1I3AA

Rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
b'MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i3aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i3aA01
1IKVA 3OYDA 3L3VA 2YHAA 4KO0A 1VSDA 3QEVA 3RMBA 4AHCA 4AHTA 1BHLA 3NF8A 3OYBA 2HMIA 4FJHA 2B6AA 1JLBA 4FLUA 4QCLA 2OPPA 5CZ2A 1SV5A 1VRTA 3ZSOA 3RR8A 4BE0A 2GBZA 3DM2A 4CHZA 1ZYQA 3M8SA 1UA1A 2ITGA 4CJ5A 3BDPA 4DFMA 4B3OA 2HHQA 4N76A 4FJ9A 1GOAA 4FXDA 2Y1IA 4DQQA 4LSNA 4FZYA 1C1BA 4I7FA 1QSLA 1T7PA 2Z1JA 4ELUA 1VRUA 4CJLA 4L8RB 3ZSXA 1RBRA 1WSIA 2X6SA 3TARA 3IRXA 3OJUA 4K8ZA 1Q9XA 5D3GA 3AVIA 4RW6A 3QESA 1IO2A 4OVLA 1CXQA 1WSJA 3KLIA 2KW4A 4BWJA 3SNNA 1NJZA 2YNGA 2DFEA 3V9ZA 2XRIA 3WNFA 1B9DA 1C6VA 1TGOA 3V9XA 1IKYA 3TAEA 1BQMA 4FLVA 1XHZA 4RG8A 4B9VA 2LSNA 1T8EA 1RNHA 2HNYA 5EU7A 4AHVA 3V9SA 5J2NA 1NK7A 2G8KA 3OYEA 1NK4A 4IKFA 3L2VA 1D8YA 3OYHA 3PX0A 3VQBA 2O4IA 4CGGA 1C1AA 3S3MA 4KV8A 1A5WA 3PX6A 2YKNA 2Y1JA 4RW8A 1Z26A 3EYZA 4CIFA 3MEEA 1X1PA 4CIEA 2HB5A 2EHGA 4CJPA 4JS5A 4CJSA 3RMCA 4LSLA 4N56A 3KK3A 3U6FA 4CHNA 3HXMA 3K58A 3CQ8A 1HYZA 3LALA 1LWCA 4DTMA 1QQCA 4FM0A 2X78A 1BL3A 3NBPA 1O1WA 1TVRA 4CGIA 4KB1A 2VG5A 4Y1CA 3ITHA 4DSEA 4EP4A 3DRRA 4ID5A 3LAMA 3OVNA 4LY7A 1NOYA 2PYLA 3RWUA 4J2BA 3AA2A 1WSEA 5I3UA 4CK1A 4FK2A 1VSIA 2HNDA 4M3RA 3RRHA 5JS1A 4CJ4A 1TL3A 4ZTFA 2PY5A 1Y97A 1VK0A 1VSLA 4RW4A 4DTSA 3BGRA 3KD1E 1ZBIA 2HW3A 1S6PA 3HPHA 3CM5A 3LWMA 2OPSA 3SI6A 2IGIA 4CHYA 1EKEA 2D5RA 3L2WA 4CJKA 3LZIA 3LPTA 1I3AA 1RDAA 4E1NA 1L3SA 2RN2A 3ZT2A 3VQ6A 4YNQA 3V9UA 3AO4A 3AVHA 3U3YA 3MEGA 3SQ1A 4KHNA 1TK0A 1RTJA 4KFBA 4DSLA 4FLXA 1IKXA 4CGJA 4FJ8A 4KREA 3MEDA 3ZT4A 4CJFA 3KD5E 4FJKA 2HHSA 4IFYA 4DTNA 3DLBA 1DTTA 3H08A 4IFVA 4OKEA 3M8QA 3SPYA 1UOCA 2PYJA 4FK4A 1F21A 1Q8IA 4C8NA 2XHBA 3O3GA 2E6LA 4J2AA 3T3FA 2G8WA 2QKKA 4CJWA 4KTQA 3F9KA 1UWBA 3ZSYA 4HUEA 4F8RA 3SV3A 4QOZB 5CZ1A 2XY7A 1QS4A 3ZT0A 2P1JA 2Z1IA 1C0UA 4I9LA 4BACA 1FK9A 2NUBA 4KHSA 3LPUA 4TSXA 4DS5A 1S9GA 3WNGA 3VQ8A 1Z25A 4BDYA 3DLKA 4HUGA 1RCHA 3NH1A 3P83D 1WAJA 1RT3A 3E01A 4FM2A 4CECA 1S1VA 4DMNA 1ITGA 4OPJA 3MXIA 3LP3A 3IG1A 4W5OA 4E3SA 4B8CA 3I8DA 4HCCA 3HT3A 3THVA 2G8IA 1JLGA 1HQEA 2FC0A 1XC9A 1NK9A 4OLBA 1GOBA 3KIOA 2D0BA 5CYQA 4W5NA 4JS4A 1UA0A 4E1MA 2XY6A 4IBNA 5J2MA 4H4MA 1NKBA 3QO9A 2FBXA 1NK0A 2HHVA 3HO1A 4O44A 1JLCA 1BIUA 2FBVA 4IG0A 1LWEA 4DTRA 3SQ2A 3O4QA 2KZZA 4B08A 2QXFA 3SUQA 1JKHA 4Z4FA 1RBUA 4KHYA 1W0HA 4W5QA 4KRFA 4CFBA 1KRPA 5KRTA 3HSTB 4M3WA 2WONA 2RF2A 3HPOA 3C6UA 3SCXA 1U48A 4DQPA 4M3YA 3KTQA 1RT1A 5FDLA 2DFHA 4RW7A 4DQSA 2A1SA 4N5SA 2VWKA 4DTUA 1HQUA 3C6TA 3TAFA 1MU2A 1VSJA 4CJTA 4HCBA 3V4IA 3HM9A 1U47A 1A5XA 1ZBHA 2OZMA 3VA0A 4FJJA 3IS9A 3AO3A 2GV9A 3LZJA 2OPRA 1S1WA 2XY5A 2I5JA 3AVLA 3D0PA 1L3UA 4B9SA 3V81A 3DLHA 4E7JA 2Q3SA 3MECA 3TWHA 1T05A 3O4NA 4CK3A 3SUNA 4FJGA 4J2EA 1JL2A 1ZBFA 1JL1A 4DF8A 2IAJA 4DU1A 1S5JA 2HHUA 2BGGA 1BGXT 3RRGA 3KLFA 1CLQA 3L2QA 3L2UA 3PV8A 4CEOA 1ASVA 1WSGA 1TAUA 1YVUA 4F3OA 4ZTJA 1RTIA 2ZQBA 1RT2A 1YT3A 3ZSQA 1LW2A 4CJRA 4CCHA 1N6QA 4F4KA 3LAKA 3T19A 1CZBA 1J54A 1RBTA 4CJ3A 2G8FA 3DMJA 1KLNA 4ELVA 3F73A 5J2QA 3VQEA 2P5OA 5CY4A 4CIGA 3SUPA 3D45A 1S1XA 2P5GA 2IC3A 4NCAA 4CF9A 3V9WA 2RKIA 4RW9A 4DLGA 1EETA 3OS0A 2HNZA 5KGXA 1HMVA 1BI4B 4F2RA 1BQNA 4DS4A 2DFFA 2GUIA 1D9DA 2G8HA 1WSHA 3ZSRA 4XIUA 4FCYA 1KFSA 1XHXA 4DSKA 1DLOA 4CEAA 1CZ9A 3DLGA 3ZSZA 3QEPA 1L3VA 1Q9YA 1QSSA 2FBTA 4KI4A 3CM6A 2KFNA 3VQQA 1U45A 4KTZA 3G10A 2QK9A 4OGEA 2O4GA 4DFJA 3KLEA 5SZTA 4CEFA 2BANA 3NGYA 3G0ZA 1R0AA 1YTAA 1ZBUA 1LWFA 4FW2A 4Z0UA 3KLGA 2OZSA 1HYVA 1S9EA 4KTWA 2FBYA 5T7BA 4E7HA 5HROA 1HNVA 1RT7A 1RTDA 3EZ5A 5FROA 3RTVA 4DFPA 1BCMA 1C1CA 4KHQA 2P51A 4KHUA 2X6NA 4FJMA 1S1UA 3QIOA 2HHXA 1KVCA 1D9FA 3NFAA 4FYDA 3OYKA 3OJSA 4CJQA 3NH2A 4M45A 4FW1A 4CGFA 2BE2A 4FZZA 4HTUA 2ATQA 1X9MA 2HHTA 3S9HA 4CF0A 1LAWA 3CG7A 3QNOA 1NJYA 2YHBA 3DLEA 3RR7A 4DQIA 3KK2A 1IH7A 3TAGA 4NCBA 4BE2A 3ULDA 3TR8A 1ASUA 3LANA 4B9UA 2D0AA 3DOKA 3S3OA 2A1RA 1SKWA 3I0RA 3ZCMA 3AVNA 3TAPA 5HBMA 1RBVA 2YNIA 3ASMA 4H8KA 3MAQA 3AVMA 4BDZA 4BDPA 3SJJA 1BCOA 5KGWA 4J2DA 1EXQA 1RBSA 1KSPA 1D5AA 3O3FA 1IG9A 4QAGA 3K5NA 4FK0A 3A2FA 4CGDA 3K59A 4DU4A 4CEEA 3DRPA 5I42A 3MXMA 1WN7A 5E41A 1UAXA 4DFKA 1HRHA 2EX3A 3VQCA 4CFDA 1L3TA 4DSJA 2ZE2A 4M3XA 4FLYA 3NF9A 1C0TA 4E19A 3NAEA 3PO4A 3HJFA 5FRNA 3AVJA 1X9WA 4DQRA 3OYLA 1TK8A 3QERA 1WAFA 5HP1A 2YNHA 4FJLA 4PUOA 4B9TA 1LV5A 4H4OA 4M42A 1TV6A 3ZT1A 1VSFA 1W9HA 3QINA 4I2PA 4NYFA 4NYNA 3K5LA 4DTJA 4W5TA 2VG7A 2BDPA 1SL0A 4CJEA 2HVHA 2R7YA 4K8XA 3OYAA 4CHPA 1SKRA 4N41A 4CJUA 4CERA 4ZHRA 5C25A 3NDKA 1QTMA 3ISNC 3K57A 4Q5VA 4EZ6A 1QSYA 1C0MA 1JLFA 3NHGA 1S1TA 5DK5A 1NK5A 3KKRA 2E6MA 4LD0A 5C24A 2G8UA 5C42A 1U4BA 4CE9A 1HPZA 2IS3A 4Z4EA 3AA3A 1WLJA 4B9NA 2AJQA 4CEZA 4PQUA 5FRMA 1LAVA 4DTXA 2KFZA 2KQ2A 3SYZA 4C8OA 4KHWA 3RMDA 1VSMA 3U3GA 2WOMA 3HP6A 2YNFA 1TKTA 5HRPA 1BIZA 3VQDA 3DYAA 1JLQA 3VA3A 3HL8A 1VSEA 1SUQA 3B6PA 1T03A 1RILA 3K5MA 4FJNA 1DTQA 3SQ0A 1NJXA 4G1QA 3TAMA 3SUOA 1KLMA 3K2PA 1VSKA 1EX4A 4FLTA 3HP9A 2F96A 3NGZA 