1ETXA

The crystal structure of e. coli fis mutant q74a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
74
Chain Sequence
VLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRGNATRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 27
structure length 74
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etxA00
1POGA 3DCFA 2Y9ZA 2JWTA 4W97A 3A02A 2M2EA 5C3EJ 1G2HA 1H89C 1ZR4A 4A3JJ 4EEFG 1TWFJ 3RKQA 1PUFA 2QF7A 3HEFA 1K83J 2HOSA 4RDUA 4BY7J 3LSRA 1AKHA 5J1YA 2NS8A 2CQXA 3G1OA 1UHSA 4A3FJ 1BA5A 4S0HB 4A3EJ 1ORKA 1WI3A 2DA7A 5FLVA 4IEJA 3IH2A 2M8GX 4D7NA 1U78A 2FJ1A 5J1UA 2R5ZB 2L0KA 4IHXA 3B6CA 4BBSJ 1T56A 2H1KA 2DA4A 5K7FA 2QCOA 2XPVA 2VKVA 4A3DJ 3F0CA 3ZOBA 4AUXA 5E3LA 3GBGA 2ME6A 4QIWN 1X2NA 4M3FA 4NDLA 1XG1A 2LLKA 2Y9YA 1BL0A 3ZQFA 3BR2A 3TP0A 3JRDA 1FTTA 4MO7A 4M3BA 2DMQA 5IP7J 2DA1A 4AYBN 3S1MJ 5IPAA 1ZTRA 1W0TA 3HGGA 5J3LA 1B72A 1XC5A 5EDNA 1JKRC 2MGQA 3BG9A 4V2GA 5FKKA 1IV6A 4DYCA 1JT0A 3HOWJ 3HOXJ 4Y52J 2JJ7A 5EGOA 3JR9A 2YS9A 1IDZA 5C4JJ 4A3IJ 2K9SA 3TP3A 2VUMJ 5F1JA 3JRCA 1JGGA 5M5WJ 2DA2A 3PO3J 3S1RJ 1SANA 2L9RA 2HI3A 1IRZA 3DEWA 1OFCX 4BXXJ 3HBLA 3NARA 2OPTA 3GTKJ 2DJNA 5IYBJ 2FQ4A 4A3KJ 2PMZN 1R9TJ 3OSGA 5GPCA 3Q0VA 1FTZA 5M5YJ 1MNMC 1JUPA 5FKNA 5M3FJ 2GBYA 2XB0X 4DYRA 4IHWA 3GTPJ 3D1NI 5F0CA 4A3MJ 4M3DA 1MBFA 3BTIA 1RKTA 5FKLA 3Q0WA 3PM1A 4FTHA 2O7OA 3ZQIA 5EGOB 3M3YJ 1T33A 3HOVJ 2B63J 4A3BJ 2ID6A 3CDLA 1JKOC 2M34A 3HOYJ 2M9HA 2DMPA 4BKXA 5EEAA 4G12A 4FISA 1U9NA 1X58A 1HLVA 1ETKA 2LKXA 4LOCA 1HDDC 2XGDA 2LFBA 2LP0A 1GDTA 4A93J 1YRNA 3BG5A 3HM5A 4I76A 2COBA 3JRFA 2R5YA 4FE4A 1EF4A 3A01A 4B3AA 3OSFA 1HF0A 2HOTA 1BJZA 4AC0A 2X6OA 3GTLJ 4UUSB 2NVQJ 4HNVA 2VPRA 4ABZA 4FCYA 3GTOJ 2R7ZJ 3CCYA 5EF6A 2XPUA 2LK2A 1ZQ3P 1DU0A 3GTJJ 1S7EA 3BQYA 5IOYA 4DZJA 4D5CA 4MLOA 5FLMJ 1JJ8C 2NS7A 5DS9A 1WGXA 2LTPA 2OF7A 3MKLA 5E3OA 5F04A 3I4MJ 2IEKA 3RQIA 4B4CA 3JRGA 1QVTA 2DMUA 2GM4A 3WHCA 5HODA 3BQZA 1BW6A 3LSPA 4XRSG 5EZGA 2TRTA 3BT9A 2JK3A 1ZKGA 1MH3A 4JX6A 3S16J 2HYJA 9ANTA 3GTGJ 1WCMJ 3PO2J 2DA3A 2E19A 1X2MA 2Y30A 3A03A 2K40A 3IH3A 3S2HJ 1XS9A 1APLC 4FE7A 4C3JJ 4JYKA 1VFCA 1MBHA 4JX5A 4CYCA 1I6HJ 1PUFB 3O8GA 1JTXA 4DZPA 1TWCJ 2E1OA 4UUTA 5JLXA 3FISA 2VKEA 3TW6A 1JT6A 3HDDA 3LOCA 1IC8A 1AKHB 3TW7A 2R92J 3QPSA 4M3GA 4QTRA 1FIPA 1E3OC 2CU7A 2GLOA 5FKMA 5EYRA 1Z0XA 3BR3A 1U9OA 2X9DA 1RR7A 5FJ8J 2FX0A 1P7JA 3FKIJ 3JRIA 1ZR2A 1SFOJ 3TEDA 3E7LA 3JRHA 2NVYJ 3LNQA 1GUUA 1JJ6C 2R0QC 2JA6J 1HOMA 1F36A 1P7IA 3G1LA 2G0EA 1MBKA 2ID3A 2K9NA 1QVUA 1CQTA 2EZKA 3ZQHA 5F0HA 1Z77A 1ENHA 3BR6A 1QPIA 1AHDP 4B1RA 3QPLA 2JN6A 1JUMA 2JA5J 1Q1VA 2MG4A 1LFBA 2XGCA 2DA5A 2EZHA 1OJLA 5IYDJ 1B72B 3QQAA 2E2IJ 1GV5A 1Y1VJ 4D5FA 2ELKA 2VI6A 1IUFA 3S14J 2I10A 1GV2A 3K2AA 3WHBA 3ZQGA 1IG7A 1FIAA 5E3NA 1RPWA 1VNDA 5EG0A 1H8AC 1JUSA 5GP9A 1HCRA 3Q0UA 1LE8A 1UG2A 2E2JJ 3ZQCA 1TWGJ 2O9LA 2XRLA 1ETYA 2L7MP 1H88C 2IAIA 5K7HA 3NAUA 3ZQLA 5JLWA 5IP6A 2XPWA 4DW6A 1JKPC 4A3CJ 1K61A 2EZIA 3CMYA 3SFIA 3BTCA 3GTQJ 1AU7A 2MSYA 2HQ5A 4C2MJ 1A6IA 2D5VA 2XB5A 4RBOA 1B8IA 4MFEA 1UMQA 5F08A 1MBJA 2WB1N 2ZB9A 3BR5A 4GFBA 2YU9J 3MVPA 2O8KA 3S1NJ 1JKQC 4C3IJ 5K7ZA 2E2HJ 1TWAJ 1MBEA 3BTJA 1WPKA 3JRAA 2L7ZA 3GTMJ 5F27A 3CQZJ 4M3EA 3MN2A 2R93J 2KDZA 2HDDA 3S17J 2R5ZA 1JTYA 2IBDA 2DA6A 2AHQA 2JMWA 3K7AJ 1RETA 2L7FP 4DYQA 4X6AJ 1I50J 1I3QJ 2WAQN 5BNGA 1YRNB 2YUSA 1WH5A 2CUFA 2R5YB 3FIWA 3A01B 3BR1A 3SDGA 3G1MA 1B8IB 1RKWA 2P81A 1NK2P 1GT0C 1MSEC 4IHYA 1TWHJ 4V2FA 2Y2ZA 2ME0A 4XIDA 3I4NJ 3HB9A 1TC3C 1WH7A 2ECBA 3RZOJ 3H3VK 1O4XA 1F43A 3Q3SA 1ETVA 2EQRA 2NOGA 4XRSA 4J19A 4BY1J 2WV1A 3VPRA 2HXIA 1QRYA 3IH4A 2MW8A 3JREA 3H0GJ 3FK7A 5FKOA 5IP9J 1IGNA 1ETQA 3L1PA 3RZDJ 1ETWA 2LVSA 3OIOA 1IJWC 1A5JA 4XICA 1W0UA 1BW5A 3UKGA 1LFUP 1OCPA 3O8HA 3FK6A 1OCTC 2DMTA 1VI0A 3LSGA 5J1RA 4D7MA 1RESA 1DU6A 2LR8A 2KT0A 5GPAA 5M5XJ 1Y1WJ 4CYCB 2TCTA 2XGEA 2FD5A 1FEXA 4JP0A 4Y7NJ 2EZLA 2Y31A 1VF9A 3C2BA 4QSHA 5C44J 3S1QJ 3JRBA 4W1UA 3B6AA 1MBGA 5E3MA 5IYCJ 1D5YA 5IOZA 2NVXJ 2JA7J 4BBRJ 4A3LJ 3BG3A 3HGYA 2M0CA 3W6VA 3SJMA 5F0FA 3IV5A 3OOUA 2N8GA 3BTLA 4I6ZA 2RAEA 5EZHA 2DTZA 4XRMA 2H8RA 4UUSA 5DTDA 4A3GJ 2HXOA 1GVDA 2CJJA 1ETOA 1ZK8A 4MIMA 3M4OJ 2ECCA 4IHVA 1ITYA 3HOUJ 3S2DJ 2HOAA 2Y0SN 5M3MJ 2XSDC 2LD5A 1U8BA 2AO9A 2LY9A 1IDYA 4C3HJ 2CUEA 1NTCA 1FJLA 3HKZN 4X1EA 4L5EA 4M6VA 2NVTJ 4MFDA 2EBIA 1HDPA 3HOZJ 5C4XJ 2CRGA 3LSJA 1ETXA 4A69C 1ZGWA 1MSFC 2EH3A 2K9QA 2DMNA 3BR0A 2X48A 2JA8J 5EG0B 2CQQA 3S15J 1LE8B 1MH4A 1NK3P 2W48A 4JX4A 2DN0A 4XK4A
chains in the Genus database with same CATH superfamily
3I71A 4LG0A 3OYGA 2WAEA 2L02A 2M2EA 1KYZA 4OWRB 4RGUA 1IXCA 4N9HA 4EGZA 3HEFA 5KAIC 2ZFWA 3K70D 1ON1A 3VSKA 5D5XB 3LSRA 1AKHA 1S3JA 5TISC 3A0HC 2DPUA 3G1OA 5DUIA 3FXJA 1DP7P 1UHMA 1O7FA 3D5LA 1IAWA 3DXJF 1R1UA 4BJ6C 3JW4A 3OMYA 1WI3A 2VQLA 3HPHA 3KIOA 4IEJA 1KU3A 2DT6A 1SMYF 5FRMA 3HRMA 5HS7A 5K1YA 2OQRA 1U78A 2CW8A 1QZEA 4CCLA 1A35A 2GXAA 2E1MC 4IHXA 4IKFA 2FEZA 3B6CA 4YELA 1IRXA 2DA4A 3G6EI 2QCOA 2XF5A 2XPVA 2DI3A 2FU4A 1YFHA 1Z21A 5HDKA 4U0VA 3EUKL 5E3LA 2RVCA 2ME6A 4AWXB 2QKLB 3BOQA 4QIWN 3E6CC 4DBQA 3ZQFA 3TP0A 2EJRA 3H5NA 4FT8A 4M3BA 5IP7J 3L2VA 2DA1A 2OC6A 4F7ZA 1ZRDA 4YIFA 2E1MB 3EQLF 5IT9Z 1XC5A 2OQGA 2ZSHB 5EDNA 3H3ZA 5EJCA 2WY7Q 3BG9A 3V7RA 5LHHA 4ESBA 3HOXJ 5CKTA 5F6FA 2EINH 5E1ZB 5C4JJ 2YR2A 4KN4X 4X0GA 3PO3J 2DA2A 2MH9A 1IN7A 4YRVA 1SANA 2KJCA 2HI3A 3DEWA 3QU6A 5CLSA 2HTSA 4BXXJ 1I1SA 3HBLA 3OYNA 1WJFA 2K7LA 4LMYA 3HL2A 1V5EA 2DJNA 5IYBJ 2H09A 2FQ4A 3OSGA 4DBRA 2R7UA 3BPXA 3ESWB 3Q0VA 4PUSA 1GXPA 2L01A 5J4VA 2RN7A 2ETHA 4IZZA 1JUPA 1J09A 3WTXC 3F8MA 3LSIA 5M3FJ 2VKDA 4PSWA 3CC2I 2QQ8A 1E2XA 4NQWB 1G59A 4XKWA 1FC3A 3L09A 4ZC3A 3D1NI 1R4MB 3RYRA 4PJLA 1MBFA 3Q0WA 4L5IA 4FASD 2K27A 3T0YA 4U0YA 1QA6A 3ZQIA 2ZXJA 1YW8A 2TDXA 2WY8Q 5JVTA 2D1VA 1VQNI 4UVBA 2FNAA 3HOVJ 4A3BJ 4LGWA 2M34A 3J81K 4L0ZB 3HOTA 4LB5A 3QOEA 3AKZA 1J7KA 4BKXA 1K4TA 3O2PE 5HS8A 2EB7A 1U9NA 1BIAA 1IUYA 1Z67A 3HHHA 1HLVA 3DU6A 4WXHA 2LP0A 5GAHJ 4XLEA 1FX7A 3M8EA 5AIQA 4KA4A 5J4YA 3F3XA 2WV0A 4XOTA 1YYVA 3GXOA 2FMYA 4EJUA 1E0EA 2R5YA 4FE4A 4B09A 4G9YA 2FE3A 3COAC 4ESJA 4BEHA 3NWSA 4BHPA 2K5CA 3GTOJ 2R7ZJ 1BI2A 4XORA 2K3FA 3ZMSA 1O3SA 1ZQ3P 4HZFA 3ZMVA 4XSXF 3BQYA 2QVOA 2ZKZA 2D2WA 2F5EA 2F4IA 4MLOA 3OYFA 3F8CA 3OOPA 2FOWA 2OAZA 1JJ8C 4IF4A 5TJJA 2PJRA 4L18B 1S7AA 2BHYA 2CQKA 5J8CA 1WGXA 2CV2A 1SD5A 4ZTJA 4HYEA 3H92A 4CO8A 3KETA 3FHZA 2E5ZA 2IEKA 2DOEA 3KX2A 3JRGA 1QVTA 3IRRA 2HU9A 5KHDA 1YOVB 2GQQA 3HUGB 4YFKF 2CMPA 2W00A 1MMDA 3K4CA 4LIVA 2TRTA 2E7WA 3FXUA 4PK4A 4MTDA 2B9SA 4JQFA 4JX6A 1BIBA 2HYJA 4H4KC 2ZFUA 4E7KA 1WCMJ 3PO2J 2DA3A 2E19A 1QBJA 1MMGA 3PNVA 3ZMTA 3H3UA 1K78A 1Y8QB 1FOWA 2HQNA 3KEOA 1I6HJ 4IL6C 2NYXA 1P4AA 1RUOA 1WSUA 1TWCJ 4UB6C 2A68F 1F1ZA 1MMNA 4UUTA 3LSHA 3FISA 3CCSI 1L0OC 2VKEA 2W84A 3EYIA 4L0YB 4ZJZA 3BDDA 2IVMA 3LOCA 2DTRA 2XAUA 3WG9A 2R92J 5ED4A 3KP5A 3CMAI 3F9KA 2M1BA 2XASA 2MLKA 4EJOA 4ZTFA 4QTRA 3WTSC 1I3AA 5B5EC 5E1XA 4II3A 5B3SH 2VBYA 1J2XA 1OYIA 5FLXK 1W5SA 3ZCOA 5FKMA 1YIOA 4E7ZA 2GLOA 3BR3A 2OA4A 1VQKI 5FJ8J 3H36A 2DYSH 1ZR2A 2HYGD 5BPDA 5D5VB 1GUUA 2BY0A 1R6RA 2ZXIA 1HOMA 2G0EA 2V1UA 1WVRA 4MEYF 1U5TA 1MBKA 2ID3A 5BS6A 1W36C 1QVUA 2DQRA 2OV7A 3CMMA 1CQTA 2EZKA 1I27A 3ZQHA 4KT5C 4F91B 5D4SA 3OR2C 3CCQI 5GAEJ 4N0BA 1YITI 3I5UA 1G6NA 2HNHA 1LFBA 4AD9A 2EZHA 3H9JA 3K69A 4B48A 3C18A 1B72B 1Y1VJ 2L9SA 2ZMEA 2VI6A 3VODA 3CJQB 3W2WA 4BU2A 1Z91A 4RGSA 3N05A 2KIUA 3ZQGA 3I64A 4HW0A 3ROUA 3EYYA 1AA7A 5DYMA 1RPWA 5E3NA 2BW3B 4I98B 1HC8A 5GP9A 1LE8A 1I6XA 1S8NA 3KYDB 3RQ4A 4LK1F 5FRNA 1UJ8A 2JSCA 3DPLC 5K7HA 3GO5A 1I39A 4NHJA 2XPWA 3HSFA 3GFJA 5KNLA 1TW2A 3DF8A 4DW6A 3DWLE 1K61A 2EZIA 4IHSA 1B6AA 1WQ2A 1OLTA 3GTQJ 1TQPA 5DM6F 5LGNA 4C2MJ 1WJCA 4E70A 4XM3A 4M9SA 4MFEA 4ANJA 2Q1ZB 1UCRA 1HW2A 1EA3A 2DJIA 1HKSA 1OR7C 3MVPA 5B1BH 4D0PA 1JKQC 1YIJI 2JVHA 1ACIA 1XX5A 1T8IA 1MBEA 1WPKA 2WAFA 3DTEA 1ZG1A 3K10A 1REPC 4IPAA 2P7VB 2KPMA 2XF7A 4CXFA 4JK1X 3JAMZ 3DFGA 4U7BA 4LLNA 2P6SA 3TDUC 2JZYA 1HW1A 2E7XA 3H35A 3ZQ7A 4RS8A 1HBXG 2M3AA 1YE9A 2ZO4A 3OS2A 3VYRB 3CCJI 4A12A 4A0YA 4DYQA 1I50J 2PX9A 1G3TA 2VIXA 1I3QJ 2BXZA 5DCFA 2WTEA 2Y48A 2YUSA 1BI0A 3KZIC 3SQNA 3IP4B 1KU9A 3CC4I 4LITA 2KIFA 2PN6A 3FKJA 3ZMUA 4RB0A 2E35A 2O8XA 2R7RA 1GT0C 4BXUA 1UZCA 4PGGA 4IHYA 2DFHA 1P6RA 2A6TA 2XF6A 2M45A 4F92B 2I8DA 4V2FA 2E60A 1W7PA 2HGCA 1YS6A 3RZOJ 2M7BA 4UY8I 2V26A 2IXSA 1YTYA 3QAHA 3BCAA 2EQRA 3ZP5A 3I9V2 3PFIA 1GLNA 4B44A 3F8NA 3PL8A 3H0GJ 1YS7A 3FK7A 5FKOA 2FNPA 5L3EA 1YO5C 1ETQA 4UV9A 3L1PA 2QEXI 1LFPA 4J00A 5JI6A 1ETWA 3OIOA 1BOAA 1DGRM 2V9PA 3MKWB 1W0UA 1XGOA 5KK1A 3GFMA 2P5KA 3QP6A 3AAFA 1OPCA 1LFUP 2PQ8A 2OD5A 4NQWA 