1K79A

Ets-1(331-440)+ggaa duplex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
104
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*AP*AP*TP*GP*T)-3')
publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 36
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k79A00
3W6JB 2QZ8A 1R5GA 5LHGA 5CVIA 1J9IA 4EJWA 3NRVA 1DUXC 1S29A 2ZCWA 2UXXA 2DLLA 4LK1F 5F64A 1HW5A 1WWXA 1ZRFA 5HDKA 3SFZA 3RKYA 2ZFWA 2ISZA 2RN7A 2IA1A 4RAZA 4Z2YA 4A2UA 1LDKB 4ESBA 2WV0A 2BV6A 3DPLC 4FX0A 2MA3A 1DDNA 2EWNA 3K1PA 3GYHX 3M8FA 1USSA 3BZ6A 2HEOA 1OYYA 2EJRA 5ICCA 1IXCA 4LD5A 4EJUA 2FRHA 1HW2A 1ZLKA 1TQIA 3R4KA 4M9ZA 4OIPF 1H9TA 5L3CA 1ZLJA 3I58A 4KNYA 2M1BA 5DUKA 2F2EA 2A3SA 3JSOA 3J81Z 5BS6A 4PGGA 4RB2C 2JRTA 5L3FA 2DQLA 2MD5A 4OMZA 2K27A 2ZNZA 1USTA 1HQCA 3HHGA 1KU7A 2XAHA 1CF7B 1XMAA 2JTVA 1A04A 1J0RA 3RTRA 1KU2A 3GEZA 3H3UA 2M30A 1IXRC 3SZPA 2L54A 4EMSA 4KIGA 2YSRA 3COAC 2DK5A 2D2WA 3QAHA 4LMYA 1TBXA 4CICA 1MKMA 2V1XA 4RAYA 3ZMVA 3EQLF 5LHHA 1FLIA 4LGWA 1XDSA 2PBIA 1GHCA 2XVCA 3P9KA 3WE2A 3HUGA 2H27A 1YO5C 3WTYC 4Q48A 3TO6A 1QGPA 4XLNF 2NYXA 2PEXA 4YIFA 1HBXG 3ELKA 3G73A 3ROUA 2P5VA 3CUOA 2QQAA 3KEOA 3ULQB 2VBXA 3IKVA 2FMYA 3F6OA 2FF4A 3T0YA 4L0ZB 1SFXA 2P6SA 1IXSB 4KN7X 4UUVA 2JZYA 4WCGA 2O03A 3FWEA 3K1NA 4IHSA 3N4MA 4XLPF 4I2OA 2ZMEB 3GW2A 3CO7C 2FBHA 3R6SA 4GYIA 1K6OA 1W5SA 2YR2A 5HLGA 5CVRA 1S6LA 2P6TA 2V6CA 1CF7A 1PDNC 1SAXA 2GWRA 2K02A 2Q0OA 3VB2A 2HYGD 4M6XA 2L01A 3KFWX 1AWCA 5D5UB 1B4AA 4EV0A 1V3FA 1R5HA 3WODF 1FBUA 1I1GA 4HLXA 3F6VA 1YTYA 1IAWA 1BC7C 1ZRCA 2F5FA 2ZXJA 4HQMA 4U0YA 4KN4X 3QOPA 3SXYA 2STWA 1G3YA 3KP5A 3QPHA 3C18A 2UWMA 3I71A 5FD5A 3GO5A 1QZYA 1BBYA 3RKWA 5LGUA 1XGOA 1BI2A 2OZUA 4A0ZA 2VE8A 1OMIA 1LB2A 2Q2EA 3EYIA 3MAJA 4Y17A 3R0AA 1WQ2A 1ULYA 2O0YA 1I1SA 4EJTA 1L0OC 2FA5A 1IN7A 4HX8A 4L18B 1RZ4A 2PQ8A 4G7HF 2ZMEA 2K86A 2A69F 1ZG1A 3E5XA 2E1CA 2Z3YA 2WC2A 2GZWA 1OYIA 1XGSA 3F8MA 2FBKA 1R1UA 2CW0F 2RC4A 1U6GA 5CYVA 3FHZA 1Z6TA 3BPVA 4BHBA 2Z9OA 2KIMA 3WTSC 2PJPA 3KEQA 2D1HA 2R3SA 3IRRA 2ACJA 1MJ9A 5AIQA 5DD8A 4OIRF 1FBSA 5FD6A 1FSEA 2AXLA 2F5CA 3ZMDA 1J59A 4U7BA 4HF1A 2JPCA 4IRHA 4LFUA 1FC3A 3Q9VA 4L5JA 2A6HF 5H20A 1HW1A 3BWGA 1BN5A 2XIGA 3DP7A 3DV8A 2CFXA 1I5ZA 1O3RA 4YFXF 1MDMB 2M45A 4A12A 1P92A 3T1BA 4AVPA 1EH6A 2W57A 4LLNA 1S3JA 1GVJA 2ESHA 3KZYA 4OINF 4O3MA 3RPQA 1D8JA 3KETA 4A0YA 3L00A 1U8RA 3REOA 1P4WA 3I53A 3EYYA 4A6EA 4KYWA 1I27A 3ZQ7A 5HVQC 1SMYF 1KQ9A 2H6BA 3MQ0A 5LRSA 3F22A 1FP1D 1D3YA 1ZN2A 3TO7A 2RV8A 3EDPA 2Z99A 3ZMUA 5D4RA 3R0JA 3ISPA 4AIKA 1R1VA 5ILSA 1Z7UA 2LNBA 3ZP5A 1IN4A 4I7HA 5D8KB 1YW9A 4ENKA 2W84A 3CUQC 2XROA 3HHHA 5H6RA 4BHCA 2XRNA 4NB5A 4EM0B 2OU2A 2ZNYA 1TQPA 4L5IA 2HR3A 2MH9A 3L9FA 2K4JA 1QNTA 3F21A 1MDMA 5K1YA 2DFIA 1MJAA 4OOIA 5E8IA 2OZ6A 2DW4A 5E1ZB 2KRFA 3IWZA 3FMRA 2PMUA 2QM3A 4WXCA 1YW7A 3BJOA 4GCVA 1XN7A 1K7AA 4MTDA 1KYZA 3V8KA 5D6EA 1B9MA 2Y75A 2PN6A 1RUOA 3KLOA 2VC1A 2E7XA 2GIVA 2X4HA 1YLFA 2GA2A 2A61A 2CSOA 2LF8A 1FNNA 4IJAA 4KT5C 1QZZA 4G9YA 2YU3A 1ZARA 1ZHFA 4HV6A 1BIAA 4ESJA 2EFWA 4HV5A 4EM1A 3HTSB 1G3SA 3GVAA 3E5UA 4KIBA 4I98B 1G4DA 5EEGA 4BHPA 5BQTA 2EFQA 1SD6A 3H3ZA 3WTVC 2COMA 2RDPA 4RGXA 1WSUA 1P4AA 5TJJA 1SMTA 4HLYA 3U2RA 3HRUA 2PG4A 2VBWA 2GA1A 6PAXA 4CO8A 3WE3A 5JI6A 3NEUA 4A5MA 2IA0A 5HLHA 3TO9A 2O8XA 2QUFA 3RDIA 1YW8A 2G9WA 4GYGA 4EQQA 2NAZA 5CVJA 2HTSA 2XAGA 3OOPA 1R7JA 5E1WA 1CGPA 3ECHA 5F1RA 1TQMA 2BYVE 2RGVA 2F5EA 3U1DA 3HSFA 2P7VB 1BI1A 4DNCA 4BH9A 3L2CA 3BJ6A 1XCBA 1ON2A 3K2ZA 1KYWA 4ETSA 4MHGA 2AS5F 1IN8A 3JW4A 2OQGA 2OQRA 3WG9A 4IF4A 2GXGA 2L3DA 3E6MA 4G7ZF 2M5WA 2ZJ2A 2ISYA 5J8CA 4ASNA 3PQKA 5ILUA 3J81K 2ZO4A 3FF5A 3L7WA 3E6BA 4L9VA 4TV7A 2VE9A 2HKXA 1EH8A 2IP2A 1BI0A 4N0BA 4IRIA 3WTTC 1QQIA 1Z6RA 5JR3A 4N9IA 1Z91A 4HAMA 1FPQA 1LDJA 1FYLA 4L9JA 2GQQA 2FE3A 3O6BB 3RYPA 2HZTA 4U7DA 4U0WA 2BBYA 2V9VA 3FXRA 3FX3A 2VOOA 3TDZC 4M73A 1D8KA 2ZKZA 1OKRA 4M9XA 3MZHA 4KMUX 3F8BA 3MEXA 4GGGA 2A5YB 3SZTA 1KU9A 5A2QZ 3GUDA 1IUYA 3DKWA 4Y15A 1V4RA 2X0LA 1XGMA 4ON0A 3L09A 4XRFA 2YPRA 4MQ9F 3QRFF 4M74A 3ZPLA 5A2QK 1B1BA 3ECOA 2KJBA 4JBAA 3J80Z 1TW2A 4HZFA 3CTAA 3VOEA 4LB5A 3FMSA 1T39A 1PP7U 2XKOA 1R36A 1JHFA 1W7PD 2XV4S 3J80K 3CDHA 1K79A 2HWVA 4HX7A 3IL2A 5D5XB 4Y13A 4KA4A 5BPIA 5K5RA 1MJBA 3RKXA 1J75A 3W6KB 3LFKA 2OBPA 5DD4A 1W4MA 4CZZA 1MD0A 1XSXA 2XAFA 5BPDA 3K9TA 1B59A 1TLHB 4UHTA 5FGMA 4WF2A 3K69A 3GFLA 4RS8A 2QYOA 2VT2A 2R7DA 3WTWC 2PFBA 4A5NA 3WGGA 1PP8F 5HDNA 4UV8A 1B9NA 3HOSA 3U9GA 1ZYRF 4O5VA 2A6EF 1H0MA 2Z33A 3WGIA 3WU1B 3FXQA 1FSHA 1FZPB 5E18F 4Q4ZF 4OIOF 1FY7A 2YX7A 1FBQA 3WTXC 1REPC 3LA2A 3VEPA 2FEZA 1IZ1A 3GZ5A 4GXOA 4XSZF 4ZH4F 3GWZA 3TOBA 1JXSA 4BNCA 2BGCA 4R79A 2HOEA 3RYRA 3TDUC 1KA8A 3LAJA 4UNOA 3ERED 3CJNA 4LK0F 2EA2A 4FX4A 4ZZDA 4CHUA 3F3XA 2M87A 3D0SA 2PLYA 2LSOA 5CVUA 1UFMA 5LGNA 4KICA 3EUHA 3JTHA 3Q9SA 1UHWA 1NHAA 2V1DA 2CQKA 1S7AA 2UXNA 2CO5A 1YS6A 4ZYEA 1YIOA 3C7JA 2O6GE 1ZG3A 2HTJA 1T6SA 2XGXA 4WX9A 2KIUA 4LB6B 4A0XA 2XUBA 2Z5UA 4UVCA 5FO5A 3MCZA 3O3KA 1SFEA 2D45A 2RVCA 1QO0D 2JT1A 4S05A 1BC8C 1BM9A 4G94A 4G6QA 5HDGA 4CYDA 2QWWA 5IT3A 4RGRA 2W85A 4KIFA 1U78A 1U5TC 2J5PA 2DK8A 2M8EA 4RGSA 1U2WA 3JTGA 4WXHA 4A6DA 1UHMA 2WWYA 3LAPA 2FNAA 1E17A 2R7FA 5ICFA 1OYWA 1FX7A 5J8FA 3IWFA 2NS0A 3JSPA 5H6QA 4ZYHA 2W24A 4H0EA 1SD4A 3H92A 4AIHA 4OMYA 2DTRA 3DEUA 1E2XA 1IF1A 5BOXA 2PMHA 2EFNA 1FP2A 4IXAA 2A68F 4UVBA 2EA4A 4FT8A 3SHFA 3LQRA 3K1MA 2H94A 4ZYDA 2P5LC 1TW3A 2KIFA 5AONA 4M72A 4YFNF 3I5UA 2JPBA 2QQBA 3ABTA 4I0BA 3T8TA 3ZMTA 2HGCA 3QP6A 4R1HA 2VBZA 3E6CC 1YG2A 3P9IA 3R61A 3KLNA 1JGSA 2FU4A 2K4BA 2QLZA 1K78B 3I64A 4ENJA 5D5WB 3DXJF 4JK1X 4RB0A 1IN6A 2Y0MA 2ADUA 3KZZA 2NNNA 1J7KA 5KK1A 3MWMA 5L3GA 4ESFA 4M6YA 2HYFA 4IHTA 1ZRDA 3FXUA 1DPRA 2DU9A 2HFHA 1XDUA 4I09A 2ETHA 3KCCA 4CXFA 4MEXF 4PGHA 5D8LB 4MNUA 1HKSA 3JAMZ 2DO7A 1T0FA 5CLSA 4NHJA 3RIRA 1O7LA 1XGNA 5LBQA 1ZG5A 4KFCA 3M9AA 4KDPA 3GX4X 3HRMA 3QP5A 2P8TA 3HSRA 3ML6A 1YYVA 4WXDA 4Q47A 1X3UA 2HQRA 3B73A 1RI7A 4OU0A 2QVOA 4G6DA 1F4KA 1FOKA 2EFOA 4LLGF 1C0WA 3PFIA 4MQVA 4B09A 2STTA 2RQPA 1LEBA 4P96A 3F23A 2QBYB 1GXPA 3HYIA 5CVVA 1K78A 3TQNA 4BAYA 3IHUA 2QQ9A 1G6NA 2G7UA 1LJ9A 2LDUA 1ZAOA 3T5XA 1ON1A 1U5TB 4HBLA 3RJPA 1WI9A 2FNPA 5LGTA 2L4MA 3ZN0A 4I0AA 3F8FA 2HQNA 2H09A 3ZN1A 2VONA 3E97A 2VODA 1IW7F 3R60A 3E5QA 1XCVA 5LLQA 2IA2A 1RIOH 1F9NA 3K0LA 3V7CA 4EVIA 3GFJA 1FYKA 3LA7A 1PUEE 4LG0B 4B8XA 4O6JA 4UV9A 2CWEA 2L4AA 2O3FA 1P2FA 2GXBA 4E70A 1LVAA 2UZKA 3FMQA 4WK8F 1Q1HA 3I54A 4UVAA 3I4PA 3GZ6A 4P55A 2MLKA 1R22A 5ED4A 1S8NA 1UCRA 4P9UA 4IVNA 2MLGA 5BMZA 4HA8A 2DI3A 2QBYA 2DBBA 2NRAC 3CUQB 3KP3A 1BOAA 4QLCU 2XAQA 5D4SA 5DCFA 1SD5A 4BXUA 2ESNA 5HS9A 1J5YA 3V7RA 4HDUA 3BROA 1U5TA 3Q5FA 1F5TA 5DV5A 1W5TA 4HW0A 1P4XA 2DQRA 3GFMA 2YX4A 3HRSA 1LDDA 5EEHA 1IN5A 4FHTA 4M71A 4HOBA 3BDDA 2ELHA 5F6FA 1T38A 5FFXA 4LG0A 4DQ2A 3V4GA 3AAFA 4IPAA 5LEKA 3RPUA 3FM5A 1FT9A 4L0YB 4L9TA 4HX4A 3KE2A 3NQOA 4M9SA 3IRQA 3T8RA 2VN2A 5TRDA 3MZYA 2J5OA 1ODDA 2IW5A 2FSWA 1R23A 4P9FA 4RB1A 1TNTA 3GLXA 1ONVA 2BE5F 1STZA 4G8XA 4IRGA 2LF7A 2KKOA 3F8NA 1MGTA 3KP7A 4R8HA 1LQ1A 1IRFA 2DPUA 1I6XA 3CUQA 3WTUC 1WKMA 1O7FA 1HSJA 5JVTA 1RNLA 1GXQA 5E17F 3LA3A 1G3WA 2VBYA 3P9CA 1Z05A 5JHUA 2PI0A 1YQAA 4U0VA 5K5OA 3HOTA 1KQ8A 1ZH5A 1XSVA 5HLIA 1H9GA 2B0LA 2D1VA 1ZGJA 1BI3A 1O3SA 1HSTA 2HS5A 4YG2F 4K2EA 4ZYGA 3WTZA 5DYMA 2C6YA 3I0TA 1DP7P 3M7GA 4U88A 5L3BA 5ICEA 1BIBA 2VT3A 2BEOA 1XB4A 2JSCA 1W7PB 3O2PE 1JHHA 5E1XA 4ENNA 3J7AO 3E6DA 4BQAA 4I01A 2GAUA 2E1NA 2A07F 4EJOA 3F72A 1R00A 5J6XA 1VTNC 4WWCA 2RNJA 5FB2A 5DEQA 2P7CB 3TOAA 2XASA 1BJAA 3GF2A 3HRTA 4S04A 2TDXA 4MEYF 4AIJA 2G7HA 1B6AA 2IVMA 2VOPA 5ERIA 2Q8KA 2EV0A 3G3ZA 1F1ZA 1LNWA 3LWFA 4ENMA 4GO1A 4XSXF 3P7NA 2FXAA 5E20A 1FWZA 2O61A 5D5VB 1P6RA 3BY6A 1EH7A 2EFPA 3S2WA 2IRFG 3V7SA 5KVRA 1OPCA 5DDGA 3LSTA 3VFZA 2W25A 2CG4A 3I59B 1QBJA 1EV7A 2V1UA 4CDGA 3IC7A 5K5QA 2OA4A 2RKHA 5AIPA 2FOKA 2P4WA 1L3LA 1KGSA 2MC3A 2FBIA 4PZJA 1XSDA 1Z1DA 5L3EA 2XHKA 3DQVC 2CGPA 5CJ9A 1SFUA 2XAJA 1W7PA 4HDVA 4PCQA 4CGZA 2E7WA 5HS7A 3C1DA 4LLLA 3DF8A 5LEJA 2L02A 3F8CA 4LJZF 4XBFA 4EGYA 2H6CA 4MGRA 4PDKA 1MZBA 2EV5A 4AWXB 2IT0A 3KP6A 4EJVA 5LHIA 2MH2A 3FZVA 3KP4A 4Q5SF 1YS7A 2VC0A 3BPXA 5HOOA 5DCMB 4AD9A 2OAZA 3RI4A 5D6FA 3IKTA 1IRGA 3BJAA 1R1TA 3DFGA 4NQWA 2CYYA 5FLXZ 1UB9A 3V8LA 3MFKA 1Z9CA 3GFIA 5E8GA 3I59A 2IJLA 5ILVA 2K7LA 5HS8A 2OD5A 4N9HA 5FLXK 3ABUA 4KUMA 1O3QA 5L3DA 3KP2A 4HQEA 3SQNA 1XMKA 3LQQA 2V79A 1XD7A 4HF2A 1TNSA 3CO6C 2DPDA 3WGHA 3TGNA 1JE8A 1O3TA 3VODA 3DPTA 1HKTA 4BYYA 3EETA 3QPTA 1YFHA 1LEAA 2VXZA 1OR7A 3V8JA 1Y0UA 2MBFA 4HF0A 2FQ3A 2EK5A 1FYMA 1AOYA 2IPQX 2EB7A 2HKOA 4EM2A 4I02A 4P5OA 3B02A 5JFRA 2FMLA 1J2XA 1RUNA 2ZBKA 1D5VA 4UXNA 4F7ZA 3BOQA 3QU3A 4EGZA 3M8EA 4YFKF 4YIIA 1TTYA 5DCMA 1HXDA 2DT5A 5ICGA 1QPMA 4D0PA 1KU3A 3JAMK 1SD7A 5DUIA 3C3WA 1KQ0A 4RGUA 4KMFA 1DPUA 4HYEA 4ZZLA 3ZMZA 3ZMSA 3OV8A 3QU6A 1R58A 1O57A 1HKQA 2F5DA 1S7OA 4JQFA 3WU0A 3TKYA 4MTEA 2LKPA 3E3VA 2QENA 3PQJA 2Y48A 4L9NA 1WRJA 1T98A 3HIFA 1T2KA 1U3EM 2KJCA 5IT9Z 3HSEA 1ZGAA 3FM3A 1ZREA 4RB3C 5LRRA 3CLOA 2P5KA 2EV6A 3M1EA 5IT9K 2HDCA 2XKPA 3BP8A 2DAOA 3N97A 5FFZA 1G3TA 4G7OF 4OIQF 3HTUA 4QWQA 3GXOA 2NNYA 3D5LA 2WTEA
chains in the Genus database with same CATH superfamily
3W6JB 2WBMA 2XGDA 2ZSHB 2QZ8A 1R5GA 4JYKA 3MKLA 3BR0A 5LHGA 4IKFA 2K3PA 5CVIA 3F9KA 3HB9A 1J9IA 4EJWA 3NRVA 1DUXC 2OF7A 1S29A 2ZCWA 2UXXA 1Y8QB 2DLLA 4LK1F 5F64A 3GTMJ 1HW5A 2ZXWH 4Y4RA 3EUHC 1WWXA 1Y6IA 2I8DA 1K61A 3BQYA 4UUSB 1X1AA 5IY5H 1ZRFA 5HDKA 3SFZA 3RKYA 3S93A 2ZFWA 3RZDJ 1HA8A 2KLOA 2ISZA 2RN7A 2IA1A 3HUGB 4RAZA 4Z2YA 3HEFA 1JKPC 4OAYA 4A2UA 1LDKB 1R4MB 3DWLE 1GVDA 3LNQA 4ESBA 1BOBA 1RRJA 4B3XA 4DBQA 4IHVA 2WV0A 2BV6A 3B6CA 3DPLC 3H0GJ 5EYRA 3BT9A 2H8RA 1Z67A 3VYUB 3GTGJ 3RQIA 4FX0A 2MA3A 2DJNA 5J40A 2EWNA 3K1PA 3GYHX 2L0KA 1DDNA 3M8FA 1USSA 5CPRB 3IAS2 3KYCB 1R6RA 3OS2A 1T08B 3DEEA 2FJ1A 3BZ6A 5K7HA 3OS0A 1ETQA 1R9TJ 3LMMA 2HEOA 4BE2A 1OYYA 2EJRA 5ICCA 1IXCA 2LY9A 1E3OC 2CV0A 4A3DJ 2M9HA 4LD5A 2JVGA 1PUFA 1BA5A 4EJUA 2FRHA 1HW2A 4A69C 2HI3A 1ZLKA 1TQIA 3R4KA 2M4KA 4BKXA 1JKOC 1H8AC 4RM2A 4M9ZA 4OIPF 1H9TA 5L3CA 1ZLJA 3OYMA 3I58A 4KNYA 2M1BA 5DUKA 3I4NJ 2F2EA 2XRLA 2A3SA 1P7IA 1XMXA 2DMPA 5JLXA 4HSTA 3JSOA 2HQAA 3J81Z 2KRHA 5BS6A 4PGGA 4RB2C 2JRTA 5L3FA 3K4KA 1LFBA 2DQLA 2MD5A 4U87A 4DYCA 4OMZA 4FISA 2K27A 2ZB9A 5EF6A 2LP0A 3TW6A 2ZNZA 1USTA 1TWFJ 4M3EA 1HQCA 3HHGA 1KU7A 1JKRC 2XAHA 4RAGA 1CF7B 1XMAA 2JTVA 1A04A 3ESWB 5EZHA 1J0RA 1MMAA 3RTRA 1KU2A 1A6QA 3GEZA 2HXIA 3H3UA 1UAAA 3UR3C 4BEHA 3GTJJ 3G71I 2M30A 3Q3SA 1D5YA 1IXRC 3OYIA 3SZPA 4C3JJ 2L54A 4QIWN 4EMSA 4KIGA 2CUEA 1ENHA 2YSRA 3COAC 2DK5A 1ETKA 2D2WA 4XONA 3QAHA 1Y0NA 4LMYA 1TBXA 4CICA 1MKMA 2V1XA 4AIDA 5DS9A 2HDDA 4RAYA 2IBDA 2WAEA 3ZMVA 3TEDA 2OC6A 3EQLF 5LHHA 1OISA 1FLIA 4LGWA 1R71A 1ETOA 5F1JA 4UUSA 1O4XA 1XDSA 2PBIA 3LSPA 1GHCA 3PFYA 2XVCA 3P9KA 4LITA 3WE2A 3HUGA 2H27A 1YO5C 3WTYC 4Z6YA 2DA4A 4Q48A 3TO6A 1QGPA 4XLNF 1AHDP 3S2DJ 2NYXA 2PEXA 3BTCA 1Z21A 4YIFA 2ZSIB 1HBXG 2DOEA 3WHCA 3ELKA 3G73A 3K6GA 1JKQC 3ROUA 2F5VA 2P5VA 3CUOA 2NVYJ 2QQAA 3KEOA 3LSIA 3ULQB 1K4SA 2VBXA 3IKVA 2FMYA 3F6OA 5CKTA 2FF4A 1S9HA 2VB6A 3T0YA 4BQNA 2Q2EB 4L0ZB 5B5EC 3FKJA 2M4GA 1SFXA 2P6SA 3C2HA 1IXSB 4KN7X 4C9YA 2Z2SB 3A0HC 4IQ4A 1GV5A 4JX4A 1DU0A 4UUVA 2JZYA 4WCGA 2O03A 5HNHA 3FWEA 3M07A 3K1NA 4IHSA 3N4MA 4XRSG 3KEYA 4XLPF 4I2OA 1DU6A 2IEKA 3LOCA 4HEA2 2P0WA 5GAEJ 2VLAA 5KAFC 4RLFA 2ZMEB 3OYDA 3GW2A 4M3FA 4E4HA 3CO7C 2FBHA 3R6SA 1I6HJ 2OPTA 4GYIA 4KITB 1K6OA 1W5SA 4RLQA 3WG7H 2GXAA 2YR2A 1T0FC 5EG0B 3HOYJ 5HLGA 5CVRA 4DBRA 1S6LA 2P6TA 2KISA 