2IA0A

Transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
156
Chain Sequence
HLDDLDRNILRLLKKDARLTISELSEQLKKPESTIHFRIKKLQERGVIERYTIILGEQLKPKHLALIVLEVGKPEDFLERYISYISSTLSALPGVLFVAKSGEDKIIALVGKNNKDELVKFIEENITSIPNLKHIQIFPITEIKKGEDLTGFLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative HTH-type transcriptional regulator PF0864
publication title Crystal Structure of the Transcriptional Regulatory Protein PF0864: an Asnc Family member from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
total genus 34
structure length 156
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia0A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ia0A02
4LFUA 3LQRA 1T38A 2NAZA 1O7LA 2EA2A 5CVUA 1ULYA 3FZVA 4LLGF 2LKPA 4KMFA 5D4RA 3ZP5A 3ZN0A 4YFNF 3JSPA 1FOKA 2X4HA 2FQ3A 3B73A 4RGUA 2KIFA 4BQAA 2ZBKA 3LFKA 3TGNA 1FZPB 3V8KA 2HR3A 1BI3A 2FXAA 2ZKZA 1FSHA 1OPCA 1SFEA 4LG0A 3KP7A 2EFOA 3L00A 5LHGA 6PAXA 2Y48A 2LF7A 5F6FA 4QLCU 1MKMA 3DPTA 1KGSA 2X0LA 5DUKA 3ROUA 2PLYA 3EYIA 1EH8A 2PG4A 1R5HA 3ISPA 1D8JA 3ML6A 3ULQB 4MQVA 2CWEA 2XAQA 4LLLA 4LJZF 3JAMZ 4I2OA 1B4AA 3F22A 3ZMUA 3I54A 4HZFA 4AVPA 2PQ8A 1O57A 2EFNA 3VB2A 3KP3A 5FB2A 1O7FA 3HRUA 2W57A 3MZHA 2VBZA 2FOKA 3BDDA 4ENJA 3KCCA 2P5KA 2WWYA 4L9JA 5LHHA 5D5XB 3E6BA 4NQWA 2OQGA 3RYPA 5ICGA 2W25A 5D4SA 2NNNA 2PEXA 3FXQA 2V1XA 3WODF 1FP1D 1IW7F 1EH6A 1IN6A 2R7FA 1FBUA 4L5IA 2E1AA 3F72A 1TLHB 5ILSA 2FEZA 3IC7A 2IA0A 2OAZA 5DYMA 4ETSA 1UHWA 2TDXA 4MNUA 4ESBA 1YG2A 2QM3A 3BY6A 2L3DA 2FA5A 3E5UA 4P96A 3MWMA 4ENKA 5LGNA 1H9TA 4KDPA 2DBBA 3EDPA 2Q0OA 1XSDA 3K9TA 3T8TA 2YX4A 4F7ZA 3CO6C 5D5VB 5D6FA 2Z9OA 3LAPA 1JXSA 3KLNA 1KYWA 5KK1A 1BI1A 3V8LA 2K7LA 1T0FA 3SZPA 4M9ZA 2RC4A 3N97A 3C1DA 1FNNA 5TRDA 3CJNA 3WU1B 1JHFA 2VXZA 1T98A 4OMYA 1L3LA 5H6QA 4A12A 1UFMA 5CVJA 1ZLJA 3GFMA 2EA4A 1L0OC 3LSTA 4P5OA 1ON1A 3R61A 1B9MA 4CZZA 4U7BA 2F5DA 5LEJA 3H92A 4UXNA 1SFXA 2DW4A 5HS7A 3QAHA 4IF4A 3K1MA 5DD8A 3HRMA 2O03A 1MDMB 2A3SA 1W4MA 3LA2A 3ELKA 2DQLA 2E7XA 4HOBA 5K5QA 3V7RA 1F5TA 4H0EA 4HDUA 5ED4A 1S7AA 2EFPA 4XLNF 2XHKA 2HKXA 3LWFA 1KA8A 1J59A 1STZA 3GFLA 3JW4A 2YX7A 5ERIA 2IPQX 4MEXF 1G6NA 3SQNA 3J80Z 1FYMA 2P4WA 2ZNZA 3E6MA 1HW5A 3M8EA 3GZ6A 1D8KA 3N4MA 1ZGJA 4YIFA 1FY7A 1S8NA 3Q5FA 3WTZA 1YS7A 5L3BA 2NNYA 3G73A 1HW2A 1A04A 4FT8A 1USSA 3FMQA 1G3YA 4B09A 3KP4A 3GFJA 5FFZA 2M8EA 1XSVA 1J7KA 4HV6A 2HEOA 4A6EA 5L3DA 4M9XA 4KYWA 2IW5A 2XAGA 4EGZA 3PFIA 5E1WA 1TW3A 2OU2A 3GYHX 3TQNA 5L3GA 2C6YA 2M30A 1BBYA 3GXOA 4WK8F 1MJ9A 2CG4A 2Q8KA 2HYFA 3I58A 2V1DA 1J75A 2FE3A 1Q1HA 2EV6A 2RN7A 4KT5C 1I5ZA 4RAYA 3ABTA 1YIOA 1O3TA 5LRRA 2K27A 1XN7A 5JVTA 4O5VA 3F6VA 1MJAA 5HDNA 2UZKA 5HDGA 1E2XA 1XMAA 3FWEA 1IF1A 1R1UA 1HKQA 5CJ9A 4HX7A 3KFWX 2ELHA 4EJWA 2HZTA 1Z1DA 5IT9K 1YYVA 2YPRA 3E6DA 1HBXG 2DLLA 1SFUA 4OIPF 3VEPA 3F3XA 5HS9A 3MAJA 2PI0A 1HQCA 2EJRA 3CUOA 5LGTA 1AWCA 2QZ8A 2A5YB 2A07F 1Z7UA 2GIVA 1U2WA 3M7GA 1LDKB 2LDUA 4HYEA 1IRFA 4ZZLA 4BAYA 2JPCA 2ZBCA 1LB2A 3ZMTA 4AWXB 5JR3A 4Y17A 2BBYA 2ZMEB 2STTA 2QBYB 1XGNA 2EB7A 2L54A 2Y75A 2D1HA 4YFKF 4KN7X 1SAXA 3QPTA 1WKMA 1LJ9A 1MDMA 4HX4A 4TV7A 4RGRA 2D1VA 1I6XA 3I4PA 3P9KA 3L7WA 4R79A 2ZJ2A 2LNBA 2HFHA 4S05A 4ENMA 3ZN1A 4MQ9F 3IHUA 1SMYF 2E1NA 3RKYA 1ZAOA 3DQVC 5BQTA 3HSFA 1BI2A 4I02A 2FF4A 1KYZA 3I0TA 1ZH5A 1P92A 4OINF 1Z9CA 2PMUA 2IJLA 2WC2A 3WGIA 2H6BA 2HS5A 3E97A 3HRSA 2MH9A 2XGXA 4ZYEA 5A2QZ 2V79A 3E5XA 1U5TC 4HDVA 1BIAA 4KFCA 3QU6A 5K1YA 2DPUA 1K78B 1ZLKA 2DT5A 2GA1A 4U0VA 1SD5A 2DI3A 1ON2A 4ENNA 1ZG1A 4M9SA 3DFGA 2PMHA 3ZMDA 2M5WA 1K79A 3F8FA 1PDNC 4M6XA 4HAMA 2F5EA 2RKHA 2MA3A 1Z6TA 1Y0UA 1YLFA 3EQLF 4GYIA 2KKOA 3J81Z 2Z4PA 4LMYA 2QQ9A 1R36A 4KICA 1TQMA 1RZ4A 4MTDA 3RPUA 3IRRA 1HSTA 1FWZA 1UCRA 3V8JA 3GZ5A 3CUQB 1P4AA 3GFIA 1SD7A 3H3ZA 4GCVA 2XROA 3C7JA 1IN5A 2FRHA 1IXRC 4B8XA 2XAHA 3W6JB 3R60A 5HDKA 2VBYA 4IPAA 3DXJF 2IA2A 2F5FA 2E7WA 4IRHA 4L5JA 3DF8A 3L9FA 1S7OA 2QLZA 3IWFA 3V4GA 1BIBA 2JSCA 4Y13A 1GXPA 1P4XA 4D0PA 3QRFF 4IHSA 1RI7A 1MD0A 4CYDA 4HX8A 2XV4S 4OIRF 2MBFA 2A6HF 4Q48A 5E17F 4UVCA 1FYKA 3L2CA 2P8TA 4UV8A 5AIPA 4GGGA 2IRFG 1W7PD 3P9IA 4WWCA 3NQOA 4KIFA 5BS6A 1XMKA 5KVRA 3BJAA 1XCVA 2GQQA 5BOXA 1LVAA 1MJBA 2JRTA 2ZMEA 2OQRA 1XGSA 4MHGA 2QBYA 2D2WA 4G6DA 5J6XA 4XBFA 3HUGA 1FSEA 2VC1A 1EH7A 5H6RA 1KU2A 2ZXJA 5DV5A 5JFRA 3JTGA 3DEUA 2XAFA 3IKVA 4BYYA 2XKPA 2HQNA 4G9YA 2Q2EA 3HSRA 2GAUA 1QNTA 1P4WA 1UB9A 1S3JA 3LAJA 2HYGD 3WTWC 3T8RA 1B9NA 5E8GA 4U88A 3L09A 5J8FA 3ZMZA 4R8HA 1JHHA 2GZWA 3E5QA 3RKWA 1NHAA 3TO9A 1YS6A 3BROA 5BPIA 1IZ1A 5BMZA 1BJAA 5J8CA 2R7DA 1T2KA 2KIUA 4LK1F 1R1VA 2WV0A 3TO6A 2VN2A 3CLOA 3J7AO 5CVIA 1R22A 1K78A 5ICEA 1HKTA 2PN6A 1C0WA 3TOAA 3RI4A 3RJPA 1I1SA 4QWQA 3KE2A 4RGXA 2PFBA 1W5SA 1QGPA 4A0ZA 2HOEA 3W6KB 2EWNA 2YSRA 1IUYA 2FNAA 3BJOA 2FBIA 4BNCA 3VOEA 3LQQA 3V7CA 3HYIA 2P6SA 1TNSA 5DUIA 2CQKA 4A5NA 4A5MA 4EJTA 2F2EA 4CO8A 3COAC 3SXYA 5LHIA 1D5VA 3RDIA 3J80K 1TTYA 2EFQA 3WTUC 2MLGA 2OA4A 3BPXA 5DCMB 4HW0A 2IVMA 3P9CA 1OKRA 3CUQA 5E1ZB 4CDGA 3BWGA 2B0LA 2EV0A 1UHMA 1R5GA 1XGOA 2V9VA 2P7VB 5HS8A 4EM2A 3GLXA 2WTEA 5ILUA 3KZYA 2CFXA 5CYVA 3BOQA 