1K79A

Ets-1(331-440)+ggaa duplex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
104
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*AP*AP*TP*GP*T)-3')
publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 36
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k79A00
2O6GE 2W25A 1FYKA 3FX3A 1YFHA 3F8CA 4M9SA 1MD0A 2H09A 3FZVA 2VBWA 1TNSA 1U6GA 1F5TA 5BQTA 1IRFA 1YW9A 4G8XA 2LF7A 5A2QZ 1UHMA 4IHSA 1ZARA 4P55A 5FFZA 1T39A 3BP8A 4LG0A 2KIUA 4NQWA 1REPC 3GLXA 1P4XA 5LGNA 4RGSA 2EFNA 1CGPA 1LDDA 2QWWA 2IW5A 3KEOA 3WU1B 3IL2A 4Q47A 2V1XA 4IVNA 2A61A 1MGTA 1QQIA 4IPAA 1YTYA 2CWEA 4I01A 3MAJA 2CSOA 3I58A 2LF8A 3T8RA 4TV7A 2W57A 1OPCA 3JAMZ 5F1RA 2R3SA 2ETHA 3V7SA 1MJBA 2V6CA 4Y17A 1H9GA 2KKOA 4KN7X 2IA1A 1JE8A 3I0TA 2ZXJA 3T8TA 3CUQA 4Q4ZF 3GFJA 1W7PD 5LEKA 3R6SA 4KDPA 1ZGAA 3IHUA 3LFKA 3LAPA 4MTEA 4ASNA 3HSFA 5J8FA 2G9WA 4L5IA 4FHTA 5HDKA 3GZ6A 3U9GA 2LKPA 5K5OA 4OOIA 3Q9SA 4Y15A 3EETA 4XSXF 3RPQA 1IXRC 3DXJF 5BMZA 3PQJA 2F5EA 3D5LA 3GXOA 2HDCA 2VBZA 1G3WA 2UZKA 3KP3A 2XKPA 2PFBA 2EV0A 2FMLA 3DQVC 3LSTA 5D5WB 3MFKA 1W5TA 3QU6A 3I53A 1IN5A 3V4GA 1RNLA 5TJJA 1J5YA 2KJBA 1T2KA 4BHBA 2K02A 1YYVA 1CF7B 4ESFA 5CVIA 2QLZA 2E7WA 3ZPLA 2YX7A 4MTDA 1DP7P 3TDUC 2FE3A 2HTJA 2DQRA 4I98B 5ICCA 2XGXA 4WF2A 2LNBA 1XGMA 1Z1DA 3K69A 4IXAA 2MBFA 3DPLC 3RKXA 4ZZLA 3OOPA 1KA8A 5D8LB 2VN2A 2K86A 4YG2F 2EFPA 2ZNYA 5D6FA 3ZMZA 1O57A 1TTYA 2UXNA 2IA0A 2DPUA 3KZZA 3HOTA 3M1EA 1O3SA 2ZBKA 4MNUA 1TNTA 1SD6A 1WKMA 4P9FA 2XV4S 1TQIA 3C18A 1T38A 4O5VA 3WGIA 3WGGA 1QO0D 3CLOA 2DK8A 2PLYA 2EB7A 4KA4A 4HQMA 3T5XA 2FA5A 1KYWA 3HOSA 4LK0F 4L9NA 4R79A 2HFHA 3MCZA 4G6DA 4GGGA 2PMHA 4P96A 5L3GA 3COAC 3F8FA 5J6XA 1YG2A 3VODA 1ON1A 2L4AA 1FP1D 4HDVA 1K79A 4S05A 1HKQA 2W24A 2GIVA 5K5RA 1YO5C 3P9KA 3FXUA 2P7VB 2AXLA 3IC7A 1PP8F 2DW4A 4KMFA 1MZBA 1U5TC 3J81K 2MLKA 1OR7A 4LLGF 4HQEA 3T1BA 3O2PE 2M1BA 1HW5A 4RGXA 3DKWA 1WQ2A 1TBXA 2QUFA 2P4WA 3E5QA 3ZN1A 1ZYRF 3PQKA 4JK1X 4ZYEA 4AD9A 3WTVC 2DLLA 1U3EM 3HSEA 3RYPA 5ILVA 1FPQA 4FX4A 1U5TB 1FT9A 2FEZA 5BPIA 1HSTA 4BNCA 2QVOA 4EJOA 1BM9A 3SFZA 4L9VA 5HLGA 4UV8A 1P6RA 4S04A 2Z9OA 2VOOA 1R00A 2QENA 3CO7C 4CGZA 4GXOA 2EA4A 4UUVA 3U2RA 2IPQX 5HS7A 3TOAA 3ZMTA 3IKVA 3GFIA 1FX7A 4KMUX 5H6QA 1CF7A 2MLGA 1J9IA 2HTSA 4EVIA 3LA3A 1SD5A 4NHJA 4H0EA 4I09A 4EV0A 3C7JA 4EMSA 1I1SA 4LK1F 1B59A 2L4MA 3DEUA 2XKOA 3K1NA 5AIQA 1R7JA 5JI6A 4LJZF 4A5MA 2QYOA 5KVRA 2A07F 4EJTA 3BY6A 5F64A 5JFRA 3HIFA 3ECOA 4EM2A 1K7AA 3WE2A 4KIGA 3HRTA 3KLNA 3KZYA 4YFNF 1IN7A 1J0RA 4WXCA 1IXCA 2OZUA 3LA2A 2VOPA 2G7UA 2O0YA 2XROA 2NS0A 2OBPA 3KEQA 4L18B 1U2WA 3CJNA 3GVAA 4P9UA 2CG4A 1AWCA 3ECHA 1LDKB 1Z9CA 1S6LA 5CVJA 4L5JA 3BJOA 2WTEA 5D5VB 2HYGD 1GVJA 2HYFA 2R7DA 5HS9A 4B8XA 3E6BA 1O3RA 1BN5A 2F5FA 3R60A 1L0OC 2DFIA 1BI3A 3ZMSA 3RDIA 2OAZA 3BJAA 5JHUA 4KYWA 3K2ZA 4KNYA 2DAOA 3M8FA 4BAYA 1WI9A 2IP2A 2K4JA 2ADUA 3FMSA 1I1GA 1SD4A 1R58A 1ZLKA 2OQRA 1EH7A 3QP6A 2RNJA 4BYYA 3GUDA 1O3QA 5FFXA 1I27A 2H94A 5D5UB 4U88A 3C3WA 3RIRA 1IN4A 2RDPA 2QBYB 2XRNA 3KP5A 5E8GA 3B73A 1LB2A 2QZ8A 1SD7A 5FD5A 3QPHA 2D1HA 4YIIA 4ENJA 2HZTA 4HLYA 2F2EA 3C1DA 3FM3A 2DI3A 4M9ZA 3GO5A 3E6DA 4YFKF 2NNYA 1U5TA 2OQGA 1RIOH 3BDDA 2VBYA 4KIBA 1HSJA 2F5CA 3F23A 2PJPA 3KETA 2HKOA 4I02A 1FBSA 2H27A 1LQ1A 1QGPA 1BC7C 2EFOA 3FMQA 1S8NA 1TW3A 3HHHA 2VODA 2CFXA 2E1NA 3TOBA 3EQLF 2RC4A 3TO9A 5L3EA 5AONA 2M8EA 1UHWA 2DO7A 2L3DA 2O03A 1WWXA 4M72A 4CICA 3TGNA 1T98A 1XN7A 2Y0MA 1G6NA 4U7BA 3T0YA 3HTSB 3V8KA 3WTUC 5L3DA 1JXSA 3WTYC 3LQQA 4LMYA 1QPMA 3FF5A 2A69F 3ML6A 3ZMUA 5CJ9A 5DYMA 1YW7A 4CZZA 5CVRA 5ERIA 2STWA 2HKXA 5ILUA 5LHGA 3KP6A 1EV7A 1WRJA 1K78B 3ABUA 3QPTA 4Q48A 2O61A 4ZYHA 1IF1A 4LLLA 3K1PA 2STTA 2M87A 1F9NA 3TKYA 1IN8A 3AAFA 5H20A 2JSCA 1J2XA 1DPRA 4LB5A 1BI1A 2GAUA 2P5VA 3ABTA 3F22A 2YSRA 3SZTA 4ESJA 2P6SA 1S3JA 4R1HA 3SZPA 3HTUA 4LFUA 4OIOF 1SFUA 1IUYA 4KFCA 1RUNA 2QBYA 1KU9A 3GEZA 2BGCA 5BPDA 2A6HF 4QWQA 3J7AO 4M71A 2COMA 5JR3A 1TW2A 2Z5UA 5LHIA 4KN4X 1P92A 2K4BA 5F6FA 2M45A 1XDUA 5D4RA 2L01A 1B9NA 3KP2A 2PI0A 2RKHA 1DDNA 2DTRA 2KJCA 3K0LA 5DEQA 2YR2A 4MGRA 1X3UA 5H6RA 1P4WA 2Q2EA 3GW2A 5K5QA 3RKWA 3HHGA 1BIAA 3R0AA 4IRIA 2WC2A 4LLNA 1XSDA 4HZFA 5JVTA 2EA2A 2BYVE 4PGHA 1XB4A 4EGZA 2GZWA 1XCVA 4XLPF 2D2WA 1E2XA 3Q9VA 1FYMA 4XBFA 3WTSC 5LGUA 1KU3A 1C0WA 2FXAA 2RVCA 4KT5C 1BC8C 3BPVA 2PMUA 2DU9A 4OMZA 1OYYA 5K1YA 2UWMA 4FX0A 4BXUA 4LD5A 2FNPA 3GFLA 3EUHA 1HKTA 2XAQA 3NQOA 2E1CA 2D45A 3J81Z 3HSRA 4EQQA 3WTTC 1MJAA 2OU2A 2X0LA 4HA8A 2VXZA 5LBQA 1YQAA 4AIHA 4L0ZB 3RJPA 4KIFA 3KE2A 3QP5A 3TO7A 3V7RA 1G3TA 3JTHA 2CYYA 4RB1A 2NRAC 1LVAA 1S7OA 1I6XA 1TQMA 3TQNA 3BJ6A 2J5PA 1O7LA 4I7HA 2BV6A 5DCFA 1K78A 3J80Z 4ENKA 1GHCA 3TDZC 2VC0A 4M74A 4FT8A 4GYIA 5FD6A 5FLXK 2ZCWA 3TO6A 1D8JA 3GZ5A 4U0YA 5ICEA 3KP7A 5LGTA 2PBIA 3HYIA 1XMAA 3QU3A 3W6KB 1YLFA 5D8KB 1ZLJA 1JHFA 4IF4A 3L9FA 3EDPA 5J8CA 3M8EA 5HLIA 3N4MA 2D1VA 1R1TA 4DQ2A 1ZREA 2RN7A 1H0MA 2ZKZA 3BPXA 5FO5A 3BOQA 1JHHA 1V4RA 3CO6C 2XVCA 2K27A 2FF4A 1LEAA 2OZ6A 3ISPA 4E70A 1U8RA 1RUOA 2P5LC 2VC1A 4EGYA 3I64A 2XAFA 5DCMB 3KFWX 3WU0A 4N9IA 1BIBA 3MEXA 3WTWC 3ULQB 4O6JA 1IXSB 3F72A 4OMYA 1BI0A 4R8HA 2UXXA 2FBHA 4LB6B 1W7PB 5L3FA 4AIKA 5DD8A 4BHPA 4B09A 3KP4A 4MEYF 2HGCA 1KYZA 4G94A 3CUOA 3DV8A 3S2WA 4G7ZF 6PAXA 2V1DA 3QAHA 3ZMDA 3LAJA 4DNCA 1ULYA 1SAXA 2F5DA 1OYWA 3NRVA 4MQ9F 5D6EA 4IJAA 4U7DA 4CHUA 3E5XA 2HR3A 3KCCA 5ICFA 1KQ9A 2XAHA 3QOPA 2IJLA 4EM0B 4CDGA 4CXFA 1SFXA 1B6AA 4JBAA 1R1VA 1Y0UA 2Z3YA 3F21A 3SHFA 4I2OA 3LA7A 4F7ZA 3SXYA 1YS6A 2HQRA 4WCGA 3JW4A 3P9IA 4K2EA 3M9AA 4PCQA 5HLHA 3WE3A 3F8BA 4U0VA 1R23A 4IHTA 2FRHA 3E6CC 5TRDA 4OU0A 1KGSA 2FMYA 2H6BA 4HX8A 3LQRA 1FSEA 3G3ZA 5CLSA 2QQAA 4JQFA 4M6YA 1SMYF 2CO5A 2FSWA 4YIFA 3K9TA 2P7CB 2K7LA 1XSXA 4UVCA 3MWMA 2XUBA 1KQ0A 1G3YA 3L7WA 1XD7A 4RS8A 4IRGA 3VEPA 1QZYA 3L2CA 2JZYA 3P9CA 2NYXA 3RYRA 5BS6A 1HKSA 1HQCA 1PUEE 1FOKA 4LGWA 1BI2A 4RAZA 2CW0F 5LHHA 1BOAA 4OIPF 4M9XA 4KUMA 4ZYGA 4ETSA 3LWFA 4A0XA 5L3CA 1T6SA 4OINF 3H3UA 3P7NA 1Z05A 3HRSA 4HW0A 2ESNA 3W6JB 4Z2YA 2C6YA 5BOXA 3QRFF 2FU4A 4RB2C 1ZRCA 1G4DA 3GF2A 1HW1A 1O3TA 4AWXB 1H9TA 1D5VA 4CO8A 4HF2A 1S7AA 3IRRA 5DCMA 2B0LA 4OIQF 4BHCA 4HX7A 3M7GA 4P5OA 3OV8A 4XLNF 5HOOA 1L3LA 1MJ9A 1EH6A 1W7PA 2XIGA 3RTRA 2M5WA 4G7HF 1E17A 1ZRDA 2Y48A 4U0WA 5DD4A 2BE5F 1JGSA 3I54A 4MHGA 1USSA 1FWZA 1FLIA 3O6BB 1D8KA 1GXQA 4XRFA 1ZG5A 5AIPA 2GA2A 4I0AA 1Z6TA 2GXBA 2ESHA 3R4KA 1FC3A 1NHAA 3JSOA 4OIRF 4WXDA 2CQKA 1BJAA 1OYIA 3WODF 1OKRA 3EYIA 2VE8A 5LRSA 2BEOA 1ON2A 1A04A 4ON0A 4ENNA 2P6TA 2ZO4A 1HXDA 5FGMA 1XSVA 5LLQA 5E1ZB 5ICGA 4GO1A 2V9VA 2JPBA 4RGRA 1FYLA 3GX4X 2RV8A 2HEOA 5DUIA 2GWRA 4ESBA 3FXRA 5D4SA 3HUGA 1W4MA 3L00A 1ZAOA 4UNOA 1WSUA 1OMIA 2L54A 4A0ZA 3DP7A 3F3XA 2MH9A 4EJVA 2GXGA 4Q5SF 2A6EF 3V7CA 2DT5A 4AVPA 2YPRA 5IT9K 4CYDA 5E18F 4D0PA 1R5GA 4Y13A 3Q5FA 4HX4A 4RGUA 2P5KA 1ZN2A 3I59B 5CYVA 3BZ6A 4UHTA 5E1XA 3CTAA 2A68F 4L9TA 3WG9A 5D5XB 5CVUA 1KU7A 2EWNA 1I5ZA 1YS7A 1IW7F 2PQ8A 4UXNA 3F8NA 5A2QK 4PGGA 4WX9A 2XASA 2Z99A 3GYHX 3MQ0A 3WTXC 3IWFA 5IT3A 2QQBA 2ZNZA 1J7KA 2YU3A 3D0SA 1UB9A 2DK5A 3VB2A 3EYYA 1ZH5A 1F1ZA 3GWZA 4A5NA 2A5YB 1T0FA 3JTGA 5DUKA 1XGOA 1P2FA 2XAGA 5CVVA 2IT0A 4A2UA 5FLXZ 3JAMK 3HRMA 1ZRFA 1FNNA 3R0JA 1MDMB 3ZN0A 4BH9A 3BROA 3WGHA 2VT2A 1YIOA 2E7XA 1FBQA 4KICA 2KIMA 3R61A 1VTNC 3NEUA 2V1UA 4RB0A 1HBXG 3E5UA 1TLHB 2WV0A 3WTZA 1FZPB 1YW8A 4WWCA 4WK8F 1ZG1A 3I4PA 1R1UA 3DFGA 1P4AA 2DQLA 4WXHA 3N97A 1USTA 2G7HA 2CGPA 4NB5A 1QZZA 1F4KA 2JRTA 1FBUA 1LDJA 3V8LA 2W84A 3GFMA 5LEJA 4RAYA 3O3KA 5E1WA 2JT1A 1B9MA 5E8IA 3MZHA 3DF8A 5HDGA 1AOYA 3SQNA 2J5OA 5EEGA 2YX4A 2ISZA 5L3BA 2P8TA 1XCBA 3G73A 3PFIA 4HF1A 2Z33A 2O8XA 5DV5A 2ACJA 3FMRA 4AIJA 1XGNA 1D3YA 4L0YB 3BWGA 4A6DA 5ED4A 2IRFG 2FBKA 4HAMA 3E6MA 5ILSA 1HW2A 2KIFA 1Z6RA 4ZYDA 2VT3A 1DUXC 1XDSA 1FY7A 2LSOA 2HQNA 4ENMA 3K1MA 1LNWA 3E97A 3I59A 4XSZF 2OA4A 1XMKA 2DBBA 1B4AA 4HBLA 3HRUA 1ONVA 1KQ8A 1LJ9A 4GYGA 3VOEA 2PEXA 3ZQ7A 1IRGA 1DPUA 5HS8A 1R36A 3RI4A 2M30A 2MC3A 2L02A 3IKTA 1GXPA 3RPUA 4HF0A 3ZMVA 3FHZA 3H92A 3CDHA 4N0BA 2GQQA 3F8MA 3J80K 1Z7UA 2EV6A 3L09A 1G3SA 2ZMEB 2KRFA 4I0BA 4HLXA 2IA2A 2EJRA 2Y75A 4L9JA 2Q0OA 4HOBA 4YFXF 1R5HA 5HVQC 1BBYA 5DDGA 1FSHA 1STZA 2RGVA 1MDMA 2PG4A 3MZYA 5KK1A 2NNNA 3FWEA 1KU2A 4O3MA 4ZH4F 1RI7A 1IZ1A 3VFZA 3JSPA 3F6OA 1UFMA 2EK5A 3KLOA 4G9YA 2XAJA 5EEHA 1V3FA 4HV6A 4PDKA 2JTVA 2VE9A 4EM1A 1ZHFA 4A6EA 1ODDA 1MKMA 1QNTA 3ELKA 3RKYA 1SFEA 1Q1HA 3REOA 4UVAA 1FP2A 2WWYA 2EFWA 2W85A 2A3SA 2H6CA 2VONA 2ZFWA 4G7OF 1K6OA 2QQ9A 4LG0B 4G6QA 1PDNC 2AS5F 3ROUA 3DPTA 2V79A 1PP7U 2EFQA 4GCVA 2ZJ2A 4UVBA 1LEBA 3B02A 2X4HA 3CUQC 2OD5A 4UV9A 4MQVA 5FB2A 3E3VA 2IVMA 3ERED 1ZGJA 2BBYA 1XGSA 1J59A 1J75A 2FBIA 1O7FA 3F6VA 1UCRA 3ZP5A 1U78A 3U1DA 1R22A 2RQPA 5LRRA 3CUQB 3H3ZA 4QLCU 4EJUA 5HDNA 4RB3C 3FM5A 4ZZDA 4EJWA 4M6XA 2LDUA 1QBJA 2HOEA 2VBXA 2FQ3A 4IRHA 2EV5A 2QM3A 4HV5A 1ZG3A 2PN6A 2FNAA 1TQPA 1RZ4A 2ISYA 2MH2A 2MA3A 3I71A 1IAWA 4HDUA 2TDXA 2HWVA 2R7FA 2DPDA 2XHKA 4HYEA 3I5UA 2ZMEA 4N9HA 1Z91A 1B1BA 3IRQA 2MD5A 4M73A 4BQAA 2O3FA 1S29A 2HS5A 3IWZA 4A12A 5E17F 1W5SA 3V8JA 4PZJA 2FOKA 2JPCA 2NAZA 1IN6A 2Q8KA 2GA1A 1EH8A 4MEXF 3FXQA 4A0YA 5E20A 2ELHA 1SMTA 5IT9Z
chains in the Genus database with same CATH superfamily
2O6GE 1Y8RB 4FASD 3HOUJ 1P7JA 1YRNB 4E7HA 2V6EA 2W25A 1FYKA 2F4OB 3FX3A 1X4PA 1Z7LA 4CCKA 1VF9A 4W1UA 1YFHA 3F8CA 1A6IA 1GV2A 4M9SA 1MD0A 5K7HA 2H09A 4UUSA 4LG3A 3JRGA 3BTLA 4IQJA 3FZVA 2VBWA 2KIQA 4RM2A 3PIOF 5F0CA 4CCJA 1TNSA 1U6GA 1WVRA 4M3BA 3RKQA 4FCYA 4YRVA 1F5TA 5BQTA 1IRFA 1YW9A 2XGEA 3ESWB 3QYFA 4G8XA 2YU9J 3HGYA 2HNHA 2PJRA 2Y9YA 4B47A 4PJ0C 2LF7A 5A2QZ 2E35A 2HOAA 1SEUA 1UHMA 4IHSA 1ZARA 4P55A 5FFZA 1A35A 5M3FJ 1T39A 2NOJB 3BP8A 3QODA 4LG0A 2DMNA 3CMYA 2KIUA 4DZJA 2CQNA 2IGOA 4NQWA 2XAUA 3GLXA 1REPC 1P4XA 2TCTA 5LGNA 4A3FJ 4RGSA 2EFNA 1CGPA 1LDDA 2QWWA 2IW5A 2Q1ZB 4A3JJ 3KEOA 3WU1B 3M4OJ 3IL2A 4Q47A 2CS3A 2V1XA 4IVNA 5CKTA 2A61A 1MGTA 1QQIA 2HU9A 4PSXA 2H1LA 4IPAA 1YTYA 1MIJA 1MMNA 2CWEA 1OCCH 2CUEA 2JK3A 3MAJA 1OR7C 4I01A 2CSOA 3I58A 2LF8A 3F9KA 3T8RA 1FEXA 2NOGA 3BTJA 4TV7A 2XPUA 2W57A 4DGWB 1JGGA 2BHYA 2YUSA 2K9SA 3HBLA 1S7EA 3ZQCA 1MBFA 5EF6A 5FLMJ 4C2TA 1OPCA 3JAMZ 1E3PA 4IHYA 2R7ZJ 3NAUA 2Z16A 5F1RA 2VUMJ 2R3SA 1Y0NA 2ETHA 5KCMA 1EF4A 3V7SA 1MJBA 2ZSHB 3BG5A 2V6CA 3WHCA 4Y17A 1H9GA 2KKOA 4KN7X 2IA1A 4RA2A 1JE8A 1HCRA 5FLVA 3I0TA 2ZXJA 4F92B 2W4SA 4IHVA 3GTGJ 3T8TA 3CUQA 4Q4ZF 3GFJA 1RKTA 1D5YA 3CJRB 1W7PD 1TWCJ 1JUMA 1LFPA 4ZYAA 5LEKA 3R6SA 4KDPA 4UB8C 3FKIJ 1ZGAA 3IHUA 2AXTC 3LFKA 3K70C 1ERDA 3LAPA 1QHGA 4MTEA 4ASNA 3HSFA 4OAYA 1YE9A 5J8FA 2MSYA 2G9WA 4L5IA 4FHTA 5HDKA 3GZ6A 4IHWA 5IYDJ 3U9GA 5GAGJ 2LH9A 2LKPA 5K5OA 4RMNA 1YITI 1NK2P 1UMQA 2CV1A 4OOIA 3Q9SA 4Y15A 4S0HB 1OFCX 3EETA 2LREA 4XSXF 3RPQA 1IXRC 1BR4A 2HZDA 3DXJF 5BMZA 3PQJA 1PUFA 3PUFA 2F5EA 2QEXI 3D5LA 1V5EA 3DU6A 3GXOA 2ZSIB 2HDCA 5KNLA 2VBZA 3BG3A 2M8GX 1FTTA 1G3WA 2UZKA 3KP3A 2XKPA 2E36A 3EUAA 2PFBA 3FK7A 3LSIA 3OR1C 5E3OA 2EV0A 1OISA 1AKHA 2FMLA 3DQVC 3FHNA 3LSTA 3JR9A 4UY8I 5D5WB 3HDDA 3OS2A 3IP4B 2VI6A 1W5TA 3MFKA 3HXLA 3QU6A 1X1AA 2GM4A 3I53A 1IN5A 1FOWA 3V4GA 1RNLA 5TJJA 1J5YA 2KJBA 1T2KA 4BHBA 2WB1N 4KJZA 3IUOA 3ZR8X 3MMYB 2K02A 5J1YA 1YYVA 4BBRJ 1CF7B 2R7VA 4ESFA 2DFEA 3DU5A 5CVIA 3A1YA 3B6CA 2QLZA 4FISA 1N25A 2E7WA 3ZPLA 3RQ4A 3S15J 2YX7A 4N4NB 3RZDJ 4MTDA 2V9KA 3AFHA 2HI3A 1DP7P 1WFXA 4Z6YA 5K7ZA 3TDUC 2FE3A 2HTJA 2DQRA 1YRNA 4I98B 1MMGA 5ICCA 2XGXA 4AU7A 4WF2A 5HODA 2LNBA 3FISA 1XGMA 1VQ4I 5HNHA 1Z1DA 3K69A 4IXAA 2MBFA 3DPLC 3S17J 1M1EB 5M5WJ 3RKXA 3LSHA 2OV7A 2LOOA 2DA4A 4ZZLA 3OOPA 2OTJI 1VQNI 