1K79A

Ets-1(331-440)+ggaa duplex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
104
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*AP*AP*TP*GP*T)-3')
total genus 36
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k79A00
4KIBA 4OOIA 5H20A 3JSPA 2W85A 5HOOA 4YIIA 3WU0A 4IXAA 1H0MA 2W24A 5D5WB 4AWXB 1I6XA 1U78A 1MJ9A 2D1VA 3QOPA 3I53A 1YQAA 4D0PA 3RYPA 2XKPA 2HDCA 5LRSA 4ZYHA 2XAJA 3ZMZA 2CSOA 3IRRA 4GGGA 2OBPA 5FGMA 3LA7A 1BC7C 5JR3A 2P5VA 1I1GA 5BS6A 5CVRA 1X3UA 4MEXF 1MJBA 5AIQA 4EGYA 4NB5A 5FLXK 3GXOA 1IW7F 4IHSA 4ENMA 2JZYA 4H0EA 5JI6A 3IKVA 1PDNC 1XD7A 1UB9A 3BDDA 3HSEA 4KUMA 3WTXC 4WK8F 1ZAOA 2F5DA 2HR3A 3JTHA 1FT9A 2D1HA 5K5RA 4HF2A 5LHHA 2Q2EA 1STZA 5D6EA 5CVVA 3W6JB 2O0YA 3ZN1A 3F21A 1XCVA 3CUQC 5CVUA 1KU9A 2ESNA 4WWCA 1IN6A 3CO6C 4YIFA 2K7LA 3JW4A 1T0FA 3L2CA 4G6DA 4HLYA 2F5FA 3SXYA 2LF7A 4JK1X 4Y17A 2HYFA 1W7PA 1ZGJA 1J5YA 4EM2A 2ISZA 1ZLKA 5KK1A 1U5TA 3GEZA 2DO7A 2XAHA 5CLSA 1PP7U 4LB6B 4A0ZA 1YIOA 2GIVA 4RGXA 1JHFA 3LA2A 4HDUA 1B59A 5JVTA 3U9GA 1B9MA 2AXLA 1ZG1A 2OQRA 1XB4A 5DDGA 5DD4A 3K1MA 1DPUA 3FMSA 3ECOA 5A2QZ 3EYIA 3DEUA 3K0LA 1XSDA 2X0LA 1LEBA 3KLOA 4OMYA 2P5KA 2E7WA 2H27A 4HOBA 2FU4A 2EV5A 1I1SA 2MC3A 3RKXA 3TDUC 4FT8A 3V7SA 3MAJA 4ZYEA 2K4BA 1EH8A 5DD8A 1K78B 2M30A 5TJJA 1GXPA 3GFMA 1LDDA 2FOKA 1S7OA 2DI3A 1BIAA 2XV4S 1YTYA 4BH9A 2KIMA 4HX4A 1XDUA 4LLGF 3CUQA 5FLXZ 4BHCA 5HS7A 4NHJA 4L9TA 3F22A 1PP8F 2A68F 1R00A 4PZJA 4EJTA 1R1VA 1F4KA 1TQIA 2E1CA 2GWRA 3WTTC 2NNYA 3RYRA 2YPRA 3E5XA 4BQAA 3LQRA 4B8XA 3E5UA 4LLLA 2G7HA 3F8FA 3ISPA 4B09A 2O03A 3BJOA 3MQ0A 2Z3YA 4QWQA 3E6BA 1MD0A 5F1RA 1TLHB 2HZTA 3KP4A 2PMUA 5LLQA 3MWMA 3AAFA 1IN8A 1LQ1A 1IF1A 3SZTA 1ZRFA 3FX3A 2P6TA 4EGZA 2Q0OA 1XGMA 3LA3A 5ILSA 1S8NA 1WRJA 2Y0MA 2VC0A 3VOEA 4A0XA 1BJAA 5BMZA 5E20A 3ELKA 2DFIA 4LG0B 3NQOA 2GXBA 2ZBKA 1FLIA 5LHIA 1V3FA 3I71A 3WTWC 3BROA 3P7NA 3DV8A 3SFZA 3E5QA 3KP7A 2F5EA 2ZCWA 2VBZA 3RI4A 2STTA 4AIKA 1FSEA 1IRGA 1KU7A 3I0TA 1ONVA 3DQVC 3RPQA 1KGSA 2OZ6A 4ENNA 4ESJA 3HHGA 3MFKA 3C1DA 4HF0A 1P4AA 2LNBA 3NEUA 3GFIA 2BGCA 1R36A 1WSUA 5FD5A 1IZ1A 3IL2A 3HRTA 4UXNA 4O3MA 1K7AA 1XDSA 2KIUA 1OYYA 2DU9A 5FB2A 1SMTA 1J0RA 3C3WA 1HKQA 5TRDA 2FMYA 1H9TA 3T0YA 2YSRA 2RN7A 2XGXA 3HRSA 3ZMSA 1DP7P 1J75A 1XGOA 1YLFA 1JE8A 1BI1A 4FHTA 4I0BA 3J81Z 3ULQB 4RB1A 2VBWA 4LG0A 1HW5A 4CICA 4HQEA 3I4PA 1HSJA 3ZMVA 1XGNA 4I09A 4PDKA 3GZ5A 3TQNA 1KQ0A 4ZZLA 1IXCA 4WXDA 3ABTA 1B4AA 5KVRA 2IJLA 4KFCA 1W5SA 4M71A 2QQAA 1EH7A 5HDKA 1HW1A 1K6OA 4KMFA 3M7GA 5D5VB 3TOAA 3MEXA 2FBKA 5ED4A 5CYVA 1RI7A 5D8KB 5AIPA 4I02A 1YW7A 1WQ2A 4R79A 2FNPA 3TOBA 1KYWA 4KMUX 3LAPA 4I98B 4Q5SF 4O6JA 4UVAA 3HSRA 2KRFA 5DUKA 2VT2A 1D8KA 2CWEA 1R1TA 1MDMB 5CJ9A 2QWWA 2LKPA 4MTEA 2V6CA 1V4RA 3ABUA 5LGUA 2OU2A 4BNCA 3F8CA 1W4MA 3IKTA 3K1NA 2D45A 3RJPA 3QPHA 4RGRA 4A0YA 3TGNA 4LB5A 1T6SA 2L4AA 3QU6A 3QU3A 5HLHA 2NAZA 1ZARA 2O61A 3WE2A 4CZZA 1TW2A 2CO5A 4I7HA 5L3DA 2FSWA 3FMRA 1XMAA 2XROA 3W6KB 5E18F 3O6BB 3GWZA 2QM3A 4EVIA 2E1NA 1MGTA 3Q9SA 5DCFA 5E8IA 4EQQA 1KU2A 5L3FA 2DT5A 1U5TC 2PJPA 2L54A 4XSXF 3F6OA 2ETHA 5E8GA 1P2FA 2G7UA 1BN5A 4KYWA 2EA2A 2IA1A 1FYMA 1IAWA 1ZRDA 2PMHA 4L9JA 3ZMDA 4MEYF 1O3RA 1TTYA 3R0AA 4R1HA 4JBAA 3RPUA 3WTYC 1KYZA 4EJOA 4OIOF 3DPLC 2PI0A 4LGWA 2BYVE 2WWYA 2STWA 1LEAA 3F72A 1IN5A 1U6GA 4P96A 4RB0A 4LK0F 4M6XA 2QLZA 3D5LA 1TBXA 3GFLA 1FNNA 1ON1A 3F8NA 4FX0A 2KJCA 1E17A 3TKYA 4MHGA 1R22A 2QBYB 3DFGA 4OIPF 1SFUA 3HTSB 4MGRA 3KP6A 3M8EA 1KQ9A 1W7PB 4YG2F 4TV7A 2NRAC 3B73A 1DDNA 4WXCA 1L0OC 4ZYDA 2QQBA 2JRTA 3TDZC 3QP5A 3DPTA 4YFXF 1Z6RA 1I5ZA 3WGHA 3DKWA 2EJRA 2D2WA 2CYYA 2YX4A 3F23A 4XLPF 2P5LC 3SZPA 4HV6A 4GYIA 2WC2A 1YO5C 1XMKA 2YU3A 3BZ6A 5IT9Z 3GF2A 2F5CA 3IC7A 1OMIA 5D5UB 3WTVC 1A04A 1FC3A 3H92A 2P8TA 4PGGA 2MH2A 5LRRA 3E6DA 1FSHA 4HBLA 1EH6A 4P5OA 2JT1A 2IRFG 3ERED 1ZG3A 2XVCA 3KZYA 2VONA 3L9FA 2HKXA 4G9YA 2DQLA 4KICA 2MLGA 3K1PA 3SHFA 2ZFWA 1ZYRF 2PBIA 3CUQB 3BJ6A 5FFXA 1G6NA 2GQQA 4RAYA 1O7FA 4M74A 3LSTA 4RGSA 3IRQA 5E1WA 2HEOA 5DEQA 1MDMA 4YFKF 3ZMTA 5D4RA 1TNSA 1FBSA 1HKSA 3J81K 2O6GE 4HDVA 2QENA 4OIQF 2EWNA 4MNUA 1FYLA 3ECHA 2A6EF 2VBXA 2K27A 2CG4A 1IN4A 2UXNA 1HXDA 3T1BA 3FF5A 2EFOA 2EV0A 3EUHA 4UVCA 1LJ9A 1WI9A 2Z5UA 2MLKA 2MA3A 1B1BA 4K2EA 5ICFA 2DQRA 2RGVA 5LBQA 2Z33A 3M9AA 2M1BA 4GYGA 2RKHA 5IT3A 4ENJA 1UCRA 4N9HA 2OD5A 1SD5A 3KEOA 1D8JA 5DUIA 2HGCA 2DLLA 1R5GA 2FA5A 2G9WA 2R3SA 2LF8A 4A12A 2VT3A 4BHPA 4WF2A 1UHMA 3WE3A 2XASA 3C18A 2QQ9A 3KE2A 4KIGA 3N97A 3GO5A 4DQ2A 2DBBA 1FOKA 4Z2YA 2VE8A 5FO5A 2Z99A 3EQLF 2ELHA 5LHGA 4BAYA 4XSZF 4HX8A 2C6YA 1EV7A 4KN7X 1ZHFA 2L01A 1BC8C 2COMA 3U1DA 1FWZA 1T98A 2FEZA 2XAFA 2ZMEB 1QNTA 3KETA 2ZNZA 2V9VA 1UFMA 3C7JA 3R6SA 4QLCU 3MZHA 5HDNA 1O7LA 5BPDA 4GCVA 4CDGA 3FM3A 3I5UA 3COAC 4EJWA 2HTJA 2RC4A 3VEPA 1QZZA 4ENKA 4CHUA 5ILUA 3DF8A 1USSA 5CVJA 1T39A 4EJUA 1O3SA 1ZG5A 3QP6A 1BBYA 5FFZA 2QUFA 1SD7A 2YR2A 1ULYA 2FBHA 2KIFA 1ODDA 5BPIA 2L02A 1D5VA 1O3QA 2L4MA 4LMYA 2JPCA 4P55A 1HBXG 3QAHA 2FQ3A 4UUVA 2VXZA 1XSXA 3FM5A 3R4KA 4ESBA 4CGZA 2H94A 3QPTA 4A2UA 4HQMA 1ZLJA 5E17F 1U2WA 1GVJA 4BYYA 4BXUA 3REOA 3HHHA 3G73A 5K5QA 1JHHA 2A07F 5F6FA 2ZO4A 5D8LB 1Z9CA 1JGSA 2ZJ2A 3HSFA 2FRHA 3WTSC 3O3KA 2XUBA 1ZREA 1R23A 2KJBA 2R7FA 1FY7A 3VODA 1B6AA 1BI3A 2A3SA 4U0YA 2RQPA 3KEQA 1YW9A 2FF4A 5J6XA 4M6YA 4PCQA 3CTAA 1IUYA 4KIFA 2EK5A 1YW8A 1Z05A 1GHCA 3HRUA 5K5OA 5J8FA 2OA4A 2YX7A 2P4WA 2OQGA 4KT5C 2K86A 1IXRC 5K1YA 2J5OA 2F2EA 3WODF 5L3BA 2ESHA 1DUXC 2H6CA 4ETSA 1W5TA 1DPRA 1FX7A 4E70A 4EM0B 3R60A 4F7ZA 3JAMZ 1KU3A 1QZYA 2W25A 1T38A 1S7AA 2O3FA 5IT9K 4I01A 4NQWA 4XLNF 2HTSA 3E6CC 1FYKA 2JSCA 4UVBA 1YFHA 3T8RA 2CW0F 3KZZA 2VC1A 1BIBA 2DAOA 4HX7A 1HQCA 2O8XA 4L5JA 2VN2A 1E2XA 1F5TA 1YS6A 1TQPA 1R58A 4IF4A 2EB7A 3LFKA 1ZH5A 1AOYA 4GO1A 3RKWA 4ASNA 2EA4A 3RIRA 3HIFA 2NYXA 5HVQC 5EEGA 1P6RA 1TQMA 1RIOH 5D4SA 1P4WA 3GFJA 3J80Z 3MCZA 3I58A 3BOQA 5CVIA 1XN7A 4IRHA 5D5XB 1D3YA 3F3XA 5DCMA 4G8XA 3ZN0A 3KCCA 1IN7A 3FHZA 2XAGA 2EFPA 2DPUA 2M45A 2BEOA 5ERIA 3IWZA 3E6MA 2RV8A 4A5MA 4UV8A 2V79A 3WU1B 2QYOA 2WTEA 3J80K 2X4HA 1G3YA 4HA8A 3ZPLA 3GW2A 2VODA 5LEJA 1Z91A 2HOEA 4XBFA 2FNAA 4Y13A 1WWXA 2HQNA 4AIHA 3T8TA 5BOXA 1F1ZA 1LNWA 3CLOA 4JQFA 3VB2A 5D6FA 1YYVA 4P9FA 4Q4ZF 3GUDA 4AVPA 4A6EA 4HAMA 3CO7C 4YFNF 4M9ZA 3FXUA 4OMZA 1FPQA 2WV0A 2DW4A 6PAXA 1LDKB 1XSVA 2W57A 3I54A 4IPAA 4LD5A 2K02A 2M5WA 2HQRA 1BI0A 3BP8A 4FX4A 5H6RA 2VOPA 4IHTA 5DCMB 3HYIA 2QZ8A 1Z1DA 2GA1A 2PQ8A 2PLYA 4ZZDA 1QGPA 3V4GA 2V1UA 1C0WA 3L09A 4RAZA 5ICGA 1HKTA 4KDPA 3KP3A 4OIRF 1JXSA 1F9NA 3IWFA 1VTNC 4HF1A 1USTA 4CYDA 1IXSB 2RDPA 3DXJF 1QQIA 4DNCA 1RNLA 3K69A 3MZYA 4IVNA 1FP1D 2CFXA 3BPXA 2IA0A 3M8FA 3WTZA 3V8LA 1J2XA 1XGSA 1S29A 1S6LA 1YS7A 3I64A 3JSOA 3RTRA 3N4MA 3U2RA 3R0JA 4Q48A 4U0VA 2A5YB 2AS5F 3CDHA 1BM9A 2LDUA 4PGHA 3WGIA 1WKMA 4I0AA 1CF7A 4R8HA 3HOSA 3V8JA 1RZ4A 2BBYA 1REPC 4L18B 3H3UA 4G7HF 3HUGA 1SAXA 2NNNA 4UHTA 2ZNYA 3R61A 3K9TA 2P6SA 2PEXA 1PUEE 1AWCA 4HLXA 4N0BA 1S3JA 2IT0A 4HZFA 1RUOA 2PN6A 2P7VB 2XHKA 3ZQ7A 2FE3A 3EDPA 4LLNA 2IA2A 3V7CA 3KP5A 1SMYF 2OZUA 2IVMA 1G3WA 3DP7A 4GXOA 2MH9A 5HDGA 1ON2A 1OYWA 2DK8A 3L00A 2DTRA 2XKOA 2HYGD 3BY6A 2DK5A 2RNJA 1FP2A 1J7KA 2UXXA 1MZBA 3J7AO 1BOAA 5DV5A 4ZYGA 1H9GA 4WXHA 5BQTA 1HW2A 1LB2A 1T2KA 2A6HF 4EM1A 3V8KA 1IRFA 3WTUC 4O5VA 3ZMUA 1I27A 4L9VA 3EYYA 5FD6A 2FMLA 2UWMA 2RVCA 2VE9A 3EETA 1RUNA 2VOOA 3RKYA 3I59A 4U7BA 5DYMA 2GAUA 2K4JA 3NRVA 1MJAA 4UNOA 3PFIA 1O57A 4RGUA 5F64A 4KN4X 2HFHA 4UV9A 5HLIA 1MKMA 2V1DA 4Y15A 2OAZA 5LEKA 3TO9A 4WX9A 2GXGA 1OYIA 2EV6A 1BI2A 2NS0A 5JHUA 3QRFF 4M9XA 3M1EA 4U0WA 3T5XA 3LQQA 1R1UA 4P9UA 4I2OA 3GLXA 5HS9A 2FXAA 4XRFA 3CJNA 3CUOA 3GZ6A 4AIJA 5L3EA 1B9NA 2J5PA 3D0SA 2JPBA 3OOPA 3ZP5A 2H09A 1U3EM 5AONA 4G7ZF 1OR7A 3ROUA 5ILVA 5L3GA 4HV5A 3FMQA 4MTDA 3JAMK 4IRIA 2R7DA 3K2ZA 1ZRCA 1KA8A 2QBYA 1YG2A 5J8CA 4KNYA 3F6VA 4HW0A 5LGNA 2M87A 2CQKA 1SFEA 2A69F 1HSTA 3WGGA 4A5NA 4ESFA 1QPMA 3JTGA 2FBIA 3LWFA 1TW3A 5H6QA 2TDXA 1FZPB 4S05A 1G3TA 1G3SA 3E3VA 3GVAA 3B02A 3LAJA 3PQJA 1ZGAA 2DPDA 1O3TA 2VBYA 4ON0A 3S2WA 3FXRA 4AD9A 4CXFA 2ZXJA 1W7PD 1J9IA 5HS8A 3GYHX 3BPVA 1SD6A 1GXQA 4G94A 4WCGA 2Y75A 2QVOA 4G7OF 3FZVA 1SFXA 4KA4A 4L5IA 5HLGA 4LK1F 3BWGA 4ZH4F 3TO6A 1QO0D 2IPQX 4EMSA 5JFRA 3HOTA 3GX4X 2Y48A 2HKOA 2Q8KA 2A61A 4EJVA 2ADUA 4HYEA 2BE5F 5EEHA 3FWEA 4G6QA 2V1XA 3V7RA 2ISYA 3F8BA 4MQ9F 2HWVA 1SD4A 2BV6A 4N9IA 4RS8A 5A2QK 1L3LA 4L0YB 4L0ZB 4U7DA 1K79A 2L3DA 1CF7B 4M72A 2ZMEA 4IJAA 2XRNA 2GZWA 3KLNA 2PFBA 1FBQA 4L9NA 3L7WA 2HS5A 2IW5A 5LGTA 2XIGA 1Q1HA 3ML6A 2PG4A 4LFUA 3H3ZA 3WG9A 1Z6TA 2Z9OA 3TO7A 3O2PE 4A6DA 2GA2A 1U5TB 1CGPA 1J59A 3G3ZA 1P4XA 2EFQA 4MQVA 3KP2A 4S04A 3RDIA 1XCBA 1U8RA 2UZKA 4RB3C 2P7CB 3P9IA 1OKRA 2XAQA 3P9CA 1LDJA 3IHUA 2JTVA 2M8EA 3E97A 2ZKZA 3FXQA 2KKOA 2W84A 2B0LA 4EV0A 3Q9VA 4Q47A 2MBFA 2EFNA 3KFWX 1QBJA 1TNTA 3SQNA 1R7JA 4IRGA 1LVAA 3I59B 1KQ8A 1NHAA 3Q5FA 4LJZF 3P9KA 1FBUA 1UHWA 1Y0UA 4M9SA 1K78A 3PQKA 2IP2A 5L3CA 3HTUA 3VFZA 3OV8A 5ICEA 4RB2C 2MD5A 2CGPA 1Z7UA 2EFWA 1G4DA 3HRMA 4OU0A 5E1ZB 2H6BA 1ZN2A 2LSOA 1R5HA 4BHBA 4CO8A 1P92A 2E7XA 4M73A 4OINF 2ACJA 4U88A 5E1XA 5ICCA 3F8MA 3BJAA 1OPCA
chains in the Genus database with same CATH superfamily
5F08A 4KIBA 1D0XA 4KITB 1ORKA 2YUSA 2DDAA 2IS4A 4OOIA 4UUTA 4DW6A 5H20A 2NOJB 2QEXI 3JSPA 2W85A 1JI8A 5CPRB 5HOOA 2E2HJ 4IOAF 3VYTB 4YIIA 3WU0A 4IXAA 1EA3A 2O9LA 1DU6A 1H0MA 3FXJA 1OCRH 2W24A 4IX7A 1W0UA 5D5WB 1W36D 4AWXB 1I6XA 4HSRA 4DJAA 1U78A 1MJ9A 2D1VA 3QOPA 2PMZA 3PL8A 3CC2I 3I53A 1YQAA 4D0PA 1P7JA 3RYPA 4J00A 3ZQCA 1KONA 1ACIA 2XKPA 2HDCA 1V5GA 5LRSA 4BXXJ 4ZYHA 2XAJA 3ZMZA 2A5WA 2MFZA 2CSOA 3FXMA 3IRRA 1WZ2A 3OSFA 3MKYB 1PUFA 3KPHA 2ZJRF 4GGGA 2WY7Q 2OBPA 5FGMA 2Q2EB 1RKTA 3LA7A 3Q0UA 3ZR8X 2JSPA 2DFHA 3D5SC 2P5VA 5JR3A 1BC7C 1YX3A 1I1GA 3N05A 1ZTRA 5BS6A 3FBIB 2DXIA 3RSNA 4F93B 5CVRA 2KZVA 1X3UA 3Q0VA 2LY1A 1O4XA 3WHCA 4MEXF 3LSJA 1MJBA 5AIQA 3CP2A 4EGYA 4NB5A 2LYCA 3GXOA 5C4XJ 1IW7F 3OYNA 5FLXK 4IHSA 4MFEA 3W2WA 4ENMA 4ZDOA 2JZYA 4QPQA 5JI6A 4H0EA 3IKVA 1PDNC 1XD7A 4XKWA 4FISA 1UB9A 2Y9ZA 4IKFA 3I4MJ 3BDDA 2K3FA 1T0FC 3HM5A 3HSEA 4KUMA 1JUPA 4B4CA 3WTXC 4WK8F 5KAFC 4A3EJ 1XPXA 1ZAOA 2F5DA 5IP6A 5EF6A 2HR3A 4HEA2 3H1CA 1SEUA 1MMNA 4RDUA 3QQAA 1GLNA 3JTHA 1FT9A 2D1HA 4V19K 5K5RA 2X1DA 3VSKA 1X2NA 3M3YJ 4PJ0C 4HF2A 5LHHA 2Q2EA 4ZJZA 1STZA 3ZGKA 5D6EA 4V2GA 5CVVA 3W6JB 3GZNB 1GUUA 4U87A 3I3LA 2FX0A 2WY8Q 3OMYA 2O0YA 1HDPA 3ZN1A 2HPMA 4JX4A 3OYKA 1LFUP 3KYCB 1K83J 2R7QA 3FISA 3F21A 1XCVA 3CUQC 5CVUA 3ZCOA 1KU9A 2VIXA 4II3A 2ESNA 2GIZA 2CQ7A 3CMMA 1H89C 4IHWA 4WWCA 4E7JA 2CUFA 1IN6A 3CO6C 4YIFA 2K7LA 3JW4A 1OFCX 1JUSA 1T0FA 3L2CA 4G6DA 1LE8B 4HLYA 1MMDA 2CUJA 2L9SA 4YRVA 3L2VA 2HZDA 2F5FA 4FE7A 1JKRC 1VQ9I 2X48A 5IOYA 3OL3A 4NDLA 2LF7A 4JK1X 3SXYA 4Y17A 2L7FP 1IV8A 3ZQQA 2HYFA 3CCUI 1W7PA 2DOAA 1ZGJA 1E3HA 1J5YA 2IS1A 4EM2A 5GPCA 5M5XJ 4BL0B 2IS6A 1B8IB 4RAGA 2ISZA 4C30A 1MSEC 3K70D 4FETA 5KK1A 3U1KA 1U5TA 1ZLKA 3GEZA 1N75A 2XSJC 2DO7A 1TZLA 2DODA 2XAHA 1MMAA 5FJ8J 3AG3H 1S72I 5CLSA 1PP7U 5KAIC 4LB6B 4A0ZA 3ZXSA 1YIOA 2GIVA 2R7XA 4RGXA 1JHFA 2XF5A 3LA2A 4G12A 2V4JC 4KT6A 4HDUA 3PO2J 1Z77A 1B59A 3ZQGA 4A3MJ 5JVTA 3U9GA 2EZIA 2PJRB 1B9MA 1X1PA 2K85A 3TP3A 3J7ZI 2AXLA 4ITVA 1ZG1A 2OQRA 3UR3C 1FIAA 4GFBA 1XB4A 5DDGA 5DD4A 3K1MA 1FOXA 2R7OA 1X2MA 1DPUA 3FMSA 2B9SA 1X1BA 4A3FJ 1LE8A 3ECOA 2KT0A 4AC0A 1BA5A 5A2QZ 1DGWY 3EYIA 2YS9A 2LBFA 3DEUA 3EUHC 3K0LA 4P1WA 5FROA 4A3BJ 1XSDA 2X0LA 3H9GA 2M0MA 1LEBA 5IYCJ 3QOEA 3KLOA 3OYBA 1R9TJ 5K7ZA 4OMYA 3OOUA 1WPKA 2P5KA 2E7WA 3J7AY 1YRNB 1VNDA 2HPIA 1W0TA 4LIUA 4HOBA 2FU4A 2LP0A 2H27A 1SFOJ 