1I3AA

Rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
200
Chain Sequence
MKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biochemistry of a type 2 RNase H: RNA primer recognition and removal during DNA replication.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
total genus 70
structure length 200
sequence length 200
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1i3aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1i3aA01
1VSHA 4KHQA 1VRUA 3KJVA 3AVNA 3I0RA 1IH7A 2IC3A 1LW0A 4FCYA 4DLEA 3LWLA 4DQSA 4DQPA 4IKFA 2KFNA 1JL2A 4E0DA 3HPHA 2KZMA 1IKVA 2RF2A 4CECA 4NYNA 4CK2A 5J2MA 4CEQA 2A1SA 3EYZA 3KLFA 2Y1IA 3K5MA 1LV5A 2NUBA 3F9KA 3DLEA 3M8QA 4R5PA 4FJJA 3QEXA 1KRPA 1WSGA 1D9DA 3PY8A 4RW9A 1NJXA 1RTDA 4Z4HA 2OPPA 3MXMA 3B6PA 3OYJA 5FRMA 4G1QA 4E1NA 3UIQA 3OS2A 4F2SA 1WSIA 1HYZA 1S1WA 1J54A 2Z1JA 5HRRA 3SUOA 1RTIA 4ELVA 2QK9A 1GOAA 3P5JA 1VSMA 4IBNA 4M3UA 3SUNA 3O3HA 1ZBLA 4DSJA 1LAWA 3OYEA 3NGYA 1EKEA 2KQ2A 4CGIA 2XY6A 4JRPA 1U04A 3AVIA 5SZTA 1ZBFA 1TKTA 3HPGA 4AHUA 3F73A 3NCIA 3SYZA 2QKBA 4E7KA 2HNZA 2HHVA 3RRGA 3HVTA 1R0AA 1ZBUA 3VA3A 3SQ4A 3RMAA 4FK0A 4FJXA 1RT4A 1TGOA 4BE1A 1QSSA 2G8IA 4DSLA 3AA4A 1NKCA 3SUQA 4GMJB 2G8FA 1BI4B 3AA3A 3AO3A 3DMJA 5FDLA 4AHCA 4C8OA 3OYFA 4KREA 3AVFA 3TAQA 3S3NA 1XC9A 4IDKA 1ZBHA 1XHXA 4M3ZA 1ZYQA 2PZSA 3C6UA 3KKSA 2DFFA 2VWJA 3EZ5A 1VSDA 3JSMA 1J53A 1HQEA 1U47A 3AVJA 2IAJA 4DQIA 4CESA 3S9HA 2F8TA 4CHQA 2P1JA 2HNYA 3LAMA 4XIUA 4DTUA 3IAYA 4KHYA 3U3GA 4FZYA 3TAPA 3VQEA 1GOCA 1RBVA 1NK6A 1HRHA 4KTWA 4FW2A 4B8AB 1J5OA 1KVBA 3S3MA 1QSLA 5KI6A 2Q3SA 2EHGA 1TK5A 1S5JA 4CIGA 2IDOA 2OPSA 1JXBA 3I0SA 2YNHA 2HHXA 1RT1A 4OPKA 1LWFA 2XO7A 3BDPA 2Z1GA 2VG6A 4LSNA 3ZSQA 5I3UA 4M3TA 1EXQA 1EP4A 3NBPA 4OGCA 3KLEA 4ZHRA 2OZMA 3VN5A 4FK2A 4O5BA 2KTQA 3KK1A 2BGGA 2VWKA 2FBTA 1TAUA 1G15A 3T19A 4O44A 1CZBA 1YTUA 1QQCA 4CK1A 4I9LA 3V9SA 4DTMA 1DLOA 1IKWA 1T7PA 2F96A 4K8XA 3C6TA 4H4OA 1X9MA 4HVJA 4FYDA 2DY4A 3ZSOA 4F4KA 3ULDA 4ID1A 3HXMA 2X78A 4CEZA 3LDSA 3AVHA 3HM9A 4JS4A 2FBXA 4CHPA 3K2PA 5C25A 3PX6A 4AHRA 3AO4A 3V1QA 3VQ8A 4CHYA 1K6YA 4PWDA 1QHTA 4DFKA 3ZT3A 4O0IA 3OS0A 3VQPA 3KK3A 4BWMA 4FM2A 5J2PA 4DTNA 4B9NA 1NK5A 1NK7A 2OPQA 5FROA 2HMIA 1WSFA 4E19A 3SJJA 1HYVA 1UOCA 4W5TA 5KGXA 5HLFA 2I5JA 2FC0A 4CIEA 2B4JA 1L3SA 2HHTA 4I2QA 3OJSA 4FVMA 4E3SA 3QNOA 4FJKA 1RNHA 2YHAA 2YV0X 2ZE2A 3D0PA 1NK9A 4DSKA 2DTUA 1S6QA 3MECA 1N5YA 3PO4A 1SL2A 1S9GA 3VQAA 4J2EA 1FKPA 2RKIA 2G8WA 4DSFA 4KHWA 4JRQA 1NOYA 4QCLA 3RRHA 3OYIA 5C24A 4UQGA 4KKOA 1RT3A 3QIOA 1I39A 1TKDA 4FJ9A 2YNFA 1U4BA 4N56A 3VQ6A 1NJWA 1O1WA 3ZSYA 1WSJA 3VQQA 1SUQA 2ATQA 3V6DA 1FK9A 3DRRA 4FLYA 3TR8A 1HMVA 1JLAA 3SQ0A 3MEEA 4CJRA 4CGFA 3IS9A 3LPTA 3NF9A 4BDZA 2VG7A 3QLHA 1KLMA 3NF7A 4B9UA 4KHUA 4FJNA 4KV8A 3KTQA 3P1GA 3LAKA 4FM1A 3VQ4A 3TABA 3PUFA 4Z4GA 1L5UA 1S1UA 1TVRA 4L8RB 3QINA 1YVUA 4DTJA 1RT2A 3SCXA 2DFEA 3ZSVA 1JLGA 3OJUA 1KFDA 1KVCA 3CM5A 4MFBA 2Z1IA 2E6MA 4N76A 1A5XA 3M8PA 5KRTA 4OKEA 4CJKA 4Q5VA 3L3UA 2ZD1A 1A5WA 1U48A 3HO1A 4QOZB 4FLXA 3LPUA 4OKJA 1UWBA 3AO2A 4CERA 3S3OA 1NJYA 1LWEA 1ASUA 4LY7A 1C1BA 4OGEA 4QAGA 4CF2A 1NK0A 4J2BA 3L2VA 3ISNC 4KHNA 2RPIA 4KAZA 4KTQA 4CFAA 2HW3A 1BI4A 1YTAA 3MEGA 3HPOA 3QIPA 3MAQA 4FK4A 3K5OA 3SV4A 2FBYA 4OLAA 3SNNA 4DQRA 1SKSA 4MQ3A 4DWIA 1RT5A 1CLQA 1GOBA 1RBSA 4W5RA 3M8SA 1TK0A 4F3OA 3VQCA 1VSJA 3DLKA 4AHSA 4Z4EA 2BDPA 4AH9A 4M42A 4EP4A 2E6LA 2YNIA 1IG9A 1B9FA 5CYMA 2XHBA 4HTUA 1RDBA 1RILA 4CJ4A 3NAEA 4J2AA 2KW4A 5D3GA 4CGGA 3LWMA 3NH1A 2YKMA 2R7YA 2B6AA 4DU3A 3WNFA 4E7IA 4CK3A 4AILC 1NJZA 4FXDA 1QSYA 1SKRA 3ZT4A 2JGUA 3WNGA 4KRFA 4CIFA 4KPYA 1WSEA 3OYLA 3IG1A 1RDCA 2QXFA 2B5JA 3VQ5A 4CEFA 3HK2A 2XY7A 5FRNA 3A2FA 3NHGA 4HCCA 2W42A 4CJ3A 4B3OA 4GVMA 3V81A 4I9QA 5T7BA 3LALA 1T03A 4DFMA 4E1MA 1BQMA 4CJ5A 1XWLA 2P51A 4B8CA 3LP2A 1MU2A 4CFDA 3SI6A 3DOLA 3MXIA 3SQ1A 3RR8A 4ID5A 1HNIA 5CZ1A 3V9UA 1J9AA 4FJGA 3AO1A 4N47A 3U3YA 1SKWA 3CFPA 4FLVA 4DSIA 3DLHA 4HUFA 3U6FA 3DM2A 3LANA 4KB0A 4DG1A 1RCHA 2X6NA 4FLWA 3LP3A 3ZCMA 3E01A 4RW7A 4E7JA 3TAEA 1D5AA 1HQUA 3CM6A 4CF9A 1X9WA 4O4GA 3PO5A 1JLFA 3OYGA 3ZT0A 5KRSA 3OY9A 3VQDA 4BE2A 2O4IA 3AVAA 3D45A 3VQ9A 1JLQA 4EP5A 1REVA 4F8RA 4B9LA 4CJWA 4DU4A 4DF4A 1N6QA 2ZQBA 2HHSA 4FLUA 3V9XA 1IKXA 3RMDA 1NOZA 2OPRA 1WAFA 2D5RA 3OVNA 1ASWA 4IG3A 1I3AA 4AHTA 4CEEA 2PY5A 4HCBA 3CYMA 5EU7A 3MEDA 4CJUA 4JS5A 3K57A 4BACA 5HROA 1KSPA 1SL0A 4DTRA 1W9HA 4CHZA 4N5SA 4FZXC 1BGXT 3DRSA 3CQ8A 1BL3A 4CHNA 3L2UA 1DTQA 2O4GA 2Z1HA 3AVGA 5CZ2A 4CHOA 4OKKA 3NH2A 1S9EA 1RBTA 1X1PA 4KO0A 4H8KA 4DTPA 5JS2A 4OJRA 1JLBA 3QEPA 5DK5A 1TKZA 4OLBA 4ZTFA 2KFZA 1TV6A 3HJFA 3MXJA 4WE1A 3CFRA 1WAJA 5HBMA 2YHBA 3AV9A 3SV3A 4K8ZA 1HJRA 4FLZA 4BDYA 1KCFA 3AVKA 1XI1A 1IO2A 4RW8A 4DFJA 1C0UA 4C8KA 3SPZA 4CJEA 3AVCA 4PY5A 4CGJA 1WNSA 3ZSXA 3L2WA 3KKRA 4DF8A 2F8SA 1HNVA 2D0AA 2IS3A 2RN2A 3AO5A 4NCBA 3QETA 1KLNA 3LP1A 3HT3A 4HHTA 4Z4CA 3OYHA 2P5OA 3AA2A 4DTSA 1F21A 5C42A 2Y1JA 3HP6A 1JLEA 4W5QA 3PX4A 1VSIA 4FJHA 4RW4A 4YNQA 4FJMA 1JXEA 2XRIA 3OYAA 5E41A 3NGIA 2HVIA 4Q0BA 1NKBA 2OA8A 1Q9YA 3NFAA 