1ETXA

The crystal structure of e. coli fis mutant q74a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
74
Chain Sequence
VLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRGNATRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 74
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etxA00
1IG7A 4FE7A 3HKZN 1ETXA 3K2AA 1R9TJ 1QVUA 3E7LA 3LNQA 4G12A 5F04A 5J3LA 5JLWA 3ZQFA 2IAIA 2O8KA 3S15J 1MH4A 2GLOA 5M5YJ 5F08A 3NARA 2O9LA 1A6IA 2ZB9A 2GBYA 5EG0B 1JKOC 3GTQJ 2MGQA 3JRIA 1Y1VJ 2DN0A 3IH3A 1H88C 4AC0A 4D7NA 2IEKA 1MSFC 2K9QA 1NK3P 3BR2A 4AUXA 2R5ZB 3G1MA 1VI0A 2VUMJ 4C3JJ 3S2HJ 9ANTA 2VI6A 2DMUA 2E2HJ 5BNGA 5FKNA 5GPAA 1I3QJ 1D5YA 1ETYA 4M3EA 1E3OC 2GM4A 3ZOBA 2JK3A 3NAUA 1JGGA 3MKLA 4W1UA 4DW6A 2Y30A 3BQZA 4M6VA 4I6ZA 3BT9A 2PMZN 1JTYA 3DCFA 2JN6A 3Q0WA 3A01A 3RZDJ 1K83J 5J1YA 1XC5A 4XIDA 1S7EA 3SFIA 3HDDA 1GVDA 1I6HJ 4QTRA 1ETQA 5IP7J 3GTPJ 3S17J 1ORKA 3I4NJ 1LE8A 1JKPC 2WAQN 1U9OA 2VKEA 4JP0A 1BA5A 1TC3C 3GTOJ 3PO3J 2KT0A 3OSFA 5E3LA 3JRAA 1MBEA 1ZR4A 3PO2J 1POGA 3HEFA 3BR0A 1WI3A 5C4JJ 1XS9A 1JKRC 2EQRA 1UHSA 5F27A 2X9DA 3Q3SA 5J1RA 2ME0A 4XRSG 1FTZA 1IDZA 3HOYJ 2CQXA 5IPAA 1BJZA 3HM5A 2IBDA 1VF9A 1NTCA 1GDTA 3HBLA 2LD5A 5F1JA 1JT0A 4B4CA 3Q0UA 4M3DA 2M2EA 4NDLA 4W97A 2M8GX 5IOZA 1RETA 5EGOA 1JUMA 2TCTA 2EZLA 4I76A 3BR5A 4JX5A 4XRSA 2HOTA 1DU6A 2NS7A 2ELKA 3SDGA 1LFUP 1T33A 2L0KA 1W0UA 2EZHA 2OPTA 2XGEA 1AKHA 2DMNA 5GP9A 5C4XJ 2R93J 3GTKJ 2JA8J 3LSPA 2NS8A 4FISA 1WCMJ 4V2FA 3FK7A 5GPCA 5M5XJ 2M9HA 2R0QC 1UMQA 2EBIA 2MG4A 1IDYA 3FISA 1G2HA 3TP0A 2O7OA 3A01B 2D5VA 4QSHA 2L9RA 5F0CA 4A3EJ 2NVTJ 3ZQHA 3GTJJ 1FIPA 5EF6A 1FEXA 3BTLA 2HDDA 1ZR2A 2JA6J 1LE8B 3JRGA 2X48A 2Y9ZA 3LSJA 4QIWN 1HLVA 1JTXA 4XRMA 4DYQA 2JMWA 4MFDA 2MW8A 3ZQIA 2FD5A 2LFBA 3JRDA 3GTLJ 3HGGA 5IYDJ 1X2NA 2CUEA 4A3IJ 2N8GA 4IHWA 1BW5A 2XGDA 1MH3A 2EZIA 4RDUA 2L7ZA 3B6AA 4BBSJ 3W6VA 4IHYA 5C44J 1WGXA 1CQTA 3Q0VA 4IHVA 2ME6A 4A3CJ 2X6OA 2W48A 4UUSA 5FKLA 4A69C 3M4OJ 4A3DJ 4DZJA 4M3GA 3LSGA 4EEFG 4D5FA 3LOCA 4BXXJ 2B63J 2ECCA 2K9NA 5EGOB 1FTTA 4A93J 3BTJA 1ZK8A 3O8HA 4M3FA 4MO7A 4C3IJ 4D7MA 1JUSA 5E3NA 5C3EJ 4BKXA 1BL0A 3HOZJ 3QPLA 2YUSA 1ZGWA 4MIMA 1AKHB 1TWCJ 2R5YA 1RESA 1WPKA 2DTZA 2HXIA 3QPSA 1ETOA 4RBOA 2WV1A 2ECBA 1IC8A 3A02A 3A03A 1X58A 1ETVA 3CCYA 3HOXJ 1ETWA 4CYCA 1YRNB 1I50J 2LP0A 2XRLA 1UG2A 4L5EA 4A3GJ 1F36A 1HF0A 1IV6A 3BG3A 3S2DJ 2Y2ZA 5FKOA 4X1EA 1IGNA 3CQZJ 4FE4A 1K61A 5FJ8J 3S1RJ 1B8IA 4XICA 3H3VK 1T56A 3BR6A 1OFCX 5F0HA 1Y1WJ 2EZKA 3FIWA 3K7AJ 3BTIA 4IHXA 2DA5A 3G1LA 4AYBN 5IYBJ 1F43A 3MN2A 5J1UA 2DA1A 1WH5A 1FIAA 3WHBA 1Q1VA 4UUSB 3VPRA 1MBGA 1QPIA 2CRGA 2JJ7A 4V2GA 4HNVA 2AHQA 3ZQLA 1U78A 1OJLA 2XB0X 3UKGA 1A5JA 5HODA 2OF7A 3IV5A 3TEDA 1JJ6C 2XPWA 2LR8A 3HOWJ 3BQYA 2XSDC 4IEJA 2R7ZJ 5FKMA 4B1RA 2ID6A 2E2IJ 1YRNA 1PUFA 2R5YB 1ZTRA 1AU7A 3TW7A 3RZOJ 3RKQA 3JRBA 2HQ5A 1NK2P 3FKIJ 1Z77A 5EYRA 1ZQ3P 3OSGA 1U8BA 3TW6A 2HOAA 4CYCB 3H0GJ 1TWFJ 2JA5J 4JX4A 4S0HB 1RR7A 1WH7A 1EF4A 1FJLA 2EH3A 2Y0SN 3HOUJ 4A3JJ 3BR1A 2VKVA 5FLVA 5M3MJ 5EZGA 1BW6A 1ETKA 2CUFA 2LTPA 2XPVA 5DS9A 4A3MJ 1O4XA 2FX0A 4LOCA 3S1QJ 1B8IB 4UUTA 1MBJA 2I10A 4C3HJ 2DA4A 4XK4A 1P7JA 5FLMJ 1H89C 2XGCA 5EEAA 1OCPA 1GUUA 1MBHA 3LSRA 2Y31A 1MBKA 2E1OA 1VFCA 1JKQC 3JRFA 2ID3A 3GTGJ 2NVQJ 2HI3A 2FJ1A 1GT0C 3BG9A 1X2MA 2CU7A 4D5CA 3JRHA 1HDPA 2H1KA 2JWTA 3JR9A 1MBFA 4J19A 2M34A 2MSYA 5DTDA 3IH2A 4MLOA 5M3FJ 1TWGJ 2LK2A 1GV2A 2DA2A 3DEWA 2DA3A 1GV5A 5K7FA 5K7HA 3ZQGA 1H8AC 4Y7NJ 3M3YJ 2QCOA 2H8RA 1PUFB 1APLC 3HGYA 2DMPA 2LLKA 1OCTC 4ABZA 4DYCA 2YS9A 1IRZA 3JREA 2COBA 4JX6A 1JUPA 2P81A 3GBGA 1ITYA 2E19A 2K9SA 3RQIA 2M0CA 5EDNA 2YU9J 3OOUA 1JJ8C 5K7ZA 3S16J 3MVPA 2NOGA 4FTHA 3QQAA 1TWHJ 1ZKGA 4A3LJ 3C2BA 4X6AJ 1HCRA 2RAEA 1IUFA 3PM1A 4B3AA 1B72A 1HOMA 3G1OA 5EZHA 2NVYJ 3BG5A 3S1NJ 3IH4A 1JT6A 2Y9YA 5JLXA 1QVTA 3D1NI 1RKWA 2DJNA 4JYKA 2E2JJ 2JA7J 4M3BA 5F0FA 2L7FP 5IP6A 2L7MP 5EG0A 2K40A 3OIOA 1RPWA 1U9NA 2R5ZA 1HDDC 4A3FJ 2DA7A 2DMQA 2WB1N 4A3BJ 2DMTA 3L1PA 3HOVJ 5FKKA 2XB5A 3I4MJ 2NVXJ 4DZPA 2LKXA 1MNMC 3F0CA 3BTCA 3HB9A 2DA6A 2LY9A 2HXOA 2HYJA 4C2MJ 3JRCA 1XG1A 3FK6A 3O8GA 1ENHA 1W0TA 1P7IA 5IP9J 3TP3A 3WHCA 5M5WJ 2LVSA 2XPUA 4GFBA 2AO9A 2QF7A 2G0EA 1MSEC 2FQ4A 1IJWC 1LFBA 4FCYA 1VNDA 1AHDP 1QRYA 2VPRA 2CQQA 5IYCJ 2HOSA 3BR3A 5E3MA 3SJMA 5IOYA 3S14J 3CMYA 1RKTA 3ZQCA 3CDLA 2TRTA 1SANA 4A3KJ 4DYRA 4MFEA 2R92J 4BY1J 1SFOJ 2CJJA 3GTMJ 1TWAJ 3S1MJ 5E3OA 4BBRJ 3B6CA 4Y52J 1DU0A 1Z0XA 4BY7J 2KDZA 1B72B
chains in the Genus database with same CATH superfamily
3PIPF 4FE7A 2LNBA 5LLQA 3LNQA 4RB0A 1JHFA 5J3LA 3OS2A 3DV8A 2O8KA 3S15J 1UHWA 3CP2A 1UZCA 2O9LA 2EIJH 1J0RA 2GBYA 5EG0B 2QZ8A 1JKOC 3GTQJ 2KZGA 1G3SA 2DN0A 4P5OA 3IH3A 1MJAA 2O61A 3TDUC 1H88C 1A35A 4AC0A 1Z1DA 5CJ9A 1MSFC 2K9QA 4RMNA 2ADUA 2IRFG 3MZYA 1ZRDA 3E6DA 3S2HJ 4S05A 9ANTA 2IXSA 3RQ4A 2ZJPF 5D5UB 2B7EA 1Z05A 1CGPA 4RAFA 3WU2C 4XQFA 4BS9A 3F23A 3DXJF 1X19A 3K4CA 3NAUA 3H92A 3QPTA 3IRQA 4W1UA 2C6YA 3KETA 4M6VA 3JTHA 4BXUA 1MGTA 5LEKA 4FASD 2PMZN 4XSZF 1JTYA 3DCFA 2VBYA 3KP2A 2MBFA 3OIPA 3PUBA 2RV8A 3DU6A 3PL8A 1YTYA 3CCUI 2EFNA 3GVAA 2M30A 1GVDA 3L09A 3U9GA 3QP6A 3F8FA 5D6EA 3COAC 2G7UA 1YFHA 3GTPJ 1LE8A 1X4OA 4C2TA 2MFZA 2UWMA 3HL2A 4ESFA 1KU9A 2XAUA 1P2FA 2Q2EA 3FMQA 4FT8A 1YG2A 2BY3A 3AKZA 3GTOJ 2KQRA 2WC2A 2FRHA 2KT0A 3KP4A 1MMDA 3SZPA 4H4KC 1ZR4A 3CF5F 4BDYA 1YIJI 3HEFA 1XGNA 1PUEE 3FHZA 1JKRC 2EQRA 1STZA 3AG3H 4MGRA 2M4KA 4ZZDA 5BS6A 1F4KA 2YU3A 4NHJA 1IDZA 3IAM2 5ICEA 2CGPA 5D4RA 1BJZA 4RGSA 1SC7A 2KIFA 4UVCA 4AYBA 1NTCA 3HBLA 2BVLA 3GLXA 5F1JA 1HW1A 5E20A 4B4CA 2P5VA 2KLOA 2HKOA 4M3DA 2EK5A 1XB4A 2XASA 3BPVA 1ZG3A 1LDKB 2EFOA 3S32A 5DCMA 4CCOA 3VEPA 2ZMEA 1ON1A 3BZ6A 4MTDA 1XMAA 1U5TC 3W6KB 3BR5A 1S3JA 3PNYA 3I58A 4XRSA 1GXQA 2NS7A 4MQVA 1ZGJA 3MKWB 3MCZA 2CO5A 4U7DA 1PYVA 1YIOA 2EZHA 3E5XA 3GUDA 4XN0A 5GP9A 1GLNA 1R49A 3GTKJ 5AIQA 1USSA 2NS8A 4V2FA 5CVUA 5CVJA 4XLHA 2R0QC 2XUBA 4RLFA 2DPDA 4OMZA 2OZ6A 1Y0NA 5HLTA 1LVAA 3I64A 1ZG5A 2CWEA 1W36C 4I2OA 2STWA 4U0VA 3GTJJ 3BG6A 2K9MA 4PJLA 1FIPA 5HLHA 2HPIA 5IY5H 2XF7A 4Y17A 3ZN0A 1LE8B 4PFPA 2X48A 2XAJA 5CPRB 3LSJA 3DFGA 2Q8KA 2DU9A 2JMWA 3E5UA 2Q2EB 4F7ZA 1IUYA 2CQNA 3P5JA 4IRGA 4N4OB 3IKVA 3RJPA 5L3GA 2N8GA 1SEUA 4CCJA 2XAHA 2W24A 2EWNA 2XGDA 4FHTA 1D0YA 4P55A 1BOBA 5ICFA 4Q5SF 3HC7A 1X1AA 2ME6A 1FOWA 1VQLI 2X6OA 2X1DA 4IQ4A 4I99C 1Z67A 2JUGA 1TQIA 4IZZA 2H1LA 4ZDLA 4M3GA 5BOXA 1U2WA 2JTVA 5TGTA 5DCMB 2ESNA 4QPOA 3M8FA 2ZMEB 3CO7C 1ZN2A 4M3FA 3DKWA 3LFKA 2IT0A 1Q1HA 3CDHA 1LDJA 3HSFA 2X6YA 5C3EJ 5B66C 3DBLB 2YUSA 2PJPA 2LF8A 3CESA 1NG7A 5BMZA 1ZGWA 1FOYA 4MIMA 2KKOA 2EILH 5KCMA 2R7SA 2HZDA 5CQGA 4R8HA 1ETOA 4IVNA 1E17A 3W2AA 2VQHA 2D1VA 3A02A 3A03A 3M1CA 1D0ZA 3MEXA 1TTYA 2R7VA 5DUKA 3H9GA 3PNVA 5ILSA 4KITB 2XRLA 3S8PA 3AFHA 2Y0MA 2Y48A 1K6OA 1MMSA 5GAGJ 3S2DJ 4AIDA 2DDAA 5HDKA 2MLGA 2WTEA 2Y2ZA 3U21A 5FKOA 4MEYF 3F21A 3CC2I 4BDZA 2BHYA 2M4GA 1A31A 1QQIA 4HEA2 3HUGA 3HTUA 4KIGA 1I5ZA 1V5FA 4HX7A 2BE5F 3IWFA 1UB9A 4WXCA 1GVJA 3WTVC 2XKOA 3AG2H 5F0HA 1OYIA 1Y1WJ 5LD2C 1LPQA 1QPMA 1U3EM 5DEQA 3GFMA 3FIWA 2OTLI 4BQNA 3DLLF 1QHGA 3DLAA 4EJWA 4RB2C 5ICCA 3WTYC 2XAGA 1FIAA 3R0JA 3W6JB 4P96A 1MBGA 1QPIA 4HNVA 5F64A 2RVCA 3ZQLA 1U6GA 3QAHA 1HXDA 2DFFA 2IVMA 4CDGA 3IV5A 3TEDA 1KQ9A 1OMIA 1JJ6C 2XPWA 2CQKA 3TMOA 2H09A 3DF8A 3K4BA 2RNJA 3VYTB 1MNDA 4E70A 3AL0B 3ML6A 2Z33A 2LKPA 2X51A 1MZBA 2G7HA 2KISA 4NB5A 2ID6A 2PMUA 3V8KA 3H5RA 3VYRB 1ZTRA 1BI1A 2DTRA 3RZOJ 2DPUA 4HDUA 5DDGA 1NK2P 1LJ9A 1F9NA 4OMYA 1ZQ3P 1U8BA 5H6QA 2LBFA 3TW6A 1Z7LA 2YPRA 5HDNA 1D8JA 3JW4A 2V1XA 1W5SA 4JX4A 1MIJA 4WWCA 2R3SA 1ERDA 4S0HB 2RNGA 1KYZA 1FJLA 2NNYA 1QA6A 2X0LA 3OYKA 3A4CA 3BR1A 5D5XB 5BQTA 5M3MJ 4B3XA 1UELB 5H20A 3HKZA 4KN7X 3SYTA 3WTUC 2L5QA 3MFKA 1XPXA 2VONA 1ETKA 4UHTA 3D5LA 2CUFA 3ESWB 3HUGB 4AIJA 3S1QJ 1EJ9A 4J01A 1YLFA 1V5GA 1FY7A 3BCAA 3GFIA 3S3OA 1F1ZA 4XK4A 1AOYA 2OD5A 5FLMJ 2QQBA 2XGCA 1MBHA 3PSFA 1JXSA 3R0AA 4Y4RA 2HVSA 2P0WA 3OYEA 2V4JC 3OYFA 4A6EA 4M71A 2ID3A 4CCKA 4CZZA 1LEAA 4MQ9F 2HI3A 2FJ1A 1GT0C 1X3ZB 1WQ2A 4WCGA 3FBNB 4YG2F 3KZZA 2A6EF 4CICA 3GEZA 3LSKA 4YRVA 2E35A 3F9KA 2A5WA 2F5VA 3MWMA 2H1KA 2A5YB 2MSYA 5DTDA 1FMVA 2FA5A 3FXUA 4RS8A 3E0JB 5E1WA 1XN7A 4BH9A 1YHQI 1E2XA 3IH2A 4MLOA 4CCNA 2WBMA 1VQ6I 2OA4A 1EH8A 4LJZF 1GV2A 5ED4A 2KPMA 4F91B 1TZLA 1G6NA 4EGZA 1W36D 1GV5A 3KP5A 5K7FA 3ZQGA 1FBUA 1H8AC 1IN5A 2H8RA 1RR8C 4HRIA 3RIRA 2ZJQF 1QHHD 5DM7F 1SD5A 3JREA 4BACA 1JUPA 4FETA 3KX2A 5FGMA 3TDZC 4XOTA 4ZTJA 2EPFA 2QLZA 1KZHA 3ZQQA 4DNCA 4BQQA 2FOKA 1BR2A 1D1CA 1TP4A 3GLLA 2LBFB 2LDUA 1Z3YA 5EDNA 3LAPA 3MVPA 3U1KA 1B9NA 2PFBA 3CCQI 2NOGA 4FTHA 3BC8A 4M9ZA 1ZKGA 4D1QA 