1I3AA

Rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i3aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i3aA01
4DFKA 4CF8A 1X9SA 4ID1A 2X6NA 2A1SA 4CFCA 3OYBA 4B3OA 1B9DA 3C6UA 3KD1E 4CF1A 4CHZA 4B9MA 3D45A 4JS4A 4OGEA 3K58A 4BWMA 3OYNA 3LDSA 1YT3A 4M3XA 1S1VA 1SL1A 2D5RA 3HPHA 3NGZA 3VQAA 3T3FA 1HPZA 3QINA 3IAYA 4B9TA 4BACA 3RMCA 3RRHA 1DLOA 4E19A 3DM2A 3HO1A 5E41A 1U45A 4DS4A 4E3SA 3HM9A 3ZT1A 3K5NA 3LZJA 4JRQA 1RBTA 1S1WA 4H4OA 1NK6A 3QO9A 4CJUA 2G8FA 3DLBA 4DQQA 2KZZA 1VSHA 2RPIA 1RILA 3VQ7A 4DTPA 1NJWA 1VK0A 2KQ2A 4B8CA 4FM1A 3HVRA 2FBVA 1KVBA 1RDBA 4F2SA 5FRNA 4DF8A 2FC0A 1QE1A 3ZT2A 3NDKA 1WSFA 5I42A 1X9WA 4FJ8A 3OYKA 4DU3A 3L3UA 3SQ1A 2FBYA 3HK2A 2ITGA 4Z4CA 2D0BA 1NJYA 3KTQA 4RG8A 4DTMA 1S1XA 2KZMA 4DSIA 4FLWA 1DTTA 1VRUA 1WAFA 1UA1A 4FZYA 2KTQA 2JLEA 3JSMA 1VSJA 2GUIA 3EYZA 3V9ZA 4O55A 1FKPA 4OVLA 4FJ5A 3RRGA 4Q0BA 2YHAA 2X6SA 1RTJA 1TL1A 4CJSA 1VSIA 4W5OA 3O3GA 3VA3A 1L3UA 4IKFA 3AO4A 2B5JA 4LSNA 4DTOA 4OJRA 1ZBIA 1Z25A 3OYEA 3OYIA 4FYDA 1RTIA 2R7YA 3ALYA 3OS2A 4KPYA 4KHYA 1ZYQA 4FK4A 2HVHA 3QEPA 3NBPA 1S6QA 4CJWA 4QCLA 2XRIA 1G15A 1QTMA 3VQ6A 1C1BA 4NYFA 4OGCA 3MEDA 4DQPA 4E89A 4F8RA 3VA0A 4CEAA 4DQSA 3TARA 4KFBA 4Y1DA 2KW4A 5KTQA 4FLTA 1NK5A 2PY5A 3K59A 1HJRA 1YTAA 2YKMA 5C25A 1QS4A 1R0AA 3P83D 5CZ2A 2HHVA 4IG3A 4CJVA 3KLGA 3ISNC 1ITGA 4RW9A 4CHYA 3DRSA 1D5AA 4KTZA 3K57A 3HXMA 2YKNA 4CF9A 3LP3A 4FJ9A 2YV0X 1VSFA 1ZBHA 3NF7A 3SUOA 3RMBA 1LW2A 4M3YA 3OYAA 3NFAA 3B6PA 4CJEA 3MEEA 5HP1A 4AHVA 3RWUA 3L2RA 1TL3A 3SYZA 3ZT4A 3OYJA 4FLZA 5HBMA 4DTNA 2X74A 4QOZB 4B9NA 1QQCA 4J2BA 3HSTB 4GVMA 4FJHA 1JXEA 3L2VA 1VRTA 2IS3A 4CEFA 3DI6A 1T03A 3WNEA 2Z1IA 4YNQA 3L2WA 4PY5A 1TV6A 4W5QA 1SUQA 1RBSA 1S1UA 4CERA 4CEQA 3CFRA 4CGGA 1D8YA 1BCOA 2QKKA 3ZSVA 4GMJB 4HHTA 3QNNA 3LZIA 4FM2A 3LPTA 4H8KA 1KRPA 1HNIA 4BDZA 3KLEA 3O4NA 3VQBA 4N41A 2D0AA 1EX4A 3VQEA 1HRHA 5J2PA 3QEWA 3RMDA 3NH1A 3MAQA 3AA5X 3V1RA 4CK1A 4DTUA 4B9LA 4CIFA 4IFYA 4ELTA 3S9HA 1BQNA 2YNFA 5KRTA 1RDAA 4CJRA 4DTRA 2OPRA 3L8BA 1RT2A 3VQ4A 2HHTA 3C6TA 4IBNA 3L2UA 2OYQA 1X9MA 3VQPA 2KFNA 3PUFA 4DLGA 4FCYA 4NYNA 3QESA 4HUEA 1GOCA 3TAEA 1NOYA 2OA8A 2DFFA 3DOKA 4CK3A 1NK7A 3BDPA 1IKXA 1RTHA 3OY9A 1JLBA 1UOCA 3SUNA 4CIEA 3HT3A 3AA2A 3CQ8A 1L3SA 4EZ6A 1IKWA 4FLYA 1JLEA 1A5WA 3AA3A 3HYFA 1QSLA 3ZSQA 3I8DA 1T8EA 2HHWA 4M45A 3AO5A 4BE0A 3KJVA 2B6AA 2VWKA 3OYHA 4DSFA 3VN5A 4CEBA 4GW6A 3G10A 3ZCMA 3LP0A 3SV3A 1JLAA 1HYZA 1U4BA 2G8VA 4Q5VA 3CFOA 2RN2A 1IH7A 4C8OA 5FROA 3B6OA 3V9SA 2VG6A 4ICLA 3HP9A 3U6FA 4ZTJA 1WSEA 1J53A 3IRXA 4CGIA 4FK0A 4DFPA 3QETA 1YVUA 4F4KA 2RF2A 4KHQA 4M3ZA 1Z26A 1D9FA 4DSEA 4KO0A 1HNVA 4EP4A 1D9DA 3VQ5A 3PX6A 2G8UA 1U48A 3TWHA 1XHZA 2ZE2A 2HMIA 4J2EA 4OKJA 4XIUA 3SV4A 4DU1A 1CXQA 4O0JA 2Y1IA 4DSJA 4NCAA 1O1WA 3NF6A 2G8WA 2Z1HA 2KFZA 4Y1CA 3DLGA 3AVIA 2HHXA 2YNIA 4KV8A 5HROA 1A5XA 3SQ2A 4HCBA 5HRRA 4R5PA 1RBVA 4DG1A 1QHTA 4RW8A 1UAXA 4HTUA 3M8RA 1NK0A 5J2NA 4B9SA 4OLBA 4C8NA 1VSEA 3HP6A 4L8RB 2G8IA 3KK1A 1JLGA 1HMVA 3O3HA 3PO5A 4FXDA 1KCFA 4CESA 1XI1A 5CYQA 4AHSA 1NK4A 2W42A 4IDKA 4CIGA 3S3NA 2P1JA 2DY4A 4DWIA 3E01A 3ZSOA 3OYCA 4K8ZA 1RT7A 1SL2A 3DOLA 3ZT0A 4FW1A 3DYAA 4FLUA 3SZ2A 3QEXA 5CZ1A 1J5OA 1BI4A 4KTWA 4CGJA 1C1AA 4CCHA 1HQEA 1U47A 5SWMA 1VSLA 1J9AA 1CZBA 3LAMA 4JS5A 3S3OA 1BIZA 1UA0A 1NKEA 3AA4A 5FRMA 1BGXT 1N6QA 3AVKA 1MU2A 1KLMA 1ASVA 2OZMA 2OZSA 4LY7A 2P51A 1X1PA 1UWBA 3ZSXA 4E7HA 4LH4A 1RT6A 1TK0A 1Q8IA 4DFJA 4M41A 1RT3A 1GOAA 2IDOA 1XHXA 3AO1A 1LWFA 4FJMA 1SKRA 2F8TA 4LSLA 1REVA 3U3YA 3L3VA 1LAVA 1NJZA 2VG7A 2P5OA 1BISA 1IKYA 3VQCA 3ZSYA 4HVJA 4FLXA 3WNGA 4DSKA 4FJJA 4IFVA 1NKBA 3H08A 1NJXA 4F2RA 3AVFA 1WNSA 5HRPA 3KKRA 2O4GA 2E6LA 2F8SA 1IG9A 3HJFA 2FBTA 1ASUA 3PV8A 1NOZA 4PQUA 3MXJA 1ASWA 1C0MA 1RDCA 4M3WA 3RR7A 3NE6A 4DTJA 4FJIA 1KLNA 1LWEA 3CM5A 4QAGA 3I0SA 4KHWA 4FZXC 2QKBA 4CEDA 3AVMA 1HQUA 3EZ5A 4KTQA 2HNYA 3QNOA 1JL2A 3LPUA 3DLKA 2G8KA 3SNNA 1BHLA 4M3TA 3OYLA 4KREA 4CJKA 1N5YA 5J2MA 4CHQA 4O5BA 1RT4A 3DRPA 1ZBLA 4FJXA 3IS9A 1KSPA 3AVJA 4AHUA 1WLJA 3DLRA 4KHUA 4OLAA 1S9EA 3AVCA 4CEZA 5SZTA 4N76A 1WN7A 1JLFA 4ID5A 2QK9A 2EX3A 1C6VA 4IG0A 2ZD1A 3DLEA 3MECA 3ZSRA 4BWJA 3M8QA 1EKEA 4AHTA 4CJPA 2GBZA 1KTQA 3NGIA 5J1EA 4PUOA 4LD0A 2X78A 1NKCA 1KFSA 3AVNA 2WONA 4AHRA 4DS5A 3DMJA 1WSGA 2DFHA 4CFAA 3LWLA 4FLVA 4CGHA 3O4QA 2BANA 2Q3SA 5J2QA 2QXFA 2PZSA 4NCGA 4J2AA 4E1MA 1CXUA 2IC3A 2WOMA 4Z4HA 4DTXA 2PYLA 3WNFA 4Z4FA 2VG5A 2IOCA 4UQGA 1TGOA 1L3VA 3TR8A 1IO2A 4C8MA 4CEOA 3MEGA 3SQ4A 4DTSA 5FDLA 3K2PA 1T7PA 3AVGA 3DRRA 3F73A 4OPJA 2XY5A 3SCXA 3PY8A 4C8LA 1IKVA 1KVCA 3VQQA 3ZSZA 4FW2A 4FK2A 3ZSWA 3KK2A 3KLIA 1KFDA 1TKZA 1FK9A 4CJ3A 1SKSA 3OYDA 2XHBA 3DLHA 3M8SA 3VQDA 2HNZA 2XY8A 2XY7A 3OYGA 1U04A 3T19A 1LWCA 3THVA 3RTVA 4DU4A 1YTUA 2F96A 1QSSA 1S6PA 1EP4A 1C0UA 1WSIA 1WSHA 2YHBA 4DMNA 3ZT3A 1BCMA 3V9XA 3NF8A 1RDDA 3VQ8A 3V4IA 2HNDA 3TAQA 3KLFA 3OYFA 3V1OA 3F9KA 3OJUA 4M42A 1LW0A 2YNGA 5KGWA 5K14A 2IGIA 3TAFA 5HRSA 4O0IA 3LAKA 1W0HA 3LP1A 4FVMA 1RT1A 3OS0A 3SUQA 4KB1A 3K5MA 3SPZA 1JL1A 5CY4A 