1ETXA

The crystal structure of e. coli fis mutant q74a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
74
Chain Sequence
b'VLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRGNATRAALMMGINRGTLRKKLKKYGMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 27
structure length 74
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etxA00
1RETA 5IYCJ 4XRSA 3BR2A 4S0HB 2HDDA 4DW6A 4HNVA 3BR5A 1A5JA 1X2MA 1GDTA 4FTHA 2VPRA 5E3MA 1FIPA 1A6IA 2DA5A 4UUSA 3HOUJ 2NVXJ 1ETVA 2NS7A 2LLKA 2R92J 2GBYA 3F0CA 1JT6A 1HF0A 2LVSA 4XIDA 1XG1A 3FKIJ 5FKKA 2P81A 4DYCA 3B6AA 4JX6A 3L1PA 3LSGA 3GTMJ 5C4JJ 3SJMA 1UMQA 1IJWC 1BA5A 4DZPA 5IP6A 3ZQLA 5JLWA 2ID6A 5M3FJ 3HOWJ 2R0QC 3BG3A 5FKOA 3OSFA 4IEJA 1ZR2A 1JTXA 4XRSG 2MSYA 4A3BJ 2X9DA 4AC0A 5IYBJ 1LFBA 1QVUA 3Q0VA 4DYRA 5E3OA 2E1OA 3GTLJ 5F08A 2G0EA 3TP3A 2HOAA 5K7FA 5C44J 4A3EJ 2GM4A 1I50J 4CYCA 1JUMA 1NK3P 4UUSB 3CQZJ 1XC5A 1I3QJ 5K7ZA 4B3AA 2NOGA 2HOTA 1IV6A 2HI3A 1BW6A 1ENHA 4FISA 2B63J 3HOXJ 3C2BA 1WH5A 4JX5A 1G2HA 4A3FJ 3BR0A 1UHSA 5DS9A 2VUMJ 5BNGA 2R5ZA 2LY9A 2L7ZA 1ZK8A 4GFBA 3PM1A 4D7MA 3SDGA 3S1RJ 2K9NA 5FLMJ 3Q0UA 1P7JA 2Y0SN 3QPSA 5FJ8J 2AO9A 2LFBA 4A69C 2MW8A 5FLVA 1ZKGA 3CMYA 1QRYA 5C3EJ 2VKEA 1AU7A 3I4MJ 2LKXA 1HOMA 1S7EA 3BG5A 4V2FA 3FK7A 1VFCA 2EBIA 1PUFB 2M34A 2CQQA 4BY1J 3SFIA 9ANTA 4W97A 2WAQN 2I10A 2Y2ZA 4QTRA 5E3LA 1ORKA 5GPCA 1H8AC 3BG9A 2Y9ZA 4D7NA 1K61A 4EEFG 1FTZA 3A01A 2DA2A 3BR3A 1ITYA 3S1MJ 3S2HJ 5EDNA 1IGNA 2K40A 1O4XA 5M5YJ 3MVPA 2NS8A 4FE4A 2ZB9A 3BTIA 4MFDA 1NTCA 4G12A 4XK4A 4D5CA 4V2GA 1W0UA 3HOZJ 1WH7A 2NVQJ 2CUEA 2AHQA 5EZGA 1U9NA 4M6VA 2R5ZB 4XICA 2X6OA 3H0GJ 4MIMA 4C3IJ 3GTQJ 4UUTA 3S1QJ 3M4OJ 2DTZA 2MGQA 3QPLA 2DMTA 1JKQC 1VF9A 5GPAA 4A3KJ 2O9LA 4JP0A 2XGDA 3OIOA 4RBOA 3TEDA 1BJZA 2DA3A 3RZDJ 4B1RA 3JRCA 3LSPA 2QCOA 2XPWA 3HM5A 5C4XJ 1P7IA 5EZHA 1ZQ3P 2TRTA 4MO7A 3LOCA 4W1UA 3ZQHA 1MNMC 2E2IJ 3S17J 4M3BA 1JKRC 1TWGJ 1TWAJ 2NVYJ 3G1OA 1POGA 1OFCX 2N8GA 3WHCA 2KT0A 4A3JJ 2RAEA 3HKZN 4QSHA 1TC3C 2D5VA 2HQ5A 3A01B 1BW5A 1JUPA 3DCFA 3LSRA 1ETKA 4RDUA 3S1NJ 2LD5A 3ZQFA 1Z77A 2TCTA 5IYDJ 2FQ4A 2JWTA 1UG2A 5F04A 1APLC 5EGOA 1ETXA 4J19A 3JRAA 4MLOA 4QIWN 3JREA 2JA6J 4A93J 5F27A 2R5YA 1PUFA 1OJLA 1JTYA 2Y31A 4I76A 3CDLA 3HGGA 2DA7A 4Y52J 3S16J 3BTJA 1D5YA 4NDLA 1GT0C 2XSDC 2E2JJ 3NARA 4L5EA 3Q3SA 5IOZA 2E2HJ 1BL0A 2PMZN 5IOYA 3PO2J 5F0CA 3LNQA 2NVTJ 3K7AJ 2EZKA 1F43A 2JA7J 2IBDA 3TW7A 4C3JJ 2EZHA 1MBEA 2ECCA 4XRMA 5J1YA 4M3FA 3PO3J 3JR9A 1WCMJ 3A03A 4X6AJ 2EZIA 1HDDC 3S15J 2L0KA 1QVTA 5F0HA 1I6HJ 2EH3A 1HLVA 3IH4A 4Y7NJ 2K9QA 5EGOB 3JRGA 1AHDP 5EG0A 2LP0A 2EZLA 1FTTA 1R9TJ 3QQAA 4MFEA 3BTCA 2R5YB 1WGXA 2ID3A 1ETYA 2O7OA 1TWHJ 3JRIA 2DJNA 2YS9A 1DU0A 1DU6A 5M3MJ 4LOCA 1H88C 1TWCJ 2M8GX 1X2NA 5M5XJ 2L7FP 1B72A 3K2AA 1XS9A 1GV5A 2CU7A 1OCPA 2H1KA 1FIAA 2M0CA 2X48A 1FEXA 4X1EA 4D5FA 3GTPJ 2ELKA 1OCTC 4BBSJ 1AKHA 2H8RA 3JRDA 1WPKA 2E19A 3A02A 2IEKA 3BQZA 3IH3A 5GP9A 5DTDA 2MG4A 1LE8A 2JJ7A 2VI6A 2COBA 1JJ6C 1K83J 1JJ8C 1FJLA 3GTGJ 5IP7J 4BY7J 1TWFJ 5IPAA 4AYBN 4BXXJ 2OPTA 2R7ZJ 4C2MJ 2XB5A 2HXOA 3BTLA 1SFOJ 5F1JA 3TP0A 3RQIA 3D1NI 1ETWA 3M3YJ 3CCYA 2DN0A 2VKVA 3GBGA 2R93J 1ZGWA 1MSFC 5EG0B 3G1MA 1QPIA 1VNDA 1CQTA 4I6ZA 3G1LA 3ZQCA 5J1RA 1RPWA 2JN6A 1ETQA 1MBHA 2ECBA 1U8BA 2CQXA 1B8IA 4IHVA 1JKOC 2XB0X 3HB9A 1MBKA 1RESA 1WI3A 1B72B 2K9SA 1F36A 3O8HA 2DMUA 2GLOA 4M3DA 3BT9A 3FK6A 2YUSA 3ZOBA 2ME6A 3HOYJ 4A3IJ 3O8GA 1AKHB 2JMWA 2DMNA 4IHXA 5FKNA 2XGCA 4IHYA 3TW6A 5J3LA 1Q1VA 3JRFA 3DEWA 3OSGA 2Y30A 1LE8B 3HDDA 4IHWA 5FKLA 1IC8A 5J1UA 3S2DJ 2XGEA 2OF7A 3IH2A 3HBLA 4BBRJ 3ZQIA 3UKGA 1JGGA 2DA1A 1RKTA 2JK3A 3WHBA 2HYJA 2HOSA 2HXIA 5EF6A 2JA5J 2IAIA 4JX4A 3B6CA 5IP9J 1E3OC 1IDZA 3LSJA 2Y9YA 4DZJA 2KDZA 1U78A 2EQRA 1RKWA 2DMPA 1HCRA 1YRNA 3H3VK 1HDPA 1IUFA 3BR6A 1JKPC 1GUUA 1MH4A 1B8IB 1ZR4A 3GTOJ 3IV5A 1ETOA 1Y1WJ 2QF7A 2CRGA 1IG7A 3FISA 4FCYA 5EEAA 3JRBA 2FD5A 5EYRA 4AUXA 2L9RA 1MSEC 3VPRA 2DA6A 2WB1N 2DMQA 1VI0A 1JT0A 3BQYA 3E7LA 5E3NA 1IDYA 1U9OA 2XPUA 3Q0WA 2M2EA 2ME0A 2L7MP 2FX0A 2XRLA 3FIWA 3RKQA 1NK2P 4B4CA 4DYQA 3HGYA 5F0FA 2W48A 4M3EA 4A3CJ 3JRHA 1W0TA 4JYKA 1T56A 4M3GA 3I4NJ 3HEFA 2LR8A 3OOUA 1YRNB 1SANA 2LTPA 2M9HA 2XPVA 1RR7A 2WV1A 3S14J 5M5WJ 1LFUP 3W6VA 1GV2A 1X58A 3ZQGA 2JA8J 1EF4A 2YU9J 2LK2A 4CYCB 1MBGA 2CUFA 4A3MJ 1IRZA 2FJ1A 4A3GJ 3BR1A 3MKLA 3NAUA 4C3HJ 3GTKJ 3HOVJ 1MH3A 4BKXA 5K7HA 3MN2A 1JUSA 2CJJA 1H89C 4A3DJ 4A3LJ 1Z0XA 2DA4A 5HODA 1T33A 1ZTRA 1Y1VJ 4FE7A 1GVDA 1MBFA 4ABZA 2O8KA 5FKMA 3RZOJ 1MBJA 3GTJJ 5JLXA
chains in the Genus database with same CATH superfamily
1RETA 4A5MA 4HA8A 3C2HA 2M4KA 3JTGA 3ELKA 4KITB 1GDTA 2ZJRF 3OYLA 1XB4A 3K0LA 3CLQA 2WB1A 5E3MA 1A6IA 1R36A 3SZPA 1YE9A 1P4XA 4UHTA 4V19K 2GBYA 1Z05A 1HF0A 4WK8F 1OCCH 4XIDA 3J80Z 1K7AA 3D0SA 2R7VA 5FKKA 4HLYA 4L9TA 3AFHA 3BC8A 4JX6A 2V4JC 2XAQA 3BROA 4M6YA 2VBXA 3FF5A 2EFNA 2WA0A 2DJIA 4N9IA 2KJCA 3JTHA 4DZPA 3I59A 1R6RA 3MZ8A 2HDCA 4NC7A 1OQYA 2JUGA 3EQLF 1W36C 1P4WA 4IQJA 2PX9A 2OZ6A 3QYEA 3BG3A 4KT5C 2HPMA 4XRSG 4ESFA 1FT9A 1Z7UA 5EEGA 2K86A 4ZDLA 5ICFA 4ESBA 3CUQC 1YTYA 2EFWA 4EM0B 1YIOA 3Q0VA 4DYRA 3FMSA 5E3OA 1FSEA 3B02A 3GTLJ 4RLFA 3K4NA 1BI1A 1WQ2A 5F08A 4AYBA 3KYLA 2FBKA 2GM4A 2E5NA 2HKXA 5C44J 4A3EJ 1WI9A 3K2ZA 1Z6TA 2E7WA 3IWZA 4AVPA 5JI6A 4CYCA 2X1EA 3CQZJ 3WE2A 1IAWA 1SMTA 2LOOA 5K7ZA 2O3FA 4XLNF 5J8CA 2CS3A 4HF1A 1KQ8A 4FISA 3HOXJ 2H09A 4A3FJ 1QU3A 5DS9A 5E17F 4M71A 4NHJA 3EPZA 2R5ZA 2LY9A 1T2KA 1ZK8A 3WTTC 2EFQA 1D1CA 1YW8A 3RDIA 4JOMA 1QZYA 3CJRB 2K3FA 2QSFX 5FLMJ 3Q0UA 3AG2H 2CMPA 2PI0A 3GYHX 2Y0SN 1R23A 1OYIA 4ENMA 2LFBA 4ZYAA 2MW8A 3HZJA 1X3WB 1QRYA 2V1NA 3I4MJ 4XLHA 1HOMA 4A5NA 4ZTJA 1S7EA 3MMYB 2Y48A 3BG5A 5L3EA 2PJRA 2ZO4A 3MZHA 1VFCA 3R60A 2FOWA 5HS7A 3O6BB 2M34A 3AG3H 4F92B 1A04A 2CQQA 2ZMEA 1T8IA 1MD0A 2FMYA 1ORKA 4ENJA 3FMQA 2Y9ZA 4D7NA 2AQFA 4UY8I 5FGMA 2NVUB 3A01A 4G6DA 1OLTA 2M7AA 1ITYA 1TTYA 2E5ZA 3K4KA 5M5YJ 2EA2A 4RGXA 4AWXB 1WWXA 2NS8A 4FE4A 4MFDA 4U87A 2UUZA 3EUHC 4G12A 2RN7A 3BZCA 5EZGA 1J59A 2CSOA 4MIMA 2C6YA 2K5CA 2DMTA 3DU6A 3FXQA 4HLXA 3ASNH 1EA3A 4RAFA 4YEJA 5GPAA 5TGTA 1ZG5A 2O9LA 3OIOA 4LB6B 3WG7H 4RBOA 5JR3A 1BJZA 2DA3A 2K9MA 2ZSIB 2XAJA 4TV7A 2LRDA 4B1RA 1XGNA 1B9NA 1OYYA 4HAMA 2ZKZA 4KIFA 3K4JA 2K3PA 4RAGA 1P6RA 4XMYA 2IS1A 1MDMB 3QOEA 3ZQHA 3UNGC 1JGSA 2A69F 3S17J 2UZKA 1TWGJ 1OCRH 1BIAA 2XF7A 3R0JA 1OFCX 2FSWA 1JHHA 2X1DA 2Y0SA 4UV8A 3JAMZ 4IQ4A 2BW3B 5DCMA 3DCFA 1QZEA 4A0YA 1FC3A 4RGRA 5L3FA 4BDZA 3D5SC 1ETKA 3QYBA 4XKVA 3OL4A 3X2QH 2GQQA 1FYMA 2DT7B 1TNTA 2L9SA 1Z77A 4CCLA 2FQ4A 1APLC 1UG2A 5F04A 3I55I 3ABMH 1ETXA 1HW1A 2O03A 2NRAC 4B43A 3E6DA 4UB8C 3GF2A 4P1WA 1YG2A 5F27A 1OJLA 4BDYA 3CDLA 1NH3A 2DA7A 4Y52J 3CLOA 4UV9A 5L3BA 1G8XA 3GW2A 5LFAA 1D5YA 3U1DA 4NDLA 2M5WA 3CC7I 4KNYA 1U5TA 2RKHA 1A35A 1TQMA 1K78B 1OYWA 2KLOA 4DJAA 4EQQA 3JAMK 4L5EA 1Z91A 4UB6C 5E8GA 3BG7A 1UB9A 3VFZA 1VQ7I 1FBUA 2UV1A 5IOYA 3PO2J 2R7FA 2XGXA 3L7WA 3LNQA 2VXZA 2XSJC 2IGKA 3TW7A 1X3UA 4CSWA 2ELHA 2GWRA 4P96A 4XRMA 4M3FA 2X6XA 4HNUA 3F8CA 3SYTA 3S15J 2HQAA 2CV2A 4RS8A 3BJAA 2Z9OA 2VKDA 2ELJA 3ZCOA 2EV5A 5FB2A 1KYWA 3M9AA 3N05A 1I6HJ 2ZCWA 1HLVA 3IH4A 4Y7NJ 2ZSHB 5EGOB 1TW3A 4RA2A 3JRGA 2QSHX 3DXJF 3PQKA 1FTTA 1SFUA 1R9TJ 4E7JA 2R5YB 1ETYA 1QHGA 3A0HC 5LGNA 1DU6A 2DLLA 1L0OC 2DK5A 1YJ9I 1FOXA 2M3AA 4MNUA 3RKXA 1UELB 2W1OA 2VIXA 1TWCJ 3OY9A 2HVSA 3LL7A 4GXOA 3UR3C 2UXNA 3KEQA 4XSXF 3DQVC 3OYHA 1OCPA 1SAXA 4X1EA 4D5FA 2M30A 3F8MA 2F5DA 2JPBA 1WPKA 2L9VA 2E19A 3DFGA 4KIGA 3CCQI 3BQZA 1BI0A 3IH3A 3ZMVA 5GP9A 1SC7A 3HUGB 1QGPA 3DBHB 2KIUA 3H9GA 1RZ4A 1O7LA 4NUBA 3DKWA 4LLLA 4BXXJ 3NEUA 1RIOH 2L9NA 4IJAA 2HXOA 2L2OA 3RQIA 3TP0A 4HQMA 3M3YJ 2CWEA 3VYTB 4R8HA 3L9FA 4FASD 2DK8A 3DF8A 2W84A 3G1MA 1QPIA 1VNDA 2BY0A 1RPWA 1B8IA 2EPFA 1Z67A 3BCBA 4LITA 1YYVA 4EVIA 2LKSA 5D5WB 1Y0UA 2DU9A 2DFHA 3E6CC 4K2EA 1Y6IA 3L2RA 1S72I 4PZJA 4RAYA 2K9SA 2WBMA 4EMSA 3O8HA 4I0BA 3LSHA 1FYKA 1I27A 3CP2A 3H5AA 4M3DA 3W2WA 4KA4A 4KN4X 2DDBA 2FU4A 3FK6A 3MAJA 3BZ6A 2ME6A 1LVKA 4A3IJ 2A07F 4LG0A 4A0XA 1ZH5A 4II3A 2BHZA 3RQ4A 1XCVA 4BACA 5JVTA 3DEWA 1WZ2A 4L5IA 4H0EA 4U7DA 5IT9K 4IHWA 1SFKA 2B9SA 4CCOA 1IC8A 3FWEA 3TOBA 4PUSA 2OF7A 3UKGA 2Z3YA 1FPQA 1UZCA 2HYJA 4DBRA 5EF6A 4RGUA 4C2TA 2JA5J 4JX4A 3QP5A 1E3OC 2DOFA 3QU6A 2LG4A 4RB3C 3FM5A 4R79A 2XAHA 3QODA 1HCRA 3H3VK 1JKPC 5DUIA 2KFDA 2XIGA 1MH4A 2XKPA 2P6TA 3CESA 2X6WA 5TISC 5GTIC 2OU2A 2RQPA 3C3WA 1D3YA 1MSEC 2XROA 3ZN1A 3K69A 2QF7A 4U0WA 2CRGA 3WGIA 3FISA 4FCYA 3GFLA 2FA5A 4UVAA 3B73A 2IA2A 3MEXA 2W82A 5EYRA 2L01A 1U5TC 4FETA 2Y75A 2HTJA 2KZVA 1JT0A 1IV8A 1AWCA 5BPIA 3OOPA 1U9OA 2QVOA 2M2EA 2FX0A 2XRLA 1O3SA 3S8PA 2F4MB 3RKQA 1L3LA 4JBAA 