2QF7A 3LOCA 1KA8A 5D8LB 2VN2A 4A3EJ 1AHDP 2NS8A 4IX7A 2LVSA 2GBYA 2O7OA 2MD0A 3J7YJ 3OOUA 2K86A 4YG2F 3UKGA 2EFPA 1MMSA 1R49A 2ZNYA 4PFOA 5D6FA 3ZMZA 3J7AY 1DU6A 1O57A 1TTYA 2UXNA 1R4MB 2IA0A 2DPUA 3KZZA 3HOTA 3M1EA 1O3SA 1EJ9A 2E60A 2WAQN 4BJTA 2ZBKA 3IH4A 4MNUA 4ZDPA 1TNTA 1SD6A 4ZTFA 1WKMA 4P9FA 2XV4S 1TQIA 3C18A 5B66C 1OCOH 1T38A 4O5VA 4AYBN 3WGIA 3WGGA 1QO0D 3CLOA 2DK8A 2PLYA 1TZLA 2EB7A 2N8GA 4HQMA 4KA4A 3QPLA 3T5XA 3W3CA 2FA5A 4YEJA 2DMTA 1KYWA 3HOSA 3HKZA 4LK0F 4L9NA 2JRMA 2ZXHA 1ETWA 3HJEA 5F08A 4R79A 5E3NA 2HFHA 3VDXA 5BNGA 3MCZA 2LY2A 4G6DA 3VPRA 1MBJA 4GGGA 2PMHA 5H2FC 4GDFA 4GFBA 4P96A 5L3GA 3OL3A 3COAC 3F8FA 1R6RA 3BTIA 5J6XA 1H88C 1YG2A 3VODA 3S2HJ 2DDAA 1ON1A 2ME0A 1IGNA 2L4AA 2KP6A 1FP1D 4HDVA 1K79A 4YELA 4S05A 1HKQA 2W24A 3HM5A 2DOFA 3MKYB 2GIVA 5K5RA 1YO5C 3P9KA 3FXUA 1V54H 2LYCA 2CW8A 2P7VB 2AXLA 3IC7A 5J4VA 1PP8F 2DW4A 4MO7A 4KMFA 1MZBA 2IS2A 1U5TC 5FRNA 3J81K 2MLKA 1OR7A 1Y8QB 4LLGF 4HQEA 3S3NA 2X85A 2EIMH 3T1BA 1A36A 2VJJA 3K4CA 3O2PE 2E2JJ 2M1BA 5F04A 2M4GA 1XC5A 1HW5A 4RGXA 1Z3YA 1DGRM 2I10A 2VXDA 3DKWA 1WQ2A 2KDZA 1EKEA 3AG1H 1TBXA 2QUFA 2P4WA 3E5QA 3ZN1A 1UHSA 1ZYRF 1Q1VA 3PQKA 2EBIA 4JK1X 2E1MB 2R7OA 2JMWA 4XONA 4ZYEA 1JKRC 1XX5A 1X58A 3H9QA 2CFOA 4AD9A 3WTVC 2DLLA 1FMVA 1U3EM 3HSEA 3RYPA 3ZCOA 5ILVA 1FPQA 4HG2A 5GP9A 2DJNA 4BY1J 1ZGWA 4FX4A 1U5TB 1FT9A 2FEZA 2LR8A 3HEFA 5BPIA 1HSTA 4XRSG 4BNCA 2QVOA 2R7WA 3VYUB 4EJOA 1BM9A 2EIKH 3SFZA 2NVTJ 4L9VA 4DYCA 1HA8A 2L7KA 5HLGA 2CW7A 4UV8A 3K10A 1X19A 1P6RA 3IH2A 4S04A 2Z9OA 2VOOA 3AG2H 5E3MA 1R00A 2QENA 2X6XA 3MD2A 3CO7C 4CGZA 4GXOA 2EA4A 2MC4A 4UUVA 1OCRH 2XF6A 2B63J 3U2RA 1OLTA 2IPQX 2V4JC 5HS7A 3TOAA 3ZMTA 3IKVA 2ICWG 3GFIA 1FX7A 4KMUX 5H6QA 2LKXA 1CF7A 3BC8A 2Y30A 2E19A 2MLGA 1J9IA 2HTSA 4M3GA 4EVIA 3LA3A 1HDDC 3BLYA 2DT6A 1SD5A 4NHJA 4UB6C 2YS9A 3PM1A 4H0EA 2R5ZB 4I09A 3KX2A 4E6KG 4EV0A 3C7JA 4EMSA 1I1SA 4LK1F 1B59A 2L4MA 2Y69H 3DEUA 3WHBA 2XKOA 3K1NA 4HSRA 5AIQA 1R7JA 5JI6A 4LJZF 2M9HA 4A5MA 3LSJA 2QYOA 5KVRA 2A07F 4EJTA 1D1BA 3BY6A 2WAEA 3D5SC 5F64A 5JFRA 3HIFA 2R7TA 3ECOA 1D0ZA 4EM2A 3HL2A 1K7AA 3WE2A 2DJIA 5EEAA 4FTHA 4KIGA 2L9RA 3HRTA 3KLNA 3KZYA 4YFNF 3FXKA 1IN7A 1XS9A 1BR1A 5E3LA 1J0RA 1E3HA 4WXCA 1IXCA 1JT6A 2OZUA 3LA2A 2VOPA 5IOYA 1G8XA 2G7UA 2ZXWH 2DA1A 3VYTB 3PUBA 1WPKA 2L9NA 2O0YA 1P9QC 5GPCA 2XROA 2NS0A 2OBPA 3KEQA 1P7IA 1X1PA 1GT0C 4L18B 1TWAJ 1U2WA 2VJ5A 3CJNA 3GVAA 4P9UA 3KYLA 2CG4A 3MN2A 1AWCA 5IP7J 2DCEA 4XKWA 1NG6A 3ECHA 3DBHB 1LDKB 1Z9CA 1H89C 1S6LA 5CVJA 3HPGA 4L5JA 4IOAF 3BJOA 2WTEA 1VQ9I 5D5VB 3OY9A 1IJWC 2HYGD 1GVJA 2V1NA 1D0YA 1T8IA 2GIZA 2HYFA 2R7SA 2OUMA 2R7DA 5HS9A 3ZRGA 3SYTA 4B8XA 3OIOA 1R5ID 4FE7A 1BOBA 3E6BA 1O3RA 1BN5A 2F5FA 3CMMA 3R60A 1L0OC 2DFIA 4AVZA 1BI3A 3GTJJ 3ZMSA 2GOXB 2K40A 2OAZA 3BJAA 3RDIA 1RC9A 2DFHA 3K2ZA 3PNTA 2DAOA 1R9TJ 1LE8B 4KNYA 4LIUA 4KYWA 3H0DA 3M8FA 3G2BA 4BAYA 1WI9A 2IP2A 2K4JA 2FJ1A 2ADUA 1Z3XA 3FMSA 2K3PA 1LFUP 1I1GA 1SD4A 2QSGX 1R58A 1ZLKA 1BA5A 2ZC2A 2UUZA 3CQZJ 4JX4A 5EZHA 2EILH 2QSFX 2WV1A 4BE2A 1XTAA 2OQRA 3OSGA 2CJJA 1TC3C 1EH7A 1WJ5A 2DYSH 2M0MA 2EQRA 3QP6A 2RNJA 4NDLA 4BYYA 5F0HA 3GUDA 1O3QA 3MKWB 4A93J 5FFXA 5M5XJ 1K4TA 1I27A 2H94A 5D5UB 4U88A 3CCRI 3C3WA 4BU2A 3RIRA 3GBGA 1IN4A 2RDPA 2QBYB 3G71I 5FKNA 5EG0B 2XRNA 3OIQA 3KP5A 5C3EJ 3WU2C 1OCTC 5E8GA 3B73A 1LUJB 1LB2A 2QZ8A 1SD7A 5FD5A 3QPHA 3V42A 2D1HA 4YIIA 4ENJA 1GUUA 3JRAA 2HZTA 3UNGC 4HLYA 5GTHC 3KEYA 2V9PA 2F2EA 3UR3C 2B9SA 5CPRB 3C1DA 3FM3A 1PUFB 1T0FC 2DI3A 4M9ZA 3ONQA 1VFCA 1MH3A 3GO5A 3E6DA 1QRYA 4YFKF 2NNYA 3A01B 1U5TA 3HOVJ 2OQGA 1RIOH 4NUBA 3BDDA 2VBYA 4KIBA 2XDVA 2KLOA 3QQAA 1HSJA 2XPVA 2XGDA 2F5CA 1DU0A 3F23A 2PJPA 2Q2EB 3KETA 2HKOA 2M3AA 4I02A 4BQOA 1W0TA 1MMAA 1W1WE 3QOEA 1FBSA 2H27A 3HOYJ 4B1RA 1LQ1A 1QGPA 2ECBA 1BC7C 2EFOA 3MKZA 3S1NJ 2PMZA 3VWBA 3FMQA 3DWLE 1S8NA 2VKHA 1TW3A 5HNFA 3HHHA 2QSHX 4E7LA 2W82A 2VODA 4XLEA 2CFXA 3EUHC 1SFOJ 2E1NA 1GLNA 2X6YA 3TOBA 4A3CJ 3EQLF 2RC4A 2E5NA 3NWTA 2BY0A 4XLFA 5J40A 3BG9A 3TO9A 5L3EA 3I4NJ 5AONA 1IC8A 2LP0A 1UHWA 2M8EA 2DO7A 3BR3A 2L3DA 2O03A 4M3EA 4XLCA 1D1AA 1ZQ3P 2R5ZA 1WWXA 1JTYA 4M72A 2HQAA 4XORA 1HDPA 2R7UA 2ZFUA 2VJIA 4CICA 1CQTA 3TGNA 5J47A 2OC6A 1T98A 4CCOA 1XN7A 2HOSA 3M8JA 3PNVA 2Y0MA 1G6NA 4U7BA 1QHHD 4XOTA 3T0YA 4BE0A 3HTSB 4Y4RA 1MW7A 2JSPA 3V8KA 4E4HA 3WTUC 5L3DA 1JXSA 3WTYC 3LQQA 4LMYA 1QPMA 3FF5A 1LKXA 3DLAA 3WG7H 2A69F 4E7JA 3ML6A 3ZMUA 5CJ9A 2A05A 4X6AJ 5DYMA 1YW7A 4CZZA 3DPUA 5CVRA 2Y0SA 5ERIA 2BXYA 2CMPA 4C2MJ 4DBQA 3VSKA 2STWA 4II2A 3ZOBA 2HKXA 5ILUA 5LHGA 3KP6A 1EV7A 1WRJA 2ELJA 2DDBA 4F3QA 4DYQA 3GTKJ 5JLXA 1K78B 3ABUA 3ZQHA 4LITA 3S1MJ 3QPTA 1U0JA 4JP0A 4Q48A 1VQLI 1Z0XA 2O61A 4ZYHA 3QPSA 1VZ0A 1IF1A 4LLLA 3K1PA 2STTA 3MVPA 2VKVA 4B3AA 1XPXA 2M87A 4OAZA 1F9NA 3K4BA 3TKYA 3FXMA 3I3LA 3OL4A 4M3FA 1LE8A 2TRTA 4BEHA 1IN8A 3FKJA 3AAFA 5H20A 1RESA 4C3HJ 1GV5A 4BJ5C 4BUPA 2JSCA 2NVUB 1J2XA 1DPRA 1Y1WJ 4LB5A 2F5VA 1BI1A 2GAUA 2P5VA 3ABTA 2UV1A 4BJ6C 3F22A 2R92J 2YSRA 2F4IA 1ZR2A 2G0EA 3SZTA 4ESJA 2P6SA 1S3JA 4JOMA 3PO3J 5KHDA 4M6VA 3HG9A 4R1HA 3CC2I 3SZPA 3TW6A 3HTUA 4LFUA 4OIOF 2V26A 3H0GJ 1HOMA 1ENHA 1SFUA 1IUYA 3BZKA 4KFCA 1RUNA 2QBYA 5B5EC 1KU9A 5EG0A 3GEZA 2BGCA 5BPDA 1VNDA 5J1UA 2A6HF 5FRMA 5J4YA 3W6VA 4QWQA 3J7AO 4M71A 4AC0A 2BHZA 3G6EI 2COMA 5JR3A 3AKZA 1X2NA 2VJ4A 3SFIA 1TW2A 2E34A 1IRZA 3SDGA 5IP9J 2Z5UA 1A5JA 5LHIA 1MBGA 2I5UA 4KN4X 3VYRB 1P92A 2K4BA 1B8IB 3Q0WA 2M45A 5F6FA 1XDUA 5D4RA 1I50J 3DEEA 1I3AA 2L01A 1B9NA 3K6GA 5GPAA 4V2FA 3DTIA 3KP2A 1E3OC 2PI0A 3W2VA 3S3OA 3K4NA 1WJBA 3A01A 1N77A 1XMXA 3LMMA 4XK4A 3CC4I 2RKHA 1DDNA 2DTRA 2KJCA 3K0LA 3ASNH 3QYBA 3IV5A 1NK3P 5DEQA 4D9JA 2YR2A 2AHQA 4MGRA 1X3UA 5H6RA 2F48A 4MFDA 1P4WA 2Q2EA 3A0BC 1EA3A 3GW2A 2KPMA 4Y7NJ 5K5QA 3RKWA 3HHGA 4IO9F 4QPQA 3AG4H 1BL0A 2X6OA 1BIAA 3R0AA 4IRIA 4CCMA 2WC2A 4LLNA 1XSDA 4CH7A 4IQ4A 3FIWA 4HZFA 5JVTA 2EA2A 3RSNA 2BYVE 4PGHA 1XB4A 4EGZA 3K2AA 5J1RA 3S8PA 2GZWA 1X4OA 4A69C 1SVOA 1XCVA 4DIQA 4XLPF 1K6YA 3LSPA 2D2WA 1E2XA 3Q9VA 1FYMA 1T33A 2RNGA 4XBFA 3WTSC 2LY9A 4BL0B 2FQ4A 4CUGA 3FDYA 5LGUA 1KU3A 2HXIA 1C0WA 2FXAA 2RVCA 4KT5C 1BC8C 3BPVA 2PMUA 1D0XA 1RR7A 1IDZA 2DU9A 2XPWA 2JJ7A 4W97A 3GTMJ 4OMZA 1OYYA 5K1YA 2XSDC 2UWMA 4FX0A 4BXUA 4LD5A 2FNPA 2DMUA 3GFLA 1JUSA 5DM7F 2DXIA 3EUHA 1HKTA 2KT0A 2XAQA 2KQRA 3NQOA 3PFYA 4XMYA 2O5RA 2E1CA 2D45A 3J81Z 3K4KA 3HSRA 4EQQA 5KAFC 2K3FA 3OYIA 3WTTC 1JJ8C 1MJAA 2OU2A 3ZQFA 4XIDA 2X0LA 4HA8A 2VXZA 3H36A 5LBQA 2ZJQF 1YQAA 1V5GA 3CP8A 4AIHA 1RRJA 4BY7J 5B1BH 4L0ZB 1GVDA 1DGWY 2M34A 4KIFA 3KE2A 3QP5A 3RJPA 3TO7A 2CH0A 3V7RA 1G3TA 3JTHA 2CYYA 2P0WA 2R7XA 2M0CA 4RB1A 2NRAC 2LRDA 3DEWA 1LVAA 1S7OA 1I6XA 3PJRA 1TQMA 4OWRB 5FKOA 3TQNA 1I6HJ 3BJ6A 4KT6A 1H8AC 3CCLI 2J5PA 2FUG2 1S72I 1O7LA 4I7HA 1YI2I 1X2MA 4CZCA 2BV6A 3IAS2 4XKBA 5DCFA 1K78A 1VI0A 3LSMA 3J80Z 4ENKA 1GHCA 4A3IJ 3TDZC 2PX9A 2VC0A 4M74A 4FT8A 4GYIA 3H5RA 5FD6A 1LFBA 1G59A 1GDTA 5FLXK 2ZCWA 1UJ8A 3TO6A 1RPWA 1D8JA 4V2GA 2XSJC 3GZ5A 1IV6A 2ZB9A 4BKXA 3CC7I 4U0YA 5ICEA 3KP7A 4XNFA 5LGTA 2PBIA 1U8BA 4D1QA 2WBMA 3HYIA 1S9HA 1XMAA 3QU3A 3G4SI 1RETA 1MH4A 3W6KB 2QQ8A 3I55I 1YLFA 5D8KB 3FXJA 1ZLJA 1JHFA 1HLVA 3TP3A 3TMOA 4IF4A 1NG7A 1ACIA 4QTRA 1O4XA 1SVMA 3L9FA 2NVQJ 3EDPA 5J8CA 3BQZA 4HRIA 2F6CA 3M8EA 2MABA 5HLIA 3N4MA 3U21A 1VQ8I 3BR1A 2D1VA 2L9VA 1SC7A 1R1TA 4DQ2A 1ZREA 1SVLA 2RN7A 1H0MA 2BVMA 2ZKZA 3BPXA 5FO5A 5FROA 3OS0A 1VQKI 3BOQA 1JHHA 1VQ6I 3CJQB 2MFZA 2IS1A 1YJ9I 1V4RA 2OF7A 3HB9A 3CO6C 4G12A 2XVCA 2K27A 3LNQA 4AUXA 3FXLA 2FF4A 1LEAA 4D5CA 2OZ6A 2R7RA 1B8IA 3S32A 3ISPA 4D5FA 4E70A 1DQUA 2Z1DA 2L7FP 1U8RA 3TW7A 1RUOA 3BCAA 2P5LC 2BW3B 2WY8Q 5C4JJ 2VC1A 4EGYA 1QVTA 3JRDA 3I64A 2XAFA 2RAEA 5DCMB 2DOEA 3E0JB 3KFWX 3WU0A 4BXXJ 4N9IA 3HGGA 1BIBA 3CP2A 3MEXA 3WTWC 3ULQB 2JA8J 4O6JA 1IXSB 2LK2A 3F72A 3KPHA 3C2HA 1Z67A 4NNJA 4OMYA 3CF5F 2BOLA 2E5ZA 1BI0A 4RDUA 4R8HA 2UXXA 2K9NA 2FBHA 4NBQA 2KZVA 4LB6B 1W7PB 5L3FA 4AIKA 1MSEC 1X1CA 5DD8A 4BHPA 3TEDA 2AO9A 4B09A 3CCJI 2WB1A 3JCUC 2L9SA 2MW8A 2DOAA 4ZTJA 4IHXA 2EZLA 2K9QA 2BY1A 2M2EA 3KP4A 3LSGA 4MEYF 1TT0A 1IRXA 5IPAA 1WZ2A 2HGCA 2P81A 3G1MA 1KYZA 4G94A 3CUOA 3DV8A 3S2WA 3W2WA 4G7ZF 4HEA2 6PAXA 4F91B 3PO2J 2V1DA 3QAHA 3ZMDA 4A3GJ 3LAJA 4DNCA 1ULYA 1SAXA 2F5DA 3JRIA 1OYWA 3NRVA 4MQ9F 3SEZA 3CZ6A 5D6EA 4IJAA 4U7DA 4CHUA 2O8KA 3E5XA 3D1NI 2HR3A 1UELB 3CCYA 3KCCA 1OQYA 5ICFA 1KQ9A 2XAHA 5JHUA 3RCOA 3DBRB 3QOPA 2IJLA 2KFDA 2L2OA 4EM0B 5B1AH 5C4XJ 4C9YA 3S14J 4CDGA 2H8RA 4CXFA 1SFXA 1B6AA 4XL9A 4JBAA 1U9OA 1BR2A 1R1VA 1Y0UA 2Z3YA 1T08B 3BR2A 3F21A 2QGUA 3SHFA 4I2OA 2F4MB 3C2GA 5IYBJ 3LA7A 1MNMC 4F7ZA 3SXYA 1YS6A 2LFBA 2HQRA 3LSKA 2E1OA 3P5JA 2VQGA 2IGNA 4WCGA 2DYRH 2VKEA 3BT9A 2K9MA 2KISA 3S1RJ 4CCLA 1YJNI 3JW4A 3P9IA 4K2EA 4QPOA 3M9AA 4PCQA 3GTPJ 2WAQA 5HLHA 1FJLA 3CMEI 3WE3A 3F8BA 1PVEA 3EPZA 4Y3OA 4U0VA 1R23A 2DODA 4IHTA 1MNEA 2JVHA 2FRHA 2HOTA 3E6CC 3H9GA 4AYBA 5TRDA 4OU0A 1KGSA 2FMYA 2DFFA 2H6BA 4HX8A 1ETOA 2COBA 3LQRA 1ZK8A 1FSEA 3G3ZA 3NARA 4C30A 2KMUA 5CLSA 3JRHA 1VQ5I 3HUGB 2XC7A 1LPQA 2CQ7A 1JKOC 2QQAA 4JQFA 1FOXA 1XG1A 2MYSA 4M6YA 3ZXSA 1SMYF 2CO5A 2FSWA 4YIFA 4X0GA 3K9TA 2LTPA 2KHMA 2P7CB 2K7LA 1XSXA 4UVCA 4MFEA 3MWMA 4BEHB 1X1DA 3Q0UA 2XUBA 1KQ0A 1G3YA 3L7WA 3AL0C 1IO2A 5IP6A 3EUKL 1XD7A 4RS8A 4CA0A 4IRGA 3VEPA 1QZYA 2OPTA 5F27A 3C2BA 3L2CA 2O9LA 3BR0A 2JZYA 3B6AA 3P9CA 1MBHA 2NYXA 4XLAA 3RYRA 5BS6A 3RPUD 3ABMH 5F1JA 1HKSA 1HQCA 1PUEE 1FOKA 4LGWA 3OYGA 2DA3A 1BI2A 3HOWJ 4ITVA 4RAZA 2XGCA 2WA0A 4JX6A 2CW0F 5LHHA 1BOAA 4OIPF 2JA6J 1G2HA 4M9XA 4KUMA 3W2AA 3PNYA 4ZYGA 1K61A 4ETSA 3LWFA 4A0XA 5L3CA 1T6SA 5CQGA 4OINF 3H3UA 2LMDA 1Z05A 3HRSA 3P7NA 4HW0A 2ESNA 3CF2A 3M1CA 3W6JB 2Y2ZA 4Z2YA 3AL0B 2C6YA 3CMAI 3BG6A 5BOXA 3QRFF 2BY2A 2FU4A 4RB2C 4ZDOA 1ZRCA 1G4DA 2R93J 1IUFA 1K4SA 3GF2A 1HW1A 2EZIA 2W1OA 1O3TA 2DA5A 1NH3A 2R7QA 4I99C 3NWSA 2VQLA 4JYKA 4AWXB 1H9TA 2BW3A 2JA5J 3GCMA 1D5VA 4CO8A 4HF2A 1S7AA 3IRRA 5C44J 5DCMA 1HF0A 4U87A 2B0LA 4OIQF 4N4OB 4BHCA 4PJMA 1ETYA 4A3LJ 4HX7A 3M7GA 5GTIC 3FBIB 3OV8A 2MG4A 3OIPA 4P5OA 4XLNF 5HOOA 1L3LA 1MJ9A 1EH6A 3IH3A 1X3WB 2CU7A 2W48A 1ZR4A 3ZQLA 1W7PA 2M7BA 3I4MJ 2NS7A 2XIGA 3RTRA 1FOYA 2M5WA 1KONA 4G7HF 1E17A 1QA6A 4MIMA 1ZRDA 2Y48A 4IKFA 1SFKA 2BVLA 4ANJA 2IXSA 4U0WA 1I3QJ 1UG2A 2X48A 5DD4A 4KITB 2BE5F 3OWTA 4II3A 1JGSA 3I54A 4MHGA 3S3MA 3M3YJ 2HPIA 3FXOA 4BDYA 1USSA 1UZCA 3MKLA 1FWZA 4XQFA 5GADJ 5JLWA 1FLIA 3O6BB 1D8KA 3BZCA 5K7FA 3QYEA 4J01A 1GXQA 3H35A 1PYVA 4XRFA 1TWHJ 1ZG5A 5AIPA 2GA2A 4I0AA 1Z6TA 2ECCA 4H4KC 2GXBA 2RQQA 2VQHA 3CDIA 3DKXA 4CCNA 5EDNA 2ESHA 2DT7B 1NTCA 3K4MA 3ZQIA 3CD6I 2FD5A 4PSWA 3R4KA 1FC3A 3U1KA 4PJLA 5FKKA 4J19A 1NHAA 1JJ6C 1OCPA 5M3MJ 1MMDA 2KRCA 1SAUA 3H5NA 2CUZA 1Z21A 3JSOA 2JVGA 4MLOA 4OIRF 4WXDA 4RM3A 5TGTA 3N05A 2CV2A 3O8HA 2CQKA 4EEFG 4GRIA 2HXOA 4PUSA 1ZKGA 1BJAA 1OYIA 3WODF 1IDYA 1OKRA 4BGDA 3EYIA 3KYDB 1Y39A 3KIOA 3L1PA 1ZTRA 2VE8A 5LRSA 3CCEI 3A0HC 2BEOA 2DMQA 3CJTB 1ON2A 1A04A 4ON0A 4ENNA 9ANTA 2P6TA 2ZO4A 3DBLB 2R5YB 1HXDA 2X51A 2IGKA 3Q3SA 5FGMA 1XSVA 5LLQA 2JUCA 5E1ZB 5ICGA 4GO1A 2V9VA 2XB5A 2JPBA 4RGRA 1FYLA 3GX4X 4E7IA 5HLTA 3LFUA 2RV8A 3G1OA 2IGMA 3CCSI 2HEOA 5DUIA 2GWRA 4XR6A 4ESBA 3FXRA 5D4SA 1IG7A 2XRLA 3HUGA 1DP3A 2DTZA 3OYHA 1W4MA 4RBOA 3L00A 1ZAOA 2QKMB 2NXNB 4UNOA 3OYBA 1WSUA 4AIDA 2E2IJ 2WY7Q 1OMIA 2L54A 3OYFA 3S2DJ 4DW6A 4A0ZA 3DP7A 3OMYA 1X1BA 3F3XA 1JI8A 2MH9A 4EJVA 2GXGA 2LY1A 2XB0X 3CCMI 4Q5SF 4P1WA 2Z2SB 2A6EF 3V7CA 5J3LA 4DZPA 2DT5A 4AVPA 2CUJA 3LL7A 4DYRA 4PJJA 2YPRA 2CUFA 5IT9K 3HKZN 3CCQI 1RKWA 4CYDA 3BG7A 3OYAA 2Y9ZA 5E18F 4QSHA 2E2HJ 4D0PA 2OCEA 1TP4A 1R5GA 1V55H 2LBFB 