1I3AA

Rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i3aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i3aA01
3AVIA 1KFDA 1HQUA 1WAFA 3DLKA 4M41A 1KLMA 4ELUA 4E89A 2Z1IA 2EX3A 2F8SA 3M8RA 3KLEA 1C0MA 2QKBA 1S5JA 4DTNA 1A5VA 4B9UA 4N41A 3ZSXA 3RTVA 3QEIA 1SL1A 3TAFA 1REVA 1QSSA 4CJUA 4CIFA 3S3NA 3IAYA 4FLWA 3P5JA 3DLGA 2XY7A 2ETJA 3O4QA 1JKHA 1IKXA 4AHUA 4HTUA 4KV8A 1S1XA 4DMNA 3QETA 3F73A 1J53A 3C6TA 1WSIA 4W5OA 3L2QA 4B8AB 5I42A 4CEQA 3O3FA 1WSEA 2KFZA 4Z4GA 3ALYA 2VWJA 1VRUA 5KTQA 1R0AA 2KZMA 4B9VA 2D0AA 3K5OA 2YHBA 3AVFA 3AA5X 4FLXA 2F96A 4Z0UA 4W5QA 5CYQA 4J2DA 4DS4A 4E3SA 2D5RA 3RR7A 1MU2A 2OYQA 3LAKA 4CEEA 4PWDA 3ZSVA 3DRPA 3MAQA 2JGUA 4CJFA 3U6FA 2ITGA 4DQIA 4GVMA 1NK4A 3BDPA 4OPKA 1BI4B 1KVCA 4FXDA 4FW1A 1U04A 3PX0A 1C1CA 4BACA 1QQCA 4BDZA 4CFAA 4BE1A 3OYEA 4DLEA 4KHSA 1EETA 2XY8A 4FVMA 4JRPA 4DWIA 3CYMA 4BWMA 3OYFA 1RDDA 1U48A 1TK5A 4PUOA 2HHVA 1WNSA 5K14A 5HRNA 4ZTJA 4M3WA 1KFSA 3KLIA 2FBTA 1ASUA 3K2PA 3DLEA 3NGYA 4OGCA 2D0BA 1GOAA 2PYJA 3A2FA 1Z26A 4BE0A 1BIZA 1KRPA 5KGWA 3ASMA 2HMIA 1QSYA 1WAJA 4HUEA 3ISNC 1CZBA 3DI6A 4CECA 4BE2A 1RT5A 3VA3A 3NDKA 1T8EA 4FZZA 4E1NA 1HPZA 1VSDA 4GW6A 3TWHA 4DTSA 1HYVA 4QOZB 4F2RA 4IG0A 2P5GA 4CF1A 4RW4A 1SV5A 3RMDA 4K8ZA 1LW2A 3KLGA 3O4NA 4CIEA 2YV0X 5HRSA 4TSXA 2IAJA 3KK3A 3HL8A 4KAZA 4CF2A 3T3FA 4CHOA 3NFAA 4FJJA 4DFKA 1JLGA 4JS5A 4CFDA 1RTIA 3PX6A 4EZ6A 4DSEA 1BIUA 1BISA 4MFBA 3NBPA 1ASVA 3DOKA 4CK3A 1A5WA 4CEDA 4W5TA 4DQRA 4FK4A 4CHQA 2VWKA 5CYMA 2OPQA 3LDSA 1NJZA 1KLNA 3SI6A 1C1BA 4DS5A 2KW4A 3L2RA 2PZSA 3TAEA 3OYAA 4FLYA 1NK7A 4KI6A 3OVNA 4RW8A 4CESA 5J2NA 3AVCA 3HK2A 4H4MA 4XIUA 3HT3A 1HMVA 3DLRA 4H4OA 1ZBIA 3OJUA 2XO7A 1RBSA 1JL1A 5EU7A 3OYDA 1QSLA 4CGDA 4KKOA 5D3GA 2PY5A 4ZHRA 2OPPA 2X6NA 2OPRA 4FM2A 1U45A 3CG7A 1D9FA 4FK2A 1G15A 2RN2A 3KD5E 1JL2A 1FKOA 3S9HA 1JLAA 2FBVA 4CGJA 1KSPA 3AO3A 4DTMA 1S1UA 4CHZA 4GMJB 1BL3A 4CHYA 3MXMA 3L2UA 1O1WA 1B9FA 3SJJA 3ZSYA 4UQGA 4K8XA 1SKWA 4B9MA 1IO2A 3SUPA 1NJYA 1LAVA 1S6QA 3MXIA 3TI0A 3JSMA 4NCBA 4CHPA 2FC0A 5FROA 3V1QA 1NKCA 1L3UA 2Y1IA 4M3TA 1RT2A 4BDYA 4DFPA 3MEGA 2G8KA 4PQUA 1NJXA 1WSHA 4CJKA 3VA0A 3C94A 3TABA 3AVAA 2Z1HA 4M45A 4FJ7A 5FRNA 1EX4A 3PUFA 5KI6A 1LV5A 1RBVA 4AHVA 3O3HA 4ICLA 1FKPA 2RKIA 3CQ8A 4C8OA 1XWLA 5C24A 1CXUA 4IFYA 3VQ9A 3K5LA 3U3YA 1L5UA 2D0CA 2IDOA 4AH9A 4HUGA 4B3OA 5JS2A 1VSJA 3D0PA 4FJIA 1JLEA 3OYGA 3EZ5A 2GBZA 1VRTA 1HYZA 3SV3A 3QEVA 4KRFA 4O0IA 4DFMA 4B9TA 4DLGA 1CZ9A 4I2PA 1VK0A 1NKBA 5CZ1A 2DFFA 1TAUA 2IC3A 3TR8A 3ZT2A 3TAMA 4FZXC 4M3RA 5J2PA 4KHQA 3C95A 3WNEA 2OA8A 4CJTA 2ZQBA 4FZYA 4ID5A 2ZD1A 3NF9A 1D9DA 3QIPA 2R7YA 1SL0A 5T7BA 4DSLA 5KRTA 4AHSA 3DM2A 1KCFA 1Q9YA 4O55A 2DTUA 1BGXT 1DTQA 1IKWA 1B92A 1RILA 4RW7A 4KHNA 3JYTA 2QKKA 3QEPA 4QCLA 3NGZA 2DFHA 4O0JA 1X9SA 3RMCA 1KVAA 5C25A 1BQMA 1SUQA 3DYAA 4CFBA 1JLBA 2HNYA 4DTJA 3AA3A 3DMJA 5FDLA 3K5NA 4CGHA 3NAEA 4E0DA 4PY5A 2E4LA 1VSHA 1KTQA 2E6MA 3V6DA 3L8BA 2O4IA 2HVIA 1CLQA 3V9SA 2XRIA 1L3VA 4NYFA 1YVUA 3BGRA 4O4GA 4Y1CA 1TK0A 2Y1JA 3QERA 1U49A 2HW3A 4NCGA 4BWJA 3TANA 3FFIA 3DRRA 3AO5A 5C42A 2YNFA 3DLHA 3AO1A 4AHTA 1TGOA 3KLHA 2IGIA 3V4IA 1NOYA 5CZ2A 1RBUA 3HP9A 3T1AA 2LSNA 1NK0A 4DQPA 3OYCA 2OPSA 3V9WA 2G8WA 4FJHA 1W0HA 1HYSA 1XI1A 3VQQA 3SYZA 2Z1JA 4CJPA 1RDBA 3NF8A 4FJXA 4FJLA 2OZMA 3HO1A 2G8FA 3LWLA 4OKEA 2VG5A 1JLFA 3NF6A 3T19A 4C8KA 4LD0A 4CHNA 3ZT1A 3NCIA 2XY6A 3EYZA 3DRSA 3AVKA 4CCHA 2Z1GA 4C8MA 3F9KA 4F8RA 4M3UA 1C0UA 3QESA 1QE1A 1HNVA 1IKVA 4CK1A 1BI4A 3LAMA 3QLHA 1ZBFA 3MXJA 3WNHA 1YT3A 4N5SA 3KK1A 4CF8A 4HHTA 2ZE2A 2NUBA 5DK5A 4DTXA 4FJ8A 3OYKA 2DY4A 4C8NA 4ZTFA 2P51A 2VG6A 3U3GA 1RT1A 4LH4A 1BCMA 3AVNA 4H8KA 3TAQA 3OYBA 4YFUA 2GV9A 3SQ2A 1HJRA 3L2WA 1WSGA 3OS2A 3SUOA 4CJSA 4HCCA 4OVLA 5HRPA 3OY9A 3E01A 2VG7A 4FJ9A 4Q0BA 3ZSOA 1UOCA 2KQ2A 4CF0A 3ZSQA 3QNOA 3VQ4A 3D45A 2HNZA 1A5XA 4B8CA 4DTRA 2HHSA 3AVLA 2QXFA 3WNFA 3V9UA 1VSFA 1TAQA 4CJVA 1TKXA 3VQEA 3HVTA 1LWEA 3HSTB 1NK6A 2BANA 2E6LA 4KHYA 4DSJA 2KTQA 3DLBA 5J2MA 4F4KA 4CGIA 2F8TA 2GUIA 3ZT0A 4DQSA 3K59A 1RT4A 3SCXA 4ELTA 3RMBA 3RWUA 1S9GA 1YTUA 2QK9A 2RF2A 4DQQA 3RR8A 3K58A 3NE6A 3V1OA 1JXEA 1RT3A 2YKNA 3I0SA 1TK8A 3PY8A 1XHXA 2YNIA 4DU3A 3NHGA 3UIQA 3HPHA 4FJMA 1I39A 3PX4A 4DU1A 4J2EA 1RTJA 3ZSZA 4CE9A 3VQ6A 4Y1DA 1T05A 4CJQA 4F3TA 1YTAA 2B5JA 4OGEA 1Z25A 4FJGA 5J2QA 3VQBA 2P5OA 4ELVA 2A1RA 4EP4A 3QEXA 4M42A 1LWCA 2KFNA 3I0RA 4OKKA 1UA0A 1ITGA 1VSIA 4KREA 3AVHA 2B4JA 3LPTA 4LH5A 4CERA 1B9DA 3C6UA 1TV6A 4EP5A 3LP1A 4HCBA 4G1QA 4IG3A 4E7HA 4KI4A 4I9LA 4KHUA 4OLAA 5SWMA 3IRXA 2YHAA 3LPUA 1C1AA 3QIOA 4CEBA 4W5RA 3QO9A 4CFCA 3S3MA 4FJNA 1J54A 4IFVA 5HP1A 4ID1A 4CEAA 4Q5VA 3OS1A 1NK8A 3VQPA 4CEZA 3NGIA 4Z4HA 4CJ4A 3IS9A 2OZSA 4E7IA 3KJVA 2IS3A 1I3AA 3TAPA 2HB5A 4B9SA 1T7PA 2EHGA 3LANA 1ZBLA 4CF9A 4FYDA 3QNNA 4OPJA 4FLUA 2RPIA 5I3UA 4J2AA 3IG1A 1Q8IA 3AVJA 1Y97A 5KRSA 2HVHA 3ZCMA 3V9XA 1VSKA 2G8HA 4KHWA 3ITHA 1U4BA 4DSKA 4CIGA 4Z4IA 1JLCA 5HROA 4CJ3A 3CFOA 4OKJA 1HRHA 4CK2A 4B08A 3OYHA 4DU4A 4DTPA 1IH7A 3LP2A 4OJRA 1RDCA 4E7JA 1U47A 