1K79A

Ets-1(331-440)+ggaa duplex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
104
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*AP*AP*TP*GP*T)-3')
publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k79A00
1O57A 1T6SA 1P4XA 3R61A 4XLNF 5LGTA 1TQPA 2FQ3A 3QPTA 3GVAA 1JGSA 1XMKA 3ZMTA 2STTA 2VXZA 1KYZA 2BBYA 3WGHA 3F6OA 5HDKA 2P6SA 3R0AA 3DFGA 1O7FA 1JE8A 3WTXC 3L9FA 2ZCWA 3EDPA 3F23A 3P7NA 2V6CA 2D2WA 4A2UA 2EFQA 1LNWA 5HVQC 4Y15A 1QQIA 2CYYA 2XAFA 1ONVA 1CGPA 3RPUA 1XDSA 3HYIA 4PDKA 4MNUA 2HQNA 2R7DA 3GLXA 4KYWA 4LFUA 2EWNA 3L00A 4K2EA 4OOIA 3B73A 4A5NA 3F6VA 2MC3A 3DPLC 2GQQA 4RB0A 1SD4A 4IRHA 2QYOA 1XSVA 2F5DA 1G3TA 3BOQA 2KJCA 1G3YA 1TW3A 2EA2A 5JHUA 2FA5A 4YFXF 2RVCA 2RQPA 1D8KA 1CF7B 1U6GA 1KU2A 2PLYA 4G7OF 3MCZA 4RGRA 3C7JA 2Z99A 3F8NA 4UVBA 4EJUA 4HV6A 3LA7A 1S29A 2GAUA 4I98B 3DKWA 2KIUA 1WI9A 2MA3A 4WWCA 1FYMA 1SFEA 3F21A 3M9AA 4LD5A 3TO7A 3JTGA 1YS6A 4IXAA 1T2KA 5K5QA 2VOPA 2A61A 1ZH5A 1FYLA 4ESJA 4U0VA 3LAJA 2E1CA 4AIJA 1O3SA 1EH8A 5HLHA 3SHFA 4M74A 3FMQA 3D0SA 4O5VA 1P4AA 2JSCA 2GA2A 3T8TA 2O61A 3FF5A 4QLCU 1D5VA 3MAJA 4HBLA 5L3DA 1XB4A 1DDNA 1WSUA 3L09A 4S05A 3SQNA 1T39A 4JBAA 2LSOA 1D8JA 4U7DA 3PQJA 4I02A 1P4WA 3B02A 4LLGF 3I0TA 3ZMSA 1Q1HA 2MLGA 1U5TB 2HOEA 2HZTA 3HSFA 2UZKA 2DFIA 2ESHA 3KP7A 2FXAA 4ZYEA 1VTNC 1HSJA 2PEXA 2O6GE 5DEQA 1FT9A 3K69A 5ICFA 2H94A 4KFCA 5HDGA 2D1HA 2YR2A 1J9IA 4NHJA 4HF0A 4ON0A 2QUFA 1TNSA 5DV5A 1R1UA 5L3CA 3IRRA 3ELKA 3ERED 2CGPA 2ZBKA 4A6EA 1ZG1A 1OPCA 2HFHA 3QU6A 3G3ZA 2FSWA 2GA1A 4M71A 2OBPA 1W7PB 3KEQA 5BQTA 5D5WB 5LBQA 2JPCA 2HR3A 2W84A 3FHZA 1ZG3A 3F72A 1S6LA 1Z9CA 2XKOA 3RKYA 3FM5A 2YX7A 3KP4A 4XSXF 2EFOA 3EETA 4CICA 4LJZF 5K1YA 1ZG5A 3KE2A 1LDDA 2Z5UA 2D45A 3Q9SA 1PP8F 1YFHA 1S7OA 1KU7A 4Q47A 4B09A 1K79A 2ETHA 5ICEA 3RKWA 5LHGA 5ILUA 4A12A 3H3ZA 1BIAA 1IN4A 2L54A 4G8XA 2K7LA 2IRFG 3WTSC 5FD6A 1IF1A 2F2EA 1XCBA 2O0YA 2ZMEA 5CVJA 2PQ8A 3V8JA 1XSXA 5H20A 2RDPA 3TOBA 4N9IA 3E5XA 3R4KA 1B6AA 3I5UA 2A5YB 3KLNA 3GEZA 3I59A 1GHCA 2VBXA 4WCGA 4A6DA 1QGPA 3JAMK 3SFZA 1HKQA 2G7UA 1E17A 4P55A 3VODA 3ROUA 1T0FA 1JHFA 3T5XA 3WTZA 3M1EA 5K5RA 2HYFA 2K27A 2RGVA 3I53A 1TBXA 5AONA 5D6FA 4ZH4F 2O3FA 2CW0F 2DT5A 1QNTA 4LK1F 2GIVA 2OAZA 5ICCA 2LF7A 4H0EA 4HX8A 5FGMA 1AWCA 5LEJA 1SMYF 5D5VB 4NB5A 3NQOA 2HWVA 2COMA 5LLQA 3T0YA 2LKPA 3P9KA 4WXDA 3HUGA 2DPUA 5F1RA 3V8KA 4CXFA 3CUQB 5F64A 3VB2A 3V7SA 4I0AA 3WTUC 2DPDA 1QZYA 3C3WA 3T1BA 1C0WA 5KVRA 3DQVC 3VOEA 4L9NA 2M8EA 3QPHA 1U2WA 3GWZA 4P5OA 3ZMUA 4RB1A 1XN7A 3W6JB 2Z9OA 3E5QA 1R36A 4MTEA 1YIOA 1E2XA 1QO0D 3ZQ7A 2GXGA 4RAZA 3TDZC 4DQ2A 4ENJA 2DW4A 2VBZA 5L3FA 4HA8A 3RDIA 4LLNA 4ENKA 4IVNA 3WGGA 3L2CA 4GO1A 1LQ1A 2VBYA 2DK8A 6PAXA 5HLGA 1FWZA 3J80Z 1U8RA 2CWEA 1RUNA 4BHCA 5E1WA 3I4PA 1FSEA 3ZN1A 4AIHA 4MEYF 2IVMA 4KDPA 3OV8A 2QM3A 1YW7A 5KK1A 2ESNA 2IA0A 2PG4A 2H6BA 1FP1D 2ZKZA 4UV9A 1FP2A 2A6HF 2F5EA 4KA4A 4LLLA 3GX4X 1L3LA 1FBSA 3ZP5A 1LJ9A 2OZUA 1XGOA 5D8KB 3REOA 3K1NA 2QQ9A 2ADUA 5D6EA 3QAHA 2Q2EA 4ESFA 4EJVA 2EA4A 2IJLA 5DCMA 2RC4A 2QENA 1JHHA 1XD7A 2A69F 2L3DA 2G9WA 4IHSA 2DBBA 3HTSB 5CJ9A 3K1MA 2EFPA 5BPDA 2VN2A 4HQMA 4OMZA 1AOYA 4RGUA 2FU4A 4EM0B 2CO5A 3IWFA 1QPMA 2EV0A 3KP5A 4HAMA 3BZ6A 3O3KA 5H6RA 3VEPA 5DUIA 3LFKA 3WTYC 1DPRA 5HLIA 1BM9A 3GYHX 3HHHA 5D8LB 4UV8A 2NYXA 3F8CA 4FHTA 3HRUA 4BHPA 1K7AA 1QZZA 4LG0A 3N97A 1SAXA 5IT9Z 4Q48A 4ENMA 3R60A 4RB3C 3QP5A 3F22A 2CQKA 5JFRA 3FXQA 3EQLF 3FX3A 2A07F 4L5IA 4P9FA 1TQIA 1O3RA 2HGCA 1GXQA 3BY6A 4ENNA 1UCRA 1PUEE 4N0BA 1I6XA 3E5UA 1ZLKA 3KZYA 4EJOA 3CUOA 2CFXA 1Z6TA 4L5JA 3KP3A 4GYGA 1GVJA 3E6DA 2YPRA 2D1VA 2IA1A 1EH6A 3IHUA 2HTSA 2JPBA 4UUVA 4XBFA 4R8HA 3P9IA 5DDGA 2XAHA 2BYVE 4ZYDA 2QBYA 1EV7A 3GFMA 2EV6A 3MZHA 2O03A 3BWGA 4WXHA 4B8XA 1OMIA 1TW2A 3R6SA 1OYYA 2XIGA 3EYIA 1IN8A 1HKTA 1LB2A 2UXNA 1R58A 2L02A 4G6DA 4A0XA 4EMSA 2NAZA 4RB2C 1O3QA 4OIPF 1IN5A 2XAGA 4AVPA 2J5PA 2HYGD 1BN5A 3ULQB 4HF2A 2XROA 1S3JA 2CSOA 4E70A 2XUBA 1FC3A 1MDMB 4UVCA 4L0YB 2A3SA 5LGNA 5ERIA 2Y75A 2VC0A 2ZMEB 2Y0MA 3RI4A 2EK5A 1UFMA 1Z7UA 1TLHB 5HS8A 1FBUA 3EUHA 4GGGA 3HIFA 5LRRA 1O7LA 3J81Z 2V1DA 1U3EM 1OYWA 1J2XA 5DD4A 3PQKA 5LRSA 1H9GA 4ZZLA 3KETA 3LA2A 1XCVA 4XSZF 3I59B 5D5XB 4U0WA 1MZBA 1I5ZA 1R23A 1A04A 4UNOA 4YIIA 5E8IA 4R79A 3JTHA 1KU9A 3F8BA 1R5HA 2YX4A 2R7FA 4O3MA 2QVOA 3R0JA 2DLLA 3Q5FA 1ZHFA 1ZARA 4CDGA 1REPC 2LDUA 4U0YA 1B9MA 3OOPA 2L4AA 1XGNA 3QP6A 1DUXC 4A0YA 3BJAA 1XSDA 1R1TA 2PJPA 4ZYGA 5L3BA 1SFUA 3TOAA 3HSRA 4M72A 3KLOA 4BAYA 2P7VB 1K6OA 2RNJA 2QLZA 2P5VA 3RIRA 1YTYA 1S8NA 5BPIA 4L9JA 1ZGJA 2R3SA 4CO8A 1TNTA 4MHGA 4LK0F 2KRFA 4JK1X 3KFWX 2E7WA 3E97A 2WWYA 1IAWA 1X3UA 3HRTA 2IPQX 2FNAA 1ZRDA 3IC7A 4DNCA 1F9NA 3CLOA 1L0OC 2AS5F 2ZNZA 2EV5A 1XMAA 3N4MA 4WX9A 2EFNA 3M8EA 2W25A 3E6BA 1SD7A 4QWQA 4KNYA 3E3VA 5EEGA 1LEAA 2VBWA 1DPUA 2BEOA 1B1BA 2K86A 5CLSA 3MZYA 1UHMA 2GWRA 1IXRC 3GW2A 1SFXA 1PP7U 3I64A 1LEBA 4A0ZA 2DO7A 3RPQA 3I54A 3DV8A 1Z91A 1CF7A 1MKMA 4OIRF 3HOTA 2STWA 3BP8A 1USTA 2XAQA 2X4HA 2Z33A 3IRQA 3TO9A 2VOOA 3DPTA 3I58A 5E20A 2H09A 2BGCA 3FMSA 1BIBA 2FE3A 4EGZA 4EJWA 1ZAOA 3KP6A 4I01A 5TRDA 4KIBA 4HF1A 3MQ0A 4YIFA 2VONA 2Y48A 1NHAA 1G6NA 5H6QA 2RV8A 5J8CA 3U9GA 1ZGAA 1SMTA 5FFXA 5DUKA 4GXOA 2W57A 2HS5A 4EV0A 2MH2A 4BQAA 2VT2A 4KMFA 3F8MA 1LVAA 2OQGA 5ICGA 4CZZA 3J80K 1G4DA 2M1BA 5E18F 3SZPA 4LG0B 4PZJA 2HDCA 1KYWA 1GXPA 2VT3A 5J8FA 5ILSA 4G6QA 3IL2A 2BE5F 4M6YA 3GFJA 4RS8A 1HW2A 1B4AA 2XVCA 3IWZA 2FOKA 1WQ2A 1YQAA 1R00A 3U1DA 4ESBA 2H27A 1EH7A 4IF4A 1ULYA 1F5TA 3ZN0A 2EFWA 3U2RA 4HX7A 5FLXZ 3KZZA 2QBYB 1YW8A 4D0PA 3IKTA 3J7AO 1W7PA 3HHGA 4CGZA 1KGSA 2DAOA 3BROA 3JW4A 2CG4A 2HQRA 3F8FA 4HX4A 3HOSA 4L0ZB 2P5KA 2HKXA 3V4GA 3P9CA 4UXNA 5JI6A 3RYPA 2MD5A 4EJTA 3K0LA 2ZNYA 2H6CA 4EQQA 3S2WA 1OR7A 1FNNA 5F6FA 1YYVA 4RGSA 3EYYA 4OIQF 2GXBA 1R5GA 5DCFA 4O6JA 4KN7X 4KMUX 4UHTA 2Q8KA 2QZ8A 1IXSB 1SD6A 4HDVA 3NEUA 1W7PD 2ISZA 3DEUA 5D4RA 1KA8A 1UB9A 4YFKF 3TDUC 4CHUA 4OMYA 4GCVA 1G3SA 3COAC 5EEHA 1Y0UA 5IT9K 2M87A 3V7CA 1R22A 2NS0A 1BI0A 5A2QZ 4I0BA 2LF8A 3D5LA 5HS7A 3TGNA 1T38A 3BDDA 4HV5A 2JZYA 2MLKA 1KQ0A 4RGXA 2W85A 3ABUA 5L3EA 1BC7C 3BJOA 1Z05A 2B0LA 3DXJF 2HTJA 5LHHA 1USSA 4HQEA 4GYIA 4M6XA 2PI0A 2K4JA 3GF2A 2WV0A 2E7XA 3GXOA 1ODDA 3M8FA 2WTEA 3WE3A 3O6BB 2FRHA 4ASNA 1I27A 5JVTA 3ABTA 2FNPA 4MGRA 1HBXG 5K5OA 5AIPA 1YW9A 3RKXA 4IRGA 4MQ9F 1G3WA 2RN7A 5FB2A 2L4MA 2L01A 4XRFA 4HLXA 4UVAA 4OU0A 3JSOA 2EB7A 3CUQA 4HOBA 2MBFA 2AXLA 3KEOA 2P8TA 1BC8C 2DTRA 3VFZA 2PFBA 3ECHA 2GZWA 3GFLA 2QQAA 4ETSA 2YU3A 3HRSA 2WC2A 1J75A 3NRVA 3J81K 3V7RA 2XASA 2XAJA 3WTWC 3GZ6A 5ILVA 3HSEA 4OINF 2F5FA 4EM1A 4BYYA 5ED4A 1B9NA 2F5CA 5FD5A 2O8XA 3LQRA 4BNCA 1KU3A 2M5WA 1YG2A 4PGHA 2XKPA 1TTYA 4BH9A 3CJNA 2W24A 1F1ZA 3FXRA 4R1HA 1H0MA 2M45A 4KUMA 4FX4A 3FMRA 4BHBA 1R7JA 2ELHA 2ZFWA 5E8GA 2JTVA 3CO6C 2XHKA 4KIFA 3FM3A 2XGXA 4Q4ZF 5BMZA 1HXDA 1MJ9A 1OYIA 2X0LA 2OQRA 4YG2F 1IXCA 2A6EF 2QQBA 4U88A 3E6MA 1IUYA 1H9TA 1I1GA 3K1PA 2TDXA 1K78A 4HZFA 1IRGA 1O3TA 5AIQA 2JT1A 1HSTA 2LNBA 1D3YA 2XRNA 1LDKB 3M7GA 4IHTA 2P5LC 1RIOH 2BV6A 1IN7A 4YFNF 5DYMA 1P2FA 4LGWA 2VE8A 1YLFA 3DF8A 2OU2A 4L9TA 2P7CB 2HEOA 4AWXB 4I2OA 1OKRA 4S04A 1F4KA 2FEZA 2ISYA 1STZA 1U5TC 5JR3A 3E6CC 4MEXF 3TKYA 1Z6RA 4Y17A 3FWEA 3BJ6A 3LA3A 3ML6A 1PDNC 5D4SA 1TQMA 1V3FA 5CVRA 4L18B 5E1ZB 4EGYA 4M9SA 4WF2A 3DP7A 4EM2A 5D5UB 1T98A 2C6YA 3RYRA 1ZLJA 2NNNA 2PMHA 3WTTC 1MGTA 1FLIA 4FX0A 4Y13A 5E17F 3SXYA 1W5TA 4IJAA 3K2ZA 4WXCA 2YSRA 4A5MA 4XLPF 4OIOF 4LB6B 2ZJ2A 1YS7A 1DP7P 1ON2A 4I7HA 1IRFA 2A68F 2V1XA 2KKOA 4WK8F 4G9YA 4KN4X 3WE2A 5LEKA 1P92A 1S7AA 1IW7F 4P9UA 5LHIA 5HOOA 1MJBA 4FT8A 1HQCA 2FMLA 5J6XA 3ECOA 2DQRA 2E1NA 1XGSA 3HTUA 3JSPA 4NQWA 4TV7A 2DU9A 4F7ZA 2DI3A 2KIFA 1LDJA 4G94A 3CDHA 2ACJA 1FYKA 2G7HA 5IT3A 1FZPB 2OD5A 1BJAA 2OZ6A 1MJAA 1BBYA 3CTAA 3C1DA 1SD5A 3ZMZA 5HDNA 2FF4A 3F3XA 1MDMA 2HKOA 4I09A 1BI1A 3W6KB 2IT0A 1RZ4A 3WGIA 1XDUA 2K4BA 2K02A 3HRMA 1XGMA 3MFKA 3KCCA 2UWMA 3FXUA 5DD8A 5DCMB 3WU0A 3QU3A 4P96A 5CVIA 2OA4A 5L3GA 2FBIA 1FSHA 2FBKA 1BI2A 1ZN2A 3H3UA 2J5OA 4BXUA 2V9VA 1FBQA 3C18A 4N9HA 4L9VA 4EVIA 2EJRA 1J59A 4HW0A 2NNYA 1W5SA 5E1XA 4ZZDA 4U7BA 2M30A 3QOPA 3CUQC 2VC1A 5FLXK 2ZXJA 1WRJA 1J5YA 3SZTA 3O2PE 3K9TA 3LAPA 1J7KA 1FY7A 2UXXA 4M9ZA 4Z2YA 4KT5C 3KP2A 1RUOA 4G7ZF 4MQVA 4AIKA 1Z1DA 5BS6A 1WKMA 3G73A 1U5TA 5HS9A 3T8RA 1ON1A 1FX7A 4PGGA 3ISPA 1J0RA 3ZMDA 4IPAA 3WTVC 2XV4S 3GO5A 3ZMVA 3CO7C 3FZVA 4PCQA 1YO5C 1V4RA 5CYVA 2P4WA 3JAMZ 1WWXA 2KIMA 5CVUA 2VODA 1ZREA 4IRIA 2NRAC 3RTRA 4M9XA 3AAFA 1HW1A 5BOXA 2Q0OA 3TQNA 1IZ1A 5A2QK 1ZRFA 4LB5A 3QRFF 4HLYA 5CVVA 1HKSA 4G7HF 2FBHA 1P6RA 3MEXA 1W4MA 2V1UA 2MH9A 2Z3YA 3WG9A 1RI7A 1U78A 5TJJA 4HDUA 1BI3A 1R1VA 2IP2A 1FPQA 3Q9VA 4CYDA 4ZYHA 2P6TA 4Q5SF 2V79A 3PFIA 2JRTA 1UHWA 1FOKA 2ZO4A 2PN6A 4KICA 1KQ8A 1K78B 1RNLA 3BPXA 3WU1B 2QWWA 4KIGA 3LQQA 2VE9A 2PBIA 3RJPA 3GFIA 3V8LA 4LMYA 2IA2A 4AD9A 4MTDA 3GZ5A 3ZPLA 3I71A 1I1SA 2FMYA 1B59A 5FO5A 3BPVA 4HYEA 1ZRCA 3TO6A 3H92A 3LWFA 1IN6A 2DQLA 4RAYA 2IW5A 1HW5A 1JXSA 3MWMA 5FFZA 5LGUA 3GUDA 3LSTA 3L7WA 4M73A 1BOAA 1MD0A 2KJBA 1KQ9A 2RKHA 2PMUA 4JQFA 3WODF 2DK5A 3IKVA 1ZYRF 1QBJA
chains in the Genus database with same CATH superfamily
1MNDA 3MMYB 2OF7A 4PSXA 1SVMA 1Z77A 3M4OJ 1O57A 5LFAA 1T6SA 1I6HJ 2LBFA 2A5WA 1P4XA 3R61A 4XLNF 3I9V2 5LGTA 1TQPA 2FQ3A 3QPTA 3GVAA 4Y52J 4E7ZA 5TGTA 4JYKA 2V6EA 1VQ5I 1JGSA 4RM2A 1XMKA 3ZMTA 3DEWA 2STTA 1VQOI 2VXZA 1EA3A 1KYZA 2BBYA 3WGHA 3F6OA 3CP8A 3C2HA 5HDKA 2P6SA 1IV6A 2VJ4A 3R0AA 4BXFA 1WJEA 3TW7A 1ETOA 3DFGA 1O7FA 3FBNB 3MD2A 4NUBA 1JE8A 3WTXC 1FOWA 2JUGA 2WAQN 3L9FA 2ZCWA 2XGCA 3EDPA 3OWTA 3F23A 4DYRA 4N4NB 3P7NA 2V6CA 2D2WA 1ETYA 4A2UA 2EFQA 3OYLA 1LNWA 5HVQC 4Y15A 1QQIA 2CYYA 2VASA 1MMGA 2ELJA 2XAFA 1ONVA 3QPLA 1CGPA 3RPUA 4XK4A 3GTMJ 1MMNA 1XDSA 3HYIA 4G6TB 4PDKA 2HPMA 1X1BA 1N78A 1FTTA 4MNUA 2YS9A 1XX5A 2HQNA 2R7DA 3GLXA 4Y7NJ 4KYWA 4LFUA 2EWNA 2QSGX 1A35A 4A3LJ 3L00A 3DBRB 4K2EA 4OOIA 2D5VA 3K70D 1JGGA 1M1EB 3B73A 4A5NA 1MBHA 1ZQ3P 3M8JA 3F6VA 2ID6A 2MC3A 3DPLC 3LSHA 1I39A 3PO2J 1YIJI 2X51A 2M4KA 2GQQA 4RB0A 2BOLA 4D7NA 4HNUA 1SD4A 4IRHA 2QYOA 1XSVA 1YI2I 2F5DA 1G3TA 3BR1A 2DOAA 3DCFA 2QQ8A 3BOQA 2ZMEC 4DYCA 2KJCA 1G3YA 3BR5A 1TW3A 2EA2A 2FX0A 5JHUA 2FA5A 4YFXF 2RVCA 3RPUD 2RQPA 2MC4A 1D8KA 2IBDA 2ZB9A 1CF7B 2W82A 1U6GA 1KU2A 2PLYA 4G7OF 1RESA 3MCZA 4RGRA 3C7JA 2Z99A 4HNTA 1WFXA 4QPQA 5C3EJ 3F8NA 1PUFB 5F0HA 4UVBA 2N8GA 5B1AH 4QPOA 4EJUA 4HV6A 1G59A 3LA7A 1S29A 1X3WB 2AQEA 2F4IA 2GAUA 4I98B 1P9QC 3DKWA 3VYUB 2KIUA 1ZELA 1WI9A 2MA3A 4WWCA 3ABMH 3DTIA 1FYMA 1SFEA 3SYTA 3F21A 3HOUJ 3VDXA 3M9AA 2WV1A 4LD5A 4A3BJ 3TO7A 4DOZA 1OCRH 4KJZA 1VQMI 3JTGA 1YS6A 4KITB 4IXAA 3OR2C 3BLYA 1T2KA 1ENHA 5K5QA 2VOPA 3OMYA 2A61A 1ZH5A 3GBGA 1YX5A 2V26A 5J1UA 1FYLA 4ESJA 5IY5H 4U0VA 3LAJA 1Z21A 2BY0A 3DTEA 2E1CA 1HC8A 1R9TJ 4AIJA 1O3SA 3S2HJ 1EH8A 3HC7A 1F36A 3F9KA 5HLHA 2DA1A 3MKWB 2XDVA 3SHFA 4M74A 3FMQA 3D0SA 1LE8B 4O5VA 4F3QA 1P4AA 3BTIA 3UKGA 4IHWA 1X1DA 2JSCA 2LYCA 2GA2A 2EQRA 3T8TA 2O61A 3FF5A 3OOUA 3W6VA 4QLCU 1D5VA 1DGWY 3MAJA 2KL4A 4HBLA 3HL2A 4DBRA 2KRHA 5L3DA 1XB4A 1DDNA 1WSUA 3L09A 1X1AA 4S05A 3SQNA 4A93J 4YEJA 2R7TA 1DP3A 4DZPA 1QRYA 4JBAA 1T39A 1VQ9I 3Q0WA 2LSOA 4RM3A 1XS9A 1D8JA 3PQJA 4I02A 4U7DA 5DM7F 1P4WA 2X6YA 3GLLA 1MBGA 3PIPF 3B02A 4LLGF 3I0TA 3ZMSA 1Q1HA 2EPFA 2MLGA 1G8XA 4NC8A 2R7SA 1U5TB 2HOEA 2HZTA 4LG3A 5M5YJ 3HSFA 3P5JA 4JP0A 4PUSA 2UZKA 2DFIA 3H5RA 5M3MJ 4XICA 2ESHA 3KP7A 2FXAA 4ZYEA 1VTNC 1SC7A 1HSJA 2PEXA 2O6GE 2PJRB 5J1RA 4IHVA 5DEQA 1FT9A 3K69A 5ICFA 2H94A 2CW8A 1YITI 5HDGA 4KFCA 5FLMJ 4XQFA 1QVTA 1UG2A 3S3NA 2V4JC 