2X6SA 3OYCA 1ZBIA 4CJFA 4YFUA 4M41A 3O4QA 1JL1A 3NGZA 2QKKA 4M3WA 3OYKA 2IOCA 1CXUA 3ALYA 1Y97A 1FXXA 3DLRA 3QEWA 1SV5A 3L3VA 1ASVA 2PYJA 3WNHA 1RDAA 1TKXA 2G8UA 1QE1A 4PA1A 3CFOA 4M3XA 3T1AA 4FJ5A 4NYFA 3TAGA 1A5VA 4RG8A 4RW6A 3G0ZA 1S1TA 2G8HA 2IGIA 1WN7A 5HRSA 4AHVA 2WOMA 4FM0A 3C94A 2A1RA 3LP0A 1WSHA 2P5GA 4FJIA 2BE2A 4H4MA 1LAVA 4B9SA 3O3GA 3P83D 5SWMA 1NK4A 3KK2A 4CCHA 1BHLA 1VSLA 4CEAA 2EX3A 1JLCA 3I8DA 3V9WA 2HHWA 3ZSZA 4E89A 1RDDA 3AVBA 3LZJA 4ELUA 4DS5A 1CXQA 3PV8A 4CE9A 4BDPA 2GUIA 2E4LA 4HUGA 4PUOA 3SPYA 4CJVA 4CEDA 1U49A 4NCAA 4LH4A 4CF8A 3SZ2A 4KI6A 1VSFA 4LD0A 4NCGA 4B9VA 1RBUA 3TANA 3O3FA 1B92A 2WONA 3AVMA 1RTJA 1VSEA 2BANA 4EZ6A 1S6PA 2LSNA 3OS1A 5J2NA 4Z4IA 3DOKA 3QO9A 4CGDA 3THVA 1TK8A 3DRPA 1TAQA 3OYMA 3DLBA 2ETJA 2GBZA 4OPJA 3IRXA 1BCMA 2D0BA 4M3YA 3EY1A 5KTQA 1Z26A 3QEIA 3L2QA 1UA1A 2HHUA 4C8NA 4FLTA 2GV9A 1C0MA 4KTZA 1VRTA 3ZT2A 4CJPA 4HUEA 4CEOA 1BISA 3HL8A 4DFPA 4W5NA 3RR7A 4E7LA 2HVHA 1BCOA 1EETA 4I7FA 4B9MA 3QNNA 4ZTJA 2FBVA 1TL1A 1KVAA 1LW2A 4CJLA 5J2QA 1U45A 3CG7A 3ZT1A 4E7HA 3G10A 1C0TA 2YNGA 1BIUA 4FW1A 4FJ8A 3HP9A 4DSEA 3V4IA 1T05A 5CYQA 3O4NA 3PX0A 3DI6A 3TAFA 1NKEA 3HSTB 3K58A 5KGWA 3QERA 2DFHA 4M3RA 1EX4A 1WLJA 3ITHA 3SUPA 2G8KA 3RMCA 4KHSA 5HRPA 4PQUA 1VK0A 3KD1E 3JYTA 4Y1CA 3NF6A 2XY8A 1IKYA 4CFCA 2VG5A 1S1VA 1S1XA 4I2PA 2G8VA 3KD5E 4FZZA 3T3FA 1C1AA 1B9DA 2D0CA 3HVRA 1Q9XA 3K5LA 3KIOA 4O55A 4CEBA 1SL1A 1FKOA 4TSXA 3WNEA 3AA5X 3FFIA 3NF8A 3K5NA 1X9SA 3AVLA 3C95A 3RTVA 1UA0A 4ICLA 4CJQA 4ELTA 1Z25A 4GW6A 3V1RA 1NK8A 3KLHA 1TL3A 1ITGA 4J2DA 3B6OA 4F2RA 3ASMA 4DLGA 3NE6A 1T8EA 1CZ9A 3V1OA 4DU1A 2ITGA 3M8RA 2PYLA 3L2RA 1LWCA 3VA0A 3HYFA 3H08A 3BGRA 3K59A 3KLGA 1HYSA 3LZIA 1KFSA 4O0JA 2HB5A 1QTMA 4CJSA 3ZSRA 1VSKA 4Y1DA 4CF0A 4CF1A 3NDKA 4DTOA 3TARA 1UAXA 4EZ9A 1D8YA 3DLGA 2X74A 3V9ZA 1KTQA 3VQ7A 4FJLA 4Z0UA 5CY4A 2OZSA 1QS4A 3TWHA 3TAMA 2XY5A 1L3UA 4BE0A 1D9FA 1HPZA 1Q8IA 4Z4FA 4F3TA 5I42A 4C8MA 2AJQA 4IFYA 4CFBA 4LH5A 4DS4A 5K14A 1C1CA 4C8LA 1L3VA 4N41A 1JKHA 2KZZA 4B08A 5HRNA 3NH0A 4KI4A 4CGHA 4IG0A 1DTTA 2HNDA 3KLIA 3VQBA 5DMRA 1W0HA 4M45A 1RTHA 4CJTA 3OYNA 4KB1A 5J1EA 3L8BA 3QEVA 1XHZA 3OYDA 3QESA 3OYBA 3ZSWA 4OVLA 4DTXA 3SQ2A 5HP1A 4KFBA 4B9TA 1L3TA 4FJ7A 2JLEA 4BWJA 4DMNA 4LSLA 4DQQA 1BIZA 2OYQA 2YKNA 3DYAA 4IFVA 1BQNA 3RMBA 1C6VA 3RWUA 5JS1A 3TI0A 1RBRA 2HHQA 1RT6A 1YT3A 4W5OA 4JLHA 1RT7A
chains in the Genus database with same CATH superfamily
1VSHA 1KC8O 4HQMA 4KFCA 3H5NA 1BJZA 2O0YA 4OO1J 1IH7A 4IXCA 4IKFA 1TW2A 1YF5L 3D5RC 2KFNA 4PY5A 1YX5A 5AQUA 2BGCA 1BWFO 3FBIB 4UUSA 2PFUA 1E4FT 2M0CA 3CCJI 4AIHA 4NYNA 2QK9A 4CK2A 4Y15A 2K5CA 3FM5A 5CVIA 2Q36A 5M3MJ 4N4NB 2A1SA 3DXMB 4JI7K 1LV5A 1PJRA 2NUBA 2WV1A 3BF3A 3C7NB 2CO5A 3DLEA 1X58A 3VF6A 3QEXA 4FJJA 1MBFA 1Y56A 3JRHA 1D9DA 1XNRK 2O8KA 2HWVA 2VODA 4WXCA 5D5UB 3TEDA 4Z4HA 3CCSI 2IT0A 2OPPA 2P4WA 4XK4A 3VEWA 5FRMA 1XMQK 3CP2A 3OS2A 4HNTA 4U87A 4F2SA 1HSJA 5DD4A 1IXCA 3C7JA 5HRRA 3QPTA 4H0YB 2NS8A 1GOAA 4IBNA 2R93J 3CCRI 3O3HA 1ZBLA 1G3TA 4DSJA 1LAWA 4RMNA 2KQ2A 4XLHA 3VYRB 4OIRF 4MIMA 4CO8A 2IGOA 1STZA 1JE8A 3HPGA 2A07F 1UCRA 4AHUA 4NHJA 2RN7A 1YYVA 2HOAA 3F22A 1B8IB 1TC3C 1QHAA 4BGAA 4WQ4A 2PQ8A 3D1NI 3QDKA 3RRGA 2WBNA 1DEJA 1N78A 2QWOA 1TL8A 1R0AA 4FK0A 4DQ8A 3HOXJ 2QF7A 5FPMA 3QICA 4CBWA 2RQQA 1FYKA 2YU9J 1TGOA 1BC7C 2G8IA 5KPZA 3F8BA 2GXAA 2GWJA 1VQNN 1MGTA 1HLVA 2JMWA 3GLXA 4II3A 3AA4A 2G7HA 3D0SA 3GCMA 1BA1A 1BI4B 5AQGA 3U9ZA 4KREA 2M8EA 4AYBN 3PM1A 1OH8A 4LF9K 2PI0A 3HRUA 5L3GA 4Y52J 4IDKA 2HS5A 1ZBHA 2MFZA 2ECCA 3OW2M 1HQCA 2DJIA 4H5WA 3C2BA 4ASNA 3S8PA 1WJCA 2K7LA 5CPRB 1VSDA 3E3VA 2DW4A 4XRSG 4BXXJ 2F5VA 4LB6B 3AVJA 3UKRB 5KQ8A 1P6RA 2A6TA 4DQIA 1V55H 2DA3A 5IOZA 2HNYA 4DR2K 3FZKA 2A6HF 4BL0B 3TAPA 3HKZA 1YQAA 4CDGA 3ZMVA 5JICA 2M0MA 1NK6A 3BTIA 2YJEA 4BQQA 2D2WA 2FMYA 5BS6A 3HOWJ 1BA0A 3S3MA 1KVBA 3FMRA 2V7ZA 4PKHA 5KI6A 4C1NI 2JSCA 4CIGA 1U0JA 3J7ZI 3ZN0A 1QPMA 2I10A 2MLGA 1JXBA 2BZTA 2RKHA 4ISEA 2O61A 4OPKA 2XKPA 1ENHA 3WG9A 1DUXC 3BDPA 2Z1GA 3NRVA 3MWPA 2BVMA 2W85A 4DBRA 4M3TA 2EFQA 4KIFA 2EIKH 4BUPA 1EP4A 2P5VA 2LREA 2CSOA 5C4XJ 3VN5A 2XASA 3F8MA 4FK2A 1TQPA 2BGGA 3GZNB 1IG8A 2IS2A 1R22A 3HI0A 4O44A 1CZBA 1QU3A 1K61A 1XSXA 1NGAA 2HYFA 2Q31A 1YTUA 1NBWA 2XGDA 2HTSA 4MLOA 2F96A 4A6EA 2YX4A 3C6TA 3WTVC 2Y31A 5GAEJ 3SEZA 4HZFA 4FYDA 9ANTA 3SBTA 2XVCA 2XF7A 3A5NC 3ULDA 4DR7K 3LDSA 3AVHA 4JS4A 2FBXA 2OF7A 3O6WA 1I6HJ 1NGHA 1D1AA 3AO4A 2XDVA 4LIUA 2WAEA 3FIWA 4DFKA 1BOBA 1NG6A 4RAFA 3Q0VA 3VQPA 4BWMA 1XDSA 5E17F 5J2PA 2NVXJ 2P9NB 3W0LA 1NK7A 2HMIA 4B9NA 2HQNA 2GM4A 4XMYA 1S72I 1DGKN 5KGXA 4JKHA 3BTCA 1VQ4N 4I6MB 2HHTA 4M7YA 1HW1A 2ZSHB 3TW7A 2P9IB 4K25A 2PBDA 1WJDA 5CVJA 3EETA 3OJSA 1R36A 2YHAA 4DSKA 3MECA 2YPRA 3ZQCA 1IF1A 4M3EA 2HOTA 2VOPA 4CVNE 3L6QA 4MEXF 4BRNA 4JD2B 1ZQ3P 4G9YA 2BH1A 3PO3J 3M7GA 5B3SH 4FASD 2DCEA 3BQYA 4JRQA 5LFAA 3CMAI 1FWZA 1GUUA 2VI6A 3MWTA 4RAGA 3CCEN 1IAWA 4KKOA 1ZH5A 1X9JA 2GWKA 1SAXA 4KN4X 1RT3A 1I39A 3TU5A 2YNFA 5AQMA 3H36A 3A0BC 3M8EA 4FETA 5BPIA 4N56A 1VQ5N 1E17A 3MDQA 3ZSYA 4B3SK 2F4OB 3AAFA 