3TAGA 2G8HA 1TAUA 1BI4B 1W9HA 1QSYA 4H4MA 3BGRA 4BDPA 3KKSA 5C24A 4ZHRA 4KHSA 4Z4IA 2HHSA 4CE9A 3OS1A 4RW4A 1L3TA 2GV9A 4MQ3A 4CECA 4N56A 4CF2A 2ETJA 2HVIA 3V9WA 5DMRA 2D0CA 4TSXA 3L2QA 4CK2A 3OJSA 4E7KA 4AILC 3HPGA 2ATQA 4N47A 3ASMA 1TKXA 1RNHA 4PWDA 2P5GA 1RBRA 2OPSA 4O4GA 2HHQA 5D3GA 5KRSA 4CEEA 3SQ0A 4ELVA 1JLQA 4CHOA 4FJLA 4B8AB 1I3AA 4WE1A 2Z1JA 3HVTA 3CYMA 3SJJA 1Q9YA 4C8KA 2PYJA 1TKDA 2OPPA 4DLEA 1U49A 2A1RA 5JS2A 4FZZA 2EHGA 3LP2A 3RR8A 1C0TA 1WAJA 1LAWA 4DQRA 3K5LA 3V81A 4CFDA 3QERA 3CFPA 1HYSA 1Y97A 2DTUA 4CGFA 4BE1A 1VSDA 1T05A 4NCBA 3PX4A 1HYVA 5HLFA 1L5UA 3MXMA 4EP5A 2HHUA 5C42A 3TANA 3AVLA 1F21A 1TK5A 3RMAA 4CFBA 4Z4EA 4AH9A 1FXXA 1CZ9A 3NGYA 3ITHA 3EY1A 1I39A 2DFEA 3C95A 1TVRA 1TKTA 3S3MA 4FJGA 1C1CA 4I9QA 1RTDA 3HPOA 4MFBA 1KVAA 4CF0A 3TAPA 4DQIA 3TABA 1TK8A 4ELUA 4CGDA 4B9UA 5HRNA 4EZ9A 3KK3A 4CHNA 3LWMA 4E7LA 4DFMA 3P1GA 3SUPA 4E7JA 4I2PA 1SV5A 3KLHA 3VQ9A 3MXIA 4HCCA 2BGGA 4W5NA 1A5VA 3NHGA 3WNHA 3AVHA 1WSJA 2O4IA 1B9FA 1RBUA 4CJQA 1RT5A 1NK8A 2BE2A 2Z1GA 2IAJA 1S5JA 2FBXA 2E4LA 3CG7A 4CJ4A 3NCIA 3C94A 3V1QA 1XC9A 4BE2A 2XO7A 3U3GA 1S9GA 3NAEA 4W5RA 1BQMA 3KIOA 3G0ZA 1BIUA 2E6MA 4OKEA 1XWLA 4Z0UA 4K8XA 1JXBA 4E1NA 4FJKA 2NUBA 1RCHA 4E0DA 5CYMA 5DK5A 4YFUA 1CLQA 4O44A 4CJTA 1ZBFA 4F3TA 4DF4A 2B4JA 3AVBA 4OPKA 4J2DA 4KRFA 4ZTFA 4CJFA 3A2FA 1TAQA 4N5SA 2YNHA 2Y1JA 3M8PA 4HUFA 1JKHA 4HUGA 1GOBA 4KB0A 4CJLA 3TI0A 3IG1A 1BL3A 3P5JA 1VSKA 5JS1A 3QLHA 3K5OA 4KHNA 4FM0A 3AVAA 4RW6A 4FJNA 3UIQA 2XY6A 2VWJA 1VSMA 3TAMA 4PA1A 3NH2A 1LV5A 3JYTA 3OVNA 3QIOA 4KKOA 5EU7A 3O3FA 4B9VA 4G1QA 4DSLA 3T1AA 5KGXA 2HB5A 3CM6A 2RKIA 1Q9XA 1S1TA 4I9LA 2BDPA 4I2QA 3NH0A 1NK9A 3I0RA 4BDYA 1J54A 1FKOA 1EXQA 4I7FA 5I3UA 3QEVA 1SKWA 3HL8A 3PO4A 4B08A 4CJ5A 5T7BA 3PX0A 1B92A 1EETA 1K6YA 3AO2A 4LH5A 4KI4A 4KI6A 3D0PA 3NF9A 3V6DA 2AJQA 1SL0A 4E7IA 2HW3A 3FFIA 3AV9A 4OKKA 1JLCA 2JGUA 5KI6A 4FJ7A 4M3UA 2I5JA 4M3RA 3QEIA 3LANA 4AHCA 2OPQA 3AO3A 1ZBUA 3LALA 4W5TA 4JRPA 4JLHA 2ZQBA 3ULDA 3V9UA 4RW7A 3OYMA 3SI6A 3KD5E 4KAZA 4Z4GA 4CHPA 3QIPA 4F3OA 3SPYA 2LSNA 1DTQA
chains in the Genus database with same CATH superfamily
3FBIB 5H20A 4XORA 2R7QA 1U5TC 2FMLA 1E3OC 2XAGA 1KQSM 2XAQA 4PKHA 4L9VA 5EXWA 2FD5A 4CH7A 4DTPA 3E6DA 5IT9K 1XD7A 2X1EA 1VQ5N 3ABKH 2KTQA 2GIVA 5M3MJ 3G6EI 4IKFA 3VEPA 4QS8A 2EPFA 3K4MA 4YOTA 1FOYA 1G15A 3HKZA 2HDWA 4E89A 4A6DA 4YRVA 2QKLB 5F0XA 1PJRA 4FETA 5F1RA 2QTDA 3WTYC 3THWA 3E1SA 3D7EO 3HSEA 4MDBA 4HSRA 2YX6A 2BE5F 4AHVA 4XLFA 1KA8A 4B9NA 3D5LA 1T08B 3V7RA 3L2VA 4DBQA 1YQAA 4PGGA 1VTNC 3CCJN 1KRPA 2LRDA 3TPQA 3UKGA 2D0AA 2HBKA 4B09A 3FZKA 2YR2A 1TYQB 4MLOA 2VL8A 3RKXA 3T0YA 4KMUX 1PYVA 1L3SA 5F0FA 3I0TA 2E60A 1A5WA 3HYFA 3H3VK 1TYQA 4FX4A 4Z6YA 2YS9A 1U4BA 3HOTA 4FK0A 2KRHA 1XN7A 2RGVA 3QU3A 3O9QA 2W24A 1YUWA 4DSJA 3ULQB 1SAXA 2E5LK 4PGHA 5EG0B 5BNGA 2KFZA 1J6ZA 3EEQA 3Q0VA 5E3OA 1BM9A 1XI1A 3JREA 3ZT0A 1IAWA 4A2UA 5LGTA 3GL1A 3S32A 2ZJQF 2VOPA 1FP2A 1BGXT 4HBLA 1IZ1A 1W5CC 4A12A 2CGPA 1Q8IA 2X4HA 4W1UA 2F8TA 2CH6A 4CCMA 4ENMA 1LDDA 3VEXA 1F36A 2RV8A 3SEQA 4HDUA 4CBXA 3LA3A 4PJNA 3ZOBA 3W6KB 3TSQA 4HG2A 4RB0A 2MG4A 3H1VX 2FF3B 3BPXA 2XAFA 1HXDA 3LPUA 1HC8A 2HI3A 5JVGL 4Y4RA 2EX3A 4IG0A 3HC7A 2HF3A 3MX2A 4CJPA 2GBZA 3G2BA 2JK3A 4XM3A 3W3CA 1X1DA 2DFHA 2MC4A 4CFAA 3N4QA 4CA0A 4C2MJ 3HOVJ 2PZSA 2NVUB 3U1DA 3CF5L 4KDPA 3DRRA 2WAFA 2EIMH 4C2TA 2F5FA 1ZKGA 3J7ZO 3RTVA 1S6PA 3D5SC 6PAXA 1C0UA 1O7FA 2HNDA 3K7AJ 4UV8A 2ZNYA 4BJ5C 4O0IA 2EFPA 2HBLA 2H8WA 4P9FA 5DCMB 4H0VB 3S2HJ 5HVQC 3FXLA 2DOFA 4CE9A 3D2FA 4MNUA 4N56A 1M1KO 5EDNA 2OZUA 3L2QA 3PIPF 2AXTC 4O4GA 2OPSA 2M0CA 1U2WA 4B8AB 3J81Z 1OYWA 2J5PA 3I55N 5JS2A 2XKOA 3SBGA 4YELA 2BGCA 5ERIA 2EZHA 1HKGA 2HHUA 1AU7A 1S6LA 2K5CA 1F1ZA 4B4CA 1X58A 1FTTA 3TABA 5IP9J 4E7LA 4DFMA 4EHTA 3K9KA 2RN7A 4GCVA 2R7FA 3QYBA 3G0ZA 1WJCA 1BIUA 2FBIA 2BY0A 2CQQA 4FJKA 3H5AA 3CCUN 2B4JA 4CJFA 1I5ZA 3FR0A 3LSRA 1OH7A 3FXUA 3VTIA 4OIRF 3T8RA 5JS1A 4KHNA 4LF7K 4RW6A 4LGWA 3H45C 2KIMA 4PA1A 4Z2YA 3FK7A 4A5MA 5FFZA 1JKOC 1MWMA 4CZZA 4EFHA 1R59O 5GADJ 2I5JA 2M45A 1J59A 1IW7F 4W5TA 2ZQBA 3HRMA 4CHPA 1HSJA 2ZGYA 2M34A 2A1SA 4IOCL 4RMNA 1B9DA 1X1AA 1YW8A 1JJ8C 2FE3A 3JRIA 3TU5A 1Y0NA 1MMSA 4C23A 3W3DA 4AC0A 5D4RA 4GNIA 4FM1A 4FASD 4NC7A 3H92A 4XRSA 4B1RA 1BUPA 4FJ8A 2GX9A 1T3VA 5FLXZ 2ITGA 2E2IJ 2GUIA 3EE9A 2EJRA 2X6SA 1X4OA 3OYEA 3OYIA 1X3ZB 3E5UA 4BRNA 3VQ6A 1QVGM 3ZEUA 2LF7A 4OO1J 1QS4A 1LEAA 3KCCA 1J7KA 1ZBHA 3S2WA 2PMZA 2V1XA 2Q36A 4DV1K 2P9UB 1T03A 2PMUA 3L2WA 4LJZF 1YOVB 1C0FA 2Y2ZA 1VQ4N 5ED4A 3IAS2 4XKCA 4GMJB 3QNNA 2XAUA 2RREA 1ORKA 4BQOA 4KUMA 1VAZA 3S9HA 4B48A 2A41A 4RM3A 5DM6F 1WGXA 4IOXA 1RT2A 2HHTA 1W5SA 3CDLA 1BDGA 2HOAA 4LF5K 2DAOA 2XGXA 1ZYRF 3W2AA 2O5RA 3A5OC 1NG6A 4GW6A 2G9WA 2WAEA 2J5OA 4ZTJA 1MMGA 4UV9A 1HNVA 3M8EA 2G8UA 4LG0B 1RFQA 4M9ZA 3SV4A 2ECBA 5FPNA 5HOOA 4G12A 2YNIA 4ILJA 2RVCA 3JRAA 1H1VA 3JTHA 2ZSIB 1GV5A 5AQHA 2AA4A 4ILGB 1WSUA 4P1WA 3BG5A 3C65A 2GOXB 3FMSA 1VSLA 3JAMZ 1KU7A 4KYWA 1X1PA 3J7YP 3E9LA 1IN4A 4HQMA 1BJZA 1JKPC 4IHWA 2WTUA 