2EV5A 2IBDA 1I1SA 2MC3A 3RKXA 3TDUC 4FT8A 3P5JA 3V7SA 2FOWA 4F92B 1AKHB 3MAJA 3S1NJ 2ID6A 4ZYEA 2HYJA 2K4BA 1EH8A 2IGOA 5DD8A 3JRHA 1K78B 3PJRA 2M30A 5FKLA 5TJJA 3G6EI 1NH3A 1GXPA 3H5NA 3GFMA 1LDDA 2FOKA 4RLFA 1S7OA 1Z21A 2DI3A 1BIAA 2XV4S 3BQZA 3LSIA 1YTYA 4BH9A 2KIMA 4HX4A 3A02A 1XDUA 4IZZA 4LLGF 3CUQA 3ERMA 4D1QA 5FLXZ 4D7MA 1T95A 4BHCA 4AYBA 1WGXA 2YU9J 2OTLI 5HS7A 5GAGJ 4Z6YA 4NHJA 2KL4A 1Y8RB 4L9TA 3F22A 1PP8F 2A68F 1R00A 3C2BA 4PZJA 3A01B 4EJTA 1R1VA 1F4KA 1TQIA 2M7AA 1FJLA 2E1CA 2GWRA 2W1OA 1DP3A 2V9PA 1AA7A 5TGTA 3VYUB 3WTTC 2HVQA 3BQYA 1ZR4A 2W4SA 3RYRA 2NNYA 2YPRA 3E5XA 3SDBA 4BQAA 3LQRA 1Y1VJ 4B8XA 3E5UA 4LLLA 2G7HA 3F8FA 3ISPA 4B09A 1H88C 1HDDC 5HLTA 2GOMA 2O03A 5FLVA 3IH3A 3BJOA 1V54H 2Z3YA 3MQ0A 4QWQA 5GAEJ 5DM7F 3E6BA 2HXIA 4B3AA 3ESWB 1MH3A 1MD0A 2DTZA 1TLHB 5F1RA 2HZTA 2HOTA 3KP4A 4E6KG 2PMUA 5LLQA 3MWMA 2MW8A 3AAFA 1IN8A 3W3CA 3HGGA 2GLOA 2WADA 1IC8A 1LQ1A 2M4GA 1IF1A 1A6IA 3IH2A 3SZTA 1ZRFA 4JYKA 4JP0A 3FX3A 1Y6IA 4ZDLA 4PFOA 4JX5A 2P6TA 4XMYA 4EGZA 2Q0OA 3FXKA 1XGMA 3LA3A 1RC9A 5ILSA 1S8NA 1WRJA 2Y0MA 2VC0A 3VOEA 4A0XA 3S1MJ 1BJAA 5BMZA 3CLQA 1R6RA 5E20A 3ELKA 2DFIA 4LG0B 3NQOA 2GXBA 2ZBKA 1AKHA 3GLLA 1FLIA 5LHIA 4C9YA 1V3FA 4BBRJ 3I71A 2KRHA 4H4KC 3SEZA 3WTWC 3BR3A 3BROA 1ZR2A 3P7NA 3DV8A 5F1JA 3SFZA 3E5QA 3KP7A 3FK7A 2V26A 2CW8A 2F5EA 3LL7A 3WU2C 2ZCWA 1VQ7I 2VBZA 3RI4A 2STTA 3FXOA 3JRIA 4AIKA 1FSEA 2JK3A 2PMZN 2G0EA 2M34A 2LLKA 3K6GA 1B72A 1IRGA 1KU7A 2BXZA 3I0TA 1ONVA 1AHDP 3DQVC 3MZ8A 3RPQA 1KGSA 2OZ6A 4ENNA 3H5AA 4ESJA 1QHHD 2RAEA 2R5YA 3HHGA 4J19A 3MFKA 3C1DA 4HF0A 2P0WA 3OS0A 2KIQA 2CQQA 2EZLA 4HNUA 2Y2ZA 1P4AA 3MD2A 1FTTA 2LNBA 3M4OJ 2Y0SN 3NEUA 3GFIA 2ZMEC 4IHVA 3LSGA 4RA2A 4BUPA 2BGCA 1R36A 2E34A 1WSUA 4CYCB 2L2OA 5FD5A 1IZ1A 4EEFG 3IL2A 3DEEA 3DU6A 3HRTA 4UXNA 4O3MA 3C2GA 2Y30A 1K7AA 1XDSA 2KIUA 4XLCA 1OYYA 1VQMI 1Z0XA 2RQQA 2DU9A 5FB2A 4I99C 2DA4A 3UKGA 2BOLA 1SMTA 5CQGA 1J0RA 3C3WA 1HKQA 4IQ4A 5TRDA 2FMYA 4C3HJ 1JJ8C 1H9TA 3DU5A 3T0YA 2VJ4A 2DA6A 2YSRA 2B7EA 2RN7A 2XGXA 3CCLI 1ZQ3P 3HRSA 4CCKA 2LBFB 3ZMSA 5FKNA 2DDBA 1DP7P 1J75A 5IP7J 3RQIA 1XGOA 4DOZA 1IDYA 1YLFA 1JE8A 1HLVA 1BI1A 4FHTA 2Z16A 4D7NA 5B3SH 4I0BA 3J81Z 2HDDA 3CCEI 3ULQB 3OYEA 2ELKA 4RB1A 1S5LC 1UZCA 2VBWA 3IUOA 4LG0A 4IQJA 2NS7A 4C2UA 1HW5A 2D5VA 2DA2A 4CICA 1ENHA 3DBLB 2HQAA 4HQEA 1APLC 4Y7NJ 2PX9A 1HSJA 1MH4A 3I4PA 5KNLA 1W36C 3BLYA 4QSHA 2Z1DA 3ZMVA 2JQ7A 2I5UA 2I10A 2OF7A 1E0EA 1XGNA 4UY8I 1OCTC 4I09A 4PDKA 3GZ5A 3TQNA 1KQ0A 2FQ4A 4ZZLA 1IXCA 1A5JA 4WXDA 3LOCA 3ZQFA 3ABTA 4BACA 1B4AA 3BCAA 5KVRA 4AUXA 2IJLA 2QGUA 4KFCA 1W5SA 4M71A 2MABA 4RAFA 1ETWA 3HOZJ 1X4PA 2QQAA 3H35A 4IHXA 2DMTA 2DYSH 1MMSA 2GOXB 1EH7A 4RM2A 2RREA 5J1RA 2NVQJ 4A93J 3GTQJ 1OCOH 4RM3A 2R5YB 3S3NA 4XLHA 3VWBA 5HDKA 1HW1A 1K6OA 3CD6I 2Z2SB 4BXFA 4KMFA 3M7GA 5D5VB 1TWAJ 1VQ6I 1U9OA 2CH0A 2Y9YA 4OAYA 3MEXA 2FBKA 3TOAA 5ED4A 5CYVA 1A31A 1Z67A 4AVZA 1RI7A 5D8KB 5AIPA 2LH9A 2MD0A 1VF9A 4I02A 1YW7A 4BBSJ 3QWLA 1WQ2A 1TWFJ 3BZCA 2V6EA 1Y56A 4R79A 2FNPA 5LD2C 3CCSI 1FMWA 5GTIC 3TOBA 1KYWA 4KMUX 2DA7A 3LAPA 4I98B 3GMEA 4Q5SF 3DBHB 4CCLA 4O6JA 5IYDJ 1OQYA 2LKXA 1FIPA 4UVAA 5JLXA 3HSRA 1ETYA 3PUFA 2NVTJ 2KRFA 4BKXA 5DUKA 2VT2A 1D8KA 4B43A 2CWEA 1R1TA 5B5EC 1QHGA 4CCOA 2VB6A 3LSRA 4XICA 1MDMB 5CJ9A 2QWWA 2LKPA 4XN0A 4MTEA 2V6CA 3EPZA 1V4RA 3PFYA 2NVUB 3ABUA 1LFBA 2XSDC 1D0ZA 5LGUA 3BG9A 2KDOA 2OU2A 3IP4B 4BNCA 3OYDA 3ABMH 4C3IJ 2VQHA 1W4MA 3BG5A 3F8CA 3IKTA 3K1NA 2JA8J 2D45A 3RJPA 3QPHA 4RGRA 4DZJA 4A0YA 3ZQHA 2OC6A 2M8GX 3TGNA 4LB5A 2DT6A 1T6SA 2L4AA 3QU6A 3QU3A 5HLHA 5GP9A 3BG7A 1QVUA 2NAZA 3TP0A 1ZARA 2W48A 2DCEA 2ZFUA 2O61A 3V42A 5KHDA 3WE2A 4CZZA 1TW2A 4M3DA 2CO5A 4I7HA 5L3DA 1D0YA 2FSWA 5F0CA 5GTHC 3QODA 1Y0NA 3FMRA 2BVMA 1XMAA 4S0HB 2K9QA 2XROA 2UV1A 3W2AA 3W6KB 4NQWB 4W97A 2R7SA 1T56A 5E18F 3CJQB 3O6BB 3CCQI 3GWZA 2QM3A 1LUJB 4EVIA 1SAUA 3CCYA 2CW7A 4LG3A 2E1NA 1MGTA 2F4OB 4N4NB 1GT0C 3IH4A 3Q9SA 4IO9F 5IPAA 5DCFA 5E8IA 3TL4X 4EQQA 1KU2A 2R5ZA 3D5RC 3LSMA 5L3FA 5FRMA 2DT5A 1U5TC 3KIOA 2PJPA 2L54A 4XSXF 2P81A 4XRMA 3F6OA 2ETHA 4C3JJ 2H8RA 5E8GA 1P2FA 2G7UA 5M3FJ 1BN5A 3S8PA 3CJTB 1X1DA 2XC7A 3BCBA 4KYWA 4XONA 2EA2A 2IA1A 4OWRB 1FYMA 1IAWA 4XIDA 5J4VA 1ZRDA 3D1NI 5EGOA 2PMHA 3MVPA 4L9JA 3ZMDA 2DJNA 4MEYF 4F3QA 3G2BA 3CDIA 1TTYA 5K7HA 1O3RA 3R0AA 4I6ZA 4R1HA 4JBAA 3RPUA 3X2QH 1OISA 3WTYC 1KYZA 4EJOA 3CMAI 4OIOF 2LR8A 3DPLC 2PI0A 4LGWA 2BYVE 2WWYA 2STWA 1LEAA 3F72A 1IN5A 1U6GA 4P96A 4RB0A 1FOWA 1B72B 2B63J 1OR7C 4LK0F 2QSGX 4M6XA 3CCMI 1E3OC 2ID3A 2QLZA 3OR2C 4ANJA 3D5LA 3HXLA 1TBXA 3GFLA 1FNNA 1S7EA 1ON1A 1WI3A 3F8NA 4FX0A 2X9DA 2KJCA 4RBOA 1E17A 1YJNI 3GTOJ 4NC8A 3TKYA 4M3EA 1Z7LA 2W00A 4MHGA 1R22A 4PFPA 2MSYA 2K3PA 2QBYB 3DFGA 4OIPF 3SEQA 2NS8A 1QRYA 1SFUA 3BR1A 4FTHA 1UG2A 2DA3A 4MGRA 3JRGA 3KP6A 3M8EA 2CV1A 3GBGA 4CCMA 3HTSB 2E71A 1IO2A 3KEYA 1YX5A 3CQZJ 1KQ9A 1W7PB 4A3LJ 4YG2F 4TV7A 3G1LA 2NRAC 1E3PA 4XN3A 4PJMA 4AU7A 2VJIA 3B73A 3H5RA 1DDNA 3OIQA 4WXCA 1L0OC 2XB0X 4BE0A 1YI2I 3FXLA 2K40A 4ZYDA 2QQBA 4LIVA 2JRTA 3TDZC 4C2TA 2JA2A 3QP5A 3DPTA 4QIWN 4YFXF 1Z6RA 1I5ZA 2DN0A 3WGHA 4BQQA 3FDYA 5DS9A 3DKWA 1MIJA 2EJRA 2ECBA 3NARA 4ZC3A 4FQGA 2D2WA 2CYYA 1MNEA 2ME6A 2IGMA 2OPTA 2YX4A 4DYRA 3F23A 4XLPF 3JRBA 2QCOA 3LMMA 3S2DJ 3IAM2 1QZEA 2P5LC 3SZPA 4HV6A 2ZSIB 4IOCF 4GYIA 2R7RA 2DA1A 2VKDA 2WC2A 1YO5C 3OYGA 1XMKA 2YU3A 3BZ6A 5IT9Z 3GF2A 3KX2A 3OYJA 2A6TA 3MKLA 1TT0A 2F5CA 3IC7A 1FEXA 1MBKA 3RCOA 3OIOA 4B3XA 3I4NJ 3OYFA 1OMIA 3B6CA 4V2FA 5D5UB 1A04A 1FC3A 4JOMA 2QF7A 4DGWB 3WTVC 5IY5H 2BY1A 2WB1N 4PK4A 4A3JJ 3H92A 1WCMJ 2P8TA 1VI0A 1JUMA 4PGGA 2MH2A 5LRRA 3E6DA 1FSHA 1EJ9A 1VQNI 4HBLA 1EH6A 4P5OA 4FE4A 1XTAA 2JT1A 2IRFG 2JUGA 3ERED 1DGRM 1ZG3A 2XVCA 2DJIA 3CMEI 3KZYA 2VONA 3L9FA 3S32A 3AFHA 2HKXA 3OYMA 4G9YA 2DQLA 4KICA 2MLGA 2ZC2A 4XOTA 4C2MJ 3K1PA 3SHFA 2ZB9A 2ZFWA 1ZYRF 4XRSG 2PBIA 3CUQB 3FKJA 4D5CA 3BJ6A 2JWTA 5FFXA 1G6NA 3HGYA 2GQQA 2W82A 2O7OA 4NC6A 5EJCA 4RAYA 1O7FA 1YOVB 4M74A 1TWHJ 1XX5A 4QPOA 4YELA 3S2HJ 3PNVA 1V5EA 3ZQLA 3LSTA 4RGSA 3IRQA 5E1WA 1OJLA 3HKZA 2HEOA 5DEQA 1MDMA 5E3OA 1M1EB 1XC5A 4YFKF 3ZMTA 1A6QA 4CCNA 2IEKA 5D4RA 1NK3P 5IYBJ 1HF0A 4UB8C 2CUZA 2NOGA 4MLOA 1P9QC 1TNSA 1FBSA 1HKSA 3J81K 2O6GE 4BJTA 4XR6A 2IGKA 4HDVA 2DFEA 2QENA 4OIQF 2EWNA 4MNUA 5F0FA 4OAZA 3JRDA 5J40A 2WV1A 1FYLA 5E79C 2X6WA 1WJ5A 2OJED 4IEJA 1XG1A 2A6EF 2VBXA 3ECHA 4BY7J 2K27A 3VSLA 2LKSA 3RKQA 1A35A 3TW7A 1PJRA 2CG4A 1IN4A 1HCRA 2UXNA 3K10A 1HXDA 1TT5B 3T1BA 3FF5A 1X1AA 4W1UA 2XPUA 2EFOA 2EV0A 4BDZA 3EUHA 5DTDA 4UVCA 1LJ9A 1WI9A 2JVGA 3A0HC 2Z5UA 4AYBN 3SJMA 2E60A 2MLKA 1ZK8A 1OCCH 2HI3A 3MKZA 2MA3A 3DKYA 1B1BA 1MBFA 3DBRB 4K2EA 2QSHX 5ICFA 3JR9A 2DQRA 2RGVA 2KZGA 5LBQA 2MC4A 2CMPA 3QPLA 2Z33A 2EZKA 3M9AA 2M1BA 4GYGA 1R4NB 2RKHA 5IT3A 1K4SA 4ENJA 1UCRA 4N9HA 2R92J 1VQPI 2OD5A 2OV7A 1SD5A 3KEOA 2FUG2 1D8JA 5DUIA 1T8IA 4NBQA 1WVRA 3OWTA 2HGCA 3HJEA 5M3MJ 4KISA 1F43A 2ME0A 4F91B 1WJBA 2DLLA 1R5GA 2BXYA 2FA5A 2QKLB 5FLMJ 1WHUA 2G9WA 2XF6A 3OS2A 2R3SA 2LF8A 4A12A 2VT3A 2X6XA 4BHPA 4WF2A 1ZELA 3TMOA 1UHMA 2V7FA 2KQRA 2HVSA 2BZTA 1UG0A 3PNYA 2VJ5A 3WE3A 2XASA 2VQGA 1SANA 3C18A 3BR2A 3OYLA 2QQ9A 3KE2A 4KIGA 3N97A 2IGNA 3GO5A 2EPFA 2F4IA 4DQ2A 2DBBA 1FOKA 4Z2YA 2VE8A 3S15J 2BVLA 2IAIA 4BEHB 2VPRA 3EUKL 5FO5A 2Z99A 3EQLF 2ELHA 5LHGA 4BAYA 4XSZF 1VQ5I 4HX8A 2C6YA 1EV7A 4KN7X 1VZ0A 1ZHFA 2L01A 5J1UA 2EIKH 5K7FA 3PSFA 3QYBA 1BC8C 2COMA 4JX6A 4E7IA 3U1DA 1FWZA 1T98A 1OCZH 3MMYB 4Y33A 2VXDA 2FEZA 2XAFA 2ZMEB 3H0DA 1QNTA 4II2A 4M3BA 3KETA 1I3QJ 2V9VA 2ZNZA 3GTJJ 1UFMA 2QSFX 3C7JA 3HL2A 3R6SA 4DYQA 4QLCU 3MZHA 4HRIA 1W1WE 3NWSA 5HDNA 1O7LA 4J01A 5BPDA 3ZOBA 4GCVA 4CDGA 3FM3A 3I5UA 3PIOF 1UJ8A 3COAC 2OCCH 4EJWA 2HTJA 2JN6A 4E7SA 2RC4A 4UB6C 3IV5A 3VEPA 1QZZA 1VQOI 3CF2A 4ENKA 1Y39A 5ILUA 3JCUC 4DBQA 4CHUA 1HOMA 3DF8A 3ZRGA 1F36A 1USSA 5CVJA 1T39A 2HU9A 4EJUA 1O3SA 5IOZA 3WHBA 5E3MA 1ZG5A 3QP6A 3HBLA 1BBYA 2L7MP 4CZCA 5FFZA 2QUFA 3H9JA 1SD7A 3OY9A 3GTPJ 1U8BA 2COBA 1XS9A 2YR2A 2BY3A 2R7VA 1ULYA 2FBHA 3K7AJ 4CUGA 1IUFA 3ABLH 3G4SI 2KIFA 1JKPC 4BU2A 1ODDA 5BPIA 4BQOA 2L02A 1D5VA 1O3QA 1ETKA 2CQXA 2L4MA 4X0GA 5E3LA 5JVGF 1PVEA 1FOYA 4LMYA 3OSGA 2JPCA 3VDXA 4P55A 1LPQA 1QPIA 2NXNB 1U0JA 1HBXG 3QAHA 1JKOC 2FQ3A 4XK4A 4UUVA 4QTRA 2VXZA 1XSXA 5DM6F 3HOVJ 1ZGWA 3FM5A 1NK2P 3O8GA 2E35A 3BG6A 2DOFA 3R4KA 4ESBA 4CGZA 2H94A 3CP8A 3QPTA 3HOUJ 4E7ZA 2QQ8A 2LMDA 2XGEA 4B1RA 4A3IJ 4A2UA 4HQMA 4MIMA 2K9MA 1ZLJA 3LSPA 4NC7A 5E17F 1U2WA 4D9JA 3BTJA 3SZGA 1GVJA 2KFDA 4BYYA 4BXUA 1N77A 4ZTFA 2K9NA 3K4KA 3B6AA 3REOA 3HHHA 4PSXA 1K61A 1YJ9I 1RR8C 3G73A 5K5QA 1VQLI 1JHHA 2A07F 5F6FA 2FD5A 4L5EA 2QKMB 2ZO4A 5D8LB 3WG7H 1N25A 3S17J 1MBHA 2VQLA 1Z9CA 1JGSA 1GV5A 2ZJ2A 3HSFA 2FRHA 3WTSC 3O3KA 1YHQI 2XB5A 2E1OA 3AKZA 1TC3C 2PJRA 2HDWA 2XUBA 1ZREA 1RRJA 2R7FA 2KJBA 1R23A 2AQEA 1FY7A 1B6AA 3VODA 1BI3A 2A3SA 2CFOA 4U0YA 2L7KA 3AG4H 3UNGC 2RQPA 3KEQA 1YW9A 4XLEA 2FF4A 5J6XA 4BE2A 4M6YA 4PCQA 3CTAA 1IUYA 4KIFA 2EK5A 2JA6J 2LY2A 2R7ZJ 5EZHA 1YW8A 1Z05A 3AG1H 1NG6A 1GHCA 3HRUA 3C2HA 5K5OA 5J8FA 3BTIA 3DTKA 2OA4A 1BR4A 3ASNH 3AL0B 2YX7A 5H2FC 3CZ6A 2P4WA 2EIJH 2OQGA 2Y69H 4KT5C 4GDFA 1BJZA 2LOOA 2K86A 1IXRC 3FHNA 3DLAA 5K1YA 2X1EA 2J5OA 2F2EA 3WODF 2NVXJ 5L3BA 2ESHA 1DUXC 2H6CA 1JJ6C 1YRNA 1JT6A 4ETSA 1W5TA 2VASA 4XORA 1DPRA 5C44J 1MBGA 2KPMA 1FX7A 2JVHA 4E70A 4EM0B 1X3WB 3R60A 1WJDA 5TISC 4F7ZA 3JAMZ 1KU3A 3JRAA 1QZYA 2A05A 2W25A 1BW6A 1LVKA 1T38A 1S7AA 2WB1A 3LSHA 4DBRA 2O3FA 5IT9K 3G1OA 4I01A 4NQWA 3W6VA 4AIDA 1FTZA 4XLNF 2HTSA 3E6CC 1FYKA 2JSCA 4UVBA 4XOPA 1YFHA 1ITYA 3T8RA 3K4CA 2CW0F 1WJAA 3KZZA 2VC1A 5FKMA 1BIBA 2E5NA 2DAOA 3L2UA 4HX7A 1HQCA 2O8XA 2LREA 1TWCJ 3A03A 2E1MB 1V55H 4L5JA 2VN2A 3VYSB 3GTMJ 1E2XA 1F5TA 2HNHA 1YS6A 3CF5F 1TQPA 1R58A 4IF4A 1IV6A 1R49A 2EB7A 1FMVA 3LFKA 1ZH5A 3S93A 1AOYA 2XPVA 4GO1A 4YEJA 3RKWA 4ASNA 2EA4A 3RIRA 1TL8A 3HIFA 3RQ4A 1QVTA 2NYXA 5EEGA 5HVQC 1P6RA 1TQMA 1VFCA 4XKBA 1RIOH 5D4SA 1P4WA 4I76A 2VPLA 3BTLA 1NTCA 4PSWA 3HG9A 3GFJA 3J80Z 3MCZA 3I58A 3BOQA 3S1RJ 2KLOA 5CVIA 2LTPA 1XN7A 2X85A 4IRHA 1MMGA 5D5XB 5M5WJ 2BY2A 1Y1WJ 3TEDA 1D3YA 1X1CA 1D1AA 4DZPA 3F3XA 1KZHA 5DCMA 2KRCA 4G8XA 3ZN0A 2WAQA 3KCCA 1IN7A 3FHZA 2XAGA 3HKZN 1Z3YA 3HPHA 2EFPA 2FJ1A 2DPUA 3L2WA 2M45A 1IDZA 2BEOA 3DTIA 1PYVA 5F04A 2AXTC 5ERIA 3SDGA 3GCMA 3IWZA 1ETXA 3E6MA 2JMWA 2RV8A 4A5MA 4UV8A 2V79A 3VPRA 4DIQA 3WU1B 1POGA 3KYLA 2EIMH 2QYOA 2WTEA 3J80K 2X4HA 1G3YA 4HA8A 1RESA 2K9LA 3ZPLA 3GW2A 2VODA 3K4JA 5LEJA 4E7LA 1Z91A 2HOEA 5EYRA 3CCJI 1W5CC 2E5ZA 2ZXHA 4XBFA 3DLLF 2FNAA 2XF7A 4Y13A 1WWXA 3I56I 2HQNA 3CMYA 4AIHA 2CJJA 3HPGA 2DYRH 3T8TA 2DA5A 3M8JA 5BOXA 1F1ZA 2I8DA 1A36A 2AQFA 1LNWA 3CLOA 4JQFA 3VB2A 2WAQN 5D6FA 1YYVA 1SVOA 2RNGA 1IGNA 3NWTA 2NVYJ 3PUBA 3E7LA 4P9FA 2MYSA 2VI6A 4HNTA 4BDYA 4Q4ZF 2JUCA 3GUDA 5J3LA 3G71I 2LFBA 3TW6A 3OYIA 4AVPA 4E4HA 2M2EA 4ZTJA 3G1MA 4CCJA 4A6EA 2X6OA 3CJRB 3JRFA 3E0JB 1OCPA 4HAMA 1GVDA 1Z3XA 3W2VA 1JKQC 3CO7C 2CS3A 4YFNF 4M9ZA 3HUGB 3FXUA 4OMZA 1H8AC 1D1CA 1FPQA 3PO3J 3QYFA 1T08B 1WH7A 2WV0A 3ASOH 2DW4A 6PAXA 1LDKB 1LKXA 2V1NA 1R71A 2ELJA 4M6VA 1XSVA 2ZJQF 2W57A 3BZKA 5CQEA 3I54A 1AU7A 4IPAA 4LD5A 4BGDA 3HEFA 2K02A 2JJ7A 2M5WA 2HQRA 2L5QA 1BI0A 3BP8A 4FX4A 4XLAA 2WBMA 5H6RA 2VOPA 2UUZA 4IHTA 2HXOA 5DCMB 3HYIA 3LSKA 1ETVA 2QZ8A 1D5YA 1Z1DA 2GA1A 2PQ8A 4XL9A 2GM4A 2PLYA 2VLAA 4ZZDA 1MBJA 2IXSA 1QGPA 3V4GA 4DYCA 2W7NA 2X1CA 2V1UA 1R4MB 2VUMJ 3K4LA 2VL8A 2VQCA 3A01A 1C0WA 2F5VA 3L09A 4RAZA 3AL0C 3RZOJ 5ICGA 1HKTA 2Q1ZB 3AG2H 2ZXWH 3OYHA 3JRCA 3BR5A 4KDPA 3GTLJ 3KP3A 4OIRF 1G2HA 5M5YJ 1WFXA 2V9KA 2QA4I 2R0QC 3FIWA 