A;  3QPT A;  1I1G A;  2LD5 A;  3AFH A;  2RGV A;  3BR5 A;  2L5Q A;  4LMY A;  3CDH A;  5ILU A;  1FWZ A;  5J1U A;  1SFO J;  3TP0 A;  4XON A;  2EFP A;  3IUO A;  2OQG A;  4U7D A;  1IF1 A;  1W7P B;  2CH0 A;  2QYO A;  4PK4 A;  3ONQ A;  1UZC A;  1DPR A;  1QVU A;  2M30 A;  3F8M A;  4JP0 A;  1FLI A;  3MVP A;  3ZRG A;  4HF0 A;  1JUP A;  2JA8 J;  4RLQ A;  2RNJ A;  1R58 A;  2VIX A;  5JFR A;  1YRN B;  1GVJ A;  1U6G A;  3OYC A;  2DFE A;  3BG3 A;  1AWC A;  3DU5 A;  2CQN A;  2XPU A;  4RGX A;  4IO9 F;  3HEF A;  4AIJ A;  2DFI A;  3ABU A;  4RGS A;  2A6E F;  2XC7 A;  1T56 A;  4F55 A;  1OLT A;  2L7M P;  2ZJ2 A;  1ZHF A;  4WXH A;  3AKZ A;  5LHI A;  1K78 A;  2IT0 A;  2IGM A;  4RB2 C;  1VTN C;  5K7F A;  4IQJ A;  3PNY A;  2V79 A;  4I02 A;  4PFO A;  4YIR X;  3M8J A;  4JQF A;  1S7O A;  2F5E A;  3G6E I;  3N05 A;  2W57 A;  1IRX A;  2HYJ A;  3QP6 A;  4G6Q A;  4XLP F;  1FOX A;  1YOV B;  4PGG A;  5H6Q A;  3RYP A;  5KHD A;  2YS9 A;  1V3F A;  1QU3 A;  1D8J A;  2D2W A;  2VE8 A;  2TDX A;  1WH5 A;  2ZME A;  3S2H J;  2P81 A;  3RKY A;  1LFP A;  3IRQ A;  3SFZ A;  2IPQ X;  1E3O C;  1ZLJ A;  3H9J A;  4RAY A;  1C0W A;  2ECC A;  2AO9 A;  4RAG A;  1R22 A;  5IT9 Z;  1PUE E;  2K9N A;  3K2A A;  4RA2 A;  4G9Y A;  2IS4 A;  3DPU A;  1R5G A;  4I98 B;  1WVR A;  4RB1 A;  3AL0 C;  4AID A;  4A3F J;  2Z9O A;  3IP4 B;  2CUF A;  2DI3 A;  3HC7 A;  1QPI A;  4AC0 A;  3OV8 A;  1U9O A;  3CJT B;  3HDD A;  1ONV A;  2F4I A;  1XSD A;  4A5N A;  1BA5 A;  3GWZ A;  3MKY B;  2H1L A;  3PSI A;  2RN7 A;  2DYS H;  3OR1 C;  3F3X A;  1V5G A;  1OPC A;  3CES A;  3CJN A;  3HKZ A;  1SMY F;  2JSC A;  5CKT A;  1NG7 A;  3E6D A;  2HWV A;  3C2G A;  4KIF A;  3S17 J;  3DKY A;  4RDU A;  5K1Y A;  1QRY A;  1HSJ A;  4JX4 A;  4PJJ A;  4HNU A;  2R7Q A;  2CS3 A;  3L2U A;  1OCC H;  2WB1 A;  4JYK A;  5L3B A;  1G2H A;  2LDU A;  1I6H J;  2EA4 A;  3RZO J;  3VYS B;  1HW1 A;  3BWG A;  4CSW A;  4CCL A;  2HU9 A;  4RM3 A;  1Y1W J;  4IEJ A;  1FBS A;  2FRH A;  2JQ7 A;  5CVI A;  4DIQ A;  1Z21 A;  2FXA A;  3OYB A;  2CUE A;  2E7X A;  3MWM A;  1IO2 A;  2HOS A;  1ZYR F;  3RTR A;  3NRV A;  5EYR A;  1W0T A;  1MBJ A;  4LD5 A;  2L7Z A;  2CV2 A;  4UV8 A;  3A01 A;  3EYY A;  4C2M J;  3GZ6 A;  1U9N A;  1ZAO A;  4CCN A;  5FKL A;  3M1C A;  4EM1 A;  5F0C