2IA0A

Transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
156
Chain Sequence
HLDDLDRNILRLLKKDARLTISELSEQLKKPESTIHFRIKKLQERGVIERYTIILGEQLKPKHLALIVLEVGKPEDFLERYISYISSTLSALPGVLFVAKSGEDKIIALVGKNNKDELVKFIEENITSIPNLKHIQIFPITEIKKGEDLTGFLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HTH-type transcriptional regulator PF0864
publication title Crystal Structure of the Transcriptional Regulatory Protein PF0864: an Asnc Family member from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 34
structure length 156
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia0A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ia0A02
1YW7A 3MCZA 1TQMA 4RGSA 3I53A 4MNUA 1YO5C 3QOPA 4WXCA 1K7AA 1H9TA 4GGGA 4LG0B 5E18F 1AWCA 5FGMA 2RV8A 1BC8C 1RNLA 3JTHA 3BZ6A 2ADUA 1IZ1A 2PLYA 2J5PA 2XASA 4IHSA 4HZFA 4HAMA 1I27A 2YSRA 1L3LA 1P6RA 4LLGF 2XAJA 1XDUA 2Q0OA 3B73A 2Z3YA 1O7LA 3HHGA 3DPTA 2OBPA 3QAHA 4I01A 4UVBA 4LJZF 3J80Z 2PFBA 4R8HA 2D2WA 3J80K 2ZKZA 4GYIA 4TV7A 1L0OC 4BHPA 3IL2A 1ZREA 1HQCA 3CUOA 2B0LA 4LB6B 5EEGA 1MZBA 1I1GA 4R79A 3TDZC 5CVIA 3J7AO 1IUYA 2HZTA 3KP5A 1DPRA 4FX0A 5LBQA 1MJBA 5L3CA 1U2WA 3ERED 2HTJA 4AVPA 2HFHA 2M8EA 2QQBA 1OKRA 1YW9A 3ECOA 1LEAA 3WODF 4EJVA 5AIQA 2HTSA 2CQKA 3DXJF 1W5SA 1S7OA 1D8JA 2HDCA 1Z91A 2QLZA 4KNYA 2GXBA 2BYVE 1O57A 1QZYA 2M87A 4ZH4F 2UXXA 3HHHA 2KIMA 3LQRA 5D5XB 3M1EA 1ZGJA 1G3YA 3O6BB 2FA5A 4HDVA 2V79A 1J75A 2V1UA 4WXDA 3NQOA 2L01A 3KE2A 1FNNA 3T8TA 3K1MA 4UUVA 2L4MA 3WTSC 2L4AA 1KA8A 2L02A 2M1BA 3M7GA 4XBFA 4Q4ZF 3E6DA 5HLGA 3JAMZ 3W6KB 5J8FA 3FXQA 4EM0B 2HQRA 3WU0A 3FM3A 2QQ9A 4HOBA 3JAMK 5LEKA 5CLSA 4EJUA 2LDUA 4HBLA 3I5UA 1RZ4A 5K5OA 1ZGAA 5E8IA 3GLXA 4KICA 5LEJA 1HKQA 2KJBA 3H92A 4B8XA 1LDDA 2IA0A 1TNTA 4ESBA 3DQVC 3F72A 3R60A 4NB5A 1D5VA 2QZ8A 2EA4A 1LVAA 3G73A 3ISPA 3ROUA 3KP6A 4IRHA 2DPDA 4OMYA 4XLNF 2PG4A 2XHKA 1CGPA 2NS0A 3KEQA 2X4HA 2DK5A 1IN7A 3E97A 4MTDA 1FY7A 4OINF 1DUXC 4L9NA 1SFUA 1GVJA 3BJOA 1GHCA 2F5DA 3HRTA 3SQNA 1HXDA 2PBIA 5J6XA 2HKOA 2IT0A 1DDNA 3P9KA 4KYWA 3R4KA 3KEOA 5DCMB 3R61A 3AAFA 2GA2A 1BI1A 2KJCA 3Q9VA 1KQ9A 4CGZA 4KA4A 3JW4A 2Z9OA 3ABUA 2DO7A 1F4KA 2CWEA 1Z05A 1U8RA 4K2EA 1JE8A 1EH6A 2FNAA 4G7HF 1FT9A 1U5TA 1HKTA 1U5TC 3IRQA 1R1UA 4KDPA 4I98B 4ENNA 3HTSB 5IT3A 2O3FA 2JRTA 3ZP5A 1H0MA 3NEUA 4NHJA 1ZYRF 3BJAA 2MD5A 2YPRA 1P4WA 2DT5A 3CO6C 1XSDA 1R00A 1TW3A 5L3EA 3QPHA 4RGUA 1SD6A 2EFOA 4HQEA 2JZYA 4KFCA 1OYWA 1EH7A 3CUQA 2A07F 3HYIA 4UV9A 2XV4S 1XSXA 1J0RA 4RGXA 4P5OA 3RYPA 2EK5A 5E1ZB 1UB9A 1ON2A 1I6XA 1J59A 2A69F 3CUQB 1T98A 1XCVA 4GYGA 3EQLF 5AIPA 1EV7A 2E7WA 3QPTA 4JK1X 2IA2A 2VN2A 5ICCA 4ESFA 3N97A 3QP5A 2O61A 2XIGA 2WV0A 2PI0A 3ECHA 4UVAA 1SFEA 3WGIA 4XSXF 3OV8A 5DDGA 2Y0MA 3H3UA 3JTGA 4OMZA 1FZPB 4AIJA 4HW0A 5A2QZ 1CF7A 2UWMA 2DAOA 2YU3A 3CJNA 2HOEA 2FXAA 2H09A 4A5NA 5ICFA 3LSTA 1ONVA 1X3UA 1A04A 5HS9A 2ZBKA 1CF7B 3GWZA 2HYGD 2M30A 2RKHA 2R7DA 2R3SA 1UHWA 1J2XA 3K69A 1IN8A 3FHZA 1OYYA 2ELHA 4AD9A 3FXUA 4B09A 1HSJA 3M8FA 5D6EA 5DCFA 1GXQA 4Y15A 1E2XA 2VONA 1UFMA 1XN7A 4M73A 4KT5C 2ZCWA 4DQ2A 3ZMZA 5CJ9A 3WE3A 1EH8A 1Q1HA 4Q47A 4UVCA 3CLOA 2JTVA 3ZN1A 2EB7A 4KIGA 3GZ6A 4EJWA 2W25A 2C6YA 4HX8A 2W84A 2ZNYA 3L09A 1YIOA 1S8NA 5ILVA 4YFKF 3MZHA 2VBZA 3IKTA 3RI4A 5IT9Z 5K1YA 1ZLJA 4O3MA 2FRHA 5IT9K 2ZMEA 1SD7A 3P7NA 2XGXA 3IWFA 3ZMSA 3R0JA 2YX4A 1XCBA 4HV5A 4M74A 1J7KA 2OAZA 2XUBA 4MQ9F 4IRGA 1ODDA 1HBXG 4LD5A 2ISYA 2ZMEB 2K86A 1IRGA 4LB5A 4PCQA 1XB4A 1O3QA 3F6VA 3EUHA 5BPDA 1R22A 2CYYA 3F6OA 1XD7A 3L7WA 1FSHA 4KN4X 3TO9A 4BXUA 1TNSA 3LQQA 2P5LC 2V1XA 2IW5A 4CICA 2AXLA 2YX7A 4UV8A 1ZH5A 2EFNA 1B4AA 1S6LA 2K27A 5BS6A 4G9YA 2LF8A 3K2ZA 4IPAA 3WE2A 4KUMA 4EM2A 2DBBA 1T38A 3BROA 1MDMA 2RGVA 2O6GE 2MLGA 1S3JA 2F5FA 2KKOA 4HLYA 2OU2A 5ERIA 3HRMA 3KLOA 3ML6A 4A12A 1VTNC 3DP7A 3FMSA 1ZLKA 4U7BA 2K4BA 3R0AA 3EDPA 1R23A 5L3DA 1XGOA 4EVIA 3ZMUA 2P5KA 3N4MA 4FT8A 4N0BA 5FB2A 2KIUA 2P8TA 4MEXF 4BYYA 3RJPA 2BE5F 2FMYA 2A5YB 3HIFA 4G6QA 3LA2A 3RPQA 4P9UA 2FSWA 2IA1A 2IJLA 3E5QA 4O6JA 1IF1A 5H6RA 5LHGA 5AONA 3VOEA 4QWQA 2XKOA 2VC0A 2FQ3A 4OIQF 4P96A 2V9VA 1B59A 3MAJA 1O3TA 5JI6A 5LHIA 2WTEA 4NQWA 2HQNA 4KIFA 1ZG1A 5HLIA 3EETA 4A0YA 4UNOA 4M9SA 4EM1A 4EJTA 4G94A 1T2KA 1YTYA 2GWRA 2V6CA 5H6QA 1OMIA 2GZWA 4FX4A 3ZMTA 1P4XA 4U0WA 2MC3A 3TOBA 3HTUA 1ZRCA 5CVRA 3F22A 1NHAA 2JSXA 2VE9A 1USTA 2UZKA 1BI2A 1U78A 1KU9A 6PAXA 2MLKA 4ON0A 5D8KB 1MD0A 1G3WA 2A6EF 4YIFA 4IJAA 3V4GA 1XGNA 4XSZF 2ISZA 5F1RA 2PJPA 1JHFA 3RKYA 5L3BA 1FSEA 1XMKA 1SFXA 1O7FA 1HKSA 1YFHA 3HRUA 1J5YA 3SZPA 4MHGA 4ZYEA 2FNPA 3ZQ7A 1Z9CA 2MH2A 3FX3A 3FMQA 1IXCA 3U1DA 2STWA 3TGNA 3REOA 2A6HF 3TO7A 3ZMVA 3GUDA 1MJ9A 1HSTA 4RAYA 1R36A 2HS5A 3BPVA 3MQ0A 1KYWA 2ZFWA 2XAHA 1LB2A 4KMFA 2IP2A 1Z1DA 4L5JA 4OU0A 2FU4A 4RB3C 3FWEA 4HF1A 4M72A 1J9IA 4M9XA 5LLQA 2EFQA 2IPQX 4LMYA 2TDXA 2BEOA 3G3ZA 1WQ2A 3M8EA 2W85A 3COAC 1LDKB 2CO5A 3RKXA 2OZ6A 2P6SA 2ZXJA 3ZPLA 4GXOA 2VBXA 3S2WA 5ICGA 5TRDA 1H9GA 1QGPA 3E3VA 1F5TA 3RTRA 4QLCU 3FXRA 1RI7A 5LGNA 4YIIA 2RNJA 3F8FA 2UXNA 1B1BA 1BBYA 1R1TA 1UHMA 1FOKA 2QYOA 4XRFA 1TW2A 2FF4A 1PP8F 1TLHB 3SZTA 3ZMDA 