2B4JA 3C94A 4FVMA 4B9LA 1HNIA 4EP5A 1I39A 3O3HA 3OYNA 4BE1A 4ELTA 3OS2A 1RDCA 1SKSA 3OYIA 3PX4A 3AA5X 2KZMA 3SZ2A 3S3NA 1ZBLA 1RT6A 4CFAA 3TANA 2PZSA 1L5UA 4JLHA 5DMRA 4DG1A 1J9AA 1RDDA 3QETA 1VSHA 4CEBA 2Z1GA 4CK2A 3AVBA 1BISA 4M41A 3ZT3A 4OPKA 5HRSA 4W5RA 4PA1A 4IDKA 1NKEA 2OA8A 1FXXA 3V1QA 3HVTA 3UIQA 4DTPA 3ZSWA 3K5OA 4CF1A 4Z4HA 3QEIA 4AHRA 4HVJA 3AO5A 2RPIA 3MXJA 4R5PA 3RMAA 3NF7A 3B6OA 3AO2A 3LP1A 3T1AA 4YFUA 1NKCA 2VG6A 1KCFA 3FFIA 3NF6A 4HHTA 2Z1HA 4C8MA 3PUFA 3VQ4A 1GOCA 3I0SA 3LP0A 3AVAA 3WNEA 5J2PA 3TABA 2HVIA 4N47A 2DY4A 1EP4A 3PO5A 4B9MA 4F3TA 4FJIA 4AH9A 4KB0A 2D0CA 3HK2A 3VN5A 2X74A 2IDOA 4LH5A 4CFCA 1QHTA 5KRSA 2XO7A 3QEWA 3OYMA 4MFBA 2B5JA 2XY8A 4E7KA 4E7LA 2OYQA 3DI6A 3DLRA 3ALYA 1KVAA 4MQ3A 3KLHA 4DWIA 3OY9A 1KTQA 1S6QA 4CHOA 4I2QA 2YV0X 3KK1A 2ZD1A 3SV4A 1B92A 4Z4CA 2F8TA 1LW0A 3CFPA 3TI0A 1REVA 3QIPA 2KTQA 4WE1A 3VQPA 4FJ7A 3LP2A 1HYSA 3SQ4A 4GVMA 4O0IA 3M8PA 1TKZA 1TKDA 2JGUA 5KI6A 1B9FA 1WNSA 1A5VA 4Y1DA 3V1RA 3VQ9A 3OYCA 4C8LA 3P5JA 4OJRA 4PY5A 4E0DA 4JRQA 4OLAA 2JLEA 1NK8A 3AVFA 3SPZA 3OYFA 4GW6A 3L2RA 4DLEA 1JLAA 1RT5A 4BWMA 3AO1A 3AVGA 4I9QA 3VQ7A 3VQAA 4Q0BA 4FJXA 3DOLA 2W42A 1RTHA 3LDSA 4AILC 4DSIA 4KAZA 3AVKA 4HUFA 1X9SA 3NGIA 4F2SA 4DF4A 3P1GA 5HRRA 1FKOA 3DRSA 1JXBA 4CHQA 1SL2A 3AA4A 4CF8A 4Z4GA 5JS2A 4ID1A 4FM1A 2DTUA 2G8VA 4CEQA 4FLZA 5SWMA 4OGCA 4M3UA 1J53A 1XWLA 1TK5A 1K6YA 2QKBA 4M3TA 3WNHA 4KKOA 1KVBA 5CYMA 4GMJB 3LWLA 1J5OA 4CGHA 4AHUA 4OKJA 4AHSA 5KTQA 3OYJA 3NH0A 2VWJA 1U49A 1N5YA 3QLHA 3V6DA 1RDBA 3C95A 3AV9A 3JYTA 4O4GA 4FJ5A 2F8SA 3CFOA 1NJWA 2HHWA 4O0JA 4IG3A 3KJVA 1U04A 1RT4A 2YKMA 3HVRA 4DTOA 4CEDA 3HYFA 1KFDA 4ICLA 4M3ZA 1JXEA 3NE6A 4DSFA 1YTUA 3VQ5A 4KPYA 4OKKA 4CF2A 4C8KA 1BI4A 1TL1A 1FKPA 1ASWA 4EZ9A 3CFRA 3QNNA 3KKSA 4CJVA 1CXUA 1G15A 3L3UA 1QE1A 4UQGA 1IKWA 3CYMA 5J1EA 1TKXA 3NCIA 3L8BA 3TAQA 4O55A 1SL1A 4FZXC 4KI6A 5HLFA 4O5BA 5HRNA 4Z4IA 1NK6A 3PY8A 4JRPA 4E7IA 1XI1A 3OS1A 4PWDA 1HJRA 3V1OA 1TAQA 3JSMA 3IAYA 2OPQA 3EY1A 4CESA 4NCGA 5K14A 3HPGA 3QEXA 1JLEA 3AVCA 2ETJA 3OYGA 3M8RA 4DU3A 4LH4A 3ZSVA 4E89A 1NOZA 2IOCA 4B8AB 4FLWA 2E4LA 1WSFA
chains in the Genus database with same CATH superfamily
2NRAC 3KYCB 1EO1A 1Z21A 4BRLA 2F4MB 1Z05A 2WAQA 3F8MA 1TQPA 1UG2A 1IW7F 1IV6A 4A3MJ 4B3TK 4CI6A 4UUTA 2HVSA 1NJZA 4RG8A 1VQMN 1ORKA 3UKRA 1O13A 5JR3A 4D9JA 3AGKA 1B4AA 1Z26A 4BBSJ 2R5YB 1Y1WJ 3LWFA 1TC3C 2HBKA 2E7WA 3CUQC 4JKHA 4H0TB 4RGRA 2ZXIA 1AWCA 4IO8A 4ZTFA 1TL3A 3HOXJ 2HW3A 3CM5A 4AWXB 3SI6A 2O8FA 3ZMVA 4FHTA 2D5RA 4L18B 4CJKA 1V4RA 2K4JA 4IHTA 2P5VA 2N8GA 1PVEA 4C3HJ 3CMAN 3FHZA 3T3FA 1ZRCA 5EVZA 2QKKA 2EBIA 3TW6A 2KIFA 2RVCA 1JI8A 1DPUA 2D2WA 2ID3A 1S9GA 3NVKA 4RAYA 3ZQ7A 2ZSHB 4HNVA 3F2KA 1JLGA 2YX7A 2HQNA 1NKBA 3SZGA 1VQON 1BJZA 1I1SA 3EE8A 3AAPA 1HR0K 1KRPA 3RI4A 2WONA 4R79A 3LDLA 2K4BA 4HYEA 1P6RA 3JRCA 2PLYA 2OPRA 2QSHX 2P5LC 1T05A 2UXXA 1OFCX 4HZFA 1YAGA 4WWCA 2DO7A 1T38A 1D3YA 5IP6A 1XC5A 3CF5F 5FLMJ 5LGUA 3K0SA 1WI9A 1X3WB 5FKMA 2G8FA 2OJED 3VQEA 2HOSA 1U8BA 5L3GA 4OIRF 3RPUA 3D7EO 3Q9VA 1D9DA 3N97A 3PUBA 4KI4A 2XGXA 3QP5A 4IOAF 2LKXA 3BCAA 4KTWA 3HOWJ 4CZGA 1CF7A 4XBFA 2JA7J 3WXIA 3OYKA 2VXDA 1MDMB 2ATQA 5GINA 1NJYA 3GYHX 2UUAK 1IV0A 5FO5A 1A6IA 4A69C 3MFKA 3CZ6A 3TAPA 3HZJA 2HFHA 2VQHA 4DBRA 1HDDC 3VGKA 1T33A 4DFKA 1Q82O 1ZTRA 1L3TA 3FKIJ 2X9DA 1C0TA 4FE7A 4A3BJ 3KZZA 3VMFB 1OVYA 1J09A 2VKEA 4PUOA 4LF4K 5BPMA 3JRDA 3HJEA 4G6DA 4IEIA 1EH6A 3SZTA 1JUSA 4N41A 4ZHRA 5C12A 3NDKA 2PJPA 1N8RO 2JWLA 3ISNC 3WODF 1QSYA 3M3YJ 4L9VA 1U8RA 4CE9A 2FBIA 3Q5FA 4PQUA 3T8RA 1MBGA 2ZJPL 4K41A 1YLFA 2R7UA 4UB6C 3G73A 5F1RA 3W2VA 1GDTA 4BE1A 2KZMA 3PX4A 3AA5X 5AQTA 3B6AA 4A6DA 4X6AJ 3GBGA 5KCMA 4JLHA 2QVOA 3Q0VA 2Z1GA 5HRSA 3EUHC 4DJAA 4Z4HA 3AO5A 2MFZA 3J80K 3PUFA 3VQ4A 3IKTA 4F3TA 4AH9A 3E9PA 1FYLA 4B47A 3TTDA 2HOEA 2VL8A 1FBQA 1RZ4A 2B5JA 3IAS2 3CMEN 3GFMA 2R93J 1UELB 3CIPA 3BR0A 1O3SA 3CFPA 2XHKA 4WE1A 3I8BA 1WNSA 3GTLJ 4A3GJ 2W00A 1VQPN 3AO1A 3AVGA 4BGBA 2D4WA 4HUFA 1WJDA 1WKMA 5TJJA 3NAUA 2F5DA 1BL0A 5F1XA 3FXQA 2DODA 3BROA 3VF2A 1RKWA 1KYWA 1Z7UA 3IP4B 3HUGB 1N32K 5CYMA 1LB2A 4DYQA 1QQOA 1U49A 1VQNN 3V6DA 4LITA 3CFOA 3T7ZA 2M4GA 4KPYA 4A57A 2L4MA 3P9IA 2IIRA 2GEMA 2P0WA 2VQGA 5HLFA 1OQYA 1JKPC 1ZC6A 1U5TC 2E5LK 2K9LA 1XMOK 3C2GA 1DU0A 1K78A 1MMSA 5K14A 2Z5UA 3T1HK 3VYTB 2AQFA 1WSFA 2YHAA 2XF7A 2PJRA 5C15A 2OPPA 4LF9K 4XIDA 2FSKA 4CHZA 4OO1J 3CD6I 4DFMA 2RV8A 2Y1IA 1VRUA 1D0YA 4N4NB 4DV7K 3IRXA 1WSJA 4H03B 3D6RA 2VODA 4B9VA 1FSEA 3CQYA 4YIIA 3ZYYX 3IKVA 3VERA 4IZZA 3C2BA 1WFXA 3L2CA 2RHKA 3D2FB 2HQ5A 2H6CA 1D5VA 3LALA 3CJ9A 4GNIA 3T1BA 4DTMA 4FM0A 2VBZA 1BL3A 3FFKB 1O1WA 3OW2M 1UAAA 4FWQA 3AA2A 1Z3YA 3CJTB 2HF4A 3QYEA 4A93J 3U8XA 1I6XA 4LK1F 1VSLA 3LZIA 3ZT2A 1TTYA 3LM9A 2AQEA 3VEPA 2HHSA 3Q0UA 2ZMEC 4RAFA 2DT5A 4FASD 5EDNA 4D1QA 2LY1A 4I9LA 3CCUN 1FK9A 2NUBA 3MD2A 4GXOA 1PP7U 4FETA 2Q1NA 1TQMA 1B72B 2WBNA 3RYRA 1Z91A 4A2UA 2FBXA 3MKZA 1FP1D 5E3NA 5F0CA 1VHXA 1MNDA 3SLCA 4OPHA 4CCKA 1VZ0A 3I54A 5AFUA 2RF2A 4ENJA 4M3YA 1ZAOA 1E2XA 1QPIA 3K69A 