4IZZA 4Y13A 2ELKA 2X9DA 3Q5FA 1ETKA 3I9V2 5JVGF 1JT0A 3SJMA 4HX4A 4RGUA 2P5KA 2DA7A 1ZN2A 1S5LC 4A3BJ 3I59B 2OCCH 2RREA 3IAM2 5CYVA 2VASA 3BZ6A 2EPFA 4UHTA 5E1XA 1LVKA 3CTAA 2A68F 4L9TA 2L5QA 3WG9A 5D5XB 1QZEA 1YJWI 5CVUA 1KU7A 1W5CC 2EWNA 3O8GA 3PSFA 4A3KJ 1I5ZA 1YS7A 1IW7F 2PQ8A 4UXNA 3F8NA 4B4CA 5A2QK 4XKCA 1A6QA 2H8WA 3ASOH 3S93A 4PGGA 1K83J 1TWGJ 3E7LA 4WX9A 2XASA 2Z99A 5DS9A 3GYHX 1JKQC 3MQ0A 3WTXC 1T95A 3KYCB 3IWFA 5IT3A 3L2QA 1J09A 2QQBA 3OYCA 3J7ZI 2ZNZA 5EYRA 1J7KA 2YU3A 3ABKH 3D0SA 1SANA 1UB9A 2DK5A 2EH3A 5EZGA 4HNTA 3OYDA 1E0EA 4RAGA 3VB2A 3EYYA 1AU7A 1ZH5A 1F1ZA 3GWZA 4PFPA 2A5YB 4A5NA 2LD5A 1T0FA 3JTGA 5DUKA 1WH5A 1XGOA 1P2FA 2BY3A 2B7EA 2CQXA 1B72A 2XAGA 5CVVA 3FK6A 2IT0A 3S1QJ 2VQCA 4A2UA 5FLXZ 3JAMK 4D7NA 3HRMA 1F36A 1ZRFA 1FNNA 3R0JA 2K9LA 2EIJH 2ZJPF 2E71A 1MDMB 3ZN0A 4FE4A 4BH9A 5KAIC 3BROA 3WGHA 3BCBA 3OYKA 2VT2A 1YIOA 4HPQA 2E7XA 3GTLJ 1FBQA 5LD2C 4KICA 2KIMA 3R61A 1VTNC 3ZGKA 3NEUA 2DA2A 3A4CA 2V1UA 4RLQA 4RB0A 1HBXG 3E5UA 1TLHB 4IEJA 1FIPA 5EJCA 2WV0A 3WTZA 5B3SH 1FZPB 1YW8A 4WWCA 4BQQA 4WK8F 1ZG1A 2ID3A 1U9NA 1W0UA 3I4PA 1FIAA 1R1UA 5GAHJ 3DFGA 1P4AA 4ZC3A 4V19K 2XF5A 5DTDA 1JTXA 4FETA 3G1LA 4NC8A 1POGA 2DQLA 4WXHA 3N97A 3QWLA 1USTA 3M07A 2G7HA 2CGPA 1YIJI 4NC6A 5IY5H 4NB5A 1R4NB 2OTLI 1QZZA 2R5YA 1F4KA 4DBRA 2JRTA 4C2UA 1FBUA 1LDJA 3V8LA 1IV8A 1WJEA 2W84A 2LG4A 3H9JA 3GFMA 5LEJA 4J00A 3CCUI 4RAYA 4B44A 3O3KA 1RR8C 5E1WA 2JT1A 1B9MA 5E8IA 4BE1A 3MZHA 3TL4X 3DF8A 1WJCA 3K4JA 5HDGA 1ETQA 3FBNB 1AOYA 3SQNA 2J5OA 3TP0A 1V5FA 4B43A 3JRBA 5EEGA 2YX4A 4F52A 4A3MJ 2ISZA 3HOZJ 2VL8A 3ZQGA 2P8TA 5L3BA 1XCBA 3G73A 3GZNB 4FQGA 1WJAA 3PFIA 3HPHA 4BDZA 1W36D 5TISC 4HF1A 3HC7A 2Z33A 2O8XA 3DKYA 3LSRA 4C3JJ 5DV5A 2ACJA 3FMRA 4AIJA 1XGNA 1FMWA 1D3YA 2L7MP 3BWGA 4L0YB 4A6DA 3DTKA 3OYLA 4I76A 5ED4A 2IRFG 5M5YJ 2FBKA 3OYJA 1QU3A 2R4GA 4B48A 4HAMA 3E6MA 5ILSA 2FOWA 1HW2A 1UG0A 3X2QH 2KIFA 3K4LA 3OYMA 1Z6RA 2W7NA 4ZYDA 2EZKA 2VT3A 3CCVI 2DA6A 3I56I 2JUGA 1DUXC 1XDSA 1FY7A 1BW5A 2LBFA 2LSOA 2XF7A 4ZDLA 2HQNA 4E7ZA 4ENMA 2R0QC 3K1MA 3K7AJ 2IBDA 3TBIA 1T56A 1LNWA 3E97A 2E1MC 3PSIA 1R71A 4XICA 3I59A 4B3XA 4XSZF 2IEKA 5GAEJ 1TL8A 2DMPA 2VIXA 2WADA 1QPIA 2OA4A 1XMKA 1AA7A 2DBBA 3OYNA 1B4AA 4IOCF 3SDBA 4HBLA 3HRUA 1ONVA 1KQ8A 2VLAA 1LJ9A 4HNVA 4GYGA 3VOEA 2LLKA 2PEXA 1OCZH 2ZMEC 3ZQ7A 3GLLA 3JRFA 2L7ZA 4A3DJ 1IRGA 3H3VK 1DPUA 1WHUA 2ME6A 5HS8A 1R36A 1Y56A 3RI4A 2M30A 2QCOA 2MC3A 2L02A 2QA4I 1MNDA 3IKTA 2EZHA 3KZIC 1QVUA 1GXPA 4G6TB 3RPUA 4X1EA 4XOPA 4HF0A 3ZMVA 4M3DA 3BQYA 3E1SA 1Z77A 2QKLB 4CYCB 3FHZA 2W00A 3H92A 4EATA 3CDHA 4N0BA 2GQQA 4BACA 1MBKA 3F8MA 4BXFA 3SEQA 1MBEA 1YOVB 4BQNA 2Y31A 3J80K 1Z7UA 2HPMA 2EV6A 3L09A 1G3SA 4F93B 4CSWA 5E79C 2ZMEB 3CDLA 2KRFA 4I0BA 1PJRA 4HLXA 3L2RA 2IA2A 2LC2A 4BBSJ 2EJRA 2Y75A 2OJED 4L9JA 2A5WA 5EGOB 3L2WA 3A2KA 3CESA 2Q0OA 2BXZA 4HOBA 4XLHA 4YFXF 1R5HA 5HVQC 1BBYA 3OSFA 1I39A 5DDGA 2KDOA 2VKDA 4F55A 1FSHA 1WH7A 1STZA 2X6WA 2CV0A 2RGVA 1MDMA 2X1EA 2PG4A 3MZYA 4QIWN 4DOZA 5KK1A 2PMZN 2JA7J 4ABZA 2NNNA 4KISA 2I8DA 3FWEA 3BR6A 1KU2A 4O3MA 4JX5A 4LIVA 4ZH4F 1TWFJ 1RI7A 2GOMA 1IZ1A 4L5EA 3VFZA 1WJFA 3F0CA 3JSPA 3F6OA 4E7KA 1UFMA 2EK5A 5IYCJ 3KLOA 3DCFA 2CRGA 3A03A 2HDDA 4G9YA 4XM3A 4XRSA 2XAJA 2JQ7A 3ZQQA 5F0FA 4ZJZA 5EEHA 1V3FA 4HV6A 4PDKA 2JTVA 2EINH 4DJAA 4UUSB 3JRCA 2VPLA 2FX0A 2VE9A 4EM1A 3MZ8A 1ZHFA 4A6EA 3Q0VA 3HOXJ 2WAFA 5LFAA 1ODDA 1MKMA 1QNTA 3ELKA 3RQIA 3A02A 4BS9A 3RKYA 1SFEA 1Q1HA 3S16J 3REOA 4UVAA 1FP2A 1A31A 2WWYA 2EFWA 2PJRB 2W85A 1VQMI 2A3SA 5FJ8J 2KRHA 2H6CA 4D7MA 2VONA 2ZFWA 4G7OF 1WI3A 2HVSA 3VSLA 2JN6A 1K6OA 4RAFA 1WGXA 2QQ9A 2ZXIA 3L2VA 1BW6A 4LG0B 4G6QA 3CLQA 2BZTA 4NQWB 1X3ZB 2VPRA 1PDNC 1YX5A 4IL6C 2KL4A 4LOCA 3DLLF 2AS5F 4UUTA 3ROUA 3DPTA 2V79A 1MSFC 3BTCA 2Y0SN 1PP7U 1BJZA 2EFQA 4RLFA 4GCVA 4YIRX 3GTQJ 2ZJ2A 4UVBA 3AG3H 1LEBA 2CQQA 1D1CA 3B02A 2KZGA 3PL8A 1Y1VJ 2X4HA 4PK4A 1ETVA 3CUQC 1F43A 4E7SA 2HDWA 1W36C 2OD5A 4UV9A 4MQVA 2JA2A 1FTZA 2HVRA 4XRMA 3SZGA 5FB2A 3E3VA 2NVYJ 2NVXJ 1N78A 2IVMA 3ERED 2L0KA 1ZGJA 2GXAA 1APLC 2BBYA 1XGSA 2IS6A 1J59A 3BR5A 2AQFA 1J75A 2FBIA 1O7FA 1VQPI 3F6VA 1UCRA 3PIPF 1TT5B 2HVQA 3H5AA 3ZP5A 1U78A 2H1KA 3U1DA 1VQOI 1R22A 3RZOJ 1HC8A 3K70D 4HSTA 2RQPA 3L2UA 5LRRA 3OR2C 3CUQB 1YX3A 3GMEA 3H3ZA 4QLCU 4EJUA 1ITYA 5HDNA 4RB3C 3FM5A 3OYEA 2ZJRF 4ZZDA 4EJWA 3ERMA 3GTOJ 1UAAA 4M6XA 1KZHA 2HQ5A 1JUPA 3H1CA 2IS4A 1WCMJ 2LDUA 1QBJA 2HOEA 1OJLA 2VBXA 2GLOA 2FQ3A 4IRHA 2A6TA 2EV5A 2DN0A 2QM3A 1WJDA 4HV5A 4XN3A 1ZG3A 2PN6A 2D5VA 3VYSB 4HNUA 2FNAA 1TQPA 2M7AA 3OS1A 1RZ4A 2ISYA 4PJNA 1JKPC 2MH2A 3DTEA 1Y6IA 2MA3A 5FKMA 3I71A 1IAWA 2ID6A 2K85A 4CYCA 4HDUA 2JWTA 2X1DA 2IAIA 5FKLA 2TDXA 1YHQI 2M4KA 2HWVA 2R7FA 2DPDA 2XHKA 4HYEA 3I5UA 1N75A 2ZMEA 4N9HA 1ETXA 3ABLH 2VB6A 1Z91A 1B1BA 3IRQA 4XN0A 2AQEA 2LKSA 2MD5A 1AKHB 5CQEA 4M73A 5IOZA 5EGOA 2HYJA 1B72B 4BQAA 2V7FA 2O3FA 1S29A 2HS5A 3IWZA 4I6ZA 4A12A 1ZELA 5E17F 3D5RC 1W5SA 3V8JA 3JREA 4Y52J 4PZJA 2FOKA 2K5CA 2X1CA 3HZJA 1ORKA 2JPCA 2NAZA 1IN6A 2Q8KA 5JHFA 2GA1A 4Y33A 1EH8A 4XKVA 4MEXF 3FXQA 4NC7A 5E20A 4A0YA 4C3IJ 2ELHA 2MGQA 1VQ7I 1SMTA 5DM6F 5IT9Z 4AM3A
chains in the Genus database with same CATH topology
2O6GE 2W25A 1FYKA 3FX3A 1YFHA 3F8CA 4M9SA 1MD0A 2H09A 3FZVA 2VBWA 1TNSA 1U6GA 1F5TA 5BQTA 1IRFA 1YW9A 4G8XA 2LF7A 5A2QZ 1UHMA 4IHSA 1ZARA 4P55A 5FFZA 1T39A 3BP8A 4LG0A 2KIUA 4NQWA 1REPC 3GLXA 1P4XA 5LGNA 4RGSA 2EFNA 1CGPA 1LDDA 2QWWA 2IW5A 3KEOA 3WU1B 3IL2A 4Q47A 2V1XA 4IVNA 2A61A 1MGTA 1QQIA 4IPAA 1YTYA 2CWEA 4I01A 3MAJA 2CSOA 3I58A 2LF8A 3T8RA 4TV7A 2W57A 1OPCA 3JAMZ 5F1RA 2R3SA 2ETHA 3V7SA 1MJBA 2V6CA 4Y17A 1H9GA 2KKOA 4KN7X 2IA1A 1JE8A 3I0TA 2ZXJA 3T8TA 3CUQA 4Q4ZF 3GFJA 1W7PD 5LEKA 3R6SA 4KDPA 1ZGAA 3IHUA 3LFKA 3LAPA 4MTEA 4ASNA 3HSFA 5J8FA 2G9WA 4L5IA 4FHTA 5HDKA 3GZ6A 3U9GA 2LKPA 5K5OA 4OOIA 3Q9SA 4Y15A 3EETA 4XSXF 3RPQA 1IXRC 3DXJF 5BMZA 3PQJA 2F5EA 3D5LA 3GXOA 2HDCA 2VBZA 1G3WA 2UZKA 3KP3A 2XKPA 2PFBA 2EV0A 2FMLA 3DQVC 3LSTA 5D5WB 3MFKA 1W5TA 3QU6A 3I53A 1IN5A 3V4GA 1RNLA 5TJJA 1J5YA 2KJBA 1T2KA 4BHBA 2K02A 1YYVA 1CF7B 4ESFA 5CVIA 2QLZA 2E7WA 3ZPLA 2YX7A 4MTDA 1DP7P 3TDUC 2FE3A 2HTJA 2DQRA 4I98B 5ICCA 2XGXA 4WF2A 2LNBA 1XGMA 1Z1DA 3K69A 4IXAA 2MBFA 3DPLC 3RKXA 4ZZLA 3OOPA 1KA8A 5D8LB 2VN2A 2K86A 4YG2F 2EFPA 2ZNYA 5D6FA 3ZMZA 1O57A 1TTYA 2UXNA 2IA0A 2DPUA 3KZZA 3HOTA 3M1EA 1O3SA 2ZBKA 4MNUA 1TNTA 1SD6A 1WKMA 4P9FA 2XV4S 1TQIA 3C18A 1T38A 4O5VA 3WGIA 3WGGA 1QO0D 3CLOA 2DK8A 2PLYA 2EB7A 4KA4A 4HQMA 3T5XA 2FA5A 1KYWA 3HOSA 4LK0F 4L9NA 4R79A 2HFHA 3MCZA 4G6DA 4GGGA 2PMHA 4P96A 5L3GA 3COAC 3F8FA 5J6XA 1YG2A 3VODA 1ON1A 2L4AA 1FP1D 4HDVA 1K79A 4S05A 1HKQA 2W24A 2GIVA 5K5RA 1YO5C 3P9KA 3FXUA 2P7VB 2AXLA 3IC7A 1PP8F 2DW4A 4KMFA 1MZBA 1U5TC 3J81K 2MLKA 1OR7A 4LLGF 4HQEA 3T1BA 3O2PE 2M1BA 1HW5A 4RGXA 3DKWA 1WQ2A 1TBXA 2QUFA 2P4WA 3E5QA 3ZN1A 1ZYRF 3PQKA 4JK1X 4ZYEA 4AD9A 3WTVC 2DLLA 1U3EM 3HSEA 3RYPA 5ILVA 1FPQA 4FX4A 1U5TB 1FT9A 2FEZA 5BPIA 1HSTA 4BNCA 2QVOA 4EJOA 1BM9A 3SFZA 4L9VA 5HLGA 4UV8A 1P6RA 4S04A 2Z9OA 2VOOA 1R00A 2QENA 3CO7C 4CGZA 4GXOA 2EA4A 4UUVA 3U2RA 2IPQX 5HS7A 3TOAA 3ZMTA 3IKVA 3GFIA 1FX7A 4KMUX 5H6QA 1CF7A 2MLGA 1J9IA 2HTSA 4EVIA 3LA3A 1SD5A 4NHJA 4H0EA 4I09A 4EV0A 3C7JA 4EMSA 1I1SA 4LK1F 1B59A 2L4MA 3DEUA 2XKOA 3K1NA 5AIQA 1R7JA 5JI6A 4LJZF 4A5MA 2QYOA 5KVRA 2A07F 4EJTA 3BY6A 5F64A 5JFRA 3HIFA 3ECOA 4EM2A 1K7AA 3WE2A 4KIGA 3HRTA 3KLNA 3KZYA 4YFNF 1IN7A 1J0RA 4WXCA 1IXCA 2OZUA 3LA2A 2VOPA 2G7UA 2O0YA 2XROA 2NS0A 2OBPA 3KEQA 4L18B 1U2WA 3CJNA 3GVAA 4P9UA 2CG4A 1AWCA 3ECHA 1LDKB 1Z9CA 1S6LA 5CVJA 4L5JA 3BJOA 2WTEA 5D5VB 2HYGD 1GVJA 2HYFA 2R7DA 5HS9A 4B8XA 3E6BA 1O3RA 1BN5A 2F5FA 3R60A 1L0OC 2DFIA 1BI3A 3ZMSA 3RDIA 2OAZA 3BJAA 5JHUA 4KYWA 3K2ZA 4KNYA 2DAOA 3M8FA 4BAYA 1WI9A 2IP2A 2K4JA 2ADUA 3FMSA 1I1GA 1SD4A 1R58A 1ZLKA 2OQRA 1EH7A 3QP6A 2RNJA 4BYYA 3GUDA 1O3QA 5FFXA 1I27A 2H94A 5D5UB 4U88A 3C3WA 3RIRA 1IN4A 2RDPA 2QBYB 2XRNA 3KP5A 5E8GA 3B73A 1LB2A 2QZ8A 1SD7A 5FD5A 3QPHA 2D1HA 4YIIA 4ENJA 2HZTA 4HLYA 2F2EA 3C1DA 3FM3A 2DI3A 4M9ZA 3GO5A 3E6DA 4YFKF 2NNYA 1U5TA 2OQGA 1RIOH 3BDDA 2VBYA 4KIBA 1HSJA 2F5CA 3F23A 2PJPA 3KETA 2HKOA 4I02A 1FBSA 2H27A 1LQ1A 1QGPA 1BC7C 2EFOA 3FMQA 1S8NA 1TW3A 3HHHA 2VODA 2CFXA 2E1NA 3TOBA 3EQLF 2RC4A 3TO9A 5L3EA 5AONA 2M8EA 1UHWA 2DO7A 2L3DA 2O03A 1WWXA 4M72A 4CICA 3TGNA 1T98A 1XN7A 2Y0MA 1G6NA 4U7BA 3T0YA 3HTSB 3V8KA 3WTUC 5L3DA 1JXSA 3WTYC 3LQQA 4LMYA 1QPMA 3FF5A 2A69F 3ML6A 3ZMUA 5CJ9A 5DYMA 1YW7A 4CZZA 5CVRA 5ERIA 2STWA 2HKXA 5ILUA 5LHGA 3KP6A 1EV7A 1WRJA 1K78B 3ABUA 3QPTA 4Q48A 2O61A 4ZYHA 1IF1A 4LLLA 3K1PA 2STTA 2M87A 1F9NA 3TKYA 1IN8A 3AAFA 5H20A 2JSCA 1J2XA 1DPRA 4LB5A 1BI1A 2GAUA 2P5VA 3ABTA 3F22A 2YSRA 3SZTA 4ESJA 2P6SA 1S3JA 4R1HA 3SZPA 3HTUA 4LFUA 4OIOF 1SFUA 1IUYA 4KFCA 1RUNA 2QBYA 1KU9A 3GEZA 2BGCA 5BPDA 2A6HF 4QWQA 3J7AO 4M71A 2COMA 5JR3A 1TW2A 2Z5UA 5LHIA 4KN4X 1P92A 2K4BA 5F6FA 2M45A 1XDUA 5D4RA 2L01A 1B9NA 3KP2A 2PI0A 2RKHA 1DDNA 2DTRA 2KJCA 3K0LA 5DEQA 2YR2A 4MGRA 1X3UA 5H6RA 1P4WA 2Q2EA 3GW2A 5K5QA 3RKWA 3HHGA 1BIAA 3R0AA 4IRIA 2WC2A 4LLNA 1XSDA 4HZFA 5JVTA 2EA2A 2BYVE 4PGHA 1XB4A 4EGZA 2GZWA 1XCVA 4XLPF 2D2WA 1E2XA 3Q9VA 1FYMA 4XBFA 3WTSC 5LGUA 1KU3A 1C0WA 2FXAA 2RVCA 4KT5C 1BC8C 3BPVA 2PMUA 2DU9A 4OMZA 1OYYA 5K1YA 2UWMA 4FX0A 4BXUA 4LD5A 2FNPA 3GFLA 3EUHA 1HKTA 2XAQA 3NQOA 2E1CA 2D45A 3J81Z 3HSRA 4EQQA 3WTTC 1MJAA 2OU2A 2X0LA 4HA8A 2VXZA 5LBQA 1YQAA 4AIHA 4L0ZB 3RJPA 4KIFA 3KE2A 3QP5A 3TO7A 3V7RA 1G3TA 3JTHA 2CYYA 4RB1A 2NRAC 1LVAA 1S7OA 1I6XA 1TQMA 3TQNA 3BJ6A 2J5PA 1O7LA 4I7HA 2BV6A 5DCFA 1K78A 3J80Z 4ENKA 1GHCA 3TDZC 2VC0A 4M74A 4FT8A 4GYIA 5FD6A 5FLXK 2ZCWA 3TO6A 1D8JA 3GZ5A 4U0YA 5ICEA 3KP7A 5LGTA 2PBIA 3HYIA 1XMAA 3QU3A 3W6KB 1YLFA 5D8KB 1ZLJA 1JHFA 4IF4A 3L9FA 3EDPA 5J8CA 3M8EA 5HLIA 3N4MA 2D1VA 1R1TA 4DQ2A 1ZREA 2RN7A 1H0MA 2ZKZA 3BPXA 5FO5A 3BOQA 1JHHA 1V4RA 3CO6C 2XVCA 2K27A 2FF4A 1LEAA 2OZ6A 3ISPA 4E70A 1U8RA 1RUOA 2P5LC 2VC1A 4EGYA 3I64A 2XAFA 5DCMB 3KFWX 3WU0A 4N9IA 1BIBA 3MEXA 3WTWC 3ULQB 4O6JA 1IXSB 3F72A 4OMYA 1BI0A 4R8HA 2UXXA 2FBHA 4LB6B 1W7PB 5L3FA 4AIKA 5DD8A 4BHPA 4B09A 3KP4A 4MEYF 2HGCA 1KYZA 4G94A 3CUOA 3DV8A 3S2WA 4G7ZF 6PAXA 2V1DA 3QAHA 3ZMDA 3LAJA 4DNCA 1ULYA 1SAXA 2F5DA 1OYWA 3NRVA 4MQ9F 5D6EA 4IJAA 4U7DA 4CHUA 3E5XA 2HR3A 3KCCA 5ICFA 1KQ9A 2XAHA 3QOPA 2IJLA 4EM0B 4CDGA 4CXFA 1SFXA 1B6AA 4JBAA 1R1VA 1Y0UA 2Z3YA 3F21A 3SHFA 4I2OA 3LA7A 4F7ZA 3SXYA 1YS6A 2HQRA 4WCGA 3JW4A 3P9IA 4K2EA 3M9AA 4PCQA 5HLHA 3WE3A 3F8BA 4U0VA 1R23A 4IHTA 2FRHA 3E6CC 5TRDA 4OU0A 1KGSA 2FMYA 2H6BA 4HX8A 3LQRA 1FSEA 3G3ZA 5CLSA 2QQAA 4JQFA 4M6YA 1SMYF 2CO5A 2FSWA 4YIFA 3K9TA 2P7CB 2K7LA 1XSXA 4UVCA 3MWMA 2XUBA 1KQ0A 1G3YA 3L7WA 1XD7A 4RS8A 4IRGA 3VEPA 1QZYA 3L2CA 2JZYA 3P9CA 2NYXA 3RYRA 5BS6A 1HKSA 1HQCA 1PUEE 1FOKA 4LGWA 1BI2A 4RAZA 2CW0F 5LHHA 1BOAA 4OIPF 4M9XA 4KUMA 4ZYGA 4ETSA 3LWFA 4A0XA 5L3CA 1T6SA 4OINF 3H3UA 3P7NA 1Z05A 3HRSA 4HW0A 2ESNA 3W6JB 4Z2YA 2C6YA 5BOXA 3QRFF 2FU4A 4RB2C 1ZRCA 1G4DA 3GF2A 1HW1A 1O3TA 4AWXB 1H9TA 1D5VA 4CO8A 4HF2A 1S7AA 3IRRA 5DCMA 2B0LA 4OIQF 4BHCA 4HX7A 3M7GA 4P5OA 3OV8A 4XLNF 5HOOA 1L3LA 1MJ9A 1EH6A 1W7PA 2XIGA 3RTRA 2M5WA 4G7HF 1E17A 1ZRDA 2Y48A 4U0WA 5DD4A 2BE5F 1JGSA 3I54A 4MHGA 1USSA 1FWZA 1FLIA 3O6BB 1D8KA 1GXQA 4XRFA 1ZG5A 5AIPA 2GA2A 4I0AA 1Z6TA 2GXBA 2ESHA 3R4KA 1FC3A 1NHAA 3JSOA 4OIRF 4WXDA 2CQKA 1BJAA 1OYIA 3WODF 1OKRA 3EYIA 2VE8A 5LRSA 2BEOA 1ON2A 1A04A 4ON0A 4ENNA 2P6TA 2ZO4A 1HXDA 5FGMA 1XSVA 5LLQA 5E1ZB 5ICGA 4GO1A 2V9VA 2JPBA 4RGRA 1FYLA 3GX4X 2RV8A 2HEOA 5DUIA 2GWRA 4ESBA 3FXRA 5D4SA 3HUGA 1W4MA 3L00A 1ZAOA 4UNOA 1WSUA 1OMIA 