1OCRH 2VKDA 4LLGF 4P9UA 2HQNA 3LA7A 1K4TA 1IUFA 3DEUA 1KGSA 3PM1A 1XMKA 4X0GA 1B72A 2GXBA 3G1OA 2LRDA 4IXAA 1FYMA 1D3YA 3BG5A 3IH4A 4RAGA 5JLXA 3V7SA 1X3WB 2IGNA 4JYKA 4NQWA 2VC0A 3K6GA 3PQKA 4YIFA 4CH7A 5IT9Z 2K40A 3GFLA 1JHHA 3KLOA 3OY9A 2OBPA 3JSOA 1U9NA 2F4MB 2HQRA 2R5ZA 1HDDC 2DA7A 2MLKA 2QM3A 3IC7A 2DMTA 3GMEA 3P9IA 3MMYB 3CCSI 1SFXA 1SVOA 2K27A 2V6CA 1DGWY 3F0CA 3BTCA 2M5WA 2ZFUA 4I02A 2DA6A 4EV0A 2XRNA 1YI2I 3K4NA 2DDBA 1ACIA 3H3ZA 2HXOA 2HYJA 4C2MJ 2PMHA 2W7NA 4E7IA 2PI0A 4U0WA 5FB2A 5EEHA 1P7IA 5IP9J 3LL7A 3L2UA 3L2QA 5GAHJ 5M5WJ 3OMYA 2JPBA 3W2WA 3KYLA 1HBXG 4BQOA 3V8LA 3A2KA 1IJWC 1LFBA 4N9IA 2ZO4A 4FCYA 2F5DA 1U8RA 2CG4A 4PCQA 1QRYA 2VPRA 2CQQA 1XSDA 2E1MB 1WJ5A 2H6BA 2K3PA 3PJRA 2VC1A 1O57A 3BDDA 3SJMA 1WSUA 3S14J 1RKTA 2TRTA 4ON0A 4A3KJ 1XDUA 4DYRA 1I1GA 1SFOJ 4RA2A 3S1MJ 4GYIA 4Y33A 1VZ0A 3B6CA 1SFUA 2FNAA 2DFHA 4UUVA 2KDZA 1B72B 3HPGA 1IG7A 3MQ0A 1RUNA 4CSWA 1R9TJ 1RIOH 4YIIA 2ZXHA 4PJ0C 2KP6A 2JRMA 3L7WA 3E7LA 4LFUA 2M8EA 2W1OA 3HJEA 5F04A 3S3NA 3VOEA 4NBQA 4HNUA 2IAIA 3P7NA 4NQWB 1HSTA 1IRXA 3DQVC 1TT5B 1A6IA 1SD7A 2DFIA 2ZB9A 2DLLA 3T0YA 1LVKA 1HKSA 2AXLA 1NK3P 1B9MA 3BR2A 2R5ZB 3G1MA 1VI0A 2P4WA 4C3JJ 4CCMA 2VI6A 1SVLA 3FXOA 2DMUA 2QENA 3G71I 5FKNA 1N77A 5GPAA 4P9FA 1ETYA 2EV0A 3IHUA 4M3EA 5E17F 2W00A 4KIBA 4GXOA 4KICA 4YIRX 4BL0B 3ZMDA 3KIOA 1FOKA 1XMXA 3Q0WA 3RZDJ 3EPZA 1XC5A 3CCLI 3SDBA 3EQLF 1B1BA 4ASNA 4XKWA 2QUFA 1S7EA 3HDDA 2EFQA 2Z16A 2EB7A 4O5VA 3ULQB 2CQ7A 3VSKA 2DO7A 4GRIA 4O6JA 2CS3A 3D5RC 4R1HA 4JP0A 4LD5A 3WE2A 1TC3C 2JUCA 2ZNYA 3KP6A 1IF1A 2QQ8A 2BVMA 2HTSA 3OSFA 1T08B 5DM6F 4MNUA 3PO2J 1POGA 2P8TA 1YE9A 2BXYA 2M1BA 5EEGA 5C4JJ 4LK0F 2JPCA 3CMEI 3H9JA 4IO9F 5LRSA 2HYGD 3FMSA 3HIFA 2QKMB 5FLXK 5BPDA 2ME0A 4XRSG 2Y75A 3CJTB 4PGGA 1XSXA 2ZMEC 1T39A 2IBDA 2LD5A 4RLQA 2BBYA 3ZRGA 2CYYA 3AG4H 3C2GA 3QYBA 3E1SA 2QKLB 4L0YB 4HBLA 2M2EA 1AWCA 2KJCA 3IAS2 5IOZA 1YW7A 5B5EC 3H35A 1RETA 4NC8A 3X2QH 3GXOA 2TCTA 2EZLA 2BOLA 1USTA 3NWSA 2BGCA 2K7LA 2WB1A 5L3EA 2E7WA 2HOTA 1K78A 1G59A 3KPHA 5K1YA 4CA0A 1X1DA 3ZMZA 1T33A 2L0KA 1W0UA 1YYVA 2EV6A 1AKHA 4LIUA 2DCEA 1PP8F 5H2FC 2EIKH 2MD5A 1WCMJ 3FK7A 2QQAA 3RYPA 4LG0A 1S8NA 3ABMH 3F3XA 3I0TA 1QZEA 1KU3A 2L7KA 3FXKA 1IDYA 3FISA 2CV1A 5J40A 1H9GA 3RDIA 3NRVA 2L9RA 4G9YA 5F0CA 1MDMA 2NVTJ 3DPTA 3ZQHA 2PG4A 5LBQA 2WY8Q 2P6SA 4UY8I 5L3CA 1A6QA 3KP7A 4LK1F 4OAZA 1WJFA 4MFDA 2MW8A 3CUQA 1Y8QB 2LFBA 2HZTA 3JRDA 3EUHA 3FZVA 1O3TA 3WE3A 1JI8A 3FXQA 1FZPB 2FE3A 2CUEA 1EV7A 4EQQA 4A3IJ 1LB2A 2P7CB 1VTNC 1T6SA 1MH3A 2X85A 5ILVA 1WI9A 3L9FA 4HF2A 4JBAA 3OYCA 4G94A 4O3MA 3DU5A 2Z1DA 1HKTA 4IHYA 1WGXA 1CQTA 2GQQA 5CLSA 3AL0C 4H0EA 2E71A 4G6QA 3REOA 3A0BC 1W4MA 6PAXA 2W48A 5FKLA 2P5KA 3M4OJ 3BZKA 4UVBA 1SFKA 3LSGA 2DOAA 2XHKA 2ZSIB 3LSTA 3FXMA 2DW4A 4BXXJ 2W25A 3Q9SA 3QODA 2KRFA 3RYRA 1G3YA 4XONA 3FXLA 1ZK8A 1T0FA 1YW9A 4LLNA 5HS7A 2IW5A 1YJNI 1K78B 5E8GA 3VFZA 4BKXA 3JAMZ 2E60A 1WZ2A 2FMLA 5E1ZB 3W3CA 1AKHB 1LNWA 2CUJA 2ZXIA 1PP7U 2PMZA 1S9HA 2VE8A 2L4AA 2HPMA 1UFMA 1BR1A 2EINH 4XLAA 2KIMA 1FPQA 4PDKA 5J6XA 4LG0B 1SAXA 2HKXA 2VOPA 3OS1A 5HOOA 4CGZA 1OR7A 2V1UA 1ETWA 1YRNB 1MDMB 2PJRA 2OC6A 4MEXF 2P7VB 1I50J 2AS5F 2DYSH 2IS2A 4JK1X 1F36A 3CJRB 3HYIA 2K9LA 3L2WA 2CMPA 3BG3A 5HDGA 1QO0D 3CJQB 4E4HA 1TW3A 2ZXJA 3WGGA 3CUQB 5IT3A 5LGNA 4HG2A 1K61A 3L2CA 2ZXWH 1XD7A 3DWLE 1TQMA 3QU6A 2CW0F 3V4GA 1TNTA 3QYFA 3G6EI 1T56A 1RI7A 3LSMA 2EZKA 3K7AJ 4ENJA 2LMDA 3ASOH 1BJAA 3K1PA 4AYBN 3BG7A 5B3SH 1F43A 3SZTA 3MN2A 1AA7A 3R4KA 3OYDA 3TL4X 4F52A 3WHBA 1QZYA 2V26A 2WADA 1HA8A 2CRGA 2JJ7A 4V2GA 4L18B 4EM2A 4OIOF 4G7OF 2ZKZA 5LEJA 1U78A 1JGSA 1TNSA 1MMGA 5DD8A 3KCCA 5HNHA 1A5JA 5HODA 2OF7A 3ECOA 4I0BA 3HOWJ 4F92B 2XROA 4F93B 3N97A 2R7ZJ 3DKXA 3KZYA 4A12A 4A2UA 2VJIA 2E2IJ 4C2UA 4F3QA 1J2XA 3F22A 3C3WA 1IV8A 3ABTA 5D4SA 1VQMI 1BR4A 4GYGA 2M3AA 4D0PA 5CVIA 5J8CA 2GAUA 3OYJA 3H9QA 3SEZA 2XDVA 1Z77A 5EYRA 4NC7A 2LY1A 5HVQC 4LLLA 2HOAA 2PJRB 4EATA 1QZZA 4IHSA 2JA5J 3K4MA 1O7LA 4B47A 4BAYA 1Z91A 2F6CA 5D5VB 4WK8F 3ERED 4BE1A 2OZUA 3HOUJ 1WJAA 3OS0A 2MC4A 5EZGA 1QNTA 2H27A 2QYOA 4B44A 5J4YA 3G73A 2LTPA 2XPVA 5DYMA 2FX0A 3J7ZI 4BJ6C 3LQRA 1J5YA 4BU2A 4UUTA 4C3HJ 1HW2A 2NXNB 3K70D 1P7JA 1WWXA 1FOXA 3TOAA 3DPLC 2K85A 5D6FA 1MKMA 4L9TA 1GUUA 4QWQA 3LSRA 1EH6A 2E1OA 1VFCA 1JKQC 2DQLA 2NVQJ 1IXCA 5K5RA 2CU7A 3HHGA 2Q1ZB 3WG9A 2GIZA 1WJBA 4D5CA 3JSPA 3CUOA 2FNPA 1Z21A 2DYRH 2FU4A 1HDPA 1T2KA 2ZNZA 5CKTA 4OIPF 1VQNI 3JR9A 1MBFA 1HW5A 1H9TA 2FEZA 3WTXC 2L9SA 3BPXA 4L5IA 2DJIA 4YFXF 4KDPA 3RCOA 2E1MC 5M3FJ 3VSLA 2LK2A 4HOBA 3ZMSA 3C18A 3JCUC 5L3FA 2Z2SB 1TLHB 2DA3A 3T5XA 5K7HA 5FD5A 2VT3A 1T95A 4RGXA 2JVGA 1YX3A 1APLC 2R7TA 2DMPA 1R7JA 2LH9A 1IRZA 2VQGA 2IS4A 1XCVA 3HOSA 4UNOA 1RNLA 2P81A 3G3ZA 2QQ9A 4PSXA 3RQIA 5LGUA 4AM3A 3GYHX 1P4XA 3BROA 2M0CA 2HYFA 2YU9J 3EUKL 3T8TA 3OOUA 1JJ8C 3T1BA 2K4BA 3CO6C 4A3LJ 2LKSA 3P9KA 3DP7A 3TBIA 4I01A 2X1EA 4ZYAA 2XVCA 1D1AA 2LF7A 2OCEA 3ZCOA 3CCJI 1JT6A 2Y9YA 2L54A 2HEOA 3GF2A 1QVTA 4RM2A 1RKWA 1S72I 1T98A 2X1CA 3JTGA 4BQAA 3LQQA 4HQMA 1Y0UA 1IN4A 2HDWA 2J5PA 5F0FA 5IP6A 2YSRA 2L7MP 1LUJB 3CD6I 3HSRA 5JR3A 3DBHB 1I3AA 2HNHA 3R6SA 4A3FJ 1BC7C 4KIFA 1ZYRF 2O03A 4A3BJ 1FT9A 1XTAA 4M6YA 3VYSB 2ZJRF 5FKKA 2X6WA 3HOVJ 1V55H 2R7DA 3I4MJ 3Q5FA 2XGXA 2DBBA 3OYLA 1LFPA 2LY9A 1P9QC 5JHFA 2UUZA 3JRCA 2L2OA 5D8KB 1ENHA 1NHAA 1W0TA 1OISA 1SVMA 4KT6A 5AONA 3BZCA 2OJED 1FWZA 4HPQA 2LVSA 3HRSA 5H6RA 2XPUA 4GFBA 4IF4A 3ZMTA 3RKYA 5DUIA 2G0EA 2FQ4A 4FQGA 2DOFA 1YX5A 4EM0B 3K2ZA 3HTSB 1VNDA 3HG9A 1V5EA 5GTIC 5IYCJ 1RZ4A 5E3MA 1Z6RA 2CSOA 2LC2A 4F55A 4OAYA 1Z9CA 5JHUA 4BJTA 1BOAA 2IGKA 2CJJA 5TRDA 1MJ9A 4HV6A 2CH0A 2JQ7A 4MHGA 2VBWA 4BBRJ 3IP4B 3PNTA 1DU0A 4ZJZA 4A0ZA 5L3DA 3TO6A 2UXXA 3HKZN 1ETXA 4UB6C 3CC4I 3ABKH 2MA3A 2OAZA 4IOCF 4G8XA 5F6FA 1RUOA 3L2VA 2VPLA 3ZR8X 1ZRCA 3C2HA 3ZQFA 4HF0A 4NUBA 1MH4A 5IT9K 2GLOA 5M5YJ 2F4IA 3NARA 2XSJC 2VKHA 1KA8A 4BE2A 4RGRA 4RAZA 3JRIA 3CLQA 1DQUA 4FX0A 2VN2A 1FX7A 3HZJA 3QOEA 2QSHX 1FYLA 4IRIA 3OWTA 1J7KA 2OV7A 2VUMJ 2VQCA 4L9NA 3SQNA 5B1AH 2YR2A 4DIQA 4LB5A 2DFEA 3PSIA 1I3QJ 4LG3A 1E3OC 3ZOBA 1RC9A 1VQ4I 4DW6A 4EGYA 4I6ZA 2Z9OA 3BT9A 4G6DA 4RB3C 1N25A 3A01A 1K83J 5J1YA 2IA2A 2IJLA 4B48A 3WGHA 1O7FA 4XIDA 1B4AA 3SFIA 1I6HJ 4QTRA 1WJCA 5IP7J 2ELJA 1TQPA 2O3FA 1R00A 1JKPC 3I4NJ 3FXJA 1K7AA 5E79C 2DQRA 1GXPA 2WAQN 1HSJA 1U9OA 1VQ8I 2VKEA 2XAQA 3UNGC 1YJ9I 2XKPA 5E3LA 1MBEA 4N0BA 1OCOH 2V1NA 5L3BA 4KFCA 1WI3A 3K4JA 2GZWA 4BHPA 3DEEA 3I71A 4ZYEA 4ZYDA 1DP3A 2X9DA 3Q3SA 3KFWX 5J1RA 2ESHA 2F2EA 3GZ6A 5IPAA 1DPUA 4L9JA 4JOMA 1VF9A 1ON2A 1GDTA 1I27A 1Y39A 1W7PA 1JT0A 3ZMVA 1FBQA 3U2RA 3I54A 3QU3A 2FBIA 4PJJA 2IS1A 1FYKA 1D5VA 4W97A 4NDLA 2LYCA 3WTWC 2VB6A 4ESJA 2M8GX 3K4LA 3GCMA 2ZBKA 3CP8A 3ELKA 1EKEA 1JUMA 2VT2A 3F6VA 4E7SA 1KONA 2ZCWA 3FM3A 1Z7UA 4AU7A 5LHGA 1LQ1A 4E7KA 4JX5A 2BY0A 2FBKA 3NQOA 1DU6A 2UZKA 3C1DA 2RQPA 2ELKA 3C7JA 4GCVA 1OCCH 3OOPA 3PFYA 4IOAF 2M7AA 1T38A 2OPTA 2DMNA 2JA8J 5GPCA 1H0MA 1JE8A 1MD0A 3K4KA 1YJWI 3TKYA 2EBIA 2MG4A 1QU3A 3CUQC 4CYDA 1GHCA 4B43A 2D5VA 3A01B 4QSHA 3EUHC 1ZH5A 4A3EJ 3RPUA 5A2QK 4IPAA 5EF6A 2HDDA 5LFAA 2JA6J 2HDCA 3KEOA 2F5EA 1J75A 2FMYA 3OIQA 2Y9ZA 4QIWN 1HLVA 2XIGA 1JTXA 4XRMA 4DYQA 3K0LA 3MAJA 3QWLA 3GTLJ 3HGGA 4LGWA 2OTJI 5IYDJ 2L4MA 2LOOA 5FFZA 1BW5A 3L2RA 4TV7A 1R71A 3PQJA 3ZPLA 2R7OA 4RDUA 3B6AA 3TQNA 4PZJA 4BBSJ 1VQKI 3HOTA 5C44J 3Q0VA 2O8XA 1FMWA 2XF6A 3GWZA 2XC7A 2O6GE 4IKFA 1W7PB 1XX5A 1ZRFA 5DD4A 1T0FC 4YELA 4UUSA 3RSNA 1S29A 1A36A 4S04A 3FWEA 1TW2A 1R1TA 4A3DJ 1R58A 2V9VA 4DZJA 4Y15A 4RB1A 1IAWA 4GDFA 4EEFG 4D5FA 3LOCA 4ZH4F 2B63J 3I3LA 1FTTA 3CTAA 4Q47A 2GA1A 2W84A 5EJCA 3M07A 3DPUA 2W57A 3O8HA 4MO7A 4C3IJ 2W4SA 1JUSA 1OR7C 1SD6A 3OYHA 5E3NA 3QYEA 3HOZJ 1FP1D 5GADJ 3QPLA 1BL0A 3N05A 3SXYA 2R5YA 1RESA 2VBXA 2M45A 3K1NA 2DTZA 1ZHFA 2HXIA 5A2QZ 2PLYA 1NG6A 1SD4A 2FOWA 3QPSA 2RGVA 3OL4A 2OU2A 1IC8A 3M8EA 3VDXA 1X58A 1ETVA 4UXNA 3HOXJ 1SAUA 4G7ZF 1LDDA 2CW8A 4CYCA 3HSEA 3A0HC 3F6OA 4OIRF 3G4SI 2KMUA 3BY6A 2LP0A 4XOPA 2DK8A 4EJVA 1HF0A 2WA0A 4XLCA 1IV6A 1L0OC 3CCVI 3FKJA 4XLEA 3RKXA 4E7ZA 3CCRI 4HLYA 2HTJA 1N75A 2W82A 4X1EA 1X1PA 2M7BA 4N9HA 1DGRM 2OQRA 3H5NA 1S6LA 3B73A 1OPCA 3GX4X 1B8IA 4XICA 4HLXA 3LSHA 3QPHA 3A1YA 4M9SA 2IA0A 4AWXB 2E34A 1UAAA 3K70C 3BTIA 3I5UA 3HHHA 2MABA 3PFIA 2K3FA 4PSWA 4IHXA 4NC6A 2VLAA 2DA5A 2Q0OA 3KZIC 1WRJA 5J1UA 4AIKA 1WH5A 3LMMA 4CUGA 1HQCA 3DBRB 1Q1VA 1Y6IA 3FMRA 4UB8C 3VPRA 4UUSB 3MKZA 4IX7A 4M74A 2FBHA 2AHQA 5GTHC 1P6RA 4OIQF 1XGOA 1OJLA 2XB0X 3WODF 5TJJA 2EJRA 3GW2A 4PJMA 3GZ5A 3E6MA 3W2VA 3J7YJ 1YITI 4YFNF 2LR8A 2EIMH 3BQYA 2H94A 1BBYA 3F8BA 3FBIB 3T8RA 3ZP5A 1XSVA 1R1VA 