A;  2NYX A;  2FNP A;  1MJA A;  4AVZ A;  5LEJ A;  1XDS A;  1XDU A;  1HOM A;  2HDC A;  3L2V A;  3CDI A;  1QZZ A;  3MQ0 A;  3TP3 A;  4G7O F;  2J5O A;  1A35 A;  2NVQ J;  5IY5 H;  4QPO A;  2X1E A;  5HS7 A;  1N75 A;  2ZXW H;  2WAQ A;  2O6G E;  2QKM B;  2HQN A;  2HR3 A;  3I4N J;  1VQP I;  1OYY A;  2VPR A;  4HQE A;  3B6A A;  1LDJ A;  4GXO A;  3IC7 A;  3KP5 A;  5ICE A;  3BTL A;  1Y1V J;  2OJE D;  1W36 D;  3P7N A;  5BS6 A;  2PN6 A;  2MG4 A;  2YPR A;  3L1P A;  4A3G J;  2JTV A;  2LYC A;  2E7W A;  3JCU C;  4L5E A;  5HS8 A;  2CQK A;  1X4O A;  3S3M A;  3K1N A;  1CQT A;  3U9G A;  2NOG A;  2CMP A;  1A31 A;  3WU1 B;  3CD6 I;  2LKP A;  1HXD A;  3UNG C;  1LPQ A;  4A93 J;  3HRU A;  5KAI C;  3BDD A;  1J09 A;  4IQ4 A;  3MKW B;  1G59 A;  1FY7 A;  4P9F A;  3MAJ A;  1VQ4 I;  1HKS A;  2Z1D A;  5FFX A;  3RIR A;  2ELJ A;  2V7F A;  5D4R A;  1F1Z A;  3LNQ A;  4ESJ A;  1MMA A;  3J7A O;  1MNE A;  3REO A;  3K69 A;  4BHC A;  4XRM A;  1PUF B;  3KEQ A;  2E34 A;  1VQM I;  4GFB A;  3S3N A;  1G3T A;  3S93 A;  1U8R A;  3E1S A;  3PUF A;  2GXG A;  2VKE A;  4BUP A;  4II2 A;  3BTJ A;  5K5Q A;  1G3Y A;  4XRS G;  3EET A;  2F2E A;  3SZT A;  4I6Z A;  4CH7 A;  4RGR A;  4U88 A;  2Y9Z A;  1DP7 P;  4KT5 C;  4DYC A;  3H3V K;  4S04 A;  4R1H A;  1U78 A;  3GTL J;  1V4R A;  3VFZ A;  4ZTJ A;  2M4K A;  4C9Y A;  3CO6 C;  1IXS B;  2ELH A;  3I9V 2;  4NDL A;  4BQO A;  1QBJ A;  2G9W A;  3L2R A;  1CF7 B;  3GFL A;  2D5V A;  3LST A;  2KFD A;  4IOA F;  4G12 A;  1UMQ A;  3GF2 A;  2LBF A;  4G6D A;  2QSH X;  2M1B A;  1WZ2 A;  3D5R C;  4CCM A;  1PYV A;  2RQQ A;  1I39 A;  1FC3 A;  4PFP A;  5HLG A;  4AVP A;  1JT0 A;  4OIQ F;  4I2O A;  5HDK A;  2I10 A;  4RLF A;  2W1O A;  3NAU A;  3WTY C;  3HOV J;  3NWS A;  2DA3 A;  2FNA A;  4A3M J;  2KL4 A;  3QP5 A;  3FXM A;  3F23 A;  3SDB A;  1H88 C;  2XGE A;  3KFW X;  1XSV A;  4A3J J;  1WI3 A;  2CFX A;  3LSJ A;  3IAM 2;  3HTU A;  2DOE A;  5AIP A;  1Y56 A;  1MW7 A;  2ZJQ F;  4XKW A;  1YJN I;  1OKR A;  1XX5 A;  3WE3 A;  5D6F A;  1STZ A;  3T0Y A;  4OIN F;  3I55 I;  2OTL I;  4E4H A;  1F5T A;  2ELK A;  2ZB9 A;  1ZR2 A;  2IXS A;  2BHY A;  2V26 A;  1Z0X A;  2LH9 A;  2RAE A;  1S29 A;  2V1N A;  1YIJ I;  1YI2 I;  2EB7 A;  2K9M A;  1PVE A;  1U5T B;  3GFI A;  4HNT A;  2E5Z A;  1I3Q J;  1JHH A;  3H92 A;  3BJ6 A;  5EGO B;  1H89 C;  4IX7 A;  4MFD A;  4IHW A;  3FIW A;  2ID6 A;  2EQR A;  3ZCO A;  4XOT A;  3SEZ A;  3LSK A;  5K7Z A;  1DU6 A;  4ZH4 F;  4OIR F;  5CVJ A;  2NNY A;  3ZQL A;  5IOZ A;  3GME A;  3OL3 A;  4HW0 A;  1H8A C;  2Z3Y A;  3TQN A;  3L09 A;  3OYJ A;  1FTT A;  2Z5U A;  1KQ9 A;  2KIU A; 