1ZAOA 2IGKA 2ZXHA 4BAYA 3LFKA 3FK6A 4S05A 3J7AO 3GF2A 2NS0A 4PFPA 5E17F 2GXGA 4M9XA 1XDSA 2EFQA 1FOXA 3ABKH 4D7MA 2H27A 4OOIA 5CVIA 1IZ1A 3DKWA 4CYCB 1O3RA 3I0TA 4RAZA 2XGEA 2FD5A 1Z6TA 1QZYA 4U88A 1LKXA 3GLLA 4DIQA 2VJ4A 3ZMZA 4BH9A 4Y7NJ 3C2BA 1H0MA 1YHQI 1XGNA 3TKYA 1FMVA 3S1QJ 3S3MA 1XMKA 2L9NA 3OWTA 2WC2A 3K6GA 4RLQA 3TGNA 4N4OB 1TT0A 4W1UA 4KJZA 3JTGA 3IUOA 5DCMB 2EV0A 5IYCJ 3GWZA 3WTVC 1W1WE 3BG3A 4L5JA 2FUG2 1B9NA 2L2OA 5L3BA 1ZLJA 1X4PA 4C9YA 4WCGA 4AVPA 1WRJA 3SJMA 3IV5A 4ENMA 3OOUA 3GZ5A 4O5VA 2CW0F 2R7FA 3E6DA 2MD0A 1EH8A 4XRMA 3ECOA 3KFWX 3HSRA 3K70C 3EUHC 2CJJA 4CGZA 1VQMI 2DFIA 2ECCA 4GO1A 4IHVA 1ITYA 3RJPA 4GDFA 1O57A 2IA2A 2HOAA 2KMUA 2Y0SN 3TL4X 2XSDC 4GRIA 2LY9A 2QQ9A 1QHHD 2CUEA 2ZCWA 2NVTJ 4ZZLA 1K4SA 3HOZJ 2W1OA 3BY6A 3DLAA 4OU0A 3KLNA 2CRGA 3OS0A 4BJTA 4RB1A 3QOPA 5HLTA 1P9QC 1ETXA 4A69C 2NNYA 1ZGWA 3EUAA 1LVKA 3HUGA 5FB2A 3H5AA 2VBXA 2JA8J 3A0BC 4KICA 4Y3OA 3EDPA 2W48A 3KEYA 4JX4A 2PLYA 2Z16A 3LAJA 1IN5A 3TMOA 5ILUA 2UXNA 1DPUA 4W97A 5CVJA 1G2HA 1H89C 3GW2A 4KUMA 1OCOH 4A3JJ 5GAGJ 1TWFJ 3RPQA 4G7ZF 3TOAA 3RKQA 3J7AY 2LF8A 3P5JA 4UNOA 1K83J 2IRFG 1V54H 2XAJA 3K4JA 4RDUA 4Q4ZF 5J1YA 4YFNF 2UXXA 3P9CA 4BE1A 1B4AA 1UHSA 2COMA 2PJPA 2OTJI 3K1NA 2F5FA 1MNDA 2GOXB 2Y0SA 4Y33A 3GVAA 1STZA 3ABLH 2DA7A 3PFYA 3U21A 5DDGA 3J81Z 2EFWA 2ZXWH 4KYWA 3ZGKA 2W4SA 4BQQA 2EV5A 3CP2A 3V8KA 2X6YA 4B3XA 4JBAA 5B1AH 2IA0A 2HOEA 1ZLKA 4CSWA 1YJWI 2GZWA 4A3DJ 4CDGA 4DJAA 2E36A 2VPLA 2Y69H 2AS5F 3EPZA 3FXLA 4ZZDA 3V7SA 1JI8A 1SAXA 4M3FA 1W5TA 4E4HA 2LLKA 2QBYB 4I7HA 3BR2A 4N4NB 3JRDA 3S1MJ 2DMQA 3W2AA 1ZTRA 3FXQA 3HGGA 5J3LA 1B72A 4EJTA 4XSZF 2MLGA 2R7DA 2MGQA 4XLHA 5GADJ 4EMSA 1Z1DA 2V6EA 5FKKA 4HLXA 1IV6A 1JT0A 1XSVA 4BQAA 4Y52J 4HX7A 4II2A 4HNTA 2Q2EB 1IDZA 2VUMJ 3FMSA 2NAZA 5E8IA 5FFXA 1F9NA 1JGGA 2BBYA 3BG6A 2VB6A 3G4SI 2BW3A 3MZHA 1F5TA 1BN5A 3NARA 1S72I 1EH7A 2OPTA 2EILH 2BVLA 4A3KJ 2PMZN 1V3FA 3ZMDA 1R9TJ 4RGRA 2FQ3A 3CLOA 3NWTA 1QPMA 1G3YA 2A3SA 1FTZA 5M5YJ 1MNMC 3V8JA 4XRFA 2F5VA 2XGXA 4C30A 1ZYRF 2XAFA 3LA3A 2EV6A 3GYHX 4NC6A 2CSOA 3LQRA 1RKTA 2IS2A 3E5QA 3DEUA 3QODA 4FTHA 4XQFA 2LKPA 1MNEA 3ECHA 5EGOB 5LGTA 1EH6A 4L9JA 2ID6A 1GHCA 4I01A 2O3FA 2P5LC 3HOYJ 5JR3A 2V9KA 1KQ9A 2UWMA 3R61A 5EEAA 4HOBA 2DLLA 2NXNB 4FISA 2L3DA 1OR7A 1XB4A 1HDDC 3Q5FA 4HG2A 4IO9F 2QYOA 5FLXZ 2A61A 3WU0A 2D1HA 4HX4A 2EFOA 2COBA 4FQGA 1EJ9A 1N75A 2FRHA 3ONQA 2BZTA 3WODF 1EV7A 4AC0A 2PMZA 4UUSB 2NVQJ 5TRDA 1SAUA 3O3KA 4FCYA 3CCYA 5EF6A 3E6BA 2NOJB 2WBMA 1DQUA 2LOOA 1DGWY 2V9VA 1HKQA 4D5CA 5A2QK 1HW5A 3H9GA 3N4MA 1LEBA 2A6EF 3VOEA 3ZXSA 1JE8A 4GCVA 3MKYB 3WGGA 1ZARA 3T5XA 4MHGA 3K4BA 2QGUA 5E8GA 5E3OA 4ON0A 2JVGA 3I55I 4BE0A 1IV8A 1QQIA 3RQIA 4B4CA 3OYBA 3J7ZI 4M6XA 3BQZA 1ULYA 1BW6A 1G4DA 2JPBA 4XRSG 3E97A 3BT9A 3G3ZA 1W5CC 4A6DA 1MH3A 2ISYA 1TBXA 1RR8C 1QNTA 2K02A 3AG3H 3ELKA 3CUOA 3DKYA 1XDUA 1IN6A 2VXDA 1R22A 1APLC 1B9MA 5CQGA 1X1CA 1K6YA 4CYCA 1PUFB 3O8GA 1JTXA 3WTZA 4UVCA 2E1OA 3KP3A 4AU7A 1GVJA 1ZELA 3KZZA 3OR1C 4HPQA 3S2WA 3LA2A 3TW6A 1WHUA 3FBIB 1TTYA 1WJDA 3MWMA 1A6QA 1T38A 5DCMA 1FIPA 3VDXA 3L9FA 2HPIA 2KZVA 2L4AA 1J0RA 2XAQA 1Z0XA 3K4KA 2KQRA 2X9DA 5EYRA 5ILVA 5HOOA 1P7JA 3FKIJ 4XLFA 3E7LA 4IVNA 4IX7A 3VYTB 4KISA 5IY5H 3RKXA 1F36A 1P7IA 3NRVA 3Q9VA 3ASNH 1R23A 4ZYAA 1R71A 5K5QA 5F0HA 2R7QA 3BG7A 1LPQA 2STTA 3AG4H 5JFRA 4AM3A 3QPLA 1KQ0A 3CD6I 2JQ7A 3IKTA 4C2TA 1JUMA 2JA5J 1TNSA 3CCVI 1PP7U 1Q1VA 4P9UA 4BDYA 2MG4A 4XLAA 4KMUX 2ZJRF 1OJLA 2F6CA 4I2OA 3QQAA 2PBIA 3F21A 1MJAA 1X3WB 2RV8A 2AQEA 2NNNA 3EUHA 2QSFX 2HYFA 2IA1A 2I10A 4HBLA 1GV2A 1YI2I 4EM2A 3K2AA 3WHBA 1FIAA 3VEPA 1S5LC 5GTIC 1FOKA 1HCRA 1H9GA 3Q0UA 4FX4A 1Y39A 2CFXA 2E2JJ 3ZQCA 2O9LA 1ETYA 2V1NA 3D5SC 2IAIA 1B59A 2QSHX 3NAUA 4DOZA 5JLWA 2M5WA 1R00A 4CYDA 5IP6A 1JKPC 4A3CJ 2KRFA 1Q1HA 5K5RA 1AU7A 2MSYA 1Z9CA 4DQ2A 2BXYA 2UV1A 2XB5A 5H6QA 3GLXA 3T8TA 3M8JA 1P4XA 4XKCA 5F08A 1OCZH 5H20A 2RKHA 2X1DA 2ZB9A 3KE2A 4RB3C 2YU9J 1KONA 3S1NJ 1BBYA 5CVRA 2HS5A 3S32A 1BC7C 5J6XA 1FBQA 1DPRA 4XBFA 4AVZA 5LGUA 2FSWA 5F27A 3CQZJ 2K4JA 3U1KA 2P5VA 4LLLA 4Y17A 5DD8A 3ERED 2BY1A 4IRIA 1Z7LA 2VC0A 2VC1A 3T8RA 1JTYA 1RETA 1TNTA 3FM5A 3FM3A 5GTHC 2RGVA 2L7FP 4R1HA 4X6AJ 2PG4A 3CTAA 3CF2A 4KFCA 4A0XA 4E6KG 5BNGA 4HRIA 1WKMA 3PSIA 2ESNA 5ERIA 2QBYA 1WH5A 3FIWA 4LFUA 4BHBA 3WGIA 5E79C 3BR1A 2KDOA 3TO7A 3SDGA 4ZYHA 1B8IB 2ICWG 1XTAA 2LMDA 2EA4A 2DT5A 1NK2P 1SVLA 1MSEC 4EJWA 3HZJA 5D6EA 4ZYDA 3F8FA 2H94A 3E5XA 1G3SA 4E7JA 1TWHJ 4HQEA 5J47A 2Y2ZA 4PCQA 5E18F 3BZ6A 2Q2EA 1HA8A 4D1QA 3OIQA 3GUDA 2BY3A 3HB9A 2UZKA 1TC3C 1KQ8A 3H3VK 1YX5A 2W25A 2IGOA 3L00A 3PNYA 3HKZA 4OAZA 2HQRA 1ETVA 4XRSA 2AXLA 1O3TA 3F6OA 2W7NA 1DDNA 1Y0UA 2VT2A 3VPRA 4HDUA 2HXIA 3IH4A 2WWYA 1FYLA 3OYKA 3RZDJ 3BJAA 3CESA 2KL4A 1A5JA 3L2RA 3LSKA 2LYCA 2J5PA 1FBUA 2IGMA 1P92A 2DCEA 1OCPA 1R5HA 2DODA 3RIRA 4Y4RA 4XNFA 2X4HA 3FZVA 3MEXA 2DMTA 2MABA 3B02A 4I09A 2H1LA 1RRJA 3ERMA 2WA0A 1PDNC 2CO5A 3GX4X 2LR8A 4BL0B 1R36A 2GIVA 3FDYA 3QP5A 3C7JA 1X1PA 1JHFA 2EZLA 4QSHA 3VYSB 2ISZA 3BWGA 2NRAC 3RKWA 1VTNC 3HG9A 1ZN2A 4LIUA 3I58A 2QA4I 1D1CA 3A1YA 2MC3A 5IOZA 3ULQB 2JA7J 1J9IA 1RI7A 5BQTA 2VQGA 3MCZA 4AIDA 2CYYA 4A3LJ 1VQOI 4XR6A 5F0FA 1N25A 3UNGC 4I6ZA 1XN7A 2R4GA 2R7OA 1SVMA 5D4RA 1USTA 2DTZA 3I4PA 2M4KA 4UUSA 4IQ4A 2CH0A 1W7PD 1W4MA 1ETOA 1ZK8A 4HV5A 4MIMA 3E6MA 2V1XA 4KMFA 3BROA 1S9HA 1HKTA 4HSRA 2JT1A 5HVQC 2L9VA 3HOUJ 1TZLA 4LB6B 2JRTA 3NEUA 3PNTA 3S2DJ 1DP3A 1IXRC 1U8BA 2AO9A 1WJBA 4P5OA 2R7VA 1YJ9I 5D5UB 4XLNF 1FJLA 2XKOA 4L5EA 4M6VA 3U9GA 1F4KA 1G8XA 5HLIA 2HFHA 2OZUA 3PQKA 2ZNZA 3VWBA 3LL7A 2CWEA 3L2WA 5E20A 4ENKA 3VFZA 1LJ9A 3U2RA 1T0FC 2EH3A 4BUPA 2O0YA 4S04A 2X48A 3KEQA 5HNHA 1ZRFA 4OIPF 5J40A 4I0BA 3S15J 2JA2A 3WU1B 1AWCA 3BP8A 4YEJA 1FYKA 5IT9K 1KU2A 2DN0A 2K9LA 4XK4A 3K2ZA 4LLGF 2Y9ZA 2JWTA 3A02A 5C3EJ 3OS1A 1D8KA 3M8FA 4OIQF 1ZR4A 2QM3A 1E17A 3I54A 3PJRA 3RYPA 3RKYA 1PUFA 4MEXF 2E1CA 3H5RA 3DQVC 1N77A 3I56I 3CO7C 1LNWA 1VQPI 1Z3YA 3ABUA 2QLZA 1YG2A 3CLQA 5L3FA 2P7CB 1FBSA 2DYRH 3CUQC 4A3FJ 4S0HB 2VLAA 1VQ7I 4A3EJ 2CQNA 4R79A 5JHFA 1X19A 5FLVA 3OL3A 3EETA 2HQAA 2M8GX 4M9ZA 1U6GA 4WK8F 1R58A 1BJAA 2FJ1A 5J1UA 4ZYEA 5FFZA 1JHHA 2L0KA 5ICGA 3H9QA 2H1KA 4A0ZA 3ABTA 2M0MA 4ETSA 5K7FA 2AXTC 2VKVA 4P9FA 3F0CA 1CF7B 3CUQB 4RAGA 1T08B 3FBNB 2E71A 3ZOBA 3GBGA 3CCLI 1X2NA 4NDLA 1ZH5A 1BL0A 1O3QA 3CDIA 3A2KA 5DEQA 5J8FA 2FXAA 1KA8A 4AYBN 1W0TA 1R49A 3SZTA 1K7AA 1MKMA 1R5GA 4HX8A 3CF5F 1JKRC 2OCCH 4V2GA 1UAAA 2JPCA 3PIPF 1XSXA 4HQMA 4OMYA 1E3PA 2LDUA 4YIRX 1BC8C 2F4MB 2YS9A 1O7LA 5A2QZ 3JR9A 4A3IJ 3TP3A 5F1JA 1WJ5A 2YX4A 3R60A 3JRCA 3RSNA 2RNGA 2L9RA 4E7IA 1IRZA 2EFPA 5ICCA 3GZNB 2FMLA 4P55A 1ZRCA 2K3PA 1E3HA 3X2QH 5L3GA 4XOPA 1TQMA 2PMUA 5GPCA 3ISPA 1XSDA 3GFLA 4WXCA 1SFKA 2IGNA 4XMYA 1AOYA 5FD5A 1Z3XA 2GBYA 1TL8A 4DYRA 2VN2A 1YX3A 1T95A 1WJEA 3PIOF 5D8KB 1MZBA 3GZ6A 4IHWA 3GTPJ 1MW7A 2XAGA 1V55H 4E7HA 4BS9A 3OYIA 4M3DA 3BTIA 1MD0A 4RM3A 5FKLA 4A3MJ 3MMYB 4IOAF 3PM1A 2EIMH 1RC9A 4EVIA 1YQAA 2XHKA 2VJIA 4CHUA 1FP1D 2R7WA 4AIJA 3M3YJ 1T33A 3JSOA 4WXDA 3CDLA 3RPUA 4B47A 4AYBA 1SMTA 2DMPA 3M1EA 2RQQA 3WG7H 1X58A 2HPMA 1ETKA 1K6OA 3QPHA 2XGDA 2LFBA 3BJOA 2X1CA 3J80K 2XIGA 1NG6A 3BG5A 4G7HF 2A6HF 1NH3A 3JRFA 4I02A 1P4WA 3IRQA 2KISA 2A05A 1EF4A 4B3AA 1BJZA 4PJNA 2KKOA 3GTLJ 4CCJA 1MJBA 2BVMA 4ABZA 1FPQA 4FHTA 1OISA 3PSFA 2P6TA 3MAJA 2K85A 5IOYA 3DBRB 4DZJA 2F48A 4BJ5C 3OY9A 4CZCA 4EQQA 3CCMI 4UXNA 4IRGA 5KVRA 2L7KA 4NUBA 1R5ID 3K4NA 4BYYA 2WADA 3OYLA 1TW3A 5LRSA 2F4OB 5DS9A 4RM2A 4I99C 4LG3A 4ZDOA 2LTPA 4CCMA 4E7LA 5LEJA 2FBHA 2OF7A 4Y13A 1VQ6I 4KDPA 4QLCU 3F6VA 1RZ4A 3H1CA 3IAS2 4KITB 2DO7A 2AQFA 5HODA 3JTHA 1T2KA 4EATA 3QPTA 1SFEA 4P96A 3LSMA 5EZGA 2EIJH 3PQJA 2JK3A 1UB9A 1ZKGA 1VQ5I 2W57A 3KLOA 1QGPA 1D3YA 1YLFA 2B0LA 4RAYA 3GTGJ 3LAPA 1FT9A 1X2MA 1R4NB 1XS9A 4FE7A 4LJZF 1MBHA 3O6BB 4JX5A 3MFKA 4QPQA 2CQ7A 4DZPA 2PJRB 3OYEA 3C3WA 5JLXA 3T1BA 3ABMH 4CA0A 1JT6A 1ZREA 2WB1A 3HDDA 5KAFC 3TW7A 2K4BA 1Z05A 4M3GA 3TOBA 1U2WA 1SC7A 2XVCA 4O6JA 2EIKH 2CU7A 4PFOA 2L54A 3VYUB 3CC7I 2FX0A 3FHNA 3TEDA 4AIHA 4BNCA 3JRHA 1PVEA 3I3LA 1XGSA 1V5GA 2O03A 2OU2A 1ERDA 1JJ6C 2R0QC 2DFEA 2LREA 3U1DA 2KIMA 4NC8A 3W2VA 3HSEA 4UB8C 1Z77A 1ENHA 3BR6A 1QZZA 3FMQA 1AHDP 3ZR8X 4IJAA 3H0DA 4K2EA 1VQ4I 2GAUA 2BGCA 3WE2A 2PEXA 2OUMA 4ZH4F 4HLYA 3HYIA 2ZJ2A 3DP7A 4BE2A 3L2CA 3QYBA 1D8JA 1GV5A 4MNUA 1D1AA 2XC7A 5B66C 3F8BA 2ELKA 3NQOA 1FZPB 1IUFA 2MYSA 1X4OA 3S14J 2JUGA 4PGHA 1HXDA 3JSPA 2F5DA 1M1EB 2P4WA 3KP7A 2GXBA 1JUSA 3K0LA 2G7HA 1A04A 2JTVA 2XRLA 5L3DA 2HKOA 1LVAA 2L7MP 1H88C 2CV0A 3M9AA 1IW7F 3ZQLA 1S6LA 3HIFA 2MFZA 3DBHB 3SFIA 1T0FA 3BTCA 4DGWB 4A6EA 2D5VA 1A6IA 