2IA0A

Transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
156
Chain Sequence
b'HLDDLDRNILRLLKKDARLTISELSEQLKKPESTIHFRIKKLQERGVIERYTIILGEQLKPKHLALIVLEVGKPEDFLERYISYISSTLSALPGVLFVAKSGEDKIIALVGKNNKDELVKFIEENITSIPNLKHIQIFPITEIKKGEDLTGFLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HTH-type transcriptional regulator PF0864
publication title Crystal Structure of the Transcriptional Regulatory Protein PF0864: an Asnc Family member from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 34
structure length 156
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia0A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ia0A02
2FNAA 2VOPA 4IF4A 2B0LA 2WTEA 3FXQA 4OIOF 4ON0A 3IRRA 5E1ZB 5ICCA 3R6SA 3MFKA 2OQGA 4A0XA 1XB4A 3K2ZA 1MZBA 4E70A 4L5JA 4XLNF 2OU2A 4ZYHA 1L0OC 5ICFA 3BJAA 2OAZA 1RZ4A 4U0YA 1I27A 2HDCA 2LSOA 1KA8A 2O8XA 4U0VA 4ZH4F 4JQFA 2QM3A 2ZBCA 2PFBA 3I64A 3ISPA 2O0YA 2DJWA 3MZHA 4AVPA 4I98B 2RDPA 3PFIA 5JVTA 3KETA 5E17F 5L3FA 2X4HA 1SD4A 2L01A 4GO1A 4MEXF 4OIPF 1G3WA 4N9HA 1YW8A 2DO7A 2D1HA 1YFHA 2AXLA 5HLGA 1OR7A 1FWZA 1W5TA 1FSHA 2FMYA 1XDUA 3ULQB 1CF7A 3FZVA 1G3TA 2PMHA 3I59A 1BC7C 3RPUA 3LAPA 1USTA 5ILVA 3QPHA 4I7HA 2XAGA 2NS0A 3ABTA 2BGCA 5E8GA 3SFZA 3CLOA 3IRQA 4CYDA 1E2XA 2EFNA 3FXUA 4L0ZB 2PJPA 5L3CA 1T39A 2CYYA 1IXSB 1Z05A 2P5VA 3I58A 4TV7A 4CICA 3K1NA 3K9TA 5J8CA 1HW2A 2VN2A 1B9NA 4IHTA 1TQIA 2BYVE 1BI3A 1IN8A 1W7PD 3WTTC 1YW7A 2L4AA 4HV5A 3R0JA 2ELHA 3KCCA 1R5HA 3RPQA 3JTHA 3KP4A 2GXGA 1OYWA 1D3YA 3IL2A 1R23A 2ISYA 4XBFA 4N9IA 1BIAA 2YSRA 4ZYGA 3LQRA 1KYWA 2HTJA 3BZ6A 4KIBA 4ESJA 3ZP5A 2QUFA 4RB0A 2JZYA 2QBYB 4A6EA 4L18B 3QOPA 3GFLA 4N0BA 4B8XA 5FLXZ 3H92A 1XDSA 1CF7B 2XUBA 3I59B 3IWZA 1GHCA 3JSPA 2P5KA 2FXAA 1WI9A 4XRFA 4ENMA 3QU3A 3K69A 4Q47A 5LGNA 3S2WA 3W6JB 4D0PA 3NQOA 4PCQA 2Y48A 4BQAA 2R7FA 1JHFA 4WXCA 2VBYA 3O6BB 4IHSA 3P9IA 3JAMZ 3I53A 1ULYA 4G6DA 1F4KA 2FMLA 2HYFA 3CUQC 5K5QA 3VEPA 2Q8KA 4ZZDA 1LJ9A 2HWVA 2CQKA 4LB5A 3E97A 3DFGA 3LQQA 2WWYA 1STZA 2VXZA 3TOBA 5ED4A 2G9WA 5BPIA 3HHGA 5LHIA 2XGXA 1PUEE 4RGSA 1D5VA 3E5UA 3V7SA 2FA5A 4AWXB 5FLXK 2O61A 4RAZA 2A3SA 4EM0B 1UCRA 3BPXA 4OOIA 4Y13A 3SHFA 4UV8A 2ZKZA 5JFRA 2C6YA 2Z9OA 4RGUA 3ZN1A 2O3FA 1LEBA 1D8JA 2NNYA 1P2FA 2HYGD 4LB6B 1PP7U 1Z1DA 4Y15A 2DTRA 2V6CA 2VODA 2VONA 3V8JA 2DBBA 3T0YA 5J8FA 3RI4A 1USSA 1TW2A 4F7ZA 3M8EA 4HF1A 3WTVC 5ILUA 4BHPA 1O7LA 5KVRA 1XSXA 1IXCA 3LA3A 4NQWA 5K5RA 2LF8A 3DV8A 4ZYDA 1IZ1A 1DP7P 2EFQA 3K0LA 3MWMA 5H6RA 4EM2A 5D6FA 1P4AA 4ENJA 3KP2A 1FYMA 3GFMA 1KU7A 3F3XA 2Q2EA 3M1EA 1ZYRF 2QZ8A 2BE5F 1FLIA 2RQPA 4G7ZF 4LLGF 4OIRF 3RIRA 5HLIA 2KRFA 3F6VA 1KQ0A 5H6QA 1SD6A 1IN4A 3KP7A 3JSOA 4UNOA 5K1YA 2M8EA 3CUQA 2DQRA 4FT8A 2MLKA 2W84A 4OINF 3G73A 3HUGA 4LJZF 4PZJA 4MQVA 1Z9CA 3GWZA 3LFKA 5IT9Z 1QPMA 1T2KA 5D6EA 3HRMA 4Q48A 1FNNA 3F72A 1SMTA 4RB1A 4RB3C 1B4AA 3F8BA 3PQKA 1S29A 1U3EM 1EV7A 4EGZA 4FX4A 3HIFA 4ESFA 3D5LA 4Q5SF 1R00A 3RJPA 3Q9SA 4M73A 5CJ9A 3T8TA 3MZYA 1HSTA 2FQ3A 2HFHA 3NEUA 5LLQA 2RNJA 5FO5A 1Q1HA 2KIFA 2A69F 1ZN2A 1OPCA 2QLZA 3GZ5A 1REPC 2V9VA 4MTDA 5LBQA 2D45A 1H9TA 3D0SA 5CYVA 1BI0A 2OA4A 2IRFG 3IKVA 1AWCA 4CXFA 5A2QK 1JHHA 3SZPA 2RN7A 5HS8A 5LGUA 1FBSA 3GF2A 2VT2A 4EMSA 4M6YA 3I71A 2MD5A 3CUQB 2FF4A 3EETA 2YPRA 3CO7C 4WXDA 1PDNC 2XVCA 1ZRCA 5EEHA 1FYLA 5F6FA 2P7VB 4U0WA 3G3ZA 2IJLA 1LNWA 2KIUA 3IC7A 1HBXG 2OZUA 5FFZA 1DPUA 1JGSA 1T98A 1XN7A 1W4MA 1YIOA 4HDVA 2QYOA 4IXAA 3RKXA 2COMA 2ETHA 2IPQX 2XRNA 5DD4A 1SD7A 2Z4PA 1YTYA 1U8RA 2PLYA 3GFJA 3F8CA 1MJAA 1B9MA 3RDIA 3HSRA 3TKYA 1O3TA 4RGXA 2XAHA 3QRFF 1I6XA 4LLNA 2XV4S 2R7DA 3IKTA 4L5IA 1KQ9A 1U78A 3Q9VA 1U2WA 1LDDA 2Z33A 3EYIA 3J80K 4WF2A 5IT3A 3OOPA 1UFMA 1WQ2A 4KFCA 4IVNA 1ZAOA 4L9VA 1FP1D 4ETSA 4KUMA 1YLFA 3BWGA 4CDGA 4A0ZA 2DU9A 2FRHA 1Z7UA 1XGOA 4M6XA 1QNTA 5LHGA 3BY6A 3B73A 2RC4A 3ZMTA 2YX7A 5BOXA 2VC1A 4IRGA 2A68F 2PN6A 3ML6A 2G7HA 3U1DA 1KU3A 2VOOA 3NRVA 2JSXA 2Y75A 2TDXA 2QENA 2K86A 4CO8A 1HSJA 2IA1A 1GVJA 4RB2C 1PP8F 1O3SA 2ZO4A 3GO5A 1P4XA 3T1BA 2Y0MA 3TOAA 4LLLA 1R22A 4LFUA 3EUHA 3F8NA 2JSCA 2JPBA 1J9IA 2PQ8A 3WTWC 3V7RA 2A61A 2BV6A 4OU0A 2XROA 3BROA 3E6MA 2EFWA 3HRSA 4U7BA 4G94A 2L02A 5D8KB 3REOA 2ISZA 2XHKA 2JTVA 5AIQA 4L9NA 4A5NA 1ZHFA 1P92A 4G8XA 2QWWA 4BXUA 2M5WA 3FX3A 1XSDA 1U5TA 4B09A 3LA2A 4R79A 3KLOA 2V1DA 1BI2A 3L00A 2Q0OA 2KKOA 2X0LA 2HTSA 5HS9A 4GCVA 1GXQA 3DF8A 4L9TA 3EQLF 3VOEA 2A6EF 1K78A 2JRTA 1R1TA 2J5OA 4HDUA 4HX8A 5DUIA 1LEAA 2PG4A 1C0WA 3HHHA 5LGTA 1V4RA 4BHBA 2DLLA 3KZYA 5CVIA 2Z3YA 4G6QA 2DPDA 1R1VA 1LDKB 4AIHA 1BC8C 4KMFA 3KFWX 4HV6A 1ZG3A 1MKMA 4GYGA 4ZZLA 1MD0A 4YFNF 5J6XA 2FSWA 4Q4ZF 2EV6A 1IN7A 2Z99A 3WTSC 2P4WA 2ZXJA 5LEKA 1O3QA 2E1NA 5L3DA 5CLSA 2RV8A 1EH6A 4EV0A 1QGPA 3QU6A 3GX4X 1O7FA 4QLCU 4K2EA 3TO9A 3ECOA 5JI6A 2DK8A 1R7JA 4A6DA 4A0YA 2YU3A 4L0YB 3TGNA 2L4MA 2XAQA 1FX7A 4HW0A 3WGHA 3WU0A 5BQTA 1G4DA 3I5UA 1FYKA 4PGGA 1O3RA 4HA8A 1U5TB 1QZYA 3IWFA 3DXJF 3I4PA 1RI7A 1KGSA 1HKTA 4KIGA 1ZH5A 2CO5A 1E17A 1K78B 3DEUA 1U6GA 2GQQA 2QQAA 3WGIA 3TDZC 4MHGA 4KICA 1RNLA 2A5YB 5E20A 3FM5A 5ERIA 2OQRA 1S7AA 3FF5A 5D4SA 1TLHB 5K5OA 