1ETXA

The crystal structure of e. coli fis mutant q74a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
74
Chain Sequence
VLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRGNATRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 27
structure length 74
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etxA00
1GVDA 3HGYA 2K9NA 4C2MJ 3S15J 2E1OA 3QPLA 1I50J 2JK3A 5GP9A 4C3HJ 4A3KJ 4FTHA 4D7MA 2LR8A 2ELKA 2DA1A 1MBEA 3IV5A 2R93J 3A01B 4M3BA 4QSHA 5FKOA 2DA2A 1G2HA 3G1MA 5IP6A 3SJMA 4LOCA 1FTZA 3BTJA 4QTRA 2M9HA 3IH3A 5M3FJ 2CQQA 3QPSA 1IV6A 3LSPA 2XRLA 2DMPA 1GV2A 2FJ1A 4MIMA 1ETVA 3HOWJ 1ETQA 1T56A 2GLOA 2R0QC 4IHYA 4A3MJ 2L0KA 3HBLA 1ETWA 2Y9YA 5JLXA 3UKGA 2NS8A 2XPWA 5IYCJ 5F0HA 3JRHA 1X2NA 2O7OA 3GTLJ 2K9SA 3ZQGA 1MBGA 4AC0A 2Y2ZA 1BL0A 5IPAA 1MBJA 2LVSA 2XB5A 4M6VA 3GTOJ 2DA6A 1WPKA 2JMWA 2MGQA 2IAIA 3GBGA 3SFIA 4AUXA 4M3EA 5FJ8J 2R5YB 1ZGWA 4DYRA 1TWHJ 2NOGA 5E3NA 3JRIA 2MSYA 2L7MP 4M3DA 2LFBA 1QRYA 2GM4A 2Y0SN 3HOVJ 4V2GA 3CDLA 1APLC 5J3LA 2B63J 3A01A 1HDPA 2FX0A 2LK2A 1U9OA 5F0CA 3BG5A 4A3JJ 3BR5A 2ECCA 2HXIA 2LTPA 4Y52J 4HNVA 1TWCJ 4FISA 1WGXA 1O4XA 1ETXA 2XSDC 1JTXA 2P81A 3K2AA 2HQ5A 2DMTA 3GTJJ 1RPWA 2NS7A 2DMUA 5F1JA 4B1RA 5GPAA 1A5JA 1BW5A 3LSJA 3G1LA 1JGGA 3GTQJ 1H8AC 1FEXA 3DEWA 5IP7J 3HOZJ 1NK3P 4G12A 2LLKA 2M2EA 4I76A 3BG3A 1JKQC 1YRNA 2G0EA 1VF9A 3DCFA 4W1UA 4I6ZA 2MW8A 4J19A 2YU9J 1QVUA 4V2FA 3ZQCA 4D5FA 5M5YJ 4BBSJ 3K7AJ 2DMNA 2EQRA 2JA7J 1AKHB 3JRCA 2R5YA 2DA4A 1IDYA 1X2MA 1SANA 2HXOA 4QIWN 5C4XJ 1Z0XA 3B6AA 1PUFB 3S17J 3OIOA 4UUTA 1D5YA 4MFEA 2NVTJ 4C3IJ 2EH3A 5F08A 1I6HJ 5C3EJ 2R92J 1H89C 3TP3A 1GUUA 1RR7A 3FISA 1TWGJ 1U9NA 2CQXA 1WH7A 2O9LA 1F43A 2ZB9A 1NK2P 2NVXJ 4BY1J 2HDDA 2CJJA 2NVYJ 1ETOA 3LOCA 3FIWA 1BW6A 1VI0A 2JJ7A 1B72A 1BJZA 2E19A 5F04A 1W0UA 2LY9A 2R7ZJ 2DA7A 4RBOA 5F0FA 3JRFA 2E2JJ 1NTCA 1K61A 2MG4A 1VFCA 1IRZA 1K83J 1MH4A 1ITYA 3Q0VA 1DU6A 4L5EA 2NVQJ 2GBYA 1JKOC 3LSRA 1LFUP 4DZJA 4XK4A 5E3OA 1HF0A 1MSFC 1B8IB 2JA5J 1Q1VA 3Q3SA 1R9TJ 1FJLA 1AKHA 1OJLA 3H3VK 1WH5A 3FK6A 2RAEA 4FE4A 1YRNB 1JJ8C 1PUFA 1TC3C 3BR6A 4B3AA 2O8KA 3S2DJ 3F0CA 3PO2J 1LFBA 2VKVA 4MFDA 2XGEA 4A3IJ 4A3BJ 5HODA 5EYRA 5IYBJ 1JT6A 1OCPA 4UUSB 3M4OJ 2E2HJ 4C3JJ 5EG0B 1S7EA 3JRGA 5DS9A 2LD5A 5EZHA 1X58A 3H0GJ 4XRMA 1T33A 4IHXA 2DA5A 2H1KA 3A02A 3JR9A 2X48A 1MSEC 1Y1WJ 4JYKA 1RETA 2XB0X 5C4JJ 2EBIA 2EZLA 3BQYA 5C44J 4BBRJ 5E3MA 1ORKA 1JUSA 5F27A 3CCYA 2DA3A 2EZHA 3NAUA 4M3GA 2YUSA 1AU7A 1AHDP 3W6VA 2DTZA 4DYCA 3GTMJ 2JA6J 5EDNA 3HEFA 3RQIA 3O8HA 3GTKJ 4AYBN 4A3CJ 2M8GX 1MH3A 1B72B 1B8IA 1ZR4A 3S2HJ 3G1OA 4MO7A 4A3EJ 4IHVA 2AHQA 3RZDJ 1IUFA 3ZQLA 4DYQA 1IGNA 2PMZN 1U78A 1BA5A 2DJNA 3FK7A 1RKTA 2VI6A 2X9DA 4IHWA 3I4NJ 3SDGA 3S14J 4S0HB 3JRBA 3HDDA 4BXXJ 3OSGA 2M34A 5K7FA 3JRAA 3PM1A 1A6IA 4UUSA 5J1YA 1CQTA 2JWTA 1HCRA 3BR3A 5K7HA 5EG0A 9ANTA 2FD5A 2Y9ZA 1IDZA 5J1RA 2LKXA 2W48A 4XRSG 4FCYA 2IEKA 1XC5A 3B6CA 3LSGA 3D1NI 4DW6A 5EZGA 3E7LA 3VPRA 4A93J 2EZKA 1GT0C 1SFOJ 1MBFA 2Y31A 5DTDA 4D5CA 1JKPC 1TWFJ 3GTGJ 2HI3A 2XPUA 3HOUJ 1ZQ3P 1QPIA 2L7ZA 3NARA 3IH2A 4JX5A 2WB1N 3GTPJ 3HKZN 2VUMJ 4CYCB 2HOSA 2VPRA 2X6OA 4DZPA 3RZOJ 3MN2A 2QCOA 1ENHA 3Q0UA 2L9RA 4BY7J 1QVTA 4NDLA 3ZQHA 4JX6A 2ME0A 3MKLA 2Y30A 2VKEA 5FKLA 5M3MJ 5IOZA 5BNGA 5FKNA 1UG2A 4Y7NJ 1H88C 2K9QA 2K40A 2KDZA 3TW6A 3HOXJ 1ZR2A 1LE8B 1WCMJ 1OCTC 2OPTA 2I10A 1F36A 5GPCA 1RESA 2TCTA 2ECBA 3S1MJ 3ZQFA 2E2IJ 3M3YJ 1JT0A 4A69C 1OFCX 5E3LA 2QF7A 1HOMA 4JP0A 3HB9A 2JN6A 5EEAA 2ID6A 1JTYA 1I3QJ 3BR0A 1Z77A 3TW7A 3S1RJ 2FQ4A 1ZTRA 1VNDA 4MLOA 1POGA 4JX4A 5M5XJ 2DN0A 4RDUA 5IOYA 3BTIA 5JLWA 5EF6A 5J1UA 3BTLA 2KT0A 1JKRC 5EGOB 3TP0A 3S1QJ 4X6AJ 2LP0A 3I4MJ 4A3DJ 4CYCA 3LNQA 4A3FJ 4XIDA 1MBKA 3CQZJ 5IYDJ 4B4CA 3ZOBA 2DMQA 2WV1A 5K7ZA 1DU0A 3QQAA 1EF4A 2JA8J 2AO9A 4X1EA 4XICA 2N8GA 5FKKA 2ID3A 4M3FA 5FLMJ 1JUPA 1U8BA 1XG1A 4FE7A 2XGDA 3OSFA 3BR2A 2R5ZB 3RKQA 3BT9A 3BQZA 2CUEA 4XRSA 1IG7A 1LE8A 3HOYJ 3BTCA 2D5VA 1ETKA 1JUMA 3C2BA 1UHSA 2OF7A 2HOAA 1E3OC 4IEJA 3JREA 2COBA 2CUFA 5FKMA 4ABZA 1JJ6C 3JRDA 2CU7A 2TRTA 3IH4A 3L1PA 1FIAA 3WHCA 1HLVA 2HOTA 1UMQA 2M0CA 3Q0WA 3MVPA 3FKIJ 1ZK8A 3S1NJ 1RKWA 3O8GA 1Y1VJ 1MBHA 5EGOA 3ZQIA 3BG9A 4GFBA 5FLVA 1TWAJ 1IC8A 3HGGA 2XGCA 1MNMC 2XPVA 1FTTA 1HDDC 2ME6A 4A3LJ 3OOUA 2IBDA 4W97A 2CRGA 1P7JA 1ZKGA 4EEFG 1WI3A 2WAQN 1W0TA 3A03A 2H8RA 2EZIA 2L7FP 2HYJA 4A3GJ 4BKXA 1GV5A 2R5ZA 3BR1A 1ETYA 3WHBA 3TEDA 1IJWC 3PO3J 5M5WJ 1P7IA 1FIPA 3CMYA 4D7NA 1XS9A 1GDTA 3S16J 5IP9J 2YS9A 3HM5A
chains in the Genus database with same CATH superfamily
1GVDA 4C2MJ 3S15J 2CQKA 2JK3A 1E17A 2IPQX 4Y33A 4LLGF 1BIAA 1Y39A 4MNUA 4E7IA 5BPIA 1WJ5A 4I09A 4M3BA 1K4SA 4H4KC 4E7HA 1G2HA 3G1MA 5IP6A 2W7NA 3I4PA 2V6CA 2M3AA 3FKJA 3ZN1A 1X1CA 4CCLA 1YIOA 2HTJA 2CQQA 3QPSA 2XRLA 1Y8QB 5JFRA 2L4MA 4UY8I 3H9QA 2V1UA 2H94A 2K9MA 1ZYRF 1GV2A 1UZCA 2FJ1A 1ETVA 2GIZA 1ETQA 4MTEA 4HG2A 2GLOA 2FBHA 5GAEJ 2WAQA 2L0KA 2P7VB 2ZBKA 2QEXI 3S32A 1IXRC 2NS8A 3L2RA 1I1GA 1LKXA 2IVMA 1S3JA 1YFHA 2K9SA 3ZQGA 3J7YJ 3GTLJ 3H5NA 5FFZA 2X51A 2Y2ZA 1BI0A 2JPCA 1J0RA 2M8EA 1X4OA 1BL0A 2KFDA 1R1UA 2QKLB 5TISC 4BACA 1WPKA 3LSIA 4F3QA 2DK5A 3KEYA 2OZ6A 4XBFA 2FEZA 2HKXA 4Y17A 3F8BA 5JVTA 1H9TA 1A04A 1I39A 2WADA 4M3EA 2R5YB 1TWHJ 2NOGA 3IL2A 2L7MP 1YW8A 4F55A 4O5VA 2GM4A 2KJCA 3R0JA 1QO0D 4V2GA 3CDLA 2B63J 3FMSA 1K78B 1HDPA 2FX0A 1VQOI 2XKPA 2L01A 2W00A 2GOMA 2HDWA 3BR5A 4HSTA 5A2QK 2ZXIA 2ECCA 3Q9VA 4A3JJ 3ECHA 1WVRA 2HXIA 3F8NA 2EINH 4D1QA 1WGXA 2ADUA 5DD8A 1O4XA 2R7VA 1E3PA 2ACJA 1ETXA 4KFCA 1JTXA 4AIKA 1NG7A 4CUGA 4HA8A 3BZ6A 2WAEA 1N25A 1QQIA 4MEXF 2EJRA 2NS7A 1XSDA 1N77A 3PSIA 1BW5A 2F4MB 2G7HA 3G1LA 1JGGA 4P55A 4P96A 3OYDA 1P6RA 3L2WA 4L9JA 3I56I 1NK3P 3HOZJ 2LLKA 4WXHA 3O6BB 3GFJA 3CMMA 3OS0A 4RGXA 1YRNA 5D6FA 3DCFA 4BQQA 4G7OF 3KP6A 2RV8A 2KQRA 2MW8A 3W6KB 5TGTA 4G7HF 4N9HA 3K70D 3EUHA 3K7AJ 2DBBA 2HU9A 2FU4A 5K5OA 4ENNA 1M1EB 1Z3XA 3S3NA 2Y0SA 2JA7J 3K4MA 2STTA 2DLLA 2DA4A 1X2MA 2KIQA 3FHNA 4ZYGA 1VQKI 1SANA 3I59B 1K7AA 4MQVA 2GZWA 2DW4A 4F92B 5H2FC 4E6KG 1OCOH 2K9LA 2X1DA 4BHCA 1S8NA 3WTXC 3I55I 4WF2A 5FB2A 4U88A 4UUTA 2HYGD 4RLQA 3QP5A 3W2VA 3EQLF 2VBXA 4Y4RA 2R92J 1I6XA 2Z33A 1YX3A 5IT9Z 1SAXA 2ETHA 1WH7A 1Q1HA 1ZN2A 1F43A 1XCBA 3ULQB 2NVXJ 1Z1DA 2BY3A 4BY1J 5TJJA 4PGGA 2CJJA 2GXAA 4Q47A 1ZLJA 3DEUA 5HLIA 1T0FA 4BXUA 3GF2A 3VOEA 3WE3A 2Q1ZB 1W0UA 2KZVA 2MD0A 2R7ZJ 4RBOA 3TL4X 5F0FA 2E2JJ 2QBYA 4EQQA 2MG4A 4CCJA 1QHGA 1R5HA 3ZMZA 1MH4A 2Q8KA 1ITYA 1TT5B 4LFUA 3ZPLA 1DU6A 1E0EA 3L2CA 4HNUA 4XK4A 1B8IB 1R9TJ 1FJLA 4KMUX 2RDPA 4LK1F 4EGYA 4IVNA 2RGVA 2B0LA 3EUHC 5D5VB 1F4KA 3FK6A 3I64A 4FE4A 5HDKA 3CCEI 3CUQC 3V8KA 4WWCA 1O3RA 6PAXA 4U0VA 2A5WA 3BJOA 4MFDA 2DCEA 1I5ZA 2OU2A 3P7NA 2QYOA 5EYRA 5IYBJ 2E1MC 1EH7A 2WB1A 4GXOA 4KN4X 4U87A 3M4OJ 1UB9A 5D8LB 2ZSIB 3JRGA 3KYLA 4RAGA 2YR2A 4E7KA 1X3UA 3HOSA 1V4RA 4NC6A 1OKRA 4IHXA 3JR9A 2X48A 4HSRA 1Y1WJ 2V4JC 4RB0A 2HTSA 1RNLA 1KQ9A 2EBIA 3H36A 4BEHB 2WTEA 3E3VA 1R5GA 1T0FC 1ZELA 4M3GA 5HLHA 5ICGA 2DTZA 2FE3A 4DYCA 3GTMJ 3NQOA 2EFQA 3HSEA 3HEFA 3RQIA 4ENJA 3WU2C 4R8HA 2VODA 5LFAA 2WA0A 3CCQI 1MH3A 4I01A 1ZG5A 3S2HJ 3FX3A 3G1OA 4BQOA 1LVKA 2Z2SB 2AHQA 2HZTA 3SDBA 5HVQC 2YU3A 1PUEE 3ZQLA 2K3FA 5ICCA 1MJ9A 2F2EA 2KDOA 2PEXA 3L00A 1K79A 1FYKA 2ELHA 4RB3C 1QZZA 4UB6C 2X9DA 3N97A 5B1BH 3H0DA 3WG7H 3FMQA 3JRBA 3FXRA 3E0JB 2VT2A 2Z5UA 4Y15A 3OIPA 2M7BA 1ON1A 3QOEA 4ZYEA 2NVUB 1T98A 4BYYA 1CQTA 4RAZA 2HWVA 4UXNA 4F52A 3BR3A 2Y9ZA 5J1RA 2KRCA 3GFIA 1MJBA 1XC5A 3B6CA 2VXDA 3D1NI 3M1EA 5EZGA 4NHJA 4A93J 3IRRA 1B9MA 4AIDA 5K5QA 5DTDA 1DGRM 4LD5A 3FDYA 1MMNA 2XPUA 5L3GA 1ZQ3P 2DT6A 1TQPA 2L02A 1BI2A 4II2A 4JX5A 4A0XA 5BS6A 3BCBA 2CO5A 1N75A 1FZPB 1VQ7I 4MHGA 1OYWA 1BR1A 1GXQA 2P4WA 2EILH 4PSXA 2IGOA 2XAGA 4XLPF 5ICFA 2V1DA 4Z2YA 2L9RA 4LIVA 4BY7J 3RJPA 4EM2A 2KZGA 3WTWC 3BJAA 5D4SA 2D2WA 2MBFA 1ZG3A 1LUJB 3E6DA 3W2WA 5FKNA 2XV4S 4BS9A 4Y7NJ 2L2OA 3F8CA 2R7XA 5IT9K 3MZ8A 2CYYA 1BI3A 4RGRA 1VQLI 4O3MA 4DQ2A 1XMXA 1OMIA 1RESA 1BI1A 4B47A 1W36C 2UV1A 3U2RA 2ECBA 2LBFA 2XRNA 1JT0A 4BXFA 4A69C 1S72I 5F6FA 4WXDA 2VQCA 5B1AH 1H9GA 1O57A 4ZZDA 3BR0A 3TW7A 1X19A 2OQGA 3KZZA 3M07A 3WODF 1BOBA 4AU7A 3QPHA 1POGA 3S93A 3BLYA 3PQJA 1XSXA 4JX4A 2DN0A 2XAHA 2HVSA 2DK8A 2NXNB 5J1UA 3BTLA 1ZRDA 3NWSA 3ABMH 1D1CA 1PJRA 3MD2A 5FFXA 4CYCA 3LNQA 2F4OB 4B4CA 3ZOBA 2DMQA 3B02A 4OIRF 2NS0A 3RPUA 1USTA 4HX8A 4PJNA 4LIUA 1W5SA 1XTAA 2AO9A 4N4OB 4PJMA 1YW7A 1F5TA 2ID3A 3MWMA 3ONQA 2MLGA 3HSFA 2XGDA 3F6VA 2R5ZB 3RKQA 2IJLA 3BQZA 4XRSA 1TTYA 3KP5A 2OUMA 5DCFA 4BL0B 2D5VA 1ETKA 2AQEA 1UHSA 2OF7A 1HC8A 3PJRA 3OOPA 4EJOA 2R7QA 1IZ1A 3HRUA 3ZMTA 2DFHA 2KMUA 4HX4A 2GIVA 1EH8A 3CC2I 3CMAI 