2OBPA 2DDBA 1TP4A 3BJ6A 1UMQA 1KU7A 2VQCA 3BR5A 3K4MA 2QSGX 2O6GE 4GFBA 5LHGA 2M30A 4C3IJ 5K7ZA 2E2HJ 2Q8KA 5CVVA 4XKVA 3JRAA 2L7ZA 3GTMJ 3PUFA 4HAMA 1X1BA 4BGDA 4ZYGA 4PJMA 3MN2A 2R93J 4ASNA 2KDZA 2LF7A 3N97A 2OTLI 1I1GA 2HTJA 2KFDA 2JMWA 4XONA 2VONA 2LKSA 3SYTA 4PSXA 5DV5A 2VKHA 1CF7A 3CUQA 4BXFA 3E5UA 3C1DA 1YRNB 2RREA 2YSRA 3I53A 2BV6A 2HR3A 1R1VA 3I59B 2CUFA 1LUJB 3HXLA 3A01B 4IOCF 3G1MA 1RKWA 2DDAA 2P81A 1Z7UA 1LDDA 2LG4A 3A4CA 2CG4A 3HHGA 1S29A 4QWQA 1X3UA 2EK5A 5F64A 3DLLF 2F5CA 2ME0A 4IQJA 4Z2YA 4XIDA 3R6SA 2XSJC 2ECBA 3IKVA 4OIRF 3L7WA 3M7GA 3IL2A 3HC7A 1O4XA 1F43A 3Q3SA 1X1AA 5IT3A 4KIBA 4J19A 4P1WA 1WJAA 4BY1J 2WV1A 1KYWA 1BM9A 2CUZA 1BR1A 3JREA 3AG2H 5IP9J 1IGNA 1T98A 1UELB 3JCUC 3QYEA 1LEAA 4XICA 1BW5A 2Z3YA 3UKGA 4E7SA 3WU2C 2IS4A 1ZGAA 2QQBA 2HVRA 1BOBA 4F52A 1OCTC 1VI0A 4PJJA 1T39A 3MD2A 2B7EA 1DU6A 2DQLA 2QENA 2TCTA 1W7PB 1FEXA 4JP0A 2DOAA 3IWFA 1FMWA 4CCKA 1TLHB 1VF9A 5C44J 2BE5F 3JRBA 3FX3A 1N78A 3R0AA 1OCRH 3WE3A 3GFIA 3B6AA 1VQ9I 2IS6A 2YU3A 1B1BA 4G8XA 2X51A 3V8LA 2IW5A 3DKXA 1IXSB 1XCBA 2E34A 1K79A 2ELJA 2VXZA 1BR2A 1ONVA 2K9MA 3R0JA 3G2BA 3ZPLA 1SD4A 2RAEA 1QHGA 1TT5B 3D5RC 1L3LA 1IF1A 1VZ0A 1XD7A 2KZGA 1SD6A 3E1SA 3P9KA 5EZHA 2H8RA 1WI9A 5DTDA 3CDHA 2VODA 1GVDA 2X0LA 5BOXA 5D8LB 2L4MA 1D0YA 2OZ6A 1FSHA 4HA8A 2G7UA 2QWWA 5BPIA 2Y0MA 1NHAA 2IP2A 4QPOA 3SZGA 2KP6A 5M3MJ 5BMZA 2IT0A 3HRUA 5LFAA 2MBFA 2E1NA 5HLGA 1NTCA 3HKZN 4M6YA 4DNCA 4AIKA 4M74A 4HNUA 2CS3A 4OAYA 4G7OF 3HPGA 3OL4A 4BQOA 1MSFC 2K9QA 1X3ZB 3IC7A 3RDIA 2M87A 2DMNA 3K1PA 1OYWA 1HSTA 4CICA 5EG0B 3OYMA 1PUEE 2NVUB 4EV0A 2Z5UA 1MH4A 4Q48A 3V7CA 2VJJA 3SEZA 1POGA 3IAM2 3DCFA 2CFOA 2O5RA 4XLPF 3MKZA 1MDMB 5E1WA 4EEFG 4U7DA 3AL0C 2QF7A 3BC8A 2DU9A 3CJTB 2M4GA 4A5MA 3F72A 2MD5A 1X1DA 2HOSA 4BY7J 4NNJA 1OKRA 2MA3A 4I0AA 2CGPA 2VASA 4KNYA 2NS8A 3LWFA 1SEUA 4HF2A 1SFXA 2HDWA 2CQXA 1CGPA 2LBFB 4U87A 1BA5A 1T6SA 1ORKA 1R7JA 3DTIA 5JHUA 1Y6IA 3AL0B 4OMZA 1QU3A 5CYVA 5HDNA 4GYGA 3IH2A 2BY2A 3TO9A 4D7NA 4M71A 2QQAA 5ICEA 4HSTA 2R5ZB 4BBSJ 1IO2A 4CZZA 3GCMA 1T56A 2I5UA 4RAFA 5L3CA 5EEGA 2KRCA 2P0WA 3W3CA 4AUXA 3J80Z 4HV6A 3REOA 1XG1A 2Y9YA 3SFZA 2CV1A 3QYFA 1MGTA 4EM0B 4RB2C 1FTTA 2F2EA 4LD5A 4LK0F 4MO7A 1QO0D 5IPAA 4MTEA 4Q47A 2QUFA 4G6DA 3BZCA 4PDKA 5D5WB 2HKXA 1A36A 4DYCA 3HOWJ 2ZJPF 4ZDLA 1H9TA 2JJ7A 5K5OA 5EGOA 5LHIA 5H6RA 5CJ9A 2HEOA 2K9SA 1FY7A 1KZHA 3K9TA 5M5WJ 2GA1A 3P7NA 3S1RJ 4XL9A 1XCVA 4YFXF 4Q5SF 1IRFA 2ZJQF 1OFCX 4F3QA 2R7XA 2W24A 4A5NA 3V4GA 3RI4A 5D6FA 3GTKJ 3ZRGA 5LLQA 2HVQA 2LY1A 2VJ5A 4C2UA 3KPHA 2LRDA 5FO5A 5FKNA 3SDBA 3HRTA 2VBZA 2YPRA 2XB0X 2JSPA 4BHCA 2VE8A 1XPXA 3M1CA 3ML6A 2BOLA 3K1MA 5F0CA 4CCOA 4EJVA 1I5ZA 3OYJA 1XMAA 4V19K 3CJRB 2X6WA 1BI3A 3CP8A 1RNLA 2O7OA 4HF1A 1PYVA 4XN3A 2G9WA 4KT6A 3ZN1A 1J5YA 3F23A 2B63J 1JKOC 4BACA 2M9HA 3DU5A 4ENNA 2OCEA 2HZDA 3V42A 1EKEA 4G12A 4B8XA 2ZNYA 1IN8A 1Z6RA 2W82A 3DPUA 2LKXA 4LOCA 4PJ0C 4OIOF 1GDTA 2GWRA 1UFMA 4A93J 3C2HA 5AIPA 2XRNA 3TBIA 1YRNA 3HM5A 2V79A 3KYCB 4I76A 2H6BA 1JGSA 3I59A 5ICFA 1MMSA 4L9NA 2HDCA 4UV8A 5HLHA 3A01A 1PJRA 3OSFA 1WWXA 3AFHA 1HF0A 2HOTA 4M72A 2X6OA 2FOKA 3HTUA 4HNVA 1FSEA 1MMAA 2OJED 2VPRA 2JRMA 4L9VA 2XPUA 2LK2A 2P8TA 1DU0A 2HVSA 3GTJJ 1Y0NA 1S7EA 2KRHA 4NBQA 2V7FA 3M07A 2LNBA 2Z9OA 2KIQA 6PAXA 2L5QA 4XLCA 1HSJA 1VQ8I 5FLMJ 2J5OA 3MZYA 2FA5A 2ESHA 2Z33A 5FROA 2EA2A 5LD2C 5LRRA 2NS7A 4M73A 3OYCA 4MQ9F 1FP2A 1G3WA 2V1DA 1VQLI 4JOMA 3MKLA 5F04A 1SFUA 1IN4A 3I4MJ 4G6QA 3LMMA 2V6CA 4UVAA 2DMUA 4CCNA 2RNJA 2GM4A 3Q9SA 1LDJA 3WHCA 4KN7X 3LSPA 3GEZA 1C0WA 3DV8A 2XAHA 1WZ2A 5JVGF 3S16J 9ANTA 2IPQX 4G94A 2Y30A 3A03A 2K40A 4LG0B 3IH3A 3RPUD 3S2HJ 4A2UA 1D0XA 2LY2A 4C3JJ 4JYKA 1VFCA 2Y75A 1ZG3A 3IWZA 1RIOH 1FLIA 2X6XA 3CZ6A 1Y8RB 2VL8A 2YX7A 4MQVA 3E0JB 1YW9A 5EEHA 5ILSA 2DK5A 2BEOA 3BLYA 1ODDA 1ZHFA 3DEEA 3HOSA 1IC8A 1AKHB 3OYHA 2DT7B 3S3NA 3QPSA 1HQCA 2CW7A 2M8EA 2Q0OA 1U8RA 3P9IA 1YW7A 3FXKA 3WTUC 1E3OC 3KCCA 2EWNA 4F93B 1U9OA 1MIJA 1RR7A 4RGXA 3JRIA 1SFOJ 2A69F 3C2GA 4D9JA 2NVYJ 4WF2A 4GGGA 3LNQA 3CCEI 2FBKA 1USSA 3CCRI 2JA6J 2RDPA 3G1LA 3W6JB 2K9NA 2DPDA 3K4LA 2GA2A 1QPIA 1FNNA 2Z2SB 4B1RA 2ZSIB 2JN6A 1LDKB 1WFXA 2VQHA 4R8HA 3UR3C 4IXAA 2XGCA 2DA5A 5IYDJ 3BPVA 3CMEI 2D45A 2VT3A 3SZPA 5CPRB 2E2IJ 4D5FA 1DUXC 2ADUA 3AG1H 2QZ8A 3OYDA 2R7SA 2MC4A 2ELHA 1OQYA 1U3EM 2JUCA 3VSLA 5H2FC 4HF0A 2LC2A 2W85A 3PUBA 2HZTA 5HDGA 2R3SA 1IG7A 5KCMA 4UUVA 1VNDA 5DM7F 5EG0A 2R7TA 3RCOA 4XN0A 1H8AC 3MQ0A 3FF5A 1UG2A 1TWGJ 1XMXA 2V4JC 1A31A 3W6KB 5AONA 1MJ9A 1OCCH 1OYYA 4ENJA 3R4KA 2FBIA 3B73A 4YG2F 4XKBA 5FD6A 3KZYA 1MDMA 3DPTA 3KP4A 3CMYA 2A5YB 4RLFA 2EPFA 1KGSA 1R1TA 3ASOH 4KIGA 2FF4A 4L9TA 2HQ5A 4Y15A 1S7OA 2BHZA 1W36D 4RBOA 1ON2A 1B8IA 3TDZC 5CVUA 2ZBKA 5FGMA 2KLOA 3SHFA 1MBJA 3TQNA 2WB1N 2X1EA 3L2QA 1LB2A 4N9IA 3HRSA 2O8KA 3FXMA 2LBFA 1FWZA 2HWVA 1TWAJ 3BTJA 2DAOA 1SD7A 2A5WA 4M3EA 1P2FA 2HDDA 2DW4A 4EGYA 2R5ZA 3S8PA 3S17J 4HDVA 4H0EA 5DUKA 4RMNA 2IBDA 2DA6A 2AHQA 3K7AJ 4BDZA 3OIPA 4U0WA 1V5FA 3S93A 3WGHA 2PFBA 1JXSA 2WAQN 1UHWA 4KIFA 4ITVA 2R5YB 1SVOA 3BCBA 5LBQA 1FYMA 4YIIA 4BEHB 3L2UA 1J75A 2CUJA 3F22A 3OYAA 5TGTA 2A07F 3LFUA 2DK8A 2MH2A 4J01A 5DD4A 5F1RA 2VOOA 3SXYA 4TV7A 1D1BA 4CH7A 3DBLB 3I4NJ 1WH7A 2XDVA 1ZGJA 2X85A 3QWLA 1UG0A 1V4RA 2XV4S 2PI0A 3FWEA 2VBWA 2PMHA 2H6CA 2M7AA 1YJNI 2NOGA 1RUNA 3HJEA 2KJBA 2LSOA 2UUZA 2XROA 3VB2A 1QRYA 2MW8A 3LA7A 3ZN0A 2XKPA 4B43A 4NC7A 1D0ZA 3WTYC 4OINF 4FETA 2LVSA 3WTTC 1IJWC 3IHUA 2IJLA 2XUBA 2DFFA 4EM1A 2QKMB 2DXIA 1J59A 2STWA 3CO6C 4Z6YA 3O8HA 2C6YA 1PP8F 4BQNA 3LSGA 3DTKA 4RA2A 2E5NA 2DBBA 1ZG5A 4FX0A 2WAQA 5LEKA 1K78B 5J1RA 2O61A 4CUGA 3KP2A 1RESA 3LQQA 3CCUI 2KT0A 5GPAA 2LH9A 5M5XJ 1Y1WJ 2BYVE 4ZDPA 3JAMK 2DOFA 3RTRA 3J7YJ 2Y31A 3FMRA 3GMEA 3OV8A 2Z99A 3SEQA 5CQEA 2IS1A 1NG7A 2ZC2A 1U5TC 4MGRA 1MBGA 5E3MA 1D5YA 2NVXJ 3D0SA 4BBRJ 2K86A 2RC4A 2M0CA 3HGYA 3S3OA 3W6VA 2N8GA 3BTLA 1IRGA 4HEA2 4WX9A 3ZQQA 1TQIA 1BI1A 2VE9A 1OMIA 4UHTA 1BR4A 4A3GJ 2HXOA 1U5TB 2H8WA 2ZMEC 3QU3A 1Y56A 4WWCA 3M4OJ 1U0JA 3G73A 3E3VA 1XGMA 3G71I 2GIZA 2RQPA 1LQ1A 3FXOA 4IHTA 4O3MA 2LD5A 4GXOA 2Z1DA 4PZJA 1IDYA 4C3HJ 5HS9A 3WTWC 4X1EA 4GYIA 2GOMA 3CJNA 3MZ8A 3HTSB 2ZMEB 2KHMA 4MFDA 3LSTA 3KP6A 1D5VA 2EBIA 1HDPA 3BZKA 5C4XJ 5HNFA 3FXRA 1FOYA 3LSJA 2ACJA 2EFNA 4ESFA 3QRFF 3KYLA 3BR0A 4G6TB 1GXQA 3TO6A 2CQQA 2VOPA 1LE8B 4IRHA 4F55A 1NK3P 4NB5A
chains in the Genus database with same CATH topology
1POGA 3DCFA 2Y9ZA 2JWTA 4W97A 3A02A 2M2EA 5C3EJ 1G2HA 1H89C 1ZR4A 4A3JJ 4EEFG 1TWFJ 3RKQA 1PUFA 2QF7A 3HEFA 1K83J 2HOSA 4RDUA 4BY7J 3LSRA 1AKHA 5J1YA 2NS8A 2CQXA 3G1OA 1UHSA 4A3FJ 1BA5A 4S0HB 4A3EJ 1ORKA 1WI3A 2DA7A 5FLVA 4IEJA 3IH2A 2M8GX 4D7NA 1U78A 2FJ1A 5J1UA 2R5ZB 2L0KA 4IHXA 3B6CA 4BBSJ 1T56A 2H1KA 2DA4A 5K7FA 2QCOA 2XPVA 2VKVA 4A3DJ 3F0CA 3ZOBA 4AUXA 5E3LA 3GBGA 2ME6A 4QIWN 1X2NA 4M3FA 4NDLA 1XG1A 2LLKA 2Y9YA 1BL0A 3ZQFA 3BR2A 3TP0A 3JRDA 1FTTA 4MO7A 4M3BA 2DMQA 5IP7J 2DA1A 4AYBN 3S1MJ 5IPAA 1ZTRA 1W0TA 3HGGA 5J3LA 1B72A 1XC5A 5EDNA 1JKRC 2MGQA 3BG9A 4V2GA 5FKKA 1IV6A 4DYCA 1JT0A 3HOWJ 3HOXJ 4Y52J 2JJ7A 5EGOA 3JR9A 2YS9A 1IDZA 5C4JJ 4A3IJ 2K9SA 3TP3A 2VUMJ 5F1JA 3JRCA 1JGGA 5M5WJ 2DA2A 3PO3J 3S1RJ 1SANA 2L9RA 2HI3A 1IRZA 3DEWA 1OFCX 4BXXJ 3HBLA 3NARA 2OPTA 3GTKJ 2DJNA 5IYBJ 2FQ4A 4A3KJ 2PMZN 1R9TJ 3OSGA 5GPCA 3Q0VA 1FTZA 5M5YJ 1MNMC 1JUPA 5FKNA 5M3FJ 2GBYA 2XB0X 4DYRA 4IHWA 3GTPJ 3D1NI 5F0CA 4A3MJ 4M3DA 1MBFA 3BTIA 1RKTA 5FKLA 3Q0WA 3PM1A 4FTHA 2O7OA 3ZQIA 5EGOB 3M3YJ 1T33A 3HOVJ 2B63J 4A3BJ 2ID6A 3CDLA 1JKOC 2M34A 3HOYJ 2M9HA 2DMPA 4BKXA 5EEAA 4G12A 4FISA 1U9NA 1X58A 1HLVA 1ETKA 2LKXA 4LOCA 1HDDC 2XGDA 2LFBA 2LP0A 1GDTA 4A93J 1YRNA 3BG5A 3HM5A 4I76A 2COBA 3JRFA 2R5YA 4FE4A 1EF4A 3A01A 4B3AA 3OSFA 1HF0A 2HOTA 1BJZA 4AC0A 2X6OA 3GTLJ 4UUSB 2NVQJ 4HNVA 2VPRA 4ABZA 4FCYA 3GTOJ 2R7ZJ 3CCYA 5EF6A 2XPUA 2LK2A 1ZQ3P 1DU0A 3GTJJ 1S7EA 3BQYA 5IOYA 4DZJA 4D5CA 4MLOA 5FLMJ 1JJ8C 2NS7A 5DS9A 1WGXA 2LTPA 2OF7A 3MKLA 5E3OA 5F04A 3I4MJ 2IEKA 3RQIA 4B4CA 3JRGA 1QVTA 2DMUA 2GM4A 3WHCA 5HODA 3BQZA 1BW6A 3LSPA 4XRSG 5EZGA 2TRTA 3BT9A 2JK3A 1ZKGA 1MH3A 4JX6A 3S16J 2HYJA 9ANTA 3GTGJ 1WCMJ 3PO2J 2DA3A 2E19A 1X2MA 2Y30A 3A03A 2K40A 3IH3A 3S2HJ 1XS9A 1APLC 4FE7A 4C3JJ 4JYKA 1VFCA 1MBHA 4JX5A 4CYCA 1I6HJ 1PUFB 3O8GA 1JTXA 4DZPA 1TWCJ 2E1OA 4UUTA 5JLXA 3FISA 2VKEA 3TW6A 1JT6A 3HDDA 3LOCA 1IC8A 1AKHB 3TW7A 2R92J 3QPSA 4M3GA 4QTRA 1FIPA 1E3OC 2CU7A 2GLOA 5FKMA 5EYRA 1Z0XA 3BR3A 1U9OA 2X9DA 1RR7A 5FJ8J 2FX0A 1P7JA 3FKIJ 3JRIA 1ZR2A 1SFOJ 3TEDA 3E7LA 3JRHA 2NVYJ 3LNQA 1GUUA 1JJ6C 2R0QC 2JA6J 1HOMA 1F36A 1P7IA 3G1LA 2G0EA 1MBKA 2ID3A 2K9NA 1QVUA 1CQTA 2EZKA 3ZQHA 5F0HA 1Z77A 1ENHA 3BR6A 1QPIA 