1I3AA

Rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i3aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i3aA01
4DTPA 2HNZA 3RR7A 4NCBA 4DQPA 1B9DA 3O3FA 1O1WA 3SUPA 4B9LA 4HCBA 4FW1A 1S1VA 1BI4B 2I5JA 2YHAA 4OKEA 4CJSA 4HVJA 1B9FA 1QTMA 4M3UA 4FJ5A 3VQ8A 5C25A 1RNHA 1WSJA 3DLGA 3ZSOA 1GOCA 3ZSXA 3NGZA 3D0PA 1HJRA 1WSEA 3AVCA 4CEZA 3OYFA 4BDYA 4ELUA 2HNDA 2F8TA 5C42A 2IC3A 3T19A 4CEDA 3NGIA 4DTXA 2EHGA 3KK3A 1XWLA 1TL3A 3LZIA 3AO5A 2QKBA 4FJJA 1HPZA 4C8OA 5KRSA 4WE1A 3LP2A 2VWJA 3QIOA 3QETA 1T7PA 1NOZA 4DWIA 1TK0A 1RT2A 4OVLA 2R7YA 4DU1A 3RMDA 3LWMA 5FROA 4DQSA 4BACA 4CGFA 3KD5E 4DTRA 3K5OA 1WAFA 2BGGA 3WNEA 4OKJA 4CECA 3CM5A 4E1MA 2YNFA 4B08A 3K58A 5HLFA 3ZCMA 1BQMA 4N56A 3LDSA 1J5OA 3PY8A 4M3XA 1JXBA 3NCIA 1RTJA 4M41A 4DQQA 2JLEA 3NFAA 4KAZA 3OYNA 3FFIA 1J9AA 4OPKA 4AILC 1HNIA 1WSHA 4O0IA 3KLGA 1ASVA 4W5NA 4ZHRA 3HM9A 1MU2A 3QIPA 3OYEA 3OYGA 1VRUA 3SQ4A 4CGHA 1YVUA 1S6QA 1HNVA 2X78A 4CFCA 4YFUA 3T3FA 4CFBA 2KZMA 1BI4A 1IKXA 1DLOA 2D5RA 3DRRA 2IDOA 4CIEA 3CFRA 1RT1A 4FZXC 2HHWA 1Z25A 3RR8A 2PYLA 4MFBA 1RDCA 4FJIA 2P5GA 4FK0A 2ZD1A 4W5OA 4DLGA 4DFKA 1ZYQA 1WNSA 3TAEA 3NF9A 2YKNA 3RTVA 1U49A 3CYMA 4KRFA 2W42A 2HHTA 1BL3A 1KVCA 4NCGA 4CJEA 1FKOA 1XHZA 2FBVA 5CYQA 3THVA 2KFZA 3DRSA 4CESA 4W5TA 3PX6A 3VQQA 4CJVA 4OPJA 4BE2A 5FDLA 3RRGA 3HO1A 4PQUA 1CZ9A 3DI6A 4EP4A 4BDPA 4F2RA 4CJRA 1S9EA 1QE1A 2KW4A 4JRQA 3S3OA 4KHSA 4RW9A 1T8EA 3RRHA 2IAJA 1UA1A 1U4BA 1EKEA 1S1TA 3HVRA 2Y1JA 4E7JA 3QERA 1SL0A 3DLKA 3LP0A 1D9FA 3PX4A 4ELVA 3IRXA 3AVJA 1TK8A 4KB0A 3P83D 3OYHA 2OA8A 4RW6A 3F73A 3LZJA 2XO7A 4B9UA 4N76A 5JS1A 3SCXA 3TAMA 1RDBA 3DYAA 2XRIA 1KRPA 1N5YA 3SQ0A 3VA3A 3L2VA 4Q0BA 5HROA 2Z1JA 4CCHA 4Z4CA 1U48A 1JKHA 2X6NA 4H4MA 1U04A 3QO9A 4CHZA 3VQ4A 2GBZA 1KTQA 2FC0A 3ITHA 1HYZA 4CHNA 4FJ8A 1EX4A 2F96A 2YV0X 4BE1A 4H4OA 4FJKA 4CJTA 4OJRA 4DSEA 2DFFA 3ZT2A 1SKWA 1WSGA 4FVMA 5J1EA 3CFOA 1LW2A 3MXMA 3C95A 2OZMA 3PV8A 1UOCA 4LH4A 3PO4A 3AVNA 1QSYA 4FM2A 2ITGA 3SZ2A 4CK2A 3V4IA 4M42A 3OYDA 2KQ2A 2OPPA 2QK9A 2XY8A 4CEBA 1IKWA 1FKPA 3IAYA 4CJKA 3U6FA 4B9TA 4CK1A 5HRNA 3QEIA 1SKRA 2LSNA 1IH7A 1LW0A 1VRTA 4FLTA 3U3GA 2G8HA 5KRTA 2HHQA 3VQ9A 1FXXA 1LWEA 2D0BA 3AA5X 3AVFA 1GOAA 4CF9A 3EY1A 4DTOA 4DQIA 1RBSA 4I9LA 3O4NA 4EZ6A 2G8IA 3L2WA 3AO1A 3L2QA 3EYZA 4DF4A 3AA3A 4O55A 3CFPA 1VSLA 1KVAA 3IG1A 3ZSVA 4HTUA 2HHSA 1T05A 3S9HA 4F4KA 2AJQA 3S3MA 2BE2A 4TSXA 4UQGA 1TKTA 4RW8A 4AHSA 3O3GA 3EZ5A 4EZ9A 1BIUA 4N5SA 4W5QA 3SPYA 3L3VA 1BQNA 2WONA 2WOMA 3HP9A 1CLQA 4HUGA 4Z4FA 3VQ7A 4C8NA 4E7IA 4IG3A 3KTQA 4FZYA 4KHQA 2IOCA 2ZQBA 3TI0A 3NBPA 4NYNA 3JSMA 4FLWA 3RMCA 5HP1A 1WN7A 4Z0UA 1FK9A 1HYVA 1NK4A 3HL8A 4CHPA 4CGJA 1RT7A 3VQDA 5J2QA 1YTUA 3AVKA 4CJWA 3ZT1A 2YNGA 3VQPA 5SWMA 1RDDA 3M8SA 4DSFA 1UWBA 4KHNA 1HYSA 5SZTA 3VQEA 5CZ1A 1ZBFA 1WSFA 1JLAA 1S1WA 3VQBA 1ZBUA 3U3YA 3TARA 1QS4A 4I2PA 3JYTA 4NCAA 2DY4A 1EXQA 4CEQA 3I8DA 5I3UA 1RTIA 3LPTA 2XHBA 1NK0A 2P5OA 2BDPA 3SV3A 1A5VA 4DLEA 4KTZA 1Y97A 1S1UA 4BWMA 4KO0A 4CERA 4J2BA 4FJ7A 1Q9XA 3IS9A 2P51A 3DRPA 1JLGA 4M3YA 3AVGA 1C0MA 1C1AA 1DTTA 4LSLA 3OYLA 4EP5A 4CJ3A 3RMBA 4FJXA 3NH0A 3L2RA 1G15A 3MEEA 1ZBIA 4GW6A 3CQ8A 3NGYA 2G8WA 3AA2A 1C1CA 3KKRA 2A1RA 3L3UA 5KI6A 1VSFA 1VSKA 3K59A 3NH1A 2D0CA 3S3NA 3OYIA 4JS4A 1UAXA 5JS2A 2YKMA 1JLCA 4CEEA 1IG9A 4FXDA 3QEPA 4CIFA 1JL1A 3SJJA 5KGXA 3TAFA 3PX0A 5KTQA 4FM0A 1X9SA 4CE9A 3B6OA 4KKOA 1KFDA 3QESA 1NK8A 2KZZA 4QCLA 1VK0A 4KB1A 1D5AA 1QQCA 1ZBHA 1I39A 1A5XA 3AVHA 4E3SA 1BCOA 1NOYA 1RT5A 4J2AA 1CZBA 3M8PA 3MAQA 2OZSA 1HRHA 1ZBLA 1NKBA 2Z1HA 1NK9A 2X6SA 3NHGA 3HSTB 4KREA 1TKXA 1VSEA 2IS3A 5CZ2A 4DTJA 4GVMA 4O5BA 3K57A 1KFSA 4CGIA 3SV4A 3I0SA 4IKFA 2XY7A 1N6QA 1NKCA 5HRSA 1KLMA 3SUNA 3LANA 4CEFA 1HQUA 4CF1A 4C8KA 1T03A 3DMJA 4RW4A 1L3VA 4KHUA 1BCMA 4BWJA 3TR8A 3LP1A 1R0AA 4CJQA 2OPQA 1JLBA 1K6YA 1RTHA 3AVMA 4CHOA 1U45A 1VSDA 1I3AA 4YNQA 2Z1GA 4KI6A 3DLRA 4CF2A 1U47A 3LAMA 3AVLA 3KKSA 3V6DA 3OS0A 3I0RA 1NJZA 5HRRA 4OGCA 5DK5A 3TABA 3OS1A 4CEOA 4CHQA 2Z1IA 1VSHA 2HHXA 3VN5A 3MXJA 1D9DA 3DOKA 3C94A 2FBTA 3HT3A 4DTSA 4IG0A 3C6UA 1F21A 4E1NA 1X9WA 4B3OA 2HHUA 2G8VA 2RF2A 4CJUA 3OJSA 4DG1A 3NF6A 3NAEA 3SPZA 5FRMA 1J54A 4KPYA 4Y1CA 4LSNA 4FJMA 3OY9A 4JRPA 4LH5A 1QSLA 4KHYA 1WLJA 3ZT4A 1RT4A 2KFNA 3WNFA 4FLXA 1QSSA 3QNNA 3MEGA 4FJHA 4FJNA 4R5PA 1TKDA 4M3TA 4DFJA 1Z26A 4H8KA 3KK2A 3TAPA 4KHWA 4LY7A 1JL2A 4CJFA 4DFMA 3ASMA 5KGWA 5EU7A 1XC9A 4DS4A 1DTQA 2ATQA 3OYAA 3CG7A 4CK3A 3OYJA 1RCHA 5C24A 2PZSA 1TGOA 3V1QA 4ZTJA 3RWUA 3G0ZA 4F8RA 2HMIA 3V9UA 3ZSWA 5J2NA 4E19A 3LALA 3V81A 1XHXA 2RPIA 4I2QA 2B6AA 2RKIA 4ID1A 3ZT3A 4I7FA 2JGUA 3P5JA 2RN2A 4BE0A 3LAKA 3AO4A 3HVTA 3AVIA 1JLFA 3WNGA 4B8AB 4CJLA 3QEWA 4DSKA 4PY5A 1TAUA 3HPOA 1UA0A 1NKEA 2HVIA 4AHTA 3KIOA 4FLYA 4DU4A 3KJVA 1S1XA 1A5WA 4FLVA 4DSJA 4PA1A 4AH9A 2D0AA 3DLBA 2B4JA 3QNOA 1RTDA 4FJLA 1W0HA 1LWFA 2VG6A 1RBUA 4LD0A 2G8KA 4NYFA 1CXUA 4Z4HA 4FK2A 4K8ZA 2E6MA 4CJ4A 3V1RA 4CHYA 1NK7A 2OYQA 5D3GA 4K8XA 4GMJB 3OYKA 3OYCA 1LAVA 3K5LA 3OJUA 3DOLA 4FZZA 1ASUA 4FLZA 1NJWA 5CY4A 