#chains in the Genus database with same CATH homology
 2G7H A;  2PJP A;  4Q5S F;  3FXR A;  2L02 A;  5D8L B;  2HYG D;  1JXS A;  1FZP B;  2A3S A;  2X0L A;  1FYK A;  3L7W A;  2OU2 A;  4KN7 X;  1LDK B;  4OOI A;  1YS6 A;  4A2U A;  3QOP A;  1U3E M;  4IJA A;  1UFM A;  1KYZ A;  4HLX A;  5FGM A;  3HRS A;  2ISZ A;  3T8T A;  1XN7 A;  1ZLK A;  4KDP A;  2VN2 A;  3I0T A;  1IN8 A;  2XAJ A;  3KP4 A;  4BXU A;  2VOO A;  2VOP A;  2L54 A;  2QVO A;  2RQP A;  3I4P A;  3GZ5 A;  3HSF A;  3M8F A;  5BQT A;  5KK1 A;  1SAX A;  2RC4 A;  3BRO A;  4KA4 A;  5CYV A;  4N9H A;  2RVC A;  3KP7 A;  3WTS C;  1MZB A;  4IRG A;  4XLN F;  1IZ1 A;  5D5V B;  2Z99 A;  2L3D A;  5FFZ A;  3M9A A;  2HEO A;  4UVB A;  3FM5 A;  5ED4 A;  1J5Y A;  2DK8 A;  2K02 A;  4M6Y A;  4LG0 B;  5CVU A;  5L3D A;  2XAH A;  2H6C A;  4LK0 F;  4A0X A;  2GA1 A;  5CLS A;  3GLX A;  4ON0 A;  3GYH X;  1O3Q A;  2OBP A;  3B02 A;  1USS A;  3K9T A;  1R1T A;  5FLX K;  3E97 A;  5D6E A;  1MDM B;  4O5V A;  5KVR A;  4ESB A;  1DPU A;  2JPB A;  2ZNZ A;  4RGU A;  1S7A A;  3HTS B;  2AS5 F;  4ZZL A;  3GFM A;  1BJA A;  3DFG A;  2FSW A;  4KYW A;  2W25 A;  5TJJ A;  4U0Y A;  2RDP A;  4EM2 A;  2UZK A;  2G7U A;  2L4A A;  1B1B A;  5J8C A;  5D8K B;  4YIF A;  2XAG A;  3TKY A;  1KU7 A;  3KE2 A;  4MNU A;  1BOA A;  2K27 A;  2IP2 A;  3HOT A;  5DD8 A;  4E70 A;  3LA3 A;  2STT A;  1IAW A;  2R3S A;  3LQR A;  2IA1 A;  3ZMT A;  4O3M A;  2P5L C;  1G3S A;  2FMY A;  4KMF A;  1RI7 A;  5DV5 A;  1ZG1 A;  2NNN A;  3AAF A;  2KKO A;  2M45 A;  4U0W A;  2XKP A;  2XAF A;  1B9N A;  1GXQ A;  3ABT A;  1YFH A;  4KIB A;  2MLK A;  4L18 B;  1SFU A;  1WSU A;  3M1E A;  2F5C A;  4MTE A;  3BJA A;  4M6X A;  1IUY A;  3O2P E;  2DQL A;  3MEX A;  5A2Q Z;  5HS9 A;  1YG2 A;  1SD7 A;  1O3S A;  2BEO A;  2VBZ A;  4XRF A;  1IN5 A;  4BQA A;  2HFH A;  1ZG3 A;  1R5H A;  3WOD F;  3BOQ A;  3KCC A;  1LB2 A;  3I5U A;  2JRT A;  3ERE D;  3FF5 A;  4ESF A;  2VT3 A;  1BN5 