4IHYA 2LKSA 2XF6A 5EEAA 2F6CA 4F92B 1ZXOA 2CH0A 4JI7K 1KLNA 2KLOA 1TW3A 2KP6A 1FBQA 1HQUA 4CBUA 4KITB 2HNYA 1X1CA 3R1XA 3IS9A 1KSPA 3SZPA 5SZTA 4CGZA 5TKYA 4BWJA 4AHRA 3DBRB 2OQRA 3RVCA 3G1LA 4A0ZA 3CCSI 4ZDLA 5DD4A 3ZMTA 2NRXA 2GAUA 3E5QA 1RKWA 3KWIA 2I7NA 2XY5A 4FK2A 2IVPA 5JLXA 1XDSA 2QUFA 2XHBA 1OH8A 2I7PA 4BQAA 2P81A 1GLLO 2NRVA 3NF8A 5IT3A 2XF7A 3LDPA 1RDUA 3CMMA 1Y8RB 4WCEL 1Q86O 3SUQA 2O9LA 2X6YA 5LD2C 1P8ZA 1YJWN 4BG9A 3HEFA 2CV0A 4MQ3A 1BR2A 2ETJA 5DMRA 5D6EA 4B43A 5F04A 4AD9A 3HVTA 3CYMA 4DLEA 4BC4A 1OH6A 2EWNA 1JJ6C 4JKGB 3K5LA 3V81A 1HYVA 2M9HA 5C42A 3CCSN 3TANA 4Z4EA 3Q5FA 4ISFA 2EV5A 4KN7X 1UHWA 3A1YA 5BR9A 4DQIA 3ZQFA 5L3CA 3A0IX 3LWMA 2BVMA 3NHGA 1NGGA 3KE2A 3U21A 1RUOA 1P7IA 2ECCA 2IAJA 3F3XA 5D4SA 1BQMA 4OKEA 5J3LA 5IP7J 2Z5UA 5LHGA 2G0EA 3A2FA 2L4MA 1VSKA 5TGTA 3K5OA 1E2XA 4G9YA 3UIQA 4IX7A 3WT0A 2HB5A 3P7NA 5CLSA 1I94K 2KJBA 4NHJA 2V1NA 1B92A 1EETA 4DKWA 3D0PA 4BROA 2HPMA 5AQPA 3V8LA 3ULDA 1HKCA 3KD5E 2KPMA 1JUSA 4DBRA 2K86A 4WX9A 3MX5A 5C10A 4XSZF 3BEXA 4H5WA 1J09A 2VONA 4E19A 2ZC2A 1JT0A 3QO9A 1ZHFA 3HVRA 2P5KA 2VC1A 3ZT2A 1WI9A 3SQ1A 3LFKA 4RA2A 1NJYA 1V4TA 1OQYA 1FKPA 2ZMEC 3O3GA 1HKQA 3AO4A 4XIDA 2N8GA 4RM2A 4KHYA 3CC2I 3NBPA 1SFEA 3U4LA 4CXFA 2IAIA 3VA0A 4H5VA 1VQKN 2ME6A 2WY8Q 2B9SA 3KLGA 3VF4A 3R61A 4P96A 2MH2A 4AVZA 5LJVA 4X64K 1W7PB 3O9UA 3OYJA 4DTNA 4XRFA 1EF4A 3PNYA 1IDZA 2HYFA 4V2FA 2GUPA 2EFOA 2PMZN 3F9MA 1S1UA 1IBLK 1FC3A 4ON0A 1I1SA 5B1BH 4BRQA 1ETVA 2W4SA 3CUQB 4DTUA 4ELTA 4IFYA 1B9MA 4LFBK 2VKDA 1MDUB 4HX7A 3IKVA 2V6EA 4FCYA 1B6AA 3LFUA 2OA8A 3BF3A 1DKGD 2D0PA 3F8CA 4LFUA 2AXLA 2NRZA 1WBDA 1XCVA 1NMDA 2JVHA 2VWKA 1TZLA 3VN5A 3G10A 3ZCMA 5AZIA 2QEXI 3P9IA 2H8RA 3CJTB 2F4OB 3QETA 4A0XA 1Z6RA 4FT8A 1I1GA 3J7AP 3A2KA 1IGNA 1R1UA 1VZ0A 2WUSA 1CF7B 2O7OA 1S22A 1SAZA 4HCBA 3HOZJ 4AM3A 1F43A 4DG1A 4WF2A 1DP3A 1FW6A 3SFIA 3CMAI 2QM1A 2PEXA 1BA5A 4DW6A 4YOWA 3OYCA 3O8GA 1RT7A 4K8ZA 5GIPA 1BOTO 4O3MA 3ZX0A 4G6QA 2EH3A 3FHNA 3J7AO 2XAJA 4IRIA 1YXQA 3A5LC 3U3YA 4F2RA 3AVFA 1IG9A 1XX5A 3ZPLA 1C0MA 4GDFA 4M3WA 1BBYA 3NE6A 4GO1A 3EPZA 1VQMN 3K9TA 1GV2A 4RDUA 3PIPL 3NAUA 2GOMA 4FJXA 3CMEI 4WQ5C 4CW7B 2ZJ2A 4A3BJ 4PUOA 4B3XA 5KAFC 3MDQA 3IFRA 4CCJA 4OAYA 3G3ZA 2QXFA 2JWKA 4JI8K 1Z67A 1W7AA 1QVUA 3WE3A 1U5TA 3VQQA 4BR9A 3RIRA 2HR3A 3M1CA 1GLAG 5AQTA 3JCUC 4LIUA 2VE8A 3M1FA 1WJAA 4YIIA 1RT1A 3HOSA 3TAGA 5E1WA 2OPTA 1RR8C 2GV9A 5H6QA 1TQPA 2BW3A 1HKBA 4JI4K 1N75A 4CEEA 3SAHA 2O8BA 2P6TA 3KEQA 1TKDA 1JUPA 4DQRA 1ZGJA 5M1KA 4A2BA 1MBFA 3TOBA 1R22A 2OD5A 3EUHC 1S3XA 3R60A 4BC3A 1TK8A 3QPLA 3ZQLA 3SUPA 4I2PA 3ID8A 3UKRA 4D7MA 3BP8A 4K25A 3SZGA 1IG7A 1S5JA 4W5RA 1K9MO 2ZCWA 5ELZA 3H1QA 1ZGAA 5DEQA 1KU9A 1QZYA 2EWSA 1XDUA 4F3TA 2GIZA 1DT9A 4KRFA 3IP4B 3ZCOA 4B3SK 3M8PA 3IKTA 4HUGA 3E1YA 4CJLA 2LNBA 1MMDA 2RQPA 4FJNA 3BLYA 4KKOA 4B9VA 1USSA 3F5TA 2BDPA 3KVGA 3GTJJ 3WTXC 3TEDA 2KFDA 2RKHA 3FFIA 3CXCM 5J4VA 3E97A 1P9QC 1ZBUA 3OA9A 2CWEA 4Z4GA 2F4IA 4NO7A 4CF8A 3C6UA 2Q2EB 3NVMA 2Y75A 1BWFO 3CDIA 2VCPA 3QINA 2F2EA 5HDKA 3MWMA 3RRHA 3L4QA 1U9NA 3HGYA 3EN9A 3VQ7A 3M8FA 1X9WA 4DU3A 3A0HC 4ITVA 3EYZA 4FWRA 4Q0BA 2E5NA 4JD2B 4I01A 4W5OA 5BRHA 1FOXA 4OJRA 1ZBIA 2K9SA 3S93A 2M8EA 2FUG2 2CGJA 3Q3SA 3I56N 2HU9A 1LFBA 2E1NA 5JLWA 4XL9A 1MBJA 1R0AA 1HA8A 3ISNC 2DMNA 1ITGA 3QMLA 4BL0B 1CQTA 3Q9VA 5J6XA 1MNMC 2E2NA 2Q97A 1VQ8I 1IDYA 5GPCA 4AUXA 4FLZA 5AR0A 3LSPA 1E4FT 2HBJA 2NNWA 4CEFA 5EEGA 3IAM2 5K5RA 4OX9K 3CFRA 2CO5A 4BBRJ 4G9ZA 3Q9SA 1VQPN 4BDZA 1YF5L 3Q7BA 1HRHA 4B3MK 4CK1A 3LAJA 2FSWA 3LWFA 4CIFA 3M7GA 5LGUA 4DR7K 3BZKA 1HKSA 2L5QA 1VHXA 1U6GA 4YDUC 3SUNA 2B7EA 2LY1A 4EAHD 4IO9F 4X1EA 2R5ZB 4BRFA 2R92J 3GTQJ 1O3TA 3G1MA 1JJ2M 3E7LA 2WA0A 4E7SA 3CFOA 2VE9A 2D45A 4C8OA 3DKYA 4CUGA 2K4BA 2RC4A 3C18A 4DFPA 2EB7A 2MD5A 4GYGA 5JLFA 3HBLA 4ZYEA 3PX6A 2NXNB 2LYCA 4NC8A 3GMEA 5DUKA 1NGEA 3DWLE 1IXSB 1IJJA 2JWTA 4XOPA 4HWIA 3K1MA 2ETHA 1ZK8A 1HMVA 5JHFA 3TSPA 3HJEA 2P1JA 2DY4A 1XSXA 3K4BA 3DEUA 1HQEA 4NQWB 1ETYA 2LLKA 4FWOA 1SKRA 4KH6A 4ZDPA 4O5VA 3VQCA 3BTJA 1FBSA 5C44J 4BY1J 4NQWA 5HLHA 3HJFA 2VGNA 3V8KA 2STTA 2A68F 1RDCA 4BU2A 2IS2A 1LVAA 4KHWA 3I0SA 4A93J 3K1NA 1FIAA 1F9NA 1FOKA 2D5VA 5J2MA 1JLFA 2CW7A 1EKEA 1GLDG 2NRTA 2R7DA 3VYUB 1Q81O 4U7BA 4J2AA 4BS9A 4MEXF 1JCFA 3SQ4A 4Y13A 1P92A 4OOIA 1LFUP 3MK6A 4ISGA 3CJQB 1RRJA 4B3AA 2ZXHA 3AY9A 2PI0A 4CJ3A 2A5YB 1IXRC 3WTUC 3DLHA 1DU0A 3THVA 2L9VA 1YTUA 4A59A 3VQ8A 3CF2A 4UB6C 4ZH4F 2R3SA 4M9SA 3TW6A 3DV8A 1I3QJ 5LRRA 2ESNA 3K5MA 4C3JJ 4H5NA 1BOBA 1ZR4A 4TSXA 4RWTA 3L00A 1TKXA 4PWDA 1H89C 3GX4X 2R7RA 1OJLA 5KRSA 1I3AA 2XC7A 1ZN2A 2DA4A 3AG3H 3C6HA 2P9IB 4RTFD 3FLCO 1JHFA 4FWLA 4DZPA 2QF7A 1A5VA 1QRYA 5FD5A 3HOXJ 2F5VA 2L54A 3IH2A 1RCHA 1WQ2A 1GLBG 3CCEI 1UG2A 4HUFA 3LL3A 3WU1B 1D5VA 2VODA 4A3LJ 4GV9A 2DXIA 3QLHA 4KMFA 4FM0A 2FU4A 2IJLA 3SXYA 4BDYA 1XGMA 2QWWA 4XLAA 3UKUA 4LH5A 4OINF 2F4VK 3VPRA 4BEHA 4NUBA 1EH8A 5D5WB 3THXA 3GE1A 1ETQA 2DMTA 3LMMA 1ODDA 3ECOA 2R7TA 5D5XB 3CD6N 3KD1E 4Y52J 1IUFA 4B9MA 2VBWA 4EM1A 3NGZA 2UXCK 1LCUA 3FM3A 