1I3AA

Rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i3aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i3aA01
2P51A 2WOMA 4B3OA 1LAWA 4NCAA 2HHUA 2HNZA 3IS9A 3T19A 3L2RA 1TGOA 1ZBUA 2IDOA 2FBVA 3PX4A 1F21A 3LP2A 1NKCA 3ITHA 3LALA 4FK4A 2PY5A 4HVJA 4DU3A 3MEEA 4DF8A 1QQCA 1QHTA 4M3RA 1N6QA 3P5JA 3CM5A 1BISA 5DMRA 4FLYA 1VSHA 3AO5A 3C94A 4OGCA 2WONA 2D0AA 1JL1A 3KK2A 3TAQA 3DLHA 1JKHA 2XRIA 3HJFA 4CCHA 3AVKA 3SQ1A 3V9SA 4KPYA 3O3GA 1KTQA 1RCHA 1WSFA 4OKKA 3DOKA 5CY4A 4CFDA 3QESA 4Y1CA 3TAPA 2D5RA 3JSMA 1KVAA 4I2QA 4CJ3A 4DG1A 3SV4A 3RMAA 5JS1A 2R7YA 4DQQA 3AVLA 4BWMA 3LWMA 1TK8A 4KAZA 3KK3A 4OPJA 1RILA 3HSTB 3OYHA 4DSJA 3M8QA 4F8RA 3F9KA 4CK1A 4DSLA 4FJ9A 1HYZA 1HQUA 2OPQA 4CJEA 4FXDA 3DMJA 3K59A 3HVRA 2QXFA 3SUNA 4FJGA 3HPGA 2YNIA 1WSJA 4CGIA 4CIGA 4DU4A 1W9HA 1U47A 3I0RA 4IKFA 4KRFA 3NFAA 3V9UA 4E1NA 3SUOA 4KB1A 3I8DA 4JRQA 2PZSA 3VQAA 4FJ8A 1RDDA 3CQ8A 1NK7A 2RN2A 4OVLA 1RTHA 2OZMA 1TAUA 4CGGA 3T3FA 4FJMA 5FRMA 4O0IA 4DSKA 1XHXA 3OVNA 1VSLA 4G1QA 3RTVA 5HRNA 3V9ZA 4Z4CA 1YT3A 3SQ0A 1RT6A 5KGXA 1KVBA 4KHWA 4B9MA 3LPTA 1CZBA 5HP1A 4FK2A 1BCMA 4FJIA 3KKRA 5HBMA 2JGUA 1ZBIA 2A1SA 4K8XA 4KHQA 1D5AA 4FM0A 4KI6A 1CXQA 1RT5A 1ZBFA 3ISNC 3KLEA 3RRGA 3MXIA 3NF6A 3M8PA 1VSKA 1VSIA 1WAJA 1I3AA 4EP5A 3V9XA 4DQSA 3U3YA 1TVRA 5SWMA 3OY9A 2G8UA 4B9TA 4IFVA 1S1VA 3OYMA 1TV6A 2HVIA 4LSNA 2Y1JA 1SL1A 3NF9A 1EX4A 1TK5A 3O4NA 1S1UA 3VA0A 5J2MA 1NJWA 3CM6A 2IS3A 4FW2A 1FKPA 2D0BA 4I7FA 4O4GA 2P1JA 3KKSA 3ZCMA 3HYFA 4W5NA 3MECA 4IG3A 2OA8A 4PQUA 1KSPA 3AVNA 1A5VA 1RBVA 5K14A 5J2PA 3SCXA 4CFBA 5FROA 2YHAA 1X9SA 3HP6A 1T03A 1QSLA 4RW4A 4F2SA 4DTOA 4Z4HA 1D9FA 3TAFA 2YKNA 1J9AA 4CEAA 3TAEA 4FJJA 5KI6A 4RG8A 4WE1A 3VQCA 4DMNA 2KZZA 3AO1A 3DI6A 3AVFA 4CEDA 1ZYQA 4OKJA 3OJUA 2AJQA 2GUIA 2OPSA 4BE0A 3BDPA 3MXMA 3LAKA 1NJXA 4FYDA 1TKXA 3TAMA 1WSIA 4PUOA 2DTUA 1IKXA 3KD1E 3K58A 4PWDA 5HRRA 3TR8A 4IBNA 4I9LA 2EHGA 2E4LA 1JLGA 1IKWA 3B6PA 3JYTA 3OS2A 3SQ4A 4E3SA 1T8EA 3ZSOA 1HNVA 3RRHA 4DQRA 1D8YA 3K2PA 3DRPA 3DM2A 3DLKA 3AVCA 4CF9A 4DWIA 2HHTA 3IG1A 1TK0A 3SI6A 5FDLA 3VQBA 3ZT0A 4E7HA 3NF7A 5CYMA 4DTUA 4KHSA 4GMJB 1D9DA 2RF2A 1GOCA 3AA2A 2Z1GA 3RMDA 1K6YA 4Z0UA 3QEPA 4Q5VA 3V1RA 4N41A 1U49A 4L8RB 5J2QA 1QSYA 3AO3A 3AVIA 3O3FA 1A5WA 2JLEA 1JLQA 4AHSA 3H08A 3ZSYA 2XY8A 4O0JA 4AHCA 4FZZA 3OYEA 4NYFA 3K5NA 1HMVA 3WNFA 3NHGA 4DF4A 3KD5E 4CGFA 4B9SA 3CFOA 5E41A 1QTMA 4N56A 4E7KA 1VRTA 4CJSA 1CXUA 1L5UA 3O3HA 3ZT2A 4AH9A 4BE1A 3SJJA 2F8TA 4I9QA 4QCLA 4FM2A 2G8WA 3DRRA 3PX6A 4CEEA 4E1MA 3QNOA 3T1AA 4DSEA 1SKSA 3ALYA 4C8LA 2G8IA 3TARA 1W0HA 1NK6A 1BL3A 1JLEA 1ASUA 3HM9A 4CIFA 1J5OA 2G8VA 4B9NA 3VQDA 4E19A 4NYNA 1XWLA 4JS5A 1NKEA 4FVMA 4XIUA 4M3UA 2BANA 2VWKA 4H4MA 3EY1A 4CHZA 2VG7A 3CFRA 5KRSA 3DLBA 1UA0A 2ZD1A 1I39A 3AA5X 3VQEA 1NOYA 4EZ6A 3QETA 1RT1A 4CEQA 4NCGA 1RT3A 3L2UA 3V4IA 1WAFA 1RBUA 2DFFA 3LPUA 1WLJA 4KTWA 4HUFA 4DTJA 3L3UA 3CG7A 1HQEA 5HRPA 1HRHA 3G10A 1WSEA 5KTQA 3HVTA 1HPZA 3OYNA 2F8SA 1LW2A 2X6NA 1BHLA 1JXEA 4M3WA 1TL3A 2ETJA 3MAQA 4DTMA 3RR8A 2I5JA 4FJ7A 3QEXA 4ID5A 3AVHA 4O44A 1RDCA 1VRUA 1BQMA 3BGRA 3IRXA 2NUBA 1ASVA 4E89A 3LWLA 3VQ4A 3OYJA 3VQ8A 3M8RA 2HB5A 3U6FA 3V6DA 4JS4A 4DQIA 4FJKA 2A1RA 2B4JA 4LD0A 3DLGA 1KFSA 3NDKA 1LWCA 5CZ1A 3AV9A 3OS1A 2OZSA 4OGEA 4CJVA 3ZSQA 3NH0A 4YFUA 3C95A 1X9WA 1RTDA 2QKBA 4O55A 5J2NA 4OLAA 2HW3A 3P1GA 1CZ9A 3HPHA 4H4OA 3NE6A 3CFPA 4E7LA 1ZBLA 3RWUA 5T7BA 4OJRA 4DS4A 1FK9A 1VSFA 4FLWA 4M3ZA 3ZSVA 4CJLA 4C8KA 4HTUA 2RKIA 4ELUA 3LAMA 4PA1A 4CHNA 1NK8A 2DY4A 2HHXA 1ASWA 3PO5A 4CECA 4CJPA 1S6QA 2HHQA 3TABA 3RMBA 2QK9A 1S1TA 3S3OA 1LW0A 2ITGA 1TKZA 1BQNA 2P5GA 2YNGA 4J2BA 4FJXA 1VSDA 5FRNA 4AHUA 1A5XA 1HJRA 1J54A 3OYCA 4HCBA 3K5MA 1BCOA 4BE2A 4CGHA 1FKOA 4CE9A 2ZE2A 1Y97A 4JLHA 1NK9A 1RTIA 1S6PA 3ZT4A 3AA4A 5DK5A 3HK2A 1DLOA 3AVMA 5C25A 3DLRA 1O1WA 4DTNA 4DLEA 1REVA 3S3NA 4ZTFA 1B9FA 4ZTJA 3DLEA 3L8BA 1YVUA 4IFYA 4J2DA 4ID1A 1HYSA 2VWJA 3VQ6A 3L3VA 2G8HA 4FLZA 3L2WA 4N5SA 3TWHA 2HHSA 4EZ9A 2G8FA 4CJUA 1JL2A 3HP9A 1JLAA 3QIPA 1S5JA 4LSLA 4CK2A 5I42A 4M3XA 2KW4A 3LP3A 2BE2A 5KRTA 4B9UA 1KRPA 1YTAA 1JLFA 4OLBA 3QERA 3NCIA 3VQ7A 2DFEA 1LWFA 4AHRA 1RDBA 4CF8A 4AILC 1C0MA 1U04A 4B9LA 1KLMA 2BGGA 4J2AA 2DFHA 4F3TA 4CEFA 4E7JA 3KJVA 1GOAA 4KHYA 1R0AA 1NK4A 1XHZA 1S1WA 3WNGA 3KLHA 4B08A 1QSSA 1RT4A 3MXJA 4CJKA 1Q8IA 2HHVA 4JRPA 3HT3A 3OS0A 3AVBA 1RTJA 1UA1A 4DTXA 1ZBHA 4CESA 3KIOA 3V9WA 4HCCA 5KGWA 3V1QA 1QE1A 4C8MA 4O5BA 4AHTA 1XI1A 1LV5A 3LP1A 2ATQA 2X78A 2PYJA 2D0CA 4CF0A 3QEIA 4F3OA 1NOZA 2IOCA 3OYDA 4CFCA 2Z1HA 4KKOA 3QNNA 2YV0X 5JS2A 1C6VA 1EETA 1NJYA 4LH4A 1WSGA 5D3GA 4FLTA 3RMCA 3HPOA 4Y1DA 3SPYA 4KHNA 3TI0A 3KLFA 3QEVA 1GOBA 1HNIA 3MEGA 4YNQA 1C1BA 1NKBA 2KFNA 1KLNA 3RR7A 4KFBA 3C6TA 2LSNA 3KLGA 4FJHA 2HNDA 3SPZA 3NAEA 2GV9A 5HLFA 3C6UA 1U48A 4Q0BA 5HRSA 1RBRA 3QIOA 2XHBA 3TANA 1RNHA 2KFZA 3EZ5A 2XY6A 1RDAA 4FLXA 4DFJA 1TKTA 1UAXA 2B6AA 3OJSA 3D0PA 1NK5A 2F96A 1C0TA 2FBTA 2W42A 2BDPA 4OPKA 2KZMA 3I0SA 2KQ2A 2XO7A 3NF8A 3V1OA 4N76A 4FW1A 2EX3A 1RBSA 4CF1A 3SUPA 