A;  2QQ9 A;  1FSH A;  1YQA A;  4LLN A;  2BGC A;  3I54 A;  2QM3 A;  3IKV A;  4R79 A;  1EV7 A;  1UCR A;  3IHU A;  3Q5F A;  2V1D A;  1YW7 A;  5FB2 A;  3HIF A;  2EFW A;  2FEZ A;  3V8K A;  1LQ1 A;  3E6M A;  2B0L A;  1R00 A;  2C6Y A;  3QU3 A;  2HTJ A;  3F8C A;  5ERI A;  4CO8 A;  1R23 A;  1TNS A;  5L3C A;  1ON1 A;  3TOB A;  1IXR C;  2KJB A;  2VON A;  2AXL A;  1KA8 A;  4Y13 A;  2GZW A;  1YO5 C;  2EWN A;  1IN4 A;  1OMI A;  2QBY B;  4ZZD A;  4HDU A;  2DO7 A;  1B4A A;  2M5W A;  3J81 Z;  1FT9 A;  4WX9 A;  3CUQ B;  1PP7 U;  2FOK A;  2K4B A;  5F64 A;  4GO1 A;  2GQQ A;  1XD7 A;  4HZF A;  4U0V A;  3KP3 A;  3KZY A;  3TGN A;  2D1H A;  2JPC A;  3KZZ A;  5DCM A;  3J80 K;  3ZQ7 A;  1WI9 A;  4WWC A;  4FHT A;  3GW2 A;  1W4M A;  4CHU A;  4P96 A;  4RB0 A;  3HSR A;  4ENN A;  3ELK A;  4HX7 A;  3SXY A;  1MJ9 A;  1SMT A;  2Z33 A;  4A0Y A;  4RAZ A;  4FT8 A;  5LRS A;  1L3L A;  4M9Z A;  1IN6 A;  2ETH A;  4B09 A;  4LJZ F;  3ZN0 A;  2O8X A;  5ICF A;  1KQ8 A;  5D5U B;  3DV8 A;  3GXO A;  2YX4 A;  3TO6 A;  2ZME B;  4FX0 A;  4Y15 A;  2DBB A;  4G7Z F;  5LGU A;  2KJC A;  1Q1H A;  1FBQ A;  2DPD A;  3P9I A;  3FXU A;  1LDD A;  2VBX A;  4EJW A;  4KIC A;  5LGN A;  1HW2 A;  2FU4 A;  2ADU A;  1SFE A;  2QUF A;  2LSO A;  5E1X A;  4HBL A;  1HQC A;  5IT9 K;  1UHW A;  3C3W A;  5LEK A;  2GXB A;  3PQK A;  3N4M A;  3HSE A;  2GWR A;  2V9V A;  1FYL A;  2PLY A;  4HF2 A;  4S05 A;  1JHF A;  5EEH A;  3FHZ A;  1FSE A;  1IRF A;  5E18 F;  2OQR A;  4L5I A;  3JTG A;  5DEQ A;  1L0O C;  5FD5 A;  5E17 F;  5ICC A;  3F21 A;  4MTD A;  4KUM A;  4HV6 A;  4IHT A;  1TQM A;  2FBK A;  3V8J A;  3DQV C;  1BI1 A;  3BJO A;  2E1N A;  4HF1 A;  2V1U A;  1ZN2 A;  2CGP A;  2GAU A;  1CF7 A;  4YFK F;  3Q9V A;  5L3E A;  3F8F A;  1Z6R A;  5E1Z B;  3K1P A;  4A0Z A;  3N97 A;  2DU9 A;  3DKW A;  1QZY A;  3IWZ A;  2A6H F;  3JAM Z;  3ZPL A;  3IWF A;  3RDI A;  1Y0U A;  1LEB A;  3G3Z A;  2ZO4 A;  1HKQ A;  2PBI A;  2IA0 A;  5EEG A;  5E8I A;  1O7L A;  2H6B A;  5TRD A;  3I59 B;  3C7J A;  4M73 A;  4FX4 A;  4IPA A;  4G94 A;  2EFN A;  5H20 A;  3R61 A;  4UVC A;  1R1V A;  1YIO A;  3JTH A;  1FBU A;  2H09 A;  2P8T A;  4G8X A;  1ZRE A;  1D8K A;  4GYI A;  1YW9 A;  1FP2 A;  1FOK A;  4HAM A;  3HYI A;  2CO5 A;  2H94 A;  5LBQ A;  1XGO A;  1G6N