1XC9A 2G8IA 2YNHA 3ULDA 4M3XA 4CEOA 1HNIA 1L3TA 4DF4A 1EKEA 1F21A 1EP4A 3HYFA 1CXQA 1KVBA 4C8LA 4AHCA 2WOMA 4AHRA 3NF7A 4FLTA 4IKFA 3SPYA 4NCAA 2BE2A 3SQ0A 3OS0A 1X1PA 3SUQA 3OJSA 3B6PA 1RBRA 4E7KA 3VQDA 4LSLA 4DTUA 3QEWA 3THVA 4W5NA 3HM9A 1X9WA 2HHWA 1Q9XA 2X74A 1TL1A 4CJRA 3VQ5A 1IKYA 3P83D 3ZT4A 4FCYA 4RG8A 1RT7A 4O5BA 3RRHA 1X9MA 1DLOA 4EZ9A 4FJKA 3RRGA 4Z4EA 4RW9A 1BCOA 4HVJA 3HVRA 1GOBA 2G8VA 4KTQA 3VQCA 3P1GA 4IBNA 2I5JA 1NK9A 1UAXA 3SUNA 4E19A 1SKRA 1NOZA 3AV9A 3LZIA 2BGGA 3B6OA 3TAGA 4FM0A 4N56A 4LY7A 5SZTA 1ZBUA 2FBXA 2HNDA 5HRRA 1NK5A 2Q3SA 3VQ7A 4M3YA 3I8DA 1LWFA 3AO4A 1FXXA 1C0TA 4KFBA 1TKDA 3EY1A 3AVBA 3OYMA 3K57A 1J5OA 1S1TA 3MECA 5HBMA 4KTWA 1SKSA 2G8UA 3MEEA 3PV8A 3KKRA 3SQ4A 4E1MA 1UA1A 4OLBA 3AA4A 2O4GA 4JLHA 4CGFA 4J2BA 3WNGA 1NJWA 4KO0A 3TARA 1S1WA 4I2QA 3LZJA 4DF8A 1RBTA 2B6AA 3AO2A 4KB0A 1BHLA 3AA2A 3HJFA 4CJEA 4DG1A 4DSIA 4F2SA 1D5AA 4Z4CA 4JS4A 1VSMA 3AVGA 1FK9A 3PO4A 3VQAA 3V81A 4LSNA 1J9AA 4R5PA 4O44A 1RT6A 3LALA 3O3GA 4WE1A 3PO5A 3ZSRA 3S3OA 1RDAA 4DFJA 3OYJA 1ZYQA 3OYIA 3SNNA 4CEFA 1W9HA 5KGXA 4CJ5A 5CY4A 3NH1A 4CJWA 3M8SA 3V9ZA 4E7LA 2JLEA 3RMAA 1HQEA 1WLJA 4KTZA 1SL2A 4DSFA 1K6YA 3HPOA 1RNHA 3LP0A 4KPYA 4Z4FA 1LAWA 3MEDA 5HLFA 1RTDA 4B9NA 1XHZA 3H08A 4FK0A 1ASWA 2AJQA 2A1SA 1T03A 1QTMA 2IOCA 4AILC 4HUFA 1RCHA 1TKZA 3HPGA 3DOLA 3SV4A 3NH2A 3M8QA 4BDPA 3KD1E 4JRQA 3LP3A 2YNGA 2WONA 3CM6A 1TKTA 4FLVA 2XY5A 3K5MA 5DMRA 2DFEA 1L3SA 1JXBA 3ZT3A 4DTOA 1VSEA 1UWBA 2ATQA 4FM1A 1D8YA 1C6VA 4QAGA 3KK2A 4FLZA 4M3ZA 1TL3A 4N47A 4CJLA 3L3VA 3KIOA 3LWMA 3M8PA 1BQNA 5FRMA 3L2VA 3ZSWA 2X6SA 4PA1A 4FW2A 1N6QA 2HHUA 2BDPA 1ZBHA 4MQ3A 1S1VA 2P1JA 3G0ZA 3QINA 3OYLA 3SQ1A 1JLQA 1WSFA 1GOCA 1QS4A 5JS1A 3CM5A 4B9LA 1WN7A 1IG9A 4F3OA 4N76A 3G10A 3L3UA 3CFRA 4RW6A 3HP6A 1S9EA 1EXQA 3AVMA 4FJ5A 2X78A 2HHXA 3KTQA 5E41A 4L8RB 2HHQA 4IDKA 3SZ2A 1WSJA 4I7FA 1QHTA 3KKSA 4CGGA 3OYNA 4YNQA 3V1RA 2XHBA 1N5YA 5J1EA 1TVRA 3VQ8A 2PYLA 1RTHA 2YKMA 3VN5A 4I9QA 1DTTA 1VSLA 2FBYA 3CFPA 4KB1A 3SPZA 2HHTA 3HXMA 1LW0A 2KZZA 3KLFA 2W42A 1S6PA 3NH0A 1NKEA 4NYNA
chains in the Genus database with same CATH superfamily
1JHHA 3BZ6A 1EV7A 3L6QA 4CZLA 2IW5A 2XKPA 5FPMA 3IAYA 4CIFA 3AG2H 4KV8A 4YY3K 5GTIC 3JRCA 4G7OF 2M7BA 2WA0A 2F48A 1W2BM 2ADUA 2IS2A 1NNEA 1NK4A 4OPKA 4BH9A 1BI4B 1AU7A 1BJAA 3FK6A 3FWEA 1KVCA 4CCMA 1YAGA 1X3ZB 3FHNA 1TNTA 2A42A 4Q5SF 5F1XA 3WGHA 3L1PA 4IEJA 4BRKA 3FHZA 5DTDA 3ASMA 2HR3A 4HUEA 3AGKA 1JI8A 2DA3A 2L7KA 3GYHX 3GTLJ 3S1RJ 3WG9A 1FBSA 4HLYA 5HRSA 4MLOA 1W36D 3QOPA 3DOKA 1N78A 4DQRA 2IEKA 4BRFA 2PZSA 4YIRX 3IRRA 4XIUA 1HW1A 4JI5K 2RVCA 5HNHA 3E5XA 2P4WA 2O8DB 3DPTA 3JRGA 2OTLI 3L2UA 2DOAA 2BVMA 3REOA 4LF5K 1NLVA 2O3FA 4FOIA 3BCAA 3PUFA 3LQRA 1OISA 3PQJA 3O8MA 5LHIA 4C8OA 1CXUA 4B3OA 1WJBA 4B9TA 1CZ9A 1HOMA 2DFFA 1I27A 1FYKA 4BHCA 4C3HJ 3ENBA 5HS9A 1SL0A 4XEIA 5D8LB 4CA0A 1XSXA 2ZFUA 1OH5A 1N75A 2R5ZB 4JKAA 1JLBA 2BBYA 3KWIA 2Y31A 4KH4A 5B1AH 4E0DA 2K9LA 1TUYA 4HW0A 1A36A 4BRGA 3S1MJ 1RDBA 3RSEA 4X66K 3HO1A 4H0EA 4MFDA 4K0KK 3FMRA 5CVRA 1C0UA 2NVYJ 1P7IA 4N5SA 1WOQA 3BG6A 2HMPA 2L9RA 3KZYA 2VG7A 3D45A 2DA4A 4BG9A 2W1OA 5BRDA 1JTYA 3CMAI 3RMBA 2Q8KA 1UG0A 2CH0A 4BRQA 1X4PA 2EA2A 4WXCA 4NXNK 1XHXA 3BJ6A 2ZGYA 4DU1A 2EWSA 1HX1A 1Y56A 1JKOC 2A5YB 1WKMA 2WTEA 5H6QA 4HOBA 4OKKA 4CERA 1N33K 1C0WA 1NK8A 4Q5VA 5J47A 1Z6RA 3LDQA 4B9SA 1YFHA 5A2QO 5I3UA 2P0WA 1FMVA 3V9XA 2CGLA 1U4BA 4DSKA 2XUBA 2UU9K 4ETSA 5H6RA 2IAIA 1HQCA 2UXCK 2M0CA 1FP1D 3SQ0A 1GXQA 3IUCA 2QA4I 3P9KA 4E7KA 1X9WA 3BTLA 3H3UA 3ZQ7A 1Q9XA 3FFKB 1O3QA 4DZJA 5EYRA 2JWTA 2YX7A 3TOBA 3TTDA 4Y52J 2FBXA 4OIOF 3MN6A 2HDCA 3G2BA 3S2DJ 3MECA 3SBTA 3HKZN 4YDUA 3WNGA 1U0JA 2HOEA 2DDBA 1ZC6A 3O3GA 2AS5F 2J4RA 3S3OA 1RDAA 1W9HA 2E36A 2RC4A 4DNCA 3FM3A 4GFBA 1ZTRA 1GLLO 4IRHA 1HUXA 2AJQA 4CICA 4BDPA 3GTJJ 1YRNB 4BL0B 4MEXF 1W5CC 3CJNA 4BXUA 4NQWA 1TWCJ 4U7BA 2I7NA 2EFWA 1R5GA 3ELKA 3WE2A 5J1UA 3L2VA 5FKOA 4GKKK 1N6QA 2JA8J 3AAFA 1VQ7N 3QINA 3EKUA 3UKRA 3L3UA 2LH9A 4I7FA 4CGGA 3V1RA 1TVRA 3ZGKA 3CFPA 1A6IA 2Z1DA 1U9NA 1WWXA 3O9SA 3GTKJ 2W25A 3VB2A 3P38A 1NKEA 1Z77A 3N4QA 5KAIC 2IJLA 2Z1IA 3LDPA 2A68F 4DUZK 4JI0K 5L3DA 3VTIA 4B9UA 2L7FP 1IN6A 1KAYA 1R71A 3JREA 5JVHL 5M1KA 2KRHA 2W84A 1I50J 3RSEB 3AA5X 2ZBKA 4Z0UA 3ZSVA 4CJFA 5AQZA 3U6FA 4DQIA 2V1UA 4ILJA 4DR6K 3FF5A 3KFWX 3OW2M 4CD1A 2ASOA 2RNGA 1QPIA 1EETA 3IV5A 2X9DA 1S7OA 4IVNA 4PZJA 5J1RA 2P9NA 3O4WA 4X1EA 1VTNC 1APLC 3WT0A 2NRRA 4FQGA 4YOXA 1XMOK 3MCPA 4CVNE 4OAYA 4EZ6A 4DSEA 2FBHA 5IY5H 3GFLA 1Y1WJ 1UFMA 5K5RA 2Y9ZA 3TAEA 4BKXA 4A57A 4ESJA 3HK2A 2QSHX 4UUVA 3ZN0A 4ZH4F 2X6NA 4P1WA 1JL2A 3CCVN 2ZNZA 5C44J 1BIBA 4A0XA 1W4MA 2ZMEC 2FBIA 2H09A 1OQYA 4HG2A 1YJNN 1NGFA 4XR6A 2BYVE 3O1WA 3TI0A 3CC4N 2IA0A 4UVBA 4LLLA 1MH4A 1Z6TA 2E1NA 1SFOJ 1IN5A 5B3SH 2Q0RA 3O3HA 3I5UA 2HPMA 3CQ8A 4HRIA 1NBWA 2RQQA 1VSJA 1Z7UA 3EZ5A 1XTAA 3BWGA 3F21A 4KRFA 2DDAA 4BC2A 2IC3A 4M3RA 2HDDA 1NGIA 5T7BA 2Z99A 3DM2A 1KCFA 4RW7A 3R0JA 4O0JA 2M5WA 4XOTA 3M1FA 3AA3A 3DMJA 3V6DA 3K1NA 4EIAA 2V7FA 5HL7L 4Y1CA 2PMZA 