5F64A 1K4TA 2FNPA 4ZYGA 2H8WA 3CCVI 1TLHB 1GVJA 3TMOA 3HGYA 3M7GA 1MNDA 2ISYA 4A3CJ 2GIZA 2KL4A 4IX7A 5FD6A 1KZHA 1H9GA 2Z2SB 5L3GA 2M8EA 3E1SA 2ZFUA 2V6CA 4JYKA 1FOYA 2O6GE 2VT3A 2EFPA 4XQFA 4ZH4F 2E71A 5ICCA 5A2QZ 5BMZA 3K1PA 3HEFA 4M74A 2R7QA 1YRNB 4E7IA 2LTPA 3MKWB 1T95A 2KRFA 3HOSA 1KGSA 3W6VA 2JA8J 4F93B 1REPC 4IPAA 1ZN2A 3VB2A 3S32A 2PBIA 3L2UA 1ZREA 2B0LA 1RUOA 2FJ1A 4HX8A 1MZBA 3MKLA 4KT6A 1YO5C 2LBFB 3MN2A 1JUSA 3TDZC 1QQIA 1P9QC 4N0BA 4ASNA 1UJ8A 2JRMA 1DGRM 4A3LJ 5A2QK 2DA4A 2IA1A 2GXGA 4E7SA 4EM2A 1ZTRA 1Y1VJ 1Z21A 1MBFA 3PIOF 3H1CA 1ZGAA 1MBJA 3GTJJ 2HFHA 3WTVC 4NC8A 4XRSA 3BR2A 4G7OF 4BHCA 3K6GA 3KCCA 3K4LA 4DW6A 4HNVA 2HVRA 2EV6A 1X2MA 2GA1A 3CDIA 4FTHA 1LDJA 1LB2A 1FIPA 5B66C 5HLTA 3KETA 3HOUJ 2NVXJ 1ETVA 3BG6A 1D0ZA 3IAS2 2DI3A 2P8TA 1G4DA 2LVSA 1DGWY 4CZCA 3OR2C 1XG1A 3FKIJ 4OWRB 4CHUA 2P81A 4DYCA 1OISA 3LQRA 5KVRA 4ZZDA 3KZYA 2XKOA 5LHIA 3L1PA 3F21A 3LSGA 2K7LA 3GTMJ 4WX9A 1PVEA 1FLIA 2O0YA 2VJ4A 4ENKA 3HSFA 4IHTA 3E6BA 3H92A 1EJ9A 4I02A 3TL4X 1PUEE 2A6HF 3HOWJ 5FKOA 1YX3A 2A6TA 2ESNA 2LY1A 3GFIA 3TBIA 1O3RA 3V7SA 3I9V2 4HV5A 4GDFA 2X9DA 4XRFA 3EUKL 3CD6I 3ABLH 1LFPA 2Q0OA 2DOEA 2QKLB 3DV8A 2MH2A 2ZFWA 4DNCA 1X3ZB 5IYBJ 1LFBA 2EV0A 2EIJH 2F5FA 4BNCA 3H5NA 4CICA 2XV4S 4QWQA 4IRIA 1D8JA 2HOAA 3QPHA 1I50J 2EIMH 3OYNA 1JUMA 2KP6A 1NK3P 4UUSB 1VQ8I 2HQRA 5B1AH 4G6TB 4B3AA 2L02A 4MEYF 1IV6A 1KU9A 1BW6A 1I3AA 2HI3A 4CA0A 3I0TA 3KP7A 3C2BA 3ZQ7A 4XN3A 2V9VA 4CYDA 3AL0C 2VUMJ 5BNGA 4E6KG 1EKEA 2L7ZA 3G3ZA 3CJQB 3IKVA 4D7MA 4ZZLA 2MLGA 3S1RJ 1STZA 2MABA 1P7JA 5AIPA 4D9JA 3IC7A 3W6KB 3VWBA 3COAC 4LG3A 3G2BA 1SD6A 2DYSH 3CMYA 3EUAA 3E6MA 5C3EJ 5KCMA 4BQQA 3EUHA 3J81K 3PL8A 2LKXA 3F3XA 4IKFA 1WFXA 1FZPB 4V2FA 3AL0B 3FK7A 1MDMA 3DPUA 1PUFB 2QKMB 2KQRA 3T8TA 9ANTA 4M72A 2WAQN 2I10A 4HDUA 3E3VA 4Q47A 1YJNI 1SFEA 2J5PA 2PFBA 1ODDA 2AXLA 3HRSA 3HSRA 2E1MB 5HNFA 4E7LA 2DA2A 1B59A 3SFZA 3M8JA 4ZTFA 3QU3A 5CQEA 3M07A 3MVPA 1IZ1A 1TT5B 2QWWA 2HNHA 1YHQI 3BTIA 4P9UA 4ESJA 1FMWA 2BE5F 4CUGA 2QENA 3LSKA 4P9FA 4D5CA 5FO5A 4V2GA 2NVQJ 3WTZA 2JT1A 3ERED 1ULYA 4YRVA 1IF1A 3H0GJ 1XSVA 1T0FC 4C3IJ 3S1QJ 4Y13A 3RCOA 3M4OJ 2CYYA 4LK1F 2DYRH 4JP0A 1NG6A 3KE2A 2VC0A 3DEUA 2P5LC 4HZFA 4CGZA 1HBXG 4NNJA 4BQOA 1K78A 3LSPA 3HOTA 1XX5A 3L2QA 1LJ9A 2QCOA 2XPWA 4MTEA 1YIJI 2Y69H 2VN2A 3TDUC 1JI8A 4B09A 5D8KB 4B3XA 1K4SA 1ZQ3P 3FHZA 4W1UA 1MNMC 1X1CA 2E2IJ 4F55A 1D1BA 4XORA 4Y15A 3F8BA 3IUOA 4QLCU 2NVYJ 4YELA 1W4MA 1I5ZA 1VQ4I 1S9HA 2X4HA 4RGSA 2HR3A 2KT0A 4KMUX 2VXDA 3RYPA 1TC3C 1BW5A 2Q2EB 1JUPA 3V42A 1OKRA 5DYMA 3P5JA 4YFXF 4E7HA 2DW4A 3LSRA 1BOAA 3S1NJ 4XONA 3BJ6A 3R61A 3VEPA 3ZQFA 1RR8C 2RNGA 1MIJA 5EGOA 3PNYA 3P9IA 3SEZA 3H35A 3NWTA 1B1BA 3OMYA 4S04A 4XKWA 2DTRA 1ZAOA 5D8LB 1QA6A 1V54H 2WAQA 3FXKA 2R5YA 4AM3A 3GMEA 2Z99A 4G7HF 3CCSI 2RVCA 3J80K 3VODA 4ZJZA 1GT0C 3GCMA 2BXZA 2XSDC 3ZP5A 3VSLA 2E2JJ 4KDPA 4CCMA 5IT3A 2MFZA 3IRRA 2V6EA 4LFUA 3Q3SA 3LQQA 2WTEA 4EJOA 1XPXA 2CFXA 5IOZA 3WTXC 2E2HJ 2MA3A 1JE8A 2IXSA 2PMZN 1UCRA 1K6OA 3K4BA 3K7AJ 4A0ZA 1ERDA 1F43A 2BHYA 1F1ZA 2KIMA 3DBRB 1MBEA 5DCFA 2KDOA 4O5VA 2M4GA 5J1YA 4OMYA 3PO3J 3JR9A 2DBBA 2XHKA 2XRNA 3A0BC 3DTEA 1HDDC 4X6AJ 3KP5A 2IGOA 3AG4H 4ANJA 1YI2I 1FSHA 3QRFF 1LDKB 2L4AA 2F6CA 1EH6A 2IW5A 3CDHA 2VODA 3L2VA 3ECHA 1VZ0A 2YX7A 2VKHA 1UFMA 2CV1A 2EA4A 1W1WE 2LP0A 2EZLA 2R4GA 5D6EA 4MFEA 2QBYB 5E1WA 4KISA 3NQOA 2JA2A 1CF7B 3WTSC 1J7KA 2FF4A 2ID3A 3FXJA 5D4SA 2R7DA 3JRIA 3TO7A 1FYLA 4IVNA 5FRMA 1D0XA 5JHFA 1ZHFA 1WSUA 1E0EA 5M5XJ 3TQNA 4S05A 2VQCA 3K2AA 1ZLKA 3HL2A 3I5UA 1B6AA 3ZGKA 3F8NA 2H6BA 4LMYA 4BBSJ 5DV5A 2IJLA 2NOJB 1W7PB 5KK1A 1A31A 3A02A 2IEKA 2OC6A 4XLEA 4Z6YA 3HJEA 2V9KA 5DTDA 1A36A 2DT6A 2E1NA 3OYJA 1DUXC 1JJ8C 3V7RA 1XMKA 1FJLA 3GTGJ 5IP7J 2WWYA 3CCUI 1TWFJ 4LJZF 4QPQA 2IVMA 3WTYC 1BOBA 3VDXA 1Z9CA 3WGHA 4C2MJ 3HHGA 4PGHA 2XB5A 1DDNA 2STTA 1H9TA 2KHMA 5F1JA 1R7JA 3FM3A 2PMZA 3JCUC 3GBGA 2WADA 2JTVA 2ETHA 3QAHA 2M1BA 5FLXZ 1JHFA 2CUJA 1ON2A 1FOKA 1I6XA 2FXAA 1I1SA 1IN6A 4BXUA 2NAZA 2P5VA 5ILVA 3G1LA 3ZQCA 3H3UA 3KEOA 2ECBA 4IHVA 3VOEA 1WJDA 1JKOC 3W2AA 2BV6A 2D1VA 5GADJ 1MBKA 4O6JA 3MZYA 1UG0A 1WI3A 4XM3A 3GZ5A 1B4AA 1SD5A 3BT9A 2YUSA 4WCGA 3FHNA 5J8FA 3ULQB 3DBLB 3O8GA 2E35A 2DMNA 2VQLA 3AG1H 2LREA 2XVCA 2IT0A 1T6SA 3KZZA 3TW6A 5FLXK 4EJWA 3HDDA 3IAM2 1SVLA 5HS8A 1OCTC 4L9VA 1ZRFA 5HDGA 2G7UA 2JQ7A 3S2DJ 2EFOA 3DKXA 4IO9F 4HSTA 1JXSA 5E8IA 2ISZA 3ZQIA 1QPMA 2DA1A 3BPVA 3CJNA 1ZRCA 4WF2A 5K5QA 2BXYA 5BQTA 2E60A 3DLLF 1T39A 2HOSA 2HXIA 4DOZA 3NWSA 2CW7A 1KQ9A 5IP9J 2FQ3A 2X1CA 3OL3A 1VQLI 1IDZA 2W00A 3LSJA 3W2VA 1QBJA 5EEHA 1RKWA 1YRNA 1IUFA 5EJCA 4MHGA 1W7PD 2LSOA 2E36A 2VBZA 1ZR4A 3U9GA 3K1NA 3P9CA 4NBQA 4A6DA 4BU2A 3O2PE 4XLPF 2LC2A 4AVZA 4BE2A 1ACIA 2A6EF 5EEAA 5H6RA 1LEBA 4BS9A 2H6CA 2A3SA 3ZMDA 1QHHD 2V79A 4NQWB 2E7XA 2W85A 2LBFA 1R00A 3BQYA 4Q5SF 5ERIA 5E3NA 2GA2A 3V4GA 2XPUA 3F9KA 1X1DA 4PDKA 2VOOA 2ME0A 3PIPF 3OYBA 5D5VB 2OCCH 4ENNA 1EH8A 3F6VA 5D6FA 2NNYA 1ZARA 2BGCA 2DFFA 4EV0A 5F0FA 4AIKA 2JVHA 4M3EA 2XC7A 2D1HA 3N97A 1S6LA 2Y0MA 3ABUA 4NB5A 1MJBA 3I59B 3KIOA 4EJVA 3P7NA 3TGNA 2H27A 3KPHA 1T56A 2VOPA 1J9IA 3QP6A 4HRIA 1Y56A 4MTDA 2LR8A 2QQAA 5CLSA 3ABTA 1SANA 2BZTA 3PNVA 4LIUA 4RB0A 3SDBA 3JSPA 2QQ9A 4HOBA 4BE1A 1GV2A 2F2EA 3ZQGA 4BHPA 2CFOA 2LK2A 1FX7A 1WJAA 1X4OA 4CYCB 3M1CA 2CUFA 1GXPA 1IRZA 2BBYA 1IN4A 2K4BA 4BEHB 3LSIA 3OR1C 5F1RA 4OIOF 3S93A 3CJTB 2WC2A 4RLQA 4L9JA 5LEKA 2I8DA 2CJJA 3CUOA 1H89C 3SEQA 3L2WA 1T33A 3CCMI 4LB5A 1GVDA 4XKBA 3CTAA 5L3DA 1TQIA 2QEXI 4ON0A 2VJJA 1HKTA 3CMMA 4S0HB 2TDXA 3I64A 2HDDA 4CCNA 2G9WA 3BR5A 4J01A 2KRCA 4BGDA 2VPRA 3HRMA 3OIPA 3AAFA 4XOPA 4UUVA 4UUSA 4EJTA 1D0YA 4CCKA 4QPOA 2D2WA 2PJRB 3OS2A 5AONA 4OAZA 3H3ZA 4IF4A 3F0CA 4N4OB 2DT5A 4OIQF 4G7ZF 2PN6A 2IRFG 1E2XA 2CUZA 5LHGA 3B6AA 3LAPA 3BCAA 3SQNA 1HQCA 5DM7F 3KLNA 4CH7A 4BAYA 1IRXA 1D1AA 5C4JJ 1UMQA 2JVGA 5IP6A 4EGZA 3ZQLA 1RRJA 1DQUA 5JLWA 1IW7F 4GYGA 4M9ZA 4DBQA 4GRIA 2JUCA 5M3FJ 2R0QC 1HC8A 4OU0A 2HYFA 3OSFA 4IEJA 1F5TA 3E0JB 1JTXA 2YPRA 4LGWA 1KU7A 2MSYA 1FOWA 4A3BJ 5FFXA 2A68F 2JSPA 1MMDA 3ZXSA 2XAUA 5FFZA 4KMFA 2DQLA 1ONVA 1Z7LA 2CW8A 3I71A 3IHUA 2E1OA 1R5HA 2QYOA 3LAJA 3FX3A 3TP3A 4NC6A 4O3MA 3I54A 3JSOA 1F9NA 2HZTA 1I3QJ 1DPUA 4RAZA 1FWZA 1Z1DA 2GAUA 4RM3A 4WXDA 3KZIC 2HOTA 1YS6A 2P7VB 1ENHA 4I2OA 2VBWA 2MC4A 4JX5A 1G2HA 4PFOA 3BR0A 1UHSA 1YW9A 4Y17A 4HSRA 3R0AA 2AXTC 1UHMA 4XN0A 2BVMA 4CZZA 3HPGA 4GFBA 5H6QA 5GAHJ 1S8NA 1XSXA 4OOIA 3SDGA 4L9NA 2K9NA 3KP6A 1J0RA 3M8EA 3QPSA 5FJ8J 2AO9A 5KAFC 3ROUA 3ONQA 5H20A 2K27A 3L09A 1AU7A 2VKEA 1VQ6I 4BJ5C 1LUJB 1G3TA 4YFKF 2HKOA 2MLKA 4JK1X 3RTRA 3U2RA 5B3SH 3DP7A 2DXIA 1T0FA 2BOLA 4IZZA 3OWTA 2F4OB 2H94A 4PJ0C 4H4KC 1G3SA 4W97A 4QTRA 2Y2ZA 3OYEA 1IXCA 5GPCA 2CO5A 1KA8A 1SVMA 5JVGF 5FRNA 3H9QA 1WVRA 2YX4A 4N4NB 4EEFG 1GXQA 1FTZA 2FBIA 2ZJ2A 2K85A 1WJ5A 2Q2EA 1WRJA 5EDNA 4A6EA 1IGNA 2K40A 2A61A 2IS4A 2R3SA 3WG9A 3IKTA 1MNEA 2VASA 3W3CA 3FBNB 2ZB9A 3J7AO 3WU2C 3DPTA 3I3LA 2ZXHA 5CVJA 4HBLA 5LEJA 1W0UA 3GVAA 4XKCA 2HPIA 3OYGA 3OYIA 3HOZJ 2AHQA 2L54A 3FXUA 2QZ8A 2ACJA 4F3QA 2MGQA 3HPHA 3H36A 4XBFA 1JKQC 1BN5A 4YIFA 2P4WA 3GLLA 4FHTA 1P2FA 1XGMA 3TEDA 3ZMUA 1Y8QB 2WV0A 3RZDJ 2LF8A 2Q8KA 3TO9A 4ZYHA 3JRCA 3HXLA 3ABKH 1IN7A 3GZ6A 3HM5A 1PDNC 2WY8Q 1WJCA 3QWLA 3LOCA 2KMUA 2I5UA 2W57A 4YFNF 1O3TA 3BLYA 1S7OA 1TWAJ 3G1OA 4UXNA 4RB1A 1E3HA 1OCOH 2N8GA 3WHCA 5HLGA 4AIJA 2RAEA 3HKZN 3FBIB 3MFKA 2RREA 4A3JJ 2EJRA 2IPQX 2RV8A 2WAFA 2X51A 4GCVA 2UWMA 1FMVA 3BOQA 1DP3A 4RDUA 1X19A 4KJZA 1S29A 1MMGA 2A05A 5IYDJ 4ZC3A 2HOEA 2DPDA 3LWFA 5DD8A 1GLNA 3K4MA 5IY5H 3JRAA 4PJMA 4J19A 3SZGA 4MLOA 4QIWN 3QPTA 3JREA 2JA6J 2F48A 3T8RA 3HGGA 1PP7U 3GFMA 3S16J 1YOVB 3BTJA 3PJRA 2X85A 3CCEI 2QGUA 2PJPA 4II2A 4IHSA 2UXXA 3H0DA 1YW7A 5J6XA 4Q4ZF 2VL8A 2XF6A 3KP4A 1LVAA 3O3KA 1OPCA 3EYYA 2IGNA 3PSIA 4BQAA 2FRHA 3F6OA 2IBDA 3U1KA 3J7YJ 2EZHA 2ECCA 4GGGA 2PMUA 3F22A 2FMLA 4XR6A 3CF2A 3A03A 3FXRA 4DIQA 1NG7A 3DU5A 3T0YA 2VT2A 2R7SA 5DD4A 1R4NB 3KP2A 3WU1B 1XGSA 2EINH 2L7KA 1G59A 1VQOI 5F0HA 1E17A 2E1MC 3LFUA 2OA4A 4LG0B 3PNTA 3ZRGA 3H5RA 5J40A 1XSDA 4EGYA 3C18A 2MH9A 2NXNB 2F5VA 4IOCF 1AHDP 1U0JA 2NYXA 3KX2A 4PSWA 2QUFA 3BTCA 1BIBA 1WGXA 2EIKH 1H0MA 3L00A 4L18B 1DU0A 2XASA 3E97A 3HKZA 5M3MJ 2YR2A 3RKYA 5TRDA 5CJ9A 4LOCA 2M8GX 1V4RA 1X2NA 1TQPA 3E5UA 5J47A 5K5OA 1ZG1A 1GV5A 2BW3A 2CU7A 3RYRA 2H1KA 1FIAA 3W6JB 2M0CA 2X48A 3Q9VA 1FEXA 1WJFA 3GTPJ 2RNJA 2LNBA 2H8RA 3JRDA 5KHDA 5LRRA 2V26A 5LBQA 4I01A 4CO8A 4CXFA 4M6XA 1OMIA 2COBA 1XMXA 1K83J 3SHFA 3BPXA 2P5KA 2JZYA 3CO7C 3K70D 3EYIA 1DP7P 1AOYA 1BM9A 2W7NA 3DEEA 3GXOA 4AYBN 1K79A 2OPTA 3PUBA 2R7ZJ 1HKQA 5DUKA 3N4MA 