2EX3A 2VG5A 3QLHA 4RW7A 3O4QA 2HVHA 1C0TA 1NK5A 1Q9YA 4N41A 4G1QA 4CEAA 4DFPA 2YNHA 2ETJA 3QINA 4IBNA 2FBXA 3DLHA 3BGRA 1VSMA 4M3RA 4PWDA 1REVA 1S6PA 1YTAA 1L3UA 4CF0A 4KV8A 3V1OA 2HW3A 1CXQA 1EP4A 5HRPA 1IKVA 1S5JA 2ZE2A 4CFAA 4Y1DA 3QEXA 4DQRA 1TK5A 4PUOA 4FCYA 3O3HA 4HCCA 1KCFA 3BDPA 1JLEA 3MXIA 4N47A 5FRNA 3F9KA 1RILA 3NH2A 3V9ZA 4QAGA 1VSIA 3V9SA 1KSPA 2BANA 4Z4EA 3AVBA 2FBYA 3AV9A 4IDKA 4KI4A 4Z4GA 2DFHA 4CF8A 1BISA 2B5JA 4JS5A 1JLQA 4E7HA 4OLBA 3K5NA 3ALYA 3SQ1A 3KD1E 1SL1A 3L8BA 2O4GA 4KTWA 3ULDA 4DTNA 1TKZA 3NDKA 1GOBA 3B6PA 3ISNC 4B9VA 3G10A 4OGEA 1TV6A 4E0DA 2YHBA 4ICLA 2O4IA 4DMNA 1IO2A 1IKYA 2OPRA 3VQ6A 4KTQA 5HBMA 3SUOA 2QKKA 3LWLA 3AO3A 3D45A 5K14A 2PY5A 3M8RA 4F3OA 1RDAA 1HQEA 1SL2A 2G8UA 4AHVA 4CIGA 5T7BA 3HPHA 2E4LA 1WSIA 4JLHA 3NE6A 3K5MA 2YNIA 5I42A 4Z4IA 3K2PA 5E41A 4QOZB 3HPGA 3VQ5A 1QHTA 3CM6A 1Q8IA 4B9SA 3V9WA 2PYJA 4B8CA 4IFVA 2A1SA 2KTQA 3HYFA 4Q5VA 4B9MA 4BDZA 3SYZA 5J2PA 2G8FA 3T1AA 3C6TA 3P1GA 3SNNA 4F3TA 1S9GA 1X9MA 4J2EA 4ELTA 4CGDA 1RT3A 1LAWA 3SI6A 3L2UA 4MQ3A 5DMRA 1D8YA 1LV5A 4HUFA 1RT6A 1B92A 1WAJA 3MECA 3OYMA 1EETA 4DTMA 1W9HA 4I9QA 1NJXA 3OVNA 1ITGA 3LP3A 1KLNA 4DSLA 3TANA 1NK6A 2XY5A 3A2FA 4FM1A 3KK1A 1BGXT 3RMAA 3TAQA 4OKKA 2XY6A 2X74A 4HUEA 2E6LA 2NUBA 4O44A 3ZT0A 4C8MA 3VA0A 4IFYA 1BHLA 1HMVA 3KLFA 4E7LA 4OLAA 3DLEA 3HP6A 1C0UA 2VWKA 4HHTA 4FJ9A 4E7KA 1YT3A 3AA4A 4FYDA 1BIZA 3DM2A 1TAQA 1C6VA 3M8QA 2VG7A 3V9XA 4L8RB 1VSJA 3ZSYA 4ID5A 2IGIA 2F8SA 3HXMA 3VQCA 4CJPA 3ZSQA 2HNYA 3H08A 1SUQA 2OPSA 3E01A 4AHRA 3SQ2A 1XI1A 3PO5A 3ZSRA 2HHVA 2GV9A 3NF7A 1RBVA 4CJ5A 1TVRA 2QXFA 4M45A 2DTUA 4O0JA 4ZTFA 1LWCA 2GUIA 4M3ZA 4FK4A 4FLUA 4C8LA 3UIQA 4FJGA 2Q3SA 3MEDA 4CGGA 4DTUA 4AHUA 1SKSA 4M3WA 4DF8A 4DU3A 3HK2A 2Y1IA 4DS5A 1SV5A 3OS2A 1JXEA 3AVAA 4DSIA 3OYBA 3TWHA 5CYMA 1X1PA 5J2MA 1NJYA 1L3SA 4KFBA 1L3TA 3KLEA 1RBRA 3KLHA 3TAGA 4B9NA 3LPUA 4RG8A 3WNHA 3PUFA 1J53A 2HB5A 3VQAA 2P1JA 3NF8A 3SUQA 4FW2A 4J2DA 1TL1A 1C1BA 3ZSZA 4F2SA 4O4GA 1KVBA 4W5RA 4XIUA 4E89A 3AO2A 3HJFA 3KLIA 1ASWA 1RBTA 4AHCA 3QEVA 2DFEA 1L5UA 4CFDA
chains in the Genus database with same CATH superfamily
2VC1A 2J4RA 1NH3A 3AL0B 4JKAA 1J5EK 2HNZA 1ITYA 3QPHA 3LDLA 1WGXA 1QNTA 4MFDA 1WWXA 5FPMA 1FW6A 3ZX3A 3TTDA 3SUPA 4B9LA 3CHWA 5GAGP 3QWLA 3QOEA 1AHDP 4AIKA 3RVCA 1RIOH 3MWMA 5H20A 4JK8A 5C25A 5BR8K 1RNHA 4FT8A 3RKQA 1X4PA 1WSJA 3OR1C 2VKHA 4EM2A 3GYHX 2GWRA 2FA5A 2H6BA 3K4MA 4KUMA 2HPMA 2HDWA 3DKWA 2VODA 3AVCA 4FTHA 3NVMA 3THWB 2WWYA 3LDOA 3HRMA 3B73A 2F8TA 5L3EA 4AVZA 2LF8A 4XSXF 5J3LA 5AQWA 4BRMA 4CEDA 2HWVA 3FXQA 3EL2A 2P9NA 2RAEA 1TL3A 2VT2A 4U67L 1SAXA 3BZKA 3QYEA 2ID6A 4DQ8A 1ZH5A 2QCOA 4G6DA 4WE1A 1LEAA 3LP2A 3QETA 2EZKA 5F08A 3H6EA 2QUFA 1N77A 2DA2A 2A6HF 1TWCJ 2X51A 3AKZA 3KPHA 3H1QA 4OVLA 1QVTA 2KKOA 5FROA 1XD7A 4BACA 4A5BA 3KD5E 2V4JC 2A5YB 3C7JA 1BR1A 3FM5A 5GADJ 4IXCA 5C10A 2IW5A 5H1SQ 3CM5A 4PL7A 4FX0A 2HOEA 3Q0UA 1BQMA 4AM7A 4DZPA 2FXUA 3K2AA 3D7EO 1JJ6C 1DU0A 5AQTA 1Y8RB 4BKXA 2XRNA 3M4OJ 3GCMA 3QBWA 4LC9B 5C2FA 1J9AA 4KAZA 3MN9A 3JSPA 2ZJPF 3JCUC 1ASVA 4NXMK 3OYEA 1UHWA 3SHFA 2VUMJ 1MU2A 1XDUA 2ITMA 3SQ4A 4CGHA 1B72B 1S6QA 3EYYA 2NS0A 3FWEA 3F9MA 5FO5A 2PBDA 1K9MO 4DV6K 3CCQN 2D5RA 2E35A 4KH5A 4CIEA 5KPZA 2FF4A 1QPIA 2I7NA 2OTLN 2HHWA 1XDSA 2EPFA 2WY7Q 5EG0A 1ZRDA 4FO0A 4BJTA 4HX8A 2QEXI 3CI5A 4DR3K 2VBWA 4XMYA 1W7AA 3I4NJ 3ZMTA 1LVAA 3Q5FA 1D0YA 1FNNA 1OKRA 1POGA 3VPRA 4AVPA 2HEOA 5F0CA 3CYMA 1BL3A 4A0YA 3KP2A 1KVCA 4RGSA 1FKOA 4I76A 3S2DJ 2P9IB 5GPAA 5CYQA 1SMYF 2DMUA 3CJNA 1O3SA 1ZG5A 1VQ4I 3PX6A 4EJWA 4AUXA 1XCBA 1FP2A 3G1LA 4RTFD 1OCOH 4JX5A 1PDNC 4L0YB 3DPTA 3A8YA 2D45A 1M1KO 3DPLC 4BDPA 4F2RA 1ULYA 1S9EA 3GDQA 3J7AP 1S8NA 3MMVA 4RW9A 2VBZA 1X9JA 3CZ6A 3LOCA 3V42A 1OH5A 4R1HA 1U8BA 1GLEG 3ID6A 3L6QA 2OF7A 2BHZA 2V7ZA 2Y0MA 3F8MA 4AM6A 2Q1NA 2Y30A 4E70A 3LL3A 4IZ9A 2CUEA 2Z2SB 2MLGA 3G1OA 1ACIA 5FPNA 1EH8A 3H1CA 4PKGA 2RGVA 1TK8A 4ITVA 2QQAA 1MGTA 1AKHA 2Y31A 2F5FA 2L02A 5IP9J 2KDZA 1PUEE 4RW6A 4KIGA 3F73A 5JS1A 3MKWB 4YDUA 2H8WA 5KAIC 3LSHA 2QQ8A 2XRIA 4EV0A 3SQ0A 3L2VA 3H0DA 4XLFA 5F0HA 3RPUA 2R5YB 4A3LJ 2YI1A 1G3SA 2RDPA 2R7TA 4KA4A 3OIOA 4JI1K 1IG7A 4CHZA 4ILHA 4U7DA 5LD2C 2YU3A 4IL6C 1KTQA 4FSVA 1VQON 4GXOA 1EX4A 2F96A 2YV0X 1B4AA 4GRIA 4IJAA 4RS8A 4XKCA 2E2JJ 4H4OA 1KAYA 4CJTA 1TQPA 3HTUA 1TWFJ 5E79C 3JS6A 5CR4A 1ESVA 3ZT2A 1SKWA 1JKPC 1WSGA 1RKTA 4WF2A 1A04A 4BXFA 3WTSC 1B1BA 4LJZF 5TRDA 3MXMA 3C95A 4RB1A 1IV8A 1OR7C 3DTEA 2QA4I 5F64A 2F4OB 3BR2A 3PO4A 2E2PA 3R9PA 2LC2A 3HRUA 2ITGA 4FM2A 4CK2A 3V4IA 3C2GA 4M42A 3OYDA 3M5RA 3G2BA 4AYBA 4H0EA 1W7PA 4IOCF 2KQ2A 5E3MA 2QENA 1FKPA 3RQIA 1MBJA 2VQGA 3X2QH 5AONA 4CK1A 3U6FA 4XRSA 3FBIB 1IH7A 3E6DA 4FLTA 2IVMA 3E6BA 3L2CA 3U3GA 4X66K 3CCMN 2Q2EB 3TO7A 5EZGA 1OMIA 3OOUA 1LWEA 3KHYA 4EJTA 4B4CA 2R5YA 1RBSA 3OTOK 4B09A 3KX2A 4UUSA 1IBLK 5B5EC 2M87A 3JRFA 1OYYA 2QWOA 1HSTA 2G8IA 2L7MP 3AO1A 1Z0XA 1FX7A 2BY2A 2HYJA 5DD8A 4M9SA 4YOVA 4I7HA 5C0YA 3ZSVA 2E1NA 4IOAL 3FKIJ 3ZQLA 4JK7A 1BDGA 4TSXA 4UQGA 4XLHA 2IS6A 1OJLA 4GYIA 