1K79A

Ets-1(331-440)+ggaa duplex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
104
Chain Sequence
b'GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*AP*AP*TP*GP*T)-3')
publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 36
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k79A00
2IA1A 5DV5A 3TO7A 4HQEA 3RYPA 2OQGA 2EFPA 3IWFA 1B6AA 4JBAA 3ERED 4L9NA 3QU6A 3ABTA 4OIQF 4LK0F 2P6TA 2CGPA 3J81Z 4WXDA 2F2EA 5FFXA 2QBYB 4L9JA 4OIPF 1P4AA 5H6QA 4Q48A 2ZO4A 1PUEE 3BZ6A 4M9ZA 1MKMA 1TW3A 3K9TA 5L3EA 4OU0A 1U5TC 2IP2A 2P5VA 1F1ZA 1BI0A 2XAJA 2FSWA 3Q9SA 1HSTA 2IVMA 2WTEA 1XGSA 3M1EA 3HHHA 2PFBA 3K1MA 3OV8A 3F8NA 2K7LA 5IT9Z 1YFHA 3GX4X 1S7OA 3M8FA 1DPUA 2H6BA 4LD5A 3EDPA 3I0TA 2VBZA 4ESBA 1Z7UA 1E2XA 3MCZA 3I53A 4A0YA 4LMYA 3SHFA 1FLIA 3W6JB 4HBLA 4R8HA 4KUMA 3FMSA 3QP5A 1KA8A 3RKXA 2BEOA 1XSVA 1HW1A 1A04A 3DQVC 1FZPB 3I54A 3BPVA 2JTVA 3RJPA 3BJOA 5ICEA 1WWXA 3GF2A 1H9GA 1JGSA 3FXRA 2ZMEB 3U9GA 4B8XA 5ED4A 5BQTA 2RGVA 4L0ZB 3HRUA 4ZZLA 3JTHA 4P9FA 3RYRA 2XKPA 2EK5A 2OAZA 4I7HA 3WE3A 2FNAA 2RNJA 3WODF 1ZRDA 2GXBA 1P2FA 3BROA 3TO9A 1UB9A 5AIPA 3O6BB 2J5PA 4LLGF 1ZARA 4DQ2A 3O3KA 4PCQA 2A6HF 2Q2EA 2X0LA 2A69F 1YW9A 1RUOA 4EV0A 4GYGA 3E6DA 4I2OA 3ISPA 2DAOA 3L09A 3EYYA 4KIFA 3ZPLA 2H94A 3GFLA 5K5RA 3KP6A 5D4RA 3LAJA 4MTEA 2QBYA 3F23A 3RI4A 4EM1A 3F21A 1U5TB 3QPTA 4CICA 2DK8A 3JAMZ 3IRRA 3BOQA 3RDIA 2PBIA 1SFUA 1BJAA 5J8CA 3HTSB 2FBKA 3CLOA 2GXGA 5LEJA 2RV8A 4YFKF 2R3SA 5E8GA 4EM0B 2V1UA 2VT3A 2FXAA 1S3JA 2DFIA 2P7VB 3COAC 4MEXF 5JR3A 4RB1A 2DPUA 4ENNA 4HZFA 3E5UA 1OYWA 4U0WA 1OR7A 1TNSA 1IN8A 2QVOA 3DKWA 5CVUA 4PGHA 5DEQA 2KRFA 5HOOA 3R61A 1F4KA 1FX7A 2BV6A 3V7RA 1MJ9A 5LRRA 3RIRA 1ZGJA 4ZH4F 1SD6A 3KP2A 4O5VA 4XSXF 3TOBA 1OYIA 5HDKA 1ONVA 2RKHA 4XLNF 4M71A 2BE5F 1KU9A 2V9VA 4M73A 2HZTA 4M6YA 3GLXA 4HX8A 4O3MA 5KVRA 2V1XA 4LG0A 3E6BA 4EM2A 2QYOA 1QZZA 4BXUA 1GVJA 2PQ8A 3BP8A 2CO5A 3LA3A 3TKYA 3HIFA 5ERIA 3ML6A 1W4MA 2ZXJA 2FEZA 2L4AA 4RS8A 1D5VA 4LLNA 2FMLA 2KIMA 4QWQA 4UXNA 4KA4A 4L9VA 2D2WA 4EGYA 3QPHA 2V6CA 2OA4A 4XBFA 5JI6A 4KMUX 4CDGA 5LRSA 5D6FA 4I0AA 5A2QZ 1GXQA 2YX4A 2ZNYA 1S7AA 5H20A 2DO7A 4UHTA 5J6XA 2XVCA 2H27A 5FLXK 3H3UA 2D1HA 3LSTA 1ZLKA 2XAFA 1BOAA 1U3EM 4G7HF 2HFHA 3AAFA 2OZUA 1ZAOA 2EFNA 3T5XA 2O0YA 1IAWA 3LA7A 1T39A 5LLQA 1J59A 3MZHA 4AIHA 3U1DA 3K0LA 1V4RA 5E20A 4HF1A 2W57A 1U8RA 1U5TA 1AOYA 2O61A 3V8LA 2X4HA 4IPAA 4RGRA 1SFEA 4L9TA 2QM3A 1YW7A 3F8MA 3KLOA 4HLXA 2KJCA 5FO5A 4N9HA 1R23A 2PLYA 1Z05A 5FD6A 2IA2A 2MLKA 3HYIA 1HSJA 1LDKB 4E70A 2VOOA 4ZYHA 3WGGA 4MQVA 2EV0A 2XIGA 2ZJ2A 2GA1A 1J75A 5EEHA 5JHUA 4A5NA 5ILUA 4ON0A 4P55A 4G7ZF 3DPLC 4A6EA 3GO5A 2NYXA 4I02A 2E1CA 2D45A 2K86A 1XSDA 5CVJA 4OIOF 1IXSB 4Q47A 1XN7A 3I59B 1IF1A 1IXRC 5L3BA 4I01A 1D3YA 3WGIA 5K5QA 1ULYA 4HOBA 2NNNA 1IZ1A 3V8JA 4ZYEA 3BY6A 5D5WB 4O6JA 2M30A 1ODDA 1KU2A 3FMQA 5HVQC 1YO5C 2C6YA 2UXNA 5F1RA 3ZN0A 4R79A 3OOPA 4HAMA 2H6CA 1QNTA 3CDHA 3DXJF 2XAQA 3L2CA 4CXFA 3P9IA 1G3WA 4PGGA 1DDNA 1E17A 2XRNA 2F5FA 3P9CA 4OOIA 4Y17A 1C0WA 3MWMA 2OZ6A 2DI3A 1KU3A 3J81K 3MEXA 5E18F 1I6XA 4GO1A 5E1ZB 2M5WA 4ETSA 4U0VA 2ZNZA 2FOKA 3EUHA 3QRFF 3FM3A 4G9YA 3D0SA 3RKWA 4UVCA 1QPMA 3JW4A 3KEOA 2P8TA 2KIFA 3WTUC 3QU3A 2YSRA 2G7HA 5IT9K 2GZWA 1BIAA 2VE9A 1HKTA 2A6EF 3DPTA 3RKYA 3E3VA 2MBFA 3WGHA 2HEOA 3CJNA 1BC8C 5LGTA 1G3TA 1H9TA 3DFGA 1J2XA 3KEQA 4NQWA 1BI1A 3KLNA 2O3FA 1LQ1A 4KN7X 1K7AA 1S8NA 1G6NA 3RPUA 1YIOA 4CGZA 4HA8A 4IRHA 2YU3A 2PI0A 5HDNA 1TLHB 3DF8A 2IRFG 4OIRF 1QZYA 3I59A 3JSPA 3QP6A 1LDDA 4RB2C 4N9IA 2K02A 2XASA 3CUQC 4K2EA 4RGUA 1WSUA 1S29A 3K69A 2RQPA 2D1VA 2M87A 4A12A 4ESJA 4M9XA 2EFQA 3EETA 3HUGA 4R1HA 1R58A 4AIJA 3DEUA 1MJAA 2NRAC 2LNBA 2ZKZA 3P9KA 1LB2A 3WTSC 1XMKA 1PDNC 4NHJA 4H0EA 1CF7B 4I0BA 2YX7A 2NS0A 5ILVA 3HSEA 2J5OA 1SD5A 1FY7A 5DCMB 3HSFA 3T0YA 3WU1B 2IPQX 1XCVA 4LG0B 4ENKA 4LB5A 5EEGA 2HTJA 2QQBA 5ICFA 2W25A 1LVAA 3FM5A 1P4XA 2E1NA 4HF0A 2WV0A 4MQ9F 2A07F 1ZG5A 4P96A 3VODA 2HS5A 1BC7C 1LNWA 2QWWA 4G6DA 3TDZC 1U6GA 3ZMSA 2OBPA 3S2WA 1I27A 2COMA 3WTYC 5E17F 4LFUA 4DNCA 4EJOA 4ZZDA 1R22A 3C18A 3U2RA 1ON1A 2VC0A 2OD5A 2L3DA 3DV8A 1R1UA 1HW5A 2Y75A 2R7FA 3EQLF 3D5LA 3CUOA 1ZREA 1PP7U 3B73A 1SAXA 2Y0MA 2VONA 5H6RA 3FHZA 2K4JA 1P6RA 2ISYA 1TBXA 2EA4A 5D8LB 3KP7A 2RC4A 1RIOH 3KP4A 5HLHA 1Z9CA 1KYZA 2KKOA 4P5OA 4FHTA 3FXUA 4YIIA 1S6LA 3CUQB 2DPDA 3BDDA 5HS7A 4IVNA 4JQFA 1IUYA 2VODA 3NEUA 1G4DA 2NAZA 3WG9A 1BN5A 1D8JA 5D5VB 1Y0UA 3GFJA 4S04A 1KQ0A 2DT5A 2BBYA 2VE8A 1I1SA 1IN5A 2R7DA 4UV9A 2HKOA 2DU9A 3F72A 3KZYA 1SD4A 2ZFWA 1IRGA 1SD7A 4EJVA 3F8FA 2P7CB 5CJ9A 4LB6B 1SFXA 4GYIA 2A61A 1CF7A 2A5YB 3Q5FA 3GFMA 3IWZA 5DCMA 2EFWA 3RTRA 4Z2YA 4BHBA 2OQRA 3IC7A 3VEPA 5CLSA 5D6EA 2HKXA 1JHFA 3G3ZA 2RN7A 1HQCA 3ABUA 5LEKA 1BI3A 1O3RA 4A5MA 5KK1A 1U78A 3MZYA 1EH6A 1WQ2A 1P4WA 1XB4A 2Z99A 4L0YB 4U0YA 2EFOA 5CYVA 3ZMVA 3PQKA 2HR3A 3SQNA 1TQIA 4HV5A 1IN6A 2DW4A 2IT0A 2MH9A 3F6VA 3V4GA 4CO8A 2E7WA 3KE2A 4BHCA 4Y15A 1FP1D 3MFKA 3ZMTA 1FNNA 2NNYA 4HF2A 1NHAA 3I71A 3JSOA 2VT2A 3W6KB 3HHGA 1LEAA 1BBYA 1W5SA 1IW7F 4ENJA 3ECOA 2KJBA 4AVPA 4WWCA 5HLIA 2HYFA 1QO0D 2VOPA 2DTRA 1HKSA 1W7PB 3LA2A 1QGPA 1YTYA 4BAYA 1R5GA 1J9IA 2WWYA 1XD7A 5LHIA 3CUQA 4AD9A 6PAXA 1B4AA 2EA2A 2F5DA 4RGXA 1X3UA 4CYDA 4OMZA 5BPIA 2V79A 4FT8A 2HQRA 2MD5A 4UVAA 5DUIA 3GZ5A 3CO7C 4Y13A 4FX0A 3L7WA 4IJAA 4WXCA 4CHUA 2LSOA 5LBQA 2QZ8A 1FSEA 1O7FA 4KT5C 1RUNA 1FOKA 4OINF 1ZG1A 1UCRA 3TGNA 3HRTA 1XGNA 5JFRA 3VOEA 5J8FA 5TRDA 2LF7A 4JK1X 4IHSA 3C3WA 1K78B 4M9SA 2XKOA 3GUDA 1K79A 4WK8F 1ZRCA 3GYHX 3HOTA 2JZYA 3LQQA 4KMFA 1RZ4A 3M9AA 1FP2A 4PDKA 4MTDA 3GW2A 2FNPA 4ZYGA 4G6QA 1KQ8A 2W85A 1R1TA 2QQAA 2H09A 1FYKA 3PFIA 1XDSA 1KGSA 3I64A 3ZQ7A 1PP8F 3LWFA 2CFXA 5CVIA 2M8EA 2XAHA 3IRQA 1FBQA 5TJJA 2EWNA 3N97A 1ZHFA 3EYIA 5ILSA 1GHCA 1FWZA 4YIFA 3IL2A 1R5HA 3E6CC 1AWCA 1BM9A 2AXLA 2JT1A 4D0PA 4KYWA 1JHHA 1YYVA 5ICCA 2STTA 1K6OA 4GGGA 3FZVA 1Q1HA 2MA3A 3F3XA 2L02A 1USSA 1VTNC 1W7PA 5FGMA 2CYYA 3F8CA 5HS9A 3TOAA 1EH7A 3KP3A 4ZYDA 1YG2A 5FB2A 3J80Z 2P6SA 2PEXA 3BWGA 2MH2A 2FQ3A 1MD0A 1YQAA 2IW5A 1STZA 1USTA 2ADUA 1LDJA 5CVRA 1REPC 4PZJA 1ZRFA 1T6SA 3GEZA 2OU2A 1CGPA 4HDUA 4CZZA 1HKQA 1EH8A 4I98B 2Q8KA 4NB5A 1ZG3A 5DCFA 2B0LA 2TDXA 1Z6TA 5DDGA 2ZCWA 1SMTA 2GQQA 2Z5UA 2ESNA 1XCBA 3I4PA 1IRFA 4L18B 3E6MA 1B9NA 4LJZF 3FWEA 2UXXA 2P4WA 3M8EA 4QLCU 2VBYA 2FBIA 2XHKA 3IHUA 1J5YA 2LDUA 2Z9OA 1OPCA 4HX7A 3HSRA 2K4BA 2W24A 3K2ZA 2ELHA 2M45A 4HX4A 1K78A 2CWEA 4N0BA 2A3SA 2ACJA 1OKRA 1MDMB 2HTSA 4BYYA 5D5UB 3ROUA 3L00A 2HOEA 4ESFA 1TW2A 4A0ZA 2ZBKA 1WRJA 5F64A 4RAZA 1LEBA 4HV6A 5JVTA 2EB7A 5L3FA 2Z33A 5DD8A 4HW0A 1ZLJA 3JTGA 3SZTA 1WKMA 3T1BA 4MEYF 2HGCA 3NRVA 4Q4ZF 2BYVE 2JPCA 1FBUA 2GWRA 3I5UA 3PQJA 5IT3A 2XGXA 3R6SA 4KFCA 1T0FA 3GXOA 3E97A 5BS6A 2YR2A 1EV7A 3HTUA 3KCCA 4B09A 1O7LA 3C7JA 4HQMA 2UWMA 4F7ZA 3ELKA 3FXQA 3K1NA 4EJTA 3JAMK 1KQ9A 1XGOA 4HDVA 4KNYA 2ISZA 4IRGA 4GXOA 2LKPA 2FF4A 4LK1F 2GAUA 5AONA 2RVCA 4WCGA 2L01A 3VFZA 3ZP5A 3BPXA 5HS8A 1UFMA 4U7DA 4UV8A 1O57A 4RB3C 5F6FA 1YW8A 2XAGA 2O03A 3J7AO 1G3YA 1Z6RA 3SZPA 5L3GA 4OMYA 3L9FA 5DD4A 3ZMZA 2STWA 3BJ6A 2KIUA 3WTVC 4EVIA 4AWXB 2DLLA 1O3TA 2HDCA 3WTXC 3BJAA 2CQKA 4G7OF 3F6OA 3MQ0A 1XGMA 2QQ9A 2DQRA 3FF5A 2JRTA 3QAHA 2PN6A 4EGZA 5LGNA 2JPBA 2VBWA 1T98A 3G73A 3HRMA 1TTYA 1U2WA 4MNUA 1O3QA 2FU4A 2L4MA 5LHGA 1Z1DA 4IHTA 1RNLA 3R60A 1XSXA 4BHPA 4A0XA 2DQLA 3GZ6A 3V8KA 1MDMA 3CO6C 3E5XA 3GWZA 3R4KA 4KIBA 1FC3A 4LGWA 1F9NA 1W7PD 5A2QK 2PJPA 2RDPA 4M6XA 3ZMUA 1T38A 5K1YA 1TQMA 1FT9A 2Z3YA 1KU7A 2FMYA 4S05A 4LLLA 2VXZA 1FSHA 4EQQA 1DPRA 5E1WA 1GXPA 4YFNF 4UUVA 1ON2A 3WTWC 4L5JA 3R0AA 2L54A 3ECHA 2FRHA 5L3CA 4P9UA 2QENA 3T8TA 2F5EA 4KN4X 1BI2A 4A6DA 2P5KA 1SMYF 2CG4A 1I5ZA 4U88A 4XSZF 5BMZA 4AIKA 5K5OA 3TDUC 2DK5A 2ZMEA 4KICA 5ICGA 5DUKA 3H3ZA 1F5TA 1Z91A 4M72A 1UHWA 3DP7A 3HRSA 4WF2A 1QQIA 3WTZA 1FYMA 1BIBA 1IN7A 1I1GA 4IF4A 3TO6A 2F5CA 1T2KA 2G9WA 1B59A 3ZMDA 1FYLA 1V3FA 2LF8A 1R36A 5D5XB 5D4SA 2AS5F 1QBJA 4UNOA 1JE8A 3SFZA 2FA5A 5FFZA 1FPQA 1MGTA 1TQPA 2Q0OA 3Q9VA 3K1PA 4IRIA 2M1BA 2EJRA 1O3SA 3SXYA 4RAYA 4RB0A 4BNCA 3QOPA 4HYEA 2EV5A 2GA2A 2VBXA 1G3SA 1B1BA 3N4MA 2MC3A 5AIQA 3KFWX 3WU0A 1OYYA 1HW2A 2WC2A 2CSOA 4YG2F 4Q5SF 3WTTC 5DYMA 3HOSA 3F8BA 2MLGA 1H0MA 4FX4A 4U7BA 3KP5A 3FX3A 5E8IA 2HYGD 3F22A 1YS6A 4TV7A 3R0JA 2BGCA 3IKTA 1FBSA 1WI9A 2QUFA 1DUXC 5LHHA 2O8XA 5HLGA 5E1XA 3CTAA 1MJBA 2W84A 2PG4A 3J80K 2O6GE 4EMSA 3C1DA 1HXDA 4I09A 5BOXA 3H92A 2K27A 4MGRA 5D8KB 4YFXF 1L0OC 1W5TA 5FLXZ 3MAJA 2A68F 3IKVA 1MZBA 2QLZA 1ZH5A 1TNTA 3RPQA 2JSCA 1D8KA 2ESHA 4M74A 2DBBA 1L3LA 3GFIA 4XLPF 2ETHA 1YS7A 1OMIA 2FBHA 1R00A 2G7UA 1DP7P 1YLFA 4MHGA 1JXSA 5BPDA 1ZN2A 4A2UA 4ENMA 3KZZA 4KIGA 4EJWA 2CW0F 2GIVA 1R7JA 2PMUA 2VN2A 3FMRA 3REOA 2FE3A 4G94A 2HWVA 3P7NA 4GCVA 3I58A 2IA0A 4BQAA 1HBXG 2XUBA 5CVVA 4EJUA 4KDPA 1ZYRF 1XDUA 3V7CA 3ULQB 3O2PE 3NQOA 2UZKA 2PMHA 3B02A 1IXCA 1J7KA 3M7GA 5LGUA 3V7SA 5FD5A 2Y48A 2HQNA 4HLYA 1R1VA 4G8XA 4BH9A 1ZGAA 5HDGA 3KETA 3ZN1A 3LQRA 4WX9A 4ASNA 5L3DA 1KYWA 1RI7A 1LJ9A 2VC1A 2XV4S 2YPRA 1B9MA 1P92A 3WE2A 2XROA 4IXAA 2E7XA 2P5LC 2V1DA 4XRFA 4WXHA 3VB2A 2EV6A 4L5IA 3T8RA 2IJLA 4RGSA 3TQNA 3LAPA 1XMAA 3E5QA 1UHMA 3GVAA 3LFKA 1IN4A 4UVBA 1J0RA
chains in the Genus database with same CATH superfamily
2JRMA 2IA1A 3M8JA 3NWSA 4JX4A 5DV5A 3TO7A 4HQEA 3BG6A 2WAQA 5DTDA 1LE8B 2WADA 3RYPA 1IGNA 2OQGA 2Z2SB 4F55A 2EFPA 1MSEC 3IWFA 1MBFA 4RM3A 1B6AA 4JBAA 3ERED 3MZ8A 4L9NA 2VKDA 3QU6A 3ABTA 4OIQF 3AKZA 4LK0F 2O7OA 2P6TA 2CGPA 2DYRH 3J81Z 2UUZA 3K4LA 4WXDA 2F2EA 5FFXA 3JRHA 2QBYB 2KT0A 4L9JA 3A03A 4OIPF 1P4AA 5H6QA 3FISA 4Q48A 2ZO4A 1PUEE 3BZ6A 4M9ZA 1MKMA 1Z21A 3FKJA 1TW3A 3K9TA 1JJ8C 1AKHA 3HOWJ 2ZJRF 1VQNI 5L3EA 1NG6A 4OU0A 1U5TC 2M4KA 2IP2A 5FJ8J 2P5VA 1F1ZA 1BI0A 2VQHA 3IH3A 2XAJA 2FSWA 3Q9SA 4E4HA 4CUGA 1HSTA 3BQZA 2GOMA 2IVMA 2WTEA 4BE2A 1XGSA 1FJLA 1VQ5I 3M1EA 4A3LJ 1X1PA 3O8GA 4FCYA 4PSXA 5HNHA 3HHHA 2PFBA 3K1MA 2FD5A 4DOZA 2NVTJ 3OV8A 1VF9A 3F8NA 2K7LA 2JQ7A 5IT9Z 1YFHA 4BJ6C 3GX4X 2HYJA 2L9RA 3HM5A 2P81A 1S7OA 3CP8A 3M8FA 4XK4A 1DPUA 2H6BA 4LD5A 4Y52J 3EDPA 3I0TA 2VBZA 4ESBA 3J7AY 1DQUA 1Z7UA 1E2XA 4PSWA 2RQQA 3GTJJ 3W2VA 3MCZA 4IZZA 3P5JA 1BR1A 3I53A 4A0YA 4M3FA 4LMYA 2BXZA 3SHFA 1FLIA 1LFPA 5GAGJ 5FLVA 1S9HA 5LFAA 2BHZA 3W6JB 3OR2C 4HBLA 2K9MA 4R8HA 4KUMA 3FMSA 3QP5A 1KA8A 3RKXA 2BEOA 1XSVA 1HW1A 1IC8A 1A04A 3DQVC 1FZPB 5DM7F 4BE1A 3GTLJ 2V4JC 4RMNA 3VYUB 3I54A 4C2UA 4XORA 2L0KA 3BPVA 1RR8C 2JTVA 3RJPA 3SDBA 1BL0A 3BJOA 5ICEA 3QYFA 5C4JJ 3ZQLA 1WWXA 3GF2A 4RAGA 1FOXA 1H9GA 1JGSA 3FXRA 2ZMEB 3U9GA 3DU6A 5LD2C 4B8XA 4XLAA 5J40A 3OYKA 1RR7A 5ED4A 1E0EA 5BQTA 2RGVA 3I9V2 4L0ZB 3HBLA 3HRUA 2O8KA 1YX3A 2EINH 4ZZLA 5DM6F 3W3CA 3JTHA 3BR2A 4P9FA 3RYRA 2XKPA 3S1MJ 2EK5A 3TW6A 2OAZA 1K4SA 4I7HA 1JTYA 4QSHA 4AU7A 3WE3A 5JLWA 4IHVA 2FNAA 3Q3SA 5KCMA 2RNJA 3WODF 3U21A 2X9DA 1ZRDA 2GXBA 1FMWA 3I4MJ 3KX2A 4F3QA 1P2FA 3BROA 3TO9A 3S3NA 4XONA 1UB9A 5AIPA 2O9LA 2K9QA 3O6BB 1IV6A 2J5PA 4LLGF 1ZARA 4DQ2A 3S3MA 3O3KA 4P1WA 5EJCA 4PCQA 2A6HF 1TL8A 3BG9A 2H1KA 1X1AA 2Q2EA 1UG0A 2X0LA 3ZR8X 2HPIA 3CJRB 2A69F 1YW9A 4ZDOA 3CZ6A 1LE8A 1RUOA 4EV0A 2MSYA 4GYGA 3E6DA 1RKWA 2QSFX 3EUHC 2E35A 3ISPA 2DAOA 5IP9J 4I2OA 3L09A 3EYYA 4KIFA 3ZPLA 1OCOH 3IP4B 4NC6A 2H94A 3GFLA 2AHQA 5K5RA 3HC7A 4AIDA 1JT6A 3KP6A 4CZCA 1D5YA 4F91B 3FHNA 1ZK8A 2RREA 5D4RA 3LAJA 4MTEA 3H5NA 2OJED 2QBYA 3F23A 4LIUA 1WJDA 4PFOA 3DTIA 1K6YA 4ANJA 3RI4A 4HNUA 2MYSA 1Z7LA 4EM1A 2KZGA 1UJ8A 4B44A 3F21A 4AC0A 4DBRA 4DZPA 1U5TB 3QPTA 2XC7A 5EG0B 4CICA 4M3GA 2DK8A 3JAMZ 3IRRA 3HDDA 1Y56A 2YS9A 3BOQA 3RDIA 5J4YA 2PBIA 1SFUA 3H0DA 9ANTA 