3JAMK 2VXZA 1XGMA 3R61A 4HSRA 1V3FA 4Z2YA 1HKQA 1R1UA 3HRMA 5FKMA 4ETSA 2I5UA 1NH3A 1YO5C 5DCFA 2ISZA 1YRNA 2L01A 2VASA 5KAIC 1PUFA 1K4SA 1W5CC 2R5YB 1OYYA 4KA4A 2EA2A 4I0AA 2D1HA 3FKIJ 3NWTA 4HF1A 4M73A 4HV5A 2CFXA 2B9SA 1BN5A 3I53A 3FHNA 2KRCA 4CYCB 4BEHA 4ENKA 2K86A 2PBIA 2W85A 2QGUA 5DV5A 1WH7A 2ELHA 1EF4A 1YS7A 2EH3A 2Y0SN 1TL8A 3OR2C 4A3JJ 2VKVA 4OU0A 5FLVA 3O2PE 1BW6A 4HDVA 2GXAA 3CJNA 1J09A 1FSEA 4XBFA 3EYIA 5DS9A 1O4XA 1B8IB 2RDPA 1MBJA 2CW7A 2DA4A 1MMAA 4C30A 2V7FA 3D0SA 3MKYB 3BCBA 3OL3A 2JSPA 1R5GA 5EEAA 1OCPA 1ODDA 1X1BA 2M87A 2Y31A 4RAYA 1DPRA 1OYWA 2VL8A 1J59A 2VJ4A 4A6DA 1Y56A 1C0WA 2HS5A 2IGOA 4WXHA 3GTGJ 1ZARA 1X2MA 2LSOA 3ZXSA 4ANJA 2PN6A 1VQ5I 1SMTA 2XAFA 3AG1H 2V79A 4KN4X 2NYXA 4ZDPA 4J19A 1S7OA 1P4WA 1KQ0A 4RM3A 3WTTC 1IN6A 1MW7A 3CZ6A 1OQYA 1TWGJ 2L9NA 2BY2A 4BYYA 1OCZH 1IXSB 3DEWA 4HNTA 2DOEA 1F5TA 4K2EA 3M3YJ 2QCOA 3EYYA 5BPIA 1PUFB 2R7UA 1MMNA 3V7CA 3S3MA 2LLKA 4ABZA 4DYCA 2KFDA 2COBA 1Z6TA 1DDNA 2DXIA 1ZREA 2E19A 2K9SA 1J9IA 1K79A 2P5LC 4A5NA 1QBJA 5K7ZA 1E0EA 3S16J 2J5OA 3BOQA 1I39A 5E1XA 3QQAA 1TWHJ 4RGUA 4BEHB 2DT6A 1RRJA 4II2A 4X6AJ 1HCRA 2RAEA 2V6EA 4B3AA 4CXFA 2VJ5A 1M1EB 4IRHA 4KUMA 3S1NJ 3HXLA 5FFXA 1O3QA 4KYWA 1ZAOA 3EDPA 2L02A 3ABLH 2UV1A 1BIAA 2GA2A 3D1NI 4PFOA 4Q4ZF 2E2JJ 2JA7J 4M3BA 2L7FP 2ZJ2A 2E1CA 2IP2A 2WWYA 3V8JA 3OIOA 4DGWB 1Z3XA 2IS6A 1O3SA 3H3UA 3OYNA 3BLYA 3HRTA 3L00A 2VIXA 4WXDA 2NVXJ 1YQAA 4KJZA 1KU2A 4DOZA 3CMMA 1WHUA 1XG1A 3FK6A 2MH9A 3O8GA 2A3SA 5CVVA 2B0LA 4U88A 5E18F 1IRFA 3WHCA 3VWBA 4HQEA 4HSTA 4HA8A 2AO9A 3CF2A 3BJOA 1E3HA 2NRAC 2BV6A 3I59A 3PUFA 2JRTA 4GO1A 1REPC 4KMFA 2WAFA 3BR3A 2HOSA 1UCRA 3OV8A 2OQGA 5HS9A 3QOPA 3CMYA 3CDLA 3LA2A 2BY1A 3K10A 1SANA 4MFEA 2R92J 5K5OA 1G3TA 5LGTA 2HR3A 3ZN1A 5JFRA 2GIVA 5E3OA 1VQ9I 2IPQX 3H5AA 4BNCA 3Q9VA 4Y52J 4IHWA 1Z0XA 3W6VA 4HX8A 4XLNF 4BJ5C 3K2AA 2KIQA 1QVUA 3WTSC 4G12A 2FF4A 1ONVA 5JLWA 2IGMA 2Z3YA 1R6RA 4BGDA 5LHIA 3OYGA 4L5JA 2M0MA 5F08A 2RN7A 3BP8A 1LKXA 2MGQA 1Y1VJ 3IUOA 2MD0A 1YOVB 4D7NA 2IEKA 3MD2A 4AUXA 4U0YA 1VQOI 2CUZA 2WV0A 2VXDA 3I55I 4E7HA 2BW3A 2NOJB 4KNYA 2H8WA 2E2HJ 2HFHA 5BNGA 4EJTA 1OLTA 2A05A 3QRFF 1D5YA 1B59A 2GM4A 2E5ZA 2JK3A 1JGGA 3MKLA 2WAEA 4R79A 3OYMA 3BJ6A 2Y30A 3BQZA 4XORA 4AVZA 3CC7I 3KLNA 1G8XA 2JN6A 4AVPA 1L3LA 3CLOA 1V54H 3TO7A 1UJ8A 3ROUA 2GXGA 4KT5C 2KZVA 2CFOA 1ETQA 1IRGA 1TT0A 3S17J 1ORKA 3AAFA 3GFJA 1K6YA 3OYAA 1R5ID 2AQEA 3LA3A 3O6BB 5K5QA 1O3RA 3I59B 2XV4S 2ACJA 3WU0A 1VQ7I 4XRFA 1BA5A 2EA4A 2HVRA 3PO3J 1X1CA 4XKBA 4D9JA 3JRAA 4ENNA 5CYVA 1T8IA 3BR0A 2E1NA 5TISC 3IKTA 1XS9A 3ABUA 4PK4A 1UHSA 2O5RA 1V4RA 5F27A 5KVRA 1FTZA 3EUAA 3HOYJ 2CQXA 1QGPA 3RKWA 4PGHA 3B02A 2VBZA 3ISPA 5ERIA 3IRRA 3HM5A 1S5LC 1BI2A 3ASNH 3PIOF 2DI3A 5B1BH 4DJAA 3BJAA 3KEQA 3Q0UA 1IZ1A 4AD9A 2QA4I 4HAMA 1R4MB 2XF5A 1FBSA 1XDSA 2UXNA 1X3UA 5EGOA 4KISA 2FSWA 3FF5A 2YX4A 4CCLA 4I76A 3H0DA 3FM5A 1HC8A 3KYCB 3IL2A 4A5MA 1WKMA 1W5TA 2RC4A 4LMYA 4XLFA 3SDGA 4XSXF 1LFUP 2BW3B 2ZC2A 4IJAA 2XGEA 2K5CA 4XR6A 3J80K 5C4XJ 2JVHA 2R93J 5J8FA 1FNNA 3LSPA 4FISA 1R23A 1OKRA 5M5XJ 5KNLA 2M9HA 1UMQA 2TDXA 1U5TA 3V42A 2R7QA 2RKHA 1G2HA 3TP0A 3CMAI 2O7OA 4QPQA 2MH2A 1IN7A 1FEXA 3BTLA 3HRUA 1Y8RB 4CZCA 1ZR2A 2JZYA 2X6XA 4EJUA 3JRGA 4LB6B 3K69A 2D45A 1YS6A 3E3VA 4Z6YA 5FRNA 3MZ8A 3ZQIA 2FD5A 2E5NA 3ONQA 2X4HA 3FX3A 5FRMA 1X2NA 5FO5A 2AQFA 4A0YA 3N4MA 3KEYA 4V19K 1SFEA 1LEBA 3QP5A 1KQ8A 4G7HF 1ULYA 2EZIA 4ZZLA 2MYSA 2L7ZA 3WGIA 4IHVA 4A3CJ 1R5HA 4LIVA 2GWRA 4DBQA 3SZGA 5HNFA 3E6CC 2NNNA 2OCCH 3M8JA 2ZSHB 1E3PA 2A69F 2D2WA 5CVRA 4A69C 1UG0A 5FROA 2KRHA 2R7WA 2V1DA 2E36A 4ZTFA 4Y3OA 2F4OB 4QLCU 4B09A 2DT7B 2ECCA 2K9NA 5EGOB 3M9AA 4I7HA 4A93J 4N4NB 5ILUA 3J80Z 3BTJA 4D7MA 2NS0A 1B6AA 3J7AY 2A6TA 2JSCA 2BEOA 4WX9A 2HGCA 2R7XA 4UV8A 1TWCJ 1IW7F 3MZHA 1WPKA 1BC8C 3VYUB 4ZDOA 4II3A 4Q48A 1U5TB 4RBOA 2WV1A 2ECBA 4EJOA 1BI0A 2O0YA 3KYDB 3CCYA 4ZYHA 1U0JA 4U87A 2WAQA 4A3GJ 1UG2A 4L5EA 1XGSA 3F8NA 4PUSA 5J47A 2PQ8A 4I98B 2VOOA 2Z5UA 4IL6C 4XM3A 1IGNA 4NNJA 3CQZJ 3S93A 4FE4A 2ISYA 3ZMUA 4YFKF 5FJ8J 3S1RJ 3CCEI 1R4NB 4I09A 3S2WA 2HU9A 4L9VA 3H3VK 4BXFA 4ESBA 1IN8A 3BR6A 1OFCX 1D0XA 4OINF 2DODA 1ZGAA 1IXRC 4Y13A 1N78A 2KL4A 4WF2A 2FXAA 1R36A 3G1LA 5IYBJ 2WY7Q 4CO8A 3F72A 2DA1A 1BIBA 2G9WA 3I9V2 4XL9A 4EVIA 4KMUX 2GOMA 2F5FA 2F48A 4UV9A 1D1BA 2KHMA 2GOXB 1MNEA 3UKGA 4XNFA 4FX4A 1YW8A 3U1DA 3K1MA 2EV5A 1BI3A 4XKVA 1TBXA 3GO5A 3SEQA 2DT5A 2XSDC 1BM9A 2KIUA 5KAFC 4IEJA 3DTIA 3FXRA 2HVQA 4YEJA 2VODA 5D5WB 1ZLKA 4B1RA 2LG4A 1FSHA 5ICGA 5HLIA 3ZQ7A 5F1RA 3H1CA 1AU7A 3TW7A 3FDYA 1ZG1A 3RKQA 3JRBA 2HQ5A 3WTZA 2K02A 3SHFA 1FC3A 2ICWG 2HOEA 2FUG2 2QBYA 3OSGA 2OUMA 3J81K 1W7PD 2R4GA 4L0ZB 3KE2A 1W1WE 3H0GJ 1TWFJ 3KP3A 3BWGA 4GGGA 1RR7A 4M6XA 4PJNA 4XN3A 3E6BA 4E7LA 5J4VA 2L3DA 1WFXA 2R7FA 3LWFA 4G6TB 4MTEA 4CHUA 2MC3A 2BHZA 4A3MJ 1WVRA 4LOCA 4XKCA 1I1SA 2I10A 3VB2A 2QWWA 3P9CA 1D8KA 3DTKA 1ZLJA 1H89C 4OWRB 5AIPA 2JA2A 1MBKA 1PVEA 2NAZA 4IHTA 2K4JA 1KU7A 1I6XA 3JRFA 2DK5A 3DTEA 3V7RA 4EMSA 4LITA 3BG9A 4DBRA 2V9PA 2AXTC 2A68F 4HYEA 1FP2A 1PJRA 2YX7A 3RPUD 3WU1B 3JRHA 3LAJA 4E7JA 1VQPI 4HW0A 2JWTA 2L9VA 1IO2A 3LSIA 2M34A 3E5QA 4XMYA 4BHBA 4M72A 1FLIA 1SMYF 3ERMA 1PDNC 2CV0A 2I8DA 3SFZA 4ENMA 3M1EA 5JVGF 2DA2A 2RQQA 4B8XA 2RREA 2Z99A 1CF7A 3HPHA 5E8IA 2VE9A 2E7XA 1G3WA 5CQEA 4E6KG 4Y7NJ 2QSGX 3J7AO 3HGYA 5JI6A 3J81Z 1OCTC 4UVAA 3RTRA 2YS9A 2VJJA 3RI4A 3NEUA 4JX6A 1ITYA 3GBGA 3GZNB 5JVTA 4DQ2A 2STTA 2QBYB 2COMA 2A61A 2QSFX 2FQ3A 4JQFA 2QEXI 3C2BA 3VODA 2EFPA 2KJBA 1UHMA 3K9TA 1HOMA 5EZHA 2NVYJ 5KK1A 3IWZA 2EFWA 1XCBA 3UR3C 4AIHA 4BHCA 4BUPA 1DP7P 1A04A 1P92A 5HLGA 1G4DA 2DJNA 1WJEA 2HWVA 4OOIA 3I4PA 2IA1A 2ETHA 2F5CA 2NVUB 5EG0A 3F8MA 3TOBA 4C9YA 3TGNA 3CCMI 3CDIA 2JT1A 3EETA 1RPWA 4BE0A 3F8CA 2HQAA 4ITVA 2DMQA 1KYWA 2WB1N 3L1PA 3D5SC 2XB5A 4DZPA 2PEXA 2LKXA 1MNMC 3HB9A 3R60A 2P6TA 3ZGKA 3M7GA 4M9XA 2QVOA 5D8LB 5KHDA 3ECHA 3RPQA 2BXZA 2PX9A 2ZFWA 1R22A 1X4PA 4HX4A 3TP3A 1WJDA 2H6CA 1EH7A 2LREA 4HZFA 5LHHA 3OYBA 3OYIA 1CF7B 1P4AA 4A0XA 1DUXC 2QF7A 2A6HF 1MSEC 3H36A 4P1WA 2V9KA 1EA3A 5FD6A 2R7RA 2CV2A 3G2BA 2BZTA 3TO9A 4J00A 1AHDP 3DKYA 2VQLA 4EM1A 5HS8A 3E97A 4IQJA 5IOYA 3ZQCA 2DAOA 3WG7H 4U7BA 4BY1J 3O3KA 4ZC3A 1TWAJ 5LRRA 3GTMJ 1MJBA 2Y0SA 4ZYGA 5FLXZ 2A07F 2Y69H 3OR1C 3I56I 3LFUA 2BYVE 2LY2A 1S7AA 5GAEJ 4XLPF 4BY7J 1ZELA 2KDOA
chains in the Genus database with same CATH topology
1IG7A 4FE7A 3HKZN 1ETXA 3K2AA 1R9TJ 1QVUA 3E7LA 3LNQA 4G12A 5F04A 5J3LA 5JLWA 3ZQFA 2IAIA 2O8KA 3S15J 1MH4A 2GLOA 5M5YJ 5F08A 3NARA 2O9LA 1A6IA 2ZB9A 2GBYA 5EG0B 1JKOC 3GTQJ 2MGQA 3JRIA 1Y1VJ 2DN0A 3IH3A 1H88C 4AC0A 4D7NA 2IEKA 1MSFC 2K9QA 1NK3P 3BR2A 4AUXA 2R5ZB 3G1MA 1VI0A 2VUMJ 4C3JJ 3S2HJ 9ANTA 2VI6A 2DMUA 2E2HJ 5BNGA 5FKNA 5GPAA 1I3QJ 1D5YA 1ETYA 4M3EA 1E3OC 2GM4A 3ZOBA 2JK3A 3NAUA 1JGGA 3MKLA 4W1UA 4DW6A 2Y30A 3BQZA 4M6VA 4I6ZA 3BT9A 2PMZN 1JTYA 3DCFA 2JN6A 3Q0WA 3A01A 3RZDJ 1K83J 5J1YA 1XC5A 4XIDA 1S7EA 3SFIA 3HDDA 1GVDA 1I6HJ 4QTRA 1ETQA 5IP7J 3GTPJ 3S17J 1ORKA 3I4NJ 1LE8A 1JKPC 2WAQN 1U9OA 2VKEA 4JP0A 1BA5A 1TC3C 3GTOJ 3PO3J 2KT0A 3OSFA 5E3LA 3JRAA 1MBEA 1ZR4A 3PO2J 1POGA 3HEFA 3BR0A 1WI3A 5C4JJ 1XS9A 1JKRC 2EQRA 1UHSA 5F27A 2X9DA 3Q3SA 5J1RA 2ME0A 4XRSG 1FTZA 1IDZA 3HOYJ 2CQXA 5IPAA 1BJZA 3HM5A 2IBDA 1VF9A 1NTCA 1GDTA 3HBLA 2LD5A 5F1JA 1JT0A 4B4CA 3Q0UA 4M3DA 2M2EA 4NDLA 4W97A 2M8GX 5IOZA 1RETA 5EGOA 1JUMA 2TCTA 2EZLA 4I76A 3BR5A 4JX5A 4XRSA 2HOTA 1DU6A 2NS7A 2ELKA 3SDGA 1LFUP 1T33A 2L0KA 1W0UA 2EZHA 2OPTA 2XGEA 1AKHA 2DMNA 5GP9A 5C4XJ 2R93J 3GTKJ 2JA8J 3LSPA 2NS8A 4FISA 1WCMJ 4V2FA 3FK7A 5GPCA 5M5XJ 2M9HA 2R0QC 1UMQA 2EBIA 2MG4A 1IDYA 3FISA 1G2HA 3TP0A 2O7OA 3A01B 2D5VA 4QSHA 2L9RA 5F0CA 4A3EJ 2NVTJ 3ZQHA 3GTJJ 1FIPA 5EF6A 1FEXA 3BTLA 2HDDA 1ZR2A 2JA6J 1LE8B 3JRGA 2X48A 2Y9ZA 3LSJA 4QIWN 1HLVA 1JTXA 4XRMA 4DYQA 2JMWA 4MFDA 2MW8A 3ZQIA 2FD5A 2LFBA 3JRDA 3GTLJ 3HGGA 5IYDJ 1X2NA 2CUEA 4A3IJ 2N8GA 4IHWA 1BW5A 2XGDA 1MH3A 2EZIA 4RDUA 2L7ZA 3B6AA 4BBSJ 3W6VA 4IHYA 5C44J 1WGXA 1CQTA 3Q0VA 4IHVA 2ME6A 4A3CJ 2X6OA 2W48A 4UUSA 5FKLA 4A69C 3M4OJ 4A3DJ 4DZJA 4M3GA 3LSGA 4EEFG 4D5FA 3LOCA 4BXXJ 2B63J 2ECCA 2K9NA 5EGOB 1FTTA 4A93J 3BTJA 1ZK8A 3O8HA 4M3FA 4MO7A 4C3IJ 4D7MA 1JUSA 5E3NA 5C3EJ 4BKXA 1BL0A 3HOZJ 3QPLA 2YUSA 1ZGWA 4MIMA 1AKHB 1TWCJ 2R5YA 1RESA 1WPKA 2DTZA 2HXIA 3QPSA 1ETOA 4RBOA 2WV1A 2ECBA 1IC8A 3A02A 3A03A 1X58A 1ETVA 3CCYA 3HOXJ 1ETWA 4CYCA 1YRNB 1I50J 2LP0A 2XRLA 1UG2A 4L5EA 4A3GJ 1F36A 1HF0A 1IV6A 3BG3A 3S2DJ 2Y2ZA 5FKOA 4X1EA 1IGNA 3CQZJ 4FE4A 1K61A 5FJ8J 3S1RJ 1B8IA 4XICA 3H3VK 1T56A 3BR6A 1OFCX 5F0HA 1Y1WJ 2EZKA 3FIWA 3K7AJ 3BTIA 4IHXA 2DA5A 3G1LA 4AYBN 5IYBJ 1F43A 