3H3NO 3C3WA 4RW8A 3O3GA 1RGIA 3FZKA 4EATA 4N5SA 5C15A 2NXNB 3LSGA 4LIUA 3L3VA 3J7YP 5LLQA 2O61A 5M1KA 3GWZA 4CCJA 5BPLA 3E6CC 2VXDA 4FVUA 5LGUA 3FHNA 4KHQA 2PMZA 2WB1N 1ZC6A 1QRYA 2LKSA 3CUQA 2KLOA 4IRIA 1T6DA 1MBHA 2UZKA 5EY4A 2OZUA 3WT0A 1W97L 2A5WA 3OIPA 1UZCA 4EJVA 1E4GT 4UV8A 1T0FA 3VQDA 5J2QA 1UCRA 4A3MJ 2GUPA 3CP2A 4GV3A 4BRPA 2KTQA 3VQPA 3M8SA 2Z99A 3CTAA 4A93J 3H3OB 4KHNA 3O9UA 5SZTA 2Q97A 3GTGJ 1JLAA 1C0WA 3GO5A 1P92A 1S1WA 1X3MA 2MFZA 3THYB 2ZXJA 4MLOA 5D8KB 3JYTA 4NCAA 2W24A 4BG8A 4WXHA 3RSEA 2H6CA 1Q18A 2XHBA 2P5OA 1ZR2A 3N4QA 1A5VA 5DUKA 3JRAA 2P8TA 2DBBA 2GBYA 1FSEA 1C0GA 4BRQA 1Q9XA 3AVGA 4GY2B 3RMBA 1LB2A 4UNOA 4CJ3A 4FJXA 1XMQK 1MWKA 2E2QA 2DT7B 3MEEA 3LL7A 4BC3A 2FSNA 5EJCA 3DP7A 3CQ8A 5AQSA 2LVSA 2P5VA 3SFIA 1C1CA 2QI2A 5M1PA 1EH6A 5KI6A 1LEBA 1IN8A 2PFBA 1QZEA 2RREA 1FY7A 2D0CA 5B3SH 1Z6RA 1UAXA 3CERA 2E1MB 4JS4A 1XX5A 4L18B 2LR8A 5IP7J 3O08A 1IG9A 3QEPA 2HQ5A 1JL1A 1MNMC 4D9JA 2ZXIA 3G71I 2GXBA 5TKWA 3PIPL 2IP2A 4UB8C 5J8CA 4BR7A 4HV6A 4Y4RA 5FPDA 3QRFF 1J7KA 1OCPA 3HRSA 6PAXA 3THXB 2GAUA 3DBLB 1WZ2A 3VWBA 3K10A 3F21A 3QESA 2E8AA 2O0YA 4KB1A 4B3RK 1ZBHA 3B02A 2VYPA 4E3SA 4FHTA 3F2KA 2OU2A 4RLFA 1HNZK 2M8EA 4GYGA 5KK1A 3CPEA 2P9SA 1NKBA 1XN7A 2P9KA 4FE4A 1NK9A 2MABA 3HSTB 3HUGB 2K4BA 5CZ2A 2W84A 4EM0B 1BL0A 3HM8A 1RFQA 2P9PA 3LDQA 1KFSA 3V7CA 2XY7A 1T6SA 5HVQC 3RSEB 1N6QA 1NKCA 5HRSA 4NQWA 5AQGA 1OCRH 4CEFA 1HQUA 4A3FJ 2V6EA 4WCEL 1T03A 3CDIA 3DMJA 3UR3C 1HXDA 1QZZA 2CUZA 3JW4A 3ZCOA 2E1CA 3MN5A 1ZG1A 4H03B 2XIGA 2QLZA 4DQ2A 1IRFA 3LP1A 1G6NA 1U9OA 4X64K 1U45A 2QBYB 4ILGB 3FZVA 2Z1GA 4XICA 3DLRA 2DQRA 2DOAA 1S72N 1QZ6A 1BOAA 2JUGA 3U9DA 3HJEA 4BYYA 2FBIA 3I0RA 1Q1VA 1SAUA 1NJZA 5AIPA 4OGCA 1DUXC 4C1NI 3K7AJ 1T08B 3MZ8A 1YJWI 2Z1IA 2O6GE 2BTFA 2VQFK 2F5CA 3DWLA 1T33A 4YFNF 5HLGA 3J7ZO 3FK6A 3V4GA 3C94A 2E36A 4EIAA 4DR2K 1K79A 1ZXOA 4CSWA 4DTSA 4IG0A 2RV8A 3C6UA 1F21A 4LLGF 5AQMA 4B3OA 2K27A 2K02A 2YJFA 4LG3A 3QOPA 5HLFA 3VF6A 2F4IA 1ZARA 4DG1A 3IC7A 3NF6A 3FZFA 4JKHA 3SK3A 4RMNA 1X1CA 3FMSA 4Y1CA 4LSNA 4DHYA 3ULEB 3BY5A 3ASOH 1RT4A 3EN9A 4K41A 5JICA 3K4KA 1TNSA 1IJWC 1G99A 3K0LA 4OIOF 2EA4A 5CVRA 2NVUB 1U2VA 2QXLA 4FJNA 5BRHA 3KK2A 2AQEA 2Y48A 3TAPA 4KHWA 2OCEA 1QPMA 3T8TA 2E7WA 5F1JA 2FBKA 2BVLA 4LY7A 1GLLO 2HF4A 2ZGYA 4BROA 3DLLL 1YJ9N 4G9ZA 4CK3A 2OC6A 2P5KA 4A3BJ 1YO5C 1RCHA 5C24A 1JGGA 4BY9C 3V9UA 2P0WA 1W1WE 3QODA 3R60A 1YIOA 4A5MA 2Q0RA 2RPIA 3O9RA 1YTUA 4A3KJ 1XC3A 4DV0K 3M1FA 5GINA 2VPLA 4BE0A 4PFPA 2UUBK 1MDMA 3AO4A 3ENOA 1H0MA 1CF7B 2YU9J 3AVIA 2FE3A 4RDUA 3EKUA 4JKDA 3QEWA 1TAUA 3BTCA 2QWWA 4AHTA 3VYSB 4IEJA 4FLYA 3LDNA 4BQQA 3KJVA 3Q7CA 2COBA 1SQKA 1NMNA 1ATNA 4JX4A 5JMVA 4NC6A 2D0AA 2XV4S 3DV8A 4I09A 2B4JA 3BOQA 1UJ8A 2VG6A 3V7SA 2N8GA 2UUZA 4H0TB 2JPBA 5E8IA 3C2HA 2OD5A 5LGTA 4Z4HA 5M5XJ 2DFIA 2O8XA 3R6MA 3I56N 3I8BA 4K8ZA 4MTDA 5KVRA 1YUWA 4CHYA 1NK7A 5D3GA 3W3DA 2Q8KA 2PX9A 2FD5A 1B9NA 3K5LA 3DOLA 4FLZA 4RW7A 2R7QA 4LITA 4UV9A 2FBHA 4A6EA 4KFCA 4N41A 2VBXA 1DGWY 2PJRA 3THXA 4CDGA 4IBNA 1ZREA 3VTHA 1GVJA 2IOCA 2IS4A 4PJMA 1YTAA 4NC7A 1ETWA 4DUYK 1L3UA 2EK5A 5JI6A 1ATSA 2JT1A 2KT0A 2O8DB 3RSNA 2ZE2A 4CFAA 3EE8A 4S04A 3KZBA 4CZZA 5K5OA 4P1WA 2K9SA 2DA1A 2VXZA 3VEZA 3T0YA 4WF9L 3MXIA 1TW3A 2LFBA 2OUMA 4N47A 3F9KA 2CV2A 3V9SA 4PDKA 1VSIA 1Z6TA 4CD1A 3JAMO 4Z4EA 3G73A 3ZQQA 1R58A 3AVBA 4IDKA 5AQKA 2DFHA 3WXIA 1JTXA 2EINH 1BISA 2B5JA 3S2WA 1JLQA 3SAHA 4OLBA 3L8BA 5LFAA 4N9IA 4DTNA 3FF5A 2DA7A 2LSOA 2WTEA 1TKZA 1Z3YA 4JK1X 1HR0K 2HDCA 4B9VA 1ETKA 1P4XA 3ZMVA 3H92A 2QF7A 4B43A 4DBRA 2DTZA 2HNHA 3IHUA 2YHBA 2O4IA 1RNLA 4X65K 3BLYA 2L54A 1GVDA 4YIRX 1VQMI 4C2TA 5HBMA 5M1QA 3VQ6A 2QKKA 4CYCA 4HLYA 4BJ5C 3AO3A 4FPAA 5K14A 1N34K 1RDAA 1MJAA 2R7XA 5T7BA 4XOTA 1XMAA 3HPHA 2E4LA 4ZZLA 5E18F 3KP7A 4RAFA 2PJRB 4LF9K 3KEYA 1WBBA 2HZDA 3UKUA 5BS6A 3V9WA 2PYJA 1G59A 2M7AA 2VJ4A 3S93A 3QPSA 4CZCA 3A4CA 1W7PD 1LCUA 2NNYA 3IFRA 5AQZA 2JA7J 2G8FA 2K3FA 2Q2EA 2XHKA 4NHJA 4BG9A 5CVJA 3K4JA 1ETYA 1S72I 4NB4A 3SNNA 1X9MA 1OPCA 1FEXA 4Y13A 5FPEA 1V3FA 4RAYA 2XF7A 1UG0A 3C1DA 5GAEP 5JVHL 3K70C 1WAJA 4HUFA 4JAXA 4GV9A 1YW8A 2PYLA 5ILVA 4I9QA 3FR0A 4BC2A 5FKLA 3QFUA 3TANA 3JAMZ 2KHMA 1TBXA 3KCCA 3L9FA 4AIDA 5FLXK 3A2FA 4FWQA 3TAQA 2X74A 2E6LA 3ZT0A 2G9WA 4YOYA 4BRNA 4LIVA 3DLEA 2OTJN 1C0UA 4LLNA 3U8XA 3UKGA 3DEWA 3KEQA 2ZC2A 2NOJB 1O3RA 4FWKA 1Z7UA 4OINF 5ICEA 3AA4A 3HOUJ 3FHZA 4BY7J 1BIZA 1TQMA 2KRCA 1C6VA 1P2FA 1F36A 1O4XA 1Y64A 2W40A 4EAHD 2V9PA 4R8HA 4IZZA 2W57A 3IKMA 4OIQF 3ZSYA 1DKGD 1MD0A 2PJPA 1J75A 1IN4A 4A3JJ 4O8UA 3ZSQA 3H08A 3K4BA 4I01A 3SQ2A 4B3MK 2P5GA 2HHVA 4CH7A 2CV0A 5FLXZ 2IT0A 1TVRA 1TW2A 2QXFA 1WVRA 1TQIA 4NXNK 3D2EA 4XLCA 3AG3H 5AQNA 4C8LA 3L4QA 3UIQA 3QPTA 5FB2A 2QSHX 4XL9A 3FIWA 2DT5A 4M3DA 1A31A 4DU3A 4BL0B 4YY3K 3W2VA 2C6YA 2H1LA 1X1BA 3AVAA 3LA2A 4UVBA 3OYBA 1K7AA 2L7FP 2ZXHA 2H27A 2P9UA 1B8IA 3TBIA 5DEQA 4IRHA 1SFKA 1U0JA 1JHHA 3EDPA 1D1CA 4KFBA 3CCRN 3TKYA 3KLHA 4W97A 1L3TA 4B9NA 3DTIA 1BJZA 4CICA 3GTJJ 1AWCA 3WNHA 2DA6A 1N75A 2VI6A 3EPZA 2QTDA 