3DXKA 5L3EA 2WV1A 3V7SA 4F55A 1D0XA 3NDKA 1OCOH 2IW5A 3NQOA 5BPDA 2ITMA 2VQHA 4Z4CA 3KTQA 4JP0A 3V9ZA 1OR7A 1IN8A 4H4KC 4FWNA 1VSIA 2PBDA 2M87A 2DQLA 2L0KA 4U0VA 2BY2A 3BR1A 3HHGA 4CJWA 1WH7A 1ZRFA 3O6BB 4ENNA 2VGMA 4CEAA 2CRGA 3V7CA 1LE8B 4LF8K 5IYBJ 3VFZA 4A3GJ 3NFAA 1YJ9N 4TV7A 1UHSA 1JKQC 1JXEA 1Z6TA 5CHIA 4PY5A 1LE8A 1TV6A 4KFCA 2M5WA 1D8YA 5ICCA 3MMYB 2P0WA 1HNIA 4U67L 3VGKA 3O4NA 3VQBA 1VNDA 3J80Z 3O6WA 4RAGA 2CUFA 1YX3A 3QDKA 3E3VA 3S2DJ 4CK3A 3TBIA 5LHIA 2VBZA 4BJ6C 3SAFA 3I4PA 2EQRA 3DPLC 4ZYHA 1K73O 4OIOF 3LQQA 5ICFA 2VXDA 2KIFA 3M3YJ 1JLAA 4G94A 4CBWA 1TWFJ 4ZC3A 1G3SA 2VG6A 3VF6A 4M3ZA 1FTZA 2QYOA 4JQFA 5GINA 3VQ5A 1V5EA 4CZHA 1XHZA 2EIJH 1XMOK 1NGAA 1P90A 4AYBA 1NLVA 4BGBA 3AVIA 4KV8A 4CCLA 1QHTA 3M8RA 2ME0A 2GLOA 2G8IA 1U3EM 4GY2B 2ZO4A 5CYQA 1ULYA 3S3NA 3ZSOA 3KYCB 4DR6K 3VGLA 2P51A 3HOUJ 1TBXA 3K1PA 1APLC 2AS5F 1P4XA 2NNNA 2HDDA 4RGSA 2P5OA 2F5CA 2LREA 1HOMA 1IKYA 1JGGA 1JCGA 3TO6A 3ZN0A 3HOYJ 1ASUA 2YSRA 5B3SH 1YJNI 4QAGA 4A3IJ 2JWLA 2Q31A 4WFBL 4M3TA 4F93B 3EKSA 1KC8O 4AIDA 3ZRGA 3I9V2 1Q18A 1Q82O 1C6VA 2EIKH 1TL8A 5LMUK 4LD0A 3MKZA 3ASNH 2BYVE 1WFXA 2XUBA 4CGHA 3O1WA 2PYLA 3IC7A 3TP0A 3WXLA 5BR8K 1KFDA 3VQDA 4LLLA 4I7HA 1BI3A 1IXCA 1WSHA 3FXMA 3ZT3A 2WC9A 3ONQA 5BPIA 1UG0A 5FO5A 4HDVA 4I98B 3OJUA 2Y31A 1W4MA 2ESHA 4JK1X 3ZQ7A 2WBMA 3WG7H 1W9HA 2ZMEA 3WEEA 3VYSB 1B8IA 3KETA 4CECA 3HPGA 1RNHA 1LUJB 2HQAA 2O6GE 2FXAA 4C8KA 3CQYA 3LP2A 3RR8A 2FQ4A 3MCAB 5GAEP 2DTUA 1W0UA 4LF9K 1L5UA 1Z3XA 4OIQF 4AQYK 4XNFA 1I39A 3MCZA 4L0ZB 5IYCJ 3QPSA 3BR3A 4B8XA 3Q0UA 3DBLB 4DV5K 3DKWA 3K0LA 1WSJA 2YHXA 4DHYA 3U3GA 2RNJA 5TRDA 4XKVA 3I59A 2EV6A 3K9JA 1A04A 5IT9Z 2QZ8A 3O9SA 5CVJA 4LK0F 2ZFUA 3L6QA 1QBJA 2A6EF 2LKXA 3O8MA 1V4SA 1SANA 2VWJA 4HLXA 4DSLA 2W85A 5JVTA 3GOIA 4I2QA 4DZJA 2L7ZA 3QEVA 3AO2A 2AJQA 3G4SI 1JLCA 4WQ4C 3CO6C 1V5GA 3QEIA 4HLYA 1IV0A 4JRPA 4JKEA 1FIPA 2DI3A 4F3OA 3AAPA 2K02A 4PSWA 3HUGB 2K40A 3I53A 1OYIA 1J9IA 1T6CA 3RZOJ 3ZP5A 1W2BM 2NRHA 4OGEA 1YT3A 4M3XA 1Z0XA 3FXQA 3HPHA 3CMYA 1K8KB 4B9TA 2FEZA 1U45A 2L7KA 1BW5A 3ZT1A 4UUSA 3HM9A 4DOZA 1WJ5A 3QICA 4KJZA 2PJRA 2NVTJ 3IUCA 1MJ9A 1Q1HA 3ZXSA 2ASPA 4HNUA 1W7PD 4IO9L 4FPBA 3EQLF 3VA3A 1D1AA 3AGRA 3GO5A 4XQFA 2HVHA 1IF1A 4UUTA 3GW2A 2XVCA 5FKOA 5AONA 3HSRA 2KW4A 5KTQA 3KPHA 2CYYA 3T5XA 2YKMA 5C25A 4WQ5A 4CHYA 3K57A 4X0GA 2YV0X 4EEFG 1VQ7I 5KNLA 2W6LA 4I0AA 4CJEA 5HP1A 3K2ZA 5HBMA 1QQCA 4HPQA 2HOSA 4M63C 3FM5A 4YNQA 1SUQA 2R5YB 3AAQA 3CCRI 2DFIA 3BG6A 1S9HA 3J81K 2VKEA 3MFKA 4B9LA 3ZX2A 4IEJA 3COAC 3IDHA 4MQ9F 2Y48A 3CCLI 1VQ6I 3EDPA 2KFNA 4HUEA 3AGKA 2OC6A 3OIQA 3OY9A 1S7OA 3HT3A 3SMPA 4WXHA 1JLEA 3GZ6A 2DA2A 2P9LA 1VQLN 4M45A 3VEYA 3C7JA 1B4AA 1MMNA 4KISA 5JMVA 3DCFA 2B6AA 1ZRCA 5FPEA 4XKBA 5F08A 1VI0A 3FXKA 3ZQGA 4XICA 1T8IA 2P4WA 4DV7K 5HLIA 2DT7B 1VQ7N 2DMPA 2P9PA 5CYVA 4HTUA 1YE9A 3EUHA 3HZJA 1M1EB 2MD0A 1MDMA 2IS4A 2K9MA 3E01A 5AZJA 4IQ4A 2JSCA 3DOLA 2P9NA 3DYAA 5E18F 4KTWA 5JVGF 2H94A 1N6QA 1KAYA 1KLMA 3CCLN 3VPZA 1BJAA 2OTJN 1REVA 1BISA 4FWKA 3L2CA 2R7ZJ 1J2XA 2F8SA 5AIQA 2IA2A 2CH5A 2FBTA 2QWQA 2Q0UA 2NVYJ 1QU3A 2HQ5A 3WE2A 4FJIA 1BR1A 1KAXA 3S1QJ 2FJ1A 4XH4A 3EZ5A 4NC6A 3VF2A 4KREA 3A02A 1N5YA 2R7WA 4O5BA 1ZBLA 2FQ3A 1ONVA 2FF6A 1T39A 1WN7A 2L01A 2L9RA 3FDYA 4HW0A 5FLXK 4BQLA 2B0LA 3MECA 4O8KA 1KTQA 2IEKA 2ZKZA 4EV0A 4MFDA 2DTZA 4YFKF 3CPWM 1T0FC 2MLKA 1DEJA 4WK8F 1B72A 3A5MC 3SBTA 3H36A 1MBKA 1MIJA 3CC4I 1EQYA 4UVAA 1YRNA 3OYDA 4CYCA 2GTDA 5GAHP 1U8BA 2YPRA 1RI7A 4MHGA 2UV1A 3TAFA 4CD3A 1GT0C 2LK2A 3EUAA 3K2AA 2NRWA 3I5UA 2O8CB 1L3TA 2CQ7A 1TQIA 1ZREA 3OJSA 5AQQA 3QP6A 3ID6A 4R79A 5H6RA 4FJLA 2GM4A 2AQFA 5A2QK 2O8CA 2YI1A 4EJTA 4ISEA 2E35A 2D0OA 4FVUA 2X48A 4CGFA 3QFPA 1QPMA 2JZYA 5AQJA 5ICGA 2MABA 1RIOH 1QZ6A 1CZ9A 3DLAA 2ELHA 3OBYA 2NS0A 4CGDA 2Z2SB 1DPUA 5CKTA 1OPCA 3J81O 2O4IA 3HM8A 4EIAA 4CJQA 3GG4A 1NH3A 2FBXA 4CJ4A 1XC9A 4K8XA 2P6SA 3A01B 5DK5A 1RGIA 4YDUA 3IL2A 4DJAA 2Y1JA 1YVNA 1JKHA 1KGSA 1T33A 9ANTA 1YHQI 3O3FA 4IO8A 3JAMK 2WV0A 1WUAA 2IXSA 2L9SA 5I3UA 1SKWA 1G4DA 3PO4A 4KN4X 3V6DA 1MZBA 1SL0A 4KIGA 1XCBA 1W97L 1HUXA 1ON2A 2XHKA 1WPKA 3OYBA 4FO0A 2EFQA 2QI2A 3R6SA 3LM2A 3NWTA 1SL1A 5HDNA 3IAYA 3VQAA 1LDJA 5M1FA 1S1WA 1Z9CA 1VSHA 4C1NI 1QZZA 1QPIA 1VK0A 4F2SA 4BC2A 4M6VA 4RG8A 1R1VA 1X9JA 4OVLA 5EGOB 2QSGX 5AQIA 4GYIA 2R7YA 5K5OA 3QEPA 1Z77A 2XRIA 4BR5A 1MBGA 2UXNA 2VI6A 1MKMA 4XLEA 3TQNA 1FSEA 5FLXO 3HZ6A 2HYGD 4IG3A 4CJVA 2NLXA 3O8HA 3CCVN 1GLNA 1DPRA 2RE2A 3CETA 4B9QA 3C2BA 4JI6K 5H2FC 5EF6A 1IG8A 5HODA 2X0LA 1AKHB 2HVQA 4IF4A 4C9YA 1RBSA 2OAZA 2EFWA 2HBMA 3P9KA 3BTLA 3BT9A 1HJOA 1YI2N 4J01A 4CJRA 3HOWJ 2R7SA 2OYQA 2MW8A 5EZHA 2H09A 5DCFA 4PDKA 5C4XJ 1OYYA 4W97A 4LIVA 4K42A 1NNEA 3O9RA 3QODA 3S8PA 1JXSA 4YEJA 3JS6A 1VQ9N 2YX4A 4IJNA 2Z1HA 3CUQC 3DLGA 2NS7A 2NZTA 4B9SA 1WJBA 3WU0A 1TQMA 5K5QA 2MC3A 4CGJA 2F48A 3AVKA 1J75A 2O8EB 2KKZA 1YITN 4E7HA 4I2OA 1J5EK 4HV5A 4WYBA 4Y33A 2IGMA 3CCMN 3G71I 4HOBA 2HQNA 1NJZA 5C0YA 2IA0A 1R5HA 2LBFB 3ZSYA 5GTHC 4DSKA 4IFVA 4RAFA 3OR1C 3AFHA 4XRMA 1RETA 4RLQA 