1Q1VA 1JXSA 1F9NA 3IWFA 1VTNC 4HF1A 1USTA 2KP6A 4CYDA 4XQFA 1IXSB 2RDPA 3DXJF 1QQIA 2R93J 4B44A 1RNLA 3K69A 3MZYA 4DNCA 5HNHA 4IVNA 4Y52J 3OR1C 1UELB 1FP1D 2CFXA 3BPXA 2IA0A 3M8FA 3WTZA 2JA5J 3V8LA 2M0CA 3H3VK 1J2XA 1OLTA 4YIRX 4BE1A 3LNQA 4ABZA 1XGSA 5F0HA 1S29A 1S6LA 1YS7A 2M4KA 3I64A 3JSOA 3RTRA 3N4MA 1QA6A 5LFAA 3R0JA 4Q48A 3U2RA 3S1QJ 4U0VA 2A5YB 2EZHA 2AS5F 3FKIJ 1Y8QB 4E7KA 4IL6C 4XLFA 3CDHA 4PJJA 5HODA 1BM9A 2CQNA 2LDUA 4PGHA 2CUEA 4MFDA 3WGIA 1WKMA 2VKEA 3VYRB 4I0AA 1CF7A 3HC7A 1BOBA 2XDVA 4R8HA 3HOSA 1RR7A 1BR2A 3V8JA 1GDTA 2BHZA 1RZ4A 2BBYA 3FK6A 1REPC 4L18B 2EBIA 4A3KJ 3H3UA 2R4GA 3IAS2 4G7HF 5EG0B 3HUGA 1SAXA 3DCFA 2NNNA 1MBEA 4UHTA 2ZNYA 3R61A 3K9TA 4BS9A 2P6SA 2PEXA 1PUEE 3M1CA 3MN2A 1AWCA 4HLXA 4N0BA 1S3JA 5GPAA 1N78A 2IT0A 5GADJ 3Q0WA 3MKWB 4HZFA 3OYAA 1RUOA 4CH7A 3OYCA 1IRZA 3GTGJ 3S16J 2E36A 2PN6A 2P7VB 3LFUA 2XHKA 1I6HJ 2DMPA 2WAFA 5IP9J 3ZQ7A 2FE3A 3ZQIA 3EDPA 4LLNA 2XPWA 2IA2A 2KHMA 3V7CA 1BL0A 2LRDA 1P7IA 3KP5A 4AM3A 3CC7I 2O8KA 2GXAA 1SMYF 4G6TB 2OZUA 4EATA 2IVMA 1G3WA 3DP7A 4GXOA 5E3NA 2MH9A 3HZJA 5HDGA 2LK2A 1EKEA 1ON2A 1OYWA 2DK8A 2OTJI 3L00A 2DTRA 2XKOA 2HYGD 3BY6A 2DK5A 2RNJA 1J7KA 1FP2A 2UXXA 3S3OA 1MZBA 3J7AO 2WA0A 1BOAA 5DV5A 2CV2A 4ZYGA 1RPWA 1H9GA 3DTEA 3M07A 4CYCA 4WXHA 5BQTA 2DT7B 4XKCA 1HW2A 2Y31A 1LB2A 1T2KA 2L0KA 2A6HF 4EM1A 3V8KA 1IRFA 3WTUC 4RMNA 4O5VA 2Y0SA 3A0BC 3DWLE 1I27A 4L9VA 3ZMUA 1SVLA 4HG2A 4A3CJ 3EYYA 3JREA 5FD6A 1WJEA 2FMLA 2UWMA 2RVCA 3TBIA 2VE9A 1YITI 3EETA 3A1YA 1RUNA 2HOAA 2VOOA 3RKYA 3I59A 3CDLA 5DYMA 4U7BA 1IG7A 5KCMA 2GAUA 2K4JA 3NRVA 1MJAA 3HOXJ 3DEWA 1VQKI 3K4BA 2M3AA 4UNOA 2R5ZB 3PFIA 3RZDJ 5J47A 1O57A 1IRXA 4RGUA 5F64A 4KN4X 2HFHA 1X19A 5JLWA 2L9VA 4XNFA 4UV9A 5HLIA 1MKMA 1CQTA 2V1DA 1JTXA 1SFKA 3DKXA 3HB9A 3F0CA 2E1MC 1WJFA 2OCEA 4Y15A 5CKTA 4Y4RA 2OAZA 5J4YA 5LEKA 5EG0A 3TO9A 4CSWA 4WX9A 2GXGA 1OYIA 5EGOB 2EV6A 5FKKA 1BI2A 2NS0A 1UAAA 5JHUA 3QRFF 1HC8A 2F48A 4M9XA 3M1EA 3DPUA 4U0WA 2R7WA 2GBYA 3H9QA 3LQQA 3T5XA 1R1UA 5B1AH 4P9UA 4FASD 4I2OA 3BG3A 2K9SA 3GLXA 5HS9A 2FXAA 1XMXA 4XRFA 2ICWG 1UMQA 3CJNA 3BR0A 4F55A 1X58A 2ZSHB 3A4CA 3CUOA 3GZ6A 3OL4A 2DFFA 1GV2A 4AIJA 2H1KA 5L3EA 3CCRI 1B9NA 4XKVA 4D5FA 2J5PA 3D0SA 2JPBA 4ZDPA 3NAUA 3OOPA 5EDNA 3K70C 3ZP5A 1ETQA 2H09A 1U3EM 5AONA 2ZXIA 3E1SA 4G7ZF 1OR7A 1J09A 2DMQA 3ROUA 2VKVA 3I9V2 1I3AA 1ETOA 5ILVA 5L3GA 1JGGA 4HV5A 2L9NA 3BT9A 3FMQA 3CESA 4MTDA 4X1EA 3RPUD 3F9KA 3JAMK 2R7DA 1T33A 4IRIA 3K2ZA 4PJNA 1ZRCA 3OIPA 1KA8A 2QBYA 1YG2A 5J8CA 4KNYA 2M7BA 3F6VA 4HW0A 4F52A 5LGNA 4M3FA 2M87A 2CQKA 1SFEA 2A69F 3U21A 1HSTA 3WGGA 5BNGA 4A5NA 1MNMC 3HOWJ 2EQRA 4ESFA 1QPMA 3K4MA 3JTGA 2FBIA 3LWFA 1TW3A 5H6QA 2TDXA 1K6YA 1PUFB 1IJWC 3I55I 4ZYAA 2H1LA 4GRIA 1FZPB 5C4JJ 1TWGJ 4LITA 4S05A 1G3TA 1SC7A 1G3SA 3E3VA 1X4OA 3GVAA 4CA0A 3B02A 3LAJA 4BJ5C 3PQJA 1V5FA 5B1BH 1ZGAA 2DPDA 1SVMA 1YE9A 3J7YJ 1O3TA 2VBYA 4ON0A 3S2WA 2F4MB 3GTKJ 2AO9A 2KMUA 3FXRA 4AD9A 1WH5A 4CXFA 2EH3A 2ZXJA 1W7PD 4MO7A 4B48A 1J9IA 5HS8A 2X51A 3GYHX 4B47A 2HQ5A 2BY0A 1MW7A 4LOCA 1K4TA 3BPVA 4A69C 1SD6A 1R5ID 2AHQA 5GAHJ 1GXQA 4A3DJ 2M9HA 2MGQA 4G94A 1YJWI 2Y75A 3PM1A 4WCGA 2QVOA 4G7OF 3K4NA 4FCYA 3FZVA 1SFXA 2WAEA 4KA4A 4L5IA 5HLGA 4LK1F 9ANTA 3PSIA 2DMNA 3BWGA 1I39A 4ZH4F 3TO6A 4BJ6C 1QO0D 2IPQX 4EMSA 4UUSA 5JFRA 3HOTA 2EINH 3GX4X 2DMUA 2Y48A 2HKOA 2Q8KA 2A61A 4EJVA 2ADUA 3QYEA 4HYEA 2BE5F 5EEHA 3FWEA 4PJLA 2R7UA 2E2JJ 4G6QA 2V1XA 3V7RA 2ISYA 3F8BA 2BW3B 3O8HA 4MQ9F 2HWVA 4IHYA 2H8WA 2XGCA 4BEHA 1SD4A 2O5RA 2BHYA 2BV6A 2JRMA 3BC8A 4N9IA 4RS8A 5A2QK 1L3LA 4L0YB 4L0ZB 4U7DA 1QU3A 4Y3OA 2VJJA 4RLQA 1K79A 1DU0A 3L1PA 4PUSA 4N4OB 1MNDA 2JA7J 2L3DA 3H36A 2L7ZA 4M72A 1CF7B 2ZMEA 4HNVA 3ONQA 3S3MA 4IJAA 2XRNA 2GZWA 3KLNA 3SFIA 1HA8A 2PFBA 2CRGA 2L9RA 2CV0A 1FBQA 4A3GJ 4KJZA 3A2KA 1ZKGA 3BTCA 1U9NA 2LG4A 4L9NA 1DQUA 3L7WA 2HS5A 2IW5A 5LGTA 1G8XA 2XIGA 1Q1HA 3ML6A 2PG4A 4LFUA 3H3ZA 3WG9A 4UUSB 3L2QA 1Z6TA 2Z9OA 3TO7A 3O2PE 4A6DA 2GA2A 5J1YA 1U5TB 1CGPA 1J59A 3G3ZA 2XAUA 1P4XA 2EFQA 4HPQA 1VQ4I 2MG4A 2XRLA 2LC2A 2BW3A 3KYDB 2TRTA 1G59A 4MQVA 3PIPF 1VQ8I 2N8GA 3KP2A 4S04A 2KISA 3RDIA 1XCBA 1NG7A 1JTYA 2HVRA 1U8RA 2UZKA 4RB3C 2P7CB 2TCTA 3P9IA 1OKRA 2XAQA 3P9CA 3HOYJ 1LDJA 3IHUA 2JTVA 1BW5A 2M8EA 1JT0A 3E97A 2ZKZA 3H0GJ 1MSFC 1EF4A 2K5CA 4NUBA 2DOEA 3FXQA 2IS2A 2KKOA 2W84A 3CCVI 3HDDA 4E7HA 2B0LA 1RETA 1BR1A 3KZIC 5B66C 2E19A 1S9HA 4EV0A 3Q9VA 3EUAA 1D1BA 2ZJPF 4Q47A 1B8IA 2MBFA 2EFNA 3KFWX 1QBJA 1TNTA 3SQNA 1R7JA 5HNFA 5FRNA 5C3EJ 1WJCA 4IRGA 1LVAA 3PNTA 3I59B 1KQ8A 2LVSA 2XGDA 1NHAA 2OUMA 3CC4I 3Q5FA 4M3GA 1I50J 4LJZF 3P9KA 1FBUA 2R7TA 1UHWA 1RKWA 1Y0UA 4M9SA 1YIJI 2E2IJ 1K78A 4HSTA 3PQKA 2IP2A 5L3CA 2HOSA 3HTUA 3VFZA 2LD5A 3K2AA 1LFPA 3OV8A 5ICEA 4RB2C 4BY1J 2MD5A 2CGPA 4NNJA 1Z7UA 2EFWA 1G4DA 3HRMA 4OU0A 5E1ZB 2ECCA 5F27A 1ERDA 3QPSA 1UHSA 2H6BA 1ZN2A 4XM3A 2LSOA 4BQNA 5FKOA 1R5HA 4BHBA 4XRSA 4CO8A 3OS1A 3SYTA 1P92A 1X3ZB 3FBNB 2KDZA 2VKHA 2E7XA 3BR6A 2EILH 1TP4A 3L2RA 4M73A 4OINF 2LY9A 2ACJA 5EZGA 5EEAA 2X6YA 4U88A 5E1XA 5ICCA 4X6AJ 2CU7A 2F6CA 3F8MA 3S14J 3ABKH 3Q3SA 3BJAA 1OPCA 5JHFA
chains in the Genus database with same CATH topology
4KIBA 4OOIA 5H20A 3JSPA 2W85A 5HOOA 4YIIA 3WU0A 4IXAA 1H0MA 2W24A 5D5WB 4AWXB 1I6XA 1U78A 1MJ9A 2D1VA 3QOPA 3I53A 1YQAA 4D0PA 3RYPA 2XKPA 2HDCA 5LRSA 4ZYHA 2XAJA 3ZMZA 2CSOA 3IRRA 4GGGA 2OBPA 5FGMA 3LA7A 1BC7C 5JR3A 2P5VA 1I1GA 5BS6A 5CVRA 1X3UA 4MEXF 1MJBA 5AIQA 4EGYA 4NB5A 5FLXK 3GXOA 1IW7F 4IHSA 4ENMA 2JZYA 4H0EA 5JI6A 3IKVA 1PDNC 1XD7A 1UB9A 3BDDA 3HSEA 4KUMA 3WTXC 4WK8F 1ZAOA 2F5DA 2HR3A 3JTHA 1FT9A 2D1HA 5K5RA 4HF2A 5LHHA 2Q2EA 1STZA 5D6EA 5CVVA 3W6JB 2O0YA 3ZN1A 3F21A 1XCVA 3CUQC 5CVUA 1KU9A 2ESNA 4WWCA 1IN6A 3CO6C 4YIFA 2K7LA 3JW4A 1T0FA 3L2CA 4G6DA 4HLYA 2F5FA 3SXYA 2LF7A 4JK1X 4Y17A 2HYFA 1W7PA 1ZGJA 1J5YA 4EM2A 2ISZA 1ZLKA 5KK1A 1U5TA 3GEZA 2DO7A 2XAHA 5CLSA 1PP7U 4LB6B 4A0ZA 1YIOA 2GIVA 4RGXA 1JHFA 3LA2A 4HDUA 1B59A 5JVTA 3U9GA 1B9MA 2AXLA 1ZG1A 2OQRA 1XB4A 5DDGA 5DD4A 3K1MA 1DPUA 3FMSA 3ECOA 5A2QZ 3EYIA 3DEUA 3K0LA 1XSDA 2X0LA 1LEBA 3KLOA 4OMYA 2P5KA 2E7WA 2H27A 4HOBA 2FU4A 2EV5A 1I1SA 2MC3A 3RKXA 3TDUC 4FT8A 3V7SA 3MAJA 4ZYEA 2K4BA 1EH8A 5DD8A 1K78B 2M30A 5TJJA 1GXPA 3GFMA 1LDDA 2FOKA 1S7OA 2DI3A 1BIAA 2XV4S 1YTYA 4BH9A 2KIMA 4HX4A 1XDUA 4LLGF 3CUQA 5FLXZ 4BHCA 5HS7A 4NHJA 4L9TA 3F22A 1PP8F 2A68F 1R00A 4PZJA 4EJTA 1R1VA 1F4KA 1TQIA 2E1CA 2GWRA 3WTTC 2NNYA 3RYRA 2YPRA 3E5XA 4BQAA 3LQRA 4B8XA 3E5UA 4LLLA 2G7HA 3F8FA 3ISPA 4B09A 2O03A 3BJOA 3MQ0A 2Z3YA 4QWQA 3E6BA 1MD0A 5F1RA 1TLHB 2HZTA 3KP4A 2PMUA 5LLQA 3MWMA 3AAFA 1IN8A 1LQ1A 1IF1A 3SZTA 1ZRFA 3FX3A 2P6TA 4EGZA 2Q0OA 1XGMA 3LA3A 5ILSA 1S8NA 1WRJA 2Y0MA 2VC0A 3VOEA 4A0XA 1BJAA 5BMZA 5E20A 3ELKA 2DFIA 4LG0B 3NQOA 2GXBA 2ZBKA 1FLIA 5LHIA 1V3FA 3I71A 3WTWC 3BROA 3P7NA 3DV8A 3SFZA 3E5QA 3KP7A 2F5EA 2ZCWA 2VBZA 3RI4A 2STTA 4AIKA 1FSEA 1IRGA 1KU7A 3I0TA 1ONVA 3DQVC 3RPQA 1KGSA 2OZ6A 4ENNA 4ESJA 3HHGA 3MFKA 3C1DA 4HF0A 1P4AA 2LNBA 3NEUA 3GFIA 2BGCA 1R36A 1WSUA 5FD5A 1IZ1A 3IL2A 3HRTA 4UXNA 4O3MA 1K7AA 1XDSA 2KIUA 1OYYA 2DU9A 5FB2A 1SMTA 1J0RA 3C3WA 1HKQA 5TRDA 2FMYA 1H9TA 3T0YA 2YSRA 2RN7A 2XGXA 3HRSA 3ZMSA 1DP7P 1J75A 1XGOA 1YLFA 1JE8A 1BI1A 4FHTA 4I0BA 3J81Z 3ULQB 4RB1A 2VBWA 4LG0A 1HW5A 4CICA 4HQEA 3I4PA 1HSJA 3ZMVA 1XGNA 4I09A 4PDKA 3GZ5A 3TQNA 1KQ0A 4ZZLA 1IXCA 4WXDA 3ABTA 1B4AA 5KVRA 2IJLA 4KFCA 1W5SA 4M71A 2QQAA 1EH7A 5HDKA 1HW1A 1K6OA 4KMFA 3M7GA 5D5VB 3TOAA 3MEXA 2FBKA 5ED4A 5CYVA 1RI7A 5D8KB 5AIPA 4I02A 1YW7A 1WQ2A 4R79A 2FNPA 3TOBA 1KYWA 4KMUX 3LAPA 4I98B 4Q5SF 4O6JA 4UVAA 3HSRA 2KRFA 5DUKA 2VT2A 1D8KA 2CWEA 1R1TA 1MDMB 5CJ9A 2QWWA 2LKPA 4MTEA 2V6CA 1V4RA 3ABUA 5LGUA 2OU2A 4BNCA 3F8CA 1W4MA 3IKTA 3K1NA 2D45A 3RJPA 3QPHA 4RGRA 4A0YA 3TGNA 4LB5A 1T6SA 2L4AA 3QU6A 3QU3A 5HLHA 2NAZA 1ZARA 2O61A 3WE2A 4CZZA 1TW2A 2CO5A 4I7HA 5L3DA 2FSWA 3FMRA 1XMAA 2XROA 3W6KB 5E18F 3O6BB 3GWZA 2QM3A 4EVIA 2E1NA 1MGTA 3Q9SA 5DCFA 5E8IA 4EQQA 1KU2A 5L3FA 2DT5A 1U5TC 2PJPA 2L54A 4XSXF 3F6OA 2ETHA 5E8GA 1P2FA 2G7UA 1BN5A 4KYWA 2EA2A 2IA1A 1FYMA 1IAWA 1ZRDA 2PMHA 4L9JA 3ZMDA 4MEYF 1O3RA 1TTYA 3R0AA 4R1HA 4JBAA 3RPUA 3WTYC 1KYZA 4EJOA 4OIOF 3DPLC 2PI0A 4LGWA 2BYVE 2WWYA 2STWA 1LEAA 3F72A 1IN5A 1U6GA 4P96A 4RB0A 4LK0F 4M6XA 2QLZA 3D5LA 1TBXA 3GFLA 1FNNA 1ON1A 3F8NA 4FX0A 2KJCA 1E17A 3TKYA 4MHGA 1R22A 2QBYB 3DFGA 4OIPF 1SFUA 3HTSB 4MGRA 3KP6A 3M8EA 1KQ9A 1W7PB 4YG2F 4TV7A 2NRAC 3B73A 1DDNA 4WXCA 1L0OC 4ZYDA 2QQBA 2JRTA 3TDZC 3QP5A 3DPTA 4YFXF 1Z6RA 1I5ZA 3WGHA 3DKWA 2EJRA 2D2WA 2CYYA 2YX4A 3F23A 4XLPF 2P5LC 3SZPA 4HV6A 4GYIA 2WC2A 1YO5C 1XMKA 2YU3A 3BZ6A 5IT9Z 3GF2A 2F5CA 3IC7A 1OMIA 5D5UB 3WTVC 1A04A 1FC3A 3H92A 2P8TA 4PGGA 2MH2A 5LRRA 3E6DA 1FSHA 4HBLA 1EH6A 4P5OA 2JT1A 2IRFG 3ERED 1ZG3A 2XVCA 3KZYA 2VONA 3L9FA 2HKXA 4G9YA 2DQLA 4KICA 2MLGA 3K1PA 3SHFA 2ZFWA 1ZYRF 2PBIA 3CUQB 3BJ6A 5FFXA 1G6NA 2GQQA 4RAYA 1O7FA 4M74A 3LSTA 4RGSA 3IRQA 5E1WA 2HEOA 5DEQA 1MDMA 4YFKF 3ZMTA 5D4RA 1TNSA 1FBSA 1HKSA 3J81K 2O6GE 4HDVA 2QENA 4OIQF 2EWNA 4MNUA 1FYLA 3ECHA 2A6EF 2VBXA 2K27A 2CG4A 1IN4A 2UXNA 1HXDA 3T1BA 3FF5A 2EFOA 2EV0A 3EUHA 4UVCA 1LJ9A 1WI9A 2Z5UA 2MLKA 2MA3A 1B1BA 4K2EA 5ICFA 2DQRA 2RGVA 5LBQA 2Z33A 3M9AA 2M1BA 4GYGA 2RKHA 5IT3A 4ENJA 1UCRA 4N9HA 2OD5A 1SD5A 3KEOA 1D8JA 5DUIA 2HGCA 2DLLA 1R5GA 2FA5A 2G9WA 2R3SA 2LF8A 4A12A 2VT3A 4BHPA 4WF2A 1UHMA 3WE3A 2XASA 3C18A 2QQ9A 3KE2A 4KIGA 3N97A 3GO5A 4DQ2A 2DBBA 1FOKA 4Z2YA 2VE8A 5FO5A 2Z99A 3EQLF 2ELHA 5LHGA 4BAYA 4XSZF 4HX8A 2C6YA 1EV7A 4KN7X 1ZHFA 2L01A 1BC8C 2COMA 3U1DA 1FWZA 1T98A 2FEZA 2XAFA 2ZMEB 1QNTA 3KETA 2ZNZA 2V9VA 1UFMA 3C7JA 3R6SA 4QLCU 3MZHA 5HDNA 1O7LA 5BPDA 4GCVA 4CDGA 3FM3A 3I5UA 3COAC 4EJWA 2HTJA 2RC4A 3VEPA 1QZZA 4ENKA 4CHUA 5ILUA 3DF8A 1USSA 5CVJA 1T39A 4EJUA 1O3SA 1ZG5A 3QP6A 1BBYA 5FFZA 2QUFA 1SD7A 2YR2A 1ULYA 2FBHA 2KIFA 1ODDA 5BPIA 2L02A 1D5VA 1O3QA 2L4MA 4LMYA 2JPCA 4P55A 1HBXG 3QAHA 2FQ3A 4UUVA 2VXZA 1XSXA 3FM5A 3R4KA 4ESBA 4CGZA 2H94A 3QPTA 4A2UA 4HQMA 1ZLJA 5E17F 1U2WA 1GVJA 4BYYA 4BXUA 3REOA 3HHHA 3G73A 5K5QA 1JHHA 2A07F 5F6FA 2ZO4A 5D8LB 1Z9CA 1JGSA 2ZJ2A 3HSFA 2FRHA 3WTSC 3O3KA 2XUBA 1ZREA 1R23A 2KJBA 2R7FA 1FY7A 3VODA 1B6AA 1BI3A 2A3SA 4U0YA 2RQPA 3KEQA 1YW9A 2FF4A 5J6XA 4M6YA 4PCQA 3CTAA 1IUYA 4KIFA 2EK5A 1YW8A 1Z05A 1GHCA 3HRUA 5K5OA 5J8FA 2OA4A 2YX7A 2P4WA 2OQGA 4KT5C 2K86A 1IXRC 5K1YA 2J5OA 2F2EA 3WODF 5L3BA 2ESHA 1DUXC 2H6CA 4ETSA 1W5TA 1DPRA 1FX7A 4E70A 4EM0B 3R60A 4F7ZA 3JAMZ 1KU3A 1QZYA 2W25A 1T38A 1S7AA 2O3FA 5IT9K 4I01A 4NQWA 4XLNF 2HTSA 3E6CC 1FYKA 2JSCA 4UVBA 1YFHA 3T8RA 2CW0F 3KZZA 2VC1A 1BIBA 2DAOA 4HX7A 1HQCA 2O8XA 4L5JA 2VN2A 1E2XA 1F5TA 1YS6A 1TQPA 1R58A 4IF4A 2EB7A 3LFKA 1ZH5A 1AOYA 4GO1A 3RKWA 4ASNA 2EA4A 3RIRA 3HIFA 2NYXA 5HVQC 5EEGA 1P6RA 1TQMA 1RIOH 5D4SA 1P4WA 3GFJA 3J80Z 3MCZA 3I58A 3BOQA 5CVIA 1XN7A 4IRHA 5D5XB 1D3YA 3F3XA 5DCMA 4G8XA 3ZN0A 3KCCA 1IN7A 3FHZA 2XAGA 2EFPA 2DPUA 2M45A 2BEOA 5ERIA 3IWZA 3E6MA 2RV8A 4A5MA 4UV8A 2V79A 3WU1B 2QYOA 2WTEA 3J80K 2X4HA 1G3YA 4HA8A 3ZPLA 3GW2A 2VODA 5LEJA 1Z91A 2HOEA 4XBFA 2FNAA 4Y13A 1WWXA 2HQNA 4AIHA 3T8TA 5BOXA 1F1ZA 1LNWA 3CLOA 4JQFA 3VB2A 5D6FA 1YYVA 4P9FA 4Q4ZF 3GUDA 4AVPA 4A6EA 4HAMA 3CO7C 4YFNF 4M9ZA 3FXUA 4OMZA 1FPQA 2WV0A 2DW4A 6PAXA 1LDKB 1XSVA 2W57A 3I54A 4IPAA 4LD5A 2K02A 2M5WA 2HQRA 1BI0A 3BP8A 4FX4A 5H6RA 2VOPA 4IHTA 5DCMB 3HYIA 2QZ8A 1Z1DA 2GA1A 2PQ8A 2PLYA 4ZZDA 1QGPA 3V4GA 2V1UA 1C0WA 3L09A 4RAZA 5ICGA 1HKTA 4KDPA 3KP3A 4OIRF 1JXSA 1F9NA 3IWFA 1VTNC 4HF1A 1USTA 4CYDA 1IXSB 2RDPA 3DXJF 1QQIA 4DNCA 1RNLA 3K69A 3MZYA 4IVNA 1FP1D 2CFXA 3BPXA 2IA0A 3M8FA 3WTZA 3V8LA 1J2XA 1XGSA 