2L54A 4A0ZA 3DP7A 3F3XA 2MH9A 4EJVA 2GXGA 4Q5SF 2A6EF 3V7CA 2DT5A 4AVPA 2YPRA 5IT9K 4CYDA 5E18F 4D0PA 1R5GA 4Y13A 3Q5FA 4HX4A 4RGUA 2P5KA 1ZN2A 3I59B 5CYVA 3BZ6A 4UHTA 5E1XA 3CTAA 2A68F 4L9TA 3WG9A 5D5XB 5CVUA 1KU7A 2EWNA 1I5ZA 1YS7A 1IW7F 2PQ8A 4UXNA 3F8NA 5A2QK 4PGGA 4WX9A 2XASA 2Z99A 3GYHX 3MQ0A 3WTXC 3IWFA 5IT3A 2QQBA 2ZNZA 1J7KA 2YU3A 3D0SA 1UB9A 2DK5A 3VB2A 3EYYA 1ZH5A 1F1ZA 3GWZA 4A5NA 2A5YB 1T0FA 3JTGA 5DUKA 1XGOA 1P2FA 2XAGA 5CVVA 2IT0A 4A2UA 5FLXZ 3JAMK 3HRMA 1ZRFA 1FNNA 3R0JA 1MDMB 3ZN0A 4BH9A 3BROA 3WGHA 2VT2A 1YIOA 2E7XA 1FBQA 4KICA 2KIMA 3R61A 1VTNC 3NEUA 2V1UA 4RB0A 1HBXG 3E5UA 1TLHB 2WV0A 3WTZA 1FZPB 1YW8A 4WWCA 4WK8F 1ZG1A 3I4PA 1R1UA 3DFGA 1P4AA 2DQLA 4WXHA 3N97A 1USTA 2G7HA 2CGPA 4NB5A 1QZZA 1F4KA 2JRTA 1FBUA 1LDJA 3V8LA 2W84A 3GFMA 5LEJA 4RAYA 3O3KA 5E1WA 2JT1A 1B9MA 5E8IA 3MZHA 3DF8A 5HDGA 1AOYA 3SQNA 2J5OA 5EEGA 2YX4A 2ISZA 5L3BA 2P8TA 1XCBA 3G73A 3PFIA 4HF1A 2Z33A 2O8XA 5DV5A 2ACJA 3FMRA 4AIJA 1XGNA 1D3YA 4L0YB 3BWGA 4A6DA 5ED4A 2IRFG 2FBKA 4HAMA 3E6MA 5ILSA 1HW2A 2KIFA 1Z6RA 4ZYDA 2VT3A 1DUXC 1XDSA 1FY7A 2LSOA 2HQNA 4ENMA 3K1MA 1LNWA 3E97A 3I59A 4XSZF 2OA4A 1XMKA 2DBBA 1B4AA 4HBLA 3HRUA 1ONVA 1KQ8A 1LJ9A 4GYGA 3VOEA 2PEXA 3ZQ7A 1IRGA 1DPUA 5HS8A 1R36A 3RI4A 2M30A 2MC3A 2L02A 3IKTA 1GXPA 3RPUA 4HF0A 3ZMVA 3FHZA 3H92A 3CDHA 4N0BA 2GQQA 3F8MA 3J80K 1Z7UA 2EV6A 3L09A 1G3SA 2ZMEB 2KRFA 4I0BA 4HLXA 2IA2A 2EJRA 2Y75A 4L9JA 2Q0OA 4HOBA 4YFXF 1R5HA 5HVQC 1BBYA 5DDGA 1FSHA 1STZA 2RGVA 1MDMA 2PG4A 3MZYA 5KK1A 2NNNA 3FWEA 1KU2A 4O3MA 4ZH4F 1RI7A 1IZ1A 3VFZA 3JSPA 3F6OA 1UFMA 2EK5A 3KLOA 4G9YA 2XAJA 5EEHA 1V3FA 4HV6A 4PDKA 2JTVA 2VE9A 4EM1A 1ZHFA 4A6EA 1ODDA 1MKMA 1QNTA 3ELKA 3RKYA 1SFEA 1Q1HA 3REOA 4UVAA 1FP2A 2WWYA 2EFWA 2W85A 2A3SA 2H6CA 2VONA 2ZFWA 4G7OF 1K6OA 2QQ9A 4LG0B 4G6QA 1PDNC 2AS5F 3ROUA 3DPTA 2V79A 1PP7U 2EFQA 4GCVA 2ZJ2A 4UVBA 1LEBA 3B02A 2X4HA 3CUQC 2OD5A 4UV9A 4MQVA 5FB2A 3E3VA 2IVMA 3ERED 1ZGJA 2BBYA 1XGSA 1J59A 1J75A 2FBIA 1O7FA 3F6VA 1UCRA 3ZP5A 1U78A 3U1DA 1R22A 2RQPA 5LRRA 3CUQB 3H3ZA 4QLCU 4EJUA 5HDNA 4RB3C 3FM5A 4ZZDA 4EJWA 4M6XA 2LDUA 1QBJA 2HOEA 2VBXA 2FQ3A 4IRHA 2EV5A 2QM3A 4HV5A 1ZG3A 2PN6A 2FNAA 1TQPA 1RZ4A 2ISYA 2MH2A 2MA3A 3I71A 1IAWA 4HDUA 2TDXA 2HWVA 2R7FA 2DPDA 2XHKA 4HYEA 3I5UA 2ZMEA 4N9HA 1Z91A 1B1BA 3IRQA 2MD5A 4M73A 4BQAA 2O3FA 1S29A 2HS5A 3IWZA 4A12A 5E17F 1W5SA 3V8JA 4PZJA 2FOKA 2JPCA 2NAZA 1IN6A 2Q8KA 2GA1A 1EH8A 4MEXF 3FXQA 4A0YA 5E20A 2ELHA 1SMTA 5IT9Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6G E;  2W25 A;  1FYK A;  3FX3 A;  1YFH A;  3F8C A;  4M9S A;  1MD0 A;  2H09 A;  3FZV A;  2VBW A;  1TNS A;  1U6G A;  1F5T A;  5BQT A;  1IRF A;  1YW9 A;  4G8X A;  2LF7 A;  5A2Q Z;  1UHM A;  4IHS A;  1ZAR A;  4P55 A;  5FFZ A;  1T39 A;  3BP8 A;  4LG0 A;  2KIU A;  4NQW A;  1REP C;  3GLX A;  1P4X A;  5LGN A;  4RGS A;  2EFN A;  1CGP A;  1LDD A;  2QWW A;  2IW5 A;  3KEO A;  3WU1 B;  3IL2 A;  4Q47 A;  2V1X A;  4IVN A;  2A61 A;  1MGT A;  1QQI A;  4IPA A;  1YTY A;  2CWE A;  4I01 A;  3MAJ A;  2CSO A;  3I58 A;  2LF8 A;  3T8R A;  4TV7 A;  2W57 A;  1OPC A;  3JAM Z;  5F1R A;  2R3S A;  2ETH A;  3V7S A;  1MJB A;  2V6C A;  4Y17 A;  1H9G A;  2KKO A;  4KN7 X;  2IA1 A;  1JE8 A;  3I0T A;  2ZXJ A;  3T8T A;  3CUQ A;  4Q4Z F;  3GFJ A;  1W7P D;  5LEK A;  3R6S A;  4KDP A;  1ZGA A;  3IHU A;  3LFK A;  3LAP A;  4MTE A;  4ASN A;  3HSF A;  5J8F A;  2G9W A;  4L5I A;  4FHT A;  5HDK A;  3GZ6 A;  3U9G A;  2LKP A;  5K5O A;  4OOI A;  3Q9S A;  4Y15 A;  3EET A;  4XSX F;  3RPQ A;  1IXR C;  3DXJ F;  5BMZ A;  3PQJ A;  2F5E A;  3D5L A;  3GXO A;  2HDC A;  2VBZ A;  1G3W A;  2UZK A;  3KP3 A;  2XKP A;  2PFB A;  2EV0 A;  2FML A;  3DQV C;  3LST A;  5D5W B;  3MFK A;  1W5T A;  3QU6 A;  3I53 A;  1IN5 A;  3V4G A;  1RNL A;  5TJJ A;  1J5Y A;  2KJB A;  1T2K A;  4BHB A;  2K02 A;  1YYV A;  1CF7 B;  4ESF A;  5CVI A;  2QLZ A;  2E7W A;  3ZPL A;  2YX7 A;  4MTD A;  1DP7 P;  3TDU C;  2FE3 A;  2HTJ A;  2DQR A;  4I98 B;  5ICC A;  2XGX A;  4WF2 A;  2LNB A;  1XGM A;  1Z1D A;  3K69 A;  4IXA A;  2MBF A;  3DPL C;  3RKX A;  4ZZL A;  3OOP A;  1KA8 A;  5D8L B;  2VN2 A;  2K86 A;  4YG2 F;  2EFP A;  2ZNY A;  5D6F A;  3ZMZ A;  1O57 A;  1TTY A;  2UXN A;  2IA0 A;  2DPU A;  3KZZ A;  3HOT A;  3M1E A;  1O3S A;  2ZBK A;  4MNU A;  1TNT A;  1SD6 A;  1WKM A;  4P9F A;  2XV4 S;  1TQI A;  3C18 A;  1T38 A;  4O5V A;  3WGI A;  3WGG A;  1QO0 D;  3CLO A;  2DK8 A;  2PLY A;  2EB7 A;  4KA4 A;  4HQM A;  3T5X A;  2FA5 A;  1KYW A;  3HOS A;  4LK0 F;  4L9N A;  4R79 A;  2HFH A;  3MCZ A;  4G6D A;  4GGG A;  2PMH A;  4P96 A;  5L3G A;  3COA C;  3F8F A;  5J6X A;  1YG2 A;  3VOD A;  1ON1 A;  2L4A A;  1FP1 D;  4HDV A;  1K79 A;  4S05 A;  1HKQ A;  2W24 A;  2GIV A;  5K5R A;  1YO5 C;  3P9K A;  3FXU A;  2P7V B;  2AXL A;  3IC7 A;  1PP8 F;  2DW4 A;  4KMF A;  1MZB A;  1U5T C;  3J81 K;  2MLK A;  1OR7 A;  4LLG F;  4HQE A;  3T1B A;  3O2P E;  2M1B A;  1HW5 A;  4RGX A;  3DKW A;  1WQ2 A;  1TBX A;  2QUF A;  2P4W A;  3E5Q A;  3ZN1 A;  1ZYR F;  3PQK A;  4JK1 X;  4ZYE A;  4AD9 A;  3WTV C;  2DLL A;  1U3E M;  3HSE A;  3RYP A;  5ILV A;  1FPQ A;  4FX4 A;  1U5T B;  1FT9 A;  2FEZ A;  5BPI A;  1HST A;  4BNC A;  2QVO A;  4EJO A;  1BM9 A;  3SFZ A;  4L9V A;  5HLG A;  4UV8 A;  1P6R A;  4S04 A;  2Z9O A;  2VOO A;  1R00 A;  2QEN A;  3CO7 C;  4CGZ A;  4GXO A;  2EA4 A;  4UUV A;  3U2R A;  2IPQ X;  5HS7 A;  3TOA A;  3ZMT A;  3IKV A;  3GFI A;  1FX7 A;  4KMU X;  5H6Q A;  1CF7 A;  2MLG A;  1J9I A;  2HTS A;  4EVI A;  3LA3 A;  1SD5 A;  4NHJ A;  4H0E A;  4I09 A;  4EV0 A;  3C7J A;  4EMS A;  1I1S A;  4LK1 F;  1B59 A;  2L4M A;  3DEU A;  2XKO A;  3K1N A;  5AIQ A;  1R7J A;  5JI6 A;  4LJZ F;  4A5M A;  2QYO A;  5KVR A;  2A07 F;  4EJT A;  3BY6 A;  5F64 A;  5JFR A;  3HIF A;  3ECO A;  4EM2 A;  1K7A A;  3WE2 A;  4KIG A;  3HRT A;  3KLN A;  3KZY A;  4YFN F;  1IN7 A;  1J0R A;  4WXC A;  1IXC A;  2OZU A;  3LA2 A;  2VOP A;  2G7U A;  2O0Y A;  2XRO A;  2NS0 A;  2OBP A;  3KEQ A;  4L18 B;  1U2W A;  3CJN A;  3GVA A;  4P9U A;  2CG4 A;  1AWC A;  3ECH A;  1LDK B;  1Z9C A;  1S6L A;  5CVJ A;  4L5J A;  3BJO A;  2WTE A;  5D5V B;  2HYG D;  1GVJ A;  2HYF A;  2R7D A;  5HS9 A;  4B8X A;  3E6B A;  1O3R A;  1BN5 A;  2F5F A;  3R60 A;  1L0O C;  2DFI A;  1BI3 A;  3ZMS A;  3RDI A;  2OAZ A;  3BJA A;  5JHU A;  4KYW A;  3K2Z A;  4KNY A;  2DAO A;  3M8F A;  4BAY A;  1WI9 A;  2IP2 A;  2K4J A;  2ADU A;  3FMS A;  1I1G A;  1SD4 A;  1R58 A;  1ZLK A;  2OQR A;  1EH7 A;  3QP6 A;  2RNJ A;  4BYY A;  3GUD A;  1O3Q A;  5FFX A;  1I27 A;  2H94 A;  5D5U B;  4U88 A;  3C3W A;  3RIR A;  1IN4 A;  2RDP A;  2QBY B;  2XRN A;  3KP5 A;  5E8G A;  3B73 A;  1LB2 A;  2QZ8 A;  1SD7 A;  5FD5 A;  3QPH A;  2D1H A;  4YII A;  4ENJ A;  2HZT A;  4HLY A;  2F2E A;  3C1D A;  3FM3 A;  2DI3 A;  4M9Z A;  3GO5 A;  3E6D A;  4YFK F;  2NNY A;  1U5T A;  2OQG A;  1RIO H;  3BDD A;  2VBY A;  4KIB A;  1HSJ A;  2F5C A;  3F23 A;  2PJP A;  3KET A;  2HKO A;  4I02 A;  1FBS A;  2H27 A;  1LQ1 A;  1QGP A;  1BC7 C;  2EFO A;  3FMQ A;  1S8N A;  1TW3 A;  3HHH A;  2VOD A;  2CFX A;  2E1N A;  3TOB A;  3EQL F;  2RC4 A;  3TO9 A;  5L3E A;  5AON A;  2M8E A;  1UHW A;  2DO7 A;  2L3D A;  2O03 A;  1WWX A;  4M72 A;  4CIC A;  3TGN A;  1T98 A;  1XN7 A;  2Y0M A;  1G6N A;  4U7B A;  3T0Y A;  3HTS B;  3V8K A;  3WTU C;  5L3D A;  1JXS A;  3WTY C;  3LQQ A;  4LMY A;  1QPM A;  3FF5 A;  2A69 F;  3ML6 A;  3ZMU A;  5CJ9 A;  5DYM A;  1YW7 A;  4CZZ A;  5CVR A;  5ERI A;  2STW A;  2HKX A;  5ILU A;  5LHG A;  3KP6 A;  1EV7 A;  1WRJ A;  1K78 B;  3ABU A;  3QPT A;  4Q48 A;  2O61 A;  4ZYH A;  1IF1 A;  4LLL A;  3K1P A;  2STT A;  2M87 A;  1F9N A;  3TKY A;  1IN8 A;  3AAF A;  5H20 A;  2JSC A;  1J2X A;  1DPR A;  4LB5 A;  1BI1 A;  2GAU A;  2P5V A;  3ABT A;  3F22 A;  2YSR A;  3SZT A;  4ESJ A;  2P6S A;  1S3J A;  4R1H A;  3SZP A;  3HTU A;  4LFU A;  4OIO F;  1SFU A;  1IUY A;  4KFC A;  1RUN A;  2QBY A;  1KU9 A;  3GEZ A;  2BGC A;  5BPD A;  2A6H F;  4QWQ A;  3J7A O;  4M71 A;  2COM A;  5JR3 A;  1TW2 A;  2Z5U A;  5LHI A;  4KN4 X;  1P92 A;  2K4B A;  5F6F A;  2M45 A;  1XDU A;  5D4R A;  2L01 A;  1B9N A;  3KP2 A;  2PI0 A;  2RKH A;  1DDN A;  2DTR A;  2KJC A;  3K0L A;  5DEQ A;  2YR2 A;  4MGR A;  1X3U A;  5H6R A;  1P4W A;  2Q2E A;  3GW2 A;  5K5Q A;  3RKW A;  3HHG A;  1BIA A;  3R0A A;  4IRI A;  2WC2 A;  4LLN A;  1XSD A;  4HZF A;  5JVT A;  2EA2 A;  2BYV E;  4PGH A;  1XB4 A;  4EGZ A;  2GZW A;  1XCV A;  4XLP F;  2D2W A;  1E2X A;  3Q9V A;  1FYM A;  4XBF A;  3WTS C;  5LGU A;  1KU3 A;  1C0W A;  2FXA A;  2RVC A;  4KT5 C;  1BC8 C;  3BPV A;  2PMU A;  2DU9 A;  4OMZ A;  1OYY A;  5K1Y A;  2UWM A;  4FX0 A;  4BXU A;  4LD5 A;  2FNP A;  3GFL A;  3EUH A;  1HKT A;  2XAQ A;  3NQO A;  2E1C A;  2D45 A;  3J81 Z;  3HSR A;  4EQQ A;  3WTT C;  1MJA A;  2OU2 A;  2X0L A;  4HA8 A;  2VXZ A;  5LBQ A;  1YQA A;  4AIH A;  4L0Z B;  3RJP A;  4KIF A;  3KE2 A;  3QP5 A;  3TO7 A;  3V7R A;  1G3T A;  3JTH A;  2CYY A;  4RB1 A;  2NRA C;  1LVA A;  1S7O A;  1I6X A;  1TQM A;  3TQN A;  3BJ6 A;  2J5P A;  1O7L A;  4I7H A;  2BV6 A;  5DCF A;  1K78 A;  3J80 Z;  4ENK A;  1GHC A;  3TDZ C;  2VC0 A;  4M74 A;  4FT8 A;  4GYI A;  5FD6 A;  5FLX K;  2ZCW A;  3TO6 A;  1D8J A;  3GZ5 A;  4U0Y A;  5ICE A;  3KP7 A;  5LGT A;  2PBI A;  3HYI A;  1XMA A;  3QU3 A;  3W6K B;  1YLF A;  5D8K B;  1ZLJ A;  1JHF A;  4IF4 A;  3L9F A;  3EDP A;  5J8C A;  3M8E A;  5HLI A;  3N4M A;  2D1V A;  1R1T A;  4DQ2 A;  1ZRE A;  2RN7 A;  1H0M A;  2ZKZ A;  3BPX A;  5FO5 A;  3BOQ A;  1JHH A;  1V4R A;  3CO6 C;  2XVC A;  2K27 A;  2FF4 A;  1LEA A;  2OZ6 A;  3ISP A;  4E70 A;  1U8R A;  1RUO A;  2P5L C;  2VC1 A;  4EGY A;  3I64 A;  2XAF A;  5DCM B;  3KFW X;  3WU0 A;  4N9I A;  1BIB A;  3MEX A;  3WTW C;  3ULQ B;  4O6J A;  1IXS B;  3F72 A;  4OMY A;  1BI0 A;  4R8H A;  2UXX A;  2FBH A;  4LB6 B;  1W7P B;  5L3F A;  4AIK A;  5DD8 A;  4BHP A;  4B09 A;  3KP4 A;  4MEY F;  2HGC A;  1KYZ A;  4G94 A;  3CUO A;  3DV8 A;  3S2W A;  4G7Z F;  6PAX A;  2V1D A;  3QAH A;  3ZMD A;  3LAJ A;  4DNC A;  1ULY A;  1SAX A;  2F5D A;  1OYW A;  3NRV A;  4MQ9 F;  5D6E A;  4IJA A;  4U7D A;  4CHU A;  3E5X A;  2HR3 A;  3KCC A;  5ICF A;  1KQ9 A;  2XAH A;  3QOP A;  2IJL A;  4EM0 B;  4CDG A;  4CXF A;  1SFX A;  1B6A A;  4JBA A;  1R1V A;  1Y0U A;  2Z3Y A;  3F21 A;  3SHF A;  4I2O A;  3LA7 A;  4F7Z A;  3SXY A;  1YS6 A;  2HQR A;  4WCG A;  3JW4 A;  3P9I A;  4K2E A;  3M9A A;  4PCQ A;  5HLH A;  3WE3 A;  3F8B A;  4U0V A;  1R23 A;  4IHT A;  2FRH A;  3E6C C;  5TRD A;  4OU0 A;  1KGS A;  2FMY A;  2H6B A;  4HX8 A;  3LQR A;  1FSE A;  3G3Z A;  5CLS A;  2QQA A;  4JQF A;  4M6Y A;  1SMY F;  2CO5 A;  2FSW A;  4YIF A;  3K9T A;  2P7C B;  2K7L A;  1XSX A;  4UVC A;  3MWM A;  2XUB A;  1KQ0 A;  1G3Y A;  3L7W A;  1XD7 A;  4RS8 A;  4IRG A;  3VEP A;  1QZY A;  3L2C A;  2JZY A;  3P9C A;  2NYX A;  3RYR A;  5BS6 A;  1HKS A;  1HQC A;  1PUE E;  1FOK A;  4LGW A;  1BI2 A;  4RAZ A;  2CW0 F;  5LHH A;  1BOA A;  4OIP F;  4M9X A;  4KUM A;  4ZYG A;  4ETS A;  3LWF A;  4A0X A;  5L3C A;  1T6S A;  4OIN F;  3H3U A;  3P7N A;  1Z05 A;  3HRS A;  4HW0 A;  2ESN A;  3W6J B;  4Z2Y A;  2C6Y A;  5BOX A;  3QRF F;  2FU4 A;  4RB2 C;  1ZRC A;  1G4D A;  3GF2 A;  1HW1 A;  1O3T A;  4AWX B;  1H9T A;  1D5V A;  4CO8 A;  4HF2 A;  1S7A A;  3IRR A;  5DCM A;  2B0L A;  4OIQ F;  4BHC A;  4HX7 A;  3M7G A;  4P5O A;  3OV8 A;  4XLN F;  5HOO A;  1L3L A;  1MJ9 A;  1EH6 A;  1W7P A;  2XIG A;  3RTR A;  2M5W A;  4G7H F;  1E17 A;  1ZRD A;  2Y48 A;  4U0W A;  5DD4 A;  2BE5 F;  1JGS A;  3I54 A;  4MHG A;  1USS A;  1FWZ A;  1FLI A;  3O6B B;  1D8K A;  