3DQVC 4CZZA 1JE8A 3J81Z 1JXSA 4BYYA 3HSEA 4G7HF 3R61A 3WU1B 1I5ZA 4LK0F 3EYYA 4MEYF 1SMYF 5KK1A 3FWEA 3U9GA 3O2PE 2VE9A 5DDGA 3KZZA 1S7OA 3PQJA 2QQ9A 1QQIA 1P4WA 2IW5A 5CVJA 1H9GA 3WTXC 3TO6A 2FE3A 2HOEA 3V8LA 3FXRA 4WWCA 4GYIA 1OKRA 2H94A 3QP5A 1IXRC 3V7CA 1Z6RA 3F8MA 4A12A 3HRUA 3R60A 4HQMA 1FPQA 5DUKA 1ZLKA 3JW4A 3JAMK 1KU9A 3R4KA 3HTUA 3ZPLA 3L2CA 4LMYA 1K79A 1WRJA 1BN5A 1YW9A 4OMZA 3ZMUA 4BHCA 1UB9A 4FHTA 4MGRA 1DUXC 2J5PA 4EJUA 2MH9A 2P8TA 3V8KA 2EV0A 4EJWA 2MBFA 3J81K 3LA7A 1R58A 3ECHA 4O3MA 3ZQ7A 2P6TA 3W6KB 5D4RA 3HRTA 1TNSA 3BDDA 3ZMZA 2WC2A 3WTUC 1XMAA 5AIPA 2M87A 3RYRA 3LSTA 1SFEA 2KIMA 2GAUA 2KJCA 4IRHA 5F64A 1WWXA 1WSUA 2ZBKA 2D1VA 2H6CA 4CHUA 3E6CC 2CW0F 4P55A 5HLHA 5FD6A 3DKWA 3GYHX 1O57A 3GLXA 1F5TA 3VODA 2P7CB 1QO0D 1OYIA 1XGMA 5FFXA 5LEJA 1TNTA 1UHMA 3CTAA 4G9YA 4NHJA 4WX9A 3AAFA 3C1DA 1IW7F 3SZTA 4Y17A 2M30A 1Z91A 1G3YA 1X3UA 2YX4A 2DT5A 3QPTA 1DDNA 3RKWA 2CGPA 1TW3A 2VC0A 1HXDA 1D8KA 4UHTA 2VBXA 5E18F 1ODDA 2NNNA 1IN5A 4P5OA 4ASNA 2DI3A 2H27A 2D2WA 4YFXF 4A2UA 4I0BA 5ICEA 1YG2A 2RGVA 3M7GA 4UVCA 2E1AA 5DCFA 2MLGA 4UVBA 2ESHA 3B02A 5IT9K 3L9FA 3T8RA 2O6GE 4I02A 2L3DA 4AD9A 1KQ8A 5E1WA 3ZMSA 2HQNA 2M1BA 1BM9A 4WCGA 2OD5A 5TJJA 1HKSA 4LK1F 4S05A 4U7DA 1ZLJA 4HX7A 2W25A 2KJBA 4KYWA 2NRAC 1S8NA 1I1GA 1Y0UA 1NHAA 4WK8F 4EJTA 1B59A 3M8FA 1ZGAA 3C18A 3K1PA 2DAOA 5H20A 2VBWA 1J2XA 5LRSA 2HEOA 1B1BA 1U5TC 2HKOA 2FBKA 3H3UA 4EGYA 1ZG5A 1XMKA 3KE2A 2LNBA 4MQ9F 2GXBA 1LQ1A 4YFKF 2HKXA 3ZN0A 2EA4A 3FM3A 1YQAA 2V79A 2ZMEA 2LDUA 2VBZA 2DFIA 2FBIA 1S3JA 5D5UB 3MQ0A 3RYPA 4OMYA 3FHZA 3RTRA 2FEZA 3HYIA 3WG9A 2HR3A 1CGPA 3L09A 5HDGA 5LRRA 4XSZF 1ZRDA 2F5EA 2UWMA 3J7AO 4KIFA 2XKOA 4LD5A 3WGGA 3TO7A 1T0FA 2ESNA 1BBYA 4HOBA 2CFXA 4UXNA 1G6NA 4GGGA 4LGWA 3N4MA 5CVRA 1B6AA 2PBIA 3O3KA 1R36A 4EJVA 2IT0A 1HW1A 3ROUA 1R5GA 3GFIA 1AOYA 2K4BA 5D8LB 3K1MA 3BJ6A 4KMUX 3CDHA 2DW4A 1BOAA 1FZPB 1FBQA 2XIGA 2UXXA 2FNPA 2YR2A 3LAJA 1TQPA 2F2EA 5DCMA 2HGCA 1XCVA 2QBYA 3GW2A 1RUNA 3HOTA 5ILSA 2MH2A 3P9CA 4RS8A 4UUVA 2GIVA 2CWEA 2A07F 1QZZA 4YIIA 2P5LC 4H0EA 1EH7A 2E7XA 1J7KA 4KN7X 4DNCA 5L3EA 1SFUA 1BI1A 1K6OA 1SD5A 2IP2A 4I0AA 2XKPA 2ZMEB 5AONA 3HTSB 3DP7A 3R0AA 1RUOA 1EH8A 2W24A 3GVAA 1XD7A 5TRDA 1UHWA 1ZG1A 2ACJA 3F21A 3I54A 2K4JA 1P6RA 1BJAA 3LWFA 2XAJA 1ZREA 1TQMA 4KA4A 2F5CA 1HW5A 4Z2YA 3SQNA 3P7NA 4AIKA 4HQEA 4IPAA 1S6LA 4AIJA 2BEOA 2R3SA 3FMRA 4DQ2A 2RVCA 2UZKA 4I01A 2V1XA 1F9NA 4BH9A 3U2RA 2ZNZA 5LHHA 5DCMB 1ZGJA 4O6JA 2ADUA 4M72A 5BPDA 3WE3A 3C7JA 3L7WA 1FSEA 4M74A 3JTGA 2E1CA 5CVUA 3WTYC 5HOOA 1KYZA 2IA2A 4P9FA 3E6DA 2EFOA 4HF0A 5HDKA 1MDMA 4HYEA 2DQLA 5HDNA 4KT5C 4HAMA 4YG2F 5BMZA 4I2OA 1TBXA 3KEQA 2V1UA 2PMUA 1G3SA 3BPVA 5L3BA 2MC3A 2K27A 3I0TA 3KP6A 2Z5UA 1IAWA 5EEGA 2CSOA 1IRGA 3QP6A 2HS5A 1YS7A 2WV0A 3FMSA 2EV5A 3ELKA 2NAZA 3F8FA 3KEOA 3GZ6A 2W85A 3DPLC 3KP3A 2F5DA 4PDKA 1XGNA 4G7OF 4S04A 2VT3A 3GUDA 2STTA 4A5MA 4MTEA 2JPCA 4QWQA 4FX0A 2BBYA 5FD5A 1XCBA 4LG0A 4HZFA 1FBUA 5L3GA 3MAJA 4RGRA 6PAXA 5D5WB 3BOQA 3ERED 5JHUA 1YO5C 1FY7A 5DD8A 1GXPA 5DEQA 1TTYA 5JR3A 4BAYA 1V3FA 1L3LA 4XLPF 3TQNA 4HLXA 4I09A 2HZTA 2QVOA 1MDMB 3VFZA 3DPTA 1BIBA 3CUOA 3CO6C 3WODF 1KU2A 1LVAA 2GA2A 4UV9A 2PI0A 2LKPA 1IF1A 5DV5A 5D5VB 3GEZA 2FU4A 2EA2A 1RIOH 2GZWA 4IJAA 4ESBA 4R1HA 1ONVA 4JK1X 2UXNA 4KN4X 2E7WA 2AS5F 1FT9A 2EB7A 1K7AA 1YS6A 2K7LA 4O5VA 4M71A 4JBAA 5F1RA 1ZRFA 2EK5A 1SFXA 2LF7A 2NYXA 3ZMDA 2F5FA 5A2QZ 3E6BA 1ON1A 3BP8A 2G7UA 2H09A 4GXOA 3N97A 4EVIA 3ABUA 2QQBA 4LG0B 4MNUA 3VB2A 4ENNA 5CVVA 3RKYA 3WTZA 1J5YA 2MA3A 2FOKA 5E8IA 1F1ZA 1SAXA 4HLYA 4M9ZA 1W7PA 5HS7A 1WKMA 4HBLA 2HQRA 2GA1A 1ON2A 4EQQA 2O03A 3MEXA 2A6HF 2JT1A 2DK5A 2K02A 3Q5FA 3M9AA 3TDUC 4HX4A 1I1SA 1R1UA 2PEXA 4P9UA 3COAC 4EM1A 3CJNA 4ZYEA 1YYVA 4L9JA 3F23A 2OBPA 1OYYA 2H6BA 3P9KA 5HVQC 5BS6A 1FP2A 3KP5A 1LB2A 2EWNA 2L54A 2OZ6A 1FOKA 3F22A 2DPUA 1IN6A 2VE8A 1W5SA 4M9SA 4IRIA 4PGHA 5FGMA 3MCZA 1Z6TA 1ZARA 3E5QA 4R8HA 4U88A 4UVAA 2ZCWA 1T38A 1DPRA 1XSVA 2XAFA 3QAHA 3FMQA 1H0MA 3GXOA 2CVIA 2FBHA 1IRFA 1HQCA 4CGZA 4EJOA 3ZMVA 3J80Z 4P96A 3WE2A 3EDPA 1J75A 3BJOA 5FB2A 2RKHA 2ZJ2A 2M45A 4RAYA 3F6OA 4ENKA 4KDPA 5E1XA 4YIFA 1LDJA 1W7PB 1XGSA 1QBJA 2IVMA 4NB5A 1OMIA 3V4GA 4M9XA 1MJBA 3T5XA 4OIQF 1IUYA 1MJ9A 2ZNYA 1MGTA 1FC3A 5DYMA 3HOSA 3H3ZA 1VTNC 2EFPA 2GWRA 3E3VA 3SXYA 2W57A 2STWA 3KLNA 3IHUA 1HKQA 1J0RA 5ICGA 2P6SA 2ZFWA 3OV8A 2CG4A 4WXHA 3E5XA 5D5XB 2EJRA 1J59A 2XASA 4XSXF 1T6SA 4BNCA 4HF2A 2IA0A 4KNYA 3C3WA 3HSFA 1A04A
chains in the Genus database with same CATH superfamily