5J4VA 1IRZA 1BJAA 4LG3A 5J8CA 3HTSB 2FBKA 3CLOA 1W0TA 2GXGA 5LEJA 2RV8A 3BCAA 2ZXIA 4GDFA 4YFKF 2R3SA 5E8GA 3CCEI 4EM0B 2V1UA 2VT3A 2FX0A 1WH5A 1S3JA 2DFIA 2FXAA 2P7VB 3COAC 2HZDA 3NAUA 3PL8A 2NVQJ 4MEXF 5JR3A 1E3PA 4RB1A 2DN0A 2DPUA 3HJEA 4ENNA 2IEKA 4HZFA 2GLOA 2CU7A 2LG4A 2VQCA 3E5UA 1OYWA 4E6KG 4U0WA 4A3BJ 1WJCA 3HGGA 4JOMA 3S15J 1OR7A 1TNSA 1IN8A 2QVOA 3DKWA 4BE0A 3B6AA 5CVUA 1WJFA 2K9NA 1XC5A 4PGHA 5DEQA 3ZQHA 2KRFA 3VWBA 1NK3P 1ERDA 5HOOA 3RCOA 3R61A 1F4KA 1ACIA 4NC8A 2BY0A 1FX7A 2BV6A 3V7RA 1MJ9A 5LRRA 3RIRA 1ZGJA 4ZH4F 2R7ZJ 4DW6A 1SD6A 3KP2A 1ZR4A 4O5VA 4XSXF 4XIDA 3TOBA 1OYIA 2LH9A 5HDKA 1AU7A 1ONVA 2RKHA 2BW3B 4XLNF 2DDBA 2OCCH 3OL4A 1A35A 4M71A 3SDGA 2BE5F 1FIAA 1KU9A 3H9GA 1QHHD 3HG9A 4XLCA 2V9VA 4M73A 2HZTA 4M6YA 3GLXA 4HX8A 4O3MA 5KVRA 1YITI 2V1XA 3KEYA 4LG0A 3LL7A 1TZLA 3E6BA 4EM2A 2CQXA 1T33A 2QYOA 1JUPA 1QZZA 2KFDA 2LY2A 4BXUA 1OCRH 1ZR2A 4MO7A 2QKMB 1GVJA 2PQ8A 5F0HA 4B48A 3BP8A 2CO5A 3LA3A 1MBKA 2WB1N 2EIJH 5GP9A 3TKYA 2B63J 3HIFA 5ERIA 4IO9F 4G12A 4II2A 3ML6A 1W4MA 2ZXJA 2FEZA 1WJBA 2L4AA 4RS8A 1RPWA 1D5VA 4I99C 4LLNA 1LUJB 2FMLA 2KIMA 4QWQA 4UXNA 3AG1H 4KA4A 4L9VA 2D2WA 3CDIA 3OIPA 4DYRA 1E3HA 2CUFA 4EGYA 1TC3C 3OYBA 3CCRI 3QPHA 2V6CA 2OA4A 4XBFA 5FLMJ 1YJNI 3K70C 5JI6A 4KMUX 4CDGA 2XF7A 5LRSA 5D6FA 2M4GA 4I0AA 5A2QZ 3S3OA 1GXQA 3G1OA 1UHSA 2YX4A 2W7NA 1Z3XA 2ZNYA 1S7AA 5H20A 2DO7A 4UHTA 5J6XA 2XVCA 3S1RJ 5FRNA 2B9SA 2K3FA 4JYKA 4B3AA 2H27A 5FLXK 3H3UA 2D1HA 3LSTA 4HNTA 1ZLKA 2XAFA 1Y8QB 1BOAA 1U3EM 3BCBA 2HFHA 4G7HF 2X6OA 1ETWA 3VSKA 3AAFA 2OZUA 4BBRJ 2F4IA 1ZAOA 2EFNA 4QPQA 3T5XA 2M7BA 2O0YA 1IAWA 1T08B 1KZHA 3LA7A 1T39A 5LLQA 1J59A 3MZHA 2DMUA 4AIHA 2WB1A 3DTKA 2Y31A 2IGMA 3BR0A 1HDPA 3U1DA 4ZJZA 5F1JA 3K0LA 2EZKA 4X6AJ 1V4RA 5E20A 4HF1A 2B7EA 1YHQI 1MIJA 4PJLA 5FRMA 2W57A 1U8RA 1U5TA 5EG0A 3L2WA 1AOYA 2O61A 3V8LA 2X4HA 1HC8A 2HPMA 2E36A 4IPAA 4RGRA 3CMEI 1HCRA 2VJIA 1SFEA 4L9TA 4RBOA 2QM3A 2KRCA 1YW7A 3F8MA 3K6GA 2R93J 2OV7A 3KLOA 4HLXA 2KJCA 5FO5A 4N9HA 3W6VA 4RDUA 1EF4A 1R23A 1WCMJ 2LREA 2PLYA 1Z05A 3OYJA 3SFIA 3ABKH 2EIMH 5FD6A 2IA2A 1POGA 4BU2A 4KJZA 3IUOA 3DWLE 2VKHA 3JRDA 2MLKA 4NQWB 3HYIA 1HSJA 1ZELA 4FTHA 1LDKB 4E70A 2VOOA 3AL0B 1W1WE 4ZYHA 1AA7A 2BY2A 4MQVA 2EV0A 2XIGA 2ZJ2A 3WGGA 2GA1A 5IP7J 3GCMA 1J75A 3LNQA 4XRSG 1OCTC 5EEHA 3D5RC 5JHUA 2LP0A 4A5NA 1YRNB 5ILUA 4ON0A 4P55A 2HVSA 2CW7A 4G7ZF 3DPLC 2E2JJ 4A6EA 1XMXA 1B72A 3GO5A 4LIVA 1BA5A 2NYXA 4I02A 3FKIJ 1BR4A 2I10A 2E1CA 2D45A 2K86A 1XSDA 3GTGJ 3BR1A 1YE9A 1UAAA 1D1AA 3OIOA 1WHUA 2WA0A 1Y6IA 5CVJA 4OIOF 1IXSB 2LC2A 1MMNA 2KISA 4Q47A 1XN7A 2HXOA 4ZTFA 3I59B 3SZGA 1IXRC 5L3BA 1IF1A 4I01A 1H88C 4QTRA 4A3FJ 2BW3A 3TP3A 2IS6A 1D3YA 3WGIA 5K5QA 4RLQA 4V19K 1ULYA 4HOBA 3I3LA 1SC7A 2NNNA 1IZ1A 3V8JA 4ZYEA 5FKKA 3BY6A 1GUUA 3TMOA 2NXNB 1QPIA 5D5WB 2DA6A 4A3DJ 2XSJC 4O6JA 2M30A 4IHXA 3JR9A 1ODDA 1TWCJ 1KU2A 3HXLA 3SEZA 1X3ZB 2WAFA 3FMQA 5HVQC 1YO5C 2C6YA 3BZCA 3SEQA 2UXNA 5F1RA 3ZN0A 4R79A 3CCUI 3OOPA 4XN3A 4HAMA 2XSDC 3HUGB 3A0HC 1R6RA 4C30A 3K2AA 2H6CA 1QNTA 3CDHA 3DXJF 4ZDLA 2XAQA 3L2CA 2KRHA 2KDOA 2OPTA 4CXFA 2IAIA 3P9IA 1G3WA 4PGGA 1DDNA 1E17A 2L7ZA 3M4OJ 2XRNA 2F5FA 2CV2A 1OR7C 2HDWA 5M5XJ 1BW6A 1X1DA 1IJWC 3P9CA 4OOIA 4X1EA 4Y17A 1JKOC 1C0WA 3MWMA 2OZ6A 1MNEA 2DI3A 3E0JB 3JRFA 1KU3A 3J81K 3MEXA 5E18F 1ETOA 3CCMI 4I6ZA 1I6XA 2MD0A 4GO1A 5E1ZB 2M5WA 4ETSA 3D5SC 1LFBA 4U0VA 2ZNZA 2FOKA 2NOGA 3DTEA 3EUHA 3QRFF 1U9NA 4HSTA 4RM2A 5EEAA 3FM3A 4UB6C 3KYLA 1IDZA 4G9YA 2EZLA 4XNFA 3D0SA 3G1MA 4M3EA 1DGRM 2ZB9A 3RKWA 4UVCA 1QPMA 2WAQN 3JW4A 3KEOA 3C2BA 2P8TA 4DYQA 2ZC2A 3DPUA 2GM4A 2KIFA 4JX6A 1MH3A 2E1MC 3VDXA 3WTUC 3QU3A 4HEA2 2YSRA 2LLKA 3VYSB 1DP3A 1VFCA 2JUCA 2G7HA 5IT9K 1ZTRA 2Q1ZB 4G6TB 2E19A 1WI3A 4KT6A 2GZWA 1BIAA 2VE9A 1HKTA 2A6EF 3K4NA 3WG7H 1FOWA 3DPTA 3RKYA 2CUZA 1VQ6I 3H5RA 3E3VA 1YX5A 1JGGA 2MBFA 3WGHA 2HEOA 3CJNA 2HQ5A 3L1PA 1BC8C 1MSFC 5LGTA 1G3TA 3LOCA 3GMEA 1SANA 2AXTC 5KNLA 1H9TA 1ETYA 3DFGA 1J2XA 1OFCX 3KEQA 4NQWA 3H3VK 1I39A 1BI1A 5GTHC 1UELB 1U8BA 4A3MJ 5M3FJ 1Y1WJ 1VQ4I 4BXFA 3KLNA 2QCOA 2O3FA 1LQ1A 2XF6A 2R92J 2XPUA 4KN7X 1WPKA 1K7AA 1BJZA 2V9KA 4XKWA 3JRBA 1Y39A 1S8NA 5F0FA 2DA7A 4MIMA 1YRNA 1G6NA 1Y1VJ 3PO2J 2MG4A 3RPUA 4QPOA 3WHBA 1YIOA 4E7KA 4CGZA 4HA8A 3VSLA 4IRHA 1I6HJ 2YU3A 2PI0A 5HDNA 4D7MA 2QF7A 1TLHB 2YUSA 3DF8A 4HSRA 1P7JA 2IRFG 2VPLA 2IGOA 4OIRF 1QZYA 4NDLA 2R5YB 2DA1A 3I59A 2CV1A 3JSPA 3ZQFA 2JN6A 3QP6A 2LKXA 1LDDA 1Z3YA 1YI2I 2DODA 3IAS2 4RB2C 2LR8A 2K02A 4N9IA 2KQRA 2XASA 3GLLA 3AG2H 3CUQC 1VQPI 3FXLA 2NVYJ 4K2EA 4RGUA 3OYLA 3GBGA 4IL6C 3L2QA 1WSUA 1DGWY 1S29A 2JUGA 1X4OA 3K69A 1X2NA 3A0BC 5M5WJ 2UV1A 2RQPA 3CMAI 2DDAA 2D1VA 2M87A 4BEHB 4A12A 4BACA 3PNTA 2R5ZB 4ESJA 2QQ8A 3DBLB 3VYRB 1WGXA 1J09A 4DGWB 4M9XA 3CESA 5B1AH 5E3OA 2EFQA 1R49A 3EETA 3F0CA 4N4OB 1OJLA 3HUGA 4R1HA 3OYIA 3DKXA 1R58A 4AIJA 4XM3A 2L9NA 2W82A 3DEUA 4BQQA 1ETXA 4RA2A 3S93A 1MJAA 2NRAC 2LNBA 2ZKZA 2GOXB 3ZQQA 3P9KA 3OYFA 4BDYA 1LB2A 3WTSC 5IYBJ 1XMKA 5EGOB 2R7OA 2ZJPF 2IS1A 4C2MJ 1PDNC 4NHJA 3ASNH 3OL3A 4H0EA 2VUMJ 1CF7B 4I0BA 3CDLA 2YX7A 4X0GA 2VKEA 2NS0A 3FXKA 2DA5A 1YIJI 5ILVA 3HSEA 3S16J 2ECCA 2J5OA 1SD5A 1FY7A 5DCMB 1GDTA 4BXXJ 3HSFA 1PVEA 1IO2A 3S17J 2K85A 3T0YA 3WU1B 4UUTA 2V1NA 2E1MB 3H5AA 2PX9A 2EH3A 2IPQX 1UMQA 4V2FA 1XCVA 3I56I 1MBEA 2AO9A 4LG0B 1VZ0A 4ENKA 4J19A 4LB5A 5EEGA 2HTJA 2QQBA 5ICFA 2W25A 1LVAA 3FM5A 3S14J 1XX5A 1P4XA 2E1NA 4HF0A 2DFHA 2WV0A 4MQ9F 5H2FC 2A07F 1ZG5A 4P96A 3VODA 2HS5A 1VQ9I 1A5JA 1BC7C 1LNWA 2CUJA 1MMSA 2XAUA 3OSFA 2CS3A 1XTAA 1VNDA 2QWWA 3HKZA 4G6DA 2PMZA 1HA8A 3TDZC 1G59A 1U6GA 4A3IJ 4MLOA 3ZMSA 3OYEA 2OBPA 3S2WA 1I27A 3HPGA 2COMA 3WTYC 3FIWA 5E17F 4LFUA 4DNCA 4LITA 1D0YA 1X1BA 4EJOA 4A93J 4ZZDA 1R22A 3C18A 3U2RA 1ON1A 1Y0NA 2BXYA 2VC0A 2LY9A 2OD5A 1JI8A 2L3DA 3DV8A 1R1UA 2X51A 3ASOH 4XICA 1HW5A 4E7SA 4RLFA 2Y75A 2R7FA 1X19A 5B5EC 4W1UA 3EQLF 1JJ6C 2F4MB 3D5LA 1F43A 3CUOA 1ZREA 1B8IB 3OS2A 1PP7U 3B73A 1SAXA 2Y0MA 4PJ0C 3EUAA 4NBQA 2VONA 5H6RA 3FHZA 2K4JA 1P6RA 4KISA 1A6QA 2R0QC 4A3GJ 3HEFA 2ISYA 3KIOA 2BOLA 1TT0A 1TBXA 1K4TA 2EA4A 2JA7J 5JVGF 2QGUA 2WY8Q 2RC4A 3KP7A 5D8LB 1RIOH 4UB8C 3KP4A 1Z77A 5HLHA 3S1QJ 5GPAA 4LOCA 2R5YA 5E3NA 1Z9CA 4UY8I 3K4KA 2Z1DA 3HZJA 1KYZA 2E71A 2KKOA 4P5OA 4BJ5C 2EZIA 4FHTA 2IBDA 3FXUA 4CCOA 3PIOF 4YIIA 1U0JA 1S6LA 4QIWN 3MKZA 2R7WA 1JKRC 2MC4A 2KHMA 2VLAA 1V5GA 3CUQB 1EA3A 2L7MP 2DPDA 3BDDA 3PO3J 5HS7A 5HNFA 2KLOA 2M8GX 3BR6A 3JCUC 3H36A 4IVNA 4JQFA 4CCNA 1IUYA 2KIQA 2VODA 2X85A 3NEUA 3PFYA 1G4DA 1ZQ3P 3HB9A 2NAZA 4BEHA 2R5ZA 3WG9A 1BW5A 1BN5A 1D8JA 1QVUA 3GTOJ 3M07A 5D5VB 1Y0UA 3OYNA 3GFJA 4B47A 3H1CA 4BS9A 3CJQB 5FROA 4CSWA 1KQ0A 5F04A 4S04A 2DT5A 2BBYA 2VE8A 2HVQA 2FQ4A 2HU9A 1I1SA 3CC7I 1IN5A 1QZEA 4IEJA 4FE7A 3AL0C 2R7DA 4UV9A 2HKOA 2DU9A 3F72A 3KZYA 1SD4A 2Y30A 3FXOA 2ZFWA 1IRGA 1SD7A 2K5CA 5E3LA 5CPRB 5C44J 2XPVA 4EJVA 1QHGA 3F8FA 3S2DJ 1PYVA 5CQEA 1B72B 2KZVA 3TEDA 5EGOA 2P7CB 2EBIA 5CJ9A 1APLC 4LB6B 1SFXA 2KP6A 4GYIA 2A61A 3V42A 1CF7A 2A5YB 2DJNA 1LPQA 4CH7A 3RZDJ 4IOAF 3Q5FA 4E7IA 3GFMA 3IWZA 5DCMA 3A4CA 2X1CA 5HODA 3O8HA 2EFWA 4XL9A 3RTRA 3M1CA 4Z2YA 2NS8A 3H35A 4BHBA 3OYAA 3HOXJ 3AG3H 2OQRA 5GPCA 3IC7A 3VEPA 2FUG2 5CLSA 5D6EA 1N78A 3CLQA 2HKXA 5K7ZA 2ID6A 5J1RA 1JHFA 3G3ZA 2RN7A 3OMYA 1HQCA 3ABUA 5LEKA 4IHYA 1BI3A 1T56A 1O3RA 3OYHA 3DLAA 4A5MA 2VJJA 4XLEA 4YRVA 5KK1A 2X6XA 1U78A 2CQNA 1EH6A 3MZYA 1WQ2A 2GBYA 4F92B 4ZDPA 3IH4A 1P4WA 1XB4A 4GRIA 2Z99A 4L0YB 4U0YA 2EFOA 1GV2A 5CYVA 5J3LA 3PQKA 2HR3A 3ZMVA 4DZJA 3SQNA 1TQIA 4HV5A 2OF7A 1IN6A 1QVTA 3BC8A 2DW4A 2IT0A 2GXAA 1UG2A 2MH9A 3K7AJ 1I50J 3E1SA 3F6VA 2VASA 3V4GA 4CO8A 5K7FA 2E7WA 1VQ8I 2VJ4A 3KE2A 4IKFA 4M6VA 5TISC 4BHCA 4FQGA 4Y15A 1FP1D 4BJTA 3MFKA 2ZJQF 1JKQC 1MBJA 1HF0A 2K9LA 3ZMTA 2QKLB 2R4GA 1IRXA 1FNNA 2NNYA 3A1YA 4FE4A 3Q0UA 1NHAA 4HF2A 1TWHJ 2JA5J 2X1EA 1B8IA 3I71A 3QYBA 3JSOA 4JP0A 2VT2A 3W6KB 3HHGA 1LEAA 1BBYA 1W5SA 1IW7F 2VKVA 4ENJA 3ECOA 3FBNB 2ZSIB 1IUFA 2KJBA 4AVPA 4WWCA 4B1RA 5HLIA 4A3KJ 1OCPA 2HYFA 1QO0D 4AVZA 2HI3A 2VOPA 2DTRA 3K70D 1HKSA 1W7PB 3LA2A 4BQNA 3GTKJ 1QGPA 3G2BA 1YTYA 3S1NJ 4BAYA 2COBA 4YEJA 1R5GA 1MBHA 2MABA 3J7ZI 3G71I 1J9IA 1LFUP 2WWYA 1XD7A 4S0HB 5LHIA 3L2VA 2XGDA 3BR5A 3H0GJ 2ELJA 2VQLA 3CUQA 2VJ5A 4AD9A 2V26A 3EPZA 6PAXA 3KZIC 1B4AA 2EA2A 3PUBA 2HOSA 2LKSA 2F5DA 2JA2A 4RGXA 3IV5A 1MNMC 1N25A 2DMQA 2D5VA 2R7TA 1V54H 1X3UA 2ECBA 4OMZA 4CYDA 2R7XA 5BPIA 1XPXA 2V79A 2OCEA 2VPRA 2ELKA 4FT8A 2HQRA 3CCVI 2CFOA 2MD5A 4UVAA 3W2AA 4M3BA 5DUIA 3OSGA 3GZ5A 5IP6A 4UUSB 3FXJA 4F93B 3CO7C 2TRTA 4Y13A 4FX0A 2O5RA 3E7LA 3ZOBA 3L7WA 4XOTA 3CCLI 3S32A 4IJAA 2LFBA 2E1OA 2JSPA 4WXCA 3WU2C 4CHUA 3LSKA 1SFKA 2LSOA 1V5FA 5LBQA 3ONQA 2QZ8A 1D0ZA 1FSEA 1D0XA 2DCEA 2DOEA 2H8WA 2MGQA 3OWTA 1V5EA 1ZKGA 1O7FA 4KT5C 1RUNA 4BY7J 5C3EJ 1FOKA 1EKEA 4OINF 1RESA 1GVDA 1YJ9I 4CCKA 4C9YA 1ZG1A 1UCRA 3TGNA 3HRTA 1XGNA 3S8PA 2LK2A 5JFRA 3VOEA 5J8FA 5TRDA 2LF7A 4JK1X 4IHSA 3C3WA 2M2EA 3BZKA 1K78B 5IY5H 4OWRB 2Y0SN 4M9SA 2XKOA 1W0UA 3HL2A 3GUDA 1VQ7I 1K79A 1P7IA 3MKWB 2DA2A 2EILH 4WK8F 1RETA 2DFEA 1HDDC 3X2QH 1U9OA 1E3OC 2DMNA 1ZRCA 3GYHX 3HOTA 2JZYA 3LQQA 2JA8J 4KMFA 1DU6A 1RZ4A 3M9AA 2KPMA 4AM3A 1M1EB 1H89C 3QWLA 1FP2A 4PDKA 4MTDA 3CP2A 1OCZH 1TWGJ 3GW2A 2FNPA 4ZYGA 4G6QA 2HOAA 1KQ8A 2W85A 1R1TA 2QQAA 2H09A 1VQKI 2LMDA 1FYKA 4CA0A 4XRSA 3PFIA 1XDSA 4B3XA 3HOVJ 2LOOA 3BG3A 3JREA 3F9KA 1KGSA 3I64A 3PSIA 3ZQ7A 1PP8F 2XPWA 3LWFA 5F27A 5F08A 2CFXA 4IQJA 5CVIA 5IOZA 2M8EA 2R7VA 2WV1A 5E3MA 2XAHA 3IRQA 3RQIA 1FBQA 5TJJA 2EWNA 3N97A 1SFOJ 1ZHFA 1XG1A 1A36A 3EYIA 5ILSA 2WAEA 1WZ2A 1GHCA 1FWZA 4YIFA 2OTLI 3IL2A 1I3QJ 2NVUB 2A5WA 2ZXWH 1R5HA 3E6CC 1JT0A 3CMMA 2Y0SA 1T8IA 1X4PA 1AWCA 1BM9A 3DBRB 2AXLA 2JT1A 5IOYA 4H4KC 4D0PA 4KYWA 1JHHA 1YYVA 3ZQIA 3HOYJ 2CQ7A 3DEWA 3MKYB 5EYRA 4AYBA 2H1LA 5ICCA 2WBMA 1H8AC 2STTA 2BY3A 1K6OA 4GGGA 3FZVA 2F5VA 3BG7A 1Q1HA 3CQZJ 2MA3A 3SYTA 3F3XA 1A6IA 2L02A 1USSA 1VTNC 1W7PA 5FGMA 2CYYA 3F8CA 5HS9A 3TOAA 1EH7A 3KP3A 4ZYDA 1YG2A 3D1NI 5FB2A 3J80Z 2P6SA 2PEXA 3BWGA 1SAUA 2MH2A 5TGTA 2LTPA 2FQ3A 2W4SA 1MD0A 1YQAA 2IW5A 1STZA 1USTA 2ADUA 1LDJA 3OYMA 5CVRA 4D7NA 1REPC 1X1CA 2MW8A 3QQAA 4PZJA 3QPLA 5IYCJ 3EUKL 1ZRFA 1T6SA 2VB6A 4UUSA 3GEZA 3GTQJ 4GFBA 2OU2A 3RSNA 4HDUA 2AQFA 1CGPA 2DFFA 4CZZA 1HKQA 2G0EA 1EH8A 2Z16A 4I98B 4E7JA 3UKGA 2Q8KA 4NB5A 1ZG3A 2W00A 4C3JJ 5FKOA 1LVKA 5DCFA 2CUEA 4CCMA 2B0LA 2TDXA 1FIPA 1Z6TA 2CH0A 2EPFA 5DDGA 2DOAA 2ZCWA 3A01B 1SMTA 2GQQA 2Z5UA 2ESNA 1XCBA 2L9SA 3I4PA 1IRFA 4NUBA 4L18B 3E6MA 4CYCB 1B9NA 4LJZF 3FWEA 2LY1A 2UXXA 2ME6A 5GAHJ 2P4WA 2ZSHB 2M0MA 3M8EA 2VBYA 2FBIA 4QLCU 3BT9A 2XHKA 3IHUA 4Y33A 1J5YA 1TWFJ 2LDUA 3M3YJ 4E7LA 2Z9OA 1OPCA 5M3MJ 3ABMH 3CCSI 4HX7A 3HSRA 2K4BA 2W24A 3K2ZA 3LSGA 2ELHA 4I76A 2M45A 4HX4A 2F48A 1W5CC 4XR6A 3GTPJ 4ABZA 3HOUJ 3CF5F 1K78A 2E60A 4U87A 4D9JA 2Y69H 2CWEA 4N0BA 1QRYA 1SVLA 2A3SA 2ACJA 3DEEA 4XKVA 1OKRA 1PJRA 1MDMB 3BTIA 2R7RA 2HTSA 4BYYA 5D5UB 3ROUA 3L00A 2HOEA 2LRDA 1TW2A 4ESFA 1MMAA 4A0ZA 3CCQI 3GTMJ 2ZBKA 2VIXA 1WRJA 2EQRA 2XB5A 5F64A 4RAZA 1LKXA 1LEBA 2DA4A 3LSJA 1Q1VA 1V55H 1NH3A 2CJJA 4HV6A 4E7HA 5JVTA 2YU9J 2EB7A 5L3FA 2Z33A 4A3CJ 5DD8A 2IS2A 2M3AA 3OR1C 4HW0A 4L5EA 1ZLJA 4AUXA 3JTGA 3SZTA 1WKMA 3T1BA 4MEYF 3OY9A 2HGCA 3NRVA 3VPRA 4W97A 4Q4ZF 3HKZN 2BYVE 2RNGA 1WJEA 2JPCA 2PMZN 3I4NJ 1FBUA 2GWRA 3OYDA 3I5UA 3PQJA 3LSHA 1S7EA 5IT3A 2XGXA 1R9TJ 3R6SA 2L9VA 4KFCA 1T0FA 3GXOA 3E97A 2OTJI 2YR2A 1EV7A 3HTUA 5BS6A 1MH4A 3KCCA 4XMYA 4B09A 2H8RA 1O7LA 3C7JA 4HQMA 1S5LC 1TWAJ 2Y2ZA 3K4CA 2UWMA 4F7ZA 3A2KA 3ELKA 3FXQA 3K1NA 5F0CA 3DLLF 4EJTA 2VXDA 2WY7Q 5KAFC 3JAMK 