1GXQ A;  4XRF A;  1ZG5 A;  5AIP A;  2GA2 A;  4I0A A;  1Z6T A;  2GXB A;  2ESH A;  3R4K A;  1FC3 A;  1NHA A;  3JSO A;  4OIR F;  4WXD A;  2CQK A;  1BJA A;  1OYI A;  3WOD F;  1OKR A;  3EYI A;  2VE8 A;  5LRS A;  2BEO A;  1ON2 A;  1A04 A;  4ON0 A;  4ENN A;  2P6T A;  2ZO4 A;  1HXD A;  5FGM A;  1XSV A;  5LLQ A;  5E1Z B;  5ICG A;  4GO1 A;  2V9V A;  2JPB A;  4RGR A;  1FYL A;  3GX4 X;  2RV8 A;  2HEO A;  5DUI A;  2GWR A;  4ESB A;  3FXR A;  5D4S A;  3HUG A;  1W4M A;  3L00 A;  1ZAO A;  4UNO A;  1WSU A;  1OMI A;  2L54 A;  4A0Z A;  3DP7 A;  3F3X A;  2MH9 A;  4EJV A;  2GXG A;  4Q5S F;  2A6E F;  3V7C A;  2DT5 A;  4AVP A;  2YPR A;  5IT9 K;  4CYD A;  5E18 F;  4D0P A;  1R5G A;  4Y13 A;  3Q5F A;  4HX4 A;  4RGU A;  2P5K A;  1ZN2 A;  3I59 B;  5CYV A;  3BZ6 A;  4UHT A;  5E1X A;  3CTA A;  2A68 F;  4L9T A;  3WG9 A;  5D5X B;  5CVU A;  1KU7 A;  2EWN A;  1I5Z A;  1YS7 A;  1IW7 F;  2PQ8 A;  4UXN A;  3F8N A;  5A2Q K;  4PGG A;  4WX9 A;  2XAS A;  2Z99 A;  3GYH X;  3MQ0 A;  3WTX C;  3IWF A;  5IT3 A;  2QQB A;  2ZNZ A;  1J7K A;  2YU3 A;  3D0S A;  1UB9 A;  2DK5 A;  3VB2 A;  3EYY A;  1ZH5 A;  1F1Z A;  3GWZ A;  4A5N A;  2A5Y B;  1T0F A;  3JTG A;  5DUK A;  1XGO A;  1P2F A;  2XAG A;  5CVV A;  2IT0 A;  4A2U A;  5FLX Z;  3JAM K;  3HRM A;  1ZRF A;  1FNN A;  3R0J A;  1MDM B;  3ZN0 A;  4BH9 A;  3BRO A;  3WGH A;  2VT2 A;  1YIO A;  2E7X A;  1FBQ A;  4KIC A;  2KIM A;  3R61 A;  1VTN C;  3NEU A;  2V1U A;  4RB0 A;  1HBX G;  3E5U A;  1TLH B;  2WV0 A;  3WTZ A;  1FZP B;  1YW8 A;  4WWC A;  4WK8 F;  1ZG1 A;  3I4P A;  1R1U A;  3DFG A;  1P4A A;  2DQL A;  4WXH A;  3N97 A;  1UST A;  2G7H A;  2CGP A;  4NB5 A;  1QZZ A;  1F4K A;  2JRT A;  1FBU A;  1LDJ A;  3V8L A;  2W84 A;  3GFM A;  5LEJ A;  4RAY A;  3O3K A;  5E1W A;  2JT1 A;  1B9M A;  5E8I A;  3MZH A;  3DF8 A;  5HDG A;  1AOY A;  3SQN A;  2J5O A;  5EEG A;  2YX4 A;  2ISZ A;  5L3B A;  2P8T A;  1XCB A;  3G73 A;  3PFI A;  4HF1 A;  2Z33 A;  2O8X A;  5DV5 A;  2ACJ A;  3FMR A;  4AIJ A;  1XGN A;  1D3Y A;  4L0Y B;  3BWG A;  4A6D A;  5ED4 A;  2IRF G;  2FBK A;  4HAM A;  3E6M A;  5ILS A;  1HW2 A;  2KIF A;  1Z6R A;  4ZYD A;  2VT3 A;  1DUX C;  1XDS A;  1FY7 A;  2LSO A;  2HQN A;  4ENM A;  3K1M A;  1LNW A;  3E97 A;  3I59 A;  4XSZ F;  2OA4 A;  1XMK A;  2DBB A;  1B4A A;  4HBL A;  3HRU A;  1ONV A;  1KQ8 A;  1LJ9 A;  4GYG A;  3VOE A;  2PEX A;  3ZQ7 A;  1IRG A;  1DPU A;  5HS8 A;  1R36 A;  3RI4 A;  2M30 A;  2MC3 A;  2L02 A;  3IKT A;  1GXP A;  3RPU A;  4HF0 A;  3ZMV A;  3FHZ A;  3H92 A;  3CDH A;  4N0B A;  2GQQ A;  3F8M A;  3J80 K;  1Z7U A;  2EV6 A;  3L09 A;  1G3S A;  2ZME B;  2KRF A;  4I0B A;  4HLX A;  2IA2 A;  2EJR A;  2Y75 A;  4L9J A;  2Q0O A;  4HOB A;  4YFX F;  1R5H A;  5HVQ C;  1BBY A;  5DDG A;  1FSH A;  1STZ A;  2RGV A;  1MDM A;  2PG4 A;  3MZY A;  5KK1 A;  2NNN A;  3FWE A;  1KU2 A;  4O3M A;  4ZH4 F;  1RI7 A;  1IZ1 A;  3VFZ A;  3JSP A;  3F6O A;  1UFM A;  2EK5 A;  3KLO A;  4G9Y A;  2XAJ A;  5EEH A;  1V3F A;  4HV6 A;  4PDK A;  2JTV A;  2VE9 A;  4EM1 A;  1ZHF A;  4A6E A;  1ODD A;  1MKM A;  1QNT A;  3ELK A;  3RKY A;  1SFE A;  1Q1H A;  3REO A;  4UVA A;  1FP2 A;  2WWY A;  2EFW A;  2W85 A;  2A3S A;  2H6C A;  2VON A;  2ZFW A;  4G7O F;  1K6O A;  2QQ9 A;  4LG0 B;  4G6Q A;  1PDN C;  2AS5 F;  3ROU A;  3DPT A;  2V79 A;  1PP7 U;  2EFQ A;  4GCV A;  2ZJ2 A;  4UVB A;  1LEB A;  3B02 A;  2X4H A;  3CUQ C;  2OD5 A;  4UV9 A;  4MQV A;  5FB2 A;  3E3V A;  2IVM A;  3ERE D;  1ZGJ A;  2BBY A;  1XGS A;  1J59 A;  1J75 A;  2FBI A;  1O7F A;  3F6V A;  1UCR A;  3ZP5 A;  1U78 A;  3U1D A;  1R22 A;  2RQP A;  5LRR A;  3CUQ B;  3H3Z A;  4QLC U;  4EJU A;  5HDN A;  4RB3 C;  3FM5 A;  4ZZD A;  4EJW A;  4M6X A;  2LDU A;  1QBJ A;  2HOE A;  2VBX A;  2FQ3 A;  4IRH A;  2EV5 A;  2QM3 A;  4HV5 A;  1ZG3 A;  2PN6 A;  2FNA A;  1TQP A;  1RZ4 A;  2ISY A;  2MH2 A;  2MA3 A;  3I71 A;  1IAW A;  4HDU A;  2TDX A;  2HWV A;  2R7F A;  2DPD A;  2XHK A;  4HYE A;  3I5U A;  2ZME A;  4N9H A;  1Z91 A;  1B1B A;  3IRQ A;  2MD5 A;  4M73 A;  4BQA A;  2O3F A;  1S29 A;  2HS5 A;  3IWZ A;  4A12 A;  5E17 F;  1W5S A;  3V8J A;  4PZJ A;  2FOK A;  2JPC A;  2NAZ A;  1IN6 A;  2Q8K A;  2GA1 A;  1EH8 A;  4MEX F;  3FXQ A;  4A0Y A;  5E20 A;  2ELH A;  1SMT A;  5IT9 Z; 
#chains in the Genus database with same CATH topology
 2O6G E;  1Y8R B;  4FAS D;  3HOU J;  1P7J A;  1YRN B;  4E7H A;  2V6E A;  2W25 A;  1FYK A;  2F4O B;  3FX3 A;  1X4P A;  1Z7L A;  4CCK A;  1VF9 A;  4W1U A;  1YFH A;  3F8C A;  1A6I A;  1GV2 A;  4M9S A;  1MD0 A;  5K7H A;  2H09 A;  4UUS A;  4LG3 A;  3JRG A;  3BTL A;  4IQJ A;  3FZV A;  2VBW A;  2KIQ A;  4RM2 A;  3PIO F;  5F0C A;  4CCJ A;  1TNS A;  1U6G A;  1WVR A;  4M3B A;  3RKQ A;  4FCY A;  4YRV A;  1F5T A;  5BQT A;  1IRF A;  1YW9 A;  2XGE A;  3ESW B;  3QYF A;  4G8X A;  2YU9 J;  3HGY A;  2HNH A;  2PJR A;  2Y9Y A;  4B47 A;  4PJ0 C;  2LF7 A;  5A2Q Z;  2E35 A;  2HOA A;  1SEU A;  1UHM A;  4IHS A;  1ZAR A;  4P55 A;  5FFZ A;  1A35 A;  5M3F J;  1T39 A;  2NOJ B;  3BP8 A;  3QOD A;  4LG0 A;  2DMN A;  3CMY A;  2KIU A;  4DZJ A;  2CQN A;  2IGO A;  4NQW A;  2XAU A;  3GLX A;  1REP C;  1P4X A;  2TCT A;  5LGN A;  4A3F J;  4RGS A;  2EFN A;  1CGP A;  1LDD A;  2QWW A;  2IW5 A;  2Q1Z B;  4A3J J;  3KEO A;  3WU1 B;  3M4O J;  3IL2 A;  4Q47 A;  2CS3 A;  2V1X A;  4IVN A;  5CKT A;  2A61 A;  1MGT A;  1QQI A;  2HU9 A;  4PSX A;  2H1L A;  4IPA A;  1YTY A;  1MIJ A;  1MMN A;  2CWE A;  1OCC H;  2CUE A;  2JK3 A;  3MAJ A;  1OR7 C;  4I01 A;  2CSO A;  3I58 A;  2LF8 A;  3F9K A;  3T8R A;  1FEX A;  2NOG A;  3BTJ A;  4TV7 A;  2XPU A;  2W57 A;  4DGW B;  1JGG A;  2BHY A;  2YUS A;  2K9S A;  3HBL A;  1S7E A;  3ZQC A;  1MBF A;  5EF6 A;  5FLM J;  4C2T A;  1OPC A;  3JAM Z;  1E3P A;  4IHY A;  2R7Z J;  3NAU A;  2Z16 A;  5F1R A;  2VUM J;  2R3S A;  1Y0N A;  2ETH A;  5KCM A;  1EF4 A;  3V7S A;  1MJB A;  2ZSH B;  3BG5 A;  2V6C A;  3WHC A;  4Y17 A;  1H9G A;  2KKO A;  4KN7 X;  2IA1 A;  4RA2 A;  1JE8 A;  1HCR A;  5FLV A;  3I0T A;  2ZXJ A;  4F92 B;  2W4S A;  4IHV A;  3GTG J;  3T8T A;  3CUQ A;  4Q4Z F;  3GFJ A;  1RKT A;  1D5Y A;  3CJR B;  1W7P D;  1TWC J;  1JUM A;  1LFP A;  4ZYA A;  5LEK A;  3R6S A;  4KDP A;  4UB8 C;  3FKI J;  1ZGA A;  3IHU A;  2AXT C;  3LFK A;  3K70 C;  1ERD A;  3LAP A;  1QHG A;  4MTE A;  4ASN A;  3HSF A;  4OAY A;  1YE9 A;  5J8F A;  2MSY A;  2G9W A;  4L5I A;  4FHT A;  5HDK A;  3GZ6 A;  4IHW A;  5IYD J;  3U9G A;  5GAG J;  2LH9 A;  2LKP A;  5K5O A;  4RMN A;  1YIT I;  1NK2 P;  1UMQ A;  2CV1 A;  4OOI A;  3Q9S A;  4Y15 A;  4S0H B;  1OFC X;  3EET A;  2LRE A;  4XSX F;  3RPQ A;  1IXR C;  1BR4 A;  2HZD A;  3DXJ F;  5BMZ A;  3PQJ A;  1PUF A;  3PUF A;  2F5E A;  2QEX I;  3D5L A;  1V5E A;  3DU6 A;  3GXO A;  2ZSI B;  2HDC A;  5KNL A;  2VBZ A;  3BG3 A;  2M8G X;  1FTT A;  1G3W A;  2UZK A;  3KP3 A;  2XKP A;  2E36 A;  3EUA A;  2PFB A;  3FK7 A;  3LSI A;  3OR1 C;  5E3O A;  2EV0 A;  1OIS A;  1AKH A;  2FML A;  3DQV C;  3FHN A;  3LST A;  3JR9 A;  4UY8 I;  5D5W B;  3HDD A;  3OS2 A;  3IP4 B;  2VI6 A;  1W5T A;  3MFK A;  3HXL A;  3QU6 A;  1X1A A;  2GM4 A;  3I53 A;  1IN5 A;  1FOW A;  3V4G A;  1RNL A;  5TJJ A;  1J5Y A;  2KJB A;  1T2K A;  4BHB A;  2WB1 N;  4KJZ A;  3IUO A;  3ZR8 X;  3MMY B;  2K02 A;  5J1Y A;  1YYV A;  4BBR J;  1CF7 B;  2R7V A;  4ESF A;  2DFE A;  3DU5 A;  5CVI A;  3A1Y A;  3B6C A;  2QLZ A;  4FIS A;  1N25 A;  2E7W A;  3ZPL A;  3RQ4 A;  3S15 J;  2YX7 A;  4N4N B;  3RZD J;  4MTD A;  2V9K A;  3AFH A;  2HI3 A;  1DP7 P;  1WFX A;  4Z6Y A;  5K7Z A;  3TDU C;  2FE3 A;  2HTJ A;  2DQR A;  1YRN A;  4I98 B;  1MMG A;  5ICC A;  2XGX A;  4AU7 A;  4WF2 A;  5HOD A;  2LNB A;  3FIS A;  1XGM A;  1VQ4 I;  5HNH A;  1Z1D A;  3K69 A;  4IXA A;  2MBF A;  3DPL C;  3S17 J;  1M1E B;  5M5W J;  3RKX A;  3LSH A;  2OV7 A;  2LOO A;  2DA4 A;  4ZZL A;  3OOP A;  2OTJ I;  1VQN I;  2QF7 A;  3LOC A;  1KA8 A;  5D8L B;  2VN2 A;  4A3E J;  1AHD P;  2NS8 A;  4IX7 A;  2LVS A;  2GBY A;  2O7O A;  2MD0 A;  3J7Y J;  3OOU A;  2K86 A;  4YG2 F;  3UKG A;  2EFP A;  1MMS A;  1R49 A;  2ZNY A;  4PFO A;  5D6F A;  3ZMZ A;  3J7A Y;  1DU6 A;  1O57 A;  1TTY A;  2UXN A;  1R4M B;  2IA0 A;  2DPU A;  3KZZ A;  3HOT A;  3M1E A;  1O3S A;  1EJ9 A;  2E60 A;  2WAQ N;  4BJT A;  2ZBK A;  3IH4 A;  4MNU A;  4ZDP A;  1TNT A;  1SD6 A;  4ZTF A;  1WKM A;  4P9F A;  2XV4 S;  1TQI A;  3C18 A;  5B66 C;  1OCO H;  1T38 A;  4O5V A;  4AYB N;  3WGI A;  3WGG A;  1QO0 D;  3CLO A;  2DK8 A;  2PLY A;  1TZL A;  2EB7 A;  2N8G A;  4HQM A;  4KA4 A;  3QPL A;  3T5X A;  3W3C A;  2FA5 A;  4YEJ A;  2DMT A;  1KYW A;  3HOS A;  3HKZ A;  4LK0 F;  4L9N A;  2JRM A;  2ZXH A;  1ETW A;  3HJE A;  5F08 A;  4R79 A;  5E3N A;  2HFH A;  3VDX A;  5BNG A;  3MCZ A;  2LY2 A;  4G6D A;  3VPR A;  1MBJ A;  4GGG A;  2PMH A;  5H2F C;  4GDF A;  4GFB A;  4P96 A;  5L3G A;  3OL3 A;  3COA C;  3F8F A;  1R6R A;  3BTI A;  5J6X A;  1H88 C;  1YG2 A;  3VOD A;  3S2H J;  2DDA A;  1ON1 A;  2ME0 A;  1IGN A;  2L4A A;  2KP6 A;  1FP1 D;  4HDV A;  1K79 A;  4YEL A;  4S05 A;  1HKQ A;  2W24 A;  3HM5 A;  2DOF A;  3MKY B;  2GIV A;  5K5R A;  1YO5 C;  3P9K A;  3FXU A;  1V54 H;  2LYC A;  2CW8 A;  2P7V B;  2AXL A;  3IC7 A;  5J4V A;  1PP8 F;  2DW4 A;  4MO7 A;  4KMF A;  1MZB A;  2IS2 A;  1U5T C;  5FRN A;  3J81 K;  2MLK A;  1OR7 A;  1Y8Q B;  4LLG F;  4HQE A;  3S3N A;  2X85 A;  2EIM H;  3T1B A;  1A36 A;  2VJJ A;  3K4C A;  3O2P E;  2E2J J;  2M1B A;  5F04 A;  2M4G A;  1XC5 A;  1HW5 A;  4RGX A;  1Z3Y A;  1DGR M;  2I10 A;  2VXD A;  3DKW A;  1WQ2 A;  2KDZ A;  1EKE A;  3AG1 H;  1TBX A;  2QUF A;  2P4W A;  3E5Q A;  3ZN1 A;  1UHS A;  1ZYR F;  1Q1V A;  3PQK A;  2EBI A;  4JK1 X;  2E1M B;  2R7O A;  2JMW A;  4XON A;  4ZYE A;  1JKR C;  1XX5 A;  1X58 A;  3H9Q A;  2CFO A;  4AD9 A;  3WTV C;  2DLL A;  1FMV A;  1U3E M;  3HSE A;  3RYP A;  3ZCO A;  5ILV A;  1FPQ A;  4HG2 A;  5GP9 A;  2DJN A;  4BY1 J;  1ZGW A;  4FX4 A;  1U5T B;  1FT9 A;  2FEZ A;  2LR8 A;  3HEF A;  5BPI A;  1HST A;  4XRS G;  4BNC A;  2QVO A;  2R7W A;  3VYU B;  4EJO A;  1BM9 A;  2EIK H;  3SFZ A;  2NVT J;  4L9V A;  4DYC A;  1HA8 A;  2L7K A;  5HLG A;  2CW7 A;  4UV8 A;  3K10 A;  1X19 A;  1P6R A;  3IH2 A;  4S04 A;  2Z9O A;  2VOO A;  3AG2 H;  5E3M A;  1R00 A;  2QEN A;  2X6X A;  3MD2 A;  3CO7 C;  4CGZ A;  4GXO A;  2EA4 A;  2MC4 A;  4UUV A;  1OCR H;  2XF6 A;  2B63 J;  3U2R A;  1OLT A;  2IPQ X;  2V4J C;  5HS7 A;  3TOA A;  3ZMT A;  3IKV A;  2ICW G;  3GFI A;  1FX7 A;  4KMU X;  5H6Q A;  2LKX A;  1CF7 A;  3BC8 A;  2Y30 A;  2E19 A;  2MLG A;  1J9I A;  2HTS A;  4M3G A;  4EVI A;  3LA3 A;  1HDD C;  3BLY A;  2DT6 A;  1SD5 A;  4NHJ A;  4UB6 C;  2YS9 A;  3PM1 A;  4H0E A;  2R5Z B;  4I09 A;  3KX2 A;  4E6K G;  4EV0 A;  3C7J A;  4EMS A;  1I1S A;  4LK1 F;  1B59 A;  2L4M A;  2Y69 H;  3DEU A;  3WHB A;  2XKO A;  3K1N A;  4HSR A;  5AIQ A;  1R7J A;  5JI6 A;  4LJZ F;  2M9H A;  4A5M A;  3LSJ A;  2QYO A;  5KVR A;  2A07 F;  4EJT A;  1D1B A;  3BY6 A;  2WAE A;  3D5S C;  5F64 A;  5JFR A;  3HIF A;  2R7T A;  3ECO A;  1D0Z A;  4EM2 A;  3HL2 A;  1K7A A;  3WE2 A;  2DJI A;  5EEA A;  4FTH A;  4KIG A;  2L9R A;  3HRT A;  3KLN A;  3KZY A;  4YFN F;  3FXK A;  1IN7 A;  1XS9 A;  1BR1 A;  5E3L A;  1J0R A;  1E3H A;  4WXC A;  1IXC A;  1JT6 A;  2OZU A;  3LA2 A;  2VOP A;  5IOY A;  1G8X A;  2G7U A;  2ZXW H;  2DA1 A;  3VYT B;  3PUB A;  1WPK A;  2L9N A;  2O0Y A;  1P9Q C;  5GPC A;  2XRO A;  2NS0 A;  2OBP A;  3KEQ A;  1P7I A;  1X1P A;  1GT0 C;  4L18 B;  1TWA J;  1U2W A;  2VJ5 A;  3CJN A;  3GVA A;  4P9U A;  3KYL A;  2CG4 A;  3MN2 A;  1AWC A;  5IP7 J;  2DCE A;  4XKW A;  1NG6 A;  3ECH A;  3DBH B;  1LDK