1AHDP 4B1RA 3QPLA 2JN6A 1JUMA 2JA5J 1Q1VA 2MG4A 1LFBA 2XGCA 2DA5A 2EZHA 1OJLA 5IYDJ 1B72B 3QQAA 2E2IJ 1GV5A 1Y1VJ 4D5FA 2ELKA 2VI6A 1IUFA 3S14J 2I10A 1GV2A 3K2AA 3WHBA 3ZQGA 1IG7A 1FIAA 5E3NA 1RPWA 1VNDA 5EG0A 1H8AC 1JUSA 5GP9A 1HCRA 3Q0UA 1LE8A 1UG2A 2E2JJ 3ZQCA 1TWGJ 2O9LA 2XRLA 1ETYA 2L7MP 1H88C 2IAIA 5K7HA 3NAUA 3ZQLA 5JLWA 5IP6A 2XPWA 4DW6A 1JKPC 4A3CJ 1K61A 2EZIA 3CMYA 3SFIA 3BTCA 3GTQJ 1AU7A 2MSYA 2HQ5A 4C2MJ 1A6IA 2D5VA 2XB5A 4RBOA 1B8IA 4MFEA 1UMQA 5F08A 1MBJA 2WB1N 2ZB9A 3BR5A 4GFBA 2YU9J 3MVPA 2O8KA 3S1NJ 1JKQC 4C3IJ 5K7ZA 2E2HJ 1TWAJ 1MBEA 3BTJA 1WPKA 3JRAA 2L7ZA 3GTMJ 5F27A 3CQZJ 4M3EA 3MN2A 2R93J 2KDZA 2HDDA 3S17J 2R5ZA 1JTYA 2IBDA 2DA6A 2AHQA 2JMWA 3K7AJ 1RETA 2L7FP 4DYQA 4X6AJ 1I50J 1I3QJ 2WAQN 5BNGA 1YRNB 2YUSA 1WH5A 2CUFA 2R5YB 3FIWA 3A01B 3BR1A 3SDGA 3G1MA 1B8IB 1RKWA 2P81A 1NK2P 1GT0C 1MSEC 4IHYA 1TWHJ 4V2FA 2Y2ZA 2ME0A 4XIDA 3I4NJ 3HB9A 1TC3C 1WH7A 2ECBA 3RZOJ 3H3VK 1O4XA 1F43A 3Q3SA 1ETVA 2EQRA 2NOGA 4XRSA 4J19A 4BY1J 2WV1A 3VPRA 2HXIA 1QRYA 3IH4A 2MW8A 3JREA 3H0GJ 3FK7A 5FKOA 5IP9J 1IGNA 1ETQA 3L1PA 3RZDJ 1ETWA 2LVSA 3OIOA 1IJWC 1A5JA 4XICA 1W0UA 1BW5A 3UKGA 1LFUP 1OCPA 3O8HA 3FK6A 1OCTC 2DMTA 1VI0A 3LSGA 5J1RA 4D7MA 1RESA 1DU6A 2LR8A 2KT0A 5GPAA 5M5XJ 1Y1WJ 4CYCB 2TCTA 2XGEA 2FD5A 1FEXA 4JP0A 4Y7NJ 2EZLA 2Y31A 1VF9A 3C2BA 4QSHA 5C44J 3S1QJ 3JRBA 4W1UA 3B6AA 1MBGA 5E3MA 5IYCJ 1D5YA 5IOZA 2NVXJ 2JA7J 4BBRJ 4A3LJ 3BG3A 3HGYA 2M0CA 3W6VA 3SJMA 5F0FA 3IV5A 3OOUA 2N8GA 3BTLA 4I6ZA 2RAEA 5EZHA 2DTZA 4XRMA 2H8RA 4UUSA 5DTDA 4A3GJ 2HXOA 1GVDA 2CJJA 1ETOA 1ZK8A 4MIMA 3M4OJ 2ECCA 4IHVA 1ITYA 3HOUJ 3S2DJ 2HOAA 2Y0SN 5M3MJ 2XSDC 2LD5A 1U8BA 2AO9A 2LY9A 1IDYA 4C3HJ 2CUEA 1NTCA 1FJLA 3HKZN 4X1EA 4L5EA 4M6VA 2NVTJ 4MFDA 2EBIA 1HDPA 3HOZJ 5C4XJ 2CRGA 3LSJA 1ETXA 4A69C 1ZGWA 1MSFC 2EH3A 2K9QA 2DMNA 3BR0A 2X48A 2JA8J 5EG0B 2CQQA 3S15J 1LE8B 1MH4A 1NK3P 2W48A 4JX4A 2DN0A 4XK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POG A;  3DCF A;  2Y9Z A;  2JWT A;  4W97 A;  3A02 A;  2M2E A;  5C3E J;  1G2H A;  1H89 C;  1ZR4 A;  4A3J J;  4EEF G;  1TWF J;  3RKQ A;  1PUF A;  2QF7 A;  3HEF A;  1K83 J;  2HOS A;  4RDU A;  4BY7 J;  3LSR A;  1AKH A;  5J1Y A;  2NS8 A;  2CQX A;  3G1O A;  1UHS A;  4A3F J;  1BA5 A;  4S0H B;  4A3E J;  1ORK A;  1WI3 A;  2DA7 A;  5FLV A;  4IEJ A;  3IH2 A;  2M8G X;  4D7N A;  1U78 A;  2FJ1 A;  5J1U A;  2R5Z B;  2L0K A;  4IHX A;  3B6C A;  4BBS J;  1T56 A;  2H1K A;  2DA4 A;  5K7F A;  2QCO A;  2XPV A;  2VKV A;  4A3D J;  3F0C A;  3ZOB A;  4AUX A;  5E3L A;  3GBG A;  2ME6 A;  4QIW N;  1X2N A;  4M3F A;  4NDL A;  1XG1 A;  2LLK A;  2Y9Y A;  1BL0 A;  3ZQF A;  3BR2 A;  3TP0 A;  3JRD A;  1FTT A;  4MO7 A;  4M3B A;  2DMQ A;  5IP7 J;  2DA1 A;  4AYB N;  3S1M J;  5IPA A;  1ZTR A;  1W0T A;  3HGG A;  5J3L A;  1B72 A;  1XC5 A;  5EDN A;  1JKR C;  2MGQ A;  3BG9 A;  4V2G A;  5FKK A;  1IV6 A;  4DYC A;  1JT0 A;  3HOW J;  3HOX J;  4Y52 J;  2JJ7 A;  5EGO A;  3JR9 A;  2YS9 A;  1IDZ A;  5C4J J;  4A3I J;  2K9S A;  3TP3 A;  2VUM J;  5F1J A;  3JRC A;  1JGG A;  5M5W J;  2DA2 A;  3PO3 J;  3S1R J;  1SAN A;  2L9R A;  2HI3 A;  1IRZ A;  3DEW A;  1OFC X;  4BXX J;  3HBL A;  3NAR A;  2OPT A;  3GTK J;  2DJN A;  5IYB J;  2FQ4 A;  4A3K J;  2PMZ N;  1R9T J;  3OSG A;  5GPC A;  3Q0V A;  1FTZ A;  5M5Y J;  1MNM C;  1JUP A;  5FKN A;  5M3F J;  2GBY A;  2XB0 X;  4DYR A;  4IHW A;  3GTP J;  3D1N I;  5F0C A;  4A3M J;  4M3D A;  1MBF A;  3BTI A;  1RKT A;  5FKL A;  3Q0W A;  3PM1 A;  4FTH A;  2O7O A;  3ZQI A;  5EGO B;  3M3Y J;  1T33 A;  3HOV J;  2B63 J;  4A3B J;  2ID6 A;  3CDL A;  1JKO C;  2M34 A;  3HOY J;  2M9H A;  2DMP A;  4BKX A;  5EEA A;  4G12 A;  4FIS A;  1U9N A;  1X58 A;  1HLV A;  1ETK A;  2LKX A;  4LOC A;  1HDD C;  2XGD A;  2LFB A;  2LP0 A;  1GDT A;  4A93 J;  1YRN A;  3BG5 A;  3HM5 A;  4I76 A;  2COB A;  3JRF A;  2R5Y A;  4FE4 A;  1EF4 A;  3A01 A;  4B3A A;  3OSF A;  1HF0 A;  2HOT A;  1BJZ A;  4AC0 A;  2X6O A;  3GTL J;  4UUS B;  2NVQ J;  4HNV A;  2VPR A;  4ABZ A;  4FCY A;  3GTO J;  2R7Z J;  3CCY A;  5EF6 A;  2XPU A;  2LK2 A;  1ZQ3 P;  1DU0 A;  3GTJ J;  1S7E A;  3BQY A;  5IOY A;  4DZJ A;  4D5C A;  4MLO A;  5FLM J;  1JJ8 C;  2NS7 A;  5DS9 A;  1WGX A;  2LTP A;  2OF7 A;  3MKL A;  5E3O A;  5F04 A;  3I4M J;  2IEK A;  3RQI A;  4B4C A;  3JRG A;  1QVT A;  2DMU A;  2GM4 A;  3WHC A;  5HOD A;  3BQZ A;  1BW6 A;  3LSP A;  4XRS G;  5EZG A;  2TRT A;  3BT9 A;  2JK3 A;  1ZKG A;  1MH3 A;  4JX6 A;  3S16 J;  2HYJ A;  9ANT A;  3GTG J;  1WCM J;  3PO2 J;  2DA3 A;  2E19 A;  1X2M A;  2Y30 A;  3A03 A;  2K40 A;  3IH3 A;  3S2H J;  1XS9 A;  1APL C;  4FE7 A;  4C3J J;  4JYK A;  1VFC A;  1MBH A;  4JX5 A;  4CYC A;  1I6H J;  1PUF B;  3O8G A;  1JTX A;  4DZP A;  1TWC J;  2E1O A;  4UUT A;  5JLX A;  3FIS A;  2VKE A;  3TW6 A;  1JT6 A;  3HDD A;  3LOC A;  1IC8 A;  1AKH B;  3TW7 A;  2R92 J;  3QPS A;  4M3G A;  4QTR A;  1FIP A;  1E3O C;  2CU7 A;  2GLO A;  5FKM A;  5EYR A;  1Z0X A;  3BR3 A;  1U9O A;  2X9D A;  1RR7 A;  5FJ8 J;  2FX0 A;  1P7J A;  3FKI J;  3JRI A;  1ZR2 A;  1SFO J;  3TED A;  3E7L A;  3JRH A;  2NVY J;  3LNQ A;  1GUU A;  1JJ6 C;  2R0Q C;  2JA6 J;  1HOM A;  1F36 A;  1P7I A;  3G1L A;  2G0E A;  1MBK A;  2ID3 A;  2K9N A;  1QVU A;  1CQT A;  2EZK A;  3ZQH A;  5F0H A;  1Z77 A;  1ENH A;  3BR6 A;  1QPI A;  1AHD P;  4B1R A;  3QPL A;  2JN6 A;  1JUM A;  2JA5 J;  1Q1V A;  2MG4 A;  1LFB A;  2XGC A;  2DA5 A;  2EZH A;  1OJL A;  5IYD J;  1B72 B;  3QQA A;  2E2I J;  1GV5 A;  1Y1V J;  4D5F A;  2ELK A;  2VI6 A;  1IUF A;  3S14 J;  2I10 A;  1GV2 A;  3K2A A;  3WHB A;  3ZQG A;  1IG7 A;  1FIA A;  5E3N A;  1RPW A;  1VND A;  5EG0 A;  1H8A C;  1JUS A;  5GP9 A;  1HCR A;  3Q0U A;  1LE8 A;  1UG2 A;  2E2J J;  3ZQC A;  1TWG J;  2O9L A;  2XRL A;  1ETY A;  2L7M P;  1H88 C;  2IAI A;  5K7H A;  3NAU A;  3ZQL A;  5JLW A;  5IP6 A;  2XPW A;  4DW6 A;  1JKP C;  4A3C J;  1K61 A;  2EZI A;  3CMY A;  3SFI A;  3BTC A;  3GTQ J;  1AU7 A;  2MSY A;  2HQ5 A;  4C2M J;  1A6I A;  2D5V A;  2XB5 A;  4RBO A;  1B8I A;  4MFE A;  1UMQ A;  5F08 A;  1MBJ A;  2WB1 N;  2ZB9 A;  3BR5 A;  4GFB A;  2YU9 J;  3MVP A;  2O8K A;  3S1N J;  1JKQ C;  4C3I J;  5K7Z A;  2E2H J;  1TWA J;  1MBE A;  3BTJ A;  1WPK A;  3JRA A;  2L7Z A;  3GTM J;  5F27 A;  3CQZ J;  4M3E A;  3MN2 A;  2R93 J;  2KDZ A;  2HDD A;  3S17 J;  2R5Z A;  1JTY A;  2IBD A;  2DA6 A;  2AHQ A;  2JMW A;  3K7A J;  1RET A;  2L7F P;  4DYQ A;  4X6A J;  1I50 J;  1I3Q J;  2WAQ N;  5BNG A;  1YRN B;  2YUS A;  1WH5 A;  2CUF A;  2R5Y B;  3FIW A;  3A01 B;  3BR1 A;  3SDG A;  3G1M A;  1B8I B;  1RKW A;  2P81 A;  1NK2 P;  1GT0 C;  1MSE C;  4IHY A;  1TWH J;  4V2F A;  2Y2Z A;  2ME0 A;  4XID A;  3I4N J;  3HB9 A;  1TC3 C;  1WH7 A;  2ECB A;  3RZO J;  3H3V K;  1O4X A;  1F43 A;  3Q3S A;  1ETV A;  2EQR A;  2NOG A;  4XRS A;  4J19 A;  4BY1 J;  2WV1 A;  3VPR A;  2HXI A;  1QRY A;  3IH4 A;  2MW8 A;  3JRE A;  3H0G J;  3FK7 A;  5FKO A;  5IP9 J;  1IGN A;  1ETQ A;  3L1P A;  3RZD J;  1ETW A;  2LVS A;  3OIO A;  1IJW C;  1A5J A;  4XIC A;  1W0U A;  1BW5 A;  3UKG A;  1LFU P;  1OCP A;  3O8H A;  3FK6 A;  1OCT C;  2DMT A;  1VI0 A;  3LSG A;  5J1R A;  4D7M A;  1RES A;  1DU6 A;  2LR8 A;  2KT0 A;  5GPA A;  5M5X J;  1Y1W J;  4CYC B;  2TCT A;  2XGE A;  2FD5 A;  1FEX A;  4JP0 A;  4Y7N J;  2EZL A;  2Y31 A;  1VF9 A;  3C2B A;  4QSH A;  5C44 J;  3S1Q J;  3JRB A;  4W1U A;  3B6A A;  1MBG A;  5E3M A;  5IYC J;  1D5Y A;  5IOZ A;  2NVX J;  2JA7 J;  4BBR J;  4A3L J;  3BG3 A;  3HGY A;  2M0C A;  3W6V A;  3SJM A;  5F0F A;  3IV5 A;  3OOU A;  2N8G A;  3BTL A;  4I6Z A;  2RAE A;  5EZH A;  2DTZ A;  4XRM A;  2H8R A;  4UUS A;  5DTD A;  4A3G J;  2HXO A;  1GVD A;  2CJJ A;  1ETO A;  1ZK8 A;  4MIM A;  3M4O J;  2ECC A;  4IHV A;  1ITY A;  3HOU J;  3S2D J;  2HOA A;  2Y0S N;  5M3M J;  2XSD C;  2LD5 A;  1U8B A;  2AO9 A;  2LY9 A;  1IDY A;  4C3H J;  2CUE A;  1NTC A;  1FJL A;  3HKZ N;  4X1E A;  4L5E A;  4M6V A;  2NVT J;  4MFD A;  2EBI A;  1HDP A;  3HOZ J;  5C4X J;  2CRG A;  3LSJ A;  1ETX A;  4A69 C;  1ZGW A;  1MSF C;  2EH3 A;  2K9Q A;  2DMN A;  3BR0 A;  2X48 A;  2JA8 J;  5EG0 B;  2CQQ A;  3S15 J;  1LE8 B;  1MH4 A;  1NK3 P;  2W48 A;  4JX4 A;  2DN0 A;  4XK4 A; 
#chains in the Genus database with same CATH topology