1KQ9A 1XGOA 4ZTJA 1R4MB 4HDVA 4KNYA 2ISZA 4IRGA 3J7YJ 4GXOA 2DYSH 3UR3C 2LKPA 4BQOA 4NC7A 4E7ZA 1MMDA 2FF4A 3QPSA 4LK1F 2GAUA 5AONA 2LBFB 3MVPA 2QSGX 2RVCA 4WCGA 2L01A 3VFZA 2DT6A 1KONA 3ZP5A 3BPXA 2XGEA 1PUFB 1BOBA 2K3PA 3S2HJ 4F52A 2KL4A 5HS8A 1UFMA 1WH7A 4U7DA 2DXIA 4UV8A 1O57A 3UNGC 4ITVA 1JUSA 5F6FA 1YW8A 4RB3C 3CCJI 4V2GA 2XAGA 1O4XA 1ETQA 4BUPA 2O03A 3AG4H 3J7AO 3MD2A 1G3YA 1Z6RA 3SZPA 4ZYAA 5L3GA 1RKTA 2ID3A 2M7AA 4OMYA 4BDZA 4N4NB 3L9FA 4A3EJ 5DD4A 2XB0X 2R7UA 2E5NA 3ZMZA 2STWA 3BJ6A 2KIUA 4IX7A 3WTVC 4EVIA 2L7FP 4AWXB 2DLLA 4J01A 1T95A 1O3TA 2HDCA 4Y3OA 3LSRA 3WTXC 1BR2A 3BJAA 2CQKA 4G7OF 3F6OA 1Z0XA 3SJMA 4XLFA 3MQ0A 3OS0A 5CQGA 4ZC3A 3A01A 1XGMA 4HNVA 2QQ9A 2DQRA 4XRMA 3FF5A 3OYGA 2ME0A 2JRTA 2R7QA 3QAHA 3CC4I 2IS4A 2PN6A 4CYCA 4EGZA 5LGNA 2JPBA 2VBWA 1K83J 5HLTA 1K61A 1T98A 4C3HJ 3G73A 3FK6A 3HRMA 1TTYA 1U2WA 4MNUA 3LMMA 3JRGA 2DMTA 3G4SI 1O3QA 2FU4A 2DOFA 2L4MA 3MKLA 2R7SA 4D5CA 1WVRA 2V6EA 1IV8A 2L7KA 3HPHA 5JHFA 5LHGA 5CKTA 1Z1DA 4IHTA 1RNLA 3R60A 1XSXA 4BHPA 2JVGA 4A0XA 4C2TA 1FEXA 4JX5A 3N05A 2DQLA 4OAYA 4HPQA 3GZ6A 2AQEA 2CMPA 3V8KA 3FXMA 1MDMA 3CO6C 4EEFG 3E5XA 4II3A 1ORKA 3GWZA 3R4KA 4KIBA 3L2UA 1FC3A 1R4NB 4LGWA 1F9NA 1JKPC 1W7PD 5A2QK 2BY1A 3KYDB 1IDYA 3NWTA 2RDPA 2PJPA 3HGYA 4M6XA 2RAEA 2IXSA 2PJRB 5E79C 3FDYA 3ZMUA 1T38A 5K1YA 4BKXA 1TQMA 2KDZA 1QU3A 1FT9A 2Z3YA 1KU7A 5EDNA 2FMYA 4D1QA 3PM1A 5KHDA 2F6CA 3MMYB 4S05A 3BTCA 3W2WA 1W36C 2HXIA 4LLLA 3LSMA 2VXZA 4B4CA 2M9HA 1WJ5A 2KMUA 1FSHA 4EQQA 1DPRA 2BVLA 5E1WA 4UVBA 2OC6A 1GXPA 2BZTA 1RRJA 5K7HA 4PJJA 1FTZA 4YFNF 4UUVA 1ON2A 5B66C 2DJIA 2W48A 2ZFUA 3WTWC 2E2IJ 4L5JA 3R0AA 2QSHX 2V9PA 2CV0A 4XKCA 1SVMA 1TT5B 3KPHA 2IGKA 2L54A 3H9QA 3BR3A 3ECHA 2QEXI 1ZGWA 2BVMA 2FRHA 5L3CA 2A05A 3RPUD 3U1KA 2V7FA 1RC9A 2QA4I 1W36D 2HVRA 1ETKA 4P9UA 1MNDA 2LBFA 2QENA 3T8TA 2F5EA 1TP4A 4KN4X 2HNHA 1BI2A 3ZQGA 3CMYA 4A6DA 3PNYA 2N8GA 4MFDA 2P5KA 1PUFA 1SMYF 4FISA 3K4MA 2CG4A 1S72I 1Y8RB 1I5ZA 4U88A 4XSZF 5BMZA 3ZQCA 3C2HA 4AIKA 5K5OA 3FK7A 3TDUC 1I3AA 2DK5A 2ZMEA 4KICA 1EJ9A 5ICGA 1G2HA 2OUMA 5DUKA 4PJMA 3H3ZA 1F5TA 2JJ7A 3TW7A 3OS1A 5IPAA 2NS7A 1Z91A 3PNVA 1F36A 5BNGA 1ENHA 1OCCH 1UHWA 3DP7A 4M72A 1X2MA 3HRSA 4EATA 4WF2A 1QQIA 4MFEA 3WTZA 5J1YA 1FYMA 1BIBA 1IN7A 3TP0A 1OISA 1I1GA 4IF4A 3TO6A 3B6CA 2F5CA 1T2KA 2E34A 5M5YJ 2NOJB 2G9WA 1B59A 3PUFA 3ZMDA 1FYLA 1V3FA 2LF8A 1R36A 3NARA 1T0FC 5D5XB 5D4SA 3RQ4A 2JA6J 4IHWA 2AS5F 1QBJA 4UNOA 1JE8A 4XQFA 1IG7A 3SFZA 2VQGA 1A31A 2FA5A 1SVOA 1YOVB 4M3DA 5FFZA 1FPQA 3K10A 3JRIA 3G1LA 1MGTA 1TQPA 3ZRGA 4Y4RA 2Q0OA 2ICWG 1R71A 2ZXHA 1GLNA 3Q9VA 4C3IJ 3K1PA 4IRIA 2M1BA 4A69C 5B3SH 2EJRA 3K4JA 5B1BH 2LYCA 1O3SA 3SXYA 4RAYA 4RB0A 2CQQA 4BNCA 5EF6A 3QOPA 1N77A 5IYDJ 4HYEA 2EV5A 2GA2A 2VBXA 3KYCB 3OIQA 1G3SA 3AFHA 3H9JA 3OOUA 3BLYA 2JWTA 1NTCA 1B1BA 3A02A 3N4MA 2MC3A 5AIQA 1VQMI 3KFWX 3WU0A 1OYYA 3CF2A 3OYCA 4B43A 4DBQA 4Y7NJ 2WC2A 1HW2A 2A6TA 2CSOA 4YG2F 3RKQA 3ZXSA 4Q5SF 2X48A 3CC2I 1X3WB 3DBHB 3WTTC 5GAEJ 5DYMA 1CQTA 3HOSA 3F8BA 2MLGA 4XN0A 1H0MA 4FX4A 2PJRA 1ITYA 4U7BA 3KP5A 1VQOI 3FX3A 1OLTA 5E8IA 2HYGD 4RAFA 3F22A 4CCJA 4IQ4A 5C4XJ 2Y9YA 1UZCA 1YS6A 2W1OA 4TV7A 3QODA 3R0JA 5KAIC 3Q0WA 2BGCA 2HQAA 4OAZA 2FJ1A 3ERMA 3IKTA 3DCFA 1FBSA 1WI9A 3PIPF 1VQLI 2XDVA 2QUFA 2M34A 4PUSA 4DJAA 1XS9A 1DUXC 2DT7B 2DMPA 1DU0A 4D5FA 5LHHA 2O8XA 3WHCA 5HLGA 1N75A 1NG7A 5E1XA 1HOMA 3CTAA 1MJBA 2W84A 3L2RA 2PG4A 3J80K 2O6GE 4EMSA 3C1DA 3IH2A 1HXDA 5GADJ 4I09A 5BOXA 3LFUA 5J1UA 3H92A 2K27A 3MN2A 3ABLH 4MGRA 5D8KB 1SEUA 1OQYA 4YFXF 2VL8A 1L0OC 3DU5A 5FKLA 1W5TA 4J00A 2EIKH 1ETVA 4AYBN 5FLXZ 3MAJA 2A68F 3IKVA 3RZOJ 1MZBA 2HDDA 4DIQA 2Y9ZA 4BY1J 2QLZA 1AKHB 4FETA 4DYCA 3Q0VA 1ZH5A 1P9QC 3HOZJ 1AHDP 1TNTA 3RPQA 1Z67A 2JSCA 1D8KA 2ESHA 4M74A 2DBBA 2JVHA 1D1BA 1FOYA 4XKBA 1GV5A 1L3LA 3DKYA 2MFZA 3GZNB 3PJRA 5EZGA 5JLXA 3GFIA 4XLPF 1R5ID 2ETHA 1VI0A 1OMIA 1YS7A 2FBHA 1R00A 2G7UA 3CJTB 2XF5A 1YLFA 1DP7P 2X1DA 1MBGA 4MHGA 1QA6A 1JXSA 2IGNA 5BPDA 2CW8A 4IOCF 2DTZA 1ZN2A 3TBIA 4A2UA 3KZZA 4ENMA 4KIGA 4EJWA 2CW0F 2P0WA 2GIVA 1R7JA 5FKNA 2PMUA 3QOEA 1JTXA 2VN2A 3K4BA 3FMRA 1GT0C 3C2GA 2NVXJ 4CCLA 3REOA 2FE3A 4YELA 4G94A 2HWVA 1MW7A 3P7NA 4GCVA 2LVSA 3I58A 2K40A 3BTLA 1HLVA 3ESWB 2IA0A 4BQAA 2XRLA 4BBSJ 4NNJA 4YIRX 1YJWI 3BQYA 4Z6YA 1HBXG 1MMGA 2XUBA 5CVVA 2E2HJ 4BL0B 4EJUA 2GIZA 3QYEA 1WJAA 2HOTA 2I5UA 4KDPA 2DA3A 1ZYRF 4PJNA 1XDUA 3V7CA 3ULQB 3O2PE 3ZCOA 3NQOA 2EZHA 3FBIB 3BTJA 4PK4A 2UZKA 4BGDA 2PMHA 5GTIC 5J47A 4HRIA 5EZHA 3B02A 1IXCA 2VI6A 2LD5A 4XOPA 2E5ZA 1FMVA 2I8DA 1J7KA 2K9SA 3M7GA 5LGUA 3V7SA 5FD5A 2Y48A 2HQNA 3TL4X 3LSPA 5DS9A 2TCTA 2BHYA 4HLYA 2ZMEC 1R1VA 4G8XA 4BH9A 1ZGAA 5HDGA 3KETA 3ZN1A 3LQRA 2JMWA 4WX9A 1NK2P 4ASNA 5L3DA 2X6WA 1JUMA 1KYWA 1RI7A 4A3JJ 1FTTA 1LJ9A 2VC1A 2XV4S 2YPRA 1B9MA 3PSFA 3G6EI 1P92A 3WE2A 2XROA 5FKMA 4XLHA 2L2OA 3IAM2 4IXAA 4FASD 1G8XA 2M0CA 2E7XA 3BG5A 3JRAA 2P5LC 2F4OB 2V1DA 4XRFA 2XGCA 4WXHA 3I55I 3VB2A 2EV6A 4L5IA 3CCYA 3T8RA 2IJLA 3LSIA 1WFXA 2CRGA 4RGSA 1D1CA 3TQNA 2FOWA 2JK3A 3LAPA 2X6YA 1XMAA 2L5QA 3VYTB 4KITB 3E5QA 1X58A 1UHMA 3GVAA 3LFKA 3ZGKA 3JRCA 3CD6I 4PFPA 1IN4A 4HG2A 2Q2EB 1J0RA
chains in the Genus database with same CATH topology
2IA1A 5DV5A 3TO7A 4HQEA 3RYPA 2OQGA 2EFPA 3IWFA 1B6AA 4JBAA 3ERED 4L9NA 3QU6A 3ABTA 4OIQF 4LK0F 2P6TA 2CGPA 3J81Z 4WXDA 2F2EA 5FFXA 2QBYB 4L9JA 4OIPF 1P4AA 5H6QA 4Q48A 2ZO4A 1PUEE 3BZ6A 4M9ZA 1MKMA 1TW3A 3K9TA 5L3EA 4OU0A 1U5TC 2IP2A 2P5VA 1F1ZA 1BI0A 2XAJA 2FSWA 3Q9SA 1HSTA 2IVMA 2WTEA 1XGSA 3M1EA 3HHHA 2PFBA 3K1MA 3OV8A 3F8NA 2K7LA 5IT9Z 1YFHA 3GX4X 1S7OA 3M8FA 1DPUA 2H6BA 4LD5A 3EDPA 3I0TA 2VBZA 4ESBA 1Z7UA 1E2XA 3MCZA 3I53A 4A0YA 4LMYA 3SHFA 1FLIA 3W6JB 4HBLA 4R8HA 4KUMA 3FMSA 3QP5A 1KA8A 3RKXA 2BEOA 1XSVA 1HW1A 1A04A 3DQVC 1FZPB 3I54A 3BPVA 2JTVA 3RJPA 3BJOA 5ICEA 1WWXA 3GF2A 1H9GA 1JGSA 3FXRA 2ZMEB 3U9GA 4B8XA 5ED4A 5BQTA 2RGVA 4L0ZB 3HRUA 4ZZLA 3JTHA 4P9FA 3RYRA 2XKPA 2EK5A 2OAZA 4I7HA 3WE3A 2FNAA 2RNJA 3WODF 1ZRDA 2GXBA 1P2FA 3BROA 3TO9A 1UB9A 5AIPA 3O6BB 2J5PA 4LLGF 1ZARA 4DQ2A 3O3KA 4PCQA 2A6HF 2Q2EA 2X0LA 2A69F 1YW9A 1RUOA 4EV0A 4GYGA 3E6DA 4I2OA 3ISPA 2DAOA 3L09A 3EYYA 4KIFA 3ZPLA 2H94A 3GFLA 5K5RA 3KP6A 5D4RA 3LAJA 4MTEA 2QBYA 3F23A 3RI4A 4EM1A 3F21A 1U5TB 3QPTA 4CICA 2DK8A 3JAMZ 3IRRA 3BOQA 3RDIA 2PBIA 1SFUA 1BJAA 5J8CA 3HTSB 2FBKA 3CLOA 2GXGA 5LEJA 2RV8A 4YFKF 2R3SA 5E8GA 4EM0B 2V1UA 2VT3A 2FXAA 1S3JA 2DFIA 2P7VB 3COAC 4MEXF 5JR3A 4RB1A 2DPUA 4ENNA 4HZFA 3E5UA 1OYWA 4U0WA 1OR7A 1TNSA 1IN8A 2QVOA 3DKWA 5CVUA 4PGHA 5DEQA 2KRFA 5HOOA 3R61A 1F4KA 1FX7A 2BV6A 3V7RA 1MJ9A 5LRRA 3RIRA 1ZGJA 4ZH4F 1SD6A 3KP2A 4O5VA 4XSXF 3TOBA 1OYIA 5HDKA 1ONVA 2RKHA 4XLNF 4M71A 2BE5F 1KU9A 2V9VA 4M73A 2HZTA 4M6YA 3GLXA 4HX8A 4O3MA 5KVRA 2V1XA 4LG0A 3E6BA 4EM2A 2QYOA 1QZZA 4BXUA 1GVJA 2PQ8A 3BP8A 2CO5A 3LA3A 3TKYA 3HIFA 5ERIA 3ML6A 1W4MA 2ZXJA 2FEZA 2L4AA 4RS8A 1D5VA 4LLNA 2FMLA 2KIMA 4QWQA 4UXNA 4KA4A 4L9VA 2D2WA 4EGYA 3QPHA 2V6CA 2OA4A 4XBFA 5JI6A 4KMUX 4CDGA 5LRSA 5D6FA 4I0AA 5A2QZ 1GXQA 2YX4A 2ZNYA 1S7AA 5H20A 2DO7A 4UHTA 5J6XA 2XVCA 2H27A 5FLXK 3H3UA 2D1HA 3LSTA 1ZLKA 2XAFA 1BOAA 1U3EM 4G7HF 2HFHA 3AAFA 2OZUA 1ZAOA 2EFNA 3T5XA 2O0YA 1IAWA 3LA7A 1T39A 5LLQA 1J59A 3MZHA 4AIHA 3U1DA 3K0LA 1V4RA 5E20A 4HF1A 2W57A 1U8RA 1U5TA 1AOYA 2O61A 3V8LA 2X4HA 4IPAA 4RGRA 1SFEA 4L9TA 2QM3A 1YW7A 3F8MA 3KLOA 4HLXA 2KJCA 5FO5A 4N9HA 1R23A 2PLYA 1Z05A 5FD6A 2IA2A 2MLKA 3HYIA 1HSJA 1LDKB 4E70A 2VOOA 4ZYHA 3WGGA 4MQVA 2EV0A 2XIGA 2ZJ2A 2GA1A 1J75A 5EEHA 5JHUA 4A5NA 5ILUA 4ON0A 4P55A 4G7ZF 3DPLC 4A6EA 3GO5A 2NYXA 4I02A 2E1CA 2D45A 2K86A 1XSDA 5CVJA 4OIOF 1IXSB 4Q47A 1XN7A 3I59B 1IF1A 1IXRC 5L3BA 4I01A 1D3YA 3WGIA 5K5QA 1ULYA 4HOBA 2NNNA 1IZ1A 3V8JA 4ZYEA 3BY6A 5D5WB 4O6JA 2M30A 1ODDA 1KU2A 3FMQA 5HVQC 1YO5C 2C6YA 2UXNA 5F1RA 3ZN0A 4R79A 3OOPA 4HAMA 2H6CA 1QNTA 3CDHA 3DXJF 2XAQA 3L2CA 4CXFA 3P9IA 1G3WA 4PGGA 1DDNA 1E17A 2XRNA 2F5FA 3P9CA 4OOIA 4Y17A 1C0WA 3MWMA 2OZ6A 2DI3A 1KU3A 3J81K 3MEXA 5E18F 1I6XA 4GO1A 5E1ZB 2M5WA 4ETSA 4U0VA 2ZNZA 2FOKA 3EUHA 3QRFF 3FM3A 4G9YA 3D0SA 3RKWA 4UVCA 1QPMA 3JW4A 3KEOA 2P8TA 2KIFA 3WTUC 3QU3A 2YSRA 2G7HA 5IT9K 2GZWA 1BIAA 2VE9A 1HKTA 2A6EF 3DPTA 3RKYA 3E3VA 2MBFA 3WGHA 2HEOA 3CJNA 1BC8C 5LGTA 1G3TA 1H9TA 3DFGA 1J2XA 3KEQA 4NQWA 1BI1A 3KLNA 2O3FA 1LQ1A 4KN7X 1K7AA 1S8NA 1G6NA 3RPUA 1YIOA 4CGZA 4HA8A 4IRHA 2YU3A 2PI0A 5HDNA 1TLHB 3DF8A 2IRFG 4OIRF 1QZYA 3I59A 3JSPA 3QP6A 1LDDA 4RB2C 4N9IA 2K02A 2XASA 3CUQC 4K2EA 4RGUA 1WSUA 1S29A 3K69A 2RQPA 2D1VA 2M87A 4A12A 4ESJA 4M9XA 2EFQA 3EETA 3HUGA 4R1HA 1R58A 4AIJA 3DEUA 1MJAA 2NRAC 2LNBA 2ZKZA 3P9KA 1LB2A 3WTSC 1XMKA 1PDNC 4NHJA 4H0EA 1CF7B 4I0BA 2YX7A 2NS0A 5ILVA 3HSEA 2J5OA 1SD5A 1FY7A 5DCMB 3HSFA 3T0YA 3WU1B 2IPQX 1XCVA 4LG0B 4ENKA 4LB5A 5EEGA 2HTJA 2QQBA 5ICFA 2W25A 1LVAA 3FM5A 1P4XA 2E1NA 4HF0A 2WV0A 4MQ9F 2A07F 1ZG5A 4P96A 3VODA 2HS5A 1BC7C 1LNWA 2QWWA 4G6DA 3TDZC 1U6GA 3ZMSA 2OBPA 3S2WA 1I27A 2COMA 3WTYC 5E17F 4LFUA 4DNCA 4EJOA 4ZZDA 1R22A 3C18A 3U2RA 1ON1A 2VC0A 2OD5A 2L3DA 3DV8A 1R1UA 1HW5A 2Y75A 2R7FA 3EQLF 3D5LA 3CUOA 1ZREA 1PP7U 3B73A 1SAXA 2Y0MA 2VONA 5H6RA 3FHZA 2K4JA 1P6RA 2ISYA 1TBXA 2EA4A 5D8LB 3KP7A 2RC4A 1RIOH 3KP4A 5HLHA 1Z9CA 1KYZA 2KKOA 4P5OA 4FHTA 3FXUA 4YIIA 1S6LA 3CUQB 2DPDA 3BDDA 5HS7A 4IVNA 4JQFA 1IUYA 2VODA 3NEUA 1G4DA 2NAZA 3WG9A 1BN5A 1D8JA 5D5VB 1Y0UA 3GFJA 4S04A 1KQ0A 2DT5A 2BBYA 2VE8A 1I1SA 1IN5A 2R7DA 4UV9A 2HKOA 2DU9A 3F72A 3KZYA 1SD4A 2ZFWA 1IRGA 1SD7A 4EJVA 3F8FA 2P7CB 5CJ9A 4LB6B 1SFXA 4GYIA 2A61A 1CF7A 2A5YB 3Q5FA 3GFMA 3IWZA 5DCMA 2EFWA 3RTRA 4Z2YA 4BHBA 2OQRA 3IC7A 3VEPA 5CLSA 5D6EA 2HKXA 1JHFA 3G3ZA 2RN7A 1HQCA 3ABUA 5LEKA 1BI3A 1O3RA 4A5MA 5KK1A 1U78A 3MZYA 1EH6A 1WQ2A 1P4WA 1XB4A 2Z99A 4L0YB 4U0YA 2EFOA 5CYVA 3ZMVA 3PQKA 2HR3A 3SQNA 1TQIA 4HV5A 1IN6A 2DW4A 2IT0A 2MH9A 3F6VA 3V4GA 4CO8A 2E7WA 3KE2A 4BHCA 4Y15A 1FP1D 3MFKA 3ZMTA 1FNNA 2NNYA 4HF2A 1NHAA 3I71A 3JSOA 2VT2A 3W6KB 3HHGA 1LEAA 1BBYA 1W5SA 1IW7F 4ENJA 3ECOA 2KJBA 4AVPA 4WWCA 5HLIA 2HYFA 1QO0D 2VOPA 2DTRA 1HKSA 1W7PB 3LA2A 1QGPA 1YTYA 4BAYA 1R5GA 1J9IA 2WWYA 1XD7A 5LHIA 3CUQA 4AD9A 6PAXA 1B4AA 2EA2A 2F5DA 4RGXA 1X3UA 4CYDA 4OMZA 5BPIA 2V79A 4FT8A 2HQRA 2MD5A 4UVAA 5DUIA 3GZ5A 3CO7C 4Y13A 4FX0A 3L7WA 4IJAA 4WXCA 4CHUA 2LSOA 5LBQA 2QZ8A 1FSEA 1O7FA 4KT5C 1RUNA 1FOKA 4OINF 1ZG1A 1UCRA 3TGNA 3HRTA 1XGNA 5JFRA 3VOEA 5J8FA 5TRDA 2LF7A 4JK1X 4IHSA 3C3WA 1K78B 4M9SA 2XKOA 3GUDA 1K79A 4WK8F 1ZRCA 3GYHX 3HOTA 2JZYA 3LQQA 4KMFA 1RZ4A 3M9AA 1FP2A 4PDKA 4MTDA 3GW2A 2FNPA 4ZYGA 4G6QA 1KQ8A 2W85A 1R1TA 2QQAA 2H09A 1FYKA 3PFIA 1XDSA 1KGSA 3I64A 3ZQ7A 1PP8F 3LWFA 2CFXA 5CVIA 2M8EA 2XAHA 3IRQA 1FBQA 5TJJA 2EWNA 3N97A 1ZHFA 3EYIA 5ILSA 1GHCA 1FWZA 4YIFA 3IL2A 1R5HA 3E6CC 1AWCA 1BM9A 2AXLA 2JT1A 4D0PA 4KYWA 1JHHA 1YYVA 5ICCA 2STTA 1K6OA 4GGGA 3FZVA 1Q1HA 2MA3A 3F3XA 2L02A 1USSA 1VTNC 1W7PA 5FGMA 2CYYA 3F8CA 5HS9A 3TOAA 1EH7A 3KP3A 4ZYDA 1YG2A 5FB2A 3J80Z 2P6SA 2PEXA 3BWGA 2MH2A 2FQ3A 1MD0A 1YQAA 2IW5A 1STZA 1USTA 2ADUA 1LDJA 5CVRA 1REPC 4PZJA 1ZRFA 1T6SA 3GEZA 2OU2A 1CGPA 4HDUA 4CZZA 1HKQA 1EH8A 4I98B 2Q8KA 4NB5A 1ZG3A 5DCFA 2B0LA 2TDXA 1Z6TA 5DDGA 2ZCWA 1SMTA 2GQQA 2Z5UA 2ESNA 1XCBA 3I4PA 1IRFA 4L18B 3E6MA 1B9NA 4LJZF 3FWEA 2UXXA 2P4WA 3M8EA 4QLCU 2VBYA 2FBIA 2XHKA 3IHUA 1J5YA 2LDUA 2Z9OA 1OPCA 4HX7A 3HSRA 2K4BA 2W24A 3K2ZA 2ELHA 2M45A 4HX4A 1K78A 2CWEA 4N0BA 2A3SA 2ACJA 1OKRA 1MDMB 2HTSA 4BYYA 5D5UB 3ROUA 3L00A 2HOEA 4ESFA 1TW2A 4A0ZA 2ZBKA 1WRJA 5F64A 4RAZA 1LEBA 4HV6A 5JVTA 2EB7A 5L3FA 2Z33A 5DD8A 4HW0A 1ZLJA 3JTGA 3SZTA 1WKMA 3T1BA 4MEYF 2HGCA 3NRVA 4Q4ZF 2BYVE 2JPCA 1FBUA 2GWRA 3I5UA 3PQJA 