5H20A 2IVMA 3SHFA 1D8KA 2GIVA 4LK1F 5CVJA 1LEBA 3HSEA 3C7JA 1IN5A 4EMSA 4Z2YA 4L9VA 4BH9A 1T6SA 1U5TB 1RUNA 4ESJA 3MZYA 2ZJ2A 2PN6A 5FLXZ 4I2OA 4LLNA 3VB2A 1YLFA 1BI3A 1R1VA 5D5WB 5FLXK 5JVTA 3PQJA 3V8JA 3GYHX 5BPIA 4UXNA 4O5VA 1FC3A 4HDUA 1D3YA 3U2RA 3BP8A 3GZ5A 4M71A 3TDUC 1C0WA 2EA2A 1T39A 5TJJA 2F5CA 4CDGA 4G7ZF 2XKPA 3DPLC 1F1ZA 4MTEA 2STTA 3IKVA 1G4DA 3QU6A 3LA7A 4BNCA 3T0YA 1KQ0A 4L9TA 1QZZA 4EQQA 1ON1A 1YS7A 2QVOA 3P9IA 1MKMA 2O03A 4IF4A 2QBYA 2NAZA 4G6DA 2G7UA 2YR2A 5E17F 3GFLA 1FYLA 4U0YA 3WTUC 1OYIA 3GEZA 1BC7C 1ZRFA 2BV6A 3D5LA 1FBQA 2QBYB 2LF7A 1FPQA 2IRFG 4L0YB 1O3SA 2FE3A 2HGCA 3EYYA 3JSOA 2ACJA 5EEHA 3I58A 3K1NA 1YW8A 1DP7P 4Q48A 3KZZA 2Q2EA 3WGHA 4EJOA 1FBSA 1B9MA 1SD5A 1XDSA 2W24A 4P55A 3ABTA 1AOYA 1LDJA 2VXZA 4I0AA 3D0SA 1K78A 2E1CA 2XRNA 2H27A 2KIFA 4KIBA 2VODA 2DJWA 5FFXA 3CTAA 1WRJA 2QM3A 1QNTA 3WTYC 5DD8A 4ZZDA 4U0VA 3DV8A 2HKXA 3C1DA 3TOAA 1O3RA 1K78B 4WCGA 2WC2A 1IXRC 2HEOA 1IXSB 1YG2A 1FX7A 5HDNA 3QP6A 4WWCA 5K5QA 4HX4A 5LHHA 4Y17A 2BGCA 3JSPA 3CDHA 3K9TA 2RDPA 3Q9SA 3W6JB 5KVRA 4I0BA 1QBJA 3GFJA 4AIHA 1R7JA 3SXYA 1S29A 4M6XA 1YQAA 5JFRA 3L2CA 3HOSA 1G3TA 3F3XA 2VT3A 2NYXA 2G7HA 4MQVA 2L54A 3MEXA 1ULYA 3WGGA 4RB0A 3KLNA 2W57A 4EGZA 2RVCA 1LNWA 3L9FA 5D8LB 4Y13A 4M9ZA 2FBHA 2Z99A 3E6CC 1PP7U 3I64A 5JHUA 2HYFA 2BBYA 1V3FA 2K7LA 3RDIA 2MA3A 2ZNZA 4RAZA 2P4WA 4BQAA 2E7XA 4IVNA 4G7OF 2EWNA 1TTYA 4L5IA 2DQLA 3TO6A 1FWZA 3ELKA 3T1BA 3GFIA 5E1XA 5CVUA 3KP2A 2QWWA 2XAFA 4D0PA 2D1VA 4XLPF 4JQFA 1USSA 2J5OA 5HOOA 5HS7A 5KK1A 4RB2C 1QO0D 3I54A 4BHCA 2HR3A 1MJAA 3I71A 4LG0A 2CFXA 1Z6TA 3E6BA 3PQKA 2OQGA 4HYEA 2L3DA 5D5UB 3T8RA 2ZO4A 5DYMA 4ENKA 5E20A 3LAJA 2D45A 2A3SA 4P9FA 3KP4A 4LK0F 5LGUA 3R6SA 4YG2F 5L3FA 3DKWA 1MDMB 1ZHFA 4IXAA 1XSVA 1W7PD 4UHTA 2Q8KA 3P9CA 4N9HA 5BMZA 4AIKA 3I59A 3GO5A 3KP3A 3F8BA 1KU7A 1KU2A 2VT2A 2CW0F 1B6AA 3RIRA 2V1DA 2VBYA 1G6NA 4RS8A 2FBIA 2X0LA 2DLLA 5L3GA 1HW5A 3I59B 3O2PE 1BOAA 1PUEE 2AS5F 4EGYA 3HSRA 4ETSA 2OD5A 3KZYA 4GO1A 3BJ6A 2FOKA 2VOPA 3ZN0A 4PGHA 1FP2A 3F8NA 4OIRF 4EV0A 2FBKA 3M9AA 3J81Z 2EFWA 2A68F 4IHTA 1WWXA 4G8XA 3J81K 5ILUA 1RUOA 1UCRA 3E6MA 5D6FA 2H6BA 5JR3A 1U3EM 3ULQB 3WTVC 2VE8A 2O8XA 2ESNA 2R7FA 3KCCA 2D1HA 2JPBA 4GCVA 2NRAC 1JGSA 3KFWX 4KN7X 5LRRA 2MBFA 1BIAA 2LNBA 5ILSA 1HW2A 3MFKA 3LAPA 5LGTA 5ED4A 1STZA 5HDGA 4CYDA 1W5TA 2P7VB 2EV5A 3FM5A 3TKYA 3O3KA 4A6EA 4I02A 1V4RA 2Z5UA 3KETA 4ENJA 2DFIA 2K02A 4I09A 4OIOF 2QUFA 5HLHA 2DQRA 2DK8A 3OOPA 1TQPA 2XROA 1R58A 3WTTC 2GQQA 1JXSA 1YYVA 4LFUA 1ZARA 3V7SA 3GW2A 1OPCA 4WXHA 3C18A 1GXPA 4F7ZA 2QENA 4YFXF 3SFZA 4PDKA 3K0LA 2CG4A 1KQ8A 1QPMA 2H6CA 3L00A 3LA3A 1R5GA 1FP1D 1ZAOA 3BDDA 5E8GA 4ZYDA 4S04A 4PGGA 3NRVA 2PMUA 3V7CA 2M45A 1IRFA 3E5UA 2NNYA 3CO7C 5DUKA 1BJAA 1HW1A 3F21A 2GA1A 3B02A 3I4PA 3BWGA 3RYRA 1RIOH 1F9NA 4LGWA 1JHHA 2OA4A 5F64A 4PZJA 1KYZA 5CVVA 5DCMA 3I0TA 2MH9A 1OR7A 3IHUA 2O0YA 4HF0A 3V8KA 5K5RA 1K79A 2QQAA 1FBUA 3V8LA 1QQIA 4A0ZA 1T0FA 3RKWA 4HF2A 4HLXA 3WTZA 2OQRA 2VBWA 5FD6A 3F8CA 1Y0UA 4E70A 3F8MA 3FMRA 4OIPF 3GFMA 2Y75A 4FHTA 4WX9A 4WF2A 2PQ8A 1XMAA 5DUIA 4H0EA 1ZRDA 3MWMA 1I1SA 1DPUA 1FLIA 2F2EA 1IAWA 1G3SA 2EV0A 4RGRA 4L0ZB 4R1HA 3HRSA 4HA8A 4MEYF 1S7AA 1Z6RA 2JSCA 3U9GA 4HV6A 1WSUA 3VFZA 4A0XA 2Z33A 3PFIA 5E1WA 1LJ9A 4HX7A 4S05A 2EJRA 2ESHA 3CUQC 1SMYF 2RC4A 1KGSA 1ZG3A 4CO8A 2FMLA 4OOIA 3IC7A 3IRRA 1YS6A 1K6OA 1TBXA 3HUGA 2GAUA 1W4MA 2GXGA 3V7RA 2K4JA 3GXOA 2HWVA 2JPCA 4A2UA 2XVCA 3HOTA 1FYMA 5D4SA 5BQTA 2ETHA 5DD4A 1XGMA 2ZBCA 3WTXC 4JBAA 1XGSA 5FFZA 3QRFF 1KU3A 2JT1A 4YFNF 3BOQA 2Z4PA 5BOXA 2CGPA 3FZVA 4MGRA 1TQIA 1MGTA 4N9IA 1SD4A 2A61A 5CYVA 5HDKA 1BN5A 2RN7A 3WTWC 2P5VA 2DPUA 2E1NA 3FF5A 2COMA 4M6YA 4A5MA 3GF2A 4ZYGA 2EFPA 4WK8F 5A2QK 1U6GA 4A6DA 2LKPA 2DU9A 2OZUA 4ENMA 1ZN2A 3DF8A 1REPC 4CHUA 1B9NA 1P4AA 2CSOA 3E5XA 3QU3A 1IN4A 5DEQA 2E1AA 3VODA 1ZG5A 3KP7A 5D5VB 1P92A 3DEUA 5ICEA 1FYKA 4ZZLA 4CZZA 5D4RA 4L18B 2FEZA 2EV6A 3GX4X 2XAGA 4KMUX 4HQMA 1SAXA 5J8CA 1WKMA 3K1PA 5LRSA 2PMHA 2VC1A 1IN6A 4I7HA 3BY6A 3BPXA 2WWYA 4CXFA 2DW4A 1E17A 4LLLA 2CVIA 3WU1B 3T5XA 3HSFA 1WI9A 5DV5A 2H94A 2Y48A 1Z7UA 1PDNC 1BM9A 2VOOA 4DNCA 2LSOA 3EYIA 3H3ZA 5HS8A 2NNNA 4U88A 2P6TA 4ASNA 1SMTA 4AWXB 4ZYHA 4Q5SF 5FD5A 1P2FA 1R5HA 1W7PA 4BAYA 3LFKA 3Q5FA 2G9WA 2RQPA 4L9JA 5F6FA 3LWFA 4BHBA 3GVAA 3VEPA 5FO5A 3WG9A 1W7PB 4RB1A 4U7DA 3IWZA 2M5WA 1LQ1A 2KRFA 1I5ZA 2P7CB 4IRIA 3RPUA 1BIBA 3C3WA 1IW7F 2DI3A 3TQNA 2F5EA 2XAQA 1BI0A 2PEXA 3F23A 2DTRA 3DFGA 5HVQC
chains in the Genus database with same CATH superfamily
