1ETXA

The crystal structure of e. coli fis mutant q74a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
74
Chain Sequence
VLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRGNATRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
total genus 27
structure length 74
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etxA00
1MBEA 3CDLA 1OCTC 3HDDA 1GVDA 1IC8A 2H8RA 5E3MA 4MFDA 2LKXA 2L7MP 2EZIA 1JT6A 1DU6A 4LOCA 1I6HJ 5C4XJ 3A01A 3G1OA 2O9LA 1WH5A 1X2NA 2IBDA 1AHDP 2ID3A 4JX6A 1ETKA 2NVQJ 5F0CA 2TRTA 1Z77A 4D5FA 3BG5A 1B8IA 2EQRA 1BA5A 5DS9A 3GTGJ 4D7NA 3OSFA 3C2BA 1UG2A 2DA2A 2R93J 1JUSA 2R7ZJ 2H1KA 2Y31A 5F08A 1VI0A 1RKWA 1B72B 1TWFJ 4C3HJ 2YS9A 1GDTA 3DCFA 3JREA 2YUSA 3SFIA 5M5WJ 5EYRA 1YRNA 3LSRA 3GTOJ 3BR3A 2CU7A 4IEJA 1TWHJ 5FJ8J 3JRDA 1QPIA 3Q0UA 4AC0A 3H0GJ 3UKGA 1LFBA 2FQ4A 5J1RA 5EG0B 2JWTA 2XB5A 4IHXA 2JJ7A 1JTXA 1QVUA 2DMPA 3B6AA 1PUFB 2ID6A 2E2HJ 3NARA 1WH7A 3PO3J 3S15J 1O4XA 2LR8A 1HF0A 1OFCX 3GTQJ 3JRIA 1PUFA 2OPTA 2NOGA 1U8BA 2N8GA 2X6OA 2LP0A 3QQAA 5FLVA 4V2GA 1U9OA 4AYBN 1GUUA 5F1JA 2MSYA 2VKEA 2ZB9A 2QF7A 1H88C 1VNDA 2O7OA 2ME6A 4GFBA 4IHVA 5EF6A 5FKNA 3TW7A 5GPAA 3BR6A 5M5YJ 5E3NA 1IRZA 2LFBA 2E1OA 4DYRA 2E2IJ 2G0EA 4DYCA 1P7JA 3M4OJ 3QPLA 2HXOA 4FE7A 1VFCA 2DA4A 3A01B 4MIMA 2M9HA 3FISA 2XGCA 5EEAA 1HCRA 2LVSA 2DA3A 1JJ6C 2R0QC 1BW6A 2QCOA 3TEDA 4B1RA 1F36A 4M6VA 2HQ5A 3ZOBA 5EZHA 1U78A 3A03A 5C4JJ 3OIOA 5K7ZA 1WGXA 2XGDA 2HOAA 4A3MJ 3G1MA 3S1MJ 1JKRC 3K7AJ 2VI6A 3S2HJ 5FKOA 3BTLA 4NDLA 2E19A 4M3GA 1T56A 3RZDJ 5JLXA 3DEWA 5JLWA 1MSEC 2DA1A 2EZKA 1FEXA 5IP9J 3BTIA 5FLMJ 2FD5A 4XIDA 4CYCB 4J19A 2R5YA 2LLKA 4FE4A 1QVTA 1TWGJ 4Y7NJ 3TP3A 3K2AA 4QIWN 5HODA 2CUFA 5IPAA 4UUSB 1LE8B 9ANTA 1R9TJ 2Y9YA 4JX4A 5E3LA 1RESA 1E3OC 1ETWA 2K40A 2MG4A 5C3EJ 3LNQA 2DTZA 1ETVA 3F0CA 2ECBA 2NVXJ 2JN6A 5F0HA 1OCPA 1APLC 1NK3P 3GTLJ 1MBKA 2DA5A 1RETA 1IDZA 4A3JJ 2HYJA 3BR0A 4FISA 4JP0A 1A6IA 2X48A 3HOZJ 2L9RA 3OOUA 2JK3A 4BKXA 2K9QA 3S14J 4X6AJ 2L0KA 3A02A 4M3BA 1SFOJ 3LSPA 2YU9J 1ZK8A 4UUTA 1IDYA 3NAUA 2DA7A 5IOYA 1NTCA 3Q0VA 2MW8A 3S1RJ 1MH4A 2JA7J 2EZLA 2M2EA 1OJLA 4I76A 4FCYA 4MFEA 2B63J 2DJNA 2FJ1A 2XPVA 2AO9A 3LSJA 4C3JJ 3RKQA 5K7HA 4XK4A 2DMNA 3GTJJ 3FIWA 1ITYA 1P7IA 4UUSA 3BR1A 2HXIA 1LE8A 5C44J 3WHBA 3CMYA 5E3OA 3JRAA 1HDDC 1FTZA 2W48A 5F0FA 1ETQA 1WPKA 3Q3SA 2Y0SN 1JKQC 2CUEA 3I4NJ 2XSDC 1I3QJ 5GP9A 4D5CA 5EG0A 3BT9A 5DTDA 4XRMA 3TW6A 3FK7A 1RR7A 2Y30A 1FIPA 1MH3A 1MNMC 1MSFC 2ELKA 2I10A 4IHYA 1IG7A 1POGA 2Y9ZA 5EGOA 3S17J 1UMQA 2JMWA 4A93J 1BJZA 3FKIJ 2O8KA 2IEKA 1K83J 4MLOA 3BTJA 4V2FA 1H8AC 4DYQA 4L5EA 1TWAJ 4Y52J 5M3MJ 2L7FP 4JYKA 1IJWC 4C2MJ 5EGOB 1LFUP 4D7MA 5J1UA 4G12A 5IOZA 3JRGA 2HOSA 2KT0A 2XRLA 4A3LJ 5K7FA 4A3BJ 1ZR4A 3GTKJ 3HOVJ 1ZQ3P 1Y1WJ 2HDDA 2EH3A 1YRNB 1W0UA 3HOYJ 2NS7A 5EDNA 5IYBJ 3CCYA 3ZQIA 1F43A 4RBOA 4A3KJ 3HEFA 1XS9A 3GTMJ 2PMZN 3E7LA 1SANA 1GT0C 2IAIA 4XRSA 2COBA 3GTPJ 2HI3A 1EF4A 3BG3A 1JGGA 5J3LA 3MVPA 2GLOA 1QRYA 4XRSG 4B3AA 1HOMA 4QSHA 1Z0XA 4HNVA 2L7ZA 3RQIA 3HOWJ 2M34A 4AUXA 3S16J 3IH3A 1RKTA 3JRBA 4M3FA 2TCTA 4IHWA 4C3IJ 3L1PA 1RPWA 3IH2A 1JUPA 1JTYA 5IYDJ 1FIAA 3QPSA 1WCMJ 3TP0A 2NVTJ 3MN2A 4CYCA 2WV1A 4XICA 2HOTA 5IP6A 3H3VK 2LK2A 2EZHA 1UHSA 1HLVA 4QTRA 3Q0WA 1H89C 1ZKGA 1JKOC 1XC5A 3CQZJ 4A3EJ 3LOCA 2M0CA 3BQZA 1B72A 3B6CA 2R5YB 1XG1A 2JA8J 2K9SA 3HOUJ 3IV5A 3M3YJ 3BG9A 1TWCJ 3JRHA 2VUMJ 5F27A 3LSGA 4A3IJ 1MBGA 2FX0A 1G2HA 5M5XJ 3OSGA 3VPRA 3WHCA 3ZQHA 1TC3C 2XGEA 3HOXJ 2R5ZB 1MBJA 1W0TA 2DN0A 2DMUA 2KDZA 4FTHA 1S7EA 3RZOJ 3W6VA 1IUFA 2X9DA 3S1QJ 4I6ZA 3HKZN 3PO2J 1GV5A 1X58A 5FKKA 4A3GJ 4JX5A 1GV2A 1I50J 1BW5A 1MBFA 1B8IB 2RAEA 4B4CA 1FJLA 1ORKA 3ZQLA 1Y1VJ 2LTPA 4BY1J 2ME0A 4A3FJ 2LY9A 3HM5A 1K61A 1JJ8C 1JKPC 3BQYA 5GPCA 2MGQA 1T33A 1ETOA 4ABZA 4A3DJ 3IH4A 3S2DJ 2CJJA 4M3DA 1FTTA 2K9NA 2GM4A 1IGNA 2EBIA 3GBGA 1ZR2A 4DW6A 5IYCJ 1ZTRA 5J1YA 1ZGWA 2VPRA 5M3FJ 5FKLA 1AKHA 3SDGA 3BR5A 1Q1VA 2CQQA 1A5JA 2AHQA 4S0HB 2E2JJ 3JRFA 5FKMA 2M8GX 4W97A 1WI3A 2NVYJ 2XB0X 3O8HA 2DMQA 3JR9A 1NK2P 3I4MJ 2R92J 3BR2A 5F04A 2VKVA 2OF7A 2JA6J 1AKHB 2XPWA 3D1NI 1CQTA 1AU7A 2XPUA 1U9NA 1ETYA 2P81A 1X2MA 1ENHA 2Y2ZA 2WAQN 3MKLA 1DU0A 4EEFG 3ZQGA 4BBRJ 5IP7J 4BXXJ 4M3EA 5EZGA 2LD5A 1BL0A 3S1NJ 1IV6A 3PM1A 3FK6A 2CRGA 1VF9A 4DZPA 3G1LA 4A3CJ 4BY7J 1HDPA 3HGGA 4DZJA 3ZQCA 2GBYA 2JA5J 1JUMA 2DMTA 3JRCA 2ECCA 3SJMA 2D5VA 1D5YA 2DA6A 4W1UA 2NS8A 2WB1N 3BTCA 3HBLA 3O8GA 3HGYA 2R5ZA 4MO7A 4A69C 1MBHA 4X1EA 3ZQFA 1JT0A 4RDUA 2CQXA 1ETXA 5BNGA 3HB9A 4BBSJ
chains in the Genus database with same CATH superfamily
2FF4A 4ZDLA 2XGXA 1MBEA 2KZGA 4A0XA 3CDLA 4QLCU 2FRHA 1I1GA 5BPIA 3CC2I 3IWZA 2HTSA 2H8RA 5E3MA 2LKXA 2PJRA 4RMNA 2KJCA 1SFUA 1JT6A 1WZ2A 3E0JB 4R1HA 2XDVA 1UHMA 2IGNA 3G1OA 5DCMB 5TRDA 1HW1A 4ZTJA 2IJLA 5H6RA 2HVSA 1XMAA 3MWMA 3TGNA 2E1NA 3M1CA 2VT2A 3BDDA 1FOWA 3IC7A 3CP8A 2XF5A 2RV8A 2EQRA 1DQUA 3H5RA 1BA5A 1HKSA 2KL4A 3FBIB 2DJIA 4PZJA 3GTGJ 5GADJ 3OSFA 3C2BA 1ZLKA 1KQ8A 2R93J 3VYSB 3KYDB 3HTSB 3BJ6A 3K70D 4NC6A 4ESJA 1B72B 2EV0A 3J80Z 4E7ZA 4RGRA 4AVPA 3WG7H 4Z2YA 2YUSA 5EYRA 3LSRA 2MBFA 3BR3A 2HS5A 2Y69H 4HX7A 2ZJ2A 3W2AA 3JRDA 1Z1DA 4NQWA 2CO5A 2F6CA 4ZYDA 3CD6I 2MLGA 4PJJA 5EG0B 2ZKZA 3HZJA 3IAS2 5DYMA 3DPTA 1T6SA 1TTYA 1JHHA 1FMWA 1W7PB 1JTXA 2OV7A 2QBYA 4IHXA 5CQEA 2HKXA 3RJPA 1JE8A 3LA3A 3DQVC 4KMFA 1RNLA 3U1DA 2OCCH 5HVQC 1R4MB 4IJAA 1PUFA 2OPTA 1SMYF 5E20A 2JRTA 1LUJB 4XKCA 1YI2I 2X6OA 2LP0A 2QM3A 2VJ4A 5EEGA 3QQAA 4V2GA 1GUUA 2KIUA 4BEHA 2QF7A 2HVQA 2V79A 1R00A 2ME6A 3ESWB 2RQPA 5EF6A 2M7BA 3HOSA 3QOEA 2IW5A 1D0ZA 2CSOA 1V54H 1RIOH 1MIJA 1R6RA 5M5YJ 2A6HF 3OY9A 4MEYF 3FXLA 4OWRB 1P7JA 2XC7A 4BJ6C 3M4OJ 3VFZA 3OYDA 1N77A 2DFFA 1HSJA 2KP6A 3CCVI 4OIPF 4HOBA 3OYGA 3BC8A 2FMLA 2M9HA 3FISA 5E1ZB 5EEAA 1Y39A 5DD8A 3BLYA 4YELA 1VQ4I 1BW6A 2HQRA 3NQOA 2BEOA 3K4BA 2MFZA 3C1DA 4BQNA 1W5SA 1R71A 3IL2A 3MKZA 3WTVC 2QVOA 2XGDA 5DCMA 1MD0A 4PGGA 2FSWA 4BACA 1JKRC 4F52A 1TT5B 3BPXA 3I59B 2ZSIB 3E5XA 4UY8I 3NEUA 1SD7A 1J2XA 1X1AA 2JPBA 2XIGA 1FEXA 4CYCB 3TMOA 2LYCA 4J19A 1F9NA 2BHYA 4AWXB 3K4MA 3AL0C 1S72I 1WSUA 4QIWN 5JFRA 1V3FA 2CUFA 4UUSB 1LE8B 2BW3A 5L3EA 9ANTA 3G4SI 5LHGA 4PSXA 1W7PD 5E3LA 1OCCH 1PDNC 1YW8A 2GOXB 2H09A 2MG4A 3WODF 1T2KA 2Z1DA 3WTXC 4L9NA 2JN6A 5F0HA 5B1AH 3BCAA 1APLC 4LB5A 3IKVA 5HLIA 3KEQA 2HYJA 4JP0A 4FISA 1X3UA 4EM2A 3GO5A 1A6IA 3G3ZA 1FSEA 3F8BA 3OOUA 2JK3A 1NG6A 2L7KA 2LMDA 3A1YA 3K4KA 4XKVA 3OYJA 1A04A 4X6AJ 5J47A 4D9JA 5IY5H 1YS7A 3B73A 1G4DA 4EVIA 5IOYA 3S1RJ 3Q0VA 4A6EA 1BOAA 4ZYAA 2WTEA 4FCYA 1MMAA 4I0AA 2R7DA 3EUHA 2BVLA 5H2FC 4H0EA 1L0OC 3WGHA 4IPAA 4EM0B 1I1SA 4C3JJ 2LKPA 2LBFA 5FLXZ 5K7HA 3I71A 2F4OB 4Y15A 1ZGAA 1RI7A 4CZZA 3GTJJ 3WTUC 4XOTA 4KIBA 4BS9A 3M1EA 2HQNA 4CUGA 5E3OA 4DOZA 5F0FA 1UB9A 1ETQA 2WADA 3Q3SA 1JKQC 1OLTA 2AXLA 1C0WA 2TDXA 3AG2H 4TV7A 5GP9A 3CUOA 1BN5A 2E5NA 5DTDA 4JOMA 2F5VA 2CV0A 2W24A 1J0RA 2JT1A 1P9QC 3SFZA 1MNMC 1MSFC 1O7FA 3OS0A 2XAFA 3KPHA 4Y4RA 1IUYA 2JMWA 4A93J 2PG4A 3D5RC 3HHHA 2NYXA 1K78B 1LEAA 2DLLA 4EV0A 2O8KA 4RB1A 1HC8A 2X51A 4UXNA 2Z33A 1FT9A 3H3UA 3DEEA 1MDMB 3BTJA 4HYEA 2L7FP 1VTNC 2DDBA 1UHWA 1XN7A 3I59A 5FFZA 4C2MJ 1IJWC 1IZ1A 1LB2A 1K6YA 1MJ9A 1NHAA 3ZMDA 1YLFA 2COMA 5E8GA 1SD4A 2LRDA 3QP6A 5HLGA 2STTA 4Y17A 3ZN0A 2QA4I 4MTDA 2W7NA 2VIXA 2HDDA 4IHTA 2V1UA 3GEZA 1W0UA 2WY7Q 3HUGA 3HOYJ 2HOEA 5IYBJ 3N4MA 2VPLA 1BR4A 1D1BA 3I54A 4A3KJ 2BY3A 2KIQA 5B3SH 3GTMJ 1X3WB 3LWFA 3IAM2 3HOTA 4BGDA 2OCEA 3IRRA 2COBA 2K86A 3GTPJ 5GAHJ 3BG3A 4XSZF 4X0GA 3CCJI 2NXNB 3MVPA 3I9V2 5E1XA 2ZJPF 3GMEA 2UXNA 4V19K 5FD5A 1WWXA 4M9ZA 4QSHA 3OYKA 2QSHX 2L7ZA 3HOWJ 2M34A 3S16J 3NRVA 3GUDA 2WC2A 3ASNH 2TCTA 4IHWA 4OINF 4DBQA 1E2XA 1RPWA 1TBXA 2RREA 3S3NA 1MKMA 3HKZA 1ZAOA 3TP0A 2Y75A 4YEJA 4B09A 5LRSA 3OYAA 2EZHA 1FYKA 2E34A 1V55H 2VBYA 1FSHA 5F1RA 3CUQB 3Q0WA 5LBQA 2DODA 3WGIA 3PSFA 2XROA 2A07F 5IT9K 4E7SA 2XF6A 5J4YA 3SQNA 1UELB 4G6TB 2XSJC 3GLLA 1KU2A 4P55A 2MH2A 2K5CA 4BHBA 2BE5F 2K9SA 4OAYA 4C2UA 3K1NA 3MKWB 3BY6A 4L0ZB 3BG9A 2QYOA 1TWCJ 1X1CA 3JW4A 2QEXI 5F27A 4AD9A 3LSGA 4LLNA 1MBGA 2FX0A 1YJWI 5A2QK 5H6QA 2EA4A 4PSWA 3ZQHA 1U5TC 2CV1A 1UAAA 4BXUA 3CUQC 4FHTA 2DMUA 2E1MC 4AU7A 2AQFA 3Q9VA 3KEYA 1D5VA 2VT3A 4DGWB 4I6ZA 4YG2F 4ZZDA 4XNFA 1YHQI 2E1MB 1ORKA 1W5TA 4G94A 3ML6A 2FEZA 3SEZA 1U5TA 4A0ZA 1JJ8C 3ULQB 3WTZA 3K9TA 2KHMA 4XN0A 4L9JA 2X6WA 1Z05A 1BI0A 2VKHA 1WRJA 3WE2A 4XOPA 3HSFA 2E35A 2GM4A 1RUNA 4BDZA 4L0YB 3GBGA 2DXIA 4U7BA 1ZTRA 1E3PA 2WAEA 4BEHB 4EQQA 1H9TA 3KIOA 3JCUC 1Y0UA 5E17F 2GXGA 3MQ0A 4I7HA 4C9YA 2WAFA 4U0VA 4HBLA 1J7KA 1LEBA 2M8GX 2NVYJ 3O8HA 1S29A 3JR9A 1NK2P 3WU0A 3BCBA 3HRSA 3OWTA 2DT5A 2OZUA 1WHUA 4RM2A 2W25A 2QSFX 1AU7A 