5IT3A 2XGXA 3R6SA 4KFCA 1T0FA 3GXOA 3E97A 5BS6A 2YR2A 1EV7A 3HTUA 3KCCA 4B09A 1O7LA 3C7JA 4HQMA 2UWMA 4F7ZA 3ELKA 3FXQA 3K1NA 4EJTA 3JAMK 1KQ9A 1XGOA 4HDVA 4KNYA 2ISZA 4IRGA 4GXOA 2LKPA 2FF4A 4LK1F 2GAUA 5AONA 2RVCA 4WCGA 2L01A 3VFZA 3ZP5A 3BPXA 5HS8A 1UFMA 4U7DA 4UV8A 1O57A 4RB3C 5F6FA 1YW8A 2XAGA 2O03A 3J7AO 1G3YA 1Z6RA 3SZPA 5L3GA 4OMYA 3L9FA 5DD4A 3ZMZA 2STWA 3BJ6A 2KIUA 3WTVC 4EVIA 4AWXB 2DLLA 1O3TA 2HDCA 3WTXC 3BJAA 2CQKA 4G7OF 3F6OA 3MQ0A 1XGMA 2QQ9A 2DQRA 3FF5A 2JRTA 3QAHA 2PN6A 4EGZA 5LGNA 2JPBA 2VBWA 1T98A 3G73A 3HRMA 1TTYA 1U2WA 4MNUA 1O3QA 2FU4A 2L4MA 5LHGA 1Z1DA 4IHTA 1RNLA 3R60A 1XSXA 4BHPA 4A0XA 2DQLA 3GZ6A 3V8KA 1MDMA 3CO6C 3E5XA 3GWZA 3R4KA 4KIBA 1FC3A 4LGWA 1F9NA 1W7PD 5A2QK 2PJPA 2RDPA 4M6XA 3ZMUA 1T38A 5K1YA 1TQMA 1FT9A 2Z3YA 1KU7A 2FMYA 4S05A 4LLLA 2VXZA 1FSHA 4EQQA 1DPRA 5E1WA 1GXPA 4YFNF 4UUVA 1ON2A 3WTWC 4L5JA 3R0AA 2L54A 3ECHA 2FRHA 5L3CA 4P9UA 2QENA 3T8TA 2F5EA 4KN4X 1BI2A 4A6DA 2P5KA 1SMYF 2CG4A 1I5ZA 4U88A 4XSZF 5BMZA 4AIKA 5K5OA 3TDUC 2DK5A 2ZMEA 4KICA 5ICGA 5DUKA 3H3ZA 1F5TA 1Z91A 4M72A 1UHWA 3DP7A 3HRSA 4WF2A 1QQIA 3WTZA 1FYMA 1BIBA 1IN7A 1I1GA 4IF4A 3TO6A 2F5CA 1T2KA 2G9WA 1B59A 3ZMDA 1FYLA 1V3FA 2LF8A 1R36A 5D5XB 5D4SA 2AS5F 1QBJA 4UNOA 1JE8A 3SFZA 2FA5A 5FFZA 1FPQA 1MGTA 1TQPA 2Q0OA 3Q9VA 3K1PA 4IRIA 2M1BA 2EJRA 1O3SA 3SXYA 4RAYA 4RB0A 4BNCA 3QOPA 4HYEA 2EV5A 2GA2A 2VBXA 1G3SA 1B1BA 3N4MA 2MC3A 5AIQA 3KFWX 3WU0A 1OYYA 1HW2A 2WC2A 2CSOA 4YG2F 4Q5SF 3WTTC 5DYMA 3HOSA 3F8BA 2MLGA 1H0MA 4FX4A 4U7BA 3KP5A 3FX3A 5E8IA 2HYGD 3F22A 1YS6A 4TV7A 3R0JA 2BGCA 3IKTA 1FBSA 1WI9A 2QUFA 1DUXC 5LHHA 2O8XA 5HLGA 5E1XA 3CTAA 1MJBA 2W84A 2PG4A 3J80K 2O6GE 4EMSA 3C1DA 1HXDA 4I09A 5BOXA 3H92A 2K27A 4MGRA 5D8KB 4YFXF 1L0OC 1W5TA 5FLXZ 3MAJA 2A68F 3IKVA 1MZBA 2QLZA 1ZH5A 1TNTA 3RPQA 2JSCA 1D8KA 2ESHA 4M74A 2DBBA 1L3LA 3GFIA 4XLPF 2ETHA 1YS7A 1OMIA 2FBHA 1R00A 2G7UA 1DP7P 1YLFA 4MHGA 1JXSA 5BPDA 1ZN2A 4A2UA 4ENMA 3KZZA 4KIGA 4EJWA 2CW0F 2GIVA 1R7JA 2PMUA 2VN2A 3FMRA 3REOA 2FE3A 4G94A 2HWVA 3P7NA 4GCVA 3I58A 2IA0A 4BQAA 1HBXG 2XUBA 5CVVA 4EJUA 4KDPA 1ZYRF 1XDUA 3V7CA 3ULQB 3O2PE 3NQOA 2UZKA 2PMHA 3B02A 1IXCA 1J7KA 3M7GA 5LGUA 3V7SA 5FD5A 2Y48A 2HQNA 4HLYA 1R1VA 4G8XA 4BH9A 1ZGAA 5HDGA 3KETA 3ZN1A 3LQRA 4WX9A 4ASNA 5L3DA 1KYWA 1RI7A 1LJ9A 2VC1A 2XV4S 2YPRA 1B9MA 1P92A 3WE2A 2XROA 4IXAA 2E7XA 2P5LC 2V1DA 4XRFA 4WXHA 3VB2A 2EV6A 4L5IA 3T8RA 2IJLA 4RGSA 3TQNA 3LAPA 1XMAA 3E5QA 1UHMA 3GVAA 3LFKA 1IN4A 4UVBA 1J0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA1 A;  5DV5 A;  3TO7 A;  4HQE A;  3RYP A;  2OQG A;  2EFP A;  3IWF A;  1B6A A;  4JBA A;  3ERE D;  4L9N A;  3QU6 A;  3ABT A;  4OIQ F;  4LK0 F;  2P6T A;  2CGP A;  3J81 Z;  4WXD A;  2F2E A;  5FFX A;  2QBY B;  4L9J A;  4OIP F;  1P4A A;  5H6Q A;  4Q48 A;  2ZO4 A;  1PUE E;  3BZ6 A;  4M9Z A;  1MKM A;  1TW3 A;  3K9T A;  5L3E A;  4OU0 A;  1U5T C;  2IP2 A;  2P5V A;  1F1Z A;  1BI0 A;  2XAJ A;  2FSW A;  3Q9S A;  1HST A;  2IVM A;  2WTE A;  1XGS A;  3M1E A;  3HHH A;  2PFB A;  3K1M A;  3OV8 A;  3F8N A;  2K7L A;  5IT9 Z;  1YFH A;  3GX4 X;  1S7O A;  3M8F A;  1DPU A;  2H6B A;  4LD5 A;  3EDP A;  3I0T A;  2VBZ A;  4ESB A;  1Z7U A;  1E2X A;  3MCZ A;  3I53 A;  4A0Y A;  4LMY A;  3SHF A;  1FLI A;  3W6J B;  4HBL A;  4R8H A;  4KUM A;  3FMS A;  3QP5 A;  1KA8 A;  3RKX A;  2BEO A;  1XSV A;  1HW1 A;  1A04 A;  3DQV C;  1FZP B;  3I54 A;  3BPV A;  2JTV A;  3RJP A;  3BJO A;  5ICE A;  1WWX A;  3GF2 A;  1H9G A;  1JGS A;  3FXR A;  2ZME B;  3U9G A;  4B8X A;  5ED4 A;  5BQT A;  2RGV A;  4L0Z B;  3HRU A;  4ZZL A;  3JTH A;  4P9F A;  3RYR A;  2XKP A;  2EK5 A;  2OAZ A;  4I7H A;  3WE3 A;  2FNA A;  2RNJ A;  3WOD F;  1ZRD A;  2GXB A;  1P2F A;  3BRO A;  3TO9 A;  1UB9 A;  5AIP A;  3O6B B;  2J5P A;  4LLG F;  1ZAR A;  4DQ2 A;  3O3K A;  4PCQ A;  2A6H F;  2Q2E A;  2X0L A;  2A69 F;  1YW9 A;  1RUO A;  4EV0 A;  4GYG A;  3E6D A;  4I2O A;  3ISP A;  2DAO A;  3L09 A;  3EYY A;  4KIF A;  3ZPL A;  2H94 A;  3GFL A;  5K5R A;  3KP6 A;  5D4R A;  3LAJ A;  4MTE A;  2QBY A;  3F23 A;  3RI4 A;  4EM1 A;  3F21 A;  1U5T B;  3QPT A;  4CIC A;  2DK8 A;  3JAM Z;  3IRR A;  3BOQ A;  3RDI A;  2PBI A;  1SFU A;  1BJA A;  5J8C A;  3HTS B;  2FBK A;  3CLO A;  2GXG A;  5LEJ A;  2RV8 A;  4YFK F;  2R3S A;  5E8G A;  4EM0 B;  2V1U A;  2VT3 A;  2FXA A;  1S3J A;  2DFI A;  2P7V B;  3COA C;  4MEX F;  5JR3 A;  4RB1 A;  2DPU A;  4ENN A;  4HZF A;  3E5U A;  1OYW A;  4U0W A;  1OR7 A;  1TNS A;  1IN8 A;  2QVO A;  3DKW A;  5CVU A;  4PGH A;  5DEQ A;  2KRF A;  5HOO A;  3R61 A;  1F4K A;  1FX7 A;  2BV6 A;  3V7R A;  1MJ9 A;  5LRR A;  3RIR A;  1ZGJ A;  4ZH4 F;  1SD6 A;  3KP2 A;  4O5V A;  4XSX F;  3TOB A;  1OYI A;  5HDK A;  1ONV A;  2RKH A;  4XLN F;  4M71 A;  2BE5 F;  1KU9 A;  2V9V A;  4M73 A;  2HZT A;  4M6Y A;  3GLX A;  4HX8 A;  4O3M A;  5KVR A;  2V1X A;  4LG0 A;  3E6B A;  4EM2 A;  2QYO A;  1QZZ A;  4BXU A;  1GVJ A;  2PQ8 A;  3BP8 A;  2CO5 A;  3LA3 A;  3TKY A;  3HIF A;  5ERI A;  3ML6 A;  1W4M A;  2ZXJ A;  2FEZ A;  2L4A A;  4RS8 A;  1D5V A;  4LLN A;  2FML A;  2KIM A;  4QWQ A;  4UXN A;  4KA4 A;  4L9V A;  2D2W A;  4EGY A;  3QPH A;  2V6C A;  2OA4 A;  4XBF A;  5JI6 A;  4KMU X;  4CDG A;  5LRS A;  5D6F A;  4I0A A;  5A2Q Z;  1GXQ A;  2YX4 A;  2ZNY A;  1S7A A;  5H20 A;  2DO7 A;  4UHT A;  5J6X A;  2XVC A;  2H27 A;  5FLX K;  3H3U A;  2D1H A;  3LST A;  1ZLK A;  2XAF A;  1BOA A;  1U3E M;  4G7H F;  2HFH A;  3AAF A;  2OZU A;  1ZAO A;  2EFN A;  3T5X A;  2O0Y A;  1IAW A;  3LA7 A;  1T39 A;  5LLQ A;  1J59 A;  3MZH A;  4AIH A;  3U1D A;  3K0L A;  1V4R A;  5E20 A;  4HF1 A;  2W57 A;  1U8R A;  1U5T A;  1AOY A;  2O61 A;  3V8L A;  2X4H A;  4IPA A;  4RGR A;  1SFE A;  4L9T A;  2QM3 A;  1YW7 A;  3F8M A;  3KLO A;  4HLX A;  2KJC A;  5FO5 A;  4N9H A;  1R23 A;  2PLY A;  1Z05 A;  5FD6 A;  2IA2 A;  2MLK A;  3HYI A;  1HSJ A;  1LDK B;  4E70 A;  2VOO A;  4ZYH A;  3WGG A;  4MQV A;  2EV0 A;  2XIG A;  2ZJ2 A;  2GA1 A;  1J75 A;  5EEH A;  5JHU A;  4A5N A;  5ILU A;  4ON0 A;  4P55 A;  4G7Z F;  3DPL C;  4A6E A;  3GO5 A;  2NYX A;  4I02 A;  2E1C A;  2D45 A;  2K86 A;  1XSD A;  5CVJ A;  4OIO F;  1IXS B;  4Q47 A;  1XN7 A;  3I59 B;  1IF1 A;  1IXR C;  5L3B A;  4I01 A;  1D3Y A;  3WGI A;  5K5Q A;  1ULY A;  4HOB A;  2NNN A;  1IZ1 A;  3V8J A;  4ZYE A;  3BY6 A;  5D5W B;  4O6J A;  2M30 A;  1ODD A;  1KU2 A;  3FMQ A;  5HVQ C;  1YO5 C;  2C6Y A;  2UXN A;  5F1R A;  3ZN0 A;  4R79 A;  3OOP A;  4HAM A;  2H6C A;  1QNT A;  3CDH A;  3DXJ F;  2XAQ A;  3L2C A;  4CXF A;  3P9I A;  1G3W A;  4PGG A;  1DDN A;  1E17 A;  2XRN A;  2F5F A;  3P9C A;  4OOI A;  4Y17 A;  1C0W A;  3MWM A;  2OZ6 A;  2DI3 A;  1KU3 A;  3J81 K;  3MEX A;  5E18 F;  1I6X A;  4GO1 A;  5E1Z B;  2M5W A;  4ETS A;  4U0V A;  2ZNZ A;  2FOK A;  3EUH A;  3QRF F;  3FM3 A;  4G9Y A;  3D0S A;  3RKW A;  4UVC A;  1QPM A;  3JW4 A;  3KEO A;  2P8T A;  2KIF A;  3WTU C;  3QU3 A;  2YSR A;  2G7H A;  5IT9 K;  2GZW A;  1BIA A;  2VE9 A;  1HKT A;  2A6E F;  3DPT A;  3RKY A;  3E3V A;  2MBF A;  3WGH A;  2HEO A;  3CJN A;  1BC8 C;  5LGT A;  1G3T A;  1H9T A;  3DFG A;  1J2X A;  3KEQ A;  4NQW A;  1BI1 A;  3KLN A;  2O3F A;  1LQ1 A;  4KN7 X;  1K7A A;  1S8N A;  1G6N A;  3RPU A;  1YIO A;  4CGZ A;  4HA8 A;  4IRH A;  2YU3 A;  2PI0 A;  5HDN A;  1TLH B;  3DF8 A;  2IRF G;  4OIR F;  1QZY A;  3I59 A;  3JSP A;  3QP6 A;  1LDD A;  4RB2 C;  4N9I A;  2K02 A;  2XAS A;  3CUQ C;  4K2E A;  4RGU A;  1WSU A;  1S29 A;  3K69 A;  2RQP A;  2D1V A;  2M87 A;  4A12 A;  4ESJ A;  4M9X A;  2EFQ A;  3EET A;  3HUG A;  4R1H A;  1R58 A;  4AIJ A;  3DEU A;  1MJA A;  2NRA C;  2LNB A;  2ZKZ A;  3P9K A;  1LB2 A;  3WTS C;  1XMK A;  1PDN C;  4NHJ A;  4H0E A;  1CF7 B;  4I0B A;  2YX7 A;  2NS0 A;  5ILV A;  3HSE A;  2J5O A;  1SD5 A;  1FY7 A;  5DCM B;  3HSF A;  3T0Y A;  3WU1 B;  2IPQ X;  1XCV A;  4LG0 B;  4ENK A;  4LB5 A;  5EEG A;  2HTJ A;  2QQB A;  5ICF A;  2W25 A;  1LVA A;  3FM5 A;  1P4X A;  2E1N A;  4HF0 A;  2WV0 A;  4MQ9 F;  2A07 F;  1ZG5 A;  4P96 A;  3VOD A;  2HS5 A;  1BC7 C;  1LNW A;  2QWW A;  4G6D A;  3TDZ C;  1U6G A;  3ZMS A;  2OBP A;  3S2W A;  1I27 A;  2COM A;  3WTY C;  5E17 F;  4LFU A;  4DNC A;  4EJO A;  4ZZD A;  1R22 A;  3C18 A;  3U2R A;  1ON1 A;  2VC0 A;  2OD5 A;  2L3D A;  3DV8 A;  1R1U A;  1HW5 A;  2Y75 A;  2R7F A;  3EQL F;  3D5L A;  3CUO A;  1ZRE A;  1PP7 U;  3B73 A;  1SAX A;  2Y0M A;  2VON A;  5H6R A;  3FHZ A;  2K4J A;  1P6R A;  2ISY A;  1TBX A;  2EA4 A;  5D8L B;  3KP7 A;  2RC4 A;  1RIO H;  3KP4 A;  5HLH A;  1Z9C A;  1KYZ A;  2KKO A;  4P5O A;  4FHT A;  3FXU A;  4YII A;  1S6L A;  3CUQ B;  2DPD A;  3BDD A;  5HS7 A;  4IVN A;  4JQF A;  1IUY A;  2VOD A;  3NEU A;  1G4D A;  2NAZ A;  3WG9 A;  1BN5 A;  1D8J A;  5D5V B;  1Y0U A;  3GFJ A;  4S04 A;  1KQ0 A;  2DT5 A;  2BBY A;  2VE8 A;  1I1S A;  1IN5 A;  2R7D A;  4UV9 A;  2HKO A;  2DU9 A;  3F72 A;  3KZY A;  1SD4 A;  2ZFW A;  1IRG A;  1SD7 A;  4EJV A;  3F8F A;  2P7C B;  5CJ9 A;  4LB6 B;  1SFX A;  4GYI A;  2A61 A;  1CF7 A;  2A5Y B;  3Q5F A;  3GFM A;  3IWZ A;  5DCM A;  2EFW A;  3RTR A;  4Z2Y A;  4BHB A;  2OQR A;  3IC7 A;  3VEP A;  5CLS A;  5D6E A;  2HKX A;  1JHF A;  3G3Z A;  2RN7 A;  1HQC A;  3ABU A;  5LEK A;  1BI3 A;  1O3R A;  4A5M A;  5KK1 A;  1U78 A;  3MZY A;  1EH6 A;  1WQ2 A;  1P4W A;  1XB4 A;  2Z99 A;  4L0Y B;  4U0Y A;  2EFO A;  5CYV A;  3ZMV A;  3PQK A;  2HR3 A;  3SQN A;  1TQI A;  4HV5 A;  1IN6 A;  2DW4 A;  2IT0 A;  2MH9 A;  3F6V A;  3V4G A;  4CO8 A;  2E7W A;  3KE2 A;  4BHC A;  4Y15 A;  1FP1 D;  3MFK A;  3ZMT A;  1FNN A;  2NNY A;  4HF2 A;  1NHA A;  3I71 A;  3JSO A;  2VT2 A;  3W6K B;  3HHG A;  1LEA A;  1BBY A;  1W5S A;  1IW7 F;  4ENJ A;  3ECO A;  2KJB A;  4AVP A;  4WWC A;  5HLI A;  2HYF A;  1QO0 D;  2VOP A;  2DTR A;  1HKS A;  1W7P B;  3LA2 A;  1QGP A;  1YTY A;  4BAY A;  1R5G A;  1J9I A;  2WWY A;  1XD7 A;  5LHI A;  3CUQ A;  4AD9 A;  6PAX A;  1B4A A;  2EA2 A;  2F5D A;  4RGX A;  1X3U A;  4CYD A;  4OMZ A;  5BPI A;  2V79 A;  4FT8 A;  2HQR A;  2MD5 A;  4UVA A;  5DUI A;  3GZ5 A;  3CO7 C;  4Y13 A;  4FX0 A;  3L7W A;  4IJA A;  4WXC A;  4CHU A;  2LSO A;  5LBQ A;  2QZ8 A;  1FSE A;  1O7F A;  4KT5 C;  1RUN A;  1FOK A;  4OIN F;  1ZG1 A;  1UCR A;  3TGN A;  3HRT A;  1XGN A;  5JFR A;  3VOE A;  5J8F A;  5TRD A;  2LF7 A;  4JK1 X;  4IHS A;  3C3W A;  1K78 B;  4M9S A;  2XKO A;  3GUD A;  1K79 A;  4WK8 F;  1ZRC A;  3GYH X;  3HOT A;  2JZY A;  3LQQ A;  4KMF A;  1RZ4 A;  3M9A A;  1FP2 A;  4PDK A;  4MTD A;  3GW2 A;  2FNP A;  4ZYG A;  4G6Q A;  1KQ8 A;  2W85 A;  1R1T A;  2QQA A;  2H09 A;  1FYK A;  3PFI A;  1XDS A;  1KGS A;  3I64 A;  3ZQ7 A;  1PP8 F;  3LWF A;  2CFX A;  5CVI A;  2M8E A;  2XAH A;  3IRQ A;  1FBQ A;  5TJJ A;  2EWN A;  3N97 A;  1ZHF A;  3EYI A;  5ILS A;  1GHC A;  1FWZ A;  4YIF A;  3IL2 A;  1R5H A;  3E6C C;  1AWC A;  1BM9 A;  2AXL A;  2JT1 A;  4D0P A;  4KYW A;  1JHH A;  1YYV A;  5ICC A;  2STT A;  1K6O A;  4GGG A;  3FZV A;  1Q1H A;  2MA3 A;  3F3X A;  2L02 A;  1USS A;  1VTN C;  1W7P A;  5FGM A;  2CYY A;  3F8C A;  5HS9 A;  3TOA A;  1EH7 A;  3KP3 A;  4ZYD A;  1YG2 A;  5FB2 A;  3J80 Z;  2P6S A;  2PEX A;  3BWG A;  2MH2 A;  2FQ3 A;  1MD0 A;  1YQA A;  2IW5 A;  1STZ A;  1UST A;  2ADU A;  1LDJ A;  5CVR A;  1REP C;  4PZJ A;  1ZRF A;  1T6S A;  3GEZ A;  2OU2 A;  1CGP A;  4HDU A;  4CZZ A;  1HKQ A;  1EH8 A;  4I98 B;  2Q8K A;  4NB5 A;  1ZG3 A;  5DCF A;  2B0L A;  2TDX A;  1Z6T A;  5DDG A;  2ZCW A;  1SMT A;  2GQQ A;  2Z5U A;  2ESN A;  1XCB A;  3I4P A;  1IRF A;  4L18 B;  3E6M A;  1B9N A;  4LJZ F;  3FWE A;  2UXX A;  2P4W A;  3M8E A;  4QLC U;  2VBY A;  2FBI A;  2XHK A;  3IHU A;  