3MN2A 5J1UA 2DA1A 1WH5A 1FIAA 3WHBA 1Q1VA 4UUSB 3VPRA 1MBGA 1QPIA 2CRGA 2JJ7A 4V2GA 4HNVA 2AHQA 3ZQLA 1U78A 1OJLA 2XB0X 3UKGA 1A5JA 5HODA 2OF7A 3IV5A 3TEDA 1JJ6C 2XPWA 2LR8A 3HOWJ 3BQYA 2XSDC 4IEJA 2R7ZJ 5FKMA 4B1RA 2ID6A 2E2IJ 1YRNA 1PUFA 2R5YB 1ZTRA 1AU7A 3TW7A 3RZOJ 3RKQA 3JRBA 2HQ5A 1NK2P 3FKIJ 1Z77A 5EYRA 1ZQ3P 3OSGA 1U8BA 3TW6A 2HOAA 4CYCB 3H0GJ 1TWFJ 2JA5J 4JX4A 4S0HB 1RR7A 1WH7A 1EF4A 1FJLA 2EH3A 2Y0SN 3HOUJ 4A3JJ 3BR1A 2VKVA 5FLVA 5M3MJ 5EZGA 1BW6A 1ETKA 2CUFA 2LTPA 2XPVA 5DS9A 4A3MJ 1O4XA 2FX0A 4LOCA 3S1QJ 1B8IB 4UUTA 1MBJA 2I10A 4C3HJ 2DA4A 4XK4A 1P7JA 5FLMJ 1H89C 2XGCA 5EEAA 1OCPA 1GUUA 1MBHA 3LSRA 2Y31A 1MBKA 2E1OA 1VFCA 1JKQC 3JRFA 2ID3A 3GTGJ 2NVQJ 2HI3A 2FJ1A 1GT0C 3BG9A 1X2MA 2CU7A 4D5CA 3JRHA 1HDPA 2H1KA 2JWTA 3JR9A 1MBFA 4J19A 2M34A 2MSYA 5DTDA 3IH2A 4MLOA 5M3FJ 1TWGJ 2LK2A 1GV2A 2DA2A 3DEWA 2DA3A 1GV5A 5K7FA 5K7HA 3ZQGA 1H8AC 4Y7NJ 3M3YJ 2QCOA 2H8RA 1PUFB 1APLC 3HGYA 2DMPA 2LLKA 1OCTC 4ABZA 4DYCA 2YS9A 1IRZA 3JREA 2COBA 4JX6A 1JUPA 2P81A 3GBGA 1ITYA 2E19A 2K9SA 3RQIA 2M0CA 5EDNA 2YU9J 3OOUA 1JJ8C 5K7ZA 3S16J 3MVPA 2NOGA 4FTHA 3QQAA 1TWHJ 1ZKGA 4A3LJ 3C2BA 4X6AJ 1HCRA 2RAEA 1IUFA 3PM1A 4B3AA 1B72A 1HOMA 3G1OA 5EZHA 2NVYJ 3BG5A 3S1NJ 3IH4A 1JT6A 2Y9YA 5JLXA 1QVTA 3D1NI 1RKWA 2DJNA 4JYKA 2E2JJ 2JA7J 4M3BA 5F0FA 2L7FP 5IP6A 2L7MP 5EG0A 2K40A 3OIOA 1RPWA 1U9NA 2R5ZA 1HDDC 4A3FJ 2DA7A 2DMQA 2WB1N 4A3BJ 2DMTA 3L1PA 3HOVJ 5FKKA 2XB5A 3I4MJ 2NVXJ 4DZPA 2LKXA 1MNMC 3F0CA 3BTCA 3HB9A 2DA6A 2LY9A 2HXOA 2HYJA 4C2MJ 3JRCA 1XG1A 3FK6A 3O8GA 1ENHA 1W0TA 1P7IA 5IP9J 3TP3A 3WHCA 5M5WJ 2LVSA 2XPUA 4GFBA 2AO9A 2QF7A 2G0EA 1MSEC 2FQ4A 1IJWC 1LFBA 4FCYA 1VNDA 1AHDP 1QRYA 2VPRA 2CQQA 5IYCJ 2HOSA 3BR3A 5E3MA 3SJMA 5IOYA 3S14J 3CMYA 1RKTA 3ZQCA 3CDLA 2TRTA 1SANA 4A3KJ 4DYRA 4MFEA 2R92J 4BY1J 1SFOJ 2CJJA 3GTMJ 1TWAJ 3S1MJ 5E3OA 4BBRJ 3B6CA 4Y52J 1DU0A 1Z0XA 4BY7J 2KDZA 1B72B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG7 A;  4FE7 A;  3HKZ N;  1ETX A;  3K2A A;  1R9T J;  1QVU A;  3E7L A;  3LNQ A;  4G12 A;  5F04 A;  5J3L A;  5JLW A;  3ZQF A;  2IAI A;  2O8K A;  3S15 J;  1MH4 A;  2GLO A;  5M5Y J;  5F08 A;  3NAR A;  2O9L A;  1A6I A;  2ZB9 A;  2GBY A;  5EG0 B;  1JKO C;  3GTQ J;  2MGQ A;  3JRI A;  1Y1V J;  2DN0 A;  3IH3 A;  1H88 C;  4AC0 A;  4D7N A;  2IEK A;  1MSF C;  2K9Q A;  1NK3 P;  3BR2 A;  4AUX A;  2R5Z B;  3G1M A;  1VI0 A;  2VUM J;  4C3J J;  3S2H J;  9ANT A;  2VI6 A;  2DMU A;  2E2H J;  5BNG A;  5FKN A;  5GPA A;  1I3Q J;  1D5Y A;  1ETY A;  4M3E A;  1E3O C;  2GM4 A;  3ZOB A;  2JK3 A;  3NAU A;  1JGG A;  3MKL A;  4W1U A;  4DW6 A;  2Y30 A;  3BQZ A;  4M6V A;  4I6Z A;  3BT9 A;  2PMZ N;  1JTY A;  3DCF A;  2JN6 A;  3Q0W A;  3A01 A;  3RZD J;  1K83 J;  5J1Y A;  1XC5 A;  4XID A;  1S7E A;  3SFI A;  3HDD A;  1GVD A;  1I6H J;  4QTR A;  1ETQ A;  5IP7 J;  3GTP J;  3S17 J;  1ORK A;  3I4N J;  1LE8 A;  1JKP C;  2WAQ N;  1U9O A;  2VKE A;  4JP0 A;  1BA5 A;  1TC3 C;  3GTO J;  3PO3 J;  2KT0 A;  3OSF A;  5E3L A;  3JRA A;  1MBE A;  1ZR4 A;  3PO2 J;  1POG A;  3HEF A;  3BR0 A;  1WI3 A;  5C4J J;  1XS9 A;  1JKR C;  2EQR A;  1UHS A;  5F27 A;  2X9D A;  3Q3S A;  5J1R A;  2ME0 A;  4XRS G;  1FTZ A;  1IDZ A;  3HOY J;  2CQX A;  5IPA A;  1BJZ A;  3HM5 A;  2IBD A;  1VF9 A;  1NTC A;  1GDT A;  3HBL A;  2LD5 A;  5F1J A;  1JT0 A;  4B4C A;  3Q0U A;  4M3D A;  2M2E A;  4NDL A;  4W97 A;  2M8G X;  5IOZ A;  1RET A;  5EGO A;  1JUM A;  2TCT A;  2EZL A;  4I76 A;  3BR5 A;  4JX5 A;  4XRS A;  2HOT A;  1DU6 A;  2NS7 A;  2ELK A;  3SDG A;  1LFU P;  1T33 A;  2L0K A;  1W0U A;  2EZH A;  2OPT A;  2XGE A;  1AKH A;  2DMN A;  5GP9 A;  5C4X J;  2R93 J;  3GTK J;  2JA8 J;  3LSP A;  2NS8 A;  4FIS A;  1WCM J;  4V2F A;  3FK7 A;  5GPC A;  5M5X J;  2M9H A;  2R0Q C;  1UMQ A;  2EBI A;  2MG4 A;  1IDY A;  3FIS A;  1G2H A;  3TP0 A;  2O7O A;  3A01 B;  2D5V A;  4QSH A;  2L9R A;  5F0C A;  4A3E J;  2NVT J;  3ZQH A;  3GTJ J;  1FIP A;  5EF6 A;  1FEX A;  3BTL A;  2HDD A;  1ZR2 A;  2JA6 J;  1LE8 B;  3JRG A;  2X48 A;  2Y9Z A;  3LSJ A;  4QIW N;  1HLV A;  1JTX A;  4XRM A;  4DYQ A;  2JMW A;  4MFD A;  2MW8 A;  3ZQI A;  2FD5 A;  2LFB A;  3JRD A;  3GTL J;  3HGG A;  5IYD J;  1X2N A;  2CUE A;  4A3I J;  2N8G A;  4IHW A;  1BW5 A;  2XGD A;  1MH3 A;  2EZI A;  4RDU A;  2L7Z A;  3B6A A;  4BBS J;  3W6V A;  4IHY A;  5C44 J;  1WGX A;  1CQT A;  3Q0V A;  4IHV A;  2ME6 A;  4A3C J;  2X6O A;  2W48 A;  4UUS A;  5FKL A;  4A69 C;  3M4O J;  4A3D J;  4DZJ A;  4M3G A;  3LSG A;  4EEF G;  4D5F A;  3LOC A;  4BXX J;  2B63 J;  2ECC A;  2K9N A;  5EGO B;  1FTT A;  4A93 J;  3BTJ A;  1ZK8 A;  3O8H A;  4M3F A;  4MO7 A;  4C3I J;  4D7M A;  1JUS A;  5E3N A;  5C3E J;  4BKX A;  1BL0 A;  3HOZ J;  3QPL A;  2YUS A;  1ZGW A;  4MIM A;  1AKH B;  1TWC J;  2R5Y A;  1RES A;  1WPK A;  2DTZ A;  2HXI A;  3QPS A;  1ETO A;  4RBO A;  2WV1 A;  2ECB A;  1IC8 A;  3A02 A;  3A03 A;  1X58 A;  1ETV A;  3CCY A;  3HOX J;  1ETW A;  4CYC A;  1YRN B;  1I50 J;  2LP0 A;  2XRL A;  1UG2 A;  4L5E A;  4A3G J;  1F36 A;  1HF0 A;  1IV6 A;  3BG3 A;  3S2D J;  2Y2Z A;  5FKO A;  4X1E A;  1IGN A;  3CQZ J;  4FE4 A;  1K61 A;  5FJ8 J;  3S1R J;  1B8I A;  4XIC A;  3H3V K;  1T56 A;  3BR6 A;  1OFC X;  5F0H A;  1Y1W J;  2EZK A;  3FIW A;  3K7A J;  3BTI A;  4IHX A;  2DA5 A;  3G1L A;  4AYB N;  5IYB J;  1F43 A;  3MN2 A;  5J1U A;  2DA1 A;  1WH5 A;  1FIA A;  3WHB A;  1Q1V A;  4UUS B;  3VPR A;  1MBG A;  1QPI A;  2CRG A;  2JJ7 A;  4V2G A;  4HNV A;  2AHQ A;  3ZQL A;  1U78 A;  1OJL A;  2XB0 X;  3UKG A;  1A5J A;  5HOD A;  2OF7 A;  3IV5 A;  3TED A;  1JJ6 C;  2XPW A;  2LR8 A;  3HOW J;  3BQY A;  2XSD C;  4IEJ A;  2R7Z J;  5FKM A;  4B1R A;  2ID6 A;  2E2I J;  1YRN A;  1PUF A;  2R5Y B;  1ZTR A;  1AU7 A;  3TW7 A;  3RZO J;  3RKQ A;  3JRB A;  2HQ5 A;  1NK2 P;  3FKI J;  1Z77 A;  5EYR A;  1ZQ3 P;  3OSG A;  1U8B A;  3TW6 A;  2HOA A;  4CYC B;  3H0G J;  1TWF J;  2JA5 J;  4JX4 A;  4S0H B;  1RR7 A;  1WH7 A;  1EF4 A;  1FJL A;  2EH3 A;  2Y0S N;  3HOU J;  4A3J J;  3BR1 A;  2VKV A;  5FLV A;  5M3M J;  5EZG A;  1BW6 A;  1ETK A;  2CUF A;  2LTP A;  2XPV A;  5DS9 A;  4A3M J;  1O4X A;  2FX0 A;  4LOC A;  3S1Q J;  1B8I B;  4UUT A;  1MBJ A;  2I10 A;  4C3H J;  2DA4 A;  4XK4 A;  1P7J A;  5FLM J;  1H89 C;  2XGC A;  5EEA A;  1OCP A;  1GUU A;  1MBH A;  3LSR A;  2Y31 A;  1MBK A;  2E1O A;  1VFC A;  1JKQ C;  3JRF A;  2ID3 A;  3GTG J;  2NVQ J;  2HI3 A;  2FJ1 A;  1GT0 C;  3BG9 A;  1X2M A;  2CU7 A;  4D5C A;  3JRH A;  1HDP A;  2H1K A;  2JWT A;  3JR9 A;  1MBF A;  4J19 A;  2M34 A;  2MSY A;  5DTD A;  3IH2 A;  4MLO A;  5M3F J;  1TWG J;  2LK2 A;  1GV2 A;  2DA2 A;  3DEW A;  2DA3 A;  1GV5 A;  5K7F A;  5K7H A;  3ZQG A;  1H8A C;  4Y7N J;  3M3Y J;  2QCO A;  2H8R A;  1PUF B;  1APL C;  3HGY A;  2DMP A;  2LLK A;  1OCT C;  4ABZ A;  4DYC A;  2YS9 A;  1IRZ A;  3JRE A;  2COB A;  4JX6 A;  1JUP A;  2P81 A;  3GBG A;  1ITY A;  2E19 A;  2K9S A;  3RQI A;  2M0C A;  5EDN A;  2YU9 J;  3OOU A;  1JJ8 C;  5K7Z A;  3S16 J;  3MVP A;  2NOG A;  4FTH A;  3QQA A;  1TWH J;  1ZKG A;  4A3L J;  3C2B A;  4X6A J;  1HCR A;  2RAE A;  1IUF A;  3PM1 A;  4B3A A;  1B72 A;  1HOM A;  3G1O A;  5EZH A;  2NVY J;  3BG5 A;  3S1N J;  3IH4 A;  1JT6 A;  2Y9Y A;  5JLX A;  1QVT A;  3D1N I;  1RKW A;  2DJN A;  4JYK A;  2E2J J;  2JA7 J;  4M3B A;  5F0F A;  2L7F P;  5IP6 A;  2L7M P;  5EG0 A;  2K40 A;  3OIO A;  1RPW A;  1U9N A;  2R5Z A;  1HDD C;  4A3F J;  2DA7 A;  2DMQ A;  2WB1 N;  4A3B J;  2DMT A;  3L1P A;  3HOV J;  5FKK A;  2XB5 A;  3I4M J;  2NVX J;  4DZP A;  2LKX A;  1MNM C;  3F0C A;  3BTC A;  3HB9 A;  2DA6 A;  2LY9 A;  2HXO A;  2HYJ A;  4C2M J;  3JRC A;  1XG1 A;  3FK6 A;  3O8G A;  1ENH A;  1W0T A;  1P7I A;  5IP9 J;  3TP3 A;  3WHC A;  5M5W J;  2LVS A;  2XPU A;  4GFB A;  2AO9 A;  2QF7 A;  2G0E A;  1MSE C;  2FQ4 A;  1IJW C;  1LFB A;  4FCY A;  1VND A;  1AHD P;  1QRY A;  2VPR A;  2CQQ A;  5IYC J;  2HOS A;  3BR3 A;  5E3M A;  3SJM A;  5IOY A;  3S14 J;  3CMY A;  1RKT A;  3ZQC A;  3CDL A;  2TRT A;  1SAN A;  4A3K J;  4DYR A;  4MFE A;  2R92 J;  4BY1 J;  1SFO J;  2CJJ A;  3GTM J;  1TWA J;  3S1M J;  5E3O A;  4BBR J;  3B6C A;  4Y52 J;  1DU0 A;  1Z0X A;  4BY7 J;  2KDZ A;  1B72 B; 
#chains in the Genus database with same CATH topology
