2IA0A

Transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
156
Chain Sequence
HLDDLDRNILRLLKKDARLTISELSEQLKKPESTIHFRIKKLQERGVIERYTIILGEQLKPKHLALIVLEVGKPEDFLERYISYISSTLSALPGVLFVAKSGEDKIIALVGKNNKDELVKFIEENITSIPNLKHIQIFPITEIKKGEDLTGFLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Transcriptional Regulatory Protein PF0864: an Asnc Family member from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords Putative HTH-type transcriptional regulator PF0864
total genus 34
structure length 156
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia0A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ia0A02
4IVNA 3WTXC 5AIPA 4HZFA 4WXCA 2W24A 2V1XA 2A6HF 3ZMVA 4GCVA 4PDKA 2QLZA 2LKPA 4HX7A 2XASA 5HDGA 3ZPLA 1XGMA 2RV8A 3E6BA 1IW7F 4BAYA 5D5UB 4I09A 3FHZA 1G3WA 1EH8A 4HLYA 1HSTA 2IA1A 5FFZA 1MGTA 3W6JB 2HEOA 5DYMA 3RPUA 4CO8A 1DPUA 2KRFA 3LA2A 5F64A 3WTWC 4UVAA 3Q5FA 3TKYA 1TQMA 4H0EA 1T38A 2ACJA 4FX4A 5DEQA 3E6CC 4YIFA 3HRUA 2W85A 1KU3A 4KYWA 4WXDA 2H27A 3DXJF 1USSA 3IKTA 1SFUA 1MJBA 2OD5A 2GAUA 1VTNC 3J81K 3IL2A 1BIAA 5E17F 3KZZA 1S7OA 2JT1A 4N9IA 1FNNA 1ZYRF 3ULQB 3FX3A 4UVCA 3M8EA 3RKXA 3ERED 4KIBA 4WX9A 2EA4A 1TQPA 4M6YA 3I54A 5J8CA 1Z6TA 3ZP5A 1PP8F 2EV0A 3MWMA 2RQPA 3JW4A 5ICEA 5LRRA 3E3VA 3O3KA 3HUGA 3GWZA 3EQLF 3GFJA 3JAMK 2EFPA 2D1HA 3F8BA 1BIBA 1FSHA 1EH7A 2EWNA 2FF4A 1D8JA 4RS8A 3R4KA 1E2XA 3U1DA 5L3EA 4BYYA 2RKHA 4EM0B 1P4XA 4A12A 3KETA 1RNLA 3C3WA 3GEZA 1FYKA 4WWCA 1SMYF 2ZBKA 1NHAA 4U0VA 2COMA 1YW8A 4I0AA 2Z4PA 4HLXA 4LK0F 3GUDA 4YFKF 5LGTA 4R8HA 4MEXF 3HSEA 3J80Z 3JAMZ 2EFQA 3E5UA 1T6SA 3QPTA 3CUQB 3E97A 4LLLA 3LSTA 3HSRA 2JTVA 2KJCA 4KA4A 1J5YA 4HF1A 2GA2A 4O5VA 3SFZA 4CHUA 3FXQA 1LEBA 2DK8A 4NQWA 4BXUA 2YSRA 4OMZA 3HYIA 2JZYA 2F2EA 1YTYA 2K7LA 2ZKZA 5LBQA 2DW4A 2BGCA 5K5RA 1BI2A 3NQOA 5LEKA 2L02A 1I1SA 5JVTA 1D3YA 2HR3A 2PJPA 3KP5A 3I5UA 2XAHA 4I0BA 2XRNA 5HDNA 2HQNA 3C18A 3KZYA 2H6CA 2NRAC 2UWMA 1S7AA 2QYOA 2XV4S 4MGRA 4A0ZA 3ECOA 4HX4A 2E1NA 4KIFA 2ZFWA 2KKOA 5LGNA 1ZREA 2RNJA 1WQ2A 1XMKA 3H3ZA 5K5OA 5FGMA 3VFZA 5CVUA 3GW2A 1R36A 2HTSA 5BMZA 2K86A 2H94A 3MZYA 3E6DA 3BJ6A 1O57A 4FHTA 2HZTA 1O3QA 5DUKA 2UZKA 3REOA 1BI0A 1FY7A 1HW5A 2IVMA 1UHWA 4L0YB 1FP2A 5A2QZ 2IA2A 1S3JA 3O6BB 5JHUA 1FBSA 2Y0MA 2P4WA 2VT3A 5L3CA 3FMQA 1ONVA 2O8XA 1MD0A 3WTVC 1U5TA 3TOBA 3HSFA 2ZO4A 2Z33A 2BE5F 2HKXA 1QNTA 1YS6A 1ZLJA 2DTRA 3R0AA 2MC3A 4ZYEA 4AIHA 4MTDA 1OR7A 3E5XA 5E8IA 1K78A 4L5JA 3L00A 1W4MA 1L3LA 2QWWA 2W57A 3IWFA 2STWA 5HLIA 2PLYA 4HF0A 1FYLA 4G94A 1DDNA 3WU1B 4ZZDA 1KU2A 1UCRA 2A3SA 4RGUA 3I0TA 5H6QA 1LEAA 1R58A 3DQVC 4G6QA 2VBWA 2K27A 3IC7A 3BOQA 2XKPA 2D1VA 3F6OA 4HX8A 2F5FA 2ZCWA 1T98A 1XGSA 4MQ9F 4UXNA 1MZBA 3NRVA 5LHGA 1R22A 4G7ZF 5BQTA 2XUBA 1QQIA 2P6SA 4P9UA 2PN6A 3GZ5A 4JQFA 4GO1A 1ZGJA 1U6GA 1YYVA 5HOOA 3MFKA 2FA5A 3ELKA 1AOYA 1USTA 2Z3YA 5FLXZ 1TW3A 2M30A 4HDVA 5CVRA 3U2RA 3I58A 3HIFA 2HOEA 4A0XA 5EEGA 4ZZLA 1FBQA 4ENMA 1Y0UA 4I98B 2K4JA 2FBHA 3M9AA 5ICGA 1STZA 1WWXA 4M9SA 4IJAA 3C7JA 1YS7A 3BP8A 1ZLKA 3N97A 2ZBCA 2V1UA 2GXBA 4Z2YA 1IZ1A 1JXSA 4WF2A 2DAOA 3IRQA 2OU2A 3QPHA 1J75A 1FSEA 5HS9A 1MKMA 2GWRA 3TO9A 5D5WB 3WGIA 2IA0A 4B8XA 1A04A 5LHHA 4EMSA 1R5HA 3AAFA 5K5QA 5HVQC 3T1BA 4YFXF 1FT9A 1LDKB 1V3FA 1ZG1A 3F8FA 1SMTA 1KQ8A 1LDJA 3LA7A 4XLPF 3ML6A 1YFHA 1GXPA 4EGYA 2OAZA 2ZNZA 1G3YA 2G7HA 3V8LA 3C1DA 1TTYA 1BJAA 4BHCA 1XB4A 2F5EA 4AIKA 1YW7A 4CZZA 2OQGA 2ZMEB 1LQ1A 1T0FA 1L0OC 4AIJA 1HXDA 3ZMZA 1RZ4A 2RC4A 2WC2A 2PMUA 4S04A 3DV8A 3GFLA 3DFGA 3ISPA 1F4KA 4Q48A 3L2CA 2XIGA 1D5VA 1LJ9A 2E1CA 4XSXF 1Q1HA 4FX0A 3ABUA 3TGNA 1UFMA 4L9TA 2L4AA 3F8MA 4R1HA 5FFXA 3CO6C 4PGGA 4IRGA 1LNWA 2FE3A 2AXLA 3G73A 3BPXA 1XMAA 1J2XA 1O3SA 1PDNC 5DDGA 1IXSB 1HQCA 1J0RA 5D8LB 3L09A 2L01A 2Z5UA 3SZPA 3LQRA 1J59A 1O7LA 1F9NA 1IRFA 3BROA 3IWZA 2CW0F 3FM5A 4MNUA 2YR2A 5D6FA 1G3TA 3COAC 1EH6A 1ZAOA 4XRFA 1V4RA 5CVIA 3EDPA 1HW1A 1WI9A 1DP7P 3WG9A 3GFIA 3EYYA 4LG0B 3QRFF 1XDSA 3WE3A 2Z99A 2O61A 1MJ9A 5DD8A 3V7RA 1ZH5A 1H9TA 3F22A 2VOOA 2PG4A 3DPLC 1SD7A 5JI6A 2E1AA 1SAXA 4OIPF 3D0SA 2P7VB 4GYIA 4ZYHA 2E7WA 3DEUA 4P96A 5LEJA 3RPQA 1C0WA 1IN6A 2CQKA 4S05A 1KQ9A 1FPQA 1XN7A 2DK5A 1KGSA 4L9JA 3BPVA 5IT3A 4MEYF 3MQ0A 5F6FA 2P7CB 4P5OA 3W6KB 3QAHA 1IN4A 4OIOF 2VOPA 1R1UA 5DV5A 4RB1A 3IHUA 3ROUA 3RYRA 1YG2A 2ESNA 1KYWA 1XCBA 2L3DA 4CICA 1EV7A 3OV8A 1QO0D 3HTUA 5D8KB 2AS5F 5IT9Z 2VXZA 3F6VA 2A69F 3I59A 5CVJA 5FLXK 3WGHA 4HV5A 4MQVA 4YFNF 1QPMA 3EUHA 4IF4A 4M9XA 2FRHA 2RDPA 3GXOA 1XCVA 2QM3A 1B59A 5ILVA 2ESHA 4EV0A 1Z6RA 2PFBA 1R23A 2MLGA 3B73A 4KMUX 4RGSA 3VODA 2PMHA 2QQAA 2V6CA 2EB7A 3CTAA 2XAFA 1CF7B 4U0YA 5HLHA 3P7NA 3KP6A 3H92A 1CF7A 1R1VA 4U0WA 3FWEA 2Z9OA 1ZG5A 2P5LC 4QLCU 2LF7A 3CUQA 3L9FA 5DCMA 2FNPA 1HKSA 5L3FA 1U5TB 3K0LA 3ABTA 3R61A 2M8EA 3T5XA 3JSPA 3CLOA 5L3GA 1HSJA 4N0BA 4KMFA 1FWZA 4G8XA 2JSXA 5F1RA 5KK1A 2F5CA 2D2WA 4RAYA 4U88A 2G9WA 3PQKA 2V9VA 3TO7A 5BPIA 2FSWA 4RAZA 3FMRA 3K1NA 1P4WA 2EJRA 2WWYA 5D5VB 3IKVA 2CSOA 1KU9A 2O03A 3DF8A 1LVAA 2H6BA 4YG2F 1B4AA 3BZ6A 3GF2A 1TNTA 4M73A 4MTEA 2E7XA 2STTA 1YO5C 2CGPA 3RJPA 2FMLA 5D6EA 5JR3A 