2IA0A

Transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
156
Chain Sequence
HLDDLDRNILRLLKKDARLTISELSEQLKKPESTIHFRIKKLQERGVIERYTIILGEQLKPKHLALIVLEVGKPEDFLERYISYISSTLSALPGVLFVAKSGEDKIIALVGKNNKDELVKFIEENITSIPNLKHIQIFPITEIKKGEDLTGFLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HTH-type transcriptional regulator PF0864
publication title Crystal Structure of the Transcriptional Regulatory Protein PF0864: an Asnc Family member from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 34
structure length 156
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia0A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ia0A02
1LNWA 5JVTA 4I0BA 2JPBA 5ED4A 3QRFF 4AD9A 4GXOA 1Z91A 2YX7A 3MQ0A 2A5YB 3RPQA 2XAFA 2DU9A 4K2EA 1KQ9A 4A0YA 2ZBKA 2BGCA 4RB3C 1GHCA 1YIOA 1WKMA 3JSOA 5ICFA 3GW2A 1IN5A 3EYIA 2XIGA 4L9NA 4I7HA 3ZMZA 3J80Z 1FY7A 1BC7C 5BMZA 3IRRA 4HV6A 3HRTA 3WTWC 2HOEA 5DYMA 1FOKA 4YIIA 1YYVA 1O7LA 3LAPA 1ZH5A 2MLKA 5F1RA 2LNBA 2EA4A 1LEBA 2F2EA 2FF4A 1P4WA 4BH9A 4A2UA 3L00A 4EVIA 2O3FA 1U8RA 2EFWA 1B6AA 2IW5A 3KETA 1BI2A 2FMYA 5FGMA 1R5GA 2RC4A 4RGSA 1XD7A 5K5QA 1W5SA 2VBZA 2ADUA 2YU3A 3J81K 4P55A 2V1XA 2CW0F 4HDVA 2A61A 1SFXA 2NNNA 5DDGA 4P9UA 4ESBA 4ZZLA 1WQ2A 2COMA 1IRGA 4L5JA 4PGHA 1MKMA 1XCBA 3ZQ7A 1YO5C 4HF2A 3R0JA 2OA4A 3HSFA 3KZYA 4Q4ZF 1MJ9A 5ILSA 1U2WA 2P7VB 2PJPA 2BE5F 3DEUA 2HQRA 3I54A 3LAJA 4EJTA 1I1SA 1HKSA 5HOOA 3S2WA 1ZARA 4IXAA 2IJLA 3WTZA 4WX9A 1TNSA 1P4AA 3L7WA 2IA0A 5CJ9A 4WK8F 1IXSB 3H3ZA 2ZMEA 1OPCA 5K5OA 4O3MA 3HRUA 4HQEA 1DUXC 3GLXA 1XGSA 3LA2A 4EV0A 1YS7A 5F6FA 3WTUC 2QBYB 2PEXA 2L4AA 3NRVA 1ZYRF 5LRRA 4OIQF 2XUBA 3E6BA 2HDCA 5J8CA 4CXFA 1HXDA 1XN7A 4MQVA 1KYZA 4HW0A 4OINF 3FX3A 4YIFA 3DP7A 2MH9A 2RGVA 1SMYF 2VE8A 1G4DA 4MQ9F 3IC7A 2VODA 1W5TA 4MNUA 4XLNF 3I4PA 4HZFA 4U0YA 2MLGA 2ZMEB 2VT3A 1QNTA 2JTVA 5D5UB 3RJPA 5LHIA 5HDNA 2IP2A 3WODF 4CO8A 2P4WA 3ABUA 2HEOA 2VBYA 2XAJA 3EQLF 5ERIA 4R79A 2HFHA 2DPUA 1FT9A 3HIFA 1TTYA 3FHZA 2GA1A 2FU4A 1ZRCA 1R00A 5IT3A 4G7ZF 1FWZA 1G3WA 2D1HA 1BI0A 1R7JA 2EFQA 1KQ0A 1D8KA 4HF1A 4CGZA 1SFEA 4KDPA 3KEQA 4NQWA 4MEYF 4LG0A 1BI1A 3LSTA 3WGIA 2FXAA 5DUKA 3WTXC 2GAUA 1ONVA 4CYDA 1I5ZA 4ZZDA 1LDDA 2XVCA 3ULQB 1GXQA 4RS8A 1BC8C 3CJNA 1RUOA 3N4MA 3GX4X 5L3DA 4HBLA 5D6EA 3CTAA 3V7CA 5LEKA 3B02A 2RVCA 4EGZA 1OYIA 2O8XA 1QQIA 2STTA 4GGGA 3HUGA 3K2ZA 4M72A 3QOPA 2CWEA 1TW2A 4AIHA 4A5MA 1UHWA 4RGUA 3FMSA 4HOBA 4LG0B 1XMKA 2NYXA 3PQJA 5LRSA 3SQNA 3F6VA 3MFKA 2OBPA 2OD5A 3DV8A 4YFNF 3IKVA 3WGHA 3JTGA 1MDMB 1KU2A 5DCFA 3MWMA 5LBQA 2DI3A 2DAOA 2VBXA 2DJWA 1YW7A 4IJAA 2STWA 3WTSC 4HQMA 3N97A 1HKQA 3GFJA 3J81Z 1RZ4A 3FZVA 4N9IA 5EEHA 3G73A 5CVUA 2IRFG 1TBXA 1R36A 3RKYA 1WWXA 1IXRC 4E70A 2EJRA 2GIVA 2EFOA 2V1DA 3GF2A 3HOSA 1FC3A 1RNLA 3TO6A 3TGNA 4WXDA 3G3ZA 1J2XA 3L09A 3KFWX 4KN7X 4S05A 4U7DA 2XKPA 4XBFA 5DCMA 3V7SA 4YG2F 4G94A 1UCRA 1PUEE 2QUFA 3FM3A 3GYHX 1QBJA 2WV0A 4HYEA 2ESHA 3CUQA 4GO1A 4YFXF 5FB2A 1BBYA 3EYYA 2M5WA 4FT8A 3LQQA 4M74A 5TJJA 1YFHA 1Z9CA 5JR3A 3BJAA 1FPQA 4G6QA 3DF8A 1O3TA 2F5FA 3H3UA 1HBXG 4KUMA 4BNCA 4UUVA 1LVAA 5L3GA 2P6SA 3CO7C 1OMIA 2OAZA 4L0YB 5A2QZ 2GXGA 5ILUA 2FSWA 2QENA 1F9NA 1FSHA 2WC2A 1R1UA 5HDGA 1KYWA 5E1WA 5DCMB 2Q8KA 1I6XA 2LKPA 1BJAA 4WXHA 1S8NA 4AIJA 2JSCA 1BIAA 1HW1A 1JXSA 2KJCA 3O2PE 3CUQB 1S7OA 4PZJA 4BHBA 4XSZF 3T8RA 1TW3A 4LGWA 3REOA 4MTDA 3VODA 4L18B 3E6CC 1ON1A 3GFMA 2BYVE 4M9XA 1BOAA 4CICA 2M45A 2MA3A 3BPXA 1USTA 2ISYA 5D6FA 2AS5F 1BI3A 2HKOA 2GXBA 4NHJA 2Z33A 4PDKA 2PG4A 3KLOA 2ZNZA 3KP2A 2H94A 1MJBA 2L54A 1Y0UA 2Z99A 2VN2A 3M8EA 1JE8A 3IL2A 1CF7B 3E3VA 1IN6A 4OMYA 2FEZA 1J9IA 2HZTA 1B1BA 3DQVC 3K1NA 4WXCA 3TO7A 1ODDA 1X3UA 3CLOA 5L3CA 1QO0D 1Z6TA 1ZLJA 3E5QA 4Q47A 4B09A 3BPVA 2WWYA 2K4JA 1XDSA 4LB5A 3LA3A 1USSA 2JZYA 5AIQA 5HDKA 5LHHA 2FRHA 4Y13A 3TO9A 2ACJA 3WE2A 2DLLA 5EEGA 3H92A 3JTHA 1MZBA 2PBIA 3FMRA 1ZAOA 4QLCU 1ZG1A 1V4RA 3TDZC 2LSOA 3R0AA 2KJBA 2VONA 4KICA 3V4GA 2TDXA 1D8JA 1R5HA 1A04A 3P9CA 2OQGA 3TQNA 2O0YA 3I64A 4L0ZB 4G7OF 2QQAA 2O61A 1SD4A 4MEXF 1H0MA 1D5VA 4UNOA 1YG2A 3VEPA 1Z05A 4KN4X 2NAZA 1K79A 1HQCA 3MAJA 5L3EA 3VB2A 3M9AA 4RB2C 4HX4A 2RQPA 2HGCA 4A6DA 2X0LA 4S04A 2EV6A 1XSXA 1LQ1A 1TLHB 3ZN1A 1O57A 2ZKZA 3BOQA 1SAXA 2O6GE 2UXXA 2Q2EA 3GFLA 5HLGA 4IPAA 1IAWA 2CG4A 4UVBA 2FNAA 4I01A 4I2OA 2DW4A 2HTSA 2FMLA 2F5EA 5J8FA 5IT9Z 2OU2A 3MEXA 1J59A 4WCGA 2A3SA 3RKXA 1W4MA 5D5XB 2CGPA 3KCCA 3ZMDA 2NNYA 2L02A 2H27A 1O3SA 1NHAA 2DT5A 2NS0A 1AWCA 3COAC 3F8CA 1YW9A 1K7AA 4IRHA 3JSPA 3HTSB 5HVQC 2HWVA 3TDUC 4BHPA 1UFMA 1QPMA 2DTRA 2E1AA 1J5YA 4R8HA 3SHFA 2YPRA 5E8IA 4N0BA 4Z2YA 4Y15A 2UWMA 1IN7A 4WF2A 3JAMZ 5E20A 2R7FA 5D8KB 1ZREA 3VOEA 3HRSA 5JHUA 1G3SA 5A2QK 1E2XA 1DDNA 2M87A 3CUOA 2HR3A 1Z1DA 4U7BA 4RAZA 1QZZA 2FE3A 4LFUA 4HX7A 1XCVA 3ECOA 1FBSA 2VBWA 4ENJA 3F23A 4ESJA 3KZZA 4M9ZA 5L3FA 2D1VA 1ZN2A 4HV5A 2ZCWA 3QPTA 5KVRA 3W6JB 5FLXZ 4M6XA 1FLIA 2XAHA 3D0SA 1HKTA 4HX8A 3SZPA 4ZYEA 2P5LC 4N9HA 1I27A 1UHMA 4GYIA 3Q5FA 2QQBA 2CFXA 3KEOA 1XGMA 3I0TA 3BJOA 5ICCA 1EH8A 1XSDA 5D4SA 1AOYA 3QP5A 1ZG3A 1BN5A 2FNPA 2RN7A 5AONA 5DV5A 3R6SA 1DP7P 