2F6CA 2JA6J 2D1HA 2HVQA 1KZHA 2YR2A 5GAEJ 3S14J 4MIMA 1J9IA 1TWFJ 4HF0A 3GMEA 4ON0A 4NHJA 1NG7A 2QUFA 1TNSA 3GCMA 5DV5A 4CCJA 1R1UA 5L3CA 3IRRA 2VKDA 3ELKA 3PO3J 3ERED 2CGPA 2PX9A 2ZBKA 1EJ9A 4A6EA 1ZG1A 1OPCA 2HFHA 3QU6A 3QYFA 2R7WA 1IUFA 3G3ZA 4AM3A 2FSWA 2GA1A 4M71A 1JKRC 2OBPA 1W7PB 3KEQA 5BQTA 5D5WB 5LBQA 1XG1A 1JT0A 2JPCA 2HR3A 2WAQA 1N77A 1T95A 2W84A 3FHZA 1ZG3A 4OAYA 3BR2A 3F72A 5FKMA 4A3CJ 1S6LA 3K4LA 1Z9CA 4L5EA 4M3EA 2XKOA 4AYBN 3RKYA 3FM5A 4PJJA 3WU2C 2WBMA 2WA0A 2YX7A 3KP4A 2EIKH 3DBLB 4XSXF 2EFOA 3EPZA 3W2WA 1XMXA 1HA8A 3G2BA 3EETA 4CICA 1IJWC 2KT0A 4C2MJ 2XB5A 3FDYA 4LJZF 5K1YA 4D1QA 4D7MA 3W2AA 5B3SH 1ZG5A 4XONA 3KE2A 1LDDA 2Z5UA 2E60A 2D45A 3NWTA 4XKBA 3Q9SA 2VXDA 1VQ6I 1PP8F 5GP9A 1YFHA 1S7OA 1KU7A 4QTRA 4Q47A 1IG7A 4B09A 1K79A 2DCEA 2ETHA 4IOCF 5ICEA 4JOMA 3RKWA 5LHGA 5ILUA 1LFUP 4A12A 1SAUA 2LKSA 3H3ZA 1BIAA 1IN4A 2L54A 4G8XA 2K7LA 4FETA 3JRBA 2IRFG 1EKEA 1VZ0A 5FD6A 4XL9A 3WTSC 4BACA 1IF1A 4RDUA 2DMTA 2F2EA 2YU9J 3DLAA 5K7HA 2LMDA 4C2UA 1XCBA 2O0YA 1IDYA 2CV0A 2ZMEA 5CVJA 3X2QH 4XMYA 3I56I 4BBSJ 2PQ8A 3V8JA 1XSXA 2O8KA 2EZLA 2RDPA 3IUOA 5H20A 5JLXA 1Z3XA 3TOBA 4CSWA 3DLLF 3CC2I 4N9IA 4BXXJ 3GTGJ 4KISA 3E5XA 3R4KA 1IC8A 1B6AA 2XB0X 1POGA 2VIXA 2CS3A 3DU6A 3I5UA 2A5YB 3KLNA 3GTJJ 3CCMI 5JHFA 2BW3A 2DYRH 3GEZA 2E34A 4XOTA 1Y1VJ 2KDZA 1U9OA 3I59A 1GHCA 2W1OA 2VBXA 3BG7A 2MFZA 3H36A 2Y0SA 2LLKA 4WCGA 4A6DA 1QGPA 3JAMK 5J4VA 3SFZA 4G12A 4J19A 1HKQA 2G7UA 3FK6A 3ASOH 1TT0A 1E17A 4P55A 3VODA 4CH7A 1OISA 4RAGA 2JUCA 1X2MA 2CH0A 3ROUA 3RKQA 4F91B 4XM3A 3K70C 5EG0B 4B48A 5IP9J 3A0BC 5HODA 4IZZA 1FMVA 1T0FA 2OV7A 1JHFA 2BY2A 2LC2A 3T5XA 4UB8C 3M1EA 3WTZA 5K5RA 1FJLA 1R6RA 2HYFA 4C3IJ 5EEAA 2R5YB 1OQYA 2K27A 2NVYJ 2RGVA 1BR1A 3I53A 4M3DA 2CUFA 1TBXA 5AONA 3GTPJ 5D6FA 1ETVA 4ZH4F 4I6ZA 2O3FA 5E3MA 2CW0F 2DT5A 4IO9F 1QNTA 1W1WE 4LK1F 2GIVA 4XNFA 3E1SA 2OAZA 5ICCA 2LF7A 4H0EA 4HX8A 1MNEA 3OIQA 5FGMA 4B1RA 1ACIA 4J00A 1AWCA 5LEJA 1SMYF 5KCMA 5D5VB 3NWSA 4NB5A 2R7RA 3NQOA 2HWVA 2COMA 3CCUI 2L9SA 5LLQA 3T0YA 2PMZN 2LKPA 3P9KA 4WXDA 3HUGA 2DPUA 5F1RA 3V8KA 4CXFA 2M7BA 4EEFG 1TWAJ 3CUQB 1WCMJ 2K3PA 3G4SI 2XGDA 3TEDA 1HCRA 5F64A 3VB2A 3V7SA 4I0AA 2E2JJ 3WTUC 1MBFA 2DPDA 1QZYA 3C3WA 3T1BA 1C0WA 5KVRA 3DQVC 3VOEA 1OJLA 4L9NA 4B4CA 2M8EA 1WJ5A 1BL0A 3EUKL 4ZDPA 3ERMA 5CQEA 3S93A 3QPHA 2DYSH 2F4MB 2KIQA 1U2WA 3GWZA 2V9KA 4P5OA 3ZMUA 1XN7A 4RB1A 3W6JB 2Z9OA 3E5QA 1R36A 4NBQA 2ZFUA 4MTEA 1YIOA 3OYMA 1E2XA 2Y9YA 3KX2A 1QO0D 4NC6A 1RRJA 3OL3A 3ZQ7A 4C2TA 2GXGA 4ITVA 4RAZA 1T08B 3TDZC 4DQ2A 4AIDA 3ASNH 4ENJA 1SVLA 2DW4A 4ZTFA 2VBZA 5BNGA 2RAEA 3A02A 3H9JA 4HA8A 5L3FA 5KAIC 4V19K 2L9VA 1WH5A 3DWLE 5EJCA 3RDIA 2QA4I 3BZCA 3DKYA 2DXIA 4LLNA 1S5LC 5F0CA 2R7ZJ 4ENKA 3OYNA 1QZEA 4IVNA 3WGGA 3LSKA 3OYHA 2MGQA 4GO1A 1PJRA 3L2CA 4GDFA 1LQ1A 2KRCA 4C30A 2XF6A 2HYJA 2GIZA 2VBYA 2VI6A 2DK8A 2CUEA 3ABLH 6PAXA 3CQZJ 1FWZA 5HLGA 3PUFA 3J80Z 1R49A 2MG4A 1TT5B 3G6EI 4UUTA 4HG2A 3CDLA 4BJTA 2NVQJ 2LVSA 1U8RA 2CWEA 2ZXIA 1RUNA 4BHCA 5E1WA 3I4PA 1FSEA 3EUHC 2E1OA 3UR3C 3ZN1A 4AIHA 4MEYF 3HKZA 2IVMA 3SEQA 4KDPA 3OV8A 3QYEA 2QM3A 1I3AA 4XKVA 3LSIA 4ZC3A 4CCNA 1YW7A 3CCVI 2VKEA 5KK1A 4AYBA 1VQKI 2ESNA 2IA0A 2LKXA 2LTPA 4ZYAA 2BHZA 2P81A 2PG4A 2H6BA 1FP1D 2WAEA 2ZKZA 4UV9A 1FP2A 2A6HF 1UELB 2F5EA 4DJAA 3KYLA 4LLLA 4KA4A 3GX4X 1W0TA 1L3LA 2QKLB 1FBSA 3AG2H 1MNMC 3ZP5A 1LJ9A 4M3GA 2OZUA 1XGOA 5D8KB 3FXLA 3REOA 2R93J 2CQ7A 2Z16A 2DFHA 2VQCA 3K1NA 1QA6A 2KISA 2QQ9A 1B72A 2ADUA 2E2IJ 4BE1A 5D6EA 4F93B 4E7LA 5F08A 2TRTA 3ZOBA 3QAHA 3HM5A 1U0JA 2DMNA 2Q2EA 3AFHA 4EJVA 4ESFA 2EA4A 1A6QA 2IJLA 5DCMA 5FKNA 2RC4A 2QENA 2ZSHB 4M3FA 4E4HA 1JHHA 1XD7A 1H8AC 2A69F 2WB1N 2ECCA 2BY1A 2L3DA 2G9WA 4IHSA 2HDDA 2DBBA 3HTSB 5CJ9A 1I50J 3S32A 3K1MA 2EFPA 4BQNA 2JWTA 2Y2ZA 2K9NA 2Q1ZB 4BBRJ 4UB6C 5BPDA 2VN2A 4HQMA 3VYRB 2LP0A 4OMZA 1AOYA 4BDYA 4RGUA 5FKKA 2H1LA 2FU4A 4EM0B 1MH4A 2CO5A 3BQZA 3IWFA 2WY7Q 1QPMA 2EV0A 3KP5A 3CJRB 3OYAA 4HAMA 3BZ6A 3O3KA 5H6RA 3VEPA 5DUIA 3PL8A 3LFKA 3WTYC 1DPRA 5HLIA 4IQJA 1BM9A 4RLQA 3FXKA 3GYHX 1DQUA 3HHHA 1JI8A 5D8LB 4UV8A 2NYXA 3F8CA 3LSJA 5EF6A 2E35A 2UUZA 4FHTA 1NK2P 3HRUA 1DGRM 4BHPA 1K7AA 5M5XJ 1DU0A 1QZZA 3K4NA 1ZTRA 2OJED 3K2AA 2WAFA 4LG0A 3N97A 4BDZA 3SDGA 1SAXA 1JUPA 3SZGA 2XPVA 3NARA 5IT9Z 4Q48A 3PNYA 4ENMA 1OCCH 2L2OA 1FIAA 2E1MC 3R60A 4RB3C 5E3NA 3QP5A 5CQGA 3F22A 2R0QC 3AG1H 2CQKA 5JFRA 3FXQA 1T56A 3EQLF 3FX3A 2A07F 4L5IA 1ZK8A 4P9FA 1TQIA 2L7ZA 2VQLA 1Z3YA 1O3RA 2HGCA 2O7OA 1GXQA 3BY6A 4ENNA 1UCRA 2A6TA 4XLFA 1PUEE 2LY2A 4N0BA 1FOYA 2PMZA 1I6XA 3E5UA 2VKHA 1ZLKA 3KZYA 4EJOA 1QHHD 3CUOA 2DJIA 2CFXA 4HSRA 2M7AA 2GM4A 3DKXA 1Z6TA 4L5JA 3KP3A 4GYGA 1GVJA 3E6DA 1ITYA 2DA5A 2YPRA 2D1VA 2IA1A 3NAUA 2IGMA 9ANTA 1E0EA 2X6OA 4XRMA 3H5AA 1EH6A 3IHUA 1SFOJ 2HTSA 2JPBA 4UUVA 4XBFA 4R8HA 2XRLA 3P9IA 5DDGA 2XAHA 2BYVE 4ZYDA 4NQWB 1EV7A 2QBYA 3GFMA 3E7LA 2EV6A 1GV2A 3BG6A 2KDOA 2G0EA 3OYJA 1JTXA 2DFFA 3MZHA 3ZQGA 2O03A 1UHSA 3BWGA 3OYFA 4WXHA 4B8XA 1OMIA 1TW2A 2DFEA 4DW6A 2VLAA 3R6SA 1OYYA 3H0DA 2XIGA 3EYIA 1IN8A 5EYRA 1HKTA 3G1LA 2LK2A 4JX4A 1LB2A 2UXNA 5IOZA 4A69C 1R58A 2L02A 4G6DA 4A0XA 4EMSA 2HQ5A 2NAZA 4RB2C 1O3QA 4OIPF 1IN5A 2GLOA 4II3A 2XAGA 4AVPA 4GFBA 2J5PA 2HYGD 3VWBA 1BN5A 3ULQB 3IH4A 4NNJA 4HF2A 4FASD 2XROA 1A5JA 1GVDA 1S3JA 2CSOA 4V2GA 1VF9A 2EZIA 4E70A 2XUBA 4F52A 1FC3A 3HZJA 1MDMB 5C4JJ 2Y0SN 4UVCA 1K4TA 4L0YB 2A3SA 5LGNA 5ERIA 1BA5A 2Y75A 2BVLA 1XTAA 3AG4H 3I3LA 2VC0A 2ZMEB 3CF5F 2I10A 2Y0MA 4Y3OA 3RI4A 2EK5A 1UFMA 2GOMA 1BW6A 2K9SA 4QIWN 1Z7UA 3GTKJ 1TLHB 5HS8A 1FBUA 1T0FC 3HOXJ 2ZJRF 3EUHA 2DOEA 4GGGA 3HIFA 5LRRA 1O7LA 3J81Z 3M1CA 3ZGKA 2V1DA 1U3EM 1OYWA 1WJAA 2FD5A 2K9MA 3W2VA 3TW6A 1J2XA 5DD4A 2BW3B 3PQKA 5LRSA 1H9GA 1NH3A 4ZZLA 3KETA 3LA2A 4Y33A 1XCVA 2F5VA 4X0GA 5KNLA 4IKFA 4C3HJ 4XSZF 2VJJA 2Y31A 3I59B 5D5XB 3S8PA 4U0WA 1MZBA 1TZLA 5HLTA 1I5ZA 1R23A 5EGOB 3OSGA 1IV8A 1WJDA 1A04A 4UNOA 3A4CA 4NDLA 4YIIA 2ELKA 1S9HA 5E8IA 4R79A 3OS2A 3JTHA 1I3QJ 1KU9A 3F8BA 1R5HA 4RAFA 2LY9A 2Y69H 5M3FJ 3ZR8X 1LPQA 2YX4A 2R7FA 4O3MA 2QVOA 3GTQJ 3R0JA 1JJ6C 5FKLA 1OFCX 4DIQA 2DLLA 3K4CA 1WI3A 3Q5FA 2K40A 1ZHFA 5HNHA 1ZARA 3CC4I 2KP6A 4CDGA 1REPC 5HNFA 1WJCA 1NK3P 2LDUA 4U0YA 1B9MA 2AXTC 3O8HA 3OOPA 2L4AA 4BQQA 3JRGA 3DPUA 1XGNA 3QP6A 1DUXC 4A0YA 3HOWJ 3KYCB 3DTKA 3BJAA 1XSDA 1VQ8I 1R1TA 1N25A 3H0GJ 5F0FA 2PJPA 2E19A 2WB1A 4ZYGA 5L3BA 1SFUA 1O4XA 1QU3A 4CYCB 2BXZA 4I76A 1IRZA 3TOAA 3HSRA 4M72A 5GPAA 2IAIA 3KLOA 4BAYA 2P7VB 1K6OA 2O9LA 2RNJA 3WHBA 3RQ4A 4BGDA 1WZ2A 1D1CA 3BG9A 2QLZA 2P5VA 3RIRA 1YTYA 5K7ZA 1MMAA 1S8NA 5BPIA 2M0CA 5IOYA 4A3DJ 4L9JA 1ZR2A 1ZGJA 2R3SA 4CO8A 1TNTA 4MHGA 3HDDA 4LK0F 4CZCA 4H4KC 3HPHA 3UNGC 1S7EA 2COBA 2VKVA 3RSNA 2KRFA 2JK3A 1LFPA 4JK1X 3BZKA 1W5CC 1WPKA 2E7WA 3KFWX 3HEFA 3K4BA 5FRNA 2NVXJ 3E97A 2H8WA 2WWYA 5E79C 1IAWA 1X3UA 3HRTA 2FUG2 2IPQX 2FNAA 1ZRDA 3IC7A 5E3LA 2QCOA 5F04A 2ID3A 4DNCA 1X3ZB 1F9NA 3MKLA 3PSIA 4U87A 3CLOA 1L0OC 2AS5F 3HKZN 2ZNZA 1Y8QB 2EV5A 2TCTA 1XMAA 3L2VA 1WGXA 1FEXA 1Z0XA 4BL0B 3IP4B 3N4MA 1V54H 3ZQIA 4WX9A 2EFNA 1D1AA 3M8EA 2A05A 4JX6A 2W25A 4XN3A 3CMMA 2EILH 3E6BA 1SD7A 4QWQA 2KHMA 2XPWA 3BC8A 3TMOA 3ZQQA 4KNYA 3E3VA 2H1KA 3G71I 3AKZA 5EEGA 2R5ZA 3CC7I 3BTJA 1LEAA 2L7FP 2VBWA 1DPUA 2BEOA 1B1BA 2K86A 3KZIC 2CRGA 5CLSA 3MZYA 1UHMA 3OS0A 2GWRA 2EIMH 3LOCA 3HOZJ 3JRFA 1IXRC 3GW2A 1SFXA 2ME0A 2XSJC 1MBEA 3I64A 1PP7U 1LEBA 4BY1J 1TWCJ 3BR3A 1LFBA 4A0ZA 2BZTA 2DO7A 3RPQA 5GTHC 3I54A 3DV8A 5H2FC 1Z91A 1AKHB 1CF7A 1MKMA 1RKTA 2EBIA 3OYCA 2HNHA 3QYBA 3WG7H 4OIRF 3HOTA 2STWA 1PUFA 3BP8A 1USTA 1YJWI 2XAQA 1UJ8A 3CESA 3KIOA 2X4HA 3S3OA 2Z33A 3IRQA 2K3FA 3TO9A 2VOOA 4PFOA 2W7NA 3DPTA 1B72B 4CCLA 3ZCOA 3I58A 5E20A 2H09A 2BGCA 3FMSA 1BIBA 2FE3A 3QQAA 4EGZA 4EJWA 4QSHA 1ZAOA 3KP6A 1B8IA 4A3MJ 3JRIA 1U8BA 4I01A 5TRDA 1YJ9I 4KIBA 4HF1A 2Q2EB 1JUSA 1BW5A 4E7HA 1SVOA 3MQ0A 4YIFA 4Z6YA 2VONA 1HOMA 2M8GX 2W48A 2Y48A 1MMSA 2EH3A 1NHAA 3BG5A 2R7QA 3OL4A 1G6NA 5H6QA 1VQLI 2RV8A 3OYEA 1VI0A 2CJJA 5J8CA 3U9GA 4PJNA 1WH7A 3HJEA 1ZGAA 1OLTA 1VNDA 4BKXA 1SMTA 2CUZA 5FFXA 5DUKA 3OY9A 3OSFA 2DA2A 4GXOA 4BS9A 2JVHA 2CQQA 4CUGA 4IOAF 2IS1A 4BEHB 2W57A 1LE8A 2HS5A 1AA7A 4EV0A 1BOBA 3L1PA 2LBFB 1YOVB 4CCOA 3VSKA 1HDDC 2KMUA 4A3FJ 2MH2A 3OYKA 2DA6A 2DA4A 2VT2A 4BQAA 4KMFA 3F8MA 1LVAA 2OQGA 4YIRX 2IXSA 5ICGA 1X19A 2CFOA 4CZZA 2ZSIB 4UUSA 3J80K 1G4DA 2M1BA 5E18F 3SZPA 1ZR4A 3JRDA 3J7AY 3CCEI 3VYTB 4LG0B 4PZJA 3HG9A 2HDCA 1KYWA 4IL6C 2JA5J 1GXPA 3MKYB 2VT3A 3FKJA 5J8FA 3S15J 5ILSA 2ECBA 4G6QA 3SJMA 4IX7A 3IL2A 2OCCH 2BE5F 4HEA2 4M6YA 3GFJA 4RS8A 2ZXWH 4YELA 1HW2A 1B4AA 2XVCA 3CZ6A 3IWZA 2FOKA 5FLVA 1WQ2A 3S1NJ 1YQAA 2R7VA 1R00A 3SEZA 3CJQB 3S2DJ 4M6VA 4J01A 2XF5A 1RETA 3U1DA 2V9PA 4ESBA 2KQRA 3KPHA 2IS2A 2H27A 3FXMA 3I4MJ 3CP2A 1RR7A 2X1EA 1EH7A 1MBKA 4IF4A 1ULYA 2CV1A 1F5TA 3MKZA 3BT9A 5C4XJ 3ZN0A 2EFWA 1RC9A 3U2RA 4XIDA 1D0YA 4HX7A 3OYGA 5FLXZ 3KZZA 4II2A 2QBYB 2IS4A 1YW8A 4D0PA 2DMPA 3IKTA 3J7AO 1W7PA 4MLOA 3IH2A 2HOAA 4RMNA 5GAHJ 3HHGA 3HGYA 1X4PA 4CGZA 1D1BA 1KGSA 2DAOA 3PNVA 1RPWA 1MMDA 5K7FA 3BROA 2R7XA 1IRXA 3JW4A 2CG4A 2W4SA 2HZDA 4M3BA 4PJLA 2HXIA 2HQRA 2BVMA 4D5CA 4MFEA 2LOOA 3F8FA 1SEUA 4HX4A 1Y8RB 2B7EA 4RA2A 3HOSA 4L0ZB 2P5KA 2HKXA 1R4NB 3H9QA 4A3EJ 3V4GA 3P9CA 4X6AJ 2OC6A 4UXNA 4E7KA 5JI6A 3RYPA 1ETKA 2HXOA 3HXLA 2MD5A 4EJTA 2DA3A 4EATA 3HOVJ 3K0LA 2ZNYA 1HLVA 2H6CA 2L7MP 4EQQA 3CLQA 2HPIA 3S2WA 1OR7A 1FNNA 2CW7A 5F6FA 1OCOH 1YYVA 3K6GA 3Q3SA 4RGSA 3CCSI 1W36D 3EYYA 5E3OA 2KZVA 4OIQF 2GXBA 4D5FA 2CV2A 3CMEI 1R5GA 3H35A 4O6JA 4KN7X 5DCFA 5JVGF 1MSFC 4KMUX 4UHTA 3S1MJ 2CUJA 2Q8KA 2X1CA 2QZ8A 1IXSB 1SD6A 1ETQA 4HDVA 3NEUA 1W7PD 2ISZA 2HU9A 3A03A 2XAUA 3DEUA 4IEJA 4C3JJ 5D4RA 1KA8A 1UB9A 4YFKF 3TDUC 2HDWA 1F43A 3QOEA 5TISC 4DYQA 4FE4A 4GCVA 4CHUA 1G3SA 3FBIB 3COAC 4OMYA 2E36A 2KLOA 5EEHA 1Y0UA 4B47A 5IT9K 2WY8Q 2M87A 2KZGA 3V7CA 1R22A 3U1KA 2NS0A 2Y9ZA 1BI0A 1S72I 5A2QZ 4I0BA 2LF8A 1H88C 3D5LA 1D0ZA 3W3CA 5HS7A 3TGNA 1QHGA 3BDDA 1T38A 1VQPI 4XN0A 4HNVA 2HI3A 3KEYA 1LVKA 3AL0C 4HV5A 4E7IA 2JZYA 2MLKA 3CCYA 2QGUA 2LD5A 1JKOC 1KQ0A 1Y0NA 2JSPA 5DTDA 3PIOF 1X1CA 2MSYA 2MYSA 4RGXA 2KFDA 2RREA 2W85A 3ABUA 3B6AA 5L3EA 3I4NJ 1BC7C 3BJOA 1Z05A 2X1DA 2B0LA 3DXJF 2HTJA 5LHHA 1USSA 2R7OA 1IDZA 4HQEA 3BR0A 3OR1C 4LIVA 4GYIA 3ZQHA 4M6XA 3RZDJ 2PI0A 2K4JA 3GF2A 1WJBA 2WV0A 2E7XA 2MD0A 3VYSB 3GXOA 1VQ4I 1YRNA 2K85A 1ODDA 1Q1VA 3TBIA 4DBQA 2OTLI 1YJNI 3D1NI 3M8FA 2WTEA 3WE3A 4LOCA 3O6BB 2FRHA 2M2EA 2O5RA 4HPQA 4ASNA 1I27A 3CD6I 4XOPA 3ABTA 4AUXA 5JVTA 3L2RA 3CDIA 1BJZA 2FNPA 3JRAA 2ZJQF 4MGRA 2VUMJ 3LNQA 1HBXG 5K5OA 5AIPA 3PJRA 3CCRI 1YW9A 3RKXA 4IRGA 2DMQA 3L2UA 4MQ9F 1ETXA 1UZCA 2DDBA 1G3WA 2RN7A 2HVSA 4V2FA 1W0UA 4AVZA 1H89C 5FB2A 2L4MA 3M07A 2L01A 4XRFA 4HLXA 4UVAA 4OU0A 3JSOA 2EB7A 2JA7J 2XPUA 3AG3H 3CUQA 3K10A 3DU5A 4HOBA 1Z7LA 2MBFA 3A01A 5FKOA 2AXLA 3KEOA 2P8TA 1VFCA 1P7IA 1BC8C 2DTRA 1E3PA 3VFZA 2PFBA 4IQ4A 3H1CA 3ECHA 2GZWA 3GFLA 2QQAA 2E2HJ 2QSHX 4ETSA 2YU3A 3HRSA 1QVUA 1MW7A 2WC2A 5B5EC 4F92B 3IAM2 1J75A 3NRVA 3G1OA 3J81K 3V7RA 2XASA 1AHDP 2V1NA 2XAJA 3WTWC 4BU2A 1TL8A 1FMWA 2E1MB 1K83J 2LR8A 3GZ6A 3CCLI 1TWHJ 4UY8I 4F55A 5ILVA 3HSEA 5J3LA 2F5FA 4OINF 3ZXSA 4EM1A 4ANJA 4BYYA 2R7UA 4XLHA 1GLNA 4PK4A 5ED4A 1B9NA 2F5CA 5FD5A 2O8XA 1JKQC 3DEEA 3LQRA 4BNCA 1KU3A 2M5WA 1YG2A 2M34A 2R5ZB 4PGHA 3EUAA 5IYCJ 2XKPA 1ETWA 4A3JJ 5KHDA 3OYIA 3JCUC 1TTYA 4BH9A 3CJNA 3BQYA 2W24A 1F1ZA 3FXRA 4R1HA 5DM6F 4FTHA 4C9YA 1H0MA 2M45A 4KUMA 1A31A 4FX4A 3FMRA 3PUBA 1R7JA 2DN0A 4BHBA 1XC5A 3OIOA 5DS9A 2ELHA 2ZFWA 1UG0A 1WJFA 5J4YA 2RQQA 2AO9A 3G1MA 5E8GA 2F4OB 2JTVA 3CO6C 2XHKA 