 3I71 A;  4LG0 A;  3OYG A;  2WAE A;  2L02 A;  2M2E A;  1KYZ A;  4OWR B;  4RGU A;  1IXC A;  4N9H A;  4EGZ A;  3HEF A;  5KAI C;  2ZFW A;  3K70 D;  1ON1 A;  3VSK A;  5D5X B;  3LSR A;  1AKH A;  1S3J A;  5TIS C;  3A0H C;  2DPU A;  3G1O A;  5DUI A;  3FXJ A;  1DP7 P;  1UHM A;  1O7F A;  3D5L A;  1IAW A;  3DXJ F;  1R1U A;  4BJ6 C;  3JW4 A;  3OMY A;  1WI3 A;  2VQL A;  3HPH A;  3KIO A;  4IEJ A;  1KU3 A;  2DT6 A;  1SMY F;  5FRM A;  3HRM A;  5HS7 A;  5K1Y A;  2OQR A;  1U78 A;  2CW8 A;  1QZE A;  4CCL A;  1A35 A;  2GXA A;  2E1M C;  4IHX A;  4IKF A;  2FEZ A;  3B6C A;  4YEL A;  1IRX A;  2DA4 A;  3G6E I;  2QCO A;  2XF5 A;  2XPV A;  2DI3 A;  2FU4 A;  1YFH A;  1Z21 A;  5HDK A;  4U0V A;  3EUK L;  5E3L A;  2RVC A;  2ME6 A;  4AWX B;  2QKL B;  3BOQ A;  4QIW N;  3E6C C;  4DBQ A;  3ZQF A;  3TP0 A;  2EJR A;  3H5N A;  4FT8 A;  4M3B A;  5IP7 J;  3L2V A;  2DA1 A;  2OC6 A;  4F7Z A;  1ZRD A;  4YIF A;  2E1M B;  3EQL F;  5IT9 Z;  1XC5 A;  2OQG A;  2ZSH B;  5EDN A;  3H3Z A;  5EJC A;  2WY7 Q;  3BG9 A;  3V7R A;  5LHH A;  4ESB A;  3HOX J;  5CKT A;  5F6F A;  2EIN H;  5E1Z B;  5C4J J;  2YR2 A;  4KN4 X;  4X0G A;  3PO3 J;  2DA2 A;  2MH9 A;  1IN7 A;  4YRV A;  1SAN A;  2KJC A;  2HI3 A;  3DEW A;  3QU6 A;  5CLS A;  2HTS A;  4BXX J;  1I1S A;  3HBL A;  3OYN A;  1WJF A;  2K7L A;  4LMY A;  3HL2 A;  1V5E A;  2DJN A;  5IYB J;  2H09 A;  2FQ4 A;  3OSG A;  4DBR A;  2R7U A;  3BPX A;  3ESW B;  3Q0V A;  4PUS A;  1GXP A;  2L01 A;  5J4V A;  2RN7 A;  2ETH A;  4IZZ A;  1JUP A;  1J09 A;  3WTX C;  3F8M A;  3LSI A;  5M3F J;  2VKD A;  4PSW A;  3CC2 I;  2QQ8 A;  1E2X A;  4NQW B;  1G59 A;  4XKW A;  1FC3 A;  3L09 A;  4ZC3 A;  3D1N I;  1R4M B;  3RYR A;  4PJL A;  1MBF A;  3Q0W A;  4L5I A;  4FAS D;  2K27 A;  3T0Y A;  4U0Y A;  1QA6 A;  3ZQI A;  2ZXJ A;  1YW8 A;  2TDX A;  2WY8 Q;  5JVT A;  2D1V A;  1VQN I;  4UVB A;  2FNA A;  3HOV J;  4A3B J;  4LGW A;  2M34 A;  3J81 K;  4L0Z B;  3HOT A;  4LB5 A;  3QOE A;  3AKZ A;  1J7K A;  4BKX A;  1K4T A;  3O2P E;  5HS8 A;  2EB7 A;  1U9N A;  1BIA A;  1IUY A;  1Z67 A;  3HHH A;  1HLV A;  3DU6 A;  4WXH A;  2LP0 A;  5GAH J;  4XLE A;  1FX7 A;  3M8E A;  5AIQ A;  4KA4 A;  5J4Y A;  3F3X A;  2WV0 A;  4XOT A;  1YYV A;  3GXO A;  2FMY A;  4EJU A;  1E0E A;  2R5Y A;  4FE4 A;  4B09 A;  4G9Y A;  2FE3 A;  3COA C;  4ESJ A;  4BEH A;  3NWS A;  4BHP A;  2K5C A;  3GTO J;  2R7Z J;  1BI2 A;  4XOR A;  2K3F A;  3ZMS A;  1O3S A;  1ZQ3 P;  4HZF A;  3ZMV A;  4XSX F;  3BQY A;  2QVO A;  2ZKZ A;  2D2W A;  2F5E A;  2F4I A;  4MLO A;  3OYF A;  3F8C A;  3OOP A;  2FOW A;  2OAZ A;  1JJ8 C;  4IF4 A;  5TJJ A;  2PJR A;  4L18 B;  1S7A A;  2BHY A;  2CQK A;  5J8C A;  1WGX A;  2CV2 A;  1SD5 A;  4ZTJ A;  4HYE A;  3H92 A;  4CO8 A;  3KET A;  3FHZ A;  2E5Z A;  2IEK A;  2DOE A;  3KX2 A;  3JRG A;  1QVT A;  3IRR A;  2HU9 A;  5KHD A;  1YOV B;  2GQQ A;  3HUG B;  4YFK F;  2CMP A;  2W00 A;  1MMD A;  3K4C A;  4LIV A;  2TRT A;  2E7W A;  3FXU A;  4PK4 A;  4MTD A;  2B9S A;  4JQF A;  4JX6 A;  1BIB A;  2HYJ A;  4H4K C;  2ZFU A;  4E7K A;  1WCM J;  3PO2 J;  2DA3 A;  2E19 A;  1QBJ A;  1MMG A;  3PNV A;  3ZMT A;  3H3U A;  1K78 A;  1Y8Q B;  1FOW A;  2HQN A;  3KEO A;  1I6H J;  4IL6 C;  2NYX A;  1P4A A;  1RUO A;  1WSU A;  1TWC J;  4UB6 C;  2A68 F;  1F1Z A;  1MMN A;  4UUT A;  3LSH A;  3FIS A;  3CCS I;  1L0O C;  2VKE A;  2W84 A;  3EYI A;  4L0Y B;  4ZJZ A;  3BDD A;  2IVM A;  3LOC A;  2DTR A;  2XAU A;  3WG9 A;  2R92 J;  5ED4 A;  3KP5 A;  3CMA I;  3F9K A;  2M1B A;  2XAS A;  2MLK A;  4EJO A;  4ZTF A;  4QTR A;  3WTS C;  1I3A A;  5B5E C;  5E1X A;  4II3 A;  5B3S H;  2VBY A;  1J2X A;  1OYI A;  5FLX K;  1W5S A;  3ZCO A;  5FKM A;  1YIO A;  4E7Z A;  2GLO A;  3BR3 A;  2OA4 A;  1VQK I;  5FJ8 J;  3H36 A;  2DYS H;  1ZR2 A;  2HYG D;  5BPD A;  5D5V B;  1GUU A;  2BY0 A;  1R6R A;  2ZXI A;  1HOM A;  2G0E A;  2V1U A;  1WVR A;  4MEY F;  1U5T A;  1MBK A;  2ID3 A;  5BS6 A;  1W36 C;  1QVU A;  2DQR A;  2OV7 A;  3CMM A;  1CQT A;  2EZK A;  1I27 A;  3ZQH A;  4KT5 C;  4F91 B;  5D4S A;  3OR2 C;  3CCQ I;  5GAE J;  4N0B A;  1YIT I;  3I5U A;  1G6N A;  2HNH A;  1LFB A;  4AD9 A;  2EZH A;  3H9J A;  3K69 A;  4B48 A;  3C18 A;  1B72 B;  1Y1V J;  2L9S A;  2ZME A;  2VI6 A;  3VOD A;  3CJQ B;  3W2W A;  4BU2 A;  1Z91 A;  4RGS A;  3N05 A;  2KIU A;  3ZQG A;  3I64 A;  4HW0 A;  3ROU A;  3EYY A;  1AA7 A;  5DYM A;  1RPW A;  5E3N A;  2BW3 B;  4I98 B;  1HC8 A;  5GP9 A;  1LE8 A;  1I6X A;  1S8N A;  3KYD B;  3RQ4 A;  4LK1 F;  5FRN A;  1UJ8 A;  2JSC A;  3DPL C;  5K7H A;  3GO5 A;  1I39 A;  4NHJ A;  2XPW A;  3HSF A;  3GFJ A;  5KNL A;  1TW2 A;  3DF8 A;  4DW6 A;  3DWL E;  1K61 A;  2EZI A;  4IHS A;  1B6A A;  1WQ2 A;  1OLT A;  3GTQ J;  1TQP A;  5DM6 F;  5LGN A;  4C2M J;  1WJC A;  4E70 A;  4XM3 A;  4M9S A;  4MFE A;  4ANJ A;  2Q1Z B;  1UCR A;  1HW2 A;  1EA3 A;  2DJI A;  1HKS A;  1OR7 C;  3MVP A;  5B1B H;  4D0P A;  1JKQ C;  1YIJ I;  2JVH A;  1ACI A;  1XX5 A;  1T8I A;  1MBE A;  1WPK A;  2WAF A;  3DTE A;  1ZG1 A;  3K10 A;  1REP C;  4IPA A;  2P7V B;  2KPM A;  2XF7 A;  4CXF A;  4JK1 X;  3JAM Z;  3DFG A;  4U7B A;  4LLN A;  2P6S A;  3TDU C;  2JZY A;  1HW1 A;  2E7X A;  3H35 A;  3ZQ7 A;  4RS8 A;  1HBX G;  2M3A A;  1YE9 A;  2ZO4 A;  3OS2 A;  3VYR B;  3CCJ I;  4A12 A;  4A0Y A;  4DYQ A;  1I50 J;  2PX9 A;  1G3T A;  2VIX A;  1I3Q J;  2BXZ A;  5DCF A;  2WTE A;  2Y48 A;  2YUS A;  1BI0 A;  3KZI C;  3SQN A;  3IP4 B;  1KU9 A;  3CC4 I;  4LIT A;  2KIF A;  2PN6 A;  3FKJ A;  3ZMU A;  4RB0 A;  2E35 A;  2O8X A;  2R7R A;  1GT0 C;  4BXU A;  1UZC A;  4PGG A;  4IHY A;  2DFH A;  1P6R A;  2A6T A;  2XF6 A;  2M45 A;  4F92 B;  2I8D A;  4V2F A;  2E60 A;  1W7P A;  2HGC A;  1YS6 A;  3RZO J;  2M7B A;  4UY8 I;  2V26 A;  2IXS A;  1YTY A;  3QAH A;  3BCA A;  2EQR A;  3ZP5 A;  3I9V 2;  3PFI A;  1GLN A;  4B44 A;  3F8N A;  3PL8 A;  3H0G J;  1YS7 A;  3FK7 A;  5FKO A;  2FNP A;  5L3E A;  1YO5 C;  1ETQ A;  4UV9 A;  3L1P A;  2QEX I;  1LFP A;  4J00 A;  5JI6 A;  1ETW A;  3OIO A;  1BOA A;  1DGR M;  2V9P A;  3MKW B;  1W0U A;  1XGO A;  5KK1 A;  3GFM A;  2P5K A;  3QP6 A;  3AAF A;  1OPC A;  1LFU P;  2PQ8 A;  2OD5 A;  4NQW A;  1ZAO A;  2IGK A;  2ZXH A;  4BAY A;  3LFK A;  3FK6 A;  4S05 A;  3J7A O;  3GF2 A;  2NS0 A;  4PFP A;  5E17 F;  2GXG A;  4M9X A;  1XDS A;  2EFQ A;  1FOX A;  3ABK H;  4D7M A;  2H27 A;  4OOI A;  5CVI A;  1IZ1 A;  3DKW A;  4CYC B;  1O3R A;  3I0T A;  4RAZ A;  2XGE A;  2FD5 A;  1Z6T A;  1QZY A;  4U88 A;  1LKX A;  3GLL A;  4DIQ A;  2VJ4 A;  3ZMZ A;  4BH9 A;  4Y7N J;  3C2B A;  1H0M A;  1YHQ I;  1XGN A;  3TKY A;  1FMV A;  3S1Q J;  3S3M A;  1XMK A;  2L9N A;  3OWT A;  2WC2 A;  3K6G A;  4RLQ A;  3TGN A;  4N4O B;  1TT0 A;  4W1U A;  4KJZ A;  3JTG A;  3IUO A;  5DCM B;  2EV0 A;  5IYC J;  3GWZ A;  3WTV C;  1W1W E;  3BG3 A;  4L5J A;  2FUG 2;  1B9N A;  2L2O A;  5L3B A;  1ZLJ A;  1X4P A;  4C9Y A;  4WCG A;  4AVP A;  1WRJ A;  3SJM A;  3IV5 A;  4ENM A;  3OOU A;  3GZ5 A;  4O5V A;  2CW0 F;  2R7F A;  3E6D A;  2MD0 A;  1EH8 A;  4XRM A;  3ECO A;  3KFW X;  3HSR A;  3K70 C;  3EUH C;  2CJJ A;  4CGZ A;  1VQM I;  2DFI A;  2ECC A;  4GO1 A;  4IHV A;  1ITY A;  3RJP A;  4GDF A;  1O57 A;  2IA2 A;  2HOA A;  2KMU A;  2Y0S N;  3TL4 X;  2XSD C;  4GRI A;  2LY9 A;  2QQ9 A;  1QHH D;  2CUE A;  2ZCW A;  2NVT J;  4ZZL A;  1K4S A;  3HOZ J;  2W1O A;  3BY6 A;  3DLA A;  4OU0 A;  3KLN A;  2CRG A;  3OS0 A;  4BJT A;  4RB1 A;  3QOP A;  5HLT A;  1P9Q C;  1ETX A;  4A69 C;  2NNY A;  1ZGW A;  3EUA A;  1LVK A;  3HUG A;  5FB2 A;  3H5A A;  2VBX A;  2JA8 J;  3A0B C;  4KIC A;  4Y3O A;  3EDP A;  2W48 A;  3KEY A;  4JX4 A;  2PLY A;  2Z16 A;  3LAJ A;  1IN5 A;  3TMO A;  5ILU A;  2UXN A;  1DPU A;  4W97 A;  5CVJ A;  1G2H A;  1H89 C;  3GW2 A;  4KUM A;  1OCO H;  4A3J J;  5GAG J;  1TWF J;  3RPQ A;  4G7Z F;  3TOA A;  3RKQ A;  3J7A Y;  2LF8 A;  3P5J A;  4UNO A;  1K83 J;  2IRF G;  1V54 H;  2XAJ A;  3K4J A;  4RDU A;  4Q4Z F;  5J1Y A;  4YFN F;  2UXX A;  3P9C A;  4BE1 A;  1B4A A;  1UHS A;  2COM A;  2PJP A;  2OTJ I;  3K1N A;  2F5F A;  1MND A;  2GOX B;  2Y0S A;  4Y33 A;  3GVA A;  1STZ A;  3ABL H;  2DA7 A;  3PFY A;  3U21 A;  5DDG A;  3J81 Z;  2EFW A;  2ZXW H;  4KYW A;  3ZGK A;  2W4S A;  4BQQ A;  2EV5 A;  3CP2 A;  3V8K A;  2X6Y A;  4B3X A;  4JBA A;  5B1A H;  2IA0 A;  2HOE A;  1ZLK A;  4CSW A;  1YJW I;  2GZW A;  4A3D J;  4CDG A;  4DJA A;  2E36 A;  2VPL A;  2Y69 H;  2AS5 F;  3EPZ A;  3FXL A;  4ZZD A;  3V7S A;  1JI8 A;  1SAX A;  4M3F A;  1W5T A;  4E4H A;  2LLK A;  2QBY B;  4I7H A;  3BR2 A;  4N4N B;  3JRD A;  3S1M J;  2DMQ A;  3W2A A;  1ZTR A;  3FXQ A;  3HGG A;  5J3L A;  1B72 A;  4EJT A;  4XSZ F;  2MLG A;  2R7D A;  2MGQ A;  4XLH A;  5GAD J;  4EMS A;  1Z1D A;  2V6E A;  5FKK A;  4HLX A;  1IV6 A;  1JT0 A;  1XSV A;  4BQA A;  4Y52 J;  4HX7 A;  4II2 A;  4HNT A;  2Q2E B;  1IDZ A;  2VUM J;  3FMS A;  2NAZ A;  5E8I A;  5FFX A;  1F9N A;  1JGG A;  2BBY A;  3BG6 A;  2VB6 A;  3G4S I;  2BW3 A;  3MZH A;  1F5T A;  1BN5 A;  3NAR A;  1S72 I;  1EH7 A;  2OPT A;  2EIL H;  2BVL A;  4A3K J;  2PMZ N;  1V3F A;  