A;  4ENK A;  2X4H A;  4ENM A;  3U1D A;  4BHP A;  3L9F A;  3IRR A;  4EGZ A;  1BC7 C;  3LAJ A;  1OYI A;  4YG2 F;  5JHU A;  4IRH A;  4ETS A;  5JR3 A;  2VT2 A;  2MH2 A;  1T38 A;  4HA8 A;  2XUB A;  3E5Q A;  5HOO A;  2ZBK A;  1J0R A;  1IXC A;  2XAS A;  1ZRD A;  3GFJ A;  4JK1 X;  4A12 A;  3LFK A;  2A07 F;  4HV5 A;  1LNW A;  5BPI A;  3V7R A;  1DDN A;  2R7D A;  3LWF A;  3WGI A;  2HS5 A;  2A69 F;  1XMK A;  2EV6 A;  2Y75 A;  4ZYE A;  4A5M A;  4R8H A;  4O6J A;  1MGT A;  5BOX A;  2ACJ A;  3SHF A;  2XKO A;  4WK8 F;  3ZMZ A;  2QQA A;  4LG0 A;  4M74 A;  2PG4 A;  2DW4 A;  1EH8 A;  1WWX A;  3DPL C;  2KIF A;  3IL2 A;  2OD5 A;  2ZKZ A;  5DDG A;  2LF8 A;  3VOD A;  4ASN A;  2Q8K A;  2EK5 A;  2ZXJ A;  3I64 A;  3FMR A;  4EJV A;  3FX3 A;  2Y0M A;  3KET A;  4CIC A;  3E3V A;  4LGW A;  3C18 A;  1MDM A;  2VC0 A;  4UHT A;  2BYV E;  3WTV C;  1S3J A;  3HRM A;  2ZFW A;  2NRA C;  2OZ6 A;  3VEP A;  1MJB A;  4EM0 B;  1T98 A;  2JZY A;  2XGX A;  4WXD A;  3F8B A;  3MZH A;  1KU2 A;  1TW3 A;  3BP8 A;  2EJR A;  3CLO A;  2FML A;  4I01 A;  4AIK A;  1K7A A;  3R4K A;  4XSZ F;  3HHH A;  4WCG A;  1E2X A;  1KQ0 A;  1K6O A;  4L0Y B;  4RB3 C;  3ML6 A;  2VBW A;  4N9I A;  4MEY F;  1B6A A;  3SQN A;  2E1C A;  2PQ8 A;  4AIH A;  1A04 A;  3GUD A;  4A6D A;  3HOS A;  1P4W A;  2D45 A;  5LHG A;  2JT1 A;  1XGS A;  3E6B A;  5LGT A;  2W85 A;  4LK1 F;  1W7P D;  5AIQ A;  4CGZ A;  3M8E A;  4BHB A;  2FA5 A;  3BPV A;  4GCV A;  1UST A;  1SD4 A;  4N0B A;  1U5T C;  1EH7 A;  4OMY A;  3R60 A;  2MBF A;  1ZH5 A;  3TO7 A;  2K7L A;  3TOA A;  3DP7 A;  3KP6 A;  3NEU A;  4MEX F;  1XGM A;  4HLY A;  1TTY A;  3KLN A;  4G7H F;  2DTR A;  4UUV A;  3GVA A;  2IJL A;  3COA C;  1WKM A;  1FPQ A;  2EV0 A;  3FZV A;  2P7C B;  1O7F A;  3CO7 C;  1J59 A;  1LEA A;  2MC3 A;  2J5P A;  4Q47 A;  2CYY A;  3E6C C;  4L9N A;  1OR7 A;  4ZYG A;  3QU6 A;  1YS7 A;  2L01 A;  2WV0 A;  1REP C;  3ZMV A;  2RV8 A;  1B59 A;  3L2C A;  4IXA A;  1HBX G;  1ZG5 A;  4MQ9 F;  1JGS A;  3F72 A;  4P55 A;  2QLZ A;  1Z1D A;  3WTT C;  4BNC A;  1TQP A;  1I27 A;  3K0L A;  4KNY A;  2UXN A;  2O61 A;  2FQ3 A;  1R1U A;  3FMS A;  1O3T A;  5A2Q K;  2F5D A;  3T5X A;  1W7P A;  4NHJ A;  4U7B A;  4Y17 A;  1MD0 A;  5CVV A;  3ZMS A;  4L0Z B;  1P92 A;  3F6V A;  4YII A;  3RI4 