3JTHA

Crystal structure of a transcriptional regulator hlyu from vibrio vulnificus cmcp6
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
MNLKDMEQNSAKAVVLLKAMANERRLQILCMLHNQELSVGELCAKLQLSQSALSQHLAWLRRDGLVTTRKEAQTVYYTLKSEEVKAMIKLLHSLYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription activator HlyU
publication title Crystal structure of the transcriptional activator HlyU from Vibrio vulnificus CMCP6.
pubmed doi rcsb
source organism Vibrio vulnificus
total genus 29
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jthA00
2RDPA 3J81K 3V7CA 2OD5A 2W84A 1KYWA 1LVAA 2ZBKA 4HA8A 1Z1DA 3RKYA 1UB9A 2DW4A 2QUFA 3RKWA 1SFUA 1Z05A 2ZMEA 3KEOA 4RB3C 2GZWA 4HYEA 4JBAA 3WGGA 3FXQA 1W7PB 2E7WA 3HOSA 4KFCA 3HTSB 2DU9A 2D2WA 2VE9A 2HR3A 4LG0A 3DQVC 1W7PD 4KN4X 1FX7A 3E5UA 4XRFA 3KCCA 1ZLJA 5K5RA 2FRHA 4HAMA 4MQ9F 4P96A 4AWXB 1ZH5A 5ICGA 3T8TA 3J80Z 2RQPA 3MCZA 2XUBA 5D5VB 4MHGA 4WK8F 1YW8A 5CVVA 2KIMA 4EV0A 1O3RA 2DLLA 5H6QA 3F22A 1R22A 3DF8A 1MZBA 3GYHX 1GXPA 1I5ZA 3BPVA 5FD6A 4L0YB 1P4AA 3MWMA 1ZG5A 4A0YA 3V4GA 1OYYA 3HYIA 3VB2A 4OIOF 1IXSB 1UFMA 1YTYA 4CO8A 5K5QA 2W57A 4GCVA 4HW0A 1HKTA 3DPTA 4DQ2A 2P7CB 3FWEA 2FEZA 4NQWA 4EJWA 5L3EA 5FFZA 4L5JA 5CJ9A 2V9VA 2A6EF 2LNBA 4I7HA 3GZ6A 5LHHA 1K78A 1W4MA 1TW3A 3F8BA 1I27A 3GFMA 4RGXA 1YIOA 3RPQA 1J75A 1F5TA 3MFKA 5HLGA 1GHCA 3ISPA 2QWWA 3GFIA 1R23A 5A2QK 1JXSA 3WG9A 2K4BA 3HIFA 1TNTA 1LDJA 4A0XA 4ESJA 1S3JA 1OYWA 2QM3A 1O3TA 2HTJA 4NB5A 3ULQB 1WSUA 1EH7A 4KNYA 2EFOA 2IPQX 3CO7C 2FBKA 2XGXA 4M9ZA 5DCMA 3JTGA 5ED4A 1OKRA 5EEHA 2WWYA 1RZ4A 4XLPF 1R5GA 2ZNZA 5L3DA 1FT9A 2MLGA 3HHHA 3JTHA 4KIGA 1BJAA 3P7NA 5ICCA 4RB0A 2UWMA 4U0WA 3QPTA 2ADUA 2P7VB 2QQ9A 4KDPA 5H6RA 3SXYA 1PDNC 3LWFA 4HLXA 4ENMA 3IC7A 2F2EA 4M71A 3I59A 2EA4A 2WV0A 3KP2A 4GGGA 4G8XA 2EV0A 3D0SA 1MJBA 3TDUC 1LJ9A 1HSJA 3KP4A 4YIFA 3E97A 2CW0F 1KU3A 3C1DA 3BJ6A 4WCGA 1ZG1A 4Q4ZF 2VOPA 2QYOA 3B02A 1ZG3A 3U2RA 2EV5A 4IXAA 2HTSA 3RDIA 3RYRA 2EFPA 4KT5C 3RKXA 2PFBA 5F64A 5CVJA 4KIFA 4ZYEA 2FNAA 3F21A 3HRMA 3WTUC 4IHTA 5CYVA 5E1XA 2R7FA 2IT0A 1YLFA 2NYXA 2W24A 1FYKA 1D3YA 1S8NA 4A2UA 3IKVA 5KVRA 4IF4A 3D5LA 4N9HA 1E2XA 3ZMZA 1HSTA 3M8EA 2XKOA 1SMTA 1H0MA 2RN7A 2TDXA 2V1DA 2XV4S 3ELKA 2OAZA 2HKOA 4FHTA 1HKSA 4EJUA 4MTDA 4KMUX 1QQIA 1Y0UA 5HDGA 1HXDA 4KIBA 1X3UA 2LSOA 4LLLA 3WU1B 1FNNA 4BAYA 1ULYA 5FGMA 1BI2A 3F6VA 1DPUA 1IRGA 1T6SA 1YS7A 3DP7A 4R1HA 1XSXA 4YFKF 5E8GA 4M74A 1EH8A 3ZMSA 1T39A 1IN7A 2EFQA 2CFXA 1LDKB 1IN6A 3FM5A 3T0YA 4WWCA 3WODF 3EDPA 1Z6TA 3ZMDA 3EYIA 5BS6A 1PP7U 4RGRA 1YFHA 2QENA 5E20A 2DQLA 4Q5SF 1ZAOA 2ZO4A 3C7JA 1ONVA 1BC8C 3BDDA 4AIKA 4EJTA 3ZN0A 3BWGA 1F4KA 4EM0B 3PFIA 2D1VA 2OZ6A 4CHUA 2MBFA 3JSOA 1D8JA 3IWFA 3U1DA 4YG2F 4PDKA 3P9CA 2ZKZA 1VTNC 1FP1D 4AIJA 4XBFA 5BPIA 1ZN2A 4E70A 3N97A 3MZHA 3SHFA 2VBZA 3MEXA 2XROA 5BOXA 1BM9A 2HOEA 1OMIA 3KP6A 5TRDA 2YR2A 2BV6A 2EJRA 2CGPA 1NHAA 1CF7B 4IHSA 2BGCA 4KMFA 1XSVA 2UZKA 1ZRCA 4S05A 4I02A 1WI9A 1D5VA 1LNWA 4HV5A 2LF7A 3NEUA 5ILUA 2BE5F 3J80K 1ON2A 3GVAA 4HX7A 1ZHFA 2PQ8A 5CLSA 5CVUA 3BJOA 5E1ZB 1J2XA 4B8XA 4A12A 2YPRA 1K6OA 2CYYA 4NHJA 1I1SA 4O3MA 2RC4A 3GWZA 1W5SA 3Q9SA 1J0RA 1S7AA 1Z7UA 4UV8A 2HYGD 3LA2A 2O61A 4N0BA 5FB2A 1U5TC 1PUEE 2K86A 4LK0F 2QZ8A 1IN8A 3BY6A 2AS5F 4L0ZB 2GXBA 1IXRC 1UHMA 1STZA 1U5TA 4LB5A 3M8FA 3MQ0A 3P9IA 3KEQA 3HRTA 4XSXF 2M87A 2PI0A 3LSTA 4Z2YA 4FX4A 2GXGA 1DPRA 3RJPA 2D1HA 3N4MA 1MDMA 3K2ZA 1KGSA 2O8XA 3TO9A 4BXUA 3FHZA 1YG2A 5ILSA 4RGUA 1J9IA 3LFKA 3V8JA 2KIFA 1IAWA 5ILVA 2W85A 3ABUA 2V6CA 5LHGA 2IW5A 1XB4A 1OYIA 3H92A 1QPMA 5ICEA 2UXXA 1XDUA 2QQAA 3KP7A 3ABTA 3E5XA 3MAJA 2ACJA 4BHCA 4L9JA 2M5WA 4HF1A 1CGPA 2V1UA 4PGHA 5L3FA 1J5YA 1B59A 5L3BA 2IRFG 2MC3A 4Y13A 4JQFA 1MJAA 4EGZA 2L4AA 4YFNF 1LEBA 5D6EA 1WWXA 2RKHA 5DUIA 2WC2A 2E1CA 2HQNA 5E17F 1HW2A 1AOYA 2Y75A 1KU2A 4HLYA 3R0JA 2DT5A 1DDNA 1LQ1A 3HRSA 3RTRA 5E1WA 2K7LA 3J7AO 5LGNA 3CDHA 4O5VA 4A0ZA 4XSZF 2QLZA 2HS5A 3F8MA 2IA2A 4K2EA 5DV5A 5EEGA 3IWZA 2PBIA 2FOKA 1TQMA 4I0AA 5LHIA 4L18B 2VODA 2A6HF 3L00A 2XASA 1J7KA 3I71A 4G7ZF 2VN2A 2VBWA 2ZFWA 3P9KA 1UCRA 3G73A 3GFJA 3F6OA 1UHWA 1R1UA 4G7OF 2G9WA 1FWZA 4G94A 2MD5A 3ECHA 2A3SA 1XCBA 4CDGA 2JPCA 3I64A 2NS0A 3SZPA 4EJVA 2HYFA 3FX3A 2A5YB 2OBPA 4N9IA 4BQAA 1T38A 3H3UA 3WGHA 5K5OA 4PZJA 4MEYF 1H9GA 5F6FA 2PEXA 3K0LA 3M9AA 3Q5FA 4B09A 4UVBA 1G6NA 2ZCWA 2M30A 5J6XA 1K79A 1IN5A 3F3XA 1S6LA 2A61A 5LEJA 2DK8A 2FMLA 3JSPA 2YSRA 4LMYA 5DD8A 2VC0A 4G6QA 4UV9A 2GA2A 3BROA 3T1BA 4JK1X 4A5MA 2VT3A 4RAYA 4R8HA 1K7AA 2X4HA 1ZGAA 5J8CA 3SQNA 6PAXA 4ENKA 2IA1A 2KJBA 3QOPA 1WQ2A 2KRFA 2HGCA 4CXFA 1W7PA 3F8NA 3H3ZA 1MGTA 2CO5A 5LGUA 3MZYA 5HLHA 2M1BA 4M73A 1R36A 2F5EA 3TOAA 4KA4A 5HVQC 1XSDA 4OINF 5AIPA 1U8RA 2V79A 4KN7X 1FPQA 2MLKA 3HUGA 3R6SA 1Z91A 4P9UA 2XIGA 2QQBA 1HQCA 4ESBA 3VFZA 3O3KA 2DO7A 2BBYA 1QZZA 1U6GA 4ETSA 1XMKA 1FYMA 2PMHA 5ERIA 4UVCA 3R60A 3V7SA 2E7XA 3DXJF 5FO5A 1ZLKA 2VBXA 1E17A 2XRNA 4BYYA 3TKYA 4LLGF 2Z33A 3E6CC 5FLXZ 2E1NA 3IHUA 3QP5A 2HQRA 2OQGA 3TO7A 1GXQA 2ZNYA 2B0LA 2IP2A 2ZXJA 1ZGJA 3GEZA 2DPUA 4L9VA 2K02A 1EV7A 1J59A 4OMZA 2GIVA 4WX9A 4U7BA 2KIUA 4O6JA 3B73A 2P6SA 2J5OA 3RYPA 2DTRA 1DP7P 1C0WA 3FXUA 5JVTA 2EFWA 1R00A 3I54A 1S29A 2L4MA 1RIOH 2W25A 1B4AA 3M7GA 3FM3A 1SMYF 3E6MA 5D8KB 4ZYGA 4Y17A 3E5QA 4GYGA 2PMUA 3WTXC 3O2PE 1BIAA 1U78A 1B9MA 4LB6B 3LAPA 3FXRA 2JZYA 2H27A 2HZTA 2EFNA 3VEPA 5HDNA 4R79A 1R1TA 2MH9A 2YU3A 3F8FA 5D4SA 3CUQB 1P92A 3ECOA 3L7WA 3OV8A 2PLYA 1P2FA 1T0FA 3WTYC 4H0EA 1MKMA 3HSRA 2A69F 1SFEA 3F72A 2DFIA 2RV8A 3Q9VA 2VC1A 3PQKA 3DPLC 2EA2A 5FD5A 4OOIA 2Q0OA 2ZMEB 3RIRA 4MTEA 5HOOA 2EV6A 2EWNA 3RI4A 2LF8A 1JE8A 4WF2A 3V8KA 1SD7A 2BYVE 2M8EA 3QU6A 2P6TA 2OA4A 2G7HA 1BC7C 3QPHA 3GFLA 3KLOA 3BJAA 2J5PA 4LG0B 1YO5C 2A07F 3WTSC 1KYZA 4EM2A 2FXAA 2KJCA 3ZMVA 2FA5A 4AD9A 2R3SA 4ZZLA 2K27A 5JFRA 1G3TA 5K1YA 2Z5UA 4ZH4F 1RUNA 1TBXA 4M9SA 4LLNA 1S7OA 3HRUA 4AIHA 3CTAA 1KU9A 5HS8A 4UVAA 2EB7A 5BQTA 3OOPA 4D0PA 4ASNA 2Y0MA 1KA8A 3L09A 2L01A 4I01A 2NRAC 1TLHB 1O7LA 2M45A 3WTZA 1REPC 2VE8A 2DPDA 3IRRA 3WTVC 3FZVA 1LEAA 5D4RA 4A5NA 2P5KA 3LAJA 4ENNA 3U9GA 4BHBA 4HV6A 2OQRA 2FBIA 3WTTC 1K78B 4EJOA 1IN4A 3AAFA 1QZYA 3ML6A 2EK5A 5DYMA 4OU0A 2O03A 4HQMA 2VT2A 1FBQA 2P4WA 2DQRA 1IZ1A 4A6EA 1XDSA 2MH2A 5HLIA 3GX4X 4HF0A 5LEKA 1BN5A 5D5UB 3NQOA 2VOOA 5DCFA 2HFHA 2P5LC 2G7UA 1KQ9A 5CVIA 2VXZA 2Q8KA 2RGVA 4LFUA 1FBUA 2FF4A 1YYVA 4I0BA 3BOQA 3CO6C 1XGNA 3ZQ7A 2XAQA 5DCMB 4G9YA 1HKQA 5D5WB 1R7JA 4AVPA 2CSOA 2F5CA 3ZPLA 4OIRF 1EH6A 2UXNA 4A6DA 1BIBA 3QP6A 1JHHA 1P6RA 4FT8A 4RB1A 4OIPF 2COMA 4EMSA 1V4RA 4U0VA 3K69A 2Y48A 1W5TA 2GAUA 1LB2A 4LD5A 3JW4A 5IT3A 3QAHA 2BEOA 1SAXA 3V8LA 2L02A 3I59B 1JHFA 3QU3A 3WGIA 2OU2A 1XCVA 2NAZA 3I58A 4GXOA 1KQ8A 2Z9OA 3WE3A 4HZFA 2LDUA 3L2CA 1KQ0A 1WKMA 3CJNA 1ZRFA 3DKWA 5BMZA 4RS8A 1HBXG 3HTUA 4WXCA 4OIQF 2HDCA 2FU4A 3F23A 4LJZF 2DBBA 4G6DA 5IT9Z 3EETA 2ELHA 2O0YA 3JAMZ 1CF7A 5D5XB 2QBYB 3GLXA 3W6JB 4M72A 4I98B 2VBYA 5LLQA 4MEXF 2ESHA 1XD7A 2A68F 2CWEA 1FZPB 4L9TA 3WE2A 4XLNF 3E6BA 2H6CA 3KZYA 4ZYDA 1QNTA 4Q47A 3TOBA 1BI1A 2Z3YA 4QWQA 3KLNA 1V3FA 1HW5A 5DUKA 1A04A 4EGYA 1TW2A 2Z99A 3TQNA 1R5HA 4RB2C 1MJ9A 5FLXK 5HDKA 2CG4A 3TO6A 3J81Z 1P4XA 1TTYA 4IRHA 5E18F 4HX8A 3FMQA 5JHUA 2C6YA 3ROUA 1O57A 1O3QA 5AONA 4M9XA 4U88A 3T5XA 4EQQA 4U0YA 2OZUA 1OR7A 2XAHA 4WXDA 4LGWA 2ISYA 3E6DA 4BH9A 4HDUA 4CZZA 1G3SA 5LGTA 3COAC 1SD4A 3DV8A 3G3ZA 3K1PA 1QGPA 2K4JA 2D45A 5L3CA 3T8RA 1KU7A 4MQVA 1USTA 4IRGA 5DEQA 2F5DA 2NNNA 3F8CA 5HS7A 5F1RA 3LQQA 5CVRA 1IRFA 3WU0A 1I1GA 2IJLA 4L5IA 3BZ6A 3E3VA 1H9TA 4ZZDA 4P9FA 1B1BA 4RGSA 2FBHA 5LRRA 3K1NA 3FMSA 2H94A 5E8IA 3I4PA 3K1MA 2Q2EA 3DEUA 3LQRA 3NRVA 2L3DA 1BI3A 3VODA 3IRQA 2GA1A 2JT1A 1GVJA 2HEOA 3EUHA 1LDDA 4U7DA 3CUOA 2P8TA 1YW9A 3KETA 2RVCA 2L54A 4PCQA 4TV7A 1IUYA 1FC3A 1G4DA 1IXCA 3W6KB 4I09A 3R0AA 4HBLA 4Y15A 3SZTA 3V7RA 2QBYA 1XMAA 4HF2A 1YW7A 1L3LA 3C18A 4UNOA 4MNUA 4EM1A 5A2QZ 3ZMUA 3BPXA 3GF2A 1USSA 5D8LB 2JTVA 1SFXA 2PG4A 4P5OA 1MD0A 1F1ZA 4ESFA 2JRTA 4M6XA 5LBQA 5D6FA 2JSCA 2H09A 5KK1A 1ON1A 2XKPA 4IJAA 4HDVA 4MGRA 3R4KA 2ZJ2A 3GO5A 3HSEA 3REOA 3TDZC 1SD6A 2PN6A 2O6GE 2DK5A 4Q48A 1TNSA 1L0OC 1Z6RA 5JI6A 3GUDA 2LKPA 4HOBA 1G3YA 3EQLF 2IA0A 1FYLA 3I0TA 2DI3A 1R58A 4P55A 2XAFA 3ERED 1FY7A 1U5TB 1XGSA 1O3SA 2CQKA 1SD5A 4ON0A 2MA3A 3HHGA 2ESNA 1RUOA 2V1XA 1ZRDA 1FBSA 4UUVA 1MDMB 1T2KA 4DNCA 1Z9CA 2F5FA 2ETHA 4L9NA 3S2WA 3FF5A 3RPUA 1RI7A 2HWVA 2X0LA 4FX0A 4CYDA 1B9NA 4KYWA 1XN7A 1YS6A 1ZYRF 1BBYA 1ODDA 1TQIA 5J8FA 1FSHA 5H20A 3KP5A 3R61A 3ZMTA 4OMYA 3FMRA 5HS9A 4YIIA 4LK1F 4CICA 2FNPA 3EYYA 1BOAA 5ICFA 4IVNA 5L3GA 1G3WA 4HQEA 4UXNA 2GQQA 2P5VA 3WTWC 4F7ZA 1QO0D 2H6BA 2GWRA 4I2OA 5DD4A 1IW7F 4IPAA 4G7HF 4ENJA 1DUXC 4GYIA 4BHPA 2IVMA 2HKXA 2XAJA 3QRFF 1FSEA 1HW1A 1IF1A 4CGZA 3IL2A 2FE3A 5AIQA 2AXLA 1BI0A 3TGNA 2QVOA 5TJJA 4HX4A 3IKTA 4BNCA 4GO1A 3VOEA 2FSWA 2JPBA 1U3EM 4UHTA 3KZZA 1PP8F 3C3WA 1WRJA 3BP8A 3DFGA 3GW2A 4RAZA 1F9NA 2XAGA 3I5UA 5FFXA 5JR3A 4S04A 3HOTA 4M6YA 2YX7A 2XHKA 3CLOA 3KE2A 4ZYHA 3SFZA 4KUMA 3K9TA 2STWA 2PJPA 1P4WA 3GXOA 4KICA 2ISZA 2O3FA 4YFXF 1D8KA 5LRSA 1QBJA 1O7FA 5BPDA 3KP3A 2XVCA 4IRIA 5IT9K 3HSFA 1ZREA 3ZP5A 3JAMK 3PQJA 3I53A 3L9FA 1T98A 2R7DA 2FQ3A 3O6BB 2YX4A 1ZARA 3LA7A 3KFWX 3CUQC 1TQPA 1R1VA 2VONA 1FP2A 4QLCU 3LA3A 1Q1HA 4EVIA 5DDGA 2NNYA 2STTA 2KKOA 1I6XA 2RNJA 1RNLA 3GZ5A 3M1EA 3CUQA 4WXHA 4PGGA 1FLIA 1OPCA 1YQAA 1XGMA 1FOKA 1U2WA 2FMYA 1AWCA 2DAOA 2WTEA 1B6AA 1JGSA 3ZN1A 1XGOA
chains in the Genus database with same CATH superfamily
4ABZA 1OLTA 2RDPA 3J81K 3V7CA 2OD5A 4DIQA 4F91B 1X1PA 2W84A 3G71I 5IYDJ 3DTKA 3MKWB 1KYWA 1LVAA 1N78A 2ZBKA 1IGNA 2Z16A 4HA8A 1Z1DA 3RKYA 1UB9A 2L7FP 4Y33A 2DW4A 2QUFA 3LFUA 3RKWA 1SFUA 3TBIA 1Z05A 1E3HA 4PSXA 5FKKA 2ZMEA 2L0KA 3KEOA 4J01A 4RB3C 2GZWA 2LP0A 3CMMA 4HYEA 2XPWA 1XX5A 2HXIA 4JBAA 2FX0A 3WGGA 3FXQA 2KRHA 1W7PB 2HNHA 2KIQA 2E7WA 2H1LA 2K9LA 3HOSA 1DQUA 4KFCA 2ZXWH 3HTSB 3HL2A 2R5YA 2DU9A 2D2WA 2VE9A 2HR3A 4LG0A 4C2TA 3CC2I 3J7AY 5KCMA 3DQVC 3SEZA 1W7PD 1QU3A 4KN4X 1FX7A 5GP9A 1PUFA 1B8IB 2CUZA 3HUGB 1IDYA 3E5UA 1BR4A 4XRFA 1R9TJ 3OY9A 3KCCA 1ZLJA 5K5RA 1WPKA 2FRHA 4HAMA 4MQ9F 1RESA 4P96A 2JJ7A 4AWXB 1ZH5A 9ANTA 5ICGA 3DWLE 4XR6A 3T8TA 3J80Z 2RQPA 3MCZA 3OSFA 2XUBA 2KRCA 1LFPA 5D5VB 4MHGA 2PJRB 4V2GA 4WK8F 1YW8A 5CVVA 2KIMA 4EV0A 1O3RA 2LH9A 2DLLA 5H6QA 3F22A 1R22A 4UB8C 3DF8A 1MZBA 3GYHX 1GXPA 2NVQJ 2OTJI 1I5ZA 3BPVA 5FD6A 4L0YB 2JA2A 3OSGA 2CV1A 3JRIA 2YUSA 3HOXJ 1P4AA 2F4OB 3MWMA 1ZG5A 4A0YA 1O4XA 3V4GA 1OYYA 3HYIA 2WAEA 3VB2A 4B4CA 3MZ8A 1BL0A 3V42A 2K9MA 4H4KC 4OIOF 1IXSB 4A3JJ 1UFMA 2HI3A 1YTYA 4CO8A 5K5QA 1ETYA 5GPAA 2X48A 2JA8J 3PL8A 2W57A 4GCVA 4HW0A 1HKTA 2K85A 3DPTA 3D5RC 4DQ2A 2P7CB 3FWEA 4RM3A 3CQZJ 5TGTA 3TW7A 2JA5J 2OTLI 4NNJA 2FEZA 2K5CA 3VYSB 4NQWA 3H0GJ 4EJWA 5FFZA 5L3EA 4IX7A 1JTYA 1OCRH 4L5JA 4RDUA 2R7QA 5CJ9A 2LLKA 2V9VA 2A6EF 2F4MB 2LNBA 2JWTA 2IGNA 4I7HA 4IL6C 3GZ6A 5LHHA 4BY7J 1K78A 5M3FJ 2Y30A 1W4MA 4BJ5C 1ORKA 1MBJA 1TW3A 1OR7C 3F8BA 1I27A 3K10A 3GFMA 4B3XA 1W36C 4RGXA 1YIOA 1XMXA 3RPQA 2L5QA 1J75A 1F5TA 3MFKA 1SEUA 5HLGA 4XN3A 1GHCA 3CDLA 3ISPA 2QWWA 3GFIA 1R23A 4A3BJ 5A2QK 1JXSA 2ECCA 2Y69H 3IP4B 2V1NA 3WG9A 2M3AA 2K4BA 3HIFA 1TNTA 1LDJA 3W2AA 3CDIA 3ZQGA 4A0XA 2LD5A 4OWRB 4ESJA 1IO2A 4V2FA 1S3JA 1LE8B 4A3GJ 1OYWA 3HOVJ 1IG7A 1D1BA 1Y0NA 4F93B 4LOCA 2QM3A 1O3TA 5C4XJ 2CV2A 2HTJA 4NB5A 3IAM2 2UUZA 3ULQB 1WSUA 1ETQA 1EH7A 4KNYA 2EFOA 2IPQX 1IUFA 3W3CA 3CO7C 3A4CA 2FBKA 3HG9A 4P1WA 1TL8A 4C2UA 2OV7A 3L2WA 5DTDA 3OYCA 2XGXA 2Y2ZA 4M9ZA 5DCMA 3JTGA 3G2BA 3QYFA 4AYBA 5ED4A 1OKRA 1Y1WJ 5EEHA 2WWYA 2AQEA 1RZ4A 2QF7A 1R5GA 2ZNZA 4XLPF 5L3DA 