1DUXC

Elk-1/dna structure reveals how residues distal from dna-binding surface affect dna-recognition
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*AP*CP*CP*GP*GP*AP*AP*GP*TP*GP*T)-3')
publication title Structure of the elk-1-DNA complex reveals how DNA-distal residues affect ETS domain recognition of DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 86
sequence length 86
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1duxC00
4G9YA 2H6CA 4AVPA 4BH9A 3IHUA 1R22A 1FSHA 3QPTA 2PLYA 4FHTA 3WTSC 1I6XA 3GFIA 2KJCA 2CG4A 3RPQA 3F8CA 4WX9A 3GO5A 2PJPA 2OZ6A 1A04A 1F9NA 1Z6TA 4I7HA 4CGZA 3E97A 2Z99A 3ABTA 5DCMA 2EFPA 1T0FA 2E1NA 1MDMA 3ELKA 2GWRA 3IRRA 3BDDA 1U6GA 2BE5F 4AIHA 1TW2A 1U5TC 3QAHA 3V8LA 2KIFA 4HDUA 4HDVA 1ZRCA 4PGHA 1SD6A 3GX4X 1K78A 2V9VA 3TDZC 3QRFF 2JPCA 4RAYA 2FBHA 5FFZA 4Y17A 4JK1X 5J8CA 1R5HA 1FBSA 2ETHA 1EH8A 1I27A 3F8FA 3LQRA 4IRIA 4PDKA 2HWVA 3V8JA 2VOOA 3OOPA 3WGGA 4CYDA 2PI0A 1IN7A 1KQ8A 1ON2A 4AWXB 2IVMA 2Z5UA 2KJBA 3TGNA 4P9FA 1ON1A 2W24A 5JI6A 2LSOA 1FWZA 4U0WA 2XAHA 5CJ9A 1J59A 3HRUA 2F5EA 1ZYRF 3KLNA 5E8IA 3HTSB 1RUOA 1ZG3A 2LKPA 2HYFA 2HQRA 1PUEE 5ICGA 4N0BA 4PZJA 1G6NA 4AIKA 3WTWC 1TBXA 1FZPB 1O57A 3I4PA 1JHHA 4HBLA 3GZ6A 3FM5A 2KIUA 1CF7B 2XROA 4UVAA 2ZNYA 2STTA 4CXFA 1UCRA 4XSZF 1IXCA 3F22A 2XRNA 1FY7A 3RKXA 3R60A 3FXRA 1PDNC 3B02A 2FMYA 2TDXA 1FPQA 3D5LA 2FMLA 1QO0D 1IN8A 1BN5A 2K4JA 3M8EA 5J6XA 3LFKA 1WKMA 1TQPA 1JGSA 1FX7A 3E3VA 2ADUA 1TNSA 2ZO4A 1QBJA 5JFRA 3DFGA 4HQMA 2OQGA 4CZZA 3Q5FA 2ACJA 2C6YA 2A69F 3E5XA 4EQQA 3E6CC 2M87A 3P9IA 3ABUA 2JT1A 5L3CA 1QNTA 3WODF 4M9SA 1IF1A 3RPUA 5LHIA 3I59B 3HSRA 5AIPA 1W5TA 1HBXG 4LG0B 1R23A 4IJAA 4M74A 3F6VA 4EM1A 3RYPA 4RGUA 1LNWA 3VFZA 1ZG1A 4RGXA 4BNCA 1HQCA 2BBYA 4MHGA 3C1DA 3GF2A 3WU0A 3BOQA 4WWCA 2P6SA 1P4XA 4IRHA 3E6DA 2LDUA 1D8JA 3E5UA 1SAXA 2FBIA 4ZH4F 1W7PD 5ILSA 4R1HA 1IN5A 4QLCU 5FD5A 3RYRA 3MAJA 5L3FA 3KEOA 4BXUA 4FT8A 2VE8A 2PG4A 2P8TA 4OMZA 3QU3A 1BI3A 1YQAA 3ECHA 2H09A 4ENJA 4ASNA 4O6JA 3FF5A 1RUNA 2HEOA 1LDKB 3SZTA 3MZYA 3J80Z 2Y75A 2IRFG 2HYGD 3LAJA 3F72A 4AD9A 1FNNA 4Q48A 4I0BA 4R79A 1DDNA 2ESNA 2A3SA 4RGSA 2H6BA 4HW0A 3L9FA 1KU2A 3KFWX 5E1WA 2YSRA 1LB2A 1B1BA 1FBQA 5D5XB 1TQIA 1W4MA 2ZJ2A 2MH9A 1SFEA 1P2FA 1I1SA 5IT3A 5ILUA 2P5LC 4UV8A 1SFUA 1T2KA 4G7ZF 4ON0A 3WU1B 3ZMDA 2FF4A 4EJUA 2Q0OA 3IC7A 4L9JA 1K79A 2FSWA 1XMAA 3MCZA 1RIOH 1BI0A 1J75A 5F1RA 3E5QA 1KU3A 5CYVA 3VEPA 1YW9A 4G7OF 5E20A 4L5IA 1SD4A 3V7RA 4A5MA 2VBZA 2PN6A 3LA2A 3IKVA 1QZYA 1DUXC 3QOPA 1D8KA 4M72A 1YO5C 4P96A 1U3EM 2CO5A 3LA3A 2DLLA 4EJTA 1SMYF 5CVJA 4LJZF 4LB6B 5HOOA 3F8MA 1GHCA 3JW4A 4HOBA 3RJPA 4BAYA 3ZMZA 3KP5A 1XSDA 2FXAA 3COAC 4L5JA 1S8NA 3R61A 1IAWA 3VODA 1KYZA 2QQBA 2O03A 3C3WA 2EFNA 4MEYF 3QU6A 1BC8C 4O3MA 1KU7A 4LGWA 1BBYA 3OV8A 5HVQC 4EJVA 2IPQX 2CGPA 2MLKA 3EETA 2P7CB 4ENNA 2RC4A 1HKQA 3U1DA 2J5OA 3F6OA 2X4HA 2P7VB 2COMA 1FBUA 3REOA 3E6BA 2OZUA 2MLGA 3WGIA 5L3DA 5JVTA 4A0XA 4U7DA 2XAFA 2FQ3A 2K7LA 1F1ZA 4RGRA 1IW7F 4UHTA 4KDPA 3Q9VA 1SD7A 3EUHA 1R36A 1ZARA 1OPCA 1YIOA 1MDMB 3GWZA 5E1ZB 1Z9CA 1IRGA 3GUDA 4ZYGA 1YW8A 3ZPLA 3DEUA 5H6QA 3MZHA 1SMTA 4Y13A 4KMUX 3WTYC 4OIRF 1BC7C 2P5KA 4A5NA 1HSTA 1K78B 3C18A 6PAXA 5FD6A 2A61A 4RB1A 3I64A 1CGPA 1ZAOA 2RKHA 5AONA 4I01A 3TOBA 5D8LB 2FE3A 4CDGA 4L0YB 3F8BA 3BP8A 2JTVA 2RVCA 3CTAA 3I0TA 1B9NA 1S3JA 1KYWA 4L9NA 1U8RA 2JRTA 3I71A 2NYXA 3RDIA 1OKRA 3DPLC 4N9HA 4Z2YA 3LWFA 3F23A 4Y15A 3JTGA 1BIAA 2VT2A 2DK5A 1MJAA 2DQRA 3QPHA 5F64A 4EM0B 4PCQA 4ZYHA 3EDPA 1KQ9A 3WGHA 1EV7A 2E7XA 2NRAC 5D4SA 3QP5A 4R8HA 5HDKA 2X0LA 1Y0UA 1W7PB 4IHTA 3L2CA 5HLGA 1F4KA 4G6QA 5AIQA 1FP2A 2QLZA 1RI7A 2DO7A 2BYVE 2FNPA 4A6EA 2IA0A 1P92A 3TQNA 5H20A 4TV7A 3HUGA 4LB5A 1S29A 5J8FA 1R1TA 2VN2A 5E18F 5JHUA 3DF8A 3ISPA 3GXOA 1O7FA 3KP4A 5ICEA 1O3RA 2A6HF 3HOSA 1HW2A 4N9IA 4UV9A 4HA8A 2QENA 4HAMA 2DU9A 1HXDA 2FOKA 1ZLJA 2ISYA 3DPTA 5L3GA 4WXDA 3T1BA 2V79A 2IA2A 2G7UA 3CUQC 2G7HA 4JBAA 3L09A 2VE9A 4A0ZA 2F5FA 2JZYA 1IXRC 3EYIA 2A68F 3GFLA 3JTHA 4HV5A 1U2WA 3HYIA 4MEXF 4GYGA 2L02A 5LEKA 