2CVIA 3WTTC 3RIRA 5D8LB 4U7DA 1B59A 1EV7A 2ZCWA 5E8IA 4A6DA 1YO5C 3G3ZA 1J5YA 4IJAA 2MLKA 4EJOA 1JGSA 3KEOA 5K5OA 4PCQA 2UXXA 2LF8A 1FBQA 4BHBA 3U9GA 2VBWA 3FM5A 1PP7U 1DPRA 2ZFWA 4E70A 4JQFA 4HBLA 2RDPA 1XSXA 2XIGA 4Y15A 3MQ0A 1S29A 2MC3A 4MEYF 3Q9VA 4IRIA 2L4AA 3FX3A 5LGUA 5HVQC 3SHFA 4EVIA 1LEBA 5K5RA 2J5PA 3ABUA 1RUNA 4L9NA 2A6EF 4KN4X 1OMIA 1J0RA 5F1RA 3P7NA 4UVAA 1ZYRF 4GXOA 1X3UA 3NEUA 1I27A 4G6QA 1LQ1A 4A0YA 4AIKA 4N9IA 4HLYA 2K86A 1ONVA 4IVNA 4KIGA 3VFZA 2D45A 3BJ6A 5FGMA 1Z91A 3QP6A 2XUBA 3GVAA 1SD6A 1FLIA 4ZH4F 1ZG5A 4WF2A 1V3FA 2OZ6A 1TBXA 4L0ZB 5IT3A 2FBKA 2GA2A 2STWA 3GW2A 4XLPF 1MGTA 4L9TA 1KU7A 2BEOA 4FHTA 4M72A 2QUFA 3K2ZA 1D3YA 3VODA 4XSXF 4G8XA 1H9GA 1F9NA 1W7PB 3GEZA 3HIFA 2BGCA 5LBQA 2Z99A 2F5CA 3IL2A 3T0YA 1HXDA 2A69F 4RS8A 4YFXF 2K02A 3BP8A 3I59B 2NYXA 3OV8A 5TJJA 3HHHA 2E1CA 1YTYA 2FMYA 4KMUX 1ZARA 4GO1A 2MD5A 1K6OA 3E6CC 3K1NA 1G3WA 2OBPA 4EQQA 3IKTA 5L3CA 2ZO4A 3ECHA 3TKYA 2L01A 4R1HA 5HOOA 4KUMA 1TW2A 4U0WA 2P5LC 2IT0A 3HTSB 2G7UA 3GWZA 3B02A 2DQRA 3TDUC 2Y0MA 4P9FA 3GF2A 4KIBA 2R3SA 5DCMA 2M87A 3K0LA 2HTSA 1WI9A 1OYWA 4AIJA 1IXCA 1YW9A 4G7ZF 3TDZC 4ON0A 5D5WB 1FT9A 4RB1A 4IHTA 3EYYA 2XKOA 4KA4A 3F8BA 1IN4A 3WE3A 3DV8A 3K69A 2HTJA 5ICFA 3JTHA 1O3RA 1FYLA 2VODA 4XRFA 3WTYC 5D8KB 2ETHA 4HF1A 5FLXZ 2EFWA 3FF5A 1J9IA 5FO5A 1XDUA 1O3QA 1CF7B 4PDKA 4RGSA 3R0JA 1BOAA 3HOSA 1BC7C 4RB3C 4O3MA 1FBSA 1WWXA 2JSXA 3EETA 1YW8A 2HGCA 1Z05A 2DK5A 3QPHA 3QOPA 4NB5A 2GXBA 2G7HA 2V1UA 1R7JA 1XDSA 2DTRA 3NRVA 3HSEA 1G3SA 2W85A 4WCGA 1KQ8A 2P7CB 4JBAA 2AXLA 3I71A 3QP5A 5ILVA 2O0YA 3JAMK 2DAOA 2DK8A 4RAZA 2COMA 2JPBA 1GXQA 1IN7A 2QWWA 2QVOA 4HLXA 2JT1A 5ICCA 4EJVA 2VE8A 3TO7A 5E20A 1U5TB 4EV0A 2FU4A 4I0BA 1Z6RA 1BC8C 3GO5A 4LK0F 1ZRFA 3ZPLA 3R0AA 3E3VA 3F21A 3TOBA 1LNWA 4CICA 4P9UA 1O3SA 3WU0A 3C18A 1OR7A 2YR2A 5L3EA 4OMZA 1ZREA 4M74A 1ODDA 3WGHA 4IRGA 3U1DA 1B6AA 4WXCA 4DQ2A 1JE8A 3FMRA 1FC3A 1LDDA 1U8RA 3F23A 1OYIA 3ZMVA 3CO7C 2M1BA 4ZYHA 1YQAA 1RUOA 2VT3A 3IRQA 4I01A 1LEAA 3D0SA 3PQJA 1W7PA 4LLNA 4RB0A 3Q9SA 1TQPA 1F1ZA 3EUHA 3I64A 2VBXA 2L02A 1TQIA 2MH2A 3I59A 4UHTA 3JSOA 1V4RA 3M8FA 4P55A 3IWZA 5EEHA 4EJUA 5E1XA 4HQMA 1BN5A 4YIIA 3KZZA 1WSUA 4KNYA 5LRSA 2RVCA 3ECOA 2P5VA 3QU3A 4BH9A 5D5UB 3FMSA 1RIOH 1BI0A 3GX4X 5JI6A 3RPQA 1DP7P 4RB2C 2CO5A 5HLGA 4BHCA 2O61A 4Q4ZF 2RGVA 4ZYGA 1ZRDA 5JHUA 3M9AA 4EM0B 1U78A 4UNOA 4EMSA 3C3WA 2GXGA 2V6CA 4CGZA 1LDJA 2ESHA 2ACJA 3HOTA 1XGMA 2ESNA 1ZGAA 4XSZF 3SZTA 2UWMA 4OIQF 1ZHFA 1G3TA 1GVJA 2PBIA 3O2PE 2BV6A 3RYRA 2KIMA 4O6JA 5LEKA 1S6LA 3GUDA 4K2EA 2K4BA 5E18F 5DEQA 1YW7A 4G7HF 2Z3YA 1FX7A 1OYYA 4DNCA 2GWRA 4A2UA 3WE2A 1AOYA 2ISYA 4HF2A 3H3UA 4YG2F 3R4KA 4BHPA 1CF7A 2RQPA 2UXNA 2ISZA 4A0XA 4I7HA 3OOPA 1IXSB 3F8CA 2VT2A 5D6EA 5L3FA 3DKWA 1I1GA 2Z33A 1CGPA 1E17A 1T6SA 3KP5A 2NRAC 3BZ6A 3KLOA 2HWVA 3R6SA 1QZYA 4OIOF 2H6CA 2RV8A 2O8XA 1SMTA 1XB4A 1K7AA 3O3KA 1HSJA 2XAJA 4WX9A 4JK1X 3HHGA 4S04A 4LD5A 2DFIA 1DDNA 4I98B 4L0YB 4CHUA 5DD4A 1U5TA 3WTXC 2FNPA 4HQEA 4HF0A 4Z2YA 5CLSA 4AIHA 1R58A 1HW1A 3RKXA 4PGGA 3LA7A 2J5OA 3F8NA 4OU0A 2CW0F 2K4JA 4G7OF 1R23A 3F8MA 4M73A 4CXFA 3HTUA 4EGYA 1QZZA 1KQ0A 1R1TA 1VTNC 2H27A 4LB5A 3MZYA 5F64A 3I5UA 4UV9A 3KETA 1DPUA 5BPDA 2IP2A 2BE5F 5DDGA 2FSWA 2DO7A 3KP6A 3KP2A 2XVCA 4BXUA 2CYYA 4N0BA 4OOIA 2H09A 3MCZA 4G94A 5CVRA 1QBJA 4M71A 3WG9A 1P6RA 3V7SA 4LB6B 4M6YA 3ZQ7A 4NHJA 5CVVA 1YFHA 2H94A 4ESFA 3MFKA 4ZZDA 4FX0A 3AAFA 1XD7A 1IN8A 3BPVA 2G9WA 2HQRA 3DPLC 1XCBA 1QQIA 3LA3A 2OD5A 3O6BB 1F4KA 2W24A 5FD5A 4LG0B 1T39A 1FP2A 2PJPA 2EV5A 1KU9A 2RNJA 2W84A 2NS0A 1B1BA 4ESJA 4UVBA 2VE9A 3D5LA 2ZNYA 2VONA 2FMLA 2A68F 1REPC 2HDCA 1PUEE 4LGWA 2ADUA 5EEGA 2IA1A 2DU9A 2YU3A 1QO0D 4Q47A 4Q5SF 1P2FA 2QQBA 2QYOA 3REOA 3FXRA 5HLIA 5HLHA 3HRTA 4GYGA 2AS5F 3WTVC 2KJCA 1ZG3A 3K1PA 1J2XA 1WRJA 5IT9Z 1ZN2A 2O3FA 4MGRA 1U3EM 3CDHA 2EK5A 5FD6A 1GHCA 3T5XA 4ASNA 3FM3A 4WXHA 3RTRA 2DJWA 2LSOA 4PZJA 4PGHA 3MEXA 3WTSC 1G4DA 4HA8A 3FXUA 1KQ9A 2VOOA 2Z5UA 4ZYDA 5DCFA 1BM9A 4AD9A 4I09A 1IRGA 3T1BA 5AIQA 3DP7A 3CTAA 2CGPA 3I53A 2VOPA 1SD4A 5H20A 5FFXA 4MTEA 1RNLA 1W5TA 2VC0A 2KRFA 1KU3A 2QQAA 1USTA 2JZYA 3F6OA 3M1EA 2QENA 3SFZA 1QPMA 5A2QK 2O6GE 4EM1A 2A61A 4WXDA 4UUVA 1U6GA 3S2WA 4FX4A 3ERED 3PQKA 3FHZA 4HV5A 2CSOA 2XASA 1WQ2A 1H0MA 3WGGA 1DUXC 1HKSA 2FBHA 5FLXK 2P6TA 2XRNA 2L4MA 3CUQC 2M45A 3U2RA 5AONA 4IXAA 1IAWA 1FPQA 4L9VA 2JTVA 1ZRCA 1R00A 2BYVE 3ZMSA 2DPDA 3J81K 4N9HA 2HKOA 5LLQA 2OZUA 4L18B 4I0AA 1TNTA 3KEQA 4U0YA 1PP8F 1MZBA 2KJBA
chains in the Genus database with same CATH superfamily