3NF8A 2QZ8A 5HLHA 3BG3A 2K4JA 1WJEA 1TL1A 1FOKA 2W6LA 3LDSA 2EFPA 4XIUA 1X3UA 1BU6O 1YJ9I 3I71A 3K0SA 2B7EA 1NGDA 3ZQFA 2CYYA 2H09A 4L5IA 4KDPA 1L5UA 4XKBA 1KC8O 4IHXA 2VE8A 2JRMA 4DTPA 2VBYA 4PL8A 4DW6A 3ZETA 2M7BA 3ENHA 5ADXH 3WTWC 5C2DA 2E5LK 2ZXWH 4NCBA 1O1WA 4BEHB 2Y9YA 1JUSA 3QDKA 3AY9A 1S1VA 1QTMA 4OKEA 4UUSB 4CJSA 1BC8C 1B9FA 3E3VA 4WK8F 3BCAA 3H5AA 2VC0A 3VQ8A 4M3UA 4WX9A 2LY9A 4BVPA 4C2UA 2EA2A 3GTOJ 4HDVA 1BW6A 3BWGA 1GOCA 4FWMA 2E1MC 1Z1DA 4Y0WA 2O8FA 2TDXA 2MLKA 2ELHA 2XRLA 4PJLA 4ENKA 3HOWJ 1HJRA 4CEZA 4YOXA 3CC4N 4S0HB 2HNDA 2OTJI 5C42A 4Z2YA 3IV5A 3H35A 3HSRA 4N4NB 4HF2A 2IC3A 4CXFA 3T19A 4CD3A 3G6EN 2AS5F 5AQJA 1MDMB 1IAWA 2FF6A 4KMUX 1JUMA 2MC4A 2X6YA 4M72A 1KAXA 5AQUA 4FJJA 2M8GX 4FISA 1UHMA 2Y69H 1HKGA 4L0ZB 5AQHA 4F3QA 3QIOA 3WUHA 1TK0A 2BW3A 3I59A 1RT2A 4MO5A 2HMPA 4DU1A 3RMDA 2ZMEB 1ZQ3P 4JI5K 2RN7A 5E3NA 3ZMDA 4FOEA 3U1DA 3DQVC 4YIIA 3GTLJ 1SANA 4B3AA 3K5OA 1VQ4N 1WAFA 2BGGA 2E19A 2FQ3A 3WNEA 4CECA 1E3MA 3NWSA 4I98B 4K42A 3REOA 3GTPJ 3TPQA 2HOAA 2YNFA 4E1MA 3BZ6A 3THYA 2RE2A 1MJBA 4M3XA 1MA9B 3NCIA 1NG9A 3ZR8X 1V4RA 3ZQIA 1V5GA 4ZZDA 1YYVA 4M9ZA 1WSHA 3KLGA 5FKOA 5KAFC 4ZHRA 3EO3A 1F1ZA 4PUSA 3ZQHA 1XQSC 4BRCA 2K3PA 5E8GA 2X78A 2FUG2 3DTKA 1Z05A 2FNAA 3H0GJ 4DBQA 3EETA 1U6ZA 1BI1A 3IWFA 1DLOA 3DRRA 2WADA 4FZXC 1RT1A 4HRIA 3WTVC 2W41A 3QYBA 3PIPF 4XBFA 3S14J 4FK0A 4EJOA 4W5OA 1H1VA 4G8XA 4Y17A 5LHHA 4DLGA 4DFKA 3NF9A 2YKNA 4KRFA 2R5ZB 1C0FA 2DYSH 4CHUA 3HZ6A 1IRGA 4F52A 2IVPA 5GTIC 3DRSA 2HDDA 2PFUA 4W5TA 4PQUA 1MJ9A 3TP3A 5FDLA 3OL3A 2JUCA 3CC2I 2UXNA 2W85A 4ENMA 2HQRA 2XPUA 3I55N 3ATUA 4YRVA 3KE2A 3SZTA 5CE3A 3RRHA 5D6FA 4JD2A 1XPXA 2IAJA 2DN0A 3HYIA 1MKMA 2RNGA 4H0XB 1U4BA 4G9YA 1EKEA 5AJ3K 4EMSA 4LB6B 1V5EA 3K1NA 3NMUA 3DLKA 2VIXA 1D9FA 2ETHA 2M4GA 3PX4A 1E0EA 3HSEA 2QWMA 2A07F 4KB0A 5HODA 5HS7A 2O8FB 1UMQA 4AC0A 4C23A 5J6XA 2OA8A 3LZJA 4B9UA 1VI0A 3ZCMA 1PVEA 1RDBA 2K86A 2L0KA 4M3FA 3J80K 4PKIA 2CW0F 1XSVA 1WKMA 1JI8A 1N5YA 1SMTA 1W4MA 4LF6K 4Q0BA 3CCUI 1ZAOA 2NVYJ 5HROA 1VFCA 1TTYA 2D0PA 5EEHA 3BJ6A 2WFBA 1HJOA 2QWPA 2X6NA 4H4MA 4B1XB 2GBZA 1QQIA 1VHXA 3ITHA 3WTXC 3E9LA 3R1XA 3SEQA 2FSJA 3NQOA 4QTRA 4A3DJ 2IS2A 2CFOA 5CHIA 2BGCA 2DFFA 3GW2A 3TW6A 5ICGA 3QMLA 4FWRA 4CGZA 4FVMA 5J1EA 4BR2A 3CFOA 1Q1HA 2MD5A 3M9AA 3MKLA 3DXKB 3OBWA 1UOCA 3AG1H 4LH4A 3BR6A 2FU4A 1FYKA 1RUOA 5EEAA 4DGWB 4DNCA 1QSYA 3ABTA 4JKGB 4PCQA 2CV1A 3CCUN 3P7NA 2QK9A 1YFHA 4XIDA 2JJ7A 5KPRA 1IRZA 3CCLN 1PP8F 1SKRA 5FLVA 1VRTA 2G8HA 4EJUA 2H3GX 3VQ9A 3P9KA 3AA5X 3VEYA 3CCMI 3AVFA 2JSCA 1GOAA 3MWTA 1O7FA 4ZDOA 1ZBSA 1MH3A 2L5QA 4YFXF 2LTPA 3D2EB 4DTOA 1S3XA 3KP4A 4I9LA 2O7OA 2RQQA 4D5CA 3L2WA 2LRDA 2CH5A 2LY2A 3EYZA 3WHCA 1RUNA 2XAFA 2O8DA 2LG4A 2GX9A 2HHSA 1VSLA 2PBIA 1KVAA 1T05A 3D5SC 1UAAA 1AU7A 3S9HA 4F4KA 4KN4X 2BE2A 3GTKJ 3CLQA 3GBTA 1G4DA 5FD6A 4CW7B 1BIUA 2UUCK 3SPYA 2P7CB 1BQNA 2WONA 2WOMA 1X19A 3HEFA 2CRGA 3HGYA 2CUJA 3C65A 4HUGA 1N78A 4E7IA 5K7ZA 4LD5A 4FZYA 2E1OA 1T0FC 2ZQBA 3VOVA 4XOPA 3TI0A 2DOFA 2E71A 3CMMA 5TGTA 2Q0UA 1MMNA 1WN7A 3RMCA 1FK9A 2ZFUA 5BOXA 5HS8A 2B0LA 1HYVA 3HL8A 4CHPA 1YHQN 1RT7A 2HOSA 3C7NB 2L4MA 3C6AA 2VE9A 2XSDC 1RDDA 3GMEA 4GKKK 2NNNA 4I6MA 5CZ1A 4XN3A 4B3XA 4H5TA 3TSPA 1RR7A 3TARA 1QS4A 3VETA 1EXQA 5HDNA 1BW5A 3ZX2A 4MDAA 1VQLI 5I3UA 5E20A 2HZTA 2BDPA 3SV3A 2K7LA 1IN7A 4DLEA 4Z94A 4NLBA 5DM7L 2X48A 3IAS2 3CMEN 4FJ7A 1XGNA 1CGPA 5IOZA 3DRPA 1QA6A 5KQ8A 3OYLA 1C0MA 4JD2B 4EP5A 2BEOA 2GOMA 1MMGA 3BG9A 1G15A 3NH0A 2R7WA 3HSFA 2QW9A 5FFXA 4GW6A 2XUBA 1T95A 4NC8A 4D1QA 1VQ8I 2JA5J 1G2HA 3OHRA 4BR5A 4WFBL 1GHCA 3KYLA 1S3JA 2IXSA 1E2XA 3K59A 3JRCA 1JCEA 3NH1A 2X0LA 3S3NA 2AXTC 3LSMA 4L9TA 1KXPA 2YKMA 4V2FA 2LOOA 5J1YA 4FXDA 4CIFA 3E9PA 3TAFA 1FJGK 5KTQA 1MMAA 4CBWA 4FM0A 1X9SA 1EF4A 1OR7A 2IA1A 3B6OA 3SJHA 4OIRF 1MBGA 4JI3K 2GTDA 1ZHFA 4P5OA 3BPVA 3UKRB 2UXBK 1VK0A 3HI0A 1D5AA 4BC5A 2KZZA 4A5AA 4BHCA 4CBUA 4M3TA 3BF1A 3IKTA 3HBTA 4HTLA 2NS7A 4JOMA 4B1YB 1NOYA 1CZBA 2HYFA 3M8PA 5M5YJ 3DCFA 1HRHA 2NRXA 3VGMA 1NGIA 4K0KK 1B59A 3A01A 3DXMB 3CXCM 3NHGA 4NBQA 1CQTA 5EVZA 4BREA 3K57A 4U88A 3SV4A 4UHTA 3OMYA 3CUQC 2A42A 4BHBA 1PYVA 1KLMA 2UUAK 4A2UA 4O8KA 4YDUC 3P38A 5JS2A 1JE8A 4HYEA 2K9QA 2NRRA 2OANA 3HGGA 4HNTA 4KHUA 4LFUA 5LL6Z 1KONA 5L3FA 3HXLA 1O13A 1W0UA 1K6YA 1RTHA 2OPQA 2CSOA 1HW5A 1ERDA 3AVMA 4KH6A 2JSPA 2QWNA 4YNQA 4ZYAA 4CF2A 1UFMA 3CCEI 3KKSA 3MX2A 4ZH4F 1W5CC 5EGOB 4IWVA 2VL8A 3DPUA 1QZYA 3S16J 4DR6K 3FLCO 3TL4X 5K1YA 5DK5A 4BRFA 4CHQA 5D5WB 4H0VB 4JI6K 1YJNN 1LDDA 5TJJA 2EFNA 1AOYA 2HHXA 2DT6A 3VN5A 2IGNA 1KU2A 3BTLA 2ASOA 4XK4A 4HX4A 4L5JA 5H6RA 3DOKA 3IUCA 2EFOA 3PUBA 4LLLA 4A69C 2FBTA 3A01B 3HT3A 2UXDK 2G7HA 2A6AA 3TGNA 1RKWA 3DEUA 1X9WA 1IC8A 1ZN2A 4M6XA 4E1NA 4II2A 4XM3A 2RF2A 1OH8A 3OJSA 3CJTB 1YVNA 2F9TA 2JN6A 1PUFB 5FRMA 3NAEA 2ZJPL 1WUAA 1NGEA 2V9VA 3P9IA 4DR1K 2NS8A 4DR5K 4FJMA 3QU3A 4KPYA 5J4VA 3OY9A 3MX5A 1MZBA 2IBDA 1VF9A 1KQ9A 1FSHA 3ZT4A 3Q3SA 3WNFA 4JRPA 1MWMA 1XGOA 3QNNA 1X3WB 1R49A 5C4JJ 4IHYA 3MEGA 4FJHA 3WQTA 4CA0A 4R5PA 4M74A 3LA7A 