4JKFA 3P31A 4KDPA 1MDUB 3K4NA 3GXOA 1MW7A 3AG4H 1FK9A 3DRRA 2Q8KA 3V6DA 1Z3YA 2CW8A 2Z16A 2L02A 4BRLA 4AQYK 3LOCA 3O9UA 1NG9A 4B8AB 3ERMA 1E3HA 1FZPB 3IS9A 3LPTA 1R4MB 2EV0A 3AARA 3NF9A 4JK8A 3SAHA 1T33A 3NF7A 3GVAA 4C3JJ 4UUTA 2ELJA 4FJNA 3P1GA 3OIOA 3W6JB 2A69F 2E88A 4BG8A 3CC4I 3TL4X 3CPWM 2AHQA 2XUBA 3PUFA 2CYYA 2RC4A 4MO7A 2GX9A 4ESJA 3QINA 1Q18A 5AFUA 1W5TA 3C2GA 2O8EB 2VWBA 1JLGA 4V2FA 1KFDA 4DB3A 2E2OA 3B6CA 1R5ID 1BUPA 1MBJA 4N9IA 1TNTA 2MSYA 1ONVA 1ACIA 3CM5A 3S17J 4IEIA 2D1VA 3HOZJ 1KQ9A 4MLHA 2JA8J 1A5XA 2EPFA 4XSXF 1NGCA 2G7UA 4YEJA 3JRDA 3SHFA 1HDPA 3JAMZ 3M8PA 3CF5F 1A5WA 5LJWA 1IBKK 2PJRB 1UWBA 3AO2A 4CERA 5FFXA 1DP7P 2HNHA 1ASUA 4HBLA 2O6GE 2UWMA 1LWEA 1NK0A 4DR4K 2JA5J 3E66A 3L2VA 1J6ZA 3F6OA 1SD6A 2ASOA 4D1QA 3Q7BA 3CZ6A 2RHKA 1OCOH 1SVLA 3I55I 3IV5A 3HM8A 5CJ9A 2O5RA 3BR3A 2OCCH 3SNNA 2V52B 4KHPK 5DUIA 4IZZA 1HXDA 4NDLA 4BRKA 4X65K 1GOBA 2L9SA 4O8KA 5B66C 4DKWA 4W5RA 3Q5FA 3M8SA 1TK0A 2XF5A 5GAGJ 2VE9A 3GMEA 2VXDA 2LBFB 4RM2A 5EOYA 4AH9A 1FJGK 2X9DA 1LCUA 3KP5A 2E6LA 1IG9A 2PMHA 1YJ9I 4UUVA 2VJIA 1I3QJ 2JUGA 3CO7C 2JN6A 4J2AA 1TQMA 3ZMUA 4EJOA 2XSDC 4CGGA 4WK8F 2R7YA 4RCHA 2PMZA 3NH1A 4DV5K 1N25A 2W7NA 1YHQI 1IG7A 2M7AA 3ULEB 5AZJB 1BR4A 4CK3A 1N32K 1NJZA 1MDMB 1QSYA 2QYOA 2JGUA 3WNGA 3JRIA 2XB0X 2ECBA 2JRMA 1E3OC 1TWFJ 1ITYA 3R6MA 5AQXA 3OYLA 3ZQ7A 3ENHA 1FOKA 1UG0A 3IL2A 1U9OA 3WGIA 5KVRA 3RVCA 3HK2A 4WF9L 1HKCA 4FWPA 4DR3K 3ULEA 3HM5A 3O2PE 1NGDA 2V6EA 1JJ8C 4G6DA 5E3NA 3MX2A 2W24A 4GVMA 4B3OA 3O8GA 4HF0A 4I9QA 3CHWA 2Y75A 3L2CA 2FUG2 1DDNA 2CGKA 1FW6A 4NNJA 1OCRH 4FWQA 3CJRB 1XWLA 4CJ5A 4MGRA 3PIPL 2BV6A 3K9TA 3ZETB 4D7MA 3DOLA 1E3PA 2VT3A 1FP1D 1SANA 3CCVI 4JKDA 5CZ1A 1MMAA 5C15A 1Z3XA 1KU7A 1SKWA 1P7IA 4OMZA 3WE2A 5EEHA 2IA1A 4EEFG 4MO5A 5E26A 3DM2A 5EG0B 4KA4A 5AZIB 1K73O 2DTZA 3VEOA 1GVJA 2F4IA 3V7CA 3RSEA 3TAEA 3T1YK 4GFBA 5J1YA 4H0OA 2DPNA 5KPRA 5LGTA 2P9PB 1V5GA 5JHUA 5IYCJ 2JTVA 3OYGA 2RVCA 3L4QA 1OCZH 3D45A 5KHDA 2VGMA 4IFEA 4ANJA 1KONA 3IAS2 1K83J 1JHHA 1UFMA 2TDXA 4LK1F 1VQMI 1REVA 4BRHA 4B3MK 2HHSA 3G4SI 3H5AA 1IKXA 3ENOA 3RMDA 1LKXA 3VGLA 3CCJN 1W1WE 4LG3A 5FKKA 4A0XA 4AHTA 2PY5A 4HQEA 2LF7A 2HHHK 3QP6A 4I0BA 2FSKA 4RGXA 2ISYA 3LSJA 5IP7J 2IAIA 2M30A 3IRRA 1PUEE 1A36A 1FMVA 4BACA 1Z0XA 1O7LA 2O03A 2ZJRL 2R5ZB 3PNYA 1GV5A 4DTRA 2E1MC 3ID8A 5HL7L 4PGGA 4BREA 4CCKA 4YOVA 3CQ8A 3U9GA 3WHBA 1FX7A 4GYIA 2O4GA 3AVGA 4CHOA 2XF6A 1T6CA 3ABTA 4LC9B 4OKKA 5LY3A 5DEQA 2QVOA 4YDUA 4KUMA 1HF0A 4HLXA 3THXA 3SK3A 4OLBA 1TKZA 4GVEA 4B44A 4ZTFA 1WWXA 1TV6A 2NRRA 1N75A 3IHUA 4HPQA 1R5GA 1G59A 3FZMA 3MXJA 2ID6A 4AVZA 1HKTA 4CI6A 3KP2A 2YHBA 1N33K 5JLWA 4FLZA 2V7FA 1ZGJA 3CCQN 2ZBKA 1NK3P 4F3QA 3AVKA 1G8XA 4PFPA 1HCRA 3T69A 4DFJA 2ZMEA 1C0UA 2O8FB 1XMOK 4ZYHA 3HRSA 1IDYA 3I53A 3HEFA 4BRAA 3RPUA 1RFQA 3AVCA 1WGXA 4CJEA 4CBUA 3GTPJ 2QSHX 1LDJA 3AO5A 3GTQJ 3S1RJ 3QETA 2GA2A 1XTAA 2MBFA 2OV7A 2PJPA 3H3NO 3HT3A 2HPMA 3THWA 2P5OA 4UXNA 5CE3A 2DLLA 2Q0OA 3PSFA 4AVPA 3DLAA 3IKTA 5AQJA 3A01B 4I0AA 4C23A 2LDUA 3J7ZO 3PX4A 2UU9K 4KISA 3CF5L 4ILHA 3F6VA 2XAUA 2IW5A 3HIFA 2UUBK 3UKUB 3CDHA 4IJAA 2OA4A 5CKTA 5E41A 3H0DA 2HVIA 1RDWX 3OL4A 3G73A 3SQNA 2OA8A 2F5DA 3HGYA 1D8JA 5HOOA 4M41A 3NGZA 4M3WA 4DV7K 4H5NA 1CXUA 2W1OA 3I3LA 3T8TA 3ZQHA 2HQAA 3RIRA 1XGOA 4AM3A 1SV5A 3I56N 1Z67A 2BUPA 3I4PA 3K58A 3QERA 1P90A 2G8UA 4WCEL 2LTPA 4JX4A 5F6FA 2Y69H 3G71I 1FT9A 1BU6O 4NYFA 3P9CA 3T5XA 2L9RA 2HXOA 2QM1A 3S2HJ 3WTSC 4U67L 1WN7A 3WXIA 5CVRA 3D2EB 3D5LA 4DV0K 1UELB 1A6IA 2R3SA 3ERED 2JA7J 1LPQA 4B9SA 2D0PA 4X62K 3DKYA 3VF2A 5SWMA 1KU9A 3S1MJ 1NK4A 1BHLA 2A61A 4LIVA 4CEAA 3CQZJ 4QTRA 4BHBA 4OPHA 4EAHD 3E6MA 5FPDA 4OPJA 1VF9A 3K4BA 1HKGA 2UYTA 4CEDA 2QWNA 4O8UA 3ELKA 4CICA 1VSFA 4CZKA 3DWLE 2VE8A 4A5MA 4ZZLA 4FOEA 5IT9Z 5F1XA 4ZYAA 3RJPA 4BY1J 1VSEA 3KHYA 1T08B 3D7EO 3J81O 5AQHA 2E5ZA 2HI3A 3QO9A 1VQ6N 5GIOA 2GBZA 1LVAA 1MIJA 1YJNI 3IRXA 3PIPF 4PJLA 4ZDPA 2QKLB 2D0BA 2ZSIB 1EF4A 1Z26A 2KDOA 2YU3A 1BDGA 4A5BA 2MH9A 4C8NA 1S72N 4L18B 4HV6A 3EUHC 1MBGA 4JX6A 1C0MA 3BZCA 2DMUA 5KCMA 1AKHA 2H8RA 5C3EJ 3GTOJ 1TW3A 1VRTA 1ZC6A 4FWNA 5A2QZ 3V42A 4E7LA 4IWVA 2HVHA 1BCOA 2HR3A 3HKZN 1APLC 1B6AA 1ILYA 2JPCA 3QNNA 1MJ9A 4M6XA 1TL1A 1KVAA 2OJED 2Z1DA 5J2QA 3FGUA 3CG7A 1XB4A 2KPMA 4PJNA 2XROA 2E2JJ 2YNGA 1AU7A 1HDDC 4FW1A 5E1WA 4ZYEA 5KAFC 2R7SA 4KH6A 2R7OA 1BI2A 2FJ1A 2GIZA 1Q1VA 2GEMA 3J7AP 4CGZA 4ZH4F 4JYAK 3F5TA 1VQ5I 4FHTA 4I02A 1J75A 1R59O 1YJWN 3PNTA 1W0TA 3KD1E 3HPOA 1LFPA 4Y1CA 3NF6A 3HZJA 1X3MA 2VG5A 1FBQA 4I2PA 4FWLA 3JRCA 3T3FA 2E1NA 1W97L 3HB9A 1HA8A 1KD1O 1S5LC 2COMA 3R60A 3W6KB 1XSDA 1SL1A 2NVQJ 2KKZA 4TSXA 1ETVA 3K9JA 3CUQA 3HTVA 1LNWA 4PCQA 5F2RA 2VASA 2FEZA 1YW8A 3CC4N 2LY1A 5AQPA 4ELTA 2EBIA 2HQRA 2BHZA 2ESNA 3I71A 4BJTA 4F7ZA 5J8CA 3K4MA 4IF4A 1T0FA 2XSJC 2ZXIA 5AIPA 3B6OA 4A61A 4DUYK 2DN0A 1I50J 4UVAA 4DLGA 3NEUA 4G94A 4Y3OA 5IP6A 4FWOA 5IT9O 1F1ZA 1P4AA 2PYLA 3FK6A 4BRCA 1X3ZB 2XGEA 3A03A 3H3VK 4A3GJ 1NJIO 5CYVA 3ATVA 3G3ZA 3QRFF 3RKQA 1QPIA 3H08A 3TTDA 5IWAK 5E1XA 1AOYA 4AILC 1ORKA 4CJSA 5DM7L 2BYVE 3HZ6A 4ABZA 4CF1A 3NDKA 