1JUPA 1A5XA 3VA0A 2X6XA 3D2EB 4Z94A 3CJNA 3A01B 2I5JA 1L3UA 2KZVA 3TWHA 3SUNA 2IAJA 4DU1A 4OOIA 1FYKA 1FBUA 4MQ9F 1QZEA 2HQAA 1TAUA 2ECCA 3SHFA 2MLKA 4X1EA 5KAFC 2F9TA 4JKEA 4E1JA 1WJBA 2VXZA 2A6TA 1WSUA 4UUVA 5EGOB 1HW5A 3UE5A 4F2RA 3SAFA 3DF8A 1XD7A 5CVUA 2IVPA 4BREA 4CZJA 1NHAA 3TSPA 1U45A 4KTZA 1YJNN 1S29A 3NGYA 1TWFJ 1ZBUA 3GG4A 2GELA 4P9FA 2JRMA 1N34K 4B3MK 2NVTJ 4HLXA 4D5CA 1N77A 4KICA 2O8BB 4MFDA 3NH2A 3DKXA 3RR7A 4I0AA 3I55I 1YW8A 1SD7A 4CVNE 3GFLA 1MBEA 3QP6A 3HTSB 2E2PA 2YPRA 2W57A 3GL1A 3D0SA 1O57A 3WTZA 3THYB 2O8EB 4A3CJ 2EX3A 5CR4A 4HWIA 3SFIA 5DCMA 3NAEA 3NWSA 1TK8A 5K5QA 4BVOA 1I6HJ 4I2PA 5DUIA 3CCRI 3E6BA 4FO0A 1SKRA 4CJUA 3FXOA 3CO6C 5C25A 3DKWA 1YHQN 1JLFA 2XB5A 1U4BA 2V52B 4CZLA 4JK7A 5E1WA 4LFCK 2JQ7A 2HHHK 4YFXF 3L0QA 1TQIA 2V26A 3ZR8X 4B9LA 1JT6A 2VN2A 3DLAA 3J7ZI 2NNWA 3UIQA 4M3TA 1HYSA 3B6OA 5L3DA 2Z3YA 3FZVA 1BW6A 3HK2A 5D5UB 4L0YB 4IL6C 2X51A 2C6YA 4MLEA 4PFOA 3KYLA 4MQ3A 2YR2A 3M1FA 3ABKH 4M3DA 2P9NA 1XN7A 4DUYK 3QIPA 1F4KA 3LP2A 2FXUA 1J5YA 2IEKA 3FMSA 5E84A 2I10A 3KEQA 4IRGA 4AILC 2YU9J 1P7IA 1TWCJ 5HRRA 3M7GA 2Q2EB 3Q0WA 3CC7I 1RGIA 4FM1A 5SWMA 3FBNB 3PQKA 5HLHA 3Q7BA 1MMNA 2ZXJA 3DCFA 4A61A 4FISA 1BC8C 4XNFA 4DSFA 1SFXA 4EIAA 3H45C 1NGDA 3UKGA 4ITVA 2JN6A 1SL1A 3GEZA 5ILVA 4IJNA 3PY8A 3T69A 2WV1A 2HBMA 3R0AA 3K4CA 3G6EN 2IOCA 3H1QA 2ZJQL 2IVMA 2BY0A 5E3LA 1VQKN 3M3ZA 4A59A 2PFUA 4FZYA 3VOVA 2X6SA 4OVLA 2FXAA 2XRNA 4MIMA 2CFOA 1NK7A 4EGZA 5C44J 1OCRH 3CCYA 3FE1A 2KDZA 4CD3A 1YITI 4HOBA 4ZYGA 4LSLA 2MD0A 3HXMA 2HF3A 5HLTA 4Y1CA 2ZKZA 1ZH5A 2WY7Q 4JI6K 2CGKA 2ETHA 1ESVA 5FLXO 3HBTA 4I6MB 5F2RA 3LQRA 4G7ZF 5J1RA 3A02A 1XDSA 2HPMA 1BJAA 4DSLA 1EWQA 3ZQHA 4U7BA 4Y52J 3E97A 3NEUA 1S3JA 5HLIA 3CUQB 2XHBA 3BR3A 1I1GA 3VEYA 3GLXA 4IZ9A 2O8XA 5MLCQ 4YHHK 5J47A 4U67L 4ABZA 2E20A 4K2EA 3OL3A 4LG0A 2CQXA 2NYXA 3HT3A 2G8IA 2Y31A 2JA6J 2DCEA 1K8KA 5CVIA 3O4QA 4YELA 2QXFA 2DT7B 2WFBA 3K4JA 2CV0A 1C0GA 1T0FC 2IGMA 4F55A 2DFHA 4DQSA 3SDGA 1E3OC 4NB5A 2V7YA 1VSJA 3UB5A 2OZMA 1QZZA 2DDBA 3JAMO 3EKUA 2OCCH 3THXA 4CK3A 2VIXA 2NRTA 3JREA 2EJRA 1RUOA 3ASOH 1CLQA 4LF8K 4A62A 1JUMA 1G3YA 1XC3A 4DV4K 3ZMUA 4XL9A 5EG0B 4CJ3A 4WXCA 3LFUA 3DU6A 2NRWA 3KK7A 4DS4A 3MMYB 3IRQA 2V1DA 1Y8RB 3IV5A 1MBKA 2FBTA 4AYBN 2UV1A 1LE8A 3DWLA 3FXUA 5E20A 4OIOF 2BANA 3IHUA 5HS7A 2K27A 2JA2A 1WPKA 2HHXA 3CC2N 1IV8A 4A5AA 4JKFA 2P5KA 2NS7A 4DQIA 3MWPA 3KK2A 4RLQA 3CCVI 1EQYA 4B9UA 2HMPA 1LQ1A 3MCPA 5AQZA 5CPRB 1P4XA 4J2DA 1EXQA 1D5AA 5M1QA 1BUPA 2MW8A 2R5YA 3PO4A 2KRHA 5FRNA 1K4SA 4BGDA 2X6YA 4QS8A 1RDWX 4H4OA 4NYFA 2OV7A 2E5NA 4W5TA 1XGOA 3EUKL 2VG7A 2HVHA 3WHBA 3OYAA 5IWAK 3U4LA 1TT5B 3MN9A 3HOSA 2DPNA 1MMGA 2MA3A 5TGTA 1AU7A 4XN3A 2KFZA 2WOMA 4DUZK 3G4SN 2NRZA 2DA1A 4FJNA 2VBYA 2OZUA 1GLAG 4YOYA 2JWKA 1NGGA 3O80A 3BTJA 3KP2A 2ICWG 3LDQA 4OPKA 5GAGP 2F5EA 3GXOA 2D0PA 1LPQA 2DK8A 1BR1A 3LSIA 2GWKA 2XB0X 2GZWA 2VJJA 2DA2A 4N47A 3O2PE 3NWTA 2P9SA 1WJ5A 4C30A 1QHTA 1VQ5I 1LNWA 3QEWA 5D6FA 3DTEA 3O9QA 2JSCA 2VWBA 3DLLF 4CSWA 4I2QA 4Z4CA 1REVA 4M73A 2B7EA 3VF4A 3VQ9A 1BDGA 4C8LA 3K9KA 5HLGA 3V8JA 1PYVA 4DGWB 4DF4A 4JI2K 4FT8A 3DRSA 1L3LA 3G71I 1T8IA 1S7EA 1FBSA 1J5OA 5M5YJ 4MGRA 3TL4X 3QLHA 4B1WB 3AV9A 2FOWA 4CEDA 3R3LA 4BL0B 1ASWA 2LR8A 4EZ9A 1G15A 3S1QJ 5ICGA 4EHTA 4C2TA 3WXMB 4B1ZA 2OPQA 3HG9A 1LDJA 5J1UA 1DGKN 3WQUA 3MN5A 1NOZA 1RDUA 4X62K 2LP0A 3U21A 4FJHA 4Z6YA 1ZR2A 2OUMA 4AF1A 4JKCA 1WVRA 4HSRA 1T2KA 3DM2A 1FC3A 1Z67A 4B3OA 1HNXK 4I7FA 2W85A 5CYVA 2QQBA 5A2QK 1U5TB 3FHNA 3ZSXA 2VGNA 1YO5C 2ZJRF 4S05A 3PJRA 4BJ5C 2YJFA 3C65A 2XRIA 2QQ9A 1O3TA 3I5UA 1BWFO 1C1AA 3FKJA 1MWKA 3VDXA 4C3IJ 4NBQA 3R60A 3N4MA 2X78A 3EQLF 5C2FA 4Y0WA 5J1YA 1Z9CA 3BR2A 5AQUA 3LSTA 1G3TA 3GDQA 3FLCO 3RRHA 5LD2C 5BR9A 2OPSA 5IYBJ 3PFIA 1KAXA 1MGTA 3P38A 2RN2A 3KZIC 2UXNA 1JCEA 3LA2A 1IF1A 3QFPA 2PYJA 3HOVJ 5GIOA 4J2AA 1UWBA 2XY7A 3DBRB 1C0UA 4B48A 3LPUA 3BJOA 3VSKA 4HDUA 3HOZJ 3EL2A 3MXIA 3CCLN 3IG1A 3CP2A 4M7YA 1TLHB 1UA0A 4H4MA 2ZMEB 4HX8A 4IG0A 3VGMA 4B08A 2QEXI 4CBWA 4KRFA 4M3WA 1U48A 2DA7A 1KZHA 3KTQA 2HTSA 3M1EA 3HM9A 4M3BA 3ATUA 4DR7K 4LB5A 2CQKA 1YYVA 2R7QA 1IN6A 4E7JA 1JHFA 4F93B 3K70D 4FJGA 3CCJN 3HUGA 2A6AA 2P9KB 4HPQA 2BHZA 2OA4A 5JI6A 4F4KA 2R7ZJ 3SUPA 1R59O 4BS9A 4C2MJ 4C2UA 4PJMA 1EETA 1YX5A 2XAFA 4DSKA 3DLGA 3H1VX 3QEPA 4A3IJ 1RPWA 2NXNB 4DFJA 3DAWA 5FFXA 1YTAA 1PJRA 3N4QA 2ACJA 2RGVA 3GBTA 2R0QC 1YF5L 1XMKA 1X4OA 4BRGA 1KC8O 3RDIA 4NCBA 1Y56A 3LSPA 2D0AA 4BGAA 5D8KB 2LY2A 1U0JA 1RBVA 4RAGA 5KGWA 4AM3A 1HC8A 4CGDA 4HRIA 4FE4A 2F2EA 2NVUB 4XH1A 3IC7A 2VC0A 5B8HA 3D2FA 4JAXA 1FZPB 2YI1A 4LIUA 3WT0A 4FJLA 4Y15A 2DA6A 1TV6A 3ENOA 2FBKA 5EY4A 3TPQA 1W5SA 4JX6A 3ABMH 2X1DA 2XGDA 5C24A 2AJQA 3FXMA 2PI0A 2UUCK 1R22A 5HRPA 3HL8A 1RC9A 4IEJA 3TAMA 3F23A 3K2AA 5DM6F 5IT9K 5KAIC 3S3NA 1AKHB 4J19A 2R7TA 1RT6A 1TYQB 4GYIA 3QETA 3CERA 1B59A 3T5XA 4PA1A 1KU2A 3GO5A 3QEIA 4FOIA 1OKJA 3AO2A 4OIQF 1HX1A 1B72A 4ESJA 2QK9A 2FX0A 3NVMA 3LP0A 5J2PA 3TABA 4JN4A 3R61A 4E7LA 1S7AA 2XY8A 4OMYA 2CGPA 4O5FA 1KQ8A 5M1FA 3RKXA 1DGRM 1UG0A 4EM1A 