3LAPA 2XPUA 1PUEE 3T8TA 4ZTFA 3LSHA 2JRMA 3VSKA 4E7HA 2BV6A 4EM1A 5IP7J 4RS8A 3K2ZA 3DEUA 2NAZA 2LD5A 3QPTA 3S1NJ 3FK6A 1PP7U 3J81K 2FOKA 4DZPA 3G1LA 4K2EA 2HZDA 3HGGA 4DZJA 2GBYA 3F3XA 3LSTA 3Q9SA 4N0BA 5E18F 3OOPA 4G7OF 3M8FA 4A5NA 3BROA 1YTYA 1F4KA 1JUMA 1STZA 4KICA 1GHCA 2DA6A 4XLEA 4HDUA 4EJOA 2DAOA 3E6DA 3HGYA 4ZZLA 4F55A 2BW3B 4A69C 2H6CA 1JT0A 2CQXA 3AG3H 1LJ9A 1S9HA 2DYSH 4L18B 1WJFA 3GVAA 2OTJI 2PI0A 3MCZA 1Z3YA 1P4WA 1VQNI 2V4JC 3F8FA 3TO7A 3HDDA 2L7MP 2EZIA 1CF7B 1YQAA 3DPLC 3CJQB 2VJ5A 2YR2A 4RLQA 4XLCA 2WAQA 3PUFA 3A01A 3OYNA 3KP3A 3K69A 3L7WA 1AHDP 3W6JB 1IRFA 2NVQJ 4BL0B 3BOQA 2TRTA 2O3FA 3QAHA 4E7IA 2KRHA 3BG5A 3J81Z 3FXOA 1Z67A 3TKYA 1ZREA 1ONVA 4QPQA 2HVRA 1FNNA 3TDZC 2KDOA 3F9KA 1QA6A 2VXDA 3JTGA 4D7NA 1G3YA 1BI2A 1UG2A 1JUSA 2R7ZJ 3QYFA 2Y31A 3GWZA 3E1SA 2L2OA 1HKQA 5F08A 3CMAI 2AS5F 1RKWA 2ICWG 1TWFJ 1R4NB 2A6TA 1YW9A 4NNJA 1TW2A 2PEXA 2DYRH 2EK5A 3JREA 3N97A 2ZBKA 3FM5A 4KISA 1S7OA 4AYBA 5CPRB 2L01A 2ZXJA 1TWHJ 3RPUD 5FJ8J 1S6LA 2ZFUA 3WTWC 2ZSHB 1QPIA 2Z2SB 3CO7C 4G9YA 3AFHA 1A36A 1LFBA 3GLXA 3I56I 3I55I 1SAXA 2QZ8A 3FXQA 1S5LC 4ITVA 4ENNA 3R0JA 4PFPA 3DLLF 4LG0A 4ESBA 3P5JA 5DDGA 1MDMA 2XRNA 1PUFB 2E2HJ 4HF1A 1XGMA 4OMZA 2P4WA 3PO3J 3S15J 1O4XA 2LR8A 3S3MA 1OFCX 1KU3A 2DOAA 3GTQJ 4FASD 1OISA 5GTHC 2QBYB 3GX4X 2FOWA 5FRMA 3PFYA 3VOEA 5LD2C 1ZLJA 2MSYA 3S3OA 4Y33A 2ZB9A 1OYWA 4FETA 4A6DA 1H88C 4KYWA 4RAGA 4GYGA 4IHVA 3F72A 5LGUA 5GPAA 2LSOA 2OAZA 3KCCA 3HSRA 4ETSA 4YFNF 2EFNA 3GZNB 3FMQA 4HEA2 2LFBA 4ZDOA 2PJPA 1D0XA 4DYCA 4XN3A 1NG7A 3FMRA 5KVRA 4N4NB 3EYIA 4M73A 2UZKA 1FP2A 2PMUA 5B5EC 4FE7A 4EGYA 1VFCA 2IRFG 2CQKA 2XGCA 3C2GA 1HCRA 2LVSA 4II2A 4AIHA 4OMYA 3ZMSA 2R0QC 2V9KA 1X1PA 1XCBA 3TEDA 2XAQA 1K4SA 2RNGA 3FZVA 4OOIA 2K3FA 2LDUA 2NVUB 2CWEA 1U0JA 3OYIA 1W1WE 5K7ZA 1WGXA 4CA0A 3FHNA 1QZZA 3VEPA 1YX3A 3VYRB 2BXYA 5DUIA 1DP3A 1Z7UA 2GXBA 4PJNA 3DBHB 1KU7A 3S1MJ 4XLPF 3K7AJ 1E0EA 3QP5A 1FMVA 1VZ0A 1X3ZB 2VOPA 2AQEA 5FKOA 3BTLA 4NDLA 4M3GA 1KYWA 3PL8A 3ECHA 5JLXA 3RZDJ 1LQ1A 3DEWA 1U5TB 3MZYA 1MSEC 2DA1A 2KFDA 2EZKA 1D1AA 5ICGA 1J5YA 3RYRA 2EIMH 4IZZA 3SYTA 4XQFA 2DOEA 3HRMA 2E36A 3SZGA 3H5AA 4HPQA 1TWGJ 4EMSA 3K2AA 5HODA 2FA5A 3OR2C 5IPAA 1R9TJ 2Y9YA 1IO2A 1R1UA 2P7VB 3V8LA 2YSRA 5DCFA 3EQLF 4KNYA 2P0WA 2K40A 1ZGJA 4GYIA 4E7KA 1ETVA 2OZ6A 2NVXJ 2ECBA 2R7QA 5CJ9A 4F7ZA 1OCPA 4PFOA 2K7LA 2O5RA 2M7AA 3OYCA 3BR0A 4A3JJ 4CCNA 2BXZA 3HOZJ 2L9RA 1ZG5A 3PJRA 2DO7A 3JSOA 3A02A 1SFOJ 2WA0A 3M7GA 5HDGA 5DUKA 2DA7A 1BC7C 2MW8A 2PX9A 1Y8QB 1QHGA 4GO1A 2JA7J 2EZLA 4E70A 4I76A 2O03A 3FKJA 3IP4B 2M1BA 2RNJA 4YFKF 2FJ1A 2XPVA 2AO9A 4OAZA 2WV0A 2HTJA 1QHHD 4N4OB 5D5XB 5B1BH 4J00A 2DT6A 3FXMA 2DMNA 3LA2A 1IN5A 5ERIA 1P7IA 4UUSA 1LE8A 2HXIA 3WHBA 5H20A 1LVAA 2CW8A 3JRAA 1FTZA 3QODA 2D1HA 1SVOA 3PQKA 3U9GA 4WXCA 2XSDC 2Z9OA 1B4AA 5HDNA 4D5CA 2YPRA 2LNBA 3G6EI 3G73A 2OUMA 3BT9A 1J59A 2IS2A 3TW6A 1WJDA 1YX5A 3DKXA 2ELKA 4WK8F 2ISYA 1IG7A 2STWA 3CC7I 1POGA 2IVMA 3V42A 2B9SA 1XCVA 3D0SA 1N25A 3FMSA 2DW4A 2MC3A 2GOMA 1BJZA 2V1DA 3FKIJ 2F5EA 4BE1A 3AG1H 2RGVA 4L5EA 3AKZA 2D1VA 3Q5FA 2O61A 1ON1A 2X85A 4JYKA 4WWCA 5TJJA 3S8PA 2MD0A 3RTRA 4D7MA 3IKTA 3KP7A 3LSMA 3JRGA 3K1PA 2KKOA 3ERMA 2BBYA 3WU2C 4A0YA 1ZR4A 3V7SA 1ON2A 3GFIA 3ZQ7A 3HOVJ 2FMYA 1Z6TA 1XSDA 1SAUA 4LGWA 3E6CC 2E71A 3P9IA 2VBZA 3FX3A 1TQPA 4I01A 3HXLA 4KIFA 1R23A 3KP6A 5GTIC 5FGMA 2QKLB 3EYYA 4BQAA 1Y0NA 3PSIA 1XMKA 1XS9A 3GZ5A 2PMZN 3REOA 3OL3A 3E7LA 4XRSA 1FYLA 4DBRA 4P96A 3G2BA 3T1BA 5KCMA 4IQ4A 1QPMA 5J3LA 2ADUA 2GLOA 1QRYA 3RSNA 2K9MA 3MD2A 1KZHA 2DOFA 4ZJZA 1KYZA 4AIJA 4B8XA 2ZMEA 3AG4H 3S2WA 5J8CA 1X19A 4AUXA 2OBPA 1TP4A 3I4PA 2XVCA 2X1DA 3JRBA 2L3DA 2ZO4A 3H92A 1VQ6I 1ZHFA 2LC2A 4C3IJ 2XAHA 3J7AO 2L9SA 1FIAA 4U0WA 2Q1ZB 3KE2A 4YIFA 4CYCA 2GWRA 4XICA 2HOTA 2GIVA 2L9NA 4KIGA 4II3A 1ZKGA 4BAYA 2QSGX 5TISC 1ZG1A 1XC5A 4A3EJ 4ASNA 3E5QA 3LOCA 1B72A 4FT8A 1Z7LA 1YYVA 2R5YB 3A4CA 1EJ9A 1BR2A 1X1DA 3FXJA 2HFHA 1XG1A 5E79C 2IS4A 3G71I 2H27A 4UUVA 4HSTA 3IV5A 4P5OA 5L3BA 5D4SA 3F8NA 1P2FA 2M4KA 3S32A 1IN8A 2FBHA 4KN4X 3OSGA 3VPRA 5FD6A 5LHHA 2IA0A 4M9SA 4R8HA 1MBJA 4D0PA 1Y6IA 3AAFA 1W0TA 3TO9A 4H4KC 2UWMA 3O2PE 3KP5A 5CVIA 3RKYA 4FTHA 2LKSA 4P9UA 3W6VA 1IUFA 4CGZA 4BXFA 2H6BA 3PO2J 1I39A 5FKKA 2FUG2 2D2WA 5AIPA 4A3GJ 1BW5A 4HX4A 3BZKA 2W85A 1LNWA 2WY8Q 4LLLA 4B4CA 3DBLB 2D45A 1FJLA 1NH3A 3ZQLA 2A5YB 3OS1A 4BY1J 2VQCA 4ENKA 5D5VB 4G6DA 1SC7A 3CCQI 2BHZA 4XMYA 2LY9A 1JKPC 3D5SC 2XF7A 5EJCA 2MGQA 1T33A 4EGZA 1ETOA 4A3DJ 2JA2A 3I58A 2CJJA 2WWYA 3NWSA 2X1EA 1K4TA 4M3DA 4KFCA 2Q2EA 1B9MA 2VC1A 2B0LA 5FLXK 2EBIA 3FHZA 3EPZA 4DW6A 5IYCJ 3LAJA 2VC0A 2IGKA 5J1YA 1RC9A 5HLTA 4OIRF 3M9AA 1KA8A 4CSWA 3CCLI 2RDPA 5LGTA 3KYLA 2CQQA 4ESFA 1FP1D 2L9VA 4DNCA 2AHQA 2IXSA 2E2JJ 3JRFA 1OPCA 3PNVA 4CCKA 2VB6A 4BJTA 3LMMA 1YJNI 3EDPA 2LF8A 3BZ6A 1VQPI 1E3HA 2V9PA 1Z21A 3CZ6A 4UV9A 4LK1F 4D1QA 4RB3C 2R7SA 5FROA 2K3PA 2MYSA 1VQOI 1X2MA 2Y2ZA 4IOCF 1I6XA 4O5VA 3ZQGA 5ILVA 4BNCA 3DTIA 4AIDA 2ELJA 1U8RA 4XKBA 4EJUA 4M3EA 5EZGA 2C6YA 3W2WA 1KGSA 2CRGA 1K7AA 3MZ8A 1VF9A 4BY7J 1SD6A 1HDPA 5HNHA 4IKFA 1XSXA 4BQQA 2JA5J 3SJMA 3JRCA 1R5GA 2WB1N 3BTCA 3HBLA 2HNHA 3HSEA 2ELHA 4MO7A 2R5ZA 2HYGD 3K0LA 4ZC3A 5D6FA 3RI4A 2ZXHA 4HQMA 3C18A 4LIVA 2K4JA 1ETXA 2KJBA 4GRIA 3L2UA 3V7CA 1O7LA 4BBSJ 4MGRA 4BU2A 3FF5A 1G3WA 2P5VA 2KPMA 1GVDA 1XMXA 2EIKH 3TBIA 4EJVA 1IC8A 4MFDA 4IQJA 4CYDA 5HLHA 4YIRX 1LDKB 5CKTA 2HGCA 1QO0D 1X4OA 5J4VA 1VQKI 4IXAA 5EEHA 1I6HJ 5C4XJ 1USTA 2K9LA 2L5QA 3SDBA 1W4MA 2L54A 2O9LA 1X2NA 3GF2A 4M6YA 3WTTC 2XKOA 2A5WA 2ID3A 3OL4A 1MJBA 2IPQX 3A0BC 1I27A 3CCMI 1B8IA 3DU5A 5LEKA 2ESNA 2R7VA 5CYVA 1OCZH 2H1KA 4BE2A 1H9GA 2EB7A 1YFHA 3ABUA 3M8EA 2JVGA 1HKTA 2YS9A 3T5XA 1GDTA 2Z5UA 2Y48A 3DCFA 2L02A 3SFIA 5IT9Z 1U2WA 2EWNA 1WJEA 4RA2A 2OD5A 3AL0B 2EIJH 3NWTA 2KLOA 1D8JA 5ILSA 1W36D 3F21A 1DGWY 1U6GA 3H0GJ 5FO5A 2V9VA 5J1RA 1D3YA 1ZG3A 2XB5A 1N75A 3FWEA 5FB2A 4DQ2A 5DEQA 2JJ7A 1KQ0A 5A2QZ 3B6AA 3LSKA 2ID6A 1IXCA 4I99C 4BYYA 5KK1A 5LLQA 3KLOA 3CLQA 1UZCA 4B47A 4ENMA 1R5HA 2VBWA 2NOGA 4IX7A 3GCMA 3C7JA 2N8GA 2A05A 1J75A 5HNFA 3TOBA 1U9OA 2E5ZA 2PLYA 5F1JA 2E7WA 4HA8A 4KA4A 3L2RA 2O7OA 5KHDA 5FKNA 3TW7A 3RCOA 4Q5SF 5BPDA 4LIUA 1BR1A 3BR6A 4MTEA 5E3NA 2E2IJ 2JSPA 1XSVA 2VN2A 2A68F 4PCQA 1IN7A 4G7ZF 3TOAA 1X1BA 4BDYA 2KZVA 2Z3YA 1P4XA 2HZTA 1MMNA 1ZELA 3DXJF 2DA4A 2YX7A 5KAIC 1FY7A 4MIMA 1S3JA 3FXKA 1WKMA 4ANJA 1QQIA 2DA3A 2L4MA 4XLFA 1IAWA 3CESA 4UV8A 3H9GA 3K70C 1JJ6C 2ZFWA 1GXPA 2F48A 3ZGKA 4B1RA 4XRFA 1P4AA 1V5FA 2A69F 4CHUA 3VYTB 3ZOBA 1U78A 2CQ7A 3A03A 2JUGA 3OIOA 2VQLA 2M8EA 2K85A 3OYBA 2Y0SA 2HOAA 4M9XA 1T39A 2A6EF 3G1MA 4B44A 2IA1A 2VI6A 4YRVA 3S2HJ 4NB5A 2E19A 4HLYA 3FBNB 4Y13A 2F4IA 2NNYA 2CH0A 1OKRA 5J8FA 2X6YA 4KMUX 5LGNA 5FLMJ 2FD5A 4XIDA 1DP7P 3RIRA 4U7DA 1MNEA 2BVMA 4M6XA 4M71A 2GA1A 4HV5A 4CO8A 2YU3A 3UR3C 1IF1A 1QVTA 4Y7NJ 2QKMB 5GAEJ 3F6VA 3WG9A 1YS6A 3BWGA 5HS8A 5CLSA 1UFMA 5K5RA 1WJBA 1D8KA 3HYIA 1ZYRF 1RESA 2CW7A 1E3OC 5C3EJ 2NS0A 4P9FA 4F92B 3F0CA 2VE9A 3E3VA 1FX7A 4LFUA 3J7AY 1NK3P 2DA5A 4BQOA 3ZPLA 2QQBA 2VJIA 4UB8C 3QPHA 2HDWA 1EH8A 2G7UA 4RLFA 4BKXA 4IF4A 5KNLA 2L0KA 3LSPA 2M3AA 2ZC2A 5CVJA 1W36C 4UNOA 1IDYA 3NAUA 5L3DA 2ZNYA 1TNSA 2EPFA 1XGNA 1PP8F 1MH4A 3EUAA 2ZJRF 3RDIA 1OJLA 4ZYGA 2P5LC 3T0YA 2ISZA 3P7NA 2H8WA 1BJAA 4WXDA 2W00A 1DUXC 3ISPA 2DJNA 1PVEA 2W1OA 3L00A 5BOXA 3PUBA 3HL2A 3COAC 3LSJA 3H9JA 1JI8A 3KZIC 3RKQA 1OYIA 1T0FC 3KP2A 3WU1B 2FXAA 3CO6C 4HF2A 1HA8A 3FIWA 4MQ9F 3X2QH 5JVTA 3BR1A 1B59A 3ZRGA 5C44J 2JUCA 3FXRA 3CMYA 4OIOF 2JTVA 2J5PA 3RPQA 2W48A 5D5UB 3SZPA 3GFLA 2XASA 2JQ7A 2CUEA 1T08B 2V6CA 4IVNA 4CCJA 5GAGJ 1I3QJ 4BHCA 2E1CA 3ABMH 2LY1A 2EFPA 2DK5A 2EFQA 4QPOA 4XRMA 1A35A 4Q47A 2PMHA 3FK7A 3HRUA 1RR7A 2Y30A 3JTHA 1HBXG 1FIPA 5LEJA 1MH3A 2I10A 2L4AA 4HF0A 2OQGA 4HSRA 4P1WA 2V1XA 4HV6A 5EGOA 4PJLA 1MGTA 2HQAA 4AVZA 1FOKA 1O57A 3F23A 4LJZF 2IEKA 1K83J 1AWCA 3GZ6A 2XKPA 1OR7C 4FQGA 1H8AC 3KX2A 1JGSA 3FM3A 4Y52J 3TO6A 5M3MJ 3H5NA 1LFUP 2HOSA 4G12A 5IOZA 1P92A 4A3LJ 2LOOA 5K7FA 4PJ0C 4S04A 1T38A 1T95A 3H9QA 4U87A 2R7FA 5B66C 2Y0MA 4XKWA 4KDPA 1YITI 3TL4X 1Y1WJ 2YX4A 2EH3A 2ESHA 1YRNB 3DU6A 4RGSA 1WQ2A 5D8LB 3QU3A 5EDNA 2ZNZA 5HS9A 1F5TA 2CGPA 3CCYA 1P6RA 2RQQA 1F43A 1OMIA 4RBOA 2EILH 5BQTA 4XR6A 5CQGA 1FWZA 2E7XA 4CDGA 3WTYC 3SXYA 1HQCA 1SANA 1GT0C 2IAIA 1YO5C 1RUOA 1TT0A 3GFJA 1XPXA 2HI3A 2PQ8A 1JGGA 1AOYA 1GLNA 2MABA 4LG0B 4KITB 4LB6B 2A61A 2KIFA 4F93B 3DV8A 1HOMA 1Z0XA 4HNVA 1FLIA 3V7RA 3IH3A 4RAZA 3BJAA 2P7CB 1R7JA 2XAGA 2HYFA 2JPCA 2LY2A 1QU3A 2ZMEB 1G8XA 3W3CA 1JTYA 3HPHA 2RVCA 3QPSA 5CVUA 1YJ9I 5IYDJ 2H1LA 1XGSA 3RKWA 3GYHX 1WCMJ 4HNTA 2NVTJ 2OTLI 