2HDCA 5LHGA 5FKMA 3IKTA 4A5MA 5DCMB 2CU7A 2K86A 1UAAA 2DT7B 3VODA 5FROA 4GYGA 1FIAA 1XSVA 3CTAA 3K4JA 2WWYA 5GTHC 3K1PA 5FD5A 3PSFA 4A0ZA 1LJ9A 4RB1A 3Q0WA 4KDPA 3FBNB 1ZK8A 2X85A 1RKWA 2KKOA 3O8GA 1R4NB 3BG9A 3N4MA 2MLKA 1X1AA 4XL9A 2BW3B 2MABA 3TDUC 4OWRB 3T5XA 2ZNYA 1J9IA 2M1BA 5GTIC 1IXSB 1P7JA 1HSJA 1ZKGA 1WI3A 1MGTA 1MD0A 4UNOA 2WAQN 2XDVA 1FOWA 1JHFA 2L7FP 1D8JA 4KIBA 1IN8A 3DBRB 1GV5A 4BKXA 3TEDA 4HF0A 3KP2A 5M5WJ 4G9YA 4FX0A 2EPFA 4D7NA 3S16J 2VJJA 1E3HA 2EB7A 3RQ4A 5M5XJ 3F9KA 2GA1A 3LSHA 1DDNA 1Y0UA 2HVRA 3D5LA 5GP9A 1I50J 4C3HJ 2M30A 3CCLI 3K1NA 5LRRA 1MBEA 2H8WA 3IV5A 4V19K 2RVCA 4QSHA 1BIBA 3KP7A 2LF7A 4XOTA 3SJMA 5GAHJ 4ZZLA 2M9HA 3KFWX 3CJQB 4CDGA 4Y13A 1WJFA 3LWFA 4IX7A 3LSPA 3QYFA 3M1CA 2DO7A 1J5YA 1O3SA 1S7AA 4PFPA 3JTHA 3HPHA 1T56A 2E35A 2NOJB 5ED4A 2QSGX 4A3MJ 1ETWA 2ZXHA 5JI6A 4A6DA 3BDDA 3UKGA 4NQWA 2XPWA 3BCAA 5IYCJ 1VQNI 5F0HA 4WCGA 3JRHA 2O7OA 4B48A 3AG1H 3OIQA 1WFXA 2OCEA 2L5QA 2P5KA 2LVSA 3D5SC 4M6VA 3ZP5A 4WK8F 2DA6A 4ITVA 3GTOJ 3DKWA 2MGQA 2IAIA 3GBGA 3GZ6A 3QP6A 1HKTA 2O8XA 2OAZA 2LOOA 2JZYA 3JTGA 2IGNA 2YX4A 2R7RA 2FNPA 3PFIA 2K85A 3ZRGA 5E3NA 4M3DA 2E34A 2FBIA 2LFBA 4PCQA 1J59A 3ZMVA 2Y0SN 2CMPA 3UR3C 2HS5A 4ON0A 1APLC 1RZ4A 3A01A 2CW7A 2LK2A 1U9OA 1YS6A 3KIOA 5F0CA 1R23A 4JQFA 3S8PA 1B59A 3QYBA 2D45A 3ROUA 2W84A 1TW2A 5E1WA 1IO2A 4L5IA 1AWCA 4FISA 2EFWA 5FO5A 4C2TA 2A69F 2P81A 3K2AA 1P4AA 4A6EA 1EA3A 3BROA 4F7ZA 1T6SA 4MGRA 3V42A 4LB6B 4IPAA 3I5UA 4CCOA 4EGZA 2H27A 2DMUA 4B1RA 1A5JA 3RPUD 3MKYB 2V9KA 3QODA 4IKFA 2VONA 5IP7J 5LEJA 1KQ8A 2TDXA 2RQPA 2QWWA 3CO7C 3AG3H 5KNLA 1USSA 4RM3A 4A2UA 2OZUA 1JKQC 5HS8A 2DDAA 1VF9A 2FA5A 2VL8A 1LDJA 5LLQA 1YJNI 1U0JA 1G6NA 2V26A 4D5FA 2HFHA 5M5YJ 4HAMA 2JTVA 3OYKA 3M8EA 4AVZA 2EQRA 1NH3A 3TOBA 1GXPA 4CZCA 3JRCA 4IHSA 2LC2A 1Z7UA 3IAS2 3CCJI 2ISYA 5CJ9A 4CHUA 1EV7A 1FC3A 1FWZA 4QIWN 1OLTA 3B6AA 1PUFB 2UXNA 4WX9A 3S17J 3I0TA 1G3WA 4XSZF 4EM0B 2VBZA 4M6YA 1R1VA 1FNNA 1D5YA 1W1WE 1U6GA 1BC8C 4AIJA 3PNYA 3SZPA 3HJEA 1I6HJ 2KLOA 1H89C 2WY8Q 1GUUA 1RR7A 5AIQA 4U7BA 2F6CA 1TWGJ 1U9NA 2IT0A 2IS1A 3F8MA 4XN0A 4LMYA 4E4HA 2ZB9A 5L3FA 4Q48A 4F93B 1WJCA 1SFXA 4LG0B 4MQ9F 2NVYJ 5J8FA 1DQUA 3KZIC 4UB8C 3FIWA 2IGMA 1VI0A 2JJ7A 2EIKH 1BJZA 1R5ID 2E19A 4C30A 2PMZA 4ZDLA 1WKMA 2FXAA 3KYDB 3OV8A 1R71A 2DA7A 3DV8A 1K61A 2DJIA 2LRDA 3J81Z 1VFCA 4IQJA 3FZVA 1YQAA 1KYWA 4E7JA 1YI2I 3VSLA 2ZFUA 4L5EA 2W4SA 1BM9A 3LA7A 2XUBA 1LFUP 1MSFC 1T38A 3J80Z 1S5LC 1JI8A 2JA5J 1Q1VA 5DEQA 3K4CA 1AKHA 4EJVA 2EFPA 3H3VK 1WWXA 2BHYA 2H1LA 2O61A 2Q2EB 1BR2A 2XF7A 5AONA 2RAEA 1XD7A 2E71A 5ILSA 1JJ8C 1XGSA 4B09A 3P9IA 1P4WA 3BR6A 4B3AA 4LG3A 3S2DJ 2O5RA 1TW3A 2MA3A 5DUIA 2VE9A 2P6SA 1D3YA 1OR7A 1G3SA 4OAZA 4A3BJ 5HODA 1I1SA 1W5TA 4S05A 1BBYA 2DPUA 2MH2A 2AS5F 1ZH5A 4C3JJ 5EG0B 1IRXA 1S7EA 1YYVA 3OYEA 4L9NA 2UZKA 4I0BA 4LB5A 2V1NA 3CDIA 5EZHA 4XRMA 3H0GJ 5CPRB 3QU6A 1RUNA 3VYTB 2NNYA 2BV6A 2H1KA 1MSEC 4JYKA 2HGCA 1GVJA 1RETA 2W25A 3EETA 3DTEA 3KP4A 4KIFA 2DOEA 2Z1DA 4Q4ZF 1OQYA 1FBUA 2Z99A 3WG9A 1XCVA 2DA3A 4DOZA 1AHDP 1X3ZB 4OU0A 3ERED 2OTJI 2BZTA 4PK4A 3VDXA 3O8HA 2M4KA 3T8TA 4HW0A 1BOAA 2L54A 3GTKJ 2OCCH 3KE2A 2PI0A 2LG4A 5HDNA 1LVAA 1ZR4A 4MO7A 1Y0NA 3V7CA 2BHZA 4TV7A 3KZYA 3K1MA 1T08B 4OOIA 1HW5A 4AM3A 1IGNA 3C3WA 2I5UA 5D6EA 3FK7A 4DIQA 1BC7C 3SDGA 4IRGA 4KMFA 3E5UA 3BC8A 3R60A 4P5OA 3TO7A 2P5LC 4ZC3A 3PM1A 1A6IA 1OCCH 4BQAA 3CUQA 4UUSA 2JWTA 1B9NA 2AXTC 1QPMA 1MMAA 2V9PA 3ABLH 1OR7C 2ZMEA 1X4PA 5E17F 1Z3YA 3MFKA 3CCMI 4FCYA 2IEKA 1ZRFA 3DP7A 1R22A 3AL0C 1R36A 1SC7A 4NC8A 1FLIA 2CFOA 3E7LA 3VPRA 3HRSA 2DQRA 2EZKA 4I0AA 1SFOJ 4D5CA 1JKPC 3DKYA 2G9WA 4LJZF 2HI3A 3K4LA 1FMVA 3OL3A 4XONA 4AVPA 2L7ZA 3NARA 3FWEA 1KZHA 3GTPJ 4OIOF 3H3ZA 5CQEA 3HKZN 4XR6A 3R6SA 2VUMJ 2GAUA 3FM3A 4PUSA 5LBQA 3KETA 3VB2A 3C18A 4DZPA 1LB2A 3CP8A 2EFOA 1QVTA 1TQIA 1U5TB 2DQLA 2HPIA 1ZGAA 2RQQA 2EK5A 5M3MJ 3C2GA 5IOZA 1REPC 4RGSA 1UG2A 3I9V2 5EJCA 3QOPA 2W24A 2K9QA 2K40A 2KDZA 1IW7F 3TW6A 2W1OA 1LE8B 2NYXA 1OCTC 2M87A 2I10A 1F36A 5GPCA 3LAPA 2XASA 4C9YA 4RM2A 3OMYA 5E1XA 3TQNA 5LD2C 2TCTA 5J8CA 3ZQFA 1DPRA 4AWXB 3CMEI 4CGZA 5CLSA 2H6CA 4D0PA 4U0YA 3ASNH 1R4MB 2YSRA 3BY6A 2OTLI 3PQKA 4K2EA 5E3LA 2FOWA 2VBWA 2OC6A 4UV9A 5EEAA 3J81K 3M8FA 1I3QJ 2ZMEC 1Z77A 3NEUA 1FX7A 2FQ4A 2JPBA 2DOFA 3G71I 3MAJA 2DT5A 3DPUA 5E8IA 4OMZA 3AG4H 3J80K 2KT0A 4IO9F 5KK1A 4E70A 4OINF 3EUKL 4YFKF 1JKRC 5AIPA 4OMYA 3TP0A 2YX7A 1CF7A 4BNCA 4X6AJ 2L7KA 2LP0A 1ODDA 3GXOA 4A3DJ 5FLXZ 4RAFA 4A3FJ 3H9JA 1MBKA 2KIFA 1MIJA 1V5EA 2MD5A 3FBIB 3VEPA 5K7ZA 4ZYDA 2CV1A 3OYAA 3QQAA 1EF4A 2XVCA 2N8GA 3WGIA 1WJAA 1VQ8I 5KAIC 1MMDA 5L3DA 3R4KA 1JUPA 2PJRA 1XG1A 3ISPA 2VJIA 3BR2A 3BT9A 2A6TA 3S3OA 2CUEA 1IG7A 1XB4A 4KN7X 4Y3OA 2EV6A 2V79A 3HOYJ 2ZKZA 1KQ0A 1ONVA 3U1KA 3U1DA 2IA2A 2GXBA 2BGCA 2RREA 2K4JA 4LLNA 2HKOA 1OYYA 1IRFA 2COBA 4HBLA 4ABZA 1JJ6C 3ZGKA 1SD5A 3JRDA 4YG2F 2TRTA 3QPTA 1ZREA 5KVRA 3GZ5A 1X1PA 1IV8A 4XMYA 4X0GA 4HOBA 2BY1A 4BU2A 3MZHA 1SFUA 2VPLA 4II3A 1Z05A 3F22A 1MDMA 1UMQA 1SMYF 2A3SA 3MVPA 5LGTA 2IS6A 2ZJRF 3DTIA 2A61A 1SD7A 2ZC2A 2R7UA 4G6QA 1KU3A 4EJTA 4O6JA 5EGOA 4GFBA 3DEEA 1TWAJ 2RKHA 2QA4I 1XPXA 1IC8A 2BXYA 3HGGA 4KITB 4XKVA 5D4RA 1MNMC 1JXSA 1HDDC 4A3LJ 2CW0F 2WC2A 5IT3A 4L0YB 2B9SA 3DXJF 3L2UA 3M8JA 4EEFG 4DJAA 2FUG2 3K0LA 2KP6A 5BPDA 1QHHD 2E1CA 1SAUA 1MMSA 1Y8RB 1PP7U 3OYFA 3ZN0A 3BR1A 1ETYA 4R1HA 2E60A 4HPQA 4HZFA 1XS9A 1GDTA 4LK0F 4YIRX 3HXLA 3MZYA 5DYMA 2EIJH 3HGYA 3OYHA 5F64A 2E1OA 2RNJA 1T2KA 4A3KJ 1W7PA 3O2PE 3AG2H 2HVQA 1SVLA 3TOAA 3R61A 2IRFG 2R93J 4HRIA 1FP1D 1W4MA 4DNCA 3A0BC 3OYGA 3CF2A 4PGHA 1FTZA 3BTJA 4QTRA 3TDZC 1NG6A 3IH3A 5M3FJ 3OR1C 4ZTJA 5CVRA 3LSMA 2A07F 3CC7I 3JSPA 4XN3A 1PYVA 2GOXB 3DPLC 4XLHA 2P8TA 3Q5FA 2ZNZA 1G3YA 3H9GA 3OYBA 4MIMA 3HOWJ 1ACIA 1P92A 4L18B 1TNSA 2M45A 3F6OA 2Y9YA 5JLXA 3EYYA 4FASD 1X2NA 3SEZA 5D8KB 4AC0A 4ANJA 1MBGA 5L3EA 4MEYF 2PQ8A 5E8GA 2XB5A 5IPAA 3WE2A 1SFKA 2JMWA 2UUZA 2BEOA 3ABKH 3CCUI 2VOPA 3CLOA 4ESFA 1RC9A 3T8RA 3OYIA 1C0WA 3FM5A 2RN7A 1JHHA 5BQTA 2QSFX 1ZGWA 1TQMA 4P1WA 4DYRA 4IF4A 4GO1A 5HS9A 2MSYA 2WBMA 4RGUA 3JRIA 3CC4I 2HEOA 2Z16A 1ON2A 3BPXA 3RYRA 2F5FA 4BH9A 3HOVJ 1WRJA 1U3EM 1R6RA 2E1MB 4N9IA 1SVOA 4RMNA 5DUKA 3DLAA 4EJWA 1PDNC 4XLAA 1SMTA 3KLNA 3BJ6A 4I98B 2O03A 3LFKA 5FLXK 2ZXWH 2VB6A 5JHUA 3PUFA 1MKMA 4HNVA 3WTZA 3KLOA 2NAZA 3RSNA 3K6GA 2XSDC 4I2OA 2H09A 3E5QA 5DDGA 1MMGA 4CCKA 2DDBA 2GWRA 3GTJJ 2PFBA 1Z67A 4IZZA 4CXFA 5F1RA 3ML6A 3K9TA 3LSJA 5HLTA 3GTQJ 2X6YA 3EDPA 1N78A 1FEXA 1R00A 2WV0A 1Y56A 1BN5A 3DEWA 2ZSHB 4YIFA 3OYMA 2R7SA 2QUFA 4KICA 4G12A 2VC0A 2M2EA 3GW2A 4I76A 2QBYB 5ERIA 1FSEA 2OD5A 4I6ZA 4LITA 3ZQCA 1LPQA 4B8XA 2QVOA 3FXKA 3I71A 4BBSJ 3H1CA 4IXAA 1P9QC 1FSHA 2FF4A 4M73A 2R5YA 2K4BA 1SD6A 2Y69H 3PNTA 2CW8A 2HXOA 5C4XJ 1EJ9A 1Z0XA 1YIJI 1UJ8A 3LL7A 3REOA 3LQRA 4IRIA 1W36D 1UG0A 2HR3A 2XIGA 1K78A 4PFOA 5JR3A 3FF5A 3HOTA 4IOCF 2ZJQF 4MFEA 1DP3A 3FXJA 2X1CA 2XHKA 1O3QA 1X3WB 3DWLE 1K4TA 2EH3A 5F08A 1MNDA 3F23A 3GLLA 5C3EJ 5GAGJ 4BQNA 4E7SA 1HSTA 1UCRA 2HQRA 2HZDA 2LDUA 1VQPI 2CQXA 3HRTA 3FHZA 2O9LA 2P0WA 4BDZA 1NK2P 4XLCA 3K69A 1W5CC 2G7UA 2JRTA 2P6TA 1KU7A 2HDDA 3DBLB 1I3AA 1ETOA 3S2WA 1KYZA 1BW6A 4I7HA 3FMRA 2EV0A 3L09A 2LKSA 3G73A 3N05A 1TNTA 3P9CA 2FQ3A 4B44A 4NUBA 3OWTA 2LY9A 3IWZA 3HTUA 4ZH4F 3TO9A 3OL4A 4GYIA 4IL6C 4FT8A 1IRZA 1K83J 5J4VA 2A6HF 4M9ZA 1K6OA 2QKMB 2GBYA 5FRMA 3KPHA 1JKOC 3HTSB 1WZ2A 2R7TA 1HF0A 4BE1A 1XDSA 2P7CB 3NWTA 2NRAC 3IHUA 1F9NA 3P9KA 2X1EA 2DTRA 1WH5A 1Y6IA 3I59A 4E7ZA 2EFNA 5J47A 3OYNA 2O8KA 3DTKA 1VQ4I 3BZCA 1QA6A 3F0CA 2ZFWA 5CVIA 3PO2J 4LLLA 2PBIA 3QRFF 1G3TA 2VKVA 4I02A 4BDYA 4A3IJ 3IRQA 1ULYA 1WHUA 1O3TA 1YTYA 4U0WA 4XKCA 3H3UA 3E6BA 2K3PA 2CV2A 3K2ZA 3AFHA 3BG6A 2BYVE 2MC4A 3W6JB 1VQ5I 2LNBA 3S3MA 2QQAA 5DS9A 3V7SA 2LD5A 4XSXF 4XOPA 4BAYA 2BY2A 4A0YA 2F4IA 3OR2C 2PLYA 2FRHA 3H5RA 1YG2A 2OA4A 3A02A 2B7EA 3I3LA 3M9AA 2XB0X 5C4JJ 3E6MA 4NB5A 3BQYA 3WU0A 4CO8A 2DFIA 2IS4A 3NAUA 2EZHA 2XAUA 3ZCOA 3HUGB 2QM3A 3UNGC 1HA8A 2XGXA 3LMMA 4PZJA 1B72B 1B8IA 5FGMA 4XKWA 4A3EJ 4XNFA 4DBRA 1ZGJA 4KJZA 3L2QA 3I53A 1LEAA 3SZGA 4BJ6C 4UV8A 4CH7A 1KA8A 2E36A 1RKTA 2VI6A 3NRVA 4HYEA 4IHWA 3B73A 3ZR8X 3J7AY 3S14J 3I4NJ 4M71A 4KIGA 2LY1A 4B43A 3DFGA 1FBQA 3HSRA 3OSGA 2M34A 5K7FA 2QLZA 3JRAA 3CF5F 4G6TB 2JQ7A 3SEQA 3SYTA 2LBFB 5J1YA 1YO5C 5JHFA 2CGPA 3FXLA 4EJUA 5K7HA 9ANTA 1IDZA 1UFMA 1B1BA 2W48A 4XRSG 3KEQA 2H6BA 2HYFA 1V5FA 2FOKA 4YIIA 1UELB 1UHMA 3LA3A 4E7LA 1T39A 4ESJA 4ZYAA 2DI3A 2Y31A 2LKPA 1TWFJ 4GCVA 4ETSA 3OS2A 2RC4A 4HF1A 4OIPF 3RIRA 2IS2A 1WJEA 4P9UA 4ESBA 3QWLA 3V8LA 4BEHA 3IH2A 2QGUA 2AQFA 2WB1N 3W3CA 4XLFA 4AYBA 3VYSB 3IWFA 3CCSI 