3D2EA 1EWRA 3HM5A 4NXMK 4P55A 3A01A 2JLEA 2QA4N 1JLAA 1MWMA 2FU4A 3JRGA 3EDPA 4FWSA 2VYPA 3ZQLA 4B3XA 2K5CA 5AQQA 3HTUA 4EEFG 4IOCL 4IX7A 2CQNA 3NH0A 2VWJA 1R5GA 1RR7A 3CDHA 3PIPF 1JXEA 5EGOA 3LSGA 1NGBA 3KVGA 3KKSA 4X64K 2QUFA 1H89C 2G9WA 4CJ7A 4E7IA 4CESA 1J0RA 4IVNA 4DV1K 1DPRA 3CESA 3FDYA 2GOMA 5H2FC 4E89A 3IWZA 5EJCA 1IKVA 1YVNA 3QEVA 2VI6A 2O8BA 5EX5A 2YX6A 3MN7A 4GV3A 1SV5A 1ZYQA 3TKYA 3S14J 1LEAA 3OJUA 1CXQA 3THYA 3GFIA 3O8HA 2XAGA 3S17J 4UHTA 2QW9A 2BXZA 1HCRA 4CGGA 3S3MA 2YKNA 4RB0A 3CQ8A 1HYZA 2KJBA 4B1VA 4FOEA 1KQSM 2W25A 4AIJA 4CJ4A 1MBJA 3I3LA 5ADXH 2LK2A 5JLXA 2VQCA 4YNQA 3MEGA 2QWNA 3K6GA 1IKXA 2A07F 2BVLA 4EJUA 1JCFA 3H08A 3GWZA 2RKHA 3F9KA 4LC9B 2VJIA 3JRAA 4F8RA 4UVAA 1P2FA 1LVAA 5JVGF 3H92A 1TNTA 1TZLA 5EEHA 4XH5A 4NQWB 4I0BA 1FPQA 1JJ2M 1TL8A 1RKTA 3CP8A 1NK9A 4FWLA 1R5HA 1W5TA 3W0LA 4KBOA 4W5QA 3CCEI 1BIBA 3FZHA 2ID6A 1G59A 3I33A 2Q2EA 2HKOA 5DCFA 1I27A 4JKAA 2D5VA 3BTLA 4YIFA 3SAGA 3SDBA 4E6KG 1SANA 2ZQBA 4CCHA 4CJRA 4C3JJ 3OMYA 5E3OA 3M6GA 4XRFA 5M1OA 2Z2SB 1FIAA 4MQVA 2NNNA 4RW9A 4DLGA 4MTEA 3LL7A 4QS7A 4NLCA 1KFSA 4AUXA 3A4CA 2K86A 2FSJA 1VQ9N 1YI2N 4JBAA 2Y9ZA 3H36A 4J00A 1G8XA 5AQPA 4ANJA 4L3QA 3OWTA 4E7HA 2WY8Q 3FMRA 4FJMA 4H5VA 5H6RA 4CGFA 1N25A 1KU9A 4CF0A 2M5WA 1LAWA 2VT2A 2D1KA 3L4IA 3JR9A 3V8LA 4IQ4A 3WXJA 3LA7A 3ZCMA 4YRVA 3AVMA 4P5OA 1FTTA 1D1CA 4BXFA 1RBSA 3A2FA 3PL8A 3W2AA 3FZLA 4V2FA 2R7DA 1UAXA 3AG1H 4CFDA 1MKMA 4M74A 3TMOA 1BOAA 3OYLA 4KH6A 3VENA 3OHRA 3C3WA 1LV5A 2M8EA 4JNEA 1KAYA 2MH9A 3BTIA 3RKQA 4EZ6A 1C0MA 5ERIA 2EQRA 4Z4EA 4I6MA 4PKGA 1APLC 1WLJA 4CEZA 2YNFA 2MC3A 5AQJA 3PO3J 2GXAA 1MBHA 2L7FP 2Q0OA 1GVJA 3HP9A 2F96A 5BRDA 2X6WA 3CUQA 4ELTA 3OS2A 3VWBA 1MIJA 2CRGA 4CFAA 2E1NA 1VQ6I 5AQMA 4ETSA 2Q31A 3S41A 4IDKA 1DGWY 3NF7A 4DV2K 3ZMDA 1QQNA 2QKLB 4B9MA 5CE3A 4LF5K 3H9JA 2ZJRL 3I9V2 4XKCA 3OYMA 4BUPA 3DLRA 4N0BA 2WV0A 2OTLN 1K8AO 3SV4A 2FF4A 3W6VA 4DV5K 2EZHA 4E0DA 3A0IX 4I9QA 3L2RA 2CYYA 4YOWA 3H3OB 3AVKA 1FKOA 4CHQA 3QQAA 1CZAN 4GRIA 3U9DA 1P4WA 5LHGA 4GMJB 5EG0A 3G1LA 2V79A 3K0LA 3J80Z 3OYJA 5F6FA 3JYTA 4IG3A 4P1WA 3HYFA 4M9SA 2WB1A 2HHWA 3CUOA 1D8KA 3MCZA 3O9TA 3ZSVA 1FOKA 1WB9A 4BRKA 4IO9F 1W1WE 1WZ2A 5L3FA 4IFEA 4Y17A 3WEEB 4NXNK 1GOAA 2EA2A 1YJWN 4PFPA 5D3GA 2HVQA 3KZYA 2B63J 1TW2A 3IL2A 1IKYA 3V9XA 1S5LC 1ZGWA 3VEVA 4HA8A 5J4VA 3VQBA 4ZH4F 4LIVA 1D4XA 1R71A 3MEEA 3K10A 3QICA 4G6TB 5LJWA 1Z3XA 3V42A 1TVRA 3A5MC 4RMNA 4EP4A 3VF6A 1JJ6C 3I0TA 3GTGJ 4MO4A 4MEYF 4CK1A 3M5RA 4GCVA 2X6OA 1FSHA 1GXQA 5K7HA 5JVTA 3THWB 2XGCA 4E1NA 1S6LA 1CQTA 2KLAA 3E5UA 3GZNB 1ZBSA 3DLBA 4BR9A 1Q8IA 3TBIA 1K6OA 4CCNA 3P9CA 4BY7J 4DS5A 4XLHA 4W1UA 3A03A 1VQ8N 3I8DA 1IN7A 3H35A 3GZ5A 2D45A 2X0LA 3QO9A 4YOTA 3HIFA 4IHXA 2NVQJ 2W41A 3E6MA 3EUHA 3V7RA 2M34A 2STWA 4CJTA 3C1DA 1S72N 4PSXA 1KGSA 3ZMZA 1JGSA 5K1YA 4J2EA 1JL1A 3WTTC 2B0LA 5F27A 3KLFA 3KHYA 3RCOA 1H9GA 1VQLI 4JV5K 3L2UA 1YG2A 4JI4K 1G3WA 1SFUA 1NLVA 3K4MA 1IBMK 3BY6A 3ZSQA 3SMPA 4H4KC 2P5GA 3I4PA 2DFFA 5TISC 4FCYA 5DM7F 4HX7A 3G1MA 1ZQ3P 1ETYA 2KFNA 5E79C 4BHCA 1TW3A 4CEFA 2ZF5O 4D7NA 2RE2A 1XNQK 1KA8A 5M5WJ 4KIGA 4FWMA 5FROA 1C1CA 5F1JA 2ZO4A 2EZIA 1R49A 4KMFA 2DJIA 4WF2A 2V9VA 5FLVA 2P9IB 1O7LA 4M45A 3N05A 1U5TA 4IQJA 2TDXA 3VEWA 4BE2A 4L5EA 5F0HA 3PIOF 3VTIA 2YNIA 1BCOA 4CH7A 4K42A 3O3FA 3K5NA 2QBYB 2F6CA 4HV6A 4W97A 4JI5K 3B8AX 2WADA 3K4KA 2M7BA 4YOXA 2I5UA 4FL9A 5ILSA 5AQHA 4DR3K 2QCOA 1W7AA 2TCTA 3MK6A 1F43A 3DXKB 4CERA 3SZPA 1TWAJ 2G8UA 3H3VK 2ECBA 2E2HJ 5BPDA 3SYZA 3M8JA 2NNYA 1SUQA 1T03A 4FLTA 1EX4A 2VOPA 3I56N 1T56A 3K7AJ 2HI3A 4DSIA 1DT9A 4CEBA 4EVIA 4M63C 2BE5F 3C18A 4ZDPA 4CZZA 2ZSIB 5IP9J 3TSQA 4ESFA 2VG6A 3DPTA 3FFIA 2L01A 1Y0UA 4Q48A 3ZN1A 2R7OA 3H9GA 1R9TJ 2AS5F 3KETA 5KRSA 4E7KA 3UR3C 3ALYA 4DWIA 1KTQA 1XQSC 2P6SA 2ZNZA 3ML6A 3HL2A 5LRRA 4Y1DA 4HF1A 3GTOJ 4I98B 3IMXA 3AVFA 4DLEA 4BWMA 1RT5A 2VT3A 1ZRDA 2E60A 1UZCA 3ELKA 1G99A 4EGYA 2P9KA 2PBIA 4BJTA 4L5IA 2EWSA 3WNHA 2EFWA 3MAJA 3F8FA 2VE8A 5FKKA 3I58A 3CPWM 3H3ZA 4FJ5A 4JOMA 4BRMA 4JD2B 1LDDA 4RTFD 1FKPA 5AQRA 5M1NA 4HQEA 1O7FA 4Z4IA 1NK6A 3QODA 5C10A 1TAQA 3IAYA 4BYYA 2M8GX 2VLAA 1HF0A 4BRDA 4L9NA 3F8CA 3NF8A 3WGGA 4BROA 1OYIA 3HSRA 1NGFA 1UHWA 5AQGA 4CZMA 2HVRA 4CJLA 2H6BA 2QXLA 4A3LJ 2YNGA 1X1DA 1QO0D 3WNFA 4FLVA 1T8EA 4AHVA 1NGCA 2FSNA 5HL7L 1JKQC 1D8YA 3PX0A 4EM0B 3HEFA 1TNSA 3C0BA 1KQ0A 1D8JA 4Z2YA 4EJWA 2DAOA 1FOXA 1V5GA 2IS1A 1TUYA 5D4RA 5C3EJ 4DSEA 1XTAA 4U0VA 4LY7A 1NOYA 4LOCA 5AQLA 1W36D 4FK2A 2F4VK 3CC4I 3BZKA 3U3YA 3SQ1A 4FLXA 1AKHA 1OMIA 3K2ZA 2P9PB 1TYQA 4PJ0C 4CCLA 3SPYA 4RGUA 1Z6TA 3WXLA 3SV3A 2L9VA 4PGHA 1OCOH 2P8TA 1BA0A 3VQ8A 4CA0A 1HA8A 4YY3K 2KT0A 1WAJA 3RJPA 4W5OA 1GOBA 3I4NJ 3OA9A 4AM7A 5J2MA 3CF2A 4ZC3A 2IS6A 4GY2B 4O6JA 2HHVA 1LWEA 3SQ2A 4H0PA 1GV2A 1SD4A 1RBUA 4KHYA 2UU9K 2VKDA 3FXLA 3CCQN 3HSTB 3TP3A 3C6TA 3IS9A 4FPAA 3AGRA 2J4RA 1NG9A 3HSFA 3WTVC 1X1AA 1YIJN 3ZGKA 3X2QH 1NGIA 1ZRFA 3V8KA 1VQ4N 4B1XB 1RUNA 3LAKA 3T19A 4CIGA 2PBDA 1GVDA 4C1NI 2RNJA 1SVMA 3W3CA 1DLOA 3QDKA 5K7ZA 2HNHA 2MG4A 2CO5A 1WHUA 5LJVA 