3JTHA

Crystal structure of a transcriptional regulator hlyu from vibrio vulnificus cmcp6
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
MNLKDMEQNSAKAVVLLKAMANERRLQILCMLHNQELSVGELCAKLQLSQSALSQHLAWLRRDGLVTTRKEAQTVYYTLKSEEVKAMIKLLHSLYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription activator HlyU
publication title Crystal structure of the transcriptional activator HlyU from Vibrio vulnificus CMCP6.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription
total genus 29
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jthA00
2Z33A 4N9HA 1JE8A 2VE9A 4HDUA 5J6XA 3T5XA 1BN5A 2UZKA 4G9YA 5KVRA 3F8BA 3GW2A 4LLGF 3IWFA 4GXOA 1UHMA 3V8KA 1TBXA 4OIPF 3SXYA 4A0XA 1TLHB 1ZG5A 3TO6A 3RJPA 2FEZA 5L3BA 2ZNYA 1FP1D 3FMSA 4LLNA 4CO8A 3GF2A 4RGSA 3L2CA 4LLLA 3L9FA 4HDVA 2KJCA 1ZH5A 3HIFA 4KFCA 3HRUA 2FE3A 2ACJA 1K79A 2L54A 2E7WA 3FF5A 2H6CA 2IA2A 5D6EA 1FBSA 5D4SA 4YFKF 1S6LA 4R1HA 2HQRA 2EV6A 2QQ9A 1D8KA 3F6VA 2QVOA 2IVMA 5L3EA 5E17F 2HZTA 2HYGD 5DCMB 2F5CA 1Z6TA 1BJAA 4GGGA 1JHHA 2NNYA 1W7PB 3JTHA 4KNYA 4L5JA 4UVCA 2XGXA 5FD6A 3N97A 1T6SA 2M30A 1EV7A 1T39A 2OZ6A 4WXCA 5IT9Z 1OR7A 5DCFA 2L01A 4KUMA 3HRSA 4RGXA 4MNUA 2DT5A 2GA1A 1T98A 2C6YA 5H20A 2TDXA 5HDGA 1FBQA 4Q47A 2QWWA 1TNSA 3ULQB 5J8FA 5DD4A 1QPMA 1BIAA 3Q9VA 4HX7A 1O3QA 2E1NA 1DUXC 3FHZA 1J75A 1USSA 1IXRC 1HSTA 4UV9A 3DQVC 2CG4A 2EA2A 1LVAA 1OMIA 1Z9CA 1PUEE 3U9GA 4ZZDA 3L7WA 2YU3A 5ILUA 2KJBA 3ECOA 4IJAA 3BROA 2QBYB 3KCCA 3BP8A 2KIFA 4FX0A 3BWGA 5D5VB 1MJAA 3Q5FA 3HSRA 3K69A 3REOA 2V79A 4I02A 1HKQA 4R79A 4HLYA 3LFKA 2O03A 4IXAA 3LAJA 1K78A 4KMUX 4B8XA 4I0BA 5K5OA 3VB2A 1C0WA 2RV8A 1LQ1A 1R58A 3HSFA 1G3YA 1YW7A 2P5LC 2Q8KA 2CSOA 4ON0A 4EV0A 2H6BA 5CVUA 4TV7A 3P9CA 5D4RA 3KEQA 1ZREA 1LDDA 1KU9A 2PG4A 4AIJA 3HHGA 2RDPA 4A0ZA 2LF7A 3M1EA 3E5XA 1BC8C 2RNJA 2OBPA 5ICFA 2HDCA 2YR2A 4ESFA 2Q2EA 2WC2A 2J5OA 2L4AA 1IXSB 1ZGJA 2ZXJA 2JTVA 2PJPA 1Z05A 1FYLA 4GCVA 2F2EA 2HQNA 1QZYA 3QU3A 3GXOA 3J80K 3PFIA 3MCZA 5L3DA 3DP7A 3JSOA 5EEGA 1O7LA 2DAOA 2E1CA 3CUOA 1U5TA 4YFXF 4ESJA 4IHSA 3HRTA 2RGVA 2QZ8A 4KMFA 2L02A 5LRSA 2H27A 3DEUA 3KE2A 3ROUA 1YLFA 4RAYA 1BI0A 1K7AA 4Z2YA 1RUNA 3ZMZA 2FU4A 5BPIA 4UNOA 1TQMA 2HTJA 4MEYF 2D2WA 1QBJA 2ISZA 3I64A 3EYIA 1IXCA 2NS0A 2ESHA 1O3SA 4L9TA 4XBFA 1KGSA 3O2PE 1K78B 4QWQA 4LJZF 4LGWA 1V3FA 4LD5A 4L18B 4GO1A 1STZA 4HYEA 1FP2A 3BDDA 1MJBA 4G6QA 3WTYC 2M1BA 5D6FA 1D5VA 3R61A 1S29A 3COAC 2G9WA 1XN7A 4I0AA 1P6RA 4A5MA 2IA1A 2VONA 4OIQF 2PI0A 5BMZA 5HLGA 2M5WA 3TQNA 1QO0D 3R6SA 1XSVA 2V1XA 5DV5A 1JXSA 5HOOA 4CGZA 2JPCA 3KLNA 3IC7A 1MKMA 2CW0F 3QOPA 1J0RA 1QNTA 1IN4A 3RI4A 2P6TA 3K0LA 2D1VA 1XDUA 1XGNA 1YS6A 1P4WA 3E6MA 3RTRA 2IPQX 1H0MA 3GX4X 1W4MA 2P4WA 3HYIA 2B0LA 3QPHA 2Y48A 1U5TB 1ZRFA 4KYWA 5FLXZ 2AS5F 1ZAOA 1FY7A 2LNBA 1R00A 5DUKA 3NRVA 2HGCA 3P7NA 1OYIA 2Z9OA 4BYYA 1ONVA 4H0EA 4EGZA 3SFZA 1U5TC 1T38A 1U78A 5E1WA 1G6NA 2EA4A 2VN2A 3GLXA 2EFNA 5E18F 1R22A 4M72A 4LG0A 1FYMA 2QUFA 2K4BA 1DPRA 4PDKA 4O5VA 4OINF 2GZWA 3J81K 1MJ9A 5FFZA 4WWCA 4RGRA 5ED4A 3LWFA 4YG2F 1EH8A 4MQ9F 2XRNA 3E5UA 4HQMA 2XAHA 1O3TA 3JAMZ 1BM9A 1SD6A 5ILSA 3B73A 3ECHA 2IRFG 4XLPF 4EJOA 4EJTA 3KLOA 1F5TA 5JI6A 2NAZA 2ISYA 1ZG1A 3PQKA 3KZYA 2DBBA 1I5ZA 3M8EA 3RYRA 2R7FA 1LJ9A 2OU2A 4XSZF 3V7RA 1YW8A 4RB1A 1GXPA 3W6KB 2DK5A 1UCRA 4PZJA 1ZYRF 3HOSA 2P7VB 1XMKA 1IN7A 2XUBA 5ICGA 1R5GA 3KETA 2YX7A 3F3XA 1XGMA 4WXHA 1G3WA 4I2OA 3FXQA 3J7AO 1FT9A 2G7HA 1FX7A 2MA3A 3F21A 2EFWA 4Q4ZF 2VT3A 3C3WA 4OOIA 1KU7A 1D3YA 1QGPA 3T8TA 5BOXA 1IW7F 4NB5A 2IT0A 3LA7A 3RPQA 1TQPA 2QBYA 3GFJA 4O3MA 2O3FA 4ENNA 4A5NA 2X0LA 4G94A 3WTTC 4L0ZB 1OYWA 4LFUA 5LHHA 4DQ2A 1U2WA 1T0FA 2Q0OA 1L3LA 3OOPA 1FYKA 2PLYA 4LG0B 2OZUA 4F7ZA 3E3VA 2RC4A 4PGHA 4R8HA 1FSHA 4RB0A 2IW5A 4ENMA 4LMYA 4CXFA 1IN6A 2NRAC 5L3FA 1CGPA 2DK8A 1IZ1A 4HF2A 2FBIA 2HR3A 1WI9A 2HTSA 2WV0A 2W85A 4RGUA 3WE2A 4WXDA 3EETA 2FOKA 3TOBA 2MD5A 1S7OA 2ZMEA 1RZ4A 6PAXA 2O61A 3F8FA 1JHFA 3FX3A 5FO5A 5H6RA 4IPAA 4WX9A 2F5DA 4ASNA 1SFEA 1VTNC 3LQQA 2D45A 2XVCA 4UVAA 2HKOA 4PGGA 3I71A 1HKSA 4M9ZA 3IWZA 1WWXA 3G73A 3BJ6A 3EYYA 1YFHA 2FSWA 3DKWA 1O57A 2P6SA 1R23A 1V4RA 1RIOH 5HLIA 2XAQA 2CO5A 1YO5C 2A3SA 5A2QZ 2W57A 2A6EF 1YQAA 3GYHX 4OMYA 2GXGA 1XSXA 4A12A 3GVAA 5AIPA 2PMHA 2ZBKA 3JTGA 1CF7A 3KFWX 3CLOA 1R1UA 3MEXA 1SMYF 1XCVA 5ICCA 1DP7P 2MH2A 4GYIA 3RKWA 1YTYA 1K6OA 1ON1A 1A04A 2RVCA 2WTEA 4HLXA 1Y0UA 3E97A 2MC3A 2HYFA 1B6AA 2JSCA 1LDJA 2IP2A 4Q48A 3HSEA 2YSRA 1SFXA 1UB9A 4OMZA 2ESNA 1YW9A 2HOEA 1ZGAA 2Y0MA 2VBYA 5JVTA 3BZ6A 3ZPLA 2XASA 3KP7A 1Q1HA 3GFLA 1HW2A 4UXNA 4MTDA 4BHCA 2PEXA 3H92A 5E1ZB 2RKHA 2F5FA 3F8MA 2EK5A 4YFNF 4P55A 4HBLA 4M73A 3V7SA 3B02A 3R0JA 2FF4A 2ZMEB 2Y75A 3EQLF 1IN5A 1QZZA 3FMQA 4I98B 3TO7A 3ZMTA 1AWCA 3QRFF 1DPUA 4IRGA 2H94A 1I1GA 2F5EA 5K5RA 3LQRA 4LK0F 3T8RA 4S04A 2VOOA 3LA3A 4ZYGA 1XGOA 3E6DA 3ZMSA 5HVQC 1Z7UA 1BI3A 1O3RA 1YS7A 2NNNA 5JR3A 2DU9A 4EJVA 5TJJA 4N0BA 4HAMA 1CF7B 1T2KA 3GZ5A 1KYWA 3J80Z 1WQ2A 3ERED 2XHKA 2UXXA 3CJNA 1B4AA 3RKXA 1B59A 2VBWA 4MTEA 3WU1B 4HX4A 3R0AA 1EH6A 5JFRA 4OIRF 4Q5SF 4AVPA 5ILVA 1IAWA 1UFMA 3KP3A 3QP6A 2Z5UA 2A61A 2L4MA 2XAJA 3IL2A 1W5TA 4BH9A 4ESBA 4U7DA 1B1BA 3QPTA 1EH7A 5J8CA 4MGRA 5CLSA 2DPUA 1R1VA 3O3KA 2VOPA 4A0YA 1P2FA 5DDGA 5BQTA 4P9FA 4I7HA 3HRMA 3WTXC 4XRFA 1KA8A 4JK1X 5D5XB 3WE3A 3F8NA 1QQIA 4M6XA 1SMTA 2FRHA 1BI2A 3VEPA 2EV0A 3DPLC 4LK1F 3V8LA 2G7UA 4E70A 1XD7A 4M6YA 5HS9A 1H9GA 4EM2A 2K4JA 1BBYA 2QQAA 2R7DA 2DTRA 4U0VA 1PP8F 4GYGA 5HS8A 1MGTA 3WG9A 1HW5A 4S05A 5TRDA 3R60A 5LHGA 4YIFA 4OU0A 3F72A 4LB6B 4A6EA 2ZKZA 4EGYA 3KEOA 3DPTA 2MH9A 3QP5A 3GUDA 2R3SA 1SD5A 2FNPA 3OV8A 2W25A 1I1SA 4AIKA 2OQRA 1TTYA 3P9KA 2P5KA 1AOYA 4Y13A 2BE5F 3V8JA 3SZPA 3GFIA 4WK8F 1XGSA 1WSUA 2AXLA 4ZYDA 3RYPA 2ZFWA 2STWA 1TQIA 5FD5A 3K1MA 4EJUA 4L9NA 4L0YB 5LEKA 2YX4A 4AWXB 1SFUA 2K86A 2MLKA 4CZZA 5HLHA 3ISPA 2Z99A 3U1DA 2GWRA 2XROA 1HSJA 5JHUA 3E6BA 1G3SA 3EDPA 3PQJA 2O8XA 4KA4A 4HQEA 3GWZA 1PP7U 3JAMK 3I0TA 4BNCA 4RS8A 4BQAA 4EJWA 3I59A 2V9VA 2GA2A 3I54A 2FA5A 3C7JA 2HKXA 2PMUA 3IRQA 3IHUA 3WTZA 1RUOA 1F1ZA 4WF2A 2DPDA 3J81Z 5FGMA 1LDKB 1FWZA 3RKYA 5ERIA 3HTSB 5CVRA 4KDPA 4PCQA 2XKPA 3ABUA 2P7CB 3KP5A 5AONA 2XAFA 3GEZA 2RN7A 3G3ZA 3DF8A 4IRIA 1PDNC 3QAHA 3BJAA 5BPDA 4FT8A 1FBUA 3N4MA 2FBKA 2HFHA 2KRFA 1KU2A 1SD4A 1GVJA 1TNTA 5LRRA 5L3GA 1H9TA 5LGUA 1G4DA 2GAUA 3K9TA 3SZTA 1MDMA 2MLGA 1S7AA 2VC0A 2BBYA 3WTWC 2STTA 3CO7C 3MWMA 4EVIA 5CYVA 2BV6A 4G8XA 3M9AA 2FMLA 1E17A 4M74A 1P4AA 2RQPA 2D1HA 4EM0B 1ZRDA 3CO6C 2M8EA 1MD0A 4MEXF 1Z91A 3WU0A 3ZMVA 4KT5C 3K2ZA 1B9NA 1FOKA 2VE8A 2Z3YA 5K1YA 1OYYA 5LEJA 1KYZA 4ETSA 3KP4A 3E6CC 2HEOA 3I59B 4P9UA 1BIBA 4XSXF 4IF4A 3F22A 3TO9A 3ZP5A 4L9JA 3Q9SA 3GFMA 3F23A 5F1RA 3HOTA 3RDIA 5IT9K 1LNWA 4AD9A 4I01A 3ML6A 2LKPA 4U0YA 4OIOF 2OD5A 1YIOA 3VODA 1J2XA 3P9IA 2QQBA 1U6GA 3TDZC 5F6FA 4K2EA 2VBZA 2QENA 1RI7A 5CVJA 2OQGA 4A6DA 2ZNZA 3CUQA 1F9NA 3DFGA 4HX8A 4ZH4F 4BHBA 5A2QK 1BI1A 5H6QA 4ENJA 2XIGA 2JPBA 2V1UA 1L0OC 1ULYA 1X3UA 3WGGA 1USTA 4ZYEA 3GZ6A 2EFPA 2COMA 3BPXA 3FMRA 5CVIA 2EV5A 4RAZA 2EFQA 3WGHA 4U7BA 4IRHA 2A6HF 3BY6A 3RIRA 1MDMB 4G6DA 2FMYA 4EQQA 3LAPA 2E7XA 3KP2A 4L9VA 3D5LA 4HF1A 2BYVE 5LBQA 4HZFA 3R4KA 4KN4X 3LSTA 1HXDA 2EWNA 2W84A 5E8GA 1SAXA 1XCBA 4HV5A 2VODA 2VBXA 3F6OA 5DYMA 2MBFA 1FNNA 4HF0A 1ZARA 2DI3A 3K1NA 4M71A 3V7CA 5LHIA 5HS7A 1ZLKA 5L3CA 1I27A 1GXQA 2QYOA 3F8CA 2EB7A 5DUIA 5CVVA 2DFIA 4YIIA 2VC1A 2BGCA 1KU3A 3CTAA 4DNCA 1J5YA 1HQCA 5BS6A 1KQ0A 1ZHFA 2ELHA 2VT2A 1YG2A 1F4KA 1WKMA 1WRJA 1ON2A 1FZPB 5D5UB 2YPRA 2DQRA 3BJOA 3I53A 3JW4A 4M9SA 1UHWA 1RNLA 5FB2A 3FM3A 1R1TA 1Z6RA 1S8NA 5LLQA 3WTSC 1ODDA 1J7KA 1GHCA 1HW1A 2CGPA 4IHTA 2A68F 3C18A 5E8IA 4WCGA 1R7JA 5IT3A 3CUQB 4P5OA 4G7ZF 3AAFA 1MZBA 4U0WA 3W6JB 1W5SA 4UHTA 3U2RA 1D8JA 1HBXG 1B9MA 1FPQA 4N9IA 2XKOA 4A2UA 3NEUA 2K02A 3QU6A 3CUQC 5F64A 1JGSA 4U88A 3SQNA 2X4HA 3TKYA 4KN7X 3IRRA 3O6BB 1IUYA 5K5QA 3M7GA 2FQ3A 3L09A 1XSDA 3ABTA 4KIFA 3HUGA 2UXNA 2W24A 3FXRA 4NHJA 3FM5A 4HOBA 3S2WA 3WGIA 3WODF 1LEBA 5D5WB 1ZLJA 2WWYA 3TOAA 4CICA 2ADUA 4HV6A 1FC3A 3HTUA 5CJ9A 2H09A 2EFOA 4FHTA 1XB4A 1R5HA 5D8LB 2V6CA 4M9XA 1S3JA 1KQ9A 2P8TA 2VXZA 2K27A 2A07F 5LGTA 4NQWA 5HDKA 2PN6A 1DDNA 2JZYA 2J5PA 2FBHA 2M87A 3ZMDA 4L5IA 4I09A 2ZJ2A 1SD7A 1FLIA 4CYDA 4KIGA 3TDUC 2V1DA 4HA8A 2EJRA 4EM1A 2PFBA 5ICEA 1BOAA 4UUVA 3FWEA 1G3TA 1J59A 3EUHA 2HWVA 1E2XA 4D0PA 5FFXA 1U3EM 3VFZA 4UVBA 1IRGA 5E20A 5AIQA 3DXJF 2PQ8A 1XMAA 3DV8A 3TGNA 3I58A 2ZO4A 3WTVC 4RB3C 3H3UA 5HDNA 4O6JA 4B09A 1XDSA 3I5UA 4FX4A 5FLXK 3T1BA 5KK1A 2A69F 4Y17A 1NHAA 2L3DA 4UV8A 4HW0A 2CQKA 4KIBA 2DO7A 1IN8A 1ZRCA 2P5VA 3LA2A 2BEOA 3FXUA 3ZN0A 4XLNF 3M8FA 2GXBA 2KIUA 3RPUA 4CDGA 4AIHA 4Y15A 2KIMA 4EMSA 1ZN2A 2KKOA 1REPC 3E5QA 3I4PA 5D8KB 1P4XA 3MAJA 2DLLA 4BAYA 3D0SA 4RB2C 1BC7C 2O6GE 4G7OF 1FSEA 1J9IA 4ENKA 3BPVA 1R36A 3FZVA 3JSPA 1W7PD 3HHHA 2QM3A 2O0YA 2ETHA 1ZG3A 3MQ0A 2DQLA 2K7LA 3ZN1A 1LB2A 2IA0A 1P92A 3KP6A 3GO5A 2CWEA 2M45A 2LSOA 3ZQ7A 2GIVA 5DCMA 3C1DA 2A5YB 2FXAA 2JRTA 1O7FA 4BXUA 1W7PA 1KQ8A 5EEHA 1HKTA 1OKRA 2IJLA 5LGNA 3MZHA 3T0YA 2FNAA 2OA4A 4MQVA 2CYYA 3CDHA 4P96A 4KICA 3V4GA 3ZMUA 2XV4S 5DEQA 4MHGA 1TW2A 2GQQA 4JQFA 3BOQA 2DW4A 1YYVA 3ELKA 3KZZA 4QLCU 2OAZA 3MZYA 2JT1A 2ZCWA 1OPCA 4JBAA 4G7HF 4LB5A 1I6XA 3SHFA 1LEAA 1Z1DA 3H3ZA 2NYXA 2LF8A 2LDUA 2HS5A 5DD8A 3WTUC 2XAGA 4IVNA 4BHPA 3NQOA 3K1PA 4CHUA 1IF1A 1IRFA 3VOEA 1TW3A 2UWMA 4ZZLA 4ZYHA 1U8RA 2QLZA 3L00A 3IKVA 3IKTA 2CFXA 3MFKA 5E1XA 2PBIA
chains in the Genus database with same CATH superfamily
2Z33A 2L5QA 4N9HA 2QSGX 5C4XJ 1JE8A 2VE9A 3BR1A 4HDUA 5J6XA 3T5XA 5IP6A 1OISA 1BN5A 2X48A 2UZKA 2WA0A 4G9YA 4A3FJ 2M0MA 5IP9J 2ELKA 3SJMA 5KVRA 3F8BA 2M7AA 3GW2A 4LLGF 3IWFA 4GXOA 5F08A 1UHMA 2DN0A 4M3DA 1A35A 3V8KA 1TBXA 4OIPF 3SXYA 3OS2A 2LFBA 1TLHB 4A0XA 1VI0A 4CA0A 3TO6A 4LITA 5K7FA 1ZG5A 3RJPA 2FEZA 3BLYA 4B47A 4CH7A 5L3BA 3NWSA 3QQAA 2DT6A 2ZNYA 5F0CA 1BW6A 3MKYB 1IJWC 5B66C 4B1RA 1FP1D 3FMSA 4LLNA 5CQEA 4CO8A 2L2OA 3GF2A 3OYCA 3CCEI 1VQ6I 4RGSA 2CS3A 3DBLB 3L2CA 4LLLA 3L9FA 1WJAA 2KJCA 2WADA 3DU5A 4PSWA 4HDVA 1ZH5A 3HIFA 4KFCA 3HRUA 2FE3A 4BXFA 4LIVA 2ACJA 1K79A 4II3A 1LUJB 2E5ZA 2L54A 2E7WA 3FF5A 2H6CA 2IA2A 5D6EA 1FBSA 1MIJA 5D4SA 3DTEA 4YFKF 1S6LA 4R1HA 1Y1VJ 2HQRA 1APLC 1WJCA 5GPAA 2EV6A 3VSLA 2M3AA 2MG4A 3HXLA 3WHBA 3RZDJ 2L9VA 2QQ9A 1D8KA 3F6VA 2QVOA 1MMNA 2BVLA 2CV0A 2IVMA 5L3EA 4HNUA 5E17F 2HZTA 1WVRA 2HYGD 5DCMB 2F5CA 1Z6TA 4ITVA 4N4NB 4DZJA 1BJAA 4GGGA 1JHHA 2NNYA 4HRIA 1W7PB 3JTHA 4KNYA 4L5JA 4UVCA 2XGXA 4RAFA 4BGDA 1W5CC 1JJ8C 5FD6A 1Y1WJ 1QVUA 2ME0A 4LIUA 1OCTC 5CKTA 1R71A 3N97A 5KAIC 4BUPA 1T6SA 2M30A 1EV7A 1T39A 2OZ6A 4WXCA 2HU9A 2FJ1A 1F36A 5IT9Z 1OR7A 5DCFA 1SEUA 2L01A 2QKMB 3H0GJ 4KUMA 2X1CA 2WAFA 3HRSA 4RGXA 1JGGA 2OC6A 4MNUA 2DT5A 3KEYA 2GA1A 3QYBA 5FJ8J 4BY1J 1T98A 1XG1A 4NNJA 5E3OA 2JJ7A 2C6YA 1VF9A 5H20A 2FD5A 2TDXA 5HDGA 4C2UA 1FBQA 4Q47A 1D1AA 3MKWB 2QWWA 2JA5J 1TNSA 2FUG2 3SEZA 3ULQB 4E7JA 5J8FA 5M5XJ 5DD4A 3LNQA 1QPMA 1BIAA 2X6WA 3K4NA 1S7EA 2VXDA 2LY2A 3Q9VA 4GRIA 4HX7A 2CW7A 1O3QA 2EIKH 2X1EA 2E1NA 3JR9A 2VKVA 1DUXC 4EATA 4XR6A 3FHZA 1J75A 1USSA 1WJ5A 5JLWA 1IXRC 1HSTA 4D9JA 4UV9A 2WAEA 3DQVC 2CG4A 4F3QA 1ZR2A 2EA2A 1MNEA 1LVAA 1ETQA 2M0CA 1UHSA 1OMIA 1N77A 1Z9CA 1PUEE 3U9GA 4ZZDA 5C44J 2VKDA 2CQQA 1Z3XA 3PNVA 5K7HA 2MABA 4P1WA 2DYSH 1AHDP 1JKOC 1RR8C 5FKLA 1P9QC 3H9JA 2O8KA 2E2JJ 3L7WA 2YU3A 5ILUA 2KJBA 3ECOA 5IOYA 4IJAA 4IQ4A 3BROA 2QBYB 5FKOA 1X1CA 2XAUA 2HXIA 2WY8Q 3KCCA 5M5YJ 3BP8A 2KIFA 4FX0A 3I56I 3BWGA 5D5VB 1MJAA 1JUPA 2K40A 3Q5FA 3SZGA 2Y9YA 3HSRA 3K10A 4C3HJ 3K69A 1RPWA 1SVLA 1XC5A 3REOA 1LFUP 4A93J 2V79A 1FEXA 