1KU3A 5BPDA 1O7FA 3IRQA 3I59A 3CO6C 4IVNA 2R3SA 4PGGA 4O5VA 1BM9A 1P2FA 2GQQA 5DD8A 1G3TA 2QZ8A 1IXCA 4QWQA 4EJOA 3RPUA 3BP8A 4XLPF 3ECHA 1GVJA 1XDUA 3P9IA 3LWFA 4I09A 1SD5A 2M30A 1XGNA 5TRDA 2VT2A 2G9WA 4P96A 2E7XA 4A6EA 2HYGD 2UXNA 1V3FA 2OZ6A 1EV7A 4ZYGA 1TQIA 1CGPA 4AVPA 2P7CB 1R58A 2K02A 1IN4A 1PP7U 1FSEA 3I59B 4I02A 3KP7A 1KU9A 4CZZA 2DPDA 4FX0A 1U6GA 4KIGA 2W85A 1U5TA 5AIPA 1FX7A 1WRJA 3NQOA 2K7LA 4KMUX 1IUYA 1W7PA 5DUIA 3O6BB 1HW2A 1D3YA 3GXOA 2XASA 4L5IA 1K78A 4IHSA 2V1UA 3KP6A 4KA4A 3T0YA 2FBHA 1WI9A 3DXJF 2L3DA 2YX4A 3BY6A 3B73A 4R1HA 4HF0A 2DQRA 5HLIA 2EK5A 2PLYA 3KE2A 5IT9K 1OYWA 2LDUA 3WG9A 4U0VA 4DQ2A 3T8TA 3F22A 3ML6A 4KYWA 4KNYA 2H09A 1JHHA 5E8GA 2J5PA 4OU0A 1XGOA 3I71A 4O6JA 1LEAA 1S3JA 3GEZA 4ON0A 4L9VA 5DEQA 1U5TB 2QVOA 2EV5A 1OR7A 1HSJA 5KK1A 5LGTA 3C18A 4P9FA 1W7PB 2XV4S 4WWCA 4L9TA 4XRFA 3ZP5A 2VOOA 5H6RA 4I0AA 3TOBA 3QU6A 1K78B 2PMUA 3CUQC 3E6DA 4OOIA 2PFBA 3HSRA 2FBKA 2CVIA 3JAMK 1P6RA 3QPHA 2IVMA 4UV8A 2P5VA 2ISZA 1Q1HA 2RDPA 4LLNA 3I53A 2IPQX 5CVIA 3LQRA 3RIRA 2YSRA 4NB5A 1LB2A 2X4HA 2GZWA 3ERED 3MZHA 2QYOA 3GUDA 4I98B 4UVCA 3K69A 3SZTA 3BDDA 4UHTA 3W6KB 2FOKA 1RI7A 1R1VA 3C7JA 1ZRDA 2D2WA 3ISPA 1YTYA 2H6CA 4LJZF 3IKTA 1B9NA 2ZFWA 3KP5A 1TQPA 5FLXK 5FFXA 4BHCA 2M1BA 1Z6RA 3L9FA 3GZ6A 5L3BA 1VTNC 3HOTA 3ZMSA 2V6CA 1ZRFA 1UB9A 1ON2A 2BBYA 1YQAA 5LHGA 2A6EF 2XAGA 1XSVA 4FX4A 3HTUA 1G6NA 4H0EA 4G9YA 5DD4A 3R61A 3K9TA 4ENKA 1R23A 3ABTA 2PI0A 2ZJ2A 1BIBA 2A6HF 5HLHA 3T5XA 5ICEA 2D45A 3D5LA 3Q9VA 4ZH4F 1O3QA 2XAQA 1FZPB 2GWRA 4M9SA 4M6YA 3U2RA 4PCQA 1REPC 3KLNA 1FBUA 2G7HA 1SMTA 1HSTA 1YS6A 3FM5A 2MD5A 1ULYA 2HS5A 1F5TA 3F8MA 2CQKA 1F1ZA 4ASNA 3MZYA 4RB0A 2JT1A 4B8XA 3V8JA 4KIFA 4DNCA 5K5RA 5E1ZB 2K4BA 3PQKA 4IF4A 3F6OA 4UVAA 2A07F 1H9GA 3F8FA 3E5UA 4EGYA 2MC3A 2FA5A 1XB4A 4RGRA 3IWFA 3WU1B 1QGPA 4A0ZA 3FMQA 4LMYA 1MGTA 1OKRA 1Z7UA 3I5UA 2G7UA 5FFZA 4KMFA 1DPRA 3IHUA 2QQ9A 3C3WA 2F5DA 4CHUA 1XMAA 5CLSA 1MD0A 5FD5A 2Z4PA 3SFZA 3QAHA 4AIKA 1WSUA 1I1GA 5BOXA 3P7NA 5BPIA 1IW7F 1SD7A 2M8EA 2QLZA 4D0PA 3HYIA 1S29A 1S7AA 3BJ6A 3GVAA 3LFKA 1SFUA 2Y48A 2Q0OA 3F8BA 3E97A 4HLXA 2W57A 2RNJA 4HA8A 1J0RA 1RIOH 2DK8A 1R1TA 4BQAA 4ENMA 2QBYA 4A5NA 1TNTA 2E1CA 1P92A 2H6BA 4MTEA 2E7WA 4U0WA 1EH6A 3HHHA 4EQQA 3WTTC 3F8NA 2DFIA 3EUHA 2HYFA 2OZUA 4LD5A 3P9KA 5D4RA 4G8XA 3LA7A 2L01A 2PN6A 3WU0A 4LK1F 2XRNA 3HRMA 1ZHFA 1KU7A 4KT5C 1ZG5A 4BYYA 3RYPA 2F5CA 2UZKA 4JK1X 3IWZA 4M71A 4Y17A 1U3EM 2OQRA 2JRTA 4KFCA 2CYYA 3BWGA 5J6XA 4LB6B 2XHKA 1ZLKA 5D5VB 2IA2A 3SXYA 4EJVA 2Y0MA 4IRGA 3RI4A 1SD6A 3V7RA 4MGRA 1JHFA 4TV7A 4ESFA 2ETHA 2L4MA 4EM0B 1STZA 3QP6A 5CYVA 5HS7A 1J7KA 2W24A 1IZ1A 1LDJA 1T39A 5ILVA 3M8FA 3GZ5A 2P5KA 2DK5A 3FXUA 4AWXB 2AXLA 2IT0A 3R60A 1T0FA 3WTYC 3RYRA 4LLLA 1W7PD 3PFIA 3DPTA 1KGSA 2EFPA 2HKXA 1FYMA 1U78A 2B0LA 1PDNC 3EDPA 4RB1A 5ICGA 1FNNA 1GXPA 3NEUA 3BZ6A 3O3KA 3F21A 1ZGAA 2R7DA 1L3LA 4KIBA 5K1YA 3J7AO 3EETA 1F4KA 1ZGJA 1FBQA 2Y75A 1FP2A 2FBIA 3V8KA 4CDGA 2V79A 3VFZA 2J5OA 5H6QA 2XGXA 2VE9A 3RDIA 6PAXA 2KIFA 4Q5SF 4JBAA 1MDMA 1FYLA 3DKWA 5BQTA 1HW5A 5BS6A 4L9JA 2MBFA 2MH2A 2W25A 4Q48A 2Z9OA 4HAMA 1B59A 3K1PA 3ZMVA 3GWZA 2FQ3A 2RV8A 1FP1D 3FXQA 1P4XA 1RUNA 2NRAC 4GCVA 4YFKF 1E17A 2EB7A 2P8TA 2VC1A 2LF7A 3J80K 3I58A 3ROUA 3Q9SA 5LEJA 1IN8A 3TOAA 5HS8A 4F7ZA 5FO5A 1KA8A 4IRIA 2ZBCA 1U5TC 5E1XA 5LGNA 4ENNA 4M73A 2DQLA 1S6LA 2E1NA 3E5XA 5JFRA 1IF1A 2LF8A 1KQ8A 2Z3YA 2XKOA 2O03A 2EWNA 1QZYA 2KIUA 2QM3A 1O3RA 5F64A 2CO5A 2BEOA 3F72A 3OV8A 4G7HF 2QWWA 2HQNA 2ZNYA 3AAFA 3L2CA 5H20A 3JW4A 2HTJA 3U9GA 2VC0A 3WE3A 4BAYA 1PP8F 4MHGA 3K0LA 2C6YA 2ZXJA 2V9VA 2WTEA 2JSXA 3MCZA 3HSEA 5D8LB 1DPUA 5CVJA 3DFGA 1IRFA 1MJAA 2W84A 5D5WB 3DPLC 5E17F 3U1DA 4A0XA 2JPCA 3ELKA 4HLYA 4OIPF 5CVVA 1EH7A 1B4AA 3FXRA 3OOPA 4EM1A 2DBBA 3ZMTA 3K1MA 2PMHA 2K86A 1B9MA 2DO7A 4JQFA 3FF5A 2K27A 4G6DA 1R22A 4EM2A 4EJUA 5E18F 3ZMUA 5FD6A 1OYYA 2EV0A 3QU3A 3CDHA 1YLFA 5HS9A 4OMZA 2VXZA 3M1EA 4UV9A 4LK0F 3RTRA 4HDUA 5JI6A 2ELHA 4RAYA 3KP3A 4RGXA 4EMSA 1T38A 1JGSA 2YR2A 2CSOA 2IA1A 3F3XA 4OIRF 4GYGA 1T98A 3WGGA 3T1BA 1L0OC 3V8LA 4ETSA 3C1DA 1K6OA 4A12A 2EA2A 4BXUA 2A69F 2ESNA 2PQ8A 2A68F 3R4KA 4ZYHA 1CF7A 3WTVC 1H9TA 1LDKB 3ZN0A 4FHTA 3RKWA 5LGUA 5LLQA 2XROA 3HHGA 2BV6A 3FWEA 3GO5A 2ZO4A 4U88A 4P5OA 3BROA 2KIMA 3ZPLA 1C0WA 4ZYDA 4IHTA 2P6TA 3M7GA 2Z5UA 1LJ9A 3TKYA 3E6MA 4OIOF 1G3YA 4UXNA 1T2KA 2GA2A 1TQMA 4EJWA 1J75A 4XSXF 2RKHA 2KRFA 3KP4A 1FYKA 3GFIA 2KKOA 2EFNA 1T6SA 1YW8A 5CVRA 2VOPA 4LLGF
chains in the Genus database with same CATH superfamily