2JVHA 4OIQF 5KQDA 2FNAA 4DTOA 2K4BA 2D4WA 2DMPA 3V9ZA 4OWRB 1U6GA 2IIRA 2YJFA 2WY7Q 2W41A 1LUJB 3TWHA 2XY5A 4A3MJ 3ZQLA 2R7DA 3O9TA 3R1XA 1HPZA 2P9SB 2YX6A 4F9OA 5F1RA 5EJCA 1TQIA 1K79A 4CUGA 3M4OJ 2ELKA 2LC2A 2EH3A 2FF4A 4LH5A 2KHMA 2ACJA 5FLVA 1Y1WJ 1BIBA 3REOA 3MCPA 1L3VA 1JKHA 1FNNA 3VERA 4BY9C 1WCMJ 3NH0A 1MWKA 3G25A 5JLHA 3CJ7A 1ON2A 4JHDB 4EHUA 1RTHA 1FSEA 2XPWA 1XHZA 2DODA 3H3ZA 3OYDA 4EATA 4MQ9F 3MK6A 3SAFA 4DTXA 3FZVA 3SQ2A 2LKSA 3AY9A 4B9TA 1J7KA 4XN0A 4KITB 1BOAA 4BY7J 3AL0C 4BWJA 4DMNA 2YKNA 4DQQA 1YHQN 4B43A 2OYQA 2DT7B 1K78B 2FBIA 1C6VA 1N36K 5K5OA 3PO2J 5EEGA 3RWUA 4A3EJ 2DO7A 1RT6A 4KTQA 1B9NA 1FC3A 1BC8C 4W5OA 2Y1JA 1R1VA 2XAQA 4FCYA 1NMDA 2QWPA 4DQPA 1LW0A 2IBDA 4FX4A 3LWLA 4DLEA 5LD2C 2ZKZA 2WTEA 3LL7A 1JL2A 3LQQA 3HPHA 1SMYF 4LITA 3ZMZA 1IKVA 4CECA 2VL8A 2EZHA 1WBDA 5TISC 2JK3A 4RS8A 2FXUA 2Y1IA 3K5MA 3KP6A 1ZAOA 4XONA 4GV6A 3M8QA 2AXTC 3LDNA 1KRPA 1FIAA 2H1KA 3L7WA 2FOWA 4HNVA 2ZGYA 3O5BA 1NJXA 2NXNB 1HUXA 1RTDA 3HOTA 4HF2A 3CCVN 1YITI 3KP4A 2BE5F 4G1QA 5AJ3K 1TNSA 3VOEA 1X1DA 3UIQA 2X6WA 2UXCK 4RWTA 1PYVA 4DUZK 1ETXA 1S1WA 2F5EA 3LFKA 2MGQA 4R1HA 4M3GA 3W2AA 3SUOA 1ETWA 3S1NJ 4ELVA 3P5JA 2HEOA 1VSMA 4CZGA 4M3UA 3SUNA 1VQ8N 3GZ5A 1QZ5A 4CBXA 4MQVA 3ISPA 5GAHJ 3NGYA 1QQIA 2NRTA 4CGIA 5SZTA 3LM2A 1G6NA 4G8XA 4NXNK 1SAZA 1ZELA 1FYLA 3CPEA 2DAOA 2NRAC 2H27A 2PMUA 1LJ9A 3F73A 3E97A 5C2FA 3GO5A 4JKEA 3DPTA 4LLNA 2R4GA 1S3JA 1B1BA 2K9MA 4E7KA 1LEBA 2HNZA 2PBIA 3ZCOA 5BPNA 2ASPA 4Q4ZF 4IZ9A 3SQ4A 3V8LA 1X2MA 1JHFA 4C2TA 4BE1A 1RT4A 3DCFA 4DSLA 3K9KA 4ON0A 4B1XB 4M74A 5IYBJ 2NRXA 3SUQA 1NKCA 4HEA2 2JWLA 3AO3A 3P9KA 1IW7F 3AVFA 4ENNA 1BR2A 3S3NA 1XPXA 3QP5A 3QU3A 4FXDA 4H4KC 2ZJ2A 1JKQC 3SZGA 3CUOA 1FTZA 2G0EA 1XHXA 4DR1K 1YUWA 1ZYQA 4M3ZA 3CCUN 4LFUA 5JI6A 3C6UA 4B3TK 3TOBA 2LBFA 4ILGB 1J2XA 1JXSA 4BAYA 4YIFA 4QPOA 4CESA 5JVHL 3S9HA 2P1JA 2QM3A 4Q47A 2L3DA 1VFCA 3LAMA 2VC1A 4KHYA 1S7OA 3U3GA 5LHHA 3LL3A 3VMFB 4FZYA 2LSOA 3DP7A 3ZQGA 1HRHA 1A04A 1R00A 4KTWA 1JUMA 1QSLA 3KCCA 1ULYA 5LHGA 2F9TA 3VTIA 2IDOA 2COBA 3BG7A 2QLZA 3I0SA 4DV4K 3L0QA 2X4HA 4DJAA 1F43A 4IPAA 1K9MO 3QFPA 2RNJA 5EF6A 1OVQA 1D8KA 1DU6A 2VG6A 3F21A 1MH4A 3T1HK 3KLEA 5I3UA 4LFAK 4BS9A 4IHWA 4O5BA 3SMPA 4A0YA 2MW8A 3F8CA 1H88C 4PSXA 2E7WA 3QOEA 2QEXI 4B8XA 1SS6A 1FMWA 4M7XA 1QQCA 2QQ8A 4BRIA 1T7PA 1IKWA 3HL2A 1WI3A 2UV1A 3QMLA 1S7EA 3EUAA 4EM2A 1X9MA 3FXRA 3ZSOA 5BRFA 1B59A 4JOMA 2EWSA 4H5VA 4BKXA 2V6CA 3BJ6A 3HM9A 4YFNF 5LMNK 2XB5A 2EFWA 3K2PA 3JRBA 1RESA 5D6FA 4AHRA 1GXQA 4FTHA 1Z7UA 3V1QA 3VQ8A 1K6YA 2HOEA 2P6TA 2DK5A 2M4KA 3IH3A 3KK3A 4FM2A 3QPLA 2ASMA 1NK5A 3O8MA 5FROA 2W6KA 3ZOBA 3KETA 4AF1A 3K10A 4OX9K 3HYIA 2P9PA 2IS1A 3F72A 5J40A 3FZFA 4DHYA 1NGBA 3QYBA 4I2QA 1OCTC 4FVMA 3BP8A 3HHGA 2LFBA 3ZSZA 4CZIA 1RNHA 2AS5F 4FJKA 4K42A 3CCLI 1ZG3A 2FLOA 4K43A 3D0PA 1S6QA 5LGUA 3OMYA 2RREA 5AQIA 3M07A 3FK7A 4HF1A 3EDPA 4L0ZB 4B1RA 3TOAA 1ZK8A 2H6BA 3FZHA 2EA2A 1O13A 1OH5A 1TUYA 2K02A 1OPCA 3VETA 4DSFA 4K0KK 3V8JA 3JAMO 4IEEA 2CS3A 4YIIA 1QZYA 4N0BA 2QWQA 5C24A 4M9ZA 4CCOA 5IP9J 3M5RA 2PN6A 2HBJA 3AL0B 1VQON 1ZG5A 2OANA 1U4BA 2QQBA 2DU9A 3L1PA 2ZFUA 1NJWA 2CU7A 1O1WA 3EN9A 3G2BA 1OR7A 4JK1X 6PAXA 1LOTB 1W7PB 1VQ6I 2CQKA 4DZPA 5F04A 3TR8A 4FX0A 4GCVA 1JLAA 1GDTA 3WXMB 5LEKA 4D5FA 1NM1A 1YJNN 4HSTA 2P9KB 2PLYA 1K8KA 4KH4A 4BQOA 1WPKA 4EV0A 2R5YA 2WC9A 5M1KA 4JI8K 4ESFA 1G2HA 3D6RA 4KHUA 1HW5A 2DT6A 4XLNF 3D5SC 3VYTB 1R7JA 4KV8A 4IOCL 1IGNA 3LAKA 4H0PA 1PVEA 1G3YA 3S15J 4E7ZA 1REPC 3K6GA 2NZTA 4UUSB 3G6EI 1TVRA 1W4MA 4L8RB 4DTJA 3JREA 3T8RA 2EZIA 1RT2A 3OJUA 3SCXA 2UUCK 4LFCK 2PEXA 4LGWA 4HRIA 1KVCA 1MBHA 2DI3A 1XGSA 3GUDA 1VZ0A 4D7NA 3CQXA 3LA7A 3ZMDA 5BPLA 4LD5A 4I6MA 3ZEUA 2E6MA 4N76A 2DA1A 5M5WJ 4B9QA 1V54H 4JBAA 4HX4A 4ZJZA 4RBOA 4BJ6C 4BEHA 1SFUA 2K9SA 2ZD1A 3BWGA 5EXWA 4OKJA 3S3OA 4Z94A 4LY7A 4GO1A 4OGEA 1ETKA 2WAQN 3FKJA 1F5TA 1I27A 1QHHD 4PJJA 1TYQB 4KHNA 5BPDA 4KT5C 4M3BA 2H6CA 4AM6A 4KAZA 4CFAA 2HW3A 2ESHA 2V1XA 3ZR8X 2XC7A 3MAQA 4FK4A 5LHIA 1XSVA 2ZJPF 4DQRA 2P7CB 1X1CA 4B3XA 2R7QA 4MLEA 2HTJA 4YDUC 2FQ4A 3GFLA 1SVMA 4UV9A 1OISA 4F3OA 4BVOA 2ZJQF 3FHZA 2E5NA 2JPBA 4EJUA 1NU0A 5M5YJ 1T44A 2P9UB 4NLBA 4EP4A 4M42A 2QWWA 1R71A 3CDIA 5ICGA 3H1QA 2XAJA 4XOPA 1SAUA 1CF7B 3HSFA 3TMOA 2R7FA 3L9FA 1P7JA 3ASNH 3LWMA 2P6SA 2FF3B 4DU3A 3HUGB 3PQJA 2IGNA 4E7IA 3ZYYX 3GG4A 2E36A 5BREA 2GXGA 3KEOA 1IZ1A 1MH3A 3FF5A 5D4SA 2R7ZJ 1SKRA 1OH7A 1JJ2M 2QA4I 5HODA 3A2KA 3IG1A 3F23A 2BY1A 2QXFA 2EB7A 2XY7A 4ZZDA 3NQOA 3NHGA 3SFZA 5E79C 1C0GA 3QBWA 2V1NA 2VBYA 3ZPLA 4BRFA 3LALA 5HS7A 4DFMA 3IWZA 4RB0A 3BLYA 4BR5A 4LMYA 2E8AA 1MU2A 4DR6K 2VT2A 1IV0A 2EV5A 4UNOA 4JI0K 2WB1A 2V79A 3EKUA 2O8BA 2NNWA 2IVNA 1RETA 2ME0A 3AO1A 3CP8A 2F5CA 3LWFA 4J19A 3P7NA 3KP7A 1N77A 3TDUC 2QWRA 3BOQA 3ZQFA 4DG1A 1RCHA 3NWTA 2X6NA 3LP3A 3X2QH 4YFXF 3E01A 4RW7A 3BY6A 1HQUA 3U4LA 3BZ6A 4P9UA 1FP2A 3HSCA 1JLFA 3WTZA 4N9HA 2OTJI 3J7YJ 3KVGA 4M9XA 2C6YA 3C0BA 2EFOA 4A62A 4B1WB 4EP5A 3TGNA 1P9QC 4DU4A 2E2PA 4XH4A 1TBXA 4FLUA 4YOUA 1J09A 1IN8A 2KQRA 1BJAA 3FWEA 4EMSA 2Y0SN 1MMSA 1WAFA 1P8ZA 4IG3A 