4I02A 3H9GA 1HKQA 4R79A 4HLYA 2B63J 1R6RA 3W2WA 4XK4A 5C3EJ 3LFKA 2HDDA 2O03A 4IXAA 2MSYA 3LAJA 1K78A 4KMUX 4ANJA 1VQLI 3TMOA 4B8XA 4PFPA 3CDLA 4I0BA 5K5OA 1IG7A 3VB2A 1T56A 1C0WA 2RV8A 1LQ1A 1R58A 3HSFA 2CW8A 1G3YA 1SAUA 3IH4A 4G6TB 1YW7A 2P5LC 3QYFA 2Q8KA 2CSOA 1T95A 4ON0A 1RESA 3IH2A 4EV0A 1D0XA 2H6BA 3CD6I 4XORA 5CVUA 4TV7A 3P9CA 4XMYA 5D4RA 1JI8A 3KEQA 1ZREA 4UY8I 4CCKA 1LDDA 3OYLA 2HOTA 1KU9A 2DA4A 2PG4A 1SVMA 3W6VA 2JA6J 4AIJA 3HHGA 2RDPA 4A0ZA 2LF7A 3M1EA 1JT0A 2XPWA 1I39A 1UZCA 3E5XA 1BC8C 4GDFA 3LL7A 3JRDA 4MIMA 2RNJA 2OBPA 5ICFA 2HDCA 2YR2A 1YJ9I 1MH4A 4ESFA 4S0HB 2Q2EA 2WC2A 3D5SC 2J5OA 2L4AA 3CCRI 1IXSB 4V19K 3S1NJ 1ZGJA 3BZCA 2ZXJA 2JTVA 4IZZA 2R93J 2PJPA 2XGEA 2XPUA 1Z05A 1FYLA 2NS8A 4GCVA 2F2EA 1Z67A 2HQNA 1QZYA 4ABZA 3QU3A 3GXOA 3J80K 5HNHA 3PFIA 2D5VA 1GV2A 1OR7C 2UV1A 3MCZA 5E3NA 5L3DA 1NK3P 1EJ9A 4RAGA 3C2GA 3DP7A 4W97A 3JSOA 3JREA 1G8XA 4PJMA 3MKZA 2JA8J 1RKWA 2R7ZJ 1G2HA 5EEGA 1O7LA 2DAOA 1HCRA 2E1CA 3PIPF 3CUOA 3IH3A 3M07A 4M6VA 4ZYAA 4AU7A 1U5TA 2ZXIA 2HI3A 4II2A 4YFXF 5FLMJ 4ESJA 4IHSA 1LFPA 3AG4H 3GTLJ 3HRTA 2RGVA 1QZEA 5EYRA 2QZ8A 1BR1A 4KMFA 4Y4RA 4BU2A 2L02A 2FOWA 1YOVB 5LRSA 2H27A 3DEUA 2WV1A 3H36A 2A6TA 3KE2A 2Y30A 3ROUA 1YLFA 1T8IA 4RAYA 1BI0A 4MFEA 3S3OA 1K7AA 4BQOA 1ZQ3P 3S1RJ 4Z2YA 1RUNA 3DWLE 4XRSG 4QPQA 3AG1H 2LRDA 3OWTA 4Y7NJ 2WAQA 4CSWA 4PJJA 3S16J 3ZOBA 3ZMZA 2QGUA 5F1JA 2FU4A 1TZLA 3CF5F 5BPIA 2LYCA 4UNOA 1TQMA 3ONQA 1XTAA 3S32A 4RBOA 2HTJA 3QOEA 4MEYF 2D2WA 1QBJA 2ISZA 3I64A 3EYIA 1IXCA 2NS0A 2ESHA 1O3SA 1JJ6C 3HOZJ 2X1DA 4L9TA 4XLFA 4X0GA 2OUMA 4XBFA 4J01A 1KGSA 3O2PE 3A01A 1NG6A 2R7TA 5K7ZA 1TL8A 2HXOA 1K78B 4DOZA 4QWQA 2KPMA 4LJZF 3W3CA 4LGWA 2BY3A 1V3FA 3BQZA 1HF0A 3ASNH 5J4VA 4LD5A 4L18B 3U21A 5B3SH 4GO1A 1STZA 4HYEA 4A3KJ 2VJ5A 1ZR4A 2IS6A 2F4MB 3CJRB 1FP2A 3BDDA 2PX9A 2ZXWH 3OYHA 1MJBA 1VQNI 5GPCA 4G6QA 4PUSA 3WTYC 2VJIA 2M1BA 3S1MJ 1TWAJ 4OWRB 5D6FA 1NK2P 1D5VA 1JTYA 3R61A 1S29A 3COAC 2G9WA 2Q1ZB 1XN7A 4I0AA 1P6RA 4E7HA 4A5MA 3AG2H 2KDZA 2IA1A 3BR6A 2LTPA 5C4JJ 3K4LA 4YEJA 1MBKA 1H8AC 2F4IA 3I4NJ 2VONA 4OIQF 2PI0A 2R7SA 5BMZA 3OS1A 5HLGA 2M5WA 3TQNA 3HG9A 4U87A 1QO0D 1ORKA 3R6SA 1XSVA 2V1XA 5DV5A 2QKLB 1JXSA 5HOOA 2IGOA 1H89C 4QIWN 4CGZA 1QRYA 2JPCA 1W0TA 3KLNA 4DJAA 3HOXJ 3DKXA 3IC7A 4ZDOA 1MKMA 3LSKA 3I55I 2CW0F 3QOPA 1Y56A 2OTJI 3NWTA 2DOFA 1J0RA 4XLAA 1K83J 4BQNA 1QNTA 1MSFC 1IN4A 3RI4A 1A5JA 5IP7J 2P6TA 4A3GJ 3DKYA 3K0LA 2E60A 2D1VA 4MLOA 3FBIB 2JUCA 1XDUA 4BXXJ 3CC2I 1XGNA 1YS6A 1P4WA 3E6MA 3RTRA 2IPQX 1H0MA 2LBFA 3GX4X 2AHQA 2DA5A 1W4MA 2P4WA 3HYIA 2B0LA 3QPHA 2IS2A 2Y48A 1U5TB 3G1LA 1ZRFA 2DA3A 3QPLA 4KYWA 5FLXZ 2AS5F 2DA1A 3ZR8X 3GMEA 1VQPI 4FQGA 1ZAOA 1FY7A 2LNBA 1R00A 5DUKA 9ANTA 4IHXA 3NRVA 3TW7A 3G2BA 2K85A 1Z3YA 1ETWA 3SEQA 2HQ5A 3FK7A 2HGCA 3P7NA 1OYIA 3DCFA 4DIQA 4A3CJ 2Z9OA 3H5AA 3O8GA 2W1OA 4BYYA 1YRNA 3S2HJ 1ONVA 4CYCA 2KQRA 4H0EA 4EGZA 3SFZA 2GXAA 4D7NA 1U5TC 1X4PA 2V9PA 3GBGA 1T38A 2CUJA 2N8GA 1U78A 5E1WA 4IO9F 2HVRA 1AU7A 1G6NA 2EA4A 2VN2A 3BG6A 2EFNA 3GLXA 5E18F 1R22A 4M72A 3WHCA 4LG0A 1FYMA 1NTCA 2KT0A 4V2FA 2QUFA 2K4BA 1DPRA 4PDKA 5KAFC 4O5VA 4OINF 2GZWA 4MFDA 3J81K 1MJ9A 4JX6A 5FFZA 3UNGC 4WWCA 4RGRA 5ED4A 2CUZA 3LWFA 3A01B 4YG2F 2DA2A 1E3PA 1EH8A 4MQ9F 3RKQA 2XRNA 3E5UA 4OAYA 3WU2C 1IGNA 1X4OA 4HQMA 3S1QJ 2XAHA 1O3TA 1U9NA 3S3NA 3JAMZ 1BM9A 1SD6A 5ILSA 2JUGA 3B73A 2V7FA 3L2UA 3VWBA 3ECHA 3A03A 2IRFG 1RETA 1I3QJ 3VYRB 4XLPF 4EJOA 4EJTA 2IBDA 3KLOA 1F5TA 3W2VA 5JI6A 2EZKA 2NAZA 1BL0A 2ISYA 2YS9A 4XN0A 2OTLI 1KONA 4IHWA 1LFBA 5KCMA 3PQKA 1ZG1A 1D5YA 1D0YA 2DBBA 3KZYA 5J47A 1I5ZA 2AQFA 3M8EA 3RYRA 2R7FA 3PNTA 1LJ9A 2X9DA 2OU2A 2I10A 4XSZF 1YJNI 4BJ6C 3V7RA 1X3WB 1YW8A 2HOAA 2HQAA 4RB1A 2IS4A 3CESA 1GXPA 3W6KB 5JVGF 4XIDA 2DK5A 1UCRA 1FTZA 3CCLI 1OLTA 4PZJA 2FQ4A 1ZYRF 5JHFA 2F4OB 3HOSA 1POGA 1HDPA 2P7VB 1XMKA 1IN7A 1X58A 2XUBA 3KIOA 1R5ID 3IP4B 3E7LA 1B72A 4AM3A 4XOPA 5ICGA 1R5GA 3KETA 1UG2A 3CMYA 2YX7A 3BTCA 3F3XA 1XGMA 4WXHA 1G3WA 5GAEJ 4I2OA 3Q0VA 3MVPA 3FXQA 4AYBA 3J7AO 1FT9A 2G7HA 4ZDLA 1FX7A 1FMWA 2MA3A 3ABKH 3F21A 3ZQGA 1R4MB 4XKCA 2EFWA 4Q4ZF 4BS9A 3GTGJ 1ZK8A 3ZQQA 2VT3A 1X1BA 3FISA 2E5NA 3C3WA 2LBFB 3RCOA 3DBRB 3CJTB 2LLKA 3WG7H 4OOIA 1KU7A 1D3YA 1QGPA 3T8TA 5BOXA 1D0ZA 1Z21A 1IW7F 1OCCH 4NB5A 2IT0A 4JOMA 3LA7A 1FMVA 3CP2A 3RPQA 1TQPA 2JWTA 4BBSJ 2QBYA 3GFJA 1I3AA 2MW8A 1IUFA 4O3MA 2M34A 1ETVA 3CMMA 2O3FA 4ENNA 2M4GA 3DTIA 4G12A 4A5NA 2X0LA 1LE8A 2EIMH 2E35A 4G94A 5F0FA 1YRNB 3WTTC 3JRHA 4CYCB 2L9NA 2X6OA 4L0ZB 1OYWA 4LFUA 4F52A 1XS9A 5LHHA 3CLQA 4RLFA 3SYTA 4DQ2A 2DT7B 3J7YJ 1TC3C 1U2WA 3S15J 1T0FA 2Q0OA 3CCUI 1L3LA 3MZ8A 3OOPA 1FYKA 2PLYA 4IEJA 4J19A 4LG0B 3OYDA 2VASA 2OZUA 4F7ZA 2X6XA 3E3VA 2RC4A 1FIPA 4PGHA 4QTRA 4R8HA 2R0QC 1FSHA 2CMPA 4M3FA 4RB0A 4B3XA 3HDDA 3FDYA 1GDTA 5IYBJ 2IW5A 3LSJA 3M1CA 2BXYA 4ENMA 2Z2SB 4LMYA 3A2KA 2V6EA 4CXFA 2G0EA 2MD0A 1IN6A 2Y2ZA 4PSXA 4IX7A 4W1UA 3BCAA 2NRAC 2M8GX 5L3FA 1QHHD 1CGPA 2DFHA 1LVKA 2DK8A 4B43A 1VQOI 3KZIC 1PVEA 1IZ1A 4XOTA 4HF2A 2FBIA 4M3BA 2DFFA 4BY7J 1RC9A 5J3LA 2HR3A 3SDGA 1S5LC 1WI9A 2HTSA 5FROA 2W4SA 2WV0A 2W85A 2DJIA 4RGUA 3WE2A 4WXDA 3EETA 2FOKA 3TOBA 2MD5A 1S7OA 2F5VA 4C3JJ 2ZMEA 4E4HA 1RZ4A 6PAXA 2O61A 1ZTRA 1JHFA 3E1SA 3F8FA 3FX3A 5FO5A 5H6RA 5M3MJ 4IQJA 4IPAA 2OJED 4UB6C 4C3IJ 1BJZA 4WX9A 3OYAA 2F5DA 3HOWJ 1VFCA 3LSGA 2BXZA 4ASNA 1SFEA 3G1MA 1VTNC 2L0KA 2LOOA 3LQQA 2DYRH 2D45A 2XVCA 4UVAA 4D1QA 2HKOA 4PGGA 2L7KA 3I71A 1HKSA 3HKZA 4M9ZA 3CC4I 3IWZA 4BJ5C 1WWXA 2LMDA 1B72B 3G73A 2Z16A 3BJ6A 3EYYA 1YFHA 2FSWA 2EPFA 2L9RA 3DKWA 1MBEA 1O57A 2P6SA 1R23A 2BZTA 3TBIA 2H8RA 4CUGA 1V4RA 1RIOH 5HLIA 2XAQA 2Y69H 3JRAA 1HLVA 2CO5A 2BY1A 3ZQHA 1YO5C 2A3SA 5BNGA 5A2QZ 2W57A 2TRTA 2AXTC 2A6EF 1YQAA 3Q0UA 3GYHX 4OMYA 2IGMA 2MGQA 2JA7J 1HOMA 2GXGA 3OIPA 2KHMA 1FOYA 1XSXA 4A12A 3GVAA 5IYDJ 5AIPA 2PMHA 2Z1DA 2ZBKA 3TP0A 3JTGA 1CF7A 3L1PA 3KFWX 2VKHA 2WB1N 1ZELA 3CLOA 1R1UA 4BBRJ 2IGKA 3MEXA 1SMYF 3IAS2 3PM1A 3K4MA 1XCVA 2V4JC 5ICCA 1DP7P 2MH2A 4GYIA 4A3DJ 2OPTA 2VPRA 3RKWA 1YTYA 1LE8B 3OSGA 2BW3B 5EG0A 2OF7A 4D7MA 1K6OA 1ON1A 2XDVA 1A04A 2RVCA 2WTEA 4HLXA 1Y0UA 1E3HA 2F48A 3E97A 2MC3A 3L2WA 2HYFA 2E1OA 1B6AA 2X85A 2JSCA 3NAUA 1LDJA 1PJRA 2IP2A 4Q48A 4PK4A 3HSEA 4XQFA 1OCRH 3BTIA 2YSRA 1SFXA 4DW6A 3BG7A 1UB9A 3L2RA 4OMZA 1ITYA 2ESNA 1JUMA 1YW9A 2HOEA 1ZGAA 2IEKA 5FKKA 4A3LJ 2Y0MA 2VBYA 5JVTA 2HDWA 5GADJ 4FTHA 3ZCOA 3ZQCA 3BZ6A 3QWLA 2XASA 3KP7A 4UB8C 3ZPLA 1Q1HA 3GFLA 1HW2A 4UXNA 4MTDA 1TT0A 2ZJQF 1T0FC 1WFXA 4BHCA 2NVTJ 2PEXA 3H92A 1EKEA 5E1ZB 3A4CA 2RKHA 2ZXHA 2F5FA 3F8MA 3DLLF 4JYKA 2Y0SA 4F93B 1OJLA 2EK5A 4BKXA 3IAM2 4YFNF 4P55A 4HBLA 3PIOF 4M73A 3V7SA 2EIJH 3B02A 2LH9A 3R0JA 2FF4A 2ZMEB 2X6YA 3HEFA 1TT5B 3S8PA 4CCNA 3OIQA 2Y75A 3EQLF 2P0WA 1IN5A 1IO2A 1BR4A 1QZZA 1MBJA 4E6KG 2O9LA 3FMQA 4A69C 1P7IA 2LP0A 2VKEA 4I98B 1OCOH 2ZC2A 1O4XA 3F0CA 3TO7A 3ZMTA 1AWCA 2R7XA 3FKJA 3D5RC 3QRFF 3LFUA 3GTKJ 1YJWI 1DPUA 3O8HA 4E7KA 4CZCA 4IRGA 5JLXA 2H94A 3OYIA 1I1GA 3CCYA 2F5EA 5K5RA 3D1NI 2ZMEC 3LQRA 3FHNA 4LK0F 4BEHA 3T8RA 4S04A 2VOOA 1N25A 3LA3A 4ZYGA 3FXOA 2KP6A 1XGOA 1BOBA 3E6DA 3ZMSA 1Z7UA 5HVQC 1WHUA 3E0JB 1BI3A 3V42A 1DP3A 1W36D 1O3RA 1YS7A 2NNNA 5JR3A 2PMZA 3VYSB 2JN6A 3CJQB 3FXMA 2DU9A 1TWCJ 4EJVA 4N0BA 5TJJA 4HAMA 3FK6A 3SFIA 4AC0A 1T2KA 1CF7B 3GZ5A 1KYWA 3GZNB 2R4GA 3J80Z 1WQ2A 3ERED 1JKQC 2XHKA 2HZDA 2UXXA 1B4AA 2VJJA 3CJNA 4IL6C 3RKXA 1IV8A 2DDBA 2Y31A 1R49A 1B59A 1Z77A 2KZGA 4ZDPA 4BACA 1JKPC 3OYEA 2F6CA 2VBWA 4MTEA 2DMNA 4IKFA 3Q3SA 1MH3A 2BHYA 3WU1B 3K4KA 3BG3A 4HX4A 2E2HJ 2KFDA 3R0AA 1EH6A 5EG0B 3LOCA 5JFRA 4OIRF 4Q5SF 2XPVA 3HM5A 4AVPA 3BTLA 5ILVA 1IAWA 1UFMA 3ERMA 4E7LA 3KP3A 3OR1C 3QP6A 2Z5UA 3J7ZI 2A61A 2YUSA 2L4MA 2XAJA 2B7EA 1SC7A 3IL2A 1W5TA 4BH9A 3FXKA 4ESBA 4U7DA 4HEA2 1B1BA 3QPTA 5F04A 3ZXSA 1EH7A 5KHDA 4E7SA 1UG0A 2OV7A 2VJ4A 2CJJA 3DU6A 3K4JA 3TP3A 1YIJI 2K9NA 4RLQA 4XN3A 5J8CA 5B5EC 1S9HA 1QHGA 3S14J 4MGRA 5CLSA 3OYGA 2DPUA 1R1VA 4KITB 2VLAA 4IHVA 5HODA 3ZGKA 3O3KA 2VOPA 1XX5A 3B6CA 4A0YA 4UUTA 1P2FA 1EA3A 5DDGA 2VB6A 4P9FA 5BQTA 4I7HA 3HRMA 3WTXC 3TEDA 4XRFA 1KA8A 3AG3H 4HNVA 2DODA 3ZQFA 5H2FC 4JK1X 3PSIA 2E1MB 1WJEA 5D5XB 3WE3A 3F8NA 3KYLA 1QQIA 5EZHA 4M6XA 3HL2A 2LY1A 2V1NA 2ID3A 3JRCA 1MMDA 1SMTA 2KL4A 4JX4A 4BJTA 2FRHA 2L7ZA 2Y9ZA 2HYJA 1BI2A 3HJEA 3VEPA 1SANA 3W2AA 2DA6A 2CQ7A 2EV0A 2R7VA 3DPLC 4NDLA 4LK1F 3BQYA 3V8LA 2VQCA 5DS9A 2G7UA 3HPGA 4E70A 1XD7A 4M6YA 3AFHA 5HS9A 1H9GA 4EM2A 3BG9A 2K3PA 2K4JA 4DBRA 1BBYA 2E1MC 2QQAA 2R7DA 2DTRA 3Q0WA 4U0VA 1PP8F 2I8DA 4GYGA 5HS8A 1MGTA 2QF7A 3WG9A 1HW5A 4S05A 4HSRA 5TRDA 3R60A 2MYSA 5EDNA 3F9KA 5LHGA 3I4MJ 4OU0A 4YIFA 3F72A 4LB6B 4A6EA 2ZKZA 4EGYA 1HA8A 4HG2A 2GM4A 3BCBA 4BEHB 3KEOA 3LSRA 4XLHA 2JA2A 4M3EA 3DPTA 2MH9A 1N78A 3QPSA 4ZC3A 3QP5A 3H5RA 2QEXI 3GUDA 2R3SA 4IOCF 1SD5A 2FNPA 2JRMA 3OV8A 1JUSA 2EZHA 2ZSHB 3LMMA 3BC8A 3DBHB 2VIXA 4PJLA 4A3EJ 1OCZH 1P7JA 2W25A 1DGRM 1I1SA 3MD2A 1OQYA 4AIKA 4FASD 2OQRA 2H8WA 1TTYA 4YIRX 3CMAI 1V55H 3HGGA 3P9KA 3RQIA 2P5KA 4ZTJA 4FISA 1AOYA 4Y13A 4EEFG 2BE5F 2KRCA 3FIWA 3V8JA 3SZPA 3CC7I 2VQLA 2EH3A 3GFIA 5EF6A 4WK8F 1UAAA 4CCOA 1XGSA 1DQUA 1KZHA 1WSUA 1U0JA 2AXLA 2CQNA 1V5GA 3RYPA 2ZFWA 4ZYDA 1TQIA 3K7AJ 2STWA 2UUZA 5FD5A 2L7MP 3K1MA 4EJUA 4A3IJ 1K4TA 4L9NA 4L0YB 5LEKA 1R9TJ 2YX4A 4AWXB 2NXNB 4D5FA 1SFUA 2K86A 4XONA 2MLKA 4CZZA 5HLHA 3ISPA 2Z99A 3U1DA 2GWRA 2XROA 1HSJA 3LSIA 5JHUA 3E6BA 1G3SA 3AKZA 2GIZA 3EDPA 3PQJA 5F27A 2O8XA 3PNYA 5E3LA 4KA4A 4HQEA 2DMPA 3GWZA 3HZJA 1PP7U 3JAMK 3I0TA 4BNCA 4RS8A 4BQAA 4EJWA 2M7BA 3I59A 1WJBA 4CCMA 2ELJA 2V9VA 3OYBA 1X3ZB 2GA2A 3I54A 4BDYA 2DDAA 5HNFA 4Z6YA 1B8IA 2FA5A 1U8BA 1W36C 3CCMI 1VQ7I 3C7JA 2HKXA 2PMUA 3IRQA 1ZGWA 1VQKI 4PJ0C 1WH5A 4D5CA 1VQ5I 3IHUA 1FOWA 2L7FP 3WTZA 1F1ZA 2CH0A 4WF2A 1NH3A 1RUOA 2DPDA 3J81Z 1VQ4I 3PUFA 5FGMA 4KJZA 5DM6F 3VPRA 1LDKB 1FWZA 2DOEA 3DPUA 3A1YA 5ERIA 4LG3A 5CVRA 3RKYA 4PCQA 3G71I 2CV2A 3HTSB 4KDPA 2KMUA 2XKPA 2IS1A 4AUXA 3ABUA 5TISC 5J4YA 4QPOA 2R7QA 2P7CB 1RKTA 3KP5A 5AONA 2XAFA 1AA7A 3GEZA 2RN7A 2DMQA 3G3ZA 3DF8A 3OL3A 3PSFA 1PDNC 4IRIA 3QAHA 4B4CA 4L5EA 2VL8A 3OR2C 3BJAA 1XPXA 2DFEA 2K9LA 3MN2A 4A3JJ 4IHYA 5BPDA 4FT8A 1A6IA 4BE2A 1FBUA 2XGDA 1Y8RB 3N4MA 2FBKA 1D1BA 2HFHA 3P5JA 1Y0NA 5E3MA 2KRFA 1KU2A 3X2QH 1SD4A 1WPKA 2NS7A 1GVJA 2K9SA 1TNTA 1ETYA 2RQQA 4Y52J 3RQ4A 3A0BC 2NVYJ 1GVDA 5LRRA 1WGXA 5L3GA 2NVQJ 1H9TA 4PJNA 2DXIA 5LGUA 2LREA 1G4DA 2GAUA 3K9TA 3GTPJ 1SVOA 3SZTA 3EUHC 2VQHA 1MDMA 2MLGA 1S7AA 2VC0A 3PFYA 5CQGA 4IOAF 1FIAA 1RR7A 2BBYA 3WTWC 5KNLA 4C2TA 3OOUA 4DGWB 2OCEA 2STTA 1X1PA 1FOXA 2EILH 3CO7C 3MWMA 4X1EA 2DCEA 4EVIA 5CYVA 4DYCA 4I6ZA 2BV6A 3CCSI 1Z7LA 4G8XA 3M9AA 2FMLA 1E17A 4CCLA 1CQTA 3BR3A 2K5CA 2IXSA 4M74A 2ZJRF 2BW3A 4RM2A 1P4AA 1W0UA 2RQPA 2D1HA 4EM0B 2WAQN 1ZRDA 4HNTA 3CO6C 2M8EA 1DU6A 1NG7A 1MD0A 4BE0A 4MEXF 1Z91A 2P81A 3WU0A 3ZMVA 4AIDA 2LY9A 4KT5C 3K2ZA 1B9NA 1FOKA 2VE8A 2Z3YA 1W1WE 1OYYA 4BQQA 5K1YA 1YITI 1SFOJ 2COBA 3C2BA 5LEJA 1KYZA 4ETSA 3HGYA 4N4OB 3KP4A 3DEWA 3C2HA 2DMTA 3E6CC 4PFOA 2ME6A 2HEOA 3PO2J 1IV6A 2E71A 2R7UA 1M1EB 3VSKA 1VQMI 1X1AA 3I59B 2ZB9A 1BIBA 4P9UA 4E7IA 3ZQIA 1D1CA 4A3MJ 4XSXF 4IF4A 2QQ8A 2HVSA 2HPIA 3F22A 3PO3J 5J40A 3TO9A 3ZP5A 1MNMC 4L9JA 1MBGA 2XC7A 1TP4A 5GAGJ 1B8IB 3Q9SA 3GFMA 1ENHA 5LFAA 1IDYA 2KLOA 3NARA 5F1RA 3F23A 1JT6A 3HOTA 3RDIA 5IT9K 2KRHA 1LNWA 4AD9A 4C2MJ 1PYVA 4I01A 3ML6A 3HOYJ 3AL0B 2LKPA 4XKWA 5EGOB 4U0YA 4OIOF 1WCMJ 2A5WA 2CFOA 2OD5A 3ABMH 1YIOA 1GLNA 3VODA 1J2XA 4BL0B 3P9IA 2QQBA 3RZOJ 1U6GA 3TDZC 3MKLA 5F6FA 4K2EA 1WZ2A 2E2IJ 3H0DA 4FE4A 2VBZA 2QENA 1RI7A 5CVJA 2EBIA 2OQGA 5DM7F 1FJLA 1AKHA 4A6DA 2W00A 2KIQA 2ZNZA 3CUQA 