4L5EA 2W6LA 1TGOA 3RDIA 1ENHA 2OPSA 2G8WA 4PKIA 2XPUA 2LVSA 1QQNA 2ZFWA 2G8FA 4K42A 4OKEA 1STZA 2K9MA 2DPUA 2G9WA 2FRHA 2M30A 3U1KA 2ELKA 2CUJA 1HA8A 1TYQA 4BRMA 1LEAA 4CW7B 1QZEA 2KIMA 2EFOA 3TO6A 1LOTB 3AVNA 1H8AC 2X85A 4NQWB 2GV9A 4G6QA 5HVQC 3L2WA 3A8YA 2TDXA 5KCMA 2CG4A 3ZSQA 2HQRA 2HNZA 2QXFA 4ZDLA 1UHSA 3UKRB 4F91B 4BRHA 2YKNA 5EEHA 2CUFA 3UIQA 3HPHA 4YOYA 3CCMN 3ZQCA 4ELVA 2P5OA 1G4DA 3MN5A 1B9DA 4E7HA 4GKJK 1NGBA 4IFVA 1OCZH 3OS1A 3PIPL 1BA1A 2RPIA 1VSKA 5JMVA 5DS9A 3LSRA 5IP6A 3RKQA 2XB0X 1JCEA 3J7ZO 4CK2A 4IX7A 4DYQA 2G8IA 5DCMB 4GCVA 1J5EK 1KVBA 1Y0NA 2BUPA 4BR0A 3NMUA 1ZG1A 1U3EM 3B8AX 3SUQA 1SMTA 2VGMA 2LDUA 3DU5A 3PSFA 2HYFA 2E2HJ 1VQ9N 2JMWA 2W82A 4PFPA 4HBLA 1K78B 1UAXA 4OU0A 1NOZA 4BQOA 1HR0K 3B6OA 3BG9A 2Z2SB 1YTYA 4N4OB 1OCCH 4AM6A 4GRIA 3ZYYX 1KU3A 5GTHC 2K27A 3PV8A 2OU2A 5FPDA 3LZJA 1RBTA 2B6AA 3AO2A 4DG1A 4RDUA 3CJRB 1J9AA 3QP5A 1U2WA 4CJWA 2M4KA 3RMAA 4WK8F 3DXMA 4CSWA 2LOOA 2K4JA 1T03A 3OR1C 4A3MJ 3U1DA 3IDHA 4HDUA 3ZT3A 4IF4A 3O9QA 5IOZA 4F52A 2IS6A 4II3A 1KQ0A 4MDBA 4A3BJ 4D9JA 1VQMI 1NGDA 3BR3A 2VYPA 5JLWA 1WSFA 5JS1A 4Y3OA 5TKWA 2MD0A 1WJCA 4GY2B 1EWQA 2D1VA 1XNQK 5BN9A 3ZMVA 2IRFG 2HHTA 3DTEA 2M87A 2NVUB 2KZZA 3L2CA 1PP8F 2X6YA 3AVIA 4EGYA 3CHWA 3ZMSA 4WXHA 4N41A 1DT9A 3ZSXA 4E4HA 2B63J 1R5ID 4CJUA 1SQKA 2EJRA 2GLOA 2KKOA 4FPBA 2KRFA 1R36A 3BZCA 1R0AA 3MCZA 4EVIA 5F27A 4DS4A 3CLQA 1IZ1A 1FBUA 2OYQA 3DRPA 4ZJZA 5KPZA 4GVMA 2UZKA 4I09A 2F9TA 4FXDA 2KDOA 4KHSA 3HRSA 4DWIA 1WNSA 4CCLA 2FMLA 2XDVA 2LK2A 3N97A 2JVGA 5ICFA 2Y0SN 1UJ8A 1AA7A 1VFCA 2VT3A 2V1XA 3HL8A 1HW2A 3JAMK 4JKHA 3F6OA 2X48A 4BQAA 1XMXA 3M6GA 4G6DA 2F2EA 2F5VA 3SI6A 4A0ZA 3LM2A 2JSCA 1R58A 1WI3A 3F2KA 2OPPA 2VQLA 2BW3A 2HGCA 3ZSYA 3TKYA 3AG3H 1FYMA 1PUFB 1O3TA 1MNEA 4PQUA 1OCRH 1YIJI 3KWGA 1ATNA 4ILHA 1RUOA 4P9FA 3ZX2A 1MMDA 4MO5A 1ETXA 3F8FA 4RMNA 3RPQA 3OWTA 2VKDA 1N36K 4DLGA 4BVPA 2AO9A 5L3BA 3C95A 1ZREA 2HXIA 2EINH 1T39A 1FOXA 1ZAOA 1BGXT 3K4NA 1DTQA 3GFIA 3SZGA 5EX5A 2FQ3A 1BQMA 5EEAA 5E3LA 5FDLA 2O4IA 3TDUC 3EUAA 4FWOA 2BXZA 4I98B 4NYFA 3L7WA 4BWJA 3J7AP 4PGHA 3K9JA 3I71A 4ENJA 5LEJA 3KLHA 2IGIA 2OUMA 4XONA 4LG0A 2O8XA 1KU9A 4C8KA 4JD2B 3MKZA 3NCIA 5F0FA 3DXMB 2VOPA 3EYZA 3AVKA 1WJAA 2DT5A 4PK4A 3EE9A 2XGDA 2A69F 2P51A 3JAMO 3K7AJ 3ZSOA 2KQ2A 2CV0A 3GEZA 5IYBJ 1VSFA 3VPRA 3ML6A 2DI3A 2O8CB 1Z3YA 5B8HA 2HQ5A 4B1VA 1S9GA 3J80K 2X1DA 1OFCX 4AIKA 4JHDB 3I0SA 2YNIA 1WJEA 2ZNYA 3DFGA 4I99C 4JNEA 5JVGL 5H1SQ 3CLOA 1QHAA 3I0RA 3A01A 2EB7A 1LDKB 3LPTA 3TW7A 3C6UA 5AQXA 2P7CB 1BOTO 4A2BA 4CEBA 4ID1A 3ERMA 1CF7A 2VCPA 3IG1A 2D0PA 1FW6A 1TL8A 4KHWA 4CIGA 5ICCA 5JI6A 4E7JA 2WUSA 2EBIA 5LEKA 1I5ZA 1LE8B 1HDPA 3M7GA 1LEBA 3KZBA 3OS0A 1NGJA 2HOAA 5D5XB 1IXSB 4X64K 3CJCA 3S93A 3VODA 1RT7A 1YHQI 3M3ZA 2P8TA 4D7NA 4BC4A 1JGGA 3MWMA 2G8VA 4MGRA 2JWKA 2JA7J 3WXIA 1A5JA 4M6VA 3ROUA 4BY9C 2W4SA 3MEEA 4HV6A 4DF8A 3WTUC 4DSIA 3DP7A 3PO5A 2EFQA 4UUSA 3K4BA 4CJ5A 2XF7A 3GMEA 3E6DA 1X19A 2YX6A 1B9MA 2L3DA 3QPLA 3G73A 3ZCOA 3HM8A 3J80O 4G9YA 2XY5A 1SS6A 4WYBA 3AL0B 5F08A 3KLNA 5AZIA 4E1JA 3T5XA 3CFRA 1S9EA 3R60A 1ZN2A 1RDWX 1ON1A 4LF9K 4KB1A 1XUPO 3MN7A 2L7ZA 4UB6C 1S6PA 1MMGA 5FPEA 2QBYB 2FA5A 2E5LK 2DAOA 1HQUA 2BY2A 3THXB 3CXCM 4DTNA 1T2KA 1N34K 4O8KA 2VBZA 3BTJA 1SZ2A 4B09A 4FVUA 2YJEA 3T8RA 1IC8A 2P9LB 3EQLF 1JTXA 5FD5A 2KFZA 4PHTX 2UXDK 2M2EA 4AWXB 2DA5A 1IJJA 3PNYA 4IJAA 3RR7A 2P9IA 1RUNA 2QW9A 1SFKA 3VEOA 3J7YP 2KLAA 2PJPA 3CCLI 3PNVA 4BE1A 1WJDA 3QYFA 2XY8A 1U48A 5C0YA 5HRNA 2F5CA 1R5HA 1BIZA 2IBDA 1EH7A 1D8JA 1VQ6I 3NDKA 3JTGA 2P5GA 2M8GX 3THYB 3T3FA 4CHOA 2AXTC 4O5VA 1JLGA 5F1RA 3U9ZA 3RQ4A 2GQQA 4IEEA 2HVRA 3SXYA 3RVCA 1LDDA 1ESVA 3A01B 4KUMA 3TW6A 2DU9A 4Y7NJ 4H4OA 2QZ8A 2E1ZA 4KKOA 2Q1NA 5EVZA 1LVAA 4ZYGA 2RN2A 3K70C 4CGJA 1BL3A 1X3MA 4UUTA 6PAXA 3KVGA 2D0OA 2JTVA 1CZAN 1XCBA 3ZQGA 1ORKA 2O6GE 4RM2A 2ZO4A 3JSOA 1E4GT 5C15A 4KFCA 4RAZA 1EX4A 3IAM2 4PJ0C 2VBWA 2K5CA 2LSOA 3WODF 5JS2A 4CZMA 4YOUA 1IV0A 4U0WA 5CZ1A 2OA8A 2QKMB 4F93B 3BEXA 5HLGA 1KYWA 1IXRC 3H5RA 5FLVA 4Q4ZF 1FSHA 1V5EA 5BPDA 1TZLA 4BNCA 4DV1K 3QERA 4RCHA 4P5OA 5ADXA 4GGGA 4FWNA 5IOYA 4B8XA 2VKEA 3V9WA 3TMOA 1HKQA 2Z1JA 1HSTA 1P7JA 4FJLA 4IOAF 3R8EA 2VPLA 5ICEA 4I01A 4FOEA 3HRTA 3QLHA 5IT9K 4DTXA 4LFAK 2VG6A 1BCMA 3TAQA 1K9MO 4HCCA 2W40A 2GXGA 3BJOA 1OLTA 4CF0A 5E18F 3R6MA 3SFIA 2RKHA 2EV0A 1TK8A 1QNTA 4QPOA 3VQ6A 2QA4N 1X3NA 2YHWA 4CJQA 4OGEA 2RGVA 5J2QA 4H5NA 4M42A 1ZR2A 1Z05A 4OIPF 1S3JA 2H27A 4PL8A 2H1KA 4XICA 3CDLA 2BE5F 2FLOA 5E3NA 5J3LA 1C1AA 2MYSA 5BNGA 2AQEA 4NDLA 3A03A 3CC7I 4FWRA 2H8WA 1JHFA 1MBJA 3Q5FA 1X4OA 3THWA 1IH7A 1RDCA 1MGTA 2F4OB 2LY2A 3F8BA 5BPNA 4FLTA 2BE2A 1P2FA 4JX4A 2KT0A 4WFNL 3QYBA 3J8AA 2VJ4A 4CJRA 1X9MA 1QQMA 3LAJA 1WQ2A 2LD5A 2GEMA 2I5JA 4JK1X 3AV9A 1GLEG 2BV6A 4A3IJ 3K0SA 2HNDA 2KKZA 2Q3SA 2L54A 3K4MA 2GXBA 3K57A 2WY7Q 4YORA 4GV3A 1SC7A 3L4QA 3LA7A 2KPMA 1ZRDA 4JS4A 1GDTA 2D2WA 5AFUH 3TTFA 2CU7A 3CDIA 4IHTA 3VDXA 1G59A 2WC9A 5DUIA 3HPOA 2O8FB 3E9OA 4HQEA 5JLHA 3GDQA 5AQJA 5DMRA 1JXBA 5KVRA 5K7FA 4DUYK 