5SZTA 3DWLE 2K3PA 2ZM6K 1FOYA 4I99C 2IS2A 3SQNA 2OZSA 2DFIA 5F08A 5K7FA 1VQMI 1LOTB 1GLNA 3OJSA 4LGWA 4KN4X 3S9HA 2JA8J 2FA5A 3ZEUB 3OIQA 5IT3A 1NK2P 1ASUA 1E4FT 3TR8A 4YIRX 3ABTA 4HBLA 1EH7A 3I0RA 4H8KA 2JK3A 4D7MA 4UY8O 1X2MA 1KSPA 4FK0A 2ZB9A 1BIAA 3A0HC 3S2HJ 1A31A 5I42A 3MXMA 4DR1K 2LG4A 3BF3A 3VOEA 3ERMA 1X9WA 2QWOA 3QERA 1FX7A 5EZGA 2A6HF 1XS9A 3S16J 2YHXA 4FSVA 3K5LA 4IRHA 2XKOA 3O6BB 1W7PB 4I09A 2R7YA 2ZGZA 4RGXA 3LFKA 3M1CA 1IN4A 2NS0A 3CMAI 4LD0A 2OTJN 2XROA 4BR4A 5GADP 2MABA 3W3DA 4II2A 1VTNC 1ZN2A 4M7XA 1QZYA 2IW5A 5FKLA 2F4OB 4BC2A 2K7LA 1KLMA 4MEXF 2EZKA 5AJ3K 1YE9A 2CV2A 2LTPA 1IJJA 3BR6A 3TANA 5DMRA 1O3QA 5LBQA 1VQOI 3AY9A 2HEOA 4NQWA 2IBDA 2QZ8A 4CF1A 4R5PA 3RMAA 1HKCA 4WCEL 3CETA 5AZIB 2DY4A 4R1HA 1XDUA 1ZHFA 1GT0C 4CZFA 3KEOA 2X1EA 4IEEA 1BR4A 1ZXOA 1S3XA 4YG2F 2L0KA 4B8XA 1J7KA 1A5VA 2H94A 1R00A 3SPZA 3FF5A 3OYFA 5AQIA 1BI0A 4E70A 4KAZA 4YORA 1U2VB 4H5TA 4F2SA 4CZCA 4CW7B 2Y0SA 2CH5A 4NNJA 4XLEA 1ETWA 1J53A 3U1DA 5CVVA 4KKOA 2XASA 1T0FA 5AQKA 4F7ZA 2D0OA 3BPVA 3TO6A 3A8YA 4M3ZA 4ICLA 3VQ5A 3GCMA 4EM2A 5BNGA 4PCQA 5AQOA 1CXUA 1IKWA 2LKPA 5AQFA 2IGKA 1HJRA 3TSUA 3IDHA 4XQFA 2P9SB 2DA4A 2VASA 1WOQA 2K02A 2A40A 3AVCA 3EN9A 3O4WA 4B8AB 3R8EA 2LKSA 1IBKK 3KZBA 1IG7A 2OPTA 2RREA 1UMQA 3H3NO 2QM1A 4CJ5A 2LH9A 2XAUA 2HS5A 3F8NA 3VSLA 3SNNA 2K40A 3L00A 2QWLA 3DQVC 4BWJA 4ENMA 3OSFA 1C6VA 5J2NA 3WHCA 3V7CA 1YX3A 4YDUC 2HPIA 3HSEA 3RMCA 1YJ9N 4B09A 4PSWA 1QQIA 3MX2A 2VKVA 1D0XA 4HNTA 3OOPA 5GAGJ 4KA4A 5GAEP 3LWMA 3O9UA 5A2QZ 3H3UA 1XX5A 1JE8A 2ASOA 3QOPA 2EFQA 2IAIA 4HG2A 3C7JA 1ZELA 5J8FA 1JT0A 4C8NA 1ZKGA 1IRZA 3E1SA 3CMEI 5HDNA 1I94K 3KFWX 4BACA 2CGJA 1HOMA 4HUGA 5EF6A 4DMNA 1VQPI 4B8CA 1R6RA 1NK0A 2DPUA 3ECOA 4DTRA 4QTRA 4XRSG 3ZETB 4DQPA 2UWMA 4RW7A 1VQNI 5E18F 1S1WA 2DYSH 3AVLA 4KISA 4YOVA 2K3FA 4M9ZA 4HF0A 1DEJA 3BUZB 1ASVA 5HS9A 4WQ5C 3VYSB 4G94A 3O8GA 1NK3P 1YT3A 1LEBA 1BG3A 2RQPA 3CXCM 3WTWC 4XRMA 3TW7A 4CXFA 1BQNA 1WSHA 4GV9A 4OU0A 2E19A 1XHXA 1Q18A 1Q9YA 2W6KA 4NDLA 3RSEB 4OGEA 2JJ7A 2UXCK 4FVUA 1ZR4A 5IPAA 5LRSA 1HKBA 1YRNB 1S9EA 2FBYA 4DFPA 3CCSN 3NFAA 5E26A 3WEEA 3M9AA 2DQRA 3QNOA 4B1RA 5DYMA 4K0KK 1WRJA 4B3RK 2BVMA 3NMUA 3B6CA 2CH6A 4BQNA 1IG9A 3I59B 3MVPA 3DRPA 3TO9A 5CVJA 3J81K 3DPLC 3K4BA 4LLLA 1HSTA 4OAZA 4D0PA 2UUBK 2NRRA 2Z16A 2DU9A 3L7WA 2DN0A 2KLOA 2BYVE 1HNWK 3NHGA 3Q3SA 3ECHA 3JRFA 2OAZA 2V6EA 2CS3A 3THWA 4M3FA 4M6YA 3CCUI 1H1VA 1VSEA 2WTEA 1NNEA 3NGZA 1SFEA 1RDCA 3E6DA 3OYIA 5BPLA 5IOZA 1QU3A 3JW4A 4CK2A 2L9SA 2GLOA 1EJ9A 3C6HA 3ZSWA 5FPNA 4AHRA 2LYCA 4JI7K 2EFNA 3SJMA 4A2AA 2D0CA 2X74A 3RKYA 1E17A 5LGTA 3H5AA 2YHYA 2K9QA 3SBGA 5HS8A 4CHOA 2PMZN 2E8AA 2YV0X 2W24A 1T39A 5IOYA 2KTQA 3CJ1A 2YCHA 4H0EA 2HBJA 4GVMA 5KI6A 3T0YA 3M4OJ 3VQAA 2LVSA 4HAMA 5IT9Z 3QYBA 5GAHP 1DU6A 2V6CA 4B1UB 3ZLJA 5C4JJ 2F5VA 4ID1A 1XWLA 2QKBA 1Y39A 1WJCA 4DCHA 3LWLA 4GGGA 4HNUA 2PEXA 3W6JB 1YJNI 2HSTA 3GTQJ 1U04A 1A5JA 1MSEC 4CHUA 1ITYA 2I7NA 3S93A 1OH6A 4DNCA 3MEXA 1IN8A 1ZLKA 1HPMA 1NJIO 5TKYA 1SZ2A 1V5FA 1XI1A 4IPAA 1CGPA 1ETVA 3KE2A 2LREA 1BC7C 1IXSB 2M0MA 3ULQB 1G2HA 1XCBA 2BUPA 1VSDA 1S22A 2B6AA 2P9IA 4RA2A 3LQQA 3GVAA 1XMAA 1LKXA 2H27A 2CJJA 2O61A 1Q1VA 1HDPA 3SMSA 1P4AA 1SFOJ 3TP0A 1RIOH 2JVHA 2R3SA 3FXJA 1H9TA 1T08B 4CCOA 2QBYA 4A3KJ 3TAEA 1B8IB 3J7AP 1XG1A 1YHQI 2G8KA 5ICFA 3L2VA 4Y33A 3QOEA 4QPQA 2E5ZA 2ZJ2A 4K43A 3DXKA 3LA3A 4CJSA 3L09A 3C2HA 1ZK8A 2VG5A 2KHOA 3J8AA 4C23A 4ON0A 5E8GA 1X3MA 1OLTA 3BLYA 5JICA 2PY5A 4L9JA 4XK4A 1EKEA 3E6CC 3KPHA 3VQ6A 3WU2C 2IGOA 1RTJA 4KFBA 4KREA 5FKNA 3M8QA 1T6SA 1F21A 3CJAA 4BH9A 4KHSA 4TSXA 4OIPF 1EH8A 4BDYA 2ZFWA 3ENBA 2HGCA 1ETQA 2KZGA 4NB4A 5D4SA 5IYCJ 1DP3A 1IUFA 1QHAA 3THVA 4EJOA 1HQEA 4OLBA 2D0BA 3WU1B 5CYQA 3TGNA 2XV4S 2P81A 1BIUA 1JLCA 2FBVA 2LDUA 1KAZA 3G1OA 2EIJH 1W0HA 2HBLA 4BRHA 2PG4A 2FSWA 1EA3A 4O8UA 2VWKA 4YEJA 4HCBA 2R5ZB 2XIGA 4FTHA 4H0VB 2EINH 4IRIA 4BVPA 1BO5O 1MMDA 4RAZA 5FD6A 4DQ2A 5C0YA 3BJAA 3L2QA 2A68F 4OWRB 3CHWA 3FZFA 4O5VA 3G6EI 4JD2A 1SVLA 3BF1A 3W2WA 2P5OA 3W6KB 1A6QA 2UXDK 2DMNA 2VQEK 1IXRC 2F5CA 2L5QA 2VC1A 1VQKI 1YXQA 2GUIA 4XIUA 2V7FA 4BXXJ 2KHMA 4J01A 2HDCA 5IY5H 3SYTA 3OBWA 1FNNA 1Z1DA 1NBWA 2BW3B 4AU7A 3RIRA 3OSGA 1ETXA 3RTVA 2E1OA 4KHUA 2O9LA 2V1NA 2XPVA 1F1ZA 4XEIA 2R7VA 5ELZA 2H1KA 5GTHC 3ULEB 1YS7A 3TAGA 1GLJO 5CJ9A 4ILGB 1GLEG 2QWPA 2W1OA 2O8CB 1N33K 1HNZK 4A6EA 5LY3A 2ZWHA 2HWVA 4DQRA 2KKOA 4JK9A 4M42A 1VSFA 2JA5J 2BDPA 4BQLA 2LFBA 3JSPA 3VFZA 2COBA 2JTVA 2FMYA 4NUBA 5JMVA 1NK5A 1S1TA 1BI1A 4WFNL 1HPZA 5LHHA 3TDUC 4LD5A 3U9ZA 3U1KA 4H5NA 2Y75A 2P9PA 5BN8A 3BCBA 3DTIA 1JTXA 2EIKH 2DTRA 1L5UA 4AIDA 1BISA 3JTGA 1LFPA 1SEUA 3PLAA 3M8FA 5JHUA 4DTPA 4HVJA 5EEAA 2NAZA 4YFUA 1NKCA 2V1UA 1NGEA 4C8MA 3WNEA 2ESHA 4GFBA 1GLBG 5GPAA 2NVXJ 3N4PA 2FBHA 1S6QA 1QVFM 3R6MA 3CF5L 4LB6B 2RC4A 3LDPA 3DXMB 4QS9A 5FKOA 4O0IA 3NARA 1X1CA 4S0HB 3CQZJ 4KT5C 4XKBA 4FJXA 2W42A 1FW6A 3VB2A 2WBMA 5HOOA 3AA4A 4RM3A 3ZQFA 2O0YA 3WGHA 3CCMN 4JHDB 2IT0A 4IOAL 3OIOA 2F5FA 1YW7A 3C95A 2CQ7A 3FM3A 5EOYA 3KJVA 1IBLK 3ZQIA 4JI1K 