2O8XA 4PJNA 1SFOJ 1G6NA 1R1VA 1ETWA 2L4MA 1R5GA 3D5LA 3K10A 3CP8A 3BY6A 1ZGWA 3A4CA 4IRHA 1MSFC 5EG0B 3I4PA 1S3JA 2LYCA 3BWGA 3P9KA 3OYMA 5J1RA 2JN6A 3CCLI 1U8BA 2XAFA 4G9YA 2HDWA 2FBHA 1OCZH 3HB9A 4ETSA 1HA8A 2GOXB 3KEYA 1RESA 1SAUA 1B72B 2WY7Q 4C2UA 4BHBA 5ILSA 1TP4A 2DMUA 4YG2F 4YIIA 3OS0A 1GHCA 1S7AA 4Q48A 2J5OA 4M9SA 1RUNA 4U88A 5K1YA 1BC7C 4NQWA 1BR2A 4UVCA 3MWMA 1AKHB 1V5EA 2JMWA 4DQ2A 4IHXA 5FKNA 2M45A 4CDGA 2HGCA 1Q1VA 3KYDB 3JRFA 3OSGA 2Y30A 5ILUA 1LE8B 1HSTA 4RMNA 3BDDA 4MQ9F 2VLAA 4AU7A 2ZNYA 2HS5A 5J1UA 2V1XA 1RC9A 2BY3A 3IH2A 1TT0A 1JGGA 1OR7C 2K02A 4WXCA 3D5RC 2DFIA 2JK3A 1QZZA 1R22A 3V8KA 3WHBA 4KIBA 2VONA 1E3PA 3T1BA 1PYVA 2BYVE 5AIQA 1TBXA 3DWLE 4DZJA 1YFHA 1U78A 2PG4A 4OAYA 2EQRA 2DMPA 1HDPA 3BR6A 2DPUA 4L0ZB 4LD5A 1GUUA 3IRQA 3OV8A 3F23A 2JSCA 2KRHA 2OD5A 5LRSA 1T98A 2ZJQF 2B7EA 1MMAA 3HUGA 1KQ0A 2PEXA 4B8XA 3FDYA 3PQJA 2X0LA 4B47A 3VYUB 3JRBA 4XLAA 4BEHA 1X1PA 3SXYA 2X6YA 1FBSA 2RGVA 4R1HA 4U7BA 5H2FC 3CO6C 5FROA 4I99C 5D5XB 1SVOA 1U2WA 2V7FA 3C2GA 3FXOA 4BUPA 3CUQB 3GLXA 3ZR8X 1TZLA 3OYFA 1LKXA 4HEA2 4DYQA 1SD7A 4I09A 4HPQA 2W48A 3QOPA 1WKMA 2K4JA 5F6FA 4OIPF 1BI3A 5CPRB 1B9MA 1BR4A 2BY1A 4P5OA 1LNWA 2NNNA 1SD4A 3I4NJ 4IOAF 2PQ8A 3K1MA 4LLNA 4F52A 3VSKA 3OOUA 2R7WA 1SMYF 2LF7A 4UVBA 4G6QA 3HHHA 2XF5A 1RR7A 2WV1A 4A2UA 1VQKI 3VYRB 3S14J 3PUFA 4KUMA 2PLYA 5BS6A 4AD9A 2ZBKA 1X58A 5CVRA 1WJEA 3J7ZI 2L5QA 3NRVA 1IXRC 1ON1A 2YU9J 1N75A 1MBGA 3K4CA 3IWFA 1ZGJA 5JHUA 4A3GJ 2OBPA 4C3HJ 3HOVJ 2R7XA 5HS9A 4BKXA 1YJWI 4KN7X 3RIRA 3KFWX 3EDPA 2HU9A 1Z0XA 2H1LA 5HODA 1IN8A 3MKZA 1YITI 2WAEA 1D5VA 2YU3A 2O8KA 1V55H 5FKMA 3RZOJ 3ASOH 1N78A 4AIDA 2JPCA 5JLXA 5IYCJ 3J7AY 3HRTA 4PJLA 1BBYA 1R4MB 3C1DA 5E20A 5GAEJ 1A5JA 1XGOA 4PFPA 1HW2A 1W36D 2KZGA 4BE0A 2CQ7A 2OQGA 5D4RA 2OTLI 2DA5A 3ZQQA 3IL2A 2XAGA 1HW5A 2KKOA 3FZVA 2NS7A 2LLKA 2R92J 3ZN0A 3WU0A 1JT6A 4F7ZA 1XN7A 5CVVA 2Z16A 4RM2A 3ZMZA 1R58A 1W5CC 5ED4A 4WXHA 2W4SA 1EV7A 1FP1D 3DTKA 2P7CB 3M8FA 3GX4X 3ML6A 3SJMA 1IJWC 1QNTA 3CCRI 1IXSB 1BA5A 4I7HA 4PJJA 1R1UA 4EATA 4OINF 4BYYA 1R1TA 2ID6A 4I0AA 3OYAA 4E7KA 3S3NA 1ZR2A 1IO2A 4HF0A 5HLHA 3RPUD 2FNAA 2HEOA 2NS0A 5DDGA 2HTSA 2R7UA 3CMAI 1LPQA 4AC0A 1MKMA 1I39A 2YSRA 2OAZA 1QVUA 4IRGA 4BQNA 1XTAA 1J2XA 4M9XA 1O7FA 3CCJI 5CVIA 1I1GA 3OYCA 2G0EA 5K7FA 3OYKA 4KICA 1IRGA 2V1UA 2L3DA 2OCEA 1XC5A 4PK4A 1K6YA 3HG9A 2NOGA 1S5LC 2OTJI 2B63J 3CF5F 1WH5A 2OUMA 1RNLA 3FMRA 2OJED 2P6SA 3TOAA 4HX4A 4U0YA 5LHHA 2K9LA 4C9YA 3PM1A 2LY2A 4FQGA 2VJIA 1Z3YA 5DM6F 1N77A 5CKTA 2MBFA 1ZRDA 1QO0D 5E18F 2DOAA 4G8XA 3GFJA 4A69C 5FLVA 1ZKGA 2IGMA 1MW7A 3GZNB 2FOKA 1V5GA 5ICGA 2VQGA 2EBIA 4FX0A 1R71A 4OIRF 3I58A 2LKPA 5HNHA 4BY1J 3MCZA 3SFIA 2Q1ZB 2DDAA 1H8AC 5E3LA 3BG9A 4XNFA 2CV0A 1K61A 4WWCA 3GWZA 1TL8A 3BR3A 3IP4B 1WJBA 1MGTA 3VYSB 3S1MJ 1M1EB 5TJJA 2HWVA 3S2HJ 1IUYA 5CQGA 1O4XA 3PSFA 4L0YB 3R4KA 1SFXA 1UHWA 4IL6C 1NTCA 2E34A 3Q9SA 4XK4A 5KAIC 2O5RA 1R49A 4KFCA 1Y39A 2EWNA 4HV6A 1WH7A 2CUEA 3S2WA 2R5ZB 2HQNA 1U9NA 4M6VA 3ZMSA 4XICA 2X6OA 4E70A 3GTQJ 4M73A 4UUTA 2DTZA 3QPLA 2ZMEC 4Y4RA 4BH9A 3G6EI 1VF9A 4A3KJ 2W25A 2XGDA 1MJ9A 3LA2A 5BOXA 2R7TA 2P0WA 4BL0B 3CC2I 2XUBA 1J09A 2BVLA 2AS5F 2QQ8A 1U6GA 4UNOA 1XMAA 5HVQC 1LDDA 4Z2YA 5KNLA 1DPRA 1P7IA 5C4XJ 2STWA 5IT9Z 5EZHA 2DFEA 4PCQA 1AA7A 2TRTA 3DLAA 3QYFA 4MO7A 2ZMEB 4LLGF 4M3BA 5E1ZB 1JKRC 1VQ5I 2VC1A 4L5JA 5DEQA 4ZDOA 4B48A 1FNNA 2ZJPF 2ESHA 3RI4A 1POGA 1ZELA 1USTA 2VB6A 4QSHA 2HQ5A 3A01B 2KIFA 2D5VA 2ZXWH 1WHUA 3GO5A 4D1QA 3G71I 1X1BA 2FUG2 2VQHA 2LDUA 4P55A 3RSNA 1UAAA 2CW0F 2LD5A 2DO7A 4FT8A 2G7HA 2TCTA 3WTUC 2JWTA 1T38A 3T5XA 2GXBA 2XDVA 5CVUA 1EH7A 4A93J 5K5RA 2DAOA 4I98B 1PUFA 4Y33A 1JTYA 2Y31A 4I76A 1LEAA 2EK5A 2A5WA 2CQKA 2MD0A 1TNSA 4HQEA 4G94A 3ZMTA 1O57A 1U8RA 5HDNA 3KP3A 5GTHC 5L3CA 2F5EA 2GZWA 3NARA 1G3YA 2W24A 2Z5UA 4IXAA 3S3MA 5HLIA 1T08B 3R6SA 1BL0A 1TW2A 1V5FA 2IS6A 5F0CA 4HDVA 2NVTJ 2OQRA 2EZKA 4HX7A 4U0VA 2VE8A 2JA7J 5FD5A 3FXMA 4C3JJ 2PMHA 3SZTA 3REOA 1WCMJ 3RPQA 2EZIA 3E5XA 3KLOA 3HTSB 2L0KA 2RDPA 1KU3A 1QVTA 5J4YA 4XLCA 2EB7A 5DCMB 4BJ6C 2ZC2A 3CC4I 2QA4I 3M1EA 2COMA 3E5QA 3OIQA 4YIRX 4J00A 2RC4A 1USSA 5D5UB 1CGPA 2EH3A 3G73A 2K9QA 2DQRA 1YS7A 2EILH 4ZYDA 2KISA 5EG0A 3I53A 1ZG3A 3QQAA 2O7OA 1TWHJ 2CQNA 2DJNA 2YS9A 3HSEA 2M0MA 3LFKA 1J5YA 1FBQA 1G3WA 2E1CA 4XL9A 3PFIA 1VTNC 4XOTA 3MKYB 3CZ6A 1U5TB 3LSTA 1H88C 1VQNI 2BY2A 1XDSA 3DKYA 2QLZA 2L7FP 3DTIA 1B72A 1XDUA 1P92A 5B5EC 3H9JA 1XS9A 3ZPLA 3L2CA 1FY7A 4GYIA 5LGTA 2QM3A 2KIQA 1XD7A 1PP8F 3RKWA 2HYGD 3OS1A 2ELKA 2M7BA 1RI7A 1A6QA 3AKZA 3G4SI 1AKHA 5LGUA 1XCBA 5CYVA 1MJAA 4PSXA 5ICEA 1IN5A 4GO1A 1LQ1A 1HXDA 2MG4A 1LE8A 2JJ7A 2VI6A 1JJ6C 3V8LA 2CGPA 1HSJA 3U21A 3A1YA 4BY7J 3I56I 1R5ID 5IPAA 4OMZA 4X0GA 4CCJA 3RJPA 1ZLJA 2AQEA 2F5CA 3BTLA 4RB2C 3D1NI 2O61A 2VPLA 3CCYA 2DN0A 2VKVA 3BP8A 3HC7A 4F91B 3HTUA 2R93J 1BJAA 1BR1A 4HW0A 1F4KA 1CQTA 4I6ZA 1U3EM 2V9PA 1W5SA 5B1BH 1KONA 4DGWB 1ETQA 1MBHA 2CQXA 5E79C 2IP2A 1NHAA 2QSGX 2XB0X 2GOMA 3V8JA 1OR7A 1KYZA 3GUDA 2VJ5A 2D45A 1C0WA 4HF2A 3K70C 1F36A 1O3QA 3ISPA 1Q1HA 4EJUA 2GLOA 1Z3XA 1MMSA 4HYEA 2R7OA 3ZOBA 1X1AA 3ESWB 3HOYJ 3LA3A 1VQ9I 2LH9A 2XGCA 4EM1A 2FE3A 3CUQA 3WTWC 3A2KA 4IHYA 1X4PA 5J3LA 5HOOA 1Z6RA 4LK0F 5FKLA 2QBYA 3BJOA 3GEZA 1CF7A 1YX5A 2XGEA 3LMMA 2BEOA 3HBLA 2QQBA 4BBRJ 1RKTA 2VBYA 3HRUA 1ZYRF 2JRTA 3C7JA 1J75A 2IAIA 3B6CA 5LD2C 2IS2A 2Y9YA 2KDZA 5J4VA 3RPUA 2DODA 2GXAA 5HDKA 3S3OA 5BPDA 1W7PA 4HG2A 1B8IB 3GTOJ 4MQVA 1KU2A 1PJRA 3CMEI 3IV5A 2KJBA 2OZUA 2Z33A 2MYSA 2DCEA 1ETOA 4MGRA 1Y1WJ 1IG7A 4N9HA 1FP2A 3MD2A 4A12A 2F4IA 2RQQA 2OV7A 2FD5A 3K9TA 3J81Z 3V7CA 4AUXA 2ZXIA 4XLFA 1W5TA 3KYCB 1MMNA 2L9RA 2ICWG 3BZKA 3JW4A 3PFYA 2DA6A 3ERMA 2WB1N 3VPRA 2R7RA 1SEUA 2DMQA 1VI0A 2KPMA 3FKJA 3F72A 3ECOA 3E7LA 3WGGA 1IDYA 3Q0WA 4B44A 1HKSA 2L7MP 5LLQA 3FIWA 4FX4A 3Q5FA 1P4AA 2MD5A 6PAXA 4XSZF 1NK2P 4C30A 2HVQA 3WE3A 1VQMI 4B4CA 5GAGJ 1V3FA 2IA0A 4BXFA 1Y8RB 3TO6A 1BI2A 3FXLA 3JRHA 4HNTA 2V1DA 3EETA 4ITVA 1W0TA 4AIHA 4M3GA 3WODF 4E4HA 2HZDA 1YLFA 1D8KA 2M87A 2Z1DA 5JFRA 2MC3A 3LSMA 5E1XA 4LIVA 1YQAA 2XPVA 2M9HA 4ZYEA 2LMDA 2GIVA 4D0PA 2VE9A 5M5WJ 1LFUP 2A5YB 3TKYA 2FEZA 4KYWA 3DPLC 1EF4A 1VQPI 4MEXF 4PGGA 4ZDPA 1N25A 4A3MJ 4BJTA 1IRFA 3BR1A 3GTKJ 3MQ0A 3NAUA 1BC8C 1MH3A 5K7HA 1Y0NA 3F8FA 2CG4A 3OYDA 4A3DJ 4JQFA 3HYIA 2CH0A 2ADUA 3HIFA 4FE7A 2ZNZA 4ABZA 4E7ZA 4Y3OA 2ZXJA 3LA7A
chains in the Genus database with same CATH topology
1RETA 5IYCJ 4XRSA 3BR2A 4S0HB 2HDDA 4DW6A 4HNVA 3BR5A 1A5JA 1X2MA 1GDTA 4FTHA 2VPRA 5E3MA 1FIPA 1A6IA 2DA5A 4UUSA 3HOUJ 2NVXJ 1ETVA 2NS7A 2LLKA 2R92J 2GBYA 3F0CA 1JT6A 1HF0A 2LVSA 4XIDA 1XG1A 3FKIJ 5FKKA 2P81A 4DYCA 3B6AA 4JX6A 3L1PA 3LSGA 3GTMJ 5C4JJ 3SJMA 1UMQA 1IJWC 1BA5A 4DZPA 5IP6A 3ZQLA 5JLWA 2ID6A 5M3FJ 3HOWJ 2R0QC 3BG3A 5FKOA 3OSFA 4IEJA 1ZR2A 1JTXA 4XRSG 2MSYA 4A3BJ 2X9DA 4AC0A 5IYBJ 1LFBA 1QVUA 3Q0VA 4DYRA 5E3OA 2E1OA 3GTLJ 5F08A 2G0EA 3TP3A 2HOAA 5K7FA 5C44J 4A3EJ 2GM4A 1I50J 4CYCA 1JUMA 1NK3P 4UUSB 3CQZJ 1XC5A 1I3QJ 5K7ZA 4B3AA 2NOGA 2HOTA 1IV6A 2HI3A 1BW6A 1ENHA 4FISA 2B63J 3HOXJ 3C2BA 1WH5A 4JX5A 1G2HA 4A3FJ 3BR0A 1UHSA 5DS9A 2VUMJ 5BNGA 2R5ZA 2LY9A 2L7ZA 1ZK8A 4GFBA 3PM1A 4D7MA 3SDGA 3S1RJ 2K9NA 5FLMJ 3Q0UA 1P7JA 2Y0SN 3QPSA 5FJ8J 2AO9A 2LFBA 4A69C 2MW8A 5FLVA 1ZKGA 3CMYA 1QRYA 5C3EJ 2VKEA 1AU7A 3I4MJ 2LKXA 1HOMA 1S7EA 3BG5A 4V2FA 3FK7A 1VFCA 2EBIA 1PUFB 2M34A 2CQQA 4BY1J 3SFIA 9ANTA 4W97A 2WAQN 2I10A 2Y2ZA 4QTRA 5E3LA 1ORKA 5GPCA 1H8AC 3BG9A 2Y9ZA 4D7NA 1K61A 4EEFG 1FTZA 3A01A 2DA2A 3BR3A 1ITYA 3S1MJ 3S2HJ 5EDNA 1IGNA 2K40A 1O4XA 5M5YJ 3MVPA 2NS8A 4FE4A 2ZB9A 3BTIA 4MFDA 1NTCA 4G12A 4XK4A 4D5CA 4V2GA 1W0UA 3HOZJ 1WH7A 2NVQJ 2CUEA 2AHQA 5EZGA 1U9NA 4M6VA 2R5ZB 4XICA 2X6OA 3H0GJ 4MIMA 4C3IJ 3GTQJ 4UUTA 3S1QJ 3M4OJ 2DTZA 2MGQA 3QPLA 2DMTA 1JKQC 1VF9A 5GPAA 4A3KJ 2O9LA 4JP0A 2XGDA 3OIOA 4RBOA 3TEDA 1BJZA 2DA3A 3RZDJ 4B1RA 3JRCA 3LSPA 2QCOA 2XPWA 3HM5A 5C4XJ 1P7IA 5EZHA 1ZQ3P 2TRTA 4MO7A 3LOCA 4W1UA 3ZQHA 1MNMC 2E2IJ 3S17J 4M3BA 1JKRC 1TWGJ 1TWAJ 2NVYJ 3G1OA 1POGA 1OFCX 2N8GA 3WHCA 2KT0A 4A3JJ 2RAEA 3HKZN 4QSHA 1TC3C 2D5VA 2HQ5A 3A01B 1BW5A 1JUPA 3DCFA 3LSRA 1ETKA 4RDUA 3S1NJ 2LD5A 3ZQFA 1Z77A 2TCTA 5IYDJ 2FQ4A 2JWTA 1UG2A 5F04A 1APLC 5EGOA 1ETXA 4J19A 3JRAA 4MLOA 4QIWN 3JREA 2JA6J 4A93J 5F27A 2R5YA 1PUFA 1OJLA 1JTYA 2Y31A 4I76A 3CDLA 3HGGA 2DA7A 4Y52J 3S16J 3BTJA 1D5YA 4NDLA 1GT0C 2XSDC 2E2JJ 3NARA 4L5EA 3Q3SA 5IOZA 2E2HJ 1BL0A 2PMZN 5IOYA 3PO2J 5F0CA 3LNQA 2NVTJ 3K7AJ 2EZKA 1F43A 2JA7J 2IBDA 3TW7A 4C3JJ 2EZHA 1MBEA 2ECCA 4XRMA 5J1YA 4M3FA 3PO3J 3JR9A 1WCMJ 3A03A 4X6AJ 2EZIA 1HDDC 3S15J 2L0KA 1QVTA 5F0HA 1I6HJ 2EH3A 1HLVA 3IH4A 4Y7NJ 2K9QA 5EGOB 