4XMYA 2ZOFA 1YG0A 2X6WA 5HROA 3VGSA 4MO7A 1B7YB 3OYGA 3FXQA 3N6NA 1TWHJ 2K9MA 1TQLA 5F8HA 2HURA 2DH8A 1BLUA 5ICCA 4BCAA 2LCWA 1M1EB 3DMJB 3M2RB 3IP0A 3S01A 4F52A 3JTOA 1XB4A 3CMAI 5KFHA 1TWCJ 3K2ZA 3JXOA 3DYAB 3MEEA 5K14B 4PG4A 1AFJA 2OU2A 1IQZA 3IR5B 3GTLJ 5ICFA 2FIUA 3FNNA 2ROGA 3TJ9A 4NYPA 3OR2A 2CV1A 1TTHB 2DR7A 3CESA 4ZH4F 1KD1T 2HHTA 3IS9B 3MZHA 4AVPA 4YY3F 4I98B 1IGNA 3PFIA 2DHXA 2HVZA 5L1JA 3ISZA 2XGCA 3U1KA 3K4MA 4OIPF 3WU2C 2WVCA 1WNEA 3BN4A 2DO7A 1YFHA 4HHUA 1FSHA 3Q3SA 1H2UX 3ULQB 3HSGA 2V69A 2XBPA 3TAQA 1NMEB 4X4NA 1BC7C 3RPUA 2R7TA 3LAPA 3DKDA 3D7SB 4WE1B 2EPFA 4EYHB 1REVB 4CLPA 2HAFA 3H2LA 2NXNA 3VYRB 2GC8A 2UVRA 3SFZA 4ANEA 4OI0A 4C97A 1E2XA 5J2MA 3SI8A 1WOSA 2KHMA 2PJPA 3CULA 5L3CA 1LKXA 1T39A 1OPZA 3EUKL 1I50J 2DNGA 3I58A 3KKFA 3M9NB 2AW0A 2PMZN 4GO7X 1FFWB 1FNOA 3O2IA 3QRQA 3HKWA 2E29A 1I51B 4IHTA 4A93J 3OXGA 5I3QA 4F0KA 1IKYB 3AJDA 2KYZA 4X1EA 4C3IJ 3WTTC 2DYSH 5L9XA 4XKVA 5D4LA 1U1PA 2XEXA 1GQEA 3A1YA 1WG1A 3PX6A 2VXDA 3Q0AA 3IL2A 8AT1B 1R23A 3CCUS 1RHKB 1F9HA 1IBMJ 4N9IA 1PG5B 1BIAA 5EWGA 3PO2J 4ZYGA 4QCLA 1ORKA 2DA2A 1H98A 1M5VC 3JSRA 3BZ6A 3N28A 3PEJA 3ZP5A 4L18B 2DNLA 2NSBA 2KVQE 5B0AA 4BY7J 4ID8A 5CYJA 2G2OA 1ZPVA 2CQ3A 1U9OA 4I4BA 1C1BA 2E34A 1GHCA 3M4XA 4WK1A 3T6BA 4ENMA 2DR8A 4NC6A 3CCRS 5HP1B 2E35A 2ZZNA 2DO4A 3BR8A 3UR0A 2E60A 1H38A 1RRJA 1RU2A 5LGNA 3S2WA 1J5OA 3CE8A 4D0PA 2F8EX 1RT3A 4QYZJ 1W1WE 3OYAA 2V6AA 3RZDJ 1DRZA 3EMTA 3VALA 3FXOA 1DQ9A 4GDFA 3AOAA 1JHFA 3U7JA 3T5KA 4K2JA 4L75A 3R2CJ 3P9IA 3I53A 2ZOGA 1TU0B 4A3LJ 1FRMA 3HLUA 4RJVA 3R97A 1F4KA 3MM8B 3CUQC 5CZVA 4WFAQ 1K83J 3C15B 3VEPA 1RTHA 2LLZA 4ATNA 2Q8KA 3UE2A 2B4OA 3VGVA 1LJ9A 4H4OA 4BE1A 3DBRB 3ZO7A 4OFZA 4J9UE 1CJUB 3CEDA 2GZOA 3DFGA 2RF2A 5CCMA 1HARA 4Y2IA 1V3SA 3GSIA 1WEZA 4FYWB 2EQRA 4XPEA 2QL5B 2Y8WA 2OFGX 2ZJPF 1LFUP 3OYMA 5IYDJ 4MKYA 1D5VA 3E5UA 2FA5A 4RAZA 1RR8C 2A3SA 4EM0B 4OOIA 5IM0B 4Y13A 4A3GJ 4DSIA 3PDNA 5LSRA 5JFRA 2DB1A 3HPHA 2Z9OA 4DR2J 3ZN1A 3CJTA 2O3FA 4NXNF 1N77A 9ANTA 4ZKAA 4ZPDA 2QYCA 3EM1A 5FKKA 1GNKA 4OMFG 2LK2A 1K8AT 1NJXA 4BLGA 2PSZA 3V8JA 4CO0A 2MZJA 3T0YA 1YX2A 3MM7A 3RI4A 2YKQA 1TW2A 4PG5A 1T05A 5E2QA 3PW0A 3R1LA 3D1HA 3HZEA 4C11A 3D1OA 2QA4S 1S1VB 3H3VK 2C2MB 1KTQA 2BW3B 4CLUA 1S77D 1X7VA 3LA3A 3ILJA 1JUMA 1IM4A 4NQWA 1HDDC 3AXMA 2Z2MA 5LJ3Y 3BG6A 2HFSA 2XMUA 3MWMA 2IM1A 4M5MA 5E3AA 5HBMB 3TARA 3GFMA 1JLBA 5THWA 2CQBA 1UPMB 4G7ZF 3WC2A 1S9GA 4BQQA 1R5ID 2K5CA 5HLIA 4IHXA 3F6VA 4A46A 3IAM2 5LL6d 1KQ0A 5H6QA 1JNZB 3S2HJ 4OJGA 3I5CA 3E2EA 3H0GJ 5F8IA 3CUQA 3SSSA 4CT8A 3PIPQ 2ASJA 1KWMA 5C3EJ 4LF6F 2ZWPA 1FKPA 3HUGA 4LJZF 3H20A 1F36A 4PZJA 3BSOA 5FJ8J 4OHXA 4KAIA 5KFCA 4M5GA 3GWZA 4DCOB 5I3UB 2CIMA 3V6HA 2C28A 1HPZB 3HVTA 3CIMA 3Q0VA 3HL2A 3DLLF 3KK3A 1FNNA 4WFBQ 3QQCD 3F72A 4FVCA 2L5QA 2KDOA 3DTEA 4DV4F 4DL0C 2JVRA 1UZHA 2OGUA 3FHNA 4IR9A 3ZZ0A 4HH0A 3HOXJ 3HIFA 3J7ZI 1Q81T 4XRSG 4QR1A 3FFIB 2ADBA 2D7SA 5CJ9A 1B8IA 1VQ9S 1FEHA 1W25A 2J9DE 2Y0BB 5FO5A 3MPYA 4HTIA 1QDUB 1UFKA 3L7PA 1NHVA 2R7QA 3RAXA 2X3GA 1Y1VJ 1HW9A 1ZN2A 1OPCA 2QLZA 1B0PA 3OFGA 4EGLA 1HBMB 3HVAA 1NB2A 4KT0C 1DGRM 4LF8J 4LFAF 2VPZB 1DLOB 3HP6A 1N52B 3DU6A 3IKVA 4CXFA 1H88C 5A2QK 4FP9A 1X4FA 4ZVUB 1HW8A 1IV6A 4HT5A 1CULA 3NXZA 4MK9A 4UQTA 4M6YA 4DV7F 3EDRB 3ZTSA 3CT9A 2V5HG 2W8LA 3LP1A 1VBZA 4OHVA 3PYGA 2HQDA 3I5AA 5T41A 2OTJI 3TEGA 1Y4ZB 1VQ6I 1J2VA 2XVCA 1NK6A 2CQ1A 3MM9A 4ES1A 5E5NA 3HT3A 3GG1A 3EUHC 2CUFA 1BXNA 4DLEA 4HEA2 1TVRA 4ZVFA 1YJNS 1RT2B 1TUVA 1FK9B 2CUZA 3RQIA 4KB7A 3CD7A 1RR7A 1LNWA 1KQGB 2AGOA 1BGXT 2V4RA 3IC7A 3CDLA 1MWZA 1DPUA 1TFYA 3G2XA 1JGSA 3IV5A 1DQUA 4IXAA 2Z2ZA 3VZHA 3SQOP 2XRNA 1G2HA 2WONA 2XAUA 3TX8A 3MD2A 1U8RA 1V5IB 3GFJA 4CTAB 1FCAA 1NEEA 4DV1F 3F8CA 3QRPA 1B9MA 1AA7A 4OYIA 3TKYA 3DKYA 1O3TA 2H51B 2XAHA 4ZPVR 4X4OA 2C42A 4LF4F 1QJHA 2N3OA 4DUYF 2B43A 4XK4A 1KQ9A 2PT0A 5EN1A 2I6WA 3Q9VA 3ZTQA 4CI0B 2ACYA 4ANCA 2XSJC 2C2RA 2Z33A 3OXLA 5J40A 5DDRC 4DG1B 4WF2A 3A13A 2WW8A 1S5ZA 4KFCA 4HVZA 3RBEA 1S97A 3A4TA 3GPAA 4ETSA 1ETOA 3KNGA 1UCNA 3F0NA 3JYTA 4YRVA 5IQ6A 3HKZA 2K3FA 1VHFA 3N79A 3DDIA 4ES3A 3ZOBA 3B73A 4JI6J 3U02A 1KOOA 2R7SA 4RW4A 2VC1A 3JRAA 1SKSA 4AL5A 4NUBA 4RUHA 5C4XJ 3OFHA 1TK0A 3PIOQ 3K70C 2UXCF 2PN6A 4YR2A 4NC8A 2G7HA 2EVZA 5IZHA 3CCLS 2KU7A 4MIWA 2XM3A 3E8OA 1FTCA 3FCVA 2VJ4A 2K86A 3K4CA 1WOOA 2C2ZB 2QIFA 4BL0B 2BY0A 3EGWB 3H7HB 4RB2C 1YK9A 1PP8F 2MKJA 4DSKA 1QA6A 1NZ8A 2EILH 1XK8A 1P4XA 3BT9A 3TOAA 4OHWA 2ECCA 1Q8LA 2CW7A 1UJ5A 5SZTA 2BACA 3EUHA 1D5YA 3DCAA 4FZVA 2TCTA 4YQWA 4LFBJ 1XMOF 1SANA 2BV6A 2WRMA 2ZEJA 1WHVA 2MJUA 1U1LA 1CSJA 1T8EA 3CMMA 1IKWB 2LU1A 2ZUAA 4R0JA 4MIBA 3P49B 4ECSA 3VR1A 2DY9A 3QLHB 4RNMA 3EPIA 1ZAXA 2L02A 3X2QH 3ZXWA 3Q8RB 5J1RA 1KVIA 2MJNA 3DHXA 1YWXA 3CF2A 2GS8A 3GZ7A 4G8XA 3S6EA 4XN0A 4BXUA 2WVEA 1T03B 3FX3A 4P6QA 4B09A 5JHFA 3BH7B 3LA2A 4R79A 2RH3A 4WFNQ 2VG6A 1Q5VA 4ZPWR 4EMDA 1QUVA 4JYAJ 1QZEA 3EGZA 2F4IA 1SJFA 3GTKJ 3VOEA 4NMXA 3T1YJ 2A6EF 4OYOA 2JUGA 1XNRJ 4Y2MA 2E9ZA 3DRSA 1ETKA 2XSJA 1D9DA 3NS6A 3UDCA 3LSGA 1IKVA 2XC7A 3TJ8A 4Y3OA 4DR3F 2AYGA 1V4RA 4BHBA 4XL9A 3EZOA 1GXUA 2DA6A 3KZYA 1VRUB 5CVIA 3OYKA 2BM0A 4XIUA 4L74A 3ILIA 2LRDA 2E5LF 4P10A 3DTIA 1LDKB 4AIHA 3M2VA 3H98A 4OQJA 1LPQA 2ILYA 1UAAA 4GYGA 2BJ3A 2K9NA 2FSWA 4LR8A 2YTCA 2JLEA 3EYZA 4EO8A 3DXSX 1IN7A 3NWRA 2Z99A 1NH3A 3PW7A 2F63A 4BWJA 2ICWG 2O7OA 4DV3J 1U0JA 2DHSA 2ZXJA 2E2IJ 4E8UA 1FD2A 4P72A 4F25A 2E1NA 4GVBB 5DS7A 2FHJD 4EV0A 1RGVA 1TK5A 3J7YJ 3GX4X 5HJXA 2HRUA 2DDBA 2JJ4D 4CLYA 3S32A 1R7JA 3TUJC 3TA2A 1BW6A 3K10A 2BW7A 4LITA 2YU3A 2F8HA 3WU0A 3WGHA 4B48A 1NK4A 1G2EA 1G4DA 3I5UA 2RHQB 1J27A 4AVZA 4RW7A 4PGGA 1O3RA 3WIVA 2Z58B 1YJTA 2VPXB 