5ETVA 4FS2A 2DNQA 1S5LC 2DGSA 1N34F 5JVTA 1I5OB 4ER8A 2CV2A 4O3RA 2IM2A 5ED4A 2H1YA 2WZ1A 3QRFF 2V2KA 3W8PA 2YPZA 2Z2YB 1WOOA 3LO3A 2E1OA 3MQ0A 3RPQA 4IKAA 5EG0A 3H3VK 3HD1A 5FIIA 3L4BC 1QVTA 4NLTA 3W1YC 1L3VA 3EYZA 1RT7B 1N78A 1WKMA 5ICFA 2VJVA 3BPDA 1IDZA 2KL4A 7FDRA 1IN5A 3CF2A 2QL9B 2AXTC 4HT7A 4N8OA 4KGXB 4WTOB 3NAUA 2AZ3A 2OTLI 2WAFA 1M5SA 3H4DA 2DIUA 4HV6A 2FVCA 5A2QY 1ZETA 2LY9A 1DJ0A 5DYMA 5HVGA 1BW5A 1NK2P 1O7LA 1POGA 5KFRA 2EFVA 5J4VA 1NDKA 2HG4A 3ENWA 5JHFA 1FVQA 2FF4A 1TL3B 3GR1A 4BH9A 3SQGA 4A2UA 5FDLB 4MIAA 4BY7J 4EVIA 2HHQA 2O3FA 1E6VB 2ZJRF 2HFUA 4UUTA 4YEAA 1B72B 5FGMA 4TXSA 4F3OA 1XD7A 1YRUA 1W5SA 2F48A 2BMBA 2E7VA 3NL0A 3RB3A 5AE1A 2A3JA 4P55A 1IBLF 3W3SA 1SFXA 3DBHB 1AUSL 1FX4A 2NLWA 1RWXB 2LQ9A 1Q7YT 4IUFA 2NNNA 2ALZA 2QFIA 4YR0A 1PYSB 3FBBA 3PFYA 2EFGA 4IRCA 4L5JA 2H8RA 2IAJA 1XCBA 2YNGA 4ECVA 2XLKA 3TQEA 3TI0A 1RKWA 2IMWP 3R0JA 2KPMA 4Q4ZF 3MR2A 2P7VB 4J9PA 4AYBA 3LAJA 3FCHA 1SJ3P 2XPVA 1YJNS 2UUWA 4UY8T 4LSLA 3NGKA 3WC2A 1OCOH 1N25A 2IJLA 1NRKA 3WTZA 4WX9A 1KD1T 2CQQA 3CO9A 3PR5B 5CYQB 2IA0A 4BS9A 4C3IJ 4X64J 1FNXH 3C6TB 3W3CA 3QGIA 1SQFA 3RPUD 2ZKTA 1X1BA 4X84A 1T9TA 4LITA 5A8KB 2FYXA 2FJVA 1MNMC 2R9LA 1D1AA 2DNPA 2LFVA 4PQUB 1TR0A 4PPDA 3GLXA 4P6QA 3LA2A 3PSFA 4CCKA 4QU6A 4EV0A 2QSFA 1DQ8A 2CJAA 2YQ0A 3E01B 2QBYB 5B0BA 2PEXA 1UKUA 1ZYRF 5LRRA 4Y6IA 3UN3A 3E6BA 2KYZA 2HDCA 5J8CA 2B5JB 2F7VA 3ZZ0A 4KBIA 2Q66A 3R5GA 1S76D 2CQPA 2BXYA 1KYZA 3CCRS 3CJ4A 2DFFA 1A36A 4PABA 4HW0A 2QF7A 1U6BA 4OINF 4UZCA 3PIPQ 1YHQI 1SMYF 3C14A 2VE8A 2CPDA 1G4DA 3OFGA 4ZC3A 2XF5A 2GAHC 2KVIA 3M8ZA 4AQYJ 1T3NA 3R8YA 1GV5A 1W5TA 1S6QA 4MNUA 4QWDA 2R7WA 1N32F 1QE1B 2C3UA 3HJFA 2MLGA 2HEKA 1RA6A 2Y0SD 4O4RA 2JTVA 3HHDA 4TYAA 5BYSA 2ECBA 1RT6B 4DF4A 4CO8A 2W4CA 2P4WA 3C66A 4HTIA 3ABUA 4I6YA 3W60A 2FC8A 3DDKA 2XAJA 5AXMA 3OW2R 2G2OA 1QAIA 3EQLF 4R79A 1C1BB 3SEOA 1SJFA 1FT9A 2ZZMA 2HNZA 1TTYA 1IRZA 2LBFA 2GA1A 3Q89A 1CJKA 5IT3A 2KLOA 2D1HA 3N0VA 3LOUA 1Z2LA 4NYZA 1D8KA 4H4MB 4V19J 4HF1A 1SFEA 4KDPA 1GH8A 3CD0A 4DXLA 4NEZA 4B43A 3QWLA 3EM1A 1VYAA 3FMWA 3I82A 3GTOJ 5D4NA 5E33A 1Z2ZA 4IDKB 1PYTA 3CCVI 2GAUA 4PG7A 1ONVA 4NLXA 1I5ZA 2A05A 5LMNF 2YS9A 3B4DA 1TWFJ 1TKZB 2XGQA 2BY0A 1EAYC 1HF0A 3KUGA 1R0AA 4HG2A 4MIBA 1Q79A 5L3DA 1X0PA 3K6GA 5J47A 5D6EA 1TVRB 3V7CA 4DZDA 2OPPA 5LEKA 4PWUA 3B02A 2VLAA 2L3MA 4B4CA 2GVDA 3UCGA 1F5BA 5KG6A 4EGZA 3DGPB 3IWNC 2BY2A 1QVGR 2Z56B 2STTA 1VQ6S 1FRKA 3KJVA 2XEXA 1WEZA 4M72A 5L1JA 3OYDA 4AIHA 3IWXA 1GMUA 4A5MA 1UHWA 1Z0XA 1QSLA 1CQTA 4XORA 3M1CA 4HOBA 2DTJA 4Q43A 4C0HA 1XMKA 3F6VA 2MSTA 1WORA 2LEAA 5EDWA 3IKVA 5D77A 3THPA 3JREA 2VB6A 1I3QJ 1IV6A 3BM7A 1ZAWA 2DI3A 3NNAA 3MECA 2ZJQF 5D0RA 2VD3A 3AD8C 4LF2A 1CULA 4ZJQA 3V4IB 3VV2B 4TKTA 4HQMA 1M1EB 2O8KA 1FT8A 4ZTJA 2R7ZJ 3GFJA 3S3NA 1K0TA 2MABA 3HFZB 1VJQA 5D0HA 4KJIA 5DJBA 3DM2B 4I0WA 3LNQA 3UVJB 1PUFB 3UDCA 3CJRB 3TZWA 2KN4A 1R8PA 4E70A 4OHVA 2EJRA 4IOCF 2EXUA 4B48A 1QJHA 3M30A 1FC3A 3OVAA 1SL2A 3AOCA 1FJCA 2IGMA 1F1BB 2MLZA 5KFIA 1Q8KA 2HHVA 4I99C 3TGNA 1FWPA 3KYLA 4UOFA 1WDTA 2ZC4A 2V26A 3QNWB 3D5MA 4S05A 4U7DA 1TQLA 3V7SA 2JZ5A 4LF4J 2OCEA 5CD4A 2KFNA 2Y9ZA 5IOLA 4HVZA 4CO4A 3J7ZT 4DV5J 1MU2A 4I2QB 4YG2F 1CSJA 2AGOA 2R5YB 5LL6d 2CQ4A 2GVZB 4UOCA 3GYHX 1S48A 3BSAA 3M2UA 3GMEA 2L41A 4WP3A 2FJDB 2EBGA 1SL0A 4GO1A 1YSJA 2RUGA 1RSCA 5TJJA 4C3KA 2DGXA 3EVMA 4Q44A 5JR3A 1CJTB 3TVZA 3P49B 3VDXA 2BBEA 3ILIA 2VUGA 1U1OA 5ETLA 3LGMA 1ZQ3P 4ED8A 4KUMA 3JQMA 1RA7A 1Q5YA 4BNCA 5EWFA 4CCMA 5J1UA 1O0PA 3SCKE 3CO7C 4ZN3A 1OMIA 2OAZA 2GXGA 3UCZP 2EINH 1FSHA 3PFOA 3D6FB 3OYHA 2RJZA 2DNHA 1KYWA 5E1WA 2M8HA 2F4MB 2ZOFA 2Q8KA 1Y7PA 4J91A 4DPOA 2QCOA 2DJIA 2DA1A 2M88A 2O01C 3QT6A 1G8XA 3KDNA 2V7FA 3WHCA 2EBIA 4UW2A 3V4MA 4RKUC 4ZMMA 5DG8A 5M2UA 4MYTA 2BEFA 3ZTRA 5KG7A 1N6QA 3T8RA 5CHCB 2ZUAA 3FCVA 5A8RA 2ZBIA 1YDLA 3C19A 3GFMA 2BYVE 4M9XA 1B7YB 3QIPA 4YP3A 2DRDA 4OYAA 1GMWA 2M45A 4S0HB 1S9EA 2XSJA 3ZRGA 1NG6A 1XQIA 2V94A 3MUMP 2BX6A 2MKKA 5D6FA 2AS5F 4P7TA 4USHA 2DK2A 1RBOB 3BG5A 4R5PA 1K44A 3ZQIA 4ZCIA 1H7WA 3SDBA 5M3FJ 1LW0B 3PHEA 4ANEA 2PG4A 1HFEL 4QPTA 3D3CJ 4A3EJ 1Y0UA 4DR4F 4IR1A 5EGOA 3R7NB 2Z99A 1JE8A 3IL2A 1RZMA 3E3VA 3JRAA 2JC1A 3K5LA 1IN6A 2CWXA 2WY7Q 1J9IA 5A0YA 1PC4A 4K5SA 2A6MA 2H8WA 3CLOA 3CCLI 3K0JA 3HPGA 1ZLJA 3E5QA 3BPVA 2WWYA 4F0HA 2YKNA 1T9VA 4OYIA 4FBUA 1SAUA 4MTPA 4FKXA 2UUCF 2ACJA 4LVOP 2OJ3A 3QJJA 5EEGA 4JP0A 4BBSJ 4CI0B 1ZG1A 3E0JB 1V4RA 2Y0SN 2AEFA 2H9ZA 3BB5A 4IH7A 2QQ8A 2VQEJ 3DRYA 4BEHA 2DA6A 3SJMA 4KICA 3NOGA 1MMAA 3PJ9A 4W4MA 4I69A 3P9CA 1MN9A 4AL5A 3MVPA 4A69C 3EZ5A 3RBDA 4CNZA 1MMNA 2QQAA 2V5HG 2IYIA 5FRMA 1KONA 2HGLA 1YZ6A 3GYXB 1YG2A 1M90T 4KITB 3MMJA 2FZGB 4KN4X 3IAM9 2NAZA 1K79A 3CC4S 4NPOA 1QAXA 4DBRA 2LQBA 1VQ9I 2RT3A 5IZHA 2LXFA 4HX4A 5EG0B 4A6DA 2DDBA 2E5HA 2HVZA 4S04A 2HQ3A 2U2FA 1SCJB 4RW6B 1TLHB 3ZN1A 3OHBA 1O57A 2X9DA 3BOQA 2YU9J 1BHNA 2RRNA 1SAXA 2VICA 3V6HA 4LBIA 2O6GE 4RJVA 4Y3OA 1S4EA 3TEGA 2DYAA 1P7IA 5B0EA 1IAWA 4ANCA 4UVBA 4I01A 2BR0A 2KM8B 2HTSA 2FMLA 3OLAA 2KP6A 5GAGJ 2M8DB 1T05A 3PSIA 5IT9Z 2K9LA 2LOOA 2XCAA 1A31A 4WCGA 2A3SA 2HVHA 1W4MA 4WFBQ 4TY9A 3ZMDA 2AW0A 3K17A 1IKXB 2HPUA 4WP9A 2B56A 2QA4S 1LPQA 1S4FA 2VKZG 3H7HB 4UUWA 3G1OA 2ZJPQ 3CCJI 4KFBB 2W4SA 2FGOA 2KVQE 1B3TA 4DS5A 2NS0A 2FZKB 3SQGB 2L9SA 5CCMA 3COAC 2UXBF 2JVGA 3F8CA 3J7YJ 3JRIA 3R5DA 1K7AA 3EPIA 4EZ6A 2DDAA 3JSPA 3KYDB 1LWFA 1JLFB 5GADJ 2W00A 2BVLA 3VYTB 5KFYA 5EYRA 2KRHA 2WVBA 3TDUC 4E7HA 2BM0A 3T41A 1ZPVA 2N82B 1UFMA 3E8OA 2DTRA 3S93A 2NUHA 1S6PA 2V68A 2YPYA 4WE1A 2NQPA 3SHFA 4B3OB 2AHOB 4Z2YA 2V50A 1F2HA 3EPZA 1HPZB 2MKCA 4NXMF 4Y15A 2UWMA 4J90A 3ENVA 3MCOA 5M3MJ 2L48A 2HVSA 1GLNA 2X3GA 