1I3AA 4BQAA 4A2BA 5C0YA 3WU0A 2LF8A 5BN9A 5HDKA 3CYMA 5EU7A 3VB2A 3KZZA 3ZX0A 4JS5A 5HROA 1KSPA 2WFBA 5LGNA 1W9HA 3S16J 3QODA 4BHCA 2P9SA 1YITN 3H0GJ 1GLNA 4LG0B 1LFBA 1TT5B 4KH5A 4LF7K 1N8RO 2DDBA 2V26A 1S9EA 5BPMA 3NH2A 1BA5A 1JKPC 4OJRA 4KYWA 3CI5A 1JLBA 3QPHA 5CVUA 5FLXZ 1C0WA 1MSEC 3KWIA 4AM7A 4WXDA 1ZARA 3K1NA 2VGNA 4EJVA 5HBMA 4X6AJ 2CUFA 3CCYA 1FY7A 3ZX2A 4NO7A 3DTKA 3GEZA 3MAJA 2EFNA 2QBYB 4NB4A 1IO2A 2FU4A 2M9HA 4L5JA 2W25A 3CERA 4RW8A 4C8KA 1XUPO 1R6RA 1IBMK 3EKSA 4BHPA 1W7PD 5IY5H 4Y0WA 2BY0A 4A69C 5M1PA 3RSEB 5EGOA 4CGJA 3L2WA 2NRZA 5AQLA 2NS7A 2RN2A 3THYA 1KYWA 5AIQA 1YRNB 2FD5A 3OYHA 2NRVA 1NNEA 4DTSA 1XMAA 1F21A 3BY5A 5C42A 1WH5A 1VSIA 3ESWB 2WBMA 1VQ9N 2EV6A 4P5OA 2Y9ZA 2M87A 2XRIA 3F8FA 4WFBL 3THYB 2ZB9A 4I99C 3CF2A 3OYCA 5BMZA 3NFAA 3NMUA 3O4QA 1JL1A 1RRJA 3J81Z 3COAC 2XGXA 3ALYA 2DFIA 1Y97A 3CUQC 5AFUH 1Q86O 3E6CC 1QBJA 1JCFA 2ZCWA 3WNHA 1RDAA 1TKXA 4H03B 2K9QA 4CZZA 2V9PA 3GW2A 2KLOA 2NLXA 4FJ5A 1WKMA 3A02A 4BRPA 1QVGM 1YLFA 5F08A 3DEWA 4A3KJ 5C10A 2E2IJ 2HDDA 3ATUA 4R79A 4AHVA 4DV6K 4FM0A 3O4WA 4NQWB 1WSHA 5E20A 3LP0A 4FJIA 4BVPA 1K6OA 3O3GA 4M72A 5J47A 3CD6I 2ZF5O 3V8KA 2O8DB 4CCHA 4HAMA 3LA2A 1VSLA 5H20A 1JGSA 2DJNA 3O6BB 4PJMA 1JLCA 1RR8C 2EX3A 1UAAA 5L3DA 4MTDA 3GTKJ 1XG1A 2M34A 1YVNA 3WEEA 2CQXA 1XS9A 5JLXA 3H46O 3LZJA 1SQKA 2E4LA 4DS5A 4ELUA 1PP7U 4M73A 2W84A 3MCAB 4PUOA 3TTCA 5HLGA 4C1NK 1XMKA 1O3RA 2XV4S 1Z91A 1ATNA 3HP6A 2HZDA 2WONA 1RTJA 3AVMA 3FHNA 1T6DA 4G6QA 2BANA 1S9HA 2HYGD 3TSPA 1S6PA 3WTUC 2H94A 5FD6A 2AA4A 2LSNA 4I76A 2KZVA 3DOKA 4X64K 5J2NA 2BHYA 3HJEA 3K1MA 2MD5A 3OYMA 5TKWA 4RB3C 2L01A 4L9NA 5DYMA 4CCJA 3WTXC 2E1YA 4M3YA 1Z77A 1QHGA 1XGMA 3JS6A 3QEIA 1UA1A 3IUCA 4GGGA 2HHUA 5JLFA 4R8HA 1ZTRA 2BEOA 2R0QC 1K4SA 4HTLA 4FLTA 2DBBA 1U8RA 1Z9CA 3LSGA 3I4NJ 3TPQA 2K86A 3IH2A 5ICFA 4C9YA 4M3DA 4D5CA 2HSTA 3ENBA 3ZT2A 2RDPA 1Q1HA 3AG2H 3KYCB 3HL8A 2Q1NA 4CEOA 2GIVA 1B8IA 3CCLN 3RR7A 5K7HA 1P4WA 3CCSN 3RPQA 3R0JA 2QSFX 4IRHA 3VEPA 2DK8A 4B9MA 3C18A 3HC7A 1KQSM 5JR3A 1D0ZA 1MBEA 3ZT1A 2O8FA 2EZLA 3AG1H 5B5EC 2R7TA 2J4RA 1BIUA 3G10A 3OBYA 3CXCM 2P9NA 3GFIA 3ONQA 3PX0A 4XH1A 3TAFA 3BTLA 3LSKA 2L7MP 3L09A 3RKYA 4M9SA 3ITHA 1EWRA 3BCBA 1M1KO 1NGEA 3SUPA 3WG7H 4F55A 3EE9A 4JN4A 4E1JA 2E35A 2YS9A 3QU6A 3JRGA 3LAPA 1V4TA 3JYTA 1UMQA 2M5WA 4DV2K 3WU1B 2MD0A 4IQ4A 1IKYA 2TCTA 4XQFA 1S1XA 4CFCA 2G8VA 4PK4A 2EZKA 1B9DA 3EZWA 4M3FA 4KBOA 4BXUA 3NWSA 2CUJA 1R5HA 2HZTA 3MEXA 3K5LA 1SL0A 4G9ZA 2P0WA 3WNEA 1GV2A 3NF8A 3FXLA 1VQNI 2K85A 2HF4A 3C95A 4Y7NJ 1BW6A 1BR1A 2DYSH 4CCLA 1UA0A 1YW9A 2MABA 1GHCA 1Z25A 4GW6A 3DLLL 3KLHA 1TL3A 1ITGA 2E1ZA 2I8DA 5FKLA 3FXMA 2UZKA 1J5YA 1O3TA 3ASMA 3CMMA 4PZJA 4F93B 3DLLF 3NE6A 4GKJK 1CZ9A 4DU1A 2L0KA 2KIMA 3DFGA 1ETYA 3CJBA 1BG3A 3NVMA 3HSEA 2A5WA 1DPRA 1LVKA 2PAVA 3IAM2 4XEIA 1FEXA 1I6XA 2HDCA 2IGMA 4O0JA 1ZKGA 1OFCX 2KDZA 3GZ6A 2HB5A 2Y48A 4EM1A 3ZSRA 2L4MA 4N4OB 3RQ4A 1X3UA 4CF0A 3GLLA 5ICCA 4FISA 2KT0A 3VWBA 2UUAK 4XKBA 4OPAA 2X6XA 2D1KA 4FJLA 4CD1A 1GLJO 2EWNA 2OZSA 3TAMA 1UJ8A 4ZDOA 4BE0A 1GLLO 4OIOF 5HNHA 1LDDA 1T56A 2RAEA 3IFRA 5I42A 3GBTA 3BR2A 3OOPA 4A3BJ 5L3CA 4C8MA 2PFBA 4UVCA 3KE2A 1C1CA 4C8LA 4N41A 2KISA 1Z7LA 3BF1A 5HRNA 1WVRA 3E9OA 3BR6A 5F0CA 5LLQA 3I33A 1Z05A 5BR9A 1OYIA 2A3SA 3HG9A 3KLIA 4XRFA 5K5QA 3OYNA 5AQQA 1OQYA 3AAQA 5AQZA 3QEVA 1HSTA 2ICWG 3QESA 1HR0K 3SBGA 1T38A 2WADA 4ITVA 1G3WA 5FGMA 2XRLA 1BIZA 3LSHA 1X9SA 5CQGA 4BRMA 3RSNA 1RBRA 1XDUA 4DCHA 3TANA 3CMEN 2GA1A 2L2OA 1VRUA 3GTJJ 3ASOH 3KJVA 3VOVA 1O4XA 1WZ2A 3I0RA 4WFNL 3K4KA 4AC0A 3FLCO 3WODF 5TRDA 4DQSA 2KRCA 1MWMA 3RZDJ 2VXZA 3WQUA 2GZWA 3BZKA 3EYYA 4RDUA 2RF2A 5C12A 2IEKA 1U5TC 1S29A 5J2MA 2EFPA 3VEZA 2KMUA 3GF2A 4BC2A 3F0CA 2IXSA 3HRMA 2HKOA 4LLGF 2EINH 2KP6A 1S8NA 2M3AA 4R5PA 1FTTA 3E1SA 4C2MJ 3PY8A 2LP0A 5ED4A 2WV0A 2DMNA 2P81A 2WAQA 3BG6A 1AA7A 4II2A 3P4IA 3MXMA 1JKRC 2M45A 2UXBK 2DYRH 4MFEA 2NVYJ 4E1NA 4NLCA 4CYCA 1W36D 2KJBA 3S93A 4AD9A 1A5JA 3JXUA 3E5QA 3H92A 1RTIA 4LOCA 3VF4A 3VGKA 1MNEA 3WXKA 1HKBA 1MD0A 1D1BA 2MC4A 2VN2A 3BTJA 3OYEA 1EKEA 2VKDA 3VSKA 1GLCG 3QFUA 2NS0A 2DPDA 4IQJA 2CFXA 3AVIA 1ZBFA 1F9NA 1TKTA 2Y0MA 1V5EA 1CF7A 1PDNC 2VQHA 2X48A 4FPAA 3NCIA 2O8DA 4PL7A 4BBRJ 3TO6A 3PNVA 4EM0B 4ZDLA 3ZGKA 1A31A 2DXIA 4B3AA 4MHGA 2XPUA 4DBQA 1QQMA 2JVGA 2F7TA 4I09A 2PMZN 1GVDA 5ILVA 4I7HA 4KMUX 4FJXA 2LVSA 3VA3A 3BG3A 2P8TA 4FE7A 4IHYA 3OBWA 1U5TB 3FXUA 1TYQA 3L4IA 2ZXWH 2DMTA 4PKIA 4GMJB 1I5ZA 3V7RA 5GIPA 3DMJA 3AA3A 3F2KA 5FDLA 4AHCA 2G8FA 4D9JA 4BH9A 3OYFA 1YFHA 1TWAJ 3B02A 1SFOJ 1MA9B 3H35A 3DXKA 3VFZA 2E2HJ 4GDFA 3E0JB 3FZLA 2VWJA 1VQPN 4A0ZA 5FJ8J 1J53A 2XAFA 4MFDA 1HQEA 2IAJA 2VCPA 1JUPA 1U47A 5DS9A 2YX7A 5J4VA 3W3CA 2B63J 5FPNA 4CHQA 3RYPA 1H9TA 4XIUA 4ETSA 4KIGA 4DTUA 1AWCA 5HDGA 3VQEA 2CRGA 4HX8A 3QPSA 3S14J 1RBVA 1KQ8A 4QIWN 3FFKB 3OL3A 2PG4A 4A3IJ 3CIPA 4FW2A 3I55N 1J5OA 1P92A 2E60A 2E5LK 5IOYA 4BR7A 2EHGA 1TK5A 1B4AA 2OPSA 3DJCA 2BXYA 2YNHA 2ZJRF 2HHXA 3FXQA 3CJ9A 3S1QJ 2DTRA 4ZYGA 4CCMA 1GT0C 3ZSQA 1V4RA 1EXQA 3NBPA 1Q7YO 4BR2A 4MDAA 2ZXJA 2OZMA 2O3FA 1DGRM 1R1TA 