4RB2C 4PQUA 2O8EA 1Z7UA 3CM5A 1X19A 3JAMO 4X6AJ 3W2WA 3LQRA 3L09A 1OCTC 3MN5A 4IRGA 3FKIJ 3E66A 4OLAA 2QW9A 3SEZA 4Q5SF 3WQUA 1LFPA 2Q0RA 2VG5A 3ESWB 1L3VA 2JA7J 1V3FA 4C8LA 3K4NA 5FGMA 3VYRB 2P7VB 2RDPA 3PQKA 4KBOA 1QSSA 1EP4A 3H46O 4IEIA 4J19A 5LL6Z 3GYHX 3V4IA 2QBYB 3OYFA 3TL4X 1GLFO 3HSCA 3VYTB 1KQ9A 4L9NA 2QXLA 2LKPA 2FMYA 3CCJI 4JK8A 1H88C 1GVJA 3FXOA 2HFHA 1LNWA 3SQ0A 1XG1A 4WE1A 1Q9YA 3J7YJ 2PYJA 1U49A 1ZG1A 3VGMA 2HZDA 3CFPA 2DQRA 3JRCA 4BE1A 1OKJA 3RMAA 2DFEA 1HPMA 1KVAA 3M1EA 4E7JA 2QWPA 1RBUA 1NK8A 4FOEA 2DJIA 4BE2A 5JFRA 4S04A 3IKMA 1NGJA 3DAWA 2JJ7A 1XWLA 2O0YA 1CLQA 4CJTA 2V9KA 5AQLA 4J8FA 2XGCA 3MN2A 4AM7A 3BQYA 1GOBA 1XNRK 1BL3A 4GGGA 3Q7CA 1JT6A 2OANA 4PKGA 4I6MB 2CUZA 4L5IA 4FJ7A 2P9SB 1VQNI 3AO3A 1R7JA 3MN6A 3GUDA 4JLHA 5F1JA 3TO7A 2UYTA 3BR0A 3QFUA 1DTQA 3DPTA 4B3OA 3KP6A 3JTGA 2P9SA 3LDSA 3GTOJ 4BACA 3ERMA 1UJ8A 3LZJA 2ZB9A 4DQQA 3HRTA 4UY8O 3U9GA 4KIBA 4G6DA 2BXYA 4IZ9A 1Q1VA 4D5FA 1VSJA 1KYWA 4FJ5A 4DQ8A 1QGPA 3ENBA 4FYDA 5EG0A 3ALYA 5ILUA 1IJWC 3HIFA 3SFZA 1BOAA 3KX2A 2FSNA 1TTYA 3TTDA 3SYTA 3AG4H 3DU6A 1VQNN 3F0CA 3SUOA 1S7AA 3HTUA 2VN2A 3FMRA 5C3EJ 1HW2A 3WXKA 4MO7A 2QQAA 5BREA 2DODA 4IL6C 3OR2C 3P31A 3N4PA 2VQEK 1YS7A 3E9PA 1XS9A 3I55I 2J4RA 1RDAA 3C6TA 4IBNA 3VSKA 4JKCA 3PUFA 4YOYA 3AARA 1NOYA 1RTHA 1JLBA 1UOCA 3DLLF 2E7XA 2M3AA 5B8HA 4EZ6A 2HQRA 3WHBA 2HEOA 1T8EA 2ISZA 3CCQN 2JVGA 2NS8A 4RB3C 4JKBA 1IH7A 5ICEA 1X1BA 4F4KA 1Z26A 1X3UA 4EP4A 2W48A 1ZRDA 1G3WA 2ISYA 5AQXA 3DEEA 2DYSH 4K2EA 3CCUI 4DU1A 2VQFK 2IIRA 1O1WA 1WHUA 3DF8A 3QWLA 4FSVA 4FWPA 2DDAA 2M7AA 3IRQA 4Y17A 4KH5A 2EZLA 5J2NA 2VBYA 2ACJA 2DK8A 4IDKA 5J1RA 4JN4A 1HX1A 1SL2A 1K78B 1J5OA 5DCMA 4YFNF 4QWQA 3CPEA 1UAAA 3LAMA 1NKEA 3MMVA 3BG7A 3S17J 1WRJA 4LY7A 2VB6A 3ZSXA 1MGTA 4HNTA 4LSLA 3L3VA 3TTCA 1WVRA 4FX0A 2VG7A 4FLXA 1XQSC 3CERA 3M6GA 4HX8A 1S5LC 2DDBA 1ZH5A 5BPNA 5J1YA 1O3QA 4FL9A 3RR7A 3RPUA 3AVMA 3O2PE 3ZQCA 3W6VA 1FYLA 3DJCA 4YOUA 2E2HJ 3CC7N 2JRMA 1WI3A 4KHUA 1XUPO 3AVCA 2GELA 3H3ZA 5AQVA 2ZD1A 3ZSRA 4WQ4A 3THYB 1KFSA 5HS8A 3AVNA 2WONA 4DCHA 5AIPA 2JTVA 1CXUA 4HV6A 4BNCA 5EEHA 1O4XA 2DK5A 2W57A 4FW2A 3ATVA 3RKYA 2AP1A 2HNZA 3WTVC 2LOOA 2EV0A 1RDDA 4YHHK 3BOQA 2M7BA 2K85A 4BR2A 4L9TA 3VOVA 1O3RA 2XIGA 2L02A 1ETWA 2K4JA 4YG2F 1BI4B 3GTGJ 1VQ4I 3R0JA 2GWJA 3QPTA 2D1HA 2X9DA 4PFOA 4CK2A 4AILC 1NGFA 3TW7A 1LVKA 1A6IA 5CVUA 1YIJI 1IRFA 2HHQA 2G7UA 3ASOH 4II3A 2PLYA 1IN6A 4M3GA 2LSOA 1K7AA 1Y6IA 2EHGA 1KQ8A 3MKYB 4KHPK 3H3NO 4M7YA 1XMAA 4EP5A 2WB1N 1HNZK 4CFBA 1FXXA 3S16J 4CF0A 4ETSA 1Y1WJ 3BPVA 3WTSC 5HRNA 1HBXG 3P1GA 3BJ6A 2F9WA 2NNYA 1ZBSA 4ASNA 5KPRA 1QVTA 4XH5A 3K0SA 1VQON 5E79C 3FZMA 4X66K 1XTAA 3QOEA 4Z0UA 2XF5A 1V4RA 4E0DA 5IP6A 3FZHA 3LL7A 3AVBA 4HNVA 1BO5O 4JYAK 4N5SA 3MN9A 4CZIA 1XMQK 2QWMA 1R58A 2XY6A 3WTTC 2DW4A 3CLQA 5AJ3K 2KRFA 1YIJN 1SVMA 4LF4K 1K79A 2P9UA 5BPLA 4I7FA 2LY9A 2BV6A 3SJHA 2VKHA 3HTVA 1FMVA 1K6YA 4MO4A 4JHDB 1TWGJ 4K41A 4AHCA 3HG9A 1HKTA 3SI6A 1ZG3A 2A40A 3PNVA 3SLCA 2ZXJA 5D6FA 1YW9A 2QWNA 2FOWA 5B1AH 1ZG5A 2Z1DA 1S1VA 4A62A 3RMCA 2KMUA 1R6RA 1TWHJ 3K5NA 3DLBA 1YX5A 2HTSA 3TDUC 3VMFB 1NJWA 1GDTA 4A2AA 1RDBA 1LOTB 4B1VA 1K8AO 2JA5J 1WSFA 1KQ0A 4H0XB 3OYKA 4V19S 4DSIA 1DTTA 4BH9A 4LG0A 4IHSA 5LBQA 1QQOA 1ZYQA 1QTMA 3I58A 2HVRA 3P39A 5GIOA 3VEZA 3LSGA 4PKIA 1N8RO 4XR6A 4DQSA 2IVMA 3K59A 4IWVA 2QWLA 5KQDA 2HHVA 3ZN1A 5KPZA 5K7HA 3HRGA 3HXMA 5J47A 1OR7C 2A6AA 4M3YA 3FZFA 3RWUA 1O3SA 3L2RA 3SYZA 1YJWI 3HHHA 1SS6A 3CJNA 2DPUA 1T0FA 4GVMA 4FJHA 3KZIC 3WNEA 4IRHA 4RGXA 3SQNA 3LPTA 4BRKA 4N41A 2VUMJ 2YHYA 3V1RA 3EYYA 3FZVA 5KRTA 4DTRA 5HNHA 4EATA 3C2GA 5EOYA 1D5YA 3L2UA 4DYRA 3O1BA 3RSNA 4QPOA 3F72A 5HS7A 4IQJA 2AQEA 3CJ9A 1N25A 2R7UA 4CO8A 2EFNA 1TP4A 3AO5A 2F9TA 1EH7A 3VTHA 5LY3A 4Q5VA 4OIPF 2B63J 1JTYA 1P6RA 3JRFA 3CP2A 2YU9J 1Y56A 1D9FA 4DSEA 5DM7F 1FBUA 2R7OA 3BQZA 3GFMA 2JA8J 5ILVA 2ZE2A 4HSTA 2ICWG 1U2VB 1CXQA 3T1HK 4Y1CA 2DA6A 4X65K 1NK0A 3KK7A 3VB2A 4ZJZA 3H35A 4FOIA 3PO5A 3WU2C 4KA4A 2KKOA 1NK4A 4I76A 3HI0A 3ABMH 4DWIA 5EX5A 4FLUA 4XLCA 4XSXF 3WQTA 2QA4N 1USTA 3CO7C 1QQNA 1HDPA 1UELB 3PIOF 3H08A 5HRPA 2E6LA 4JKGA 4N9IA 5J8CA 1EO1A 3GEZA 4M73A 5FKLA 3WG9A 3ECHA 1BHLA 1W36D 5CVIA 4CHQA 1ZC6A 4JKHA 1ITYA 3L9FA 4CEZA 3DLEA 3KP4A 1Y39A 1NKCA 3T8TA 1EWRA 4JKFA 1YS6A 2DA3A 2HPIA 3OOUA 3BR2A 3QYEA 2IC3A 1XGSA 2FBKA 4CEOA 4MO5A 4DV0K 3PY8A 1FX7A 3ZSZA 1VQKI 2EZIA 2RHKA 4LF6K 1ZARA 3OYGA 1LWCA 4DU4A 4GV6A 2VJ4A 2O8DB 2YHBA 3ZETB 2HXIA 3TAQA 3V8JA 3V1OA 3LSKA 1D1CA 2KDZA 5M3FJ 4FWMA 1GUUA 4HEA2 3LP1A 3OS0A 2DU9A 2P9KB 1QSYA 3BGRA 1PUFB 4HX4A 4ENKA 2X6WA 4EM2A 1XGOA 3GTMJ 3BC8A 3GFLA 3J80K 1S72N 1S7EA 3W0LA 3IWFA 3VODA 2Q1ZB 4AWXB 5DDGA 3GDQA 1HSTA 1LAWA 2XGDA 4EGYA 3R9PA 3ZMSA 3PX4A 1XSVA 2E34A 2ELKA 1F21A 4DR1K 3EL2A 1VF9A 1C1CA 3VSLA 4MFBA 1SEUA 4FWSA 4DR3K 2CS3A 2P7CB 3MXIA 4DNCA 3WNHA 3C7NB 2XPUA 2L7MP 1N77A 2XB5A 3IH4A 1S9GA 3F6OA 3WGHA 3AL0B 2UUZA 2E2JJ 4OMZA 3FZLA 2E1OA 4ANJA 4I99C 1R49A 4BR0A 2VLAA 2YNHA 3H0DA 1BIBA 4XMYA 1W7PA 3ZMVA 2CGLA 3R3LA 4U0WA 2VKVA 4LFAK 