3ASMA 1IKVA 2XY7A 1BGXT 3ZSWA 1CLQA 1DTQA 1FXXA 1Z25A 2X6SA 3PUFA 4LH5A 2E6LA 4RW7A 4CEBA 3ZSZA 4H8KA 4FLUA 1X9MA 1Z26A 4Z4FA 3SYZA 2VG6A 4CJRA 2Z1IA 4DFMA 1VSJA 1NK0A 3NGYA 4FM1A 1TKDA 3ZSXA 1KVCA 4AHVA 3SUQA 4NCBA 3VA3A 3DRSA 1VSMA 3OYIA 1XC9A 1LAVA 4N47A 1RT7A 1VSEA 4W5RA 2YKMA 1C1AA 4LY7A 2KTQA 3AVJA 3U3GA 3LZIA 4DSIA 3NGIA 4B9VA 2XY5A 4I2PA 3HL8A 2HNYA 1VK0A 4KTZA 5J1EA 4UQGA 1L3TA 4FJ5A 2X74A 4DFPA 1U45A 2HVHA 1YTUA 3B6OA 2IAJA 1ITGA 1QS4A 3NH2A 5I3UA 4FLVA 4F4KA 1B9DA 1EP4A 1TAQA 3K5LA 3E01A 1SL0A 1WNSA 4BDPA 2GBZA 3VQ5A 2PYLA 3THVA 4OKEA 1X1PA 4ELTA 2OPPA 3ZT1A 4CJ4A 3SV3A 3P83D 1SUQA 4M45A 1IH7A 4Z4EA 2O4IA 4CHPA 4KREA 3AO4A 2HMIA 2RPIA 3NBPA 4FJNA 1HYVA 4CK3A 4CGDA 4CJQA 4FZXC 4CJTA 3LP0A 2Z1JA 3WNEA 4BDYA 3QEWA 1RBTA 4DTRA 2O4GA 3WNHA 4CHOA 2Q3SA 4DTSA 3PV8A 3AVAA 4Z4GA 3LDSA 2YNFA 3L2QA 4DS5A 3NH1A 2FBXA 4ZHRA 1Q9XA 3PO4A 1BIUA 1S9GA 3PY8A 1T05A 4K8ZA 1BI4A 3S3MA 4CHYA 5CYQA 3A2FA 3EYZA 4DTPA 1SKWA 4E7IA 3VQQA 4KHUA 1WSHA 3SNNA 4F2RA 1G15A 2IC3A 3D45A 4CGJA 4DU1A 3OYKA 4KI4A 4MFBA 4RW8A 2QKKA 4CJ5A 4CJFA 3ZSRA 5C42A 5HROA 1J53A 3QLHA 1KFDA 2Y1IA 4RW9A 4KTQA 1EXQA 4FJLA 1WN7A 3VQ9A 4M3YA 2HHWA 1N5YA 1BIZA 4CERA 3QINA 4W5QA 1MU2A 3AVGA 4KV8A 3L2VA 1TL1A 4IDKA 3KK1A 4J2EA 3UIQA 1RT2A 4R5PA 1SKRA 3DYAA 4Z4IA 3HO1A 5EU7A 3NGZA 4B8CA 1S1XA 3QO9A 1U4BA 4BWJA 3OYBA 1KCFA 1IO2A 3ZT3A 4FZYA 2OPRA 4W5TA 3OYGA 4EP4A 1IKYA 1UOCA 4HUEA 3SQ2A 2OYQA 1Q9YA 3K57A 1SV5A 4DFKA 4ICLA 5C24A 4E0DA 3V81A 1JLCA 3K5OA 2G8KA 4CEOA 4BACA 3S9HA 3KTQA 4KB0A 1JXBA 2FBYA 5SZTA 3VQPA 4GVMA 3M8SA 4FK0A 3IAYA 3AO2A 3HXMA 1JLBA 4DQPA 2ZQBA 1UWBA 3KLIA 4MQ3A 2B5JA 1C1CA 4CF2A 2VG5A 3FFIA 4KO0A 4W5OA 1L3UA 4PY5A 4BDZA 4FCYA 2E6MA 1IG9A 4QAGA 4HHTA 3OYLA 4M41A 3LZJA 3VN5A 4GW6A 4DSFA 4CEZA 1EKEA 3G0ZA 3LANA 4QOZB 1B92A 2IGIA 4C8OA 2P5OA 3OYFA 4ELVA 1S9EA 1LWEA 4IG0A 4B8AB 4CJWA 4CFAA 4RW6A 3AA3A 2YHBA 4CHQA 3PX0A 1C0UA 4M42A 1SL2A 2YNHA 4CIEA 1L3VA 1NJZA 4C8NA 3CYMA 3TAGA 4M3TA 4TSXA 1L3SA 1DTTA 5CZ2A 3SZ2A 3DOLA 3OYAA 3F73A 1T7PA 4DLGA 3MEDA 2FC0A 3ULDA 3O4QA 1BI4B 4HUGA
chains in the Genus database with same CATH superfamily
2EB7A 2CUJA 4YOYA 1ETYA 5HDGA 2IDOA 1ZN2A 3FZKA 1USSA 4CZGA 1QQCA 4QS7A 2Q1ZB 4C2UA 3B6AA 3K4BA 3JAMZ 5ILVA 2V1XA 3C65A 4I2QA 3BJAA 5F08A 2MW8A 2DMPA 1XGNA 5DD8A 3R8EA 1R1VA 1VQ9I 4DCHA 2PFBA 2DU9A 2IVNA 2PZSA 3LL7A 4IEIA 1SAUA 2LBFB 3LAPA 3VYUB 2YX7A 5HP1A 4M6VA 3AAPA 1OPCA 4IOCF 3NF6A 2NRWA 1XMKA 4LG0B 4ENMA 5HDKA 1W7PA 4AIHA 1WI9A 3IFRA 4W5NA 1ZRFA 3FHZA 5AQRA 2P9SA 1PVEA 1OYYA 4H0OA 5EEHA 3GYHX 3DI6A 4U7DA 4XLEA 3K1MA 4XBFA 1V5FA 1WSIA 1MW7A 3J7YJ 3SQ4A 3JYTA 3OS2A 2KLOA 5M5WJ 1HBXG 3SI6A 2JA2A 4CUGA 2LTPA 4AM6A 2I7PA 3ZP5A 3HBTA 2XAGA 4NLCA 4L8RB 1ZREA 3H5AA 4AHSA 3HOVJ 4FZZA 1HMVA 3WNFA 3THXB 1YHQN 1FEXA 4BY9C 3O3HA 1TUUA 4E1JA 4NB5A 4C8LA 5TJJA 2K4BA 2COMA 4GRIA 4CBWA 5FPNA 1WHUA 4V2FA 1G2HA 1YI2N 1J5EK 1BW6A 3QETA 1M90O 3RQIA 4ESBA 1JXEA 1TL3A 3BPVA 3CP8A 2DODA 5K5QA 1KQSM 2W40A 3U6FA 2O8BB 5CZ1A 3A4CA 3K70C 4CJVA 3ZSQA 4O55A 2MH9A 3HPHA 3TSQA 1KQ9A 4DYQA 2GWRA 2JJ7A 1NGFA 1X1CA 2HHXA 4AM3A 1E17A 2HOSA 3O4WA 5FD6A 3S8PA 1TKZA 3V7CA 1X3NA 3ZT4A 4DLEA 4IEEA 3I5UA 3L3VA 4FWPA 4NC7A 4HA8A 1ETXA 4BRKA 1JL2A 2XGEA 5KRTA 4JAXA 3NCIA 1IV8A 1QPMA 3VOEA 5KNLA 3E0JB 4F3TA 4CEFA 3H3ZA 4M6XA 4FASD 3OMYA 2HZDA 5LGTA 4FX4A 1Q8IA 4OOIA 3HHGA 5E8IA 1LQ1A 2VKEA 1ZBSA 3KIOA 3O8MA 4BL0B 2V7ZA 1IN8A 3RPQA 2ASOA 1S9HA 3U21A 1SVOA 4DR6K 1YIJN 1J0RA 3KZZA 3EZWA 4CZEA 4D0PA 2LSNA 1RETA 4QSHA 3CCUN 4IHTA 2DAOA 3S1MJ 2W4SA 3QIOA 2ECBA 4NC8A 1IBLK 1K6OA 3AG3H 5GIOA 2FBTA 2W42A 2LY9A 3H36A 4JHDA 1MSFC 4AD9A 3ASMA 1IKVA 2ACJA 2XKOA 1FXXA 2FQ3A 4RW7A 4FLUA 4Z4FA 1RKWA 3PQJA 2ZNYA 2JWLA 4BG8A 3OYIA 2UWMA 5TGTA 4W5RA 3VF6A 2KTQA 4N0BA 4DSIA 5IT9Z 1QHGA 1TC3C 4EJWA 3K4MA 3LDPA 2D45A 5ICFA 2PI0A 3CQZJ 1ITGA 4FLVA 2BV6A 1SL0A 1WNSA 3R0JA 2AA4A 1SUQA 4ILHA 1XB4A 4IHXA 4IFEA 1FBSA 3PV8A 3O08A 1MBJA 2QVOA 2ZFWA 5C3EJ 1VQOI 2FBXA 1S9GA 4K8ZA 3QMLA 1FTTA 1BM9A 3EO3A 2XB0X 2HYFA 4A2BA 2BVMA 1IG8A 4LF4K 5IP6A 4LMYA 1IRXA 1WJDA 4WFAL 2P9PB 3QINA 3R3LA 4CCJA 1DU6A 3H9JA 3BR0A 5D4SA 2NRRA 5M1PA 1KYWA 3J80Z 5AFUA 3A03A 2RKHA 2VXZA 4DQPA 2JTVA 1KGSA 4FCYA 2UXCK 3VN5A 2ELKA 4AQYK 4ELVA 5KAIC 3I54A 2LLKA 5E3NA 4LF5K 1O13A 4TSXA 4BGDA 2OZUA 4DLGA 3HRTA 2WOMA 4DV2K 3A0IX 3WQTA 1NKCA 4IOAL 1YS6A 3WXKA 5LMNK 1N6QA 2JWKA 2WONA 3KK2A 2FNAA 3DPTA 4CJ3A 5H6RA 1NH3A 3VOVA 2R7YA 4CK1A 4DSLA 4FJ9A 1HYZA 4FXDA 3LMMA 1V4RA 2F5VA 2QXFA 4FJGA 4KRFA 3P38A 2JVHA 3KP4A 5EGOB 2BW3B 5LRRA 2BY2A 4E70A 2F5EA 4XIDA 1XTAA 5HBMA 1MMSA 2HPIA 4FM0A 4ZYHA 4ILJA 3GFMA 2XIGA 5BN9A 3KLOA 1SL1A 1TW3A 2QLZA 1G99A 4KIFA 5E20A 2EIJH 3G6EN 2DA6A 2Q0UA 2KIMA 5FFXA 2NS7A 3MECA 3F23A 1FP1D 5KI6A 3VQCA 4DMNA 4BUPA 5M1NA 4O5VA 3MXMA 1DP7P 3LAKA 4PUOA 3MN5A 1OCZH 4L5IA 4G12A 1DKGD 4JI4K 3IH4A 2DW4A 1J2XA 2HOTA 2W48A 3PNYA 3P4IA 2E1CA 3DPUA 3RMDA 2E2PA 1OCRH 1XS9A 3A02A 1WZ2A 2EFQA 5GADP 1EV7A 3SMSA 3JTHA 1YE9A 5TKYA 4DF4A 4BR9A 3UE5A 1D0YA 4HDVA 1GUUA 5AQSA 2QQ9A 3ZMDA 