3ZMD A;  1R9T J;  4RGR A;  2FQ3 A;  3CLO A;  3NWT A;  1QPM A;  1G3Y A;  2A3S A;  1FTZ A;  5M5Y J;  1MNM C;  3V8J A;  4XRF A;  2F5V A;  2XGX A;  4C30 A;  1ZYR F;  2XAF A;  3LA3 A;  2EV6 A;  3GYH X;  4NC6 A;  2CSO A;  3LQR A;  1RKT A;  2IS2 A;  3E5Q A;  3DEU A;  3QOD A;  4FTH A;  4XQF A;  2LKP A;  1MNE A;  3ECH A;  5EGO B;  5LGT A;  1EH6 A;  4L9J A;  2ID6 A;  1GHC A;  4I01 A;  2O3F A;  2P5L C;  3HOY J;  5JR3 A;  2V9K A;  1KQ9 A;  2UWM A;  3R61 A;  5EEA A;  4HOB A;  2DLL A;  2NXN B;  4FIS A;  2L3D A;  1OR7 A;  1XB4 A;  1HDD C;  3Q5F A;  4HG2 A;  4IO9 F;  2QYO A;  5FLX Z;  2A61 A;  3WU0 A;  2D1H A;  4HX4 A;  2EFO A;  2COB A;  4FQG A;  1EJ9 A;  1N75 A;  2FRH A;  3ONQ A;  2BZT A;  3WOD F;  1EV7 A;  4AC0 A;  2PMZ A;  4UUS B;  2NVQ J;  5TRD A;  1SAU A;  3O3K A;  4FCY A;  3CCY A;  5EF6 A;  3E6B A;  2NOJ B;  2WBM A;  1DQU A;  2LOO A;  1DGW Y;  2V9V A;  1HKQ A;  4D5C A;  5A2Q K;  1HW5 A;  3H9G A;  3N4M A;  1LEB A;  2A6E F;  3VOE A;  3ZXS A;  1JE8 A;  4GCV A;  3MKY B;  3WGG A;  1ZAR A;  3T5X A;  4MHG A;  3K4B A;  2QGU A;  5E8G A;  5E3O A;  4ON0 A;  2JVG A;  3I55 I;  4BE0 A;  1IV8 A;  1QQI A;  3RQI A;  4B4C A;  3OYB A;  3J7Z I;  4M6X A;  3BQZ A;  1ULY A;  1BW6 A;  1G4D A;  2JPB A;  4XRS G;  3E97 A;  3BT9 A;  3G3Z A;  1W5C C;  4A6D A;  1MH3 A;  2ISY A;  1TBX A;  1RR8 C;  1QNT A;  2K02 A;  3AG3 H;  3ELK A;  3CUO A;  3DKY A;  1XDU A;  1IN6 A;  2VXD A;  1R22 A;  1APL C;  1B9M A;  5CQG A;  1X1C A;  1K6Y A;  4CYC A;  1PUF B;  3O8G A;  1JTX A;  3WTZ A;  4UVC A;  2E1O A;  3KP3 A;  4AU7 A;  1GVJ A;  1ZEL A;  3KZZ A;  3OR1 C;  4HPQ A;  3S2W A;  3LA2 A;  3TW6 A;  1WHU A;  3FBI B;  1TTY A;  1WJD A;  3MWM A;  1A6Q A;  1T38 A;  5DCM A;  1FIP A;  3VDX A;  3L9F A;  2HPI A;  2KZV A;  2L4A A;  1J0R A;  2XAQ A;  1Z0X A;  3K4K A;  2KQR A;  2X9D A;  5EYR A;  5ILV A;  5HOO A;  1P7J A;  3FKI J;  4XLF A;  3E7L A;  4IVN A;  4IX7 A;  3VYT B;  4KIS A;  5IY5 H;  3RKX A;  1F36 A;  1P7I A;  3NRV A;  3Q9V A;  3ASN H;  1R23 A;  4ZYA A;  1R71 A;  5K5Q A;  5F0H A;  2R7Q A;  3BG7 A;  1LPQ A;  2STT A;  3AG4 H;  5JFR A;  4AM3 A;  3QPL A;  1KQ0 A;  3CD6 I;  2JQ7 A;  3IKT A;  4C2T A;  1JUM A;  2JA5 J;  1TNS A;  3CCV I;  1PP7 U;  1Q1V A;  4P9U A;  4BDY A;  2MG4 A;  4XLA A;  4KMU X;  2ZJR F;  1OJL A;  2F6C A;  4I2O A;  3QQA A;  2PBI A;  3F21 A;  1MJA A;  1X3W B;  2RV8 A;  2AQE A;  2NNN A;  3EUH A;  2QSF X;  2HYF A;  2IA1 A;  2I10 A;  4HBL A;  1GV2 A;  1YI2 I;  4EM2 A;  3K2A A;  3WHB A;  1FIA A;  3VEP A;  1S5L C;  5GTI C;  1FOK A;  1HCR A;  1H9G A;  3Q0U A;  4FX4 A;  1Y39 A;  2CFX A;  2E2J J;  3ZQC A;  2O9L A;  1ETY A;  2V1N A;  3D5S C;  2IAI A;  1B59 A;  2QSH X;  3NAU A;  4DOZ A;  5JLW A;  2M5W A;  1R00 A;  4CYD A;  5IP6 A;  1JKP C;  4A3C J;  2KRF A;  1Q1H A;  5K5R A;  1AU7 A;  2MSY A;  1Z9C A;  4DQ2 A;  2BXY A;  2UV1 A;  2XB5 A;  5H6Q A;  3GLX A;  3T8T A;  3M8J A;  1P4X A;  4XKC A;  5F08 A;  1OCZ H;  5H20 A;  2RKH A;  2X1D A;  2ZB9 A;  3KE2 A;  4RB3 C;  2YU9 J;  1KON A;  3S1N J;  1BBY A;  5CVR A;  2HS5 A;  3S32 A;  1BC7 C;  5J6X A;  1FBQ A;  1DPR A;  4XBF A;  4AVZ A;  5LGU A;  2FSW A;  5F27 A;  3CQZ J;  2K4J A;  3U1K A;  2P5V A;  4LLL A;  4Y17 A;  5DD8 A;  3ERE D;  2BY1 A;  4IRI A;  1Z7L A;  2VC0 A;  2VC1 A;  3T8R A;  1JTY A;  1RET A;  1TNT A;  3FM5 A;  3FM3 A;  5GTH C;  2RGV A;  2L7F P;  4R1H A;  4X6A J;  2PG4 A;  3CTA A;  3CF2 A;  4KFC A;  4A0X A;  4E6K G;  5BNG A;  4HRI A;  1WKM A;  3PSI A;  2ESN A;  5ERI A;  2QBY A;  1WH5 A;  3FIW A;  4LFU A;  4BHB A;  3WGI A;  5E79 C;  3BR1 A;  2KDO A;  3TO7 A;  3SDG A;  4ZYH A;  1B8I B;  2ICW G;  1XTA A;  2LMD A;  2EA4 A;  2DT5 A;  1NK2 P;  1SVL A;  1MSE C;  4EJW A;  3HZJ A;  5D6E A;  4ZYD A;  3F8F A;  2H94 A;  3E5X A;  1G3S A;  4E7J A;  1TWH J;  4HQE A;  5J47 A;  2Y2Z A;  4PCQ A;  5E18 F;  3BZ6 A;  2Q2E A;  1HA8 A;  4D1Q A;  3OIQ A;  3GUD A;  2BY3 A;  3HB9 A;  2UZK A;  1TC3 C;  1KQ8 A;  3H3V K;  1YX5 A;  2W25 A;  2IGO A;  3L00 A;  3PNY A;  3HKZ A;  4OAZ A;  2HQR A;  1ETV A;  4XRS A;  2AXL A;  1O3T A;  3F6O A;  2W7N A;  1DDN A;  1Y0U A;  2VT2 A;  3VPR A;  4HDU A;  2HXI A;  3IH4 A;  2WWY A;  1FYL A;  3OYK A;  3RZD J;  3BJA A;  3CES A;  2KL4 A;  1A5J A;  3L2R A;  3LSK A;  2LYC A;  2J5P A;  1FBU A;  2IGM A;  1P92 A;  2DCE A;  1OCP A;  1R5H A;  2DOD A;  3RIR A;  4Y4R A;  4XNF A;  2X4H A;  3FZV A;  3MEX A;  2DMT A;  2MAB A;  3B02 A;  4I09 A;  2H1L A;  1RRJ A;  3ERM A;  2WA0 A;  1PDN C;  2CO5 A;  3GX4 X;  2LR8 A;  4BL0 B;  1R36 A;  2GIV A;  3FDY A;  3QP5 A;  3C7J A;  1X1P A;  1JHF A;  2EZL A;  4QSH A;  3VYS B;  2ISZ A;  3BWG A;  2NRA C;  3RKW A;  1VTN C;  3HG9 A;  1ZN2 A;  4LIU A;  3I58 A;  2QA4 I;  1D1C A;  3A1Y A;  2MC3 A;  5IOZ A;  3ULQ B;  2JA7 J;  1J9I A;  1RI7 A;  5BQT A;  2VQG A;  3MCZ A;  4AID A;  2CYY A;  4A3L J;  1VQO I;  4XR6 A;  5F0F A;  1N25 A;  3UNG C;  4I6Z A;  1XN7 A;  2R4G A;  2R7O A;  1SVM A;  5D4R A;  1UST A;  2DTZ A;  3I4P A;  2M4K A;  4UUS A;  4IQ4 A;  2CH0 A;  1W7P D;  1W4M A;  1ETO A;  1ZK8 A;  4HV5 A;  4MIM A;  3E6M A;  2V1X A;  4KMF A;  3BRO A;  1S9H A;  1HKT A;  4HSR A;  2JT1 A;  5HVQ C;  2L9V A;  3HOU J;  1TZL A;  4LB6 B;  2JRT A;  3NEU A;  3PNT A;  3S2D J;  1DP3 A;  1IXR C;  1U8B A;  2AO9 A;  1WJB A;  4P5O A;  2R7V A;  1YJ9 I;  5D5U B;  4XLN F;  1FJL A;  2XKO A;  4L5E A;  4M6V A;  3U9G A;  1F4K A;  1G8X A;  5HLI A;  2HFH A;  2OZU A;  3PQK A;  2ZNZ A;  3VWB A;  3LL7 A;  2CWE A;  3L2W A;  5E20 A;  4ENK A;  3VFZ A;  1LJ9 A;  3U2R A;  1T0F C;  2EH3 A;  4BUP A;  2O0Y A;  4S04 A;  2X48 A;  3KEQ A;  5HNH A;  1ZRF A;  4OIP F;  5J40 A;  4I0B A;  3S15 J;  2JA2 A;  3WU1 B;  1AWC A;  3BP8 A;  4YEJ A;  1FYK A;  5IT9 K;  1KU2 A;  2DN0 A;  2K9L A;  4XK4 A;  3K2Z A;  4LLG F;  2Y9Z A;  2JWT A;  3A02 A;  5C3E J;  3OS1 A;  1D8K A;  3M8F A;  4OIQ F;  1ZR4 A;  2QM3 A;  1E17 A;  3I54 A;  3PJR A;  3RYP A;  3RKY A;  1PUF A;  4MEX F;  2E1C A;  3H5R A;  3DQV C;  1N77 A;  3I56 I;  3CO7 C;  1LNW A;  1VQP I;  1Z3Y A;  3ABU A;  2QLZ A;  1YG2 A;  3CLQ A;  5L3F A;  2P7C B;  1FBS A;  2DYR H;  3CUQ C;  4A3F J;  4S0H B;  2VLA A;  1VQ7 I;  4A3E J;  2CQN A;  4R79 A;  5JHF A;  1X19 A;  5FLV A;  3OL3 A;  3EET A;  2HQA A;  2M8G X;  4M9Z A;  1U6G A;  4WK8 F;  1R58 A;  1BJA A;  2FJ1 A;  5J1U A;  4ZYE A;  5FFZ A;  1JHH A;  2L0K A;  5ICG A;  3H9Q A;  2H1K A;  4A0Z A;  3ABT A;  2M0M A;  4ETS A;  5K7F A;  2AXT C;  2VKV A;  4P9F A;  3F0C A;  1CF7 B;  3CUQ B;  4RAG A;  1T08 B;  3FBN B;  2E71 A;  3ZOB A;  3GBG A;  3CCL I;  1X2N A;  4NDL A;  1ZH5 A;  1BL0 A;  1O3Q A;  3CDI A;  3A2K A;  5DEQ A;  5J8F A;  2FXA A;  1KA8 A;  4AYB N;  1W0T A;  1R49 A;  3SZT A;  1K7A A;  1MKM A;  1R5G A;  4HX8 A;  3CF5 F;  1JKR C;  2OCC H;  4V2G A;  1UAA A;  2JPC A;  3PIP F;  1XSX A;  4HQM A;  4OMY A;  1E3P A;  2LDU A;  4YIR X;  1BC8 C;  2F4M B;  2YS9 A;  1O7L A;  5A2Q Z;  3JR9 A;  4A3I J;  3TP3 A;  5F1J A;  1WJ5 A;  2YX4 A;  3R60 A;  3JRC A;  3RSN A;  2RNG A;  2L9R A;  4E7I A;  1IRZ A;  2EFP A;  5ICC A;  3GZN B;  2FML A;  4P55 A;  1ZRC A;  2K3P A;  1E3H A;  3X2Q H;  5L3G A;  4XOP A;  1TQM A;  2PMU A;  5GPC A;  3ISP A;  1XSD A;  3GFL A;  4WXC A;  1SFK A;  2IGN A;  4XMY A;  1AOY A;  5FD5 A;  1Z3X A;  2GBY A;  1TL8 A;  4DYR A;  2VN2 A;  1YX3 A;  1T95 A;  1WJE A;  3PIO F;  5D8K B;  1MZB A;  3GZ6 A;  4IHW A;  3GTP J;  1MW7 A;  2XAG A;  1V55 H;  4E7H A;  4BS9 A;  3OYI A;  4M3D A;  3BTI A;  1MD0 A;  4RM3 A;  5FKL A;  4A3M J;  3MMY B;  4IOA F;  3PM1 A;  2EIM H;  1RC9 A;  4EVI A;  1YQA A;  2XHK A;  2VJI A;  4CHU A;  1FP1 D;  2R7W A;  4AIJ A;  3M3Y J;  1T33 A;  3JSO A;  4WXD A;  3CDL A;  3RPU A;  4B47 A;  4AYB A;  1SMT A;  2DMP A;  3M1E A;  2RQQ A;  3WG7 H;  1X58 A;  2HPM A;  1ETK A;  1K6O A;  3QPH A;  2XGD A;  2LFB A;  3BJO A;  2X1C A;  3J80 K;  2XIG A;  1NG6 A;  3BG5 A;  4G7H F;  2A6H F;  1NH3 A;  3JRF A;  4I02 A;  1P4W A;  3IRQ A;  2KIS A;  2A05 A;  1EF4 A;  4B3A A;  1BJZ A;  4PJN A;  2KKO A;  3GTL J;  4CCJ A;  1MJB A;  2BVM A;  4ABZ A;  1FPQ A;  4FHT A;  1OIS A;  3PSF A;  2P6T A;  3MAJ A;  2K85 A;  5IOY A;  3DBR B;  4DZJ A;  2F48 A;  4BJ5 C;  3OY9 A;  4CZC A;  4EQQ A;  3CCM I;  4UXN A;  4IRG A;  5KVR A;  2L7K A;  4NUB A;  1R5I D;  3K4N A;  4BYY A;  2WAD A;  3OYL A;  1TW3 A;  5LRS A;  2F4O B;  5DS9 A;  4RM2 A;  4I99 C;  4LG3 A;  4ZDO A;  2LTP A;  4CCM A;  4E7L A;  5LEJ A;  2FBH A;  2OF7 A;  4Y13 A;  1VQ6 I;  4KDP A;  4QLC U;  3F6V A;  1RZ4 A;  3H1C A;  3IAS 2;  4KIT B;  2DO7 A;  2AQF A;  5HOD A;  3JTH A;  1T2K A;  4EAT A;  3QPT A;  1SFE A;  4P96 A;  3LSM A;  5EZG A;  2EIJ H;  3PQJ A;  