1J5Y A;  2LDU A;  2Z9O A;  1OPC A;  4HX7 A;  3HSR A;  2K4B A;  2W24 A;  3K2Z A;  2ELH A;  2M45 A;  4HX4 A;  1K78 A;  2CWE A;  4N0B A;  2A3S A;  2ACJ A;  1OKR A;  1MDM B;  2HTS A;  4BYY A;  5D5U B;  3ROU A;  3L00 A;  2HOE A;  4ESF A;  1TW2 A;  4A0Z A;  2ZBK A;  1WRJ A;  5F64 A;  4RAZ A;  1LEB A;  4HV6 A;  5JVT A;  2EB7 A;  5L3F A;  2Z33 A;  5DD8 A;  4HW0 A;  1ZLJ A;  3JTG A;  3SZT A;  1WKM A;  3T1B A;  4MEY F;  2HGC A;  3NRV A;  4Q4Z F;  2BYV E;  2JPC A;  1FBU A;  2GWR A;  3I5U A;  3PQJ A;  5IT3 A;  2XGX A;  3R6S A;  4KFC A;  1T0F A;  3GXO A;  3E97 A;  5BS6 A;  2YR2 A;  1EV7 A;  3HTU A;  3KCC A;  4B09 A;  1O7L A;  3C7J A;  4HQM A;  2UWM A;  4F7Z A;  3ELK A;  3FXQ A;  3K1N A;  4EJT A;  3JAM K;  1KQ9 A;  1XGO A;  4HDV A;  4KNY A;  2ISZ A;  4IRG A;  4GXO A;  2LKP A;  2FF4 A;  4LK1 F;  2GAU A;  5AON A;  2RVC A;  4WCG A;  2L01 A;  3VFZ A;  3ZP5 A;  3BPX A;  5HS8 A;  1UFM A;  4U7D A;  4UV8 A;  1O57 A;  4RB3 C;  5F6F A;  1YW8 A;  2XAG A;  2O03 A;  3J7A O;  1G3Y A;  1Z6R A;  3SZP A;  5L3G A;  4OMY A;  3L9F A;  5DD4 A;  3ZMZ A;  2STW A;  3BJ6 A;  2KIU A;  3WTV C;  4EVI A;  4AWX B;  2DLL A;  1O3T A;  2HDC A;  3WTX C;  3BJA A;  2CQK A;  4G7O F;  3F6O A;  3MQ0 A;  1XGM A;  2QQ9 A;  2DQR A;  3FF5 A;  2JRT A;  3QAH A;  2PN6 A;  4EGZ A;  5LGN A;  2JPB A;  2VBW A;  1T98 A;  3G73 A;  3HRM A;  1TTY A;  1U2W A;  4MNU A;  1O3Q A;  2FU4 A;  2L4M A;  5LHG A;  1Z1D A;  4IHT A;  1RNL A;  3R60 A;  1XSX A;  4BHP A;  4A0X A;  2DQL A;  3GZ6 A;  3V8K A;  1MDM A;  3CO6 C;  3E5X A;  3GWZ A;  3R4K A;  4KIB A;  1FC3 A;  4LGW A;  1F9N A;  1W7P D;  5A2Q K;  2PJP A;  2RDP A;  4M6X A;  3ZMU A;  1T38 A;  5K1Y A;  1TQM A;  1FT9 A;  2Z3Y A;  1KU7 A;  2FMY A;  4S05 A;  4LLL A;  2VXZ A;  1FSH A;  4EQQ A;  1DPR A;  5E1W A;  1GXP A;  4YFN F;  4UUV A;  1ON2 A;  3WTW C;  4L5J A;  3R0A A;  2L54 A;  3ECH A;  2FRH A;  5L3C A;  4P9U A;  2QEN A;  3T8T A;  2F5E A;  4KN4 X;  1BI2 A;  4A6D A;  2P5K A;  1SMY F;  2CG4 A;  1I5Z A;  4U88 A;  4XSZ F;  5BMZ A;  4AIK A;  5K5O A;  3TDU C;  2DK5 A;  2ZME A;  4KIC A;  5ICG A;  5DUK A;  3H3Z A;  1F5T A;  1Z91 A;  4M72 A;  1UHW A;  3DP7 A;  3HRS A;  4WF2 A;  1QQI A;  3WTZ A;  1FYM A;  1BIB A;  1IN7 A;  1I1G A;  4IF4 A;  3TO6 A;  2F5C A;  1T2K A;  2G9W A;  1B59 A;  3ZMD A;  1FYL A;  1V3F A;  2LF8 A;  1R36 A;  5D5X B;  5D4S A;  2AS5 F;  1QBJ A;  4UNO A;  1JE8 A;  3SFZ A;  2FA5 A;  5FFZ A;  1FPQ A;  1MGT A;  1TQP A;  2Q0O A;  3Q9V A;  3K1P A;  4IRI A;  2M1B A;  2EJR A;  1O3S A;  3SXY A;  4RAY A;  4RB0 A;  4BNC A;  3QOP A;  4HYE A;  2EV5 A;  2GA2 A;  2VBX A;  1G3S A;  1B1B A;  3N4M A;  2MC3 A;  5AIQ A;  3KFW X;  3WU0 A;  1OYY A;  1HW2 A;  2WC2 A;  2CSO A;  4YG2 F;  4Q5S F;  3WTT C;  5DYM A;  3HOS A;  3F8B A;  2MLG A;  1H0M A;  4FX4 A;  4U7B A;  3KP5 A;  3FX3 A;  5E8I A;  2HYG D;  3F22 A;  1YS6 A;  4TV7 A;  3R0J A;  2BGC A;  3IKT A;  1FBS A;  1WI9 A;  2QUF A;  1DUX C;  5LHH A;  2O8X A;  5HLG A;  5E1X A;  3CTA A;  1MJB A;  2W84 A;  2PG4 A;  3J80 K;  2O6G E;  4EMS A;  3C1D A;  1HXD A;  4I09 A;  5BOX A;  3H92 A;  2K27 A;  4MGR A;  5D8K B;  4YFX F;  1L0O C;  1W5T A;  5FLX Z;  3MAJ A;  2A68 F;  3IKV A;  1MZB A;  2QLZ A;  1ZH5 A;  1TNT A;  3RPQ A;  2JSC A;  1D8K A;  2ESH A;  4M74 A;  2DBB A;  1L3L A;  3GFI A;  4XLP F;  2ETH A;  1YS7 A;  1OMI A;  2FBH A;  1R00 A;  2G7U A;  1DP7 P;  1YLF A;  4MHG A;  1JXS A;  5BPD A;  1ZN2 A;  4A2U A;  4ENM A;  3KZZ A;  4KIG A;  4EJW A;  2CW0 F;  2GIV A;  1R7J A;  2PMU A;  2VN2 A;  3FMR A;  3REO A;  2FE3 A;  4G94 A;  2HWV A;  3P7N A;  4GCV A;  3I58 A;  2IA0 A;  4BQA A;  1HBX G;  2XUB A;  5CVV A;  4EJU A;  4KDP A;  1ZYR F;  1XDU A;  3V7C A;  3ULQ B;  3O2P E;  3NQO A;  2UZK A;  2PMH A;  3B02 A;  1IXC A;  1J7K A;  3M7G A;  5LGU A;  3V7S A;  5FD5 A;  2Y48 A;  2HQN A;  4HLY A;  1R1V A;  4G8X A;  4BH9 A;  1ZGA A;  5HDG A;  3KET A;  3ZN1 A;  3LQR A;  4WX9 A;  4ASN A;  5L3D A;  1KYW A;  1RI7 A;  1LJ9 A;  2VC1 A;  2XV4 S;  2YPR A;  1B9M A;  1P92 A;  3WE2 A;  2XRO A;  4IXA A;  2E7X A;  2P5L C;  2V1D A;  4XRF A;  4WXH A;  3VB2 A;  2EV6 A;  4L5I A;  3T8R A;  2IJL A;  4RGS A;  3TQN A;  3LAP A;  1XMA A;  3E5Q A;  1UHM A;  3GVA A;  3LFK A;  1IN4 A;  4UVB A;  1J0R A; 
#chains in the Genus database with same CATH topology
 2JRM A;  2IA1 A;  3M8J A;  3NWS A;  4JX4 A;  5DV5 A;  3TO7 A;  4HQE A;  3BG6 A;  2WAQ A;  5DTD A;  1LE8 B;  2WAD A;  3RYP A;  1IGN A;  2OQG A;  2Z2S B;  4F55 A;  2EFP A;  1MSE C;  3IWF A;  1MBF A;  4RM3 A;  1B6A A;  4JBA A;  3ERE D;  3MZ8 A;  4L9N A;  2VKD A;  3QU6 A;  3ABT A;  4OIQ F;  3AKZ A;  4LK0 F;  2O7O A;  2P6T A;  2CGP A;  2DYR H;  3J81 Z;  2UUZ A;  3K4L A;  4WXD A;  2F2E A;  5FFX A;  3JRH A;  2QBY B;  2KT0 A;  4L9J A;  3A03 A;  4OIP F;  1P4A A;  5H6Q A;  3FIS A;  4Q48 A;  2ZO4 A;  1PUE E;  3BZ6 A;  4M9Z A;  1MKM A;  1Z21 A;  3FKJ A;  1TW3 A;  3K9T A;  1JJ8 C;  1AKH A;  3HOW J;  2ZJR F;  1VQN I;  5L3E A;  1NG6 A;  4OU0 A;  1U5T C;  2M4K A;  2IP2 A;  5FJ8 J;  2P5V A;  1F1Z A;  1BI0 A;  2VQH A;  3IH3 A;  2XAJ A;  2FSW A;  3Q9S A;  4E4H A;  4CUG A;  1HST A;  3BQZ A;  2GOM A;  2IVM A;  2WTE A;  4BE2 A;  1XGS A;  1FJL A;  1VQ5 I;  3M1E A;  4A3L J;  1X1P A;  3O8G A;  4FCY A;  4PSX A;  5HNH A;  3HHH A;  2PFB A;  3K1M A;  2FD5 A;  4DOZ A;  2NVT J;  3OV8 A;  1VF9 A;  3F8N A;  2K7L A;  2JQ7 A;  5IT9 Z;  1YFH A;  4BJ6 C;  3GX4 X;  2HYJ A;  2L9R A;  3HM5 A;  2P81 A;  1S7O A;  3CP8 A;  3M8F A;  4XK4 A;  1DPU A;  2H6B A;  4LD5 A;  4Y52 J;  3EDP A;  3I0T A;  2VBZ A;  4ESB A;  3J7A Y;  1DQU A;  1Z7U A;  1E2X A;  4PSW A;  2RQQ A;  3GTJ J;  3W2V A;  3MCZ A;  4IZZ A;  3P5J A;  1BR1 A;  3I53 A;  4A0Y A;  4M3F A;  4LMY A;  2BXZ A;  3SHF A;  1FLI A;  1LFP A;  5GAG J;  5FLV A;  1S9H A;  5LFA A;  2BHZ A;  3W6J B;  3OR2 C;  4HBL A;  2K9M A;  4R8H A;  4KUM A;  3FMS A;  3QP5 A;  1KA8 A;  3RKX A;  2BEO A;  1XSV A;  1HW1 A;  1IC8 A;  1A04 A;  3DQV C;  1FZP B;  5DM7 F;  4BE1 A;  3GTL J;  2V4J C;  4RMN A;  3VYU B;  3I54 A;  4C2U A;  4XOR A;  2L0K A;  3BPV A;  1RR8 C;  2JTV A;  3RJP A;  3SDB A;  1BL0 A;  3BJO A;  5ICE A;  3QYF A;  5C4J J;  3ZQL A;  1WWX A;  3GF2 A;  4RAG A;  1FOX A;  1H9G A;  1JGS A;  3FXR A;  2ZME B;  3U9G A;  3DU6 A;  5LD2 C;  4B8X A;  4XLA A;  5J40 A;  3OYK A;  1RR7 A;  5ED4 A;  1E0E A;  5BQT A;  2RGV A;  3I9V 2;  4L0Z B;  3HBL A;  3HRU A;  2O8K A;  1YX3 A;  2EIN H;  4ZZL A;  5DM6 F;  3W3C A;  3JTH A;  3BR2 A;  4P9F A;  3RYR A;  2XKP A;  3S1M J;  2EK5 A;  3TW6 A;  2OAZ A;  1K4S A;  4I7H A;  1JTY A;  4QSH A;  4AU7 A;  3WE3 A;  5JLW A;  4IHV A;  2FNA A;  3Q3S A;  5KCM A;  2RNJ A;  3WOD F;  3U21 A;  2X9D A;  1ZRD A;  2GXB A;  1FMW A;  3I4M J;  3KX2 A;  4F3Q A;  1P2F A;  3BRO A;  3TO9 A;  3S3N A;  4XON A;  1UB9 A;  5AIP A;  2O9L A;  2K9Q A;  3O6B B;  1IV6 A;  2J5P A;  4LLG F;  1ZAR A;  4DQ2 A;  3S3M A;  3O3K A;  4P1W A;  5EJC A;  4PCQ A;  2A6H F;  1TL8 A;  3BG9 A;  2H1K A;  1X1A A;  2Q2E A;  1UG0 A;  2X0L A;  3ZR8 X;  2HPI A;  3CJR B;  2A69 F;  1YW9 A;  4ZDO A;  3CZ6 A;  1LE8 A;  1RUO A;  4EV0 A;  2MSY A;  4GYG A;  3E6D A;  1RKW A;  2QSF X;  3EUH C;  2E35 A;  3ISP A;  2DAO A;  5IP9 J;  4I2O A;  3L09 A;  3EYY A;  4KIF A;  3ZPL A;  1OCO H;  3IP4 B;  4NC6 A;  2H94 A;  3GFL A;  2AHQ A;  5K5R A;  3HC7 A;  4AID A;  1JT6 A;  3KP6 A;  4CZC A;  1D5Y A;  4F91 B;  3FHN A;  1ZK8 A;  2RRE A;  5D4R A;  3LAJ A;  4MTE A;  3H5N A;  2OJE D;  2QBY A;  3F23 A;  4LIU A;  1WJD A;  4PFO A;  3DTI A;  1K6Y A;  4ANJ A;  3RI4 A;  4HNU A;  2MYS A;  1Z7L A;  4EM1 A;  2KZG A;  1UJ8 A;  4B44 A;  3F21 A;  4AC0 A;  4DBR A;  4DZP A;  1U5T B;  3QPT A;  2XC7 A;  5EG0 B;  4CIC A;  4M3G A;  2DK8 A;  3JAM Z;  3IRR A;  3HDD A;  1Y56 A;  2YS9 A;  3BOQ A;  3RDI A;  5J4Y A;  2PBI A;  1SFU A;  3H0D A;  9ANT A;  5J4V A;  1IRZ A;  1BJA A;  4LG3 A;  5J8C A;  3HTS B;  2FBK A;  3CLO A;  1W0T A;  2GXG A;  5LEJ A;  2RV8 A;  3BCA A;  2ZXI A;  4GDF A;  4YFK F;  2R3S A;  5E8G A;  3CCE I;  4EM0 B;  2V1U A;  2VT3 A;  2FX0 A;  1WH5 A;  1S3J A;  2DFI A;  2FXA A;  2P7V B;  3COA C;  2HZD A;  3NAU A;  3PL8 A;  2NVQ J;  4MEX F;  5JR3 A;  1E3P A;  4RB1 A;  2DN0 A;  2DPU A;  3HJE A;  4ENN A;  2IEK A;  4HZF A;  2GLO A;  2CU7 A;  2LG4 A;  2VQC A;  3E5U A;  1OYW A;  4E6K G;  4U0W A;  4A3B J;  1WJC A;  3HGG A;  4JOM A;  3S15 J;  1OR7 A;  1TNS A;  1IN8 A;  2QVO A;  3DKW A;  4BE0 A;  3B6A A;  5CVU A;  1WJF A;  2K9N A;  1XC5 A;  4PGH A;  5DEQ A;  3ZQH A;  2KRF A;  3VWB A;  1NK3 P;  1ERD A;  5HOO A;  3RCO A;  3R61 A;  1F4K A;  1ACI A;  4NC8 A;  2BY0 A;  1FX7 A;  2BV6 A;  3V7R A;  1MJ9 A;  5LRR A;  3RIR A;  1ZGJ A;  4ZH4 F;  2R7Z J;  4DW6 A;  1SD6 A;  3KP2 A;  1ZR4 A;  4O5V A;  4XSX F;  4XID A;  3TOB A;  1OYI A;  2LH9 A;  5HDK A;  1AU7 A;  1ONV A;  2RKH A;  2BW3 B;  4XLN F;  2DDB A;  2OCC H;  3OL4 A;  1A35 A;  4M71 A;  3SDG A;  2BE5 F;  1FIA A;  1KU9 A;  3H9G A;  1QHH D;  3HG9 A;  4XLC A;  2V9V A;  4M73 A;  2HZT A;  4M6Y A;  3GLX A;  4HX8 A;  4O3M A;  5KVR A;  1YIT I;  2V1X A;  3KEY A;  4LG0 A;  3LL7 A;  1TZL A;  3E6B A;  4EM2 A;  2CQX A;  1T33 A;  2QYO A;  1JUP A;  1QZZ A;  2KFD A;  2LY2 A;  4BXU A;  1OCR H;  1ZR2 A;  4MO7 A;  2QKM B;  1GVJ A;  2PQ8 A;  5F0H A;  4B48 A;  3BP8 A;  2CO5 A;  3LA3 A;  1MBK A;  2WB1 N;  2EIJ H;  5GP9 A;  3TKY A;  2B63 J;  3HIF A;  5ERI A;  4IO9 F;  4G12 A;  4II2 A;  3ML6 A;  1W4M A;  2ZXJ A;  2FEZ A;  1WJB A;  2L4A A;  4RS8 A;  1RPW A;  1D5V A;  4I99 C;  4LLN A;  1LUJ B;  2FML A;  2KIM A;  4QWQ A;  4UXN A;  3AG1 H;  4KA4 A;  4L9V A;  2D2W A;  3CDI A;  3OIP A;  4DYR A;  1E3H A;  2CUF A;  4EGY A;  1TC3 C;  3OYB A;  3CCR I;  3QPH A;  2V6C A;  2OA4 A;  4XBF A;  5FLM J;  1YJN I;  3K70 C;  5JI6 A;  4KMU X;  4CDG A;  2XF7 A;  5LRS A;  5D6F A;  2M4G A;  4I0A A;  5A2Q Z;  3S3O A;  1GXQ A;  3G1O A;  1UHS A;  2YX4 A;  2W7N A;  1Z3X A;  2ZNY A;  1S7A A;  5H20 A;  2DO7 A;  4UHT A;  5J6X A;  2XVC A;  3S1R J;  5FRN A;  2B9S A;  2K3F A;  4JYK A;  4B3A A;  2H27 A;  5FLX K;  3H3U A;  2D1H A;  3LST A;  4HNT A;  1ZLK A;  2XAF A;  1Y8Q B;  1BOA A;  1U3E M;  3BCB A;  2HFH A;  4G7H F;  2X6O A;  1ETW A;  3VSK A;  3AAF A;  2OZU A;  4BBR J;  2F4I A;  1ZAO A;  2EFN A;  4QPQ A;  3T5X A;  2M7B A;  2O0Y A;  1IAW A;  1T08 B;  1KZH A;  3LA7 A;  1T39 A;  5LLQ A;  1J59 A;  3MZH A;  2DMU A;  4AIH A;  2WB1 A;  3DTK A;  2Y31 A;  2IGM A;  3BR0 A;  1HDP A;  3U1D A;  4ZJZ A;  5F1J A;  3K0L A;  2EZK A;  4X6A J;  1V4R A;  5E20 A;  4HF1 A;  2B7E A;  1YHQ I;  1MIJ A;  4PJL A;  5FRM A;  2W57 A;  1U8R A;  1U5T A;  5EG0 A;  3L2W A;  1AOY A;  2O61 A;  3V8L A;  2X4H A;  1HC8 A;  2HPM A;  2E36 A;  4IPA A;  4RGR A;  3CME I;  1HCR A;  2VJI A;  1SFE A;  4L9T A;  4RBO A;  2QM3 A;  2KRC A;  1YW7 A;  3F8M A;  3K6G A;  2R93 J;  2OV7 A;  3KLO A;  4HLX A;  2KJC A;  5FO5 A;  4N9H A;  3W6V A;  4RDU A;  1EF4 A;  1R23 A;  1WCM J;  2LRE A;  2PLY A;  1Z05 A;  3OYJ A;  3SFI A;  3ABK H;  2EIM H;  5FD6 A;  2IA2 A;  1POG A;  4BU2 A;  4KJZ A;  3IUO A;  3DWL E;  2VKH A;  3JRD A;  2MLK A;  4NQW B;  3HYI A;  1HSJ A;  1ZEL A;  4FTH A;  1LDK B;  4E70 A;  2VOO A;  3AL0 B;  1W1W E;  4ZYH A;  1AA7 A;  2BY2 A;  4MQV A;  2EV0 A;  2XIG A;  2ZJ2 A;  3WGG A;  2GA1 A;  5IP7 J;  3GCM A;  1J75 A;  3LNQ A;  4XRS G;  1OCT C;  5EEH A;  3D5R C;  5JHU A;  2LP0 A;  4A5N A;  1YRN B;  5ILU A;  4ON0 A;  4P55 A;  2HVS A;  2CW7 A;  4G7Z F;  3DPL C;  2E2J J;  4A6E A;  1XMX A;  1B72 A;  3GO5 A;  4LIV A;  1BA5 A;  2NYX A;  4I02 A;  3FKI J;  1BR4 A;  2I10 A;  2E1C A;  2D45 A;  2K86 A;  1XSD A;  3GTG