A;  3PFI A;  3WG9 A;  2P5V A;  1TW2 A;  1Z6T A;  3LAP A;  1Z7U A;  3U2R A;  2XRN A;  3JSP A;  3D0S A;  2MH9 A;  5L3F A;  4HX8 A;  2VOD A;  3WE2 A;  4IRI A;  5JVT A;  4QWQ A;  3KEO A;  2XV4 S;  1IN7 A;  4BH9 A;  1YTY A;  4IHS A;  4P5O A;  1TNT A;  5DD4 A;  2VE9 A;  3WGH A;  4HQM A;  4IVN A;  5E8G A;  5FO5 A;  2XAQ A;  3Q9S A;  4OIO F;  1DUX C;  1I1S A;  3W6J B;  2O0Y A;  4EMS A;  1Z91 A;  1TQI A;  5E1W A;  4M71 A;  3RKX A;  4HDV A;  2HQR A;  4KIG A;  2ZNY A;  1WQ2 A;  3K1M A;  4CZZ A;  2A68 F;  4LFU A;  4XSX F;  2YR2 A;  2HZT A;  4LB6 B;  1BC8 C;  4A6E A;  3I58 A;  1XCV A;  4GGG A;  3QPH A;  1K78 B;  3GO5 A;  1JE8 A;  1K79 A;  5DCM B;  2XRO A;  4MHG A;  3MFK A;  2GA2 A;  1HW5 A;  5CVR A;  2XHK A;  4L9T A;  2R7F A;  3J81 K;  1BBY A;  4M9X A;  4KFC A;  4M72 A;  1U2W A;  5D5X B;  2IRF G;  4Z2Y A;  1SD5 A;  2F5F A;  3RYR A;  3T8R A;  3ULQ B;  1J2X A;  2Q0O A;  3WTX C;  4CXF A;  3HRT A;  3ZP5 A;  3H3U A;  3R0J A;  4Q48 A;  2EFO A;  1S8N A;  4LB5 A;  3R0A A;  2LNB A;  2DQR A;  3T1B A;  5JI6 A;  4UVA A;  1S6L A;  4BYY A;  1RIO H;  2VBY A;  1Z9C A;  4EVI A;  2D1V A;  3V7C A;  5IT3 A;  2P7V B;  1XGN A;  1ZRF A;  4PZJ A;  2P5K A;  2LF7 A;  3EUH A;  3SZP A;  1XMA A;  4EQQ A;  2FBI A;  2ESN A;  3F8N A;  4XBF A;  4EV0 A;  3WTW C;  3FM3 A;  2MD5 A;  2MA3 A;  2O3F A;  5J6X A;  1O3R A;  4KN4 X;  4NB5 A;  5ICG A;  3WTZ A;  4JBA A;  5HDG A;  3V8L A;  1ZGA A;  3ECO A;  2BV6 A;  2HKO A;  1ULY A;  4WF2 A;  2PEX A;  4OU0 A;  3WU0 A;  1ZGJ A;  3ZN1 A;  1P2F A;  3FXQ A;  5BMZ A;  1LVA A;  2DLL A;  2MLG A;  3D5L A;  3ZMU A;  5HVQ C;  4OIP F;  2YU3 A;  3RPQ A;  4D0P A;  1G4D A;  2VC1 A;  3OOP A;  3TDZ C;  4OMZ A;  3EDP A;  1QO0 D;  1NHA A;  2YX7 A;  2A5Y B;  1P4X A;  4MQV A;  3B73 A;  3DEU A;  3I59 A;  1YW8 A;  2V1X A;  2A61 A;  2WWY A;  2O03 A;  3CUQ C;  2QQB A;  3V7S A;  2P4W A;  5K5O A;  1U5T A;  4PCQ A;  1D3Y A;  2W24 A;  3H3Z A;  1QGP A;  2CSO A;  2XVC A;  2OA4 A;  4PDK A;  1P6R A;  5LRR A;  2IVM A;  1R36 A;  2K4J A;  4DNC A;  5LLQ A;  3LA2 A;  2RKH A;  3DF8 A;  3TO9 A;  4I7H A;  1B9M A;  3P9K A;  4ZYD A;  1T0F A;  5LHH A;  1D5V A;  1QPM A;  2K86 A;  1TBX A;  5AON A;  3JAM K;  1F9N A;  3ZMD A;  1MKM A;  1ZRC A;  1FX7 A;  2QWW A;  4WXC A;  3KP2 A;  1AOY