4CYCB 3RKXA 3GEZA 4WXCA 4FX4A 1FOXA 2F5DA 1B4AA 2DU9A 2X4HA 1WJDA 2XC7A 2KRFA 3H35A 2VLAA 1A36A 3W2AA 4NDLA 3ZQHA 4PJ0C 3K70C 1J75A 2ME0A 5CVUA 4F91B 2VKDA 3MKLA 2Y30A 1RI7A 2VKEA 5BNGA 1H88C 5L3CA 1WCMJ 2F5EA 2FBKA 3K10A 2HNHA 4IOAF 1FT9A 3V4GA 3O3KA 2VQLA 3OYLA 3ZMSA 4HF2A 2V1XA 2O0YA 4L9TA 2JSCA 5IY5H 4CA0A 1LDDA 1P4XA 4RA2A 3PIPF 2BOLA 3CDHA 3E1SA 2CUJA 2ELJA 1LDKB 3PFYA 2K02A 2QF7A 2FNAA 1R58A 2DODA 2ID6A 1JTYA 4FQGA 3S1RJ 4H0EA 3HIFA 1Z6RA 2LREA 3TMOA 2DXIA 2OQRA 2DFEA 4MLOA 2Q0OA 3J7ZI 4IQ4A 3BTIA 2CUZA 3WTUC 4QWQA 4BE0A 3PUBA 1R1TA 2CSOA 2VIXA 2PG4A 4Z6YA 2AXLA 1FY7A 3MQ0A 3RKYA 3T1BA 3ZXSA 4NNJA 4EV0A 4EM1A 3CQZJ 4XIDA 5IYDJ 2JVGA 3Q9SA 4HDVA 3PL8A 2JA8J 4M3FA 3RDIA 5FLMJ 5LRSA 1TLHB 4PSWA 1U8BA 2VT3A 3CESA 3OSFA 2Y48A 2K7LA 2OV7A 3GLXA 5ILUA 2R3SA 3DLLF 3WU1B 3JW4A 1SEUA 1JUMA 1VTNC 4YRVA 2F48A 3U21A 3IP4B 3ABUA 2HOAA 4S04A 1E3OC 4BGDA 4M72A 5KAFC 2M4GA 1YW9A 3EUAA 1FMWA 2CUFA 4FETA 2UWMA 3L1PA 2HPMA 3AAFA 4RB2C 3IUOA 3E6CC 2HOTA 2M0CA 3FKIJ 3S1NJ 1Y1VJ 1TT0A 3CZ6A 4YFXF 3OY9A 2LF8A 2XGCA 1FTTA 2KJBA 3BG7A 1OCZH 1U2WA 2ME6A 1D1BA 1XMKA 1V5GA 3FXQA 4G6DA 5E20A 2CG4A 4NQWB 1Z9CA 1HKSA 3RKWA 1QU3A 3EPZA 2I8DA 3A03A 1RR8C 2HYJA 2VE8A 5J6XA 1OISA 1DP7P 1FPQA 4CCMA 4A3GJ 2LYCA 2Y0MA 3LSKA 2R5ZA 3WHBA 1QZYA 5ICEA 1IJWC 3GVAA 1P7IA 3CMYA 2A05A 1FBSA 1L0OC 3WGHA 1IUYA 2QZ8A 2K9NA 5E1ZB 4C2UA 5LHIA 2E5ZA 3KYCB 3QPLA 1O7FA 4FTHA 4D7MA 5K5RA 3G6EI 2LR8A 5FRNA 2ELKA 2DA1A 2VASA 1PP8F 5HNHA 2M5WA 3V8JA 3WGGA 3X2QH 4CZZA 1HQCA 4JOMA 3A01B 4XLNF 5FKOA 5DCMA 2DA2A 1MW7A 1YS7A 2E7XA 2JA2A 2JVHA 2VKHA 4QLCU 5DD4A 4HV5A 4LOCA 4UUVA 5FD6A 4ENKA 2XAFA 1ZARA 1RIOH 1S9HA 2LMDA 1IV6A 2ZO4A 3CP2A 2YPRA 2IA1A 2VQHA 4GGGA 2DMPA 2R7FA 1VQMI 4EATA 3OYJA 2R0QC 2ISZA 2BW3A 4IHYA 4KA4A 4DBQA 3SZTA 3HBLA 1HXDA 3H92A 3RI4A 4M9XA 3OYCA 3G2BA 4M74A 2KHMA 3JAMZ 3TBIA 5KCMA 1MBJA 1SFEA 1MNEA 3K4KA 4M6XA 2XAQA 3SFIA 2BY0A 4BJTA 1DGWY 4AD9A 4AUXA 5FJ8J 1S6LA 1SVMA 3LA2A 2ESNA 2Z3YA 3FXUA 5HS7A 1FOKA 1QRYA 4HQEA 2XF5A 3JSOA 1EH6A 1HKQA 1MJAA 2KIMA 4HQMA 5J3LA 1A31A 2R7DA 1KU9A 3RCOA 3ASOH 3BG5A 4LGWA 2FSWA 2L3DA 3HHHA 1WQ2A 2M0MA 3BPVA 5GADJ 1IF1A 2LTPA 3HZJA 2O6GE 4Y52J 1TWCJ 1J7KA 2VQGA 1L3LA 1J2XA 3DU6A 2QENA 2QQBA 2HQ5A 4XLEA 2JT1A 3I58A 2DMTA 2UXXA 1Z21A 5J4YA 1QGPA 1RPWA 1V54H 2D1VA 3HC7A 5CYVA 4BJ5C 5F1JA 3IC7A 5GPAA 2GA2A 4L9VA 2ZJ2A 4L0ZB 1H8AC 2XSJC 3BWGA 3L7WA 3HG9A 5H6QA 2EWNA 3GFMA 3BG3A 2CFXA 3CO6C 2G0EA 3WTTC 5CQGA 3LQQA 4W1UA 3I54A 4J19A 2YU9J 1KONA 1QVUA 4V2FA 4B3XA 3WTSC 2VOOA 1O7LA 4ZYHA 4G7ZF 4XKBA 3TGNA 2DMNA 5DV5A 5E18F 1IN5A 1AKHB 1HW2A 2R4GA 1IDYA 2JSPA 3SXYA 2O3FA 3HPGA 4D9JA 2IW5A 3F72A 1CGPA 3CJTB 3CLQA 4L5JA 2JUCA 2QQ9A 2M7AA 2NNNA 3JCUC 1YJ9I 2EA4A 3F3XA 1ZAOA 2GQQA 3OIOA 4OIQF 2NVTJ 2XKOA 2MC3A 4C3IJ 5LGNA 1S7OA 4MTDA 2KPMA 1YX5A 2R7OA 1STZA 3VFZA 4HLYA 3TP3A 4UVBA 3SFZA 3AL0B 3H5AA 1YHQI 3FISA 5DM6F 2XAJA 1HW1A 4PJJA 3ZMUA 4M9SA 3HUGA 2A6EF 4P9FA 1D1AA 5ILVA 1JGSA 3OS1A 3LOCA 3DPTA 1EKEA 4KUMA 2CH0A 4FHTA 1B72A 1WJBA 3DQVC 5F04A 2L9VA 2VJ4A 4KT6A 1F1ZA 3G3ZA 4CICA 3JRFA 4J01A 1NTCA 3MKWB 4XQFA 1XX5A 5LEKA 2CV0A 3D0SA 5EEGA 3Q0VA 3FXMA 2NVQJ 2PN6A 1IN7A 1XDUA 2HOEA 3LSRA 4DZJA 3CCRI 3ESWB 5E3OA 3Q3SA 4QPQA 2COMA 2X6WA 1R49A 1OJLA 3CJRB 1LEBA 4A5NA 3KCCA 3ERMA 3E5XA 4XORA 1YRNB 5J40A 2OJED 1PUFA 2CWEA 1TC3C 5KHDA 1RRJA 2W85A 1JE8A 4N0BA 4CSWA 3BZKA 3RPQA 2D1HA 2V6EA 1LFBA 2J5OA 2DPDA 1DPUA 2XGEA 1OYIA 2ZJPF 2QQ8A 5BOXA 2Z9OA 2JUGA 2DYRH 1JT6A 1OCPA 1VZ0A 2VN2A 1G8XA 2W57A 3CUQB 4ZDPA 3M7GA 4UUSB 1IAWA 4KYWA 2E5NA 3HKZA 1TZLA 4IRHA 2E2HJ 2ZMEB 3V7RA 2C6YA 4A12A 1U8RA 1ZG1A 1Z6TA 3JAMK 1LFPA 1FYLA 1X58A 3C2HA 2IP2A 1T33A 4RAYA 3MCZA 4LG0A 2XROA 1IN4A 2DA5A 1NHAA 5B5EC 4ZDOA 2V7FA 4XRFA 3KEOA 2HQAA 2EZLA 5C44J 4BBRJ 5E3MA 2BVLA 1ORKA 1JUSA 5B66C 3GWZA 5F27A 3CCYA 2JRMA 1D0ZA 3D5RC 2YUSA 1AU7A 3A4CA 1FOYA 5CVJA 2MYSA 3W6VA 2A5YB 3VSKA 3RYPA 2JA6J 5EDNA 4BUPA 5D5WB 5D5UB 4HDUA 3MMYB 2L9NA 4AYBN 2M8GX 4A3CJ 1AOYA 5TRDA 3MEXA 1K6YA 3R0AA 1WI9A 1H0MA 1UHWA 1X1DA 3CCVI 3GO5A 4IHVA 1DUXC 3RZDJ 1TBXA 3GFLA 1IUFA 5CKTA 4DYQA 1FYMA 1BJAA 3F8FA 5HDGA 2Q2EA 4G8XA 2PMZN 1U78A 1A35A 1YOVB 1BA5A 2DJNA 3L9FA 3PNVA 2PMHA 3FXOA 3DKXA 4S0HB 3QAHA 3HDDA 2P5VA 4BXXJ 2FMLA 5CVVA 5B3SH 5HOOA 1E2XA 4HEA2 3COAC 1P2FA 2BXZA 4NBQA 1HBXG 3BP8A 5H20A 1HCRA 1V55H 1XMAA 2V9VA 4HV6A 3IKVA 5EG0A 1LNWA 2FD5A 2LKXA 2KISA 2QSHX 2WAFA 1VQ6I 2BVMA 3LSGA 2BE5F 4DW6A 2X0LA 1QZEA 1GT0C 2EIMH 1MBFA 1YITI 1VQ9I 1TL8A 4N4NB 4KT5C 4UVCA 3CJNA 5DM7F 2STWA 3GTGJ 3C7JA 1ZHFA 3HOUJ 1XGNA 4YEJA 1QPIA 3F21A 3DBHB 1D8KA 1X1BA 1CF7B 3EYIA 3WTYC 4ZJZA 3GZNB 2Y75A 2HOSA 2VPRA 2OBPA 4GDFA 4BE2A 5L3BA 2X6OA 1QBJA 3HRMA 3RZOJ 3MN2A 2QCOA 1ENHA 5E79C 3Q0UA 1Z91A 4G94A 1QNTA 2DOAA 4JX6A 2PJRB 1D0XA 4CYDA 3AKZA 5FKLA 3TKYA 2KL4A 3ELKA 2EV5A 3LSTA 3DF8A 3ECOA 3HOXJ 5LGUA 1ZR2A 1IRGA 3T0YA 3ABTA 1XN7A 2E7WA 2EA2A 2F5VA 2OPTA 4KISA 4EVIA 2GXGA 2BBYA 3GX4X 2W82A 4YELA 2VC1A 2HQNA 4NC7A 2DAOA 3S1MJ 4ZTFA 2E2IJ 4KNYA 3M3YJ 4HLXA 1W7PD 1OPCA 4OAYA 5BMZA 4IJAA 4JBAA 1OFCX 1R7JA 3CD6I 1YJWI 2VXZA 3VWBA 4GRIA 1HOMA 4JP0A 3ZQ7A 3HB9A 1T95A 2JN6A 5JVGF 2CQNA 2VJ5A 3GYHX 1ZTRA 2IGKA 3ZQQA 1VNDA 5LHHA 1SD4A 2CS3A 1MDMB 5K1YA 2IA0A 4RDUA 5IOYA 5JLWA 4JK1X 5EF6A 1OCRH 2K27A 1D5VA 1MZBA 3KP3A 2X6XA 1I27A 5EGOB 3S1QJ 2FMYA 4DGWB 5A2QZ 3I4MJ 1KGSA 1IN6A 1D0YA 4HNTA 1ZLKA 3BOQA 1DU0A 3HHGA 2KIUA 2WV1A 1KU2A 3J7AO 2IXSA 4J00A 5D5XB 3LAJA 4X1EA 4QPOA 4XICA 4UHTA 1T8IA 3E97A 4PJLA 5FKKA 2ZXJA 4XM3A 3K4BA 3LFUA 4BHPA 1U5TA 4FE7A 3U9GA 5HNFA 3K4NA 2MFZA 2RNGA 1B6AA 2WY7Q 1LE8A 1PVEA 2CQ7A 2DYSH 3BTCA 4ENMA 1IXCA 1FP2A 2MH9A 3C2BA 3DU5A 5HLGA 3HL2A 3TO6A 2DFFA 3KX2A 4U7DA 4YFNF 1YLFA 4RLFA 3GCMA 4IEJA 3RTRA 4UVAA 3QYEA 2L9SA 1W7PB 3JREA 2E1NA 1A6QA 3L2VA 1RUOA 4EMSA 4I99C 2LY2A 3IH4A 3ZMDA 3A1YA 5EEHA 5H6RA 3A2KA 1GHCA 2KRHA 3WHCA 3IAM2 3G4SI 1HLVA 2PX9A 3GMEA 3VYUB 4R79A 1Z7LA 4PDKA 2K5CA 2XF6A 1LQ1A 4Q5SF 1MBHA 2R7WA 3ZQIA 2VBYA 1G4DA 5FLVA 3P5JA 1ZRCA 2ZCWA 2XPVA 1TP4A 2LH9A 1J09A 1S29A 2PJPA 1XGMA 3MKZA 3OOUA 4AIHA 2IBDA 2PMUA 3C1DA 4ASNA 4IHTA 4W97A 2CRGA 1ERDA 2F5CA 3VYRB 1BR4A 3CUOA 4BHBA 2L4AA 3SQNA 3QU3A 1W0TA 2LSOA 2H8RA 4HX7A 2EZIA 2A68F 3HYIA 3WTVC 3A0HC 1XGOA 1G59A 1WSUA 4CCNA 2ESHA 1AA7A 1GLNA 1V3FA 3PO3J 1U5TC 1FIPA 2ICWG 3SHFA 3PIOF 3GUDA 1YE9A 2J5PA 4RS8A 5IP9J 2YS9A 3HM5A
chains in the Genus database with same CATH topology
1GVDA 3HGYA 2K9NA 4C2MJ 3S15J 2E1OA 3QPLA 1I50J 2JK3A 5GP9A 4C3HJ 4A3KJ 4FTHA 4D7MA 2LR8A 2ELKA 2DA1A 1MBEA 3IV5A 2R93J 3A01B 4M3BA 4QSHA 5FKOA 2DA2A 1G2HA 3G1MA 5IP6A 3SJMA 4LOCA 1FTZA 3BTJA 4QTRA 2M9HA 3IH3A 5M3FJ 2CQQA 3QPSA 1IV6A 3LSPA 2XRLA 2DMPA 1GV2A 2FJ1A 4MIMA 1ETVA 3HOWJ 1ETQA 1T56A 2GLOA 2R0QC 4IHYA 4A3MJ 2L0KA 3HBLA 1ETWA 2Y9YA 5JLXA 3UKGA 2NS8A 2XPWA 5IYCJ 5F0HA 3JRHA 1X2NA 2O7OA 3GTLJ 2K9SA 3ZQGA 1MBGA 4AC0A 2Y2ZA 1BL0A 5IPAA 1MBJA 2LVSA 2XB5A 4M6VA 3GTOJ 2DA6A 1WPKA 2JMWA 2MGQA 2IAIA 3GBGA 3SFIA 4AUXA 4M3EA 5FJ8J 2R5YB 1ZGWA 4DYRA 1TWHJ 2NOGA 5E3NA 3JRIA 2MSYA 2L7MP 4M3DA 2LFBA 1QRYA 2GM4A 2Y0SN 3HOVJ 4V2GA 3CDLA 1APLC 5J3LA 2B63J 3A01A 1HDPA 2FX0A 2LK2A 1U9OA 5F0CA 3BG5A 4A3JJ 3BR5A 2ECCA 2HXIA 2LTPA 4Y52J 4HNVA 1TWCJ 4FISA 1WGXA 1O4XA 1ETXA 2XSDC 1JTXA 2P81A 3K2AA 2HQ5A 2DMTA 3GTJJ 1RPWA 2NS7A 2DMUA 5F1JA 4B1RA 5GPAA 1A5JA 1BW5A 3LSJA 3G1LA 1JGGA 3GTQJ 1H8AC 1FEXA 3DEWA 5IP7J 3HOZJ 1NK3P 4G12A 2LLKA 2M2EA 4I76A 3BG3A 1JKQC 1YRNA 2G0EA 1VF9A 3DCFA 4W1UA 4I6ZA 2MW8A 4J19A 2YU9J 1QVUA 4V2FA 3ZQCA 4D5FA 5M5YJ 4BBSJ 3K7AJ 2DMNA 2EQRA 2JA7J 1AKHB 3JRCA 2R5YA 2DA4A 1IDYA 1X2MA 1SANA 2HXOA 4QIWN 5C4XJ 1Z0XA 3B6AA 1PUFB 3S17J 3OIOA 4UUTA 1D5YA 4MFEA 2NVTJ 4C3IJ 2EH3A 5F08A 1I6HJ 5C3EJ 2R92J 1H89C 3TP3A 1GUUA 1RR7A 3FISA 1TWGJ 1U9NA 2CQXA 1WH7A 2O9LA 1F43A 2ZB9A 1NK2P 2NVXJ 4BY1J 2HDDA 2CJJA 2NVYJ 1ETOA 3LOCA 3FIWA 1BW6A 1VI0A 2JJ7A 1B72A 1BJZA 2E19A 5F04A 1W0UA 2LY9A 2R7ZJ 2DA7A 4RBOA 5F0FA 3JRFA 2E2JJ 1NTCA 1K61A 2MG4A 1VFCA 1IRZA 1K83J 1MH4A 1ITYA 3Q0VA 1DU6A 4L5EA 2NVQJ 2GBYA 1JKOC 3LSRA 1LFUP 4DZJA 4XK4A 5E3OA 1HF0A 1MSFC 1B8IB 2JA5J 1Q1VA 3Q3SA 1R9TJ 1FJLA 1AKHA 1OJLA 3H3VK 1WH5A 3FK6A 2RAEA 4FE4A 1YRNB 1JJ8C 1PUFA 1TC3C 3BR6A 4B3AA 2O8KA 3S2DJ 3F0CA 3PO2J 1LFBA 2VKVA 4MFDA 2XGEA 4A3IJ 4A3BJ 5HODA 5EYRA 5IYBJ 1JT6A 1OCPA 4UUSB 3M4OJ 2E2HJ 4C3JJ 5EG0B 1S7EA 3JRGA 5DS9A 2LD5A 5EZHA 1X58A 3H0GJ 4XRMA 1T33A 4IHXA 2DA5A 2H1KA 3A02A 3JR9A 2X48A 1MSEC 1Y1WJ 4JYKA 1RETA 2XB0X 5C4JJ 2EBIA 2EZLA 3BQYA 5C44J 4BBRJ 5E3MA 1ORKA 1JUSA 5F27A 3CCYA 2DA3A 2EZHA 3NAUA 4M3GA 2YUSA 1AU7A 1AHDP 3W6VA 2DTZA 4DYCA 3GTMJ 2JA6J 5EDNA 3HEFA 3RQIA 3O8HA 3GTKJ 4AYBN 4A3CJ 2M8GX 1MH3A 