4YDDB 2G1HA 4UB8C 5HMXA 2KM8B 3QO9A 2WB1N 2M2BA 3X1LB 3GZNB 2GNKA 4U7UD 2IS2A 2CO5A 2AJ0A 1K78B 5ETPA 4ZHRB 3AG1H 3AY0A 4PUOB 2IYIA 4NI2A 3TDZC 5EUHA 3CCTA 5EG0B 2V50A 4KICA 4JI7F 5HQMA 1FKAF 5E20A 4X4QA 3OVSA 1UZDA 5BYRA 5D4SA 1HQEA 4H54A 1PKUA 4DU8A 3KJQB 4A3BJ 2KT5A 3G82A 6FD1A 1X58A 2DMQA 1JE8A 3SCIE 1U1QA 2RQCA 2U1AA 3J7YI 1X9SA 3HSEA 2MLXA 3R61A 4CYUA 3WU1B 2GIQA 2OJED 2CZ9A 4DV2F 4NYZA 4YUDA 4MEYF 1SMYF 3Q0WA 1QAJA 3EXYA 4B3MF 1WORA 1QE1A 3HDSA 2PA8D 2VE9A 2VJUA 3T3FA 3FDSA 5EDWA 3NL0A 3KMQA 4FXWA 3K5PA 3KZZA 3PQJA 1RU1A 2C3YA 1I94F 5CVJA 1H9GA 3PL8A 1KLMA 2FE3A 3HZJA 3V8LA 4P2FA 3HD2A 3ABMH 2MABA 4W97A 5KCMA 1BQMB 3I5BA 5DGAA 3F8MA 3CMEI 2YXLA 4LFCF 4OZ5A 5IWAJ 1ZA2B 5DO2A 5DUKA 2GVZB 4MK7A 3NKYA 3J81Y 1ZLKA 1GLNA 2ME6A 4X66J 1KU9A 3R4KA 3NMAA 3KLEA 2ZBPA 1ETYA 3ZPLA 1TKXA 3A1YG 3L2CA 1F60B 4AYBN 5A0YB 5IOLA 9ATCB 3JAMU 3HHLB 1K79A 1WRJA 2ROPA 2P81A 1BN5A 3GILA 4AQYJ 4X4VA 2HNHA 1LWEA 5KFPA 4YR3A 4FHTA 3C16B 3K0JA 2QX0A 1SH3A 1SAUA 3MVPA 2N7YA 4J9QA 2VL8A 3EX7B 2J5PA 1IVZA 1HF0A 3R5CA 3V8KA 1YBAA 2VU5A 2EV0A 4EJWA 1Q0NA 2DFHA 4P2XA 1YIJS 1EP4A 1I5OB 3ZQ7A 3AH6A 5DM7Q 1HNVB 2P6TA 3W6KB 5D4RA 2F8MA 3LAMA 3H0PA 4F92B 3NS7B 4JOUA 3J81U 5FLVA 2YWKA 1POGA 3HRTA 1UAWA 3LSPA 3MAHA 2M87A 2F65A 2NXEA 4RAFA 3I56S 3LSTA 1SFEA 2KIMA 2QSWA 2WB1D 3BO2A 4Y2CA 4IRHA 3ZZPA 1YJ9I 4PEOA 3ISNC 1NK9A 2H6CA 1UW9A 3ABLH 2X1EA 4ECXA 3B6BA 1IJFB 1X1DA 2FLOA 3OQ2A 2NQPA 3VODA 3I0RB 4FF3A 3B6AA 1MNMC 4OX9F 1WKLA 1D1AA 2ATCB 3SYZA 2WADA 1QO0D 1HKAA 1TNTA 4LBIA 1H8AC 1DFDA 4F50A 3CTAA 4C8OA 2AHQA 3GYNA 1KKHA 3FK4A 3DOMA 1WF0A 2JQ7A 1MU2A 3LFUA 2AZ3A 1P8GA 1B72A 2AU0A 1K6YA 2K3PA 2YWHA 1G3YA 2YX4A 2VPYB 1MMSA 3P8BB 3QPTA 3J7Z5 3PYFA 3RKWA 3UVJB 4G65A 2KQRA 1AU7A 2GAGC 2CPJA 1D8KA 4DSEA 3RGIA 4UHTA 2VBXA 4LSLB 3KHHA 2ZH3A 4ASNA 2DI3A 2M52A 1ZM4A 3QSYB 2WB4A 3D5RC 4F91B 2NUHA 4HNUA 3BYRA 4DR4F 3H5AA 5DCFA 4UVBA 5GAGJ 1NSKL 3B02A 5IT9K 2Y0SN 4GVLA 4RAGA 2CUYA 3BZCA 3FDYA 2M1BA 1R43A 4ZVHA 2OCEA 1IO2A 4AU7A 4AYBD 3KNAA 2DMPA 4LK1F 4S05A 2KRBA 2GGPA 3GJTB 2GJIA 3Q8UA 4U7CA 4KYWA 4FKYA 4DX5A 3K7RA 1VQKS 2NRAC 3MR7A 3S1QJ 1TWFJ 2OEJA 3H42A 1NHAA 1J09A 4PKDB 1KQKA 4WK8F 2EXUA 1JJ2R 2Q79A 3M8FA 3FGVA 2WK4A 2QEXI 4LRCA 3PXGa 3IM9A 2FVRA 5EYRA 4KR0B 1JXEA 1U5TC 2FBKA 3H3UA 5AT1B 1A5JA 2DOEA 3D5MA 4KV8B 2DH7A 4ZVSB 2IYGA 1V3ZA 4DFMA 6FDRA 2LNBA 1X4HA 3ET6A 2Y31A 2KZMA 3DLEB 4AD6A 4YFKF 4ZVEA 2KTQA 2C1EB 5CD4A 2QMUB 4DPUA 2PMZA 1FESA 1NUEA 3VV2B 1QUPA 1LE8B 1NDPA 1ZTWA 1YI2S 1P7IA 1YOVB 5GAGI 3ESWB 2V79A 2Y69H 2VBZA 1C4CA 3MFIA 3V42A 4PQAA 3LSMA 4OYMA 4WP8A 2AO9A 2IGNA 2HYJA 5D5UB 3K4KA 1F1BB 3G6VA 1WHUA 4J19A 1S0NA 3HYIA 2UUTA 2EW9A 2F4MB 2ZJRQ 3DLHA 4IEJA 3R5GA 2EG1A 2O9LA 1E6VA 1Y10A 4ID5A 3GFZA 4LF2A 5KT5A 2XKOA 1GK8A 4LD5A 2EINH 1V5FA 3MECA 2DJIA 4UZCA 3RZOJ 1AZSA 3G6YA 3H35A 2MY8A 1BBYA 4HOBA 2YU9J 3ZTPA 4TQRA 1G6NA 1KFDA 2K9LA 1Q95G 1NK7A 4CH7A 4DYQA 2VJJA 4RWXA 4LIRA 1JKQC 3SFUA 3CPWR 2WTFA 5CVRA 1SEUA 3DC2A 3M1CA 1ZR4A 3CD0A 2BZTA 4IQ4A 3OUYB 4Q2MA 2D9OA 3KK1A 1Y1WJ 3ROUA 4MYUA 1AOYA 4KSEB 5A8WA 3K1MA 2KHCA 2CG8A 4KMUX 1YJWS 5D15A 1R31A 2DW4A 1TL3A 5L1LA 4I2QA 1S0MA 2FNPA 1HR0F 4LJMA 1SVOA 5DCMA 3HGGA 3F0CA 1U8SA 1UJ8A 3GW2A 1FI4A 2BANA 3P9CA 1VC6A 1SL0A 2A07F 4O3PA 4OHYA 3QOEA 2LTPA 3DGVA 4H0EA 3Q2SC 1VQ4S 2E7XA 1T3NA 4KN7X 4BY1J 5J1EA 1RQ0A 5L3EA 2LXIA 2VFVA 4Z6YA 2R92J 2J6SA 1K6OA 4ZMMA 2VF3A 4KKOA 3ZNJ1 4I0AA 2XKPA 3B78A 2QMXA 3NWTA 2O8KA 3TEHB 3HTSB 3JSMA 4LRAA 4OJ3A 2W24A 3BQ1A 4XDCA 1ZG1A 2ACJA 3F21A 3I54A 4X65J 3RSNA 2K4JA 2DT7B 2W00A 3HM5A 1ZREA 2OPRB 1PBAA 1FXDA 1OY9A 3BGRA 3W2WB 1TQMA 1LK5A 2JH3A 1S1WB 4KHPJ 4YELA 3WC0A 2Q66A 4Y2KA 8RUCA 3OYBA 3HHNB 4J9KA 2JK3A 5L39A 4BEHA 5F08A 1T3OA 2UXDF 2ZM6F 1S6LA 3KG0A 4E2FB 1UVIA 4CCHA 1FTTA 3UN5A 4RUBA 2GHWA 2VPRA 4XNFA 3FQLA 1RTIB 3VZIA 1M5PC 3I55S 4OYWA 2BVMA 3IRXB 5E3PA 4DQ2A 4DBQA 3V5RA 4YFUA 4FASD 2RVCA 1U48A 3CWJA 3HOYJ 2VJ5A 2HQ3A 2HHPA 4M5DB 1AKHA 3DOLB 2BJ8A 3U2RA 3THVA 2CPZA 2F40A 2RT3A 3TVZA 2VD3A 3CJ2A 4O6JA 4AL6A 2CQGA 4M72A 1RT4B 4IHYA 1RAIB 3H4DA 1NKCA 4M74A 2E1CA 2EPIA 2FJEB 3QT6A 1KYZA 3FEZA 1GV2A 1IXKA 4G3IA 2EFOA 4CLLA 2B0GA 4G1PA 4HF0A 3CUNA 1MDMA 4HACA 4EZ6A 3WHBA 2G0JA 2I5UA 1ZM2A 3GLJA 1NM2A 3G6ES 1APSA 3O6QA 5EX3A 4URSA 2V1UA 2HHXA 2NS1B 2V2KA 3BR9A 2BXZA 2YNFB 1R8HA 1YJ7A 5B0CA 2MC3A 3DRPB 4OZ1A 3I0TA 3IH4A 3KP6A 4MAKA 2CZ4A 4BKXA 1CQTA 1S10A 2Q1ZB 2HHQA 3QP6A 1S9HA 1GX5A 1YS7A 2RHSB 1U6ZA 5J2QB 3ELKA 2HQAA 3KEOA 3G86A 2RJZA 1F6TA 1JJCB 2MHNA 2F5DA 2O67A 1DQ8A 4PDKA 2BHZA 2BKPA 4KIAA 1N6QA 4NCGB 2LQ9A 5KFNA 2VHGA 2B9YA 2HBYB 2STTA 1JLGB 3NLCA 2X1AA 1FJ7A 2JPCA 5A8KB 5G0RA 4FX0A 2BBYA 2JL9A 3RBXA 4K5RA 4J9RA 4CCJA 4ZOSA 3TMOA 3LAKA 1HI1A 4UOGA 4HZFA 1FT8A 2G0IA 1BC6A 5L3GA 2FY8A 4RGRA 4BU2A 6PAXA 4O44B 1OSCA 2D3ZA 5D5WB 3HHEA 2H1KA 4II2A 3OTEA 1YO5C 5DD8A 1O5JA 1S6QB 2HPMA 2K9QA 1TTYA 3EJMA 4NRTA 2CQ7A 2C2DA 4I6WA 5DM6Q 4HNVA 3CCVI 2UUAJ 2V9PA 2DNMA 3W8GA 3TQNA 2WSCC 1VQ7I 5FKLA 2ID3A 2ZH6A 3GR0A 5CKTA 1R0AA 2W2NP 2R8HA 1YLXA 3DPTA 3RCOA 1S1XB 3C6TB 4ZVOB 1K0VA 3CJ5A 1X1BA 3BPDA 1LVAA 2GA2A 