3I71A 3HRMA 3J80O 2JWTA 5HODA 4CF2A 1TL1A 4PL8A 1SFKA 1XNRK 1QE1A 3CC2I 3S1NJ 4KI6A 3EYIA 2YJEA 1P7JA 3HKZA 2XAQA 4JI3K 4XOTA 2E36A 2NRHA 3OYGA 4DU3A 4WX9A 4LH4A 2QLZA 2E4LA 1MDUB 2HMIA 2XPUA 1IRXA 3D5SC 3M8SA 3ZEUA 4AVZA 1MJAA 3MZYA 4LSNA 2MLGA 2Z1JA 2J5PA 4L8RB 3AL0C 3TARA 3H46O 4K8ZA 5J8CA 5CLSA 3MZ8A 2FRHA 3J81O 3KLIA 5EEGA 1B9NA 2KPMA 3L1PA 2KIQA 2LSNA 1RNHA 3GTPJ 3V9SA 3EKSA 2WC2A 1TWGJ 4IWVA 1U6ZA 1P92A 1QHGA 2DW4A 3VGLA 1VI0A 4RW8A 2E1ZA 1W7PA 3G4SI 4JS5A 2EV5A 2OQGA 1HW2A 4N56A 4NLBA 3KK3A 3U6FA 4PL7A 1WQ2A 2L54A 3RKWA 1QQCA 2M87A 3ITHA 4JX4A 4ID5A 4MLOA 5I9EB 3I4MJ 4UV8A 2WB1N 3BGRA 3PNTA 4X65K 3RZOJ 2XAJA 4QPOA 4CJFA 4R8HA 2CV1A 3O3GA 2E6LA 4KTQA 4EQQA 2BGCA 2W6LA 3ZSYA 1NTCA 5AZIA 4M71A 1IRFA 3HC7A 5AQWA 3E01A 4HDVA 1JHHA 1ENHA 3LP3A 2VKHA 4HCCA 2CQQA 4DOZA 5DD8A 4IBNA 3UKUB 2LF8A 4DBQA 1BA1A 2J5OA 3F0CA 2YSRA 5AIQA 3C6UA 2AO9A 4U0WA 4QIWN 4N5SA 2M1BA 1IUYA 1K9MO 1U2VA 3DEUA 3AO3A 2UXBK 4WQ4C 1FMVA 3LZJA 3VEXA 3ONQA 5BMZA 4B9SA 3V81A 1OH5A 3H5RA 1A35A 2MYSA 4DR6K 4DF8A 1BGXT 4AD9A 1VQ7I 2VCPA 3I64A 4A3DJ 2GIZA 4ZTJA 1YTYA 1PDNC 2LC2A 4ELVA 1S1XA 3SBTA 2JUCA 3OS0A 1XMXA 5BOXA 3ID6A 5AR0A 1CZ9A 3LSKA 4XONA 1UHSA 2NS8A 3VQQA 1X3ZB 2O4GA 3KLEA 2Y0MA 4QWQA 3G0ZA 1R0AA 4Z0UA 2EWNA 3ATVA 3AG3H 3EYYA 1BCMA 2X6NA 5KHDA 3HOYJ 1LCUA 4B43A 4FZZA 2YHBA 1RRJA 5HNHA 3DOKA 5FGMA 1GLCG 1R1UA 3MAQA 1UFMA 1VAZA 2IPQX 2CFXA 2QI2A 3F3XA 2K9NA 3J7AO 1L0OC 2ZJQF 1NGJA 4YFNF 1FY7A 4B1YB 1XB4A 3OL4A 4E19A 1ZARA 3HJFA 5HDGA 1WAFA 2V9KA 4E7ZA 3QWLA 4B9TA 2YUSA 3BG6A 1MW7A 1VQ7N 2EFOA 3SAHA 5B1BH 1NMNA 3KKRA 4UXNA 5J3LA 1QQMA 1LAVA 1VSMA 1W97L 2O8DB 4BRIA 3DYAA 2TRTA 4F3QA 3B6PA 1RILA 2I8DA 3IRRA 1DTQA 3SUOA 2I7PA 3K2PA 4DR5K 2B4JA 3CCLI 4IHYA 4EP5A 3OYNA 2QKMB 4F91B 3BC8A 2LF7A 2CMPA 5FB2A 1B9MA 3CQXA 3ZT3A 1J9IA 2W40A 1NKEA 2OA8A 2DLLA 2QF7A 3K5OA 1V4SA 1KCFA 4HHTA 4KB0A 1SD6A 2QM3A 3CCJI 2VJ5A 3ZETA 3VQPA 2FF6A 4FJ7A 3SQ4A 3M8PA 4XLFA 1FLIA 1RTHA 3OR1C 1IGNA 2KMUA 2DMQA 1A04A 4LMYA 5JS2A 5F0FA 2L02A 3QPHA 2YHWA 1TUUA 1OR7C 4OGCA 1K6YA 1SQKA 1KVBA 4XKWA 2R7RA 1LJ9A 4PDKA 2ISZA 2JMWA 4K25A 4O4GA 2F8SA 4O0JA 4DTOA 1Z6RA 1RT4A 2YKMA 4P96A 3QFUA 3DFGA 2GM4A 3QNNA 3HHGA 3CYMA 1AA7A 1U6GA 2AXTC 2BY1A 4WXHA 2HOTA 3RSEA 4JI8K 3ABUA 3HPGA 1MJBA 1YRNA 3L4QA 1D1AA 2COMA 3J7AY 4FLWA 3L3VA 4BRFA 3K70C 2NOJB 1BOBA 2DYRH 1U9OA 5FLXK 3VPZA 1UA1A 1QA6A 2HHQA 4S04A 1C1BA 1USTA 1FEXA 3HGYA 4BG9A 3HRTA 2HXIA 1USSA 1IO2A 1HLVA 2KW4A 3I59A 3K4LA 1S7OA 3CJCA 3E66A 3HM8A 1BQMA 5JLWA 3BQZA 2VBXA 3OYEA 4RWTA 5AZJB 2ELJA 2EHGA 4CJPA 2YU3A 1LWCA 1W5CC 2PYLA 4XLPF 2YS9A 2A5WA 3LAMA 1LUJB 2WTUA 3GX4X 3D1NI 4GO1A 4BEHA 4LK0F 1WUAA 1ZGAA 5IYDJ 4CHYA 5JLHA 3CO7C 2PN6A 1I3AA 2OQRA 4JKGB 3JAMK 3AO4A 3S1MJ 4BJ6C 4DQ8A 2W48A 3E5QA 4Y3OA 3MEDA 3ZT4A 4FJKA 5JVHL 4DTNA 2P9LB 4UY8I 1O4XA 5KNLA 3TTCA 4IDHA 1HUXA 3BQYA 4U7DA 2KFDA 1NG6A 2Y69H 2QA4I 3MKLA 2DT6A 1QPMA 3BT9A 4O44A 5D5XB 5AFUH 4E4HA 1FIPA 5ED4A 2Z33A 5FDLA 5DV5A 3DBHB 5KVRA 3QPSA 1XGNA 3JS6A 1DQUA 1JTYA 4HF2A 5JHFA 4CBXA 3ZXSA 1ACIA 2FE3A 3VYRB 4JYAK 3PV8A 2EZLA 4KMUX 4F3OA 3EUAA 2DOFA 2DA5A 2ASPA 3DMJA 3F73A 2L9NA 2FD5A 2STTA 2IC3A 2BH1A 4A5BA 2DJNA 2HNZA 3AARA 5JLFA 2CU7A 2QWQA 4CEAA 1L3VA 4CYCB 1KYZA 2GA1A 3ZRGA 3AG4H 1QBJA 5BRFA 1HYVA 5HROA 1RT7A 3WTSC 2K9SA 4CJQA 4JEPA 3WTYC 4KN7X 2L2OA 3F8BA 2YX4A 2AA4A 3IUCA 4Y7NJ 2G7HA 1XSXA 3S3OA 1SKWA 5HBMA 1B8IA 2DMTA 4DYCA 3K59A 1AHDP 1D5YA 2IGNA 2E2JJ 1WN7A 3DPUA 2XSDC 3QYFA 3CD6N 1ZG3A 3ZN0A 2YNHA 3QBWA 3QMLA 4DIQA 4M6XA 3ZT1A 2OCEA 4C1NK 3BPXA 4CJEA 4FPBA 1SAXA 4UV9A 2VB6A 3K57A 5AIPA 4Q5VA 5DK5A 5C42A 3JCUC 3RMDA 2CUZA 3VQDA 1JKOC 3VA3A 3O3KA 1BOTO 2JT1A 1HXDA 4HQMA 4DV6K 4MTDA 3FM5A 2LRDA 2A5YB 1VSHA 4PUSA 4KFCA 4KHNA 2GXGA 3IFRA 1GOCA 3I0SA 4BQZA 3PO5A 2A6EF 2BZTA 1MH3A 3BDDA 2IDOA 4MNUA 4BKXA 4CFCA 1XMQK 2RAEA 3FXKA 2ZD1A 5ICEA 4UUSB 2R5ZA 1TKDA 1TKZA 2JGUA 3FIWA 3V1RA 4PY5A 4ASNA 4OLAA 5J40A 3KYDB 5DEQA 1XGMA 3ID8A 4PK4A 1X9SA 3HGGA 1JXBA 3GFJA 4M6VA 1H0MA 3E1YA 4I02A 3BR5A 1K4TA 1VQ9I 1YI2I 1IZ1A 1ZG1A 1WCMJ 2W7NA 4XSXF 1MNEA 2WAQN 1MZBA 4A2BA 3ZMTA 2OBPA 3PO2J 4UQGA 3LSJA 5J1EA 1TKXA 5M3FJ 3L8BA 3CI5A 2Q0RA 3JSMA 4DZPA 2EH3A 3O8MA 4CCJA 2BW3A 4C9YA 3M8RA 1RESA 4LF7K 3CJQB 4HX4A 3MDQA 3P9KA 4QCLA 5CZ2A 3KX2A 3ZSOA 3ULEA 4LFAK 2MC4A 4BAYA 1R4NB 1QSLA 3HOTA 1FMWA 2B9SA 4FWNA 2HOAA 3D5LA 3QESA 4RDUA 2O8CA 1XHZA 4BRNA 5EU7A 2Y0SN 4F9OA 4EJVA 5M5XJ 2OF7A 1KD1O 2ESNA 4WFAL 5GADJ 2Q0UA 3I55N 3WGIA 2GUPA 1BBYA 3AL0B 2BOLA 4CGZA 2V9PA 3DRRA 5LEKA 2Y9YA 3RWUA 4H5RA 2L7KA 4G9ZA 5JS1A 1SC7A 1VK0A 4BHBA 1ZBIA 1U3EM 1X1BA 3BWGA 1KU3A 1RNLA 4OMZA 5ADXA 3O08A 3FISA 1NMDA 5A2QO 4ZJZA 3CCRN 4CGJA 2QSFX 3ZX2A 4JQFA 4OKEA 3DLLL 2PAVA 2G8WA 3EE9A 4BRCA 4XR6A 2A5XA 2OTLI 1ZLJA 2CWEA 2E2NA 3WNGA 1Z25A 1RCHA 1RT3A 4CECA 4HW0A 2KRCA 1V5EA 3FXRA 5FPDA 5EZHA 1W0TA 3HO1A 3DXMA 1JKHA 2GWRA 3HZ6A 3R6SA 3KP6A 3OBYA 2RN7A 4CFBA 4MHGA 3C7NB 4GKJK 1GLLO 3TQNA 3TAFA 1SD5A 1U47A 4FJJA 2XGEA 2XDVA 4KT6A 5EXWA 3O4NA 3IUOA 4JHDA 2BGGA 1P9QC 4UVBA 2FNPA 3F22A 1ILYA 