3JRGA 1AHDP 5EG0A 2LP0A 2EZLA 1FTTA 1R9TJ 3QQAA 4MFEA 3BTCA 2R5YB 1WGXA 2ID3A 1ETYA 2O7OA 1TWHJ 3JRIA 2DJNA 2YS9A 1DU0A 1DU6A 5M3MJ 4LOCA 1H88C 1TWCJ 2M8GX 1X2NA 5M5XJ 2L7FP 1B72A 3K2AA 1XS9A 1GV5A 2CU7A 1OCPA 2H1KA 1FIAA 2M0CA 2X48A 1FEXA 4X1EA 4D5FA 3GTPJ 2ELKA 1OCTC 4BBSJ 1AKHA 2H8RA 3JRDA 1WPKA 2E19A 3A02A 2IEKA 3BQZA 3IH3A 5GP9A 5DTDA 2MG4A 1LE8A 2JJ7A 2VI6A 2COBA 1JJ6C 1K83J 1JJ8C 1FJLA 3GTGJ 5IP7J 4BY7J 1TWFJ 5IPAA 4AYBN 4BXXJ 2OPTA 2R7ZJ 4C2MJ 2XB5A 2HXOA 3BTLA 1SFOJ 5F1JA 3TP0A 3RQIA 3D1NI 1ETWA 3M3YJ 3CCYA 2DN0A 2VKVA 3GBGA 2R93J 1ZGWA 1MSFC 5EG0B 3G1MA 1QPIA 1VNDA 1CQTA 4I6ZA 3G1LA 3ZQCA 5J1RA 1RPWA 2JN6A 1ETQA 1MBHA 2ECBA 1U8BA 2CQXA 1B8IA 4IHVA 1JKOC 2XB0X 3HB9A 1MBKA 1RESA 1WI3A 1B72B 2K9SA 1F36A 3O8HA 2DMUA 2GLOA 4M3DA 3BT9A 3FK6A 2YUSA 3ZOBA 2ME6A 3HOYJ 4A3IJ 3O8GA 1AKHB 2JMWA 2DMNA 4IHXA 5FKNA 2XGCA 4IHYA 3TW6A 5J3LA 1Q1VA 3JRFA 3DEWA 3OSGA 2Y30A 1LE8B 3HDDA 4IHWA 5FKLA 1IC8A 5J1UA 3S2DJ 2XGEA 2OF7A 3IH2A 3HBLA 4BBRJ 3ZQIA 3UKGA 1JGGA 2DA1A 1RKTA 2JK3A 3WHBA 2HYJA 2HOSA 2HXIA 5EF6A 2JA5J 2IAIA 4JX4A 3B6CA 5IP9J 1E3OC 1IDZA 3LSJA 2Y9YA 4DZJA 2KDZA 1U78A 2EQRA 1RKWA 2DMPA 1HCRA 1YRNA 3H3VK 1HDPA 1IUFA 3BR6A 1JKPC 1GUUA 1MH4A 1B8IB 1ZR4A 3GTOJ 3IV5A 1ETOA 1Y1WJ 2QF7A 2CRGA 1IG7A 3FISA 4FCYA 5EEAA 3JRBA 2FD5A 5EYRA 4AUXA 2L9RA 1MSEC 3VPRA 2DA6A 2WB1N 2DMQA 1VI0A 1JT0A 3BQYA 3E7LA 5E3NA 1IDYA 1U9OA 2XPUA 3Q0WA 2M2EA 2ME0A 2L7MP 2FX0A 2XRLA 3FIWA 3RKQA 1NK2P 4B4CA 4DYQA 3HGYA 5F0FA 2W48A 4M3EA 4A3CJ 3JRHA 1W0TA 4JYKA 1T56A 4M3GA 3I4NJ 3HEFA 2LR8A 3OOUA 1YRNB 1SANA 2LTPA 2M9HA 2XPVA 1RR7A 2WV1A 3S14J 5M5WJ 1LFUP 3W6VA 1GV2A 1X58A 3ZQGA 2JA8J 1EF4A 2YU9J 2LK2A 4CYCB 1MBGA 2CUFA 4A3MJ 1IRZA 2FJ1A 4A3GJ 3BR1A 3MKLA 3NAUA 4C3HJ 3GTKJ 3HOVJ 1MH3A 4BKXA 5K7HA 3MN2A 1JUSA 2CJJA 1H89C 4A3DJ 4A3LJ 1Z0XA 2DA4A 5HODA 1T33A 1ZTRA 1Y1VJ 4FE7A 1GVDA 1MBFA 4ABZA 2O8KA 5FKMA 3RZOJ 1MBJA 3GTJJ 5JLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RET A;  5IYC J;  4XRS A;  3BR2 A;  4S0H B;  2HDD A;  4DW6 A;  4HNV A;  3BR5 A;  1A5J A;  1X2M A;  1GDT A;  4FTH A;  2VPR A;  5E3M A;  1FIP A;  1A6I A;  2DA5 A;  4UUS A;  3HOU J;  2NVX J;  1ETV A;  2NS7 A;  2LLK A;  2R92 J;  2GBY A;  3F0C A;  1JT6 A;  1HF0 A;  2LVS A;  4XID A;  1XG1 A;  3FKI J;  5FKK A;  2P81 A;  4DYC A;  3B6A A;  4JX6 A;  3L1P A;  3LSG A;  3GTM J;  5C4J J;  3SJM A;  1UMQ A;  1IJW C;  1BA5 A;  4DZP A;  5IP6 A;  3ZQL A;  5JLW A;  2ID6 A;  5M3F J;  3HOW J;  2R0Q C;  3BG3 A;  5FKO A;  3OSF A;  4IEJ A;  1ZR2 A;  1JTX A;  4XRS G;  2MSY A;  4A3B J;  2X9D A;  4AC0 A;  5IYB J;  1LFB A;  1QVU A;  3Q0V A;  4DYR A;  5E3O A;  2E1O A;  3GTL J;  5F08 A;  2G0E A;  3TP3 A;  2HOA A;  5K7F A;  5C44 J;  4A3E J;  2GM4 A;  1I50 J;  4CYC A;  1JUM A;  1NK3 P;  4UUS B;  3CQZ J;  1XC5 A;  1I3Q J;  5K7Z A;  4B3A A;  2NOG A;  2HOT A;  1IV6 A;  2HI3 A;  1BW6 A;  1ENH A;  4FIS A;  2B63 J;  3HOX J;  3C2B A;  1WH5 A;  4JX5 A;  1G2H A;  4A3F J;  3BR0 A;  1UHS A;  5DS9 A;  2VUM J;  5BNG A;  2R5Z A;  2LY9 A;  2L7Z A;  1ZK8 A;  4GFB A;  3PM1 A;  4D7M A;  3SDG A;  3S1R J;  2K9N A;  5FLM J;  3Q0U A;  1P7J A;  2Y0S N;  3QPS A;  5FJ8 J;  2AO9 A;  2LFB A;  4A69 C;  2MW8 A;  5FLV A;  1ZKG A;  3CMY A;  1QRY A;  5C3E J;  2VKE A;  1AU7 A;  3I4M J;  2LKX A;  1HOM A;  1S7E A;  3BG5 A;  4V2F A;  3FK7 A;  1VFC A;  2EBI A;  1PUF B;  2M34 A;  2CQQ A;  4BY1 J;  3SFI A;  9ANT A;  4W97 A;  2WAQ N;  2I10 A;  2Y2Z A;  4QTR A;  5E3L A;  1ORK A;  5GPC A;  1H8A C;  3BG9 A;  2Y9Z A;  4D7N A;  1K61 A;  4EEF G;  1FTZ A;  3A01 A;  2DA2 A;  3BR3 A;  1ITY A;  3S1M J;  3S2H J;  5EDN A;  1IGN A;  2K40 A;  1O4X A;  5M5Y J;  3MVP A;  2NS8 A;  4FE4 A;  2ZB9 A;  3BTI A;  4MFD A;  1NTC A;  4G12 A;  4XK4 A;  4D5C A;  4V2G A;  1W0U A;  3HOZ J;  1WH7 A;  2NVQ J;  2CUE A;  2AHQ A;  5EZG A;  1U9N A;  4M6V A;  2R5Z B;  4XIC A;  2X6O A;  3H0G J;  4MIM A;  4C3I J;  3GTQ J;  4UUT A;  3S1Q J;  3M4O J;  2DTZ A;  2MGQ A;  3QPL A;  2DMT A;  1JKQ C;  1VF9 A;  5GPA A;  4A3K J;  2O9L A;  4JP0 A;  2XGD A;  3OIO A;  4RBO A;  3TED A;  1BJZ A;  2DA3 A;  3RZD J;  4B1R A;  3JRC A;  3LSP A;  2QCO A;  2XPW A;  3HM5 A;  5C4X J;  1P7I A;  5EZH A;  1ZQ3 P;  2TRT A;  4MO7 A;  3LOC A;  4W1U A;  3ZQH A;  1MNM C;  2E2I J;  3S17 J;  4M3B A;  1JKR C;  1TWG J;  1TWA J;  2NVY J;  3G1O A;  1POG A;  1OFC X;  2N8G A;  3WHC A;  2KT0 A;  4A3J J;  2RAE A;  3HKZ N;  4QSH A;  1TC3 C;  2D5V A;  2HQ5 A;  3A01 B;  1BW5 A;  1JUP A;  3DCF A;  3LSR A;  1ETK A;  4RDU A;  3S1N J;  2LD5 A;  3ZQF A;  1Z77 A;  2TCT A;  5IYD J;  2FQ4 A;  2JWT A;  1UG2 A;  5F04 A;  1APL C;  5EGO A;  1ETX A;  4J19 A;  3JRA A;  4MLO A;  4QIW N;  3JRE A;  2JA6 J;  4A93 J;  5F27 A;  2R5Y A;  1PUF A;  1OJL A;  1JTY A;  2Y31 A;  4I76 A;  3CDL A;  3HGG A;  2DA7 A;  4Y52 J;  3S16 J;  3BTJ A;  1D5Y A;  4NDL A;  1GT0 C;  2XSD C;  2E2J J;  3NAR A;  4L5E A;  3Q3S A;  5IOZ A;  2E2H J;  1BL0 A;  2PMZ N;  5IOY A;  3PO2 J;  5F0C A;  3LNQ A;  2NVT J;  3K7A J;  2EZK A;  1F43 A;  2JA7 J;  2IBD A;  3TW7 A;  4C3J J;  2EZH A;  1MBE A;  2ECC A;  4XRM A;  5J1Y A;  4M3F A;  3PO3 J;  3JR9 A;  1WCM J;  3A03 A;  4X6A J;  2EZI A;  1HDD C;  3S15 J;  2L0K A;  1QVT A;  5F0H A;  1I6H J;  2EH3 A;  1HLV A;  3IH4 A;  4Y7N J;  2K9Q A;  5EGO B;  3JRG A;  1AHD P;  5EG0 A;  2LP0 A;  2EZL A;  1FTT A;  1R9T J;  3QQA A;  4MFE A;  3BTC A;  2R5Y B;  1WGX A;  2ID3 A;  1ETY A;  2O7O A;  1TWH J;  3JRI A;  2DJN A;  2YS9 A;  1DU0 A;  1DU6 A;  5M3M J;  4LOC A;  1H88 C;  1TWC J;  2M8G X;  1X2N A;  5M5X J;  2L7F P;  1B72 A;  3K2A A;  1XS9 A;  1GV5 A;  2CU7 A;  1OCP A;  2H1K A;  1FIA A;  2M0C A;  2X48 A;  1FEX A;  4X1E A;  4D5F A;  3GTP J;  2ELK A;  1OCT C;  4BBS J;  1AKH A;  2H8R A;  3JRD A;  1WPK A;  2E19 A;  3A02 A;  2IEK A;  3BQZ A;  3IH3 A;  5GP9 A;  5DTD A;  2MG4 A;  1LE8 A;  2JJ7 A;  2VI6 A;  2COB A;  1JJ6 C;  1K83 J;  1JJ8 C;  1FJL A;  3GTG J;  5IP7 J;  4BY7 J;  1TWF J;  5IPA A;  4AYB N;  4BXX J;  2OPT A;  2R7Z J;  4C2M J;  2XB5 A;  2HXO A;  3BTL A;  1SFO J;  5F1J A;  3TP0 A;  3RQI A;  3D1N I;  1ETW A;  3M3Y J;  3CCY A;  2DN0 A;  2VKV A;  3GBG A;  2R93 J;  1ZGW A;  1MSF C;  5EG0 B;  3G1M A;  1QPI A;  1VND A;  1CQT A;  4I6Z A;  3G1L A;  3ZQC A;  5J1R A;  1RPW A;  2JN6 A;  1ETQ A;  1MBH A;  2ECB A;  1U8B A;  2CQX A;  1B8I A;  4IHV A;  1JKO C;  2XB0 X;  3HB9 A;  1MBK A;  1RES A;  1WI3 A;  1B72 B;  2K9S A;  1F36 A;  3O8H A;  2DMU A;  2GLO A;  4M3D A;  3BT9 A;  3FK6 A;  2YUS A;  3ZOB A;  2ME6 A;  3HOY J;  4A3I J;  3O8G A;  1AKH B;  2JMW A;  2DMN A;  4IHX A;  5FKN A;  2XGC A;  4IHY A;  3TW6 A;  5J3L A;  1Q1V A;  3JRF A;  3DEW A;  3OSG A;  2Y30 A;  1LE8 B;  3HDD A;  4IHW A;  5FKL A;  1IC8 A;  5J1U A;  3S2D J;  2XGE A;  2OF7 A;  3IH2 A;  3HBL A;  4BBR J;  3ZQI A;  3UKG A;  1JGG A;  2DA1 A;  1RKT A;  2JK3 A;  3WHB A;  2HYJ A;  2HOS A;  2HXI A;  5EF6 A;  2JA5 J;  2IAI A;  4JX4 A;  3B6C A;  5IP9 J;  1E3O C;  1IDZ A;  3LSJ A;  2Y9Y A;  4DZJ A;  2KDZ A;  1U78 A;  2EQR A;  1RKW A;  2DMP A;  1HCR A;  1YRN A;  3H3V K;  1HDP A;  1IUF A;  3BR6 A;  1JKP C;  1GUU A;  1MH4 A;  1B8I B;  1ZR4 A;  3GTO J;  3IV5 A;  1ETO A;  1Y1W J;  2QF7 A;  2CRG A;  1IG7 A;  3FIS A;  4FCY A;  5EEA A;  3JRB A;  2FD5 A;  5EYR A;  4AUX A;  2L9R A;  1MSE C;  3VPR A;  2DA6 A;  2WB1 N;  2DMQ A;  1VI0 A;  1JT0 A;  3BQY A;  3E7L A;  5E3N A;  1IDY A;  1U9O A;  2XPU A;  3Q0W A;  2M2E A;  2ME0 A;  2L7M P;  2FX0 A;  2XRL A;  3FIW A;  3RKQ A;  1NK2 P;  4B4C A;  4DYQ A;  3HGY A;  5F0F A;  2W48 A;  4M3E A;  4A3C J;  3JRH A;  1W0T A;  4JYK A;  1T56 A;  4M3G A;  3I4N J;  3HEF A;  2LR8 A;  3OOU A;  1YRN B;  1SAN A;  2LTP A;  2M9H A;  2XPV A;  1RR7 A;  2WV1 A;  3S14 J;  5M5W J;  1LFU P;  3W6V A;  1GV2 A;  1X58 A;  3ZQG A;  2JA8 J;  1EF4 A;  2YU9 J;  2LK2 A;  4CYC B;  1MBG A;  2CUF A;  4A3M J;  1IRZ A;  2FJ1 A;  4A3G J;  3BR1 A;  3MKL A;  3NAU A;  4C3H J;  3GTK J;  3HOV J;  1MH3 A;  4BKX A;  5K7H A;  3MN2 A;  1JUS A;  2CJJ A;  1H89 C;  4A3D J;  4A3L J;  1Z0X A;  2DA4 A;  5HOD A;  1T33 A;  1ZTR A;  1Y1V J;  4FE7 A;  1GVD A;  1MBF A;  4ABZ A;  2O8K A;  5FKM A;  3RZO J;  1MBJ A;  3GTJ J;  5JLX A; 
#chains in the Genus database with same CATH topology