4IO9F 5FLVA 1FT9A 1MNEA 2MLGA 3HHHA 1EF4A 4NC7A 2LTPA 3JTHA 3MKLA 4KIGA 2VPLA 1BJAA 3BQYA 4L5EA 4AC0A 3P7NA 5ICCA 4RB0A 2UWMA 3NARA 4U0WA 3QPTA 2DMPA 4B48A 1Z0XA 3B6CA 4M3FA 2ADUA 1H88C 2P7VB 2ICWG 2QQ9A 4FCYA 1WHUA 4E7KA 3S3OA 5H6RA 3SXYA 1PDNC 4KDPA 3LWFA 4HLXA 1QHGA 4ENMA 3IC7A 3KYDB 2F2EA 4M71A 3I59A 3EUHC 5M5WJ 3ZQCA 2MGQA 1I6HJ 2EA4A 2WV0A 4BDYA 3KP2A 4X0GA 4RBOA 4GGGA 1YIJI 4G8XA 2GOMA 2EV0A 3D0SA 1VQ6I 2DA1A 1MJBA 3TDUC 1LJ9A 2XSDC 1E3OC 1VQ7I 1HSJA 3KP4A 4YIFA 3E97A 2CW0F 3HXLA 1KU3A 3C1DA 3VYRB 3BJ6A 4WCGA 1ZG1A 5KAIC 3VDXA 2QYOA 3B02A 4Q4ZF 2VOPA 1ZG3A 1R71A 2R5ZA 3U2RA 2EV5A 4IXAA 3HM5A 2HTSA 3RDIA 3RYRA 2EFPA 4C30A 1XC5A 4KT5C 2WB1A 2K3PA 3RKXA 3QODA 2PFBA 2RQQA 5F64A 5CVJA 4KIFA 2YU9J 2HPIA 2XAUA 4ZYEA 2ZJRF 2L9SA 2FNAA 3ASNH 3F21A 3HRMA 2ECBA 4XORA 1TWAJ 3WTUC 4BS9A 3L2UA 3CD6I 4IHTA 5M5XJ 1TC3C 2HDWA 4CYCB 3HPGA 1HDDC 4CCMA 2NOGA 2MW8A 5CYVA 5E1XA 5K7FA 2NXNB 4AM3A 3VSKA 2R7FA 2IT0A 2L9VA 1YLFA 2JA6J 1Z21A 2NYXA 2W24A 5EZGA 1FYKA 5E3LA 3S3NA 2BY3A 2F4IA 1H8AC 4CA0A 1D3YA 1MMDA 2O7OA 4FE4A 1S8NA 2XDVA 4A2UA 4DOZA 3IKVA 3SJMA 5KVRA 4CCLA 5F04A 3OS0A 3OYDA 4IF4A 3D5LA 4N9HA 1E2XA 3ZXSA 3ZMZA 1HSTA 1P9QC 3M8EA 2WADA 3QWLA 2XKOA 3TEDA 1SMTA 1H0MA 4PFPA 2VKHA 2RN7A 2TDXA 5GTHC 3PUBA 2V1DA 2FOWA 2XV4S 3ELKA 2KPMA 2OAZA 2HKOA 4FHTA 2VJ5A 1HKSA 2W00A 2RNGA 3BG9A 3GTJJ 4EJUA 4D5FA 4KMUX 4MTDA 1QQIA 1T8IA 1K4TA 1Y0UA 4C3HJ 5HDGA 4AU7A 1D5YA 1HXDA 2X6YA 4XRSA 1LUJB 4KIBA 4PUSA 1X3UA 2LSOA 3GZNB 4LLLA 3WU1B 3U1KA 2ME0A 2KDZA 1FNNA 4IOCF 2X9DA 4BAYA 2NVYJ 1POGA 1ULYA 1X3ZB 5FGMA 1BI2A 2V9PA 3F6VA 3LL7A 2W4SA 1DPUA 3FDYA 1IRGA 1T6SA 1YS7A 4AYBN 5IP6A 2E60A 2R92J 1BW6A 2A05A 3DP7A 4FASD 3QQAA 2FD5A 3H9QA 3HJEA 3LSJA 2OCEA 2E1MC 2HVRA 2R7RA 4IHWA 1MBFA 2X51A 4R1HA 1XSXA 1JI8A 1SVMA 1P7JA 4YFKF 3CCQI 2KZGA 5E8GA 4M74A 3L1PA 1EH8A 2X6WA 3ZMSA 3JR9A 4KITB 2R93J 1RKTA 1WFXA 1MMAA 3CCVI 1JJ8C 1T39A 1IN7A 2EFQA 2Z1DA 2HXOA 2CFXA 1LDKB 2QKMB 1OCTC 1IN6A 4BE0A 3FM5A 3T0YA 4WWCA 1LVKA 2L9NA 3WODF 2GM4A 3EDPA 1Z6TA 5EGOB 2WY7Q 3ZMDA 1A36A 3AG4H 2Y31A 3EYIA 5BS6A 1PP7U 1NG7A 2HU9A 3FISA 2O8KA 4RGRA 1D1CA 1YFHA 3OL3A 1MMGA 4YRVA 3HOWJ 1FTZA 2QENA 5E20A 3AL0B 1W1WE 1A5JA 2DQLA 2CQXA 3BR6A 4XLAA 4Q5SF 1ZAOA 1ACIA 1WJ5A 2W1OA 3K4JA 4ZC3A 2ZO4A 3C7JA 1ONVA 4RM2A 1BC8C 1IC8A 5F1JA 2KL4A 2Y9YA 1Y1VJ 3BDDA 4AIKA 2Q1ZB 3C2HA 1U0JA 3IH2A 4EJTA 3ZN0A 1XS9A 3K6GA 1TWFJ 1YOVB 3BWGA 4A3FJ 1F4KA 2WB1N 4EM0B 2VLAA 3PFIA 2D1VA 3FXKA 3OYJA 5J4VA 2CUFA 2OZ6A 4CHUA 2MBFA 4Y52J 3JSOA 2NS7A 1X1DA 2VKEA 3EPZA 1D8JA 3IWFA 3G6EI 3U1DA 2LC2A 4YG2F 3BG3A 4PDKA 3P9CA 3S2DJ 2LBFA 1YRNA 2ZKZA 1VTNC 1SFKA 1FP1D 3Q0VA 4AIJA 1W0UA 4XBFA 5BPIA 1ZN2A 5HNFA 3SZGA 1X3WB 5DM7F 4E70A 4ZYAA 3N97A 2RAEA 3S16J 3MZHA 1Z3YA 3SHFA 2DA3A 3PNTA 2VBZA 3MEXA 2XROA 2EIJH 5BOXA 2W82A 1BM9A 3Q3SA 2HOEA 1HC8A 1OMIA 4UB6C 3KP6A 5TRDA 2I5UA 2YR2A 2XPVA 2ID3A 3FIWA 3DBLB 2BV6A 2EJRA 1ENHA 2CGPA 1NHAA 1N77A 1OJLA 1CF7B 4IHSA 2BGCA 3OYLA 4KMFA 3S1MJ 1XSVA 2DYSH 4OAZA 2UZKA 2I10A 1ZRCA 1VQ5I 4S05A 4I02A 1WI9A 2DFHA 1P7IA 4ZJZA 5GPCA 2VL8A 1D5VA 2E5NA 2NS8A 1LNWA 2L2OA 4U87A 4HV5A 2LF7A 3NEUA 3ABKH 5ILUA 2BE5F 3HB9A 3GTLJ 3C2BA 3J80K 1ON2A 4DBQA 3CCMI 3GVAA 1TWHJ 3LNQA 4HX7A 1ZHFA 2PQ8A 1FTTA 5CLSA 5CVUA 3RZOJ 1GV5A 3BJOA 5E1ZB 1J2XA 1MMNA 5CQGA 4B8XA 1YJ9I 4A12A 2JA7J 2YPRA 1K6OA 2CYYA 4NHJA 1I1SA 2XGEA 5F0CA 3DLAA 1SAUA 4O3MA 2RC4A 4XLFA 3GWZA 3HBLA 4BE1A 3D1NI 1W5SA 3Q9SA 1S7AA 1J0RA 1AKHA 1AA7A 1Z7UA 4UV8A 1MIJA 2HYGD 3LA2A 4D7MA 1B72B 2O61A 3A0HC 4N0BA 5FB2A 1U5TC 3S93A 1PUEE 2XF5A 2K86A 1BA5A 2GXAA 4YELA 4MFDA 4FTHA 4LK0F 3GTQJ 2QZ8A 1HCRA 2FUG2 2V4JC 1IN8A 3K4LA 2R7UA 2DCEA 3BY6A 1HF0A 2AS5F 5IP7J 4L0ZB 2GXBA 1K83J 3CLQA 1IXRC 1UHMA 1STZA 2LYCA 3EUAA 1U5TA 4LB5A 3M8FA 3MQ0A 3P9IA 3KEQA 3HRTA 4XSXF 2M87A 3RSNA 2PI0A 3LSTA 3JRBA 1IDZA 4Z2YA 4FX4A 2DA7A 1I3QJ 4BQQA 2GXGA 4BXXJ 1DPRA 5IOYA 3BLYA 3RJPA 2L9RA 2D1HA 4Y4RA 4PJNA 3N4MA 5J1RA 1MDMA 3A02A 1N75A 1W36D 4AUXA 3K2ZA 2ZMEC 1KGSA 1ETVA 2DOEA 2O8XA 3TO9A 2HVQA 4BXUA 3FHZA 2VQCA 1YG2A 5FKLA 5ILSA 1D1AA 4RGUA 1J9IA 3LFKA 3V8JA 2KIFA 1IAWA 3HEFA 2F5VA 5ILVA 2VJIA 2W85A 3G1MA 4A3MJ 3ABUA 2GIZA 1MNDA 2V6CA 3AG1H 3ONQA 1U8BA 3N05A 5LHGA 3BR0A 2IW5A 1BR1A 1TT0A 1WI3A 1XB4A 1OYIA 4XK4A 3H92A 3KX2A 1QPMA 5ICEA 5FKNA 1BJZA 3VYUB 2UXXA 1XDUA 2BW3A 3LSMA 3L2RA 4GDFA 2QQAA 3KP7A 3ABTA 3E5XA 3MAJA 5BNGA 2ACJA 4BHCA 3BR3A 2XRLA 3OWTA 4L9JA 2M5WA 4HF1A 1CGPA 2MYSA 2HOTA 4B47A 3JRAA 2V1UA 3PUFA 4PGHA 3SYTA 2M8GX 5L3FA 1J5YA 3QYBA 1DGRM 5B66C 1B59A 5L3BA 2IRFG 2MC3A 3HOUJ 2IGKA 3S17J 3DKXA 4Y13A 4JQFA 1MJAA 4EGZA 2L4AA 4YFNF 3BZKA 1GVDA 1LEBA 4PFOA 5D6EA 1WWXA 2RKHA 5DUIA 1XG1A 5K7HA 3S2HJ 2WC2A 2E1CA 2GOXB 2HQNA 2BZTA 1A6IA 3S1NJ 5E17F 1HW2A 2B63J 1AOYA 2Y75A 1KU2A 3DU5A 4HLYA 3FKIJ 1YJWI 3R0JA 2DT5A 1DDNA 5E3MA 1QVUA 1LQ1A 2RREA 2KFDA 4CCKA 2IGOA 4XKBA 3ABLH 3HRSA 3RTRA 3OYKA 3PIOF 5E1WA 2K7LA 3J7AO 3G4SI 1MW7A 5LGNA 3CDHA 2TRTA 4O5VA 4A0ZA 4XSZF 2Y0SA 1X1BA 2QLZA 2HS5A 3F8MA 2IA2A 4K2EA 5DV5A 3FHNA 5EEGA 4B44A 4UUSB 3IWZA 2PBIA 2FOKA 3WHCA 1TQMA 4I0AA 5F0HA 3H5RA 2XC7A 3OIOA 5LHIA 2MFZA 1D0ZA 4L18B 1LFBA 2ZFUA 2IBDA 2VODA 4X6AJ 3DBHB 2A6HF 3L00A 2XASA 5IP9J 1R5ID 2LMDA 1J7KA 2BHZA 3I71A 4G7ZF 1QA6A 2VN2A 2VBWA 3PSFA 2ZFWA 1MSEC 2DMUA 4II3A 3TP0A 3P9KA 2M2EA 1JT6A 2P81A 1A6QA 1UCRA 4E6KG 3G73A 3GFJA 4E7IA 3F6OA 3PO3J 1UHWA 5FRNA 1R1UA 4G7OF 2G9WA 1FWZA 4G94A 2MD5A 4I76A 5J1UA 3ECHA 2ZB9A 2A3SA 3I3LA 1XCBA 4DZJA 4CDGA 4ZDPA 2JPCA 4AIDA 3I64A 1OQYA 2NS0A 3SZPA 4EJVA 2HYFA 4LITA 2LOOA 3FX3A 2A5YB 2OBPA 4N9IA 4XKVA 1T38A 3E1SA 4BQAA 1S72I 2PMZA 3H3UA 3WGHA 3I4MJ 1EKEA 2DN0A 3TW6A 5C44J 5K5OA 1MBKA 4PZJA 4MEYF 1FMWA 1H9GA 1Z3XA 1ZTRA 5F6FA 3JRDA 2E34A 3M1CA 2PEXA 3LSHA 3K0LA 1E3PA 2CQNA 3M9AA 3Q5FA 4B09A 4UVBA 1G6NA 2ZCWA 3B6AA 4I6ZA 2I8DA 2M30A 3MVPA 5J6XA 2QSFX 3ZCOA 1K79A 1IN5A 2L7MP 3F3XA 3KYCB 3DEWA 1S6LA 1ZKGA 2IGMA 2A61A 5LEJA 1WZ2A 3G1OA 3A01B 4RA2A 2JQ7A 2DK8A 3WHBA 2HOAA 2VKDA 2XGCA 1A31A 3AG3H 2NOJB 1JKOC 4XKCA 3QOEA 4XIDA 2WA0A 2FMLA 2IXSA 3F9KA 3JSPA 2YSRA 4LMYA 5DD8A 3HGGA 2VC0A 4G6QA 4UV9A 2GA2A 2E1MB 1MBHA 3BROA 3T1BA 3HZJA 5B5EC 3DU6A 2QSGX 4JK1X 4A5MA 1V55H 2VT3A 4RAYA 4R8HA 1K7AA 4M6VA 3HPHA 2X4HA 1ZGAA 5J8CA 4BY1J 3SQNA 2LVSA 6PAXA 1T56A 1YHQI 2KHMA 4ENKA 4DBRA 2IA1A 2KJBA 1F36A 3OOUA 3D5SC 2QCOA 3RPUD 3OL4A 4NDLA 3QOPA 1WQ2A 3BCBA 3ZGKA 2KRFA 2HGCA 4CXFA 4BXFA 1W7PA 2HVSA 3F8NA 1JUPA 3VYTB 3H3ZA 1MGTA 2CO5A 5LGUA 3MZYA 5HLHA 2M1BA 3BTIA 4M73A 3K70C 1R36A 1Q1VA 2F5EA 3TOAA 4PSWA 4KA4A 4XRMA 5HVQC 1GDTA 2OPTA 4I99C 4OINF 1XSDA 2BY2A 2N8GA 5AIPA 3K4MA 2V79A 1U8RA 2IS2A 4KN7X 1FPQA 2MLKA 1B8IA 3HUGA 3R6SA 2DFFA 1Z91A 4BJTA 4P9UA 2XIGA 1ZELA 2QQBA 3RCOA 2V9KA 3BR5A 1HQCA 3G1LA 3I56I 4ESBA 2CQ7A 3VFZA 3GTOJ 5HNHA 4RLQA 3O3KA 2X6XA 2BVMA 2DO7A 2BBYA 1QZZA 1U6GA 2BHYA 4ETSA 1OCOH 2PJRA 1XMKA 1MH3A 1LKXA 1FYMA 5FROA 2JN6A 2PMHA 5ERIA 4UVCA 3R60A 3V7SA 2E7XA 3DXJF 5FO5A 1ZLKA 2VBXA 1UG2A 3LSRA 2ZSIB 1E17A 2XRNA 4XM3A 4BYYA 2L7KA 1YI2I 3GTKJ 3TKYA 4LLGF 2NVUB 4BEHB 2Z33A 4JOMA 3E6CC 4ZDLA 5FLXZ 4A3IJ 4CCOA 2E1NA 3Q0WA 4HNUA 3IHUA 3QP5A 4UUSA 3RQ4A 1ETOA 2HQRA 3CCUI 1RRJA 2MD0A 2OQGA 3TO7A 4A93J 4B1RA 3KZIC 2O5RA 1GXQA 2ZNYA 2XB0X 4C3JJ 1X2NA 2CS3A 2B0LA 5EG0B 2IP2A 2ZXJA 1RC9A 5E79C 1ZGJA 3GEZA 4XL9A 2ZJPF 2DPUA 2E1OA 4L9VA 2K02A 1EV7A 1J59A 4IHYA 1T33A 2GIVA 4OMZA 4WX9A 5E3NA 2K9SA 4U7BA 2KIUA 3S1RJ 4O6JA 3B73A 2XF7A 3CJRB 2P6SA 2M0CA 3M07A 4BKXA 3BG7A 4M3BA 1WGXA 2J5OA 2XF6A 3RYPA 2DTRA 3BG5A 1C0WA 1DP7P 2PMZN 2KZVA 1TWCJ 2DTZA 4JYKA 3BQZA 3FXUA 5JVTA 2VXDA 2EFWA 1R00A 3HOYJ 2M34A 1V5FA 3I54A 3CZ6A 1S29A 2R0QC 1ETXA 2L4MA 1NG6A 2W25A 5B1AH 1B4AA 3M7GA 1RIOH 3FM3A 1SMYF 3OYHA 3E6MA 5EZHA 5D8KB 4ZYGA 4Y17A 2JRMA 3E5QA 1KONA 4GYGA 2PMUA 3JCUC 1LFUP 3LOCA 3WTXC 3O2PE 3OYNA 1LE8A 2IS4A 1IRZA 1BIAA 1U78A 1B9MA 3H9GA 4N4OB 4LB6B 3OYMA 3LAPA 4A3LJ 1QPIA 3FXRA 2JZYA 1OCCH 1NTCA 2H27A 2HZTA 3UKGA 2EFNA 3VEPA 5HDNA 4R79A 4GFBA 5JHFA 1VQLI 1R1TA 2MH9A 2YU3A 3A2KA 2P0WA 3OR2C 3F8FA 5D4SA 3CUQB 4HNTA 3S15J 2LK2A 1P92A 3ZQIA 3NWSA 4BQOA 3ECOA 3RQIA 3L7WA 3OV8A 1Y6IA 2PLYA 3VWBA 4IHVA 1P2FA 4D9JA 1T0FA 2VI6A 3WTYC 1DGWY 4RMNA 4H0EA 3IUOA 1JKPC 1MKMA 3HSRA 1IRXA 3RKQA 4E7JA 1VZ0A 4XOTA 3OIPA 2A69F 2EZLA 1S5LC 1SFEA 4HEA2 1UMQA 1JT0A 3F72A 3W6VA 2DFIA 1Z67A 2RV8A 3Q9VA 4BU2A 1CQTA 2VC1A 4IZZA 4IEJA 3PQKA 3DPLC 3P5JA 4LIUA 2EA2A 4BDZA 2E5ZA 5FD5A 4OOIA 2COBA 2Q0OA 2LRDA 4BQNA 1VQ4I 3DPUA 2ZMEB 2G0EA 3RIRA 4MTEA 1FIPA 3GMEA 5HOOA 2EV6A 2EWNA 1HA8A 3RI4A 2QKLB 2WBMA 2LF8A 4DJAA 4EATA 1JE8A 1YX3A 4WF2A 2Z2SB 1ETKA 3V8KA 4C2MJ 4NUBA 1SD7A 2BYVE 2DOFA 4XLHA 4X1EA 2M8EA 4A3DJ 2EZIA 3X2QH 1Y56A 4UY8I 3QU6A 2P6TA 2DODA 2OA4A 2G7HA 2R5YB 1BC7C 3QPHA 5LD2C 4E7LA 3GFLA 5F0FA 3OYGA 3KLOA 3BR1A 3BJAA 2J5PA 4LG0B 2VKVA 4HRIA 4B43A 1YO5C 2LR8A 4FE7A 2A07F 3WTSC 3QPLA 1X4PA 1KYZA 1ERDA 2X85A 4EM2A 3ZOBA 1ZGWA 2FXAA 2KJCA 2LG4A 3JRFA 3ZMVA 2WAQA 2LKSA 2YS9A 2FA5A 4CZCA 1NH3A 4D5CA 3TMOA 1PJRA 2HDDA 4AD9A 1JTXA 2R3SA 3FK6A 4D7NA 2K27A 4ZZLA 5JFRA 1G3TA 3SDGA 5K1YA 1UHSA 3S3MA 3KYLA 2QEXI 2Z5UA 4ZH4F 1RUNA 5GAHJ 1TBXA 4CYCA 4M9SA 4PK4A 1SFOJ 2JK3A 4XMYA 4LLNA 1S7OA 4IOAF 1UJ8A 3HRUA 4QTRA 1ETWA 3O8HA 4NC8A 4JP0A 3H9JA 4BEHA 4AIHA 1X2MA 3PSIA 3CTAA 1KU9A 5HS8A 4UVAA 2EB7A 1VQOI 1ZR4A 5BQTA 3C2GA 3OOPA 4D0PA 3J7ZI 2DDBA 2E71A 4C9YA 1ZQ3P 4ASNA 2Y0MA 1KA8A 3ERMA 3H5NA 3L09A 2L01A 4I01A 3ZQFA 2NRAC 3CMYA 1MSFC 1TLHB 1WVRA 3BCAA 1O7LA 1OFCX 1X4OA 2LREA 2M45A 3WTZA 1REPC 1JGGA 2VE8A 2DPDA 2VIXA 3IRRA 3WTVC 3OS2A 3HGYA 3FZVA 2MC4A 1LEAA 4NQWB 5D4RA 4DYCA 4A5NA 1F43A 2P5KA 2KQRA 2LKXA 4HSRA 2ELKA 3OYFA 3U9GA 3LAJA 3BT9A 4ENNA 4BL0B 4BHBA 4HV6A 3L2QA 2OQRA 2FBIA 3WTTC 1K78B 2E2HJ 4EJOA 1ITYA 1IN4A 3AAFA 1QZYA 3DKYA 3ML6A 2EK5A 1XPXA 3IH3A 5DYMA 4OU0A 2O03A 2DT7B 2BXZA 4HQMA 3CCSI 2VT2A 1FBQA 3VPRA 2P4WA 4JX4A 3K4BA 4XONA 2DQRA 1Y8RB 1RPWA 4ITVA 1I39A 2R7ZJ 5IPAA 2E36A 1IZ1A 4A6EA 2EPFA 2R4GA 3LSKA 1XDSA 2H1KA 3RZDJ 2MH2A 1RR8C 5HLIA 3HDDA 3CJQB 4YEJA 5CQEA 3WG7H 3GX4X 4HF0A 5LEKA 1BN5A 2DDAA 3K4CA 5D5UB 4MFEA 2E19A 3NQOA 4XRSG 2VOOA 4RAGA 1BW5A 3LSGA 3CC4I 5DCFA 2HFHA 2P5LC 2G7UA 1KQ9A 2QGUA 5CVIA 2VXZA 2ELJA 2Q8KA 2RGVA 1AHDP 4LFUA 1FBUA 3S32A 2FF4A 3UR3C 1YYVA 3ESWB 4AVZA 4BACA 4I0BA 3BOQA 3CO6C 1XGNA 5JVGF 3GTPJ 3ZQ7A 4XOPA 1FOYA 2XAQA 1RETA 3ABMH 5DCMB 4G9YA 3JREA 1HKQA 2XPUA 5EGOA 3M3YJ 3BZCA 4PJLA 5D5WB 1Z77A 5B1BH 1R7JA 4AVPA 1K4SA 2CSOA 4V19K 2F5CA 5IYCJ 3FXLA 3ZPLA 2ZSHB 4OIRF 1EH6A 2UXNA 3FXMA 4A6DA 5C4JJ 1BIBA 3E0JB 4KJZA 3QP6A 1JHHA 3OYAA 1P6RA 4FT8A 4DYRA 1OISA 4RB1A 2DMNA 4OIPF 2COMA 1OCPA 2KT0A 1V4RA 3DTIA 4U0VA 4EMSA 3K69A 2D5VA 4Y3OA 3CCJI 2Y48A 5GAGJ 1W5TA 2GAUA 3FXOA 1X1CA 1LB2A 4LD5A 3K7AJ 3JW4A 5IT3A 4ZTJA 1JKQC 2WAQN 3QAHA 2BEOA 2X1CA 3MD2A 2UV1A 3PFYA 1SAXA 5DM6F 3V8LA 2QSHX 3OYEA 2L02A 3I59B 5FKMA 2AXTC 3PNVA 1GLNA 1SANA 1JHFA 2B9SA 1EA3A 1S9HA 4A3EJ 1JUMA 3QU3A 5EYRA 2K3FA 4FISA 3WGIA 2OU2A 3MMYB 2Q2EB 2W48A 1XCVA 2NAZA 3I58A 4GXOA 1KQ8A 2ID6A 4XLEA 5KAFC 2Z9OA 3WE3A 4HZFA 5J40A 2LDUA 2H8RA 3LSPA 2OUMA 3L2CA 2R5ZB 1KQ0A 1PYVA 1WKMA 4DW6A 1RKWA 3CJNA 4QIWN 1HOMA 1ZRFA 3DKWA 5BMZA 1J09A 1GUUA 5IYBJ 2BOLA 1VQNI 4RS8A 1HBXG 1SVOA 3HTUA 4WXCA 3LMMA 4HPQA 4OIQF 4M3EA 2HDCA 3K4NA 1V5GA 1WJBA 2FU4A 3S14J 1UAAA 1KZHA 3HOZJ 3F23A 4LJZF 2DA4A 4N4NB 2E2IJ 3CF2A 3K70D 2HYJA 2DBBA 2DFEA 4G6DA 5IT9Z 3EETA 2ELHA 2O0YA 2K40A 3JAMZ 1CF7A 2JSPA 1U9NA 5D5XB 2QBYB 2HZDA 1IV8A 3GLXA 3W6JB 4M72A 4I98B 2CUJA 2CRGA 2V26A 2EINH 2VBYA 2CW7A 2FJ1A 5LLQA 4MEXF 1XD7A 2ESHA 2A68F 2CWEA 1WJAA 2M4GA 2OC6A 4JX6A 1FZPB 2R7WA 4L9TA 3WE2A 1H89C 1MBGA 1VQ8I 5FKOA 