1HNZF 5JHUA 2VFVA 3MKWB 3J80Y 5D6GA 3PYFA 1G3SA 1E2XA 4X62J 3CUOA 4XAKA 4F4WA 2BJDA 3DGVA 4U7BA 1VISA 2Q1LA 2X3DA 3VHQA 1NK0A 1PYVA 3MM7A 4HNVA 2PD1A 1HDDC 3ECOA 4LSLB 4ENJA 1M1GA 4CM0A 4MKAA 3K70D 3BH7B 5L3FA 4OJ3A 1FK9A 3KK2A 5K7HA 1RACB 3QPTA 4CYUA 2FJWA 3KLIA 2NZCA 2UUAF 2BJ9A 4M6XA 1RT2A 3D0SA 2BJ3A 2KFDA 3L7OA 4HX8A 3QOEA 3SZPA 4ZYEA 4BE2A 1UETA 1I27A 5E3LA 1MG7A 3O8GA 2PDAA 3PO5A 1XGMA 3BJOA 1MBKA 3DLEA 3C15B 4KH0B 5ICCA 2KRRA 4B9VA 2QT7A 4PG6A 2VQFF 1MSWD 1OMSA 2YKPA 3OS0A 1QRYA 1BN5A 2FNPA 1UWBA 4ZP9A 5DV5A 1PKUA 1RWWB 3ENQA 3HOZJ 3CMAS 1XNQF 3TL4X 3HSGA 3LAKA 1X58A 4A47A 2M7BA 1OYEA 1S0OA 3CO6C 2VI6A 2M3DA 4DL7A 2ZHOA 4O5VA 3EUNA 1UA1A 3H9QA 4X65F 2GQQA 2PX9A 1HQEA 2JEIA 4LFCJ 3C14B 2DA5A 2NCKL 2FPHX 5DD8A 1TL8A 2X6XA 2QO3A 1G3TA 5A6PA 2F8EX 4U7UK 2QZ8A 5D0EA 1EKSA 4RW7B 4EJOA 4OX9J 4M5HA 2GJIA 1SVDA 1K4TA 3WC0A 4C8ZA 2IM1A 2AEJA 3P9IA 3LWFA 5GVQA 3HVAA 4PRFA 3CD6I 2IY5B 4JI5J 4U87A 2ZH7A 2BA9A 1F5CA 1GV2A 2VT2A 1QTNB 1VJWA 4P96A 1T33A 2ROEA 4DHVA 3GWCA 4ED3A 4NNJA 1V3FA 3ZQLA 4C6AA 3VAFA 3O6QA 3JRCA 4ZPBA 2MQPA 2AQEA 4L74A 4YB1P 2P7CB 1R58A 2K02A 1PP7U 2V2QA 3Q8UA 2VV5A 2VL1A 3CJSA 1WHYA 4RZRA 1EB0A 3PYDA 4NA1A 3DRPA 2KI2A 1KVIA 2DA3A 4IX7A 2NXCA 1X4EA 1VQNI 2FHJD 4FX0A 3S2DJ 2CQ7A 4MKVA 2W2OP 3RZDJ 2LCWA 2R7QA 2K7LA 4LMZA 2H1LA 4MKBA 4CTAA 5DUIA 3LL7A 3LSJA 3K5MA 2K40A 1HW2A 2V2ZA 2YWFA 2RF2A 2R8GA 2ZSIB 2E9RX 4R8UB 1R0AB 2HDDA 5IT0A 3OR2C 3HM9A 3PCOB 3RGIA 2O9LA 3OS1A 2XASA 1AYEA 2V67A 5HP1A 4AL7A 1OQYA 4IHSA 2PI5A 5JJBA 4U7CA 3I3LA 3I56I 1T9WA 2HRUA 3NMAA 1RAOA 2NS8A 2QIFA 4FQGA 4B02A 2EK5A 3LH2S 2MLXA 4ERDA 3PX0A 2LDUA 3QO9B 1FEHA 1S0NA 4DR2F 4M3GA 4NCBA 1GQEA 4U0VA 1Z4UA 6AT1B 2H09A 2AJ4A 4TVAB 4GKKF 3DDIA 2MZ1A 4OU0A 1D0YA 1ULRA 3I71A 1RCXB 3QZ7A 3QWUA 4WJBA 4XK4A 3JRGA 4BJTA 4II2A 4D3HA 4F4XA 1S3JA 1T03B 4DQRA 1L3KA 1FTRA 1S59A 3GJQB 1W5CC 1NH7A 2ASYA 4ED1A 1GTHA 2GO9A 2E35A 4NLRA 1UP1A 3ERMA 5LGTA 5KCMA 4L6V3 2XV4S 2BOLA 3OXLA 3HC7A 2CQGA 2QGFB 1CULB 1RB0A 4ID5A 1VQYA 4I0AA 4B3MF 3TEHB 3MR5A 1K78B 4DFMA 1NJWA 4QW8A 1G2EA 3CUQC 3MFIA 2QLBB 3HLUA 1S99A 4KKOA 1SFKA 3KNAA 1T7PA 2X7IA 2DPIA 4AVZA 4H4KA 3RG6A 2ADBA 2J0SD 1LB2A 1NO8A 2XS7A 4PWDA 2GZWA 4IQJA 2OF7A 4F52A 4WKRA 2WTFA 4I6AA 3K69A 5A76A 3P6YC 4AIDA 3BDDA 5U47A 2C3MA 1U8WA 4UHTA 4IH5A 2YH0A 3K89A 3MM5A 4IG0B 4AUKA 2KDOA 2NOJB 4DR3J 1ZRDA 4ZPCA 1FKPA 3ISPA 3WU2C 1NLKL 2GV1A 2VFSA 4EBDA 1D3WA 3MEGA 5J1EA 2P9CA 1C1CB 3HEFA 2LEBA 3KP5A 1R8BA 3OYEA 3QRRA 4ZVGA 4BU2A 3BR6A 4XKCA 1ON2A 1WUUA 1ZBTA 4DIQA 3CMEI 2XY5A 1SIZA 1JLBB 5IWAF 1XSVA 4FX4A 5KFJA 4A4JA 2R2RA 2RS2A 1G6NA 1WJEA 3IGNA 2F4VF 3K9TA 1WSRA 2W2MP 3ABTA 2ZJ2A 2QYCA 3PUBA 3SDEB 3T5XA 5ICEA 3MD1A 3N4WA 3ESWB 5C42A 1YIJS 1RR7A 5B7WA 2ASJA 2J9DE 2JK3A 2GWRA 4J9UE 4KAIA 2ZH9A 1M5VC 3ABKH 1HI8A 1RUSA 4II3A 3JR9A 3C16B 1OFCX 3CJ2A 2L7ZA 3SFUA 5GTHC 1TKDA 4U95A 1HSTA 1HR0J 2MD5A 4DV0J 1ULYA 1TL1B 2A0FB 4I64A 2AV5A 2FQQB 3W9IA 1F1ZA 2VPZB 5HN0A 4C30A 2JFDA 4X4TA 4B8XA 1Y5NB 2Z0GA 5J4YA 3BG6A 3FXLA 1VK3A 3M8YA 2MQOA 1TK8A 2HXOA 4DNCA 4LF7F 1Y0NA 3J7A1 1OJLA 3F6OA 1SEUA 1A5JA 2A07F 4EGYA 3UN2A 1JKPC 3DLAA 1T9XA 2DMUA 4LQ3A 1N6QB 1I6JA 1HYSA 2K9QA 1S0MA 3VWBA 2CQXA 1PYOB 5KFGA 2WB1N 4K2XA 3MZIA 2HVRA 4CLYA 2QLFB 4LFAJ 1S9EB 2XSJB 2GMLA 3FMQA 4LMYA 3VCDA 3S8PA 4P2FA 1AA7A 1OKRA 5FLVA 2XGPA 1Z7UA 2AWZA 2VDHA 4OHYA 4BS2A 2XGCA 2KHCA 1FIAA 1W36D 5KG2A 3US5A 4W1UA 5EGOB 5CLSA 1SJ1A 4Q45A 2Z4PA 1SIWB 2Z2SB 3SCJE 3ZZOA 1I1GA 4I56A 4ZCMA 3DOMA 1QUVA 1RRJA 2M8EA 3M8WA 3LGNA 4RU2A 3EXYA 4LRBA 4BQQA 4BBYA 2CJQA 2K5CA 2YNHA 3GVAA 2WW4A 4X4SA 1SFUA 2YKNB 2X1DA 4HDGA 1DY3A 3TVYA 3G6VA 4K59A 2OUGA 4WU3A 2O66A 3BR0A 4OV1A 3T1HF 1H88C 1ZA1B 2JFKA 4DV1F 3M6WA 1ETXA 3GJTB 1RIOH 1FEXA 2C22A 3FSXA 1LFPA 3PW0A 1XS9A 1P92A 3L2UA 4MTEA 2LVSA 4U0WA 2P9EA 3QWPA 4UOGA 3CJ3A 3D66A 1Q4RA 4JI8J 1EIYB 1I6HJ 2SXLA 4E7IA 4H4OA 5HVHA 5C4XJ 3EUHA 2P8IA 1S7IA 2E5LJ 2L01A 3LA7A 2PN6A 5E0OA 1UAWA 1Q0NA 2AMCB 2K9SA 3V81A 1S79A 3HRMA 3MOZA 5H9FK 2R2TA 1Z77A 2JUGA 5BNGA 4P2MA 3IAM2 4OZLA 2HK3A 4JK1X 3IWZA 4Y17A 3S1NJ 1JJCB 3SV4A 3IFEA 4QIWD 1KFSA 2ZBRA 1MWYA 2OPTA 2W7NA 2M70A 4KFCA 4YDDB 5EHHA 4Y3CA 5C24A 2H3EB 2B4UA 5JXSA 1SQGA 3L2QA 1FTTA 1FFSB 3FBIB 1FRLA 2XHKA 1T05B 4EJVA 1Y56A 2KHDA 2KG0A 2BRKA 1SD6A 4B9NA 1JHFA 3CCZA 1V3SA 4RMNA 3L95X 3LWMA 4BJ5C 2L4MA 5GPAA 1STZA 5AT1B 5FKMA 3BGLA 2DEJA 2RRAA 1YJWS 1KQKA 4JUZA 1K1SA 2LA4A 2C2ZB 3MAHA 4NLUA 4OZ5A 3V6DA 3NWRA 3NS7B 3J81j 4CCJA 4LJMA 3DKXA 1KVJA 3HHLB 2AZ1A 4B47A 4AWXB 2JX2A 3ZNJ1 1M5HA 4DL5A 3OTCA 3H5NA 3RYRA 3CE8A 1JKRC 2VJ5A 5DDRC 2DODA 2HKXA 4RM2A 1U78A 2B0LA 2VL8A 4DG1A 1PDNC 5ICGA 1GXPA 5B5EC 3DI6A 1TP4A 3VVTA 4M5KA 1T11A 1L3LA 2V9WA 3LSGA 1X5TA 4A93J 1FNMA 3EETA 4W97A 1HNWF 1G7CB 5KFKA 1ZGJA 5ETMA 1FBQA 4CDGA 3V8KA 2AHQA 5BYQA 1V5GA 1EJ9A 2V79A 3MEDA 2J5OA 3TARA 5H6QA 5KFLA 3SYTA 4BC7A 2XGXA 3KUEA 3I9V9 3RDIA 2R4FA 1T9YA 6PAXA 3KK2B 3HSDA 1EKRA 4K2JA 3LP1A 4UQGA 1M0SA 3KLIB 3BR8A 1FYLA 4OZ1A 1VGYA 5BQTA 3ZCOA 5BS6A 3AJDA 1G3OA 3BO4A 2DGWA 2MBFA 2R92J 4JI6J 1ZM4A 1R8AA 4Q48A 3WHIA 4HAMA 4KH1B 2DH7A 