1S29A 1S6LA 1YS7A 3I64A 3JSOA 3RTRA 3N4MA 3U2RA 3R0JA 4Q48A 4U0VA 2A5YB 2AS5F 3CDHA 1BM9A 2LDUA 4PGHA 3WGIA 1WKMA 4I0AA 1CF7A 4R8HA 3HOSA 3V8JA 1RZ4A 2BBYA 1REPC 4L18B 3H3UA 4G7HF 3HUGA 1SAXA 2NNNA 4UHTA 2ZNYA 3R61A 3K9TA 2P6SA 2PEXA 1PUEE 1AWCA 4HLXA 4N0BA 1S3JA 2IT0A 4HZFA 1RUOA 2PN6A 2P7VB 2XHKA 3ZQ7A 2FE3A 3EDPA 4LLNA 2IA2A 3V7CA 3KP5A 1SMYF 2OZUA 2IVMA 1G3WA 3DP7A 4GXOA 2MH9A 5HDGA 1ON2A 1OYWA 2DK8A 3L00A 2DTRA 2XKOA 2HYGD 3BY6A 2DK5A 2RNJA 1FP2A 1J7KA 2UXXA 1MZBA 3J7AO 1BOAA 5DV5A 4ZYGA 1H9GA 4WXHA 5BQTA 1HW2A 1LB2A 1T2KA 2A6HF 4EM1A 3V8KA 1IRFA 3WTUC 4O5VA 3ZMUA 1I27A 4L9VA 3EYYA 5FD6A 2FMLA 2UWMA 2RVCA 2VE9A 3EETA 1RUNA 2VOOA 3RKYA 3I59A 4U7BA 5DYMA 2GAUA 2K4JA 3NRVA 1MJAA 4UNOA 3PFIA 1O57A 4RGUA 5F64A 4KN4X 2HFHA 4UV9A 5HLIA 1MKMA 2V1DA 4Y15A 2OAZA 5LEKA 3TO9A 4WX9A 2GXGA 1OYIA 2EV6A 1BI2A 2NS0A 5JHUA 3QRFF 4M9XA 3M1EA 4U0WA 3T5XA 3LQQA 1R1UA 4P9UA 4I2OA 3GLXA 5HS9A 2FXAA 4XRFA 3CJNA 3CUOA 3GZ6A 4AIJA 5L3EA 1B9NA 2J5PA 3D0SA 2JPBA 3OOPA 3ZP5A 2H09A 1U3EM 5AONA 4G7ZF 1OR7A 3ROUA 5ILVA 5L3GA 4HV5A 3FMQA 4MTDA 3JAMK 4IRIA 2R7DA 3K2ZA 1ZRCA 1KA8A 2QBYA 1YG2A 5J8CA 4KNYA 3F6VA 4HW0A 5LGNA 2M87A 2CQKA 1SFEA 2A69F 1HSTA 3WGGA 4A5NA 4ESFA 1QPMA 3JTGA 2FBIA 3LWFA 1TW3A 5H6QA 2TDXA 1FZPB 4S05A 1G3TA 1G3SA 3E3VA 3GVAA 3B02A 3LAJA 3PQJA 1ZGAA 2DPDA 1O3TA 2VBYA 4ON0A 3S2WA 3FXRA 4AD9A 4CXFA 2ZXJA 1W7PD 1J9IA 5HS8A 3GYHX 3BPVA 1SD6A 1GXQA 4G94A 4WCGA 2Y75A 2QVOA 4G7OF 3FZVA 1SFXA 4KA4A 4L5IA 5HLGA 4LK1F 3BWGA 4ZH4F 3TO6A 1QO0D 2IPQX 4EMSA 5JFRA 3HOTA 3GX4X 2Y48A 2HKOA 2Q8KA 2A61A 4EJVA 2ADUA 4HYEA 2BE5F 5EEHA 3FWEA 4G6QA 2V1XA 3V7RA 2ISYA 3F8BA 4MQ9F 2HWVA 1SD4A 2BV6A 4N9IA 4RS8A 5A2QK 1L3LA 4L0YB 4L0ZB 4U7DA 1K79A 2L3DA 1CF7B 4M72A 2ZMEA 4IJAA 2XRNA 2GZWA 3KLNA 2PFBA 1FBQA 4L9NA 3L7WA 2HS5A 2IW5A 5LGTA 2XIGA 1Q1HA 3ML6A 2PG4A 4LFUA 3H3ZA 3WG9A 1Z6TA 2Z9OA 3TO7A 3O2PE 4A6DA 2GA2A 1U5TB 1CGPA 1J59A 3G3ZA 1P4XA 2EFQA 4MQVA 3KP2A 4S04A 3RDIA 1XCBA 1U8RA 2UZKA 4RB3C 2P7CB 3P9IA 1OKRA 2XAQA 3P9CA 1LDJA 3IHUA 2JTVA 2M8EA 3E97A 2ZKZA 3FXQA 2KKOA 2W84A 2B0LA 4EV0A 3Q9VA 4Q47A 2MBFA 2EFNA 3KFWX 1QBJA 1TNTA 3SQNA 1R7JA 4IRGA 1LVAA 3I59B 1KQ8A 1NHAA 3Q5FA 4LJZF 3P9KA 1FBUA 1UHWA 1Y0UA 4M9SA 1K78A 3PQKA 2IP2A 5L3CA 3HTUA 3VFZA 3OV8A 5ICEA 4RB2C 2MD5A 2CGPA 1Z7UA 2EFWA 1G4DA 3HRMA 4OU0A 5E1ZB 2H6BA 1ZN2A 2LSOA 1R5HA 4BHBA 4CO8A 1P92A 2E7XA 4M73A 4OINF 2ACJA 4U88A 5E1XA 5ICCA 3F8MA 3BJAA 1OPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIB A;  4OOI A;  5H20 A;  3JSP A;  2W85 A;  5HOO A;  4YII A;  3WU0 A;  4IXA A;  1H0M A;  2W24 A;  5D5W B;  4AWX B;  1I6X A;  1U78 A;  1MJ9 A;  2D1V A;  3QOP A;  3I53 A;  1YQA A;  4D0P A;  3RYP A;  2XKP A;  2HDC A;  5LRS A;  4ZYH A;  2XAJ A;  3ZMZ A;  2CSO A;  3IRR A;  4GGG A;  2OBP A;  5FGM A;  3LA7 A;  1BC7 C;  5JR3 A;  2P5V A;  1I1G A;  5BS6 A;  5CVR A;  1X3U A;  4MEX F;  1MJB A;  5AIQ A;  4EGY A;  4NB5 A;  5FLX K;  3GXO A;  1IW7 F;  4IHS A;  4ENM A;  2JZY A;  4H0E A;  5JI6 A;  3IKV A;  1PDN C;  1XD7 A;  1UB9 A;  3BDD A;  3HSE A;  4KUM A;  3WTX C;  4WK8 F;  1ZAO A;  2F5D A;  2HR3 A;  3JTH A;  1FT9 A;  2D1H A;  5K5R A;  4HF2 A;  5LHH A;  2Q2E A;  1STZ A;  5D6E A;  5CVV A;  3W6J B;  2O0Y A;  3ZN1 A;  3F21 A;  1XCV A;  3CUQ C;  5CVU A;  1KU9 A;  2ESN A;  4WWC A;  1IN6 A;  3CO6 C;  4YIF A;  2K7L A;  3JW4 A;  1T0F A;  3L2C A;  4G6D A;  4HLY A;  2F5F A;  3SXY A;  2LF7 A;  4JK1 X;  4Y17 A;  2HYF A;  1W7P A;  1ZGJ A;  1J5Y A;  4EM2 A;  2ISZ A;  1ZLK A;  5KK1 A;  1U5T A;  3GEZ A;  2DO7 A;  2XAH A;  5CLS A;  1PP7 U;  4LB6 B;  4A0Z A;  1YIO A;  2GIV A;  4RGX A;  1JHF A;  3LA2 A;  4HDU A;  1B59 A;  5JVT A;  3U9G A;  1B9M A;  2AXL A;  1ZG1 A;  2OQR A;  1XB4 A;  5DDG A;  5DD4 A;  3K1M A;  1DPU A;  3FMS A;  3ECO A;  5A2Q Z;  3EYI A;  3DEU A;  3K0L A;  1XSD A;  2X0L A;  1LEB A;  3KLO A;  4OMY A;  2P5K A;  2E7W A;  2H27 A;  4HOB A;  2FU4 A;  2EV5 A;  1I1S A;  2MC3 A;  3RKX A;  3TDU C;  4FT8 A;  3V7S A;  3MAJ A;  4ZYE A;  2K4B A;  1EH8 A;  5DD8 A;  1K78 B;  2M30 A;  5TJJ A;  1GXP A;  3GFM A;  1LDD A;  2FOK A;  1S7O A;  2DI3 A;  1BIA A;  2XV4 S;  1YTY A;  4BH9 A;  2KIM A;  4HX4 A;  1XDU A;  4LLG F;  3CUQ A;  5FLX Z;  4BHC A;  5HS7 A;  4NHJ A;  4L9T A;  3F22 A;  1PP8 F;  2A68 F;  1R00 A;  4PZJ A;  4EJT A;  1R1V A;  1F4K A;  1TQI A;  2E1C A;  2GWR A;  3WTT C;  2NNY A;  3RYR A;  2YPR A;  3E5X A;  4BQA A;  3LQR A;  4B8X A;  3E5U A;  4LLL A;  2G7H A;  3F8F A;  3ISP A;  4B09 A;  2O03 A;  3BJO A;  3MQ0 A;  2Z3Y A;  4QWQ A;  3E6B A;  1MD0 A;  5F1R A;  1TLH B;  2HZT A;  3KP4 A;  2PMU A;  5LLQ A;  3MWM A;  3AAF A;  1IN8 A;  1LQ1 A;  1IF1 A;  3SZT A;  1ZRF A;  3FX3 A;  2P6T A;  4EGZ A;  2Q0O A;  1XGM A;  3LA3 A;  5ILS A;  1S8N A;  1WRJ A;  2Y0M A;  2VC0 A;  3VOE A;  4A0X A;  1BJA A;  5BMZ A;  5E20 A;  3ELK A;  2DFI A;  4LG0 B;  3NQO A;  2GXB A;  2ZBK A;  1FLI A;  5LHI A;  1V3F A;  3I71 A;  3WTW C;  3BRO A;  3P7N A;  3DV8 A;  3SFZ A;  3E5Q A;  3KP7 A;  2F5E A;  2ZCW A;  2VBZ A;  3RI4 A;  2STT A;  4AIK A;  1FSE A;  1IRG A;  1KU7 A;  3I0T A;  1ONV A;  3DQV C;  3RPQ A;  1KGS A;  2OZ6 A;  4ENN A;  4ESJ A;  3HHG A;  3MFK A;  3C1D A;  4HF0 A;  1P4A A;  2LNB A;  3NEU A;  3GFI A;  2BGC A;  1R36 A;  1WSU A;  5FD5 A;  1IZ1 A;  3IL2 A;  3HRT A;  4UXN A;  4O3M A;  1K7A A;  1XDS A;  2KIU A;  1OYY A;  2DU9 A;  5FB2 A;  1SMT A;  1J0R A;  3C3W A;  1HKQ A;  5TRD A;  2FMY A;  1H9T A;  3T0Y A;  2YSR A;  2RN7 A;  2XGX A;  3HRS A;  3ZMS A;  1DP7 P;  1J75 A;  1XGO A;  1YLF A;  1JE8 A;  1BI1 A;  4FHT A;  4I0B A;  3J81 Z;  3ULQ B;  4RB1 A;  2VBW A;  4LG0 A;  1HW5 A;  4CIC A;  4HQE A;  3I4P A;  1HSJ A;  3ZMV A;  1XGN A;  4I09 A;  4PDK A;  3GZ5 A;  3TQN A;  1KQ0 A;  4ZZL A;  1IXC A;  4WXD A;  3ABT A;  1B4A A;  5KVR A;  2IJL A;  4KFC A;  1W5S A;  4M71 A;  2QQA A;  1EH7 A;  5HDK A;  1HW1 A;  1K6O A;  4KMF A;  3M7G A;  5D5V B;  3TOA A;  3MEX A;  2FBK A;  5ED4 A;  5CYV A;  1RI7 A;  5D8K B;  5AIP A;  4I02 A;  1YW7 A;  1WQ2 A;  4R79 A;  2FNP A;  3TOB A;  1KYW A;  4KMU X;  3LAP A;  4I98 B;  4Q5S F;  4O6J A;  4UVA A;  3HSR A;  2KRF A;  5DUK A;  2VT2 A;  1D8K A;  2CWE A;  1R1T A;  1MDM B;  5CJ9 A;  2QWW A;  2LKP A;  4MTE A;  2V6C A;  1V4R A;  3ABU A;  5LGU A;  2OU2 A;  4BNC A;  3F8C A;  1W4M A;  3IKT A;  3K1N A;  2D45 A;  3RJP A;  3QPH A;  4RGR A;  4A0Y A;  3TGN A;  4LB5 A;  1T6S A;  2L4A A;  3QU6 A;  3QU3 A;  5HLH A;  2NAZ A;  1ZAR A;  2O61 A;  3WE2 A;  4CZZ A;  1TW2 A;  2CO5 A;  4I7H A;  5L3D A;  2FSW A;  3FMR A;  1XMA A;  2XRO A;  3W6K B;  5E18 F;  3O6B B;  3GWZ A;  2QM3 A;  4EVI A;  2E1N A;  1MGT A;  3Q9S A;  5DCF A;  5E8I A;  4EQQ A;  1KU2 A;  5L3F A;  2DT5 A;  1U5T C;  2PJP A;  2L54 A;  4XSX F;  3F6O A;  2ETH A;  5E8G A;  1P2F A;  2G7U A;  1BN5 A;  4KYW A;  2EA2 A;  2IA1 A;  1FYM A;  1IAW A;  1ZRD A;  2PMH A;  4L9J A;  3ZMD A;  4MEY F;  1O3R A;  1TTY A;  3R0A A;  4R1H A;  4JBA A;  3RPU A;  3WTY C;  1KYZ A;  4EJO A;  4OIO F;  3DPL C;  2PI0 A;  4LGW A;  2BYV E;  2WWY A;  2STW A;  1LEA A;  3F72 A;  1IN5 A;  1U6G A;  4P96 A;  4RB0 A;  4LK0 F;  4M6X A;  2QLZ A;  3D5L A;  1TBX A;  3GFL A;  1FNN A;  1ON1 A;  3F8N A;  4FX0 A;  2KJC A;  1E17 A;  3TKY A;  4MHG A;  1R22 A;  2QBY B;  3DFG A;  4OIP F;  1SFU A;  3HTS B;  4MGR A;  3KP6 A;  3M8E A;  1KQ9 A;  1W7P B;  4YG2 F;  4TV7 A;  2NRA C;  3B73 A;  1DDN A;  4WXC A;  1L0O C;  4ZYD A;  2QQB A;  2JRT A;  3TDZ C;  3QP5 A;  3DPT A;  4YFX F;  1Z6R A;  1I5Z A;  3WGH A;  3DKW A;  2EJR A;  2D2W A;  2CYY A;  2YX4 A;  3F23 A;  4XLP F;  2P5L C;  3SZP A;  4HV6 A;  4GYI A;  2WC2 A;  1YO5 C;  1XMK A;  2YU3 A;  3BZ6 A;  5IT9 Z;  3GF2 A;  2F5C A;  3IC7 A;  1OMI A;  5D5U B;  3WTV C;  1A04 A;  1FC3 A;  3H92 A;  2P8T A;  4PGG A;  2MH2 A;  5LRR A;  3E6D A;  1FSH A;  4HBL A;  1EH6 A;  4P5O A;  2JT1 A;  2IRF G;  3ERE D;  1ZG3 A;  2XVC A;  3KZY A;  2VON A;  3L9F A;  2HKX A;  4G9Y A;  2DQL A;  4KIC A;  2MLG A;  3K1P A;  3SHF A;  2ZFW A;  1ZYR F;  2PBI A;  3CUQ B;  3BJ6 A;  5FFX A;  1G6N A;  2GQQ A;  4RAY A;  1O7F A;  4M74 A;  3LST A;  4RGS A;  3IRQ A;  5E1W A;  2HEO A;  5DEQ A;  1MDM A;  4YFK F;  3ZMT A;  5D4R A;  1TNS A;  1FBS A;  1HKS A;  3J81 K;  2O6G E;  4HDV A;  2QEN A;  4OIQ F;  2EWN A;  4MNU A;  1FYL A;  3ECH A;  2A6E F;  2VBX A;  2K27 A;  2CG4 A;  1IN4 A;  2UXN A;  1HXD A;  3T1B A;  3FF5 A;  2EFO A;  2EV0 A;  3EUH A;  4UVC A;  1LJ9 A;  1WI9 A;  2Z5U A;  2MLK A;  2MA3 A;  1B1B A;  4K2E A;  5ICF A;  2DQR A;  2RGV A;  5LBQ A;  2Z33 A;  3M9A A;  2M1B A;  4GYG A;  2RKH A;  5IT3 A;  4ENJ A;  1UCR A;  4N9H A;  2OD5 A;  1SD5 A;  3KEO A;  1D8J A;  5DUI A;  2HGC A;  2DLL A;  1R5G A;  2FA5 A;  2G9W A;  2R3S A;  2LF8 A;  4A12 A;  2VT3 A;  4BHP A;  4WF2 A;  1UHM A;  3WE3 A;  2XAS A;  3C18 A;  2QQ9 A;  3KE2 A;  4KIG A;  3N97 A;  3GO5 A;  4DQ2 A;  2DBB A;  1FOK A;  4Z2Y A;  2VE8 A;  5FO5 A;  2Z99 A;  3EQL F;  2ELH A;  5LHG A;  4BAY A;  4XSZ F;  4HX8 A;  2C6Y A;  1EV7 A;  4KN7 X;  1ZHF A;  2L01 A;  1BC8 C;  2COM A;  3U1D A;  1FWZ A;  1T98 A;  2FEZ A;  2XAF A;  2ZME B;  1QNT A;  3KET A;  2ZNZ A;  2V9V A;  1UFM A;  3C7J A;  3R6S A;  4QLC U;  3MZH A;  5HDN A;  1O7L A;  5BPD A;  4GCV A;  4CDG A;  3FM3 A;  3I5U A;  3COA C;  4EJW A;  2HTJ A;  2RC4 A;  3VEP A;  1QZZ A;  4ENK A;  4CHU A;  5ILU A;  3DF8 A;  1USS A;  5CVJ A;  1T39 A;  4EJU A;  1O3S A;  1ZG5 A;  3QP6 A;  1BBY A;  5FFZ A;  2QUF A;  1SD7 A;  2YR2 A;  1ULY A;  2FBH A;  2KIF A;  1ODD A;  5BPI A;  2L02 A;  1D5V A;  1O3Q A;  2L4M A;  4LMY A;  2JPC A;  4P55 A;  1HBX G;  3QAH A;  2FQ3 A;  4UUV A;  2VXZ A;  1XSX A;  3FM5 A;  3R4K A;  4ESB A;  4CGZ A;  2H94 A;  3QPT A;  4A2U A;  4HQM A;  1ZLJ A;  5E17 F;  1U2W A;  1GVJ A;  4BYY A;  4BXU A;  3REO A;  3HHH A;  3G73 A;  5K5Q A;  1JHH A;  2A07 F;  5F6F A;  2ZO4 A;  5D8L B;  1Z9C A;  1JGS A;  2ZJ2 A;  3HSF A;  2FRH A;  3WTS C;  3O3K A;  2XUB A;  1ZRE A;  1R23 A;  2KJB A;  2R7F A;  1FY7 A;  3VOD A;  1B6A A;  1BI3 A;  2A3S A;  4U0Y A;  2RQP A;  3KEQ A;  1YW9 A;  2FF4 A;  5J6X A;  4M6Y A;  4PCQ A;  3CTA A;  1IUY A;  4KIF A;  2EK5 A;  1YW8 A;  1Z05 A;  1GHC A;  3HRU A;  5K5O A;  5J8F A;  2OA4 A;  2YX7 A;  2P4W A;  2OQG A;  4KT5 C;  2K86 A;  1IXR C;  5K1Y A;  2J5O A;  2F2E A;  3WOD F;  5L3B A;  2ESH A;  1DUX C;  2H6C A;  4ETS A;  1W5T A;  1DPR A;  1FX7 A;  4E70 A;  4EM0 B;  3R60 A;  4F7Z A;  3JAM Z;  1KU3 A;  1QZY A;  2W25 A;  1T38 A;  1S7A A;  2O3F A;  5IT9 K;  4I01 A;  4NQW A;  4XLN F;  2HTS A;  3E6C C;  1FYK A;  2JSC A;  4UVB A;  1YFH A;  3T8R A;  2CW0 F;  3KZZ A;  2VC1 A;  1BIB A;  2DAO A;  4HX7 A;  1HQC A;  2O8X A;  4L5J A;  2VN2 A;  1E2X A;  1F5T A;  1YS6 A;  1TQP A;  1R58 A;  4IF4 A;  2EB7 A;  3LFK A;  1ZH5 A;  1AOY A;  4GO1 A;  3RKW A;  4ASN A;  2EA4 A;  3RIR A;  3HIF A;  2NYX A;  5HVQ C;  5EEG A;  1P6R A;  1TQM A;  1RIO H;  5D4S A;  1P4W A;  3GFJ A;  3J80 Z;  3MCZ A;  3I58 A;  3BOQ A;  5CVI A;  1XN7 A;  4IRH A;  5D5X B;  1D3Y A;  3F3X A;  5DCM A;  4G8X A;  3ZN0 A;  3KCC A;  1IN7 A;  3FHZ A;  2XAG A;  2EFP A;  2DPU A;  2M45 A;  2BEO A;  5ERI A;  3IWZ A;  3E6M A;  2RV8 A;  4A5M A;  4UV8 A;  2V79 A;  3WU1 B;  2QYO A;  2WTE A;  3J80 K;  2X4H A;  1G3Y A;  4HA8 A;  3ZPL A;  3GW2 A;  2VOD A;  5LEJ A;  1Z91 A;  2HOE A;  4XBF A;  2FNA A;  4Y13 A;  1WWX A;  2HQN A;  4AIH A;  3T8T A;  5BOX A;  1F1Z A;  1LNW A;  3CLO A;  4JQF A;  3VB2 A;  5D6F A;  1YYV A;  4P9F A;  4Q4Z F;  3GUD A;  4AVP A;  4A6E A;  4HAM A;  3CO7 C;  4YFN F;  4M9Z A;  3FXU A;  4OMZ A;  1FPQ A;  2WV0 A;  2DW4 A;  6PAX A;  1LDK