1K79A

Ets-1(331-440)+ggaa duplex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
104
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*AP*AP*TP*GP*T)-3')
total genus 36
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k79A00
2FNPA 5K5OA 4ASNA 5E8IA 4NHJA 2V6CA 5BPIA 3RIRA 3T0YA 4IF4A 2J5PA 2GZWA 2ZMEB 2FBKA 3RTRA 1IN6A 5E1ZB 2R3SA 1R1VA 3GZ5A 1T0FA 1L0OC 5KK1A 1XSXA 1FP1D 1KU2A 4KICA 3HRMA 2O8XA 4U7BA 3KETA 4G9YA 1XMAA 1B1BA 4A6DA 3NEUA 4OMYA 2P6SA 4PZJA 2P5LC 2EFNA 1ONVA 5ERIA 3T8RA 3V7CA 2UZKA 4A0XA 2HKXA 2HGCA 5HS7A 4KYWA 3P9IA 4BQAA 2QVOA 2KIFA 3ECOA 2PG4A 4IHSA 3C3WA 1Z6TA 1B4AA 4OU0A 1OMIA 3KP3A 1FC3A 5CJ9A 1BI0A 1YFHA 3SZPA 4I09A 1R5HA 1L3LA 1P4XA 1G3YA 3FXQA 1R58A 2CO5A 3ZN1A 1CF7A 4LLNA 3IRQA 2XAFA 1R7JA 5HOOA 3I64A 4PDKA 1FBQA 4G6QA 4ZYEA 1O57A 4WF2A 3F8NA 1JHHA 3ZQ7A 2G9WA 1IUYA 4MTEA 1XB4A 1R1UA 4WK8F 3FMRA 4EJUA 1C0WA 1KQ9A 3L9FA 1FSHA 2A5YB 3ELKA 4ENKA 2FA5A 2CYYA 1R00A 4UXNA 1J5YA 3WTSC 1LEAA 4L0ZB 1D3YA 2KIUA 4MQVA 5AIPA 2GA2A 3K1PA 1GHCA 1J7KA 4EJOA 3IHUA 3E5QA 2VXZA 2DLLA 2RNJA 2QENA 5ICFA 3U2RA 1TBXA 2UWMA 3ZPLA 4YFKF 2W25A 2STTA 4RAYA 5JR3A 5IT9Z 5L3CA 3IL2A 4CHUA 2H27A 4FT8A 2Z99A 2PJPA 2EWNA 4RB1A 2G7HA 1MGTA 4O3MA 2LSOA 4I02A 5DUKA 4CICA 2HR3A 2HFHA 2D1VA 4HA8A 1HSTA 5K1YA 4OMZA 4OIQF 3O6BB 4WWCA 1O7FA 3DPLC 4UV8A 4M9XA 4JK1X 3VEPA 1I27A 2DTRA 4BNCA 4AIKA 4I2OA 4EGZA 2XUBA 3VOEA 1CF7B 2Y0MA 3ZMUA 1KU7A 2HS5A 3WTVC 2RV8A 1XDSA 3FWEA 3EDPA 4HV6A 3R0JA 2P5VA 1S6LA 4Y15A 1ZG1A 2GXBA 2O0YA 5ILSA 1I1SA 3I0TA 2KRFA 4ENMA 3ML6A 1XSVA 3GFJA 3DQVC 1YIOA 2DO7A 3FX3A 2RQPA 2WC2A 3EYIA 4GXOA 1LDKB 1QPMA 2Y48A 2XASA 4HQMA 4L9JA 4BHPA 1Q1HA 2LNBA 2TDXA 3TQNA 4EV0A 3O2PE 1Z6RA 2CW0F 2CGPA 5D8LB 3CLOA 2P5KA 2FMYA 2NS0A 4M71A 5TRDA 4N0BA 1ZRCA 5HDNA 3RI4A 1FLIA 5JVTA 4ETSA 4JBAA 3MWMA 4YIIA 1HKQA 1XGNA 2PI0A 1TW3A 5H6QA 3KCCA 1I5ZA 3O3KA 3LQQA 2ZXJA 2VT3A 4I0BA 5CVUA 2A3SA 3M7GA 4HAMA 1IXSB 3ZMTA 4I98B 3C18A 4AVPA 4BH9A 5JI6A 2ADUA 2OQRA 2V1DA 4KN7X 1T38A 5LGTA 2QM3A 4R1HA 2LF8A 3IKTA 5IT9K 4IPAA 2F5DA 4GO1A 1MJAA 2PMUA 1ZRDA 3CUQA 3KEQA 3WE3A 3JSPA 2GWRA 2V1UA 1G4DA 4HBLA 3EQLF 2FE3A 2QYOA 3BPXA 3I4PA 3DEUA 3I58A 4L0YB 2ZNYA 2D45A 3WGGA 1ZREA 2V9VA 1LEBA 2QQBA 1F9NA 3WTYC 3F8MA 4KT5C 1ZLKA 1TQMA 3P9CA 1S7AA 4Q4ZF 1YS7A 2QQAA 3JAMZ 4XBFA 1W7PB 1REPC 1KU3A 1OR7A 3BJOA 1TQIA 4XLNF 1EH8A 2EJRA 3ZMZA 2VBZA 4B09A 1I1GA 1IRGA 5J8CA 1MD0A 4QWQA 5JFRA 1T98A 1WSUA 2FEZA 1HW2A 2XHKA 2D2WA 3CO7C 1QQIA 1LJ9A 3GFIA 1W5TA 3KP7A 4BHBA 1IN8A 3QP5A 1UHMA 3T1BA 3T8TA 1J9IA 1TQPA 3ZMVA 4XRFA 2MD5A 4B8XA 2JPCA 4HX8A 4ZYGA 4HDVA 2FXAA 1O3QA 2JTVA 3RKXA 4WX9A 4CGZA 1ZGJA 1U8RA 3TO7A 3Q9VA 1HKSA 4LFUA 4HDUA 3N97A 3MZYA 1MKMA 4HZFA 2XAHA 2FRHA 1U6GA 3TO9A 3ERED 2ZMEA 5HDKA 3Q9SA 3COAC 2JRTA 3HSFA 1YQAA 1IN5A 4HQEA 1WWXA 5JHUA 1YG2A 2H6CA 1E17A 1TNTA 1BJAA 2EFQA 3FM5A 2LKPA 4HLYA 4I01A 3R0AA 1FYKA 4NQWA 5CLSA 2A61A 3J7AO 2M30A 2R7FA 1TW2A 2MLKA 1XMKA 4G8XA 2VBYA 1H9GA 4HW0A 2CFXA 3B73A 2A68F 3VODA 1ZG3A 3CUOA 2J5OA 2O61A 1OYYA 1YW9A 5ILUA 2ISZA 4P9UA 3CDHA 5TJJA 4Q48A 2EV0A 5F64A 3WTTC 2FOKA 2A6EF 2CG4A 1B9NA 3QRFF 6PAXA 3KFWX 2Q8KA 3BWGA 2NNNA 2QUFA 3PFIA 2EFWA 1QBJA 1BOAA 4RB0A 2EV6A 4I0AA 4AIHA 4KUMA 3F23A 5H20A 1OKRA 5FB2A 3R61A 5A2QK 5DV5A 1XCVA 3K1NA 2ZJ2A 1OYIA 2Q0OA 5CVIA 3EETA 1K7AA 2GXGA 1CGPA 3IWFA 5DCMB 3KE2A 4RB3C 2AXLA 4A5MA 2MC3A 3SZTA 3GXOA 2HKOA 2Q2EA 4EM1A 2L54A 1W7PA 2FQ3A 1WI9A 3EUHA 2JT1A 2ZFWA 4RAZA 3Q5FA 2M1BA 2HTJA 1KYWA 4LG0A 2H09A 3V8JA 2A69F 1P2FA 4ON0A 4GYIA 1X3UA 2P7CB 2ETHA 3L00A 1RUNA 5D6EA 1D8JA 2YX7A 2RGVA 3E6MA 3QOPA 4H0EA 3DFGA 4JQFA 4GYGA 2KIMA 2YX4A 2RKHA 3VFZA 3WTWC 1P4AA 4M6XA 3WU0A 4U0YA 2EFPA 1D8KA 1BIBA 4OOIA 1RNLA 2FSWA 2GAUA 2K4BA 2K4JA 3LQRA 4UVBA 5BPDA 3GWZA 3F21A 5D4SA 3L7WA 5ED4A 3SHFA 3BP8A 1K6OA 4A0ZA 1A04A 3ECHA 1LDJA 4EMSA 5IT3A 3ABTA 1UCRA 2ESHA 1U3EM 4I7HA 4L9VA 2NYXA 4CXFA 5FLXK 2YR2A 3ZMSA 2DT5A 1SD4A 4RGSA 1P92A 1XCBA 1RUOA 3F72A 5DCFA 2ZO4A 1F5TA 4MGRA 4OIPF 3KP4A 2OBPA 2FNAA 4UVCA 1QNTA 3NRVA 5HLGA 1U78A 3LSTA 1SD6A 1R36A 3MCZA 2VC0A 1IRFA 1IXRC 2IRFG 2Z9OA 3BROA 3FZVA 1H9TA 2IP2A 4G94A 4O6JA 4XLPF 3MFKA 2K86A 1EV7A 4LK1F 3V7SA 3HOTA 4A12A 2H6BA 2IJLA 3T5XA 3DP7A 2L01A 3HSRA 1BBYA 1S7OA 4BXUA 5CVRA 4EVIA 3GF2A 4S04A 1KQ0A 3QU6A 3L2CA 2ZNZA 2VE8A 3LA3A 3TGNA 3S2WA 1ZRFA 3I54A 3HSEA 4G7ZF 1YO5C 1BI2A 2YPRA 1EH6A 4HV5A 4TV7A 2PLYA 4U0VA 4KA4A 4HF2A 1FT9A 3RKWA 1WRJA 3DPTA 2RDPA 5ICCA 3LA2A 2M87A 2E7XA 5LLQA 5LHHA 5J8FA 3R4KA 4ZZLA 3J80Z 4LMYA 2E7WA 4M72A 3M8FA 5BS6A 4HF0A 4FX0A 2OZUA 4IVNA 4KIBA 5F6FA 4HOBA 4ENNA 2QLZA 1FPQA 4PGGA 3V8LA 2XAGA 4LD5A 2L02A 1YLFA 1G3WA 2ZCWA 4M9SA 4A2UA 3R60A 3RDIA 1LNWA 1W7PD 3QU3A 1RIOH 1U5TB 5HS9A 4ZH4F 3FMQA 5D5XB 2X0LA 3TKYA 2OZ6A 3I71A 1G3TA 3HOSA 5F1RA 4R8HA 3J81Z 4L9TA 4CYDA 3WTUC 2UXNA 3KP2A 1W5SA 2HZTA 2HWVA 1USSA 1SFEA 5D5VB 4KN4X 4IRIA 5E17F 4EQQA 5LEKA 1ZAOA 1XGSA 5D4RA 2F5FA 1BC7C 2XIGA 2VT2A 5K5QA 3FF5A 1P4WA 1IXCA 1DDNA 4K2EA 4G6DA 2Z5UA 3IKVA 4P5OA 1XGOA 4FHTA 5BMZA 2GQQA 2MLGA 4ZYDA 2DW4A 4BAYA 2R7DA 3V7RA 2XKOA 1KU9A 1SMTA 1Y0UA 1YW7A 4ZZDA 3ABUA 3WODF 1SFUA 1SMYF 2V79A 1ZH5A 5E1XA 2EA4A 2BV6A 5AONA 3LWFA 1FBUA 3J80K 2EB7A 3IWZA 3REOA 1MJ9A 4Q47A 4UV9A 1RZ4A 1JGSA 2XROA 1S29A 3I5UA 2QZ8A 5J6XA 3E5UA 4OIOF 4WXDA 1K78B 2BEOA 4GGGA 2A6HF 4A6EA 1SFXA 4DNCA 4U7DA 2DK8A 1EH7A 3GFLA 2M8EA 2FU4A 3GUDA 2COMA 2QBYB 2HEOA 2F5EA 1SD7A 3TOBA 3GW2A 3J81K 2L3DA 4YIFA 5L3GA 4KFCA 4G7HF 3B02A 2STWA 5FO5A 4BHCA 1E2XA 1HBXG 4ZYHA 1ZARA 1AWCA 3MZHA 2YU3A 2OQGA 3RKYA 4IHTA 1HSJA 4AD9A 2ESNA 1F4KA 2CSOA 1JXSA 3QPHA 4EM0B 4ENJA 2HDCA 3C1DA 4KMFA 4A5NA 3HTSB 1YYVA 2LDUA 3BPVA 3K69A 3F8FA 2VOOA 4YG2F 3F22A 4KNYA 4BYYA 3N4MA 1O7LA 3KEOA 4LK0F 1DPUA 5DD4A 2IPQX 2Z3YA 4EJVA 4WCGA 3P7NA 2KJCA 5EEHA 3M9AA 1R22A 2XAJA 2MA3A 3FXRA 2Y75A 3PQKA 3WG9A 4ESBA 1FBSA 1UB9A 2JZYA 2HYFA 2ZKZA 3BZ6A 3IC7A 1K78A 3OV8A 1ODDA 3RYPA 2K27A 3WGIA 1QZZA 2L4MA 2MH2A 3CO6C 1W4MA 3LFKA 1ZN2A 2BYVE 4EGYA 3D5LA 3LA7A 2P4WA 4KIGA 1IZ1A 2RC4A 3P9KA 3G73A 3MAJA 1XN7A 2BE5F 5E1WA 4P55A 1FZPB 3RPQA 3KLNA 5L3EA 2FBIA 4YFNF 3SFZA 3KLOA 3JTHA 2WV0A 5HS8A 5L3DA 1J0RA 1JE8A 3E6CC 3V8KA 2OAZA 3C7JA 2PEXA 3ZMDA 3RPUA 1XGMA 3I59A 4ESJA 1WQ2A 2JSCA 2GA1A 1K79A 1STZA 3ULQB 2OD5A 4GCVA 3E6BA 4QLCU 1YW8A 1Z1DA 3QP6A 5A2QZ 3E5XA 1YS6A 2UXXA 5CVJA 4IRHA 4L5IA 4LB5A 3G3ZA 2DPUA 3H3UA 1U2WA 4XSXF 2PFBA 2F5CA 1KYZA 1QGPA 2IT0A 1R5GA 4PCQA 4KDPA 3W6JB 5K5RA 1WKMA 2YSRA 4UHTA 2IA2A 2DAOA 1HQCA 4KMUX 5LHIA 4XSZF 2DQLA 5E20A 4M74A 3BOQA 1ZLJA 1GVJA 1FYLA 4UUVA 1YTYA 2VE9A 1Z05A 1JHFA 4F7ZA 2VOPA 1B9MA 2Z33A 2QBYA 1LQ1A 3ISPA 3QPTA 3V4GA 1Z91A 1F1ZA 2HYGD 2NAZA 2XKPA 4IJAA 5E8GA 2ZBKA 2ACJA 5FGMA 1P6RA 4EM2A 4M73A 1I6XA 3I53A 1R1TA 4IXAA 3SXYA 2A07F 3JSOA 1HKTA 5D6FA 2CWEA 4Z2YA 3PQJA 5FFZA 2VODA 3M1EA 5LGNA 3F6OA 3FHZA 4DQ2A 2H94A 3H3ZA 3KZZA 1TTYA 3BJ6A 2VBWA 3ROUA 3GX4X 1IN7A 1TLHB 3WGHA 3F8BA 3U1DA 2W24A 1T39A 4OINF 4A0YA 1Z7UA 2IVMA 4S05A 4CO8A 2M45A 2K02A 3E3VA 3HYIA 2ISYA 1IN4A 1HW5A 1V4RA 4AIJA 3IRRA 2CQKA 1SD5A 2W84A 1FP2A 2P7VB 4PGHA 3GYHX 2PBIA 2IW5A 1BC8C 1B59A 5HVQC 5CYVA 2GIVA 4CDGA 2QQ9A 5LRRA 3W6KB 5D5UB 4P9FA 4HX7A 3SQNA 2O03A 2ELHA 2NNYA 2VBXA 1LDDA 2L4AA 3TDZC 1G6NA 1S3JA 2EK5A 2FBHA 4G7OF 1BIAA 2D1HA 5DCMA 2FF4A 4CZZA 2PN6A 1J59A 2WTEA 1ON2A 5KVRA 1V3FA 1QO0D 4WXHA 1ON1A 4L18B 1BN5A 2W85A 1FWZA 5FD5A 5LRSA 2V1XA 3F6VA 3GZ6A 3GO5A 4HF1A 2W57A 5DYMA 1BI1A 1LB2A 1PP7U 1HXDA 2XVCA 1ZHFA 4HLXA 2HTSA 3MQ0A 4N9HA 2VC1A 1J75A 3D0SA 4L9NA 1DPRA 2MH9A 2DPDA 4U88A 1SAXA 2LF7A 4UVAA 1Z9CA 1D5VA 1UHWA 5HDGA 1O3TA 4OIRF 4HX4A 3EYYA 3FMSA 1ULYA 2M5WA 5FD6A 5DEQA 1R23A 4RS8A 1MDMB 5ILVA 2DK5A 3MEXA 1IAWA 4AWXB 2EA2A 3GFMA 3R6SA 3FM3A 5D5WB 1B6AA 3HRUA 2WWYA 3KP5A 3RYRA 1ZYRF 2IA0A 1GXPA 5H6RA 3K2ZA 5LHGA 4Y17A 1VTNC 4EJWA 3HHHA 5BOXA 4P96A 3CUQB 4IRGA 1NHAA 1LVAA 4LLGF 2DI3A 2NRAC 5LBQA 2G7UA 3E6DA 2DU9A 4RGRA 5HLHA 3WE2A 3JAMK 3F3XA 2MBFA 3WU1B 4KIFA 2QWWA 2P8TA 3CJNA 1PP8F 5D8KB 4RGUA 1FYMA 1USTA 4R79A 1FNNA 2VN2A 5DUIA 1ZG5A 3BDDA 2O6GE 4M9ZA 1GXQA 5BQTA 4LGWA 2B0LA 1OPCA 2K7LA 2XV4S 1G3SA 3U9GA 4L5JA 1RI7A 4D0PA 2HQNA 2RN7A 1ZGAA 4LJZF 3L09A 3LAPA 3F8CA 4LLLA 3HIFA 4EJTA 3GVAA 4YFXF 3BJAA 2HQRA 2EV5A 2XRNA 2BGCA 1U5TC 1BM9A 1J2XA 2PQ8A 5ICEA 5LGUA 4MHGA 5LEJA 1MJBA 3QAHA 3GEZA 3WTZA 2DQRA 1KA8A 1UFMA 1IW7F 1QZYA 1OYWA 2O3FA 5HLIA 4Y13A 2VONA 2FMLA 3DV8A 4LG0B 3K0LA 3GLXA 1XDUA 1XSDA 3ZN0A 2KJBA 1IF1A 4LB6B 1TNSA 1U5TA 4ESFA 1BI3A 5L3BA 1DUXC 2E1CA 1S8NA 3DXJF 3K9TA 3TOAA 3DF8A 3FXUA 4NB5A 3CUQC 3HTUA 5ICGA 4N9IA 2E1NA 4RB2C 3HRTA 4MQ9F 3BY6A 1XD7A 3I59B 2P6TA 3M8EA 1FOKA 2JPBA 2BBYA 3AAFA 2F2EA 1O3RA 4WXCA 2XAQA 1PUEE 5DD8A 4M6YA 5L3FA 1KQ8A 5CVVA 2C6YA 5AIQA 2OA4A 1DP7P 2PMHA 1AOYA 3DKWA 5EEGA 3JTGA 1KGSA 3KZYA 5FFXA 2X4HA 2IA1A 2AS5F 3NQOA 4U0WA 1FY7A 4MTDA 3KP6A 2OU2A 3OOPA 4UNOA 4E70A 5E18F 3TO6A 3LAJA 3HRSA 1FX7A 3WTXC 1HW1A 2DFIA 3K1MA 4MEYF 1MDMA 1MZBA 2DBBA 4MEXF 1T6SA 1H0MA 4RGXA 1T2KA 3JW4A 1O3SA 3E97A 4O5VA 5DDGA 4FX4A 2XGXA 3HHGA 4HYEA 1PDNC 5FLXZ 2EFOA 4Q5SF 3ZP5A 3CTAA 3RJPA 3HUGA 2KKOA 4MNUA 2HOEA 2RVCA 3TDUC 3H92A 3VB2A 1FSEA
chains in the Genus database with same CATH superfamily
4PUSA 1LVKA 5F04A 2L0KA 3K4NA 2FNPA 1EA3A 1PYVA 4ASNA 5K5OA 3ZQLA 4ZYAA 4M3GA 5E8IA 4NHJA 2V6CA 5BPIA 2M9HA 2ZJQF 2F4OB 2MYSA 2QQ8A 4X6AJ 4HNTA 4JYKA 3RIRA 5EGOA 3T0YA 4IF4A 3OYBA 2L9SA 2J5PA 2GZWA 2ZMEB 2FBKA 1JKPC 3RTRA 1IN6A 1V5EA 1MNDA 3I4MJ 5E1ZB 2R3SA 1TWAJ 1R1VA 3GZ5A 1HCRA 1T0FA 1L0OC 5KCMA 5KK1A 4CSWA 1U9NA 1XSXA 3GTGJ 1V5FA 1FP1D 1HA8A 1KU2A 1X1BA 4KICA 1T08B 2FQ4A 3VPRA 5C4JJ 3JRHA 3ESWB 3HRMA 2O8XA 3LFUA 4U7BA 2DA2A 3KETA 4G9YA 1XMAA 3BTJA 1B1BA 3VYTB 3LSKA 4A3DJ 1N75A 4A6DA 3NEUA 4C2MJ 4OMYA 2P6SA 4PZJA 2P5LC 2K9QA 4KITB 4DYQA 2EFNA 1E3HA 3RKQA 2BOLA 1ONVA 5ERIA 3T8RA 1G8XA 3V7CA 2ELKA 5EDNA 1YJWI 2M3AA 2LOOA 2VASA 2F4IA 2UZKA 4A0XA 4JX5A 2HKXA 2HGCA 5HS7A 2H1KA 4IHXA 4KYWA 2GBYA 3P9IA 4BQAA 2QVOA 2KIFA 3ECOA 4ZC3A 2PG4A 1R4MB 1R5ID 4IHSA 4PJNA 2VI6A 2LYCA 3C3WA 1ERDA 1Z6TA 2GOMA 3A0BC 1B4AA 2E71A 2HYJA 4OU0A 1OMIA 3KP3A 1FC3A 3QODA 1BI0A 1FIPA 1OCZH 5CJ9A 4A3IJ 4HRIA 1YFHA 3SZPA 4I09A 1S72I 1R5HA 2A05A 3G2BA 3IV5A 1L3LA 1P4XA 1G3YA 3FXQA 1YJNI 4S0HB 1R58A 2CO5A 5E3OA 4ITVA 3ZN1A 1CF7A 4LLNA 3LSIA 3PNVA 3IRQA 1TL8A 2XAFA 2CQQA 3D5SC 3A2KA 4UUSA 3PIPF 1R7JA 5HOOA 2DFEA 3I64A 4F55A 4PDKA 1FBQA 1V5GA 1JUSA 1VZ0A 2LTPA 2VJIA 4G6QA 4ZYEA 4BGDA 4CYCA 3VDXA 1O57A 3ZQQA 4WF2A 1ETWA 5IPAA 3F8NA 2WA0A 1I6HJ 3S3OA 1RR7A 3W6VA 4C2TA 1E3OC 1NG7A 3HBLA 5E3NA 4BL0B 1JHHA 3HOVJ 3B6CA 3H5NA 3ZQ7A 2G9WA 1IUYA 4MTEA 1XB4A 5E3MA 1JT6A 3IAM2 1R1UA 4WK8F 3FMRA 3SZGA 4EJUA 1C0WA 1KQ9A 3KYDB 4RAFA 3L9FA 3CQZJ 3S93A 2MC4A 5E3LA 1FSHA 1ETYA 4QTRA 1Z3XA 1M1EB 4E7HA 2A5YB 3ELKA 4ENKA 1AHDP 3RZDJ 2FA5A 2CYYA 2BZTA 1R00A 4UXNA 1J5YA 5DS9A 3WTSC 1LEAA 4L0ZB 1D3YA 2KIUA 4MQVA 3CDIA 4EATA 5AIPA 2GA2A 3K2AA 3K1PA 4RDUA 1GHCA 3K4JA 3PO3J 4XKBA 3ZXSA 1AKHB 4C3HJ 1J7KA 4EJOA 1R9TJ 1OQYA 3IHUA 3E5QA 2E36A 2DLLA 2RNJA 2VXZA 3QYFA 2DYSH 2KFDA 4M3BA 5DM6F 2QENA 3VWBA 4E7JA 5ICFA 3U2RA 1WJDA 1TBXA 2UWMA 3ZPLA 4RM2A 2DN0A 4YFKF 4BE2A 2W25A 2CQNA 4RAYA 2STTA 5JR3A 5IT9Z 5L3CA 3IL2A 4CHUA 2H27A 2DTZA 4FT8A 4BE0A 2Z99A 2E35A 2PJPA 2EWNA 3S14J 4RB1A 1ZKGA 2R7TA 2LG4A 4A3EJ 2G7HA 1MGTA 4O3MA 2AQEA 2LSOA 4I02A 3OIQA 5DUKA 4CICA 5FKOA 1KZHA 1CQTA 2HR3A 3GTQJ 2HFHA 1YITI 1Z7LA 4G12A 1PJRA 2D1VA 3CZ6A 4HA8A 3HKZN 2OC6A 1HSTA 3JRDA 5K1YA 4OMZA 4ZTJA 4OIQF 3O6BB 4WWCA 1O7FA 3DPLC 4UV8A 4M9XA 4JK1X 1E0EA 3I56I 3VEPA 1I27A 4PJ0C 3VYUB 3GTJJ 2DTRA 3CP8A 4BNCA 4AIKA 1IG7A 