1B3TA 5JVHQ 1N52B 4DV3J 2W9BB 3M4XA 4RGSA 5FLXU 4OI0A 4LG0B 1YO5C 3QOPA 3R7BB 4OJ3A 2XLJA 3DDKA 5FGMA 2XYGB 2RV8A 1BC8C 1FRMA 3S6EA 1RK8A 2LKZA 3BZ6A 3QAUA 5HJXA 1IZ1A 2VJIA 2J5PA 2XASA 4XIDA 3K6GA 1DQAA 4N8OA 4Z6YA 1I27A 1P6RA 2K3PA 4Q43A 2XAJA 1FA0A 3NCPA 1XDUA 2Q0OA 1T8EA 2EK1A 3PFOA 2ELKA 3CCZA 3MAQA 2RF2A 4M63A 1JLBB 1LQ9A 2M4GA 4UVBA 1KBRA 4OZ1A 3OR2C 4I2QB 3PSFA 1HPZA 3D1OA 4BC7A 2EFGA 1CJVB 3VVTA 5L1JA 4RBUA 4R8HA 2D2WA 1MWQA 1XR7A 3HKWA 2VKHA 2RS8A 3IL2A 2HI3A 2L48A 4GO5X 1Y5IB 1MZBA 1I1GA 3K5OA 1NPRA 3J7AO 2HZTA 4MIWA 1S7HA 1UJ4A 2XCAA 4FX0A 4J9RA 4PR6A 1PUFB 5L3CA 3UCGA 4NYOA 1UEKA 3DKYA 3M1VB 4M3FA 4KKOB 1X31C 3FMWA 2WB1A 1JKQC 4DR1F 4H4MB 1TWHJ 3PVXA 3OYDA 1FI4A 2X6OA 1XQIA 2HDCA 2QT7A 5J4VA 2QLZA 4KNYA 2GXBA 2BYVE 3H9GA 1X3WB 1J2VA 2OEMA 2M7AA 2M87A 2UXXA 1H0HB 3LQRA 1JLAB 4LF8J 4ES3A 3PYFA 1BW6A 2FA5A 4LFBJ 2CQIA 3CDIA 3BKUA 5JLXA 1J75A 3KMSA 3RW7A 2V1UA 3ZQFA 1RAEB 1JLFB 4OYPA 1VOMA 2CADA 3PKYA 2JJ7A 2LG4A 4DSEA 1YJTA 1BHNA 5D0RA 2WZ1A 3T8TA 1UW9A 3EM1A 5D4OA 2L4MA 1G8XA 3WTSC 4ZCLA 2L02A 1YBUA 1YJ9S 4X65J 4LF7J 1SKUB 2ABYA 1RWUA 2B8QA 1WTFA 1ITYA 3BBBA 4FYXB 2LD5A 1FRKA 2DHAA 4Y33A 2F8EX 3CMEI 2HGMA 3MHYA 3FXQA 2CAJA 2CV2A 2Z56B 2HQRA 2J7KA 3I55S 3FM3A 3G82A 2M9HA 5CLSA 5LEKA 3H4BA 4C8KA 2D74B 5GAHU 3GYGA 2ACYA 2WHOA 3AB2B 4PXEA 4RBOA 1YE9A 4MJKA 5KAFC 3OR1B 5CQGA 4M3DA 5E8IA 2JEFA 3B6CA 3GLXA 1BR1A 3DBLB 2GFFA 2MJUA 4B8XA 2W7AA 4A8FA 3RG6A 5KFWA 4NB5A 3A8JA 4P72A 2COBA 2QZ8A 2LY1A 1PJ5A 4IG0B 3K5MA 3SSRA 2HPIA 4A93J 2GS8A 2VG7A 3QQAA 3ISPA 1UEUA 3CUNA 4DEZA 4PWUA 4GVBA 2C28A 1IBKJ 1IM6A 2DK5A 2JWNA 1MH3A 1YX3A 2Y30A 4B3AA 4L9NA 3BJOA 4B3SF 3TQEA 2W48A 2IMWP 2XF6A 1HWIA 3SQNA 5DRKA 1JJ6C 5J6XA 1T33A 1NK7A 3P9KA 4NA2A 3TW0A 3L2VA 3R61A 1QVUA 2GA2A 2KJCA 1MNEA 1TFYA 3DTIA 3TMOA 1RWNB 5HLFA 2ADCA 4HSTA 2R7RA 2NREA 1XK8A 2G0EA 2BJ7A 4ZP6A 4WK1A 1YJWI 2VUGA 2PSZA 3QSIA 2A1BA 3WQPA 2OPSB 1GXLA 1E3PA 3HSJA 1Z05A 4KGVB 1JE8A 1EH6A 1JLQB 2ZD1B 3D1NI 3NAHA 2FJBB 1FT9A 4YIRX 4MYTA 3LSPA 1U5TC 3BGOP 3NS6A 2OI2A 4F52A 4KDPA 3VAHA 3MEEA 4I98B 3HSZA 3HTSB 2VDHA 2QF7A 1U09A 2JRTA 3MUTP 2C1EB 5E3AA 4DV0F 3ZP5A 3NEUA 1DJ0A 2B4UA 2IDEA 1N54B 3OT9A 1Q81T 2DGQA 5IFMA 1YRNA 1LW2B 1XSDA 3PEHA 1B72A 1AXQA 1R00A 2ZB9A 1TW3A 3QPIA 4KH1B 3N6NA 4XRSA 1NB7A 2JDJA 5A76A 1UG0A 1Y0NA 1W25A 1J0RA 4RGXA 3VAIA 1VQ5I 5HQMA 5EYRA 2EK5A 5E1ZB 3DCAA 3BEGB 3N0VA 1X1PA 5F9LA 4ELTA 4QOTA 1NDPA 4CH1A 7FD1A 3IRXB 5KFGA 2BOPA 2W00A 2K3IA 2ZSHB 2Y8WA 2Z58B 3KUGA 3JXOA 4K4TA 3HEFA 4CI0B 3W2WB 3J81U 3HUGB 4NA3A 2DPJA 4I67A 1ETQA 3PDNA 3K8WA 2Q3PA 1JXVA 4IKAA 1W1WE 2HG4A 2XC7A 1FTZA 2APOA 3THVA 1I3OB 2XMJA 3QP5A 4DX8H 3RRHA 3NMAA 1H2VZ 1NH7A 5C42B 1SKWA 1J5OA 2WV0A 4X4NA 4AYBD 4UVAA 3HHKA 3WGIA 4BY7J 5CZXA 2H1YA 2XB2D 4NRTA 2Y0MA 4PFOA 1CEZA 2JVGA 3JTGA 1FZPB 1R8HA 4HW0A 2YKPA 2Y9ZA 2I8EA 3ZZZA 1S1TA 2KJWA 3R5BA 2YU3A 2W2QP 3CJNA 2HLTA 4OZ5A 4JI1J 3SDBA 1HNWF 1URNA 2H09A 4A5NA 5ICFA 1G1XA 3QT6A 1NK2P 2YKAA 4F93B 1RHJB 3GSDA 5HS9A 4XRMA 2EIKH 3E2EA 4HL9A 2IY5B 3S32A 1GV2A 2RSQA 3DYAB 3TAMA 1R8PA 3DLGA 3GV7B 1FK9A 5B7WA 2RKHA 3KUHA 3J7ZI 1PILA 3GTJJ 2R3SA 3LWMA 4CCOA 1R0AA 2ZBIA 3FXUA 5D6EA 1WHYA 4ZVOB 4WTYA 4HI1A 1E2XA 4RU2A 3T3FA 3BGUA 3WX4A 4ZIVA 1WKLA 5BXIA 1UFMA 1XN7A 3OL4A 2EI5A 1L3VA 1X9MA 3R5CA 2I10A 4KT5C 3CP2A 4QYZJ 2ZCWA 4DQ2A 4JB8B 3WE3A 4A3CJ 3BSOA 3O5TB 4QYRA 3LWLA 2IHR1 3W9JA 1Q1HA 1VZ0A 4Q47A 1AKHA 2KYXA 2DNYA 2ZWPA 3TJ8A 2CJQA 2HZCA 4RPFA 3GZ6A 3OOUA 4F04B 1VDHA 5C25A 2C6YA 3L09A 2DTZA 3QBCA 1NJIT 3IKTA 4H4OB 4KO0A 1ZBTA 3ZOBA 5K1YA 3GZ7A 2HHVA 3J7YJ 3JB9k 1GMVA 1ZM9A 4RW8A 1Y3KA 5B1AH 2HPMA 1P7IA 2CQ0A 2FUG9 2AHQA 2QV6A 1NJXA 1RR7A 2YX4A 1VQSA 3DDIA 5DZ6A 1MMNA 3H20A 3KYLA 1RTHB 4HV5A 1UA1A 1ZPVA 2VH7A 2MQOA 2YNIA 4RUBA 2DNGA 4MQ9F 2IDLA 4B9NA 4BE0A 5E33A 4DR2F 3QRPA 3CJTB 2ISYA 5KG2A 2ZMEB 1FTTA 1OS5A 1I3AA 3MD2A 3AOAA 2Q79A 1WORA 2WSFC 2ZZTA 2NS7A 3MAAB 2JA2A 2K3FA 3SFGA 3BQYA 1IRGA 3KLFB 4ZLJA 5EJCA 1ZR2A 3MCNA 2MZQA 2VV5A 1O3QA 3F6VA 1R22A 1VRTB 2VIXA 1LWCA 4BXUA 1TNSA 1BR2A 3FDSA 3RRGA 1N5VA 2V4JB 2V1XA 3ZZYA 4AL7A 4CICA 2AXLA 3QWPA 2CV1A 2J9EA 1H72C 4NLSA 2BY3A 1U02A 2DPIA 4XIUA 3LGNA 2LMIA 4I2PA 4OYAA 5D3GA 2X1BA 3K2ZA 4KUMA 1UCNA 3MFHA 2DBBA 3M2UA 1SB6A 4CYCA 3V6HA 2O6GE 1EKEA 2R7SA 5CXTA 2KKOA 3I9ZA 1LW0B 3I0RB 1EKRA 3E8OA 4F92B 3NGKA 1ETYA 2BRKA 5DS7A 4HG2A 1UMJA 1ETWA 1CG2A 5FJ4A 3ITHB 2RRAA 4AQYJ 2MY7A 3OS0A 3DP7A 3FMSA 1KFDA 1HBOA 1TKTB 2K4BA 2AEMA 2OFGX 4PWDA 3R0AA 3CO9A 3EDPA 2MKJA 1A31A 4Y2IA 4FTHA 3OR2A 2E1RA 2AJFE 3ZMUA 3N4MA 4FT8A 3ILJA 4K4VA 5FB2A 1ZKGA 3LA0A 5CYMB 4MEXF 2IM3A 2ROGA 4A48A 4NC7A 3JTNA 2DNOA 2LFVA 3PX0A 2FMYA 1X3ZB 2BVZA 2HAFA 2QFJA 2GGPB 4ELUA 1HBUA 4ER8A 4F0KA 3TEDA 4BL0B 2FSWA 3IP4B 2XGPA 2IA1A 3T1YF 3E5QA 2NVTJ 2GHPA 3M8QB 2GIZA 3BB5A 2CA9A 2BQ3A 4QWQA 2XKOA 4CZCA 1GVDA 1TL4A 4PPZA 4P96A 3LP0B 1WJCA 3SZ2A 3KZIC 2V9VA 5HN0A 1ZOTA 1B59A 3DLLQ 3MAJA 3B4MA 4WIQA 1S1WB 2E29A 2ZKUA 5HLIA 3JRFA 1SI9A 2W7OA 2YNHA 3EETA 4A0YA 4UNOA 4M9SA 3U21A 2B5JB 3DRRA 2UP1A 2GWRA 1YITS 3G4SS 5H6QA 1X5PA 1OMIA 3LUYA 4ZHRA 5C4XJ 2M4KA 2CUFA 4KHPJ 2KB2A 1X4PA 2MC3A 3H42A 5IZHA 3TOBA 3CCQS 5CVRA 1CS4A 1FEHA 3F22A 4QU6A 4ECQA 1HA1A 1OCTC 4IQMA 4EYHB 2VHGA 1T3NA 2OV7A 2UZKA 1U78A 2MMYA 2WVFA 3T5KA 4ON0A 2A6TA 2B3TB 2FUG2 3W2VB 1UVIA 2HZAA 4UF4A 4LQ3A 3RKYA 5A6PA 1D09B 4NLVA 4QIEA 2BANA 2MABA 1TVRA 2DH7A 2MJNA 5HODA 3UDVA 3KTQA 2R7VA 3ISND 1UFWA 2MH2A 4R8UA 1MSEC 3U1DA 2X1EA 3CJQA 3VF0B 4IG3A 2QX0A 3FRZA 2ZJQF 1TAUA 1S4EA 4X4QA 4P1WA 4E8UA 1MJ9A 3ADAC 1HSTA 2YNGB 1V3SA 2R8GA 2ILZA 1RJJA 1W2IA 5IOZA 1K8AT 1KYWA 3D0IE 2XAHA 1HI8A 1FF2A 1U1QA 1RAJA 4PYDA 4L5JA 2XSJB 4DV1J 