1B72B 1B8IA 1ZR4A 3S2HJ 3G1OA 4MO7A 4A3EJ 4IHVA 2AHQA 3RZDJ 1IUFA 3ZQLA 4DYQA 1IGNA 2PMZN 1U78A 1BA5A 2DJNA 3FK7A 1RKTA 2VI6A 2X9DA 4IHWA 3I4NJ 3SDGA 3S14J 4S0HB 3JRBA 3HDDA 4BXXJ 3OSGA 2M34A 5K7FA 3JRAA 3PM1A 1A6IA 4UUSA 5J1YA 1CQTA 2JWTA 1HCRA 3BR3A 5K7HA 5EG0A 9ANTA 2FD5A 2Y9ZA 1IDZA 5J1RA 2LKXA 2W48A 4XRSG 4FCYA 2IEKA 1XC5A 3B6CA 3LSGA 3D1NI 4DW6A 5EZGA 3E7LA 3VPRA 4A93J 2EZKA 1GT0C 1SFOJ 1MBFA 2Y31A 5DTDA 4D5CA 1JKPC 1TWFJ 3GTGJ 2HI3A 2XPUA 3HOUJ 1ZQ3P 1QPIA 2L7ZA 3NARA 3IH2A 4JX5A 2WB1N 3GTPJ 3HKZN 2VUMJ 4CYCB 2HOSA 2VPRA 2X6OA 4DZPA 3RZOJ 3MN2A 2QCOA 1ENHA 3Q0UA 2L9RA 4BY7J 1QVTA 4NDLA 3ZQHA 4JX6A 2ME0A 3MKLA 2Y30A 2VKEA 5FKLA 5M3MJ 5IOZA 5BNGA 5FKNA 1UG2A 4Y7NJ 1H88C 2K9QA 2K40A 2KDZA 3TW6A 3HOXJ 1ZR2A 1LE8B 1WCMJ 1OCTC 2OPTA 2I10A 1F36A 5GPCA 1RESA 2TCTA 2ECBA 3S1MJ 3ZQFA 2E2IJ 3M3YJ 1JT0A 4A69C 1OFCX 5E3LA 2QF7A 1HOMA 4JP0A 3HB9A 2JN6A 5EEAA 2ID6A 1JTYA 1I3QJ 3BR0A 1Z77A 3TW7A 3S1RJ 2FQ4A 1ZTRA 1VNDA 4MLOA 1POGA 4JX4A 5M5XJ 2DN0A 4RDUA 5IOYA 3BTIA 5JLWA 5EF6A 5J1UA 3BTLA 2KT0A 1JKRC 5EGOB 3TP0A 3S1QJ 4X6AJ 2LP0A 3I4MJ 4A3DJ 4CYCA 3LNQA 4A3FJ 4XIDA 1MBKA 3CQZJ 5IYDJ 4B4CA 3ZOBA 2DMQA 2WV1A 5K7ZA 1DU0A 3QQAA 1EF4A 2JA8J 2AO9A 4X1EA 4XICA 2N8GA 5FKKA 2ID3A 4M3FA 5FLMJ 1JUPA 1U8BA 1XG1A 4FE7A 2XGDA 3OSFA 3BR2A 2R5ZB 3RKQA 3BT9A 3BQZA 2CUEA 4XRSA 1IG7A 1LE8A 3HOYJ 3BTCA 2D5VA 1ETKA 1JUMA 3C2BA 1UHSA 2OF7A 2HOAA 1E3OC 4IEJA 3JREA 2COBA 2CUFA 5FKMA 4ABZA 1JJ6C 3JRDA 2CU7A 2TRTA 3IH4A 3L1PA 1FIAA 3WHCA 1HLVA 2HOTA 1UMQA 2M0CA 3Q0WA 3MVPA 3FKIJ 1ZK8A 3S1NJ 1RKWA 3O8GA 1Y1VJ 1MBHA 5EGOA 3ZQIA 3BG9A 4GFBA 5FLVA 1TWAJ 1IC8A 3HGGA 2XGCA 1MNMC 2XPVA 1FTTA 1HDDC 2ME6A 4A3LJ 3OOUA 2IBDA 4W97A 2CRGA 1P7JA 1ZKGA 4EEFG 1WI3A 2WAQN 1W0TA 3A03A 2H8RA 2EZIA 2L7FP 2HYJA 4A3GJ 4BKXA 1GV5A 2R5ZA 3BR1A 1ETYA 3WHBA 3TEDA 1IJWC 3PO3J 5M5WJ 1P7IA 1FIPA 3CMYA 4D7NA 1XS9A 1GDTA 3S16J 5IP9J 2YS9A 3HM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVD A;  3HGY A;  2K9N A;  4C2M J;  3S15 J;  2E1O A;  3QPL A;  1I50 J;  2JK3 A;  5GP9 A;  4C3H J;  4A3K J;  4FTH A;  4D7M A;  2LR8 A;  2ELK A;  2DA1 A;  1MBE A;  3IV5 A;  2R93 J;  3A01 B;  4M3B A;  4QSH A;  5FKO A;  2DA2 A;  1G2H A;  3G1M A;  5IP6 A;  3SJM A;  4LOC A;  1FTZ A;  3BTJ A;  4QTR A;  2M9H A;  3IH3 A;  5M3F J;  2CQQ A;  3QPS A;  1IV6 A;  3LSP A;  2XRL A;  2DMP A;  1GV2 A;  2FJ1 A;  4MIM A;  1ETV A;  3HOW J;  1ETQ A;  1T56 A;  2GLO A;  2R0Q C;  4IHY A;  4A3M J;  2L0K A;  3HBL A;  1ETW A;  2Y9Y A;  5JLX A;  3UKG A;  2NS8 A;  2XPW A;  5IYC J;  5F0H A;  3JRH A;  1X2N A;  2O7O A;  3GTL J;  2K9S A;  3ZQG A;  1MBG A;  4AC0 A;  2Y2Z A;  1BL0 A;  5IPA A;  1MBJ A;  2LVS A;  2XB5 A;  4M6V A;  3GTO J;  2DA6 A;  1WPK A;  2JMW A;  2MGQ A;  2IAI A;  3GBG A;  3SFI A;  4AUX A;  4M3E A;  5FJ8 J;  2R5Y B;  1ZGW A;  4DYR A;  1TWH J;  2NOG A;  5E3N A;  3JRI A;  2MSY A;  2L7M P;  4M3D A;  2LFB A;  1QRY A;  2GM4 A;  2Y0S N;  3HOV J;  4V2G A;  3CDL A;  1APL C;  5J3L A;  2B63 J;  3A01 A;  1HDP A;  2FX0 A;  2LK2 A;  1U9O A;  5F0C A;  3BG5 A;  4A3J J;  3BR5 A;  2ECC A;  2HXI A;  2LTP A;  4Y52 J;  4HNV A;  1TWC J;  4FIS A;  1WGX A;  1O4X A;  1ETX A;  2XSD C;  1JTX A;  2P81 A;  3K2A A;  2HQ5 A;  2DMT A;  3GTJ J;  1RPW A;  2NS7 A;  2DMU A;  5F1J A;  4B1R A;  5GPA A;  1A5J A;  1BW5 A;  3LSJ A;  3G1L A;  1JGG A;  3GTQ J;  1H8A C;  1FEX A;  3DEW A;  5IP7 J;  3HOZ J;  1NK3 P;  4G12 A;  2LLK A;  2M2E A;  4I76 A;  3BG3 A;  1JKQ C;  1YRN A;  2G0E A;  1VF9 A;  3DCF A;  4W1U A;  4I6Z A;  2MW8 A;  4J19 A;  2YU9 J;  1QVU A;  4V2F A;  3ZQC A;  4D5F A;  5M5Y J;  4BBS J;  3K7A J;  2DMN A;  2EQR A;  2JA7 J;  1AKH B;  3JRC A;  2R5Y A;  2DA4 A;  1IDY A;  1X2M A;  1SAN A;  2HXO A;  4QIW N;  5C4X J;  1Z0X A;  3B6A A;  1PUF B;  3S17 J;  3OIO A;  4UUT A;  1D5Y A;  4MFE A;  2NVT J;  4C3I J;  2EH3 A;  5F08 A;  1I6H J;  5C3E J;  2R92 J;  1H89 C;  3TP3 A;  1GUU A;  1RR7 A;  3FIS A;  1TWG J;  1U9N A;  2CQX A;  1WH7 A;  2O9L A;  1F43 A;  2ZB9 A;  1NK2 P;  2NVX J;  4BY1 J;  2HDD A;  2CJJ A;  2NVY J;  1ETO A;  3LOC A;  3FIW A;  1BW6 A;  1VI0 A;  2JJ7 A;  1B72 A;  1BJZ A;  2E19 A;  5F04 A;  1W0U A;  2LY9 A;  2R7Z J;  2DA7 A;  4RBO A;  5F0F A;  3JRF A;  2E2J J;  1NTC A;  1K61 A;  2MG4 A;  1VFC A;  1IRZ A;  1K83 J;  1MH4 A;  1ITY A;  3Q0V A;  1DU6 A;  4L5E A;  2NVQ J;  2GBY A;  1JKO C;  3LSR A;  1LFU P;  4DZJ A;  4XK4 A;  5E3O A;  1HF0 A;  1MSF C;  1B8I B;  2JA5 J;  1Q1V A;  3Q3S A;  1R9T J;  1FJL A;  1AKH A;  1OJL A;  3H3V K;  1WH5 A;  3FK6 A;  2RAE A;  4FE4 A;  1YRN B;  1JJ8 C;  1PUF A;  1TC3 C;  3BR6 A;  4B3A A;  2O8K A;  3S2D J;  3F0C A;  3PO2 J;  1LFB A;  2VKV A;  4MFD A;  2XGE A;  4A3I J;  4A3B J;  5HOD A;  5EYR A;  5IYB J;  1JT6 A;  1OCP A;  4UUS B;  3M4O J;  2E2H J;  4C3J J;  5EG0 B;  1S7E A;  3JRG A;  5DS9 A;  2LD5 A;  5EZH A;  1X58 A;  3H0G J;  4XRM A;  1T33 A;  4IHX A;  2DA5 A;  2H1K A;  3A02 A;  3JR9 A;  2X48 A;  1MSE C;  1Y1W J;  4JYK A;  1RET A;  2XB0 X;  5C4J J;  2EBI A;  2EZL A;  3BQY A;  5C44 J;  4BBR J;  5E3M A;  1ORK A;  1JUS A;  5F27 A;  3CCY A;  2DA3 A;  2EZH A;  3NAU A;  4M3G A;  2YUS A;  1AU7 A;  1AHD P;  3W6V A;  2DTZ A;  4DYC A;  3GTM J;  2JA6 J;  5EDN A;  3HEF A;  3RQI A;  3O8H A;  3GTK J;  4AYB N;  4A3C J;  2M8G X;  1MH3 A;  1B72 B;  1B8I A;  1ZR4 A;  3S2H J;  3G1O A;  4MO7 A;  4A3E J;  4IHV A;  2AHQ A;  3RZD J;  1IUF A;  3ZQL A;  4DYQ A;  1IGN A;  2PMZ N;  1U78 A;  1BA5 A;  2DJN A;  3FK7 A;  1RKT A;  2VI6 A;  2X9D A;  4IHW A;  3I4N J;  3SDG A;  3S14 J;  4S0H B;  3JRB A;  3HDD A;  4BXX J;  3OSG A;  2M34 A;  5K7F A;  3JRA A;  3PM1 A;  1A6I A;  4UUS A;  5J1Y A;  1CQT A;  2JWT A;  1HCR A;  3BR3 A;  5K7H A;  5EG0 A;  9ANT A;  2FD5 A;  2Y9Z A;  1IDZ A;  5J1R A;  2LKX A;  2W48 A;  4XRS G;  4FCY A;  2IEK A;  1XC5 A;  3B6C A;  3LSG A;  3D1N I;  4DW6 A;  5EZG A;  3E7L A;  3VPR A;  4A93 J;  2EZK A;  1GT0 C;  1SFO J;  1MBF A;  2Y31 A;  5DTD A;  4D5C A;  1JKP C;  1TWF J;  3GTG J;  2HI3 A;  2XPU A;  3HOU J;  1ZQ3 P;  1QPI A;  2L7Z A;  3NAR A;  3IH2 A;  4JX5 A;  2WB1 N;  3GTP J;  3HKZ N;  2VUM J;  4CYC B;  2HOS A;  2VPR A;  2X6O A;  4DZP A;  3RZO J;  3MN2 A;  2QCO A;  1ENH A;  3Q0U A;  2L9R A;  4BY7 J;  1QVT A;  4NDL A;  3ZQH A;  4JX6 A;  2ME0 A;  3MKL A;  2Y30 A;  2VKE A;  5FKL A;  5M3M J;  5IOZ A;  5BNG A;  5FKN A;  1UG2 A;  4Y7N J;  1H88 C;  2K9Q A;  2K40 A;  2KDZ A;  3TW6 A;  3HOX J;  1ZR2 A;  1LE8 B;  1WCM J;  1OCT C;  2OPT A;  2I10 A;  1F36 A;  5GPC A;  1RES A;  2TCT A;  2ECB A;  3S1M J;  3ZQF A;  2E2I J;  3M3Y J;  1JT0 A;  4A69 C;  1OFC X;  5E3L A;  2QF7 A;  1HOM A;  4JP0 A;  3HB9 A;  2JN6 A;  5EEA A;  2ID6 A;  1JTY A;  1I3Q J;  3BR0 A;  1Z77 A;  3TW7 A;  3S1R J;  2FQ4 A;  1ZTR A;  1VND A;  4MLO A;  1POG A;  4JX4 A;  5M5X J;  2DN0 A;  4RDU A;  5IOY A;  3BTI A;  5JLW A;  5EF6 A;  5J1U A;  3BTL A;  2KT0 A;  1JKR C;  5EGO B;  3TP0 A;  3S1Q J;  4X6A J;  2LP0 A;  3I4M J;  4A3D J;  4CYC A;  3LNQ A;  4A3F J;  4XID A;  1MBK A;  3CQZ J;  5IYD J;  4B4C A;  3ZOB A;  2DMQ A;  2WV1 A;  5K7Z A;  1DU0 A;  3QQA A;  1EF4 A;  2JA8 J;  2AO9 A;  4X1E A;  4XIC A;  2N8G A;  5FKK A;  2ID3 A;  4M3F A;  5FLM J;  1JUP A;  1U8B A;  1XG1 A;  4FE7 A;  2XGD A;  3OSF A;  3BR2 A;  2R5Z B;  3RKQ A;  3BT9 A;  3BQZ A;  2CUE A;  4XRS A;  1IG7 A;  1LE8 A;  3HOY J;  3BTC A;  2D5V A;  1ETK A;  1JUM A;  3C2B A;  1UHS A;  2OF7 A;  2HOA A;  1E3O C;  4IEJ A;  3JRE A;  2COB A;  2CUF A;  5FKM A;  4ABZ A;  1JJ6 C;  3JRD A;  2CU7 A;  2TRT A;  3IH4 A;  3L1P A;  1FIA A;  3WHC A;  1HLV A;  2HOT A;  1UMQ A;  2M0C A;  3Q0W A;  3MVP A;  3FKI J;  1ZK8 A;  3S1N J;  1RKW A;  3O8G A;  1Y1V J;  1MBH A;  5EGO A;  3ZQI A;  3BG9 A;  4GFB A;  5FLV A;  1TWA J;  1IC8 A;  3HGG A;  2XGC A;  1MNM C;  2XPV A;  1FTT A;  1HDD C;  2ME6 A;  4A3L J;  3OOU A;  2IBD A;  4W97 A;  2CRG A;  1P7J A;  1ZKG A;  4EEF G;  1WI3 A;  2WAQ N;  1W0T A;  3A03 A;  2H8R A;  2EZI A;  2L7F P;  2HYJ A;  4A3G J;  4BKX A;  1GV5 A;  2R5Z A;  3BR1 A;  1ETY A;  3WHB A;  3TED A;  1IJW C;  3PO3 J;  5M5W J;  1P7I A;  1FIP A;  3CMY A;  4D7N A;  1XS9 A;  1GDT A;  3S16 J;  5IP9 J;  2YS9 A;  3HM5 A; 
#chains in the Genus database with same CATH topology