B;  1XSV A;  2W57 A;  3I54 A;  4IPA A;  4LD5 A;  2K02 A;  2M5W A;  2HQR A;  1BI0 A;  3BP8 A;  4FX4 A;  5H6R A;  2VOP A;  4IHT A;  5DCM B;  3HYI A;  2QZ8 A;  1Z1D A;  2GA1 A;  2PQ8 A;  2PLY A;  4ZZD A;  1QGP A;  3V4G A;  2V1U A;  1C0W A;  3L09 A;  4RAZ A;  5ICG A;  1HKT A;  4KDP A;  3KP3 A;  4OIR F;  1JXS A;  1F9N A;  3IWF A;  1VTN C;  4HF1 A;  1UST A;  4CYD A;  1IXS B;  2RDP A;  3DXJ F;  1QQI A;  4DNC A;  1RNL A;  3K69 A;  3MZY A;  4IVN A;  1FP1 D;  2CFX A;  3BPX A;  2IA0 A;  3M8F A;  3WTZ A;  3V8L A;  1J2X A;  1XGS A;  1S29 A;  1S6L A;  1YS7 A;  3I64 A;  3JSO A;  3RTR A;  3N4M A;  3U2R A;  3R0J A;  4Q48 A;  4U0V A;  2A5Y B;  2AS5 F;  3CDH A;  1BM9 A;  2LDU A;  4PGH A;  3WGI A;  1WKM A;  4I0A A;  1CF7 A;  4R8H A;  3HOS A;  3V8J A;  1RZ4 A;  2BBY A;  1REP C;  4L18 B;  3H3U A;  4G7H F;  3HUG A;  1SAX A;  2NNN A;  4UHT A;  2ZNY A;  3R61 A;  3K9T A;  2P6S A;  2PEX A;  1PUE E;  1AWC A;  4HLX A;  4N0B A;  1S3J A;  2IT0 A;  4HZF A;  1RUO A;  2PN6 A;  2P7V B;  2XHK A;  3ZQ7 A;  2FE3 A;  3EDP A;  4LLN A;  2IA2 A;  3V7C A;  3KP5 A;  1SMY F;  2OZU A;  2IVM A;  1G3W A;  3DP7 A;  4GXO A;  2MH9 A;  5HDG A;  1ON2 A;  1OYW A;  2DK8 A;  3L00 A;  2DTR A;  2XKO A;  2HYG D;  3BY6 A;  2DK5 A;  2RNJ A;  1FP2 A;  1J7K A;  2UXX A;  1MZB A;  3J7A O;  1BOA A;  5DV5 A;  4ZYG A;  1H9G A;  4WXH A;  5BQT A;  1HW2 A;  1LB2 A;  1T2K A;  2A6H F;  4EM1 A;  3V8K A;  1IRF A;  3WTU C;  4O5V A;  3ZMU A;  1I27 A;  4L9V A;  3EYY A;  5FD6 A;  2FML A;  2UWM A;  2RVC A;  2VE9 A;  3EET A;  1RUN A;  2VOO A;  3RKY A;  3I59 A;  4U7B A;  5DYM A;  2GAU A;  2K4J A;  3NRV A;  1MJA A;  4UNO A;  3PFI A;  1O57 A;  4RGU A;  5F64 A;  4KN4 X;  2HFH A;  4UV9 A;  5HLI A;  1MKM A;  2V1D A;  4Y15 A;  2OAZ A;  5LEK A;  3TO9 A;  4WX9 A;  2GXG A;  1OYI A;  2EV6 A;  1BI2 A;  2NS0 A;  5JHU A;  3QRF F;  4M9X A;  3M1E A;  4U0W A;  3T5X A;  3LQQ A;  1R1U A;  4P9U A;  4I2O A;  3GLX A;  5HS9 A;  2FXA A;  4XRF A;  3CJN A;  3CUO A;  3GZ6 A;  4AIJ A;  5L3E A;  1B9N A;  2J5P A;  3D0S A;  2JPB A;  3OOP A;  3ZP5 A;  2H09 A;  1U3E M;  5AON A;  4G7Z F;  1OR7 A;  3ROU A;  5ILV A;  5L3G A;  4HV5 A;  3FMQ A;  4MTD A;  3JAM K;  4IRI A;  2R7D A;  3K2Z A;  1ZRC A;  1KA8 A;  2QBY A;  1YG2 A;  5J8C A;  4KNY A;  3F6V A;  4HW0 A;  5LGN A;  2M87 A;  2CQK A;  1SFE A;  2A69 F;  1HST A;  3WGG A;  4A5N A;  4ESF A;  1QPM A;  3JTG A;  2FBI A;  3LWF A;  1TW3 A;  5H6Q A;  2TDX A;  1FZP B;  4S05 A;  1G3T A;  1G3S A;  3E3V A;  3GVA A;  3B02 A;  3LAJ A;  3PQJ A;  1ZGA A;  2DPD A;  1O3T A;  2VBY A;  4ON0 A;  3S2W A;  3FXR A;  4AD9 A;  4CXF A;  2ZXJ A;  1W7P D;  1J9I A;  5HS8 A;  3GYH X;  3BPV A;  1SD6 A;  1GXQ A;  4G94 A;  4WCG A;  2Y75 A;  2QVO A;  4G7O F;  3FZV A;  1SFX A;  4KA4 A;  4L5I A;  5HLG A;  4LK1 F;  3BWG A;  4ZH4 F;  3TO6 A;  1QO0 D;  2IPQ X;  4EMS A;  5JFR A;  3HOT A;  3GX4 X;  2Y48 A;  2HKO A;  2Q8K A;  2A61 A;  4EJV A;  2ADU A;  4HYE A;  2BE5 F;  5EEH A;  3FWE A;  4G6Q A;  2V1X A;  3V7R A;  2ISY A;  3F8B A;  4MQ9 F;  2HWV A;  1SD4 A;  2BV6 A;  4N9I A;  4RS8 A;  5A2Q K;  1L3L A;  4L0Y B;  4L0Z B;  4U7D A;  1K79 A;  2L3D A;  1CF7 B;  4M72 A;  2ZME A;  4IJA A;  2XRN A;  2GZW A;  3KLN A;  2PFB A;  1FBQ A;  4L9N A;  3L7W A;  2HS5 A;  2IW5 A;  5LGT A;  2XIG A;  1Q1H A;  3ML6 A;  2PG4 A;  4LFU A;  3H3Z A;  3WG9 A;  1Z6T A;  2Z9O A;  3TO7 A;  3O2P E;  4A6D A;  2GA2 A;  1U5T B;  1CGP A;  1J59 A;  3G3Z A;  1P4X A;  2EFQ A;  4MQV A;  3KP2 A;  4S04 A;  3RDI A;  1XCB A;  1U8R A;  2UZK A;  4RB3 C;  2P7C B;  3P9I A;  1OKR A;  2XAQ A;  3P9C A;  1LDJ A;  3IHU A;  2JTV A;  2M8E A;  3E97 A;  2ZKZ A;  3FXQ A;  2KKO A;  2W84 A;  2B0L A;  4EV0 A;  3Q9V A;  4Q47 A;  2MBF A;  2EFN A;  3KFW X;  1QBJ A;  1TNT A;  3SQN A;  1R7J A;  4IRG A;  1LVA A;  3I59 B;  1KQ8 A;  1NHA A;  3Q5F A;  4LJZ F;  3P9K A;  1FBU A;  1UHW A;  1Y0U A;  4M9S A;  1K78 A;  3PQK A;  2IP2 A;  5L3C A;  3HTU A;  3VFZ A;  3OV8 A;  5ICE A;  4RB2 C;  2MD5 A;  2CGP A;  1Z7U A;  2EFW A;  1G4D A;  3HRM A;  4OU0 A;  5E1Z B;  2H6B A;  1ZN2 A;  2LSO A;  1R5H A;  4BHB A;  4CO8 A;  1P92 A;  2E7X A;  4M73 A;  4OIN F;  2ACJ A;  4U88 A;  5E1X A;  5ICC A;  3F8M A;  3BJA A;  1OPC A; 
#chains in the Genus database with same CATH topology
 5F08 A;  4KIB A;  1D0X A;  4KIT B;  1ORK A;  2YUS A;  2DDA A;  2IS4 A;  4OOI A;  4UUT A;  4DW6 A;  5H20 A;  2NOJ B;  2QEX I;  3JSP A;  2W85 A;  1JI8 A;  5CPR B;  5HOO A;  2E2H J;  4IOA F;  3VYT B;  4YII A;  3WU0 A;  4IXA A;  1EA3 A;  2O9L A;  1DU6 A;  1H0M A;  3FXJ A;  1OCR H;  2W24 A;  4IX7 A;  1W0U A;  5D5W B;  1W36 D;  4AWX B;  1I6X A;  4HSR A;  4DJA A;  1U78 A;  1MJ9 A;  2D1V A;  3QOP A;  2PMZ A;  3PL8 A;  3CC2 I;  3I53 A;  1YQA A;  4D0P A;  1P7J A;  3RYP A;  4J00 A;  3ZQC A;  1KON A;  1ACI A;  2XKP A;  2HDC A;  1V5G A;  5LRS A;  4BXX J;  4ZYH A;  2XAJ A;  3ZMZ A;  2A5W A;  2MFZ A;  2CSO A;  3FXM A;  3IRR A;  1WZ2 A;  3OSF A;  3MKY B;  1PUF A;  3KPH A;  2ZJR F;  4GGG A;  2WY7 Q;  2OBP A;  5FGM A;  2Q2E B;  1RKT A;  3LA7 A;  3Q0U A;  3ZR8 X;  2JSP A;  2DFH A;  3D5S C;  2P5V A;  5JR3 A;  1BC7 C;  1YX3 A;  1I1G A;  3N05 A;  1ZTR A;  5BS6 A;  3FBI B;  2DXI A;  3RSN A;  4F93 B;  5CVR A;  2KZV A;  1X3U A;  3Q0V A;  2LY1 A;  1O4X A;  3WHC A;  4MEX F;  3LSJ A;  1MJB A;  5AIQ A;  3CP2 A;  4EGY A;  4NB5 A;  2LYC A;  3GXO A;  5C4X J;  1IW7 F;  3OYN A;  5FLX K;  4IHS A;  4MFE A;  3W2W A;  4ENM A;  4ZDO A;  2JZY A;  4QPQ A;  5JI6 A;  4H0E A;  3IKV A;  1PDN C;  1XD7 A;  4XKW A;  4FIS A;  1UB9 A;  2Y9Z A;  4IKF A;  3I4M J;  3BDD A;  2K3F A;  1T0F C;  3HM5 A;  3HSE A;  4KUM A;  1JUP A;  4B4C A;  3WTX C;  4WK8 F;  5KAF C;  4A3E J;  1XPX A;  1ZAO A;  2F5D A;  5IP6 A;  5EF6 A;  2HR3 A;  4HEA 2;  3H1C A;  1SEU A;  1MMN A;  4RDU A;  3QQA A;  1GLN A;  3JTH A;  1FT9 A;  2D1H A;  4V19 K;  5K5R A;  2X1D A;  3VSK A;  1X2N A;  3M3Y J;  4PJ0 C;  4HF2 A;  5LHH A;  2Q2E A;  4ZJZ A;  1STZ A;  3ZGK A;  5D6E A;  4V2G A;  5CVV A;  3W6J B;  3GZN B;  1GUU A;  4U87 A;  3I3L A;  2FX0 A;  2WY8 Q;  3OMY A;  2O0Y A;  1HDP A;  3ZN1 A;  2HPM A;  4JX4 A;  3OYK A;  1LFU P;  3KYC B;  1K83 J;  2R7Q A;  3FIS A;  3F21 A;  1XCV A;  3CUQ C;  5CVU A;  3ZCO A;  1KU9 A;  2VIX A;  4II3 A;  2ESN A;  2GIZ A;  2CQ7 A;  3CMM A;  1H89 C;  4IHW A;  4WWC A;  4E7J A;  2CUF A;  1IN6 A;  3CO6 C;  4YIF A;  2K7L A;  3JW4 A;  1OFC X;  1JUS A;  1T0F A;  3L2C A;  4G6D A;  1LE8 B;  4HLY A;  1MMD A;  2CUJ A;  2L9S A;  4YRV A;  3L2V A;  2HZD A;  2F5F A;  4FE7 A;  1JKR C;  1VQ9 I;  2X48 A;  5IOY A;  3OL3 A;  4NDL A;  2LF7 A;  4JK1 X;  3SXY A;  4Y17 A;  2L7F P;  1IV8 A;  3ZQQ A;  2HYF A;  3CCU I;  1W7P A;  2DOA A;  1ZGJ A;  1E3H A;  1J5Y A;  2IS1 A;  4EM2 A;  5GPC A;  5M5X J;  4BL0 B;  2IS6 A;  1B8I B;  4RAG A;  2ISZ A;  4C30 A;  1MSE C;  3K70 D;  4FET A;  5KK1 A;  3U1K A;  1U5T A;  1ZLK A;  3GEZ A;  1N75 A;  2XSJ C;  2DO7 A;  1TZL A;  2DOD A;  2XAH A;  1MMA A;  5FJ8 J;  3AG3 H;  1S72 I;  5CLS A;  1PP7 U;  5KAI C;  4LB6 B;  4A0Z A;  3ZXS A;  1YIO A;  2GIV A;  2R7X A;  4RGX A;  1JHF A;  2XF5 A;  3LA2 A;  4G12 A;  2V4J C;  4KT6 A;  4HDU A;  3PO2 J;  1Z77 A;  1B59 A;  3ZQG A;  4A3M J;  5JVT A;  3U9G A;  2EZI A;  2PJR B;  1B9M A;  1X1P A;  2K85 A;  3TP3 A;  3J7Z I;  2AXL A;  4ITV A;  1ZG1 A;  2OQR A;  3UR3 C;  1FIA A;  4GFB A;  1XB4 A;  5DDG A;  5DD4 A;  3K1M A;  1FOX A;  2R7O A;  1X2M A;  1DPU A;  3FMS A;  2B9S A;  1X1B A;  4A3F J;  1LE8 A;  3ECO A;  2KT0 A;  4AC0 A;  1BA5 A;  5A2Q Z;  1DGW Y;  3EYI A;  2YS9 A;  2LBF A;  3DEU A;  3EUH C;  3K0L A;  4P1W A;  5FRO A;  4A3B J;  1XSD A;  2X0L A;  3H9G A;  2M0M A;  1LEB A;  5IYC J;  3QOE A;  3KLO A;  3OYB A;  1R9T J;  5K7Z A;  4OMY A;  3OOU A;  1WPK A;  2P5K A;  2E7W A;  3J7A Y;  1YRN B;  1VND A;  2HPI A;  1W0T A;  4LIU A;  4HOB A;  2FU4 A;  2LP0 A;  2H27 A;  1SFO J;  2EV5 A;  2IBD A;  1I1S A;  2MC3 A;  3RKX A;  3TDU C;  4FT8 A;  3P5J A;  3V7S A;  2FOW A;  4F92 B;  1AKH B;  3MAJ A;  3S1N J;  2ID6 A;  4ZYE A;  2HYJ A;  2K4B A;  1EH8 A;  2IGO A;  5DD8 A;  3JRH A;  1K78 B;  3PJR A;  2M30 A;  5FKL A;  5TJJ A;  3G6E I;  1NH3 A;  1GXP A;  3H5N A;  3GFM A;  1LDD A;  2FOK A;  4RLF A;  1S7O A;  1Z21 A;  2DI3 A;  1BIA A;  2XV4 S;  3BQZ A;  3LSI A;  1YTY A;  4BH9 A;  2KIM A;  4HX4 A;  3A02 A;  1XDU A;  4IZZ A;  4LLG F;  3CUQ A;  3ERM A;  4D1Q A;  5FLX Z;  4D7M A;  1T95 A;  4BHC A;  4AYB A;  1WGX A;  2YU9 J;  2OTL I;  5HS7 A;  5GAG J;  4Z6Y A;  4NHJ A;  2KL4 A;  1Y8R B;  4L9T A;  3F22 A;  1PP8 F;  2A68 F;  1R00 A;  3C2B A;  4PZJ A;  3A01 B;  4EJT A;  1R1V A;  1F4K A;  1TQI A;  2M7A A;  1FJL A;  2E1C A;  2GWR A;  2W1O A;  1DP3 A;  2V9P A;  1AA7 A;  5TGT A;  3VYU B;  3WTT C;  2HVQ A;  3BQY A;  1ZR4 A;  2W4S A;  3RYR A;  2NNY A;  2YPR A;  3E5X A;  3SDB A;  4BQA A;  3LQR A;  1Y1V J;  4B8X A;  3E5U A;  4LLL A;  2G7H A;  3F8F A;  3ISP A;  4B09 A;  1H88 C;  1HDD C;  5HLT A;  2GOM A;  2O03 A;  5FLV A;  3IH3 A;  3BJO A;  1V54 H;  2Z3Y A;  3MQ0 A;  4QWQ A;  5GAE J;  5DM7 F;  3E6B A;  2HXI A;  4B3A A;  3ESW B;  1MH3 A;  1MD0 A;  2DTZ A;  1TLH B;  5F1R A;  2HZT A;  2HOT A;  3KP4 A;  4E6K G;  2PMU A;  5LLQ A;  3MWM A;  2MW8 A;  3AAF A;  1IN8 A;  3W3C A;  3HGG A;  2GLO A;  2WAD A;  1IC8 A;  1LQ1 A;  2M4G A;  1IF1 A;  1A6I A;  3IH2 A;  3SZT A;  1ZRF A;  4JYK A;  4JP0 A;  3FX3 A;  1Y6I A;  4ZDL A;  4PFO A;  4JX5 A;  2P6T A;  4XMY A;  4EGZ A;  2Q0O A;  3FXK A;  1XGM A;  3LA3 A;  1RC9 A;  5ILS A;  1S8N A;  1WRJ A;  2Y0M A;  2VC0 A;  3VOE A;  4A0X A;  3S1M J;  1BJA A;  5BMZ A;  3CLQ A;  1R6R A;  5E20 A;  3ELK A;  2DFI A;  4LG0 B;  3NQO A;  2GXB A;  2ZBK A;  1AKH A;  3GLL A;  1FLI A;  5LHI A;  4C9Y A;  1V3F A;  4BBR J;  3I71 A;  2KRH A;  4H4K C;  3SEZ A;  3WTW C;  3BR3 A;  3BRO A;  1ZR2 A;  3P7N A;  3DV8 A;  5F1J A;  3SFZ A;  3E5Q A;  3KP7 A;  3FK7 A;  2V26 A;  2CW8 A;  2F5E A;  3LL7 A;  3WU2 C;  2ZCW A;  1VQ7 I;  2VBZ A;  3RI4 A;  2STT A;  3FXO A;  3JRI A;  4AIK A;  1FSE A;  2JK3 A;  2PMZ N;  2G0E A;  2M34 A;  2LLK A;  3K6G A;  1B72 A;  1IRG A;  1KU7 A;  2BXZ A;  3I0T A;  1ONV A;  1AHD P;  3DQV C;  3MZ8 A;  3RPQ A;  1KGS A;  2OZ6 A;  4ENN A;  3H5A A;  4ESJ A;  1QHH D;  2RAE A;  2R5Y A;  3HHG A;  4J19 A;  3MFK A;  3C1D A;  4HF0 A;  2P0W A;  3OS0 A;  2KIQ A;  2CQQ A;  2EZL A;  4HNU A;  2Y2Z A;  1P4A A;  3MD2 A;  1FTT A;  2LNB A;  3M4O J;  2Y0S N;  3NEU A;  3GFI A;  2ZME C;  4IHV A;  3LSG A;  4RA2 A;  4BUP A;  2BGC A;  1R36 A;  2E34 A;  1WSU A;  4CYC B;  2L2O A;  5FD5 A;  1IZ1 A;  4EEF G;  3IL2 A;  3DEE A;  3DU6 A;  3HRT A;  4UXN A;  4O3M A;  3C2G A;  2Y30 A;  1K7A A;  1XDS A;  2KIU A;  4XLC A;  1OYY A;  1VQM I;  1Z0X A;  2RQQ A;  2DU9 A;  5FB2 A;  4I99 C;  2DA4 A;  3UKG A;  2BOL A;  1SMT A;  5CQG A;  1J0R A;  3C3W A;  1HKQ A;  4IQ4 A;  5TRD A;  2FMY A;  4C3H J;  1JJ8 C;  1H9T A;  3DU5 A;  3T0Y A;  2VJ4 A;  2DA6 A;  2YSR A;  2B7E A;  2RN7 A;  2XGX A;  3CCL I;  1ZQ3 P;  3HRS A;  4CCK A;  2LBF B;  3ZMS A;  5FKN A;  2DDB A;  1DP7 P;  1J75 A;  5IP7 J;  3RQI A;  1XGO A;  4DOZ A;  1IDY A;  1YLF A;  1JE8 A;  1HLV A;  1BI1 A;  4FHT A;  2Z16 A;  4D7N A;  5B3S H;  4I0B A;  3J81 Z;  2HDD A;  3CCE I;  3ULQ B;  3OYE A;  2ELK A;  4RB1 A;  1S5L C;  1UZC A;  2VBW A;  3IUO A;  4LG0 A;  4IQJ A;  2NS7 A;  4C2U A;  1HW5 A;  2D5V A;  2DA2 A;  4CIC A;  1ENH A;  3DBL B;  2HQA A;  4HQE A;  1APL C;  4Y7N J;  2PX9 A;  1HSJ A;  1MH4 A;  3I4P A;  5KNL A;  1W36 C;  3BLY A;  4QSH A;  2Z1D A;  3ZMV A;  2JQ7 A;  2I5U A;  2I10 A;  2OF7 A;  1E0E A;  1XGN A;  4UY8 I;  