2V6CA 3ZQIA 3GLLA 1CF7A 1PDNC 1SAXA 2GWRA 2CW7A 2DODA 2K02A 2IGKA 3I4MJ 2Q0OA 3VB2A 3EUKL 2HYGD 4M6XA 2L01A 2MD0A 3KFWX 1AWCA 3OL3A 5D5UB 4DYQA 1ETYA 1B4AA 1F43A 1A31A 4EV0A 5H2FC 2ZJQF 4LIUA 1V3FA 1R5HA 2HQ5A 3WODF 1FBUA 1I1GA 4HLXA 3F6VA 3RZOJ 1YTYA 3QYEA 1IAWA 1S72I 2JJ7A 2LC2A 1BC7C 2LOOA 1ZRCA 2F5FA 2FQ4A 2WB1A 4ABZA 2ZXJA 4HQMA 4KN4X 3QOPA 3SXYA 4U0YA 1OCRH 2STWA 3FISA 3K4CA 2K9MA 1G3YA 3JRAA 1FMVA 5E3LA 1X1PA 3KP5A 1MH4A 3QPHA 4E7LA 4XOPA 3C18A 2L2OA 2UWMA 3I71A 5FD5A 3GO5A 1QZYA 1BBYA 3RKWA 5LGUA 3A01B 2JK3A 3BR1A 2R5YB 4QTRA 3W2AA 1XGOA 3VSLA 1BI2A 2JA2A 2OZUA 1JT0A 4A0ZA 3FK7A 2VE8A 1OMIA 4C2MJ 1LB2A 2KHMA 2Q2EA 4ZDOA 3EYIA 4B3AA 3MAJA 4Y17A 3R0AA 1EA3A 1WQ2A 2DDAA 1ULYA 2O0YA 2RNGA 3AG2H 1I1SA 4EJTA 1L0OC 2XB5A 1RKTA 2FA5A 1DP3A 1WJCA 1WHUA 2OTLI 1VI0A 1KZHA 3H0DA 3C2BA 1IN7A 3D1NI 1MMSA 4HX8A 4L18B 4A3BJ 2VKVA 1G2HA 5GPCA 2WY7Q 1RZ4A 2PQ8A 2GOMA 4G7HF 3TP3A 2ZMEA 2K86A 2A69F 2XGEA 4BS9A 1BJZA 1ZG1A 3E5XA 1EF4A 2E1CA 1NG7A 2Z3YA 3Q0VA 5EG0A 2WC2A 2GZWA 1OYIA 1XGSA 3F8MA 2FBKA 2KFDA 1N25A 1R1UA 5F0CA 4E6KG 2NVUB 4IO9F 5LFAA 2CW0F 2COBA 2RC4A 2LLKA 1U6GA 1GUUA 2DXIA 5CYVA 3FHZA 1Z6TA 2LR8A 3BPVA 4BHBA 3L1PA 4EEFG 1Q1VA 2Z9OA 3M1CA 2AO9A 2KIMA 1HF0A 2L7MP 3WTSC 1KONA 3H9GA 5FRMA 2PJPA 3KEQA 4D7MA 2D1HA 2R3SA 3IRRA 2ACJA 1V5GA 1MJ9A 5AIQA 1OLTA 2X1EA 5DD8A 4OIRF 2BZTA 2VASA 1FBSA 5FD6A 1B8IB 1FSEA 2AXLA 3DPUA 2F5CA 3ZMDA 1J59A 4U7BA 4HF1A 3LSJA 2JPCA 4IRHA 3JR9A 4LFUA 1FC3A 3SZGA 4G6TB 3Q9VA 2IAIA 3SYTA 4HNTA 4L5JA 2A6HF 3FIWA 2R7OA 2NS7A 5H20A 4JX6A 3MVPA 4XORA 1X4PA 2D5VA 2EH3A 2CQNA 1HW1A 2JMWA 4L5EA 3BWGA 1BN5A 2XIGA 3DP7A 3VYRB 3H5RA 1SFOJ 3DV8A 2CFXA 1QHHD 3A01A 4CCKA 2HVSA 2LH9A 2E5NA 1I5ZA 1O3RA 4AC0A 4YFXF 4X1EA 4BU2A 3ZQHA 4C3IJ 2NOGA 1MDMB 3G1OA 2M45A 4A12A 3DTIA 1P92A 4I76A 3T1BA 1ETXA 3M3YJ 4AVPA 4CH7A 1EH6A 2W57A 1ORKA 5J1YA 2QSFX 4LLNA 1S3JA 2DA5A 1ETVA 5BNGA 4A3MJ 1TP4A 4II3A 1GVJA 4BBRJ 3IAM2 1UHSA 2IXSA 1ZKGA 3CLQA 2ESHA 2O7OA 1JGGA 3KZYA 4OINF 4O3MA 3HOZJ 2CQXA 2E1OA 2JUCA 3RPQA 1D8JA 3OYEA 3KETA 4A0YA 4W97A 3L00A 1U8RA 1MBEA 3REOA 1P4WA 3I53A 4DZJA 3EYYA 2VQLA 2MC4A 4A6EA 3CDIA 4BQQA 5B66C 4BL0B 2LVSA 4RMNA 3FHNA 1MSFC 1NK2P 4KYWA 5FLVA 3HJEA 1MNDA 1I27A 2A5WA 5F04A 5TISC 3ZQ7A 1RR8C 5HVQC 1SMYF 3D5RC 1UELB 4FASD 1RR7A 2ZFUA 3DLLF 2CU7A 1KQ9A 9ANTA 2KMUA 3GCMA 2H6BA 3BR3A 3MQ0A 5LRSA 3F22A 1FP1D 1D3YA 5F27A 2CFOA 1ZN2A 3TO7A 2RV8A 2OV7A 3EDPA 2Z99A 1BR2A 4YEJA 3ZMUA 1IV6A 3X2QH 2HZDA 2XF7A 5D4RA 4M3BA 1B8IA 3ABLH 4E7IA 3R0JA 3ISPA 2Y0SA 2AHQA 2DN0A 4XL9A 4XM3A 4AIKA 1R1VA 1AKHB 2LTPA 3RKQA 2R93J 2BW3B 2BXYA 5ILSA 1PVEA 1Z7UA 5EEAA 2LNBA 2BY1A 3ZP5A 1FOYA 1IN4A 4I7HA 5HODA 4F55A 5D8KB 3E1SA 3S15J 2OUMA 1MIJA 1Z3XA 3TW7A 5J4YA 1YW9A 4ENKA 3CC7I 3HPGA 2W84A 1G8XA 3CUQC 3S8PA 2XROA 4D5FA 3HHHA 4BUPA 5H6RA 4II2A 3SFIA 2XRNA 4NB5A 4BHCA 4EM0B 2OU2A 2FX0A 1TQPA 2JWTA 2ZNYA 2HR3A 2MH9A 4L5IA 3ZQGA 3L9FA 3ZQQA 2K4JA 1VF9A 1QNTA 3F21A 2B63J 1MDMA 5K1YA 4UB6C 2DFIA 3OY9A 1X2NA 1MJAA 4NUBA 4OOIA 5E8IA 2QEXI 1AU7A 2OZ6A 2DW4A 5E1ZB 2KRFA 2VJJA 3OS1A 3IWZA 3FMRA 4XOTA 2PMUA 1UG2A 2QM3A 5J1RA 1SVLA 4XK4A 3HGYA 3L2VA 4WXCA 1YW7A 1ZK8A 3BJOA 4GCVA 1XN7A 3QWLA 1K7AA 4GRIA 4MTDA 1KYZA 4FE7A 4LIVA 3V8KA 5D6EA 4DZPA 1B9MA 5FLMJ 2Y75A 3J7YJ 3CCMI 2PN6A 5J1UA 1RUOA 4Y3OA 3KLOA 2VC1A 2O8KA 2DMNA 2E7XA 2GIVA 3QQAA 2X4HA 1YLFA 2IGOA 2GA2A 2A61A 4CA0A 2R7RA 2CSOA 5DM6F 2LF8A 3FDYA 1FNNA 4IJAA 4KT5C 1FIAA 1QZZA 4G9YA 1MW7A 1ZARA 1ZHFA 2YU3A 4HV6A 1AA7A 3BC8A 5FKKA 1BIAA 4ESJA 2EFWA 3BR6A 1VQ5I 4HRIA 4HV5A 4Y52J 1FTZA 1PYVA 1GV2A 5GAGJ 4EM1A 3HTSB 5IOYA 1G3SA 3GVAA 3E5UA 2BHZA 3QODA 3ZQCA 3OSGA 4KIBA 4I98B 1G4DA 5EEGA 4BHPA 5BQTA 2BOLA 2EFQA 1SD6A 2CRGA 3H3ZA 4RGXA 2COMA 2RDPA 3AG3H 3WTVC 1AKHA 2BW3A 4AUXA 2DA3A 1WSUA 1UJ8A 1P4AA 2HOSA 2QCOA 5TJJA 4FETA 1SMTA 3GZNB 4QPOA 1MBJA 2N8GA 4HLYA 3U2RA 3BG6A 3HRUA 2PG4A 3RPUD 2VBWA 4XKVA 1DGWY 4MIMA 2GA1A 3GMEA 6PAXA 4CO8A 3WE3A 5JI6A 3NEUA 1X3ZB 2BVLA 2LBFB 3BZCA 1Y1VJ 2B7EA 4A5MA 2IA0A 5HLHA 3JRDA 2R4GA 4BBSJ 3TO9A 2O8XA 3H35A 3BG9A 1A35A 4IEJA 2EPFA 2QUFA 1GLNA 2KPMA 4MLOA 3RDIA 4S0HB 1VQNI 1YW8A 1TWCJ 2G9WA 4LG3A 4GYGA 4EQQA 2NAZA 5CVJA 2HTSA 2XAGA 3OOPA 3QYFA 1R7JA 5E1WA 3CP2A 1R49A 1CGPA 1MBHA 3ECHA 5F1RA 1TQMA 4PFOA 3A2KA 3SJMA 2BYVE 2RGVA 2F5EA 2JVHA 3VDXA 3U1DA 2LREA 3CJRB 3HSFA 2P7VB 1K6YA 2HOTA 3AL0C 3AFHA 1BI1A 4DNCA 4BH9A 1HC8A 3L2CA 3BJ6A 3OIQA 3G1LA 4V2GA 1XCBA 3GBGA 1ON2A 2DT7B 3K2ZA 1Y1WJ 1NTCA 4PUSA 3K70D 2PJRB 3BCAA 2R7WA 1OCPA 1KYWA 3DKXA 4MHGA 4ETSA 2BXZA 3I55I 2GOXB 1NK3P 2AS5F 1IN8A 3JW4A 2E19A 2OQGA 3PIPF 2OQRA 1LUJB 4N4OB 1VQOI 3F0CA 1XC5A 3WG9A 5EGOB 4IF4A 2GXGA 2XGCA 4A3CJ 4ZJZA 2L3DA 3E6MA 2E71A 1X58A 4G7ZF 2M5WA 2BY3A 1YX3A 2ZJ2A 4X6AJ 2ISYA 5J8CA 3HKZA 4ASNA 4KT6A 3PQKA 5JHFA 3OYNA 5ILUA 2R7VA 3J81K 2ZO4A 3FF5A 1EKEA 3L7WA 1P7JA 4BGDA 5M5YJ 2R7UA 3E6BA 4L9VA 4TV7A 3VWBA 2VE9A 4RM3A 2HKXA 2LBFA 3QOEA 4ZDLA 1EH8A 5GTIC 3OYBA 3CCQI 2IP2A 1BI0A 1U0JA 4N0BA 4IRIA 3IUOA 2WAQA 4M3DA 2QQ8A 3ZOBA 3WTTC 3L2WA 3ABMH 1QQIA 3LL7A 2VUMJ 1I3AA 1Z6RA 4A3IJ 5JR3A 4N4NB 1X1CA 4N9IA 1Z91A 4HAMA 2VKEA 1FPQA 1LDJA 1FYLA 4RDUA 3CC2I 4L9JA 2GQQA 4J19A 3G1MA 1WVRA 3O8HA 2FE3A 3M4OJ 3O6BB 3RYPA 2HZTA 4U7DA 4U0WA 4D7NA 2BBYA 2V9VA 3FXRA 3FX3A 4FTHA 2VOOA 4QPQA 3TDZC 2X51A 2X6YA 4M73A 2HPMA 1D8KA 2ZKZA 3DU6A 1OKRA 4M9XA 1UMQA 3MZHA 4KMUX 2K40A 3F8BA 3MEXA 4GGGA 1A5JA 2A5YB 3A02A 2DA2A 4M3GA 3PNYA 3SZTA 1KU9A 3OR2C 5CQEA 2R92J 5A2QZ 3GUDA 2F48A 2E1MC 4B47A 1IUYA 3DKWA 1OR7C 4Y15A 1V4RA 2OCEA 5IPAA 5B3SH 3S14J 2OJED 4X0GA 4C2TA 2X0LA 1XGMA 1Y8RB 4ON0A 3L09A 5DM7F 4PJJA 4XRFA 3HL2A 2YPRA 4IOCF 4HG2A 2XPUA 2PJRA 4CCMA 4MQ9F 3QRFF 4M74A 3ZPLA 5A2QK 1B1BA 3ECOA 1ZQ3P 4E7JA 4JP0A 2KJBA 1D1BA 4XNFA 2NS8A 4JBAA 2XPWA 4HZFA 1TW2A 3J80Z 4YIRX 1OCCH 2VL8A 3CTAA 4D9JA 1SVOA 1MMNA 3VOEA 4LB5A 2K9QA 5EGOA 3FMSA 1T39A 2LKXA 1BW6A 1PP7U 2MFZA 2XKOA 2QSHX 5C4JJ 1R36A 1QPIA 1IJWC 1JHFA 1W7PD 2XV4S 5GP9A 2L5QA 3J80K 2PMZN 3CDHA 2KZGA 3L2RA 1K79A 3OIOA 3VSKA 2HWVA 2DYRH 4YRVA 1TT5B 4HX7A 3IL2A 3A0BC 5D5XB 4Y13A 5FJ8J 2KZVA 4KA4A 3PNVA 3D5SC 3SEQA 2Q1ZB 3EUAA 4PJLA 1K83J 1RESA 5K5RA 5BPIA 1MJBA 2R5ZB 5F0HA 3RKXA 1J75A 3W6KB 3FKIJ 2QGUA 1T8IA 3HDDA 3MKWB 3LFKA 2V4JC 2OBPA 5DD4A 1W4MA 1VQLI 5C44J 2VQHA 1E0EA 4CZZA 4DGWB 2ID6A 1MD0A 4C3HJ 1LVKA 1XSXA 2XAFA 3OL4A 3TL4X 5BPDA 3K9TA 1B59A 4XMYA 1TLHB 4UHTA 4BJ6C 5FGMA 4WF2A 3K69A 2HVRA 3JRFA 3GFLA 5KCMA 4RS8A 2QYOA 2VT2A 4MFDA 2R7DA 3AL0B 3WTWC 3W3CA 3GTLJ 2PFBA 3H1CA 3BG3A 4A5NA 3WGGA 1PP8F 2O5RA 5HDNA 4H4KC 3BR5A 4UV8A 1RKWA 3JRCA 2B9SA 1B9NA 3HOSA 1IUFA 3U9GA 1NG6A 2DA6A 1ZYRF 4O5VA 1YJNI 3M8JA 3QYBA 2AQFA 2A6EF 1J09A 3S2HJ 2G0EA 4CCLA 3QPLA 1JUMA 1H0MA 2V9KA 2CUFA 2MG4A 2Z33A 3WGIA 4V19K 3WU1B 3FXQA 3DBLB 1TT0A 2X85A 1FSHA 4BXFA 1FZPB 2V1NA 3BCBA 4BE1A 2NVXJ 1VQKI 5E18F 4Q4ZF 4OIOF 1FY7A 3SEZA 2YX7A 3CCJI 1FBQA 3WTXC 1REPC 2Z1DA 3LA2A 3VEPA 4A3FJ 2FEZA 1IZ1A 3BTLA 3PUFA 2DOAA 2YUSA 3GZ5A 4GXOA 5TGTA 4XSZF 4ZH4F 3GWZA 2UUZA 2VKHA 1D1AA 3TOBA 1JXSA 3HZJA 3FXOA 4B48A 4BNCA 3S1RJ 2BGCA 2X48A 4R79A 3IV5A 2HOEA 1RPWA 5GAHJ 5LD2C 2LD5A 1SFKA 3RYRA 4B4CA 5IYDJ 2WAFA 2CH0A 2DTZA 3TDUC 1KA8A 2YU9J 3LAJA 1FEXA 4UNOA 3ERED 1R5ID 3CJNA 4LK0F 1LFPA 2V26A 2EA2A 1V54H 4FX4A 4ZTFA 4ZZDA 4CHUA 3F3XA 2RAEA 5CQGA 2M87A 3D0SA 2R5ZA 2PLYA 2LSOA 5CVUA 1UFMA 4CUGA 5LGNA 4KICA 2Z16A 3EUHA 3O8GA 3JTHA 3Q9SA 4A3KJ 3K4JA 4C30A 3Q0WA 1UHWA 3G2BA 4F52A 1NHAA 2V1DA 4DJAA 2CQKA 1YITI 1S7AA 4DYRA 2UXNA 4XLHA 2CO5A 1YS6A 4D5CA 4ZYEA 1YIOA 3C7JA 2O6GE 2DA7A 3HOVJ 1Z77A 1ZG3A 2HTJA 1T6SA 1W5CC 2MSYA 2DDBA 1TZLA 3TBIA 2XGXA 4WX9A 1MBGA 1I50J 2KIUA 4LB6B 2WA0A 2M7AA 4A0XA 2XUBA 2E1MB 2Z5UA 4UVCA 2XB0X 1UG0A 5FO5A 2YS9A 3U21A 3PUBA 3MCZA 3O3KA 1WCMJ 1SFEA 2D45A 1IDYA 1Y56A 2RVCA 3PSFA 4XKCA 2E2JJ 2VJIA 1QO0D 2JT1A 4S05A 3H5NA 3H36A 1BC8C 1D0YA 2XPVA 2R5YA 1BM9A 4G94A 2ZJRF 4G6QA 5HDGA 3ASNH 2EZLA 3FBIB 1T33A 4AYBN 3ZR8X 1N78A 4CYDA 2QWWA 5IT3A 4RGRA 2GLOA 2W85A 3OMYA 4KIFA 1U78A 1U5TC 2J5PA 2GM4A 4JX5A 2DK8A 2M8EA 4BJTA 4RGSA 1U2WA 1SEUA 3JTGA 4WXHA 1Z7LA 4A6DA 1X19A 1UHMA 2WWYA 3LAPA 2FNAA 1E17A 3HC7A 2E36A 2R7FA 5ICFA 1OYWA 3PNTA 2CMPA 2CQQA 3UNGC 1FX7A 1V5EA 2L7ZA 2JA8J 5J8FA 3IWFA 3OOUA 3PSIA 1JUSA 2NS0A 4J00A 4IHYA 1GDTA 2FUG2 2IGNA 2IS2A 3JSPA 1B72B 2NXNB 2L7FP 5H6QA 1R4NB 3WU2C 4ZYHA 2W24A 2UV1A 3CDLA 4H0EA 1SD4A 1VQPI 3H92A 2IS6A 4AIHA 3AG1H 4CYCB 2DTRA 4OMYA 3DEUA 1E2XA 1IF1A 3S1NJ 3PM1A 3CCEI 5BOXA 2PMHA 3S1MJ 2EFNA 1FP2A 4IXAA 4E7ZA 2A68F 3CMYA 4UVBA 2EA4A 3L2QA 3K10A 4FT8A 3SHFA 3LQRA 3K1MA 2H94A 4ZYDA 2P5LC 1TW3A 1WJFA 2KIFA 5AONA 2L9SA 3ERMA 3DEWA 4M72A 3MKZA 4AM3A 4YFNF 3I5UA 2JPBA 3BR2A 2QQBA 3ABTA 4I0BA 3T8TA 4A3LJ 3ZMTA 3A4CA 2HGCA 3JRHA 4F93B 2ELKA 3AG4H 3QP6A 4R1HA 4BY1J 2VBZA 3W6VA 3E6CC 3DCFA 1YG2A 3P9IA 3R61A 1JTXA 3KLNA 2EILH 1JGSA 2FU4A 2K4BA 2QLZA 3JCUC 5EZGA 1K78B 4B1RA 3I64A 2H1LA 4ENJA 5D5WB 3DXJF 1IG7A 1JTYA 4JK1X 3I3LA 3OYCA 4IHWA 3NWTA 4RB0A 2OTJI 1IN6A 5EDNA 2Y0MA 4XQFA 1I3QJ 1FOXA 2ADUA 2VXDA 3KZZA 2EIMH 2NNNA 1J7KA 2ME0A 1N75A 1DGRM 3OR1C 5E3OA 3PO2J 5KK1A 3MWMA 2W48A 5L3GA 4ESFA 1WJDA 1IC8A 4M6YA 2A05A 2HYFA 4IHTA 3OIPA 1ZRDA 3HOUJ 3FXUA 1DPRA 2DU9A 2HFHA 2V7FA 2VPRA 4UY8I 1XDUA 4I09A 2ETHA 2Y30A 3KCCA 4CXFA 3K70C 4MEXF 1XPXA 4PGHA 5J3LA 5D8LB 4MNUA 1HKSA 3JAMZ 4XN0A 3B6AA 1SC7A 2DO7A 3HG9A 1T0FA 5CLSA 3I9V2 1LFUP 1BL0A 4NHJA 1ACIA 3RIRA 5E79C 1U9NA 1O7LA 1XGNA 1SANA 5LBQA 1B72A 1ZG5A 4KFCA 3M9AA 2DOFA 2K5CA 3JRGA 3GX4X 4KDPA 3HRMA 3FXMA 4PJMA 2L9VA 2VI6A 1XG1A 3QP5A 4CYCA 2P8TA 3HSRA 1TL8A 4NC6A 2CUJA 2JRMA 2WB1N 3BQZA 5M5WJ 2MABA 3HM5A 4A3JJ 3ML6A 1YYVA 2IS1A 4WXDA 4Q47A 1G59A 3BZKA 1X3UA 5IOZA 2HQRA 3B73A 4IL6C 3BLYA 3MKYB 4FQGA 4NDLA 4QSHA 1RI7A 3I56I 4BY7J 4OU0A 2QVOA 4G6DA 1F4KA 2XF6A 1FOKA 4KISA 4I6ZA 2EFOA 4LLGF 1C0WA 3PFIA 5IYCJ 1ZGWA 4MQVA 4B09A 2STTA 2RQPA 1LEBA 4P96A 3F23A 2QBYB 1GXPA 3KX2A 1YOVB 1QVUA 4ZDPA 3HYIA 5CVVA 1WH7A 1K78A 1W0TA 3ZGKA 3TQNA 4NC7A 3IHUA 2QQ9A 4BAYA 1G6NA 2G7UA 1LJ9A 2X6WA 4Y7NJ 2E2HJ 2GIZA 3RCOA 3CC4I 1S5LC 2LDUA 1IO2A 1ZAOA 4XLFA 1MMDA 2KDOA 3MN2A 1UZCA 2I10A 3T5XA 1ON1A 2LFBA 2JA7J 1U5TB 2NVQJ 4HBLA 3RJPA 3SDGA 1WI9A 2FNPA 1FMWA 5LGTA 1QU3A 3PIOF 5B1AH 2L4MA 3ZN0A 2QKLB 2H1KA 4I0AA 3F8FA 4FE4A 2HQNA 2H09A 1FOWA 3LFUA 5B1BH 3ZN1A 4C2UA 3QPSA 2VONA 3E97A 3HOWJ 1HDPA 2VODA 1IW7F 3R60A 3E5QA 1XCVA 1I39A 2DT6A 3WHBA 5LLQA 2IS4A 3ZQLA 4IHXA 2KP6A 4LOCA 2MGQA 2IA2A 4E7SA 4PSXA 1ZR4A 4D1QA 2KL4A 1RIOH 1F9NA 3CD6I 1IDZA 1QZEA 3L2UA 2BVMA 3K0LA 3V7CA 1FJLA 4EVIA 2DYSH 4XICA 1W36C 3GFJA 2Y9YA 3CESA 3LA7A 1FYKA 1PUEE 2WV1A 4LG0B 3ZXSA 4B8XA 1RC9A 4O6JA 3DU5A 4UV9A 2CWEA 2L4AA 3HBLA 2O3FA 1P2FA 2GXBA 3GTKJ 4PJNA 4E70A 2E35A 3S16J 1LVAA 4CZCA 3EPZA 2UZKA 3FMQA 2CV1A 4WK8F 3W2VA 2Y9ZA 1Q1HA 1YRNB 3I54A 2M0CA 1V55H 4UVAA 1SAUA 1WI3A 3I4PA 3OYHA 3GZ6A 3KZIC 2DMTA 4P55A 4NC8A 2E60A 2MLKA 1YHQI 1R22A 4F91B 5ED4A 2JA5J 1S8NA 1UCRA 4P9UA 2TCTA 3A1YA 3DBRB 2MLGA 4IVNA 5BMZA 3CF5F 2F4MB 4A3GJ 2R7SA 4HA8A 4GFBA 2DI3A 3H5AA 2QBYA 2DBBA 2NRAC 3K2AA 1LPQA 3CUQB 4RAFA 2ELJA 3HOXJ 3KP3A 3OWTA 1WZ2A 3J7AY 2LK2A 1BOAA 3Q0UA 4QLCU 2XAQA 2EBIA 4ZYAA 5D4SA 1FTTA 1WJBA 3OYFA 5DCFA 1SD5A 2DFHA 4BXUA 4BJ5C 2ESNA 2DMQA 1WGXA 2EZHA 4NBQA 4AYBA 1WPKA 5HS9A 1J5YA 2Y31A 3BTJA 1Z0XA 3V7RA 4HDUA 3BROA 1U5TA 2ZJPF 3Q5FA 5DV5A 1F5TA 5FRNA 2NVTJ 3S3MA 1W5TA 4E7KA 3FXLA 5J47A 1E3PA 1E3HA 2HOAA 5F0FA 4HW0A 4UUTA 1P4XA 4RA2A 4BQOA 2DQRA 3ASOH 2KQRA 3K4MA 1OFCX 3GFMA 2YX4A 2EIJH 2CS3A 3HRSA 1LDDA 4ZTJA 3H9QA 5EEHA 1IN5A 3NAUA 3MD2A 4FHTA 1ERDA 4M71A 4HOBA 1A36A 3BDDA 2ELHA 4Y33A 5F6FA 3CMEI 2W4SA 4AVZA 