4I2OA 3FKJA 3K4CA 4EGZA 3H5RA 4Y4RA 2XUBA 3VOEA 1QZEA 3O8GA 3KYCB 5K7ZA 4W97A 1CF7B 2R5YB 4IHYA 4AM3A 1WJBA 2Y0MA 1OCTC 2LVSA 3ZMUA 1KU7A 2HS5A 3WTVC 2RQQA 2RV8A 2QCOA 2E19A 3QPLA 2R7WA 3LSRA 1XDSA 3FWEA 1X2NA 3EDPA 4HV6A 4C3IJ 2FOWA 3R0JA 2P5VA 2RAEA 1S6LA 1RC9A 4Y15A 3Q3SA 3PL8A 1ZG1A 3C2HA 2GXBA 2O0YA 5FLMJ 5ILSA 1QA6A 1I1SA 3I0TA 3FK6A 3CJQB 3WU2C 1PVEA 2KRFA 4ENMA 3ML6A 1NH3A 2DMPA 1XSVA 1VI0A 2X6XA 3GFJA 3DQVC 1YIOA 4DZJA 2DO7A 3FX3A 2RQPA 2WC2A 3JRBA 3EYIA 3FISA 4RMNA 4GXOA 1LDKB 1JKRC 1QPMA 2Y48A 2XASA 4HQMA 4L9JA 4BHPA 1Q1HA 2LNBA 1DGRM 2TDXA 4IQ4A 3TQNA 4EV0A 3O2PE 2KIQA 1Z6RA 3BG9A 2IS4A 2CW0F 1MMNA 1SVMA 3KYLA 2CGPA 2XGDA 3QQAA 4RA2A 4QIWN 4JX4A 5D8LB 3CLOA 2P5KA 4PFPA 2JVHA 2FMYA 2NS0A 4E7KA 4M71A 5TRDA 2K9NA 4N0BA 3BZCA 1ZRCA 5HDNA 3RI4A 2W7NA 1Y39A 1FLIA 2Y2ZA 2QSFX 5JVTA 3FBIB 1VQ5I 4ETSA 2JUGA 1X1DA 3VYRB 4JBAA 3MWMA 3PNYA 2OTJI 4YIIA 1HKQA 1HF0A 1XGNA 2H8RA 2PI0A 4IHVA 1O4XA 1TW3A 3CP2A 5H6QA 1GV5A 2IGMA 3KCCA 2ME6A 1I5ZA 3O3KA 3LQQA 2ZXJA 4CCLA 2HI3A 3CESA 3BTLA 2VT3A 3KPHA 1W36C 2IS6A 3GTOJ 5BNGA 2JVGA 3U1KA 2EZKA 4I0BA 4W1UA 5CVUA 2A3SA 1S5LC 3M7GA 3BTIA 1IXSB 4HAMA 3OYEA 2Y69H 3ZMTA 3HM5A 2X1CA 4I98B 3KIOA 3C18A 4AVPA 4BH9A 4XONA 5JI6A 2DFHA 4MO7A 2ADUA 2V1NA 5J3LA 2OQRA 4PJJA 1W0UA 2V1DA 4KN7X 3AG3H 1T38A 5LGTA 1NK2P 3I4NJ 2LK2A 2QM3A 4R1HA 1I39A 2LF8A 3IKTA 1VQ4I 5IT9K 2YU9J 3BC8A 4IPAA 1X19A 3CMAI 2F5DA 2ZSIB 2BY1A 1MJAA 4GO1A 2PMUA 2E2HJ 3BR6A 2ZXWH 1ZRDA 3CUQA 3KEQA 4AVZA 1WH7A 1RKTA 3WE3A 1FJLA 1SVLA 3JSPA 2GWRA 4UB6C 2V4JC 2V1UA 1Z3YA 2DT6A 2VKDA 1UELB 1G4DA 4HBLA 3EQLF 4M3DA 2FE3A 1N25A 1JJ6C 1IDYA 2QYOA 3BPXA 3I4PA 3K70C 3OSFA 3J7YJ 3DEUA 4DBQA 2K5CA 3I58A 2BVLA 4L0YB 2ZNYA 2D45A 3WGGA 1QU3A 4A3MJ 2LD5A 1ZREA 5KAFC 2V9VA 1LPQA 1MMSA 1YE9A 1LEBA 2QQBA 5GTHC 1F9NA 4MFDA 2CUJA 2OPTA 3WTYC 3F8MA 5LFAA 4KT5C 1ZLKA 1TQMA 2AXTC 3P9CA 3L2WA 1APLC 1POGA 5C4XJ 1S7AA 3QPSA 4Q4ZF 1YS7A 1EJ9A 2QQAA 2GLOA 2LKXA 3JAMZ 2D5VA 1IUFA 4XNFA 3DTKA 2ZC2A 5FKNA 4XBFA 3FXJA 4LIUA 4V19K 1A6QA 1W7PB 2HXIA 1X58A 1REPC 1KU3A 3JRAA 1OR7A 3BJOA 3D1NI 1TQIA 2HOSA 4XLNF 2X6YA 3OS1A 4BKXA 3K7AJ 1EH8A 3PUFA 4IOCF 2EJRA 2JK3A 3ZMZA 1OCRH 2Y30A 2VBZA 1T56A 2LKSA 4B09A 1I1GA 1W36D 2XPWA 1IRGA 5J8CA 1MD0A 4QWQA 5JFRA 1T98A 1UG0A 1WSUA 3VSKA 2FEZA 4NBQA 3LSGA 3A1YA 1HW2A 2XHKA 2D2WA 3CO7C 1QQIA 1LJ9A 3GFIA 3GZNB 1W5TA 3KP7A 4BHBA 1MSFC 1IN8A 3QP5A 1AA7A 4LG3A 1UHMA 3T1BA 3T8TA 1ACIA 4ABZA 1J9IA 1TQPA 5CPRB 1K4SA 3M4OJ 2WB1N 2ECCA 2X1DA 2JJ7A 3ZMVA 1YRNA 2IBDA 3CCLI 3CCSI 4XRFA 4CUGA 1JI8A 1X4OA 2MD5A 2KQRA 4B8XA 1ZTRA 2JPCA 4HX8A 3HXLA 2R7QA 1BR4A 4ZYGA 4HDVA 2FXAA 1W1WE 1O3QA 2JTVA 3RKXA 3MKYB 5EG0B 4WX9A 4CGZA 1ZGJA 1U8RA 1WJ5A 1IGNA 1Y8RB 3TO7A 2HZDA 4HSRA 1U8BA 3Q9VA 1OFCX 1HKSA 4J00A 4LFUA 3WHCA 4HDUA 1V54H 3N97A 3HGGA 3MZYA 1MKMA 5J47A 3JREA 4BE1A 1B72B 1OCOH 4HZFA 2IXSA 2XAHA 2FRHA 1U6GA 3TO9A 5EZGA 5EGOB 3ERED 2GM4A 1RR8C 4BACA 2KISA 2ZMEA 5HDKA 3Q9SA 4NC7A 1WCMJ 3COAC 2JRTA 1SFOJ 3HSFA 1YQAA 2YUSA 3K4KA 1IN5A 4HQEA 3AKZA 1WWXA 2VL8A 2ZMEC 5JHUA 4BEHA 5CQEA 1YG2A 2H6CA 1E17A 2QSHX 1TNTA 1PUFB 1BJAA 4F92B 2EFQA 3FM5A 2MD0A 3G6EI 2LKPA 1MNMC 4HLYA 2ZJPF 2IS2A 2NVYJ 4ZDOA 4I01A 3K4BA 3KEYA 3R0AA 1FYKA 1BW5A 1WPKA 2DA6A 2KLOA 4NQWA 5CLSA 2A61A 3J7AO 2M30A 2R7FA 1DU6A 1MBFA 3DEWA 3AG2H 2HQ5A 1TW2A 2MLKA 1XMKA 1WJAA 4G8XA 4HG2A 2VBYA 1DQUA 1FOXA 1H9GA 1WJEA 4HW0A 1B8IA 3L2QA 2CFXA 3B73A 2A68F 3FDYA 1ZR2A 4XIDA 3MZ8A 3VODA 4B44A 2BY2A 1ZG3A 3CUOA 2J5OA 2O61A 1EKEA 5M5XJ 2KPMA 3ZQGA 1OYYA 1YW9A 2Q1ZB 5ILUA 1D0XA 5C3EJ 2NOJB 5EEAA 3L2RA 2ISZA 4P9UA 3CDHA 1WJCA 2VIXA 5TJJA 4Q48A 2EV0A 4MFEA 4KISA 5F64A 3WTTC 2FOKA 2A6EF 2CV1A 3BQYA 3CJRB 2CG4A 3DBHB 4I6ZA 4DOZA 1B9NA 3QRFF 6PAXA 2EBIA 3KFWX 2Q8KA 3BWGA 2NNNA 2QUFA 1IDZA 3FXLA 3PFIA 3Q0WA 4XQFA 1BOAA 2EFWA 2E60A 2EV6A 4RB0A 1QBJA 3AL0B 4I0AA 1ZQ3P 3A01B 4AIHA 4CCMA 3HOUJ 3AG4H 1MIJA 4KUMA 1JT0A 2CH0A 1FIAA 3GBGA 3F23A 5M3FJ 3CCMI 5H20A 3GTMJ 3FHNA 1Z67A 1OKRA 2QKLB 5FB2A 2BVMA 2HPMA 3R61A 5A2QK 1I50J 3A0HC 1VQMI 2ICWG 5DV5A 2R7UA 1XCVA 1Y8QB 2KRCA 3K1NA 2ZJ2A 5CQGA 3S1RJ 4KJZA 4PSWA 2DMQA 1OYIA 2Q0OA 3Q0VA 5CVIA 3EETA 1K7AA 2GXGA 1CGPA 3IWFA 5DCMB 5F0CA 5GAEJ 3M3YJ 3KE2A 4RB3C 3S15J 5JLXA 2EZLA 2B9SA 2DT7B 5J1UA 2AXLA 4E7ZA 4A5MA 2LH9A 2MC3A 3SZTA 3P5JA 2XB0X 3GXOA 2HKOA 5IOZA 2Q2EA 4NC8A 2L54A 3SEQA 4EM1A 2NOGA 2Z1DA 4ZTFA 1W7PA 3JRCA 2FQ3A 5HNHA 1WI9A 3EUHA 2DMTA 2JT1A 3I9V2 3BR1A 2ZFWA 4RAZA 4X0GA 3LNQA 3Q5FA 2M1BA 2R4GA 1P7JA 2HTJA 2WADA 1KYWA 4LG0A 2H09A 3V8JA 2A69F 1P2FA 2XGCA 4ON0A 4GYIA 1X3UA 1OJLA 2COBA 2P7CB 2ETHA 3L00A 1RUNA 5D6EA 1D8JA 2YX7A 2RGVA 3E6MA 2LRDA 2EH3A 5GTIC 5IYCJ 2OCEA 4XICA 3QOPA 3SDGA 4H0EA 3DFGA 4JQFA 4OAZA 4GYGA 2KIMA 4BY1J 2YX4A 5DTDA 2RKHA 2R92J 2KMUA 3VFZA 3BCBA 3WTWC 1P9QC 1P4AA 4M6XA 2XGEA 3BLYA 3WU0A 3QWLA 5HNFA 1XTAA 1Q1VA 4U0YA 4XRSA 2EFPA 5FRMA 2XF6A 4AC0A 1D8KA 1BIBA 1HOMA 4OOIA 1Z0XA 1VQ6I 1FOYA 4LOCA 4F3QA 1RNLA 2DOAA 2IGOA 2FSWA 2HDDA 2GAUA 2K4BA 3ABMH 3IH3A 1K6YA 2K4JA 3LQRA 4UVBA 5BPDA 3GWZA 4II2A 3F21A 1ZR4A 1IJWC 5D4SA 3ONQA 3LSJA 3L7WA 1BJZA 4E4HA 3SHFA 3BP8A 5ED4A 1K6OA 4A0ZA 2CUEA 1X4PA 2GOXB 2E5ZA 1A04A 3ECHA 1LDJA 4EMSA 2ZFUA 5IT3A 5B5EC 3ABTA 1UCRA 2ESHA 1W5CC 1U3EM 3FK7A 4I7HA 1WJFA 3H36A 4L9VA 2NYXA 4CXFA 1BA5A 5FLXK 2YR2A 3ZMSA 2DT5A 1SD4A 3Q0UA 4RGSA 1P92A 2XF7A 1XCBA 2E2JJ 1RUOA 4YEJA 3F72A 4BDYA 4J19A 3OSGA 3HZJA 5DCFA 1IRXA 2ZO4A 3NWTA 2ZJRF 1F5TA 4MGRA 4OIPF 2HNHA 3KP4A 4AYBA 2OBPA 2WBMA 2FNAA 5IP9J 4UVCA 1QNTA 3NRVA 3H5AA 2M2EA 3LSMA 5HLGA 2M4KA 5K7FA 5E79C 1U78A 3LSTA 2Y0SN 5F0HA 1SD6A 2DMNA 1R36A 4BBSJ 3MCZA 1FTZA 2VC0A 2F6CA 2XC7A 4DBRA 1IRFA 2OCCH 3HPGA 1IXRC 2MFZA 2IRFG 2Z9OA 3BROA 3FZVA 1H9TA 3QYBA 2IP2A 4G94A 4O6JA 4XLPF 3MFKA 2K86A 1EV7A 3S32A 4B43A 4OWRB 4LK1F 3V7SA 3HOTA 1WFXA 4A12A 2H6BA 2IJLA 1ENHA 5CKTA 3CDLA 3T5XA 4C30A 3DP7A 2L01A 3HSRA 3CC4I 2ZXIA 5F0FA 1BBYA 4XKCA 1S7OA 5KAIC 4BXUA 3MKLA 4UUSB 5J1RA 4FE4A 3L2VA 5CVRA 4B3AA 1Y1VJ 2GIZA 2BW3A 3BT9A 2LBFA 4FISA 4FASD 4XORA 3GF2A 4EVIA 4S04A 1KQ0A 3QU6A 4NQWB 3L2CA 2V9KA 1MMAA 1LUJB 3MD2A 2ZNZA 2VE8A 3HGYA 3LA3A 3OYJA 1LFPA 1XG1A 3TGNA 2EIKH 3S2WA 2HQAA 3HOXJ 2X48A 3CLQA 3I54A 3HSEA 3CCEI 1ZRFA 4G7ZF 1YO5C 1BI2A 2YPRA 2IGKA 1EH6A 1AKHA 1BR1A 3BZKA 3MVPA 4HV5A 3HDDA 4TV7A 4XM3A 2PLYA 4U0VA 2DA3A 2DMUA 4KA4A 2BY3A 5M3MJ 1GVDA 4HF2A 1FT9A 2Y31A 4FQGA 4XOTA 1QVTA 3RKWA 1WRJA 2R5ZB 3DPTA 3UR3C 3DPUA 2MSYA 2RDPA 2A6TA 4RLQA 3JR9A 5ICCA 3LA2A 2I10A 2M87A 1JTXA 4B4CA 2E7XA 5LLQA 5LHHA 5J8FA 3R4KA 4MIMA 4ZZLA 3J80Z 3DTIA 2LBFB 2CS3A 4LMYA 4I76A 5IOYA 2E7WA 3OMYA 4M72A 2JRMA 3M8FA 2VXDA 5BS6A 1JKQC 3S16J 2ZB9A 1WI3A 2AO9A 3OR1C 5LD2C 1ITYA 4IEJA 2DDBA 4HF0A 4FX0A 1TT0A 2OZUA 3MKWB 4IVNA 4KIBA 3ZQFA 5F6FA 4HOBA 2PX9A 1UG2A 4HSTA 4ENNA 2QLZA 1U0JA 4N4OB 1X1PA 1FPQA 2FD5A 3H0DA 3NARA 1IO2A 3M07A 3CC2I 1RETA 1FTTA 5J4YA 3H9QA 4PGGA 2XAGA 4LD5A 3V8LA 4AUXA 2L02A 3CCYA 1YLFA 1D0YA 2QEXI 3EUHC 1G3WA 5FRNA 5IP6A 1XC5A 2ZCWA 1Y1WJ 4M9SA 3A02A 4A2UA 3EPZA 3R60A 3RDIA 2JA7J 1LNWA 1TZLA 2L5QA 2DA5A 3BG3A 4Y3OA 2KHMA 2R7RA 1H89C 3W2WA 1W7PD 1T0FC 1ETQA 3QU3A 1J09A 1RIOH 1U5TB 1ETXA 3CC7I 1VNDA 5JVGF 1VQLI 3SDBA 5HS9A 4U87A 4A3JJ 4ZH4F 3K6GA 4JX6A 1UAAA 1RESA 3FMQA 2M34A 2LLKA 5D5XB 2X0LA 3TKYA 2OZ6A 2EILH 2DOFA 3I71A 1G3TA 3HOSA 5F1RA 4R8HA 3J81Z 4L9TA 4CYDA 1RPWA 4FETA 3S3NA 3PO2J 2NS8A 3WTUC 4XKWA 2UXNA 3KP2A 2DXIA 1SANA 1W5SA 2JN6A 2CUFA 5C44J 3H9JA 4XKVA 2HZTA 4IX7A 3FBNB 3LSPA 1VQ8I 2HWVA 4V2FA 3RZOJ 1USSA 1SFEA 5D5VB 4KN4X 1HC8A 2W82A 4IRIA 5E17F 4EQQA 5LEKA 3FXOA 3E1SA 1ZAOA 3OYGA 1XGSA 1ZELA 5D4RA 2F5FA 1BC7C 2XIGA 2VT2A 5K5QA 3FF5A 1P4WA 1IXCA 1DDNA 4K2EA 4DYCA 1QVUA 4G6DA 4ANJA 2Z5UA 3IKVA 3OIOA 4P5OA 1IC8A 1XGOA 3OL4A 4FHTA 3DU5A 3OYNA 1MMGA 5GPCA 5BMZA 4RLFA 2GQQA 4CCKA 5IYBJ 3IP4B 4FTHA 2MLGA 3OYCA 4ZYDA 2DW4A 2E34A 3WHBA 4BAYA 4G6TB 1MSEC 1T95A 2R7DA 3V7RA 2XKOA 2UUZA 1KU9A 1SMTA 3PJRA 1KONA 4PJLA 1Y0UA 1D0ZA 1YW7A 1SEUA 4M3FA 1DGWY 2XF5A 4ZZDA 3ABUA 3WODF 2CUZA 1SFUA 1A35A 4XLFA 4F93B 1SMYF 2V79A 2Z16A 4EEFG 5E1XA 2EA4A 2BV6A 5AONA 1ZH5A 2JA6J 3LWFA 1FBUA 2NVQJ 3PFYA 1FMVA 3J80K 2EB7A 3J7AY 3IWZA 2HVRA 3REOA 2CV0A 2X6OA 1MJ9A 4Q47A 4UV9A 1RZ4A 1JGSA 1SC7A 2XROA 3K4MA 3MN2A 4RBOA 1RKWA 2B63J 1S29A 2LP0A 4BQNA 3I5UA 1XPXA 2QZ8A 3IH4A 5J6XA 1TWGJ 3NWSA 3E5UA 3TMOA 1S9HA 1E3PA 3SYTA 3E7LA 4OIOF 4WXDA 1K78B 3CD6I 2VKHA 2BEOA 1K83J 3E0JB 4GGGA 5F08A 2L7KA 2A6HF 4A6EA 5DM7F 1SFXA 4DNCA 4U7DA 4M3EA 3OYFA 2DK8A 2V9PA 3MMYB 2X1EA 1EH7A 3WG7H 3GFLA 3S17J 1P7IA 1Y0NA 2Y0SA 3DWLE 3DBRB 3UKGA 2M8EA 3ABLH 3W3CA 4MLOA 2FU4A 4LITA 3GUDA 3HJEA 2COMA 2HDWA 2QBYB 2Y9YA 2HEOA 3ERMA 2PMZN 3ASNH 2F5EA 2K3PA 1H8AC 5J40A 1SD7A 3TOBA 4XN3A 4BXFA 3A01A 3GW2A 5FKLA 2L3DA 3J81K 1JJ8C 3HPHA 1ORKA 4YIFA 5L3GA 4KFCA 3EUKL 1JUMA 4G7HF 2KT0A 3B02A 4I99C 1YI2I 2STWA 3S2DJ 5FO5A 4BHCA 1E2XA 1BL0A 1HBXG 4ZYHA 2LMDA 1ZARA 1AWCA 1LFBA 3MZHA 2YU3A 2OQGA 3RKYA 4IHTA 1HSJA 4AD9A 4BBRJ 2ESNA 2BW3B 2CSOA 1YHQI 2K9SA 1F4KA 4IOAF 1JXSA 3QPHA 1HLVA 4EM0B 3HB9A 1K4TA 4PK4A 2IEKA 1NK3P 2RREA 4ENJA 2R7SA 3CCUI 3S8PA 3OYMA 2HDCA 2BHZA 1OCCH 3C1DA 2G0EA 4KMFA 3LMMA 2K3FA 4A5NA 2VQGA 3OYDA 3HTSB 3GLLA 1YYVA 2LDUA 3BPVA 3K69A 2F4MB 3F8FA 1WH5A 4P1WA 4YG2F 3F22A 4KNYA 2VOOA 4BYYA 3V42A 3N4MA 2DYRH 4ZJZA 1O7LA 3JRGA 5KNLA 3KEOA 4LK0F 1DPUA 2HXOA 2CJJA 2IPQX 2Z3YA 4HEA2 5DD4A 1OISA 4JP0A 3DTEA 4EJVA 4WCGA 3P7NA 2KJCA 3N05A 3G1MA 5EEHA 2VUMJ 3M9AA 1R22A 3AG1H 1VQPI 1TP4A 1UHSA 3HUGB 2XAJA 5HLTA 1TWFJ 3FXMA 4DYRA 1YX5A 3ZOBA 2KZVA 2R7OA 2MA3A 4DGWB 3GTKJ 3FXRA 1WZ2A 1BR2A 2Y75A 3PQKA 3WG9A 4ESBA 1IRZA 3DKXA 2ID3A 4HNVA 3OR2C 3DBLB 3TW7A 3LL7A 1FBSA 1UB9A 4CYCB 2JZYA 3S2HJ 2M0CA 2HYFA 2E1MC 4AYBN 2ZKZA 2TCTA 3BZ6A 3IC7A 3TW6A 4E6KG 5J1YA 1K78A 3JRIA 3OV8A 1ODDA 3RYPA 4RM3A 3OYIA 1MNEA 2K27A 1TT5B 3WGIA 3HOWJ 1QZZA 4E7IA 1R71A 1ZK8A 2L4MA 3IAS2 2L2OA 2MH2A 3CO6C 2EIMH 1W4MA 2K9LA 2WAEA 3LFKA 1ZN2A 5FKMA 1GUUA 2BYVE 1VQOI 2PMZA 3BR3A 4H4KC 4EGYA 3FKIJ 4E7SA 4YIRX 3D5LA 2KRHA 3LA7A 3ZRGA 2P4WA 3H3VK 4KIGA 4NUBA 2VJ4A 1IZ1A 2RC4A 1JUPA 3P9KA 1QHHD 3G73A 1TC3C 4C9YA 3H1CA 4XMYA 2RNGA 3M8JA 2DDAA 2NS7A 3MAJA 1DP3A 3ZCOA 1XN7A 3TP3A 2KZGA 2BE5F 5E1WA 4P55A 1FZPB 3RPQA 3KLNA 2CW8A 3GTLJ 5L3EA 2FBIA 1OLTA 4YFNF 3SFZA 4Z6YA 1FEXA 3KLOA 2M8GX 3JTHA 4PSXA 2WV0A 4NNJA 5HS8A 5L3DA 2LREA 1J0RA 2W48A 1JE8A 3PIOF 2DFFA 3E6CC 2BXZA 4XLCA 2DA7A 2OJED 4CH7A 3V8KA 1TWHJ 4J01A 1SAUA 2OAZA 3C7JA 3CMMA 2PEXA 3ZMDA 5FLVA 3RPUA 1XGMA 3I59A 2EZIA 1MH4A 2MABA 4ESJA 1ZGWA 1WQ2A 2CRGA 1D1AA 2K9MA 3S1MJ 3CJTB 2JSCA 2JA8J 2GA1A 1K79A 3SJMA 2M7AA 2LY9A 2IS1A 3TP0A 2ME0A 1STZA 2WV1A 4AU7A 2W00A 3ULQB 2OD5A 4GCVA 4CZCA 3E6BA 4QLCU 1XX5A 1YW8A 2IGNA 1Z1DA 3QP6A 5A2QZ 1GT0C 3E5XA 1YS6A 2UXXA 4XLAA 3F0CA 3RSNA 4BJTA 5CVJA 2JA2A 4IRHA 9ANTA 4L5IA 4BQQA 4L5EA 4LB5A 3KX2A 3G3ZA 2DPUA 1VQNI 3H3UA 3DU6A 4RAGA 1K61A 1U2WA 4XSXF 1W0TA 2PFBA 1ETVA 2ZXHA 3H0GJ 3BR5A 2F5CA 1KYZA 2LR8A 2L9RA 1QGPA 3RCOA 4DIQA 2IT0A 1VF9A 1WVRA 1VQ9I 3QYEA 2JWTA 3TBIA 1R5GA 2BXYA 4PCQA 4KDPA 3W6JB 5HODA 5K5RA 1WKMA 2L7FP 5F27A 3H35A 2YSRA 4HPQA 5EG0A 3K10A 4UHTA 2KL4A 4BXXJ 2IA2A 2DAOA 1HQCA 2O5RA 3PUBA 4KMUX 3CF2A 2CV2A 1OCPA 2HVSA 1YX3A 5LHIA 2XDVA 4XSZF 1T8IA 2DQLA 1IV6A 4FCYA 2DODA 4UY8I 5E20A 4M74A 1LKXA 3BOQA 5B1AH 3D5RC 2OV7A 4E7LA 1ZLJA 2O8KA 2XPVA 1GVJA 2VQCA 2X6WA 1FYLA 4UUVA 1YTYA 2VE9A 1Z05A 1JHFA 4F7ZA 2VOPA 1B9MA 4DJAA 4LIVA 3PSIA 2Z33A 2QBYA 3GMEA 2NVUB 1H88C 1LQ1A 3ISPA 3QPTA 2LFBA 3CF5F 2QSGX 2OUMA 3V4GA 2WAQA 4OAYA 1Z91A 4IHWA 3U21A 1F1ZA 2HYGD 2NAZA 2XKPA 4IJAA 2ZBKA 5E8GA 3VSLA 2ACJA 5FGMA 1P6RA 