2IA0A

Transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
156
Chain Sequence
HLDDLDRNILRLLKKDARLTISELSEQLKKPESTIHFRIKKLQERGVIERYTIILGEQLKPKHLALIVLEVGKPEDFLERYISYISSTLSALPGVLFVAKSGEDKIIALVGKNNKDELVKFIEENITSIPNLKHIQIFPITEIKKGEDLTGFLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Transcriptional Regulatory Protein PF0864: an Asnc Family member from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords Putative HTH-type transcriptional regulator PF0864
total genus 34
structure length 156
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia0A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ia0A02
3KCCA 3JAMZ 1FYKA 3SXYA 1ZRCA 3KFWX 4G6QA 2Z33A 2QYOA 2H94A 3I5UA 2KIMA 3BZ6A 2NS0A 1KU7A 1DUXC 2V79A 4GCVA 2DQRA 5JI6A 1RUOA 2CYYA 4ASNA 5ERIA 2P6SA 1TBXA 1MZBA 5TRDA 3SZTA 3RI4A 3CJNA 4WF2A 3T1BA 2VE9A 2Y0MA 2D2WA 2CGPA 2A68F 2BE5F 3BOQA 3J81Z 3I58A 2JRTA 3ZMDA 4UVAA 1SFEA 4BHBA 4KA4A 3CUQB 2OZUA 5E1ZB 1A04A 2LSOA 1LEAA 2VOOA 3J80K 3RPUA 3OV8A 4KT5C 2GIVA 1UB9A 1QZZA 3ZMVA 3ULQB 2LKPA 4LK0F 1ZREA 3F8NA 3AAFA 2BV6A 2NNNA 3SFZA 1FX7A 4KUMA 5J8CA 1ZN2A 3LQQA 4A5NA 3PQJA 5CVRA 2DO7A 2HYGD 2A69F 3IWFA 4HZFA 3R61A 4LLNA 5LEKA 4FT8A 2HGCA 1QPMA 2E7XA 3TO7A 2Z5UA 1ZGJA 5LRRA 5BS6A 3JSOA 2DPUA 4MEYF 1ZRFA 2DT5A 2H27A 3C7JA 3HTSB 2LF8A 2CWEA 4BYYA 3JAMK 1USTA 2GXGA 4O3MA 2VN2A 1B9NA 5CVUA 4G6DA 1FBSA 5DUIA 3GUDA 2H09A 3V7RA 4HAMA 3TOBA 1FP1D 2COMA 1U3EM 2JSCA 3MQ0A 5AIPA 3GEZA 2QZ8A 1J7KA 3DF8A 2PI0A 3DKWA 3WGHA 1YO5C 2HWVA 2MA3A 5H6QA 4ENKA 3LSTA 2PQ8A 3SZPA 1S7AA 1V3FA 1LEBA 5HDKA 4AIJA 4I0BA 3OOPA 1LDKB 4RB2C 2W84A 4EM0B 2XAGA 2X4HA 4AIKA 1FY7A 2O03A 5LHHA 3KE2A 3RDIA 3F8MA 5D8LB 3MWMA 1XSXA 1HW5A 4FHTA 2PEXA 3MZHA 5K1YA 2VT3A 4U7BA 2PMUA 1HXDA 3EDPA 4S05A 2EB7A 3I54A 3LQRA 5DEQA 2K27A 5LEJA 3KLOA 2VXZA 2GA1A 4I98B 3V8KA 5LGNA 1BI2A 2VBXA 1XCVA 1Y0UA 1FSEA 4HW0A 1MGTA 3ECHA 3KP5A 2JPBA 2OQRA 1RUNA 3NRVA 4B8XA 4L9TA 2GXBA 1Z7UA 4AVPA 4WCGA 2W57A 3IKTA 5CVVA 1U5TC 4Z2YA 3L00A 4OMZA 3NEUA 3F8CA 3QAHA 4GYIA 1K7AA 2CQKA 1O3TA 3P9IA 2JT1A 4AD9A 4MQVA 3EQLF 1TNTA 4KMUX 2QQBA 5DYMA 1P4XA 5FLXK 4ENJA 5FGMA 1SD6A 4UVBA 5ICFA 3T8TA 5D5XB 4RAZA 2B0LA 2O3FA 1S6LA 1T39A 2BYVE 1CF7A 4JBAA 2IPQX 4LG0B 3E6CC 1BI1A 1FP2A 3M1EA 2E1CA 1AOYA 5LRSA 3KEOA 5HDNA 1BIBA 3LA7A 4L0ZB 2YU3A 2JSXA 2ZJ2A 2Q2EA 1FT9A 1F1ZA 4YFKF 2DK8A 2EV6A 3HSFA 1W7PD 3FXUA 1KQ0A 2UXXA 3S2WA 3WTYC 2FOKA 1GXQA 3KZYA 1BJAA 2RVCA 3GW2A 4A0ZA 1U5TB 2EV5A 3COAC 3M8FA 3TKYA 3BPVA 3CO6C 1OYIA 3F8FA 1S29A 4WK8F 2FEZA 3Q9VA 3BY6A 4R8HA 1S3JA 2ESHA 1IRGA 3CTAA 2MBFA 1KGSA 2HTSA 3T8RA 2CG4A 1R23A 2VBYA 1MJ9A 3R0AA 3BROA 5D5VB 5JHUA 5HLIA 3J80Z 4P5OA 4KIFA 2W25A 1TW3A 3Q5FA 1P92A 1BC7C 3W6KB 4UHTA 1FNNA 2KJBA 1J9IA 3QP6A 2STWA 1Z05A 4XSZF 3QOPA 3BP8A 3R6SA 3C3WA 5K5RA 4HLYA 4WXHA 2F2EA 1L0OC 3IRRA 2YPRA 3M9AA 2UXNA 1G4DA 2DBBA 1BI3A 3F6VA 3JTHA 2P8TA 3ML6A 4OIOF 5BPIA 4MGRA 3H92A 3KP4A 5E18F 3ZMTA 3ZMUA 4OIQF 1EV7A 2QVOA 1H9GA 4HA8A 3MZYA 2DW4A 2RV8A 3FWEA 2K86A 4N9HA 5KK1A 5A2QK 2K4JA 4KIBA 3FM5A 4U0WA 1H0MA 3TDUC 4CHUA 2HFHA 4MEXF 1XSVA 5ICEA 3I64A 1YQAA 2ZFWA 1W7PB 1O7FA 5TJJA 3T5XA 1G3TA 1G3WA 2ADUA 2HTJA 4FX4A 1FYLA 4EJUA 4EJTA 3P7NA 3C1DA 2AXLA 5FO5A 2FE3A 2F5EA 4G9YA 5L3CA 4HF0A 4YFNF 1IN8A 5DD4A 3GXOA 1XGOA 2PLYA 2OD5A 1FPQA 1XN7A 1YW9A 3DFGA 4M74A 2AS5F 4OIRF 2FSWA 1ODDA 2DU9A 1BOAA 4RGUA 3EUHA 4IRHA 5FLXZ 2RDPA 3TGNA 3LWFA 3N97A 2J5OA 4K2EA 3J7AO 3I0TA 1XGMA 1TQMA 2QQ9A 2CW0F 2F5CA 2WTEA 3FF5A 2XIGA 4U0VA 5D6EA 3ELKA 4Q48A 4YG2F 2L01A 1I1SA 2RC4A 4EV0A 1VTNC 3DV8A 4P9FA 1R1VA 2P4WA 2OQGA 4LFUA 5D4SA 2XAJA 4KNYA 4WXCA 1FOKA 3DPTA 1REPC 5K5OA 1IXRC 3LAPA 4ESFA 4UVCA 5DCMB 5LBQA 2ACJA 1MDMB 4HQMA 3CUOA 2Z4PA 3N4MA 1FBQA 3D5LA 1W5TA 4UNOA 5ILVA 1D3YA 1XGNA 2XKPA 1OYWA 5BMZA 5DUKA 1Z9CA 4A2UA 1E17A 1X3UA 5IT3A 2FNPA 1E2XA 4G8XA 4BHCA 1NHAA 4M72A 4HX7A 2GAUA 5HS8A 1JGSA 1ZLJA 2QM3A 3WTUC 3J81K 5LGUA 1WKMA 3K1NA 4G94A 4IPAA 2JZYA 1J2XA 5AONA 1ZAOA 1F4KA 3E6DA 3V8LA 1R7JA 3KP7A 2QLZA 1SMYF 2VT2A 4HF1A 1ULYA 2ETHA 3KZZA 5DDGA 5HLHA 4CXFA 1R00A 3I59A 4BXUA 2J5PA 4UXNA 4CICA 2ZO4A 2FA5A 3HOTA 1IZ1A 4BAYA 4HOBA 1EH7A 1WI9A 2IA0A 5IT9Z 2W85A 2BGCA 2ZBKA 2ZCWA 5DCFA 3REOA 3KP3A 3TO6A 4NHJA 2IT0A 5D5WB 4YIIA 3GF2A 5E1WA 5E1XA 2DK5A 4LJZF 3WGGA 5L3BA 2HDCA 1R1TA 2A61A 2M30A 3E3VA 4WWCA 1D8KA 1BN5A 4HLXA 2FBHA 2HKOA 3D0SA 4BQAA 5LHGA 2F5DA 3F6OA 1R36A 2MH9A 3GLXA 1D5VA 3G3ZA 4P96A 4RAYA 2OZ6A 2KKOA 3F23A 2A6EF 4ZH4F 2FU4A 2ISYA 1P2FA 2RNJA 5ICGA 3MCZA 1STZA 2G7UA 2VE8A 3I71A 4EM1A 3ZP5A 1IW7F 2OAZA 3E6MA 4GO1A 4N0BA 4EJVA 2XVCA 3R0JA 1BI0A 1O7LA 3CO7C 4AWXB 2DFIA 5E20A 1HKSA 4ESJA 4KIGA 4KN7X 1QQIA 1KQ9A 3GVAA 1PDNC 4PDKA 5CVIA 1MJBA 4U0YA 3QP5A 1J75A 3CLOA 2BEOA 2BBYA 4Y15A 1Q1HA 4LLLA 4MNUA 2E1NA 5HLGA 2O8XA 1J5YA 1FC3A 4RB1A 1IF1A 1K78A 2L4AA 2C6YA 1P4WA 3F22A 1H9TA 3KEQA 1O57A 2QBYB 4HV6A 1B1BA 4RS8A 3VOEA 1LDDA 4GXOA 2A6HF 2ESNA 3ABTA 2EFWA 3I53A 2EA2A 3HOSA 3L7WA 5EEGA 3DXJF 3F3XA 1LNWA 2ZMEB 1FSHA 2X0LA 4EGYA 2V1UA 4HF2A 1HSJA 5FFXA 4U7DA 4EGZA 2H6CA 3HRSA 3K2ZA 2A07F 4OOIA 5CJ9A 4I2OA 4JK1X 