3WE3A 1W0HA 3EUHA 4B9NA 1AHDP 4E19A 4FVMA 2LKXA 1R1TA 5LMUK 3VQEA 3BZCA 2XB5A 1U9OA 1KU9A 2NXNB 2GXBA 5F0XA 1S72I 4F52A 1IN5A 2E5LK 1FOYA 3VSLA 4CA0A 5AQHA 1ZLJA 3C2HA 3OYJA 3M8RA 4YDUC 3LWLA 2JMWA 3SMPA 3WTXC 3IDHA 1TW2A 2R7SA 3C95A 3K9JA 2L4MA 1BO5O 4H4OA 3A01B 1XMXA 4A0ZA 4CZJA 4M3BA 4E4HA 2CRGA 2HHQA 3TABA 3RMBA 1ZR4A 4MO5A 1R49A 4HCBA 3SZGA 2V79A 3OIQA 4BE2A 4XH5A 1PP8F 4M3EA 3LSPA 1IXRC 3DLRA 1REVA 1MBEA 3DLEA 2R7TA 3ABKH 3K4NA 2VWJA 3M8JA 2WTUA 2QENA 5EY4A 3W3DA 3FM5A 5GAHJ 2XASA 4AHRA 1RDBA 3D5LA 1KLMA 2E35A 1FIAA 4BR7A 3QYEA 4CJKA 3U9ZA 5CVUA 2ZSIB 2H27A 5KGWA 4C30A 2A6HF 3QNNA 3DXJF 3WHCA 2DCEA 2NOJB 1E3PA 5D3GA 4RTFD 2CV2A 1FMWA 1SD4A 4YNQA 1IC8A 4RAGA 2ZB9A 4KFBA 2O8FA 1SMYF 2GV9A 2RHKA 3GOIA 1RDAA 1NK5A 1T98A 4AIKA 1JE8A 4FW1A 4CF1A 3L9FA 4RAYA 5M1FA 2BE5F 1CLQA 1DTQA 1T0FC 4BC5A 3K6GA 4CZHA 4XR6A 2VG6A 2K3PA 3WGIA 4M9ZA 3V7SA 2VT2A 2D0PA 2VI6A 1HF0A 2EK5A 2L2OA 2NS8A 1N36K 5TISC 4A12A 4PJ0C 5IYBJ 2FXUA 1YS7A 3BY5A 3O9QA 3N97A 5GP9A 1BWFO 1YG2A 1KQ0A 3DKWA 5JI6A 2OPPA 2VBXA 1R71A 3UR3C 1I50J 5FLMJ 3TP3A 1S22A 1LDDA 2FJ1A 3TO9A 5CQEA 4CGDA 2GTDA 4ZH4F 3A5LC 4UVBA 1REPC 1EO1A 1K4SA 1BI4A 4G6TB 5DS9A 4BJ5C 4KA4A 3ZEUB 5JLFA 4RB0A 2Y0MA 1ZR2A 5HROA 4RCHA 4UV9A 4FJLA 4M3YA 2CGPA 4XLAA 3AVGA 4N9IA 2WC2A 3N4QA 3PIPF 2ITMA 1YJWI 1VAZA 2P9IA 4BRNA 3QYBA 3BR2A 3V81A 2M0CA 2FX0A 1Q1VA 3M8SA 5LHIA 3AO2A 3KLIA 4BQNA 2NNWA 4QAGA 2DJIA 4CEZA 2EILH 2OUMA 1YW8A 4CHQA 1QZ5A 1Y0UA 4M3TA 1HKQA 1LVAA 3EKUA 3WEEA 5DTDA 2P51A 5LBQA 2CV0A 2GZWA 1MMDA 2I10A 2QCOA 2LG4A 2VQHA 2KDOA 5HNHA 4HRIA 3QOPA 1QHTA 3TW6A 3O9SA 4N4NB 5AQYA 5CVIA 3K2AA 3PL8A 5J4YA 4I2OA 3GTQJ 4JI5K 1BOAA 2EBIA 1AA7A 1U47A 3NFAA 4QPQA 1NLVA 3CCVN 4IHYA 5FLVA 4FQGA 3T3FA 2F6CA 5FRMA 5CR4A 1VSLA 3EE9A 3JRFA 2R0QC 1KVBA 1WJFA 1ZBIA 4K8XA 4KHQA 3ISNC 2ID3A 3G1MA 1VQ4N 2G8UA 1S1VA 5LGUA 4JP0A 3IC7A 3CC4I 1HJOA 3FBIB 2E2NA 4X6AJ 2M5WA 3ZGKA 4CFBA 1YO5C 2QGUA 2W24A 5M3MJ 4QS8A 1WGXA 2HBMA 4XN3A 3VGLA 4FSVA 4FYDA 3CJBA 2GWJA 3VSKA 5LLQA 1MNDA 5BRFA 3CJ7A 4RLQA 4U67L 4ZYGA 2F4IA 2AXTC 4GMJB 3DXKA 3VTHA 1VQNN 3M4OJ 5FLXZ 5AQNA 3M9AA 3S1QJ 3HOTA 1D8JA 5M5YJ 3NHGA 1NGAA 4B9SA 3S16J 1QTMA 2BH1A 2QTDA 3CMAI 2JZYA 3ABUA 1O7FA 5DUKA 2UUBK 4XLCA 3V4GA 5GTHC 4A3CJ 1F43A 4XL9A 3WXJA 2W25A 3CZ6A 4CD1A 3FE1A 2P9SB 3CFRA 1I39A 3IAM2 3GZ5A 4M73A 4CCKA 3L2UA 3H1QA 3V8KA 2P9UA 3QICA 4RM3A 2DT5A 3SZPA 5JFRA 3AVHA 1VRUA 3HL2A 2NUBA 4XQFA 3TSUA 3K7AJ 1TUYA 3G2BA 3TP0A 2UU9K 3H1CA 3D0SA 3DCFA 1WJCA 1B9MA 1ZTRA 4OJRA 1U5TA 1I6XA 4LF8K 2HQ5A 2XPUA 4CJPA 4EQQA 4MO4A 3WXMB 1FMVA 3QPHA 4GV6A 2YNGA 3OYCA 1YF5L 5BREA 1UG2A 2CFXA 4FETA 5EDNA 2HOAA 1DLOA 3VODA 2ISZA 1O1WA 3CCEN 4BQQA 1HSTA 1U2VA 1NGEA 4BEHA 3KETA 3LP3A 2XAQA 4DYCA 1N25A 3ZN0A 4RB2C 4JOMA 3ISPA 4A3EJ 1FX7A 3O80A 2KL4A 1JTXA 3F8MA 1U78A 3JAMK 3M1CA 3S1NJ 1QE1A 5HNFA 3O9TA 4FWLA 2D0CA 3QEIA 3GTLJ 2IOCA 4KKOA 2L01A 2IAIA 4BU2A 3I59A 3SPYA 5TKWA 1EH8A 4KN7X 2HF4A 3CCMN 2JK3A 2OQGA 1HPMA 5B3SH 3UB5A 4FWNA 2E60A 4YOWA 5MLCQ 1FTZA 2YU3A 2NZTA 1K7AA 1X9JA 1OH8A 2ZWHA 3HZ6A 4OMYA 3Q7BA 4DFMA 3E5XA 3CLOA 4B3RK 5GINA 2GUPA 3TOAA 2DQRA 2FD5A 5AQVA 1T6SA 3HL8A 2HNYA 4UQGA 3C18A 2LYCA 2Y0SA 1HDPA 2DY4A 2FBIA 3SFZA 5LRSA 1H9TA 4DV6K 1ZGJA 4II3A 2MH2A 3WNHA 3CC7N 2YNFA 3LSIA 2VJ4A 4OPHA 4EM1A 4YEJA 3MX5A 3CJ1A 1XG1A 4ETSA 1Z3YA 1SAZA 1G15A 4CGJA 4BHBA 2MFZA 4JHDB 3CO7C 4M6YA 4FE7A 2W57A 4IDKA 3QOEA 4CCNA 4IZZA 2Z9OA 4BS9A 3K57A 1TWAJ 4CEOA 3KTQA 5J8CA 1RDWX 3VQPA 1YJ9I 4GVMA 2BEOA 3GG4A 4AWXB 2ZFUA 2O61A 1GDTA 2DO7A 1VQ8I 3MKLA 1MSEC 1ZRCA 3DOLA 3UKRA 3F73A 1T7PA 1J7KA 2BGCA 4B3OA 2HHUA 2RDPA 2WAQA 2O8KA 2XGXA 2M9HA 5CKTA 2FSJA 1HKCA 4FE4A 3CUQB 2KIFA 3GTMJ 4YOUA 3RYPA 4I01A 1ETWA 3TAQA 1K8AO 4DZJA 2EQRA 3BG9A 2E2OA 4MDBA 3H46O 5LEJA 4DG1A 2L9VA 2XAHA 4ZJZA 3CD6I 1HXDA 3WODF 4ESJA 3LNQA 3E1SA 1WRJA 3SUOA 4BXUA 3FIWA 4K25A 1RDDA 5E79C 2Z1DA 3CCLI 3U1KA 4PCQA 5CPRB 4JX5A 2XUBA 2M4GA 3MZHA 3LA7A 1I3AA 1VSIA 3U3YA 1LVKA 3X2QH 4B9TA 3AGKA 4DR3K 2IS3A 2M45A 3RSEA 2UXXA 2D0BA 3KKSA 3HYFA 4K41A 4EGZA 1C0FA 1N34K 2DOFA 2WC9A 3H6EA 4BRIA 1BR1A 5IY5H 3AL0B 1Z6RA 5HRRA 3A1YA 1NGJA 1JLGA 2QSFX 4L9JA 5CYMA 1ENHA 3GUDA 1V5GA 1GOCA 4Q5VA 3DLAA 3W6KB 1A6IA 3AVIA 1X4PA 1ZAOA 1O3SA 1Z1DA 1T56A 5IT9K 2ZC2A 5AQIA 2HVSA 3IKTA 4E7KA 1YVNA 5M5XJ 3KVGA 1L5UA 1UCRA 3ALYA 4WF9L 1LE8A 1XNQK 3WUHA 2HDWA 4IWVA 3QPTA 5HOOA 2UV1A 3LSMA 4DW6A 2R7RA 4LB5A 1K83J 3LPUA 1Q1HA 4DTJA 3OYNA 2F8SA 1FP2A 4OIQF 4DR2K 3JSOA 3BGRA 3I8BA 3GCMA 2E20A 3AKZA 1U3EM 3RSNA 4IJNA 1CZ9A 4UVAA 2CH6A 2KRFA 3J7AP 1IUFA 2PG4A 3J80K 5FPEA 1G3YA 3EUKL 1HCRA 4AHUA 1HJRA 5JICA 4CE9A 1S6PA 4KNYA 2ZJRL 2OV7A 1W97L 2DTZA 4ID1A 4CGZA 1FYLA 1Y6IA 2Y69H 1ESVA 4BJTA 3LAJA 4I6MA 3FXMA 3FMQA 3HP9A 4B1ZA 1SQKA 1P2FA 2YR2A 1IF1A 2ZF5O 1WB9A 3IP4B 2VGNA 2E1YA 1Y8RB 1RT4A 4M7YA 4DTXA 3ML6A 2FA5A 4YIFA 3CJQB 1NGGA 3IAS2 2DFIA 2IS1A 3BR5A 1D5YA 2KFNA 4PHTX 2LOOA 2O0YA 5K7ZA 1VTNC 3OBYA 1RNHA 3ZQFA 5EF6A 1BG3A 2M34A 2YU9J 2F96A 1C0TA 2R7XA 4AU7A 4F3QA 3BTIA 1SMTA 3RTRA 4N76A 2QEXN 