2WV1A 3U21A 5IP6A 3H3VK 2LK2A 2O8XA 4NC7A 1MZBA 4E6KG 3OIPA 2QGUA 1H89C 1X4PA 2EFWA 4HNUA 5DM7F 3W6KB 3HUGB 1ULYA 2HR3A 4IRHA 3CF2A 1GXQA 2M87A 2M0CA 3BQZA 4B48A 3OYHA 3B6CA 1ZRCA 2JA8J 2OA4A 4IO9F 5K5QA 2IT0A 4YFXF 4GCVA 2GA2A 3L9FA 2IGOA 1RRJA 1G2HA 5M5XJ 5LRRA 3WHCA 2PJRB 1TC3C 2XGEA 2CQNA 2R5ZB 1SVMA 4HX8A 3IRQA 3RQ4A 2DN0A 1EA3A 4HRIA 3IUOA 1TQMA 3ZCOA 1U3EM 3KETA 3CJNA 4N9IA 2GQQA 3VB2A 3LL7A 2X9DA 1ZRFA 3HKZN 1RZ4A 1G3SA 1Y56A 1X58A 3O6BB 3JAMK 2G7HA 2O6GE 1OR7A 1I50J 1XDSA 2DT7B 1VQ9I 4RAFA 2CV2A 3CJRB 3ECOA 1OYYA 1MMDA 4CZCA 1B8IB 3HIFA 5ICEA 4MQVA 3ABLH 3ZMUA 2ME0A 1JXSA 3DTKA 3HM5A 2CUJA 2OC6A 3BQYA 1TNTA 3CMMA 1FBSA 3K4NA 2B7EA 1QGPA 3BG6A 3OS2A 1K79A 3IH4A 1DPUA 1FZPB 5LFAA 1FTTA 2XAUA 1IGNA 3KLNA 5F6FA 3VWBA 2ZXIA 4LMYA 2QENA 3C3WA 2GAUA 3BJOA 1H0MA 3QYBA 1FBQA 2VXZA 2HDCA 2DFHA 1IRXA 2PBIA 4GXOA 4UVAA 2P6SA 3SDGA 4BH9A 1QZYA 2OU2A 3I0TA 3BR5A 3DKYA 1Q1VA 4CCLA 4HDVA 1A5JA 5E1WA 4S0HB 3WE3A 4W97A 1EKEA 2W82A 1O3QA 1YE9A 2M4GA 4L9VA 4EJTA 3I4MJ 5FFXA 2FBKA 2R92J 5F04A 2VKVA 2CUZA 4KT5C 1W7PA 4MHGA 1I3AA 3QU6A 3LFUA 3V4GA 1AKHB 2JA6J 3D1NI 4CICA 4KT6A 5JHUA 3GW2A 1ETYA 1ENHA 2WAQN 3MKLA 1DU0A 1IW7F 4RAYA 3WGGA 3CUQA 4BHPA 4EEFG 2FE3A 1M1EB 3ABKH 4NUBA 2ACJA 2ZMEC 3UNGC 2R4GA 1O3SA 3PM1A 1L3LA 2VONA 3LQRA 1K6OA 4WF2A 3CCUI 3V8JA 3DPUA 4LK0F 2MLKA 1PYVA 3ROUA 1D0YA 3IWFA 2R7RA 2DMTA 2ECCA 2D5VA 2DCEA 3DP7A 2VE8A 4FX0A 1R49A 1D5YA 4W1UA 2NS8A 1W5CC 4PK4A 3BG7A 1SFEA 3DTEA 3MEXA 2R3SA 1TW3A 4B3XA 4JK1X 4HAMA 1V4RA 1MBHA 1HW5A 2F2EA 3ZQFA 1T8IA 1CF7A 1T0FA 5D8KB 2LG4A 2NNNA 1REPC 1MMGA 5BNGA 2Z99A 5DD4A 1MNDA 3HB9A 3QYEA 1DDNA 1MJAA 3PNTA 2DQRA 1ERDA 2CFOA 3H35A 3KZZA 5D6EA 1SFXA 5K5OA 2BY1A 1OCTC 2GZWA 3D5LA 4G8XA 3CCEI 1SD5A 4U0YA 2ZXWH 4ZDPA 3MMYB 3ZN1A 3HC7A 1DU6A 3HRTA 4CCOA 4LOCA 3MAJA 1WH5A 2HPMA 4S05A 2IBDA 2CFXA 4JX6A 2W4SA 1ETKA 5F0CA 2W84A 4I98B 1Z77A 3K1MA 2CS3A 4D5FA 2LBFB 1HSTA 3ZXSA 2DPUA 2M0MA 4I0BA 3H1CA 4OU0A 2CG4A 5DV5A 2HU9A 3K4LA 5DS9A 2UV1A 2DA2A 3OYMA 1EV7A 3ZMZA 2ZJQF 1BC8C 1VI0A 2E60A 1ZARA 4C3HJ 2I8DA 2BZTA 4CCMA 1YRNA 5M5WJ 2OQRA 3GTOJ 4LG3A 2DU9A 4L9TA 2CU7A 4IEJA 4LITA 1DPRA 1FPQA 1Q1HA 2VODA 3CTAA 2HEOA 1BBYA 4RGXA 4RGUA 3Q0UA 4AC0A 3ZMTA 3UKGA 4XLAA 5IT3A 2FQ4A 3HJEA 2X4HA 3PFIA 1J09A 2JWTA 2LH9A 2BY2A 2FBIA 2RN7A 1QVUA 2DMPA 4PJMA 2FQ3A 2ZCWA 1ZH5A 3NARA 1WH7A 1XDUA 3EUHC 1VQMI 3F8MA 1HF0A 2PN6A 4IOAF 2A3SA 3JRIA 3K10A 3BP8A 1ZN2A 2CW0F 1MW7A 2DBBA 3TDUC 2IP2A 4WX9A 1U8BA 1A31A 3HG9A 1BOBA 1YOVB 4XBFA 5FLVA 1G59A 4AYBN 3DF8A 1O3TA 2JSCA 1FBUA 2VKEA 1YG2A 5ICCA 1VNDA 2BYVE 3CJTB 2VASA 4XSXF 3MZHA 3LFKA 4KUMA 5K1YA 3HHGA 4GFBA 1AA7A 1LFPA 1QZEA 2Q2EB 2VKDA 4IRIA 1R5ID 1IRZA 3F8CA 2E1OA 1OQYA 4DYRA 1Z9CA 2G0EA 3R0AA 4RB2C 1D1CA 2EFOA 4RB0A 3LA7A 4NBQA 3QPLA 2QUFA 5BMZA 3R4KA 2HXOA 3QWLA 5KAFC 5L3FA 1YIOA 4PGHA 3R60A 3BZCA 2ETHA 2R7WA 4O6JA 3A01B 3CMEI 3IHUA 6PAXA 5J6XA 1V5EA 2QCOA 4UVBA 2DDAA 2Z16A 5D4RA 2Q0OA 1F36A 1BM9A 4M6VA 3OMYA 2KQRA 2HQ5A 5EZHA 2EJRA 1F1ZA 5C4JJ 4LD5A 5HOOA 1T98A 3SZTA 4AIKA 4L5JA 3O3KA 2R7UA 1UG0A 2V26A 3LSIA 4A3MJ 1WVRA 2P6TA 5TGTA 3E6MA 4I09A 2H94A 3C2HA 4Y3OA 3U1KA 1RR8C 1T56A 2DQLA 3KFWX 1B6AA 2EA2A 5JLWA 4ZYEA 2R7TA 2KIMA 1IRGA 3R61A 5IP9J 3BTIA 4IRGA 2QQAA 4DIQA 2R5YA 2LLKA 3OV8A 4FE4A 2VBXA 4E4HA 3DWLE 2XUBA 2DI3A 1BIAA 4A5MA 4HZFA 1HW2A 3TP3A 2VJJA 2V7FA 3E6BA 4IL6C 4JX4A 4JQFA 3A0HC 3PNYA 3VYUB 1VQLI 2GXAA 1ETWA 3LNQA 2DTZA 1IN4A 2P5KA 3ONQA 3CCSI 4BE0A 3KP4A 4NC8A 2VOOA 1ODDA 3EUKL 3GXOA 2QQ9A 3GTLJ 1MBKA 5JI6A 1RETA 3KZYA 1IDZA 2FNAA 3WTSC 3MKYB 3VODA 1LVKA 1HXDA 2X48A 3P9CA 1TQIA 2K9QA 3S14J 2DK8A 4M3BA 4E7JA 2YU9J 1BI3A 3I3LA 2I5UA 5HDKA 2PMZA 1ZK8A 4UUTA 1NTCA 2F5FA 3CF5F 2M2EA 2AXTC 4GDFA 3H36A 4YIIA 4MFEA 2B63J 1V5GA 1WJCA 5JR3A 1OCOH 2P8TA 2HPIA 3PIPF 3K4CA 4G6QA 2XHKA 4PDKA 4RM3A 1LDJA 5DM6F 1J9IA 4XK4A 4HG2A 1QBJA 2EV6A 2FU4A 1IXRC 1ITYA 5AIQA 4MEXF 1LPQA 2V6EA 4PUSA 3M07A 4FX4A 3U2RA 4WCGA 2X1CA 3L2VA 1HDDC 1G3TA 2G9WA 4EATA 3OYLA 5J40A 3I5UA 2OJED 2V1NA 4E7LA 4NHJA 1WPKA 3I4NJ 2Y0SN 5ILUA 1S8NA 2JZYA 3OYFA 3ZMVA 2QWWA 3V8KA 1QNTA 1VQ7I 3M8JA 5EG0A 1SMTA 1PJRA 2R7OA 3H0DA 5CVVA 4IHYA 2Y9ZA 5JVGF 2F5CA 3S17J 2NOJB 3CLOA 1UMQA 3R6SA 3K6GA 1CGPA 1VQ8I 1XD7A 4Q4ZF 1KU9A 3I64A 3J7YJ 3KEOA 2Q8KA 4MLOA 2MA3A 4V2FA 4DYQA 4XONA 1TWAJ 3OR1C 1DGRM 2F5DA 1FYMA 5LHIA 1BI1A 5EGOB 2NRAC 4Z6YA 5L3GA 5J1UA 1R58A 3LQQA 2KT0A 2XRLA 4A3BJ 3QOPA 2UUZA 1IV8A 1UCRA 3L09A 2KRFA 3GTKJ 3S93A 1Z6RA 2XAJA 2KRCA 1ZQ3P 4F91B 1E17A 4JBAA 3W2VA 2FNPA 2NS7A 2PFBA 1TL8A 2KISA 3JSPA 1USSA 3ELKA 3ZQIA 2DFIA 2QQ8A 4UVCA 3HEFA 1WJ5A 1IN6A 5AONA 3ZR8X 1Y8RB 3DBRB 5ED4A 1R1VA 5HS7A 2EINH 2GIZA 1EF4A 2J5OA 2M5WA 5FRNA 4XRSG 3ERED 4B3AA 2M30A 3ASOH 1KQ9A 2QLZA 3P9KA 3RQIA 1FC3A 1LKXA 1XX5A 1O3RA 3E5UA 4HW0A 4I02A 3A2KA 1RKTA 3T8RA 3RPUA 2BOLA 4AM3A 1TLHB 4M3FA 3F6OA 1XTAA 1YW7A 3L1PA 4OIQF 3IH2A 2BY0A 2BGCA 1JUPA 5CVRA 3F22A 3VSLA 4Q48A 3MN2A 1G6NA 2F4MB 3PIOF 4J01A 3J7ZI 3HTUA 4XLNF 3E97A 4R79A 2HKOA 2EV5A 4UB6C 1WJAA 1UHSA 1HLVA 4LLGF 2RKHA 4NQWB 2M45A 4QTRA 2VL8A 3OYEA 1N78A 4GGGA 1JKOC 1B9NA 3CQZJ 1ZRDA 3GFMA 1WI9A 4M72A 4XL9A 2CYYA 2O0YA 3PQJA 3QRFF 1YIJI 4CXFA 2IA2A 1EH7A 4ENJA 2IS6A 1A6QA 1ACIA 3HOUJ 4C30A 2JVHA 5F64A 3M3YJ 1SVLA 1XGOA 3DLAA 4HLXA 3L2CA 3JRHA 1BIBA 3H3ZA 3HPGA 2VUMJ 4A3IJ 4I2OA 4UHTA 4L5IA 4WXHA 3HOXJ 2DPDA 1MMSA 2VQHA 3CC4I 1R36A 2DTRA 5D5WB 1Z91A 2KDZA 4M74A 1UJ8A 1S7EA 3RZOJ 3RYPA 3S1QJ 1K78A 1FOYA 3DFGA 1GV5A 4JX5A 1GV2A 1LDDA 1MBFA 1GVJA 3N05A 2RAEA 1I5ZA 2K4BA 4ON0A 3JAMZ 2KMUA 5BS6A 2R7XA 3ZQQA 1S7AA 1Y1VJ 2LTPA 2X6XA 1R1TA 4A3FJ 3DKWA 4ZH4F 1K61A 5GPCA 2UXXA 3RKXA 3TQNA 4ABZA 3S2DJ 2IS1A 2MC4A 2MD5A 2X0LA 2LREA 2K9NA 3MFKA 4EJWA 5E8IA 1ZR2A 3CDIA 1ZGWA 4A12A 4F3QA 1VQ5I 4C2TA 2VPRA 5M3FJ 5FKLA 3L2QA 2IGMA 1OCRH 1TZLA 1AKHA 2LF7A 3I53A 4B43A 3EETA 2MH9A 2W57A 3OIQA 5FKMA 4DJAA 1WI3A 4MNUA 2XB0X 2WB1A 3FXUA 2DMQA 4ZYHA 2HWVA 4CH7A 3SHFA 1XB4A 3BR2A 3KYCB 3SEQA 4BUPA 3CCRI 1R22A 3K4JA 1JHFA 2OF7A 3VDXA 2WBMA 5ICFA 4QWQA 2XPWA 1CQTA 4O3MA 1U9NA 2P81A 4BBRJ 3ZP5A 4XORA 4BXXJ 5L3CA 1SEUA 2K02A 1BL0A 1IV6A 4BJ5C 5JHFA 1WFXA 3L2WA 4A3CJ 3ZQCA 1Z3XA 2RC4A 4N9HA 4HQEA 4KN7X 1KONA 4A2UA 3ABTA 4IHSA 1IXSB 4XLHA 4KJZA 2VQGA 4U88A 3BPVA 1B1BA 4G7HF 2XV4S 3O8GA 3CP2A 3CDHA 1EH6A 4X1EA 3J80K 2VLAA 2CMPA 3B02A 2K27A 4XM3A 1SFKA 4RDUA 1FOXA 2DFEA 3FDYA
chains in the Genus database with same CATH topology
1MBEA 3CDLA 1OCTC 3HDDA 1GVDA 1IC8A 2H8RA 5E3MA 4MFDA 2LKXA 2L7MP 2EZIA 1JT6A 1DU6A 4LOCA 1I6HJ 5C4XJ 3A01A 3G1OA 2O9LA 1WH5A 1X2NA 2IBDA 1AHDP 2ID3A 4JX6A 1ETKA 2NVQJ 5F0CA 2TRTA 1Z77A 4D5FA 3BG5A 1B8IA 2EQRA 1BA5A 5DS9A 3GTGJ 4D7NA 3OSFA 3C2BA 1UG2A 2DA2A 2R93J 1JUSA 2R7ZJ 2H1KA 2Y31A 5F08A 1VI0A 1RKWA 1B72B 1TWFJ 4C3HJ 2YS9A 1GDTA 3DCFA 3JREA 2YUSA 3SFIA 5M5WJ 5EYRA 1YRNA 3LSRA 3GTOJ 3BR3A 2CU7A 4IEJA 1TWHJ 5FJ8J 3JRDA 1QPIA 3Q0UA 4AC0A 3H0GJ 3UKGA 1LFBA 2FQ4A 5J1RA 5EG0B 2JWTA 2XB5A 4IHXA 2JJ7A 1JTXA 1QVUA 2DMPA 3B6AA 1PUFB 2ID6A 2E2HJ 3NARA 1WH7A 3PO3J 3S15J 1O4XA 2LR8A 1HF0A 1OFCX 3GTQJ 3JRIA 1PUFA 2OPTA 2NOGA 1U8BA 2N8GA 2X6OA 2LP0A 3QQAA 5FLVA 4V2GA 1U9OA 4AYBN 1GUUA 5F1JA 2MSYA 2VKEA 2ZB9A 2QF7A 1H88C 1VNDA 2O7OA 2ME6A 4GFBA 4IHVA 5EF6A 5FKNA 3TW7A 5GPAA 3BR6A 5M5YJ 5E3NA 1IRZA 2LFBA 2E1OA 4DYRA 2E2IJ 2G0EA 4DYCA 1P7JA 3M4OJ 3QPLA 2HXOA 4FE7A 1VFCA 2DA4A 3A01B 4MIMA 2M9HA 3FISA 2XGCA 5EEAA 1HCRA 2LVSA 2DA3A 1JJ6C 2R0QC 1BW6A 2QCOA 3TEDA 4B1RA 1F36A 4M6VA 2HQ5A 3ZOBA 5EZHA 1U78A 3A03A 5C4JJ 3OIOA 5K7ZA 1WGXA 2XGDA 2HOAA 4A3MJ 3G1MA 3S1MJ 1JKRC 3K7AJ 2VI6A 3S2HJ 5FKOA 3BTLA 4NDLA 2E19A 4M3GA 1T56A 3RZDJ 5JLXA 3DEWA 5JLWA 1MSEC 2DA1A 2EZKA 1FEXA 5IP9J 3BTIA 5FLMJ 2FD5A 4XIDA 4CYCB 4J19A 2R5YA 2LLKA 4FE4A 1QVTA 1TWGJ 4Y7NJ 3TP3A 3K2AA 4QIWN 5HODA 2CUFA 5IPAA 4UUSB 1LE8B 9ANTA 1R9TJ 2Y9YA 4JX4A 5E3LA 1RESA 1E3OC 1ETWA 2K40A 2MG4A 5C3EJ 3LNQA 2DTZA 1ETVA 3F0CA 2ECBA 2NVXJ 2JN6A 5F0HA 1OCPA 1APLC 1NK3P 3GTLJ 1MBKA 2DA5A 1RETA 1IDZA 4A3JJ 2HYJA 3BR0A 4FISA 4JP0A 1A6IA 2X48A 3HOZJ 2L9RA 3OOUA 2JK3A 4BKXA 2K9QA 3S14J 4X6AJ 2L0KA 3A02A 4M3BA 1SFOJ 3LSPA 2YU9J 1ZK8A 4UUTA 1IDYA 3NAUA 2DA7A 5IOYA 1NTCA 3Q0VA 2MW8A 3S1RJ 1MH4A 2JA7J 2EZLA 2M2EA 1OJLA 4I76A 4FCYA 4MFEA 2B63J 2DJNA 2FJ1A 2XPVA 2AO9A 3LSJA 4C3JJ 3RKQA 5K7HA 4XK4A 2DMNA 3GTJJ 3FIWA 1ITYA 1P7IA 4UUSA 3BR1A 2HXIA 1LE8A 5C44J 3WHBA 3CMYA 5E3OA 3JRAA 1HDDC 1FTZA 2W48A 5F0FA 1ETQA 1WPKA 3Q3SA 2Y0SN 1JKQC 2CUEA 3I4NJ 2XSDC 1I3QJ 5GP9A 4D5CA 5EG0A 3BT9A 5DTDA 4XRMA 3TW6A 3FK7A 1RR7A 2Y30A 1FIPA 1MH3A 1MNMC 1MSFC 2ELKA 2I10A 4IHYA 1IG7A 1POGA 2Y9ZA 5EGOA 3S17J 1UMQA 2JMWA 4A93J 1BJZA 3FKIJ 2O8KA 2IEKA 1K83J 4MLOA 