2JK3 A;  1UB9 A;  1ZKG A;  1VQ5 I;  2W57 A;  3KLO A;  1QGP A;  1D3Y A;  1YLF A;  2B0L A;  4RAY A;  3GTG J;  3LAP A;  1FT9 A;  1X2M A;  1R4N B;  1XS9 A;  4FE7 A;  4LJZ F;  1MBH A;  3O6B B;  4JX5 A;  3MFK A;  4QPQ A;  2CQ7 A;  4DZP A;  2PJR B;  3OYE A;  3C3W A;  5JLX A;  3T1B A;  3ABM H;  4CA0 A;  1JT6 A;  1ZRE A;  2WB1 A;  3HDD A;  5KAF C;  3TW7 A;  2K4B A;  1Z05 A;  4M3G A;  3TOB A;  1U2W A;  1SC7 A;  2XVC A;  4O6J A;  2EIK H;  2CU7 A;  4PFO A;  2L54 A;  3VYU B;  3CC7 I;  2FX0 A;  3FHN A;  3TED A;  4AIH A;  4BNC A;  3JRH A;  1PVE A;  3I3L A;  1XGS A;  1V5G A;  2O03 A;  2OU2 A;  1ERD A;  1JJ6 C;  2R0Q C;  2DFE A;  2LRE A;  3U1D A;  2KIM A;  4NC8 A;  3W2V A;  3HSE A;  4UB8 C;  1Z77 A;  1ENH A;  3BR6 A;  1QZZ A;  3FMQ A;  1AHD P;  3ZR8 X;  4IJA A;  3H0D A;  4K2E A;  1VQ4 I;  2GAU A;  2BGC A;  3WE2 A;  2PEX A;  2OUM A;  4ZH4 F;  4HLY A;  3HYI A;  2ZJ2 A;  3DP7 A;  4BE2 A;  3L2C A;  3QYB A;  1D8J A;  1GV5 A;  4MNU A;  1D1A A;  2XC7 A;  5B66 C;  3F8B A;  2ELK A;  3NQO A;  1FZP B;  1IUF A;  2MYS A;  1X4O A;  3S14 J;  2JUG A;  4PGH A;  1HXD A;  3JSP A;  2F5D A;  1M1E B;  2P4W A;  3KP7 A;  2GXB A;  1JUS A;  3K0L A;  2G7H A;  1A04 A;  2JTV A;  2XRL A;  5L3D A;  2HKO A;  1LVA A;  2L7M P;  1H88 C;  2CV0 A;  3M9A A;  1IW7 F;  3ZQL A;  1S6L A;  3HIF A;  2MFZ A;  3DBH B;  3SFI A;  1T0F A;  3BTC A;  4DGW B;  4A6E A;  2D5V A;  1A6I A;  2OBP A;  2DDB A;  1TP4 A;  3BJ6 A;  1UMQ A;  1KU7 A;  2VQC A;  3BR5 A;  3K4M A;  2QSG X;  2O6G E;  4GFB A;  5LHG A;  2M30 A;  4C3I J;  5K7Z A;  2E2H J;  2Q8K A;  5CVV A;  4XKV A;  3JRA A;  2L7Z A;  3GTM J;  3PUF A;  4HAM A;  1X1B A;  4BGD A;  4ZYG A;  4PJM A;  3MN2 A;  2R93 J;  4ASN A;  2KDZ A;  2LF7 A;  3N97 A;  2OTL I;  1I1G A;  2HTJ A;  2KFD A;  2JMW A;  4XON A;  2VON A;  2LKS A;  3SYT A;  4PSX A;  5DV5 A;  2VKH A;  1CF7 A;  3CUQ A;  4BXF A;  3E5U A;  3C1D A;  1YRN B;  2RRE A;  2YSR A;  3I53 A;  2BV6 A;  2HR3 A;  1R1V A;  3I59 B;  2CUF A;  1LUJ B;  3HXL A;  3A01 B;  4IOC F;  3G1M A;  1RKW A;  2DDA A;  2P81 A;  1Z7U A;  1LDD A;  2LG4 A;  3A4C A;  2CG4 A;  3HHG A;  1S29 A;  4QWQ A;  1X3U A;  2EK5 A;  5F64 A;  3DLL F;  2F5C A;  2ME0 A;  4IQJ A;  4Z2Y A;  4XID A;  3R6S A;  2XSJ C;  2ECB A;  3IKV A;  4OIR F;  3L7W A;  3M7G A;  3IL2 A;  3HC7 A;  1O4X A;  1F43 A;  3Q3S A;  1X1A A;  5IT3 A;  4KIB A;  4J19 A;  4P1W A;  1WJA A;  4BY1 J;  2WV1 A;  1KYW A;  1BM9 A;  2CUZ A;  1BR1 A;  3JRE A;  3AG2 H;  5IP9 J;  1IGN A;  1T98 A;  1UEL B;  3JCU C;  3QYE A;  1LEA A;  4XIC A;  1BW5 A;  2Z3Y A;  3UKG A;  4E7S A;  3WU2 C;  2IS4 A;  1ZGA A;  2QQB A;  2HVR A;  1BOB A;  4F52 A;  1OCT C;  1VI0 A;  4PJJ A;  1T39 A;  3MD2 A;  2B7E A;  1DU6 A;  2DQL A;  2QEN A;  2TCT A;  1W7P B;  1FEX A;  4JP0 A;  2DOA A;  3IWF A;  1FMW A;  4CCK A;  1TLH B;  1VF9 A;  5C44 J;  2BE5 F;  3JRB A;  3FX3 A;  1N78 A;  3R0A A;  1OCR H;  3WE3 A;  3GFI A;  3B6A A;  1VQ9 I;  2IS6 A;  2YU3 A;  1B1B A;  4G8X A;  2X51 A;  3V8L A;  2IW5 A;  3DKX A;  1IXS B;  1XCB A;  2E34 A;  1K79 A;  2ELJ A;  2VXZ A;  1BR2 A;  1ONV A;  2K9M A;  3R0J A;  3G2B A;  3ZPL A;  1SD4 A;  2RAE A;  1QHG A;  1TT5 B;  3D5R C;  1L3L A;  1IF1 A;  1VZ0 A;  1XD7 A;  2KZG A;  1SD6 A;  3E1S A;  3P9K A;  5EZH A;  2H8R A;  1WI9 A;  5DTD A;  3CDH A;  2VOD A;  1GVD A;  2X0L A;  5BOX A;  5D8L B;  2L4M A;  1D0Y A;  2OZ6 A;  1FSH A;  4HA8 A;  2G7U A;  2QWW A;  5BPI A;  2Y0M A;  1NHA A;  2IP2 A;  4QPO A;  3SZG A;  2KP6 A;  5M3M J;  5BMZ A;  2IT0 A;  3HRU A;  5LFA A;  2MBF A;  2E1N A;  5HLG A;  1NTC A;  3HKZ N;  4M6Y A;  4DNC A;  4AIK A;  4M74 A;  4HNU A;  2CS3 A;  4OAY A;  4G7O F;  3HPG A;  3OL4 A;  4BQO A;  1MSF C;  2K9Q A;  1X3Z B;  3IC7 A;  3RDI A;  2M87 A;  2DMN A;  3K1P A;  1OYW A;  1HST A;  4CIC A;  5EG0 B;  3OYM A;  1PUE E;  2NVU B;  4EV0 A;  2Z5U A;  1MH4 A;  4Q48 A;  3V7C A;  2VJJ A;  3SEZ A;  1POG A;  3IAM 2;  3DCF A;  2CFO A;  2O5R A;  4XLP F;  3MKZ A;  1MDM B;  5E1W A;  4EEF G;  4U7D A;  3AL0 C;  2QF7 A;  3BC8 A;  2DU9 A;  3CJT B;  2M4G A;  4A5M A;  3F72 A;  2MD5 A;  1X1D A;  2HOS A;  4BY7 J;  4NNJ A;  1OKR A;  2MA3 A;  4I0A A;  2CGP A;  2VAS A;  4KNY A;  2NS8 A;  3LWF A;  1SEU A;  4HF2 A;  1SFX A;  2HDW A;  2CQX A;  1CGP A;  2LBF B;  4U87 A;  1BA5 A;  1T6S A;  1ORK A;  1R7J A;  3DTI A;  5JHU A;  1Y6I A;  3AL0 B;  4OMZ A;  1QU3 A;  5CYV A;  5HDN A;  4GYG A;  3IH2 A;  2BY2 A;  3TO9 A;  4D7N A;  4M71 A;  2QQA A;  5ICE A;  4HST A;  2R5Z B;  4BBS J;  1IO2 A;  4CZZ A;  3GCM A;  1T56 A;  2I5U A;  4RAF A;  5L3C A;  5EEG A;  2KRC A;  2P0W A;  3W3C A;  4AUX A;  3J80 Z;  4HV6 A;  3REO A;  1XG1 A;  2Y9Y A;  3SFZ A;  2CV1 A;  3QYF A;  1MGT A;  4EM0 B;  4RB2 C;  1FTT A;  2F2E A;  4LD5 A;  4LK0 F;  4MO7 A;  1QO0 D;  5IPA A;  4MTE A;  4Q47 A;  2QUF A;  4G6D A;  3BZC A;  4PDK A;  5D5W B;  2HKX A;  1A36 A;  4DYC A;  3HOW J;  2ZJP F;  4ZDL A;  1H9T A;  2JJ7 A;  5K5O A;  5EGO A;  5LHI A;  5H6R A;  5CJ9 A;  2HEO A;  2K9S A;  1FY7 A;  1KZH A;  3K9T A;  5M5W J;  2GA1 A;  3P7N A;  3S1R J;  4XL9 A;  1XCV A;  4YFX F;  4Q5S F;  1IRF A;  2ZJQ F;  1OFC X;  4F3Q A;  2R7X A;  2W24 A;  4A5N A;  3V4G A;  3RI4 A;  5D6F A;  3GTK J;  3ZRG A;  5LLQ A;  2HVQ A;  2LY1 A;  2VJ5 A;  4C2U A;  3KPH A;  2LRD A;  5FO5 A;  5FKN A;  3SDB A;  3HRT A;  2VBZ A;  2YPR A;  2XB0 X;  2JSP A;  4BHC A;  2VE8 A;  1XPX A;  3M1C A;  3ML6 A;  2BOL A;  3K1M A;  5F0C A;  4CCO A;  4EJV A;  1I5Z A;  3OYJ A;  1XMA A;  4V19 K;  3CJR B;  2X6W A;  1BI3 A;  3CP8 A;  1RNL A;  2O7O A;  4HF1 A;  1PYV A;  4XN3 A;  2G9W A;  4KT6 A;  3ZN1 A;  1J5Y A;  3F23 A;  2B63 J;  1JKO C;  4BAC A;  2M9H A;  3DU5 A;  4ENN A;  2OCE A;  2HZD A;  3V42 A;  1EKE A;  4G12 A;  4B8X A;  2ZNY A;  1IN8 A;  1Z6R A;  2W82 A;  3DPU A;  2LKX A;  4LOC A;  4PJ0 C;  4OIO F;  1GDT A;  2GWR A;  1UFM A;  4A93 J;  3C2H A;  5AIP A;  2XRN A;  3TBI A;  1YRN A;  3HM5 A;  2V79 A;  3KYC B;  4I76 A;  2H6B A;  1JGS A;  3I59 A;  5ICF A;  1MMS A;  4L9N A;  2HDC A;  4UV8 A;  5HLH A;  3A01 A;  1PJR A;  3OSF A;  1WWX A;  3AFH A;  1HF0 A;  2HOT A;  4M72 A;  2X6O A;  2FOK A;  3HTU A;  4HNV A;  1FSE A;  1MMA A;  2OJE D;  2VPR A;  2JRM A;  4L9V A;  2XPU A;  2LK2 A;  2P8T A;  1DU0 A;  2HVS A;  3GTJ J;  1Y0N A;  1S7E A;  2KRH A;  4NBQ A;  2V7F A;  3M07 A;  2LNB A;  2Z9O A;  2KIQ A;  6PAX A;  2L5Q A;  4XLC A;  1HSJ A;  1VQ8 I;  5FLM J;  2J5O A;  3MZY A;  2FA5 A;  2ESH A;  2Z33 A;  5FRO A;  2EA2 A;  5LD2 C;  5LRR A;  2NS7 A;  4M73 A;  3OYC A;  4MQ9 F;  1FP2 A;  1G3W A;  2V1D A;  1VQL I;  4JOM A;  3MKL A;  5F04 A;  1SFU A;  1IN4 A;  3I4M J;  4G6Q A;  3LMM A;  2V6C A;  4UVA A;  2DMU A;  4CCN A;  2RNJ A;  2GM4 A;  3Q9S A;  1LDJ A;  3WHC A;  4KN7 X;  3LSP A;  3GEZ A;  1C0W A;  3DV8 A;  2XAH A;  1WZ2 A;  5JVG F;  3S16 J;  9ANT A;  2IPQ X;  4G94 A;  2Y30 A;  3A03 A;  2K40 A;  4LG0 B;  3IH3 A;  3RPU D;  3S2H J;  4A2U A;  1D0X A;  2LY2 A;  4C3J J;  4JYK A;  1VFC A;  2Y75 A;  1ZG3 A;  3IWZ A;  1RIO H;  1FLI A;  2X6X A;  3CZ6 A;  1Y8R B;  2VL8 A;  2YX7 A;  4MQV A;  3E0J B;  1YW9 A;  5EEH A;  5ILS A;  2DK5 A;  2BEO A;  3BLY A;  1ODD A;  1ZHF A;  3DEE A;  3HOS A;  1IC8 A;  1AKH B;  3OYH A;  2DT7 B;  3S3N A;  3QPS A;  1HQC A;  2CW7 A;  2M8E A;  2Q0O A;  1U8R A;  3P9I A;  1YW7 A;  3FXK A;  3WTU C;  1E3O C;  3KCC A;  2EWN A;  4F93 B;  1U9O A;  1MIJ A;  1RR7 A;  4RGX A;  3JRI A;  1SFO J;  2A69 F;  3C2G A;  4D9J A;  2NVY J;  4WF2 A;  4GGG A;  3LNQ A;  3CCE I;  2FBK A;  1USS A;  3CCR I;  2JA6 J;  2RDP A;  3G1L A;  3W6J B;  2K9N A;  2DPD A;  3K4L A;  2GA2 A;  1QPI A;  1FNN A;  2Z2S B;  4B1R A;  2ZSI B;  2JN6 A;  1LDK B;  1WFX A;  2VQH A;  4R8H A;  3UR3 C;  4IXA A;  2XGC A;  2DA5 A;  5IYD J;  3BPV A;  3CME I;  2D45 A;  2VT3 A;  3SZP A;  5CPR B;  2E2I J;  4D5F A;  1DUX C;  2ADU A;  3AG1 H;  2QZ8 A;  3OYD A;  2R7S A;  2MC4 A;  2ELH A;  1OQY A;  1U3E M;  2JUC A;  3VSL A;  5H2F C;  4HF0 A;  2LC2 A;  2W85 A;  3PUB A;  2HZT A;  5HDG A;  2R3S A;  1IG7 A;  5KCM A;  4UUV A;  1VND A;  5DM7 F;  5EG0 A;  2R7T A;  3RCO A;  4XN0 A;  1H8A C;  3MQ0 A;  3FF5 A;  1UG2 A;  1TWG J;  1XMX A;  2V4J C;  1A31 A;  3W6K B;  5AON A;  1MJ9 A;  1OCC H;  1OYY A;  4ENJ A;  3R4K A;  2FBI A;  3B73 A;  4YG2 F;  4XKB A;  5FD6 A;  3KZY A;  1MDM A;  3DPT A;  3KP4 A;  3CMY A;  2A5Y B;  4RLF A;  2EPF A;  1KGS A;  1R1T A;  3ASO H;  4KIG A;  2FF4 A;  4L9T A;  2HQ5 A;  4Y15 A;  1S7O A;  2BHZ A;  1W36 D;  4RBO A;  1ON2 A;  1B8I A;  3TDZ C;  5CVU A;  2ZBK A;  5FGM A;  2KLO A;  3SHF A;  1MBJ A;  3TQN A;  2WB1 N;  2X1E A;  3L2Q A;  1LB2 A;  4N9I A;  3HRS A;  2O8K A;  3FXM