 1RET A;  4A5M A;  4HA8 A;  3C2H A;  2M4K A;  3JTG A;  3ELK A;  4KIT B;  1GDT A;  2ZJR F;  3OYL A;  1XB4 A;  3K0L A;  3CLQ A;  2WB1 A;  5E3M A;  1A6I A;  1R36 A;  3SZP A;  1YE9 A;  1P4X A;  4UHT A;  4V19 K;  2GBY A;  1Z05 A;  1HF0 A;  4WK8 F;  1OCC H;  4XID A;  3J80 Z;  1K7A A;  3D0S A;  2R7V A;  5FKK A;  4HLY A;  4L9T A;  3AFH A;  3BC8 A;  4JX6 A;  2V4J C;  2XAQ A;  3BRO A;  4M6Y A;  2VBX A;  3FF5 A;  2EFN A;  2WA0 A;  2DJI A;  4N9I A;  2KJC A;  3JTH A;  4DZP A;  3I59 A;  1R6R A;  3MZ8 A;  2HDC A;  4NC7 A;  1OQY A;  2JUG A;  3EQL F;  1W36 C;  1P4W A;  4IQJ A;  2PX9 A;  2OZ6 A;  3QYE A;  3BG3 A;  4KT5 C;  2HPM A;  4XRS G;  4ESF A;  1FT9 A;  1Z7U A;  5EEG A;  2K86 A;  4ZDL A;  5ICF A;  4ESB A;  3CUQ C;  1YTY A;  2EFW A;  4EM0 B;  1YIO A;  3Q0V A;  4DYR A;  3FMS A;  5E3O A;  1FSE A;  3B02 A;  3GTL J;  4RLF A;  3K4N A;  1BI1 A;  1WQ2 A;  5F08 A;  4AYB A;  3KYL A;  2FBK A;  2GM4 A;  2E5N A;  2HKX A;  5C44 J;  4A3E J;  1WI9 A;  3K2Z A;  1Z6T A;  2E7W A;  3IWZ A;  4AVP A;  5JI6 A;  4CYC A;  2X1E A;  3CQZ J;  3WE2 A;  1IAW A;  1SMT A;  2LOO A;  5K7Z A;  2O3F A;  4XLN F;  5J8C A;  2CS3 A;  4HF1 A;  1KQ8 A;  4FIS A;  3HOX J;  2H09 A;  4A3F J;  1QU3 A;  5DS9 A;  5E17 F;  4M71 A;  4NHJ A;  3EPZ A;  2R5Z A;  2LY9 A;  1T2K A;  1ZK8 A;  3WTT C;  2EFQ A;  1D1C A;  1YW8 A;  3RDI A;  4JOM A;  1QZY A;  3CJR B;  2K3F A;  2QSF X;  5FLM J;  3Q0U A;  3AG2 H;  2CMP A;  2PI0 A;  3GYH X;  2Y0S N;  1R23 A;  1OYI A;  4ENM A;  2LFB A;  4ZYA A;  2MW8 A;  3HZJ A;  1X3W B;  1QRY A;  2V1N A;  3I4M J;  4XLH A;  1HOM A;  4A5N A;  4ZTJ A;  1S7E A;  3MMY B;  2Y48 A;  3BG5 A;  5L3E A;  2PJR A;  2ZO4 A;  3MZH A;  1VFC A;  3R60 A;  2FOW A;  5HS7 A;  3O6B B;  2M34 A;  3AG3 H;  4F92 B;  1A04 A;  2CQQ A;  2ZME A;  1T8I A;  1MD0 A;  2FMY A;  1ORK A;  4ENJ A;  3FMQ A;  2Y9Z A;  4D7N A;  2AQF A;  4UY8 I;  5FGM A;  2NVU B;  3A01 A;  4G6D A;  1OLT A;  2M7A A;  1ITY A;  1TTY A;  2E5Z A;  3K4K A;  5M5Y J;  2EA2 A;  4RGX A;  4AWX B;  1WWX A;  2NS8 A;  4FE4 A;  4MFD A;  4U87 A;  2UUZ A;  3EUH C;  4G12 A;  2RN7 A;  3BZC A;  5EZG A;  1J59 A;  2CSO A;  4MIM A;  2C6Y A;  2K5C A;  2DMT A;  3DU6 A;  3FXQ A;  4HLX A;  3ASN H;  1EA3 A;  4RAF A;  4YEJ A;  5GPA A;  5TGT A;  1ZG5 A;  2O9L A;  3OIO A;  4LB6 B;  3WG7 H;  4RBO A;  5JR3 A;  1BJZ A;  2DA3 A;  2K9M A;  2ZSI B;  2XAJ A;  4TV7 A;  2LRD A;  4B1R A;  1XGN A;  1B9N A;  1OYY A;  4HAM A;  2ZKZ A;  4KIF A;  3K4J A;  2K3P A;  4RAG A;  1P6R A;  4XMY A;  2IS1 A;  1MDM B;  3QOE A;  3ZQH A;  3UNG C;  1JGS A;  2A69 F;  3S17 J;  2UZK A;  1TWG J;  1OCR H;  1BIA A;  2XF7 A;  3R0J A;  1OFC X;  2FSW A;  1JHH A;  2X1D A;  2Y0S A;  4UV8 A;  3JAM Z;  4IQ4 A;  2BW3 B;  5DCM A;  3DCF A;  1QZE A;  4A0Y A;  1FC3 A;  4RGR A;  5L3F A;  4BDZ A;  3D5S C;  1ETK A;  3QYB A;  4XKV A;  3OL4 A;  3X2Q H;  2GQQ A;  1FYM A;  2DT7 B;  1TNT A;  2L9S A;  1Z77 A;  4CCL A;  2FQ4 A;  1APL C;  1UG2 A;  5F04 A;  3I55 I;  3ABM H;  1ETX A;  1HW1 A;  2O03 A;  2NRA C;  4B43 A;  3E6D A;  4UB8 C;  3GF2 A;  4P1W A;  1YG2 A;  5F27 A;  1OJL A;  4BDY A;  3CDL A;  1NH3 A;  2DA7 A;  4Y52 J;  3CLO A;  4UV9 A;  5L3B A;  1G8X A;  3GW2 A;  5LFA A;  1D5Y A;  3U1D A;  4NDL A;  2M5W A;  3CC7 I;  4KNY A;  1U5T A;  2RKH A;  1A35 A;  1TQM A;  1K78 B;  1OYW A;  2KLO A;  4DJA A;  4EQQ A;  3JAM K;  4L5E A;  1Z91 A;  4UB6 C;  5E8G A;  3BG7 A;  1UB9 A;  3VFZ A;  1VQ7 I;  1FBU A;  2UV1 A;  5IOY A;  3PO2 J;  2R7F A;  2XGX A;  3L7W A;  3LNQ A;  2VXZ A;  2XSJ C;  2IGK A;  3TW7 A;  1X3U A;  4CSW A;  2ELH A;  2GWR A;  4P96 A;  4XRM A;  4M3F A;  2X6X A;  4HNU A;  3F8C A;  3SYT A;  3S15 J;  2HQA A;  2CV2 A;  4RS8 A;  3BJA A;  2Z9O A;  2VKD A;  2ELJ A;  3ZCO A;  2EV5 A;  5FB2 A;  1KYW A;  3M9A A;  3N05 A;  1I6H J;  2ZCW A;  1HLV A;  3IH4 A;  4Y7N J;  2ZSH B;  5EGO B;  1TW3 A;  4RA2 A;  3JRG A;  2QSH X;  3DXJ F;  3PQK A;  1FTT A;  1SFU A;  1R9T J;  4E7J A;  2R5Y B;  1ETY A;  1QHG A;  3A0H C;  5LGN A;  1DU6 A;  2DLL A;  1L0O C;  2DK5 A;  1YJ9 I;  1FOX A;  2M3A A;  4MNU A;  3RKX A;  1UEL B;  2W1O A;  2VIX A;  1TWC J;  3OY9 A;  2HVS A;  3LL7 A;  4GXO A;  3UR3 C;  2UXN A;  3KEQ A;  4XSX F;  3DQV C;  3OYH A;  1OCP A;  1SAX A;  4X1E A;  4D5F A;  2M30 A;  3F8M A;  2F5D A;  2JPB A;  1WPK A;  2L9V A;  2E19 A;  3DFG A;  4KIG A;  3CCQ I;  3BQZ A;  1BI0 A;  3IH3 A;  3ZMV A;  5GP9 A;  1SC7 A;  3HUG B;  1QGP A;  3DBH B;  2KIU A;  3H9G A;  1RZ4 A;  1O7L A;  4NUB A;  3DKW A;  4LLL A;  4BXX J;  3NEU A;  1RIO H;  2L9N A;  4IJA A;  2HXO A;  2L2O A;  3RQI A;  3TP0 A;  4HQM A;  3M3Y J;  2CWE A;  3VYT B;  4R8H A;  3L9F A;  4FAS D;  2DK8 A;  3DF8 A;  2W84 A;  3G1M A;  1QPI A;  1VND A;  2BY0 A;  1RPW A;  1B8I A;  2EPF A;  1Z67 A;  3BCB A;  4LIT A;  1YYV A;  4EVI A;  2LKS A;  5D5W B;  1Y0U A;  2DU9 A;  2DFH A;  3E6C C;  4K2E A;  1Y6I A;  3L2R A;  1S72 I;  4PZJ A;  4RAY A;  2K9S A;  2WBM A;  4EMS A;  3O8H A;  4I0B A;  3LSH A;  1FYK A;  1I27 A;  3CP2 A;  3H5A A;  4M3D A;  3W2W A;  4KA4 A;  4KN4 X;  2DDB A;  2FU4 A;  3FK6 A;  3MAJ A;  3BZ6 A;  2ME6 A;  1LVK A;  4A3I J;  2A07 F;  4LG0 A;  4A0X A;  1ZH5 A;  4II3 A;  2BHZ A;  3RQ4 A;  1XCV A;  4BAC A;  5JVT A;  3DEW A;  1WZ2 A;  4L5I A;  4H0E A;  4U7D A;  5IT9 K;  4IHW A;  1SFK A;  2B9S A;  4CCO A;  1IC8 A;  3FWE A;  3TOB A;  4PUS A;  2OF7 A;  3UKG A;  2Z3Y A;  1FPQ A;  1UZC A;  2HYJ A;  4DBR A;  5EF6 A;  4RGU A;  4C2T A;  2JA5 J;  4JX4 A;  3QP5 A;  1E3O C;  2DOF A;  3QU6 A;  2LG4 A;  4RB3 C;  3FM5 A;  4R79 A;  2XAH A;  3QOD A;  1HCR A;  3H3V K;  1JKP C;  5DUI A;  2KFD A;  2XIG A;  1MH4 A;  2XKP A;  2P6T A;  3CES A;  2X6W A;  5TIS C;  5GTI C;  2OU2 A;  2RQP A;  3C3W A;  1D3Y A;  1MSE C;  2XRO A;  3ZN1 A;  3K69 A;  2QF7 A;  4U0W A;  2CRG A;  3WGI A;  3FIS A;  4FCY A;  3GFL A;  2FA5 A;  4UVA A;  3B73 A;  2IA2 A;  3MEX A;  2W82 A;  5EYR A;  2L01 A;  1U5T C;  4FET A;  2Y75 A;  2HTJ A;  2KZV A;  1JT0 A;  1IV8 A;  1AWC A;  5BPI A;  3OOP A;  1U9O A;  2QVO A;  2M2E A;  2FX0 A;  2XRL A;  1O3S A;  3S8P A;  2F4M B;  3RKQ A;  1L3L A;  4JBA A;  5F64 A;  1K4T A;  2FNP A;  4ZYG A;  2H8W A;  3CCV I;  1TLH B;  1GVJ A;  3TMO A;  3HGY A;  3M7G A;  1MND A;  2ISY A;  4A3C J;  2GIZ A;  2KL4 A;  4IX7 A;  5FD6 A;  1KZH A;  1H9G A;  2Z2S B;  5L3G A;  2M8E A;  3E1S A;  2ZFU A;  2V6C A;  4JYK A;  1FOY A;  2O6G E;  2VT3 A;  2EFP A;  4XQF A;  4ZH4 F;  2E71 A;  5ICC A;  5A2Q Z;  5BMZ A;  3K1P A;  3HEF A;  4M74 A;  2R7Q A;  1YRN B;  4E7I A;  2LTP A;  3MKW B;  1T95 A;  2KRF A;  3HOS A;  1KGS A;  3W6V A;  2JA8 J;  4F93 B;  1REP C;  4IPA A;  1ZN2 A;  3VB2 A;  3S32 A;  2PBI A;  3L2U A;  1ZRE A;  2B0L A;  1RUO A;  2FJ1 A;  4HX8 A;  1MZB A;  3MKL A;  4KT6 A;  1YO5 C;  2LBF B;  3MN2 A;  1JUS A;  3TDZ C;  1QQI A;  1P9Q C;  4N0B A;  4ASN A;  1UJ8 A;  2JRM A;  1DGR M;  4A3L J;  5A2Q K;  2DA4 A;  2IA1 A;  2GXG A;  4E7S A;  4EM2 A;  1ZTR A;  1Y1V J;  1Z21 A;  1MBF A;  3PIO F;  3H1C A;  1ZGA A;  1MBJ A;  3GTJ J;  2HFH A;  3WTV C;  4NC8 A;  4XRS A;  3BR2 A;  4G7O F;  4BHC A;  3K6G A;  3KCC A;  3K4L A;  4DW6 A;  4HNV A;  2HVR A;  2EV6 A;  1X2M A;  2GA1 A;  3CDI A;  4FTH A;  1LDJ A;  1LB2 A;  1FIP A;  5B66 C;  5HLT A;  3KET A;  3HOU J;  2NVX J;  1ETV A;  3BG6 A;  1D0Z A;  3IAS 2;  2DI3 A;  2P8T A;  1G4D A;  2LVS A;  1DGW Y;  4CZC A;  3OR2 C;  1XG1 A;  3FKI J;  4OWR B;  4CHU A;  2P81 A;  4DYC A;  1OIS A;  3LQR A;  5KVR A;  4ZZD A;  3KZY A;  2XKO A;  5LHI A;  3L1P A;  3F21 A;  3LSG A;  2K7L A;  3GTM J;  4WX9 A;  1PVE A;  1FLI A;  2O0Y A;  2VJ4 A;  4ENK A;  3HSF A;  4IHT A;  3E6B A;  3H92 A;  1EJ9 A;  4I02 A;  3TL4 X;  1PUE E;  2A6H F;  3HOW J;  5FKO A;  1YX3 A;  2A6T A;  2ESN A;  2LY1 A;  3GFI A;  3TBI A;  1O3R A;  3V7S A;  3I9V 2;  4HV5 A;  4GDF A;  2X9D A;  4XRF A;  3EUK L;  3CD6 I;  3ABL H;  1LFP A;  2Q0O A;  2DOE A;  2QKL B;  3DV8 A;  2MH2 A;  2ZFW A;  4DNC A;  1X3Z B;  5IYB J;  1LFB A;  2EV0 A;  2EIJ H;  2F5F A;  4BNC A;  3H5N A;  4CIC A;  2XV4 S;  4QWQ A;  4IRI A;  1D8J A;  2HOA A;  3QPH A;  1I50 J;  2EIM H;  3OYN A;  1JUM A;  2KP6 A;  1NK3 P;  4UUS B;  1VQ8 I;  2HQR A;  5B1A H;  4G6T B;  4B3A A;  2L02 A;  4MEY F;  1IV6 A;  1KU9 A;  1BW6 A;  1I3A A;  2HI3 A;  4CA0 A;  3I0T A;  3KP7 A;  3C2B A;  3ZQ7 A;  4XN3 A;  2V9V A;  4CYD A;  3AL0 C;  2VUM J;  5BNG A;  4E6K G;  1EKE A;  2L7Z A;  3G3Z A;  3CJQ B;  3IKV A;  4D7M A;  4ZZL A;  2MLG A;  3S1R J;  1STZ A;  2MAB A;  1P7J A;  5AIP A;  4D9J A;  3IC7 A;  3W6K B;  3VWB A;  3COA C;  4LG3 A;  3G2B A;  1SD6 A;  2DYS H;  3CMY A;  3EUA A;  3E6M A;  5C3E J;  5KCM A;  4BQQ A;  3EUH A;  3J81 K;  3PL8 A;  2LKX A;  3F3X A;  4IKF A;  1WFX A;  1FZP B;  4V2F A;  3AL0 B;  3FK7 A;  1MDM A;  3DPU A;  1PUF B;  2QKM B;  2KQR A;  3T8T A;  9ANT A;  4M72 A;  2WAQ N;  2I10 A;  4HDU A;  3E3V A;  4Q47 A;  1YJN I;  1SFE A;  2J5P A;  2PFB A;  1ODD A;  2AXL A;  3HRS A;  3HSR A;  2E1M B;  5HNF A;  4E7L A;  2DA2 A;  1B59 A;  3SFZ A;  3M8J A;  4ZTF A;  3QU3 A;  5CQE A;  