4B3RF 2LKPA 2W4SA 3FRZA 4NDLA 2HI3A 5IS2A 4DL2A 4Y00A 1OYEA 2FU4A 2DOAA 1IC8A 5JLXA 1LWFA 3G9CA 1FNXH 3HFKA 3AB4B 2FTRA 2BXJA 4TU7A 1U6FA 5D3GB 4YB6A 2MQMA 3BEGB 3N01A 3R5AA 1QHHD 4JK1X 3TZZA 2BJDA 1X19A 2AS5F 2W9CA 1YS6A 2K7LA 1QSYA 1TP7A 1XTZA 1ACIA 4NLTA 1HA1A 1X31C 1EKRA 1EAYC 1FRJA 3O8GA 1B7FA 1NH8A 2AZ1A 3ZMDA 5GAEJ 4ECUA 4A8KA 4K4UA 2XMVA 5KG6A 1TELA 3RKQA 5M5XJ 4IHVA 1RPWA 2BQ3A 1M5KC 2P9CA 3RB6A 2MQOA 4LG0B 3MAAB 1S6PB 2DNHA 1WSVA 3HSJA 2HU9A 3VB2A 4ENNA 2L08A 5CVVA 2V2VA 3LWMA 3PNVA 2MA3A 5LFAA 2BABA 3C2GA 2KMUA 3R2DJ 2HFZA 3M32B 1W7PA 4CYCA 3CJQB 2MLYA 3OIQA 1HLWA 1R89A 1JLFB 1RESA 2GHVC 4PQUA 2A6HF 4O0IA 2OPPA 3Q5FA 3PFOA 3DOKA 2PEXA 1A35A 4AXJA 4P9UA 1RCXB 1XEZA 4R8UA 1B0TA 3W5YA 4EM1A 1WJCA 2YX1A 3CCMS 3OS2A 1G6BA 3PKMA 3NCQA 2OPSA 2QT7A 3DWLE 4MFBB 4QWDA 3PIPF 4F7VA 1OY6A 2L48A 2GW8A 2OBPA 1OYYA 4DYCA 2DHHA 1OCOH 1OIAA 2H6BA 3DLKA 2EIJH 2DR9A 5FROA 5BS6A 1VMBA 5GAEI 3KHRA 2CQ0A 1N88A 2NVUB 4TY8A 4E6KG 5HVFA 2EWNA 3ZQIA 4LF9J 2RVJA 2OZ6A 1G8XA 1MN9A 2DPUA 1IN6A 4M9SA 4PGHA 4RMNA 2DISA 3PG9A 5J1YA 4R8HA 1N36F 1JLEB 1MSWD 2R9LA 3W2VB 3BYPA 3KLHB 3UN2A 1DPRA 1SKRA 3DMJA 2FHMA 3M2RA 2AGPA 1H0MA 1NNDA 1HQUB 5M3FJ 1S7IA 5KFFA 3DYAA 4GFBA 5K14A 2GIRA 4BUPA 2J7WA 3PFEA 5HJYA 3BS9A 5CH7B 2RKHA 1ICEB 2CV0A 3WIUA 2M7BA 3I9V2 4LVOP 1FJEB 2E1OA 5E1XA 2KHDA 2LECA 4MLOA 3W5ZA 4PXCA 1XGSA 4FPRA 2JEGA 1OR7C 4JI3J 5D0EA 3T5XA 4FPIA 2I1RA 1FFSB 3VAMA 3E1SA 3FKBA 3IS9A 2MDAA 1VTNC 4UQGA 5KAFC 1FJGF 4P2MA 3V6DB 1NZAA 1TL4A 3BKFA 4OI6A 3I3LA 1U8WA 3K2AA 1HKQA 1RLCL 1J0RA 3UCZP 2D41A 1QAYA 2P6SA 4LF7J 4NLYA 4WXHA 2XF6A 4EYIB 3QGPA 2FJWA 3J80Y 2MB0B 2YVSA 1EJ7L 1WEYA 5KFJA 4UY8I 1RA7A 2W1BA 1KP6A 4WE1A 1CS4B 3OLAA 1REVA 2XGPA 2VOPA 4XDDA 1HD1A 1X1AA 3E3XA 2YPZA 2WTEA 2HVRA 2CADA 1BL0A 4K4XA 2DFEA 4OIOF 1IBKF 4ON0A 3HM9A 2R7RA 4UUSB 3CCRI 2LY1A 2OF7A 1MMNA 3IAM9 5C7PA 3T1HJ 2AQFA 1GT0C 1UPPA 1S9EB 4PSXA 2LMDA 2DA4A 1IKYA 5B0FA 1N0UA 1XERA 4EATA 4K0KJ 1EA3A 1XIQA 3UDEA 2M2EA 4U0YA 3J80U 1I27A 2E1MB 4K5SA 5FKNA 2O8XA 4U0VA 4DI6A 3U21A 1XNQF 1N33J 2HQCA 1Y5NB 3I64A 1S7HA 2O0YA 2VJIA 1BW5A 3NP5A 2V8VA 4JV2A 3OL9A 1SD4A 2R5YB 1G3WA 1YW8A 4A8OA 2BM1A 3QBCA 2AXLA 4QW8A 2M7SA 5HLGA 1OR7A 3NAHA 2MZ1A 1PAUB 2FMYA 2IS1A 1AROP 4DJBA 2BMBA 2LY2A 4B1RA 3L1PA 2MGZB 1U1OA 2XZDB 3M8YA 2RQKA 4P75A 3PIOF 5FJ4A 2OCCH 3ERMA 2G13A 2BQRA 4FNHA 2YNGB 2WAQN 1UWBB 2V94A 5HL7Q 5HP1A 3H25A 4WFXA 4DGWB 3CLOA 3IRQA 1VI7A 5LSLA 1SIWB 3KPHA 3S2DJ 2E5HA 3O8WA 3OYEA 1XMQJ 3ASNH 5D4OA 4OV1A 3E7LA 2CYYA 4RX6A 1WHXA 4LREA 2HQ5A 3ULHA 1RHMB 1AYEA 4PG6A 1NK2P 1UL3A 4RW8B 3GIJA 1TQIA 1R0CB 3RBDA 4DR6J 3WG7H 1FX2A 4DZPA 3L2UA 2OAUA 1YW7A 1WC4A 5BR8J 2L4AA 4ZDNA 4A47A 3R0JA 2ELHA 3MM8A 3K5OA 1R5HA 2VI6A 3C15A 2E44A 3D1NI 4M6VA 2QA4I 2GXGA 1OLTA 3JSYA 3BDPA 3H4BA 4HEA9 2HDDA 2I8EA 2XGQA 2CQQA 4DX6A 2ISYA 1CJUA 3NY0A 4D1QA 1TK8A 4NX9A 2VA3A 3LQRA 3TR5A 4M5NA 1N34J 3JRBA 3MF5A 4KIBA 5KFAA 2QUFA 1YX3A 2RUGA 2QBYB 3QFHA 3HSDA 3QOPA 1EF4A 1TWGJ 3FKIJ 1GMWA 1FJCA 1GAOA 6AT1B 2HLTA 5FLXZ 3H92A 4I6AA 5IT0A 1VK8A 3MOJB 4F93B 2IM0A 1S0OA 3JSPA 4GKJJ 1WI9A 1S1TB 3BR2A 4LIVA 2RS2A 3CMYA 3WZ0A 2YKMA 4QU7A 1PYSB 2HFVA 2DCLA 4NASA 1D0XA 1LFBA 2C3UA 3W6JB 2B6AB 1LW0B 2QRRA 3NQOA 4IHWA 2Y48A 4KFBA 1G59A 3GJRB 3D66A 3H0DA 2XWYA 1F9FA 3NOCA 2R7FA 1TMMA 3BGLA 1SQEA 1S1VA 2BZ2A 1L3SA 2BW3A 2NYHA 3JAMZ 1RAOA 5H9EK 4F67A 4ED7A 2HYFA 2BQUA 1VQ9I 4RNNA 1VISA 5HBMA 2Z16A 3NCRA 3WX4A 2ASLA 4J5OA 1JMTA 2JN6A 2NREA 3V2UC 4NLDA 3ENAA 1V9OA 2B63J 4Q45A 5CZXA 3CCQS 3HZGA 2HWVA 2KIQA 1UVNA 1UMJA 2UUCF 5C42B 3WHCA 4H4KC 4RBVA 2WWYA 4RO0A 2VXZA 3TI0A 1Z4UA 2NSCA 1RHQB 4IFVB 1WC1A 4OWRB 4RGSA 4JI5J 4EFAC 2ZH7A 5FLXK 4WTYA 2HHHJ 4C4WA 1S99A 3BPXA 3NARA 4BC9A 1PJ6A 3SHFA 2CXEA 3NWGA 4UV8A 5I3UA 2QLJB 3OSGA 1HPZA 3K4NA 1NJIT 5TISC 2DTZA 2DXFA 3B82A 1DHMA 1LEBA 1D8JA 4G12A 3ZTRA 2DY1A 1RETA 1OSDA 3J7ZT 1Z1DA 2HW3A 2VODA 4ZJLA 3TL4X 5KAKA 1V54H 2M0CA 1RBAA 2QA1A 1USSA 3DFEA 4LF1A 2WW4A 3FFIA 3A12A 1CBKA 1U6BA 2DA3A 3PSFA 3Q8VA 5ILUA 1ENHA 4WBFA 1FDAA 1A7GE 5KVRA 1XSXA 3W9JA 5H1SV 2F9JA 3DV8A 4HPQA 5IOYA 4A3CJ 1HBMA 1Z67A 4A8QA 3KP2A 1K61A 5KFOA 2VG5A 5TGTA 1DLOA 4LG3A 4CDIA 3PCOB 1DZ5A 1FFGB 3IC1A 5AXNA 2QZ8A 1C1CB 2H1YA 1FLIA 2RQPA 1W2IA 3EPZA 3UKGA 4ZLNA 3RIRA 3OYIA 1Q8BA 5LMUF 2BKNA 1H73A 2KRFA 1YRNB 1NG6A 3MCOA 2H3EB 1GXLA 3HSZA 4PG8A 1IN4A 2Y0SA 2FLPA 3CO0P 2M8EA 4FT8A 3RPUD 2W84A 2OSRA 3Q22A 4DHVA 3G73A 2J9EA 2E2JJ 1WKJA 3UNYA 4QU6A 2CS3A 1DTQA 4RLEA 1RWNB 3ZRGA 4OYBA 3THTA 4C0HA 2D3OR 1HMVA 4H4KA 5D6EA 4MMOA 1AUDA 2JSPA 1RT2A 2GQ2A 1FK9A 4RB1A 1URNA 3LSIA 4B3SF 2QQ8A 2JX2A 1ZR2A 1B4AA 3QWUA 3F8BA 1RISA 3CCLI 3CP8A 1U3EM 1EV7A 4EGZA 2ZD1B 2ZHBA 2R4FA 3D5LA 4ZJOA 4RR5A 4TN2A 3B4MA 1URRA 4M73A 2KZVA 3GQCA 4C98A 1NK5A 2JC0A 2HFHA 2RNJA 3CJRB 5C4JJ 1Q4RA 2B7CB 2IY5B 1YHQS 3ZTOA 1XMBA 1GMVA 4ECZA 1N5SA 3MKYB 5CYMB 2A69F 3GZ5A 3C6UB 2V9VA 4MTDA 3VAIA 5DS9A 2D45A 1H9TA 3D0SA 2EZLA 5CYVA 2LQ5A 2Q2EB 1N32J 1X2MA 4GMKA 4DMZA 4F2SA 4NLPA 3ZNUA 1BR2A 4B4CA 1X8DA 4B3OB 4PPDA 4Y0FA 2RN7A 5LGUA 1FBSA 2DGVA 3KLVA 4DG1A 3GF2A 4E7SA 3I32A 1NSPA 