1F9NA 4C30A 3DFGA 3AL0C 5DTDA 2AQEA 4HX8A 3J7AY 3H35A 2BOLA 4ZH4F 4BHBA 1T33A 3EUKL 5A2QK 4FCYA 1BI1A 5H6QA 4GFBA 4ENJA 5FRMA 2ZFUA 2XIGA 3N05A 2JPBA 2ECCA 4ZJZA 2GBYA 3PJRA 2V1UA 1L0OC 1ULYA 2CV1A 4RMNA 1A31A 3OS0A 1GUUA 4V2GA 2FX0A 2R7WA 4NBQA 1X3UA 3WGGA 1USTA 4ZYEA 3L2QA 3GZ6A 2EFPA 3OY9A 3S3MA 2COMA 3BPXA 3FMRA 5CVIA 2EV5A 4RM3A 4RAZA 2EFQA 3FBNB 3WGHA 1ERDA 5GTHC 4U7BA 1IRZA 4IRHA 2A6HF 3BY6A 2LC2A 3RIRA 1MDMB 4G6DA 2FMYA 2E34A 2NVXJ 4EQQA 3LAPA 2E7XA 3KP2A 4L9VA 3D5LA 4HF1A 3SDBA 2BYVE 2WBMA 5LBQA 3HBLA 4HZFA 1VQ9I 2R5YA 1V54H 3FXLA 3R4KA 4KN4X 3LSTA 3LSPA 1HXDA 2EWNA 1ZKGA 2W84A 1OFCX 5E8GA 1SAXA 5M5WJ 2CUFA 2HVQA 1XCBA 4XNFA 2M2EA 4E7ZA 4NC6A 1IRXA 4B48A 4HV5A 2VODA 2VBXA 2ID6A 1X2NA 2IGNA 3F6OA 5DYMA 3G6EI 2VQGA 4DYQA 4I99C 2MBFA 4UUSA 3HC7A 2CRGA 1FNNA 3GCMA 4HF0A 2R7RA 1ZARA 2DI3A 2ZJPF 3K1NA 4M71A 3V7CA 2H1LA 1GT0C 2X51A 4FE7A 5LHIA 5HS7A 1ZLKA 5L3CA 3GLLA 1I27A 1X2MA 1GXQA 3K70D 2M4KA 2QYOA 3F8CA 2EB7A 1ETXA 2MC4A 3BTJA 5DUIA 3IV5A 5CVVA 1BW5A 2DFIA 4YIIA 2VC1A 4J00A 2BGCA 1YX3A 1KU3A 2M9HA 3CTAA 4DNCA 4ZTFA 1J5YA 1HQCA 4DBQA 5BS6A 1KQ0A 1ETOA 1ZHFA 2JQ7A 2ELHA 2VT2A 3HB9A 3BR2A 1YG2A 4KT6A 1F4KA 1WKMA 2JVHA 1WRJA 1ON2A 1FZPB 3CMEI 5D5UB 3OYFA 3RSNA 1UMQA 2YPRA 2XRLA 2DQRA 3BJOA 3I53A 3JW4A 4M9SA 1UHWA 1H88C 2XSJC 1RNLA 5FB2A 3ESWB 4B44A 1MMSA 3FM3A 5IOZA 1R1TA 4NUBA 2ICWG 1Z6RA 1S8NA 5LLQA 3WTSC 2DMUA 1UJ8A 3CCQI 1ODDA 2RNGA 1J7KA 1GHCA 1HW1A 2ECBA 2CGPA 4IHTA 1X19A 2A68F 4FETA 3C18A 5E8IA 1AKHB 4WCGA 1R7JA 3VYUB 5IT3A 1G59A 3CUQB 1WJDA 2XF7A 4XLCA 4YELA 2DJNA 3K4BA 1QPIA 4P5OA 1E3OC 5B1BH 1Y6IA 4G7ZF 3AAFA 1MZBA 1YE9A 2HNHA 2KISA 1J09A 4U0WA 3KYDB 3W6JB 5EEAA 2ZSIB 1W5SA 1LPQA 4UHTA 3U2RA 1D8JA 3ZQLA 1DGWY 1HBXG 4AYBN 1B9MA 1FPQA 1K6YA 1U9OA 4N9IA 2XKOA 2QSHX 3S93A 4A2UA 3NEUA 2K02A 3GTOJ 3BZKA 1QA6A 3H1CA 3JCUC 3QU6A 3CUQC 5F64A 1JGSA 4LOCA 4U88A 2X4HA 3SQNA 3TKYA 1EF4A 2NVUB 2E19A 1GV5A 4KN7X 3IRRA 4BE1A 4OAZA 3CZ6A 2DTZA 1YHQI 3O6BB 1IUYA 3ZRGA 5K5QA 2LKSA 3M7GA 2O6GE 3TL4X 3GTJJ 1JTXA 3QYEA 2FQ3A 3L09A 2DOAA 1XSDA 3ABTA 4KIFA 2R5YB 3HUGA 1R4NB 3CQZJ 3K6GA 3OMYA 2UXNA 2W24A 3FXRA 2W82A 4NHJA 5LD2C 3OYMA 3FM5A 4HOBA 3S2WA 2R5ZA 3WGIA 4QSHA 3WODF 1LEBA 2BY0A 2VUMJ 5D5WB 2TCTA 1ZLJA 1TWFJ 2WWYA 3TOAA 4CICA 2ADUA 4HV6A 5GTIC 4UUSB 1FC3A 2HOSA 1MW7A 3HTUA 2LG4A 1K61A 5CJ9A 2H09A 2EZLA 5EJCA 5FLVA 2EQRA 2EFOA 4FHTA 1XB4A 1R5HA 5D8LB 2V6CA 1HDDC 3K2AA 2K9QA 2WY7Q 2CUEA 4M9XA 3JRIA 3I3LA 1S3JA 1KQ9A 2P8TA 1MNDA 2VXZA 2K27A 1PUFA 5LGTA 2A07F 2I5UA 3KX2A 4NQWA 4XICA 5HDKA 2PN6A 3BT9A 2DA7A 1DDNA 3H5NA 2JZYA 4XRSA 3JRFA 2K3FA 1RRJA 2J5PA 5J1YA 2FBHA 2M87A 2KDOA 3ZMDA 4L5IA 4I09A 2ZJ2A 1BR2A 1SD7A 4MO7A 3IUOA 4C9YA 1IC8A 3LSMA 1FLIA 1WH7A 4CYDA 4JX5A 2QA4I 4KIGA 5IYCJ 3TDUC 2V1DA 3K4CA 1MBHA 2KZVA 4HA8A 2EJRA 4EM1A 2R7OA 1BA5A 1F43A 3MMYB 2PFBA 2LK2A 2GLOA 4HPQA 1Z0XA 5ICEA 1BOAA 4UUVA 3FWEA 2CU7A 3I9V2 5J1RA 1G3TA 1J59A 3ABLH 1SFKA 1QU3A 5FKMA 1Q1VA 3EUHA 2HWVA 1E2XA 4D0PA 5FFXA 1U3EM 3VFZA 5IPAA 3BR5A 4UVBA 3H9QA 3HKZN 2XSDC 1IRGA 5E20A 5AIQA 3DXJF 2PQ8A 2K9MA 3HOVJ 1HC8A 1V5FA 3K70C 2BHZA 2CQXA 3RPUD 1XMAA 3DV8A 3TGNA 2LD5A 3I58A 2W48A 1Y39A 2ZO4A 3WTVC 4RB3C 3H3UA 4F92B 5IY5H 1MMGA 5HDNA 2JSPA 4O6JA 3HOUJ 2Q2EB 4B09A 1XDSA 3I5UA 2H1KA 4FX4A 5FLXK 1E0EA 3T1BA 3OYNA 5KK1A 2A69F 4Y17A 1NHAA 1UELB 2PJRA 2L3DA 4HSTA 4UV8A 4HW0A 2CQKA 2NOGA 4KIBA 2DO7A 1IN8A 2YU9J 1ZRCA 2P5VA 2XGCA 3A0HC 3KYCB 3LA2A 2BEOA 3FXUA 3VYTB 4NC8A 3ZN0A 4XLNF 3M8FA 4NC7A 1LKXA 2GXBA 2KIUA 3RPUA 5FRNA 4CDGA 4Y3OA 4AIHA 4Y15A 1DU0A 3UKGA 2KIMA 4EMSA 4Y33A 1T08B 1ZN2A 2KKOA 4F55A 4RDUA 1K4SA 1REPC 3E5QA 2E36A 3I4PA 1FTTA 5D8KB 3HUGB 5B1AH 2JVGA 1P4XA 2BVMA 3PL8A 3MAJA 2DLLA 2WB1A 2O7OA 2XB0X 3OYJA 1WJFA 3D0SA 4XM3A 4BAYA 4RB2C 3L2VA 2LR8A 2R5ZB 3OSFA 1BC7C 3CF2A 3GTMJ 1VZ0A 3A02A 3OYKA 3BR0A 4XKBA 3DTKA 2W7NA 4G7OF 3CDIA 4DZPA 3EPZA 1FSEA 1J9IA 4ENKA 1I50J 3BPVA 2VPLA 4F91B 1A36A 1R36A 3FZVA 4BDZA 1MSEC 2HPMA 2B9SA 2L9SA 3BG5A 3JSPA 2XB5A 1JKRC 1W7PD 3HHHA 2O5RA 3B6AA 2QM3A 2RREA 2O0YA 2OCCH 1ETKA 2LKXA 3VDXA 3CP8A 2ETHA 1ZG3A 1ACIA 3MQ0A 2DQLA 3FKIJ 1PUFB 2K7LA 3ZN1A 3U1KA 1LB2A 1VQ8I 1IDZA 4NQWB 3ASOH 1A6QA 3QODA 4M3GA 2IA0A 3M4OJ 1P92A 3DLAA 3KP6A 4XRMA 5E79C 4XKVA 5GAHJ 1S72I 4H4KC 1YI2I 3GTQJ 2JK3A 3GO5A 2QSFX 2CWEA 2M45A 2LSOA 2R92J 3S17J 3TW6A 3ZQ7A 2GIVA 5DCMA 5EGOA 3M3YJ 3OIOA 3C1DA 5GP9A 1X1DA 2A5YB 2FXAA 2MFZA 2Y0SN 2JRTA 3LSHA 5HLTA 1O7FA 4BXUA 5TGTA 1W7PA 1KQ8A 2QCOA 2AO9A 5EEHA 1HKTA 4JP0A 1OKRA 2IJLA 2GOMA 5LGNA 3OL4A 4YRVA 4I76A 5F0HA 3JRBA 3MZHA 5CPRB 4XLEA 3T0YA 1VNDA 2FNAA 2OA4A 4MQVA 3H3VK 2XF5A 2CYYA 3CDHA 4P96A 3JRGA 2RAEA 3FXJA 3CCJI 2JMWA 1XMXA 4KICA 3V4GA 1OCPA 3ZMUA 3G1OA 3HPHA 3KPHA 3M8JA 5J1UA 2XV4S 5DEQA 4MHGA 1TW2A 2GQQA 1TWGJ 4JQFA 1V5EA 3PUBA 5EZGA 2NOJB 3UR3C 3BOQA 1MMAA 4AVZA 2DW4A 4X6AJ 1YYVA 2GOXB 3ELKA 2BY2A 3KZZA 4QLCU 3CCVI 2OAZA 3MZYA 2JT1A 2ZCWA 2LVSA 4KISA 1OPCA 4JBAA 4G7HF 4LB5A 2A05A 1I6XA 1N75A 3DEEA 4XL9A 3SHFA 1LEAA 1Z1DA 3H3ZA 2IAIA 2NYXA 2LF8A 2LDUA 4B3AA 2HS5A 5DD8A 3WTUC 3G4SI 2EZIA 2XAGA 2PJRB 4IVNA 4RA2A 4BHPA 3NQOA 4A3BJ 1TWHJ 3EUAA 3K1PA 5FKNA 2V9KA 4CHUA 1IF1A 5M3FJ 1QVTA 1I6HJ 1IRFA 3VOEA 1TW3A 2UWMA 1MBFA 2PMZN 4ZZLA 1YX5A 4ZYHA 3S2DJ 2V26A 2XF6A 4DYRA 2QLZA 1U8RA 4CCJA 1Y8QB 1WI3A 3L00A 3IKVA 3IKTA 2CFXA 2VI6A 2EINH 3MFKA 5E1XA 2PBIA
chains in the Genus database with same CATH topology
2Z33A 4N9HA 1JE8A 2VE9A 4HDUA 5J6XA 3T5XA 1BN5A 2UZKA 4G9YA 5KVRA 3F8BA 3GW2A 4LLGF 3IWFA 4GXOA 1UHMA 3V8KA 1TBXA 4OIPF 3SXYA 4A0XA 1TLHB 1ZG5A 3TO6A 3RJPA 2FEZA 5L3BA 2ZNYA 1FP1D 3FMSA 4LLNA 4CO8A 3GF2A 4RGSA 3L2CA 4LLLA 3L9FA 4HDVA 2KJCA 1ZH5A 3HIFA 4KFCA 3HRUA 2FE3A 2ACJA 1K79A 2L54A 2E7WA 3FF5A 2H6CA 2IA2A 5D6EA 1FBSA 5D4SA 4YFKF 1S6LA 4R1HA 2HQRA 2EV6A 2QQ9A 1D8KA 3F6VA 2QVOA 2IVMA 5L3EA 5E17F 2HZTA 2HYGD 5DCMB 2F5CA 1Z6TA 1BJAA 4GGGA 1JHHA 2NNYA 1W7PB 3JTHA 4KNYA 4L5JA 4UVCA 2XGXA 5FD6A 3N97A 1T6SA 2M30A 1EV7A 1T39A 2OZ6A 4WXCA 5IT9Z 1OR7A 5DCFA 2L01A 4KUMA 3HRSA 4RGXA 4MNUA 2DT5A 2GA1A 1T98A 2C6YA 5H20A 2TDXA 5HDGA 1FBQA 4Q47A 2QWWA 1TNSA 3ULQB 5J8FA 5DD4A 1QPMA 1BIAA 3Q9VA 4HX7A 1O3QA 2E1NA 1DUXC 3FHZA 1J75A 1USSA 1IXRC 1HSTA 4UV9A 3DQVC 2CG4A 2EA2A 1LVAA 1OMIA 1Z9CA 1PUEE 3U9GA 4ZZDA 3L7WA 2YU3A 5ILUA 2KJBA 3ECOA 4IJAA 3BROA 2QBYB 3KCCA 3BP8A 2KIFA 4FX0A 3BWGA 5D5VB 1MJAA 3Q5FA 3HSRA 3K69A 3REOA 2V79A 4I02A 1HKQA 4R79A 4HLYA 3LFKA 2O03A 4IXAA 3LAJA 1K78A 4KMUX 4B8XA 4I0BA 5K5OA 3VB2A 1C0WA 2RV8A 1LQ1A 1R58A 3HSFA 1G3YA 1YW7A 2P5LC 2Q8KA 2CSOA 4ON0A 4EV0A 2H6BA 5CVUA 4TV7A 3P9CA 5D4RA 3KEQA 1ZREA 1LDDA 1KU9A 2PG4A 4AIJA 3HHGA 2RDPA 4A0ZA 2LF7A 3M1EA 3E5XA 1BC8C 2RNJA 2OBPA 5ICFA 2HDCA 2YR2A 4ESFA 2Q2EA 2WC2A 2J5OA 2L4AA 1IXSB 1ZGJA 2ZXJA 2JTVA 2PJPA 1Z05A 1FYLA 4GCVA 2F2EA 2HQNA 1QZYA 3QU3A 3GXOA 3J80K 3PFIA 3MCZA 5L3DA 3DP7A 3JSOA 5EEGA 1O7LA 2DAOA 2E1CA 3CUOA 1U5TA 4YFXF 4ESJA 4IHSA 3HRTA 2RGVA 2QZ8A 4KMFA 2L02A 5LRSA 2H27A 3DEUA 3KE2A 3ROUA 1YLFA 4RAYA 1BI0A 1K7AA 4Z2YA 1RUNA 3ZMZA 2FU4A 5BPIA 4UNOA 1TQMA 2HTJA 4MEYF 2D2WA 1QBJA 2ISZA 3I64A 3EYIA 1IXCA 2NS0A 2ESHA 1O3SA 4L9TA 4XBFA 1KGSA 3O2PE 1K78B 4QWQA 4LJZF 4LGWA 1V3FA 4LD5A 4L18B 4GO1A 1STZA 4HYEA 1FP2A 3BDDA 1MJBA 4G6QA 3WTYC 2M1BA 5D6FA 1D5VA 3R61A 1S29A 3COAC 2G9WA 1XN7A 4I0AA 1P6RA 4A5MA 2IA1A 2VONA 4OIQF 2PI0A 5BMZA 5HLGA 2M5WA 3TQNA 1QO0D 3R6SA 1XSVA 2V1XA 5DV5A 1JXSA 5HOOA 4CGZA 2JPCA 3KLNA 3IC7A 1MKMA 2CW0F 3QOPA 1J0RA 1QNTA 1IN4A 3RI4A 2P6TA 3K0LA 2D1VA 1XDUA 1XGNA 1YS6A 1P4WA 3E6MA 3RTRA 2IPQX 1H0MA 3GX4X 1W4MA 2P4WA 3HYIA 2B0LA 3QPHA 2Y48A 1U5TB 1ZRFA 4KYWA 5FLXZ 2AS5F 1ZAOA 1FY7A 2LNBA 1R00A 5DUKA 3NRVA 2HGCA 3P7NA 1OYIA 2Z9OA 4BYYA 1ONVA 4H0EA 4EGZA 3SFZA 1U5TC 1T38A 1U78A 5E1WA 1G6NA 2EA4A 2VN2A 3GLXA 2EFNA 5E18F 1R22A 4M72A 4LG0A 1FYMA 2QUFA 2K4BA 1DPRA 4PDKA 4O5VA 4OINF 2GZWA 3J81K 1MJ9A 5FFZA 4WWCA 4RGRA 5ED4A 3LWFA 4YG2F 1EH8A 4MQ9F 2XRNA 3E5UA 4HQMA 2XAHA 1O3TA 3JAMZ 1BM9A 1SD6A 5ILSA 3B73A 3ECHA 2IRFG 4XLPF 4EJOA 4EJTA 3KLOA 1F5TA 5JI6A 2NAZA 2ISYA 1ZG1A 3PQKA 3KZYA 2DBBA 1I5ZA 3M8EA 3RYRA 2R7FA 1LJ9A 2OU2A 4XSZF 3V7RA 1YW8A 4RB1A 1GXPA 3W6KB 2DK5A 1UCRA 4PZJA 1ZYRF 3HOSA 2P7VB 1XMKA 1IN7A 2XUBA 5ICGA 1R5GA 3KETA 2YX7A 3F3XA 1XGMA 4WXHA 1G3WA 4I2OA 3FXQA 3J7AO 1FT9A 2G7HA 1FX7A 2MA3A 3F21A 2EFWA 4Q4ZF 2VT3A 3C3WA 4OOIA 1KU7A 1D3YA 1QGPA 3T8TA 5BOXA 1IW7F 4NB5A 2IT0A 3LA7A 3RPQA 1TQPA 2QBYA 3GFJA 4O3MA 2O3FA 4ENNA 4A5NA 2X0LA 4G94A 3WTTC 4L0ZB 1OYWA 4LFUA 5LHHA 4DQ2A 1U2WA 1T0FA 2Q0OA 1L3LA 3OOPA 1FYKA 2PLYA 4LG0B 2OZUA 4F7ZA 3E3VA 2RC4A 4PGHA 4R8HA 1FSHA 4RB0A 2IW5A 4ENMA 4LMYA 4CXFA 1IN6A 2NRAC 5L3FA 1CGPA 2DK8A 1IZ1A 4HF2A 2FBIA 2HR3A 1WI9A 2HTSA 2WV0A 2W85A 4RGUA 3WE2A 4WXDA 3EETA 2FOKA 3TOBA 2MD5A 1S7OA 2ZMEA 1RZ4A 6PAXA 2O61A 3F8FA 1JHFA 3FX3A 5FO5A 5H6RA 4IPAA 4WX9A 2F5DA 4ASNA 1SFEA 1VTNC 3LQQA 2D45A 2XVCA 4UVAA 2HKOA 4PGGA 3I71A 1HKSA 4M9ZA 3IWZA 1WWXA 3G73A 3BJ6A 3EYYA 1YFHA 2FSWA 3DKWA 1O57A 2P6SA 1R23A 1V4RA 1RIOH 5HLIA 2XAQA 2CO5A 1YO5C 2A3SA 5A2QZ 2W57A 2A6EF 1YQAA 3GYHX 4OMYA 2GXGA 1XSXA 4A12A 3GVAA 5AIPA 2PMHA 2ZBKA 3JTGA 1CF7A 3KFWX 3CLOA 1R1UA 3MEXA 1SMYF 1XCVA 5ICCA 1DP7P 2MH2A 4GYIA 3RKWA 1YTYA 1K6OA 1ON1A 1A04A 2RVCA 2WTEA 4HLXA 1Y0UA 3E97A 2MC3A 2HYFA 1B6AA 2JSCA 1LDJA 2IP2A 4Q48A 3HSEA 2YSRA 1SFXA 1UB9A 4OMZA 2ESNA 1YW9A 2HOEA 1ZGAA 2Y0MA 2VBYA 5JVTA 3BZ6A 3ZPLA 2XASA 3KP7A 1Q1HA 3GFLA 1HW2A 4UXNA 4MTDA 4BHCA 2PEXA 3H92A 5E1ZB 2RKHA 2F5FA 3F8MA 2EK5A 4YFNF 4P55A 4HBLA 4M73A 3V7SA 3B02A 3R0JA 2FF4A 2ZMEB 2Y75A 3EQLF 1IN5A 1QZZA 3FMQA 4I98B 3TO7A 3ZMTA 1AWCA 3QRFF 1DPUA 4IRGA 2H94A 1I1GA 2F5EA 5K5RA 3LQRA 4LK0F 3T8RA 4S04A 2VOOA 3LA3A 4ZYGA 1XGOA 3E6DA 3ZMSA 5HVQC 1Z7UA 1BI3A 1O3RA 1YS7A 2NNNA 5JR3A 2DU9A 4EJVA 5TJJA 4N0BA 4HAMA 1CF7B 1T2KA 3GZ5A 1KYWA 3J80Z 1WQ2A 3ERED 2XHKA 2UXXA 3CJNA 1B4AA 3RKXA 1B59A 2VBWA 4MTEA 3WU1B 4HX4A 3R0AA 1EH6A 5JFRA 4OIRF 4Q5SF 4AVPA 5ILVA 1IAWA 1UFMA 3KP3A 3QP6A 2Z5UA 2A61A 2L4MA 2XAJA 3IL2A 1W5TA 4BH9A 4ESBA 4U7DA 1B1BA 3QPTA 1EH7A 5J8CA 4MGRA 5CLSA 2DPUA 1R1VA 3O3KA 2VOPA 4A0YA 1P2FA 5DDGA 5BQTA 4P9FA 4I7HA 3HRMA 3WTXC 4XRFA 1KA8A 4JK1X 5D5XB 3WE3A 3F8NA 1QQIA 4M6XA 1SMTA 2FRHA 1BI2A 3VEPA 2EV0A 3DPLC 4LK1F 3V8LA 2G7UA 4E70A 1XD7A 4M6YA 5HS9A 1H9GA 4EM2A 2K4JA 1BBYA 2QQAA 2R7DA 2DTRA 4U0VA 1PP8F 4GYGA 5HS8A 1MGTA 3WG9A 1HW5A 4S05A 5TRDA 3R60A 5LHGA 4YIFA 4OU0A 3F72A 4LB6B 4A6EA 2ZKZA 4EGYA 3KEOA 3DPTA 2MH9A 3QP5A 3GUDA 2R3SA 1SD5A 2FNPA 3OV8A 2W25A 1I1SA 4AIKA 2OQRA 1TTYA 3P9KA 2P5KA 1AOYA 4Y13A 2BE5F 3V8JA 3SZPA 3GFIA 4WK8F 1XGSA 1WSUA 2AXLA 4ZYDA 3RYPA 2ZFWA 2STWA 1TQIA 5FD5A 3K1MA 4EJUA 4L9NA 4L0YB 5LEKA 2YX4A 4AWXB 1SFUA 2K86A 2MLKA 4CZZA 5HLHA 3ISPA 2Z99A 3U1DA 2GWRA 2XROA 1HSJA 5JHUA 3E6BA 1G3SA 3EDPA 3PQJA 2O8XA 4KA4A 4HQEA 3GWZA 1PP7U 3JAMK 3I0TA 4BNCA 4RS8A 4BQAA 4EJWA 3I59A 2V9VA 2GA2A 3I54A 2FA5A 3C7JA 2HKXA 2PMUA 3IRQA 3IHUA 3WTZA 1RUOA 1F1ZA 4WF2A 2DPDA 3J81Z 5FGMA 1LDKB 1FWZA 3RKYA 5ERIA 3HTSB 5CVRA 4KDPA 4PCQA 2XKPA 3ABUA 2P7CB 3KP5A 5AONA 2XAFA 3GEZA 2RN7A 3G3ZA 3DF8A 4IRIA 1PDNC 3QAHA 3BJAA 5BPDA 4FT8A 1FBUA 3N4MA 2FBKA 2HFHA 2KRFA 1KU2A 1SD4A 1GVJA 1TNTA 5LRRA 5L3GA 1H9TA 5LGUA 1G4DA 2GAUA 3K9TA 3SZTA 1MDMA 2MLGA 1S7AA 2VC0A 2BBYA 3WTWC 2STTA 3CO7C 3MWMA 4EVIA 5CYVA 2BV6A 4G8XA 3M9AA 2FMLA 1E17A 4M74A 1P4AA 2RQPA 2D1HA 4EM0B 1ZRDA 3CO6C 2M8EA 1MD0A 4MEXF 1Z91A 3WU0A 3ZMVA 4KT5C 3K2ZA 1B9NA 1FOKA 2VE8A 2Z3YA 5K1YA 1OYYA 5LEJA 1KYZA 4ETSA 3KP4A 3E6CC 2HEOA 3I59B 4P9UA 1BIBA 4XSXF 4IF4A 3F22A 3TO9A 3ZP5A 4L9JA 3Q9SA 3GFMA 3F23A 5F1RA 3HOTA 3RDIA 5IT9K 1LNWA 4AD9A 4I01A 3ML6A 2LKPA 4U0YA 4OIOF 2OD5A 1YIOA 3VODA 1J2XA 