4KIFA 3FM3A 2XGXA 5F1JA 1Y56A 1X1PA 4Q4ZF 5BMZA 1HDPA 1IO2A 5J40A 4B44A 1HXDA 1ORKA 3QODA 2CQNA 1RR8C 1MJ9A 1OYIA 5CKTA 2VL8A 2LY1A 2X0LA 1BR2A 2OQRA 4BY7J 2HOTA 4YG2F 1IXCA 2A6EF 2QQBA 4U88A 1MBJA 3E6MA 3IH3A 4S0HB 1IUYA 2JMWA 1H9TA 3CMYA 1I1GA 3K1PA 2TDXA 3ZRGA 2CQXA 4E6KG 1K78A 4HZFA 3GTOJ 1IRGA 1B8IB 3JREA 4RLFA 2OPTA 2VQGA 1O3TA 3PFYA 3JRHA 3GZNB 2M4GA 5AIQA 2JT1A 3FIWA 1HSTA 4HRIA 2JA2A 2LNBA 1D3YA 2XRNA 1LDKB 3M7GA 1ZKGA 4IHTA 1E3HA 2P5LC 1RIOH 2BV6A 1IN7A 1GT0C 2NVTJ 4YFNF 3LL7A 4XKWA 5DYMA 1P2FA 2YUSA 4LGWA 1RKWA 3FK7A 1UMQA 2VE8A 2X6WA 3JRCA 1E3OC 1YLFA 3DF8A 2OU2A 4L9TA 2P7CB 4A3IJ 2HEOA 3N05A 4AWXB 4I2OA 1OKRA 3HOYJ 2VJ5A 4S04A 4B43A 2X6XA 3OS1A 3ZQFA 2FEZA 1F4KA 2ISYA 3JR9A 3PNTA 1STZA 1U5TC 4Y4RA 4BQOA 1MH3A 5JR3A 3J7ZI 3PM1A 3E6CC 4LITA 4MEXF 1FTZA 3TKYA 2L0KA 1Z6RA 2JN6A 4ZDLA 3U21A 4Y17A 3FWEA 3BJ6A 1DU6A 4NC7A 4CCKA 4IHXA 3LA3A 3ML6A 2Z1DA 2X85A 3OIPA 1PDNC 1V5EA 3FKIJ 2JRMA 5D4SA 1TQMA 5J47A 1V3FA 3SDBA 3HUGB 1HF0A 4UUSB 5CVRA 4L18B 5E1ZB 4CCMA 4EGYA 4M9SA 2VJIA 4WF2A 4ZDOA 3DP7A 4EM2A 5D5UB 1VQ7I 1T98A 2C6YA 3RYRA 1ZLJA 1W36C 2NNNA 2PMHA 1FOXA 2FQ4A 3WTTC 1GDTA 3D5SC 1MGTA 5IPAA 4BUPA 2L9NA 4ZTJA 1FLIA 2BY3A 2FOWA 4FX0A 2DJNA 2M3AA 5B1BH 5GAGJ 4Y13A 5E17F 4XLCA 3SXYA 4YRVA 3H9GA 3S1QJ 4B3AA 4FE7A 1W5TA 4IJAA 4E7SA 4N4OB 2VPLA 4OAZA 3K2ZA 4WXCA 3LFUA 2JJ7A 2YSRA 3VSLA 4A5MA 1PYVA 4XLPF 4OIOF 4LB6B 2ZJ2A 2R4GA 1YS7A 1DP7P 1ON2A 4I7HA 1IRFA 2A68F 5FRMA 2V1XA 2KKOA 1X2NA 4DZJA 4WK8F 2Z2SB 3I55I 5IYDJ 4G9YA 3L2WA 2ZJPF 4KN4X 5IP7J 3WE2A 5LEKA 2NVUB 1X58A 1BR4A 3TP3A 4JX5A 4D9JA 1OR7C 1P92A 1S7AA 2LRDA 1IW7F 4P9UA 5LHIA 5HOOA 1J09A 1MJBA 2QKMB 3DBHB 1Y6IA 3QWLA 2JA8J 2I5UA 2Y30A 4FT8A 1HQCA 2FMLA 5J6XA 2R92J 3B6CA 3ECOA 2K9LA 4P1WA 3IV5A 2DQRA 2E1NA 1XGSA 4XLAA 3D5RC 3HTUA 3JSPA 2X9DA 2EZHA 2VPRA 3C2BA 1P7JA 4HSTA 4NQWA 2IGKA 4TV7A 1N75A 1JKPC 2EZKA 2DU9A 4F7ZA 2FJ1A 2NOJB 2DI3A 1G2HA 4XLEA 1SFKA 2V7FA 4XORA 2MW8A 3E0JB 5F27A 2KIFA 3ZQCA 3H3VK 1LDJA 4G94A 3CDHA 2ACJA 1FYKA 2G7HA 5IT3A 1FZPB 3BR6A 2OD5A 2K5CA 1BJAA 2DT7B 5J1YA 1MSEC 1U9NA 1AU7A 2OZ6A 1MJAA 1D5YA 2XC7A 1BBYA 1Y39A 3CTAA 3C1DA 3PSFA 5EDNA 1SD5A 3ABKH 3ZMZA 2BXYA 2HQAA 4BE0A 5HDNA 2LFBA 2FF4A 3F3XA 1MDMA 2B63J 3A2KA 2HKOA 1K6YA 4I09A 1BI1A 1XPXA 3W6KB 3L2QA 2IT0A 2NOGA 1RZ4A 3WGIA 1XDUA 5FROA 2K4BA 3J7YJ 5M5WJ 1KONA 4RBOA 2K02A 2LH9A 4DGWB 3F0CA 3MZ8A 4FISA 3FHNA 3HRMA 4PJ0C 3M3YJ 1XGMA 1WHUA 1YX3A 3MFKA 3KCCA 2GOXB 2UWMA 3V42A 3FXUA 5DD8A 5DCMB 3WU0A 5EZHA 5JLWA 1A6IA 3HGGA 3QU3A 2QSFX 4P96A 5LD2C 3ZQLA 2XSDC 5CVIA 2OA4A 5L3GA 2DMUA 1R4MB 2FBIA 1FSHA 2FBKA 1BI2A 1ZN2A 3H3UA 2E5NA 2J5OA 4PSWA 2HOSA 2KPMA 1EF4A 1VQNI 4BXUA 3OYBA 2L5QA 3WHCA 2V9VA 3HB9A 2M9HA 1FBQA 5EGOA 1TC3C 2HVRA 3C18A 5GTIC 3LSRA 1UAAA 4N9HA 4L9VA 2UV1A 4AU7A 4EVIA 2BHYA 3HPGA 2ZXHA 2EJRA 1J59A 1JUMA 4HW0A 2IGNA 2EIJH 2NNYA 1W5SA 3HBLA 2VB6A 1GV5A 5E1XA 4ABZA 3KYDB 2XGEA 4ZZDA 4U7BA 3S17J 2M30A 3QOPA 3CUQC 4BJ5C 2VC1A 1YRNB 5FLXK 1R5ID 2ZXJA 3ESWB 2DDAA 1WRJA 4IHYA 1J5YA 3SZTA 3O2PE 3K9TA 3LAPA 4B3XA 1J7KA 2DA7A 1FY7A 2UXXA 3Q0UA 4M9ZA 3RQIA 2JQ7A 4Z2YA 4KT5C 4MO7A 3KP2A 3K4JA 1TP4A 2EINH 2JVGA 5IYBJ 1RUOA 4G7ZF 4MQVA 4AIKA 2QF7A 3QPSA 1Z1DA 4I99C 5BS6A 1WKMA 1TWGJ 4CYCA 3FISA 3G73A 5CPRB 1U5TA 5HS9A 3T8RA 1ON1A 1FX7A 2DTZA 1OCPA 4PGGA 1JT6A 2OTJI 3ISPA 1J0RA 3ZMDA 1SANA 3SFIA 4IPAA 3WTVC 4W97A 2L9RA 4BE2A 2XV4S 2E5ZA 1V5GA 2PJRA 5FJ8J 3GO5A 3ZMVA 3CO7C 3FZVA 2IGOA 4PCQA 3A01B 1ZGWA 1YO5C 1V4RA 5CYVA 2P4WA 3JAMZ 1WWXA 2KIMA 2MABA 5CVUA 2VODA 2E71A 1ZREA 4FQGA 1WVRA 4IRIA 1T33A 2GXAA 2W00A 3TP0A 2NRAC 3K4KA 4A3KJ 3RTRA 4M9XA 4XKCA 3AAFA 1HW1A 5BOXA 2Q0OA 3TQNA 2GBYA 1IZ1A 4X1EA 1OCZH 3CCQI 3BCBA 1LKXA 4ZJZA 5A2QK 1ZRFA 4LB5A 1OCTC 4A3GJ 4FCYA 2I8DA 4PFPA 3QRFF 1IGNA 4XRSA 1A36A 2CMPA 4HLYA 5IP6A 2CU7A 2QEXI 3C2GA 5GPCA 3RCOA 4XRSG 5CVVA 3OYDA 3S1RJ 1HKSA 4G7HF 2FBHA 1P6RA 4AC0A 3MEXA 3MN2A 1YHQI 1W4MA 2V1UA 2F48A 3LSMA 3LSPA 2X48A 2NXNB 2MH9A 3ONQA 3BCAA 2Z3YA 3WG9A 1RI7A 2ZC2A 1U78A 4GRIA 5TJJA 2ME6A 4HDUA 4OWRB 1YE9A 1BI3A 1R1VA 2IP2A 1FPQA 1V5FA 3A1YA 3BTCA 2LREA 1T8IA 4XR6A 1V55H 1PVEA 1ERDA 2IS6A 3Q9VA 4CYDA 1JJ8C 4ZYHA 2P6TA 3VPRA 4Q5SF 2V79A 2OUMA 2VQHA 4KT6A 3PFIA 2JRTA 1UHWA 3H5NA 1FOKA 1AKHA 3K4MA 2ZO4A 1R71A 5GADJ 3FXOA 3IAS2 2PN6A 4KICA 3S16J 1KQ8A 4E7JA 3S3MA 1K78B 1RNLA 3BPXA 3WU1B 1X4OA 2QWWA 3BTLA 2AQFA 4KIGA 5KAFC 3BG3A 3LQQA 1APLC 2VE9A 1Z67A 2PBIA 3RJPA 3V8LA 3GFIA 4LMYA 4MFDA 2ICWG 2IA2A 2B9SA 3MVPA 2NS7A 4AD9A 4MTDA 2DT6A 2DOFA 2L7KA 2LG4A 3Q0VA 4PJMA 3GTLJ 2OCEA 2XF7A 5B66C 3GZ5A 3ZPLA 3I71A 1I1SA 2FMYA 2AHQA 1B59A 5FO5A 4BJ6C 1LUJB 4LIUA 1D0XA 3BPVA 4HYEA 4CA0A 3CCJI 1K61A 1ZRCA 3A0HC 3TO6A 3H92A 3TL4X 3CMAI 1GUUA 3LWFA 3O8GA 2M0MA 1IN6A 2DQLA 1CQTA 1NTCA 2DODA 3LMMA 4RAYA 1NG6A 2IW5A 1HW5A 5C44J 1JXSA 3LSGA 3MWMA 5FFZA 1QPIA 5LGUA 2IEKA 3K7AJ 3CF2A 2WADA 4W1UA 5EG0A 2P0WA 3GUDA 3LSTA 1K4SA 1JTYA 3L7WA 4M73A 2RNGA 2H8RA 1BOAA 1MD0A 2KJBA 1KQ9A 2R5YA 2RKHA 2PMUA 4JQFA 3RZOJ 1MIJA 3WODF 2K9QA 2DK5A 3CJTB 3IKVA 3AL0B 1ZYRF 3FXJA 4BEHA 5EZGA 1Y1WJ 1QBJA 2NS8A 1FIPA
chains in the Genus database with same CATH topology
1O57A 1T6SA 1P4XA 3R61A 4XLNF 5LGTA 1TQPA 2FQ3A 3QPTA 3GVAA 1JGSA 1XMKA 3ZMTA 2STTA 2VXZA 1KYZA 2BBYA 3WGHA 3F6OA 5HDKA 2P6SA 3R0AA 3DFGA 1O7FA 1JE8A 3WTXC 3L9FA 2ZCWA 3EDPA 3F23A 3P7NA 2V6CA 2D2WA 4A2UA 2EFQA 1LNWA 5HVQC 4Y15A 1QQIA 2CYYA 2XAFA 1ONVA 1CGPA 3RPUA 1XDSA 3HYIA 4PDKA 4MNUA 2HQNA 2R7DA 3GLXA 4KYWA 4LFUA 2EWNA 3L00A 4K2EA 4OOIA 3B73A 4A5NA 3F6VA 2MC3A 3DPLC 2GQQA 4RB0A 1SD4A 4IRHA 2QYOA 1XSVA 2F5DA 1G3TA 3BOQA 2KJCA 1G3YA 1TW3A 2EA2A 5JHUA 2FA5A 4YFXF 2RVCA 2RQPA 1D8KA 1CF7B 1U6GA 1KU2A 2PLYA 4G7OF 3MCZA 4RGRA 3C7JA 2Z99A 3F8NA 4UVBA 4EJUA 4HV6A 3LA7A 1S29A 2GAUA 4I98B 3DKWA 2KIUA 1WI9A 2MA3A 4WWCA 1FYMA 1SFEA 3F21A 3M9AA 4LD5A 3TO7A 3JTGA 1YS6A 4IXAA 1T2KA 5K5QA 2VOPA 2A61A 1ZH5A 1FYLA 4ESJA 4U0VA 3LAJA 2E1CA 4AIJA 1O3SA 1EH8A 5HLHA 3SHFA 4M74A 3FMQA 3D0SA 4O5VA 1P4AA 2JSCA 2GA2A 3T8TA 2O61A 3FF5A 4QLCU 1D5VA 3MAJA 4HBLA 5L3DA 1XB4A 1DDNA 1WSUA 3L09A 4S05A 3SQNA 1T39A 4JBAA 2LSOA 1D8JA 4U7DA 3PQJA 4I02A 1P4WA 3B02A 4LLGF 3I0TA 3ZMSA 1Q1HA 2MLGA 1U5TB 2HOEA 2HZTA 3HSFA 2UZKA 2DFIA 2ESHA 3KP7A 2FXAA 4ZYEA 1VTNC 1HSJA 2PEXA 2O6GE 5DEQA 1FT9A 3K69A 5ICFA 2H94A 4KFCA 5HDGA 2D1HA 2YR2A 1J9IA 4NHJA 4HF0A 4ON0A 2QUFA 1TNSA 5DV5A 1R1UA 5L3CA 3IRRA 3ELKA 3ERED 2CGPA 2ZBKA 4A6EA 1ZG1A 1OPCA 2HFHA 3QU6A 3G3ZA 2FSWA 2GA1A 4M71A 2OBPA 1W7PB 3KEQA 5BQTA 5D5WB 5LBQA 2JPCA 2HR3A 2W84A 3FHZA 1ZG3A 3F72A 1S6LA 1Z9CA 2XKOA 3RKYA 3FM5A 2YX7A 3KP4A 4XSXF 2EFOA 3EETA 4CICA 4LJZF 5K1YA 1ZG5A 3KE2A 1LDDA 2Z5UA 2D45A 3Q9SA 1PP8F 1YFHA 1S7OA 1KU7A 4Q47A 4B09A 1K79A 2ETHA 5ICEA 3RKWA 5LHGA 5ILUA 4A12A 3H3ZA 1BIAA 1IN4A 2L54A 4G8XA 2K7LA 2IRFG 3WTSC 5FD6A 1IF1A 2F2EA 1XCBA 2O0YA 2ZMEA 5CVJA 2PQ8A 3V8JA 1XSXA 5H20A 2RDPA 3TOBA 4N9IA 3E5XA 3R4KA 1B6AA 3I5UA 2A5YB 3KLNA 3GEZA 3I59A 1GHCA 2VBXA 4WCGA 4A6DA 1QGPA 3JAMK 3SFZA 1HKQA 2G7UA 1E17A 4P55A 3VODA 3ROUA 1T0FA 1JHFA 3T5XA 3WTZA 3M1EA 5K5RA 2HYFA 2K27A 2RGVA 3I53A 1TBXA 5AONA 5D6FA 4ZH4F 2O3FA 2CW0F 2DT5A 1QNTA 4LK1F 2GIVA 2OAZA 5ICCA 2LF7A 4H0EA 4HX8A 5FGMA 1AWCA 5LEJA 1SMYF 5D5VB 4NB5A 3NQOA 2HWVA 2COMA 5LLQA 3T0YA 2LKPA 3P9KA 4WXDA 3HUGA 2DPUA 5F1RA 3V8KA 4CXFA 3CUQB 5F64A 3VB2A 3V7SA 4I0AA 3WTUC 2DPDA 1QZYA 3C3WA 3T1BA 1C0WA 5KVRA 3DQVC 3VOEA 4L9NA 2M8EA 3QPHA 1U2WA 3GWZA 4P5OA 3ZMUA 4RB1A 1XN7A 3W6JB 2Z9OA 3E5QA 1R36A 4MTEA 1YIOA 1E2XA 1QO0D 3ZQ7A 2GXGA 4RAZA 3TDZC 4DQ2A 4ENJA 2DW4A 2VBZA 5L3FA 4HA8A 3RDIA 4LLNA 4ENKA 4IVNA 3WGGA 3L2CA 4GO1A 1LQ1A 2VBYA 2DK8A 6PAXA 5HLGA 1FWZA 3J80Z 1U8RA 2CWEA 1RUNA 4BHCA 5E1WA 3I4PA 1FSEA 3ZN1A 4AIHA 4MEYF 2IVMA 4KDPA 3OV8A 2QM3A 1YW7A 5KK1A 2ESNA 2IA0A 2PG4A 2H6BA 1FP1D 2ZKZA 4UV9A 1FP2A 2A6HF 2F5EA 4KA4A 4LLLA 3GX4X 1L3LA 1FBSA 3ZP5A 1LJ9A 2OZUA 1XGOA 5D8KB 3REOA 3K1NA 2QQ9A 2ADUA 5D6EA 3QAHA 2Q2EA 4ESFA 4EJVA 2EA4A 2IJLA 5DCMA 2RC4A 2QENA 1JHHA 1XD7A 2A69F 2L3DA 2G9WA 4IHSA 2DBBA 3HTSB 5CJ9A 3K1MA 2EFPA 5BPDA 2VN2A 4HQMA 4OMZA 1AOYA 4RGUA 2FU4A 4EM0B 2CO5A 3IWFA 1QPMA 2EV0A 3KP5A 4HAMA 3BZ6A 3O3KA 5H6RA 3VEPA 5DUIA 3LFKA 3WTYC 1DPRA 5HLIA 1BM9A 3GYHX 3HHHA 5D8LB 4UV8A 2NYXA 3F8CA 4FHTA 3HRUA 4BHPA 1K7AA 1QZZA 4LG0A 3N97A 1SAXA 5IT9Z 4Q48A 4ENMA 3R60A 4RB3C 3QP5A 3F22A 2CQKA 5JFRA 3FXQA 3EQLF 3FX3A 2A07F 4L5IA 4P9FA 1TQIA 1O3RA 2HGCA 1GXQA 3BY6A 4ENNA 1UCRA 1PUEE 4N0BA 1I6XA 3E5UA 1ZLKA 3KZYA 4EJOA 3CUOA 2CFXA 1Z6TA 4L5JA 3KP3A 4GYGA 1GVJA 3E6DA 2YPRA 2D1VA 2IA1A 1EH6A 3IHUA 2HTSA 2JPBA 4UUVA 4XBFA 4R8HA 3P9IA 5DDGA 2XAHA 2BYVE 4ZYDA 2QBYA 1EV7A 3GFMA 2EV6A 3MZHA 2O03A 3BWGA 4WXHA 4B8XA 1OMIA 1TW2A 3R6SA 1OYYA 2XIGA 3EYIA 1IN8A 1HKTA 1LB2A 2UXNA 1R58A 2L02A 4G6DA 4A0XA 4EMSA 2NAZA 4RB2C 1O3QA 4OIPF 1IN5A 2XAGA 4AVPA 2J5PA 2HYGD 1BN5A 3ULQB 4HF2A 2XROA 1S3JA 2CSOA 4E70A 2XUBA 1FC3A 1MDMB 4UVCA 4L0YB 2A3SA 5LGNA 5ERIA 2Y75A 2VC0A 2ZMEB 2Y0MA 3RI4A 2EK5A 1UFMA 1Z7UA 1TLHB 5HS8A 1FBUA 3EUHA 4GGGA 3HIFA 5LRRA 1O7LA 3J81Z 2V1DA 1U3EM 1OYWA 1J2XA 5DD4A 3PQKA 5LRSA 1H9GA 4ZZLA 3KETA 3LA2A 1XCVA 4XSZF 3I59B 5D5XB 4U0WA 1MZBA 1I5ZA 1R23A 1A04A 4UNOA 4YIIA 5E8IA 4R79A 3JTHA 1KU9A 3F8BA 1R5HA 2YX4A 2R7FA 4O3MA 2QVOA 3R0JA 2DLLA 3Q5FA 1ZHFA 1ZARA 4CDGA 1REPC 2LDUA 4U0YA 1B9MA 3OOPA 2L4AA 1XGNA 3QP6A 1DUXC 4A0YA 3BJAA 1XSDA 1R1TA 2PJPA 4ZYGA 5L3BA 1SFUA 3TOAA 3HSRA 4M72A 3KLOA 4BAYA 2P7VB 1K6OA 2RNJA 2QLZA 2P5VA 3RIRA 1YTYA 1S8NA 5BPIA 4L9JA 1ZGJA 2R3SA 4CO8A 1TNTA 4MHGA 4LK0F 2KRFA 4JK1X 3KFWX 2E7WA 3E97A 2WWYA 1IAWA 1X3UA 3HRTA 2IPQX 2FNAA 1ZRDA 3IC7A 4DNCA 1F9NA 3CLOA 1L0OC 2AS5F 2ZNZA 2EV5A 1XMAA 3N4MA 4WX9A 2EFNA 3M8EA 2W25A 3E6BA 1SD7A 4QWQA 4KNYA 3E3VA 5EEGA 1LEAA 2VBWA 1DPUA 2BEOA 1B1BA 2K86A 5CLSA 3MZYA 1UHMA 2GWRA 1IXRC 3GW2A 1SFXA 1PP7U 3I64A 1LEBA 4A0ZA 2DO7A 3RPQA 3I54A 3DV8A 1Z91A 1CF7A 1MKMA 4OIRF 3HOTA 2STWA 3BP8A 1USTA 2XAQA 2X4HA 2Z33A 3IRQA 3TO9A 2VOOA 3DPTA 3I58A 5E20A 2H09A 2BGCA 3FMSA 1BIBA 2FE3A 4EGZA 4EJWA 1ZAOA 3KP6A 4I01A 5TRDA 4KIBA 4HF1A 3MQ0A 4YIFA 2VONA 2Y48A 1NHAA 1G6NA 5H6QA 2RV8A 5J8CA 3U9GA 1ZGAA 1SMTA 5FFXA 5DUKA 4GXOA 2W57A 2HS5A 4EV0A 2MH2A 4BQAA 2VT2A 4KMFA 3F8MA 1LVAA 2OQGA 5ICGA 4CZZA 3J80K 1G4DA 2M1BA 5E18F 3SZPA 4LG0B 4PZJA 2HDCA 1KYWA 1GXPA 2VT3A 5J8FA 5ILSA 4G6QA 3IL2A 2BE5F 4M6YA 3GFJA 4RS8A 1HW2A 1B4AA 2XVCA 3IWZA 2FOKA 1WQ2A 1YQAA 1R00A 3U1DA 4ESBA 2H27A 1EH7A 4IF4A 1ULYA 1F5TA 3ZN0A 2EFWA 3U2RA 4HX7A 5FLXZ 3KZZA 2QBYB 1YW8A 4D0PA 3IKTA 3J7AO 1W7PA 3HHGA 4CGZA 1KGSA 2DAOA 3BROA 3JW4A 2CG4A 2HQRA 3F8FA 4HX4A 3HOSA 4L0ZB 2P5KA 2HKXA 3V4GA 3P9CA 4UXNA 5JI6A 3RYPA 2MD5A 4EJTA 3K0LA 2ZNYA 2H6CA 4EQQA 3S2WA 1OR7A 1FNNA 5F6FA 1YYVA 4RGSA 3EYYA 4OIQF 2GXBA 1R5GA 5DCFA 4O6JA 4KN7X 4KMUX 4UHTA 2Q8KA 2QZ8A 1IXSB 1SD6A 4HDVA 3NEUA 1W7PD 2ISZA 3DEUA 5D4RA 1KA8A 1UB9A 4YFKF 3TDUC 4CHUA 4OMYA 4GCVA 1G3SA 3COAC 5EEHA 1Y0UA 5IT9K 2M87A 3V7CA 1R22A 2NS0A 1BI0A 5A2QZ 4I0BA 2LF8A 3D5LA 5HS7A 3TGNA 1T38A 3BDDA 4HV5A 2JZYA 2MLKA 1KQ0A 4RGXA 2W85A 3ABUA 5L3EA 1BC7C 3BJOA 1Z05A 2B0LA 3DXJF 2HTJA 5LHHA 1USSA 4HQEA 4GYIA 4M6XA 2PI0A 2K4JA 3GF2A 2WV0A 2E7XA 3GXOA 1ODDA 3M8FA 2WTEA 3WE3A 3O6BB 2FRHA 4ASNA 1I27A 5JVTA 3ABTA 2FNPA 4MGRA 1HBXG 5K5OA 5AIPA 1YW9A 3RKXA 4IRGA 4MQ9F 1G3WA 2RN7A 5FB2A 2L4MA 2L01A 4XRFA 4HLXA 4UVAA 4OU0A 3JSOA 2EB7A 3CUQA 4HOBA 2MBFA 2AXLA 3KEOA 2P8TA 1BC8C 2DTRA 3VFZA 2PFBA 3ECHA 2GZWA 3GFLA 2QQAA 4ETSA 2YU3A 3HRSA 2WC2A 1J75A 3NRVA 3J81K 3V7RA 2XASA 2XAJA 3WTWC 3GZ6A 5ILVA 3HSEA 4OINF 2F5FA 4EM1A 4BYYA 5ED4A 1B9NA 2F5CA 5FD5A 2O8XA 3LQRA 4BNCA 1KU3A 2M5WA 1YG2A 