2AXLA 2BBYA 2E19A 3NARA 5DDGA 3EL2A 4JI4K 3KK1A 1YJ9N 5EZHA 2FBTA 2VWKA 1HPMA 3T19A 2R92J 4HA8A 4E6KG 4XLPF 4WCGA 4O3MA 4YIRX 4CK1A 5CR4A 3O3KA 1EV7A 2YCHA 4L5EA 4K8XA 2NVUB 5K7ZA 1K4TA 4H4OA 3LSPA 1ON1A 3FM3A 4O5FA 4A6DA 1R9TJ 1U2VB 2X78A 4K2EA 4DV1K 3PUBA 1OH6A 3O1WA 4IOAL 3PFIA 2QSGX 2KIFA 4C3IJ 4S04A 1JI8A 5AQVA 2V1UA 1QZ6A 1BIAA 3J81K 1OCCH 3ZT3A 3OS0A 4O0IA 2XGCA 4AUXA 4DTNA 5B1BH 3KLOA 3W6VA 2OPQA 4XRMA 2Z3YA 4DV3K 2FBKA 2VIXA 2XAGA 5AQWA 4W5TA 3EEQA 1WJBA 2I5JA 4CIEA 1VTNC 2H1LA 2O7OA 4BBSJ 4RGRA 2DTUA 2ZE2A 1OR7C 3QQAA 2YV0X 3A5MC 1NK9A 2NYXA 2R7VA 3CD6N 2X1CA 1EH8A 1EA3A 3VTHA 3PO4A 3CC7N 3H9GA 1SL2A 5BRHA 4XBFA 4CZLA 4J2EA 2DOFA 2MC3A 1FKPA 2YHYA 2RKIA 2V1DA 2VQLA 2G8WA 4EQQA 1NOYA 1E3MA 4QCLA 3RRHA 1K7AA 3BJOA 2KRFA 5L3BA 5FKMA 2GAUA 3OYIA 3GTLJ 4UQGA 1QZZA 3FMSA 3E9PA 5FFZA 1Y0NA 4M63C 3BR1A 4IRGA 5FB2A 1Y8RB 2R5YB 1PUFA 1CGPA 2ISZA 5L3FA 4LJZF 3CCRN 4HUFA 4H0VB 3S41A 1RPWA 3WTWC 3QWLA 4YY3K 2RNGA 3JSOA 1WSJA 3VQQA 1SUQA 2ATQA 1I1GA 2DA2A 2LKXA 3ZQQA 3M3YJ 1WOQA 2P9LA 1NKEA 1QRYA 2W4SA 2ZJQL 2GTDA 4KICA 3MN9A 1VQLN 3MEEA 5KGWA 3THXB 1HNWK 3UE5A 4S0HB 4CGFA 1ZR2A 1YIJI 3KK7A 3S2DJ 2VPLA 4YELA 4BDZA 3Q0WA 2VG7A 3QLHA 3BPXA 3KFWX 2V4JC 3VDXA 4ZC3A 3KTQA 2CW7A 2J5OA 3ZEUB 4YOYA 1ZBSA 4FM1A 5E8IA 2WAFA 3CJNA 3TABA 5AONA 2BW3B 2BXZA 1IN7A 4I98B 1O3SA 4Z2YA 5HS8A 4Z4GA 4UY8O 5BR8K 2NAZA 1WI9A 1XCBA 4KN7X 4B1UB 3C2HA 3WTTC 4FWKA 3VEYA 4BXFA 1RUNA 2VUMJ 4MFBA 3OR1C 1OYYA 4G7OF 2Z2SB 2FQ3A 3PL8A 3MMVA 1ZRCA 1U3EM 2JT1A 3H3UA 5GTIC 1U48A 2BW3A 3IC7A 4PJ0C 3L3UA 4Q5VA 3HO1A 1TAUA 1NJYA 3D2EA 2F4VK 3EPZA 4CF2A 3UNGC 4J2BA 3G1OA 1YOVB 1SFKA 3CCQI 3VSLA 2Q97A 3TSQA 3ISNC 5FPEA 4HG2A 1DGWY 5AZJA 1YTAA 3QIPA 4L9VA 4OLAA 1MBKA 1S22A 1W7AA 1Z6RA 1SKSA 4B4CA 1SFEA 2NNYA 3BUZB 1RT5A 1N34K 1Q82O 3DPUA 4RB1A 1RBSA 4JNEA 3CESA 2EQRA 3HHHA 3LFUA 5ADXH 4AHSA 4IO9L 4FPBA 2BDPA 1YX3A 1P2FA 1UHSA 4PFOA 4U0VA 3ZRGA 3HOVJ 2R7UA 1GLFO 2YNIA 2A68F 1XQSC 2CFOA 1X19A 5J8FA 2VKVA 5B8HA 2XHBA 2VC0A 4HTUA 4GV3A 4DOZA 4CZEA 3K1PA 4ILJA 3NAEA 1LE8B 2KW4A 2K3FA 3MZHA 4OOIA 3C65A 1NH3A 2XY6A 1RZ4A 5D3GA 1EWQA 2YKMA 2B6AA 4WXHA 4XIDA 5AQTA 2W82A 2OBPA 4NUBA 3WNFA 3MZYA 5F64A 3VYUB 3ZT4A 3MKYB 1KGSA 2M7BA 3K69A 3WE3A 4J8FA 4E4HA 3ABLH 3I56I 4A93J 4HX7A 4MEYF 4I2OA 1A35A 4CZFA 3J7AO 3I0TA 2DA7A 3A1YA 4I01A 4RM3A 4AYBA 1RDCA 2B5JA 4CEFA 3BC8A 5FRNA 3A2FA 4UY8I 4YFKF 5A2QO 3KEQA 4PHTX 4CJ3A 1YO5C 1KAXA 4HCCA 3Q3SA 1UHMA 1BO5O 4FO0A 1JT0A 1ZREA 3IMXA 4E1MA 3MN2A 4L5IA 1QVUA 1T3VA 2A3ZA 2P51A 4B8CA 3FXJA 2STWA 3CCMN 4WX9A 1HOMA 4PKGA 1VQ4I 3MXIA 3ML6A 4ID5A 4LLLA 3WU2C 2XAHA 5IYDJ 1HNIA 3SAGA 4YHHK 2VQEK 1J9AA 1BL0A 3V9UA 4FJGA 4M6VA 4N47A 2VOOA 3H1CA 4FLVA 4DSIA 3T0YA 5M3FJ 4A3DJ 1WHUA 1ZGAA 3DTEA 5D8LB 2FSJA 2KIUA 2X51A 4ENJA 3GDQA 4XH5A 1XC5A 5F0XA 3CMAN 4FLWA 4KB0A 3WGGA 1D5AA 2L7FP 3CM6A 4CF9A 1X9WA 4O4GA 1V4SA 5C2DA 3JAMK 1JUSA 4DZJA 3CJCA 1ZLKA 4BE2A 4H0EA 5KRSA 4B1VA 3M1CA 5M1FA 4XNFA 4HYEA 1RKTA 3AVAA 2O4IA 3VQ9A 1YG2A 1IXRC 5ERIA 2HVRA 1JLQA 1LE8A 4B9LA 3QOPA 5AQFA 4F8RA 2ZQBA 5F1JA 3V9XA 1NOZA 1P4XA 3ZXSA 3IKVA 2OPRA 1RGIA 4E70A 3OVNA 4YOTA 1HNXK 2A41A 2Z9OA 5H6RA 4KMFA 1VHXA 4NC8A 2VQGA 2L9NA 2IRFG 3K70D 4UV8A 4FVUA 2L54A 2O8XA 4N5SA 2HVQA 4FZXC 4RLFA 1RC9A 3DRSA 4XLCA 2QI2A 3I5UA 3L2UA 1R49A 1BL3A 1M1EB 4CHNA 3J7YP 4XM3A 1ZYRF 5CZ2A 5AQNA 4BQLA 5EZGA 1RBTA 4IXAA 2QZ8A 3DWLA 4H8KA 4DTPA 5JS2A 4UHTA 1VQ7I 4CD3A 1TZLA 2JUCA 1S6LA 5DK5A 1QZEA 5B1AH 3SDBA 5K5RA 4WE1A 3CFRA 1Z1DA 3LQRA 1WAJA 1WJAA 2RGVA 1S7AA 4AIKA 3AAPA 4JI6K 3SV3A 4K8ZA 1U78A 2V7YA 4CSWA 1YRNA 3EYIA 4DW6A 2LK2A 1KCFA 3I59A 1EQYA 3DBHB 1HKSA 1VI0A 1D5VA 3R0AA 1YAGA 3KZBA 3MN5A 4JQFA 2IA2A 5HLTA 2Q0UA 1OJLA 3CLOA 2MA3A 5DCFA 1WNSA 4DF8A 4RGUA 1HNVA 2D0AA 2IS3A 3CETA 4NCBA 1NGFA 1KLNA 3PLAA 3OIQA 4HHTA 2GQQA 1WJ5A 1YIOA 3OIPA 4LK0F 3VEXA 2J5PA 2ZXHA 1I94K 4FJHA 1G4DA 2R7XA 4OAYA 5JVTA 1Y8QB 5HLHA 4YNQA 1RR7A 2OZ6A 2FF6A 2YR2A 3O9RA 2GXBA 3A8YA 5KRTA 4FJMA 4WQ5C 1UZCA 3U21A 3OYAA 4EHTA 3NGIA 3C1DA 4LFBK 4Q0BA 1BI1A 4YG2F 3FXKA 4M71A 1Q9YA 4LF5K 3BJAA 1IV6A 2P9IA 2X6SA 5E8GA 2F48A 4YFUA 1MNDA 2QKKA 2W6LA 3A0IX 5CQEA 1NMNA 4FL9A 3OYKA 1IRXA 3TDZC 2VKEA 1D0YA 1A6QA 3BDDA 3FX3A 4NQWA 4S05A 2D5VA 3DLRA 1DKGD 5FLXO 1IXSB 3L3VA 1ASVA 1IDZA 5BNGA 3K0SA 4RLQA 2YHWA 2A40A 4M3XA 4OAZA 2ME6A 4YRVA 3T1AA 2O8BB 2R7RA 3A01A 2WY8Q 1A5VA 4IOAF 5LEJA 1SEUA 3IKMA 4NC7A 4RG8A 4KIBA 1S1TA 3G0ZA 2G8HA 2O8CA 2BVLA 3DU5A 3LA3A 3TP3A 5ILUA 2WOMA 3C94A 4MNUA 5HS9A 2CGPA 1OLTA 2A1RA 3I8BA 1LAVA 4IHXA 2P5GA 5AQYA 5LRSA 3ZX3A 3DPLC 3QYEA 4HV5A 5M5XJ 4OU0A 1SD7A 2AQFA 3KK2A 1FBSA 1G3SA 4QLCU 2OQRA 3LDOA 3I8DA 1C0FA 2HHWA 2IPQX 3M6GA 5GADJ 3AVBA 1ZBIA 3BG5A 4BDPA 1CXQA 2ITMA 3JW4A 3GBGA 1X3NA 2D1HA 2GUIA 4CE9A 3EUKL 4HUGA 3SPYA 1U49A 4UVBA 1B72A 4V19K 4ISGA 3M8JA 4CF8A 4KI6A 4H0TB 4LD0A 2B0LA 5TKYA 4NCGA 1X2NA 4JKCA 1RBUA 4HDVA 3OV8A 2H3GX 3HRGA 1NGJA 4F91B 4EZ6A 3VESA 3MN7A 2W40A 3QB0A 1GXPA 3TP0A 4X1EA 1QO0D 5DCMA 4WYBA 4JI1K 1Z21A 2XPVA 3DKXA 4KJZA 3BEXA 2HF3A 3DXKB 4CGDA 3DLBA 4A3FJ 4K41A 1JGGA 1GLEG 1OKRA 4NB5A 