1CJVB 1LVKA 3K2AA 2EW9A 2XNQA 3ZMVA 2HFSA 4KHRA 3PNYA 1R27B 3ILOA 1J5EF 3A4CA 4ITSA 2OEJA 1FP1D 3FXQA 3K7RA 2W9AA 1RUNA 2ZE2A 4YFKF 2DH8A 2GQCA 4P74A 2P8TA 2VC1A 1X4PA 2KFZA 2LF7A 4KSEB 3OL8A 3ETOA 3VWSA 3ROUA 2Y30A 3BGRA 3AG4H 2QLWA 2EH3A 5CCLA 3IWLA 2K06A 3DPUA 4DR7J 2I38A 1KVKA 3QGGA 1LK7A 5LEJA 1ZS6A 3MOJB 9ANTA 1IN8A 1HQEB 2QSFX 1KA8A 2DCUB 2CADA 2FUG9 4C2MA 5J1NA 2ZM6F 2M7AA 1X5OA 3G2BA 2G1HA 2APOA 2M52A 4DBQA 4ENNA 3H5RA 2DQLA 2CVEA 3EX7B 3AAWB 3W2VA 4DR1F 1I50J 3MMBA 1TV6A 3HCXA 2XKOA 8RUCA 3TP2A 1QZYA 3J7YI 3H9JA 4MK8A 3I6PA 4J9KA 4QPOA 3F72A 1FOXA 2BV3A 2QWWA 1LV5A 3IBWA 3TUPA 5DS7A 3WQPA 4URGA 4YIRX 4USIA 2NVTJ 3U9GA 2CG8A 4AYBN 1BE4A 5D4LA 5FLXU 2ILYA 2OTJS 2VC0A 3IGVA 4C8NA 1W7WA 4XKBA 4MHGA 1VF9A 2P81A 2NPFA 2ZXJA 4CUGA 4F25A 3JTNA 3TMOA 2WTEA 2JSXA 5C25B 1E0EA 1KZHA 4OYMA 3LTOA 1EQ0A 2VG7B 5CVJA 3DFGA 1IRFA 1DTTB 3S7RA 4LIWA 3THTA 5D5WB 3DPLC 5E17F 3B78A 5D15A 2XHWA 1N54B 2JPCA 3ELKA 1EH7A 1B4AA 2CU7A 4EM1A 3S1RJ 3RZOJ 1YJTA 4OQJA 4RNMA 1ZELA 2FGCA 2NVXJ 4JI2F 2ZEJA 3MMCB 1P1TA 2K86A 4CLTA 1B9MA 1PILA 1O5JA 4Q0BB 5IT4A 2X6OA 3H4BA 1DQ9A 2A5WA 3NWSA 4RNHA 1WHUA 3IR5B 4EJUA 2EV0A 1LFWA 5H9FJ 3GP9A 3CDHA 5HS9A 1WG5A 3M7VA 4XDDA 4C8OA 2VXZA 3D68A 2XPUA 2DFHA 1XC9A 2XCPA 1RTZA 5E41A 4JV1A 2XMVA 2VF3A 1GX5A 2ME6A 2ELHA 4RAYA 3KP3A 2BJEA 4RGXA 4EMSA 3CJKA 1RWUA 2HWHA 5E5NA 2M2BA 3F3XA 4P71A 1DARA 1VRTB 1FIPA 3P5JA 4GYGA 4FTHA 1T98A 3T1BA 5KFVA 5KFWA 1Z67A 1VLOA 3HDDA 1K47A 2EA2A 2ESNA 1WFXA 2A68F 1LKZA 4E7ZA 2YXLA 3DLLQ 1TL7A 1TK5A 2UUBF 3SSSA 3KNGA 3PY8A 3R5JB 4RBVA 1E3PA 5IYBJ 4FHTA 4F4YA 4AC0A 5LLQA 4FP9A 1BD6A 2XF6A 3GO5A 4ED6A 4A3IJ 4HI1A 2ZO4A 3T9NA 4QWCA 3ZPLA 4RWWA 2ZWOA 2Y1LB 1IDYA 2L0KA 1FXLA 3M1VA 4OJHA 4OYXA 3EDRB 3OYBA 5IYDJ 4UXNA 4RUCA 4Y4RA 5KAKA 3DOKB 4EJWA 1ZZFA 4XR6A 2ZWPA 4BLGA 2H65B 2RKHA 3KP4A 4OIXA 3OJUA 2Y8YA 5J1EB 5KNLA 2EFNA 1KEKA 4DCJB 1YW8A 2CPJA 1JMTA 5CVRA 3BTCA 2VOPA 4LLGF 4WFNQ 2WOMA 5MLCV 2FD2A 4I0BA 3CF5Q 2JPBA 1GFWB 4R0EA 1R4MB 3BDEA 3CCRI 1E3HA 3PIPF 3D7SB 4JI7J 2XB5A 1G1XA 2VA2A 2YX7A 1D9AA 3BT9A 2G2ZA 2X6YA 2DNKA 3HHLD 3IS9B 2XAFA 1MBHA 3K4CA 3LPEA 3FXJA 4NLVA 5C42B 1F36A 3HT3A 1U2CA 2E44A 4EI2A 3HOVJ 4RB3C 2H54B 2QSWA 1S1WA 3MD2A 4DU8A 2LU1A 4J9MA 2Y69H 2VQCA 3GW2A 1IQTA 2MKSA 3HBLA 2XIGA 2C2RA 1GAOA 3D6TB 3D6HB 3VZIA 3IBFB 1BC7C 4F4KA 1U9OA 2B9EA 3GJRB 4B3TF 1G4CA 4FF4A 1QM9A 1MMSA 1FOKA 1P27B 4P72A 3SSQA 2HQFA 4YIIA 4Y65A 1HBMA 1BMQB 4DX8H 1ZH5A 2MLKA 1C4AA 2BKOA 3RR8A 5KT2A 2DR6A 1SKWA 2F2EA 1RAHB 4DV7J 1P4WA 3KLVA 3ZQCA 2N8GA 2AU0A 4BUPA 2IMOA 1W2IA 1U8RA 2EFWA 1XMBA 4YY3F 2KB2A 3KETA 2OEKA 1RWKB 4OYPA 4KTQA 1BI2A 3SIPB 2KT5A 2FMYA 4CLLA 1JJ6C 2KZGA 3DHWC 3OSFA 1S1VA 2R8KA 1Z1ZA 2VBZA 2VJ4A 2V1XA 2CW0F 4HDVA 1YITI 1H98A 4XN3A 1MNEA 4DWIA 4QWEA 2WSEC 2BXZA 5CQGA 1RTIA 2QFJA 3VAKA 4ZZLA 2B9SA 4NCGA 1N34J 4YHHJ 2COMA 2LDIA 4PGHA 4LSNA 2C3YA 2E29A 2XSFA 1YO5C 4C2UA 4FYXB 3Q8VA 1MJ9A 2RD5C 5ILSA 1VQ6I 4NI2A 1IR2A 3M8SA 1RADB 2PJPA 3JRHA 3DEWA 3I54A 1I1SA 5HOOA 1ZM2A 2ROPA 3S2WA 3BG9A 4HHHA 4NL5A 4ELVA 1ZARA 4IXAA 2ZSHB 4RBTA 4A8OA 2DR7A 1MROA 3OL4A 1TNSA 2WVEA 1QHGA 4WK8F 3CW2C 1IXSB 3H3ZA 2YNHB 2ZMEA 2D41A 3R97A 2CPFA 4XOTA 4DX7A 3H5UA 4KPYA 4Q2MA 2CPZA 2JWTA 2DOAA 5K5OA 1UWAA 3NWTA 1FDAA 3HRUA 4USUA 3VR1A 2ZD1A 2R42A 5E3OA 4MMOA 5L38A 1YS7A 1RT1A 3MI7X 2XM3A 5F6FA 3WTUC 3MPUB 5AXNA 4URQU 2L4AA 3EGVA 1VQMS 3NRVA 2JH3A 1NK6A 4XIDA 4OIQF 4KV8A 8ATCB 4C7QA 3V6JA 1X4DA 1FMVA 1VS3A 2NXNB 4CXFA 1HXDA 3MHYA 5B66C 4J00A 1FDBA 5I3QA 4MQVA 2WK4A 2F4IA 4H4OB 3F0CA 4KISA 1WJDA 1UFWA 4DL4A 2AYGA 1RBAA 4KGKA 2XWYA 4DQIA 2RGVA 2MH9A 2ELJA 2X1GA 1WKLA 4J9QA 3BLYA 4AM3A 2L9RA 2Y9YA 4MQ9F 4FN5A 3IC7A 1APLC 4WZQA 3UFCX 2J6SA 4B3SJ 2KJWA 4HZFA 1X4CA 3OYJA 1KDNA 3ILLA 1Q53A 3DBRB 3RQIA 3EUAA 1QNTA 1QA6A 3OPKA 3QRQA 3RJPA 3Q0VA 2OD6A 1Q8LA 2G0JA 4P52A 2MQLA 4F92B 2Z30B 3NXZA 3QLHB 2TCTA 4U7UD 1SJQA 3OMYA 2W2PP 3HIFA 2W7OA 2CRLA 4LF1A 3FHZA 3QGPA 2FU4A 1ZRCA 1R00A 1LFUP 5KFNA 4RBOA 2IA6A 4IQXA 1G3WA 4ATNA 2QYGA 2HHPA 1UCNA 2R3VA 4EO8A 4NQWA 3C6UB 4N8NA 4LG0A 1BI1A 4DV3F 3WGIA 4DPTA 4PUOA 4FISA 2I0XA 2QMXA 1ETVA 4DYCA 5DUKA 3V6DB 1IG7A 5AXLA 4IFVA 3DLHA 5K9FA 3DYAA 2BHZA 3OQ2A 1VQPS 5HLTA 4RM3A 4I2PA 3ULQB 1GXQA 1RTJA 4PSWA 5M2PA 4RS8A 3CJNA 4WXWA 3N4MA 1PAEX 2XS5A 1VQ5S 3DXBA 2VG5A 2B8QA 3CTAA 4IHXA 2DMPA 3DI6B 2H5IB 3PW5A 2CW8A 4K5RA 2J8SA 2FLLA 1MMLA 3N01A 4HSRA 3W2AA 4U67Q 4K4SA 4O23A 4FKYA 2EIJH 2EK6A 4ZVOB 3QOPA 2CWEA 3HX9A 3M2RA 3MEDB 1N32J 2DITA 4RGUA 3FMSA 3MPWA 3OR1C 4DV4J 2ACYA 3H36A 2CQ0A 4QBUA 2OBPA 4FYWB 4YFNF 4F8RA 4UY85 1CC7A 3K4NA 4TQSA 2VUMJ 4OFZA 1KU2A 3I9V2 4E7JA 5T7LB 1S97A 3MWMA 3EE3A 4RW9A 1X0FA 3BBFA 1XK8A 2CQ1A 2STWA 4DL2A 1U1MA 3H90A 3HL2A 1K73T 5FKKA 2MJNA 4G1PA 2KU7A 3AA9A 3J81Z 3BSNA 1RZ4A 3M4XA 5EEHA 1EARA 1MMDA 1TBXA 3RKYA 3CIZA 4BWMA 3G2XA 1HHTP 1CS4B 1TUGB 1K0VA 1W2BR 4M6VA 3HOSA 4GO7X 1SANA 3P4UB 2DEIA 1RNLA 3TO6A 2ZFUA 3EMTA 4YOEA 3L09A 2BOAA 2VKEA 5EDNA 2K1RB 4DSEA 4RNNA 4KN7X 1IBKF 2FUG2 2HRYA 1TV6B 3LQVA 2XKPA 1UW4A 2V8DA 5KFMA 2NYIA 4AFFA 3LP0A 1QHHD 2QUFA 3FM3A 2Q6CA 3I0SB 3D6MB 