3P9IA 2QQBA 1U6GA 3TDZC 5F6FA 4K2EA 2VBZA 2QENA 1RI7A 5CVJA 2OQGA 4A6DA 2ZNZA 3CUQA 1F9NA 3DFGA 4HX8A 4ZH4F 4BHBA 5A2QK 1BI1A 5H6QA 4ENJA 2XIGA 2JPBA 2V1UA 1L0OC 1ULYA 1X3UA 3WGGA 1USTA 4ZYEA 3GZ6A 2EFPA 2COMA 3BPXA 3FMRA 5CVIA 2EV5A 4RAZA 2EFQA 3WGHA 4U7BA 4IRHA 2A6HF 3BY6A 3RIRA 1MDMB 4G6DA 2FMYA 4EQQA 3LAPA 2E7XA 3KP2A 4L9VA 3D5LA 4HF1A 2BYVE 5LBQA 4HZFA 3R4KA 4KN4X 3LSTA 1HXDA 2EWNA 2W84A 5E8GA 1SAXA 1XCBA 4HV5A 2VODA 2VBXA 3F6OA 5DYMA 2MBFA 1FNNA 4HF0A 1ZARA 2DI3A 3K1NA 4M71A 3V7CA 5LHIA 5HS7A 1ZLKA 5L3CA 1I27A 1GXQA 2QYOA 3F8CA 2EB7A 5DUIA 5CVVA 2DFIA 4YIIA 2VC1A 2BGCA 1KU3A 3CTAA 4DNCA 1J5YA 1HQCA 5BS6A 1KQ0A 1ZHFA 2ELHA 2VT2A 1YG2A 1F4KA 1WKMA 1WRJA 1ON2A 1FZPB 5D5UB 2YPRA 2DQRA 3BJOA 3I53A 3JW4A 4M9SA 1UHWA 1RNLA 5FB2A 3FM3A 1R1TA 1Z6RA 1S8NA 5LLQA 3WTSC 1ODDA 1J7KA 1GHCA 1HW1A 2CGPA 4IHTA 2A68F 3C18A 5E8IA 4WCGA 1R7JA 5IT3A 3CUQB 4P5OA 4G7ZF 3AAFA 1MZBA 4U0WA 3W6JB 1W5SA 4UHTA 3U2RA 1D8JA 1HBXG 1B9MA 1FPQA 4N9IA 2XKOA 4A2UA 3NEUA 2K02A 3QU6A 3CUQC 5F64A 1JGSA 4U88A 3SQNA 2X4HA 3TKYA 4KN7X 3IRRA 3O6BB 1IUYA 5K5QA 3M7GA 2FQ3A 3L09A 1XSDA 3ABTA 4KIFA 3HUGA 2UXNA 2W24A 3FXRA 4NHJA 3FM5A 4HOBA 3S2WA 3WGIA 3WODF 1LEBA 5D5WB 1ZLJA 2WWYA 3TOAA 4CICA 2ADUA 4HV6A 1FC3A 3HTUA 5CJ9A 2H09A 2EFOA 4FHTA 1XB4A 1R5HA 5D8LB 2V6CA 4M9XA 1S3JA 1KQ9A 2P8TA 2VXZA 2K27A 2A07F 5LGTA 4NQWA 5HDKA 2PN6A 1DDNA 2JZYA 2J5PA 2FBHA 2M87A 3ZMDA 4L5IA 4I09A 2ZJ2A 1SD7A 1FLIA 4CYDA 4KIGA 3TDUC 2V1DA 4HA8A 2EJRA 4EM1A 2PFBA 5ICEA 1BOAA 4UUVA 3FWEA 1G3TA 1J59A 3EUHA 2HWVA 1E2XA 4D0PA 5FFXA 1U3EM 3VFZA 4UVBA 1IRGA 5E20A 5AIQA 3DXJF 2PQ8A 1XMAA 3DV8A 3TGNA 3I58A 2ZO4A 3WTVC 4RB3C 3H3UA 5HDNA 4O6JA 4B09A 1XDSA 3I5UA 4FX4A 5FLXK 3T1BA 5KK1A 2A69F 4Y17A 1NHAA 2L3DA 4UV8A 4HW0A 2CQKA 4KIBA 2DO7A 1IN8A 1ZRCA 2P5VA 3LA2A 2BEOA 3FXUA 3ZN0A 4XLNF 3M8FA 2GXBA 2KIUA 3RPUA 4CDGA 4AIHA 4Y15A 2KIMA 4EMSA 1ZN2A 2KKOA 1REPC 3E5QA 3I4PA 5D8KB 1P4XA 3MAJA 2DLLA 4BAYA 3D0SA 4RB2C 1BC7C 2O6GE 4G7OF 1FSEA 1J9IA 4ENKA 3BPVA 1R36A 3FZVA 3JSPA 1W7PD 3HHHA 2QM3A 2O0YA 2ETHA 1ZG3A 3MQ0A 2DQLA 2K7LA 3ZN1A 1LB2A 2IA0A 1P92A 3KP6A 3GO5A 2CWEA 2M45A 2LSOA 3ZQ7A 2GIVA 5DCMA 3C1DA 2A5YB 2FXAA 2JRTA 1O7FA 4BXUA 1W7PA 1KQ8A 5EEHA 1HKTA 1OKRA 2IJLA 5LGNA 3MZHA 3T0YA 2FNAA 2OA4A 4MQVA 2CYYA 3CDHA 4P96A 4KICA 3V4GA 3ZMUA 2XV4S 5DEQA 4MHGA 1TW2A 2GQQA 4JQFA 3BOQA 2DW4A 1YYVA 3ELKA 3KZZA 4QLCU 2OAZA 3MZYA 2JT1A 2ZCWA 1OPCA 4JBAA 4G7HF 4LB5A 1I6XA 3SHFA 1LEAA 1Z1DA 3H3ZA 2NYXA 2LF8A 2LDUA 2HS5A 5DD8A 3WTUC 2XAGA 4IVNA 4BHPA 3NQOA 3K1PA 4CHUA 1IF1A 1IRFA 3VOEA 1TW3A 2UWMA 4ZZLA 4ZYHA 1U8RA 2QLZA 3L00A 3IKVA 3IKTA 2CFXA 3MFKA 5E1XA 2PBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z33 A;  4N9H A;  1JE8 A;  2VE9 A;  4HDU A;  5J6X A;  3T5X A;  1BN5 A;  2UZK A;  4G9Y A;  5KVR A;  3F8B A;  3GW2 A;  4LLG F;  3IWF A;  4GXO A;  1UHM A;  3V8K A;  1TBX A;  4OIP F;  3SXY A;  4A0X A;  1TLH B;  1ZG5 A;  3TO6 A;  3RJP A;  2FEZ A;  5L3B A;  2ZNY A;  1FP1 D;  3FMS A;  4LLN A;  4CO8 A;  3GF2 A;  4RGS A;  3L2C A;  4LLL A;  3L9F A;  4HDV A;  2KJC A;  1ZH5 A;  3HIF A;  4KFC A;  3HRU A;  2FE3 A;  2ACJ A;  1K79 A;  2L54 A;  2E7W A;  3FF5 A;  2H6C A;  2IA2 A;  5D6E A;  1FBS A;  5D4S A;  4YFK F;  1S6L A;  4R1H A;  2HQR A;  2EV6 A;  2QQ9 A;  1D8K A;  3F6V A;  2QVO A;  2IVM A;  5L3E A;  5E17 F;  2HZT A;  2HYG D;  5DCM B;  2F5C A;  1Z6T A;  1BJA A;  4GGG A;  1JHH A;  2NNY A;  1W7P B;  3JTH A;  4KNY A;  4L5J A;  4UVC A;  2XGX A;  5FD6 A;  3N97 A;  1T6S A;  2M30 A;  1EV7 A;  1T39 A;  2OZ6 A;  4WXC A;  5IT9 Z;  1OR7 A;  5DCF A;  2L01 A;  4KUM A;  3HRS A;  4RGX A;  4MNU A;  2DT5 A;  2GA1 A;  1T98 A;  2C6Y A;  5H20 A;  2TDX A;  5HDG A;  1FBQ A;  4Q47 A;  2QWW A;  1TNS A;  3ULQ B;  5J8F A;  5DD4 A;  1QPM A;  1BIA A;  3Q9V A;  4HX7 A;  1O3Q A;  2E1N A;  1DUX C;  3FHZ A;  1J75 A;  1USS A;  1IXR C;  1HST A;  4UV9 A;  3DQV C;  2CG4 A;  2EA2 A;  1LVA A;  1OMI A;  1Z9C A;  1PUE E;  3U9G A;  4ZZD A;  3L7W A;  2YU3 A;  5ILU A;  2KJB A;  3ECO A;  4IJA A;  3BRO A;  2QBY B;  3KCC A;  3BP8 A;  2KIF A;  4FX0 A;  3BWG A;  5D5V B;  1MJA A;  3Q5F A;  3HSR A;  3K69 A;  3REO A;  2V79 A;  4I02 A;  1HKQ A;  4R79 A;  4HLY A;  3LFK A;  2O03 A;  4IXA A;  3LAJ A;  1K78 A;  4KMU X;  4B8X A;  4I0B A;  5K5O A;  3VB2 A;  1C0W A;  2RV8 A;  1LQ1 A;  1R58 A;  3HSF A;  1G3Y A;  1YW7 A;  2P5L C;  2Q8K A;  2CSO A;  4ON0 A;  4EV0 A;  2H6B A;  5CVU A;  4TV7 A;  3P9C A;  5D4R A;  3KEQ A;  1ZRE A;  1LDD A;  1KU9 A;  2PG4 A;  4AIJ A;  3HHG A;  2RDP A;  4A0Z A;  2LF7 A;  3M1E A;  3E5X A;  1BC8 C;  2RNJ A;  2OBP A;  5ICF A;  2HDC A;  2YR2 A;  4ESF A;  2Q2E A;  2WC2 A;  2J5O A;  2L4A A;  1IXS B;  1ZGJ A;  2ZXJ A;  2JTV A;  2PJP A;  1Z05 A;  1FYL A;  4GCV A;  2F2E A;  2HQN A;  1QZY A;  3QU3 A;  3GXO A;  3J80 K;  3PFI A;  3MCZ A;  5L3D A;  3DP7 A;  3JSO A;  5EEG A;  1O7L A;  2DAO A;  2E1C A;  3CUO A;  1U5T A;  4YFX F;  4ESJ A;  4IHS A;  3HRT A;  2RGV A;  2QZ8 A;  4KMF A;  2L02 A;  5LRS A;  2H27 A;  3DEU A;  3KE2 A;  3ROU A;  1YLF A;  4RAY A;  1BI0 A;  1K7A A;  4Z2Y A;  1RUN A;  3ZMZ A;  2FU4 A;  5BPI A;  4UNO A;  1TQM A;  2HTJ A;  4MEY F;  2D2W A;  1QBJ A;  2ISZ A;  3I64 A;  3EYI A;  1IXC A;  2NS0 A;  2ESH A;  1O3S A;  4L9T A;  4XBF A;  1KGS A;  3O2P E;  1K78 B;  4QWQ A;  4LJZ F;  4LGW A;  1V3F A;  4LD5 A;  4L18 B;  4GO1 A;  1STZ A;  4HYE A;  1FP2 A;  3BDD A;  1MJB A;  4G6Q A;  3WTY C;  2M1B A;  5D6F A;  1D5V A;  3R61 A;  1S29 A;  3COA C;  2G9W A;  1XN7 A;  4I0A A;  1P6R A;  4A5M A;  2IA1 A;  2VON A;  4OIQ F;  2PI0 A;  5BMZ A;  5HLG A;  2M5W A;  3TQN A;  1QO0 D;  3R6S A;  1XSV A;  2V1X A;  5DV5 A;  1JXS A;  5HOO A;  4CGZ A;  2JPC A;  3KLN A;  3IC7 A;  1MKM A;  2CW0 F;  3QOP A;  1J0R A;  1QNT A;  1IN4 A;  3RI4 A;  2P6T A;  3K0L A;  2D1V A;  1XDU A;  1XGN A;  1YS6 A;  1P4W A;  3E6M A;  3RTR A;  2IPQ X;  1H0M A;  3GX4 X;  1W4M A;  2P4W A;  3HYI A;  2B0L A;  3QPH A;  2Y48 A;  1U5T B;  1ZRF A;  4KYW A;  5FLX Z;  2AS5 F;  1ZAO A;  1FY7 A;  2LNB A;  1R00 A;  5DUK A;  3NRV A;  2HGC A;  3P7N A;  1OYI A;  2Z9O A;  4BYY A;  1ONV A;  4H0E A;  4EGZ A;  3SFZ A;  1U5T C;  1T38 A;  1U78 A;  5E1W A;  1G6N A;  2EA4 A;  2VN2 A;  3GLX A;  2EFN A;  5E18 F;  1R22 A;  4M72 A;  4LG0 A;  1FYM A;  2QUF A;  2K4B A;  1DPR A;  4PDK A;  4O5V A;  4OIN F;  2GZW A;  3J81 K;  1MJ9 A;  5FFZ A;  4WWC A;  4RGR A;  5ED4 A;  3LWF A;  4YG2 F;  1EH8 A;  4MQ9 F;  2XRN A;  3E5U A;  4HQM A;  2XAH A;  1O3T A;  3JAM Z;  1BM9 A;  1SD6 A;  5ILS A;  3B73 A;  3ECH A;  2IRF G;  4XLP F;  4EJO A;  4EJT A;  3KLO A;  1F5T A;  5JI6 A;  2NAZ A;  2ISY A;  1ZG1 A;  3PQK A;  3KZY A;  2DBB A;  1I5Z A;  3M8E A;  3RYR A;  2R7F A;  1LJ9 A;  2OU2 A;  4XSZ F;  3V7R A;  1YW8 A;  4RB1 A;  1GXP A;  3W6K B;  2DK5 A;  1UCR A;  4PZJ A;  1ZYR F;  3HOS A;  2P7V B;  1XMK A;  1IN7 A;  2XUB A;  5ICG A;  1R5G A;  3KET A;  2YX7 A;  3F3X A;  1XGM A;  4WXH A;  1G3W A;  4I2O A;  3FXQ A;  3J7A O;  1FT9 A;  2G7H A;  1FX7 A;  2MA3 A;  3F21 A;  2EFW A;  4Q4Z F;  2VT3 A;  3C3W A;  4OOI A;  1KU7 A;  1D3Y A;  1QGP A;  3T8T A;  5BOX A;  1IW7 F;  4NB5 A;  2IT0 A;  3LA7 A;  3RPQ A;  1TQP A;  2QBY A;  3GFJ A;  4O3M A;  2O3F A;  4ENN A;  4A5N A;  2X0L A;  4G94 A;  3WTT C;  4L0Z B;  1OYW A;  4LFU A;  5LHH A;  4DQ2 A;  1U2W A;  1T0F A;  2Q0O A;  1L3L A;  3OOP A;  1FYK A;  2PLY A;  4LG0 B;  2OZU A;  4F7Z A;  3E3V A;  2RC4 A;  4PGH A;  4R8H A;  1FSH A;  4RB0 A;  2IW5 A;  4ENM A;  4LMY A;  4CXF A;  1IN6 A;  2NRA C;  5L3F A;  1CGP A;  2DK8 A;  1IZ1 A;  4HF2 A;  2FBI A;  2HR3 A;  1WI9 A;  2HTS A;  2WV0 A;  2W85 A;  4RGU A;  3WE2 A;  4WXD A;  3EET A;  2FOK A;  3TOB A;  2MD5 A;  1S7O A;  2ZME A;  1RZ4 A;  6PAX A;  2O61 A;  3F8F A;  1JHF A;  3FX3 A;  5FO5 A;  5H6R A;  4IPA A;  4WX9 A;  2F5D A;  4ASN A;  1SFE A;  1VTN C;  3LQQ A;  2D45 A;  2XVC A;  4UVA A;  2HKO A;  4PGG A;  3I71 A;  1HKS A;  4M9Z A;  3IWZ A;  1WWX A;  3G73 A;  3BJ6 A;  3EYY A;  1YFH A;  2FSW A;  3DKW A;  1O57 A;  2P6S A;  1R23 A;  1V4R A;  1RIO H;  5HLI A;  2XAQ A;  2CO5 A;  1YO5 C;  2A3S A;  5A2Q Z;  2W57 A;  2A6E F;  1YQA A;  3GYH X;  4OMY A;  2GXG A;  1XSX A;  4A12 A;  3GVA A;  5AIP A;  2PMH A;  2ZBK A;  3JTG A;  1CF7 A;  3KFW X;  3CLO A;  1R1U A;  3MEX A;  1SMY F;  1XCV A;  5ICC A;  1DP7 P;  2MH2 A;  4GYI A;  3RKW A;  1YTY A;  1K6O A;  1ON1 A;  1A04 A;  2RVC A;  2WTE A;  4HLX A;  1Y0U A;  3E97 A;  2MC3 A;  2HYF A;  1B6A A;  2JSC A;  1LDJ A;  2IP2 A;  4Q48 A;  3HSE A;  2YSR A;  1SFX A;  1UB9 A;  4OMZ A;  2ESN A;  1YW9 A;  2HOE A;  1ZGA A;  2Y0M A;  2VBY A;  5JVT A;  3BZ6 A;  3ZPL A;  2XAS A;  3KP7 A;  1Q1H A;  3GFL A;  1HW2 A;  4UXN A;  4MTD A;  4BHC A;  2PEX A;  3H92 A;  5E1Z B;  2RKH A;  2F5F A;  3F8M A;  2EK5 A;  4YFN F;  4P55 A;  4HBL A;  4M73 A;  3V7S A;  3B02 A;  3R0J A;  2FF4 A;  2ZME B;  2Y75 A;  3EQL F;  1IN5 A;  1QZZ A;  3FMQ A;  4I98 B;  3TO7 A;  3ZMT A;  1AWC A;  3QRF F;  1DPU A;  4IRG A;  2H94 A;  1I1G A;  2F5E A;  5K5R A;  3LQR A;  4LK0 F;  3T8R A;  4S04 A;  2VOO A;  3LA3 A;  4ZYG A;  1XGO A;  3E6D A;  3ZMS A;  5HVQ C;  1Z7U A;  1BI3 A;  1O3R A;  1YS7 A;  2NNN A;  5JR3 A;  2DU9 A;  4EJV A;  5TJJ A;  4N0B A;  4HAM A;  1CF7 B;  1T2K A;  3GZ5 A;  1KYW A;  3J80 Z;  1WQ2 A;  3ERE D;  2XHK A;  2UXX A;  3CJN A;  1B4A A;  3RKX A;  1B59 A;  2VBW A;  4MTE A;  3WU1 B;  4HX4 A;  3R0A A;  1EH6 A;  5JFR A;  4OIR F;  4Q5S F;  4AVP A;  5ILV A;  1IAW A;  1UFM A;  3KP3 A;  3QP6 A;  2Z5U A;  2A61 A;  2L4M A;  2XAJ A;  3IL2 A;  1W5T A;  4BH9 A;  4ESB A;  4U7D A;  1B1B A;  3QPT A;  1EH7 A;  5J8C A;  4MGR A;  5CLS A;  2DPU A;  1R1V A;  3O3K A;  2VOP A;  4A0Y A;  1P2F A;  5DDG A;  5BQT A;  4P9F A;  4I7H A;  3HRM A;  3WTX C;  4XRF A;  1KA8 A;  4JK1 X;  5D5X B;  3WE3 A;  3F8N A;  1QQI A;  4M6X A;  1SMT A;  2FRH A;  1BI2 A;  3VEP A;  2EV0 A;  3DPL C;  4LK1 F;  3V8L A;  2G7U A;  4E70 A;  1XD7 A;  4M6Y A;  5HS9 A;  1H9G A;  4EM2 A;  2K4J A;  1BBY A;  2QQA A;  2R7D A;  2DTR A;  4U0V A;  1PP8 F;  4GYG A;  5HS8 A;  1MGT A;  3WG9 A;  1HW5 A;  4S05 A;  5TRD A;  3R60 A;  5LHG A;  4YIF A;  4OU0 A;  3F72 A;  4LB6 B;  4A6E A;  2ZKZ A;  4EGY A;  3KEO A;  3DPT A;  2MH9 A;  3QP5 A;  3GUD A;  2R3S A;  1SD5 A;  2FNP A;  3OV8 A;  2W25 A;  1I1S A;  4AIK A;  2OQR A;  1TTY A;  3P9K A;  2P5K A;  1AOY A;  4Y13 A;  2BE5 F;  3V8J A;  3SZP A;  3GFI A;  4WK8 F;  1XGS A;  1WSU A;  2AXL A;  4ZYD A;  3RYP A;  2ZFW A;  2STW A;  1TQI A;  5FD5 A;  3K1M A;  4EJU A;  4L9N A;  4L0Y B;  5LEK A;  2YX4 A;  4AWX B;  1SFU A;  2K86 A;  2MLK A;  4CZZ A;  5HLH A;  3ISP A;  2Z99 A;  3U1D A;  2GWR A;  2XRO A;  1HSJ A;  5JHU A;  3E6B A;  1G3S A;  3EDP A;  3PQJ A;  2O8X A;  4KA4 A;  4HQE A;  3GWZ A;  1PP7 U;  3JAM K;  3I0T A;  4BNC A;  4RS8 A;  4BQA A;  4EJW A;  3I59 A;  2V9V A;  2GA2 A;  3I54 A;  2FA5 A;  3C7J A;  2HKX A;  2PMU A;  3IRQ A;  3IHU A;  3WTZ A;  1RUO A;  1F1Z A;  4WF2 A;  2DPD A;  3J81 Z;  5FGM A;  1LDK B;  1FWZ A;  3RKY A;  5ERI A;  3HTS B;  5CVR A;  4KDP A;  4PCQ A;  2XKP A;  3ABU A;  2P7C B;  3KP5 A;  5AON A;  2XAF A;  3GEZ A;  2RN7 A;  3G3Z A;  3DF8 A;  4IRI A;  1PDN C;  3QAH A;  3BJA A;  5BPD A;  4FT8 A;  1FBU A;  3N4M A;  2FBK A;  2HFH A;  2KRF A;  1KU2 A;  1SD4 A;  1GVJ A;  1TNT A;  5LRR A;  5L3G A;  1H9T A;  5LGU A;  1G4D A;  2GAU A;  3K9T A;  3SZT A;  1MDM A;  2MLG A;  1S7A A;  2VC0 A;  2BBY A;  3WTW C;  2STT A;  3CO7 C;  3MWM A;  4EVI A;  5CYV A;  2BV6 A;  4G8X A;  3M9A A;  2FML A;  1E17 A;  4M74 A;  1P4A A;  2RQP A;  2D1H A;  4EM0 B;  1ZRD A;  3CO6 C;  2M8E A;  1MD0 A;  4MEX F;  1Z91 A;  