J;  3BR1 A;  1YE9 A;  1UAA A;  1D1A A;  3OIO A;  1WHU A;  2WA0 A;  1Y6I A;  5CVJ A;  4OIO F;  1IXS B;  2LC2 A;  1MMN A;  2KIS A;  4Q47 A;  1XN7 A;  2HXO A;  4ZTF A;  3I59 B;  3SZG A;  1IXR C;  5L3B A;  1IF1 A;  4I01 A;  1H88 C;  4QTR A;  4A3F J;  2BW3 A;  3TP3 A;  2IS6 A;  1D3Y A;  3WGI A;  5K5Q A;  4RLQ A;  4V19 K;  1ULY A;  4HOB A;  3I3L A;  1SC7 A;  2NNN A;  1IZ1 A;  3V8J A;  4ZYE A;  5FKK A;  3BY6 A;  1GUU A;  3TMO A;  2NXN B;  1QPI A;  5D5W B;  2DA6 A;  4A3D J;  2XSJ C;  4O6J A;  2M30 A;  4IHX A;  3JR9 A;  1ODD A;  1TWC J;  1KU2 A;  3HXL A;  3SEZ A;  1X3Z B;  2WAF A;  3FMQ A;  5HVQ C;  1YO5 C;  2C6Y A;  3BZC A;  3SEQ A;  2UXN A;  5F1R A;  3ZN0 A;  4R79 A;  3CCU I;  3OOP A;  4XN3 A;  4HAM A;  2XSD C;  3HUG B;  3A0H C;  1R6R A;  4C30 A;  3K2A A;  2H6C A;  1QNT A;  3CDH A;  3DXJ F;  4ZDL A;  2XAQ A;  3L2C A;  2KRH A;  2KDO A;  2OPT A;  4CXF A;  2IAI A;  3P9I A;  1G3W A;  4PGG A;  1DDN A;  1E17 A;  2L7Z A;  3M4O J;  2XRN A;  2F5F A;  2CV2 A;  1OR7 C;  2HDW A;  5M5X J;  1BW6 A;  1X1D A;  1IJW C;  3P9C A;  4OOI A;  4X1E A;  4Y17 A;  1JKO C;  1C0W A;  3MWM A;  2OZ6 A;  1MNE A;  2DI3 A;  3E0J B;  3JRF A;  1KU3 A;  3J81 K;  3MEX A;  5E18 F;  1ETO A;  3CCM I;  4I6Z A;  1I6X A;  2MD0 A;  4GO1 A;  5E1Z B;  2M5W A;  4ETS A;  3D5S C;  1LFB A;  4U0V A;  2ZNZ A;  2FOK A;  2NOG A;  3DTE A;  3EUH A;  3QRF F;  1U9N A;  4HST A;  4RM2 A;  5EEA A;  3FM3 A;  4UB6 C;  3KYL A;  1IDZ A;  4G9Y A;  2EZL A;  4XNF A;  3D0S A;  3G1M A;  4M3E A;  1DGR M;  2ZB9 A;  3RKW A;  4UVC A;  1QPM A;  2WAQ N;  3JW4 A;  3KEO A;  3C2B A;  2P8T A;  4DYQ A;  2ZC2 A;  3DPU A;  2GM4 A;  2KIF A;  4JX6 A;  1MH3 A;  2E1M C;  3VDX A;  3WTU C;  3QU3 A;  4HEA 2;  2YSR A;  2LLK A;  3VYS B;  1DP3 A;  1VFC A;  2JUC A;  2G7H A;  5IT9 K;  1ZTR A;  2Q1Z B;  4G6T B;  2E19 A;  1WI3 A;  4KT6 A;  2GZW A;  1BIA A;  2VE9 A;  1HKT A;  2A6E F;  3K4N A;  3WG7 H;  1FOW A;  3DPT A;  3RKY A;  2CUZ A;  1VQ6 I;  3H5R A;  3E3V A;  1YX5 A;  1JGG A;  2MBF A;  3WGH A;  2HEO A;  3CJN A;  2HQ5 A;  3L1P A;  1BC8 C;  1MSF C;  5LGT A;  1G3T A;  3LOC A;  3GME A;  1SAN A;  2AXT C;  5KNL A;  1H9T A;  1ETY A;  3DFG A;  1J2X A;  1OFC X;  3KEQ A;  4NQW A;  3H3V K;  1I39 A;  1BI1 A;  5GTH C;  1UEL B;  1U8B A;  4A3M J;  5M3F J;  1Y1W J;  1VQ4 I;  4BXF A;  3KLN A;  2QCO A;  2O3F A;  1LQ1 A;  2XF6 A;  2R92 J;  2XPU A;  4KN7 X;  1WPK A;  1K7A A;  1BJZ A;  2V9K A;  4XKW A;  3JRB A;  1Y39 A;  1S8N A;  5F0F A;  2DA7 A;  4MIM A;  1YRN A;  1G6N A;  1Y1V J;  3PO2 J;  2MG4 A;  3RPU A;  4QPO A;  3WHB A;  1YIO A;  4E7K A;  4CGZ A;  4HA8 A;  3VSL A;  4IRH A;  1I6H J;  2YU3 A;  2PI0 A;  5HDN A;  4D7M A;  2QF7 A;  1TLH B;  2YUS A;  3DF8 A;  4HSR A;  1P7J A;  2IRF G;  2VPL A;  2IGO A;  4OIR F;  1QZY A;  4NDL A;  2R5Y B;  2DA1 A;  3I59 A;  2CV1 A;  3JSP A;  3ZQF A;  2JN6 A;  3QP6 A;  2LKX A;  1LDD A;  1Z3Y A;  1YI2 I;  2DOD A;  3IAS 2;  4RB2 C;  2LR8 A;  2K02 A;  4N9I A;  2KQR A;  2XAS A;  3GLL A;  3AG2 H;  3CUQ C;  1VQP I;  3FXL A;  2NVY J;  4K2E A;  4RGU A;  3OYL A;  3GBG A;  4IL6 C;  3L2Q A;  1WSU A;  1DGW Y;  1S29 A;  2JUG A;  1X4O A;  3K69 A;  1X2N A;  3A0B C;  5M5W J;  2UV1 A;  2RQP A;  3CMA I;  2DDA A;  2D1V A;  2M87 A;  4BEH B;  4A12 A;  4BAC A;  3PNT A;  2R5Z B;  4ESJ A;  2QQ8 A;  3DBL B;  3VYR B;  1WGX A;  1J09 A;  4DGW B;  4M9X A;  3CES A;  5B1A H;  5E3O A;  2EFQ A;  1R49 A;  3EET A;  3F0C A;  4N4O B;  1OJL A;  3HUG A;  4R1H A;  3OYI A;  3DKX A;  1R58 A;  4AIJ A;  4XM3 A;  2L9N A;  2W82 A;  3DEU A;  4BQQ A;  1ETX A;  4RA2 A;  3S93 A;  1MJA A;  2NRA C;  2LNB A;  2ZKZ A;  2GOX B;  3ZQQ A;  3P9K A;  3OYF A;  4BDY A;  1LB2 A;  3WTS C;  5IYB J;  1XMK A;  5EGO B;  2R7O A;  2ZJP F;  2IS1 A;  4C2M J;  1PDN C;  4NHJ A;  3ASN H;  3OL3 A;  4H0E A;  2VUM J;  1CF7 B;  4I0B A;  3CDL A;  2YX7 A;  4X0G A;  2VKE A;  2NS0 A;  3FXK A;  2DA5 A;  1YIJ I;  5ILV A;  3HSE A;  3S16 J;  2ECC A;  2J5O A;  1SD5 A;  1FY7 A;  5DCM B;  1GDT A;  4BXX J;  3HSF A;  1PVE A;  1IO2 A;  3S17 J;  2K85 A;  3T0Y A;  3WU1 B;  4UUT A;  2V1N A;  2E1M B;  3H5A A;  2PX9 A;  2EH3 A;  2IPQ X;  1UMQ A;  4V2F A;  1XCV A;  3I56 I;  1MBE A;  2AO9 A;  4LG0 B;  1VZ0 A;  4ENK A;  4J19 A;  4LB5 A;  5EEG A;  2HTJ A;  2QQB A;  5ICF A;  2W25 A;  1LVA A;  3FM5 A;  3S14 J;  1XX5 A;  1P4X A;  2E1N A;  4HF0 A;  2DFH A;  2WV0 A;  4MQ9 F;  5H2F C;  2A07 F;  1ZG5 A;  4P96 A;  3VOD A;  2HS5 A;  1VQ9 I;  1A5J A;  1BC7 C;  1LNW A;  2CUJ A;  1MMS A;  2XAU A;  3OSF A;  2CS3 A;  1XTA A;  1VND A;  2QWW A;  3HKZ A;  4G6D A;  2PMZ A;  1HA8 A;  3TDZ C;  1G59 A;  1U6G A;  4A3I J;  4MLO A;  3ZMS A;  3OYE A;  2OBP A;  3S2W A;  1I27 A;  3HPG A;  2COM A;  3WTY C;  3FIW A;  5E17 F;  4LFU A;  4DNC A;  4LIT A;  1D0Y A;  1X1B A;  4EJO A;  4A93 J;  4ZZD A;  1R22 A;  3C18 A;  3U2R A;  1ON1 A;  1Y0N A;  2BXY A;  2VC0 A;  2LY9 A;  2OD5 A;  1JI8 A;  2L3D A;  3DV8 A;  1R1U A;  2X51 A;  3ASO H;  4XIC A;  1HW5 A;  4E7S A;  4RLF A;  2Y75 A;  2R7F A;  1X19 A;  5B5E C;  4W1U A;  3EQL F;  1JJ6 C;  2F4M B;  3D5L A;  1F43 A;  3CUO A;  1ZRE A;  1B8I B;  3OS2 A;  1PP7 U;  3B73 A;  1SAX A;  2Y0M A;  4PJ0 C;  3EUA A;  4NBQ A;  2VON A;  5H6R A;  3FHZ A;  2K4J A;  1P6R A;  4KIS A;  1A6Q A;  2R0Q C;  4A3G J;  3HEF A;  2ISY A;  3KIO A;  2BOL A;  1TT0 A;  1TBX A;  1K4T A;  2EA4 A;  2JA7 J;  5JVG F;  2QGU A;  2WY8 Q;  2RC4 A;  3KP7 A;  5D8L B;  1RIO H;  4UB8 C;  3KP4 A;  1Z77 A;  5HLH A;  3S1Q J;  5GPA A;  4LOC A;  2R5Y A;  5E3N A;  1Z9C A;  4UY8 I;  3K4K A;  2Z1D A;  3HZJ A;  1KYZ A;  2E71 A;  2KKO A;  4P5O A;  4BJ5 C;  2EZI A;  4FHT A;  2IBD A;  3FXU A;  4CCO A;  3PIO F;  4YII A;  1U0J A;  1S6L A;  4QIW N;  3MKZ A;  2R7W A;  1JKR C;  2MC4 A;  2KHM A;  2VLA A;  1V5G A;  3CUQ B;  1EA3 A;  2L7M P;  2DPD A;  3BDD A;  3PO3 J;  5HS7 A;  5HNF A;  2KLO A;  2M8G X;  3BR6 A;  3JCU C;  3H36 A;  4IVN A;  4JQF A;  4CCN A;  1IUY A;  2KIQ A;  2VOD A;  2X85 A;  3NEU A;  3PFY A;  1G4D A;  1ZQ3 P;  3HB9 A;  2NAZ A;  4BEH A;  2R5Z A;  3WG9 A;  1BW5 A;  1BN5 A;  1D8J A;  1QVU A;  3GTO J;  3M07 A;  5D5V B;  1Y0U A;  3OYN A;  3GFJ A;  4B47 A;  3H1C A;  4BS9 A;  3CJQ B;  5FRO A;  4CSW A;  1KQ0 A;  5F04 A;  4S04 A;  2DT5 A;  2BBY A;  2VE8 A;  2HVQ A;  2FQ4 A;  2HU9 A;  1I1S A;  3CC7 I;  1IN5 A;  1QZE A;  4IEJ A;  4FE7 A;  3AL0 C;  2R7D A;  4UV9 A;  2HKO A;  2DU9 A;  3F72 A;  3KZY A;  1SD4 A;  2Y30 A;  3FXO A;  2ZFW A;  1IRG A;  1SD7 A;  2K5C A;  5E3L A;  5CPR B;  5C44 J;  2XPV A;  4EJV A;  1QHG A;  3F8F A;  3S2D J;  1PYV A;  5CQE A;  1B72 B;  2KZV A;  3TED A;  5EGO A;  2P7C B;  2EBI A;  5CJ9 A;  1APL C;  4LB6 B;  1SFX A;  2KP6 A;  4GYI A;  2A61 A;  3V42 A;  1CF7 A;  2A5Y B;  2DJN A;  1LPQ A;  4CH7 A;  3RZD J;  4IOA F;  3Q5F A;  4E7I A;  3GFM A;  3IWZ A;  5DCM A;  3A4C A;  2X1C A;  5HOD A;  3O8H A;  2EFW A;  4XL9 A;  3RTR A;  3M1C A;  4Z2Y A;  2NS8 A;  3H35 A;  4BHB A;  3OYA A;  3HOX J;  3AG3 H;  2OQR A;  5GPC A;  3IC7 A;  3VEP A;  2FUG 2;  5CLS A;  5D6E A;  1N78 A;  3CLQ A;  2HKX A;  5K7Z A;  2ID6 A;  5J1R A;  1JHF A;  3G3Z A;  2RN7 A;  3OMY A;  1HQC A;  3ABU A;  5LEK A;  4IHY A;  1BI3 A;  1T56 A;  1O3R A;  3OYH A;  3DLA A;  4A5M A;  2VJJ A;  4XLE A;  4YRV A;  5KK1 A;  2X6X A;  1U78 A;  2CQN A;  1EH6 A;  3MZY A;  1WQ2 A;  2GBY A;  4F92 B;  4ZDP A;  3IH4 A;  1P4W A;  1XB4 A;  4GRI A;  2Z99 A;  4L0Y B;  4U0Y A;  2EFO A;  1GV2 A;  5CYV A;  5J3L A;  3PQK A;  2HR3 A;  3ZMV A;  4DZJ A;  3SQN A;  1TQI A;  4HV5 A;  2OF7 A;  1IN6 A;  1QVT A;  3BC8 A;  2DW4 A;  2IT0 A;  2GXA A;  1UG2 A;  2MH9 A;  3K7A J;  1I50 J;  3E1S A;  3F6V A;  2VAS A;  3V4G A;  4CO8 A;  5K7F A;  2E7W A;  1VQ8 I;  2VJ4 A;  3KE2 A;  4IKF A;  4M6V A;  5TIS C;  4BHC A;  4FQG A;  4Y15 A;  1FP1 D;  4BJT A;  3MFK A;  2ZJQ F;  1JKQ C;  1MBJ A;  1HF0 A;  2K9L A;  3ZMT A;  2QKL B;  2R4G A;  1IRX A;  1FNN A;  2NNY A;  3A1Y A;  4FE4 A;  3Q0U A;  1NHA A;  4HF2 A;  1TWH J;  2JA5 J;  2X1E A;  1B8I A;  3I71 A;  3QYB A;  3JSO A;  4JP0 A;  2VT2 A;  3W6K B;  3HHG A;  1LEA A;  1BBY A;  1W5S A;  1IW7 F;  2VKV A;  4ENJ A;  3ECO A;  3FBN B;  2ZSI B;  1IUF A;  2KJB A;  4AVP A;  4WWC A;  4B1R A;  5HLI A;  4A3K J;  1OCP A;  2HYF A;  1QO0 D;  4AVZ A;  2HI3 A;  2VOP A;  2DTR A;  3K70 D;  1HKS A;  1W7P B;  3LA2 A;  4BQN A;  3GTK J;  1QGP A;  3G2B A;  1YTY A;  3S1N J;  4BAY A;  2COB A;  4YEJ A;  1R5G A;  1MBH A;  2MAB A;  3J7Z I;  3G71 I;  1J9I A;  1LFU P;  2WWY A;  1XD7 A;  4S0H B;  5LHI A;  3L2V A;  2XGD A;  3BR5 A;  3H0G J;  2ELJ A;  2VQL A;  3CUQ A;  2VJ5 A;  4AD9 A;  2V26 A;  3EPZ A;  6PAX A;  3KZI C;  1B4A A;  2EA2 A;  3PUB A;  2HOS A;  2LKS A;  2F5D A;  2JA2 A;  4RGX A;  3IV5 A;  1MNM C;  1N25 A;  2DMQ A;  2D5V A;  2R7T A;  1V54 H;  1X3U A;  2ECB A;  4OMZ A;  4CYD A;  2R7X A;  5BPI A;  1XPX A;  2V79 A;  2OCE A;  2VPR A;  2ELK A;  4FT8 A;  2HQR A;  3CCV I;  2CFO A;  2MD5 A;  4UVA A;  3W2A A;  4M3B A;  5DUI A;  3OSG A;  3GZ5 A;  5IP6 A;  4UUS B;  3FXJ A;  4F93 B;  3CO7 C;  2TRT A;  4Y13 A;  4FX0 A;  2O5R A;  3E7L A;  3ZOB A;  3L7W A;  4XOT A;  3CCL I;  3S32 A;  4IJA A;  2LFB A;  2E1O A;  2JSP A;  4WXC A;  3WU2 C;  4CHU A;  3LSK A;  1SFK A;  2LSO A;  1V5F A;  5LBQ A;  3ONQ A;  2QZ8 A;  1D0Z A;  1FSE A;  1D0X A;  2DCE A;  2DOE A;  2H8W A;  2MGQ A;  3OWT A;  1V5E A;  1ZKG A;  1O7F A;  4KT5 C;  1RUN A;  4BY7 J;  5C3E J;  1FOK A;  1EKE A;  4OIN F;  1RES A;  1GVD A;  1YJ9 I;  4CCK A;  4C9Y A;  1ZG1 A;  1UCR A;  3TGN A;  3HRT A;  1XGN A;  3S8P A;  2LK2 A;  5JFR A;  3VOE A;  5J8F A;  5TRD A;  2LF7 A;  4JK1 X;  4IHS A;  3C3W A;  2M2E A;  3BZK A;  1K78 B;  5IY5 H;  4OWR B;  2Y0S N;  4M9S A;  2XKO A;  1W0U A;  3HL2 A;  3GUD A;  1VQ7 I;  1K79 A;  1P7I A;  3MKW B;  2DA2 A;  2EIL H;  4WK8 F;  1RET A;  2DFE A;  1HDD C;  3X2Q H;  1U9O A;  1E3O C;  2DMN A;  1ZRC A;  3GYH X;  3HOT A;  2JZY A;  3LQQ A;  2JA8 J;  4KMF A;  1DU6 A;  1RZ4 A;  3M9A A;  2KPM A;  4AM3 A;  1M1E B;  1H89 C;  3QWL A;  1FP2 A;  4PDK A;  4MTD A;  3CP2 A;  1OCZ H;  1TWG J;  3GW2 A;  2FNP A;  4ZYG A;  4G6Q A;  2HOA A;  1KQ8 A;  2W85 A;  1R1T A;  2QQA A;  2H09 A;  1VQK I;  2LMD A;  1FYK A;  4CA0 A;  4XRS A;  3PFI A;  1XDS A;  4B3X A;  3HOV J;  2LOO A;  3BG3 A;  3JRE A;  3F9K A;  1KGS A;  3I64 A;  3PSI A;  3ZQ7 A;  1PP8 F;  2XPW A;  3LWF A;  5F27 A;  5F08 A;  2CFX A;  4IQJ A;  5CVI A;  5IOZ A;  2M8E A;  2R7V A;  2WV1 A;  5E3M A;  2XAH A;  3IRQ A;  3RQI A;  1FBQ A;  5TJJ A;  2EWN A;  3N97 A;  1SFO J;  1ZHF A;  1XG1 A;  1A36 A;  3EYI A;  5ILS A;  2WAE A;  1WZ2 A;  1GHC A;  1FWZ A;  4YIF A;  2OTL I;  3IL2 A;  1I3Q J;  2NVU B;  2A5W A;  2ZXW H;  1R5H A;  3E6C C;  1JT0 A;  3CMM A;  2Y0S A;  1T8I A;  1X4P A;  1AWC A;  1BM9 A;  3DBR B;  2AXL A;  2JT1 A;  5IOY A;  4H4K C;  4D0P A;  4KYW A;  1JHH A;  1YYV A;  3ZQI A;  3HOY J;  2CQ7 A;  3DEW A;  3MKY B;  5EYR A;  4AYB A;  2H1L A;  5ICC A;  2WBM A;  1H8A C;  2STT A;  2BY3 A;  1K6O A;  4GGG A;  3FZV A;  2F5V A;  3BG7 A;  1Q1H A;  3CQZ J;  2MA3 A;  3SYT A;  3F3X A;  1A6I A;  2L02 A;  1USS A;  1VTN C;  1W7P A;  5FGM A;  2CYY A;  3F8C A;  5HS9 A;  3TOA A;  1EH7 A;  3KP3 A;  4ZYD A;  1YG2 A;  3D1N I;  5FB2 A;  3J80 Z;  2P6S A;  2PEX A;  3BWG A;  1SAU A;  2MH2 A;  5TGT A;  2LTP A;  2FQ3 A;  2W4S A;  1MD0 A;  1YQA A;  2IW5 A;  1STZ A;  1UST A;  2ADU A;  1LDJ A;  3OYM A;  5CVR A;  4D7N A;  1REP C;  1X1C A;  2MW8 A;  3QQA A;  4PZJ A;  3QPL A;  5IYC J;  3EUK L;  1ZRF A;  1T6S A;  2VB6 A;  4UUS A;  3GEZ A;  3GTQ J;  4GFB A;  2OU2 A;  3RSN A;  4HDU A;  2AQF A;  