3GMEA 3PZPA 1YG0A 2Q6BA 1B0VA 2VJ4A 3ONQA 3BLYA 2HQ5A 1O7LA 1ERDA 4B3RF 2Z1DA 3OJUA 1ULYA 3MD1A 1AKHB 1FJLA 2YY3A 2DYAA 3W3SA 2LLZA 4C0BA 3ISND 5D4RA 3JSPA 4H4OB 1A6QA 2X4HA 2FQ3A 4PWUA 2KIFA 2L9WA 4K4ZA 3A12A 3LFKA 1ROFA 4PG4A 2DXFA 2IGMA 3MAHA 2HR3A 5IM0A 2FXAA 2NVTJ 1DARA 2Y8WA 2EPFA 4LG0A 3KP7A 3PRDA 4K4UA 3M8PA 4Q0BA 2E1MB 5DG7A 2BQUA 5KFXA 3GSDA 2Y48A 1MKMA 3DPTA 1KGSA 3KIOA 1FRXA 4WFZA 3QSYB 1UTAA 3ROUA 2CQGA 4DSIA 2EK1A 3FZ2A 4C4WA 1PC5A 3UNGC 1HA8A 1FK9A 1YIJI 1HMVB 1GH8A 2JWNA 1B72A 3R6LB 4BDYA 4MQVA 3HKZN 2CWEA 5L8RC 3MM9B 3JAMZ 1B4AA 2B7BB 4EUVA 2DCEA 3PCOB 1KFDA 1T02A 3PIOQ 3PO5A 1NJIT 3VB2A 3GB0A 4KH0B 3K70D 3I6PA 3O6QA 2W57A 5D0EA 1HNWF 4B48A 5DG8A 2VLAA 4LR9A 2YKMA 1TKTB 4ZPBA 2N7CA 2Y1LB 2Z0GA 1AYEA 1BQNA 3DCAA 2A0FB 1JLGB 2XRLA 2JLFA 2W7AA 3KG4A 2F4IA 3H7HB 2ID3A 2W25A 2HHHJ 4P74A 5CCMA 5AE3A 1VIOA 2G2ZA 2PEXA 2L48A 2V1XA 1OJLA 1FP1D 2DPJA 3G96A 4BY1J 1IW7F 1FRMA 1NSQA 2CRGA 2R7FA 3NGKA 3RU0A 4MMOA 2ME0A 1QVUA 1X4PA 2E1AA 5DGAA 4J00A 2FHJA 1P1LA 5IOLA 4KHPF 2DMUA 1Q53A 5HVFA 4ILLA 4EZ9A 2IA0A 2OAZA 5DYMA 1UEUA 3R5GA 4ETSA 2IS2A 3MM7A 4K4XA 2FJXA 1UHWA 3Q8UA 1EQMA 1F36A 4BJ5C 5DM7Q 3FDYA 3CCQS 2UVWA 3E5UA 2V63A 3MWMA 4JI2F 1YJTA 5LGNA 1PUFA 4RBTA 1ACIA 2PFDA 4I4BA 3H90A 3DM2A 2GGPA 3K9TA 1UJ6A 2XZWA 5KT5A 3IS9B 5CYMA 4IR1A 4WK1A 3BN4A 3RUBL 2VFUA 9ANTA 3BGOP 2QSFX 1IKWA 1TQLA 3KLNA 1HBNA 1KYWA 5KK1A 3RBEA 5KFKA 1BI1A 2JVGA 2RC4A 1FRJA 2GZOA 2HIYA 4K0KF 5SUHA 2W9CA 1QHHD 1JHFA 2VXZA 5C2GA 2I0XA 4DFPA 5H6QA 4O3SA 3H2UB 2QJ3A 4NXMF 1M1KT 5G0RB 1IBKJ 3GFMA 1OLTA 4XM3A 3L4BC 3ILJA 5MAOA 3OVBA 4C8ZA 1L0OC 2DYRH 1RBLA 3LSMA 3D5RC 4P5OA 3R27A 2CQ1A 3R61A 5E3CA 3FEXB 4CZZA 4U7BA 3LGHA 3WDOA 3BG6A 4X62F 3L2UA 4DQRA 3H92A 1KKHA 2KZVA 4UXNA 4KFBB 3BQZA 1YX3A 5A0YA 1C1CB 4IF4A 3AOCA 3FEZA 1YJ9S 1S72S 4DL7A 5DD8A 1ZM4A 2B8QA 2CKWA 2RREA 3IH2A 2H5JB 2IRUA 3DRPB 3CO9A 4LIVA 3SCLE 3LA2A 4F3MA 2DQLA 2E7XA 3L2WA 4NEZA 5K5QA 1G3OA 2C2DA 3V7RA 2XS5A 3DMJB 4LSLB 2DOEA 4NLTA 3ZR8X 4HDUA 4FDFA 5BR8J 2ME6A 1HBUA 5M5XJ 2DRBA 3MM6B 4BUPA 2XHKA 1TFYA 5LMUJ 2RF2A 2HKXA 2X51A 3LWFA 2ZE2A 2C3YA 1J59A 3J81Y 2YX7A 4DV2F 3D0GE 3BJYA 5ERIA 4BC7A 3J80Z 2HG4A 1KOOA 3GCWP 4CWBA 3BKTA 5F3ZA 3PFOA 1BHNA 1FY7A 4DV1F 1K47A 5DS9A 4PQUB 2J76E 3WTZA 2HOTA 1YS7A 4J9RA 2ZDOA 4DFJA 2FVSA 1A04A 2YUSA 4FT8A 4GC7A 1FXRA 3FSYA 1OR7C 3GFJA 2GVDA 4UUTA 5FFZA 3TUZC 1VNDA 1XNQJ 2F5GA 5J2QB 1PC4A 3PJXA 4MLOA 2LY9A 2FVQA 5L3DA 3UR0A 4M9XA 1YJWI 3I5BA 2IW5A 3PFIA 5E1WA 4BE2A 1ZM2A 1LWCA 2B5JB 5L9NA 2XF6A 2VG7B 3OIPA 3ZNUA 2B0GA 4WCEQ 4CYCA 2DNHA 1DAXA 4WFYA 3TZWA 3GXOA 2CG8A 3N9UC 1MJ9A 2CG4A 4XNFA 2FUG2 3I58A 2V1DA 1J75A 1IO2A 2OSQA 2WSCC 1Q1HA 3L2RA 1Q8BA 4CI0B 2EV6A 3OPKA 4UOGA 1G7CB 4KT5C 2V26A 3DOKB 5JVGQ 4WKYA 1O3TA 4I76A 3LAKA 4OHXA 4RW8A 3QZ7A 1HD1A 4E7SA 4RNOA 1WJ9A 2ZBQA 3MECA 3N5BA 2DB1A 2YWGA 1E6VA 3QQAA 2HPMA 5IZHA 2ZC2A 3T5KA 3CCWA 2IBDA 2DFHA 4C97A 5HROB 3HVWA 2OELA 1U0HB 1EZZB 3KFWX 2VG5B 4IQXA 4RW9B 1X5PA 1HC8A 2YPRA 3MCMA 2RS8A 2JOQA 2DLLA 2CQDA 1SFUA 2CPFA 4OIPF 2BXJA 5F0WA 2VPZB 3RW6A 2KHDA 2RHQB 3VEPA 4B4CA 4Y34A 4GKKJ 2N7YA 1AWCA 4Q43A 4P2SA 2LVWA 5GAGJ 3TP3A 1EARA 1Z7UA 5A8WA 3HHNB 2XMWA 5F8LA 3ENQA 2XSJC 1R6VA 3DRSB 4Z2XA 2OTLI 3M7GA 3VAFA 3ZZRA 2LDUA 1TK5A 4PXDA 2WONA 1SH3A 2QX0A 3UO0A 3QWPA 3GR0A 1S6PA 1H0HB 3ZMTA 1I50J 4YELA 1RBOB 4RNMA 1KRPA 3MMCA 1F2GA 2A05A 1VI0A 1U24A 2STTA 1XGNA 2EB7A 1YX2A 4AVZA 3VAHA 2VXDA 2J7KA 2D1HA 3CMAI 4ECRA 4L5EA 4KGVB 3KMQA 4UQGA 1SAXA 5AJ3J 1FXLA 1LJ9A 2POKA 4TV7A 3CD7A 4RGRA 1CJUA 3P9KA 3GPAA 4R79A 3IRXB 4CSWA 1LW2B 1RAFB 2Q2EB 1ZTRA 4X4NA 5HSPA 3FGVA 3CC7I 2HZVA 5ETVA 3GTKJ 2R7XA 4JI8F 1ETXA 4ZCKA 2E1NA 3M1VB 3ASNH 1YLXA 3BREA 4J5OA 1AROP 2XC7A 3HSFA 3D9BA 1BI2A 4I02A 1TKZA 4K4SA 2FF4A 1KYZA 5BJRA 1SKRA 5M5WJ 3HGYA 2E66A 4MFDA 3WQPA 4OINF 4U9RA 3VGTA 2PMUA 4EMDA 5HVHA 5MLCV 3BYPA 3R7BB 5GAHJ 4E7LA 3Q0VA 3K5NA 1N0UA 3BR3A 1O51A 2LBFA 1TT5B 3QRPA 1BQXA 3P5TL 4ZYEA 2H5IB 3KDNA 1RTZA 2J0WA 3MMAB 3DDIA 4F2RA 1D9DA 3OUYB 4FNHA 2R2TA 2AKWB 2OGUA 1QVGR 3OL9A 4BWJA 5FD1A 3HDSA 3QU6A 5K1YA 1U1NA 1N32J 3GR1A 2DPUA 1K78B 2DT5A 1SD5A 3FQLA 5T7LB 1HA1A 3JB9k 2XWYA 5KFAA 4M9SA 4B1RA 3G8SA 2UUBF 4Y00A 4ZIVA 2F5EA 3K10A 9RUBA 3CCES 3T5HA 4PJLA 2BHZA 1YI2I 2C28A 3D1HA 1RETA 1X7VA 4LMYA 3D6FB 3RBXA 1IGNA 4MKVA 1MNMC 1R36A 2DGOA 2R7QA 5HLFB 5J2PB 4D9JA 2BE2A 3D0HE 2VKRA 1X0FA 1TQMA 1R4MB 3MEEA 1PJ5A 2M0MA 3RPUA 2W82A 4P75A 4CM2A 3SIPB 1HSTA 1N33J 3T9NA 3CUQB 1P4AA 3QPIA 1RESA 2ZFUA 1FX2A 1HPZB 2XROA 2X85A 3C7JA 3RGIA 1RT3A 1NHKL 3PKYA 2KHMA 3I0SA 5EX3A 2J6UA 2HS3A 2NYHA 3R1HA 1WH5A 1JT6A 4ZPDA 1S6QA 1HBOB 2BHYA 2AGPA 4DQQA 1FRIA 3T1AA 5IP6A 5HDKA 2VBYA 3K4KA 4F91B 1GTEA 3U1NA 3H9JA 5DDRC 1ZQ3P 3RRHA 5B7WA 3FK4A 4PXBA 4IRHA 1RTHA 2RVJA 4A3CJ 2IGKA 3W60A 1S7OA 4NRTA 2KP6A 1Q5YA 5HMYA 1BIBA 1SV5B 4J01A 4Y13A 3H59A 3W65A 1PVEA 3VCDA 2VD3A 4RLFA 3GYXB 1V5EA 4EI2A 1J27A 4DUYJ 4N41A 1S48A 3OR1B 2OUGA 3U02A 5CQEA 4ZLPA 4EYHB 1WI8A 4CYDA 1RA6A 1OYDA 2XB2D 4LIWA 4HX8A 5ETSA 4AQYJ 4JYAF 2PT0A 2OPRA 2BZ2A 4C11B 5E17F 4EGLA 3TWZA 4DXLA 2GW8A 1S9EB 4UB8C 2I5UA 3BT9A 1VRUA 4ZPAA 3D1OA 3Q22A 4IH7A 4P2XA 1D1AA 4ZLNA 1NXIA 2GQQA 1MJBA 2MKIA 2ZMEA 1XGSA 3J7A1 1I6HJ 4DR1J 1H73A 4G6DA 2RRAA 3ETOA 4GVBB 1MH3A 2V2ZA 1EH7A 1XQIA 2JFDA 3SDBA 3RZOJ 3JTGA 3S32A 4ED7A 3IKVA 4XRMA 5A8RA 2MZRA 4NLWA 4QWDA 4A8QA 4PSXA 3LOCA 3S1RJ 2GAUA 5DDPC 2RMLA 1P4WA 3Q3SA 4Y3OA 3ILIA 3M2VA 4OLOA 3HHLD 3OD2A 2K3FA 5E0OA 3L09A 2HSEB 2KFNA 3T1HF 1L3KA 4R8HA 1JHHA 3AY0A 3PRVA 1SPBP 4QIVA 3E5QA 4RW6A 4DV0J 2YNGB 3FFIB 1YOVB 2XSJA 4X6AJ 4KC5A 3M30A 2OO4A 2GO8A 4B3MF 5TGTA 1R1VA 3S8PA 1YBAA 2WV0A 