4M1KA 1J5EJ 4LJMA 3FWEA 3N6MA 2HIYA 2M5YA 1OSDA 4XONA 5LLQA 2W7NA 3CJ5A 2V26A 1M5OC 2DGTA 2IPQX 3TAPA 4UZCA 3G3ZA 1IDZA 1S9FA 3ZQIA 4B02A 3W5ZA 4WE1A 2JFKA 3JYTB 1A7GE 1XC5A 1U2RA 1JGGA 3S2HJ 3KJNB 3CLQA 4P73A 1T8IA 3S2DJ 1MU2A 4FF1A 2K06A 4P9SA 3QFWA 2HHPA 4USUA 4DR3F 1W5CC 1ELOA 4GRIA 1IN0A 5KFUA 3OYKA 1S1VB 2XHCA 3F8FA 2OPRA 1B1BA 3LH2S 4BDYA 4II2A 2ZBPA 1T0FC 1TW2A 2FF4A 1GAOA 3CJ4A 5HLTA 2XMKA 3SZTA 5H20A 1KD1T 3GTKJ 4N76A 4CCHA 1QVGR 3VSLA 3GJQB 2VPXB 2QLBB 3CMAS 1HL6A 1WC1A 3PNVA 3H5NA 4QU7A 4Z2YA 1IM4A 4B9MA 2AQ4A 4UZBA 3RB6A 1T6SA 1RUNA 4AYBA 2HFOA 2ZJ2A 2HPUA 1YLFA 5A8WB 1DRZA 3MM9A 2H8RA 4I6WA 3M6XA 3IV5A 1XMOJ 5B0AA 1NO8A 4M95A 1C1CA 4Z37A 4KTQA 3GZ5A 3NG8A 2V7FA 3K7AJ 3R5JB 4M71A 4JP8A 2HQ5A 2MHNA 2FB0A 1SH0A 2EA2A 4ANCA 1S9GA 2YKMA 5TJJA 2F5CA 4CDGA 2K2PA 2FQ4A 3C6UB 4J7CA 3DPLC 5DDQC 4RW9B 1E3OC 4W92B 1HNVB 3IKVA 3SQGA 3DXBA 4XLEA 1GH8A 3QU6A 4AVZA 5F0UA 1KQ0A 4M94A 4EQQA 2M2BA 1ON1A 2QVOA 4IDKA 1C0UA 5FKMA 4FCYA 4IF4A 3M05A 4YFUA 2K7JA 1D8ZA 1A36A 3D1HA 4KT0C 2YR2A 4JI0F 1FYLA 4U0YA 3WTUC 4PG8A 4DBQA 3H4DA 4OAYA 1OYIA 2FZCB 1VBZA 2CQPA 3HO1A 1JKHA 1JMTA 5IP6A 2IRFG 3RYLA 1HHTP 5IP7J 1UVKA 2XMTA 1WVRA 3H5SA 4DPXA 3ASOH 5CD4H 4K4UA 4E7JA 3LP2B 5HI7A 3L7OA 2UUCF 2ACJA 5EEHA 3I58A 2CPJA 3K1NA 2FLOA 1WG1A 1MG7A 2EBIA 3CC7I 2W4PA 3L4BC 4RNOA 3KZZA 2HHTA 2Q2EA 2EINH 1RWOB 5EUHA 1FBSA 4PQUA 1SD5A 1XDSA 2W24A 4LF4J 1HR0J 2R92J 2NLWA 4B3MF 1H2TZ 4O3SA 5I3UB 2IVFB 2UUTA 4KIBA 2IM1A 2BJ8A 5BNGA 3RAMA 2PJRA 2DXIA 4A8MP 3V81A 2V9PA 1N48A 1QNTA 3WTYC 4EEFG 4ZZDA 1HWKA 2DR6A 3UN3A 2UUAJ 2HKXA 1K78B 3V6DA 1XEZA 2L9DA 1IXRC 2CPXA 5GAEU 1VQYA 2DNHA 1H73A 5H9EK 1YI2S 1NU4A 4KV8B 3P5BP 1FX7A 4AT1B 2YS9A 3QP6A 5GADJ 2VXDA 2V69A 2CJXB 4WWCA 2J0WA 2WSCC 2OJED 2JMWA 4JV1A 2X9DA 2QSFX 1HKAA 3IAS9 3SEZA 1V5FA 3Q9SA 3OL8A 2XGQA 4A47A 4BKXA 1QBJA 4YDDB 3A03A 4O0IA 2KM8B 3SXYA 3KHGA 1DARA 4YR3A 4ZVEA 1TMMA 1S29A 4U8YA 2BE7D 3L2CA 2KL8A 4X2BA 2IS2A 3KYDB 2ZJPF 4OHVA 3MEXA 4K7QA 2WA0A 1L5UA 4ZP8A 3V6JA 4RB0A 2I2YA 1R27B 3MM6B 3G86A 2GOXB 4M5HA 2RQKA 3QJJA 4L75A 5F1JA 1KVIA 4D9JA 4ZTJA 1VI0A 2WSEC 4BBSJ 3Q0UA 1WPKA 5CPRB 3E6CC 4PEOA 5KG3A 3PX6A 4WWSA 3CCSS 2M8GX 3CJRB 3MR7A 4B3OA 1NSPA 3PO5A 3RDIA 2MA3A 2ATLA 3CC2I 3ZTOA 2P4WA 3KLEB 1PAUB 4G7OF 2EWNA 4L5IA 2DQLA 4OYBA 4OX9F 1FWZA 3LTOA 5E1XA 1K9MT 1EQMA 4FF2A 4ED3A 3BQ1A 2KKHA 5KT3A 1EETA 1W7WA 2OKQA 3C3LA 5F8IA 2HQIA 3DMJB 5HOOA 5HS7A 3HSGA 2XLIA 5KK1A 4RB2C 2YQ0A 1I6HJ 2ME6A 1JKRC 3Q23A 3G1LA 2FC8A 4UTGA 1BE4A 4ECUA 4C3MA 1YRTA 1SFKA 5CQEA 3I71A 4LG0A 2QFIA 3H2VE 3UR0A 1TK5A 1FJCA 4IFYA 1Y10A 5GAGU 4BXXJ 1GXTA 5D5UB 4LUBA 3T8RA 4KIAA 4C9YA 3S8SA 3LAJA 2D45A 2YQ1A 3TP3A 4I7FB 1X5SA 1LOUA 1IVZA 2F9JA 1ZM3A 2QG9B 5LGUA 4Q8FA 3BKFA 5L3FA 3JSBA 1VQKI 2MGZB 4YRVA 4IXAA 3OYLA 1VFJA 2SXLA 1XSVA 1JLBA 3SFIA 3ICLA 4I2QA 3EZ5A 3QODA 4CLZA 5JUMA 1CJVA 5KT7A 1NZAA 1B6AA 2J6UA 2VL8A 2VBYA 1HI0P 5DDOC 3H5XA 5ETSA 4ZVFA 1FJGJ 3EZUA 3DRPB 2ZXWH 3CCRI 4MFDA 1DTQB 2DLLA 5L3GA 1HW5A 1YJNI 1PUEE 1VHIA 4FBUA 1X4BA 4ETSA 1T05B 1PUFA 2DB1A 3FEZA 1VC0A 4GO1A 3UQSA 5CD4A 2KT5A 1NH3A 3M3YJ 3M1VA 2FOKA 2VOPA 3FSYA 4KKOA 3CCWA 1K4TA 2C2DA 4IZZA 3ILLA 4E7ZA 5FJ8J 1MIJA 3FCVA 3QAEA 2VIHA 2RU3A 2OTJI 4H4MA 4OZ0A 4OIRF 3PW2A 1S7EA 2FBKA 4IEJA 4JX6A 5DTDA 2AZ3A 2VG6B 3QATA 4ZS6A 1ZELA 2E2IJ 4X6AJ 4IHTA 1FXDA 2G1DA 2J8SA 1WWXA 4G8XA 3ILIA 1RUOA 5AJ3F 5LMUF 3KKFA 2CW8A 1FESA 3DU5A 4XN0A 5G0RA 5D6FA 2LBFB 2H6BA 4LF1A 2AEJA 3CC4S 1BUXA 1AW0A 3IAS2 1JLFA 3HX9A 3DRSB 1KWMA 2OEKA 2R7FA 4FN5A 2D1HA 4GCVA 3VQSA 4NQWB 2Q6BA 4DX5A 2NRAC 4RUAA 2MQ8A 1N5TA 4TLRA 2DR9A 2IJNA 3PEJA 1BY9A 3BQ2A 4CO5A 1BIAA 5ILSA 1I94J 4NLTA 4TLQA 2F8MA 4DR5J 1TTHB 3HZGA 4CRJA 5LGTA 3UDLA 3OS1A 4RW6A 5HDGA 3R8YA 3M1CA 2HNDA 5EDWA 4C4WA 2Q1LA 3AD9C 1PKUA 5F27A 2ECBA 2ZSIB 3O3KA 4ENJA 2Z5UA 4PXDA 2R7ZJ 3HD2A 5J1PA 2KZZA 4OIOF 4AM3A 3S93A 2XHWA 4CLFA 2DQRA 3MUMP 4OZ3A 2DK8A 3OOPA 2B4OA 4RLFA 3QLHB 3DPUA 4JV5F 1NXIA 2JWTA 5HO4A 2ZFUA 1D0ZA 4LFUA 4RNNA 2QKLB 4WXHA 2PD1A 1N6QB 5F0CA 3G87A 2UVRA 4F7ZA 4RW7B 1T9TA 4UUTA 4YFXF 3SFZA 4DL5A 4PDKA 2Z57B 1B0PA 1S12A 4IG0A 3TX0A 2H6CA 3RJMB 3DBHB 1M5HA 3O6QA 1EIYB 2FD2A 2BW2A 1KC8T 2KMUA 5KFAA 4EBDA 5C2GA 3NRVA 4X84A 2PMUA 3V7CA 4UOGA 2M45A 2MYSA 1IRFA 3HDSA 4YN3B 3MR3A 2A2DA 1JLCB 2V9WA 2W4CA 5DGBA 3C15B 3F9KA 3F21A 2MY8A 4OZ2A 3SMZA 3BWGA 1F9NA 4ZJQA 3HHLB 2JJ4D 2NOGA 1V6HA 5L38A 1E6VB 5F64A 4B9VA 4PZJA 3S1MJ 2HAIA 1KYZA 2OPTA 5CVVA 2L7ZA 3LGHA 1TKZB 3I4MJ 1Z0XA 3C2BA 4AC0A 2O0YA 3V8KA 5K5RA 2AYMA 2L7MP 1K79A 3G6ES 1FBUA 2OPSA 4M5KA 5J2QB 4N56A 1T0FA 4HF2A 3ZC4A 2OQRA 2C3OA 2ZD1A 5FDLB 3WIVA 4E6KG 3I5CA 4X66J 2QMWA 2HVEA 4B43A 2CPFA 2XY7A 3D6HB 3B8HA 4USVA 5ETOA 2HSEB 3W7BA 1VQMI 2LP4A 2KYZA 4DW6A 2OC6A 1I1SA 4LSLA 4RNFA 4RMNA 1LW2A 4XRSG 1JJCB 2O3DA 5HNFA 3S1TA 3SEQA 4XQFA 2XYPB 5C44J 3GYNA 4P7VA 2NVQJ 2YWFA 4R1HA 3HRSA 1KQGB 3U9GA 2DRBA 1Q16B 2BBEA 3J80U 3BCAA 3O8GA 2J7WA 1N4LA 3PFIA 2F65A 1HNIB 4JI4J 2HBZB 3IAM9 1JI8A 2RKIB 3HD1A 2EPIA 2R4FA 2DTJA 3GFHA 1JTYA 1UP1A 2J8AA 3CUQC 1VQLS 3W61A 2RC4A 1KGSA 4ATNA 3OJUA 3I4HX 1M1EB 