2STTA 1FWZA 3HIFA 1J0RA 3GZ5A 5JVTA 2QUFA 2H6BA 3MFKA 2P5VA 4BH9A 5L3EA 2VODA 3PFIA 1Z1DA 1ZGAA 3E5XA 4TV7A 4M9XA 1OYYA 3KP6A 4S04A 1U6GA 1G6NA 3F21A 2XAFA 3H3ZA 3U2RA 1LQ1A 4XBFA 4A0YA 3QU6A 3SQNA 2ZKZA 4I09A 3W6JB 4B09A 2M1BA 2FMLA 3QPHA 3L9FA 2FBKA 4LK1F 4HDUA 1JE8A 2EJRA 2ZBCA 2MLKA 2D1VA 2WWYA 5IT9K 2L4MA 5EEHA 2EFQA 2ZNYA 1WSUA 3L2CA 4F7ZA 3IHUA 3V7CA 3HSEA 1RZ4A 4KYWA 3B73A 2TDXA 2W24A 1ZH5A 2EK5A 3MAJA 1IRFA 2DPDA 2XKOA 3V7SA 2PMHA 3KP2A 4QLCU 2Z9OA 1I6XA 1XD7A 5BOXA 1YYVA 2GQQA 4UV8A 1MD0A 5FD5A 4U88A 4UV9A 2M87A 4E70A 2VOPA 1IXCA 5FD6A 4DQ2A 2O0YA 3WTWC 1IN7A 5HOOA 5DCMA 1B4AA 1RI7A 1TLHB 3DP7A 5AIQA 1XMKA 4L9JA 4P55A 4CGZA 5KVRA 3G73A 2XRNA 2F5FA 2RGVA 3WU0A 3ZN1A 4JQFA 2VONA 5JFRA 3KLNA 1K79A 4CZZA 1OR7A 3QRFF 1KA8A 5D8KB 3F8BA 4PGHA 1HSTA 1B6AA 2ELHA 4Q47A 4ZYGA 4OINF 4EJWA 3L09A 3P9CA 2QWWA 3BDDA 2NAZA 3K0LA 3WE3A 2A5YB 2EA4A 1B9MA 1OMIA 5E8IA 1TQPA 3LA3A 3FMSA 4Y17A 2L02A 2V6CA 3WE2A 3FZVA 3K1PA 3I59B 1USSA 3RKWA 3VODA 2FBIA 1IN6A 1XCBA 1Z91A 2IVMA 5HS9A 1T98A 5LHIA 2V9VA 5D4RA 1L3LA 1ZARA 1YS6A 4UUVA 3VB2A 1OPCA 2VBZA 3ERED 1W7PA 4IVNA 3GFIA 2DJWA 2QENA 4PZJA 4G7HF 4RB0A 3CUQA 4QWQA 5LGTA 3GFMA 3GZ6A 1XGSA 3GFLA 2OU2A 2E1AA 2FF4A 2KRFA 4KFCA 4ZYDA 1JHFA 2JTVA 3RIRA 3O2PE 2RN7A 1BIAA 2DTRA 3IWZA 5BQTA 1BM9A 1QNTA 1YW8A 5HDGA 3ZMZA 2XAQA 3V4GA 2LF7A 3M7GA 5A2QZ 1FBUA 5CVJA 4KDPA 4YIFA 3QPTA 1SFUA 1TQIA 2P7VB 4P9UA 3FM3A 4PGGA 3ZQ7A 3WTVC 4CYDA 2ZNZA 4I7HA 2NRAC 3JSPA 4NB5A 4NQWA 4G7ZF 4A12A 2K7LA 4HBLA 1TTYA 2CO5A 1S7OA 1SAXA 2HR3A 3FHZA 2IP2A 2WV0A 2K4BA 1XMAA 2EFNA 4IRGA 4L18B 2FXAA 3C18A 3E6BA 1KYZA 1PP7U 1YFHA 1EH8A 1RIOH 1GVJA 2XAHA 5ED4A 2FMYA 2M5WA 2ISZA 4XLPF 3NQOA 1FZPB 1G3YA 1BBYA 3U1DA 1AWCA 1P4AA 1PP8F 3U9GA 3V8JA 2XROA 2VC0A 2ZXJA 4AIHA 4KICA 3IC7A 4N9IA 1ON1A 2ZMEA 1YLFA 1U2WA 2HZTA 4ZYEA 4GGGA 1T2KA 4M73A 2K02A 3LA2A 1FYMA 2GA2A 3GYHX 3T0YA 2CSOA 3HHGA 1LB2A 2R3SA 3HUGA 2MD5A 4ENNA 4ESBA 1UFMA 2Y75A 1HKQA 1UHMA 4MTDA 4LB5A 1SD7A 1ZG1A 1WWXA 1O3SA 1YW7A 1IN5A 1IUYA 3KETA 2Z99A 2M45A 2P5LC 4XSXF 5J8FA 4EMSA 3CDHA 1CGPA 5E17F 1ON2A 4OMYA 3R60A 1XSDA 4BHPA 1DDNA 2DQLA 1KU3A 3WGIA 1U5TA 4A0XA 3MEXA 3SHFA 4R79A 4Y13A 3TDZC 5F6FA 4GYGA 1F5TA 5JR3A 3BJAA 3FX3A 2HYFA 3K9TA 1QBJA 2HEOA 5BPDA 1JHHA 2Y48A 4L9NA 4WX9A 1XB4A 3M8EA 1KU2A 3HYIA 3JTGA 5L3FA 1F9NA 4M9ZA 3ZPLA 1QO0D 1ZLKA 3QU3A 2DLLA 3FMRA 3RTRA 2XHKA 2FNAA 3HRTA 2CVIA 2GWRA 3ABUA 4I02A 3IKVA 3E5QA 1GXPA 3R4KA 5DV5A 4HQEA 2D45A 2NYXA 3RYRA 4ON0A 3ROUA 3GFJA 4ZZLA 2V1DA 4YFXF 2V1XA 1J59A 4L5JA 2G9WA 2Q0OA 2XGXA 4M6YA 3RYPA 1CF7B 4M9SA 4EJOA 1DPUA 4CDGA 1MDMA 5D6FA 2Z3YA 4HX8A 5HS7A 4PCQA 3Q9SA 3TO9A 3BWGA 4XRFA 4RGSA 1R5GA 2Q8KA 5H6RA 5DD8A 5ILSA 1DP7P 4O6JA 2A3SA 3HHHA 1FLIA 2DI3A 4ZYHA 1YG2A 1EH6A 3GO5A 4LB6B 4L5IA 1HBXG 4MTEA 1LVAA 2QQAA 4G7OF 3JW4A 4MQ9F 4LD5A 4HV5A 1SMTA 4LG0A 3E5UA 2R7DA 4DNCA 1KQ8A 3WTXC 5D5UB 4LLGF 2PN6A 1U8RA 2OBPA 2IA2A 1DPRA 2HOEA 4A6EA 3ZN0A 3E97A 4IHSA 1S8NA 1I27A 4XLNF 3EYIA 2VBWA 1XDUA 3RPQA 3ISPA 3WTZA 1GHCA 2HQNA 3GWZA 3LFKA 1I5ZA 1C0WA 1I1GA 1K6OA 2UZKA 2IW5A 3WTSC 3I4PA 1V4RA 1O3RA 2D1HA 4D0PA 1MJAA 1QZYA 3DPLC 4A5MA 3H3UA 1W4MA 3O3KA 2L3DA 2P6TA 2KJCA 1SD4A 4BNCA 1QGPA 4O5VA 1ZRDA 1ZHFA 1O3QA 1K78B 2NNYA 5ICCA 5K5QA 2YX7A 1R1UA 2FQ3A 2XASA 3TQNA 2HS5A 1PUEE 1G3SA 2R7FA 4HYEA 1ZG5A 1JXSA 1Z6RA 2OA4A 1W5SA 2EFPA 5E8GA 4ETSA 2PFBA 2L54A 4LMYA 4EM2A 2LNBA 4IRIA 2JPCA 3DQVC 3LAJA 1R5HA 2WC2A 4IJAA 5FB2A 1TW2A 2DAOA 4KN4X 4H0EA 2G7HA 2FRHA 2CFXA 1D8JA 4IHTA 3B02A 2YSRA 1IAWA 3ZMSA 4MHGA 3WG9A 2M8EA 4HDVA 1ZYRF 2YR2A 3BPXA 4M71A 1YS7A 2EWNA 2EV0A 1HQCA 3K69A 5FFZA 5H20A 1YIOA 1ONVA 1BC8C 2PJPA 3O6BB 3RKXA 3WODF 1SFXA 3RKYA 4KMFA 1T6SA 5L3DA 3HRMA 4L9VA 1Z6TA 1U78A 5F64A 4WXDA 4OU0A 3EETA 4CO8A 4Q4ZF 2MC3A 2QBYA 4L0YB 4I0AA 5HVQC 4IXAA 3CUQC 2VC1A 3VEPA 3HRUA 2P7CB 3HSRA 2KIFA 1LDJA 5ILUA 2RKHA 2O6GE 4ZZDA 2LDUA 2MH2A 4HX4A 5CLSA 4RGXA 1MKMA 1YTYA 3DEUA 4LGWA 3VFZA 3BJOA 3WTTC 2MLGA 3FXQA 2PG4A 6PAXA 3EYYA 1UCRA 2EFOA 2XV4S 5L3GA 1XDSA 4A6DA 3F72A 2HQRA 1T0FA 1KU9A 3K1MA 2O61A 1OKRA 2IRFG 1HKTA 4IF4A 3BJ6A 2XUBA 3TOAA 1R58A 1UHWA 2KIUA 1IXSB 1R22A 2RQPA 3FMQA 4OIPF 3P9KA 4R1HA 2GZWA 3PQKA 2IJLA 1T38A 1LJ9A 1WQ2A 2P5KA 2YX4A 5J6XA 1P6RA 1KYWA 3FXRA 1SD5A 1RNLA 1WRJA 3IL2A 2HKXA 4EVIA 4Q5SF 4EQQA 4RB3C 3IRQA 5CYVA 1TNSA 1HW2A 4FX0A 3WU1B 4I01A 2IA1A 1HW1A 4RGRA 3HTUA 1ZG3A 4M6XA 3ECOA 3RJPA 2PBIA 5LLQA 2UWMA 3GX4X 4ENMA 5F1RA 2E7WA 1B59A 1IN4A
chains in the Genus database with same CATH superfamily