1F5TA 3S2WA 1P4WA 4WXHA 2ZFWA 4RB2C 4KN7X 2A6EF 3WG9A 1WRJA 4ESFA 3KCCA 3K1PA 3ECOA 1QZZA 4ESJA 4U0VA 3B73A 3NRVA 1YLFA 3F21A 2WTEA 4GYIA 2V6CA 1FYMA 2MC3A 1PP8F 2GA2A 4WCGA 3IRQA 4H0EA 5FGMA 3KZYA 4ETSA 3JSOA 4KNYA 1WSUA 3HRSA 5DD8A 2PMUA 4HX7A 1XB4A 4OIOF 1V3FA 1GVJA 2DPDA 3BPXA 3K1NA 3FHZA 1YFHA 2HFHA 1EH7A 5LEJA 2K86A 1H0MA 5K5OA 3J81K 1XGSA 2QYOA 3CLOA 1K7AA 3FXQA 2DT5A 2P5VA 1HSJA 3O2PE 4HF2A 5HS9A 1FOKA 2PBIA 1FSEA 2XAGA 3LAPA 1U5TB 1HKSA 3ZN1A 2IA1A 5DDGA 4ENKA 2P4WA 1MJ9A 3SQNA 2H94A 2D45A 1MGTA 3CO6C 3M8FA 1R7JA 2HZTA 3TO6A 2YU3A 4DNCA 3D0SA 3IWFA 2BEOA 1P6RA 5KVRA 1G3WA 2F2EA 3R0JA 1KU9A 5DV5A 1T98A 1AWCA 1MJBA 2O0YA 2XIGA 1ULYA 4IHSA 3K2ZA 4LK1F 3IL2A 3HHHA 5CVVA 4XLNF 3GFMA 4M73A 1DP7P 3MQ0A 3N4MA 5H6RA 3V7SA 3KE2A 5LRSA 1G3YA 1OYWA 3ZMVA 4M71A 4IXAA 2ESHA 1LVAA 4ZZLA 2EK5A 1ZH5A 2A5YB 2VXZA 5BOXA 2JSCA 4UXNA 3TDUC 5D8KB 5LHHA 3GLXA 5CVIA 4D0PA 3R6SA 3RIRA 2MD5A 2QBYA 5HDNA 3PQJA 3K0LA 2UZKA 1B4AA 3T0YA 5D6EA 2ZXJA 2HQNA 4B09A 4CICA 2W57A 1XD7A 1BOAA 2DK8A 3KZZA 4OMYA 1T6SA 4LG0A 1IZ1A 3HHGA 2EB7A 1D5VA 1TTYA 5LGUA 4KYWA 2IJLA 3ZP5A 4BHPA 2K4BA 2RDPA 3M7GA 3V4GA 1RNLA 1MKMA 2CWEA 4WXCA 3E6MA 2HDCA 3GVAA 4AIJA 2GXBA 3IWZA 4I2OA 4K2EA 1FP1D 1X3UA 1YG2A 2DFIA 3MEXA 1R58A 2QQ9A 3ZMUA 2DW4A 1ZRDA 5E17F 3KETA 4KFCA 2E1CA 4FX4A 5K1YA 5CLSA 4YG2F 1QQIA 2IP2A 4NHJA 4O5VA 2Z3YA 1WI9A 3W6JB 4KIFA 1NHAA 2E7WA 3WE2A 2QVOA 3CUQA 3KLOA 5HLIA 1FYLA 2ISZA 3WTTC 3WTVC 2KIMA 4MQ9F 4ZYDA 1ODDA 3ROUA 2M45A 3M1EA 2MA3A 2VC0A 4OU0A 2BV6A 1H9TA 2AS5F 4MTEA 3O3KA 3BPVA 4MTDA 4XLPF 3BJOA 1R1UA 2QUFA 1ZN2A 1YTYA 4BHBA 3DKWA 2EA4A 2Q2EA 2D1VA 2VBWA 5EEHA 2L01A 4HX8A 1WQ2A 2P6TA 4EV0A 3I53A 2UWMA 3L7WA 1LDDA 5DUKA 3J7AO 2VOPA 2CQKA 2UXNA 3V8KA 5FFXA 1PP7U 4U88A 2VODA 3H92A 5LRRA 3MWMA 2CW0F 2ELHA 1Z91A 1H9GA 4KUMA 5DCMB 3O6BB 3M9AA 4EGYA 2FNAA 1KGSA 3G73A 1Z7UA 5D4RA 2D1HA 2Z33A 1ZRFA 2M30A 1GXQA 1USSA 4NB5A 4P55A 3N97A 3SZPA 4ZYEA 1UHWA 3H3ZA 1XSXA 5DD4A 1L0OC 1XN7A 2OBPA 4OOIA 3U9GA 3RI4A 1FLIA 2LF8A 4G94A 1BJAA 1KQ0A 5BQTA 1LEBA 4EGZA 5D5WB 5CVUA 4MGRA 5LGTA 2HTSA 3GFJA 2O6GE 5D5UB 1AOYA 3HIFA 4HX4A 3BROA 4A6DA 1FYKA 2EFOA 2NAZA 3I5UA 4I09A 4KMFA 4XRFA 4KT5C 4CHUA 1YS6A 3T8TA 3V7CA 1O3QA 1S7AA 4HF0A 2ZKZA 3C7JA 3FXUA 1LEAA 1LJ9A 4YFXF 3SXYA 3ZMTA 2ZMEA 3KP7A 3CUOA 4P5OA 2DBBA 4Q5SF 5ERIA 3KP6A 2V1DA 2WV0A 3GW2A 1QGPA 3CJNA 5KK1A 1USTA 1IXSB 2QM3A 1XCVA 3KEQA 4I98B 4A0YA 2MH2A 3MFKA 5BS6A 4L9VA 5E8GA 3LSTA 2XHKA 1O3SA 2VC1A 1J9IA 1I1GA 2HR3A 1BI1A 4LMYA 3H3UA 2GZWA 2FU4A 3WTUC 3GEZA 3GYHX 4F7ZA 5L3BA 3JAMZ 3P9CA 3LA7A 5IT9Z 5L3EA 4LD5A 2EV6A 4UVCA 3JAMK 5IT9K 2XUBA 2UXXA 2W25A 2PEXA 1O7LA 2XKOA 2FRHA 5ED4A 1IUYA 2W85A 3HRTA 4LK0F 1E2XA 4WF2A 1C0WA 2DPUA 3K69A 3CO7C 4UNOA 2XV4S 5DUIA 5LGNA 1T39A 4LLNA 1ZG5A 4YIIA 3RTRA 1EH6A 2QQAA 3SFZA 3FMSA 4CO8A 4QWQA 3PFIA 2D2WA 2FA5A 3U2RA 4S04A 3FMQA 2NS0A 5FO5A 4EJWA 4OINF 4DQ2A 4IF4A 1R00A 2CSOA 4KIGA 2R7FA 4EJOA 2CYYA 4Q4ZF 3F8NA 2KRFA 2OD5A 4M6XA 1S6LA 1LDJA 1J7KA 4HLYA 3DP7A 1MD0A 3ERED 1K6OA 2VBYA 1T38A 4A2UA 2FEZA 1G4DA 1W7PA 4MNUA 1DPRA 2EV0A 2VBXA 2OQRA 5CVRA 4FX0A 5BPIA 4KA4A 1XGMA 3QP6A 4IVNA 3JSPA 1ZREA 4A12A 5ILVA 3J81Z 3VOEA 4JQFA 1P4AA 2OA4A 5LLQA 4L9TA 1YS7A 1IN4A 2ZNZA 4BYYA 1J0RA 2QBYB 3FWEA 2HGCA 2STWA 1ZGJA 3DXJF 5TJJA 4IRGA 2LNBA 2DTRA 1JXSA 2F5CA 1REPC 3F3XA 2XVCA 1BI2A 1S7OA 1SD5A 3LQQA 3K9TA 3SHFA 3BY6A 3TO7A 2B0LA 4HF1A 5DCFA 1TW3A 4PGGA 1XDUA 5JR3A 2EWNA 4I0AA 1IRFA 5DYMA 2HOEA 5ICCA 2W84A 1CF7A 2PFBA 2RNJA 1XGOA 3TKYA 1R1VA 4ZZDA 4IPAA 2OAZA 2GA1A 5LBQA 4L18B 2MBFA 1VTNC 1V4RA 3R0AA 1BIBA 4EM2A 2RQPA 4XBFA 4YFKF 4M9XA 3CDHA 2O61A 5DEQA 2DQLA 3L00A 1JHFA 3CUQB 2XKPA 5A2QZ 3BJ6A 1O3TA 5FLXZ 1TNTA 1XSVA 2DAOA 4G8XA 2L54A 1OR7A 2Q8KA 4KICA 5A2QK 4I02A 3J80K 4GCVA 5FLXK 1FC3A 4LFUA 5K5RA 1ZLKA 5HS8A 2K02A 2GAUA 1OMIA 2EFWA 3ZN0A 1YYVA 3GZ5A 5D6FA 1J5YA 3DQVC 2XAQA 3R4KA 2PMHA 5EEGA 4EVIA 2G9WA 2L3DA 5K5QA 2QZ8A 4XSXF 3I59A 5TRDA 1G3SA 2IW5A 3EYYA 4B8XA 4G7HF 2VT3A 1B6AA 4ESBA 4HQEA 3EQLF 3W6KB 1U78A 3HSFA 1W5SA 3RKYA 5ICFA 2RV8A 