 1GVD A;  4C2M J;  3S15 J;  2CQK A;  2JK3 A;  1E17 A;  2IPQ X;  4Y33 A;  4LLG F;  1BIA A;  1Y39 A;  4MNU A;  4E7I A;  5BPI A;  1WJ5 A;  4I09 A;  4M3B A;  1K4S A;  4H4K C;  4E7H A;  1G2H A;  3G1M A;  5IP6 A;  2W7N A;  3I4P A;  2V6C A;  2M3A A;  3FKJ A;  3ZN1 A;  1X1C A;  4CCL A;  1YIO A;  2HTJ A;  2CQQ A;  3QPS A;  2XRL A;  1Y8Q B;  5JFR A;  2L4M A;  4UY8 I;  3H9Q A;  2V1U A;  2H94 A;  2K9M A;  1ZYR F;  1GV2 A;  1UZC A;  2FJ1 A;  1ETV A;  2GIZ A;  1ETQ A;  4MTE A;  4HG2 A;  2GLO A;  2FBH A;  5GAE J;  2WAQ A;  2L0K A;  2P7V B;  2ZBK A;  2QEX I;  3S32 A;  1IXR C;  2NS8 A;  3L2R A;  1I1G A;  1LKX A;  2IVM A;  1S3J A;  1YFH A;  2K9S A;  3ZQG A;  3J7Y J;  3GTL J;  3H5N A;  5FFZ A;  2X51 A;  2Y2Z A;  1BI0 A;  2JPC A;  1J0R A;  2M8E A;  1X4O A;  1BL0 A;  2KFD A;  1R1U A;  2QKL B;  5TIS C;  4BAC A;  1WPK A;  3LSI A;  4F3Q A;  2DK5 A;  3KEY A;  2OZ6 A;  4XBF A;  2FEZ A;  2HKX A;  4Y17 A;  3F8B A;  5JVT A;  1H9T A;  1A04 A;  1I39 A;  2WAD A;  4M3E A;  2R5Y B;  1TWH J;  2NOG A;  3IL2 A;  2L7M P;  1YW8 A;  4F55 A;  4O5V A;  2GM4 A;  2KJC A;  3R0J A;  1QO0 D;  4V2G A;  3CDL A;  2B63 J;  3FMS A;  1K78 B;  1HDP A;  2FX0 A;  1VQO I;  2XKP A;  2L01 A;  2W00 A;  2GOM A;  2HDW A;  3BR5 A;  4HST A;  5A2Q K;  2ZXI A;  2ECC A;  3Q9V A;  4A3J J;  3ECH A;  1WVR A;  2HXI A;  3F8N A;  2EIN H;  4D1Q A;  1WGX A;  2ADU A;  5DD8 A;  1O4X A;  2R7V A;  1E3P A;  2ACJ A;  1ETX A;  4KFC A;  1JTX A;  4AIK A;  1NG7 A;  4CUG A;  4HA8 A;  3BZ6 A;  2WAE A;  1N25 A;  1QQI A;  4MEX F;  2EJR A;  2NS7 A;  1XSD A;  1N77 A;  3PSI A;  1BW5 A;  2F4M B;  2G7H A;  3G1L A;  1JGG A;  4P55 A;  4P96 A;  3OYD A;  1P6R A;  3L2W A;  4L9J A;  3I56 I;  1NK3 P;  3HOZ J;  2LLK A;  4WXH A;  3O6B B;  3GFJ A;  3CMM A;  3OS0 A;  4RGX A;  1YRN A;  5D6F A;  3DCF A;  4BQQ A;  4G7O F;  3KP6 A;  2RV8 A;  2KQR A;  2MW8 A;  3W6K B;  5TGT A;  4G7H F;  4N9H A;  3K70 D;  3EUH A;  3K7A J;  2DBB A;  2HU9 A;  2FU4 A;  5K5O A;  4ENN A;  1M1E B;  1Z3X A;  3S3N A;  2Y0S A;  2JA7 J;  3K4M A;  2STT A;  2DLL A;  2DA4 A;  1X2M A;  2KIQ A;  3FHN A;  4ZYG A;  1VQK I;  1SAN A;  3I59 B;  1K7A A;  4MQV A;  2GZW A;  2DW4 A;  4F92 B;  5H2F C;  4E6K G;  1OCO H;  2K9L A;  2X1D A;  4BHC A;  1S8N A;  3WTX C;  3I55 I;  4WF2 A;  5FB2 A;  4U88 A;  4UUT A;  2HYG D;  4RLQ A;  3QP5 A;  3W2V A;  3EQL F;  2VBX A;  4Y4R A;  2R92 J;  1I6X A;  2Z33 A;  1YX3 A;  5IT9 Z;  1SAX A;  2ETH A;  1WH7 A;  1Q1H A;  1ZN2 A;  1F43 A;  1XCB A;  3ULQ B;  2NVX J;  1Z1D A;  2BY3 A;  4BY1 J;  5TJJ A;  4PGG A;  2CJJ A;  2GXA A;  4Q47 A;  1ZLJ A;  3DEU A;  5HLI A;  1T0F A;  4BXU A;  3GF2 A;  3VOE A;  3WE3 A;  2Q1Z B;  1W0U A;  2KZV A;  2MD0 A;  2R7Z J;  4RBO A;  3TL4 X;  5F0F A;  2E2J J;  2QBY A;  4EQQ A;  2MG4 A;  4CCJ A;  1QHG A;  1R5H A;  3ZMZ A;  1MH4 A;  2Q8K A;  1ITY A;  1TT5 B;  4LFU A;  3ZPL A;  1DU6 A;  1E0E A;  3L2C A;  4HNU A;  4XK4 A;  1B8I B;  1R9T J;  1FJL A;  4KMU X;  2RDP A;  4LK1 F;  4EGY A;  4IVN A;  2RGV A;  2B0L A;  3EUH C;  5D5V B;  1F4K A;  3FK6 A;  3I64 A;  4FE4 A;  5HDK A;  3CCE I;  3CUQ C;  3V8K A;  4WWC A;  1O3R A;  6PAX A;  4U0V A;  2A5W A;  3BJO A;  4MFD A;  2DCE A;  1I5Z A;  2OU2 A;  3P7N A;  2QYO A;  5EYR A;  5IYB J;  2E1M C;  1EH7 A;  2WB1 A;  4GXO A;  4KN4 X;  4U87 A;  3M4O J;  1UB9 A;  5D8L B;  2ZSI B;  3JRG A;  3KYL A;  4RAG A;  2YR2 A;  4E7K A;  1X3U A;  3HOS A;  1V4R A;  4NC6 A;  1OKR A;  4IHX A;  3JR9 A;  2X48 A;  4HSR A;  1Y1W J;  2V4J C;  4RB0 A;  2HTS A;  1RNL A;  1KQ9 A;  2EBI A;  3H36 A;  4BEH B;  2WTE A;  3E3V A;  1R5G A;  1T0F C;  1ZEL A;  4M3G A;  5HLH A;  5ICG A;  2DTZ A;  2FE3 A;  4DYC A;  3GTM J;  3NQO A;  2EFQ A;  3HSE A;  3HEF A;  3RQI A;  4ENJ A;  3WU2 C;  4R8H A;  2VOD A;  5LFA A;  2WA0 A;  3CCQ I;  1MH3 A;  4I01 A;  1ZG5 A;  3S2H J;  3FX3 A;  3G1O A;  4BQO A;  1LVK A;  2Z2S B;  2AHQ A;  2HZT A;  3SDB A;  5HVQ C;  2YU3 A;  1PUE E;  3ZQL A;  2K3F A;  5ICC A;  1MJ9 A;  2F2E A;  2KDO A;  2PEX A;  3L00 A;  1K79 A;  1FYK A;  2ELH A;  4RB3 C;  1QZZ A;  4UB6 C;  2X9D A;  3N97 A;  5B1B H;  3H0D A;  3WG7 H;  3FMQ A;  3JRB A;  3FXR A;  3E0J B;  2VT2 A;  2Z5U A;  4Y15 A;  3OIP A;  2M7B A;  1ON1 A;  3QOE A;  4ZYE A;  2NVU B;  1T98 A;  4BYY A;  1CQT A;  4RAZ A;  2HWV A;  4UXN A;  4F52 A;  3BR3 A;  2Y9Z A;  5J1R A;  2KRC A;  3GFI A;  1MJB A;  1XC5 A;  3B6C A;  2VXD A;  3D1N I;  3M1E A;  5EZG A;  4NHJ A;  4A93 J;  3IRR A;  1B9M A;  4AID A;  5K5Q A;  5DTD A;  1DGR M;  4LD5 A;  3FDY A;  1MMN A;  2XPU A;  5L3G A;  1ZQ3 P;  2DT6 A;  1TQP A;  2L02 A;  1BI2 A;  4II2 A;  4JX5 A;  4A0X A;  5BS6 A;  3BCB A;  2CO5 A;  1N75 A;  1FZP B;  1VQ7 I;  4MHG A;  1OYW A;  1BR1 A;  1GXQ A;  2P4W A;  2EIL H;  4PSX A;  2IGO A;  2XAG A;  4XLP F;  5ICF A;  2V1D A;  4Z2Y A;  2L9R A;  4LIV A;  4BY7 J;  3RJP A;  4EM2 A;  2KZG A;  3WTW C;  3BJA A;  5D4S A;  2D2W A;  2MBF A;  1ZG3 A;  1LUJ B;  3E6D A;  3W2W A;  5FKN A;  2XV4 S;  4BS9 A;  4Y7N J;  2L2O A;  3F8C A;  2R7X A;  5IT9 K;  3MZ8 A;  2CYY A;  1BI3 A;  4RGR A;  1VQL I;  4O3M A;  4DQ2 A;  1XMX A;  1OMI A;  1RES A;  1BI1 A;  4B47 A;  1W36 C;  2UV1 A;  3U2R A;  2ECB A;  2LBF A;  2XRN A;  1JT0 A;  4BXF A;  4A69 C;  1S72 I;  5F6F A;  4WXD A;  2VQC A;  5B1A H;  1H9G A;  1O57 A;  4ZZD A;  3BR0 A;  3TW7 A;  1X19 A;  2OQG A;  3KZZ A;  3M07 A;  3WOD F;  1BOB A;  4AU7 A;  3QPH A;  1POG A;  3S93 A;  3BLY A;  3PQJ A;  1XSX A;  4JX4 A;  2DN0 A;  2XAH A;  2HVS A;  2DK8 A;  2NXN B;  5J1U A;  3BTL A;  1ZRD A;  3NWS A;  3ABM H;  1D1C A;  1PJR A;  3MD2 A;  5FFX A;  4CYC A;  3LNQ A;  2F4O B;  4B4C A;  3ZOB A;  2DMQ A;  3B02 A;  4OIR F;  2NS0 A;  3RPU A;  1UST A;  4HX8 A;  4PJN A;  4LIU A;  1W5S A;  1XTA A;  2AO9 A;  4N4O B;  4PJM A;  1YW7 A;  1F5T A;  2ID3 A;  3MWM A;  3ONQ A;  2MLG A;  3HSF A;  2XGD A;  3F6V A;  2R5Z B;  3RKQ A;  2IJL A;  3BQZ A;  4XRS A;  1TTY A;  3KP5 A;  2OUM A;  5DCF A;  4BL0 B;  2D5V A;  1ETK A;  2AQE A;  1UHS A;  2OF7 A;  1HC8 A;  3PJR A;  3OOP A;  4EJO A;  2R7Q A;  1IZ1 A;  3HRU A;  3ZMT A;  2DFH A;  2KMU A;  4HX4 A;  2GIV A;  1EH8 A;  3CC2 I;  3CMA I;  2HDC A;  5LHG A;  5FKM A;  3IKT A;  4A5M A;  5DCM B;  2CU7 A;  2K86 A;  1UAA A;  2DT7 B;  3VOD A;  5FRO A;  4GYG A;  1FIA A;  1XSV A;  3CTA A;  3K4J A;  2WWY A;  5GTH C;  3K1P A;  5FD5 A;  3PSF A;  4A0Z A;  1LJ9 A;  4RB1 A;  3Q0W A;  4KDP A;  3FBN B;  1ZK8 A;  2X85 A;  1RKW A;  2KKO A;  3O8G A;  1R4N B;  3BG9 A;  3N4M A;  2MLK A;  1X1A A;  4XL9 A;  2BW3 B;  2MAB A;  3TDU C;  4OWR B;  3T5X A;  2ZNY A;  1J9I A;  2M1B A;  5GTI C;  1IXS B;  1P7J A;  1HSJ A;  1ZKG A;  1WI3 A;  1MGT A;  1MD0 A;  4UNO A;  2WAQ N;  2XDV A;  1FOW A;  1JHF A;  2L7F P;  1D8J A;  4KIB A;  1IN8 A;  3DBR B;  1GV5 A;  4BKX A;  3TED A;  4HF0 A;  3KP2 A;  5M5W J;  4G9Y A;  4FX0 A;  2EPF A;  4D7N A;  3S16 J;  2VJJ A;  1E3H A;  2EB7 A;  3RQ4 A;  5M5X J;  3F9K A;  2GA1 A;  3LSH A;  1DDN A;  1Y0U A;  2HVR A;  3D5L A;  5GP9 A;  1I50 J;  4C3H J;  2M30 A;  3CCL I;  3K1N A;  5LRR A;  1MBE A;  2H8W A;  3IV5 A;  4V19 K;  2RVC A;  4QSH A;  1BIB A;  3KP7 A;  2LF7 A;  4XOT A;  3SJM A;  5GAH J;  4ZZL A;  2M9H A;  3KFW X;  3CJQ B;  4CDG A;  4Y13 A;  1WJF A;  3LWF A;  4IX7 A;  3LSP A;  3QYF A;  3M1C A;  2DO7 A;  1J5Y A;  1O3S A;  1S7A A;  4PFP A;  3JTH A;  3HPH A;  1T56 A;  2E35 A;  2NOJ B;  5ED4 A;  2QSG X;  4A3M J;  1ETW A;  2ZXH A;  5JI6 A;  4A6D A;  3BDD A;  3UKG A;  4NQW A;  2XPW A;  3BCA A;  5IYC J;  1VQN I;  5F0H A;  4WCG A;  3JRH A;  2O7O A;  4B48 A;  3AG1 H;  3OIQ A;  1WFX A;  2OCE A;  2L5Q A;  2P5K A;  2LVS A;  3D5S C;  4M6V A;  3ZP5 A;  4WK8 F;  2DA6 A;  4ITV A;  3GTO J;  3DKW A;  2MGQ A;  2IAI A;  3GBG A;  3GZ6 A;  3QP6 A;  1HKT A;  2O8X A;  2OAZ A;  2LOO A;  2JZY A;  3JTG A;  2IGN A;  2YX4 A;  2R7R A;  2FNP A;  3PFI A;  2K85 A;  3ZRG A;  5E3N A;  4M3D A;  2E34 A;  2FBI A;  2LFB A;  4PCQ A;  1J59 A;  3ZMV A;  2Y0S N;  2CMP A;  3UR3 C;  2HS5 A;  4ON0 A;  1APL C;  1RZ4 A;  3A01 A;  2CW7 A;  2LK2 A;  1U9O A;  1YS6 A;  3KIO A;  5F0C A;  1R23 A;  4JQF A;  3S8P A;  1B59 A;  3QYB A;  2D45 A;  3ROU A;  2W84 A;  1TW2 A;  5E1W A;  1IO2 A;  4L5I A;  1AWC A;  4FIS A;  2EFW A;  5FO5 A;  4C2T A;  2A69 F;  2P81 A;  3K2A A;  1P4A A;  4A6E A;  1EA3 A;  3BRO A;  4F7Z A;  1T6S A;  4MGR A;  3V42 A;  4LB6 B;  4IPA A;  3I5U A;  4CCO A;  4EGZ A;  2H27 A;  2DMU A;  4B1R A;  1A5J A;  3RPU D;  3MKY B;  2V9K A;  3QOD A;  4IKF A;  2VON A;  5IP7 J;  5LEJ A;  1KQ8 A;  2TDX A;  2RQP A;  2QWW A;  3CO7 C;  3AG3 H;  5KNL A;  1USS A;  4RM3 A;  4A2U A;  2OZU A;  1JKQ C;  5HS8 A;  2DDA A;  1VF9 A;  2FA5 A;  2VL8 A;  1LDJ A;  5LLQ A;  1YJN I;  1U0J A;  1G6N A;  2V26 A;  4D5F A;  2HFH A;  5M5Y J;  4HAM A;  2JTV A;  3OYK A;  3M8E A;  4AVZ A;  2EQR A;  1NH3 A;  3TOB A;  1GXP A;  4CZC A;  3JRC A;  4IHS A;  2LC2 A;  1Z7U A;  3IAS 2;  3CCJ I;  2ISY A;  5CJ9 A;  4CHU A;  1EV7 A;  1FC3 A;  1FWZ A;  4QIW N;  1OLT A;  3B6A A;  1PUF B;  2UXN A;  4WX9 A;  3S17 J;  3I0T A;  1G3W A;  