5F1RA 2XY7A 2UUZA 2CGLA 3BCBA 1LFPA 4WQ4A 5CQGA 4K2EA 1KVCA 1LDJA 3J80O 3DRSA 5DM7F 2VQFK 2M1BA 3LA2A 2P0WA 2IA1A 2XC7A 3SQNA 2NLXA 4DHYA 1YTUA 2Y30A 3SJHA 3NH2A 2PYLA 3VF2A 3ZT1A 4Z4EA 5AIQA 5C44J 2VXDA 3WNEA 3BZ6A 3G1OA 3NH1A 1R5HA 2XSDC 3PY8A 2O8FB 4YORA 3GO5A 5JHFA 3DKYA 2QKKA 1Z21A 3W2AA 1ZXOA 1BW5A 2HR3A 1WN7A 1GLJO 2YX4A 3OR2C 4R5PA 1BOTO 4DV5K 3L6QA 2OPRA 2J5PA 1W2BM 3O8HA 4E0DA 2FUG2 5KK1A 2DLLA 4NO7A 3LSJA 2Y9YA 4LGWA 2CG4A 4A61A 6PAXA 2QQ8A 1JLBA 3AGRA 4WWCA 2HZTA 2BBYA 4KO0A 4JKBA 2Z5UA 2ETHA 1VQ6N 4O5FA 2L7KA 4BY1J 3I4NJ 2P5OA 5DCMA 3TTFA 4M42A 4C8NA 2UXDK 3A5MC 2O8DA 9ANTA 1L3SA 5EZHA 3ATUA 3L4IA 1BI4B 2FNPA 1LFUP 4IOAF 2K7LA 2JWTA 4KPYA 4CFDA 4OKKA 5CY4A 4EFHA 1UMQA 4KH6A 2P9IB 5F0CA 3GFJA 1G8XA 2ELHA 3FZLA 4KISA 1V3FA 4KHPK 2RN2A 3SAGA 1RTHA 3O1WA 1H0MA 2KMUA 1NG6A 3KKRA 5ILUA 4UV8A 1CXQA 5ICGA 4I99C 4IRGA 1UFMA 3T1BA 3THWA 3WEEB 2HVIA 2IGNA 3NF9A 2EINH 3MD2A 2P5LC 3O4NA 1NJWA 4XMYA 2M0MA 4I7FA 3Q9VA 4NBQA 2X6OA 5J2PA 2ZXHA 5LJWA 3ZMSA 4A5AA 1NU0A 5EEGA 4RG8A 3REOA 1ZYQA 4CEDA 1YQAA 2E36A 3MFKA 3BDPA 4G9YA 3G4SI 1X19A 4PWDA 3B6PA 2OPTA 4E3SA 2JRTA 3ZQQA 4M3WA 2ZNZA 4D1QA 2D2WA 2V9KA 4QPOA 3T7ZA 2R4GA 3MN7A 3ECOA 1U49A 3I55I 3AAFA 3ZRGA 5BPLA 1VF9A 3I56I 1ZG1A 4D7MA 2TRTA 2FXAA 3CCQI 4OIPF 2Y9ZA 4H0YB 1SKSA 1F1ZA 4KYWA 5J3LA 5AQWA 3J81K 1S3XA 1ASUA 2VQCA 2V6EA 4ISFA 1X4OA 4M3UA 3FZMA 2VG7A 2H8RA 2JSPA 2E2JJ 4JKGA 2V1NA 4NXMK 4B4CA 2R92J 1NJYA 1R5GA 3J7AY 3VEYA 1WJ5A 4WFBL 2A3ZA 3C0BA 1LWCA 4EMSA 4JX4A 3DXKB 4OGEA 3V8LA 2CFOA 3J7ZI 4DGWB 1MBHA 4C8KA 4PA1A 4CBUA 2P81A 3H0GJ 1X3UA 1S1TA 1Z7LA 4JLHA 1Y97A 4JK1X 1ETVA 2BY0A 1BR4A 4ZTFA 2ZXIA 1YVUA 3BOQA 4XSZF 3VQ6A 2HHSA 2HF3A 4EZ9A 2CQ7A 4UUTA 3WU2C 4A3KJ 4B3TK 4F9OA 3FISA 2P9UB 3TPQA 5AZIA 4AILC 3A5OC 4JI2K 2BGGA 2P9NB 1ZGAA 3IWFA 3FMSA 3EYYA 1XPXA 3FXJA 3J81O 5ELZA 1O3RA 3V1QA 2RV8A 2PN6A 2PYJA 3QU3A 2P6TA 3OYDA 1RPWA 2LBFA 3OIPA 3MKYB 3GTGJ 4A3GJ 3K9KA 4RS8A 1U5TB 3BTJA 3M8EA 1W5CC 4HV6A 3KLGA 4XH1A 3BTCA 4LG0A 2BYVE 2BDPA 4LLGF 4RBOA 5H1SQ 1U2VB 4FVUA 1E0EA 1Z25A 3ECHA 4BEHB 1OVYA 4M9XA 5HS9A 4AHVA 2A61A 1XC9A 3DV8A 1V4TA 1AWCA 1JKQC 4HQEA 4V19K 1PYVA 3JRHA 4FJ5A 3B6OA 3P9IA 1XUPO 5I3UA 4ILGB 4BDPA 1FNNA 4G7ZF 2O4IA 1TWHJ 3IWZA 3I59B 1V54H 4I7HA 3L2QA 1ZG3A 3T5XA 1VQKI 2NRZA 2KLAA 5ILSA 3LDOA 1RKTA 3D45A 2C6YA 3BUZB 4RW8A 4YELA 5FLXK 3WQUA 2VKHA 1MU2A 4A5MA 4PK4A 1SKRA 4MO7A 3I71A 4AUXA 1H88C 2OTJN 3HSEA 4K0KK 5DD4A 2NVXJ 4F92B 3CETA 4I02A 4OAYA 4QOZB 4C8OA 3CJ9A 5F0HA 1W4MA 4RW6A 2YHBA 5CZ2A 2HQAA 4JI8K 1PJRA 3HI0A 1S7AA 1TGOA 4KT5C 3PX4A 3GDQA 4HVJA 2FF6A 3WXLA 4HOBA 5AQOA 4M3RA 2N8GA 1JL1A 1GLEG 2MC3A 1HKGA 3HKZA 4OIRF 2A6TA 4UB6C 1JJ8C 2D5RA 3JSMA 4A6DA 2ZKZA 3RMAA 3K69A 4X0GA 1FLIA 2TDXA 4CJEA 4KDPA 2DTRA 2MABA 4BH9A 1TAUA 3I0RA 3T1HK 2HQNA 5AQQA 2LKPA 3R60A 2VC1A 1V55H 4H5VA 3RTVA 1CZBA 5L3EA 2Q0OA 3M8FA 4X66K 2HBJA 1IXCA 3R1XA 3A2KA 1P90A 3UKRB 3OYMA 2V1UA 4MLHA 1EX4A 4IG3A 4H0PA 1ETKA 2QXLA 3OJUA 1WBBA 4A6EA 3TAMA 1HNVA 1R59O 4CF9A 2HI3A 1TK0A 5AQKA 2GQQA 3ZQHA 4BBRJ 1GHCA 4NUBA 4L0YB 2OTLN 3SEZA 4C2MJ 1Z6TA 5D8LB 2HXIA 1TNSA 3W6VA 4JBAA 3HSCA 1CXUA 2A5YB 3PX6A 3G25A 4CEEA 3FBNB 1J5YA 3OIOA 1XGMA 4LK1F 3EETA 4BRMA 4WXHA 2DPUA 1ON2A 4AC0A 4J01A 2HTSA 3OBWA 2O7OA 3VEZA 1WLJA 5AQFA 4K43A 5KTQA 3QYFA 3TDUC 1F5TA 5F64A 3QEXA 2M3AA 1JGGA 3O3KA 2KRHA 1ASVA 2LVSA 2H1KA 1P4AA 4RM2A 1XSXA 2OZSA 4KITB 3CFPA 2CV1A 4FLWA 4CJLA 2GBYA 3HEFA 5IOZA 4KH5A 3C6AA 5AZJB 1BQNA 5HS8A 3J7ZO 4EAHD 1LE8B 1XMAA 1RC9A 3D5SC 1GV2A 2Q8KA 4A3LJ 3PO2J 1T33A 1JLAA 4HBLA 2K4JA 3SJMA 3KHYA 4FWRA 1R0AA 4ENKA 4B08A 1RTJA 2E2IJ 1L0OC 1NOZA 5EGOA 4CFCA 2BW3A 3LSRA 3LDLA 3A0BC 5FB2A 4JI6K 2D1VA 4JYKA 3NQOA 2R5YA 3C6TA 1QQOA 1GLBG 3EZ5A 3KZYA 1ERDA 3OJSA 3HTVA 3I0SA 1BBYA 1JGSA 4UHTA 1AU7A 4IO9L 4NCBA 2MA3A 5C15A 1T6DA 1IDYA 3HTUA 3NGIA 3S2WA 4DFPA 3E7LA 3ASNH 3CF2A 3BP8A 1QS4A 1G4DA 3K5LA 5BQTA 3THVA 2HWVA 2R5ZA 1MJBA 3FKJA 2IVOA 3DPLC 1MDUB 1Q86O 2LH9A 1RBTA 2WUSA 5D4RA 1WCMJ 4BROA 3M6GA 2X6WA 4E7IA 3ZOBA 2QM1A 3D6RA 4IXCA 4AYBA 3JRDA 2Y1IA 4W1UA 1N5YA 2RN7A 1ULYA 2V7FA 4CERA 2PMZA 3JXUA 4P5OA 1PP7U 1DU0A 2VYPA 3S41A 3OYGA 4W5TA 3SQ2A 2UXNA 3K5OA 4N9HA 4ENNA 3U8XA 2FBYA 1S29A 2ZQBA 2GLOA 2L02A 3V42A 3IUOA 4BDZA 2NAZA 1HQCA 3E9OA 4GW6A 1X3WB 3O6WA 1YLFA 4ZYAA 3G71I 3A01A 1WPKA 5GAGP 1DTTA 1GLDG 3I4MJ 3SZ2A 2AP1A 4BC4A 2GXAA 3SPZA 3T19A 3L2RA 3LALA 2JUGA 5DMRA 2HFHA 4RGXA 4OGCA 1YJ9N 4HPQA 3N4PA 3DAWA 2XF5A 3SV4A 3JW4A 4BWMA 3CMYA 1TK8A 2R7VA 3FLCO 4CBXA 3HOXJ 3S15J 3DMJA 4M71A 4CCMA 3T69A 4CZCA 4TV7A 4DJAA 5LHGA 1NMNA 4OVLA 1V5EA 4O0IA 4DSKA 4CD3A 4RB1A 5KAFC 4XKWA 3DTEA 2O8DB 1VQMN 2D5VA 3H3VK 4JNEA 5J1YA 5HLGA 4DV3K 4MDAA 2J5OA 4A93J 4BRCA 2QYOA 1UG0A 3SDGA 4F2SA 1JKPC 2XPWA 3VPRA 2QSGX 3W2WA 3DTIA 1D1AA 3AO1A 2XF6A 4C3JJ 4RAFA 4H5WA 1IKXA 1GXQA 3TR8A 2DYSH 2BHZA 4IBNA 5HLTA 1XC3A 1YX5A 2O8CA 3ZMVA 5FDLA 4E7HA 3LFUA 4PGGA 2RF2A 3ZR8X 2NOGA 4AVPA 2IGOA 1LB2A 3OW2M 2M7AA 3EL2A 4N41A 4XICA 2VKVA 3AO3A 2CYYA 4B48A 1T08B 2FSWA 3KD5E 3E6CC 4WQ5A 2RGVA 