2VE8A 1O3RA 4XBFA 2FQ3A 1ZRFA 2M1BA 1O7FA 3BDDA 4L9NA 1FX7A 4BNCA 3S2WA 1XDUA 3V8JA 2R7DA 4RB2C 2LF8A 1T39A 3F8NA 4KUMA 4LD5A 4AD9A 3GVAA 2VN2A 3M7GA 3BWGA 2OA4A 2FEZA 3TO6A 2YPRA 2J5PA 2O3FA 1PP7U 2IJLA 1K6OA 1Z05A 3DP7A 1G6NA 1XSXA 4AVPA 4P55A 4K2EA 1JHFA 1H9GA 3GLXA 2BYVE 3ZMUA 3T0YA 4DNCA 5FD6A 1Z91A 5KVRA 2V1DA 3RKYA 3EYIA 2A5YB 4XSZF 2FBIA 1YIOA 4FT8A 4O3MA 4O6JA 3RYPA 4KNYA 1FZPB 3WODF 3J80K 1OYWA 1MJAA 3KEQA 4IHSA 4Q4ZF 2JPBA 3HOSA 2PEXA 4RB3C 4YIIA 3LQQA 5HLGA 3I71A 3LAPA 1MDMA 2H09A 1Z1DA 2G7UA 1IXCA 3K69A 1R1TA 1ODDA 1J9IA 3KLOA 1ULYA 1W5SA 2XVCA 3J81Z 1GXQA 2FNAA 5DUIA 3HRTA 3R0JA 1IXRC 1IAWA 2A07F 2HKOA 2IT0A 2W84A 2QQBA 2EFOA 5EEHA 5ERIA 5D4RA 2HGCA 2DLLA 1UHMA 2XAQA 3JTGA 1QBJA 4L0ZB 1FBUA 3V8KA 1HW2A 4HV6A 2ZMEA 2QBYA 1W7PA 4D0PA 1U5TC 4EJTA 3GYHX 5E1ZB 1FC3A 5CLSA 5K1YA 4IRHA 1Z7UA 3B02A 3GFMA 4ZH4F 2DPUA 2XKOA 2UXNA 4HF2A 5LRSA 2EA2A 2GQQA 1K79A 3HOTA 1REPC 3R6SA 5JFRA 2VT2A 1SFEA 2QZ8A 3SQNA 5D4SA 5E18F 2CO5A 4EJUA 1W5TA 1F1ZA 3M1EA 1U78A 3FMSA 2O6GE 2R7FA 3LFKA 2IP2A 5E20A 4G7OF 2DT5A 1TNSA 2PQ8A 1IN5A 4UHTA 1K78B 2QENA 3JSOA 1I27A 2VODA 4L5IA 2LSOA 1DUXC 2L4MA 2MH9A 2JPCA 1HKQA 3QP5A 4ENJA 4TV7A 4ON0A 2OZ6A 3M8FA 3PQJA 4G9YA 1SD5A 2KJBA 4EM2A 2ELHA 1RUNA 3WE2A 5HS7A 2ISYA 5DCMB 2OBPA 4NB5A 1W7PB 4XLNF 4ASNA 4Y17A 2XAGA 1P2FA 1OMIA 2XAJA 4E70A 2HYFA 4ESJA 2WTEA 3R60A 5LHIA 1YLFA 5FO5A 4RGXA 3HRSA 3VOEA 3D5LA 1R00A 4M74A 4UVBA 5FD5A 3WGGA 2P5VA 2EFWA 4BH9A 1B6AA 3ZN0A 1XGOA 1QZYA 4DQ2A 1ZN2A 2A61A 1JHHA 5DD4A 2NNNA 3K1PA 5E1XA 1BI1A 4EM1A 3K9TA 2J5OA 3U9GA 4EGZA 5HDKA 6PAXA 4I7HA 4I01A 2L54A 2YX7A 1TLHB 2DBBA 3MAJA 3CJNA 1U8RA 2Y48A 2ZNYA 2F5DA 3LA3A 1BM9A 3BY6A 1PUEE 3TDUC 3MEXA 3CDHA 2GA1A 1WSUA 1IF1A 3ZMDA 4A0YA 4R79A 2M5WA 1RI7A 2IRFG 3TOAA 4LJZF 1CGPA 2Q0OA 1ZARA 1XSDA 4BHBA 5LLQA 5D5XB 4N9HA 3KP3A 5FB2A 3RIRA 1LB2A 2GXGA 4A5NA 2M45A 1P4AA 3KEOA 2R3SA 2Y75A 5ICFA 4HOBA 3RI4A 2GZWA 4UV9A 2ZJ2A 5ILSA 1JGSA 2EFNA 4ETSA 2XROA 5L3BA 1HKTA 5J6XA 3V7SA 3OOPA 1RIOH 3DKWA 1OYYA 2YX4A 4JK1X 3WTSC 4A6DA 1OYIA 1QZZA 4LB5A 1BBYA 1TW2A 5HS8A 5TRDA 3QOPA 3F21A 2W25A 4OU0A 2DJWA 4PZJA 1WRJA 2Q2EA 4LLNA 1BI3A 1KA8A 2X0LA 4WK8F 3WTTC 3BJAA 4I2OA 1QGPA 3QU6A 1ZGAA 4LLGF 3KLNA 2P8TA 4G6DA 2DU9A 2A68F 3RDIA 1S8NA 4LFUA 4KFCA 3FZVA 4LB6B 1KQ0A 4L9VA 1OKRA 3LAJA 3FM3A 2PI0A 4OINF 5DCFA 2VBZA 4I02A 1I5ZA 1UB9A 2OZUA 4WCGA 1IRGA 3WTUC 2HWVA 2VBXA 4CXFA 3T8TA 4LMYA 2CG4A 3FXUA 3FXRA 3KE2A 3ZMTA 4Q5SF 4HYEA 2UXXA 4UV8A 4HQEA 4OIRF 5ED4A 3HTSB 3BJOA 3QU3A 3NEUA 3P9IA 1SFXA 2YU3A 3ZN1A 2BEOA 3P9KA 4CGZA 4KT5C 1HBXG 2KIFA 2O0YA 2DQLA 2IW5A 3EETA 2KIMA 2DPDA 2EV6A 1GVJA 4HDUA 3KP2A 1G4DA 5BPDA 1BN5A 3GX4X 2EK5A 3I53A 2K4BA 5E8GA 2D45A 3V4GA 2QUFA 1SD6A 1IUYA 5AONA 3CO7C 5H20A 2HYGD 2VONA 3FF5A 1LDDA 2Q8KA 4LK1F 2MA3A 4M71A 4HAMA 4PGHA 1J7KA 3HHGA 1P92A 3KP4A 3CUOA 2CFXA 1YW9A 1KU7A 1B9NA 2FBKA 1FLIA 3E5QA 3F72A 4KDPA 2DI3A 1ON1A 3G3ZA 4AWXB 2RVCA 3ECHA 2NAZA 2HQRA 5BS6A 1R5GA 1IN8A 2ADUA 2B0LA 2CVIA 1FYMA 4F7ZA 1ZRCA 4UUVA 2FOKA 3WU0A 1GHCA 3DPTA 3O2PE 1MDMB 3SZTA 2A6EF 3TQNA 1ZRDA 2NYXA 5LGUA 4HQMA 4KN7X 4CYDA 4IHTA 3L7WA 4ESFA 3MCZA 4EJWA 5IT9K 2VC1A 2MLKA 1ZG3A 2P6TA 4ENNA 4EJVA 1YQAA 4GGGA 1XGNA 4OMYA 1F5TA 2XGXA 5ICCA 4OIQF 2CWEA 4MHGA 1OPCA 5L3DA 1B1BA 2MH2A 3KCCA 4NHJA 4Y13A 2ISZA 4EQQA 3Q9VA 1P6RA 3F8CA 4A5MA 3IRRA 1G3SA 4M72A 2DO7A 4GYGA 1E17A 4LGWA 4G7HF 1H0MA 2HDCA 2DFIA 4HA8A 3GO5A 4L18B 2TDXA 2RN7A 4IRIA 3WTZA 1B9MA 2LDUA 2QVOA 1WKMA 4PCQA 5H6RA 2FU4A 1T2KA 2VBYA 4HBLA 2FXAA 4LG0A 4OOIA 4M9ZA 1BC7C 2X4HA 3SXYA 3JTHA 1JE8A 3ZMSA 1FOKA 1FP1D 4RGRA 1XD7A 3HHHA 3RTRA 3K2ZA 3TDZC 2OQRA 4BQAA 4GXOA 2ZXJA 1XSVA 1K7AA 1R7JA 3RKWA 5J8FA 4P9FA 4KICA 3MZHA 1I1GA 1U2WA 4WXHA 3I59B 3I64A 4ZYDA 2HTJA 4KIGA 5CJ9A 1I6XA 5CVVA 1DPRA 5ILUA 1BC8C 3ZQ7A 4Q47A 2LNBA 2NNYA 4QWQA 1BOAA 4U7DA 2M87A 3P9CA 1RUOA 2MBFA 2HS5A 4Y15A 2K02A 3J7AO 4M6XA 2JSCA 3I4PA 2EV5A 3VB2A 2DQRA 4EJOA 3GZ6A 2BV6A 5BOXA 2VC0A 4UNOA 4ENKA 3SHFA 3HRMA 3F23A 1X3UA 5CYVA 2QQ9A 4RB0A 3KFWX 2MD5A 3F3XA 2HFHA 4HW0A 3T8RA 2ETHA 2P5KA 3QP6A 2KIUA 2VE9A 2C6YA 2BBYA 3VEPA 1ZHFA 4IPAA 2QBYB 4KN4X 1SD4A 1Z9CA 2RGVA 1ON2A 1U3EM 2CYYA 4ESBA 4IXAA 2V79A 2JRTA 4BHPA 4CDGA 1IN7A 1AWCA 3H3UA 3LWFA 4B09A 4JBAA 3PFIA 2FMYA 1D8KA 4EVIA 5A2QK 5TJJA 3Q9SA 2NS0A 3V7CA 5E1WA 1S29A 1TQIA 3CUQC 3E6MA 2XHKA 3WTYC 2GIVA 3KP7A 4ZYGA 1O3TA 3N4MA 1KYZA 1W7PD 2IPQX 4A2UA 2WV0A 5AIQA 2PBIA 4A6EA 3K1MA 1TBXA 4U7BA 1S6LA
chains in the Genus database with same CATH superfamily