3OIPA 4EM2A 4M73A 5GAHJ 1I6XA 3I53A 4YELA 4BU2A 1R1TA 2BHYA 4XRMA 4IXAA 3SXYA 3BG6A 5F1JA 1PUFA 2A07F 2VKEA 2R0QC 3JSOA 1HKTA 2E1OA 3LSHA 2VLAA 5D6FA 2EPFA 2FX0A 4QPQA 2CWEA 5EZHA 4Z2YA 3PQJA 3X2QH 5FFZA 2VODA 2DJIA 2DA1A 5FROA 5FJ8J 3M1EA 5LGNA 1Y56A 3F6OA 3FHZA 5IYDJ 4DQ2A 2H94A 4BDZA 3J7ZI 1WGXA 3HC7A 3O8HA 4GDFA 3H3ZA 3SEZA 3KZZA 1TTYA 3BJ6A 2VBWA 3ROUA 2V7FA 2VB6A 3GX4X 3W2VA 1IN7A 1TLHB 4XLEA 3BR2A 3WGHA 3F8BA 3U1DA 2W24A 1T39A 2X85A 4OINF 2LY2A 4A0YA 1Z7UA 2IVMA 4S05A 4CO8A 2M45A 2L7MP 2K02A 3E3VA 4QPOA 3HYIA 4Y33A 2ISYA 3RQ4A 1IN4A 1HW5A 1V4RA 4AIJA 3IRRA 4B48A 5TGTA 1JTYA 2CQKA 2PJRB 1SD5A 2W84A 1FP2A 2P7VB 3CCRI 3DCFA 4PGHA 3G1LA 1R6RA 3GYHX 2PBIA 3EUAA 1AU7A 2IW5A 3OWTA 5EYRA 1BC8C 1B59A 1A36A 1QHGA 4A3BJ 5HVQC 4X1EA 5CYVA 2GIVA 2WY7Q 2XPUA 2P0WA 3K4LA 4XLHA 4CDGA 2JMWA 3VYSB 2QQ9A 5B66C 4IL6C 5LRRA 4IKFA 3W6KB 5D5UB 2E1MB 4P9FA 5EF6A 4HX7A 5GP9A 3SQNA 2P81A 3ABKH 2KP6A 2VJJA 1MH3A 3ZR8X 2O03A 3OYLA 2ELHA 4GRIA 5TISC 3H9GA 2L9NA 4NDLA 5K7HA 3CCVI 2NNYA 2VBXA 1LDDA 3ASOH 2L4AA 3HOYJ 4C3JJ 3TDZC 1G6NA 1S3JA 2EK5A 2FBHA 4D7NA 4G7OF 2YS9A 4NC6A 1BIAA 1UJ8A 2D1HA 2FF4A 2VPRA 5DCMA 4CZZA 3I55I 5M5WJ 4UUTA 2PN6A 3OS2A 1J59A 2WTEA 3G1OA 1ON2A 5KVRA 1V3FA 1QO0D 2K40A 3C2BA 4JOMA 2HU9A 3DLLF 2R5ZA 1EF4A 4WXHA 3QOEA 1ON1A 4B3XA 4L18B 1BN5A 1B72A 2W85A 3HEFA 1FWZA 5FD5A 2EIJH 4M6VA 5LRSA 5M5YJ 2V1XA 2VQLA 3F6VA 2Y9ZA 3GZ6A 3GO5A 4HF1A 2FUG2 2W57A 3OYHA 1YIJI 1FMWA 2JUCA 5DYMA 1BI1A 5H2FC 1LB2A 1PP7U 1HXDA 4Y7NJ 1X3WB 2XVCA 1ZHFA 4HLXA 2HTSA 2N8GA 3IUOA 3MQ0A 1DU0A 4V2GA 4N9HA 4ZDLA 1GV2A 1XS9A 2PJRA 2VC1A 1J75A 3D0SA 4BEHB 4L9NA 3TEDA 2ZSHB 1DPRA 2MH9A 3JCUC 2DPDA 2DJNA 4U88A 1SAXA 4DZPA 3BTCA 2LF7A 4UVAA 1Z9CA 1D5VA 1UHWA 3FXKA 1MBGA 5HDGA 1O3TA 4OIRF 3ZQIA 2MG4A 4HX4A 3EYYA 4QSHA 2QF7A 3FMSA 1ULYA 2M5WA 1LE8B 2LY1A 1UZCA 2NXNB 2V26A 2M0MA 3RQIA 3CCQI 5FD6A 1VFCA 2JA5J 2LC2A 5DEQA 4HNUA 3BG5A 1R23A 4RS8A 4XN0A 5ILVA 1MDMB 2B7EA 2DK5A 4CA0A 3MEXA 5GPAA 1IAWA 2A5WA 4AWXB 2EA2A 3GFMA 3R6SA 2O7OA 3FM3A 2CQ7A 5D5WB 1B6AA 1YOVB 3HRUA 4XL9A 3HOZJ 2I8DA 1N77A 4D7MA 1MBEA 4II3A 4F91B 3I3LA 1I3QJ 1OR7C 1MBKA 4BJ6C 3KP5A 2WWYA 2V6EA 1V55H 2EINH 1YJ9I 3RYRA 1ZYRF 1XMXA 3MKZA 1S7EA 5IP7J 2IA0A 1JGGA 4D1QA 1GXPA 5H6RA 1HDDC 1MBHA 3K2ZA 5LHGA 1MW7A 4YRVA 4Y17A 1VTNC 1I3AA 5J4VA 4EJWA 3HHHA 3AL0C 5BOXA 3DEEA 2R93J 2QKMB 4P96A 3CUQB 1LE8A 1T33A 1X2MA 4IRGA 1NHAA 3LOCA 3BQZA 1U9OA 1LVAA 4LLGF 3S1NJ 2DI3A 5GADJ 3B6AA 2NRAC 2OTLI 4A3LJ 2X9DA 5LBQA 1D5YA 5EJCA 2G7UA 3E6DA 2JSPA 2R5YA 3UNGC 2W4SA 2WY8Q 4B47A 2ID6A 2DU9A 4RGRA 5HLHA 4Y52J 1NTCA 3A03A 1FOWA 3WE2A 4AIDA 5GAGJ 2CW7A 3JAMK 1B8IB 2QGUA 3F3XA 2MBFA 3WU1B 2R7VA 4KIFA 2QWWA 2P8TA 2VQHA 3KZIC 1X3ZB 1WHUA 2Z2SB 3CJNA 1PP8F 2AQFA 3F9KA 2M4GA 5JHFA 1MMDA 3PNTA 5D8KB 4RGUA 1FYMA 3A4CA 3OOUA 1USTA 2WB1A 3JRFA 4R79A 1FNNA 2TRTA 2VN2A 4CCNA 4KT6A 2R7XA 5DUIA 5B1BH 1ZG5A 2HVQA 4A3FJ 3L2UA 2BY0A 3BDDA 3ZGKA 1RRJA 1N78A 1GLNA 2CU7A 1D1CA 2I5UA 2O6GE 4XK4A 2L9VA 4M9ZA 1GXQA 5BQTA 1Z21A 4LGWA 2Q2EB 1VQKI 2B0LA 2OF7A 3TL4X 3CMYA 1OPCA 1JKOC 2K7LA 2XV4S 1G3SA 3U9GA 4L5JA 2ECBA 1A5JA 1RI7A 3HKZA 2K85A 4D0PA 2HQNA 3K70D 2RN7A 1ZGAA 3HG9A 2CQXA 4LJZF 2XSDC 1ETOA 3RPUD 3L09A 3LAPA 2VJ5A 4ZDPA 1VQ7I 3OYAA 3GCMA 3S1QJ 3F8CA 4LLLA 3HIFA 3HL2A 4EJTA 2WAQN 3GVAA 4YFXF 4D5CA 3BJAA 2HQRA 2W1OA 2EV5A 2XRNA 3ZQCA 2BGCA 1U5TC 1BM9A 1J2XA 2PQ8A 2XRLA 5ICEA 5LGUA 5IY5H 4MHGA 4BJ5C 5LEJA 1MJBA 3QAHA 3PSFA 3GEZA 2F48A 3WTZA 4CCJA 2NVTJ 2DQRA 4PFOA 1KA8A 1Y6IA 4A3CJ 1UFMA 3W2AA 1IW7F 1QZYA 1OYWA 2MW8A 2O3FA 3OL3A 1R49A 5HLIA 2M7BA 4Y13A 2UV1A 2VONA 1D1BA 1NG6A 2FMLA 3DV8A 4LG0B 4BS9A 3K0LA 4A93J 3GLXA 1XDUA 2R7ZJ 2KDOA 2EZHA 1XSDA 2KDZA 3ZN0A 2KJBA 4XR6A 2XAUA 1IF1A 4LB6B 1TNSA 1U5TA 4ESFA 2NVXJ 1BI3A 2L7ZA 5L3BA 1DUXC 2E1CA 1ETKA 1S8NA 3DXJF 3K9TA 3M1CA 3TOAA 4BQOA 3DF8A 3FXUA 4NB5A 3CUQC 3HTUA 5ICGA 2DCEA 4N9IA 4UB8C 3CMEI 2E1NA 4RB2C 2XSJC 3HRTA 3DKYA 4MQ9F 3BY6A 1X1CA 1XD7A 3G4SI 3I59B 2GXAA 2HOTA 2P6TA 2FJ1A 4CCOA 1IV8A 3M8EA 1QRYA 3ZQHA 1FOKA 2HPIA 2JPBA 4A3GJ 2BBYA 1A6IA 2QA4I 5JLWA 3AAFA 2F2EA 1O3RA 4WXCA 2XAQA 1PUEE 3SFIA 5DD8A 4M6YA 5L3FA 2VPLA 1KQ8A 2EQRA 2ELJA 3CCJI 5CVVA 2C6YA 5AIQA 1BOBA 2OA4A 1DP7P 2PMHA 4PJMA 4IQJA 3BCAA 3S3MA 3AFHA 4GFBA 1AOYA 3DKWA 2CMPA 5EEGA 3G71I 3JTGA 1LFUP 2DOEA 1KGSA 3KZYA 2WAFA 3BR0A 3GTPJ 5FFXA 2X4HA 2AHQA 2IA1A 2AS5F 3NQOA 4U0WA 1F36A 4IZZA 1R4NB 1FY7A 1UMQA 4MTDA 3KP6A 1QPIA 2OU2A 3C2GA 1G59A 3OOPA 3OYKA 4UNOA 2H8WA 5KHDA 4E70A 4XRSG 5E18F 3PM1A 4F52A 1GDTA 1MBJA 2F5VA 3TO6A 5FKKA 1A31A 3LAJA 3IH2A 3HRSA 4D9JA 1FX7A 1X1AA 2O9LA 1TWCJ 2HOAA 4DW6A 3OS0A 3NAUA 3WTXC 1Z77A 2CFOA 1BW6A 3OY9A 2X51A 1HW1A 2DFIA 2MGQA 2E2IJ 2XB5A 3K1MA 4MEYF 1MDMA 1SFKA 2H1LA 5B3SH 3FIWA 1MZBA 4A69C 2DBBA 1T6SA 4MEXF 4RGXA 1H0MA 4N4NB 1T2KA 4C2UA 4B1RA 4FE7A 2IAIA 1HDPA 3JW4A 1O3SA 3E97A 4XOPA 3DLAA 2DA4A 4O5VA 5DDGA 4FX4A 2XGXA 1YRNB 3HHGA 2JQ7A 4BY7J 4HYEA 1PDNC 3BG7A 3L1PA 5FLXZ 2EFOA 4Q5SF 3ZP5A 2E5NA 3CTAA 1F43A 3RJPA 3HUGA 4IO9F 2KKOA 4D5FA 1G2HA 4MNUA 1SVOA 4BUPA 4A3KJ 2HOEA 2RVCA 2VKVA 3H92A 3TDUC 3VB2A 1FSEA
chains in the Genus database with same CATH topology
2FNPA 5K5OA 4ASNA 5E8IA 4NHJA 2V6CA 5BPIA 3RIRA 3T0YA 4IF4A 2J5PA 2GZWA 2ZMEB 2FBKA 3RTRA 1IN6A 5E1ZB 2R3SA 1R1VA 3GZ5A 1T0FA 1L0OC 5KK1A 1XSXA 1FP1D 1KU2A 4KICA 3HRMA 2O8XA 4U7BA 3KETA 4G9YA 1XMAA 1B1BA 4A6DA 3NEUA 4OMYA 2P6SA 4PZJA 2P5LC 2EFNA 1ONVA 5ERIA 3T8RA 3V7CA 2UZKA 4A0XA 2HKXA 2HGCA 5HS7A 4KYWA 3P9IA 4BQAA 2QVOA 2KIFA 3ECOA 2PG4A 4IHSA 3C3WA 1Z6TA 1B4AA 4OU0A 1OMIA 3KP3A 1FC3A 5CJ9A 1BI0A 1YFHA 3SZPA 4I09A 1R5HA 1L3LA 1P4XA 1G3YA 3FXQA 1R58A 2CO5A 3ZN1A 1CF7A 4LLNA 3IRQA 2XAFA 1R7JA 5HOOA 3I64A 4PDKA 1FBQA 4G6QA 4ZYEA 1O57A 4WF2A 3F8NA 1JHHA 3ZQ7A 2G9WA 1IUYA 4MTEA 1XB4A 1R1UA 4WK8F 3FMRA 4EJUA 1C0WA 1KQ9A 3L9FA 1FSHA 2A5YB 3ELKA 4ENKA 2FA5A 2CYYA 1R00A 4UXNA 1J5YA 3WTSC 1LEAA 4L0ZB 1D3YA 2KIUA 4MQVA 5AIPA 2GA2A 3K1PA 1GHCA 1J7KA 4EJOA 3IHUA 3E5QA 2VXZA 2DLLA 2RNJA 2QENA 5ICFA 3U2RA 1TBXA 2UWMA 3ZPLA 4YFKF 2W25A 2STTA 4RAYA 5JR3A 5IT9Z 5L3CA 3IL2A 4CHUA 2H27A 4FT8A 2Z99A 2PJPA 2EWNA 4RB1A 2G7HA 1MGTA 4O3MA 2LSOA 4I02A 5DUKA 4CICA 2HR3A 2HFHA 2D1VA 4HA8A 1HSTA 5K1YA 4OMZA 4OIQF 3O6BB 4WWCA 1O7FA 3DPLC 4UV8A 4M9XA 4JK1X 3VEPA 1I27A 2DTRA 4BNCA 4AIKA 4I2OA 4EGZA 2XUBA 3VOEA 1CF7B 2Y0MA 3ZMUA 1KU7A 2HS5A 3WTVC 2RV8A 1XDSA 3FWEA 3EDPA 4HV6A 3R0JA 2P5VA 1S6LA 4Y15A 1ZG1A 2GXBA 2O0YA 5ILSA 1I1SA 3I0TA 2KRFA 4ENMA 3ML6A 1XSVA 3GFJA 3DQVC 1YIOA 2DO7A 3FX3A 2RQPA 2WC2A 3EYIA 4GXOA 1LDKB 1QPMA 2Y48A 2XASA 4HQMA 4L9JA 4BHPA 1Q1HA 2LNBA 2TDXA 3TQNA 4EV0A 3O2PE 1Z6RA 2CW0F 2CGPA 5D8LB 3CLOA 2P5KA 2FMYA 2NS0A 4M71A 5TRDA 4N0BA 1ZRCA 5HDNA 3RI4A 1FLIA 5JVTA 4ETSA 4JBAA 3MWMA 4YIIA 1HKQA 1XGNA 2PI0A 1TW3A 5H6QA 3KCCA 1I5ZA 3O3KA 3LQQA 2ZXJA 2VT3A 4I0BA 5CVUA 2A3SA 3M7GA 4HAMA 1IXSB 3ZMTA 4I98B 3C18A 4AVPA 4BH9A 5JI6A 2ADUA 2OQRA 2V1DA 4KN7X 1T38A 5LGTA 2QM3A 4R1HA 2LF8A 3IKTA 5IT9K 4IPAA 2F5DA 4GO1A 1MJAA 2PMUA 1ZRDA 3CUQA 3KEQA 3WE3A 3JSPA 2GWRA 2V1UA 1G4DA 4HBLA 3EQLF 2FE3A 2QYOA 3BPXA 3I4PA 3DEUA 3I58A 4L0YB 2ZNYA 2D45A 3WGGA 1ZREA 2V9VA 1LEBA 2QQBA 1F9NA 3WTYC 3F8MA 4KT5C 1ZLKA 1TQMA 3P9CA 1S7AA 4Q4ZF 1YS7A 2QQAA 3JAMZ 4XBFA 1W7PB 1REPC 1KU3A 1OR7A 3BJOA 1TQIA 4XLNF 1EH8A 2EJRA 3ZMZA 2VBZA 4B09A 1I1GA 1IRGA 5J8CA 1MD0A 4QWQA 5JFRA 1T98A 1WSUA 2FEZA 1HW2A 2XHKA 2D2WA 3CO7C 1QQIA 1LJ9A 3GFIA 1W5TA 3KP7A 4BHBA 1IN8A 3QP5A 1UHMA 3T1BA 3T8TA 1J9IA 1TQPA 3ZMVA 4XRFA 2MD5A 4B8XA 2JPCA 4HX8A 4ZYGA 4HDVA 2FXAA 1O3QA 2JTVA 3RKXA 4WX9A 4CGZA 1ZGJA 1U8RA 3TO7A 3Q9VA 1HKSA 4LFUA 4HDUA 3N97A 3MZYA 1MKMA 4HZFA 2XAHA 2FRHA 1U6GA 3TO9A 3ERED 2ZMEA 5HDKA 3Q9SA 3COAC 2JRTA 3HSFA 1YQAA 1IN5A 4HQEA 1WWXA 5JHUA 1YG2A 2H6CA 1E17A 1TNTA 1BJAA 2EFQA 3FM5A 2LKPA 4HLYA 4I01A 3R0AA 1FYKA 4NQWA 5CLSA 2A61A 3J7AO 2M30A 2R7FA 1TW2A 2MLKA 1XMKA 4G8XA 2VBYA 1H9GA 4HW0A 2CFXA 3B73A 2A68F 3VODA 1ZG3A 3CUOA 2J5OA 2O61A 1OYYA 1YW9A 5ILUA 2ISZA 4P9UA 3CDHA 5TJJA 4Q48A 2EV0A 5F64A 3WTTC 2FOKA 2A6EF 2CG4A 1B9NA 3QRFF 6PAXA 3KFWX 2Q8KA 3BWGA 2NNNA 2QUFA 3PFIA 2EFWA 1QBJA 1BOAA 4RB0A 2EV6A 4I0AA 4AIHA 4KUMA 3F23A 5H20A 1OKRA 5FB2A 3R61A 5A2QK 5DV5A 1XCVA 3K1NA 2ZJ2A 1OYIA 2Q0OA 5CVIA 3EETA 1K7AA 2GXGA 1CGPA 3IWFA 5DCMB 3KE2A 4RB3C 2AXLA 4A5MA 2MC3A 3SZTA 3GXOA 2HKOA 2Q2EA 4EM1A 2L54A 1W7PA 2FQ3A 1WI9A 3EUHA 2JT1A 2ZFWA 4RAZA 3Q5FA 2M1BA 2HTJA 1KYWA 4LG0A 2H09A 3V8JA 2A69F 1P2FA 4ON0A 4GYIA 1X3UA 2P7CB 2ETHA 3L00A 1RUNA 5D6EA 1D8JA 2YX7A 2RGVA 3E6MA 3QOPA 4H0EA 3DFGA 4JQFA 4GYGA 2KIMA 2YX4A 2RKHA 3VFZA 3WTWC 1P4AA 4M6XA 3WU0A 4U0YA 2EFPA 1D8KA 1BIBA 4OOIA 1RNLA 2FSWA 2GAUA 2K4BA 2K4JA 3LQRA 4UVBA 5BPDA 3GWZA 3F21A 5D4SA 3L7WA 5ED4A 3SHFA 3BP8A 1K6OA 4A0ZA 1A04A 3ECHA 1LDJA 4EMSA 5IT3A 3ABTA 1UCRA 2ESHA 1U3EM 4I7HA 4L9VA 2NYXA 4CXFA 5FLXK 2YR2A 3ZMSA 2DT5A 1SD4A 4RGSA 1P92A 1XCBA 1RUOA 3F72A 5DCFA 2ZO4A 1F5TA 4MGRA 4OIPF 3KP4A 2OBPA 2FNAA 4UVCA 1QNTA 3NRVA 5HLGA 1U78A 3LSTA 1SD6A 1R36A 3MCZA 2VC0A 1IRFA 1IXRC 2IRFG 2Z9OA 3BROA 3FZVA 1H9TA 2IP2A 4G94A 4O6JA 4XLPF 3MFKA 2K86A 1EV7A 4LK1F 3V7SA 3HOTA 4A12A 2H6BA 2IJLA 3T5XA 3DP7A 2L01A 3HSRA 1BBYA 1S7OA 4BXUA 5CVRA 4EVIA 3GF2A 4S04A 1KQ0A 3QU6A 3L2CA 2ZNZA 2VE8A 3LA3A 3TGNA 3S2WA 1ZRFA 3I54A 3HSEA 4G7ZF 1YO5C 1BI2A 2YPRA 1EH6A 4HV5A 4TV7A 2PLYA 4U0VA 4KA4A 4HF2A 1FT9A 3RKWA 1WRJA 3DPTA 2RDPA 5ICCA 3LA2A 2M87A 2E7XA 5LLQA 5LHHA 5J8FA 3R4KA 4ZZLA 3J80Z 4LMYA 2E7WA 4M72A 3M8FA 5BS6A 4HF0A 4FX0A 2OZUA 4IVNA 4KIBA 5F6FA 4HOBA 4ENNA 2QLZA 1FPQA 4PGGA 3V8LA 2XAGA 4LD5A 2L02A 1YLFA 1G3WA 2ZCWA 4M9SA 4A2UA 3R60A 3RDIA 1LNWA 1W7PD 3QU3A 1RIOH 1U5TB 5HS9A 4ZH4F 3FMQA 5D5XB 2X0LA 3TKYA 2OZ6A 3I71A 1G3TA 3HOSA 5F1RA 4R8HA 3J81Z 4L9TA 4CYDA 3WTUC 2UXNA 3KP2A 1W5SA 2HZTA 2HWVA 1USSA 1SFEA 5D5VB 4KN4X 4IRIA 5E17F 4EQQA 5LEKA 1ZAOA 1XGSA 5D4RA 2F5FA 1BC7C 2XIGA 2VT2A 5K5QA 3FF5A 1P4WA 1IXCA 1DDNA 4K2EA 4G6DA 2Z5UA 3IKVA 4P5OA 1XGOA 4FHTA 5BMZA 2GQQA 2MLGA 4ZYDA 2DW4A 4BAYA 2R7DA 3V7RA 2XKOA 1KU9A 1SMTA 1Y0UA 1YW7A 4ZZDA 3ABUA 3WODF 1SFUA 1SMYF 2V79A 1ZH5A 5E1XA 2EA4A 2BV6A 5AONA 3LWFA 1FBUA 3J80K 2EB7A 3IWZA 3REOA 1MJ9A 4Q47A 4UV9A 1RZ4A 1JGSA 2XROA 1S29A 3I5UA 2QZ8A 5J6XA 3E5UA 4OIOF 4WXDA 1K78B 2BEOA 4GGGA 2A6HF 4A6EA 1SFXA 4DNCA 4U7DA 2DK8A 1EH7A 3GFLA 2M8EA 2FU4A 3GUDA 2COMA 2QBYB 2HEOA 2F5EA 1SD7A 3TOBA 3GW2A 3J81K 2L3DA 4YIFA 5L3GA 4KFCA 4G7HF 3B02A 2STWA 5FO5A 4BHCA 1E2XA 1HBXG 4ZYHA 1ZARA 1AWCA 3MZHA 2YU3A 2OQGA 3RKYA 4IHTA 1HSJA 4AD9A 2ESNA 1F4KA 2CSOA 1JXSA 3QPHA 4EM0B 4ENJA 2HDCA 3C1DA 4KMFA 4A5NA 3HTSB 1YYVA 2LDUA 3BPVA 3K69A 3F8FA 2VOOA 4YG2F 3F22A 4KNYA 4BYYA 3N4MA 1O7LA 3KEOA 4LK0F 1DPUA 5DD4A 2IPQX 2Z3YA 4EJVA 4WCGA 3P7NA 2KJCA 5EEHA 3M9AA 1R22A 2XAJA 2MA3A 3FXRA 2Y75A 3PQKA 3WG9A 4ESBA 1FBSA 1UB9A 2JZYA 2HYFA 2ZKZA 3BZ6A 3IC7A 1K78A 3OV8A 1ODDA 3RYPA 2K27A 3WGIA 1QZZA 2L4MA 2MH2A 3CO6C 1W4MA 3LFKA 1ZN2A 2BYVE 4EGYA 3D5LA 3LA7A 2P4WA 4KIGA 1IZ1A 2RC4A 3P9KA 3G73A 3MAJA 1XN7A 2BE5F 5E1WA 4P55A 1FZPB 3RPQA 3KLNA 5L3EA 2FBIA 4YFNF 3SFZA 3KLOA 3JTHA 2WV0A 5HS8A 5L3DA 1J0RA 1JE8A 3E6CC 3V8KA 2OAZA 3C7JA 2PEXA 3ZMDA 3RPUA 1XGMA 3I59A 4ESJA 1WQ2A 2JSCA 2GA1A 1K79A 1STZA 3ULQB 2OD5A 4GCVA 3E6BA 4QLCU 1YW8A 1Z1DA 3QP6A 5A2QZ 3E5XA 1YS6A 2UXXA 5CVJA 4IRHA 4L5IA 4LB5A 3G3ZA 2DPUA 3H3UA 1U2WA 4XSXF 2PFBA 2F5CA 1KYZA 1QGPA 2IT0A 1R5GA 4PCQA 4KDPA 3W6JB 5K5RA 1WKMA 2YSRA 4UHTA 2IA2A 2DAOA 1HQCA 4KMUX 5LHIA 4XSZF 2DQLA 5E20A 4M74A 3BOQA 1ZLJA 1GVJA 1FYLA 4UUVA 1YTYA 2VE9A 1Z05A 1JHFA 4F7ZA 2VOPA 1B9MA 2Z33A 2QBYA 1LQ1A 3ISPA 3QPTA 3V4GA 1Z91A 1F1ZA 2HYGD 2NAZA 2XKPA 4IJAA 5E8GA 