 3PIP F;  4FE7 A;  2LNB A;  5LLQ A;  3LNQ A;  4RB0 A;  1JHF A;  5J3L A;  3OS2 A;  3DV8 A;  2O8K A;  3S15 J;  1UHW A;  3CP2 A;  1UZC A;  2O9L A;  2EIJ H;  1J0R A;  2GBY A;  5EG0 B;  2QZ8 A;  1JKO C;  3GTQ J;  2KZG A;  1G3S A;  2DN0 A;  4P5O A;  3IH3 A;  1MJA A;  2O61 A;  3TDU C;  1H88 C;  1A35 A;  4AC0 A;  1Z1D A;  5CJ9 A;  1MSF C;  2K9Q A;  4RMN A;  2ADU A;  2IRF G;  3MZY A;  1ZRD A;  3E6D A;  3S2H J;  4S05 A;  9ANT A;  2IXS A;  3RQ4 A;  2ZJP F;  5D5U B;  2B7E A;  1Z05 A;  1CGP A;  4RAF A;  3WU2 C;  4XQF A;  4BS9 A;  3F23 A;  3DXJ F;  1X19 A;  3K4C A;  3NAU A;  3H92 A;  3QPT A;  3IRQ A;  4W1U A;  2C6Y A;  3KET A;  4M6V A;  3JTH A;  4BXU A;  1MGT A;  5LEK A;  4FAS D;  2PMZ N;  4XSZ F;  1JTY A;  3DCF A;  2VBY A;  3KP2 A;  2MBF A;  3OIP A;  3PUB A;  2RV8 A;  3DU6 A;  3PL8 A;  1YTY A;  3CCU I;  2EFN A;  3GVA A;  2M30 A;  1GVD A;  3L09 A;  3U9G A;  3QP6 A;  3F8F A;  5D6E A;  3COA C;  2G7U A;  1YFH A;  3GTP J;  1LE8 A;  1X4O A;  4C2T A;  2MFZ A;  2UWM A;  3HL2 A;  4ESF A;  1KU9 A;  2XAU A;  1P2F A;  2Q2E A;  3FMQ A;  4FT8 A;  1YG2 A;  2BY3 A;  3AKZ A;  3GTO J;  2KQR A;  2WC2 A;  2FRH A;  2KT0 A;  3KP4 A;  1MMD A;  3SZP A;  4H4K C;  1ZR4 A;  3CF5 F;  4BDY A;  1YIJ I;  3HEF A;  1XGN A;  1PUE E;  3FHZ A;  1JKR C;  2EQR A;  1STZ A;  3AG3 H;  4MGR A;  2M4K A;  4ZZD A;  5BS6 A;  1F4K A;  2YU3 A;  4NHJ A;  1IDZ A;  3IAM 2;  5ICE A;  2CGP A;  5D4R A;  1BJZ A;  4RGS A;  1SC7 A;  2KIF A;  4UVC A;  4AYB A;  1NTC A;  3HBL A;  2BVL A;  3GLX A;  5F1J A;  1HW1 A;  5E20 A;  4B4C A;  2P5V A;  2KLO A;  2HKO A;  4M3D A;  2EK5 A;  1XB4 A;  2XAS A;  3BPV A;  1ZG3 A;  1LDK B;  2EFO A;  3S32 A;  5DCM A;  4CCO A;  3VEP A;  2ZME A;  1ON1 A;  3BZ6 A;  4MTD A;  1XMA A;  1U5T C;  3W6K B;  3BR5 A;  1S3J A;  3PNY A;  3I58 A;  4XRS A;  1GXQ A;  2NS7 A;  4MQV A;  1ZGJ A;  3MKW B;  3MCZ A;  2CO5 A;  4U7D A;  1PYV A;  1YIO A;  2EZH A;  3E5X A;  3GUD A;  4XN0 A;  5GP9 A;  1GLN A;  1R49 A;  3GTK J;  5AIQ A;  1USS A;  2NS8 A;  4V2F A;  5CVU A;  5CVJ A;  4XLH A;  2R0Q C;  2XUB A;  4RLF A;  2DPD A;  4OMZ A;  2OZ6 A;  1Y0N A;  5HLT A;  1LVA A;  3I64 A;  1ZG5 A;  2CWE A;  1W36 C;  4I2O A;  2STW A;  4U0V A;  3GTJ J;  3BG6 A;  2K9M A;  4PJL A;  1FIP A;  5HLH A;  2HPI A;  5IY5 H;  2XF7 A;  4Y17 A;  3ZN0 A;  1LE8 B;  4PFP A;  2X48 A;  2XAJ A;  5CPR B;  3LSJ A;  3DFG A;  2Q8K A;  2DU9 A;  2JMW A;  3E5U A;  2Q2E B;  4F7Z A;  1IUY A;  2CQN A;  3P5J A;  4IRG A;  4N4O B;  3IKV A;  3RJP A;  5L3G A;  2N8G A;  1SEU A;  4CCJ A;  2XAH A;  2W24 A;  2EWN A;  2XGD A;  4FHT A;  1D0Y A;  4P55 A;  1BOB A;  5ICF A;  4Q5S F;  3HC7 A;  1X1A A;  2ME6 A;  1FOW A;  1VQL I;  2X6O A;  2X1D A;  4IQ4 A;  4I99 C;  1Z67 A;  2JUG A;  1TQI A;  4IZZ A;  2H1L A;  4ZDL A;  4M3G A;  5BOX A;  1U2W A;  2JTV A;  5TGT A;  5DCM B;  2ESN A;  4QPO A;  3M8F A;  2ZME B;  3CO7 C;  1ZN2 A;  4M3F A;  3DKW A;  3LFK A;  2IT0 A;  1Q1H A;  3CDH A;  1LDJ A;  3HSF A;  2X6Y A;  5C3E J;  5B66 C;  3DBL B;  2YUS A;  2PJP A;  2LF8 A;  3CES A;  1NG7 A;  5BMZ A;  1ZGW A;  1FOY A;  4MIM A;  2KKO A;  2EIL H;  5KCM A;  2R7S A;  2HZD A;  5CQG A;  4R8H A;  1ETO A;  4IVN A;  1E17 A;  3W2A A;  2VQH A;  2D1V A;  3A02 A;  3A03 A;  3M1C A;  1D0Z A;  3MEX A;  1TTY A;  2R7V A;  5DUK A;  3H9G A;  3PNV A;  5ILS A;  4KIT B;  2XRL A;  3S8P A;  3AFH A;  2Y0M A;  2Y48 A;  1K6O A;  1MMS A;  5GAG J;  3S2D J;  4AID A;  2DDA A;  5HDK A;  2MLG A;  2WTE A;  2Y2Z A;  3U21 A;  5FKO A;  4MEY F;  3F21 A;  3CC2 I;  4BDZ A;  2BHY A;  2M4G A;  1A31 A;  1QQI A;  4HEA 2;  3HUG A;  3HTU A;  4KIG A;  1I5Z A;  1V5F A;  4HX7 A;  2BE5 F;  3IWF A;  1UB9 A;  4WXC A;  1GVJ A;  3WTV C;  2XKO A;  3AG2 H;  5F0H A;  1OYI A;  1Y1W J;  5LD2 C;  1LPQ A;  1QPM A;  1U3E M;  5DEQ A;  3GFM A;  3FIW A;  2OTL I;  4BQN A;  3DLL F;  1QHG A;  3DLA A;  4EJW A;  4RB2 C;  5ICC A;  3WTY C;  2XAG A;  1FIA A;  3R0J A;  3W6J B;  4P96 A;  1MBG A;  1QPI A;  4HNV A;  5F64 A;  2RVC A;  3ZQL A;  1U6G A;  3QAH A;  1HXD A;  2DFF A;  2IVM A;  4CDG A;  3IV5 A;  3TED A;  1KQ9 A;  1OMI A;  1JJ6 C;  2XPW A;  2CQK A;  3TMO A;  2H09 A;  3DF8 A;  3K4B A;  2RNJ A;  3VYT B;  1MND A;  4E70 A;  3AL0 B;  3ML6 A;  2Z33 A;  2LKP A;  2X51 A;  1MZB A;  2G7H A;  2KIS A;  4NB5 A;  2ID6 A;  2PMU A;  3V8K A;  3H5R A;  3VYR B;  1ZTR A;  1BI1 A;  2DTR A;  3RZO J;  2DPU A;  4HDU A;  5DDG A;  1NK2 P;  1LJ9 A;  1F9N A;  4OMY A;  1ZQ3 P;  1U8B A;  5H6Q A;  2LBF A;  3TW6 A;  1Z7L A;  2YPR A;  5HDN A;  1D8J A;  3JW4 A;  2V1X A;  1W5S A;  4JX4 A;  1MIJ A;  4WWC A;  2R3S A;  1ERD A;  4S0H B;  2RNG A;  1KYZ A;  1FJL A;  2NNY A;  1QA6 A;  2X0L A;  3OYK A;  3A4C A;  3BR1 A;  5D5X B;  5BQT A;  5M3M J;  4B3X A;  1UEL B;  5H20 A;  3HKZ A;  4KN7 X;  3SYT A;  3WTU C;  2L5Q A;  3MFK A;  1XPX A;  2VON A;  1ETK A;  4UHT A;  3D5L A;  2CUF A;  3ESW B;  3HUG B;  4AIJ A;  3S1Q J;  1EJ9 A;  4J01 A;  1YLF A;  1V5G A;  1FY7 A;  3BCA A;  3GFI A;  3S3O A;  1F1Z A;  4XK4 A;  1AOY A;  2OD5 A;  5FLM J;  2QQB A;  2XGC A;  1MBH A;  3PSF A;  1JXS A;  3R0A A;  4Y4R A;  2HVS A;  2P0W A;  3OYE A;  2V4J C;  3OYF A;  4A6E A;  4M71 A;  2ID3 A;  4CCK A;  4CZZ A;  1LEA A;  4MQ9 F;  2HI3 A;  2FJ1 A;  1GT0 C;  1X3Z B;  1WQ2 A;  4WCG A;  3FBN B;  4YG2 F;  3KZZ A;  2A6E F;  4CIC A;  3GEZ A;  3LSK A;  4YRV A;  2E35 A;  3F9K A;  2A5W A;  2F5V A;  3MWM A;  2H1K A;  2A5Y B;  2MSY A;  5DTD A;  1FMV A;  2FA5 A;  3FXU A;  4RS8 A;  3E0J B;  5E1W A;  1XN7 A;  4BH9 A;  1YHQ I;  1E2X A;  3IH2 A;  4MLO A;  4CCN A;  2WBM A;  1VQ6 I;  2OA4 A;  1EH8 A;  4LJZ F;  1GV2 A;  5ED4 A;  2KPM A;  4F91 B;  1TZL A;  1G6N A;  4EGZ A;  1W36 D;  1GV5 A;  3KP5 A;  5K7F A;  3ZQG A;  1FBU A;  1H8A C;  1IN5 A;  2H8R A;  1RR8 C;  4HRI A;  3RIR A;  2ZJQ F;  1QHH D;  5DM7 F;  1SD5 A;  3JRE A;  4BAC A;  1JUP A;  4FET A;  3KX2 A;  5FGM A;  3TDZ C;  4XOT A;  4ZTJ A;  2EPF A;  2QLZ A;  1KZH A;  3ZQQ A;  4DNC A;  4BQQ A;  2FOK A;  1BR2 A;  1D1C A;  1TP4 A;  3GLL A;  2LBF B;  2LDU A;  1Z3Y A;  5EDN A;  3LAP A;  3MVP A;  3U1K A;  1B9N A;  2PFB A;  3CCQ I;  2NOG A;  4FTH A;  3BC8 A;  4M9Z A;  1ZKG A;  4D1Q A;  1OCR H;  2VKD A;  4LLG F;  4P9U A;  2HQN A;  3LA7 A;  1K4T A;  1IUF A;  3DEU A;  1KGS A;  3PM1 A;  1XMK A;  4X0G A;  1B72 A;  2GXB A;  3G1O A;  2LRD A;  4IXA A;  1FYM A;  1D3Y A;  3BG5 A;  3IH4 A;  4RAG A;  5JLX A;  3V7S A;  1X3W B;  2IGN A;  4JYK A;  4NQW A;  2VC0 A;  3K6G A;  3PQK A;  4YIF A;  4CH7 A;  5IT9 Z;  2K40 A;  3GFL A;  1JHH A;  3KLO A;  3OY9 A;  2OBP A;  3JSO A;  1U9N A;  2F4M B;  2HQR A;  2R5Z A;  1HDD C;  2DA7 A;  2MLK A;  2QM3 A;  3IC7 A;  2DMT A;  3GME A;  3P9I A;  3MMY B;  3CCS I;  1SFX A;  1SVO A;  2K27 A;  2V6C A;  1DGW Y;  3F0C A;  3BTC A;  2M5W A;  2ZFU A;  4I02 A;  2DA6 A;  4EV0 A;  2XRN A;  1YI2 I;  3K4N A;  2DDB A;  1ACI A;  3H3Z A;  2HXO A;  2HYJ A;  4C2M J;  2PMH A;  2W7N A;  4E7I A;  2PI0 A;  4U0W A;  5FB2 A;  5EEH A;  1P7I A;  5IP9 J;  3LL7 A;  3L2U A;  3L2Q A;  5GAH J;  5M5W J;  3OMY A;  2JPB A;  3W2W A;  3KYL A;  1HBX G;  4BQO A;  3V8L A;  3A2K A;  1IJW C;  1LFB A;  4N9I A;  2ZO4 A;  4FCY A;  2F5D A;  1U8R A;  2CG4 A;  4PCQ A;  1QRY A;  2VPR A;  2CQQ A;  1XSD A;  2E1M B;  1WJ5 A;  2H6B A;  2K3P A;  3PJR A;  2VC1 A;  1O57 A;  3BDD A;  3SJM A;  1WSU A;  3S14 J;  1RKT A;  2TRT A;  4ON0 A;  4A3K J;  1XDU A;  4DYR A;  1I1G A;  1SFO J;  4RA2 A;  3S1M J;  4GYI A;  4Y33 A;  1VZ0 A;  3B6C A;  1SFU A;  2FNA A;  2DFH A;  4UUV A;  2KDZ A;  1B72 B;  3HPG A;  1IG7 A;  3MQ0 A;  1RUN A;  4CSW A;  1R9T J;  1RIO H;  4YII A;  2ZXH A;  4PJ0 C;  2KP6 A;  2JRM A;  3L7W A;  3E7L A;  4LFU A;  2M8E A;  2W1O A;  3HJE A;  5F04 A;  3S3N A;  3VOE A;  4NBQ A;  4HNU A;  2IAI A;  3P7N A;  4NQW B;  1HST A;  1IRX A;  3DQV C;  1TT5 B;  1A6I A;  1SD7 A;  2DFI A;  2ZB9 A;  2DLL A;  3T0Y A;  1LVK A;  1HKS A;  2AXL A;  1NK3 P;  1B9M A;  3BR2 A;  2R5Z B;  3G1M A;  1VI0 A;  2P4W A;  4C3J J;  4CCM A;  2VI6 A;  1SVL A;  3FXO A;  2DMU A;  2QEN A;  3G71 I;  5FKN A;  1N77 A;  5GPA A;  4P9F A;  1ETY A;  2EV0 A;  3IHU A;  4M3E A;  5E17 F;  2W00 A;  4KIB A;  4GXO A;  4KIC A;  4YIR X;  4BL0 B;  3ZMD A;  3KIO A;  1FOK A;  1XMX A;  3Q0W A;  3RZD J;  3EPZ A;  1XC5 A;  3CCL I;  3SDB A;  3EQL F;  1B1B A;  4ASN A;  4XKW A;  2QUF A;  1S7E A;  3HDD A;  2EFQ A;  2Z16 A;  2EB7 A;  4O5V A;  3ULQ B;  2CQ7 A;  3VSK A;  2DO7 A;  4GRI A;  4O6J A;  2CS3 A;  3D5R C;  4R1H A;  4JP0 A;  4LD5 A;  3WE2 A;  1TC3 C;  2JUC A;  2ZNY A;  3KP6 A;  1IF1 A;  2QQ8 A;  2BVM A;  2HTS A;  3OSF A;  1T08 B;  5DM6 F;  4MNU A;  3PO2 J;  1POG A;  2P8T A;  1YE9 A;  2BXY A;  2M1B A;  5EEG A;  5C4J J;  4LK0 F;  2JPC A;  3CME I;  3H9J A;  4IO9 F;  5LRS A;  2HYG D;  3FMS A;  3HIF A;  2QKM B;  5FLX K;  5BPD A;  2ME0 A;  4XRS G;  2Y75 A;  3CJT B;  4PGG A;  1XSX A;  2ZME C;  1T39 A;  2IBD A;  2LD5 A;  4RLQ A;  2BBY A;  3ZRG A;  2CYY A;  3AG4 H;  3C2G A;  3QYB A;  3E1S A;  2QKL B;  4L0Y B;  4HBL A;  2M2E A;  1AWC A;  2KJC A;  3IAS 2;  5IOZ A;  