5CKTA 1W7WA 3SXYA 5M5XJ 2AXTC 1B0VA 3GSDA 3TZZA 2RH3A 4O3NA 5D77A 4ZHRA 2JJ4D 3KUHA 3N6NA 2V63A 1PBAA 1KU7A 1DUXC 2ZE2B 2H1KA 2V79A 2ZFHA 2DQRA 2J7UA 2M7BA 2YWKA 4I1TA 2R7UA 2V6EA 2DMTA 4NMLA 2DYSH 4H54A 1MMAA 1C4CA 3BPSP 1TC3C 3D2WA 4DQSA 1DTQA 3PNYA 1MZBA 3T5KA 3T6BA 3H59A 1F36A 5I4MA 3T1BA 4WF2A 2MKSA 3D6HB 2B9WA 4Q44A 4ZIWA 5E0OA 3T5JA 1UG2A 1YE9A 1UWBA 1IO2A 1VQ8I 5H2FC 1Q81T 1OO0B 4A3DJ 1L3UA 2HQ3A 2VQCA 2LA4A 2OV7A 2LY2A 3HFZB 3J7ZI 4UVAA 4A3CJ 4PG4A 2VJIA 3VALA 2O8KA 1TL7A 2BY0A 2H3EB 5K9FA 2P9GA 1YWXA 3MHYA 4MKYA 1RBOB 1B0PA 3IV5A 3G8QA 3BQ2A 2VOOA 4Q2LA 2OP5A 4CIOA 2NR0A 1HQUB 3OSGA 3RPUA 3DRPA 3CCSI 1C0UA 4QPOA 4LF6F 1PC4A 1A6IA 4PKDB 4TN2A 1XMQJ 1M5OC 1UB9A 4IDKA 1QZZA 1IKVB 3ZMVA 4E7IA 3PRVA 3ULQB 1A6LA 3BG9A 4O44A 3GLJA 3AAFA 2ECBA 1OFCX 1AZSA 2BV6A 3PJ9A 3ISND 1K4TA 2FTRA 5J8CA 5DTDA 1ZN2A 4A5NA 4FP9A 2VFTA 3PQJA 2D7SA 5KFKA 1YVFA 3AD9C 2Z2SB 1D0ZA 1ULRA 3E51A 5LEKA 3FKJA 3CIMA 5T41A 5H1SV 1BR4A 2RKIB 5J2QB 4KO0A 2E60A 2Z5UA 4HDGA 1N48A 4KIAA 4PJNA 5LRRA 4HACB 1FESA 1ZRFA 2FZCB 1CBKA 4IQJA 1Q95G 1MSWD 3HTSB 4IHXA 2LF8A 4N47A 1O51A 3S1MJ 2XO6A 3OTBA 4HRIA 5J1PA 2HGLA 4S0HB 1NHVA 2QMUB 4QPXA 1ZZNA 1AUSL 3JTPA 2IRUA 3KMQA 2QSGX 4ZVEA 5F41A 5ETSA 4G6DA 3RRHA 4ZVQB 4LF9F 2OTJS 5DUIA 4FDFA 1JMTA 1YBTA 1WTBA 3TOBA 4RUBA 3VR1A 5E79C 3H35A 1SVOA 2COMA 4DX8H 3B78A 4NLQA 1YJVA 3EPZA 2VJVA 3MECB 2KQRA 2OPTA 1FRIA 3DF8A 1V5EA 2PI0A 4KITB 5HVGA 1VRQC 2HWVA 2B4UA 2EBIA 2JVHA 2B9SA 3FXMA 2BA9A 1NM2A 3EGVA 1T94A 3PNIA 4ZIVA 1V5VA 3B8HA 2X6WA 3DLEA 4J9RA 2VDHA 1FMWA 3M2RA 2N8GA 2NXUA 3C6UA 2ZBQA 3H40A 4AU7A 2HMIA 5HQMA 3GTJJ 4II2A 4WK3A 2K3FA 4G1PA 2KHDA 3CJ5A 2LEPA 3TZWA 3BKFA 3H5NA 3MZHA 1QE1A 4DMZA 5K1YA 3ZZUA 3G8TA 2PMUA 2TCTA 3D66A 3LQRA 2BE7D 4CM2A 5DEQA 2R7OA 1ERDA 1DRZA 2K27A 3KLOA 2BKNA 3L7UA 3G71S 4ILMA 1RWKB 4X4VA 3O8WA 2K9MA 5L9NA 1XNQF 4KYZA 4RBUA 2Q6BA 1BGXT 1JNRB 1JUMA 5JUMA 1K1SA 1GVDA 4B8XA 5FLMJ 4KT0C 4L9TA 1Z7UA 4W97A 1DJ0A 2D5VA 3BB5A 3TWZA 3IKTA 2HVHA 3DBRB 1U5TC 4DR7F 5L39A 1IBLJ 3NEUA 2UXDF 1U9OA 4GYIA 2GVDA 2BQRA 1I50J 4C3KA 2X48A 3GIMA 4F67A 4CH0S 3P9IA 4BDYA 1PIEA 2XQCA 2XY5A 1CJTB 4DIQA 4PEOA 3A8EA 4AD9A 2M3AA 2QSFX 3CCWA 2WAQD 3UWTA 2MDAA 3BDPA 2ROPA 1P4XA 5FLXK 4ENJA 1SD6A 4UVBA 5D5XB 3R3TA 2I2YA 5F8JA 4RAZA 1AU7A 3HHKA 5SZTA 2IM0A 5KT2A 1NDPA 1HBNB 4JBAA 3HP6A 2W9AA 4JV0A 2E1CA 2ZHAA 3KWMA 1WJ5A 3CJ4A 3UR0A 4FN5A 3ET6B 3NBPA 4HT7A 3KK3A 3BJYA 2ZBPA 2XEXA 4C48A 2QT7A 1HIYA 2CKWA 4RNMA 2EV6A 3TEDA 2POKA 3BR3A 1RWXB 2R8HA 1NPRA 2PX9A 4HYKA 1I51B 4EUVA 1RAFB 3S2WA 4FQGA 2FOKA 4GDFA 4N77A 2X1CA 3EX7B 5JVHQ 3TAPA 4JOMA 1U5TB 4X4SA 3PRDA 1Y7PA 1ZA1B 4XLFA 4CLWA 4WBFA 4RBOA 1G3OA 3NNCA 2MMYA 1OYIA 2KRRA 4F50A 2DY1A 3OIOA 2CU7A 1VLOA 2BE9B 5KG7A 2NCKL 5KFLA 3M6VA 4HHHA 4PXEA 3BV8A 3J7Z5 1QY7A 3T8RA 1KGSA 2HTSA 1TUGB 5DLFA 1R23A 2VBYA 1MJ9A 1U1RA 1RTZA 3PX0A 2FJAB 4IH7A 5D5VB 4A3MJ 5HLIA 2ZUAA 2LA6A 3TARA 1G7CB 4KIFA 1VRTB 1EIYB 2D3ZA 5KFIA 4F3MA 2CQQA 2JLEA 4I2PA 2DHSA 3IC1A 1J9IA 1F1BB 3HKZN 3BQ1A 4XSZF 3BF4A 3BP8A 4XL9A 2PJRB 1KHVA 3C3WA 2HVEA 1GV5A 5K5RA 2P9CA 3JYTA 3BGRB 1L0OC 3M30B 5GAEU 2E5GA 4MJKA 1JLFA 2OPSA 1EARA 3BGUA 3TUPA 1K8AT 4LFCF 5F0CA 2P8TA 1QJHA 4OIOF 5BPIA 2BW2A 1LW0A 3HT3A 2KZMA 4M5HA 3R6LB 2FVQA 1WEXA 1K1QA 2LXIA 1RHKB 4L3KA 4E2FB 1UVIA 4BBRJ 1LWXA 3D3BJ 3M7VA 1U0HB 4HA8A 3OWTA 1PGZA 3QRQA 4WXOA 2RV8A 4ZCLA 3ETMA 4IKAA 1D1UA 1HNXF 1VRUB 2VPRA 1VI0A 3KNAA 1S4EA 5FJ8J 4DR2J 5KK1A 4I7FB 1QA6A 2DGQA 4YR0A 2XZWA 2CPDA 3PYEA 3FM5A 3S1TA 1C0UB 5EEAA 4U0WA 2XS2A 1RTHB 1FNMA 3OYMA 5J2PA 1MNEA 1T7PA 5A0YB 2HFHA 3IGNA 1OYEA 3MPWA 4QIWN 3M8WA 4OZ0A 4DUYF 1HQEB 1W7PB 1XN9A 4DWIA 3TW7A 3WHCA 3GTPJ 4RM2A 1UEVA 2D74B 2CJKA 3DDNA 4PWUA 1G3TA 3CO0P 1FYLA 2GXAA 5LSRA 1XQIA 4JV1A 3R5DA 2XY7A 3H8YA 4HT5A 2EILH 3M8YA 1WUUA 3LSJA 3CJQB 3FQKA 1NRKA 1RP5A 3SFGA 2VJJA 3DXSX 3UN3A 2GOMA 1RK8A 2W7NA 4ZPVR 1XN7A 3NCPA 3H3VK 2MQLA 4LIUA 1ODDA 2LKXA 4RGUA 4KAIA 2R4GA 4JI5J 4IRHA 1EETB 3RTVA 5FLXZ 4Q8EA 1DTTA 2JL9A 3KHRA 3DBLB 3TGNA 3M1CA 5CCMA 4OYOA 3N97A 3GZNB 5IQQA 1KS2A 2QQ9A 3DLKA 4C2MJ 3C66A 1F5BA 2F5CA 1FRHA 3TYTA 2DA1A 3ZZPA 5D15A 3NMRA 5KFHA 5K7HA 4ZOSA 1UETA 2RS2A 4Q48A 4O0NA 1RHUB 3SYZA 2KI2A 3G6ES 3JAMU 5KG0A 2MGZB 2V50A 3UNYA 3HGGA 4J01A 3OHAA 3DV8A 4P9FA 1R1VA 2OQGA 3OYLA 1U49A 1S1WB 2V2ZA 4Y33A 1T33A 2FX0A 3A3OB 2AZ1A 3FUYA 1H74A 5K5OA 3CPWR 3RSNA 4DS4A 3LAPA 4UVCA 3S3NA 3GBGA 3KIOA 4BJ5C 1TKXA 5DGAA 3HBLA 2HRTA 4ZVOB 1K4SA 4KH0B 4RNHA 3DLGB 1F5AA 4M8LA 4F0MA 3CCMI 1RAHB 1RDRA 2IC3B 3PX6A 4JI7F 2B7CB 1HWKA 3BC8A 2FZKB 3D5LA 3HVWA 3POTA 1JXVA 1D3YA 2FGOA 2R7WA 1OYWA 1GMWA 2EI5A 5DUKA 1Z9CA 4A2UA 4WFXA 2AJFE 1E2XA 1HNWJ 4G8XA 3LSGA 4M72A 1X5TA 2HQDA 3CO9A 2QM3A 3WTUC 2VG5A 4QIWD 1Q7LB 3Q8SB 1XWLA 3HL2A 4YQWA 1J2XA 2DR8A 2A6MA 3E6DA 3FFIA 4EWTA 3V8LA 3KP7A 1LV5A 2L48A 3CLQA 4M5GA 2UP1A 1UHSA 2VT2A 1S6PA 4HF1A 4W92B 2AT1B 5H9EK 3EUNA 2HK3A 3A3NB 3P6YC 4DQIA 5JHFA 2ETHA 2DR5A 3SSQA 2KMUA 2ZJQF 1J27A 1BQXA 3GQCA 2YKMB 2XLJA 1RACB 3R5JB 3TX8A 1S6QA 1MW7A 1JJ6C 2BQ3A 4AFFA 5AT1B 2VF3A 2W2PP 1SBRA 4XDCA 4N41A 2W85A 3GR0A 2ZBKA 2ZCWA 4HSRA 2CJJA 5TISC 2QIFA 3C15B 4NLWA 4EATA 2FGCA 1R6RA 2ZE2A 3HLUA 2VFUA 4OX7A 2DPIA 3H9GA 1FK9B 2RF2A 4MT1A 4B9TA 2CQDA 1R1TA 3N9UC 4IHWA 4ETZA 1DP3A 3MMBA 4J19A 1U1MA 2FBHA 5JMNA 4EYIB 3Q8UA 2E7VA 1Q7YT 1WH7A 3RZDJ 4FVCA 2WZ1A 4AM3A 2MH9A 3GLXA 4PSWA 4RAYA 4DPOA 5LL6d 3HPGA 1FTTA 3CCQS 4DW6A 2YKAA 1JNZB 2DEJA 3PJWA 2KZGA 2XAUA 4RW6A 1MU2A 1GXUA 4HACA 5GP9A 3MCZA 1U0SA 2VE8A 2B5JB 2Y2ZA 3DRSB 4EM1A 1MBHA 1V54H 4J9VA 2YWWA 2MZTA 4XKCA 5KAFC 1U26A 3CMYA 2ILYA 1N8RT 5L1JA 2DMNA 1VQSA 1UPPA 3S16J 4N7TA 5GMDA 1O7LA 2UVVA 1HNVB 2VQGA 