3J7ZI 3JRBA 1T38A 4PFPA 2QA4I 1POGA 5FFXA 2LKSA 2WADA 3LSRA 4LG0A 1TWHJ 4DQ2A 3V4GA 2Y69H 4AU7A 3AAFA 4IPAA 1QHGA 5LEKA 3FXJA 3BG7A 1YE9A 2MW8A 3RPUA 3FM5A 2CV2A 2FD5A 1FT9A 5FKOA 4L0YB 2Y0SN 3HGGA 4L9TA 4HX4A 3KE2A 3NQOA 4M9SA 3VYSB 1F36A 3IRQA 2OCCH 1MMGA 2Y2ZA 3T8RA 2AQEA 2VN2A 2LMDA 3MZYA 5FKNA 5M3FJ 2BY0A 5TRDA 2J5OA 4BACA 1MSEC 1YRNA 2XDVA 1ODDA 2L7KA 2R7ZJ 4MO7A 2IW5A 2FSWA 1R23A 4P9FA 3ZQFA 4RB1A 1TNTA 3VPRA 1W36D 1OJLA 3GLXA 1ONVA 3PL8A 2BE5F 1STZA 4XLCA 4G8XA 3CCYA 4IRGA 3S17J 2LF7A 2KKOA 3HPHA 3RSNA 3F8NA 1MGTA 2ECBA 3KP7A 4I99C 2JSPA 4R8HA 1LQ1A 1VQMI 1IRFA 2DPUA 1I6XA 3CUQA 3CCSI 2M3AA 3WTUC 1U9OA 1WKMA 1O7FA 1HSJA 5JVTA 1RNLA 2R0QC 1GXQA 5E17F 3LA3A 2ME6A 1ETWA 2VJ5A 1G3WA 2VBYA 3BG5A 3P9CA 1Z05A 5JHUA 1QVTA 4XRMA 4YELA 3S3OA 3K4BA 2PI0A 1YQAA 2XC7A 4EATA 4HNVA 4U0VA 5K5OA 2F6CA 2MYSA 3CMMA 2X1DA 4IZZA 3HOTA 2K9LA 1KQ8A 1ZH5A 3GTQJ 3FK6A 1JJ8C 2W7NA 2F4OB 1XSVA 5HLIA 1H9GA 2B0LA 4DOZA 2ECCA 2D1VA 1ZGJA 1BI3A 1O3SA 2LG4A 1HSTA 2V6EA 2BHYA 2HS5A 2K9NA 2HPIA 2NOJB 3E7LA 4CSWA 4YG2F 3S32A 1TC3C 1IV8A 4K2EA 3AKZA 4ZYGA 3WTZA 5DYMA 2DJIA 2C6YA 4XIDA 3I0TA 1DP7P 1XX5A 3M7GA 2M7BA 5EJCA 4U88A 1LE8B 1YJWI 5L3BA 5IYBJ 5ICEA 2P81A 1JI8A 1BIBA 2VT3A 2BEOA 5KHDA 1XB4A 2JSCA 1W7PB 1D1CA 4DIQA 1VQ7I 3O2PE 1JHHA 5E1XA 4ENNA 3J7AO 4UB8C 3E6DA 1ZR2A 4BQAA 4I01A 2GAUA 3KIOA 2L9NA 1VQ8I 2E1NA 4P1WA 2JQ7A 2A07F 1ZELA 4EJOA 3F72A 1R00A 2X6XA 5J6XA 1HCRA 3ZCOA 1VTNC 3OYJA 4F92B 2RNJA 4ZC3A 4WWCA 4BDYA 5FB2A 2EZKA 3CQZJ 5GTHC 5DEQA 1WJAA 4E7HA 2P7CB 3TOAA 4G12A 2XASA 1BJAA 3GF2A 3HRTA 4S04A 4XRSA 2TDXA 4MEYF 4AIJA 2G7HA 3U1KA 1WFXA 1XTAA 5FKMA 1B6AA 2I5UA 3K7AJ 2IVMA 2VOPA 5ERIA 2Q8KA 2EV0A 2CJJA 3G3ZA 2RREA 3DKYA 1F1ZA 1LNWA 3LWFA 1XS9A 4ENMA 1U8BA 3CCUI 4GO1A 4XSXF 3P7NA 5GADJ 2FXAA 2EQRA 2K85A 5E20A 1FWZA 2O61A 5D5VB 1ITYA 1P6RA 2KT0A 4A93J 3BY6A 3H3VK 1Y39A 1EH7A 2EFPA 4NQWB 2R7XA 1JJ6C 4XR6A 2K9SA 3S2WA 1ZTRA 2IRFG 3V7SA 5KVRA 3KYLA 1OPCA 1SVMA 4XKBA 2GBYA 5DDGA 3LSTA 3VFZA 1X3WB 2QKMB 3K4NA 1RETA 2W25A 3CP8A 4BDZA 2CG4A 3I59B 5IP9J 4KJZA 1QBJA 1EV7A 5GPAA 2X1CA 2V1UA 4CDGA 2M34A 3IP4B 3IC7A 1QA6A 2ZXIA 5K5QA 3JRIA 5E3NA 2R7QA 2OA4A 2RKHA 5AIPA 2FOKA 1JUPA 2ID3A 2P4WA 4ANJA 1L3LA 1KGSA 2MC3A 1MNMC 2FBIA 1NH3A 2V9PA 1MH3A 3CCLI 2E2IJ 3IH4A 2M0MA 3CJQB 2W82A 4PZJA 1XSDA 2RQQA 1Z1DA 5C4XJ 5JVGF 5L3EA 2XHKA 3DQVC 3KYDB 2CGPA 1LE8A 4IQJA 2L9RA 5CJ9A 1BR1A 5HNFA 2M2EA 1SFUA 2XAJA 1W7PA 4B44A 1YJ9I 2XSJC 4PCQA 4HDVA 4CGZA 2E7WA 2BY2A 5HS7A 3OYKA 3C1DA 4LLLA 3DF8A 3A03A 1OQYA 2VKDA 4JOMA 2XF5A 3JREA 5LEJA 1IRZA 2L02A 3F8CA 4LJZF 3FBNB 4XBFA 2CW8A 2QF7A 5KAIC 4EGYA 5HLTA 1BW5A 2JN6A 2H6CA 4V2FA 2HXOA 4MGRA 4PDKA 2EIKH 2LRDA 1HOMA 1MZBA 3CCRI 2EV5A 2E5ZA 3HKZN 4AWXB 2IT0A 4MFEA 3KP6A 4EJVA 5LHIA 2MH2A 3FZVA 3KP4A 5K7ZA 1X4OA 4Q5SF 4XLAA 1MBKA 1VQ4I 1WJEA 2H8WA 3OYAA 1YS7A 2VC0A 3BPXA 5HOOA 5DCMB 4AD9A 2OAZA 3RI4A 5D6FA 2VJ4A 4HPQA 2CUZA 4RBOA 2WAQN 3MZ8A 3IKTA 2W1OA 5C3EJ 1W0UA 1IRGA 3LSMA 2KRCA 5F08A 3C2GA 3BJAA 1R1TA 2IGMA 1Z3YA 3DFGA 4NQWA 3E0JB 2CYYA 5IP7J 3GTOJ 1FIPA 5FLXZ 1UB9A 3V8LA 3UKGA 3MFKA 1Z9CA 3GFIA 4M6VA 5E8GA 5E3MA 2M8GX 3ABKH 2X9DA 3CF2A 3I59A 1H88C 2IJLA 4GDFA 5ILVA 2K7LA 2F4IA 5HS8A 2OD5A 4N9HA 1APLC 1OCTC 5FLXK 4OAZA 3ABUA 2X6OA 2HYJA 4KUMA 1VZ0A 3W2WA 1O3QA 3ONQA 5L3DA 1VQ9I 3KP2A 4HQEA 1T56A 3LSGA 3SQNA 3TMOA 1K4TA 1XMKA 3LQQA 2V79A 4XLEA 4A3EJ 1XD7A 3PO3J 4HF2A 1TNSA 3CO6C 2K3FA 2LY1A 2DPDA 5KNLA 3WGHA 1BR4A 3TGNA 1JE8A 1O3TA 3VODA 3DPTA 2DA1A 1HKTA 5M3MJ 1HDDC 4BYYA 3DLAA 3EETA 3QPTA 1YFHA 1LEAA 2VXZA 1X1BA 1OR7A 3V8JA 1Y0UA 2MBFA 3IH3A 1GT0C 4HF0A 2FQ3A 1V5FA 4IX7A 2O9LA 3LSHA 2EZIA 1VNDA 4PSWA 2JUGA 2EK5A 1FYMA 5IP6A 1M1EB 2VIXA 4OWRB 4J01A 3FXKA 2DCEA 1AOYA 2IPQX 2JA6J 2EB7A 2HKOA 4I02A 4P5OA 4EM2A 3B02A 5JFRA 2E34A 3LSKA 2FMLA 2TRTA 4HSRA 3DTKA 1J2XA 2WY8Q 1RUNA 1HLVA 1JT6A 2ZBKA 1D5VA 3S3NA 2HVQA 2ZC2A 4PJ0C 4UXNA 3VYTB 3NARA 3NWSA 4FCYA 2A6TA 4F7ZA 3BOQA 1P9QC 1LKXA 1QRYA 3QU3A 2EINH 3MMYB 3M8EA 4EGZA 5J4VA 4YFKF 1A6IA 3BTIA 4BE0A 2ICWG 2PX9A 4ITVA 4YIIA 1TTYA 2PMZA 1YI2I 5DCMA 3SDBA 1HXDA 2DT5A 5ICGA 2DFEA 1QPMA 2HU9A 4D0PA 1KU3A 1MNEA 2DFFA 3JAMK 1SD7A 5DUIA 2KDZA 3C3WA 1KQ0A 4RGUA 4KMFA 1DPUA 4DW6A 3CJTB 4HYEA 4ZZLA 4CCOA 2XSDC 3ZMZA 1YIJI 5K7FA 3ZMSA 4XKWA 3CZ6A 3P5JA 2R7TA 3OV8A 2HDWA 3DBHB 5DTDA 1VFCA 2KIQA 3QU6A 5JLWA 1YX5A 2LY2A 1S7EA 1R58A 1O57A 4F3QA 3OYLA 2CQ7A 4IOAF 4NNJA 1HKQA 4HNUA 2F5DA 1S7OA 4JQFA 3WU0A 1TWGJ 3TKYA 4MTEA 2LKPA 1VQ6I 3E3VA 2QENA 1X2MA 3PQJA 2Y48A 3H9JA 4L9NA 4BXXJ 1IRXA 1WRJA 2VQGA 3DTEA 1T98A 1WH5A 1OCZH 3HIFA 1D0ZA 4PK4A 1T2KA 3KPHA 1U3EM 1CQTA 1PUFB 4CCNA 2KJCA 3ZRGA 5IT9Z 3HSEA 1EJ9A 1ZGAA 1IGNA 3RQ4A 3FM3A 1N77A 1ZREA 3CCVI 4RB3C 2QSGX 1T95A 5LRRA 2ZXHA 2DMUA 5M5XJ 4XN3A 1H89C 3K4LA 1MBFA 3CLOA 2P5KA 3HXLA 5FKLA 3TP0A 2EV6A 3M1EA 5IT9K 3CMAI 2HDCA 3OSFA 3G6EI 2XKPA 5FROA 1D0XA 3V42A 1X1DA 3IH2A 1PJRA 3OYGA 3G4SI 3BP8A 2ZMEC 1W1WE 2DAOA 1DQUA 2AXTC 2HNHA 4CCJA 3N97A 3GTPJ 5FFZA 3S1QJ 1G3TA 2VQCA 4G7OF 4W1UA 4OIQF 1OCOH 3PJRA 3HTUA 2FOWA 4QWQA 1TWAJ 2LYCA 2XAUA 3GXOA 2W00A 3N05A 4B43A 1WJ5A 2NNYA 4BEHB 3D5LA 2WTEA 2VPLA
chains in the Genus database with same CATH topology
3W6JB 2QZ8A 1R5GA 5LHGA 5CVIA 1J9IA 4EJWA 3NRVA 1DUXC 1S29A 2ZCWA 2UXXA 2DLLA 4LK1F 5F64A 1HW5A 1WWXA 1ZRFA 5HDKA 3SFZA 3RKYA 2ZFWA 2ISZA 2RN7A 2IA1A 4RAZA 4Z2YA 4A2UA 1LDKB 4ESBA 2WV0A 2BV6A 3DPLC 4FX0A 2MA3A 1DDNA 2EWNA 3K1PA 3GYHX 3M8FA 1USSA 3BZ6A 2HEOA 1OYYA 2EJRA 5ICCA 1IXCA 4LD5A 4EJUA 2FRHA 1HW2A 1ZLKA 1TQIA 3R4KA 4M9ZA 4OIPF 1H9TA 5L3CA 1ZLJA 3I58A 4KNYA 2M1BA 5DUKA 2F2EA 2A3SA 3JSOA 3J81Z 5BS6A 4PGGA 4RB2C 2JRTA 5L3FA 2DQLA 2MD5A 4OMZA 2K27A 2ZNZA 1USTA 1HQCA 3HHGA 1KU7A 2XAHA 1CF7B 1XMAA 2JTVA 1A04A 1J0RA 3RTRA 1KU2A 3GEZA 3H3UA 2M30A 1IXRC 3SZPA 2L54A 4EMSA 4KIGA 2YSRA 3COAC 2DK5A 2D2WA 3QAHA 4LMYA 1TBXA 4CICA 1MKMA 2V1XA 4RAYA 3ZMVA 3EQLF 5LHHA 1FLIA 4LGWA 1XDSA 2PBIA 1GHCA 2XVCA 3P9KA 3WE2A 3HUGA 2H27A 1YO5C 3WTYC 4Q48A 3TO6A 1QGPA 4XLNF 2NYXA 2PEXA 4YIFA 1HBXG 3ELKA 3G73A 3ROUA 2P5VA 3CUOA 2QQAA 3KEOA 3ULQB 2VBXA 3IKVA 2FMYA 3F6OA 2FF4A 3T0YA 4L0ZB 1SFXA 2P6SA 1IXSB 4KN7X 4UUVA 2JZYA 4WCGA 2O03A 3FWEA 3K1NA 4IHSA 3N4MA 4XLPF 4I2OA 2ZMEB 3GW2A 3CO7C 2FBHA 3R6SA 4GYIA 1K6OA 1W5SA 2YR2A 5HLGA 5CVRA 1S6LA 2P6TA 2V6CA 1CF7A 1PDNC 1SAXA 2GWRA 2K02A 2Q0OA 3VB2A 2HYGD 4M6XA 2L01A 3KFWX 1AWCA 5D5UB 1B4AA 4EV0A 1V3FA 1R5HA 3WODF 1FBUA 1I1GA 4HLXA 3F6VA 1YTYA 1IAWA 1BC7C 1ZRCA 2F5FA 2ZXJA 4HQMA 4U0YA 4KN4X 3QOPA 3SXYA 2STWA 1G3YA 3KP5A 3QPHA 3C18A 2UWMA 3I71A 5FD5A 3GO5A 1QZYA 1BBYA 3RKWA 5LGUA 1XGOA 1BI2A 2OZUA 4A0ZA 2VE8A 1OMIA 1LB2A 2Q2EA 3EYIA 3MAJA 4Y17A 3R0AA 1WQ2A 1ULYA 2O0YA 1I1SA 4EJTA 1L0OC 2FA5A 1IN7A 4HX8A 4L18B 1RZ4A 2PQ8A 4G7HF 2ZMEA 2K86A 2A69F 1ZG1A 3E5XA 2E1CA 2Z3YA 2WC2A 2GZWA 1OYIA 1XGSA 3F8MA 2FBKA 1R1UA 2CW0F 2RC4A 1U6GA 5CYVA 3FHZA 1Z6TA 3BPVA 4BHBA 2Z9OA 2KIMA 3WTSC 2PJPA 3KEQA 2D1HA 2R3SA 3IRRA 2ACJA 1MJ9A 5AIQA 5DD8A 4OIRF 1FBSA 5FD6A 1FSEA 2AXLA 2F5CA 3ZMDA 1J59A 4U7BA 4HF1A 2JPCA 4IRHA 4LFUA 1FC3A 3Q9VA 4L5JA 2A6HF 5H20A 1HW1A 3BWGA 1BN5A 2XIGA 3DP7A 3DV8A 2CFXA 1I5ZA 1O3RA 4YFXF 1MDMB 2M45A 4A12A 1P92A 3T1BA 4AVPA 1EH6A 2W57A 4LLNA 1S3JA 1GVJA 2ESHA 3KZYA 4OINF 4O3MA 3RPQA 1D8JA 3KETA 4A0YA 3L00A 1U8RA 3REOA 1P4WA 3I53A 3EYYA 4A6EA 4KYWA 1I27A 3ZQ7A 5HVQC 1SMYF 1KQ9A 2H6BA 3MQ0A 5LRSA 3F22A 1FP1D 1D3YA 1ZN2A 3TO7A 2RV8A 3EDPA 2Z99A 3ZMUA 5D4RA 3R0JA 3ISPA 4AIKA 1R1VA 5ILSA 1Z7UA 2LNBA 3ZP5A 1IN4A 4I7HA 5D8KB 1YW9A 4ENKA 2W84A 3CUQC 2XROA 3HHHA 5H6RA 4BHCA 2XRNA 4NB5A 4EM0B 2OU2A 2ZNYA 1TQPA 4L5IA 2HR3A 2MH9A 3L9FA 2K4JA 1QNTA 3F21A 1MDMA 5K1YA 2DFIA 1MJAA 4OOIA 5E8IA 2OZ6A 2DW4A 5E1ZB 2KRFA 3IWZA 3FMRA 2PMUA 2QM3A 4WXCA 1YW7A 3BJOA 4GCVA 1XN7A 1K7AA 4MTDA 1KYZA 3V8KA 5D6EA 1B9MA 2Y75A 2PN6A 1RUOA 3KLOA 2VC1A 2E7XA 2GIVA 2X4HA 1YLFA 2GA2A 2A61A 2CSOA 2LF8A 1FNNA 4IJAA 4KT5C 1QZZA 4G9YA 2YU3A 1ZARA 1ZHFA 4HV6A 1BIAA 4ESJA 2EFWA 4HV5A 4EM1A 3HTSB 1G3SA 3GVAA 3E5UA 4KIBA 4I98B 1G4DA 5EEGA 4BHPA 5BQTA 2EFQA 1SD6A 3H3ZA 3WTVC 2COMA 2RDPA 4RGXA 1WSUA 1P4AA 5TJJA 1SMTA 4HLYA 3U2RA 3HRUA 2PG4A 2VBWA 2GA1A 6PAXA 4CO8A 3WE3A 5JI6A 3NEUA 4A5MA 2IA0A 5HLHA 3TO9A 2O8XA 2QUFA 3RDIA 1YW8A 2G9WA 4GYGA 4EQQA 2NAZA 5CVJA 2HTSA 2XAGA 3OOPA 1R7JA 5E1WA 1CGPA 3ECHA 5F1RA 1TQMA 2BYVE 2RGVA 2F5EA 3U1DA 3HSFA 2P7VB 1BI1A 4DNCA 4BH9A 3L2CA 3BJ6A 1XCBA 1ON2A 3K2ZA 1KYWA 4ETSA 4MHGA 2AS5F 1IN8A 3JW4A 2OQGA 2OQRA 3WG9A 4IF4A 2GXGA 2L3DA 3E6MA 4G7ZF 2M5WA 2ZJ2A 2ISYA 5J8CA 4ASNA 3PQKA 5ILUA 3J81K 2ZO4A 3FF5A 3L7WA 3E6BA 4L9VA 4TV7A 2VE9A 2HKXA 1EH8A 2IP2A 1BI0A 4N0BA 4IRIA 3WTTC 1QQIA 1Z6RA 5JR3A 4N9IA 1Z91A 4HAMA 1FPQA 1LDJA 1FYLA 4L9JA 2GQQA 2FE3A 3O6BB 3RYPA 2HZTA 4U7DA 4U0WA 2BBYA 2V9VA 3FXRA 3FX3A 2VOOA 3TDZC 4M73A 1D8KA 2ZKZA 1OKRA 4M9XA 3MZHA 4KMUX 3F8BA 3MEXA 4GGGA 2A5YB 3SZTA 1KU9A 5A2QZ 3GUDA 1IUYA 3DKWA 4Y15A 1V4RA 2X0LA 1XGMA 4ON0A 3L09A 4XRFA 2YPRA 4MQ9F 3QRFF 4M74A 3ZPLA 5A2QK 1B1BA 3ECOA 2KJBA 4JBAA 3J80Z 1TW2A 4HZFA 3CTAA 3VOEA 4LB5A 3FMSA 1T39A 1PP7U 2XKOA 1R36A 1JHFA 1W7PD 2XV4S 3J80K 3CDHA 1K79A 2HWVA 4HX7A 3IL2A 5D5XB 4Y13A 4KA4A 5BPIA 5K5RA 1MJBA 3RKXA 1J75A 3W6KB 3LFKA 2OBPA 5DD4A 1W4MA 4CZZA 1MD0A 1XSXA 2XAFA 5BPDA 3K9TA 1B59A 1TLHB 4UHTA 5FGMA 4WF2A 3K69A 3GFLA 4RS8A 2QYOA 2VT2A 2R7DA 3WTWC 2PFBA 4A5NA 3WGGA 1PP8F 5HDNA 4UV8A 1B9NA 3HOSA 3U9GA 1ZYRF 4O5VA 2A6EF 1H0MA 2Z33A 3WGIA 3WU1B 3FXQA 1FSHA 1FZPB 5E18F 4Q4ZF 4OIOF 1FY7A 2YX7A 1FBQA 3WTXC 1REPC 3LA2A 3VEPA 2FEZA 1IZ1A 3GZ5A 4GXOA 4XSZF 4ZH4F 3GWZA 3TOBA 1JXSA 4BNCA 2BGCA 4R79A 2HOEA 3RYRA 3TDUC 1KA8A 3LAJA 4UNOA 3ERED 3CJNA 4LK0F 2EA2A 4FX4A 4ZZDA 4CHUA 3F3XA 2M87A 3D0SA 2PLYA 2LSOA 5CVUA 1UFMA 5LGNA 4KICA 3EUHA 3JTHA 3Q9SA 1UHWA 1NHAA 2V1DA 2CQKA 1S7AA 2UXNA 2CO5A 1YS6A 4ZYEA 1YIOA 3C7JA 2O6GE 1ZG3A 2HTJA 1T6SA 2XGXA 4WX9A 2KIUA 4LB6B 4A0XA 2XUBA 2Z5UA 4UVCA 5FO5A 3MCZA 3O3KA 1SFEA 2D45A 2RVCA 1QO0D 2JT1A 4S05A 1BC8C 1BM9A 4G94A 4G6QA 5HDGA 4CYDA 2QWWA 5IT3A 4RGRA 2W85A 4KIFA 1U78A 1U5TC 2J5PA 2DK8A 2M8EA 4RGSA 1U2WA 3JTGA 4WXHA 4A6DA 1UHMA 2WWYA 3LAPA 2FNAA 1E17A 2R7FA 5ICFA 1OYWA 1FX7A 5J8FA 3IWFA 2NS0A 3JSPA 5H6QA 4ZYHA 2W24A 4H0EA 1SD4A 3H92A 4AIHA 4OMYA 2DTRA 3DEUA 1E2XA 1IF1A 5BOXA 2PMHA 2EFNA 1FP2A 4IXAA 2A68F 4UVBA 2EA4A 4FT8A 3SHFA 3LQRA 3K1MA 2H94A 4ZYDA 2P5LC 1TW3A 2KIFA 5AONA 4M72A 4YFNF 3I5UA 2JPBA 2QQBA 3ABTA 4I0BA 3T8TA 3ZMTA 2HGCA 3QP6A 4R1HA 2VBZA 3E6CC 1YG2A 3P9IA 3R61A 3KLNA 1JGSA 2FU4A 2K4BA 2QLZA 1K78B 3I64A 4ENJA 5D5WB 3DXJF 4JK1X 4RB0A 1IN6A 2Y0MA 2ADUA 3KZZA 2NNNA 1J7KA 5KK1A 3MWMA 5L3GA 4ESFA 4M6YA 2HYFA 4IHTA 1ZRDA 3FXUA 1DPRA 2DU9A 2HFHA 1XDUA 4I09A 2ETHA 3KCCA 4CXFA 4MEXF 4PGHA 5D8LB 4MNUA 1HKSA 3JAMZ 2DO7A 1T0FA 5CLSA 4NHJA 3RIRA 1O7LA 1XGNA 5LBQA 1ZG5A 4KFCA 3M9AA 4KDPA 3GX4X 3HRMA 3QP5A 2P8TA 3HSRA 3ML6A 1YYVA 4WXDA 4Q47A 1X3UA 2HQRA 3B73A 1RI7A 4OU0A 2QVOA 4G6DA 1F4KA 1FOKA 2EFOA 4LLGF 1C0WA 3PFIA 4MQVA 4B09A 2STTA 2RQPA 1LEBA 4P96A 3F23A 2QBYB 1GXPA 3HYIA 5CVVA 1K78A 3TQNA 4BAYA 3IHUA 2QQ9A 1G6NA 2G7UA 1LJ9A 2LDUA 1ZAOA 3T5XA 1ON1A 1U5TB 4HBLA 3RJPA 1WI9A 2FNPA 5LGTA 2L4MA 3ZN0A 4I0AA 3F8FA 2HQNA 2H09A 3ZN1A 2VONA 3E97A 2VODA 1IW7F 3R60A 3E5QA 1XCVA 5LLQA 2IA2A 1RIOH 1F9NA 3K0LA 3V7CA 4EVIA 3GFJA 1FYKA 3LA7A 1PUEE 4LG0B 4B8XA 4O6JA 4UV9A 2CWEA 2L4AA 2O3FA 1P2FA 2GXBA 4E70A 1LVAA 2UZKA 3FMQA 4WK8F 1Q1HA 3I54A 4UVAA 3I4PA 3GZ6A 4P55A 2MLKA 1R22A 5ED4A 1S8NA 1UCRA 4P9UA 4IVNA 2MLGA 5BMZA 4HA8A 2DI3A 2QBYA 2DBBA 2NRAC 3CUQB 3KP3A 1BOAA 4QLCU 2XAQA 5D4SA 5DCFA 1SD5A 4BXUA 2ESNA 5HS9A 1J5YA 3V7RA 4HDUA 3BROA 1U5TA 3Q5FA 1F5TA 