2ZBKA 2ACJA 5FGMA 1P6RA 4EM2A 4M73A 1I6XA 3I53A 1R1TA 4IXAA 3SXYA 2A07F 3JSOA 1HKTA 5D6FA 2CWEA 4Z2YA 3PQJA 5FFZA 2VODA 3M1EA 5LGNA 3F6OA 3FHZA 4DQ2A 2H94A 3H3ZA 3KZZA 1TTYA 3BJ6A 2VBWA 3ROUA 3GX4X 1IN7A 1TLHB 3WGHA 3F8BA 3U1DA 2W24A 1T39A 4OINF 4A0YA 1Z7UA 2IVMA 4S05A 4CO8A 2M45A 2K02A 3E3VA 3HYIA 2ISYA 1IN4A 1HW5A 1V4RA 4AIJA 3IRRA 2CQKA 1SD5A 2W84A 1FP2A 2P7VB 4PGHA 3GYHX 2PBIA 2IW5A 1BC8C 1B59A 5HVQC 5CYVA 2GIVA 4CDGA 2QQ9A 5LRRA 3W6KB 5D5UB 4P9FA 4HX7A 3SQNA 2O03A 2ELHA 2NNYA 2VBXA 1LDDA 2L4AA 3TDZC 1G6NA 1S3JA 2EK5A 2FBHA 4G7OF 1BIAA 2D1HA 5DCMA 2FF4A 4CZZA 2PN6A 1J59A 2WTEA 1ON2A 5KVRA 1V3FA 1QO0D 4WXHA 1ON1A 4L18B 1BN5A 2W85A 1FWZA 5FD5A 5LRSA 2V1XA 3F6VA 3GZ6A 3GO5A 4HF1A 2W57A 5DYMA 1BI1A 1LB2A 1PP7U 1HXDA 2XVCA 1ZHFA 4HLXA 2HTSA 3MQ0A 4N9HA 2VC1A 1J75A 3D0SA 4L9NA 1DPRA 2MH9A 2DPDA 4U88A 1SAXA 2LF7A 4UVAA 1Z9CA 1D5VA 1UHWA 5HDGA 1O3TA 4OIRF 4HX4A 3EYYA 3FMSA 1ULYA 2M5WA 5FD6A 5DEQA 1R23A 4RS8A 1MDMB 5ILVA 2DK5A 3MEXA 1IAWA 4AWXB 2EA2A 3GFMA 3R6SA 3FM3A 5D5WB 1B6AA 3HRUA 2WWYA 3KP5A 3RYRA 1ZYRF 2IA0A 1GXPA 5H6RA 3K2ZA 5LHGA 4Y17A 1VTNC 4EJWA 3HHHA 5BOXA 4P96A 3CUQB 4IRGA 1NHAA 1LVAA 4LLGF 2DI3A 2NRAC 5LBQA 2G7UA 3E6DA 2DU9A 4RGRA 5HLHA 3WE2A 3JAMK 3F3XA 2MBFA 3WU1B 4KIFA 2QWWA 2P8TA 3CJNA 1PP8F 5D8KB 4RGUA 1FYMA 1USTA 4R79A 1FNNA 2VN2A 5DUIA 1ZG5A 3BDDA 2O6GE 4M9ZA 1GXQA 5BQTA 4LGWA 2B0LA 1OPCA 2K7LA 2XV4S 1G3SA 3U9GA 4L5JA 1RI7A 4D0PA 2HQNA 2RN7A 1ZGAA 4LJZF 3L09A 3LAPA 3F8CA 4LLLA 3HIFA 4EJTA 3GVAA 4YFXF 3BJAA 2HQRA 2EV5A 2XRNA 2BGCA 1U5TC 1BM9A 1J2XA 2PQ8A 5ICEA 5LGUA 4MHGA 5LEJA 1MJBA 3QAHA 3GEZA 3WTZA 2DQRA 1KA8A 1UFMA 1IW7F 1QZYA 1OYWA 2O3FA 5HLIA 4Y13A 2VONA 2FMLA 3DV8A 4LG0B 3K0LA 3GLXA 1XDUA 1XSDA 3ZN0A 2KJBA 1IF1A 4LB6B 1TNSA 1U5TA 4ESFA 1BI3A 5L3BA 1DUXC 2E1CA 1S8NA 3DXJF 3K9TA 3TOAA 3DF8A 3FXUA 4NB5A 3CUQC 3HTUA 5ICGA 4N9IA 2E1NA 4RB2C 3HRTA 4MQ9F 3BY6A 1XD7A 3I59B 2P6TA 3M8EA 1FOKA 2JPBA 2BBYA 3AAFA 2F2EA 1O3RA 4WXCA 2XAQA 1PUEE 5DD8A 4M6YA 5L3FA 1KQ8A 5CVVA 2C6YA 5AIQA 2OA4A 1DP7P 2PMHA 1AOYA 3DKWA 5EEGA 3JTGA 1KGSA 3KZYA 5FFXA 2X4HA 2IA1A 2AS5F 3NQOA 4U0WA 1FY7A 4MTDA 3KP6A 2OU2A 3OOPA 4UNOA 4E70A 5E18F 3TO6A 3LAJA 3HRSA 1FX7A 3WTXC 1HW1A 2DFIA 3K1MA 4MEYF 1MDMA 1MZBA 2DBBA 4MEXF 1T6SA 1H0MA 4RGXA 1T2KA 3JW4A 1O3SA 3E97A 4O5VA 5DDGA 4FX4A 2XGXA 3HHGA 4HYEA 1PDNC 5FLXZ 2EFOA 4Q5SF 3ZP5A 3CTAA 3RJPA 3HUGA 2KKOA 4MNUA 2HOEA 2RVCA 3TDUC 3H92A 3VB2A 1FSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNP A;  5K5O A;  4ASN A;  5E8I A;  4NHJ A;  2V6C A;  5BPI A;  3RIR A;  3T0Y A;  4IF4 A;  2J5P A;  2GZW A;  2ZME B;  2FBK A;  3RTR A;  1IN6 A;  5E1Z B;  2R3S A;  1R1V A;  3GZ5 A;  1T0F A;  1L0O C;  5KK1 A;  1XSX A;  1FP1 D;  1KU2 A;  4KIC A;  3HRM A;  2O8X A;  4U7B A;  3KET A;  4G9Y A;  1XMA A;  1B1B A;  4A6D A;  3NEU A;  4OMY A;  2P6S A;  4PZJ A;  2P5L C;  2EFN A;  1ONV A;  5ERI A;  3T8R A;  3V7C A;  2UZK A;  4A0X A;  2HKX A;  2HGC A;  5HS7 A;  4KYW A;  3P9I A;  4BQA A;  2QVO A;  2KIF A;  3ECO A;  2PG4 A;  4IHS A;  3C3W A;  1Z6T A;  1B4A A;  4OU0 A;  1OMI A;  3KP3 A;  1FC3 A;  5CJ9 A;  1BI0 A;  1YFH A;  3SZP A;  4I09 A;  1R5H A;  1L3L A;  1P4X A;  1G3Y A;  3FXQ A;  1R58 A;  2CO5 A;  3ZN1 A;  1CF7 A;  4LLN A;  3IRQ A;  2XAF A;  1R7J A;  5HOO A;  3I64 A;  4PDK A;  1FBQ A;  4G6Q A;  4ZYE A;  1O57 A;  4WF2 A;  3F8N A;  1JHH A;  3ZQ7 A;  2G9W A;  1IUY A;  4MTE A;  1XB4 A;  1R1U A;  4WK8 F;  3FMR A;  4EJU A;  1C0W A;  1KQ9 A;  3L9F A;  1FSH A;  2A5Y B;  3ELK A;  4ENK A;  2FA5 A;  2CYY A;  1R00 A;  4UXN A;  1J5Y A;  3WTS C;  1LEA A;  4L0Z B;  1D3Y A;  2KIU A;  4MQV A;  5AIP A;  2GA2 A;  3K1P A;  1GHC A;  1J7K A;  4EJO A;  3IHU A;  3E5Q A;  2VXZ A;  2DLL A;  2RNJ A;  2QEN A;  5ICF A;  3U2R A;  1TBX A;  2UWM A;  3ZPL A;  4YFK F;  2W25 A;  2STT A;  4RAY A;  5JR3 A;  5IT9 Z;  5L3C A;  3IL2 A;  4CHU A;  2H27 A;  4FT8 A;  2Z99 A;  2PJP A;  2EWN A;  4RB1 A;  2G7H A;  1MGT A;  4O3M A;  2LSO A;  4I02 A;  5DUK A;  4CIC A;  2HR3 A;  2HFH A;  2D1V A;  4HA8 A;  1HST A;  5K1Y A;  4OMZ A;  4OIQ F;  3O6B B;  4WWC A;  1O7F A;  3DPL C;  4UV8 A;  4M9X A;  4JK1 X;  3VEP A;  1I27 A;  2DTR A;  4BNC A;  4AIK A;  4I2O A;  4EGZ A;  2XUB A;  3VOE A;  1CF7 B;  2Y0M A;  3ZMU A;  1KU7 A;  2HS5 A;  3WTV C;  2RV8 A;  1XDS A;  3FWE A;  3EDP A;  4HV6 A;  3R0J A;  2P5V A;  1S6L A;  4Y15 A;  1ZG1 A;  2GXB A;  2O0Y A;  5ILS A;  1I1S A;  3I0T A;  2KRF A;  4ENM A;  3ML6 A;  1XSV A;  3GFJ A;  3DQV C;  1YIO A;  2DO7 A;  3FX3 A;  2RQP A;  2WC2 A;  3EYI A;  4GXO A;  1LDK B;  1QPM A;  2Y48 A;  2XAS A;  4HQM A;  4L9J A;  4BHP A;  1Q1H A;  2LNB A;  2TDX A;  3TQN A;  4EV0 A;  3O2P E;  1Z6R A;  2CW0 F;  2CGP A;  5D8L B;  3CLO A;  2P5K A;  2FMY A;  2NS0 A;  4M71 A;  5TRD A;  4N0B A;  1ZRC A;  5HDN A;  3RI4 A;  1FLI A;  5JVT A;  4ETS A;  4JBA A;  3MWM A;  4YII A;  1HKQ A;  1XGN A;  2PI0 A;  1TW3 A;  5H6Q A;  3KCC A;  1I5Z A;  3O3K A;  3LQQ A;  2ZXJ A;  2VT3 A;  4I0B A;  5CVU A;  2A3S A;  3M7G A;  4HAM A;  1IXS B;  3ZMT A;  4I98 B;  3C18 A;  4AVP A;  4BH9 A;  5JI6 A;  2ADU A;  2OQR A;  2V1D A;  4KN7 X;  1T38 A;  5LGT A;  2QM3 A;  4R1H A;  2LF8 A;  3IKT A;  5IT9 K;  4IPA A;  2F5D A;  4GO1 A;  1MJA A;  2PMU A;  1ZRD A;  3CUQ A;  3KEQ A;  3WE3 A;  3JSP A;  2GWR A;  2V1U A;  1G4D A;  4HBL A;  3EQL F;  2FE3 A;  2QYO A;  3BPX A;  3I4P A;  3DEU A;  3I58 A;  4L0Y B;  2ZNY A;  2D45 A;  3WGG A;  1ZRE A;  2V9V A;  1LEB A;  2QQB A;  1F9N A;  3WTY C;  3F8M A;  4KT5 C;  1ZLK A;  1TQM A;  3P9C A;  1S7A A;  4Q4Z F;  1YS7 A;  2QQA A;  3JAM Z;  4XBF A;  1W7P B;  1REP C;  1KU3 A;  1OR7 A;  3BJO A;  1TQI A;  4XLN F;  1EH8 A;  2EJR A;  3ZMZ A;  2VBZ A;  4B09 A;  1I1G A;  1IRG A;  5J8C A;  1MD0 A;  4QWQ A;  5JFR A;  1T98 A;  1WSU A;  2FEZ A;  1HW2 A;  2XHK A;  2D2W A;  3CO7 C;  1QQI A;  1LJ9 A;  3GFI A;  1W5T A;  3KP7 A;  4BHB A;  1IN8 A;  3QP5 A;  1UHM A;  3T1B A;  3T8T A;  1J9I A;  1TQP A;  3ZMV A;  4XRF A;  2MD5 A;  4B8X A;  2JPC A;  4HX8 A;  4ZYG A;  4HDV A;  2FXA A;  1O3Q A;  2JTV A;  3RKX A;  4WX9 A;  4CGZ A;  1ZGJ A;  1U8R A;  3TO7 A;  3Q9V A;  1HKS A;  4LFU A;  4HDU A;  3N97 A;  3MZY A;  1MKM A;  4HZF A;  2XAH A;  2FRH A;  1U6G A;  3TO9 A;  3ERE D;  2ZME A;  5HDK A;  3Q9S A;  3COA C;  2JRT A;  3HSF A;  1YQA A;  1IN5 A;  4HQE A;  1WWX A;  5JHU A;  1YG2 A;  2H6C A;  1E17 A;  1TNT A;  1BJA A;  2EFQ A;  3FM5 A;  2LKP A;  4HLY A;  4I01 A;  3R0A A;  1FYK A;  4NQW A;  5CLS A;  2A61 A;  3J7A O;  2M30 A;  2R7F A;  1TW2 A;  2MLK A;  1XMK A;  4G8X A;  2VBY A;  1H9G A;  4HW0 A;  2CFX A;  3B73 A;  2A68 F;  3VOD A;  1ZG3 A;  3CUO A;  2J5O A;  2O61 A;  1OYY A;  1YW9 A;  5ILU A;  2ISZ A;  4P9U A;  3CDH A;  5TJJ A;  4Q48 A;  2EV0 A;  5F64 A;  3WTT C;  2FOK A;  2A6E F;  2CG4 A;  1B9N A;  3QRF F;  6PAX A;  3KFW X;  2Q8K A;  3BWG A;  2NNN A;  2QUF A;  3PFI A;  2EFW A;  1QBJ A;  1BOA A;  4RB0 A;  2EV6 A;  4I0A A;  4AIH A;  4KUM A;  3F23 A;  5H20 A;  1OKR A;  5FB2 A;  3R61 A;  5A2Q K;  5DV5 A;  1XCV A;  3K1N A;  2ZJ2 A;  1OYI A;  2Q0O A;  5CVI A;  3EET A;  1K7A A;  2GXG A;  1CGP A;  3IWF A;  5DCM B;  3KE2 A;  4RB3 C;  2AXL A;  4A5M A;  2MC3 A;  3SZT A;  3GXO A;  2HKO A;  2Q2E A;  4EM1 A;  2L54 A;  1W7P A;  2FQ3 A;  1WI9 A;  3EUH A;  2JT1 A;  2ZFW A;  4RAZ A;  3Q5F A;  2M1B A;  2HTJ A;  1KYW A;  4LG0 A;  2H09 A;  3V8J A;  2A69 F;  1P2F A;  4ON0 A;  4GYI A;  1X3U A;  2P7C B;  2ETH A;  3L00 A;  1RUN A;  5D6E A;  1D8J A;  2YX7 A;  2RGV A;  3E6M A;  3QOP A;  4H0E A;  3DFG A;  4JQF A;  4GYG A;  2KIM A;  2YX4 A;  2RKH A;  3VFZ A;  3WTW C;  1P4A A;  4M6X A;  3WU0 A;  4U0Y A;  2EFP A;  1D8K A;  1BIB A;  4OOI A;  1RNL A;  2FSW A;  2GAU A;  2K4B A;  2K4J A;  3LQR A;  4UVB A;  5BPD A;  3GWZ A;  3F21 A;  5D4S A;  3L7W A;  5ED4 A;  3SHF A;  3BP8 A;  1K6O A;  4A0Z A;  1A04 A;  3ECH A;  1LDJ A;  4EMS A;  5IT3 A;  3ABT A;  1UCR A;  2ESH A;  1U3E M;  4I7H A;  4L9V A;  2NYX A;  4CXF A;  5FLX K;  2YR2 A;  3ZMS A;  2DT5 A;  1SD4 A;  4RGS A;  1P92 A;  1XCB A;  1RUO A;  3F72 A;  5DCF A;  2ZO4 A;  1F5T A;  4MGR A;  4OIP F;  3KP4 A;  2OBP A;  2FNA A;  4UVC A;  1QNT A;  3NRV A;  5HLG A;  1U78 A;  3LST A;  1SD6 A;  1R36 A;  3MCZ A;  2VC0 A;  1IRF A;  1IXR C;  2IRF G;  2Z9O A;  3BRO A;  3FZV A;  1H9T A;  2IP2 A;  4G94 A;  4O6J A;  4XLP F;  3MFK A;  2K86 A;  1EV7 A;  4LK1 F;  3V7S A;  3HOT A;  4A12 A;  2H6B A;  2IJL A;  3T5X A;  3DP7 A;  2L01 A;  3HSR A;  1BBY A;  1S7O A;  4BXU A;  5CVR A;  4EVI A;  3GF2 A;  4S04 A;  1KQ0 A;  3QU6 A;  3L2C A;  2ZNZ A;  2VE8 A;  3LA3 A;  3TGN A;  3S2W A;  1ZRF A;  3I54 A;  3HSE A;  4G7Z F;  1YO5 C;  1BI2 A;  2YPR A;  1EH6 A;  4HV5 A;  4TV7 A;  2PLY A;  4U0V A;  4KA4 A;  4HF2 A;  1FT9 A;  3RKW A;  1WRJ A;  3DPT A;  2RDP A;  5ICC A;  3LA2 A;  2M87 A;  2E7X A;  5LLQ A;  5LHH A;  5J8F A;  3R4K A;  4ZZL A;  3J80 Z;  4LMY A;  2E7W A;  4M72 A;  3M8F A;  5BS6 A;  4HF0 A;  4FX0 A;  2OZU A;  4IVN A;  4KIB A;  5F6F A;  4HOB A;  4ENN A;  2QLZ A;  1FPQ A;  4PGG A;  3V8L A;  2XAG A;  4LD5 A;  2L02 A;  1YLF A;  1G3W A;  2ZCW A;  4M9S A;  4A2U A;  3R60 A;  3RDI A;  1LNW A;  1W7P D;  3QU3 A;  1RIO H;  1U5T B;  5HS9 A;  4ZH4 F;  3FMQ A;  5D5X B;  2X0L A;  3TKY A;  2OZ6 A;  3I71 A;  1G3T A;  3HOS A;  5F1R A;  4R8H A;  3J81 Z;  4L9T A;  4CYD A;  3WTU C;  2UXN A;  3KP2 A;  1W5S A;  2HZT A;  2HWV A;  1USS A;  1SFE A;  5D5V B;  4KN4 X;  4IRI A;  5E17 F;  4EQQ A;  5LEK A;  1ZAO A;  1XGS A;  5D4R A;  2F5F A;  1BC7 C;  2XIG A;  2VT2 A;  5K5Q A;  3FF5 A;  1P4W A;  1IXC A;  1DDN A;  4K2E A;  4G6D A;  2Z5U A;  3IKV A;  4P5O A;  1XGO A;  4FHT A;  5BMZ A;  2GQQ A;  2MLG A;  4ZYD A;  2DW4 A;  4BAY A;  2R7D A;  3V7R A;  2XKO A;  1KU9 A;  1SMT A;  1Y0U A;  1YW7 A;  4ZZD A;  3ABU A;  3WOD F;  1SFU A;  1SMY F;  2V79 A;  1ZH5 A;  5E1X A;  2EA4 A;  2BV6 A;  5AON A;  3LWF A;  1FBU A;  3J80 K;  2EB7 A;  3IWZ A;  3REO A;  1MJ9 A;  4Q47 A;  4UV9 A;  1RZ4 A;  1JGS A;  2XRO A;  1S29 A;  3I5U A;  2QZ8 A;  5J6X A;  3E5U A;  4OIO F;  4WXD A;  1K78 B;  2BEO A;  4GGG A;  2A6H F;  4A6E A;  1SFX A;  4DNC A;  4U7D A;  2DK8 A;  1EH7 A;  3GFL A;  2M8E A;  2FU4 A;  3GUD A;  2COM A;  2QBY B;  2HEO A;  2F5E A;  1SD7 A;  3TOB A;  3GW2 A;  3J81 K;  2L3D A;  4YIF A;  5L3G A;  4KFC A;  4G7H F;  3B02 A;  2STW A;  5FO5 A;  4BHC A;  1E2X A;  1HBX G;  4ZYH A;  1ZAR A;  1AWC A;  3MZH A;  2YU3 A;  2OQG A;  3RKY A;  4IHT A;  1HSJ A;  4AD9 A;  2ESN A;  1F4K A;  2CSO A;  1JXS A;  3QPH A;  4EM0 B;  4ENJ A;  2HDC A;  3C1D A;  4KMF A;  4A5N A;  3HTS B;  1YYV A;  2LDU A;  3BPV A;  3K69 A;  3F8F A;  2VOO A;  4YG2 F;  3F22 A;  4KNY A;  4BYY A;  3N4M A;  1O7L A;  3KEO A;  4LK0 F;  1DPU A;  5DD4 A;  2IPQ X;  2Z3Y A;  4EJV A;  4WCG A;  3P7N A;  2KJC A;  5EEH A;  3M9A A;  1R22 A;  2XAJ A;  2MA3 A;  3FXR A;  2Y75 A;  3PQK A;  3WG9 A;  4ESB A;  1FBS A;  1UB9 A;  2JZY A;  2HYF A;  2ZKZ A;  3BZ6 A;  3IC7 A;  1K78 A;  3OV8 A;  1ODD A;  3RYP A;  2K27 A;  3WGI A;  1QZZ A;  2L4M A;  2MH2 A;  3CO6 C;  1W4M A;  3LFK A;  1ZN2 A;  2BYV E;  4EGY A;  3D5L A;  3LA7 A;  2P4W A;  4KIG A;  1IZ1 A;  2RC4 A;  3P9K A;  3G73 A;  3MAJ A;  1XN7 A;  2BE5 F;  5E1W A;  4P55 A;  1FZP B;  3RPQ A;  3KLN A;  5L3E A;  2FBI A;  4YFN F;  3SFZ A;  3KLO A;  3JTH A;  2WV0 A;  5HS8 A;  5L3D A;  1J0R A;  1JE8 A;  3E6C C;  3V8K A;  2OAZ A;  3C7J A;  2PEX A;  3ZMD A;  3RPU A;  1XGM A;  3I59 A;  4ESJ A;  1WQ2 A;  2JSC A;  2GA1 A;  1K79 A;  1STZ A;  3ULQ B;  2OD5 A;  4GCV A;  3E6B A;  4QLC U;  1YW8 A;  1Z1D A;  3QP6 A;  5A2Q Z;  3E5X