5EX3A 1RT3B 2AGOA 1HOMA 1MJBA 4YB6A 3TW0A 2RS8A 4U0YA 3QP5A 1YJNI 5DG9A 3KKFA 4PSXA 2ZEJA 3QBCA 1KTQA 3CLOA 5E3AA 4C8ZA 2HFSA 5AE1A 2QL7B 1HDPA 4USUA 1WHWA 2LP4A 4LLLA 2GM4A 2PFFB 5K8NA 1YX2A 2VFRA 1J5YA 4OYPA 4A93J 4NL5A 2GHWA 1YSJA 1IF1A 3BG6A 1APSA 2PIIA 3EICA 4E7SA 2ZBIA 1N36J 3C6UB 2F8MA 1VBXA 3Q3SA 2WAEA 2C6YA 2KRBA 3PRBA 2B9XA 3EGWB 3FEZA 2QBYB 3AAWB 3CP8A 4HV6A 4RS8A 2VKHA 5EX0A 4QIEA 5A8RB 3AT1B 3ABTA 3P96A 1MH3A 2EKNA 1IQTA 5EEGA 3F3XA 3DXJF 3X1LB 4C11A 2E5LF 1FSHA 3L2QA 2DRDA 4XOPA 1TTHB 3UO0A 4LQ9A 3KK2B 3RAMA 4FS1A 4ZITA 1OQYA 4FXWA 3FKIJ 4BJ6C 3CJTA 3HRSA 3QPLA 4JK1X 3CC7S 3O3LA 1ZOTA 3VSKA 3OTOF 4OLOA 1WI6A 2EPFA 3MFKA 2ELJA 5L3EA 1KONA 1P6TA 1WOPA 5LD2C 1Z1DA 3CZ6A 2OPRA 3GJTB 1HI0P 3E5XA 4M9XA 5C25A 4ELVA 1WJBA 5BYQA 2CXEA 1WPKA 1IKYB 4CCLA 3IRXB 1VF9A 3H3ZA 2HMIB 2VH7A 3HVAA 3G4SI 4XBFA 2HVRA 2AX0A 3KK1A 4D5CA 2DA5A 2AEFA 1R89A 2V4JA 4DR2F 5CYMB 2M70A 4ZPCA 5IT9Y 1Z3YA 3MKZA 4LK1F 3PM1A 2EW9A 4HDUA 2EJRA 5IT4A 2ZBCA 4U96A 1WJ9A 3NLCA 2CQ2A 2BY3A 5FLVA 2L4MA 2VB6A 2LH9A 1DURA 2CDQA 1X2MA 1CULA 2RUGA 1IBMF 3ZQGA 1VGYA 4LG3A 4K2JA 1WD6A 1MWYA 3V7CA 3VPRA 4ED2A 4L75A 5J1EA 2V1NA 1RESA 2MSTA 3K4KA 3L1PA 1RT4A 2EK5A 1Y3KA 3K4BA 1T9UA 1BHNA 2C2OB 2PMHA 1TR0A 4I0WA 5LSLA 1L3SA 1Q4RA 1NSPA 1RPWA 2Z9OA 2E5LJ 3AL0C 3ENWA 3KHGA 5KFFA 2Y1LB 2ZZNA 2A6OA 2XSJA 3ZQIA 5EN1A 1VC5A 3DOKB 4DR6F 1NK4A 2XGEA 1BW5A 4HNVA 3BREA 3VV2B 2O5RA 2H4WB 1IN7A 3GE9A 2H4YB 4G12A 1FFWB 5AIQA 3CCLI 1Y0NA 4P55A 1EP4A 2IIHA 2W2OP 2D41A 2B56A 5HANA 2QKLB 4C3HJ 1Y11A 1SVLA 2O3DA 5KFCA 2RGVA 2P2CB 2GJ2A 3WU0A 1KR4A 3US5A 3DLLQ 4JQFA 5C24A 2VONA 3ZQHA 3KLNA 2XI3A 5F8IA 4K5SA 3QRFF 5D8KB 4K2XA 5BNGA 4PGHA 3MM5A 2OJED 1HPZB 4M3BA 4RW7A 4UW2A 1B6AA 3ZQCA 2OELA 3KLEA 1DGRM 4OINF 4EJWA 3HDDA 4DFJA 4LBPA 3MZIA 3DLBA 1YIJI 4KRWA 3HZEA 4MLOA 1P9YA 2CQBA 4K4XA 2AQEA 2XSFA 1B9MA 1VQLI 3NGKA 2OTLS 5FD1A 3CJKA 1NO8A 3ZNUA 1Y1WJ 4DX5A 3CMAS 3FMSA 1MH4A 3I5BA 2L02A 3WE2A 3JS9A 3MEGA 2DA2A 3KJVB 2DNMA 2RQCA 3RKWA 3GLLA 2FBIA 3N05A 2IJRA 4WKYA 2IVMA 4X0GA 2GMJA 3JSBA 4M5JA 2MKYA 3I5CA 2IBOA 3DOMB 4HHUA 3BZCA 3NMAA 1ZARA 4IHYA 1UVKA 5HO4A 1YITI 4OX9F 3K5OA 1X4BA 1OPCA 2DA4A 4PPDA 3ERMA 1TT5B 3ERED 1NZ8A 5CPRB 1JLQB 4A47A 1VC0A 2ZM6J 3QWPA 4PZJA 1IGNA 3PYGA 3MAHA 4RB0A 4WIIA 3CUQA 2ZM6F 4CLZA 2IM3A 2OU2A 5HAOA 4XR6A 2PGCA 1U6BA 2ZC2A 3FBEA 2L9NA 4MIAA 4I56A 3PCOB 4U7UD 4I2QA 2DO4A 4DL4A 1F2GA 3CDWA 1U02A 1S1UA 2CRGA 1JLGB 4DL2A 1Q1VA 1FF2A 3RIRA 3CIZA 3O2PE 2OPPB 2AEJA 2DTRA 1BM9A 1OMSA 1WOSA 3WHIA 3ZMZA 2R9LA 2ZJQQ 1KEKA 1IXKA 2YKNB 1ACMB 3V4GA 2DFEA 2E2JJ 4NWBA 1ZETA 1CJUB 4A8SA 1TUWA 4A48A 3U02A 3W2WB 4A3GJ 4WWSA 2BKPA 3G86A 3H5RA 4KDPA 2HQCA 1YZ6A 2FJEB 1Z21A 3RAQA 1DU0A 3QPTA 3KLGB 3HZGA 1FDAA 1VS3A 1HBUB 3T9NA 1FHTA 1S7IA 2YNHA 2YH0A 3FM3A 4L74A 2QYGA 4A8QA 2ZD1A 1DQ8A 2Y30A 2PE8A 3G82A 4CYDA 2NLWA 2LTPA 2MY8A 3FEXB 2MQQA 2C2KB 1HD1A 2K7LA 3HFVA 1JLAB 5E3QA 3J7YJ 1DAXA 4Y2MA 3FHZA 2K4BA 5FRMA 1XMAA 1Y8QB 2EFNA 2DN0A 5HI7A 3D4JA 5HJYA 5F0FA 2FXAA 3S1RJ 3E6BA 3I3LA 1PP7U 2FZGB 1RIOH 5ED4A 4LRBA 2WTFA 3P5TL 2FMYA 3NQOA 3A1YG 4C6AA 1BBYA 1G3YA 4P1WA 1PP8F 2EVZA 2XROA 2G0CA 4ZLPA 2B6AA 4B47A 1WHUA 5JLWA 4XKWA 2UXBJ 5KG3A 4JI8J 3CGIA 2FC9A 4C11B 1NHKL 5B5EC 2RU9A 3V42A 3EJMA 4ZYEA 4LREA 3SDBA 1TL1A 1LK7A 4WP3A 2EFGA 2ZOFA 2LY9A 1FYMA 3GV8B 3GIKA 1RR7A 4IFYA 1JLBB 1FVSA 1TWCJ 4OI2A 1ITPA 1G2HA 2G2OA 5GVQA 3T0YA 1HCRA 2ADCA 4FYWB 2AJ1A 2JA2A 3H42A 4WIQA 1VBYA 3HJEA 3JTOA 1KQFB 3I0RA 3M1VB 4F02A 3HVTB 4M1KA 1HKQA 3UDLA 3EGNA 4PWDA 3BG3A 2CJAA 2ME0A 5CH7B 4RNOA 4NASA 2XF5A 4RLQA 1IN5A 1S1VB 4I76A 2ZSIB 3TZXA 2MSSA 4IUFA 2ABYA 2BDPA 1SKSA 3SFIA 4DG1B 1VQ4S 4RDUA 2VIHA 4XSXF 4S0MA 4PAAA 5J8FA 2LVWA 2F6CA 4LF5F 2GIRA 4NI2B 3CDHA 4Y2KA 1ON2A 2AGQA 3SSRA 3S32A 2DCLA 1AHDP 4XKBA 4OMYA 2GGPA 1JLCB 3I6PA 5A6WA 3C15A 3GCXP 1HW8A 3MM6A 3ZZOA 2E44A 4R79A 3R5GA 3EMTA 2FHKA 4DV1J 4GYGA 2KVQE 1MN7A 2FJDB 2K9SA 2VD3A 4ECZA 3BJAA 1QLNA 4HR2A 3DLEB 3NWTA 5F9LA 5BPDA 2Y48A 4DL3A 1XTAA 5BXIA 3AODA 2GHVC 4QIFA 2L08A 3CDLA 1R8AA 2F7VA 1KU2A 2LLKA 4N56A 1R27B 1EJ7L 1F9NA 1M0SA 2GBYA 2BUNA 2HBQB 2J8AA 4ZPDA 1QO0D 2FQ4A 2O66A 3QU3A 3KXDA 3CC2S 4DV0F 4G6TB 4JI2F 2GC8A 3IR6B 3MEKA 3DKXA 3RTRA 1ETYA 2FNAA 7FDRA 4IRKA 3HRTA 2CVIA 5KFBA 2JX2A 1VFCA 3J7A1 5J1NA 4K4WA 3L4BC 4AD6A 3IKVA 1RAOA 4OYXA 3ROUA 3GFJA 4K4YA 3OVAA 3FXKA 2DHGA 3RR7A 3CTRA 2C2EA 3ITHB 2KYZA 2Q0OA 2XGXA 2CQIA 2DNPA 2WSCC 3GTLJ 2WONA 4HX8A 2OIHA 4O3SA 3IR5B 1MBKA 4NQWB 2HS3A 4BHQA 2J0SD 4O6JA 2K40A 1BMQB 2ELKA 4RW9A 3PFYA 4ZYHA 3GO5A 3KHLA 4L5IA 3MPUB 3M05A 5C5JA 4B4CA 3PX4A 3DM2A 4DI6A 4JP0A 4FXVA 2YY3A 4WF9Q 3CJRA 1IUFA 4YFUA 2DH8A 1N33J 3M07A 3JW4A 4MQ9F 4LD5A 3L3CA 1B0TA 1FDBA 1CQTA 2I8DA 2KL8A 4LG0A 4P6QA 1TK8A 3M8QB 1S79A 5BYSA 2V4QA 5D5UB 3SDGA 3M8PB 2W8KA 3I56S 2OBPA 3NGRA 4A6EA 3CMAI 4ABZA 3ZN0A 4J37A 1LKXA 5IYCJ 4HH0A 2WVDA 1JKQC 3ELHA 4XLNF 2VBWA 2M5YA 4KBIA 4WU2A 2X85A 3CJ8A 4G6VB 3K4MA 2AYMA 4A3EJ 4AIDA 4RA2A 2MZRA 3UVJB 1VDHA 2UZKA 3NNAA 3IRWP 1M5SA 1H7WA 5HBMA 4X4RA 4G1QA 3DXBA 1I3OB 4DU7A 5K7ZA 3I87A 3J81Y 1JLQA 3QPSA 3O3KA 3PNTA 