4XLNF 4M3GA 1I3AA 1OCZH 3E6BA 3H35A 4G6TB 4XNFA 2M4KA 5JLXA 2H6CA 2CMPA 3KZYA 4ZYDA 1V54H 4E4HA 5FJ8J 1QNTA 1VQKI 3U21A 5M3MJ 4Q47A 2IS1A 1U9OA 1VQ9I 5EF6A 5FRMA 3TOBA 1BI1A 2Z3YA 1TZLA 4QWQA 3FXJA 4E7HA 2WV1A 1V3FA 3KLNA 3L2VA 1QHHD 1HW5A 4W1UA 1W5CC 5DUKA 4FETA 3GCMA 1A04A 4EGYA 1TW2A 2VQLA 2M7AA 2Z99A 3BTJA 3TQNA 1R5HA 1PVEA 4RB2C 1MJ9A 1B72A 3AKZA 5FLXK 2L7ZA 2CG4A 2KDOA 3TO6A 1P4XA 5HDKA 3J81Z 1TTYA 4F92B 4IRHA 3M4OJ 1DU0A 3UNGC 2HQAA 4CUGA 5E18F 3GTMJ 3ZQLA 3PM1A 1R4MB 4F52A 4HX8A 3FMQA 5JHUA 2C6YA 2AQFA 3ROUA 1O57A 1O3QA 2WAFA 1G59A 4FQGA 5AONA 2JMWA 4HSTA 2NVTJ 4M9XA 4U88A 3T5XA 3MKYB 1M1EB 4EQQA 4U0YA 3K2AA 3CCEI 1YITI 5M5YJ 4PJMA 2OZUA 4A3CJ 1OR7A 4HG2A 2XAHA 2AHQA 1W0TA 4WXDA 4LGWA 4BJ6C 2DT6A 2ISYA 2DJNA 2W7NA 3E6DA 4IKFA 4UUTA 2MABA 1FJLA 1WH7A 4BH9A 5K7ZA 1I50J 4QSHA 4HDUA 1FOXA 2EZKA 4CZZA 5LFAA 3CCYA 3O8GA 1G3SA 5LGTA 2CU7A 4B3AA 4Z6YA 3COAC 1SD4A 3DV8A 3G3ZA 3K1PA 4XLCA 3S1QJ 5F08A 1QGPA 3KIOA 3H1CA 5F27A 1Y8QB 4NBQA 2CW8A 2K4JA 2D45A 1JUSA 2R7VA 5L3CA 3FBNB 4CH7A 2ZJQF 3T8RA 1KU7A 1DP3A 3NAUA 4MQVA 3H36A 3DLLF 1USTA 4HNVA 4IRGA 1JKRC 2XGDA 3I9V2 5DEQA 2IS6A 2F5DA 2NNNA 3F8CA 4EEFG 1HLVA 4IQ4A 5HS7A 5F1RA 3CC7I 2KMUA 4S0HB 1D0XA 1R6RA 3LQQA 5KNLA 5CVRA 2AO9A 1IRFA 3WU0A 1I1GA 2IJLA 4L5IA 2EQRA 3BZ6A 4II2A 3E3VA 5C3EJ 1H9TA 2V7FA 4ZZDA 3PIPF 3VSLA 4J00A 5JLWA 4P9FA 1B1BA 4RLFA 2VQHA 4RGSA 4BE2A 3DTEA 2FBHA 3QYEA 5LRRA 3K1NA 2IAIA 2Y0SN 3FMSA 1VF9A 2H94A 5DS9A 2FQ4A 3W2WA 3I4PA 5E8IA 3OR1C 3ZQHA 2VASA 2WY8Q 3HC7A 3K1MA 5B3SH 2Q2EA 2Y9ZA 2LY9A 2ZC2A 5CKTA 3DEUA 3LQRA 3NRVA 1E0EA 2MSYA 2L3DA 1BI3A 1R4NB 3VODA 3IRQA 1HDPA 2GA1A 1APLC 2DJIA 1GVJA 2JT1A 2QQ8A 2LBFB 5CPRB 2HEOA 1WJDA 1LDDA 3EUHA 1YRNB 4U7DA 3CUOA 2P8TA 2KP6A 2ZXHA 3HKZA 4QPOA 1YW9A 3LSIA 3KETA 2RVCA 3MN2A 1WJFA 4F3QA 2BY1A 2L54A 4PCQA 3FKJA 4TV7A 1X19A 1FC3A 4GRIA 1G4DA 1IUYA 1DU6A 1IXCA 3W6KB 2KLOA 3AG2H 2EILH 4I09A 3I4NJ 4ANJA 3R0AA 4HBLA 4MLOA 3H5AA 2DMTA 3CMAI 4Y15A 3SZTA 4ZDOA 2XSJC 3V7RA 2EBIA 1WJCA 4A3KJ 2QBYA 1XMAA 3GBGA 4HF2A 1YW7A 3DCFA 3C18A 1L3LA 1NK2P 1VI0A 4UNOA 4MNUA 4PJ0C 4BBSJ 5GTIC 4EM1A 4MO7A 3PNYA 5A2QZ 4DGWB 3ZMUA 3BPXA 3GF2A 2BXYA 4JX5A 1USSA 5D8LB 3SEQA 2JTVA 3OYIA 1SFXA 2PG4A 4P5OA 2NVXJ 1MD0A 1FMVA 4E7ZA 1SVLA 3CP8A 1F1ZA 4ESFA 2JRTA 1IV6A 4M6XA 2HQ5A 5LBQA 2LY1A 5D6FA 1EJ9A 2JSCA 2H09A 1VQPI 5KK1A 1ON1A 2XKPA 4IJAA 1YJNI 4HDVA 2XB5A 2CUEA 2K9NA 4MGRA 3R4KA 2ZJ2A 2JUCA 3GO5A 4LG3A 5GAEJ 3NWTA 3HSEA 3REOA 3TDZC 4XQFA 1SD6A 1A35A 2PN6A 2O6GE 2DK5A 2GBYA 4IQJA 2B7EA 4Q48A 3H3VK 1GV2A 4G12A 1AKHB 1TNSA 2M7BA 3E7LA 1L0OC 1Z6RA 2QA4I 1Y39A 4OAYA 3CMEI 5JI6A 2E35A 2F48A 5GADJ 3IAS2 5TISC 2JUGA 3GUDA 2LKPA 4HOBA 5HODA 1G3YA 4IHXA 2VUMJ 3EQLF 2IA0A 1FYLA 3I0TA 2H8WA 2DI3A 2ME6A 2MG4A 1T0FC 1FOWA 1TT5B 1R58A 4P55A 3SFIA 1G2HA 2GLOA 2XAFA 3ERED 1FY7A 1U5TB 4M3DA 1XGSA 1O3SA 2CQKA 1SD5A 4KISA 2DOAA 2V6EA 4CSWA 4YIRX 4ON0A 1BR2A 2MA3A 3HHGA 3A01A 2ESNA 2E2JJ 1RUOA 2V1XA 1ZRDA 2CJJA 1FBSA 2O9LA 2X1EA 4ZTFA 4UUVA 4W97A 3GLLA 3OYBA 1TWGJ 1MDMB 1FEXA 1ZK8A 2KISA 4D1QA 1JJ6C 1T2KA 4DNCA 5HLTA 2DMQA 1Z9CA 3BR2A 3ZRGA 2F5FA 2ETHA 4L9NA 3S2WA 2R7OA 3FBIB 3FF5A 3RPUA 2JVGA 3JRCA 1RI7A 2HWVA 2X0LA 4FX0A 4CYDA 3J7YJ 1B9NA 4KYWA 1WCMJ 1XN7A 1YS6A 1ZYRF 1BBYA 1ODDA 1TQIA 5J8FA 1FSHA 2DA6A 5H20A 3KP5A 2BVLA 1MBEA 3R61A 3ZMTA 4OMYA 3FMRA 5HS9A 2VB6A 3M8JA 3IV5A 3MKZA 3I55I 3OIQA 4J19A 1S7EA 4YIIA 2X1DA 3KEYA 3CJTB 3AFHA 4LK1F 3JRGA 2BW3B 4CICA 1X1AA 1MMSA 4BUPA 1G8XA 2FNPA 2VPRA 3EYYA 3DEEA 1NK3P 1BOAA 1YE9A 5ICFA 3HKZN 5KHDA 1PUFB 1LPQA 4F55A 1VQMI 1WJEA 1AU7A 4IVNA 3OMYA 5L3GA 1G3WA 2LY2A 3ASOH 3CESA 5IOZA 3ZR8X 4HQEA 4UXNA 2GQQA 2P5VA 2DYRH 2CQQA 4LIVA 2VJ4A 3EUKL 3QPSA 4F7ZA 3WTWC 3PJRA 1QO0D 2BY0A 1QZEA 2GWRA 1QVTA 2H6BA 5J3LA 5DD4A 2CV0A 4I2OA 1T95A 4Y7NJ 1IW7F 4IPAA 5E3OA 4G7HF 3A0BC 4ENJA 4KT6A 1XTAA 3A03A 1R49A 1DUXC 4GYIA 4PJJA 2IVMA 4BHPA 2EH3A 2CFOA 2HKXA 2OF7A 2XAJA 1RR7A 3QRFF 2M9HA 1QRYA 1FSEA 1YX5A 2JVHA 1HW1A 1IF1A 4BBRJ 4A69C 2R7XA 4CGZA 5FLMJ 3IL2A 1V5EA 2FE3A 2PX9A 5AIQA 2ZXIA 2AXLA 1BI0A 3TGNA 2QVOA 2OCCH 5TJJA 2R7SA 4HX4A 1D0YA 3BTLA 3IKTA 4QPQA 4GO1A 3VOEA 2HPMA 4BNCA 2FSWA 2JPBA 1U3EM 4UHTA 5H2FC 3KZZA 3WU2C 1PP8F 3C3WA 1WRJA 3BP8A 2F6CA 3DFGA 3GW2A 3BC8A 3F0CA 3IH4A 2A6TA 4RAZA 1F9NA 2M0MA 2XAGA 3I5UA 5FFXA 5EG0A 1Z7LA 3CCRI 3BG6A 5JR3A 4S04A 4XKWA 2X6OA 3HOTA 5EEAA 4M6YA 2YX7A 3CCLI 5IY5H 3W2VA 1UG0A 1GT0C 2XHKA 3CLOA 3KE2A 1MH4A 3KPHA 4MIMA 4ZYHA 3SFZA 3BTCA 4KUMA 3K9TA 1ZR2A 2STWA 2PJPA 1BOBA 1P4WA 2DA2A 1K61A 2IEKA 3GXOA 4KICA 2ISZA 2O3FA 2TCTA 4YFXF 1D8KA 5J1YA 3TL4X 5LRSA 4RAFA 3Q0UA 1IJWC 3GTGJ 1QBJA 1O7FA 1X58A 5BPDA 2R7TA 3H0DA 3KP3A 4BGDA 1VNDA 2EIMH 1K6YA 2XVCA 1MNMC 3S8PA 2VQGA 3CP2A 4IRIA 5IT9K 3HSFA 1ZREA 1FIAA 3JAMK 3ZP5A 3PQJA 3I53A 3L9FA 1T08B 1UZCA 3SDBA 3K4KA 2LFBA 1T98A 2OJED 2R7DA 5EDNA 5EJCA 2FQ3A 4DZPA 3JRHA 2CH0A 2A5WA 2VJJA 3O6BB 2YX4A 1ZARA 3LA7A 5J47A 3KFWX 4NC6A 3ZQQA 3CUQC 3DBRB 3TP3A 1VFCA 3FK7A 4E7SA 1TQPA 1R1VA 2VONA 5J4YA 1FP2A 2EIKH 4QLCU 3LA3A 1Q1HA 1N25A 4EVIA 5DDGA 2NNYA 2STTA 2KKOA 4XN0A 1I6XA 2RNJA 2K9QA 2DXIA 3A1YA 3PO2J 1RNLA 3GZ5A 3M1EA 3CF5F 1WH5A 3CUQA 4WXHA 4XICA 4PGGA 1TP4A 4CCNA 1OPCA 4CCJA 3AL0C 1FLIA 4DYQA 2HOSA 1YQAA 1UELB 1XGMA 4C3IJ 1FOKA 1U2WA 2FMYA 1AWCA 2DAOA 2WTEA 1B6AA 1JGSA 2DA5A 3OS1A 1SC7A 2EZHA 3ZN1A 1XGOA
chains in the Genus database with same CATH topology
2RDPA 3J81K 3V7CA 2OD5A 2W84A 1KYWA 1LVAA 2ZBKA 4HA8A 1Z1DA 3RKYA 1UB9A 2DW4A 2QUFA 3RKWA 1SFUA 1Z05A 2ZMEA 3KEOA 4RB3C 2GZWA 4HYEA 4JBAA 3WGGA 3FXQA 1W7PB 2E7WA 3HOSA 4KFCA 3HTSB 2DU9A 2D2WA 2VE9A 2HR3A 4LG0A 3DQVC 1W7PD 4KN4X 1FX7A 3E5UA 4XRFA 3KCCA 1ZLJA 5K5RA 2FRHA 4HAMA 4MQ9F 4P96A 4AWXB 1ZH5A 5ICGA 3T8TA 3J80Z 2RQPA 3MCZA 2XUBA 5D5VB 4MHGA 4WK8F 1YW8A 5CVVA 2KIMA 4EV0A 1O3RA 2DLLA 5H6QA 3F22A 1R22A 3DF8A 1MZBA 3GYHX 1GXPA 1I5ZA 3BPVA 5FD6A 4L0YB 1P4AA 3MWMA 1ZG5A 4A0YA 3V4GA 1OYYA 3HYIA 3VB2A 4OIOF 1IXSB 1UFMA 1YTYA 4CO8A 5K5QA 2W57A 4GCVA 4HW0A 1HKTA 3DPTA 4DQ2A 2P7CB 3FWEA 2FEZA 4NQWA 4EJWA 5L3EA 5FFZA 4L5JA 5CJ9A 2V9VA 2A6EF 2LNBA 4I7HA 3GZ6A 5LHHA 1K78A 1W4MA 1TW3A 3F8BA 1I27A 3GFMA 4RGXA 1YIOA 3RPQA 1J75A 1F5TA 3MFKA 5HLGA 1GHCA 3ISPA 2QWWA 3GFIA 1R23A 5A2QK 1JXSA 3WG9A 2K4BA 3HIFA 1TNTA 1LDJA 4A0XA 4ESJA 1S3JA 1OYWA 2QM3A 1O3TA 2HTJA 4NB5A 3ULQB 1WSUA 1EH7A 4KNYA 2EFOA 2IPQX 3CO7C 2FBKA 2XGXA 4M9ZA 5DCMA 3JTGA 5ED4A 1OKRA 5EEHA 2WWYA 1RZ4A 4XLPF 1R5GA 2ZNZA 5L3DA 1FT9A 2MLGA 3HHHA 3JTHA 4KIGA 1BJAA 3P7NA 5ICCA 4RB0A 2UWMA 4U0WA 3QPTA 2ADUA 2P7VB 2QQ9A 4KDPA 5H6RA 3SXYA 1PDNC 3LWFA 4HLXA 4ENMA 3IC7A 2F2EA 4M71A 3I59A 2EA4A 2WV0A 3KP2A 4GGGA 4G8XA 2EV0A 3D0SA 1MJBA 3TDUC 1LJ9A 1HSJA 3KP4A 4YIFA 3E97A 2CW0F 1KU3A 3C1DA 3BJ6A 4WCGA 1ZG1A 4Q4ZF 2VOPA 2QYOA 3B02A 1ZG3A 3U2RA 2EV5A 4IXAA 2HTSA 3RDIA 3RYRA 2EFPA 4KT5C 3RKXA 2PFBA 5F64A 5CVJA 4KIFA 4ZYEA 2FNAA 3F21A 3HRMA 3WTUC 4IHTA 5CYVA 5E1XA 2R7FA 2IT0A 1YLFA 2NYXA 2W24A 1FYKA 1D3YA 1S8NA 4A2UA 3IKVA 5KVRA 4IF4A 3D5LA 4N9HA 1E2XA 3ZMZA 1HSTA 3M8EA 2XKOA 1SMTA 1H0MA 2RN7A 2TDXA 2V1DA 2XV4S 3ELKA 2OAZA 2HKOA 4FHTA 1HKSA 4EJUA 4MTDA 4KMUX 1QQIA 1Y0UA 5HDGA 1HXDA 4KIBA 1X3UA 2LSOA 4LLLA 3WU1B 1FNNA 4BAYA 1ULYA 5FGMA 1BI2A 3F6VA 1DPUA 1IRGA 1T6SA 1YS7A 3DP7A 4R1HA 1XSXA 4YFKF 5E8GA 4M74A 1EH8A 3ZMSA 1T39A 1IN7A 2EFQA 2CFXA 1LDKB 1IN6A 3FM5A 3T0YA 4WWCA 3WODF 3EDPA 1Z6TA 3ZMDA 3EYIA 5BS6A 1PP7U 4RGRA 1YFHA 2QENA 5E20A 2DQLA 4Q5SF 1ZAOA 2ZO4A 3C7JA 1ONVA 1BC8C 3BDDA 4AIKA 4EJTA 3ZN0A 3BWGA 1F4KA 4EM0B 3PFIA 2D1VA 2OZ6A 4CHUA 2MBFA 3JSOA 1D8JA 3IWFA 3U1DA 4YG2F 4PDKA 3P9CA 2ZKZA 1VTNC 1FP1D 4AIJA 4XBFA 5BPIA 1ZN2A 4E70A 3N97A 3MZHA 3SHFA 2VBZA 3MEXA 2XROA 5BOXA 1BM9A 2HOEA 1OMIA 3KP6A 5TRDA 2YR2A 2BV6A 2EJRA 2CGPA 1NHAA 1CF7B 4IHSA 2BGCA 4KMFA 1XSVA 2UZKA 1ZRCA 4S05A 4I02A 1WI9A 1D5VA 1LNWA 4HV5A 2LF7A 3NEUA 5ILUA 2BE5F 3J80K 1ON2A 3GVAA 4HX7A 1ZHFA 2PQ8A 5CLSA 5CVUA 3BJOA 5E1ZB 1J2XA 4B8XA 4A12A 2YPRA 1K6OA 2CYYA 4NHJA 1I1SA 4O3MA 2RC4A 3GWZA 1W5SA 3Q9SA 1J0RA 1S7AA 1Z7UA 4UV8A 2HYGD 3LA2A 2O61A 4N0BA 5FB2A 1U5TC 1PUEE 2K86A 4LK0F 2QZ8A 1IN8A 3BY6A 2AS5F 4L0ZB 2GXBA 1IXRC 1UHMA 1STZA 1U5TA 4LB5A 3M8FA 3MQ0A 3P9IA 3KEQA 3HRTA 4XSXF 2M87A 2PI0A 3LSTA 4Z2YA 4FX4A 2GXGA 1DPRA 3RJPA 2D1HA 3N4MA 1MDMA 3K2ZA 1KGSA 2O8XA 3TO9A 4BXUA 3FHZA 1YG2A 5ILSA 4RGUA 1J9IA 3LFKA 3V8JA 2KIFA 1IAWA 5ILVA 2W85A 3ABUA 2V6CA 5LHGA 2IW5A 1XB4A 1OYIA 3H92A 1QPMA 5ICEA 2UXXA 1XDUA 2QQAA 3KP7A 3ABTA 3E5XA 3MAJA 2ACJA 4BHCA 4L9JA 2M5WA 4HF1A 1CGPA 2V1UA 4PGHA 5L3FA 1J5YA 1B59A 5L3BA 2IRFG 2MC3A 4Y13A 4JQFA 1MJAA 4EGZA 2L4AA 4YFNF 1LEBA 5D6EA 1WWXA 2RKHA 5DUIA 2WC2A 2E1CA 2HQNA 5E17F 1HW2A 1AOYA 2Y75A 1KU2A 4HLYA 3R0JA 2DT5A 1DDNA 1LQ1A 3HRSA 3RTRA 5E1WA 2K7LA 3J7AO 5LGNA 3CDHA 4O5VA 4A0ZA 4XSZF 2QLZA 2HS5A 3F8MA 2IA2A 4K2EA 5DV5A 5EEGA 3IWZA 2PBIA 2FOKA 1TQMA 4I0AA 5LHIA 4L18B 2VODA 2A6HF 3L00A 2XASA 1J7KA 3I71A 4G7ZF 2VN2A 2VBWA 2ZFWA 3P9KA 1UCRA 3G73A 3GFJA 3F6OA 1UHWA 1R1UA 4G7OF 2G9WA 1FWZA 4G94A 2MD5A 3ECHA 2A3SA 1XCBA 4CDGA 2JPCA 3I64A 2NS0A 3SZPA 4EJVA 2HYFA 3FX3A 2A5YB 2OBPA 4N9IA 4BQAA 1T38A 3H3UA 3WGHA 5K5OA 4PZJA 4MEYF 1H9GA 5F6FA 2PEXA 3K0LA 3M9AA 3Q5FA 4B09A 4UVBA 1G6NA 2ZCWA 2M30A 5J6XA 1K79A 1IN5A 3F3XA 1S6LA 2A61A 5LEJA 2DK8A 2FMLA 3JSPA 2YSRA 4LMYA 5DD8A 2VC0A 4G6QA 4UV9A 2GA2A 3BROA 3T1BA 4JK1X 4A5MA 2VT3A 4RAYA 4R8HA 1K7AA 2X4HA 1ZGAA 5J8CA 3SQNA 6PAXA 4ENKA 2IA1A 2KJBA 3QOPA 1WQ2A 2KRFA 2HGCA 4CXFA 1W7PA 3F8NA 3H3ZA 1MGTA 2CO5A 5LGUA 3MZYA 5HLHA 2M1BA 4M73A 1R36A 2F5EA 3TOAA 4KA4A 5HVQC 1XSDA 4OINF 5AIPA 1U8RA 2V79A 4KN7X 1FPQA 2MLKA 3HUGA 3R6SA 1Z91A 4P9UA 2XIGA 2QQBA 1HQCA 4ESBA 3VFZA 3O3KA 2DO7A 2BBYA 1QZZA 1U6GA 4ETSA 1XMKA 1FYMA 2PMHA 5ERIA 4UVCA 3R60A 3V7SA 2E7XA 3DXJF 5FO5A 1ZLKA 2VBXA 1E17A 2XRNA 4BYYA 3TKYA 4LLGF 2Z33A 3E6CC 5FLXZ 2E1NA 3IHUA 3QP5A 2HQRA 2OQGA 3TO7A 1GXQA 2ZNYA 2B0LA 2IP2A 2ZXJA 1ZGJA 3GEZA 2DPUA 4L9VA 2K02A 1EV7A 1J59A 4OMZA 2GIVA 4WX9A 4U7BA 2KIUA 4O6JA 3B73A 2P6SA 2J5OA 3RYPA 2DTRA 1DP7P 1C0WA 3FXUA 5JVTA 2EFWA 1R00A 3I54A 1S29A 2L4MA 1RIOH 2W25A 1B4AA 3M7GA 3FM3A 1SMYF 3E6MA 5D8KB 4ZYGA 4Y17A 3E5QA 4GYGA 2PMUA 3WTXC 3O2PE 1BIAA 1U78A 1B9MA 4LB6B 3LAPA 3FXRA 2JZYA 2H27A 2HZTA 2EFNA 3VEPA 5HDNA 4R79A 1R1TA 2MH9A 2YU3A 3F8FA 5D4SA 3CUQB 1P92A 3ECOA 3L7WA 3OV8A 2PLYA 1P2FA 1T0FA 3WTYC 4H0EA 1MKMA 3HSRA 2A69F 1SFEA 3F72A 2DFIA 2RV8A 3Q9VA 2VC1A 3PQKA 3DPLC 2EA2A 5FD5A 4OOIA 2Q0OA 2ZMEB 3RIRA 4MTEA 5HOOA 2EV6A 2EWNA 3RI4A 2LF8A 1JE8A 4WF2A 3V8KA 1SD7A 2BYVE 2M8EA 3QU6A 2P6TA 2OA4A 2G7HA 1BC7C 3QPHA 3GFLA 3KLOA 3BJAA 2J5PA 4LG0B 1YO5C 2A07F 3WTSC 1KYZA 4EM2A 2FXAA 2KJCA 3ZMVA 2FA5A 4AD9A 2R3SA 4ZZLA 2K27A 5JFRA 1G3TA 5K1YA 2Z5UA 4ZH4F 1RUNA 1TBXA 4M9SA 4LLNA 1S7OA 3HRUA 4AIHA 3CTAA 1KU9A 5HS8A 4UVAA 2EB7A 5BQTA 3OOPA 4D0PA 4ASNA 2Y0MA 1KA8A 3L09A 2L01A 4I01A 2NRAC 1TLHB 1O7LA 2M45A 3WTZA 1REPC 2VE8A 2DPDA 3IRRA 3WTVC 3FZVA 1LEAA 5D4RA 4A5NA 2P5KA 3LAJA 4ENNA 3U9GA 4BHBA 4HV6A 2OQRA 2FBIA 3WTTC 1K78B 4EJOA 1IN4A 3AAFA 1QZYA 3ML6A 2EK5A 5DYMA 4OU0A 2O03A 4HQMA 2VT2A 1FBQA 2P4WA 2DQRA 1IZ1A 4A6EA 1XDSA 2MH2A 5HLIA 3GX4X 4HF0A 5LEKA 1BN5A 5D5UB 3NQOA 2VOOA 5DCFA 2HFHA 2P5LC 2G7UA 1KQ9A 5CVIA 2VXZA 2Q8KA 2RGVA 4LFUA 1FBUA 2FF4A 1YYVA 4I0BA 3BOQA 3CO6C 1XGNA 3ZQ7A 2XAQA 5DCMB 4G9YA 1HKQA 5D5WB 1R7JA 4AVPA 2CSOA 2F5CA 3ZPLA 4OIRF 1EH6A 2UXNA 4A6DA 1BIBA 3QP6A 1JHHA 1P6RA 4FT8A 4RB1A 4OIPF 2COMA 4EMSA 1V4RA 4U0VA 3K69A 2Y48A 1W5TA 2GAUA 1LB2A 4LD5A 3JW4A 5IT3A 3QAHA 2BEOA 1SAXA 3V8LA 2L02A 3I59B 1JHFA 3QU3A 3WGIA 2OU2A 1XCVA 2NAZA 3I58A 4GXOA 1KQ8A 2Z9OA 3WE3A 4HZFA 2LDUA 3L2CA 1KQ0A 1WKMA 3CJNA 1ZRFA 3DKWA 5BMZA 4RS8A 