B;  1Z9C A;  1H89 C;  1S6L A;  5CVJ A;  3HPG A;  4L5J A;  4IOA F;  3BJO A;  2WTE A;  1VQ9 I;  5D5V B;  3OY9 A;  1IJW C;  2HYG D;  1GVJ A;  2V1N A;  1D0Y A;  1T8I A;  2GIZ A;  2HYF A;  2R7S A;  2OUM A;  2R7D A;  5HS9 A;  3ZRG A;  3SYT A;  4B8X A;  3OIO A;  1R5I D;  4FE7 A;  1BOB A;  3E6B A;  1O3R A;  1BN5 A;  2F5F A;  3CMM A;  3R60 A;  1L0O C;  2DFI A;  4AVZ A;  1BI3 A;  3GTJ J;  3ZMS A;  2GOX B;  2K40 A;  2OAZ A;  3BJA A;  3RDI A;  1RC9 A;  2DFH A;  3K2Z A;  3PNT A;  2DAO A;  1R9T J;  1LE8 B;  4KNY A;  4LIU A;  4KYW A;  3H0D A;  3M8F A;  3G2B A;  4BAY A;  1WI9 A;  2IP2 A;  2K4J A;  2FJ1 A;  2ADU A;  1Z3X A;  3FMS A;  2K3P A;  1LFU P;  1I1G A;  1SD4 A;  2QSG X;  1R58 A;  1ZLK A;  1BA5 A;  2ZC2 A;  2UUZ A;  3CQZ J;  4JX4 A;  5EZH A;  2EIL H;  2QSF X;  2WV1 A;  4BE2 A;  1XTA A;  2OQR A;  3OSG A;  2CJJ A;  1TC3 C;  1EH7 A;  1WJ5 A;  2DYS H;  2M0M A;  2EQR A;  3QP6 A;  2RNJ A;  4NDL A;  4BYY A;  5F0H A;  3GUD A;  1O3Q A;  3MKW B;  4A93 J;  5FFX A;  5M5X J;  1K4T A;  1I27 A;  2H94 A;  5D5U B;  4U88 A;  3CCR I;  3C3W A;  4BU2 A;  3RIR A;  3GBG A;  1IN4 A;  2RDP A;  2QBY B;  3G71 I;  5FKN A;  5EG0 B;  2XRN A;  3OIQ A;  3KP5 A;  5C3E J;  3WU2 C;  1OCT C;  5E8G A;  3B73 A;  1LUJ B;  1LB2 A;  2QZ8 A;  1SD7 A;  5FD5 A;  3QPH A;  3V42 A;  2D1H A;  4YII A;  4ENJ A;  1GUU A;  3JRA A;  2HZT A;  3UNG C;  4HLY A;  5GTH C;  3KEY A;  2V9P A;  2F2E A;  3UR3 C;  2B9S A;  5CPR B;  3C1D A;  3FM3 A;  1PUF B;  1T0F C;  2DI3 A;  4M9Z A;  3ONQ A;  1VFC A;  1MH3 A;  3GO5 A;  3E6D A;  1QRY A;  4YFK F;  2NNY A;  3A01 B;  1U5T A;  3HOV J;  2OQG A;  1RIO H;  4NUB A;  3BDD A;  2VBY A;  4KIB A;  2XDV A;  2KLO A;  3QQA A;  1HSJ A;  2XPV A;  2XGD A;  2F5C A;  1DU0 A;  3F23 A;  2PJP A;  2Q2E B;  3KET A;  2HKO A;  2M3A A;  4I02 A;  4BQO A;  1W0T A;  1MMA A;  1W1W E;  3QOE A;  1FBS A;  2H27 A;  3HOY J;  4B1R A;  1LQ1 A;  1QGP A;  2ECB A;  1BC7 C;  2EFO A;  3MKZ A;  3S1N J;  2PMZ A;  3VWB A;  3FMQ A;  3DWL E;  1S8N A;  2VKH A;  1TW3 A;  5HNF A;  3HHH A;  2QSH X;  4E7L A;  2W82 A;  2VOD A;  4XLE A;  2CFX A;  3EUH C;  1SFO J;  2E1N A;  1GLN A;  2X6Y A;  3TOB A;  4A3C J;  3EQL F;  2RC4 A;  2E5N A;  3NWT A;  2BY0 A;  4XLF A;  5J40 A;  3BG9 A;  3TO9 A;  5L3E A;  3I4N J;  5AON A;  1IC8 A;  2LP0 A;  1UHW A;  2M8E A;  2DO7 A;  3BR3 A;  2L3D A;  2O03 A;  4M3E A;  4XLC A;  1D1A A;  1ZQ3 P;  2R5Z A;  1WWX A;  1JTY A;  4M72 A;  2HQA A;  4XOR A;  1HDP A;  2R7U A;  2ZFU A;  2VJI A;  4CIC A;  1CQT A;  3TGN A;  5J47 A;  2OC6 A;  1T98 A;  4CCO A;  1XN7 A;  2HOS A;  3M8J A;  3PNV A;  2Y0M A;  1G6N A;  4U7B A;  1QHH D;  4XOT A;  3T0Y A;  4BE0 A;  3HTS B;  4Y4R A;  1MW7 A;  2JSP A;  3V8K A;  4E4H A;  3WTU C;  5L3D A;  1JXS A;  3WTY C;  3LQQ A;  4LMY A;  1QPM A;  3FF5 A;  1LKX A;  3DLA A;  3WG7 H;  2A69 F;  4E7J A;  3ML6 A;  3ZMU A;  5CJ9 A;  2A05 A;  4X6A J;  5DYM A;  1YW7 A;  4CZZ A;  3DPU A;  5CVR A;  2Y0S A;  5ERI A;  2BXY A;  2CMP A;  4C2M J;  4DBQ A;  3VSK A;  2STW A;  4II2 A;  3ZOB A;  2HKX A;  5ILU A;  5LHG A;  3KP6 A;  1EV7 A;  1WRJ A;  2ELJ A;  2DDB A;  4F3Q A;  4DYQ A;  3GTK J;  5JLX A;  1K78 B;  3ABU A;  3ZQH A;  4LIT A;  3S1M J;  3QPT A;  1U0J A;  4JP0 A;  4Q48 A;  1VQL I;  1Z0X A;  2O61 A;  4ZYH A;  3QPS A;  1VZ0 A;  1IF1 A;  4LLL A;  3K1P A;  2STT A;  3MVP A;  2VKV A;  4B3A A;  1XPX A;  2M87 A;  4OAZ A;  1F9N A;  3K4B A;  3TKY A;  3FXM A;  3I3L A;  3OL4 A;  4M3F A;  1LE8 A;  2TRT A;  4BEH A;  1IN8 A;  3FKJ A;  3AAF A;  5H20 A;  1RES A;  4C3H J;  1GV5 A;  4BJ5 C;  4BUP A;  2JSC A;  2NVU B;  1J2X A;  1DPR A;  1Y1W J;  4LB5 A;  2F5V A;  1BI1 A;  2GAU A;  2P5V A;  3ABT A;  2UV1 A;  4BJ6 C;  3F22 A;  2R92 J;  2YSR A;  2F4I A;  1ZR2 A;  2G0E A;  3SZT A;  4ESJ A;  2P6S A;  1S3J A;  4JOM A;  3PO3 J;  5KHD A;  4M6V A;  3HG9 A;  4R1H A;  3CC2 I;  3SZP A;  3TW6 A;  3HTU A;  4LFU A;  4OIO F;  2V26 A;  3H0G J;  1HOM A;  1ENH A;  1SFU A;  1IUY A;  3BZK A;  4KFC A;  1RUN A;  2QBY A;  5B5E C;  1KU9 A;  5EG0 A;  3GEZ A;  2BGC A;  5BPD A;  1VND A;  5J1U A;  2A6H F;  5FRM A;  5J4Y A;  3W6V A;  4QWQ A;  3J7A O;  4M71 A;  4AC0 A;  2BHZ A;  3G6E I;  2COM A;  5JR3 A;  3AKZ A;  1X2N A;  2VJ4 A;  3SFI A;  1TW2 A;  2E34 A;  1IRZ A;  3SDG A;  5IP9 J;  2Z5U A;  1A5J A;  5LHI A;  1MBG A;  2I5U A;  4KN4 X;  3VYR B;  1P92 A;  2K4B A;  1B8I B;  3Q0W A;  2M45 A;  5F6F A;  1XDU A;  5D4R A;  1I50 J;  3DEE A;  1I3A A;  2L01 A;  1B9N A;  3K6G A;  5GPA A;  4V2F A;  3DTI A;  3KP2 A;  1E3O C;  2PI0 A;  3W2V A;  3S3O A;  3K4N A;  1WJB A;  3A01 A;  1N77 A;  1XMX A;  3LMM A;  4XK4 A;  3CC4 I;  2RKH A;  1DDN A;  2DTR A;  2KJC A;  3K0L A;  3ASN H;  3QYB A;  3IV5 A;  1NK3 P;  5DEQ A;  4D9J A;  2YR2 A;  2AHQ A;  4MGR A;  1X3U A;  5H6R A;  2F48 A;  4MFD A;  1P4W A;  2Q2E A;  3A0B C;  1EA3 A;  3GW2 A;  2KPM A;  4Y7N J;  5K5Q A;  3RKW A;  3HHG A;  4IO9 F;  4QPQ A;  3AG4 H;  1BL0 A;  2X6O A;  1BIA A;  3R0A A;  4IRI A;  4CCM A;  2WC2 A;  4LLN A;  1XSD A;  4CH7 A;  4IQ4 A;  3FIW A;  4HZF A;  5JVT A;  2EA2 A;  3RSN A;  2BYV E;  4PGH A;  1XB4 A;  4EGZ A;  3K2A A;  5J1R A;  3S8P A;  2GZW A;  1X4O A;  4A69 C;  1SVO A;  1XCV A;  4DIQ A;  4XLP F;  1K6Y A;  3LSP A;  2D2W A;  1E2X A;  3Q9V A;  1FYM A;  1T33 A;  2RNG A;  4XBF A;  3WTS C;  2LY9 A;  4BL0 B;  2FQ4 A;  4CUG A;  3FDY A;  5LGU A;  1KU3 A;  2HXI A;  1C0W A;  2FXA A;  2RVC A;  4KT5 C;  1BC8 C;  3BPV A;  2PMU A;  1D0X A;  1RR7 A;  1IDZ A;  2DU9 A;  2XPW A;  2JJ7 A;  4W97 A;  3GTM J;  4OMZ A;  1OYY A;  5K1Y A;  2XSD C;  2UWM A;  4FX0 A;  4BXU A;  4LD5 A;  2FNP A;  2DMU A;  3GFL A;  1JUS A;  5DM7 F;  2DXI A;  3EUH A;  1HKT A;  2KT0 A;  2XAQ A;  2KQR A;  3NQO A;  3PFY A;  4XMY A;  2O5R A;  2E1C A;  2D45 A;  3J81 Z;  3K4K A;  3HSR A;  4EQQ A;  5KAF C;  2K3F A;  3OYI A;  3WTT C;  1JJ8 C;  1MJA A;  2OU2 A;  3ZQF A;  4XID A;  2X0L A;  4HA8 A;  2VXZ A;  3H36 A;  5LBQ A;  2ZJQ F;  1YQA A;  1V5G A;  3CP8 A;  4AIH A;  1RRJ A;  4BY7 J;  5B1B H;  4L0Z B;  1GVD A;  1DGW Y;  2M34 A;  4KIF A;  3KE2 A;  3QP5 A;  3RJP A;  3TO7 A;  2CH0 A;  3V7R A;  1G3T A;  3JTH A;  2CYY A;  2P0W A;  2R7X A;  2M0C A;  4RB1 A;  2NRA C;  2LRD A;  3DEW A;  1LVA A;  1S7O A;  1I6X A;  3PJR A;  1TQM A;  4OWR B;  5FKO A;  3TQN A;  1I6H J;  3BJ6 A;  4KT6 A;  1H8A C;  3CCL I;  2J5P A;  2FUG 2;  1S72 I;  1O7L A;  4I7H A;  1YI2 I;  1X2M A;  4CZC A;  2BV6 A;  3IAS 2;  4XKB A;  5DCF A;  1K78 A;  1VI0 A;  3LSM A;  3J80 Z;  4ENK A;  1GHC A;  4A3I J;  3TDZ C;  2PX9 A;  2VC0 A;  4M74 A;  4FT8 A;  4GYI A;  3H5R A;  5FD6 A;  1LFB A;  1G59 A;  1GDT A;  5FLX K;  2ZCW A;  1UJ8 A;  3TO6 A;  1RPW A;  1D8J A;  4V2G A;  2XSJ C;  3GZ5 A;  1IV6 A;  2ZB9 A;  4BKX A;  3CC7 I;  4U0Y A;  5ICE A;  3KP7 A;  4XNF A;  5LGT A;  2PBI A;  1U8B A;  4D1Q A;  2WBM A;  3HYI A;  1S9H A;  1XMA A;  3QU3 A;  3G4S I;  1RET A;  1MH4 A;  3W6K B;  2QQ8 A;  3I55 I;  1YLF A;  5D8K B;  3FXJ A;  1ZLJ A;  1JHF A;  1HLV A;  3TP3 A;  3TMO A;  4IF4 A;  1NG7 A;  1ACI A;  4QTR A;  1O4X A;  1SVM A;  3L9F A;  2NVQ J;  3EDP A;  5J8C A;  3BQZ A;  4HRI A;  2F6C A;  3M8E A;  2MAB A;  5HLI A;  3N4M A;  3U21 A;  1VQ8 I;  3BR1 A;  2D1V A;  2L9V A;  1SC7 A;  1R1T A;  4DQ2 A;  1ZRE A;  1SVL A;  2RN7 A;  1H0M A;  2BVM A;  2ZKZ A;  3BPX A;  5FO5 A;  5FRO A;  3OS0 A;  1VQK I;  3BOQ A;  1JHH A;  1VQ6 I;  3CJQ B;  2MFZ A;  2IS1 A;  1YJ9 I;  1V4R A;  2OF7 A;  3HB9 A;  3CO6 C;  4G12 A;  2XVC A;  2K27 A;  3LNQ A;  4AUX A;  3FXL A;  2FF4 A;  1LEA A;  4D5C A;  2OZ6 A;  2R7R A;  1B8I A;  3S32 A;  3ISP A;  4D5F A;  4E70 A;  1DQU A;  2Z1D A;  2L7F P;  1U8R A;  3TW7 A;  1RUO A;  3BCA A;  2P5L C;  2BW3 B;  2WY8 Q;  5C4J J;  2VC1 A;  4EGY A;  1QVT A;  3JRD A;  3I64 A;  2XAF A;  2RAE A;  5DCM B;  2DOE A;  3E0J B;  3KFW X;  3WU0 A;  4BXX J;  4N9I A;  3HGG A;  1BIB A;  3CP2 A;  3MEX A;  3WTW C;  3ULQ B;  2JA8 J;  4O6J A;  1IXS B;  2LK2 A;  3F72 A;  3KPH A;  3C2H A;  1Z67 A;  4NNJ A;  4OMY A;  3CF5 F;  2BOL A;  2E5Z A;  1BI0 A;  4RDU A;  4R8H A;  2UXX A;  2K9N A;  2FBH A;  4NBQ A;  2KZV A;  4LB6 B;  1W7P B;  5L3F A;  4AIK A;  1MSE C;  1X1C A;  5DD8 A;  4BHP A;  3TED A;  2AO9 A;  4B09 A;  3CCJ I;  2WB1 A;  3JCU C;  2L9S A;  2MW8 A;  2DOA A;  4ZTJ A;  4IHX A;  2EZL A;  2K9Q A;  2BY1 A;  2M2E A;  3KP4 A;  3LSG A;  4MEY F;  1TT0 A;  1IRX A;  5IPA A;  1WZ2 A;  2HGC A;  2P81 A;  3G1M A;  1KYZ A;  4G94 A;  3CUO A;  3DV8 A;  3S2W A;  3W2W A;  4G7Z F;  4HEA 2;  6PAX A;  4F91 B;  3PO2 J;  2V1D A;  3QAH A;  3ZMD A;  4A3G J;  3LAJ A;  4DNC A;  1ULY A;  1SAX A;  2F5D A;  3JRI A;  1OYW A;  3NRV A;  4MQ9 F;  3SEZ A;  3CZ6 A;  5D6E A;  4IJA A;  4U7D A;  4CHU A;  2O8K A;  3E5X A;  3D1N I;  2HR3 A;  1UEL B;  3CCY A;  3KCC A;  1OQY A;  5ICF A;  1KQ9 A;  2XAH A;  5JHU A;  3RCO A;  3DBR B;  3QOP A;  2IJL A;  2KFD A;  2L2O A;  4EM0 B;  5B1A H;  5C4X J;  4C9Y A;  3S14 J;  4CDG A;  2H8R A;  4CXF A;  1SFX A;  1B6A A;  4XL9 A;  4JBA A;  1U9O A;  1BR2 A;  1R1V A;  1Y0U A;  2Z3Y A;  1T08 B;  3BR2 A;  3F21 A;  2QGU A;  3SHF A;  4I2O A;  2F4M B;  3C2G A;  5IYB J;  3LA7 A;  1MNM C;  4F7Z A;  3SXY A;  1YS6 A;  2LFB A;  2HQR A;  3LSK A;  2E1O A;  3P5J A;  2VQG A;  2IGN A;  4WCG A;  2DYR H;  2VKE A;  3BT9 A;  2K9M A;  2KIS A;  3S1R J;  4CCL A;  1YJN I;  3JW4 A;  3P9I A;  4K2E A;  4QPO A;  3M9A A;  4PCQ A;  3GTP J;  2WAQ A;  5HLH A;  1FJL A;  3CME I;  3WE3 A;  3F8B A;  1PVE A;  3EPZ A;  4Y3O A;  4U0V A;  1R23 A;  2DOD A;  4IHT A;  1MNE A;  2JVH A;  2FRH A;  2HOT A;  3E6C C;  3H9G A;  4AYB A;  5TRD A;  4OU0 A;  1KGS A;  2FMY A;  2DFF A;  2H6B A;  4HX8 A;  1ETO A;  2COB A;  3LQR A;  1ZK8 A;  1FSE A;  3G3Z A;  3NAR A;  4C30 A;  2KMU A;  5CLS A;  3JRH A;  1VQ5 I;  3HUG B;  2XC7 A;  1LPQ A;  2CQ7 A;  1JKO C;  2QQA A;  4JQF A;  1FOX A;  1XG1 A;  2MYS A;  4M6Y A;  3ZXS A;  1SMY F;  2CO5 A;  2FSW A;  4YIF A;  4X0G A;  3K9T A;  2LTP A;  2KHM A;  2P7C B;  2K7L A;  1XSX A;  4UVC A;  4MFE A;  3MWM A;  4BEH B;  1X1D A;  3Q0U A;  2XUB A;  1KQ0 A;  1G3Y A;  3L7W A;  3AL0 C;  1IO2 A;  5IP6 A;  3EUK L;  1XD7 A;  4RS8 A;  4CA0 A;  4IRG A;  3VEP A;  1QZY A;  2OPT A;  5F27 A;  3C2B A;  3L2C A;  2O9L A;  3BR0 A;  2JZY A;  3B6A A;  3P9C A;  1MBH A;  2NYX A;  4XLA A;  3RYR A;  5BS6 A;  3RPU D;  3ABM H;  5F1J A;  1HKS A;  1HQC A;  1PUE E;  1FOK A;  4LGW A;  3OYG A;  2DA3 A;  1BI2 A;  3HOW J;  4ITV A;  4RAZ A;  2XGC A;  2WA0 A;  4JX6 A;  2CW0 F;  5LHH A;  1BOA A;  4OIP F;  2JA6 J;  1G2H A;  4M9X A;  4KUM A;  3W2A A;  3PNY A;  4ZYG A;  1K61 A;  4ETS A;  3LWF A;  4A0X A;  5L3C A;  1T6S A;  5CQG A;  4OIN F;  3H3U A;  2LMD A;  1Z05 A;  3HRS A;  3P7N A;  4HW0 A;  2ESN A;  3CF2 A;  3M1C A;  3W6J B;  2Y2Z A;  4Z2Y A;  3AL0 B;  2C6Y A;  3CMA I;  3BG6 A;  5BOX A;  3QRF F;  2BY2 A;  2FU4 A;  4RB2 C;  4ZDO A;  1ZRC A;  1G4D A;  2R93 J;  1IUF A;  1K4S A;  3GF2 A;  1HW1 A;  2EZI A;  2W1O A;  1O3T A;  2DA5 A;  1NH3 A;  2R7Q A;  4I99 C;  3NWS A;  2VQL A;  4JYK A;  4AWX B;  1H9T A;  2BW3 A;  2JA5 J;  3GCM A;  1D5V A;  4CO8 A;  4HF2 A;  1S7A A;  3IRR A;  5C44 J;  5DCM A;  1HF0 A;  4U87 A;  2B0L A;  4OIQ F;  4N4O B;  4BHC A;  4PJM A;  1ETY A;  4A3L J;  4HX7 A;  3M7G A;  5GTI C;  3FBI B;  3OV8 A;  2MG4 A;  3OIP A;  4P5O A;  4XLN F;  5HOO A;  1L3L A;  1MJ9 A;  1EH6 A;  3IH3 A;  1X3W B;  2CU7 A;  2W48 A;  1ZR4 A;  3ZQL A;  1W7P A;  2M7B A;  3I4M J;  2NS7 A;  2XIG A;  3RTR A;  1FOY A;  2M5W A;  1KON A;  4G7H F;  1E17 A;  1QA6 A;  4MIM A;  1ZRD A;  2Y48 A;  4IKF A;  1SFK A;  2BVL A;  4ANJ A;  2IXS A;  4U0W