4E70A 4EQQA 1Y8QB 3IHUA 2OPQA 2UWMA 4LITA 3CUQA 1ILYA 3SPYA 4JX5A 5K7FA 2CQXA 2E1YA 4LB5A 3M4OJ 2BOLA 1VQMI 1GXQA 3OYNA 3VWBA 2XSJC 2OCEA 1G3TA 1Y1VJ 1NM1A 4G8XA 4CJUA 1T44A 1KVBA 2ASMA 2FC0A 1QE1A 3NVKA 2MSYA 5C4JJ 4DB3A 2GQQA 3DLLL 4CCOA 4CJSA 2OUMA 3ZX3A 2AO9A 3LDQA 2Z99A 3DXMB 3F8NA 1S6QA 1CF7A 4Z94A 4IXAA 3M8JA 2O8FB 5I9EB 1YTAA 2PMHA 1HNWK 2NOGA 5E20A 4C3HJ 4M9XA 3DRSA 4KTZA 2YKNA 4CF9A 3NF7A 3MEEA 3JSOA 5EVZA 3ZGKA 4C30A 2K27A 3QBXA 3JRGA 1DQUA 4WCGA 3LDNA 2O8KA 2Z1IA 2ZNZA 1I6HJ 2CW0F 3LA7A 3KLEA 5AQGA 3GBTA 5GAGP 1S8NA 2E71A 3C3WA 3F2KA 3LSIA 3L8BA 4B1YB 2CU7A 3VQ4A 5L3DA 2YU3A 4PFPA 4NYNA 3TAEA 4E4HA 1YO5C 1E0EA 1NK7A 2FA5A 3TO9A 1IKXA 4NBQA 3AA2A 3VEWA 3FISA 4QS7A 2M4KA 3J80O 3B6OA 1J53A 1N33K 4CJ7A 1YVUA 2RF2A 1R23A 1IUYA 4BHBA 1E4GT 2HMIA 2HF4A 1QA6A 2W41A 4UHTA 2G8WA 5FKKA 1A5XA 1YIOA 1UZCA 4UVCA 3I3LA 4ZZLA 1VSEA 3O3HA 1UCRA 2VQLA 4FXDA 2W42A 4PHTX 3THWB 1EJ9A 3GBGA 5DS9A 3GTLJ 2BUPA 5AQNA 5GPAA 2Z33A 3AA4A 1MU2A 1UWBA 3R0AA 3WODF 2VYPA 2WFBA 4M41A 3TDZC 5IWAK 1LWFA 3B6AA 1NJIO 2VPRA 2E8AA 3WNGA 2WY7Q 3AKZA 1E3PA 2DMQA 1F5TA 2ZBKA 3IMXA 4DTJA 3FF5A 3JRDA 1JL2A 5H1SQ 4CJKA 1S9EA 3BUZB 2IGOA 4PL7A 3M8QA 3NGIA 4JI1K 4MLHA 3KWGA 2QENA 3DMJA 2DA5A 2ZJPF 3NARA 2NVXJ 5J2QA 4Z4HA 4DTXA 2VQCA 4JI2K 1MBHA 5TISC 3O3KA 4C8MA 4RBOA 3G6EN 5FDLA 1WB9A 3VESA 4QS9A 3I56I 3LNQA 2K3FA 1IKVA 4L5JA 2HHHK 1R71A 3M8SA 4G7OF 2XSDC 2F96A 1FWZA 1RUNA 3D6RA 2XASA 1BCMA 3DTIA 1ZLKA 3AG2H 2Y9ZA 3EYIA 2KQRA 4A3JJ 4OPAA 3KEOA 2DN0A 5CY4A 1YLFA 1TAUA 4PSXA 4BQNA 1IN5A 1VQPI 4RW4A 4XEIA 4JKAA 3BDDA 2W00A 3DTEA 2ATQA 2Q2EA 4A3CJ 5FB2A 1HLVA 2A1RA 1W36C 4FZZA 1U9OA 3PSIA 1WAJA 1YAGA 2YUSA 1Y97A 2D1VA 4BR4A 3CJCA 2K7LA 2JMWA 4L18B 1OFCX 5GP9A 3QAHA 3HPOA 4LFCK 3GZNB 2GWRA 1UB9A 3U9ZA 4EJOA 4JD2A 1BA0A 1GLCG 2XO7A 1JTXA 2I10A 3B8AX 5CVVA 4U0YA 4YFUA 5LGNA 2MLGA 1T56A 4J00A 3T69A 4HZFA 3I71A 1T2KA 4WWCA 3P5JA 2GXBA 1NHAA 3F6VA 4A3EJ 3AVAA 3TAMA 3NH2A 3OVNA 3NH0A 1NK9A 2VJIA 2MFZA 3MWPA 3I64A 4LK1F 5FD6A 1JI8A 3N4MA 3AV9A 4A3MJ 5IT9O 1JGSA 3D2FB 4RW7A 2IBDA 2EA4A 2ZSHB 2LSNA 2V7ZA 2Y0SA 1X9SA 4QTRA 1NMNA 4QIWN 3D1NI 4BWMA 2D5RA 2AHQA 5KCMA 4JK9A 1L3LA 1NK2P 3DM2A 2R5ZA 2A07F 1J5YA 2RPIA 2UXXA 4DUZK 2CMPA 2Y9YA 1SD7A 1SAUA 5GAEJ 4FZYA 1WAFA 1UA1A 4GRIA 2DLLA 3ZMDA 5FLVA 2R7XA 2A5WA 2X1CA 3OWTA 3MQ0A 1C1BA 4XLHA 2DMUA 3MEDA 4AIJA 2K9LA 4I6ZA 2PY5A 5DM7L 1MSFC 1MSEC 2V52B 1Z7LA 4FJ9A 2K9QA 3LP3A 1TL3A 3E6MA 3RYPA 3GTPJ 2XDVA 5E8IA 3HSTB 3KYLA 1MWKA 2IS3A 5JICA 5E17F 4H0OA 1EWQA 3OMYA 2QQ8A 2VPLA 4HHTA 1MBEA 4FM2A 2LD5A 4H8KA 5E1ZB 1ESVA 1SC7A 3L7WA 2BXZA 3CHWA 3P4IA 2GA1A 1X9MA 3VQPA 1GOCA 1SFUA 2LFBA 3PIOL 2F5EA 2ZJRF 1C0WA 3AA3A 3ABTA 2HGCA 3O80A 1XMKA 4R8HA 1GXPA 4HA8A 5FROA 3U6FA 4CGIA 1NGCA 3IRRA 3O9TA 4EHUA 3KP5A 3VDXA 4CD1A 1CZAN 3RPUD 4NCAA 3KZZA 4LD5A 3RPQA 2HHXA 1BC7C 3U8XA 3ZEUB 3ELKA 3KK1A 2JN6A 4BHPA 1XNQK 1WWXA 1SFKA 3PM1A 3SZ2A 3QEXA 3K4KA 2DOEA 4CCHA 2GBYA 1U47A 2UZKA 3MAJA 3PLAA 2ASOA 1MJAA 3K70D 4R1HA 3HKZN 3ROUA 1B1BA 4V2GA 1R5GA 4PUSA 3CD6I 1NOZA 3RTRA 4Y15A 3QP5A 4AM6A 1NWKA 4IJAA 2QKBA 2P9IA 3U2RA 3DLKA 2OF7A 3ERED 1OISA 5D5UB 1X3MA 3KHYA 2OU2A 1ATNA 2X78A 1TUUA 1XC3A 1Z1DA 5IY5H 5A2QZ 3P38A 1KU3A 2Q3SA 4GKKK 3HB9A 4NCGA 4E1MA 3EUKL 3FFKB 4Z4FA 4FQGA 3M3ZA 3MEGA 4IDHA 2HKXA 3IUOA 1XC5A 3SCXA 4CZKA 4MEYF 1MH3A 2FXUA 1LQ1A 1TKZA 1FK9A 3K69A 4F91B 4OMYA 2XY8A 1N78A 1FNNA 4MFEA 4JI5K 4XN3A 1YJ9I 2VQGA 2HZTA 2JUGA 4Y0WA 4P5OA 4N4OB 2KIQA 4RGRA 4FVMA 3FXRA 4M6YA 4KH4A 4B3RK 3ZLJA 2H6CA 4XOTA 4CF2A 1NG9A 1K4TA 1QHHD 3CJ1A 1RBRA 5D3GA 1WCMJ 1S3JA 2Z1JA 1KZHA 4M3FA 1C0TA 3SAGA 1MA9B 3EO3A 1T05A 1WJFA 2L3DA 1Z05A 2MYSA 3HL2A 4FJGA 1TKTA 1TWCJ 3ZQHA 5M5XJ 2DBBA 2FRHA 4DR2K 2IGNA 2ID3A 5BQTA 2IPQX 3ZQIA 2MA3A 4B9UA 1A5JA 4B1ZA 5D8LB 1UFMA 1I6XA 1RT5A 2E4LA 3UE5A 3JRHA 4HYEA 1FSHA 3RDIA 3L4IA 2DPDA 4E1NA 2NUBA 2ZM6K 2PG4A 2XPWA 5HS9A 1ZBFA 1I27A 4OPKA 2A3SA 2H27A 5CPRB 5IPAA 3I8BA 4BY9C 3Q0WA 5GAHJ 3TTFA 3OIPA 1FKOA 4BGDA 1IV6A 3PJRA 3PX0A 4JI3K 3BCAA 2Y0MA 2NOJB 5KI6A 1BW6A 5AQFA 3LANA 5JR3A 4HF2A 4AVPA 4WF9L 2STWA 3QIPA 3LSTA 3TOAA 5AQSA 2V4JC 2Y0SN 4CF1A 3D45A 4JS4A 4JX6A 4CZJA 1HF0A 3T1YK 3QU6A 2OA4A 3D5RC 2HOTA 5E41A 2L9NA 2C6YA 4DS4A 2X1DA 1ZQ3P 2K3PA 2BY3A 2KZZA 3TGNA 1RILA 1VFCA 2V26A 3H6EA 2FBYA 3NWSA 1S1XA 3A4CA 5DV5A 1VRUA 2JLEA 1X2MA 4O55A 2PN6A 1TL1A 2IVOA 2DT5A 3FE1A 4LSNA 1A35A 2RAEA 4FK4A 3U1KA 3F22A 1U8RA 4RAYA 2JRTA 5LHHA 1REPC 4FLTA 3S14J 2V9VA 4CVNE 4RW9A 3BY5A 4DYCA 3ZT4A 4BQQA 4BRGA 2VJJA 2HMPA 3RKQA 4XLPF 4BRLA 2TCTA 3D0SA 2BVLA 1DGRM 2BZTA 3ZSVA 4ZYDA 5D5VB 2HKOA 1OLTA 1EX4A 5J2PA 1OCRH 5KQ8A 1BQNA 1Z21A 1X3WB 3ENOA 1FY7A 4PJMA 2Y30A 3BR5A 1WJEA 4L3QA 2K9NA 3BDPA 3RQ4A 4M3BA 3X2QH 4CEBA 2XROA 3QOPA 4XRSG 3PO3J 2WBNA 3B02A 2Y1IA 4IZZA 4KNYA 2KZGA 1LEBA 5KVRA 1D8KA 2ZJPL 1RBVA 3GXOA 4BQZA 3LA2A 4C8NA 3VENA 3HP6A 4AHSA 3IWZA 5BN8A 3JW4A 4CIGA 1IRXA 3A03A 3MN7A 4CZFA 1J0RA 3I33A 1Y0UA 2CG4A 1FMWA 3GZ5A 1QHGA 1JCEA 2OZMA 5CR4A 3C1DA 4LH4A 3PNTA 2LMDA 1GOAA 3AO1A 2DO7A 3LSHA 5EYRA 