1HBXG 3HTUA 4WXCA 4OIQF 2HDCA 2FU4A 3F23A 4LJZF 2DBBA 4G6DA 5IT9Z 3EETA 2ELHA 2O0YA 3JAMZ 1CF7A 5D5XB 2QBYB 3GLXA 3W6JB 4M72A 4I98B 2VBYA 5LLQA 4MEXF 2ESHA 1XD7A 2A68F 2CWEA 1FZPB 4L9TA 3WE2A 4XLNF 3E6BA 2H6CA 3KZYA 4ZYDA 1QNTA 4Q47A 3TOBA 1BI1A 2Z3YA 4QWQA 3KLNA 1V3FA 1HW5A 5DUKA 1A04A 4EGYA 1TW2A 2Z99A 3TQNA 1R5HA 4RB2C 1MJ9A 5FLXK 5HDKA 2CG4A 3TO6A 3J81Z 1P4XA 1TTYA 4IRHA 5E18F 4HX8A 3FMQA 5JHUA 2C6YA 3ROUA 1O57A 1O3QA 5AONA 4M9XA 4U88A 3T5XA 4EQQA 4U0YA 2OZUA 1OR7A 2XAHA 4WXDA 4LGWA 2ISYA 3E6DA 4BH9A 4HDUA 4CZZA 1G3SA 5LGTA 3COAC 1SD4A 3DV8A 3G3ZA 3K1PA 1QGPA 2K4JA 2D45A 5L3CA 3T8RA 1KU7A 4MQVA 1USTA 4IRGA 5DEQA 2F5DA 2NNNA 3F8CA 5HS7A 5F1RA 3LQQA 5CVRA 1IRFA 3WU0A 1I1GA 2IJLA 4L5IA 3BZ6A 3E3VA 1H9TA 4ZZDA 4P9FA 1B1BA 4RGSA 2FBHA 5LRRA 3K1NA 3FMSA 2H94A 5E8IA 3I4PA 3K1MA 2Q2EA 3DEUA 3LQRA 3NRVA 2L3DA 1BI3A 3VODA 3IRQA 2GA1A 2JT1A 1GVJA 2HEOA 3EUHA 1LDDA 4U7DA 3CUOA 2P8TA 1YW9A 3KETA 2RVCA 2L54A 4PCQA 4TV7A 1IUYA 1FC3A 1G4DA 1IXCA 3W6KB 4I09A 3R0AA 4HBLA 4Y15A 3SZTA 3V7RA 2QBYA 1XMAA 4HF2A 1YW7A 1L3LA 3C18A 4UNOA 4MNUA 4EM1A 5A2QZ 3ZMUA 3BPXA 3GF2A 1USSA 5D8LB 2JTVA 1SFXA 2PG4A 4P5OA 1MD0A 1F1ZA 4ESFA 2JRTA 4M6XA 5LBQA 5D6FA 2JSCA 2H09A 5KK1A 1ON1A 2XKPA 4IJAA 4HDVA 4MGRA 3R4KA 2ZJ2A 3GO5A 3HSEA 3REOA 3TDZC 1SD6A 2PN6A 2O6GE 2DK5A 4Q48A 1TNSA 1L0OC 1Z6RA 5JI6A 3GUDA 2LKPA 4HOBA 1G3YA 3EQLF 2IA0A 1FYLA 3I0TA 2DI3A 1R58A 4P55A 2XAFA 3ERED 1FY7A 1U5TB 1XGSA 1O3SA 2CQKA 1SD5A 4ON0A 2MA3A 3HHGA 2ESNA 1RUOA 2V1XA 1ZRDA 1FBSA 4UUVA 1MDMB 1T2KA 4DNCA 1Z9CA 2F5FA 2ETHA 4L9NA 3S2WA 3FF5A 3RPUA 1RI7A 2HWVA 2X0LA 4FX0A 4CYDA 1B9NA 4KYWA 1XN7A 1YS6A 1ZYRF 1BBYA 1ODDA 1TQIA 5J8FA 1FSHA 5H20A 3KP5A 3R61A 3ZMTA 4OMYA 3FMRA 5HS9A 4YIIA 4LK1F 4CICA 2FNPA 3EYYA 1BOAA 5ICFA 4IVNA 5L3GA 1G3WA 4HQEA 4UXNA 2GQQA 2P5VA 3WTWC 4F7ZA 1QO0D 2H6BA 2GWRA 4I2OA 5DD4A 1IW7F 4IPAA 4G7HF 4ENJA 1DUXC 4GYIA 4BHPA 2IVMA 2HKXA 2XAJA 3QRFF 1FSEA 1HW1A 1IF1A 4CGZA 3IL2A 2FE3A 5AIQA 2AXLA 1BI0A 3TGNA 2QVOA 5TJJA 4HX4A 3IKTA 4BNCA 4GO1A 3VOEA 2FSWA 2JPBA 1U3EM 4UHTA 3KZZA 1PP8F 3C3WA 1WRJA 3BP8A 3DFGA 3GW2A 4RAZA 1F9NA 2XAGA 3I5UA 5FFXA 5JR3A 4S04A 3HOTA 4M6YA 2YX7A 2XHKA 3CLOA 3KE2A 4ZYHA 3SFZA 4KUMA 3K9TA 2STWA 2PJPA 1P4WA 3GXOA 4KICA 2ISZA 2O3FA 4YFXF 1D8KA 5LRSA 1QBJA 1O7FA 5BPDA 3KP3A 2XVCA 4IRIA 5IT9K 3HSFA 1ZREA 3ZP5A 3JAMK 3PQJA 3I53A 3L9FA 1T98A 2R7DA 2FQ3A 3O6BB 2YX4A 1ZARA 3LA7A 3KFWX 3CUQC 1TQPA 1R1VA 2VONA 1FP2A 4QLCU 3LA3A 1Q1HA 4EVIA 5DDGA 2NNYA 2STTA 2KKOA 1I6XA 2RNJA 1RNLA 3GZ5A 3M1EA 3CUQA 4WXHA 4PGGA 1FLIA 1OPCA 1YQAA 1XGMA 1FOKA 1U2WA 2FMYA 1AWCA 2DAOA 2WTEA 1B6AA 1JGSA 3ZN1A 1XGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDP A;  3J81 K;  3V7C A;  2OD5 A;  2W84 A;  1KYW A;  1LVA A;  2ZBK A;  4HA8 A;  1Z1D A;  3RKY A;  1UB9 A;  2DW4 A;  2QUF A;  3RKW A;  1SFU A;  1Z05 A;  2ZME A;  3KEO A;  4RB3 C;  2GZW A;  4HYE A;  4JBA A;  3WGG A;  3FXQ A;  1W7P B;  2E7W A;  3HOS A;  4KFC A;  3HTS B;  2DU9 A;  2D2W A;  2VE9 A;  2HR3 A;  4LG0 A;  3DQV C;  1W7P D;  4KN4 X;  1FX7 A;  3E5U A;  4XRF A;  3KCC A;  1ZLJ A;  5K5R A;  2FRH A;  4HAM A;  4MQ9 F;  4P96 A;  4AWX B;  1ZH5 A;  5ICG A;  3T8T A;  3J80 Z;  2RQP A;  3MCZ A;  2XUB A;  5D5V B;  4MHG A;  4WK8 F;  1YW8 A;  5CVV A;  2KIM A;  4EV0 A;  1O3R A;  2DLL A;  5H6Q A;  3F22 A;  1R22 A;  3DF8 A;  1MZB A;  3GYH X;  1GXP A;  1I5Z A;  3BPV A;  5FD6 A;  4L0Y B;  1P4A A;  3MWM A;  1ZG5 A;  4A0Y A;  3V4G A;  1OYY A;  3HYI A;  3VB2 A;  4OIO F;  1IXS B;  1UFM A;  1YTY A;  4CO8 A;  5K5Q A;  2W57 A;  4GCV A;  4HW0 A;  1HKT A;  3DPT A;  4DQ2 A;  2P7C B;  3FWE A;  2FEZ A;  4NQW A;  4EJW A;  5L3E A;  5FFZ A;  4L5J A;  5CJ9 A;  2V9V A;  2A6E F;  2LNB A;  4I7H A;  3GZ6 A;  5LHH A;  1K78 A;  1W4M A;  1TW3 A;  3F8B A;  1I27 A;  3GFM A;  4RGX A;  1YIO A;  3RPQ A;  1J75 A;  1F5T A;  3MFK A;  5HLG A;  1GHC A;  3ISP A;  2QWW A;  3GFI A;  1R23 A;  5A2Q K;  1JXS A;  3WG9 A;  2K4B A;  3HIF A;  1TNT A;  1LDJ A;  4A0X A;  4ESJ A;  1S3J A;  1OYW A;  2QM3 A;  1O3T A;  2HTJ A;  4NB5 A;  3ULQ B;  1WSU A;  1EH7 A;  4KNY A;  2EFO A;  2IPQ X;  3CO7 C;  2FBK A;  2XGX A;  4M9Z A;  5DCM A;  3JTG A;  5ED4 A;  1OKR A;  5EEH A;  2WWY A;  1RZ4 A;  4XLP F;  1R5G A;  2ZNZ A;  5L3D A;  1FT9 A;  2MLG A;  3HHH A;  3JTH A;  4KIG A;  1BJA A;  3P7N A;  5ICC A;  4RB0 A;  2UWM A;  4U0W A;  3QPT A;  2ADU A;  2P7V B;  2QQ9 A;  4KDP A;  5H6R A;  3SXY A;  1PDN C;  3LWF A;  4HLX A;  4ENM A;  3IC7 A;  2F2E A;  4M71 A;  3I59 A;  2EA4 A;  2WV0 A;  3KP2 A;  4GGG A;  4G8X A;  2EV0 A;  3D0S A;  1MJB A;  3TDU C;  1LJ9 A;  1HSJ A;  3KP4 A;  4YIF A;  3E97 A;  2CW0 F;  1KU3 A;  3C1D A;  3BJ6 A;  4WCG A;  1ZG1 A;  4Q4Z F;  2VOP A;  2QYO A;  3B02 A;  1ZG3 A;  3U2R A;  2EV5 A;  4IXA A;  2HTS A;  3RDI A;  3RYR A;  2EFP A;  4KT5 C;  3RKX A;  2PFB A;  5F64 A;  5CVJ A;  4KIF A;  4ZYE A;  2FNA A;  3F21 A;  3HRM A;  3WTU C;  4IHT A;  5CYV A;  5E1X A;  2R7F A;  2IT0 A;  1YLF A;  2NYX A;  2W24 A;  1FYK A;  1D3Y A;  1S8N A;  4A2U A;  3IKV A;  5KVR A;  4IF4 A;  3D5L A;  4N9H A;  1E2X A;  3ZMZ A;  1HST A;  3M8E A;  2XKO A;  1SMT A;  1H0M A;  2RN7 A;  2TDX A;  2V1D A;  2XV4 S;  3ELK A;  2OAZ A;  2HKO A;  4FHT A;  1HKS A;  4EJU A;  4MTD A;  4KMU X;  1QQI A;  1Y0U A;  5HDG A;  1HXD A;  4KIB A;  1X3U A;  2LSO A;  4LLL A;  3WU1 B;  1FNN A;  4BAY A;  1ULY A;  5FGM A;  1BI2 A;  3F6V A;  1DPU A;  1IRG A;  1T6S A;  1YS7 A;  3DP7 A;  4R1H A;  1XSX A;  4YFK F;  5E8G A;  4M74 A;  1EH8 A;  3ZMS A;  1T39 A;  1IN7 A;  2EFQ A;  2CFX A;  1LDK B;  1IN6 A;  3FM5 A;  3T0Y A;  4WWC A;  3WOD F;  3EDP A;  1Z6T A;  3ZMD A;  3EYI A;  5BS6 A;  1PP7 U;  4RGR A;  1YFH A;  2QEN A;  5E20 A;  2DQL A;  4Q5S F;  1ZAO A;  2ZO4 A;  3C7J A;  1ONV A;  1BC8 C;  3BDD A;  4AIK A;  4EJT A;  3ZN0 A;  3BWG A;  1F4K A;  4EM0 B;  3PFI A;  2D1V A;  2OZ6 A;  4CHU A;  2MBF A;  3JSO A;  1D8J A;  3IWF A;  3U1D A;  4YG2 F;  4PDK A;  3P9C A;  2ZKZ A;  1VTN C;  1FP1 D;  4AIJ A;  4XBF A;  5BPI A;  1ZN2 A;  4E70 A;  3N97 A;  3MZH A;  3SHF A;  2VBZ A;  3MEX A;  2XRO A;  5BOX A;  1BM9 A;  2HOE A;  1OMI A;  3KP6 A;  5TRD A;  2YR2 A;  2BV6 A;  2EJR A;  2CGP A;  1NHA A;  1CF7 B;  4IHS A;  2BGC A;  4KMF A;  1XSV A;  2UZK A;  1ZRC A;  4S05 A;  4I02 A;  1WI9 A;  1D5V A;  1LNW A;  4HV5 A;  2LF7 A;  3NEU A;  5ILU A;  2BE5 F;  3J80 K;  1ON2 A;  3GVA A;  4HX7 A;  1ZHF A;  2PQ8 A;  5CLS A;  5CVU A;  3BJO A;  5E1Z B;  1J2X A;  4B8X A;  4A12 A;  2YPR A;  1K6O A;  2CYY A;  4NHJ A;  1I1S A;  4O3M A;  2RC4 A;  3GWZ A;  1W5S A;  3Q9S A;  1J0R A;  1S7A A;  1Z7U A;  4UV8 A;  2HYG D;  3LA2 A;  2O61 A;  4N0B A;  5FB2 A;  1U5T C;  1PUE E;  2K86 A;  4LK0 F;  2QZ8 A;  1IN8 A;  3BY6 A;  2AS5 F;  4L0Z B;  2GXB A;  1IXR C;  1UHM A;  1STZ A;  1U5T A;  4LB5 A;  3M8F A;  3MQ0 A;  3P9I A;  3KEQ A;  3HRT A;  4XSX F;  2M87 A;  2PI0 A;  3LST A;  4Z2Y A;  4FX4 A;  2GXG A;  1DPR A;  3RJP A;  2D1H A;  3N4M A;  1MDM A;  3K2Z A;  1KGS A;  2O8X A;  3TO9 A;  4BXU A;  3FHZ A;  1YG2 A;  5ILS A;  4RGU A;  1J9I A;  3LFK A;  3V8J A;  2KIF A;  1IAW A;  5ILV A;  2W85 A;  3ABU A;  2V6C A;  5LHG A;  2IW5 A;  1XB4 A;  1OYI A;  3H92 A;  1QPM A;  5ICE A;  2UXX A;  1XDU A;  2QQA A;  3KP7 A;  3ABT A;  3E5X A;  3MAJ A;  2ACJ A;  4BHC A;  4L9J A;  2M5W A;  4HF1 A;  1CGP A;  2V1U A;  4PGH A;  5L3F A;  1J5Y A;  1B59 A;  5L3B A;  2IRF G;  2MC3 A;  4Y13 A;  4JQF A;  1MJA A;  4EGZ A;  2L4A A;  4YFN F;  1LEB A;  5D6E A;  1WWX A;  2RKH A;  5DUI A;  2WC2 A;  2E1C A;  2HQN A;  5E17 F;  1HW2 A;  1AOY A;  2Y75 A;  1KU2 A;  4HLY A;  3R0J A;  2DT5 A;  1DDN A;  1LQ1 A;  3HRS A;  3RTR A;  5E1W A;  2K7L A;  3J7A O;  5LGN A;  3CDH A;  4O5V A;  4A0Z A;  4XSZ F;  2QLZ A;  2HS5 A;  3F8M A;  2IA2 A;  4K2E A;  5DV5 A;  5EEG A;  3IWZ A;  2PBI A;  2FOK A;  1TQM A;  4I0A A;  5LHI A;  4L18 B;  2VOD A;  2A6H F;  3L00 A;  2XAS A;  1J7K A;  3I71 A;  4G7Z F;  2VN2 A;  2VBW A;  2ZFW A;  3P9K A;  1UCR A;  3G73 A;  3GFJ A;  3F6O A;  1UHW A;  1R1U A;  4G7O F;  2G9W A;  1FWZ A;  4G94 A;  2MD5 A;  3ECH A;  2A3S A;  1XCB A;  4CDG A;  2JPC A;  3I64 A;  2NS0 A;  3SZP A;  4EJV A;  2HYF A;  3FX3 A;  2A5Y B;  2OBP A;  4N9I A;  4BQA A;  1T38 A;  3H3U A;  3WGH A;  5K5O A;  4PZJ A;  4MEY F;  1H9G A;  5F6F A;  2PEX A;  3K0L A;  3M9A A;  3Q5F A;  4B09 A;  4UVB A;  1G6N A;  2ZCW A;  2M30 A;  5J6X A;  1K79 A;  1IN5 A;  3F3X A;  1S6L A;  2A61 A;  5LEJ A;  2DK8 A;  2FML A;  3JSP A;  2YSR A;  4LMY A;  5DD8 A;  2VC0 A;  4G6Q A;  4UV9 A;  2GA2 A;  3BRO A;  3T1B A;  4JK1 X;  4A5M A;  2VT3 A;  4RAY A;  4R8H A;  1K7A A;  2X4H A;  1ZGA A;  5J8C A;  3SQN A;  6PAX A;  4ENK A;  2IA1 A;  2KJB A;  3QOP A;  1WQ2 A;  2KRF A;  2HGC A;  4CXF A;  1W7P A;  3F8N A;  3H3Z A;  1MGT A;  2CO5 A;  5LGU A;  3MZY A;  5HLH A;  2M1B A;  4M73 A;  1R36 A;  2F5E A;  3TOA A;  4KA4 A;  5HVQ C;  1XSD A;  4OIN F;  5AIP A;  1U8R A;  2V79 A;  4KN7 X;  1FPQ A;  2MLK A;  3HUG A;  3R6S A;  1Z91 A;  4P9U A;  2XIG A;  2QQB A;  1HQC A;  4ESB A;  3VFZ A;  3O3K A;  2DO7 A;  2BBY A;  1QZZ A;  1U6G A;  4ETS A;  1XMK A;  1FYM A;  2PMH A;  5ERI A;  4UVC A;  3R60 A;  3V7S A;  2E7X A;  3DXJ F;  5FO5 A;  1ZLK A;  2VBX A;  1E17 A;  2XRN A;  4BYY A;  3TKY A;  4LLG F;  2Z33 A;  3E6C C;  5FLX Z;  2E1N A;  3IHU A;  3QP5 A;  2HQR A;  2OQG A;  3TO7 A;  1GXQ A;  2ZNY A;  2B0L A;  2IP2 A;  2ZXJ A;  1ZGJ A;  3GEZ A;  2DPU A;  4L9V A;  2K02 A;  1EV7 A;  1J59 A;  4OMZ A;  2GIV A;  4WX9 A;  4U7B A;  2KIU A;  4O6J A;  3B73 A;  2P6S A;  2J5O A;  3RYP A;  2DTR A;  1DP7 P;  1C0W A;  3FXU A;  5JVT A;  2EFW A;  1R00 A;  3I54 A;  1S29 A;  2L4M A;  1RIO H;  2W25 A;  1B4A A;  3M7G A;  3FM3 A;  1SMY F;  3E6M A;  5D8K B;  4ZYG A;  4Y17 A;  3E5Q A;  4GYG A;  2PMU A;  3WTX C;  3O2P E;  1BIA A;  1U78 A;  1B9M A;  4LB6 B;  3LAP A;  3FXR A;  2JZY A;  2H27 A;  2HZT A;  2EFN A;  3VEP A;  5HDN A;  4R79 A;  1R1T A;  2MH9 A;  2YU3 A;  3F8F A;  5D4S A;  3CUQ B;  1P92 A;  3ECO A;  3L7W A;  3OV8 A;  2PLY A;  1P2F A;  1T0F A;  3WTY C;  4H0E A;  1MKM A;  3HSR A;  2A69 F;  1SFE A;  3F72 A;  2DFI A;  2RV8 A;  3Q9V A;  2VC1 A;  3PQK A;  3DPL C;  2EA2 A;  5FD5 A;  4OOI A;  2Q0O A;  2ZME B;  3RIR A;  4MTE A;  5HOO A;  2EV6 A;  2EWN A;  3RI4 A;  2LF8 A;  1JE8 A;  4WF2 A;  3V8K A;  1SD7 A;  2BYV E;  2M8E A;  3QU6 A;  2P6T A;  2OA4 A;  2G7H A;  1BC7 C;  3QPH A;  3GFL A;  3KLO A;  3BJA A;  2J5P A;  4LG0 B;  1YO5 C;  2A07 F;  3WTS C;  1KYZ A;  4EM2 A;  2FXA A;  2KJC A;  3ZMV A;  2FA5 A;  4AD9 A;  2R3S A;  4ZZL A;  2K27 A;  5JFR A;  1G3T A;  5K1Y A;  2Z5U A;  4ZH4 F;  1RUN A;  1TBX A;  4M9S A;  4LLN A;  1S7O A;  3HRU A;  4AIH A;  3CTA A;  1KU9 A;  5HS8 A;  4UVA A;  2EB7 A;  5BQT A;  3OOP A;  4D0P A;  4ASN A;  2Y0M A;  1KA8 A;  3L09 A;  2L01 A;  4I01 A;  2NRA C;  1TLH B;  1O7L A;  2M45 A;  3WTZ A;  1REP C;  2VE8 A;  2DPD A;  3IRR A;  3WTV C;  3FZV A;  1LEA A;  5D4R A;  4A5N A;  2P5K A;  3LAJ A;  4ENN A;  3U9G A;  4BHB A;  4HV6 A;  2OQR A;  2FBI A;  3WTT C;  1K78 B;  4EJO A;  1IN4 A;  3AAF A;  1QZY A;  3ML6 A;  2EK5 A;  5DYM A;  4OU0 A;  2O03 A;  4HQM A;  2VT2 A;  1FBQ A;  2P4W A;  2DQR A;  1IZ1 A;  4A6E A;  1XDS A;  2MH2 A;  5HLI A;  3GX4 X;  4HF0 A;  5LEK A;  1BN5 A;  5D5U B;  3NQO A;  2VOO A;  5DCF A;  2HFH A;  2P5L C;  2G7U A;  1KQ9 A;  5CVI A;  2VXZ A;  2Q8K A;  2RGV A;  4LFU A;  1FBU A;  2FF4 A;  1YYV A;  4I0B A;  3BOQ A;  3CO6 C;  1XGN A;  3ZQ7 A;  2XAQ A;  5DCM B;  4G9Y A;  1HKQ A;  5D5W B;  1R7J A;  4AVP A;  2CSO A;  2F5C A;  3ZPL A;  4OIR F;  1EH6 A;  2UXN A;  4A6D A;  1BIB A;  3QP6 A;  1JHH