5HMWA 3O6QA 2AJFE 4U95A 2DA3A 5AIPA 4V2FA 1RT2B 3SCLE 1GV5A 1RT2A 4FPIA 1FDNA 2UXDF 2DMTA 4NASA 4GCVA 4RW4B 4PDKA 1U48A 2AKWB 4Y4RA 2QLZA 4XNFA 5HI7A 4DGWB 1U02A 4IQXA 2RDJA 3ZPLA 2J9DA 1GMWD 3BBCA 2YTCA 3OT9A 3FMWA 5LJ5Y 1RLDA 1UMJA 3EDQB 1HQUA 3GJSB 1PAUB 1WJ5A 5CYQA 3FHZA 3H7HB 4J00A 3NAUA 2DA5A 3TJ8A 5KFAA 1PIEA 3QYYA 2IFXA 2LVWA 3MFIA 2IA1A 4G1QB 3DKXA 1S1XB 2R7RA 2Y1IA 2E1MC 2BRLA 5J2NB 1EKRA 4WZQA 3TAPA 2XF6A 3DLAA 1RWUA 3Q5FA 1F36A 4WE1A 2DEIA 5EX0A 2LH9A 1P8GA 2Y2ZA 3E6CC 3W3CA 1WC6A 1WHUA 4LIVA 2W85A 1KU3A 2H27A 4ED1A 1SFUA 2ZH7A 4KJIA 1R8BA 2MQ8A 4DV2F 1VTNC 3CC4I 3IL2A 1VRQC 4NXMJ 3KLVA 3CIMA 4RO0A 3L7UA 1ZETA 4DV3F 1FJLA 2QSHX 2G0IA 3I96A 4ITSA 3W7BA 4ED6A 1MH4A 3KEYA 1V5VA 2CPXA 3GTLJ 4FISA 3BKUA 2VJVA 1ZYRF 2HFVA 4A3BJ 4KH1B 3IRXB 2OJED 2GOXB 5D4LA 1WHWA 2W9AA 4DL0C 3HHLB 1EJ7L 3JRGA 5EG0B 4ZCMA 3IMQJ 3BZCA 2EA4A 2WB1N 2K7JA 1VR6A 4M6YA 1HQEB 1KFDA 1RP5A 1LFUP 3JW4A 3S01A 2ZFUA 3GWZA 4HDGA 4E7HA 3SYZA 3HDDA 5FRMA 2EFPA 1HW8A 2MQLA 5ETSA 3F8BA 2VA3A 3PVXA 1BIBA 5DQHA 2FF4A 2LFVA 4ATNA 5C25B 3A8JA 3TAQA 7FD1A 1FMVA 2CDQA 3MECB 2R7OA 4BYYA 1BA5A 2CPDA 3SFIA 1DU6A 2QJ3A 4LBHA 1HBUA 2HVEA 1UL3A 3K8WA 2DNQA 4M5NA 1SC6A 6AT1B 3IXQA 3R7SB 2EZIA 5C2GA 3A03A 2DJIA 2JC0A 3HPOA 4DUZF 2Y1RI 3B78A 3CCLI 4ZDOA 3MPVA 4ECVA 3ABKH 3QLHB 2YUSA 4DI6A 4U0VA 2COMA 2KXHA 2LEPA 3O3LA 3THPA 3QQCD 3P49B 3TZWA 2PFDA 1O4XA 4PQUA 2B9XA 3HL2A 3GUDA 3O44A 3V6KA 3PY8A 4JI7J 2X1CA 2B7CB 1YRXA 1FTTA 3K4BA 4BQQA 2V67A 3E5UA 1AA1B 4D1QA 4KH0B 2E34A 3HSRA 3P5BP 3KJQB 2FC9A 2Z2LA 1A5JA 2J8SA 5D6GA 1WSRA 1RWOB 3ILIA 4XL9A 4O5VA 2X9DA 1XMQF 1X1BA 1T9TA 2XHCA 1SC3B 2CZVC 4CHUA 1NNDA 2OPQA 2H54B 2BANA 3G4SI 4NQWA 4BXUA 1R9TJ 4K4XA 2I5UA 3HG9A 3I0RA 3HYIA 3AL0C 2GMHA 2JZYA 4KGXB 2F2EA 2HNHA 1Y3JA 2DR9A 4FS1A 2BKPA 4KJZA 1SV5B 2G1DA 4LF6F 2HNDB 2MKSA 1OY9A 4XRMA 4J7CA 2K7LA 2ZKZA 2BGCA 2DW4A 1T8IA 4XK8C 2XZDB 3NQOA 4FF3A 4MFBA 2LP4A 5LEKA 2KH9A 4L73A 3TX0A 4ZC3A 5T7LA 1VI0A 4WTOB 1HFEL 2ID6A 4OJHA 3MURP 5F9LA 4HSRA 1AROP 1VOMA 3AFGA 2H6CA 2UXBF 2UWMA 2IYGA 1XN9A 1S7AA 1IGNA 1CLFA 4AL7A 3QZ7A 2E1NA 1L5UA 1VQ7S 4ZPCA 2Q3PA 3IO1A 1DLOB 2BJ8A 5ADZA 1ZREA 5LD2C 2RNJA 3AOAA 3FSIA 4CO3A 3H3ZA 2AGPA 1SQGA 3KTQA 4NXNJ 2ZXWH 5FGMA 1DAXA 4F55A 4DYRA 3SJMA 2B5JA 1NHVA 1GEHA 3M8YA 3KUGA 2BEFA 3VHQA 5CVUA 4O4RA 2K86A 2CQ1A 4FF2A 1MN7A 2H94A 2CQHA 3IR5B 4I4BA 3BJ6A 3TMOA 2GBYA 4DPXA 3IR7B 1S49A 3I5AA 4EGLA 1BI0A 3VSLA 1UHWA 4LRCA 2OV7A 1FP2A 1K1SA 4JOMA 1IG7A 2IA2A 1B7FA 4N76A 3UN2A 1EZZB 2L08A 1H74A 1WEXA 2Y0MA 2H5JB 4U7UK 2VFRA 2WOMB 1FWKA 2R5ZA 1OY6A 3W62A 4ECUA 1YX2A 4NLDA 4ILLA 2LC2A 3ZQLA 2VUGA 3OYNA 4Y2AA 4QPQA 5H2FC 3G71S 1LWCA 4JI2J 2ZO4A 2MB0B 2CPIA 4QTRA 2N4CA 3DLJA 4Q45A 2HKXA 1QNTA 2ZBRA 1YS6A 3CXCR 3D9BA 3BV8A 5BNGA 1XNRJ 4MTDA 2HVIA 3MCNA 2HHSA 1Q8KA 1ULRA 3E5XA 2CQ7A 4JI6J 1XK8A 3D4JA 4R8UA 2QWWA 4M5DB 1Y9OA 2PLYA 4G94A 3KMSA 4RW8B 2NS1B 2PMWA 3M32B 3QJJA 4HH1A 2A3SA 1RUSA 2XYPB 4OLPA 5HMZA 1S59A 1PJ5A 3T1YJ 2O9LA 2HBQB 4G6QA 2HG4A 2WBMA 1YX5A 3KHGA 3D5RC 4IO1A 3X3UA 2XKPA 2GV1A 3JTNA 3BT9A 3AH6A 2ZCWA 1FD8A 3JTOA 3S8SA 4OX7A 1ACMB 2VJJA 1XGSA 1XQIA 4IO9F 4UXNA 2W9CB 1MZBA 2R5YB 2E5IA 3NRVA 1R22A 4G7ZF 4A3JJ 2XUBA 1R49A 2VL8A 3CCQI 3QFWA 4J9QA 2G13A 5EWFA 5KG6A 2PN6A 3GZ5A 3VAFA 4UOCA 2JC1A 2K3PA 2CQ0A 2GQCA 1HBMA 3HVAA 1KNZA 1I6HJ 2DPJA 4KITB 4N41A 1RA7A 2NXUA 4RBTA 3MFKA 2XSFA 5F8NA 3WZ0A 1LQ9A 1AOYA 3CEDA 3HSGA 2Z3YA 4WTYA 5HP1A 1G2EA 3Q2TC 2QKLB 4JI1J 1O8BA 3NY0A 3ZZTA 2BUNA 5EEGA 2VPRA 1OO0B 1VQ9I 5IT4A 4HG2A 3A13A 1OS5A 2CJAA 1C1BB 2XO6A 4I98B 3N4WA 4OFZA 5GAHU 3CIZA 3LAKA 4QW9A 3M9AA 1S0VA 2QL9B 4M63A 3EMTA 4JI8J 1MNEA 2DCLA 4LFAF 3C7JA 1YS7A 3N97A 2X1DA 2V8VA 3K4KA 1LW0B 2K85A 5M5YJ 4RKUC 1UEVA 3I5CA 3RRHA 3RB3A 1Q5VA 3HM5A 3GIKA 2DAOA 3HVTB 4DR7J 1X4DA 2EIMH 1QE1A 5HS9A 3BSOA 2XMKA 4EMSA 1R5HA 2O67A 1V3SA 2G1HA 2OD6A 3R2CJ 1LDKB 1O6XA 2FLOA 4FYYB 1IQZA 1N88A 1ZG1A 4J91A 1TFWA 1LDJA 2GQ2A 3G9CA 1HNWF 1YVFA 3MWBA 2O8KA 5KFNA 2VG7B 2ZNZA 1NHUA 4P2XA 3QRRA 5FROA 5GAGU 2LD5A 5F8GA 2O3DA 4PUOB 2F5EA 4ELTA 1URRA 4YDDB 2B4OA 2RQMA 3JSYA 2OQGA 1EAYC 2DHAA 1DQ8A 3HOVJ 4AIJA 1HXDA 1CJVA 3CMAI 4HT5A 4DS5A 3ZMZA 1X58A 2DO4A 1N0VC 1F5BA 1RT3A 4S04A 3CMQA 4YN3B 1S1UB 5KFZA 2R0QC 2ZDPA 3DFGA 3ET6B 5EHHA 2EZHA 2LKSA 1F4KA 3WC2A 3HHLA 4GO7X 4GVLA 3AD8C 2I1RA 2AU0A 4LSNA 2K1RB 2PFFB 3CDLA 3J81U 4LQ9A 1FRLA 4MYTA 2D74B 3HC7A 2CZ9A 2BR0A 2XF7A 1S57A 1KDNA 3IR6B 1UVLA 2UXDJ 3FXLA 1XR7A 1H98A 2CPEA 3ZQFA 4PGGA 4IRGA 1XMAA 1J2XA 5IOYA 3E7LA 2DY9A 5GMKa 4YIRX 4DR4F 1IXSB 2PMZD 5DG8A 2Z5UA 1HNZF 3OXLA 1IO2A 2XGQA 2K2PA 1IRFA 2IAIA 2I6WA 3RAQA 1CG2A 1EQMA 4LFCF 2Q79A 1UKUA 4DL4A 2CW0F 4MNUA 4PG8A 1EKSA 1GV2A 3OD2A 4W98A 3V6DA 5D6FA 1GMWA 1PC4A 3COAC 1HNIA 4XN3A 2V9WA 1RR8C 3JAMY 3CD6I 2OFHX 1V4RA 5CVIA 3RW6A 3EDPA 4QWAA 2J76E 1D0YA 1H2VZ 3WG9A 3K7RA 2HQIA 2L41A 1X4BA 3GILA 1SVMA 3PHEA 4DW6A 2B8PA 3OL3A 3DYAB 1XDSA 4PPZA 2O61A 1PO6A 5DD8A 3PR4A 2VQEF 5J1UA 2OELA 3HI9A 5E3PA 3P8BB 2W8LA 4Z2XA 2M7BA 1FDAA 2Q43A 3O8WA 2KM8C 3DPLC 2KDOA 2ZVIA 1YJ7A 2M9KA 2ROGA 2ZXHA 3UCGA 4OIPF 4FXVA 2P7VB 3BF4A 4ZYHA 2E7WA 3TAMB 3DEUA 1JJ8C 3RPQA 3JQMA 4OI1A 2CQXA 1LKZA 3ZRGA 3DOMA 2UXBJ 3EJMA 2B7BB 2DMQA 1KGSA 3Q8SB 4IH7A 3IS9A 1VQ5S 4L9JA 2E5GA 5FD1A 3OYFA 2ECBA 3C16A 2H5EA 3VF0B 4OQJA 1RYRA 3D67A 2BYCA 3T1HF 1FE0A 4Q0BB 3MM6A 1J27A 1RKJA 4BWJA 5GAGI 1YG2A 2CQGA 4MJKA 2OPTA 3R7NB 3QJPA 1KYWA 1T9VA 1XCBA 2EVZA 1TL7B 1WF1A 2Q66A 2H1KA 4D7NA 5IT9Z 2A69F 2QG9B 2EZLA 3BQZA 3EUAA 3TANA 2R93J 1XMQJ 3ITHA 3JSBA 4L5EA 3EUHA 4OYBA 4UUXA 4IF4A 3ZZPA 1NZAA 3GXOA 2TRTA 3TUIC 1B59A 2ESHA 2Y31A 2V6EA 3DCAA 2QGUA 4L3KA 2PMZA 2BJDA 2QLBB 3HHEA 2GX8A 