A;  2LBF A;  1FWZ A;  2HWV A;  1TWA J;  3BTJ A;  2DAO A;  1SD7 A;  2A5W A;  4M3E A;  1P2F A;  2HDD A;  2DW4 A;  4EGY A;  2R5Z A;  3S8P A;  3S17 J;  4HDV A;  4H0E A;  5DUK A;  4RMN A;  2IBD A;  2DA6 A;  2AHQ A;  3K7A J;  4BDZ A;  3OIP A;  4U0W A;  1V5F A;  3S93 A;  3WGH A;  2PFB A;  1JXS A;  2WAQ N;  1UHW A;  4KIF A;  4ITV A;  2R5Y B;  1SVO A;  3BCB A;  5LBQ A;  1FYM A;  4YII A;  4BEH B;  3L2U A;  1J75 A;  2CUJ A;  3F22 A;  3OYA A;  5TGT A;  2A07 F;  3LFU A;  2DK8 A;  2MH2 A;  4J01 A;  5DD4 A;  5F1R A;  2VOO A;  3SXY A;  4TV7 A;  1D1B A;  4CH7 A;  3DBL B;  3I4N J;  1WH7 A;  2XDV A;  1ZGJ A;  2X85 A;  3QWL A;  1UG0 A;  1V4R A;  2XV4 S;  2PI0 A;  3FWE A;  2VBW A;  2PMH A;  2H6C A;  2M7A A;  1YJN I;  2NOG A;  1RUN A;  3HJE A;  2KJB A;  2LSO A;  2UUZ A;  2XRO A;  3VB2 A;  1QRY A;  2MW8 A;  3LA7 A;  3ZN0 A;  2XKP A;  4B43 A;  4NC7 A;  1D0Z A;  3WTY C;  4OIN F;  4FET A;  2LVS A;  3WTT C;  1IJW C;  3IHU A;  2IJL A;  2XUB A;  2DFF A;  4EM1 A;  2QKM B;  2DXI A;  1J59 A;  2STW A;  3CO6 C;  4Z6Y A;  3O8H A;  2C6Y A;  1PP8 F;  4BQN A;  3LSG A;  3DTK A;  4RA2 A;  2E5N A;  2DBB A;  1ZG5 A;  4FX0 A;  2WAQ A;  5LEK A;  1K78 B;  5J1R A;  2O61 A;  4CUG A;  3KP2 A;  1RES A;  3LQQ A;  3CCU I;  2KT0 A;  5GPA A;  2LH9 A;  5M5X J;  1Y1W J;  2BYV E;  4ZDP A;  3JAM K;  2DOF A;  3RTR A;  3J7Y J;  2Y31 A;  3FMR A;  3GME A;  3OV8 A;  2Z99 A;  3SEQ A;  5CQE A;  2IS1 A;  1NG7 A;  2ZC2 A;  1U5T C;  4MGR A;  1MBG A;  5E3M A;  1D5Y A;  2NVX J;  3D0S A;  4BBR J;  2K86 A;  2RC4 A;  2M0C A;  3HGY A;  3S3O A;  3W6V A;  2N8G A;  3BTL A;  1IRG A;  4HEA 2;  4WX9 A;  3ZQQ A;  1TQI A;  1BI1 A;  2VE9 A;  1OMI A;  4UHT A;  1BR4 A;  4A3G J;  2HXO A;  1U5T B;  2H8W A;  2ZME C;  3QU3 A;  1Y56 A;  4WWC A;  3M4O J;  1U0J A;  3G73 A;  3E3V A;  1XGM A;  3G71 I;  2GIZ A;  2RQP A;  1LQ1 A;  3FXO A;  4IHT A;  4O3M A;  2LD5 A;  4GXO A;  2Z1D A;  4PZJ A;  1IDY A;  4C3H J;  5HS9 A;  3WTW C;  4X1E A;  4GYI A;  2GOM A;  3CJN A;  3MZ8 A;  3HTS B;  2ZME B;  2KHM A;  4MFD A;  3LST A;  3KP6 A;  1D5V A;  2EBI A;  1HDP A;  3BZK A;  5C4X J;  5HNF A;  3FXR A;  1FOY A;  3LSJ A;  2ACJ A;  2EFN A;  4ESF A;  3QRF F;  3KYL A;  3BR0 A;  4G6T B;  1GXQ A;  3TO6 A;  2CQQ A;  2VOP A;  1LE8 B;  4IRH A;  4F55 A;  1NK3 P;  4NB5 A; 
#chains in the Genus database with same CATH homology
 1POG A;  3DCF A;  2Y9Z A;  2JWT A;  4W97 A;  3A02 A;  2M2E A;  5C3E J;  1G2H A;  1H89 C;  1ZR4 A;  4A3J J;  4EEF G;  1TWF J;  3RKQ A;  1PUF A;  2QF7 A;  3HEF A;  1K83 J;  2HOS A;  4RDU A;  4BY7 J;  3LSR A;  1AKH A;  5J1Y A;  2NS8 A;  2CQX A;  3G1O A;  1UHS A;  4A3F J;  1BA5 A;  4S0H B;  4A3E J;  1ORK A;  1WI3 A;  2DA7 A;  5FLV A;  4IEJ A;  3IH2 A;  2M8G X;  4D7N A;  1U78 A;  2FJ1 A;  5J1U A;  2R5Z B;  2L0K A;  4IHX A;  3B6C A;  4BBS J;  1T56 A;  2H1K A;  2DA4 A;  5K7F A;  2QCO A;  2XPV A;  2VKV A;  4A3D J;  3F0C A;  3ZOB A;  4AUX A;  5E3L A;  3GBG A;  2ME6 A;  4QIW N;  1X2N A;  4M3F A;  4NDL A;  1XG1 A;  2LLK A;  2Y9Y A;  1BL0 A;  3ZQF A;  3BR2 A;  3TP0 A;  3JRD A;  1FTT A;  4MO7 A;  4M3B A;  2DMQ A;  5IP7 J;  2DA1 A;  4AYB N;  3S1M J;  5IPA A;  1ZTR A;  1W0T A;  3HGG A;  5J3L A;  1B72 A;  1XC5 A;  5EDN A;  1JKR C;  2MGQ A;  3BG9 A;  4V2G A;  5FKK A;  1IV6 A;  4DYC A;  1JT0 A;  3HOW J;  3HOX J;  4Y52 J;  2JJ7 A;  5EGO A;  3JR9 A;  2YS9 A;  1IDZ A;  5C4J J;  4A3I J;  2K9S A;  3TP3 A;  2VUM J;  5F1J A;  3JRC A;  1JGG A;  5M5W J;  2DA2 A;  3PO3 J;  3S1R J;  1SAN A;  2L9R A;  2HI3 A;  1IRZ A;  3DEW A;  1OFC X;  4BXX J;  3HBL A;  3NAR A;  2OPT A;  3GTK J;  2DJN A;  5IYB J;  2FQ4 A;  4A3K J;  2PMZ N;  1R9T J;  3OSG A;  5GPC A;  3Q0V A;  1FTZ A;  5M5Y J;  1MNM C;  1JUP A;  5FKN A;  5M3F J;  2GBY A;  2XB0 X;  4DYR A;  4IHW A;  3GTP J;  3D1N I;  5F0C A;  4A3M J;  4M3D A;  1MBF A;  3BTI A;  1RKT A;  5FKL A;  3Q0W A;  3PM1 A;  4FTH A;  2O7O A;  3ZQI A;  5EGO B;  3M3Y J;  1T33 A;  3HOV J;  2B63 J;  4A3B J;  2ID6 A;  3CDL A;  1JKO C;  2M34 A;  3HOY J;  2M9H A;  2DMP A;  4BKX A;  5EEA A;  4G12 A;  4FIS A;  1U9N A;  1X58 A;  1HLV A;  1ETK A;  2LKX A;  4LOC A;  1HDD C;  2XGD A;  2LFB A;  2LP0 A;  1GDT A;  4A93 J;  1YRN A;  3BG5 A;  3HM5 A;  4I76 A;  2COB A;  3JRF A;  2R5Y A;  4FE4 A;  1EF4 A;  3A01 A;  4B3A A;  3OSF A;  1HF0 A;  2HOT A;  1BJZ A;  4AC0 A;  2X6O A;  3GTL J;  4UUS B;  2NVQ J;  4HNV A;  2VPR A;  4ABZ A;  4FCY A;  3GTO J;  2R7Z J;  3CCY A;  5EF6 A;  2XPU A;  2LK2 A;  1ZQ3 P;  1DU0 A;  3GTJ J;  1S7E A;  3BQY A;  5IOY A;  4DZJ A;  4D5C A;  4MLO A;  5FLM J;  1JJ8 C;  2NS7 A;  5DS9 A;  1WGX A;  2LTP A;  2OF7 A;  3MKL A;  5E3O A;  5F04 A;  3I4M J;  2IEK A;  3RQI A;  4B4C A;  3JRG A;  1QVT A;  2DMU A;  2GM4 A;  3WHC A;  5HOD A;  3BQZ A;  1BW6 A;  3LSP A;  4XRS G;  5EZG A;  2TRT A;  3BT9 A;  2JK3 A;  1ZKG A;  1MH3 A;  4JX6 A;  3S16 J;  2HYJ A;  9ANT A;  3GTG J;  1WCM J;  3PO2 J;  2DA3 A;  2E19 A;  1X2M A;  2Y30 A;  3A03 A;  2K40 A;  3IH3 A;  3S2H J;  1XS9 A;  1APL C;  4FE7 A;  4C3J J;  4JYK A;  1VFC A;  1MBH A;  4JX5 A;  4CYC A;  1I6H J;  1PUF B;  3O8G A;  1JTX A;  4DZP A;  1TWC J;  2E1O A;  4UUT A;  5JLX A;  3FIS A;  2VKE A;  3TW6 A;  1JT6 A;  3HDD A;  3LOC A;  1IC8 A;  1AKH B;  3TW7 A;  2R92 J;  3QPS A;  4M3G A;  4QTR A;  1FIP A;  1E3O C;  2CU7 A;  2GLO A;  5FKM A;  5EYR A;  1Z0X A;  3BR3 A;  1U9O A;  2X9D A;  1RR7 A;  5FJ8 J;  2FX0 A;  1P7J A;  3FKI J;  3JRI A;  1ZR2 A;  1SFO J;  3TED A;  3E7L A;  3JRH A;  2NVY J;  3LNQ A;  1GUU A;  1JJ6 C;  2R0Q C;  2JA6 J;  1HOM A;  1F36 A;  1P7I A;  3G1L A;  2G0E A;  1MBK A;  2ID3 A;  2K9N A;  1QVU A;  1CQT A;  2EZK A;  3ZQH A;  5F0H A;  1Z77 A;  1ENH A;  3BR6 A;  1QPI A;  1AHD P;  4B1R A;  3QPL A;  2JN6 A;  1JUM A;  2JA5 J;  1Q1V A;  2MG4 A;  1LFB A;  2XGC A;  2DA5 A;  2EZH A;  1OJL A;  5IYD J;  1B72 B;  3QQA A;  2E2I J;  1GV5 A;  1Y1V J;  4D5F A;  2ELK A;  2VI6 A;  1IUF A;  3S14 J;  2I10 A;  1GV2 A;  3K2A A;  3WHB A;  3ZQG A;  1IG7 A;  1FIA A;  5E3N A;  1RPW A;  1VND A;  5EG0 A;  1H8A C;  1JUS A;  5GP9 A;  1HCR A;  3Q0U A;  1LE8 A;  1UG2 A;  2E2J J;  3ZQC A;  1TWG J;  2O9L A;  2XRL A;  1ETY A;  2L7M P;  1H88 C;  2IAI A;  5K7H A;  3NAU A;  3ZQL A;  5JLW A;  5IP6 A;  2XPW A;  4DW6 A;  1JKP C;  4A3C J;  1K61 A;  2EZI A;  3CMY A;  3SFI A;  3BTC A;  3GTQ J;  1AU7 A;  2MSY A;  2HQ5 A;  4C2M J;  1A6I A;  2D5V A;  2XB5 A;  4RBO A;  1B8I A;  4MFE A;  1UMQ A;  5F08 A;  1MBJ A;  2WB1 N;  2ZB9 A;  3BR5 A;  4GFB A;  2YU9 J;  3MVP A;  2O8K A;  3S1N J;  1JKQ C;  4C3I J;  5K7Z A;  2E2H J;  1TWA J;  1MBE A;  3BTJ A;  1WPK A;  3JRA A;  2L7Z A;  3GTM J;  5F27 A;  3CQZ J;  4M3E A;  3MN2 A;  2R93 J;  2KDZ A;  2HDD A;  3S17 J;  2R5Z A;  1JTY A;  2IBD A;  2DA6 A;  2AHQ A;  2JMW A;  3K7A J;  1RET A;  2L7F P;  4DYQ A;  4X6A J;  1I50 J;  1I3Q J;  2WAQ N;  5BNG A;  1YRN B;  2YUS A;  1WH5 A;  2CUF A;  2R5Y B;  3FIW A;  3A01 B;  3BR1 A;  3SDG A;  3G1M A;  1B8I B;  1RKW A;  2P81 A;  1NK2 P;  1GT0 C;  1MSE C;  4IHY A;  1TWH J;  4V2F A;  2Y2Z A;  2ME0 A;  4XID A;  3I4N J;  3HB9 A;  1TC3 C;  1WH7 A;  2ECB A;  3RZO J;  3H3V K;  1O4X A;  1F43 A;  3Q3S A;  1ETV A;  2EQR A;  2NOG A;  4XRS A;  4J19 A;  4BY1 J;  2WV1 A;  3VPR A;  2HXI A;  1QRY A;  3IH4 A;  2MW8 A;  3JRE A;  3H0G J;  3FK7 A;  5FKO A;  5IP9 J;  1IGN A;  1ETQ A;  3L1P A;  3RZD J;  1ETW A;  2LVS A;  3OIO A;  1IJW C;  1A5J A;  4XIC A;  1W0U A;  1BW5 A;  3UKG A;  1LFU P;  1OCP A;  3O8H A;  3FK6 A;  1OCT C;  2DMT A;  1VI0 A;  3LSG A;  5J1R A;  4D7M A;  1RES A;  1DU6 A;  2LR8 A;  2KT0 A;  5GPA A;  5M5X J;  1Y1W J;  4CYC B;  2TCT A;  2XGE A;  2FD5 A;  1FEX A;  4JP0 A;  4Y7N J;  2EZL A;  2Y31 A;  1VF9 A;  3C2B A;  4QSH A;  5C44 J;  3S1Q J;  3JRB A;  4W1U A;  3B6A A;  1MBG A;  5E3M A;  5IYC J;  1D5Y A;  5IOZ A;  2NVX J;  2JA7 J;  4BBR J;  4A3L J;  3BG3 A;  3HGY A;  2M0C A;  3W6V A;  3SJM A;  5F0F A;  3IV5 A;  3OOU A;  2N8G A;  3BTL A;  4I6Z A;  2RAE A;  5EZH A;  2DTZ A;  4XRM A;  2H8R A;  4UUS A;  5DTD A;  4A3G J;  2HXO A;  1GVD A;  2CJJ A;  1ETO A;  1ZK8 A;  4MIM A;  3M4O J;  2ECC A;  4IHV A;  1ITY A;  3HOU J;  3S2D J;  2HOA A;  2Y0S N;  5M3M J;  2XSD C;  2LD5 A;  1U8B A;  2AO9 A;  2LY9 A;  1IDY A;  4C3H J;  2CUE A;  1NTC A;  1FJL A;  3HKZ N;  4X1E A;  4L5E A;  4M6V A;  2NVT J;  4MFD A;  2EBI A;  1HDP A;  3HOZ J;  5C4X J;  2CRG A;  3LSJ A;  1ETX A;  4A69 C;  1ZGW A;  1MSF C;  2EH3 A;  2K9Q A;  2DMN A;  3BR0 A;  2X48 A;  2JA8 J;  5EG0 B;  2CQQ A;  3S15 J;  1LE8 B;  1MH4 A;  1NK3 P;  2W48 A;  4JX4 A;  2DN0 A;  4XK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...