3WU0 A;  3ZMV A;  4KT5 C;  3K2Z A;  1B9N A;  1FOK A;  2VE8 A;  2Z3Y A;  5K1Y A;  1OYY A;  5LEJ A;  1KYZ A;  4ETS A;  3KP4 A;  3E6C C;  2HEO A;  3I59 B;  4P9U A;  1BIB A;  4XSX F;  4IF4 A;  3F22 A;  3TO9 A;  3ZP5 A;  4L9J A;  3Q9S A;  3GFM A;  3F23 A;  5F1R A;  3HOT A;  3RDI A;  5IT9 K;  1LNW A;  4AD9 A;  4I01 A;  3ML6 A;  2LKP A;  4U0Y A;  4OIO F;  2OD5 A;  1YIO A;  3VOD A;  1J2X A;  3P9I A;  2QQB A;  1U6G A;  3TDZ C;  5F6F A;  4K2E A;  2VBZ A;  2QEN A;  1RI7 A;  5CVJ A;  2OQG A;  4A6D A;  2ZNZ A;  3CUQ A;  1F9N A;  3DFG A;  4HX8 A;  4ZH4 F;  4BHB A;  5A2Q K;  1BI1 A;  5H6Q A;  4ENJ A;  2XIG A;  2JPB A;  2V1U A;  1L0O C;  1ULY A;  1X3U A;  3WGG A;  1UST A;  4ZYE A;  3GZ6 A;  2EFP A;  2COM A;  3BPX A;  3FMR A;  5CVI A;  2EV5 A;  4RAZ A;  2EFQ A;  3WGH A;  4U7B A;  4IRH A;  2A6H F;  3BY6 A;  3RIR A;  1MDM B;  4G6D A;  2FMY A;  4EQQ A;  3LAP A;  2E7X A;  3KP2 A;  4L9V A;  3D5L A;  4HF1 A;  2BYV E;  5LBQ A;  4HZF A;  3R4K A;  4KN4 X;  3LST A;  1HXD A;  2EWN A;  2W84 A;  5E8G A;  1SAX A;  1XCB A;  4HV5 A;  2VOD A;  2VBX A;  3F6O A;  5DYM A;  2MBF A;  1FNN A;  4HF0 A;  1ZAR A;  2DI3 A;  3K1N A;  4M71 A;  3V7C A;  5LHI A;  5HS7 A;  1ZLK A;  5L3C A;  1I27 A;  1GXQ A;  2QYO A;  3F8C A;  2EB7 A;  5DUI A;  5CVV A;  2DFI A;  4YII A;  2VC1 A;  2BGC A;  1KU3 A;  3CTA A;  4DNC A;  1J5Y A;  1HQC A;  5BS6 A;  1KQ0 A;  1ZHF A;  2ELH A;  2VT2 A;  1YG2 A;  1F4K A;  1WKM A;  1WRJ A;  1ON2 A;  1FZP B;  5D5U B;  2YPR A;  2DQR A;  3BJO A;  3I53 A;  3JW4 A;  4M9S A;  1UHW A;  1RNL A;  5FB2 A;  3FM3 A;  1R1T A;  1Z6R A;  1S8N A;  5LLQ A;  3WTS C;  1ODD A;  1J7K A;  1GHC A;  1HW1 A;  2CGP A;  4IHT A;  2A68 F;  3C18 A;  5E8I A;  4WCG A;  1R7J A;  5IT3 A;  3CUQ B;  4P5O A;  4G7Z F;  3AAF A;  1MZB A;  4U0W A;  3W6J B;  1W5S A;  4UHT A;  3U2R A;  1D8J A;  1HBX G;  1B9M A;  1FPQ A;  4N9I A;  2XKO A;  4A2U A;  3NEU A;  2K02 A;  3QU6 A;  3CUQ C;  5F64 A;  1JGS A;  4U88 A;  3SQN A;  2X4H A;  3TKY A;  4KN7 X;  3IRR A;  3O6B B;  1IUY A;  5K5Q A;  3M7G A;  2FQ3 A;  3L09 A;  1XSD A;  3ABT A;  4KIF A;  3HUG A;  2UXN A;  2W24 A;  3FXR A;  4NHJ A;  3FM5 A;  4HOB A;  3S2W A;  3WGI A;  3WOD F;  1LEB A;  5D5W B;  1ZLJ A;  2WWY A;  3TOA A;  4CIC A;  2ADU A;  4HV6 A;  1FC3 A;  3HTU A;  5CJ9 A;  2H09 A;  2EFO A;  4FHT A;  1XB4 A;  1R5H A;  5D8L B;  2V6C A;  4M9X A;  1S3J A;  1KQ9 A;  2P8T A;  2VXZ A;  2K27 A;  2A07 F;  5LGT A;  4NQW A;  5HDK A;  2PN6 A;  1DDN A;  2JZY A;  2J5P A;  2FBH A;  2M87 A;  3ZMD A;  4L5I A;  4I09 A;  2ZJ2 A;  1SD7 A;  1FLI A;  4CYD A;  4KIG A;  3TDU C;  2V1D A;  4HA8 A;  2EJR A;  4EM1 A;  2PFB A;  5ICE A;  1BOA A;  4UUV A;  3FWE A;  1G3T A;  1J59 A;  3EUH A;  2HWV A;  1E2X A;  4D0P A;  5FFX A;  1U3E M;  3VFZ A;  4UVB A;  1IRG A;  5E20 A;  5AIQ A;  3DXJ F;  2PQ8 A;  1XMA A;  3DV8 A;  3TGN A;  3I58 A;  2ZO4 A;  3WTV C;  4RB3 C;  3H3U A;  5HDN A;  4O6J A;  4B09 A;  1XDS A;  3I5U A;  4FX4 A;  5FLX K;  3T1B A;  5KK1 A;  2A69 F;  4Y17 A;  1NHA A;  2L3D A;  4UV8 A;  4HW0 A;  2CQK A;  4KIB A;  2DO7 A;  1IN8 A;  1ZRC A;  2P5V A;  3LA2 A;  2BEO A;  3FXU A;  3ZN0 A;  4XLN F;  3M8F A;  2GXB A;  2KIU A;  3RPU A;  4CDG A;  4AIH A;  4Y15 A;  2KIM A;  4EMS A;  1ZN2 A;  2KKO A;  1REP C;  3E5Q A;  3I4P A;  5D8K B;  1P4X A;  3MAJ A;  2DLL A;  4BAY A;  3D0S A;  4RB2 C;  1BC7 C;  2O6G E;  4G7O F;  1FSE A;  1J9I A;  4ENK A;  3BPV A;  1R36 A;  3FZV A;  3JSP A;  1W7P D;  3HHH A;  2QM3 A;  2O0Y A;  2ETH A;  1ZG3 A;  3MQ0 A;  2DQL A;  2K7L A;  3ZN1 A;  1LB2 A;  2IA0 A;  1P92 A;  3KP6 A;  3GO5 A;  2CWE A;  2M45 A;  2LSO A;  3ZQ7 A;  2GIV A;  5DCM A;  3C1D A;  2A5Y B;  2FXA A;  2JRT A;  1O7F A;  4BXU A;  1W7P A;  1KQ8 A;  5EEH A;  1HKT A;  1OKR A;  2IJL A;  5LGN A;  3MZH A;  3T0Y A;  2FNA A;  2OA4 A;  4MQV A;  2CYY A;  3CDH A;  4P96 A;  4KIC A;  3V4G A;  3ZMU A;  2XV4 S;  5DEQ A;  4MHG A;  1TW2 A;  2GQQ A;  4JQF A;  3BOQ A;  2DW4 A;  1YYV A;  3ELK A;  3KZZ A;  4QLC U;  2OAZ A;  3MZY A;  2JT1 A;  2ZCW A;  1OPC A;  4JBA A;  4G7H F;  4LB5 A;  1I6X A;  3SHF A;  1LEA A;  1Z1D A;  3H3Z A;  2NYX A;  2LF8 A;  2LDU A;  2HS5 A;  5DD8 A;  3WTU C;  2XAG A;  4IVN A;  4BHP A;  3NQO A;  3K1P A;  4CHU A;  1IF1 A;  1IRF A;  3VOE A;  1TW3 A;  2UWM A;  4ZZL A;  4ZYH A;  1U8R A;  2QLZ A;  3L00 A;  3IKV A;  3IKT A;  2CFX A;  3MFK A;  5E1X A;  2PBI A; 
#chains in the Genus database with same CATH topology
 2Z33 A;  2L5Q A;  4N9H A;  2QSG X;  5C4X J;  1JE8 A;  2VE9 A;  3BR1 A;  4HDU A;  5J6X A;  3T5X A;  5IP6 A;  1OIS A;  1BN5 A;  2X48 A;  2UZK A;  2WA0 A;  4G9Y A;  4A3F J;  2M0M A;  5IP9 J;  2ELK A;  3SJM A;  5KVR A;  3F8B A;  2M7A A;  3GW2 A;  4LLG F;  3IWF A;  4GXO A;  5F08 A;  1UHM A;  2DN0 A;  4M3D A;  1A35 A;  3V8K A;  1TBX A;  4OIP F;  3SXY A;  3OS2 A;  2LFB A;  1TLH B;  4A0X A;  1VI0 A;  4CA0 A;  3TO6 A;  4LIT A;  5K7F A;  1ZG5 A;  3RJP A;  2FEZ A;  3BLY A;  4B47 A;  4CH7 A;  5L3B A;  3NWS A;  3QQA A;  2DT6 A;  2ZNY A;  5F0C A;  1BW6 A;  3MKY B;  1IJW C;  5B66 C;  4B1R A;  1FP1 D;  3FMS A;  4LLN A;  5CQE A;  4CO8 A;  2L2O A;  3GF2 A;  3OYC A;  3CCE I;  1VQ6 I;  4RGS A;  2CS3 A;  3DBL B;  3L2C A;  4LLL A;  3L9F A;  1WJA A;  2KJC A;  2WAD A;  3DU5 A;  4PSW A;  4HDV A;  1ZH5 A;  3HIF A;  4KFC A;  3HRU A;  2FE3 A;  4BXF A;  4LIV A;  2ACJ A;  1K79 A;  4II3 A;  1LUJ B;  2E5Z A;  2L54 A;  2E7W A;  3FF5 A;  2H6C A;  2IA2 A;  5D6E A;  1FBS A;  1MIJ A;  5D4S A;  3DTE A;  4YFK F;  1S6L A;  4R1H A;  1Y1V J;  2HQR A;  1APL C;  1WJC A;  5GPA A;  2EV6 A;  3VSL A;  2M3A A;  2MG4 A;  3HXL A;  3WHB A;  3RZD J;  2L9V A;  2QQ9 A;  1D8K A;  3F6V A;  2QVO A;  1MMN A;  2BVL A;  2CV0 A;  2IVM A;  5L3E A;  4HNU A;  5E17 F;  2HZT A;  1WVR A;  2HYG D;  5DCM B;  2F5C A;  1Z6T A;  4ITV A;  4N4N B;  4DZJ A;  1BJA A;  4GGG A;  1JHH A;  2NNY A;  4HRI A;  1W7P B;  3JTH A;  4KNY A;  4L5J A;  4UVC A;  2XGX A;  4RAF A;  4BGD A;  1W5C C;  1JJ8 C;  5FD6 A;  1Y1W J;  1QVU A;  2ME0 A;  4LIU A;  1OCT C;  5CKT A;  1R71 A;  3N97 A;  5KAI C;  4BUP A;  1T6S A;  2M30 A;  1EV7 A;  1T39 A;  2OZ6 A;  4WXC A;  2HU9 A;  2FJ1 A;  1F36 A;  5IT9 Z;  1OR7 A;  5DCF A;  1SEU A;  2L01 A;  2QKM B;  3H0G J;  4KUM A;  2X1C A;  2WAF A;  3HRS A;  4RGX A;  1JGG A;  2OC6 A;  4MNU A;  2DT5 A;  3KEY A;  2GA1 A;  3QYB A;  5FJ8 J;  4BY1 J;  1T98 A;  1XG1 A;  4NNJ A;  5E3O A;  2JJ7 A;  2C6Y A;  1VF9 A;  5H20 A;  2FD5 A;  2TDX A;  5HDG A;  4C2U A;  1FBQ A;  4Q47 A;  1D1A A;  3MKW B;  2QWW A;  2JA5 J;  1TNS A;  2FUG 2;  3SEZ A;  3ULQ B;  4E7J A;  5J8F A;  5M5X J;  5DD4 A;  3LNQ A;  1QPM A;  1BIA A;  2X6W A;  3K4N A;  1S7E A;  2VXD A;  2LY2 A;  3Q9V A;  4GRI A;  4HX7 A;  2CW7 A;  1O3Q A;  2EIK H;  2X1E A;  2E1N A;  3JR9 A;  2VKV A;  1DUX C;  4EAT A;  4XR6 A;  3FHZ A;  1J75 A;  1USS A;  1WJ5 A;  5JLW A;  1IXR C;  1HST A;  4D9J A;  4UV9 A;  2WAE A;  3DQV C;  2CG4 A;  4F3Q A;  1ZR2 A;  2EA2 A;  1MNE A;  1LVA A;  1ETQ A;  2M0C A;  1UHS A;  1OMI A;  1N77 A;  1Z9C A;  1PUE E;  3U9G A;  4ZZD A;  5C44 J;  2VKD A;  2CQQ A;  1Z3X A;  3PNV A;  5K7H A;  2MAB A;  4P1W A;  2DYS H;  1AHD P;  1JKO C;  1RR8 C;  5FKL A;  1P9Q C;  3H9J A;  2O8K A;  2E2J J;  3L7W A;  2YU3 A;  5ILU A;  2KJB A;  3ECO A;  5IOY A;  4IJA A;  4IQ4 A;  3BRO A;  2QBY B;  5FKO A;  1X1C A;  2XAU A;  2HXI A;  2WY8 Q;  3KCC A;  5M5Y J;  3BP8 A;  2KIF A;  4FX0 A;  3I56 I;  3BWG A;  5D5V B;  1MJA A;  1JUP A;  2K40 A;  3Q5F A;  3SZG A;  2Y9Y A;  3HSR A;  3K10 A;  4C3H J;  3K69 A;  1RPW A;  1SVL A;  1XC5 A;  3REO A;  1LFU P;  4A93 J;  2V79 A;  1FEX A;  4I02 A;  3H9G A;  1HKQ A;  4R79 A;  4HLY A;  2B63 J;  1R6R A;  3W2W A;  4XK4 A;  5C3E J;  3LFK A;  2HDD A;  2O03 A;  4IXA A;  2MSY A;  3LAJ A;  1K78 A;  4KMU X;  4ANJ A;  1VQL I;  3TMO A;  4B8X A;  4PFP A;  3CDL A;  4I0B A;  5K5O A;  1IG7 A;  3VB2 A;  1T56 A;  1C0W A;  2RV8 A;  1LQ1 A;  1R58 A;  3HSF A;  2CW8 A;  1G3Y A;  1SAU A;  3IH4 A;  4G6T B;  1YW7 A;  2P5L C;  3QYF A;  2Q8K A;  2CSO A;  1T95 A;  4ON0 A;  1RES A;  3IH2 A;  4EV0 A;  1D0X A;  2H6B A;  3CD6 I;  4XOR A;  5CVU A;  4TV7 A;  3P9C A;  4XMY A;  5D4R A;  1JI8 A;  3KEQ A;  1ZRE A;  4UY8 I;  4CCK A;  1LDD A;  3OYL A;  2HOT A;  1KU9 A;  2DA4 A;  2PG4 A;  1SVM A;  3W6V A;  2JA6 J;  4AIJ A;  3HHG A;  2RDP A;  4A0Z A;  2LF7 A;  3M1E A;  1JT0 A;  2XPW A;  1I39 A;  1UZC A;  3E5X A;  1BC8 C;  4GDF A;  3LL7 A;  3JRD A;  4MIM A;  2RNJ A;  2OBP A;  5ICF A;  2HDC A;  2YR2 A;  1YJ9 I;  1MH4 A;  4ESF A;  4S0H B;  2Q2E A;  2WC2 A;  3D5S C;  2J5O A;  2L4A A;  3CCR I;  1IXS B;  4V19 K;  3S1N J;  1ZGJ A;  3BZC A;  2ZXJ A;  2JTV A;  4IZZ A;  2R93 J;  2PJP A;  2XGE A;  2XPU A;  1Z05 A;  1FYL A;  2NS8 A;  4GCV A;  2F2E A;  1Z67 A;  2HQN A;  1QZY A;  4ABZ A;  3QU3 A;  3GXO A;  3J80 K;  5HNH A;  3PFI A;  2D5V A;  1GV2 A;  1OR7 C;  2UV1 A;  3MCZ A;  5E3N A;  5L3D A;  1NK3 P;  1EJ9 A;  4RAG A;  3C2G A;  3DP7 A;  4W97 A;  3JSO A;  3JRE A;  1G8X A;  4PJM A;  3MKZ A;  2JA8 J;  1RKW A;  2R7Z J;  1G2H A;  5EEG A;  1O7L A;  2DAO A;  1HCR A;  2E1C A;  3PIP F;  3CUO A;  3IH3 A;  3M07 A;  4M6V A;  4ZYA A;  4AU7 A;  1U5T A;  2ZXI A;  2HI3 A;  4II2 A;  4YFX F;  5FLM J;  4ESJ A;  4IHS A;  1LFP A;  3AG4 H;  3GTL J;  3HRT A;  2RGV A;  1QZE A;  5EYR A;  2QZ8 A;  1BR1 A;  4KMF A;  4Y4R A;  4BU2 A;  2L02 A;  2FOW A;  1YOV B;  5LRS A;  2H27 A;  3DEU A;  2WV1 A;  3H36 A;  2A6T A;  3KE2 A;  2Y30 A;  3ROU A;  1YLF A;  1T8I A;  4RAY A;  1BI0 A;  4MFE A;  3S3O A;  1K7A A;  4BQO A;  1ZQ3 P;  3S1R J;  4Z2Y A;  1RUN A;  3DWL E;  4XRS G;  4QPQ A;  3AG1 H;  2LRD A;  3OWT A;  4Y7N J;  2WAQ A;  4CSW A;  4PJJ A;  3S16 J;  3ZOB A;  3ZMZ A;  2QGU A;  5F1J A;  2FU4 A;  1TZL A;  3CF5 F;  5BPI A;  2LYC A;  4UNO A;  1TQM A;  3ONQ A;  1XTA A;  3S32 A;  4RBO A;  2HTJ A;  3QOE A;  4MEY F;  2D2W A;  1QBJ A;  2ISZ A;  3I64 A;  3EYI A;  1IXC A;  2NS0 A;  2ESH A;  1O3S A;  1JJ6 C;  3HOZ J;  2X1D A;  4L9T A;  4XLF A;  4X0G A;  2OUM A;  4XBF A;  4J01 A;  1KGS A;  3O2P E;  3A01 A;  1NG6 A;  2R7T A;  5K7Z A;  1TL8 A;  2HXO A;  1K78 B;  4DOZ A;  4QWQ A;  2KPM A;  4LJZ F;  3W3C A;  4LGW A;  2BY3 A;  1V3F A;  3BQZ A;  1HF0 A;  3ASN H;  5J4V A;  4LD5 A;  4L18 B;  3U21 A;  5B3S H;  4GO1 A;  1STZ A;  4HYE A;  4A3K J;  2VJ5 A;  1ZR4 A;  2IS6 A;  2F4M B;  3CJR B;  1FP2 A;  3BDD A;  2PX9 A;  2ZXW H;  3OYH A;  1MJB A;  1VQN I;  5GPC A;  4G6Q A;  4PUS A;  3WTY C;  2VJI A;  2M1B A;  3S1M J;  1TWA J;  4OWR B;  5D6F A;  1NK2 P;  1D5V A;  1JTY A;  3R61 A;  1S29 A;  3COA C;  2G9W A;  2Q1Z B;  1XN7 A;  4I0A A;  1P6R A;  4E7H A;  4A5M A;  3AG2 H;  2KDZ A;  2IA1 A;  3BR6 A;  2LTP A;  5C4J J;  3K4L A;  4YEJ A;  1MBK A;  1H8A C;  2F4I A;  3I4N J;  2VON A;  4OIQ F;  2PI0 A;  2R7S A;  5BMZ A;  3OS1 A;  5HLG A;  2M5W A;  3TQN A;  3HG9 A;  4U87 A;  1QO0 D;  1ORK A;  3R6S A;  1XSV A;  2V1X A;  5DV5 A;  2QKL B;  1JXS A;  5HOO A;  2IGO A;  1H89 C;  4QIW N;  4CGZ A;  1QRY A;  2JPC A;  1W0T A;  3KLN A;  4DJA A;  3HOX J;  3DKX A;  3IC7 A;  4ZDO A;  1MKM A;  3LSK A;  3I55 I;  2CW0 F;  3QOP A;  1Y56 A;  2OTJ I;  3NWT A;  2DOF A;  1J0R A;  4XLA A;  1K83 J;  4BQN A;  1QNT A;  1MSF C;  1IN4 A;  3RI4 A;  1A5J A;  5IP7 J;  2P6T A;  4A3G J;  3DKY A;  3K0L A;  2E60 A;  2D1V A;  4MLO A;  3FBI B;  2JUC A;  1XDU A;  4BXX J;  3CC2 I;  1XGN A;  1YS6 A;  1P4W A;  3E6M A;  3RTR A;  2IPQ X;  1H0M A;  2LBF A;  3GX4 X;  2AHQ A;  2DA5 A;  1W4M A;  2P4W A;  3HYI A;  2B0L A;  3QPH A;  2IS2 A;  2Y48 A;  1U5T B;  3G1L A;  1ZRF A;  2DA3 A;  3QPL A;  4KYW A;  5FLX Z;  2AS5 F;  2DA1 A;  3ZR8 X;  