1VQPI 3L4IA 3WU0A 4DFJA 2NRAC 5ED4A 5LJWA 1JL2A 4CJFA 3MQ0A 4WFNL 5EU7A 1ZG3A 1XGSA 1LJ9A 3WTUC 4D5FA 3OYAA 2ATQA 4DV5K 3OYJA 1XC9A 4H0OA 3PLAA 5BN8A 5CVVA 3V1QA 2CQXA 4ZTJA 4M6YA 1BA5A 3ZSWA 4CYCB 1Y6IA 2QSFX 3LALA 5CVIA 1XHXA 4I2QA 2RKIA 4A61A 4L9VA 1FBQA 1EWQA 3P5JA 3T1HK 2P9NB 3LAKA 2XPWA 2ME0A 3MCAB 4M63C 1UELB 4B8AB 3VF4A 4PY5A 2X6XA 3BG5A 4F93B 1R59O 4FWPA 2BZTA 1R1UA 3HPOA 3IWZA 1UA0A 2HVIA 2O5RA 3H9QA 4JYKA 3FKJA 2KZGA 4OU0A 4MEXF 3C6HA 4Z6YA 3FXOA 3K6GA 5JVTA 2KIUA 3JRGA 5FLXO 3AGKA 3LAPA 4FLVA 3PO3J 1HCRA 2HVQA 3CLOA 3LMMA 1J6ZA 2WV1A 1OH7A 3QNOA 1VTNC 2HI3A 4BQNA 2GXGA 2HQNA 4ZJZA 3CDHA 3BR5A 2R7DA 4QIWN 1W0HA 1V54H 2A6TA 4LD0A 2HTJA 4WFAL 2KQRA 2EB7A 1Z91A 1CXUA 5HNHA 1DPUA 2DW4A 2GLOA 5AQOA 3VEPA 2NRZA 3EEQA 3R6SA 3WEEB 4GMJB 1IRXA 4HQMA 4YOTA 3OJUA 1SVLA 3KP3A 4FZZA 1BI0A 2WBMA 1NG6A 2L9NA 4G6TB 3RKXA 5CYVA 1E17A 3QLHA 5M1OA 1LVKA 3Q9VA 4KITB 5CPRB 1D0XA 3S1RJ 2HBLA 3KWIA 2YNHA 4FE7A 3QINA 3K9TA 2HXIA 1REVA 2V52B 4IO9F 3M8JA 5DCMA 5IYBJ 5GAHJ 2ASPA 2CU7A 4CF0A 4KV8A 4EFHA 3V1OA 2HW3A 3D1NI 1EP4A 2LKXA 2R4GA 4HV5A 5HRPA 5FLMJ 1TWAJ 4Q4ZF 1WSUA 3QEXA 4KN7X 5D5VB 2P9UB 5AQVA 1WBDA 5H6QA 3CC7N 2NRWA 3CCYA 3SZGA 2ME6A 3CJBA 1I50J 4V19K 4WCGA 1KCFA 1JLEA 1BWFO 1HQCA 2DO7A 3CP8A 2CWEA 1K78A 1RILA 4QAGA 1KQSM 4UB6C 2MG4A 3DU5A 1MNDA 4P96A 2PMHA 1LE8B 3OBYA 4IQJA 3LQRA 2A69F 2FOKA 2CH0A 3CCVI 4RW4A 4JS5A 4OO1J 1K61A 1X3NA 4U7BA 3CIPA 2P4WA 3LM2A 1G3YA 1SL1A 1NBWA 2O4GA 1NJIO 1SD6A 2GWJA 2ELKA 1GOBA 3GF2A 2D4WA 4ISGA 3TTCA 1TV6A 1CF7A 4AIHA 1SD4A 2FSWA 1NGJA 2DYRH 3IAM2 3RJPA 3K2ZA 2P9SB 4FOIA 3MEXA 2OPRA 1E3HA 3KZYA 4M6VA 3GFLA 3JSOA 3SUOA 1R1VA 3D45A 1ON2A 3BZCA 3MN2A 3SDBA 5IT3A 2PY5A 1KD1O 1P4AA 4D7MA 2QM3A 1YJWN 3HBLA 3NE6A 3SJMA 3MZHA 2YNIA 5E41A 2HF3A 3K5MA 4LFCK 3LSJA 2OQRA 1HBXG 1USSA 1Q8IA 1E3OC 1VQ6I 1R1TA 4B8CA 2I10A 3HYFA 4HA8A 2DAOA 4HNUA 4Q5VA 1GXPA 2HKXA 3T1AA 2YR2A 3TW7A 4BRKA 2Z9OA 2KISA 3VB2A 1KQ0A 1MMDA 2ZSHB 2WV0A 3DKXA 5HLTA 1LE8A 1TLHB 4BNCA 3A2KA 3CQYA 1RT3A 3ENBA 4CGDA 3SI6A 2M34A 5DMRA 2ZFWA 1D8YA 4BJ6C 3CC7I 2QWQA 2VJ5A 4BHPA 2GM4A 2YHXA 1I94K 3MECA 1IW7F 4KIBA 4QPQA 4P9FA 1IXSB 2PMUA 3QPLA 3AAFA 1W9HA 1NJXA 3OVNA 1GLDG 2K85A 5AIQA 2CH6A 4H5WA 5AQLA 5GADP 2UU9K 1BR2A 2KKZA 5DS9A 3CCRI 3KK1A 4FM1A 3J7ZI 3RMAA 4QS8A 2XDVA 2D2WA 4F9OA 2M0MA 3MAJA 4O6JA 4IF4A 2K9MA 2WA0A 2CQQA 3HDDA 4HPQA 3PJRA 1OYWA 2EZLA 4BRLA 4DV7K 2VWKA 1BR4A 2CG4A 1D5YA 5LJVA 5EGOA 4RAZA 4H5VA 3LSKA 3ZSXA 4FYDA 1TAQA 4KH4A 4HDUA 3ZEUA 4L8RB 3AG2H 4LFBK 4EHUA 2YX7A 4EM1A 2BW3B 3CF2A 5GPCA 1SUQA 2VLAA 3KYCB 2OPSA 3E01A 5LY3A 2AXLA 2IA2A 3R3LA 4O0JA 3H46O 3EUAA 2GUIA 3EUKL 3FXKA 3OV8A 4XRFA 2R92J 4FLUA 2MW8A 4FJGA 2R93J 3MEDA 1K4TA 2D1HA 4DTUA 2BY1A 1JUPA 1WJDA 4DF8A 3A02A 1L0OC 1Q7YO 2QWRA 3M7GA 3OS2A 1NU0A 1JXEA 5AQYA 1TKDA 3I59B 4E7SA 4DSIA 1VQ8N 2LYCA 2OCCH 3I3LA 4CYDA 1X1PA 3SZPA 5CYMA 2HR3A 4BUPA 4I02A 4G6QA 1D4XA 4R79A 2ISZA 5GTHC 4J01A 1HW2A 3FFKB 3VGLA 4CZHA 3PUFA 4ESFA 2HB5A 3VQAA 4BR4A 3EY1A 4IO9L 3COAC 4L9JA 2YX6A 3OIQA 3G25A 2L2OA 3ASNH 3BC8A 3WGGA 3GX4X 4AIJA 4YORA 4N56A 1YW7A 2DXIA 2NVXJ 4NNJA 4IHSA 1GLCG 2MGQA 1OISA 3E0JB 3NARA 2NVTJ 1RBTA 2W1OA 2YCHA 2LMDA 1KU7A 2ZJRL 2M1BA 3ECOA 2Z5UA 3ZETB 4KIFA 4OX9K 2VPRA 2QQ9A 5M1NA 5ERIA 2WAEA 4NDLA 1H8AC 3U9ZA 3RR7A 2FJ1A 3TEDA 4DQPA 5DD4A 4L9NA 3O3FA 2E2NA 5ADXA 4HCBA 4F55A 1A6IA 4ZDPA 5IT9Z 1P90A 4FW1A 1BI4B 1ONVA 4BXXJ 2F5EA 3N4MA 4CZEA 3IP4B 3ULEA 4FJ5A 1YG2A 1RETA 4A12A 5J47A 4H4KC 3DLGA 3BP8A 3NGZA 4ELUA 3OYFA 2CFXA 1MMSA 3R8EA 1ZYRF 2RVCA 1R71A 4XNFA 3WU2C 4L3QA 3HHHA 2HYGD 1JGSA 2P9LB 1XGMA 1Y8QB 4E1JA 2QGUA 1S22A 3NGIA 2LD5A 2WC2A 1ETVA 5LGNA 1XWLA 3KK3A 3J7AO 3WG7H 3CQXA 4BR0A 3LZIA 3WU1B 2M5WA 2QKBA 4A6DA 2EILH 4U87A 4BRHA 1NG7A 5KRSA 3OW2M 4XLEA 2K9NA 4ZYEA 5DV5A 3ZN1A 3EUHA 3ABUA 3K4CA 3LAMA 3LWMA 4YOUA 2G7UA 2R0QC 4DQSA 5D4SA 4CGFA 4HAMA 4B44A 1F4KA 4DTRA 2R7OA 1J59A 5F0XA 2ZNYA 2VOOA 3BR0A 1QQNA 2M0CA 1SS6A 1J5OA 4O5FA 4B08A 3PY8A 2F48A 5D6EA 3AG4H 4IHTA 2WAFA 1JXBA 4P55A 4DQQA 3LSTA 1HKSA 2JLEA 3DEEA 4EVIA 3OYNA 3F8BA 3FXLA 3DF8A 4OPKA 4AILC 1IBMK 4JKGA 4XEIA 3EUHC 1VQ7I 4W5NA 3R4KA 3OYGA 3O8GA 2FRHA 3QIPA 2KRHA 4PZJA 3HM9A 3CJ7A 4A59A 3CPWM 1XNRK 1JJ2M 2BXZA 2M45A 1YVUA 2EWSA 1HNVA 4YFUA 2M3AA 3A0HC 5JLWA 4CFBA 2KZMA 3F3XA 1XNQK 2O8BB 3J7YJ 1XSXA 1WJCA 4MFEA 1N36K 1V55H 3CQZJ 3RPUD 5AQRA 4JI7K 1JKOC 1JKQC 1BUPA 3P4IA 4MFBA 3U21A 1FOXA 3TU5A 4FJIA 3L00A 3I4MJ 2ZD1A 5BPDA 3GOIA 2EJRA 2XAGA 1YTYA 1U49A 5FFZA 2W42A 3S32A 4CJEA 3WGHA 3GFIA 4FPBA 1ETOA 2XGEA 5DYMA 3ZMSA 5LEJA 2FBVA 2GWKA 3THVA 2KRFA 3J7AY 2E20A 4N0BA 1MBKA 1H9TA 1YRNA 4OPJA 5GAGJ 4BE2A 3BDDA 5ELZA 2UXXA 1CZ9A 1Z67A 2BHYA 2Z16A 5BQTA 2XAHA 1PUFA 4EP4A 1VQOI 2DPDA 1XG1A 3ULQB 5IT9K 4G94A 2KW4A 3S3OA 2GELA 4KHSA 1YS6A 5K7FA 5FKNA 1T8EA 4PKHA 1N8RO 5F1XA 1UA1A 1FC3A 4Q5SF 4CBXA 2IJLA 3TSQA 4HBLA 5DM7F 2OZSA 1Y39A 2A40A 2JA8J 5KCMA 1S1TA 3CF5F 2Y1JA 1AA7A 4QS9A 2JRTA 2X4HA 4FL9A 2NVQJ 2NRTA 3VSLA 2DJNA 4B47A 4KMFA 4H0PA 3SUQA 4CCMA 2L7ZA 3A0IX 1KU3A 1T44A 