A;  1I3Q J;  1UG2 A;  2X48 A;  5DD4 A;  4KIT B;  2BE5 F;  3OWT A;  4II3 A;  1JGS A;  3I54 A;  4MHG A;  3S3M A;  3M3Y J;  2HPI A;  3FXO A;  4BDY A;  1USS A;  1UZC A;  3MKL A;  1FWZ A;  4XQF A;  5GAD J;  5JLW A;  1FLI A;  3O6B B;  1D8K A;  3BZC A;  5K7F A;  3QYE A;  4J01 A;  1GXQ A;  3H35 A;  1PYV A;  4XRF A;  1TWH J;  1ZG5 A;  5AIP A;  2GA2 A;  4I0A A;  1Z6T A;  2ECC A;  4H4K C;  2GXB A;  2RQQ A;  2VQH A;  3CDI A;  3DKX A;  4CCN A;  5EDN A;  2ESH A;  2DT7 B;  1NTC A;  3K4M A;  3ZQI A;  3CD6 I;  2FD5 A;  4PSW A;  3R4K A;  1FC3 A;  3U1K A;  4PJL A;  5FKK A;  4J19 A;  1NHA A;  1JJ6 C;  1OCP A;  5M3M J;  1MMD A;  2KRC A;  1SAU A;  3H5N A;  2CUZ A;  1Z21 A;  3JSO A;  2JVG A;  4MLO A;  4OIR F;  4WXD A;  4RM3 A;  5TGT A;  3N05 A;  2CV2 A;  3O8H A;  2CQK A;  4EEF G;  4GRI A;  2HXO A;  4PUS A;  1ZKG A;  1BJA A;  1OYI A;  3WOD F;  1IDY A;  1OKR A;  4BGD A;  3EYI A;  3KYD B;  1Y39 A;  3KIO A;  3L1P A;  1ZTR A;  2VE8 A;  5LRS A;  3CCE I;  3A0H C;  2BEO A;  2DMQ A;  3CJT B;  1ON2 A;  1A04 A;  4ON0 A;  4ENN A;  9ANT A;  2P6T A;  2ZO4 A;  3DBL B;  2R5Y B;  1HXD A;  2X51 A;  2IGK A;  3Q3S A;  5FGM A;  1XSV A;  5LLQ A;  2JUC A;  5E1Z B;  5ICG A;  4GO1 A;  2V9V A;  2XB5 A;  2JPB A;  4RGR A;  1FYL A;  3GX4 X;  4E7I A;  5HLT A;  3LFU A;  2RV8 A;  3G1O A;  2IGM A;  3CCS I;  2HEO A;  5DUI A;  2GWR A;  4XR6 A;  4ESB A;  3FXR A;  5D4S A;  1IG7 A;  2XRL A;  3HUG A;  1DP3 A;  2DTZ A;  3OYH A;  1W4M A;  4RBO A;  3L00 A;  1ZAO A;  2QKM B;  2NXN B;  4UNO A;  3OYB A;  1WSU A;  4AID A;  2E2I J;  2WY7 Q;  1OMI A;  2L54 A;  3OYF A;  3S2D J;  4DW6 A;  4A0Z A;  3DP7 A;  3OMY A;  1X1B A;  3F3X A;  1JI8 A;  2MH9 A;  4EJV A;  2GXG A;  2LY1 A;  2XB0 X;  3CCM I;  4Q5S F;  4P1W A;  2Z2S B;  2A6E F;  3V7C A;  5J3L A;  4DZP A;  2DT5 A;  4AVP A;  2CUJ A;  3LL7 A;  4DYR A;  4PJJ A;  2YPR A;  2CUF A;  5IT9 K;  3HKZ N;  3CCQ I;  1RKW A;  4CYD A;  3BG7 A;  3OYA A;  2Y9Z A;  5E18 F;  4QSH A;  2E2H J;  4D0P A;  2OCE A;  1TP4 A;  1R5G A;  1V55 H;  2LBF B;  4IZZ A;  4Y13 A;  2ELK A;  2X9D A;  3Q5F A;  1ETK A;  3I9V 2;  5JVG F;  1JT0 A;  3SJM A;  4HX4 A;  4RGU A;  2P5K A;  2DA7 A;  1ZN2 A;  1S5L C;  4A3B J;  3I59 B;  2OCC H;  2RRE A;  3IAM 2;  5CYV A;  2VAS A;  3BZ6 A;  2EPF A;  4UHT A;  5E1X A;  1LVK A;  3CTA A;  2A68 F;  4L9T A;  2L5Q A;  3WG9 A;  5D5X B;  1QZE A;  1YJW I;  5CVU A;  1KU7 A;  1W5C C;  2EWN A;  3O8G A;  3PSF A;  4A3K J;  1I5Z A;  1YS7 A;  1IW7 F;  2PQ8 A;  4UXN A;  3F8N A;  4B4C A;  5A2Q K;  4XKC A;  1A6Q A;  2H8W A;  3ASO H;  3S93 A;  4PGG A;  1K83 J;  1TWG J;  3E7L A;  4WX9 A;  2XAS A;  2Z99 A;  5DS9 A;  3GYH X;  1JKQ C;  3MQ0 A;  3WTX C;  1T95 A;  3KYC B;  3IWF A;  5IT3 A;  3L2Q A;  1J09 A;  2QQB A;  3OYC A;  3J7Z I;  2ZNZ A;  5EYR A;  1J7K A;  2YU3 A;  3ABK H;  3D0S A;  1SAN A;  1UB9 A;  2DK5 A;  2EH3 A;  5EZG A;  4HNT A;  3OYD A;  1E0E A;  4RAG A;  3VB2 A;  3EYY A;  1AU7 A;  1ZH5 A;  1F1Z A;  3GWZ A;  4PFP A;  2A5Y B;  4A5N A;  2LD5 A;  1T0F A;  3JTG A;  5DUK A;  1WH5 A;  1XGO A;  1P2F A;  2BY3 A;  2B7E A;  2CQX A;  1B72 A;  2XAG A;  5CVV A;  3FK6 A;  2IT0 A;  3S1Q J;  2VQC A;  4A2U A;  5FLX Z;  3JAM K;  4D7N A;  3HRM A;  1F36 A;  1ZRF A;  1FNN A;  3R0J A;  2K9L A;  2EIJ H;  2ZJP F;  2E71 A;  1MDM B;  3ZN0 A;  4FE4 A;  4BH9 A;  5KAI C;  3BRO A;  3WGH A;  3BCB A;  3OYK A;  2VT2 A;  1YIO A;  4HPQ A;  2E7X A;  3GTL J;  1FBQ A;  5LD2 C;  4KIC A;  2KIM A;  3R61 A;  1VTN C;  3ZGK A;  3NEU A;  2DA2 A;  3A4C A;  2V1U A;  4RLQ A;  4RB0 A;  1HBX G;  3E5U A;  1TLH B;  4IEJ A;  1FIP A;  5EJC A;  2WV0 A;  3WTZ A;  5B3S H;  1FZP B;  1YW8 A;  4WWC A;  4BQQ A;  4WK8 F;  1ZG1 A;  2ID3 A;  1U9N A;  1W0U A;  3I4P A;  1FIA A;  1R1U A;  5GAH J;  3DFG A;  1P4A A;  4ZC3 A;  4V19 K;  2XF5 A;  5DTD A;  1JTX A;  4FET A;  3G1L A;  4NC8 A;  1POG A;  2DQL A;  4WXH A;  3N97 A;  3QWL A;  1UST A;  3M07 A;  2G7H A;  2CGP A;  1YIJ I;  4NC6 A;  5IY5 H;  4NB5 A;  1R4N B;  2OTL I;  1QZZ A;  2R5Y A;  1F4K A;  4DBR A;  2JRT A;  4C2U A;  1FBU A;  1LDJ A;  3V8L A;  1IV8 A;  1WJE A;  2W84 A;  2LG4 A;  3H9J A;  3GFM A;  5LEJ A;  4J00 A;  3CCU I;  4RAY A;  4B44 A;  3O3K A;  1RR8 C;  5E1W A;  2JT1 A;  1B9M A;  5E8I A;  4BE1 A;  3MZH A;  3TL4 X;  3DF8 A;  1WJC A;  3K4J A;  5HDG A;  1ETQ A;  3FBN B;  1AOY A;  3SQN A;  2J5O A;  3TP0 A;  1V5F A;  4B43 A;  3JRB A;  5EEG A;  2YX4 A;  4F52 A;  4A3M J;  2ISZ A;  3HOZ J;  2VL8 A;  3ZQG A;  2P8T A;  5L3B A;  1XCB A;  3G73 A;  3GZN B;  4FQG A;  1WJA A;  3PFI A;  3HPH A;  4BDZ A;  1W36 D;  5TIS C;  4HF1 A;  3HC7 A;  2Z33 A;  2O8X A;  3DKY A;  3LSR A;  4C3J J;  5DV5 A;  2ACJ A;  3FMR A;  4AIJ A;  1XGN A;  1FMW A;  1D3Y A;  2L7M P;  3BWG A;  4L0Y B;  4A6D A;  3DTK A;  3OYL A;  4I76 A;  5ED4 A;  2IRF G;  5M5Y J;  2FBK A;  3OYJ A;  1QU3 A;  2R4G A;  4B48 A;  4HAM A;  3E6M A;  5ILS A;  2FOW A;  1HW2 A;  1UG0 A;  3X2Q H;  2KIF A;  3K4L A;  3OYM A;  1Z6R A;  2W7N A;  4ZYD A;  2EZK A;  2VT3 A;  3CCV I;  2DA6 A;  3I56 I;  2JUG A;  1DUX C;  1XDS A;  1FY7 A;  1BW5 A;  2LBF A;  2LSO A;  2XF7 A;  4ZDL A;  2HQN A;  4E7Z A;  4ENM A;  2R0Q C;  3K1M A;  3K7A J;  2IBD A;  3TBI A;  1T56 A;  1LNW A;  3E97 A;  2E1M C;  3PSI A;  1R71 A;  4XIC A;  3I59 A;  4B3X A;  4XSZ F;  2IEK A;  5GAE J;  1TL8 A;  2DMP A;  2VIX A;  2WAD A;  1QPI A;  2OA4 A;  1XMK A;  1AA7 A;  2DBB A;  3OYN A;  1B4A A;  4IOC F;  3SDB A;  4HBL A;  3HRU A;  1ONV A;  1KQ8 A;  2VLA A;  1LJ9 A;  4HNV A;  4GYG A;  3VOE A;  2LLK A;  2PEX A;  1OCZ H;  2ZME C;  3ZQ7 A;  3GLL A;  3JRF A;  2L7Z A;  4A3D J;  1IRG A;  3H3V K;  1DPU A;  1WHU A;  2ME6 A;  5HS8 A;  1R36 A;  1Y56 A;  3RI4 A;  2M30 A;  2QCO A;  2MC3 A;  2L02 A;  2QA4 I;  1MND A;  3IKT A;  2EZH A;  3KZI C;  1QVU A;  1GXP A;  4G6T B;  3RPU A;  4X1E A;  4XOP A;  4HF0 A;  3ZMV A;  4M3D A;  3BQY A;  3E1S A;  1Z77 A;  2QKL B;  4CYC B;  3FHZ A;  2W00 A;  3H92 A;  4EAT A;  3CDH A;  4N0B A;  2GQQ A;  4BAC A;  1MBK A;  3F8M A;  4BXF A;  3SEQ A;  1MBE A;  1YOV B;  4BQN A;  2Y31 A;  3J80 K;  1Z7U A;  2HPM A;  2EV6 A;  3L09 A;  1G3S A;  4F93 B;  4CSW A;  5E79 C;  2ZME B;  3CDL A;  2KRF A;  4I0B A;  1PJR A;  4HLX A;  3L2R A;  2IA2 A;  2LC2 A;  4BBS J;  2EJR A;  2Y75 A;  2OJE D;  4L9J A;  2A5W A;  5EGO B;  3L2W A;  3A2K A;  3CES A;  2Q0O A;  2BXZ A;  4HOB A;  4XLH A;  4YFX F;  1R5H A;  5HVQ C;  1BBY A;  3OSF A;  1I39 A;  5DDG A;  2KDO A;  2VKD A;  4F55 A;  1FSH A;  1WH7 A;  1STZ A;  2X6W A;  2CV0 A;  2RGV A;  1MDM A;  2X1E A;  2PG4 A;  3MZY A;  4QIW N;  4DOZ A;  5KK1 A;  2PMZ N;  2JA7 J;  4ABZ A;  2NNN A;  4KIS A;  2I8D A;  3FWE A;  3BR6 A;  1KU2 A;  4O3M A;  4JX5 A;  4LIV A;  4ZH4 F;  1TWF J;  1RI7 A;  2GOM A;  1IZ1 A;  4L5E A;  3VFZ A;  1WJF A;  3F0C A;  3JSP A;  3F6O A;  4E7K A;  1UFM A;  2EK5 A;  5IYC J;  3KLO A;  3DCF A;  2CRG A;  3A03 A;  2HDD A;  4G9Y A;  4XM3 A;  4XRS A;  2XAJ A;  2JQ7 A;  3ZQQ A;  5F0F A;  4ZJZ A;  5EEH A;  1V3F A;  4HV6 A;  4PDK A;  2JTV A;  2EIN H;  4DJA A;  4UUS B;  3JRC A;  2VPL A;  2FX0 A;  2VE9 A;  4EM1 A;  3MZ8 A;  1ZHF A;  4A6E A;  3Q0V A;  3HOX J;  2WAF A;  5LFA A;  1ODD A;  1MKM A;  1QNT A;  3ELK A;  3RQI A;  3A02 A;  4BS9 A;  3RKY A;  1SFE A;  1Q1H A;  3S16 J;  3REO A;  4UVA A;  1FP2 A;  1A31 A;  2WWY A;  2EFW A;  2PJR B;  2W85 A;  1VQM I;  2A3S A;  5FJ8 J;  2KRH A;  2H6C A;  4D7M A;  2VON A;  2ZFW A;  4G7O F;  1WI3 A;  2HVS A;  3VSL A;  2JN6 A;  1K6O A;  4RAF A;  1WGX A;  2QQ9 A;  2ZXI A;  3L2V A;  1BW6 A;  4LG0 B;  4G6Q A;  3CLQ A;  2BZT A;  4NQW B;  1X3Z B;  2VPR A;  1PDN C;  1YX5 A;  4IL6 C;  2KL4 A;  4LOC A;  3DLL F;  2AS5 F;  4UUT A;  3ROU A;  3DPT A;  2V79 A;  1MSF C;  3BTC A;  2Y0S N;  1PP7 U;  1BJZ A;  2EFQ A;  4RLF A;  4GCV A;  4YIR X;  3GTQ J;  2ZJ2 A;  4UVB A;  3AG3 H;  1LEB A;  2CQQ A;  1D1C A;  3B02 A;  2KZG A;  3PL8 A;  1Y1V J;  2X4H A;  4PK4 A;  1ETV A;  3CUQ C;  1F43 A;  4E7S A;  2HDW A;  1W36 C;  2OD5 A;  4UV9 A;  4MQV A;  2JA2 A;  1FTZ A;  2HVR A;  4XRM A;  3SZG A;  5FB2 A;  3E3V A;  2NVY J;  2NVX J;  1N78 A;  2IVM A;  3ERE D;  2L0K A;  1ZGJ A;  2GXA A;  1APL C;  2BBY A;  1XGS A;  2IS6 A;  1J59 A;  3BR5 A;  2AQF A;  1J75 A;  2FBI A;  1O7F A;  1VQP I;  3F6V A;  1UCR A;  3PIP F;  1TT5 B;  2HVQ A;  3H5A A;  3ZP5 A;  1U78 A;  2H1K A;  3U1D A;  1VQO I;  1R22 A;  3RZO J;  1HC8 A;  3K70 D;  4HST A;  2RQP A;  3L2U A;  5LRR A;  3OR2 C;  3CUQ B;  1YX3 A;  3GME A;  3H3Z A;  4QLC U;  4EJU A;  1ITY A;  5HDN A;  4RB3 C;  3FM5 A;  3OYE A;  2ZJR F;  4ZZD A;  4EJW A;  3ERM A;  3GTO J;  1UAA A;  4M6X A;  1KZH A;  2HQ5 A;  1JUP A;  3H1C A;  2IS4 A;  1WCM J;  2LDU A;  1QBJ A;  2HOE A;  1OJL A;  2VBX A;  2GLO A;  2FQ3 A;  4IRH A;  2A6T A;  2EV5 A;  2DN0 A;  2QM3 A;  1WJD A;  4HV5 A;  4XN3 A;  1ZG3 A;  2PN6 A;  2D5V A;  3VYS B;  4HNU A;  2FNA A;  1TQP A;  2M7A A;  3OS1 A;  1RZ4 A;  2ISY A;  4PJN A;  1JKP C;  2MH2 A;  3DTE A;  1Y6I A;  2MA3 A;  5FKM A;  3I71 A;  1IAW A;  2ID6 A;  2K85 A;  4CYC A;  4HDU A;  2JWT A;  2X1D A;  2IAI A;  5FKL A;  2TDX A;  1YHQ I;  2M4K A;  2HWV A;  2R7F A;  2DPD A;  2XHK A;  4HYE A;  3I5U A;  1N75 A;  2ZME A;  4N9H A;  1ETX A;  3ABL H;  2VB6 A;  1Z91 A;  1B1B A;  3IRQ A;  4XN0 A;  2AQE A;  2LKS A;  2MD5 A;  1AKH B;  5CQE A;  4M73 A;  5IOZ A;  5EGO A;  2HYJ A;  1B72 B;  4BQA A;  2V7F A;  2O3F A;  1S29 A;  2HS5 A;  3IWZ A;  4I6Z A;  4A12 A;  1ZEL A;  5E17 F;  3D5R C;  1W5S A;  3V8J A;  3JRE A;  4Y52 J;  4PZJ A;  2FOK A;  2K5C A;  2X1C A;  3HZJ A;  1ORK A;  2JPC A;  2NAZ A;  1IN6 A;  2Q8K A;  5JHF A;  2GA1 A;  4Y33 A;  1EH8 A;  4XKV A;  4MEX F;  3FXQ A;  4NC7 A;  5E20 A;  4A0Y A;  4C3I J;  2ELH A;  2MGQ A;  1VQ7 I;  1SMT A;  5DM6 F;  5IT9 Z;  4AM3 A; 
#chains in the Genus database with same CATH homology
 2O6G E;  2W25 A;  1FYK A;  3FX3 A;  1YFH A;  3F8C A;  4M9S A;  1MD0 A;  2H09 A;  3FZV A;  2VBW A;  1TNS A;  1U6G A;  1F5T A;  5BQT A;  1IRF A;  1YW9 A;  4G8X A;  2LF7 A;  5A2Q Z;  1UHM A;  4IHS A;  1ZAR A;  4P55 A;  5FFZ A;  1T39 A;  3BP8 A;  4LG0 A;  2KIU A;  4NQW A;  1REP C;  3GLX A;  1P4X A;  5LGN A;  4RGS A;  2EFN A;  1CGP A;  1LDD A;  2QWW A;  2IW5 A;  3KEO A;  3WU1 B;  3IL2 A;  4Q47 A;  2V1X A;  4IVN A;  2A61 A;  1MGT A;  1QQI A;  4IPA A;  1YTY A;  2CWE A;  4I01 A;  3MAJ A;  2CSO A;  3I58 A;  2LF8 A;  3T8R A;  4TV7 A;  2W57 A;  1OPC A;  3JAM Z;  5F1R A;  2R3S A;  2ETH A;  3V7S A;  1MJB A;  2V6C A;  4Y17 A;  1H9G A;  2KKO A;  4KN7 X;  2IA1 A;  1JE8 A;  3I0T A;  2ZXJ A;  3T8T A;  3CUQ A;  4Q4Z F;  3GFJ A;  1W7P D;  5LEK A;  3R6S A;  4KDP A;  1ZGA A;  3IHU A;  3LFK A;  3LAP A;  4MTE A;  4ASN A;  3HSF A;  5J8F A;  2G9W A;  4L5I A;  4FHT A;  5HDK A;  3GZ6 A;  3U9G A;  2LKP A;  5K5O A;  4OOI A;  3Q9S A;  4Y15 A;  3EET A;  4XSX F;  3RPQ A;  1IXR C;  3DXJ F;  5BMZ A;  3PQJ A;  2F5E A;  3D5L A;  3GXO A;  2HDC A;  2VBZ A;  1G3W A;  2UZK A;  3KP3 A;  2XKP A;  2PFB A;  2EV0 A;  2FML A;  3DQV C;  3LST A;  5D5W B;  3MFK A;  1W5T A;  3QU6 A;  3I53 A;  1IN5 A;  3V4G A;  1RNL A;  5TJJ A;  1J5Y A;  2KJB A;  1T2K A;  4BHB A;  2K02 A;  1YYV A;  1CF7 B;  4ESF A;  5CVI A;  2QLZ A;  2E7W A;  3ZPL A;  2YX7 A;  4MTD A;  1DP7 P;  3TDU C;  2FE3 A;  2HTJ A;  2DQR A;  4I98 B;  5ICC A;  2XGX A;  4WF2 A;  2LNB A;  1XGM A;  1Z1D A;  3K69 A;  4IXA A;  2MBF A;  3DPL C;  3RKX A;  4ZZL A;  3OOP A;  1KA8 A;  5D8L B;  2VN2 A;  2K86 A;  4YG2 F;  2EFP A;  2ZNY A;  5D6F A;  3ZMZ A;  1O57 A;  1TTY A;  2UXN A;  2IA0 A;  2DPU A;  3KZZ A;  3HOT A;  3M1E A;  1O3S A;  2ZBK A;  4MNU A;  1TNT