1YVUA 4IHWA 4A3FJ 4I76A 1RTIA 4RBOA 1N6QA 3VPRA 1RBTA 1QZ6A 4NCAA 2KISA 4CCMA 3LSHA 3CC7N 1BI4B 3E9OA 1QGPA 1EF4A 4GDFA 1YJWI 2M7AA 2P6TA 3ESWB 4IOCF 1G4DA 5L3CA 4GV6A 2R7SA 5E1XA 4BC5A 1HJOA 2HYGD 2VQLA 1GV5A 1IRGA 1X9MA 2HHTA 4MFEA 2P9UB 3CG7A 3BZ6A 2QENA 2UZKA 3ULDA 3BEXA 2OZ6A 2A1RA 4BQQA 3ASMA 2IA1A 3KCCA 1OYWA 4ESBA 2MBFA 4DU4A 4F52A 1K61A 3A1YA 3RQIA 2K85A 3NF9A 5GAEJ 3S1RJ 3PSFA 3WE2A 3AFHA 2WAFA 3B73A 3WXKA 3QINA 3G25A 4DTJA 3FZMA 4K8XA 1FJGK 1BI3A 3R9PA 2DXIA 4ZDOA 1GLDG 3WG7H 1QTMA 3DP7A 2H1LA 5CQEA 2R92J 3AA3A 5FRMA 4DTXA 1YITN 4YDUA 1DP7P 3MZHA 1JLQA 2IA2A 1VQ8I 3F5TA 4G1QA 1MH4A 1PUFB 1BU6O 1SKSA 4BY1J 3J81Z 5C2DA 2NLXA 2PZSA 2GXBA 2IRFG 3HVTA 5D5VB 3MXJA 4A3JJ 4JX5A 3BG7A 3AVAA 2Y48A 1FJLA 4Q4ZF 2ZXHA 3UKUA 2VBWA 2IA0A 1S72I 4MDBA 2QQ8A 2OYQA 4Q47A 1KVAA 5GP9A 3OY9A 3IH3A 1SAZA 1F36A 5GTIC 1W2BM 3H9QA 3LMMA 1ODDA 5E8IA 5AQYA 4X0GA 3EZWA 4OJRA 5J6XA 3E7LA 3VQ7A 3GTMJ 1WWXA 3S15J 2JPCA 2ZNYA 4AC0A 1SL2A 5IT9O 2HZTA 2QSGX 3BR1A 4FLZA 3WTXC 1O3RA 2MSYA 3KWIA 1Y1VJ 4AHUA 4AHSA 3VETA 1M1EB 1N5YA 2WAEA 3NE6A 2BV6A 3RPUD 3OV8A 2UYTA 1P90A 2G7UA 4Y4RA 5FPEA 4FZXC 4GYGA 1T6CA 1K83J 3COAC 3EY1A 4WQ5A 2HKXA 3H0DA 1BR2A 1YQAA 4Q5SF 3FGUA 3GMEA 2WUSA 3ZMSA 4DHYA 4AHCA 2RNGA 3MKWB 4QSHA 3RR8A 5AQVA 2GBZA 2ITGA 3BDPA 2BTFA 3GW2A 2KL4A 3U2RA 2CGLA 2OANA 1RBRA 4BR0A 3AVIA 1UB9A 2A41A 2DFEA 3V9ZA 1R4MB 1F9NA 5IP7J 4H0XB 3OYHA 3ASNH 5C4XJ 3PX6A 3EYZA 4CIEA 3CCVN 2QGUA 2O5RA 5DM6L 3HBLA 5HDKA 2XKPA 3WE3A 2NVYJ 3I56I 1NGAA 3CTAA 2LBFB 2E2IJ 2CSOA 2ISYA 2O8KA 3FBIB 2GAUA 2FLOA 2V51B 3GF2A 4PZJA 4KIFA 2O8DA 1QRYA 2LSOA 2JSPA 1HLUA 3AVHA 4XKVA 2O6GE 3AAQA 1E3HA 1DTTA 3O9RA 1VFCA 3EEQA 4I2OA 2Y2ZA 4HUEA 3ZT0A 2Z1IA 2DPDA 1FT9A 3M07A 2JVGA 4WXDA 4XH4A 1ITGA 4GVEA 1GHCA 4MLHA 5GAHJ 1X3NA 4E1MA 1ZG5A 5L3EA 3CMYA 3LNQA 4G8XA 3SUQA 4N9HA 4Z4FA 1N36K 3HXLA 1MDMA 3PIPL 5CVRA 1MD0A 4JKDA 5K5RA 2DDAA 2A1SA 2QWRA 3ROUA 1MU2A 1ATRA 3MX5A 3MWMA 2L7ZA 3RZDJ 1VQ5N 4RCHA 3D0PA 1XCVA 3E0JB 1JL2A 1ZBFA 3ZPLA 4NO7A 3O5BA 3DKYA 4O3MA 4KH5A 4B44A 5B66C 3GTJJ 5BN9A 2CH0A 2NOGA 4J8FA 3BG5A 3JRBA 4HV5A 2MH2A 4BR2A 1D0ZA 4KIBA 1HBXG 3G71N 2HQRA 4KDPA 2E1MC 2IP2A 3BG3A 1QSSA 3IAM2 4CD1A 2DBBA 2FMLA 4BRPA 2D1HA 2M4KA 4FW2A 1QNTA 1OJLA 1NM1A 5M1PA 2A3SA 2M45A 3QU3A 2P51A 1S1UA 2XPWA 1KVCA 1OH7A 2XF5A 2BE2A 3G2BA 1ATNA 1X19A 3J7YJ 4U88A 1IH7A 5FFZA 4L0ZB 1BM9A 3LM2A 3SJJA 1XSDA 4QAGA 4CICA 1HKTA 5AZJA 1HRHA 4DSJA 2ZE2A 2ZXWH 4IHSA 5LMUK 3AVJA 3HB9A 1DKGD 1NH3A 4O8KA 3SK3A 3BY5A 3H0GJ 2VONA 1W9HA 1H8AC 1WBDA 1BA5A 4V19K 4IF4A 2HZDA 2E6MA 5JVGL 2FF3B 3A5OC 2ELKA 4C8OA 2M0CA 3U3GA 4L9TA 1LDKB 4JKGA 1ZYRF 1I5ZA 4WF9L 1EV7A 4UVCA 1VSKA 2P9LA 5L3BA 1HNIA 3RYPA 3HRSA 3SZ2A 4KITB 1ZBLA 2L3DA 2PMHA 3L9FA 4ILJA 4DG1A 1RDDA 4KNYA 4M41A 5FPMA 3QB0A 4JYKA 1WJEA 3OTOK 4ZDLA 1STZA 1GXPA 3CCQI 5BRHA 1IDYA 3VEOA 4JK1X 1EP4A 3KP7A 2GA2A 3H6EA 1OISA 4JK8A 4FJIA 3Q7CA 1W36C 3A5NC 1X58A 3EO3A 1YIJI 4G9YA 5BS6A 2ME0A 4AM6A 1R7JA 1PUEE 5CHIA 4I6ZA 1B92A 3TI0A 1VQ4I 1B1BA 2EA4A 3LDOA 3OYCA 4GW6A 5F64A 5ICCA 3K1MA 3P1GA 1JGGA 4BR5A 2QEXN 1TK5A 3KP4A 2PMZA 4OKJA 5KTQA 4XLNF 3IWFA 4QLCU 5HNFA 4HLYA 5KQDA 2DOAA 5BR8K 5AONA 4OKKA 2CW8A 3CLOA 2H8WA 4V19S 2E88A 1WJFA 3LDNA 3HDDA 3RPQA 1AOYA 3TU5A 3ERED 4BHPA 4CYCA 4KYWA 4ILHA 4CO8A 1SVOA 4FWOA 1WI3A 2XRLA 2FUG2 5JFRA 1F5TA 2AP1A 2H09A 3CJRB 1YOVB 3F21A 3OYDA 4KO0A 1BHLA 2MD5A 3HI0A 1WH5A 1ULYA 1VRTA 1ON2A 3MN2A 3PSIA 3QU6A 1JKRC 4FXDA 4ELUA 4RW6A 1J75A 1T3VA 4ISEA 3CPEA 2F7TA 4NC8A 2ZBKA 4IKFA 3M8EA 2HYFA 2Q1ZB 2O4IA 2OTJI 4KV8A 5KK1A 2E1CA 2HXOA 1X1PA 2F9WA 4HTLA 4ZYDA 4CHNA 3K58A 2BEOA 3NBPA 5LL6Z 3OVNA 4LFUA 4LJZF 1VSIA 2VQFK 2ZCWA 3BP8A 2X1CA 4RW4A 2VE9A 1R5ID 2IGIA 3LPTA 1RDAA 1NGHA 3HKZN 4MO7A 4FJ8A 4DB3A 4IFYA 4IFVA 1UOCA 2VPRA 1MBFA 3WQTA 2EFPA 2W82A 2FOKA 4CJWA 3MMVA 4QOZB 5CZ1A 3FX3A 2VGMA 4DV0K 3DLKA 2O03A 1SAUA 2W4SA 2GOXB 4G12A 3NH1A 1K79A 3CLQA 2X4HA 4E3SA 1VNDA 2KDOA 4UUSA 3R4KA 1N78A 2V4JC 1QHHD 1G3SA 1JXSA 4AIHA 5KRTA 3SCXA 4RM2A 1RT1A 4BR7A 3E9LA 1HQUA 2DOEA 4A0YA 1MNMC 5LMNK 2Q3SA 3MECA 4DYRA 4UNOA 1HKSA 1M90O 1S5JA 2OU2A 1K73O 3RRGA 2O8EA 5KQ8A 3DEWA 3ZOBA 3DTKA 1MA9B 4IO9L 1HQCA 5E3MA 1CZBA 1J54A 5CY4A 4CF9A 3KLOA 2RKIA 3KWGA 2H8RA 5LGNA 3RQ4A 4FWPA 2AXLA 3R0JA 1J59A 3HOUJ 4EATA 2GQQA 1WH7A 1ONVA 1XGSA 2M3AA 4I01A 4ZYHA 5T7BA 1RTDA 4XRSA 3QIOA 1D9FA 2GX9A 1OPCA 4FYDA 2JRTA 4FW1A 2R4GA 1H88C 3LL3A 4MDAA 5LHIA 4CDGA 1XPXA 1W0UA 4WYBA 3PFYA 1YJ9I 3AVNA 5TRDA 4BDPA 4YFKF 2QWMA 1OKRA 1OVQA 5B3SH 4G7HF 4M72A 5DTDA 3H5NA 4A5NA 3CMMA 3DV8A 3C6AA 1QVTA 3UKRB 4M3XA 3HRGA 3OOUA 3O1BA 1RFQA 3HYIA 4BU2A 3MN6A 4AQYK 4FWKA 3GZ6A 1RR8C 2F4IA 2XVCA 4U0YA 5K5OA 1I50J 1Y0NA 4LG3A 3TEDA 2L9RA 1HKQA 2KQ2A 4KHWA 1BIZA 5DS9A 1Q1HA 1Y64A 3L6QA 3CDIA 2O8FB 3NQOA 3SQ0A 2FNAA 4H5WA 4ZZDA 3BZCA 3Q9SA 4L5JA 1I39A 4PKHA 4V2GA 2ZFUA 1FOWA 3KLNA 3MKYB 5H20A 5GPCA 3FK7A 4HSTA 4XLAA 2QQAA 1V3FA 3LP1A 2WA0A 5FJ8J 3T1AA 3PNVA 3ZCOA 3NF6A 4LLNA 2HVIA 3K1NA 2DI3A 1Z0XA 1QZ5A 4LH5A 2XO7A 4M3EA 3K9JA 1KONA 1N75A 3ZX3A 1YW9A 