4ELVA 3IRXA 1X1DA 4F91B 3AVJA 3R0AA 3P83D 3OYHA 4BS9A 1G3TA 2HSTA 2YHYA 3EZWA 3BJOA 2E2OA 2H8RA 4N76A 4I6MB 3QQAA 3ID8A 3DFGA 4RBOA 3TAMA 4B3SK 5JLHA 3DYAA 3F6VA 1D8JA 1KRPA 4LK1F 1YHQI 3F72A 1IZ1A 1BIAA 2CGLA 2F5VA 4DQIA 4XQFA 2PAVA 2LREA 4KJZA 2Z1JA 3O9TA 4JKCA 4Z4CA 1U48A 1JKHA 5IY5H 3HM5A 2NZTA 1U04A 1Y56A 3UKUB 4B3TK 3P9CA 2FC0A 1W0TA 4IQ4A 1HYZA 4FJ8A 1B9MA 1TL8A 2XGDA 1Y1VJ 3M1CA 2IVNA 2Z3YA 5M5WJ 4OJRA 4DSEA 1R5HA 5BRDA 1YAGA 3SMSA 5LRRA 3H1VX 2LKPA 2OZMA 3GFMA 3CUOA 5FJ8J 3PV8A 3RIRA 4HF0A 3AVNA 3SFZA 1R00A 1YW9A 3IDHA 5HLIA 3SEZA 1BBYA 1UB9A 2XY8A 2Z1DA 1VQ9N 2W25A 3DKYA 3WE2A 4CJKA 3K70D 2E1YA 4B9TA 1QQOA 1APLC 1BA1A 2LSNA 1LW0A 3M1EA 5KRTA 3ZMZA 3FXMA 4B9QA 1FXXA 2D0BA 4K2EA 4FWNA 4CF9A 4FWSA 3OOPA 1HNWK 3AFHA 1A35A 3P39A 5F2RA 2XKOA 5JFRA 2V1XA 3ZRGA 5AQXA 4DB3A 1FIAA 1P8ZA 4EZ6A 1WPKA 1OVQA 3FE1A 2FSKA 3L2QA 1R5GA 2STWA 1BA0A 4DF4A 4O55A 4HTUA 1RDUA 4HSTA 3ZQGA 2AJQA 2H1KA 1W2BM 3S3MA 1IV6A 2CS3A 3LSIA 1O3TA 1TKTA 1HKBA 5M1FA 3EZ5A 5KNLA 2P7VB 3G6EI 1U78A 4W5QA 2B63J 1NM1A 3MMYB 2GIVA 1VQ5N 3GFJA 3WHBA 4D7NA 1WFXA 4ZC3A 3VQ7A 4LF8K 1O57A 4IG3A 3LFUA 4FWLA 4IO8A 4NYNA 4JYAK 2ZKZA 3QAHA 2BUPA 4FLWA 5IYCJ 1BN5A 4Z0UA 3RZOJ 2WBNA 3FMQA 3LQQA 1NK4A 1U2VB 1XUPO 1YXQA 3P31A 1WOQA 1ENHA 2IRFG 3ZT1A 1KU9A 3MVPA 5SWMA 3MFKA 2VQHA 1HW1A 1K6OA 1UWBA 3C7NA 2HQAA 1CZAN 3VQEA 1WSFA 2ZGZA 3VQBA 4LF4K 3A5LC 4I2PA 3L09A 3J80Z 5JLXA 4M3WA 3NVKA 1TP4A 2DI3A 2AHQA 3ELKA 5LMUK 4DR4K 1K78B 3RI4A 1NK0A 3I33A 3CF5L 3OL4A 5L3DA 1JCGA 4CZLA 3WE3A 1REPC 1S1UA 5BN9A 2ZCWA 2ACJA 4BWMA 4CERA 4J2BA 4M3YA 4BBSJ 3KFWX 5B1BH 3RPQA 3IS9A 5GAHP 4LSLA 2HXOA 3CESA 3FM3A 3L2RA 2KJBA 2HBKA 3V8KA 4XKWA 3S41A 1ZBIA 1QVUA 3KLOA 4XLAA 2YPRA 1YF5L 4XRMA 3NGYA 2G8WA 4LB5A 3KKRA 2L9VA 1GV2A 3OSFA 3HTVA 1VSFA 3FGUA 4BU2A 4KYWA 1P7IA 2DDBA 3F6OA 4CEEA 3SDGA 4QSHA 2VGMA 1NLVA 4BH9A 3HOVJ 2CGKA 1HKTA 3SBTA 2LBFB 4KBOA 4BRGA 5KGXA 1T56A 5IPAA 1DGKN 1EA3A 2GEMA 3CJCA 3O80A 3ABLH 4ZDLA 3TDUC 4JP0A 5AZJB 4CE9A 2HBJA 1KFDA 4KKOA 3G71N 1VQ6N 3F0CA 5H2FC 2BH1A 1X2NA 2Q1ZB 2QBYA 5D4RA 3O4WA 3SAFA 3GLLA 1BO5O 4MQVA 5IYDJ 4YHHK 3AVHA 1SFXA 4PJNA 2RKHA 3BJAA 1BCOA 1W5SA 2GIZA 2PMZN 2PN6A 2WB1A 1Z9CA 1MIJA 3W2AA 4BY1J 5A2QO 4IRGA 3MAQA 3FZMA 1J2XA 2MSYA 3UE5A 5AZIA 2JTVA 2VONA 3O6WA 4KREA 1TKXA 5F6FA 3TP0A 1VSEA 4JKBA 4GVMA 2E5ZA 4CGIA 4IKFA 1P4WA 2BVMA 4KNYA 4OMZA 3VEOA 4CZJA 3LANA 3SUNA 1NK8A 3WXMB 1ETQA 1RRJA 4C8KA 5J40A 4H5RA 3HRTA 4PK4A 1L3VA 4XLPF 1BCMA 1LDKB 3LM9A 1IG8A 3H9JA 1R0AA 2A05A 5ILUA 1S7EA 2IGMA 4C3IJ 3VGKA 4GV6A 1EO1A 2EIJH 3I9V2 3OSGA 2MH2A 3E5QA 5AQFA 3VESA 1VSDA 4CHOA 1H88C 4A0ZA 1U47A 3JRHA 2I8DA 2MA3A 5L3BA 3O6BB 1ZLJA 3HOTA 1VQ9I 3OS0A 3GTQJ 3JRBA 2JK3A 2Q36A 1VQNN 5E3OA 5HRRA 4EQQA 3ZN0A 2HOTA 3TABA 3OS1A 1NGFA 1LFPA 4II3A 3J81K 3CCJI 2FNPA 1WJ5A 3V8JA 1P9QC 2QKLB 4UXNA 3F5TA 1WI3A 1D9DA 2V79A 2QSGX 2VCPA 2EZIA 4ASNA 2CGPA 3EYIA 2YS9A 1NTCA 3CC4I 1NGGA 5E17F 5AQQA 1STZA 1SD5A 3DWLE 2HHUA 5CQEA 2G8VA 2ISYA 2HHHK 4WXCA 5F0FA 4MQ9F 2KPMA 3HC7A 1TYQA 4IEIA 1WI9A 3SPZA 1SVMA 2LP0A 4MO7A 2UXCK 4OPHA 1J54A 2E88A 4V2GA 1VQNI 2ICWG 4KHYA 4LH5A 4RM2A 1WLJA 3T5XA 3C0BA 4FLXA 1QSSA 4JI2K 3I0TA 4BEHA 2GA2A 2ZJ2A 4H8KA 4PGGA 1Y0NA 4J00A 3CCQI 4JI4K 1DTQA 5F27A 2ZJRF 4IVNA 3WG9A 2V6CA 5LEKA 1T6CA 2PZSA 5HOOA 3CCLI 2GZWA 2X6WA 3GXOA 3PQKA 3G0ZA 1RESA 4FQGA 4GFBA 1KYZA 3I56I 4XRSG 4MNUA 1R9TJ 3CJ1A 4E19A 5J2NA 3V81A 2HFHA 1TZLA 3ONQA 4HZFA 4I7FA 1HLVA 4JKFA 3ZT3A 1Z3XA 1ZLKA 3WNGA 4DSKA 2LK2A 3WTYC 5LBQA 3I4PA 2IIRA 3G3ZA 3TSUA 3K4NA 1NKEA 3T8RA 1HA8A 1OLTA 2DQLA 4RB0A 3KIOA 2HKOA 4A3CJ 3T7ZA 1MSEC 1A5WA 1S1XA 2VGNA 3VERA 3FISA 4PA1A 5IWAK 4AH9A 1YX3A 3KYDB 1Z21A 2M9HA 3M8FA 1HUXA 1RTDA 5EF6A 2KDOA 2CJJA 3I53A 2ZNZA 2STTA 2UWMA 5J4YA 1XC5A 1RR8C 1BG3A 2XASA 5DM6F 2LH9A 4LF5K 2E6MA 2EWNA 1I5ZA 3F22A 3VPZA 2R7RA 3MCPA 4Q48A 4I99C 4K8XA 1OVYA 3DU6A 3WGIA 1YS7A 3OYCA 2CQNA 4G7HF 1LAVA 1VAZA 1OQYA 3GBGA 2MD0A 3HZJA 4RA2A 4E7ZA 2VG5A 2YHWA 3L0QA 3H3UA 3I54A 2R7ZJ 5D5XB 3CMYA 5C4XJ 1C0TA 3O4QA 3QP5A 5AR0A 2HVHA 2F4MB 2V7YA 2W7NA 4RWTA 5GIPA 4HSRA 2ETJA 2K9LA 2I7PA 2ECCA 2FBXA 3DLHA 2P9LA 2F5DA 4PWDA 4WXDA 4KISA 2G0EA 3ZQCA 2DPNA 2VN2A 3HG9A 3KVGA 2P5LC 2P9KB 4ILJA 4HWIA 1IKVA 3JTHA 1S5JA 2E1ZA 4Y1DA 1R5ID 4GO1A 3TOBA 4DQRA 4PUOA 3PIOL 3CMAN 1IUFA 3O3HA 3H3ZA 1R4MB 1ZTRA 3BDPA 1KYWA 4QPOA 2WAQN 5E3LA 5FRNA 1Y1WJ 2R7UA 4KICA 3NH2A 3V9ZA 1KSPA 2BANA 1HKQA 4BRDA 3VYTB 2FBYA 5BR9A 2EH3A 1JHFA 2V51B 4CF8A 4HQEA 1IXRC 4BGAA 5M3MJ 2VQEK 4M71A 3K5NA 3V7RA 3ALYA 3SQ1A 2IA0A 5FGMA 3ULDA 4KTWA 3IMXA 1MNEA 3WTTC 4IJNA 3CCSN 3BQZA 5HNFA 1S5LC 3B6PA 1O7LA 2EV5A 1NMDA 3QP6A 1EJ9A 4ICLA 3MN7A 2OTLI 1VQMN 5HS9A 3NWTA 3NEUA 4JQFA 1FPQA 3OWTA 3RKWA 3LFKA 1IKYA 2FF3B 3FZLA 1TUYA 4DMNA 1WH7A 4DUZK 4KTQA 1DDNA 3MWPA 1DQUA 3V9XA 4F3OA 4DOZA 1HQEA 1SL2A 1YJNI 1R7JA 3S17J 2Q2RA 2VT3A 1H9GA 1WSIA 5JHUA 2CW8A 2HGCA 2OAZA 3VEWA 5I42A 3K2PA 4Z4IA 4QOZB 4B1WB 2KFNA 3VQ5A 3RDIA 4B9SA 2P9IA 2KL4A 3KLNA 1R4NB 1P6RA 2EIKH 4U0WA 4IFVA 4B1ZA 3THWA 4B9MA 3SYZA 4DV2K 2UV1A 5J2PA 1YE9A 3HB9A 3LWFA 3C6TA 1X1AA 1NK2P 1JT6A 3KP5A 1NGCA 1GLBG 1S9GA 4J2EA 4YIFA 4TV7A 3SBGA 3WEEA 4F3TA 3ESWB 3RYPA 4FASD 1WJBA 3L2UA 3W6VA 1WJFA 4BC4A 3SLCA 1B92A 4XH4A 2EQRA 4DTMA 4XR6A 4BGBA 1U8RA 2OV7A 3T1YK 3A03A 1ITGA 5BRFA 3LP3A 2R3SA 4CVNE 3D0SA 1VQPN 4DSLA 3DXKA 2XY5A 1XMXA 1BGXT 4CZKA 3HOSA 2O8EA 2XY6A 1F9NA 3LAJA 1BOBA 3CO7C 4CZMA 3VA0A 4IFYA 1S7OA 1ZGAA 1HMVA 4UVCA 5GAEJ 1MBEA 1SFOJ 1ZRCA 4AD9A 2HTSA 4HHTA 2M4KA 3NRVA 4DYRA 4B1VA 4FJ9A 4V19S 3ISPA 3HSCA 2XROA 1X58A 4YEJA 1TC3C 4UVAA 3F8CA 2KIMA 1VSJA 2HPIA 4RLQA 3O2PE 4LFAK 2IGIA 1K83J 2XGCA 1FYLA 2L4AA 3S1MJ 3HXMA 3VQCA 1HC8A 3MD2A 4CCLA 1IUYA 2WY8Q 3CJ9A 3VYRB 2TRTA 3M07A 5B1AH 4WQ4A 4AHRA 1NNEA 4MGRA 1ZGWA 3NF7A 3VEVA 4CJ5A 2ASMA 1FJLA 4U0VA 2EV6A 3QYFA 1TNTA 2DTUA 4M3ZA 4FK4A 5BREA 1DT9A 1YIJN 4LF7K 3C2BA 4CGGA 2LLKA 2F7TA 2JZYA 2EFWA 3HK2A 3Q9SA 4C1NK 4DS5A 1SV5A 4OWRB 3NAUA 2E60A 4M3GA 3BG7A 5J2MA 5E1XA 2AA4A 4XKVA 1RBRA 4FX4A 3KLEA 4X0GA 1VQKN 3KEOA 3CMEI 4A2AA 5LHIA 4IHWA 2EIMH 3LPUA 4XORA 2Y75A 1J53A 2W4SA 5HL7L 3K69A 4Y52J 1YRNB 3D2FB 3E5XA 3U9GA 2Y2ZA 3O9QA 4FW2A 4J2DA 4IX7A 3I55I 2GXAA 1GT0C 1KVBA 3DBRB 4F2SA 4E89A 4PSXA 3HJFA 3KLIA 1ASWA 3RKYA 1E4FT 3BUZB 2UYTA 1DP7P 4A62A 4CFDA 4GNIA 4JNEA 3PSIA 1LFUP 3QFPA 4C3HJ 2W6KA 3IH3A 4I6ZA 1KQ8A 2CUFA 2A61A 3SXYA 3WTZA 1B9DA 3GVAA 4PFOA 2JPCA 4ANJA 3RYRA 3TO9A 1EWRA 4JEPA 2YHAA 2I5JA 5F04A 2D5VA 2NYXA 3IH4A 4HVJA 1VNDA 2AQFA 1DP3A 4EEFG 2QA4N 4AF1A 2KLAA 1NGHA 5DM6L 2DU9A 3ZSOA 2QWLA 1U6GA 2VQLA 2HVRA 2F9WA 3D0PA 1I1GA 1WSEA 2YUSA 4BDYA 1FTTA 3CDLA 4ZYGA 4Y15A 2DODA 2J5OA 2WC9A 4ABZA 3HRGA 4NLCA 3M8EA 3AL0C 3GUDA 2X85A 3IUOA 2A3SA 4DTXA 4LGWA 2EHGA 1WHUA 2IAIA 5D5UB 3SAGA 2IGOA 3AO5A 1VQ5I 1L3LA 3V8LA 5GIOA 3B6CA 2JVHA 1HPZA 4DV4K 2Y0SN 4MLEA 4C8OA 4N4OB 2VWJA 1T7PA 1F43A 1NOZA 4DWIA 1D1BA 1QO0D 2L9SA 3FDYA 4MTEA 3VYUB 3GZ6A 1VQLN 2R7YA 2HU9A 2YSRA 3TQNA 4YOWA 1X4OA 1WH5A 5AQIA 1GDTA 5DTDA 1QZ5A 2BY0A 1DGRM 3CUQB 3ECHA 1RZ4A 3HL2A 2RC4A 3D5LA 4NB5A 3IRQA 1IXCA 1HOMA 4OKJA 5EOYA 3T1BA 3F8NA 1A5JA 2W82A 2GQQA 2OA4A 2I5UA 2DK8A 1WJAA 2E7XA 2PEXA 3GLXA 1RDWX 5TISC 4NQWB 3OA9A 2ZO4A 1IF1A 4CJ7A 1R23A 1RTJA 4M41A 3LSPA 3NFAA 2JA6J 3FFIA 3U4LA 3ABKH 1HNIA 2QYOA 4O0IA 3CCVN 4XN0A 4XONA 3PNYA 4H0YB 5D8LB 3ZQ7A 2HVSA 1DEJA 3PL8A 1A36A 1VRUA 1FTZA 4A3IJ 1KAZA 2R7SA 4CFCA 3CC2N 1OYIA 3CJQB 4OAYA 3O1BA 3WXLA 3T3FA 3JTGA 2VB6A 2ZJQF 2VWBA 3FK7A 1BI4A 4LG0A 1IKXA 3I58A 1K8KB 4CZFA 2IDOA 4CI6A 3CFRA 3I64A 2O8CB 2WTUA 4OPAA 1Q82O 2BE5F 1Z25A 3S1NJ 3RR8A 1OKJA 4EGYA 3MDQA 4MIMA 1RDCA 3WXKA 5FKKA 1ZYQA 1WNSA 2WUSA 3IL2A 3TAEA 2HHTA 3RTVA 2IEKA 4P9UA 4ENJA 3CETA 1T8IA 4A57A 4NCGA 2XAUA 1DU6A 4KHPK 1BI3A 1XHZA 3Q0VA 2DOEA 4LG0B 5EX5A 1G3WA 3E7LA 4CESA 1NGAA 3RRGA 2GA1A 3VQQA 4CJVA 2B9SA 1QQMA 3M3ZA 3FXJA 3HO1A 2XF5A 3QICA 3DI6A 4CZGA 4DV3K 2BXYA 1AKHB 3BR1A 4N9HA 3LA3A 4LK0F 1I1SA 4CJRA 1QVFM 3K4LA 4GCVA 4A0XA 5CJ9A 1QE1A 5KQDA 4JRQA 4JX6A 1K8AO 1IGNA 3QU6A 1HX1A 1S9HA 1K8KA 4F92B 2CQKA 1J9IA 2KZVA 4RM3A 3HOXJ 5DCFA 2MBFA 1T38A 3HVRA 1XS9A 3BCBA 3J81Z 3MKZA 4E7JA 4M7YA 4AQYK 3QERA 1SL0A 2DPUA 3LP0A 3G1MA 1LUJB 4D0PA 2GOXB 2NOGA 2DMQA 2JVGA 3I5UA 1HDPA 4A5NA 4CO8A 4BBRJ 3CJAA 3BY6A 4YELA 2HBMA 1GLNA 1A6QA 2OJED 2V1NA 2LF7A 2X1DA 1FLIA 4CCNA 1LOTB 3VF2A 4BQZA 2V1UA 2XO7A 3SCXA 4JV5K 1BI2A 3KK7A 5I9EB 4HNVA 2X9DA 1YITI 4GGGA 1S6LA 3FZHA 3VA3A 3TO6A 3L1PA 1G8XA 3VDXA 5BMZA 4MO4A 1H89C 2OZ6A 2R5ZA 2KMUA 3QO9A 1SFEA 3VQ4A 2F2EA 1FP1D 1P7JA 3QB0A 1Q81O 4CHNA 2OYQA 4BE1A 3ZP5A 2M2EA 3RZDJ 1EQYA 4FJKA 2VOPA 1KA8A 2E5NA 1HKCA 5HDGA 1TUUA 4EHTA 2K40A 2V26A 2VKEA 4EGZA 3KP6A 2PI0A 1LW2A 3HKZN 3DJCA 2V1DA 1B72A 4A3EJ 1YOVB 5LHGA 3ZMUA 5JHFA 1Q86O 3ERMA 4CZIA 3SZ2A 2YX4A 2MYSA 3S15J 2OPPA 4I0AA 5E1WA 4CEBA 1IKWA 3IAYA 3LSRA 4PJ0C 4H5NA 3KETA 1TWGJ 5HRNA 4DKWA 3QEIA 1S29A 3J8AA 4YG2F 2HHQA 3FBNB 2KIFA 5J1RA 3J81O 2CW7A 3LNQA 5CQGA 5EG0B 1ZELA 2ZWHA 2XVCA 4E0DA 1SD7A 4K25A 1USTA 3O4NA 2ZSIB 3JREA 1FYMA 2ESNA 2ZMEA 4DZJA 1SFUA 3RCOA 1U9NA 3ATVA 1ODDA 3DXJF 5KHDA 5L3CA 4X6AJ 1MW7A 1D0ZA 2ELJA 2JMWA 5ICFA 4Y33A 3HTSB 3AA3A 3CFPA 1TYQB 3IG1A 1YITN 1J09A 1GLJO 1K73O 1N32K 2DMTA 3Q0WA 4Y7NJ 1M90O 2BBYA 2HS5A 3L7WA 4ISFA 4AHSA 4DCHA 3CCEN 4EZ9A 2LDUA 3TOAA 3BF3A 2F6CA 2QKMB 4PJJA 4HW0A 1LNWA 4ZYDA 2Y9ZA 3HP9A 1CLQA 4O4GA 4Z4FA 1XCVA 4C8NA 1WCMJ 3KTQA 4WWCA 3R61A 3T69A 3E66A 4MHGA 3NBPA 4FWOA 3UB5A 3JSMA 4IOAF 5HP1A 3W2WA 1ATRA 3ERED 4CGJA 3N4PA 4LOCA 3W3CA 2P81A 1WQ2A 3MKYB 1ETXA 4M73A 3TDZC 3JRIA 3AVKA 3O9SA 2YNGA 4CJWA 4UUVA 1K4SA 4DSFA 3EKSA 1NHAA 4BXUA 2BOLA 5K5QA 1KGSA 3FMRA 3KZIC 3ZYYX 1HYSA 1IV0A 1ZBFA 1SAZA 3U3YA 1ZBUA 5DDGA 3K1PA 5HDKA 4JN4A 4M7XA 1T98A 2KIQA 3GG4A 1FBUA 4CUGA 4JHDA 2A6EF 2FEZA 4X62K 4CEQA 2DY4A 2ID3A 3I8DA 1YLFA 3RQ4A 3M3YJ 1RTIA 4M9XA 3LPTA 3O8MA 1ZRFA 2VJIA 4C9YA 2XPVA 4KTZA 2DCEA 1VQ7N 1I27A 1Y97A 4KO0A 1FZPB 1GV5A 4IOCL 3EE9A 2P51A 3DXMA 1JLGA 1C1AA 4XSZF 1DTTA 1GLFO 2VASA 2YJEA 3AA2A 3W6KB 4BVOA 2A1RA 3L3UA 1VSKA 1ORKA 1V4TA 4MDBA 2EZHA 4Q47A 1I6XA 4IPAA 1QHGA 5IOYA 