3TVZA 5E3RA 1RKWA 4CO4A 2K1RA 3HM5A 3HKZN 5GPAA 1OQ6A 1XMXA 2FMLA 2MKYA 4XN3A 3IC7A 4IRKA 2MQLA 1MROB 4N41A 1MWZA 4K59A 7FDRA 1RADB 1YS6A 3W2WA 1IV6A 3HUGA 2ZUAA 1V3RA 2Y0SD 3CE8A 1VQ7S 1Y8RB 3OYGA 1GXUA 1ZA2B 2DKOB 4USTA 2QE5A 3M8PA 3K70D 5C42A 2DYSH 1RXOB 5D4SA 5BQTA 5DM7Q 4CT8A 1JLEB 2MPUA 3WTXC 3QRFF 1FCAA 2Z4PA 5J2MB 2ERRA 2A0FB 4CM2A 4JX5A 3CCUI 4EGLA 3QGGA 4BJ5C 3FZVA 3DOLA 1JLGA 3OXLA 1NM2A 2VQEF 4MGRA 1Y39A 2EPFA 1ZTRA 1Y6IA 1LNQA 3AT1B 2WAFA 4FPIA 5CYVA 1ZM4A 1F43A 2DPUA 2JFDA 3DHWC 3FF5A 5IYDJ 3W8PA 3KK2B 2COMA 3ZZUA 3AJ2A 2EFPA 3I82A 4TQSA 3HT0A 2MHEA 2HVSA 2F7VA 3KJVB 2B63J 3WC2A 4LBHA 1ZN2A 1AROP 1REPC 4CHUA 2ZOMA 4W98A 2K40A 3KG0A 1NJYA 3QU3A 4HNVA 2MDAA 3MMBB 5TGTA 4Y2CA 4CLKA 2KZVA 5ICEA 3CCES 1TP4A 3S1QJ 1JXLA 5D4RA 2A05A 3GX4X 4LF8F 3I96A 4QWAA 5A8RA 3H5YA 4RW4B 3TA1A 3OIQA 4JYKA 2BV3A 1WUUA 1RT1A 3K1PA 2E1PA 3DU6A 2AX1A 3MMAA 1NMEB 3OUYB 2JA6J 2PMHA 3BY6A 3BPXA 5K7ZA 2Z0GA 3F73A 2NVYJ 4FYVB 4OJ1A 1NTCA 2ALYB 5K8MA 1FEEA 4MH8A 4QIGA 2Y1LB 1BM9A 1D1BA 4DNCA 3D5MA 2LSOA 3EYIA 4X65F 1XMBA 3H3ZA 3VALA 3VAMA 4LG3A 3VGSA 5J2NB 2NNNA 3GG1A 3VAKA 9ANTA 5I3PA 5ETVA 2GZOA 1PCAA 3ZR8X 1QD1A 3KIOA 4XAKA 2HQCA 4EEYA 4LFCJ 2LY2A 3ET6B 4DQRA 2HNYA 4YB6A 1R8AA 4CWBA 3CJTA 2G9WA 1EJ7L 2RRNA 4L9JA 5F6FA 2I0XA 3LWFA 5D4LA 2D3OR 3EDQB 4OI4A 4JI3F 3LF0A 3MAAA 3QO9A 2W4SA 1N5QA 2BEFA 3ZQQA 1W7PB 4JI7J 4RB1A 1X5TA 5GTHC 4FKYA 4TQRA 3IAM2 2V2QA 2OUMA 1B0TA 4IL6C 1VRTA 4ZPDA 1P1TA 4CCLA 4D7NA 3W9IA 4HSRA 4LR8A 1I5ZA 4TY9A 4JOUA 2F4VJ 2P7CB 2Y1JA 3FMBA 1APLC 4RBVA 4DV6J 2DFEA 2YX1A 1RAAB 2E34A 4OLOA 5IM0B 1Q1VA 3C3WA 1TL5A 3MEDB 2DI3A 2PE8A 2DN0A 5B3SH 2ZM6F 3FRYA 1NHVA 3CESA 2W82A 4BCAA 3P96A 3DFGA 4RUHA 3QT5A 1IBKF 2KTQA 3LOUA 4WP8A 4RM2A 4CO1A 1YJ9I 3B54A 1WCMJ 1LW0A 3I0RA 4N4OB 1F5AA 2VZ9A 2IS6A 3I53A 4MNUA 4WXCA 1DHMA 1OMSA 5EGYA 2YWEA 1AWCA 5IV4A 2CQNA 2VFVA 1P8GA 2X3GA 1TKTA 2AW0A 1NNDA 5AT1B 1YSJA 2CPZA 3CCYA 4HAMA 3E51A 3I55I 2OHDA 2R7OA 5F0HA 3BTLA 2YSRA 1L3LA 3T41A 2V6AA 1QY7A 2A5WA 5IT4A 3PJRA 1YX5A 1D0EA 1WF2A 2Z3YA 4DZ6A 4FXWA 4B9UA 1O7LA 2B56A 1R71A 4FQGA 4BBRJ 3DPTA 2OBPA 3A3PB 3K5LA 1NH8A 4ILLA 4HT5A 4JI6F 2K7KA 3KOAA 4P2FA 4DR4F 4F4YA 3CEDA 3J80K 3GCWP 2COLA 2RF2B 3D3CJ 3K17A 3LAMA 4HR2A 1HQCA 3CUOA 4LB6B 1TUWA 1IBCB 3M8QA 4DUYJ 1Q0NA 1HPZB 1F0XA 4P71A 5B0DA 1U9NA 1MJBA 1DU6A 2A6OA 4IOCQ 2E1MC 3SXLA 1U2WA 5DZ7A 2HFHA 3L9ZA 4LFAF 2HNHA 2FJXA 3TW7A 1OKRA 1XWLA 2IC3A 1RAHB 1S1WA 4QYZK 2D9PA 1WGXA 2HTSA 2I38A 4N77A 2MZJA 2QL9B 3MOZA 3DXJF 1W5SA 2YKNB 1D8JA 4E98A 2BE2A 1Z91A 4Q2MA 2WV1A 1O57A 3FCWA 3GTLJ 1BMQB 3HHHA 4IO9F 4EBEA 2KIMA 3NWSA 1R3NA 1ZGJA 1G3YA 3DBRB 2DCUB 4AD6A 2EG1A 4KITB 3FKBA 2WW8A 3HHEA 2V79A 3NOGA 2J0QD 4ERDA 5EWEA 4O4GB 2OMOA 4C98A 3BG3A 3BKTA 1U1RA 1JT6A 4USKA 1Z77A 1FNNA 3PCOB 4UUVA 2NXEA 1GMWD 3CD7A 3SCJE 1DBDA 1V54H 2LR8A 3M7GA 2FHKA 2V94A 5K14A 4YHHF 2HYIB 1SEUA 1HQEB 3N6LA 5GP9A 1WZ2A 3FNNA 3DM2B 4DS4A 6AT1B 2VQCA 5HLGA 1S5ZA 3QYFA 3W6KB 1F2HA 4P2XA 3JAMK 3G96A 2HVRA 3THPA 3HKZD 3DLHA 2YNGA 4EJUA 4JI1F 1HW9A 4HBLA 3HHDA 3LP1A 3JSYA 2V5HG 4JP0A 3CCJS 4EI2A 1VIXA 2HOSA 5K5OA 3CD0A 2NXJA 3G82B 3QRQA 1PVEA 3M30B 1HKQA 2IGMA 4NLOA 3DQVC 3V2UC 3F72A 3R60A 2GOMA 2C22A 2V6EA 4DU7A 2PA3A 1LVAA 2CMPA 3G73A 3SIPB 1LFWA 1K44A 2M70A 4FETA 2DPDA 3I9V9 2KISA 4XLNF 4A3MJ 1VNDA 3JYTA 2XHKA 1RISA 3BDPA 3EGVA 3BN4A 2X4HA 4EUVA 1TT5B 4WKRA 1M90T 2IGNA 3E97A 1FY7A 3KX2A 5KFYA 4O44B 2UUZA 2VG7B 3BR2A 4BDPA 2MB0B 3CDWA 2PBIA 3SSSA 2HKOA 2GHWA 1S1VA 4CCJA 4F3OA 4RAFA 4KYWA 3ONQA 5D0HA 2VJUA 3D68A 4D3GA 3AFHA 1N78A 2D69A 1BI1A 5LJ3Y 4JUZA 4NZ6A 3Q9VA 1BXNA 1KQ9A 3GIRA 3TL4X 4CGZA 2Z9OA 1REVA 4I69A 3Q0VA 2OPPB 4A3FJ 2GAGC 1F4KA 5A8KB 1U8RA 5K5MA 4Y28C 5KT4A 3HT3A 4K2EA 1KOHA 2UUBJ 3TZZA 3BJYA 4C97A 4G7HF 1K1QA 1RABB 5HLFB 1MBHA 3AOBA 3MI7X 4ZOSA 3NMRA 2DOFA 5IC4B 5IQQA 2POKA 3FEYB 3Q86A 4TYAA 3GP9A 2X51A 1S0NA 4HH1A 5CA5A 4NHJA 2XPUA 2DEJA 2MD5A 3W6VA 2E2JJ 4CCKA 4CM0A 2YKOA 4G3IA 1R8BA 3CULA 1C2PA 1XS9A 1R4NB 3MEEB 3QPHA 3NAIA 4RGUA 1GTHA 4OI1A 2VQFF 4UY8T 1DQ9A 1YHQS 2EEYA 1WG5A 3U1LA 2DMUA 3CUQA 1F9FA 2UUWA 3NNAA 3GR1A 3Q89A 5HP1A 1YRNB 4TU8A 1B72B 3T5JA 4DV2F 1CQMA 1WC6A 4P5OA 2M0MA 4IQXA 2HQAA 1X2MA 2Z8QA 2FZGB 1I6XA 5KFMA 3G8TA 1FKOA 1T98A 2DGOA 1XCVA 4E0DA 3MGJA 3EQLF 2P81A 2XTJP 4BGDA 5C5JA 2BABA 2KN4A 3FBFA 3M9MB 2VB6A 3POTA 1RTDA 5KFQA 3HP6A 4JK1X 3HOYJ 2IA2A 5K8OA 1IWGA 1RU1A 2AGPA 1V5GA 3VHQA 3FBNB 2R5ZB 2RQQA 4AQYF 1WSVA 4F25A 4DCPB 4F4AA 1ZYQA 3KMQA 4ESFA 5KG7A 1S77D 2R2RA 1UPMB 4CUGA 2XIGA 3R9LA 2BACA 3ECHA 4XSXF 3WHCA 4M5NA 1IXKA 1QAYA 2LU1A 2XZDB 1K73T 2X1AA 4DL2A 2JX2A 4FS1A 3I5AA 3KDNA 1R6YA 4AIJA 5A2QZ 1CF7A 3AD8C 5HQ8A 1C4AA 2UWMA 4USHA 3HC7A 3Q0AA 3MKZA 1J5OB 2CQ3A 1VQ4S 1Q8LA 2DGUA 2KFZA 4C0HA 1WH5A 2CJAA 2YNFA 2IA6A 5AXMA 2K9QA 2ZBKA 3ESWB 4F2RA 4F0HA 2HYGD 1APSA 2N7CA 5F04A 4CIOA 3LQVA 1X9WA 3AD7C 4U87A 3I9V2 1LPQA 4XR6A 2OTLS 5E0OA 4CLWA 1IN8A 3FBEA 4KV8A 4LF2A 4LSZB 3ULHA 2G2ZA 2QGFB 2E5LJ 4B09A 3TAMB 4AXJA 3VGUA 3DLGB 5DCFA 3NOCA 3QYYA 3Q0WA 1FK9B 4Y15A 4UT4A 4OI2A 7AT1B 4DV5J 2VPLA 1EZZB 1FXRA 1IRZA 1R0AB 