1ZHFA 1HW1A 2ZCWA 3HTUA 3RKWA 2EJRA 4HYEA 3FM3A 2M8EA 2YX7A 2O8XA 1D3YA 3I54A 1U5TA 3TOAA 4YIFA 3ML6A 2XAJA 1GXPA 1SFXA 4BQAA 2M5WA 5HDGA 2L4MA 2OU2A 4E70A 2NNYA 2PQ8A 4GO1A 2V1UA 1DPUA 1E17A 2YX4A 3T5XA 4BHCA 4WK8F 1B59A 3BJAA 3WTZA 3FX3A 5D5VB 4KIBA 2GQQA 1UFMA 4YFNF 2Y48A 2JPBA 1BM9A 4U0YA 2QWWA 1UHMA 3DV8A 4RB3C 1STZA 1TQMA 2NNNA 1FT9A 2XGXA 2HKXA 3NEUA 2K27A 1JE8A 2EA2A 3KP3A 3AAFA 1UB9A 4RAZA 1OYIA 2Z9OA 2DI3A 4HZFA 3FMRA 2FBKA 4KN4X 1Z05A 4ENMA 2ZMEB 5E1XA 4Q47A 3ZMSA 3ZQ7A 3G3ZA 2XASA 3I58A 3Q9SA 1MZBA 5BPDA 3KP2A 4HLXA 4RB0A 1XCBA 3VB2A 5LHGA 1L3LA 3WTXC 4OIPF 2WWYA 3WE3A 3P7NA 4NQWA 2LF7A 4L0ZB 4RS8A 5F6FA 2HKOA 3PQKA 3FZVA 3T8RA 4S05A 5BMZA 1ONVA 2WC2A 2ZBKA 3BWGA 2HS5A 1R5GA 3IKTA 1Q1HA 1ZGAA 4GXOA 2L4AA 2AXLA 1XGNA 1IN6A 1HKTA 2R3SA 2YR2A 4UUVA 2EFQA 2VONA 1LQ1A 3ULQB 1HW5A 1Z1DA 4M9ZA 1YW7A 1Z6RA 4LLLA 2H27A 2HTJA 4M6YA 3BZ6A 2O3FA 2BGCA 2CFXA 5HS7A 3HRMA 2V1XA 1QPMA 3P9KA 1I5ZA 1KA8A 2IT0A 3HSEA 2GXGA 1RZ4A 1XMKA 3TO9A 2YPRA 4OIQF 3K1MA 2Y0MA 2GIVA 2A07F 4UVBA 2RN7A 2F5DA 1B9MA 4P9UA 4U7BA 1WWXA 2KKOA 3HOTA 2M1BA 1OYYA 1G3TA 1TLHB 5HLHA 4EMSA 5FB2A 4G6DA 4MQVA 4LLGF 4HV6A 2J5PA 3NQOA 2R7DA 4GGGA 1J2XA 1XDSA 2EV5A 2RGVA
chains in the Genus database with same CATH superfamily
2Y0SN 4G9YA 2H6CA 5F04A 4AVPA 3IHUA 1R22A 4BH9A 1FSHA 1MH3A 3M4OJ 2BY0A 3QPTA 2PLYA 4FHTA 1IO2A 4M3GA 3WTSC 1I6XA 3OSGA 5HNFA 3GFIA 4OAYA 2KJCA 2CG4A 3RPQA 1YJWI 3F8CA 4RA2A 1I39A 4D7NA 4D9JA 4WX9A 2KDZA 3GO5A 2X85A 2E1OA 3EUAA 2PJPA 3FDYA 1UG2A 4NC6A 2OZ6A 3IH4A 3ONQA 1A04A 4YIRX 3ZGKA 1F9NA 4IEJA 1Z6TA 1A5JA 3BLYA 3JR9A 3PM1A 4I7HA 4CGZA 3E97A 4E7ZA 2Z99A 3ABTA 5DCMA 1JT6A 1WJCA 2F5VA 2EFPA 2HXIA 4RBOA 1ZTRA 3TP0A 1T0FA 2DYSH 2E1NA 2Q1ZB 2CUZA 1MDMA 3D5RC 2R7QA 3ELKA 2GWRA 3HZJA 3IRRA 3BDDA 1U6GA 2BE5F 4AIHA 1TW2A 4NC8A 2LY9A 1U5TC 3QAHA 4CCKA 5M3MJ 3V8LA 1V5EA 1P7IA 2KIFA 4RAFA 5IOYA 2PMZN 4HDUA 3G2BA 4XLCA 3U1KA 3AG2H 3OS2A 3CMEI 3GTGJ 3L2VA 1A6IA 3HJEA 4HDVA 1XG1A 1ZRCA 4PGHA 1ACIA 1SD6A 4B4CA 3MKYB 3GX4X 1K78A 1AKHA 2V9VA 4PUSA 3TDZC 2JPCA 3QRFF 4RAYA 3CZ6A 2FBHA 1X3ZB 4LIUA 3HOUJ 5GTHC 5FFZA 4Y17A 4JK1X 5J8CA 1R5HA 2WB1A 1FBSA 2ETHA 1EH8A 1FOWA 1I27A 4XKVA 1KZHA 5IP6A 3F8FA 5E3NA 3LQRA 4IRIA 1K83J 4PDKA 1LE8B 2HWVA 3CMYA 1X1PA 3V8JA 1VQ8I 4BS9A 2VOOA 3OOPA 3WGGA 4CYDA 4RAGA 4AC0A 2PI0A 1IN7A 2VXDA 1KQ8A 2CRGA 1ON2A 4AWXB 1ITYA 2L9RA 1LKXA 2OCCH 2IVMA 2Z5UA 4DGWB 2KJBA 3TGNA 4UUSB 4A3KJ 3W3CA 1OCCH 2UUZA 4QPQA 2FQ4A 5GAHJ 4P9FA 1ON1A 2W24A 3BG7A 5JI6A 1BW5A 2LSOA 1FWZA 3QYBA 2IS4A 2ICWG 2OV7A 3GLLA 4U0WA 2XAHA 5CJ9A 3LSJA 1J59A 3HRUA 2F5EA 2DFHA 3JRAA 1ZYRF 3KLNA 5E8IA 1RC9A 2P0WA 2VLAA 1JJ6C 2O7OA 3HTSB 1RUOA 5IYBJ 1ZG3A 2LKPA 2HYFA 2HQRA 3VYSB 1PUEE 3PFYA 2NVUB 5ICGA 4N0BA 4PZJA 3PNYA 1ZQ3P 1G6NA 4AIKA 3WTWC 2EBIA 2DTZA 1TBXA 1FZPB 1O57A 3I4PA 1JHHA 3I9V2 4HBLA 3GZ6A 3FM5A 2KIUA 3F0CA 1CF7B 2Y30A 1X4OA 2XROA 4UVAA 5FLVA 2ZNYA 3Q0UA 2STTA 4CXFA 1UCRA 3OYFA 4XSZF 1IXCA 2VQHA 3F22A 2XRNA 1JI8A 1FY7A 3RKXA 3R60A 2Y69H 3FXRA 2XGEA 4HNUA 1PDNC 1X2MA 2VJ4A 3B02A 2FMYA 2TDXA 1FPQA 1XPXA 3D5LA 5EDNA 3CJRB 2R7WA 2FMLA 2KMUA 2V9KA 1QO0D 1IN8A 1BN5A 2ZC2A 2K4JA 4W97A 1DP3A 4XLFA 1PVEA 3M8EA 5J6XA 3LFKA 1WKMA 4M3BA 3K4KA 1TQPA 2E1MB 2LG4A 1JGSA 1JUSA 4BJ5C 1FX7A 3E3VA 3UR3C 2ADUA 3C2BA 5B5EC 1TNSA 2ZO4A 3HPHA 1QBJA 5JFRA 3DFGA 2M8GX 1FTTA 4HQMA 2OQGA 4G6TB 3FIWA 4CZZA 3Q5FA 2ACJA 2C6YA 2A69F 3CLQA 3E5XA 4EQQA 3E6CC 2M87A 3P9IA 3ABUA 2JT1A 5L3CA 1QNTA 3WODF 1DU0A 4M9SA 1BR1A 1IF1A 3RPUA 5LHIA 3I59B 2H1KA 2KRCA 3HSRA 5AIPA 4MLOA 2A05A 5C44J 1W5TA 1TT5B 1HBXG 4LG0B 1R23A 2VIXA 1YHQI 4IJAA 1QVTA 4IX7A 4M74A 3F6VA 4EM1A 3GCMA 3RYPA 4IQJA 1MMAA 2ZJPF 2JUGA 2CW7A 2FUG2 1FIPA 4RGUA 1G59A 2F4OB 1LNWA 3VFZA 2L9VA 4DJAA 1ZG1A 4RGXA 4BNCA 1HQCA 1XTAA 2BBYA 1OCOH 2K9SA 2ZXHA 3C1DA 2DMTA 4MHGA 3GF2A 2NVXJ 3CCYA 1WH7A 3WU0A 1R71A 4HNTA 3BOQA 3JRGA 4WWCA 1ZKGA 2P6SA 1P4XA 4IRHA 3KX2A 2X51A 3E6DA 2LDUA 1SAUA 3AKZA 3C2HA 1D8JA 2WAQN 3E5UA 2B7EA 2BXZA 1SAXA 2FBIA 4ZH4F 1W7PD 5ILSA 2IS2A 2V1NA 2WB1N 4R1HA 3VSKA 1S72I 