2B8PA 3J80U 4JP8A 2Y30A 2PE8A 4RMNA 4XK4A 3LSHA 2H1YA 1MBHA 2LU1A 4CH0S 4O44B 3SFGA 5ICEA 2LQJA 4Z6YA 4I0WA 3QRRA 4KBIA 3CJTB 1V55H 1QGPA 5AXMA 4OWRB 4XLCA 3W6KB 1OY8A 3JSRA 2KM8C 3V7CA 3HYIA 2P6SA 1B0TA 2ZWOA 3NG8A 4NLVA 3UD3P 4A5NA 4EJTA 1GVDA 3OHAA 1HQEB 2B4OA 3J80K 1N34J 3CO0P 3IWNC 3DI6A 5IQQA 1TKDA 1RWWB 4DSKA 2N3OA 1H2TZ 2M8HA 2DGWA 4A3IJ 2LOOA 4C2UA 1NKCA 4RNHA 2DITA 4DCPB 3BSOA 5E1ZB 4F4XA 9ATCB 1R5GA 3K17A 2V9VA 3DOMA 1OCTC 2DT9A 3H35A 3R5CA 1SQFA 2HRTA 4A3MJ 4EM2A 1ZAXA 3GLXA 5DQGA 2DA6A 3CJ5A 4DQPA 5ILUA 2ZH9A 3KZYA 1C0UB 5CYVA 1RK8A 1N78A 3OXLA 5ETKA 5KFSA 2EC0A 2CVIA 5KFCA 4DQSA 1T08B 1C0TA 4MIMA 5D8LB 1RRJA 3GJTB 4ZPWR 1FHTA 1XMXA 5E8IA 4B3RJ 4A6DA 2KN4A 5DM6Q 3G3ZA 2ZWPA 3BS9A 3DKDA 3KG1A 4JI1F 3V4IA 3HPHA 2MYSA 4IJAA 3VWSA 2MLKA 2K1RA 4UT4A 1R6YA 3FCVA 5D15A 3Q0UA 2FB0A 5K5OA 2K06A 3LH2S 1U8BA 5KG5A 1WEZA 2XPUA 2OPPA 2UXXA 3UPFA 5HL7Q 5KFEA 4YY3F 1FBQA 4BHBA 4OYAA 2V4JC 2VBWA 4HEA9 2O7OA 1PP7U 1DPRA 1CJTB 2ASDA 3SZGA 2ZFWA 2ZHAA 3ZZOA 2RQMA 3MEDB 3F0CA 1X2MA 2LDIA 2R42A 1UVJA 2ZZMA 2HOAA 1V3RA 1IJWC 2XIGA 1XSXA 4Y15A 3BQ1A 1REVB 5CCLA 1U1LA 4ZDOA 4XDDA 3AD9C 4NC7A 5B0DA 2EEYA 2HZDA 4KJIA 3PYFA 2HXOA 3SHFA 4EVIA 1SJ4P 5K5RA 3S6EA 4RKUC 1OISA 2G13A 1HR0F 4MT1A 1X4GA 4WP8A 1K8AT 2QSFA 1I94J 1ZAVA 3BKFA 1OMIA 2KXNB 4N4OB 4LOCA 2HHPA 3OYMA 2EI5A 2R8HA 1I27A 4G6QA 3FBEA 2SXLA 4PG5A 5HBMB 4ZP7A 2CUZA 1HNWJ 2HQAA 1Y5IB 2BKNA 3ITHA 2QEXS 3QSIA 4IQMA 4NWBA 4UOHA 3GIJA 2ZH5A 2O67A 3AA8A 1RAHB 3PYDA 4Y2MA 1ONVA 1WI3A 3FXOA 3GG1A 5KT7A 2QKLB 4ALZA 4IVNA 1KWMA 4RWWA 3C14A 4DX5A 2BW3B 1Z91A 1TL4A 3CC4I 4A8MP 2CV2A 4DHVA 1Y0NA 1S97A 1BLUA 1L3SA 2YKNB 2UP1A 2HQCA 3EVWA 5I3UA 3SFIA 3MR3A 4M3FA 3GIMA 1TBXA 1FFGB 2C2KB 4I2PB 4BY7J 4KE5A 3QLHA 1KU7A 3M6XA 1FOXA 2MMYA 4QTRA 4M72A 2RU9A 3HSJA 4K2XA 3IFEA 3OYHA 4FS1A 3K2ZA 1YITS 1G1XA 5EG0B 1TV6B 1T05B 4EO6A 1H9GA 3HT0A 1T0FC 3GEZA 1FA0A 2V2QA 2MKJA 1X5OA 1RWXB 2E2IJ 3C15A 2MGQA 1HQUB 2V68A 2BM0A 5TJJA 3OV8A 4EBEA 2C3OA 3HHHA 2DGUA 4Y65A 2MD0A 4G12A 2BABA 1JUMA 2MD5A 3OSGA 2IYGA 3E6CC 1Q95G 4L74A 4AL6A 2DR7A 1OCPA 4OZJA 1OPIA 1G3WA 1NO8A 5K7HA 2NZCA 3K5LA 5E3NA 2B63J 3PO3J 1TVRB 2M4KA 4NE9C 5HOOA 4K0KJ 5C5JA 4KUMA 1Q78A 5GPAA 2P5LC 4NCAA 2G7UA 3G71S 1GX5A 4LF1A 2GMJA 3TDUC 1HYSA 3HHLB 2N4CA 4P9FA 1PJRA 2F48A 1EF4A 2AX1A 2R3SA 1U45A 2HTSA 1LKXA 4DYQA 1R89A 4JOUA 4AIJA 2R7WA 1MSWD 2Z2ZA 4LF8F 1YW9A 3DEWA 2CPHA 2VFSA 1DBDA 4MTPA 2QKMB 1UVIA 4BC9A 2C3PA 2XLKA 2APOA 4X62J 2J9EA 4IHTA 3ZNJ1 1WH7A 3Q23A 1MBKA 4A3BJ 4ZPVR 4DGWB 4PK4A 1FI4A 3TI0A 1WJAA 2E1MC 3DV8A 2YKQA 2CWKA 5KFZA 4FETA 5KFWA 2ZEJA 1JLAB 1FYLA 4AT1B 4C2TA 3WTYC 3QFHA 5AXNA 2LCWA 2QFJA 1S6UA 1S6OA 4DPYA 1VQ5I 4IQJA 2EFWA 3VQTA 1R8BA 3SZ2A 5FO5A 2XI2A 1XDUA 2D9OA 2M4GA 2KDZA 3QMQA 4BQOA 4RB3C 5C24A 4O3MA 1HLWA 1FOWA 2HU9A 1WWXA 1NAQA 3SDGA 2DY1A 3RBZA 5I3QA 3A8EA 4DV2J 5B3SH 1UJ8A 3WIUA 4J9LA 3H5RA 3HFVA 3BEGB 1YW8A 1T56A 1D8YA 2VIXA 1NK7A 1A36A 1S1TA 3QPHA 1RT2B 2HWHA 1VQLS 5EGOB 1H89C 4QWEA 2V1UA 1R7JA 3SV4A 2XC9A 3FMBA 4TYAA 3Q8RB 2QIFA 3HG9A 4DV1J 2Y1RI 4WCGA 1VQ7I 1BJZA 1F6TA 2CJQA 4XR6A 1UG2A 3QP5A 1KLMA 2OH2A 4OYZA 3Q83A 2DNMA 2J6SA 4HACB 1FDBA 2OP5A 4DV5J 1N4LA 1GXQA 1IN7A 3C2HA 3I9V2 1VQMS 2VE8A 1QSYA 5E20A 1M5OC 4S0HB 3WX8A 4TU7A 4I0BA 3SDEB 1Z6RA 4QWBA 3CCJS 5EX0A 3GO5A 5J40A 1QJHA 1RTDB 4R0JA 1OCOH 1RWVB 2VIHA 3ZZPA 5J2MB 1P6TA 1O3SA 4ZVUB 4RPFA 5IC6B 2KJWA 1L3TA 4ES1A 2YVSA 1KHWA 2KXFA 4H4MA 4WTOB 2VKHA 1NK4A 1X2NA 1AZSB 3HZGA 4DQ2A 4K4WA 1FF2A 3US5A 4JI7F 5E5NA 3IBFB 1LDDA 5J2NA 2EC2A 2RUGA 2WVBA 4QQBA 1HI0P 3ZMVA 2ASYA 3CO7C 4BQNA 4JX4A 3AB2B 2VT3A 3M8YA 3PQJA 1W7PA 5CD4H 3J81j 4HG2A 2K9NA 1RHUB 2BX6A 4CZCA 1CS4B 3KJQB 1W36C 4OJGA 1X4AA 2L02A 4HVZA 4UHTA 3OTOF 3JSOA 3A4CA 5EGYA 4ZCMA 4DR7J 3FQKA 2DJNA 3UR3C 4ZYAA 1SH2A 4L3KA 5IT9Y 1BN5A 2J0XA 3NOGA 5ADZA 2LU2A 1WSUA 1RR8C 3VPRA 2RVCA 1RSCA 3ECOA 3LAMA 2KRBA 2P5VA 4ZC3A 4BH9A 1N5YB 3DHXA 1SEUA 3FMSA 4CO3A 3PEJA 3O44A 3BSCA 1BI0A 1CQMA 2ZJQQ 3H0GJ 2XI3A 4ZJZA 1JI8A 1E6YB 5G4DA 4Q4ZF 3LMMA 1SC4B 2V94A 2VUMJ 2KG1A 4EM0B 1M5SA 4EMSA 3DRRA 2IJRA 3UVJB 3LSRA 3MD3A 4OYXA 4IQ4A 3OIQA 4A3KJ 2JEFA 1EKSA 3UDCA 4NZ7A 2PBIA 3O2PE 3NAUA 1PSDA 4DPXA 3DLAA 4O6JA 1UMQA 3GUDA 4K2EA 2E29A 5E33A 2FVRA 5DEQA 2Z3YA 1FX7A 2VICA 2ZH1A 2GWRA 4KH1B 1BE4A 4Q7AA 3G2BA 4MIAA 3MUMP 4AD6A 5D0HA 2DMTA 4I6YA 1IWAA 5I42A 4IOCF 2L7FP 1CF7A 3RR8A 1UJ4A 1IKXB 2ISZA 4TQRA 4FISA 3KK3B 4A0XA 3DLKB 3MEKA 4JBCA 4JI8J 1IXSB 1H2VZ 1ZR4A 3P96A 3RZDJ 3O2IA 2VT2A 1PYOB 3DKWA 2Z33A 1CGPA 1TC3C 3CCRS 5AE2A 3KOAA 3KP5A 3VAMA 2NRAC 1U1OA 2E9RX 2X6OA 3BZ6A 2VFRA 2HWVA 2Y0SN 1KQFB 2EKNA 3I32A 3ISNC 4KHRA 1XMOF 2RV8A 3HKZD 4E7JA 4CCKA 3DLEB 1JKRC 4IG3A 1YE9A 2BRKA 1X8DA 2Z16A 1X3WB 5KG1A 3G6VA 4MFBA 3SSRA 3HHGA 4S04A 3D6TB 4FBUA 3S2DJ 3X2QH 1VQKI 2IS4A 1NJYA 1K6YA 1NKBA 2PMWA 4L0YB 1P27B 3U1LA 4M3DA 2P8IA 2XNRA 4HQEA 2DIUA 3I9ZA 2FLOA 2UUBJ 2VPRA 5IWAF 3OTEA 1HW1A 4PGGA 3LA7A 5GP9A 3A0HC 2EINH 2BDPA 5E3RA 4G7OF 1SC3B 1R23A 2LEBA 4DBRA 2JVRA 3PVXA 2GX8A 2LYCA 3HTUA 2CQ2A 2X1BA 4U95A 4LBIA 4F04B 4F0MA 1ETYA 3I31A 2ZM6F 1X58A 3CCMS 