3AL0C 1W0TA 1VNDA 5C2DA 4IJAA 4BE1A 5C0YA 4QCLA 1ZK8A 4FM2A 5BS6A 3CCRN 2GELA 3BG7A 1XC5A 1IRZA 2RQPA 4CZMA 2ZXWH 5BR9A 2BANA 1DT9A 3ZETA 3S14J 1UA0A 1D4XA 3RDIA 2TCTA 4NCGA 1IN6A 5AQUA 1YAGA 1HRHA 1A04A 1IRFA 4QWQA 2DT7B 2ETJA 5D8KB 4ID5A 4Q48A 2VPLA 3D2FA 3I33A 5AJ3K 3RJPA 3WGGA 1K73O 2QWNA 1B72B 4BG9A 4JI3K 3ERMA 1BI2A 3BQYA 1DEJA 4HZFA 1LFBA 5A2QO 1YTYA 2ZJRF 3HK2A 5E18F 1YHQI 3O9UA 1L3LA 4A3DJ 4ISEA 4M63C 2KW4A 4JKGB 1XMOK 3VQ7A 4JN4A 4L3QA 4AYBN 2IXSA 5E1ZB 2JT1A 2HHVA 2PMZN 4ASNA 2E19A 3ENOA 3TTCA 3EUHC 4CF0A 2Z1HA 2YV0X 4OWRB 1ZYRF 1QHHD 1IZ1A 1NKBA 3HOWJ 4XOTA 2VQEK 5F2RA 3C6HA 4C3HJ 4FLXA 4EM0B 5C12A 1UAXA 3D0PA 1H9GA 3HTSB 2XO7A 3NF8A 3RKQA 4MTEA 2IPQX 2HTJA 3ZSWA 1NHAA 3PUFA 4A0YA 4CH7A 1TZLA 2GOXB 4IVNA 3Q0WA 2D4WA 3NGYA 3SUQA 5AZIB 3VA3A 3LDQA 4U0VA 2YPRA 3LZIA 2A40A 1U45A 4FWSA 1Y56A 2RAEA 4F4KA 1FBQA 4CJ7A 4ITVA 3PFYA 3S17J 3FZHA 4OMZA 4FJNA 1ZC6A 3MEXA 3PSIA 3HOYJ 1SS6A 2Q3SA 3E66A 4Z4GA 1XDSA 3PO4A 1BIUA 2HYJA 1SFXA 5L3FA 3A2FA 5L3GA 4DTPA 4KHUA 1YIJI 4WF2A 4J8FA 5C42A 1KFDA 4KTQA 2VQLA 3VQ9A 2HHWA 3CCUI 2QW9A 1I94K 2WBNA 1JKOC 3UIQA 1Y1VJ 4B8CA 1U8RA 1AKHA 3ZX0A 1Q9YA 2ZJQL 1ILYA 1HR0K 3DKXA 3U9DA 5F1JA 3QWLA 2V52B 2NYXA 2OF7A 3CMEN 2OAZA 1OKJA 3MWTA 5KPZA 2E6MA 3HGYA 4UB8C 3LANA 2CGJA 5E17F 1ZG5A 3RPUD 2HDDA 5BPMA 3WTWC 4XLHA 2YNHA 1L3VA 3CCJN 1NJZA 3TAGA 3OV8A 2WBMA 3Q9SA 3O4QA 4WE1A 2HNZA 4CYCB 4DR1K 2NVQJ 3VF4A 2YHWA 4IOXA 1D1BA 2R3SA 3P5JA 1FJLA 1BISA 4OPAA 4Y17A 2X1DA 1KD1O 3SLCA 4D7NA 1GXPA 1ZH5A 3FM3A 2DMUA 2V6CA 3CLQA 1VQ5I 4CW7B 2O3FA 3HVRA 1C0GA 4IHVA 1W9HA 2KQRA 4FWOA 3CCSN 2E7XA 3C7NB 2CW0F 2WY8Q 4DUYK 5J6XA 4G1QA 3KLNA 1BI0A 5KGXA 3Q0VA 4KHWA 4L9TA 2A1SA 3ATVA 4GCVA 3RRGA 3MXIA 3V9XA 2ZSHB 4LLLA 2DDBA 1WSUA 1IV6A 5C4JJ 4B1YB 4DV1K 2WB1N 1VQ7I 1GVJA 4WXDA 4B3XA 3BTLA 1ODDA 4ZZLA 4HTLA 2RQQA 1EWQA 3DM2A 1KAXA 3IG1A 1Y1WJ 1ORKA 1B59A 5JLWA 2P5VA 2P9LB 4DTUA 1NGIA 3FXKA 1T44A 1ACIA 1RRJA 2QM3A 4O0JA 1RFQA 3OYEA 4GV3A 2STTA 3CP2A 4WCGA 4IX7A 3G4SN 1R5ID 2EV0A 1FYMA 4A57A 5LY3A 4XIUA 3JRGA 3NAUA 2CQXA 2V51B 4PUSA 1SC7A 2W84A 4H0EA 4Q5SF 3D7EO 3LSTA 2V26A 3I56N 2QA4N 3V6DA 3VQ8A 2HB5A 5JVTA 3DEEA 4LIVA 5DM7L 4OIOF 3NH0A 3PIOL 5FKLA 2HW3A 1U0JA 4E7LA 1HNZK 1UJ8A 1TWGJ 2IS4A 2CGKA 1SD5A 5DDGA 1WQ2A 4MEXF 1MNMC 2ITGA 2W85A 2P5GA 2K9NA 4XKBA 4BQLA 1GLAG 4DR7K 1TT0A 4CGHA 1FKOA 4RGRA 4G9ZA 4GY2B 5DK5A 4B3MK 3QFUA 1N75A 3QPSA 3CUQA 3Q7CA 1Q18A 1S5JA 4R79A 2VE8A 1MBKA 2EZIA 2BE2A 3RKYA 3QU6A 3I3LA 1JLFA 4OLBA 2UZKA 1BR2A 4GXOA 2YJEA 3FF5A 2CUEA 3AFHA 2COBA 4BJ6C 3ROUA 3T1YK 4G94A 3VYSB 3CI5A 4AHTA 1R4NB 3DEUA 1M1KO 2ZCWA 4C1NK 5JR3A 1WSGA 3SAFA 2EH3A 1FOXA 2O8EA 1C1BA 4A2AA 1VQPN 3GMEA 2XY6A 3M7GA 4RGUA 2STWA 1TKTA 2PMUA 2OZ6A 3SEQA 1JCEA 3LM2A 4H8KA 1X9MA 4CJRA 3T8RA 1NK0A 1U5TC 4S04A 4G6QA 3FZFA 2NNNA 1VSEA 1F4KA 2XY5A 4ZDLA 3GFIA 2I7NA 1NGHA 4ABZA 2QBYB 3HG9A 4IRHA 1WVRA 4MEYF 1OCPA 3E9LA 4RB3C 1UZCA 4BR0A 3K70D 2EJRA 5IP9J 2BY1A 2R5YB 1NTCA 4H5TA 4BRPA 3CPWM 1J53A 3QLHA 1BIZA 3GBGA 2HS5A 3LQRA 3L2VA 1TL1A 4J2EA 4Z4IA 5EU7A 1C0WA 1MJAA 1SFEA 2W6LA 4EP4A 2EV5A 3S9HA 2LY1A 2A3SA 4PL7A 4H4KC 1CGPA 3VB2A 4EVIA 5AIPA 1EKEA 4XRFA 2R5ZB 1E3HA 3AA3A 3PX0A 2JA7J 1R00A 2XVCA 2JQ7A 1JXSA 2D1KA 1APLC 1F9NA 3E6DA 5KQDA 3BF3A 1LEBA 5GPAA 1B6AA 3E5QA 3AVKA 3V9SA 2IVMA 4M3DA 3QESA 3TAPA 2EPFA 4DQQA 3LWMA 4OPJA 4B8XA 5J1RA 3OR1C 4HDUA 3SUNA 4IKFA 4E1NA 5CVVA 2LREA 3BG5A 5C10A 2X1CA 1EJ9A 4CGGA 3F21A 4FJMA 1R1UA 3I64A 3HGGA 3LPTA 2EFPA 3K1PA 4FJIA 2JGUA 1MWKA 4LG3A 4G8XA 3MN6A 1X1BA 3TTDA 1T2KA 3RCOA 2LD5A 1TP4A 3VETA 3P39A 4OO1J 4ZYDA 3FGUA 4B1WB 1FKPA 2P9KA 1KYZA 1WUAA 3SCXA 1YW7A 4G7HF 3OOPA 4WX9A 4FWKA 1QSLA 1SZ2A 3GBTA 3FK7A 2ME6A 1H8AC 4HQMA 3CUOA 2OPSA 1LJ9A 3WG7H 2P7CB 4IO8A 1W36C 5D5XB 4GDFA 1D8YA 2DYRH 3AVCA 4I0AA 1E4FT 4LD5A 2LR8A 2VB6A 2LF8A 5LGNA 1WBDA 1A5JA 1TTYA 4KT6A 3RKXA 1TBXA 2NVYJ 1YFHA 2Q0RA 2VC0A 3CCVI 4ANJA 2XRNA 1JUPA 4MNUA 3JR9A 4Y15A 3BLYA 1JJ6C 2PX9A 1UELB 2K27A 1IXSB 1BL3A 1JLEA 1VQ4I 3ZQ7A 4JQFA 3FKIJ 1P8ZA 1IJJA 3L00A 2JA6J 4XH4A 4DQ8A 4F7ZA 1RBUA 1DPUA 4KTWA 5HRPA 1X2MA 2ICWG 5AR0A 1LW2A 3KP7A 4B44A 3RR8A 3EEQA 3CF5L 2O8CB 3ZX2A 4X62K 2BHYA 4FOIA 4JS4A 4DQIA 2A1RA 3FHNA 1JUMA 3ABMH 3BR3A 3WGHA 3E3VA 1BC7C 2E2HJ 3RWUA 1VSFA 1ASWA 3IV5A 1VQNI 3S1RJ 5BN8A 1Z91A 4U87A 1A5XA 1A31A 4YY3K 3QFPA 4E7ZA 2PJRA 4WK8F 4A3FJ 1Y39A 1EH6A 1S6LA 2VJ5A 1VQLN 2K3FA 3ZETB 3L2WA 3QIPA 4CK2A 2UUCK 1JTYA 5B1BH 3QERA 2Y75A 1U04A 2VBWA 3KJVA 1GOAA 1R4MB 1OMIA 3D2FB 1O7LA 4JRPA 1QHAA 1UA1A 3PSFA 4XOPA 3KYLA 1LV5A 3DWLE 2ASPA 3LM9A 1D8KA 1IV0A 1EETA 4LH4A 3JRCA 3CC2I 1SD7A 3HPOA 3J7YP 4DZPA 2LKSA 1HNIA 5DM6L 1RIOH 1HC8A 3RR7A 3WG9A 4KMFA 5FPMA 1IN7A 1YJNI 4BC2A 5FD5A 1F36A 3H5RA 1NK2P 2ZMEA 2EWSA 3V1OA 1RBSA 4IO9F 1K8KB 2B9SA 3G73A 3IHUA 1G59A 4A3IJ 4JK7A 5F1XA 3CCEI 2L9NA 4IHSA 3QODA 4LY7A 1OR7A 1VK0A 1OISA 3GTJJ 2EZLA 1SEUA 2GBZA 1FYKA 3LWFA 2H6CA 3P83D 2KISA 1IH7A 1Q81O 4KREA 3AO4A 3B73A 4NB4A 1XN7A 4CJQA 1QZZA 4EJTA 4DTRA 4KFCA 2BVLA 3FK6A 1Q9XA 4R1HA 1BJZA 4Y3OA 4AIJA 