A;  1YS6 A;  2UXX A;  5CVJ A;  4IRH A;  4L5I A;  4LB5 A;  3G3Z A;  2DPU A;  3H3U A;  1U2W A;  4XSX F;  2PFB A;  2F5C A;  1KYZ A;  1QGP A;  2IT0 A;  1R5G A;  4PCQ A;  4KDP A;  3W6J B;  5K5R A;  1WKM A;  2YSR A;  4UHT A;  2IA2 A;  2DAO A;  1HQC A;  4KMU X;  5LHI A;  4XSZ F;  2DQL A;  5E20 A;  4M74 A;  3BOQ A;  1ZLJ A;  1GVJ A;  1FYL A;  4UUV A;  1YTY A;  2VE9 A;  1Z05 A;  1JHF A;  4F7Z A;  2VOP A;  1B9M A;  2Z33 A;  2QBY A;  1LQ1 A;  3ISP A;  3QPT A;  3V4G A;  1Z91 A;  1F1Z A;  2HYG D;  2NAZ A;  2XKP A;  4IJA A;  5E8G A;  2ZBK A;  2ACJ A;  5FGM A;  1P6R A;  4EM2 A;  4M73 A;  1I6X A;  3I53 A;  1R1T A;  4IXA A;  3SXY A;  2A07 F;  3JSO A;  1HKT A;  5D6F A;  2CWE A;  4Z2Y A;  3PQJ A;  5FFZ A;  2VOD A;  3M1E A;  5LGN A;  3F6O A;  3FHZ A;  4DQ2 A;  2H94 A;  3H3Z A;  3KZZ A;  1TTY A;  3BJ6 A;  2VBW A;  3ROU A;  3GX4 X;  1IN7 A;  1TLH B;  3WGH A;  3F8B A;  3U1D A;  2W24 A;  1T39 A;  4OIN F;  4A0Y A;  1Z7U A;  2IVM A;  4S05 A;  4CO8 A;  2M45 A;  2K02 A;  3E3V A;  3HYI A;  2ISY A;  1IN4 A;  1HW5 A;  1V4R A;  4AIJ A;  3IRR A;  2CQK A;  1SD5 A;  2W84 A;  1FP2 A;  2P7V B;  4PGH A;  3GYH X;  2PBI A;  2IW5 A;  1BC8 C;  1B59 A;  5HVQ C;  5CYV A;  2GIV A;  4CDG A;  2QQ9 A;  5LRR A;  3W6K B;  5D5U B;  4P9F A;  4HX7 A;  3SQN A;  2O03 A;  2ELH A;  2NNY A;  2VBX A;  1LDD A;  2L4A A;  3TDZ C;  1G6N A;  1S3J A;  2EK5 A;  2FBH A;  4G7O F;  1BIA A;  2D1H A;  5DCM A;  2FF4 A;  4CZZ A;  2PN6 A;  1J59 A;  2WTE A;  1ON2 A;  5KVR A;  1V3F A;  1QO0 D;  4WXH A;  1ON1 A;  4L18 B;  1BN5 A;  2W85 A;  1FWZ A;  5FD5 A;  5LRS A;  2V1X A;  3F6V A;  3GZ6 A;  3GO5 A;  4HF1 A;  2W57 A;  5DYM A;  1BI1 A;  1LB2 A;  1PP7 U;  1HXD A;  2XVC A;  1ZHF A;  4HLX A;  2HTS A;  3MQ0 A;  4N9H A;  2VC1 A;  1J75 A;  3D0S A;  4L9N A;  1DPR A;  2MH9 A;  2DPD A;  4U88 A;  1SAX A;  2LF7 A;  4UVA A;  1Z9C A;  1D5V A;  1UHW A;  5HDG A;  1O3T A;  4OIR F;  4HX4 A;  3EYY A;  3FMS A;  1ULY A;  2M5W A;  5FD6 A;  5DEQ A;  1R23 A;  4RS8 A;  1MDM B;  5ILV A;  2DK5 A;  3MEX A;  1IAW A;  4AWX B;  2EA2 A;  3GFM A;  3R6S A;  3FM3 A;  5D5W B;  1B6A A;  3HRU A;  2WWY A;  3KP5 A;  3RYR A;  1ZYR F;  2IA0 A;  1GXP A;  5H6R A;  3K2Z A;  5LHG A;  4Y17 A;  1VTN C;  4EJW A;  3HHH A;  5BOX A;  4P96 A;  3CUQ B;  4IRG A;  1NHA A;  1LVA A;  4LLG F;  2DI3 A;  2NRA C;  5LBQ A;  2G7U A;  3E6D A;  2DU9 A;  4RGR A;  5HLH A;  3WE2 A;  3JAM K;  3F3X A;  2MBF A;  3WU1 B;  4KIF A;  2QWW A;  2P8T A;  3CJN A;  1PP8 F;  5D8K B;  4RGU A;  1FYM A;  1UST A;  4R79 A;  1FNN A;  2VN2 A;  5DUI A;  1ZG5 A;  3BDD A;  2O6G E;  4M9Z A;  1GXQ A;  5BQT A;  4LGW A;  2B0L A;  1OPC A;  2K7L A;  2XV4 S;  1G3S A;  3U9G A;  4L5J A;  1RI7 A;  4D0P A;  2HQN A;  2RN7 A;  1ZGA A;  4LJZ F;  3L09 A;  3LAP A;  3F8C A;  4LLL A;  3HIF A;  4EJT A;  3GVA A;  4YFX F;  3BJA A;  2HQR A;  2EV5 A;  2XRN A;  2BGC A;  1U5T C;  1BM9 A;  1J2X A;  2PQ8 A;  5ICE A;  5LGU A;  4MHG A;  5LEJ A;  1MJB A;  3QAH A;  3GEZ A;  3WTZ A;  2DQR A;  1KA8 A;  1UFM A;  1IW7 F;  1QZY A;  1OYW A;  2O3F A;  5HLI A;  4Y13 A;  2VON A;  2FML A;  3DV8 A;  4LG0 B;  3K0L A;  3GLX A;  1XDU A;  1XSD A;  3ZN0 A;  2KJB A;  1IF1 A;  4LB6 B;  1TNS A;  1U5T A;  4ESF A;  1BI3 A;  5L3B A;  1DUX C;  2E1C A;  1S8N A;  3DXJ F;  3K9T A;  3TOA A;  3DF8 A;  3FXU A;  4NB5 A;  3CUQ C;  3HTU A;  5ICG A;  4N9I A;  2E1N A;  4RB2 C;  3HRT A;  4MQ9 F;  3BY6 A;  1XD7 A;  3I59 B;  2P6T A;  3M8E A;  1FOK A;  2JPB A;  2BBY A;  3AAF A;  2F2E A;  1O3R A;  4WXC A;  2XAQ A;  1PUE E;  5DD8 A;  4M6Y A;  5L3F A;  1KQ8 A;  5CVV A;  2C6Y A;  5AIQ A;  2OA4 A;  1DP7 P;  2PMH A;  1AOY A;  3DKW A;  5EEG A;  3JTG A;  1KGS A;  3KZY A;  5FFX A;  2X4H A;  2IA1 A;  2AS5 F;  3NQO A;  4U0W A;  1FY7 A;  4MTD A;  3KP6 A;  2OU2 A;  3OOP A;  4UNO A;  4E70 A;  5E18 F;  3TO6 A;  3LAJ A;  3HRS A;  1FX7 A;  3WTX C;  1HW1 A;  2DFI A;  3K1M A;  4MEY F;  1MDM A;  1MZB A;  2DBB A;  4MEX F;  1T6S A;  1H0M A;  4RGX A;  1T2K A;  3JW4 A;  1O3S A;  3E97 A;  4O5V A;  5DDG A;  4FX4 A;  2XGX A;  3HHG A;  4HYE A;  1PDN C;  5FLX Z;  2EFO A;  4Q5S F;  3ZP5 A;  3CTA A;  3RJP A;  3HUG A;  2KKO A;  4MNU A;  2HOE A;  2RVC A;  3TDU C;  3H92 A;  3VB2 A;  1FSE A; 
#chains in the Genus database with same CATH topology
 4PUS A;  1LVK A;  5F04 A;  2L0K A;  3K4N A;  2FNP A;  1EA3 A;  1PYV A;  4ASN A;  5K5O A;  3ZQL A;  4ZYA A;  4M3G A;  5E8I A;  4NHJ A;  2V6C A;  5BPI A;  2M9H A;  2ZJQ F;  2F4O B;  2MYS A;  2QQ8 A;  4X6A J;  4HNT A;  4JYK A;  3RIR A;  5EGO A;  3T0Y A;  4IF4 A;  3OYB A;  2L9S A;  2J5P A;  2GZW A;  2ZME B;  2FBK A;  1JKP C;  3RTR A;  1IN6 A;  1V5E A;  1MND A;  3I4M J;  5E1Z B;  2R3S A;  1TWA J;  1R1V A;  3GZ5 A;  1HCR A;  1T0F A;  1L0O C;  5KCM A;  5KK1 A;  4CSW A;  1U9N A;  1XSX A;  3GTG J;  1V5F A;  1FP1 D;  1HA8 A;  1KU2 A;  1X1B A;  4KIC A;  1T08 B;  2FQ4 A;  3VPR A;  5C4J J;  3JRH A;  3ESW B;  3HRM A;  2O8X A;  3LFU A;  4U7B A;  2DA2 A;  3KET A;  4G9Y A;  1XMA A;  3BTJ A;  1B1B A;  3VYT B;  3LSK A;  4A3D J;  1N75 A;  4A6D A;  3NEU A;  4C2M J;  4OMY A;  2P6S A;  4PZJ A;  2P5L C;  2K9Q A;  4KIT B;  4DYQ A;  2EFN A;  1E3H A;  3RKQ A;  2BOL A;  1ONV A;  5ERI A;  3T8R A;  1G8X A;  3V7C A;  2ELK A;  5EDN A;  1YJW I;  2M3A A;  2LOO A;  2VAS A;  2F4I A;  2UZK A;  4A0X A;  4JX5 A;  2HKX A;  2HGC A;  5HS7 A;  2H1K A;  4IHX A;  4KYW A;  2GBY A;  3P9I A;  4BQA A;  2QVO A;  2KIF A;  3ECO A;  4ZC3 A;  2PG4 A;  1R4M B;  1R5I D;  4IHS A;  4PJN A;  2VI6 A;  2LYC A;  3C3W A;  1ERD A;  1Z6T A;  2GOM A;  3A0B C;  1B4A A;  2E71 A;  2HYJ A;  4OU0 A;  1OMI A;  3KP3 A;  1FC3 A;  3QOD A;  1BI0 A;  1FIP A;  1OCZ H;  5CJ9 A;  4A3I J;  4HRI A;  1YFH A;  3SZP A;  4I09 A;  1S72 I;  1R5H A;  2A05 A;  3G2B A;  3IV5 A;  1L3L A;  1P4X A;  1G3Y A;  3FXQ A;  1YJN I;  4S0H B;  1R58 A;  2CO5 A;  5E3O A;  4ITV A;  3ZN1 A;  1CF7 A;  4LLN A;  3LSI A;  3PNV A;  3IRQ A;  1TL8 A;  2XAF A;  2CQQ A;  3D5S C;  3A2K A;  4UUS A;  3PIP F;  1R7J A;  5HOO A;  2DFE A;  3I64 A;  4F55 A;  4PDK A;  1FBQ A;  1V5G A;  1JUS A;  1VZ0 A;  2LTP A;  2VJI A;  4G6Q A;  4ZYE A;  4BGD A;  4CYC A;  3VDX A;  1O57 A;  3ZQQ A;  4WF2 A;  1ETW A;  5IPA A;  3F8N A;  2WA0 A;  1I6H J;  3S3O A;  1RR7 A;  3W6V A;  4C2T A;  1E3O C;  1NG7 A;  3HBL A;  5E3N A;  4BL0 B;  1JHH A;  3HOV J;  3B6C A;  3H5N A;  3ZQ7 A;  2G9W A;  1IUY A;  4MTE A;  1XB4 A;  5E3M A;  1JT6 A;  3IAM 2;  1R1U A;  4WK8 F;  3FMR A;  3SZG A;  4EJU A;  1C0W A;  1KQ9 A;  3KYD B;  4RAF A;  3L9F A;  3CQZ J;  3S93 A;  2MC4 A;  5E3L A;  1FSH A;  1ETY A;  4QTR A;  1Z3X A;  1M1E B;  4E7H A;  2A5Y B;  3ELK A;  4ENK A;  1AHD P;  3RZD J;  2FA5 A;  2CYY A;  2BZT A;  1R00 A;  4UXN A;  1J5Y A;  5DS9 A;  3WTS C;  1LEA A;  4L0Z B;  1D3Y A;  2KIU A;  4MQV A;  3CDI A;  4EAT A;  5AIP A;  2GA2 A;  3K2A A;  3K1P A;  4RDU A;  1GHC A;  3K4J A;  3PO3 J;  4XKB A;  3ZXS A;  1AKH B;  4C3H J;  1J7K A;  4EJO A;  1R9T J;  1OQY A;  3IHU A;  3E5Q A;  2E36 A;  2DLL A;  2RNJ A;  2VXZ A;  3QYF A;  2DYS H;  2KFD A;  4M3B A;  5DM6 F;  2QEN A;  3VWB A;  4E7J A;  5ICF A;  3U2R A;  1WJD A;  1TBX A;  2UWM A;  3ZPL A;  4RM2 A;  2DN0 A;  4YFK F;  4BE2 A;  2W25 A;  2CQN A;  4RAY A;  2STT A;  5JR3 A;  5IT9 Z;  5L3C A;  3IL2 A;  4CHU A;  2H27 A;  2DTZ A;  4FT8 A;  4BE0 A;  2Z99 A;  2E35 A;  2PJP A;  2EWN A;  3S14 J;  4RB1 A;  1ZKG A;  2R7T A;  2LG4 A;  4A3E J;  2G7H A;  1MGT A;  4O3M A;  2AQE A;  2LSO A;  4I02 A;  3OIQ A;  5DUK A;  4CIC A;  5FKO A;  1KZH A;  1CQT A;  2HR3 A;  3GTQ J;  2HFH A;  1YIT I;  1Z7L A;  4G12 A;  1PJR A;  2D1V A;  3CZ6 A;  4HA8 A;  3HKZ N;  2OC6 A;  1HST A;  3JRD A;  5K1Y A;  4OMZ A;  4ZTJ A;  4OIQ F;  3O6B B;  4WWC A;  1O7F A;  3DPL C;  4UV8 A;  4M9X A;  4JK1 X;  1E0E A;  3I56 I;  3VEP A;  1I27 A;  4PJ0 C;  3VYU B;  3GTJ J;  2DTR A;  3CP8 A;  4BNC A;  4AIK A;  1IG7 A;  4I2O A;  3FKJ A;  3K4C A;  4EGZ A;  3H5R A;  4Y4R A;  2XUB A;  3VOE A;  1QZE A;  3O8G A;  3KYC B;  5K7Z A;  4W97 A;  1CF7 B;  2R5Y B;  4IHY A;  4AM3 A;  1WJB A;  2Y0M A;  1OCT C;  2LVS A;  3ZMU A;  1KU7 A;  2HS5 A;  3WTV C;  2RQQ A;  2RV8 A;  2QCO A;  2E19 A;  3QPL A;  2R7W A;  3LSR A;  1XDS A;  3FWE A;  1X2N A;  3EDP A;  4HV6 A;  4C3I J;  2FOW A;  3R0J A;  2P5V A;  2RAE A;  1S6L A;  1RC9 A;  4Y15 A;  3Q3S A;  3PL8 A;  1ZG1 A;  3C2H A;  2GXB A;  2O0Y A;  5FLM J;  5ILS A;  1QA6 A;  1I1S A;  3I0T A;  3FK6 A;  3CJQ B;  3WU2 C;  1PVE A;  2KRF A;  4ENM A;  3ML6 A;  1NH3 A;  2DMP A;  1XSV A;  1VI0 A;  2X6X A;  3GFJ A;  3DQV C;  1YIO A;  4DZJ A;  2DO7 A;  3FX3 A;  2RQP A;  2WC2 A;  3JRB A;  3EYI A;  3FIS A;  4RMN A;  4GXO A;  1LDK B;  1JKR C;  1QPM A;  2Y48 A;  2XAS A;  4HQM A;  4L9J A;  4BHP A;  1Q1H A;  2LNB A;  1DGR M;  2TDX A;  4IQ4 A;  3TQN A;  4EV0 A;  3O2P E;  2KIQ A;  1Z6R A;  3BG9 A;  2IS4 A;  2CW0 F;  1MMN A;  1SVM A;  3KYL A;  2CGP A;  2XGD A;  3QQA A;  4RA2 A;  4QIW N;  4JX4 A;  5D8L B;  3CLO A;  2P5K A;  4PFP A;  2JVH A;  2FMY A;  2NS0 A;  4E7K A;  4M71 A;  5TRD A;  2K9N A;  4N0B A;  3BZC A;  1ZRC A;  5HDN A;  3RI4 A;  2W7N A;  1Y39 A;  1FLI A;  2Y2Z A;  2QSF X;  5JVT A;  3FBI B;  1VQ5 I;  4ETS A;  2JUG A;  1X1D A;  3VYR B;  4JBA A;  3MWM A;  3PNY A;  2OTJ I;  4YII A;  1HKQ A;  1HF0 A;  1XGN A;  2H8R A;  2PI0 A;  4IHV A;  1O4X A;  1TW3 A;  3CP2 A;  5H6Q A;  1GV5 A;  2IGM A;  3KCC A;  2ME6 A;  1I5Z A;  3O3K A;  3LQQ A;  2ZXJ A;  4CCL A;  2HI3 A;  3CES A;  3BTL A;  2VT3 A;  3KPH A;  1W36 C;  2IS6 A;  3GTO J;  5BNG A;  2JVG A;  3U1K A;  2EZK A;  4I0B A;  4W1U A;  5CVU A;  2A3S A;  1S5L C;  3M7G A;  3BTI A;  1IXS B;  4HAM A;  3OYE A;  2Y69 H;  3ZMT A;  3HM5 A;  2X1C A;  4I98 B;  3KIO A;  3C18 A;  4AVP A;  4BH9 A;  4XON A;  5JI6 A;  2DFH A;  4MO7 A;  2ADU A;  2V1N A;  5J3L A;  2OQR A;  4PJJ A;  1W0U A;  2V1D A;  4KN7 X;  3AG3 H;  1T38 A;  5LGT A;  1NK2 P;  3I4N J;  2LK2 A;  2QM3 A;  4R1H A;  1I39 A;  2LF8 A;  3IKT A;  1VQ4 I;  5IT9 K;  2YU9 J;  3BC8 A;  4IPA A;  1X19 A;  3CMA I;  2F5D A;  2ZSI B;  2BY1 A;  1MJA A;  4GO1 A;  2PMU A;  2E2H J;  3BR6 A;  2ZXW H;  1ZRD A;  3CUQ A;  3KEQ A;  4AVZ A;  1WH7 A;  1RKT A;  3WE3 A;  1FJL A;  1SVL A;  3JSP A;  2GWR A;  4UB6 C;  2V4J C;  2V1U A;  1Z3Y A;  2DT6 A;  2VKD A;  1UEL B;  1G4D A;  4HBL A;  3EQL F;  4M3D A;  2FE3 A;  1N25 A;  1JJ6 C;  1IDY A;  2QYO A;  3BPX A;  3I4P A;  3K70 C;  3OSF A;  3J7Y J;  3DEU A;  4DBQ A;  2K5C A;  3I58 A;  2BVL A;  4L0Y B;  2ZNY A;  2D45 A;  3WGG A;  1QU3 A;  4A3M J;  2LD5 A;  1ZRE A;  5KAF C;  2V9V A;  1LPQ A;  1MMS A;  1YE9 A;  1LEB A;  2QQB A;  5GTH C;  1F9N A;  4MFD A;  2CUJ A;  2OPT A;  3WTY C;  3F8M A;  5LFA A;  4KT5 C;  1ZLK A;  1TQM A;  2AXT C;  3P9C A;  3L2W A;  1APL C;  1POG A;  5C4X J;  1S7A A;  3QPS A;  4Q4Z F;  1YS7 A;  1EJ9 A;  2QQA A;  2GLO A;  2LKX A;  3JAM Z;  2D5V A;  1IUF A;  4XNF A;  3DTK A;  2ZC2 A;  5FKN A;  4XBF A;  3FXJ A;  4LIU A;  4V19 K;  1A6Q A;  1W7P B;  2HXI A;  1X58 A;  1REP C;  1KU3 A;  3JRA A;  1OR7 A;  3BJO A;  3D1N I;  1TQI A;  2HOS A;  4XLN F;  2X6Y A;  3OS1 A;  4BKX A;  3K7A J;  1EH8 A;  3PUF A;  4IOC F;  2EJR A;  2JK3 A;  3ZMZ A;  1OCR H;  2Y30 A;  2VBZ A;  1T56 A;  2LKS A;  4B09 A;  1I1G A;  1W36 D;  2XPW A;  1IRG A;  5J8C A;  1MD0 A;  4QWQ A;  5JFR A;  1T98 A;  1UG0 A;  1WSU A;  3VSK A;  2FEZ A;  4NBQ A;  3LSG A;  3A1Y A;  1HW2 A;  2XHK A;  2D2W A;  3CO7 C;  1QQI A;  1LJ9 A;  3GFI A;  3GZN B;  1W5T A;  3KP7 A;  4BHB A;  1MSF C;  1IN8 A;  3QP5 A;  1AA7 A;  4LG3 A;  1UHM A;  3T1B A;  3T8T A;  1ACI A;  4ABZ A;  1J9I A;  1TQP A;  