4NI2B 1R3NA 4J90A 4USVA 3S1NJ 5CYMA 4D3HA 2ASJA 2KP6A 5AE2A 3H5XA 1R0CB 2YKMA 2IM1A 1WHVA 3OSFA 1WG1A 2DFFA 2EKYA 4HDHA 4Y2CA 1SJFA 3UI3A 4A3IJ 5C42A 3CO9A 1VQOI 2OPQB 1R8AA 1C4CA 4ID5B 2POKA 2VJ4A 1CF7A 1R1VA 1JLAB 4U0WA 3FWEA 2Z9OA 1H2UX 2HOSA 1VMBA 2MPUA 2XI2A 2BJ3A 2BX6A 2XB5A 1PYVA 2KRCA 1ZG5A 4HHUA 2P5LC 2LA4A 4KT0C 4QLCU 2LF7A 3L9FA 3K5NA 5L3FA 2LKXA 2BJ9A 2KIQA 4UY8I 3PZPA 3ABTA 4HTJA 3R61A 2MYSA 3D0IE 5L3GA 2ID3A 1YHQI 2NREA 2OH2A 4KMFA 4G8XA 2WOMA 3C8YA 3NGSA 3BTIA 5GMEA 3PSIA 4U88A 2IMWP 2V9VA 4FASD 1WGXA 2HLUA 4JP8A 3AT1B 1RISA 1I51B 3MVPA 3AJDA 1KU9A 5TISC 2HRTA 2GFFA 1VQ4S 4HEA9 1QAXA 3DF8A 1LVAA 5CH7B 2WV1A 2KZVA 4OZ3A 1XTAA 4C11B 3UWTA 4H4OB 1CJTB 4V19X 2NR0A 2EKNA 2R9LA 2E7XA 2STTA 4DR7F 1OCPA 3KG4A 2BOLA 2AX1A 3OYGA 1SVLA 2E35A 1NKCA 1K8AT 4XBFA 2FQ3A 2CQ4A 3DRXA 4TNOA 4X64F 3BDDA 3HZEA 3HDSA 4L9NA 3N28A 1SH3A 4MKAA 2R7DA 1K61A 2LCWA 4AT1B 2DXEA 3GCXP 1IBLJ 5HP1B 1J5EF 1LEOA 4ED8A 5L38A 4AD9A 2VN2A 4JI1F 3TO6A 5KFSA 5KFBA 4XKBA 2J5PA 2JRMA 4UUWA 1LVKA 2V2QA 2NZCA 1LWEB 3NGRA 1M90T 4V19J 1W2BR 1WACA 1WC4A 2DMUA 3I0SB 4DL5A 4Q8EA 2IRXA 4AVPA 3X2QH 5KFMA 2AYMA 4K2EA 2CJKA 1S7IA 4PK4A 2BYVE 3ZMUA 4L72B 2HXIA 4DNCA 3VAKA 5KVRA 4ZPAA 4FNIA 3RKYA 1TZ0A 2W1BA 3QT8A 4XSZF 2R8IA 2I38A 4FT8A 4O3MA 4KNYA 3CC4S 3WODF 4GKKF 5G0RB 5J1YA 1ZZNA 2LQ8A 5FKOA 2DIVA 1R43A 2Z30B 1MJAA 1CQMA 3SZGA 3MMBA 2WW8A 3HSDA 4LR7A 2JPBA 4J01A 5LT5A 3SSQA 1N36F 2XS7A 3S3MA 5HLGA 2YBVA 4NYPA 4DV4F 4ICLA 3BTJA 1CQTA 2ZD1B 3MI7X 3PTWA 4GRSA 4DR3F 1RK8A 2MGZB 1MDMA 1H88C 4I0WA 2BABA 3GCWP 2G7UA 1ODDA 1B72B 2QV6A 1W5SA 5M5WJ 5HNFA 3QODA 4XRSG 2XMTA 5HAOA 4WJBA 2DVIA 3D6HB 4X4TA 2ALZA 2WW4A 1E3PA 5A2QU 3HRTA 3R0JA 1IAWA 2WVFA 2UUCJ 1TKTA 4F02A 4AYBD 1F3VA 2HGCA 3DWLE 2A2DA 1LKXA 2I8DA 1A6QA 4XOTA 1FBUA 1HW2A 1U9OA 1W7PA 4D0PA 3T9ZA 3MDFA 3QWPA 3LW5C 1VDHA 1U26A 5E1ZB 1FC3A 2EIKH 5K14A 2RU9A 3WHIA 2HOAA 1F9HA 3B02A 1RTIA 2GGPA 1IN0A 2LY9A 2XKOA 5K9FA 2UXNA 3OJUA 1RHRB 5LRSA 2EA2A 4PYDA 2KQRA 2BV3A 1JQGA 3OY9A 3CCWA 2IDEA 5JFRA 1WDDA 3V81A 2XDVA 3W1YC 3FKIJ 2HNZA 1YOVB 3DBHB 1GT8A 2CO5A 3PACA 4EJUA 2FJBB 1W5TA 2DNZA 1R4NB 3BQ0A 4KTQA 1U8WA 3MM5A 5I42B 2O6GE 1U2RA 4WWSA 2PI5A 2LY2A 3OQ2A 1HA8A 1FKAF 5E20A 4ECRA 2DT5A 1TNSA 5AJ3J 3KK2B 5D77A 2O1PA 3JSOA 2DR8A 1S5LC 4O4GB 2L4MA 1LK5A 4IHWA 4TV7A 3M8FA 1VRUA 5KG1A 4WFYA 2LY1A 3HPGA 3PHTA 2ISYA 2XULA 1X4HA 3ZZRA 2Z8QA 2VPWB 5J2PA 1KQSR 4MFBB 4NB5A 3RKQA 4ASNA 4B3OA 4J9NA 3DBLB 2MQNA 2HQCA 4FF4A 3KJNB 4ESJA 5LHIA 4JBCA 1YLFA 3MPWA 2BW3A 3G2XA 4A3LJ 4C2MA 1QAIA 4QR0A 4I69A 1EETA 1R00A 3KLFA 1BQMB 5FD5A 2ZJRQ 5J1EA 3RCOA 3D1QA 4I7FA 2RJZA 4BH9A 1VYAA 1N5YB 4IG0A 3ZN0A 1XGOA 4D5CA 4DQ2A 1ZM4A 1X1AA 5B66C 2F9DA 4TY9A 1BI1A 1DGWY 4ZJLA 4EM1A 1JKPC 1H2TZ 2J5OA 4PG4A 2V8PA 1VBKA 4G1PA 5HDKA 1TKDA 2B6AB 4MKBA 1XJWB 3K2AA 3CCSI 2YX7A 2BACA 4F36A 2XF5A 5HODA 1JT0A 4B48A 3CJNA 4KGVB 1U8RA 3PW2A 1RQ0A 2Y48A 3D54A 2OTLS 2NVYJ 3LA3A 1ZR4A 5K8MA 3AFHA 5KAIC 1OCCH 3RZDJ 3LSPA 4DPWA 3PX0A 4LSLA 1B0TA 4A0YA 4CO1A 1FRKA 4N4NB 1GTHA 2I2YA 4LJZF 1CGPA 4LF6J 2FLLA 4CLZA 3AOCA 3HM9A 4LF1A 2EQRA 4BHBA 2DMPA 4ETXA 5DDOC 2YNFB 2J0QD 3W61A 1FFSB 1T08B 2CUZA 2CDRB 4QBUA 2GXGA 2M45A 4USUA 2M3DA 3GMEA 1RWNB 3AAWB 2GZWA 2VDHA 4D3GA 2ZJ2A 1GNKA 5E0OA 4ETSA 2OSQA 3ZTPA 3UR0A 4RU2A 1HKTA 5J6XA 4DBQA 3IP0A 2R7ZJ 3KLIA 1N33F 1PAEX 3V7SA 1B0VA 2JA2A 4Y33A 4ITVA 3MCSA 4A6DA 1ZTWA 4H4MA 1QZZA 4A8YA 2JOQA 3EUKL 2CRLA 4BHQA 4IRKA 1TW2A 4CYUA 4K5SA 4BXFA 1SQEA 4NZ6A 2V2VA 2UVWA 3S14J 4YB1P 2ZKTA 3HK2A 4PZJA 3PM1A 1L3UA 3DLHA 5L9XA 2AEJA 1NXIA 2DGXA 5KFRA 5EZHA 3MHYA 1U1QA 5IZHA 3DMJB 1WWHA 1D1BA 2IJFA 1ZGAA 3EZOA 3EUHC 2RREA 5KFVA 2C2DA 2XO7A 4C2TA 2ZEJA 3QYFA 3FDYA 2JA8J 4XO0A 2HURA 1S8NA 1FOXA 3FZVA 3FC9A 4LB6B 4ED5A 2RHQB 1T8EA 1SL2A 3A0BC 3D7SB 2NS8A 1N25A 1IUJA 3J7YI 2JEFA 3FM3A 1FE4A 4KRWA 2M88A 5DCFA 1G59A 2MGZA 2KMUA 5JMNA 1SL0A 1R89A 1ETKA 1CULA 3A4CA 1KTVA 2PI4A 2DR7A 5C2CA 2KRBA 4J9PA 4BQOA 1XEZA 2F48A 1UWAA 2ELJA 4BACA 3IP4B 3DGPA 1YKWA 2GVZB 4NYOA 4LMYA 2MQPA 1WF0A 2B5JB 5IP9J 4W90B 1DZ5A 2P9GA 2HPMA 2LTPA 5F04A 4OIRF 2F3JA 5ED4A 4TVAB 1JKQC 4XKWA 2L9WA 4TLQA 3BJOA 2HZVA 3QU3A 2KFNA 5I3PA 3OIQA 1WJBA 3CJ5A 4JI3J 3DI6B 3P9KA 1N32F 2UVRA 1FWPA 2RF2A 1WKLA 2KIFA 1TWCJ 1REGX 2WCXA 1U49A 4QIVA 2LYCA 1WC5A 1YQHA 2YNIB 5LXYA 1WFXA 2IBOA 2DPDA 3IFEA 2EV6A 4ZYAA 3M4XA 2VPZB 3X1LB 2EC0A 5BPDA 1BN5A 4MT1A 2RUSA 3UDLA 3VCDA 3N0VA 1RDRA 3QYBA 5IY5H 1S72I 1RT6B 4KFBA 3U1LA 5AONA 5H20A 2DNYA 1YIJS 2HYGD 3ZQQA 2QYGA 5DDRC 3Q22A 1GLNA 1U7LA 2YQ1A 1XNQF 1U25A 1J7KA 3OOUA 3CUOA 2CFXA 3SSSA 1YW9A 1IRXA 2UXCF 4JB8B 2ZJQF 1S6QA 3Q8VA 2N8GA 1ON1A 2IGMA 2FB0A 4AWXB 4B3MJ 1VHFA 2RVCA 2HQRA 1R5GA 2WVCA 5LOQA 1IN8A 3POTA 3QSIA 3ZTQA 1AU7A 1CJTA 4H4OA 2QMUB 2XGPA 3OR1B 1GT0C 2MJNA 4A3CJ 4PUOA 2CVIA 5KT7A 4OWRB 1HNXF 4A8WA 4CO4A 4WFZA 1WJ9A 2ZHAA 1U2CA 3E01A 4UUVA 5LSLA 2UVUA 2DH8A 5DDPC 3SFUA 3KK1A 1TL4A 3FXOA 4EMDA 3CJTA 1APSA 1TUWA 4WU2A 3RJMB 5DQGA 1G6BA 2BHYA 4IHTA 3L7WA 1MMAA 1MG7A 1HNXJ 1IVZA 2BHZA 5K7HA 2Q1ZB 1TV6B 4GGGA 4RM2A 2MY7A 3CCUS 3RQ4A 5ICCA 5GAEU 3J7AN 3MPYA 