3GME A;  1VQP I;  4FQG A;  1ZAO A;  1FY7 A;  2LNB A;  1R00 A;  5DUK A;  9ANT A;  4IHX A;  3NRV A;  3TW7 A;  3G2B A;  2K85 A;  1Z3Y A;  1ETW A;  3SEQ A;  2HQ5 A;  3FK7 A;  2HGC A;  3P7N A;  1OYI A;  3DCF A;  4DIQ A;  4A3C J;  2Z9O A;  3H5A A;  3O8G A;  2W1O A;  4BYY A;  1YRN A;  3S2H J;  1ONV A;  4CYC A;  2KQR A;  4H0E A;  4EGZ A;  3SFZ A;  2GXA A;  4D7N A;  1U5T C;  1X4P A;  2V9P A;  3GBG A;  1T38 A;  2CUJ A;  2N8G A;  1U78 A;  5E1W A;  4IO9 F;  2HVR A;  1AU7 A;  1G6N A;  2EA4 A;  2VN2 A;  3BG6 A;  2EFN A;  3GLX A;  5E18 F;  1R22 A;  4M72 A;  3WHC A;  4LG0 A;  1FYM A;  1NTC A;  2KT0 A;  4V2F A;  2QUF A;  2K4B A;  1DPR A;  4PDK A;  5KAF C;  4O5V A;  4OIN F;  2GZW A;  4MFD A;  3J81 K;  1MJ9 A;  4JX6 A;  5FFZ A;  3UNG C;  4WWC A;  4RGR A;  5ED4 A;  2CUZ A;  3LWF A;  3A01 B;  4YG2 F;  2DA2 A;  1E3P A;  1EH8 A;  4MQ9 F;  3RKQ A;  2XRN A;  3E5U A;  4OAY A;  3WU2 C;  1IGN A;  1X4O A;  4HQM A;  3S1Q J;  2XAH A;  1O3T A;  1U9N A;  3S3N A;  3JAM Z;  1BM9 A;  1SD6 A;  5ILS A;  2JUG A;  3B73 A;  2V7F A;  3L2U A;  3VWB A;  3ECH A;  3A03 A;  2IRF G;  1RET A;  1I3Q J;  3VYR B;  4XLP F;  4EJO A;  4EJT A;  2IBD A;  3KLO A;  1F5T A;  3W2V A;  5JI6 A;  2EZK A;  2NAZ A;  1BL0 A;  2ISY A;  2YS9 A;  4XN0 A;  2OTL I;  1KON A;  4IHW A;  1LFB A;  5KCM A;  3PQK A;  1ZG1 A;  1D5Y A;  1D0Y A;  2DBB A;  3KZY A;  5J47 A;  1I5Z A;  2AQF A;  3M8E A;  3RYR A;  2R7F A;  3PNT A;  1LJ9 A;  2X9D A;  2OU2 A;  2I10 A;  4XSZ F;  1YJN I;  4BJ6 C;  3V7R A;  1X3W B;  1YW8 A;  2HOA A;  2HQA A;  4RB1 A;  2IS4 A;  3CES A;  1GXP A;  3W6K B;  5JVG F;  4XID A;  2DK5 A;  1UCR A;  1FTZ A;  3CCL I;  1OLT A;  4PZJ A;  2FQ4 A;  1ZYR F;  5JHF A;  2F4O B;  3HOS A;  1POG A;  1HDP A;  2P7V B;  1XMK A;  1IN7 A;  1X58 A;  2XUB A;  3KIO A;  1R5I D;  3IP4 B;  3E7L A;  1B72 A;  4AM3 A;  4XOP A;  5ICG A;  1R5G A;  3KET A;  1UG2 A;  3CMY A;  2YX7 A;  3BTC A;  3F3X A;  1XGM A;  4WXH A;  1G3W A;  5GAE J;  4I2O A;  3Q0V A;  3MVP A;  3FXQ A;  4AYB A;  3J7A O;  1FT9 A;  2G7H A;  4ZDL A;  1FX7 A;  1FMW A;  2MA3 A;  3ABK H;  3F21 A;  3ZQG A;  1R4M B;  4XKC A;  2EFW A;  4Q4Z F;  4BS9 A;  3GTG J;  1ZK8 A;  3ZQQ A;  2VT3 A;  1X1B A;  3FIS A;  2E5N A;  3C3W A;  2LBF B;  3RCO A;  3DBR B;  3CJT B;  2LLK A;  3WG7 H;  4OOI A;  1KU7 A;  1D3Y A;  1QGP A;  3T8T A;  5BOX A;  1D0Z A;  1Z21 A;  1IW7 F;  1OCC H;  4NB5 A;  2IT0 A;  4JOM A;  3LA7 A;  1FMV A;  3CP2 A;  3RPQ A;  1TQP A;  2JWT A;  4BBS J;  2QBY A;  3GFJ A;  1I3A A;  2MW8 A;  1IUF A;  4O3M A;  2M34 A;  1ETV A;  3CMM A;  2O3F A;  4ENN A;  2M4G A;  3DTI A;  4G12 A;  4A5N A;  2X0L A;  1LE8 A;  2EIM H;  2E35 A;  4G94 A;  5F0F A;  1YRN B;  3WTT C;  3JRH A;  4CYC B;  2L9N A;  2X6O A;  4L0Z B;  1OYW A;  4LFU A;  4F52 A;  1XS9 A;  5LHH A;  3CLQ A;  4RLF A;  3SYT A;  4DQ2 A;  2DT7 B;  3J7Y J;  1TC3 C;  1U2W A;  3S15 J;  1T0F A;  2Q0O A;  3CCU I;  1L3L A;  3MZ8 A;  3OOP A;  1FYK A;  2PLY A;  4IEJ A;  4J19 A;  4LG0 B;  3OYD A;  2VAS A;  2OZU A;  4F7Z A;  2X6X A;  3E3V A;  2RC4 A;  1FIP A;  4PGH A;  4QTR A;  4R8H A;  2R0Q C;  1FSH A;  2CMP A;  4M3F A;  4RB0 A;  4B3X A;  3HDD A;  3FDY A;  1GDT A;  5IYB J;  2IW5 A;  3LSJ A;  3M1C A;  2BXY A;  4ENM A;  2Z2S B;  4LMY A;  3A2K A;  2V6E A;  4CXF A;  2G0E A;  2MD0 A;  1IN6 A;  2Y2Z A;  4PSX A;  4IX7 A;  4W1U A;  3BCA A;  2NRA C;  2M8G X;  5L3F A;  1QHH D;  1CGP A;  2DFH A;  1LVK A;  2DK8 A;  4B43 A;  1VQO I;  3KZI C;  1PVE A;  1IZ1 A;  4XOT A;  4HF2 A;  2FBI A;  4M3B A;  2DFF A;  4BY7 J;  1RC9 A;  5J3L A;  2HR3 A;  3SDG A;  1S5L C;  1WI9 A;  2HTS A;  5FRO A;  2W4S A;  2WV0 A;  2W85 A;  2DJI A;  4RGU A;  3WE2 A;  4WXD A;  3EET A;  2FOK A;  3TOB A;  2MD5 A;  1S7O A;  2F5V A;  4C3J J;  2ZME A;  4E4H A;  1RZ4 A;  6PAX A;  2O61 A;  1ZTR A;  1JHF A;  3E1S A;  3F8F A;  3FX3 A;  5FO5 A;  5H6R A;  5M3M J;  4IQJ A;  4IPA A;  2OJE D;  4UB6 C;  4C3I J;  1BJZ A;  4WX9 A;  3OYA A;  2F5D A;  3HOW J;  1VFC A;  3LSG A;  2BXZ A;  4ASN A;  1SFE A;  3G1M A;  1VTN C;  2L0K A;  2LOO A;  3LQQ A;  2DYR H;  2D45 A;  2XVC A;  4UVA A;  4D1Q A;  2HKO A;  4PGG A;  2L7K A;  3I71 A;  1HKS A;  3HKZ A;  4M9Z A;  3CC4 I;  3IWZ A;  4BJ5 C;  1WWX A;  2LMD A;  1B72 B;  3G73 A;  2Z16 A;  3BJ6 A;  3EYY A;  1YFH A;  2FSW A;  2EPF A;  2L9R A;  3DKW A;  1MBE A;  1O57 A;  2P6S A;  1R23 A;  2BZT A;  3TBI A;  2H8R A;  4CUG A;  1V4R A;  1RIO H;  5HLI A;  2XAQ A;  2Y69 H;  3JRA A;  1HLV A;  2CO5 A;  2BY1 A;  3ZQH A;  1YO5 C;  2A3S A;  5BNG A;  5A2Q Z;  2W57 A;  2TRT A;  2AXT C;  2A6E F;  1YQA A;  3Q0U A;  3GYH X;  4OMY A;  2IGM A;  2MGQ A;  2JA7 J;  1HOM A;  2GXG A;  3OIP A;  2KHM A;  1FOY A;  1XSX A;  4A12 A;  3GVA A;  5IYD J;  5AIP A;  2PMH A;  2Z1D A;  2ZBK A;  3TP0 A;  3JTG A;  1CF7 A;  3L1P A;  3KFW X;  2VKH A;  2WB1 N;  1ZEL A;  3CLO A;  1R1U A;  4BBR J;  2IGK A;  3MEX A;  1SMY F;  3IAS 2;  3PM1 A;  3K4M A;  1XCV A;  2V4J C;  5ICC A;  1DP7 P;  2MH2 A;  4GYI A;  4A3D J;  2OPT A;  2VPR A;  3RKW A;  1YTY A;  1LE8 B;  3OSG A;  2BW3 B;  5EG0 A;  2OF7 A;  4D7M A;  1K6O A;  1ON1 A;  2XDV A;  1A04 A;  2RVC A;  2WTE A;  4HLX A;  1Y0U A;  1E3H A;  2F48 A;  3E97 A;  2MC3 A;  3L2W A;  2HYF A;  2E1O A;  1B6A A;  2X85 A;  2JSC A;  3NAU A;  1LDJ A;  1PJR A;  2IP2 A;  4Q48 A;  4PK4 A;  3HSE A;  4XQF A;  1OCR H;  3BTI A;  2YSR A;  1SFX A;  4DW6 A;  3BG7 A;  1UB9 A;  3L2R A;  4OMZ A;  1ITY A;  2ESN A;  1JUM A;  1YW9 A;  2HOE A;  1ZGA A;  2IEK A;  5FKK A;  4A3L J;  2Y0M A;  2VBY A;  5JVT A;  2HDW A;  5GAD J;  4FTH A;  3ZCO A;  3ZQC A;  3BZ6 A;  3QWL A;  2XAS A;  3KP7 A;  4UB8 C;  3ZPL A;  1Q1H A;  3GFL A;  1HW2 A;  4UXN A;  4MTD A;  1TT0 A;  2ZJQ F;  1T0F C;  1WFX A;  4BHC A;  2NVT J;  2PEX A;  3H92 A;  1EKE A;  5E1Z B;  3A4C A;  2RKH A;  2ZXH A;  2F5F A;  3F8M A;  3DLL F;  4JYK A;  2Y0S A;  4F93 B;  1OJL A;  2EK5 A;  4BKX A;  3IAM 2;  4YFN F;  4P55 A;  4HBL A;  3PIO F;  4M73 A;  3V7S A;  2EIJ H;  3B02 A;  2LH9 A;  3R0J A;  2FF4 A;  2ZME B;  2X6Y A;  3HEF A;  1TT5 B;  3S8P A;  4CCN A;  3OIQ A;  2Y75 A;  3EQL F;  2P0W A;  1IN5 A;  1IO2 A;  1BR4 A;  1QZZ A;  1MBJ A;  4E6K G;  2O9L A;  3FMQ A;  4A69 C;  1P7I A;  2LP0 A;  2VKE A;  4I98 B;  1OCO H;  2ZC2 A;  1O4X A;  3F0C A;  3TO7 A;  3ZMT A;  1AWC A;  2R7X A;  3FKJ A;  3D5R C;  3QRF F;  3LFU A;  3GTK J;  1YJW I;  1DPU A;  3O8H A;  4E7K A;  4CZC A;  4IRG A;  5JLX A;  2H94 A;  3OYI A;  1I1G A;  3CCY A;  2F5E A;  5K5R A;  3D1N I;  2ZME C;  3LQR A;  3FHN A;  4LK0 F;  4BEH A;  3T8R A;  4S04 A;  2VOO A;  1N25 A;  3LA3 A;  4ZYG A;  3FXO A;  2KP6 A;  1XGO A;  1BOB A;  3E6D A;  3ZMS A;  1Z7U A;  5HVQ C;  1WHU A;  3E0J B;  1BI3 A;  3V42 A;  1DP3 A;  1W36 D;  1O3R A;  1YS7 A;  2NNN A;  5JR3 A;  2PMZ A;  3VYS B;  2JN6 A;  3CJQ B;  3FXM A;  2DU9 A;  1TWC J;  4EJV A;  4N0B A;  5TJJ A;  4HAM A;  3FK6 A;  3SFI A;  4AC0 A;  1T2K A;  1CF7 B;  3GZ5 A;  1KYW A;  3GZN B;  2R4G A;  3J80 Z;  1WQ2 A;  3ERE D;  1JKQ C;  2XHK A;  2HZD A;  2UXX A;  1B4A A;  2VJJ A;  3CJN A;  4IL6 C;  3RKX A;  1IV8 A;  2DDB A;  2Y31 A;  1R49 A;  1B59 A;  1Z77 A;  2KZG A;  4ZDP A;  4BAC A;  1JKP C;  3OYE A;  2F6C A;  2VBW A;  4MTE A;  2DMN A;  4IKF A;  3Q3S A;  1MH3 A;  2BHY A;  3WU1 B;  3K4K A;  3BG3 A;  4HX4 A;  2E2H J;  2KFD A;  3R0A A;  1EH6 A;  5EG0 B;  3LOC A;  5JFR A;  4OIR F;  4Q5S F;  2XPV A;  3HM5 A;  4AVP A;  3BTL A;  5ILV A;  1IAW A;  1UFM A;  3ERM A;  4E7L A;  3KP3 A;  3OR1 C;  3QP6 A;  2Z5U A;  3J7Z I;  2A61 A;  2YUS A;  2L4M A;  2XAJ A;  2B7E A;  1SC7 A;  3IL2 A;  1W5T A;  4BH9 A;  3FXK A;  4ESB A;  4U7D A;  4HEA 2;  1B1B A;  3QPT A;  5F04 A;  3ZXS A;  1EH7 A;  5KHD A;  4E7S A;  1UG0 A;  2OV7 A;  2VJ4 A;  2CJJ A;  3DU6 A;  3K4J A;  3TP3 A;  1YIJ I;  2K9N A;  4RLQ A;  4XN3 A;  5J8C A;  5B5E C;  1S9H A;  1QHG A;  3S14 J;  4MGR A;  5CLS A;  3OYG A;  2DPU A;  1R1V A;  4KIT B;  2VLA A;  4IHV A;  5HOD A;  3ZGK A;  3O3K A;  2VOP A;  1XX5 A;  3B6C A;  4A0Y A;  4UUT A;  1P2F A;  1EA3 A;  5DDG A;  2VB6 A;  4P9F A;  5BQT A;  4I7H A;  3HRM A;  3WTX C;  3TED A;  4XRF A;  1KA8 A;  3AG3 H;  4HNV A;  2DOD A;  3ZQF A;  5H2F C;  4JK1 X;  3PSI A;  2E1M B;  1WJE A;  5D5X B;  3WE3 A;  3F8N A;  3KYL A;  1QQI A;  5EZH A;  4M6X A;  3HL2 A;  2LY1 A;  2V1N A;  2ID3 A;  3JRC A;  1MMD A;  1SMT A;  2KL4 A;  4JX4 A;  4BJT A;  2FRH A;  2L7Z A;  2Y9Z A;  2HYJ A;  1BI2 A;  3HJE A;  3VEP A;  1SAN A;  3W2A A;  2DA6 A;  2CQ7 A;  2EV0 A;  2R7V A;  3DPL C;  4NDL A;  4LK1 F;  3BQY A;  3V8L A;  2VQC A;  5DS9 A;  2G7U A;  3HPG A;  4E70 A;  1XD7 A;  4M6Y A;  3AFH A;  5HS9 A;  1H9G A;  4EM2 A;  3BG9 A;  2K3P A;  2K4J A;  4DBR A;  1BBY A;  2E1M C;  2QQA A;  2R7D A;  2DTR A;  3Q0W A;  4U0V A;  1PP8 F;  2I8D A;  4GYG A;  5HS8 A;  1MGT A;  2QF7 A;  3WG9 A;  1HW5 A;  4S05 A;  4HSR A;  5TRD A;  3R60 A;  2MYS A;  5EDN A;  3F9K A;  5LHG A;  3I4M J;  4OU0 A;  4YIF A;  3F72 A;  4LB6 B;  4A6E A;  2ZKZ A;  4EGY A;  1HA8 A;  4HG2 A;  2GM4 A;  3BCB A;  4BEH B;  3KEO A;  3LSR A;  4XLH A;  2JA2 A;  4M3E A;  3DPT A;  2MH9 A;  1N78 A;  3QPS A;  4ZC3 A;  3QP5 A;  3H5R A;  2QEX I;  3GUD A;  2R3S A;  4IOC F;  1SD5 A;  2FNP A;  2JRM A;  3OV8 A;  1JUS A;  2EZH A;  2ZSH B;  3LMM A;  3BC8 A;  3DBH B;  2VIX A;  4PJL A;  4A3E J;  1OCZ H;  1P7J A;  2W25 A;  1DGR M;  1I1S A;  3MD2 A;  1OQY A;  4AIK A;  4FAS D;  2OQR A;  2H8W A;  1TTY A;  4YIR X;  3CMA I;  1V55 H;  3HGG A;  3P9K A;  3RQI A;  2P5K A;  4ZTJ A;  4FIS A;  1AOY A;  4Y13 A;  4EEF G;  2BE5 F;  2KRC A;  3FIW A;  3V8J A;  3SZP A;  3CC7 I;  2VQL A;  2EH3 A;  3GFI A;  5EF6 A;  4WK8 F;  1UAA A;  4CCO A;  1XGS A;  1DQU A;  1KZH A;  1WSU A;  1U0J A;  2AXL A;  2CQN A;  1V5G A;  3RYP A;  2ZFW A;  4ZYD A;  1TQI A;  3K7A J;  2STW A;  2UUZ A;  5FD5 A;  2L7M P;  3K1M A;  4EJU A;  4A3I J;  1K4T A;  4L9N A;  4L0Y B;  5LEK A;  1R9T J;  2YX4 A;  4AWX B;  2NXN B;  4D5F A;  1SFU A;  2K86 A;  4XON A;  2MLK A;  4CZZ A;  5HLH A;  3ISP A;  2Z99 A;  3U1D A;  2GWR A;  2XRO A;  1HSJ A;  3LSI A;  5JHU A;  3E6B A;  1G3S A;  3AKZ A;  2GIZ A;  3EDP A;  3PQJ A;  5F27 A;  2O8X A;  3PNY A;  5E3L A;  4KA4 A;  4HQE A;  2DMP A;  3GWZ A;  3HZJ A;  1PP7 U;  3JAM K;  3I0T A;  4BNC A;  4RS8 A;  4BQA A;  4EJW A;  2M7B A;  3I59 A;  1WJB A;  4CCM A;  2ELJ A;  2V9V A;  3OYB A;  1X3Z B;  2GA2 A;  3I54 A;  4BDY A;  2DDA A;  5HNF A;  4Z6Y A;  1B8I A;  2FA5 A;  1U8B A;  1W36 C;  3CCM I;  1VQ7 I;  3C7J A;  2HKX A;  2PMU A;  3IRQ A;  1ZGW A;  1VQK I;  4PJ0 C;  1WH5 A;  4D5C A;  1VQ5 I;  3IHU A;  1FOW A;  2L7F P;  3WTZ A;  1F1Z A;  2CH0 A;  4WF2 A;  1NH3 A;  1RUO A;  2DPD A;  3J81 Z;  1VQ4 I;  3PUF A;  5FGM A;  4KJZ A;  5DM6 F;  3VPR A;  1LDK B;  1FWZ A;  2DOE A;  3DPU A;  3A1Y A;  5ERI A;  4LG3 A;  5CVR A;  3RKY A;  4PCQ A;  3G71 I;  2CV2 A;  3HTS B;  4KDP A;  2KMU A;  2XKP A;  2IS1 A;  4AUX A;  3ABU A;  5TIS C;  5J4Y A;  4QPO A;  2R7Q A;  2P7C B;  1RKT A;  3KP5 A;  5AON A;  2XAF A;  1AA7 A;  3GEZ A;  2RN7 A;  2DMQ A;  3G3Z A;  3DF8 A;  3OL3 A;  3PSF A;  1PDN C;  4IRI A;  3QAH A;  4B4C A;  4L5E A;  2VL8 A;  3OR2 C;  3BJA A;  1XPX A;  2DFE A;  2K9L A;  3MN2 A;  4A3J J;  4IHY A;  5BPD A;  4FT8 A;  1A6I A;  4BE2 A;  1FBU A;  2XGD A;  1Y8R B;  3N4M A;  2FBK A;  1D1B A;  2HFH A;  3P5J A;  1Y0N A;  5E3M A;  2KRF A;  1KU2 A;  3X2Q H;  1SD4 A;  1WPK A;  2NS7 A;  1GVJ A;  2K9S A;  1TNT A;  1ETY A;  2RQQ A;  4Y52 J;  3RQ4 A;  3A0B C;  2NVY J;  1GVD A;  5LRR A;  1WGX A;  5L3G A;  2NVQ J;  1H9T A;  4PJN A;  2DXI A;  5LGU A;  2LRE A;  1G4D A;  2GAU A;  3K9T A;  3GTP J;  1SVO A;  3SZT A;  3EUH C;  