5CPR B;  1K4S A;  3M4O J;  2WB1 N;  2ECC A;  2X1D A;  2JJ7 A;  3ZMV A;  1YRN A;  2IBD A;  3CCL I;  3CCS I;  4XRF A;  4CUG A;  1JI8 A;  1X4O A;  2MD5 A;  2KQR A;  4B8X A;  1ZTR A;  2JPC A;  4HX8 A;  3HXL A;  2R7Q A;  1BR4 A;  4ZYG A;  4HDV A;  2FXA A;  1W1W E;  1O3Q A;  2JTV A;  3RKX A;  3MKY B;  5EG0 B;  4WX9 A;  4CGZ A;  1ZGJ A;  1U8R A;  1WJ5 A;  1IGN A;  1Y8R B;  3TO7 A;  2HZD A;  4HSR A;  1U8B A;  3Q9V A;  1OFC X;  1HKS A;  4J00 A;  4LFU A;  3WHC A;  4HDU A;  1V54 H;  3N97 A;  3HGG A;  3MZY A;  1MKM A;  5J47 A;  3JRE A;  4BE1 A;  1B72 B;  1OCO H;  4HZF A;  2IXS A;  2XAH A;  2FRH A;  1U6G A;  3TO9 A;  5EZG A;  5EGO B;  3ERE D;  2GM4 A;  1RR8 C;  4BAC A;  2KIS A;  2ZME A;  5HDK A;  3Q9S A;  4NC7 A;  1WCM J;  3COA C;  2JRT A;  1SFO J;  3HSF A;  1YQA A;  2YUS A;  3K4K A;  1IN5 A;  4HQE A;  3AKZ A;  1WWX A;  2VL8 A;  2ZME C;  5JHU A;  4BEH A;  5CQE A;  1YG2 A;  2H6C A;  1E17 A;  2QSH X;  1TNT A;  1PUF B;  1BJA A;  4F92 B;  2EFQ A;  3FM5 A;  2MD0 A;  3G6E I;  2LKP A;  1MNM C;  4HLY A;  2ZJP F;  2IS2 A;  2NVY J;  4ZDO A;  4I01 A;  3K4B A;  3KEY A;  3R0A A;  1FYK A;  1BW5 A;  1WPK A;  2DA6 A;  2KLO A;  4NQW A;  5CLS A;  2A61 A;  3J7A O;  2M30 A;  2R7F A;  1DU6 A;  1MBF A;  3DEW A;  3AG2 H;  2HQ5 A;  1TW2 A;  2MLK A;  1XMK A;  1WJA A;  4G8X A;  4HG2 A;  2VBY A;  1DQU A;  1FOX A;  1H9G A;  1WJE A;  4HW0 A;  1B8I A;  3L2Q A;  2CFX A;  3B73 A;  2A68 F;  3FDY A;  1ZR2 A;  4XID A;  3MZ8 A;  3VOD A;  4B44 A;  2BY2 A;  1ZG3 A;  3CUO A;  2J5O A;  2O61 A;  1EKE A;  5M5X J;  2KPM A;  3ZQG A;  1OYY A;  1YW9 A;  2Q1Z B;  5ILU A;  1D0X A;  5C3E J;  2NOJ B;  5EEA A;  3L2R A;  2ISZ A;  4P9U A;  3CDH A;  1WJC A;  2VIX A;  5TJJ A;  4Q48 A;  2EV0 A;  4MFE A;  4KIS A;  5F64 A;  3WTT C;  2FOK A;  2A6E F;  2CV1 A;  3BQY A;  3CJR B;  2CG4 A;  3DBH B;  4I6Z A;  4DOZ A;  1B9N A;  3QRF F;  6PAX A;  2EBI A;  3KFW X;  2Q8K A;  3BWG A;  2NNN A;  2QUF A;  1IDZ A;  3FXL A;  3PFI A;  3Q0W A;  4XQF A;  1BOA A;  2EFW A;  2E60 A;  2EV6 A;  4RB0 A;  1QBJ A;  3AL0 B;  4I0A A;  1ZQ3 P;  3A01 B;  4AIH A;  4CCM A;  3HOU J;  3AG4 H;  1MIJ A;  4KUM A;  1JT0 A;  2CH0 A;  1FIA A;  3GBG A;  3F23 A;  5M3F J;  3CCM I;  5H20 A;  3GTM J;  3FHN A;  1Z67 A;  1OKR A;  2QKL B;  5FB2 A;  2BVM A;  2HPM A;  3R61 A;  5A2Q K;  1I50 J;  3A0H C;  1VQM I;  2ICW G;  5DV5 A;  2R7U A;  1XCV A;  1Y8Q B;  2KRC A;  3K1N A;  2ZJ2 A;  5CQG A;  3S1R J;  4KJZ A;  4PSW A;  2DMQ A;  1OYI A;  2Q0O A;  3Q0V A;  5CVI A;  3EET A;  1K7A A;  2GXG A;  1CGP A;  3IWF A;  5DCM B;  5F0C A;  5GAE J;  3M3Y J;  3KE2 A;  4RB3 C;  3S15 J;  5JLX A;  2EZL A;  2B9S A;  2DT7 B;  5J1U A;  2AXL A;  4E7Z A;  4A5M A;  2LH9 A;  2MC3 A;  3SZT A;  3P5J A;  2XB0 X;  3GXO A;  2HKO A;  5IOZ A;  2Q2E A;  4NC8 A;  2L54 A;  3SEQ A;  4EM1 A;  2NOG A;  2Z1D A;  4ZTF A;  1W7P A;  3JRC A;  2FQ3 A;  5HNH A;  1WI9 A;  3EUH A;  2DMT A;  2JT1 A;  3I9V 2;  3BR1 A;  2ZFW A;  4RAZ A;  4X0G A;  3LNQ A;  3Q5F A;  2M1B A;  2R4G A;  1P7J A;  2HTJ A;  2WAD A;  1KYW A;  4LG0 A;  2H09 A;  3V8J A;  2A69 F;  1P2F A;  2XGC A;  4ON0 A;  4GYI A;  1X3U A;  1OJL A;  2COB A;  2P7C B;  2ETH A;  3L00 A;  1RUN A;  5D6E A;  1D8J A;  2YX7 A;  2RGV A;  3E6M A;  2LRD A;  2EH3 A;  5GTI C;  5IYC J;  2OCE A;  4XIC A;  3QOP A;  3SDG A;  4H0E A;  3DFG A;  4JQF A;  4OAZ A;  4GYG A;  2KIM A;  4BY1 J;  2YX4 A;  5DTD A;  2RKH A;  2R92 J;  2KMU A;  3VFZ A;  3BCB A;  3WTW C;  1P9Q C;  1P4A A;  4M6X A;  2XGE A;  3BLY A;  3WU0 A;  3QWL A;  5HNF A;  1XTA A;  1Q1V A;  4U0Y A;  4XRS A;  2EFP A;  5FRM A;  2XF6 A;  4AC0 A;  1D8K A;  1BIB A;  1HOM A;  4OOI A;  1Z0X A;  1VQ6 I;  1FOY A;  4LOC A;  4F3Q A;  1RNL A;  2DOA A;  2IGO A;  2FSW A;  2HDD A;  2GAU A;  2K4B A;  3ABM H;  3IH3 A;  1K6Y A;  2K4J A;  3LQR A;  4UVB A;  5BPD A;  3GWZ A;  4II2 A;  3F21 A;  1ZR4 A;  1IJW C;  5D4S A;  3ONQ A;  3LSJ A;  3L7W A;  1BJZ A;  4E4H A;  3SHF A;  3BP8 A;  5ED4 A;  1K6O A;  4A0Z A;  2CUE A;  1X4P A;  2GOX B;  2E5Z A;  1A04 A;  3ECH A;  1LDJ A;  4EMS A;  2ZFU A;  5IT3 A;  5B5E C;  3ABT A;  1UCR A;  2ESH A;  1W5C C;  1U3E M;  3FK7 A;  4I7H A;  1WJF A;  3H36 A;  4L9V A;  2NYX A;  4CXF A;  1BA5 A;  5FLX K;  2YR2 A;  3ZMS A;  2DT5 A;  1SD4 A;  3Q0U A;  4RGS A;  1P92 A;  2XF7 A;  1XCB A;  2E2J J;  1RUO A;  4YEJ A;  3F72 A;  4BDY A;  4J19 A;  3OSG A;  3HZJ A;  5DCF A;  1IRX A;  2ZO4 A;  3NWT A;  2ZJR F;  1F5T A;  4MGR A;  4OIP F;  2HNH A;  3KP4 A;  4AYB A;  2OBP A;  2WBM A;  2FNA A;  5IP9 J;  4UVC A;  1QNT A;  3NRV A;  3H5A A;  2M2E A;  3LSM A;  5HLG A;  2M4K A;  5K7F A;  5E79 C;  1U78 A;  3LST A;  2Y0S N;  5F0H A;  1SD6 A;  2DMN A;  1R36 A;  4BBS J;  3MCZ A;  1FTZ A;  2VC0 A;  2F6C A;  2XC7 A;  4DBR A;  1IRF A;  2OCC H;  3HPG A;  1IXR C;  2MFZ A;  2IRF G;  2Z9O A;  3BRO A;  3FZV A;  1H9T A;  3QYB A;  2IP2 A;  4G94 A;  4O6J A;  4XLP F;  3MFK A;  2K86 A;  1EV7 A;  3S32 A;  4B43 A;  4OWR B;  4LK1 F;  3V7S A;  3HOT A;  1WFX A;  4A12 A;  2H6B A;  2IJL A;  1ENH A;  5CKT A;  3CDL A;  3T5X A;  4C30 A;  3DP7 A;  2L01 A;  3HSR A;  3CC4 I;  2ZXI A;  5F0F A;  1BBY A;  4XKC A;  1S7O A;  5KAI C;  4BXU A;  3MKL A;  4UUS B;  5J1R A;  4FE4 A;  3L2V A;  5CVR A;  4B3A A;  1Y1V J;  2GIZ A;  2BW3 A;  3BT9 A;  2LBF A;  4FIS A;  4FAS D;  4XOR A;  3GF2 A;  4EVI A;  4S04 A;  1KQ0 A;  3QU6 A;  4NQW B;  3L2C A;  2V9K A;  1MMA A;  1LUJ B;  3MD2 A;  2ZNZ A;  2VE8 A;  3HGY A;  3LA3 A;  3OYJ A;  1LFP A;  1XG1 A;  3TGN A;  2EIK H;  3S2W A;  2HQA A;  3HOX J;  2X48 A;  3CLQ A;  3I54 A;  3HSE A;  3CCE I;  1ZRF A;  4G7Z F;  1YO5 C;  1BI2 A;  2YPR A;  2IGK A;  1EH6 A;  1AKH A;  1BR1 A;  3BZK A;  3MVP A;  4HV5 A;  3HDD A;  4TV7 A;  4XM3 A;  2PLY A;  4U0V A;  2DA3 A;  2DMU A;  4KA4 A;  2BY3 A;  5M3M J;  1GVD A;  4HF2 A;  1FT9 A;  2Y31 A;  4FQG A;  4XOT A;  1QVT A;  3RKW A;  1WRJ A;  2R5Z B;  3DPT A;  3UR3 C;  3DPU A;  2MSY A;  2RDP A;  2A6T A;  4RLQ A;  3JR9 A;  5ICC A;  3LA2 A;  2I10 A;  2M87 A;  1JTX A;  4B4C A;  2E7X A;  5LLQ A;  5LHH A;  5J8F A;  3R4K A;  4MIM A;  4ZZL A;  3J80 Z;  3DTI A;  2LBF B;  2CS3 A;  4LMY A;  4I76 A;  5IOY A;  2E7W A;  3OMY A;  4M72 A;  2JRM A;  3M8F A;  2VXD A;  5BS6 A;  1JKQ C;  3S16 J;  2ZB9 A;  1WI3 A;  2AO9 A;  3OR1 C;  5LD2 C;  1ITY A;  4IEJ A;  2DDB A;  4HF0 A;  4FX0 A;  1TT0 A;  2OZU A;  3MKW B;  4IVN A;  4KIB A;  3ZQF A;  5F6F A;  4HOB A;  2PX9 A;  1UG2 A;  4HST A;  4ENN A;  2QLZ A;  1U0J A;  4N4O B;  1X1P A;  1FPQ A;  2FD5 A;  3H0D A;  3NAR A;  1IO2 A;  3M07 A;  3CC2 I;  1RET A;  1FTT A;  5J4Y A;  3H9Q A;  4PGG A;  2XAG A;  4LD5 A;  3V8L A;  4AUX A;  2L02 A;  3CCY A;  1YLF A;  1D0Y A;  2QEX I;  3EUH C;  1G3W A;  5FRN A;  5IP6 A;  1XC5 A;  2ZCW A;  1Y1W J;  4M9S A;  3A02 A;  4A2U A;  3EPZ A;  3R60 A;  3RDI A;  2JA7 J;  1LNW A;  1TZL A;  2L5Q A;  2DA5 A;  3BG3 A;  4Y3O A;  2KHM A;  2R7R A;  1H89 C;  3W2W A;  1W7P D;  1T0F C;  1ETQ A;  3QU3 A;  1J09 A;  1RIO H;  1U5T B;  1ETX A;  3CC7 I;  1VND A;  5JVG F;  1VQL I;  3SDB A;  5HS9 A;  4U87 A;  4A3J J;  4ZH4 F;  3K6G A;  4JX6 A;  1UAA A;  1RES A;  3FMQ A;  2M34 A;  2LLK A;  5D5X B;  2X0L A;  3TKY A;  2OZ6 A;  2EIL H;  2DOF A;  3I71 A;  1G3T A;  3HOS A;  5F1R A;  4R8H A;  3J81 Z;  4L9T A;  4CYD A;  1RPW A;  4FET A;  3S3N A;  3PO2 J;  2NS8 A;  3WTU C;  4XKW A;  2UXN A;  3KP2 A;  2DXI A;  1SAN A;  1W5S A;  2JN6 A;  2CUF A;  5C44 J;  3H9J A;  4XKV A;  2HZT A;  4IX7 A;  3FBN B;  3LSP A;  1VQ8 I;  2HWV A;  4V2F A;  3RZO J;  1USS A;  1SFE A;  5D5V B;  4KN4 X;  1HC8 A;  2W82 A;  4IRI A;  5E17 F;  4EQQ A;  5LEK A;  3FXO A;  3E1S A;  1ZAO A;  3OYG A;  1XGS A;  1ZEL A;  5D4R A;  2F5F A;  1BC7 C;  2XIG A;  2VT2 A;  5K5Q A;  3FF5 A;  1P4W A;  1IXC A;  1DDN A;  4K2E A;  4DYC A;  1QVU A;  4G6D A;  4ANJ A;  2Z5U A;  3IKV A;  3OIO A;  4P5O A;  1IC8 A;  1XGO A;  3OL4 A;  4FHT A;  3DU5 A;  3OYN A;  1MMG A;  5GPC A;  5BMZ A;  4RLF A;  2GQQ A;  4CCK A;  5IYB J;  3IP4 B;  4FTH A;  2MLG A;  3OYC A;  4ZYD A;  2DW4 A;  2E34 A;  3WHB A;  4BAY A;  4G6T B;  1MSE C;  1T95 A;  2R7D A;  3V7R A;  2XKO A;  2UUZ A;  1KU9 A;  1SMT A;  3PJR A;  1KON A;  4PJL A;  1Y0U A;  1D0Z A;  1YW7 A;  1SEU A;  4M3F A;  1DGW Y;  2XF5 A;  4ZZD A;  3ABU A;  3WOD F;  2CUZ A;  1SFU A;  1A35 A;  4XLF A;  4F93 B;  1SMY F;  2V79 A;  2Z16 A;  4EEF G;  5E1X A;  2EA4 A;  2BV6 A;  5AON A;  1ZH5 A;  2JA6 J;  3LWF A;  1FBU A;  2NVQ J;  3PFY A;  1FMV A;  3J80 K;  2EB7 A;  3J7A Y;  3IWZ A;  2HVR A;  3REO A;  2CV0 A;  2X6O A;  1MJ9 A;  4Q47 A;  4UV9 A;  1RZ4 A;  1JGS A;  1SC7 A;  2XRO A;  3K4M A;  3MN2 A;  4RBO A;  1RKW A;  2B63 J;  1S29 A;  2LP0 A;  4BQN A;  3I5U A;  1XPX A;  2QZ8 A;  3IH4 A;  5J6X A;  1TWG J;  3NWS A;  3E5U A;  3TMO A;  1S9H A;  1E3P A;  3SYT A;  3E7L A;  4OIO F;  4WXD A;  1K78 B;  3CD6 I;  2VKH A;  2BEO A;  1K83 J;  3E0J B;  4GGG A;  5F08 A;  2L7K A;  2A6H F;  4A6E A;  5DM7 F;  1SFX A;  4DNC A;  4U7D A;  4M3E A;  3OYF A;  2DK8 A;  2V9P A;  3MMY B;  2X1E A;  1EH7 A;  3WG7 H;  3GFL A;  3S17 J;  1P7I A;  1Y0N A;  2Y0S A;  3DWL E;  3DBR B;  3UKG A;  2M8E A;  3ABL H;  3W3C A;  4MLO A;  2FU4 A;  4LIT A;  3GUD A;  3HJE A;  2COM A;  2HDW A;  2QBY B;  2Y9Y A;  2HEO A;  3ERM A;  2PMZ N;  3ASN H;  2F5E A;  2K3P A;  1H8A C;  5J40 A;  1SD7 A;  3TOB A;  4XN3 A;  4BXF A;  3A01 A;  3GW2 A;  5FKL A;  2L3D A;  3J81 K;  1JJ8 C;  3HPH A;  1ORK A;  4YIF A;  5L3G A;  4KFC A;  3EUK L;  1JUM A;  4G7H F;  2KT0 A;  3B02 A;  4I99 C;  1YI2 I;  2STW A;  3S2D J;  5FO5 A;  4BHC A;  1E2X A;  1BL0 A;  1HBX G;  4ZYH A;  2LMD A;  1ZAR A;  1AWC A;  1LFB A;  3MZH A;  2YU3 A;  2OQG A;  3RKY A;  4IHT A;  1HSJ A;  4AD9 A;  4BBR J;  2ESN A;  2BW3 B;  2CSO A;  1YHQ I;  2K9S A;  1F4K A;  4IOA F;  1JXS A;  3QPH A;  1HLV A;  4EM0 B;  3HB9 A;  1K4T A;  4PK4 A;  2IEK A;  1NK3 P;  2RRE A;  4ENJ A;  2R7S A;  3CCU I;  3S8P A;  3OYM A;  2HDC A;  2BHZ A;  1OCC H;  3C1D A;  2G0E A;  4KMF A;  3LMM A;  2K3F A;  4A5N A;  2VQG A;  3OYD A;  3HTS B;  3GLL A;  1YYV A;  2LDU A;  3BPV A;  3K69 A;  2F4M B;  3F8F A;  1WH5 A;  4P1W A;  4YG2 F;  3F22 A;  4KNY A;  2VOO A;  4BYY A;  3V42 A;  3N4M A;  2DYR H;  4ZJZ A;  1O7L A;  3JRG A;  5KNL A;  3KEO A;  4LK0 F;  1DPU A;  2HXO A;  2CJJ A;  2IPQ X;  2Z3Y A;  4HEA 2;  5DD4 A;  1OIS A;  4JP0 A;  3DTE A;  4EJV A;  4WCG A;  3P7N A;  2KJC A;  3N05 A;  3G1M A;  5EEH A;  2VUM J;  3M9A A;  1R22 A;  3AG1 H;  1VQP I;  1TP4 A;  1UHS A;  3HUG B;  2XAJ A;  5HLT A;  1TWF J;  3FXM A;  4DYR A;  1YX5 A;  3ZOB A;  2KZV A;  2R7O A;  2MA3 A;  4DGW B;  3GTK J;  3FXR A;  1WZ2 A;  1BR2 A;  2Y75 A;  3PQK A;  3WG9 A;  4ESB A;  1IRZ A;  3DKX A;  2ID3 A;  4HNV A;  3OR2 C;  3DBL B;  3TW7 A;  3LL7 A;  1FBS A;  1UB9 A;  4CYC B;  2JZY A;  3S2H J;  2M0C A;  2HYF A;  2E1M C;  4AYB N;  2ZKZ A;  2TCT A;  3BZ6 A;  3IC7 A;  3TW6 A;  4E6K G;  5J1Y A;  1K78 A;  3JRI A;  3OV8 A;  1ODD A;  3RYP A;  4RM3 A;  3OYI A;  1MNE A;  2K27 A;  1TT5 B;  3WGI A;  3HOW J;  1QZZ A;  4E7I A;  1R71 A;  1ZK8 A;  2L4M A;  3IAS 2;  2L2O A;  2MH2 A;  3CO6 C;  2EIM H;  1W4M A;  2K9L A;  2WAE A;  3LFK A;  1ZN2 A;  5FKM A;  1GUU A;  2BYV E;  1VQO I;  2PMZ A;  3BR3 A;  4H4K C;  4EGY A;  3FKI J;  4E7S A;  4YIR X;  3D5L A;  2KRH A;  3LA7 A;  3ZRG A;  2P4W A;  3H3V K;  4KIG A;  4NUB A;  2VJ4 A;  1IZ1 A;  2RC4 A;  1JUP A;  3P9K A;  1QHH D;  3G73 A;  1TC3 C;  4C9Y A;  3H1C A;  4XMY A;  2RNG A;  3M8J A;  2DDA A;  2NS7 A;  3MAJ A;  1DP3 A;  3ZCO A;  1XN7 A;  3TP3 A;  2KZG A;  2BE5 F;  5E1W A;  4P55 A;  1FZP B;  3RPQ A;  3KLN A;  2CW8 A;  3GTL J;  5L3E A;  2FBI A;  1OLT A;  4YFN F;  3SFZ A;  4Z6Y A;  1FEX A;  3KLO A;  2M8G X;  3JTH A;  4PSX A;  2WV0 A;  4NNJ A;  5HS8 A;  5L3D A;  2LRE A;  1J0R A;  2W48 A;  1JE8 A;  3PIO F;  2DFF A;  3E6C C;  2BXZ A;  4XLC A;  2DA7 A;  2OJE D;  4CH7 A;  3V8K A;  1TWH J;  4J01 A;  1SAU A;  2OAZ A;  3C7J A;  3CMM A;  2PEX A;  3ZMD A;  5FLV A;  3RPU A;  1XGM A;  3I59 A;  2EZI A;  1MH4 A;  2MAB A;  4ESJ A;  1ZGW A;  1WQ2 A;  2CRG A;  1D1A A;  2K9M A;  3S1M J;  3CJT B;  2JSC A;  2JA8 J;  2GA1 A;  1K79 A;  3SJM A;  2M7A A;  2LY9 A;  2IS1 A;  3TP0 A;  2ME0 A;  1STZ A;  2WV1 A;  4AU7 A;  2W00 A;  3ULQ B;  2OD5 A;  4GCV A;  4CZC A;  3E6B A;  4QLC U;  1XX5 A;  1YW8 A;  2IGN A;  1Z1D A;  3QP6 A;  5A2Q Z;  1GT0 C;  3E5X A;  1YS6 A;  2UXX A;  4XLA A;  3F0C A;  3RSN A;  4BJT A;  5CVJ A;  2JA2 A;  4IRH A;  9ANT A;  4L5I A;  4BQQ A;  4L5E A;  4LB5 A;  3KX2 A;  3G3Z A;  2DPU A;  1VQN I;  3H3U A;  3DU6 A;  4RAG A;  1K61 A;  1U2W A;  4XSX F;  1W0T A;  2PFB A;  1ETV A;  2ZXH A;  3H0G J;  3BR5 A;  2F5C A;  1KYZ A;  2LR8 A;  2L9R A;  1QGP A;  3RCO A;  4DIQ A;  2IT0 A;  1VF9 A;  1WVR A;  1VQ9 I;  3QYE A;  2JWT A;  3TBI A;  1R5G A;  2BXY A;  4PCQ A;  4KDP A;  3W6J B;  5HOD A;  5K5R A;  1WKM A;  2L7F P;  5F27 A;  3H35 A;  2YSR A;  4HPQ A;  5EG0 A;  3K10 A;  4UHT A;  2KL4 A;  4BXX J;  2IA2 A;  2DAO A;  1HQC A;  2O5R A;  3PUB A;  4KMU X;  3CF2 A;  2CV2 A;  1OCP A;  2HVS A;  1YX3 A;  5LHI A;  2XDV A;  4XSZ F;  1T8I A;  2DQL A;  1IV6 A;  4FCY A;  2DOD A;  4UY8 I;  5E20 A;  4M74 A;  1LKX A;  3BOQ A;  5B1A H;  3D5R C;  2OV7 A;  4E7L A;  1ZLJ A;  2O8K A;  2XPV A;  1GVJ A;  2VQC A;  2X6W A;  1FYL A;  4UUV A;  1YTY A;  2VE9 A;  1Z05 A;  1JHF A;  4F7Z A;  2VOP A;  1B9M A;  4DJA A;  4LIV A;  3PSI A;  2Z33 A;  2QBY A;  3GME A;  2NVU B;  1H88 C;  1LQ1 A;  3ISP A;  3QPT A;  2LFB A;  3CF5 F;  2QSG X;  2OUM A;  3V4G A;  2WAQ A;  4OAY A;  1Z91 A;  4IHW A;  3U21 A;  1F1Z A;  2HYG D;  2NAZ A;  2XKP A;  4IJA A;  2ZBK A;  5E8G A;  3VSL A;  2ACJ A;  5FGM A;  1P6R A;  3OIP A;  4EM2 A;  4M73 A;  5GAH J;  1I6X A;  3I53 A;  4YEL A;  4BU2 A;  1R1T A;  2BHY A;  4XRM A;  4IXA A;  3SXY A;  3BG6 A;  5F1J A;  1PUF A;  2A07 F;  2VKE A;  2R0Q C;  3JSO A;  1HKT A;  2E1O A;  3LSH A;  2VLA A;  5D6F A;  2EPF A;  2FX0 A;  4QPQ A;  2CWE A;  5EZH A;  4Z2Y A;  3PQJ A;  3X2Q H;  5FFZ A;  2VOD A;  2DJI A;  2DA1 A;  5FRO A;  5FJ8 J;  3M1E A;  5LGN A;  1Y56 A;  3F6O A;  3FHZ A;  5IYD J;  4DQ2 A;  2H94 A;  4BDZ A;  3J7Z I;  1WGX A;  3HC7 A;  3O8H A;  4GDF A;  3H3Z A;  3SEZ A;  3KZZ A;  1TTY A;  3BJ6 A;  2VBW A;  3ROU A;  2V7F A;  2VB6 A;  3GX4 X;  3W2V A;  1IN7 A;  1TLH B;  4XLE A;  3BR2 A;  3WGH A;  3F8B A;  3U1D A;  2W24 A;  1T39 A;  2X85 A;  4OIN F;  2LY2 A;  4A0Y A;  1Z7U A;  2IVM A;  4S05 A;  4CO8 A;  2M45 A;  2L7M P;  2K02 A;  3E3V A;  4QPO A;  3HYI A;  4Y33 A;  2ISY A;  3RQ4 A;  1IN4 A;  1HW5 A;  1V4R A;  4AIJ A;  3IRR A;  4B48 A;  5TGT A;  1JTY A;  2CQK A;  2PJR B;  1SD5 A;  2W84 A;  1FP2 A;  2P7V B;  3CCR I;  3DCF A;  4PGH A;  3G1L A;  1R6R A;  3GYH X;  2PBI A;  3EUA A;  1AU7 A;  2IW5 A;  3OWT A;  5EYR A;  1BC8 C;  1B59 A;  1A36 A;  1QHG A;  4A3B J;  5HVQ C;  4X1E A;  5CYV A;  2GIV A;  2WY7 Q;  2XPU A;  2P0W A;  3K4L A;  4XLH A;  4CDG A;  2JMW A;  3VYS B;  2QQ9 A;  5B66 C;  4IL6 C;  5LRR A;  4IKF A;  3W6K B;  5D5U B;  2E1M B;  4P9F A;  5EF6 A;  4HX7 A;  5GP9 A;  3SQN A;  2P81 A;  3ABK H;  2KP6 A;  2VJJ A;  1MH3 A;  3ZR8 X;  2O03 A;  3OYL A;  2ELH A;  4GRI A;  5TIS C;  3H9G A;  2L9N A;  4NDL A;  5K7H A;  3CCV I;  2NNY A;  2VBX A;  1LDD A;  3ASO H;  2L4A A;  3HOY J;  4C3J J;  3TDZ C;  1G6N A;  1S3J A;  2EK5 A;  2FBH A;  4D7N A;  4G7O F;  2YS9 A;  4NC6 A;  1BIA A;  1UJ8 A;  2D1H A;  2FF4 A;  2VPR A;  5DCM A;  4CZZ A;  3I55 I;  5M5W J;  4UUT A;  2PN6 A;  3OS2 A;  1J59 A;  2WTE A;  3G1O A;  1ON2 A;  5KVR A;  1V3F A;  1QO0 D;  2K40 A;  3C2B A;  4JOM A;  2HU9 A;  3DLL F;  2R5Z A;  1EF4 A;  4WXH A;  3QOE A;  1ON1 A;  4B3X A;  4L18 B;  1BN5 A;  1B72 A;  2W85 A;  3HEF A;  1FWZ A;  5FD5 A;  2EIJ H;  4M6V A;  5LRS A;  5M5Y J;  2V1X A;  2VQL A;  3F6V A;  2Y9Z A;  3GZ6 A;  3GO5 A;  4HF1 A;  2FUG 2;  2W57 A;  3OYH A;  1YIJ I;  1FMW A;  2JUC A;  5DYM A;  1BI1 A;  5H2F C;  1LB2 A;  1PP7 U;  1HXD A;  4Y7N J;  1X3W B;  2XVC A;  1ZHF A;  4HLX A;  2HTS A;  2N8G A;  3IUO A;  3MQ0 A;  1DU0 A;  4V2G A;  4N9H A;  4ZDL A;  1GV2 A;  1XS9 A;  2PJR A;  2VC1 A;  1J75 A;  3D0S A;  4BEH B;  4L9N A;  3TED A;  2ZSH B;  1DPR A;  2MH9 A;  3JCU C;  2DPD A;  2DJN A;  4U88 A;  1SAX A;  4DZP A;  3BTC A;  2LF7 A;  4UVA A;  1Z9C A;  1D5V A;  1UHW A;  3FXK A;  1MBG A;  5HDG A;  1O3T A;  4OIR F;  3ZQI A;  2MG4 A;  4HX4 A;  3EYY A;  4QSH A;  2QF7 A;  3FMS A;  1ULY A;  2M5W A;  1LE8 B;  2LY1 A;  1UZC A;  2NXN B;  2V26 A;  2M0M A;  3RQI A;  3CCQ I;  5FD6 A;  1VFC A;  2JA5 J;  2LC2 A;  5DEQ A;  4HNU A;  3BG5 A;  1R23 A;  4RS8 A;  4XN0 A;  5ILV A;  1MDM B;  2B7E A;  2DK5 A;  4CA0 A;  3MEX A;  5GPA A;  1IAW A;  2A5W A;  4AWX B;  2EA2 A;  3GFM A;  3R6S A;  2O7O A;  3FM3 A;  2CQ7 A;  5D5W B;  1B6A A;  1YOV B;  3HRU A;  4XL9 A;  3HOZ J;  2I8D A;  1N77 A;  4D7M A;  1MBE A;  4II3 A;  4F91 B;  3I3L A;  1I3Q J;  1OR7 C;  1MBK A;  4BJ6 C;  3KP5 A;  2WWY A;  2V6E A;  1V55 H;  2EIN H;  1YJ9 I;  3RYR A;  1ZYR F;  1XMX A;  3MKZ A;  1S7E A;  5IP7 J;  2IA0 A;  1JGG A;  4D1Q A;  1GXP A;  5H6R A;  1HDD C;  1MBH A;  3K2Z A;  5LHG A;  1MW7 A;  4YRV A;  4Y17 A;  1VTN C;  1I3A A;  5J4V A;  4EJW A;  3HHH A;  3AL0 C;  5BOX A;  3DEE A;  2R93 J;  2QKM B;  4P96 A;  3CUQ B;  1LE8 A;  1T33 A;  1X2M A;  4IRG A;  1NHA A;  3LOC A;  3BQZ A;  1U9O A;  1LVA A;  4LLG F;  3S1N J;  2DI3 A;  5GAD J;  3B6A A;  2NRA C;  2OTL I;  4A3L J;  2X9D A;  5LBQ A;  1D5Y A;  5EJC A;  2G7U A;  3E6D A;  2JSP A;  2R5Y A;  3UNG C;  2W4S A;  2WY8 Q;  4B47 A;  2ID6 A;  2DU9 A;  4RGR A;  5HLH A;  4Y52 J;  1NTC A;  3A03 A;  1FOW A;  3WE2 A;  4AID A;  5GAG J;  2CW7 A;  3JAM K;  1B8I B;  2QGU A;  3F3X A;  2MBF A;  3WU1 B;  2R7V A;  4KIF A;  2QWW A;  2P8T A;  2VQH A;  3KZI C;  1X3Z B;  1WHU A;  2Z2S B;  3CJN A;  1PP8 F;  2AQF A;  3F9K A;  2M4G A;  5JHF A;  1MMD A;  3PNT A;  5D8K B;  4RGU A;  1FYM A;  3A4C A;  3OOU A;  1UST A;  2WB1 A;  3JRF A;  4R79 A;  1FNN A;  2TRT A;  2VN2 A;  4CCN A;  4KT6 A;  2R7X A;  5DUI A;  5B1B H;  1ZG5 A;  2HVQ A;  4A3F J;  3L2U A;  2BY0 A;  3BDD A;  3ZGK A;  1RRJ A;  1N78 A;  1GLN A;  2CU7 A;  1D1C A;  2I5U A;  2O6G E;  4XK4 A;  2L9V A;  4M9Z A;  1GXQ A;  5BQT A;  1Z21 A;  4LGW A;  2Q2E B;  1VQK I;  2B0L A;  2OF7 A;  3TL4 X;  3CMY A;  1OPC A;  1JKO C;  2K7L A;  2XV4 S;  1G3S A;  3U9G A;  4L5J A;  2ECB A;  1A5J A;  1RI7 A;  3HKZ A;  2K85 A;  4D0P A;  2HQN A;  3K70 D;  2RN7 A;  1ZGA A;  3HG9 A;  2CQX A;  4LJZ F;  2XSD C;  1ETO A;  3RPU D;  3L09 A;  3LAP A;  2VJ5 A;  4ZDP A;  1VQ7 I;  3OYA A;  3GCM A;  3S1Q J;  3F8C A;  4LLL A;  3HIF A;  3HL2 A;  4EJT A;  2WAQ N;  3GVA A;  4YFX F;  4D5C A;  3BJA A;  2HQR A;  2W1O A;  2EV5 A;  2XRN A;  3ZQC A;  2BGC A;  1U5T C;  1BM9 A;  1J2X A;  2PQ8 A;  2XRL A;  5ICE A;  5LGU A;  5IY5 H;  4MHG A;  4BJ5 C;  5LEJ A;  1MJB A;  3QAH A;  3PSF A;  3GEZ A;  2F48 A;  3WTZ A;  4CCJ A;  2NVT J;  2DQR A;  4PFO A;  1KA8 A;  1Y6I A;  4A3C J;  1UFM A;  3W2A A;  1IW7 F;  1QZY A;  1OYW A;  2MW8 A;  2O3F A;  3OL3 A;  1R49 A;  5HLI A;  2M7B A;  4Y13 A;  2UV1 A;  2VON A;  1D1B A;  1NG6 A;  2FML A;  3DV8 A;  4LG0 B;  4BS9 A;  3K0L A;  4A93 J;  3GLX A;  1XDU A;  2R7Z J;  2KDO A;  2EZH A;  1XSD A;  2KDZ A;  3ZN0 A;  2KJB A;  4XR6 A;  2XAU A;  1IF1 A;  4LB6 B;  1TNS A;  1U5T A;  4ESF A;  2NVX J;  1BI3 A;  2L7Z A;  5L3B A;  1DUX C;  2E1C A;  1ETK A;  1S8N A;  3DXJ F;  3K9T A;  3M1C A;  3TOA A;  4BQO A;  3DF8 A;  3FXU A;  4NB5 A;  3CUQ C;  3HTU A;  5ICG A;  2DCE A;  4N9I A;  4UB8 C;  3CME I;  2E1N A;  4RB2 C;  2XSJ C;  3HRT A;  3DKY A;  4MQ9 F;  3BY6 A;  1X1C A;  1XD7 A;  3G4S I;  3I59 B;  2GXA A;  2HOT A;  2P6T A;  2FJ1 A;  4CCO A;  1IV8 A;  3M8E A;  1QRY A;  3ZQH A;  1FOK A;  2HPI A;  2JPB A;  4A3G J;  2BBY A;  1A6I A;  2QA4 I;  5JLW A;  3AAF A;  2F2E A;  1O3R A;  4WXC A;  2XAQ A;  1PUE E;  3SFI A;  5DD8 A;  4M6Y A;  5L3F A;  2VPL A;  1KQ8 A;  2EQR A;  2ELJ A;  3CCJ I;  5CVV A;  2C6Y A;  5AIQ A;  1BOB A;  2OA4 A;  1DP7 P;  2PMH A;  4PJM A;  4IQJ A;  3BCA A;  3S3M A;  3AFH A;  4GFB A;  1AOY A;  3DKW A;  2CMP A;  5EEG A;  3G71 I;  3JTG A;  1LFU P;  2DOE A;  1KGS A;  3KZY A;  2WAF A;  3BR0 A;  3GTP J;  5FFX A;  2X4H A;  2AHQ A;  2IA1 A;  2AS5 F;  3NQO A;  4U0W A;  1F36 A;  4IZZ A;  1R4N B;  1FY7 A;  1UMQ A;  4MTD A;  3KP6 A;  1QPI A;  2OU2 A;  3C2G A;  1G59 A;  3OOP A;  3OYK A;  4UNO A;  2H8W A;  5KHD A;  4E70 A;  4XRS G;  5E18 F;  3PM1 A;  4F52 A;  1GDT A;  1MBJ A;  2F5V A;  3TO6 A;  5FKK A;  1A31 A;  3LAJ A;  3IH2 A;  3HRS A;  4D9J A;  1FX7 A;  1X1A A;  2O9L A;  1TWC J;  2HOA A;  4DW6 A;  3OS0 A;  3NAU A;  3WTX C;  1Z77 A;  2CFO A;  1BW6 A;  3OY9 A;  2X51 A;  1HW1 A;  2DFI A;  2MGQ A;  2E2I J;  2XB5 A;  3K1M A;  4MEY F;  1MDM A;  1SFK A;  2H1L A;  5B3S H;  3FIW A;  1MZB A;  4A69 C;  2DBB A;  1T6S A;  4MEX F;  4RGX A;  1H0M A;  4N4N B;  1T2K A;  4C2U A;  4B1R A;  4FE7 A;  2IAI A;  1HDP A;  3JW4 A;  1O3S A;  3E97 A;  4XOP A;  3DLA A;  2DA4 A;  4O5V A;  5DDG A;  4FX4 A;  2XGX A;  1YRN B;  3HHG A;  2JQ7 A;  4BY7 J;  4HYE A;  1PDN C;  3BG7 A;  3L1P A;  5FLX Z;  2EFO A;  4Q5S F;  3ZP5 A;  2E5N A;  3CTA A;  1F43 A;  3RJP A;  3HUG A;  4IO9 F;  2KKO A;  4D5F A;  1G2H A;  4MNU A;  1SVO A;  4BUP A;  4A3K J;  2HOE A;  2RVC A;  2VKV A;  3H92 A;  3TDU C;  3VB2 A;  1FSE A; 
#chains in the Genus database with same CATH homology
 2FNP A;  5K5O A;  4ASN A;  5E8I A;  4NHJ A;  2V6C A;  5BPI A;  3RIR A;  3T0Y A;  4IF4 A;  2J5P A;  2GZW A;  2ZME B;  2FBK A;  3RTR A;  1IN6 A;  5E1Z B;  2R3S A;  1R1V A;  3GZ5 A;  1T0F A;  1L0O C;  5KK1 A;  1XSX A;  1FP1 D;  1KU2 A;  4KIC A;  3HRM A;  2O8X A;  4U7B A;  3KET A;  4G9Y A;  1XMA A;  1B1B A;  4A6D A;  3NEU A;  4OMY A;  2P6S A;  4PZJ A;  2P5L C;  2EFN A;  1ONV A;  5ERI A;  3T8R A;  3V7C A;  2UZK A;  4A0X A;  2HKX A;  2HGC A;  5HS7 A;  4KYW A;  3P9I A;  4BQA A;  2QVO A;  2KIF A;  3ECO A;  2PG4 A;  4IHS A;  3C3W A;  1Z6T A;  1B4A A;  4OU0 A;  1OMI A;  3KP3 A;  1FC3 A;  5CJ9 A;  1BI0 A;  1YFH A;  3SZP A;  4I09 A;  1R5H A;  1L3L A;  1P4X A;  1G3Y A;  3FXQ A;  1R58 A;  2CO5 A;  3ZN1 A;  1CF7 A;  4LLN A;  3IRQ A;  2XAF A;  1R7J A;  5HOO A;  3I64 A;  4PDK A;  1FBQ A;  4G6Q A;  4ZYE A;  1O57 A;  4WF2 A;  3F8N A;  1JHH A;  3ZQ7 A;  2G9W A;  1IUY A;  4MTE A;  1XB4 A;  1R1U A;  4WK8 F;  3FMR A;  4EJU A;  1C0W A;  1KQ9 A;  3L9F A;  1FSH A;  2A5Y B;  3ELK A;  4ENK A;  2FA5 A;  2CYY A;  1R00 A;  4UXN A;  1J5Y A;  3WTS C;  1LEA A;  4L0Z B;  1D3Y A;  2KIU A;  4MQV A;  5AIP A;  2GA2 A;  3K1P A;  1GHC A;  1J7K A;  4EJO A;  3IHU A;  3E5Q A;  2VXZ A;  2DLL A;  2RNJ A;  2QEN A;  5ICF A;  3U2R A;  1TBX A;  2UWM A;  3ZPL A;  4YFK F;  2W25 A;  2STT A;  4RAY A;  5JR3 A;  5IT9 Z;  5L3C A;  3IL2 A;  4CHU A;  2H27 A;  4FT8 A;  2Z99 A;  2PJP A;  2EWN A;  4RB1 A;  2G7H A;  1MGT A;  4O3M A;  2LSO A;  4I02 A;  5DUK A;  4CIC A;  2HR3 A;  2HFH A;  2D1V A;  4HA8 A;  1HST A;  5K1Y A;  4OMZ A;  4OIQ F;  3O6B B;  4WWC A;  1O7F A;  3DPL C;  4UV8 A;  4M9X A;  4JK1 X;  3VEP A;  1I27 A;  2DTR A;  4BNC A;  4AIK A;  4I2O A;  4EGZ A;  2XUB A;  3VOE A;  1CF7 B;  2Y0M A;  3ZMU A;  1KU7 A;  