2X48A 2BY1A 2J8AA 5L3DA 4AYBN 3RB0A 3L7PA 2CQ2A 3GFYA 2W2OP 4XRSA 1WC3A 2FUG9 3PFOA 4Y13A 2ISZA 3JRBA 2NXEA 2KM8B 3F8CA 4B3RJ 1LK7A 5KT2A 2ZBIA 3M6XA 3AJ1A 4LRAA 1RTIB 4M72A 4F26A 1WKJA 2YPYA 3DXSX 2MLYA 2DO7A 4G7HF 2HPUA 5K8OA 2HDCA 3DFEA 4UOFA 2TDXA 3J7Z5 2RN7A 3GIJA 3IGNA 3UDCA 4CTAA 1PKUA 4RW7B 3DLLQ 2LDUA 2UUAF 4XN0A 4IG3B 4ECZA 2F8EX 3H2VE 3M8JA 5KG3A 4K5RA 4OJ3A 1RTDA 5H6RA 1T2KA 2IA6A 4A3DJ 2W9CA 5M2RA 2QLFB 4LG0A 3CD0A 2A05A 3R2DJ 1S79A 1HKAA 2MZQA 4DZ6A 4AM3A 4PJJA 2XHWA 2XRLA 3OYCA 2FHJA 1YITS 4RGRA 1XD7A 2QLXA 4NLSA 4CLWA 4FVCA 3K2ZA 1X0FA 3TR5A 3ONQA 4BQAA 3C16B 4IYQA 2M2EA 1Q82T 1B3TA 1IBMF 2PJRA 4P9FA 4WF9Q 1HQUB 2DOEA 3PEJA 3PJXA 4ZYDA 2BY0A 1U09A 3NP5A 3LSJA 1MMSA 2JUCA 3H9QA 1I6XA 2XWXA 2YQ3A 4HR2A 2RE1A 1JTXA 3ZQ7A 2L3MA 2HGMA 4PG5A 1KS2A 3J7YJ 3BGRB 3MEDB 1S0NA 3BR2A 4QWQA 5CZVA 2CAJA 2OPPB 1ZELA 5EUHA 2EV5A 2QMWA 1PG5B 2DQRA 1LWXA 1FFWB 3GZ6A 1S0MA 3R5JB 3D2WA 3WHBA 4OX9J 5BOXA 5DS7A 3FXJA 4ZCLA 2VC0A 2ASLA 2ABYA 2EK6A 1ROFA 3R8YA 2UVVA 4UNOA 4IKFA 1FKOA 1H8AC 3HRMA 5B0CA 4HACB 3OLAA 4B9VA 2DOFA 3OW2R 2QQ9A 4RB0A 4IZZA 3TL4X 3CCQS 3F3XA 3LQVA 2HFHA 4ZIVA 2P5KA 3QP6A 2KIUA 2AT1B 4OV6A 3K5LA 2XMAA 3TVKA 2VE9A 2C6YA 2EBIA 3EZ5A 3VEPA 3KYLA 4LF9F 2QBYB 4MLOA 2M9HA 5J3LA 2C28A 1OLTA 2JSPA 3RU0A 1SH2A 3BO4A 3NARA 4M3BA 4I6ZA 5F27A 2B63J 2O7OA 2E2IJ 4B9SA 2W2MP 4N5SA 1JXLA 2DHXA 2AQ4A 1U8SA 2CIMA 3AQPA 2V79A 3CF2A 2X1FA 4Y6IA 1UWBB 1U1NA 2CJJA 3T1HJ 2AMCB 3UPFA 2E36A 4USWA 2HVHA 4JBAA 3PFIA 4LIWA 3GZNB 3BS9A 5TJJA 3GJRB 1DLOA 1T05A 1VISA 2XHKA 3DU6A 2GIVA 4ZYGA 2DA4A 1FNOA 1VQ8I 1KP6A 1W7PD 2HHHF 2HU9A 4CCNA 5IYBJ 3PNIA 2YWHA 1RWKB 1NRKA 1Z77A 4ZLPA 2ERRA 4J37A 2LFBA 1LOUA 4K7QA 3CD5A 3L4BC 4IVNA 5B1AH 1UJ4A 2V0NA 1Y56A 3BKTA 4WXCA 2W24A 3KG0A 2V1XA 2RKIA 4ZHRB 2A6HF 4OZ5A 3DDIA 5DG7A 5IYDJ 4ZJQA 2YKNB 2HNDA 1UPPA 2OPRB 4WIQA 3TJAA 1WCMJ 2XASA 3JSRA 3OUYB 3M2RB 2WRMA 2H51B 1T03B 3K5OA 4NQWB 3E6BA 2EIJH 5D5UB 3R97A 1M5OC 2L7KA 3H8YA 5LMUF 2YXLA 2QTWA 1ETXA 3FMBA 4I09A 3VYTB 4J9UE 1G3WA 1WKKA 5HNHA 5D4PA 3BG3A 3PRVA 4PXCA 3M9OB 4HLYA 1FXRA 3CCMS 2LQJA 1MSFC 4OYZA 4BJ5C 2HEOA 4CO8A 2KRFA 1NH8A 1L3SA 4IOAQ 1XWLA 4LF8J 3FZ2A 3WTWC 4KKOA 1OY8A 3T5LA 3C6UB 1RT5B 4I67A 3ITHB 1Q8IA 1T38A 4PXDA 2ZITA 2X85A 4FX4A 5B0FA 1IR1A 1JJHA 4M3FA 3EGVA 1N34J 4KYWA 4WXDA 4KAIA 3S1RJ 3DXJF 4DSJA 2CA9A 4DN0A 2GAUA 1FJGJ 2K40A 1UVIA 4C8NA 1OYDA 3DPUA 1BIAA 4Q0BA 2CQ3A 5E17F 2LR8A 1A31A 4N9IA 4ZVRB 1L3VA 1X5TA 3ULQB 3MM8A 2GLOA 3OS1A 4EEFG 3T9NA 3TW0A 3D6MB 1IKXB 3HX9A 2ZSIB 4NX9A 2FD5A 1BW6A 2HQGA 1TQPA 3ADAC 3IGVA 2DH7A 2MDAA 3ZP5A 2RQPA 1TK0A 2L9NA 2MG4A 5ICEA 3E3VA 3O3KA 3HUGA 3D1HA 3JAMK 1P1LA 2ZOFA 3BH6B 3LSGA 2W82A 1RHMB 5J2MA 1EH7A 3CJQA 6FDRA 5JHFA 4RW9A 4RS8A 3R4KA 1RZMA 3U1NA 3CMAS 1DRZA 4ZS6A 4JI2F 2CJ9A 1HBOA 2RKHA 1KVIA 2O66A 1YRNA 4EM0B 3QRPA 3GEZA 1IDZA 3CCUI 4X84A 2ZC2A 3UKGA 3RG6A 1NHAA 2J6SA 1Z4UA 4I0AA 4WE1B 2ZOMA 2FQQB 4YEJA 2OCEA 2OMLA 3GIIA 3GIRA 3BTLA 1IC8A 2Z4PA 4UF4A 4C3KA 4HLXA 4MEXF 2K9QA 4YFKF 2CJYB 3V6DB 3L2UA 3FQKA 1FERA 4TQRA 1HBNA 1VS3A 2DRBA 1Q8BA 2AEMA 1LWCB 2ZFHA 2Y0BB 3D66A 5LJ3Y 2K06A 2F6CA 2JTVA 4KA4A 1J5YA 3OL4A 2FZCB 2Y69H 4QYRA 4CYUB 4M3DA 3SFZA 2G2ZA 2LEBA 3PJWA 3QAUA 1RWPB 1LEBA 3GV8B 4JI3F 4HI1A 1B0PA 1YHQS 1F0XA 4K4ZA 3PYEA 5AE1A 4X2BA 2IM3A 9RUBA 4DYQA 1R4MB 3H9GA 3QBCA 1BI2A 3U1MA 3UVJA 5KFKA 3W6VA 2P9EA 1EARA 2HR3A 2CUFA 2PJPA 5JUMA 4MFEA 3I5UA 3KIOA 3LO3A 2XRNA 4IDKB 2E5LF 4PG6A 2NLWA 2HQNA 5F8HA 1TL3A 3Q8YA 5JVGQ 1VC6A 4MGRA 4A0ZA 4IFYA 1CJVB 4KIFA 2ZFWA 1KHVA 4CDIA 3W66A 2CUYA 1U6FA 2M7AA 4K0KJ 1H89C 3AB4B 1VQ6S 4Y2KA 4ZK7M 1SQFA 2DA7A 4CIOA 1WQ2A 3LNQA 1Q53A 2Y1JA 3CC2I 4U87A 5HBMB 2ZZMA 3SFGA 1D09B 2HWIA 5K5OA 6FD1A 1K0TA 2EEYA 1VI7A 3S3NA 2DMNA 1ZM3A 3DEWA 1U9NA 2YU9J 2A18A 3GW2A 5BMZA 4DN9A 3MM7B 1IJFB 3MZYA 2H5IB 3MTJA 1T94A 4B44A 1RAGB 1AB8A 1O57A 2HZTA 2I5JA 4IH6A 3NKYA 4F3QA 5C3EJ 3REOA 4O23A 1VCTA 2RQCA 5KFXA 4AXJA 4HYKA 4FBUA 1FY7A 1WD6A 3TP3A 4I7FB 4M5JA 3PFEA 3SYTA 3PG9A 1FRHA 2XCAA 5A2QZ 1P9YA 1HPZB 2ZE2B 2HGLA 3S7RA 2Q6BA 2NZ4A 5BYQA 2H8RA 3JS9A 4FPRA 4CO0A 3D3BJ 3O6BB 4U8YA 1FBSA 1R8HA 3H5UA 2HHXA 2VT3A 3M8RA 3MEKA 1IBCB 2DOAA 1WOSA 2DGSA 4NLRA 2CQQA 5CKTA 5L3CA 1KVKA 1ONVA 3OYDA 2JA5J 1GX5A 4ZHRA 5F0CA 2JFKA 5E7OB 1ZTRA 3F0CA 1YIJI 1U5TA 2LYVA 3SDEB 4N4OB 4C8LA 3SDEA 2Z33A 2HS0A 4IKAA 2BE5F 4DX6A 2GAHC 1TP4A 2HVZA 1RAIB 3CC7S 2MC3A 2VQCA 2E2HJ 3GYXB 1WJAA 2C22A 1VQKS 1OR7A 3HOXJ 1W4MA 4XTTA 4JI0J 2W57A 1REVA 3TWZA 2V50A 3H5RA 3JRDA 2DNPA 1FYLA 1DDNA 3CESA 3WU1B 1TMMA 1NK2P 1KU2A 3P6YC 4Y34A 3B6AA 4DL2A 1UCRA 3TEHB 4IO9Q 1YK9A 2HVSA 4LR8A 2M8GX 5A8WB 3GMGA 3TI0A 1VQLI 2I5JB 2JMWA 5EGYA 3DQVC 2ZVSA 3MXHP 2K27A 3ZZYA 4ECSA 3EVMA 4ELVA 5I3QA 2DODA 3H0PA 3TA2A 4EO8A 4MIAA 5IT9Y 2KT2A 4WIIA 2XY5A 1U1OA 3CCLS 2F5FA 4ECQA 2FVRA 3FK4A 4JV1A 3KNAA 4TXSA 5LHGA 1QQIA 4RUCA 5CCMA 3ISZA 1JKHB 2COBA 4P9UA 3WIUA 2XMMA 1BOBA 4DPUA 1FD2A 2RNGA 2WAEA 2QA4I 3HLUA 3HSZA 2B8QA 1ZGJA 2Y9HA 5HOOA 2RAEA 4DXLA 2M30A 3CDAA 2BJ7A 5F0FA 2AIRB 5CD4H 3I58A 4HKQA 2VJUA 4R25A 4A0XA 5B0BA 2DY1A 1TKTB 2DYSH 5BXIA 