1R1TA 2BE9B 4UV9A 4M6VA 4UY8I 2PX9A 1TZ0A 1EHWA 3K70C 1DPUA 2FJWA 1Z2ZA 4FXVA 3MAAB 4QW8A 2DO7A 4NLGA 3KP6A 3KP2A 3RRGA 4L75A 4OOIA 3ZQHA 4ECQA 1D5YA 5GADI 1NJZA 1QBJA 1EAYC 1W25A 4J9VA 2V9WA 1P6RA 3KUEA 1Q82T 2QLWA 2XZTB 3BR8A 1VR6A 3FXKA 1UEKA 3GFYA 4H4KA 2W9BA 5KFFA 2UUCJ 4DR6F 3MFKA 4DL5A 1AA7A 3NGDA 5HI7A 1M5HA 4F92B 2HQRA 2W4PA 5IM0B 4NNJA 1XCBA 2QO3A 2Z30B 1JXLA 4DN0A 3RAMA 3LA3A 4LG0B 2V1NA 3AL0C 4Q0BB 1LWFA 3HPGA 1T39A 4ER8A 3NCPA 2B4PA 2KYXA 3S17J 2YNHA 2EILH 2LQ5A 2E1PA 4A46A 5J1UA 1BD6A 4MIWA 3NCQA 2JC0A 2FMLA 4DJAA 2V8GA 3K8VA 2JNJA 2Z8QA 2WB1N 1FK9B 3W5ZA 4JYAJ 1B72B 4QYZJ 4DQIA 1Y1WJ 3VVTA 2JJ4D 2DU9A 3C66A 2OPSA 4ZCIA 4IH5A 3BO4A 2BW2A 2E5IA 1QO0D 2MXYA 1X4DA 4Q47A 4JYKA 3OYIA 1P2FA 2QYOA 2BRLA 2C2NA 5HLIA 5ETRA 3BG9A 2XQCA 3TO8A 1VQOI 2AS5F 2CDQA 2YKMB 3CP2A 2NQPA 4MO7A 2KJCA 1BQNB 4IHXA 1HHTP 2RUSA 1QHGA 3GZNB 2K7KA 2LTPA 1U3EM 2QGFB 4IO1A 4ZJLA 2LXIA 4ASNA 3MPVA 5L39A 3IAM2 4A3LJ 2OSRA 2BY1A 1ZK8A 4DR2F 2DCUB 1SJFA 3HCXA 1OO0B 3UD4P 3MEXA 1G4DA 3EX7B 3R5AA 1NDPA 4NYOA 1B99A 4I09A 2Y69H 2HFUA 3MM7B 3GFZA 1PAEX 5AIQA 3T1HJ 2EIMH 2CJAA 3O8WA 1K0TA 4ELVA 2E36A 2W7NA 2QLXA 3EPZA 1PUFB 5H20A 1NU4A 4MTEA 1ZAWA 4RR5A 1RNLA 2ACYA 1KD1T 2JA2A 1MIJA 2KRFA 1TP4A 3A3NB 3DM2B 2JZYA 2GGPB 2QENA 4MFEA 2ADCA 2B4VA 4B3MJ 3SFZA 3J81U 5CYMB 3B4DA 2O6GE 4WXDA 1TUVA 4FX4A 3DLJA 1MROA 3CTRA 3BBCA 1N8RT 1IKWB 3EPIA 1S9HA 1HBNB 1JMTA 2W4CA 2K9SA 1N5TA 4XLHA 3CCUS 1H0MA 2GC8A 5DO2A 4I7FA 3I56S 4USVA 3A3PB 1FFWB 1HKSA 3UN3A 4BJTA 4ZCLA 2W8LA 4XRSG 2NYIA 5D4PA 2W9CB 5FLVA 3CUQC 2M45A 4CQ1A 1XTZA 2F9JA 2EK6A 5AONA 3CCQI 4MAKA 1IAWA 1FPQA 1FRLA 1NK5A 5M3FJ 1N52B 2JRSA 1HI1A 1LFPA 5JHFA 3WIVA 4WP9A 3AJDA 2DPDA 3A1YG 3CGIA 3J81K 3B82A 5LLQA 3LP2A 2E71A 3J7YI 1WJ5A 4L18B 4OYPA 4Q45A 3KEQA 2EG1A 4U0YA 5K14B 2BY3A 3AB4B 3I4HX 4U7UK 3GV5B 3M9MB 3HD2A 1MZBA 3IR6B 3KLHA 2CQCA 3FXJA 2WB1A 3H4BA 3Q24A 1RT4B 4FVMA 5A0YB 3M8ZA 1T38A 5DQHA 2K8GA 4PWDA 1NRKA 1NZ8A 3IM9A 1K4SA 3QYFA 3IGNA 3OR1C 1Q0NA 4OX8A 2HVHA 2LKPA 2MQPA 3ZN0A 4YFNF 2AGOA 3L7UA 1FOKA 1T03A 4KPCA 5HO4A 4BQAA 1HBUB 3GG0A 5LOQA 4JI1J 2ZBKA 2LG4A 1MMAA 2RS2A 3M8QA 3V8KA 1UWBA 2DHGA 1OPCA 1HBMA 2KJVA 2RF2B 2ZE2B 2ATLA 3J7ZI 2LF7A 4QLCU 4O3QA 3WHCA 1TZLA 4YY3J 3RPUD 4XN3A 3LSKA 1GQEA 3JSBA 2NSCA 1ZGWA 2X0LA 1O6XA 3GQCA 2GIZA 3QT7A 2RSQA 5DUKA 1I3AA 1RYRA 1A7GE 1NSPA 4MKBA 4Y33A 1RISA 4UY85 1EH8A 2GMLA 1R5HA 3ISPA 3E01A 3T6BA 3ML6A 4C0OC 4LLLA 4LJZF 2MPUA 3H25A 1AHDP 1Y6IA 2NVYJ 2JA6J 2R3VA 4UOCA 2CQNA 1HR0J 3QFWA 3W5XA 4AVPA 1O57A 1AU7A 2EFNA 2GVDB 2YNFA 1O7FA 3CDIA 3SQOP 1YJNI 3IG1A 2O66A 3N28A 1LWCB 1YK9A 3E6BA 5K9FA 1HNXF 2ZJPQ 3RYPA 4CYCB 5F3TA 1NG6A 1NSKL 5AT1B 1G6BA 4TXSA 3RBDA 3CF2A 2JWTA 2LXFA 1IC8A 3FC9A 3R5BA 1EH6A 1CC8A 2IVYA 1DQ9A 2O5DA 3EUAA 2M88A 1HL6A 4IG0A 2BQ3A 1XR6A 4L5IA 2BA9A 4ED3A 4NX9A 2COLA 5D78A 3F72A 1U6FA 2KB2A 1TLHB 4F3QA 2AHQA 3PNYA 1Q16B 2FEZA 2EXUA 5M2PA 2M9HA 1PBUA 2CNLB 4X4VA 1Z2LA 4RW8B 1X0PA 2TDXA 2IM2A 1YG2A 2K5CA 2IC3A 2FA5A 4M5IA 3MECB 1ZTWA 1T7PA 1NZAA 4ENKA 4KGMA 4WE1A 2W01A 5KFTA 1VI7A 4YP3A 1X4EA 3R6GB 1RHMB 1E6VB 3EDPA 2J7WA 1OYEA 4A47A 2VQHA 3BN7A 1XSDA 2WSFC 3F9KA 3CJQB 4QOTA 5D5VB 2V0NA 4ETZA 1VRTA 2FLPA 2Z9OA 3LAPA 3ABMH 3ASOH 1FTRA 2JX2A 1K0VA 3S1QJ 2K7LA 3P45B 3SZPA 4E7IA 4Y52J 3DN9A 1QVFR 3C1DA 1FNNA 2MDAA 2AP6A 4WTYA 1OIAA 3EZOA 3L95X 3WU1B 4LT6A 2HWIA 3ZZYA 3NKYA 1UFMA 4Y7NJ 1X3ZB 4QIGA 5A8WB 2GVZA 3OYJA 1S4FA 1VQNS 5JLXA 3LSTA 2EKYA 2BKPA 2KRRA 1K9MT 1WD6A 1MMDA 4ZLLA 3OBIA 3U1KA 2WONB 1WG5A 1FRKA 2ECCA 3RKQA 3QQCD 2F8EX 5LEJA 1S6PB 2XY7A 4AFFA 2HFZA 2HK2A 3MMCB 3QO9A 4N76A 4LF8J 2MGZB 3K57A 4XIUA 2MY7A 2VH7A 2J7UA 3K1MA 3CDAA 4YQWA 3HRMA 5LD2C 3SEZA 3S93A 5IQ6A 4MKYA 1SJ3P 2YX1A 3FBIB 4WU3A 1W4MA 4XRSA 4OAZA 1C1BA 4O0NA 4RU9A 1CJUB 2A2DA 4HOBA 1MN7A 4H0EA 2PC6A 2G1DA 2H54B 3FVYA 5JLWA 3D28A 4XL9A 3C2BA 3KJVA 2DH9A 5ED4A 2EFPA 1BGXT 3A1YA 3TRGA 2OD4A 1JLEA 2IHR1 3AAWB 5F0UA 1B0PA 1U09A 4CCNA 1JGGA 4C8MA 1TKZB 2ASJA 1HW5A 1MLAA 2BE7D 2VQGA 4WXWA 1RWOB 2LBFB 3PNTA 1N88A 1YX5A 4MK9A 4ICLA 1KS2A 4DFMA 2LVSA 3UDEA 5KOWA 2XF7A 2IDEA 3POTA 2HNZA 3OL3A 1BA5A 4W97A 1IV6A 2XCAA 4DL3A 2X3GA 4Q5VA 1FX4A 4ZP9A 3GIRA 3Q89A 3KP4A 5EYRA 5BYQA 1XSVA 2GS8A 2MKCA 2LY1A 2DMPA 1SC7A 5KFHA 2DA1A 3N6LA 2CVEA 4KYWA 5ETTA 2V5HG 4LIRA 2EFVA 3FCHA 1RHRB 1WKJA 1VQ8I 1F60B 4AIDA 2DFFA 3Q8VA 1S9GA 3J7Z5 2LKXA 1VYAA 4OYBA 3FZBA 1NJWA 2Q8KA 3M3YJ 2YH0A 2HYFA 2FE3A 3V2UC 3AFHA 3MEEB 2BEFA 2RN7A 5GMKa 2LXUA 3DBLB 3OT9A 2DNNA 1S7IA 2DRDA 3G4SS 2FTRA 1YIOA 2CQ3A 2KT2A 4GO7X 5LRRA 4C3HJ 1IBMJ 1IR0A 1RT3B 3BR5A 2J8SA 3I0SB 4O5VA 4JI7J 1I5OB 3NXZA 1IVZA 5HDGA 4U96A 5KAKA 3FWEA 1U4BA 5DLFA 2V50A 3S16J 1ENHA 2KZGA 4YR0A 4BL0B 1FRHA 1SJ1A 4P10A 5HVGA 1RTHB 2HZTA 3CCSI 3NGRA 1Z1DA 1YYVA 4WZMA 4Y2KA 3HHLC 5E3LA 3TZZA 3E6DA 4KT0C 1KLNA 2OEMA 4XOPA 5J47A 4NXNF 3KX2A 4U87A 1F9HA 4IFYA 1EETA 5D3GA 3LSPA 2PI0A 5H9FK 1HQCA 4DS4A 4YN3B 5LGTA 2ZJRQ 1F5CA 2IS1A 3VSKA 1TWGJ 2QZ8A 2AO9A 4F93B 2A07F 2GIVA 1TL3A 3L7PA 2VKDA 5KAFC 2OPRB 3W8PA 3HJFA 2VQCA 5F8GA 2A3JA 1QVTA 2VV5A 1JLBA 3G6EI 5C25B 2DR9A 1LDKB 1VRUB 