1EF4A 1IGNA 1IN5A 2HZDA 3QPSA 4QLCU 5FD5A 2BW3B 3S1QJ 3RYRA 3MAJA 3WU2C 5L3FA 2R7XA 3KEOA 2V26A 4BXUA 4FT8A 2VE8A 2PG4A 4MFEA 1YRNB 4BDYA 2BHZA 1ETWA 2P8TA 1MW7A 4AYBA 2VKHA 4OMZA 3QU3A 1BI3A 1YQAA 1Y8RB 3ECHA 2H09A 4ENJA 2DMQA 4N4OB 4ASNA 3PL8A 3CCSI 5GTIC 4O6JA 3FF5A 1RUNA 2HEOA 2QSFX 2DN0A 4C3HJ 2KPMA 1LDKB 4FE4A 3SZTA 3MZYA 3J80Z 2Y75A 2IRFG 2HYGD 3S2DJ 3S3MA 3LAJA 3F72A 3I4NJ 4AD9A 1FNNA 4BEHB 4Q48A 4I0BA 4R79A 4XL9A 4YRVA 1DDNA 2ESNA 2A3SA 2JN6A 3OR1C 2H6BA 4HW0A 4KT6A 3L9FA 4RGSA 3G6EI 3CF5F 1ERDA 2VQLA 2BVMA 2X6XA 3FISA 1KU2A 1B8IA 3KFWX 5E1WA 1WGXA 1ETOA 5CQEA 5EJCA 1VQPI 2YSRA 3A01A 5DM6F 2ME0A 1N25A 1LB2A 4IHYA 2XSJC 2OTLI 2FOWA 2DJIA 1B1BA 4CSWA 1FBQA 3L2QA 3PO2J 2VL8A 1XMXA 2NXNB 3B6AA 1PJRA 5J47A 5D5XB 1TQIA 4C3JJ 3FXJA 1Y39A 3OIOA 1W4MA 4A3CJ 2ZJ2A 1QA6A 2MH9A 1SFEA 3OYLA 1GV2A 1P2FA 1I1SA 1QHHD 5IT3A 5ILUA 1WPKA 2P5LC 1X2NA 4UV8A 1SFUA 1X1DA 2BOLA 1T2KA 4G7ZF 4ON0A 1RETA 1MMSA 1FOXA 2HDWA 3WU1B 3RZOJ 3S1RJ 3BR3A 3ZMDA 1UJ8A 2FF4A 2E2HJ 4EJUA 4IOCF 3OYDA 2Q0OA 3IC7A 2L2OA 2DMUA 5HNHA 3OIQA 3PO3J 4L9JA 2X6WA 1K79A 4NQWB 4Y7NJ 5JHFA 2W7NA 2GLOA 3KYLA 2FSWA 3S93A 1XMAA 2CQNA 3PIOF 4KITB 4QIWN 3MCZA 2EIJH 1RIOH 2QCOA 1BI0A 3VSLA 5LD2C 1J75A 5F1RA 4L5EA 3E5QA 2JMWA 1KU3A 5CYVA 3VEPA 2JA7J 1YW9A 1X1BA 4G7OF 5E20A 4F91B 1SVLA 3HGYA 4LITA 4L5IA 1SD4A 1R5ID 3V7RA 1YJNI 4A5MA 1Z3YA 2VBZA 5M5YJ 2ZJRF 2PN6A 4BQQA 2AO9A 4RM3A 1HDDC 3LA2A 2OCEA 3IKVA 1QZYA 5IP9J 1DUXC 3QOPA 2K9NA 1D8KA 4M72A 4B43A 1SANA 2XC7A 1YO5C 1P7JA 4P96A 1N75A 2Y0SA 1U3EM 2CO5A 3LA3A 2DLLA 4E7IA 2XF5A 4EJTA 3LMMA 1SMYF 2KQRA 2QGUA 4LJZF 5CVJA 3CC7I 4LB6B 5HOOA 4DBRA 3F8MA 1GHCA 2WV1A 2E19A 3JW4A 4HOBA 2E5NA 3RJPA 4BAYA 3ZMZA 2BY3A 3KP5A 4D5FA 1XSDA 2FXAA 2XPUA 3COAC 4L5JA 1S8NA 4ANJA 2EZHA 3LSMA 3R61A 1IAWA 3VODA 3SDGA 5GAEJ 1KYZA 2QQBA 2O03A 3L2RA 3C3WA 2EFNA 1X1AA 4MEYF 3QU6A 4C9YA 3LSPA 1BC8C 4O3MA 2V9PA 4PJJA 1KU7A 1RR7A 4LGWA 1BBYA 2ZJQF 1UG0A 3OV8A 5HVQC 4EJVA 2WAFA 2IPQX 2CGPA 4XLHA 2AXTC 4ZDPA 2MLKA 3EETA 1BR4A 2ID6A 4C2UA 2P7CB 4ENNA 3CMMA 2RC4A 3QWLA 1HKQA 3L2UA 1XS9A 3U1DA 3KEYA 2J5OA 3F6OA 4BJ6C 1E3PA 2X4HA 4IKFA 2P7VB 1TWAJ 4EEFG 2TRTA 4AYBN 1VQMI 2COMA 1FBUA 4V2FA 4YEJA 2DOFA 3REOA 3E6BA 3DKXA 2VJIA 1D0XA 2OZUA 2MLGA 3WGIA 5L3DA 1F36A 5JVTA 4M3EA 4N4NB 2EIKH 4M3FA 4A0XA 1TZLA 3TL4X 4U7DA 2XAFA 2FQ3A 3A0BC 3G1LA 2K7LA 3DWLE 1F1ZA 3BTJA 1JKRC 2B63J 4IHVA 1RKWA 4RGRA 1IW7F 3CCUI 2R0QC 2HOTA 4UHTA 4KDPA 3Q9VA 3QYFA 2BY1A 1SD7A 3EUHA 1R36A 1ZARA 3RQ4A 1OPCA 1YIOA 3GTQJ 2R5YA 2DFEA 1MDMB 3GWZA 5HLTA 5E1ZB 3HOXJ 1Z9CA 1IRGA 2BXYA 3GUDA 3CP2A 4ZYGA 1YW8A 1K4SA 3ZPLA 3PUFA 3VYTB 1FMVA 3BQZA 3K4MA 2MABA 3DEUA 2H1LA 5H6QA 1UZCA 2LFBA 2E2IJ 4BJTA 3MZHA 1SMTA 4Y13A 4KMUX 3WTYC 4OIRF 5EZHA 1O4XA 1BC7C 1K61A 3PNTA 2P5KA 4A5NA 3A03A 1HSTA 1K78B 3C18A 1AKHB 1NK3P 4MFDA 6PAXA 5B66C 5FD6A 2A61A 4DOZA 4ZTJA 4RB1A 1TWGJ 3I64A 4A93J 1CGPA 1ZAOA 3OYJA 2RKHA 5AONA 2L9NA 4I01A 5F08A 3TOBA 1F43A 5D8LB 2FE3A 3M07A 3FXLA 3CD6I 1E3OC 1T56A 2YU9J 3F9KA 4CDGA 1MBEA 4L0YB 3JCUC 3LFUA 3F8BA 3LSRA 2VPRA 4QSHA 2VKEA 3BP8A 2JTVA 1WCMJ 2RVCA 2EQRA 4BUPA 2YS9A 3CTAA 2IGOA 3I0TA 2W82A 1B9NA 3CDLA 2D5VA 3OR2C 4FQGA 1S3JA 1KYWA 3JRIA 4L9NA 1U8RA 3J7YJ 1MMNA 4DW6A 4II2A 2KHMA 2JRTA 3I71A 1ZR2A 2NYXA 2K9LA 3RDIA 5JVGF 1KONA 1OKRA 3DPLC 4N9HA 1OCRH 4Z2YA 1YE9A 5C4JJ 2L7MP 3LWFA 4M3DA 2COBA 3F23A 4D7MA 4A3EJ 4Y15A 3JTGA 4KISA 1WJAA 2E36A 2QSHX 5LFAA 3C2GA 1BIAA 2VT2A 2DK5A 2QKLB 1MJAA 2DQRA 3QPHA 5F64A 4EM0B 1W36D 4PCQA 4ZYHA 2IS1A 3GTKJ 3EDPA 1KQ9A 1BR2A 1EV7A 3WGHA 2E7XA 4B44A 5D4SA 2NRAC 2EPFA 3QP5A 4R8HA 1MMGA 5F0HA 5HDKA 1K4TA 2X0LA 1Y0UA 1W7PB 4IHTA 1LUJB 2L7ZA 3L2CA 4M6VA 5HLGA 3TP3A 1TL8A 1F4KA 2HVRA 1Y0NA 1VF9A 1W0TA 2OJED 4G6QA 5AIQA 1FP2A 2QLZA 1RI7A 3BTCA 4CCNA 2DO7A 2L5QA 2BYVE 3BTIA 2OC6A 4XLEA 2FNPA 4A6EA 2IA0A 2M4GA 3J7ZI 3V42A 2EZKA 3HDDA 1P92A 3TQNA 3GTMJ 2BHYA 5H20A 3HOWJ 4TV7A 1IG7A 1YITI 3HUGA 3S1MJ 2WAQA 4LB5A 1S29A 5J8FA 1R1TA 2VN2A 5E18F 4RMNA 5JHUA 3DF8A 3ISPA 3GXOA 1O7FA 3OWTA 3KP4A 5FKKA 5GP9A 4FE7A 2LMDA 2VJJA 