5D3GB 1FBQA 1Y0UA 5M5XJ 2DT7B 2ZB9A 5C4XJ 4XQFA 4ZJZA 4BQNA 2FBHA 2DCEA 1M1EB 2ASDA 1RHKB 1STZA 3L2WA 2B4VA 2OPPA 3AB2B 5E3LA 1YLXA 5KAFC 5I42A 3QOEA 2R2UA 5EDNA 2GM4A 1Q5YA 2GXBA 3MEDA 3UVJB 1N33J 4Z2YA 1JXSA 4ZTFA 1SEUA 4PKDB 2B3TB 4ICLB 1HWKA 1FSEA 1FEXA 3TO9A 5E3MA 1GFWB 2HHHJ 2CV0A 2PIIA 3NNAA 3MUVP 5HVQC 2E5ZA 3NOCA 1LWFB 4YFXF 1W25A 2P0WA 2GZOA 1PUFB 3F8FA 1SMTA 4GMKA 3LA7A 3CQZJ 2IAJA 1T9YA 3KHRA 4DR5J 3IN5A 2A0FB 5BYSA 3JYTB 3FFIB 2HW3A 1L3TA 4C2MJ 1G3YA 1V5EA 3V8LA 1RRJA 3C1DA 2EINH 3M1VB 2XGEA 4BHCA 1XB4A 4AIKA 1WUUA 2VU5A 1Z7LA 2C2NA 3SEQA 4BDZA 3IH2A 3TJ9A 4NCBA 4W97A 4DCOB 4CLKA 5H9FJ 3MEGB 3SCIE 1ZR2A 2QRRA 5LXRA 4ER8A 4YRVA 2XB0X 1TTHB 2DRDA 1NDLA 3K0JA 3NLCA 4DQQA 4BEHA 3T3FA 1VFCA 3EVOA 1LJ9A 1AZSA 4LIUA 1FWLA 4RW9B 4A8FA 1S6PA 2B9WA 1Q1HA 3ABUA 4UZCA 5SZTA 3HP6A 1MIJA 3M2VA 3G1LA 2L4AA 3J7ZT 3G96A 4DV1J 2E66A 5FFXA 3BR5A 2D1CA 3MN2A 3D0GE 1LNWA 2FE3A 3M9NB 4Q2MA 1TUGB 2B56A 1PDNC 1B64A 1HQCA 1FJCA 2FYXA 3BGOP 5DJBA 3SZPA 3LQRA 5L46A 2QFJA 2MJUA 3AD7C 4F2SA 4DR1F 3BROA 1NKBA 5FLVA 2G4BA 2VB6A 3LSIA 2E2JJ 4LSLB 1GK8A 4OHXA 5FRNA 4N56A 1VRTA 3H4DA 2IDLA 1TUVA 1UA0A 2JVOA 1WI8A 4XRFA 4FNHA 2BA9A 1HW1A 4ZVFA 1WI9A 2V94A 1DP7P 3OTDA 3MM9A 3PFYA 1SANA 2B6AA 2Y0SN 3EYYA 3ZR8X 4DUTA 3JSMA 2EG2A 3KK1B 1S5ZA 2RRBA 1BD6A 2LMDA 3V7RA 2OEKA 2NVQJ 2AZ1A 4B3MF 5C7PA 4XLEA 4K4YA 1IR0A 2VOOA 3ZQGA 1HMVB 3QT6A 4MTPA 1RTJA 2LXFA 4EEYA 1SC4B 2OUGA 4ZLLA 3DDKA 2C3OA 5JI6A 3CWJA 4ANEA 4AFFA 3HOWJ 3US5A 1N5YA 1SAXA 2IYIA 2LU1A 4X4SA 4KYZA 3IUOA 5LEJA 4ABZA 3KLFB 2KFDA 4PEOA 1FPQA 4NDLA 2Z2YB 4RAGA 5KG5A 1U1KA 1M5KC 1XN7A 2DK5A 2CKWA 3CZ6A 3OYAA 4AVZA 3MEEA 2FJWA 1D0ZA 3BPVA 5IT3A 3IRXA 5AXNA 5F6FA 2P7CB 2IC3B 4P5OA 3QAHA 4OIOF 2QA2A 1R1UA 5DV5A 2QKMB 4WYLA 4RB1A 3CF5Q 2H65B 4P52A 4TU8A 3SIPB 2OEMA 1B8IA 4HNVA 2ESNA 4CICA 3HOUJ 3LSMA 5F3ZA 2V26A 5GAEI 3HTUA 2EZKA 5D8KB 2VXZA 3CCES 1V55H 1YJRA 3I59A 4PWDA 3UN5A 4YFNF 3AA8A 1DP3A 4DR1J 3CCJS 1QPMA 1BY9A 3CDIA 4CI0B 1BXNA 1NB2A 2RDPA 2BVMA 1JJ6C 4FYWB 3MR2A 1AKHB 2Q2EB 1R23A 3DHWC 2KKHA 5A6WA 1VQ7I 3V4MA 2PMHA 2QQAA 4ZDLA 4O3QA 4GC6A 3BR8A 3QWLA 1OCZH 1CF7B 1C4AA 3A3NB 3NNCA 1UETA 3BGLA 4M95A 3KP6A 2Y3YA 4NCAA 1UVJA 2I10A 3HD1A 4DHVA 4ZVUB 3DU5A 1NLKL 3DRRA 3VZHA 3HMJG 3RYLA 1QAYA 3OL8A 3FGVA 1XNRF 3H98A 3GTOJ 3M6WA 2ATCB 1HKSA 1S9EB 1S48A 5DGBA 3GG1A 2DDBA 1V5GA 2P9CA 2M8EA 3BN7A 3ZZZA 3MFHA 3JSPA 3CLOA 4C9DA 3TBIA 1FWZA 2ILZA 5F1RA 5KK1A 4KHPJ 2F5CA 1XMOF 4P6QA 3DLGB 3TO7A 1IKWB 4X65F 3FMRA 2L9SA 3ILJA 2XTJP 3HCXA 2EJRA 4JI4J 4DUYJ 2EG1A 2CSOA 2APOA 4F93B 2JLEA 5AXLA 4M5MA 2XMJA 3HOYJ 2CV2A 1NK5A 4MTEA 1U1MA 1SC7A 4KC5A 1YO5C 3GV5B 2CGPA 1RR7A 1WZ2A 4BCAA 1N34F 1FVSA 2MTLA 2HQDA 5I3UA 3LMMA 2VE8A 2HZCA 1FK9A 2M1BA 2HAIA 3HHKA 3A3OB 4WP8A 1G4CA 3LP1A 3S2WA 3OYMA 2C42A 4LF4J 1YJWI 3V8JA 4RB2C 1NPPA 3TAMA 1WDTA 3CSKA 1JKOC 5M2UA 4V1Ak 3AA9A 1T39A 3DRPB 4DS4A 4E7SA 4RW4A 1GVDA 2NXNB 4KUMA 2ZXIA 3BYPA 1WC1A 2E19A 1ETQA 3M7GA 3IWXA 2M0MA 4CZCA 4R0EA 8RUCA 1K6OA 3N5BA 2B4UA 3Q0VA 5KFUA 1G6NA 3TW6A 3IG1B 4RWXA 3CJKB 1MU2A 1H9GA 4CH0S 5F1JA 5THWA 1RWMB 4EU0A 4CLYA 4A3EJ 3T0YA 5FD6A 1D3WA 1Z91A 2FPHX 3A2KA 1M0SA 1XERA 2A5YB 3IAM2 2CFOA 4O6JA 3RYPA 2FHMA 2XQCA 2A1BA 3LUYA 1VQMI 3J80K 5KT6A 1PYOB 2BJ1A 4NMLA 1LV5A 2V4JA 4NEZA 1YG0A 3RBZA 4ES1A 4IHSA 2LREA 4HT7A 3PJ9A 2PEXA 2VIXA 4PYAA 1CJKB 3C6UA 3LQQA 3I71A 1RT1B 3N5FA 4DLGA 2AGQA 4OI2A 5FLXU 3MZIA 1J5EJ 4RUAA 4JP0A 3BM7A 2H09A 1Z1DA 3S1QJ 1TKXA 1N32J 3M1CA 1UVNA 3OPKA 5IQ6A 3QT5A 1IXCA 1ULYA 1ZPWX 2XVCA 5DTDA 3J81Z 2MHNA 2ZHBA 2QE5A 4QU6A 5DUIA 2UUAJ 1G2HA 5HO4A 4LSNB 3DLLF 5DETA 4ZN1A 2VQLA 2NSBA 3MKYB 2IT0A 3ZZ0A 1HNZJ 1EF4A 2EFOA 4ED4A 4LF9J 4LBIA 3KLHB 3W5ZA 2PEBA 1ETYA 2ZC3A 5I3UB 3C14B 5K5MA 2UV8A 5KFQA 4X4UA 4L0ZB 1W2IA 3DBRB 4NLVA 3R5BA 3PSFA 2AXTC 5KFEA 2W9BA 1VQPI 4DIQA 5KT5A 4NC8A 3D1NI 1PYTA 3K4JA 1YBUA 1RTJB 1BJZA 5E79C 1MBGA 4ILRA 5CLSA 5K1YA 3A8KA 1VRUB 1BR1A 2UUBJ 4NC7A 1D1AA 1GMVA 4BY7J 4PABA 2DPUA 2MGQA 2VKEA 4UUSA 1TQLA 1HI0P 5IM0B 2GQQA 2CW8A 2MSSA 2KXNB 2ME6A 3IM9A 3FSXA 3CCEI 3QIPB 1TK5A 3PIOF 1REPC 1T05B 2VT2A 1SFEA 1WI6A 2QZ8A 4OHVA 1CVJA 3TYTA 2NVUB 2M2BA 1OPZA 1F1ZA 3M1EA 1U78A 5C5JA 2NPIA 1VQ6I 2HQFA 3S93A 4D9JA 3NGKA 9ATCB 1O0PA 2GIRA 3GYNA 1R8CA 4DL7A 4XK4A 4G7OF 2PQ8A 2EFVA 3NWRA 4L5IA 4I2QA 3PYFA 1DUXC 2MH9A 5E41A 4WFAQ 2JPCA 1T33A 4F4AA 1HKQA 3TP2A 3CJ4A 3PQJA 2VI6A 2JFDA 2V34A 4YR3A 1UCNA 2HPIA 2V4RA 5DCMB 1IKVB 2OBPA 2NYIA 1RAEB 4ZDNA 1RCOB 2IVFB 1W7PB 2WAQN 4XLNF 3JTPA 5EDWA 2X7IA 4Y17A 2XAGA 3UN3A 1UTAA 1OSCA 1OMIA 3PM9A 3AQOA 1X5PA 2YNGA 2WTEA 3R60A 2C2RA 1BE4A 2IJNA 3E51A 5CQEA 1DTQB 2DFEA 1FNXH 2V9KA 2RS2A 2NUHA 4UVBA 3H42A 1X2NA 4LG3A 1RB0A 3R5CA 4DFJA 3NBPB 2XMVA 3G86A 3RUBL 2CXEA 1ZN2A 5IOZA 2LBFA 4CCJA 2FTRA 3QRQA 3OYJA 1NG6A 3RSNA 2CUJA 1OFCX 2OTLI 2BQRA 4MK8A 3O8HA 1VQYA 2IC3A 1T9XA 2JWTA 1H7WA 4DQRA 4ANCA 3MKZA 1U2FA 4ZVGA 5IV3A 1K73T 1BQNB 2GVDA 1WHXA 4I01A 1T03A 2ZH4A 1OCTC 1TLHB 3MAJA 5LL6d 4F0KA 2FLNA 2QCOA 4LIRA 2ZNYA 2X3DA 4DZDA 1QSSA 4P74A 4Q7AA 2XPUA 3TDUC 1KVJA 3CDHA 3H35A 1H0HB 1IF1A 4K8RA 2VH7A 2AQFA 