1D8KA 4JYAK 3KK2A 3HOVJ 4KA4A 5LGTA 5FRMA 1XNRK 2BDPA 3N05A 1C0GA 2XAHA 2A6TA 2IGKA 2FJ1A 4F3OA 3G10A 2VJJA 2HHXA 3QAHA 4BRCA 2FBYA 2HEOA 1UELB 1GV5A 5FLMJ 2YCHA 4OLAA 2YU3A 4E89A 2A6AA 3WTZA 4I6MA 2QKBA 3ZLJA 3UKUA 1ETYA 2XV4S 2ETJA 1LVKA 3DXKA 2WAQA 4KISA 1LNWA 3BR1A 4XLHA 4KT6A 3E5UA 2CH5A 2B9SA 2QKLB 5LL6Z 4B3XA 5B5EC 3HOXJ 1C1CA 1MDUB 4Q48A 2XPVA 4Y4RA 4DLEA 2ISYA 4OOIA 2DMQA 4FWMA 2PYJA 5EG0A 1B8IA 2ZMEA 3VF2A 4IRIA 1CZBA 1GLBG 2EA4A 3FE1A 4DTSA 4S0HB 3A5NC 4CF1A 4BG8A 3GTPJ 4BAYA 4FJJA 1MBKA 4XBFA 3ESWB 1T38A 2V7ZA 3MKYB 3L00A 3ZXSA 4CK3A 1OR7C 4FK4A 2KZGA 1KLNA 1NWKA 3LAPA 1T6SA 5IP7J 3OVNA 1H88C 2F5EA 1NTCA 1RBSA 3TSQA 5LGUA 3C2BA 3IP4B 1TWAJ 1VQ4N 3PQKA 4PSXA 3S9HA 1JLAA 2UUAK 2A40A 1S1UA 4M71A 4IHWA 2K40A 4DGWB 3BC8A 5KPRA 2CW7A 1SKWA 2XASA 3V8LA 1BC8C 4ZYEA 2FC0A 3OL4A 2Y1IA 2ZXJA 4GDFA 1LV5A 4R8HA 4XN3A 2G7UA 3U3YA 2D0CA 1L5UA 3DLLL 3OYGA 4FE7A 4BR4A 1T6DA 1LKXA 1QHGA 4ISGA 4FTHA 2E2NA 5LRRA 4RGSA 4HX4A 2DTUA 1UAAA 1BL0A 3JYTA 1QHHD 4C30A 3CI5A 1KVAA 4UB8C 1Y1VJ 4BXFA 1O3SA 3NAEA 1UZCA 1VSHA 2WBMA 3G4SN 3HL2A 1BA5A 4XRFA 3QFUA 3AO1A 1RBUA 3T1AA 4FJHA 1Z0XA 2VG5A 3NF6A 1XB4A 2BY3A 1FZPB 4C8MA 4M3UA 3VENA 3LAMA 3MXJA 3K4CA 4YELA 3LSTA 4YFUA 3HOUJ 3M8JA 4OVLA 3VFZA 4O5FA 3BUZB 3H5NA 2KTQA 2GWKA 2OZUA 4CO8A 2PMZN 3RWUA 1E3MA 1I39A 1DGWY 2ME0A 3CCEN 3QPTA 3SDGA 1QZYA 1SAUA 1R7JA 5E8IA 3S3MA 3FXQA 4B1XB 2OTJI 1H9TA 3QU3A 1Q8IA 2HVHA 1G99A 4EQQA 1TTYA 4HNVA 4KN4X 2JRTA 2YNHA 4JKGA 3ZN1A 3HYFA 3BTIA 1VNDA 1BW5A 3NF7A 4XKCA 3I4PA 3OJSA 3B6PA 5AQLA 1YS7A 4Z6YA 1V4TA 1R6RA 3P83D 4FCYA 3ABLH 2E8AA 4I7HA 1F4KA 3VMFB 1MJBA 4JAXA 5DEQA 5F0CA 2JPBA 2QUFA 3GXOA 4DQ2A 1J9IA 1WHUA 1YITI 3VQ7A 2LTPA 1Y6IA 2VQGA 3QODA 4XM3A 2G8UA 3WHCA 3AA4A 1IW7F 4KB0A 3HRUA 4F2SA 1YUWA 2O7OA 3VQAA 1EH8A 3BLYA 4O44A 4WCEL 4WE1A 1QZZA 3MN2A 3H6EA 4HSTA 4C2UA 2Q31A 4Z4FA 2ELHA 4XSZF 4B44A 5C12A 4HUFA 1RCHA 2W57A 3TBIA 2YNGA 1UWBA 1C6VA 2OPTA 1MBEA 1MDMA 1IRXA 3DPLC 2CQXA 1RKWA 3JRBA 1X2NA 3OYLA 2DODA 4D5FA 1GOCA 1BN5A 3SZ2A 2VASA 4M74A 2QCOA 4AIJA 2BHYA 3QYEA 2UYTA 1BR4A 3WU1B 2QEXI 2R5YA 4HNUA 5FB2A 1VF9A 3DEUA 2Z33A 1WAFA 4ELUA 2AQFA 5LJVA 4JKFA 1YVNA 4BR9A 3S3NA 2E1MC 2VT2A 2XY7A 1SAXA 2YU9J 1JKHA 3F73A 1I94K 2KZMA 1XMQK 3CZ6A 1PUEE 3H3ZA 3BDPA 4XOPA 5HLTA 3QFPA 3C2HA 1BUPA 1TNSA 2VL8A 5JHUA 1QQCA 2E1OA 2Q0OA 4FVMA 4HV5A 4B1WB 2HHVA 2Q97A 4M3WA 4BROA 1TAUA 2OCEA 3NGYA 4OGCA 1VI0A 4PGGA 2O8BA 2NRVA 1T44A 4IHSA 4QOZB 2PLYA 4DW6A 3HOWJ 3KK3A 3ZMTA 3NFAA 4IQJA 1I1SA 3MN9A 1YW9A 1BISA 2NRXA 2DLLA 4MFBA 3NBPA 1ASVA 5D6EA 2GAUA 1FJLA 2OPQA 3C1DA 4RAYA 2QYOA 3C3WA 1NK7A 1ONVA 4H5TA 3F22A 1QSLA 3P39A 3FZLA 4LF6K 3FBNB 1HKGA 4UV8A 4LJZF 1JJ6C 2HYGD 2HOTA 1O1WA 2GM4A 2GWRA 3GX4X 1S6QA 4JKEA 2P9PA 4JKGB 3IH4A 1VHXA 2M4GA 1YIOA 3WXLA 2Z1HA 1OYIA 4BQZA 4GNIA 3D6RA 3K5LA 3J81Z 4XLCA 3HOSA 3RCOA 1JLEA 1R22A 2P5LC 1XSVA 5CKTA 2PQ8A 3NEUA 3CD6I 2W00A 3VPZA 3SHFA 5E3MA 1IKWA 2CJJA 3QBXA 4F92B 3GG4A 3LL7A 1NGAA 3M8EA 2E6MA 1UCRA 1KU7A 1YVUA 3JRAA 2FSNA 1U2VA 4OX9K 1NK0A 1RC9A 4KIGA 3A0HC 1F9NA 3F8NA 5AQVA 2OA4A 5E1ZB 1FMWA 1R00A 3K69A 2ZM6K 4XORA 1HNVA 2VQEK 3ID8A 3AY9A 2DY4A 4FWSA 3PIPF 1TWHJ 3ISPA 4NC8A 1MDMB 5HRPA 1V4SA 1UOCA 3VETA 4N4NB 3AVLA 3VYUB 4ENMA 3QMLA 2V52B 1HNXK 3GLXA 2E6LA 3BPXA 3DLBA 3DBRB 4DQQA 3RR8A 4JKDA 1OKJA 1NGHA 2Q0UA 4MO4A 2D1KA 4D1QA 1I6HJ 2KFNA 4XKWA 4KREA 1MZBA 4G7ZF 2HF3A 3QIOA 1YI2N 5HP1A 3IS9A 4WF9L 2VIXA 2IS3A 5DD8A 4OINF 4OPJA 3PO3J 3ZCMA 3ITHA 3B73A 5IT3A 2R7RA 1B72B 2VOOA 1GHCA 4DF4A 1ZYRF 2MGQA 3IC7A 2AXLA 4AHCA 4NCAA 3ABKH 2XHKA 2QQ9A 1HBXG 5DYMA 4LSLA 4DTUA 2O8EA 3ZPLA 1MJAA 3CP8A 1NG6A 5MLCQ 2H3GX 3RRHA 3CCYA 5BMZA 2QWOA 2GXAA 1LUJB 2V9PA 1BOBA 4GV9A 5CVIA 3AO4A 1TUUA 4C3IJ 1J5OA 4U87A 2EIJH 3GFMA 5M1QA 5EJCA 4EM1A 1WVRA 3TSPA 5JICA 1ZKGA 5FO5A 1K8AO 1MNMC 3AVGA 2ZJ2A 2GX9A 4UV9A 3WU0A 2CO5A 4DFJA 1ZYQA 5KGXA 2DPDA 5CY4A 3M8SA 2BEOA 4E7LA 2JLEA 1WBDA 5HLFA 1ETKA 4FK0A 3N4PA 3BR2A 5EF6A 4WQ5A 5TRDA 5FLXZ 2P9PB 4CCJA 4C1NI 4NUBA 4FLVA 1MH3A 2OQRA 1JXSA 1KYZA 3H1CA 3CCUI 3H1QA 1FOYA 3Q3SA 4MQ3A 2UXBK 1JLQA 3HP6A 1MKMA 2KDZA 5M5WJ 4IDKA 5BPMA 1WSJA 1R1VA 4E6KG 1U5TB 2VLAA 1RTHA 5GAEP 1ZLJA 3FXUA 5K7HA 4IZZA 3CCLN 2RHKA 2AHQA 4H03B 5FPNA 4M41A 2IVPA 3FXKA 4W97A 4Y15A 1SL1A 2A61A 1U2VB 3E6BA 3L4IA 3A0BC 2IGNA 4W5OA 4B8AB 3O3FA 2EIKH 5E8GA 2QWRA 4ISFA 5J40A 4LF8K 2CW0F 2OCCH 3E66A 2ICWG 2R7FA 4A3LJ 2QTDA 3HTUA 4IHVA 4BWMA 4YRVA 4AC0A 1KFSA 2P9UA 3FXRA 2V4JC 4DZPA 1XDSA 4AUXA 3ISNC 1JGSA 4M3FA 5D4RA 1BI0A 3TWHA 4CGZA 2HQAA 4XNFA 5J1YA 4IZ9A 1FOWA 4RW4A 2A6EF 4JX5A 3H9QA 2HPIA 3E9LA 2E19A 1GVJA 1OYWA 2L4MA 4CHQA 3E7LA 2VBXA 5AQKA 5J2NA 4XLNF 4U0YA 1Y8RB 2GOXB 4CGDA 4ZZLA 2PG4A 1G15A 2Q2EA 1FKOA 4C1NK 2FBVA 3K9TA 2HBLA 3WXJA 2KIFA 1B9FA 2N8GA 4J01A 4CUGA 4UQGA 1IO2A 1E3PA 4JI4K 4M3TA 2NVXJ 2PFUA 2NXNB 2L02A 5F0HA 3JCUC 2L0KA 4XK4A 1RBVA 4AHVA 2RKIA 3D2FA 3G6EN 4Q47A 2XGCA 4BRPA 1A04A 2FXAA 3GE1A 3SV3A 2X0LA 1TQPA 2PMHA 5IYDJ 1I6XA 1XS9A 2HWVA 4AHSA 5JLFA 5J4VA 3ZQIA 4BHBA 3ECOA 1DGKN 3NGZA 4BY7J 