1KVKA 2W8KA 2OSRA 4GDFA 1RLDA 3ZMZA 2XULA 2EVZA 2NZ4A 1EH8A 1RAIB 1IKWB 3CLOA 2JTVA 3LSMA 4GO7X 4C2MA 2EB7A 3KNAA 4EJWA 2W25A 4TXSA 3TJAA 5J2PB 2W84A 3BG9A 1S4FA 1YIOA 4ZCMA 1OYEA 5ILVA 3LO3A 3I56I 1BGXT 3NBPA 1AKHB 2VBZA 1YRUA 2KG0A 1MLAA 1HNXJ 2HLUA 3HVTB 1VRUB 3CJ0A 1SD7A 3ZMSA 3R0JA 3BLYA 4KO0B 2NS1B 3LW5C 2CQBA 2OAZA 2XUBA 3PUBA 5THWA 4RW8B 4IRGA 1ODDA 4ANEA 1PYTA 3H3VK 1F36A 2DIVA 5M5XJ 2K86A 1WF0A 1KFSA 3D5SC 3CCVS 4LB5A 2YNIB 2XNRA 1LFPA 3K7RA 1WNEA 3OQ2A 5BPDA 3G4SI 1J5EF 5L9NA 3F6OA 1XD7A 1FSHA 3HFVA 1KZHA 3TNVA 3MR5A 2P5LC 4DL0C 4YY3J 5IYBJ 2JUGA 3J81Y 2IW5A 3K4JA 3CCQI 2P2CB 1BR4A 2CWKA 2D1CA 2RT3A 3H0PA 2ASJA 4UV8A 1UVMA 5IOYA 2EIMH 3VAJA 4B3TJ 1B4AA 1S6LA 5BS6A 3VYRB 1Z3XA 2HQ3A 2BJEA 3SV4A 1T38A 2LFBA 4EBCA 2FPHX 3W65A 2MGZA 5DG9A 2BM0A 2MLGA 2XF7A 5DQGA 2W2MP 1N32J 2L3MA 3MN2A 1WSRA 4I2PB 5D3GB 2CZ9A 3MEKA 4A3EJ 2DCEA 3M2UB 4NA1A 2JL9A 3CO0P 2EFVA 3IWNC 1GMUA 5L3DA 1R23A 1DTQA 4EVIA 1XR5A 4LIUA 3ENAA 1FMVA 4BYYA 1O5JA 1GMWA 1NEEA 4YB1P 2UXCF 4PWDB 2DHHA 2LXIA 2ZUGA 3OR2B 4ILMA 5ETNA 3W3CA 1OPZA 2CV0A 2CH0A 2FZKB 3KLIB 2HRYA 2CRGA 1PC4A 1RT6B 3IUOA 3AY0A 5EN1A 1V9OA 3NP5A 4P9UA 4AE5A 3T1HJ 4OWRB 4ZVPB 2VG6A 3GR0A 2UXBF 2IJLA 4BQQA 1XMOF 5LHGA 1YJUA 3N5BA 3HKZA 5AONA 5J1UA 1I3QJ 4UQTA 1O8BA 3S17J 1T03A 2LQ9A 3R6LB 2KDOA 4DWIA 2FQ3A 3OSGA 4OIQF 8RUCA 2FHJD 1HBUB 1VQNS 2HRUA 2CUZA 1EP4B 2G2OA 2WTEA 1RETA 4HEA9 4LIRA 4NQWA 3K57A 3CCMS 4LT6A 1NKEA 1KQKA 4M3GA 2QO3A 1X2NA 2BQUA 1S1UA 3DHXA 1TK0A 2QA4S 3AG3H 3DGPA 4C3LA 4EJTA 4XO0A 1T2KA 2LQBA 1NHKL 1PJRA 1KS2A 4FX4A 3HCXA 1XNQJ 3K4MA 3EZOA 4DUTA 3HTUA 1ZAVA 3U7JA 1K83J 1CLFA 4OJGA 4QPTA 3DRRB 2VE9A 4DF8A 6PAXA 1FKPA 2LQJA 1WJEA 1G3WA 4ED2A 4GKKJ 4OV1A 2CW7A 1XGNA 1R4MB 3MKYB 5F1RA 2PJPA 4PJJA 2XI2A 2Z30B 3QLHA 3G71I 3K0JA 2OJ3A 4DR7F 1HKSA 4PJ0C 1J5YA 2X1FA 3SZPA 2IPOB 2MLXA 4MHGA 1N6QA 1X4GA 3ZQ7A 4O3OA 2DHSA 1XERA 2WVBA 3TEHB 2WB4A 1GNKA 4IOCF 2BANB 2HW3A 4PZVA 3GUDA 2FVPA 1TVRB 1HR0F 3HVAA 1X4CA 4C6AA 4ZPVR 2F6CA 1GK8A 1QPIA 2GW8A 3L2UA 4FKXA 1TKDA 5KFIA 3TANA 2ZFWA 1KHVA 4R8UB 3TA0A 3CJQB 3H9QA 1NJWA 1JLCA 2MQPA 4IG3B 3TX8A 3DN9A 4UB8C 3C15A 4KMFA 3NGRA 4OU0A 2FU4A 2OAUA 2KG1A 4EO6A 4M72A 1SJQA 3R97A 2QYGA 5J4YA 1E6VA 4IX7A 3M7VA 5D0EA 2EFQA 5IXUA 2JVHA 2ZH2A 3K89A 1TKZA 4LMYA 2NSBA 1OYDA 4QCLA 2B9EA 2TDXA 2JLFA 5J1YA 1X4AA 2BHYA 2FDNA 3B4DA 4ZPWR 1LDKB 2CO5A 5F3ZA 3MVPA 4ECTA 1S99A 3UN2A 3FXJA 1F2GA 4NLPA 5DGAA 5ICGA 5TRDA 2RB7A 2V2VA 1H9GA 1YBTA 3DOMB 5IWAF 2W9CA 2VKEA 1F5TA 3QFHA 3A01A 1XR6A 5FDLA 1UVLA 2IGKA 4YB7A 3HL2A 1PBUA 3DKXA 2H54B 1CQNA 4WE1B 1DFDA 4HNUA 5J3LA 3OW2R 2LOOA 4ED4A 2XMAA 2AMCB 4WFAQ 4ED1A 1FOKA 3KYCB 4UB6C 3ABLH 2CQQA 1SJ1A 3IR7B 1PP8F 1VQ8S 1TLHB 2IBDA 3UI3A 3ZMDA 1A0OB 2Y8YA 3PUFA 1Y4ZB 1RTIB 2K9MA 4XPCA 4I99C 3R1HA 1D8YA 1IV8A 4LITA 4U67Q 3RQIA 4LK1F 5M3FJ 5CVJA 1LEBA 1UAAA 2XPWA 5KT5A 5LXRA 2K5CA 1IN5A 4DL4A 1DTTA 1QUVA 4BH9A 3AL0C 3PNIA 1U5TB 5HQLA 4ESJA 3TVKA 4I2OA 2VU5A 2HK3A 4LLNA 5CKTA 1N5YB 3P8BB 3CD5A 3TA2A 2RKIA 1YI2I 4NLGA 3Q8RB 4DR1J 2OF7A 4YDXA 4HEA2 4O5VA 4ZCKA 4GVLA 2MQNA 4QWDA 5H9FJ 3BP8A 2DJIA 1HA8A 2DCLA 3FC9A 4NUBA 4KPCA 2MSSA 3C2GA 1MROA 4QIFA 5HANA 1MW7A 5K20B 2CG8A 3TDUC 3GMEA 3MM9B 2GO8A 4JV0A 1WDDA 4HTJA 2RU9A 4ECWA 3GONA 3T6BA 1FO1A 1HC8A 1ZAXA 3BO3A 1G4DA 2ZHOA 3GFYA 4BNCA 3T0YA 1S9GB 2I9SA 2YKMB 3NY0A 4L9TA 2VF3A 3RB3A 1PC5A 3OTBA 4RKUC 2B7EA 4K4ZA 1MKMA 4ZN3A 2QL7B 4ZVSB 2QBYA 3SQGB 1IG7A 4G6DA 4DG1A 5J2MA 1Q79A 3GFLA 5E3NA 2NUHA 2XGCA 1KN6A 4F3MA 1UELB 2OCEA 3K2YA 1ZRFA 3CCSI 4F02A 4IDKB 2DT9A 4J9VA 1YWXA 1WI3A 3D5LA 1FBQA 3MPWA 4ED0A 4O3NA 1TMJA 1FVQA 1OFCX 2RDJA 2D7SA 4DZPA 3JSOA 2BXJA 1YJWS 1RHKB 4B9TA 3HOUJ 4ECSA 1DP7P 2UXDF 4AL5A 1AA7A 6FD1A 2IM2A 5KNLA 1HMVA 2HFNA 1L3SA 1TUGB 4P55A 4MIAA 4GKJF 3TARA 2QIFA 2AYEA 2V8DA 2E1CA 1U48A 3OL9A 3PM9A 1O6XA 5LFAA 3CTAA 1HD0A 5FLMJ 4MAKA 4NCAA 2QM3A 2N3OA 3TP2A 1RKJA 2M0CA 2Y2ZA 2CNOB 1B70B 1S0VA 3DV8A 3OTCA 4CQ1A 3C1DA 2J6TA 2BYCA 2I1RA 3HJEA 5HJYA 3OUYA 2PJRB 2CQ4A 1QHHD 2ASDA 3WDOA 1HBNA 3KUEA 3V81B 3RCOA 3EVMA 5K5QA 1VMBA 4B3SJ 2OPQA 5LHHA 1PYSB 4I1TA 3GLLA 2BGCA 2WRMA 4NLXA 1SQEA 3CDHA 3K9TA 2RDPA 3W6JB 2F5VA 5KVRA 1I94F 3OYCA 4DFMA 5J2NA 1SFOJ 5ETQA 1VCTA 3KLVA 2JLGA 4AIHA 1U9OA 2WAQN 2I5UA 1ICEB 2OSQA 1I39A 5KFXA 3ET6A 5JFRA 3HOSA 3M8SA 3GCMA 4J9KA 4PUSA 4IRCA 4M3BA 3AQOA 3MPVA 4L76A 4DV4J 2ZVSA 2HQGA 1ORKA 2AO9A 3TAQA 2XYHB 2W57A 3ZTRA 1JNZB 1VI7A 3WC0A 4BACA 5L8RC 2F4MB 2QSGX 4PQAA 1Q86T 5D8LB 3PACA 2BA9A 1XJWB 2IM0A 2VASA 3H59A 3BR0A 3GCXP 3BC8A 1RHMB 1HFEL 3UDEA 1YJ7A 3HXLA 2VPRA 2ZNZA 2E7XA 4IVNA 1WELA 3HJVA 1TTYA 1ZPWX 2MD0A 2WVEA 3IRWP 4ECZA 1RWVB 4IUFA 3T1BA 2CJKA 1RA6A 3GFIA 5IM0A 1DP3A 3FQKA 2C2MB 3FKJA 4MK7A 4B3OB 3DGVA 3P49B 4JQFA 2ROEA 1USSA 2DA6A 3IMQJ 1WWHA 1IBMF 1YIJI 3ZQGA 1FXLA 1UG2A 1N25A 1QO0D 3DXSX 2FY1A 3QQCD 3EX7B 3I54A 3HF5A 3R3TA 4WBFA 1PGZA 4DYCA 1HLWA 4MK8A 4L6V3 3PQKA 1U4BA 3ZQLA 3A1YA 1BD6A 2IAJB 2PFDA 4DLEA 3TUIC 4XK4A 2RAEA 4KISA 3ETMA 5L1KA 4P9FA 3S3MA 3KP4A 2UU9F 1BOBA 3R6SA 1HOMA 2F63A 4IFYB 1OCZH 4BLGA 1T56A 1EB0A 1ZHFA 2DDBA 1U2CA 4O3PA 