4XSZ F;  4EM0 B;  2VBZ A;  4M6Y A;  1R1V A;  1FNN A;  1D5Y A;  1W1W E;  1U6G A;  1BC8 C;  4AIJ A;  3PNY A;  3SZP A;  3HJE A;  1I6H J;  2KLO A;  1H89 C;  2WY8 Q;  1GUU A;  1RR7 A;  5AIQ A;  4U7B A;  2F6C A;  1TWG J;  1U9N A;  2IT0 A;  2IS1 A;  3F8M A;  4XN0 A;  4LMY A;  4E4H A;  2ZB9 A;  5L3F A;  4Q48 A;  4F93 B;  1WJC A;  1SFX A;  4LG0 B;  4MQ9 F;  2NVY J;  5J8F A;  1DQU A;  3KZI C;  4UB8 C;  3FIW A;  2IGM A;  1VI0 A;  2JJ7 A;  2EIK H;  1BJZ A;  1R5I D;  2E19 A;  4C30 A;  2PMZ A;  4ZDL A;  1WKM A;  2FXA A;  3KYD B;  3OV8 A;  1R71 A;  2DA7 A;  3DV8 A;  1K61 A;  2DJI A;  2LRD A;  3J81 Z;  1VFC A;  4IQJ A;  3FZV A;  1YQA A;  1KYW A;  4E7J A;  1YI2 I;  3VSL A;  2ZFU A;  4L5E A;  2W4S A;  1BM9 A;  3LA7 A;  2XUB A;  1LFU P;  1MSF C;  1T38 A;  3J80 Z;  1S5L C;  1JI8 A;  2JA5 J;  1Q1V A;  5DEQ A;  3K4C A;  1AKH A;  4EJV A;  2EFP A;  3H3V K;  1WWX A;  2BHY A;  2H1L A;  2O61 A;  2Q2E B;  1BR2 A;  2XF7 A;  5AON A;  2RAE A;  1XD7 A;  2E71 A;  5ILS A;  1JJ8 C;  1XGS A;  4B09 A;  3P9I A;  1P4W A;  3BR6 A;  4B3A A;  4LG3 A;  3S2D J;  2O5R A;  1TW3 A;  2MA3 A;  5DUI A;  2VE9 A;  2P6S A;  1D3Y A;  1OR7 A;  1G3S A;  4OAZ A;  4A3B J;  5HOD A;  1I1S A;  1W5T A;  4S05 A;  1BBY A;  2DPU A;  2MH2 A;  2AS5 F;  1ZH5 A;  4C3J J;  5EG0 B;  1IRX A;  1S7E A;  1YYV A;  3OYE A;  4L9N A;  2UZK A;  4I0B A;  4LB5 A;  2V1N A;  3CDI A;  5EZH A;  4XRM A;  3H0G J;  5CPR B;  3QU6 A;  1RUN A;  3VYT B;  2NNY A;  2BV6 A;  2H1K A;  1MSE C;  4JYK A;  2HGC A;  1GVJ A;  1RET A;  2W25 A;  3EET A;  3DTE A;  3KP4 A;  4KIF A;  2DOE A;  2Z1D A;  4Q4Z F;  1OQY A;  1FBU A;  2Z99 A;  3WG9 A;  1XCV A;  2DA3 A;  4DOZ A;  1AHD P;  1X3Z B;  4OU0 A;  3ERE D;  2OTJ I;  2BZT A;  4PK4 A;  3VDX A;  3O8H A;  2M4K A;  3T8T A;  4HW0 A;  1BOA A;  2L54 A;  3GTK J;  2OCC H;  3KE2 A;  2PI0 A;  2LG4 A;  5HDN A;  1LVA A;  1ZR4 A;  4MO7 A;  1Y0N A;  3V7C A;  2BHZ A;  4TV7 A;  3KZY A;  3K1M A;  1T08 B;  4OOI A;  1HW5 A;  4AM3 A;  1IGN A;  3C3W A;  2I5U A;  5D6E A;  3FK7 A;  4DIQ A;  1BC7 C;  3SDG A;  4IRG A;  4KMF A;  3E5U A;  3BC8 A;  3R60 A;  4P5O A;  3TO7 A;  2P5L C;  4ZC3 A;  3PM1 A;  1A6I A;  1OCC H;  4BQA A;  3CUQ A;  4UUS A;  2JWT A;  1B9N A;  2AXT C;  1QPM A;  1MMA A;  2V9P A;  3ABL H;  1OR7 C;  2ZME A;  1X4P A;  5E17 F;  1Z3Y A;  3MFK A;  3CCM I;  4FCY A;  2IEK A;  1ZRF A;  3DP7 A;  1R22 A;  3AL0 C;  1R36 A;  1SC7 A;  4NC8 A;  1FLI A;  2CFO A;  3E7L A;  3VPR A;  3HRS A;  2DQR A;  2EZK A;  4I0A A;  1SFO J;  4D5C A;  1JKP C;  3DKY A;  2G9W A;  4LJZ F;  2HI3 A;  3K4L A;  1FMV A;  3OL3 A;  4XON A;  4AVP A;  2L7Z A;  3NAR A;  3FWE A;  1KZH A;  3GTP J;  4OIO F;  3H3Z A;  5CQE A;  3HKZ N;  4XR6 A;  3R6S A;  2VUM J;  2GAU A;  3FM3 A;  4PUS A;  5LBQ A;  3KET A;  3VB2 A;  3C18 A;  4DZP A;  1LB2 A;  3CP8 A;  2EFO A;  1QVT A;  1TQI A;  1U5T B;  2DQL A;  2HPI A;  1ZGA A;  2RQQ A;  2EK5 A;  5M3M J;  3C2G A;  5IOZ A;  1REP C;  4RGS A;  1UG2 A;  3I9V 2;  5EJC A;  3QOP A;  2W24 A;  2K9Q A;  2K40 A;  2KDZ A;  1IW7 F;  3TW6 A;  2W1O A;  1LE8 B;  2NYX A;  1OCT C;  2M87 A;  2I10 A;  1F36 A;  5GPC A;  3LAP A;  2XAS A;  4C9Y A;  4RM2 A;  3OMY A;  5E1X A;  3TQN A;  5LD2 C;  2TCT A;  5J8C A;  3ZQF A;  1DPR A;  4AWX B;  3CME I;  4CGZ A;  5CLS A;  2H6C A;  4D0P A;  4U0Y A;  3ASN H;  1R4M B;  2YSR A;  3BY6 A;  2OTL I;  3PQK A;  4K2E A;  5E3L A;  2FOW A;  2VBW A;  2OC6 A;  4UV9 A;  5EEA A;  3J81 K;  3M8F A;  1I3Q J;  2ZME C;  1Z77 A;  3NEU A;  1FX7 A;  2FQ4 A;  2JPB A;  2DOF A;  3G71 I;  3MAJ A;  2DT5 A;  3DPU A;  5E8I A;  4OMZ A;  3AG4 H;  3J80 K;  2KT0 A;  4IO9 F;  5KK1 A;  4E70 A;  4OIN F;  3EUK L;  4YFK F;  1JKR C;  5AIP A;  4OMY A;  3TP0 A;  2YX7 A;  1CF7 A;  4BNC A;  4X6A J;  2L7K A;  2LP0 A;  1ODD A;  3GXO A;  4A3D J;  5FLX Z;  4RAF A;  4A3F J;  3H9J A;  1MBK A;  2KIF A;  1MIJ A;  1V5E A;  2MD5 A;  3FBI B;  3VEP A;  5K7Z A;  4ZYD A;  2CV1 A;  3OYA A;  3QQA A;  1EF4 A;  2XVC A;  2N8G A;  3WGI A;  1WJA A;  1VQ8 I;  5KAI C;  1MMD A;  5L3D A;  3R4K A;  1JUP A;  2PJR A;  1XG1 A;  3ISP A;  2VJI A;  3BR2 A;  3BT9 A;  2A6T A;  3S3O A;  2CUE A;  1IG7 A;  1XB4 A;  4KN7 X;  4Y3O A;  2EV6 A;  2V79 A;  3HOY J;  2ZKZ A;  1KQ0 A;  1ONV A;  3U1K A;  3U1D A;  2IA2 A;  2GXB A;  2BGC A;  2RRE A;  2K4J A;  4LLN A;  2HKO A;  1OYY A;  1IRF A;  2COB A;  4HBL A;  4ABZ A;  1JJ6 C;  3ZGK A;  1SD5 A;  3JRD A;  4YG2 F;  2TRT A;  3QPT A;  1ZRE A;  5KVR A;  3GZ5 A;  1X1P A;  1IV8 A;  4XMY A;  4X0G A;  4HOB A;  2BY1 A;  4BU2 A;  3MZH A;  1SFU A;  2VPL A;  4II3 A;  1Z05 A;  3F22 A;  1MDM A;  1UMQ A;  1SMY F;  2A3S A;  3MVP A;  5LGT A;  2IS6 A;  2ZJR F;  3DTI A;  2A61 A;  1SD7 A;  2ZC2 A;  2R7U A;  4G6Q A;  1KU3 A;  4EJT A;  4O6J A;  5EGO A;  4GFB A;  3DEE A;  1TWA J;  2RKH A;  2QA4 I;  1XPX A;  1IC8 A;  2BXY A;  3HGG A;  4KIT B;  4XKV A;  5D4R A;  1MNM C;  1JXS A;  1HDD C;  4A3L J;  2CW0 F;  2WC2 A;  5IT3 A;  4L0Y B;  2B9S A;  3DXJ F;  3L2U A;  3M8J A;  4EEF G;  4DJA A;  2FUG 2;  3K0L A;  2KP6 A;  5BPD A;  1QHH D;  2E1C A;  1SAU A;  1MMS A;  1Y8R B;  1PP7 U;  3OYF A;  3ZN0 A;  3BR1 A;  1ETY A;  4R1H A;  2E60 A;  4HPQ A;  4HZF A;  1XS9 A;  1GDT A;  4LK0 F;  4YIR X;  3HXL A;  3MZY A;  5DYM A;  2EIJ H;  3HGY A;  3OYH A;  5F64 A;  2E1O A;  2RNJ A;  1T2K A;  4A3K J;  1W7P A;  3O2P E;  3AG2 H;  2HVQ A;  1SVL A;  3TOA A;  3R61 A;  2IRF G;  2R93 J;  4HRI A;  1FP1 D;  1W4M A;  4DNC A;  3A0B C;  3OYG A;  3CF2 A;  4PGH A;  1FTZ A;  3BTJ A;  4QTR A;  3TDZ C;  1NG6 A;  3IH3 A;  5M3F J;  3OR1 C;  4ZTJ A;  5CVR A;  3LSM A;  2A07 F;  3CC7 I;  3JSP A;  4XN3 A;  1PYV A;  2GOX B;  3DPL C;  4XLH A;  2P8T A;  3Q5F A;  2ZNZ A;  1G3Y A;  3H9G A;  3OYB A;  4MIM A;  3HOW J;  1ACI A;  1P92 A;  4L18 B;  1TNS A;  2M45 A;  3F6O A;  2Y9Y A;  5JLX A;  3EYY A;  4FAS D;  1X2N A;  3SEZ A;  5D8K B;  4AC0 A;  4ANJ A;  1MBG A;  5L3E A;  4MEY F;  2PQ8 A;  5E8G A;  2XB5 A;  5IPA A;  3WE2 A;  1SFK A;  2JMW A;  2UUZ A;  2BEO A;  3ABK H;  3CCU I;  2VOP A;  3CLO A;  4ESF A;  1RC9 A;  3T8R A;  3OYI A;  1C0W A;  3FM5 A;  2RN7 A;  1JHH A;  5BQT A;  2QSF X;  1ZGW A;  1TQM A;  4P1W A;  4DYR A;  4IF4 A;  4GO1 A;  5HS9 A;  2MSY A;  2WBM A;  4RGU A;  3JRI A;  3CC4 I;  2HEO A;  2Z16 A;  1ON2 A;  3BPX A;  3RYR A;  2F5F A;  4BH9 A;  3HOV J;  1WRJ A;  1U3E M;  1R6R A;  2E1M B;  4N9I A;  1SVO A;  4RMN A;  5DUK A;  3DLA A;  4EJW A;  1PDN C;  4XLA A;  1SMT A;  3KLN A;  3BJ6 A;  4I98 B;  2O03 A;  3LFK A;  5FLX K;  2ZXW H;  2VB6 A;  5JHU A;  3PUF A;  1MKM A;  4HNV A;  3WTZ A;  3KLO A;  2NAZ A;  3RSN A;  3K6G A;  2XSD C;  4I2O A;  2H09 A;  3E5Q A;  5DDG A;  1MMG A;  4CCK A;  2DDB A;  2GWR A;  3GTJ J;  2PFB A;  1Z67 A;  4IZZ A;  4CXF A;  5F1R A;  3ML6 A;  3K9T A;  3LSJ A;  5HLT A;  3GTQ J;  2X6Y A;  3EDP A;  1N78 A;  1FEX A;  1R00 A;  2WV0 A;  1Y56 A;  1BN5 A;  3DEW A;  2ZSH B;  4YIF A;  3OYM A;  2R7S A;  2QUF A;  4KIC A;  4G12 A;  2VC0 A;  2M2E A;  3GW2 A;  4I76 A;  2QBY B;  5ERI A;  1FSE A;  2OD5 A;  4I6Z A;  4LIT A;  3ZQC A;  1LPQ A;  4B8X A;  2QVO A;  3FXK A;  3I71 A;  4BBS J;  3H1C A;  4IXA A;  1P9Q C;  1FSH A;  2FF4 A;  4M73 A;  2R5Y A;  2K4B A;  1SD6 A;  2Y69 H;  3PNT A;  2CW8 A;  2HXO A;  5C4X J;  1EJ9 A;  1Z0X A;  1YIJ I;  1UJ8 A;  3LL7 A;  3REO A;  3LQR A;  4IRI A;  1W36 D;  1UG0 A;  2HR3 A;  2XIG A;  1K78 A;  4PFO A;  5JR3 A;  3FF5 A;  3HOT A;  4IOC F;  2ZJQ F;  4MFE A;  1DP3 A;  3FXJ A;  2X1C A;  2XHK A;  1O3Q A;  1X3W B;  3DWL E;  1K4T A;  2EH3 A;  5F08 A;  1MND A;  3F23 A;  3GLL A;  5C3E J;  5GAG J;  4BQN A;  4E7S A;  1HST A;  1UCR A;  2HQR A;  2HZD A;  2LDU A;  1VQP I;  2CQX A;  3HRT A;  3FHZ A;  2O9L A;  2P0W A;  4BDZ A;  1NK2 P;  4XLC A;  3K69 A;  1W5C C;  2G7U A;  2JRT A;  2P6T A;  1KU7 A;  2HDD A;  3DBL B;  1I3A A;  1ETO A;  3S2W A;  1KYZ A;  1BW6 A;  4I7H A;  3FMR A;  2EV0 A;  3L09 A;  2LKS A;  3G73 A;  3N05 A;  1TNT A;  3P9C A;  2FQ3 A;  4B44 A;  4NUB A;  3OWT A;  2LY9 A;  3IWZ A;  3HTU A;  4ZH4 F;  3TO9 A;  3OL4 A;  4GYI A;  4IL6 C;  4FT8 A;  1IRZ A;  1K83 J;  5J4V A;  2A6H F;  4M9Z A;  1K6O A;  2QKM B;  2GBY A;  5FRM A;  3KPH A;  1JKO C;  3HTS B;  1WZ2 A;  2R7T A;  1HF0 A;  4BE1 A;  1XDS A;  2P7C B;  3NWT A;  2NRA C;  3IHU A;  1F9N A;  3P9K A;  2X1E A;  2DTR A;  1WH5 A;  1Y6I A;  3I59 A;  4E7Z A;  2EFN A;  5J47 A;  3OYN A;  2O8K A;  3DTK A;  1VQ4 I;  3BZC A;  1QA6 A;  3F0C A;  2ZFW A;  5CVI A;  3PO2 J;  4LLL A;  2PBI A;  3QRF F;  1G3T A;  2VKV A;  4I02 A;  4BDY A;  4A3I J;  3IRQ A;  1ULY A;  1WHU A;  1O3T A;  1YTY A;  4U0W A;  4XKC A;  3H3U A;  3E6B A;  2K3P A;  2CV2 A;  