5B3SH 2DA4A 5ICEA 1O3RA 2A6HF 3HOSA 2LOOA 1X1CA 1HW2A 4N9IA 5HODA 1TC3C 1M1EB 2P81A 4UV9A 2LK2A 4HA8A 2QENA 4LG3A 3HG9A 4BY7J 3D5SC 4HAMA 1MBGA 3IV5A 2DU9A 1HXDA 4CH7A 1MBHA 3GMEA 2FOKA 1ZLJA 2ISYA 2DT6A 3DPTA 5L3GA 4WXDA 3T1BA 1FTZA 1B72A 2V79A 2IA2A 2G7UA 2R7OA 4XN0A 3CUQC 2G7HA 4JBAA 4ZTFA 3OIPA 5J1RA 2R7RA 3L09A 2EIMH 1NTCA 2E71A 1T33A 2Z1DA 4F92B 2X6OA 2VE9A 4A0ZA 2Y31A 3MKZA 2F5FA 2JZYA 1IXRC 1MH4A 3EYIA 4X0GA 2DJNA 2A68F 3ESWB 3GFLA 2WA0A 3UKGA 3JTHA 3G71I 4HV5A 4RLQA 1U2WA 4E6KG 2LD5A 3CCQI 3HYIA 2R5ZA 1QHGA 4MEXF 4GYGA 2N8GA 3LSIA 5B1BH 2L02A 5LEKA 1F5TA 2CUFA 3S2WA 3KYCB 1P4WA 4WXHA 2ZFWA 4ZC3A 4RB2C 4BKXA 3CCLI 1A35A 4KN7X 2K9QA 3HOYJ 2A6EF 3WG9A 5K7HA 1WRJA 4B48A 4ESFA 3KCCA 3K1PA 3ECOA 1JTXA 1QZZA 3SEZA 4ESJA 4U0VA 1T95A 1TWHJ 5B1AH 2VQGA 3B73A 2LH9A 3NRVA 1YLFA 4JOMA 3F21A 3B6CA 1D1CA 1A31A 3EUHC 2WTEA 3ASNH 3E0JB 4ZDOA 1RPWA 4GYIA 4BU2A 3HC7A 2V6CA 1FYMA 3VDXA 2MC3A 1PP8F 2GA2A 4CUGA 4E7SA 1E3HA 4WCGA 3IRQA 1I50J 2QF7A 4H0EA 2HDDA 5FGMA 1VFCA 2LBFB 5EYRA 3H3VK 3DEWA 3KZYA 4ETSA 3GZNB 3JSOA 4KNYA 2ELJA 1JGGA 5GADJ 3OYNA 1WSUA 1A36A 3HRSA 5DD8A 3X2QH 3A01B 1BA5A 2PMUA 3K4CA 2IGKA 4HX7A 1XB4A 3CCRI 1WI3A 4FISA 4I99C 4OIOF 1V3FA 1GVJA 3S8PA 2DPDA 3BPXA 3K1NA 3FHZA 4B3AA 1YFHA 2HFHA 3M1CA 1EH7A 1Z0XA 5LEJA 2K86A 3WHCA 1H0MA 5K5OA 1VQ9I 4J19A 3GTPJ 3J81K 2X1DA 4DYCA 1FOYA 1J09A 3BR6A 1XGSA 1MBKA 3G1MA 2QYOA 3HB9A 3CLOA 4Y52J 1K7AA 3FXQA 2DT5A 2P5VA 2LR8A 1HSJA 2K3PA 3O2PE 3OYIA 1VNDA 4XOTA 4HG2A 4HF2A 4RM2A 5HS9A 1FOKA 2ZXWH 3BG3A 2PBIA 3PIPF 1Z3XA 3AL0C 1VQ4I 3BTLA 2ZB9A 1FSEA 2XAGA 3LAPA 3TMOA 1U8BA 1OQYA 1U5TB 1HKSA 3ZN1A 3GTJJ 5EG0B 2E2JJ 2IA1A 3KZIC 5DDGA 4BDZA 4ENKA 2IEKA 2P4WA 1MJ9A 3SQNA 2H94A 2D45A 1DQUA 1MGTA 3M8FA 3CO6C 3FK7A 1R7JA 4BE0A 2HZTA 2W48A 3W6VA 3L1PA 2G0EA 3TO6A 4IHXA 2RAEA 2YU3A 4DNCA 2HI3A 3D0SA 2ZMEC 3IWFA 2BEOA 5FKOA 1LFUP 1P6RA 5KVRA 1G3WA 2F2EA 3R0JA 1KU9A 5J1UA 4OAZA 5DV5A 5BNGA 3OYBA 4XM3A 1T98A 4XONA 1AWCA 1MJBA 1PUFA 2O0YA 2XIGA 1ULYA 4E7HA 4IHSA 1R4NB 2JWTA 3K2ZA 4LK1F 3HHHA 3IL2A 3LNQA 5CVVA 4XLNF 3GFMA 3L2WA 4A69C 2BY2A 4M73A 1DP7P 3MQ0A 1YX3A 3N4MA 5IYCJ 5H6RA 2F4MB 4MIMA 3V7SA 4CCJA 3BG6A 1T08B 3PNVA 2PX9A 3KE2A 5LRSA 1G3YA 1OYWA 3ZMVA 3O8GA 4IXAA 4M71A 2ESHA 1LVAA 3RPUD 4ZZLA 2LP0A 4JX6A 1RR8C 3MVPA 2IS6A 2HQ5A 3DLAA 5J4YA 3OYAA 2EK5A 2HU9A 1FEXA 1ZH5A 2A5YB 2VXZA 1HDPA 5BOXA 2LLKA 2JSCA 2OPTA 4UXNA 3TDUC 1IRZA 5D8KB 5LHHA 3GLXA 5CVIA 1V55H 4D0PA 3R6SA 4BQNA 3JRDA 3RIRA 5DTDA 4E4HA 2MD5A 4HNVA 2QBYA 2AQFA 2KIQA 2NOJB 1N78A 4XICA 1MNDA 4XKBA 1WJBA 2CH0A 3ZQGA 5HDNA 3H5AA 3PQJA 3K0LA 2UZKA 1B4AA 3K70D 2M9HA 3T0YA 5D6EA 3CMAI 2ZXJA 2HQNA 3H9GA 4B09A 4CICA 2W57A 1XD7A 2FJ1A 3JREA 1BOAA 2DK8A 3KZZA 4OMYA 3DKYA 1T6SA 4LG0A 4PJ0C 1IZ1A 2IXSA 3AFHA 5C3EJ 3HHGA 4BBSJ 2EB7A 2K85A 5IYDJ 1D5VA 1TTYA 5LGUA 1MSEC 2K40A 4KYWA 1BJZA 2IJLA 1POGA 2NVYJ 3ZP5A 4BHPA 1OCPA 4LIVA 1YJ9I 2K4BA 5IOZA 1SFKA 2CU7A 2RDPA 2DMNA 2I10A 2MD0A 3GTOJ 1ZELA 3M7GA 1QZEA 4C30A 1RNLA 3V4GA 5KAFC 4J01A 4XKWA 3MD2A 1MKMA 2CWEA 4WXCA 2KT0A 1K6YA 2X6YA 3M8JA 3FBNB 5JLXA 4Y3OA 3E6MA 2HDCA 5IPAA 3GVAA 2KP6A 3RZDJ 4AIJA 2GXBA 1LVKA 2MC4A 1QU3A 3IWZA 3TW6A 3MKLA 4I2OA 5GAGJ 1WJ5A 3AG1H 4K2EA 1FP1D 3CESA 4XIDA 1X3UA 4B1RA 3S15J 1YG2A 2DFIA 3MEXA 3PSIA 2MFZA 1R58A 2QQ9A 2NOGA 3ZMUA 2DW4A 1MNMC 1ZRDA 5E17F 3KETA 4KFCA 1X4PA 2E1CA 2Y9YA 4BE2A 4FX4A 2CMPA 5K1YA 5CLSA 4YG2F 1QQIA 2ECCA 3E1SA 3H9QA 2IP2A 4BXXJ 4NHJA 4O5VA 3OL3A 2XPVA 4AIDA 4PSXA 2Z3YA 1WI9A 3W6JB 4ABZA 4KIFA 1NHAA 2E7WA 3RCOA 3WE2A 1LFBA 2CQQA 2JQ7A 2QVOA 3FXOA 3CUQA 3KLOA 2X1EA 5HLIA 2ELKA 1FYLA 2ISZA 3E7LA 3K4BA 3QYEA 2KL4A 3WTTC 1R9TJ 3WTVC 2KIMA 4MQ9F 1E0EA 4MO7A 5EGOA 4ZYDA 1ODDA 3ROUA 2M45A 4HPQA 3M1EA 2MA3A 2VC0A 4H4KC 2BV6A 4OU0A 1ZGWA 1R49A 1H9TA 1S9HA 2AS5F 4MTEA 2O5RA 3O3KA 3BPVA 3KIOA 5E3MA 2DA6A 2CS3A 1WH5A 2OTJI 4MTDA 4XLPF 3BJOA 1R1UA 1OCTC 2QUFA 1ZN2A 5J1YA 4BHBA 1OFCX 3DKWA 1YTYA 4A3FJ 2EA4A 2Q2EA 1VZ0A 2D1VA 1SC7A 1BW6A 1EKEA 1MBJA 2VBWA 4NUBA 5EEHA 2L01A 3S17J 4B47A 4HX8A 2HVSA 1WQ2A 4W1UA 2E34A 4NNJA 2P6TA 4EV0A 2XPWA 3BR1A 3I53A 1VQ7I 2UWMA 3L7WA 3QODA 1LDDA 5DUKA 3BC8A 3J7AO 2VOPA 2A5WA 1EJ9A 2CQKA 2UXNA 3V8KA 2XDVA 3N05A 5FFXA 3DBRB 2NS7A 1PP7U 2DT7B 4A3BJ 4U88A 2VODA 3H92A 5LRRA 3MWMA 4F3QA 3HOZJ 4DIQA 1OLTA 1ORKA 2CW0F 3FXKA 2ELHA 4D5CA 3BCAA 2CV0A 1Z91A 1H9GA 1YIJI 1Z21A 1WVRA 4KUMA 3O6BB 3M9AA 5DCMB 1AHDP 3CC4I 4EGYA 2FNAA 1KGSA 4IL6C 2BVLA 3G73A 4F55A 3ZOBA 1T8IA 4A3LJ 1Z7UA 2E35A 3G1OA 5IP7J 4AM3A 2KRHA 5D4RA 2D1HA 3H9JA 3U21A 2Z33A 5FRMA 3HPGA 3OY9A 2VKDA 4YELA 2V4JC 1ZRFA 1HOMA 4NC7A 2O9LA 2M30A 5DS9A 2DA2A 1GXQA 4XN3A 2E5ZA 3BCBA 3H0GJ 1USSA 2XB0X 1NK2P 3H36A 3DLLF 4NB5A 4P55A 5M5XJ 3N97A 2EZIA 2R93J 3SZPA 3HUGB 4ZYEA 1UHWA 3H3ZA 1XSXA 5DD4A 1L0OC 1XN7A 2OBPA 4OOIA 3HGGA 3U9GA 3H0DA 3RI4A 1TT0A 1FLIA 2DOEA 3RKQA 1JTYA 2LF8A 3WG7H 4G94A 1BJAA 2JA2A 2LKXA 3HBLA 1KQ0A 3FBIB 5BQTA 1LEBA 4EGZA 3J7AY 3K10A 1GLNA 5D5WB 5CVUA 2I8DA 1QPIA 4MGRA 5JLWA 2JSPA 5LGTA 1D0ZA 1JUMA 2HTSA 3GFJA 3H5NA 2O6GE 2F48A 5D5UB 1VQLI 4XNFA 1AOYA 2GM4A 3EUKL 2Z2SB 3HIFA 4HX4A 1H89C 3BROA 3S2HJ 4A6DA 3I56I 1FYKA 3ZQHA 1U9OA 3AG4H 3CQZJ 4GFBA 2EFOA 2NAZA 3I5UA 1XX5A 4I09A 1B72B 1MSFC 2CFOA 4KMFA 4XRFA 4KT5C 1I3QJ 2I5UA 1JUPA 4NDLA 1MNEA 2O8KA 3H1CA 4CHUA 1YS6A 3T8TA 3I4MJ 2W4SA 3V7CA 3O8HA 3S1NJ 1O3QA 1S7AA 1Y1VJ 4HF0A 2ZKZA 3C7JA 3S32A 3FXUA 1G8XA 1LEAA 2X9DA 4FETA 1LJ9A 4YFXF 1Z7LA 2HPMA 2JVGA 3SXYA 3ZMTA 2ZMEA 1OR7C 2E1MC 3KP7A 5F0FA 3CUOA 2JA5J 2W1OA 3VYRB 1JKOC 4RLFA 4P5OA 3IH3A 2DXIA 3OYCA 2DBBA 4Q5SF 5ERIA 3KP6A 2V1DA 2WV0A 3GW2A 1QGPA 2R5ZB 3CJNA 5J3LA 5KHDA 3TBIA 2LTPA 4XQFA 3CP8A 5KK1A 1USTA 2WADA 2R4GA 4PJLA 1IXSB 3S14J 2H8RA 2QM3A 1XCVA 3KEQA 4I98B 1Q1VA 4ZJZA 4A0YA 1QRYA 2MH2A 3MFKA 4V2GA 1W1WE 5BS6A 4L9VA 3A4CA 2CW8A 5E8GA 3LSTA 2XHKA 5J40A 4F52A 2M7AA 1O3SA 3S3NA 2VC1A 1J9IA 4HSRA 3AG3H 1I1GA 2HR3A 1BI1A 4XRMA 4LMYA 3H3UA 4CYCA 4UUTA 2GZWA 2FU4A 2LYCA 3WHBA 2F4IA 2VQCA 3WTUC 2CQXA 3GEZA 3GYHX 3CCVI 2HYJA 3EPZA 4F93B 4IOAF 4F7ZA 4BY1J 5L3BA 1ETYA 3JAMZ 4IO9F 3P9CA 2UV1A 2GOMA 3LA7A 5IT9Z 4JP0A 5L3EA 4LD5A 1ETKA 4DZJA 2EV6A 1GV5A 3BG9A 3CDIA 4UVCA 2XF6A 3ZQIA 5M5WJ 3D1NI 3JAMK 5IT9K 3Q0WA 2M3AA 2XUBA 5IY5H 2LKSA 3K4JA 5EF6A 2UXXA 2WBMA 2XAUA 2W25A 4RDUA 2PEXA 3A0HC 1P9QC 3MMYB 1O7LA 2XKOA 2JVHA 2FRHA 1TWCJ 5ED4A 4FASD 2R7UA 1IUYA 1H8AC 2DDAA 2W85A 2KZVA 2IGMA 3HRTA 3JRCA 4LK0F 4LOCA 3MZ8A 5FRNA 1E2XA 1VI0A 3I55I 4WF2A 1C0WA 2EH3A 2DPUA 3QPLA 2JK3A 3K2AA 3K69A 3CO7C 5FLMJ 1IC8A 4XOPA 4UNOA 2XV4S 5DUIA 5LGNA 1T39A 4LLNA 1ZG5A 4YIIA 4IQ4A 3NAUA 3RTRA 1EH6A 2QQAA 2VPLA 3SFZA 3FMSA 2FX0A 2MW8A 4CO8A 4BE1A 2WY7Q 4QWQA 3JRBA 3PFIA 2D2WA 2FA5A 3U2RA 2PJRA 2RNGA 3HKZN 5EZGA 4S04A 3FMQA 2NS0A 5FO5A 4EJWA 3TEDA 4OINF 2XGDA 2VJ5A 1VQKI 4C2MJ 4S0HB 1JKQC 4A3JJ 2WY8Q 4DQ2A 1UHSA 4IF4A 4CA0A 1R6RA 1R00A 2CSOA 2E60A 3SEQA 4HRIA 2K5CA 3BR2A 4KIGA 2R7FA 1GVDA 3FKJA 3HM5A 4EJOA 2CYYA 4Q4ZF 2HOAA 3IAM2 1FMWA 1PYVA 2LREA 1AA7A 1IDYA 4E7KA 4Z6YA 3DU5A 3H5RA 3F8NA 2KRFA 2OD5A 3G4SI 4JX5A 4M6XA 1NH3A 4C3IJ 2X48A 3HXLA 1S6LA 4FTHA 1LDJA 2NS8A 1J7KA 2WAEA 2F6CA 1PUFB 4BQOA 3CCEI 1VQOI 4HLYA 2NVTJ 4IHWA 3DP7A 2LY1A 1MD0A 3IAS2 2AQEA 3ERED 1K6OA 2VBYA 1T38A 4A2UA 4ZYAA 2DA5A 3ZR8X 4I76A 3DBHB 2FEZA 4AUXA 4NBQA 1G4DA 3ZQFA 4AU7A 4II3A 1W7PA 4MNUA 2KDOA 4ZDLA 3CJTB 2VKVA 1DPRA 2KISA 2IBDA 3OOUA 2EV0A 5E3OA 3IH2A 2VBXA 1B8IB 2ZSHB 2R7ZJ 2OQRA 5CVRA 2Y9ZA 3S16J 4FX0A 2TCTA 5BPIA 2IAIA 4KA4A 1XGMA 3QP6A 4IVNA 5FJ8J 3JSPA 4A3MJ 4XR6A 1ZREA 1CQTA 4A12A 5ILVA 1N77A 1WFXA 3J81Z 3VOEA 1AU7A 1A6QA 4JQFA 1S5LC 1P4AA 2OA4A 2X1CA 5LLQA 3BZKA 4L9TA 2HOSA 1YS7A 1IN4A 2ZNZA 5M3FJ 4BBRJ 4V19K 5GPAA 4EATA 1HF0A 4BYYA 3VYUB 1W36C 1J0RA 2QBYB 3FWEA 4CCLA 2HGCA 2STWA 3UNGC 2HNHA 4KJZA 3OYGA 1WZ2A 4E7LA 1ZGJA 2JA6J 3DXJF 5TJJA 4IRGA 1LE8A 5C4XJ 2LNBA 1Y56A 3DTIA 2L0KA 4PK4A 1WJFA 2DTRA 1JXSA 2F5CA 1REPC 3F3XA 3LSHA 2XVCA 1JKPC 2ME6A 4P1WA 4UUSA 1ETQA 4CZCA 4PJMA 1BI2A 5J4VA 4CCMA 2FD5A 1S7OA 5CKTA 1SD5A 2R92J 4BGDA 2EILH 3BQYA 3LQQA 3NWSA 5F0CA 1HC8A 3K9TA 3LL7A 3DTEA 2XGCA 2IGNA 4UY8I 5FKLA 3SHFA 2ZSIB 5DM7F 4QTRA 1YOVB 