1F2GA 3UNGC 2FVSA 3CUQA 4UY8I 2PE8A 4QR0A 4YEJA 1IKYB 3KLEA 3LQQA 3BGFA 4WYWA 3MKLA 4M74A 2EQRA 3GFHA 3QPLA 3W8GA 4YN3B 4G6VB 3BJAA 1FPQA 4OI1A 4XKVA 3D2WA 3MM8B 3KLGA 5GMEA 1HBXG 3EJMA 3BR2A 2RS8A 2VJUA 2MSYA 3U1LA 2E9ZA 1ERDA 3KHRA 1FMWA 4KHPJ 1FXRA 2HMIA 2R5ZA 1TFWA 2D3O1 3HT0A 2CZ9A 1D0EA 1RTDA 2FSWA 2QENA 2L9DA 2XAUA 4RUHA 4N41A 1D0XA 2PEBA 1NJZA 1H0HB 4LF9J 1R1UA 3GYGA 2W4PA 1WC0A 1LWEA 2YNIB 5DCMB 3AD7C 3DRRB 3KLFA 1IBMF 4WXHA 3NNCA 4Y7NJ 3BYRA 4G12A 5IOZA 2QA4I 3UW1A 2B6AA 1S57A 4NLDA 4HLBA 5K8PA 1U26A 2F5VA 3CDAA 1Y3JA 1S7OA 4NA2A 3MM6A 1YRNB 4PZJA 4BHBA 1QLNA 4MH8A 1D1CA 3M3YJ 1TW3A 3WG7H 2ZDPA 1B8IA 1NK9A 3REOA 4E4HA 2XMAA 1VBXA 3U02A 3QRPA 5EZGA 2OV7A 3VODA 2XWXA 1ON1A 2M34A 2OFGX 4ECRA 5T41A 3CJKB 4FS1A 1NPPA 4CICA 1AKHB 2XI2A 2MA3A 3BPXA 1USTA 3CQZJ 2FHOB 3BPSP 4M5IA 2ISYA 2FY8A 1BI3A 2RQQA 2HYIB 2GXBA 3J81U 3EGWB 2DFEA 5IS2A 5L46A 3RRHA 1UW9A 4NC6A 3KLOA 1VQLS 3KP2A 2E2IJ 2L54A 3IH3A 1D0ZA 2XMMA 3TAMA 3MZ8A 2FEZA 3DQVC 2PMZA 3K1NA 2OMLA 3OUYB 2AYBA 4ZVQB 5HANA 3PEHA 3G1LA 3FK4A 4WKYA 1ETQA 2VIXA 4B09A 3BZQA 5DM7Q 3H0DA 2HWIA 2K4JA 2XTJP 4LB5A 4DSJA 1WKJA 3LA3A 1USSA 4WYLA 3CJQA 2CAJA 3DHXA 1H72C 2FRHA 1S1UA 3WE2A 3L9ZA 2DLLA 2HHHJ 2E5NA 2QA1A 1RHRB 3PW4A 5H1SV 3AA8A 2KFYA 4B08A 3VAIA 2OELA 5HODA 2C3OA 3MAAA 5HK4A 2WSFC 2CUJA 2JC0A 3DTKA 1WTFA 2KJBA 4DR6F 4ZHRB 2IVFB 2E5JA 3V4GA 3FCWA 1WI8A 1IQZA 2M9KA 3TQNA 2O0YA 4L0ZB 3CMAI 1HI0P 2WOMB 2WVFA 1SD4A 1JJ4A 4XM3A 1Z05A 1NUEA 4YB5A 1HQCA 2JEFA 4G1QB 3WIUA 1KOOA 1YJ9S 3AG2H 3DLKA 2RQPA 4PUSA 2HLUA 2UP1A 3HKZA 2RAEA 2OCCH 3K4LA 1TT5B 4B3RJ 1JLQA 2ZKZA 1VIOA 4AQYF 4FZVA 3PX6A 1TELA 4USMA 4WIQA 3D28A 1IV8A 2Q3PA 5HL7Q 3QBCA 4BGDA 5HLGA 1WTBA 2CG4A 5EWEA 1Q1KA 5FD1A 1NTCA 2K9MA 1JTXA 1HA8A 1N8RT 2HFVA 2DNNA 4PXBA 1TKTA 2OU2A 4ZPDA 1ZGWA 3RKXA 4DL3A 1X1PA 2R7RA 1VCTA 2CGPA 2Y31A 1HBMB 2NNYA 4X4UA 2H27A 4N7TA 2B4VA 1JNRB 2QMWA 3DWLE 4DFKA 1AWCA 2XB0X 1C0TA 3ZZTA 1W0UA 3CMES 2K3FA 3IAS9 2HWVA 3QPSA 3S3MA 1W0TA 2A2DA 5ETSA 2IJRA 1NKEA 1S1VB 4QYZK 2NPIA 3GSDA 2M0MA 1ZA2B 3OYGA 1R9TJ 2XY6A 5CAAA 3LOCA 3NP5A 1HBNB 1FVSA 1PJRA 2B3TB 2G4BA 4N0BA 2QSHX 3G4SS 3ELHA 2BW3B 4XN0A 2R7XA 4DV2F 1HWKA 2Q2EB 3FVYA 1JJ8C 2LQJA 1XR6A 4NCGB 2R8HA 1IN7A 3MEEB 2NSBA 2PJRA 1IRXA 5E20A 4LSNB 2B4OA 2R7FA 5D8KB 3VOEA 2C2KB 4XO0A 2OGUA 1KRPA 5A8WB 2GM4A 3PX4A 4F93B 3BGOP 1DDNA 5D3GA 2Y1IA 3EWGA 1SKRA 2E9TA 3ZZZA 1N36J 2FE3A 1WEXA 3FKJA 3A0BC 1RYSA 1FKOA 4ESJA 1MROB 1JXLA 2ZXWH 4V19X 4JI4F 2BRLA 2JL9A 1ZN2A 1IWAA 2RHQB 4XPCA 3RW6A 4C9YA 2GFFA 2R7VA 1FLIA 4K4ZA 4ZVHA 4PFPA 5B0AA 1LE8A 3ZQHA 3FKIJ 3M8PA 3THVA 3VAGA 2ZD1B 4X4NA 2DIVA 1UHMA 4F91B 2QQBA 2CFXA 3I55S 3I0TA 2CNLB 3ET6B 4WWSA 4K4YA 2ZKUA 1XSDA 5D4SA 5F27A 2KT3A 3RQ4A 3C8YA 1U6ZA 1AOYA 1F43A 2IPOB 3QP5A 1ZG3A 5AONA 5HJXA 1N48A 3VYUB 1RP5A 4ICLA 4HNTA 5BPDA 3GZ7A 5J2MB 2ZH6A 2R3SA 4P10A 1DRZA 4PGGA 2F8MA 2RSQA 2B8PA 1SL1A 2RDDA 3TW7A 2UVUA 1G2HA 5LMUJ 3POTB 3M6VA 1S9HA 5C3EJ 4NEYA 1TMJA 4JV2A 1EHWA 1UFLA 2MC4A 1UJ6A 2HQDA 4A8MP 1IXCA 4QIGA 1JLCA 3VSKA 4DZ6A 1TWGJ 4XLPF 1XMOF 1HDPA 2RKIB 1NKBA 1JKHA 1SD5A 3FEYB 2M30A 2G0CA 2VPYB 5G4DA 3CUNA 4LF4F 4D5FA 2IC3B 3BQ2A 3BS9A 1U1QA 1ZPWX 2C2NA 4S0MA 4ZIWA 3Q0AA 1MSEC 1TQIA 2DYSH 5I42A 2HPMA 3QFHA 4U8VA 2MYSA 2P0WA 1V54H 2JQ7A 1IN4A 3UKGA 3A2KA 1U09A 3I59B 1YIJI 1BJZA 3KP7A 1KU9A 1REVB 1P8GA 1V55H 4KIGA 2W85A 2IDEA 1KKHA 4NA3A 2CUEA 1WRJA 3NQOA 1QSSA 4KMUX 1IUYA 3Q2SC 1W7PA 2QLXA 5IQQA 4M5LA 2RAQA 3MFHA 1RWNB 2VQFJ 4RW4B 2ZDOA 1SBRA 3QQCD 3DLJA 4NDLA 2MDAA 3PKMA 4DGWB 2X1CA 2LVWA 1XG1A 2NUUG 4AL6A 2V1UA 3NKYA 1WNEA 3KP6A 4KA4A 1HWJA 4IFYA 4XRSG 4CIOA 2CUZA 1WI9A 1CBKA 3V2UC 3GV8B 1RQ0A 4LG3A 2YX4A 1SKUB 3CJ8A 3DRXA 2PLYA 2W01A 2FQ4A 3TANA 1OYWA 4N56A 1RESA 3DRSB 4C2TA 3RBZA 1UVKA 1HMVB 3WG9A 3KKFA 3Q3SA 3ML6A 3KYCB 3VAMA 3OTDA 1XGOA 2D9OA 3TZZA 2HHUA 3NAHA 2CH0A 4IR9A 4KO0A 1LEAA 4PXEA 4L9VA 4CLFA 1U5TB 2QVOA 1IJEB 1QZEA 1P1LA 2EV5A 2CQDA 1HSJA 2QX0A 4OYWA 4RW9B 1CPZA 4P9FA 1RWVB 5BXIA 3OR2B 4WWCA 4XRFA 3ZP5A 1FA0A 2HBYB 3JTPA 3ZFVA 3IC1A 2VOOA 3KIOA 3QU6A 4BQOA 4A3GJ 1R3NA 4X4VA 2F9DA 3QYYA 3G6EI 3D0GE 2MGZA 3OFFA 1V5EA 4OOIA 3T6BA 2IRYA 2CVIA 3ILJA 4EFAC 5FROA 2MHNA 3I53A 4ZDPA 2IPQX 1G59A 5CVIA 1RGVA 3HD2A 3GTMJ 3M05A 5LXRA 3Q8RB 3LQRA 4QW9A 1L3UA 2MY7A 1X2NA 3GUDA 1VFCA 3UDEA 5E3RA 2H1KA 3AH6A 5BR8J 4OYBA 3SZTA 2VFRA 1RT3B 1YJVA 1R4NB 5J2PA 2W2QP 2AO9A 1WHVA 2C42A 2H6CA 1S9GA 1X5PA 1OISA 2BZ2A 3ZZYA 3IKTA 1B9NA 3EICA 2ZFWA 5FLXK 4KGVB 2JVOA 2VQEF 3UDVA 3L9FA 2LYVA 5KG1A 5L3BA 2VPLA 4DR2J 5KFTA 2V6CA 1UB9A 1RAFB 2OPRA 2BBYA 2IGOA 2G0EA 1R49A 2NVUB 3K4KA 2FVQA 4DZPA 2XNRA 3HTUA 2GMHA 4CCOA 3LSHA 2WONB 5DD4A 1JK9B 3K5OA 2EG2A 2F6CA 4CT9A 4DI6A 4M5GA 2P9GA 1FRIA 1IKWA 2L7MP 4LFBF 3I4HX 3LAMA 4L72B 1S77D 2XAQA 4Z7YA 4M9SA 5GAHJ 1BR1A 4B9MA 5KFXA 1UA0A 3U2RA 4ED5A 1HHSA 3CP2A 2R5ZB 1RU1A 4B3MJ 1FBUA 2HW3A 4NASA 5F0UA 3VZHA 1YS6A 2LH9A 2ZJQQ 1F5TA 5K14A 2VIHA 2CQKA 1D5YA 2D5VA 5IPAA 1WHWA 3V8JA 3L2RA 5K5RA 1A9NB 3G82A 2B6AB 4ENOA 1ICEB 1Z7LA 2L9VA 1YJWI 4IF4A 3B4MA 3JS9A 3N05A 2GBYA 1H9GA 1UL3A 3E5UA 3OYNA 4IO1A 3TX8A 