1CGP A;  2DFF A;  4CZZ A;  1HKQ A;  2G0E A;  1EH8 A;  2Z16 A;  4I98 B;  4E7J A;  3UKG A;  2Q8K A;  4NB5 A;  1ZG3 A;  2W00 A;  4C3J J;  5FKO A;  1LVK A;  5DCF A;  2CUE A;  4CCM A;  2B0L A;  2TDX A;  1FIP A;  1Z6T A;  2CH0 A;  2EPF A;  5DDG A;  2DOA A;  2ZCW A;  3A01 B;  1SMT A;  2GQQ A;  2Z5U A;  2ESN A;  1XCB A;  2L9S A;  3I4P A;  1IRF A;  4NUB A;  4L18 B;  3E6M A;  4CYC B;  1B9N A;  4LJZ F;  3FWE A;  2LY1 A;  2UXX A;  2ME6 A;  5GAH J;  2P4W A;  2ZSH B;  2M0M A;  3M8E A;  2VBY A;  2FBI A;  4QLC U;  3BT9 A;  2XHK A;  3IHU A;  4Y33 A;  1J5Y A;  1TWF J;  2LDU A;  3M3Y J;  4E7L A;  2Z9O A;  1OPC A;  5M3M J;  3ABM H;  3CCS I;  4HX7 A;  3HSR A;  2K4B A;  2W24 A;  3K2Z A;  3LSG A;  2ELH A;  4I76 A;  2M45 A;  4HX4 A;  2F48 A;  1W5C C;  4XR6 A;  3GTP J;  4ABZ A;  3HOU J;  3CF5 F;  1K78 A;  2E60 A;  4U87 A;  4D9J A;  2Y69 H;  2CWE A;  4N0B A;  1QRY A;  1SVL A;  2A3S A;  2ACJ A;  3DEE A;  4XKV A;  1OKR A;  1PJR A;  1MDM B;  3BTI A;  2R7R A;  2HTS A;  4BYY A;  5D5U B;  3ROU A;  3L00 A;  2HOE A;  2LRD A;  1TW2 A;  4ESF A;  1MMA A;  4A0Z A;  3CCQ I;  3GTM J;  2ZBK A;  2VIX A;  1WRJ A;  2EQR A;  2XB5 A;  5F64 A;  4RAZ A;  1LKX A;  1LEB A;  2DA4 A;  3LSJ A;  1Q1V A;  1V55 H;  1NH3 A;  2CJJ A;  4HV6 A;  4E7H A;  5JVT A;  2YU9 J;  2EB7 A;  5L3F A;  2Z33 A;  4A3C J;  5DD8 A;  2IS2 A;  2M3A A;  3OR1 C;  4HW0 A;  4L5E A;  1ZLJ A;  4AUX A;  3JTG A;  3SZT A;  1WKM A;  3T1B A;  4MEY F;  3OY9 A;  2HGC A;  3NRV A;  3VPR A;  4W97 A;  4Q4Z F;  3HKZ N;  2BYV E;  2RNG A;  1WJE A;  2JPC A;  2PMZ N;  3I4N J;  1FBU A;  2GWR A;  3OYD A;  3I5U A;  3PQJ A;  3LSH A;  1S7E A;  5IT3 A;  2XGX A;  1R9T J;  3R6S A;  2L9V A;  4KFC A;  1T0F A;  3GXO A;  3E97 A;  2OTJ I;  2YR2 A;  1EV7 A;  3HTU A;  5BS6 A;  1MH4 A;  3KCC A;  4XMY A;  4B09 A;  2H8R A;  1O7L A;  3C7J A;  4HQM A;  1S5L C;  1TWA J;  2Y2Z A;  3K4C A;  2UWM A;  4F7Z A;  3A2K A;  3ELK A;  3FXQ A;  3K1N A;  5F0C A;  3DLL F;  4EJT A;  2VXD A;  2WY7 Q;  5KAF C;  3JAM K;  1KQ9 A;  1XGO A;  4ZTJ A;  1R4M B;  4HDV A;  4KNY A;  2ISZ A;  4IRG A;  3J7Y J;  4GXO A;  2DYS H;  3UR3 C;  2LKP A;  4BQO A;  4NC7 A;  4E7Z A;  1MMD A;  2FF4 A;  3QPS A;  4LK1 F;  2GAU A;  5AON A;  2LBF B;  3MVP A;  2QSG X;  2RVC A;  4WCG A;  2L01 A;  3VFZ A;  2DT6 A;  1KON A;  3ZP5 A;  3BPX A;  2XGE A;  1PUF B;  1BOB A;  2K3P A;  3S2H J;  4F52 A;  2KL4 A;  5HS8 A;  1UFM A;  1WH7 A;  4U7D A;  2DXI A;  4UV8 A;  1O57 A;  3UNG C;  4ITV A;  1JUS A;  5F6F A;  1YW8 A;  4RB3 C;  3CCJ I;  4V2G A;  2XAG A;  1O4X A;  1ETQ A;  4BUP A;  2O03 A;  3AG4 H;  3J7A O;  3MD2 A;  1G3Y A;  1Z6R A;  3SZP A;  4ZYA A;  5L3G A;  1RKT A;  2ID3 A;  2M7A A;  4OMY A;  4BDZ A;  4N4N B;  3L9F A;  4A3E J;  5DD4 A;  2XB0 X;  2R7U A;  2E5N A;  3ZMZ A;  2STW A;  3BJ6 A;  2KIU A;  4IX7 A;  3WTV C;  4EVI A;  2L7F P;  4AWX B;  2DLL A;  4J01 A;  1T95 A;  1O3T A;  2HDC A;  4Y3O A;  3LSR A;  3WTX C;  1BR2 A;  3BJA A;  2CQK A;  4G7O F;  3F6O A;  1Z0X A;  3SJM A;  4XLF A;  3MQ0 A;  3OS0 A;  5CQG A;  4ZC3 A;  3A01 A;  1XGM A;  4HNV A;  2QQ9 A;  2DQR A;  4XRM A;  3FF5 A;  3OYG A;  2ME0 A;  2JRT A;  2R7Q A;  3QAH A;  3CC4 I;  2IS4 A;  2PN6 A;  4CYC A;  4EGZ A;  5LGN A;  2JPB A;  2VBW A;  1K83 J;  5HLT A;  1K61 A;  1T98 A;  4C3H J;  3G73 A;  3FK6 A;  3HRM A;  1TTY A;  1U2W A;  4MNU A;  3LMM A;  3JRG A;  2DMT A;  3G4S I;  1O3Q A;  2FU4 A;  2DOF A;  2L4M A;  3MKL A;  2R7S A;  4D5C A;  1WVR A;  2V6E A;  1IV8 A;  2L7K A;  3HPH A;  5JHF A;  5LHG A;  5CKT A;  1Z1D A;  4IHT A;  1RNL A;  3R60 A;  1XSX A;  4BHP A;  2JVG A;  4A0X A;  4C2T A;  1FEX A;  4JX5 A;  3N05 A;  2DQL A;  4OAY A;  4HPQ A;  3GZ6 A;  2AQE A;  2CMP A;  3V8K A;  3FXM A;  1MDM A;  3CO6 C;  4EEF G;  3E5X A;  4II3 A;  1ORK A;  3GWZ A;  3R4K A;  4KIB A;  3L2U A;  1FC3 A;  1R4N B;  4LGW A;  1F9N A;  1JKP C;  1W7P D;  5A2Q K;  2BY1 A;  3KYD B;  1IDY A;  3NWT A;  2RDP A;  2PJP A;  3HGY A;  4M6X A;  2RAE A;  2IXS A;  2PJR B;  5E79 C;  3FDY A;  3ZMU A;  1T38 A;  5K1Y A;  4BKX A;  1TQM A;  2KDZ A;  1QU3 A;  1FT9 A;  2Z3Y A;  1KU7 A;  5EDN A;  2FMY A;  4D1Q A;  3PM1 A;  5KHD A;  2F6C A;  3MMY B;  4S05 A;  3BTC A;  3W2W A;  1W36 C;  2HXI A;  4LLL A;  3LSM A;  2VXZ A;  4B4C A;  2M9H A;  1WJ5 A;  2KMU A;  1FSH A;  4EQQ A;  1DPR A;  2BVL A;  5E1W A;  4UVB A;  2OC6 A;  1GXP A;  2BZT A;  1RRJ A;  5K7H A;  4PJJ A;  1FTZ A;  4YFN F;  4UUV A;  1ON2 A;  5B66 C;  2DJI A;  2W48 A;  2ZFU A;  3WTW C;  2E2I J;  4L5J A;  3R0A A;  2QSH X;  2V9P A;  2CV0 A;  4XKC A;  1SVM A;  1TT5 B;  3KPH A;  2IGK A;  2L54 A;  3H9Q A;  3BR3 A;  3ECH A;  2QEX I;  1ZGW A;  2BVM A;  2FRH A;  5L3C A;  2A05 A;  3RPU D;  3U1K A;  2V7F A;  1RC9 A;  2QA4 I;  1W36 D;  2HVR A;  1ETK A;  4P9U A;  1MND A;  2LBF A;  2QEN A;  3T8T A;  2F5E A;  1TP4 A;  4KN4 X;  2HNH A;  1BI2 A;  3ZQG A;  3CMY A;  4A6D A;  3PNY A;  2N8G A;  4MFD A;  2P5K A;  1PUF A;  1SMY F;  4FIS A;  3K4M A;  2CG4 A;  1S72 I;  1Y8R B;  1I5Z A;  4U88 A;  4XSZ F;  5BMZ A;  3ZQC A;  3C2H A;  4AIK A;  5K5O A;  3FK7 A;  3TDU C;  1I3A A;  2DK5 A;  2ZME A;  4KIC A;  1EJ9 A;  5ICG A;  1G2H A;  2OUM A;  5DUK A;  4PJM A;  3H3Z A;  1F5T A;  2JJ7 A;  3TW7 A;  3OS1 A;  5IPA A;  2NS7 A;  1Z91 A;  3PNV A;  1F36 A;  5BNG A;  1ENH A;  1OCC H;  1UHW A;  3DP7 A;  4M72 A;  1X2M A;  3HRS A;  4EAT A;  4WF2 A;  1QQI A;  4MFE A;  3WTZ A;  5J1Y A;  1FYM A;  1BIB A;  1IN7 A;  3TP0 A;  1OIS A;  1I1G A;  4IF4 A;  3TO6 A;  3B6C A;  2F5C A;  1T2K A;  2E34 A;  5M5Y J;  2NOJ B;  2G9W A;  1B59 A;  3PUF A;  3ZMD A;  1FYL A;  1V3F A;  2LF8 A;  1R36 A;  3NAR A;  1T0F C;  5D5X B;  5D4S A;  3RQ4 A;  2JA6 J;  4IHW A;  2AS5 F;  1QBJ A;  4UNO A;  1JE8 A;  4XQF A;  1IG7 A;  3SFZ A;  2VQG A;  1A31 A;  2FA5 A;  1SVO A;  1YOV B;  4M3D A;  5FFZ A;  1FPQ A;  3K10 A;  3JRI A;  3G1L A;  1MGT A;  1TQP A;  3ZRG A;  4Y4R A;  2Q0O A;  2ICW G;  1R71 A;  2ZXH A;  1GLN A;  3Q9V A;  4C3I J;  3K1P A;  4IRI A;  2M1B A;  4A69 C;  5B3S H;  2EJR A;  3K4J A;  5B1B H;  2LYC A;  1O3S A;  3SXY A;  4RAY A;  4RB0 A;  2CQQ A;  4BNC A;  5EF6 A;  3QOP A;  1N77 A;  5IYD J;  4HYE A;  2EV5 A;  2GA2 A;  2VBX A;  3KYC B;  3OIQ A;  1G3S A;  3AFH A;  3H9J A;  3OOU A;  3BLY A;  2JWT A;  1NTC A;  1B1B A;  3A02 A;  3N4M A;  2MC3 A;  5AIQ A;  1VQM I;  3KFW X;  3WU0 A;  1OYY A;  3CF2 A;  3OYC A;  4B43 A;  4DBQ A;  4Y7N J;  2WC2 A;  1HW2 A;  2A6T A;  2CSO A;  4YG2 F;  3RKQ A;  3ZXS A;  4Q5S F;  2X48 A;  3CC2 I;  1X3W B;  3DBH B;  3WTT C;  5GAE J;  5DYM A;  1CQT A;  3HOS A;  3F8B A;  2MLG A;  4XN0 A;  1H0M A;  4FX4 A;  2PJR A;  1ITY A;  4U7B A;  3KP5 A;  1VQO I;  3FX3 A;  1OLT A;  5E8I A;  2HYG D;  4RAF A;  3F22 A;  4CCJ A;  4IQ4 A;  5C4X J;  2Y9Y A;  1UZC A;  1YS6 A;  2W1O A;  4TV7 A;  3QOD A;  3R0J A;  5KAI C;  3Q0W A;  2BGC A;  2HQA A;  4OAZ A;  2FJ1 A;  3ERM A;  3IKT A;  3DCF A;  1FBS A;  1WI9 A;  3PIP F;  1VQL I;  2XDV A;  2QUF A;  2M34 A;  4PUS A;  4DJA A;  1XS9 A;  1DUX C;  2DT7 B;  2DMP A;  1DU0 A;  4D5F A;  5LHH A;  2O8X A;  3WHC A;  5HLG A;  1N75 A;  1NG7 A;  5E1X A;  1HOM A;  3CTA A;  1MJB A;  2W84 A;  3L2R A;  2PG4 A;  3J80 K;  2O6G E;  4EMS A;  3C1D A;  3IH2 A;  1HXD A;  5GAD J;  4I09 A;  5BOX A;  3LFU A;  5J1U A;  3H92 A;  2K27 A;  3MN2 A;  3ABL H;  4MGR A;  5D8K B;  1SEU A;  1OQY A;  4YFX F;  2VL8 A;  1L0O C;  3DU5 A;  5FKL A;  1W5T A;  4J00 A;  2EIK H;  1ETV A;  4AYB N;  5FLX Z;  3MAJ A;  2A68 F;  3IKV A;  3RZO J;  1MZB A;  2HDD A;  4DIQ A;  2Y9Z A;  4BY1 J;  2QLZ A;  1AKH B;  4FET A;  4DYC A;  3Q0V A;  1ZH5 A;  1P9Q C;  3HOZ J;  1AHD P;  1TNT A;  3RPQ A;  1Z67 A;  2JSC A;  1D8K A;  2ESH A;  4M74 A;  2DBB A;  2JVH A;  1D1B A;  1FOY A;  4XKB A;  1GV5 A;  1L3L A;  3DKY A;  2MFZ A;  3GZN B;  3PJR A;  5EZG A;  5JLX A;  3GFI A;  4XLP F;  1R5I D;  2ETH A;  1VI0 A;  1OMI A;  1YS7 A;  2FBH A;  1R00 A;  2G7U A;  3CJT B;  2XF5 A;  1YLF A;  1DP7 P;  2X1D A;  1MBG A;  4MHG A;  1QA6 A;  1JXS A;  2IGN A;  5BPD A;  2CW8 A;  4IOC F;  2DTZ A;  1ZN2 A;  3TBI A;  4A2U A;  3KZZ A;  4ENM A;  4KIG A;  4EJW A;  2CW0 F;  2P0W A;  2GIV A;  1R7J A;  5FKN A;  2PMU A;  3QOE A;  1JTX A;  2VN2 A;  3K4B A;  3FMR A;  1GT0 C;  3C2G A;  2NVX J;  4CCL A;  3REO A;  2FE3 A;  4YEL A;  4G94 A;  2HWV A;  1MW7 A;  3P7N A;  4GCV A;  2LVS A;  3I58 A;  2K40 A;  3BTL A;  1HLV A;  3ESW B;  2IA0 A;  4BQA A;  2XRL A;  4BBS J;  4NNJ A;  4YIR X;  1YJW I;  3BQY A;  4Z6Y A;  1HBX G;  1MMG A;  2XUB A;  5CVV A;  2E2H J;  4BL0 B;  4EJU A;  2GIZ A;  3QYE A;  1WJA A;  2HOT A;  2I5U A;  4KDP A;  2DA3 A;  1ZYR F;  4PJN A;  1XDU A;  3V7C A;  3ULQ B;  3O2P E;  3ZCO A;  3NQO A;  2EZH A;  3FBI B;  3BTJ A;  4PK4 A;  2UZK A;  4BGD A;  2PMH A;  5GTI C;  5J47 A;  4HRI A;  5EZH A;  3B02 A;  1IXC A;  2VI6 A;  2LD5 A;  4XOP A;  2E5Z A;  1FMV A;  2I8D A;  1J7K A;  2K9S A;  3M7G A;  5LGU A;  3V7S A;  5FD5 A;  2Y48 A;  2HQN A;  3TL4 X;  3LSP A;  5DS9 A;  2TCT A;  2BHY A;  4HLY A;  2ZME C;  1R1V A;  4G8X A;  4BH9 A;  1ZGA A;  5HDG A;  3KET A;  3ZN1 A;  3LQR A;  2JMW A;  4WX9 A;  1NK2 P;  4ASN A;  5L3D A;  2X6W A;  1JUM A;  1KYW A;  1RI7 A;  4A3J J;  1FTT A;  1LJ9 A;  2VC1 A;  2XV4 S;  2YPR A;  1B9M A;  3PSF A;  3G6E I;  1P92 A;  3WE2 A;  2XRO A;  5FKM A;  4XLH A;  2L2O A;  3IAM 2;  4IXA A;  4FAS D;  1G8X A;  2M0C A;  2E7X A;  3BG5 A;  3JRA A;  2P5L C;  2F4O B;  2V1D A;  4XRF A;  2XGC A;  4WXH A;  3I55 I;  3VB2 A;  2EV6 A;  4L5I A;  3CCY A;  3T8R A;  2IJL A;  3LSI A;  1WFX A;  2CRG A;  4RGS A;  1D1C A;  3TQN A;  2FOW A;  2JK3 A;  3LAP A;  2X6Y A;  1XMA A;  2L5Q A;  3VYT B;  4KIT B;  3E5Q A;  1X58 A;  1UHM A;  3GVA A;  3LFK A;  3ZGK A;  3JRC A;  3CD6 I;  4PFP A;  1IN4 A;  4HG2 A;  2Q2E B;  1J0R A; 
#chains in the Genus database with same CATH homology
 2IA1 A;  5DV5 A;  3TO7 A;  4HQE A;  3RYP A;  2OQG A;  2EFP A;  3IWF A;  1B6A A;  4JBA A;  3ERE D;  4L9N A;  3QU6 A;  3ABT A;  4OIQ F;  4LK0 F;  2P6T A;  2CGP A;  3J81 Z;  4WXD A;  2F2E A;  5FFX A;  2QBY B;  4L9J A;  4OIP F;  1P4A A;  5H6Q A;  4Q48 A;  2ZO4 A;  1PUE E;  3BZ6 A;  4M9Z A;  1MKM A;  1TW3 A;  3K9T A;  5L3E A;  4OU0 A;  1U5T C;  2IP2 A;  2P5V A;  1F1Z A;  1BI0 A;  2XAJ A;  2FSW A;  3Q9S A;  1HST A;  2IVM A;  2WTE A;  1XGS A;  3M1E A;  3HHH A;  2PFB A;  3K1M A;  3OV8 A;  3F8N A;  2K7L A;  5IT9 Z;  1YFH A;  3GX4 X;  1S7O A;  3M8F A;  1DPU A;  2H6B A;  4LD5 A;  3EDP A;  3I0T A;  2VBZ A;  4ESB A;  1Z7U A;  1E2X A;  3MCZ A;  3I53 A;  4A0Y A;  4LMY A;  3SHF A;  1FLI A;  3W6J B;  4HBL A;  4R8H A;  4KUM A;  3FMS A;  3QP5 A;  1KA8 A;  3RKX A;  2BEO A;  1XSV A;  1HW1 A;  1A04 A;  3DQV C;  1FZP B;  3I54 A;  3BPV A;  2JTV A;  3RJP A;  3BJO A;  5ICE A;  1WWX A;  3GF2 A;  1H9G A;  1JGS A;  3FXR A;  2ZME B;  3U9G A;  4B8X A;  5ED4 A;  5BQT A;  2RGV A;  4L0Z B;  3HRU A;  4ZZL A;  3JTH A;  4P9F A;  3RYR A;  2XKP A;  2EK5 A;  2OAZ A;  4I7H A;  3WE3 A;  2FNA A;  2RNJ A;  3WOD F;  1ZRD A;  2GXB A;  1P2F A;  3BRO A;  3TO9 A;  1UB9 A;  5AIP A;  3O6B B;  2J5P A;  4LLG F;  1ZAR A;  4DQ2 A;  3O3K A;  4PCQ A;  2A6H F;  2Q2E A;  2X0L A;  2A69 F;  1YW9 A;  1RUO A;  4EV0 A;  4GYG A;  3E6D A;  4I2O A;  3ISP A;  2DAO A;  3L09 A;  3EYY A;  4KIF A;  3ZPL A;  2H94 A;  3GFL A;  5K5R A;  3KP6 A;  5D4R A;  3LAJ A;  4MTE A;  2QBY A;  3F23 A;  3RI4 A;  4EM1 A;  3F21 A;  1U5T B;  3QPT A;  4CIC A;  2DK8 A;  3JAM Z;  3IRR A;  3BOQ A;  3RDI A;  2PBI A;  1SFU A;  1BJA A;  5J8C A;  3HTS B;  2FBK A;  3CLO A;  2GXG A;  5LEJ A;  2RV8 A;  4YFK F;  2R3S A;  5E8G A;  4EM0 B;  2V1U A;  