2M4KA 1BL0A 5KCMA 3BY6A 1HLVA 1ETVA 1IDZA 2OF7A 3TO7A 2B0LA 4HF1A 4FCYA 4UB8C 5DCFA 1TW3A 4PGGA 2M2EA 4E7JA 2ZXIA 1XDUA 2AHQA 2DFFA 2EINH 3BT9A 5JR3A 2EWNA 2LC2A 2DDBA 4I0AA 4UB6C 1IRFA 4GDFA 2R7TA 5DYMA 2HOEA 3SYTA 1DGWY 1Z67A 2XRLA 4BXFA 5ICCA 2QKMB 1APLC 2W84A 3A2KA 1CF7A 2PFBA 2CV1A 2VASA 3ZQCA 2RNJA 4X1EA 2JA8J 1XGOA 3TKYA 1R1VA 4ZZDA 3GBGA 4IPAA 2OAZA 1UAAA 3RQIA 2JRMA 2H8WA 2GA1A 5LBQA 4L18B 2MBFA 1VTNC 2GBYA 1V4RA 2JUCA 1BIBA 3R0AA 2RQPA 4XBFA 4EM2A 4YFKF 3A1YA 5CPRB 4M9XA 2DA3A 3QOEA 3CDHA 2O61A 3ABLH 2V7FA 3ABMH 5DEQA 2DQLA 2R7VA 3K6GA 3L00A 4BACA 2ZFUA 1JHFA 3CUQB 1IRXA 1U9NA 2XKPA 3BR5A 4CCOA 2B9SA 4U87A 5A2QZ 3I3LA 2HPIA 3BJ6A 1O3TA 3DU6A 5FLXZ 3JRHA 1TNTA 1OJLA 2GOXB 1G2HA 1XSVA 5EGOB 4OWRB 2DAOA 3NARA 1T0FC 3PSFA 4G8XA 2L54A 3OYMA 1I6HJ 1OR7A 2Q8KA 3SJMA 4KICA 5A2QK 4GRIA 4I02A 4DYRA 2DA1A 4GCVA 3J80K 1FC3A 5FLXK 4HEA2 4LFUA 5K5RA 1U0JA 1ZLKA 5HS8A 1MIJA 2K02A 2LBFA 4C2TA 2VUMJ 3FKIJ 3OS1A 2DOAA 2GAUA 1OMIA 2Q2EB 5FROA 2EFWA 3DBLB 3H35A 3ZN0A 1RESA 1YYVA 2JJ7A 1SFOJ 3SDBA 2QSGX 3GZ5A 3K4NA 2YUSA 4XORA 1HCRA 3BG5A 5D6FA 3OYKA 1J5YA 1I3AA 1Y6IA 2XAQA 3DQVC 2PMHA 3R4KA 5EEGA 4EVIA 1GT0C 2G9WA 2L3DA 2MYSA 5K5QA 1W5CC 2QZ8A 4XSXF 3HOVJ 1DGRM 3I59A 5TRDA 1TWFJ 1G3SA 2IW5A 3EYYA 4B8XA 4G7HF 3W2WA 2VT3A 1B6AA 3SFIA 2DYRH 3FK6A 4ESBA 5KNLA 4HQEA 1H88C 3EQLF 5K7ZA 1ZK8A 3W6KB 1U78A 2RREA 4XKCA 3HSFA 1XC5A 1W5SA 3RKYA 5ICFA 1D5YA 2RV8A 3CCJI 3K7AJ 5K7FA 2CUEA 1UELB 1VQ6I 1ZHFA 1HW1A 2ZCWA 1JT0A 2R5YB 1D1BA 2RQQA 3HTUA 3RKWA 3DEEA 1GUUA 2EJRA 4PFOA 4HYEA 3FM3A 4A3DJ 2M8EA 2YX7A 2ID3A 3W2AA 2O8XA 1D3YA 5F1JA 4B3XA 3I54A 5KAIC 1U5TA 3VPRA 4JX4A 5EG0A 1IV8A 3TOAA 4YIFA 5H2FC 2W00A 3ML6A 2XAJA 3OSFA 1GXPA 1SFXA 4BQAA 2M5WA 3HEFA 4HSTA 5HDGA 1R4MB 2L7KA 3DTKA 2L4MA 3IP4B 2OU2A 1VQ5I 1DU6A 4E70A 2BW3A 2NNYA 2PQ8A 4GO1A 4G12A 3S3OA 1YX5A 3ZQLA 3ZQQA 3SZGA 1TP4A 2V1UA 1DPUA 1E17A 2YX4A 3Q3SA 1YRNA 1YI2I 3T5XA 4BHCA 1SEUA 2CQ7A 4IZZA 2GXAA 2L9SA 4ITVA 3GTLJ 4WK8F 2V6EA 1B59A 3BJAA 4XK4A 2LRDA 2M34A 3WTZA 2NVQJ 3FX3A 2QEXI 5D5VB 1NG6A 4KIBA 2GQQA 1MMDA 1UFMA 2K3FA 4YFNF 3AL0B 2BZTA 2Y48A 5TISC 2JPBA 1BM9A 3CJQB 4U0YA 3OS0A 2QWWA 3BZCA 2XB5A 1UHMA 3DV8A 4RB3C 1STZA 1TQMA 4D1QA 2NNNA 2OUMA 4BEHA 3ERMA 1FT9A 2XGXA 1SVMA 1WJDA 2HKXA 3NEUA 2K27A 2MGQA 1JE8A 2EA2A 3KP3A 2K9MA 2HVQA 3AAFA 1UB9A 2LVSA 1NG7A 2HXOA 1BOBA 3ABKH 4RAZA 4DZPA 1S7EA 1OYIA 3Q0VA 2DI3A 2Z9OA 3LSKA 4HZFA 3OL4A 3FMRA 2MSYA 2FBKA 1RKTA 3ZCOA 3MN2A 4DYQA 4KN4X 1Z05A 1ETXA 3LSGA 4ENMA 2ZMEB 5E1XA 4Y33A 4XMYA 2CV2A 2LY2A 4Q47A 3ZMSA 2DCEA 1JJ8C 2QA4I 1UMQA 1D0YA 3TW7A 3CF2A 1ZR4A 5E3LA 2PMZA 3ZQ7A 3G3ZA 3LOCA 2XASA 3I58A 1V54H 3Q9SA 1MZBA 4BL0B 5BPDA 2XF7A 3KP2A 4HLXA 4RB0A 4XRSG 1XCBA 4XLAA 3ZRGA 2CJJA 3VB2A 5LHGA 1FIAA 1L3LA 3WTXC 2Z16A 4OIPF 3KYDB 3RSNA 1W0UA 2DA7A 4A3IJ 2VB6A 2WWYA 1FJLA 3HL2A 3WE3A 1MBFA 1OISA 2R7SA 2ECBA 2M7BA 3P7NA 4NQWA 2XSDC 2LF7A 1SVOA 4L0ZB 5CQGA 3PUBA 4JYKA 3NWTA 4RS8A 3VWBA 3K4LA 5F6FA 1WJEA 2HKOA 2A6TA 3PQKA 1Y8QB 2VI6A 3FZVA 5F27A 4CYCB 3T8RA 1ENHA 5EEAA 3OYEA 4S05A 5BMZA 1ONVA 2WC2A 2ZBKA 3BWGA 4PSWA 2HS5A 3HKZA 1R5GA 3IKTA 2M0MA 1Q1HA 5GPCA 3OYHA 3M3YJ 1QVUA 2CUJA 1IUFA 5E79C 5FKNA 1ZGAA 1GDTA 4GXOA 2L4AA 2AXLA 1XGNA 3BR0A 1IN6A 4I6ZA 1HKTA 2HQAA 1HA8A 3JRFA 5TGTA 2R3SA 4QPOA 3CC2I 2M0CA 1X19A 2QQ8A 2DMPA 2YR2A 3K70C 4UUVA 2EFQA 3ZXSA 2VONA 2KLOA 1LQ1A 3ULQB 1VQNI 1HW5A 1Z1DA 4M9ZA 1YW7A 1Z6RA 4LLLA 2H27A 2HTJA 4M6YA 1LFPA 3BZ6A 3DCFA 1Y1WJ 3QQAA 2O3FA 2BGCA 2CFXA 5HS7A 1V5FA 2L7FP 4A3GJ 4AVZA 3HRMA 1V5GA 2V1XA 1QPMA 1X58A 3P9KA 1I5ZA 1KA8A 3OMYA 2IT0A 3HSEA 3P5JA 2GXGA 1RZ4A 3MKWB 1XMKA 3TO9A 1EA3A 5FKMA 9ANTA 3DPUA 2YPRA 4OIQF 3K1MA 2Y0MA 1RRJA 2GIVA 2A07F 2Y2ZA 4UVBA 4X6AJ 3FXMA 2RN7A 2F5DA 2MG4A 4J00A 4XRSA 1OCZH 2DODA 2GIZA 4PJNA 1B9MA 4P9UA 4U7BA 1WWXA 2KKOA 3HOTA 2M1BA 1OYYA 1LPQA 1Z77A 1G3TA 1TLHB 1X3WB 5HLHA 4Y4RA 1D1AA 4EMSA 3ASOH 3KPHA 4G6DA 4MQVA 5FB2A 2PJRB 3A02A 3CCMI 4LLGF 4HV6A 2KFDA 2KZGA 3IUOA 2J5PA 4PFPA 1WHUA 1IJWC 3FHNA 1IV6A 3PJRA 3W2VA 3NQOA 2R7DA 4GGGA 1J2XA 1XDSA 2EV5A 2RGVA 4DBQA 2EZLA