3QO9B 1RI7A 1DQAA 3TOAA 4KT6A 2ZC4A 3SQGB 4UT4A 1E0EA 2MABA 5FB2A 2VFTA 2WADA 3RIRA 2W7OA 1LB2A 3VAMA 1WSVA 1RWWB 1KQGB 2ZOGA 2KVIA 2DHHA 1JGGA 4C97A 4WP3A 4J9RA 4HOBA 4UOHA 3RI4A 1W36D 3DTEA 1PGZA 2HBZB 2M4GA 4P9SA 2XROA 2K3FA 2HEKA 4ZCIA 4BU2A 5B09A 3DKWA 1OYYA 2WB1A 4JK1X 4NWBA 1OYIA 1T0TV 4MIMA 4GDFA 2M4MA 2VQHA 1BBYA 3M8PA 3MCOA 1RWVB 1KSPA 3J7ZI 1IKXA 1PSDA 1X8DA 1ZAWA 5HS8A 5A8WA 1W0TA 3W9IA 5TRDA 4J9VA 1UAAA 3M30B 2ZKUA 3ETOA 3QT7A 4RW6A 3F21A 2CWKA 3A8EA 4OLOA 4PJMA 1FRJA 2Q2EA 1AZSB 1JNZB 1BI3A 1S9HA 2HS3A 3D1OA 3WTTC 3HULA 5IXUA 4IHXA 4I2OA 1D1UA 4EO6A 1QGPA 2OPSB 3MR6A 1H3DA 3DRSA 1FFGB 1UG2A 5KFIA 4LLGF 3KLNA 4IOAF 3AODA 4UZBA 3CJTB 2DGTA 3U02A 2GMLA 3RDIA 1XC5A 4IHVA 4KV8A 4LFUA 4KY3A 4KFCA 2F4OB 4F2RA 4YB7A 5C25A 5T7LB 4RMNA 4NOHA 5KOXA 3JB9k 1C1CA 3LAJA 1VQPS 5CD4A 2JEJA 2L9DA 2DTZA 5BYRA 1PUFA 3PW5A 3FUYA 3KLGA 2FIUA 1I5ZA 2OZUA 3ZCOA 1JNRB 1OPIA 3FIWA 1LE8B 2DNNA 5F9NA 1HYSB 4FF1A 4CO2A 2B9YA 5HJYA 4F4XA 3T8TA 3KLEB 2JX2A 2D9PA 3A01A 3LGHA 3KE2A 3G6EI 3ZMTA 2OSRA 3GTPJ 2X1EA 3NAIA 2UXXA 3VWBA 1XMBA 4HQEA 5D8HB 2DYRH 5HLFA 3MKLA 4OI6A 4LF7J 1WG5A 2VFUA 3HTSB 1RKIA 3FXMA 2F63A 4DR6J 4L6V3 4KGZB 3NEUA 3ZN1A 3OSGA 3HKZA 4Q5VA 4PQUB 1RBOB 2MZJA 4JUZA 2BEOA 1YZ7A 4KT5C 1MMLA 3GG0A 3JQJA 2UV8G 2VL1A 3IH3A 3KG1A 2A6TA 1Y5NB 3CC2S 2MHEA 4XDCA 3THVA 3VQSA 3DRSB 2KIMA 3VPRA 3GFXA 3KP2A 2E5JA 4F4YA 5J2NA 2EK5A 4MKYA 4TY8B 2MKIA 2QSGX 4II3A 2K4BA 4C8YA 1GXUA 3FBIB 4IUFA 2HS4A 1SD6A 2NCKL 5I4MA 3T19A 3H5NA 2ZH8A 2VONA 1FO1A 3IA0A 1QD1A 1LDDA 4LK1F 2MA3A 4M71A 4HAMA 2J5AA 3HHGA 4BJTA 1OJLA 4TKTA 4NLXA 2Z0GA 1YI2S 1KU7A 1FLIA 5DM7F 4ZA1A 2YQ0A 5IWAJ 3CCYA 2Z1DA 3AG1H 2CPJA 1T3NA 1Q7LB 2FD2A 3T6JA 1F43A 2IGNA 2YY3A 5BS6A 4LR9A 3SV3A 1R8PA 4P2MA 3IC1A 2ADUA 1JKRC 3LFUA 1B99A 2W01A 3LALA 2UP1A 2DJNA 2B0LA 5AXKA 3DTKA 4DV7J 2RRNA 2V9PA 2CJBA 4QPOA 2FOKA 4LVOP 3AD9C 1GHCA 3O2PE 4YS2A 1T9WA 5DS9A 3N6NA 2OI2A 1RYSA 3D5MA 3TQNA 2DYAA 2R8KA 4C8MA 1D5YA 3W3SA 2NYXA 5LGUA 1ZRDA 4KN7X 5B0EA 3UD4P 1FKOB 4CYDA 1DTTB 3DMJA 1XC9A 1XR5A 2AEFA 2R92J 2MLKA 3Q3SA 3OHAA 1V5IB 2FHOB 3QAEA 4QU7A 1WEZA 3CDWA 4G65A 1UEUA 2D3ZA 4B4CA 4KIAA 1XGNA 2ELKA 2XGXA 4OIQF 4G1QA 3EXYA 4PSWA 1HHTP 2H8WA 5FKNA 2IM0A 4TQSA 1B1BA 2MH2A 3M6VA 3O1LA 2OGUA 3MCMA 2CNOB 1IQTA 3CT9A 1RAHB 3CLQA 1R0BG 4XDDA 4C48A 2E9ZA 1P6RA 1YJNI 2RDIA 1I6JA 3KLHA 2OKQA 3UCZP 5A8RB 1X3WB 2L5QA 1T7PA 2ZZNA 3P5TL 1HD1A 2QMXA 4GYGA 1E17A 3R9LA 4LGWA 1H0MA 5H9FK 3FKJA 3BDEA 1QTMA 1FEEA 2DKOB 3HZJA 1X4CA 2DNOA 1FI4A 1QVUA 2RQQA 2FOWA 2LRDA 3H3VK 3Q0WA 4DWIA 1NSQA 4IRIA 3EUNA 2ZBQA 4LOCA 4QR2A 5AE3A 2CQPA 2QVOA 4GO5X 1WKMA 4RLQA 3DLEA 5IC6B 4A3GJ 1F2GA 2CU7A 2FU4A 3AXMA 4NEYA 1UVMA 2RH3A 2FXAA 1WI3A 4M9ZA 4B9MA 2B0GA 2ECCA 1BC7C 2K7KA 2ZWOA 1ZZFA 3SXYA 3JTHA 1B4SA 1JUPA 1FOKA 1FP1D 4K4TA 4AIDA 2ZJQQ 1NJYA 1LUJB 2DO0A 3QJLA 5GADJ 1M5PC 4GXOA 3H2UB 1W5CC 1R7JA 3RKWA 5J8FA 4B9LA 4KICA 3MZHA 3WHCA 5A8KB 1I1GA 1U2WA 3M8PB 2F40A 2DB1A 4IRCA 3I59B 3ICLA 5CJ9A 2GCFA 2PC6A 3HVTA 4J5OA 2RILA 1QSYA 3GTJJ 1BWEA 2WVDA 2CS3A 2NNYA 2XY6A 2Y9ZA 5IP7J 2HIQA 4ZVTB 2VIHA 1BOAA 4U7DA 3GTQJ 1BGXT 5A2QY 1D9DA 2HS5A 4DX8H 4M6XA 2JSCA 2UUZA 3I4PA 3EGZA 2DEJA 3E3XA 3VB2A 5J1EB 4HHHA 3LP1B 2RRAA 2XI3A 4E6KG 4ECTA 2HXOA 2J6TA 1N5VA 1S6UA 5IS2A 5KFFA 4YFUA 2MD5A 1NH7A 4LVNP 4HW0A 3PKYA 5L1LA 2AP6A 3VALA 4EBEA 3EGWB 2V5HG 1BWVA 3OYHA 4ZLJA 4DV6F 4E7KA 2ZH6A 3CE8A 3JYTA 5B08A 5GVQA 1MBKA 3MUMP 2MSYA 3CJRB 4EBCA 3BH7B 4K2XA 3ZC4A 2R2TA 4BL0B 1HQEA 4UUTA 3H5AA 4C8OA 1ZKGA 2F9JA 4CDGA 1XMOJ 1FCAA 3WX4A 4KHPF 1IN7A 4HNTA 1URNA 1AWCA 1WH5A 4DJBA 2O5RA 1JT6A 2FMYA 1TAQA 3IAM9 2P8IA 2LECA 3M30A 2F7VA 3Q9SA 1VQNI 3JREA 2HFSA 5ETNA 2NS0A 3V7CA 2KYXA 4I76A 2IS2A 1S29A 4O44A 2CNLB 3E1SA 3BSCA 3E6MA 3H5YA 2XS2A 1HNWJ 3WTYC 2AQEA 3AHPA 3BGUA 4J9SA 1N36J 3JRCA 2EK1A 2QL5B 4ERDA 1O3TA 1DTQA 2IVYA 1HR0J 3N4MA 3MM7A 1G8XA 4I2PA 1PVEA 2IPQX 5CZXA 3W2WA 5AIQA 4A6EA 2RD5C 5IC4B 5DM6F 5GAHI 3K1MA 1S77D 4U7BA 2XGDA 1NK0A 3K10A 3WTXC 4LFAJ 3E0JB 2UXCJ 3OS0A 1DQ9A 4HZFA 1KLMA 1KLMB 1QJHA 2FJ1A 1B7YB 2YWFA 5LMNF 3R27A 3ZMVA 2LEAA 4TY8A 4I1TA 4CLTA 1RBLA 1HF0A 2XZTB 2LKPA 5CYQB 4HX7A 4KISA 3NMRA 4IQ4A 3GE9A 4O0NA 4C30A 3B82A 4MK9A 5M3FJ 1DHMA 1Q16B 2R8HA 1XGMA 2RV8A 1IW7F 4BAYA 4QIFA 5ETRA 4U7UD 2AF6A 5FJ4A 2E60A 1UA1A 3MAAA 1B8IB 1ZOTA 2WVBA 1YRUA 1GX6A 1QHHD 1HSTA 3FJ2A 3BBFA 4QYZJ 1MGTA 2IHR1 5DYMA 1DY3A 3NS6A 4OYIA 3LA2A 1UP1A 5F64A 1EJ9A 2BBEA 1C2PA 2W7AA 3ENWA 1JMTA 4HHJA 2IS4A 3KLEA 2A6MA 4MO7A 2W7PA 3TKYA 1FIAA 1TQMA 3W8GA 3M3YJ 5F8IA 1VF9A 5DEQA 3MKWB 1VNDA 1TKZA 1IR2A 1RXOB 3LF0A 3HRUA 1CEZA 1S1TB 1USSA 2RNEA 2OD5A 1ENHA 1F9EB 2X6XA 4O0IA 3J80Y 1S7OA 3TA1A 4II2A 2EWHA 2E5HA 2JT1A 2NUUG 1FNNA 2XPVA 2O5DA 2U1AA 4UVCA 3M8EA 4KV8B 3DC2A 5J2QA 3CJ8A 1W1WE 3RKXA 3MGJA 3CD7A 4B3SJ 2D9OA 1RETA 4WX9A 1Z6TA 3LOUA 4OHYA 3P96A 3MWMA 3OIPA 2XB2D 3EQLF 2OJ3A 2ZE2A 3IWNC 3QGHA 2IJRA 3PXGa 5LFAA 3H4BA 2D1HA 2EPIA 1ELOA 4C3MA 4DV7F 1UAWA 1WOPA 3BSNA 2Z2SB 1SKSA 2FC8A 4TN2A 3CJQB 4OMFG 1FSHA 3BDPA 4ZP7A 2W2PP 1AUDA 5KG7A 4RW6B 3UO0A 3LSHA 3OTBA 1E2XA 3U1DA 5L3EA 