3BTJA 4V2FA 1H8AC 4DYQA 4L5EA 1TWAJ 4Y52J 5M3MJ 2L7FP 4JYKA 1IJWC 4C2MJ 5EGOB 1LFUP 4D7MA 5J1UA 4G12A 5IOZA 3JRGA 2HOSA 2KT0A 2XRLA 4A3LJ 5K7FA 4A3BJ 1ZR4A 3GTKJ 3HOVJ 1ZQ3P 1Y1WJ 2HDDA 2EH3A 1YRNB 1W0UA 3HOYJ 2NS7A 5EDNA 5IYBJ 3CCYA 3ZQIA 1F43A 4RBOA 4A3KJ 3HEFA 1XS9A 3GTMJ 2PMZN 3E7LA 1SANA 1GT0C 2IAIA 4XRSA 2COBA 3GTPJ 2HI3A 1EF4A 3BG3A 1JGGA 5J3LA 3MVPA 2GLOA 1QRYA 4XRSG 4B3AA 1HOMA 4QSHA 1Z0XA 4HNVA 2L7ZA 3RQIA 3HOWJ 2M34A 4AUXA 3S16J 3IH3A 1RKTA 3JRBA 4M3FA 2TCTA 4IHWA 4C3IJ 3L1PA 1RPWA 3IH2A 1JUPA 1JTYA 5IYDJ 1FIAA 3QPSA 1WCMJ 3TP0A 2NVTJ 3MN2A 4CYCA 2WV1A 4XICA 2HOTA 5IP6A 3H3VK 2LK2A 2EZHA 1UHSA 1HLVA 4QTRA 3Q0WA 1H89C 1ZKGA 1JKOC 1XC5A 3CQZJ 4A3EJ 3LOCA 2M0CA 3BQZA 1B72A 3B6CA 2R5YB 1XG1A 2JA8J 2K9SA 3HOUJ 3IV5A 3M3YJ 3BG9A 1TWCJ 3JRHA 2VUMJ 5F27A 3LSGA 4A3IJ 1MBGA 2FX0A 1G2HA 5M5XJ 3OSGA 3VPRA 3WHCA 3ZQHA 1TC3C 2XGEA 3HOXJ 2R5ZB 1MBJA 1W0TA 2DN0A 2DMUA 2KDZA 4FTHA 1S7EA 3RZOJ 3W6VA 1IUFA 2X9DA 3S1QJ 4I6ZA 3HKZN 3PO2J 1GV5A 1X58A 5FKKA 4A3GJ 4JX5A 1GV2A 1I50J 1BW5A 1MBFA 1B8IB 2RAEA 4B4CA 1FJLA 1ORKA 3ZQLA 1Y1VJ 2LTPA 4BY1J 2ME0A 4A3FJ 2LY9A 3HM5A 1K61A 1JJ8C 1JKPC 3BQYA 5GPCA 2MGQA 1T33A 1ETOA 4ABZA 4A3DJ 3IH4A 3S2DJ 2CJJA 4M3DA 1FTTA 2K9NA 2GM4A 1IGNA 2EBIA 3GBGA 1ZR2A 4DW6A 5IYCJ 1ZTRA 5J1YA 1ZGWA 2VPRA 5M3FJ 5FKLA 1AKHA 3SDGA 3BR5A 1Q1VA 2CQQA 1A5JA 2AHQA 4S0HB 2E2JJ 3JRFA 5FKMA 2M8GX 4W97A 1WI3A 2NVYJ 2XB0X 3O8HA 2DMQA 3JR9A 1NK2P 3I4MJ 2R92J 3BR2A 5F04A 2VKVA 2OF7A 2JA6J 1AKHB 2XPWA 3D1NI 1CQTA 1AU7A 2XPUA 1U9NA 1ETYA 2P81A 1X2MA 1ENHA 2Y2ZA 2WAQN 3MKLA 1DU0A 4EEFG 3ZQGA 4BBRJ 5IP7J 4BXXJ 4M3EA 5EZGA 2LD5A 1BL0A 3S1NJ 1IV6A 3PM1A 3FK6A 2CRGA 1VF9A 4DZPA 3G1LA 4A3CJ 4BY7J 1HDPA 3HGGA 4DZJA 3ZQCA 2GBYA 2JA5J 1JUMA 2DMTA 3JRCA 2ECCA 3SJMA 2D5VA 1D5YA 2DA6A 4W1UA 2NS8A 2WB1N 3BTCA 3HBLA 3O8GA 3HGYA 2R5ZA 4MO7A 4A69C 1MBHA 4X1EA 3ZQFA 1JT0A 4RDUA 2CQXA 1ETXA 5BNGA 3HB9A 4BBSJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBE A;  3CDL A;  1OCT C;  3HDD A;  1GVD A;  1IC8 A;  2H8R A;  5E3M A;  4MFD A;  2LKX A;  2L7M P;  2EZI A;  1JT6 A;  1DU6 A;  4LOC A;  1I6H J;  5C4X J;  3A01 A;  3G1O A;  2O9L A;  1WH5 A;  1X2N A;  2IBD A;  1AHD P;  2ID3 A;  4JX6 A;  1ETK A;  2NVQ J;  5F0C A;  2TRT A;  1Z77 A;  4D5F A;  3BG5 A;  1B8I A;  2EQR A;  1BA5 A;  5DS9 A;  3GTG J;  4D7N A;  3OSF A;  3C2B A;  1UG2 A;  2DA2 A;  2R93 J;  1JUS A;  2R7Z J;  2H1K A;  2Y31 A;  5F08 A;  1VI0 A;  1RKW A;  1B72 B;  1TWF J;  4C3H J;  2YS9 A;  1GDT A;  3DCF A;  3JRE A;  2YUS A;  3SFI A;  5M5W J;  5EYR A;  1YRN A;  3LSR A;  3GTO J;  3BR3 A;  2CU7 A;  4IEJ A;  1TWH J;  5FJ8 J;  3JRD A;  1QPI A;  3Q0U A;  4AC0 A;  3H0G J;  3UKG A;  1LFB A;  2FQ4 A;  5J1R A;  5EG0 B;  2JWT A;  2XB5 A;  4IHX A;  2JJ7 A;  1JTX A;  1QVU A;  2DMP A;  3B6A A;  1PUF B;  2ID6 A;  2E2H J;  3NAR A;  1WH7 A;  3PO3 J;  3S15 J;  1O4X A;  2LR8 A;  1HF0 A;  1OFC X;  3GTQ J;  3JRI A;  1PUF A;  2OPT A;  2NOG A;  1U8B A;  2N8G A;  2X6O A;  2LP0 A;  3QQA A;  5FLV A;  4V2G A;  1U9O A;  4AYB N;  1GUU A;  5F1J A;  2MSY A;  2VKE A;  2ZB9 A;  2QF7 A;  1H88 C;  1VND A;  2O7O A;  2ME6 A;  4GFB A;  4IHV A;  5EF6 A;  5FKN A;  3TW7 A;  5GPA A;  3BR6 A;  5M5Y J;  5E3N A;  1IRZ A;  2LFB A;  2E1O A;  4DYR A;  2E2I J;  2G0E A;  4DYC A;  1P7J A;  3M4O J;  3QPL A;  2HXO A;  4FE7 A;  1VFC A;  2DA4 A;  3A01 B;  4MIM A;  2M9H A;  3FIS A;  2XGC A;  5EEA A;  1HCR A;  2LVS A;  2DA3 A;  1JJ6 C;  2R0Q C;  1BW6 A;  2QCO A;  3TED A;  4B1R A;  1F36 A;  4M6V A;  2HQ5 A;  3ZOB A;  5EZH A;  1U78 A;  3A03 A;  5C4J J;  3OIO A;  5K7Z A;  1WGX A;  2XGD A;  2HOA A;  4A3M J;  3G1M A;  3S1M J;  1JKR C;  3K7A J;  2VI6 A;  3S2H J;  5FKO A;  3BTL A;  4NDL A;  2E19 A;  4M3G A;  1T56 A;  3RZD J;  5JLX A;  3DEW A;  5JLW A;  1MSE C;  2DA1 A;  2EZK A;  1FEX A;  5IP9 J;  3BTI A;  5FLM J;  2FD5 A;  4XID A;  4CYC B;  4J19 A;  2R5Y A;  2LLK A;  4FE4 A;  1QVT A;  1TWG J;  4Y7N J;  3TP3 A;  3K2A A;  4QIW N;  5HOD A;  2CUF A;  5IPA A;  4UUS B;  1LE8 B;  9ANT A;  1R9T J;  2Y9Y A;  4JX4 A;  5E3L A;  1RES A;  1E3O C;  1ETW A;  2K40 A;  2MG4 A;  5C3E J;  3LNQ A;  2DTZ A;  1ETV A;  3F0C A;  2ECB A;  2NVX J;  2JN6 A;  5F0H A;  1OCP A;  1APL C;  1NK3 P;  3GTL J;  1MBK A;  2DA5 A;  1RET A;  1IDZ A;  4A3J J;  2HYJ A;  3BR0 A;  4FIS A;  4JP0 A;  1A6I A;  2X48 A;  3HOZ J;  2L9R A;  3OOU A;  2JK3 A;  4BKX A;  2K9Q A;  3S14 J;  4X6A J;  2L0K A;  3A02 A;  4M3B A;  1SFO J;  3LSP A;  2YU9 J;  1ZK8 A;  4UUT A;  1IDY A;  3NAU A;  2DA7 A;  5IOY A;  1NTC A;  3Q0V A;  2MW8 A;  3S1R J;  1MH4 A;  2JA7 J;  2EZL A;  2M2E A;  1OJL A;  4I76 A;  4FCY A;  4MFE A;  2B63 J;  2DJN A;  2FJ1 A;  2XPV A;  2AO9 A;  3LSJ A;  4C3J J;  3RKQ A;  5K7H A;  4XK4 A;  2DMN A;  3GTJ J;  3FIW A;  1ITY A;  1P7I A;  4UUS A;  3BR1 A;  2HXI A;  1LE8 A;  5C44 J;  3WHB A;  3CMY A;  5E3O A;  3JRA A;  1HDD C;  1FTZ A;  2W48 A;  5F0F A;  1ETQ A;  1WPK A;  3Q3S A;  2Y0S N;  1JKQ C;  2CUE A;  3I4N J;  2XSD C;  1I3Q J;  5GP9 A;  4D5C A;  5EG0 A;  3BT9 A;  5DTD A;  4XRM A;  3TW6 A;  3FK7 A;  1RR7 A;  2Y30 A;  1FIP A;  1MH3 A;  1MNM C;  1MSF C;  2ELK A;  2I10 A;  4IHY A;  1IG7 A;  1POG A;  2Y9Z A;  5EGO A;  3S17 J;  1UMQ A;  2JMW A;  4A93 J;  1BJZ A;  3FKI J;  2O8K A;  2IEK A;  1K83 J;  4MLO A;  3BTJ A;  4V2F A;  1H8A C;  4DYQ A;  4L5E A;  1TWA J;  4Y52 J;  5M3M J;  2L7F P;  4JYK A;  1IJW C;  4C2M J;  5EGO B;  1LFU P;  4D7M A;  5J1U A;  4G12 A;  5IOZ A;  3JRG A;  2HOS A;  2KT0 A;  2XRL A;  4A3L J;  5K7F A;  4A3B J;  1ZR4 A;  3GTK J;  3HOV J;  1ZQ3 P;  1Y1W J;  2HDD A;  2EH3 A;  1YRN B;  1W0U A;  3HOY J;  2NS7 A;  5EDN A;  5IYB J;  3CCY A;  3ZQI A;  1F43 A;  4RBO A;  4A3K J;  3HEF A;  1XS9 A;  3GTM J;  2PMZ N;  3E7L A;  1SAN A;  1GT0 C;  2IAI A;  4XRS A;  2COB A;  3GTP J;  2HI3 A;  1EF4 A;  3BG3 A;  1JGG A;  5J3L A;  3MVP A;  2GLO A;  1QRY A;  4XRS G;  4B3A A;  1HOM A;  4QSH A;  1Z0X A;  4HNV A;  2L7Z A;  3RQI A;  3HOW J;  2M34 A;  4AUX A;  3S16 J;  3IH3 A;  1RKT A;  3JRB A;  4M3F A;  2TCT A;  4IHW A;  4C3I J;  3L1P A;  1RPW A;  3IH2 A;  1JUP A;  1JTY A;  5IYD J;  1FIA A;  3QPS A;  1WCM J;  3TP0 A;  2NVT J;  3MN2 A;  4CYC A;  2WV1 A;  4XIC A;  2HOT A;  5IP6 A;  3H3V K;  2LK2 A;  2EZH A;  1UHS A;  1HLV A;  4QTR A;  3Q0W A;  1H89 C;  1ZKG A;  1JKO C;  1XC5 A;  3CQZ J;  4A3E J;  3LOC A;  2M0C A;  3BQZ A;  1B72 A;  3B6C A;  2R5Y B;  1XG1 A;  2JA8 J;  2K9S A;  3HOU J;  3IV5 A;  3M3Y J;  3BG9 A;  1TWC J;  3JRH A;  2VUM J;  5F27 A;  3LSG A;  4A3I J;  1MBG A;  2FX0 A;  1G2H A;  5M5X J;  3OSG A;  3VPR A;  3WHC A;  3ZQH A;  1TC3 C;  2XGE A;  3HOX J;  2R5Z B;  1MBJ A;  1W0T A;  2DN0 A;  2DMU A;  2KDZ A;  4FTH A;  1S7E A;  3RZO J;  3W6V A;  1IUF A;  2X9D A;  3S1Q J;  4I6Z A;  3HKZ N;  3PO2 J;  1GV5 A;  1X58 A;  5FKK A;  4A3G J;  4JX5 A;  1GV2 A;  1I50 J;  1BW5 A;  1MBF A;  1B8I B;  2RAE A;  4B4C A;  1FJL A;  1ORK A;  3ZQL A;  1Y1V J;  2LTP A;  4BY1 J;  2ME0 A;  4A3F J;  2LY9 A;  3HM5 A;  1K61 A;  1JJ8 C;  1JKP C;  3BQY A;  5GPC A;  2MGQ A;  1T33 A;  1ETO A;  4ABZ A;  4A3D J;  3IH4 A;  3S2D J;  2CJJ A;  4M3D A;  1FTT A;  2K9N A;  2GM4 A;  1IGN A;  2EBI A;  3GBG A;  1ZR2 A;  4DW6 A;  5IYC J;  1ZTR A;  5J1Y A;  1ZGW A;  2VPR A;  5M3F J;  5FKL A;  1AKH A;  3SDG A;  3BR5 A;  1Q1V A;  2CQQ A;  1A5J A;  2AHQ A;  4S0H B;  2E2J J;  3JRF A;  5FKM A;  2M8G X;  4W97 A;  1WI3 A;  2NVY J;  2XB0 X;  3O8H A;  2DMQ A;  3JR9 A;  1NK2 P;  3I4M J;  2R92 J;  3BR2 A;  5F04 A;  2VKV A;  2OF7 A;  2JA6 J;  1AKH B;  2XPW A;  3D1N I;  1CQT A;  1AU7 A;  2XPU A;  1U9N A;  1ETY A;  2P81 A;  1X2M A;  1ENH A;  2Y2Z A;  2WAQ N;  3MKL A;  1DU0 A;  4EEF G;  3ZQG A;  4BBR J;  5IP7 J;  4BXX J;  4M3E A;  5EZG A;  2LD5 A;  1BL0 A;  3S1N J;  1IV6 A;  3PM1 A;  3FK6 A;  2CRG A;  1VF9 A;  4DZP A;  3G1L A;  4A3C J;  4BY7 J;  1HDP A;  3HGG A;  4DZJ A;  3ZQC A;  2GBY A;  2JA5 J;  1JUM A;  2DMT A;  3JRC A;  2ECC A;  3SJM A;  2D5V A;  1D5Y A;  2DA6 A;  4W1U A;  2NS8 A;  2WB1 N;  3BTC A;  3HBL A;  3O8G A;  3HGY A;  2R5Z A;  4MO7 A;  4A69 C;  1MBH A;  4X1E A;  3ZQF A;  1JT0 A;  4RDU A;  2CQX A;  1ETX A;  5BNG A;  3HB9 A;  4BBS J; 
#chains in the Genus database with same CATH topology