4PGHA 2XKPA 1TTYA 4BH9A 3CJNA 2W24A 1F1ZA 3FXRA 4R1HA 1H0MA 2M45A 4KUMA 4FX4A 3FMRA 4BHBA 1R7JA 2ELHA 2ZFWA 5E8GA 2JTVA 3CO6C 2XHKA 4KIFA 3FM3A 2XGXA 4Q4ZF 5BMZA 1HXDA 1MJ9A 1OYIA 2X0LA 2OQRA 4YG2F 1IXCA 2A6EF 2QQBA 4U88A 3E6MA 1IUYA 1H9TA 1I1GA 3K1PA 2TDXA 1K78A 4HZFA 1IRGA 1O3TA 5AIQA 2JT1A 1HSTA 2LNBA 1D3YA 2XRNA 1LDKB 3M7GA 4IHTA 2P5LC 1RIOH 2BV6A 1IN7A 4YFNF 5DYMA 1P2FA 4LGWA 2VE8A 1YLFA 3DF8A 2OU2A 4L9TA 2P7CB 2HEOA 4AWXB 4I2OA 1OKRA 4S04A 1F4KA 2FEZA 2ISYA 1STZA 1U5TC 5JR3A 3E6CC 4MEXF 3TKYA 1Z6RA 4Y17A 3FWEA 3BJ6A 3LA3A 3ML6A 1PDNC 5D4SA 1TQMA 1V3FA 5CVRA 4L18B 5E1ZB 4EGYA 4M9SA 4WF2A 3DP7A 4EM2A 5D5UB 1T98A 2C6YA 3RYRA 1ZLJA 2NNNA 2PMHA 3WTTC 1MGTA 1FLIA 4FX0A 4Y13A 5E17F 3SXYA 1W5TA 4IJAA 3K2ZA 4WXCA 2YSRA 4A5MA 4XLPF 4OIOF 4LB6B 2ZJ2A 1YS7A 1DP7P 1ON2A 4I7HA 1IRFA 2A68F 2V1XA 2KKOA 4WK8F 4G9YA 4KN4X 3WE2A 5LEKA 1P92A 1S7AA 1IW7F 4P9UA 5LHIA 5HOOA 1MJBA 4FT8A 1HQCA 2FMLA 5J6XA 3ECOA 2DQRA 2E1NA 1XGSA 3HTUA 3JSPA 4NQWA 4TV7A 2DU9A 4F7ZA 2DI3A 2KIFA 1LDJA 4G94A 3CDHA 2ACJA 1FYKA 2G7HA 5IT3A 1FZPB 2OD5A 1BJAA 2OZ6A 1MJAA 1BBYA 3CTAA 3C1DA 1SD5A 3ZMZA 5HDNA 2FF4A 3F3XA 1MDMA 2HKOA 4I09A 1BI1A 3W6KB 2IT0A 1RZ4A 3WGIA 1XDUA 2K4BA 2K02A 3HRMA 1XGMA 3MFKA 3KCCA 2UWMA 3FXUA 5DD8A 5DCMB 3WU0A 3QU3A 4P96A 5CVIA 2OA4A 5L3GA 2FBIA 1FSHA 2FBKA 1BI2A 1ZN2A 3H3UA 2J5OA 4BXUA 2V9VA 1FBQA 3C18A 4N9HA 4L9VA 4EVIA 2EJRA 1J59A 4HW0A 2NNYA 1W5SA 5E1XA 4ZZDA 4U7BA 2M30A 3QOPA 3CUQC 2VC1A 5FLXK 2ZXJA 1WRJA 1J5YA 3SZTA 3O2PE 3K9TA 3LAPA 1J7KA 1FY7A 2UXXA 4M9ZA 4Z2YA 4KT5C 3KP2A 1RUOA 4G7ZF 4MQVA 4AIKA 1Z1DA 5BS6A 1WKMA 3G73A 1U5TA 5HS9A 3T8RA 1ON1A 1FX7A 4PGGA 3ISPA 1J0RA 3ZMDA 4IPAA 3WTVC 2XV4S 3GO5A 3ZMVA 3CO7C 3FZVA 4PCQA 1YO5C 1V4RA 5CYVA 2P4WA 3JAMZ 1WWXA 2KIMA 5CVUA 2VODA 1ZREA 4IRIA 2NRAC 3RTRA 4M9XA 3AAFA 1HW1A 5BOXA 2Q0OA 3TQNA 1IZ1A 5A2QK 1ZRFA 4LB5A 3QRFF 4HLYA 5CVVA 1HKSA 4G7HF 2FBHA 1P6RA 3MEXA 1W4MA 2V1UA 2MH9A 2Z3YA 3WG9A 1RI7A 1U78A 5TJJA 4HDUA 1BI3A 1R1VA 2IP2A 1FPQA 3Q9VA 4CYDA 4ZYHA 2P6TA 4Q5SF 2V79A 3PFIA 2JRTA 1UHWA 1FOKA 2ZO4A 2PN6A 4KICA 1KQ8A 1K78B 1RNLA 3BPXA 3WU1B 2QWWA 4KIGA 3LQQA 2VE9A 2PBIA 3RJPA 3GFIA 3V8LA 4LMYA 2IA2A 4AD9A 4MTDA 3GZ5A 3ZPLA 3I71A 1I1SA 2FMYA 1B59A 5FO5A 3BPVA 4HYEA 1ZRCA 3TO6A 3H92A 3LWFA 1IN6A 2DQLA 4RAYA 2IW5A 1HW5A 1JXSA 3MWMA 5FFZA 5LGUA 3GUDA 3LSTA 3L7WA 4M73A 1BOAA 1MD0A 2KJBA 1KQ9A 2RKHA 2PMUA 4JQFA 3WODF 2DK5A 3IKVA 1ZYRF 1QBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O57 A;  1T6S A;  1P4X A;  3R61 A;  4XLN F;  5LGT A;  1TQP A;  2FQ3 A;  3QPT A;  3GVA A;  1JGS A;  1XMK A;  3ZMT A;  2STT A;  2VXZ A;  1KYZ A;  2BBY A;  3WGH A;  3F6O A;  5HDK A;  2P6S A;  3R0A A;  3DFG A;  1O7F A;  1JE8 A;  3WTX C;  3L9F A;  2ZCW A;  3EDP A;  3F23 A;  3P7N A;  2V6C A;  2D2W A;  4A2U A;  2EFQ A;  1LNW A;  5HVQ C;  4Y15 A;  1QQI A;  2CYY A;  2XAF A;  1ONV A;  1CGP A;  3RPU A;  1XDS A;  3HYI A;  4PDK A;  4MNU A;  2HQN A;  2R7D A;  3GLX A;  4KYW A;  4LFU A;  2EWN A;  3L00 A;  4K2E A;  4OOI A;  3B73 A;  4A5N A;  3F6V A;  2MC3 A;  3DPL C;  2GQQ A;  4RB0 A;  1SD4 A;  4IRH A;  2QYO A;  1XSV A;  2F5D A;  1G3T A;  3BOQ A;  2KJC A;  1G3Y A;  1TW3 A;  2EA2 A;  5JHU A;  2FA5 A;  4YFX F;  2RVC A;  2RQP A;  1D8K A;  1CF7 B;  1U6G A;  1KU2 A;  2PLY A;  4G7O F;  3MCZ A;  4RGR A;  3C7J A;  2Z99 A;  3F8N A;  4UVB A;  4EJU A;  4HV6 A;  3LA7 A;  1S29 A;  2GAU A;  4I98 B;  3DKW A;  2KIU A;  1WI9 A;  2MA3 A;  4WWC A;  1FYM A;  1SFE A;  3F21 A;  3M9A A;  4LD5 A;  3TO7 A;  3JTG A;  1YS6 A;  4IXA A;  1T2K A;  5K5Q A;  2VOP A;  2A61 A;  1ZH5 A;  1FYL A;  4ESJ A;  4U0V A;  3LAJ A;  2E1C A;  4AIJ A;  1O3S A;  1EH8 A;  5HLH A;  3SHF A;  4M74 A;  3FMQ A;  3D0S A;  4O5V A;  1P4A A;  2JSC A;  2GA2 A;  3T8T A;  2O61 A;  3FF5 A;  4QLC U;  1D5V A;  3MAJ A;  4HBL A;  5L3D A;  1XB4 A;  1DDN A;  1WSU A;  3L09 A;  4S05 A;  3SQN A;  1T39 A;  4JBA A;  2LSO A;  1D8J A;  4U7D A;  3PQJ A;  4I02 A;  1P4W A;  3B02 A;  4LLG F;  3I0T A;  3ZMS A;  1Q1H A;  2MLG A;  1U5T B;  2HOE A;  2HZT A;  3HSF A;  2UZK A;  2DFI A;  2ESH A;  3KP7 A;  2FXA A;  4ZYE A;  1VTN C;  1HSJ A;  2PEX A;  2O6G E;  5DEQ A;  1FT9 A;  3K69 A;  5ICF A;  2H94 A;  4KFC A;  5HDG A;  2D1H A;  2YR2 A;  1J9I A;  4NHJ A;  4HF0 A;  4ON0 A;  2QUF A;  1TNS A;  5DV5 A;  1R1U A;  5L3C A;  3IRR A;  3ELK A;  3ERE D;  2CGP A;  2ZBK A;  4A6E A;  1ZG1 A;  1OPC A;  2HFH A;  3QU6 A;  3G3Z A;  2FSW A;  2GA1 A;  4M71 A;  2OBP A;  1W7P B;  3KEQ A;  5BQT A;  5D5W B;  5LBQ A;  2JPC A;  2HR3 A;  2W84 A;  3FHZ A;  1ZG3 A;  3F72 A;  1S6L A;  1Z9C A;  2XKO A;  3RKY A;  3FM5 A;  2YX7 A;  3KP4 A;  4XSX F;  2EFO A;  3EET A;  4CIC A;  4LJZ F;  5K1Y A;  1ZG5 A;  3KE2 A;  1LDD A;  2Z5U A;  2D45 A;  3Q9S A;  1PP8 F;  1YFH A;  1S7O A;  1KU7 A;  4Q47 A;  4B09 A;  1K79 A;  2ETH A;  5ICE A;  3RKW A;  5LHG A;  5ILU A;  4A12 A;  3H3Z A;  1BIA A;  1IN4 A;  2L54 A;  4G8X A;  2K7L A;  2IRF G;  3WTS C;  5FD6 A;  1IF1 A;  2F2E A;  1XCB A;  2O0Y A;  2ZME A;  5CVJ A;  2PQ8 A;  3V8J A;  1XSX A;  5H20 A;  2RDP A;  3TOB A;  4N9I A;  3E5X A;  3R4K A;  1B6A A;  3I5U A;  2A5Y B;  3KLN A;  3GEZ A;  3I59 A;  1GHC A;  2VBX A;  4WCG A;  4A6D A;  1QGP A;  3JAM K;  3SFZ A;  1HKQ A;  2G7U A;  1E17 A;  4P55 A;  3VOD A;  3ROU A;  1T0F A;  1JHF A;  3T5X A;  3WTZ A;  3M1E A;  5K5R A;  2HYF A;  2K27 A;  2RGV A;  3I53 A;  1TBX A;  5AON A;  5D6F A;  4ZH4 F;  2O3F A;  2CW0 F;  2DT5 A;  1QNT A;  4LK1 F;  2GIV A;  2OAZ A;  5ICC A;  2LF7 A;  4H0E A;  4HX8 A;  5FGM A;  1AWC A;  5LEJ A;  1SMY F;  5D5V B;  4NB5 A;  3NQO A;  2HWV A;  2COM A;  5LLQ A;  3T0Y A;  2LKP A;  3P9K A;  4WXD A;  3HUG A;  2DPU A;  5F1R A;  3V8K A;  4CXF A;  3CUQ B;  5F64 A;  3VB2 A;  3V7S A;  4I0A A;  3WTU C;  2DPD A;  1QZY A;  3C3W A;  3T1B A;  1C0W A;  5KVR A;  3DQV C;  3VOE A;  4L9N A;  2M8E A;  3QPH A;  1U2W A;  3GWZ A;  4P5O A;  3ZMU A;  4RB1 A;  1XN7 A;  3W6J B;  2Z9O A;  3E5Q A;  1R36 A;  4MTE A;  1YIO A;  1E2X A;  1QO0 D;  3ZQ7 A;  2GXG A;  4RAZ A;  3TDZ C;  4DQ2 A;  4ENJ A;  2DW4 A;  2VBZ A;  5L3F A;  4HA8 A;  3RDI A;  4LLN A;  4ENK A;  4IVN A;  3WGG A;  3L2C A;  4GO1 A;  1LQ1 A;  2VBY A;  2DK8 A;  6PAX A;  5HLG A;  1FWZ A;  3J80 Z;  1U8R A;  2CWE A;  1RUN A;  4BHC A;  5E1W A;  3I4P A;  1FSE A;  3ZN1 A;  4AIH A;  4MEY F;  2IVM A;  4KDP A;  3OV8 A;  2QM3 A;  1YW7 A;  5KK1 A;  2ESN A;  2IA0 A;  2PG4 A;  2H6B A;  1FP1 D;  2ZKZ A;  4UV9 A;  1FP2 A;  2A6H F;  2F5E A;  4KA4 A;  4LLL A;  3GX4 X;  1L3L A;  1FBS A;  3ZP5 A;  1LJ9 A;  2OZU A;  1XGO A;  5D8K B;  3REO A;  3K1N A;  2QQ9 A;  2ADU A;  5D6E A;  3QAH A;  2Q2E A;  4ESF A;  4EJV A;  2EA4 A;  2IJL A;  5DCM A;  2RC4 A;  2QEN A;  1JHH A;  1XD7 A;  2A69 F;  2L3D A;  2G9W A;  4IHS A;  2DBB A;  3HTS B;  5CJ9 A;  3K1M A;  2EFP A;  5BPD A;  2VN2 A;  4HQM A;  4OMZ A;  1AOY A;  4RGU A;  2FU4 A;  4EM0 B;  2CO5 A;  3IWF A;  1QPM A;  2EV0 A;  3KP5 A;  4HAM A;  3BZ6 A;  3O3K A;  5H6R A;  3VEP A;  5DUI A;  3LFK A;  3WTY C;  1DPR A;  5HLI A;  1BM9 A;  3GYH X;  3HHH A;  5D8L B;  4UV8 A;  2NYX A;  3F8C A;  4FHT A;  3HRU A;  4BHP A;  1K7A A;  1QZZ A;  4LG0 A;  3N97 A;  1SAX A;  5IT9 Z;  4Q48 A;  4ENM A;  3R60 A;  4RB3 C;  3QP5 A;  3F22 A;  2CQK A;  5JFR A;  3FXQ A;  3EQL F;  3FX3 A;  2A07 F;  4L5I A;  4P9F A;  1TQI A;  1O3R A;  2HGC A;  1GXQ A;  3BY6 A;  4ENN A;  1UCR A;  1PUE E;  4N0B A;  1I6X A;  3E5U A;  1ZLK A;  3KZY A;  4EJO A;  3CUO A;  2CFX A;  1Z6T A;  4L5J A;  3KP3 A;  4GYG A;  1GVJ A;  3E6D A;  2YPR A;  2D1V A;  2IA1 A;  1EH6 A;  3IHU A;  2HTS A;  2JPB A;  4UUV A;  4XBF A;  4R8H A;  3P9I A;  5DDG A;  2XAH A;  2BYV E;  4ZYD A;  2QBY A;  1EV7 A;  3GFM A;  2EV6 A;  3MZH A;  2O03 A;  3BWG A;  4WXH A;  4B8X A;  1OMI A;  1TW2 A;  3R6S A;  1OYY A;  2XIG A;  3EYI A;  1IN8 A;  1HKT A;  1LB2 A;  2UXN A;  1R58 A;  2L02 A;  4G6D A;  4A0X A;  4EMS A;  2NAZ A;  4RB2 C;  1O3Q A;  4OIP F;  1IN5 A;  2XAG A;  4AVP A;  2J5P A;  2HYG D;  1BN5 A;  3ULQ B;  4HF2 A;  2XRO A;  1S3J A;  2CSO A;  4E70 A;  2XUB A;  1FC3 A;  1MDM B;  4UVC A;  4L0Y B;  2A3S A;  5LGN A;  5ERI A;  2Y75 A;  2VC0 A;  2ZME B;  2Y0M A;  3RI4 A;  2EK5 A;  1UFM A;  1Z7U A;  1TLH B;  5HS8 A;  1FBU A;  3EUH A;  4GGG A;  3HIF A;  5LRR A;  1O7L A;  3J81 Z;  2V1D A;  1U3E M;  1OYW A;  1J2X A;  5DD4 A;  3PQK A;  5LRS A;  1H9G A;  4ZZL A;  3KET A;  3LA2 A;  1XCV A;  4XSZ F;  3I59 B;  5D5X B;  4U0W A;  1MZB A;  1I5Z A;  1R23 A;  1A04 A;  4UNO A;  4YII A;  5E8I A;  4R79 A;  3JTH A;  1KU9 A;  3F8B A;  1R5H A;  2YX4 A;  2R7F A;  4O3M A;  2QVO A;  3R0J A;  2DLL A;  3Q5F A;  1ZHF A;  1ZAR A;  4CDG A;  1REP C;  2LDU A;  4U0Y A;  1B9M A;  3OOP A;  2L4A A;  1XGN A;  3QP6 A;  1DUX C;  4A0Y A;  3BJA A;  1XSD A;  1R1T A;  2PJP A;  4ZYG A;  5L3B A;  1SFU A;  3TOA A;  3HSR A;  4M72 A;  3KLO A;  4BAY A;  2P7V B;  1K6O A;  2RNJ A;  2QLZ A;  2P5V A;  3RIR A;  1YTY A;  1S8N A;  5BPI A;  4L9J A;  1ZGJ A;  2R3S A;  4CO8 A;  1TNT A;  4MHG A;  4LK0 F;  2KRF A;  4JK1 X;  3KFW X;  2E7W A;  3E97 A;  2WWY A;  1IAW A;  1X3U A;  3HRT A;  2IPQ X;  2FNA A;  1ZRD A;  3IC7 A;  4DNC A;  1F9N A;  3CLO A;  1L0O C;  2AS5 F;  2ZNZ A;  2EV5 A;  1XMA A;  3N4M A;  4WX9 A;  2EFN A;  3M8E A;  2W25 A;  3E6B A;  1SD7 A;  4QWQ A;  4KNY A;  3E3V A;  5EEG A;  1LEA A;  2VBW A;  1DPU A;  2BEO A;  1B1B A;  2K86 A;  5CLS A;  3MZY A;  1UHM A;  2GWR A;  1IXR C;  3GW2 A;  1SFX A;  1PP7 U;  3I64 A;  1LEB A;  4A0Z A;  2DO7 A;  3RPQ A;  3I54 A;  3DV8 A;  1Z91 A;  1CF7 A;  1MKM A;  4OIR F;  3HOT A;  2STW A;  3BP8 A;  1UST A;  2XAQ A;  2X4H A;  2Z33 A;  3IRQ A;  3TO9 A;  2VOO A;  3DPT A;  3I58 A;  5E20 A;  2H09 A;  2BGC A;  3FMS A;  1BIB A;  2FE3 A;  4EGZ A;  4EJW A;  1ZAO A;  3KP6 A;  4I01 A;  5TRD A;  4KIB A;  4HF1 A;  3MQ0 A;  4YIF A;  2VON A;  2Y48 A;  1NHA A;  1G6N A;  5H6Q A;  2RV8 A;  5J8C A;  3U9G A;  1ZGA A;  1SMT A;  5FFX A;  5DUK A;  4GXO A;  2W57 A;  2HS5 A;  4EV0 A;  2MH2 A;  4BQA A;  2VT2 A;  4KMF A;  3F8M A;  1LVA A;  2OQG A;  5ICG A;  4CZZ A;  3J80 K;  1G4D A;  2M1B A;  5E18 F;  3SZP A;  4LG0 B;  4PZJ A;  2HDC A;  1KYW A;  1GXP A;  2VT3 A;  5J8F A;  5ILS A;  4G6Q A;  3IL2 A;  2BE5 F;  4M6Y A;  3GFJ A;  4RS8 A;  1HW2 A;  1B4A A;  2XVC A;  3IWZ A;  2FOK A;  1WQ2 A;  1YQA A;  1R00 A;  3U1D A;  4ESB A;  2H27 A;  1EH7 A;  4IF4 A;  1ULY A;  1F5T A;  3ZN0 A;  2EFW A;  3U2R A;  4HX7 A;  5FLX Z;  3KZZ A;  2QBY B;  1YW8 A;  4D0P A;  3IKT A;  3J7A O;  1W7P A;  3HHG A;  4CGZ A;  1KGS A;  2DAO A;  3BRO A;  3JW4 A;  2CG4 A;  2HQR A;  3F8F A;  4HX4 A;  3HOS A;  4L0Z B;  2P5K A;  2HKX A;  3V4G A;  3P9C A;  4UXN A;  5JI6 A;  3RYP A;  2MD5 A;  4EJT A;  3K0L A;  2ZNY A;  2H6C A;  4EQQ A;  3S2W A;  1OR7 A;  1FNN A;  5F6F A;  1YYV A;  4RGS A;  3EYY A;  4OIQ F;  2GXB A;  1R5G A;  5DCF A;  4O6J A;  4KN7 X;  4KMU X;  4UHT A;  2Q8K A;  2QZ8 A;  1IXS B;  1SD6 A;  4HDV A;  3NEU A;  1W7P D;  2ISZ A;  3DEU A;  5D4R A;  1KA8 A;  1UB9 A;  4YFK F;  3TDU C;  4CHU A;  4OMY A;  4GCV A;  1G3S A;  3COA C;  5EEH A;  1Y0U A;  5IT9 K;  2M87 A;  3V7C A;  1R22 A;  2NS0 A;  1BI0 A;  5A2Q Z;  4I0B A;  2LF8 A;  3D5L A;  5HS7 A;  3TGN A;  1T38 A;  3BDD A;  4HV5 A;  2JZY A;  2MLK A;  1KQ0 A;  4RGX A;  2W85 A;  3ABU A;  5L3E A;  1BC7 C;  3BJO A;  1Z05 A;  2B0L A;  3DXJ F;  2HTJ A;  5LHH A;  1USS A;  4HQE A;  4GYI A;  4M6X A;  2PI0 A;  2K4J A;  3GF2 A;  2WV0 A;  2E7X A;  3GXO A;  1ODD A;  3M8F A;  2WTE A;  3WE3 A;  3O6B B;  2FRH A;  4ASN A;  1I27 A;  5JVT A;  3ABT A;  2FNP A;  4MGR A;  1HBX G;  