3K2Z A;  3AFH A;  3BG6 A;  2BYV E;  2MC4 A;  3W6J B;  1VQ5 I;  2LNB A;  3S3M A;  2QQA A;  5DS9 A;  3V7S A;  2LD5 A;  4XSX F;  4XOP A;  4BAY A;  2BY2 A;  4A0Y A;  2F4I A;  3OR2 C;  2PLY A;  2FRH A;  3H5R A;  1YG2 A;  2OA4 A;  3A02 A;  2B7E A;  3I3L A;  3M9A A;  2XB0 X;  5C4J J;  3E6M A;  4NB5 A;  3BQY A;  3WU0 A;  4CO8 A;  2DFI A;  2IS4 A;  3NAU A;  2EZH A;  2XAU A;  3ZCO A;  3HUG B;  2QM3 A;  3UNG C;  1HA8 A;  2XGX A;  3LMM A;  4PZJ A;  1B72 B;  1B8I A;  5FGM A;  4XKW A;  4A3E J;  4XNF A;  4DBR A;  1ZGJ A;  4KJZ A;  3L2Q A;  3I53 A;  1LEA A;  3SZG A;  4BJ6 C;  4UV8 A;  4CH7 A;  1KA8 A;  2E36 A;  1RKT A;  2VI6 A;  3NRV A;  4HYE A;  4IHW A;  3B73 A;  3ZR8 X;  3J7A Y;  3S14 J;  3I4N J;  4M71 A;  4KIG A;  2LY1 A;  4B43 A;  3DFG A;  1FBQ A;  3HSR A;  3OSG A;  2M34 A;  5K7F A;  2QLZ A;  3JRA A;  3CF5 F;  4G6T B;  2JQ7 A;  3SEQ A;  3SYT A;  2LBF B;  5J1Y A;  1YO5 C;  5JHF A;  2CGP A;  3FXL A;  4EJU A;  5K7H A;  9ANT A;  1IDZ A;  1UFM A;  1B1B A;  2W48 A;  4XRS G;  3KEQ A;  2H6B A;  2HYF A;  1V5F A;  2FOK A;  4YII A;  1UEL B;  1UHM A;  3LA3 A;  4E7L A;  1T39 A;  4ESJ A;  4ZYA A;  2DI3 A;  2Y31 A;  2LKP A;  1TWF J;  4GCV A;  4ETS A;  3OS2 A;  2RC4 A;  4HF1 A;  4OIP F;  3RIR A;  2IS2 A;  1WJE A;  4P9U A;  4ESB A;  3QWL A;  3V8L A;  4BEH A;  3IH2 A;  2QGU A;  2AQF A;  2WB1 N;  3W3C A;  4XLF A;  4AYB A;  3VYS B;  3IWF A;  3CCS I;  4CYC B;  3RKX A;  3GEZ A;  4WXC A;  4FX4 A;  1FOX A;  2F5D A;  1B4A A;  2DU9 A;  2X4H A;  1WJD A;  2XC7 A;  2KRF A;  3H35 A;  2VLA A;  1A36 A;  3W2A A;  4NDL A;  3ZQH A;  4PJ0 C;  3K70 C;  1J75 A;  2ME0 A;  5CVU A;  4F91 B;  2VKD A;  3MKL A;  2Y30 A;  1RI7 A;  2VKE A;  5BNG A;  1H88 C;  5L3C A;  1WCM J;  2F5E A;  2FBK A;  3K10 A;  2HNH A;  4IOA F;  1FT9 A;  3V4G A;  3O3K A;  2VQL A;  3OYL A;  3ZMS A;  4HF2 A;  2V1X A;  2O0Y A;  4L9T A;  2JSC A;  5IY5 H;  4CA0 A;  1LDD A;  1P4X A;  4RA2 A;  3PIP F;  2BOL A;  3CDH A;  3E1S A;  2CUJ A;  2ELJ A;  1LDK B;  3PFY A;  2K02 A;  2QF7 A;  2FNA A;  1R58 A;  2DOD A;  2ID6 A;  1JTY A;  4FQG A;  3S1R J;  4H0E A;  3HIF A;  1Z6R A;  2LRE A;  3TMO A;  2DXI A;  2OQR A;  2DFE A;  4MLO A;  2Q0O A;  3J7Z I;  4IQ4 A;  3BTI A;  2CUZ A;  3WTU C;  4QWQ A;  4BE0 A;  3PUB A;  1R1T A;  2CSO A;  2VIX A;  2PG4 A;  4Z6Y A;  2AXL A;  1FY7 A;  3MQ0 A;  3RKY A;  3T1B A;  3ZXS A;  4NNJ A;  4EV0 A;  4EM1 A;  3CQZ J;  4XID A;  5IYD J;  2JVG A;  3Q9S A;  4HDV A;  3PL8 A;  2JA8 J;  4M3F A;  3RDI A;  5FLM J;  5LRS A;  1TLH B;  4PSW A;  1U8B A;  2VT3 A;  3CES A;  3OSF A;  2Y48 A;  2K7L A;  2OV7 A;  3GLX A;  5ILU A;  2R3S A;  3DLL F;  3WU1 B;  3JW4 A;  1SEU A;  1JUM A;  1VTN C;  4YRV A;  2F48 A;  3U21 A;  3IP4 B;  3ABU A;  2HOA A;  4S04 A;  1E3O C;  4BGD A;  4M72 A;  5KAF C;  2M4G A;  1YW9 A;  3EUA A;  1FMW A;  2CUF A;  4FET A;  2UWM A;  3L1P A;  2HPM A;  3AAF A;  4RB2 C;  3IUO A;  3E6C C;  2HOT A;  2M0C A;  3FKI J;  3S1N J;  1Y1V J;  1TT0 A;  3CZ6 A;  4YFX F;  3OY9 A;  2LF8 A;  2XGC A;  1FTT A;  2KJB A;  3BG7 A;  1OCZ H;  1U2W A;  2ME6 A;  1D1B A;  1XMK A;  1V5G A;  3FXQ A;  4G6D A;  5E20 A;  2CG4 A;  4NQW B;  1Z9C A;  1HKS A;  3RKW A;  1QU3 A;  3EPZ A;  2I8D A;  3A03 A;  1RR8 C;  2HYJ A;  2VE8 A;  5J6X A;  1OIS A;  1DP7 P;  1FPQ A;  4CCM A;  4A3G J;  2LYC A;  2Y0M A;  3LSK A;  2R5Z A;  3WHB A;  1QZY A;  5ICE A;  1IJW C;  3GVA A;  1P7I A;  3CMY A;  2A05 A;  1FBS A;  1L0O C;  3WGH A;  1IUY A;  2QZ8 A;  2K9N A;  5E1Z B;  4C2U A;  5LHI A;  2E5Z A;  3KYC B;  3QPL A;  1O7F A;  4FTH A;  4D7M A;  5K5R A;  3G6E I;  2LR8 A;  5FRN A;  2ELK A;  2DA1 A;  2VAS A;  1PP8 F;  5HNH A;  2M5W A;  3V8J A;  3WGG A;  3X2Q H;  4CZZ A;  1HQC A;  4JOM A;  3A01 B;  4XLN F;  5FKO A;  5DCM A;  2DA2 A;  1MW7 A;  1YS7 A;  2E7X A;  2JA2 A;  2JVH A;  2VKH A;  4QLC U;  5DD4 A;  4HV5 A;  4LOC A;  4UUV A;  5FD6 A;  4ENK A;  2XAF A;  1ZAR A;  1RIO H;  1S9H A;  2LMD A;  1IV6 A;  2ZO4 A;  3CP2 A;  2YPR A;  2IA1 A;  2VQH A;  4GGG A;  2DMP A;  2R7F A;  1VQM I;  4EAT A;  3OYJ A;  2R0Q C;  2ISZ A;  2BW3 A;  4IHY A;  4KA4 A;  4DBQ A;  3SZT A;  3HBL A;  1HXD A;  3H92 A;  3RI4 A;  4M9X A;  3OYC A;  3G2B A;  4M74 A;  2KHM A;  3JAM Z;  3TBI A;  5KCM A;  1MBJ A;  1SFE A;  1MNE A;  3K4K A;  4M6X A;  2XAQ A;  3SFI A;  2BY0 A;  4BJT A;  1DGW Y;  4AD9 A;  4AUX A;  5FJ8 J;  1S6L A;  1SVM A;  3LA2 A;  2ESN A;  2Z3Y A;  3FXU A;  5HS7 A;  1FOK A;  1QRY A;  4HQE A;  2XF5 A;  3JSO A;  1EH6 A;  1HKQ A;  1MJA A;  2KIM A;  4HQM A;  5J3L A;  1A31 A;  2R7D A;  1KU9 A;  3RCO A;  3ASO H;  3BG5 A;  4LGW A;  2FSW A;  2L3D A;  3HHH A;  1WQ2 A;  2M0M A;  3BPV A;  5GAD J;  1IF1 A;  2LTP A;  3HZJ A;  2O6G E;  4Y52 J;  1TWC J;  1J7K A;  2VQG A;  1L3L A;  1J2X A;  3DU6 A;  2QEN A;  2QQB A;  2HQ5 A;  4XLE A;  2JT1 A;  3I58 A;  2DMT A;  2UXX A;  1Z21 A;  5J4Y A;  1QGP A;  1RPW A;  1V54 H;  2D1V A;  3HC7 A;  5CYV A;  4BJ5 C;  5F1J A;  3IC7 A;  5GPA A;  2GA2 A;  4L9V A;  2ZJ2 A;  4L0Z B;  1H8A C;  2XSJ C;  3BWG A;  3L7W A;  3HG9 A;  5H6Q A;  2EWN A;  3GFM A;  3BG3 A;  2CFX A;  3CO6 C;  2G0E A;  3WTT C;  5CQG A;  3LQQ A;  4W1U A;  3I54 A;  4J19 A;  2YU9 J;  1KON A;  1QVU A;  4V2F A;  4B3X A;  3WTS C;  2VOO A;  1O7L A;  4ZYH A;  4G7Z F;  4XKB A;  3TGN A;  2DMN A;  5DV5 A;  5E18 F;  1IN5 A;  1AKH B;  1HW2 A;  2R4G A;  1IDY A;  2JSP A;  3SXY A;  2O3F A;  3HPG A;  4D9J A;  2IW5 A;  3F72 A;  1CGP A;  3CJT B;  3CLQ A;  4L5J A;  2JUC A;  2QQ9 A;  2M7A A;  2NNN A;  3JCU C;  1YJ9 I;  2EA4 A;  3F3X A;  1ZAO A;  2GQQ A;  3OIO A;  4OIQ F;  2NVT J;  2XKO A;  2MC3 A;  4C3I J;  5LGN A;  1S7O A;  4MTD A;  2KPM A;  1YX5 A;  2R7O A;  1STZ A;  3VFZ A;  4HLY A;  3TP3 A;  4UVB A;  3SFZ A;  3AL0 B;  3H5A A;  1YHQ I;  3FIS A;  5DM6 F;  2XAJ A;  1HW1 A;  4PJJ A;  3ZMU A;  4M9S A;  3HUG A;  2A6E F;  4P9F A;  1D1A A;  5ILV A;  1JGS A;  3OS1 A;  3LOC A;  3DPT A;  1EKE A;  4KUM A;  2CH0 A;  4FHT A;  1B72 A;  1WJB A;  3DQV C;  5F04 A;  2L9V A;  2VJ4 A;  4KT6 A;  1F1Z A;  3G3Z A;  4CIC A;  3JRF A;  4J01 A;  1NTC A;  3MKW B;  4XQF A;  1XX5 A;  5LEK A;  2CV0 A;  3D0S A;  5EEG A;  3Q0V A;  3FXM A;  2NVQ J;  2PN6 A;  1IN7 A;  1XDU A;  2HOE A;  3LSR A;  4DZJ A;  3CCR I;  3ESW B;  5E3O A;  3Q3S A;  4QPQ A;  2COM A;  2X6W A;  1R49 A;  1OJL A;  3CJR B;  1LEB A;  4A5N A;  3KCC A;  3ERM A;  3E5X A;  4XOR A;  1YRN B;  5J40 A;  2OJE D;  1PUF A;  2CWE A;  1TC3 C;  5KHD A;  1RRJ A;  2W85 A;  1JE8 A;  4N0B A;  4CSW A;  3BZK A;  3RPQ A;  2D1H A;  2V6E A;  1LFB A;  2J5O A;  2DPD A;  1DPU A;  2XGE A;  1OYI A;  2ZJP F;  2QQ8 A;  5BOX A;  2Z9O A;  2JUG A;  2DYR H;  1JT6 A;  1OCP A;  1VZ0 A;  2VN2 A;  1G8X A;  2W57 A;  3CUQ B;  4ZDP A;  3M7G A;  4UUS B;  1IAW A;  4KYW A;  2E5N A;  3HKZ A;  1TZL A;  4IRH A;  2E2H J;  2ZME B;  3V7R A;  2C6Y A;  4A12 A;  1U8R A;  1ZG1 A;  1Z6T A;  3JAM K;  1LFP A;  1FYL A;  1X58 A;  3C2H A;  2IP2 A;  1T33 A;  4RAY A;  3MCZ A;  4LG0 A;  2XRO A;  1IN4 A;  2DA5 A;  1NHA A;  5B5E C;  4ZDO A;  2V7F A;  4XRF A;  3KEO A;  2HQA A;  2EZL A;  5C44 J;  4BBR J;  5E3M A;  2BVL A;  1ORK A;  1JUS A;  5B66 C;  3GWZ A;  5F27 A;  3CCY A;  2JRM A;  1D0Z A;  3D5R C;  2YUS A;  1AU7 A;  3A4C A;  1FOY A;  5CVJ A;  2MYS A;  3W6V A;  2A5Y B;  3VSK A;  3RYP A;  2JA6 J;  5EDN A;  4BUP A;  5D5W B;  5D5U B;  4HDU A;  3MMY B;  2L9N A;  4AYB N;  2M8G X;  4A3C J;  1AOY A;  5TRD A;  3MEX A;  1K6Y A;  3R0A A;  1WI9 A;  1H0M A;  1UHW A;  1X1D A;  3CCV I;  3GO5 A;  4IHV A;  1DUX C;  3RZD J;  1TBX A;  3GFL A;  1IUF A;  5CKT A;  4DYQ A;  1FYM A;  1BJA A;  3F8F A;  5HDG A;  2Q2E A;  4G8X A;  2PMZ N;  1U78 A;  1A35 A;  1YOV B;  1BA5 A;  2DJN A;  3L9F A;  3PNV A;  2PMH A;  3FXO A;  3DKX A;  4S0H B;  3QAH A;  3HDD A;  2P5V A;  4BXX J;  2FML A;  5CVV A;  5B3S H;  5HOO A;  1E2X A;  4HEA 2;  3COA C;  1P2F A;  2BXZ A;  4NBQ A;  1HBX G;  3BP8 A;  5H20 A;  1HCR A;  1V55 H;  1XMA A;  2V9V A;  4HV6 A;  3IKV A;  5EG0 A;  1LNW A;  2FD5 A;  2LKX A;  2KIS A;  2QSH X;  2WAF A;  1VQ6 I;  2BVM A;  3LSG A;  2BE5 F;  4DW6 A;  2X0L A;  1QZE A;  1GT0 C;  2EIM H;  1MBF A;  1YIT I;  1VQ9 I;  1TL8 A;  4N4N B;  4KT5 C;  4UVC A;  3CJN A;  5DM7 F;  2STW A;  3GTG J;  3C7J A;  1ZHF A;  3HOU J;  1XGN A;  4YEJ A;  1QPI A;  3F21 A;  3DBH B;  1D8K A;  1X1B A;  1CF7 B;  3EYI A;  3WTY C;  4ZJZ A;  3GZN B;  2Y75 A;  2HOS A;  2VPR A;  2OBP A;  4GDF A;  4BE2 A;  5L3B A;  2X6O A;  1QBJ A;  3HRM A;  3RZO J;  3MN2 A;  2QCO A;  1ENH A;  5E79 C;  3Q0U A;  1Z91 A;  4G94 A;  1QNT A;  2DOA A;  4JX6 A;  2PJR B;  1D0X A;  4CYD A;  3AKZ A;  5FKL A;  3TKY A;  2KL4 A;  3ELK A;  