5DV5A 1W5TA 4HW0A 1P4XA 2DQRA 3GFMA 2YX4A 3HRSA 1LDDA 5EEHA 1IN5A 4FHTA 4M71A 4HOBA 3BDDA 2ELHA 5F6FA 1T38A 5FFXA 4LG0A 4DQ2A 3V4GA 3AAFA 4IPAA 5LEKA 3RPUA 3FM5A 1FT9A 4L0YB 4L9TA 4HX4A 3KE2A 3NQOA 4M9SA 3IRQA 3T8RA 2VN2A 5TRDA 3MZYA 2J5OA 1ODDA 2IW5A 2FSWA 1R23A 4P9FA 4RB1A 1TNTA 3GLXA 1ONVA 2BE5F 1STZA 4G8XA 4IRGA 2LF7A 2KKOA 3F8NA 1MGTA 3KP7A 4R8HA 1LQ1A 1IRFA 2DPUA 1I6XA 3CUQA 3WTUC 1WKMA 1O7FA 1HSJA 5JVTA 1RNLA 1GXQA 5E17F 3LA3A 1G3WA 2VBYA 3P9CA 1Z05A 5JHUA 2PI0A 1YQAA 4U0VA 5K5OA 3HOTA 1KQ8A 1ZH5A 1XSVA 5HLIA 1H9GA 2B0LA 2D1VA 1ZGJA 1BI3A 1O3SA 1HSTA 2HS5A 4YG2F 4K2EA 4ZYGA 3WTZA 5DYMA 2C6YA 3I0TA 1DP7P 3M7GA 4U88A 5L3BA 5ICEA 1BIBA 2VT3A 2BEOA 1XB4A 2JSCA 1W7PB 3O2PE 1JHHA 5E1XA 4ENNA 3J7AO 3E6DA 4BQAA 4I01A 2GAUA 2E1NA 2A07F 4EJOA 3F72A 1R00A 5J6XA 1VTNC 4WWCA 2RNJA 5FB2A 5DEQA 2P7CB 3TOAA 2XASA 1BJAA 3GF2A 3HRTA 4S04A 2TDXA 4MEYF 4AIJA 2G7HA 1B6AA 2IVMA 2VOPA 5ERIA 2Q8KA 2EV0A 3G3ZA 1F1ZA 1LNWA 3LWFA 4ENMA 4GO1A 4XSXF 3P7NA 2FXAA 5E20A 1FWZA 2O61A 5D5VB 1P6RA 3BY6A 1EH7A 2EFPA 3S2WA 2IRFG 3V7SA 5KVRA 1OPCA 5DDGA 3LSTA 3VFZA 2W25A 2CG4A 3I59B 1QBJA 1EV7A 2V1UA 4CDGA 3IC7A 5K5QA 2OA4A 2RKHA 5AIPA 2FOKA 2P4WA 1L3LA 1KGSA 2MC3A 2FBIA 4PZJA 1XSDA 1Z1DA 5L3EA 2XHKA 3DQVC 2CGPA 5CJ9A 1SFUA 2XAJA 1W7PA 4HDVA 4PCQA 4CGZA 2E7WA 5HS7A 3C1DA 4LLLA 3DF8A 5LEJA 2L02A 3F8CA 4LJZF 4XBFA 4EGYA 2H6CA 4MGRA 4PDKA 1MZBA 2EV5A 4AWXB 2IT0A 3KP6A 4EJVA 5LHIA 2MH2A 3FZVA 3KP4A 4Q5SF 1YS7A 2VC0A 3BPXA 5HOOA 5DCMB 4AD9A 2OAZA 3RI4A 5D6FA 3IKTA 1IRGA 3BJAA 1R1TA 3DFGA 4NQWA 2CYYA 5FLXZ 1UB9A 3V8LA 3MFKA 1Z9CA 3GFIA 5E8GA 3I59A 2IJLA 5ILVA 2K7LA 5HS8A 2OD5A 4N9HA 5FLXK 3ABUA 4KUMA 1O3QA 5L3DA 3KP2A 4HQEA 3SQNA 1XMKA 3LQQA 2V79A 1XD7A 4HF2A 1TNSA 3CO6C 2DPDA 3WGHA 3TGNA 1JE8A 1O3TA 3VODA 3DPTA 1HKTA 4BYYA 3EETA 3QPTA 1YFHA 1LEAA 2VXZA 1OR7A 3V8JA 1Y0UA 2MBFA 4HF0A 2FQ3A 2EK5A 1FYMA 1AOYA 2IPQX 2EB7A 2HKOA 4EM2A 4I02A 4P5OA 3B02A 5JFRA 2FMLA 1J2XA 1RUNA 2ZBKA 1D5VA 4UXNA 4F7ZA 3BOQA 3QU3A 4EGZA 3M8EA 4YFKF 4YIIA 1TTYA 5DCMA 1HXDA 2DT5A 5ICGA 1QPMA 4D0PA 1KU3A 3JAMK 1SD7A 5DUIA 3C3WA 1KQ0A 4RGUA 4KMFA 1DPUA 4HYEA 4ZZLA 3ZMZA 3ZMSA 3OV8A 3QU6A 1R58A 1O57A 1HKQA 2F5DA 1S7OA 4JQFA 3WU0A 3TKYA 4MTEA 2LKPA 3E3VA 2QENA 3PQJA 2Y48A 4L9NA 1WRJA 1T98A 3HIFA 1T2KA 1U3EM 2KJCA 5IT9Z 3HSEA 1ZGAA 3FM3A 1ZREA 4RB3C 5LRRA 3CLOA 2P5KA 2EV6A 3M1EA 5IT9K 2HDCA 2XKPA 3BP8A 2DAOA 3N97A 5FFZA 1G3TA 4G7OF 4OIQF 3HTUA 4QWQA 3GXOA 2NNYA 3D5LA 2WTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6J B;  2QZ8 A;  1R5G A;  5LHG A;  5CVI A;  1J9I A;  4EJW A;  3NRV A;  1DUX C;  1S29 A;  2ZCW A;  2UXX A;  2DLL A;  4LK1 F;  5F64 A;  1HW5 A;  1WWX A;  1ZRF A;  5HDK A;  3SFZ A;  3RKY A;  2ZFW A;  2ISZ A;  2RN7 A;  2IA1 A;  4RAZ A;  4Z2Y A;  4A2U A;  1LDK B;  4ESB A;  2WV0 A;  2BV6 A;  3DPL C;  4FX0 A;  2MA3 A;  1DDN A;  2EWN A;  3K1P A;  3GYH X;  3M8F A;  1USS A;  3BZ6 A;  2HEO A;  1OYY A;  2EJR A;  5ICC A;  1IXC A;  4LD5 A;  4EJU A;  2FRH A;  1HW2 A;  1ZLK A;  1TQI A;  3R4K A;  4M9Z A;  4OIP F;  1H9T A;  5L3C A;  1ZLJ A;  3I58 A;  4KNY A;  2M1B A;  5DUK A;  2F2E A;  2A3S A;  3JSO A;  3J81 Z;  5BS6 A;  4PGG A;  4RB2 C;  2JRT A;  5L3F A;  2DQL A;  2MD5 A;  4OMZ A;  2K27 A;  2ZNZ A;  1UST A;  1HQC A;  3HHG A;  1KU7 A;  2XAH A;  1CF7 B;  1XMA A;  2JTV A;  1A04 A;  1J0R A;  3RTR A;  1KU2 A;  3GEZ A;  3H3U A;  2M30 A;  1IXR C;  3SZP A;  2L54 A;  4EMS A;  4KIG A;  2YSR A;  3COA C;  2DK5 A;  2D2W A;  3QAH A;  4LMY A;  1TBX A;  4CIC A;  1MKM A;  2V1X A;  4RAY A;  3ZMV A;  3EQL F;  5LHH A;  1FLI A;  4LGW A;  1XDS A;  2PBI A;  1GHC A;  2XVC A;  3P9K A;  3WE2 A;  3HUG A;  2H27 A;  1YO5 C;  3WTY C;  4Q48 A;  3TO6 A;  1QGP A;  4XLN F;  2NYX A;  2PEX A;  4YIF A;  1HBX G;  3ELK A;  3G73 A;  3ROU A;  2P5V A;  3CUO A;  2QQA A;  3KEO A;  3ULQ B;  2VBX A;  3IKV A;  2FMY A;  3F6O A;  2FF4 A;  3T0Y A;  4L0Z B;  1SFX A;  2P6S A;  1IXS B;  4KN7 X;  4UUV A;  2JZY A;  4WCG A;  2O03 A;  3FWE A;  3K1N A;  4IHS A;  3N4M A;  4XLP F;  4I2O A;  2ZME B;  3GW2 A;  3CO7 C;  2FBH A;  3R6S A;  4GYI A;  1K6O A;  1W5S A;  2YR2 A;  5HLG A;  5CVR A;  1S6L A;  2P6T A;  2V6C A;  1CF7 A;  1PDN C;  1SAX A;  2GWR A;  2K02 A;  2Q0O A;  3VB2 A;  2HYG D;  4M6X A;  2L01 A;  3KFW X;  1AWC A;  5D5U B;  1B4A A;  4EV0 A;  1V3F A;  1R5H A;  3WOD F;  1FBU A;  1I1G A;  4HLX A;  3F6V A;  1YTY A;  1IAW A;  1BC7 C;  1ZRC A;  2F5F A;  2ZXJ A;  4HQM A;  4U0Y A;  4KN4 X;  3QOP A;  3SXY A;  2STW A;  1G3Y A;  3KP5 A;  3QPH A;  3C18 A;  2UWM A;  3I71 A;  5FD5 A;  3GO5 A;  1QZY A;  1BBY A;  3RKW A;  5LGU A;  1XGO A;  1BI2 A;  2OZU A;  4A0Z A;  2VE8 A;  1OMI A;  1LB2 A;  2Q2E A;  3EYI A;  3MAJ A;  4Y17 A;  3R0A A;  1WQ2 A;  1ULY A;  2O0Y A;  1I1S A;  4EJT A;  1L0O C;  2FA5 A;  1IN7 A;  4HX8 A;  4L18 B;  1RZ4 A;  2PQ8 A;  4G7H F;  2ZME A;  2K86 A;  2A69 F;  1ZG1 A;  3E5X A;  2E1C A;  2Z3Y A;  2WC2 A;  2GZW A;  1OYI A;  1XGS A;  3F8M A;  2FBK A;  1R1U A;  2CW0 F;  2RC4 A;  1U6G A;  5CYV A;  3FHZ A;  1Z6T A;  3BPV A;  4BHB A;  2Z9O A;  2KIM A;  3WTS C;  2PJP A;  3KEQ A;  2D1H A;  2R3S A;  3IRR A;  2ACJ A;  1MJ9 A;  5AIQ A;  5DD8 A;  4OIR F;  1FBS A;  5FD6 A;  1FSE A;  2AXL A;  2F5C A;  3ZMD A;  1J59 A;  4U7B A;  4HF1 A;  2JPC A;  4IRH A;  4LFU A;  1FC3 A;  3Q9V A;  4L5J A;  2A6H F;  5H20 A;  1HW1 A;  3BWG A;  1BN5 A;  2XIG A;  3DP7 A;  3DV8 A;  2CFX A;  1I5Z A;  1O3R A;  4YFX F;  1MDM B;  2M45 A;  4A12 A;  1P92 A;  3T1B A;  4AVP A;  1EH6 A;  2W57 A;  4LLN A;  1S3J A;  1GVJ A;  2ESH A;  3KZY A;  4OIN F;  4O3M A;  3RPQ A;  1D8J A;  3KET A;  4A0Y A;  3L00 A;  1U8R A;  3REO A;  1P4W A;  3I53 A;  3EYY A;  4A6E A;  4KYW A;  1I27 A;  3ZQ7 A;  5HVQ C;  1SMY F;  1KQ9 A;  2H6B A;  3MQ0 A;  5LRS A;  3F22 A;  1FP1 D;  1D3Y A;  1ZN2 A;  3TO7 A;  2RV8 A;  3EDP A;  2Z99 A;  3ZMU A;  5D4R A;  3R0J A;  3ISP A;  4AIK A;  1R1V A;  5ILS A;  1Z7U A;  2LNB A;  3ZP5 A;  1IN4 A;  4I7H A;  5D8K B;  1YW9 A;  4ENK A;  2W84 A;  3CUQ C;  2XRO A;  3HHH A;  5H6R A;  4BHC A;  2XRN A;  4NB5 A;  4EM0 B;  2OU2 A;  2ZNY A;  1TQP A;  4L5I A;  2HR3 A;  2MH9 A;  3L9F A;  2K4J A;  1QNT A;  3F21 A;  1MDM A;  5K1Y A;  2DFI A;  1MJA A;  4OOI A;  5E8I A;  2OZ6 A;  2DW4 A;  5E1Z B;  2KRF A;  3IWZ A;  3FMR A;  2PMU A;  2QM3 A;  4WXC A;  1YW7 A;  3BJO A;  4GCV A;  1XN7 A;  1K7A A;  4MTD A;  1KYZ A;  3V8K A;  5D6E A;  1B9M A;  2Y75 A;  2PN6 A;  1RUO A;  3KLO A;  2VC1 A;  2E7X A;  2GIV A;  2X4H A;  1YLF A;  2GA2 A;  2A61 A;  2CSO A;  2LF8 A;  1FNN A;  4IJA A;  4KT5 C;  1QZZ A;  4G9Y A;  2YU3 A;  1ZAR A;  1ZHF A;  4HV6 A;  1BIA A;  4ESJ A;  2EFW A;  4HV5 A;  4EM1 A;  3HTS B;  1G3S A;  3GVA A;  3E5U A;  4KIB A;  4I98 B;  1G4D A;  5EEG A;  4BHP A;  5BQT A;  2EFQ A;  1SD6 A;  3H3Z A;  3WTV C;  2COM A;  2RDP A;  4RGX A;  1WSU A;  1P4A A;  5TJJ A;  1SMT A;  4HLY A;  3U2R A;  3HRU A;  2PG4 A;  2VBW A;  2GA1 A;  6PAX A;  4CO8 A;  3WE3 A;  5JI6 A;  3NEU A;  4A5M A;  2IA0 A;  5HLH A;  3TO9 A;  2O8X A;  2QUF A;  3RDI A;  1YW8 A;  2G9W A;  4GYG A;  4EQQ A;  2NAZ A;  5CVJ A;  2HTS A;  2XAG A;  3OOP A;  1R7J A;  5E1W A;  1CGP A;  3ECH A;  5F1R A;  1TQM A;  2BYV E;  2RGV A;  2F5E A;  3U1D A;  3HSF A;  2P7V B;  1BI1 A;  4DNC A;  4BH9 A;  3L2C A;  3BJ6 A;  1XCB A;  1ON2 A;  3K2Z A;  1KYW A;  4ETS A;  4MHG A;  2AS5 F;  1IN8 A;  3JW4 A;  2OQG A;  2OQR A;  3WG9 A;  4IF4 A;  2GXG A;  2L3D A;  3E6M A;  4G7Z F;  2M5W A;  2ZJ2 A;  2ISY A;  5J8C A;  4ASN A;  3PQK A;  5ILU A;  3J81 K;  2ZO4 A;  3FF5 A;  3L7W A;  3E6B A;  4L9V A;  4TV7 A;  2VE9 A;  2HKX A;  1EH8 A;  2IP2 A;  1BI0 A;  4N0B A;  4IRI A;  3WTT C;  1QQI A;  1Z6R A;  5JR3 A;  4N9I A;  1Z91 A;  4HAM A;  1FPQ A;  1LDJ A;  1FYL A;  4L9J A;  2GQQ A;  2FE3 A;  3O6B B;  3RYP A;  2HZT A;  4U7D A;  4U0W A;  2BBY A;  2V9V A;  3FXR A;  3FX3 A;  2VOO A;  3TDZ C;  4M73 A;  1D8K A;  2ZKZ A;  1OKR A;  4M9X A;  3MZH A;  4KMU X;  3F8B A;  3MEX A;  4GGG A;  2A5Y B;  3SZT A;  1KU9 A;  5A2Q Z;  3GUD A;  1IUY A;  3DKW A;  4Y15 A;  1V4R A;  2X0L A;  1XGM A;  4ON0 A;  3L09 A;  4XRF A;  2YPR A;  4MQ9 F;  3QRF F;  4M74 A;  3ZPL A;  5A2Q K;  1B1B A;  3ECO A;  2KJB A;  4JBA A;  3J80 Z;  1TW2 A;  4HZF A;  3CTA A;  3VOE A;  4LB5 A;  3FMS A;  1T39 A;  1PP7 U;  2XKO A;  1R36 A;  1JHF A;  1W7P D;  2XV4 S;  3J80 K;  3CDH A;  1K79 A;  2HWV A;  4HX7 A;  3IL2 A;  5D5X B;  4Y13 A;  4KA4 A;  5BPI A;  5K5R A;  1MJB A;  3RKX A;  1J75 A;  3W6K B;  3LFK A;  2OBP A;  5DD4 A;  1W4M A;  4CZZ A;  1MD0 A;  1XSX A;  2XAF A;  5BPD A;  3K9T A;  1B59 A;  1TLH B;  4UHT A;  5FGM A;  4WF2 A;  3K69 A;  3GFL A;  4RS8 A;  2QYO A;  2VT2 A;  2R7D A;  3WTW C;  2PFB A;  4A5N A;  3WGG A;  1PP8 F;  5HDN A;  4UV8 A;  1B9N A;  3HOS A;  3U9G A;  1ZYR F;  4O5V A;  2A6E F;  1H0M A;  2Z33 A;  3WGI A;  3WU1 B;  3FXQ A;  1FSH A;  1FZP B;  5E18 F;  4Q4Z F;  4OIO F;  1FY7 A;  2YX7 A;  1FBQ A;  3WTX C;  1REP C;  3LA2 A;  3VEP A;  2FEZ A;  1IZ1 A;  3GZ5 A;  4GXO A;  4XSZ F;  4ZH4 F;  3GWZ A;  3TOB A;  1JXS A;  4BNC A;  2BGC A;  4R79 A;  2HOE A;  3RYR A;  3TDU C;  1KA8 A;  3LAJ A;  4UNO A;  3ERE D;  3CJN A;  4LK0 F;  2EA2 A;  4FX4 A;  4ZZD A;  4CHU A;  3F3X A;  2M87 A;  3D0S A;  2PLY A;  2LSO A;  5CVU A;  1UFM A;  5LGN A;  4KIC A;  3EUH A;  3JTH A;  3Q9S A;  1UHW A;  1NHA A;  2V1D A;  2CQK A;  1S7A A;  2UXN A;  2CO5 A;  1YS6 A;  4ZYE A;  1YIO A;  3C7J A;  2O6G E;  1ZG3 A;  2HTJ A;  1T6S A;  2XGX A;  4WX9 A;  2KIU A;  4LB6 B;  4A0X A;  2XUB A;  2Z5U A;  4UVC A;  5FO5 A;  3MCZ A;  3O3K A;  1SFE A;  2D45 A;  2RVC A;  1QO0 D;  2JT1 A;  4S05 A;  1BC8 C;  1BM9 A;  4G94 A;  4G6Q A;  5HDG A;  4CYD A;  2QWW A;  5IT3 A;  4RGR A;  2W85 A;  4KIF A;  1U78 A;  1U5T C;  2J5P A;  2DK8 A;  2M8E A;  4RGS A;  1U2W A;  3JTG A;  4WXH A;  4A6D A;  1UHM A;  2WWY A;  3LAP A;  2FNA A;  1E17 A;  2R7F A;  5ICF A;  1OYW A;  1FX7 A;  5J8F A;  3IWF A;  2NS0 A;  3JSP A;  5H6Q A;  4ZYH A;  2W24 A;  4H0E A;  1SD4 A;  3H92 A;  4AIH A;  4OMY A;  2DTR A;  3DEU A;  1E2X A;  1IF1 A;  5BOX A;  2PMH A;  2EFN A;  1FP2 A;  4IXA A;  2A68 F;  4UVB A;  2EA4 A;  4FT8 A;  3SHF A;  3LQR A;  3K1M A;  2H94 A;  4ZYD A;  2P5L C;  1TW3 A;  2KIF A;  5AON A;  4M72 A;  4YFN F;  3I5U A;  2JPB A;  2QQB A;  3ABT A;  4I0B A;  3T8T A;  3ZMT A;  2HGC A;  3QP6 A;  4R1H A;  2VBZ A;  3E6C C;  1YG2 A;  3P9I A;  3R61 A;  3KLN A;  1JGS A;  2FU4 A;  2K4B A;  2QLZ A;  1K78 B;  3I64 A;  4ENJ A;  5D5W B;  3DXJ F;  4JK1 X;  4RB0 A;  1IN6 A;  2Y0M A;  2ADU A;  3KZZ A;  2NNN A;  1J7K A;  5KK1 A;  3MWM A;  5L3G A;  4ESF A;  4M6Y A;  2HYF A;  4IHT A;  1ZRD A;  3FXU A;  1DPR A;  2DU9 A;  2HFH A;  1XDU A;  4I09 A;  2ETH A;  3KCC A;  4CXF A;  4MEX F;  4PGH A;  5D8L B;  4MNU A;  1HKS A;  3JAM Z;  2DO7 A;  1T0F A;  5CLS A;  4NHJ A;  3RIR A;  1O7L A;  1XGN A;  5LBQ A;  1ZG5 A;  4KFC A;  3M9A A;  4KDP A;  3GX4 X;  3HRM A;  3QP5 A;  2P8T A;  3HSR A;  3ML6 A;  1YYV A;  4WXD A;  4Q47 A;  1X3U A;  2HQR A;  3B73 A;  1RI7 A;  4OU0 A;  2QVO A;  4G6D A;  1F4K A;  1FOK A;  2EFO A;  4LLG F;  1C0W A;  3PFI A;  4MQV A;  4B09 A;  2STT A;  2RQP A;  1LEB A;  4P96 A;  3F23 A;  2QBY B;  1GXP A;  3HYI A;  5CVV A;  1K78 A;  3TQN A;  4BAY A;  3IHU A;  2QQ9 A;  1G6N A;  2G7U A;  1LJ9 A;  2LDU A;  1ZAO A;  3T5X A;  1ON1 A;  1U5T B;  4HBL A;  3RJP A;  1WI9 A;  2FNP A;  5LGT A;  2L4M A;  3ZN0 A;  4I0A A;  3F8F A;  2HQN A;  2H09 A;  3ZN1 A;  2VON A;  3E97 A;  2VOD A;  1IW7 F;  3R60 A;  3E5Q A;  1XCV A;  5LLQ A;  2IA2 A;  1RIO H;  1F9N A;  3K0L A;  3V7C A;  4EVI A;  