A;  2EA2 A;  4K2E A;  5K5R A;  2EFQ A;  2KIM A;  3O3K A;  2BE5 F;  3G73 A;  5HLH A;  2FBH A;  2DPU A;  3E5X A;  2CWE A;  2OAZ A;  1H9G A;  1T2K A;  4Q4Z F;  3BY6 A;  5F6F A;  3VOE A;  5H6R A;  2L4M A;  4LLL A;  4NQW A;  2HTS A;  1IW7 F;  2OZU A;  4L5J A;  6PAX A;  5E20 A;  1H9T A;  4PGH A;  4EJT A;  4ENJ A;  2WTE A;  3HUG A;  4YFN F;  1XSX A;  1XCB A;  3EQL F;  2WC2 A;  1KYW A;  4HYE A;  1F4K A;  3LQQ A;  5FLX Z;  3I53 A;  3F22 A;  3E5U A;  2GIV A;  4I0B A;  2FF4 A;  2UXX A;  1EH6 A;  1UHM A;  3CTA A;  2HYF A;  4I0A A;  2Y48 A;  1KU9 A;  1LJ9 A;  5J8F A;  1R7J A;  3NQO A;  1RUO A;  3L00 A;  3BZ6 A;  2ISY A;  3M7G A;  1YYV A;  2HGC A;  2YSR A;  1CGP A;  1GHC A;  1J7K A;  1PP8 F;  3RKW A;  4BAY A;  1BM9 A;  1FNN A;  1I6X A;  3S2W A;  1KU3 A;  4IF4 A;  2HKX A;  4CYD A;  3ECH A;  3JSO A;  1QNT A;  5CJ9 A;  5ILS A;  3KLO A;  2H27 A;  4L9J A;  3QRF F;  5L3G A;  1T6S A;  1YLF A;  4EGY A;  4CDG A;  5DUI A;  1W5T A;  2CW0 F;  3CUO A;  4HOB A;  2HOE A;  3GX4 X;  3WTU C;  1KGS A;  2UWM A;  2FE3 A;  2KRF A;  2IW5 A;  5DUK A;  2W84 A;  1O57 A;  4ZYH A;  3EYI A;  2P6S A;  1X3U A;  1J75 A;  4EJU A;  1RUN A;  1H0M A;  4TV7 A;  1BIB A;  2CG4 A;  2ESH A;  2PMH A;  4M9S A;  2PMU A;  4UXN A;  1J9I A;  1P4A A;  2DT5 A;  1SFX A;  3DPT A;  2COM A;  2DAO A;  5DCF A;  4UV9 A;  4AWX B;  1RZ4 A;  3GEZ A;  3WGG A;  4MGR A;  1GXP A;  2VXZ A;  1BI3 A;  3FMQ A;  1W5S A;  4KMU X;  2QZ8 A;  1UB9 A;  2ZCW A;  3JW4 A;  2M87 A;  1E17 A;  1XB4 A;  4GYG A;  3MZY A;  3LA7 A;  3IKT A;  3RJP A;  4F7Z A;  2XIG A;  4H0E A;  1ON2 A;  2PFB A;  4UNO A;  3ISP A;  3W6K B;  5FD6 A;  3FWE A;  1Z05 A;  1ZAR A;  3K2Z A;  1FP1 D;  1G3W A;  3V4G A;  4AD9 A;  1OYW A;  5D4S A;  3O6B B;  3P9C A;  2DK5 A;  2Q2E A;  4I09 A;  2PI0 A;  3I71 A;  2IA2 A;  3VB2 A;  2STW A;  4YFX F;  4EJO A;  1ODD A;  1T39 A;  5HDN A;  2V6C A;  3HHG A;  1QQI A;  1I5Z A;  2BBY A;  5ILV A;  4HX4 A;  1BI0 A;  2NS0 A;  1BI2 A;  3ROU A;  2P6T A;  1SD6 A;  4L9V A;  5DYM A;  5F1R A;  2EV5 A;  4RS8 A;  1PDN C;  2QEN A;  4P9U A;  1HKT A;  3BPX A;  1WRJ A;  1TLH B;  4QLC U;  1IRG A;  3R6S A;  4DQ2 A;  3C1D A;  3F6O A;  1FYM A;  3J80 Z;  5BPD A;  2QBY A;  3PQJ A;  5D5W B;  3QAH A;  2M8E A;  4B8X A;  1RNL A;  1HST A;  5HLI