3VEVA 5B8HA 3D2EA 3CCMI 3VWBA 4BQAA 3BCAA 5GADJ 1RESA 4M7XA 1IKYA 1S7OA 3RKWA 4CZFA 4RLFA 1J59A 3T8TA 4LC9B 1R58A 3MN9A 2ZJPL 3ID8A 4MQ3A 5FO5A 1BI3A 4L9NA 2KIQA 4M41A 4DSFA 1EWRA 3SK3A 2M2EA 3OYFA 2LSOA 2G7HA 3DLLL 4L18B 2HBLA 4WQ4C 2Z33A 1TQMA 2KHOA 3V8JA 1BU6O 3OYAA 2FC0A 2DQLA 3OSFA 1LAWA 3JS6A 3AARA 2AQFA 4DIQA 1F21A 4UUSA 3MEEA 2MLKA 3IL2A 4Z6YA 2K9MA 1XSVA 2XRIA 3HJFA 1S5LC 3MQ0A 3KWGA 2EFOA 1WSFA 4KJZA 2F5DA 3I0TA 2B7EA 1AKHB 4D5CA 3WU1B 4DSJA 1SVLA 1Z7UA 4FPAA 5F0FA 2P9NA 3ZMTA 3HSFA 3CHWA 2CQNA 4U0WA 1YT3A 2BXZA 1RUOA 1W7AA 3ZYYX 4BRHA 1ZBFA 3TDZC 1O4XA 3FX3A 3M8PA 4X64K 1UHMA 4EATA 1D1CA 3PNVA 2K5CA 3GXOA 3S93A 5JLXA 1RNLA 4O4GA 1KU7A 4IPAA 3FWEA 1X9SA 2VCPA 1AOYA 1DUXC 2YKNA 1KZHA 4CEAA 3FXRA 3GFLA 4BR2A 2WV1A 1ZARA 3DBLB 3O5BA 4BE0A 2GUIA 2JVGA 2YI1A 1S7EA 1BN5A 2DMTA 4XSXF 2E4LA 2CO5A 3ZQIA 3VQBA 4PGHA 1BA5A 1K78A 2HXOA 5CVRA 3ZN1A 3MDQA 1ZELA 1JUSA 1JLQA 3TEDA 1E4GT 4NYFA 1VI0A 1LPQA 4I9QA 1R22A 2G8IA 5M1OA 2QI2A 2NRVA 4JS5A 4RWTA 4YOXA 5AQTA 2NRAC 1NOYA 2W00A 4JYAK 2LP0A 2DFFA 5M3FJ 4JKCA 2W41A 4LIUA 5I9EB 3VDXA 4GFBA 5EEAA 1H89C 2MG4A 1YX3A 2B4JA 3GZ6A 4PJNA 4PFPA 1MIJA 1X9WA 4II2A 5GPCA 3C3WA 4F55A 3RYRA 4HTUA 2FOKA 4E6KG 4GNIA 1RR8C 2NRTA 2OA4A 3THYB 3CJNA 2CH5A 3RZOJ 2CMPA 3S3OA 3QBXA 2FF3B 3F6OA 4Y33A 3RZDJ 2VOOA 5F27A 1V4SA 4IFYA 5BR8K 4F93B 4FLZA 5EXWA 1CZAN 1RZ4A 3JAMO 4CJUA 5I42A 4PL8A 2WWYA 2XAUA 4LF7K 1QO0D 4X65K 2DFHA 3WTUC 3KE2A 1ATRA 1QA6A 2VONA 4RA2A 4C8MA 4CYDA 5B1AH 2Q2EA 2WY7Q 3CERA 5JS2A 3TGNA 4KICA 3RMCA 3PUBA 2DI3A 3GW2A 4Y4RA 2ZO4A 3GVAA 3C6UA 4B47A 3LL3A 2FE3A 4Q0BA 1RBRA 2M8GX 2OQRA 2MD5A 3H9GA 4OPKA 3BF1A 1OKRA 2EX3A 2X6SA 2EZKA 2E88A 3H3NO 2P4WA 1T8IA 3H45C 1T38A 3WTYC 1EQYA 4GKJK 1B4AA 3AVJA 1N8RO 4I2PA 3QAHA 1JJ2M 1DP3A 1QRYA 4CICA 2F7TA 5ICEA 3PM1A 1X1PA 3M1EA 4ISGA 4M45A 4CHPA 4C9YA 5IYCJ 4HW0A 4BRAA 1QZ6A 2O8EB 3R4KA 2E7WA 2JRMA 3KZIC 3FMRA 2XV4S 2HPMA 3KP3A 5CYQA 4Y0WA 2K40A 5HS7A 1WSHA 2Y2ZA 4PJJA 4Q47A 4NLBA 3PJRA 1EH7A 4Y13A 4PSXA 3K0SA 4H0VB 2A69F 3BG6A 1NG9A 5D5VB 1VQ9N 4P55A 2VWBA 3B6CA 1S8NA 2MBFA 2ZJQF 2DK8A 2OYQA 4I09A 2QEXI 3BROA 4ICLA 1HKTA 3QRFF 3IAYA 4LJZF 1C1CA 1X58A 4PY5A 1QQNA 3LZJA 2MSYA 4JKFA 2VLAA 5GAHP 1LWEA 4CJWA 2D1HA 4PFOA 2ZJ2A 3VMFB 2XDVA 2QWMA 5K1YA 1YIOA 5E3LA 2HYGD 1ZBUA 3ABLH 5AZJA 3NMUA 1DGWY 3OA9A 4DU3A 4DF8A 5HDNA 3CTAA 4NNJA 2FLOA 1JKHA 3W3CA 4BHCA 1ZHFA 3IRQA 1UAAA 1NNEA 4F8RA 3OYHA 1RILA 3PLAA 2E1OA 3SAHA 3BG3A 3Q0UA 4CSWA 3TL4X 5KPTA 1WOQA 3CQ8A 2OZMA 2XHKA 1XHXA 2PJPA 1P6RA 4B9MA 4UXNA 3Q5FA 3IH3A 1RT5A 2HU9A 3G1LA 4EP5A 5GAEP 1VQ6I 2ISYA 4LSNA 1BC8C 3HDDA 2CUZA 5IOYA 2OC6A 1VQ5N 1HUXA 5E8GA 2X1EA 2QUFA 3WTVC 3HOZJ 3BJOA 2OBPA 4Z4HA 3LA3A 4V19S 2FEZA 2MYSA 4NDLA 2ID6A 5BNGA 4Y7NJ 2X51A 4XNFA 1QVFM 4DV0K 2Z99A 5IT9O 5HL7L 3NVMA 2H1LA 4XRSG 1QQIA 2R7DA 4Z0UA 3HYIA 3EE8A 4CXFA 1IBKK 4D9JA 3UNGC 3CFOA 1Q7YO 4N56A 4CJSA 2O5RA 3BR1A 4AH9A 4DKWA 1VQ7N 3ZX3A 2G8WA 3T1AA 3VEPA 2P9KB 1NK6A 3U4LA 3RPUA 3ONQA 2UUAK 4DQ2A 1XDUA 1D3YA 3MZ8A 2YJFA 1DPRA 2MD0A 3EY1A 5KRSA 3AA5X 1O3QA 1PDNC 2IA2A 4A5NA 4HUFA 2A41A 3G10A 3HVTA 1HPZA 2XGCA 2I5JA 2CUFA 1MA9B 2X0LA 1KU3A 3GLLA 3VQ4A 1KFSA 3NDKA 3PIOF 3VTIA 1BOBA 3F0CA 2DXIA 3GTPJ 4YFUA 1DGKN 4FPBA 2V9PA 3HRSA 5ADXH 4DS4A 2CSOA 4ESFA 4YFNF 5HLIA 2IGMA 2QWOA 4L5EA 1S6QA 4H03B 2QK9A 3KEOA 1LW0A 4AIDA 3WU0A 2W7NA 5C25A 3L8BA 1JCGA 1XNRK 2GOMA 4PDKA 1OH7A 5JVHL 2DBBA 1T95A 4DV4K 2RNGA 3I4PA 1IG7A 3GEZA 3E6BA 1S1WA 3LSKA 3MXJA 5M1KA 3OS0A 1NK3P 3A5NC 4HCCA 2DOEA 3LP1A 3EYIA 1VQON 2RREA 2V7YA 3VENA 1FSEA 5FKOA 4EHUA 1M1EB 2A5XA 1Z05A 3MEGA 3M07A 3ZLJA 1MGTA 2BXYA 1P92A 2QSHX 4ZDOA 3GF2A 4DFJA 5H20A 2GX9A 4HG2A 2PJRB 2HOEA 3MWPA 2KZMA 3O9RA 5D6EA 2Z2SB 1KAYA 3C2GA 3CQXA 3ID6A 2RNJA 3SYZA 1WH5A 1VSJA 3WTZA 2PFUA 3IRRA 2V4JC 1RT7A 1MDMB 2GXGA 4X1EA 1L3TA 2IA0A 4CZLA 2M8EA 1N33K 2NRXA 3A8YA 4OU0A 3VGKA 4OKEA 4ELTA 3SV3A 2DA2A 2UYTA 4GKKK 3EN9A 1FJGK 3I9V2 3K1NA 4BQZA 4CK3A 4NXNK 3R0AA 3FR0A 3LDSA 3FDYA 4CDGA 4JK9A 4AM7A 3KZBA 1U8BA 2PQ8A 3U9GA 2HHHK 1SKWA 4EJVA 3O1BA 4JI7K 3LDNA 2IC3A 3BQZA 2QF7A 4BBSJ 1GVDA 2ZMEB 2EV6A 3UKUA 3BC8A 2QWRA 3KK1A 4MLOA 3F6VA 1S1XA 3F8NA 4XKVA 2KDZA 4O8UA 2AQEA 4IZ9A 1XX5A 2L54A 4IRIA 4Z94A 4XRSA 3L1PA 4CF2A 5ERIA 3AY9A 3WTSC 3ELKA 1SFOJ 1S9EA 4B8AB 1VHXA 4CIEA 3CYMA 3DRRA 1B72A 3ITHA 1K9MO 3C94A 3D2EB 2FBKA 3DLHA 4HSTA 2ZGYA 1QPIA 4WXCA 3CCYA 3DOKA 2X6XA 2A6AA 4Y1CA 4BR4A 2HKOA 1WJBA 1FC3A 5GAEJ 2DMNA 1GLFO 3HSTB 3F9KA 2LNBA 3KX2A 1ZGWA 4YRVA 2A42A 3HUGB 3J81Z 3WXIA 5AQZA 3ERED 1QVTA 2OTJI 3MCPA 5HRNA 1NGCA 1RT6A 3HOSA 4FK2A 1BCMA 4JKHA 4KI6A 1TVRA 3DWLA 3DBHB 3VA0A 3JRBA 1DGRM 2CQKA 1WH7A 4UUSB 1OH5A 4P9FA 3MKWB 3AVNA 1RBVA 2KZGA 3TQNA 2YHAA 3HP6A 1S72N 3EPZA 1J9AA 5LL6Z 2JSCA 4XORA 5JVGL 2AJQA 1I1SA 4J19A 5GTIC 2KJBA 1TKXA 3KD1E 3K58A 1UB9A 4WCEL 1CF7A 1R7JA 4CI6A 2EHGA 3QP5A 3BPXA 1T8EA 1J9IA 4DQRA 4LF6K 5KQ8A 2X4HA 5IYDJ 5J47A 3MWMA 1GLCG 3V1RA 4IHWA 3HIFA 3O3FA 1TT5B 2GA1A 3M3YJ 4AHCA 2XY8A 3N4MA 2FMLA 1IRGA 5E41A 2AS5F 3SJJA 4JI1K 2DPNA 3HSRA 