2EV5 A;  3LST A;  3DF8 A;  3ECO A;  3HOX J;  5LGU A;  1ZR2 A;  1IRG A;  3T0Y A;  3ABT A;  1XN7 A;  2E7W A;  2EA2 A;  2F5V A;  2OPT A;  4KIS A;  4EVI A;  2GXG A;  2BBY A;  3GX4 X;  2W82 A;  4YEL A;  2VC1 A;  2HQN A;  4NC7 A;  2DAO A;  3S1M J;  4ZTF A;  2E2I J;  4KNY A;  3M3Y J;  4HLX A;  1W7P D;  1OPC A;  4OAY A;  5BMZ A;  4IJA A;  4JBA A;  1OFC X;  1R7J A;  3CD6 I;  1YJW I;  2VXZ A;  3VWB A;  4GRI A;  1HOM A;  4JP0 A;  3ZQ7 A;  3HB9 A;  1T95 A;  2JN6 A;  5JVG F;  2CQN A;  2VJ5 A;  3GYH X;  1ZTR A;  2IGK A;  3ZQQ A;  1VND A;  5LHH A;  1SD4 A;  2CS3 A;  1MDM B;  5K1Y A;  2IA0 A;  4RDU A;  5IOY A;  5JLW A;  4JK1 X;  5EF6 A;  1OCR H;  2K27 A;  1D5V A;  1MZB A;  3KP3 A;  2X6X A;  1I27 A;  5EGO B;  3S1Q J;  2FMY A;  4DGW B;  5A2Q Z;  3I4M J;  1KGS A;  1IN6 A;  1D0Y A;  4HNT A;  1ZLK A;  3BOQ A;  1DU0 A;  3HHG A;  2KIU A;  2WV1 A;  1KU2 A;  3J7A O;  2IXS A;  4J00 A;  5D5X B;  3LAJ A;  4X1E A;  4QPO A;  4XIC A;  4UHT A;  1T8I A;  3E97 A;  4PJL A;  5FKK A;  2ZXJ A;  4XM3 A;  3K4B A;  3LFU A;  4BHP A;  1U5T A;  4FE7 A;  3U9G A;  5HNF A;  3K4N A;  2MFZ A;  2RNG A;  1B6A A;  2WY7 Q;  1LE8 A;  1PVE A;  2CQ7 A;  2DYS H;  3BTC A;  4ENM A;  1IXC A;  1FP2 A;  2MH9 A;  3C2B A;  3DU5 A;  5HLG A;  3HL2 A;  3TO6 A;  2DFF A;  3KX2 A;  4U7D A;  4YFN F;  1YLF A;  4RLF A;  3GCM A;  4IEJ A;  3RTR A;  4UVA A;  3QYE A;  2L9S A;  1W7P B;  3JRE A;  2E1N A;  1A6Q A;  3L2V A;  1RUO A;  4EMS A;  4I99 C;  2LY2 A;  3IH4 A;  3ZMD A;  3A1Y A;  5EEH A;  5H6R A;  3A2K A;  1GHC A;  2KRH A;  3WHC A;  3IAM 2;  3G4S I;  1HLV A;  2PX9 A;  3GME A;  3VYU B;  4R79 A;  1Z7L A;  4PDK A;  2K5C A;  2XF6 A;  1LQ1 A;  4Q5S F;  1MBH A;  2R7W A;  3ZQI A;  2VBY A;  1G4D A;  5FLV A;  3P5J A;  1ZRC A;  2ZCW A;  2XPV A;  1TP4 A;  2LH9 A;  1J09 A;  1S29 A;  2PJP A;  1XGM A;  3MKZ A;  3OOU A;  4AIH A;  2IBD A;  2PMU A;  3C1D A;  4ASN A;  4IHT A;  4W97 A;  2CRG A;  1ERD A;  2F5C A;  3VYR B;  1BR4 A;  3CUO A;  4BHB A;  2L4A A;  3SQN A;  3QU3 A;  1W0T A;  2LSO A;  2H8R A;  4HX7 A;  2EZI A;  2A68 F;  3HYI A;  3WTV C;  3A0H C;  1XGO A;  1G59 A;  1WSU A;  4CCN A;  2ESH A;  1AA7 A;  1GLN A;  1V3F A;  3PO3 J;  1U5T C;  1FIP A;  2ICW G;  3SHF A;  3PIO F;  3GUD A;  1YE9 A;  2J5P A;  4RS8 A;  5IP9 J;  2YS9 A;  3HM5 A; 
#chains in the Genus database with same CATH homology
 1GVD A;  3HGY A;  2K9N A;  4C2M J;  3S15 J;  2E1O A;  3QPL A;  1I50 J;  2JK3 A;  5GP9 A;  4C3H J;  4A3K J;  4FTH A;  4D7M A;  2LR8 A;  2ELK A;  2DA1 A;  1MBE A;  3IV5 A;  2R93 J;  3A01 B;  4M3B A;  4QSH A;  5FKO A;  2DA2 A;  1G2H A;  3G1M A;  5IP6 A;  3SJM A;  4LOC A;  1FTZ A;  3BTJ A;  4QTR A;  2M9H A;  3IH3 A;  5M3F J;  2CQQ A;  3QPS A;  1IV6 A;  3LSP A;  2XRL A;  2DMP A;  1GV2 A;  2FJ1 A;  4MIM A;  1ETV A;  3HOW J;  1ETQ A;  1T56 A;  2GLO A;  2R0Q C;  4IHY A;  4A3M J;  2L0K A;  3HBL A;  1ETW A;  2Y9Y A;  5JLX A;  3UKG A;  2NS8 A;  2XPW A;  5IYC J;  5F0H A;  3JRH A;  1X2N A;  2O7O A;  3GTL J;  2K9S A;  3ZQG A;  1MBG A;  4AC0 A;  2Y2Z A;  1BL0 A;  5IPA A;  1MBJ A;  2LVS A;  2XB5 A;  4M6V A;  3GTO J;  2DA6 A;  1WPK A;  2JMW A;  2MGQ A;  2IAI A;  3GBG A;  3SFI A;  4AUX A;  4M3E A;  5FJ8 J;  2R5Y B;  1ZGW A;  4DYR A;  1TWH J;  2NOG A;  5E3N A;  3JRI A;  2MSY A;  2L7M P;  4M3D A;  2LFB A;  1QRY A;  2GM4 A;  2Y0S N;  3HOV J;  4V2G A;  3CDL A;  1APL C;  5J3L A;  2B63 J;  3A01 A;  1HDP A;  2FX0 A;  2LK2 A;  1U9O A;  5F0C A;  3BG5 A;  4A3J J;  3BR5 A;  2ECC A;  2HXI A;  2LTP A;  4Y52 J;  4HNV A;  1TWC J;  4FIS A;  1WGX A;  1O4X A;  1ETX A;  2XSD C;  1JTX A;  2P81 A;  3K2A A;  2HQ5 A;  2DMT A;  3GTJ J;  1RPW A;  2NS7 A;  2DMU A;  5F1J A;  4B1R A;  5GPA A;  1A5J A;  1BW5 A;  3LSJ A;  3G1L A;  1JGG A;  3GTQ J;  1H8A C;  1FEX A;  3DEW A;  5IP7 J;  3HOZ J;  1NK3 P;  4G12 A;  2LLK A;  2M2E A;  4I76 A;  3BG3 A;  1JKQ C;  1YRN A;  2G0E A;  1VF9 A;  3DCF A;  4W1U A;  4I6Z A;  2MW8 A;  4J19 A;  2YU9 J;  1QVU A;  4V2F A;  3ZQC A;  4D5F A;  5M5Y J;  4BBS J;  3K7A J;  2DMN A;  2EQR A;  2JA7 J;  1AKH B;  3JRC A;  2R5Y A;  2DA4 A;  1IDY A;  1X2M A;  1SAN A;  2HXO A;  4QIW N;  5C4X J;  1Z0X A;  3B6A A;  1PUF B;  3S17 J;  3OIO A;  4UUT A;  1D5Y A;  4MFE A;  2NVT J;  4C3I J;  2EH3 A;  5F08 A;  1I6H J;  5C3E J;  2R92 J;  1H89 C;  3TP3 A;  1GUU A;  1RR7 A;  3FIS A;  1TWG J;  1U9N A;  2CQX A;  1WH7 A;  2O9L A;  1F43 A;  2ZB9 A;  1NK2 P;  2NVX J;  4BY1 J;  2HDD A;  2CJJ A;  2NVY J;  1ETO A;  3LOC A;  3FIW A;  1BW6 A;  1VI0 A;  2JJ7 A;  1B72 A;  1BJZ A;  2E19 A;  5F04 A;  1W0U A;  2LY9 A;  2R7Z J;  2DA7 A;  4RBO A;  5F0F A;  3JRF A;  2E2J J;  1NTC A;  1K61 A;  2MG4 A;  1VFC A;  1IRZ A;  1K83 J;  1MH4 A;  1ITY A;  3Q0V A;  1DU6 A;  4L5E A;  2NVQ J;  2GBY A;  1JKO C;  3LSR A;  1LFU P;  4DZJ A;  4XK4 A;  5E3O A;  1HF0 A;  1MSF C;  1B8I B;  2JA5 J;  1Q1V A;  3Q3S A;  1R9T J;  1FJL A;  1AKH A;  1OJL A;  3H3V K;  1WH5 A;  3FK6 A;  2RAE A;  4FE4 A;  1YRN B;  1JJ8 C;  1PUF A;  1TC3 C;  3BR6 A;  4B3A A;  2O8K A;  3S2D J;  3F0C A;  3PO2 J;  1LFB A;  2VKV A;  4MFD A;  2XGE A;  4A3I J;  4A3B J;  5HOD A;  5EYR A;  5IYB J;  1JT6 A;  1OCP A;  4UUS B;  3M4O J;  2E2H J;  4C3J J;  5EG0 B;  1S7E A;  3JRG A;  5DS9 A;  2LD5 A;  5EZH A;  1X58 A;  3H0G J;  4XRM A;  1T33 A;  4IHX A;  2DA5 A;  2H1K A;  3A02 A;  3JR9 A;  2X48 A;  1MSE C;  1Y1W J;  4JYK A;  1RET A;  2XB0 X;  5C4J J;  2EBI A;  2EZL A;  3BQY A;  5C44 J;  4BBR J;  5E3M A;  1ORK A;  1JUS A;  5F27 A;  3CCY A;  2DA3 A;  2EZH A;  3NAU A;  4M3G A;  2YUS A;  1AU7 A;  1AHD P;  3W6V A;  2DTZ A;  4DYC A;  3GTM J;  2JA6 J;  5EDN A;  3HEF A;  3RQI A;  3O8H A;  3GTK J;  4AYB N;  4A3C J;  2M8G X;  1MH3 A;  1B72 B;  1B8I A;  1ZR4 A;  3S2H J;  3G1O A;  4MO7 A;  4A3E J;  4IHV A;  2AHQ A;  3RZD J;  1IUF A;  3ZQL A;  4DYQ A;  1IGN A;  2PMZ N;  1U78 A;  1BA5 A;  2DJN A;  3FK7 A;  1RKT A;  2VI6 A;  2X9D A;  4IHW A;  3I4N J;  3SDG A;  3S14 J;  4S0H B;  3JRB A;  3HDD A;  4BXX J;  3OSG A;  2M34 A;  5K7F A;  3JRA A;  3PM1 A;  1A6I A;  4UUS A;  5J1Y A;  1CQT A;  2JWT A;  1HCR A;  3BR3 A;  5K7H A;  5EG0 A;  9ANT A;  2FD5 A;  2Y9Z A;  1IDZ A;  5J1R A;  2LKX A;  2W48 A;  4XRS G;  4FCY A;  2IEK A;  1XC5 A;  3B6C A;  3LSG A;  3D1N I;  4DW6 A;  5EZG A;  3E7L A;  3VPR A;  4A93 J;  2EZK A;  1GT0 C;  1SFO J;  1MBF A;  2Y31 A;  5DTD A;  4D5C A;  1JKP C;  1TWF J;  3GTG J;  2HI3 A;  2XPU A;  3HOU J;  1ZQ3 P;  1QPI A;  2L7Z A;  3NAR A;  3IH2 A;  4JX5 A;  2WB1 N;  3GTP J;  3HKZ N;  2VUM J;  4CYC B;  2HOS A;  2VPR A;  2X6O A;  4DZP A;  3RZO J;  3MN2 A;  2QCO A;  1ENH A;  3Q0U A;  2L9R A;  4BY7 J;  1QVT A;  4NDL A;  3ZQH A;  4JX6 A;  2ME0 A;  3MKL A;  2Y30 A;  2VKE A;  5FKL A;  5M3M J;  5IOZ A;  5BNG A;  5FKN A;  1UG2 A;  4Y7N J;  1H88 C;  2K9Q A;  2K40 A;  2KDZ A;  3TW6 A;  3HOX J;  1ZR2 A;  1LE8 B;  1WCM J;  1OCT C;  2OPT A;  2I10 A;  1F36 A;  5GPC A;  1RES A;  2TCT A;  2ECB A;  3S1M J;  3ZQF A;  2E2I J;  3M3Y J;  1JT0 A;  4A69 C;  1OFC X;  5E3L A;  2QF7 A;  1HOM A;  4JP0 A;  3HB9 A;  2JN6 A;  5EEA A;  2ID6 A;  1JTY A;  1I3Q J;  3BR0 A;  1Z77 A;  3TW7 A;  3S1R J;  2FQ4 A;  1ZTR A;  1VND A;  4MLO A;  1POG A;  4JX4 A;  5M5X J;  2DN0 A;  4RDU A;  5IOY A;  3BTI A;  5JLW A;  5EF6 A;  5J1U A;  3BTL A;  2KT0 A;  1JKR C;  5EGO B;  3TP0 A;  3S1Q J;  4X6A J;  2LP0 A;  3I4M J;  4A3D J;  4CYC A;  3LNQ A;  4A3F J;  4XID A;  1MBK A;  3CQZ J;  5IYD J;  4B4C A;  3ZOB A;  2DMQ A;  2WV1 A;  5K7Z A;  1DU0 A;  3QQA A;  1EF4 A;  2JA8 J;  2AO9 A;  4X1E A;  4XIC A;  2N8G A;  5FKK A;  2ID3 A;  4M3F A;  5FLM J;  1JUP A;  1U8B A;  1XG1 A;  4FE7 A;  2XGD A;  3OSF A;  3BR2 A;  2R5Z B;  3RKQ A;  3BT9 A;  3BQZ A;  2CUE A;  4XRS A;  1IG7 A;  1LE8 A;  3HOY J;  3BTC A;  2D5V A;  1ETK A;  1JUM A;  3C2B A;  1UHS A;  2OF7 A;  2HOA A;  1E3O C;  4IEJ A;  3JRE A;  2COB A;  2CUF A;  5FKM A;  4ABZ A;  1JJ6 C;  3JRD A;  2CU7 A;  2TRT A;  3IH4 A;  3L1P A;  1FIA A;  3WHC A;  1HLV A;  2HOT A;  1UMQ A;  2M0C A;  3Q0W A;  3MVP A;  3FKI J;  1ZK8 A;  3S1N J;  1RKW A;  3O8G A;  1Y1V J;  1MBH A;  5EGO A;  3ZQI A;  3BG9 A;  4GFB A;  5FLV A;  1TWA J;  1IC8 A;  3HGG A;  2XGC A;  1MNM C;  2XPV A;  1FTT A;  1HDD C;  2ME6 A;  4A3L J;  3OOU A;  2IBD A;  4W97 A;  2CRG A;  1P7J A;  1ZKG A;  4EEF G;  1WI3 A;  2WAQ N;  1W0T A;  3A03 A;  2H8R A;  2EZI A;  2L7F P;  2HYJ A;  4A3G J;  4BKX A;  1GV5 A;  2R5Z A;  3BR1 A;  1ETY A;  3WHB A;  3TED A;  1IJW C;  3PO3 J;  5M5W J;  1P7I A;  1FIP A;  3CMY A;  4D7N A;  1XS9 A;  1GDT A;  3S16 J;  5IP9 J;  2YS9 A;  3HM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...