 2FF4 A;  4ZDL A;  2XGX A;  1MBE A;  2KZG A;  4A0X A;  3CDL A;  4QLC U;  2FRH A;  1I1G A;  5BPI A;  3CC2 I;  3IWZ A;  2HTS A;  2H8R A;  5E3M A;  2LKX A;  2PJR A;  4RMN A;  2KJC A;  1SFU A;  1JT6 A;  1WZ2 A;  3E0J B;  4R1H A;  2XDV A;  1UHM A;  2IGN A;  3G1O A;  5DCM B;  5TRD A;  1HW1 A;  4ZTJ A;  2IJL A;  5H6R A;  2HVS A;  1XMA A;  3MWM A;  3TGN A;  2E1N A;  3M1C A;  2VT2 A;  3BDD A;  1FOW A;  3IC7 A;  3CP8 A;  2XF5 A;  2RV8 A;  2EQR A;  1DQU A;  3H5R A;  1BA5 A;  1HKS A;  2KL4 A;  3FBI B;  2DJI A;  4PZJ A;  3GTG J;  5GAD J;  3OSF A;  3C2B A;  1ZLK A;  1KQ8 A;  2R93 J;  3VYS B;  3KYD B;  3HTS B;  3BJ6 A;  3K70 D;  4NC6 A;  4ESJ A;  1B72 B;  2EV0 A;  3J80 Z;  4E7Z A;  4RGR A;  4AVP A;  3WG7 H;  4Z2Y A;  2YUS A;  5EYR A;  3LSR A;  2MBF A;  3BR3 A;  2HS5 A;  2Y69 H;  4HX7 A;  2ZJ2 A;  3W2A A;  3JRD A;  1Z1D A;  4NQW A;  2CO5 A;  2F6C A;  4ZYD A;  3CD6 I;  2MLG A;  4PJJ A;  5EG0 B;  2ZKZ A;  3HZJ A;  3IAS 2;  5DYM A;  3DPT A;  1T6S A;  1TTY A;  1JHH A;  1FMW A;  1W7P B;  1JTX A;  2OV7 A;  2QBY A;  4IHX A;  5CQE A;  2HKX A;  3RJP A;  1JE8 A;  3LA3 A;  3DQV C;  4KMF A;  1RNL A;  3U1D A;  2OCC H;  5HVQ C;  1R4M B;  4IJA A;  1PUF A;  2OPT A;  1SMY F;  5E20 A;  2JRT A;  1LUJ B;  4XKC A;  1YI2 I;  2X6O A;  2LP0 A;  2QM3 A;  2VJ4 A;  5EEG A;  3QQA A;  4V2G A;  1GUU A;  2KIU A;  4BEH A;  2QF7 A;  2HVQ A;  2V79 A;  1R00 A;  2ME6 A;  3ESW B;  2RQP A;  5EF6 A;  2M7B A;  3HOS A;  3QOE A;  2IW5 A;  1D0Z A;  2CSO A;  1V54 H;  1RIO H;  1MIJ A;  1R6R A;  5M5Y J;  2A6H F;  3OY9 A;  4MEY F;  3FXL A;  4OWR B;  1P7J A;  2XC7 A;  4BJ6 C;  3M4O J;  3VFZ A;  3OYD A;  1N77 A;  2DFF A;  1HSJ A;  2KP6 A;  3CCV I;  4OIP F;  4HOB A;  3OYG A;  3BC8 A;  2FML A;  2M9H A;  3FIS A;  5E1Z B;  5EEA A;  1Y39 A;  5DD8 A;  3BLY A;  4YEL A;  1VQ4 I;  1BW6 A;  2HQR A;  3NQO A;  2BEO A;  3K4B A;  2MFZ A;  3C1D A;  4BQN A;  1W5S A;  1R71 A;  3IL2 A;  3MKZ A;  3WTV C;  2QVO A;  2XGD A;  5DCM A;  1MD0 A;  4PGG A;  2FSW A;  4BAC A;  1JKR C;  4F52 A;  1TT5 B;  3BPX A;  3I59 B;  2ZSI B;  3E5X A;  4UY8 I;  3NEU A;  1SD7 A;  1J2X A;  1X1A A;  2JPB A;  2XIG A;  1FEX A;  4CYC B;  3TMO A;  2LYC A;  4J19 A;  1F9N A;  2BHY A;  4AWX B;  3K4M A;  3AL0 C;  1S72 I;  1WSU A;  4QIW N;  5JFR A;  1V3F A;  2CUF A;  4UUS B;  1LE8 B;  2BW3 A;  5L3E A;  9ANT A;  3G4S I;  5LHG A;  4PSX A;  1W7P D;  5E3L A;  1OCC H;  1PDN C;  1YW8 A;  2GOX B;  2H09 A;  2MG4 A;  3WOD F;  1T2K A;  2Z1D A;  3WTX C;  4L9N A;  2JN6 A;  5F0H A;  5B1A H;  3BCA A;  1APL C;  4LB5 A;  3IKV A;  5HLI A;  3KEQ A;  2HYJ A;  4JP0 A;  4FIS A;  1X3U A;  4EM2 A;  3GO5 A;  1A6I A;  3G3Z A;  1FSE A;  3F8B A;  3OOU A;  2JK3 A;  1NG6 A;  2L7K A;  2LMD A;  3A1Y A;  3K4K A;  4XKV A;  3OYJ A;  1A04 A;  4X6A J;  5J47 A;  4D9J A;  5IY5 H;  1YS7 A;  3B73 A;  1G4D A;  4EVI A;  5IOY A;  3S1R J;  3Q0V A;  4A6E A;  1BOA A;  4ZYA A;  2WTE A;  4FCY A;  1MMA A;  4I0A A;  2R7D A;  3EUH A;  2BVL A;  5H2F C;  4H0E A;  1L0O C;  3WGH A;  4IPA A;  4EM0 B;  1I1S A;  4C3J J;  2LKP A;  2LBF A;  5FLX Z;  5K7H A;  3I71 A;  2F4O B;  4Y15 A;  1ZGA A;  1RI7 A;  4CZZ A;  3GTJ J;  3WTU C;  4XOT A;  4KIB A;  4BS9 A;  3M1E A;  2HQN A;  4CUG A;  5E3O A;  4DOZ A;  5F0F A;  1UB9 A;  1ETQ A;  2WAD A;  3Q3S A;  1JKQ C;  1OLT A;  2AXL A;  1C0W A;  2TDX A;  3AG2 H;  4TV7 A;  5GP9 A;  3CUO A;  1BN5 A;  2E5N A;  5DTD A;  4JOM A;  2F5V A;  2CV0 A;  2W24 A;  1J0R A;  2JT1 A;  1P9Q C;  3SFZ A;  1MNM C;  1MSF C;  1O7F A;  3OS0 A;  2XAF A;  3KPH A;  4Y4R A;  1IUY A;  2JMW A;  4A93 J;  2PG4 A;  3D5R C;  3HHH A;  2NYX A;  1K78 B;  1LEA A;  2DLL A;  4EV0 A;  2O8K A;  4RB1 A;  1HC8 A;  2X51 A;  4UXN A;  2Z33 A;  1FT9 A;  3H3U A;  3DEE A;  1MDM B;  3BTJ A;  4HYE A;  2L7F P;  1VTN C;  2DDB A;  1UHW A;  1XN7 A;  3I59 A;  5FFZ A;  4C2M J;  1IJW C;  1IZ1 A;  1LB2 A;  1K6Y A;  1MJ9 A;  1NHA A;  3ZMD A;  1YLF A;  2COM A;  5E8G A;  1SD4 A;  2LRD A;  3QP6 A;  5HLG A;  2STT A;  4Y17 A;  3ZN0 A;  2QA4 I;  4MTD A;  2W7N A;  2VIX A;  2HDD A;  4IHT A;  2V1U A;  3GEZ A;  1W0U A;  2WY7 Q;  3HUG A;  3HOY J;  2HOE A;  5IYB J;  3N4M A;  2VPL A;  1BR4 A;  1D1B A;  3I54 A;  4A3K J;  2BY3 A;  2KIQ A;  5B3S H;  3GTM J;  1X3W B;  3LWF A;  3IAM 2;  3HOT A;  4BGD A;  2OCE A;  3IRR A;  2COB A;  2K86 A;  3GTP J;  5GAH J;  3BG3 A;  4XSZ F;  4X0G A;  3CCJ I;  2NXN B;  3MVP A;  3I9V 2;  5E1X A;  2ZJP F;  3GME A;  2UXN A;  4V19 K;  5FD5 A;  1WWX A;  4M9Z A;  4QSH A;  3OYK A;  2QSH X;  2L7Z A;  3HOW J;  2M34 A;  3S16 J;  3NRV A;  3GUD A;  2WC2 A;  3ASN H;  2TCT A;  4IHW A;  4OIN F;  4DBQ A;  1E2X A;  1RPW A;  1TBX A;  2RRE A;  3S3N A;  1MKM A;  3HKZ A;  1ZAO A;  3TP0 A;  2Y75 A;  4YEJ A;  4B09 A;  5LRS A;  3OYA A;  2EZH A;  1FYK A;  2E34 A;  1V55 H;  2VBY A;  1FSH A;  5F1R A;  3CUQ B;  3Q0W A;  5LBQ A;  2DOD A;  3WGI A;  3PSF A;  2XRO A;  2A07 F;  5IT9 K;  4E7S A;  2XF6 A;  5J4Y A;  3SQN A;  1UEL B;  4G6T B;  2XSJ C;  3GLL A;  1KU2 A;  4P55 A;  2MH2 A;  2K5C A;  4BHB A;  2BE5 F;  2K9S A;  4OAY A;  4C2U A;  3K1N A;  3MKW B;  3BY6 A;  4L0Z B;  3BG9 A;  2QYO A;  1TWC J;  1X1C A;  3JW4 A;  2QEX I;  5F27 A;  4AD9 A;  3LSG A;  4LLN A;  1MBG A;  2FX0 A;  1YJW I;  5A2Q K;  5H6Q A;  2EA4 A;  4PSW A;  3ZQH A;  1U5T C;  2CV1 A;  1UAA A;  4BXU A;  3CUQ C;  4FHT A;  2DMU A;  2E1M C;  4AU7 A;  2AQF A;  3Q9V A;  3KEY A;  1D5V A;  2VT3 A;  4DGW B;  4I6Z A;  4YG2 F;  4ZZD A;  4XNF A;  1YHQ I;  2E1M B;  1ORK A;  1W5T A;  4G94 A;  3ML6 A;  2FEZ A;  3SEZ A;  1U5T A;  4A0Z A;  1JJ8 C;  3ULQ B;  3WTZ A;  3K9T A;  2KHM A;  4XN0 A;  4L9J A;  2X6W A;  1Z05 A;  1BI0 A;  2VKH A;  1WRJ A;  3WE2 A;  4XOP A;  3HSF A;  2E35 A;  2GM4 A;  1RUN A;  4BDZ A;  4L0Y B;  3GBG A;  2DXI A;  4U7B A;  1ZTR A;  1E3P A;  2WAE A;  4BEH B;  4EQQ A;  1H9T A;  3KIO A;  3JCU C;  1Y0U A;  5E17 F;  2GXG A;  3MQ0 A;  4I7H A;  4C9Y A;  2WAF A;  4U0V A;  4HBL A;  1J7K A;  1LEB A;  2M8G X;  2NVY J;  3O8H A;  1S29 A;  3JR9 A;  1NK2 P;  3WU0 A;  3BCB A;  3HRS A;  3OWT A;  2DT5 A;  2OZU A;  1WHU A;  4RM2 A;  2W25 A;  2QSF X;  1AU7 A;  3LAP A;  2XPU A;  1PUE E;  3T8T A;  4ZTF A;  3LSH A;  2JRM A;  3VSK A;  4E7H A;  2BV6 A;  4EM1 A;  5IP7 J;  4RS8 A;  3K2Z A;  3DEU A;  2NAZ A;  2LD5 A;  3QPT A;  3S1N J;  3FK6 A;  1PP7 U;  3J81 K;  2FOK A;  4DZP A;  3G1L A;  4K2E A;  2HZD A;  3HGG A;  4DZJ A;  2GBY A;  3F3X A;  3LST A;  3Q9S A;  4N0B A;  5E18 F;  3OOP A;  4G7O F;  3M8F A;  4A5N A;  3BRO A;  1YTY A;  1F4K A;  1JUM A;  1STZ A;  4KIC A;  1GHC A;  2DA6 A;  4XLE A;  4HDU A;  4EJO A;  2DAO A;  3E6D A;  3HGY A;  4ZZL A;  4F55 A;  2BW3 B;  4A69 C;  2H6C A;  1JT0 A;  2CQX A;  3AG3 H;  1LJ9 A;  1S9H A;  2DYS H;  4L18 B;  1WJF A;  3GVA A;  2OTJ I;  2PI0 A;  3MCZ A;  1Z3Y A;  1P4W A;  1VQN I;  2V4J C;  3F8F A;  3TO7 A;  3HDD A;  2L7M P;  2EZI A;  1CF7 B;  1YQA A;  3DPL C;  3CJQ B;  2VJ5 A;  2YR2 A;  4RLQ A;  4XLC A;  2WAQ A;  3PUF A;  3A01 A;  3OYN A;  3KP3 A;  3K69 A;  3L7W A;  1AHD P;  3W6J B;  1IRF A;  2NVQ J;  4BL0 B;  3BOQ A;  2TRT A;  2O3F A;  3QAH A;  4E7I A;  2KRH A;  3BG5 A;  3J81 Z;  3FXO A;  1Z67 A;  3TKY A;  1ZRE A;  1ONV A;  4QPQ A;  2HVR A;  1FNN A;  3TDZ C;  2KDO A;  3F9K A;  1QA6 A;  2VXD A;  3JTG A;  4D7N A;  1G3Y A;  1BI2 A;  1UG2 A;  1JUS A;  2R7Z J;  3QYF A;  2Y31 A;  3GWZ A;  3E1S A;  2L2O A;  1HKQ A;  5F08 A;  3CMA I;  2AS5 F;  1RKW A;  2ICW G;  1TWF J;  1R4N B;  2A6T A;  1YW9 A;  4NNJ A;  1TW2 A;  2PEX A;  2DYR H;  2EK5 A;  3JRE A;  3N97 A;  2ZBK A;  3FM5 A;  4KIS A;  1S7O A;  4AYB A;  5CPR B;  2L01 A;  2ZXJ A;  1TWH J;  3RPU D;  5FJ8 J;  1S6L A;  2ZFU A;  3WTW C;  2ZSH B;  1QPI A;  2Z2S B;  3CO7 C;  4G9Y A;  3AFH A;  1A36 A;  1LFB A;  3GLX A;  3I56 I;  3I55 I;  1SAX A;  2QZ8 A;  3FXQ A;  1S5L C;  4ITV A;  4ENN A;  3R0J A;  4PFP A;  3DLL F;  4LG0 A;  4ESB A;  3P5J A;  5DDG A;  1MDM A;  2XRN A;  1PUF B;  2E2H J;  4HF1 A;  1XGM A;  4OMZ A;  2P4W A;  3PO3 J;  3S15 J;  1O4X A;  2LR8 A;  3S3M A;  1OFC X;  1KU3 A;  2DOA A;  3GTQ J;  4FAS D;  1OIS A;  5GTH C;  2QBY B;  3GX4 X;  2FOW A;  5FRM A;  3PFY A;  3VOE A;  5LD2 C;  1ZLJ A;  2MSY A;  3S3O A;  4Y33 A;  2ZB9 A;  1OYW A;  4FET A;  4A6D A;  1H88 C;  4KYW A;  4RAG A;  4GYG A;  4IHV A;  3F72 A;  5LGU A;  5GPA A;  2LSO A;  2OAZ A;  3KCC A;  3HSR A;  4ETS A;  4YFN F;  2EFN A;  3GZN B;  3FMQ A;  4HEA 2;  2LFB A;  4ZDO A;  2PJP A;  1D0X A;  4DYC A;  4XN3 A;  1NG7 A;  3FMR A;  5KVR A;  4N4N B;  3EYI A;  4M73 A;  2UZK A;  1FP2 A;  2PMU A;  5B5E C;  4FE7 A;  4EGY A;  1VFC A;  2IRF G;  2CQK A;  2XGC A;  3C2G A;  1HCR A;  2LVS A;  4II2 A;  4AIH A;  4OMY A;  3ZMS A;  2R0Q C;  2V9K A;  1X1P A;  1XCB A;  3TED A;  2XAQ A;  1K4S A;  2RNG A;  3FZV A;  4OOI A;  2K3F A;  2LDU A;  2NVU B;  2CWE A;  1U0J A;  3OYI A;  1W1W E;  5K7Z A;  1WGX A;  4CA0 A;  3FHN A;  1QZZ A;  3VEP A;  1YX3 A;  3VYR B;  2BXY A;  5DUI A;  1DP3 A;  1Z7U A;  2GXB A;  4PJN A;  3DBH B;  1KU7 A;  3S1M J;  4XLP F;  3K7A J;  1E0E A;  3QP5 A;  1FMV A;  1VZ0 A;  1X3Z B;  2VOP A;  2AQE A;  5FKO A;  3BTL A;  4NDL A;  4M3G A;  1KYW A;  3PL8 A;  3ECH A;  5JLX A;  3RZD J;  1LQ1 A;  3DEW A;  1U5T B;  3MZY A;  1MSE C;  2DA1 A;  2KFD A;  2EZK A;  1D1A A;  5ICG A;  1J5Y A;  3RYR A;  2EIM H;  4IZZ A;  3SYT A;  4XQF A;  2DOE A;  3HRM A;  2E36 A;  3SZG A;  3H5A A;  4HPQ A;  1TWG J;  4EMS A;  3K2A A;  5HOD A;  2FA5 A;  3OR2 C;  5IPA A;  1R9T J;  2Y9Y A;  1IO2 A;  1R1U A;  2P7V B;  3V8L A;  2YSR A;  5DCF A;  3EQL F;  4KNY A;  2P0W A;  2K40 A;  1ZGJ A;  4GYI A;  4E7K A;  1ETV A;  2OZ6 A;  2NVX J;  2ECB A;  2R7Q A;  5CJ9 A;  4F7Z A;  1OCP A;  4PFO A;  2K7L A;  2O5R A;  2M7A A;  3OYC A;  3BR0 A;  4A3J J;  4CCN A;  2BXZ A;  3HOZ J;  2L9R A;  1ZG5 A;  3PJR A;  2DO7 A;  3JSO A;  3A02 A;  1SFO J;  2WA0 A;  3M7G A;  5HDG A;  5DUK A;  2DA7 A;  1BC7 C;  2MW8 A;  2PX9 A;  1Y8Q B;  1QHG A;  4GO1 A;  2JA7 J;  2EZL A;  4E70 A;  4I76 A;  2O03 A;  3FKJ A;  3IP4 B;  2M1B A;  2RNJ A;  4YFK F;  2FJ1 A;  2XPV A;  2AO9 A;  4OAZ A;  2WV0 A;  2HTJ A;  1QHH D;  4N4O B;  5D5X B;  5B1B H;  4J00 A;  2DT6 A;  3FXM A;  2DMN A;  3LA2 A;  1IN5 A;  5ERI A;  1P7I A;  4UUS A;  1LE8 A;  2HXI A;  3WHB A;  5H20 A;  1LVA A;  2CW8 A;  3JRA A;  1FTZ A;  3QOD A;  2D1H A;  1SVO A;  3PQK A;  3U9G A;  4WXC A;  2XSD C;  2Z9O A;  1B4A A;  5HDN A;  4D5C A;  2YPR A;  2LNB A;  3G6E I;  3G73 A;  2OUM A;  3BT9 A;  1J59 A;  2IS2 A;  3TW6 A;  1WJD A;  1YX5 A;  3DKX A;  2ELK A;  4WK8 F;  2ISY A;  1IG7 A;  2STW A;  3CC7 I;  1POG A;  2IVM A;  3V42 A;  2B9S A;  1XCV A;  3D0S A;  1N25 A;  3FMS A;  2DW4 A;  2MC3 A;  2GOM A;  1BJZ A;  2V1D A;  3FKI J;  2F5E A;  4BE1 A;  3AG1 H;  2RGV A;  4L5E A;  3AKZ A;  2D1V A;  3Q5F A;  2O61 A;  1ON1 A;  2X85 A;  4JYK A;  4WWC A;  5TJJ A;  3S8P A;  2MD0 A;  3RTR A;  4D7M A;  3IKT A;  3KP7 A;  3LSM A;  3JRG A;  3K1P A;  2KKO A;  3ERM A;  2BBY A;  3WU2 C;  4A0Y A;  1ZR4 A;  3V7S A;  1ON2 A;  3GFI A;  3ZQ7 A;  3HOV J;  2FMY A;  1Z6T A;  1XSD A;  1SAU A;  4LGW A;  3E6C C;  2E71 A;  3P9I A;  2VBZ A;  3FX3 A;  1TQP A;  4I01 A;  3HXL A;  4KIF A;  1R23 A;  3KP6 A;  5GTI C;  5FGM A;  2QKL B;  3EYY A;  4BQA A;  1Y0N A;  3PSI A;  1XMK A;  1XS9 A;  3GZ5 A;  2PMZ N;  3REO A;  3OL3 A;  3E7L A;  4XRS A;  1FYL A;  4DBR A;  4P96 A;  3G2B A;  3T1B A;  5KCM A;  4IQ4 A;  1QPM A;  5J3L A;  2ADU A;  2GLO A;  1QRY A;  3RSN A;  2K9M A;  3MD2 A;  1KZH A;  2DOF A;  4ZJZ A;  1KYZ A;  4AIJ A;  4B8X A;  2ZME A;  3AG4 H;  3S2W A;  5J8C A;  1X19 A;  4AUX A;  2OBP A;  1TP4 A;  3I4P A;  2XVC A;  2X1D A;  3JRB A;  2L3D A;  2ZO4 A;  3H92 A;  1VQ6 I;  1ZHF A;  2LC2 A;  4C3I J;  2XAH A;  3J7A O;  2L9S A;  1FIA A;  4U0W A;  2Q1Z B;  3KE2 A;  4YIF A;  4CYC A;  2GWR A;  4XIC A;  2HOT A;  2GIV A;  2L9N A;  4KIG A;  4II3 A;  1ZKG A;  4BAY A;  2QSG X;  5TIS C;  1ZG1 A;  1XC5 A;  4A3E J;  4ASN A;  3E5Q A;  3LOC A;  1B72 A;  4FT8 A;  1Z7L A;  1YYV A;  2R5Y B;  3A4C A;  1EJ9 A;  1BR2 A;  1X1D A;  3FXJ A;  2HFH A;  1XG1 A;  5E79 C;  2IS4 A;  3G71 I;  2H27 A;  4UUV A;  4HST A;  3IV5 A;  4P5O A;  5L3B A;  5D4S A;  3F8N A;  1P2F A;  2M4K A;  3S32 A;  1IN8 A;  2FBH A;  4KN4 X;  3OSG A;  3VPR A;  5FD6 A;  5LHH A;  2IA0 A;  4M9S A;  4R8H A;  1MBJ A;  4D0P A;  1Y6I A;  3AAF A;  1W0T A;  3TO9 A;  4H4K C;  2UWM A;  3O2P E;  3KP5 A;  5CVI A;  3RKY A;  4FTH A;  2LKS A;  4P9U A;  3W6V A;  1IUF A;  4CGZ A;  4BXF A;  2H6B A;  3PO2 J;  1I39 A;  5FKK A;  2FUG 2;  2D2W A;  5AIP A;  4A3G J;  1BW5 A;  4HX4 A;  3BZK A;  2W85 A;  1LNW A;  2WY8 Q;  4LLL A;  4B4C A;  3DBL B;  2D45 A;  1FJL A;  1NH3 A;  3ZQL A;  2A5Y B;  3OS1 A;  4BY1 J;  2VQC A;  4ENK A;  5D5V B;  4G6D A;  1SC7 A;  3CCQ I;  2BHZ A;  4XMY A;  2LY9 A;  1JKP C;  3D5S C;  2XF7 A;  5EJC A;  2MGQ A;  1T33 A;  4EGZ A;  1ETO A;  4A3D J;  2JA2 A;  3I58 A;  2CJJ A;  2WWY A;  3NWS A;  2X1E A;  1K4T A;  4M3D A;  4KFC A;  2Q2E A;  1B9M A;  2VC1 A;  2B0L A;  5FLX K;  2EBI A;  3FHZ A;  3EPZ A;  4DW6 A;  5IYC J;  3LAJ A;  2VC0 A;  2IGK A;  5J1Y A;  1RC9 A;  5HLT A;  4OIR F;  3M9A A;  1KA8 A;  4CSW A;  3CCL I;  2RDP A;  5LGT A;  3KYL A;  2CQQ A;  4ESF A;  1FP1 D;  2L9V A;  4DNC A;  2AHQ A;  2IXS A;  2E2J J;  3JRF A;  1OPC A;  3PNV A;  4CCK A;  2VB6 A;  4BJT A;  3LMM A;  1YJN I;  3EDP A;  2LF8 A;  3BZ6 A;  1VQP I;  1E3H A;  2V9P A;  1Z21 A;  3CZ6 A;  4UV9 A;  4LK1 F;  4D1Q A;  4RB3 C;  2R7S A;  5FRO A;  2K3P A;  2MYS A;  1VQO I;  1X2M A;  2Y2Z A;  4IOC F;  1I6X A;  4O5V A;  3ZQG A;  5ILV A;  4BNC A;  3DTI A;  4AID A;  2ELJ A;  1U8R A;  4XKB A;  4EJU A;  4M3E A;  5EZG A;  2C6Y A;  3W2W A;  1KGS A;  2CRG A;  1K7A A;  3MZ8 A;  1VF9 A;  4BY7 J;  1SD6 A;  1HDP A;  5HNH A;  4IKF A;  1XSX A;  4BQQ A;  2JA5 J;  3SJM A;  3JRC A;  1R5G A;  2WB1 N;  3BTC A;  3HBL A;  2HNH A;  3HSE A;  2ELH A;  4MO7 A;  2R5Z A;  2HYG D;  3K0L A;  4ZC3 A;  5D6F A;  3RI4 A;  2ZXH A;  4HQM A;  3C18 A;  4LIV A;  2K4J A;  1ETX A;  2KJB A;  4GRI A;  3L2U A;  3V7C A;  1O7L A;  4BBS J;  4MGR A;  4BU2 A;  3FF5 A;  1G3W A;  2P5V A;  2KPM A;  1GVD A;  1XMX A;  2EIK H;  3TBI A;  4EJV A;  1IC8 A;  4MFD A;  4IQJ A;  4CYD A;  5HLH A;  4YIR X;  1LDK B;  5CKT A;  2HGC A;  1QO0 D;  1X4O A;  5J4V A;  1VQK I;  4IXA A;  5EEH A;  1I6H J;  5C4X J;  1UST A;  2K9L A;  2L5Q A;  3SDB A;  1W4M A;  2L54 A;  2O9L A;  1X2N A;  3GF2 A;  4M6Y A;  3WTT C;  2XKO A;  2A5W A;  2ID3 A;  3OL4 A;  1MJB A;  2IPQ X;  3A0B C;  1I27 A;  3CCM I;  1B8I A;  3DU5 A;  5LEK A;  2ESN A;  2R7V A;  5CYV A;  1OCZ H;  2H1K A;  4BE2 A;  1H9G A;  2EB7 A;  1YFH A;  3ABU A;  3M8E A;  2JVG A;  1HKT A;  2YS9 A;  3T5X A;  1GDT A;  2Z5U A;  2Y48 A;  3DCF A;  2L02 A;  3SFI A;  5IT9 Z;  1U2W A;  2EWN A;  1WJE A;  4RA2 A;  2OD5 A;  3AL0 B;  2EIJ H;  3NWT A;  2KLO A;  1D8J A;  5ILS A;  1W36 D;  3F21 A;  1DGW Y;  1U6G A;  3H0G J;  5FO5 A;  2V9V A;  5J1R A;  1D3Y A;  1ZG3 A;  2XB5 A;  1N75 A;  3FWE A;  5FB2 A;  4DQ2 A;  5DEQ A;  2JJ7 A;  1KQ0 A;  5A2Q Z;  3B6A A;  3LSK A;  2ID6 A;  1IXC A;  4I99 C;  4BYY A;  5KK1 A;  5LLQ A;  3KLO A;  3CLQ A;  1UZC A;  4B47 A;  4ENM A;  1R5H A;  2VBW A;  2NOG A;  4IX7 A;  3GCM A;  3C7J A;  2N8G A;  2A05 A;  1J75 A;  5HNF A;  3TOB A;  1U9O A;  2E5Z A;  2PLY A;  5F1J A;  2E7W A;  4HA8 A;  4KA4 A;  3L2R A;  2O7O A;  5KHD A;  5FKN A;  3TW7 A;  3RCO A;  4Q5S F;  5BPD A;  4LIU A;  1BR1 A;  3BR6 A;  4MTE A;  5E3N A;  2E2I J;  2JSP A;  1XSV A;  2VN2 A;  2A68 F;  4PCQ A;  1IN7 A;  4G7Z F;  3TOA A;  1X1B A;  4BDY A;  2KZV A;  2Z3Y A;  1P4X A;  2HZT A;  1MMN A;  1ZEL A;  3DXJ F;  2DA4 A;  2YX7 A;  5KAI C;  1FY7 A;  4MIM A;  1S3J A;  3FXK A;  1WKM A;  4ANJ A;  1QQI A;  2DA3 A;  2L4M A;  4XLF A;  1IAW A;  3CES A;  4UV8 A;  3H9G A;  3K70 C;  1JJ6 C;  2ZFW A;  1GXP A;  2F48 A;  3ZGK A;  4B1R A;  4XRF A;  1P4A A;  1V5F A;  2A69 F;  4CHU A;  3VYT B;  3ZOB A;  1U78 A;  2CQ7 A;  3A03 A;  2JUG A;  3OIO A;  2VQL A;  2M8E A;  2K85 A;  3OYB A;  2Y0S A;  2HOA A;  4M9X A;  1T39 A;  2A6E F;  3G1M A;  4B44 A;  2IA1 A;  2VI6 A;  4YRV A;  3S2H J;  4NB5 A;  2E19 A;  4HLY A;  3FBN B;  4Y13 A;  2F4I A;  2NNY A;  2CH0 A;  1OKR A;  5J8F A;  2X6Y A;  4KMU X;  5LGN A;  5FLM J;  2FD5 A;  4XID A;  1DP7 P;  3RIR A;  4U7D A;  1MNE A;  2BVM A;  4M6X A;  4M71 A;  2GA1 A;  4HV5 A;  4CO8 A;  2YU3 A;  3UR3 C;  1IF1 A;  1QVT A;  4Y7N J;  2QKM B;  5GAE J;  3F6V A;  3WG9 A;  1YS6 A;  3BWG A;  5HS8 A;  5CLS A;  1UFM A;  5K5R A;  1WJB A;  1D8K A;  3HYI A;  1ZYR F;  1RES A;  2CW7 A;  1E3O C;  5C3E J;  2NS0 A;  4P9F A;  4F92 B;  3F0C A;  2VE9 A;  3E3V A;  1FX7 A;  4LFU A;  3J7A Y;  1NK3 P;  2DA5 A;  4BQO A;  3ZPL A;  2QQB A;  2VJI A;  4UB8 C;  3QPH A;  2HDW A;  1EH8 A;  2G7U A;  4RLF A;  4BKX A;  4IF4 A;  5KNL A;  2L0K A;  3LSP A;  2M3A A;  2ZC2 A;  5CVJ A;  1W36 C;  4UNO A;  1IDY A;  3NAU A;  5L3D A;  2ZNY A;  1TNS A;  2EPF A;  1XGN A;  1PP8 F;  1MH4 A;  3EUA A;  2ZJR F;  3RDI A;  1OJL A;  4ZYG A;  2P5L C;  3T0Y A;  2ISZ A;  3P7N A;  2H8W A;  1BJA A;  4WXD A;  2W00 A;  1DUX C;  3ISP A;  2DJN A;  1PVE A;  2W1O A;  3L00 A;  5BOX A;  3PUB A;  3HL2 A;  3COA C;  3LSJ A;  3H9J A;  1JI8 A;  3KZI C;  3RKQ A;  1OYI A;  1T0F C;  3KP2 A;  3WU1 B;  2FXA A;  3CO6 C;  4HF2 A;  1HA8 A;  3FIW A;  4MQ9 F;  3X2Q H;  5JVT A;  3BR1 A;  1B59 A;  3ZRG A;  5C44 J;  2JUC A;  3FXR A;  3CMY A;  4OIO F;  2JTV A;  2J5P A;  3RPQ A;  2W48 A;  5D5U B;  3SZP A;  3GFL A;  2XAS A;  2JQ7 A;  2CUE A;  1T08 B;  2V6C A;  4IVN A;  4CCJ A;  5GAG J;  1I3Q J;  4BHC A;  2E1C A;  3ABM H;  2LY1 A;  2EFP A;  2DK5 A;  2EFQ A;  4QPO A;  4XRM A;  1A35 A;  4Q47 