1BOAA 4CHUA 1KC8O 4N9HA 4XN0A 3ZOBA 4F9OA 2HVQA 2B0LA 1U49A 3FFIA 3I59B 4IJNA 3BP8A 5BRHA 5C2FA 3ERED 5K1YA 3CUQB 3P31A 4CCOA 1V4RA 5ILVA 3F23A 2OF7A 5JVGF 1JLFA 4FWKA 4CCKA 4BXXJ 3DRSA 3LSKA 2F4IA 3FZKA 1I3QJ 4CK1A 3L0QA 5AQNA 1OMIA 3IRQA 1DP7P 3HEFA 1Q82O 1RT1A 5E20A 4PL7A 3O9UA 2CYYA 2KIQA 1YX5A 1OJLA 5JFRA 3HVTA 3VEXA 4CZKA 2WV1A 4XLFA 2ZB9A 3V8JA 2LYCA 4B3MK 3WE3A 5KQDA 2DJIA 1RT3A 2EZKA 4FJMA 1SVOA 2DYRH 3A5MC 4DJAA 1K73O 1LWCA 1UA0A 2LY9A 3U2RA 3H9JA 5SWMA 3ZMUA 4R1HA 3R0AA 4N0BA 2D4WA 5EOYA 3S2HJ 4E7IA 3EDPA 2HB5A 2PI0A 2EHGA 1R1TA 4PSWA 2WTUA 4B43A 4Y13A 1K61A 1X3WB 5L3FA 4CJ3A 3CFOA 1HRHA 3K4LA 4DU4A 3JR9A 3BY5A 4B1ZA 1IXCA 4AYBA 2VC0A 5AQOA 3VQDA 2HHWA 1N32K 5HS7A 3MEXA 4RG8A 1XG1A 2P9UB 4O8UA 4DBRA 3QDKA 3P1GA 1H9GA 1SKRA 4BRAA 3FZFA 2XSDC 3LDOA 4FM0A 2EQRA 4TV7A 5HRRA 3ABMH 1JCFA 1YXQA 5CVUA 2OQGA 1PVEA 1ZH5A 5CLSA 4M3EA 3CC2N 3D2EB 4E7ZA 3DKWA 2DTRA 1YF5L 3TARA 2VQHA 3ASOH 3M8FA 1T98A 4RB0A 4D5CA 1F36A 1H0MA 2Q2EB 4A6EA 3OYIA 3LL3A 2F5FA 3LDNA 4MLHA 2DW4A 1MJ9A 4DSFA 3H9GA 2QI2A 4RLFA 1FNNA 3H08A 4BC3A 1JKRC 1L3SA 1TKTA 3K5MA 2DFEA 4DV3K 1RIOH 4DTOA 2KQRA 2Q1ZB 1VQLI 2CV1A 2CWEA 2MSYA 2MFZA 1ZGAA 4CJLA 2HYJA 3KIOA 4JI6K 3M9AA 5E1WA 1ZR4A 1J7KA 4B9LA 3VOVA 1K8KA 3JTHA 2IVOA 4L8RB 4AIHA 1ODDA 1DPUA 4CCNA 4B4CA 3W3DA 3QEWA 5A2QK 1BA0A 3WQUA 2C6YA 1LFBA 3RTVA 1XGOA 4B9QA 3JRFA 4CBXA 3TDZC 3PSIA 3KYLA 4XIDA 3DLGA 2XF6A 2E7WA 3O4QA 5ICGA 4HTUA 1QVGM 4KMFA 2YX4A 2QSFX 4RB1A 4B9VA 1J0RA 2L4AA 1K4SA 2D5RA 1VQKI 5HDNA 1W0TA 2GBYA 2HF4A 2HKXA 1AHDP 2FOKA 4P9UA 4BDZA 3CQZJ 2PN6A 5AZJA 1ZQ3P 2HBMA 5K14A 4ZTJA 1JUSA 5B1BH 1GOAA 2UWMA 2M45A 5AJ3K 3GLLA 4XKBA 2LG4A 3VGKA 4DR4K 4IDHA 4F3QA 3AARA 3CQYA 1TWGJ 2BH1A 1EO1A 3VYTB 5CQEA 2YV0X 4JI1K 2WAQN 3F0CA 2J5PA 2WAEA 4BRDA 3CJQB 3L2RA 2EPFA 1MBHA 4WF2A 3I33A 1HLUA 5D3GA 2QM1A 4M7YA 3VOEA 1U78A 1S8NA 2V9VA 3JSPA 3KD5E 4DYCA 1U6GA 4GMJB 2RN7A 3LMMA 2JN6A 1VQ8I 4B9MA 2HSTA 1QVTA 3D7EO 3V1QA 4DV2K 5DDGA 1IRGA 3E9PA 2VI6A 1FJGK 5FKLA 5GIOA 3T8TA 2FF6A 2OJED 1T56A 5CYVA 4G12A 4B3SK 4HUGA 3CJTB 4DFMA 2KP6A 3SZTA 4I02A 2R7UA 3MVPA 3FXOA 3NF9A 4ID5A 4O55A 1VQ7I 4NXMK 1MA9B 3L9FA 1T95A 2XSJC 1X9SA 4GXOA 2NVTJ 1SUQA 1N8RO 3K5NA 4BRIA 5HOOA 5E79C 3V9SA 2EFPA 3BGRA 3PIOL 4DIQA 4V19S 2K3FA 3A5OC 2LY1A 4MDAA 4X65K 3K0LA 1QVUA 2FMYA 2G0EA 3QBWA 4LMYA 4A3EJ 3K2AA 4CHNA 2HXOA 3ZT1A 4FX0A 3Q7BA 2JT1A 4H4KC 2YHYA 3Q9VA 1QE1A 4YIIA 1T33A 2VE9A 1IBKK 3WNHA 1YT3A 4CF8A 2VQFK 1RESA 1WSGA 4CJSA 1W7PD 4FJ9A 3S2WA 1A6QA 3BF1A 5JVTA 3NAUA 2BANA 3BTCA 3A4CA 4YOWA 2PFBA 3E1YA 2YSRA 3K58A 3V1OA 2M1BA 3A1YA 5JR3A 3U4LA 3HG9A 2QWNA 3WTXC 3CETA 2IVMA 2EILH 5M1NA 1Z91A 4EP5A 3FBIB 2NZTA 5L3GA 3NWSA 4ASNA 3OIPA 5M3FJ 3QB0A 3CJAA 1BW6A 3NGIA 4XKVA 1BO5O 1IV8A 3LANA 4CF9A 1YITN 1GLCG 1QVFM 5EXWA 2IA1A 4BBSJ 1NU0A 1H1VA 5DD4A 3LSIA 3O80A 1XGMA 3PM1A 3V4GA 3LP2A 4IWVA 1FTTA 2DOFA 1DQUA 1E4FT 4C8LA 3HOTA 1X1PA 4V19K 4A5MA 1YJNI 4H0XB 3CC4I 2DOEA 4PDKA 1AOYA 5BQTA 4DV4K 3G25A 4B3RK 2GELA 4E19A 2V1NA 1ACIA 3DWLA 4YHHK 4RBOA 4M6XA 1NK5A 4X6AJ 4LFBK 3PNTA 3RKWA 2W41A 1TKDA 3EY1A 3WTWC 2Y2ZA 1IN7A 2ASPA 4J00A 1JJ2M 2CW8A 3PO4A 1RT6A 3I55I 1FTZA 2RE2A 2W85A 4EV0A 1K4TA 4MIMA 1LAWA 2GA1A 1EH6A 2IOCA 3HM5A 3LP3A 5AQTA 3IWFA 1XC5A 1VSEA 4XLEA 2H1LA 2JA2A 2Z5UA 2Y48A 3TO9A 1S1VA 1Z67A 4A61A 3PLAA 2E71A 4RW6A 5E41A 5CJ9A 4FSVA 2L7MP 4B47A 4LK1F 2E5ZA 4I9QA 1VSLA 5JLXA 1U9OA 5BPLA 4HF0A 4IRGA 2MW8A 3MCAB 1D0ZA 3DLKA 1VQNN 1AKHA 3KLEA 5CQGA 5JHFA 1GUUA 1ATSA 4BUPA 4LLNA 2EZHA 4WQ4C 1RFQA 2WB1A 1S1XA 1EF4A 4C3JJ 1BU6O 1FBQA 3MAQA 4AM3A 4JBAA 1B59A 2BY0A 3G1OA 2V6CA 3ZETA 4FW1A 4CFAA 3FZHA 1IN4A 1TK5A 2OV7A 2JPCA 2HZTA 3WU2C 2D0BA 3A2FA 4AQYK 1HPMA 2HMIA 2Y30A 4CYDA 4FZZA 4E1NA 1VSDA 1YW8A 4MLEA 1JCGA 1LW2A 4L9VA 4KAZA 3ECHA 3P9IA 1ZXOA 3DF8A 3DLLF 2L2OA 3TSUA 1A5WA 2DQLA 2E2QA 1R1UA 1NJZA 2JJ7A 1C1BA 2FSWA 1MBFA 3OYAA 4MQ9F 3VEZA 3K4KA 3OJUA 4DV6K 1KAZA 3KP3A 1IJWC 1HCRA 4NB4A 3SJJA 1XMKA 3VWBA 3EZWA 4ZYDA 4CHPA 3MEGA 3CF2A 1WSHA 3R6SA 3J7AO 1BIAA 2NRTA 4MHGA 5J8FA 5M1FA 1FKPA 3F3XA 1WCMJ 3GWZA 2WADA 1S3XA 3D0PA 4U67L 4ZYAA 2BTFA 2TRTA 3ZT2A 4OAZA 1SFEA 1BM9A 1G3TA 2D1HA 3HSCA 2UXNA 4BREA 3ZX0A 4QCLA 3LA3A 2H94A 4A69C 5F64A 1V5GA 3SBGA 1P90A 4O6JA 1QQIA 4PY5A 2FF3B 5KNLA 3L8BA 1ON2A 1E3OC 5C10A 4O4GA 2O5RA 3SEQA 2P9NB 3DRRA 2XF5A 1A31A 4OIQF 3HP9A 2AA4A 3BT9A 4HX8A 3W2VA 1R4NB 4K43A 3EETA 1O3RA 4FJXA 3BF3A 2R7VA 1SFXA 3T19A 3ENOA 1PDNC 4EGZA 1IKVA 4HHTA 1VZ0A 5DK5A 1KQ8A 3U3GA 4LH4A 1POGA 5AR0A 1F43A 3OYBA 1W0UA 3OOUA 3OS2A 4DR7K 2CUZA 5FKNA 4B8CA 1FYLA 3QQAA 4RB2C 4ENKA 4F4KA 3GZNB 1YTUA 3J81O 3JAMZ 1C0FA 4V2FA 4Y1DA 3PFYA 4JYKA 5AQRA 1Z25A 3DKYA 5L3EA 1TBXA 1VQ5I 4HCBA 5C4XJ 9ANTA 4FYDA 3CCJN 2VPRA 4M9SA 2CGKA 2MA3A 1JLCA 3D0SA 1S6LA 3OYHA 3EYIA 4GO1A 3ULDA 1LJ9A 1D3YA 1EKEA 1EP4A 1CXQA 2LNBA 4IQ4A 1LDJA 4LIVA 2X74A 1TQIA 1BI3A 3RRGA 3K1PA 4V2GA 4FWPA 1M1EB 3DCFA 3AL0C 3LZIA 4Y17A 1ZHFA 4N56A 1TYQB 3NQOA 2Z3YA 3M5RA 4ZZDA 4RLQA 3ATVA 2DCEA 1BDGA 4AU7A 1UA1A 4CGFA 3RSNA 4I2QA 4AVPA 1TP4A 