3VSKA 3DNCA 3HFZB 4K59A 2EK6A 3EETA 4NLWA 2PO4A 4QWAA 3GFHA 1IN0A 4D3GA 4Y2AA 3M6VA 1S59A 1DBDA 2CQ2A 2DXEA 4PJJA 1EIYB 1S9FA 1T9WA 3P96A 5F8MA 5KAIC 3TW7A 3Q8QB 4F4WA 2AX0A 2KIUA 3H5SA 3UD4P 4AFFA 3BBFA 5FFZA 2W1OA 4B43A 1WC6A 4CIOA 1T98A 4HDVA 2QYOA 2YKNB 2DA7A 4GO5X 3G1OA 1A36A 1LW2B 3ZZTA 3RKXA 2COMA 3TQ1A 1JLCA 4LBPA 2IPQX 3T6JA 1U7LA 2Z4PA 3I9ZA 2PLYA 3HVRA 2RQ4A 4DFPA 2JA2A 3RDIA 3RB4A 3HSRA 2H8WA 3BO3A 1DQAA 3G71S 3VWSA 1T9YA 1L3VA 1IKWA 1TFWA 2D69A 2KM8C 3W6VA 1I6XA 5K8PA 2BE9B 1HBOB 3QLHA 1JXVA 3W1YC 1CC7A 1XR6A 3PHTA 2R7DA 3M3YJ 4J91A 4KO0B 1U78A 2V34A 3MURP 1FIAA 1FEEA 1SJRA 3EYIA 5E33A 4IOAF 2FVSA 3OOPA 3FBEA 3OTOJ 4UY85 1ZAOA 1BOBA 4DV6J 3PFYA 4KUMA 1Z0XA 4FVMA 4PWDB 4A0ZA 1XGOA 3LPEA 3QAUA 1TL7A 1KLNA 3BY6A 1HHTP 2RC4A 3ZMTA 2YX7A 2XWXA 3TZXA 3QRRA 5BOXA 5A8RB 1BUXA 3KLGB 5KT6A 4M3DA 3NNHA 3ML6A 1ETWA 1SVMA 4DL7A 4IQXA 2VOOA 5DZ6A 2Y75A 2TDXA 4U9RA 1VRUA 1SC1B 2W4DA 4C0OC 4ZTJA 1N8RT 4CO8A 2ZJRF 3EPGA 4NXNJ 2CJQA 3VVUA 1XC9A 3LANA 4ED1A 2ZO4A 4WCEQ 2Y0MA 4IOBA 1F3FA 2YNHB 4LLLA 1R22A 3AXKA 4QYRA 4LFUA 1LFWA 1RE1B 2NZCA 2JPBA 2PQ8A 2W7NA 3W65A 2Z2YB 5D0HA 3RTVA 3V7RA 4GVBA 3CSKA 2AEMA 2RIJA 4B9NA 3K6GA 1QTNB 5JJBA 3D5SC 5JVGQ 5H9FK 1YRTA 2ZHAA 4RDUA 3GE9A 3HFVA 4KY3A 3BKUA 2XHWA 5HN0A 1RAAB 4KISA 2EFWA 2PJRB 2IRXA 4KHMA 1M90T 2A3JA 2HZVA 5D8KB 3REOA 3EXCX 2JTVA 1A6LA 2YH0A 4AM3A 4E4HA 3MMAB 4A5NA 1P92A 2R7UA 4BXFA 3ZZYA 2UXBJ 2RRBA 2GXAA 3BZQA 4DQRA 2FHOB 4RBUA 4V2GA 2Q0OA 2QC3A 4GCVA 4F26A 3DF8A 2XDVA 1JLQB 4WZMA 1K78A 4BS2A 4ZHRA 2BOLA 3HI9A 4LF6J 4PUOA 2V4JA 2ZKUA 5EG0A 1AW0A 4L3NA 2KISA 5BNGA 2IRUA 4RU9A 5JXSA 5DUIA 3BKTA 4C3MA 2PG4A 3UR3C 4ALZA 2ZFHA 2ZDOA 3CJ4A 3HKZN 3EVOA 2Z3YA 4G6QA 1PIEA 4M5IA 4MTPA 1R1VA 4NLGA 3CF5Q 2O1PA 3BTLA 4C3JJ 2HZAA 3PY8A 1BC8C 1VCTA 1S49A 2CJAA 1ZG3A 1O4XA 4DV4J 3VF0B 2J7KA 4PWUA 1MD0A 4YFNF 2V68A 4ILRA 5M2UA 2VDHA 3ZR8X 4Q4ZF 1XR7A 1NKEA 4V2FA 1HWJA 2EV6A 3A0HC 2R7OA 2VICA 2R8IA 2DNZA 5LEKA 2LBFB 1D0ZA 1JWWA 1JJ4A 2DGOA 4I2PB 3M30B 1XN9A 5CLSA 1RT1B 5FD1A 1EH6A 4HRIA 5E3CA 3HOVJ 1UW4A 3KLIB 1EQMA 3NCPA 4K2EA 1UG0A 3AAWB 4K7QA 3MAQA 3M8RA 2V2ZA 3I56I 3AG3H 3HCXA 3KUEA 4QR2A 4ZP9A 1SJ1A 2MYSA 2XF7A 1BQMA 4P9SA 5DDPC 3F41A 4L0YB 3PUFA 1FX7A 1RKIA 4DLGA 1PVEA 2GVZA 4QWCA 1JKOC 2Z2LA 4UOFA 2O5RA 5HAOA 1U5TB 2VL1A 3IWFA 4DV7J 3DXJF 1UWAA 1HKTA 3HHLA 3FZ2A 2E5ZA 4J9VA 4YB5A 3MR3A 3AODA 3WGIA 1JKHB 1NU4A 3DRRB 1RNLA 2A5YB 2LXUA 3C16A 2KP6A 5ERIA 4A69C 1RWMB 4CO1A 1S7AA 2JWTA 2IJNA 3IP4B 3R9LA 4USVA 1JXSA 5IC6B 4Q8FA 3PJXA 4G7HF 1O51A 1HNVA 1WJBA 2Z30B 3W61A 4PXBA 1RJJA 1I5ZA 2JVOA 2UZAA 3ZZRA 1B0VA 3J81j 1FERA 2ZC2A 2CJ9A 3U9GA 1MSEC 4V19K 2IGKA 4HYKA 3DI6B 4ZVRB 1JTXA 2QQ9A 2Z57B 1NLKL 1P4WA 1Z7LA 2IW5A 2XB5A 5FKOA 1NHUA 4DV1J 1TUGB 3D4JA 1N5YB 3FXRA 1RDRA 1V5EA 2WVBA 4WWCA 3CJ0A 1VIOA 1RA6A 2E2HJ 2MKYA 1QVTA 2FVQA 2AEJA 5F8LA 1Z6RA 3I0RA 4LFBF 5IYBJ 1IR1A 4N8OA 4F2RA 1Q7LB 4HQMA 4NEZA 4DUYJ 3HKZD 1FPQA 3QQAA 2RQQA 5KT2A 1VQKI 3HF5A 3W9HA 1NBEB 1N56A 1OO0B 3IAS2 3HOWJ 3R27A 4IRCA 1X0PA 3JTPA 2F4VJ 4LMYA 5DM6F 1MBEA 4DSJA 3O44A 3KX2A 3FJ2A 3DLAA 1KVKA 4BHCA 1QVFR 2L9DA 2MZSA 4AE5A 4MGRA 4XONA 2EKYA 3UVJA 4ANJA 2MLZA 4X4TA 4N4NB 4O0NA 1RYSA 2LMIA 2UXCJ 1AB8A 3D1QA 4LSLA 4JI4F 1ZKGA 1YI2I 3J7YU 1PO6A 3GCXP 4O3MA 1RWUA 4USJC 1GFWB 2LDYA 3BDDA 3ZMZA 2WC2A 1FWPA 1TT0A 4RU2A 1L3KA 4FYXB 1PC5A 4NYOA 3FCHA 3RYRA 3IRWP 4X4UA 3K8VA 4ZA1A 2HWHA 2KJCA 3H8YA 2AYMA 2DD8S 2DYRH 2BY2A 4BJ6C 3A3OB 1WSUA 4GKKF 4CHUA 2PI4A 3OL3A 1B3TA 2CW0F 1H74A 5F27A 2PGCA 3DKWA 5KFLA 5M5WJ 2LP0A 1VDHA 1O57A 4PG7A 4DX8H 4JYKA 1DU6A 2L3MA 3D9BA 2KXHA 2APOA 1WTBA 4MK8A 3JTNA 3QT5A 3W60A 4L6V3 5LEJA 1SH2A 1YJWI 2L9WA 2ZH5A 1FWKA 4ZP7A 1S1UB 2IM2A 4KV8A 2MKIA 4G9YA 2R7WA 4U95A 2HXOA 5C25B 1TL8A 3QGIA 1K4TA 3OVBA 1X4DA 3C1DA 2GO9A 2M9HA 3DLEA 3OR1B 3R5BA 1X3UA 3EICA 5HODA 1LE8A 3WDOA 3GG0A 3IBCB 4EZ9A 2JA7J 3FXLA 2H1LA 1DDNA 1X4AA 3DM2B 2VC0A 1RC9A 1HXDA 2D74B 4OYAA 4G1IA 3PO4A 2J0QD 1JJ6C 2L41A 3FZBA 4RNOA 5E18F 4DR3J 2NNNA 1RKJA 3BLYA 4M8LA 3K70D 4ANDA 2D2WA 3PEHA 4FISA 4A3DJ 5K9FA 2Y8YA 1X2NA 2CNOB 2FX0A 5ICEA 4HHJA 4DL5A 2E5LJ 4M3FA 1VQMS 1YG2A 3M7GA 4YHHF 4NC7A 2X1GA 3OS0A 2RQMA 2MLGA 2ESHA 3TYTA 1G3OA 4DUZJ 1N4LA 3I4HX 4ZN1A 2O6GE 4I02A 4AD9A 4XPCA 3A2KA 2HQNA 3BSAA 5HLFB 5TJJA 3HXLA 2FJ1A 2H4WB 4U7DA 3MM5B 2CNKB 3F9KA 5MLCV 2IRYA 3OUYA 1Y5LB 4FQGA 3FSIA 2KJBA 4J9OA 4WU3A 2IAIA 4I6ZA 4UUTA 4XLHA 4EJTA 4DPOA 2J7UA 1MNEA 3I55I 4ED8A 1U02A 2WAQA 4X64F 3H2VE 5H20A 2IHR1 3KIOA 4L3KA 3CJKB 2EIKH 4Y52J 1J2XA 5LRSA 4CCNA 1B1BA 2HVSA 3KDNA 3HPOA 4EGYA 4K4YA 2FPHX 4PPZA 3KE2A 3GMEA 3SDGA 1M0SA 4MQ9F 4LIUA 2I0XA 1PUFB 2WA0A 2V9KA 5IWAF 5FIIA 5JLWA 4NLOA 1OQYA 3FM3A 4USMA 5T7LB 3T1AA 5D4NA 3G8TA 2LDUA 1JIHA 2KVIA 3AB2B 3ZQFA 1RUSA 1HNXF 3RYPA 1KS2A 4PFPA 3LP1B 5L46A 3M7VA 3WG9A 1CGPA 2F9DA 1ZQ3P 5GADJ 3H5NA 5LRRA 3G6EI 2PEBA 3IBWA 2UWMA 3I31A 1WTFA 5DLGA 2QMWA 4DBRA 3MM9B 1S1WA 3WGGA 2MQNA 2LVWA 2HK2A 4RBOA 2CFXA 5AXKA 2AF6A 2CJXB 5B5EC 1Q79A 4RM3A 4GGGA 2Y1LB 4OZ0A 3OWTA 1VBXA 1S57A 4B3MJ 2RE1A 4KPYA 2XRLA 2DMTA 2OMLA 1B6AA 1Y8QB 1R36A 3S7RA 