5KFMA 4DGWB 4MMOA 3RBXA 2BRLA 1NB7A 3LALA 4LFAF 2KJCA 4C3JJ 2MQMA 2RB7A 2VQEJ 4PUOB 2IGOA 4O5VA 2GO8A 1SJ1A 3AQOA 1O3QA 4Y3OA 1DHMA 2HHVA 2NNYA 5B0EA 4YB7A 1R6VA 4NCGB 2FQ3A 3TQNA 2VZ9A 4LIWA 3BR5A 1N54B 5HMZA 2HHXA 2HWHA 3IWNC 2JA8J 1G3SA 2CPXA 2R8JA 3S15J 4I2PB 3ZNJ1 1Z6RA 1UW9A 5F0WA 5E8GA 5HJXA 4ETSA 4EM2A 1Z77A 2M4KA 2V2VA 3C8YA 3RKQA 3VGTA 3V6KA 2BR0A 3DGPA 2HRUA 1G2EA 1IJWC 3MD3A 4IJAA 1GMWD 3N5BA 4KN4X 2DAOA 4H0EA 1PBUA 3SJMA 1H88C 2FRHA 2DIVA 3OFHA 3B02A 4CLKA 2FYXA 1TQLA 2CQPA 2HAIA 1S5LC 2HHHF 1A0OB 5A8WA 3WG9A 3S14J 2M8EA 2QA4G 3KG0A 1ZAVA 4HDVA 3B4MA 1ZAWA 4USMA 1RHQB 2YNIA 4JI6J 3NGTA 2KKHA 4OYWA 2I5JB 2IBDA 2IFXA 5E41A 3PXGa 3LGHA 4ITVA 3TL4X 2EV0A 2ZBRA 5LJ3Y 2XI2A 3ASOH 1Z2LA 5FFZA 1EZZB 1LXNA 2XMJA 3HKZD 4F55A 4GRSA 4OAYA 4E4HA 3W5YA 4NXMJ 3CCQI 3RKXA 5FROA 2NXNA 2EBEA 9ANTA 5IV3A 5KAIC 2FD2A 3HRMA 4P2MA 3MUVP 4BEHB 2IA6A 4WXDA 4LF1A 1NB2A 2BHYA 4OU0A 3EETA 2HXIA 2KLOA 3MEDA 1S72I 3CCZA 2J9EA 1YI2S 1KDNA 1S9GA 3W8GA 4I0AA 3E0JB 2CQNA 3CUQC 1SC6A 4AC0A 4UOFA 1UJ6A 3AY0A 1JIHA 1OR7C 3K70D 2A05A 4FISA 4IFVB 2XMWA 4HX4A 2HFOA 3BKUA 1HNIA 2E2HJ 4MFEA 3BSNA 4KPYA 3GPAA 3WTTC 1N0UA 4DCJB 2MLGA 5J1UA 1Y0HA 6PAXA 2XMKA 3EYYA 1HD0A 1UCRA 2EFOA 2XV4S 2C22A 1XR7A 3TJ8A 4F3OA 1TL3A 2HQRA 1T0FA 1H2TZ 1KU9A 1IN0A 3O5TB 4PJ0C 4QYZJ 1YJWI 3OL3A 1VQNS 1HKTA 4IF4A 2WOMB 1S1XB 1R58A 3OR2A 5DLGA 1OIAA 2ASJA 1TKZB 3DLHA 4R1HA 5ETNA 2GZWA 1T38A 3GMEA 3P49B 4K7QA 2QA1A 3W8PA 2YX4A 4D5FA 2Z2ZA 3G6XA 1KYWA 3LSKA 3BGOP 4J9SA 3UDCA 4IR1A 3IL2A 1WDDA 1S48A 2HAFA 2HKXA 2GMLA 4EQQA 1WNEA 3C2HA 3P4UB 1HR0F 2NVYJ 3MECA 5CD4A 2R2TA 1HNZJ 2HZDA 5GPCA 1JUPA 1SPBP 4F8RA 3C16A 3UW1A 4I01A 4K59A 1HW1A 4DPUA 4RGRA 2AD9A 5E3MA 3LAMA 3HMJG 5IM0A 3OOUA 3OUYA 5IOYA 1YKWA 2NUHA 1SJQA 1C2PA 1NDCA 3SBMA 4FVMA 4EGLA 3K7RA 2XB0X 4ENMA 2YTCA 1N32J 4A8WA 5F0HA 2MG4A 1FO1A 4ALZA 5K8PA 3OYGA 3I55S 1N5YA 3GYGA 1FYKA 4A3JJ 4KFBA 2M88A 2Z33A 1U25A 2QC3A 5DZ6A 3DHWC 1TV6B 3MUMP 3DYAB 3BT9A 2NS0A 4NC7A 2UUWA 2VKEA 3QT7A 3M4XA 3HEFA 1U1NA 1GFWB 5JI6A 3Q0WA 2I1RA 3GU0A 4MKAA 2IDEA 4ZP7A 3OL9A 3MM8B 1B7FA 4DR1F 1KTVA 2CYYA 4ASNA 5ERIA 4YOEA 1U45A 3D6TB 3KLHA 2VG5B 2HHTA 3I4HX 5TRDA 3SZTA 3MXHP 2Y0MA 3LGNA 4PFPA 1MG7A 2DNLA 1JX4A 4YY3F 1UEUA 3UKGA 1FFGB 4U9RA 3I58A 2XRLA 3VYSB 3SCLE 3T9ZA 3QO9B 2VKVA 4BQOA 1DFDA 2BKOA 2XULA 4BQNA 3RB0A 2OZUA 2OFHX 2DCUB 3A3PB 4IQXA 5J40A 1LEAA 1VQ7S 4Y4RA 3PYFA 3CDUA 4XRSG 3J80K 3OMYA 4NXNF 4FF4A 1UFLA 3KPHA 1EJ9A 1S97A 4UY85 4NDLA 4RU2A 3PR4A 4PR6A 1CSJA 2LKPA 4LK0F 2JOQA 4B3SF 2LFVA 4TY8B 3FXJA 1CS4A 2C3MA 4CA0A 3BTCA 1FX7A 2ALZA 3I55I 4ANDA 3CCJI 3F0NA 4N5SA 5L38A 2H9ZA 3R9LA 2A69F 2KP6A 4F91B 2ZVIA 4DSFA 4A8FA 3CCEI 4LLNA 4RBTA 1FX4A 3VZHA 2Z8QA 1H8AC 4ED3A 2HOTA 1QPMA 5ETKA 3DKYA 2VPXB 3V6HA 3BQ0A 2R0QC 1X9SA 1JJ2R 3FISA 4DR1J 2B7EA 3WBZA 3C7JA 4ECYA 2XPUA 4DV1F 5ETOA 4K4TA 4NX9A 2JN6A 4OYBA 1IBKJ 1USTA 2CQCA 4USKA 5F8GA 3AH6A 4O3MA 4X4PA 1B9NA 3HHDA 2LC2A 1TWAJ 5L46A 3QYBA 2L0KA 3S93A 2G0JA 1SB6A 2A2DA 4K50A 4JX6A 3AQPA 4ANEA 4WPAA 5C2CA 3M8RA 2JSCA 3BCAA 5A2QY 3MQ0A 3TAMB 4B9LA 2VA2A 4NMXA 5KFRA 3GEZA 2HNDA 2QZ8A 4DV4F 5D4PA 1FERA 5B0DA 4NRTA 4OZ1A 2QA4I 2XNRA 2XM3A 1YO5C 2MA3A 3DPUA 4YMEA 4HHJA 3LSTA 2BJ8A 2R7ZJ 4ES3A 4RX6A 2N7CA 5HDKA 1Q53A 4G1IA 3FVYA 2V8HA 3OOPA 1LDKB 4QTRA 4KHRA 3CD7A 2XAGA 4AIKA 1FY7A 2F4MB 3B6AA 1AROP 1JWWA 3H1CA 4NEZA 1S72S 3R5AA 2W2MP 3NWSA 3F8MA 1SI9A 2J9DA 3SDEB 4DN9A 3MWMA 4DSKA 1XSXA 2GCFA 2BACA 1S0VA 1VQYA 2MGZA 1FE0A 2PEXA 3GTKJ 2VT3A 1HXDA 3EDPA 2OFGX 3F44A 4JP8A 2V6AA 1T8IA 4NYZA 1FDNA 2EB7A 3OIPA 4DDFA 5C7PA 2V9KA 2GIFA 2CPIA 5J4VA 5LEJA 4NZ6A 3QYFA 4FF2A 4NLOA 3OLAA 3QWLA 5LGNA 2MB0B 1BI2A 2B8PA 2ZVSA 3NWGA 1XCVA 4RNFA 4HW0A 1MGTA 1TP4A 1RABB 3KP5A 1APLC 2IDLA 2FOWA 3CC4I 4YIRX 2M3DA 4AVPA 4CYUA 4ECUA 2W2QP 3KLIA 2W57A 1AA1B 3FBCA 2AP6A 1FEHA 2VFVA 2Q43A 5HK4A 1K7AA 1Y00A 2OPRB 1O3TA 2ZMEC 1VBKA 3AA8A 2ZOMA 4HTIA 4OX6A 3QZ8A 4DR4F 2DXEA 3EQLF 4KMUX 1TAUA 1SV5A 4J9NA 4ID5B 2QQBA 2GMHA 2Z2MA 5FGMA 1I6HJ 2Y3YA 5D6GA 3NS5A 5ICFA 4LR9A 4NLDA 2KRCA 2Y0SN 3P5BP 2ZH5A 1S6LA 4Q8FA 5M2UA 2IPQX 4LG0B 2H5EA 2QL5B 2KIQA 3NCRA 4D7NA 1CEZA 2JUCA 2KFDA 4DQQA 1ORKA 1RWPB 2M0CA 3RRKA 1ELOA 3P5JA 3LA7A 2HQIA 4BE1A 2HZVA 1CJVA 3PUBA 1CQNA 3OYKA 2QLJB 2Q2EA 4DUYJ 2FVPA 2VQEF 4DR5J 4YFKF 3HSFA 2QE5A 5MAOA 4QIVA 5IWAF 2RRAA 3ISZA 2ZHBA 5KTQA 2NPFA 4PJMA 1VQ5S 2UXXA 2JEIA 3Q22A 1LWCA 1Z7LA 2HOSA 4IKFA 2GS8A 3GW2A 2OD6A 2YWGA 4B3MF 3COAC 1YJUA 4GKJJ 3MM7B 2CWXA 3UFCX 1K0TA 2IRYA 1C1CB 3FK7A 4P7TA 5M2RA 4P52A 1B8IB 3CO6C 3KUEA 2K3IA 1K73T 5KFQA 3FXLA 2L2OA 2JFDA 5ETRA 4WK8F 2ALYB 2ATCB 3Q9VA 4R8HA 1D9DA 2ESHA 4GVBA 2FHMA 4U7CA 5E3OA 1ETVA 2MBFA 4HSTA 2OO4A 2J7KA 2MYSA 2CUZA 4HI1A 2C2NA 3WC2A 3OFFA 3BROA 4O4RA 2L41A 5JHUA 2X3DA 3W6VA 3J80Z 4P5OA 2W25A 1A35A 1P92A 1IDYA 2FVSA 2NYIA 4UHTA 4ZTFA 3PO3J 2V8VA 3MM8A 1UL3A 2W7AA 1VOMA 1CPZA 1Z05A 2IS1A 4J9PA 1UVNA 4ZLJA 4O4GB 1WG1A 3B6CA 3C3LA 3KLHB 1WACA 5B0CA 1FEEA 3LWLA 3GCMA 3IM8A 3DGPB 4NC8A 3BM7A 5K7FA 3M9AA 1G4DA 1BI3A 2JA5J 5A0YA 3KP4A 1RT6B 1IWAA 2FPHX 4DCOB 3ZMUA 4JI7J 1EV7A 