2HHHK 1D5AA 3S16J 1S5LC 3IKVA 1GVDA 2MG4A 3SMSA 2VWBA 1GLDG 4M6YA 5F1JA 1VQON 4KTZA 2E5NA 4B9NA 3ZRGA 3OBYA 4A3CJ 3R61A 3DTKA 1TKZA 3SV4A 1T8IA 1QPMA 4H5VA 3KYCB 2OZ6A 1HSJA 1D8YA 3O8HA 4XSXF 4PFOA 1TL3A 1YJWN 2X6SA 2XPWA 3SQ1A 3CM5A 5C4JJ 3I54A 1HJOA 2EH3A 3M07A 3GTOJ 1JT0A 2VXZA 3NVKA 3J7YJ 3SPZA 1RRJA 1RNLA 2QWWA 4G6TB 4IXAA 4BHPA 2KJBA 3AKZA 1ETWA 1D5YA 1GT0C 3H35A 3TO7A 4HA8A 3MX5A 3ABTA 4WXDA 3E1SA 4DMNA 2V26A 1NM1A 2JA5J 2H8RA 4Z4GA 5HNFA 3VEPA 1VRUA 2H6CA 4W5QA 4CEEA 2ITGA 2J5OA 2NRAC 2LF7A 1U04A 4EJOA 2R5ZA 1D5VA 1Q81O 2X6OA 1LQ1A 4BVOA 2FD5A 4HNTA 3CQXA 4LITA 5FLXO 2L9VA 3K2PA 2JVHA 1KRPA 4MTDA 1F1ZA 1NG9A 3HBTA 2IAJA 4TSXA 4CJ7A 4JK7A 4IOCL 5J8CA 3BDDA 3G71I 1GV2A 5CYMA 2KJCA 1Q1VA 4S05A 5LHGA 2QWMA 3QP6A 4A12A 3QU6A 4CESA 3Q9SA 3HT3A 3HZ6A 3DLRA 3M3YJ 1IG7A 2DJNA 5EU7A 2V51B 1V54H 1LB2A 1D9FA 2HVSA 2O9LA 2FSKA 5FGMA 2IT0A 1LPQA 5ELZA 3MX2A 3H3VK 4A93J 3GW2A 1USSA 1QGPA 5KI6A 2KMUA 3FXJA 1NH3A 3JRIA 3ULQB 3D5SC 1IN8A 3E0JB 4KHPK 3IL2A 1ERDA 5KQ8A 3GTMJ 2E2PA 3KK7A 4HX7A 3KZIC 3WNEA 1FY7A 3IUOA 3SAFA 2WY8Q 3R3LA 1IDYA 1FWZA 4BRNA 3QIPA 2R7YA 4DSLA 1Q9YA 4FPAA 4BC5A 3BG7A 1K7AA 3CJ9A 3HSFA 1B92A 4NLCA 3NVMA 5BR9A 4CFBA 4H0YB 2P9SA 1TK0A 3G1MA 3TGNA 3F6VA 3V7SA 1DKGD 2IA2A 1UHMA 2E34A 1G3SA 3CF5L 3NF8A 1QZ5A 4LD0A 4A6DA 4K41A 4OPHA 1ZRFA 3G3ZA 4F8RA 3KEOA 4PKHA 1TW3A 3Q0VA 4ZTFA 5AQQA 3NARA 1HJRA 3LDLA 1Y39A 2VKVA 1MMNA 4FX4A 3VQ4A 5DV5A 2BW3B 1PJRA 1OKRA 3KYDB 4RGRA 5HLHA 3T1HK 1XGNA 3R1XA 1JXEA 3GCMA 1ZGWA 2ZXIA 3F9MA 5EDNA 3U21A 3PX4A 3ASNH 4F3TA 1YTAA 1WH5A 1YRNA 1ITGA 3C7NA 5DM7L 1TV6A 1IV6A 5HDKA 1EWRA 3EUHC 3FDYA 1BJZA 4YIFA 4CEZA 5GP9A 3S17J 1R23A 1Y97A 2FE3A 4PJMA 2A41A 1OCOH 1E17A 1KGSA 2P5VA 4UNOA 3LOCA 2XAUA 4OJRA 4DV0K 1Y0UA 5D5UB 4M3GA 4FHTA 2ECBA 2R7ZJ 2R7XA 4HF2A 4CBWA 2UUCK 4HDVA 2IXSA 1W5SA 2VXDA 4M3DA 4EZ9A 1CQTA 2DYSH 4Z4EA 1T0FC 3LSHA 4LG0B 4YFKF 5FKKA 3SUNA 4JI3K 5E1XA 3WQTA 2QQAA 4M63C 4M3YA 1VQLN 2A3ZA 3HHGA 2R7TA 1C0TA 5E3OA 4KFBA 3OSGA 3ONQA 2BY1A 3P4IA 4MTEA 4E1MA 4EM2A 4DR2K 4AF1A 1ULYA 4LF7K 2OTLN 3BROA 3D5LA 3VSLA 4AYBN 1BHLA 4YEJA 2NOJB 4EHUA 4A5AA 1K83J 1RI7A 2ZJRL 1KA8A 4IOXA 3V9ZA 2W48A 3R9PA 2QSGX 3H46O 1WZ2A 2MH9A 4AILC 4YFNF 5IT9Z 3VERA 4JKCA 3FLCO 2ATQA 4LF4K 3MZYA 4QAGA 2V6EA 4G94A 3AAPA 5H2FC 3L3VA 3M8PA 3H45C 2QQ8A 3KP2A 2I10A 1CF7B 2LR8A 2HHUA 1WSUA 1KU2A 3COAC 4EJUA 1VQKN 3KTQA 3OYNA 4WFAL 3HXLA 1GLJO 1HKCA 4B3AA 2CQNA 4QS8A 1KFDA 3HDDA 2EX3A 2VGNA 1C0MA 2P9SB 1B1BA 4HTLA 1OCPA 3TAFA 4IPAA 2CQQA 2K9SA 3CCQI 2XAFA 3FISA 3SEZA 1X2MA 2OAZA 3BQYA 4I6ZA 5AIQA 3QETA 1J53A 3F8MA 3HI0A 3A2KA 1YJ9I 2FSJA 2LKXA 3A02A 4LFCK 2K85A 3I4NJ 1TWFJ 1XDUA 3K4JA 3CMAN 4HZFA 3OIQA 2M8EA 3WXKA 2CRGA 4HSRA 3KLIA 4G9ZA 4UUSB 3TEDA 1VQ8N 2GIVA 4BE2A 1RT5A 1T8EA 2VC1A 4F2RA 2STWA 1SV5A 2JA6J 4CIEA 2NYXA 1SD5A 3SK3A 2HOSA 1DU0A 2O03A 5GAGJ 2DK8A 3C7NB 2QLZA 3KEQA 5AZIB 3OYDA 2PY5A 5E84A 4L9NA 2DT6A 4AVZA 4DTMA 2R92J 2V1DA 4DBQA 3GOIA 3KP7A 3VEYA 4NC7A 5J6XA 5TISC 3HHHA 4EJWA 3AVAA 4M45A 3J7ZI 4MFEA 2KFDA 1Z3XA 4ICLA 4OIRF 1J59A 4RM3A 4Z2YA 4XMYA 2VKHA 2M3AA 2ZSHB 3CTAA 3OTOK 3S15J 4FZXC 4GV6A 4L0YB 2MD5A 4FZYA 4F55A 5CVVA 4GYGA 5LMNK 2P9IB 5M1OA 2CV2A 3I56I 4CH7A 5LD2C 1RILA 4KHNA 2QKKA 3OIOA 3EO3A 5DCMA 2DFHA 2ISZA 5C25A 4CGHA 2HBJA 5FD6A 2A6HF 2CQKA 5H20A 3W0LA 4BJTA 5KAFC 1W5TA 4NCGA 2HDWA 4U0VA 4XLAA 1BR1A 3OSFA 1ETOA 2LSNA 4ILGB 3TOAA 2ACJA 2OZMA 1K78A 1IGNA 3ZMZA 4KJZA 3F9KA 3X2QH 3OOPA 2RAEA 4MEYF 1MD0A 4D7MA 4C8NA 3SQ2A 4I0AA 3E01A 2LFBA 3E6MA 1MNDA 3LNQA 1WUAA 3C2GA 1E0EA 2Z16A 1WH7A 3RJPA 4ELTA 4JN4A 2JK3A 2QK9A 2E60A 3OV8A 3ZMDA 4A3GJ 2QWPA 3FMQA 2GOMA 4DU3A 2QENA 1RTJA 1T05A 2L9SA 3DU6A 2LRDA 3CPEA 3EYYA 3T1YK 2RREA 4KHUA 3DKXA 2KZVA 4W5RA 1J54A 3E6CC 1L0OC 1JKPC 2DO7A 1T7PA 4FLUA 4KH6A 3S1QJ 2X4HA 5KRSA 1MIJA 4CI6A 4JEPA 5HROA 5BREA 2ZJQL 1VQ4I 4CEOA 1HNIA 2WOMA 4ZYHA 1F5TA 3I55N 3ZT4A 4FJKA 2XRLA 2CH6A 4FISA 2RDPA 3WEEA 4LK0F 5AFUA 2IGMA 4HYEA 4BS9A 5EY4A 4XLPF 1S1TA 4BQQA 3CMYA 2R4GA 1MMSA 1NJWA 4CZJA 5D4SA 3RPUD 3V81A 4XQFA 3MWTA 3ZSRA 1W36C 1U8RA 3SNNA 3MWPA 3G4SI 2R7SA 1WLJA 1SL2A 1FC3A 1RTDA 2A1SA 1QQOA 3HPGA 3DOLA 3HSRA 3CDHA 3NH2A 3HB9A 3FGUA 4DQ8A 4WQ4A 4FLZA 4M3ZA 2HKOA 4PA1A 1ZBHA 1YE9A 4JOMA 4ESFA 4KBOA 1V3FA 3AVMA 3EE8A 3THWB 2XHBA 5J1EA 3KLFA 1SMYF 3NH0A 1PUFA 4NYNA 1A35A 2GTDA 2F8SA 2LLKA 3VEWA 2QVOA 1S29A 1S5JA 3SZPA 3MFKA 1RPWA 1FEXA 3BY6A 4BU2A 3CCEI 3K1MA 2M7AA 3L2QA 3AGRA 4IO9L 2X1CA 2ZC2A 5KK1A 1ATRA 2DA1A 4HAMA 2PBIA 3FZVA 3IWZA 2VE8A 2WWYA 1Q18A 1QU3A 5TJJA 3LWFA 1G3WA 2JGUA 1VQPI 3Q0WA 1W1WE 4RGXA 1P9QC 4B3TK 3KX2A 3VTHA 5LBQA 2FBTA 1M90O 2F5DA 2WV0A 4BE0A 3C6AA 5M3MJ 4YOTA 3RKYA 3DI6A 5GINA 4GW6A 1HYVA 3BJAA 4IG0A 1RR8C 4K8ZA 2O8KA 2WB1N 3I0TA 4DYRA 4JD2A 4DFKA 4EATA 2MBFA 1UG2A 2DXIA 4JK9A 4W5TA 2ZF5O 2OANA 3LFUA 3AVCA 3E3VA 2WFBA 5M1PA 4ZHRA 3I8BA 3CG7A 3H1VX 4FK2A 5LRSA 3MXMA 1ITYA 4EJVA 3TQNA 2O8CA 3LA2A 4K8XA 4NHJA 2RNJA 4EEFG 1LAVA 3GF2A 3JSMA 3U9DA 1NKCA 4JHDA 2G8KA 3PIOF 2EK5A 1FPQA 3VGMA 4IEIA 4H0TB 3ZQHA 5GADJ 