5K5O A;  5AIP A;  1YW9 A;  3RKX A;  4IRG A;  4MQ9 F;  1G3W A;  2RN7 A;  5FB2 A;  2L4M A;  2L01 A;  4XRF A;  4HLX A;  4UVA A;  4OU0 A;  3JSO A;  2EB7 A;  3CUQ A;  4HOB A;  2MBF A;  2AXL A;  3KEO A;  2P8T A;  1BC8 C;  2DTR A;  3VFZ A;  2PFB A;  3ECH A;  2GZW A;  3GFL A;  2QQA A;  4ETS A;  2YU3 A;  3HRS A;  2WC2 A;  1J75 A;  3NRV A;  3J81 K;  3V7R A;  2XAS A;  2XAJ A;  3WTW C;  3GZ6 A;  5ILV A;  3HSE A;  4OIN F;  2F5F A;  4EM1 A;  4BYY A;  5ED4 A;  1B9N A;  2F5C A;  5FD5 A;  2O8X A;  3LQR A;  4BNC A;  1KU3 A;  2M5W A;  1YG2 A;  4PGH A;  2XKP A;  1TTY A;  4BH9 A;  3CJN A;  2W24 A;  1F1Z A;  3FXR A;  4R1H A;  1H0M A;  2M45 A;  4KUM A;  4FX4 A;  3FMR A;  4BHB A;  1R7J A;  2ELH A;  2ZFW A;  5E8G A;  2JTV A;  3CO6 C;  2XHK A;  4KIF A;  3FM3 A;  2XGX A;  4Q4Z F;  5BMZ A;  1HXD A;  1MJ9 A;  1OYI A;  2X0L A;  2OQR A;  4YG2 F;  1IXC A;  2A6E F;  2QQB A;  4U88 A;  3E6M A;  1IUY A;  1H9T A;  1I1G A;  3K1P A;  2TDX A;  1K78 A;  4HZF A;  1IRG A;  1O3T A;  5AIQ A;  2JT1 A;  1HST A;  2LNB A;  1D3Y A;  2XRN A;  1LDK B;  3M7G A;  4IHT A;  2P5L C;  1RIO H;  2BV6 A;  1IN7 A;  4YFN F;  5DYM A;  1P2F A;  4LGW A;  2VE8 A;  1YLF A;  3DF8 A;  2OU2 A;  4L9T A;  2P7C B;  2HEO A;  4AWX B;  4I2O A;  1OKR A;  4S04 A;  1F4K A;  2FEZ A;  2ISY A;  1STZ A;  1U5T C;  5JR3 A;  3E6C C;  4MEX F;  3TKY A;  1Z6R A;  4Y17 A;  3FWE A;  3BJ6 A;  3LA3 A;  3ML6 A;  1PDN C;  5D4S A;  1TQM A;  1V3F A;  5CVR A;  4L18 B;  5E1Z B;  4EGY A;  4M9S A;  4WF2 A;  3DP7 A;  4EM2 A;  5D5U B;  1T98 A;  2C6Y A;  3RYR A;  1ZLJ A;  2NNN A;  2PMH A;  3WTT C;  1MGT A;  1FLI A;  4FX0 A;  4Y13 A;  5E17 F;  3SXY A;  1W5T A;  4IJA A;  3K2Z A;  4WXC A;  2YSR A;  4A5M A;  4XLP F;  4OIO F;  4LB6 B;  2ZJ2 A;  1YS7 A;  1DP7 P;  1ON2 A;  4I7H A;  1IRF A;  2A68 F;  2V1X A;  2KKO A;  4WK8 F;  4G9Y A;  4KN4 X;  3WE2 A;  5LEK A;  1P92 A;  1S7A A;  1IW7 F;  4P9U A;  5LHI A;  5HOO A;  1MJB A;  4FT8 A;  1HQC A;  2FML A;  5J6X A;  3ECO A;  2DQR A;  2E1N A;  1XGS A;  3HTU A;  3JSP A;  4NQW A;  4TV7 A;  2DU9 A;  4F7Z A;  2DI3 A;  2KIF A;  1LDJ A;  4G94 A;  3CDH A;  2ACJ A;  1FYK A;  2G7H A;  5IT3 A;  1FZP B;  2OD5 A;  1BJA A;  2OZ6 A;  1MJA A;  1BBY A;  3CTA A;  3C1D A;  1SD5 A;  3ZMZ A;  5HDN A;  2FF4 A;  3F3X A;  1MDM A;  2HKO A;  4I09 A;  1BI1 A;  3W6K B;  2IT0 A;  1RZ4 A;  3WGI A;  1XDU A;  2K4B A;  2K02 A;  3HRM A;  1XGM A;  3MFK A;  3KCC A;  2UWM A;  3FXU A;  5DD8 A;  5DCM B;  3WU0 A;  3QU3 A;  4P96 A;  5CVI A;  2OA4 A;  5L3G A;  2FBI A;  1FSH A;  2FBK A;  1BI2 A;  1ZN2 A;  3H3U A;  2J5O A;  4BXU A;  2V9V A;  1FBQ A;  3C18 A;  4N9H A;  4L9V A;  4EVI A;  2EJR A;  1J59 A;  4HW0 A;  2NNY A;  1W5S A;  5E1X A;  4ZZD A;  4U7B A;  2M30 A;  3QOP A;  3CUQ C;  2VC1 A;  5FLX K;  2ZXJ A;  1WRJ A;  1J5Y A;  3SZT A;  3O2P E;  3K9T A;  3LAP A;  1J7K A;  1FY7 A;  2UXX A;  4M9Z A;  4Z2Y A;  4KT5 C;  3KP2 A;  1RUO A;  4G7Z F;  4MQV A;  4AIK A;  1Z1D A;  5BS6 A;  1WKM A;  3G73 A;  1U5T A;  5HS9 A;  3T8R A;  1ON1 A;  1FX7 A;  4PGG A;  3ISP A;  1J0R A;  3ZMD A;  4IPA A;  3WTV C;  2XV4 S;  3GO5 A;  3ZMV A;  3CO7 C;  3FZV A;  4PCQ A;  1YO5 C;  1V4R A;  5CYV A;  2P4W A;  3JAM Z;  1WWX A;  2KIM A;  5CVU A;  2VOD A;  1ZRE A;  4IRI A;  2NRA C;  3RTR A;  4M9X A;  3AAF A;  1HW1 A;  5BOX A;  2Q0O A;  3TQN A;  1IZ1 A;  5A2Q K;  1ZRF A;  4LB5 A;  3QRF F;  4HLY A;  5CVV A;  1HKS A;  4G7H F;  2FBH A;  1P6R A;  3MEX A;  1W4M A;  2V1U A;  2MH9 A;  2Z3Y A;  3WG9 A;  1RI7 A;  1U78 A;  5TJJ A;  4HDU A;  1BI3 A;  1R1V A;  2IP2 A;  1FPQ A;  3Q9V A;  4CYD A;  4ZYH A;  2P6T A;  4Q5S F;  2V79 A;  3PFI A;  2JRT A;  1UHW A;  1FOK A;  2ZO4 A;  2PN6 A;  4KIC A;  1KQ8 A;  1K78 B;  1RNL A;  3BPX A;  3WU1 B;  2QWW A;  4KIG A;  3LQQ A;  2VE9 A;  2PBI A;  3RJP A;  3GFI A;  3V8L A;  4LMY A;  2IA2 A;  4AD9 A;  4MTD A;  3GZ5 A;  3ZPL A;  3I71 A;  1I1S A;  2FMY A;  1B59 A;  5FO5 A;  3BPV A;  4HYE A;  1ZRC A;  3TO6 A;  3H92 A;  3LWF A;  1IN6 A;  2DQL A;  4RAY A;  2IW5 A;  1HW5 A;  1JXS A;  3MWM A;  5FFZ A;  5LGU A;  3GUD A;  3LST A;  3L7W A;  4M73 A;  1BOA A;  1MD0 A;  2KJB A;  1KQ9 A;  2RKH A;  2PMU A;  4JQF A;  3WOD F;  2DK5 A;  3IKV A;  1ZYR F;  1QBJ A; 
#chains in the Genus database with same CATH topology
 1MND A;  3MMY B;  2OF7 A;  4PSX A;  1SVM A;  1Z77 A;  3M4O J;  1O57 A;  5LFA A;  1T6S A;  1I6H J;  2LBF A;  2A5W A;  1P4X A;  3R61 A;  4XLN F;  3I9V 2;  5LGT A;  1TQP A;  2FQ3 A;  3QPT A;  3GVA A;  4Y52 J;  4E7Z A;  5TGT A;  4JYK A;  2V6E A;  1VQ5 I;  1JGS A;  4RM2 A;  1XMK A;  3ZMT A;  3DEW A;  2STT A;  1VQO I;  2VXZ A;  1EA3 A;  1KYZ A;  2BBY A;  3WGH A;  3F6O A;  3CP8 A;  3C2H A;  5HDK A;  2P6S A;  1IV6 A;  2VJ4 A;  3R0A A;  4BXF A;  1WJE A;  3TW7 A;  1ETO A;  3DFG A;  1O7F A;  3FBN B;  3MD2 A;  4NUB A;  1JE8 A;  3WTX C;  1FOW A;  2JUG A;  2WAQ N;  3L9F A;  2ZCW A;  2XGC A;  3EDP A;  3OWT A;  3F23 A;  4DYR A;  4N4N B;  3P7N A;  2V6C A;  2D2W A;  1ETY A;  4A2U A;  2EFQ A;  3OYL A;  1LNW A;  5HVQ C;  4Y15 A;  1QQI A;  2CYY A;  2VAS A;  1MMG A;  2ELJ A;  2XAF A;  1ONV A;  3QPL A;  1CGP A;  3RPU A;  4XK4 A;  3GTM J;  1MMN A;  1XDS A;  3HYI A;  4G6T B;  4PDK A;  2HPM A;  1X1B A;  1N78 A;  1FTT A;  4MNU A;  2YS9 A;  1XX5 A;  2HQN A;  2R7D A;  3GLX A;  4Y7N J;  4KYW A;  4LFU A;  2EWN A;  2QSG X;  1A35 A;  4A3L J;  3L00 A;  3DBR B;  4K2E A;  4OOI A;  2D5V A;  3K70 D;  1JGG A;  1M1E B;  3B73 A;  4A5N A;  1MBH A;  1ZQ3 P;  3M8J A;  3F6V A;  2ID6 A;  2MC3 A;  3DPL C;  3LSH A;  1I39 A;  3PO2 J;  1YIJ I;  2X51 A;  2M4K A;  2GQQ A;  4RB0 A;  2BOL A;  4D7N A;  4HNU A;  1SD4 A;  4IRH A;  2QYO A;  1XSV A;  1YI2 I;  2F5D A;  1G3T A;  3BR1 A;  2DOA A;  3DCF A;  2QQ8 A;  3BOQ A;  2ZME C;  4DYC A;  2KJC A;  1G3Y A;  3BR5 A;  1TW3 A;  2EA2 A;  2FX0 A;  5JHU A;  2FA5 A;  4YFX F;  2RVC A;  3RPU D;  2RQP A;  2MC4 A;  1D8K A;  2IBD A;  2ZB9 A;  1CF7 B;  2W82 A;  1U6G A;  1KU2 A;  2PLY A;  4G7O F;  1RES A;  3MCZ A;  4RGR A;  3C7J A;  2Z99 A;  4HNT A;  1WFX A;  4QPQ A;  5C3E J;  3F8N A;  1PUF B;  5F0H A;  4UVB A;  2N8G A;  5B1A H;  4QPO A;  4EJU A;  4HV6 A;  1G59 A;  3LA7 A;  1S29 A;  1X3W B;  2AQE A;  2F4I A;  2GAU A;  4I98 B;  1P9Q C;  3DKW A;  3VYU B;  2KIU A;  1ZEL A;  1WI9 A;  2MA3 A;  4WWC A;  3ABM H;  3DTI A;  1FYM A;  1SFE A;  3SYT A;  3F21 A;  3HOU J;  3VDX A;  3M9A A;  2WV1 A;  4LD5 A;  4A3B J;  3TO7 A;  4DOZ A;  1OCR H;  4KJZ A;  1VQM I;  3JTG A;  1YS6 A;  4KIT B;  4IXA A;  3OR2 C;  3BLY A;  1T2K A;  1ENH A;  5K5Q A;  2VOP A;  3OMY A;  2A61 A;  1ZH5 A;  3GBG A;  1YX5 A;  2V26 A;  5J1U A;  1FYL A;  4ESJ A;  5IY5 H;  4U0V A;  3LAJ A;  1Z21 A;  2BY0 A;  3DTE A;  2E1C A;  1HC8 A;  1R9T J;  4AIJ A;  1O3S A;  3S2H J;  1EH8 A;  3HC7 A;  1F36 A;  3F9K A;  5HLH A;  2DA1 A;  3MKW B;  2XDV A;  3SHF A;  4M74 A;  3FMQ A;  3D0S A;  1LE8 B;  4O5V A;  4F3Q A;  1P4A A;  3BTI A;  3UKG A;  4IHW A;  1X1D A;  2JSC A;  2LYC A;  2GA2 A;  2EQR A;  3T8T A;  2O61 A;  3FF5 A;  3OOU A;  3W6V A;  4QLC U;  1D5V A;  1DGW Y;  3MAJ A;  2KL4 A;  4HBL A;  3HL2 A;  4DBR A;  2KRH A;  5L3D A;  1XB4 A;  1DDN A;  1WSU A;  3L09 A;  1X1A A;  4S05 A;  3SQN A;  4A93 J;  4YEJ A;  2R7T A;  1DP3 A;  4DZP A;  1QRY A;  4JBA A;  1T39 A;  1VQ9 I;  3Q0W A;  2LSO A;  4RM3 A;  1XS9 A;  1D8J A;  3PQJ A;  4I02 A;  4U7D A;  5DM7 F;  1P4W A;  2X6Y A;  3GLL A;  1MBG A;  3PIP F;  3B02 A;  4LLG F;  3I0T A;  3ZMS A;  1Q1H A;  2EPF A;  2MLG A;  1G8X A;  4NC8 A;  2R7S A;  1U5T B;  2HOE A;  2HZT A;  4LG3 A;  5M5Y J;  3HSF A;  3P5J A;  4JP0 A;  4PUS A;  2UZK A;  2DFI A;  3H5R A;  5M3M J;  4XIC A;  2ESH A;  3KP7 A;  2FXA A;  4ZYE A;  1VTN C;  1SC7 A;  1HSJ A;  2PEX A;  2O6G E;  2PJR B;  5J1R A;  4IHV A;  5DEQ A;  1FT9 A;  3K69 A;  5ICF A;  2H94 A;  2CW8 A;  1YIT I;  5HDG A;  4KFC A;  5FLM J;  4XQF A;  1QVT A;  1UG2 A;  3S3N A;  2V4J C;  2F6C A;  2JA6 J;  2D1H A;  2HVQ A;  1KZH A;  2YR2 A;  5GAE J;  3S14 J;  4MIM A;  1J9I A;  1TWF J;  4HF0 A;  3GME A;  4ON0 A;  4NHJ A;  1NG7 A;  2QUF A;  1TNS A;  3GCM A;  5DV5 A;  4CCJ A;  1R1U A;  5L3C A;  3IRR A;  2VKD A;  3ELK A;  3PO3 J;  3ERE D;  2CGP A;  2PX9 A;  2ZBK A;  1EJ9 A;  4A6E A;  1ZG1 A;  1OPC A;  2HFH A;  3QU6 A;  3QYF A;  2R7W A;  1IUF A;  3G3Z A;  4AM3 A;  2FSW A;  2GA1 A;  4M71 A;  1JKR C;  2OBP A;  1W7P B;  3KEQ A;  5BQT A;  5D5W B;  5LBQ A;  1XG1 A;  1JT0 A;  2JPC A;  2HR3 A;  2WAQ A;  1N77 A;  1T95 A;  2W84 A;  3FHZ A;  1ZG3 A;  4OAY A;  3BR2 A;  3F72 A;  5FKM A;  4A3C J;  1S6L A;  3K4L A;  1Z9C A;  4L5E A;  4M3E A;  2XKO A;  4AYB N;  3RKY A;  3FM5 A;  4PJJ A;  3WU2 C;  2WBM A;  2WA0 A;  2YX7 A;  3KP4 A;  2EIK H;  3DBL B;  4XSX F;  2EFO A;  3EPZ A;  3W2W A;  1XMX A;  1HA8 A;  3G2B A;  3EET A;  4CIC A;  1IJW C;  2KT0 A;  4C2M J;  2XB5 A;  3FDY A;  4LJZ F;  5K1Y A;  4D1Q A;  4D7M A;  3W2A A;  5B3S H;  1ZG5 A;  4XON A;  3KE2 A;  1LDD A;  2Z5U A;  2E60 A;  2D45 A;  3NWT A;  4XKB A;  3Q9S A;  2VXD A;  1VQ6 I;  1PP8 F;  5GP9 A;  1YFH A;  1S7O A;  1KU7 A;  4QTR A;  4Q47 A;  1IG7 A;  4B09 A;  1K79 A;  2DCE A;  2ETH A;  4IOC F;  5ICE A;  4JOM A;  3RKW A;  5LHG A;  5ILU A;  1LFU P;  4A12 A;  1SAU A;  2LKS A;  3H3Z A;  1BIA A;  1IN4 A;  2L54 A;  4G8X A;  2K7L A;  4FET A;  3JRB A;  2IRF G;  1EKE A;  1VZ0 A;  5FD6 A;  4XL9 A;  3WTS C;  4BAC A;  1IF1 A;  4RDU A;  2DMT A;  2F2E A;  2YU9 J;  3DLA A;  5K7H A;  2LMD A;  4C2U A;  1XCB A;  2O0Y A;  1IDY A;  2CV0 A;  2ZME A;  5CVJ A;  3X2Q H;  4XMY A;  3I56 I;  4BBS J;  2PQ8 A;  3V8J A;  1XSX A;  2O8K A;  2EZL A;  2RDP A;  3IUO A;  5H20 A;  5JLX A;  1Z3X A;  3TOB A;  4CSW A;  3DLL F;  3CC2 I;  4N9I A;  4BXX J;  3GTG J;  4KIS A;  3E5X A;  3R4K A;  1IC8 A;  1B6A A;  2XB0 X;  1POG A;  2VIX A;  2CS3 A;  3DU6 A;  3I5U A;  2A5Y B;  3KLN A;  3GTJ J;  3CCM I;  5JHF A;  2BW3 A;  2DYR H;  3GEZ A;  2E34 A;  4XOT A;  1Y1V J;  2KDZ A;  1U9O A;  3I59 A;  1GHC A;  2W1O A;  2VBX A;  3BG7 A;  2MFZ A;  3H36 A;  2Y0S A;  2LLK A;  4WCG A;  4A6D A;  1QGP A;  3JAM K;  5J4V A;  3SFZ A;  4G12 A;  4J19 A;  1HKQ A;  2G7U A;  3FK6 A;  3ASO H;  1TT0 A;  1E17 A;  4P55 A;  3VOD A;  4CH7 A;  1OIS A;  4RAG A;  2JUC A;  1X2M A;  2CH0 A;  3ROU A;  3RKQ A;  4F91 B;  4XM3 A;  3K70 C;  5EG0 B;  4B48 A;  5IP9 J;  3A0B C;  5HOD A;  4IZZ A;  1FMV A;  1T0F A;  2OV7 A;  1JHF A;  2BY2 A;  2LC2 A;  3T5X A;  4UB8 C;  3M1E A;  3WTZ A;  5K5R A;  1FJL A;  1R6R A;  2HYF A;  4C3I J;  5EEA A;  2R5Y B;  1OQY A;  2K27 A;  2NVY J;  2RGV A;  1BR1 A;  3I53 A;  4M3D A;  2CUF A;  1TBX A;  5AON A;  3GTP J;  5D6F A;  1ETV A;  4ZH4 F;  4I6Z A;  2O3F A;  5E3M A;  2CW0 F;  2DT5 A;  4IO9 F;  1QNT A;  1W1W E;  4LK1 F;  2GIV A;  4XNF A;  3E1S A;  2OAZ A;  5ICC A;  2LF7 A;  4H0E A;  4HX8 A;  1MNE A;  3OIQ A;  5FGM A;  4B1R A;  1ACI A;  4J00 A;  1AWC A;  5LEJ A;  1SMY F;  5KCM A;  5D5V B;  3NWS A;  4NB5 A;  2R7R A;  3NQO A;  2HWV A;  2COM A;  3CCU I;  2L9S A;  5LLQ A;  3T0Y A;  2PMZ N;  2LKP A;  3P9K A;  4WXD A;  3HUG A;  2DPU A;  5F1R A;  3V8K A;  4CXF A;  2M7B A;  4EEF G;  1TWA J;  3CUQ B;  1WCM J;  2K3P A;  3G4S I;  2XGD A;  3TED A;  1HCR A;  5F64 A;  3VB2 A;  3V7S A;  4I0A A;  2E2J J;  3WTU C;  1MBF A;  2DPD A;  1QZY A;  3C3W A;  3T1B A;  1C0W A;  5KVR A;  3DQV C;  3VOE A;  1OJL A;  4L9N A;  4B4C A;  2M8E A;  1WJ5 A;  1BL0 A;  3EUK L;  4ZDP A;  3ERM A;  5CQE A;  3S93 A;  3QPH A;  2DYS H;  2F4M B;  2KIQ A;  1U2W A;  3GWZ A;  2V9K A;  4P5O A;  3ZMU A;  1XN7 A;  4RB1 A;  3W6J B;  2Z9O A;  3E5Q A;  1R36 A;  4NBQ A;  2ZFU A;  4MTE A;  1YIO