3H5RA 4NXMK 4FJJA 3SK3A 1HW5A 3ZR8X 2O4GA 1M90O 1W5TA 1A31A 1ASWA 4BUPA 1D4XA 4CEDA 4F7ZA 4KTQA 4ZZDA 1A36A 2GZWA 3F8FA 2COBA 3GFJA 3IV5A 3PL8A 3AVJA 2EINH 4LLNA 2ZJQL 4ID5A 1R4MB 5J1EA 2DA1A 3BZCA 2UXBK 5B5EC 5AZIB 1FJLA 2BANA 3TMOA 1HDDC 3CP8A 2R93J 3WXIA 1ETXA 4BKXA 3OHRA 3K2PA 4EVIA 4OPJA 2OCCH 1RC9A 3CC2N 1IRGA 1MNEA 1SKSA 4XK4A 2X85A 2OZ6A 2LDUA 4WXCA 5GADP 4GVEA 1PUEE 4EJVA 5E26A 3K70C 2YNGA 1NGHA 1W0HA 3SPZA 1JL1A 2Z16A 2G8HA 4L5EA 4MQVA 5AQOA 1QVFM 3HUGA 2BH1A 2BTFA 4N47A 3ASMA 4HF0A 3VETA 3CJBA 2GA2A 1ATSA 3SJJA 3FWEA 1K8KA 3VOEA 5EY4A 5J8FA 4NCBA 3MXMA 1TK5A 5CVRA 2E1MB 4CZLA 3H9GA 1VQLI 3EY1A 4FISA 3K6GA 1OMIA 1RKTA 3HDDA 5E3LA 3BTCA 4D9JA 2V1UA 4W5NA 4DGWB 3AVHA 2QEXN 1IBKK 1NG7A 3KIOA 1ZLJA 1ZTRA 1R5ID 4EM0B 3ISPA 1U5TB 4S05A 2OJED 1N34K 2CSOA 4JK7A 3PFIA 4OU0A 2OTLI 4D0PA 3O4WA 3CMAN 1C0GA 1VSMA 1LV5A 5K7ZA 2A05A 4G1QA 3FKJA 5AQYA 2R5YA 2OTJI 3LALA 2O3FA 3GF2A 4LG3A 2O8XA 2X6NA 5M5YJ 2BW3B 4CFCA 2CV2A 2ID6A 5BN9A 2O8BB 3GFIA 4D1QA 4CZGA 3VEOA 1D8JA 4Y7NJ 1HPZA 1G8XA 4E3SA 2Q2RA 4H4OA 2DTRA 3U9DA 1KD1O 3CMEN 4DF8A 4BRAA 2FNAA 1FOWA 2WADA 2D0BA 4S0HB 4QLCU 4CZEA 3P9CA 3BWGA 3RRGA 3UKRB 2OTLN 1RTJA 4KICA 2ZJRL 3ML6A 2NAZA 1Z25A 3OS2A 4KPYA 2HWVA 4RGUA 1BU6O 4NYFA 3KP3A 5TKWA 2P5LC 1R4NB 1MW7A 1LB2A 1A6QA 3OSFA 2A69F 4Y1DA 1T6DA 3FBNB 3FHZA 1SFXA 3GVAA 3DBHB 2QGUA 1D5AA 4MGRA 3C0BA 3RMBA 1XPXA 2IA1A 5E8GA 3KZBA 3WGGA 4PL8A 3CJ7A 5L3FA 2UU9K 1DDNA 3T7ZA 2FSKA 4J2BA 1K61A 1VRTA 3T1BA 5AQZA 1V54H 4CEQA 4CGGA 2QKKA 2VASA 3LZIA 5E3NA 4UVBA 2HVSA 1UHMA 3MD2A 1T38A 3NH1A 2JT1A 2XKPA 2GXGA 2YNFA 3KLOA 4BAYA 3ENHA 2LH9A 3WXJA 5AQWA 1RR7A 3QQAA 3DTKA 1LJ9A 5HLTA 2DFFA 3HGGA 4NLCA 4F9OA 5D8KB 1FT9A 1XSDA 1QSLA 5GTIC 2HHWA 4BXFA 4BE0A 4DSFA 1W0TA 2KT0A 4BHCA 1B59A 3V9SA 4M3EA 4ICLA 3KFWX 2EA2A 4U7DA 3JR9A 1R9TJ 2FBHA 4A3KJ 2M2EA 2HTJA 2LP0A 4KO0A 2CQNA 4A5AA 4EMSA 4IVNA 2JSPA 5F6FA 1QZ5A 5LEJA 3NF6A 3QB0A 5DM6L 1TW2A 1PDNC 5HRRA 4X62K 2QLZA 2E88A 3SDBA 2CFXA 4EGZA 1ZAOA 5IOYA 4BY7J 3ABUA 2Q8KA 4FW1A 2MH9A 2IGKA 1J9AA 4PJJA 1CZBA 1UA0A 1BIZA 5CE3A 1IC8A 1ASVA 3QRFF 2V9PA 1TK0A 2DT6A 2LF8A 1NGBA 4DR4K 1XHXA 4FJMA 2VXZA 2W84A 2F4MB 4MIMA 2ZF5O 1OVQA 3G1OA 3RSEB 4O8UA 3MEXA 4AIHA 1BI0A 2L4AA 3DFGA 3H5NA 4BRHA 3QNOA 3WHCA 4B44A 4DYQA 4IXCA 2DPNA 4DV6K 2O03A 3N97A 1WLJA 3DLRA 3RSEA 2QK9A 2XV4S 4H5RA 5EJCA 3RCOA 4PCQA 2PAVA 4P9UA 3UB5A 3PQJA 4IHXA 4DS5A 5E3MA 1WSGA 3GLLA 3FXJA 2A6TA 2IOCA 1OH5A 1IV8A 2W6KA 1T7PA 3A01A 4CI6A 1WBBA 3ZSWA 3KK2A 3KLIA 1U04A 1NGIA 3CCVI 4ZDOA 1BR4A 1HR0K 2VT2A 3DWLA 1WSIA 3QPHA 2QQ9A 4B1XB 1QQMA 3PO2J 5LEKA 4CHUA 1NU0A 5K1YA 3F9KA 3W6JB 5KGWA 5HRSA 4A3FJ 1AA7A 4EJUA 1VQ8N 1B9NA 4BDPA 2FSJA 3HSFA 4M72A 3MVPA 5BPMA 4JV5K 4NB5A 3LM9A 1F4KA 4AIKA 1WZ2A 2P5GA 5M1QA 1XGNA 1P7JA 1YI2I 4BJTA 1IBMK 1E3HA 5ILSA 4D5CA 2V51B 3QERA 3ZMZA 3TP3A 5HLFA 4BRPA 4YIFA 2GXAA 4AH9A 2TDXA 3NGYA 3S3MA 4I9QA 1RTDA 4CYDA 4NB4A 3D2EB 4CHNA 3NRVA 2BGGA 4I0BA 2ZFWA 5EGOA 4H0YB 1P4AA 1VQ9I 2KIUA 1RZ4A 3D2EA 3LDOA 2RNGA 3CI5A 4JNEA 4DF4A 3C2HA 4D7NA 2ZGZA 1D3YA 2NVQJ 3CTAA 3E6BA 3TI0A 2W1OA 3FX3A 4DV3K 3V42A 3JYTA 5EU7A 2KZMA 3CM6A 2RKIA 4I9LA 3I0RA 1J54A 4H0EA 1AKHA 2P5VA 1YITI 5T7BA 3BJAA 4XBFA 4KI6A 4OKKA 3CCMI 2JGUA 1R36A 4M7XA 4M3RA 4BVOA 2DCEA 1L0OC 4KAZA 5LFAA 1GLJO 3BROA 4R5PA 3AL0C 2Z3YA 4ID1A 2KHMA 4NXNK 1U0JA 4E6KG 3WGIA 3R8EA 4A6EA 2ZXIA 4IPAA 3T3FA 1TT0A 4LLGF 1P2FA 3GTKJ 1TUYA 2G8FA 1YFHA 4E1JA 3RI4A 2Z9OA 3ZYYX 5FRNA 1KAZA 2H6BA 5I42A 3L3UA 1JE8A 4A69C 3JSMA 2DA7A 3MZ8A 4B1WB 1KU2A 2B5JA 3BG3A 1ETOA 1FYMA 3LSJA 3REOA 2D2WA 4ENJA 1MD0A 3TARA 1MMAA 1RDWX 5M1NA 3L0QA 1HJRA 2OQGA 1DGKN 5EZGA 1HQCA 1T95A 4MTEA 1WKMA 1VSFA 3HRSA 3BY6A 1O57A 5FPMA 4MDAA 4QOZB 5LJWA 4YY3K 3SZTA 3DI6A 3UKUB 1BCOA 2LBFA 3S1RJ 4M71A 4BEHB 4MLEA 3VQEA 4FE7A 4N0BA 3THXB 3AA5X 2E2PA 5AFUA 1U6ZA 3HYIA 1AHDP 2KHOA 3KP2A 4FPAA 2F5DA 5E84A 3KLNA 2P8TA 2Q0OA 3QESA 1RNLA 2L2OA 2M1BA 5FKMA 4K0KK 3OSGA 5C15A 4FLYA 3ZQQA 2EZKA 1D0YA 3DXKB 1LPQA 2RN2A 1K4SA 3HP9A 1HW1A 3CCYA 5LMNK 3IRXA 3F8BA 1TNSA 4KHQA 2KL4A 2ZWHA 4C1NK 4IOAF 3BR6A 1U48A 3TWHA 1YYVA 4OKJA 1QHAA 1FP1D 2A61A 3HTSB 4WFAL 3SQ2A 2BHYA 3BJOA 5J1UA 3CCEN 1T6SA 1V5FA 2QBYA 4BRIA 4FTHA 2WAQA 3OBWA 2WTEA 4QSHA 2ADUA 4L0YB 4CSWA 2PJPA 2YX7A 5CZ1A 2E19A 3BCBA 1BN5A 2IT0A 5SWMA 3DEWA 4JS5A 2R4GA 5FRMA 1QZEA 4F52A 5HL7L 1FEXA 2WB1A 3K4JA 2UUBK 4KIFA 5KPTA 5HDGA 4ESJA 3HM5A 4HVJA 1NJXA 4CCKA 3KKRA 1WJDA 3MXJA 3EE8A 4OWRB 5F0HA 2G8KA 5J4YA 1OCZH 1WH5A 1GLEG 3O08A 3FK6A 4A57A 2R7VA 4M3DA 2E20A 5AFUH 4C2UA 3UR3C 2W40A 4FLVA 3GLXA 2M0MA 4MTDA 1PP8F 3WNFA 4UQGA 2LG4A 4DTSA 3OL4A 2IP2A 4HQEA 3AVGA 1YG2A 1KVCA 5FKNA 3OOPA 2G7HA 3MZHA 4LMYA 1E3MA 3T19A 3MKLA 3R4KA 2JUCA 5L3GA 2COMA 2V6CA 3BG9A 1XB4A 2A3ZA 3NEUA 4I6MA 1LW0A 1QNTA 1Y64A 2FLOA 5JHUA 2IGIA 3LAKA 2E36A 5FJ8J 4IHVA 1U78A 5C24A 3ATUA 3CZ6A 4OPHA 3WTWC 2D0CA 1DP7P 3MCPA 4I09A 3G25A 5MLCQ 3O5BA 2OPPA 5ADXA 1Z3YA 5B66C 3FMQA 1I50J 5BRDA 2WC2A 4B47A 5C12A 2XB0X 2H3GX 3CCQI 2CUJA 3K4CA 1DU6A 1CGPA 3TAPA 1POGA 2E1ZA 