3GFJ A;  1FYK A;  3LA7 A;  1PUE E;  4LG0 B;  4B8X A;  4O6J A;  4UV9 A;  2CWE A;  2L4A A;  2O3F A;  1P2F A;  2GXB A;  4E70 A;  1LVA A;  2UZK A;  3FMQ A;  4WK8 F;  1Q1H A;  3I54 A;  4UVA A;  3I4P A;  3GZ6 A;  4P55 A;  2MLK A;  1R22 A;  5ED4 A;  1S8N A;  1UCR A;  4P9U A;  4IVN A;  2MLG A;  5BMZ A;  4HA8 A;  2DI3 A;  2QBY A;  2DBB A;  2NRA C;  3CUQ B;  3KP3 A;  1BOA A;  4QLC U;  2XAQ A;  5D4S A;  5DCF A;  1SD5 A;  4BXU A;  2ESN A;  5HS9 A;  1J5Y A;  3V7R A;  4HDU A;  3BRO A;  1U5T A;  3Q5F A;  1F5T A;  5DV5 A;  1W5T A;  4HW0 A;  1P4X A;  2DQR A;  3GFM A;  2YX4 A;  3HRS A;  1LDD A;  5EEH A;  1IN5 A;  4FHT A;  4M71 A;  4HOB A;  3BDD A;  2ELH A;  5F6F A;  1T38 A;  5FFX A;  4LG0 A;  4DQ2 A;  3V4G A;  3AAF A;  4IPA A;  5LEK A;  3RPU A;  3FM5 A;  1FT9 A;  4L0Y B;  4L9T A;  4HX4 A;  3KE2 A;  3NQO A;  4M9S A;  3IRQ A;  3T8R A;  2VN2 A;  5TRD A;  3MZY A;  2J5O A;  1ODD A;  2IW5 A;  2FSW A;  1R23 A;  4P9F A;  4RB1 A;  1TNT A;  3GLX A;  1ONV A;  2BE5 F;  1STZ A;  4G8X A;  4IRG A;  2LF7 A;  2KKO A;  3F8N A;  1MGT A;  3KP7 A;  4R8H A;  1LQ1 A;  1IRF A;  2DPU A;  1I6X A;  3CUQ A;  3WTU C;  1WKM A;  1O7F A;  1HSJ A;  5JVT A;  1RNL A;  1GXQ A;  5E17 F;  3LA3 A;  1G3W A;  2VBY A;  3P9C A;  1Z05 A;  5JHU A;  2PI0 A;  1YQA A;  4U0V A;  5K5O A;  3HOT A;  1KQ8 A;  1ZH5 A;  1XSV A;  5HLI A;  1H9G A;  2B0L A;  2D1V A;  1ZGJ A;  1BI3 A;  1O3S A;  1HST A;  2HS5 A;  4YG2 F;  4K2E A;  4ZYG A;  3WTZ A;  5DYM A;  2C6Y A;  3I0T A;  1DP7 P;  3M7G A;  4U88 A;  5L3B A;  5ICE A;  1BIB A;  2VT3 A;  2BEO A;  1XB4 A;  2JSC A;  1W7P B;  3O2P E;  1JHH A;  5E1X A;  4ENN A;  3J7A O;  3E6D A;  4BQA A;  4I01 A;  2GAU A;  2E1N A;  2A07 F;  4EJO A;  3F72 A;  1R00 A;  5J6X A;  1VTN C;  4WWC A;  2RNJ A;  5FB2 A;  5DEQ A;  2P7C B;  3TOA A;  2XAS A;  1BJA A;  3GF2 A;  3HRT A;  4S04 A;  2TDX A;  4MEY F;  4AIJ A;  2G7H A;  1B6A A;  2IVM A;  2VOP A;  5ERI A;  2Q8K A;  2EV0 A;  3G3Z A;  1F1Z A;  1LNW A;  3LWF A;  4ENM A;  4GO1 A;  4XSX F;  3P7N A;  2FXA A;  5E20 A;  1FWZ A;  2O61 A;  5D5V B;  1P6R A;  3BY6 A;  1EH7 A;  2EFP A;  3S2W A;  2IRF G;  3V7S A;  5KVR A;  1OPC A;  5DDG A;  3LST A;  3VFZ A;  2W25 A;  2CG4 A;  3I59 B;  1QBJ A;  1EV7 A;  2V1U A;  4CDG A;  3IC7 A;  5K5Q A;  2OA4 A;  2RKH A;  5AIP A;  2FOK A;  2P4W A;  1L3L A;  1KGS A;  2MC3 A;  2FBI A;  4PZJ A;  1XSD A;  1Z1D A;  5L3E A;  2XHK A;  3DQV C;  2CGP A;  5CJ9 A;  1SFU A;  2XAJ A;  1W7P A;  4HDV A;  4PCQ A;  4CGZ A;  2E7W A;  5HS7 A;  3C1D A;  4LLL A;  3DF8 A;  5LEJ A;  2L02 A;  3F8C A;  4LJZ F;  4XBF A;  4EGY A;  2H6C A;  4MGR A;  4PDK A;  1MZB A;  2EV5 A;  4AWX B;  2IT0 A;  3KP6 A;  4EJV A;  5LHI A;  2MH2 A;  3FZV A;  3KP4 A;  4Q5S F;  1YS7 A;  2VC0 A;  3BPX A;  5HOO A;  5DCM B;  4AD9 A;  2OAZ A;  3RI4 A;  5D6F A;  3IKT A;  1IRG A;  3BJA A;  1R1T A;  3DFG A;  4NQW A;  2CYY A;  5FLX Z;  1UB9 A;  3V8L A;  3MFK A;  1Z9C A;  3GFI A;  5E8G A;  3I59 A;  2IJL A;  5ILV A;  2K7L A;  5HS8 A;  2OD5 A;  4N9H A;  5FLX K;  3ABU A;  4KUM A;  1O3Q A;  5L3D A;  3KP2 A;  4HQE A;  3SQN A;  1XMK A;  3LQQ A;  2V79 A;  1XD7 A;  4HF2 A;  1TNS A;  3CO6 C;  2DPD A;  3WGH A;  3TGN A;  1JE8 A;  1O3T A;  3VOD A;  3DPT A;  1HKT A;  4BYY A;  3EET A;  3QPT A;  1YFH A;  1LEA A;  2VXZ A;  1OR7 A;  3V8J A;  1Y0U A;  2MBF A;  4HF0 A;  2FQ3 A;  2EK5 A;  1FYM A;  1AOY A;  2IPQ X;  2EB7 A;  2HKO A;  4EM2 A;  4I02 A;  4P5O A;  3B02 A;  5JFR A;  2FML A;  1J2X A;  1RUN A;  2ZBK A;  1D5V A;  4UXN A;  4F7Z A;  3BOQ A;  3QU3 A;  4EGZ A;  3M8E A;  4YFK F;  4YII A;  1TTY A;  5DCM A;  1HXD A;  2DT5 A;  5ICG A;  1QPM A;  4D0P A;  1KU3 A;  3JAM K;  1SD7 A;  5DUI A;  3C3W A;  1KQ0 A;  4RGU A;  4KMF A;  1DPU A;  4HYE A;  4ZZL A;  3ZMZ A;  3ZMS A;  3OV8 A;  3QU6 A;  1R58 A;  1O57 A;  1HKQ A;  2F5D A;  1S7O A;  4JQF A;  3WU0 A;  3TKY A;  4MTE A;  2LKP A;  3E3V A;  2QEN A;  3PQJ A;  2Y48 A;  4L9N A;  1WRJ A;  1T98 A;  3HIF A;  1T2K A;  1U3E M;  2KJC A;  5IT9 Z;  3HSE A;  1ZGA A;  3FM3 A;  1ZRE A;  4RB3 C;  5LRR A;  3CLO A;  2P5K A;  2EV6 A;  3M1E A;  5IT9 K;  2HDC A;  2XKP A;  3BP8 A;  2DAO A;  3N97 A;  5FFZ A;  1G3T A;  4G7O F;  4OIQ F;  3HTU A;  4QWQ A;  3GXO A;  2NNY A;  3D5L A;  2WTE A; 
#chains in the Genus database with same CATH topology
 3W6J B;  2WBM A;  2XGD A;  2ZSH B;  2QZ8 A;  1R5G A;  4JYK A;  3MKL A;  3BR0 A;  5LHG A;  4IKF A;  2K3P A;  5CVI A;  3F9K A;  3HB9 A;  1J9I A;  4EJW A;  3NRV A;  1DUX C;  2OF7 A;  1S29 A;  2ZCW A;  2UXX A;  1Y8Q B;  2DLL A;  4LK1 F;  5F64 A;  3GTM J;  1HW5 A;  2ZXW H;  4Y4R A;  3EUH C;  1WWX A;  1Y6I A;  2I8D A;  1K61 A;  3BQY A;  4UUS B;  1X1A A;  5IY5 H;  1ZRF A;  5HDK A;  3SFZ A;  3RKY A;  3S93 A;  2ZFW A;  3RZD J;  1HA8 A;  2KLO A;  2ISZ A;  2RN7 A;  2IA1 A;  3HUG B;  4RAZ A;  4Z2Y A;  3HEF A;  1JKP C;  4OAY A;  4A2U A;  1LDK B;  1R4M B;  3DWL E;  1GVD A;  3LNQ A;  4ESB A;  1BOB A;  1RRJ A;  4B3X A;  4DBQ A;  4IHV A;  2WV0 A;  2BV6 A;  3B6C A;  3DPL C;  3H0G J;  5EYR A;  3BT9 A;  2H8R A;  1Z67 A;  3VYU B;  3GTG J;  3RQI A;  4FX0 A;  2MA3 A;  2DJN A;  5J40 A;  2EWN A;  3K1P A;  3GYH X;  2L0K A;  1DDN A;  3M8F A;  1USS A;  5CPR B;  3IAS 2;  3KYC B;  1R6R A;  3OS2 A;  1T08 B;  3DEE A;  2FJ1 A;  3BZ6 A;  5K7H A;  3OS0 A;  1ETQ A;  1R9T J;  3LMM A;  2HEO A;  4BE2 A;  1OYY A;  2EJR A;  5ICC A;  1IXC A;  2LY9 A;  1E3O C;  2CV0 A;  4A3D J;  2M9H A;  4LD5 A;  2JVG A;  1PUF A;  1BA5 A;  4EJU A;  2FRH A;  1HW2 A;  4A69 C;  2HI3 A;  1ZLK A;  1TQI A;  3R4K A;  2M4K A;  4BKX A;  1JKO C;  1H8A C;  4RM2 A;  4M9Z A;  4OIP F;  1H9T A;  5L3C A;  1ZLJ A;  3OYM A;  3I58 A;  4KNY A;  2M1B A;  5DUK A;  3I4N J;  2F2E A;  2XRL A;  2A3S A;  1P7I A;  1XMX A;  2DMP A;  5JLX A;  4HST A;  3JSO A;  2HQA A;  3J81 Z;  2KRH A;  5BS6 A;  4PGG A;  4RB2 C;  2JRT A;  5L3F A;  3K4K A;  1LFB A;  2DQL A;  2MD5 A;  4U87 A;  4DYC A;  4OMZ A;  4FIS A;  2K27 A;  2ZB9 A;  5EF6 A;  2LP0 A;  3TW6 A;  2ZNZ A;  1UST A;  1TWF J;  4M3E A;  1HQC A;  3HHG A;  1KU7 A;  1JKR C;  2XAH A;  4RAG A;  1CF7 B;  1XMA A;  2JTV A;  1A04 A;  3ESW B;  5EZH A;  1J0R A;  1MMA A;  3RTR A;  1KU2 A;  1A6Q A;  3GEZ A;  2HXI A;  3H3U A;  1UAA A;  3UR3 C;  4BEH A;  3GTJ J;  3G71 I;  2M30 A;  3Q3S A;  1D5Y A;  1IXR C;  3OYI A;  3SZP A;  4C3J J;  2L54 A;  4QIW N;  4EMS A;  4KIG A;  2CUE A;  1ENH A;  2YSR A;  3COA C;  2DK5 A;  1ETK A;  2D2W A;  4XON A;  3QAH A;  1Y0N A;  4LMY A;  1TBX A;  4CIC A;  1MKM A;  2V1X A;  4AID A;  5DS9 A;  2HDD A;  4RAY A;  2IBD A;  2WAE A;  3ZMV A;  3TED A;  2OC6 A;  3EQL F;  5LHH A;  1OIS A;  1FLI A;  4LGW A;  1R71 A;  1ETO A;  5F1J A;  4UUS A;  1O4X A;  1XDS A;  2PBI A;  3LSP A;  1GHC A;  3PFY A;  2XVC A;  3P9K A;  4LIT A;  3WE2 A;  3HUG A;  2H27 A;  1YO5 C;  3WTY C;  4Z6Y A;  2DA4 A;  4Q48 A;  3TO6 A;  1QGP A;  4XLN F;  1AHD P;  3S2D J;  2NYX A;  2PEX A;  3BTC A;  1Z21 A;  4YIF A;  2ZSI B;  1HBX G;  2DOE A;  3WHC A;  3ELK A;  3G73 A;  3K6G A;  1JKQ C;  3ROU A;  2F5V A;  2P5V A;  3CUO A;  2NVY J;  2QQA A;  3KEO A;  3LSI A;  3ULQ B;  1K4S A;  2VBX A;  3IKV A;  2FMY A;  3F6O A;  5CKT A;  2FF4 A;  1S9H A;  2VB6 A;  3T0Y A;  4BQN A;  2Q2E B;  4L0Z B;  5B5E C;  3FKJ A;  2M4G A;  1SFX A;  2P6S A;  3C2H A;  1IXS B;  4KN7 X;  4C9Y A;  2Z2S B;  3A0H C;  4IQ4 A;  1GV5 A;  4JX4 A;  1DU0 A;  4UUV A;  2JZY A;  4WCG A;  2O03 A;  5HNH A;  3FWE A;  3M07 A;  3K1N A;  4IHS A;  3N4M A;  4XRS G;  3KEY A;  4XLP F;  4I2O A;  1DU6 A;  2IEK A;  3LOC A;  4HEA 2;  2P0W A;  5GAE J;  2VLA A;  5KAF C;  4RLF A;  2ZME B;  3OYD A;  3GW2 A;  4M3F A;  4E4H A;  3CO7 C;  2FBH A;  3R6S A;  1I6H J;  2OPT A;  4GYI A;  4KIT B;  1K6O A;  1W5S A;  4RLQ A;  3WG7 H;  2GXA A;  2YR2 A;  1T0F C;  5EG0 B;  3HOY J;  5HLG A;  5CVR A;  4DBR A;  1S6L A;  2P6T A;  2KIS A;  2V6C A;  3ZQI A;  3GLL A;  1CF7 A;  1PDN C;  1SAX A;  2GWR A;  2CW7 A;  2DOD A;  2K02 A;  2IGK A;  3I4M J;  2Q0O A;  3VB2 A;  3EUK L;  2HYG D;  4M6X A;  2L01 A;  2MD0 A;  3KFW X;  1AWC A;  3OL3 A;  5D5U B;  4DYQ A;  1ETY A;  1B4A A;  1F43 A;  1A31 A;  4EV0 A;  5H2F C;  2ZJQ F;  4LIU A;  1V3F A;  1R5H A;  2HQ5 A;  3WOD F;  1FBU A;  1I1G A;  4HLX A;  3F6V A;  3RZO J;  1YTY A;  3QYE A;  1IAW A;  1S72 I;  2JJ7 A;  2LC2 A;  1BC7 C;  2LOO A;  1ZRC A;  2F5F A;  2FQ4 A;  2WB1 A;  4ABZ A;  2ZXJ A;  4HQM A;  4KN4 X;  3QOP A;  3SXY A;  4U0Y A;  1OCR H;  2STW A;  3FIS A;  3K4C A;  2K9M A;  1G3Y A;  3JRA A;  1FMV A;  5E3L A;  1X1P A;  3KP5 A;  1MH4 A;  3QPH A;  4E7L A;  4XOP A;  3C18 A;  2L2O A;  2UWM A;  3I71 A;  5FD5 A;  3GO5 A;  1QZY A;  1BBY A;  3RKW A;  5LGU A;  3A01 B;  2JK3 A;  3BR1 A;  2R5Y B;  4QTR A;  3W2A A;  1XGO A;  3VSL A;  1BI2 A;  2JA2 A;  2OZU A;  1JT0 A;  4A0Z A;  3FK7 A;  2VE8 A;  1OMI A;  4C2M J;  1LB2 A;  2KHM A;  2Q2E A;  4ZDO A;  3EYI A;  4B3A A;  3MAJ A;  4Y17 A;  3R0A A;  1EA3 A;  1WQ2 A;  2DDA A;  1ULY A;  2O0Y A;  2RNG A;  3AG2 H;  1I1S A;  4EJT A;  1L0O C;  2XB5 A;  1RKT A;  2FA5 A;  1DP3 A;  1WJC A;  1WHU A;  2OTL I;  1VI0 A;  1KZH A;  3H0D A;  3C2B A;  1IN7 A;  3D1N I;  1MMS A;  4HX8 A;  4L18 B;  4A3B J;  2VKV A;  1G2H A;  5GPC A;  2WY7 Q;  1RZ4 A;  2PQ8 A;  2GOM A;  4G7H F;  3TP3 A;  2ZME A;  2K86 A;  2A69 F;  2XGE A;  4BS9 A;  1BJZ A;  1ZG1 A;  3E5X A;  1EF4 A;  2E1C A;  1NG7 A;  2Z3Y A;  3Q0V A;  5EG0 A;  2WC2 A;  2GZW A;  1OYI A;  1XGS A;  3F8M A;  2FBK A;  2KFD A;  1N25 A;  1R1U A;  5F0C A;  4E6K G;  2NVU B;  4IO9 F;  5LFA A;  2CW0 F;  2COB A;  2RC4 A;  2LLK A;  1U6G A;  1GUU A;  2DXI A;  5CYV A;  3FHZ A;  1Z6T A;  2LR8 A;  3BPV A;  4BHB A;  3L1P A;  4EEF G;  1Q1V A;  2Z9O A;  3M1C A;  2AO9 A;  2KIM A;  1HF0 A;  2L7M P;  3WTS C;  1KON A;  3H9G A;  5FRM A;  2PJP A;  3KEQ A;  4D7M A;  2D1H A;  2R3S A;  3IRR A;  2ACJ A;  1V5G A;  1MJ9 A;  5AIQ A;  1OLT A;  2X1E A;  5DD8 A;  4OIR F;  2BZT A;  2VAS A;  1FBS A;  5FD6 A;  1B8I B;  1FSE A;  2AXL A;  3DPU A;  2F5C A;  3ZMD A;  1J59 A;  4U7B A;  4HF1 A;  3LSJ A;  2JPC A;  4IRH A;  3JR9 A;  4LFU A;  1FC3 A;  3SZG A;  4G6T B;  3Q9V A;  2IAI A;  3SYT A;  4HNT A;  4L5J A;  2A6H F;  3FIW A;  2R7O A;  2NS7 A;  5H20 A;  4JX6 A;  3MVP A;  4XOR A;  1X4P A;  2D5V A;  2EH3 A;  2CQN A;  1HW1 A;  2JMW A;  4L5E A;  3BWG A;  1BN5 A;  2XIG A;  3DP7 A;  3VYR B;  3H5R A;  1SFO J;  3DV8 A;  2CFX A;  1QHH D;  3A01 A;  4CCK A;  2HVS A;  2LH9 A;  2E5N A;  1I5Z A;  1O3R A;  4AC0 A;  4YFX F;  4X1E A;  4BU2 A;  3ZQH A;  4C3I J;  2NOG A;  1MDM B;  3G1O A;  2M45 A;  4A12 A;  3DTI A;  1P92 A;  4I76 A;  3T1B A;  1ETX A;  3M3Y J;  4AVP A;  4CH7 A;  1EH6 A;  2W57 A;  1ORK A;  5J1Y A;  2QSF X;  4LLN A;  1S3J A;  2DA5 A;  1ETV A;  5BNG A;  4A3M J;  1TP4 A;  4II3 A;  1GVJ A;  4BBR J;  3IAM 2;  1UHS A;  2IXS A;  1ZKG A;  3CLQ A;  2ESH A;  2O7O A;  1JGG A;  3KZY A;  4OIN F;  4O3M A;  3HOZ J;  2CQX A;  2E1O A;  2JUC A;  3RPQ A;  1D8J A;  3OYE A;  3KET A;  4A0Y A;  4W97 A;  3L00 A;  1U8R A;  1MBE A;  3REO A;  1P4W A;  3I53 A;  4DZJ A;  3EYY A;  2VQL A;  2MC4 A;  4A6E A;  3CDI A;  4BQQ A;  5B66 C;  4BL0 B;  2LVS A;  4RMN A;  3FHN A;  1MSF C;  1NK2 P;  4KYW A;  5FLV A;  3HJE A;  1MND A;  1I27 A;  2A5W A;  5F04 A;  5TIS C;  3ZQ7 A;  1RR8 C;  5HVQ C;  1SMY F;  3D5R C;  1UEL B;  4FAS D;  1RR7 A;  2ZFU A;  3DLL F;  2CU7 A;  1KQ9 A;  9ANT A;  2KMU A;  3GCM A;  2H6B A;  3BR3 A;  3MQ0 A;  5LRS A;  3F22 A;  1FP1 D;  1D3Y A;  5F27 A;  2CFO A;  1ZN2 A;  3TO7 A;  2RV8 A;  2OV7 A;  3EDP A;  2Z99 A;  1BR2 A;  4YEJ A;  3ZMU A;  1IV6 A;  3X2Q H;  2HZD A;  2XF7 A;  5D4R A;  