1YW7 A;  5B5E C;  3H35 A;  1RET A;  4NC8 A;  3X2Q H;  3GXO A;  2TCT A;  2EZL A;  2BOL A;  1UST A;  3NWS A;  2BGC A;  2K7L A;  2WB1 A;  5L3E A;  2E7W A;  2HOT A;  1K78 A;  1G59 A;  3KPH A;  5K1Y A;  4CA0 A;  1X1D A;  3ZMZ A;  1T33 A;  2L0K A;  1W0U A;  1YYV A;  2EV6 A;  1AKH A;  4LIU A;  2DCE A;  1PP8 F;  5H2F C;  2EIK H;  2MD5 A;  1WCM J;  3FK7 A;  2QQA A;  3RYP A;  4LG0 A;  1S8N A;  3ABM H;  3F3X A;  3I0T A;  1QZE A;  1KU3 A;  2L7K A;  3FXK A;  1IDY A;  3FIS A;  2CV1 A;  5J40 A;  1H9G A;  3RDI A;  3NRV A;  2L9R A;  4G9Y A;  5F0C A;  1MDM A;  2NVT J;  3DPT A;  3ZQH A;  2PG4 A;  5LBQ A;  2WY8 Q;  2P6S A;  4UY8 I;  5L3C A;  1A6Q A;  3KP7 A;  4LK1 F;  4OAZ A;  1WJF A;  4MFD A;  2MW8 A;  3CUQ A;  1Y8Q B;  2LFB A;  2HZT A;  3JRD A;  3EUH A;  3FZV A;  1O3T A;  3WE3 A;  1JI8 A;  3FXQ A;  1FZP B;  2FE3 A;  2CUE A;  1EV7 A;  4EQQ A;  4A3I J;  1LB2 A;  2P7C B;  1VTN C;  1T6S A;  1MH3 A;  2X85 A;  5ILV A;  1WI9 A;  3L9F A;  4HF2 A;  4JBA A;  3OYC A;  4G94 A;  4O3M A;  3DU5 A;  2Z1D A;  1HKT A;  4IHY A;  1WGX A;  1CQT A;  2GQQ A;  5CLS A;  3AL0 C;  4H0E A;  2E71 A;  4G6Q A;  3REO A;  3A0B C;  1W4M A;  6PAX A;  2W48 A;  5FKL A;  2P5K A;  3M4O J;  3BZK A;  4UVB A;  1SFK A;  3LSG A;  2DOA A;  2XHK A;  2ZSI B;  3LST A;  3FXM A;  2DW4 A;  4BXX J;  2W25 A;  3Q9S A;  3QOD A;  2KRF A;  3RYR A;  1G3Y A;  4XON A;  3FXL A;  1ZK8 A;  1T0F A;  1YW9 A;  4LLN A;  5HS7 A;  2IW5 A;  1YJN I;  1K78 B;  5E8G A;  3VFZ A;  4BKX A;  3JAM Z;  2E60 A;  1WZ2 A;  2FML A;  5E1Z B;  3W3C A;  1AKH B;  1LNW A;  2CUJ A;  2ZXI A;  1PP7 U;  2PMZ A;  1S9H A;  2VE8 A;  2L4A A;  2HPM A;  1UFM A;  1BR1 A;  2EIN H;  4XLA A;  2KIM A;  1FPQ A;  4PDK A;  5J6X A;  4LG0 B;  1SAX A;  2HKX A;  2VOP A;  3OS1 A;  5HOO A;  4CGZ A;  1OR7 A;  2V1U A;  1ETW A;  1YRN B;  1MDM B;  2PJR A;  2OC6 A;  4MEX F;  2P7V B;  1I50 J;  2AS5 F;  2DYS H;  2IS2 A;  4JK1 X;  1F36 A;  3CJR B;  3HYI A;  2K9L A;  3L2W A;  2CMP A;  3BG3 A;  5HDG A;  1QO0 D;  3CJQ B;  4E4H A;  1TW3 A;  2ZXJ A;  3WGG A;  3CUQ B;  5IT3 A;  5LGN A;  4HG2 A;  1K61 A;  3L2C A;  2ZXW H;  1XD7 A;  3DWL E;  1TQM A;  3QU6 A;  2CW0 F;  3V4G A;  1TNT A;  3QYF A;  3G6E I;  1T56 A;  1RI7 A;  3LSM A;  2EZK A;  3K7A J;  4ENJ A;  2LMD A;  3ASO H;  1BJA A;  3K1P A;  4AYB N;  3BG7 A;  5B3S H;  1F43 A;  3SZT A;  3MN2 A;  1AA7 A;  3R4K A;  3OYD A;  3TL4 X;  4F52 A;  3WHB A;  1QZY A;  2V26 A;  2WAD A;  1HA8 A;  2CRG A;  2JJ7 A;  4V2G A;  4L18 B;  4EM2 A;  4OIO F;  4G7O F;  2ZKZ A;  5LEJ A;  1U78 A;  1JGS A;  1TNS A;  1MMG A;  5DD8 A;  3KCC A;  5HNH A;  1A5J A;  5HOD A;  2OF7 A;  3ECO A;  4I0B A;  3HOW J;  4F92 B;  2XRO A;  4F93 B;  3N97 A;  2R7Z J;  3DKX A;  3KZY A;  4A12 A;  4A2U A;  2VJI A;  2E2I J;  4C2U A;  4F3Q A;  1J2X A;  3F22 A;  3C3W A;  1IV8 A;  3ABT A;  5D4S A;  1VQM I;  1BR4 A;  4GYG A;  2M3A A;  4D0P A;  5CVI A;  5J8C A;  2GAU A;  3OYJ A;  3H9Q A;  3SEZ A;  2XDV A;  1Z77 A;  5EYR A;  4NC7 A;  2LY1 A;  5HVQ C;  4LLL A;  2HOA A;  2PJR B;  4EAT A;  1QZZ A;  4IHS A;  2JA5 J;  3K4M A;  1O7L A;  4B47 A;  4BAY A;  1Z91 A;  2F6C A;  5D5V B;  4WK8 F;  3ERE D;  4BE1 A;  2OZU A;  3HOU J;  1WJA A;  3OS0 A;  2MC4 A;  5EZG A;  1QNT A;  2H27 A;  2QYO A;  4B44 A;  5J4Y A;  3G73 A;  2LTP A;  2XPV A;  5DYM A;  2FX0 A;  3J7Z I;  4BJ6 C;  3LQR A;  1J5Y A;  4BU2 A;  4UUT A;  4C3H J;  1HW2 A;  2NXN B;  3K70 D;  1P7J A;  1WWX A;  1FOX A;  3TOA A;  3DPL C;  2K85 A;  5D6F A;  1MKM A;  4L9T A;  1GUU A;  4QWQ A;  3LSR A;  1EH6 A;  2E1O A;  1VFC A;  1JKQ C;  2DQL A;  2NVQ J;  1IXC A;  5K5R A;  2CU7 A;  3HHG A;  2Q1Z B;  3WG9 A;  2GIZ A;  1WJB A;  4D5C A;  3JSP A;  3CUO A;  2FNP A;  1Z21 A;  2DYR H;  2FU4 A;  1HDP A;  1T2K A;  2ZNZ A;  5CKT A;  4OIP F;  1VQN I;  3JR9 A;  1MBF A;  1HW5 A;  1H9T A;  2FEZ A;  3WTX C;  2L9S A;  3BPX A;  4L5I A;  2DJI A;  4YFX F;  4KDP A;  3RCO A;  2E1M C;  5M3F J;  3VSL A;  2LK2 A;  4HOB A;  3ZMS A;  3C18 A;  3JCU C;  5L3F A;  2Z2S B;  1TLH B;  2DA3 A;  3T5X A;  5K7H A;  5FD5 A;  2VT3 A;  1T95 A;  4RGX A;  2JVG A;  1YX3 A;  1APL C;  2R7T A;  2DMP A;  1R7J A;  2LH9 A;  1IRZ A;  2VQG A;  2IS4 A;  1XCV A;  3HOS A;  4UNO A;  1RNL A;  2P81 A;  3G3Z A;  2QQ9 A;  4PSX A;  3RQI A;  5LGU A;  4AM3 A;  3GYH X;  1P4X A;  3BRO A;  2M0C A;  2HYF A;  2YU9 J;  3EUK L;  3T8T A;  3OOU A;  1JJ8 C;  3T1B A;  2K4B A;  3CO6 C;  4A3L J;  2LKS A;  3P9K A;  3DP7 A;  3TBI A;  4I01 A;  2X1E A;  4ZYA A;  2XVC A;  1D1A A;  2LF7 A;  2OCE A;  3ZCO A;  3CCJ I;  1JT6 A;  2Y9Y A;  2L54 A;  2HEO A;  3GF2 A;  1QVT A;  4RM2 A;  1RKW A;  1S72 I;  1T98 A;  2X1C A;  3JTG A;  4BQA A;  3LQQ A;  4HQM A;  1Y0U A;  1IN4 A;  2HDW A;  2J5P A;  5F0F A;  5IP6 A;  2YSR A;  2L7M P;  1LUJ B;  3CD6 I;  3HSR A;  5JR3 A;  3DBH B;  1I3A A;  2HNH A;  3R6S A;  4A3F J;  1BC7 C;  4KIF A;  1ZYR F;  2O03 A;  4A3B J;  1FT9 A;  1XTA A;  4M6Y A;  3VYS B;  2ZJR F;  5FKK A;  2X6W A;  3HOV J;  1V55 H;  2R7D A;  3I4M J;  3Q5F A;  2XGX A;  2DBB A;  3OYL A;  1LFP A;  2LY9 A;  1P9Q C;  5JHF A;  2UUZ A;  3JRC A;  2L2O A;  5D8K B;  1ENH A;  1NHA A;  1W0T A;  1OIS A;  1SVM A;  4KT6 A;  5AON A;  3BZC A;  2OJE D;  1FWZ A;  4HPQ A;  2LVS A;  3HRS A;  5H6R A;  2XPU A;  4GFB A;  4IF4 A;  3ZMT A;  3RKY A;  5DUI A;  2G0E A;  2FQ4 A;  4FQG A;  2DOF A;  1YX5 A;  4EM0 B;  3K2Z A;  3HTS B;  1VND A;  3HG9 A;  1V5E A;  5GTI C;  5IYC J;  1RZ4 A;  5E3M A;  1Z6R A;  2CSO A;  2LC2 A;  4F55 A;  4OAY A;  1Z9C A;  5JHU A;  4BJT A;  1BOA A;  2IGK A;  2CJJ A;  5TRD A;  1MJ9 A;  4HV6 A;  2CH0 A;  2JQ7 A;  4MHG A;  2VBW A;  4BBR J;  3IP4 B;  3PNT A;  1DU0 A;  4ZJZ A;  4A0Z A;  5L3D A;  3TO6 A;  2UXX A;  3HKZ N;  1ETX A;  4UB6 C;  3CC4 I;  3ABK H;  2MA3 A;  2OAZ A;  4IOC F;  4G8X A;  5F6F A;  1RUO A;  3L2V A;  2VPL A;  3ZR8 X;  1ZRC A;  3C2H A;  3ZQF A;  4HF0 A;  4NUB A;  1MH4 A;  5IT9 K;  2GLO A;  5M5Y J;  2F4I A;  3NAR A;  2XSJ C;  2VKH A;  1KA8 A;  4BE2 A;  4RGR A;  4RAZ A;  3JRI A;  3CLQ A;  1DQU A;  4FX0 A;  2VN2 A;  1FX7 A;  3HZJ A;  3QOE A;  2QSH X;  1FYL A;  4IRI A;  3OWT A;  1J7K A;  2OV7 A;  2VUM J;  2VQC A;  4L9N A;  3SQN A;  5B1A H;  2YR2 A;  4DIQ A;  4LB5 A;  2DFE A;  3PSI A;  1I3Q J;  4LG3 A;  1E3O C;  3ZOB A;  1RC9 A;  1VQ4 I;  4DW6 A;  4EGY A;  4I6Z A;  2Z9O A;  3BT9 A;  4G6D A;  4RB3 C;  1N25 A;  3A01 A;  1K83 J;  5J1Y A;  2IA2 A;  2IJL A;  4B48 A;  3WGH A;  1O7F A;  4XID A;  1B4A A;  3SFI A;  1I6H J;  4QTR A;  1WJC A;  5IP7 J;  2ELJ A;  1TQP A;  2O3F A;  1R00 A;  1JKP C;  3I4N J;  3FXJ A;  1K7A A;  5E79 C;  2DQR A;  1GXP A;  2WAQ N;  1HSJ A;  1U9O A;  1VQ8 I;  2VKE A;  2XAQ A;  3UNG C;  1YJ9 I;  2XKP A;  5E3L A;  1MBE A;  4N0B A;  1OCO H;  2V1N A;  5L3B A;  4KFC A;  1WI3 A;  3K4J A;  2GZW A;  4BHP A;  3DEE A;  3I71 A;  4ZYE A;  4ZYD A;  1DP3 A;  2X9D A;  3Q3S A;  3KFW X;  5J1R A;  2ESH A;  2F2E A;  3GZ6 A;  5IPA A;  1DPU A;  4L9J A;  4JOM A;  1VF9 A;  1ON2 A;  1GDT A;  1I27 A;  1Y39 A;  1W7P A;  1JT0 A;  3ZMV A;  1FBQ A;  3U2R A;  3I54 A;  3QU3 A;  2FBI A;  4PJJ A;  2IS1 A;  1FYK A;  1D5V A;  4W97 A;  4NDL A;  2LYC A;  3WTW C;  2VB6 A;  4ESJ A;  2M8G X;  3K4L A;  3GCM A;  2ZBK A;  3CP8 A;  3ELK A;  1EKE A;  1JUM A;  2VT2 A;  3F6V A;  4E7S A;  1KON A;  2ZCW A;  3FM3 A;  1Z7U A;  4AU7 A;  5LHG A;  1LQ1 A;  4E7K A;  4JX5 A;  2BY0 A;  2FBK A;  3NQO A;  1DU6 A;  2UZK A;  3C1D A;  2RQP A;  2ELK A;  3C7J A;  4GCV A;  1OCC H;  3OOP A;  3PFY A;  4IOA F;  2M7A A;  1T38 A;  2OPT A;  2DMN A;  2JA8 J;  5GPC A;  1H0M A;  1JE8 A;  1MD0 A;  3K4K A;  1YJW I;  3TKY A;  2EBI A;  2MG4 A;  1QU3 A;  3CUQ C;  4CYD A;  1GHC A;  4B43 A;  2D5V A;  3A01 B;  4QSH A;  3EUH C;  1ZH5 A;  4A3E J;  3RPU A;  5A2Q K;  4IPA A;  5EF6 A;  2HDD A;  5LFA A;  2JA6 J;  2HDC A;  3KEO A;  2F5E A;  1J75 A;  2FMY A;  3OIQ A;  2Y9Z A;  4QIW N;  1HLV A;  2XIG A;  1JTX A;  4XRM A;  4DYQ A;  3K0L A;  3MAJ A;  3QWL A;  3GTL J;  3HGG A;  4LGW A;  2OTJ I;  5IYD J;  2L4M A;  2LOO A;  5FFZ A;  1BW5 A;  3L2R A;  4TV7 A;  1R71 A;  3PQJ A;  3ZPL A;  2R7O A;  4RDU A;  3B6A A;  3TQN A;  4PZJ A;  4BBS J;  1VQK I;  3HOT A;  5C44 J;  3Q0V A;  2O8X A;  1FMW A;  2XF6 A;  3GWZ A;  2XC7 A;  2O6G E;  4IKF A;  1W7P B;  1XX5 A;  1ZRF A;  5DD4 A;  1T0F C;  4YEL A;  4UUS A;  3RSN A;  1S29 A;  1A36 A;  4S04 A;  3FWE A;  1TW2 A;  1R1T A;  4A3D J;  1R58 A;  2V9V A;  4DZJ A;  4Y15 A;  4RB1 A;  1IAW A;  4GDF A;  4EEF G;  4D5F A;  3LOC A;  4ZH4 F;  2B63 J;  3I3L A;  1FTT A;  3CTA A;  4Q47 A;  2GA1 A;  2W84 A;  5EJC A;  3M07 A;  3DPU A;  2W57 A;  3O8H A;  4MO7 A;  4C3I J;  2W4S