1HWIA 5FRMA 2DN0A 4NMXA 3HFKA 4BAYA 2MHEA 4ZA1A 3NCRA 4XKBA 1LB2A 2DNPA 2BVZA 4PSWA 3WHIA 5F0FA 4Y17A 2BBYA 3GMGA 1V9OA 1DQUA 2DGSA 4URGA 2ZMEB 3G6YA 3ENVA 1G4CA 2QSHX 4OYOA 4M3GA 3KDOA 2PO4A 1MDMA 4XQFA 1XBWA 1FTZA 1S4EA 2D74B 3V5RA 4J9QA 2VKVA 1GFWB 2LNBA 2DA4A 2IMOA 4UUXA 3CD6I 3WC0A 2HFHA 1WC6A 1QUPA 3AXKA 3H0PA 1VHFA 4OYMA 4MQ9F 4JUZA 5LXYA 3M2VB 1SMYF 2D3OR 4B9NA 1RTJA 3JTPA 1UCNA 5HODA 4HHJA 4RW6B 4UOFA 1Z9CA 2L7MP 2NSBA 1M0SA 2H6BA 1SFKA 2XSJB 2HS5A 1PKUA 3E97A 3M30B 3HRSA 2XMUA 2MH9A 5HK4A 4NASA 1VQ6I 2X6WA 5A2QZ 3E5XA 1RPWA 1TL8A 4HDVA 3UN2A 2XCPA 4AL5A 4DFKA 2Y0BB 1SC1B 2CV0A 3FK7A 2K3KA 1XMOJ 3UWTA 4KKOA 4KFCA 2BANA 2M9KA 3NEKA 1K1SA 4JV5J 3R3TA 4K5RA 4U0VA 1NHVA 4X4RA 5LMUF 1ZG1A 5JVHQ 2E34A 1N5QA 1ZA2B 4BBYA 5ETPA 4LF4F 3HL2A 2IM3A 2PMHA 4R5PA 2M5WA 4HAMA 2RKHA 1VQ4S 1Y9OA 4GDFA 2MA3A 1YLFA 3EQLF 4CO2A 3DC2A 4RJVA 1V3SA 1ZETA 1K1QA 3CC2I 2QLJB 2ZZTA 3TA2A 4FKYA 5IWAJ 1F1BB 2ZXHA 3JYTA 2E19A 3LWLA 4DR3J 3IXQA 4OMFG 3DI6B 1RZ4A 4F26A 2EIJH 3HHKA 2XB0X 3MHYA 3TYTA 4KAIA 1YWXA 2DDAA 1XPXA 3V8JA 1VF9A 1LKZA 2JH3A 2ZM6J 1JXEA 1YJUA 3D7SB 1XNQF 3HOYJ 4DYCA 3DOMB 2CUYA 3CW2C 4ED1A 2W1OA 2R0QC 4FPIA 4RM2A 3HB9A 4B8XA 2V2VA 5JXSA 3W6JB 1C0TB 4M5LA 2RNEA 3R60A 1HNIA 1WF2A 4IPAA 2K2PA 3DXJF 2ABYA 3CIZA 1N6QA 4LFAF 1R8CA 2OKQA 2ZOFA 1C4AA 2AQ4A 4OI1A 3V4IB 1CG2A 4YDDB 2K1RB 2JSCA 3PO2J 3SCJE 1RLDA 4D0PA 5CYQA 3QRFF 2OPPB 3UKGA 1S5ZA 4RNFA 4F0KA 3ZCOA 2YQ1A 1JWWA 3AXMA 2L9NA 1YZ7A 8ATCB 3HBLA 1T94A 1MD0A 4HLBA 4A8SA 2FJAB 1KVIA 3QIPB 2QL9B 3S14J 1D1UA 1YJVA 2B6AA 2LYVA 2F8HA 4PUOB 1X1DA 2A6HF 4BXXJ 2DD8S 2FGCA 3L2CA 2QA4I 2HDDA 1SC6A 5GAEU 4V19J 1XIQA 4G1PA 5AIPA 1V3ZA 1Y8RB 2CADA 2IRFG 4R8UA 1VQPS 4WP3A 1W7PD 4WWCA 2CNOB 2DGQA 3M9NB 3SV3A 1XMKA 3WC2A 4TN2A 3BJAA 5GAEJ 3PYEA 1S76D 4U7UD 2B9WA 1WOSA 3PJWA 3THTA 3TZXA 2OQRA 3M9OB 2XTJP 1VOMA 1G59A 4XBFA 2PI4A 3FBCA 4M3BA 5FJ4A 4ZOSA 3TUPA 2VC1A 7FD1A 4LF2A 3IH4A 4V19K 2V6AA 3DEUA 2RJZA 3ITHB 2OPTA 1TAQA 4BYYA 5B0FA 3RZAA 2JUCA 5FLMJ 1C2PA 2E5LF 2R92J 2W2QP 3C14B 4CTAA 4WYWA 1QSLA 2ZH8A 4C8OA 2HYGD 3WTWC 3F56A 5I3UB 5CXTA 1V6HA 5J8FA 1H7WA 4DR2J 4DR5J 1U1KA 3ZMZA 4FF4A 4IDKA 3QLHB 2DA3A 3T3FA 3S2HJ 2GZWA 3KTQA 3HZEA 1O8BA 4PJNA 1X4BA 3OTCA 4PJ0C 5EZHA 2HNDA 1A9NB 3OSNA 2ZB9A 1IZ1A 1P7IA 1T2KA 5A6WA 2CUFA 2KIUA 4J19A 3BGRA 5DQIA 3QGIA 3C15B 4MKAA 1RKTA 2GJ2A 2VN2A 4JX5A 1R22A 2IXSA 3BR2A 2PN6A 1IKVA 4F55A 3NY0A 2I1RA 1S1UA 3CB4A 4QWQA 2QRRA 2NOJB 2PFBA 5D8HB 1F0XA 4F4YA 1YIJS 2YSRA 3BJOA 2FBIA 4BNCA 3A13A 4NLDA 2PIIA 4YIRX 5FLXY 2HK3A 4ZVFA 5L1KA 3VALA 2F2EA 3LQVA 2JUGA 3RDIA 2KH9A 1HYSB 1TTYA 3WTUC 3N01A 2RH3A 1U8SA 1R27B 3RJMB 1FDNA 3ISZA 3WZ0A 2IVMA 3P4UB 1SIZA 1LUJB 5KOXA 4A3JJ 3OFHA 3BWGA 2B0LA 2EV0A 4A69C 1XGOA 3AQOA 2OHDA 4EEFG 5CHCB 3GYNA 5CAAA 2WTEA 2J0QD 4XN0A 3BOQA 4LITA 4ED8A 1GAOA 2D3UA 1FDDA 3WTTC 5KFIA 1APLC 5HJXA 5JUMA 4XONA 2X9DA 1EV7A 2OV7A 2HI3A 3KNGA 1YO5C 2XWXA 3DRXA 4CLSA 4AUKA 4XKCA 3V6HA 3N05A 3QWLA 3D4JA 3HVAA 3ETMA 4AYBN 1K44A 1B4SA 4ANCA 1SQGA 1N33F 3GWCA 5DDQC 4IO9Q 2MJUA 2DNLA 3MM5A 3L3CA 1WSRA 4QW9A 1RE1B 3U9GA 2KZMA 1OY9A 4Y2CA 4FXWA 5KFMA 5C24B 3FM5A 2KM8B 1GMVA 2W2PP 4M63A 4HBLA 4HNUA 1WZ2A 4X64F 2Q1ZB 1S29A 3Q9VA 4IRIA 1HWLA 5LGUA 1S1TB 2KT5A 3PM1A 1LEBA 3K89A 2VPYB 1GUUA 2J5PA 1SVLA 3K4JA 1UPMB 4L9NA 3M07A 2XGQA 1ZBTA 3HKWA 3HPOA 3EUHC 1H3DA 3VHQA 2W8KA 3IAM9 1A6IA 3CT9A 2F40A 1J0RA 5TISC 2DO0A 2LP4A 3P7NA 1HNVA 2OJ3A 3HC7A 5A8KA 4UVAA 1VQSA 1Q8KA 2KRCA 2MKSA 1EJ9A 4IKAA 1S10A 1IDYA 4AIKA 3RTVA 4I69A 4AC0A 4HLYA 1W7WA 4NLRA 4O3PA 1SJRA 3NWRA 2X6YA 3K59A 2HLUA 3VFZA 4YDXA 3BJ6A 2Q66A 5FGMA 1KR4A 3ZTRA 3QP6A 1VQLI 2HVDA 3GVAA 4H4MB 2GJIA 1ZG5A 1V3FA 2OZ6A 3TR5A 4DG1A 3ADAC 3CCZA 4OL8A 4ID8A 4L0ZB 5IT3A 1Y11A 3IV5A 1IUFA 4W1UA 4XLPF 1POGA 4C7QA 4L9TA 4DR1F 1WI6A 4EBDA 5FROA 1EQ0A 5IY5H 1B8IA 4RUCA 4CDIA 2DNRA 1VQMI 3AH6A 1UZCA 4B9LA 3OS0A 4DF8A 3J7AN 3VODA 2VF3A 2FX0A 3OS2A 2Y0SD 2L3MA 2CJBA 3HHEA 1W7PB 3OVSA 2BGCA 4PQAA 3MUTP 5LBQA 2Y2ZA 4ZVSB 4HL9A 1VK3A 3MKZA 2K02A 3BP8A 3OIOA 2F1FA 3RR7A 4J9KA 4NLOA 1R49A 1YTYA 4ABZA 2B7CB 3HVTA 2UU9J 2FMYA 4GO5X 3L7OA 3PW2A 4KMUX 4C8KA 2G0CA 4J7CA 2E9ZA 1MN9A 3G1LA 2GMHA 2Y1JA 4Z37A 1RADB 4X1EA 3OYNA 3JRCA 4EQQA 4DV0F 4ZVRB 5RUBA 1EX8A 1D0ZA 3TKYA 4R1HA 4MK8A 2LEAA 2K7JA 1LW0A 2IT0A 3HTSB 4K5SA 1DTQA 2DMNA 4BXFA 2OUMA 2QSGX 4LUBA 4KIBA 2RE1A 2M87A 3CJ4A 2K3PA 1WI9A 3DRRB 4I6AA 3C2GA 2G2OA 4YB7A 1APSA 1BR1A 5HNHA 3K6GA 1QA6A 1SL2A 4G7ZF 1G2HA 1MW7A 1HCRA 2ZKUA 1RHJB 1PO6A 1SXLA 1FT9A 4ZLJA 3D5SC 2KU7A 3K5PA 2Q3PA 4WFBQ 4UUSA 3FJ2A 3NL0A 3EXCX 1WOOA 3KHRA 4NRUA 2ZH6A 3K69A 5ICFA 1O3RA 3GJQB 3OYKA 4OHVA 3I82A 3GLJA 5D8KB 1O4XA 2NREA 2JHEA 2RKIA 5T14A 3ZQQA 2F7VA 1J9IA 3JRIA 2HBQB 1CF7B 1FKOA 4ZP6A 1BOAA 3HOSA 1L3VA 4IX7A 4UF4A 4IOBA 1FBSA 2WAQN 4K4TA 1FTCA 2KYZA 2JSXA 1VZ0A 3M8JA 2QCOA 3CP8A 5DZ6A 4MK7A 1QE1A 2OD6A 2HGCA 2NS7A 2WB1D 2QLBB 3BZQA 1WHXA 2I8EA 2H1LA 3EGZA 2XF5A 2XMKA 3LP1A 4OQJA 5BXIA 3NRVA 1K4TA 1G3SA 4M5HA 1KQ8A 4IG3B 3MUVP 2AXLA 4MFBB 1TWHJ 4RAZA 3DTEA 5F8IA 4GC6A 2QWWA 4ZP8A 2QVOA 3W9HA 2XHWA 2MEWA 4EO8A 1VDHA 