2XC9A 1F3FA 4A8YA 2KRHA 1HLVA 1T9YA 2BW7A 4AIKA 3I59A 2QMUB 1GLNA 1KU7A 3QPLA 3NS7B 1KU2A 4NLUA 2ACMA 3MKWB 3OJSA 1VBXA 2LKSA 1G6NA 4RS8A 3J7ZT 2GQ2A 1KRPA 4CDIA 4J9NA 1I50J 5KFJA 2ZITA 3HSRA 2NPIA 2ZXIA 1HNWJ 2IBKA 4H4KC 3KZYA 2OIHA 3RPUD 3Q8YA 1U8BA 1URRA 3M2RA 3KHHA 4PGHA 1IUFA 1LWXA 1JWWA 3PSIA 1JIHA 3BH6B 2RUGA 3JQKA 1XTZA 2AV5A 3QGHA 2AIRB 3F8NA 3LSHA 4Y7NJ 4BE1A 4M3EA 4EV0A 4YMEA 2YKNA 2ZJQQ 2LDIA 3CJ2A 3J7A1 4V2GA 1B7YB 4Y3OA 4NC8A 4FF4A 3MCSA 5ILUA 2M8HA 4KGZB 3QWUA 2DT7B 2XI3A 5AXLA 3E6MA 2HHUA 3CQZJ 5HMZA 5FLVA 4OIXA 5A2QU 3RB0A 1TC3C 5IV3A 3BBFA 2B4VA 2VE8A 4B4CA 1F5CA 1R49A 4O4GA 3QGPA 5HMXA 2MZ1A 1Y8QB 4HYKA 3JRAA 1TWFJ 3SDGA 1OY9A 4X0GA 5G0RB 1WH7A 4J5OA 1RBLA 4RAGA 2HS0A 2L9SA 2CNKB 2LNBA 2BE9B 2VPZB 2R5YB 3GSIA 4JX4A 3FHNA 3N9UC 2L7KA 3RBEA 4ZK7M 1HQEA 2VQLA 2DRAA 1Z1ZA 1FRLA 4HRIA 4KB7A 3HMJG 2P7VB 3DM2A 1T94A 4HVZA 2EILH 3E01A 3HJFA 3FM5A 4DV7F 4IH6A 1A6QA 4A6EA 1S6PA 4I02A 3IC1A 4PG4A 3PIPF 1ZTTA 3VZIA 3WG7H 5L39A 4RW6B 2E5IA 3MCMA 2HNDB 1TQPA 4MIMA 1UZDA 3WTTC 5JMNA 3MXHP 1H88C 2BQRA 1JXSA 4XNFA 4DQSA 1ZARA 3V7SA 3GW2A 4LF6J 3M30A 3LAKA 2EIJH 2HFZA 3T9NA 5F8HA 2NZCA 3DOKB 3PM1A 2R7UA 3GWCA 3FGVA 1KQ8A 4YB5A 4QPXA 4CCNA 1R5GA 3HFZB 1CVJA 1FP1D 5F0FA 1G6BA 2PFFB 4LIWA 4AUKA 5RUBA 4S04A 4XICA 2I5JA 3LANA 4XOTA 5C3EJ 1ZETA 4C8OA 1F5BA 4BQOA 1SC3B 1NK6A 4Y00A 1HBMB 5KT6A 2DGXA 2R42A 3NCRA 3G8SA 4LIVA 3CO7C 3BT9A 2GAHC 2LLZA 5DUKA 4PUOA 3ERMA 4O44A 4K0KJ 1LXNA 1BJAA 1VQ7I 2AT1B 5GADI 2YVSA 2EQRA 5CYJA 3QNWB 4LGWA 3OYFA 2OO4A 1JT0A 3C66A 2V4QA 1KHWA 3L7PA 1UETA 1G2HA 3NAUA 2NXCA 4OYXA 2CUYA 3UO0A 9RUBA 1NPKA 2VFTA 1CJKA 1NAQA 2XEXA 1S5LC 3BPSP 1BQXA 5IOLA 3N05A 2OPPA 2QQAA 3UWTA 1X60A 5CABA 3S7RA 3V8LA 5A8KA 4A0ZA 3MMCB 2AJ4A 5FD6A 4LSNA 3HPOA 2FYXA 3CIMA 1XN9A 2HNZA 1Y0UA 2IJRA 1H38A 4ANJA 2Q1ZB 4F8RA 4DU8A 1NUEA 5E5NA 4WZQA 2V63A 1XMAA 4Q2LA 5F8GA 1O0PA 5GAHJ 3FCHA 5C24A 5BR8F 1IR1A 1SJ4P 2E5GA 4DZDA 1WOPA 2NSCA 4NLWA 3GTYX 4Z7YA 4U7UK 3QIPA 5DO2A 1EX8A 5I4MA 1IAWA 4M8LA 4JI7F 3CCEI 3GJSB 3T1YJ 2HMIB 2NUUG 2IRUA 4JI8F 4HA8A 1U26A 1CULA 2ZFHA 4LSLB 2MSYA 4HV6A 4PSXA 3G9CA 2WAQD 4DFJA 2HVIA 2VQGA 2Z33A 1VYAA 2EG2A 3R7NB 4LREA 3BR8A 4F4WA 2MYFA 2YWGA 4GRSA 4A8QA 3QZ7A 3FK4A 3G6YA 3PW0A 4C8ZA 4IH7A 1FFWB 4DFKA 1FE4A 3IRRA 2JN6A 3IFEA 1IBLJ 5IS2A 3ZNJ1 1MSWD 1K6OA 4DPTA 2CPEA 2KVQE 4M5JA 1TBXA 1KNZA 3TZYA 2ZH5A 3DEWA 3NEKA 2R5ZA 2K4JA 4EFAC 1HD1A 2K1RB 1S6OA 2OGUA 2MZSA 1W36C 3T6JA 4FASD 1J09A 3W9HA 3PO3J 5KFFA 4F67A 3JCUC 1RT2B 1BQMB 5KCMA 1AFJA 2ETHA 3F56A 2DRDA 2HQFA 2ZBCA 2L5QA 4JBAA 1XGSA 1R89A 2JT1A 3M4OJ 3KEYA 5BOXA 3MM5A 2KVIA 1QLNA 2CGPA 1WACA 3M8PB 4I0WA 1FWPA 1FOWA 1UWAA 1KKHA 4P2MA 4DXLA 1KDNA 2ZJPQ 3OWTA 1UW4A 4JI2F 1BN5A 2RN7A 5HMYA 2P5VA 4FYDA 4Q44A 4M6YA 3DOLB 3GF2A 1JLGB 4DN9A 2ME0A 4A3JJ 4C8YA 1N34F 1B8IA 4UOHA 4ZP7A 5A2QK 3CSKA 4A6DA 3ZNUA 4C3KA 1SCJB 2OZUA 1Y5LB 1U1OA 4DUZF 1RAGB 1Y1WJ 4PSWA 4BJ6C 3BSAA 1TWCJ 4Y0FA 1LWEA 1DY3A 1YZ6A 3GB0A 2QMXA 2E1AA 4XLCA 2XMVA 4I6ZA 3VODA 1ZG5A 3X3UA 3KP7A 1W36D 4ANDA 3SCIE 2E44A 2MLYA 1TL1A 3OYNA 3TQ1A 2PO4A 1Q8KA 4QWCA 4MKBA 1NK8A 4OV6A 3BR6A 3TZWA 4R0EA 1S49A 1A6LA 2CQXA 4BE2A 2OH2A 1IKWA 4R25A 2VQHA 4OZLA 3DDNA 4EMDA 3NGUA 3G1OA 2G2YA 2C42A 4U8VA 4LLLA 5J2PA 2DNLA 4OZNA 3T5XA 3BZQA 3PHEA 1T11A 2LKXA 5A8RB 1Z7UA 1WTBA 1SH3A 2VOOA 2H65B 2N4DA 1RT1B 3MMAB 2JHEA 1U1KA 1Q53A 4DMZA 2A2CA 2CFOA 1X0FA 1K0VA 1SMTA 1W26A 3HVTA 1VRUA 4NX9A 2QLFB 3UN5A 6FDRA 5DLFA 4W4MA 3A02A 5HROA 4PRFA 3PTWA 5FD5A 4TU9A 2XZWA 1YOVB 4TU7A 2WADA 1U45A 3J80Y 1VC6A 2LRDA 4C2MJ 3FFIB 3F0CA 4ZA1A 1TL7A 3NRBA 1FWKA 2BW3A 5ETKA 5D4PA 3MF5A 4BHBA 4UY85 3GVAA 3RAXA 2CZVC 3ZTQA 2HNYB 3WG9A 2MKSA 1GUUA 1SUQA 3Q2SC 3GE9A 3GILA 3S8PA 1VC5A 4P2SA 1N36F 4EK2A 2KRFA 4Y2AA 2KQRA 4IRIA 4UUWA 4RU9A 1RP5A 3QO9B 3RPUA 2YWHA 4DJAA 1BIBA 4PFPA 4WKYA 2XBPA 4E7KA 5AE3A 4XMYA 3G1MA 2DEIA 3L2QA 1L3KA 3EUHC 1TT0A 5L46A 1SC1B 4WYWA 2BM1A 4S0MA 1OCRH 4C7QA 2LCWA 2PEXA 1RCOB 2DTRA 4E7HA 4K8RA 1S10A 1UFKA 1VGYA 3X1LB 3IS9B 3MCZA 1H89C 1TQMA 2A3JA 3BR9A 2HU9A 1U6ZA 2UV8G 2DH8A 1GT8A 2GMJA 1K7AA 1H9TA 4GGGA 2F4OB 3UNYA 5E18F 4IYQA 1RACB 2PT0A 5EX0A 3JTHA 1KLMA 4NLYA 4QR2A 4JI0J 2ADUA 3G6VA 2PLYA 2O8KA 4DR6F 3GTOJ 4HZFA 3H2UB 5D78A 3UPFA 2Z2MA 2EW9A 1VQ6I 3BSCA 3B73A 1HHQA 4CLSA 3VDXA 1T9VA 3H5RA 4V19J 1SV5B 3FISA 3HHGA 2W1BA 3CCJI 3QAHA 4I01A 1OWXA 1F60B 4OYZA 2UUBF 3J80Z 2WCXA 2PFBA 1WOOA 4WCEQ 3BGFA 3WU2C 2XRLA 2AEFA 2UUCJ 3KLIA 2MKKA 1FFGB 1PYOB 4V2FA 1RT6A 4H4KA 2B6AA 2IGOA 2HDWA 4KJZA 2ZKZA 4GYIA 4TV7A 1R7IA 3JAMY 4BHPA 5KFCA 1ZREA 3MKLA 4OHXA 5EEGA 3QWLA 4R79A 3TDZC 5CVIA 1IUYA 4B3MJ 5B0EA 4CYUA 3BG7A 3VVUA 3ERED 1HDPA 3OSPA 2HTJA 1I51B 2M8EA 1GX6A 1YW9A 1EP4A 3KJQB 4Y34A 1TL3B 3ECOA 3FXMA 4A8KA 3LSJA 1SVDA 1LEAA 2LDYA 4X64F 2EZLA 3UW1A 4B17A 2R2TA 2PGCA 4M5DA 3ISNC 2BRLA 5BYQA 3BYPA 2KFYA 5CYQB 5KFKA 1S7OA 2CUJA 2BY1A 3O1LA 1DQUA 4ZVQB 1N75A 4W97A 5E7OB 2IC3B 4KHRA 3AQPA 2ZBQA 3M1EA 5LMNF 2DNMA 2MEWA 3ZTPA 2HVZA 4MFBA 4WFNQ 1K1SA 4D5FA 4HDVA 4F36A 1DZ5A 4A3LJ 2VKDA 4B48A 4G1QB 4WTOB 2BE2B 4DQIA 2Y3YA 1Q1KA 4NDLA 3DLBA 3KE2A 