A;  3OYM A;  1E2X A;  2Y9Y A;  3KX2 A;  1QO0 D;  4NC6 A;  1RRJ A;  3OL3 A;  3ZQ7 A;  4C2T A;  2GXG A;  4ITV A;  4RAZ A;  1T08 B;  3TDZ C;  4DQ2 A;  4AID A;  3ASN H;  4ENJ A;  1SVL A;  2DW4 A;  4ZTF A;  2VBZ A;  5BNG A;  2RAE A;  3A02 A;  3H9J A;  4HA8 A;  5L3F A;  5KAI C;  4V19 K;  2L9V A;  1WH5 A;  3DWL E;  5EJC A;  3RDI A;  2QA4 I;  3BZC A;  3DKY A;  2DXI A;  4LLN A;  1S5L C;  5F0C A;  2R7Z J;  4ENK A;  3OYN A;  1QZE A;  4IVN A;  3WGG A;  3LSK A;  3OYH A;  2MGQ A;  4GO1 A;  1PJR A;  3L2C A;  4GDF A;  1LQ1 A;  2KRC A;  4C30 A;  2XF6 A;  2HYJ A;  2GIZ A;  2VBY A;  2VI6 A;  2DK8 A;  2CUE A;  3ABL H;  6PAX A;  3CQZ J;  1FWZ A;  5HLG A;  3PUF A;  3J80 Z;  1R49 A;  2MG4 A;  1TT5 B;  3G6E I;  4UUT A;  4HG2 A;  3CDL A;  4BJT A;  2NVQ J;  2LVS A;  1U8R A;  2CWE A;  2ZXI A;  1RUN A;  4BHC A;  5E1W A;  3I4P A;  1FSE A;  3EUH C;  2E1O A;  3UR3 C;  3ZN1 A;  4AIH A;  4MEY F;  3HKZ A;  2IVM A;  3SEQ A;  4KDP A;  3OV8 A;  3QYE A;  2QM3 A;  1I3A A;  4XKV A;  3LSI A;  4ZC3 A;  4CCN A;  1YW7 A;  3CCV I;  2VKE A;  5KK1 A;  4AYB A;  1VQK I;  2ESN A;  2IA0 A;  2LKX A;  2LTP A;  4ZYA A;  2BHZ A;  2P81 A;  2PG4 A;  2H6B A;  1FP1 D;  2WAE A;  2ZKZ A;  4UV9 A;  1FP2 A;  2A6H F;  1UEL B;  2F5E A;  4DJA A;  3KYL A;  4LLL A;  4KA4 A;  3GX4 X;  1W0T A;  1L3L A;  2QKL B;  1FBS A;  3AG2 H;  1MNM C;  3ZP5 A;  1LJ9 A;  4M3G A;  2OZU A;  1XGO A;  5D8K B;  3FXL A;  3REO A;  2R93 J;  2CQ7 A;  2Z16 A;  2DFH A;  2VQC A;  3K1N A;  1QA6 A;  2KIS A;  2QQ9 A;  1B72 A;  2ADU A;  2E2I J;  4BE1 A;  5D6E A;  4F93 B;  4E7L A;  5F08 A;  2TRT A;  3ZOB A;  3QAH A;  3HM5 A;  1U0J A;  2DMN A;  2Q2E A;  3AFH A;  4EJV A;  4ESF A;  2EA4 A;  1A6Q A;  2IJL A;  5DCM A;  5FKN A;  2RC4 A;  2QEN A;  2ZSH B;  4M3F A;  4E4H A;  1JHH A;  1XD7 A;  1H8A C;  2A69 F;  2WB1 N;  2ECC A;  2BY1 A;  2L3D A;  2G9W A;  4IHS A;  2HDD A;  2DBB A;  3HTS B;  5CJ9 A;  1I50 J;  3S32 A;  3K1M A;  2EFP A;  4BQN A;  2JWT A;  2Y2Z A;  2K9N A;  2Q1Z B;  4BBR J;  4UB6 C;  5BPD A;  2VN2 A;  4HQM A;  3VYR B;  2LP0 A;  4OMZ A;  1AOY A;  4BDY A;  4RGU A;  5FKK A;  2H1L A;  2FU4 A;  4EM0 B;  1MH4 A;  2CO5 A;  3BQZ A;  3IWF A;  2WY7 Q;  1QPM A;  2EV0 A;  3KP5 A;  3CJR B;  3OYA A;  4HAM A;  3BZ6 A;  3O3K A;  5H6R A;  3VEP A;  5DUI A;  3PL8 A;  3LFK A;  3WTY C;  1DPR A;  5HLI A;  4IQJ A;  1BM9 A;  4RLQ A;  3FXK A;  3GYH X;  1DQU A;  3HHH A;  1JI8 A;  5D8L B;  4UV8 A;  2NYX A;  3F8C A;  3LSJ A;  5EF6 A;  2E35 A;  2UUZ A;  4FHT A;  1NK2 P;  3HRU A;  1DGR M;  4BHP A;  1K7A A;  5M5X J;  1DU0 A;  1QZZ A;  3K4N A;  1ZTR A;  2OJE D;  3K2A A;  2WAF A;  4LG0 A;  3N97 A;  4BDZ A;  3SDG A;  1SAX A;  1JUP A;  3SZG A;  2XPV A;  3NAR A;  5IT9 Z;  4Q48 A;  3PNY A;  4ENM A;  1OCC H;  2L2O A;  1FIA A;  2E1M C;  3R60 A;  4RB3 C;  5E3N A;  3QP5 A;  5CQG A;  3F22 A;  2R0Q C;  3AG1 H;  2CQK A;  5JFR A;  3FXQ A;  1T56 A;  3EQL F;  3FX3 A;  2A07 F;  4L5I A;  1ZK8 A;  4P9F A;  1TQI A;  2L7Z A;  2VQL A;  1Z3Y A;  1O3R A;  2HGC A;  2O7O A;  1GXQ A;  3BY6 A;  4ENN A;  1UCR A;  2A6T A;  4XLF A;  1PUE E;  2LY2 A;  4N0B A;  1FOY A;  2PMZ A;  1I6X A;  3E5U A;  2VKH A;  1ZLK A;  3KZY A;  4EJO A;  1QHH D;  3CUO A;  2DJI A;  2CFX A;  4HSR A;  2M7A A;  2GM4 A;  3DKX A;  1Z6T A;  4L5J A;  3KP3 A;  4GYG A;  1GVJ A;  3E6D A;  1ITY A;  2DA5 A;  2YPR A;  2D1V A;  2IA1 A;  3NAU A;  2IGM A;  9ANT A;  1E0E A;  2X6O A;  4XRM A;  3H5A A;  1EH6 A;  3IHU A;  1SFO J;  2HTS A;  2JPB A;  4UUV A;  4XBF A;  4R8H A;  2XRL A;  3P9I A;  5DDG A;  2XAH A;  2BYV E;  4ZYD A;  4NQW B;  1EV7 A;  2QBY A;  3GFM A;  3E7L A;  2EV6 A;  1GV2 A;  3BG6 A;  2KDO A;  2G0E A;  3OYJ A;  1JTX A;  2DFF A;  3MZH A;  3ZQG A;  2O03 A;  1UHS A;  3BWG A;  3OYF A;  4WXH A;  4B8X A;  1OMI A;  1TW2 A;  2DFE A;  4DW6 A;  2VLA A;  3R6S A;  1OYY A;  3H0D A;  2XIG A;  3EYI A;  1IN8 A;  5EYR A;  1HKT A;  3G1L A;  2LK2 A;  4JX4 A;  1LB2 A;  2UXN A;  5IOZ A;  4A69 C;  1R58 A;  2L02 A;  4G6D A;  4A0X A;  4EMS A;  2HQ5 A;  2NAZ A;  4RB2 C;  1O3Q A;  4OIP F;  1IN5 A;  2GLO A;  4II3 A;  2XAG A;  4AVP A;  4GFB A;  2J5P A;  2HYG D;  3VWB A;  1BN5 A;  3ULQ B;  3IH4 A;  4NNJ A;  4HF2 A;  4FAS D;  2XRO A;  1A5J A;  1GVD A;  1S3J A;  2CSO A;  4V2G A;  1VF9 A;  2EZI A;  4E70 A;  2XUB A;  4F52 A;  1FC3 A;  3HZJ A;  1MDM B;  5C4J J;  2Y0S N;  4UVC A;  1K4T A;  4L0Y B;  2A3S A;  5LGN A;  5ERI A;  1BA5 A;  2Y75 A;  2BVL A;  1XTA A;  3AG4 H;  3I3L A;  2VC0 A;  2ZME B;  3CF5 F;  2I10 A;  2Y0M A;  4Y3O A;  3RI4 A;  2EK5 A;  1UFM A;  2GOM A;  1BW6 A;  2K9S A;  4QIW N;  1Z7U A;  3GTK J;  1TLH B;  5HS8 A;  1FBU A;  1T0F C;  3HOX J;  2ZJR F;  3EUH A;  2DOE A;  4GGG A;  3HIF A;  5LRR A;  1O7L A;  3J81 Z;  3M1C A;  3ZGK A;  2V1D A;  1U3E M;  1OYW A;  1WJA A;  2FD5 A;  2K9M A;  3W2V A;  3TW6 A;  1J2X A;  5DD4 A;  2BW3 B;  3PQK A;  5LRS A;  1H9G A;  1NH3 A;  4ZZL A;  3KET A;  3LA2 A;  4Y33 A;  1XCV A;  2F5V A;  4X0G A;  5KNL A;  4IKF A;  4C3H J;  4XSZ F;  2VJJ A;  2Y31 A;  3I59 B;  5D5X B;  3S8P A;  4U0W A;  1MZB A;  1TZL A;  5HLT A;  1I5Z A;  1R23 A;  5EGO B;  3OSG A;  1IV8 A;  1WJD A;  1A04 A;  4UNO A;  3A4C A;  4NDL A;  4YII A;  2ELK A;  1S9H A;  5E8I A;  4R79 A;  3OS2 A;  3JTH A;  1I3Q J;  1KU9 A;  3F8B A;  1R5H A;  4RAF A;  2LY9 A;  2Y69 H;  5M3F J;  3ZR8 X;  1LPQ A;  2YX4 A;  2R7F A;  4O3M A;  2QVO A;  3GTQ J;  3R0J A;  1JJ6 C;  5FKL A;  1OFC X;  4DIQ A;  2DLL A;  3K4C A;  1WI3 A;  3Q5F A;  2K40 A;  1ZHF A;  5HNH A;  1ZAR A;  3CC4 I;  2KP6 A;  4CDG A;  1REP C;  5HNF A;  1WJC A;  1NK3 P;  2LDU A;  4U0Y A;  1B9M A;  2AXT C;  3O8H A;  3OOP A;  2L4A A;  4BQQ A;  3JRG A;  3DPU A;  1XGN A;  3QP6 A;  1DUX C;  4A0Y A;  3HOW J;  3KYC B;  3DTK A;  3BJA A;  1XSD A;  1VQ8 I;  1R1T A;  1N25 A;  3H0G J;  5F0F A;  2PJP A;  2E19 A;  2WB1 A;  4ZYG A;  5L3B A;  1SFU A;  1O4X A;  1QU3 A;  4CYC B;  2BXZ A;  4I76 A;  1IRZ A;  3TOA A;  3HSR A;  4M72 A;  5GPA A;  2IAI A;  3KLO A;  4BAY A;  2P7V B;  1K6O A;  2O9L A;  2RNJ A;  3WHB A;  3RQ4 A;  4BGD A;  1WZ2 A;  1D1C A;  3BG9 A;  2QLZ A;  2P5V A;  3RIR A;  1YTY A;  5K7Z A;  1MMA A;  1S8N A;  5BPI A;  2M0C A;  5IOY A;  4A3D J;  4L9J A;  1ZR2 A;  1ZGJ A;  2R3S A;  4CO8 A;  1TNT A;  4MHG A;  3HDD A;  4LK0 F;  4CZC A;  4H4K C;  3HPH A;  3UNG C;  1S7E A;  2COB A;  2VKV A;  3RSN A;  2KRF A;  2JK3 A;  1LFP A;  4JK1 X;  3BZK A;  1W5C C;  1WPK A;  2E7W A;  3KFW X;  3HEF A;  3K4B A;  5FRN A;  2NVX J;  3E97 A;  2H8W A;  2WWY A;  5E79 C;  1IAW A;  1X3U A;  3HRT A;  2FUG 2;  2IPQ X;  2FNA A;  1ZRD A;  3IC7 A;  5E3L A;  2QCO A;  5F04 A;  2ID3 A;  4DNC A;  1X3Z B;  1F9N A;  3MKL A;  3PSI A;  4U87 A;  3CLO A;  1L0O C;  2AS5 F;  3HKZ N;  2ZNZ A;  1Y8Q B;  2EV5 A;  2TCT A;  1XMA A;  3L2V A;  1WGX A;  1FEX A;  1Z0X A;  4BL0 B;  3IP4 B;  3N4M A;  1V54 H;  3ZQI A;  4WX9 A;  2EFN A;  1D1A A;  3M8E A;  2A05 A;  4JX6 A;  2W25 A;  4XN3 A;  3CMM A;  2EIL H;  3E6B A;  1SD7 A;  4QWQ A;  2KHM A;  2XPW A;  3BC8 A;  3TMO A;  3ZQQ A;  4KNY A;  3E3V A;  2H1K A;  3G71 I;  3AKZ A;  5EEG A;  2R5Z A;  3CC7 I;  3BTJ A;  1LEA A;  2L7F P;  2VBW A;  1DPU A;  2BEO A;  1B1B A;  2K86 A;  3KZI C;  2CRG A;  5CLS A;  3MZY A;  1UHM A;  3OS0 A;  2GWR A;  2EIM H;  3LOC A;  3HOZ J;  3JRF A;  1IXR C;  3GW2 A;  1SFX A;  2ME0 A;  2XSJ C;  1MBE A;  3I64 A;  1PP7 U;  1LEB A;  4BY1 J;  1TWC J;  3BR3 A;  1LFB A;  4A0Z A;  2BZT A;  2DO7 A;  3RPQ A;  5GTH C;  3I54 A;  3DV8 A;  5H2F C;  1Z91 A;  1AKH B;  1CF7 A;  1MKM A;  1RKT A;  2EBI A;  3OYC A;  2HNH A;  3QYB A;  3WG7 H;  4OIR F;  3HOT A;  2STW A;  1PUF A;  3BP8 A;  1UST A;  1YJW I;  2XAQ A;  1UJ8 A;  3CES A;  3KIO A;  2X4H A;  3S3O A;  2Z33 A;  3IRQ A;  2K3F A;  3TO9 A;  2VOO A;  4PFO A;  2W7N A;  3DPT A;  1B72 B;  4CCL A;  3ZCO A;  3I58 A;  5E20 A;  2H09 A;  2BGC A;  3FMS A;  1BIB A;  2FE3 A;  3QQA A;  4EGZ A;  4EJW A;  4QSH A;  1ZAO A;  3KP6 A;  1B8I A;  4A3M J;  3JRI A;  1U8B A;  4I01 A;  5TRD A;  1YJ9 I;  4KIB A;  4HF1 A;  2Q2E B;  1JUS A;  1BW5 A;  4E7H A;  1SVO A;  3MQ0 A;  4YIF A;  4Z6Y A;  2VON A;  1HOM A;  2M8G X;  2W48 A;  2Y48 A;  1MMS A;  2EH3 A;  1NHA A;  3BG5 A;  2R7Q A;  3OL4 A;  1G6N A;  5H6Q A;  1VQL I;  2RV8 A;  3OYE A;  1VI0 A;  2CJJ A;  5J8C A;  3U9G A;  4PJN A;  1WH7 A;  3HJE A;  1ZGA A;  1OLT A;  1VND A;  4BKX A;  1SMT A;  2CUZ A;  5FFX A;  5DUK A;  3OY9 A;  3OSF A;  2DA2 A;  4GXO A;  4BS9 A;  2JVH A;  2CQQ A;  4CUG A;  4IOA F;  2IS1 A;  4BEH B;  2W57 A;  1LE8 A;  2HS5 A;  1AA7 A;  4EV0 A;  1BOB A;  3L1P A;  2LBF B;  1YOV B;  4CCO A;  3VSK A;  1HDD C;  2KMU A;  4A3F J;  2MH2 A;  3OYK A;  2DA6 A;  2DA4 A;  2VT2 A;  4BQA A;  4KMF A;  3F8M A;  1LVA A;  2OQG A;  4YIR X;  2IXS A;  5ICG A;  1X19 A;  2CFO A;  4CZZ A;  2ZSI B;  4UUS A;  3J80 K;  1G4D A;  2M1B A;  5E18 F;  3SZP A;  1ZR4 A;  3JRD A;  3J7A Y;  3CCE I;  3VYT B;  4LG0 B;  4PZJ A;  3HG9 A;  2HDC A;  1KYW A;  4IL6 C;  2JA5 J;  1GXP A;  3MKY B;  2VT3 A;  3FKJ A;  5J8F A;  3S15 J;  5ILS A;  2ECB A;  4G6Q A;  3SJM A;  4IX7 A;  3IL2 A;  2OCC H;  2BE5 F;  4HEA 2;  4M6Y A;  3GFJ A;  4RS8 A;  2ZXW H;  4YEL A;  1HW2 A;  1B4A A;  2XVC A;  3CZ6 A;  3IWZ A;  2FOK A;  5FLV A;  1WQ2 A;  3S1N J;  1YQA A;  2R7V A;  1R00 A;  3SEZ A;  3CJQ B;  3S2D J;  4M6V A;  4J01 A;  2XF5 A;  1RET A;  3U1D A;  2V9P A;  4ESB A;  2KQR A;  3KPH A;  2IS2 A;  2H27 A;  3FXM A;  3I4M J;  3CP2 A;  1RR7 A;  2X1E A;  1EH7 A;  1MBK A;  4IF4 A;  1ULY A;  2CV1 A;  1F5T A;  3MKZ A;  3BT9 A;  5C4X J;  3ZN0 A;  2EFW A;  1RC9 A;  3U2R A;  4XID A;  1D0Y A;  4HX7 A;  3OYG A;  5FLX Z;  3KZZ A;  4II2 A;  2QBY B;  2IS4 A;  1YW8 A;  4D0P A;  2DMP A;  3IKT A;  3J7A O;  1W7P A;  4MLO A;  3IH2 A;  2HOA A;  4RMN A;  5GAH J;  3HHG A;  3HGY A;  1X4P A;  4CGZ A;  1D1B A;  1KGS A;  2DAO A;  3PNV A;  1RPW A;  1MMD A;  5K7F A;  3BRO A;  2R7X A;  1IRX A;  3JW4 A;  2CG4 A;  2W4S A;  2HZD A;  4M3B A;  4PJL A;  2HXI A;  2HQR A;  2BVM A;  4D5C A;  4MFE A;  2LOO A;  3F8F A;  1SEU A;  4HX4 A;  1Y8R B;  2B7E A;  4RA2 A;  3HOS A;  4L0Z B;  2P5K A;  2HKX A;  1R4N B;  3H9Q A;  4A3E J;  3V4G A;  3P9C A;  4X6A J;  2OC6 A;  4UXN A;  4E7K A;  5JI6 A;  3RYP A;  1ETK A;  2HXO A;  3HXL A;  2MD5 A;  4EJT A;  2DA3 A;  4EAT A;  3HOV J;  3K0L A;  2ZNY A;  1HLV A;  2H6C A;  2L7M P;  4EQQ A;  3CLQ A;  2HPI A;  3S2W A;  1OR7 A;  1FNN A;  2CW7 A;  5F6F A;  1OCO H;  1YYV A;  3K6G A;  3Q3S A;  4RGS A;  3CCS I;  1W36 D;  3EYY A;  5E3O A;  2KZV A;  4OIQ F;  2GXB A;  4D5F A;  2CV2 A;  3CME I;  1R5G A;  3H35 A;  4O6J A;  4KN7 X;  5DCF A;  5JVG F;  1MSF C;  4KMU X;  4UHT A;  3S1M J;  2CUJ A;  2Q8K A;  2X1C A;  2QZ8 A;  1IXS B;  1SD6 A;  1ETQ A;  4HDV A;  3NEU A;  1W7P D;  2ISZ A;  2HU9 A;  3A03 A;  2XAU A;  3DEU A;  4IEJ A;  4C3J J;  5D4R A;  1KA8 A;  1UB9 A;  4YFK F;  3TDU C;  2HDW A;  1F43 A;  3QOE A;  5TIS C;  4DYQ A;  4FE4 A;  4GCV A;  4CHU A;  1G3S A;  3FBI B;  3COA C;  4OMY A;  2E36 A;  2KLO A;  5EEH A;  1Y0U A;  4B47 A;  5IT9 K;  2WY8 Q;  2M87 A;  2KZG A;  3V7C A;  1R22 A;  3U1K A;  2NS0 A;  2Y9Z A;  1BI0 A;  1S72 I;  5A2Q Z;  4I0B A;  2LF8 A;  1H88 C;  3D5L A;  1D0Z A;  3W3C A;  5HS7 A;  3TGN A;  1QHG A;  3BDD A;  1T38 A;  1VQP I;  4XN0 A;  4HNV A;  2HI3 A;  3KEY A;  1LVK A;  3AL0 C;  4HV5 A;  4E7I A;  2JZY A;  2MLK A;  3CCY A;  2QGU A;  2LD5 A;  1JKO C;  1KQ0 A;  1Y0N A;  2JSP A;  5DTD A;  3PIO F;  1X1C A;  2MSY A;  2MYS A;  4RGX A;  2KFD A;  2RRE A;  2W85 A;  3ABU A;  3B6A A;  5L3E A;  3I4N J;  1BC7 C;  3BJO A;  1Z05 A;  2X1D A;  2B0L A;  