A;  1JUS A;  1OR7 C;  1SD6 A;  3OYH A;  5E3N A;  3QYE A;  3HOZ J;  1FP1 D;  5GAD J;  3QPL A;  1BL0 A;  3N05 A;  3SXY A;  2R5Y A;  1RES A;  2VBX A;  2M45 A;  3K1N A;  2DTZ A;  1ZHF A;  2HXI A;  5A2Q Z;  2PLY A;  1NG6 A;  1SD4 A;  2FOW A;  3QPS A;  2RGV A;  3OL4 A;  2OU2 A;  1IC8 A;  3M8E A;  3VDX A;  1X58 A;  1ETV A;  4UXN A;  3HOX J;  1SAU A;  4G7Z F;  1LDD A;  2CW8 A;  4CYC A;  3HSE A;  3A0H C;  3F6O A;  4OIR F;  3G4S I;  2KMU A;  3BY6 A;  2LP0 A;  4XOP A;  2DK8 A;  4EJV A;  1HF0 A;  2WA0 A;  4XLC A;  1IV6 A;  1L0O C;  3CCV I;  3FKJ A;  4XLE A;  3RKX A;  4E7Z A;  3CCR I;  4HLY A;  2HTJ A;  1N75 A;  2W82 A;  4X1E A;  1X1P A;  2M7B A;  4N9H A;  1DGR M;  2OQR A;  3H5N A;  1S6L A;  3B73 A;  1OPC A;  3GX4 X;  1B8I A;  4XIC A;  4HLX A;  3LSH A;  3QPH A;  3A1Y A;  4M9S A;  2IA0 A;  4AWX B;  2E34 A;  1UAA A;  3K70 C;  3BTI A;  3I5U A;  3HHH A;  2MAB A;  3PFI A;  2K3F A;  4PSW A;  4IHX A;  4NC6 A;  2VLA A;  2DA5 A;  2Q0O A;  3KZI C;  1WRJ A;  5J1U A;  4AIK A;  1WH5 A;  3LMM A;  4CUG A;  1HQC A;  3DBR B;  1Q1V A;  1Y6I A;  3FMR A;  4UB8 C;  3VPR A;  4UUS B;  3MKZ A;  4IX7 A;  4M74 A;  2FBH A;  2AHQ A;  5GTH C;  1P6R A;  4OIQ F;  1XGO A;  1OJL A;  2XB0 X;  3WOD F;  5TJJ A;  2EJR A;  3GW2 A;  4PJM A;  3GZ5 A;  3E6M A;  3W2V A;  3J7Y J;  1YIT I;  4YFN F;  2LR8 A;  2EIM H;  3BQY A;  2H94 A;  1BBY A;  3F8B A;  3FBI B;  3T8R A;  3ZP5 A;  1XSV A;  1R1V A;  3JAM K;  2VXZ A;  1XGM A;  3R61 A;  4HSR A;  1V3F A;  4Z2Y A;  1HKQ A;  1R1U A;  3HRM A;  5FKM A;  4ETS A;  2I5U A;  1NH3 A;  1YO5 C;  5DCF A;  2ISZ A;  1YRN A;  2L01 A;  2VAS A;  5KAI C;  1PUF A;  1K4S A;  1W5C C;  2R5Y B;  1OYY A;  4KA4 A;  2EA2 A;  4I0A A;  2D1H A;  3FKI J;  3NWT A;  4HF1 A;  4M73 A;  4HV5 A;  2CFX A;  2B9S A;  1BN5 A;  3I53 A;  3FHN A;  2KRC A;  4CYC B;  4BEH A;  4ENK A;  2K86 A;  2PBI A;  2W85 A;  2QGU A;  5DV5 A;  1WH7 A;  2ELH A;  1EF4 A;  1YS7 A;  2EH3 A;  2Y0S N;  1TL8 A;  3OR2 C;  4A3J J;  2VKV A;  4OU0 A;  5FLV A;  3O2P E;  1BW6 A;  4HDV A;  2GXA A;  3CJN A;  1J09 A;  1FSE A;  4XBF A;  3EYI A;  5DS9 A;  1O4X A;  1B8I B;  2RDP A;  1MBJ A;  2CW7 A;  2DA4 A;  1MMA A;  4C30 A;  2V7F A;  3D0S A;  3MKY B;  3BCB A;  3OL3 A;  2JSP A;  1R5G A;  5EEA A;  1OCP A;  1ODD A;  1X1B A;  2M87 A;  2Y31 A;  4RAY A;  1DPR A;  1OYW A;  2VL8 A;  1J59 A;  2VJ4 A;  4A6D A;  1Y56 A;  1C0W A;  2HS5 A;  2IGO A;  4WXH A;  3GTG J;  1ZAR A;  1X2M A;  2LSO A;  3ZXS A;  4ANJ A;  2PN6 A;  1VQ5 I;  1SMT A;  2XAF A;  3AG1 H;  2V79 A;  4KN4 X;  2NYX A;  4ZDP A;  4J19 A;  1S7O A;  1P4W A;  1KQ0 A;  4RM3 A;  3WTT C;  1IN6 A;  1MW7 A;  3CZ6 A;  1OQY A;  1TWG J;  2L9N A;  2BY2 A;  4BYY A;  1OCZ H;  1IXS B;  3DEW A;  4HNT A;  2DOE A;  1F5T A;  4K2E A;  3M3Y J;  2QCO A;  3EYY A;  5BPI A;  1PUF B;  2R7U A;  1MMN A;  3V7C A;  3S3M A;  2LLK A;  4ABZ A;  4DYC A;  2KFD A;  2COB A;  1Z6T A;  1DDN A;  2DXI A;  1ZRE A;  2E19 A;  2K9S A;  1J9I A;  1K79 A;  2P5L C;  4A5N A;  1QBJ A;  5K7Z A;  1E0E A;  3S16 J;  2J5O A;  3BOQ A;  1I39 A;  5E1X A;  3QQA A;  1TWH J;  4RGU A;  4BEH B;  2DT6 A;  1RRJ A;  4II2 A;  4X6A J;  1HCR A;  2RAE A;  2V6E A;  4B3A A;  4CXF A;  2VJ5 A;  1M1E B;  4IRH A;  4KUM A;  3S1N J;  3HXL A;  5FFX A;  1O3Q A;  4KYW A;  1ZAO A;  3EDP A;  2L02 A;  3ABL H;  2UV1 A;  1BIA A;  2GA2 A;  3D1N I;  4PFO A;  4Q4Z F;  2E2J J;  2JA7 J;  4M3B A;  2L7F P;  2ZJ2 A;  2E1C A;  2IP2 A;  2WWY A;  3V8J A;  3OIO A;  4DGW B;  1Z3X A;  2IS6 A;  1O3S A;  3H3U A;  3OYN A;  3BLY A;  3HRT A;  3L00 A;  2VIX A;  4WXD A;  2NVX J;  1YQA A;  4KJZ A;  1KU2 A;  4DOZ A;  3CMM A;  1WHU A;  1XG1 A;  3FK6 A;  2MH9 A;  3O8G A;  2A3S A;  5CVV A;  2B0L A;  4U88 A;  5E18 F;  1IRF A;  3WHC A;  3VWB A;  4HQE A;  4HST A;  4HA8 A;  2AO9 A;  3CF2 A;  3BJO A;  1E3H A;  2NRA C;  2BV6 A;  3I59 A;  3PUF A;  2JRT A;  4GO1 A;  1REP C;  4KMF A;  2WAF A;  3BR3 A;  2HOS A;  1UCR A;  3OV8 A;  2OQG A;  5HS9 A;  3QOP A;  3CMY A;  3CDL A;  3LA2 A;  2BY1 A;  3K10 A;  1SAN A;  4MFE A;  2R92 J;  5K5O A;  1G3T A;  5LGT A;  2HR3 A;  3ZN1 A;  5JFR A;  2GIV A;  5E3O A;  1VQ9 I;  2IPQ X;  3H5A A;  4BNC A;  3Q9V A;  4Y52 J;  4IHW A;  1Z0X A;  3W6V A;  4HX8 A;  4XLN F;  4BJ5 C;  3K2A A;  2KIQ A;  1QVU A;  3WTS C;  4G12 A;  2FF4 A;  1ONV A;  5JLW A;  2IGM A;  2Z3Y A;  1R6R A;  4BGD A;  5LHI A;  3OYG A;  4L5J A;  2M0M A;  5F08 A;  2RN7 A;  3BP8 A;  1LKX A;  2MGQ A;  1Y1V J;  3IUO A;  2MD0 A;  1YOV B;  4D7N A;  2IEK A;  3MD2 A;  4AUX A;  4U0Y A;  1VQO I;  2CUZ A;  2WV0 A;  2VXD A;  3I55 I;  4E7H A;  2BW3 A;  2NOJ B;  4KNY A;  2H8W A;  2E2H J;  2HFH A;  5BNG A;  4EJT A;  1OLT A;  2A05 A;  3QRF F;  1D5Y A;  1B59 A;  2GM4 A;  2E5Z A;  2JK3 A;  1JGG A;  3MKL A;  2WAE A;  4R79 A;  3OYM A;  3BJ6 A;  2Y30 A;  3BQZ A;  4XOR A;  4AVZ A;  3CC7 I;  3KLN A;  1G8X A;  2JN6 A;  4AVP A;  1L3L A;  3CLO A;  1V54 H;  3TO7 A;  1UJ8 A;  3ROU A;  2GXG A;  4KT5 C;  2KZV A;  2CFO A;  1ETQ A;  1IRG A;  1TT0 A;  3S17 J;  1ORK A;  3AAF A;  3GFJ A;  1K6Y A;  3OYA A;  1R5I D;  2AQE A;  3LA3 A;  3O6B B;  5K5Q A;  1O3R A;  3I59 B;  2XV4 S;  2ACJ A;  3WU0 A;  1VQ7 I;  4XRF A;  1BA5 A;  2EA4 A;  2HVR A;  3PO3 J;  1X1C A;  4XKB A;  4D9J A;  3JRA A;  4ENN A;  5CYV A;  1T8I A;  3BR0 A;  2E1N A;  5TIS C;  3IKT A;  1XS9 A;  3ABU A;  4PK4 A;  1UHS A;  2O5R A;  1V4R A;  5F27 A;  5KVR A;  1FTZ A;  3EUA A;  3HOY J;  2CQX A;  1QGP A;  3RKW A;  4PGH A;  3B02 A;  2VBZ A;  3ISP A;  5ERI A;  3IRR A;  3HM5 A;  1S5L C;  1BI2 A;  3ASN H;  3PIO F;  2DI3 A;  5B1B H;  4DJA A;  3BJA A;  3KEQ A;  3Q0U A;  1IZ1 A;  4AD9 A;  2QA4 I;  4HAM A;  1R4M B;  2XF5 A;  1FBS A;  1XDS A;  2UXN A;  1X3U A;  5EGO A;  4KIS A;  2FSW A;  3FF5 A;  2YX4 A;  4CCL A;  4I76 A;  3H0D A;  3FM5 A;  1HC8 A;  3KYC B;  3IL2 A;  4A5M A;  1WKM A;  1W5T A;  2RC4 A;  4LMY A;  4XLF A;  3SDG A;  4XSX F;  1LFU P;  2BW3 B;  2ZC2 A;  4IJA A;  2XGE A;  2K5C A;  4XR6 A;  3J80 K;  5C4X J;  2JVH A;  2R93 J;  5J8F A;  1FNN A;  3LSP A;  4FIS A;  1R23 A;  1OKR A;  5M5X J;  5KNL A;  2M9H A;  1UMQ A;  2TDX A;  1U5T A;  3V42 A;  2R7Q A;  2RKH A;  1G2H A;  3TP0 A;  3CMA I;  2O7O A;  4QPQ A;  2MH2 A;  1IN7 A;  1FEX A;  3BTL A;  3HRU A;  1Y8R B;  4CZC A;  1ZR2 A;  2JZY A;  2X6X A;  4EJU A;  3JRG A;  4LB6 B;  3K69 A;  2D45 A;  1YS6 A;  3E3V A;  4Z6Y A;  5FRN A;  3MZ8 A;  3ZQI A;  2FD5 A;  2E5N A;  3ONQ A;  2X4H A;  3FX3 A;  5FRM A;  1X2N A;  5FO5 A;  2AQF A;  4A0Y A;  3N4M A;  3KEY A;  4V19 K;  1SFE A;  1LEB A;  3QP5 A;  1KQ8 A;  4G7H F;  1ULY A;  2EZI A;  4ZZL A;  2MYS A;  2L7Z A;  3WGI A;  4IHV A;  4A3C J;  1R5H A;  4LIV A;  2GWR A;  4DBQ A;  3SZG A;  5HNF A;  3E6C C;  2NNN A;  2OCC H;  3M8J A;  2ZSH B;  1E3P A;  2A69 F;  2D2W A;  5CVR A;  4A69 C;  1UG0 A;  5FRO A;  2KRH A;  2R7W A;  2V1D A;  2E36 A;  4ZTF A;  4Y3O A;  2F4O B;  4QLC U;  4B09 A;  2DT7 B;  2ECC A;  2K9N A;  5EGO B;  3M9A A;  4I7H A;  4A93 J;  4N4N B;  5ILU A;  3J80 Z;  3BTJ A;  4D7M A;  2NS0 A;  1B6A A;  3J7A Y;  2A6T A;  2JSC A;  2BEO A;  4WX9 A;  2HGC A;  2R7X A;  4UV8 A;  1TWC J;  1IW7 F;  3MZH A;  1WPK A;  1BC8 C;  3VYU B;  4ZDO A;  4II3 A;  4Q48 A;  1U5T B;  4RBO A;  2WV1 A;  2ECB A;  4EJO A;  1BI0 A;  2O0Y A;  3KYD B;  3CCY A;  4ZYH A;  1U0J A;  4U87 A;  2WAQ A;  4A3G J;  1UG2 A;  4L5E A;  1XGS A;  3F8N A;  4PUS A;  5J47 A;  2PQ8 A;  4I98 B;  2VOO A;  2Z5U A;  4IL6 C;  4XM3 A;  1IGN A;  4NNJ A;  3CQZ J;  3S93 A;  4FE4 A;  2ISY A;  3ZMU A;  4YFK F;  5FJ8 J;  3S1R J;  3CCE I;  1R4N B;  4I09 A;  3S2W A;  2HU9 A;  4L9V A;  3H3V K;  4BXF A;  4ESB A;  1IN8 A;  3BR6 A;  1OFC X;  1D0X A;  4OIN F;  2DOD A;  1ZGA A;  1IXR C;  4Y13 A;  1N78 A;  2KL4 A;  4WF2 A;  2FXA A;  1R36 A;  3G1L A;  5IYB J;  2WY7 Q;  4CO8 A;  3F72 A;  2DA1 A;  1BIB A;  2G9W A;  3I9V 2;  4XL9 A;  4EVI A;  4KMU X;  2GOM A;  2F5F A;  2F48 A;  4UV9 A;  1D1B A;  2KHM A;  2GOX B;  1MNE A;  3UKG A;  4XNF A;  4FX4 A;  1YW8 A;  3U1D A;  3K1M A;  2EV5 A;  1BI3 A;  4XKV A;  1TBX A;  3GO5 A;  3SEQ A;  2DT5 A;  2XSD C;  1BM9 A;  2KIU A;  5KAF C;  4IEJ A;  3DTI A;  3FXR A;  2HVQ A;  4YEJ A;  2VOD A;  5D5W B;  1ZLK A;  4B1R A;  2LG4 A;  1FSH A;  5ICG A;  5HLI A;  3ZQ7 A;  5F1R A;  3H1C A;  1AU7 A;  3TW7 A;  3FDY A;  1ZG1 A;  3RKQ A;  3JRB A;  2HQ5 A;  3WTZ A;  2K02 A;  3SHF A;  1FC3 A;  2ICW G;  2HOE A;  2FUG 2;  2QBY A;  3OSG A;  2OUM A;  3J81 K;  1W7P D;  2R4G A;  4L0Z B;  3KE2 A;  1W1W E;  3H0G J;  1TWF J;  3KP3 A;  3BWG A;  4GGG A;  1RR7 A;  4M6X A;  4PJN A;  4XN3 A;  3E6B A;  4E7L A;  5J4V A;  2L3D A;  1WFX A;  2R7F A;  3LWF A;  