2HS5 A;  3WTV C;  2RV8 A;  1XDS A;  3FWE A;  3EDP A;  4HV6 A;  3R0J A;  2P5V A;  1S6L A;  4Y15 A;  1ZG1 A;  2GXB A;  2O0Y A;  5ILS A;  1I1S A;  3I0T A;  2KRF A;  4ENM A;  3ML6 A;  1XSV A;  3GFJ A;  3DQV C;  1YIO A;  2DO7 A;  3FX3 A;  2RQP A;  2WC2 A;  3EYI A;  4GXO A;  1LDK B;  1QPM A;  2Y48 A;  2XAS A;  4HQM A;  4L9J A;  4BHP A;  1Q1H A;  2LNB A;  2TDX A;  3TQN A;  4EV0 A;  3O2P E;  1Z6R A;  2CW0 F;  2CGP A;  5D8L B;  3CLO A;  2P5K A;  2FMY A;  2NS0 A;  4M71 A;  5TRD A;  4N0B A;  1ZRC A;  5HDN A;  3RI4 A;  1FLI A;  5JVT A;  4ETS A;  4JBA A;  3MWM A;  4YII A;  1HKQ A;  1XGN A;  2PI0 A;  1TW3 A;  5H6Q A;  3KCC A;  1I5Z A;  3O3K A;  3LQQ A;  2ZXJ A;  2VT3 A;  4I0B A;  5CVU A;  2A3S A;  3M7G A;  4HAM A;  1IXS B;  3ZMT A;  4I98 B;  3C18 A;  4AVP A;  4BH9 A;  5JI6 A;  2ADU A;  2OQR A;  2V1D A;  4KN7 X;  1T38 A;  5LGT A;  2QM3 A;  4R1H A;  2LF8 A;  3IKT A;  5IT9 K;  4IPA A;  2F5D A;  4GO1 A;  1MJA A;  2PMU A;  1ZRD A;  3CUQ A;  3KEQ A;  3WE3 A;  3JSP A;  2GWR A;  2V1U A;  1G4D A;  4HBL A;  3EQL F;  2FE3 A;  2QYO A;  3BPX A;  3I4P A;  3DEU A;  3I58 A;  4L0Y B;  2ZNY A;  2D45 A;  3WGG A;  1ZRE A;  2V9V A;  1LEB A;  2QQB A;  1F9N A;  3WTY C;  3F8M A;  4KT5 C;  1ZLK A;  1TQM A;  3P9C A;  1S7A A;  4Q4Z F;  1YS7 A;  2QQA A;  3JAM Z;  4XBF A;  1W7P B;  1REP C;  1KU3 A;  1OR7 A;  3BJO A;  1TQI A;  4XLN F;  1EH8 A;  2EJR A;  3ZMZ A;  2VBZ A;  4B09 A;  1I1G A;  1IRG A;  5J8C A;  1MD0 A;  4QWQ A;  5JFR A;  1T98 A;  1WSU A;  2FEZ A;  1HW2 A;  2XHK A;  2D2W A;  3CO7 C;  1QQI A;  1LJ9 A;  3GFI A;  1W5T A;  3KP7 A;  4BHB A;  1IN8 A;  3QP5 A;  1UHM A;  3T1B A;  3T8T A;  1J9I A;  1TQP A;  3ZMV A;  4XRF A;  2MD5 A;  4B8X A;  2JPC A;  4HX8 A;  4ZYG A;  4HDV A;  2FXA A;  1O3Q A;  2JTV A;  3RKX A;  4WX9 A;  4CGZ A;  1ZGJ A;  1U8R A;  3TO7 A;  3Q9V A;  1HKS A;  4LFU A;  4HDU A;  3N97 A;  3MZY A;  1MKM A;  4HZF A;  2XAH A;  2FRH A;  1U6G A;  3TO9 A;  3ERE D;  2ZME A;  5HDK A;  3Q9S A;  3COA C;  2JRT A;  3HSF A;  1YQA A;  1IN5 A;  4HQE A;  1WWX A;  5JHU A;  1YG2 A;  2H6C A;  1E17 A;  1TNT A;  1BJA A;  2EFQ A;  3FM5 A;  2LKP A;  4HLY A;  4I01 A;  3R0A A;  1FYK A;  4NQW A;  5CLS A;  2A61 A;  3J7A O;  2M30 A;  2R7F A;  1TW2 A;  2MLK A;  1XMK A;  4G8X A;  2VBY A;  1H9G A;  4HW0 A;  2CFX A;  3B73 A;  2A68 F;  3VOD A;  1ZG3 A;  3CUO A;  2J5O A;  2O61 A;  1OYY A;  1YW9 A;  5ILU A;  2ISZ A;  4P9U A;  3CDH A;  5TJJ A;  4Q48 A;  2EV0 A;  5F64 A;  3WTT C;  2FOK A;  2A6E F;  2CG4 A;  1B9N A;  3QRF F;  6PAX A;  3KFW X;  2Q8K A;  3BWG A;  2NNN A;  2QUF A;  3PFI A;  2EFW A;  1QBJ A;  1BOA A;  4RB0 A;  2EV6 A;  4I0A A;  4AIH A;  4KUM A;  3F23 A;  5H20 A;  1OKR A;  5FB2 A;  3R61 A;  5A2Q K;  5DV5 A;  1XCV A;  3K1N A;  2ZJ2 A;  1OYI A;  2Q0O A;  5CVI A;  3EET A;  1K7A A;  2GXG A;  1CGP A;  3IWF A;  5DCM B;  3KE2 A;  4RB3 C;  2AXL A;  4A5M A;  2MC3 A;  3SZT A;  3GXO A;  2HKO A;  2Q2E A;  4EM1 A;  2L54 A;  1W7P A;  2FQ3 A;  1WI9 A;  3EUH A;  2JT1 A;  2ZFW A;  4RAZ A;  3Q5F A;  2M1B A;  2HTJ A;  1KYW A;  4LG0 A;  2H09 A;  3V8J A;  2A69 F;  1P2F A;  4ON0 A;  4GYI A;  1X3U A;  2P7C B;  2ETH A;  3L00 A;  1RUN A;  5D6E A;  1D8J A;  2YX7 A;  2RGV A;  3E6M A;  3QOP A;  4H0E A;  3DFG A;  4JQF A;  4GYG A;  2KIM A;  2YX4 A;  2RKH A;  3VFZ A;  3WTW C;  1P4A A;  4M6X A;  3WU0 A;  4U0Y A;  2EFP A;  1D8K A;  1BIB A;  4OOI A;  1RNL A;  2FSW A;  2GAU A;  2K4B A;  2K4J A;  3LQR A;  4UVB A;  5BPD A;  3GWZ A;  3F21 A;  5D4S A;  3L7W A;  5ED4 A;  3SHF A;  3BP8 A;  1K6O A;  4A0Z A;  1A04 A;  3ECH A;  1LDJ A;  4EMS A;  5IT3 A;  3ABT A;  1UCR A;  2ESH A;  1U3E M;  4I7H A;  4L9V A;  2NYX A;  4CXF A;  5FLX K;  2YR2 A;  3ZMS A;  2DT5 A;  1SD4 A;  4RGS A;  1P92 A;  1XCB A;  1RUO A;  3F72 A;  5DCF A;  2ZO4 A;  1F5T A;  4MGR A;  4OIP F;  3KP4 A;  2OBP A;  2FNA A;  4UVC A;  1QNT A;  3NRV A;  5HLG A;  1U78 A;  3LST A;  1SD6 A;  1R36 A;  3MCZ A;  2VC0 A;  1IRF A;  1IXR C;  2IRF G;  2Z9O A;  3BRO A;  3FZV A;  1H9T A;  2IP2 A;  4G94 A;  4O6J A;  4XLP F;  3MFK A;  2K86 A;  1EV7 A;  4LK1 F;  3V7S A;  3HOT A;  4A12 A;  2H6B A;  2IJL A;  3T5X A;  3DP7 A;  2L01 A;  3HSR A;  1BBY A;  1S7O A;  4BXU A;  5CVR A;  4EVI A;  3GF2 A;  4S04 A;  1KQ0 A;  3QU6 A;  3L2C A;  2ZNZ A;  2VE8 A;  3LA3 A;  3TGN A;  3S2W A;  1ZRF A;  3I54 A;  3HSE A;  4G7Z F;  1YO5 C;  1BI2 A;  2YPR A;  1EH6 A;  4HV5 A;  4TV7 A;  2PLY A;  4U0V A;  4KA4 A;  4HF2 A;  1FT9 A;  3RKW A;  1WRJ A;  3DPT A;  2RDP A;  5ICC A;  3LA2 A;  2M87 A;  2E7X A;  5LLQ A;  5LHH A;  5J8F A;  3R4K A;  4ZZL A;  3J80 Z;  4LMY A;  2E7W A;  4M72 A;  3M8F A;  5BS6 A;  4HF0 A;  4FX0 A;  2OZU A;  4IVN A;  4KIB A;  5F6F A;  4HOB A;  4ENN A;  2QLZ A;  1FPQ A;  4PGG A;  3V8L A;  2XAG A;  4LD5 A;  2L02 A;  1YLF A;  1G3W A;  2ZCW A;  4M9S A;  4A2U A;  3R60 A;  3RDI A;  1LNW A;  1W7P D;  3QU3 A;  1RIO H;  1U5T B;  5HS9 A;  4ZH4 F;  3FMQ A;  5D5X B;  2X0L A;  3TKY A;  2OZ6 A;  3I71 A;  1G3T A;  3HOS A;  5F1R A;  4R8H A;  3J81 Z;  4L9T A;  4CYD A;  3WTU C;  2UXN A;  3KP2 A;  1W5S A;  2HZT A;  2HWV A;  1USS A;  1SFE A;  5D5V B;  4KN4 X;  4IRI A;  5E17 F;  4EQQ A;  5LEK A;  1ZAO A;  1XGS A;  5D4R A;  2F5F A;  1BC7 C;  2XIG A;  2VT2 A;  5K5Q A;  3FF5 A;  1P4W A;  1IXC A;  1DDN A;  4K2E A;  4G6D A;  2Z5U A;  3IKV A;  4P5O A;  1XGO A;  4FHT A;  5BMZ A;  2GQQ A;  2MLG A;  4ZYD A;  2DW4 A;  4BAY A;  2R7D A;  3V7R A;  2XKO A;  1KU9 A;  1SMT A;  1Y0U A;  1YW7 A;  4ZZD A;  3ABU A;  3WOD F;  1SFU A;  1SMY F;  2V79 A;  1ZH5 A;  5E1X A;  2EA4 A;  2BV6 A;  5AON A;  3LWF A;  1FBU A;  3J80 K;  2EB7 A;  3IWZ A;  3REO A;  1MJ9 A;  4Q47 A;  4UV9 A;  1RZ4 A;  1JGS A;  2XRO A;  1S29 A;  3I5U A;  2QZ8 A;  5J6X A;  3E5U A;  4OIO F;  4WXD A;  1K78 B;  2BEO A;  4GGG A;  2A6H F;  4A6E A;  1SFX A;  4DNC A;  4U7D A;  2DK8 A;  1EH7 A;  3GFL A;  2M8E A;  2FU4 A;  3GUD A;  2COM A;  2QBY B;  2HEO A;  2F5E A;  1SD7 A;  3TOB A;  3GW2 A;  3J81 K;  2L3D A;  4YIF A;  5L3G A;  4KFC A;  4G7H F;  3B02 A;  2STW A;  5FO5 A;  4BHC A;  1E2X A;  1HBX G;  4ZYH A;  1ZAR A;  1AWC A;  3MZH A;  2YU3 A;  2OQG A;  3RKY A;  4IHT A;  1HSJ A;  4AD9 A;  2ESN A;  1F4K A;  2CSO A;  1JXS A;  3QPH A;  4EM0 B;  4ENJ A;  2HDC A;  3C1D A;  4KMF A;  4A5N A;  3HTS B;  1YYV A;  2LDU A;  3BPV A;  3K69 A;  3F8F A;  2VOO A;  4YG2 F;  3F22 A;  4KNY A;  4BYY A;  3N4M A;  1O7L A;  3KEO A;  4LK0 F;  1DPU A;  5DD4 A;  2IPQ X;  2Z3Y A;  4EJV A;  4WCG A;  3P7N A;  2KJC A;  5EEH A;  3M9A A;  1R22 A;  2XAJ A;  2MA3 A;  3FXR A;  2Y75 A;  3PQK A;  3WG9 A;  4ESB A;  1FBS A;  1UB9 A;  2JZY A;  2HYF A;  2ZKZ A;  3BZ6 A;  3IC7 A;  1K78 A;  3OV8 A;  1ODD A;  3RYP A;  2K27 A;  3WGI A;  1QZZ A;  2L4M A;  2MH2 A;  3CO6 C;  1W4M A;  3LFK A;  1ZN2 A;  2BYV E;  4EGY A;  3D5L A;  3LA7 A;  2P4W A;  4KIG A;  1IZ1 A;  2RC4 A;  3P9K A;  3G73 A;  3MAJ A;  1XN7 A;  2BE5 F;  5E1W A;  4P55 A;  1FZP B;  3RPQ A;  3KLN A;  5L3E A;  2FBI A;  4YFN F;  3SFZ A;  3KLO A;  3JTH A;  2WV0 A;  5HS8 A;  5L3D A;  1J0R A;  1JE8 A;  3E6C C;  3V8K A;  2OAZ A;  3C7J A;  2PEX A;  3ZMD A;  3RPU A;  1XGM A;  3I59 A;  4ESJ A;  1WQ2 A;  2JSC A;  2GA1 A;  1K79 A;  1STZ A;  3ULQ B;  2OD5 A;  4GCV A;  3E6B A;  4QLC U;  1YW8 A;  1Z1D A;  3QP6 A;  5A2Q Z;  3E5X A;  1YS6 A;  2UXX A;  5CVJ A;  4IRH A;  4L5I A;  4LB5 A;  3G3Z A;  2DPU A;  3H3U A;  1U2W A;  4XSX F;  2PFB A;  2F5C A;  1KYZ A;  1QGP A;  2IT0 A;  1R5G A;  4PCQ A;  4KDP A;  3W6J B;  5K5R A;  1WKM A;  2YSR A;  4UHT A;  2IA2 A;  2DAO A;  1HQC A;  4KMU X;  5LHI A;  4XSZ F;  2DQL A;  5E20 A;  4M74 A;  3BOQ A;  1ZLJ A;  1GVJ A;  1FYL A;  4UUV A;  1YTY A;  2VE9 A;  1Z05 A;  1JHF A;  4F7Z A;  2VOP A;  1B9M A;  2Z33 A;  2QBY A;  1LQ1 A;  3ISP A;  3QPT A;  3V4G A;  1Z91 A;  1F1Z A;  2HYG D;  2NAZ A;  2XKP A;  4IJA A;  5E8G A;  2ZBK A;  2ACJ A;  5FGM A;  1P6R A;  4EM2 A;  4M73 A;  1I6X A;  3I53 A;  1R1T A;  4IXA A;  3SXY A;  2A07 F;  3JSO A;  1HKT A;  5D6F A;  2CWE A;  4Z2Y A;  3PQJ A;  5FFZ A;  2VOD A;  3M1E A;  5LGN A;  3F6O A;  3FHZ A;  4DQ2 A;  2H94 A;  3H3Z A;  3KZZ A;  1TTY A;  3BJ6 A;  2VBW A;  3ROU A;  3GX4 X;  1IN7 A;  1TLH B;  3WGH A;  3F8B A;  3U1D A;  2W24 A;  1T39 A;  4OIN F;  4A0Y A;  1Z7U A;  2IVM A;  4S05 A;  4CO8 A;  2M45 A;  2K02 A;  3E3V A;  3HYI A;  2ISY A;  1IN4 A;  1HW5 A;  1V4R A;  4AIJ A;  3IRR A;  2CQK A;  1SD5 A;  2W84 A;  1FP2 A;  2P7V B;  4PGH A;  3GYH X;  2PBI A;  2IW5 A;  1BC8 C;  1B59 A;  5HVQ C;  5CYV A;  2GIV A;  4CDG A;  2QQ9 A;  5LRR A;  3W6K B;  5D5U B;  4P9F A;  4HX7 A;  3SQN A;  2O03 A;  2ELH A;  2NNY A;  2VBX A;  1LDD A;  2L4A A;  3TDZ C;  1G6N A;  1S3J A;  2EK5 A;  2FBH A;  4G7O F;  1BIA A;  2D1H A;  5DCM A;  2FF4 A;  4CZZ A;  2PN6 A;  1J59 A;  2WTE A;  1ON2 A;  5KVR A;  1V3F A;  1QO0 D;  4WXH A;  1ON1 A;  4L18 B;  1BN5 A;  2W85 A;  1FWZ A;  5FD5 A;  5LRS A;  2V1X A;  3F6V A;  3GZ6 A;  3GO5 A;  4HF1 A;  2W57 A;  5DYM A;  1BI1 A;  1LB2 A;  1PP7 U;  1HXD A;  2XVC A;  1ZHF A;  4HLX A;  2HTS A;  3MQ0 A;  4N9H A;  2VC1 A;  1J75 A;  3D0S A;  4L9N A;  1DPR A;  2MH9 A;  2DPD A;  4U88 A;  1SAX A;  2LF7 A;  4UVA A;  1Z9C A;  1D5V A;  1UHW A;  5HDG A;  1O3T A;  4OIR F;  4HX4 A;  3EYY A;  3FMS A;  1ULY A;  2M5W A;  5FD6 A;  5DEQ A;  1R23 A;  4RS8 A;  1MDM B;  5ILV A;  2DK5 A;  3MEX A;  1IAW A;  4AWX B;  2EA2 A;  3GFM A;  3R6S A;  3FM3 A;  5D5W B;  1B6A A;  3HRU A;  2WWY A;  3KP5 A;  3RYR A;  1ZYR F;  2IA0 A;  1GXP A;  5H6R A;  3K2Z A;  5LHG A;  4Y17 A;  1VTN C;  4EJW A;  3HHH A;  5BOX A;  4P96 A;  3CUQ B;  4IRG A;  1NHA A;  1LVA A;  4LLG F;  2DI3 A;  2NRA C;  5LBQ A;  2G7U A;  3E6D A;  2DU9 A;  4RGR A;  5HLH A;  3WE2 A;  3JAM K;  3F3X A;  2MBF A;  3WU1 B;  4KIF A;  2QWW A;  2P8T A;  3CJN A;  1PP8 F;  5D8K B;  4RGU A;  1FYM A;  1UST A;  4R79 A;  1FNN A;  2VN2 A;  5DUI A;  1ZG5 A;  3BDD A;  2O6G E;  4M9Z A;  1GXQ A;  5BQT A;  4LGW A;  2B0L A;  1OPC A;  2K7L A;  2XV4 S;  1G3S A;  3U9G A;  4L5J A;  1RI7 A;  4D0P A;  2HQN A;  2RN7 A;  1ZGA A;  4LJZ F;  3L09 A;  3LAP A;  3F8C A;  4LLL A;  3HIF A;  4EJT A;  3GVA A;  4YFX F;  3BJA A;  2HQR A;  2EV5 A;  2XRN A;  2BGC A;  1U5T C;  1BM9 A;  1J2X A;  2PQ8 A;  5ICE A;  5LGU A;  4MHG A;  5LEJ A;  1MJB A;  3QAH A;  3GEZ A;  3WTZ A;  2DQR A;  1KA8 A;  1UFM A;  1IW7 F;  1QZY A;  1OYW A;  2O3F A;  5HLI A;  4Y13 A;  2VON A;  2FML A;  3DV8 A;  4LG0 B;  3K0L A;  3GLX A;  1XDU A;  1XSD A;  3ZN0 A;  2KJB A;  1IF1 A;  4LB6 B;  1TNS A;  1U5T A;  4ESF A;  1BI3 A;  5L3B A;  1DUX C;  2E1C A;  1S8N A;  3DXJ F;  3K9T A;  3TOA A;  3DF8 A;  3FXU A;  4NB5 A;  3CUQ C;  3HTU A;  5ICG A;  4N9I A;  2E1N A;  4RB2 C;  3HRT A;  4MQ9 F;  3BY6 A;  1XD7 A;  3I59 B;  2P6T A;  3M8E A;  1FOK A;  2JPB A;  2BBY A;  3AAF A;  2F2E A;  1O3R A;  4WXC A;  2XAQ A;  1PUE E;  5DD8 A;  4M6Y A;  5L3F A;  1KQ8 A;  5CVV A;  2C6Y A;  5AIQ A;  2OA4 A;  1DP7 P;  2PMH A;  1AOY A;  3DKW A;  5EEG A;  3JTG A;  1KGS A;  3KZY A;  5FFX A;  2X4H A;  2IA1 A;  2AS5 F;  3NQO A;  4U0W A;  1FY7 A;  4MTD A;  3KP6 A;  2OU2 A;  3OOP A;  4UNO A;  4E70 A;  5E18 F;  3TO6 A;  3LAJ A;  3HRS A;  1FX7 A;  3WTX C;  1HW1 A;  2DFI A;  3K1M A;  4MEY F;  1MDM A;  1MZB A;  2DBB A;  4MEX F;  1T6S A;  1H0M A;  4RGX A;  1T2K A;  3JW4 A;  1O3S A;  3E97 A;  4O5V A;  5DDG A;  4FX4 A;  2XGX A;  3HHG A;  4HYE A;  1PDN C;  5FLX Z;  2EFO A;  4Q5S F;  3ZP5 A;  3CTA A;  3RJP A;  3HUG A;  2KKO A;  4MNU A;  2HOE A;  2RVC A;  3TDU C;  3H92 A;  3VB2 A;  1FSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...