4G6TB 4CYDA 5H2FC 1V3FA 2L5QA 3CJ1A 4FWSA 4PL8A 3G4SN 5KTQA 5KK1A 3L2QA 2L7ZA 1HNZK 3IWFA 3TBIA 3H6EA 2AQEA 3MKZA 3HTSB 2PJRA 1QNTA 5ILSA 4GYGA 5DCMB 2GV9A 3ABKH 3ZP5A 2KIQA 3BR5A 3GTGJ 4CJPA 1BN5A 1TT0A 2HDWA 3OOUA 2DA5A 4KT6A 5D4RA 1BISA 1U6ZA 1X4PA 2IS6A 3WT0A 4DFPA 4W5NA 1YS7A 3CC7I 3G1MA 4IHTA 1HLUA 2OZUA 2D0OA 3CC2I 1TTYA 4ZTJA 4QPQA 3H1VX 3K70C 4E7HA 3CUQB 1C0TA 3FBNB 2EK5A 2JSPA 1U5TA 3U1KA 3GOIA 3HP9A 4DSEA 2DDAA 1CZAN 5CYQA 3O4NA 3V4IA 1VQKN 4FJ8A 2X6OA 3UKGA 4JEPA 1NHAA 4HW0A 4CHUA 3TSUA 2FSNA 1M90O 3MVPA 3CJAA 3RMCA 2G8KA 1XC3A 5HDNA 5E3MA 1VK0A 2QENA 4DR5K 1ZG1A 4QSHA 5KAIC 5GADP 2QCOA 5AZIA 1VQLI 2VQCA 1S1VA 4YORA 3GWZA 3SZTA 1R23A 2LG4A 4XKWA 3U1DA 1C1AA 2D0CA 1U2VA 3BCAA 5K7FA 3HVRA 3R4KA 1YIJN 1LFUP 5ADXA 4CEBA 1GLBG 1YE9A 1FKOA 1MKMA 5DV5A 1FIPA 1B9MA 4X0GA 1IRGA 1W36C 1RNLA 1XMXA 4XN3A 3DTIA 5CVVA 2HBMA 3AVLA 1E2XA 3R61A 4CJQA 3RTVA 4AU7A 3GL1A 2IJLA 3B73A 3V1RA 2FXAA 2F4MB 4F2RA 2H8WA 4O5VA 3JCUC 3I4MJ 1ZR4A 4HDUA 3IP4B 2B7EA 2OUMA 2FBHA 1H8AC 3V1OA 4BC4A 3M8RA 2EIMH 3MWMA 3CCUI 2ELHA 2DA4A 1SVOA 4UB6C 1LWCA 1R4NB 3DKWA 3KLGA 2CV2A 3WTYC 3E5UA 2CQ7A 3DXMA 1KFSA 4CH7A 3KZIC 1HYSA 3SLCA 2FX0A 4OINF 2HMPA 1SD4A 3HSRA 1NG7A 2MYSA 1ODDA 5IT9K 2UXDK 1H1VA 3TARA 3KP3A 1UAXA 2LKPA 4U88A 3DLGA 3DQVC 2BY2A 1Y64A 2X74A 3T7ZA 4EGYA 1D8YA 4LF8K 3V4GA 4HSRA 5L3EA 4Z0UA 3G71N 5CY4A 5HNFA 3HOYJ 2CMPA 1GLAG 5F27A 1QS4A 3A0HC 1X3WB 1J59A 1AHDP 4J00A 2FE3A 2KHOA 3F9MA 2CH5A 4BGBA 1L3UA 3I54A 1D9FA 1Q8IA 4Z4FA 2OTLN 5J6XA 5FKNA 3MKWB 2AJQA 4JKBA 4DS4A 3LDPA 5HLIA 3MCZA 2IVMA 3KYLA 5BRDA 1BOTO 4B08A 1J9IA 3N97A 4CGHA 3WHCA 1JKOC 1DTTA 1Z6TA 4DYCA 2HNDA 4IG0A 3ECOA 1W0HA 5DMRA 5D5WB 4CJTA 3GFJA 1TWHJ 3S2WA 2XHKA 2E1CA 5J1EA 4XLAA 3U2RA 1FJLA 5HP1A 2EA4A 4KFBA 3GX4X 4A2UA 3LSMA 1WQ2A 4XSZF 1L0OC 1JCEA 1ZLJA 4LSLA 5HVQC 1USTA 3DYAA 4JKGB 3SJHA 3HTUA 4FT8A 2IP2A 3OWTA 4JYKA 3TI0A 3WQTA 4DGWB 3U9DA 5AR0A 1ZRFA 1YT3A 4JLHA 1RT7A 4XL9A 4KHQA 3J8AA 4EIAA 1IRZA 1W0UA 3AVNA 2IC3A 5EYRA 2M1BA 4B47A 1VAZA 4CZHA 1OCPA 4E0DA 2KZMA 3W3DA 3LMMA 1NTCA 4E7SA 4EJTA 4CEQA 2HQ5A 5GAGP 3EYZA 3KLFA 1SD5A 2NOJB 2KKOA 4ENKA 4DQ2A 3F9KA 2LD5A 5MLCQ 5JFRA 1WSGA 2E1MB 3BG9A 4IJNA 1X4OA 1I1SA 4RW9A 5EX5A 3CCMI 1MNMC 4ISFA 2GOMA 3W2VA 3OYJA 3B6PA 3C6AA 3R3LA 4BG9A 1DT9A 2QUFA 2RV8A 3F3XA 4FE4A 1WB9A 2F8TA 3IH4A 4JK7A 3JRFA 3VGMA 2VBZA 2WC2A 5GP9A 3K7AJ 1HYZA 4A3LJ 1J54A 1WSIA 2X1EA 2DOEA 1E4GT 2Q2RA 2VYPA 3KX2A 2Z1JA 3C7NA 3OTOK 3THWB 4OMYA 1IN6A 2K3PA 1WFXA 2MG4A 4BJ5C 3LSRA 1VQOI 1WSUA 2GUPA 2QW9A 4EGZA 3I9V2 3CDLA 4W97A 3VYSB 4JRPA 1JTYA 2OCEA 1DPUA 4HOBA 1OKJA 1U04A 2WTUA 4JD2A 3WXJA 5JVGF 2CWEA 2LOOA 1YJWI 3SYZA 1ESVA 1BM9A 4D0PA 1H89C 1XCVA 3FISA 4V19S 3L00A 3M1EA 2FNPA 4XICA 4BEHB 2HHVA 2EIJH 1KZHA 2JQ7A 3HVTA 1TWCJ 3FXOA 1HX1A 4G7ZF 1ZBUA 3N4PA 3CJTB 3RMAA 1YI2N 3K2AA 1QSSA 1W7PA 2A6AA 4IHVA 2F6CA 2JRTA 2ZNZA 3Q9SA 3LAJA 2IGKA 3E9LA 5JMVA 4C8OA 4IEJA 3O80A 4RTFD 1KYZA 3TAQA 4PDKA 4IO9F 2BY3A 1XC9A 3HRTA 1H9GA 1FLIA 3QYFA 3N05A 3JTGA 2WWYA 1NWKA 2PZSA 5CLSA 3KKSA 2DFFA 1VQ7N 3EZ5A 3JSMA 2Z5UA 4IOXA 2FA5A 2O8EA 3AKZA 2FOKA 4XR6A 3IAYA 3OSGA 1T2KA 3HDDA 2QKMB 4RB2C 1GOCA 3ROUA 1HC8A 3JR9A 3P39A 2HVSA 2Q3SA 4XORA 3EE8A 1USSA 1S5JA 5M1OA 3HGGA 1RT1A 2WUSA 1LWFA 2OQGA 2XO7A 2HBLA 3WXLA 1POGA 1WJFA 5EG0A 1D4XA 4LSNA 1K8AO 3RDIA 3MFKA 4YOXA 4OGCA 2LY2A 2V9VA 1KAZA 1QQNA 4ZHRA 4XRSA 1EO1A 1KU3A 2WA0A 3CTAA 3I58A 3DV8A 1WH7A 3RKWA 5D5XB 2KTQA 3RYRA 5EEAA 3AFHA 1G15A 4L0YB 2MH2A 2FMLA 2YI1A 3V9SA 4I9LA 2Y0SA 5GPAA 5TJJA 1DLOA 1IUYA 4MDBA 4DTMA 5C4JJ 3MD2A 5J1UA 5K1YA 4JI2K 4HVJA 2DY4A 2CUZA 4F4KA 3J80Z 4ID1A 3ZLJA 3IDHA 4QS7A 4XLFA 2QA4N 3HXMA 4CEZA 2HU9A 3B6AA 1T95A 1YW7A 3UB5A 4BQZA 4CHPA 1D3YA 1O57A 1TUUA 5C25A 3PX6A 4H5TA 1WUAA 4CHYA 3T1BA 4PWDA 1QHTA 4IX7A 1FOYA 4Y4RA 3DU6A 3SMSA 3PSIA 5FD5A 1MZBA 4JX5A 1WSFA 2HOSA 2I7PA 4CJ7A 4E19A 4AIDA 3SJJA 2K27A 1HYVA 1HKQA 3SYTA 1UOCA 5HLFA 2FC0A 1L3SA 3H9JA 2OC6A 2B4JA 5AQSA 3TW6A 4E3SA 3QNOA 2QQ9A 3A5OC 1F36A 3RTRA 1LDKB 2IA0A 5EDNA 1N5YA 2DQLA 1X1AA 1J0RA 3ECHA 2H09A 1S9GA 4BC3A 3MZ8A 5DM6F 4Q5SF 3VQAA 3LNQA 4U7BA 4KHWA 2IVOA 3RQIA 3PIOL 2VBWA 4HWIA 4WFAL 2P5KA 2OD5A 4EVIA 4JK9A 3QIOA 3TKYA 2LRDA 1TKDA 4FJ9A 5EGOB 1VQ8I 5GINA 1HJOA 3VQ6A 4A2AA 2KJCA 3OSFA 1IN5A 1D1CA 2Y9YA 3GFMA 2MLKA 1CQTA 2Q0RA 2G9WA 1MJBA 2VB6A 4H5RA 2P5LC 2KZGA 2VJ5A 2FRHA 2LY9A 5DM7F 5FLXK 2Q1ZB 2F2EA 3E6BA 1HMVA 4FLYA 3SQ0A 1QQOA 3RI4A 3FE1A 3TTFA 4CJRA 3WEEB 4AIJA 1IBLK 1OYWA 2GLOA 1KLMA 4B9UA 4ESBA 4JHDA 4OIPF 2ZWHA 2OU2A 3ULQB 5E18F 3RPUD 4GY2B 3VQ4A 1SC7A 4AWXB 1NK2P 1BI3A 2VBXA 3I59B 1S1UA 2CGLA 1L5UA 1YVUA 1XX5A 2DFEA 3ZSVA 3SEQA 3WGHA 1HW2A 2JWTA 4WQ4C 3K4CA 3FFIA 3CC2N 1MMDA 3ZN1A 5M1NA 2E1OA 3A4CA 1SZ2A 2Z1IA 2CGJA 1Y6IA 2A05A 2VJJA 2X1DA 1VQKI 4OKEA 3K2ZA 2CH6A 4CJKA 1DU0A 2R5ZA 3LPUA 4FLXA 4QOZB 3KPHA 1C1BA 4QAGA 4CCNA 4CW7B 4DYQA 3Q0UA 1FSHA 1FYMA 3ZETA 3SJMA 2RPIA 4JI5K 5ICEA 3R6SA 1PP8F 1BI4A 2JZYA 1NGIA 2E2QA 3DEEA 3MEGA 5C44J 4WQ5A 3K5OA 3FMQA 2FBYA 3FKIJ 3SV4A 2PX9A 2R7WA 2UXXA 1U9NA 1PUFB 5H1SQ 1U8BA 5BOXA 4MQ3A 4DWIA 