3PYDA 3PFYA 1KA8A 1WEZA 3M07A 5GMEA 1ROFA 2WBRA 4UOFA 1NDKA 3SSQA 2ALZA 4XBFA 3D1QA 1S9EA 3D5RC 4FXVA 1VQKS 1QVFR 1QTNB 4Q4ZF 3E6DA 1XMQF 3JAMZ 2GHVC 2LVWA 2GO9A 3H5UA 2DOEA 4ZITA 2HGNA 3WU0A 4V19X 4NE9C 2QQ9A 2LA4A 1FJ7A 5K14B 2R3VA 3AB4B 2PI5A 2H4WB 1YHQI 5T14A 2HIQA 3J81j 1R31A 2FLPA 3I5UA 1RZ4A 4OX9J 1Y7PA 1ZGAA 3LSGA 2ZXHA 3KHRA 3DC2A 3HXMA 4GC6A 2PI4A 4U9RA 4X4SA 5IT9U 2XB0X 3C6TB 5D6GA 4X62F 3C2PA 4X4PA 3LP1B 3A3NB 4CT9A 1J27A 1JQGA 5J1EB 2EA4A 1C4CA 5KFZA 3ROUA 3KP6A 4IRHA 1WHUA 4OMYA 1X4FA 3MAHA 3IA0A 3MR2A 1WC3A 3PW4A 4A46A 5JXSA 2M0GB 1IN7A 4QR0A 3DOMA 4DJBA 4OINF 1DUXC 5M2RA 3LSKA 1S57A 2EXUA 3GJTB 1SJFA 2L2OA 4OHYA 3D0HE 5B0CA 2CQGA 1S72S 2KRRA 3HRTA 3M6UA 1O4XA 1R0CB 1HXDA 3LNQA 1VIOA 2IT0A 1FDBA 3Q8SB 1D5YA 4J01A 4F4KA 3R4KA 1FHTA 3KEOA 1WHXA 2JC1A 5DCMB 1TKXB 4FDFA 2DA4A 3AAFA 4LRCA 3UE2A 3TP0A 4L3NA 2ZZMA 3GU0A 2AGOA 4XKVA 2VPYB 2R4GA 4RWXA 5GMKa 3GTQJ 1MH4A 4DYQA 1RTIA 2M7SA 3JW4A 1VQ4I 2OD6A 4RA2A 4Q7AA 2FLLA 1SIZA 2DO7A 3CDLA 4CO0A 1S79A 3NL0A 1GFWB 3R6GB 2BKNA 2E9TA 1X19A 4ZVTB 2WAEA 2DNRA 1NDLA 1U5TA 1AHDP 2QKMB 3PX4A 3IRQA 3JTPA 1QVTA 1R1UA 1REVB 1FRIA 2ZE2A 5E3PA 1NK0A 2QSFA 4AXIA 4ENNA 1N5YA 5IT3A 4DPYA 2OTLI 5ADZA 1Y11A 4DHVA 3L95X 4F91B 4DCJB 3D7SB 1AT1B 4RDUA 1D9AA 3PYEA 1S1XA 1ZYRF 2DNKA 3Q8PB 2LXFA 4ECVA 1P4WA 5EWFA 2DT5A 4U7CA 5ITHA 2Y9YA 1H98A 2MQMA 3K58A 1RDRA 5L3EA 4FZVA 3MPUB 2M3AA 4M5IA 1SD6A 1UVNA 5M2PA 4HQEA 2X6YA 3OYMA 3DKDA 5H2FC 1G3OA 5LMUJ 2LMDA 4A3BJ 1OYWA 1EH7A 1NPPA 4IHVA 3CWJA 4YY3F 2V9KA 3HYIA 3KK3A 4UV9A 2ZVIA 1Q5VA 4YEAA 2J0XA 4NLQA 1SKSA 5CHCB 3K4CA 4B3TF 1UB9A 3MZ8A 2LQ8A 1ON2A 4BJTA 2WONB 5DM6F 1EHWA 4USJC 5I3QA 3CUQB 3O8WA 4I68A 5AIPA 2JA8J 5HP1B 5HMWA 4OL8A 4LF5J 5KFHA 1VQOS 2E7WA 5CH7B 1IKYB 2OMLA 4Q0BA 5HAOA 3GFXA 3QPTA 3TVYA 1U6BA 3EUKL 4WXWA 1FKOB 3IR5B 4LBIA 4PG5A 4DOZA 1SQFA 2H3EB 2AJ2A 4U6PA 1MMDA 4N5SA 5ICCA 2EWHA 3JRCA 3POTB 3O3LA 1RTDB 2CPHA 3RBXA 3DLJA 2PI0A 2JQ7A 3OV8A 5DDGA 4E7SA 2IRYA 4FE7A 2KHDA 3H3UA 4CO2A 4OMZA 4MT1A 1MBEA 2QJ3A 3CCVI 4W1UA 1HNZF 2DAOA 1U49A 3K8VA 3TI0A 2M9KA 4WFZA 1U0HB 4DS5A 2FXAA 3DNCA 2JUCA 3T1HF 1TZ0A 3LSTA 4K4WA 2B7BB 2FHOB 1X3UA 3PFEA 4ECRA 4DSIA 1VQMS 1CF7B 2DHXA 5CZVA 4PG6A 4A8SA 3GWZA 4BS9A 1D3WA 3BZKA 1BQNA 5T7LB 1YJRA 5F9NA 2R7DA 2FIUA 2YNFB 1UHWA 3K69A 4XKCA 3FHZA 2ELHA 4B1RA 4AD9A 2RQ4A 4LR9A 3M8FA 1GXQA 5FKOA 4RJVA 4CNZA 2BXYA 2VONA 3IH2A 3HM9A 2AXTC 2GQCA 3P5JA 2G0JA 2ZHBA 4LRFA 1D9FA 2LREA 1U1NA 2MKCA 1VLOA 4HDGA 1XNRJ 1BJZA 1SBRA 4AUXA 2PIIA 2BZ2A 1CC8A 1SQGA 3DCFA 2PEBA 5KG6A 2HHHF 4KIGA 5KFPA 5ETPA 2YKQA 4HKQA 1RWXB 2F40A 4W90B 4HX8A 1S0OA 1S8NA 4RNMA 5K7HA 4LOCA 1CJTA 4PXBA 3MZHA 3GLJA 1HIYA 1SC7A 3T5LA 2IBOA 1MN9A 4F26A 5M5WJ 3RI4A 3EJMA 4FVCA 1ZLJA 4O3MA 5DDRC 1X4EA 2FRHA 4ETXA 5IT9K 1LWFA 3TO8A 2U2FA 4HLBA 1DQ8A 1QAJA 4FBTA 1IKVA 3P7NA 3IWFA 3AA8A 3Q8UA 4K50A 1XCBA 2IS4A 3NBPB 1OPIA 5H9FK 3CCUS 2C2EA 1C1BA 4M74A 3U1MA 3W3SA 1J7KA 2GIFA 3DTKA 2QL5B 1VQNI 2HZVA 1HBXG 5E2QA 2CXEA 4O3RA 4LD5A 2CUEA 3D54A 4F55A 3H2LA 2Y0SN 1RT3A 2RDDA 3I32A 1U0JA 1HARA 2N4CA 4CO3A 2MGQA 3AXMA 2RH3A 3ZZRA 3PJXA 3R5AA 1TU0B 2KP6A 1KTQA 4PCQA 1H8AC 1FTRA 1YVFA 4A8WA 1XB4A 3RU0A 1RESA 1M0SA 5JJBA 3EUHA 1H7XA 3BR5A 3A1YG 4A3DJ 2OD4A 3EGZA 1PYVA 1FIPA 5GAEJ 3EUNA 2IAJA 2EH3A 1YBAA 1U47A 1ZH5A 4BS2A 4ZCIA 3M6VA 3AG2H 4RZRA 2O5DA 2Q66A 2LF8A 4S0HB 1NK4A 4YELA 2EC0A 3AOCA 4EM2A 4NL5A 2RGVA 2GVZB 3C19A 3OD2A 4MKVA 4KY3A 4NASA 3EPGA 1FNMA 1S3JA 4IO9Q 2M34A 2OU2A 1SANA 2M3DA 3W5YA 4DSJA 2JH3A 4A12A 3OHBA 4IRDA 3VQTA 2C3UA 1VQPS 3FBCA 1ZS6A 1FOYA 1ACMB 2ZC4A 1VTNC 3CB4A 3G6XA 3FBIB 3KLGB 1DU0A 3A8EA 2IS1A 1XGOA 2PMZN 2MKHA 3MOJB 4DX7A 2VQEJ 2JEIA 3IBWA 2P5KA 2D41A 4N0BA 3UFCX 2KIUA 4B3XA 2ZZNA 1BL0A 2P8TA 2C2OB 2YQ3A 2QA2A 4C8NA 4M5LA 2CZ4A 3ZFVA 2Y31A 3RJPA 2BE5F 1RAFB 1M1KT 3BSNA 2AYGA 2LEPA 3M32A 1KR4A 3HIFA 3OLAA 4G6QA 4BC9A 3RPQA 2VLAA 4IQ4A 3TWZA 5IT0A 1CSJA 3VR1A 3RAQA 3EPZA 4P52A 5DQIA 4IH5A 1BWVA 1UFLA 3OL7A 4BUPA 3B6BA 1RSCA 3TYTA 2DO4A 1C0TA 2NPFA 4NWBA 1VHFA 2E1MB 2HZDA 3UVJA 3DLKB 2GCFA 4BY1J 2V1NA 1PBAA 4LR7A 2AX0A 1O3TA 5JI6A 1XX5A 5LHIA 1RQ0A 4GC7A 2KZMA 5GAGJ 3OPKA 3BQZA 1T03B 1QAIA 5GTIC 2VFSA 5C4JJ 3P45B 4EM1A 2VKZG 1R6VA 1RYRA 4G94A 2AF6A 1YTYA 2R5YA 2ZH8A 1HI1A 1P4XA 4U0WA 3FBBA 1UJ8A 3ASNH 2QN6B 4MFEA 5DJBA 1ZRCA 3ELHA 1JJ8C 1S1UB 1VQ8I 3CJSA 4DYRA 5EG0A 5E3MA 1NHAA 2JSXA 3DGPB 1N0VC 4U7UD 3IGVA 3CJ3A 3VWSA 3T19A 2MLKA 5D8KB 2ZKTA 2YH0A 1VR6A 2AU0A 4TYBA 1MD0A 3P3DA 3OFFA 4IJAA 3V4GA 1UTAA 4XSZF 2ISZA 2HFUA 4UW2A 2CNLB 5L3BA 3FZBA 4ALZA 1SFXA 4BEHA 2DT6A 4KH0B 2CVEA 3CCLS 2VKRA 3BQ0A 2ID3A 3HRUA 2R0QC 2ZOFA 4D1QA 3L2RA 1FKPB 2JVRA 3AXKA 4YUDA 2IEKA 4ZYEA 3OFGA 2FNPA 2HVDA 3VZHA 1B7FA 3DOKA 4LF9J 3FX3A 3BGRB 3FMQA 4JI3J 1TQLA 2KU7A 3REOA 2A6HF 4NXNF 3TO7A 3ZMVA 2JRSA 4O3QA 4RAYA 1R36A 3FSIA 1FRXA 4RX6A 3BTJA 4B9LA 2B51A 2K8GA 3KPHA 1S48A 2CU7A 1HBMA 2VFRA 2C2RA 4CTAB 3HSDA 4DFPA 4IR1A 1Z1DA 4NCGB 4RB3C 2AD9A 1KVJA 4HF1A 1ETXA 4G12A 4B3RF 1UZCA 1J9IA 2ZM6J 3AJDA 4JYAJ 1ZZNA 4F3QA 4UOCA 2J7UA 3V6KA 1T7PA 2Z2YB 3OTOJ 1X0PA 2DY1A 4KBIA 1WQ2A 5DLGA