3TABA 4I6MB 3UKUB 3W6VA 5EZGA 5C24A 3W6JB 5D6FA 1WPKA 4ZDPA 3DXKB 3WUHA 3QEVA 4I2PA 2DQRA 3TR8A 2IVNA 4QS7A 3TAMA 2JRMA 4KHQA 2HQNA 3LSGA 3WEEB 1KXPA 4XH5A 2ZD1A 3T1BA 1QRYA 5C2DA 1JUMA 2A05A 3QEPA 3V42A 3SAGA 1LE8A 2HNYA 1NK2P 5CVJA 4BBRJ 3LQQA 2Y1JA 5EG0B 1B8IB 2ZMEB 4BR7A 1G8XA 4R79A 1Z21A 3V4IA 3IKTA 2KIUA 5TKYA 5EGOA 5AQHA 5C3EJ 5DM6L 3C65A 2XY6A 2Z1GA 3T69A 2DTZA 1J6ZA 1VQ5N 1ZBFA 1VQMN 3A5LC 3SUOA 2RV8A 5FFXA 2HHSA 2WBNA 2G7HA 2MLGA 3HSTB 1NK6A 3WXMB 4ZDOA 2GUIA 1XMAA 3SJMA 1D4XA 4OPAA 4PJLA 4EAHD 2DA2A 3PY8A 3CO7C 1J2XA 1WI9A 2ZJPL 2DFIA 2EV5A 2NRHA 4EP4A 2CUEA 2K4BA 2K02A 1NK3P 1VSIA 2B4JA 3DAWA 4KITB 4G1QA 1UMQA 4I9LA 3ENHA 3IRXA 1YYVA 4FJNA 3WTVC 4Z4HA 4CJ4A 5BN8A 1I3AA 1IG8A 2FX0A 4L18B 1N77A 1U8BA 5KPTA 4RS8A 3RTRA 3Q7CA 1NJIO 1XX5A 2JUGA 4ABZA 3IHUA 3EPZA 5BOXA 2XAQA 2PJRA 2QBYA 4W1UA 5HS8A 4FWLA 1RBRA 3HJEA 1HC8A 3THXA 5FJ8J 4CYCA 4M3BA 1D1AA 3DBLB 2ZKZA 2DPNA 5GIPA 2CFOA 3G1LA 4HVJA 3HVRA 5BRFA 3VQCA 2XAJA 4BQNA 1W7PA 1YO5C 2P9LA 1OPCA 5SZTA 1ZBUA 3BG5A 4LFUA 1YX3A 1FXXA 2EFNA 3KKRA 4C9YA 1U5TC 3HTSB 3HIFA 2JZYA 1S1WA 3DWLE 1K6OA 4CJEA 2P7VB 5TGTA 2IPQX 1VSMA 1ZLKA 3LFKA 4BJ5C 1YIJN 3OYJA 5GAEJ 4EHTA 2OBPA 4CEFA 4M7XA 3SLCA 3GUDA 4KPYA 1BI2A 3THYA 5D8KB 1OH6A 1XHZA 1ASWA 4JV5K 3QWLA 2R7QA 5KHDA 2EWNA 2ZGZA 2M9HA 4B1YB 1T3VA 2E35A 3JW4A 1KZHA 5AQGA 5AQWA 1QS4A 1WN7A 4N76A 2R3SA 4RAFA 5LHHA 2W7NA 4NNJA 4KN7X 3KKSA 4X62K 4YNQA 1RR7A 1N5YA 2PYLA 3PUBA 2YKMA 3VESA 3O8GA 1DUXC 3W3CA 1EA3A 1MWKA 4DV5K 4O3MA 3FKIJ 2DA6A 2VB6A 2CSOA 1TC3C 2EZIA 1WFXA 4L9TA 1REVA 2YJFA 1NGCA 3FR0A 2YUSA 3TP3A 1ZRCA 2MH2A 5EGOB 5I42A 2L5QA 4KMUX 2M34A 3ALYA 4E70A 1YI2I 3AVFA 1WBBA 1JE8A 1MBGA 5CYQA 3G71N 3LAKA 4M73A 2NNNA 3PO2J 3CMEI 3FIWA 1X58A 1WGXA 4PUOA 4BR2A 5CPRB 2ZCWA 3UR3C 3RYRA 4BRLA 3ZX3A 1HPZA 2UV1A 4DHYA 1USTA 1DDNA 1D1BA 3H3OB 3HSEA 4L0ZB 3ZQFA 5LFAA 4CF2A 1D1CA 1IRZA 4CFDA 3PX6A 1BIUA 2ELJA 4A59A 3O3KA 4CEDA 4J8FA 2EZLA 4CZHA 3I58A 2MABA 4LOCA 5F6FA 1JL1A 1U45A 1FIAA 4WX9A 4CHZA 4XRSA 3DPUA 3RIRA 2R5YB 2NVQJ 3SUPA 1NJYA 3MZ8A 5FROA 2E2IJ 2VBYA 3CUQC 3F5TA 5AONA 1GLNA 5B66C 4CJKA 3VA0A 4PUSA 1YHQN 5FRNA 2PJRB 5L3CA 4FASD 4IFYA 3KLOA 4L5IA 1IF1A 4WQ5C 4CYCB 2MLKA 1HKBA 2M0MA 1IUYA 3JXUA 3H3NO 4CJTA 1W7PB 3CESA 1D9DA 5KRTA 4WCGA 5ED4A 1NGEA 1NGGA 1KQSM 2NS8A 3RKXA 1GLFO 1HKSA 2PBDA 2E4LA 2HVIA 2V7YA 4CBUA 1OVQA 1DPRA 5C42A 2YNFA 2O8BB 3DLHA 1QBJA 5EEGA 5CZ2A 3O6BB 1HYSA 5GAHJ 1W0HA 2VUMJ 4A5NA 1EQYA 3VYRB 1WJFA 1S72I 3KETA 3WGGA 4DR3K 3CCRI 2PAVA 2Q2RA 2ZWHA 3QESA 3EUHA 3EUKL 4L9JA 2ZXWH 4H8KA 2FF4A 5ADXH 2K7LA 3OY9A 4RWTA 3CCSI 2NOGA 1HLVA 3QNOA 4XH4A 1P6RA 3HYIA 3CMMA 3V9UA 1TAQA 3Q0UA 1NMNA 1TKXA 4IO8A 3K59A 1RT4A 2CS3A 1KD1O 3NWTA 1RZ4A 2O8FA 2FU4A 1WRJA 2A1RA 2WC2A 3QEXA 4LGWA 1SANA 2ITMA 3C18A 2XAGA 4KI4A 1T0FA 3LPUA 3ID6A 3HBLA 5HODA 4BGBA 2DN0A 4NB5A 3F8CA 2QQBA 4ITVA 1P4AA 2IS4A 4NO7A 4H0PA 3OL3A 2KLOA 1IRFA 4UXNA 4AIDA 4JP0A 4C2TA 1J75A 3O6WA 3THVA 1VQ6N 3UB5A 4W5NA 2GZWA 2P6SA 2ME6A 1BR2A 3VQ5A 3B02A 4DR5K 4O5BA 4LC9B 2X6WA 3HC7A 3G6EI 2BGGA 2FUG2 4DV7K 1SEUA 4UVCA 5BS6A 2HU9A 3OYMA 3AVBA 1KAXA 1CGPA 5HBMA 3D5RC 3SQ4A 2O4GA 2K9QA 3GFJA 2YHXA 3AA2A 1B9NA 3AG4H 2MC3A 3DEWA 3WTSC 3WTYC 1RDUA 3TL4X 2XVCA 3CPWM 2Q36A 2LKSA 1Z9CA 4JKBA 3LP0A 3MEDA 4CZCA 2F9WA 1ETQA 3SFZA 3C6HA 4K25A 3DJCA 1JUPA 3CCQN 1O7LA 4EM0B 1HNWK 4A3JJ 2R0QC 3LWMA 5AQUA 3AFHA 4S04A 4B48A 1X1CA 3U8XA 2CFXA 1J09A 3G0ZA 2P6TA 1DP3A 2Y75A 1EXQA 4FJ5A 2HHQA 1YJ9N 1IDZA 2E1CA 4UHTA 1OVYA 2FNPA 4CZEA 1LCUA 1MW7A 1EJ9A 2O8EB 4L5JA 1O4XA 1XN7A 3DQVC 4OO1J 4LLGF 2I5UA 4IFEA 1QSSA 1ZG5A 3SJHA 4FLWA 4QSHA 5HDGA 4H5WA 4IOCF 3V8KA 4FO0A 2PMUA 2V79A 3B6AA 1MWMA 3F72A 2VWJA 3KPHA 4I2OA 4KDPA 2ZSIB 4E3SA 1MU2A 2NRWA 4PWDA 1JJ8C 4BEHA 1DU6A 1R49A 3CJ7A 4A2AA 2K86A 3PX0A 3OYEA 4JRPA 4HLXA 1ASUA 2CMPA 5KGWA 5IT9O 4M72A 3ZR8X 3IKMA 2HS5A 3QPHA 5E26A 4B1UB 1MSFC 3IMXA 3JRDA 5M5YJ 3KLGA 1X9JA 1RTIA 3FMSA 1XD7A 4YG2F 1T08B 5D5WB 4RB3C 3HOZJ 1TQMA 3HZJA 4DS5A 1RETA 3FXLA 4B1RA 5HLIA 4H0OA 3CC7N 4H4MA 4D0PA 5IPAA 2DBBA 5IWAK 3CC2I 3W2WA 4II2A 2XKOA 1Q1HA 4XRMA 3I56N 1KSPA 3AO3A 4CHYA 5I9EB 4OMZA 3SYTA 3ZQLA 4NCBA 2IGOA 3WHBA 1L3UA 4DFPA 5EZHA 2HTSA 4QWQA 2NNYA 3W2AA 1NG7A 2P5KA 5J4YA 5FKMA 4K2EA 5FFZA 2JWLA 1IBLK 3CF5F 4AH9A 3S8PA 3TP0A 3HTVA 2GBZA 1VRTA 2ID3A 1VK0A 2P9KA 3GZ6A 1BWFO 1FOKA 4BYYA 3M1EA 3GTGJ 4I0BA 3S32A 3RMCA 4UVAA 5AQPA 1V5FA 3DYAA 5A2QZ 4DTJA 1IUFA 1KTQA 2K9NA 2W24A 1FIPA 1W97L 1Z7LA 2ZXHA 5M5XJ 4CZZA 2NNWA 1KQ9A 2FOWA 1BBYA 2VODA 4EJTA 1SD7A 4DQPA 3OYCA 4IL6C 5LLQA 2VN2A 2AP1A 3GO5A 4CJPA 5F2RA 4ISEA 2Y9YA 2DT7B 2QXLA 4BR5A 4PCQA 2F7TA 5DM7F 2HTJA 2KISA 5DCFA 4LD5A 4C2MJ 2ZE2A 4FJ8A 3T0YA 3HUGA 5LMUK 3AG1H 4XRSG 2BOLA 1R4MB 4DTRA 3MAJA 1R9TJ 1ZK8A 4FL9A 4DR1K 4CJVA 2DMNA 4KHYA 3MDQA 2LMDA 4NC6A 2B7EA 3H0GJ 4X0GA 3RZOJ 3CIPA 1YS6A 1G3YA 1HW5A 3FX3A 4CE9A 3O9RA 2JUCA 4F7ZA 1X1BA 3D2FB 1XC3A 2E2JJ 4LH5A 4FE4A 3SDBA 3FKJA 2YHAA 3QO9A 3HGYA 1YW7A 2OZSA 5GAGP 2JSPA 3TAPA 1FX7A 3KHYA 1XSDA 3V7RA 3AVJA 2BVLA 2G8HA 3DEEA 