3DXJ F;  2HTJ A;  5LHH A;  1USS A;  2R7O A;  1IDZ A;  4HQE A;  3BR0 A;  3OR1 C;  4LIV A;  4GYI A;  3ZQH A;  4M6X A;  3RZD J;  2PI0 A;  2K4J A;  3GF2 A;  1WJB A;  2WV0 A;  2E7X A;  2MD0 A;  3VYS B;  3GXO A;  1VQ4 I;  1YRN A;  2K85 A;  1ODD A;  1Q1V A;  3TBI A;  4DBQ A;  2OTL I;  1YJN I;  3D1N I;  3M8F A;  2WTE A;  3WE3 A;  4LOC A;  3O6B B;  2FRH A;  2M2E A;  2O5R A;  4HPQ A;  4ASN A;  1I27 A;  3CD6 I;  4XOP A;  3ABT A;  4AUX A;  5JVT A;  3L2R A;  3CDI A;  1BJZ A;  2FNP A;  3JRA A;  2ZJQ F;  4MGR A;  2VUM J;  3LNQ A;  1HBX G;  5K5O A;  5AIP A;  3PJR A;  3CCR I;  1YW9 A;  3RKX A;  4IRG A;  2DMQ A;  3L2U A;  4MQ9 F;  1ETX A;  1UZC A;  2DDB A;  1G3W A;  2RN7 A;  2HVS A;  4V2F A;  1W0U A;  4AVZ A;  1H89 C;  5FB2 A;  2L4M A;  3M07 A;  2L01 A;  4XRF A;  4HLX A;  4UVA A;  4OU0 A;  3JSO A;  2EB7 A;  2JA7 J;  2XPU A;  3AG3 H;  3CUQ A;  3K10 A;  3DU5 A;  4HOB A;  1Z7L A;  2MBF A;  3A01 A;  5FKO A;  2AXL A;  3KEO A;  2P8T A;  1VFC A;  1P7I A;  1BC8 C;  2DTR A;  1E3P A;  3VFZ A;  2PFB A;  4IQ4 A;  3H1C A;  3ECH A;  2GZW A;  3GFL A;  2QQA A;  2E2H J;  2QSH X;  4ETS A;  2YU3 A;  3HRS A;  1QVU A;  1MW7 A;  2WC2 A;  5B5E C;  4F92 B;  3IAM 2;  1J75 A;  3NRV A;  3G1O A;  3J81 K;  3V7R A;  2XAS A;  1AHD P;  2V1N A;  2XAJ A;  3WTW C;  4BU2 A;  1TL8 A;  1FMW A;  2E1M B;  1K83 J;  2LR8 A;  3GZ6 A;  3CCL I;  1TWH J;  4UY8 I;  4F55 A;  5ILV A;  3HSE A;  5J3L A;  2F5F A;  4OIN F;  3ZXS A;  4EM1 A;  4ANJ A;  4BYY A;  2R7U A;  4XLH A;  1GLN A;  4PK4 A;  5ED4 A;  1B9N A;  2F5C A;  5FD5 A;  2O8X A;  1JKQ C;  3DEE A;  3LQR A;  4BNC A;  1KU3 A;  2M5W A;  1YG2 A;  2M34 A;  2R5Z B;  4PGH A;  3EUA A;  5IYC J;  2XKP A;  1ETW A;  4A3J J;  5KHD A;  3OYI A;  3JCU C;  1TTY A;  4BH9 A;  3CJN A;  3BQY A;  2W24 A;  1F1Z A;  3FXR A;  4R1H A;  5DM6 F;  4FTH A;  4C9Y A;  1H0M A;  2M45 A;  4KUM A;  1A31 A;  4FX4 A;  3FMR A;  3PUB A;  1R7J A;  2DN0 A;  4BHB A;  1XC5 A;  3OIO A;  5DS9 A;  2ELH A;  2ZFW A;  1UG0 A;  1WJF A;  5J4Y A;  2RQQ A;  2AO9 A;  3G1M A;  5E8G A;  2F4O B;  2JTV A;  3CO6 C;  2XHK A;  4KIF A;  3FM3 A;  2XGX A;  5F1J A;  1Y56 A;  1X1P A;  4Q4Z F;  5BMZ A;  1HDP A;  1IO2 A;  5J40 A;  4B44 A;  1HXD A;  1ORK A;  3QOD A;  2CQN A;  1RR8 C;  1MJ9 A;  1OYI A;  5CKT A;  2VL8 A;  2LY1 A;  2X0L A;  1BR2 A;  2OQR A;  4BY7 J;  2HOT A;  4YG2 F;  1IXC A;  2A6E F;  2QQB A;  4U88 A;  1MBJ A;  3E6M A;  3IH3 A;  4S0H B;  1IUY A;  2JMW A;  1H9T A;  3CMY A;  1I1G A;  3K1P A;  2TDX A;  3ZRG A;  2CQX A;  4E6K G;  1K78 A;  4HZF A;  3GTO J;  1IRG A;  1B8I B;  3JRE A;  4RLF A;  2OPT A;  2VQG A;  1O3T A;  3PFY A;  3JRH A;  3GZN B;  2M4G A;  5AIQ A;  2JT1 A;  3FIW A;  1HST A;  4HRI A;  2JA2 A;  2LNB A;  1D3Y A;  2XRN A;  1LDK B;  3M7G A;  1ZKG A;  4IHT A;  1E3H A;  2P5L C;  1RIO H;  2BV6 A;  1IN7 A;  1GT0 C;  2NVT J;  4YFN F;  3LL7 A;  4XKW A;  5DYM A;  1P2F A;  2YUS A;  4LGW A;  1RKW A;  3FK7 A;  1UMQ A;  2VE8 A;  2X6W A;  3JRC A;  1E3O C;  1YLF A;  3DF8 A;  2OU2 A;  4L9T A;  2P7C B;  4A3I J;  2HEO A;  3N05 A;  4AWX B;  4I2O A;  1OKR A;  3HOY J;  2VJ5 A;  4S04 A;  4B43 A;  2X6X A;  3OS1 A;  3ZQF A;  2FEZ A;  1F4K A;  2ISY A;  3JR9 A;  3PNT A;  1STZ A;  1U5T C;  4Y4R A;  4BQO A;  1MH3 A;  5JR3 A;  3J7Z I;  3PM1 A;  3E6C C;  4LIT A;  4MEX F;  1FTZ A;  3TKY A;  2L0K A;  1Z6R A;  2JN6 A;  4ZDL A;  3U21 A;  4Y17 A;  3FWE A;  3BJ6 A;  1DU6 A;  4NC7 A;  4CCK A;  4IHX A;  3LA3 A;  3ML6 A;  2Z1D A;  2X85 A;  3OIP A;  1PDN C;  1V5E A;  3FKI J;  2JRM A;  5D4S A;  1TQM A;  5J47 A;  1V3F A;  3SDB A;  3HUG B;  1HF0 A;  4UUS B;  5CVR A;  4L18 B;  5E1Z B;  4CCM A;  4EGY A;  4M9S A;  2VJI A;  4WF2 A;  4ZDO A;  3DP7 A;  4EM2 A;  5D5U B;  1VQ7 I;  1T98 A;  2C6Y A;  3RYR A;  1ZLJ A;  1W36 C;  2NNN A;  2PMH A;  1FOX A;  2FQ4 A;  3WTT C;  1GDT A;  3D5S C;  1MGT A;  5IPA A;  4BUP A;  2L9N A;  4ZTJ A;  1FLI A;  2BY3 A;  2FOW A;  4FX0 A;  2DJN A;  2M3A A;  5B1B H;  5GAG J;  4Y13 A;  5E17 F;  4XLC A;  3SXY A;  4YRV A;  3H9G A;  3S1Q J;  4B3A A;  4FE7 A;  1W5T A;  4IJA A;  4E7S A;  4N4O B;  2VPL A;  4OAZ A;  3K2Z A;  4WXC A;  3LFU A;  2JJ7 A;  2YSR A;  3VSL A;  4A5M A;  1PYV A;  4XLP F;  4OIO F;  4LB6 B;  2ZJ2 A;  2R4G A;  1YS7 A;  1DP7 P;  1ON2 A;  4I7H A;  1IRF A;  2A68 F;  5FRM A;  2V1X A;  2KKO A;  1X2N A;  4DZJ A;  4WK8 F;  2Z2S B;  3I55 I;  5IYD J;  4G9Y A;  3L2W A;  2ZJP F;  4KN4 X;  5IP7 J;  3WE2 A;  5LEK A;  2NVU B;  1X58 A;  1BR4 A;  3TP3 A;  4JX5 A;  4D9J A;  1OR7 C;  1P92 A;  1S7A A;  2LRD A;  1IW7 F;  4P9U A;  5LHI A;  5HOO A;  1J09 A;  1MJB A;  2QKM B;  3DBH B;  1Y6I A;  3QWL A;  2JA8 J;  2I5U A;  2Y30 A;  4FT8 A;  1HQC A;  2FML A;  5J6X A;  2R92 J;  3B6C A;  3ECO A;  2K9L A;  4P1W A;  3IV5 A;  2DQR A;  2E1N A;  1XGS A;  4XLA A;  3D5R C;  3HTU A;  3JSP A;  2X9D A;  2EZH A;  2VPR A;  3C2B A;  1P7J A;  4HST A;  4NQW A;  2IGK A;  4TV7 A;  1N75 A;  1JKP C;  2EZK A;  2DU9 A;  4F7Z A;  2FJ1 A;  2NOJ B;  2DI3 A;  1G2H A;  4XLE A;  1SFK A;  2V7F A;  4XOR A;  2MW8 A;  3E0J B;  5F27 A;  2KIF A;  3ZQC A;  3H3V K;  1LDJ A;  4G94 A;  3CDH A;  2ACJ A;  1FYK A;  2G7H A;  5IT3 A;  1FZP B;  3BR6 A;  2OD5 A;  2K5C A;  1BJA A;  2DT7 B;  5J1Y A;  1MSE C;  1U9N A;  1AU7 A;  2OZ6 A;  1MJA A;  1D5Y A;  2XC7 A;  1BBY A;  1Y39 A;  3CTA A;  3C1D A;  3PSF A;  5EDN A;  1SD5 A;  3ABK H;  3ZMZ A;  2BXY A;  2HQA A;  4BE0 A;  5HDN A;  2LFB A;  2FF4 A;  3F3X A;  1MDM A;  2B63 J;  3A2K A;  2HKO A;  1K6Y A;  4I09 A;  1BI1 A;  1XPX A;  3W6K B;  3L2Q A;  2IT0 A;  2NOG A;  1RZ4 A;  3WGI A;  1XDU A;  5FRO A;  2K4B A;  3J7Y J;  5M5W J;  1KON A;  4RBO A;  2K02 A;  2LH9 A;  4DGW B;  3F0C A;  3MZ8 A;  4FIS A;  3FHN A;  3HRM A;  4PJ0 C;  3M3Y J;  1XGM A;  1WHU A;  1YX3 A;  3MFK A;  3KCC A;  2GOX B;  2UWM A;  3V42 A;  3FXU A;  5DD8 A;  5DCM B;  3WU0 A;  5EZH A;  5JLW A;  1A6I A;  3HGG A;  3QU3 A;  2QSF X;  4P96 A;  5LD2 C;  3ZQL A;  2XSD C;  5CVI A;  2OA4 A;  5L3G A;  2DMU A;  1R4M B;  2FBI A;  1FSH A;  2FBK A;  1BI2 A;  1ZN2 A;  3H3U A;  2E5N A;  2J5O A;  4PSW A;  2HOS A;  2KPM A;  1EF4 A;  1VQN I;  4BXU A;  3OYB A;  2L5Q A;  3WHC A;  2V9V A;  3HB9 A;  2M9H A;  1FBQ A;  5EGO A;  1TC3 C;  2HVR A;  3C18 A;  5GTI C;  3LSR A;  1UAA A;  4N9H A;  4L9V A;  2UV1 A;  4AU7 A;  4EVI A;  2BHY A;  3HPG A;  2ZXH A;  2EJR A;  1J59 A;  1JUM A;  4HW0 A;  2IGN A;  2EIJ H;  2NNY A;  1W5S A;  3HBL A;  2VB6 A;  1GV5 A;  5E1X A;  4ABZ A;  3KYD B;  2XGE A;  4ZZD A;  4U7B A;  3S17 J;  2M30 A;  3QOP A;  3CUQ C;  4BJ5 C;  2VC1 A;  1YRN B;  5FLX K;  1R5I D;  2ZXJ A;  3ESW B;  2DDA A;  1WRJ A;  4IHY A;  1J5Y A;  3SZT A;  3O2P E;  3K9T A;  3LAP A;  4B3X A;  1J7K A;  2DA7 A;  1FY7 A;  2UXX A;  3Q0U A;  4M9Z A;  3RQI A;  2JQ7 A;  4Z2Y A;  4KT5 C;  4MO7 A;  3KP2 A;  3K4J A;  1TP4 A;  2EIN H;  2JVG A;  5IYB J;  1RUO A;  4G7Z F;  4MQV A;  4AIK A;  2QF7 A;  3QPS A;  1Z1D A;  4I99 C;  5BS6 A;  1WKM A;  1TWG J;  4CYC A;  3FIS A;  3G73 A;  5CPR B;  1U5T A;  5HS9 A;  3T8R A;  1ON1 A;  1FX7 A;  2DTZ A;  1OCP A;  4PGG A;  1JT6 A;  2OTJ I;  3ISP A;  1J0R A;  3ZMD A;  1SAN A;  3SFI A;  4IPA A;  3WTV C;  4W97 A;  2L9R A;  4BE2 A;  2XV4 S;  2E5Z A;  1V5G A;  2PJR A;  5FJ8 J;  3GO5 A;  3ZMV A;  3CO7 C;  3FZV A;  2IGO A;  4PCQ A;  3A01 B;  1ZGW A;  1YO5 C;  1V4R A;  5CYV A;  2P4W A;  3JAM Z;  1WWX A;  2KIM A;  2MAB A;  5CVU A;  2VOD A;  2E71 A;  1ZRE A;  4FQG A;  1WVR A;  4IRI A;  1T33 A;  2GXA A;  2W00 A;  3TP0 A;  2NRA C;  3K4K A;  4A3K J;  3RTR A;  4M9X A;  4XKC A;  3AAF A;  1HW1 A;  5BOX A;  2Q0O A;  3TQN A;  2GBY A;  1IZ1 A;  4X1E A;  1OCZ H;  3CCQ I;  3BCB A;  1LKX A;  4ZJZ A;  5A2Q K;  1ZRF A;  4LB5 A;  1OCT C;  4A3G J;  4FCY A;  2I8D A;  4PFP A;  3QRF F;  1IGN A;  4XRS A;  1A36 A;  2CMP A;  4HLY A;  5IP6 A;  2CU7 A;  2QEX I;  3C2G A;  5GPC A;  3RCO A;  4XRS G;  5CVV A;  3OYD A;  3S1R J;  1HKS A;  4G7H F;  2FBH A;  1P6R A;  4AC0 A;  3MEX A;  3MN2 A;  1YHQ I;  1W4M A;  2V1U A;  2F48 A;  3LSM A;  3LSP A;  2X48 A;  2NXN B;  2MH9 A;  3ONQ A;  3BCA A;  2Z3Y A;  3WG9 A;  1RI7 A;  2ZC2 A;  1U78 A;  4GRI A;  5TJJ A;  2ME6 A;  4HDU A;  4OWR B;  1YE9 A;  1BI3 A;  1R1V A;  2IP2 A;  1FPQ A;  1V5F A;  3A1Y A;  3BTC A;  2LRE A;  1T8I A;  4XR6 A;  1V55 H;  1PVE A;  1ERD A;  2IS6 A;  3Q9V A;  4CYD A;  1JJ8 C;  4ZYH A;  2P6T A;  3VPR A;  4Q5S F;  2V79 A;  2OUM A;  2VQH A;  4KT6 A;  3PFI A;  2JRT A;  1UHW A;  3H5N A;  1FOK A;  1AKH A;  3K4M A;  2ZO4 A;  1R71 A;  5GAD J;  3FXO A;  3IAS 2;  2PN6 A;  4KIC A;  3S16 J;  1KQ8 A;  4E7J A;  3S3M A;  1K78 B;  1RNL A;  3BPX A;  3WU1 B;  1X4O A;  2QWW A;  3BTL A;  2AQF A;  4KIG A;  5KAF C;  3BG3 A;  3LQQ A;  1APL C;  2VE9 A;  1Z67 A;  2PBI A;  3RJP A;  3V8L A;  3GFI A;  4LMY A;  4MFD A;  2ICW G;  2IA2 A;  2B9S A;  3MVP A;  2NS7 A;  4AD9 A;  4MTD A;  2DT6 A;  2DOF A;  2L7K A;  2LG4 A;  3Q0V A;  4PJM A;  3GTL J;  2OCE A;  2XF7 A;  5B66 C;  3GZ5 A;  3ZPL A;  3I71 A;  1I1S A;  2FMY A;  2AHQ A;  1B59 A;  5FO5 A;  4BJ6 C;  1LUJ B;  4LIU A;  1D0X A;  3BPV A;  4HYE A;  4CA0 A;  3CCJ I;  1K61 A;  1ZRC A;  3A0H C;  3TO6 A;  3H92 A;  3TL4 X;  3CMA I;  1GUU A;  3LWF A;  3O8G A;  2M0M A;  1IN6 A;  2DQL A;  1CQT A;  1NTC A;  2DOD A;  3LMM A;  4RAY A;  1NG6 A;  2IW5 A;  1HW5 A;  5C44 J;  1JXS A;  3LSG A;  3MWM A;  5FFZ A;  1QPI A;  5LGU A;  2IEK A;  3K7A J;  3CF2 A;  2WAD A;  4W1U A;  5EG0 A;  2P0W A;  3GUD A;  3LST A;  1K4S A;  1JTY A;  3L7W A;  4M73 A;  2RNG A;  2H8R A;  1BOA A;  1MD0 A;  2KJB A;  1KQ9 A;  2R5Y A;  2RKH A;  2PMU A;  4JQF A;  3RZO J;  1MIJ A;  3WOD F;  2K9Q A;  2DK5 A;  3CJT B;  3IKV A;  3AL0 B;  1ZYR F;  3FXJ A;  4BEH A;  5EZG A;  1Y1W J;  1QBJ A;  2NS8 A;  1FIP A; 
#chains in the Genus database with same CATH homology
 1O57 A;  1T6S A;  1P4X A;  3R61 A;  4XLN F;  5LGT A;  1TQP A;  2FQ3 A;  3QPT A;  3GVA A;  1JGS A;  1XMK A;  3ZMT A;  2STT A;  2VXZ A;  1KYZ A;  2BBY A;  3WGH A;  3F6O A;  5HDK A;  2P6S A;  3R0A A;  3DFG A;  1O7F A;  1JE8 A;  3WTX C;  3L9F A;  2ZCW A;  3EDP A;  3F23 A;  3P7N A;  2V6C A;  2D2W A;  4A2U A;  2EFQ A;  1LNW A;  5HVQ C;  4Y15 A;  1QQI A;  2CYY A;  2XAF A;  1ONV A;  1CGP A;  3RPU A;  1XDS A;  3HYI A;  4PDK A;  4MNU A;  2HQN A;  2R7D A;  3GLX A;  4KYW A;  4LFU A;  2EWN A;  3L00 A;  4K2E A;  4OOI A;  3B73 A;  4A5N A;  3F6V A;  2MC3 A;  3DPL C;  2GQQ A;  4RB0 A;  1SD4 A;  4IRH A;  2QYO A;  1XSV A;  2F5D A;  1G3T A;  3BOQ A;  2KJC A;  1G3Y A;  1TW3 A;  2EA2 A;  5JHU A;  2FA5 A;  4YFX F;  2RVC A;  2RQP A;  1D8K A;  1CF7 B;  1U6G A;  1KU2 A;  2PLY A;  4G7O F;  3MCZ A;  4RGR A;  3C7J A;  2Z99 A;  3F8N A;  4UVB A;  4EJU A;  4HV6 A;  3LA7 A;  1S29 A;  2GAU A;  4I98 B;  3DKW A;  2KIU A;  1WI9 A;  2MA3 A;  4WWC A;  1FYM A;  1SFE A;  3F21 A;  3M9A A;  4LD5 A;  3TO7 A;  3JTG A;  1YS6 A;  4IXA A;  1T2K A;  5K5Q A;  2VOP A;  2A61 A;  1ZH5 A;  1FYL A;  4ESJ A;  4U0V A;  3LAJ A;  2E1C A;  4AIJ A;  1O3S A;  1EH8 A;  5HLH A;  3SHF A;  4M74 A;  3FMQ A;  3D0S A;  4O5V A;  1P4A A;  2JSC A;  2GA2 A;  3T8T A;  2O61 A;  3FF5 A;  4QLC U;  1D5V A;  3MAJ A;  4HBL A;  5L3D A;  1XB4 A;  1DDN A;  1WSU A;  3L09 A;  4S05 A;  3SQN A;  1T39 A;  4JBA A;  2LSO A;  1D8J A;  4U7D A;  3PQJ A;  4I02 A;  1P4W A;  3B02 A;  4LLG F;  3I0T A;  3ZMS A;  1Q1H A;  2MLG A;  1U5T B;  2HOE A;  2HZT A;  3HSF A;  2UZK A;  2DFI A;  2ESH A;  3KP7 A;  2FXA A;  4ZYE A;  1VTN C;  1HSJ A;  2PEX A;  2O6G E;  5DEQ A;  1FT9 A;  3K69 A;  5ICF A;  2H94 A;  4KFC A;  5HDG A;  2D1H A;  2YR2 A;  1J9I A;  4NHJ A;  