4G6T B;  4MTE A;  4CHU A;  2MC3 A;  2BHZ A;  4A3M J;  1WVR A;  4LOC A;  4XKC A;  1I1S A;  2I10 A;  3VB2 A;  2QWW A;  3P9C A;  1D8K A;  3DTK A;  1ZLJ A;  1H89 C;  4OWR B;  5AIP A;  2JA2 A;  1MBK A;  1PVE A;  2NAZ A;  4IHT A;  2K4J A;  1KU7 A;  1I6X A;  3JRF A;  2DK5 A;  3DTE A;  3V7R A;  4EMS A;  4LIT A;  3BG9 A;  4DBR A;  2V9P A;  2AXT C;  2A68 F;  4HYE A;  1FP2 A;  1PJR A;  2YX7 A;  3RPU D;  3WU1 B;  3JRH A;  3LAJ A;  4E7J A;  1VQP I;  4HW0 A;  2JWT A;  2L9V A;  1IO2 A;  3LSI A;  2M34 A;  3E5Q A;  4XMY A;  4BHB A;  4M72 A;  1FLI A;  1SMY F;  3ERM A;  1PDN C;  2CV0 A;  2I8D A;  3SFZ A;  4ENM A;  3M1E A;  5JVG F;  2DA2 A;  2RQQ A;  4B8X A;  2RRE A;  2Z99 A;  1CF7 A;  3HPH A;  5E8I A;  2VE9 A;  2E7X A;  1G3W A;  5CQE A;  4E6K G;  4Y7N J;  2QSG X;  3J7A O;  3HGY A;  5JI6 A;  3J81 Z;  1OCT C;  4UVA A;  3RTR A;  2YS9 A;  2VJJ A;  3RI4 A;  3NEU A;  4JX6 A;  1ITY A;  3GBG A;  3GZN B;  5JVT A;  4DQ2 A;  2STT A;  2QBY B;  2COM A;  2A61 A;  2QSF X;  2FQ3 A;  4JQF A;  2QEX I;  3C2B A;  3VOD A;  2EFP A;  2KJB A;  1UHM A;  3K9T A;  1HOM A;  5EZH A;  2NVY J;  5KK1 A;  3IWZ A;  2EFW A;  1XCB A;  3UR3 C;  4AIH A;  4BHC A;  4BUP A;  1DP7 P;  1A04 A;  1P92 A;  5HLG A;  1G4D A;  2DJN A;  1WJE A;  2HWV A;  4OOI A;  3I4P A;  2IA1 A;  2ETH A;  2F5C A;  2NVU B;  5EG0 A;  3F8M A;  3TOB A;  4C9Y A;  3TGN A;  3CCM I;  3CDI A;  2JT1 A;  3EET A;  1RPW A;  4BE0 A;  3F8C A;  2HQA A;  4ITV A;  2DMQ A;  1KYW A;  2WB1 N;  3L1P A;  3D5S C;  2XB5 A;  4DZP A;  2PEX A;  2LKX A;  1MNM C;  3HB9 A;  3R60 A;  2P6T A;  3ZGK A;  3M7G A;  4M9X A;  2QVO A;  5D8L B;  5KHD A;  3ECH A;  3RPQ A;  2BXZ A;  2PX9 A;  2ZFW A;  1R22 A;  1X4P A;  4HX4 A;  3TP3 A;  1WJD A;  2H6C A;  1EH7 A;  2LRE A;  4HZF A;  5LHH A;  3OYB A;  3OYI A;  1CF7 B;  1P4A A;  4A0X A;  1DUX C;  2QF7 A;  2A6H F;  1MSE C;  3H36 A;  4P1W A;  2V9K A;  1EA3 A;  5FD6 A;  2R7R A;  2CV2 A;  3G2B A;  2BZT A;  3TO9 A;  4J00 A;  1AHD P;  3DKY A;  2VQL A;  4EM1 A;  5HS8 A;  3E97 A;  4IQJ A;  5IOY A;  3ZQC A;  2DAO A;  3WG7 H;  4U7B A;  4BY1 J;  3O3K A;  4ZC3 A;  1TWA J;  5LRR A;  3GTM J;  1MJB A;  2Y0S A;  4ZYG A;  5FLX Z;  2A07 F;  2Y69 H;  3OR1 C;  3I56 I;  3LFU A;  2BYV E;  2LY2 A;  1S7A A;  5GAE J;  4XLP F;  4BY7 J;  1ZEL A;  2KDO A; 
#chains in the Genus database with same CATH homology
 1IG7 A;  4FE7 A;  3HKZ N;  1ETX A;  3K2A A;  1R9T J;  1QVU A;  3E7L A;  3LNQ A;  4G12 A;  5F04 A;  5J3L A;  5JLW A;  3ZQF A;  2IAI A;  2O8K A;  3S15 J;  1MH4 A;  2GLO A;  5M5Y J;  5F08 A;  3NAR A;  2O9L A;  1A6I A;  2ZB9 A;  2GBY A;  5EG0 B;  1JKO C;  3GTQ J;  2MGQ A;  3JRI A;  1Y1V J;  2DN0 A;  3IH3 A;  1H88 C;  4AC0 A;  4D7N A;  2IEK A;  1MSF C;  2K9Q A;  1NK3 P;  3BR2 A;  4AUX A;  2R5Z B;  3G1M A;  1VI0 A;  2VUM J;  4C3J J;  3S2H J;  9ANT A;  2VI6 A;  2DMU A;  2E2H J;  5BNG A;  5FKN A;  5GPA A;  1I3Q J;  1D5Y A;  1ETY A;  4M3E A;  1E3O C;  2GM4 A;  3ZOB A;  2JK3 A;  3NAU A;  1JGG A;  3MKL A;  4W1U A;  4DW6 A;  2Y30 A;  3BQZ A;  4M6V A;  4I6Z A;  3BT9 A;  2PMZ N;  1JTY A;  3DCF A;  2JN6 A;  3Q0W A;  3A01 A;  3RZD J;  1K83 J;  5J1Y A;  1XC5 A;  4XID A;  1S7E A;  3SFI A;  3HDD A;  1GVD A;  1I6H J;  4QTR A;  1ETQ A;  5IP7 J;  3GTP J;  3S17 J;  1ORK A;  3I4N J;  1LE8 A;  1JKP C;  2WAQ N;  1U9O A;  2VKE A;  4JP0 A;  1BA5 A;  1TC3 C;  3GTO J;  3PO3 J;  2KT0 A;  3OSF A;  5E3L A;  3JRA A;  1MBE A;  1ZR4 A;  3PO2 J;  1POG A;  3HEF A;  3BR0 A;  1WI3 A;  5C4J J;  1XS9 A;  1JKR C;  2EQR A;  1UHS A;  5F27 A;  2X9D A;  3Q3S A;  5J1R A;  2ME0 A;  4XRS G;  1FTZ A;  1IDZ A;  3HOY J;  2CQX A;  5IPA A;  1BJZ A;  3HM5 A;  2IBD A;  1VF9 A;  1NTC A;  1GDT A;  3HBL A;  2LD5 A;  5F1J A;  1JT0 A;  4B4C A;  3Q0U A;  4M3D A;  2M2E A;  4NDL A;  4W97 A;  2M8G X;  5IOZ A;  1RET A;  5EGO A;  1JUM A;  2TCT A;  2EZL A;  4I76 A;  3BR5 A;  4JX5 A;  4XRS A;  2HOT A;  1DU6 A;  2NS7 A;  2ELK A;  3SDG A;  1LFU P;  1T33 A;  2L0K A;  1W0U A;  2EZH A;  2OPT A;  2XGE A;  1AKH A;  2DMN A;  5GP9 A;  5C4X J;  2R93 J;  3GTK J;  2JA8 J;  3LSP A;  2NS8 A;  4FIS A;  1WCM J;  4V2F A;  3FK7 A;  5GPC A;  5M5X J;  2M9H A;  2R0Q C;  1UMQ A;  2EBI A;  2MG4 A;  1IDY A;  3FIS A;  1G2H A;  3TP0 A;  2O7O A;  3A01 B;  2D5V A;  4QSH A;  2L9R A;  5F0C A;  4A3E J;  2NVT J;  3ZQH A;  3GTJ J;  1FIP A;  5EF6 A;  1FEX A;  3BTL A;  2HDD A;  1ZR2 A;  2JA6 J;  1LE8 B;  3JRG A;  2X48 A;  2Y9Z A;  3LSJ A;  4QIW N;  1HLV A;  1JTX A;  4XRM A;  4DYQ A;  2JMW A;  4MFD A;  2MW8 A;  3ZQI A;  2FD5 A;  2LFB A;  3JRD A;  3GTL J;  3HGG A;  5IYD J;  1X2N A;  2CUE A;  4A3I J;  2N8G A;  4IHW A;  1BW5 A;  2XGD A;  1MH3 A;  2EZI A;  4RDU A;  2L7Z A;  3B6A A;  4BBS J;  3W6V A;  4IHY A;  5C44 J;  1WGX A;  1CQT A;  3Q0V A;  4IHV A;  2ME6 A;  4A3C J;  2X6O A;  2W48 A;  4UUS A;  5FKL A;  4A69 C;  3M4O J;  4A3D J;  4DZJ A;  4M3G A;  3LSG A;  4EEF G;  4D5F A;  3LOC A;  4BXX J;  2B63 J;  2ECC A;  2K9N A;  5EGO B;  1FTT A;  4A93 J;  3BTJ A;  1ZK8 A;  3O8H A;  4M3F A;  4MO7 A;  4C3I J;  4D7M A;  1JUS A;  5E3N A;  5C3E J;  4BKX A;  1BL0 A;  3HOZ J;  3QPL A;  2YUS A;  1ZGW A;  4MIM A;  1AKH B;  1TWC J;  2R5Y A;  1RES A;  1WPK A;  2DTZ A;  2HXI A;  3QPS A;  1ETO A;  4RBO A;  2WV1 A;  2ECB A;  1IC8 A;  3A02 A;  3A03 A;  1X58 A;  1ETV A;  3CCY A;  3HOX J;  1ETW A;  4CYC A;  1YRN B;  1I50 J;  2LP0 A;  2XRL A;  1UG2 A;  4L5E A;  4A3G J;  1F36 A;  1HF0 A;  1IV6 A;  3BG3 A;  3S2D J;  2Y2Z A;  5FKO A;  4X1E A;  1IGN A;  3CQZ J;  4FE4 A;  1K61 A;  5FJ8 J;  3S1R J;  1B8I A;  4XIC A;  3H3V K;  1T56 A;  3BR6 A;  1OFC X;  5F0H A;  1Y1W J;  2EZK A;  3FIW A;  3K7A J;  3BTI A;  4IHX A;  2DA5 A;  3G1L A;  4AYB N;  5IYB J;  1F43 A;  3MN2 A;  5J1U A;  2DA1 A;  1WH5 A;  1FIA A;  3WHB A;  1Q1V A;  4UUS B;  3VPR A;  1MBG A;  1QPI A;  2CRG A;  2JJ7 A;  4V2G A;  4HNV A;  2AHQ A;  3ZQL A;  1U78 A;  1OJL A;  2XB0 X;  3UKG A;  1A5J A;  5HOD A;  2OF7 A;  3IV5 A;  3TED A;  1JJ6 C;  2XPW A;  2LR8 A;  3HOW J;  3BQY A;  2XSD C;  4IEJ A;  2R7Z J;  5FKM A;  4B1R A;  2ID6 A;  2E2I J;  1YRN A;  1PUF A;  2R5Y B;  1ZTR A;  1AU7 A;  3TW7 A;  3RZO J;  3RKQ A;  3JRB A;  2HQ5 A;  1NK2 P;  3FKI J;  1Z77 A;  5EYR A;  1ZQ3 P;  3OSG A;  1U8B A;  3TW6 A;  2HOA A;  4CYC B;  3H0G J;  1TWF J;  2JA5 J;  4JX4 A;  4S0H B;  1RR7 A;  1WH7 A;  1EF4 A;  1FJL A;  2EH3 A;  2Y0S N;  3HOU J;  4A3J J;  3BR1 A;  2VKV A;  5FLV A;  5M3M J;  5EZG A;  1BW6 A;  1ETK A;  2CUF A;  2LTP A;  2XPV A;  5DS9 A;  4A3M J;  1O4X A;  2FX0 A;  4LOC A;  3S1Q J;  1B8I B;  4UUT A;  1MBJ A;  2I10 A;  4C3H J;  2DA4 A;  4XK4 A;  1P7J A;  5FLM J;  1H89 C;  2XGC A;  5EEA A;  1OCP A;  1GUU A;  1MBH A;  3LSR A;  2Y31 A;  1MBK A;  2E1O A;  1VFC A;  1JKQ C;  3JRF A;  2ID3 A;  3GTG J;  2NVQ J;  2HI3 A;  2FJ1 A;  1GT0 C;  3BG9 A;  1X2M A;  2CU7 A;  4D5C A;  3JRH A;  1HDP A;  2H1K A;  2JWT A;  3JR9 A;  1MBF A;  4J19 A;  2M34 A;  2MSY A;  5DTD A;  3IH2 A;  4MLO A;  5M3F J;  1TWG J;  2LK2 A;  1GV2 A;  2DA2 A;  3DEW A;  2DA3 A;  1GV5 A;  5K7F A;  5K7H A;  3ZQG A;  1H8A C;  4Y7N J;  3M3Y J;  2QCO A;  2H8R A;  1PUF B;  1APL C;  3HGY A;  2DMP A;  2LLK A;  1OCT C;  4ABZ A;  4DYC A;  2YS9 A;  1IRZ A;  3JRE A;  2COB A;  4JX6 A;  1JUP A;  2P81 A;  3GBG A;  1ITY A;  2E19 A;  2K9S A;  3RQI A;  2M0C A;  5EDN A;  2YU9 J;  3OOU A;  1JJ8 C;  5K7Z A;  3S16 J;  3MVP A;  2NOG A;  4FTH A;  3QQA A;  1TWH J;  1ZKG A;  4A3L J;  3C2B A;  4X6A J;  1HCR A;  2RAE A;  1IUF A;  3PM1 A;  4B3A A;  1B72 A;  1HOM A;  3G1O A;  5EZH A;  2NVY J;  3BG5 A;  3S1N J;  3IH4 A;  1JT6 A;  2Y9Y A;  5JLX A;  1QVT A;  3D1N I;  1RKW A;  2DJN A;  4JYK A;  2E2J J;  2JA7 J;  4M3B A;  5F0F A;  2L7F P;  5IP6 A;  2L7M P;  5EG0 A;  2K40 A;  3OIO A;  1RPW A;  1U9N A;  2R5Z A;  1HDD C;  4A3F J;  2DA7 A;  2DMQ A;  2WB1 N;  4A3B J;  2DMT A;  3L1P A;  3HOV J;  5FKK A;  2XB5 A;  3I4M J;  2NVX J;  4DZP A;  2LKX A;  1MNM C;  3F0C A;  3BTC A;  3HB9 A;  2DA6 A;  2LY9 A;  2HXO A;  2HYJ A;  4C2M J;  3JRC A;  1XG1 A;  3FK6 A;  3O8G A;  1ENH A;  1W0T A;  1P7I A;  5IP9 J;  3TP3 A;  3WHC A;  5M5W J;  2LVS A;  2XPU A;  4GFB A;  2AO9 A;  2QF7 A;  2G0E A;  1MSE C;  2FQ4 A;  1IJW C;  1LFB A;  4FCY A;  1VND A;  1AHD P;  1QRY A;  2VPR A;  2CQQ A;  5IYC J;  2HOS A;  3BR3 A;  5E3M A;  3SJM A;  5IOY A;  3S14 J;  3CMY A;  1RKT A;  3ZQC A;  3CDL A;  2TRT A;  1SAN A;  4A3K J;  4DYR A;  4MFE A;  2R92 J;  4BY1 J;  1SFO J;  2CJJ A;  3GTM J;  1TWA J;  3S1M J;  5E3O A;  4BBR J;  3B6C A;  4Y52 J;  1DU0 A;  1Z0X A;  4BY7 J;  2KDZ A;  1B72 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...