2BOPA 2I5UA 2G0IA 2AJQA 3WHBA 1B8IB 4YR2A 4RGRA 2AX0A 3BKFA 3KHLA 4XRMA 4J9OA 1OJ4A 3W9HA 3M6XA 5G0RB 4A0ZA 1KTVA 2WVCA 1GK8A 3SSRA 1TMMA 1RAGB 5D4OA 1MGTA 2LQ8A 4Z7CA 1HCRA 4K4UA 4PK4A 4FXDA 2YH1A 1S1TA 4X66F 4E7KA 4MAKA 4EEYA 1DPRA 5JLWA 5IWAJ 1Q16B 2QL7B 2V6EA 1JUMA 2QQ9A 3OVBA 5GAEJ 2F4VJ 3TAMB 1AZSB 5FD5A 1WOSA 5DETA 1FCAA 3SFZA 1S49A 1WC6A 4AIKA 2OI2A 1WSUA 5KFUA 4LSZB 2FTRA 2AGPA 1HOMA 4UOHA 3MUVP 4FCYA 1SD7A 5A2QU 2JRSA 4IOAF 4KT0C 1RU2A 1OCTC 1EP4A 4USVA 3KLHA 4P73A 2ATCB 4FF3A 4BHQA 1DU0A 2F63A 3HZEA 4J9RA 3NCQA 2W57A 5D78A 2RNJA 1B70B 4D7MA 1J0RA 5HLFA 2DK8A 3IXQA 2DISA 1NDLA 2DNYA 4ENMA 2B4PA 1O6XA 1BR4A 2ZHAA 4LF7J 4WCEQ 1TNTA 1ZAXA 1ENHA 3I0RA 1RWMB 5D4PA 3TUJC 4BQNA 1RKJA 4USKA 1Z21A 1EH6A 1RJJA 1UEKA 5ADZA 3OIQA 3WTTC 3GZNB 4OLPA 4UZBA 2DFIA 5LSRA 4ZK7M 4IOBA 4MFEA 5AJ3F 2OZUA 1CEZA 4LD5A 3P9KA 4QZVB 3EUHC 5D0GA 4EUVA 5IFMA 2KDZA 3VGUA 3DLGA 3WU0A 1SXLA 6FDRA 4Y28C 1ZHFA 3IH4A 1BA5A 4KT5C 1HQUA 1Y00A 2WSCC 4HACA 1D1BA 3MPVA 2W1BA 3RRGA 4A3MJ 4LFCF 4A46A 4QJVA 3CJ0A 2R7UA 4ES1A 1DU6A 4EATA 3BWGA 2F1FA 1HNIA 2V2VA 5J6XA 3TVKA 4NCAA 2ZZTA 2XG8A 1JT6A 4LB6B 4OX9F 2D74B 2DNRA 1DQAA 3IRXA 1ZLKA 2HKEA 2IA2A 5FLMJ 2C1EB 2IBDA 5LM7E 1TKTB 3V7RA 4MGRA 1YJ7A 4JI5F 2JN6A 2PSZA 3HSZA 5J2QA 4PJJA 3FXMA 2UXDF 4RL1A 1J5OA 4EM0B 2OTJI 5HBMA 3HK2A 3QP6A 1UEVA 3LP2B 3OIPA 5KFEA 5HS7A 5EZHA 3N6MA 1SPBP 4WP8A 1U24A 1U8SA 3AB2B 2HNHA 1C0TB 3HG9A 1LDJA 3H20A 2GOXB 5ILVA 3M8FA 1F5AA 2P5KA 3FXUA 2V0NA 4CT8A 3W63A 4NLQA 2ADCA 2AXLA 2F4OB 2LXIA 3IAS2 5M2RA 2R2SA 2ZC2A 3PFIA 5HI7A 1HBUB 3ZGKA 3OYIA 3BQ1A 3PO2J 4CDIA 1ZTTA 1WCMJ 3ITHA 4RB1A 1FNNA 3DTIA 2D3UA 3O3KA 2YBVA 2BE2B 9RUBA 1T0TV 3SYZA 2PJRB 3BTIA 1NSPA 1ZGAA 1VI7A 1BR2A 4DCOB 1UG2A 1SV5A 1VQKS 4ANDA 3W66A 1FP2A 2FBIA 4KT6A 4Q5VA 4NZ7A 1FHTA 1TP7A 4DN0A 3I87A 3VFZA 2V9KA 3CJTB 5M5YJ 5GAGU 3FZ2A 2UU9F 1FRJA 1KLNA 3D0HE 3KG0A 4DYRA 2IFXA 2KHMA 4M3FA 1WWHA 4Q5SF 4ZLNA 1JLAB 4JBAA 3I4MJ 1YLXA 3GFZA 1MDMA 2XF7A 3HJVA 3L3CA 1F0XA 3J7YU 2CDRB 1PBAA 4I67A 2DY1A 4TLRA 2MQNA 4NMXA 3AL0C 1X4OA 1YITS 3DLLF 3ZZUA 1CLFA 1QSYA 2Z9OA 3D5RC 1B59A 4XLEA 3TW6A 1I51B 3QAEA 1QUPA 3QGHA 3MUTP 2VZ9A 2RV8A 1ETYA 1KHVA 4XNFA 2MKYA 1W25A 2D3ZA 3OY9A 1JLEA 3JAMY 2GHVC 2NRAC 2JNJA 1YBUA 3M8JA 1FE0A 1OY6A 2CQ3A 3Q9SA 4PYAA 1HBOA 3GTJJ 5DZ7A 3PNVA 3OR1A 3C46A 2POKA 5C2CA 4NC8A 3QPIA 1XIQA 1E6YB 3JAMU 1HLVA 2MEWA 5L39A 1Q1VA 2LTPA 3U7JA 1DQUA 2BY3A 5ETNA 3ICLA 4M73A 3M32B 2MXYA 2DN0A 4B44A 1R89A 1GT0C 3UD5A 4LBPA 3ZNUA 5HMWA 1KQ8A 5KFFA 2O03A 5DQGA 4N77A 5IP6A 2W9CA 4TNOA 2LKXA 2QM3A 5THWA 4M5MA 4F50A 4DR5J 1JKHB 5C4JJ 3MR7A 5F64A 3DOLB 1MBGA 4DR3F 1LKXA 3OV8A 1RT4A 2CQHA 2ZNYA 3CF5F 1U9NA 1WC5A 4X2BA 4IG3A 3ISNC 1JLGA 3HVTA 2CPHA 3A8JA 2KG1A 2AJ1A 2HTJA 2W9BB 1M5OC 3FK6A 1RR8C 2K7KA 3B6BA 4HYKA 3WE3A 1OYDA 1N33F 2M4MA 2V9VA 2XGDA 3CDIA 4ZP8A 2IM0A 1ZAVA 2LR8A 1WZ2A 2TRTA 4XL9A 2W84A 3S3OA 3G71S 4MK9A 2HLTA 2GOMA 2GJFA 4XLCA 2JA7J 4M5NA 2ZH8A 4A8SA 1XNRF 1FWKA 4LIVA 2LC2A 4ED4A 3K1MA 1M5PC 2MD0A 5F8LA 1NZAA 2DO7A 4Q7AA 1HR0F 3FF5A 4DV0F 1EETA 4FE7A 4Y34A 3OL9A 2K27A 4G6DA 4I76A 1R22A 3M4OJ 4EM2A 4G65A 5E18F 3ZMUA 4OYOA 1KQGB 4IQMA 2AT1B 1O8BA 2ZM6J 4UV9A 4Y2IA 3RTRA 2ZH2A 2FHMA 2GO8A 4JI1F 4ZP7A 2RVJA 1ZM9A 1S1XB 2OIHA 4A3LJ 1RE1B 3RAQA 5HMXA 1YX2A 3P8BB 4M3EA 2KXHA 2PA3A 2GC8A 2YR2A 2LMIA 2MKHA 1YI2S 3KK3A 4U8YA 4KO0B 2EZLA 3DMJB 3PDNA 1ORKA 3TAPA 2CQIA 4F26A 4P7VA 2M0CA 2KISA 1L0OC 4YUDA 2PA8D 2DB1A 4ILMA 3OLBA 1LW2A 2GCFA 1H2TZ 1IBCB 1AUDA 1CF7A 4NXNJ 2BANB 2FJ1A 3B6AA 5F0CA 5JVGF 1H9TA 3PVXA 1YX5A 4M1KA 3MF5A 4FYYB 2CPYA 3O1LA 3HHGA 3A8IA 3FWEA 2OPQA 1R6YA 3LALA 3AOAA 4U88A 1RT7A 1KLMA 2K3PA 3BROA 3M6UA 1X31C 2MMYA 1R31A 1Q78A 4CO5A 2WAQA 2RDIA 9ATCB 4JV0A 3VQSA 4JI2J 2PC6A 3T5KA 1IO2A 3TKYA 1QVUA 1TUWA 4CP5A 2QN6B 1T2KA 4HH0A 1TQMA 5J2PB 3GYNA 4JI0J 1J75A 3H1CA 1S9GB 1VQMI 2XSDC 4LR7A 4F02A 1TL3A 3EDQB 5FDLA 2HNDB 4FASD 3C2PA 4EBEA 1E6VA 3GG0A 4GVLA 4C8LA 3U1KA 1HNXJ 4XOPA 4TYBA 4JI8F 1B72A 4M3DA 4AD9A 4CM2A 4GXOA 3TRGA 3FBFA 4FPIA 3A01B 4CQ1A 2DHSA 3IG1B 2DU9A 4K2EA 2DPJA 1KQ9A 4A0YA 2ZBKA 1U48A 1VFJA 1TZLA 1Q82T 2MKJA 2CFOA 3TX0A 1YIOA 4GKJJ 1X60A 3JSOA 2L7KA 3MD3A 3T6JA 2OPSB 2XMUA 2PFDA 4L9NA 4I7HA 3ZMZA 1VQSA 2UUBJ 3J80Z 3CZ6A 3BZCA 1NPRA 2HFNA 3AB4B 4PFOA 5BMZA 4RBUA 1NG7A 3HRTA 1TWAJ 3F9KA 3MTKA 4DSIA 2NXJA 3AT1B 3G8QA 1RC9A 3LAPA 1H2VZ 1LEBA 2LNBA 2EA4A 1UAAA 1TKXB 3QSYB 3UCUP 4Y0FA 2K2PA 3U27A 1R0BG 1BQXA 4FVMA 1B6AA 4O3QA 2IW5A 3Q0WA 3S17J 3C6TA 5DDQC 2DMTA 4DPXA 1QVFR 1VQPI 3HZGA 1R5GA 4W90B 2RC4A 1FJEB 3OSPA 1PJ6A 4PQUA 3J81K 3DCAA 2VJIA 5FKNA 1FNOA 2R7OA 4FNHA 1X7VA 2ZOMA 3C2BA 1VQ5I 3E01A 5DDGA 2DNGA 4P9UA 4ESBA 1WQ2A 2EPIA 4FDFA 1MKMA 3R1HA 1URNA 2J0XA 2UXCJ 2B5JA 3CC7S 4FBTA 1X2MA 4OI4A 4FF2A 3HSFA 4TY8A 3TOQA 4DUTA 3WBZA 1U2WA 3NG8A 2BJ7A 2BE5F 3DEUA 2HQRA 4EJTA 1H6KX 3HPHA 3W6VA 4LF8F 3IP0A 4HTJA 3OFEA 5DZ6A 4DYQA 5F0HA 1P4AA 1EF4A 3L7WA 2JLEA 5CJ9A 4ID8A 3TYTA 1EP4B 1V3RA 3KLHB 4WU2A 4LR8A 2VJJA 2GW8A 1B0VA 2ZMEC 1OPCA 1MBJA 3HGYA 3OHAA 1ACMB 1R8CA 3IV5A 4WFXA 2M7SA 1DUXC 3CWJA 2AD9A 4DDFA 1JIHA 5E3NA 