3M07 A;  3MVP A;  1IZ1 A;  1TT5 B;  2QWW A;  2HNH A;  1YHQ I;  3BTI A;  4P9U A;  4ESJ A;  1FMW A;  2BE5 F;  4CUG A;  2QEN A;  3LSK A;  4P9F A;  4D5C A;  5FO5 A;  4V2G A;  2NVQ J;  3WTZ A;  2JT1 A;  3ERE D;  1ULY A;  4YRV A;  1IF1 A;  3H0G J;  1XSV A;  1T0F C;  4C3I J;  3S1Q J;  4Y13 A;  3RCO A;  3M4O J;  2CYY A;  4LK1 F;  2DYR H;  4JP0 A;  1NG6 A;  3KE2 A;  2VC0 A;  3DEU A;  2P5L C;  4HZF A;  4CGZ A;  1HBX G;  4NNJ A;  4BQO A;  1K78 A;  3LSP A;  3HOT A;  1XX5 A;  3L2Q A;  1LJ9 A;  2QCO A;  2XPW A;  4MTE A;  1YIJ I;  2Y69 H;  2VN2 A;  3TDU C;  1JI8 A;  4B09 A;  5D8K B;  4B3X A;  1K4S A;  1ZQ3 P;  3FHZ A;  4W1U A;  1MNM C;  1X1C A;  2E2I J;  4F55 A;  1D1B A;  4XOR A;  4Y15 A;  3F8B A;  3IUO A;  4QLC U;  2NVY J;  4YEL A;  1W4M A;  1I5Z A;  1VQ4 I;  1S9H A;  2X4H A;  4RGS A;  2HR3 A;  2KT0 A;  4KMU X;  2VXD A;  3RYP A;  1TC3 C;  1BW5 A;  2Q2E B;  1JUP A;  3V42 A;  1OKR A;  5DYM A;  3P5J A;  4YFX F;  4E7H A;  2DW4 A;  3LSR A;  1BOA A;  3S1N J;  4XON A;  3BJ6 A;  3R61 A;  3VEP A;  3ZQF A;  1RR8 C;  2RNG A;  1MIJ A;  5EGO A;  3PNY A;  3P9I A;  3SEZ A;  3H35 A;  3NWT A;  1B1B A;  3OMY A;  4S04 A;  4XKW A;  2DTR A;  1ZAO A;  5D8L B;  1QA6 A;  1V54 H;  2WAQ A;  3FXK A;  2R5Y A;  4AM3 A;  3GME A;  2Z99 A;  4G7H F;  3CCS I;  2RVC A;  3J80 K;  3VOD A;  4ZJZ A;  1GT0 C;  3GCM A;  2BXZ A;  2XSD C;  3ZP5 A;  3VSL A;  2E2J J;  4KDP A;  4CCM A;  5IT3 A;  2MFZ A;  3IRR A;  2V6E A;  4LFU A;  3Q3S A;  3LQQ A;  2WTE A;  4EJO A;  1XPX A;  2CFX A;  5IOZ A;  3WTX C;  2E2H J;  2MA3 A;  1JE8 A;  2IXS A;  2PMZ N;  1UCR A;  1K6O A;  3K4B A;  3K7A J;  4A0Z A;  1ERD A;  1F43 A;  2BHY A;  1F1Z A;  2KIM A;  3DBR B;  1MBE A;  5DCF A;  2KDO A;  4O5V A;  2M4G A;  5J1Y A;  4OMY A;  3PO3 J;  3JR9 A;  2DBB A;  2XHK A;  2XRN A;  3A0B C;  3DTE A;  1HDD C;  4X6A J;  3KP5 A;  2IGO A;  3AG4 H;  4ANJ A;  1YI2 I;  1FSH A;  3QRF F;  1LDK B;  2L4A A;  2F6C A;  1EH6 A;  2IW5 A;  3CDH A;  2VOD A;  3L2V A;  3ECH A;  1VZ0 A;  2YX7 A;  2VKH A;  1UFM A;  2CV1 A;  2EA4 A;  1W1W E;  2LP0 A;  2EZL A;  2R4G A;  5D6E A;  4MFE A;  2QBY B;  5E1W A;  4KIS A;  3NQO A;  2JA2 A;  1CF7 B;  3WTS C;  1J7K A;  2FF4 A;  2ID3 A;  3FXJ A;  5D4S A;  2R7D A;  3JRI A;  3TO7 A;  1FYL A;  4IVN A;  5FRM A;  1D0X A;  5JHF A;  1ZHF A;  1WSU A;  1E0E A;  5M5X J;  3TQN A;  4S05 A;  2VQC A;  3K2A A;  1ZLK A;  3HL2 A;  3I5U A;  1B6A A;  3ZGK A;  3F8N A;  2H6B A;  4LMY A;  4BBS J;  5DV5 A;  2IJL A;  2NOJ B;  1W7P B;  5KK1 A;  1A31 A;  3A02 A;  2IEK A;  2OC6 A;  4XLE A;  4Z6Y A;  3HJE A;  2V9K A;  5DTD A;  1A36 A;  2DT6 A;  2E1N A;  3OYJ A;  1DUX C;  1JJ8 C;  3V7R A;  1XMK A;  1FJL A;  3GTG J;  5IP7 J;  2WWY A;  3CCU I;  1TWF J;  4LJZ F;  4QPQ A;  2IVM A;  3WTY C;  1BOB A;  3VDX A;  1Z9C A;  3WGH A;  4C2M J;  3HHG A;  4PGH A;  2XB5 A;  1DDN A;  2STT A;  1H9T A;  2KHM A;  5F1J A;  1R7J A;  3FM3 A;  2PMZ A;  3JCU C;  3GBG A;  2WAD A;  2JTV A;  2ETH A;  3QAH A;  2M1B A;  5FLX Z;  1JHF A;  2CUJ A;  1ON2 A;  1FOK A;  1I6X A;  2FXA A;  1I1S A;  1IN6 A;  4BXU A;  2NAZ A;  2P5V A;  5ILV A;  3G1L A;  3ZQC A;  3H3U A;  3KEO A;  2ECB A;  4IHV A;  3VOE A;  1WJD A;  1JKO C;  3W2A A;  2BV6 A;  2D1V A;  5GAD J;  1MBK A;  4O6J A;  3MZY A;  1UG0 A;  1WI3 A;  4XM3 A;  3GZ5 A;  1B4A A;  1SD5 A;  3BT9 A;  2YUS A;  4WCG A;  3FHN A;  5J8F A;  3ULQ B;  3DBL B;  3O8G A;  2E35 A;  2DMN A;  2VQL A;  3AG1 H;  2LRE A;  2XVC A;  2IT0 A;  1T6S A;  3KZZ A;  3TW6 A;  5FLX K;  4EJW A;  3HDD A;  3IAM 2;  1SVL A;  5HS8 A;  1OCT C;  4L9V A;  1ZRF A;  5HDG A;  2G7U A;  2JQ7 A;  3S2D J;  2EFO A;  3DKX A;  4IO9 F;  4HST A;  1JXS A;  5E8I A;  2ISZ A;  3ZQI A;  1QPM A;  2DA1 A;  3BPV A;  3CJN A;  1ZRC A;  4WF2 A;  5K5Q A;  2BXY A;  5BQT A;  2E60 A;  3DLL F;  1T39 A;  2HOS A;  2HXI A;  4DOZ A;  3NWS A;  2CW7 A;  1KQ9 A;  5IP9 J;  2FQ3 A;  2X1C A;  3OL3 A;  1VQL I;  1IDZ A;  2W00 A;  3LSJ A;  3W2V A;  1QBJ A;  5EEH A;  1RKW A;  1YRN A;  1IUF A;  5EJC A;  4MHG A;  1W7P D;  2LSO A;  2E36 A;  2VBZ A;  1ZR4 A;  3U9G A;  3K1N A;  3P9C A;  4NBQ A;  4A6D A;  4BU2 A;  3O2P E;  4XLP F;  2LC2 A;  4AVZ A;  4BE2 A;  1ACI A;  2A6E F;  5EEA A;  5H6R A;  1LEB A;  4BS9 A;  2H6C A;  2A3S A;  3ZMD A;  1QHH D;  2V79 A;  4NQW B;  2E7X A;  2W85 A;  2LBF A;  1R00 A;  3BQY A;  4Q5S F;  5ERI A;  5E3N A;  2GA2 A;  3V4G A;  2XPU A;  3F9K A;  1X1D A;  4PDK A;  2VOO A;  2ME0 A;  3PIP F;  3OYB A;  5D5V B;  2OCC H;  4ENN A;  1EH8 A;  3F6V A;  5D6F A;  2NNY A;  1ZAR A;  2BGC A;  2DFF A;  4EV0 A;  5F0F A;  4AIK A;  2JVH A;  4M3E A;  2XC7 A;  2D1H A;  3N97 A;  1S6L A;  2Y0M A;  3ABU A;  4NB5 A;  1MJB A;  3I59 B;  3KIO A;  4EJV A;  3P7N A;  3TGN A;  2H27 A;  3KPH A;  1T56 A;  2VOP A;  1J9I A;  3QP6 A;  4HRI A;  1Y56 A;  4MTD A;  2LR8 A;  2QQA A;  5CLS A;  3ABT A;  1SAN A;  2BZT A;  3PNV A;  4LIU A;  4RB0 A;  3SDB A;  3JSP A;  2QQ9 A;  4HOB A;  4BE1 A;  1GV2 A;  2F2E A;  3ZQG A;  4BHP A;  2CFO A;  2LK2 A;  1FX7 A;  1WJA A;  1X4O A;  4CYC B;  3M1C A;  2CUF A;  1GXP A;  1IRZ A;  2BBY A;  1IN4 A;  2K4B A;  4BEH B;  3LSI A;  3OR1 C;  5F1R A;  4OIO F;  3S93 A;  3CJT B;  2WC2 A;  4RLQ A;  4L9J A;  5LEK A;  2I8D A;  2CJJ A;  3CUO A;  1H89 C;  3SEQ A;  3L2W A;  1T33 A;  3CCM I;  4LB5 A;  1GVD A;  4XKB A;  3CTA A;  5L3D A;  1TQI A;  2QEX I;  4ON0 A;  2VJJ A;  1HKT A;  3CMM A;  4S0H B;  2TDX A;  3I64 A;  2HDD A;  4CCN A;  2G9W A;  3BR5 A;  4J01 A;  2KRC A;  4BGD A;  2VPR A;  3HRM A;  3OIP A;  3AAF A;  4XOP A;  4UUV A;  4UUS A;  4EJT A;  1D0Y A;  4CCK A;  4QPO A;  2D2W A;  2PJR B;  3OS2 A;  5AON A;  4OAZ A;  3H3Z A;  4IF4 A;  3F0C A;  4N4O B;  2DT5 A;  4OIQ F;  4G7Z F;  2PN6 A;  2IRF G;  1E2X A;  2CUZ A;  5LHG A;  3B6A A;  3LAP A;  3BCA A;  3SQN A;  1HQC A;  5DM7 F;  3KLN A;  4CH7 A;  4BAY A;  1IRX A;  1D1A A;  5C4J J;  1UMQ A;  2JVG A;  5IP6 A;  4EGZ A;  3ZQL A;  1RRJ A;  1DQU A;  5JLW A;  1IW7 F;  4GYG A;  4M9Z A;  4DBQ A;  4GRI A;  2JUC A;  5M3F J;  2R0Q C;  1HC8 A;  4OU0 A;  2HYF A;  3OSF A;  4IEJ A;  1F5T A;  3E0J B;  1JTX A;  2YPR A;  4LGW A;  1KU7 A;  2MSY A;  1FOW A;  4A3B J;  5FFX A;  2A68 F;  2JSP A;  1MMD A;  3ZXS A;  2XAU A;  5FFZ A;  4KMF A;  2DQL A;  1ONV A;  1Z7L A;  2CW8 A;  3I71 A;  3IHU A;  2E1O A;  1R5H A;  2QYO A;  3LAJ A;  3FX3 A;  3TP3 A;  4NC6 A;  4O3M A;  3I54 A;  3JSO A;  1F9N A;  2HZT A;  1I3Q J;  1DPU A;  4RAZ A;  1FWZ A;  1Z1D A;  2GAU A;  4RM3 A;  4WXD A;  3KZI C;  2HOT A;  1YS6 A;  2P7V B;  1ENH A;  4I2O A;  2VBW A;  2MC4 A;  4JX5 A;  1G2H A;  4PFO A;  3BR0 A;  1UHS A;  1YW9 A;  4Y17 A;  4HSR A;  3R0A A;  2AXT C;  1UHM A;  4XN0 A;  2BVM A;  4CZZ A;  3HPG A;  4GFB A;  5H6Q A;  5GAH J;  1S8N A;  1XSX A;  4OOI A;  3SDG A;  4L9N A;  2K9N A;  3KP6 A;  1J0R A;  3M8E A;  3QPS A;  5FJ8 J;  2AO9 A;  5KAF C;  3ROU A;  3ONQ A;  5H20 A;  2K27 A;  3L09 A;  1AU7 A;  2VKE A;  1VQ6 I;  4BJ5 C;  1LUJ B;  1G3T A;  4YFK F;  2HKO A;  2MLK A;  4JK1 X;  3RTR A;  3U2R A;  5B3S H;  3DP7 A;  2DXI A;  1T0F A;  2BOL A;  4IZZ A;  3OWT A;  2F4O B;  2H94 A;  4PJ0 C;  4H4K C;  1G3S A;  4W97 A;  4QTR A;  2Y2Z A;  3OYE A;  1IXC A;  5GPC A;  2CO5 A;  1KA8 A;  1SVM A;  5JVG F;  5FRN A;  3H9Q A;  1WVR A;  2YX4 A;  4N4N B;  4EEF G;  1GXQ A;  1FTZ A;  2FBI A;  2ZJ2 A;  2K85 A;  1WJ5 A;  2Q2E A;  1WRJ A;  5EDN A;  4A6E A;  1IGN A;  2K40 A;  2A61 A;  2IS4 A;  2R3S A;  3WG9 A;  3IKT A;  1MNE A;  2VAS A;  3W3C A;  3FBN B;  2ZB9 A;  3J7A O;  3WU2 C;  3DPT A;  3I3L A;  2ZXH A;  5CVJ A;  4HBL A;  5LEJ A;  1W0U A;  3GVA A;  4XKC A;  2HPI A;  3OYG A;  3OYI A;  3HOZ J;  2AHQ A;  2L54 A;  3FXU A;  2QZ8 A;  2ACJ A;  4F3Q A;  2MGQ A;  3HPH A;  3H36 A;  4XBF A;  1JKQ C;  1BN5 A;  4YIF A;  2P4W A;  3GLL A;  4FHT A;  1P2F A;  1XGM A;  3TED A;  3ZMU A;  1Y8Q B;  2WV0 A;  3RZD J;  2LF8 A;  2Q8K A;  3TO9 A;  4ZYH A;  3JRC A;  3HXL A;  3ABK H;  1IN7 A;  3GZ6 A;  3HM5 A;  1PDN C;  2WY8 Q;  1WJC A;  3QWL A;  3LOC A;  2KMU A;  2I5U A;  2W57 A;  4YFN F;  1O3T A;  3BLY A;  1S7O A;  1TWA J;  3G1O A;  4UXN A;  4RB1 A;  1E3H A;  1OCO H;  2N8G A;  3WHC A;  5HLG A;  4AIJ A;  2RAE A;  3HKZ N;  3FBI B;  3MFK A;  2RRE A;  4A3J J;  2EJR A;  2IPQ X;  2RV8 A;  2WAF A;  2X51 A;  4GCV A;  2UWM A;  1FMV A;  3BOQ A;  1DP3 A;  4RDU A;  1X19 A;  4KJZ A;  1S29 A;  1MMG A;  2A05 A;  5IYD J;  4ZC3 A;  2HOE A;  2DPD A;  3LWF A;  5DD8 A;  1GLN A;  3K4M A;  5IY5 H;  3JRA A;  4PJM A;  4J19 A;  3SZG A;  4MLO A;  4QIW N;  3QPT A;  3JRE A;  2JA6 J;  2F48 A;  3T8R A;  3HGG A;  1PP7 U;  3GFM A;  3S16 J;  1YOV B;  3BTJ A;  3PJR A;  2X85 A;  3CCE I;  