A;  1P6R A;  4FT8 A;  4RB1 A;  4OIP F;  2COM A;  4EMS A;  1V4R A;  4U0V A;  3K69 A;  2Y48 A;  1W5T A;  2GAU A;  1LB2 A;  4LD5 A;  3JW4 A;  5IT3 A;  3QAH A;  2BEO A;  1SAX A;  3V8L A;  2L02 A;  3I59 B;  1JHF A;  3QU3 A;  3WGI A;  2OU2 A;  1XCV A;  2NAZ A;  3I58 A;  4GXO A;  1KQ8 A;  2Z9O A;  3WE3 A;  4HZF A;  2LDU A;  3L2C A;  1KQ0 A;  1WKM A;  3CJN A;  1ZRF A;  3DKW A;  5BMZ A;  4RS8 A;  1HBX G;  3HTU A;  4WXC A;  4OIQ F;  2HDC A;  2FU4 A;  3F23 A;  4LJZ F;  2DBB A;  4G6D A;  5IT9 Z;  3EET A;  2ELH A;  2O0Y A;  3JAM Z;  1CF7 A;  5D5X B;  2QBY B;  3GLX A;  3W6J B;  4M72 A;  4I98 B;  2VBY A;  5LLQ A;  4MEX F;  2ESH A;  1XD7 A;  2A68 F;  2CWE A;  1FZP B;  4L9T A;  3WE2 A;  4XLN F;  3E6B A;  2H6C A;  3KZY A;  4ZYD A;  1QNT A;  4Q47 A;  3TOB A;  1BI1 A;  2Z3Y A;  4QWQ A;  3KLN A;  1V3F A;  1HW5 A;  5DUK A;  1A04 A;  4EGY A;  1TW2 A;  2Z99 A;  3TQN A;  1R5H A;  4RB2 C;  1MJ9 A;  5FLX K;  5HDK A;  2CG4 A;  3TO6 A;  3J81 Z;  1P4X A;  1TTY A;  4IRH A;  5E18 F;  4HX8 A;  3FMQ A;  5JHU A;  2C6Y A;  3ROU A;  1O57 A;  1O3Q A;  5AON A;  4M9X A;  4U88 A;  3T5X A;  4EQQ A;  4U0Y A;  2OZU A;  1OR7 A;  2XAH A;  4WXD A;  4LGW A;  2ISY A;  3E6D A;  4BH9 A;  4HDU A;  4CZZ A;  1G3S A;  5LGT A;  3COA C;  1SD4 A;  3DV8 A;  3G3Z A;  3K1P A;  1QGP A;  2K4J A;  2D45 A;  5L3C A;  3T8R A;  1KU7 A;  4MQV A;  1UST A;  4IRG A;  5DEQ A;  2F5D A;  2NNN A;  3F8C A;  5HS7 A;  5F1R A;  3LQQ A;  5CVR A;  1IRF A;  3WU0 A;  1I1G A;  2IJL A;  4L5I A;  3BZ6 A;  3E3V A;  1H9T A;  4ZZD A;  4P9F A;  1B1B A;  4RGS A;  2FBH A;  5LRR A;  3K1N A;  3FMS A;  2H94 A;  5E8I A;  3I4P A;  3K1M A;  2Q2E A;  3DEU A;  3LQR A;  3NRV A;  2L3D A;  1BI3 A;  3VOD A;  3IRQ A;  2GA1 A;  2JT1 A;  1GVJ A;  2HEO A;  3EUH A;  1LDD A;  4U7D A;  3CUO A;  2P8T A;  1YW9 A;  3KET A;  2RVC A;  2L54 A;  4PCQ A;  4TV7 A;  1IUY A;  1FC3 A;  1G4D A;  1IXC A;  3W6K B;  4I09 A;  3R0A A;  4HBL A;  4Y15 A;  3SZT A;  3V7R A;  2QBY A;  1XMA A;  4HF2 A;  1YW7 A;  1L3L A;  3C18 A;  4UNO A;  4MNU A;  4EM1 A;  5A2Q Z;  3ZMU A;  3BPX A;  3GF2 A;  1USS A;  5D8L B;  2JTV A;  1SFX A;  2PG4 A;  4P5O A;  1MD0 A;  1F1Z A;  4ESF A;  2JRT A;  4M6X A;  5LBQ A;  5D6F A;  2JSC A;  2H09 A;  5KK1 A;  1ON1 A;  2XKP A;  4IJA A;  4HDV A;  4MGR A;  3R4K A;  2ZJ2 A;  3GO5 A;  3HSE A;  3REO A;  3TDZ C;  1SD6 A;  2PN6 A;  2O6G E;  2DK5 A;  4Q48 A;  1TNS A;  1L0O C;  1Z6R A;  5JI6 A;  3GUD A;  2LKP A;  4HOB A;  1G3Y A;  3EQL F;  2IA0 A;  1FYL A;  3I0T A;  2DI3 A;  1R58 A;  4P55 A;  2XAF A;  3ERE D;  1FY7 A;  1U5T B;  1XGS A;  1O3S A;  2CQK A;  1SD5 A;  4ON0 A;  2MA3 A;  3HHG A;  2ESN A;  1RUO A;  2V1X A;  1ZRD A;  1FBS A;  4UUV A;  1MDM B;  1T2K A;  4DNC A;  1Z9C A;  2F5F A;  2ETH A;  4L9N A;  3S2W A;  3FF5 A;  3RPU A;  1RI7 A;  2HWV A;  2X0L A;  4FX0 A;  4CYD A;  1B9N A;  4KYW A;  1XN7 A;  1YS6 A;  1ZYR F;  1BBY A;  1ODD A;  1TQI A;  5J8F A;  1FSH A;  5H20 A;  3KP5 A;  3R61 A;  3ZMT A;  4OMY A;  3FMR A;  5HS9 A;  4YII A;  4LK1 F;  4CIC A;  2FNP A;  3EYY A;  1BOA A;  5ICF A;  4IVN A;  5L3G A;  1G3W A;  4HQE A;  4UXN A;  2GQQ A;  2P5V A;  3WTW C;  4F7Z A;  1QO0 D;  2H6B A;  2GWR A;  4I2O A;  5DD4 A;  1IW7 F;  4IPA A;  4G7H F;  4ENJ A;  1DUX C;  4GYI A;  4BHP A;  2IVM A;  2HKX A;  2XAJ A;  3QRF F;  1FSE A;  1HW1 A;  1IF1 A;  4CGZ A;  3IL2 A;  2FE3 A;  5AIQ A;  2AXL A;  1BI0 A;  3TGN A;  2QVO A;  5TJJ A;  4HX4 A;  3IKT A;  4BNC A;  4GO1 A;  3VOE A;  2FSW A;  2JPB A;  1U3E M;  4UHT A;  3KZZ A;  1PP8 F;  3C3W A;  1WRJ A;  3BP8 A;  3DFG A;  3GW2 A;  4RAZ A;  1F9N A;  2XAG A;  3I5U A;  5FFX A;  5JR3 A;  4S04 A;  3HOT A;  4M6Y A;  2YX7 A;  2XHK A;  3CLO A;  3KE2 A;  4ZYH A;  3SFZ A;  4KUM A;  3K9T A;  2STW A;  2PJP A;  1P4W A;  3GXO A;  4KIC A;  2ISZ A;  2O3F A;  4YFX F;  1D8K A;  5LRS A;  1QBJ A;  1O7F A;  5BPD A;  3KP3 A;  2XVC A;  4IRI A;  5IT9 K;  3HSF A;  1ZRE A;  3ZP5 A;  3JAM K;  3PQJ A;  3I53 A;  3L9F A;  1T98 A;  2R7D A;  2FQ3 A;  3O6B B;  2YX4 A;  1ZAR A;  3LA7 A;  3KFW X;  3CUQ C;  1TQP A;  1R1V A;  2VON A;  1FP2 A;  4QLC U;  3LA3 A;  1Q1H A;  4EVI A;  5DDG A;  2NNY A;  2STT A;  2KKO A;  1I6X A;  2RNJ A;  1RNL A;  3GZ5 A;  3M1E A;  3CUQ A;  4WXH A;  4PGG A;  1FLI A;  1OPC A;  1YQA A;  1XGM A;  1FOK A;  1U2W A;  2FMY A;  1AWC A;  2DAO A;  2WTE A;  1B6A A;  1JGS A;  3ZN1 A;  1XGO A; 
#chains in the Genus database with same CATH topology
 4ABZ A;  1OLT A;  2RDP A;  3J81 K;  3V7C A;  2OD5 A;  4DIQ A;  4F91 B;  1X1P A;  2W84 A;  3G71 I;  5IYD J;  3DTK A;  3MKW B;  1KYW A;  1LVA A;  1N78 A;  2ZBK A;  1IGN A;  2Z16 A;  4HA8 A;  1Z1D A;  3RKY A;  1UB9 A;  2L7F P;  4Y33 A;  2DW4 A;  2QUF A;  3LFU A;  3RKW A;  1SFU A;  3TBI A;  1Z05 A;  1E3H A;  4PSX A;  5FKK A;  2ZME A;  2L0K A;  3KEO A;  4J01 A;  4RB3 C;  2GZW A;  2LP0 A;  3CMM A;  4HYE A;  2XPW A;  1XX5 A;  2HXI A;  4JBA A;  2FX0 A;  3WGG A;  3FXQ A;  2KRH A;  1W7P B;  2HNH A;  2KIQ A;  2E7W A;  2H1L A;  2K9L A;  3HOS A;  1DQU A;  4KFC A;  2ZXW H;  3HTS B;  3HL2 A;  2R5Y A;  2DU9 A;  2D2W A;  2VE9 A;  2HR3 A;  4LG0 A;  4C2T A;  3CC2 I;  3J7A Y;  5KCM A;  3DQV C;  3SEZ A;  1W7P D;  1QU3 A;  4KN4 X;  1FX7 A;  5GP9 A;  1PUF A;  1B8I B;  2CUZ A;  3HUG B;  1IDY A;  3E5U A;  1BR4 A;  4XRF A;  1R9T J;  3OY9 A;  3KCC A;  1ZLJ A;  5K5R A;  1WPK A;  2FRH A;  4HAM A;  4MQ9 F;  1RES A;  4P96 A;  2JJ7 A;  4AWX B;  1ZH5 A;  9ANT A;  5ICG A;  3DWL E;  4XR6 A;  3T8T A;  3J80 Z;  2RQP A;  3MCZ A;  3OSF A;  2XUB A;  2KRC A;  1LFP A;  5D5V B;  4MHG A;  2PJR B;  4V2G A;  4WK8 F;  1YW8 A;  5CVV A;  2KIM A;  4EV0 A;  1O3R A;  2LH9 A;  2DLL A;  5H6Q A;  3F22 A;  1R22 A;  4UB8 C;  3DF8 A;  1MZB A;  3GYH X;  1GXP A;  2NVQ J;  2OTJ I;  1I5Z A;  3BPV A;  5FD6 A;  4L0Y B;  2JA2 A;  3OSG A;  2CV1 A;  3JRI A;  2YUS A;  3HOX J;  1P4A A;  2F4O B;  3MWM A;  1ZG5 A;  4A0Y A;  1O4X A;  3V4G A;  1OYY A;  3HYI A;  2WAE A;  3VB2 A;  4B4C A;  3MZ8 A;  1BL0 A;  3V42 A;  2K9M A;  4H4K C;  4OIO F;  1IXS B;  4A3J J;  1UFM A;  2HI3 A;  1YTY A;  4CO8 A;  5K5Q A;  1ETY A;  5GPA A;  2X48 A;  2JA8 J;  3PL8 A;  2W57 A;  4GCV A;  4HW0 A;  1HKT A;  2K85 A;  3DPT A;  3D5R C;  4DQ2 A;  2P7C B;  3FWE A;  4RM3 A;  3CQZ J;  5TGT A;  3TW7 A;  2JA5 J;  2OTL I;  4NNJ A;  2FEZ A;  2K5C A;  3VYS B;  4NQW A;  3H0G J;  4EJW A;  5FFZ A;  5L3E A;  4IX7 A;  1JTY A;  1OCR H;  4L5J A;  4RDU A;  2R7Q A;  5CJ9 A;  2LLK A;  2V9V A;  2A6E F;  2F4M B;  2LNB A;  2JWT A;  2IGN A;  4I7H A;  4IL6 C;  3GZ6 A;  5LHH A;  4BY7 J;  1K78 A;  5M3F J;  2Y30 A;  1W4M A;  4BJ5 C;  1ORK A;  1MBJ A;  1TW3 A;  1OR7 C;  3F8B A;  1I27 A;  3K10 A;  3GFM A;  4B3X A;  1W36 C;  4RGX A;  1YIO A;  1XMX A;  3RPQ A;  2L5Q A;  1J75 A;  1F5T A;  3MFK A;  1SEU A;  5HLG A;  4XN3 A;  1GHC A;  3CDL A;  3ISP A;  2QWW A;  3GFI A;  1R23 A;  4A3B J;  5A2Q K;  1JXS A;  2ECC A;  2Y69 H;  3IP4 B;  2V1N A;  3WG9 A;  2M3A A;  2K4B A;  3HIF A;  1TNT A;  1LDJ A;  3W2A A;  3CDI A;  3ZQG A;  4A0X A;  2LD5 A;  4OWR B;  4ESJ A;  1IO2 A;  4V2F A;  1S3J A;  1LE8 B;  4A3G J;  1OYW A;  3HOV J;  1IG7 A;  1D1B A;  1Y0N A;  4F93 B;  4LOC A;  2QM3 A;  1O3T A;  5C4X J;  2CV2 A;  2HTJ A;  4NB5 A;  3IAM 2;  2UUZ A;  3ULQ B;  1WSU A;  1ETQ A;  1EH7 A;  4KNY A;  2EFO A;  2IPQ X;  1IUF A;  3W3C A;  3CO7 C;  3A4C A;  2FBK A;  3HG9 A;  4P1W A;  1TL8 A;  4C2U A;  2OV7 A;  3L2W A;  5DTD A;  3OYC A;  2XGX A;  2Y2Z A;  4M9Z A;  5DCM A;  3JTG A;  3G2B A;  3QYF A;  4AYB A;  5ED4 A;  1OKR A;  1Y1W J;  5EEH A;  2WWY A;  2AQE A;  1RZ4 A;  2QF7 A;  1R5G A;  2ZNZ A;  4XLP F;  5L3D A;  4IO9 F;  5FLV A;  1FT9 A;  1MNE A;  2MLG A;  3HHH A;  1EF4 A;  4NC7 A;  2LTP A;  3JTH A;  3MKL A;  4KIG A;  2VPL A;  1BJA A;  3BQY A;  4L5E A;  4AC0 A;  3P7N A;  5ICC A;  4RB0 A;  2UWM A;  3NAR A;  4U0W A;  3QPT A;  2DMP A;  4B48 A;  1Z0X A;  3B6C A;  4M3F A;  2ADU A;  1H88 C;  2P7V B;  2ICW G;  2QQ9 A;  4FCY A;  1WHU A;  4E7K A;  3S3O A;  5H6R A;  3SXY A;  1PDN C;  4KDP A;  3LWF A;  4HLX A;  1QHG A;  4ENM A;  3IC7 A;  3KYD B;  2F2E A;  4M71 A;  3I59 A;  3EUH C;  5M5W J;  3ZQC A;  2MGQ A;  1I6H J;  2EA4 A;  2WV0 A;  4BDY A;  3KP2 A;  4X0G A;  4RBO A;  4GGG A;  1YIJ I;  4G8X A;  2GOM A;  2EV0 A;  3D0S A;  1VQ6 I;  2DA1 A;  1MJB A;  3TDU C;  1LJ9 A;  2XSD C;  1E3O C;  1VQ7 I;  1HSJ A;  3KP4 A;  4YIF A;  3E97 A;  2CW0 F;  3HXL A;  1KU3 A;  3C1D A;  3VYR B;  3BJ6 A;  4WCG A;  1ZG1 A;  5KAI C;  3VDX A;  2QYO A;  3B02 A;  4Q4Z F;  2VOP A;  1ZG3 A;  1R71 A;  2R5Z A;  3U2R A;  2EV5 A;  4IXA A;  3HM5 A;  2HTS A;  3RDI A;  3RYR A;  2EFP A;  4C30 A;  1XC5 A;  4KT5 C;  2WB1 A;  2K3P A;  3RKX A;  3QOD A;  2PFB A;  2RQQ A;  5F64 A;  5CVJ A;  4KIF A;  2YU9 J;  2HPI A;  2XAU A;  4ZYE A;  2ZJR F;  2L9S A;  2FNA A;  3ASN H;  3F21 A;  3HRM A;  2ECB A;  4XOR A;  1TWA J;  3WTU C;  4BS9 A;  3L2U A;  3CD6 I;  4IHT A;  5M5X J;  1TC3 C;  2HDW A;  4CYC B;  3HPG A;  1HDD C;  4CCM A;  2NOG A;  2MW8 A;  5CYV A;  5E1X A;  5K7F A;  2NXN B;  4AM3 A;  3VSK A;  2R7F A;  2IT0 A;  2L9V A;  1YLF A;  2JA6 J;  1Z21 A;  2NYX A;  2W24 A;  5EZG A;  1FYK A;  5E3L A;  3S3N A;  2BY3 A;  2F4I A;  1H8A C;  4CA0 A;  1D3Y A;  1MMD A;  2O7O A;  4FE4 A;  1S8N A;  2XDV A;  4A2U A;  4DOZ A;  3IKV A;  3SJM A;  5KVR A;  4CCL A;  5F04 A;  3OS0 A;  3OYD A;  4IF4 A;  3D5L A;  4N9H A;  1E2X A;  3ZXS A;  3ZMZ A;  1HST A;  1P9Q C;  3M8E A;  2WAD A;  3QWL A;  2XKO A;  3TED A;  1SMT A;  1H0M A;  4PFP A;  2VKH A;  2RN7 A;  2TDX A;  5GTH C;  3PUB A;  2V1D A;  2FOW A;  2XV4 S;  3ELK A;  2KPM A;  2OAZ A;  2HKO A;  4FHT A;  2VJ5 A;  1HKS A;  2W00 A;  2RNG A;  3BG9 A;  3GTJ J;  4EJU A;  4D5F A;  4KMU X;  4MTD A;  1QQI A;  1T8I A;  1K4T A;  1Y0U A;  4C3H J;  5HDG A;  4AU7 A;  1D5Y A;  1HXD A;  2X6Y A;  4XRS A;  1LUJ B;  4KIB A;  4PUS A;  1X3U A;  2LSO A;  3GZN B;  4LLL A;  3WU1 B;  3U1K A;  2ME0 A;  2KDZ A;  1FNN A;  4IOC F;  2X9D A;  4BAY A;  2NVY J;  1POG A;  1ULY A;  1X3Z B;  5FGM A;  1BI2 A;  2V9P A;  3F6V A;  3LL7 A;  2W4S A;  1DPU A;  3FDY A;  1IRG A;  1T6S A;  1YS7 A;  4AYB N;  5IP6 A;  2E60 A;  2R92 J;  1BW6 A;  2A05 A;  3DP7 A;  4FAS D;  3QQA A;  2FD5 A;  3H9Q A;  3HJE A;  3LSJ A;  2OCE A;  2E1M C;  2HVR A;  2R7R A;  4IHW A;  1MBF A;  2X51 A;  4R1H A;  1XSX A;  1JI8 A;  1SVM A;  1P7J A;  4YFK F;  3CCQ I;  2KZG A;  5E8G A;  4M74 A;  3L1P A;  1EH8 A;  2X6W A;  3ZMS A;  3JR9 A;  4KIT B;  2R93 J;  1RKT A;  1WFX A;  1MMA A;  3CCV I;  1JJ8 C;  1T39 A;  1IN7 A;  2EFQ A;  2Z1D A;  2HXO A;  2CFX A;  1LDK B;  2QKM B;  1OCT C;  1IN6 A;  4BE0 A;  3FM5 A;  3T0Y A;  4WWC A;  1LVK A;  2L9N A;  3WOD F;  2GM4 A;  3EDP A;  1Z6T A;  5EGO B;  2WY7 Q;  3ZMD A;  1A36 A;  3AG4 H;  2Y31 A;  3EYI A;  5BS6 A;  1PP7 U;  1NG7 A;  2HU9 A;  3FIS A;  2O8K A;  4RGR A;  1D1C A;  1YFH A;  3OL3 A;  1MMG A;  4YRV A;  3HOW J;  1FTZ A;  2QEN A;  5E20 A;  3AL0 B;  1W1W E;  1A5J A;  2DQL A;  2CQX A;  3BR6 A;  4XLA A;  4Q5S F;  1ZAO A;  1ACI A;  1WJ5 A;  2W1O A;  3K4J A;  4ZC3 A;  2ZO4 A;  3C7J A;  1ONV A;  4RM2 A;  1BC8 C;  1IC8 A;  5F1J A;  2KL4 A;  2Y9Y A;  1Y1V J;  3BDD A;  4AIK A;  2Q1Z B;  3C2H A;  1U0J A;  3IH2 A;  4EJT A;  3ZN0 A;  1XS9 A;  3K6G A;  1TWF J;  1YOV B;  3BWG A;  4A3F J;  1F4K A;  2WB1 N;  4EM0 B;  2VLA A;  3PFI A;  2D1V A;  3FXK A;  3OYJ A;  5J4V A;  2CUF A;  2OZ6 A;  4CHU A;  2MBF A;  4Y52 J;  3JSO A;  2NS7 A;  1X1D A;  2VKE A;  3EPZ A;  1D8J A;  3IWF A;  3G6E I;  3U1D A;  2LC2 A;  4YG2 F;  3BG3 A;  4PDK A;  3P9C A;  3S2D J;  2LBF A;  1YRN A;  2ZKZ A;  1VTN C;  1SFK A;  1FP1 D;  3Q0V A;  4AIJ A;  1W0U A;  4XBF A;  5BPI A;  1ZN2 A;  5HNF A;  3SZG A;  1X3W B;  5DM7 F;  4E70 A;  4ZYA A;  3N97 A;  2RAE A;  3S16 J;  3MZH A;  1Z3Y A;  3SHF A;  2DA3 A;  3PNT A;  2VBZ A;  3MEX A;  2XRO A;  2EIJ H;  5BOX A;  2W82 A;  1BM9 A;  3Q3S A;  2HOE A;  1HC8 A;  1OMI A;  4UB6 C;  3KP6 A;  5TRD A;  2I5U A;  2YR2 A;  2XPV A;  2ID3 A;  3FIW A;  3DBL B;  2BV6 A;  2EJR A;  1ENH A;  2CGP A;  1NHA A;  1N77 A;  1OJL A;  1CF7 B;  4IHS A;  2BGC A;  3OYL A;  4KMF A;  3S1M J;  1XSV A;  2DYS H;  4OAZ A;  2UZK A;  2I10 A;  1ZRC A;  1VQ5 I;  4S05 A;  4I02 A;  1WI9 A;  2DFH A;  1P7I A;  4ZJZ A;  5GPC A;  2VL8 A;  1D5V A;  2E5N A;  2NS8 A;  1LNW A;  2L2O A;  4U87 A;  4HV5 A;  2LF7 A;  3NEU A;  3ABK H;  5ILU A;  2BE5 F;  3HB9 A;  3GTL J;  3C2B A;  3J80 K;  1ON2 A;  4DBQ A;  3CCM I;  3GVA A;  1TWH J;  3LNQ A;  4HX7 A;  1ZHF A;  2PQ8 A;  1FTT A;  5CLS A;  5CVU A;  3RZO J;  1GV5 A;  3BJO A;  5E1Z B;  1J2X A;  1MMN A;  5CQG A;  4B8X A;  1YJ9 I;  4A12 A;  2JA7 J;  2YPR A;  1K6O A;  2CYY A;  4NHJ A;  1I1S A;  2XGE A;  5F0C A;  3DLA A;  1SAU A;  4O3M A;  2RC4 A;  4XLF A;  3GWZ A;  3HBL A;  4BE1 A;  3D1N I;  1W5S A;  3Q9S A;  1S7A A;  1J0R A;  1AKH A;  1AA7 A;  1Z7U A;  4UV8 A;  1MIJ A;  2HYG D;  3LA2 A;  4D7M A;  1B72 B;  2O61 A;  3A0H C;  4N0B A;  5FB2 A;  1U5T C;  3S93 A;  1PUE E;  2XF5 A;  2K86 A;  1BA5 A;  2GXA A;  4YEL A;  4MFD A;  4FTH A;  4LK0 F;  3GTQ J;  2QZ8 A;  1HCR A;  2FUG 2;  2V4J C;  1IN8 A;  3K4L A;  2R7U A;  2DCE A;  3BY6 A;  1HF0 A;  2AS5 F;  5IP7 J;  4L0Z B;  2GXB A;  1K83 J;  3CLQ A;  1IXR C;  1UHM A;  1STZ A;  2LYC A;  3EUA A;  1U5T A;  4LB5 A;  3M8F A;  3MQ0 A;  3P9I A;  3KEQ A;  3HRT A;  4XSX F;  2M87 A;  3RSN A;  2PI0 A;  3LST A;  3JRB A;  1IDZ A;  4Z2Y A;  4FX4 A;  2DA7 A;  1I3Q J;  4BQQ A;  2GXG A;  4BXX J;  1DPR A;  5IOY A;  3BLY A;  3RJP A;  2L9R A;  2D1H A;  4Y4R A;  4PJN A;  3N4M A;  5J1R A;  1MDM A;  3A02 A;  1N75 A;  1W36 D;  4AUX A;  3K2Z A;  2ZME C;  1KGS A;  1ETV A;  2DOE A;  2O8X A;  3TO9 A;  2HVQ A;  4BXU A;  3FHZ A;  2VQC A;  1YG2 A;  5FKL A;  5ILS A;  1D1A A;  4RGU A;  1J9I A;  3LFK A;  3V8J A;  2KIF A;  1IAW A;  3HEF A;  2F5V A;  5ILV A;  2VJI A;  2W85 A;  3G1M A;  4A3M J;  3ABU A;  2GIZ A;  1MND A;  2V6C A;  3AG1 H;  3ONQ A;  1U8B A;  3N05 A;  5LHG A;  3BR0 A;  2IW5 A;  1BR1 A;  1TT0 A;  1WI3 A;  1XB4 A;  1OYI A;  4XK4 A;  3H92 A;  3KX2 A;  1QPM A;  5ICE A;  5FKN A;  1BJZ A;  3VYU B;  2UXX A;  1XDU A;  2BW3 A;  3LSM A;  3L2R A;  4GDF A;  2QQA A;  3KP7 A;  3ABT A;  3E5X A;  3MAJ A;  5BNG A;  2ACJ A;  4BHC A;  3BR3 A;  2XRL A;  3OWT A;  4L9J A;  2M5W A;  4HF1 A;  1CGP A;  2MYS A;  2HOT A;  4B47 A;  3JRA A;  2V1U A;  3PUF A;  4PGH A;  3SYT A;  2M8G X;  5L3F A;  1J5Y A;  3QYB A;  1DGR M;  5B66 C;  1B59 A;  5L3B A;  2IRF G;  2MC3 A;  3HOU J;  2IGK A;  3S17 J;  3DKX A;  4Y13 A;  4JQF A;  1MJA A;  4EGZ A;  2L4A A;  4YFN F;  3BZK A;  1GVD A;  1LEB A;  4PFO A;  5D6E A;  1WWX A;  2RKH A;  5DUI A;  1XG1 A;  5K7H A;  3S2H J;  2WC2 A;  2E1C A;  2GOX B;  2HQN A;  2BZT A;  1A6I A;  3S1N J;  5E17 F;  1HW2 A;  2B63 J;  1AOY A;  2Y75 A;  1KU2 A;  3DU5 A;  4HLY A;  3FKI J;  1YJW I;  3R0J A;  2DT5 A;  1DDN A;  5E3M A;  1QVU A;  1LQ1 A;  2RRE A;  2KFD A;  4CCK A;  2IGO A;  4XKB A;  3ABL H;  3HRS A;  3RTR A;  3OYK A;  3PIO F;  5E1W A;  2K7L A;  3J7A O;  3G4S I;  1MW7 A;  5LGN A;  3CDH A;  2TRT A;  4O5V A;  4A0Z A;  4XSZ F;  2Y0S A;  1X1B A;  2QLZ A;  2HS5 A;  3F8M A;  2IA2 A;  4K2E A;  5DV5 A;  3FHN A;  5EEG A;  4B44 A;  4UUS B;  3IWZ A;  2PBI A;  2FOK A;  3WHC A;  1TQM A;  4I0A A;  5F0H A;  3H5R A;  2XC7 A;  3OIO A;  5LHI A;  2MFZ A;  1D0Z A;  4L18 B;  1LFB A;  2ZFU A;  2IBD A;  2VOD A;  4X6A J;  3DBH B;  2A6H F;  3L00 A;  2XAS A;  5IP9 J;  1R5I D;  2LMD A;  1J7K A;  2BHZ A;  3I71 A;  4G7Z F;  1QA6 A;  2VN2 A;  2VBW A;  3PSF A;  2ZFW A;  1MSE C;  2DMU A;  4II3 A;  3TP0 A;  3P9K A;  2M2E A;  1JT6 A;  2P81 A;  1A6Q A;  1UCR A;  4E6K G;  3G73 A;  3GFJ A;  4E7I A;  3F6O A;  3PO3 J;  1UHW A;  5FRN A;  1R1U A;  4G7O F;  2G9W A;  1FWZ A;  4G94 A;  2MD5 A;  4I76 A;  5J1U A;  3ECH A;  2ZB9 A;  2A3S A;  3I3L A;  1XCB A;  4DZJ A;  4CDG A;  4ZDP A;  2JPC A;  4AID A;  3I64 A;  1OQY A;  2NS0 A;  3SZP A;  4EJV A;  2HYF A;  4LIT A;  2LOO A;  3FX3 A;  2A5Y B;  2OBP A;  4N9I A;  4XKV A;  1T38 A;  3E1S A;  4BQA A;  1S72 I;  2PMZ A;  3H3U A;  3WGH A;  3I4M J;  1EKE A;  2DN0 A;  3TW6 A;  5C44 J;  5K5O A;  1MBK A;  4PZJ A;  4MEY F;  1FMW A;  1H9G A;  1Z3X A;  1ZTR A;  5F6F A;  3JRD A;  2E34 A;  3M1C A;  2PEX A;  3LSH A;  3K0L A;  1E3P A;  2CQN A;  3M9A A;  3Q5F A;  4B09 A;  4UVB A;  1G6N A;  2ZCW A;  3B6A A;  4I6Z A;  2I8D A;  2M30 A;  3MVP A;  5J6X A;  2QSF X;  3ZCO A;  1K79 A;  1IN5 A;  2L7M P;  3F3X A;  3KYC B;  3DEW A;  1S6L A;  1ZKG A;  2IGM A;  2A61 A;  5LEJ A;  1WZ2 A;  3G1O A;  3A01 B;  4RA2 A;  2JQ7 A;  2DK8 A;  3WHB A;  2HOA A;  2VKD A;  2XGC A;  1A31 A;  3AG3 H;  2NOJ B;  1JKO C;  4XKC A;  3QOE A;  4XID A;  2WA0 A;  2FML A;  2IXS A;  3F9K A;  3JSP A;  2YSR A;  4LMY A;  5DD8 A;  3HGG A;  2VC0 A;  4G6Q A;  4UV9 A;  2GA2 A;  2E1M B;  1MBH A;  3BRO A;  3T1B A;  3HZJ A;  5B5E C;  3DU6 A;  2QSG X;  4JK1 X;  4A5M A;  1V55 H;  2VT3 A;  4RAY A;  4R8H A;  1K7A A;  4M6V A;  3HPH A;  2X4H A;  1ZGA A;  5J8C A;  4BY1 J;  3SQN A;  2LVS A;  6PAX A;  1T56 A;  1YHQ I;  2KHM A;  4ENK A;  4DBR A;  2IA1 A;  2KJB A;  1F36 A;  3OOU A;  3D5S C;  2QCO A;  3RPU D;  3OL4 A;  4NDL A;  3QOP A;  1WQ2 A;  3BCB A;  3ZGK A;  2KRF A;  2HGC A;  4CXF A;  4BXF A;  1W7P A;  2HVS A;  3F8N A;  1JUP A;  3VYT B;  3H3Z A;  1MGT A;  2CO5 A;  5LGU A;  3MZY A;  5HLH A;  2M1B A;  3BTI A;  4M73 A;  3K70 C;  1R36 A;  1Q1V A;  2F5E A;  3TOA A;  4PSW A;  4KA4 A;  4XRM A;  5HVQ C;  1GDT A;  2OPT A;  4I99 C;  4OIN F;  1XSD A;  2BY2 A;  2N8G A;  5AIP A;  3K4M A;  2V79 A;  1U8R A;  2IS2 A;  4KN7 X;  1FPQ A;  2MLK A;  1B8I A;  3HUG A;  3R6S A;  2DFF A;  1Z91 A;  4BJT A;  4P9U A;  2XIG A;  1ZEL A;  2QQB A;  3RCO A;  2V9K A;  3BR5 A;  1HQC A;  3G1L A;  3I56 I;  4ESB A;  2CQ7 A;  3VFZ A;  3GTO J;  5HNH A;  4RLQ A;  3O3K A;  2X6X A;  2BVM A;  2DO7 A;  2BBY A;  1QZZ A;  1U6G A;  2BHY A;  4ETS A;  1OCO H;  2PJR A;  1XMK A;  1MH3 A;  1LKX A;  1FYM A;  5FRO A;  2JN6 A;  2PMH A;  5ERI A;  4UVC A;  3R60 A;  3V7S A;  2E7X A;  3DXJ F;  5FO5 A;  1ZLK A;  2VBX A;  1UG2 A;  3LSR A;  2ZSI B;  1E17 A;  2XRN A;  4XM3 A;  4BYY A;  2L7K A;  1YI2 I;  3GTK J;  3TKY A;  4LLG F;  2NVU B;  4BEH B;  2Z33 A;  4JOM A;  3E6C C;  4ZDL A;  5FLX Z;  4A3I J;  4CCO A;  2E1N A;  3Q0W A;  4HNU A;  3IHU A;  3QP5 A;  4UUS A;  3RQ4 A;  1ETO A;  2HQR A;  3CCU I;  1RRJ A;  2MD0 A;  2OQG A;  3TO7 A;  4A93 J;  4B1R A;  3KZI C;  2O5R A;  1GXQ A;  2ZNY A;  2XB0 X;  4C3J J;  1X2N A;  2CS3 A;  2B0L A;  5EG0 B;  2IP2 A;  2ZXJ A;  1RC9 A;  5E79 C;  1ZGJ A;  3GEZ A;  4XL9 A;  2ZJP F;  2DPU A;  2E1O A;  4L9V A;  2K02 A;  1EV7 A;  1J59 A;  4IHY A;  1T33 A;  2GIV A;  4OMZ A;  4WX9 A;  5E3N A;  2K9S A;  4U7B A;  2KIU A;  3S1R J;  4O6J A;  3B73 A;  2XF7 A;  3CJR B;  2P6S A;  2M0C A;  3M07 A;  4BKX A;  3BG7 A;  4M3B A;  1WGX A;  2J5O A;  2XF6 A;  3RYP A;  2DTR A;  3BG5 A;  1C0W A;  1DP7 P;  2PMZ N;  2KZV A;  1TWC J;  2DTZ A;  4JYK A;  3BQZ A;  3FXU A;  5JVT A;  2VXD A;  2EFW A;  1R00 A;  3HOY J;  2M34 A;  1V5F A;  3I54 A;  3CZ6 A;  1S29 A;  2R0Q C;  1ETX A;  2L4M A;  1NG6 A;  2W25 A;  5B1A H;  1B4A A;  3M7G A;  1RIO H;  3FM3 A;  1SMY F;  3OYH A;  3E6M A;  5EZH A;  5D8K B;  4ZYG A;  4Y17 A;  2JRM A;  3E5Q A;  1KON A;  4GYG A;  2PMU A;  3JCU C;  1LFU P;  3LOC A;  3WTX C;  3O2P E;  3OYN A;  1LE8 A;  2IS4 A;  1IRZ A;  1BIA A;  1U78 A;  1B9M A;  3H9G A;  4N4O B;  4LB6 B;  3OYM A;  3LAP A;  4A3L J;  1QPI A;  3FXR A;  2JZY A;  1OCC H;  1NTC A;  2H27 A;  2HZT A;  3UKG A;  2EFN A;  3VEP A;  5HDN A;  4R79 A;  4GFB A;  5JHF A;  1VQL I;  1R1T A;  2MH9 A;  2YU3 A;  3A2K A;  2P0W A;  3OR2 C;  3F8F A;  5D4S A;  3CUQ B;  4HNT A;  3S15 J;  2LK2 A;  1P92 A;  3ZQI A;  3NWS A;  4BQO A;  3ECO A;  3RQI A;  3L7W A;  3OV8 A;  1Y6I A;  2PLY A;  3VWB A;  4IHV A;  1P2F A;  4D9J A;  1T0F A;  2VI6 A;  3WTY C;  1DGW Y;  4RMN A;  4H0E A;  3IUO A;  1JKP C;  1MKM A;  3HSR A;  1IRX A;  3RKQ A;  4E7J A;  1VZ0 A;  4XOT A;  3OIP A;  2A69 F;  2EZL A;  1S5L C;  1SFE A;  4HEA 2;  1UMQ A;  1JT0 A;  3F72 A;  3W6V A;  2DFI A;  1Z67 A;  2RV8 A;  3Q9V A;  4BU2 A;  1CQT A;  2VC1 A;  4IZZ A;  4IEJ A;  3PQK A;  3DPL C;  3P5J A;  4LIU A;  2EA2 A;  4BDZ A;  2E5Z A;  5FD5 A;  4OOI A;  2COB A;  2Q0O A;  2LRD A;  4BQN A;  1VQ4 I;  3DPU A;  2ZME B;  2G0E A;  3RIR A;  4MTE A;  1FIP A;  3GME A;  5HOO A;  2EV6 A;  2EWN A;  1HA8 A;  3RI4 A;  2QKL B;  2WBM A;  2LF8 A;  4DJA A;  4EAT A;  1JE8 A;  1YX3 A;  4WF2 A;  2Z2S B;  1ETK A;  3V8K A;  4C2M J;  4NUB A;  1SD7 A;  2BYV E;  2DOF A;  4XLH A;  4X1E A;  2M8E A;  4A3D J;  2EZI A;  3X2Q H;  1Y56 A;  4UY8 I;  3QU6 A;  2P6T A;  2DOD A;  2OA4 A;  2G7H A;  2R5Y B;  1BC7 C;  3QPH A;  5LD2 C;  4E7L A;  3GFL A;  5F0F A;  3OYG A;  3KLO A;  3BR1 A;  3BJA A;  2J5P A;  4LG0 B;  2VKV A;  4HRI A;  4B43 A;  1YO5 C;  2LR8 A;  4FE7 A;  2A07 F;  3WTS C;  3QPL A;  1X4P A;  1KYZ A;  1ERD A;  2X85 A;  4EM2 A;  3ZOB A;  1ZGW A;  2FXA A;  2KJC A;  2LG4 A;  3JRF A;  3ZMV A;  2WAQ A;  2LKS A;  2YS9 A;  2FA5 A;  4CZC A;  1NH3 A;  4D5C A;  3TMO A;  1PJR A;  2HDD A;  4AD9 A;  1JTX A;  2R3S A;  3FK6 A;  4D7N A;  2K27 A;  4ZZL A;  5JFR A;  1G3T A;  3SDG A;  5K1Y A;  1UHS A;  3S3M A;  3KYL A;  2QEX I;  2Z5U A;  4ZH4 F;  1RUN A;  5GAH J;  1TBX A;  4CYC A;  4M9S A;  4PK4 A;  1SFO J;  2JK3 A;  4XMY A;  4LLN A;  1S7O A;  4IOA F;  1UJ8 A;  3HRU A;  4QTR A;  1ETW A;  3O8H A;  4NC8 A;  4JP0 A;  3H9J A;  4BEH A;  4AIH A;  1X2M A;  3PSI A;  3CTA A;  1KU9 A;  5HS8 A;  4UVA A;  2EB7 A;  1VQO I;  1ZR4 A;  5BQT A;  3C2G A;  3OOP A;  4D0P A;  3J7Z I;  2DDB A;  2E71 A;  4C9Y A;  1ZQ3 P;  4ASN A;  2Y0M A;  1KA8 A;  3ERM A;  3H5N A;  3L09 A;  2L01 A;  4I01 A;  3ZQF A;  2NRA C;  3CMY A;  1MSF C;  1TLH B;  1WVR A;  3BCA A;  1O7L A;  1OFC X;  1X4O A;  2LRE A;  2M45 A;  3WTZ A;  1REP C;  1JGG A;  2VE8 A;  2DPD A;  2VIX A;  3IRR A;  3WTV C;  3OS2 A;  3HGY A;  3FZV A;  2MC4 A;  1LEA A;  4NQW B;  5D4R A;  4DYC A;  4A5N A;  1F43 A;  2P5K A;  2KQR A;  2LKX A;  4HSR A;  2ELK A;  3OYF A;  3U9G A;  3LAJ A;  3BT9 A;  4ENN A;  4BL0 B;  4BHB A;  4HV6 A;  3L2Q A;  2OQR A;  2FBI A;  3WTT C;  1K78 B;  2E2H J;  4EJO A;  1ITY A;  1IN4 A;  3AAF A;  1QZY A;  3DKY A;  3ML6 A;  2EK5 A;  1XPX A;  3IH3 A;  5DYM A;  4OU0 A;  2O03 A;  2DT7 B;  2BXZ A;  4HQM A;  3CCS I;  2VT2 A;  1FBQ A;  3VPR A;  2P4W A;  4JX4 A;  3K4B A;  4XON A;  2DQR A;  1Y8R B;  1RPW A;  4ITV A;  1I39 A;  2R7Z J;  5IPA A;  2E36 A;  1IZ1 A;  4A6E A;  2EPF A;  2R4G A;  3LSK A;  1XDS A;  2H1K A;  3RZD J;  2MH2 A;  1RR8 C;  5HLI A;  3HDD A;  3CJQ B;  4YEJ A;  5CQE A;  3WG7 H;  3GX4 X;  4HF0 A;  5LEK A;  1BN5 A;  2DDA A;  3K4C A;  5D5U B;  4MFE A;  2E19 A;  3NQO A;  4XRS G;  2VOO A;  4RAG A;  1BW5 A;  3LSG A;  3CC4 I;  5DCF A;  2HFH A;  2P5L C;  2G7U A;  1KQ9 A;  2QGU A;  5CVI A;  2VXZ A;  2ELJ A;  2Q8K A;  2RGV A;  1AHD P;  4LFU A;  1FBU A;  3S32 A;  2FF4 A;  3UR3 C;  1YYV A;  3ESW B;  4AVZ A;  4BAC A;  4I0B A;  3BOQ A;  3CO6 C;  1XGN A;  5JVG F;  3GTP J;  3ZQ7 A;  4XOP A;  1FOY A;  2XAQ A;  1RET A;  3ABM H;  5DCM B;  4G9Y A;  3JRE A;  1HKQ A;  2XPU A;  5EGO A;  3M3Y J;  3BZC A;  4PJL A;  5D5W B;  1Z77 A;  5B1B H;  1R7J A;  4AVP A;  