1OCT C;  4I09 A;  4PDK A;  3GZ5 A;  3TQN A;  1KQ0 A;  2FQ4 A;  4ZZL A;  1IXC A;  1A5J A;  4WXD A;  3LOC A;  3ZQF A;  3ABT A;  4BAC A;  1B4A A;  3BCA A;  5KVR A;  4AUX A;  2IJL A;  2QGU A;  4KFC A;  1W5S A;  4M71 A;  2MAB A;  4RAF A;  1ETW A;  3HOZ J;  1X4P A;  2QQA A;  3H35 A;  4IHX A;  2DMT A;  2DYS H;  1MMS A;  2GOX B;  1EH7 A;  4RM2 A;  2RRE A;  5J1R A;  2NVQ J;  4A93 J;  3GTQ J;  1OCO H;  4RM3 A;  2R5Y B;  3S3N A;  4XLH A;  3VWB A;  5HDK A;  1HW1 A;  1K6O A;  3CD6 I;  2Z2S B;  4BXF A;  4KMF A;  3M7G A;  5D5V B;  1TWA J;  1VQ6 I;  1U9O A;  2CH0 A;  2Y9Y A;  4OAY A;  3MEX A;  2FBK A;  3TOA A;  5ED4 A;  5CYV A;  1A31 A;  1Z67 A;  4AVZ A;  1RI7 A;  5D8K B;  5AIP A;  2LH9 A;  2MD0 A;  1VF9 A;  4I02 A;  1YW7 A;  4BBS J;  3QWL A;  1WQ2 A;  1TWF J;  3BZC A;  2V6E A;  1Y56 A;  4R79 A;  2FNP A;  5LD2 C;  3CCS I;  1FMW A;  5GTI C;  3TOB A;  1KYW A;  4KMU X;  2DA7 A;  3LAP A;  4I98 B;  3GME A;  4Q5S F;  3DBH B;  4CCL A;  4O6J A;  5IYD J;  1OQY A;  2LKX A;  1FIP A;  4UVA A;  5JLX A;  3HSR A;  1ETY A;  3PUF A;  2NVT J;  2KRF A;  4BKX A;  5DUK A;  2VT2 A;  1D8K A;  4B43 A;  2CWE A;  1R1T A;  5B5E C;  1QHG A;  4CCO A;  2VB6 A;  3LSR A;  4XIC A;  1MDM B;  5CJ9 A;  2QWW A;  2LKP A;  4XN0 A;  4MTE A;  2V6C A;  3EPZ A;  1V4R A;  3PFY A;  2NVU B;  3ABU A;  1LFB A;  2XSD C;  1D0Z A;  5LGU A;  3BG9 A;  2KDO A;  2OU2 A;  3IP4 B;  4BNC A;  3OYD A;  3ABM H;  4C3I J;  2VQH A;  1W4M A;  3BG5 A;  3F8C A;  3IKT A;  3K1N A;  2JA8 J;  2D45 A;  3RJP A;  3QPH A;  4RGR A;  4DZJ A;  4A0Y A;  3ZQH A;  2OC6 A;  2M8G X;  3TGN A;  4LB5 A;  2DT6 A;  1T6S A;  2L4A A;  3QU6 A;  3QU3 A;  5HLH A;  5GP9 A;  3BG7 A;  1QVU A;  2NAZ A;  3TP0 A;  1ZAR A;  2W48 A;  2DCE A;  2ZFU A;  2O61 A;  3V42 A;  5KHD A;  3WE2 A;  4CZZ A;  1TW2 A;  4M3D A;  2CO5 A;  4I7H A;  5L3D A;  1D0Y A;  2FSW A;  5F0C A;  5GTH C;  3QOD A;  1Y0N A;  3FMR A;  2BVM A;  1XMA A;  4S0H B;  2K9Q A;  2XRO A;  2UV1 A;  3W2A A;  3W6K B;  4NQW B;  4W97 A;  2R7S A;  1T56 A;  5E18 F;  3CJQ B;  3O6B B;  3CCQ I;  3GWZ A;  2QM3 A;  1LUJ B;  4EVI A;  1SAU A;  3CCY A;  2CW7 A;  4LG3 A;  2E1N A;  1MGT A;  2F4O B;  4N4N B;  1GT0 C;  3IH4 A;  3Q9S A;  4IO9 F;  5IPA A;  5DCF A;  5E8I A;  3TL4 X;  4EQQ A;  1KU2 A;  2R5Z A;  3D5R C;  3LSM A;  5L3F A;  5FRM A;  2DT5 A;  1U5T C;  3KIO A;  2PJP A;  2L54 A;  4XSX F;  2P81 A;  4XRM A;  3F6O A;  2ETH A;  4C3J J;  2H8R A;  5E8G A;  1P2F A;  2G7U A;  5M3F J;  1BN5 A;  3S8P A;  3CJT B;  1X1D A;  2XC7 A;  3BCB A;  4KYW A;  4XON A;  2EA2 A;  2IA1 A;  4OWR B;  1FYM A;  1IAW A;  4XID A;  5J4V A;  1ZRD A;  3D1N I;  5EGO A;  2PMH A;  3MVP A;  4L9J A;  3ZMD A;  2DJN A;  4MEY F;  4F3Q A;  3G2B A;  3CDI A;  1TTY A;  5K7H A;  1O3R A;  3R0A A;  4I6Z A;  4R1H A;  4JBA A;  3RPU A;  3X2Q H;  1OIS A;  3WTY C;  1KYZ A;  4EJO A;  3CMA I;  4OIO F;  2LR8 A;  3DPL C;  2PI0 A;  4LGW A;  2BYV E;  2WWY A;  2STW A;  1LEA A;  3F72 A;  1IN5 A;  1U6G A;  4P96 A;  4RB0 A;  1FOW A;  1B72 B;  2B63 J;  1OR7 C;  4LK0 F;  2QSG X;  4M6X A;  3CCM I;  1E3O C;  2ID3 A;  2QLZ A;  3OR2 C;  4ANJ A;  3D5L A;  3HXL A;  1TBX A;  3GFL A;  1FNN A;  1S7E A;  1ON1 A;  1WI3 A;  3F8N A;  4FX0 A;  2X9D A;  2KJC A;  4RBO A;  1E17 A;  1YJN I;  3GTO J;  4NC8 A;  3TKY A;  4M3E A;  1Z7L A;  2W00 A;  4MHG A;  1R22 A;  4PFP A;  2MSY A;  2K3P A;  2QBY B;  3DFG A;  4OIP F;  3SEQ A;  2NS8 A;  1QRY A;  1SFU A;  3BR1 A;  4FTH A;  1UG2 A;  2DA3 A;  4MGR A;  3JRG A;  3KP6 A;  3M8E A;  2CV1 A;  3GBG A;  4CCM A;  3HTS B;  2E71 A;  1IO2 A;  3KEY A;  1YX5 A;  3CQZ J;  1KQ9 A;  1W7P B;  4A3L J;  4YG2 F;  4TV7 A;  3G1L A;  2NRA C;  1E3P A;  4XN3 A;  4PJM A;  4AU7 A;  2VJI A;  3B73 A;  3H5R A;  1DDN A;  3OIQ A;  4WXC A;  1L0O C;  2XB0 X;  4BE0 A;  1YI2 I;  3FXL A;  2K40 A;  4ZYD A;  2QQB A;  4LIV A;  2JRT A;  3TDZ C;  4C2T A;  2JA2 A;  3QP5 A;  3DPT A;  4QIW N;  4YFX F;  1Z6R A;  1I5Z A;  2DN0 A;  3WGH A;  4BQQ A;  3FDY A;  5DS9 A;  3DKW A;  1MIJ A;  2EJR A;  2ECB A;  3NAR A;  4ZC3 A;  4FQG A;  2D2W A;  2CYY A;  1MNE A;  2ME6 A;  2IGM A;  2OPT A;  2YX4 A;  4DYR A;  3F23 A;  4XLP F;  3JRB A;  2QCO A;  3LMM A;  3S2D J;  3IAM 2;  1QZE A;  2P5L C;  3SZP A;  4HV6 A;  2ZSI B;  4IOC F;  4GYI A;  2R7R A;  2DA1 A;  2VKD A;  2WC2 A;  1YO5 C;  3OYG A;  1XMK A;  2YU3 A;  3BZ6 A;  5IT9 Z;  3GF2 A;  3KX2 A;  3OYJ A;  2A6T A;  3MKL A;  1TT0 A;  2F5C A;  3IC7 A;  1FEX A;  1MBK A;  3RCO A;  3OIO A;  4B3X A;  3I4N J;  3OYF A;  1OMI A;  3B6C A;  4V2F A;  5D5U B;  1A04 A;  1FC3 A;  4JOM A;  2QF7 A;  4DGW B;  3WTV C;  5IY5 H;  2BY1 A;  2WB1 N;  4PK4 A;  4A3J J;  3H92 A;  1WCM J;  2P8T A;  1VI0 A;  1JUM A;  4PGG A;  2MH2 A;  5LRR A;  3E6D A;  1FSH A;  1EJ9 A;  1VQN I;  4HBL A;  1EH6 A;  4P5O A;  4FE4 A;  1XTA A;  2JT1 A;  2IRF G;  2JUG A;  3ERE D;  1DGR M;  1ZG3 A;  2XVC A;  2DJI A;  3CME I;  3KZY A;  2VON A;  3L9F A;  3S32 A;  3AFH A;  2HKX A;  3OYM A;  4G9Y A;  2DQL A;  4KIC A;  2MLG A;  2ZC2 A;  4XOT A;  4C2M J;  3K1P A;  3SHF A;  2ZB9 A;  2ZFW A;  1ZYR F;  4XRS G;  2PBI A;  3CUQ B;  3FKJ A;  4D5C A;  3BJ6 A;  2JWT A;  5FFX A;  1G6N A;  3HGY A;  2GQQ A;  2W82 A;  2O7O A;  4NC6 A;  5EJC A;  4RAY A;  1O7F A;  1YOV B;  4M74 A;  1TWH J;  1XX5 A;  4QPO A;  4YEL A;  3S2H J;  3PNV A;  1V5E A;  3ZQL A;  3LST A;  4RGS A;  3IRQ A;  5E1W A;  1OJL A;  3HKZ A;  2HEO A;  5DEQ A;  1MDM A;  5E3O A;  1M1E B;  1XC5 A;  4YFK F;  3ZMT A;  1A6Q A;  4CCN A;  2IEK A;  5D4R A;  1NK3 P;  5IYB J;  1HF0 A;  4UB8 C;  2CUZ A;  2NOG A;  4MLO A;  1P9Q C;  1TNS A;  1FBS A;  1HKS A;  3J81 K;  2O6G E;  4BJT A;  4XR6 A;  2IGK A;  4HDV A;  2DFE A;  2QEN A;  4OIQ F;  2EWN A;  4MNU A;  5F0F A;  4OAZ A;  3JRD A;  5J40 A;  2WV1 A;  1FYL A;  5E79 C;  2X6W A;  1WJ5 A;  2OJE D;  4IEJ A;  1XG1 A;  2A6E F;  2VBX A;  3ECH A;  4BY7 J;  2K27 A;  3VSL A;  2LKS A;  3RKQ A;  1A35 A;  3TW7 A;  1PJR A;  2CG4 A;  1IN4 A;  1HCR A;  2UXN A;  3K10 A;  1HXD A;  1TT5 B;  3T1B A;  3FF5 A;  1X1A A;  4W1U A;  2XPU A;  2EFO A;  2EV0 A;  4BDZ A;  3EUH A;  5DTD A;  4UVC A;  1LJ9 A;  1WI9 A;  2JVG A;  3A0H C;  2Z5U A;  4AYB N;  3SJM A;  2E60 A;  2MLK A;  1ZK8 A;  1OCC H;  2HI3 A;  3MKZ A;  2MA3 A;  3DKY A;  1B1B A;  1MBF A;  3DBR B;  4K2E A;  2QSH X;  5ICF A;  3JR9 A;  2DQR A;  2RGV A;  2KZG A;  5LBQ A;  2MC4 A;  2CMP A;  3QPL A;  2Z33 A;  2EZK A;  3M9A A;  2M1B A;  4GYG A;  1R4N B;  2RKH A;  5IT3 A;  1K4S A;  4ENJ A;  1UCR A;  4N9H A;  2R92 J;  1VQP I;  2OD5 A;  2OV7 A;  1SD5 A;  3KEO A;  2FUG 2;  1D8J A;  5DUI A;  1T8I A;  4NBQ A;  1WVR A;  3OWT A;  2HGC A;  3HJE A;  5M3M J;  4KIS A;  1F43 A;  2ME0 A;  4F91 B;  1WJB A;  2DLL A;  1R5G A;  2BXY A;  2FA5 A;  2QKL B;  5FLM J;  1WHU A;  2G9W A;  2XF6 A;  3OS2 A;  2R3S A;  2LF8 A;  4A12 A;  2VT3 A;  2X6X A;  4BHP A;  4WF2 A;  1ZEL A;  3TMO A;  1UHM A;  2V7F A;  2KQR A;  2HVS A;  2BZT A;  1UG0 A;  3PNY A;  2VJ5 A;  3WE3 A;  2XAS A;  2VQG A;  1SAN A;  3C18 A;  3BR2 A;  3OYL A;  2QQ9 A;  3KE2 A;  4KIG A;  3N97 A;  2IGN A;  3GO5 A;  2EPF A;  2F4I A;  4DQ2 A;  2DBB A;  1FOK A;  4Z2Y A;  2VE8 A;  3S15 J;  2BVL A;  2IAI A;  4BEH B;  2VPR A;  3EUK L;  5FO5 A;  2Z99 A;  3EQL F;  2ELH A;  5LHG A;  4BAY A;  4XSZ F;  1VQ5 I;  4HX8 A;  2C6Y A;  1EV7 A;  4KN7 X;  1VZ0 A;  1ZHF A;  2L01 A;  5J1U A;  2EIK H;  5K7F A;  3PSF A;  3QYB A;  1BC8 C;  2COM A;  4JX6 A;  4E7I A;  3U1D A;  1FWZ A;  1T98 A;  1OCZ H;  3MMY B;  4Y33 A;  2VXD A;  2FEZ A;  2XAF A;  2ZME B;  3H0D A;  1QNT A;  4II2 A;  4M3B A;  3KET A;  1I3Q J;  2V9V A;  2ZNZ A;  3GTJ J;  1UFM A;  2QSF X;  3C7J A;  3HL2 A;  3R6S A;  4DYQ A;  4QLC U;  3MZH A;  4HRI A;  1W1W E;  3NWS A;  5HDN A;  1O7L A;  4J01 A;  5BPD A;  3ZOB A;  4GCV A;  4CDG A;  3FM3 A;  3I5U A;  3PIO F;  1UJ8 A;  3COA C;  2OCC H;  4EJW A;  2HTJ A;  2JN6 A;  4E7S A;  2RC4 A;  4UB6 C;  3IV5 A;  3VEP A;  1QZZ A;  1VQO I;  3CF2 A;  4ENK A;  1Y39 A;  5ILU A;  3JCU C;  4DBQ A;  4CHU A;  1HOM A;  3DF8 A;  3ZRG A;  1F36 A;  1USS A;  5CVJ A;  1T39 A;  2HU9 A;  4EJU A;  1O3S A;  5IOZ A;  3WHB A;  5E3M A;  1ZG5 A;  3QP6 A;  3HBL A;  1BBY A;  2L7M P;  4CZC A;  5FFZ A;  2QUF A;  3H9J A;  1SD7 A;  3OY9 A;  3GTP J;  1U8B A;  2COB A;  1XS9 A;  2YR2 A;  2BY3 A;  2R7V A;  1ULY A;  2FBH A;  3K7A J;  4CUG A;  1IUF A;  3ABL H;  3G4S I;  2KIF A;  1JKP C;  4BU2 A;  1ODD A;  5BPI A;  4BQO A;  2L02 A;  1D5V A;  1O3Q A;  1ETK A;  2CQX A;  2L4M A;  4X0G A;  5E3L A;  5JVG F;  1PVE A;  1FOY A;  4LMY A;  3OSG A;  2JPC A;  3VDX A;  4P55 A;  1LPQ A;  1QPI A;  2NXN B;  1U0J A;  1HBX G;  3QAH A;  1JKO C;  2FQ3 A;  4XK4 A;  4UUV A;  4QTR A;  2VXZ A;  1XSX A;  5DM6 F;  3HOV J;  1ZGW A;  3FM5 A;  1NK2 P;  3O8G A;  2E35 A;  3BG6 A;  2DOF A;  3R4K A;  4ESB A;  4CGZ A;  2H94 A;  3CP8 A;  3QPT A;  3HOU J;  4E7Z A;  2QQ8 A;  2LMD A;  2XGE A;  4B1R A;  4A3I J;  4A2U A;  4HQM A;  4MIM A;  2K9M A;  1ZLJ A;  3LSP A;  4NC7 A;  5E17 F;  1U2W A;  4D9J A;  3BTJ A;  3SZG A;  1GVJ A;  2KFD A;  4BYY A;  4BXU A;  1N77 A;  4ZTF A;  2K9N A;  3K4K A;  3B6A A;  3REO A;  3HHH A;  4PSX A;  1K61 A;  1YJ9 I;  1RR8 C;  3G73 A;  5K5Q A;  1VQL I;  1JHH A;  2A07 F;  5F6F A;  2FD5 A;  4L5E A;  2QKM B;  2ZO4 A;  5D8L B;  3WG7 H;  1N25 A;  3S17 J;  1MBH A;  2VQL A;  1Z9C A;  1JGS A;  1GV5 A;  2ZJ2 A;  3HSF A;  2FRH A;  3WTS C;  3O3K A;  1YHQ I;  2XB5 A;  2E1O A;  3AKZ A;  1TC3 C;  2PJR A;  2HDW A;  2XUB A;  1ZRE A;  1RRJ A;  2R7F A;  2KJB A;  1R23 A;  2AQE A;  1FY7 A;  1B6A A;  3VOD A;  1BI3 A;  2A3S A;  2CFO A;  4U0Y A;  2L7K A;  3AG4 H;  3UNG C;  2RQP A;  3KEQ A;  1YW9 A;  4XLE A;  2FF4 A;  5J6X A;  4BE2 A;  4M6Y A;  4PCQ A;  3CTA A;  1IUY A;  4KIF A;  2EK5 A;  2JA6 J;  2LY2 A;  2R7Z J;  5EZH A;  1YW8 A;  1Z05 A;  3AG1 H;  1NG6 A;  1GHC A;  3HRU A;  3C2H A;  5K5O A;  5J8F A;  3BTI A;  3DTK A;  2OA4 A;  1BR4 A;  3ASN H;  3AL0 B;  2YX7 A;  5H2F C;  3CZ6 A;  2P4W A;  2EIJ H;  2OQG A;  2Y69 H;  4KT5 C;  4GDF A;  1BJZ A;  2LOO A;  2K86 A;  1IXR C;  3FHN A;  3DLA A;  5K1Y A;  2X1E A;  2J5O A;  2F2E A;  3WOD F;  2NVX J;  5L3B A;  2ESH A;  1DUX C;  2H6C A;  1JJ6 C;  1YRN A;  1JT6 A;  4ETS A;  1W5T A;  2VAS A;  4XOR A;  1DPR A;  5C44 J;  1MBG A;  2KPM A;  1FX7 A;  2JVH A;  4E70 A;  4EM0 B;  1X3W B;  3R60 A;  1WJD A;  5TIS C;  4F7Z A;  3JAM Z;  1KU3 A;  3JRA A;  1QZY A;  2A05 A;  2W25 A;  1BW6 A;  1LVK A;  1T38 A;  1S7A A;  2WB1 A;  3LSH A;  4DBR A;  2O3F A;  5IT9 K;  3G1O A;  4I01 A;  4NQW A;  3W6V A;  4AID A;  1FTZ A;  4XLN F;  2HTS A;  3E6C C;  1FYK A;  2JSC A;  4UVB A;  4XOP A;  1YFH A;  1ITY A;  3T8R A;  3K4C A;  2CW0 F;  1WJA A;  3KZZ A;  2VC1 A;  5FKM A;  1BIB A;  2E5N A;  2DAO A;  3L2U A;  4HX7 A;  1HQC A;  2O8X A;  2LRE A;  1TWC J;  3A03 A;  2E1M B;  1V55 H;  4L5J A;  2VN2 A;  3VYS B;  3GTM J;  1E2X A;  1F5T A;  2HNH A;  1YS6 A;  3CF5 F;  1TQP A;  1R58 A;  4IF4 A;  1IV6 A;  1R49 A;  2EB7 A;  1FMV A;  3LFK A;  1ZH5 A;  3S93 A;  1AOY A;  2XPV A;  4GO1 A;  4YEJ A;  3RKW A;  4ASN A;  2EA4 A;  3RIR A;  1TL8 A;  3HIF A;  3RQ4 A;  1QVT A;  2NYX A;  5EEG A;  5HVQ C;  1P6R A;  1TQM A;  1VFC A;  4XKB A;  1RIO H;  5D4S A;  1P4W A;  4I76 A;  2VPL A;  3BTL A;  1NTC A;  4PSW A;  3HG9 A;  3GFJ A;  3J80 Z;  3MCZ A;  3I58 A;  3BOQ A;  3S1R J;  2KLO A;  5CVI A;  2LTP A;  1XN7 A;  2X85 A;  4IRH A;  1MMG A;  5D5X B;  5M5W J;  2BY2 A;  1Y1W J;  3TED A;  1D3Y A;  1X1C A;  1D1A A;  4DZP A;  3F3X A;  1KZH A;  5DCM A;  2KRC A;  4G8X A;  3ZN0 A;  2WAQ A;  3KCC A;  1IN7 A;  3FHZ A;  2XAG A;  3HKZ N;  1Z3Y A;  3HPH A;  2EFP A;  2FJ1 A;  2DPU A;  3L2W A;  2M45 A;  1IDZ A;  2BEO A;  3DTI A;  1PYV A;  5F04 A;  2AXT C;  5ERI A;  3SDG A;  3GCM A;  3IWZ A;  1ETX A;  3E6M A;  2JMW A;  2RV8 A;  4A5M A;  4UV8 A;  2V79 A;  3VPR A;  4DIQ A;  3WU1 B;  1POG A;  3KYL A;  2EIM H;  2QYO A;  2WTE A;  3J80 K;  2X4H A;  1G3Y A;  4HA8 A;  1RES A;  2K9L A;  3ZPL A;  3GW2 A;  2VOD A;  3K4J A;  5LEJ A;  4E7L A;  1Z91 A;  2HOE A;  5EYR A;  3CCJ I;  1W5C C;  2E5Z A;  2ZXH A;  4XBF A;  3DLL F;  2FNA A;  2XF7 A;  4Y13 A;  1WWX A;  3I56 I;  2HQN A;  3CMY A;  4AIH A;  2CJJ A;  3HPG A;  2DYR H;  3T8T A;  2DA5 A;  3M8J A;  5BOX A;  1F1Z A;  2I8D A;  1A36 A;  2AQF A;  1LNW A;  3CLO A;  4JQF A;  3VB2 A;  2WAQ N;  5D6F A;  1YYV A;  1SVO A;  2RNG A;  1IGN A;  3NWT A;  2NVY J;  3PUB A;  3E7L A;  4P9F A;  2MYS A;  2VI6 A;  4HNT A;  4BDY A;  4Q4Z F;  2JUC A;  3GUD A;  5J3L A;  3G71 I;  2LFB A;  3TW6 A;  3OYI A;  4AVP A;  4E4H A;  2M2E A;  4ZTJ A;  3G1M A;  4CCJ A;  4A6E A;  2X6O A;  3CJR B;  3JRF A;  3E0J B;  1OCP A;  4HAM A;  1GVD A;  1Z3X A;  3W2V A;  1JKQ C;  3CO7 C;  2CS3 A;  4YFN F;  4M9Z A;  3HUG B;  3FXU A;  4OMZ A;  1H8A C;  1D1C A;  1FPQ A;  3PO3 J;  3QYF A;  1T08 B;  1WH7 A;  2WV0 A;  3ASO H;  2DW4 A;  6PAX A;  1LDK B;  1LKX A;  2V1N A;  1R71 A;  2ELJ A;  4M6V A;  1XSV A;  2ZJQ F;  2W57 A;  3BZK A;  5CQE A;  3I54 A;  1AU7 A;  4IPA A;  4LD5 A;  4BGD A;  3HEF A;  2K02 A;  2JJ7 A;  2M5W A;  2HQR A;  2L5Q A;  1BI0 A;  3BP8 A;  4FX4 A;  4XLA A;  2WBM A;  5H6R A;  2VOP A;  2UUZ A;  4IHT A;  2HXO A;  5DCM B;  3HYI A;  3LSK A;  1ETV A;  2QZ8 A;  1D5Y A;  1Z1D A;  2GA1 A;  2PQ8 A;  4XL9 A;  2GM4 A;  2PLY A;  2VLA A;  4ZZD A;  1MBJ A;  2IXS A;  1QGP A;  3V4G A;  4DYC A;  2W7N A;  2X1C A;  2V1U A;  1R4M B;  2VUM J;  3K4L A;  2VL8 A;  2VQC A;  3A01 A;  1C0W A;  2F5V A;  3L09 A;  4RAZ A;  3AL0 C;  3RZO J;  5ICG A;  1HKT A;  2Q1Z B;  3AG2 H;  2ZXW H;  3OYH A;  3JRC A;  3BR5 A;  4KDP A;  3GTL J;  3KP3 A;  4OIR F;  1G2H A;  5M5Y J;  1WFX A;  2V9K A;  2QA4 I;  2R0Q C;  3FIW A;  1Q1V A;  1JXS A;  1F9N A;  3IWF A;  1VTN C;  4HF1 A;  1UST A;  2KP6 A;  4CYD A;  4XQF A;  1IXS B;  2RDP A;  3DXJ F;  1QQI A;  2R93 J;  4B44 A;  1RNL A;  3K69 A;  3MZY A;  4DNC A;  5HNH A;  4IVN A;  4Y52 J;  3OR1 C;  1UEL B;  1FP1 D;  2CFX A;  3BPX A;  2IA0 A;  3M8F A;  3WTZ A;  2JA5 J;  3V8L A;  2M0C A;  3H3V K;  1J2X A;  1OLT A;  4YIR X;  4BE1 A;  3LNQ A;  4ABZ A;  1XGS A;  5F0H A;  1S29 A;  1S6L A;  1YS7 A;  2M4K A;  3I64 A;  3JSO A;  3RTR A;  3N4M A;  1QA6 A;  5LFA A;  3R0J A;  4Q48 A;  3U2R A;  3S1Q J;  4U0V A;  2A5Y B;  2EZH A;  2AS5 F;  3FKI J;  1Y8Q B;  4E7K A;  4IL6 C;  4XLF A;  3CDH A;  4PJJ A;  5HOD A;  1BM9 A;  2CQN A;  2LDU A;  4PGH A;  2CUE A;  4MFD A;  3WGI A;  1WKM A;  2VKE A;  3VYR B;  4I0A A;  1CF7 A;  3HC7 A;  1BOB A;  2XDV A;  4R8H A;  3HOS A;  1RR7 A;  1BR2 A;  3V8J A;  1GDT A;  2BHZ A;  1RZ4 A;  2BBY A;  3FK6 A;  1REP C;  4L18 B;  2EBI A;  4A3K J;  3H3U A;  2R4G A;  3IAS 2;  4G7H F;  5EG0 B;  3HUG A;  1SAX A;  3DCF A;  2NNN A;  1MBE A;  4UHT A;  2ZNY A;  3R61 A;  3K9T A;  4BS9 A;  2P6S A;  2PEX A;  1PUE E;  3M1C A;  3MN2 A;  1AWC A;  4HLX A;  4N0B A;  1S3J A;  5GPA A;  1N78 A;  2IT0 A;  5GAD J;  3Q0W A;  3MKW B;  4HZF A;  3OYA A;  1RUO A;  4CH7 A;  3OYC A;  1IRZ A;  3GTG J;  3S16 J;  2E36 A;  2PN6 A;  2P7V B;  3LFU A;  2XHK A;  1I6H J;  2DMP A;  2WAF A;  5IP9 J;  3ZQ7 A;  2FE3 A;  3ZQI A;  3EDP A;  4LLN A;  2XPW A;  2IA2 A;  2KHM A;  3V7C A;  1BL0 A;  2LRD A;  1P7I A;  3KP5 A;  4AM3 A;  3CC7 I;  2O8K A;  2GXA A;  1SMY F;  4G6T B;  2OZU A;  4EAT A;  2IVM A;  1G3W A;  3DP7 A;  4GXO A;  5E3N A;  2MH9 A;  3HZJ A;  5HDG A;  2LK2 A;  1EKE A;  1ON2 A;  1OYW A;  2DK8 A;  2OTJ I;  3L00 A;  2DTR A;  2XKO A;  2HYG D;  3BY6 A;  2DK5 A;  2RNJ A;  1J7K A;  1FP2 A;  2UXX A;  3S3O A;  1MZB A;  3J7A O;  2WA0 A;  1BOA A;  5DV5 A;  2CV2 A;  4ZYG A;  1RPW A;  1H9G A;  3DTE A;  3M07 A;  4CYC A;  4WXH A;  5BQT A;  2DT7 B;  4XKC A;  1HW2 A;  2Y31 A;  1LB2 A;  1T2K A;  2L0K A;  2A6H F;  4EM1 A;  3V8K A;  1IRF A;  3WTU C;  4RMN A;  4O5V A;  2Y0S A;  3A0B C;  3DWL E;  1I27 A;  4L9V A;  3ZMU A;  1SVL A;  4HG2 A;  4A3C J;  3EYY A;  3JRE A;  5FD6 A;  1WJE A;  2FML A;  2UWM A;  2RVC A;  3TBI A;  2VE9 A;  1YIT I;  3EET A;  3A1Y A;  1RUN A;  2HOA A;  2VOO A;  3RKY A;  3I59 A;  3CDL A;  5DYM A;  4U7B A;  1IG7 A;  5KCM A;  2GAU A;  2K4J A;  3NRV A;  1MJA A;  3HOX J;  3DEW A;  1VQK I;  3K4B A;  2M3A A;  4UNO A;  2R5Z B;  3PFI A;  3RZD J;  5J47 A;  1O57 A;  1IRX A;  4RGU A;  5F64 A;  4KN4 X;  2HFH A;  1X19 A;  5JLW A;  2L9V A;  4XNF A;  4UV9 A;  5HLI A;  1MKM A;  1CQT A;  2V1D A;  1JTX A;  1SFK A;  3DKX A;  3HB9 A;  3F0C A;  2E1M C;  1WJF A;  2OCE A;  4Y15 A;  5CKT A;  4Y4R A;  2OAZ A;  5J4Y A;  5LEK A;  5EG0 A;  3TO9 A;  4CSW A;  4WX9 A;  2GXG A;  1OYI A;  5EGO B;  2EV6 A;  5FKK A;  1BI2 A;  2NS0 A;  1UAA A;  5JHU A;  3QRF F;  1HC8 A;  2F48 A;  4M9X A;  3M1E A;  3DPU A;  4U0W A;  2R7W A;  2GBY A;  3H9Q A;  3LQQ A;  3T5X A;  1R1U A;  5B1A H;  4P9U A;  4FAS D;  4I2O A;  3BG3 A;  2K9S A;  3GLX A;  5HS9 A;  2FXA A;  1XMX A;  4XRF A;  2ICW G;  1UMQ A;  3CJN A;  3BR0 A;  4F55 A;  1X58 A;  2ZSH B;  3A4C A;  3CUO A;  3GZ6 A;  3OL4 A;  2DFF A;  1GV2 A;  4AIJ A;  2H1K A;  5L3E A;  3CCR I;  1B9N A;  4XKV A;  4D5F A;  2J5P A;  3D0S A;  2JPB A;  4ZDP A;  3NAU A;  3OOP A;  5EDN A;  3K70 C;  3ZP5 A;  1ETQ A;  2H09 A;  1U3E M;  5AON A;  2ZXI A;  3E1S A;  4G7Z F;  1OR7 A;  1J09 A;  2DMQ A;  3ROU A;  2VKV A;  3I9V 2;  1I3A A;  1ETO A;  5ILV A;  5L3G A;  1JGG A;  4HV5 A;  2L9N A;  3BT9 A;  3FMQ A;  3CES A;  4MTD A;  4X1E A;  3RPU D;  3F9K A;  3JAM K;  2R7D A;  1T33 A;  4IRI A;  3K2Z A;  4PJN A;  1ZRC A;  3OIP A;  1KA8 A;  2QBY A;  1YG2 A;  5J8C A;  4KNY A;  2M7B A;  3F6V A;  4HW0 A;  4F52 A;  5LGN A;  4M3F A;  2M87 A;  2CQK A;  1SFE A;  2A69 F;  3U21 A;  1HST A;  3WGG A;  5BNG A;  4A5N A;  1MNM C;  3HOW J;  2EQR A;  4ESF A;  1QPM A;  3K4M A;  3JTG A;  2FBI A;  3LWF A;  1TW3 A;  5H6Q A;  2TDX A;  1K6Y A;  1PUF B;  1IJW C;  3I55 I;  4ZYA A;  2H1L A;  4GRI A;  1FZP B;  5C4J J;  1TWG J;  4LIT A;  4S05 A;  1G3T A;  1SC7 A;  1G3S A;  3E3V A;  1X4O A;  3GVA A;  4CA0 A;  3B02 A;  3LAJ A;  4BJ5 C;  3PQJ A;  1V5F A;  5B1B H;  1ZGA A;  2DPD A;  1SVM A;  1YE9 A;  3J7Y J;  1O3T A;  2VBY A;  4ON0 A;  3S2W A;  2F4M B;  3GTK J;  2AO9 A;  2KMU A;  3FXR A;  4AD9 A;  1WH5 A;  4CXF A;  2EH3 A;  2ZXJ A;  1W7P D;  4MO7 A;  4B48 A;  1J9I A;  5HS8 A;  2X51 A;  3GYH X;  4B47 A;  2HQ5 A;  2BY0 A;  1MW7 A;  4LOC A;  1K4T A;  3BPV A;  4A69 C;  1SD6 A;  1R5I D;  2AHQ A;  5GAH J;  1GXQ A;  4A3D J;  2M9H A;  2MGQ A;  4G94 A;  1YJW I;  2Y75 A;  3PM1 A;  4WCG A;  2QVO A;  4G7O F;  3K4N A;  4FCY A;  3FZV A;  1SFX A;  2WAE A;  4KA4 A;  4L5I A;  5HLG A;  4LK1 F;  9ANT A;  3PSI A;  2DMN A;  3BWG A;  1I39 A;  4ZH4 F;  3TO6 A;  4BJ6 C;  1QO0 D;  2IPQ X;  4EMS A;  4UUS A;  5JFR A;  3HOT A;  2EIN H;  3GX4 X;  2DMU A;  2Y48 A;  2HKO A;  2Q8K A;  2A61 A;  4EJV A;  2ADU A;  3QYE A;  4HYE A;  2BE5 F;  5EEH A;  3FWE A;  4PJL A;  2R7U A;  2E2J J;  4G6Q A;  2V1X A;  3V7R A;  2ISY A;  3F8B A;  2BW3 B;  3O8H A;  4MQ9 F;  2HWV A;  4IHY A;  2H8W A;  2XGC A;  4BEH A;  1SD4 A;  2O5R A;  2BHY A;  2BV6 A;  2JRM A;  3BC8 A;  4N9I A;  4RS8 A;  5A2Q K;  1L3L A;  4L0Y B;  4L0Z B;  4U7D A;  1QU3 A;  4Y3O A;  2VJJ A;  4RLQ A;  1K79 A;  1DU0 A;  3L1P A;  4PUS A;  4N4O B;  1MND A;  2JA7 J;  2L3D A;  3H36 A;  2L7Z A;  4M72 A;  1CF7 B;  2ZME A;  4HNV A;  3ONQ A;  3S3M A;  4IJA A;  2XRN A;  2GZW A;  3KLN A;  3SFI A;  1HA8 A;  2PFB A;  2CRG A;  2L9R A;  2CV0 A;  1FBQ A;  4A3G J;  4KJZ A;  3A2K A;  1ZKG A;  3BTC A;  1U9N A;  2LG4 A;  4L9N A;  1DQU A;  3L7W A;  2HS5 A;  2IW5 A;  5LGT A;  1G8X A;  2XIG A;  1Q1H A;  3ML6 A;  2PG4 A;  4LFU A;  3H3Z A;  3WG9 A;  4UUS B;  3L2Q A;  1Z6T A;  2Z9O A;  3TO7 A;  3O2P E;  4A6D A;  2GA2 A;  5J1Y A;  1U5T B;  1CGP A;  1J59 A;  3G3Z A;  2XAU A;  1P4X A;  2EFQ A;  4HPQ A;  1VQ4 I;  2MG4 A;  2XRL A;  2LC2 A;  2BW3 A;  3KYD B;  2TRT A;  1G59 A;  4MQV A;  3PIP F;  1VQ8 I;  2N8G A;  3KP2 A;  4S04 A;  2KIS A;  3RDI A;  1XCB A;  1NG7 A;  1JTY A;  2HVR A;  1U8R A;  2UZK A;  4RB3 C;  2P7C B;  2TCT A;  3P9I A;  1OKR A;  2XAQ A;  3P9C A;  3HOY J;  1LDJ A;  3IHU A;  2JTV A;  1BW5 A;  2M8E A;  1JT0 A;  3E97 A;  2ZKZ A;  3H0G J;  1MSF C;  1EF4 A;  2K5C A;  4NUB A;  2DOE A;  3FXQ A;  2IS2 A;  2KKO A;  2W84 A;  3CCV I;  3HDD A;  4E7H A;  2B0L A;  1RET A;  1BR1 A;  3KZI C;  5B66 C;  2E19 A;  1S9H A;  4EV0 A;  3Q9V A;  3EUA A;  1D1B A;  2ZJP F;  4Q47 A;  1B8I A;  2MBF A;  2EFN A;  3KFW X;  1QBJ A;  1TNT A;  3SQN A;  1R7J A;  5HNF A;  5FRN A;  5C3E J;  1WJC A;  4IRG A;  1LVA A;  3PNT A;  3I59 B;  1KQ8 A;  2LVS A;  2XGD A;  1NHA A;  2OUM A;  3CC4 I;  3Q5F A;  4M3G A;  1I50 J;  4LJZ F;  3P9K A;  1FBU A;  2R7T A;  1UHW A;  1RKW A;  1Y0U A;  4M9S A;  1YIJ I;  2E2I J;  1K78 A;  4HST A;  3PQK A;  2IP2 A;  5L3C A;  2HOS A;  3HTU A;  3VFZ A;  2LD5 A;  3K2A A;  1LFP A;  3OV8 A;  5ICE A;  4RB2 C;  4BY1 J;  2MD5 A;  2CGP A;  4NNJ A;  1Z7U A;  2EFW A;  1G4D A;  3HRM A;  4OU0 A;  5E1Z B;  2ECC A;  5F27 A;  1ERD A;  3QPS A;  1UHS A;  2H6B A;  1ZN2 A;  4XM3 A;  2LSO A;  4BQN A;  5FKO A;  1R5H A;  4BHB A;  4XRS A;  4CO8 A;  3OS1 A;  3SYT A;  1P92 A;  1X3Z B;  3FBN B;  2KDZ A;  2VKH A;  2E7X A;  3BR6 A;  2EIL H;  1TP4 A;  3L2R A;  4M73 A;  4OIN F;  2LY9 A;  2ACJ A;  5EZG A;  5EEA A;  2X6Y A;  4U88 A;  5E1X A;  5ICC A;  4X6A J;  2CU7 A;  2F6C A;  3F8M A;  3S14 J;  3ABK H;  3Q3S A;  3BJA A;  1OPC A;  5JHF A; 
#chains in the Genus database with same CATH homology
 4KIB A;  4OOI A;  5H20 A;  3JSP A;  2W85 A;  5HOO A;  4YII A;  3WU0 A;  4IXA A;  1H0M A;  2W24 A;  5D5W B;  4AWX B;  1I6X A;  1U78 A;  1MJ9 A;  2D1V A;  3QOP A;  3I53 A;  1YQA A;  4D0P A;  3RYP A;  2XKP A;  2HDC A;  5LRS A;  4ZYH A;  2XAJ A;  3ZMZ A;  2CSO A;  3IRR A;  4GGG A;  2OBP A;  5FGM A;  3LA7 A;  1BC7 C;  5JR3 A;  2P5V A;  1I1G A;  5BS6 A;  5CVR A;  1X3U A;  4MEX F;  1MJB A;  5AIQ A;  4EGY A;  4NB5 A;  5FLX K;  3GXO A;  1IW7 F;  4IHS A;  4ENM A;  2JZY A;  4H0E A;  5JI6 A;  3IKV A;  1PDN C;  1XD7 A;  1UB9 A;  3BDD A;  3HSE A;  4KUM A;  3WTX C;  4WK8 F;  1ZAO A;  2F5D A;  2HR3 A;  3JTH A;  1FT9 A;  2D1H A;  5K5R A;  4HF2 A;  5LHH A;  2Q2E A;  1STZ A;  5D6E A;  5CVV A;  3W6J B;  2O0Y A;  3ZN1 A;  3F21 A;  1XCV A;  3CUQ C;  5CVU A;  1KU9 A;  2ESN A;  4WWC A;  1IN6 A;  3CO6 C;  4YIF A;  2K7L A;  3JW4 A;  1T0F A;  3L2C A;  4G6D A;  4HLY A;  2F5F A;  3SXY A;  2LF7 A;  4JK1 X;  4Y17 A;  2HYF A;  1W7P A;  1ZGJ A;  1J5Y A;  4EM2 A;  2ISZ A;  1ZLK A;  5KK1 A;  1U5T A;  3GEZ A;  2DO7 A;  2XAH A;  5CLS A;  1PP7 U;  4LB6 B;  4A0Z A;  1YIO A;  2GIV A;  4RGX A;  1JHF A;  3LA2 A;  4HDU A;  1B59 A;  5JVT A;  3U9G A;  1B9M A;  2AXL A;  1ZG1 A;  2OQR A;  1XB4 A;  5DDG A;  5DD4 A;  3K1M A;  1DPU A;  3FMS A;  3ECO A;  5A2Q Z;  3EYI A;  3DEU A;  3K0L A;  1XSD A;  2X0L A;  1LEB A;  3KLO A;  4OMY A;  2P5K A;  2E7W A;  2H27 A;  4HOB A;  2FU4 A;  2EV5 A;  1I1S A;  2MC3 A;  3RKX A;  3TDU C;  4FT8 A;  3V7S A;  3MAJ A;  4ZYE A;  2K4B A;  1EH8 A;  5DD8 A;  1K78 B;  2M30 A;  5TJJ A;  1GXP A;  3GFM A;  1LDD A;  2FOK A;  1S7O A;  2DI3 A;  1BIA A;  2XV4 S;  1YTY A;  4BH9 A;  2KIM A;  4HX4 A;  1XDU A;  4LLG F;  3CUQ A;  5FLX Z;  4BHC A;  5HS7 A;  4NHJ A;  4L9T A;  3F22 A;  1PP8 F;  