4HF0 A;  4ON0 A;  2QUF A;  1TNS A;  5DV5 A;  1R1U A;  5L3C A;  3IRR A;  3ELK A;  3ERE D;  2CGP A;  2ZBK A;  4A6E A;  1ZG1 A;  1OPC A;  2HFH A;  3QU6 A;  3G3Z A;  2FSW A;  2GA1 A;  4M71 A;  2OBP A;  1W7P B;  3KEQ A;  5BQT A;  5D5W B;  5LBQ A;  2JPC A;  2HR3 A;  2W84 A;  3FHZ A;  1ZG3 A;  3F72 A;  1S6L A;  1Z9C A;  2XKO A;  3RKY A;  3FM5 A;  2YX7 A;  3KP4 A;  4XSX F;  2EFO A;  3EET A;  4CIC A;  4LJZ F;  5K1Y A;  1ZG5 A;  3KE2 A;  1LDD A;  2Z5U A;  2D45 A;  3Q9S A;  1PP8 F;  1YFH A;  1S7O A;  1KU7 A;  4Q47 A;  4B09 A;  1K79 A;  2ETH A;  5ICE A;  3RKW A;  5LHG A;  5ILU A;  4A12 A;  3H3Z A;  1BIA A;  1IN4 A;  2L54 A;  4G8X A;  2K7L A;  2IRF G;  3WTS C;  5FD6 A;  1IF1 A;  2F2E A;  1XCB A;  2O0Y A;  2ZME A;  5CVJ A;  2PQ8 A;  3V8J A;  1XSX A;  5H20 A;  2RDP A;  3TOB A;  4N9I A;  3E5X A;  3R4K A;  1B6A A;  3I5U A;  2A5Y B;  3KLN A;  3GEZ A;  3I59 A;  1GHC A;  2VBX A;  4WCG A;  4A6D A;  1QGP A;  3JAM K;  3SFZ A;  1HKQ A;  2G7U A;  1E17 A;  4P55 A;  3VOD A;  3ROU A;  1T0F A;  1JHF A;  3T5X A;  3WTZ A;  3M1E A;  5K5R A;  2HYF A;  2K27 A;  2RGV A;  3I53 A;  1TBX A;  5AON A;  5D6F A;  4ZH4 F;  2O3F A;  2CW0 F;  2DT5 A;  1QNT A;  4LK1 F;  2GIV A;  2OAZ A;  5ICC A;  2LF7 A;  4H0E A;  4HX8 A;  5FGM A;  1AWC A;  5LEJ A;  1SMY F;  5D5V B;  4NB5 A;  3NQO A;  2HWV A;  2COM A;  5LLQ A;  3T0Y A;  2LKP A;  3P9K A;  4WXD A;  3HUG A;  2DPU A;  5F1R A;  3V8K A;  4CXF A;  3CUQ B;  5F64 A;  3VB2 A;  3V7S A;  4I0A A;  3WTU C;  2DPD A;  1QZY A;  3C3W A;  3T1B A;  1C0W A;  5KVR A;  3DQV C;  3VOE A;  4L9N A;  2M8E A;  3QPH A;  1U2W A;  3GWZ A;  4P5O A;  3ZMU A;  4RB1 A;  1XN7 A;  3W6J B;  2Z9O A;  3E5Q A;  1R36 A;  4MTE A;  1YIO A;  1E2X A;  1QO0 D;  3ZQ7 A;  2GXG A;  4RAZ A;  3TDZ C;  4DQ2 A;  4ENJ A;  2DW4 A;  2VBZ A;  5L3F A;  4HA8 A;  3RDI A;  4LLN A;  4ENK A;  4IVN A;  3WGG A;  3L2C A;  4GO1 A;  1LQ1 A;  2VBY A;  2DK8 A;  6PAX A;  5HLG A;  1FWZ A;  3J80 Z;  1U8R A;  2CWE A;  1RUN A;  4BHC A;  5E1W A;  3I4P A;  1FSE A;  3ZN1 A;  4AIH A;  4MEY F;  2IVM A;  4KDP A;  3OV8 A;  2QM3 A;  1YW7 A;  5KK1 A;  2ESN A;  2IA0 A;  2PG4 A;  2H6B A;  1FP1 D;  2ZKZ A;  4UV9 A;  1FP2 A;  2A6H F;  2F5E A;  4KA4 A;  4LLL A;  3GX4 X;  1L3L A;  1FBS A;  3ZP5 A;  1LJ9 A;  2OZU A;  1XGO A;  5D8K B;  3REO A;  3K1N A;  2QQ9 A;  2ADU A;  5D6E A;  3QAH A;  2Q2E A;  4ESF A;  4EJV A;  2EA4 A;  2IJL A;  5DCM A;  2RC4 A;  2QEN A;  1JHH A;  1XD7 A;  2A69 F;  2L3D A;  2G9W A;  4IHS A;  2DBB A;  3HTS B;  5CJ9 A;  3K1M A;  2EFP A;  5BPD A;  2VN2 A;  4HQM A;  4OMZ A;  1AOY A;  4RGU A;  2FU4 A;  4EM0 B;  2CO5 A;  3IWF A;  1QPM A;  2EV0 A;  3KP5 A;  4HAM A;  3BZ6 A;  3O3K A;  5H6R A;  3VEP A;  5DUI A;  3LFK A;  3WTY C;  1DPR A;  5HLI A;  1BM9 A;  3GYH X;  3HHH A;  5D8L B;  4UV8 A;  2NYX A;  3F8C A;  4FHT A;  3HRU A;  4BHP A;  1K7A A;  1QZZ A;  4LG0 A;  3N97 A;  1SAX A;  5IT9 Z;  4Q48 A;  4ENM A;  3R60 A;  4RB3 C;  3QP5 A;  3F22 A;  2CQK A;  5JFR A;  3FXQ A;  3EQL F;  3FX3 A;  2A07 F;  4L5I A;  4P9F A;  1TQI A;  1O3R A;  2HGC A;  1GXQ A;  3BY6 A;  4ENN A;  1UCR A;  1PUE E;  4N0B A;  1I6X A;  3E5U A;  1ZLK A;  3KZY A;  4EJO A;  3CUO A;  2CFX A;  1Z6T A;  4L5J A;  3KP3 A;  4GYG A;  1GVJ A;  3E6D A;  2YPR A;  2D1V A;  2IA1 A;  1EH6 A;  3IHU A;  2HTS A;  2JPB A;  4UUV A;  4XBF A;  4R8H A;  3P9I A;  5DDG A;  2XAH A;  2BYV E;  4ZYD A;  2QBY A;  1EV7 A;  3GFM A;  2EV6 A;  3MZH A;  2O03 A;  3BWG A;  4WXH A;  4B8X A;  1OMI A;  1TW2 A;  3R6S A;  1OYY A;  2XIG A;  3EYI A;  1IN8 A;  1HKT A;  1LB2 A;  2UXN A;  1R58 A;  2L02 A;  4G6D A;  4A0X A;  4EMS A;  2NAZ A;  4RB2 C;  1O3Q A;  4OIP F;  1IN5 A;  2XAG A;  4AVP A;  2J5P A;  2HYG D;  1BN5 A;  3ULQ B;  4HF2 A;  2XRO A;  1S3J A;  2CSO A;  4E70 A;  2XUB A;  1FC3 A;  1MDM B;  4UVC A;  4L0Y B;  2A3S A;  5LGN A;  5ERI A;  2Y75 A;  2VC0 A;  2ZME B;  2Y0M A;  3RI4 A;  2EK5 A;  1UFM A;  1Z7U A;  1TLH B;  5HS8 A;  1FBU A;  3EUH A;  4GGG A;  3HIF A;  5LRR A;  1O7L A;  3J81 Z;  2V1D A;  1U3E M;  1OYW A;  1J2X A;  5DD4 A;  3PQK A;  5LRS A;  1H9G A;  4ZZL A;  3KET A;  3LA2 A;  1XCV A;  4XSZ F;  3I59 B;  5D5X B;  4U0W A;  1MZB A;  1I5Z A;  1R23 A;  1A04 A;  4UNO A;  4YII A;  5E8I A;  4R79 A;  3JTH A;  1KU9 A;  3F8B A;  1R5H A;  2YX4 A;  2R7F A;  4O3M A;  2QVO A;  3R0J A;  2DLL A;  3Q5F A;  1ZHF A;  1ZAR A;  4CDG A;  1REP C;  2LDU A;  4U0Y A;  1B9M A;  3OOP A;  2L4A A;  1XGN A;  3QP6 A;  1DUX C;  4A0Y A;  3BJA A;  1XSD A;  1R1T A;  2PJP A;  4ZYG A;  5L3B A;  1SFU A;  3TOA A;  3HSR A;  4M72 A;  3KLO A;  4BAY A;  2P7V B;  1K6O A;  2RNJ A;  2QLZ A;  2P5V A;  3RIR A;  1YTY A;  1S8N A;  5BPI A;  4L9J A;  1ZGJ A;  2R3S A;  4CO8 A;  1TNT A;  4MHG A;  4LK0 F;  2KRF A;  4JK1 X;  3KFW X;  2E7W A;  3E97 A;  2WWY A;  1IAW A;  1X3U A;  3HRT A;  2IPQ X;  2FNA A;  1ZRD A;  3IC7 A;  4DNC A;  1F9N A;  3CLO A;  1L0O C;  2AS5 F;  2ZNZ A;  2EV5 A;  1XMA A;  3N4M A;  4WX9 A;  2EFN A;  3M8E A;  2W25 A;  3E6B A;  1SD7 A;  4QWQ A;  4KNY A;  3E3V A;  5EEG A;  1LEA A;  2VBW A;  1DPU A;  2BEO A;  1B1B A;  2K86 A;  5CLS A;  3MZY A;  1UHM A;  2GWR A;  1IXR C;  3GW2 A;  1SFX A;  1PP7 U;  3I64 A;  1LEB A;  4A0Z A;  2DO7 A;  3RPQ A;  3I54 A;  3DV8 A;  1Z91 A;  1CF7 A;  1MKM A;  4OIR F;  3HOT A;  2STW A;  3BP8 A;  1UST A;  2XAQ A;  2X4H A;  2Z33 A;  3IRQ A;  3TO9 A;  2VOO A;  3DPT A;  3I58 A;  5E20 A;  2H09 A;  2BGC A;  3FMS A;  1BIB A;  2FE3 A;  4EGZ A;  4EJW A;  1ZAO A;  3KP6 A;  4I01 A;  5TRD A;  4KIB A;  4HF1 A;  3MQ0 A;  4YIF A;  2VON A;  2Y48 A;  1NHA A;  1G6N A;  5H6Q A;  2RV8 A;  5J8C A;  3U9G A;  1ZGA A;  1SMT A;  5FFX A;  5DUK A;  4GXO A;  2W57 A;  2HS5 A;  4EV0 A;  2MH2 A;  4BQA A;  2VT2 A;  4KMF A;  3F8M A;  1LVA A;  2OQG A;  5ICG A;  4CZZ A;  3J80 K;  1G4D A;  2M1B A;  5E18 F;  3SZP A;  4LG0 B;  4PZJ A;  2HDC A;  1KYW A;  1GXP A;  2VT3 A;  5J8F A;  5ILS A;  4G6Q A;  3IL2 A;  2BE5 F;  4M6Y A;  3GFJ A;  4RS8 A;  1HW2 A;  1B4A A;  2XVC A;  3IWZ A;  2FOK A;  1WQ2 A;  1YQA A;  1R00 A;  3U1D A;  4ESB A;  2H27 A;  1EH7 A;  4IF4 A;  1ULY A;  1F5T A;  3ZN0 A;  2EFW A;  3U2R A;  4HX7 A;  5FLX Z;  3KZZ A;  2QBY B;  1YW8 A;  4D0P A;  3IKT A;  3J7A O;  1W7P A;  3HHG A;  4CGZ A;  1KGS A;  2DAO A;  3BRO A;  3JW4 A;  2CG4 A;  2HQR A;  3F8F A;  4HX4 A;  3HOS A;  4L0Z B;  2P5K A;  2HKX A;  3V4G A;  3P9C A;  4UXN A;  5JI6 A;  3RYP A;  2MD5 A;  4EJT A;  3K0L A;  2ZNY A;  2H6C A;  4EQQ A;  3S2W A;  1OR7 A;  1FNN A;  5F6F A;  1YYV A;  4RGS A;  3EYY A;  4OIQ F;  2GXB A;  1R5G A;  5DCF A;  4O6J A;  4KN7 X;  4KMU X;  4UHT A;  2Q8K A;  2QZ8 A;  1IXS B;  1SD6 A;  4HDV A;  3NEU A;  1W7P D;  2ISZ A;  3DEU A;  5D4R A;  1KA8 A;  1UB9 A;  4YFK F;  3TDU C;  4CHU A;  4OMY A;  4GCV A;  1G3S A;  3COA C;  5EEH A;  1Y0U A;  5IT9 K;  2M87 A;  3V7C A;  1R22 A;  2NS0 A;  1BI0 A;  5A2Q Z;  4I0B A;  2LF8 A;  3D5L A;  5HS7 A;  3TGN A;  1T38 A;  3BDD A;  4HV5 A;  2JZY A;  2MLK A;  1KQ0 A;  4RGX A;  2W85 A;  3ABU A;  5L3E A;  1BC7 C;  3BJO A;  1Z05 A;  2B0L A;  3DXJ F;  2HTJ A;  5LHH A;  1USS A;  4HQE A;  4GYI A;  4M6X A;  2PI0 A;  2K4J A;  3GF2 A;  2WV0 A;  2E7X A;  3GXO A;  1ODD A;  3M8F A;  2WTE A;  3WE3 A;  3O6B B;  2FRH A;  4ASN A;  1I27 A;  5JVT A;  3ABT A;  2FNP A;  4MGR A;  1HBX G;  5K5O A;  5AIP A;  1YW9 A;  3RKX A;  4IRG A;  4MQ9 F;  1G3W A;  2RN7 A;  5FB2 A;  2L4M A;  2L01 A;  4XRF A;  4HLX A;  4UVA A;  4OU0 A;  3JSO A;  2EB7 A;  3CUQ A;  4HOB A;  2MBF A;  2AXL A;  3KEO A;  2P8T A;  1BC8 C;  2DTR A;  3VFZ A;  2PFB A;  3ECH A;  2GZW A;  3GFL A;  2QQA A;  4ETS A;  2YU3 A;  3HRS A;  2WC2 A;  1J75 A;  3NRV A;  3J81 K;  3V7R A;  2XAS A;  2XAJ A;  3WTW C;  3GZ6 A;  5ILV A;  3HSE A;  4OIN F;  2F5F A;  4EM1 A;  4BYY A;  5ED4 A;  1B9N A;  2F5C A;  5FD5 A;  2O8X A;  3LQR A;  4BNC A;  1KU3 A;  2M5W A;  1YG2 A;  4PGH A;  2XKP A;  1TTY A;  4BH9 A;  3CJN A;  2W24 A;  1F1Z A;  3FXR A;  4R1H A;  1H0M A;  2M45 A;  4KUM A;  4FX4 A;  3FMR A;  4BHB A;  1R7J A;  2ELH A;  2ZFW A;  5E8G A;  2JTV A;  3CO6 C;  2XHK A;  4KIF A;  3FM3 A;  2XGX A;  4Q4Z F;  5BMZ A;  1HXD A;  1MJ9 A;  1OYI A;  2X0L A;  2OQR A;  4YG2 F;  1IXC A;  2A6E F;  2QQB A;  4U88 A;  3E6M A;  1IUY A;  1H9T A;  1I1G A;  3K1P A;  2TDX A;  1K78 A;  4HZF A;  1IRG A;  1O3T A;  5AIQ A;  2JT1 A;  1HST A;  2LNB A;  1D3Y A;  2XRN A;  1LDK B;  3M7G A;  4IHT A;  2P5L C;  1RIO H;  2BV6 A;  1IN7 A;  4YFN F;  5DYM A;  1P2F A;  4LGW A;  2VE8 A;  1YLF A;  3DF8 A;  2OU2 A;  4L9T A;  2P7C B;  2HEO A;  4AWX B;  4I2O A;  1OKR A;  4S04 A;  1F4K A;  2FEZ A;  2ISY A;  1STZ A;  1U5T C;  5JR3 A;  3E6C C;  4MEX F;  3TKY A;  1Z6R A;  4Y17 A;  3FWE A;  3BJ6 A;  3LA3 A;  3ML6 A;  1PDN C;  5D4S A;  1TQM A;  1V3F A;  5CVR A;  4L18 B;  5E1Z B;  4EGY A;  4M9S A;  4WF2 A;  3DP7 A;  4EM2 A;  5D5U B;  1T98 A;  2C6Y A;  3RYR A;  1ZLJ A;  2NNN A;  2PMH A;  3WTT C;  1MGT A;  1FLI A;  4FX0 A;  4Y13 A;  5E17 F;  3SXY A;  1W5T A;  4IJA A;  3K2Z A;  4WXC A;  2YSR A;  4A5M A;  4XLP F;  4OIO F;  4LB6 B;  2ZJ2 A;  1YS7 A;  1DP7 P;  1ON2 A;  4I7H A;  1IRF A;  2A68 F;  2V1X A;  2KKO A;  4WK8 F;  4G9Y A;  4KN4 X;  3WE2 A;  5LEK A;  1P92 A;  1S7A A;  1IW7 F;  4P9U A;  5LHI A;  5HOO A;  1MJB A;  4FT8 A;  1HQC A;  2FML A;  5J6X A;  3ECO A;  2DQR A;  2E1N A;  1XGS A;  3HTU A;  3JSP A;  4NQW A;  4TV7 A;  2DU9 A;  4F7Z A;  2DI3 A;  2KIF A;  1LDJ A;  4G94 A;  3CDH A;  2ACJ A;  1FYK A;  2G7H A;  5IT3 A;  1FZP B;  2OD5 A;  1BJA A;  2OZ6 A;  1MJA A;  1BBY A;  3CTA A;  3C1D A;  1SD5 A;  3ZMZ A;  5HDN A;  2FF4 A;  3F3X A;  1MDM A;  2HKO A;  4I09 A;  1BI1 A;  3W6K B;  2IT0 A;  1RZ4 A;  3WGI A;  1XDU A;  2K4B A;  2K02 A;  3HRM A;  1XGM A;  3MFK A;  3KCC A;  2UWM A;  3FXU A;  5DD8 A;  5DCM B;  3WU0 A;  3QU3 A;  4P96 A;  5CVI A;  2OA4 A;  5L3G A;  2FBI A;  1FSH A;  2FBK A;  1BI2 A;  1ZN2 A;  3H3U A;  2J5O A;  4BXU A;  2V9V A;  1FBQ A;  3C18 A;  4N9H A;  4L9V A;  4EVI A;  2EJR A;  1J59 A;  4HW0 A;  2NNY A;  1W5S A;  5E1X A;  4ZZD A;  4U7B A;  2M30 A;  3QOP A;  3CUQ C;  2VC1 A;  5FLX K;  2ZXJ A;  1WRJ A;  1J5Y A;  3SZT A;  3O2P E;  3K9T A;  3LAP A;  1J7K A;  1FY7 A;  2UXX A;  4M9Z A;  4Z2Y A;  4KT5 C;  3KP2 A;  1RUO A;  4G7Z F;  4MQV A;  4AIK A;  1Z1D A;  5BS6 A;  1WKM A;  3G73 A;  1U5T A;  5HS9 A;  3T8R A;  1ON1 A;  1FX7 A;  4PGG A;  3ISP A;  1J0R A;  3ZMD A;  4IPA A;  3WTV C;  2XV4 S;  3GO5 A;  3ZMV A;  3CO7 C;  3FZV A;  4PCQ A;  1YO5 C;  1V4R A;  5CYV A;  2P4W A;  3JAM Z;  1WWX A;  2KIM A;  5CVU A;  2VOD A;  1ZRE A;  4IRI A;  2NRA C;  3RTR A;  4M9X A;  3AAF A;  1HW1 A;  5BOX A;  2Q0O A;  3TQN A;  1IZ1 A;  5A2Q K;  1ZRF A;  4LB5 A;  3QRF F;  4HLY A;  5CVV A;  1HKS A;  4G7H F;  2FBH A;  1P6R A;  3MEX A;  1W4M A;  2V1U A;  2MH9 A;  2Z3Y A;  3WG9 A;  1RI7 A;  1U78 A;  5TJJ A;  4HDU A;  1BI3 A;  1R1V A;  2IP2 A;  1FPQ A;  3Q9V A;  4CYD A;  4ZYH A;  2P6T A;  4Q5S F;  2V79 A;  3PFI A;  2JRT A;  1UHW A;  1FOK A;  2ZO4 A;  2PN6 A;  4KIC A;  1KQ8 A;  1K78 B;  1RNL A;  3BPX A;  3WU1 B;  2QWW A;  4KIG A;  3LQQ A;  2VE9 A;  2PBI A;  3RJP A;  3GFI A;  3V8L A;  4LMY A;  2IA2 A;  4AD9 A;  4MTD A;  3GZ5 A;  3ZPL A;  3I71 A;  1I1S A;  2FMY A;  1B59 A;  5FO5 A;  3BPV A;  4HYE A;  1ZRC A;  3TO6 A;  3H92 A;  3LWF A;  1IN6 A;  2DQL A;  4RAY A;  2IW5 A;  1HW5 A;  1JXS A;  3MWM A;  5FFZ A;  5LGU A;  3GUD A;  3LST A;  3L7W A;  4M73 A;  1BOA A;  1MD0 A;  2KJB A;  1KQ9 A;  2RKH A;  2PMU A;  4JQF A;  3WOD F;  2DK5 A;  3IKV A;  1ZYR F;  1QBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...