1R27B 4EJVA 2IT0A 1RTIA 1HW1A 3IRXA 3GFIA 3IN5A 5HVHA 3BF4A 3MHYA 5D8LB 3BJ6A 4M5DA 3KOAA 3NBPA 2DNNA 3DOLA 2XULA 2XIGA 2UXXA 2B9WA 3FBIB 2M3AA 1SUQB 3LWLA 3SZ2A 3LAJA 1TQPA 3GTQJ 2W82A 4A8MP 2HGCA 5D0RA 1XCVA 4O4GA 1UFLA 4C30A 1RT4A 2L0KA 3L2WA 3HOTA 5ILSA 1C2PA 2L7KA 1WCMJ 2CWEA 1QZZA 2K40A 2RAQA 2P5LC 1SKUB 1J7KA 5GADI 3H36A 4MH8A 3GR1A 3TZYA 2CUJA 1WJEA 3TQEA 5GAGU 4J9PA 2XMKA 1BI1A 3JRHA 3H5RA 2E5IA 1B64A 1UTAA 2K7KA 3QMQA 5E41A 3ADAC 2BR0A 1SVDA 3LSRA 1SJ3P 4J00A 4QIWD 2A5WA 1VC5A 2YNFA 3FISA 2Y9ZA 3OY9A 1P6RA 2JVGA 5K20B 1RLDA 3DRPA 3BR0A 3OTCA 3CXCR 5J4YA 2FJBB 5L38A 1HDPA 3I9V9 3SDEA 2E9TA 1K47A 5EWFA 2JEFA 2I9SA 2HS4A 4E7LA 5J2QA 4JI8F 1YSJA 2G4BA 1MWYA 4AIKA 4CSWA 4HQEA 1B70B 3RYLA 2XMTA 5DG9A 5E7OB 4MFEA 4WXOA 4AIJA 4NCGA 3FMRA 2H65B 1JLGA 1KEKA 1APLC 4CA0A 5A8KA 3UDLA 2V1XA 2H5IB 3LH2S 2XCPA 2G0EA 4GRIA 4N77A 2V7FA 2LOOA 4BH9A 2DRBA 3R5JB 3FSYA 2YY3A 1TKDA 5LHHA 1YZ6A 3AFHA 4ICLB 2HIQA 2LQJA 1ELOA 1S6QA 3IWNC 4OX9J 4ECVA 5BPDA 3L7WA 1GH8A 3JTGA 1WPKA 1SC6A 4OI2A 4C7QA 2W7AA 5HVGA 1HCRA 4P9FA 2GIFA 2CJJA 1JGGA 2NUUG 5H2FC 2IM3A 4ZDPA 5HDKA 3GTMJ 1X5OA 4QPXA 4MJKA 4HYEA 4B47A 2NVYJ 4RA2A 1S1XA 3C6TA 4KT5C 2BY1A 4ETXA 3JRCA 2XS5A 2H4YB 3UN3A 2IMWP 4K4WA 1TBXA 3KEQA 1JNRB 2R0QC 5KFIA 2VUGA 5C2GA 4USUA 1P7JA 2X1BA 2PE8A 3M2UB 3OYHA 4YOEA 2GM4A 5D3GA 2RKIB 5K8OA 3CCMI 3OYJA 4UOCA 3NGKA 4XLEA 5F3ZA 3HJFA 1S5LC 1BQNB 1RBOB 1Q7YT 1IKVB 1FXLA 2ZZTA 3CJSA 4NLSA 3TUZC 4ECTA 3D6TB 2W85A 2OTLS 4DR1J 4PR6A 4E7IA 1XGNA 4ZVQB 3GUDA 4A5MA 4MTEA 2DT9A 4XKCA 5GTIC 2AHOB 4G6VB 1FVSA 4LG0A 3MAAA 1S6PA 1UVJA 3BDEA 4XAKA 2OI2A 3ISND 3H5UA 5CD4H 3D28A 3Q86A 2GOMA 3ERED 5JHUA 4Q0BA 2AJQA 4JI2J 1FY7A 1GXPA 5DEQA 2ABYA 3M32A 3SSRA 3QJJA 4KPCA 5JR3A 2R93J 2PMZD 5D78A 3CJQA 3OVAA 1UMQA 3LL7A 3Q2TC 2QF7A 2DITA 2LG4A 1L3LA 1XG1A 2FLLA 1W5CC 4LVNP 4OI3A 1WG4A 2MSTA 2VJVA 2DMUA 3QWLA 2VKZG 3BV8A 3NS5A 3D54A 2K3KA 3UPFA 3DEEA 2P2CB 2RDIA 3MZIA 2HQFA 3R6LB 4J7CA 2DDAA 5DV5A 4MFBA 4BBYA 2EH3A 3AJ2A 3EGNA 5EF6A 3KYLA 2EA2A 1RIOH 2XMMA 3BH6B 2J9DA 2VDIA 2RSQA 5KT7A 4ESBA 2IGOA 5KG7A 2K8GA 1EQ0A 2XTJP 1ONVA 3R7SB 4Q2LA 2UXNA 4UF4A 4ZCLA 3HG9A 3K4BA 3P4UB 1U1RA 1RTJB 2KRHA 4I1TA 2OUGA 4FBTA 1Z1ZA 1JLEA 2E1MC 3W2VA 2UU9J 3KLHA 3MOZA 3L7OA 2LF7A 4ZJQA 2F4OB 3I82A 2DN0A 2VKHA 3CCZA 2F5FA 2KT3A 2LR8A 1HQUA 2CV2A 5A2QZ 4DS5A 4BHQA 4XOTA 4ED5A 4KHPF 3SSQA 3GV5B 3N97A 1MIJA 4N47A 2QQBA 5IY5H 4U6PA 3GV8B 2VQEJ 4MNUA 2OUMA 4ZC3A 3ZQCA 4RW6B 4I0WA 2HNYB 4USIA 5E8IA 1F1ZA 4A3JJ 3HJEA 5DQIA 3LPYA 2VLAA 3NOGA 4HLYA 4M9ZA 5HS7A 5F0CA 2XI2A 2D9PA 2LEAA 3H90A 5F04A 3EUAA 4LIWA 4CRJA 1H89C 1QSSA 1MBFA 4AUKA 4I76A 2GMJA 2DK5A 4Y4RA 5IXUA 2KYXA 4HX4A 1I1SA 1UVKA 3V6DA 4RWWA 4ZYEA 2Q6BA 4NZ6A 1YYVA 2LP4A 4M5KA 2IBDA 1EARA 2X48A 4MKAA 2MSSA 2DO0A 4UY8T 1E3OC 5AXLA 1DARA 1QY7A 3L7UA 1LK7A 4BE2A 2L54A 1WG5A 3N05A 3B6CA 2MHEA 1ZBTA 4NBQA 1WJDA 1CS4A 5ADZA 1W5SA 4XR6A 3POTB 4IRIA 4P2SA 5FGMA 3MCZA 2OPQB 1X1PA 1ZARA 5FDLB 3N5FA 4IL6C 3BTCA 1WJFA 4U88A 4UVAA 4USWA 3JRDA 4ZVPB 3VGUA 4XO0A 4P7TA 1XSVA 4Z2XA 4W1UA 4DPTA 2ZM6J 1I3QJ 5KG3A 5M2PA 1NPRA 2MGQA 4AUXA 1HHSA 1IRFA 1S9EA 4CGZA 2DR6A 3BJOA 2HYIB 5FB2A 1VQYA 2EWHA 2CKWA 4NZ7A 4ED2A 3T5LA 1F9EB 4JBCA 1ITYA 4ZPCA 4DWIA 4FN5A 1OMIA 3ZXSA 2HQIA 4V19X 1GT8A 5AE2A 3LSKA 3QIPA 5M5YJ 3HMJG 4OIQF 1IUYA 4ED0A 4LRBA 3PACA 4OAZA 2EFPA 3OSPA 1WEXA 1HHQA 3SXYA 1S6UA 2M7AA 2BXYA 4QIFA 1UELB 4CNYA 5EX0A 2IEKA 2R5YA 3WX8A 4QQBA 4HG2A 5ICGA 5DDQC 2UUAF 3R1HA 2ZFWA 1BQXA 2DGQA 2IAJB 2RAEA 4H4MB 2BE2B 3TUIC 5BYSA 5GP9A 1IWGA 3A8KA 5GAEU 1J59A 4Q5VA 4XSXF 3OLBA 3M9OB 2LKZA 1JJHA 3DPUA 3SZGA 3MEGB 4M5LA 4LOCA 3BO4A 2CQCA 2H48B 4KNYA 2YNGA 4ZVGA 1PYTA 5IOZA 3HSFA 1UWBA 1A6QA 1MMDA 2UUBJ 2FNAA 2E1PA 1HL6A 2CQIA 1ERDA 2F6CA 1S48A 1Y9OA 2XO6A 4HI1A 2ZB9A 5C2CA 3KDOA 3ILLA 3HXMA 2NPFA 3IRRA 1WSRA 5E1ZB 5K7HA 3TVYA 3VYSB 2K06A 1QPIA 1YKWA 4KH0B 4JV5J 2CQHA 1N48A 4FCYA 3KG1A 3CO9A 4A8FA 2B9EA 4Z7CA 2I5JB 4RW8A 1X5TA 4XLNF 3FBFA 2HLUA 4ZYHA 1P27B 1L0OC 1IBLF 2M0MA 3FSXA 3NGTA 3TZWA 3BJAA 2OAZA 4IFYB 1D8YA 2VV5A 3K2YA 3SCKE 2ECBA 1DTTB 5J3LA 3IUOA 3J7AY 3GIRA 3PJRA 3EGVA 2QM3A 1BJZA 2ZBCA 5KFUA 3CP2A 1TL5A 3HT0A 4QBUA 5KFRA 2M9KA 2XNQA 3TANA 1R8AA 3GV7B 4BC7A 4JX6A 2RDPA 1F5AA 3OYNA 1JTYA 2JA6J 5E17F 5L3FA 4NA1A 4DL3A 4DEZA 2X4HA 2F7VA 1OY8A 2L01A 4MEXF 4N9HA 5E3LA 3CCQI 2V0NA 2D1HA 2YNIB 4D5CA 3A8JA 1Y39A 2MZQA 4DFJA 1BWVA 2VQHA 1AFIA 1OCPA 4DQQA 3H9JA 3WBZA 1XDUA 5KOWA 1C4AA 3OPKA 2WY7Q 1G3TA 2PMHA 2ALYB 5ILVA 3QPHA 1R8BA 1B4SA 2X6OA 1S1TA 4WP9A 2IBKA 2W7OA 3CC2S 3PNTA 2NS0A 3ABTA 3Q23A 2W7PA 1OCCH 1E0EA 1IR0A 4CYDA 2EFNA 1F3VA 4L0ZB 5A6PA 1Y00A 3GTOJ 2I2YA 2B6AA 2PI5A 1LW0A 3C2PA 1IXSB 2BRKA 1YRUA 1Z05A 2P5VA 4CICA 4TV7A 1YGYA 3RU0A 2FGCA 3D0GE 1RXOB 3K1NA 1WGXA 1B9NA 1GX6A 1X5SA 2HK3A 4PRFA 1BI3A 2FB0A 3JS9A 2EZHA 5KTQA 1W7PD 2XF5A 1T94A 1YX5A 3AD8C 5KFSA 3I0SB 1EB0A 3K7AJ 1CJKB 5F8GA 2W4CA 2KT2A 2B7EA 2LVSA 5JVGF 3RPQA 3JTHA 3HHKA 2G9OA 2OH2A 2K2PA 1WZ2A 4ZCKA 2NVTJ 1LWCB 3A03A 1OWXA 4F4AA 1YZ7A 5C42A 1RT7B 2EFGA 1KYWA 2FZKB 4NLUA 1MLAA 2HZDA 4PWWA 2HTJA 4AC0A 4DPWA 