1K4S A;  2CSO A;  4V19 K;  2F5C A;  5IYC J;  3FXL A;  3ZPL A;  2ZSH B;  4OIR F;  1EH6 A;  2UXN A;  3FXM A;  4A6D A;  5C4J J;  1BIB A;  3E0J B;  4KJZ A;  3QP6 A;  1JHH A;  3OYA A;  1P6R A;  4FT8 A;  4DYR A;  1OIS A;  4RB1 A;  2DMN A;  4OIP F;  2COM A;  1OCP A;  2KT0 A;  1V4R A;  3DTI A;  4U0V A;  4EMS A;  3K69 A;  2D5V A;  4Y3O A;  3CCJ I;  2Y48 A;  5GAG J;  1W5T A;  2GAU A;  3FXO A;  1X1C A;  1LB2 A;  4LD5 A;  3K7A J;  3JW4 A;  5IT3 A;  4ZTJ A;  1JKQ C;  2WAQ N;  3QAH A;  2BEO A;  2X1C A;  3MD2 A;  2UV1 A;  3PFY A;  1SAX A;  5DM6 F;  3V8L A;  2QSH X;  3OYE A;  2L02 A;  3I59 B;  5FKM A;  2AXT C;  3PNV A;  1GLN A;  1SAN A;  1JHF A;  2B9S A;  1EA3 A;  1S9H A;  4A3E J;  1JUM A;  3QU3 A;  5EYR A;  2K3F A;  4FIS A;  3WGI A;  2OU2 A;  3MMY B;  2Q2E B;  2W48 A;  1XCV A;  2NAZ A;  3I58 A;  4GXO A;  1KQ8 A;  2ID6 A;  4XLE A;  5KAF C;  2Z9O A;  3WE3 A;  4HZF A;  5J40 A;  2LDU A;  2H8R A;  3LSP A;  2OUM A;  3L2C A;  2R5Z B;  1KQ0 A;  1PYV A;  1WKM A;  4DW6 A;  1RKW A;  3CJN A;  4QIW N;  1HOM A;  1ZRF A;  3DKW A;  5BMZ A;  1J09 A;  1GUU A;  5IYB J;  2BOL A;  1VQN I;  4RS8 A;  1HBX G;  1SVO A;  3HTU A;  4WXC A;  3LMM A;  4HPQ A;  4OIQ F;  4M3E A;  2HDC A;  3K4N A;  1V5G A;  1WJB A;  2FU4 A;  3S14 J;  1UAA A;  1KZH A;  3HOZ J;  3F23 A;  4LJZ F;  2DA4 A;  4N4N B;  2E2I J;  3CF2 A;  3K70 D;  2HYJ A;  2DBB A;  2DFE A;  4G6D A;  5IT9 Z;  3EET A;  2ELH A;  2O0Y A;  2K40 A;  3JAM Z;  1CF7 A;  2JSP A;  1U9N A;  5D5X B;  2QBY B;  2HZD A;  1IV8 A;  3GLX A;  3W6J B;  4M72 A;  4I98 B;  2CUJ A;  2CRG A;  2V26 A;  2EIN H;  2VBY A;  2CW7 A;  2FJ1 A;  5LLQ A;  4MEX F;  1XD7 A;  2ESH A;  2A68 F;  2CWE A;  1WJA A;  2M4G A;  2OC6 A;  4JX6 A;  1FZP B;  2R7W A;  4L9T A;  3WE2 A;  1H89 C;  1MBG A;  1VQ8 I;  5FKO A;  4XLN F;  4M3G A;  1I3A A;  1OCZ H;  3E6B A;  3H35 A;  4G6T B;  4XNF A;  2M4K A;  5JLX A;  2H6C A;  2CMP A;  3KZY A;  4ZYD A;  1V54 H;  4E4H A;  5FJ8 J;  1QNT A;  1VQK I;  3U21 A;  5M3M J;  4Q47 A;  2IS1 A;  1U9O A;  1VQ9 I;  5EF6 A;  5FRM A;  3TOB A;  1BI1 A;  2Z3Y A;  1TZL A;  4QWQ A;  3FXJ A;  4E7H A;  2WV1 A;  1V3F A;  3KLN A;  3L2V A;  1QHH D;  1HW5 A;  4W1U A;  1W5C C;  5DUK A;  4FET A;  3GCM A;  1A04 A;  4EGY A;  1TW2 A;  2VQL A;  2M7A A;  2Z99 A;  3BTJ A;  3TQN A;  1R5H A;  1PVE A;  4RB2 C;  1MJ9 A;  1B72 A;  3AKZ A;  5FLX K;  2L7Z A;  2CG4 A;  2KDO A;  3TO6 A;  1P4X A;  5HDK A;  3J81 Z;  1TTY A;  4F92 B;  4IRH A;  3M4O J;  1DU0 A;  3UNG C;  2HQA A;  4CUG A;  5E18 F;  3GTM J;  3ZQL A;  3PM1 A;  1R4M B;  4F52 A;  4HX8 A;  3FMQ A;  5JHU A;  2C6Y A;  2AQF A;  3ROU A;  1O57 A;  1O3Q A;  2WAF A;  1G59 A;  4FQG A;  5AON A;  2JMW A;  4HST A;  2NVT J;  4M9X A;  4U88 A;  3T5X A;  3MKY B;  1M1E B;  4EQQ A;  4U0Y A;  3K2A A;  3CCE I;  1YIT I;  5M5Y J;  4PJM A;  2OZU A;  4A3C J;  1OR7 A;  4HG2 A;  2XAH A;  2AHQ A;  1W0T A;  4WXD A;  4LGW A;  4BJ6 C;  2DT6 A;  2ISY A;  2DJN A;  2W7N A;  3E6D A;  4IKF A;  4UUT A;  2MAB A;  1FJL A;  1WH7 A;  4BH9 A;  5K7Z A;  1I50 J;  4QSH A;  4HDU A;  1FOX A;  2EZK A;  4CZZ A;  5LFA A;  3CCY A;  3O8G A;  1G3S A;  5LGT A;  2CU7 A;  4B3A A;  4Z6Y A;  3COA C;  1SD4 A;  3DV8 A;  3G3Z A;  3K1P A;  4XLC A;  3S1Q J;  5F08 A;  1QGP A;  3KIO A;  3H1C A;  5F27 A;  1Y8Q B;  4NBQ A;  2CW8 A;  2K4J A;  2D45 A;  1JUS A;  2R7V A;  5L3C A;  3FBN B;  4CH7 A;  2ZJQ F;  3T8R A;  1KU7 A;  1DP3 A;  3NAU A;  4MQV A;  3H36 A;  3DLL F;  1UST A;  4HNV A;  4IRG A;  1JKR C;  2XGD A;  3I9V 2;  5DEQ A;  2IS6 A;  2F5D A;  2NNN A;  3F8C A;  4EEF G;  1HLV A;  4IQ4 A;  5HS7 A;  5F1R A;  3CC7 I;  2KMU A;  4S0H B;  1D0X A;  1R6R A;  3LQQ A;  5KNL A;  5CVR A;  2AO9 A;  1IRF A;  3WU0 A;  1I1G A;  2IJL A;  4L5I A;  2EQR A;  3BZ6 A;  4II2 A;  3E3V A;  5C3E J;  1H9T A;  2V7F A;  4ZZD A;  3PIP F;  3VSL A;  4J00 A;  5JLW A;  4P9F A;  1B1B A;  4RLF A;  2VQH A;  4RGS A;  4BE2 A;  3DTE A;  2FBH A;  3QYE A;  5LRR A;  3K1N A;  2IAI A;  2Y0S N;  3FMS A;  1VF9 A;  2H94 A;  5DS9 A;  2FQ4 A;  3W2W A;  3I4P A;  5E8I A;  3OR1 C;  3ZQH A;  2VAS A;  2WY8 Q;  3HC7 A;  3K1M A;  5B3S H;  2Q2E A;  2Y9Z A;  2LY9 A;  2ZC2 A;  5CKT A;  3DEU A;  3LQR A;  3NRV A;  1E0E A;  2MSY A;  2L3D A;  1BI3 A;  1R4N B;  3VOD A;  3IRQ A;  1HDP A;  2GA1 A;  1APL C;  2DJI A;  1GVJ A;  2JT1 A;  2QQ8 A;  2LBF B;  5CPR B;  2HEO A;  1WJD A;  1LDD A;  3EUH A;  1YRN B;  4U7D A;  3CUO A;  2P8T A;  2KP6 A;  2ZXH A;  3HKZ A;  4QPO A;  1YW9 A;  3LSI A;  3KET A;  2RVC A;  3MN2 A;  1WJF A;  4F3Q A;  2BY1 A;  2L54 A;  4PCQ A;  3FKJ A;  4TV7 A;  1X19 A;  1FC3 A;  4GRI A;  1G4D A;  1IUY A;  1DU6 A;  1IXC A;  3W6K B;  2KLO A;  3AG2 H;  2EIL H;  4I09 A;  3I4N J;  4ANJ A;  3R0A A;  4HBL A;  4MLO A;  3H5A A;  2DMT A;  3CMA I;  4Y15 A;  3SZT A;  4ZDO A;  2XSJ C;  3V7R A;  2EBI A;  1WJC A;  4A3K J;  2QBY A;  1XMA A;  3GBG A;  4HF2 A;  1YW7 A;  3DCF A;  3C18 A;  1L3L A;  1NK2 P;  1VI0 A;  4UNO A;  4MNU A;  4PJ0 C;  4BBS J;  5GTI C;  4EM1 A;  4MO7 A;  3PNY A;  5A2Q Z;  4DGW B;  3ZMU A;  3BPX A;  3GF2 A;  2BXY A;  4JX5 A;  1USS A;  5D8L B;  3SEQ A;  2JTV A;  3OYI A;  1SFX A;  2PG4 A;  4P5O A;  2NVX J;  1MD0 A;  1FMV A;  4E7Z A;  1SVL A;  3CP8 A;  1F1Z A;  4ESF A;  2JRT A;  1IV6 A;  4M6X A;  2HQ5 A;  5LBQ A;  2LY1 A;  5D6F A;  1EJ9 A;  2JSC A;  2H09 A;  1VQP I;  5KK1 A;  1ON1 A;  2XKP A;  4IJA A;  1YJN I;  4HDV A;  2XB5 A;  2CUE A;  2K9N A;  4MGR A;  3R4K A;  2ZJ2 A;  2JUC A;  3GO5 A;  4LG3 A;  5GAE J;  3NWT A;  3HSE A;  3REO A;  3TDZ C;  4XQF A;  1SD6 A;  1A35 A;  2PN6 A;  2O6G E;  2DK5 A;  2GBY A;  4IQJ A;  2B7E A;  4Q48 A;  3H3V K;  1GV2 A;  4G12 A;  1AKH B;  1TNS A;  2M7B A;  3E7L A;  1L0O C;  1Z6R A;  2QA4 I;  1Y39 A;  4OAY A;  3CME I;  5JI6 A;  2E35 A;  2F48 A;  5GAD J;  3IAS 2;  5TIS C;  2JUG A;  3GUD A;  2LKP A;  4HOB A;  5HOD A;  1G3Y A;  4IHX A;  2VUM J;  3EQL F;  2IA0 A;  1FYL A;  3I0T A;  2H8W A;  2DI3 A;  2ME6 A;  2MG4 A;  1T0F C;  1FOW A;  1TT5 B;  1R58 A;  4P55 A;  3SFI A;  1G2H A;  2GLO A;  2XAF A;  3ERE D;  1FY7 A;  1U5T B;  4M3D A;  1XGS A;  1O3S A;  2CQK A;  1SD5 A;  4KIS A;  2DOA A;  2V6E A;  4CSW A;  4YIR X;  4ON0 A;  1BR2 A;  2MA3 A;  3HHG A;  3A01 A;  2ESN A;  2E2J J;  1RUO A;  2V1X A;  1ZRD A;  2CJJ A;  1FBS A;  2O9L A;  2X1E A;  4ZTF A;  4UUV A;  4W97 A;  3GLL A;  3OYB A;  1TWG J;  1MDM B;  1FEX A;  1ZK8 A;  2KIS A;  4D1Q A;  1JJ6 C;  1T2K A;  4DNC A;  5HLT A;  2DMQ A;  1Z9C A;  3BR2 A;  3ZRG A;  2F5F A;  2ETH A;  4L9N A;  3S2W A;  2R7O A;  3FBI B;  3FF5 A;  3RPU A;  2JVG A;  3JRC A;  1RI7 A;  2HWV A;  2X0L A;  4FX0 A;  4CYD A;  3J7Y J;  1B9N A;  4KYW A;  1WCM J;  1XN7 A;  1YS6 A;  1ZYR F;  1BBY A;  1ODD A;  1TQI A;  5J8F A;  1FSH A;  2DA6 A;  5H20 A;  3KP5 A;  2BVL A;  1MBE A;  3R61 A;  3ZMT A;  4OMY A;  3FMR A;  5HS9 A;  2VB6 A;  3M8J A;  3IV5 A;  3MKZ A;  3I55 I;  3OIQ A;  4J19 A;  1S7E A;  4YII A;  2X1D A;  3KEY A;  3CJT B;  3AFH A;  4LK1 F;  3JRG A;  2BW3 B;  4CIC A;  1X1A A;  1MMS A;  4BUP A;  1G8X A;  2FNP A;  2VPR A;  3EYY A;  3DEE A;  1NK3 P;  1BOA A;  1YE9 A;  5ICF A;  3HKZ N;  5KHD A;  1PUF B;  1LPQ A;  4F55 A;  1VQM I;  1WJE A;  1AU7 A;  4IVN A;  3OMY A;  5L3G A;  1G3W A;  2LY2 A;  3ASO H;  3CES A;  5IOZ A;  3ZR8 X;  4HQE A;  4UXN A;  2GQQ A;  2P5V A;  2DYR H;  2CQQ A;  4LIV A;  2VJ4 A;  3EUK L;  3QPS A;  4F7Z A;  3WTW C;  3PJR A;  1QO0 D;  2BY0 A;  1QZE A;  2GWR A;  1QVT A;  2H6B A;  5J3L A;  5DD4 A;  2CV0 A;  4I2O A;  1T95 A;  4Y7N J;  1IW7 F;  4IPA A;  5E3O A;  4G7H F;  3A0B C;  4ENJ A;  4KT6 A;  1XTA A;  3A03 A;  1R49 A;  1DUX C;  4GYI A;  4PJJ A;  2IVM A;  4BHP A;  2EH3 A;  2CFO A;  2HKX A;  2OF7 A;  2XAJ A;  1RR7 A;  3QRF F;  2M9H A;  1QRY A;  1FSE A;  1YX5 A;  2JVH A;  1HW1 A;  1IF1 A;  4BBR J;  4A69 C;  2R7X A;  4CGZ A;  5FLM J;  3IL2 A;  1V5E A;  2FE3 A;  2PX9 A;  5AIQ A;  2ZXI A;  2AXL A;  1BI0 A;  3TGN A;  2QVO A;  2OCC H;  5TJJ A;  2R7S A;  4HX4 A;  1D0Y A;  3BTL A;  3IKT A;  4QPQ A;  4GO1 A;  3VOE A;  2HPM A;  4BNC A;  2FSW A;  2JPB A;  1U3E M;  4UHT A;  5H2F C;  3KZZ A;  3WU2 C;  1PP8 F;  3C3W A;  1WRJ A;  3BP8 A;  2F6C A;  3DFG A;  3GW2 A;  3BC8 A;  3F0C A;  3IH4 A;  2A6T A;  4RAZ A;  1F9N A;  2M0M A;  2XAG A;  3I5U A;  5FFX A;  5EG0 A;  1Z7L A;  3CCR I;  3BG6 A;  5JR3 A;  4S04 A;  4XKW A;  2X6O A;  3HOT A;  5EEA A;  4M6Y A;  2YX7 A;  3CCL I;  5IY5 H;  3W2V A;  1UG0 A;  1GT0 C;  2XHK A;  3CLO A;  3KE2 A;  1MH4 A;  3KPH A;  4MIM A;  4ZYH A;  3SFZ A;  3BTC A;  4KUM A;  3K9T A;  1ZR2 A;  2STW A;  2PJP A;  1BOB A;  1P4W A;  2DA2 A;  1K61 A;  2IEK A;  3GXO A;  4KIC A;  2ISZ A;  2O3F A;  2TCT A;  4YFX F;  1D8K A;  5J1Y A;  3TL4 X;  5LRS A;  4RAF A;  3Q0U A;  1IJW C;  3GTG J;  1QBJ A;  1O7F A;  1X58 A;  5BPD A;  2R7T A;  3H0D A;  3KP3 A;  4BGD A;  1VND A;  2EIM H;  1K6Y A;  2XVC A;  1MNM C;  3S8P A;  2VQG A;  3CP2 A;  4IRI A;  5IT9 K;  3HSF A;  1ZRE A;  1FIA A;  3JAM K;  3ZP5 A;  3PQJ A;  3I53 A;  3L9F A;  1T08 B;  1UZC A;  3SDB A;  3K4K A;  2LFB A;  1T98 A;  2OJE D;  2R7D A;  5EDN A;  5EJC A;  2FQ3 A;  4DZP A;  3JRH A;  2CH0 A;  2A5W A;  2VJJ A;  3O6B B;  2YX4 A;  1ZAR A;  3LA7 A;  5J47 A;  3KFW X;  4NC6 A;  3ZQQ A;  3CUQ C;  3DBR B;  3TP3 A;  1VFC A;  3FK7 A;  4E7S A;  1TQP A;  1R1V A;  2VON A;  5J4Y A;  1FP2 A;  2EIK H;  4QLC U;  3LA3 A;  1Q1H A;  1N25 A;  4EVI A;  5DDG A;  2NNY A;  2STT A;  2KKO A;  4XN0 A;  1I6X A;  2RNJ A;  2K9Q A;  2DXI A;  3A1Y A;  3PO2 J;  1RNL A;  3GZ5 A;  3M1E A;  3CF5 F;  1WH5 A;  3CUQ A;  4WXH A;  4XIC A;  4PGG A;  1TP4 A;  4CCN A;  1OPC A;  4CCJ A;  3AL0 C;  1FLI A;  4DYQ A;  2HOS A;  1YQA A;  1UEL B;  1XGM A;  4C3I J;  1FOK A;  1U2W A;  2FMY A;  1AWC A;  2DAO A;  2WTE A;  1B6A A;  1JGS A;  2DA5 A;  3OS1 A;  1SC7 A;  2EZH A;  3ZN1 A;  1XGO A; 
#chains in the Genus database with same CATH homology