4M3B A;  1B8I A;  3ABL H;  4E7I A;  3R0J A;  3ISP A;  2Y0S A;  2AHQ A;  2DN0 A;  4XL9 A;  4XM3 A;  4AIK A;  1R1V A;  1AKH B;  2LTP A;  3RKQ A;  2R93 J;  2BW3 B;  2BXY A;  5ILS A;  1PVE A;  1Z7U A;  5EEA A;  2LNB A;  2BY1 A;  3ZP5 A;  1FOY A;  1IN4 A;  4I7H A;  5HOD A;  4F55 A;  5D8K B;  3E1S A;  3S15 J;  2OUM A;  1MIJ A;  1Z3X A;  3TW7 A;  5J4Y A;  1YW9 A;  4ENK A;  3CC7 I;  3HPG A;  2W84 A;  1G8X A;  3CUQ C;  3S8P A;  2XRO A;  4D5F A;  3HHH A;  4BUP A;  5H6R A;  4II2 A;  3SFI A;  2XRN A;  4NB5 A;  4BHC A;  4EM0 B;  2OU2 A;  2FX0 A;  1TQP A;  2JWT A;  2ZNY A;  2HR3 A;  2MH9 A;  4L5I A;  3ZQG A;  3L9F A;  3ZQQ A;  2K4J A;  1VF9 A;  1QNT A;  3F21 A;  2B63 J;  1MDM A;  5K1Y A;  4UB6 C;  2DFI A;  3OY9 A;  1X2N A;  1MJA A;  4NUB A;  4OOI A;  5E8I A;  2QEX I;  1AU7 A;  2OZ6 A;  2DW4 A;  5E1Z B;  2KRF A;  2VJJ A;  3OS1 A;  3IWZ A;  3FMR A;  4XOT A;  2PMU A;  1UG2 A;  2QM3 A;  5J1R A;  1SVL A;  4XK4 A;  3HGY A;  3L2V A;  4WXC A;  1YW7 A;  1ZK8 A;  3BJO A;  4GCV A;  1XN7 A;  3QWL A;  1K7A A;  4GRI A;  4MTD A;  1KYZ A;  4FE7 A;  4LIV A;  3V8K A;  5D6E A;  4DZP A;  1B9M A;  5FLM J;  2Y75 A;  3J7Y J;  3CCM I;  2PN6 A;  5J1U A;  1RUO A;  4Y3O A;  3KLO A;  2VC1 A;  2O8K A;  2DMN A;  2E7X A;  2GIV A;  3QQA A;  2X4H A;  1YLF A;  2IGO A;  2GA2 A;  2A61 A;  4CA0 A;  2R7R A;  2CSO A;  5DM6 F;  2LF8 A;  3FDY A;  1FNN A;  4IJA A;  4KT5 C;  1FIA A;  1QZZ A;  4G9Y A;  1MW7 A;  1ZAR A;  1ZHF A;  2YU3 A;  4HV6 A;  1AA7 A;  3BC8 A;  5FKK A;  1BIA A;  4ESJ A;  2EFW A;  3BR6 A;  1VQ5 I;  4HRI A;  4HV5 A;  4Y52 J;  1FTZ A;  1PYV A;  1GV2 A;  5GAG J;  4EM1 A;  3HTS B;  5IOY A;  1G3S A;  3GVA A;  3E5U A;  2BHZ A;  3QOD A;  3ZQC A;  3OSG A;  4KIB A;  4I98 B;  1G4D A;  5EEG A;  4BHP A;  5BQT A;  2BOL A;  2EFQ A;  1SD6 A;  2CRG A;  3H3Z A;  4RGX A;  2COM A;  2RDP A;  3AG3 H;  3WTV C;  1AKH A;  2BW3 A;  4AUX A;  2DA3 A;  1WSU A;  1UJ8 A;  1P4A A;  2HOS A;  2QCO A;  5TJJ A;  4FET A;  1SMT A;  3GZN B;  4QPO A;  1MBJ A;  2N8G A;  4HLY A;  3U2R A;  3BG6 A;  3HRU A;  2PG4 A;  3RPU D;  2VBW A;  4XKV A;  1DGW Y;  4MIM A;  2GA1 A;  3GME A;  6PAX A;  4CO8 A;  3WE3 A;  5JI6 A;  3NEU A;  1X3Z B;  2BVL A;  2LBF B;  3BZC A;  1Y1V J;  2B7E A;  4A5M A;  2IA0 A;  5HLH A;  3JRD A;  2R4G A;  4BBS J;  3TO9 A;  2O8X A;  3H35 A;  3BG9 A;  1A35 A;  4IEJ A;  2EPF A;  2QUF A;  1GLN A;  2KPM A;  4MLO A;  3RDI A;  4S0H B;  1VQN I;  1YW8 A;  1TWC J;  2G9W A;  4LG3 A;  4GYG A;  4EQQ A;  2NAZ A;  5CVJ A;  2HTS A;  2XAG A;  3OOP A;  3QYF A;  1R7J A;  5E1W A;  3CP2 A;  1R49 A;  1CGP A;  1MBH A;  3ECH A;  5F1R A;  1TQM A;  4PFO A;  3A2K A;  3SJM A;  2BYV E;  2RGV A;  2F5E A;  2JVH A;  3VDX A;  3U1D A;  2LRE A;  3CJR B;  3HSF A;  2P7V B;  1K6Y A;  2HOT A;  3AL0 C;  3AFH A;  1BI1 A;  4DNC A;  4BH9 A;  1HC8 A;  3L2C A;  3BJ6 A;  3OIQ A;  3G1L A;  4V2G A;  1XCB A;  3GBG A;  1ON2 A;  2DT7 B;  3K2Z A;  1Y1W J;  1NTC A;  4PUS A;  3K70 D;  2PJR B;  3BCA A;  2R7W A;  1OCP A;  1KYW A;  3DKX A;  4MHG A;  4ETS A;  2BXZ A;  3I55 I;  2GOX B;  1NK3 P;  2AS5 F;  1IN8 A;  3JW4 A;  2E19 A;  2OQG A;  3PIP F;  2OQR A;  1LUJ B;  4N4O B;  1VQO I;  3F0C A;  1XC5 A;  3WG9 A;  5EGO B;  4IF4 A;  2GXG A;  2XGC A;  4A3C J;  4ZJZ A;  2L3D A;  3E6M A;  2E71 A;  1X58 A;  4G7Z F;  2M5W A;  2BY3 A;  1YX3 A;  2ZJ2 A;  4X6A J;  2ISY A;  5J8C A;  3HKZ A;  4ASN A;  4KT6 A;  3PQK A;  5JHF A;  3OYN A;  5ILU A;  2R7V A;  3J81 K;  2ZO4 A;  3FF5 A;  1EKE A;  3L7W A;  1P7J A;  4BGD A;  5M5Y J;  2R7U A;  3E6B A;  4L9V A;  4TV7 A;  3VWB A;  2VE9 A;  4RM3 A;  2HKX A;  2LBF A;  3QOE A;  4ZDL A;  1EH8 A;  5GTI C;  3OYB A;  3CCQ I;  2IP2 A;  1BI0 A;  1U0J A;  4N0B A;  4IRI A;  3IUO A;  2WAQ A;  4M3D A;  2QQ8 A;  3ZOB A;  3WTT C;  3L2W A;  3ABM H;  1QQI A;  3LL7 A;  2VUM J;  1I3A A;  1Z6R A;  4A3I J;  5JR3 A;  4N4N B;  1X1C A;  4N9I A;  1Z91 A;  4HAM A;  2VKE A;  1FPQ A;  1LDJ A;  1FYL A;  4RDU A;  3CC2 I;  4L9J A;  2GQQ A;  4J19 A;  3G1M A;  1WVR A;  3O8H A;  2FE3 A;  3M4O J;  3O6B B;  3RYP A;  2HZT A;  4U7D A;  4U0W A;  4D7N A;  2BBY A;  2V9V A;  3FXR A;  3FX3 A;  4FTH A;  2VOO A;  4QPQ A;  3TDZ C;  2X51 A;  2X6Y A;  4M73 A;  2HPM A;  1D8K A;  2ZKZ A;  3DU6 A;  1OKR A;  4M9X A;  1UMQ A;  3MZH A;  4KMU X;  2K40 A;  3F8B A;  3MEX A;  4GGG A;  1A5J A;  2A5Y B;  3A02 A;  2DA2 A;  4M3G A;  3PNY A;  3SZT A;  1KU9 A;  3OR2 C;  5CQE A;  2R92 J;  5A2Q Z;  3GUD A;  2F48 A;  2E1M C;  4B47 A;  1IUY A;  3DKW A;  1OR7 C;  4Y15 A;  1V4R A;  2OCE A;  5IPA A;  5B3S H;  3S14 J;  2OJE D;  4X0G A;  4C2T A;  2X0L A;  1XGM A;  1Y8R B;  4ON0 A;  3L09 A;  5DM7 F;  4PJJ A;  4XRF A;  3HL2 A;  2YPR A;  4IOC F;  4HG2 A;  2XPU A;  2PJR A;  4CCM A;  4MQ9 F;  3QRF F;  4M74 A;  3ZPL A;  5A2Q K;  1B1B A;  3ECO A;  1ZQ3 P;  4E7J A;  4JP0 A;  2KJB A;  1D1B A;  4XNF A;  2NS8 A;  4JBA A;  2XPW A;  4HZF A;  1TW2 A;  3J80 Z;  4YIR X;  1OCC H;  2VL8 A;  3CTA A;  4D9J A;  1SVO A;  1MMN A;  3VOE A;  4LB5 A;  2K9Q A;  5EGO A;  3FMS A;  1T39 A;  2LKX A;  1BW6 A;  1PP7 U;  2MFZ A;  2XKO A;  2QSH X;  5C4J J;  1R36 A;  1QPI A;  1IJW C;  1JHF A;  1W7P D;  2XV4 S;  5GP9 A;  2L5Q A;  3J80 K;  2PMZ N;  3CDH A;  2KZG A;  3L2R A;  1K79 A;  3OIO A;  3VSK A;  2HWV A;  2DYR H;  4YRV A;  1TT5 B;  4HX7 A;  3IL2 A;  3A0B C;  5D5X B;  4Y13 A;  5FJ8 J;  2KZV A;  4KA4 A;  3PNV A;  3D5S C;  3SEQ A;  2Q1Z B;  3EUA A;  4PJL A;  1K83 J;  1RES A;  5K5R A;  5BPI A;  1MJB A;  2R5Z B;  5F0H A;  3RKX A;  1J75 A;  3W6K B;  3FKI J;  2QGU A;  1T8I A;  3HDD A;  3MKW B;  3LFK A;  2V4J C;  2OBP A;  5DD4 A;  1W4M A;  1VQL I;  5C44 J;  2VQH A;  1E0E A;  4CZZ A;  4DGW B;  2ID6 A;  1MD0 A;  4C3H J;  1LVK A;  1XSX A;  2XAF A;  3OL4 A;  3TL4 X;  5BPD A;  3K9T A;  1B59 A;  4XMY A;  1TLH B;  4UHT A;  4BJ6 C;  5FGM A;  4WF2 A;  3K69 A;  2HVR A;  3JRF A;  3GFL A;  5KCM A;  4RS8 A;  2QYO A;  2VT2 A;  4MFD A;  2R7D A;  3AL0 B;  3WTW C;  3W3C A;  3GTL J;  2PFB A;  3H1C A;  3BG3 A;  4A5N A;  3WGG A;  1PP8 F;  2O5R A;  5HDN A;  4H4K C;  3BR5 A;  4UV8 A;  1RKW A;  3JRC A;  2B9S A;  1B9N A;  3HOS A;  1IUF A;  3U9G A;  1NG6 A;  2DA6 A;  1ZYR F;  4O5V A;  1YJN I;  3M8J A;  3QYB A;  2AQF A;  2A6E F;  1J09 A;  3S2H J;  2G0E A;  4CCL A;  3QPL A;  1JUM A;  1H0M A;  2V9K A;  2CUF A;  2MG4 A;  2Z33 A;  3WGI A;  4V19 K;  3WU1 B;  3FXQ A;  3DBL B;  1TT0 A;  2X85 A;  1FSH A;  4BXF A;  1FZP B;  2V1N A;  3BCB A;  4BE1 A;  2NVX J;  1VQK I;  5E18 F;  4Q4Z F;  4OIO F;  1FY7 A;  3SEZ A;  2YX7 A;  3CCJ I;  1FBQ A;  3WTX C;  1REP C;  2Z1D A;  3LA2 A;  3VEP A;  4A3F J;  2FEZ A;  1IZ1 A;  3BTL A;  3PUF A;  2DOA A;  2YUS A;  3GZ5 A;  4GXO A;  5TGT A;  4XSZ F;  4ZH4 F;  3GWZ A;  2UUZ A;  2VKH A;  1D1A A;  3TOB A;  1JXS A;  3HZJ A;  3FXO A;  4B48 A;  4BNC A;  3S1R J;  2BGC A;  2X48 A;  4R79 A;  3IV5 A;  2HOE A;  1RPW A;  5GAH J;  5LD2 C;  2LD5 A;  1SFK A;  3RYR A;  4B4C A;  5IYD J;  2WAF A;  2CH0 A;  2DTZ A;  3TDU C;  1KA8 A;  2YU9 J;  3LAJ A;  1FEX A;  4UNO A;  3ERE D;  1R5I D;  3CJN A;  4LK0 F;  1LFP A;  2V26 A;  2EA2 A;  1V54 H;  4FX4 A;  4ZTF A;  4ZZD A;  4CHU A;  3F3X A;  2RAE A;  5CQG A;  2M87 A;  3D0S A;  2R5Z A;  2PLY A;  2LSO A;  5CVU A;  1UFM A;  4CUG A;  5LGN A;  4KIC A;  2Z16 A;  3EUH A;  3O8G A;  3JTH A;  3Q9S A;  4A3K J;  3K4J A;  4C30 A;  3Q0W A;  1UHW A;  3G2B A;  4F52 A;  1NHA A;  2V1D A;  4DJA A;  2CQK A;  1YIT I;  1S7A A;  4DYR A;  2UXN A;  4XLH A;  2CO5 A;  1YS6 A;  4D5C A;  4ZYE A;  1YIO A;  3C7J A;  2O6G E;  2DA7 A;  3HOV J;  1Z77 A;  1ZG3 A;  2HTJ A;  1T6S A;  1W5C C;  2MSY A;  2DDB A;  1TZL A;  3TBI A;  2XGX A;  4WX9 A;  1MBG A;  1I50 J;  2KIU A;  4LB6 B;  2WA0 A;  2M7A A;  4A0X A;  2XUB A;  2E1M B;  2Z5U A;  4UVC A;  2XB0 X;  1UG0 A;  5FO5 A;  2YS9 A;  3U21 A;  3PUB A;  3MCZ A;  3O3K A;  1WCM J;  1SFE A;  2D45 A;  1IDY A;  1Y56 A;  2RVC A;  3PSF A;  4XKC A;  2E2J J;  2VJI A;  1QO0 D;  2JT1 A;  4S05 A;  3H5N A;  3H36 A;  1BC8 C;  1D0Y A;  2XPV A;  2R5Y A;  1BM9 A;  4G94 A;  2ZJR F;  4G6Q A;  5HDG A;  3ASN H;  2EZL A;  3FBI B;  1T33 A;  4AYB N;  3ZR8 X;  1N78 A;  4CYD A;  2QWW A;  5IT3 A;  4RGR A;  2GLO A;  2W85 A;  3OMY A;  4KIF A;  1U78 A;  1U5T C;  2J5P A;  2GM4 A;  4JX5 A;  2DK8 A;  2M8E A;  4BJT A;  4RGS A;  1U2W A;  1SEU A;  3JTG A;  4WXH A;  1Z7L A;  4A6D A;  1X19 A;  1UHM A;  2WWY A;  3LAP A;  2FNA A;  1E17 A;  3HC7 A;  2E36 A;  2R7F A;  5ICF A;  1OYW A;  3PNT A;  2CMP A;  2CQQ A;  3UNG C;  1FX7 A;  1V5E A;  2L7Z A;  2JA8 J;  5J8F A;  3IWF A;  3OOU A;  3PSI A;  1JUS A;  2NS0 A;  4J00 A;  4IHY A;  1GDT A;  2FUG 2;  2IGN A;  2IS2 A;  3JSP A;  1B72 B;  2NXN B;  2L7F P;  5H6Q A;  1R4N B;  3WU2 C;  4ZYH A;  2W24 A;  2UV1 A;  3CDL A;  4H0E A;  1SD4 A;  1VQP I;  3H92 A;  2IS6 A;  4AIH A;  3AG1 H;  4CYC B;  2DTR A;  4OMY A;  3DEU A;  1E2X A;  1IF1 A;  3S1N J;  3PM1 A;  3CCE I;  5BOX A;  2PMH A;  3S1M J;  2EFN A;  1FP2 A;  4IXA A;  4E7Z A;  2A68 F;  3CMY A;  4UVB A;  2EA4 A;  3L2Q A;  3K10 A;  4FT8 A;  3SHF A;  3LQR A;  3K1M A;  2H94 A;  4ZYD A;  2P5L C;  1TW3 A;  1WJF A;  2KIF A;  5AON A;  2L9S A;  3ERM A;  3DEW A;  4M72 A;  3MKZ A;  4AM3 A;  4YFN F;  3I5U A;  2JPB A;  3BR2 A;  2QQB A;  3ABT A;  4I0B A;  3T8T A;  4A3L J;  3ZMT A;  3A4C A;  2HGC A;  3JRH A;  4F93 B;  2ELK A;  3AG4 H;  3QP6 A;  4R1H A;  4BY1 J;  2VBZ A;  3W6V A;  3E6C C;  3DCF A;  1YG2 A;  3P9I A;  3R61 A;  1JTX A;  3KLN A;  2EIL H;  1JGS A;  2FU4 A;  2K4B A;  2QLZ A;  3JCU C;  5EZG A;  1K78 B;  4B1R A;  3I64 A;  2H1L A;  4ENJ A;  5D5W B;  3DXJ F;  1IG7 A;  1JTY A;  4JK1 X;  3I3L A;  3OYC A;  4IHW A;  3NWT A;  4RB0 A;  2OTJ I;  1IN6 A;  5EDN A;  2Y0M A;  4XQF A;  1I3Q J;  1FOX A;  2ADU A;  2VXD A;  3KZZ A;  2EIM H;  2NNN A;  1J7K A;  2ME0 A;  1N75 A;  1DGR M;  3OR1 C;  5E3O A;  3PO2 J;  5KK1 A;  3MWM A;  2W48 A;  5L3G A;  4ESF A;  1WJD A;  1IC8 A;  4M6Y A;  2A05 A;  2HYF A;  4IHT A;  3OIP A;  1ZRD A;  3HOU J;  3FXU A;  1DPR A;  2DU9 A;  2HFH A;  2V7F A;  2VPR A;  4UY8 I;  1XDU A;  4I09 A;  2ETH A;  2Y30 A;  3KCC A;  4CXF A;  3K70 C;  4MEX F;  1XPX A;  4PGH A;  5J3L A;  5D8L B;  4MNU A;  1HKS A;  3JAM Z;  4XN0 A;  3B6A A;  1SC7 A;  2DO7 A;  3HG9 A;  1T0F A;  5CLS A;  3I9V 2;  1LFU P;  1BL0 A;  4NHJ A;  1ACI A;  3RIR A;  5E79 C;  1U9N A;  1O7L A;  1XGN A;  1SAN A;  5LBQ A;  1B72 A;  1ZG5 A;  4KFC A;  3M9A A;  2DOF A;  2K5C A;  3JRG A;  3GX4 X;  4KDP A;  3HRM A;  3FXM A;  4PJM A;  2L9V A;  2VI6 A;  1XG1 A;  3QP5 A;  4CYC A;  2P8T A;  3HSR A;  1TL8 A;  4NC6 A;  2CUJ A;  2JRM A;  2WB1 N;  3BQZ A;  5M5W J;  2MAB A;  3HM5 A;  4A3J J;  3ML6 A;  1YYV A;  2IS1 A;  4WXD A;  4Q47 A;  1G59 A;  3BZK A;  1X3U A;  5IOZ A;  2HQR A;  3B73 A;  4IL6 C;  3BLY A;  3MKY B;  4FQG A;  4NDL A;  4QSH A;  1RI7 A;  3I56 I;  4BY7 J;  4OU0 A;  2QVO A;  4G6D A;  1F4K A;  2XF6 A;  1FOK A;  4KIS A;  4I6Z A;  2EFO A;  4LLG F;  1C0W A;  3PFI A;  5IYC J;  1ZGW A;  4MQV A;  4B09 A;  2STT A;  2RQP A;  1LEB A;  4P96 A;  3F23 A;  2QBY B;  1GXP A;  3KX2 A;  1YOV B;  1QVU A;  4ZDP A;  3HYI A;  5CVV A;  1WH7 A;  1K78 A;  1W0T A;  3ZGK A;  3TQN A;  4NC7 A;  3IHU A;  2QQ9 A;  4BAY A;  1G6N A;  2G7U A;  1LJ9 A;  2X6W A;  4Y7N J;  2E2H J;  2GIZ A;  3RCO A;  3CC4 I;  1S5L C;  2LDU A;  1IO2 A;  1ZAO A;  4XLF A;  1MMD A;  2KDO A;  3MN2 A;  1UZC A;  2I10 A;  3T5X A;  1ON1 A;  2LFB A;  2JA7 J;  1U5T B;  2NVQ J;  4HBL A;  3RJP A;  3SDG A;  1WI9 A;  2FNP A;  1FMW A;  5LGT A;  1QU3 A;  3PIO F;  5B1A H;  2L4M A;  3ZN0 A;  2QKL B;  2H1K A;  4I0A A;  3F8F