3MKWB 4D3HA 1GMVA 3RW7A 3EVOA 3G8SA 2CDRB 1FI4A 3N01A 4N9HA 2LDIA 4BQQA 2AGPA 2QSHX 3OV7A 5A2QK 3J7AN 2LFBA 3VAJA 4PQUB 2ID3A 1MLAA 1PG5B 2FIUA 3C2BA 3TDUC 4FBUA 5EWEA 2LEBA 1DQAA 1SCJB 1PJ5A 2YQ3A 4MEXF 3HUGB 2OCEA 5ICEA 1LW2B 2ZFWA 1RAJA 1O7FA 1RTIA 1TVRB 3HJFA 2W00A 3RQ4A 1G3WA 4FX4A 1AZSB 1OISA 4EJUA 5HVHA 4B44A 4EJTA 3NARA 3P7NA 1HWJA 3OYBA 3LL7A 1GXLA 2AXLA 1N5VA 2F5EA 5HLTA 3OYJA 5CYJA 1HW9A 4YFNF 4L76A 1IN8A 2RD5C 3CC2I 4BLGA 4M5IA 1NK7A 1A9NB 4E7LA 3QGGA 2WBMA 2PLYA 2OD5A 1X31C 3CC7I 4RKUC 1YW9A 4OHZA 4M74A 5GADJ 2YNIB 4AXIA 2DGVA 1AKHB 1WC1A 2QV6A 9ATCB 2PEBA 1E6VA 4B3TJ 1R49A 1QZEA 3BG7A 4ZJQA 1XEZA 3TP3A 4C30A 1SXLA 3R1LA 2DFFA 2H1YA 2ZHOA 3I0TA 3OYCA 3L95X 3I56I 4DJBA 2CW0F 3W2VB 3H9JA 4C98A 2Y0SA 1M90T 4RL1A 1X4GA 5LMNJ 3AG3H 2BOLA 4IOCF 2MJUA 2W01A 4CNZA 4FNIA 4J9MA 1I1SA 3L9ZA 2V8DA 3AXMA 5EG0A 4IO1A 1UJ8A 4BDZA 2MTLA 3N79A 1FTCA 2HPIA 2H51B 3OYHA 4G65A 5LMUJ 4WXCA 5L1KA 2DHXA 1X4AA 5AE2A 3CCUS 4E6KG 1REPC 2DNRA 2MPUA 4ESFA 1QUVA 3MCMA 4PK4A 5DCMB 3QLHB 5D4OA 2EZLA 2VV5A 1HA1A 4V2GA 2ACJA 2OD4A 3VYTB 1UPMB 3VGSA 1YRNA 4Y2IA 1MDMB 1O0PA 2XPVA 3GILA 4L3NA 4DFKA 2ICWG 1W5TA 2OUGA 4H4OB 1KD1T 4UNOA 5ILVA 1HL6A 2XKPA 5BMZA 6AT1B 2XDVA 1E17A 1YX5A 5FLXY 4IR9A 3W5ZA 5H9EJ 4NYOA 2GAUA 2DJIA 5HS8A 4LIRA 2AYEA 3N0VA 2LK2A 2DGSA 3J81K 5KT7A 2G1DA 4G94A 3QJPA 1F4KA 4K4VA 2MLXA 3I0RB 3M1VA 3A8KA 2IHR1 2X1AA 1SEUA 1NG7A 4GRIA 1SMYF 3IG1A 1ZM3A 4USJC 5F3ZA 3CMEI 3K8VA 3M4OJ 4KSEB 4OHWA 1MMDA 2OAUA 1MROA 3OUYB 5DRKA 1EB0A 2CADA 4RLEA 3OJSA 1XX5A 3KZZA 5DDGA 2KISA 2UU9F 3K17A 3ASNH 3CCMS 5E3LA 2HGMA 4LRAA 1R00A 1NHUA 4UXNA 5EGOA 2R2SA 4CICA 2IM1A 2ZO4A 4RW7B 3HOTA 1IZ1A 1AB8A 1JXEA 3SCKE 2HYJA 3DWLE 1UWAA 2IYGA 2F3JA 5EF6A 3NG8A 2ZFUA 2BM1A 2GOXB 3P3DA 2UXCJ 4P74A 4DL7A 4AYBA 4K5RA 4J9QA 3FEYB 1HBOA 2QFIA 4JYKA 3OTOJ 4LJZF 2DNYA 3WGGA 3RB3A 1RAIB 3PW0A 4A3FJ 3E3VA 1D8KA 1FOYA 4HLXA 2HIYA 2MSYA 3H5UA 3MEGB 1FJGJ 4Y3CA 2QJ3A 2HKOA 3D0SA 1TELA 2ZH4A 2QGFB 2ILZA 4BQAA 4QWDA 2IJFA 2X6XA 1E3HA 3QATA 2M4MA 3G3ZA 1PILA 1AT1B 4P96A 2EXUA 4C3MA 2VLAA 2MJNA 1R3NA 2A6EF 2B7BB 3L2VA 2CW7A 2JK3A 2CNLB 1VR6A 2ISYA 1IKVA 4X4TA 3K0JA 4QQBA 3FJ2A 5EDNA 5B08A 3F41A 3DTKA 2GZOA 5T7LB 5GAHJ 4WFYA 3ZP5A 2H54B 4C0BA 1J09A 5DJBA 1OCPA 2OAZA 4I99C 4XRMA 3ZZRA 2BXZA 1HC8A 1VQ9S 4EJVA 4V19J 4LBHA 1I94J 2A1BA 1K6YA 3ESWB 4LF7F 4CLLA 4FF3A 4IDKB 1SJRA 2B9EA 5E20A 2R93J 3ILIA 1WJEA 4KN7X 1IBLF 2WBRA 1N5SA 1PDNC 2RQ4A 2B3TB 5ETPA 1X1CA 1ZZFA 4FNHA 1Y6IA 4J9KA 2YS9A 2PJRA 2BOAA 3HFKA 4Y15A 4OX9J 2CQHA 2E1NA 4NCBA 3HI9A 1VQNI 3TOQA 3KZIC 4HEA9 3HD2A 2VIXA 3KLGA 2EIJH 1RHRB 2KYXA 4OIXA 2HNYA 1RT6A 1NU4A 2DDBA 2YNHB 1U48A 4QWAA 2D9PA 1R6YA 3CD6I 2PO4A 1H9TA 4J91A 3SXLA 3KEQA 4HH1A 5F8MA 4WZMA 3NP5A 3ULHA 4FXDA 1O57A 2AYGA 4OZ2A 3BZQA 1YBAA 1IV6A 1LDDA 2PEHA 2AJ0A 1UKUA 2DHHA 2ESNA 3HXLA 4OZNA 2FD5A 1RKTA 4PFOA 3DRRB 3SMZA 2M8DB 2EA2A 2BX6A 2B51A 5E3RA 3L7WA 4DSIA 1LNWA 2ZMEB 5B0AA 1NJXA 3OJUA 2X0LA 2HNZB 3GG1A 3BKTA 1D8ZA 4EGYA 2V1UA 4M3FA 4HF2A 5IC4B 4ZK7M 4PQUA 4EGZA 2H6CA 2DNKA 2RIJA 1WG4A 3K2ZA 5KG6A 5CJ9A 1FNOA 1IKWB 2HPUA 2DISA 2X3GA 1FWZA 5JVTA 1DLOA 3MI7X 2CUYA 1YJRA 1UELB 2Z57B 1HHTP 5D0GA 2QUFA 1RWUA 2BE2B 2H6BA 1KFDA 4B43A 2HQ5A 1XMXA 5HLFA 3SZGA 4ILLA 2RHQB 4HLBA 1KSPA 3PFIA 1AXQA 2MQOA 4ECVA 1ZGAA 1IBMJ 3GSIA 1FE4A 2A2CA 4TV7A 1NZAA 2OSRA 4NA1A 3SIPB 3TI0A 1WJFA 1DQ9A 2OGUA 1U6GA 2CQXA 3BSOA 4YELA 3F21A 3GZ7A 4DLEA 2AJ2A 2YNFA 2IRXA 3VF0B 4ZLNA 4JX4A 5LSOA 2XS5A 2V26A 5AXKA 4ILRA 2ZKZA 5KNLA 3T5HA 3W6JB 2CQ4A 3MFHA 4C2TA 1GH8A 5DM7F 2RDJA 4PYDA 2FBKA 4ECWA 1OY9A 3OFGA 2EKYA 4XORA 1HWIA 3RYLA 4DV3J 4V2FA 3OXFA 4CO3A 4II3A 2D1VA 1E3OC 2RQKA 1B7YB 1LFUP 3TEHB 2GVDB 2EFQA 2HKEA 1XNRJ 4IZZA 3L2CA 1ZGWA 3FSXA 3IHUA 2QEXI 5MLCV 4P10A 5J2MB 1RZ4A 5I3QA 2WB4A 1FCAA 3R2CJ 3DLKB 3AG2H 2W24A 2W1OA 1C0TA 3JSMB 4LIVA 3ZGKA 2E9RX 1ZH5A 1RT2B 4ED1A 2DPDA 3ZO7A 2AJQA 3CCJS 1VQPI 3N4WA 5F0UA 5LM7E 3KP2A 2QSWA 3HPHA 3TA0A 1AW0A 4Q2MA 2E29A 5C2GA 1I6XA 3IA0A 1ETWA 1RA6A 2KT5A 5BOXA 3MM6B 1MD0A 2LVSA 4U88A 3SQGA 5GADI 1ZS6A 1TWFJ 1PJRA 1IXCA 1YJ9S 2K1RA 2XB2D 3D1QA 1S77D 1MMGA 1V3ZA 2O0YA 3WTWC 1GTEA 1QVFR 3TJAA 4AL6A 3ABKH 3CUNA 1B4AA 1RI7A 2PDAA 1J5OB 1VYAA 3K5NA 2MKHA 2VQFF 5J2NB 1MMSA 1XMKA 2FJXA 4L9JA 2HHUA 3LSRA 4CGZA 3R7BB 3W5XA 4C4WA 3IUOA 4MK8A 2BVMA 3CP2A 4XKVA 4O3RA 5DGBA 3ZN1A 3T1HJ 2BJ1A 5JFRA 1OR7A 3PY8A 1KA8A 2WSFC 2C1EB 3EM1A 2E5IA 3PR5B 2XHCA 4W4MA 3M9OB 4MK7A 1EKEA 4HL9A 2UUBJ 4Q47A 2NVXJ 2K7JA 1YBUA 1OCCH 3HHEA 4WE1B 3W65A 4NLSA 1S0OA 3BDDA 5KFJA 3IH3A 3K0LA 2HQGA 2LRDA 4JI5F 4GC7A 2A5YB 2EA4A 2BZTA 3Q2SC 1N75A 1H73A 1QRYA 3G96A 2NOJB 3NGDA 4PG8A 3S1NJ 1LE8B 3LA3A 2KHMA 3K2YA 4RUAA 4C8NA 2V6CA 3FZVA 3JQMA 4WFBQ 4GVBB 1USSA 1N4LA 4KY3A 4NA3A 1S57A 4QOTA 3K4JA 3DM2B 2LXFA 3VODA 2MKIA 2DGUA 1EAYC 4NI2A 2XGQA 2HK2A 3MDFA 2PMZA 5D4RA 3PHTA 4IG3B 3H2UB 5CA5A 5GPAA 4UUVA 3VB2A 4A4JA 4KISA 5IP9J 2E2IJ 2K06A 2R4FA 4EZ9A 3OD2A 3PKYA 3IAM9 1PVEA 4PWWA 1HR0J 3KK3B 4P2SA 3MD2A 2RE1A 3V6JA 5FLXU 4CZCA 3G9CA 3LP2A 4QWQA 1PYOB 2DA6A 3A4TA 1SFOJ 3GZ6A 3IWLA 2W8LA 2FF4A 4KTQA 2VQFJ 