2A68 F;  1R00 A;  4PZJ A;  4EJT A;  1R1V A;  1F4K A;  1TQI A;  2E1C A;  2GWR A;  3WTT C;  2NNY A;  3RYR A;  2YPR A;  3E5X A;  4BQA A;  3LQR A;  4B8X A;  3E5U A;  4LLL A;  2G7H A;  3F8F A;  3ISP A;  4B09 A;  2O03 A;  3BJO A;  3MQ0 A;  2Z3Y A;  4QWQ A;  3E6B A;  1MD0 A;  5F1R A;  1TLH B;  2HZT A;  3KP4 A;  2PMU A;  5LLQ A;  3MWM A;  3AAF A;  1IN8 A;  1LQ1 A;  1IF1 A;  3SZT A;  1ZRF A;  3FX3 A;  2P6T A;  4EGZ A;  2Q0O A;  1XGM A;  3LA3 A;  5ILS A;  1S8N A;  1WRJ A;  2Y0M A;  2VC0 A;  3VOE A;  4A0X A;  1BJA A;  5BMZ A;  5E20 A;  3ELK A;  2DFI A;  4LG0 B;  3NQO A;  2GXB A;  2ZBK A;  1FLI A;  5LHI A;  1V3F A;  3I71 A;  3WTW C;  3BRO A;  3P7N A;  3DV8 A;  3SFZ A;  3E5Q A;  3KP7 A;  2F5E A;  2ZCW A;  2VBZ A;  3RI4 A;  2STT A;  4AIK A;  1FSE A;  1IRG A;  1KU7 A;  3I0T A;  1ONV A;  3DQV C;  3RPQ A;  1KGS A;  2OZ6 A;  4ENN A;  4ESJ A;  3HHG A;  3MFK A;  3C1D A;  4HF0 A;  1P4A A;  2LNB A;  3NEU A;  3GFI A;  2BGC A;  1R36 A;  1WSU A;  5FD5 A;  1IZ1 A;  3IL2 A;  3HRT A;  4UXN A;  4O3M A;  1K7A A;  1XDS A;  2KIU A;  1OYY A;  2DU9 A;  5FB2 A;  1SMT A;  1J0R A;  3C3W A;  1HKQ A;  5TRD A;  2FMY A;  1H9T A;  3T0Y A;  2YSR A;  2RN7 A;  2XGX A;  3HRS A;  3ZMS A;  1DP7 P;  1J75 A;  1XGO A;  1YLF A;  1JE8 A;  1BI1 A;  4FHT A;  4I0B A;  3J81 Z;  3ULQ B;  4RB1 A;  2VBW A;  4LG0 A;  1HW5 A;  4CIC A;  4HQE A;  3I4P A;  1HSJ A;  3ZMV A;  1XGN A;  4I09 A;  4PDK A;  3GZ5 A;  3TQN A;  1KQ0 A;  4ZZL A;  1IXC A;  4WXD A;  3ABT A;  1B4A A;  5KVR A;  2IJL A;  4KFC A;  1W5S A;  4M71 A;  2QQA A;  1EH7 A;  5HDK A;  1HW1 A;  1K6O A;  4KMF A;  3M7G A;  5D5V B;  3TOA A;  3MEX A;  2FBK A;  5ED4 A;  5CYV A;  1RI7 A;  5D8K B;  5AIP A;  4I02 A;  1YW7 A;  1WQ2 A;  4R79 A;  2FNP A;  3TOB A;  1KYW A;  4KMU X;  3LAP A;  4I98 B;  4Q5S F;  4O6J A;  4UVA A;  3HSR A;  2KRF A;  5DUK A;  2VT2 A;  1D8K A;  2CWE A;  1R1T A;  1MDM B;  5CJ9 A;  2QWW A;  2LKP A;  4MTE A;  2V6C A;  1V4R A;  3ABU A;  5LGU A;  2OU2 A;  4BNC A;  3F8C A;  1W4M A;  3IKT A;  3K1N A;  2D45 A;  3RJP A;  3QPH A;  4RGR A;  4A0Y A;  3TGN A;  4LB5 A;  1T6S A;  2L4A A;  3QU6 A;  3QU3 A;  5HLH A;  2NAZ A;  1ZAR A;  2O61 A;  3WE2 A;  4CZZ A;  1TW2 A;  2CO5 A;  4I7H A;  5L3D A;  2FSW A;  3FMR A;  1XMA A;  2XRO A;  3W6K B;  5E18 F;  3O6B B;  3GWZ A;  2QM3 A;  4EVI A;  2E1N A;  1MGT A;  3Q9S A;  5DCF A;  5E8I A;  4EQQ A;  1KU2 A;  5L3F A;  2DT5 A;  1U5T C;  2PJP A;  2L54 A;  4XSX F;  3F6O A;  2ETH A;  5E8G A;  1P2F A;  2G7U A;  1BN5 A;  4KYW A;  2EA2 A;  2IA1 A;  1FYM A;  1IAW A;  1ZRD A;  2PMH A;  4L9J A;  3ZMD A;  4MEY F;  1O3R A;  1TTY A;  3R0A A;  4R1H A;  4JBA A;  3RPU A;  3WTY C;  1KYZ A;  4EJO A;  4OIO F;  3DPL C;  2PI0 A;  4LGW A;  2BYV E;  2WWY A;  2STW A;  1LEA A;  3F72 A;  1IN5 A;  1U6G A;  4P96 A;  4RB0 A;  4LK0 F;  4M6X A;  2QLZ A;  3D5L A;  1TBX A;  3GFL A;  1FNN A;  1ON1 A;  3F8N A;  4FX0 A;  2KJC A;  1E17 A;  3TKY A;  4MHG A;  1R22 A;  2QBY B;  3DFG A;  4OIP F;  1SFU A;  3HTS B;  4MGR A;  3KP6 A;  3M8E A;  1KQ9 A;  1W7P B;  4YG2 F;  4TV7 A;  2NRA C;  3B73 A;  1DDN A;  4WXC A;  1L0O C;  4ZYD A;  2QQB A;  2JRT A;  3TDZ C;  3QP5 A;  3DPT A;  4YFX F;  1Z6R A;  1I5Z A;  3WGH A;  3DKW A;  2EJR A;  2D2W A;  2CYY A;  2YX4 A;  3F23 A;  4XLP F;  2P5L C;  3SZP A;  4HV6 A;  4GYI A;  2WC2 A;  1YO5 C;  1XMK A;  2YU3 A;  3BZ6 A;  5IT9 Z;  3GF2 A;  2F5C A;  3IC7 A;  1OMI A;  5D5U B;  3WTV C;  1A04 A;  1FC3 A;  3H92 A;  2P8T A;  4PGG A;  2MH2 A;  5LRR A;  3E6D A;  1FSH A;  4HBL A;  1EH6 A;  4P5O A;  2JT1 A;  2IRF G;  3ERE D;  1ZG3 A;  2XVC A;  3KZY A;  2VON A;  3L9F A;  2HKX A;  4G9Y A;  2DQL A;  4KIC A;  2MLG A;  3K1P A;  3SHF A;  2ZFW A;  1ZYR F;  2PBI A;  3CUQ B;  3BJ6 A;  5FFX A;  1G6N A;  2GQQ A;  4RAY A;  1O7F A;  4M74 A;  3LST A;  4RGS A;  3IRQ A;  5E1W A;  2HEO A;  5DEQ A;  1MDM A;  4YFK F;  3ZMT A;  5D4R A;  1TNS A;  1FBS A;  1HKS A;  3J81 K;  2O6G E;  4HDV A;  2QEN A;  4OIQ F;  2EWN A;  4MNU A;  1FYL A;  3ECH A;  2A6E F;  2VBX A;  2K27 A;  2CG4 A;  1IN4 A;  2UXN A;  1HXD A;  3T1B A;  3FF5 A;  2EFO A;  2EV0 A;  3EUH A;  4UVC A;  1LJ9 A;  1WI9 A;  2Z5U A;  2MLK A;  2MA3 A;  1B1B A;  4K2E A;  5ICF A;  2DQR A;  2RGV A;  5LBQ A;  2Z33 A;  3M9A A;  2M1B A;  4GYG A;  2RKH A;  5IT3 A;  4ENJ A;  1UCR A;  4N9H A;  2OD5 A;  1SD5 A;  3KEO A;  1D8J A;  5DUI A;  2HGC A;  2DLL A;  1R5G A;  2FA5 A;  2G9W A;  2R3S A;  2LF8 A;  4A12 A;  2VT3 A;  4BHP A;  4WF2 A;  1UHM A;  3WE3 A;  2XAS A;  3C18 A;  2QQ9 A;  3KE2 A;  4KIG A;  3N97 A;  3GO5 A;  4DQ2 A;  2DBB A;  1FOK A;  4Z2Y A;  2VE8 A;  5FO5 A;  2Z99 A;  3EQL F;  2ELH A;  5LHG A;  4BAY A;  4XSZ F;  4HX8 A;  2C6Y A;  1EV7 A;  4KN7 X;  1ZHF A;  2L01 A;  1BC8 C;  2COM A;  3U1D A;  1FWZ A;  1T98 A;  2FEZ A;  2XAF A;  2ZME B;  1QNT A;  3KET A;  2ZNZ A;  2V9V A;  1UFM A;  3C7J A;  3R6S A;  4QLC U;  3MZH A;  5HDN A;  1O7L A;  5BPD A;  4GCV A;  4CDG A;  3FM3 A;  3I5U A;  3COA C;  4EJW A;  2HTJ A;  2RC4 A;  3VEP A;  1QZZ A;  4ENK A;  4CHU A;  5ILU A;  3DF8 A;  1USS A;  5CVJ A;  1T39 A;  4EJU A;  1O3S A;  1ZG5 A;  3QP6 A;  1BBY A;  5FFZ A;  2QUF A;  1SD7 A;  2YR2 A;  1ULY A;  2FBH A;  2KIF A;  1ODD A;  5BPI A;  2L02 A;  1D5V A;  1O3Q A;  2L4M A;  4LMY A;  2JPC A;  4P55 A;  1HBX G;  3QAH A;  2FQ3 A;  4UUV A;  2VXZ A;  1XSX A;  3FM5 A;  3R4K A;  4ESB A;  4CGZ A;  2H94 A;  3QPT A;  4A2U A;  4HQM A;  1ZLJ A;  5E17 F;  1U2W A;  1GVJ A;  4BYY A;  4BXU A;  3REO A;  3HHH A;  3G73 A;  5K5Q A;  1JHH A;  2A07 F;  5F6F A;  2ZO4 A;  5D8L B;  1Z9C A;  1JGS A;  2ZJ2 A;  3HSF A;  2FRH A;  3WTS C;  3O3K A;  2XUB A;  1ZRE A;  1R23 A;  2KJB A;  2R7F A;  1FY7 A;  3VOD A;  1B6A A;  1BI3 A;  2A3S A;  4U0Y A;  2RQP A;  3KEQ A;  1YW9 A;  2FF4 A;  5J6X A;  4M6Y A;  4PCQ A;  3CTA A;  1IUY A;  4KIF A;  2EK5 A;  1YW8 A;  1Z05 A;  1GHC A;  3HRU A;  5K5O A;  5J8F A;  2OA4 A;  2YX7 A;  2P4W A;  2OQG A;  4KT5 C;  2K86 A;  1IXR C;  5K1Y A;  2J5O A;  2F2E A;  3WOD F;  5L3B A;  2ESH A;  1DUX C;  2H6C A;  4ETS A;  1W5T A;  1DPR A;  1FX7 A;  4E70 A;  4EM0 B;  3R60 A;  4F7Z A;  3JAM Z;  1KU3 A;  1QZY A;  2W25 A;  1T38 A;  1S7A A;  2O3F A;  5IT9 K;  4I01 A;  4NQW A;  4XLN F;  2HTS A;  3E6C C;  1FYK A;  2JSC A;  4UVB A;  1YFH A;  3T8R A;  2CW0 F;  3KZZ A;  2VC1 A;  1BIB A;  2DAO A;  4HX7 A;  1HQC A;  2O8X A;  4L5J A;  2VN2 A;  1E2X A;  1F5T A;  1YS6 A;  1TQP A;  1R58 A;  4IF4 A;  2EB7 A;  3LFK A;  1ZH5 A;  1AOY A;  4GO1 A;  3RKW A;  4ASN A;  2EA4 A;  3RIR A;  3HIF A;  2NYX A;  5HVQ C;  5EEG A;  1P6R A;  1TQM A;  1RIO H;  5D4S A;  1P4W A;  3GFJ A;  3J80 Z;  3MCZ A;  3I58 A;  3BOQ A;  5CVI A;  1XN7 A;  4IRH A;  5D5X B;  1D3Y A;  3F3X A;  5DCM A;  4G8X A;  3ZN0 A;  3KCC A;  1IN7 A;  3FHZ A;  2XAG A;  2EFP A;  2DPU A;  2M45 A;  2BEO A;  5ERI A;  3IWZ A;  3E6M A;  2RV8 A;  4A5M A;  4UV8 A;  2V79 A;  3WU1 B;  2QYO A;  2WTE A;  3J80 K;  2X4H A;  1G3Y A;  4HA8 A;  3ZPL A;  3GW2 A;  2VOD A;  5LEJ A;  1Z91 A;  2HOE A;  4XBF A;  2FNA A;  4Y13 A;  1WWX A;  2HQN A;  4AIH A;  3T8T A;  5BOX A;  1F1Z A;  1LNW A;  3CLO A;  4JQF A;  3VB2 A;  5D6F A;  1YYV A;  4P9F A;  4Q4Z F;  3GUD A;  4AVP A;  4A6E A;  4HAM A;  3CO7 C;  4YFN F;  4M9Z A;  3FXU A;  4OMZ A;  1FPQ A;  2WV0 A;  2DW4 A;  6PAX A;  1LDK B;  1XSV A;  2W57 A;  3I54 A;  4IPA A;  4LD5 A;  2K02 A;  2M5W A;  2HQR A;  1BI0 A;  3BP8 A;  4FX4 A;  5H6R A;  2VOP A;  4IHT A;  5DCM B;  3HYI A;  2QZ8 A;  1Z1D A;  2GA1 A;  2PQ8 A;  2PLY A;  4ZZD A;  1QGP A;  3V4G A;  2V1U A;  1C0W A;  3L09 A;  4RAZ A;  5ICG A;  1HKT A;  4KDP A;  3KP3 A;  4OIR F;  1JXS A;  1F9N A;  3IWF A;  1VTN C;  4HF1 A;  1UST A;  4CYD A;  1IXS B;  2RDP A;  3DXJ F;  1QQI A;  4DNC A;  1RNL A;  3K69 A;  3MZY A;  4IVN A;  1FP1 D;  2CFX A;  3BPX A;  2IA0 A;  3M8F A;  3WTZ A;  3V8L A;  1J2X A;  1XGS A;  1S29 A;  1S6L A;  1YS7 A;  3I64 A;  3JSO A;  3RTR A;  3N4M A;  3U2R A;  3R0J A;  4Q48 A;  4U0V A;  2A5Y B;  2AS5 F;  3CDH A;  1BM9 A;  2LDU A;  4PGH A;  3WGI A;  1WKM A;  4I0A A;  1CF7 A;  4R8H A;  3HOS A;  3V8J A;  1RZ4 A;  2BBY A;  1REP C;  4L18 B;  3H3U A;  4G7H F;  3HUG A;  1SAX A;  2NNN A;  4UHT A;  2ZNY A;  3R61 A;  3K9T A;  2P6S A;  2PEX A;  1PUE E;  1AWC A;  4HLX A;  4N0B A;  1S3J A;  2IT0 A;  4HZF A;  1RUO A;  2PN6 A;  2P7V B;  2XHK A;  3ZQ7 A;  2FE3 A;  3EDP A;  4LLN A;  2IA2 A;  3V7C A;  3KP5 A;  1SMY F;  2OZU A;  2IVM A;  1G3W A;  3DP7 A;  4GXO A;  2MH9 A;  5HDG A;  1ON2 A;  1OYW A;  2DK8 A;  3L00 A;  2DTR A;  2XKO A;  2HYG D;  3BY6 A;  2DK5 A;  2RNJ A;  1FP2 A;  1J7K A;  2UXX A;  1MZB A;  3J7A O;  1BOA A;  5DV5 A;  4ZYG A;  1H9G A;  4WXH A;  5BQT A;  1HW2 A;  1LB2 A;  1T2K A;  2A6H F;  4EM1 A;  3V8K A;  1IRF A;  3WTU C;  4O5V A;  3ZMU A;  1I27 A;  4L9V A;  3EYY A;  5FD6 A;  2FML A;  2UWM A;  2RVC A;  2VE9 A;  3EET A;  1RUN A;  2VOO A;  3RKY A;  3I59 A;  4U7B A;  5DYM A;  2GAU A;  2K4J A;  3NRV A;  1MJA A;  4UNO A;  3PFI A;  1O57 A;  4RGU A;  5F64 A;  4KN4 X;  2HFH A;  4UV9 A;  5HLI A;  1MKM A;  2V1D A;  4Y15 A;  2OAZ A;  5LEK A;  3TO9 A;  4WX9 A;  2GXG A;  1OYI A;  2EV6 A;  1BI2 A;  2NS0 A;  5JHU A;  3QRF F;  4M9X A;  3M1E A;  4U0W A;  3T5X A;  3LQQ A;  1R1U A;  4P9U A;  4I2O A;  3GLX A;  5HS9 A;  2FXA A;  4XRF A;  3CJN A;  3CUO A;  3GZ6 A;  4AIJ A;  5L3E A;  1B9N A;  2J5P A;  3D0S A;  2JPB A;  3OOP A;  3ZP5 A;  2H09 A;  1U3E M;  5AON A;  4G7Z F;  1OR7 A;  3ROU A;  5ILV A;  5L3G A;  4HV5 A;  3FMQ A;  4MTD A;  3JAM K;  4IRI A;  2R7D A;  3K2Z A;  1ZRC A;  1KA8 A;  2QBY A;  1YG2 A;  5J8C A;  4KNY A;  3F6V A;  4HW0 A;  5LGN A;  2M87 A;  2CQK A;  1SFE A;  2A69 F;  1HST A;  3WGG A;  4A5N A;  4ESF A;  1QPM A;  3JTG A;  2FBI A;  3LWF A;  1TW3 A;  5H6Q A;  2TDX A;  1FZP B;  4S05 A;  1G3T A;  1G3S A;  3E3V A;  3GVA A;  3B02 A;  3LAJ A;  3PQJ A;  1ZGA A;  2DPD A;  1O3T A;  2VBY A;  4ON0 A;  3S2W A;  3FXR A;  4AD9 A;  4CXF A;  2ZXJ A;  1W7P D;  1J9I A;  5HS8 A;  3GYH X;  3BPV A;  1SD6 A;  1GXQ A;  4G94 A;  4WCG A;  2Y75 A;  2QVO A;  4G7O F;  3FZV A;  1SFX A;  4KA4 A;  4L5I A;  5HLG A;  4LK1 F;  3BWG A;  4ZH4 F;  3TO6 A;  1QO0 D;  2IPQ X;  4EMS A;  5JFR A;  3HOT A;  3GX4 X;  2Y48 A;  2HKO A;  2Q8K A;  2A61 A;  4EJV A;  2ADU A;  4HYE A;  2BE5 F;  5EEH A;  3FWE A;  4G6Q A;  2V1X A;  3V7R A;  2ISY A;  3F8B A;  4MQ9 F;  2HWV A;  1SD4 A;  2BV6 A;  4N9I A;  4RS8 A;  5A2Q K;  1L3L A;  4L0Y B;  4L0Z B;  4U7D A;  1K79 A;  2L3D A;  1CF7 B;  4M72 A;  2ZME A;  4IJA A;  2XRN A;  2GZW A;  3KLN A;  2PFB A;  1FBQ A;  4L9N A;  3L7W A;  2HS5 A;  2IW5 A;  5LGT A;  2XIG A;  1Q1H A;  3ML6 A;  2PG4 A;  4LFU A;  3H3Z A;  3WG9 A;  1Z6T A;  2Z9O A;  3TO7 A;  3O2P E;  4A6D A;  2GA2 A;  1U5T B;  1CGP A;  1J59 A;  3G3Z A;  1P4X A;  2EFQ A;  4MQV A;  3KP2 A;  4S04 A;  3RDI A;  1XCB A;  1U8R A;  2UZK A;  4RB3 C;  2P7C B;  3P9I A;  1OKR A;  2XAQ A;  3P9C A;  1LDJ A;  3IHU A;  2JTV A;  2M8E A;  3E97 A;  2ZKZ A;  3FXQ A;  2KKO A;  2W84 A;  2B0L A;  4EV0 A;  3Q9V A;  4Q47 A;  2MBF A;  2EFN A;  3KFW X;  1QBJ A;  1TNT A;  3SQN A;  1R7J A;  4IRG A;  1LVA A;  3I59 B;  1KQ8 A;  1NHA A;  3Q5F A;  4LJZ F;  3P9K A;  1FBU A;  1UHW A;  1Y0U A;  4M9S A;  1K78 A;  3PQK A;  2IP2 A;  5L3C A;  3HTU A;  3VFZ A;  3OV8 A;  5ICE A;  4RB2 C;  2MD5 A;  2CGP A;  1Z7U A;  2EFW A;  1G4D A;  3HRM A;  4OU0 A;  5E1Z B;  2H6B A;  1ZN2 A;  2LSO A;  1R5H A;  4BHB A;  4CO8 A;  1P92 A;  2E7X A;  4M73 A;  4OIN F;  2ACJ A;  4U88 A;  5E1X A;  5ICC A;  3F8M A;  3BJA A;  1OPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...