A;  4FE4 A;  2HQN A;  2H09 A;  1FOW A;  3LFU A;  5B1B H;  3ZN1 A;  4C2U A;  3QPS A;  2VON A;  3E97 A;  3HOW J;  1HDP A;  2VOD A;  1IW7 F;  3R60 A;  3E5Q A;  1XCV A;  1I39 A;  2DT6 A;  3WHB A;  5LLQ A;  2IS4 A;  3ZQL A;  4IHX A;  2KP6 A;  4LOC A;  2MGQ A;  2IA2 A;  4E7S A;  4PSX A;  1ZR4 A;  4D1Q A;  2KL4 A;  1RIO H;  1F9N A;  3CD6 I;  1IDZ A;  1QZE A;  3L2U A;  2BVM A;  3K0L A;  3V7C A;  1FJL A;  4EVI A;  2DYS H;  4XIC A;  1W36 C;  3GFJ A;  2Y9Y A;  3CES A;  3LA7 A;  1FYK A;  1PUE E;  2WV1 A;  4LG0 B;  3ZXS A;  4B8X A;  1RC9 A;  4O6J A;  3DU5 A;  4UV9 A;  2CWE A;  2L4A A;  3HBL A;  2O3F A;  1P2F A;  2GXB A;  3GTK J;  4PJN A;  4E70 A;  2E35 A;  3S16 J;  1LVA A;  4CZC A;  3EPZ A;  2UZK A;  3FMQ A;  2CV1 A;  4WK8 F;  3W2V A;  2Y9Z A;  1Q1H A;  1YRN B;  3I54 A;  2M0C A;  1V55 H;  4UVA A;  1SAU A;  1WI3 A;  3I4P A;  3OYH A;  3GZ6 A;  3KZI C;  2DMT A;  4P55 A;  4NC8 A;  2E60 A;  2MLK A;  1YHQ I;  1R22 A;  4F91 B;  5ED4 A;  2JA5 J;  1S8N A;  1UCR A;  4P9U A;  2TCT A;  3A1Y A;  3DBR B;  2MLG A;  4IVN A;  5BMZ A;  3CF5 F;  2F4M B;  4A3G J;  2R7S A;  4HA8 A;  4GFB A;  2DI3 A;  3H5A A;  2QBY A;  2DBB A;  2NRA C;  3K2A A;  1LPQ A;  3CUQ B;  4RAF A;  2ELJ A;  3HOX J;  3KP3 A;  3OWT A;  1WZ2 A;  3J7A Y;  2LK2 A;  1BOA A;  3Q0U A;  4QLC U;  2XAQ A;  2EBI A;  4ZYA A;  5D4S A;  1FTT A;  1WJB A;  3OYF A;  5DCF A;  1SD5 A;  2DFH A;  4BXU A;  4BJ5 C;  2ESN A;  2DMQ A;  1WGX A;  2EZH A;  4NBQ A;  4AYB A;  1WPK A;  5HS9 A;  1J5Y A;  2Y31 A;  3BTJ A;  1Z0X A;  3V7R A;  4HDU A;  3BRO A;  1U5T A;  2ZJP F;  3Q5F A;  5DV5 A;  1F5T A;  5FRN A;  2NVT J;  3S3M A;  1W5T A;  4E7K A;  3FXL A;  5J47 A;  1E3P A;  1E3H A;  2HOA A;  5F0F A;  4HW0 A;  4UUT A;  1P4X A;  4RA2 A;  4BQO A;  2DQR A;  3ASO H;  2KQR A;  3K4M A;  1OFC X;  3GFM A;  2YX4 A;  2EIJ H;  2CS3 A;  3HRS A;  1LDD A;  4ZTJ A;  3H9Q A;  5EEH A;  1IN5 A;  3NAU A;  3MD2 A;  4FHT A;  1ERD A;  4M71 A;  4HOB A;  1A36 A;  3BDD A;  2ELH A;  4Y33 A;  5F6F A;  3CME I;  2W4S A;  4AVZ A;  3J7Z I;  3JRB A;  1T38 A;  4PFP A;  2QA4 I;  1POG A;  5FFX A;  2LKS A;  2WAD A;  3LSR A;  4LG0 A;  1TWH J;  4DQ2 A;  3V4G A;  2Y69 H;  4AU7 A;  3AAF A;  4IPA A;  1QHG A;  5LEK A;  3FXJ A;  3BG7 A;  1YE9 A;  2MW8 A;  3RPU A;  3FM5 A;  2CV2 A;  2FD5 A;  1FT9 A;  5FKO A;  4L0Y B;  2Y0S N;  3HGG A;  4L9T A;  4HX4 A;  3KE2 A;  3NQO A;  4M9S A;  3VYS B;  1F36 A;  3IRQ A;  2OCC H;  1MMG A;  2Y2Z A;  3T8R A;  2AQE A;  2VN2 A;  2LMD A;  3MZY A;  5FKN A;  5M3F J;  2BY0 A;  5TRD A;  2J5O A;  4BAC A;  1MSE C;  1YRN A;  2XDV A;  1ODD A;  2L7K A;  2R7Z J;  4MO7 A;  2IW5 A;  2FSW A;  1R23 A;  4P9F A;  3ZQF A;  4RB1 A;  1TNT A;  3VPR A;  1W36 D;  1OJL A;  3GLX A;  1ONV A;  3PL8 A;  2BE5 F;  1STZ A;  4XLC A;  4G8X A;  3CCY A;  4IRG A;  3S17 J;  2LF7 A;  2KKO A;  3HPH A;  3RSN A;  3F8N A;  1MGT A;  2ECB A;  3KP7 A;  4I99 C;  2JSP A;  4R8H A;  1LQ1 A;  1VQM I;  1IRF A;  2DPU A;  1I6X A;  3CUQ A;  3CCS I;  2M3A A;  3WTU C;  1U9O A;  1WKM A;  1O7F A;  1HSJ A;  5JVT A;  1RNL A;  2R0Q C;  1GXQ A;  5E17 F;  3LA3 A;  2ME6 A;  1ETW A;  2VJ5 A;  1G3W A;  2VBY A;  3BG5 A;  3P9C A;  1Z05 A;  5JHU A;  1QVT A;  4XRM A;  4YEL A;  3S3O A;  3K4B A;  2PI0 A;  1YQA A;  2XC7 A;  4EAT A;  4HNV A;  4U0V A;  5K5O A;  2F6C A;  2MYS A;  3CMM A;  2X1D A;  4IZZ A;  3HOT A;  2K9L A;  1KQ8 A;  1ZH5 A;  3GTQ J;  3FK6 A;  1JJ8 C;  2W7N A;  2F4O B;  1XSV A;  5HLI A;  1H9G A;  2B0L A;  4DOZ A;  2ECC A;  2D1V A;  1ZGJ A;  1BI3 A;  1O3S A;  2LG4 A;  1HST A;  2V6E A;  2BHY A;  2HS5 A;  2K9N A;  2HPI A;  2NOJ B;  3E7L A;  4CSW A;  4YG2 F;  3S32 A;  1TC3 C;  1IV8 A;  4K2E A;  3AKZ A;  4ZYG A;  3WTZ A;  5DYM A;  2DJI A;  2C6Y A;  4XID A;  3I0T A;  1DP7 P;  1XX5 A;  3M7G A;  2M7B A;  5EJC A;  4U88 A;  1LE8 B;  1YJW I;  5L3B A;  5IYB J;  5ICE A;  2P81 A;  1JI8 A;  1BIB A;  2VT3 A;  2BEO A;  5KHD A;  1XB4 A;  2JSC A;  1W7P B;  1D1C A;  4DIQ A;  1VQ7 I;  3O2P E;  1JHH A;  5E1X A;  4ENN A;  3J7A O;  4UB8 C;  3E6D A;  1ZR2 A;  4BQA A;  4I01 A;  2GAU A;  3KIO A;  2L9N A;  1VQ8 I;  2E1N A;  4P1W A;  2JQ7 A;  2A07 F;  1ZEL A;  4EJO A;  3F72 A;  1R00 A;  2X6X A;  5J6X A;  1HCR A;  3ZCO A;  1VTN C;  3OYJ A;  4F92 B;  2RNJ A;  4ZC3 A;  4WWC A;  4BDY A;  5FB2 A;  2EZK A;  3CQZ J;  5GTH C;  5DEQ A;  1WJA A;  4E7H A;  2P7C B;  3TOA A;  4G12 A;  2XAS A;  1BJA A;  3GF2 A;  3HRT A;  4S04 A;  4XRS A;  2TDX A;  4MEY F;  4AIJ A;  2G7H A;  3U1K A;  1WFX A;  1XTA A;  5FKM A;  1B6A A;  2I5U A;  3K7A J;  2IVM A;  2VOP A;  5ERI A;  2Q8K A;  2EV0 A;  2CJJ A;  3G3Z A;  2RRE A;  3DKY A;  1F1Z A;  1LNW A;  3LWF A;  1XS9 A;  4ENM A;  1U8B A;  3CCU I;  4GO1 A;  4XSX F;  3P7N A;  5GAD J;  2FXA A;  2EQR A;  2K85 A;  5E20 A;  1FWZ A;  2O61 A;  5D5V B;  1ITY A;  1P6R A;  2KT0 A;  4A93 J;  3BY6 A;  3H3V K;  1Y39 A;  1EH7 A;  2EFP A;  4NQW B;  2R7X A;  1JJ6 C;  4XR6 A;  2K9S A;  3S2W A;  1ZTR A;  2IRF G;  3V7S A;  5KVR A;  3KYL A;  1OPC A;  1SVM A;  4XKB A;  2GBY A;  5DDG A;  3LST A;  3VFZ A;  1X3W B;  2QKM B;  3K4N A;  1RET A;  2W25 A;  3CP8 A;  4BDZ A;  2CG4 A;  3I59 B;  5IP9 J;  4KJZ A;  1QBJ A;  1EV7 A;  5GPA A;  2X1C A;  2V1U A;  4CDG A;  2M34 A;  3IP4 B;  3IC7 A;  1QA6 A;  2ZXI A;  5K5Q A;  3JRI A;  5E3N A;  2R7Q A;  2OA4 A;  2RKH A;  5AIP A;  2FOK A;  1JUP A;  2ID3 A;  2P4W A;  4ANJ A;  1L3L A;  1KGS A;  2MC3 A;  1MNM C;  2FBI A;  1NH3 A;  2V9P A;  1MH3 A;  3CCL I;  2E2I J;  3IH4 A;  2M0M A;  3CJQ B;  2W82 A;  4PZJ A;  1XSD A;  2RQQ A;  1Z1D A;  5C4X J;  5JVG F;  5L3E A;  2XHK A;  3DQV C;  3KYD B;  2CGP A;  1LE8 A;  4IQJ A;  2L9R A;  5CJ9 A;  1BR1 A;  5HNF A;  2M2E A;  1SFU A;  2XAJ A;  1W7P A;  4B44 A;  1YJ9 I;  2XSJ C;  4PCQ A;  4HDV A;  4CGZ A;  2E7W A;  2BY2 A;  5HS7 A;  3OYK A;  3C1D A;  4LLL A;  3DF8 A;  3A03 A;  1OQY A;  2VKD A;  4JOM A;  2XF5 A;  3JRE A;  5LEJ A;  1IRZ A;  2L02 A;  3F8C A;  4LJZ F;  3FBN B;  4XBF A;  2CW8 A;  2QF7 A;  5KAI C;  4EGY A;  5HLT A;  1BW5 A;  2JN6 A;  2H6C A;  4V2F A;  2HXO A;  4MGR A;  4PDK A;  2EIK H;  2LRD A;  1HOM A;  1MZB A;  3CCR I;  2EV5 A;  2E5Z A;  3HKZ N;  4AWX B;  2IT0 A;  4MFE A;  3KP6 A;  4EJV A;  5LHI A;  2MH2 A;  3FZV A;  3KP4 A;  5K7Z A;  1X4O A;  4Q5S F;  4XLA A;  1MBK A;  1VQ4 I;  1WJE A;  2H8W A;  3OYA A;  1YS7 A;  2VC0 A;  3BPX A;  5HOO A;  5DCM B;  4AD9 A;  2OAZ A;  3RI4 A;  5D6F A;  2VJ4 A;  4HPQ A;  2CUZ A;  4RBO A;  2WAQ N;  3MZ8 A;  3IKT A;  2W1O A;  5C3E J;  1W0U A;  1IRG A;  3LSM A;  2KRC A;  5F08 A;  3C2G A;  3BJA A;  1R1T A;  2IGM A;  1Z3Y A;  3DFG A;  4NQW A;  3E0J B;  2CYY A;  5IP7 J;  3GTO J;  1FIP A;  5FLX Z;  1UB9 A;  3V8L A;  3UKG A;  3MFK A;  1Z9C A;  3GFI A;  4M6V A;  5E8G A;  5E3M A;  2M8G X;  3ABK H;  2X9D A;  3CF2 A;  3I59 A;  1H88 C;  2IJL A;  4GDF A;  5ILV A;  2K7L A;  2F4I A;  5HS8 A;  2OD5 A;  4N9H A;  1APL C;  1OCT C;  5FLX K;  4OAZ A;  3ABU A;  2X6O A;  2HYJ A;  4KUM A;  1VZ0 A;  3W2W A;  1O3Q A;  3ONQ A;  5L3D A;  1VQ9 I;  3KP2 A;  4HQE A;  1T56 A;  3LSG A;  3SQN A;  3TMO A;  1K4T A;  1XMK A;  3LQQ A;  2V79 A;  4XLE A;  4A3E J;  1XD7 A;  3PO3 J;  4HF2 A;  1TNS A;  3CO6 C;  2K3F A;  2LY1 A;  2DPD A;  5KNL A;  3WGH A;  1BR4 A;  3TGN A;  1JE8 A;  1O3T A;  3VOD A;  3DPT A;  2DA1 A;  1HKT A;  5M3M J;  1HDD C;  4BYY A;  3DLA A;  3EET A;  3QPT A;  1YFH A;  1LEA A;  2VXZ A;  1X1B A;  1OR7 A;  3V8J A;  1Y0U A;  2MBF A;  3IH3 A;  1GT0 C;  4HF0 A;  2FQ3 A;  1V5F A;  4IX7 A;  2O9L A;  3LSH A;  2EZI A;  1VND A;  4PSW A;  2JUG A;  2EK5 A;  1FYM A;  5IP6 A;  1M1E B;  2VIX A;  4OWR B;  4J01 A;  3FXK A;  2DCE A;  1AOY A;  2IPQ X;  2JA6 J;  2EB7 A;  2HKO A;  4I02 A;  4P5O A;  4EM2 A;  3B02 A;  5JFR A;  2E34 A;  3LSK A;  2FML A;  2TRT A;  4HSR A;  3DTK A;  1J2X A;  2WY8 Q;  1RUN A;  1HLV A;  1JT6 A;  2ZBK A;  1D5V A;  3S3N A;  2HVQ A;  2ZC2 A;  4PJ0 C;  4UXN A;  3VYT B;  3NAR A;  3NWS A;  4FCY A;  2A6T A;  4F7Z A;  3BOQ A;  1P9Q C;  1LKX A;  1QRY A;  3QU3 A;  2EIN H;  3MMY B;  3M8E A;  4EGZ A;  5J4V A;  4YFK F;  1A6I A;  3BTI A;  4BE0 A;  2ICW G;  2PX9 A;  4ITV A;  4YII A;  1TTY A;  2PMZ A;  1YI2 I;  5DCM A;  3SDB A;  1HXD A;  2DT5 A;  5ICG A;  2DFE A;  1QPM A;  2HU9 A;  4D0P A;  1KU3 A;  1MNE A;  2DFF A;  3JAM K;  1SD7 A;  5DUI A;  2KDZ A;  3C3W A;  1KQ0 A;  4RGU A;  4KMF A;  1DPU A;  4DW6 A;  3CJT B;  4HYE A;  4ZZL A;  4CCO A;  2XSD C;  3ZMZ A;  1YIJ I;  5K7F A;  3ZMS A;  4XKW A;  3CZ6 A;  3P5J A;  2R7T A;  3OV8 A;  2HDW A;  3DBH B;  5DTD A;  1VFC A;  2KIQ A;  3QU6 A;  5JLW A;  1YX5 A;  2LY2 A;  1S7E A;  1R58 A;  1O57 A;  4F3Q A;  3OYL A;  2CQ7 A;  4IOA F;  4NNJ A;  1HKQ A;  4HNU A;  2F5D A;  1S7O A;  4JQF A;  3WU0 A;  1TWG J;  3TKY A;  4MTE A;  2LKP A;  1VQ6 I;  3E3V A;  2QEN A;  1X2M A;  3PQJ A;  2Y48 A;  3H9J A;  4L9N A;  4BXX J;  1IRX A;  1WRJ A;  2VQG A;  3DTE A;  1T98 A;  1WH5 A;  1OCZ H;  3HIF A;  1D0Z A;  4PK4 A;  1T2K A;  3KPH A;  1U3E M;  1CQT A;  1PUF B;  4CCN A;  2KJC A;  3ZRG A;  5IT9 Z;  3HSE A;  1EJ9 A;  1ZGA A;  1IGN A;  3RQ4 A;  3FM3 A;  1N77 A;  1ZRE A;  3CCV I;  4RB3 C;  2QSG X;  1T95 A;  5LRR A;  2ZXH A;  2DMU A;  5M5X J;  4XN3 A;  1H89 C;  3K4L A;  1MBF A;  3CLO A;  2P5K A;  3HXL A;  5FKL A;  3TP0 A;  2EV6 A;  3M1E A;  5IT9 K;  3CMA I;  2HDC A;  3OSF A;  3G6E I;  2XKP A;  5FRO A;  1D0X A;  3V42 A;  1X1D A;  3IH2 A;  1PJR A;  3OYG A;  3G4S I;  3BP8 A;  2ZME C;  1W1W E;  2DAO A;  1DQU A;  2AXT C;  2HNH A;  4CCJ A;  3N97 A;  3GTP J;  5FFZ A;  3S1Q J;  1G3T A;  2VQC A;  4G7O F;  4W1U A;  4OIQ F;  1OCO H;  3PJR A;  3HTU A;  2FOW A;  4QWQ A;  1TWA J;  2LYC A;  2XAU A;  3GXO A;  2W00 A;  3N05 A;  4B43 A;  1WJ5 A;  2NNY A;  4BEH B;  3D5L A;  2WTE A;  2VPL A; 
#chains in the Genus database with same CATH homology
 3W6J B;  2QZ8 A;  1R5G A;  5LHG A;  5CVI A;  1J9I A;  4EJW A;  3NRV A;  1DUX C;  1S29 A;  2ZCW A;  2UXX A;  2DLL A;  4LK1 F;  5F64 A;  1HW5 A;  1WWX A;  1ZRF A;  5HDK A;  3SFZ A;  3RKY A;  2ZFW A;  2ISZ A;  2RN7 A;  2IA1 A;  4RAZ A;  4Z2Y A;  4A2U A;  1LDK B;  4ESB A;  2WV0 A;  2BV6 A;  3DPL C;  4FX0 A;  2MA3 A;  1DDN A;  2EWN A;  3K1P A;  3GYH X;  3M8F A;  1USS A;  3BZ6 A;  2HEO A;  1OYY A;  2EJR A;  5ICC A;  1IXC A;  4LD5 A;  4EJU A;  2FRH A;  1HW2 A;  1ZLK A;  1TQI A;  3R4K A;  4M9Z A;  4OIP F;  1H9T A;  5L3C A;  1ZLJ A;  3I58 A;  4KNY A;  2M1B A;  5DUK A;  2F2E A;  2A3S A;  3JSO A;  3J81 Z;  5BS6 A;  4PGG A;  4RB2 C;  2JRT A;  5L3F A;  2DQL A;  2MD5 A;  4OMZ A;  2K27 A;  2ZNZ A;  1UST A;  1HQC A;  3HHG A;  1KU7 A;  2XAH A;  1CF7 B;  1XMA A;  2JTV A;  1A04 A;  1J0R A;  3RTR A;  1KU2 A;  3GEZ A;  3H3U A;  2M30 A;  1IXR C;  3SZP A;  2L54 A;  4EMS A;  4KIG A;  2YSR A;  3COA C;  2DK5 A;  2D2W A;  3QAH A;  4LMY A;  1TBX A;  4CIC A;  1MKM A;  2V1X A;  4RAY A;  3ZMV A;  3EQL F;  5LHH A;  1FLI A;  4LGW A;  1XDS A;  2PBI A;  1GHC A;  2XVC A;  3P9K A;  3WE2 A;  3HUG A;  2H27 A;  1YO5 C;  3WTY C;  4Q48 A;  3TO6 A;  1QGP A;  4XLN F;  2NYX A;  2PEX A;  4YIF A;  1HBX G;  3ELK A;  3G73 A;  3ROU A;  2P5V A;  3CUO A;  2QQA A;  3KEO A;  3ULQ B;  2VBX A;  3IKV A;  2FMY A;  3F6O A;  2FF4 A;  3T0Y A;  4L0Z B;  1SFX A;  2P6S A;  1IXS B;  4KN7 X;  4UUV A;  2JZY A;  4WCG A;  2O03 A;  3FWE A;  3K1N A;  4IHS A;  3N4M A;  4XLP F;  4I2O A;  2ZME B;  3GW2 A;  3CO7 C;  2FBH A;  3R6S A;  4GYI A;  1K6O A;  1W5S A;  2YR2 A;  5HLG A;  5CVR A;  1S6L A;  2P6T A;  2V6C A;  1CF7 A;  1PDN C;  1SAX A;  2GWR A;  2K02 A;  2Q0O A;  3VB2 A;  2HYG D;  4M6X A;  2L01 A;  3KFW X;  1AWC A;  5D5U