3TO7A 4RX6A 3G86A 1A35A 3QGPA 1YRXA 3RSNA 3O3LA 1J2VA 2OTLS 3BR0A 1BC8C 5JJBA 5T41A 4ES2A 3RB3A 3FRYA 4LBHA 4O4GA 3CDBA 3E3VA 3P6YC 2JVOA 4CO4A 4PFPA 3B78A 2W48A 4PWWA 1EKRA 3WU0A 1HW8A 3EM1A 1GK8A 2X1FA 3PACA 1DJ0A 4KRWA 4ZPTR 3CCLI 1UVMA 5GTHC 4M74A 3CMAS 1I94F 3WGHA 2DOAA 1YRUA 4IRGA 3U1DA 2KKHA 4PABA 4ED0A 2JA5J 4WXCA 2DNYA 1QAXA 3FMRA 1VJQA 1LNQA 8RUCA 1XNRF 5KFGA 1D9FA 1QAIA 3F23A 2M1BA 4ZYHA 2BJDA 3CC7S 4OX6A 4I01A 2CUJA 3DRSA 2RAEA 3ZQGA 2C22A 2BY0A 2EFGA 4ZITA 1TQPA 3EUHA 3T5LA 2W9BB 2VBXA 2RNGA 1MSEC 1NNDA 4DV3F 2R5YA 1TQIA 3I59A 3DLGA 3M8FA 3M32A 2A5WA 2XGDA 5EEHA 5DG9A 4Y0FA 3QYBA 2F63A 2HQIA 4BGDA 2CDRB 1JLCA 1WJDA 4ZHRB 5EEAA 1FMVA 5H2FC 4YIIA 3PIPQ 1LWFB 2JQ7A 1RWPB 1H6KX 4NXNJ 4ZN1A 1UKUA 4E7HA 5D5UB 3BKUA 2YNHB 1ETOA 2LREA 2E5JA 3R5JB 1TWAJ 3VZIA 3C6TB 2ASLA 2WY7Q 2MQMA 4RB2C 5HLGA 4BU2A 4B9SA 1HI8A 3TAMA 2DISA 2WAQA 3MF5A 2X1EA 4FTHA 2CNKB 2HHUA 3M1VA 1ZPWX 2AEJA 2OPSB 4F4WA 1LXNA 2CRLA 1S59A 4PYDA 1YI2S 3K4BA 4B9VA 2DH7A 1XERA 3BC8A 1NB7A 5DTDA 1XGMA 5DRKA 1ZGAA 1G3TA 5HLTA 3MMAA 4U8YA 4AE5A 2ZXWH 1SH0A 2BV6A 3RYRA 3C16A 1BR4A 1S6LA 1QAYA 2MJNA 5E18F 4V1Ak 1TELA 4G7HF 1OYYA 4OX7A 4WU2A 4A2UA 5EWGA 2I6WA 2CPIA 3LTOA 2XMTA 4LRAA 4YG2F 2G9OA 3R4KA 5C44J 3OQ2A 1UA0A 2HQDA 3M4OJ 4BHPA 3AJ1A 2V4RA 2RQPA 2DHXA 2I5JA 4XPCA 2FIUA 1RYSA 3OOPA 1RT1A 2CZ9A 3NMAA 4CT9A 3F8CA 4L6V3 4DLEA 4W4MA 2WOMA 2RQQA 1VBXA 4RW4B 3TX8A 3EGVA 3W9IA 2EBIA 2ZHBA 2VDHA 3H42A 1VISA 4C3LA 4WFNQ 4DOZA 2B4UA 4RLQA 3HKZA 2AF6A 5K8NA 2W4DA 2KQRA 1SL1A 1LE8A 4OIOF 4OYIA 2VU5A 2H6CA 3L2VA 3OYDA 2O8XA 1NH7A 4USKA 1NJXA 1KVKA 4OI2A 1SI9A 2OPQB 3MFHA 1HSJA 2MLZA 4K50A 4CUGA 4JK1X 1MROB 4CLTA 1JK9B 2DFIA 5GTIC 2OMLA 2XB5A 2IGNA 4NYZA 1BMQB 1Y5LB 4I7FB 5DD4A 1U5TA 2HAFA 1Q7YT 2HS4A 1XR5A 4LF4J 3TL4X 2HHXA 4B3SJ 3TMOA 2H51B 2J9DE 4PKDB 4Z2YA 5CLSA 1JUSA 1AB8A 4AIHA 2J5OA 1IM6A 3F8NA 1MG7A 2V9PA 4XMYA 2CW0F 3EYZA 4A8YA 1MWZA 1N77A 2YBVA 1S99A 3F8MA 5F04A 4C3MA 4CXFA 2MLYA 4DU8A 4FS2A 4ZDPA 3LP2B 2Z57B 2H27A 4LB5A 2M3DA 2VA2A 1Z7LA 3DLLQ 3IMQJ 2HGMA 3MM8A 5BPDA 4DV5F 5DDGA 3KLHB 2XVCA 4BXUA 3V6DA 2RD5C 4FN5A 3JAMY 3MCZA 4G94A 2K3IA 5CVRA 5DM7F 4PWDB 1R43A 4M71A 3WG9A 1IR2A 4GFBA 3BR9A 3K0JA 1JJCB 3S3OA 3QJJA 3D66A 1NDLA 4LB6B 5LMNF 4M6YA 3ZQ7A 4NHJA 5LXRA 2F4OB 5CVVA 3NAIA 3QYYA 2FQ4A 1IBCB 3CJ0A 2DA7A 4DL2A 2VPLA 1YFHA 1T03B 2H94A 4ILRA 4DS5A 1SVMA 4LFAJ 4ESFA 3U21A 4ZZDA 2WBRA 4FX0A 1S0VA 2Z2YB 3AOBA 3HHDA 3AAFA 3BPVA 1ITYA 2G9WA 3M8QB 3DGPA 1JUPA 3DPLC 1UWBB 1HBMB 4ETXA 5KG2A 3DBHB 1S1XA 3O5TB 5DJBA 3W9JA 2KO1A 1T3OA 3ZZZA 3JCUC 4NYPA 1AA1B 2W84A 2AW0A 4ESJA 4UVBA 2VE9A 4LG3A 2CU7A 2LFVA 1TU0B 2ZMEC 4WK3A 2PGCA 2A68F 1PUEE 3OHBA 4LGWA 3E01B 3M7VA 5EEGA 2H1KA 1IQTA 2QTWA 2AYEA 1ACMB 3G87A 3KLIA 4ANJA 4DR7F 1CBKA 3MR5A 4NDLA 1VHIA 1JLFA 3AG2H 2CZ4A 3REOA 2YNFB 2NS1B 3TAPA 3IG1B 1ZG3A 3A02A 3K1PA 2L5QA 2CH0A 1ZN2A 5CYJA 3JSMA 3CDHA 2AEFA 5KFPA 3MR6A 4O44A 3FM3A 2KL4A 3RTRA 1BL0A 2L08A 1P9YA 1D0YA 2ACMA 2RILA 4IYQA 3UD5A 3HM5A 2E5LJ 1QZEA 4PZJA 4IG0B 3AL0B 2FC9A 3LSJA 2VOOA 3I87A 4ZYDA 4EFAC 5D4LA 3DKYA 1SIWB 2ZH7A 3HK2A 3OWTA 1FXDA 3T1BA 3RCOA 1JKPC 5H1SV 4CRJA 3TUIC 4BLGA 3CTAA 2CGPA 2VL8A 2IC3B 3I53A 1SD4A 2Q79A 4WE1B 1X1CA 3IAS9 1W5TA 2VC0A 4WFXA 2UV1A 3FBBA 5HN0A 2QQAA 1BW6A 4EATA 2AT1B 2C2ZB 2ZBIA 2EZHA 1QPMA 4EM1A 3W63A 2HVQA 3PV8A 4UUVA 1VRTB 2HHVA 1OWXA 3MVPA 3ERED 2BJ9A 1KTVA 2DNOA 4LRFA 4QPTA 2QMWA 2XASA 4EEYA 2A6OA 3H5XA 1OSDA 1U0SA 1WG1A 3OR2A 2P6TA 5F0HA 2XRNA 3GONA 2HWTA 1WORA 2NPIA 1RKJA 5KNLA 3U2RA 3NNCA 3D67A 2LP0A 4L9VA 2LH9A 2JTVA 1ZRCA 3TNVA 1R00A 4IFVA 3ZRGA 2GVZB 2Y9ZA 4R25A 2EZLA 4CO0A 4F0HA 4A48A 4JB8B 2B7EA 3G82B 2HKOA 3HSDA 3J80Y 3BYRA 3OOUA 2GBYA 1RP5A 5KFVA 4I0AA 3MPWA 2XYPB 2B56A 2BVLA 2VQEJ 4O3NA 4BBSJ 4DF4A 3AJ2A 4CO1A 1T0TV 2N82B 2EQRA 2CXEA 3PXGa 3QO9B 5JVGF 4BCAA 4NLXA 4LFUA 4DL6A 3LQRA 1UPPA 1N54B 1MMNA 2VZ9A 1KNZA 4ED5A 2ZH2A 4AUXA 1B70B 5HMZA 1QTMA 4B08A 1AT1B 1IDZA 3C46A 1C1BB 2YWWA 4KMFA 2VJUA 2W2OP 5L38A 2E2HJ 4BDPA 4YB6A 3HXLA 2BKOA 4FXDA 2KMUA 1JKOC 2IAJA 2YKPA 3H3VK 1FDAA 1Q1KA 3KJVB 4NI2A 2QMXA 5IP7J 1FZPB 1BI3A 2ZKZA 1FSHA 2NCKL 4XKWA 1SFEA 1YJ7A 1Z21A 5HBMA 6PAXA 5F6FA 3GILA 1RHQB 2ICWG 1PJ7A 3RAQA 2WVEA 3SCIE 2GIRA 1NMEB 3I5AA 4NMLA 2HHWA 1CSJA 4NLPA 3LA0A 3GE9A 2R7RA 2PLYA 2DIVA 3M8RA 2PG4A 4X64J 1JJ4A 2HQ3A 1Y3JA 2GAGC 5EF6A 1YGYA 2UUCF 4ICLB 2CMPA 3AG1H 3EPGA 3K58A 2XAQA 4NC8A 3UNYA 4DPOA 4DJBA 2IRYA 3TA1A 1RBAA 3KK1A 3ZMUA 3POTB 2CUEA 2HNZB 1F5BA 2P9EA 4XOTA 3N6NA 3IWXA 1JKQC 2YU9J 3HXMA 4HZFA 2PQ8A 1TL1A 2AMCB 1MMLA 5FB2A 5ETNA 4P71A 2H8RA 2VBZA 3JR9A 2FOKA 3H5NA 2P5KA 1W2BR 1KN6A 1PCAA 2WWYA 3MDFA 4L9JA 5LHHA 4LIUA 2O9LA 5C4JJ 3ZZUA 4NQWA 2RDIA 1Y1VJ 2OQGA 1DRZA 1UP1A 1NK8A 3F41A 5D4SA 2AIRB 1S9GB 4EZ6A 3NBPA 1H98A 3WODF 4C3KA 1UG0A 1N5VA 3R8YA 2VPWB 4NZ0A 5FDLA 2W2NP 3HO1A 3BTCA 3RYLA 1YDLA 4LRCA 1U9NA 3VYUB 1QPIA 5CABA 2M0GB 2VJVA 5BYSA 3ABLH 1TK0A 2ZVIA 5ILSA 1ZOTA 1BQMA 2V2KA 2M8GX 2IAIA 4A8FA 4MNUA 4ESBA 2QM3A 2ZHOA 4P96A 4X84A 1ICEB 1T9YA 4KDPA 2DBBA 1RZMA 1V5GA 2Q0OA 2ZC4A 5KG7A 3G8TA 3V81A 3MPDA 1LFWA 2Y9HA 