2QGU A;  2PJP A;  4II2 A;  4IHS A;  2UXX A;  3H0D A;  1YW7 A;  5J6X A;  4Q4Z F;  2VL8 A;  2XF6 A;  3KP4 A;  1LVA A;  3O3K A;  1OPC A;  3EYY A;  2IGN A;  3PSI A;  4BQA A;  2FRH A;  3F6O A;  2IBD A;  3U1K A;  3J7Y J;  2EZH A;  2ECC A;  4GGG A;  2PMU A;  3F22 A;  2FML A;  4XR6 A;  3CF2 A;  3A03 A;  3FXR A;  4DIQ A;  1NG7 A;  3DU5 A;  3T0Y A;  2VT2 A;  2R7S A;  5DD4 A;  1R4N B;  3KP2 A;  3WU1 B;  1XGS A;  2EIN H;  2L7K A;  1G59 A;  1VQO I;  5F0H A;  1E17 A;  2E1M C;  3LFU A;  2OA4 A;  4LG0 B;  3PNT A;  3ZRG A;  3H5R A;  5J40 A;  1XSD A;  4EGY A;  3C18 A;  2MH9 A;  2NXN B;  2F5V A;  4IOC F;  1AHD P;  1U0J A;  2NYX A;  3KX2 A;  4PSW A;  2QUF A;  3BTC A;  1BIB A;  1WGX A;  2EIK H;  1H0M A;  3L00 A;  4L18 B;  1DU0 A;  2XAS A;  3E97 A;  3HKZ A;  5M3M J;  2YR2 A;  3RKY A;  5TRD A;  5CJ9 A;  4LOC A;  2M8G X;  1V4R A;  1X2N A;  1TQP A;  3E5U A;  5J47 A;  5K5O A;  1ZG1 A;  1GV5 A;  2BW3 A;  2CU7 A;  3RYR A;  2H1K A;  1FIA A;  3W6J B;  2M0C A;  2X48 A;  3Q9V A;  1FEX A;  1WJF A;  3GTP J;  2RNJ A;  2LNB A;  2H8R A;  3JRD A;  5KHD A;  5LRR A;  2V26 A;  5LBQ A;  4I01 A;  4CO8 A;  4CXF A;  4M6X A;  1OMI A;  2COB A;  1XMX A;  1K83 J;  3SHF A;  3BPX A;  2P5K A;  2JZY A;  3CO7 C;  3K70 D;  3EYI A;  1DP7 P;  1AOY A;  1BM9 A;  2W7N A;  3DEE A;  3GXO A;  4AYB N;  1K79 A;  2OPT A;  3PUB A;  2R7Z J;  1HKQ A;  5DUK A;  3N4M A;  2O8X A;  4PJN A;  1SFO J;  1G6N A;  1R1V A;  1ETW A;  2L4M A;  1R5G A;  3D5L A;  3K10 A;  3CP8 A;  3BY6 A;  1ZGW A;  3A4C A;  4IRH A;  1MSF C;  5EG0 B;  3I4P A;  1S3J A;  2LYC A;  3BWG A;  3P9K A;  3OYM A;  5J1R A;  2JN6 A;  3CCL I;  1U8B A;  2XAF A;  4G9Y A;  2HDW A;  2FBH A;  1OCZ H;  3HB9 A;  4ETS A;  1HA8 A;  2GOX B;  3KEY A;  1RES A;  1SAU A;  1B72 B;  2WY7 Q;  4C2U A;  4BHB A;  5ILS A;  1TP4 A;  2DMU A;  4YG2 F;  4YII A;  3OS0 A;  1GHC A;  1S7A A;  4Q48 A;  2J5O A;  4M9S A;  1RUN A;  4U88 A;  5K1Y A;  1BC7 C;  4NQW A;  1BR2 A;  4UVC A;  3MWM A;  1AKH B;  1V5E A;  2JMW A;  4DQ2 A;  4IHX A;  5FKN A;  2M45 A;  4CDG A;  2HGC A;  1Q1V A;  3KYD B;  3JRF A;  3OSG A;  2Y30 A;  5ILU A;  1LE8 B;  1HST A;  4RMN A;  3BDD A;  4MQ9 F;  2VLA A;  4AU7 A;  2ZNY A;  2HS5 A;  5J1U A;  2V1X A;  1RC9 A;  2BY3 A;  3IH2 A;  1TT0 A;  1JGG A;  1OR7 C;  2K02 A;  4WXC A;  3D5R C;  2DFI A;  2JK3 A;  1QZZ A;  1R22 A;  3V8K A;  3WHB A;  4KIB A;  2VON A;  1E3P A;  3T1B A;  1PYV A;  2BYV E;  5AIQ A;  1TBX A;  3DWL E;  4DZJ A;  1YFH A;  1U78 A;  2PG4 A;  4OAY A;  2EQR A;  2DMP A;  1HDP A;  3BR6 A;  2DPU A;  4L0Z B;  4LD5 A;  1GUU A;  3IRQ A;  3OV8 A;  3F23 A;  2JSC A;  2KRH A;  2OD5 A;  5LRS A;  1T98 A;  2ZJQ F;  2B7E A;  1MMA A;  3HUG A;  1KQ0 A;  2PEX A;  4B8X A;  3FDY A;  3PQJ A;  2X0L A;  4B47 A;  3VYU B;  3JRB A;  4XLA A;  4BEH A;  1X1P A;  3SXY A;  2X6Y A;  1FBS A;  2RGV A;  4R1H A;  4U7B A;  5H2F C;  3CO6 C;  5FRO A;  4I99 C;  5D5X B;  1SVO A;  1U2W A;  2V7F A;  3C2G A;  3FXO A;  4BUP A;  3CUQ B;  3GLX A;  3ZR8 X;  1TZL A;  3OYF A;  1LKX A;  4HEA 2;  4DYQ A;  1SD7 A;  4I09 A;  4HPQ A;  2W48 A;  3QOP A;  1WKM A;  2K4J A;  5F6F A;  4OIP F;  1BI3 A;  5CPR B;  1B9M A;  1BR4 A;  2BY1 A;  4P5O A;  1LNW A;  2NNN A;  1SD4 A;  3I4N J;  4IOA F;  2PQ8 A;  3K1M A;  4LLN A;  4F52 A;  3VSK A;  3OOU A;  2R7W A;  1SMY F;  2LF7 A;  4UVB A;  4G6Q A;  3HHH A;  2XF5 A;  1RR7 A;  2WV1 A;  4A2U A;  1VQK I;  3VYR B;  3S14 J;  3PUF A;  4KUM A;  2PLY A;  5BS6 A;  4AD9 A;  2ZBK A;  1X58 A;  5CVR A;  1WJE A;  3J7Z I;  2L5Q A;  3NRV A;  1IXR C;  1ON1 A;  2YU9 J;  1N75 A;  1MBG A;  3K4C A;  3IWF A;  1ZGJ A;  5JHU A;  4A3G J;  2OBP A;  4C3H J;  3HOV J;  2R7X A;  5HS9 A;  4BKX A;  1YJW I;  4KN7 X;  3RIR A;  3KFW X;  3EDP A;  2HU9 A;  1Z0X A;  2H1L A;  5HOD A;  1IN8 A;  3MKZ A;  1YIT I;  2WAE A;  1D5V A;  2YU3 A;  2O8K A;  1V55 H;  5FKM A;  3RZO J;  3ASO H;  1N78 A;  4AID A;  2JPC A;  5JLX A;  5IYC J;  3J7A Y;  3HRT A;  4PJL A;  1BBY A;  1R4M B;  3C1D A;  5E20 A;  5GAE J;  1A5J A;  1XGO A;  4PFP A;  1HW2 A;  1W36 D;  2KZG A;  4BE0 A;  2CQ7 A;  2OQG A;  5D4R A;  2OTL I;  2DA5 A;  3ZQQ A;  3IL2 A;  2XAG A;  1HW5 A;  2KKO A;  3FZV A;  2NS7 A;  2LLK A;  2R92 J;  3ZN0 A;  3WU0 A;  1JT6 A;  4F7Z A;  1XN7 A;  5CVV A;  2Z16 A;  4RM2 A;  3ZMZ A;  1R58 A;  1W5C C;  5ED4 A;  4WXH A;  2W4S A;  1EV7 A;  1FP1 D;  3DTK A;  2P7C B;  3M8F A;  3GX4 X;  3ML6 A;  3SJM A;  1IJW C;  1QNT A;  3CCR I;  1IXS B;  1BA5 A;  4I7H A;  4PJJ A;  1R1U A;  4EAT A;  4OIN F;  4BYY A;  1R1T A;  2ID6 A;  4I0A A;  3OYA A;  4E7K A;  3S3N A;  1ZR2 A;  1IO2 A;  4HF0 A;  5HLH A;  3RPU D;  2FNA A;  2HEO A;  2NS0 A;  5DDG A;  2HTS A;  2R7U A;  3CMA I;  1LPQ A;  4AC0 A;  1MKM A;  1I39 A;  2YSR A;  2OAZ A;  1QVU A;  4IRG A;  4BQN A;  1XTA A;  1J2X A;  4M9X A;  1O7F A;  3CCJ I;  5CVI A;  1I1G A;  3OYC A;  2G0E A;  5K7F A;  3OYK A;  4KIC A;  1IRG A;  2V1U A;  2L3D A;  2OCE A;  1XC5 A;  4PK4 A;  1K6Y A;  3HG9 A;  2NOG A;  1S5L C;  2OTJ I;  2B63 J;  3CF5 F;  1WH5 A;  2OUM A;  1RNL A;  3FMR A;  2OJE D;  2P6S A;  3TOA A;  4HX4 A;  4U0Y A;  5LHH A;  2K9L A;  4C9Y A;  3PM1 A;  2LY2 A;  4FQG A;  2VJI A;  1Z3Y A;  5DM6 F;  1N77 A;  5CKT A;  2MBF A;  1ZRD A;  1QO0 D;  5E18 F;  2DOA A;  4G8X A;  3GFJ A;  4A69 C;  5FLV A;  1ZKG A;  2IGM A;  1MW7 A;  3GZN B;  2FOK A;  1V5G A;  5ICG A;  2VQG A;  2EBI A;  4FX0 A;  1R71 A;  4OIR F;  3I58 A;  2LKP A;  5HNH A;  4BY1 J;  3MCZ A;  3SFI A;  2Q1Z B;  2DDA A;  1H8A C;  5E3L A;  3BG9 A;  4XNF A;  2CV0 A;  1K61 A;  4WWC A;  3GWZ A;  1TL8 A;  3BR3 A;  3IP4 B;  1WJB A;  1MGT A;  3VYS B;  3S1M J;  1M1E B;  5TJJ A;  2HWV A;  3S2H J;  1IUY A;  5CQG A;  1O4X A;  3PSF A;  4L0Y B;  3R4K A;  1SFX A;  1UHW A;  4IL6 C;  1NTC A;  2E34 A;  3Q9S A;  4XK4 A;  5KAI C;  2O5R A;  1R49 A;  4KFC A;  1Y39 A;  2EWN A;  4HV6 A;  1WH7 A;  2CUE A;  3S2W A;  2R5Z B;  2HQN A;  1U9N A;  4M6V A;  3ZMS A;  4XIC A;  2X6O A;  4E70 A;  3GTQ J;  4M73 A;  4UUT A;  2DTZ A;  3QPL A;  2ZME C;  4Y4R A;  4BH9 A;  3G6E I;  1VF9 A;  4A3K J;  2W25 A;  2XGD A;  1MJ9 A;  3LA2 A;  5BOX A;  2R7T A;  2P0W A;  4BL0 B;  3CC2 I;  2XUB A;  1J09 A;  2BVL A;  2AS5 F;  2QQ8 A;  1U6G A;  4UNO A;  1XMA A;  5HVQ C;  1LDD A;  4Z2Y A;  5KNL A;  1DPR A;  1P7I A;  5C4X J;  2STW A;  5IT9 Z;  5EZH A;  2DFE A;  4PCQ A;  1AA7 A;  2TRT A;  3DLA A;  3QYF A;  4MO7 A;  2ZME B;  4LLG F;  4M3B A;  5E1Z B;  1JKR C;  1VQ5 I;  2VC1 A;  4L5J A;  5DEQ A;  4ZDO A;  4B48 A;  1FNN A;  2ZJP F;  2ESH A;  3RI4 A;  1POG A;  1ZEL A;  1UST A;  2VB6 A;  4QSH A;  2HQ5 A;  3A01 B;  2KIF A;  2D5V A;  2ZXW H;  1WHU A;  3GO5 A;  4D1Q A;  3G71 I;  1X1B A;  2FUG 2;  2VQH A;  2LDU A;  4P55 A;  3RSN A;  1UAA A;  2CW0 F;  2LD5 A;  2DO7 A;  4FT8 A;  2G7H A;  2TCT A;  3WTU C;  2JWT A;  1T38 A;  3T5X A;  2GXB A;  2XDV A;  5CVU A;  1EH7 A;  4A93 J;  5K5R A;  2DAO A;  4I98 B;  1PUF A;  4Y33 A;  1JTY A;  2Y31 A;  4I76 A;  1LEA A;  2EK5 A;  2A5W A;  2CQK A;  2MD0 A;  1TNS A;  4HQE A;  4G94 A;  3ZMT A;  1O57 A;  1U8R A;  5HDN A;  3KP3 A;  5GTH C;  5L3C A;  2F5E A;  2GZW A;  3NAR A;  1G3Y A;  2W24 A;  2Z5U A;  4IXA A;  3S3M A;  5HLI A;  1T08 B;  3R6S A;  1BL0 A;  1TW2 A;  1V5F A;  2IS6 A;  5F0C A;  4HDV A;  2NVT J;  2OQR A;  2EZK A;  4HX7 A;  4U0V A;  2VE8 A;  2JA7 J;  5FD5 A;  3FXM A;  4C3J J;  2PMH A;  3SZT A;  3REO A;  1WCM J;  3RPQ A;  2EZI A;  3E5X A;  3KLO A;  3HTS B;  2L0K A;  2RDP A;  1KU3 A;  1QVT A;  5J4Y A;  4XLC A;  2EB7 A;  5DCM B;  4BJ6 C;  2ZC2 A;  3CC4 I;  2QA4 I;  3M1E A;  2COM A;  3E5Q A;  3OIQ A;  4YIR X;  4J00 A;  2RC4 A;  1USS A;  5D5U B;  1CGP A;  2EH3 A;  3G73 A;  2K9Q A;  2DQR A;  1YS7 A;  2EIL H;  4ZYD A;  2KIS A;  5EG0 A;  3I53 A;  1ZG3 A;  3QQA A;  2O7O A;  1TWH J;  2CQN A;  2DJN A;  2YS9 A;  3HSE A;  2M0M A;  3LFK A;  1J5Y A;  1FBQ A;  1G3W A;  2E1C A;  4XL9 A;  3PFI A;  1VTN C;  4XOT A;  3MKY B;  3CZ6 A;  1U5T B;  3LST A;  1H88 C;  1VQN I;  2BY2 A;  1XDS A;  3DKY A;  2QLZ A;  2L7F P;  3DTI A;  1B72 A;  1XDU A;  1P92 A;  5B5E C;  3H9J A;  1XS9 A;  3ZPL A;  3L2C A;  1FY7 A;  4GYI A;  5LGT A;  2QM3 A;  2KIQ A;  1XD7 A;  1PP8 F;  3RKW A;  2HYG D;  3OS1 A;  2ELK A;  2M7B A;  1RI7 A;  1A6Q A;  3AKZ A;  3G4S I;  1AKH A;  5LGU A;  1XCB A;  5CYV A;  1MJA A;  4PSX A;  5ICE A;  1IN5 A;  4GO1 A;  1LQ1 A;  1HXD A;  2MG4 A;  1LE8 A;  2JJ7 A;  2VI6 A;  1JJ6 C;  3V8L A;  2CGP A;  1HSJ A;  3U21 A;  3A1Y A;  4BY7 J;  3I56 I;  1R5I D;  5IPA A;  4OMZ A;  4X0G A;  4CCJ A;  3RJP A;  1ZLJ A;  2AQE A;  2F5C A;  3BTL A;  4RB2 C;  3D1N I;  2O61 A;  2VPL A;  3CCY A;  2DN0 A;  2VKV A;  3BP8 A;  3HC7 