B;  1B4A A;  4EV0 A;  1V3F A;  1R5H A;  3WOD F;  1FBU A;  1I1G A;  4HLX A;  3F6V A;  1YTY A;  1IAW A;  1BC7 C;  1ZRC A;  2F5F A;  2ZXJ A;  4HQM A;  4U0Y A;  4KN4 X;  3QOP A;  3SXY A;  2STW A;  1G3Y A;  3KP5 A;  3QPH A;  3C18 A;  2UWM A;  3I71 A;  5FD5 A;  3GO5 A;  1QZY A;  1BBY A;  3RKW A;  5LGU A;  1XGO A;  1BI2 A;  2OZU A;  4A0Z A;  2VE8 A;  1OMI A;  1LB2 A;  2Q2E A;  3EYI A;  3MAJ A;  4Y17 A;  3R0A A;  1WQ2 A;  1ULY A;  2O0Y A;  1I1S A;  4EJT A;  1L0O C;  2FA5 A;  1IN7 A;  4HX8 A;  4L18 B;  1RZ4 A;  2PQ8 A;  4G7H F;  2ZME A;  2K86 A;  2A69 F;  1ZG1 A;  3E5X A;  2E1C A;  2Z3Y A;  2WC2 A;  2GZW A;  1OYI A;  1XGS A;  3F8M A;  2FBK A;  1R1U A;  2CW0 F;  2RC4 A;  1U6G A;  5CYV A;  3FHZ A;  1Z6T A;  3BPV A;  4BHB A;  2Z9O A;  2KIM A;  3WTS C;  2PJP A;  3KEQ A;  2D1H A;  2R3S A;  3IRR A;  2ACJ A;  1MJ9 A;  5AIQ A;  5DD8 A;  4OIR F;  1FBS A;  5FD6 A;  1FSE A;  2AXL A;  2F5C A;  3ZMD A;  1J59 A;  4U7B A;  4HF1 A;  2JPC A;  4IRH A;  4LFU A;  1FC3 A;  3Q9V A;  4L5J A;  2A6H F;  5H20 A;  1HW1 A;  3BWG A;  1BN5 A;  2XIG A;  3DP7 A;  3DV8 A;  2CFX A;  1I5Z A;  1O3R A;  4YFX F;  1MDM B;  2M45 A;  4A12 A;  1P92 A;  3T1B A;  4AVP A;  1EH6 A;  2W57 A;  4LLN A;  1S3J A;  1GVJ A;  2ESH A;  3KZY A;  4OIN F;  4O3M A;  3RPQ A;  1D8J A;  3KET A;  4A0Y A;  3L00 A;  1U8R A;  3REO A;  1P4W A;  3I53 A;  3EYY A;  4A6E A;  4KYW A;  1I27 A;  3ZQ7 A;  5HVQ C;  1SMY F;  1KQ9 A;  2H6B A;  3MQ0 A;  5LRS A;  3F22 A;  1FP1 D;  1D3Y A;  1ZN2 A;  3TO7 A;  2RV8 A;  3EDP A;  2Z99 A;  3ZMU A;  5D4R A;  3R0J A;  3ISP A;  4AIK A;  1R1V A;  5ILS A;  1Z7U A;  2LNB A;  3ZP5 A;  1IN4 A;  4I7H A;  5D8K B;  1YW9 A;  4ENK A;  2W84 A;  3CUQ C;  2XRO A;  3HHH A;  5H6R A;  4BHC A;  2XRN A;  4NB5 A;  4EM0 B;  2OU2 A;  2ZNY A;  1TQP A;  4L5I A;  2HR3 A;  2MH9 A;  3L9F A;  2K4J A;  1QNT A;  3F21 A;  1MDM A;  5K1Y A;  2DFI A;  1MJA A;  4OOI A;  5E8I A;  2OZ6 A;  2DW4 A;  5E1Z B;  2KRF A;  3IWZ A;  3FMR A;  2PMU A;  2QM3 A;  4WXC A;  1YW7 A;  3BJO A;  4GCV A;  1XN7 A;  1K7A A;  4MTD A;  1KYZ A;  3V8K A;  5D6E A;  1B9M A;  2Y75 A;  2PN6 A;  1RUO A;  3KLO A;  2VC1 A;  2E7X A;  2GIV A;  2X4H A;  1YLF A;  2GA2 A;  2A61 A;  2CSO A;  2LF8 A;  1FNN A;  4IJA A;  4KT5 C;  1QZZ A;  4G9Y A;  2YU3 A;  1ZAR A;  1ZHF A;  4HV6 A;  1BIA A;  4ESJ A;  2EFW A;  4HV5 A;  4EM1 A;  3HTS B;  1G3S A;  3GVA A;  3E5U A;  4KIB A;  4I98 B;  1G4D A;  5EEG A;  4BHP A;  5BQT A;  2EFQ A;  1SD6 A;  3H3Z A;  3WTV C;  2COM A;  2RDP A;  4RGX A;  1WSU A;  1P4A A;  5TJJ A;  1SMT A;  4HLY A;  3U2R A;  3HRU A;  2PG4 A;  2VBW A;  2GA1 A;  6PAX A;  4CO8 A;  3WE3 A;  5JI6 A;  3NEU A;  4A5M A;  2IA0 A;  5HLH A;  3TO9 A;  2O8X A;  2QUF A;  3RDI A;  1YW8 A;  2G9W A;  4GYG A;  4EQQ A;  2NAZ A;  5CVJ A;  2HTS A;  2XAG A;  3OOP A;  1R7J A;  5E1W A;  1CGP A;  3ECH A;  5F1R A;  1TQM A;  2BYV E;  2RGV A;  2F5E A;  3U1D A;  3HSF A;  2P7V B;  1BI1 A;  4DNC A;  4BH9 A;  3L2C A;  3BJ6 A;  1XCB A;  1ON2 A;  3K2Z A;  1KYW A;  4ETS A;  4MHG A;  2AS5 F;  1IN8 A;  3JW4 A;  2OQG A;  2OQR A;  3WG9 A;  4IF4 A;  2GXG A;  2L3D A;  3E6M A;  4G7Z F;  2M5W A;  2ZJ2 A;  2ISY A;  5J8C A;  4ASN A;  3PQK A;  5ILU A;  3J81 K;  2ZO4 A;  3FF5 A;  3L7W A;  3E6B A;  4L9V A;  4TV7 A;  2VE9 A;  2HKX A;  1EH8 A;  2IP2 A;  1BI0 A;  4N0B A;  4IRI A;  3WTT C;  1QQI A;  1Z6R A;  5JR3 A;  4N9I A;  1Z91 A;  4HAM A;  1FPQ A;  1LDJ A;  1FYL A;  4L9J A;  2GQQ A;  2FE3 A;  3O6B B;  3RYP A;  2HZT A;  4U7D A;  4U0W A;  2BBY A;  2V9V A;  3FXR A;  3FX3 A;  2VOO A;  3TDZ C;  4M73 A;  1D8K A;  2ZKZ A;  1OKR A;  4M9X A;  3MZH A;  4KMU X;  3F8B A;  3MEX A;  4GGG A;  2A5Y B;  3SZT A;  1KU9 A;  5A2Q Z;  3GUD A;  1IUY A;  3DKW A;  4Y15 A;  1V4R A;  2X0L A;  1XGM A;  4ON0 A;  3L09 A;  4XRF A;  2YPR A;  4MQ9 F;  3QRF F;  4M74 A;  3ZPL A;  5A2Q K;  1B1B A;  3ECO A;  2KJB A;  4JBA A;  3J80 Z;  1TW2 A;  4HZF A;  3CTA A;  3VOE A;  4LB5 A;  3FMS A;  1T39 A;  1PP7 U;  2XKO A;  1R36 A;  1JHF A;  1W7P D;  2XV4 S;  3J80 K;  3CDH A;  1K79 A;  2HWV A;  4HX7 A;  3IL2 A;  5D5X B;  4Y13 A;  4KA4 A;  5BPI A;  5K5R A;  1MJB A;  3RKX A;  1J75 A;  3W6K B;  3LFK A;  2OBP A;  5DD4 A;  1W4M A;  4CZZ A;  1MD0 A;  1XSX A;  2XAF A;  5BPD A;  3K9T A;  1B59 A;  1TLH B;  4UHT A;  5FGM A;  4WF2 A;  3K69 A;  3GFL A;  4RS8 A;  2QYO A;  2VT2 A;  2R7D A;  3WTW C;  2PFB A;  4A5N A;  3WGG A;  1PP8 F;  5HDN A;  4UV8 A;  1B9N A;  3HOS A;  3U9G A;  1ZYR F;  4O5V A;  2A6E F;  1H0M A;  2Z33 A;  3WGI A;  3WU1 B;  3FXQ A;  1FSH A;  1FZP B;  5E18 F;  4Q4Z F;  4OIO F;  1FY7 A;  2YX7 A;  1FBQ A;  3WTX C;  1REP C;  3LA2 A;  3VEP A;  2FEZ A;  1IZ1 A;  3GZ5 A;  4GXO A;  4XSZ F;  4ZH4 F;  3GWZ A;  3TOB A;  1JXS A;  4BNC A;  2BGC A;  4R79 A;  2HOE A;  3RYR A;  3TDU C;  1KA8 A;  3LAJ A;  4UNO A;  3ERE D;  3CJN A;  4LK0 F;  2EA2 A;  4FX4 A;  4ZZD A;  4CHU A;  3F3X A;  2M87 A;  3D0S A;  2PLY A;  2LSO A;  5CVU A;  1UFM A;  5LGN A;  4KIC A;  3EUH A;  3JTH A;  3Q9S A;  1UHW A;  1NHA A;  2V1D A;  2CQK A;  1S7A A;  2UXN A;  2CO5 A;  1YS6 A;  4ZYE A;  1YIO A;  3C7J A;  2O6G E;  1ZG3 A;  2HTJ A;  1T6S A;  2XGX A;  4WX9 A;  2KIU A;  4LB6 B;  4A0X A;  2XUB A;  2Z5U A;  4UVC A;  5FO5 A;  3MCZ A;  3O3K A;  1SFE A;  2D45 A;  2RVC A;  1QO0 D;  2JT1 A;  4S05 A;  1BC8 C;  1BM9 A;  4G94 A;  4G6Q A;  5HDG A;  4CYD A;  2QWW A;  5IT3 A;  4RGR A;  2W85 A;  4KIF A;  1U78 A;  1U5T C;  2J5P A;  2DK8 A;  2M8E A;  4RGS A;  1U2W A;  3JTG A;  4WXH A;  4A6D A;  1UHM A;  2WWY A;  3LAP A;  2FNA A;  1E17 A;  2R7F A;  5ICF A;  1OYW A;  1FX7 A;  5J8F A;  3IWF A;  2NS0 A;  3JSP A;  5H6Q A;  4ZYH A;  2W24 A;  4H0E A;  1SD4 A;  3H92 A;  4AIH A;  4OMY A;  2DTR A;  3DEU A;  1E2X A;  1IF1 A;  5BOX A;  2PMH A;  2EFN A;  1FP2 A;  4IXA A;  2A68 F;  4UVB A;  2EA4 A;  4FT8 A;  3SHF A;  3LQR A;  3K1M A;  2H94 A;  4ZYD A;  2P5L C;  1TW3 A;  2KIF A;  5AON A;  4M72 A;  4YFN F;  3I5U A;  2JPB A;  2QQB A;  3ABT A;  4I0B A;  3T8T A;  3ZMT A;  2HGC A;  3QP6 A;  4R1H A;  2VBZ A;  3E6C C;  1YG2 A;  3P9I A;  3R61 A;  3KLN A;  1JGS A;  2FU4 A;  2K4B A;  2QLZ A;  1K78 B;  3I64 A;  4ENJ A;  5D5W B;  3DXJ F;  4JK1 X;  4RB0 A;  1IN6 A;  2Y0M A;  2ADU A;  3KZZ A;  2NNN A;  1J7K A;  5KK1 A;  3MWM A;  5L3G A;  4ESF A;  4M6Y A;  2HYF A;  4IHT A;  1ZRD A;  3FXU A;  1DPR A;  2DU9 A;  2HFH A;  1XDU A;  4I09 A;  2ETH A;  3KCC A;  4CXF A;  4MEX F;  4PGH A;  5D8L B;  4MNU A;  1HKS A;  3JAM Z;  2DO7 A;  1T0F A;  5CLS A;  4NHJ A;  3RIR A;  1O7L A;  1XGN A;  5LBQ A;  1ZG5 A;  4KFC A;  3M9A A;  4KDP A;  3GX4 X;  3HRM A;  3QP5 A;  2P8T A;  3HSR A;  3ML6 A;  1YYV A;  4WXD A;  4Q47 A;  1X3U A;  2HQR A;  3B73 A;  1RI7 A;  4OU0 A;  2QVO A;  4G6D A;  1F4K A;  1FOK A;  2EFO A;  4LLG F;  1C0W A;  3PFI A;  4MQV A;  4B09 A;  2STT A;  2RQP A;  1LEB A;  4P96 A;  3F23 A;  2QBY B;  1GXP A;  3HYI A;  5CVV A;  1K78 A;  3TQN A;  4BAY A;  3IHU A;  2QQ9 A;  1G6N A;  2G7U A;  1LJ9 A;  2LDU A;  1ZAO A;  3T5X A;  1ON1 A;  1U5T B;  4HBL A;  3RJP A;  1WI9 A;  2FNP A;  5LGT A;  2L4M A;  3ZN0 A;  4I0A A;  3F8F A;  2HQN A;  2H09 A;  3ZN1 A;  2VON A;  3E97 A;  2VOD A;  1IW7 F;  3R60 A;  3E5Q A;  1XCV A;  5LLQ A;  2IA2 A;  1RIO H;  1F9N A;  3K0L A;  3V7C A;  4EVI A;  3GFJ A;  1FYK A;  3LA7 A;  1PUE E;  4LG0 B;  4B8X A;  4O6J A;  4UV9 A;  2CWE A;  2L4A A;  2O3F A;  1P2F A;  2GXB A;  4E70 A;  1LVA A;  2UZK A;  3FMQ A;  4WK8 F;  1Q1H A;  3I54 A;  4UVA A;  3I4P A;  3GZ6 A;  4P55 A;  2MLK A;  1R22 A;  5ED4 A;  1S8N A;  1UCR A;  4P9U A;  4IVN A;  2MLG A;  5BMZ A;  4HA8 A;  2DI3 A;  2QBY A;  2DBB A;  2NRA C;  3CUQ B;  3KP3 A;  1BOA A;  4QLC U;  2XAQ A;  5D4S A;  5DCF A;  1SD5 A;  4BXU A;  2ESN A;  5HS9 A;  1J5Y A;  3V7R A;  4HDU A;  3BRO A;  1U5T A;  3Q5F A;  1F5T A;  5DV5 A;  1W5T A;  4HW0 A;  1P4X A;  2DQR A;  3GFM A;  2YX4 A;  3HRS A;  1LDD A;  5EEH A;  1IN5 A;  4FHT A;  4M71 A;  4HOB A;  3BDD A;  2ELH A;  5F6F A;  1T38 A;  5FFX A;  4LG0 A;  4DQ2 A;  3V4G A;  3AAF A;  4IPA A;  5LEK A;  3RPU A;  3FM5 A;  1FT9 A;  4L0Y B;  4L9T A;  4HX4 A;  3KE2 A;  3NQO A;  4M9S A;  3IRQ A;  3T8R A;  2VN2 A;  5TRD A;  3MZY A;  2J5O A;  1ODD A;  2IW5 A;  2FSW A;  1R23 A;  4P9F A;  4RB1 A;  1TNT A;  3GLX A;  1ONV A;  2BE5 F;  1STZ A;  4G8X A;  4IRG A;  2LF7 A;  2KKO A;  3F8N A;  1MGT A;  3KP7 A;  4R8H A;  1LQ1 A;  1IRF A;  2DPU A;  1I6X A;  3CUQ A;  3WTU C;  1WKM A;  1O7F A;  1HSJ A;  5JVT A;  1RNL A;  1GXQ A;  5E17 F;  3LA3 A;  1G3W A;  2VBY A;  3P9C A;  1Z05 A;  5JHU A;  2PI0 A;  1YQA A;  4U0V A;  5K5O A;  3HOT A;  1KQ8 A;  1ZH5 A;  1XSV A;  5HLI A;  1H9G A;  2B0L A;  2D1V A;  1ZGJ A;  1BI3 A;  1O3S A;  1HST A;  2HS5 A;  4YG2 F;  4K2E A;  4ZYG A;  3WTZ A;  5DYM A;  2C6Y A;  3I0T A;  1DP7 P;  3M7G A;  4U88 A;  5L3B A;  5ICE A;  1BIB A;  2VT3 A;  2BEO A;  1XB4 A;  2JSC A;  1W7P B;  3O2P E;  1JHH A;  5E1X A;  4ENN A;  3J7A O;  3E6D A;  4BQA A;  4I01 A;  2GAU A;  2E1N A;  2A07 F;  4EJO A;  3F72 A;  1R00 A;  5J6X A;  1VTN C;  4WWC A;  2RNJ A;  5FB2 A;  5DEQ A;  2P7C B;  3TOA A;  2XAS A;  1BJA A;  3GF2 A;  3HRT A;  4S04 A;  2TDX A;  4MEY F;  4AIJ A;  2G7H A;  1B6A A;  2IVM A;  2VOP A;  5ERI A;  2Q8K A;  2EV0 A;  3G3Z A;  1F1Z A;  1LNW A;  3LWF A;  4ENM A;  4GO1 A;  4XSX F;  3P7N A;  2FXA A;  5E20 A;  1FWZ A;  2O61 A;  5D5V B;  1P6R A;  3BY6 A;  1EH7 A;  2EFP A;  3S2W A;  2IRF G;  3V7S A;  5KVR A;  1OPC A;  5DDG A;  3LST A;  3VFZ A;  2W25 A;  2CG4 A;  3I59 B;  1QBJ A;  1EV7 A;  2V1U A;  4CDG A;  3IC7 A;  5K5Q A;  2OA4 A;  2RKH A;  5AIP A;  2FOK A;  2P4W A;  1L3L A;  1KGS A;  2MC3 A;  2FBI A;  4PZJ A;  1XSD A;  1Z1D A;  5L3E A;  2XHK A;  3DQV C;  2CGP A;  5CJ9 A;  1SFU A;  2XAJ A;  1W7P A;  4HDV A;  4PCQ A;  4CGZ A;  2E7W A;  5HS7 A;  3C1D A;  4LLL A;  3DF8 A;  5LEJ A;  2L02 A;  3F8C A;  4LJZ F;  4XBF A;  4EGY A;  2H6C A;  4MGR A;  4PDK A;  1MZB A;  2EV5 A;  4AWX B;  2IT0 A;  3KP6 A;  4EJV A;  5LHI A;  2MH2 A;  3FZV A;  3KP4 A;  4Q5S F;  1YS7 A;  2VC0 A;  3BPX A;  5HOO A;  5DCM B;  4AD9 A;  2OAZ A;  3RI4 A;  5D6F A;  3IKT A;  1IRG A;  3BJA A;  1R1T A;  3DFG A;  4NQW A;  2CYY A;  5FLX Z;  1UB9 A;  3V8L A;  3MFK A;  1Z9C A;  3GFI A;  5E8G A;  3I59 A;  2IJL A;  5ILV A;  2K7L A;  5HS8 A;  2OD5 A;  4N9H A;  5FLX K;  3ABU A;  4KUM A;  1O3Q A;  5L3D A;  3KP2 A;  4HQE A;  3SQN A;  1XMK A;  3LQQ A;  2V79 A;  1XD7 A;  4HF2 A;  1TNS A;  3CO6 C;  2DPD A;  3WGH A;  3TGN A;  1JE8 A;  1O3T A;  3VOD A;  3DPT A;  1HKT A;  4BYY A;  3EET A;  3QPT A;  1YFH A;  1LEA A;  2VXZ A;  1OR7 A;  3V8J A;  1Y0U A;  2MBF A;  4HF0 A;  2FQ3 A;  2EK5 A;  1FYM A;  1AOY A;  2IPQ X;  2EB7 A;  2HKO A;  4EM2 A;  4I02 A;  4P5O A;  3B02 A;  5JFR A;  2FML A;  1J2X A;  1RUN A;  2ZBK A;  1D5V A;  4UXN A;  4F7Z A;  3BOQ A;  3QU3 A;  4EGZ A;  3M8E A;  4YFK F;  4YII A;  1TTY A;  5DCM A;  1HXD A;  2DT5 A;  5ICG A;  1QPM A;  4D0P A;  1KU3 A;  3JAM K;  1SD7 A;  5DUI A;  3C3W A;  1KQ0 A;  4RGU A;  4KMF A;  1DPU A;  4HYE A;  4ZZL A;  3ZMZ A;  3ZMS A;  3OV8 A;  3QU6 A;  1R58 A;  1O57 A;  1HKQ A;  2F5D A;  1S7O A;  4JQF A;  3WU0 A;  3TKY A;  4MTE A;  2LKP A;  3E3V A;  2QEN A;  3PQJ A;  2Y48 A;  4L9N A;  1WRJ A;  1T98 A;  3HIF A;  1T2K A;  1U3E M;  2KJC A;  5IT9 Z;  3HSE A;  1ZGA A;  3FM3 A;  1ZRE A;  4RB3 C;  5LRR A;  3CLO A;  2P5K A;  2EV6 A;  3M1E A;  5IT9 K;  2HDC A;  2XKP A;  3BP8 A;  2DAO A;  3N97 A;  5FFZ A;  1G3T A;  4G7O F;  4OIQ F;  3HTU A;  4QWQ A;  3GXO A;  2NNY A;  3D5L A;  2WTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...