3B6CA 4BRMA 3KK3A 2W25A 3M5RA 5F2RA 1UMQA 3KLHA 3VQ9A 4Q47A 3CESA 5C2DA 1SVOA 3NCIA 3C94A 1NK3P 3V1QA 1XMXA 3GCMA 4GV3A 5L3BA 1SD6A 4Y3OA 3TSUA 1D0ZA 4J2DA 4JYKA 2R0QC 3DU5A 4BR7A 1KONA 2CW8A 4LC9B 4KB0A 4YFXF 3OW2M 2A42A 3QIOA 3HBTA 3T1AA 5KGXA 3JSPA 3RYRA 1QO0D 1EXQA 3ULEB 3HL8A 4XONA 4JEPA 4KI4A 2XRLA 3EZWA 4DQ2A 4BC5A 1V55H 2ZMEB 3WEEB 3WUHA 4FWQA 1B8IB 5BRFA 2CGKA 3V9UA 3H0GJ 2E1CA 3DPUA 3ULEA 2CV1A 4U88A 4CHZA 3R6MA 3K58A 3H3UA 1YJNN 3C6AA 3CC7I 3HO1A 5IYDJ 2E5ZA 3RZDJ 5M5WJ 1E17A 2YJFA 2KQ2A 4B8CA 2FBVA 1OCCH 2LTPA 1Z91A 2JA2A 4O6JA 1SQKA 1ERDA 5DTDA 5ADXH 3IH3A 1OKRA 1L3UA 1R1TA 4DTOA 3SHFA 1LKXA 4QCLA 4Q4ZF 2D4WA 3CJRB 3I59B 4OGCA 4F8RA 4KFBA 1NK5A 2V1DA 4C3IJ 4JKDA 4JBAA 5CZ2A 2M4GA 2E7WA 3E5XA 3RJPA 1K78A 3OYAA 4L9JA 2HOEA 3RQIA 5KHDA 3FGUA 2X74A 2JA6J 3A8YA 3DKXA 4DV2K 3SDGA 5DYMA 4W5QA 4CERA 3J7AY 1SD5A 5F0CA 2W82A 4DUYK 3N05A 3QEWA 2VC0A 3RMDA 4A5NA 4ZYAA 2MBFA 4XKWA 4G7HF 1PVEA 2BHZA 2XAHA 2DOAA 3CJAA 2TRTA 4FHTA 4DLGA 1STZA 3OTOK 1O13A 3E0JB 2RQQA 3CQ8A 5F27A 1IKWA 2YHWA 4HF1A 3ZSQA 4UUSB 3JRBA 3THYA 2XRNA 2W7NA 4CDGA 1H9GA 1K83J 3KJVA 3OYHA 3NMUA 3LP0A 1HYZA 2G8VA 2PJRB 1SZ2A 2I8DA 1X3NA 1VQOI 2HS5A 3K4LA 2L7FP 1BI1A 2HNHA 2LR8A 4J2EA 4XIUA 3M07A 1N36K 4DR5K 2BEOA 2MGQA 4BVPA 2DJNA 5AQUA 5F64A 2QQBA 5HROA 1ACIA 2NRRA 1UAXA 2CFOA 3PFYA 1JLGA 3QBWA 2QSHX 2ZXWH 4CZCA 4CESA 2KLAA 4BRDA 1RESA 2GEMA 1TNTA 2WAQN 3SJMA 3EKUA 1BI4A 5C2FA 1C1AA 5F1XA 3S3OA 4M74A 2H1KA 2OZSA 3E6CC 1RT6A 1RT3A 1DUXC 3G4SN 2A6HF 3DP7A 2EILH 3HRUA 2E2OA 2IS1A 1IRZA 4N9HA 5DUIA 1BC8C 3CUOA 1G99A 5GAGJ 3SNNA 4DV4K 1BI2A 3OYLA 3UNGC 4A0YA 3S41A 1RT4A 1BIAA 5JI6A 3V4GA 5DD8A 3CQXA 4AHUA 4XH1A 5CQEA 4YIRX 4N76A 4PZJA 5J40A 1MNDA 4RS8A 3KZYA 1ZELA 2P9LB 1ZR2A 3W2VA 3LWLA 3O4QA 4UB8C 2WWYA 2IVNA 3LDLA 1TLHB 3FIWA 2XGEA 3AAFA 2EK5A 1H0MA 4G7ZF 2XY7A 2P9PB 3CQZJ 3V9XA 1K6OA 4NNJA 1JKRC 1MDMB 4GKJK 2QCOA 5K14A 5AZJB 1Q7YO 1X4PA 2P9NB 4KB1A 4JHDA 3AG1H 2F7TA 4WXDA 4H4MA 1LDKB 3KKSA 4AYBN 4ZHRA 4KHSA 2VJ5A 4Z4IA 2HHSA 3OS1A 4ESBA 3S15J 4RB1A 1HCRA 3V9WA 4UUVA 4AF1A 4IHTA 4E7KA 1W1WE 1R00A 3CCRN 4ELVA 1JLQA 4CHOA 3F23A 3QYFA 5HNFA 4CFDA 1VQ6N 2VT3A 1VSDA 4UNOA 2PQ8A 3AVLA 1ENHA 3CF5F 3ITHA 1TVRA 1QQIA 4QPQA 4XLNF 1ATRA 1BG3A 1H9TA 4PK4A 4JX4A 5FLMJ 2VBXA 2LC2A 4HCCA 5M1PA 1B9FA 3KP7A 2BE2A 3CG7A 2NYXA 5KK1A 2E6MA 1G59A 2LVSA 1B72B 2PBIA 2X6OA 5CYMA 2O61A 2Y69H 4HRIA 2KRCA 2PX9A 4OAZA 2X51A 1YRNB 4CYCB 4UXNA 3IG1A 1AOYA 4CCNA 4YOXA 5LLQA 2Q1NA 2H1LA 2QA4I 1Q9XA 2KISA 1S1TA 1EV7A 4H0TB 3BF1A 4IEEA 4B08A 3NF9A 3L1PA 2HW3A 4II2A 3A5NC 2NRAC 4BBSJ 3RKWA 4G6TB 1GHCA 4DFKA 4JOMA 2JPBA 2V7YA 1TWAJ 2KZVA 1OCPA 5AQRA 3MZYA 4PJ0C 1G3YA 5BS6A 4B1UB 2BBYA 1EH6A 4AU7A 1YTYA 4ABZA 1DLOA 4ESFA 4JRQA 1P4WA 1RBTA 3LAPA 1NK6A 5CJ9A 1SVLA 3CLOA 2V79A 4LOCA 4U87A 1OVYA 3HK2A 4IFEA 1WOQA 4DTMA 4FLWA 4BGAA 3H1CA 4E7ZA 5E1XA 2YHAA 2D1KA 1FYKA 1U2VA 1RTIA 4ZYGA 2X6XA 2DYRH 1D1BA 3F8MA 1MH4A 4H0PA 4DQPA 4BXXJ 3CC4N 3DQVC 3KYDB 2UUAK 3P83D 4IOAL 3GWZA 2QWRA 4UY8I 2QSFX 4NDLA 4ILHA 1LW2A 5FFXA 3B6PA 4RCHA 1YW7A 4IOCF 2YJEA 3BZ6A 4PJLA 2PFUA 4XN0A 1JHHA 1S72I 3G73A 2QM3A 2UUCK 1RPWA 3VEVA 4A61A 3MAQA 1ON1A 4DIQA 2OPRA 2LY2A 1H8AC 4GFBA 1N32K 4H5TA 5AQMA 3MKWB 3DOKA 4H03B 3M9AA 4CIEA 3CDHA 1FLIA 2M30A 2HYJA 3CIPA 1G2HA 2QWOA 3I8DA 1SD4A 4BREA 1T98A 1TT5B 1SMYF 3I54A 4N4NB 3J8AA 3SV3A 4EJWA 2XPVA 4KT6A 1WSEA 2JPCA 3B73A 4LB6B 1IN7A 1O7LA 2CQKA 4JI0K 1D9DA 3JXUA 3S1MJ 1HNXK 2OV7A 3OIOA 2A5XA 1MJBA 1NBWA 4I02A 4RLFA 4O0JA 5JLHA 2VOOA 1SMTA 4WFNL 1FZPB 4NLBA 2O8DA 4YOVA 4RW8A 3ZETA 4OLBA 1NGDA 4L8RB 1KCFA 3VERA 3I4MJ 5FPDA 1YHQN 1X2NA 3J7ZI 2P9KA 2FOKA 1ZGWA 1PUFA 4HTLA 1FPQA 1AWCA 4Q48A 2M8GX 4DFJA 2CJJA 4P55A 2IDOA 1DGWY 2CUEA 2PFBA 1LAVA 1NKBA 1PP7U 1WNSA 2FF4A 3EETA 4CZMA 3LSMA 3PV8A 3LOCA 5JVHL 2HSTA 2HDCA 1LWEA 5BMZA 4FZXC 1SFOJ 3DXJF 3DRPA 4BG8A 2ELJA 5HLGA 4AHTA 1BL0A 2IRFG 1S29A 3C7NA 3WXMB 4B3TK 4RAZA 1GVDA 2WOMA 3H3OB 4BYYA 1TGOA 3TR8A 1IO2A 3ZMUA 4A3DJ 2YCHA 5M1OA 5KAIC 3F73A 3A0BC 3K10A 4FE4A 3WTZA 4HAMA 2JQ7A 2FNPA 4DMNA 2E2QA 4V19K 1G6NA 4A5BA 3S1NJ 4K43A 5A2QO 3KLFA 2OBPA 4M42A 3SMSA 1JUMA 1FJGK 5LRSA 2QVOA 3TKYA 4JAXA 1KYZA 2QKMB 2HVIA 4O5FA 1HLUA 2VWBA 4CICA 2FX0A 3H9JA 1ETKA 3MWTA 3E9OA 5TJJA 5IOZA 4KT5C 3I4NJ 1HYSA 2UXDK 3KEYA 3OV8A 2V7FA 5CQGA 4YORA 4GXOA 1EA3A 3OL3A 3C95A 3BTIA 5AQKA 2BY1A 4ELUA 4EZ9A 2VIXA 1SV5A 2Z1GA 2EBIA 3DXMA 4M6XA 2IS6A 1NTCA 3NAEA 3H9QA 1TC3C 3F21A 1VQ5I 1JXBA 2HXOA 2O8FA 2GWKA 4O44A 3PUBA 4ZTFA 1TAQA 1BA1A 5BOXA 3ABLH 4F3QA 2E1MC 3PSFA 2I5UA 4CJ5A 2KDOA 4E7IA 4M3UA 3HXLA 2KJCA 4BRCA 3OYMA 3G71N 1KXPA 4BXUA
chains in the Genus database with same CATH topology
4DFKA 4CF8A 1X9SA 4ID1A 2X6NA 2A1SA 4CFCA 3OYBA 4B3OA 1B9DA 3C6UA 3KD1E 4CF1A 4CHZA 4B9MA 3D45A 4JS4A 4OGEA 3K58A 4BWMA 3OYNA 3LDSA 1YT3A 4M3XA 1S1VA 1SL1A 2D5RA 3HPHA 3NGZA 3VQAA 3T3FA 1HPZA 3QINA 3IAYA 4B9TA 4BACA 3RMCA 3RRHA 1DLOA 4E19A 3DM2A 3HO1A 5E41A 1U45A 4DS4A 4E3SA 3HM9A 3ZT1A 3K5NA 3LZJA 4JRQA 1RBTA 1S1WA 4H4OA 1NK6A 3QO9A 4CJUA