 2RDP A;  3J81 K;  3V7C A;  2OD5 A;  2W84 A;  1KYW A;  1LVA A;  2ZBK A;  4HA8 A;  1Z1D A;  3RKY A;  1UB9 A;  2DW4 A;  2QUF A;  3RKW A;  1SFU A;  1Z05 A;  2ZME A;  3KEO A;  4RB3 C;  2GZW A;  4HYE A;  4JBA A;  3WGG A;  3FXQ A;  1W7P B;  2E7W A;  3HOS A;  4KFC A;  3HTS B;  2DU9 A;  2D2W A;  2VE9 A;  2HR3 A;  4LG0 A;  3DQV C;  1W7P D;  4KN4 X;  1FX7 A;  3E5U A;  4XRF A;  3KCC A;  1ZLJ A;  5K5R A;  2FRH A;  4HAM A;  4MQ9 F;  4P96 A;  4AWX B;  1ZH5 A;  5ICG A;  3T8T A;  3J80 Z;  2RQP A;  3MCZ A;  2XUB A;  5D5V B;  4MHG A;  4WK8 F;  1YW8 A;  5CVV A;  2KIM A;  4EV0 A;  1O3R A;  2DLL A;  5H6Q A;  3F22 A;  1R22 A;  3DF8 A;  1MZB A;  3GYH X;  1GXP A;  1I5Z A;  3BPV A;  5FD6 A;  4L0Y B;  1P4A A;  3MWM A;  1ZG5 A;  4A0Y A;  3V4G A;  1OYY A;  3HYI A;  3VB2 A;  4OIO F;  1IXS B;  1UFM A;  1YTY A;  4CO8 A;  5K5Q A;  2W57 A;  4GCV A;  4HW0 A;  1HKT A;  3DPT A;  4DQ2 A;  2P7C B;  3FWE A;  2FEZ A;  4NQW A;  4EJW A;  5L3E A;  5FFZ A;  4L5J A;  5CJ9 A;  2V9V A;  2A6E F;  2LNB A;  4I7H A;  3GZ6 A;  5LHH A;  1K78 A;  1W4M A;  1TW3 A;  3F8B A;  1I27 A;  3GFM A;  4RGX A;  1YIO A;  3RPQ A;  1J75 A;  1F5T A;  3MFK A;  5HLG A;  1GHC A;  3ISP A;  2QWW A;  3GFI A;  1R23 A;  5A2Q K;  1JXS A;  3WG9 A;  2K4B A;  3HIF A;  1TNT A;  1LDJ A;  4A0X A;  4ESJ A;  1S3J A;  1OYW A;  2QM3 A;  1O3T A;  2HTJ A;  4NB5 A;  3ULQ B;  1WSU A;  1EH7 A;  4KNY A;  2EFO A;  2IPQ X;  3CO7 C;  2FBK A;  2XGX A;  4M9Z A;  5DCM A;  3JTG A;  5ED4 A;  1OKR A;  5EEH A;  2WWY A;  1RZ4 A;  4XLP F;  1R5G A;  2ZNZ A;  5L3D A;  1FT9 A;  2MLG A;  3HHH A;  3JTH A;  4KIG A;  1BJA A;  3P7N A;  5ICC A;  4RB0 A;  2UWM A;  4U0W A;  3QPT A;  2ADU A;  2P7V B;  2QQ9 A;  4KDP A;  5H6R A;  3SXY A;  1PDN C;  3LWF A;  4HLX A;  4ENM A;  3IC7 A;  2F2E A;  4M71 A;  3I59 A;  2EA4 A;  2WV0 A;  3KP2 A;  4GGG A;  4G8X A;  2EV0 A;  3D0S A;  1MJB A;  3TDU C;  1LJ9 A;  1HSJ A;  3KP4 A;  4YIF A;  3E97 A;  2CW0 F;  1KU3 A;  3C1D A;  3BJ6 A;  4WCG A;  1ZG1 A;  4Q4Z F;  2VOP A;  2QYO A;  3B02 A;  1ZG3 A;  3U2R A;  2EV5 A;  4IXA A;  2HTS A;  3RDI A;  3RYR A;  2EFP A;  4KT5 C;  3RKX A;  2PFB A;  5F64 A;  5CVJ A;  4KIF A;  4ZYE A;  2FNA A;  3F21 A;  3HRM A;  3WTU C;  4IHT A;  5CYV A;  5E1X A;  2R7F A;  2IT0 A;  1YLF A;  2NYX A;  2W24 A;  1FYK A;  1D3Y A;  1S8N A;  4A2U A;  3IKV A;  5KVR A;  4IF4 A;  3D5L A;  4N9H A;  1E2X A;  3ZMZ A;  1HST A;  3M8E A;  2XKO A;  1SMT A;  1H0M A;  2RN7 A;  2TDX A;  2V1D A;  2XV4 S;  3ELK A;  2OAZ A;  2HKO A;  4FHT A;  1HKS A;  4EJU A;  4MTD A;  4KMU X;  1QQI A;  1Y0U A;  5HDG A;  1HXD A;  4KIB A;  1X3U A;  2LSO A;  4LLL A;  3WU1 B;  1FNN A;  4BAY A;  1ULY A;  5FGM A;  1BI2 A;  3F6V A;  1DPU A;  1IRG A;  1T6S A;  1YS7 A;  3DP7 A;  4R1H A;  1XSX A;  4YFK F;  5E8G A;  4M74 A;  1EH8 A;  3ZMS A;  1T39 A;  1IN7 A;  2EFQ A;  2CFX A;  1LDK B;  1IN6 A;  3FM5 A;  3T0Y A;  4WWC A;  3WOD F;  3EDP A;  1Z6T A;  3ZMD A;  3EYI A;  5BS6 A;  1PP7 U;  4RGR A;  1YFH A;  2QEN A;  5E20 A;  2DQL A;  4Q5S F;  1ZAO A;  2ZO4 A;  3C7J A;  1ONV A;  1BC8 C;  3BDD A;  4AIK A;  4EJT A;  3ZN0 A;  3BWG A;  1F4K A;  4EM0 B;  3PFI A;  2D1V A;  2OZ6 A;  4CHU A;  2MBF A;  3JSO A;  1D8J A;  3IWF A;  3U1D A;  4YG2 F;  4PDK A;  3P9C A;  2ZKZ A;  1VTN C;  1FP1 D;  4AIJ A;  4XBF A;  5BPI A;  1ZN2 A;  4E70 A;  3N97 A;  3MZH A;  3SHF A;  2VBZ A;  3MEX A;  2XRO A;  5BOX A;  1BM9 A;  2HOE A;  1OMI A;  3KP6 A;  5TRD A;  2YR2 A;  2BV6 A;  2EJR A;  2CGP A;  1NHA A;  1CF7 B;  4IHS A;  2BGC A;  4KMF A;  1XSV A;  2UZK A;  1ZRC A;  4S05 A;  4I02 A;  1WI9 A;  1D5V A;  1LNW A;  4HV5 A;  2LF7 A;  3NEU A;  5ILU A;  2BE5 F;  3J80 K;  1ON2 A;  3GVA A;  4HX7 A;  1ZHF A;  2PQ8 A;  5CLS A;  5CVU A;  3BJO A;  5E1Z B;  1J2X A;  4B8X A;  4A12 A;  2YPR A;  1K6O A;  2CYY A;  4NHJ A;  1I1S A;  4O3M A;  2RC4 A;  3GWZ A;  1W5S A;  3Q9S A;  1J0R A;  1S7A A;  1Z7U A;  4UV8 A;  2HYG D;  3LA2 A;  2O61 A;  4N0B A;  5FB2 A;  1U5T C;  1PUE E;  2K86 A;  4LK0 F;  2QZ8 A;  1IN8 A;  3BY6 A;  2AS5 F;  4L0Z B;  2GXB A;  1IXR C;  1UHM A;  1STZ A;  1U5T A;  4LB5 A;  3M8F A;  3MQ0 A;  3P9I A;  3KEQ A;  3HRT A;  4XSX F;  2M87 A;  2PI0 A;  3LST A;  4Z2Y A;  4FX4 A;  2GXG A;  1DPR A;  3RJP A;  2D1H A;  3N4M A;  1MDM A;  3K2Z A;  1KGS A;  2O8X A;  3TO9 A;  4BXU A;  3FHZ A;  1YG2 A;  5ILS A;  4RGU A;  1J9I A;  3LFK A;  3V8J A;  2KIF A;  1IAW A;  5ILV A;  2W85 A;  3ABU A;  2V6C A;  5LHG A;  2IW5 A;  1XB4 A;  1OYI A;  3H92 A;  1QPM A;  5ICE A;  2UXX A;  1XDU A;  2QQA A;  3KP7 A;  3ABT A;  3E5X A;  3MAJ A;  2ACJ A;  4BHC A;  4L9J A;  2M5W A;  4HF1 A;  1CGP A;  2V1U A;  4PGH A;  5L3F A;  1J5Y A;  1B59 A;  5L3B A;  2IRF G;  2MC3 A;  4Y13 A;  4JQF A;  1MJA A;  4EGZ A;  2L4A A;  4YFN F;  1LEB A;  5D6E A;  1WWX A;  2RKH A;  5DUI A;  2WC2 A;  2E1C A;  2HQN A;  5E17 F;  1HW2 A;  1AOY A;  2Y75 A;  1KU2 A;  4HLY A;  3R0J A;  2DT5 A;  1DDN A;  1LQ1 A;  3HRS A;  3RTR A;  5E1W A;  2K7L A;  3J7A O;  5LGN A;  3CDH A;  4O5V A;  4A0Z A;  4XSZ F;  2QLZ A;  2HS5 A;  3F8M A;  2IA2 A;  4K2E A;  5DV5 A;  5EEG A;  3IWZ A;  2PBI A;  2FOK A;  1TQM A;  4I0A A;  5LHI A;  4L18 B;  2VOD A;  2A6H F;  3L00 A;  2XAS A;  1J7K A;  3I71 A;  4G7Z F;  2VN2 A;  2VBW A;  2ZFW A;  3P9K A;  1UCR A;  3G73 A;  3GFJ A;  3F6O A;  1UHW A;  1R1U A;  4G7O F;  2G9W A;  1FWZ A;  4G94 A;  2MD5 A;  3ECH A;  2A3S A;  1XCB A;  4CDG A;  2JPC A;  3I64 A;  2NS0 A;  3SZP A;  4EJV A;  2HYF A;  3FX3 A;  2A5Y B;  2OBP A;  4N9I A;  4BQA A;  1T38 A;  3H3U A;  3WGH A;  5K5O A;  4PZJ A;  4MEY F;  1H9G A;  5F6F A;  2PEX A;  3K0L A;  3M9A A;  3Q5F A;  4B09 A;  4UVB A;  1G6N A;  2ZCW A;  2M30 A;  5J6X A;  1K79 A;  1IN5 A;  3F3X A;  1S6L A;  2A61 A;  5LEJ A;  2DK8 A;  2FML A;  3JSP A;  2YSR A;  4LMY A;  5DD8 A;  2VC0 A;  4G6Q A;  4UV9 A;  2GA2 A;  3BRO A;  3T1B A;  4JK1 X;  4A5M A;  2VT3 A;  4RAY A;  4R8H A;  1K7A A;  2X4H A;  1ZGA A;  5J8C A;  3SQN A;  6PAX A;  4ENK A;  2IA1 A;  2KJB A;  3QOP A;  1WQ2 A;  2KRF A;  2HGC A;  4CXF A;  1W7P A;  3F8N A;  3H3Z A;  1MGT A;  2CO5 A;  5LGU A;  3MZY A;  5HLH A;  2M1B A;  4M73 A;  1R36 A;  2F5E A;  3TOA A;  4KA4 A;  5HVQ C;  1XSD A;  4OIN F;  5AIP A;  1U8R A;  2V79 A;  4KN7 X;  1FPQ A;  2MLK A;  3HUG A;  3R6S A;  1Z91 A;  4P9U A;  2XIG A;  2QQB A;  1HQC A;  4ESB A;  3VFZ A;  3O3K A;  2DO7 A;  2BBY A;  1QZZ A;  1U6G A;  4ETS A;  1XMK A;  1FYM A;  2PMH A;  5ERI A;  4UVC A;  3R60 A;  3V7S A;  2E7X A;  3DXJ F;  5FO5 A;  1ZLK A;  2VBX A;  1E17 A;  2XRN A;  4BYY A;  3TKY A;  4LLG F;  2Z33 A;  3E6C C;  5FLX Z;  2E1N A;  3IHU A;  3QP5 A;  2HQR A;  2OQG A;  3TO7 A;  1GXQ A;  2ZNY A;  2B0L A;  2IP2 A;  2ZXJ A;  1ZGJ A;  3GEZ A;  2DPU A;  4L9V A;  2K02 A;  1EV7 A;  1J59 A;  4OMZ A;  2GIV A;  4WX9 A;  4U7B A;  2KIU A;  4O6J A;  3B73 A;  2P6S A;  2J5O A;  3RYP A;  2DTR A;  1DP7 P;  1C0W A;  3FXU A;  5JVT A;  2EFW A;  1R00 A;  3I54 A;  1S29 A;  2L4M A;  1RIO H;  2W25 A;  1B4A A;  3M7G A;  3FM3 A;  1SMY F;  3E6M A;  5D8K B;  4ZYG A;  4Y17 A;  3E5Q A;  4GYG A;  2PMU A;  3WTX C;  3O2P E;  1BIA A;  1U78 A;  1B9M A;  4LB6 B;  3LAP A;  3FXR A;  2JZY A;  2H27 A;  2HZT A;  2EFN A;  3VEP A;  5HDN A;  4R79 A;  1R1T A;  2MH9 A;  2YU3 A;  3F8F A;  5D4S A;  3CUQ B;  1P92 A;  3ECO A;  3L7W A;  3OV8 A;  2PLY A;  1P2F A;  1T0F A;  3WTY C;  4H0E A;  1MKM A;  3HSR A;  2A69 F;  1SFE A;  3F72 A;  2DFI A;  2RV8 A;  3Q9V A;  2VC1 A;  3PQK A;  3DPL C;  2EA2 A;  5FD5 A;  4OOI A;  2Q0O A;  2ZME B;  3RIR A;  4MTE A;  5HOO A;  2EV6 A;  2EWN A;  3RI4 A;  2LF8 A;  1JE8 A;  4WF2 A;  3V8K A;  1SD7 A;  2BYV E;  2M8E A;  3QU6 A;  2P6T A;  2OA4 A;  2G7H A;  1BC7 C;  3QPH A;  3GFL A;  3KLO A;  3BJA A;  2J5P A;  4LG0 B;  1YO5 C;  2A07 F;  3WTS C;  1KYZ A;  4EM2 A;  2FXA A;  2KJC A;  3ZMV A;  2FA5 A;  4AD9 A;  2R3S A;  4ZZL A;  2K27 A;  5JFR A;  1G3T A;  5K1Y A;  2Z5U A;  4ZH4 F;  1RUN A;  1TBX A;  4M9S A;  4LLN A;  1S7O A;  3HRU A;  4AIH A;  3CTA A;  1KU9 A;  5HS8 A;  4UVA A;  2EB7 A;  5BQT A;  3OOP A;  4D0P A;  4ASN A;  2Y0M A;  1KA8 A;  3L09 A;  2L01 A;  4I01 A;  2NRA C;  1TLH B;  1O7L A;  2M45 A;  3WTZ A;  1REP C;  2VE8 A;  2DPD A;  3IRR A;  3WTV C;  3FZV A;  1LEA A;  5D4R A;  4A5N A;  2P5K A;  3LAJ A;  4ENN A;  3U9G A;  4BHB A;  4HV6 A;  2OQR A;  2FBI A;  3WTT C;  1K78 B;  4EJO A;  1IN4 A;  3AAF A;  1QZY A;  3ML6 A;  2EK5 A;  5DYM A;  4OU0 A;  2O03 A;  4HQM A;  2VT2 A;  1FBQ A;  2P4W A;  2DQR A;  1IZ1 A;  4A6E A;  1XDS A;  2MH2 A;  5HLI A;  3GX4 X;  4HF0 A;  5LEK A;  1BN5 A;  5D5U B;  3NQO A;  2VOO A;  5DCF A;  2HFH A;  2P5L C;  2G7U A;  1KQ9 A;  5CVI A;  2VXZ A;  2Q8K A;  2RGV A;  4LFU A;  1FBU A;  2FF4 A;  1YYV A;  4I0B A;  3BOQ A;  3CO6 C;  1XGN A;  3ZQ7 A;  2XAQ A;  5DCM B;  4G9Y A;  1HKQ A;  5D5W B;  1R7J A;  4AVP A;  2CSO A;  2F5C A;  3ZPL A;  4OIR F;  1EH6 A;  2UXN A;  4A6D A;  1BIB A;  3QP6 A;  1JHH A;  1P6R A;  4FT8 A;  4RB1 A;  4OIP F;  2COM A;  4EMS A;  1V4R A;  4U0V A;  3K69 A;  2Y48 A;  1W5T A;  2GAU A;  1LB2 A;  4LD5 A;  3JW4 A;  5IT3 A;  3QAH A;  2BEO A;  1SAX A;  3V8L A;  2L02 A;  3I59 B;  1JHF A;  3QU3 A;  3WGI A;  2OU2 A;  1XCV A;  2NAZ A;  3I58 A;  4GXO A;  1KQ8 A;  2Z9O A;  3WE3 A;  4HZF A;  2LDU A;  3L2C A;  1KQ0 A;  1WKM A;  3CJN A;  1ZRF A;  3DKW A;  5BMZ A;  4RS8 A;  1HBX G;  3HTU A;  4WXC A;  4OIQ F;  2HDC A;  2FU4 A;  3F23 A;  4LJZ F;  2DBB A;  4G6D A;  5IT9 Z;  3EET A;  2ELH A;  2O0Y A;  3JAM Z;  1CF7 A;  5D5X B;  2QBY B;  3GLX A;  3W6J B;  4M72 A;  4I98 B;  2VBY A;  5LLQ A;  4MEX F;  2ESH A;  1XD7 A;  2A68 F;  2CWE A;  1FZP B;  4L9T A;  3WE2 A;  4XLN F;  3E6B A;  2H6C A;  3KZY A;  4ZYD A;  1QNT A;  4Q47 A;  3TOB A;  1BI1 A;  2Z3Y A;  4QWQ A;  3KLN A;  1V3F A;  1HW5 A;  5DUK A;  1A04 A;  4EGY A;  1TW2 A;  2Z99 A;  3TQN A;  1R5H A;  4RB2 C;  1MJ9 A;  5FLX K;  5HDK A;  2CG4 A;  3TO6 A;  3J81 Z;  1P4X A;  1TTY A;  4IRH A;  5E18 F;  4HX8 A;  3FMQ A;  5JHU A;  2C6Y A;  3ROU A;  1O57 A;  1O3Q A;  5AON A;  4M9X A;  4U88 A;  3T5X A;  4EQQ A;  4U0Y A;  2OZU A;  1OR7 A;  2XAH A;  4WXD A;  4LGW A;  2ISY A;  3E6D A;  4BH9 A;  4HDU A;  4CZZ A;  1G3S A;  5LGT A;  3COA C;  1SD4 A;  3DV8 A;  3G3Z A;  3K1P A;  1QGP A;  2K4J A;  2D45 A;  5L3C A;  3T8R A;  1KU7 A;  4MQV A;  1UST A;  4IRG A;  5DEQ A;  2F5D A;  2NNN A;  3F8C A;  5HS7 A;  5F1R A;  3LQQ A;  5CVR A;  1IRF A;  3WU0 A;  1I1G A;  2IJL A;  4L5I A;  3BZ6 A;  3E3V A;  1H9T A;  4ZZD A;  4P9F A;  1B1B A;  4RGS A;  2FBH A;  5LRR A;  3K1N A;  3FMS A;  2H94 A;  5E8I A;  3I4P A;  3K1M A;  2Q2E A;  3DEU A;  3LQR A;  3NRV A;  2L3D A;  1BI3 A;  3VOD A;  3IRQ A;  2GA1 A;  2JT1 A;  1GVJ A;  2HEO A;  3EUH A;  1LDD A;  4U7D A;  3CUO A;  2P8T A;  1YW9 A;  3KET A;  2RVC A;  2L54 A;  4PCQ A;  4TV7 A;  1IUY A;  1FC3 A;  1G4D A;  1IXC A;  3W6K B;  4I09 A;  3R0A A;  4HBL A;  4Y15 A;  3SZT A;  3V7R A;  2QBY A;  1XMA A;  4HF2 A;  1YW7 A;  1L3L A;  3C18 A;  4UNO A;  4MNU A;  4EM1 A;  5A2Q Z;  3ZMU A;  3BPX A;  3GF2 A;  1USS A;  5D8L B;  2JTV A;  1SFX A;  2PG4 A;  4P5O A;  1MD0 A;  1F1Z A;  4ESF A;  2JRT A;  4M6X A;  5LBQ A;  5D6F A;  2JSC A;  2H09 A;  5KK1 A;  1ON1 A;  2XKP A;  4IJA A;  4HDV A;  4MGR A;  3R4K A;  2ZJ2 A;  3GO5 A;  3HSE A;  3REO A;  3TDZ C;  1SD6 A;  2PN6 A;  2O6G E;  2DK5 A;  4Q48 A;  1TNS A;  1L0O C;  1Z6R A;  5JI6 A;  3GUD A;  2LKP A;  4HOB A;  1G3Y A;  3EQL F;  2IA0 A;  1FYL A;  3I0T A;  2DI3 A;  1R58 A;  4P55 A;  2XAF A;  3ERE D;  1FY7 A;  1U5T B;  1XGS A;  1O3S A;  2CQK A;  1SD5 A;  4ON0 A;  2MA3 A;  3HHG A;  2ESN A;  1RUO A;  2V1X A;  1ZRD A;  1FBS A;  4UUV A;  1MDM B;  1T2K A;  4DNC A;  1Z9C A;  2F5F A;  2ETH A;  4L9N A;  3S2W A;  3FF5 A;  3RPU A;  1RI7 A;  2HWV A;  2X0L A;  4FX0 A;  4CYD A;  1B9N A;  4KYW A;  1XN7 A;  1YS6 A;  1ZYR F;  1BBY A;  1ODD A;  1TQI A;  5J8F A;  1FSH A;  5H20 A;  3KP5 A;  3R61 A;  3ZMT A;  4OMY A;  3FMR A;  5HS9 A;  4YII A;  4LK1 F;  4CIC A;  2FNP A;  3EYY A;  1BOA A;  5ICF A;  4IVN A;  5L3G A;  1G3W A;  4HQE A;  4UXN A;  2GQQ A;  2P5V A;  3WTW C;  4F7Z A;  1QO0 D;  2H6B A;  2GWR A;  4I2O A;  5DD4 A;  1IW7 F;  4IPA A;  4G7H F;  4ENJ A;  1DUX C;  4GYI A;  4BHP A;  2IVM A;  2HKX A;  2XAJ A;  3QRF F;  1FSE A;  1HW1 A;  1IF1 A;  4CGZ A;  3IL2 A;  2FE3 A;  5AIQ A;  2AXL A;  1BI0 A;  3TGN A;  2QVO A;  5TJJ A;  4HX4 A;  3IKT A;  4BNC A;  4GO1 A;  3VOE A;  2FSW A;  2JPB A;  1U3E M;  4UHT A;  3KZZ A;  1PP8 F;  3C3W A;  1WRJ A;  3BP8 A;  3DFG A;  3GW2 A;  4RAZ A;  1F9N A;  2XAG A;  3I5U A;  5FFX A;  5JR3 A;  4S04 A;  3HOT A;  4M6Y A;  2YX7 A;  2XHK A;  3CLO A;  3KE2 A;  4ZYH A;  3SFZ A;  4KUM A;  3K9T A;  2STW A;  2PJP A;  1P4W A;  3GXO A;  4KIC A;  2ISZ A;  2O3F A;  4YFX F;  1D8K A;  5LRS A;  1QBJ A;  1O7F A;  5BPD A;  3KP3 A;  2XVC A;  4IRI A;  5IT9 K;  3HSF A;  1ZRE A;  3ZP5 A;  3JAM K;  3PQJ A;  3I53 A;  3L9F A;  1T98 A;  2R7D A;  2FQ3 A;  3O6B B;  2YX4 A;  1ZAR A;  3LA7 A;  3KFW X;  3CUQ C;  1TQP A;  1R1V A;  2VON A;  1FP2 A;  4QLC U;  3LA3 A;  1Q1H A;  4EVI A;  5DDG A;  2NNY A;  2STT A;  2KKO A;  1I6X A;  2RNJ A;  1RNL A;  3GZ5 A;  3M1E A;  3CUQ A;  4WXH A;  4PGG A;  1FLI A;  1OPC A;  1YQA A;  1XGM A;  1FOK A;  1U2W A;  2FMY A;  1AWC A;  2DAO A;  2WTE A;  1B6A A;  1JGS A;  3ZN1 A;  1XGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...