2VQH A;  1MDM A;  2MLG A;  1S7A A;  2VC0 A;  3PFY A;  5CQG A;  4IOA F;  1FIA A;  1RR7 A;  2BBY A;  3WTW C;  5KNL A;  4C2T A;  3OOU A;  4DGW B;  2OCE A;  2STT A;  1X1P A;  1FOX A;  2EIL H;  3CO7 C;  3MWM A;  4X1E A;  2DCE A;  4EVI A;  5CYV A;  4DYC A;  4I6Z A;  2BV6 A;  3CCS I;  1Z7L A;  4G8X A;  3M9A A;  2FML A;  1E17 A;  4CCL A;  1CQT A;  3BR3 A;  2K5C A;  2IXS A;  4M74 A;  2ZJR F;  2BW3 A;  4RM2 A;  1P4A A;  1W0U A;  2RQP A;  2D1H A;  4EM0 B;  2WAQ N;  1ZRD A;  4HNT A;  3CO6 C;  2M8E A;  1DU6 A;  1NG7 A;  1MD0 A;  4BE0 A;  4MEX F;  1Z91 A;  2P81 A;  3WU0 A;  3ZMV A;  4AID A;  2LY9 A;  4KT5 C;  3K2Z A;  1B9N A;  1FOK A;  2VE8 A;  2Z3Y A;  1W1W E;  1OYY A;  4BQQ A;  5K1Y A;  1YIT I;  1SFO J;  2COB A;  3C2B A;  5LEJ A;  1KYZ A;  4ETS A;  3HGY A;  4N4O B;  3KP4 A;  3DEW A;  3C2H A;  2DMT A;  3E6C C;  4PFO A;  2ME6 A;  2HEO A;  3PO2 J;  1IV6 A;  2E71 A;  2R7U A;  1M1E B;  3VSK A;  1VQM I;  1X1A A;  3I59 B;  2ZB9 A;  1BIB A;  4P9U A;  4E7I A;  3ZQI A;  1D1C A;  4A3M J;  4XSX F;  4IF4 A;  2QQ8 A;  2HVS A;  2HPI A;  3F22 A;  3PO3 J;  5J40 A;  3TO9 A;  3ZP5 A;  1MNM C;  4L9J A;  1MBG A;  2XC7 A;  1TP4 A;  5GAG J;  1B8I B;  3Q9S A;  3GFM A;  1ENH A;  5LFA A;  1IDY A;  2KLO A;  3NAR A;  5F1R A;  3F23 A;  1JT6 A;  3HOT A;  3RDI A;  5IT9 K;  2KRH A;  1LNW A;  4AD9 A;  4C2M J;  1PYV A;  4I01 A;  3ML6 A;  3HOY J;  3AL0 B;  2LKP A;  4XKW A;  5EGO B;  4U0Y A;  4OIO F;  1WCM J;  2A5W A;  2CFO A;  2OD5 A;  3ABM H;  1YIO A;  1GLN A;  3VOD A;  1J2X A;  4BL0 B;  3P9I A;  2QQB A;  3RZO J;  1U6G A;  3TDZ C;  3MKL A;  5F6F A;  4K2E A;  1WZ2 A;  2E2I J;  3H0D A;  4FE4 A;  2VBZ A;  2QEN A;  1RI7 A;  5CVJ A;  2EBI A;  2OQG A;  5DM7 F;  1FJL A;  1AKH A;  4A6D A;  2W00 A;  2KIQ A;  2ZNZ A;  3CUQ A;  1F9N A;  4C30 A;  3DFG A;  3AL0 C;  5DTD A;  2AQE A;  4HX8 A;  3J7A Y;  3H35 A;  2BOL A;  4ZH4 F;  4BHB A;  1T33 A;  3EUK L;  5A2Q K;  4FCY A;  1BI1 A;  5H6Q A;  4GFB A;  4ENJ A;  5FRM A;  2ZFU A;  2XIG A;  3N05 A;  2JPB A;  2ECC A;  4ZJZ A;  2GBY A;  3PJR A;  2V1U A;  1L0O C;  1ULY A;  2CV1 A;  4RMN A;  1A31 A;  3OS0 A;  1GUU A;  4V2G A;  2FX0 A;  2R7W A;  4NBQ A;  1X3U A;  3WGG A;  1UST A;  4ZYE A;  3L2Q A;  3GZ6 A;  2EFP A;  3OY9 A;  3S3M A;  2COM A;  3BPX A;  3FMR A;  5CVI A;  2EV5 A;  4RM3 A;  4RAZ A;  2EFQ A;  3FBN B;  3WGH A;  1ERD A;  5GTH C;  4U7B A;  1IRZ A;  4IRH A;  2A6H F;  3BY6 A;  2LC2 A;  3RIR A;  1MDM B;  4G6D A;  2FMY A;  2E34 A;  2NVX J;  4EQQ A;  3LAP A;  2E7X A;  3KP2 A;  4L9V A;  3D5L A;  4HF1 A;  3SDB A;  2BYV E;  2WBM A;  5LBQ A;  3HBL A;  4HZF A;  1VQ9 I;  2R5Y A;  1V54 H;  3FXL A;  3R4K A;  4KN4 X;  3LST A;  3LSP A;  1HXD A;  2EWN A;  1ZKG A;  2W84 A;  1OFC X;  5E8G A;  1SAX A;  5M5W J;  2CUF A;  2HVQ A;  1XCB A;  4XNF A;  2M2E A;  4E7Z A;  4NC6 A;  1IRX A;  4B48 A;  4HV5 A;  2VOD A;  2VBX A;  2ID6 A;  1X2N A;  2IGN A;  3F6O A;  5DYM A;  3G6E I;  2VQG A;  4DYQ A;  4I99 C;  2MBF A;  4UUS A;  3HC7 A;  2CRG A;  1FNN A;  3GCM A;  4HF0 A;  2R7R A;  1ZAR A;  2DI3 A;  2ZJP F;  3K1N A;  4M71 A;  3V7C A;  2H1L A;  1GT0 C;  2X51 A;  4FE7 A;  5LHI A;  5HS7 A;  1ZLK A;  5L3C A;  3GLL A;  1I27 A;  1X2M A;  1GXQ A;  3K70 D;  2M4K A;  2QYO A;  3F8C A;  2EB7 A;  1ETX A;  2MC4 A;  3BTJ A;  5DUI A;  3IV5 A;  5CVV A;  1BW5 A;  2DFI A;  4YII A;  2VC1 A;  4J00 A;  2BGC A;  1YX3 A;  1KU3 A;  2M9H A;  3CTA A;  4DNC A;  4ZTF A;  1J5Y A;  1HQC A;  4DBQ A;  5BS6 A;  1KQ0 A;  1ETO A;  1ZHF A;  2JQ7 A;  2ELH A;  2VT2 A;  3HB9 A;  3BR2 A;  1YG2 A;  4KT6 A;  1F4K A;  1WKM A;  2JVH A;  1WRJ A;  1ON2 A;  1FZP B;  3CME I;  5D5U B;  3OYF A;  3RSN A;  1UMQ A;  2YPR A;  2XRL A;  2DQR A;  3BJO A;  3I53 A;  3JW4 A;  4M9S A;  1UHW A;  1H88 C;  2XSJ C;  1RNL A;  5FB2 A;  3ESW B;  4B44 A;  1MMS A;  3FM3 A;  5IOZ A;  1R1T A;  4NUB A;  2ICW G;  1Z6R A;  1S8N A;  5LLQ A;  3WTS C;  2DMU A;  1UJ8 A;  3CCQ I;  1ODD A;  2RNG A;  1J7K A;  1GHC A;  1HW1 A;  2ECB A;  2CGP A;  4IHT A;  1X19 A;  2A68 F;  4FET A;  3C18 A;  5E8I A;  1AKH B;  4WCG A;  1R7J A;  3VYU B;  5IT3 A;  1G59 A;  3CUQ B;  1WJD A;  2XF7 A;  4XLC A;  4YEL A;  2DJN A;  3K4B A;  1QPI A;  4P5O A;  1E3O C;  5B1B H;  1Y6I A;  4G7Z F;  3AAF A;  1MZB A;  1YE9 A;  2HNH A;  2KIS A;  1J09 A;  4U0W A;  3KYD B;  3W6J B;  5EEA A;  2ZSI B;  1W5S A;  1LPQ A;  4UHT A;  3U2R A;  1D8J A;  3ZQL A;  1DGW Y;  1HBX G;  4AYB N;  1B9M A;  1FPQ A;  1K6Y A;  1U9O A;  4N9I A;  2XKO A;  2QSH X;  3S93 A;  4A2U A;  3NEU A;  2K02 A;  3GTO J;  3BZK A;  1QA6 A;  3H1C A;  3JCU C;  3QU6 A;  3CUQ C;  5F64 A;  1JGS A;  4LOC A;  4U88 A;  2X4H A;  3SQN A;  3TKY A;  1EF4 A;  2NVU B;  2E19 A;  1GV5 A;  4KN7 X;  3IRR A;  4BE1 A;  4OAZ A;  3CZ6 A;  2DTZ A;  1YHQ I;  3O6B B;  1IUY A;  3ZRG A;  5K5Q A;  2LKS A;  3M7G A;  2O6G E;  3TL4 X;  3GTJ J;  1JTX A;  3QYE A;  2FQ3 A;  3L09 A;  2DOA A;  1XSD A;  3ABT A;  4KIF A;  2R5Y B;  3HUG A;  1R4N B;  3CQZ J;  3K6G A;  3OMY A;  2UXN A;  2W24 A;  3FXR A;  2W82 A;  4NHJ A;  5LD2 C;  3OYM A;  3FM5 A;  4HOB A;  3S2W A;  2R5Z A;  3WGI A;  4QSH A;  3WOD F;  1LEB A;  2BY0 A;  2VUM J;  5D5W B;  2TCT A;  1ZLJ A;  1TWF J;  2WWY A;  3TOA A;  4CIC A;  2ADU A;  4HV6 A;  5GTI C;  4UUS B;  1FC3 A;  2HOS A;  1MW7 A;  3HTU A;  2LG4 A;  1K61 A;  5CJ9 A;  2H09 A;  2EZL A;  5EJC A;  5FLV A;  2EQR A;  2EFO A;  4FHT A;  1XB4 A;  1R5H A;  5D8L B;  2V6C A;  1HDD C;  3K2A A;  2K9Q A;  2WY7 Q;  2CUE A;  4M9X A;  3JRI A;  3I3L A;  1S3J A;  1KQ9 A;  2P8T A;  1MND A;  2VXZ A;  2K27 A;  1PUF A;  5LGT A;  2A07 F;  2I5U A;  3KX2 A;  4NQW A;  4XIC A;  5HDK A;  2PN6 A;  3BT9 A;  2DA7 A;  1DDN A;  3H5N A;  2JZY A;  4XRS A;  3JRF A;  2K3F A;  1RRJ A;  2J5P A;  5J1Y A;  2FBH A;  2M87 A;  2KDO A;  3ZMD A;  4L5I A;  4I09 A;  2ZJ2 A;  1BR2 A;  1SD7 A;  4MO7 A;  3IUO A;  4C9Y A;  1IC8 A;  3LSM A;  1FLI A;  1WH7 A;  4CYD A;  4JX5 A;  2QA4 I;  4KIG A;  5IYC J;  3TDU C;  2V1D A;  3K4C A;  1MBH A;  2KZV A;  4HA8 A;  2EJR A;  4EM1 A;  2R7O A;  1BA5 A;  1F43 A;  3MMY B;  2PFB A;  2LK2 A;  2GLO A;  4HPQ A;  1Z0X A;  5ICE A;  1BOA A;  4UUV A;  3FWE A;  2CU7 A;  3I9V 2;  5J1R A;  1G3T A;  1J59 A;  3ABL H;  1SFK A;  1QU3 A;  5FKM A;  1Q1V A;  3EUH A;  2HWV A;  1E2X A;  4D0P A;  5FFX A;  1U3E M;  3VFZ A;  5IPA A;  3BR5 A;  4UVB A;  3H9Q A;  3HKZ N;  2XSD C;  1IRG A;  5E20 A;  5AIQ A;  3DXJ F;  2PQ8 A;  2K9M A;  3HOV J;  1HC8 A;  1V5F A;  3K70 C;  2BHZ A;  2CQX A;  3RPU D;  1XMA A;  3DV8 A;  3TGN A;  2LD5 A;  3I58 A;  2W48 A;  1Y39 A;  2ZO4 A;  3WTV C;  4RB3 C;  3H3U A;  4F92 B;  5IY5 H;  1MMG A;  5HDN A;  2JSP A;  4O6J A;  3HOU J;  2Q2E B;  4B09 A;  1XDS A;  3I5U A;  2H1K A;  4FX4 A;  5FLX K;  1E0E A;  3T1B A;  3OYN A;  5KK1 A;  2A69 F;  4Y17 A;  1NHA A;  1UEL B;  2PJR A;  2L3D A;  4HST A;  4UV8 A;  4HW0 A;  2CQK A;  2NOG A;  4KIB A;  2DO7 A;  1IN8 A;  2YU9 J;  1ZRC A;  2P5V A;  2XGC A;  3A0H C;  3KYC B;  3LA2 A;  2BEO A;  3FXU A;  3VYT B;  4NC8 A;  3ZN0 A;  4XLN F;  3M8F A;  4NC7 A;  1LKX A;  2GXB A;  2KIU A;  3RPU A;  5FRN A;  4CDG A;  4Y3O A;  4AIH A;  4Y15 A;  1DU0 A;  3UKG A;  2KIM A;  4EMS A;  4Y33 A;  1T08 B;  1ZN2 A;  2KKO A;  4F55 A;  4RDU A;  1K4S A;  1REP C;  3E5Q A;  2E36 A;  3I4P A;  1FTT A;  5D8K B;  3HUG B;  5B1A H;  2JVG A;  1P4X A;  2BVM A;  3PL8 A;  3MAJ A;  2DLL A;  2WB1 A;  2O7O A;  2XB0 X;  3OYJ A;  1WJF A;  3D0S A;  4XM3 A;  4BAY A;  4RB2 C;  3L2V A;  2LR8 A;  2R5Z B;  3OSF A;  1BC7 C;  3CF2 A;  3GTM J;  1VZ0 A;  3A02 A;  3OYK A;  3BR0 A;  4XKB A;  3DTK A;  2W7N A;  4G7O F;  3CDI A;  4DZP A;  3EPZ A;  1FSE A;  1J9I A;  4ENK A;  1I50 J;  3BPV A;  2VPL A;  4F91 B;  1A36 A;  1R36 A;  3FZV A;  4BDZ A;  1MSE C;  2HPM A;  2B9S A;  2L9S A;  3BG5 A;  3JSP A;  2XB5 A;  1JKR C;  1W7P D;  3HHH A;  2O5R A;  3B6A A;  2QM3 A;  2RRE A;  2O0Y A;  2OCC H;  1ETK A;  2LKX A;  3VDX A;  3CP8 A;  2ETH A;  1ZG3 A;  1ACI A;  3MQ0 A;  2DQL A;  3FKI J;  1PUF B;  2K7L A;  3ZN1 A;  3U1K A;  1LB2 A;  1VQ8 I;  1IDZ A;  4NQW B;  3ASO H;  1A6Q A;  3QOD A;  4M3G A;  2IA0 A;  3M4O J;  1P92 A;  3DLA A;  3KP6 A;  4XRM A;  5E79 C;  4XKV A;  5GAH J;  1S72 I;  4H4K C;  1YI2 I;  3GTQ J;  2JK3 A;  3GO5 A;  2QSF X;  2CWE A;  2M45 A;  2LSO A;  2R92 J;  3S17 J;  3TW6 A;  3ZQ7 A;  2GIV A;  5DCM A;  5EGO A;  3M3Y J;  3OIO A;  3C1D A;  5GP9 A;  1X1D A;  2A5Y B;  2FXA A;  2MFZ A;  2Y0S N;  2JRT A;  3LSH A;  5HLT A;  1O7F A;  4BXU A;  5TGT A;  1W7P A;  1KQ8 A;  2QCO A;  2AO9 A;  5EEH A;  1HKT A;  4JP0 A;  1OKR A;  2IJL A;  2GOM A;  5LGN A;  3OL4 A;  4YRV A;  4I76 A;  5F0H A;  3JRB A;  3MZH A;  5CPR B;  4XLE A;  3T0Y A;  1VND A;  2FNA A;  2OA4 A;  4MQV A;  3H3V K;  2XF5 A;  2CYY A;  3CDH A;  4P96 A;  3JRG A;  2RAE A;  3FXJ A;  3CCJ I;  2JMW A;  1XMX A;  4KIC A;  3V4G A;  1OCP A;  3ZMU A;  3G1O A;  3HPH A;  3KPH A;  3M8J A;  5J1U A;  2XV4 S;  5DEQ A;  4MHG A;  1TW2 A;  2GQQ A;  1TWG J;  4JQF A;  1V5E A;  3PUB A;  5EZG A;  2NOJ B;  3UR3 C;  3BOQ A;  1MMA A;  4AVZ A;  2DW4 A;  4X6A J;  1YYV A;  2GOX B;  3ELK A;  2BY2 A;  3KZZ A;  4QLC U;  3CCV I;  2OAZ A;  3MZY A;  2JT1 A;  2ZCW A;  2LVS A;  4KIS A;  1OPC A;  4JBA A;  4G7H F;  4LB5 A;  2A05 A;  1I6X A;  1N75 A;  3DEE A;  4XL9 A;  3SHF A;  1LEA A;  1Z1D A;  3H3Z A;  2IAI A;  2NYX A;  2LF8 A;  2LDU A;  4B3A A;  2HS5 A;  5DD8 A;  3WTU C;  3G4S I;  2EZI A;  2XAG A;  2PJR B;  4IVN A;  4RA2 A;  4BHP A;  3NQO A;  4A3B J;  1TWH J;  3EUA A;  3K1P A;  5FKN A;  2V9K A;  4CHU A;  1IF1 A;  5M3F J;  1QVT A;  1I6H J;  1IRF A;  3VOE A;  1TW3 A;  2UWM A;  1MBF A;  2PMZ N;  4ZZL A;  1YX5 A;  4ZYH A;  3S2D J;  2V26 A;  2XF6 A;  4DYR A;  2QLZ A;  1U8R A;  4CCJ A;  1Y8Q B;  1WI3 A;  3L00 A;  3IKV A;  3IKT A;  2CFX A;  2VI6 A;  2EIN H;  3MFK A;  5E1X A;  2PBI A; 
#chains in the Genus database with same CATH homology