2E34A 3DI6A 2A3ZA 1Z77A 1REPC 3KLHA 1KXPA 1LFUP 2PX9A 3KK1A 3C7NA 1LW0A 4BQAA 3LAPA 2JZYA 1B9FA 2CUEA 4B4CA 2BXYA 3IH2A 2FJ1A 4Q0BA 2XUBA 4WK8F 1P8ZA 3JXUA 3DU5A 2ZGYA 2H3GX 3P31A 2P7VB 5DM7L 4CF8A 4N4OB 3ISPA 1PP8F 2G8VA 3WU0A 3CCEN 4PJNA 1ON1A 1W7PD 2KIMA 1FP2A 3HVRA 1KFDA 4WQ4A 1ZREA 3V7SA 4C8KA 3FR0A 1BI4A 2VOOA 4CUGA 3CCSI 2ASMA 3TAQA 3AKZA 4O5BA 1IC8A 4PWDA 3V1OA 3PIOL 1YS6A 4RGSA 2JUGA 1E3MA 3QEXA 2Y30A 1WJAA 5AQXA 4RB3C 3BJ6A 3A0BC 3S2WA 4ENKA 3RMBA 3OYBA 2DTZA 1JLBA 3BOQA 4A0ZA 4HEA2 4ZYEA 1CF7B 2P9UA 4BE0A 2EV0A 4BC3A 4ZYAA 4N76A 2LMDA 4XLCA 2DA3A 5ILUA 1WGXA 5BREA 2KRFA 1ATSA 2CW0F 1B9DA 1SMTA 2IJLA 4DV3K 5D5WB 4NC7A 1NK4A 3J7ZO 1R36A 2WC9A 1A5WA 2Y1JA 3I53A 4CIFA 5M3MJ 5BQTA 1U78A 2HB5A 1JJ8C 4JP0A 5FLXZ 3P7NA 2DK5A 2HNDA 4M3RA 3B02A 1Y97A 4DTSA 5D6EA 3KD1E 1S6PA 4M3GA 5F04A 4II3A 4FQGA 1QVUA 1TP4A 2VJ4A 3QRFF 2BBYA 3ZQCA 1PUFA 1K7AA 3CJBA 1X3UA 3KD5E 1C0WA 3LAJA 4FK4A 3WG9A 5E17F 4AYBA 3A2KA 1QS4A 1ETKA 3VYUB 4PHTX 1E0EA 2A61A 4M9XA 3P83D 2M30A 4JI0K 3ZX0A 2QTDA 3DJCA 4PKIA 4OPJA 1UHMA 1U9NA 1YFHA 1XC9A 4W5NA 4JS4A 3KEYA 2XSJC 3REOA 1VQ6N 3SEZA 3TOBA 2HYJA 3HPOA 3JAMZ 4BRQA 4DTUA 5FD5A 3PQJA 1NWKA 1YUWA 5HVQC 2GV9A 2XY5A 1MJ9A 2E71A 4B9QA 4BEHB 5GIPA 4RLFA 3DLHA 1E4GT 1NU0A 2HHUA 2LNBA 4ENNA 5AQSA 2L7MP 3MCAB 1OCPA 2LLKA 4P9UA 5LEJA 2EILH 4OAYA 2X85A 4LF6K 3QBXA 1IN5A 3ZQQA 5KPRA 3S2DJ 4CYDA 4EHUA 5KGXA 4IXAA 2EV6A 1OR7A 3VESA 1IXCA 2P4WA 2Q97A 3OIPA 3CM6A 3RTRA 4LFBK 1TT0A 1J5EK 3EPZA 2R7XA 1K78B 1HW1A 3HHHA 1LWFA 4WFBL 1HNVA 3EZ5A 4KHQA 1WBBA 1X9JA 2PJRB 1IJWC 4D5FA 4RS8A 4EV0A 4BBRJ 4HTUA 3JSOA 3F6OA 5E1ZB 3DLEA 2E1MB 1QVGM 3F6VA 4CBUA 3GUDA 2A69F 2V1XA 2FQ3A 2E35A 2KQRA 1W4MA 4B3SK 4CEEA 4XOPA 1V55H 2GBYA 1TWHJ 4FLYA 1I3QJ 1IDZA 3CJ7A 2VUMJ 3DXJF 2IXSA 4IHVA 2KJCA 4NYNA 1Y6IA 2BY3A 4KUMA 5DDGA 2LBFA 5B1AH 1SL0A 2XF6A 4CHPA 3D5RC 2DQLA 1VF9A 1Q81O 2IS3A 2HU9A 4DZJA 2R7WA 3HP6A 1TKTA 3ENHA 1B6AA 3TO7A 3ABLH 9ANTA 4H0OA 3K5MA 1NJXA 2BY2A 3C94A 4FVMA 3LSMA 1HKGA 3O3HA 1IG8A 3E5XA 1OCTC 2CW7A 4KB1A 3BG9A 3S8PA 3FZKA 3SJHA 3LSRA 1Z7LA 5BPNA 3VODA 4NC6A 4ISGA 3FMQA 1HSJA 3J7YP 2HDWA 5LLQA 5EYRA 4MFBA 3SFZA 4DR2K 1UCRA 1NG7A 5KPZA 3P5JA 4JRQA 3DBLB 1Q86O 1NK8A 2PMUA 3LDSA 3F72A 1MMAA 5M1KA 4Z4GA 1GUUA 4M3UA 1S9HA 4EAHD 2MGQA 5TKWA 2RQQA 3IKMA 4CGHA 4ISFA 5D8LB 3JRHA 4A12A 1YTUA 1X2NA 2HTJA 2FQ4A 3S32A 2IVOA 3TTFA 3F9MA 3PNYA 3R1XA 1E3PA 3L3UA 2ZJPF 5HRNA 4JRPA 3OS1A 2F48A 1VQLN 3T1YK 3AG2H 1R23A 2QWWA 1JLEA 2ETJA 4LLGF 2IS4A 5DUKA 1X4PA 2GWJA 5BPIA 4AHTA 2Q8KA 4FLUA 2HR3A 4BQOA 2HDDA 3RVCA 4FJ9A 4BNCA 4A5MA 4DQQA 2ITMA 1R1VA 1T7PA 1Q7YO 2LY9A 3E3VA 2LD5A 1T44A 1WSIA 1M1KO 2D1VA 1Q9XA 1RI7A 1KQ9A 4UB8C 1ZGJA 2BHYA 1TGOA 4CZHA 3GE1A 2M2EA 1T95A 2HNYA 3GLLA 2FEZA 3O6WA 3ZP5A 1MSFC 4DW6A 3QPTA 2DMPA 1JCGA 5B5EC 2ZMEA 3QAHA 4BRAA 2O7OA 5DCMB 2L4AA 1C0FA 1DDNA 2Q36A 4IOXA 3KP5A 4CGIA 4DKWA 3TOAA 4J2BA 1WSEA 2OD5A 5I3UA 2XC7A 3BTCA 1SS6A 1V4TA 4PJLA 2RDPA 3HPHA 4XSZF 1V54H 3L2WA 1L3SA 3V9UA 3CDLA 3WTUC 1J2XA 1TK0A 4OPAA 2ZC2A 2E7XA 3MQ0A 4CZKA 2Q2RA 1GLFO 2P1JA 1TBXA 3P39A 6PAXA 2CUFA 4FM2A 1S1VA 4FX4A 3RSNA 2FC0A 1LFBA 3KIOA 3K1PA 4KJZA 2XY6A 1FYMA 2CG4A 4YOUA 2KZZA 3P4IA 3CCMI 4XN0A 2P9NB 4I7HA 5DD4A 3V4IA 4E7SA 4Y13A 1ZBHA 4FWRA 1BI2A 2G0EA 2M9HA 2E1YA 1OCCH 3A5LC 1T98A 4EJTA 5H1SQ 3VTHA 5J4YA 1XUPO 4CEOA 1WSGA 4KHPK 1FWZA 3LOCA 2PQ8A 2VPLA 1RT2A 2ELHA 4OX9K 1LW2A 5AQNA 3OR2C 4GKKK 1KLNA 5J2QA 2NRXA 4XM3A 2Z1DA 3D45A 2GIVA 3KP3A 4AVPA 3V9WA 3HTVA 4H0YB 2W84A 1HMVA 3O9SA 3NRVA 5F0XA 2G8HA 2UUZA 3ZSRA 4OINF 3ZSZA 2WWYA 4ZZLA 3FK6A 3G10A 5CQGA 3KLGA 4NHJA 4F92B 2R7FA 2O3FA 2DMUA 4BY9C 1YIOA 4FX0A 3LANA 2OC6A 2JPBA 4IJAA 4PGGA 4BDZA 1R1TA 4XICA 2E2QA 4CZEA 3UNGC 4XORA 5E41A 2QYOA 3FWEA 2EB7A 3VQCA 1OYYA 4PJJA 2ADUA 1J6ZA 2NZTA 4MO5A 1OCZH 5HP1A 4G7OF 1RETA 4DR4K 2A05A 2EIMH 1OH8A 1SMYF 4BG8A 1A36A 2KP6A 4A3EJ 3U9GA 3GTKJ 4BC4A 3SEQA 4B9NA 1UJ8A 5LFAA 4A0XA 4AIKA 3EETA 3H1CA 3WUHA 4CZIA 1IAWA 2CUJA 2AHQA 1ETOA 3IH4A 3HSCA 4EFHA 2EPFA 2KIUA 4RB1A 1D1BA 2EK5A 1J9AA 1U2WA 3AVBA 1BN5A 4W5RA 3CC4N 5CKTA 3HRUA 3TDZC 1FXXA 3V1QA 2XAHA 3DEEA 4B3AA 2RPIA 2PFBA 3QPLA 2ME6A 2X48A 2Z1HA 4EMSA 3K4NA 3PM1A 1XSVA 2Z9OA 3VN5A 4BXUA 3O1WA 4LG0B 1POGA 1BW5A 3SXYA 4RB2C 5H6QA 1K8KB 2F8TA 3ZQGA 2P7CB 1G6NA 1KU7A 1FTZA 3T8TA 3V4GA 2NRVA 1DUXC 4IXCA 3DOLA 5KPTA 2Z99A 2A42A 3NGIA 4TV7A 3THXB 2K9MA 3K9TA 2DTUA 4CEQA 3GOIA 1S8NA 1ERDA 4WCGA 3JRIA 2LOOA 4N9IA 3MWTA 4X66K 2KKZA 4KH4A 4U87A 2E2OA 3G3ZA 1RDBA 3AAFA 1NJWA 4G6QA 3VEZA 4JKBA 1Y8QB 1T6DA 2GTDA 2V7ZA 3CFRA 4CJVA 3JTHA 1LVKA 3NCIA 4O55A 2IVNA 1R58A 4NCGA 4XMYA 1LE8B
chains in the Genus database with same CATH topology
1IKVA 3OYDA 3L3VA 2YHAA 4KO0A 1VSDA 3QEVA 3RMBA 4AHCA 4AHTA 1BHLA 3NF8A 3OYBA 2HMIA 4FJHA 2B6AA 1JLBA 4FLUA 4QCLA 2OPPA 5CZ2A 1SV5A 1VRTA 3ZSOA 3RR8A 4BE0A 2GBZA 3DM2A 4CHZA 1ZYQA 3M8SA 1UA1A 2ITGA 4CJ5A 3BDPA 4DFMA 4B3OA 2HHQA 4N76A 4FJ9A 1GOAA 4FXDA 2Y1IA 4DQQA 4LSNA 4FZYA 1C1BA 4I7FA 1QSLA 1T7PA 2Z1JA 4ELUA 1VRUA 4CJLA 4L8RB 3ZSXA 1RBRA