1RU2A 4KFCA 1NK6A 3ILOA 2UXDJ 2VL1A 3J80U 5K5MA 2F4VJ 1HI1A 3IH2A 4RM3A 2W4DA 1JJ4A 1REVB 4CT8A 2DYAA 2ZOGA 3IWZA 5BQTA 1LEOA 5ITHA 5D0HA 1YW8A 1IM4A 2VICA 2XAQA 3AL0B 3EUKL 3K5PA 4ETXA 2CJ9A 5A2QZ 1OCZH 1Q8BA 5CVJA 4CRJA 3AJDA 1K61A 4NE9C 3CQZJ 3KLFA 2M2BA 2LD5A 2J5AA 4B9VA 2MEWA 3HT0A 2YQ0A 3S6EA 1SFUA 2XF6A 1CJKB 1X1AA 1EHWA 3T6JA 1FVQA 2CQ3A 4XICA 2WONB 4WTYA 1D3WA 1TVRA 3FZBA 2ZNZA 4I7HA 1GMUA 4JV2A 3ZCOA 4G7ZF 4A12A 1F3FA 2PI5A 2D3OR 5EG0B 4MFBA 1AFJA 5KHDA 1S7OA 1GAOA 2HR3A 1G8XA 2CNNB 2BANA 2WV0A 3PDNA 5I42B 4RWWA 1S12A 3GG0A 3CJQA 3FBNB 3B82A 3CJRB 4IRGA 2K8GA 3D6MB 2CPJA 1YFHA 4K8RA 1EH8A 1GVJA 2MZJA 3DC2A 2XAHA 4M5NA 4XLPF 3BBCA 1FZPB 2DY9A 5HMYA 5EUHA 3TUJC 5KFYA 4FBTA 2W7PA 5CZVA 2PD1A 4DCPB 3WX8A 3ZXSA 4TYAA 2ZWOA 3TQ1A 3WU2C 4HVZA 2ZMEA 1YLFA 1ZYQA 2ZKTA 4E0DA 2HZTA 5LMNF 3F0CA 4AE5A 3HOYJ 1WI8A 3GFZA 3I82A 1U7LA 4I7FA 3PW5A 4M73A 1VCTA 2GA2A 2WA0A 2V5HG 1SH3A 1PUFA 1NSQA 4EEFG 1FKOA 1X4HA 4BC7A 2CSOA 5CYQB 3HHGA 1LB2A 3HOXJ 2R3SA 2MD5A 1PYTA 1SH2A 3HSDA 4AT1B 3GV7B 1UFMA 2RAEA 2EEYA 1UHMA 4MTDA 2EC0A 4LB5A 1SD7A 1ZG1A 1YW7A 4M63A 3KETA 1KVJA 2F48A 2KH9A 4UTGA 2HQFA 4C2MA 4U6PA 3M2RB 3HHLA 5DM6F 2J9CA 3KK1B 2DGWA 1XMBA 3ABLH 3R8YA 3R60A 1S99A 1V6HA 3UN5A 1KU3A 4LF2A 3DTIA 3JRIA 1U8SA 4CNYA 2MYFA 3TDZC 3Q0UA 3WX4A 4UUWA 2M34A 1F5TA 1QHHD 5EZHA 2W2NP 5A8KA 4J9OA 1LXJA 4ZPBA 2P81A 3OSNA 4BDPA 2HVDA 5ETQA 3DRYA 2HYFA 1SUQB 3A13A 2KVIA 2D3O1 3PO5A 3CVKA 2A6TA 3DU6A 3G1LA 1O4XA 1LUJB 1ZM9A 4QIGA 4B3AA 5FKOA 1SJ3P 3QOEA 3IBFB 2XSDC 4ERDA 3FMWA 3M2VA 4E7HA 2I5JA 4M9ZA 3ZPLA 3E2EA 3PG9A 2DLLA 4ED0A 3FMRA 5KFXA 1UZDA 2NVTJ 1J5EJ 1NEEA 2FUG2 2V69A 3T1YJ 5IM0B 3GTGJ 3WC0A 3HOVJ 4I02A 1JJ8C 3OS1A 4JYAF 5DV5A 1I3AA 4R8UB 2D45A 3VVUA 4Y00A 2NYXA 3VGVA 1TFWA 2V1DA 4DOZA 3HOUJ 3J7YU 4TYBA 4NLUA 4EI2A 1RISA 4RMNA 4LFCJ 1OY8A 2BJ3A 2G9WA 3LP0B 4M6YA 3RYPA 1CF7B 2H8WA 4BACA 5DM7Q 1DPUA 4CDGA 5D6FA 2Z3YA 2F8EX 4PCQA 1X5SA 1SL1A 1R5GA 2Q8KA 4ZLLA 3TVYA 5ILSA 2KU7A 1OY6A 1P7IA 4CLTA 4AQYJ 1LNQA 4IFVA 1YG2A 2HOAA 3JRDA 4AQYF 2B5JA 4JI6F 3OLBA 4BS9A 1S9HA 4C8YA 4K4UA 1HBXG 4ZMMA 1LVAA 2YNGA 2DB1A 3EDQB 1C4AA 4UUSA 1MNDA 3O2IA 3NCQA 3E5UA 2HHQA 2DMPA 1KC8T 4BJTA 2K9QA 2PN6A 1SAUA 1W36C 3HXMA 2J76E 5T7LA 1U8RA 2HOEA 2OLWA 4LVNP 4HI2A 5IY5H 4F26A 4AL7A 4KGKA 1U0JA 2IM2A 1HNWF 1XDUA 3RPQA 3R2DJ 3BEGB 3WTZA 4EK2A 1WJAA 2JA7J 1DBDA 3CDAA 1C0WA 1RQ0A 4OJ1A 2E1PA 4DPXA 1I39A 1QSYA 2IW5A 4DYRA 1N6QA 1CG2A 1OPIA 1PO6A 2BW3B 1MSEC 1BR2A 1V4RA 3QFWA 5IYDJ 2D1HA 1O3RA 3M6WA 3S8PA 1RSCA 1QZYA 3WZ0A 3H3UA 2KDOA 2XYPB 3AD8C 5CQEA 5HLFB 2P6TA 3BGLA 5IXUA 5HROA 4BNCA 5FKNA 1QGPA 3DFEA 1DU6A 2Y8YA 3J7AY 3OTEA 4QZVB 2DDAA 1BL0A 5AE3A 1PCAA 2HDDA 2YX7A 1Q78A 1R1UA 3V81A 3C46A 4TQSA 4FE4A 3AB4B 2R8KA 4DR3J 3HDSA 1V5IB 1T95A 4HNTA 4HYEA 3NRBA 1REVA 2CQGA 1BLUA 2PMZN 4DYQA 1TWGJ 3CCVI 1FDDA 1WOOA 2L54A 2RDDA 2XMVA 4IRIA 1OQ3A 1B3TA 2Q1ZB 2YKOA 3DQVC 2NXNB 1V55H 3G71I 2G2YA 5FB2A 4XLEA 4UOCA 1X4DA 5F9NA 1PYSB 1MSFC 4XAKA 2CFXA 1R0BG 3R27A 1M5KC 5J2PB 4X64F 1RB0A 1U4BA 4Y65A 4MHGA 2ZD1B 2IVYA 2VJUA 2VG6B 2ZUGA 1HA8A 2GJIA 2HNDB 4RW4B 1YS7A 2HYIB 3G4SS 1HQCA 3W1YC 3K69A 3PNVA 2HW3A 1YIOA 1ONVA 1JT0A 1YDLA 4XMYA 2CV1A 1NK8A 3WODF 4HPQA 4ID8A 2E5HA 2OSQA 1UVLA 1W2IA 1HQUA 3JAMY 3SEOA 5KT3A 3NAUA 4BL0B 3QRPA 1LW2A 4CO8A 3GJRB 4DBQA 1TU0B 1X60A 1N5TA 2C3PA 1KNZA 4M3DA 4LSZB 2GVZB 2QBYA 4L0YB 3CD0A 4ANJA 2F4IA 3CD5A 3ZTRA 1RKJA 3CJSA 1UMQA 4O3QA 1XMQF 4F4XA 2P7CB 3HSRA 1YRUA 3K4CA 1FRLA 2EG1A 1BQNB 4RR5A 5ILUA 3CB4A 4NBQA 2O6GE 2IJNA 5CLSA 4F0HA 2HLTA 4WCEQ 2DXIA 3S17J 4RO0A 1MKMA 1YTYA 3CDBA 4F4KA 2FY1A 2NOGA 1R8CA 2WVBA 3SQOP 4FCYA 2O67A 2B9YA 3Q86A 2I10A 4A6DA 2Z16A 5KT4A 3K1MA 5BR8J 4IO9Q 1OKRA 4NA2A 2IRFG 2EINH 2W9CA 3BJ6A 5LFAA 2RQMA 2HU9A 4WJBA 1YJ7A 3OFEA 4BU2A 3E01B 2DCEA 1IXSB 1R22A 2LXUA 2X1GA 4OIPF 3ZTPA 3G1OA 1Y1VJ 4KPCA 1M5VC 1CJTA 3PQKA 1DQUA 1LJ9A 3LNQA 2P5KA 5J6XA 1FXLA 3AJ1A 5HSPA 1RNLA 3J81U 1WRJA 4DL0C 1Q82T 2HZAA 2RRNA 3IRQA 3A8JA 4CUGA 4Z7YA 2XCPA 4IG3A 4RUHA 4HDHA 4FX0A 2GLOA 3VAHA 2IA1A 2MC4A 1N78A 1WEYA 4DS5A 4ECXA 3S2DJ 2NXEA 2JSPA 2X1FA 3ZZZA 4WYWA 1RADB 2Q2EB 3D0HE 3ECOA 3DEEA 2PBIA 2XMAA 2V0NA 3MF5A 2UWMA 2VJ5A 1YI2I 2XMTA 1UFKA 3NS6A 3OY9A 5TGTA 4J9UE 1FJEB 4EYHB 3DCFA 1X1PA 3BO4A 3UD4P 3KCCA 3JAMZ 4ED5A 1B4SA 3SDEA 4DQPA 1UFWA 2OF7A 5KOXA 3H5AA 4F2SA 1D09B 3Q89A 3KDNA 2QYOA 2H94A 3I5UA 2KIMA 3MVPA 4XIUA 3D7SB 3IAM2 3BZ6A 3ZTOA 4Y2AA 3H5SA 2JEJA 3ZR8X 3K10A 4ZPWR 1SIWB 3HGYA 5GAHU 5F27A 3H90A 1U6FA 2V94A 2QYCA 2UVRA 1T9VA 4AYBN 3RI4A 3UQSA 2VE9A 1KKHA 1BD6A 3H7HB 1ZR4A 1E0EA 3BOQA 1Q1KA 1VQMI 1T9WA 2JRTA 4A8MP 2HVIA 3W2AA 3MOZA 3QIPB 2JJ7A 4LF9J 3W60A 1FK9A 2RF2B 2CV0A 3ZMDA 1NH8A 4WZQA 2UU9J 1GV2A 3EUAA 5A8RA 4I68A 5KCMA 4RW9B 2DXFA 4BHBA 2J9DE 4OQJA 4IQMA 4KA4A 3CUQB 4X1EA 3SEQA 4AYBD 1A04A 2LSOA 2G13A 4LSNB 3A03A 2WY8Q 4NPOA 3TZYA 2YKQA 2W4CA 3MMCA 3W2WA 4PG5A 3NNHA 1GXTA 4UF4A 3OTDA 4CP5A 1UTAA 3PIOQ 3ZRGA 3HK2A 1H2VZ 1XIQA 3OV8A 3PIPF 2IAJB 2WHOA 4IOCQ 4ZN1A 2TRTA 2GIVA 2C2RA 4JYAJ 1N33F 4OYZA 4LOCA 2ECCA 4FYXB 2UUAF 4RW6B 2UXCF 5HP1A 3FDYA 