A;  3TDU C;  3DXJ F;  3RPU A;  1BIA A;  3MCZ A;  2NAZ A;  3CUQ A;  4LLG F;  3QPT A;  1I1G A;  2RGV A;  4LMY A;  3CDH A;  5ILU A;  1FWZ A;  2EFP A;  2OQG A;  4U7D A;  1IF1 A;  1W7P B;  2QYO A;  1DPR A;  2M30 A;  3F8M A;  1FLI A;  4HF0 A;  2RNJ A;  1R58 A;  5JFR A;  1GVJ A;  1U6G A;  1AWC A;  4RGX A;  4AIJ A;  2DFI A;  3ABU A;  4RGS A;  2A6E F;  2ZJ2 A;  1ZHF A;  4WXH A;  5LHI A;  1K78 A;  2IT0 A;  1VTN C;  4RB2 C;  2V79 A;  4I02 A;  4JQF A;  1S7O A;  2F5E A;  2W57 A;  4G6Q A;  3QP6 A;  4XLP F;  5H6Q A;  4PGG A;  3RYP A;  1V3F A;  1D8J A;  2D2W A;  2VE8 A;  2TDX A;  2ZME A;  3RKY A;  3IRQ A;  3SFZ A;  2IPQ X;  1ZLJ A;  4RAY A;  1C0W A;  5IT9 Z;  1R22 A;  1PUE E;  4G9Y A;  1R5G A;  4I98 B;  4RB1 A;  2Z9O A;  2DI3 A;  3OV8 A;  1ONV A;  1XSD A;  4A5N A;  3GWZ A;  2RN7 A;  3F3X A;  1OPC A;  3CJN A;  1SMY F;  2JSC A;  3E6D A;  2HWV A;  4KIF A;  5K1Y A;  1HSJ A;  5L3B A;  2LDU A;  2EA4 A;  1HW1 A;  3BWG A;  1FBS A;  2FRH A;  5CVI A;  2FXA A;  2E7X A;  3MWM A;  1ZYR F;  3RTR A;  3NRV A;  4LD5 A;  4UV8 A;  3EYY A;  3GZ6 A;  1ZAO A;  4EM1 A;  2NYX A;  2FNP A;  1MJA A;  5LEJ A;  1XDS A;  1XDU A;  2HDC A;  1QZZ A;  3MQ0 A;  4G7O F;  2J5O A;  5HS7 A;  2O6G E;  2HQN A;  2HR3 A;  1OYY A;  4HQE A;  1LDJ A;  4GXO A;  3IC7 A;  3KP5 A;  5ICE A;  3P7N A;  5BS6 A;  2PN6 A;  2YPR A;  2JTV A;  2E7W A;  5HS8 A;  2CQK A;  3K1N A;  3U9G A;  3WU1 B;  2LKP A;  1HXD A;  3HRU A;  3BDD A;  1FY7 A;  4P9F A;  3MAJ A;  1HKS A;  5FFX A;  3RIR A;  5D4R A;  1F1Z A;  4ESJ A;  3J7A O;  3REO A;  3K69 A;  4BHC A;  3KEQ A;  1U8R A;  1G3T A;  2GXG A;  5K5Q A;  1G3Y A;  3EET A;  2F2E A;  3SZT A;  4RGR A;  4U88 A;  1DP7 P;  4KT5 C;  4S04 A;  4R1H A;  1U78 A;  1V4R A;  3VFZ A;  3CO6 C;  1IXS B;  2ELH A;  1QBJ A;  2G9W A;  1CF7 B;  3GFL A;  3LST A;  3GF2 A;  4G6D A;  2M1B A;  1FC3 A;  5HLG A;  4AVP A;  4OIQ F;  4I2O A;  5HDK A;  3WTY C;  2FNA A;  3QP5 A;  3F23 A;  3KFW X;  1XSV A;  2CFX A;  3HTU A;  5AIP A;  1OKR A;  3WE3 A;  5D6F A;  1STZ A;  3T0Y A;  4OIN F;  1F5T A;  1S29 A;  2EB7 A;  1U5T B;  3GFI A;  1JHH A;  3H92 A;  3BJ6 A;  4ZH4 F;  4OIR F;  5CVJ A;  2NNY A;  4HW0 A;  2Z3Y A;  3TQN A;  3L09 A;  2Z5U A;  1KQ9 A;  2KIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...