4FETA 3OYIA 5AFUH 2O3FA 3PSFA 5DUIA 1JLCA 3SQNA 5BPMA 2ECBA 1YX5A 4B8XA 5B66C 5J8FA 3SJJA 3B6AA 1TT5B 3VTIA 3PX0A 2L9RA 5FD5A 2CGJA 3LDPA 1RI7A 2F4VK 3F23A 1GUUA 4KT5C 2X1CA 2QVOA 1SEUA 1T3VA 3ZXSA 4YFKF 2W00A 5GP9A 5LRSA 2L3DA 1BIBA 1J0RA 5EDNA 1VQKI 9ANTA 1QGPA 4X1EA 2XKPA 2VKDA 1BJAA 1SZ2A 2RHKA 3TTFA 3G4SN 5E26A 2ZJQL 1QQCA 5E84A 4QCLA 1I39A 3GEZA 1A5XA 3E5UA 1N25A 2XC7A 5K7HA 1JT0A 4NUBA 4MLHA 1BOTO 1RT5A 2TCTA 4J2AA 4UY8O 4C2MJ 4XLNF 3BG6A 1ZBLA 3E9OA 5CVUA 4GVEA 2CO5A 4C30A 4PSWA 2Z1HA 2X6SA 1IBKK 4GKJK 1YQAA 2ZMEC 3IKVA 4OMYA 2IS3A 2IVOA 4DTJA 1WRJA 2A3ZA 1W36D 4O5BA 3VENA 1QVGM 2XAQA 2M30A 3I0SA 2NLXA 3DAWA 3HUGA 5BNGA 1LFBA 3PNTA 4IXAA 2E2HJ 5L3GA 4CF1A 1ZGJA 4G7ZF 4XH1A 4BRIA 5C12A 1OFCX 3CJRB 3R0JA 3MK6A 4BWJA 3TR8A 3E1SA 1PP7U 4CJQA 3PQJA 4RAGA 3UNGC 2V9KA 3GTMJ 1JLBA 4JI0K 2W48A 3BT9A 3CD6I 3AARA 1I3AA 4KI6A 4BRAA 3O8HA 4IEEA 4B48A 3AVLA 3V6DA 2OBPA 4K43A 4O5VA 3CMAI 1JJ8C 3JR9A 1QBJA 4J8FA 3JRDA 4JK9A 1N33K 1IDYA 5F1RA 2DTRA 4W1UA 3N05A 2PLYA 3TMOA 4CEOA 1QHAA 2QM1A 3O3KA 2EFQA 2CMPA 3VSKA 1VSHA 3MXJA 4ON0A 4DIQA 1W36C 1OCTC 5M3FJ 1O3QA 4WQ4C 3D6RA 2PG4A 1LKXA 1YIJI 1TWHJ 3E6MA 1NWKA 1V4SA 2FLOA 1RPWA 3HKZA 4CJUA 2LY1A 5J1UA 3K58A 2JWLA 3PO2J 1B8IB 4MEYF 4RGRA 4IHVA 5EXWA 2P6SA 2QQBA 1RC9A 4ETSA 1NGBA 3O1WA 1U5TA 2L7KA 1QSLA 4QWQA 3S2HJ 1LQ1A 1R22A 3K9KA 2DK5A 3WODF 3E97A 3C18A 1E3PA 2XAJA 2LBFA 1GLAG 2P6TA 4XH5A 3ML6A 3RTRA 2OQGA 1SC7A 1U3EM 1LPQA 1Z26A 3AGRA 4JHDB 1I3QJ 4I2OA 4BQAA 4DFMA 1XSDA 2X6OA 3U2RA 4RB3C 3N97A 3A5OC 3ASMA 3HOZJ 5KGWA 5B8HA 4DS4A 3CG7A 1OH6A 2DA3A 1M1EB 2IGKA 2X1EA 1TGOA 2IS1A 2P9PB 4BGDA 3RWUA 1MSFC 2HMIA 4F8RA 3EQLF 3CCSI 3BEXA 5KPTA 3ZGKA 3H5NA 3D2FA 1HF0A 2B6AA 4ID1A 1U2WA 4HG2A 2JGUA 3M6GA 2NAZA 2RN2A 1T2KA 3AAQA 3K9JA 3HVTA 3HHGA 4CJLA 1JLFA 3W0LA 5K5RA 3J80O 1BM9A 3JXUA 3PM1A 2RQPA 3U1KA 4O3MA 3GL1A 4DU4A 4B1RA 3P1GA 4DSJA 2COMA 2R7FA 1Y0UA 3K1MA 4UY8I 4J19A 3DLBA 1R36A 2XB5A 1B6AA 4Y3OA 2KHOA 4NO7A 1LWFA 2ZF5O 4G12A 2FMYA 1MH4A 3HIFA 1RBUA 5C44J 2G8KA 1FT9A 1I6HJ 1OCCH 2BY3A 1EH7A 4NYFA 2E2IJ 3BPXA 4FK2A 3UKRA 4CJ4A 1X2MA 3BR3A 3GZ5A 3H9GA 4RGXA 5TKYA 3V1RA 4A2BA 1W5TA 2WAQA 3OYKA 1FMWA 2XB0X 3PNVA 2DA5A 4C3JJ 1W7PB 2VKVA 1F5TA 4WQ5C 2K5CA 4RGUA 1ASUA 4B1UB 1QU3A 1NJWA 5CY4A 1IN6A 4S05A 2EX3A 1NK5A 1Q9YA 1FIPA 2NRHA 4PGHA 4HF1A 4G1QA 3ZX0A 4CEAA 3ZPLA 4FJLA 4DFPA 4HX7A 4AYBN 1WB9A 2DMNA 3BGRA 2VQCA 1VSMA 3MN6A 5AQPA 4M3RA 1ILYA 2ESHA 3CO6C 1S6PA 3VODA 1XMOK 4DYQA 1MDUB 2JWKA 2JWTA 1CXQA 3AAPA 1FMVA 1V5FA 4BAYA 2DDAA 2KJCA 1TK5A 4FCYA 4ESBA 1XB4A 4IDHA 2O03A 2DLLA 1FWZA 2KP6A 1ZR4A 1D5VA 4BQOA 5AFUA 4HCCA 1T39A 5CLSA 5C3EJ 4AU7A 1PJRA 1VZ0A 1DPRA 3AV9A 3GE1A 4KI4A 4Z4GA 1XMKA 1KZHA 4JBAA 2A41A 3G4SI 1R6RA 4E7HA 1ZKGA 2EV0A 4HEA2 5ILSA 1SVOA 3GZNB 4QS7A 4RCHA 2ZM6K 1FOYA 2FXAA 2NRVA 4IFEA 2QEXN 3H36A 3KD1E 2XGXA 2O9LA 3NDKA 2H94A 1U5TB 3SYTA 4OAZA 2Y0SA 4E6KG 5JVGF 4A3GJ 3G10A 2A5XA 2D1KA 3ISNC 4OGEA 3CD6N 5EEGA 1IO2A 3H3VK 2J5PA 3VOEA 1IN5A 1Z77A 4DYCA 5DCMB 3LWLA 4AWXB 3M8RA 3A1YA 2G8UA 1QHHD 3JAMK 2Z33A 2MC3A 4I0BA 4AHVA 4CIGA 3CCJN 5JVGL 4JLHA 1OCZH 3A5MC 3HPGA 5AZJA 5AZIB 2O8KA 1QHTA 4F7ZA 3HOYJ 3CM6A 2IPQX 2KFZA 2A1SA 2V7FA 5BPIA 1U5TC 4BDZA 3A0BC 1D8KA 3IRRA 2ADUA 1JCFA 4U0YA 4IOXA 1YI2N 3B8AX 2MH9A 5MLCQ 4ELTA 1NK3P 1LAWA 1ZK8A 2BV6A 3VEXA 1IJJA 4MQ3A 4RB2C 1FBSA 1LV5A 2PQ8A 3KZZA 4M3EA 2ZB9A 3OYMA 4ENNA 1RT6A 1X3ZB 3VMFB 1EETA 3WQUA 2LNBA 4LMYA 3D5RC 3W6JB 4OOIA 1HSJA 2ZBKA 1KLNA 4WQ5A 1JKRC 1HDDC 1NK6A 1LDJA 3BTJA 1D3YA 2L01A 3DLAA 4DV1K 3O5BA 4OKKA 4HUEA 3OR2C 2DA4A 2NUBA 4O44A 3PO5A 2O8CA 1HLUA 4E7LA 4C8MA 1BHLA 5E1ZB 5JLFA 3KLFA 5LMNK 2BYVE 4JI8K 2KFDA 5JR3A 3HP6A 4OLAA 3BQYA 1GXQA 2RNJA 4QLCU 2A68F 4E7KA 1IDZA 2D1VA 5CKTA 4JKEA 4E4HA 5EYRA 1YT3A 1TT0A 3FXRA 3DM2A 4BR9A 3M8QA 4ISEA 3PFIA 4OIPF 2FQ4A 2VG7A 5BPNA 1JTYA 5IT9O 2Q0OA 3FX3A 3BTIA 3ROUA 4ID5A 2OPTA 3SMPA 2F8SA 2Q31A 1J5YA 2DMPA 3H5RA 3S1QJ 4CCHA 2HNYA 4CCKA 4AM3A 1FOWA 3MCZA 3F8FA 4G7OF 3Q7BA 3DBHB 3ZSRA 2DJIA 2GV9A 1XI1A 4DJAA 1RBVA 4UUTA 1EV7A 3ZLJA 4M45A 2JA2A 2FX0A 4CCOA 4ZTFA 1LWCA 2D0OA 4ZYHA 3FXUA 4DR7K 5A2QZ 2AP1A 4HLXA 2R7VA 2AO9A 5FKMA 2Q3SA 3KWGA 4AHUA 4PHTX 1SKSA 1XTAA 1ON1A 2CQ7A 2NNWA 1YI2I 2Y1IA 2E34A 2XSJC 2O8BA 4BQLA 4GDFA 1S7AA 3ABMH 3QBXA 4CJPA 3TWHA 4M3BA 4L5EA 3PIOF 1HNXK 1NJYA 4ESJA 5ICCA 1L3SA 2EBIA 1D1AA 5EZHA 1JXSA 3VFZA 3ZEUB 3TAGA 3ZOBA 3WXJA 1BC7C 4RG8A 1Z7LA 2O8EB 3S8PA 1UG2A 3PFYA 5IP6A 3MZYA 2JQ7A 2P1JA 3H45C 3A5NC 1MBFA 3ZSZA 1C1BA 2XF6A 3E1YA 4W5RA 3AO2A 2FMLA 4AHCA 3BROA 4WYBA 1UHSA 4HOBA 1HPMA 2VJJA 5A2QK 2DFEA 3DLLF 3QEVA 2FOWA 4KT6A 3IH2A
chains in the Genus database with same CATH topology
4DTPA 2HNZA 3RR7A 4NCBA 4DQPA 1B9DA 3O3FA 1O1WA 3SUPA 4B9LA 4HCBA 4FW1A 1S1VA 1BI4B 2I5JA 2YHAA 4OKEA 4CJSA 4HVJA 1B9FA 1QTMA 4M3UA 4FJ5A 3VQ8A 5C25A 1RNHA 1WSJA 3DLGA 3ZSOA 1GOCA 3ZSXA 3NGZA 3D0PA 1HJRA 1WSEA 3AVCA 4CEZA 3OYFA 4BDYA 4ELUA 2HNDA 2F8TA 5C42A 2IC3A 3T19A 4CEDA 3NGIA 4DTXA 2EHGA 3KK3A 1XWLA 1TL3A 3LZIA 3AO5A 2QKBA 4FJJA 1HPZA