4YELA 4NRUA 2G0EA 1QM9A 2R4GA 4KBIA 4RR5A 4I2PB 5HQ8A 1P4XA 2MLXA 2QYCA 4A12A 1RNLA 3C3WA 1FYKA 4WWCA 2YKAA 4WFNQ 2CPYA 4RBUA 4AU7A 3BKFA 1OMSA 2CV1A 4Q2LA 5E3QA 1I5OB 1FOWA 1QHGA 3CJSA 4LK0F 2HBYB 4R8HA 3CGIA 3SEOA 3HSEA 4M1KA 1FX4A 1RWXB 2ILYA 2EFQA 1T6SA 3NRBA 3CUQB 3CMEI 3E97A 3LSTA 4NLPA 5DGAA 2KJCA 2VG7A 1JXVA 3MMAA 5DZ6A 3OTOJ 4QWDA 3GQCA 2X1GA 4Y2IA 2FJXA 3I82A 3PNYA 3R1HA 2CJXB 1RC9A 3HGGA 2HNYA 1N56A 3FXQA 4CCOA 2DK8A 4BUPA 2AJ0A 1N78A 2MKYA 1VQKI 3RBDA 3P45B 4OMZA 2IXSA 2XSJC 3NCQA 1NDCA 1YTYA 2FY1A 2W2QP 5K5RA 3ENQA 2C2KB 2CQBA 4OI0A 1LW0A 2JLGA 1WJFA 5GADU 3FEZA 2L02A 1I1SA 2NXNA 1WHYA 1GAOA 3IBWA 2MZ1A 4ID8A 1D3YA 3GJTB 3QGGA 1RHJB 4I0BA 4UW2A 1XR6A 4O3PA 3PUBA 5E5NA 5HDNA 4X4VA 3EE3A 3C18A 1X31C 3OBIA 1TC3C 1TKZB 2GVDB 4PJ0C 2QYOA 2YKOA 2XV4S 4D7MA 3ZXWA 3L2VA 2N4DA 4HX4A 2KG1A 1U8BA 4JX4A 4D5FA 2ME0A 2W48A 3G82B 1HOMA 3ZZOA 1DBDA 2J9EA 1Z2ZA 3VZIA 5LGNA 3D68A 1DARA 2KI2A 4KFBB 3S16J 1RABB 3AL0B 1XMKA 1HBMB 1Y10A 1SKWA 3CJ2A 1QVFR 1RTZA 1X4PA 4ALZA 4RNOA 4HSTA 3DLBA 1NDPA 1G1XA 2PD1A 4JV5F 3DKDA 2DRAA 4K4WA 1V9OA 3KK2A 1A6LA 1HHQA 1X5SA 1Y8QB 2JRSA 3MM9B 2MKHA 1QA6A 3E6DA 5DUKA 2F4MB 3CW2C 2UZKA 1M1HA 1QZEA 3B6CA 3SCJE 4B3TJ 2KPMA 2IVMA 3KYDB 3OV7A 3I9ZA 3M32A 4QWCA 4L0YB 3BN4A 4LMZA 9ANTA 4NPOA 3W2WB 3DXBA 3L2QA 1E6VB 1J09A 1A9NB 5JHUA 5E3OA 2P4WA 5AXMA 3FMQA 2X1BA 3AG4H 3TVZA 2XZWA 3ENAA 3KHLA 2O8XA 3G1MA 5K14B 3WTVC 2XG8A 2QA4G 3TOBA 1ZAXA 3HXLA 1Y0NA 2HDDA 2MKCA 5D0GA 1MBFA 2VKZG 1N6QB 1ZLJA 3R0AA 4OIXA 1U45A 4C2UA 1UZCA 2KVQE 4ZYEA 4DCJB 5L39A 1REVB 4ZP6A 2AHOB 1HHSA 2WONA 1JUSA 4L5JA 1NSAA 1ZK8A 2V69A 3FVYA 1YJUA 3MEGA 3L00A 2VKDA 1L3LA 1WPKA 3A0HC 3IWFA 3PO5A 1D9FA 4NA2A 4DX5A 4HF0A 4XIDA 2IEKA 4CRJA 2LVSA 3WDOA 1SVOA 3VAJA 4RGUA 1YJ9S 3WG7H 3BG9A 3I0TA 5KHDA 5H6QA 3GCMA 3BGRA 3R1LA 3KJVB 1WTFA 1HIYA 2N3OA 5GADI 1S7EA 2HQ5A 2DITA 2R2RA 2VBWA 4KGMA 3BOQA 2GO8A 2GOMA 4S0HB 1TZLA 2D1VA 4HX8A 3R5GA 4UQTA 1T98A 5KOWA 3GLLA 2KXFA 4MQ9F 5F3TA 1N54B 3RPUD 1S9FA 2ROEA 2YKQA 5BQTA 5EX3A 3GTMJ 2IS1A 1RT4A 4DL6A 2FX0A 3BREA 4NYZA 5CYMB 2R4FA 2XSJB 4DL3A 4NMXA 2GIFA 1TWGJ 4Z7CA 4F8RA 4JQFA 4DSLA 4EWTA 3H59A 4ENOA 3OFGA 4E7LA 2VPLA 1YYVA 3D5SC 1N48A 2K9MA 4F4WA 2FA5A 1QSLA 3ELKA 3DRRB 1DFDA 1IWAA 1TKXB 4ZPDA 1Z3YA 1USTA 5FLXZ 4HDVA 3NGUA 4A93J 3U2RA 3M2UA 3TQEA 4PJNA 3HIFA 3ISND 2M4KA 4L75A 1I3AA 4C4WA 5D3GA 5F8LA 4ELUA 4YQWA 1JIHA 4ENMA 5FIIA 1B70B 1RTDB 1N8RT 4NRTA 3RRGA 5BR8F 4X64J 1Q86T 2R7QA 5EF6A 2JEGA 2OHDA 4IJAA 4ZOSA 3CCSS 5HVGA 1FTCA 3U7JA 2V1UA 2FHJD 2KISA 1IZ1A 1UFKA 1FRIA 1JLFB 5D78A 1NZ8A 2RS8A 3RGIA 3IRQA 1EA3A 2OU2A 2HYJA 3DGPB 4PG7A 4LSZB 5D5WB 3WGIA 2IA0A 1AT1B 2OP5A 4B8XA 1CJUB 3PRBA 3BYRA 5LHHA 1QU3A 5K5QA 4DYCA 3T1BA 1K44A 4DOZA 3FSYA 5F0HA 3F73A 1V3FA 1UZDA 2MZTA 4DG1A 2PEHA 3K57A 2L7FP 4XLPF 1MWZA 3BG7A 4PXBA 3ML6A 3CMMA 3BSAA 1FKPB 1HW9A 2G7HA 1TTYA 1BJAA 1TL8A 2IGOA 1RAJA 3O5TB 1YW7A 5E3RA 4PXEA 2JWNA 3R3TA 1T0FA 4YR0A 1R71A 2OC6A 4GVBB 2QLJB 2V1NA 1VC5A 4JX6A 3QLHA 2RC4A 1ZM9A 2PMUA 2LDYA 1LE8A 3DV8A 4BWMA 4BKXA 3CJRA 1YZ6A 3QSYB 5JVHQ 4OZ1A 2KYZA 4J9MA 3L2CA 1ZYQA 2QT7A 2VKRA 3CCVS 2E9RX 2E1CA 4XSXF 3OR2B 3OHBA 4FX0A 4MFDA 3OTEA 3QPLA 1UFMA 1RPWA 4L9TA 1X0PA 3F8MA 1DQUA 4QWEA 4U9RA 1RAOA 3PW4A 2IAJB 4F3MA 2AXLA 3G73A 1RLCL 3BPXA 2BKNA 1QDUB 5DDGA 2W8KA 1J0RA 1U6BA 3L09A 5LSOA 1J5OA 2A10A 1G3OA 4P7TA 5EWGA 1HLVA 2R2SA 4XPEA 4ES3A 4IQMA 4XAKA 1WNEA 4DSKA 4NLQA 3QNWB 1WC0A 3ISNC 4RM3A 4DV4J 4NZ7A 4M5GA 2R42A 5HK4A 4R5PB 4TYBA 1FKPA 1S9GA 4ZITA 1NPRA 2CADA 1EH6A 3A1YG 1X9MA 4LITA 4ZTJA 3MTKA 3W64A 4M5DA 2B51A 5F41A 3AG3H 2VKVA 5A76A 3GFIA 3T6BA 1ZA1B 4LG0B 3EICA 2M8DB 2IBDA 3S1MJ 2FJDB 5HQLA 1BR2A 3H40A 4WXWA 1JLCB 3HFVA 4NZ0A 4RA2A 5GPCA 4CTAB 1FESA 1H9TA 3F22A 2PG4A 4K4VA 3G71I 2FDNA 3TQ1A 2XM3A 2CPZA 3J81Y 4G12A 2E1AA 2LQ5A 1C0UB 1SIWB 4P96A 1KKHA 1JLCA 1C0WA 1IN6A 2CQKA 3MR7A 2VPYB 4CM2A 4UY8T 4B9TA 3L7OA 3Q24A 3IV5A 3S2HJ 4RBVA 2YX1A 3PYDA 2CQDA 3K7AJ 3MQ0A 3VDXA 2VOPA 3PYGA 4BGDA 2ALYB 4FS2A 4PWWA 2BKOA 4ZVHA 4YDXA 3D3CJ 3IHUA 1Y3KA 4L76A 4OAYA 3BR0A 2K9NA 3FFIA 3WQPA 4R5PA 1A36A 1GXTA 1QRYA 1I3OB 2MD0A 3ETMA 2HVRA 4C3LA 2HWTA 1EV7A 1GDTA 3LL7A 3IBCB 4NCGB 1HDPA 4NA3A 2NVXJ 1GH8A 5CVJA 4A8SA 2FGOA 3NG8A 5FLXK 2VICA 4HV5A 1RTHA 3V4IA 2C3UA 4S0MA 3HT3A 4Z37A 4JI7F 4KPCA 1CC7A 1WJEA 4LUBA 2FRHA 1XCVA 3OWTA 1QUPA 2HWHA 3RW7A 2RQ4A 4EV0A 2F8HA 1Z6RA 3OR1A 2ZH5A 1FEHA 3W63A 2HHUA 5HMYA 3SI8A 1FNMA 1RHUB 1OISA 2MLGA 2DPIA 1KLNA 5GAHJ 3N6MA 3VODA 1Y0HA 1IXKA 2R5YA 4YUDA 2XAFA 4OYOA 4U0YA 4YB5A 3P7NA 4GC7A 3SBMA 3HPHA 2GW8A 1F6TA 3J81j 3H92A 4B9NA 4EUVA 3PJRA 2DH9A 2UUTA 3EXCX 3LP0A 2C1EB 5E3CA 3S1TA 2HBRB 5AT1B 1VBYA 1N52B 3CUQA 5DCMA 2FNPA 3C2HA 1SBRA 4FYVB 3Q8PB 1KC8T 1HSJA 4N0BA 3I0RB 2L48A 4CT9A 2D2WA 4ZVSB 4R8UB 1EKEA 2OF7A 4RAYA 3VYSB 1XIQA 2F5GA 2Q6CA 4FN5A 4HTIA 3HJEA 4LFCJ 5GAGJ 2FSWA 4ZPWR 3M8SA 2D3OR 1P4WA 1UJ6A 2DXFA 1HCRA 2HOTA 1AYEA 3BTCA 2O03A 3MD1A 3OFHA 2V63A 4NA1A 4DV5J 4YG2F 4NXMF 3BZ6A 3GF2A 4M73A 1RADB 1NHKL 3N79A 3QPIA 4WP9A 4C98A 3RJPA 3ILOA 1S0OA 3V5RA 1KR4A 1O3RA 2E1RA 3LGMA 1ZRFA 1O7FA