1MJAA 1RUOA 1CLQA 1G99A 4B48A 1OMIA 2UUZA 3DAWA 2GBYA 1VSJA 3VQCA 2GELA 5H6QA 3TO9A 3DLKA 3UKRA 2QBYA 1VQ9I 4UB8C 2W57A 1B9FA 4I6ZA 3QBXA 5CYMA 5KPTA 2K9LA 4IVNA 1RDBA 1RILA 3BR0A 1T6SA 1V5FA 4CJ4A 2QEXN 4CA0A 1TP4A 3VODA 2VQFK 3MX5A 1VNDA 2KL4A 3VPRA 1SFXA 2CJJA 5J3LA 4P55A 1IRFA 2DT5A 2P7VB 2Q2EA 4B09A 4CZCA 1ZGWA 3B8AX 4BRGA 4L9TA 4JKAA 2Z99A 1QA6A 2Y2ZA 2ZM6K 4KRFA 2AP1A 4H0XB 4CIFA 4KPYA 3M1FA 1WSEA 2M2EA 1AKHB 1DQUA 1KU2A 3AGKA 1JTXA 4BU2A 4MO4A 3VQ5A 4BROA 2ZNYA 1O3QA 1MMNA 2W42A 4A5NA 2Q2EB 3V81A 3CLQA 2QQAA 2OTLI 3OHRA 5T7BA 2LH9A 1T03A 3PFYA 4J01A 4U0WA 2L9VA 4FSVA 3TO7A 4B3RK 1BQMA 1KA8A 2A5XA 3LP2A 2A6EF 3SI6A 4CFDA 4ZYDA 3N4QA 4A3CJ 3SQ1A 3RR8A 3IUOA 4PUSA 4IOCF 1WRJA 3M8FA 5AQRA 5LL6Z 3U3YA 4WF2A 4FQGA 4BYYA 4NXMK 1T98A 4RA2A 1ETQA 3CFPA 3MQ0A 3DLHA 1H0MA 3U6FA 2HBKA 3LANA 4GKKK 4E7JA 2LYCA 5GAHP 3ZCMA 1XNQK 1MMGA 3PO5A 4A5AA 2F9WA 1ATSA 3ZT0A 1IN4A 2X0LA 3OY9A 2Z33A 3VQDA 1Y0UA 5GPCA 3KZYA 4CJWA 3M3ZA 4DF4A 4FJ7A 1N6QA 5M1QA 5IPAA 3WUHA 1D0XA 4L9JA 2JA6J 4JP0A 5D6EA 4NBQA 4HLYA 2JJ7A 2XKOA 3K0LA 3MKLA 4TV7A 4G7HF 1ASWA 4G12A 2D5RA 4CEEA 5JVGL 4HCBA 4QWQA 2HFHA 3AGRA 3EO3A 1JJ6C 3MEDA 3SDGA 3ID6A 3O9SA 4CJUA 3K57A 4A3JJ 3HOSA 3NAUA 3SZPA 1T39A 1ZRDA 2LR8A 3C6HA 3CJQB 3VPZA 2GOXB 2IS4A 4CHZA 3G6EN 1BGXT 1SMTA 2YHXA 2VJ4A 1DTQA 2Z1HA 2KFDA 4EJWA 2KLAA 4BR0A 1O7FA 3F8NA 3KLNA 2M4GA 3W2WA 5TGTA 1X1PA 3TQNA 4KO0A 2N8GA 3JSPA 4QS8A 4CZJA 3QEPA 2KFZA 1LEAA 1TLHB 3HJFA 1Y1VJ 1DP3A 4Q48A 5J4YA 2IVPA 4JAXA 3OR2C 3AV9A 3RCOA 2JA2A 1HJRA 3V7SA 5GTHC 1ETOA 2YSRA 3SXYA 4BDYA 4C2UA 4A12A 1HBXG 2P9UA 3OA9A 4XOTA 3Q7CA 1XI1A 4JKGA 3SPZA 3U8XA 3RZOJ 3ZSXA 3KKRA 1ATRA 2F8SA 2ETHA 1YI2I 2ZO4A 3HOUJ 2D45A 3LP1A 2B9SA 4BR9A 4Z4CA 2CQQA 3DBLB 3AA2A 3PIOF 3H9QA 1UHWA 5ELZA 3HBLA 3K4JA 3J80K 1JLEA 3O8HA 2CV0A 5D8KB 5DUKA 5CHIA 3VENA 3HBTA 1FOWA 4RW4A 1J5EK 2P9KA 3O08A 3KYDB 2CV1A 2EILH 2CW0F 2NNNA 3LSIA 2NRWA 3BROA 1JXEA 3LDLA 2E34A 2K9NA 4HNUA 2AO9A 1RIOH 5I9EB 3J80O 4LF4K 4IL6C 4FWRA 2DMQA 1EH6A 1NKBA 3SFIA 3C3WA 4CJFA 2OPTA 2RE2A 2A42A 1R1UA 2IOCA 4RAZA 2F5FA 4F92B 1QTMA 1QVFM 4IRIA 1FXXA 2K40A 2M8GX 2HKXA 4FOIA 3QEWA 1RKWA 1LB2A 2X6YA 2BOLA 5IT3A 2PYJA 1QE1A 4PA1A 4DYRA 3CFOA 4Y13A 4LF6K 4GRIA 5JHFA 3TAGA 4EFHA 1ZN2A 2QXLA 1IC8A 4RW6A 1R58A 5D5VB 2IGIA 5HRSA 4CYCB 1IJWC 2BE2A 4IHSA 4H4MA 2ID3A 2E71A 4GXOA 3P83D 3HUGA 3P9IA 2LMDA 1UG2A 1X1BA 3G1LA 3A5LC 4P96A 5FLMJ 1YTYA 3Q9VA 3JRAA 2FSWA 2LLKA 4YOWA 3V9WA 1VQMN 1Y39A 1K8KB 4E89A 5DTDA 1RDDA 2QKBA 3PV8A 2QGUA 2GWRA 5AQKA 4A59A 2HYJA 3NVKA 3J7AY 2OAZA 4CJVA 3CCEI 4NCAA 1YS6A 1IUFA 4LH4A 3SZ2A 5DM6L 2K4JA 4B9VA 3I64A 4O6JA 4U7DA 3QAHA 3CMEI 1B92A 3O3FA 3P38A 2BTFA 5J1RA 4BRDA 4U0YA 1EJ9A 2I7NA 5BN8A 2XRNA 2OTJN 3EQLF 3OS1A 4Z4IA 1BI0A 2ZGZA 3CO6C 4F52A 3THVA 3DRPA 1TAQA 4M6YA 5AQOA 1TK8A 2ETJA 3AG3H 4A57A 5E1ZB 2L7KA 1BCMA 4GV9A 3ZQIA 3EY1A 1FPQA 3E6DA 4LG0A 4Z6YA 3LM9A 5EVZA 5DD8A 5EY4A 4Y17A 3JTHA 3E1YA 4KTZA 3IRQA 3FR0A 4Y33A 3LDQA 3O1BA 3K4LA 4L3QA 1BBYA 4BC5A 2CH0A 3E7LA 4HUEA 1TWGJ 3KWGA 4BQNA 1MDMA 3ABMH 4XKCA 5E3OA 4IDHA 5F0HA 1EETA 2ZMEC 2VPRA 2QWMA 2ZFWA 1ERDA 4I7FA 3VEVA 2O8CB 2FBVA 5LMUK 2TRTA 2NVTJ 1LW2A 4CJLA 1U45A 3GTMJ 3H45C 2HPIA 4PGHA 1KAYA 4W1UA 3DBRB 1E0EA 2DOAA 1RI7A 5GAEP 5LJVA 2E7XA 1T05A 4DIQA 3DI6A 3ZMSA 4B1ZA 1OVYA 1LQ1A 2ZC2A 3DF8A 2A5YB 1FOXA 3HSTB 4LB5A 2DFHA 2HGCA 3EUHA 2W00A 3HXLA 2VLAA 1EX4A 5A2QK 1WLJA 4M3RA 4KNYA 1F4KA 4KHSA 2WB1N 5E3LA 1T8EA 5HRPA 4C3HJ 3O9QA 4C30A 1MSFC 1NGGA 1JCGA 4PQUA 3S32A 3GE1A 3BT9A 3KD5E 4CXFA 1RDUA 3MMYB 1B72B 2XY8A 4Z4EA 4FZZA 4P9FA 2DPUA 3H5RA 3M9AA 5BQTA 5FKOA 1Q9XA 3KIOA 4O55A 1T8IA 3K5NA 3H3OB 2DA6A 4XLEA 3AA5X 4RAYA 2V9KA 1UB9A 3CMYA 3KEYA 1IV8A 1YXQA 2QWLA 4ICLA 3DEUA 4J2DA 3LSTA 1NK8A 1EH7A 1U2WA 3R8EA 2ADUA 1XGNA 1NLVA 4W5QA 2CG4A 2ZJPL 4MTEA 2P9LB 1XD7A 2E2NA 1W2BM 4ENMA 3N4MA 4V2GA 2DQRA 2ITGA 4BGDA 2ZMEB 3L2RA 3PJRA 4DNCA 1WBBA 3VA0A 2KRHA 3HYFA 1VQPI 3BGRA 1L3LA 2CQNA 3K59A 3LZIA 1W5SA 3UR3C 1Q81O 1ZXOA 4BRQA 1JT6A 1WJEA 2HXIA 5KNLA 4P1WA 1VSKA 4Y1DA 3R9PA 4EZ9A 2I5UA 3GYHX 1FBUA 2L4AA 2VONA 2VKHA 1QGPA 1KTQA 3BPVA 3E5XA 3RKXA 3VQ7A 1T0FC 1K78A 4XKVA 1GLDG 4NC6A 4RGSA 3FDYA 2V51B 3UKUA 4F3TA 2JWKA 5LBQA 2QTDA 2E20A 2EJRA 2STTA 1KQ0A 3CQYA 3MN6A 4IFYA 2YUSA 4CFBA 2W48A 3D2FB 5K14A 1BW5A 2KZZA 1W5CC 2O9LA 5FO5A 3ZMTA 4IO8A 2NRHA 4KI4A 4CZMA 1D5YA 2X85A 4QS9A 1QVTA 4PSWA 3VQBA 5F0FA 4M45A 4KB1A 2CUEA 1ZHFA 4JI3K 2Y30A 4GNIA 4BR4A 3L8BA 2XIGA 3DXJF 3OYBA 1IJJA 4OVLA 5E84A 3ZSWA 4B1YB 4JV5K 2LNBA 4WWCA 2JLEA 1L3TA 2NOGA 4BNCA 1XN7A 3D2FA 1KXPA 4IFVA 1S3XA 1BQNA 4FWMA 3RMBA 2UXNA 4X66K 3PQKA 5JS1A 3BQZA 3ABUA 2HHQA 5LRRA 2RQPA
chains in the Genus database with same CATH topology
1VSHA 4KHQA 1VRUA 3KJVA 3AVNA 3I0RA 1IH7A 2IC3A 1LW0A 4FCYA 4DLEA 3LWLA 4DQSA 4DQPA 4IKFA 2KFNA 1JL2A 4E0DA 3HPHA 2KZMA 1IKVA 2RF2A 4CECA 4NYNA 4CK2A 5J2MA 4CEQA 2A1SA 3EYZA 3KLFA 2Y1IA 3K5MA 1LV5A 2NUBA 3F9KA 3DLEA 3M8QA 4R5PA 4FJJA 3QEXA 1KRPA 1WSGA 1D9DA 3PY8A 4RW9A 1NJXA 1RTDA 4Z4HA 2OPPA 3MXMA 3B6PA 3OYJA 5FRMA 4G1QA 4E1NA 3UIQA 3OS2A