A;  4F91 B;  3HTU A;  2R93 J;  1BJA A;  1BR1 A;  4HW0 A;  1F4K A;  1CQT A;  4I6Z A;  1U3E M;  2V9P A;  1W5S A;  5B1B H;  1KON A;  4DGW B;  1ETQ A;  1MBH A;  2CQX A;  5E79 C;  2IP2 A;  1NHA A;  2QSG X;  2XB0 X;  2GOM A;  3V8J A;  1OR7 A;  1KYZ A;  3GUD A;  2VJ5 A;  2D45 A;  1C0W A;  4HF2 A;  3K70 C;  1F36 A;  1O3Q A;  3ISP A;  1Q1H A;  4EJU A;  2GLO A;  1Z3X A;  1MMS A;  4HYE A;  2R7O A;  3ZOB A;  1X1A A;  3ESW B;  3HOY J;  3LA3 A;  1VQ9 I;  2LH9 A;  2XGC A;  4EM1 A;  2FE3 A;  3CUQ A;  3WTW C;  3A2K A;  4IHY A;  1X4P A;  5J3L A;  5HOO A;  1Z6R A;  4LK0 F;  5FKL A;  2QBY A;  3BJO A;  3GEZ A;  1CF7 A;  1YX5 A;  2XGE A;  3LMM A;  2BEO A;  3HBL A;  2QQB A;  4BBR J;  1RKT A;  2VBY A;  3HRU A;  1ZYR F;  2JRT A;  3C7J A;  1J75 A;  2IAI A;  3B6C A;  5LD2 C;  2IS2 A;  2Y9Y A;  2KDZ A;  5J4V A;  3RPU A;  2DOD A;  2GXA A;  5HDK A;  3S3O A;  5BPD A;  1W7P A;  4HG2 A;  1B8I B;  3GTO J;  4MQV A;  1KU2 A;  1PJR A;  3CME I;  3IV5 A;  2KJB A;  2OZU A;  2Z33 A;  2MYS A;  2DCE A;  1ETO A;  4MGR A;  1Y1W J;  1IG7 A;  4N9H A;  1FP2 A;  3MD2 A;  4A12 A;  2F4I A;  2RQQ A;  2OV7 A;  2FD5 A;  3K9T A;  3J81 Z;  3V7C A;  4AUX A;  2ZXI A;  4XLF A;  1W5T A;  3KYC B;  1MMN A;  2L9R A;  2ICW G;  3BZK A;  3JW4 A;  3PFY A;  2DA6 A;  3ERM A;  2WB1 N;  3VPR A;  2R7R A;  1SEU A;  2DMQ A;  1VI0 A;  2KPM A;  3FKJ A;  3F72 A;  3ECO A;  3E7L A;  3WGG A;  1IDY A;  3Q0W A;  4B44 A;  1HKS A;  2L7M P;  5LLQ A;  3FIW A;  4FX4 A;  3Q5F A;  1P4A A;  2MD5 A;  6PAX A;  4XSZ F;  1NK2 P;  4C30 A;  2HVQ A;  3WE3 A;  1VQM I;  4B4C A;  5GAG J;  1V3F A;  2IA0 A;  4BXF A;  1Y8R B;  3TO6 A;  1BI2 A;  3FXL A;  3JRH A;  4HNT A;  2V1D A;  3EET A;  4ITV A;  1W0T A;  4AIH A;  4M3G A;  3WOD F;  4E4H A;  2HZD A;  1YLF A;  1D8K A;  2M87 A;  2Z1D A;  5JFR A;  2MC3 A;  3LSM A;  5E1X A;  4LIV A;  1YQA A;  2XPV A;  2M9H A;  4ZYE A;  2LMD A;  2GIV A;  4D0P A;  2VE9 A;  5M5W J;  1LFU P;  2A5Y B;  3TKY A;  2FEZ A;  4KYW A;  3DPL C;  1EF4 A;  1VQP I;  4MEX F;  4PGG A;  4ZDP A;  1N25 A;  4A3M J;  4BJT A;  1IRF A;  3BR1 A;  3GTK J;  3MQ0 A;  3NAU A;  1BC8 C;  1MH3 A;  5K7H A;  1Y0N A;  3F8F A;  2CG4 A;  3OYD A;  4A3D J;  4JQF A;  3HYI A;  2CH0 A;  2ADU A;  3HIF A;  4FE7 A;  2ZNZ A;  4ABZ A;  4E7Z A;  4Y3O A;  2ZXJ A;  3LA7 A; 
#chains in the Genus database with same CATH homology
 1RET A;  5IYC J;  4XRS A;  3BR2 A;  4S0H B;  2HDD A;  4DW6 A;  4HNV A;  3BR5 A;  1A5J A;  1X2M A;  1GDT A;  4FTH A;  2VPR A;  5E3M A;  1FIP A;  1A6I A;  2DA5 A;  4UUS A;  3HOU J;  2NVX J;  1ETV A;  2NS7 A;  2LLK A;  2R92 J;  2GBY A;  3F0C A;  1JT6 A;  1HF0 A;  2LVS A;  4XID A;  1XG1 A;  3FKI J;  5FKK A;  2P81 A;  4DYC A;  3B6A A;  4JX6 A;  3L1P A;  3LSG A;  3GTM J;  5C4J J;  3SJM A;  1UMQ A;  1IJW C;  1BA5 A;  4DZP A;  5IP6 A;  3ZQL A;  5JLW A;  2ID6 A;  5M3F J;  3HOW J;  2R0Q C;  3BG3 A;  5FKO A;  3OSF A;  4IEJ A;  1ZR2 A;  1JTX A;  4XRS G;  2MSY A;  4A3B J;  2X9D A;  4AC0 A;  5IYB J;  1LFB A;  1QVU A;  3Q0V A;  4DYR A;  5E3O A;  2E1O A;  3GTL J;  5F08 A;  2G0E A;  3TP3 A;  2HOA A;  5K7F A;  5C44 J;  4A3E J;  2GM4 A;  1I50 J;  4CYC A;  1JUM A;  1NK3 P;  4UUS B;  3CQZ J;  1XC5 A;  1I3Q J;  5K7Z A;  4B3A A;  2NOG A;  2HOT A;  1IV6 A;  2HI3 A;  1BW6 A;  1ENH A;  4FIS A;  2B63 J;  3HOX J;  3C2B A;  1WH5 A;  4JX5 A;  1G2H A;  4A3F J;  3BR0 A;  1UHS A;  5DS9 A;  2VUM J;  5BNG A;  2R5Z A;  2LY9 A;  2L7Z A;  1ZK8 A;  4GFB A;  3PM1 A;  4D7M A;  3SDG A;  3S1R J;  2K9N A;  5FLM J;  3Q0U A;  1P7J A;  2Y0S N;  3QPS A;  5FJ8 J;  2AO9 A;  2LFB A;  4A69 C;  2MW8 A;  5FLV A;  1ZKG A;  3CMY A;  1QRY A;  5C3E J;  2VKE A;  1AU7 A;  3I4M J;  2LKX A;  1HOM A;  1S7E A;  3BG5 A;  4V2F A;  3FK7 A;  1VFC A;  2EBI A;  1PUF B;  2M34 A;  2CQQ A;  4BY1 J;  3SFI A;  9ANT A;  4W97 A;  2WAQ N;  2I10 A;  2Y2Z A;  4QTR A;  5E3L A;  1ORK A;  5GPC A;  1H8A C;  3BG9 A;  2Y9Z A;  4D7N A;  1K61 A;  4EEF G;  1FTZ A;  3A01 A;  2DA2 A;  3BR3 A;  1ITY A;  3S1M J;  3S2H J;  5EDN A;  1IGN A;  2K40 A;  1O4X A;  5M5Y J;  3MVP A;  2NS8 A;  4FE4 A;  2ZB9 A;  3BTI A;  4MFD A;  1NTC A;  4G12 A;  4XK4 A;  4D5C A;  4V2G A;  1W0U A;  3HOZ J;  1WH7 A;  2NVQ J;  2CUE A;  2AHQ A;  5EZG A;  1U9N A;  4M6V A;  2R5Z B;  4XIC A;  2X6O A;  3H0G J;  4MIM A;  4C3I J;  3GTQ J;  4UUT A;  3S1Q J;  3M4O J;  2DTZ A;  2MGQ A;  3QPL A;  2DMT A;  1JKQ C;  1VF9 A;  5GPA A;  4A3K J;  2O9L A;  4JP0 A;  2XGD A;  3OIO A;  4RBO A;  3TED A;  1BJZ A;  2DA3 A;  3RZD J;  4B1R A;  3JRC A;  3LSP A;  2QCO A;  2XPW A;  3HM5 A;  5C4X J;  1P7I A;  5EZH A;  1ZQ3 P;  2TRT A;  4MO7 A;  3LOC A;  4W1U A;  3ZQH A;  1MNM C;  2E2I J;  3S17 J;  4M3B A;  1JKR C;  1TWG J;  1TWA J;  2NVY J;  3G1O A;  1POG A;  1OFC X;  2N8G A;  3WHC A;  2KT0 A;  4A3J J;  2RAE A;  3HKZ N;  4QSH A;  1TC3 C;  2D5V A;  2HQ5 A;  3A01 B;  1BW5 A;  1JUP A;  3DCF A;  3LSR A;  1ETK A;  4RDU A;  3S1N J;  2LD5 A;  3ZQF A;  1Z77 A;  2TCT A;  5IYD J;  2FQ4 A;  2JWT A;  1UG2 A;  5F04 A;  1APL C;  5EGO A;  1ETX A;  4J19 A;  3JRA A;  4MLO A;  4QIW N;  3JRE A;  2JA6 J;  4A93 J;  5F27 A;  2R5Y A;  1PUF A;  1OJL A;  1JTY A;  2Y31 A;  4I76 A;  3CDL A;  3HGG A;  2DA7 A;  4Y52 J;  3S16 J;  3BTJ A;  1D5Y A;  4NDL A;  1GT0 C;  2XSD C;  2E2J J;  3NAR A;  4L5E A;  3Q3S A;  5IOZ A;  2E2H J;  1BL0 A;  2PMZ N;  5IOY A;  3PO2 J;  5F0C A;  3LNQ A;  2NVT J;  3K7A J;  2EZK A;  1F43 A;  2JA7 J;  2IBD A;  3TW7 A;  4C3J J;  2EZH A;  1MBE A;  2ECC A;  4XRM A;  5J1Y A;  4M3F A;  3PO3 J;  3JR9 A;  1WCM J;  3A03 A;  4X6A J;  2EZI A;  1HDD C;  3S15 J;  2L0K A;  1QVT A;  5F0H A;  1I6H J;  2EH3 A;  1HLV A;  3IH4 A;  4Y7N J;  2K9Q A;  5EGO B;  3JRG A;  1AHD P;  5EG0 A;  2LP0 A;  2EZL A;  1FTT A;  1R9T J;  3QQA A;  4MFE A;  3BTC A;  2R5Y B;  1WGX A;  2ID3 A;  1ETY A;  2O7O A;  1TWH J;  3JRI A;  2DJN A;  2YS9 A;  1DU0 A;  1DU6 A;  5M3M J;  4LOC A;  1H88 C;  1TWC J;  2M8G X;  1X2N A;  5M5X J;  2L7F P;  1B72 A;  3K2A A;  1XS9 A;  1GV5 A;  2CU7 A;  1OCP A;  2H1K A;  1FIA A;  2M0C A;  2X48 A;  1FEX A;  4X1E A;  4D5F A;  3GTP J;  2ELK A;  1OCT C;  4BBS J;  1AKH A;  2H8R A;  3JRD A;  1WPK A;  2E19 A;  3A02 A;  2IEK A;  3BQZ A;  3IH3 A;  5GP9 A;  5DTD A;  2MG4 A;  1LE8 A;  2JJ7 A;  2VI6 A;  2COB A;  1JJ6 C;  1K83 J;  1JJ8 C;  1FJL A;  3GTG J;  5IP7 J;  4BY7 J;  1TWF J;  5IPA A;  4AYB N;  4BXX J;  2OPT A;  2R7Z J;  4C2M J;  2XB5 A;  2HXO A;  3BTL A;  1SFO J;  5F1J A;  3TP0 A;  3RQI A;  3D1N I;  1ETW A;  3M3Y J;  3CCY A;  2DN0 A;  2VKV A;  3GBG A;  2R93 J;  1ZGW A;  1MSF C;  5EG0 B;  3G1M A;  1QPI A;  1VND A;  1CQT A;  4I6Z A;  3G1L A;  3ZQC A;  5J1R A;  1RPW A;  2JN6 A;  1ETQ A;  1MBH A;  2ECB A;  1U8B A;  2CQX A;  1B8I A;  4IHV A;  1JKO C;  2XB0 X;  3HB9 A;  1MBK A;  1RES A;  1WI3 A;  1B72 B;  2K9S A;  1F36 A;  3O8H A;  2DMU A;  2GLO A;  4M3D A;  3BT9 A;  3FK6 A;  2YUS A;  3ZOB A;  2ME6 A;  3HOY J;  4A3I J;  3O8G A;  1AKH B;  2JMW A;  2DMN A;  4IHX A;  5FKN A;  2XGC A;  4IHY A;  3TW6 A;  5J3L A;  1Q1V A;  3JRF A;  3DEW A;  3OSG A;  2Y30 A;  1LE8 B;  3HDD A;  4IHW A;  5FKL A;  1IC8 A;  5J1U A;  3S2D J;  2XGE A;  2OF7 A;  3IH2 A;  3HBL A;  4BBR J;  3ZQI A;  3UKG A;  1JGG A;  2DA1 A;  1RKT A;  2JK3 A;  3WHB A;  2HYJ A;  2HOS A;  2HXI A;  5EF6 A;  2JA5 J;  2IAI A;  4JX4 A;  3B6C A;  5IP9 J;  1E3O C;  1IDZ A;  3LSJ A;  2Y9Y A;  4DZJ A;  2KDZ A;  1U78 A;  2EQR A;  1RKW A;  2DMP A;  1HCR A;  1YRN A;  3H3V K;  1HDP A;  1IUF A;  3BR6 A;  1JKP C;  1GUU A;  1MH4 A;  1B8I B;  1ZR4 A;  3GTO J;  3IV5 A;  1ETO A;  1Y1W J;  2QF7 A;  2CRG A;  1IG7 A;  3FIS A;  4FCY A;  5EEA A;  3JRB A;  2FD5 A;  5EYR A;  4AUX A;  2L9R A;  1MSE C;  3VPR A;  2DA6 A;  2WB1 N;  2DMQ A;  1VI0 A;  1JT0 A;  3BQY A;  3E7L A;  5E3N A;  1IDY A;  1U9O A;  2XPU A;  3Q0W A;  2M2E A;  2ME0 A;  2L7M P;  2FX0 A;  2XRL A;  3FIW A;  3RKQ A;  1NK2 P;  4B4C A;  4DYQ A;  3HGY A;  5F0F A;  2W48 A;  4M3E A;  4A3C J;  3JRH A;  1W0T A;  4JYK A;  1T56 A;  4M3G A;  3I4N J;  3HEF A;  2LR8 A;  3OOU A;  1YRN B;  1SAN A;  2LTP A;  2M9H A;  2XPV A;  1RR7 A;  2WV1 A;  3S14 J;  5M5W J;  1LFU P;  3W6V A;  1GV2 A;  1X58 A;  3ZQG A;  2JA8 J;  1EF4 A;  2YU9 J;  2LK2 A;  4CYC B;  1MBG A;  2CUF A;  4A3M J;  1IRZ A;  2FJ1 A;  4A3G J;  3BR1 A;  3MKL A;  3NAU A;  4C3H J;  3GTK J;  3HOV J;  1MH3 A;  4BKX A;  5K7H A;  3MN2 A;  1JUS A;  2CJJ A;  1H89 C;  4A3D J;  4A3L J;  1Z0X A;  2DA4 A;  5HOD A;  1T33 A;  1ZTR A;  1Y1V J;  4FE7 A;  1GVD A;  1MBF A;  4ABZ A;  2O8K A;  5FKM A;  3RZO J;  1MBJ A;  3GTJ J;  5JLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...