5HLFB 1K8AT 1HA1A 2Y1JA 4OI0A 1VQOS 1F6TA 1NK5A 1MN7A 3NGUA 4JI6F 3AXMA 4I68A 2R7SA 4YY3J 2IAJB 2X1AA 1XERA 4LF6J 2XUBA 1RISA 5GAHI 4M8LA 3O8HA 2YNGB 1HNVA 3AD9C 4USWA 1MBFA 2M4KA 2MPUA 4RWXA 4MIWA 2IYGA 3W65A 4WBFA 1YKWA 5KFZA 4IDKA 3TUIC 3TW0A 1Q8BA 2PEHA 4PQAA 3DLGB 1TKZA 2LLKA 2WB1D 4DR7F 2B51A 3J80U 4C3LA 1DURA 4NMLA 3I4PA 3MR6A 4KB7A 3L7PA 4HACB 2XZWA 2ACMA 4DUYF 2VT3A 1HIYA 4OYZA 1JWWA 5D5UB 4JX4A 2LREA 1W26A 5CD4H 5LHIA 1WACA 2HGMA 2D9PA 5HDNA 2IP2A 3IO1A 2HEOA 5BJRA 3DFEA 4DUZJ 3DGPA 3IRXB 5ERIA 1BWEA 2QV6A 2XYGB 3DNCA 2R4GA 3W2WA 2HFHA 5IQ6A 1VQ8S 4G7ZF 2XZTB 2JHEA 4QTRA 4LRCA 4QWBA 4RDUA 5J2QB 1IWGA 1R7JA 5KFSA 4HKQA 4DOZA 2RE1A 5HBMB 2B7EA 1J2VA 4CGZA 3KEQA 3Q8QB 1S6UA 5EX0A 3K8VA 3LSTA 1T8IA 2NXEA 3FSYA 3C2HA 2J7KA 3WTXC 2WB4A 2RU3A 1DFDA 3BCAA 1CQNA 4YELA 1UFKA 1RLCL 3P96A 3M2VA 5F8HA 2I8DA 1LDDA 2XVCA 1PC5A 4ZPVR 1S6QB 1Y1VJ 1RUOA 3H98A 2DT6A 3ZXSA 5CQEA 4AXIA 3GX4X 4E8UA 4Y00A 2XO6A 5CKTA 4HBLA 3GLJA 5JMNA 1NBEB 1ZK8A 2BJ8A 2JA2A 2GIRA 4DZJA 3ITHB 5CYJA 5KOXA 2V4JC 1AFJA 3NS6A 4CO3A 4K4TA 2C2DA 3FIWA 3KJQB 3DM2A 2B43A 2J5AA 5L9XA 2B63J 3L1PA 3UVJA 1PUFA 3CJRA 3K8WA 2HNZB 3EGZA 2X1FA 2LBFB 2G13A 3KOAA 2E60A 1CJKB 2RQ4A 1JXEA 3T5LA 2UV1A 1N52B 4JI3J 4F2RA 3BN7A 4XMYA 3MTJA 4M5DA 1VI0A 1OWXA 1RDRA 3NY0A 2XZDB 3HKZN 2NYXA 3PQJA 3SQNA 2EZHA 1H38A 3TWZA 2OD5A 4WXOA 4ZJLA 1NAQA 4CCHA 1MDMB 4AT1B 1B0PA 3X2QH 4OAYA 3QFWA 3FMBA 2DXEA 2GVZA 2F5GA 4HHJA 1SKSA 2VBXA 1YW7A 1VQLI 4IJAA 3H2UB 4YQWA 3UWTA 3BSOA 2MFZA 3H59A 4C8KA 2QGUA 1LOUA 4Z2XA 2OPPB 1ZKGA 1TAUA 3K2YA 1NB2A 5DG9A 2GVDB 3G73A 5CVUA 3QMQA 4WK1A 3HHNB 2CDQA 1R36A 4NZ6A 4V2FA 2LQ5A 5B09A 1WWXA 4OZ0A 4PXCA 2CPXA 4AE5A 4IZZA 4NRTA 3KJVB 2GZOA 1UVJA 4ZDOA 2V1DA 1LEOA 2K7JA 3OR1B 2BW7A 4QPQA 2GIZA 3GLLA 5LT5A 2WW8A 1X3ZB 1YX3A 3GTYX 4BCAA 3P5TL 2MW8A 2N3OA 4WXDA 3G3ZA 2R8JA 5IM0A 2YWKA 1FJGJ 4XBFA 3OYCA 3K4MA 5EF6A 2OP5A 2DOFA 2EWHA 4MFBA 4A3FJ 4CLZA 2FIUA 4QR1A 4EK2A 2R2UA 1V5VA 4ZCKA 3MECB 1EQMA 3NBPA 2O5DA 1XMQJ 3VQTA 1H74A 3QYFA 5DM6Q 4IO9F 1FTZA 4PJNA 5ETQA 1JLGB 3HVTB 4HYEA 1JB0C 1R43A 1AHDP 4ZVFA 1BBYA 2LU2A 2M5WA 4FT8A 2JOQA 1FF2A 3T19A 2J0WA 4OI2A 1YJ9I 2JVRA 1PCAA 5D8HB 1Z9CA 3O8WA 2MG4A 1WC4A 1U2FA 3H9GA 3DF8A 1U0HA 1O3TA 3CTRA 3H3UA 3JRDA 2FHJA 3M30B 2ZH1A 1B4SA 2VFUA 2R93J 4UUVA 1LVAA 2O7OA 5HAOA 4R25A 3PTWA 2P6SA 1DP3A 4L0YB 3PO3J 1LW0A 2JEGA 5ILUA 2DMNA 1F9NA 1CJUA 2BYCA 4PAAA 1ZTWA 2W4DA 3AFGA 2MZTA 1I6XA 3I5CA 7AT1B 2E19A 1BJAA 1MU2B 5JLXA 1WH5A 3LSIA 4TU7A 4AIJA 3VGSA 1OSCA 2GAGC 2MSSA 4LUBA 2CJYB 3BCBA 1N88A 3M2UB 3GILA 3PR4A 3MCMA 3I96A 3FZBA 3O2PE 1KTQA 2BABA 2JDJA 1BLUA 3TJAA 2VKDA 4V19K 2I6WA 2IS6A 1FOYA 2Y8WA 2Z1DA 3HM5A 4MTDA 3H35A 2KIQA 4M94A 2I5JA 3MM9A 1HD1A 2HAFA 3P3DA 3BR9A 4QIFA 4WFZA 1IUJA 3A8KA 4LOCA 3G4SI 3ULHA 2DRAA 2QLJB 1GMVA 2HURA 3ABMH 3RUBL 4NHJA 2Z33A 5F0FA 4MLOA 3GTGJ 2EKNA 4PDKA 3S6EA 2E1RA 1EJ7L 1WVRA 1U1NA 2DTZA 1WELA 4UUXA 4YHHF 3M8EA 4DSKA 1CF7B 1UJ8A 4PSXA 2BE9B 4OMYA 4Y2MA 4AYBD 2G2YA 1SB6A 2KH9A 4NLYA 3BYPA 1ETOA 4WXCA 1YOVB 3A3NB 3HULA 2H5EA 3TO7A 2XQCA 1ODDA 1S9FA 5L3CA 1QO0D 1Z6TA 4Q47A 2GA7A 2GHWA 4RW6A 2OPQB 2DRBA 3F44A 1XEZA 2DXIA 3FJ2A 1KLMB 1JI8A 5AIQA 5HDKA 2ASDA 4UT4A 2HOAA 2EZKA 5A8RB 3H92A 3JTHA 3OYLA 4M3BA 2PBIA 3RB6A 1IBMJ 3CCYA 3KPHA 3QIPB 1O4XA 5DGAA 2DR9A 2GIQA 3TDZC 2EK1A 5F04A 1NXIA 3ZQFA 3I55I 4CSWA 3GCMA 1BL0A 3S1TA 1IKXA 5F3TA 2HSEB 3S14J 3U1NA 1MLAA 4R5PB 5I3UA 2OQGA 4KFBA 4HDHA 2GGPA 3I32A 3I64A 2OKQA 3IBCB 2O61A 2N7YA 3PYEA 1I3OB 3SFIA 4UNOA 3NWGA 5F0WA 4ZTFA 1JLFA 3VEPA 3G87A 3G6ES 3T1YJ 3MAJA 5A0YB 3B6CA 3CMQA 5L3EA 2JJ7A 4RB2C 1CG2A 2HGCA 1YRXA 3I5AA 3V6KA 2WY8Q 2CIMA 2EV6A 1X4AA 4ZKAA 3RBEA 4B3OA 1LQ1A 2MY8A 3CCSS 1HPZA 1U0SA 2UXXA 3CJ5A 4B3SF 2HZAA 2BM1A 2X6WA 3CDBA 2X1EA 3M8QA 4I2OA 2FNAA 2W2NP 3MPYA 5I3PA 1RPWA 1FI4A 3HHEA 2XLJA 1KQFB 4J19A 1FD2A 1YBAA 2DO4A 4DL0C 1GUUA 1J59A 1HL6A 3ZQGA 4BEHB 5D5XB 1Y39A 1NZ8A 3KCCA 1HQ2A 2CZ4A 3SCIE 1RETA 2XB2D 2L02A 1JNZB 5EGYA 2MTLA 3K57A 1P6TA 2VQLA 4W92B 3QT5A 1ITPA 3T9ZA 2DA7A 1Y9OA 1YW9A 1HARA 4IRHA 1YGYA 4CYCA 3HTSB 3R9LA 5HVQC 3NAIA 2CQNA 4CH0S 2QKLB 4OZJA 2QG9B 4BHPA 1QPMA 3RAXA 2E1AA 1B0TA 4DR6J 3R27A 4R8HA 4J5OA 2J7WA 5E8IA 2DCEA 2DA4A 2NS1B 3C15A 1BOBA 3HDSA 4ZJOA 1P9QC 3A1YG 5F8GA 4IL6C 1HWLA 1FO1A 2C2EA 4TY8B 2M5YA 2CQCA 3G86A 4ZVUB 5A2QK 1VBYA 4ZOSA 2EIKH 3EZUA 1Z1DA 4RAZA 1QZZA 1HD0A 2B7CB 2J7UA 1FBSA 4FYVB 4CRJA 3F23A 2CV0A 4LBHA 5DO2A 3F41A 2P2CB 4H54A 2D1VA 2V8PA 3PKYA 1JUSA 5DLFA 4RW7A 2ZH5A 1LWFB 1GEHA 2QMUB 1X4GA 3KHHA 5KVRA 2L9WA 2LK2A 5HQLA 2XGEA 5FLXZ 2XO7A 4DV4F 3D5SC 2XAHA 1M5KC 1VRQC 4A3CJ 2A18A 3N5FA 3QYBA 2P5LC 2AJ2A 2EKYA 1B64A 1S6PB 4N9HA 5C2GA 3Q86A 4WE1B 1HKAA 5A6WA 4GYIA 3Q5FA 3FK7A 2CZVC 2HIQA 1C0UA 4C0BA 5ITHA 1EH8A 1RHJB 3W5YA 4ELTA 3AOBA 2ROGA 4HNUA 4ECZA 3R6SA 3R7SB 3R6GB 1Y3KA 1HNVB 2YWEA 3RU0A 2HYJA 5F8MA 1ROFA 1O7FA 2HVDA 4G1IA 4V1Ak 3CCUS 2CUYA 4IVNA 2FOWA 3CT9A 2MB0B 1BM9A 2V1NA 2NSCA 1PBUA 1X4BA 4WFAQ 4E7SA 3BREA 2Z8QA 3MM7B 2WBMA 2FJXA 2FC9A 2NVYJ 3ASNH 4B3AA 4LRDA 4I7FA 4DV2J 3KG4A 3FBEA 3CCMI 3F73A 4QWQA 1FK9B 4R8UA