 2Z33 A;  4N9H A;  1JE8 A;  2VE9 A;  4HDU A;  5J6X A;  3T5X A;  1BN5 A;  2UZK A;  4G9Y A;  5KVR A;  3F8B A;  3GW2 A;  4LLG F;  3IWF A;  4GXO A;  1UHM A;  3V8K A;  1TBX A;  4OIP F;  3SXY A;  4A0X A;  1TLH B;  1ZG5 A;  3TO6 A;  3RJP A;  2FEZ A;  5L3B A;  2ZNY A;  1FP1 D;  3FMS A;  4LLN A;  4CO8 A;  3GF2 A;  4RGS A;  3L2C A;  4LLL A;  3L9F A;  4HDV A;  2KJC A;  1ZH5 A;  3HIF A;  4KFC A;  3HRU A;  2FE3 A;  2ACJ A;  1K79 A;  2L54 A;  2E7W A;  3FF5 A;  2H6C A;  2IA2 A;  5D6E A;  1FBS A;  5D4S A;  4YFK F;  1S6L A;  4R1H A;  2HQR A;  2EV6 A;  2QQ9 A;  1D8K A;  3F6V A;  2QVO A;  2IVM A;  5L3E A;  5E17 F;  2HZT A;  2HYG D;  5DCM B;  2F5C A;  1Z6T A;  1BJA A;  4GGG A;  1JHH A;  2NNY A;  1W7P B;  3JTH A;  4KNY A;  4L5J A;  4UVC A;  2XGX A;  5FD6 A;  3N97 A;  1T6S A;  2M30 A;  1EV7 A;  1T39 A;  2OZ6 A;  4WXC A;  5IT9 Z;  1OR7 A;  5DCF A;  2L01 A;  4KUM A;  3HRS A;  4RGX A;  4MNU A;  2DT5 A;  2GA1 A;  1T98 A;  2C6Y A;  5H20 A;  2TDX A;  5HDG A;  1FBQ A;  4Q47 A;  2QWW A;  1TNS A;  3ULQ B;  5J8F A;  5DD4 A;  1QPM A;  1BIA A;  3Q9V A;  4HX7 A;  1O3Q A;  2E1N A;  1DUX C;  3FHZ A;  1J75 A;  1USS A;  1IXR C;  1HST A;  4UV9 A;  3DQV C;  2CG4 A;  2EA2 A;  1LVA A;  1OMI A;  1Z9C A;  1PUE E;  3U9G A;  4ZZD A;  3L7W A;  2YU3 A;  5ILU A;  2KJB A;  3ECO A;  4IJA A;  3BRO A;  2QBY B;  3KCC A;  3BP8 A;  2KIF A;  4FX0 A;  3BWG A;  5D5V B;  1MJA A;  3Q5F A;  3HSR A;  3K69 A;  3REO A;  2V79 A;  4I02 A;  1HKQ A;  4R79 A;  4HLY A;  3LFK A;  2O03 A;  4IXA A;  3LAJ A;  1K78 A;  4KMU X;  4B8X A;  4I0B A;  5K5O A;  3VB2 A;  1C0W A;  2RV8 A;  1LQ1 A;  1R58 A;  3HSF A;  1G3Y A;  1YW7 A;  2P5L C;  2Q8K A;  2CSO A;  4ON0 A;  4EV0 A;  2H6B A;  5CVU A;  4TV7 A;  3P9C A;  5D4R A;  3KEQ A;  1ZRE A;  1LDD A;  1KU9 A;  2PG4 A;  4AIJ A;  3HHG A;  2RDP A;  4A0Z A;  2LF7 A;  3M1E A;  3E5X A;  1BC8 C;  2RNJ A;  2OBP A;  5ICF A;  2HDC A;  2YR2 A;  4ESF A;  2Q2E A;  2WC2 A;  2J5O A;  2L4A A;  1IXS B;  1ZGJ A;  2ZXJ A;  2JTV A;  2PJP A;  1Z05 A;  1FYL A;  4GCV A;  2F2E A;  2HQN A;  1QZY A;  3QU3 A;  3GXO A;  3J80 K;  3PFI A;  3MCZ A;  5L3D A;  3DP7 A;  3JSO A;  5EEG A;  1O7L A;  2DAO A;  2E1C A;  3CUO A;  1U5T A;  4YFX F;  4ESJ A;  4IHS A;  3HRT A;  2RGV A;  2QZ8 A;  4KMF A;  2L02 A;  5LRS A;  2H27 A;  3DEU A;  3KE2 A;  3ROU A;  1YLF A;  4RAY A;  1BI0 A;  1K7A A;  4Z2Y A;  1RUN A;  3ZMZ A;  2FU4 A;  5BPI A;  4UNO A;  1TQM A;  2HTJ A;  4MEY F;  2D2W A;  1QBJ A;  2ISZ A;  3I64 A;  3EYI A;  1IXC A;  2NS0 A;  2ESH A;  1O3S A;  4L9T A;  4XBF A;  1KGS A;  3O2P E;  1K78 B;  4QWQ A;  4LJZ F;  4LGW A;  1V3F A;  4LD5 A;  4L18 B;  4GO1 A;  1STZ A;  4HYE A;  1FP2 A;  3BDD A;  1MJB A;  4G6Q A;  3WTY C;  2M1B A;  5D6F A;  1D5V A;  3R61 A;  1S29 A;  3COA C;  2G9W A;  1XN7 A;  4I0A A;  1P6R A;  4A5M A;  2IA1 A;  2VON A;  4OIQ F;  2PI0 A;  5BMZ A;  5HLG A;  2M5W A;  3TQN A;  1QO0 D;  3R6S A;  1XSV A;  2V1X A;  5DV5 A;  1JXS A;  5HOO A;  4CGZ A;  2JPC A;  3KLN A;  3IC7 A;  1MKM A;  2CW0 F;  3QOP A;  1J0R A;  1QNT A;  1IN4 A;  3RI4 A;  2P6T A;  3K0L A;  2D1V A;  1XDU A;  1XGN A;  1YS6 A;  1P4W A;  3E6M A;  3RTR A;  2IPQ X;  1H0M A;  3GX4 X;  1W4M A;  2P4W A;  3HYI A;  2B0L A;  3QPH A;  2Y48 A;  1U5T B;  1ZRF A;  4KYW A;  5FLX Z;  2AS5 F;  1ZAO A;  1FY7 A;  2LNB A;  1R00 A;  5DUK A;  3NRV A;  2HGC A;  3P7N A;  1OYI A;  2Z9O A;  4BYY A;  1ONV A;  4H0E A;  4EGZ A;  3SFZ A;  1U5T C;  1T38 A;  1U78 A;  5E1W A;  1G6N A;  2EA4 A;  2VN2 A;  3GLX A;  2EFN A;  5E18 F;  1R22 A;  4M72 A;  4LG0 A;  1FYM A;  2QUF A;  2K4B A;  1DPR A;  4PDK A;  4O5V A;  4OIN F;  2GZW A;  3J81 K;  1MJ9 A;  5FFZ A;  4WWC A;  4RGR A;  5ED4 A;  3LWF A;  4YG2 F;  1EH8 A;  4MQ9 F;  2XRN A;  3E5U A;  4HQM A;  2XAH A;  1O3T A;  3JAM Z;  1BM9 A;  1SD6 A;  5ILS A;  3B73 A;  3ECH A;  2IRF G;  4XLP F;  4EJO A;  4EJT A;  3KLO A;  1F5T A;  5JI6 A;  2NAZ A;  2ISY A;  1ZG1 A;  3PQK A;  3KZY A;  2DBB A;  1I5Z A;  3M8E A;  3RYR A;  2R7F A;  1LJ9 A;  2OU2 A;  4XSZ F;  3V7R A;  1YW8 A;  4RB1 A;  1GXP A;  3W6K B;  2DK5 A;  1UCR A;  4PZJ A;  1ZYR F;  3HOS A;  2P7V B;  1XMK A;  1IN7 A;  2XUB A;  5ICG A;  1R5G A;  3KET A;  2YX7 A;  3F3X A;  1XGM A;  4WXH A;  1G3W A;  4I2O A;  3FXQ A;  3J7A O;  1FT9 A;  2G7H A;  1FX7 A;  2MA3 A;  3F21 A;  2EFW A;  4Q4Z F;  2VT3 A;  3C3W A;  4OOI A;  1KU7 A;  1D3Y A;  1QGP A;  3T8T A;  5BOX A;  1IW7 F;  4NB5 A;  2IT0 A;  3LA7 A;  3RPQ A;  1TQP A;  2QBY A;  3GFJ A;  4O3M A;  2O3F A;  4ENN A;  4A5N A;  2X0L A;  4G94 A;  3WTT C;  4L0Z B;  1OYW A;  4LFU A;  5LHH A;  4DQ2 A;  1U2W A;  1T0F A;  2Q0O A;  1L3L A;  3OOP A;  1FYK A;  2PLY A;  4LG0 B;  2OZU A;  4F7Z A;  3E3V A;  2RC4 A;  4PGH A;  4R8H A;  1FSH A;  4RB0 A;  2IW5 A;  4ENM A;  4LMY A;  4CXF A;  1IN6 A;  2NRA C;  5L3F A;  1CGP A;  2DK8 A;  1IZ1 A;  4HF2 A;  2FBI A;  2HR3 A;  1WI9 A;  2HTS A;  2WV0 A;  2W85 A;  4RGU A;  3WE2 A;  4WXD A;  3EET A;  2FOK A;  3TOB A;  2MD5 A;  1S7O A;  2ZME A;  1RZ4 A;  6PAX A;  2O61 A;  3F8F A;  1JHF A;  3FX3 A;  5FO5 A;  5H6R A;  4IPA A;  4WX9 A;  2F5D A;  4ASN A;  1SFE A;  1VTN C;  3LQQ A;  2D45 A;  2XVC A;  4UVA A;  2HKO A;  4PGG A;  3I71 A;  1HKS A;  4M9Z A;  3IWZ A;  1WWX A;  3G73 A;  3BJ6 A;  3EYY A;  1YFH A;  2FSW A;  3DKW A;  1O57 A;  2P6S A;  1R23 A;  1V4R A;  1RIO H;  5HLI A;  2XAQ A;  2CO5 A;  1YO5 C;  2A3S A;  5A2Q Z;  2W57 A;  2A6E F;  1YQA A;  3GYH X;  4OMY A;  2GXG A;  1XSX A;  4A12 A;  3GVA A;  5AIP A;  2PMH A;  2ZBK A;  3JTG A;  1CF7 A;  3KFW X;  3CLO A;  1R1U A;  3MEX A;  1SMY F;  1XCV A;  5ICC A;  1DP7 P;  2MH2 A;  4GYI A;  3RKW A;  1YTY A;  1K6O A;  1ON1 A;  1A04 A;  2RVC A;  2WTE A;  4HLX A;  1Y0U A;  3E97 A;  2MC3 A;  2HYF A;  1B6A A;  2JSC A;  1LDJ A;  2IP2 A;  4Q48 A;  3HSE A;  2YSR A;  1SFX A;  1UB9 A;  4OMZ A;  2ESN A;  1YW9 A;  2HOE A;  1ZGA A;  2Y0M A;  2VBY A;  5JVT A;  3BZ6 A;  3ZPL A;  2XAS A;  3KP7 A;  1Q1H A;  3GFL A;  1HW2 A;  4UXN A;  4MTD A;  4BHC A;  2PEX A;  3H92 A;  5E1Z B;  2RKH A;  2F5F A;  3F8M A;  2EK5 A;  4YFN F;  4P55 A;  4HBL A;  4M73 A;  3V7S A;  3B02 A;  3R0J A;  2FF4 A;  2ZME B;  2Y75 A;  3EQL F;  1IN5 A;  1QZZ A;  3FMQ A;  4I98 B;  3TO7 A;  3ZMT A;  1AWC A;  3QRF F;  1DPU A;  4IRG A;  2H94 A;  1I1G A;  2F5E A;  5K5R A;  3LQR A;  4LK0 F;  3T8R A;  4S04 A;  2VOO A;  3LA3 A;  4ZYG A;  1XGO A;  3E6D A;  3ZMS A;  5HVQ C;  1Z7U A;  1BI3 A;  1O3R A;  1YS7 A;  2NNN A;  5JR3 A;  2DU9 A;  4EJV A;  5TJJ A;  4N0B A;  4HAM A;  1CF7 B;  1T2K A;  3GZ5 A;  1KYW A;  3J80 Z;  1WQ2 A;  3ERE D;  2XHK A;  2UXX A;  3CJN A;  1B4A A;  3RKX A;  1B59 A;  2VBW A;  4MTE A;  3WU1 B;  4HX4 A;  3R0A A;  1EH6 A;  5JFR A;  4OIR F;  4Q5S F;  4AVP A;  5ILV A;  1IAW A;  1UFM A;  3KP3 A;  3QP6 A;  2Z5U A;  2A61 A;  2L4M A;  2XAJ A;  3IL2 A;  1W5T A;  4BH9 A;  4ESB A;  4U7D A;  1B1B A;  3QPT A;  1EH7 A;  5J8C A;  4MGR A;  5CLS A;  2DPU A;  1R1V A;  3O3K A;  2VOP A;  4A0Y A;  1P2F A;  5DDG A;  5BQT A;  4P9F A;  4I7H A;  3HRM A;  3WTX C;  4XRF A;  1KA8 A;  4JK1 X;  5D5X B;  3WE3 A;  3F8N A;  1QQI A;  4M6X A;  1SMT A;  2FRH A;  1BI2 A;  3VEP A;  2EV0 A;  3DPL C;  4LK1 F;  3V8L A;  2G7U A;  4E70 A;  1XD7 A;  4M6Y A;  5HS9 A;  1H9G A;  4EM2 A;  2K4J A;  1BBY A;  2QQA A;  2R7D A;  2DTR A;  4U0V A;  1PP8 F;  4GYG A;  5HS8 A;  1MGT A;  3WG9 A;  1HW5 A;  4S05 A;  5TRD A;  3R60 A;  5LHG A;  4YIF A;  4OU0 A;  3F72 A;  4LB6 B;  4A6E A;  2ZKZ A;  4EGY A;  3KEO A;  3DPT A;  2MH9 A;  3QP5 A;  3GUD A;  2R3S A;  1SD5 A;  2FNP A;  3OV8 A;  2W25 A;  1I1S A;  4AIK A;  2OQR A;  1TTY A;  3P9K A;  2P5K A;  1AOY A;  4Y13 A;  2BE5 F;  3V8J A;  3SZP A;  3GFI A;  4WK8 F;  1XGS A;  1WSU A;  2AXL A;  4ZYD A;  3RYP A;  2ZFW A;  2STW A;  1TQI A;  5FD5 A;  3K1M A;  4EJU A;  4L9N A;  4L0Y B;  5LEK A;  2YX4 A;  4AWX B;  1SFU A;  2K86 A;  2MLK A;  4CZZ A;  5HLH A;  3ISP A;  2Z99 A;  3U1D A;  2GWR A;  2XRO A;  1HSJ A;  5JHU A;  3E6B A;  1G3S A;  3EDP A;  3PQJ A;  2O8X A;  4KA4 A;  4HQE A;  3GWZ A;  1PP7 U;  3JAM K;  3I0T A;  4BNC A;  4RS8 A;  4BQA A;  4EJW A;  3I59 A;  2V9V A;  2GA2 A;  3I54 A;  2FA5 A;  3C7J A;  2HKX A;  2PMU A;  3IRQ A;  3IHU A;  3WTZ A;  1RUO A;  1F1Z A;  4WF2 A;  2DPD A;  3J81 Z;  5FGM A;  1LDK B;  1FWZ A;  3RKY A;  5ERI A;  3HTS B;  5CVR A;  4KDP A;  4PCQ A;  2XKP A;  3ABU A;  2P7C B;  3KP5 A;  5AON A;  2XAF A;  3GEZ A;  2RN7 A;  3G3Z A;  3DF8 A;  4IRI A;  1PDN C;  3QAH A;  3BJA A;  5BPD A;  4FT8 A;  1FBU A;  3N4M A;  2FBK A;  2HFH A;  2KRF A;  1KU2 A;  1SD4 A;  1GVJ A;  1TNT A;  5LRR A;  5L3G A;  1H9T A;  5LGU A;  1G4D A;  2GAU A;  3K9T A;  3SZT A;  1MDM A;  2MLG A;  1S7A A;  2VC0 A;  2BBY A;  3WTW C;  2STT A;  3CO7 C;  3MWM A;  4EVI A;  5CYV A;  2BV6 A;  4G8X A;  3M9A A;  2FML A;  1E17 A;  4M74 A;  1P4A A;  2RQP A;  2D1H A;  4EM0 B;  1ZRD A;  3CO6 C;  2M8E A;  1MD0 A;  4MEX F;  1Z91 A;  3WU0 A;  3ZMV A;  4KT5 C;  3K2Z A;  1B9N A;  1FOK A;  2VE8 A;  2Z3Y A;  5K1Y A;  1OYY A;  5LEJ A;  1KYZ A;  4ETS A;  3KP4 A;  3E6C C;  2HEO A;  3I59 B;  4P9U A;  1BIB A;  4XSX F;  4IF4 A;  3F22 A;  3TO9 A;  3ZP5 A;  4L9J A;  3Q9S A;  3GFM A;  3F23 A;  5F1R A;  3HOT A;  3RDI A;  5IT9 K;  1LNW A;  4AD9 A;  4I01 A;  3ML6 A;  2LKP A;  4U0Y A;  4OIO F;  2OD5 A;  1YIO A;  3VOD A;  1J2X A;  3P9I A;  2QQB A;  1U6G A;  3TDZ C;  5F6F A;  4K2E A;  2VBZ A;  2QEN A;  1RI7 A;  5CVJ A;  2OQG A;  4A6D A;  2ZNZ A;  3CUQ A;  1F9N A;  3DFG A;  4HX8 A;  4ZH4 F;  4BHB A;  5A2Q K;  1BI1 A;  5H6Q A;  4ENJ A;  2XIG A;  2JPB A;  2V1U A;  1L0O C;  1ULY A;  1X3U A;  3WGG A;  1UST A;  4ZYE A;  3GZ6 A;  2EFP A;  2COM A;  3BPX A;  3FMR A;  5CVI A;  2EV5 A;  4RAZ A;  2EFQ A;  3WGH A;  4U7B A;  4IRH A;  2A6H F;  3BY6 A;  3RIR A;  1MDM B;  4G6D A;  2FMY A;  4EQQ A;  3LAP A;  2E7X A;  3KP2 A;  4L9V A;  3D5L A;  4HF1 A;  2BYV E;  5LBQ A;  4HZF A;  3R4K A;  4KN4 X;  3LST A;  1HXD A;  2EWN A;  2W84 A;  5E8G A;  1SAX A;  1XCB A;  4HV5 A;  2VOD A;  2VBX A;  3F6O A;  5DYM A;  2MBF A;  1FNN A;  4HF0 A;  1ZAR A;  2DI3 A;  3K1N A;  4M71 A;  3V7C A;  5LHI A;  5HS7 A;  1ZLK A;  5L3C A;  1I27 A;  1GXQ A;  2QYO A;  3F8C A;  2EB7 A;  5DUI A;  5CVV A;  2DFI A;  4YII A;  2VC1 A;  2BGC A;  1KU3 A;  3CTA A;  4DNC A;  1J5Y A;  1HQC A;  5BS6 A;  1KQ0 A;  1ZHF A;  2ELH A;  2VT2 A;  1YG2 A;  1F4K A;  1WKM A;  1WRJ A;  1ON2 A;  1FZP B;  5D5U B;  2YPR A;  2DQR A;  3BJO A;  3I53 A;  3JW4 A;  4M9S A;  1UHW A;  1RNL A;  5FB2 A;  3FM3 A;  1R1T A;  1Z6R A;  1S8N A;  5LLQ A;  3WTS C;  1ODD A;  1J7K A;  1GHC A;  1HW1 A;  2CGP A;  4IHT A;  2A68 F;  3C18 A;  5E8I A;  4WCG A;  1R7J A;  5IT3 A;  3CUQ B;  4P5O A;  4G7Z F;  3AAF A;  1MZB A;  4U0W A;  3W6J B;  1W5S A;  4UHT A;  3U2R A;  1D8J A;  1HBX G;  1B9M A;  1FPQ A;  4N9I A;  2XKO A;  4A2U A;  3NEU A;  2K02 A;  3QU6 A;  3CUQ C;  5F64 A;  1JGS A;  4U88 A;  3SQN A;  2X4H A;  3TKY A;  4KN7 X;  3IRR A;  3O6B B;  1IUY A;  5K5Q A;  3M7G A;  2FQ3 A;  3L09 A;  1XSD A;  3ABT A;  4KIF A;  3HUG A;  2UXN A;  2W24 A;  3FXR A;  4NHJ A;  3FM5 A;  4HOB A;  3S2W A;  3WGI A;  3WOD F;  1LEB A;  5D5W B;  1ZLJ A;  2WWY A;  3TOA A;  4CIC A;  2ADU A;  4HV6 A;  1FC3 A;  3HTU A;  5CJ9 A;  2H09 A;  2EFO A;  4FHT A;  1XB4 A;  1R5H A;  5D8L B;  2V6C A;  4M9X A;  1S3J A;  1KQ9 A;  2P8T A;  2VXZ A;  2K27 A;  2A07 F;  5LGT A;  4NQW A;  5HDK A;  2PN6 A;  1DDN A;  2JZY A;  2J5P A;  2FBH A;  2M87 A;  3ZMD A;  4L5I A;  4I09 A;  2ZJ2 A;  1SD7 A;  1FLI A;  4CYD A;  4KIG A;  3TDU C;  2V1D A;  4HA8 A;  2EJR A;  4EM1 A;  2PFB A;  5ICE A;  1BOA A;  4UUV A;  3FWE A;  1G3T A;  1J59 A;  3EUH A;  2HWV A;  1E2X A;  4D0P A;  5FFX A;  1U3E M;  3VFZ A;  4UVB A;  1IRG A;  5E20 A;  5AIQ A;  3DXJ F;  2PQ8 A;  1XMA A;  3DV8 A;  3TGN A;  3I58 A;  2ZO4 A;  3WTV C;  4RB3 C;  3H3U A;  5HDN A;  4O6J A;  4B09 A;  1XDS A;  3I5U A;  4FX4 A;  5FLX K;  3T1B A;  5KK1 A;  2A69 F;  4Y17 A;  1NHA A;  2L3D A;  4UV8 A;  4HW0 A;  2CQK A;  4KIB A;  2DO7 A;  1IN8 A;  1ZRC A;  2P5V A;  3LA2 A;  2BEO A;  3FXU A;  3ZN0 A;  4XLN F;  3M8F A;  2GXB A;  2KIU A;  3RPU A;  4CDG A;  4AIH A;  4Y15 A;  2KIM A;  4EMS A;  1ZN2 A;  2KKO A;  1REP C;  3E5Q A;  3I4P A;  5D8K B;  1P4X A;  3MAJ A;  2DLL A;  4BAY A;  3D0S A;  4RB2 C;  1BC7 C;  2O6G E;  4G7O F;  1FSE A;  1J9I A;  4ENK A;  3BPV A;  1R36 A;  3FZV A;  3JSP A;  1W7P D;  3HHH A;  2QM3 A;  2O0Y A;  2ETH A;  1ZG3 A;  3MQ0 A;  2DQL A;  2K7L A;  3ZN1 A;  1LB2 A;  2IA0 A;  1P92 A;  3KP6 A;  3GO5 A;  2CWE A;  2M45 A;  2LSO A;  3ZQ7 A;  2GIV A;  5DCM A;  3C1D A;  2A5Y B;  2FXA A;  2JRT A;  1O7F A;  4BXU A;  1W7P A;  1KQ8 A;  5EEH A;  1HKT A;  1OKR A;  2IJL A;  5LGN A;  3MZH A;  3T0Y A;  2FNA A;  2OA4 A;  4MQV A;  2CYY A;  3CDH A;  4P96 A;  4KIC A;  3V4G A;  3ZMU A;  2XV4 S;  5DEQ A;  4MHG A;  1TW2 A;  2GQQ A;  4JQF A;  3BOQ A;  2DW4 A;  1YYV A;  3ELK A;  3KZZ A;  4QLC U;  2OAZ A;  3MZY A;  2JT1 A;  2ZCW A;  1OPC A;  4JBA A;  4G7H F;  4LB5 A;  1I6X A;  3SHF A;  1LEA A;  1Z1D A;  3H3Z A;  2NYX A;  2LF8 A;  2LDU A;  2HS5 A;  5DD8 A;  3WTU C;  2XAG A;  4IVN A;  4BHP A;  3NQO A;  3K1P A;  4CHU A;  1IF1 A;  1IRF A;  3VOE A;  1TW3 A;  2UWM A;  4ZZL A;  4ZYH A;  1U8R A;  2QLZ A;  3L00 A;  3IKV A;  3IKT A;  2CFX A;  3MFK A;  5E1X A;  2PBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...