1H2UX 3R5DA 5DLGA 2YX4A 4F7ZA 3MD2A 4D7MA 2AYGA 1QRYA 4URQU 1JXSA 3A01A 2H4WB 2CJYB 2R7TA 3H8YA 3DCFA 4AM3A 3E7LA 4M9ZA 4TY8A 5IT4A 4IFYB 3N97A 1EETB 5D3GB 2BBEA 2ZC3A 1KFSA 1HF0A 5TRDA 2QYCA 3CJRA 2OCCH 3AOAA 2ZBRA 3VF0B 4LFCF 4F2SA 4F3OA 2EZIA 4OFZA 4A12A 2PI5A 1VQ7S 3QBCA 2NUHA 1R3NA 1TL3B 3B6AA 3R2CJ 2MHNA 1M1EB 1WFXA 1JLBB 5IYDJ 1OSCA 2WAEA 1ON1A 2R7ZJ 1W2IA 1WPKA 4B3OA 1B9MA 3BGFA 2MSTA 4KR0B 3DLBA 3DBRB 2PA3A 1T95A 5IT0A 2HW3A 1L5UA 2LQBA 1U1MA 4ZDLA 2DW4A 5HS7A 3QAHA 1KQKA 1CQTA 2ADBA 1WJCA 2FJBB 1S9FA 2I2YA 4JI3F 1RA7A 1Y39A 1F2HA 1Z4UA 3KYLA 1MDMB 1T3NA 2HFVA 3DWLE 3DKXA 2C42A 2M2EA 1F5TA 1G2EA 1WKLA 4YB5A 5LJ5Y 3RG6A 4XLNF 3OFEA 1N5SA 3S15J 5KFYA 3PW5A 3ZOBA 2RQCA 1A0OB 1STZA 3GYGA 1RTJB 4I1TA 1S0OA 2DEJA 2CA9A 1KQGB 3MMBA 3AD8C 1G6NA 3SQNA 2DNGA 1XTAA 4YS2A 2ZNZA 3E6MA 1DHMA 1X9MA 5HQ8A 3K2AA 3GZ6A 5D0RA 2MSYA 2RRBA 4XLAA 2JA7J 3N4MA 1ZKGA 3HT3A 1ZGJA 2XMVA 4QBUA 1T9WA 2EBEA 3B8HA 4G1IA 1WC0A 1R0AA 2CPXA 4JI5J 2XSDC 5L3BA 3LALA 4KKOB 2NNYA 2BANB 2HAIA 2VQLA 3KYDB 3BR6A 4HHUA 1USSA 2XLJA 3FMQA 1G3YA 4WIIA 3ZFVA 2M8EA 3HGGA 5ETQA 3HOXJ 2K9LA 1J7KA 1IKYA 4DZ6A 5HQMA 1KZHA 3D68A 4HV6A 2HEOA 4R5PB 4A6EA 1GDTA 3ZQFA 2XAGA 4EGZA 4M5GA 2QYGA 2OU2A 3SQGA 5L3GA 3AFGA 2DT7B 2C6YA 1WELA 2M30A 1XC5A 3OXGA 1BBYA 4WK8F 4RBVA 3JYTB 4AXJA 2QE5A 1Z67A 2W1BA 4RDUA 1ZZFA 3TJAA 5HJYA 4KQZA 1S7HA 3KLFA 1VQ9I 2BOPA 1WKKA 3FEYB 3FBNB 4KHMA 2DKOB 3MZ8A 5ETLA 2K27A 4QU6A 4BS2A 1Q81T 3KHHA 4LF7F 5JVTA 4ECZA 4FP9A 1XNRJ 4TQSA 3NGTA 1WG4A 1M5VC 5I3PA 5HDNA 5EDNA 1VQ4I 1E2XA 2PJRA 1HNIB 3OYAA 5IC4B 1SJQA 1N6QB 1IF1A 1R1UA 5CJ9A 2C2MB 4HX7A 1MU2A 2ELHA 4HEA2 4EJWA 3TW6A 4RBOA 3B4MA 4NLUA 2L9DA 3PW4A 3LOUA 4DV3J 1VLOA 2DOFA 2XGCA 2AV5A 5CYQB 4M94A 2F4VF 4E7KA 1UETA 1RDRA 2BQRA 1H8AC 3OW2R 1FJGJ 4ENOA 1PGZA 5B0AA 4RA2A 2X6XA 5HS9A 3MAJA 2V8PA 5F8HA 3ZTOA 4JI6J 2O01C 4OZ3A 1X4CA 2XG8A 3EE3A 2A5YB 1VS3A 3DYAB 1PYSB 2B6AB 2RAQA 4URSA 3SCKE 2WVFA 3UE2A 2IA6A 3EXYA 2HBZB 2LY2A 4CH7A 2M70A 1VQKS 3UQSA 3QPSA 2M0CA 5IPAA 2IJFA 3VGUA 4PFOA 2Q1LA 4CYUA 4QIEA 4R8UB 2ZBCA 3K4CA 1IJEB 3UN5A 3UFCX 2B43A 3BDEA 4AWXB 5JR3A 1ZA1B 2W7OA 4QR1A 4BS9A 5SZTA 4DPWA 4G6VB 5FLXU 3B54A 3GZ7A 1S0MA 3HOZJ 2L54A 4TU8A 3PJ9A 2UZAA 1D1CA 4YFKF 4KN7X 5F9LA 2P81A 3QPTA 4IEJA 1DURA 2L2OA 1D09B 5F8JA 1GXLA 1EP4A 5U47A 3I4PA 1I6XA 2DGTA 2IPOB 3JXOA 3PG9A 4TYBA 4IHWA 2ZJ2A 5ETOA 1D1BA 1SANA 5KFNA 3TJ9A 1VC6A 4HSRA 1B7FA 1DGWY 4CTAB 2J5AA 4I2QA 4S05A 4YRVA 4ENMA 2HBRB 2C2EA 3ZN1A 2XSFA 1FJEB 3MCNA 2PSZA 1CC7A 2UUWA 3KWMA 4G1QA 2E35A 3RKYA 1RLCL 1ZAOA 3DQVC 3NMRA 5BQTA 1AUDA 2FYXA 4LSZB 4IDKB 4P2MA 3I0TA 3HMJG 1XMQJ 3EVMA 3HZJA 4DV6F 3OL7A 4OI4A 2IJLA 3OY9A 1HOMA 3MWBA 2WC2A 3WGIA 2HNDB 2KPMA 2DTJA 3H2LA 2XM3A 4CLPA 4YR2A 2V79A 4ZVEA 2DCLA 3HD1A 4M5JA 1MBFA 4FZVA 1WCMJ 3Q86A 3BGRB 4QPQA 2PDAA 4NL5A 1BIAA 1J5OA 4M95A 1XX5A 2GQ2A 1MBGA 2VFTA 4WKRA 2V8HA 1BR2A 1ZLKA 2GA1A 2DI3A 1NK2P 4UB6C 4ZK7M 1ON2A 1IKVB 4QPXA 1HIYA 5D77A 4ZDNA 1S1UB 2HFSA 3CZ6A 4P7TA 2GHPA 3KKFA 3TAQA 1VGYA 3ZMDA 5D6GA 2RDDA 3GFHA 4M6XA 4NA1A 2CQQA 5J1EA 1FNMA 3MZIA 1UEVA 2BOLA 2KKOA 1S5LC 3J81Z 1OCZH 2AEMA 2QQ9A 3D6HB 2ZVSA 3ENWA 4KICA 5F9NA 4PEOA 3K7AJ 3RW7A 1DFDA 2HZCA 3EDQB 4MTDA 2IIHA 3ILOA 1D0EA 4XORA 5IV3A 1VQOS 4HNTA 3TANA 1H88C 2E60A 1FWZA 1UCRA 2GJFA 2QL5B 3DXBA 3GZ5A 4H4KC 5E3QA 3D1QA 2YXLA 2L7ZA 1UW4A 2YPYA 1SD7A 3BH7B 3P49B 3A4TA 4F7VA 1IN5A 3GBGA 4BQQA 4CCOA 2O3DA 2WA0A 4QYRA 5HP1B 4ZTFA 3QT8A 2FJEB 1V5FA 4DLGA 1X19A 3PNVA 2WB4A 4J9MA 2WVDA 2G0EA 2X1AA 3PM9A 3GLLA 1NB2A 2E7WA 3OLBA 5LMNJ 3C6UA 4OJHA 1E3HA 3L9FA 4ANDA 3V4GA 2UXCF 3CDWA 2FQQB 1GXPA 4X4QA 2C1EB 2XAUA 2NR0A 3QJLA 3MM5B 2M7BA 4OZ2A 2OI2A 1FIAA 3KZIC 1IBMF 4FYXB 3W2AA 3T19A 1MMSA 2VQFJ 1U8WA 3SSQA 1RABB 2XV4S 2GO9A 5B09A 2LA4A 2Y3YA 1SB6A 2MBFA 4DL4A 3LP0A 1OQ3A 2V8DA 3QWUA 3TA0A 2XY5A 1FYKA 2P8TA 2BVMA 4K2JA 2NXNA 4OI6A 1F9FA 2WTFA 3MCOA 3VQSA 3CCYA 2R7VA 1F43A 4KIFA 5KVRA 1GT8A 4CM0A 1D0XA 2V6EA 5BOXA 1HNVB 2JRTA 3I5CA 4C8NA 3EWGA 3ILLA 1ZELA 5A8KB 3CESA 2QBYA 4XPEA 2JEGA 1SKSA 2D2WA 3HDDA 5J6XA 2VHGA 3VWBA 1AW0A 3HUGA 3OTBA 3RRKA 2LLKA 3DEEA 1DY3A 5H6RA 1IBLF 2ZXJA 5DV5A 1G8XA 4FE7A 2XAFA 2D7SA 2DO4A 1PYVA 1P9QC 2XKPA 4USIA 2HQNA 4G9YA 4BJ6C 3TEDA 2QFIA 3HSRA 3B6BA 2QV6A 2IBKA 2A6MA 4ZTJA 4A3GJ 2AYBA 5FIIA 5KG6A 4ECVA 2MC4A 1B9NA 4X4SA 4LFBF 1WEXA 4DG1B 4U88A 2DPIA 1NK6A 1HW9A 2XMJA 4M3EA 1VLYA 2WAQD 3MR7A 1LPQA 3RKWA 1NHAA 1X4HA 2B9XA 2GIQA 1B8IB 1WTFA 5IP9J 4XKVA 4BE0A 1IR1A 4Q8FA 2D69A 3JQMA 4TVAB 1IQZA 5BMZA 3IH3A 1Q5VA 3M2RA 5J8CA 4ILMA 2R7DA 3K4MA 2DODA 5THWA 3ZXWA 4JI0J 3NNAA 1V5VA 2P9GA 3CLOA 4DL0C 5J4VA 5K14A 1TUGB 1RC9A 1HKTA 1HWJA 3PW0A 5KT4A 2FZGB 3HVTB 4FYWB 1RT4A 2R4GA 3CMEI 3KE2A 3BB5A 2VKEA 1UA1A 1CJVA 4FF3A 2DR6A 1FVQA 2HOEA 4FYDA 1IUYA 4I6WA 3TVZA 4F02A 1DTTA 2IM1A 3VOEA 1WJBA 1UZHA 1WEYA 1TNSA 5DUIA 1LW0B 4A5MA 2YNIA 1DTQB 3K5OA 2CPDA 1HQ2A 5IOYA 1PAUB 2EFQA 4JV2A 3NAHA 2MLGA 2OA4A 5LSRA 2HGLA 2PMZN 3KHLA 1JJ2R 3BPXA 3HVRA 2Y9YA 2CQPA 1YJNS 4JV5F 3GTJJ 4CO5A 5M5YJ 2TRTA 2QMUB 4CDGA 2FUG9 4DMZA 1UHMA 3ABKH 4QPOA 4G3IA 2P7VB 3W2VA 5HS8A