1CG2A 2IS4A 4N4OB 4ESJA 4RB0A 2ATLA 4A6EA 2JNJA 4IFVA 4UB6C 4JX4A 3GFLA 1KTVA 2ROEA 1ZZNA 4HHHA 4B8XA 4DPYA 2FY1A 3RQ4A 4Y33A 4KTQA 1ETVA 1CF7B 2CQ4A 2XUBA 1OCZH 3I59B 3IWZA 1XBWA 2MPUA 2FXAA 3PNYA 2OLWA 2ZH2A 3QU3A 3K69A 4OL8A 4Q47A 3S1MJ 4QSHA 5DDOC 2BY3A 3JSMB 2DEJA 1VQLI 2NS7A 4JI1J 4WZQA 3F44A 5I42B 1X4GA 3FK6A 4BQAA 2F1FA 1RWOB 2D3O1 3S14J 3VPRA 1FD8A 4C8KA 2QV6A 4ELTA 2VBYA 3GONA 4ZIVA 4IHSA 3QSIA 4GC6A 4C9YA 1BR1A 2JEJA 3V4MA 3O5TB 1ULYA 4G6DA 3JB9k 4DR5F 3EWGA 5K5QA 1EKEA 1X4PA 1G7CB 2MZRA 3T1HF 4ZZDA 1LNQA 4BDYA 1YHQI 3UD3P 1C1CA 1CQMA 4Z37A 4DDFA 4JX5A 3H9GA 3PSIA 2CQKA 4O3RA 2DOFA 3E97A 1YRNA 4B9SA 1QVGR 3LP0B 1TKTB 1K1SA 3A01B 1PJRA 1WI8A 2AJ1A 4Y6IA 4UTGA 1STZA 3TOBA 4I7FB 5EGOB 4UZBA 3KJVB 5ED4A 3WQPA 3BGOP 4OZ2A 1FJGJ 5BPIA 5LHIA 1H2VZ 5K8MA 2MTLA 2LY9A 4N41A 2W2MP 2VASA 5GTHC 2VG7B 1N33F 3MKWB 3AG4H 3RUBL 3THPA 2XS2A 1R4NB 1UCRA 3T41A 4IKAA 5KFVA 4PZVA 3JAMY 3KHGA 1V5GA 5FLXU 4U67Q 2C6YA 1YITI 2E66A 4RGUA 2XMAA 2VIHA 3OFEA 5J1UA 2NNYA 1P2FA 2OJ3A 2HYGD 2AGQA 3GSDA 4XRMA 3BR5A 4IOCF 2DTRA 2V6CA 3ABKH 3AL0B 1OQ3A 2ZD1A 3HBLA 5KG4A 3PO5A 4O3QA 3TAMB 2DBBA 5J8FA 2DA5A 1WC3A 4F7ZA 1F2GA 3M8EA 1IBKJ 5IFMA 4HF1A 2PDAA 4HH1A 3CJRA 2GVDB 2LA6A 1IXCA 3MKZA 3PJWA 4TYAA 1WF1A 4ZYDA 1IZ1A 1DP7P 3K0LA 4EM2A 1RACB 1U2RA 3C6UA 1GDTA 3SCLE 1P4AA 3PHEA 2FYXA 3JQMA 1AT1B 3CCYA 1KU7A 2QL9B 3IH2A 3IG1B 3LOCA 2Q2EA 3M1EA 1ZYRF 2BE5F 1I6HJ 2DR5A 2IVYA 4LLGF 2P0WA 3G71I 4F4YA 1LOUA 4B3OA 4OIRF 2KN4A 3MMYB 1MH4A 1XNQJ 3OXFA 1Z77A 3AKZA 4CP5A 1IRXA 1SD6A 4YEJA 3KP7A 3JSOA 4UNOA 1F0XA 5HO4A 4RW9A 2MLKA 3CDEA 2WAEA 3OJUA 3EZ5A 4OINF 3PW5A 3PKYA 1RB0A 4PXDA 4KGZB 3ZFVA 4MQVA 4A3FJ 1Z9CA 2IC3B 5IT9Z 1W36C 1QPMA 4D3HA 3HRMA 3DGPB 1SL1A 2B4UA 1TWAJ 5RUBA 3CC4I 2HPIA 1SMTA 2ASDA 2UUZA 3M8PB 2AJ4A 3FBCA 1MROB 5GPCA 1U8BA 3PR5B 1MN7A 3NAUA 1S29A 1X3ZB 1VJQA 1FA0A 4CZCA 2YKNA 4FX4A 3W63A 3GFYA 4ESFA 2XYPB 1LW2A 1FOWA 3DHWC 3QGGA 1FIPA 4KYZA 3GYGA 3BCBA 1R00A 3RJPA 4GKJF 2RUSA 4C2MA 2V9WA 3T8TA 3QATA 1C0UB 3BQ0A 2FQ3A 3NEUA 4E7HA 5LLQA 1JXLA 3PNIA 2DXDA 1Y5IB 4TLRA 1YQHA 1REPC 5LMNF 3QYYA 1YVFA 5LBQA 5GAHJ 2K3IA 2WBRA 5A6WA 1VI0A 2VA2A 1HBOA 4DCJB 2MQQA 1AWCA 5D6GA 5E79C 4KO0A 3SZPA 4BGDA 5L8RC 1RAGB 3W62A 3BG5A 1M1KT 5KG1A 2RDJA 3NWSA 4NLQA 1Q16B 2B8PA 3AJ1A 1Y56A 1NRKA 2KJVA 2JRMA 2R2RA 4EMSA 1GMWD 3I71A 3G6XA 2VUMJ 3UFCX 3J7A1 1U26A 4IH7A 2MD5A 3MMCB 2CMPA 2GCFA 5HI7A 1PCAA 2FLNA 2FJVA 4PWDA 1DURA 3CO7C 2DGSA 2V8HA 3RZAA 4QPTA 4WXDA 1PDNC 1SB6A 3R3TA 2OHDA 4XN3A 1FYLA 5A8RA 5F6FA 3KLGA 2W2QP 2YKPA 5C24B 2R3VA 2P7VB 1ZM3A 1AHDP 1X0FA 4TU9A 1VFJA 3DOKB 2IJLA 1Z3YA 1K44A 4XORA 1N75A 3T9NA 1HBXG 1QVUA 2OZUA 4G1QB 1W4MA 1YIOA 2HHHF 3FXKA 2BBEA 1TKZB 1KHWA 5GAHI 2P9GA 2FHKA 1LKZA 3UWTA 2ZXHA 3V81B 4ZJZA 4FS1A 3R7BB 4OI1A 5DD4A 3O3LA 3MKLA 4IKFA 1HNZF 1SD7A 3IAS9 2OEKA 1N5VA 1YTYA 1VC0A 2G1DA 2OP5A 3I4MJ 1JJ8C 1S4FA 3DDKA 2F5VA 3BREA 2X1CA 1T9TA 2N3LA 1J5EJ 1M5OC 4LLNA 1OS5A 4A3EJ 2PJRA 1REGX 2MY7A 2M0GB 1I6JA 3IKTA 4L5IA 4QWBA 3OW2R 1U2WA 3BSCA 1LDDA 1IR2A 3SBMA 4HL9A 3MMAA 3J80K 2ZWOA 1RSCA 5IT3A 1ACMB 3W7BA 1WQ2A 2HDWA 2UUCJ 4IVNA 1VR6A 4L9VA 5L1KA 2C22A 2R2SA 3S15J 1YLFA 1L3UA 3RW6A 3BWGA 4CDGA 2DU9A 5DG8A 3MUTP 1Q82T 1PC4A 2EC2A 1JLQA 1Y0NA 2JC1A 5CQGA 2A05A 2A68F 1R8PA 4OLPA 2RRAA 2HSEB 2J8SA 5KG0A 1HNWJ 1LEOA 4X2BA 3LUYA 2VB6A 3NRVA 4A48A 4CLKA 2XSDC 2N82B 1IKXB 3K58A 2LKXA 3D3BJ 4KQZA 1VBKA 3DLGB 2BUNA 2CQPA 2IA1A 3D2WA 5F41A 3TRGA 3LGMA 2YBVA 3SQGB 2X85A 2UVUA 4WKYA 5KFMA 3FUYA 3P3DA 2LBFA 4WWSA 2Z56B 4ZLLA 3CCSS 1J9IA 1UJ6A 4I2PA 3M30A 5J2PB 2A61A 2DGTA 1IUJA 1RT1A 3QNWB 4OU0A 4IZZA 2Q6CA 3MD3A 3BROA 3KLIA 3RR7A 5KFDA 1ETXA 3HRSA 2HFUA 4LF5J 2Y0SD 2XHKA 4NRUA 5AIQA 2XC9A 4L9NA 1VOMA 3D6FB 3MCMA 4WFZA 5B66C 2CPEA 1MMLA 4ZCMA 2DNYA 3IR6B 4OJHA 2FJDB 5LMUJ 2QWWA 5EJCA 5ETSA 2M5WA 4A3IJ 1U5TA 2AWZA 1EETB 4LSNB 3KLOA 4RZRA 1CC8A 5GVQA 1UVMA 1E3HA 1HNIB 3VAKA 2X0LA 1N32F 2B8QA 5HS9A 1D09B 2D5VA 3HVWA 2QJ3A 3EQLF 3V4IB 3LALA 4XM3A 5KG5A 3MM6B 1R1TA 3WHIA 1JKHA 4ZPBA 3DRRA 1N78A 3KJNB 4XK8C 3HOZJ 3HEFA 3HHHA 3RJMB 2QSFA 4DV0F 4PK4A 4Y34A 2QA2A 4USKA 2DPDA 3X3UA 1RADB 1RBLA 1WHWA 2V8DA 2M4GA 4B3SJ 3KFWX 4HV6A 3A02A 4ZZLA 3LW5C 4FE7A 4HI2A 3BG3A 2W9BB 2AJ2A 4NLVA 3ENVA 3GTPJ 2IDEA 3FMWA 4D9JA 3WTSC 3D67A 2P4WA 4ITSA 3VQTA 3A3PB 5IYCJ 1O3QA 4C8LA 3DI6A 3IR7B 1Y0HA 2NYIA 2HS0A 4S0HB 4B02A 4YB1P 3RRGA 3SEQA 3CTRA 4YDXA 1WVRA 1QGPA 4AXIA 2UVWA 2R8GA 1P9YA 2KXFA 3K57A 1ROFA 2K7JA 1N5YA 2R7ZJ 4XLFA 1RP5A 4Q44A 2HHWA 3ASOH 4A0YA 2DEIA 3OR1C 3DLBA 5GMKa 3HC7A 3KK2B 3A0BC 3RB0A 1RT6B 1FRKA 4NE9C 3TGNA 3KLFB 5BQTA 4KGMA 3UD5A 3M05A 2HVEA 4NA3A 1FYKA 4O4RA 5ETTA 2XS7A 2CPDA 1A9NB 1VGYA 2GA7A 3LGHA 4IG0B 1VQPS 1BD6A 1QZYA 4FE4A 5LXRA 1VNDA 4BWMA 3I4PA 4C3KA 2X3DA 2DRDA 2IJFA 1D0EA 4KIGA 2J0WA 1ZH5A 3M1VA 1E17A 5F3TA 5LSOA 3DEUA 2DHGA 1U6GA 3UI3A 2QQAA 2XY5A 2CQDA 4MHGA 2M8GX 2EIMH 4UW2A 3OTOF 1T08B 2B56A 2LYCA 3FM5A 1XR5A 4DV6F 2L7FP 4K4VA 4TQSA 4CT9A 1MH3A 4CZZA 3NNAA 3PW2A 2WOMB 3LMMA 4BYYA 1UKUA 3M8QB 3VCDA 3CD6S 2N4CA 1WWHA 2Q3PA 4CCLA 3SYTA 4YR0A 3LQVA 2VFUA 1Z2LA 4I6Y