3F8NA 1Y5NB 1U8BA 1U0HA 4AUKA 2ZXIA 5I3UA 4UY8T 1CJUA 2NNNA 2FLLA 1U2FA 3L7OA 1NK2P 4CLPA 4FPIA 3K8WA 4BWMA 1L3KA 2DOAA 4B48A 5CVRA 2DO7A 2HYGD 2M8HA 1BR1A 1U1OA 1VQKI 1YJNS 3R97A 1IVZA 2CRLA 4FT8A 3ILJA 1JTXA 3AOBA 1IKXB 3VQSA 5HBMB 3P45B 1UAWA 4G1QB 1ZGJA 4X4QA 4MEYF 1Y56A 1U2RA 1VQOS 3Q0VA 2MKJA 3JAMK 1VHFA 5T14A 2EH3A 1RT7A 2LYVA 4R5PB 4NLPA 2KT0A 1QVUA 2GXGA 1X0FA 2EK1A 5HQLA 2DYRH 4LF7J 5EHHA 3GUDA 2H09A 2L9DA 3V7RA 1FTZA 4HAMA 1V3RA 2LREA 4BE2A 3PFOA 4OI3A 3TVKA 1FP1D 4IQ4A 1D9AA 1U3EM 3CE8A 5J2QA 3GIJA 2XTJP 5AIPA 1H98A 4EO8A 1J7KA 3DKWA 3WGHA 3QYEA 3FCWA 5H6QA 5SUHA 3IAS2 2MGQA 3SZPA 3TQEA 1QAJA 1V3FA 1LEBA 4L73A 3MM9A 4K4ZA 4I0BA 1AYEA 1T3OA 2Z2YB 3T41A 4RJVA 2W84A 1T11A 3TUIC 2MY7A 2X4HA 2O03A 1TMJA 5LHHA 3K58A 4KGXB 3KE2A 3RDIA 2DR9A 2QMWA 4X66F 2X9DA 3UCZP 4RU9A 4KR0B 2R7QA 2IGMA 1HW5A 1I3QJ 4FHTA 3L2UA 1TMMA 4U7BA 5HN0A 2LLZA 4Z37A 3B4DA 3I32A 1HNXJ 3KHHA 3A01B 3I54A 3KDOA 1RT1A 4NLYA 1HPZA 1WFXA 1F6TA 2HFNA 3FK4A 1X1BA 4KKOB 1IR2A 4ATNA 2GA1A 2I6WA 3MN2A 5KFSA 2CUEA 2VBXA 2R7SA 3G2BA 4CYCA 3U7JA 1NK5A 1FSEA 3HC7A 4XRSA 2JPBA 1XMOJ 4JI3F 1RUNA 1T9TA 1UWBB 3NRVA 1HYSA 2G4BA 2GXBA 4F52A 3CF5F 4NLTA 2HWTA 3S8SA 4JV5F 4KHPJ 3U1NA 1X8DA 1WI3A 1HWUA 3POTB 2FUG9 2FVCA 1QE1B 2HWIA 1SKRA 3R6GB 2XC9A 5CQGA 2CA9A 2JH3A 2Q79A 4BS2A 4FTHA 1BWEA 4R25A 2KDZA 2JT1A 5F8NA 3AA9A 4O3PA 5DYMA 2RVJA 4WFNQ 3VAIA 3EGZA 2GX8A 4NCAA 2ZWPA 1J5EF 4AUXA 4M5DB 4OYMA 4YRVA 2W4SA 2C42A 5KOWA 3ZZTA 3M1EA 3BTIA 1IG7A 1ICEB 3HVTA 4EBDA 1H72C 2ZJRF 5LRSA 3KEOA 2XLIA 5HDNA 3UR3C 3E01A 2JQ7A 1BIBA 2LMDA 1FXDA 1SC3B 1NCLA 2WW4A 3BO3A 3K2AA 4XIDA 5FKKA 2ZJ2A 1FT9A 1S6QB 4PYAA 2WRMA 3M6UA 2DK8A 3PV8A 4L5EA 3D5RC 2QN6B 3ITHA 2XO7A 3ZQFA 2QQ8A 1OSCA 4ZDPA 2DGXA 3WTYC 4GKKF 3VVTA 3TJ9A 4C8LA 1S9FA 3OT9A 1VFJA 4KO0B 2Z1DA 2RVCA 4J7CA 4LR8A 2W7OA 4A0ZA 3G6VA 1N25A 3QGIA 3DLAA 2E5NA 2CPHA 3M8QA 2EV5A 1HBOB 3M8FA 1W25A 3TKYA 3M8PA 4U8YA 3TEGA 3BPVA 4D7MA 5HATA 4QU6A 1TZ0A 5KG4A 1HDDC 1WC0A 4CCOA 3MMBB 1S29A 2YNGB 3OYDA 3ONQA 2FEZA 1UA1A 1S3JA 3C14B 3SFUA 3M2UB 1J5OA 2K3KA 1NPPA 5IOLA 4ZJLA 1BW6A 2WW8A 4LRFA 3TNVA 4A3KJ 5F1JA 1BQMB 1NH7A 4F25A 2BJEA 1TW3A 1D9FA 2CG8A 3QIDA 3Q5FA 3FZ2A 3MR3A 1BC7C 3PYDA 3W6KB 1ZQ3P 3LPEA 2QKMB 2KJBA 4KV8B 3QMQA 3QP6A 2STWA 1JKHB 1U6ZA 4MO7A 4ZP9A 2DOEA 2CUJA 4DU8A 2DMQA 4C9YA 2VKDA 8AT1B 1MMNA 3D68A 3IP0A 4HLYA 5C3EJ 5B0BA 2ZH2A 4WE1A 4ES1A 2A18A 1HHQA 4CLUA 1IBKF 1QAXA 2UXNA 2YBVA 1F9HA 3F6VA 3JTHA 1S1TA 1T08B 4YP3A 1N6QB 1ETKA 3TANA 5DDOC 4FASD 3ZMTA 2Q1LA 4Y0FA 5D0EA 4TLRA 4W1UA 2LG4A 1GX6A 1WHVA 4ZN3A 4OIQF 1IDZA 2Q6CA 3CCRS 1CC8A 3IBWA 2BOPA 4DV0J 2DW4A 1RWMB 1N5QA 2GQCA 3FWEA 1QTMA 2K86A 1TL1B 2J6TA 4EZ6A 3VWSA 5E5NA 2BVLA 3EE3A 1T03B 4IH6A 3KLVA 1RZMA 2NSCA 1H0MA 3VDXA 1NG6A 4CHUA 3PW7A 2VPYB 4OWRB 1RWNB 1LW0B 1RWWB 4BBYA 1TL5A 3I64A 1KQGB 4A3IJ 1YQAA 3Q0AA 3NL0A 5BR8F 2EK6A 1X0PA 2Z30B 1VQOI 3BO2A 1X58A 3UPFA 3DRRA 4U8VA 4CDIA 4CSWA 1N0VC 2CH0A 4M5MA 5DDPC 2FE3A 2CS3A 1ETXA 5D3GA 2LECA 5D78A 1WCMJ 5J47A 5DD4A 2QX0A 1F2HA 2C3OA 2VUGA 5A8WB 3NY0A 4OZ5A 2W1BA 5FKLA 4FYDA 1FPQA 3E1SA 3DFGA 5DS7A 2BV3A 1FJCA 4OIRF 2FSWA 1YITS 1Z67A 2DU9A 1VLYA 5GAGJ 2DJNA 2OPQB 3F56A 5CABA 2RDPA 3CESA 2DT9A 2JDJA 1IRZA 5LMUF 2DRBA 4ED6A 1NKCA 5CAAA 4I6ZA 2JFKA 3MCOA 2J5OA 4K2EA 4OFZA 2DPJA 3J7AO 1RUSA 2NPIA 1JKPC 1XGMA 4YY3J 2XY6A 1TQMA 2YWFA 3O8HA 2DVIA 4WFAQ 3HHLC 1YRNB 2GVZA 1RA7A 2NS7A 1FT8A 5B0GA 2L01A 3ILLA 1VI7A 1RT5A 1R9TJ 1VTNC 2KZZA 2GO9A 2P4WA 4DUZF 4LFUA 4ZDNA 4QR0A 5D4SA 1DTTB 4DFPA 2QFJA 4KNYA 3W9IA 3OYFA 4TU9A 4CLYA 1TKZA 3KJNB 4XTTA 3O8GA 2YQ1A 3CCTA 2QG9B 4BE0A 3VCDA 4QW9A 1TL3B 5LBQA 3LGMA 3UDEA 2B4PA 1RT2A 1KQSR 2UV1A 1QVTA 2G0EA 3UNGC 3JREA 1YRXA 1S6PB 2F40A 1CQMA 4HQMA 2EZKA 2COLA 4Y52J 3OR2B 3MMJA 3SQGB 1ITYA 4X4OA 3PTWA 1XGNA 1PC5A 2YH1A 4DZ6A 3J7ZT 2GIQA 2K7KA 2KXNB 4UOGA 2FNPA 4PJJA 2DNZA 2CV2A 3BQYA 4BHCA 3QQCD 1NHAA 4KKOA 4HX7A 1JGSA 3PL8A 1ZLJA 3M32A 4ZCKA 1Z2ZA 3LQVA 3LW5C 4C9DA 3K1NA 4YEAA 2XLKA 1PAUB 2JZYA 4DX7A 5AONA 2HNHA 1XS9A 2GGPB 3PIOF 3EXCX 3QIPA 3K4NA 2CZ9A 4JI0F 2FHJA 4BY7J 2R7TA 2LMIA 4UUXA 5HLHA 2HHHJ 4CXFA 2KJVA 4YN3B 1K83J 2HEKA 2NREA 2ASYA 3I59A 4BXUA 3PW2A 1S76D 1R31A 3WDOA 3W3SA 3QT5A 1EH7A 3MMCB 1WI9A 1ZELA 4EFAC 3SCJE 1S10A 2BGCA 2CPZA 5DCFA 1R7IA 3REOA 3KP3A 2J0WA 3NGUA 3W7BA 2HFUA 3NAIA 4NHJA 3RAXA 2IT0A 3HZJA 5E1WA 4B3OB 5E1XA 1WSRA 3UI3A 5L3BA 2HDCA 7FD1A 3EZ5A 2NYHA 3BCBA 3ABMH 1NLKL 4WWCA 1BN5A 3Q24A 4OI4A 3CMES 5D4NA 5M3FJ 2J6UA 1WDTA 5LHGA 2F5DA 3F6OA 1NKBA 3BZKA 1JTYA 3N28A 2E5JA 1K9MT 2DEIA 2KT2A 1FJLA 1WC6A 2OZ6A 1RKWA 1YRTA 3F23A 4QSHA 4LSLA 4ER8A 4ZH4F 1WJCA 3X3UA 5ICGA 4Y2CA 2QRRA 2CZVC 1STZA 4KGMA 3BSCA 2WY7Q 1KQKA 4Q5VA 4CO0A 3I71A 4QYZK 1IW7F 1F0XA 1POGA 2AWZA 3GFXA 2XNQA 2RU3A 2EIMH 3D1OA 4CO4A 3BN4A 3MTJA 5ETVA 3C6TA 3V6DB 4KC5A 1M1EB 3D5MA 2IAJA 3BGFA 2CPEA 1BQMA 3CO7C 4AWXB 2DFIA 1IR1A 2L9RA 2KG0A 2JMWA 5JVGF 1RC9A 1UMJA 1KQ9A 2ZH3A 3GMGA 3QJLA 5CVIA 2YWEA 4C0OC 2UVWA 3TP0A 1ZKGA 2ROEA 1O5JA 2M8GX 4E7KA 4ZPAA 4JI1F 2KFYA 2BJDA 1XR6A 1Q1HA 2B4OA 1NMEB 1E3PA 2HFVA 5HLGA 1IR0A 4F4WA 2H5JB