4LFBK 1RUNA 1XCVA 2WV0A 2H09A 3G3ZA 2G8VA 4NYNA 2VWKA 2O9LA 4H4MA 4NQWA 5ED4A 1TL8A 5EZGA 4EZ6A 4H5NA 3NEUA 1RT1A 5B66C 1P7IA 3V4IA 2H3GX 3H3UA 1WSEA 5AQGA 3CF5F 5C4XJ 4CCOA 3J8AA 4YIRX 3RIRA 3CO6C 4FJKA 2LFBA 4DB3A 3DLGA 2J4RA 1K78B 5BPNA 2YUSA 2XGDA 3LFKA 3K2ZA 2OCCH 3E97A 5FPDA 3FXQA 1ZBLA 3TO6A 3FXOA 1LEAA 3C1DA 4MLEA 4BY7J 2VKDA 4M3ZA 3F22A 2CS3A 2BY3A 1K79A 3LAMA 1HKBA 1XQSC 1MNEA 2Z3YA 2OTLI 5FRNA 2E1ZA 3NWSA 4CYCA 2NS0A 3AVMA 5E26A 1NBWA 2F9WA 4RDUA 3TWHA 2DT6A 4YG2F 5EJCA 4LSLA 2CW8A 2YHYA 1HA8A 2I8DA 3O2PE 2CWEA 1TNTA 3H92A 4B9LA 3QQAA 4WQ5C 1FPQA 3GX4X 3K0LA 1T3VA 4V2GA 1OJLA 3HT3A 3AVBA 1ZBHA 4FISA 3V9WA 2IJLA 2X78A 1N32K 5J4VA 4HLYA 3C7NA 4MFEA 4LFAK 1Z9CA 1C6VA 1E3MA 3K4LA 5DM6F 1SAXA 2Q1NA 4I98B 3KLFA 2V9VA 2P5KA 1GOBA 3VEOA 5H6QA 1XMQK 3ZCOA 1W7PB 4OAZA 1MWMA 4OX9K 3ULEA 2XHBA 3JREA 2KFZA 4PKIA 1HX1A 4BRFA 2AXLA 3SBTA 1YJWN 4YOTA 4JD2A 4LH5A 1JCFA 3ZSZA 2E71A 2E34A 1TKDA 3KPHA 3IKVA 3TOBA 4I6ZA 3CC2N 4DOZA 3B8AX 3T0YA 2JPCA 4KTZA 2HVHA 3R9PA 3HM8A 4XRMA 1SFUA 3BZKA 2Q2EB 3LSHA 2IS6A 1B9DA 1TAQA 1YJNN 3E01A 3F8CA 2A05A 3HBLA 4O3MA 2L9RA 2P9LA 1FIPA 2RC4A 4FHTA 5FLXO 5CVJA 2HMIA 2RPIA 1OLTA 3DF8A 4BDYA 3QEWA 3LP0A 1H1VA 2W6KA 4ZHRA 3S32A 1QVUA 4HEA2 1MD0A 2F5CA 3I53A 5K5RA 2JPBA 4KI4A 4KN4X 3H0DA 4KBOA 2YHXA 1HW2A 1Q82O 2DA1A 2FQ4A 1XCBA 3E9PA 4H5RA 4BRDA 5LD2C 4KV8A 4FT8A 3NGZA 2FBHA 2DA3A 2IP2A 3KP2A 1SV5A 4NC6A 1P4XA 4BACA 3R61A 2ZJPF 2XSJC 4FK0A 3DXMA 3JRAA 3SXYA 1VFCA 3K4CA 5EYRA 2MGQA 4W5OA 1L3UA 4HLXA 4I0BA 4HHTA 2QWWA 1W1WE 1TYQA 4KH4A 3G0ZA 1X1DA 3CJRB 1Z3XA 3QDKA 3DLLF 1P4WA 3CC4N 4CFAA 1X1AA 1FOWA 3SDBA 5L3DA 2QQBA 5GIPA 3LP2A 1LOTB 2YCHA 1KU2A 1J6ZA 1UHWA 1NGBA 4M3FA 2D0AA 4BXXJ 2BZTA 2EFNA 2OU2A 5FKNA 2R7WA 3SQ1A 2VE9A 5J1UA 3O3GA 1RCHA 1BJAA 4I76A 2X48A 1TLHB 1P9QC 4KAZA 2X9DA 3M8QA 2OPQA 1J09A 3C2BA 3K59A 3GZNB 4CGIA 1WSJA 2QKMB 2EWNA 3F9MA 1R23A 3OVNA 3DQVC 5JHUA 5DV5A 3SQ0A 3CMAN 4XLPF 2XAFA 4PZJA 3S2DJ 5EVZA 2CW7A 5CLSA 3KLEA 1VSKA 4JKEA 1Z77A 5SWMA 4B1XB 1OCCH 2Y1JA 1I3QJ 3K10A 1S1UA 5J2MA 4YDUA 3HRUA 2L7MP 4A3JJ 2OA8A 1A5VA 3FFKB 5FROA 2E8AA 2AHQA 4B9QA 4DTOA 1D9FA 3ENHA 4P1WA 3CXCM 3DP7A 5KPRA 3AVFA 4OKJA 2F4OB 2JN6A 5DCFA 2CJJA 3PO3J 1ON1A 3HXLA 3E6MA 4DR4K 3NVKA 2EIKH 3RRHA 3LQQA 4KHSA 2VIXA 2IW5A 4JI0K 2E2QA 4M3GA 5J2QA 1I5ZA 2JLEA 2QBYA 2PAVA 2ADUA 4MQVA 5CHIA 5FKMA 2F8TA 5BPIA 2L7FP 1U9NA 3TARA 1SANA 5IP7J 2GWKA 1VQMI 1XWLA 1MH4A 2KFDA 3O8GA 2E1MB 2JA8J 1WAFA 2DA4A 2DMQA 3CG7A 1HQEA 2X6NA 2Q97A 4M74A 4KUMA 1KC8O 3L4QA 4FJ7A 3ASOH 1QZEA 2F4MB 4XLFA 2R7ZJ 4MTDA 3AV9A 3OS1A 3DU6A 3S2HJ 4XN0A 5BPDA 5F6FA 1W0UA 3CDLA 5E84A 2HGCA 1WJAA 4EM2A 1T0FA 3NE6A 2GEMA 3ZSVA 3JSPA 3OHRA 1Y8QB 4G6DA 1QNTA 3HRMA 3CESA 5FJ8J 2Y48A 3EUAA 3K5MA 5KCMA 4BVOA 2Q36A 4KMUX 3F8FA 1RTIA 3DU5A 4DTNA 3LSGA 3P9KA 2ZM6K 1NGDA 4JKDA 2G8HA 4GO1A 1WWXA 5FFZA 3CCRI 4B9UA 1Z67A 1C0MA 3QB0A 1P7JA 4E7JA 3L0QA 3F3XA 1NK4A 3PFIA 4MIMA 3HM5A 1FWZA 5LJVA 2CU7A 3NWTA 1YITI 1XI1A 2ELJA 3MZYA 5FKKA 2R93J 1KONA 3QEVA 3L2CA 3TI0A 2VN2A 4FWMA 1O3TA 4R8HA 1OCTC 1FOKA 2E1NA 5AQMA 1GLLO 3ZXSA 2B6AA 1OFCX 4LB6B 4B1VA 2NNYA 2KQ2A 5JMVA 4A3MJ 3HB9A 2E6LA 4CEBA 2Z1IA 1IGNA 3ZQLA 3VPZA 2XAJA 2A5WA 1YRNA 1WJEA 3WE2A 2F2EA 3MCZA 4BR5A 3U3GA 4PKHA 1R6RA 1VQ8N 3KEYA 2IAJA 1SFKA 1G6NA 3PQKA 3GWZA 3VQ5A 1MH3A 1TWFJ 4MGRA 3CUQC 2LC2A 1W7PD 3ABTA 3KP6A 2Y0SN 1HW1A 3AVAA 3EQLF 1Z0XA 2F5FA 1MJ9A 4ZDPA 3N05A 3EYZA 4HNVA 2VT3A 2QKLB 2I5UA 4MFBA 4CJFA 3JCUC 3L09A 4RW9A 3CD6N 3IUCA 2B63J 2IBDA 1BIBA 4PJLA 2EA4A 2GM4A 3CDHA 3DYAA 5AONA 3QO9A 1IO2A 4FZYA 2LK2A 1KXPA 1IAWA 3CCLN 1JXBA 5SZTA 1WKMA 3MKZA 1QBJA 3HXMA 2UXBK 2B5JA 1IG9A 3DJCA 5LHHA 1B92A 2F48A 4UY8I 1BL0A 1MZBA 2H94A 1JT6A 3VFZA 5EX5A 3MEDA 1ETQA 4NCAA 1R36A 2XPVA 2ESNA 2BOLA 2FBVA 4FK4A 5A2QZ 1ZKGA 3OWTA 5DYMA 2DJNA 4A69C 1VSHA 3RI4A 1K4TA 2WAQN 3UKUB 2VL8A 2VASA 4HV5A 1B8IA 1KVAA 1LKXA 3W6JB 3I58A 5JS1A 4HF2A 3DFGA 1ZRDA 3H3OB 3CJTB 3MMVA 1HW5A 3CDIA 3HPGA 4DU4A 3V9UA 4KB1A 4BGBA 1I6HJ 3VQAA 4FJ8A 4DNCA 3HOUJ 2GAUA 3TO7A 2LF7A 4PSWA 4Z4CA 2XF7A 3MMYB 3CMEI 1FBUA 2RVCA 1IJWC 3DBRB 2HKXA 2B0LA 4IOCL 5B5EC 3QP6A 1FSHA 1I27A 1MBGA 4FW2A 2FRHA 3L7WA 2WB1A 1QGPA 3CCJI 3E1YA 2R7FA 4PQUA 5J40A 1T03A 4RW4A 3GTKJ 4JX6A 4HAMA 5CE3A 2WADA 2ASMA 1DDNA 4A3BJ 1NJXA 1K8KA 3JRIA 2NVUB 4I9LA 1IKWA 3ZSOA 3K2PA 4DWIA 2K86A 1YI2I 3ZT0A 4HX4A 1ATSA 3IMXA 3HZJA 1SVMA 3QEPA 4FOEA 3RVCA 4BKXA 5AQXA 3H08A 3CCSI 2FSNA 1IBMK 3ZT2A 4XK4A 2W1OA 3QNOA 4Q4ZF 1UHSA 2EIMH 5EG0A 1NKEA 3VEWA 4DYRA 4HX8A 4ZC3A 4CEQA 5IT3A 1VZ0A 1RT3A 2L5QA 4LFCK 3MAQA 1CF7B 1OVQA 2R7UA 1RDCA 4E89A 1PUFA 5ICCA 4LD0A 5CJ9A 2X6YA 4BAYA 2L0KA 3E5UA 1RTDA 2QKBA 5J2NA 1LCUA 4OLAA 5HODA 5T7BA 2PBDA 1JKRC 1FK9A 4BHPA 2RKIA 4CHNA 5KVRA 3PNTA 4CECA 1MMAA 4IF4A 2YX6A 3CMMA 4C1NI 2ZE2A 3KYCB 5L3CA 3EDPA 1KAZA 4NQWB 4N5SA 4DBRA 1QZYA 4M3XA 2DA5A 4RAZA 3TW7A 1LWFA 4CF8A 2IEKA 2MLGA 3DTKA 4CHUA 5GAGJ 5IPAA 3GE1A 5L3BA 1HOMA 5E3OA 2BUPA 1WFXA 1QQMA 1DQUA 3BR6A 2ATQA 2VBYA 3AG1H 2QA4I 3FZVA 5F04A 4N4OB 2P8TA 3ULQB 2EFWA 