2VT3 A;  2FXA A;  1S3J A;  2DFI A;  2P7V B;  3COA C;  4MEX F;  5JR3 A;  4RB1 A;  2DPU A;  4ENN A;  4HZF A;  3E5U A;  1OYW A;  4U0W A;  1OR7 A;  1TNS A;  1IN8 A;  2QVO A;  3DKW A;  5CVU A;  4PGH A;  5DEQ A;  2KRF A;  5HOO A;  3R61 A;  1F4K A;  1FX7 A;  2BV6 A;  3V7R A;  1MJ9 A;  5LRR A;  3RIR A;  1ZGJ A;  4ZH4 F;  1SD6 A;  3KP2 A;  4O5V A;  4XSX F;  3TOB A;  1OYI A;  5HDK A;  1ONV A;  2RKH A;  4XLN F;  4M71 A;  2BE5 F;  1KU9 A;  2V9V A;  4M73 A;  2HZT A;  4M6Y A;  3GLX A;  4HX8 A;  4O3M A;  5KVR A;  2V1X A;  4LG0 A;  3E6B A;  4EM2 A;  2QYO A;  1QZZ A;  4BXU A;  1GVJ A;  2PQ8 A;  3BP8 A;  2CO5 A;  3LA3 A;  3TKY A;  3HIF A;  5ERI A;  3ML6 A;  1W4M A;  2ZXJ A;  2FEZ A;  2L4A A;  4RS8 A;  1D5V A;  4LLN A;  2FML A;  2KIM A;  4QWQ A;  4UXN A;  4KA4 A;  4L9V A;  2D2W A;  4EGY A;  3QPH A;  2V6C A;  2OA4 A;  4XBF A;  5JI6 A;  4KMU X;  4CDG A;  5LRS A;  5D6F A;  4I0A A;  5A2Q Z;  1GXQ A;  2YX4 A;  2ZNY A;  1S7A A;  5H20 A;  2DO7 A;  4UHT A;  5J6X A;  2XVC A;  2H27 A;  5FLX K;  3H3U A;  2D1H A;  3LST A;  1ZLK A;  2XAF A;  1BOA A;  1U3E M;  4G7H F;  2HFH A;  3AAF A;  2OZU A;  1ZAO A;  2EFN A;  3T5X A;  2O0Y A;  1IAW A;  3LA7 A;  1T39 A;  5LLQ A;  1J59 A;  3MZH A;  4AIH A;  3U1D A;  3K0L A;  1V4R A;  5E20 A;  4HF1 A;  2W57 A;  1U8R A;  1U5T A;  1AOY A;  2O61 A;  3V8L A;  2X4H A;  4IPA A;  4RGR A;  1SFE A;  4L9T A;  2QM3 A;  1YW7 A;  3F8M A;  3KLO A;  4HLX A;  2KJC A;  5FO5 A;  4N9H A;  1R23 A;  2PLY A;  1Z05 A;  5FD6 A;  2IA2 A;  2MLK A;  3HYI A;  1HSJ A;  1LDK B;  4E70 A;  2VOO A;  4ZYH A;  3WGG A;  4MQV A;  2EV0 A;  2XIG A;  2ZJ2 A;  2GA1 A;  1J75 A;  5EEH A;  5JHU A;  4A5N A;  5ILU A;  4ON0 A;  4P55 A;  4G7Z F;  3DPL C;  4A6E A;  3GO5 A;  2NYX A;  4I02 A;  2E1C A;  2D45 A;  2K86 A;  1XSD A;  5CVJ A;  4OIO F;  1IXS B;  4Q47 A;  1XN7 A;  3I59 B;  1IF1 A;  1IXR C;  5L3B A;  4I01 A;  1D3Y A;  3WGI A;  5K5Q A;  1ULY A;  4HOB A;  2NNN A;  1IZ1 A;  3V8J A;  4ZYE A;  3BY6 A;  5D5W B;  4O6J A;  2M30 A;  1ODD A;  1KU2 A;  3FMQ A;  5HVQ C;  1YO5 C;  2C6Y A;  2UXN A;  5F1R A;  3ZN0 A;  4R79 A;  3OOP A;  4HAM A;  2H6C A;  1QNT A;  3CDH A;  3DXJ F;  2XAQ A;  3L2C A;  4CXF A;  3P9I A;  1G3W A;  4PGG A;  1DDN A;  1E17 A;  2XRN A;  2F5F A;  3P9C A;  4OOI A;  4Y17 A;  1C0W A;  3MWM A;  2OZ6 A;  2DI3 A;  1KU3 A;  3J81 K;  3MEX A;  5E18 F;  1I6X A;  4GO1 A;  5E1Z B;  2M5W A;  4ETS A;  4U0V A;  2ZNZ A;  2FOK A;  3EUH A;  3QRF F;  3FM3 A;  4G9Y A;  3D0S A;  3RKW A;  4UVC A;  1QPM A;  3JW4 A;  3KEO A;  2P8T A;  2KIF A;  3WTU C;  3QU3 A;  2YSR A;  2G7H A;  5IT9 K;  2GZW A;  1BIA A;  2VE9 A;  1HKT A;  2A6E F;  3DPT A;  3RKY A;  3E3V A;  2MBF A;  3WGH A;  2HEO A;  3CJN A;  1BC8 C;  5LGT A;  1G3T A;  1H9T A;  3DFG A;  1J2X A;  3KEQ A;  4NQW A;  1BI1 A;  3KLN A;  2O3F A;  1LQ1 A;  4KN7 X;  1K7A A;  1S8N A;  1G6N A;  3RPU A;  1YIO A;  4CGZ A;  4HA8 A;  4IRH A;  2YU3 A;  2PI0 A;  5HDN A;  1TLH B;  3DF8 A;  2IRF G;  4OIR F;  1QZY A;  3I59 A;  3JSP A;  3QP6 A;  1LDD A;  4RB2 C;  4N9I A;  2K02 A;  2XAS A;  3CUQ C;  4K2E A;  4RGU A;  1WSU A;  1S29 A;  3K69 A;  2RQP A;  2D1V A;  2M87 A;  4A12 A;  4ESJ A;  4M9X A;  2EFQ A;  3EET A;  3HUG A;  4R1H A;  1R58 A;  4AIJ A;  3DEU A;  1MJA A;  2NRA C;  2LNB A;  2ZKZ A;  3P9K A;  1LB2 A;  3WTS C;  1XMK A;  1PDN C;  4NHJ A;  4H0E A;  1CF7 B;  4I0B A;  2YX7 A;  2NS0 A;  5ILV A;  3HSE A;  2J5O A;  1SD5 A;  1FY7 A;  5DCM B;  3HSF A;  3T0Y A;  3WU1 B;  2IPQ X;  1XCV A;  4LG0 B;  4ENK A;  4LB5 A;  5EEG A;  2HTJ A;  2QQB A;  5ICF A;  2W25 A;  1LVA A;  3FM5 A;  1P4X A;  2E1N A;  4HF0 A;  2WV0 A;  4MQ9 F;  2A07 F;  1ZG5 A;  4P96 A;  3VOD A;  2HS5 A;  1BC7 C;  1LNW A;  2QWW A;  4G6D A;  3TDZ C;  1U6G A;  3ZMS A;  2OBP A;  3S2W A;  1I27 A;  2COM A;  3WTY C;  5E17 F;  4LFU A;  4DNC A;  4EJO A;  4ZZD A;  1R22 A;  3C18 A;  3U2R A;  1ON1 A;  2VC0 A;  2OD5 A;  2L3D A;  3DV8 A;  1R1U A;  1HW5 A;  2Y75 A;  2R7F A;  3EQL F;  3D5L A;  3CUO A;  1ZRE A;  1PP7 U;  3B73 A;  1SAX A;  2Y0M A;  2VON A;  5H6R A;  3FHZ A;  2K4J A;  1P6R A;  2ISY A;  1TBX A;  2EA4 A;  5D8L B;  3KP7 A;  2RC4 A;  1RIO H;  3KP4 A;  5HLH A;  1Z9C A;  1KYZ A;  2KKO A;  4P5O A;  4FHT A;  3FXU A;  4YII A;  1S6L A;  3CUQ B;  2DPD A;  3BDD A;  5HS7 A;  4IVN A;  4JQF A;  1IUY A;  2VOD A;  3NEU A;  1G4D A;  2NAZ A;  3WG9 A;  1BN5 A;  1D8J A;  5D5V B;  1Y0U A;  3GFJ A;  4S04 A;  1KQ0 A;  2DT5 A;  2BBY A;  2VE8 A;  1I1S A;  1IN5 A;  2R7D A;  4UV9 A;  2HKO A;  2DU9 A;  3F72 A;  3KZY A;  1SD4 A;  2ZFW A;  1IRG A;  1SD7 A;  4EJV A;  3F8F A;  2P7C B;  5CJ9 A;  4LB6 B;  1SFX A;  4GYI A;  2A61 A;  1CF7 A;  2A5Y B;  3Q5F A;  3GFM A;  3IWZ A;  5DCM A;  2EFW A;  3RTR A;  4Z2Y A;  4BHB A;  2OQR A;  3IC7 A;  3VEP A;  5CLS A;  5D6E A;  2HKX A;  1JHF A;  3G3Z A;  2RN7 A;  1HQC A;  3ABU A;  5LEK A;  1BI3 A;  1O3R A;  4A5M A;  5KK1 A;  1U78 A;  3MZY A;  1EH6 A;  1WQ2 A;  1P4W A;  1XB4 A;  2Z99 A;  4L0Y B;  4U0Y A;  2EFO A;  5CYV A;  3ZMV A;  3PQK A;  2HR3 A;  3SQN A;  1TQI A;  4HV5 A;  1IN6 A;  2DW4 A;  2IT0 A;  2MH9 A;  3F6V A;  3V4G A;  4CO8 A;  2E7W A;  3KE2 A;  4BHC A;  4Y15 A;  1FP1 D;  3MFK A;  3ZMT A;  1FNN A;  2NNY A;  4HF2 A;  1NHA A;  3I71 A;  3JSO A;  2VT2 A;  3W6K B;  3HHG A;  1LEA A;  1BBY A;  1W5S A;  1IW7 F;  4ENJ A;  3ECO A;  2KJB A;  4AVP A;  4WWC A;  5HLI A;  2HYF A;  1QO0 D;  2VOP A;  2DTR A;  1HKS A;  1W7P B;  3LA2 A;  1QGP A;  1YTY A;  4BAY A;  1R5G A;  1J9I A;  2WWY A;  1XD7 A;  5LHI A;  3CUQ A;  4AD9 A;  6PAX A;  1B4A A;  2EA2 A;  2F5D A;  4RGX A;  1X3U A;  4CYD A;  4OMZ A;  5BPI A;  2V79 A;  4FT8 A;  2HQR A;  2MD5 A;  4UVA A;  5DUI A;  3GZ5 A;  3CO7 C;  4Y13 A;  4FX0 A;  3L7W A;  4IJA A;  4WXC A;  4CHU A;  2LSO A;  5LBQ A;  2QZ8 A;  1FSE A;  1O7F A;  4KT5 C;  1RUN A;  1FOK A;  4OIN F;  1ZG1 A;  1UCR A;  3TGN A;  3HRT A;  1XGN A;  5JFR A;  3VOE A;  5J8F A;  5TRD A;  2LF7 A;  4JK1 X;  4IHS A;  3C3W A;  1K78 B;  4M9S A;  2XKO A;  3GUD A;  1K79 A;  4WK8 F;  1ZRC A;  3GYH X;  3HOT A;  2JZY A;  3LQQ A;  4KMF A;  1RZ4 A;  3M9A A;  1FP2 A;  4PDK A;  4MTD A;  3GW2 A;  2FNP A;  4ZYG A;  4G6Q A;  1KQ8 A;  2W85 A;  1R1T A;  2QQA A;  2H09 A;  1FYK A;  3PFI A;  1XDS A;  1KGS A;  3I64 A;  3ZQ7 A;  1PP8 F;  3LWF A;  2CFX A;  5CVI A;  2M8E A;  2XAH A;  3IRQ A;  1FBQ A;  5TJJ A;  2EWN A;  3N97 A;  1ZHF A;  3EYI A;  5ILS A;  1GHC A;  1FWZ A;  4YIF A;  3IL2 A;  1R5H A;  3E6C C;  1AWC A;  1BM9 A;  2AXL A;  2JT1 A;  4D0P A;  4KYW A;  1JHH A;  1YYV A;  5ICC A;  2STT A;  1K6O A;  4GGG A;  3FZV A;  1Q1H A;  2MA3 A;  3F3X A;  2L02 A;  1USS A;  1VTN C;  1W7P A;  5FGM A;  2CYY A;  3F8C A;  5HS9 A;  3TOA A;  1EH7 A;  3KP3 A;  4ZYD A;  1YG2 A;  5FB2 A;  3J80 Z;  2P6S A;  2PEX A;  3BWG A;  2MH2 A;  2FQ3 A;  1MD0 A;  1YQA A;  2IW5 A;  1STZ A;  1UST A;  2ADU A;  1LDJ A;  5CVR A;  1REP C;  4PZJ A;  1ZRF A;  1T6S A;  3GEZ A;  2OU2 A;  1CGP A;  4HDU A;  4CZZ A;  1HKQ A;  1EH8 A;  4I98 B;  2Q8K A;  4NB5 A;  1ZG3 A;  5DCF A;  2B0L A;  2TDX A;  1Z6T A;  5DDG A;  2ZCW A;  1SMT A;  2GQQ A;  2Z5U A;  2ESN A;  1XCB A;  3I4P A;  1IRF A;  4L18 B;  3E6M A;  1B9N A;  4LJZ F;  3FWE A;  2UXX A;  2P4W A;  3M8E A;  4QLC U;  2VBY A;  2FBI A;  2XHK A;  3IHU A;  1J5Y A;  2LDU A;  2Z9O A;  1OPC A;  4HX7 A;  3HSR A;  2K4B A;  2W24 A;  3K2Z A;  2ELH A;  2M45 A;  4HX4 A;  1K78 A;  2CWE A;  4N0B A;  2A3S A;  2ACJ A;  1OKR A;  1MDM B;  2HTS A;  4BYY A;  5D5U B;  3ROU A;  3L00 A;  2HOE A;  4ESF A;  1TW2 A;  4A0Z A;  2ZBK A;  1WRJ A;  5F64 A;  4RAZ A;  1LEB A;  4HV6 A;  5JVT A;  2EB7 A;  5L3F A;  2Z33 A;  5DD8 A;  4HW0 A;  1ZLJ A;  3JTG A;  3SZT A;  1WKM A;  3T1B A;  4MEY F;  2HGC A;  3NRV A;  4Q4Z F;  2BYV E;  2JPC A;  1FBU A;  2GWR A;  3I5U A;  3PQJ A;  5IT3 A;  2XGX A;  3R6S A;  4KFC A;  1T0F A;  3GXO A;  3E97 A;  5BS6 A;  2YR2 A;  1EV7 A;  3HTU A;  3KCC A;  4B09 A;  1O7L A;  3C7J A;  4HQM A;  2UWM A;  4F7Z A;  3ELK A;  3FXQ A;  3K1N A;  4EJT A;  3JAM K;  1KQ9 A;  1XGO A;  4HDV A;  4KNY A;  2ISZ A;  4IRG A;  4GXO A;  2LKP A;  2FF4 A;  4LK1 F;  2GAU A;  5AON A;  2RVC A;  4WCG A;  2L01 A;  3VFZ A;  3ZP5 A;  3BPX A;  5HS8 A;  1UFM A;  4U7D A;  4UV8 A;  1O57 A;  4RB3 C;  5F6F A;  1YW8 A;  2XAG A;  2O03 A;  3J7A O;  1G3Y A;  1Z6R A;  3SZP A;  5L3G A;  4OMY A;  3L9F A;  5DD4 A;  3ZMZ A;  2STW A;  3BJ6 A;  2KIU A;  3WTV C;  4EVI A;  4AWX B;  2DLL A;  1O3T A;  2HDC A;  3WTX C;  3BJA A;  2CQK A;  4G7O F;  3F6O A;  3MQ0 A;  1XGM A;  2QQ9 A;  2DQR A;  3FF5 A;  2JRT A;  3QAH A;  2PN6 A;  4EGZ A;  5LGN A;  2JPB A;  2VBW A;  1T98 A;  3G73 A;  3HRM A;  1TTY A;  1U2W A;  4MNU A;  1O3Q A;  2FU4 A;  2L4M A;  5LHG A;  1Z1D A;  4IHT A;  1RNL A;  3R60 A;  1XSX A;  4BHP A;  4A0X A;  2DQL A;  3GZ6 A;  3V8K A;  1MDM A;  3CO6 C;  3E5X A;  3GWZ A;  3R4K A;  4KIB A;  1FC3 A;  4LGW A;  1F9N A;  1W7P D;  5A2Q K;  2PJP A;  2RDP A;  4M6X A;  3ZMU A;  1T38 A;  5K1Y A;  1TQM A;  1FT9 A;  2Z3Y A;  1KU7 A;  2FMY A;  4S05 A;  4LLL A;  2VXZ A;  1FSH A;  4EQQ A;  1DPR A;  5E1W A;  1GXP A;  4YFN F;  4UUV A;  1ON2 A;  3WTW C;  4L5J A;  3R0A A;  2L54 A;  3ECH A;  2FRH A;  5L3C A;  4P9U A;  2QEN A;  3T8T A;  2F5E A;  4KN4 X;  1BI2 A;  4A6D A;  2P5K A;  1SMY F;  2CG4 A;  1I5Z A;  4U88 A;  4XSZ F;  5BMZ A;  4AIK A;  5K5O A;  3TDU C;  2DK5 A;  2ZME A;  4KIC A;  5ICG A;  5DUK A;  3H3Z A;  1F5T A;  1Z91 A;  4M72 A;  1UHW A;  3DP7 A;  3HRS A;  4WF2 A;  1QQI A;  3WTZ A;  1FYM A;  1BIB A;  1IN7 A;  1I1G A;  4IF4 A;  3TO6 A;  2F5C A;  1T2K A;  2G9W A;  1B59 A;  3ZMD A;  1FYL A;  1V3F A;  2LF8 A;  1R36 A;  5D5X B;  5D4S A;  2AS5 F;  1QBJ A;  4UNO A;  1JE8 A;  3SFZ A;  2FA5 A;  5FFZ A;  1FPQ A;  1MGT A;  1TQP A;  2Q0O A;  3Q9V A;  3K1P A;  4IRI A;  2M1B A;  2EJR A;  1O3S A;  3SXY A;  4RAY A;  4RB0 A;  4BNC A;  3QOP A;  4HYE A;  2EV5 A;  2GA2 A;  2VBX A;  1G3S A;  1B1B A;  3N4M A;  2MC3 A;  5AIQ A;  3KFW X;  3WU0 A;  1OYY A;  1HW2 A;  2WC2 A;  2CSO A;  4YG2 F;  4Q5S F;  3WTT C;  5DYM A;  3HOS A;  3F8B A;  2MLG A;  1H0M A;  4FX4 A;  4U7B A;  3KP5 A;  3FX3 A;  5E8I A;  2HYG D;  3F22 A;  1YS6 A;  4TV7 A;  3R0J A;  2BGC A;  3IKT A;  1FBS A;  1WI9 A;  2QUF A;  1DUX C;  5LHH A;  2O8X A;  5HLG A;  5E1X A;  3CTA A;  1MJB A;  2W84 A;  2PG4 A;  3J80 K;  2O6G E;  4EMS A;  3C1D A;  1HXD A;  4I09 A;  5BOX A;  3H92 A;  2K27 A;  4MGR A;  5D8K B;  4YFX F;  1L0O C;  1W5T A;  5FLX Z;  3MAJ A;  2A68 F;  3IKV A;  1MZB A;  2QLZ A;  1ZH5 A;  1TNT A;  3RPQ A;  2JSC A;  1D8K A;  2ESH A;  4M74 A;  2DBB A;  1L3L A;  3GFI A;  4XLP F;  2ETH A;  1YS7 A;  1OMI A;  2FBH A;  1R00 A;  2G7U A;  1DP7 P;  1YLF A;  4MHG A;  1JXS A;  5BPD A;  1ZN2 A;  4A2U A;  4ENM A;  3KZZ A;  4KIG A;  4EJW A;  2CW0 F;  2GIV A;  1R7J A;  2PMU A;  2VN2 A;  3FMR A;  3REO A;  2FE3 A;  4G94 A;  2HWV A;  3P7N A;  4GCV A;  3I58 A;  2IA0 A;  4BQA A;  1HBX G;  2XUB A;  5CVV A;  4EJU A;  4KDP A;  1ZYR F;  1XDU A;  3V7C A;  3ULQ B;  3O2P E;  3NQO A;  2UZK A;  2PMH A;  3B02 A;  1IXC A;  1J7K A;  3M7G A;  5LGU A;  3V7S A;  5FD5 A;  2Y48 A;  2HQN A;  4HLY A;  1R1V A;  4G8X A;  4BH9 A;  1ZGA A;  5HDG A;  3KET A;  3ZN1 A;  3LQR A;  4WX9 A;  4ASN A;  5L3D A;  1KYW A;  1RI7 A;  1LJ9 A;  2VC1 A;  2XV4 S;  2YPR A;  1B9M A;  1P92 A;  3WE2 A;  2XRO A;  4IXA A;  2E7X A;  2P5L C;  2V1D A;  4XRF A;  4WXH A;  3VB2 A;  2EV6 A;  4L5I A;  3T8R A;  2IJL A;  4RGS A;  3TQN A;  3LAP A;  1XMA A;  3E5Q A;  1UHM A;  3GVA A;  3LFK A;  1IN4 A;  4UVB A;  1J0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...