5AQIA 4Z4IA 1HXDA 3HKZA 4DTPA 2A3SA 1XC9A 4I76A 1F21A 3ZEUA 1BI1A 4EFHA 3M1CA 5CE3A 5AQMA 4BEHB 4AHRA 4LB6B 2LC2A 3O5BA 1S9HA 5ERIA 1QZ6A 2ZJRF 1TL1A 2YPRA 2H6BA 1DLOA 3PFIA 5AQFA 4RW9A 2PX9A 1BCOA 2OD5A 4KTQA 3RI4A 4IBNA 1NK9A 1OR7A 5AIPA 3TAGA 3EKSA 2GIZA 1Q7YO 4DOZA 4BQLA 4OLBA 4PJJA 4P96A 4JLHA 4KO0A 3UE5A 3MMYB 3E5QA 3HJFA 3MQ0A 2CGPA 3JRHA 2STTA 1FK9A 2PEXA 2XIGA 1D0XA 3MD2A 3NH1A 4JK8A 3FM5A 1HQEA 3N4MA 1FP2A 4P55A 3M8QA 3KD1E 4Y33A 2WONA 3CM6A 1XGSA 3RYPA 4FM1A 4A62A 4JQFA 4QLCU 3M4OJ 3OR2C 3K10A 3LM9A 4YDUC 4CZFA 5ILUA 2XGEA 2P9KB 1DEJA 4HQMA 2EIMH 4CD3A 3HGGA 3BOQA 3VSKA 1VQPN 3VN5A 3OMYA 4MO7A 2NAZA 1KONA 3MKLA 1VAZA 3O1BA 4KT5C 1OH8A 3M8RA 1YG2A 1SFUA 1MSEC 2LF8A 2VJIA 4DB3A 4IHXA 3GVAA 4MNUA 1I1GA 3ULEA 1IKXA 3O08A 4HF1A 2QWQA 5K7ZA 3OA9A 2I8DA 3K5OA 2YHBA 3SMPA 4N9IA 4FLXA 2F96A 4J2DA 4QIWN 2LKPA 3VGLA 4OMYA 3GBTA 3KP5A 3HUGB 2QGUA 3CYMA 3BQZA 1RDDA 1SD6A 1GXPA 1Z1DA 3DLEA 1Z26A 1QA6A 1QSYA 4WFBL 3HRMA 4CECA 3VA3A 4QS9A 1N25A 3PL8A 3RMDA 2UXXA 4CZGA 4ANJA 2IP2A 2L01A 2ASMA 4FWQA 3DXJF 3LDSA 3QICA 1X3UA 2OTJN 2F4MB 3BR6A 4DCHA 3KP4A 3SQNA 3BZKA 2FEZA 1SVLA 1BG3A 2ETHA 3VF6A 3E97A 5E17F 1K8KB 2OPRA 3QPSA 4UY8I 2R93J 3S1NJ 1NMDA 3MXIA 1ETVA 4BDYA 1RT2A 2ECCA 1NJXA 3EL2A 3ZEUB 5BR8K 2NS0A 3C94A 1YLFA 3UNGC 4BGAA 2A5XA 3VQ9A 3O2PE 4G7HF 3K6GA 2FXUA 3MK6A 1NKBA 1YOVB 3QRFF 2XB5A 2EV6A 4RGUA 2DMUA 3CCVI 4YFXF 3BPVA 1PYVA 1B72A 5D5VB 1ZG3A 1CLQA 3V7CA 2E2OA 5AZJB 3CP2A 1SD4A 3OHRA 2DMTA 3AO5A 3A0IX 4AHTA 4KIBA 1VQNI 1NOYA 2QF7A 1XPXA 1XI1A 3VQQA 3SYZA 1K79A 2CGJA 3LWLA 5IP9J 2COMA 5LJWA 3ATUA 1OH7A 1HKTA 3OYKA 4ENNA 3WTTC 4A3DJ 3DV8A 3B6CA 1ZBSA 4KIFA 1UHWA 1XQSC 2DMPA 3IAS2 5BPIA 3WNFA 2X1EA 2QEXN 1MMAA 1LWEA 3H92A 2ZJQF 1B6AA 4U88A 3T7ZA 4CGIA 1TT5B 4DQSA 3SCXA 4FETA 3FXMA 2XROA 2XRNA 1P92A 3IH3A 3NHGA 1RKTA 3ZSZA 1JT6A 1XCVA 2B5JA 3L09A 1SAZA 4EMSA 1WB9A 3AVHA 4G8XA 2F4VK 2RQPA 2TCTA 1V55H 3VQPA 3KJVA 1ZBLA 3ULEB 3QNNA 4J2AA 3GTQJ 3I3LA 1G2HA 3BCBA 3J7AY 5AQYA 4NLBA 2KHOA 1U47A 1U5TA 3H0DA 2E7XA 4AM7A 2X51A 1DGRM 2BZTA 4IKFA 3CCMI 1IAWA 3SAHA 3H5AA 3VF4A 1O57A 1IKYA 1O13A 3K2ZA 5GADP 3P7NA 3BG3A 4C23A 2KRCA 1GOBA 3KCCA 2A5WA 4LY7A 3C7JA 3O9TA 2QM3A 3I8DA 3DBHB 2V9KA 2D45A 3U9GA 4FT8A 3TPQA 1SKSA 3FK7A 4J2BA 3S41A 2NLXA 1NHAA 2E1YA 4LSNA 1ZELA 1HF0A 3LALA 2Z9OA 3W6KB 4XL9A 1VQ9I 1QO0D 4HEA2 3D1NI 4JX6A 2IIRA 4QTRA 1P4WA 1K6YA 1ZGJA 1RNHA 4ESBA 3KEYA 2VQCA 3VYSB 3KZZA 2R7DA 4U7DA 1OCTC 4N47A 3J81K 3CD6N 4IO9F 1BQNA 3ZSWA 2UUZA 4FW2A 1U6ZA 2W6KA 4UY8O 2P1JA 4BY1J 2NS7A 1L3LA 3P9CA 1TT0A 3CMEN 1DTTA 4PKGA 4JI8K 2Y69H 1FLIA 3H36A 1KLMA 4IXCA 2LBFA 3CJBA 4JI2K 3CO6C 1A5VA 3QEIA 3DTIA 2Y0SA 4XH1A 3P5JA 4AHUA 3IFRA 4CDGA 3C6TA 2HI3A 1WSIA 1UB9A 4CEQA 1WSEA 5KTQA 3RPUA 2D0AA 1GLAG 3MZHA 3CCJI 3I53A 2KHMA 4BACA 3CUOA 2MC4A 1W7AA 3OYFA 2LREA 2E88A 2P81A 2QWLA 1P8ZA 3BR0A 1S22A 5F0XA 2WAFA 1WAJA 4A3FJ 3I59A 4MQVA 3ZP5A 3CUQA 3MKWB 5LY3A 3O4NA 1BC7C 1J5YA 4JS5A 1O7FA 5K5OA 1E2XA 3CERA 5GPAA 2E1MB 4YOVA 2E20A 3JS6A 2VWKA 2KW4A 4FLYA 2FBKA 4KI6A 2XC7A 2YR2A 4RW8A 1HMVA 1ZBIA 4PJNA 2XO7A 1ILYA 4ON0A 3RQIA 4FM2A 4BGDA 3K70D 3LSJA 3TU5A 1E3HA 1S7EA 1S7AA 2R7OA 4A3KJ 4H5RA 2BXYA 4J19A 1AKHB 3PJRA 2F6CA 4FJ7A 3LSPA 1VQOI 4KNYA 3WG7H 4A2UA 1XWLA 2IDOA 3AAQA 4FJIA 4M9ZA 5DM6F 1HYZA 2UUBK 1S72N 4O0IA 3EEQA 4LG3A 3CCRN 2YS9A 1FSEA 5ILSA 2O0YA 5J2PA 5DUKA 1YJWI 2ZQBA 3GZ5A 1LFPA 4RTFD 3ZETB 4ZC3A 2DK5A 3GBGA 2JQ7A 2ESHA 2I7PA 1Y8QB 2HFHA 3CCSN 4A5BA 5K5QA 3NRVA 2BGCA 2XRIA 1L3VA 2A07F 1JKQC 1ZARA 2HW3A 1P4XA 3TANA 2L9NA 2HBKA 3TTCA 1AWCA 3S14J 2ZJPF 4Z94A 2IS1A 4CCHA 3CCUN 2FNAA 3C0BA 2COBA 1LFUP 5FLXK 3EN9A 3K9KA 1BI4A 1OYYA 3KK1A 3VEVA 2NUBA 2YI1A 4A0YA 3D2EA 3BR5A 2HNHA 4Q0BA 3KP6A 1A5XA 4OWRB 4AD9A 3VQEA 4DSJA 2GA2A 5J2MA 2F8TA 3ZT0A 4E7SA 2GUPA 2RF2A 3UKGA 3NE6A 4LIUA 4H0VB 1Y64A 4J2EA 2DA7A 3I4MJ 3KE2A 3IH2A 2O61A 4IOAL 2ESNA 4FJGA 3VQBA 5LGNA 1X1AA 2LBFB 3LP1A 1FT9A 4IG3A 2LP0A 2HZDA 1SVMA 4NBQA 3I9V2 4CFCA 2FQ4A 4KYWA 3I64A 3MMVA 4CEAA 3GL1A 2R7WA 2O8DA 5CR4A 4CZIA 3J80Z 3RZDJ 4L3QA 1TLHB 1RGIA 2VONA 1G6NA 3HRGA 4OKJA 5CHIA 4B08A 3R4KA 4RAGA 4BJ6C 3DLAA 5AQSA 4M3XA 1L3TA 5IYCJ 2NRZA 3SPYA 3HM9A 3HOYJ 4DKWA 3ABUA 2D5VA 2X6XA 1H89C 4RA2A 4Y0WA 1Q86O 1REPC 4KICA 4WWCA 3LSMA 2BHZA 1LWFA 5F04A 4HPQA 4HWIA 3WGIA 3CJ1A 4KTWA 1YQAA 3OBWA 4LB5A 4KH5A 2VJ5A 3FZMA 4GYIA 4GVEA 4Z4CA 5GPCA 4R5PA 4CXFA 3QOEA 4JI7K 2OC6A 1T6CA 1TW2A 2Y0MA 1X1DA 3ZQQA 1R59O 5GAHP 1QTMA 1M1KO 4JRQA 1D0YA 2ID6A 2CQ7A 1IBMK 2GWJA 1B4AA 1IG9A 2X78A 4M9XA 2KL4A 1PP7U 2XGXA 1QHTA 4QPQA 3VQ8A 4IHYA 3HXMA 1HDDC 1LW0A 2W42A 1WJ5A 1HNZK 2K3PA
chains in the Genus database with same CATH topology
3AVIA 1KFDA 1HQUA 1WAFA 3DLKA 4M41A 1KLMA 4ELUA 4E89A 2Z1IA 2EX3A 2F8SA 3M8RA 3KLEA 1C0MA 2QKBA 1S5JA 4DTNA 1A5VA 4B9UA 4N41A 3ZSXA 3RTVA 3QEIA 1SL1A 3TAFA 1REVA 1QSSA 4CJUA 4CIFA 3S3NA 3IAYA 4FLWA 3P5JA 3DLGA 2XY7A 2ETJA 3O4QA 1JKHA 1IKXA 4AHUA 4HTUA 4KV8A 1S1XA 4DMNA 3QETA 3F73A 1J53A 3C6TA 1WSIA 4W5OA 3L2QA 4B8AB 5I42A 4CEQA 3O3FA 1WSEA