3F2KA 2KHMA 2IRFG 2P6SA 4BQOA 5HVQC 4L0ZB 3CJAA 4C23A 2HNDA 5HLFA 1BA1A 5HRSA 5ADXA 1USTA 2KT0A 1MMGA 2Q31A 5AFUH 5LEKA 5D5UB 4PJMA 1U2WA 4XKCA 4FM1A 4IDHA 2BTFA 2OANA 2WA0A 4G7OF 1C1AA 1X3ZB 4HF0A 1YUWA 4B9VA 1Y0NA 2X74A 3ZQGA 4KIGA 3TBIA 1EP4A 1TQPA 4CJ4A 3SBGA 3WTTC 3D1NI 3JTGA 2AO9A 3NBPA 2VJIA 3BY6A 3UKGA 2KZVA 2QWPA 2YS9A 3M5RA 3MN2A 2Z16A 3K4KA 3F5TA 4HWIA 3S3MA 1U6ZA 1E2XA 3ULEB 3VQQA 2M4KA 5JLHA 5K7FA 3HRGA 2L3DA 1EF4A 3F8BA 1EXQA 5DEQA 4JD2B 4W5QA 1KA8A 4WYBA 1VQPI 1XSDA 3HO1A 2X85A 1U4BA 4IQJA 1G3TA 4DFKA 2G8KA 1JLCA 1N78A 4KB0A 5EOYA 2D0OA 1UWBA 1YOVB 3O6BB 5BMZA 3FXLA 4HSRA 4F91B 2ZMEC 3M3ZA 4LOCA 1BDGA 2GIZA 3R6SA 4IG0A 2DK5A 1C0UA 1SL2A 2PBIA 5K7HA 1XGSA 2KRCA 3MCAB 3CJCA 4B09A 4O44A 3THYA 1MMNA 4P96A 1OR7C 3CQYA 5M1QA 1OH6A 1JHHA 3VEXA 2MC4A 4UY8O 4HX7A 1NJIO 3CM5A 4FLYA 2ME0A 1BUPA 4B43A 5BRHA 1KTQA 1G3WA 4UVCA 4HNTA 3OSGA 1OCOH 3AVLA 3G6EI 4LITA 1B9NA 2E5NA 3DXMB 5KHDA 3I55N 1NG7A 4JRQA 1HNWK 1NK7A 1IN4A 2F9TA 3BWGA 4IL6C 1TYQB 3V9ZA 1CQTA 4LLNA 3CCQN 1D5AA 3KFWX 4EGYA 2DOAA 3TKYA 4KIBA 1W5TA 3THXA 1W5SA 2DPDA 3OY9A 2F4VK 4IFVA 1TV6A 1E3OC 3TU5A 4UUVA 3EKSA 1FW6A 3C7JA 5TRDA 4GGGA 1J75A 5K5OA 3CM6A 2R7OA 2QQAA 4C2TA 1X3MA 2P1JA 3ZCMA 2HVRA 2HVQA 5K14A 5BOXA 2HBKA 2NRHA 2L4AA 5JVGF 4CZIA 1EA3A 2ECCA 2OJED 3TMOA 4HYEA 1IUYA 3DRPA 2HHTA 2O8BA 2LMDA 1HLUA 2QZ8A 3NF7A 1OQYA 3M1FA 1D9DA 2KP6A 4JV5K 3IKMA 2VOPA 1K6YA 2K9QA 4ZZDA 1QSYA 3ESWB 1A5WA 4YFXF 3ZSYA 1Y64A 3K5NA 1IW7F 4CGFA 1XGOA 4MFDA 3BEXA 4W97A 3MAJA 3H1VX 1STZA 1J5OA 4IEJA 1R9TJ 4CHZA 3DLBA 4FTHA 5IWAK 4A5BA 4FO0A 3L3UA 3W0LA 3MK6A 2GA2A 1BHLA 4DTMA 4O6JA 2E5ZA 5J8FA 5AQPA 1G3SA 4S05A 5HLHA 1SD6A 1ATNA 4EV0A 3FXUA 4QLCU 3P7NA 1NK8A 2PEXA 3ZMZA 3PO5A 1RDUA 3B02A 1VSDA 2KPMA 1J54A 2JA5J 1NK9A 4M9SA 2HSTA 2A07F 3S3NA 4K42A 4J2DA 4D5FA 4HNUA 4GYIA 1QU3A 1KRPA 2CQQA 5D5WB 3BT9A 3VESA 4J2AA 2ZXJA 4L5JA 4BREA 1XHZA 3OL3A 3KCCA 3VYRB 3IH2A 4XEIA 2VGMA 4CESA 2PMHA 1VQKN 1K61A 4FLTA 2XROA 2JUCA 4XM3A 4BNCA 1KLNA 4A0XA 3RSEB 4FJHA 4C3IJ 3NAEA 3R6MA 2GIVA 4JEPA 3TANA 4XLNF 4BC3A 2O8XA 2L9SA 2IT0A 3SUPA 2P9PA 1BGXT 3BJ6A 1HDDC 3MVPA 2IS2A 2PLYA 1POGA 1RI7A 1I1GA 3HHHA 1VQLI 3CPEA 2H6BA 4MQ9F 1A6QA 4BRGA 5J1EA 4DV7K 3VGMA 4JKAA 2DA7A 5E1WA 4LK0F 4O8KA 1N77A 3ENBA 1GLNA 4FZXC 2WFBA 2O4GA 4DTSA 2VJJA 2KKOA 1TWCJ 3AG4H 3V7RA 2ZGZA 1T05A 4CO8A 1NM1A 2O6GE 4CHYA 2VQGA 4FL9A 4QS9A 4FX0A 5AQJA 3SHFA 3SNNA 4F2RA 2HQRA 1ITYA 4DU1A 3OYKA 3SZTA 4CJ5A 1FT9A 2YSRA 3ZSRA 2W82A 2LDUA 3ZQCA 3KEQA 1GT0C 2M7BA 3WHBA 3P9CA 2DN0A 2K02A 2VUMJ 1BI1A 4U88A 3OYBA 1ONVA 1FZPB 1KCFA 3ZT3A 4HUEA 4ON0A 1YRNB 3PIPL 2G7UA 5C24A 2XKPA 4A62A 4H0TB 2VBZA 3QPLA 3FFIA 2XRLA 3OYLA 2IGIA 3AG2H 4M72A 5C2FA 3D5RC 4GYGA 4LF9K 1FY7A 1ZQ3P 4HUGA 3IS9A 2R7QA 4ENJA 1NMDA 4B1RA 4HF1A 1JT0A 2PY5A 1ZLKA 2CH0A 4I6MB 4XONA 3DEWA 3AO5A 2WAFA 2RE2A 1D0XA 4CCHA 2DDAA 3AAQA 3VERA 3NRVA 3K4JA 2WAEA 3KK3A 1LUJB 1U6GA 3HKZN 1HQUA 2YNIA 4CIGA 1MKMA 3KYDB 3I8DA 2IIRA 4EHTA 3K9TA 1NWKA 4U0YA 4YIIA 1HNXK 2LY2A 4Y52J 1BA0A 1WAJA 4DQSA 1TQIA 1TK5A 1WI3A 1LNWA 1X2NA 1KSPA 1HLVA 3U1DA 3TAFA 3TAEA 4EJOA 4FJJA 2KZZA 4GV9A 2O03A 3GL1A 4BXFA 1B8IB 4ZYEA 2IGKA 3H35A 1XD7A 2DTUA 2H8WA 4PKGA 3BDDA 5D6FA 4YOVA 4OINF 4L9VA 3DLKA 3A0HC 4QIWN 1HSJA 1QVGM 2L7ZA 2ZBKA 1MDMA 5FGMA 4YHHK 4J00A 4DR5K 3AA2A 2Z1GA 4CVNE 3Q3SA 3COAC 1S3JA 3HC7A 2FU4A 1VRTA 3HJEA 3GTOJ 4E1MA 4CZZA 4DSEA 2V1DA 5LFAA 4P9UA 1A35A 3HM9A 4CIFA 3VQDA 3MX2A 4H0XB 1OYIA 2ZD1A 4QTRA 5CYVA 3SYTA 4DUZK 1OYWA 2NVTJ 4NHJA 1IDZA 3KWIA 3IRXA 1BQMA 2HMPA 4U7BA 5DCMB 5H2FC 3KK7A 3P1GA 3KP5A 4BRQA 2OD5A 2FOWA 2HNHA 4AVZA 2E1MC 3W2VA 4ELUA 1YXQA 5BRDA 2K85A 2KJCA 4J2BA 4FJXA 3U2RA 2HEOA 1BCOA 2G0EA 4BYYA 2QWQA 3AA4A 2KIUA 3WT0A 1O57A 4ZTJA 1B9FA 5EG0B 1HYSA 2M30A 2G8FA 4B1UB 2Y31A 1MBFA 3H5NA 4IQ4A 1LDKB 4B3SK 1YTAA 3OOUA 2DFEA 3NARA 2OCEA 1JHFA 4UNOA 5A2QK 4LFUA 4KHYA 2ESHA 3WNGA 2EZHA 3KLHA 1QSSA 2FMYA 4EEFG 1PUFB 3H9QA 4O5BA 1W36D 4RGSA 4F3OA 3HUGA 2A68F 2IVPA 1RR7A 3ZMUA 1JI8A 4Y1DA 3THWB 4KHNA 1D5VA 4AF1A 4DBQA 3RQ4A 2A6EF 1KQ8A 1YW9A 3OL4A 2VODA 3ZPLA 1U48A 1YYVA 3J7AO 3ZEUA 2QWLA 1D0ZA 1RGIA 4BRLA 4CZKA 3CC7I 3VYTB 3SFIA 2KKZA 1YITN 1Z26A 5E3MA 1PUEE 3ZSXA 4A59A 1VSMA 2FF4A 1LAVA 4N47A 4Z2YA 2P7VB 2YKMA 1BIAA 3OTOK 5E1XA 4IXAA 3G71N 2LRDA 4CCLA 3GLXA 5DUIA 1T39A 1B1BA 4GVEA 3P31A 2VPRA 3LOCA 1HYVA 4CJTA 2Z1JA 1T6CA 4CHOA 1GV5A 4DS5A 4JK8A 4A2UA 3CIPA 2K9SA 4E7SA 4EJUA 4MHGA 4WFNL 2M87A 4EIAA 5AQLA 4BGAA 1RT2A 1HKSA 4BWJA 2Q2RA 4YFKF 1UOCA 4B3AA 4RMNA 1ETOA 4BVPA 2VG5A 4FWQA 2FSKA 3QBWA 3F72A 2K9LA 2G9WA 2WTEA 2EA2A 1A36A 3TSPA 2HDCA 4S0HB 3ULDA
chains in the Genus database with same CATH topology
2P51A 2WOMA 4B3OA 1LAWA 4NCAA 2HHUA 2HNZA 3IS9A 3T19A 3L2RA 1TGOA 1ZBUA 2IDOA 2FBVA 3PX4A 1F21A 3LP2A 1NKCA 3ITHA 3LALA 4FK4A 2PY5A 4HVJA 4DU3A 3MEEA 4DF8A 1QQCA 1QHTA 4M3RA 1N6QA 3P5JA 3CM5A 1BISA 5DMRA 4FLYA 1VSHA 3AO5A 3C94A 4OGCA 2WONA 2D0AA 1JL1A 3KK2A 3TAQA 3DLHA 1JKHA 2XRIA 3HJFA 4CCHA 3AVKA 3SQ1A 3V9SA 4KPYA 3O3GA 1KTQA 1RCHA 1WSFA