A;  1SD6 A;  1WKM A;  4P9F A;  2XV4 S;  1TQI A;  3C18 A;  1T38 A;  4O5V A;  3WGI A;  3WGG A;  1QO0 D;  3CLO A;  2DK8 A;  2PLY A;  2EB7 A;  4KA4 A;  4HQM A;  3T5X A;  2FA5 A;  1KYW A;  3HOS A;  4LK0 F;  4L9N A;  4R79 A;  2HFH A;  3MCZ A;  4G6D A;  4GGG A;  2PMH A;  4P96 A;  5L3G A;  3COA C;  3F8F A;  5J6X A;  1YG2 A;  3VOD A;  1ON1 A;  2L4A A;  1FP1 D;  4HDV A;  1K79 A;  4S05 A;  1HKQ A;  2W24 A;  2GIV A;  5K5R A;  1YO5 C;  3P9K A;  3FXU A;  2P7V B;  2AXL A;  3IC7 A;  1PP8 F;  2DW4 A;  4KMF A;  1MZB A;  1U5T C;  3J81 K;  2MLK A;  1OR7 A;  4LLG F;  4HQE A;  3T1B A;  3O2P E;  2M1B A;  1HW5 A;  4RGX A;  3DKW A;  1WQ2 A;  1TBX A;  2QUF A;  2P4W A;  3E5Q A;  3ZN1 A;  1ZYR F;  3PQK A;  4JK1 X;  4ZYE A;  4AD9 A;  3WTV C;  2DLL A;  1U3E M;  3HSE A;  3RYP A;  5ILV A;  1FPQ A;  4FX4 A;  1U5T B;  1FT9 A;  2FEZ A;  5BPI A;  1HST A;  4BNC A;  2QVO A;  4EJO A;  1BM9 A;  3SFZ A;  4L9V A;  5HLG A;  4UV8 A;  1P6R A;  4S04 A;  2Z9O A;  2VOO A;  1R00 A;  2QEN A;  3CO7 C;  4CGZ A;  4GXO A;  2EA4 A;  4UUV A;  3U2R A;  2IPQ X;  5HS7 A;  3TOA A;  3ZMT A;  3IKV A;  3GFI A;  1FX7 A;  4KMU X;  5H6Q A;  1CF7 A;  2MLG A;  1J9I A;  2HTS A;  4EVI A;  3LA3 A;  1SD5 A;  4NHJ A;  4H0E A;  4I09 A;  4EV0 A;  3C7J A;  4EMS A;  1I1S A;  4LK1 F;  1B59 A;  2L4M A;  3DEU A;  2XKO A;  3K1N A;  5AIQ A;  1R7J A;  5JI6 A;  4LJZ F;  4A5M A;  2QYO A;  5KVR A;  2A07 F;  4EJT A;  3BY6 A;  5F64 A;  5JFR A;  3HIF A;  3ECO A;  4EM2 A;  1K7A A;  3WE2 A;  4KIG A;  3HRT A;  3KLN A;  3KZY A;  4YFN F;  1IN7 A;  1J0R A;  4WXC A;  1IXC A;  2OZU A;  3LA2 A;  2VOP A;  2G7U A;  2O0Y A;  2XRO A;  2NS0 A;  2OBP A;  3KEQ A;  4L18 B;  1U2W A;  3CJN A;  3GVA A;  4P9U A;  2CG4 A;  1AWC A;  3ECH A;  1LDK B;  1Z9C A;  1S6L A;  5CVJ A;  4L5J A;  3BJO A;  2WTE A;  5D5V B;  2HYG D;  1GVJ A;  2HYF A;  2R7D A;  5HS9 A;  4B8X A;  3E6B A;  1O3R A;  1BN5 A;  2F5F A;  3R60 A;  1L0O C;  2DFI A;  1BI3 A;  3ZMS A;  3RDI A;  2OAZ A;  3BJA A;  5JHU A;  4KYW A;  3K2Z A;  4KNY A;  2DAO A;  3M8F A;  4BAY A;  1WI9 A;  2IP2 A;  2K4J A;  2ADU A;  3FMS A;  1I1G A;  1SD4 A;  1R58 A;  1ZLK A;  2OQR A;  1EH7 A;  3QP6 A;  2RNJ A;  4BYY A;  3GUD A;  1O3Q A;  5FFX A;  1I27 A;  2H94 A;  5D5U B;  4U88 A;  3C3W A;  3RIR A;  1IN4 A;  2RDP A;  2QBY B;  2XRN A;  3KP5 A;  5E8G A;  3B73 A;  1LB2 A;  2QZ8 A;  1SD7 A;  5FD5 A;  3QPH A;  2D1H A;  4YII A;  4ENJ A;  2HZT A;  4HLY A;  2F2E A;  3C1D A;  3FM3 A;  2DI3 A;  4M9Z A;  3GO5 A;  3E6D A;  4YFK F;  2NNY A;  1U5T A;  2OQG A;  1RIO H;  3BDD A;  2VBY A;  4KIB A;  1HSJ A;  2F5C A;  3F23 A;  2PJP A;  3KET A;  2HKO A;  4I02 A;  1FBS A;  2H27 A;  1LQ1 A;  1QGP A;  1BC7 C;  2EFO A;  3FMQ A;  1S8N A;  1TW3 A;  3HHH A;  2VOD A;  2CFX A;  2E1N A;  3TOB A;  3EQL F;  2RC4 A;  3TO9 A;  5L3E A;  5AON A;  2M8E A;  1UHW A;  2DO7 A;  2L3D A;  2O03 A;  1WWX A;  4M72 A;  4CIC A;  3TGN A;  1T98 A;  1XN7 A;  2Y0M A;  1G6N A;  4U7B A;  3T0Y A;  3HTS B;  3V8K A;  3WTU C;  5L3D A;  1JXS A;  3WTY C;  3LQQ A;  4LMY A;  1QPM A;  3FF5 A;  2A69 F;  3ML6 A;  3ZMU A;  5CJ9 A;  5DYM A;  1YW7 A;  4CZZ A;  5CVR A;  5ERI A;  2STW A;  2HKX A;  5ILU A;  5LHG A;  3KP6 A;  1EV7 A;  1WRJ A;  1K78 B;  3ABU A;  3QPT A;  4Q48 A;  2O61 A;  4ZYH A;  1IF1 A;  4LLL A;  3K1P A;  2STT A;  2M87 A;  1F9N A;  3TKY A;  1IN8 A;  3AAF A;  5H20 A;  2JSC A;  1J2X A;  1DPR A;  4LB5 A;  1BI1 A;  2GAU A;  2P5V A;  3ABT A;  3F22 A;  2YSR A;  3SZT A;  4ESJ A;  2P6S A;  1S3J A;  4R1H A;  3SZP A;  3HTU A;  4LFU A;  4OIO F;  1SFU A;  1IUY A;  4KFC A;  1RUN A;  2QBY A;  1KU9 A;  3GEZ A;  2BGC A;  5BPD A;  2A6H F;  4QWQ A;  3J7A O;  4M71 A;  2COM A;  5JR3 A;  1TW2 A;  2Z5U A;  5LHI A;  4KN4 X;  1P92 A;  2K4B A;  5F6F A;  2M45 A;  1XDU A;  5D4R A;  2L01 A;  1B9N A;  3KP2 A;  2PI0 A;  2RKH A;  1DDN A;  2DTR A;  2KJC A;  3K0L A;  5DEQ A;  2YR2 A;  4MGR A;  1X3U A;  5H6R A;  1P4W A;  2Q2E A;  3GW2 A;  5K5Q A;  3RKW A;  3HHG A;  1BIA A;  3R0A A;  4IRI A;  2WC2 A;  4LLN A;  1XSD A;  4HZF A;  5JVT A;  2EA2 A;  2BYV E;  4PGH A;  1XB4 A;  4EGZ A;  2GZW A;  1XCV A;  4XLP F;  2D2W A;  1E2X A;  3Q9V A;  1FYM A;  4XBF A;  3WTS C;  5LGU A;  1KU3 A;  1C0W A;  2FXA A;  2RVC A;  4KT5 C;  1BC8 C;  3BPV A;  2PMU A;  2DU9 A;  4OMZ A;  1OYY A;  5K1Y A;  2UWM A;  4FX0 A;  4BXU A;  4LD5 A;  2FNP A;  3GFL A;  3EUH A;  1HKT A;  2XAQ A;  3NQO A;  2E1C A;  2D45 A;  3J81 Z;  3HSR A;  4EQQ A;  3WTT C;  1MJA A;  2OU2 A;  2X0L A;  4HA8 A;  2VXZ A;  5LBQ A;  1YQA A;  4AIH A;  4L0Z B;  3RJP A;  4KIF A;  3KE2 A;  3QP5 A;  3TO7 A;  3V7R A;  1G3T A;  3JTH A;  2CYY A;  4RB1 A;  2NRA C;  1LVA A;  1S7O A;  1I6X A;  1TQM A;  3TQN A;  3BJ6 A;  2J5P A;  1O7L A;  4I7H A;  2BV6 A;  5DCF A;  1K78 A;  3J80 Z;  4ENK A;  1GHC A;  3TDZ C;  2VC0 A;  4M74 A;  4FT8 A;  4GYI A;  5FD6 A;  5FLX K;  2ZCW A;  3TO6 A;  1D8J A;  3GZ5 A;  4U0Y A;  5ICE A;  3KP7 A;  5LGT A;  2PBI A;  3HYI A;  1XMA A;  3QU3 A;  3W6K B;  1YLF A;  5D8K B;  1ZLJ A;  1JHF A;  4IF4 A;  3L9F A;  3EDP A;  5J8C A;  3M8E A;  5HLI A;  3N4M A;  2D1V A;  1R1T A;  4DQ2 A;  1ZRE A;  2RN7 A;  1H0M A;  2ZKZ A;  3BPX A;  5FO5 A;  3BOQ A;  1JHH A;  1V4R A;  3CO6 C;  2XVC A;  2K27 A;  2FF4 A;  1LEA A;  2OZ6 A;  3ISP A;  4E70 A;  1U8R A;  1RUO A;  2P5L C;  2VC1 A;  4EGY A;  3I64 A;  2XAF A;  5DCM B;  3KFW X;  3WU0 A;  4N9I A;  1BIB A;  3MEX A;  3WTW C;  3ULQ B;  4O6J A;  1IXS B;  3F72 A;  4OMY A;  1BI0 A;  4R8H A;  2UXX A;  2FBH A;  4LB6 B;  1W7P B;  5L3F A;  4AIK A;  5DD8 A;  4BHP A;  4B09 A;  3KP4 A;  4MEY F;  2HGC A;  1KYZ A;  4G94 A;  3CUO A;  3DV8 A;  3S2W A;  4G7Z F;  6PAX A;  2V1D A;  3QAH A;  3ZMD A;  3LAJ A;  4DNC A;  1ULY A;  1SAX A;  2F5D A;  1OYW A;  3NRV A;  4MQ9 F;  5D6E A;  4IJA A;  4U7D A;  4CHU A;  3E5X A;  2HR3 A;  3KCC A;  5ICF A;  1KQ9 A;  2XAH A;  3QOP A;  2IJL A;  4EM0 B;  4CDG A;  4CXF A;  1SFX A;  1B6A A;  4JBA A;  1R1V A;  1Y0U A;  2Z3Y A;  3F21 A;  3SHF A;  4I2O A;  3LA7 A;  4F7Z A;  3SXY A;  1YS6 A;  2HQR A;  4WCG A;  3JW4 A;  3P9I A;  4K2E A;  3M9A A;  4PCQ A;  5HLH A;  3WE3 A;  3F8B A;  4U0V A;  1R23 A;  4IHT A;  2FRH A;  3E6C C;  5TRD A;  4OU0 A;  1KGS A;  2FMY A;  2H6B A;  4HX8 A;  3LQR A;  1FSE A;  3G3Z A;  5CLS A;  2QQA A;  4JQF A;  4M6Y A;  1SMY F;  2CO5 A;  2FSW A;  4YIF A;  3K9T A;  2P7C B;  2K7L A;  1XSX A;  4UVC A;  3MWM A;  2XUB A;  1KQ0 A;  1G3Y A;  3L7W A;  1XD7 A;  4RS8 A;  4IRG A;  3VEP A;  1QZY A;  3L2C A;  2JZY A;  3P9C A;  2NYX A;  3RYR A;  5BS6 A;  1HKS A;  1HQC A;  1PUE E;  1FOK A;  4LGW A;  1BI2 A;  4RAZ A;  2CW0 F;  5LHH A;  1BOA A;  4OIP F;  4M9X A;  4KUM A;  4ZYG A;  4ETS A;  3LWF A;  4A0X A;  5L3C A;  1T6S A;  4OIN F;  3H3U A;  3P7N A;  1Z05 A;  3HRS A;  4HW0 A;  2ESN A;  3W6J B;  4Z2Y A;  2C6Y A;  5BOX A;  3QRF F;  2FU4 A;  4RB2 C;  1ZRC A;  1G4D A;  3GF2 A;  1HW1 A;  1O3T A;  4AWX B;  1H9T A;  1D5V A;  4CO8 A;  4HF2 A;  1S7A A;  3IRR A;  5DCM A;  2B0L A;  4OIQ F;  4BHC A;  4HX7 A;  3M7G A;  4P5O A;  3OV8 A;  4XLN F;  5HOO A;  1L3L A;  1MJ9 A;  1EH6 A;  1W7P A;  2XIG A;  3RTR A;  2M5W A;  4G7H F;  1E17 A;  1ZRD A;  2Y48 A;  4U0W A;  5DD4 A;  2BE5 F;  1JGS A;  3I54 A;  4MHG A;  1USS A;  1FWZ A;  1FLI A;  3O6B B;  1D8K A;  1GXQ A;  4XRF A;  1ZG5 A;  5AIP A;  2GA2 A;  4I0A A;  1Z6T A;  2GXB A;  2ESH A;  3R4K A;  1FC3 A;  1NHA A;  3JSO A;  4OIR F;  4WXD A;  2CQK A;  1BJA A;  1OYI A;  3WOD F;  1OKR A;  3EYI A;  2VE8 A;  5LRS A;  2BEO A;  1ON2 A;  1A04 A;  4ON0 A;  4ENN A;  2P6T A;  2ZO4 A;  1HXD A;  5FGM A;  1XSV A;  5LLQ A;  5E1Z B;  5ICG A;  4GO1 A;  2V9V A;  2JPB A;  4RGR A;  1FYL A;  3GX4 X;  2RV8 A;  2HEO A;  5DUI A;  2GWR A;  4ESB A;  3FXR A;  5D4S A;  3HUG A;  1W4M A;  3L00 A;  1ZAO A;  4UNO A;  1WSU A;  1OMI A;  2L54 A;  4A0Z A;  3DP7 A;  3F3X A;  2MH9 A;  4EJV A;  2GXG A;  4Q5S F;  2A6E F;  3V7C A;  2DT5 A;  4AVP A;  2YPR A;  5IT9 K;  4CYD A;  5E18 F;  4D0P A;  1R5G A;  4Y13 A;  3Q5F A;  4HX4 A;  4RGU A;  2P5K A;  1ZN2 A;  3I59 B;  5CYV A;  3BZ6 A;  4UHT A;  5E1X A;  3CTA A;  2A68 F;  4L9T A;  3WG9 A;  5D5X B;  5CVU A;  1KU7 A;  2EWN A;  1I5Z A;  1YS7 A;  1IW7 F;  2PQ8 A;  4UXN A;  3F8N A;  5A2Q K;  4PGG A;  4WX9 A;  2XAS A;  2Z99 A;  3GYH X;  3MQ0 A;  3WTX C;  3IWF A;  5IT3 A;  2QQB A;  2ZNZ A;  1J7K A;  2YU3 A;  3D0S A;  1UB9 A;  2DK5 A;  3VB2 A;  3EYY A;  1ZH5 A;  1F1Z A;  3GWZ A;  4A5N A;  2A5Y B;  1T0F A;  3JTG A;  5DUK A;  1XGO A;  1P2F A;  2XAG A;  5CVV A;  2IT0 A;  4A2U A;  5FLX Z;  3JAM K;  3HRM A;  1ZRF A;  1FNN A;  3R0J A;  1MDM B;  3ZN0 A;  4BH9 A;  3BRO A;  3WGH A;  2VT2 A;  1YIO A;  2E7X A;  1FBQ A;  4KIC A;  2KIM A;  3R61 A;  1VTN C;  3NEU A;  2V1U A;  4RB0 A;  1HBX G;  3E5U A;  1TLH B;  2WV0 A;  3WTZ A;  1FZP B;  1YW8 A;  4WWC A;  4WK8 F;  1ZG1 A;  3I4P A;  1R1U A;  3DFG A;  1P4A A;  2DQL A;  4WXH A;  3N97 A;  1UST A;  2G7H A;  2CGP A;  4NB5 A;  1QZZ A;  1F4K A;  2JRT A;  1FBU A;  1LDJ A;  3V8L A;  2W84 A;  3GFM A;  5LEJ A;  4RAY A;  3O3K A;  5E1W A;  2JT1 A;  1B9M A;  5E8I A;  3MZH A;  3DF8 A;  5HDG A;  1AOY A;  3SQN A;  2J5O A;  5EEG A;  2YX4 A;  2ISZ A;  5L3B A;  2P8T A;  1XCB A;  3G73 A;  3PFI A;  4HF1 A;  2Z33 A;  2O8X A;  5DV5 A;  2ACJ A;  3FMR A;  4AIJ A;  1XGN A;  1D3Y A;  4L0Y B;  3BWG A;  4A6D A;  5ED4 A;  2IRF G;  2FBK A;  4HAM A;  3E6M A;  5ILS A;  1HW2 A;  2KIF A;  1Z6R A;  4ZYD A;  2VT3 A;  1DUX C;  1XDS A;  1FY7 A;  2LSO A;  2HQN A;  4ENM A;  3K1M A;  1LNW A;  3E97 A;  3I59 A;  4XSZ F;  2OA4 A;  1XMK A;  2DBB A;  1B4A A;  4HBL A;  3HRU A;  1ONV A;  1KQ8 A;  1LJ9 A;  4GYG A;  3VOE A;  2PEX A;  3ZQ7 A;  1IRG A;  1DPU A;  5HS8 A;  1R36 A;  3RI4 A;  2M30 A;  2MC3 A;  2L02 A;  3IKT A;  1GXP A;  3RPU A;  4HF0 A;  3ZMV A;  3FHZ A;  3H92 A;  3CDH A;  4N0B A;  2GQQ A;  3F8M A;  3J80 K;  1Z7U A;  2EV6 A;  3L09 A;  1G3S A;  2ZME B;  2KRF A;  4I0B A;  4HLX A;  2IA2 A;  2EJR A;  2Y75 A;  4L9J A;  2Q0O A;  4HOB A;  4YFX F;  1R5H A;  5HVQ C;  1BBY A;  5DDG A;  1FSH A;  1STZ A;  2RGV A;  1MDM A;  2PG4 A;  3MZY A;  5KK1 A;  2NNN A;  3FWE A;  1KU2 A;  4O3M A;  4ZH4 F;  1RI7 A;  1IZ1 A;  3VFZ A;  3JSP A;  3F6O A;  1UFM A;  2EK5 A;  3KLO A;  4G9Y A;  2XAJ A;  5EEH A;  1V3F A;  4HV6 A;  4PDK A;  2JTV A;  2VE9 A;  4EM1 A;  1ZHF A;  4A6E A;  1ODD A;  1MKM A;  1QNT A;  3ELK A;  3RKY A;  1SFE A;  1Q1H A;  3REO A;  4UVA A;  1FP2 A;  2WWY A;  2EFW A;  2W85 A;  2A3S A;  2H6C A;  2VON A;  2ZFW A;  4G7O F;  1K6O A;  2QQ9 A;  4LG0 B;  4G6Q A;  1PDN C;  2AS5 F;  3ROU A;  3DPT A;  2V79 A;  1PP7 U;  2EFQ A;  4GCV A;  2ZJ2 A;  4UVB A;  1LEB A;  3B02 A;  2X4H A;  3CUQ C;  2OD5 A;  4UV9 A;  4MQV A;  5FB2 A;  3E3V A;  2IVM A;  3ERE D;  1ZGJ A;  2BBY A;  1XGS A;  1J59 A;  1J75 A;  2FBI A;  1O7F A;  3F6V A;  1UCR A;  3ZP5 A;  1U78 A;  3U1D A;  1R22 A;  2RQP A;  5LRR A;  3CUQ B;  3H3Z A;  4QLC U;  4EJU A;  5HDN A;  4RB3 C;  3FM5 A;  4ZZD A;  4EJW A;  4M6X A;  2LDU A;  1QBJ A;  2HOE A;  2VBX A;  2FQ3 A;  4IRH A;  2EV5 A;  2QM3 A;  4HV5 A;  1ZG3 A;  2PN6 A;  2FNA A;  1TQP A;  1RZ4 A;  2ISY A;  2MH2 A;  2MA3 A;  3I71 A;  1IAW A;  4HDU A;  2TDX A;  2HWV A;  2R7F A;  2DPD A;  2XHK A;  4HYE A;  3I5U A;  2ZME A;  4N9H A;  1Z91 A;  1B1B A;  3IRQ A;  2MD5 A;  4M73 A;  4BQA A;  2O3F A;  1S29 A;  2HS5 A;  3IWZ A;  4A12 A;  5E17 F;  1W5S A;  3V8J A;  4PZJ A;  2FOK A;  2JPC A;  2NAZ A;  1IN6 A;  2Q8K A;  2GA1 A;  1EH8 A;  4MEX F;  3FXQ A;  4A0Y A;  5E20 A;  2ELH A;  1SMT A;  5IT9 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...