A;  2PMH A;  3FK7 A;  3HRU A;  1RR7 A;  2Y30 A;  3JTH A;  1HBX G;  1FIP A;  5LEJ A;  1MH3 A;  2I10 A;  2L4A A;  4HF0 A;  2OQG A;  4HSR A;  4P1W A;  2V1X A;  4HV6 A;  5EGO A;  4PJL A;  1MGT A;  2HQA A;  4AVZ A;  1FOK A;  1O57 A;  3F23 A;  4LJZ F;  2IEK A;  1K83 J;  1AWC A;  3GZ6 A;  2XKP A;  1OR7 C;  4FQG A;  1H8A C;  3KX2 A;  1JGS A;  3FM3 A;  4Y52 J;  3TO6 A;  5M3M J;  3H5N A;  1LFU P;  2HOS A;  4G12 A;  5IOZ A;  1P92 A;  4A3L J;  2LOO A;  5K7F A;  4PJ0 C;  4S04 A;  1T38 A;  1T95 A;  3H9Q A;  4U87 A;  2R7F A;  5B66 C;  2Y0M A;  4XKW A;  4KDP A;  1YIT I;  3TL4 X;  1Y1W J;  2YX4 A;  2EH3 A;  2ESH A;  1YRN B;  3DU6 A;  4RGS A;  1WQ2 A;  5D8L B;  3QU3 A;  5EDN A;  2ZNZ A;  5HS9 A;  1F5T A;  2CGP A;  3CCY A;  1P6R A;  2RQQ A;  1F43 A;  1OMI A;  4RBO A;  2EIL H;  5BQT A;  4XR6 A;  5CQG A;  1FWZ A;  2E7X A;  4CDG A;  3WTY C;  3SXY A;  1HQC A;  1SAN A;  1GT0 C;  2IAI A;  1YO5 C;  1RUO A;  1TT0 A;  3GFJ A;  1XPX A;  2HI3 A;  2PQ8 A;  1JGG A;  1AOY A;  1GLN A;  2MAB A;  4LG0 B;  4KIT B;  4LB6 B;  2A61 A;  2KIF A;  4F93 B;  3DV8 A;  1HOM A;  1Z0X A;  4HNV A;  1FLI A;  3V7R A;  3IH3 A;  4RAZ A;  3BJA A;  2P7C B;  1R7J A;  2XAG A;  2HYF A;  2JPC A;  2LY2 A;  1QU3 A;  2ZME B;  1G8X A;  3W3C A;  1JTY A;  3HPH A;  2RVC A;  3QPS A;  5CVU A;  1YJ9 I;  5IYD J;  2H1L A;  1XGS A;  3RKW A;  3GYH X;  1WCM J;  4HNT A;  2NVT J;  2OTL I;  2WV1 A;  3U21 A;  5IP6 A;  3H3V K;  2LK2 A;  2O8X A;  4NC7 A;  1MZB A;  4E6K G;  3OIP A;  2QGU A;  1H89 C;  1X4P A;  2EFW A;  4HNU A;  5DM7 F;  3W6K B;  3HUG B;  1ULY A;  2HR3 A;  4IRH A;  3CF2 A;  1GXQ A;  2M87 A;  2M0C A;  3BQZ A;  4B48 A;  3OYH A;  3B6C A;  1ZRC A;  2JA8 J;  2OA4 A;  4IO9 F;  5K5Q A;  2IT0 A;  4YFX F;  4GCV A;  2GA2 A;  3L9F A;  2IGO A;  1RRJ A;  1G2H A;  5M5X J;  5LRR A;  3WHC A;  2PJR B;  1TC3 C;  2XGE A;  2CQN A;  2R5Z B;  1SVM A;  4HX8 A;  3IRQ A;  3RQ4 A;  2DN0 A;  1EA3 A;  4HRI A;  3IUO A;  1TQM A;  3ZCO A;  1U3E M;  3KET A;  3CJN A;  4N9I A;  2GQQ A;  3VB2 A;  3LL7 A;  2X9D A;  1ZRF A;  3HKZ N;  1RZ4 A;  1G3S A;  1Y56 A;  1X58 A;  3O6B B;  3JAM K;  2G7H A;  2O6G E;  1OR7 A;  1I50 J;  1XDS A;  2DT7 B;  1VQ9 I;  4RAF A;  2CV2 A;  3CJR B;  3ECO A;  1OYY A;  1MMD A;  4CZC A;  1B8I B;  3HIF A;  5ICE A;  4MQV A;  3ABL H;  3ZMU A;  2ME0 A;  1JXS A;  3DTK A;  3HM5 A;  2CUJ A;  2OC6 A;  3BQY A;  1TNT A;  3CMM A;  1FBS A;  3K4N A;  2B7E A;  1QGP A;  3BG6 A;  3OS2 A;  1K79 A;  3IH4 A;  1DPU A;  1FZP B;  5LFA A;  1FTT A;  2XAU A;  1IGN A;  3KLN A;  5F6F A;  3VWB A;  2ZXI A;  4LMY A;  2QEN A;  3C3W A;  2GAU A;  3BJO A;  1H0M A;  3QYB A;  1FBQ A;  2VXZ A;  2HDC A;  2DFH A;  1IRX A;  2PBI A;  4GXO A;  4UVA A;  2P6S A;  3SDG A;  4BH9 A;  1QZY A;  2OU2 A;  3I0T A;  3BR5 A;  3DKY A;  1Q1V A;  4CCL A;  4HDV A;  1A5J A;  5E1W A;  4S0H B;  3WE3 A;  4W97 A;  1EKE A;  2W82 A;  1O3Q A;  1YE9 A;  2M4G A;  4L9V A;  4EJT A;  3I4M J;  5FFX A;  2FBK A;  2R92 J;  5F04 A;  2VKV A;  2CUZ A;  4KT5 C;  1W7P A;  4MHG A;  1I3A A;  3QU6 A;  3LFU A;  3V4G A;  1AKH B;  2JA6 J;  3D1N I;  4CIC A;  4KT6 A;  5JHU A;  3GW2 A;  1ETY A;  1ENH A;  2WAQ N;  3MKL A;  1DU0 A;  1IW7 F;  4RAY A;  3WGG A;  3CUQ A;  4BHP A;  4EEF G;  2FE3 A;  1M1E B;  3ABK H;  4NUB A;  2ACJ A;  2ZME C;  3UNG C;  2R4G A;  1O3S A;  3PM1 A;  1L3L A;  2VON A;  3LQR A;  1K6O A;  4WF2 A;  3CCU I;  3V8J A;  3DPU A;  4LK0 F;  2MLK A;  1PYV A;  3ROU A;  1D0Y A;  3IWF A;  2R7R A;  2DMT A;  2ECC A;  2D5V A;  2DCE A;  3DP7 A;  2VE8 A;  4FX0 A;  1R49 A;  1D5Y A;  4W1U A;  2NS8 A;  1W5C C;  4PK4 A;  3BG7 A;  1SFE A;  3DTE A;  3MEX A;  2R3S A;  1TW3 A;  4B3X A;  4JK1 X;  4HAM A;  1V4R A;  1MBH A;  1HW5 A;  2F2E A;  3ZQF A;  1T8I A;  1CF7 A;  1T0F A;  5D8K B;  2LG4 A;  2NNN A;  1REP C;  1MMG A;  5BNG A;  2Z99 A;  5DD4 A;  1MND A;  3HB9 A;  3QYE A;  1DDN A;  1MJA A;  3PNT A;  2DQR A;  1ERD A;  2CFO A;  3H35 A;  3KZZ A;  5D6E A;  1SFX A;  5K5O A;  2BY1 A;  1OCT C;  2GZW A;  3D5L A;  4G8X A;  3CCE I;  1SD5 A;  4U0Y A;  2ZXW H;  4ZDP A;  3MMY B;  3ZN1 A;  3HC7 A;  1DU6 A;  3HRT A;  4CCO A;  4LOC A;  3MAJ A;  1WH5 A;  2HPM A;  4S05 A;  2IBD A;  2CFX A;  4JX6 A;  2W4S A;  1ETK A;  5F0C A;  2W84 A;  4I98 B;  1Z77 A;  3K1M A;  2CS3 A;  4D5F A;  2LBF B;  1HST A;  3ZXS A;  2DPU A;  2M0M A;  4I0B A;  3H1C A;  4OU0 A;  2CG4 A;  5DV5 A;  2HU9 A;  3K4L A;  5DS9 A;  2UV1 A;  2DA2 A;  3OYM A;  1EV7 A;  3ZMZ A;  2ZJQ F;  1BC8 C;  1VI0 A;  2E60 A;  1ZAR A;  4C3H J;  2I8D A;  2BZT A;  4CCM A;  1YRN A;  5M5W J;  2OQR A;  3GTO J;  4LG3 A;  2DU9 A;  4L9T A;  2CU7 A;  4IEJ A;  4LIT A;  1DPR A;  1FPQ A;  1Q1H A;  2VOD A;  3CTA A;  2HEO A;  1BBY A;  4RGX A;  4RGU A;  3Q0U A;  4AC0 A;  3ZMT A;  3UKG A;  4XLA A;  5IT3 A;  2FQ4 A;  3HJE A;  2X4H A;  3PFI A;  1J09 A;  2JWT A;  2LH9 A;  2BY2 A;  2FBI A;  2RN7 A;  1QVU A;  2DMP A;  4PJM A;  2FQ3 A;  2ZCW A;  1ZH5 A;  3NAR A;  1WH7 A;  1XDU A;  3EUH C;  1VQM I;  3F8M A;  1HF0 A;  2PN6 A;  4IOA F;  2A3S A;  3JRI A;  3K10 A;  3BP8 A;  1ZN2 A;  2CW0 F;  1MW7 A;  2DBB A;  3TDU C;  2IP2 A;  4WX9 A;  1U8B A;  1A31 A;  3HG9 A;  1BOB A;  1YOV B;  4XBF A;  5FLV A;  1G59 A;  4AYB N;  3DF8 A;  1O3T A;  2JSC A;  1FBU A;  2VKE A;  1YG2 A;  5ICC A;  1VND A;  2BYV E;  3CJT B;  2VAS A;  4XSX F;  3MZH A;  3LFK A;  4KUM A;  5K1Y A;  3HHG A;  4GFB A;  1AA7 A;  1LFP A;  1QZE A;  2Q2E B;  2VKD A;  4IRI A;  1R5I D;  1IRZ A;  3F8C A;  2E1O A;  1OQY A;  4DYR A;  1Z9C A;  2G0E A;  3R0A A;  4RB2 C;  1D1C A;  2EFO A;  4RB0 A;  3LA7 A;  4NBQ A;  3QPL A;  2QUF A;  5BMZ A;  3R4K A;  2HXO A;  3QWL A;  5KAF C;  5L3F A;  1YIO A;  4PGH A;  3R60 A;  3BZC A;  2ETH A;  2R7W A;  4O6J A;  3A01 B;  3CME I;  3IHU A;  6PAX A;  5J6X A;  1V5E A;  2QCO A;  4UVB A;  2DDA A;  2Z16 A;  5D4R A;  2Q0O A;  1F36 A;  1BM9 A;  4M6V A;  3OMY A;  2KQR A;  2HQ5 A;  5EZH A;  2EJR A;  1F1Z A;  5C4J J;  4LD5 A;  5HOO A;  1T98 A;  3SZT A;  4AIK A;  4L5J A;  3O3K A;  2R7U A;  1UG0 A;  2V26 A;  3LSI A;  4A3M J;  1WVR A;  2P6T A;  5TGT A;  3E6M A;  4I09 A;  2H94 A;  3C2H A;  4Y3O A;  3U1K A;  1RR8 C;  1T56 A;  2DQL A;  3KFW X;  1B6A A;  2EA2 A;  5JLW A;  4ZYE A;  2R7T A;  2KIM A;  1IRG A;  3R61 A;  5IP9 J;  3BTI A;  4IRG A;  2QQA A;  4DIQ A;  2R5Y A;  2LLK A;  3OV8 A;  4FE4 A;  2VBX A;  4E4H A;  3DWL E;  2XUB A;  2DI3 A;  1BIA A;  4A5M A;  4HZF A;  1HW2 A;  3TP3 A;  2VJJ A;  2V7F A;  3E6B A;  4IL6 C;  4JX4 A;  4JQF A;  3A0H C;  3PNY A;  3VYU B;  1VQL I;  2GXA A;  1ETW A;  3LNQ A;  2DTZ A;  1IN4 A;  2P5K A;  3ONQ A;  3CCS I;  4BE0 A;  3KP4 A;  4NC8 A;  2VOO A;  1ODD A;  3EUK L;  3GXO A;  2QQ9 A;  3GTL J;  1MBK A;  5JI6 A;  1RET A;  3KZY A;  1IDZ A;  2FNA A;  3WTS C;  3MKY B;  3VOD A;  1LVK A;  1HXD A;  2X48 A;  3P9C A;  1TQI A;  2K9Q A;  3S14 J;  2DK8 A;  4M3B A;  4E7J A;  2YU9 J;  1BI3 A;  3I3L A;  2I5U A;  5HDK A;  2PMZ A;  1ZK8 A;  4UUT A;  1NTC A;  2F5F A;  3CF5 F;  2M2E A;  2AXT C;  4GDF A;  3H36 A;  4YII A;  4MFE A;  2B63 J;  1V5G A;  1WJC A;  5JR3 A;  1OCO H;  2P8T A;  2HPI A;  3PIP F;  3K4C A;  4G6Q A;  2XHK A;  4PDK A;  4RM3 A;  1LDJ A;  5DM6 F;  1J9I A;  4XK4 A;  4HG2 A;  1QBJ A;  2EV6 A;  2FU4 A;  1IXR C;  1ITY A;  5AIQ A;  4MEX F;  1LPQ A;  2V6E A;  4PUS A;  3M07 A;  4FX4 A;  3U2R A;  4WCG A;  2X1C A;  3L2V A;  1HDD C;  1G3T A;  2G9W A;  4EAT A;  3OYL A;  5J40 A;  3I5U A;  2OJE D;  2V1N A;  4E7L A;  4NHJ A;  1WPK A;  3I4N J;  2Y0S N;  5ILU A;  1S8N A;  2JZY A;  3OYF A;  3ZMV A;  2QWW A;  3V8K A;  1QNT A;  1VQ7 I;  3M8J A;  5EG0 A;  1SMT A;  1PJR A;  2R7O A;  3H0D A;  5CVV A;  4IHY A;  2Y9Z A;  5JVG F;  2F5C A;  3S17 J;  2NOJ B;  3CLO A;  1UMQ A;  3R6S A;  3K6G A;  1CGP A;  1VQ8 I;  1XD7 A;  4Q4Z F;  1KU9 A;  3I64 A;  3J7Y J;  3KEO A;  2Q8K A;  4MLO A;  2MA3 A;  4V2F A;  4DYQ A;  4XON A;  1TWA J;  3OR1 C;  1DGR M;  2F5D A;  1FYM A;  5LHI A;  1BI1 A;  5EGO B;  2NRA C;  4Z6Y A;  5L3G A;  5J1U A;  1R58 A;  3LQQ A;  2KT0 A;  2XRL A;  4A3B J;  3QOP A;  2UUZ A;  1IV8 A;  1UCR A;  3L09 A;  2KRF A;  3GTK J;  3S93 A;  1Z6R A;  2XAJ A;  2KRC A;  1ZQ3 P;  4F91 B;  1E17 A;  4JBA A;  3W2V A;  2FNP A;  2NS7 A;  2PFB A;  1TL8 A;  2KIS A;  3JSP A;  1USS A;  3ELK A;  3ZQI A;  2DFI A;  2QQ8 A;  4UVC A;  3HEF A;  1WJ5 A;  1IN6 A;  5AON A;  3ZR8 X;  1Y8R B;  3DBR B;  5ED4 A;  1R1V A;  5HS7 A;  2EIN H;  2GIZ A;  1EF4 A;  2J5O A;  2M5W A;  5FRN A;  4XRS G;  3ERE D;  4B3A A;  2M30 A;  3ASO H;  1KQ9 A;  2QLZ A;  3P9K A;  3RQI A;  1FC3 A;  1LKX A;  1XX5 A;  1O3R A;  3E5U A;  4HW0 A;  4I02 A;  3A2K A;  1RKT A;  3T8R A;  3RPU A;  2BOL A;  4AM3 A;  1TLH B;  4M3F A;  3F6O A;  1XTA A;  1YW7 A;  3L1P A;  4OIQ F;  3IH2 A;  2BY0 A;  2BGC A;  1JUP A;  5CVR A;  3F22 A;  3VSL A;  4Q48 A;  3MN2 A;  1G6N A;  2F4M B;  3PIO F;  4J01 A;  3J7Z I;  3HTU A;  4XLN F;  3E97 A;  4R79 A;  2HKO A;  2EV5 A;  4UB6 C;  1WJA A;  1UHS A;  1HLV A;  4LLG F;  2RKH A;  4NQW B;  2M45 A;  4QTR A;  2VL8 A;  3OYE A;  1N78 A;  4GGG A;  1JKO C;  1B9N A;  3CQZ J;  1ZRD A;  3GFM A;  1WI9 A;  4M72 A;  4XL9 A;  2CYY A;  2O0Y A;  3PQJ A;  3QRF F;  1YIJ I;  4CXF A;  2IA2 A;  1EH7 A;  4ENJ A;  2IS6 A;  1A6Q A;  1ACI A;  3HOU J;  4C30 A;  2JVH A;  5F64 A;  3M3Y J;  1SVL A;  1XGO A;  3DLA A;  4HLX A;  3L2C A;  3JRH A;  1BIB A;  3H3Z A;  3HPG A;  2VUM J;  4A3I J;  4I2O A;  4UHT A;  4L5I A;  4WXH A;  3HOX J;  2DPD A;  1MMS A;  2VQH A;  3CC4 I;  1R36 A;  2DTR A;  5D5W B;  1Z91 A;  2KDZ A;  4M74 A;  1UJ8 A;  1S7E A;  3RZO J;  3RYP A;  3S1Q J;  1K78 A;  1FOY A;  3DFG A;  1GV5 A;  4JX5 A;  1GV2 A;  1LDD A;  1MBF A;  1GVJ A;  3N05 A;  2RAE A;  1I5Z A;  2K4B A;  4ON0 A;  3JAM Z;  2KMU A;  5BS6 A;  2R7X A;  3ZQQ A;  1S7A A;  1Y1V J;  2LTP A;  2X6X A;  1R1T A;  4A3F J;  3DKW A;  4ZH4 F;  1K61 A;  5GPC A;  2UXX A;  3RKX A;  3TQN A;  4ABZ A;  3S2D J;  2IS1 A;  2MC4 A;  2MD5 A;  2X0L A;  2LRE A;  2K9N A;  3MFK A;  4EJW A;  5E8I A;  1ZR2 A;  3CDI A;  1ZGW A;  4A12 A;  4F3Q A;  1VQ5 I;  4C2T A;  2VPR A;  5M3F J;  5FKL A;  3L2Q A;  2IGM A;  1OCR H;  1TZL A;  1AKH A;  2LF7 A;  3I53 A;  4B43 A;  3EET A;  2MH9 A;  2W57 A;  3OIQ A;  5FKM A;  4DJA A;  1WI3 A;  4MNU A;  2XB0 X;  2WB1 A;  3FXU A;  2DMQ A;  4ZYH A;  2HWV A;  4CH7 A;  3SHF A;  1XB4 A;  3BR2 A;  3KYC B;  3SEQ A;  4BUP A;  3CCR I;  1R22 A;  3K4J A;  1JHF A;  2OF7 A;  3VDX A;  2WBM A;  5ICF A;  4QWQ A;  2XPW A;  1CQT A;  4O3M A;  1U9N A;  2P81 A;  4BBR J;  3ZP5 A;  4XOR A;  4BXX J;  5L3C A;  1SEU A;  2K02 A;  1BL0 A;  1IV6 A;  4BJ5 C;  5JHF A;  1WFX A;  3L2W A;  4A3C J;  3ZQC A;  1Z3X A;  2RC4 A;  4N9H A;  4HQE A;  4KN7 X;  1KON A;  4A2U A;  3ABT A;  4IHS A;  1IXS B;  4XLH A;  4KJZ A;  2VQG A;  4U88 A;  3BPV A;  1B1B A;  4G7H F;  2XV4 S;  3O8G A;  3CP2 A;  3CDH A;  1EH6 A;  4X1E A;  3J80 K;  2VLA A;  2CMP A;  3B02 A;  2K27 A;  4XM3 A;  1SFK A;  4RDU A;  1FOX A;  2DFE A;  3FDY A; 
#chains in the Genus database with same CATH homology
 1MBE A;  3CDL A;  1OCT C;  3HDD A;  1GVD A;  1IC8 A;  2H8R A;  5E3M A;  4MFD A;  2LKX A;  2L7M P;  2EZI A;  1JT6 A;  1DU6 A;  4LOC A;  1I6H J;  5C4X J;  3A01 A;  3G1O A;  2O9L A;  1WH5 A;  1X2N A;  2IBD A;  1AHD P;  2ID3 A;  4JX6 A;  1ETK A;  2NVQ J;  5F0C A;  2TRT A;  1Z77 A;  4D5F A;  3BG5 A;  1B8I A;  2EQR A;  1BA5 A;  5DS9 A;  3GTG J;  4D7N A;  3OSF A;  3C2B A;  1UG2 A;  2DA2 A;  2R93 J;  1JUS A;  2R7Z J;  2H1K A;  2Y31 A;  5F08 A;  1VI0 A;  1RKW A;  1B72 B;  1TWF J;  4C3H J;  2YS9 A;  1GDT A;  3DCF A;  3JRE A;  2YUS A;  3SFI A;  5M5W J;  5EYR A;  1YRN A;  3LSR A;  3GTO J;  3BR3 A;  2CU7 A;  4IEJ A;  1TWH J;  5FJ8 J;  3JRD A;  1QPI A;  3Q0U A;  4AC0 A;  3H0G J;  3UKG A;  1LFB A;  2FQ4 A;  5J1R A;  5EG0 B;  2JWT A;  2XB5 A;  4IHX A;  2JJ7 A;  1JTX A;  1QVU A;  2DMP A;  3B6A A;  1PUF B;  2ID6 A;  2E2H J;  3NAR A;  1WH7 A;  3PO3 J;  3S15 J;  1O4X A;  2LR8 A;  1HF0 A;  1OFC X;  3GTQ J;  3JRI A;  1PUF A;  2OPT A;  2NOG A;  1U8B A;  2N8G A;  2X6O A;  2LP0 A;  3QQA A;  5FLV A;  4V2G A;  1U9O A;  4AYB N;  1GUU A;  5F1J A;  2MSY A;  2VKE A;  2ZB9 A;  2QF7 A;  1H88 C;  1VND A;  2O7O A;  2ME6 A;  4GFB A;  4IHV A;  5EF6 A;  5FKN A;  3TW7 A;  5GPA A;  3BR6 A;  5M5Y J;  5E3N A;  1IRZ A;  2LFB A;  2E1O A;  4DYR A;  2E2I J;  2G0E A;  4DYC A;  1P7J A;  3M4O J;  3QPL A;  2HXO A;  4FE7 A;  1VFC A;  2DA4 A;  3A01 B;  4MIM A;  2M9H A;  3FIS A;  2XGC A;  5EEA A;  1HCR A;  2LVS A;  2DA3 A;  1JJ6 C;  2R0Q C;  1BW6 A;  2QCO A;  3TED A;  4B1R A;  1F36 A;  4M6V A;  2HQ5 A;  3ZOB A;  5EZH A;  1U78 A;  3A03 A;  5C4J J;  3OIO A;  5K7Z A;  1WGX A;  2XGD A;  2HOA A;  4A3M J;  3G1M A;  3S1M J;  1JKR C;  3K7A J;  2VI6 A;  3S2H J;  5FKO A;  3BTL A;  4NDL A;  2E19 A;  4M3G A;  1T56 A;  3RZD J;  5JLX A;  3DEW A;  5JLW A;  1MSE C;  2DA1 A;  2EZK A;  1FEX A;  5IP9 J;  3BTI A;  5FLM J;  2FD5 A;  4XID A;  4CYC B;  4J19 A;  2R5Y A;  2LLK A;  4FE4 A;  1QVT A;  1TWG J;  4Y7N J;  3TP3 A;  3K2A A;  4QIW N;  5HOD A;  2CUF A;  5IPA A;  4UUS B;  1LE8 B;  9ANT A;  1R9T J;  2Y9Y A;  4JX4 A;  5E3L A;  1RES A;  1E3O C;  1ETW A;  2K40 A;  2MG4 A;  5C3E J;  3LNQ A;  2DTZ A;  1ETV A;  3F0C A;  2ECB A;  2NVX J;  2JN6 A;  5F0H A;  1OCP A;  1APL C;  1NK3 P;  3GTL J;  1MBK A;  2DA5 A;  1RET A;  1IDZ A;  4A3J J;  2HYJ A;  3BR0 A;  4FIS A;  4JP0 A;  1A6I A;  2X48 A;  3HOZ J;  2L9R A;  3OOU A;  2JK3 A;  4BKX A;  2K9Q A;  3S14 J;  4X6A J;  2L0K A;  3A02 A;  4M3B A;  1SFO J;  3LSP A;  2YU9 J;  1ZK8 A;  4UUT A;  1IDY A;  3NAU A;  2DA7 A;  5IOY A;  1NTC A;  3Q0V A;  2MW8 A;  3S1R J;  1MH4 A;  2JA7 J;  2EZL A;  2M2E A;  1OJL A;  4I76 A;  4FCY A;  4MFE A;  2B63 J;  2DJN A;  2FJ1 A;  2XPV A;  2AO9 A;  3LSJ A;  4C3J J;  3RKQ A;  5K7H A;  4XK4 A;  2DMN A;  3GTJ J;  3FIW A;  1ITY A;  1P7I A;  4UUS A;  3BR1 A;  2HXI A;  1LE8 A;  5C44 J;  3WHB A;  3CMY A;  5E3O A;  3JRA A;  1HDD C;  1FTZ A;  2W48 A;  5F0F A;  1ETQ A;  1WPK A;  3Q3S A;  2Y0S N;  1JKQ C;  2CUE A;  3I4N J;  2XSD C;  1I3Q J;  5GP9 A;  4D5C A;  5EG0 A;  3BT9 A;  5DTD A;  4XRM A;  3TW6 A;  3FK7 A;  1RR7 A;  2Y30 A;  1FIP A;  1MH3 A;  1MNM C;  1MSF C;  2ELK A;  2I10 A;  4IHY A;  1IG7 A;  1POG A;  2Y9Z A;  5EGO A;  3S17 J;  1UMQ A;  2JMW A;  4A93 J;  1BJZ A;  3FKI J;  2O8K A;  2IEK A;  1K83 J;  4MLO A;  3BTJ A;  4V2F A;  1H8A C;  4DYQ A;  4L5E A;  1TWA J;  4Y52 J;  5M3M J;  2L7F P;  4JYK A;  1IJW C;  4C2M J;  5EGO B;  1LFU P;  4D7M A;  5J1U A;  4G12 A;  5IOZ A;  3JRG A;  2HOS A;  2KT0 A;  2XRL A;  4A3L J;  5K7F A;  4A3B J;  1ZR4 A;  3GTK J;  3HOV J;  1ZQ3 P;  1Y1W J;  2HDD A;  2EH3 A;  1YRN B;  1W0U A;  3HOY J;  2NS7 A;  5EDN A;  5IYB J;  3CCY A;  3ZQI A;  1F43 A;  4RBO A;  4A3K J;  3HEF A;  1XS9 A;  3GTM J;  2PMZ N;  3E7L A;  1SAN A;  1GT0 C;  2IAI A;  4XRS A;  2COB A;  3GTP J;  2HI3 A;  1EF4 A;  3BG3 A;  1JGG A;  5J3L A;  3MVP A;  2GLO A;  1QRY A;  4XRS G;  4B3A A;  1HOM A;  4QSH A;  1Z0X A;  4HNV A;  2L7Z A;  3RQI A;  3HOW J;  2M34 A;  4AUX A;  3S16 J;  3IH3 A;  1RKT A;  3JRB A;  4M3F A;  2TCT A;  4IHW A;  4C3I J;  3L1P A;  1RPW A;  3IH2 A;  1JUP A;  1JTY A;  5IYD J;  1FIA A;  3QPS A;  1WCM J;  3TP0 A;  2NVT J;  3MN2 A;  4CYC A;  2WV1 A;  4XIC A;  2HOT A;  5IP6 A;  3H3V K;  2LK2 A;  2EZH A;  1UHS A;  1HLV A;  4QTR A;  3Q0W A;  1H89 C;  1ZKG A;  1JKO C;  1XC5 A;  3CQZ J;  4A3E J;  3LOC A;  2M0C A;  3BQZ A;  1B72 A;  3B6C A;  2R5Y B;  1XG1 A;  2JA8 J;  2K9S A;  3HOU J;  3IV5 A;  3M3Y J;  3BG9 A;  1TWC J;  3JRH A;  2VUM J;  5F27 A;  3LSG A;  4A3I J;  1MBG A;  2FX0 A;  1G2H A;  5M5X J;  3OSG A;  3VPR A;  3WHC A;  3ZQH A;  1TC3 C;  2XGE A;  3HOX J;  2R5Z B;  1MBJ A;  1W0T A;  2DN0 A;  2DMU A;  2KDZ A;  4FTH A;  1S7E A;  3RZO J;  3W6V A;  1IUF A;  2X9D A;  3S1Q J;  4I6Z A;  3HKZ N;  3PO2 J;  1GV5 A;  1X58 A;  5FKK A;  4A3G J;  4JX5 A;  1GV2 A;  1I50 J;  1BW5 A;  1MBF A;  1B8I B;  2RAE A;  4B4C A;  1FJL A;  1ORK A;  3ZQL A;  1Y1V J;  2LTP A;  4BY1 J;  2ME0 A;  4A3F J;  2LY9 A;  3HM5 A;  1K61 A;  1JJ8 C;  1JKP C;  3BQY A;  5GPC A;  2MGQ A;  1T33 A;  1ETO A;  4ABZ A;  4A3D J;  3IH4 A;  3S2D J;  2CJJ A;  4M3D A;  1FTT A;  2K9N A;  2GM4 A;  1IGN A;  2EBI A;  3GBG A;  1ZR2 A;  4DW6 A;  5IYC J;  1ZTR A;  5J1Y A;  1ZGW A;  2VPR A;  5M3F J;  5FKL A;  1AKH A;  3SDG A;  3BR5 A;  1Q1V A;  2CQQ A;  1A5J A;  2AHQ A;  4S0H B;  2E2J J;  3JRF A;  5FKM A;  2M8G X;  4W97 A;  1WI3 A;  2NVY J;  2XB0 X;  3O8H A;  2DMQ A;  3JR9 A;  1NK2 P;  3I4M J;  2R92 J;  3BR2 A;  5F04 A;  2VKV A;  2OF7 A;  2JA6 J;  1AKH B;  2XPW A;  3D1N I;  1CQT A;  1AU7 A;  2XPU A;  1U9N A;  1ETY A;  2P81 A;  1X2M A;  1ENH A;  2Y2Z A;  2WAQ N;  3MKL A;  1DU0 A;  4EEF G;  3ZQG A;  4BBR J;  5IP7 J;  4BXX J;  4M3E A;  5EZG A;  2LD5 A;  1BL0 A;  3S1N J;  1IV6 A;  3PM1 A;  3FK6 A;  2CRG A;  1VF9 A;  4DZP A;  3G1L A;  4A3C J;  4BY7 J;  1HDP A;  3HGG A;  4DZJ A;  3ZQC A;  2GBY A;  2JA5 J;  1JUM A;  2DMT A;  3JRC A;  2ECC A;  3SJM A;  2D5V A;  1D5Y A;  2DA6 A;  4W1U A;  2NS8 A;  2WB1 N;  3BTC A;  3HBL A;  3O8G A;  3HGY A;  2R5Z A;  4MO7 A;  4A69 C;  1MBH A;  4X1E A;  3ZQF A;  1JT0 A;  4RDU A;  2CQX A;  1ETX A;  5BNG A;  3HB9 A;  4BBS J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...