chains in the Genus database with same CATH topology
4G9YA 2H6CA 4AVPA 4BH9A 3IHUA 1R22A 1FSHA 3QPTA 2PLYA 4FHTA 3WTSC 1I6XA 3GFIA 2KJCA 2CG4A 3RPQA 3F8CA 4WX9A 3GO5A 2PJPA 2OZ6A 1A04A 1F9NA 1Z6TA 4I7HA 4CGZA 3E97A 2Z99A 3ABTA 5DCMA 2EFPA 1T0FA 2E1NA 1MDMA 3ELKA 2GWRA 3IRRA 3BDDA 1U6GA 2BE5F 4AIHA 1TW2A 1U5TC 3QAHA 3V8LA 2KIFA 4HDUA 4HDVA 1ZRCA 4PGHA 1SD6A 3GX4X 1K78A 2V9VA 3TDZC 3QRFF 2JPCA 4RAYA 2FBHA 5FFZA 4Y17A 4JK1X 5J8CA 1R5HA 1FBSA 2ETHA 1EH8A 1I27A 3F8FA 3LQRA 4IRIA 4PDKA 2HWVA 3V8JA 2VOOA 3OOPA 3WGGA 4CYDA 2PI0A 1IN7A 1KQ8A 1ON2A 4AWXB 2IVMA 2Z5UA 2KJBA 3TGNA 4P9FA 1ON1A 2W24A 5JI6A 2LSOA 1FWZA 4U0WA 2XAHA 5CJ9A 1J59A 3HRUA 2F5EA 1ZYRF 3KLNA 5E8IA 3HTSB 1RUOA 1ZG3A 2LKPA 2HYFA 2HQRA 1PUEE 5ICGA 4N0BA 4PZJA 1G6NA 4AIKA 3WTWC 1TBXA 1FZPB 1O57A 3I4PA 1JHHA 4HBLA 3GZ6A 3FM5A 2KIUA 1CF7B 2XROA 4UVAA 2ZNYA 2STTA 4CXFA 1UCRA 4XSZF 1IXCA 3F22A 2XRNA 1FY7A 3RKXA 3R60A 3FXRA 1PDNC 3B02A 2FMYA 2TDXA 1FPQA 3D5LA 2FMLA 1QO0D 1IN8A 1BN5A 2K4JA 3M8EA 5J6XA 3LFKA 1WKMA 1TQPA 1JGSA 1FX7A 3E3VA 2ADUA 1TNSA 2ZO4A 1QBJA 5JFRA 3DFGA 4HQMA 2OQGA 4CZZA 3Q5FA 2ACJA 2C6YA 2A69F 3E5XA 4EQQA 3E6CC 2M87A 3P9IA 3ABUA 2JT1A 5L3CA 1QNTA 3WODF 4M9SA 1IF1A 3RPUA 5LHIA 3I59B 3HSRA 5AIPA 1W5TA 1HBXG 4LG0B 1R23A 4IJAA 4M74A 3F6VA 4EM1A 3RYPA 4RGUA 1LNWA 3VFZA 1ZG1A 4RGXA 4BNCA 1HQCA 2BBYA 4MHGA 3C1DA 3GF2A 3WU0A 3BOQA 4WWCA 2P6SA 1P4XA 4IRHA 3E6DA 2LDUA 1D8JA 3E5UA 1SAXA 2FBIA 4ZH4F 1W7PD 5ILSA 4R1HA 1IN5A 4QLCU 5FD5A 3RYRA 3MAJA 5L3FA 3KEOA 4BXUA 4FT8A 2VE8A 2PG4A 2P8TA 4OMZA 3QU3A 1BI3A 1YQAA 3ECHA 2H09A 4ENJA 4ASNA 4O6JA 3FF5A 1RUNA 2HEOA 1LDKB 3SZTA 3MZYA 3J80Z 2Y75A 2IRFG 2HYGD 3LAJA 3F72A 4AD9A 1FNNA 4Q48A 4I0BA 4R79A 1DDNA 2ESNA 2A3SA 4RGSA 2H6BA 4HW0A 3L9FA 1KU2A 3KFWX 5E1WA 2YSRA 1LB2A 1B1BA 1FBQA 5D5XB 1TQIA 1W4MA 2ZJ2A 2MH9A 1SFEA 1P2FA 1I1SA 5IT3A 5ILUA 2P5LC 4UV8A 1SFUA 1T2KA 4G7ZF 4ON0A 3WU1B 3ZMDA 2FF4A 4EJUA 2Q0OA 3IC7A 4L9JA 1K79A 2FSWA 1XMAA 3MCZA 1RIOH 1BI0A 1J75A 5F1RA 3E5QA 1KU3A 5CYVA 3VEPA 1YW9A 4G7OF 5E20A 4L5IA 1SD4A 3V7RA 4A5MA 2VBZA 2PN6A 3LA2A 3IKVA 1QZYA 1DUXC 3QOPA 1D8KA 4M72A 1YO5C 4P96A 1U3EM 2CO5A 3LA3A 2DLLA 4EJTA 1SMYF 5CVJA 4LJZF 4LB6B 5HOOA 3F8MA 1GHCA 3JW4A 4HOBA 3RJPA 4BAYA 3ZMZA 3KP5A 1XSDA 2FXAA 3COAC 4L5JA 1S8NA 3R61A 1IAWA 3VODA 1KYZA 2QQBA 2O03A 3C3WA 2EFNA 4MEYF 3QU6A 1BC8C 4O3MA 1KU7A 4LGWA 1BBYA 3OV8A 5HVQC 4EJVA 2IPQX 2CGPA 2MLKA 3EETA 2P7CB 4ENNA 2RC4A 1HKQA 3U1DA 2J5OA 3F6OA 2X4HA 2P7VB 2COMA 1FBUA 3REOA 3E6BA 2OZUA 2MLGA 3WGIA 5L3DA 5JVTA 4A0XA 4U7DA 2XAFA 2FQ3A 2K7LA 1F1ZA 4RGRA 1IW7F 4UHTA 4KDPA 3Q9VA 1SD7A 3EUHA 1R36A 1ZARA 1OPCA 1YIOA 1MDMB 3GWZA 5E1ZB 1Z9CA 1IRGA 3GUDA 4ZYGA 1YW8A 3ZPLA 3DEUA 5H6QA 3MZHA 1SMTA 4Y13A 4KMUX 3WTYC 4OIRF 1BC7C 2P5KA 4A5NA 1HSTA 1K78B 3C18A 6PAXA 5FD6A 2A61A 4RB1A 3I64A 1CGPA 1ZAOA 2RKHA 5AONA 4I01A 3TOBA 5D8LB 2FE3A 4CDGA 4L0YB 3F8BA 3BP8A 2JTVA 2RVCA 3CTAA 3I0TA 1B9NA 1S3JA 1KYWA 4L9NA 1U8RA 2JRTA 3I71A 2NYXA 3RDIA 1OKRA 3DPLC 4N9HA 4Z2YA 3LWFA 3F23A 4Y15A 3JTGA 1BIAA 2VT2A 2DK5A 1MJAA 2DQRA 3QPHA 5F64A 4EM0B 4PCQA 4ZYHA 3EDPA 1KQ9A 3WGHA 1EV7A 2E7XA 2NRAC 5D4SA 3QP5A 4R8HA 5HDKA 2X0LA 1Y0UA 1W7PB 4IHTA 3L2CA 5HLGA 1F4KA 4G6QA 5AIQA 1FP2A 2QLZA 1RI7A 2DO7A 2BYVE 2FNPA 4A6EA 2IA0A 1P92A 3TQNA 5H20A 4TV7A 3HUGA 4LB5A 1S29A 5J8FA 1R1TA 2VN2A 5E18F 5JHUA 3DF8A 3ISPA 3GXOA 1O7FA 3KP4A 5ICEA 1O3RA 2A6HF 3HOSA 1HW2A 4N9IA 4UV9A 4HA8A 2QENA 4HAMA 2DU9A 1HXDA 2FOKA 1ZLJA 2ISYA 3DPTA 5L3GA 4WXDA 3T1BA 2V79A 2IA2A 2G7UA 3CUQC 2G7HA 4JBAA 3L09A 2VE9A 4A0ZA 2F5FA 2JZYA 1IXRC 3EYIA 2A68F 3GFLA 3JTHA 4HV5A 1U2WA 3HYIA 4MEXF 4GYGA 2L02A 5LEKA 1F5TA 3S2WA 1P4WA 4WXHA 2ZFWA 4RB2C 4KN7X 2A6EF 3WG9A 1WRJA 4ESFA 3KCCA 3K1PA 3ECOA 1QZZA 4ESJA 4U0VA 3B73A 3NRVA 1YLFA 3F21A 2WTEA 4GYIA 2V6CA 1FYMA 2MC3A 1PP8F 2GA2A 4WCGA 3IRQA 4H0EA 5FGMA 3KZYA 4ETSA 3JSOA 4KNYA 1WSUA 3HRSA 5DD8A 2PMUA 4HX7A 1XB4A 4OIOF 1V3FA 1GVJA 2DPDA 3BPXA 3K1NA 3FHZA 1YFHA 2HFHA 1EH7A 5LEJA 2K86A 1H0MA 5K5OA 3J81K 1XGSA 2QYOA 3CLOA 1K7AA 3FXQA 2DT5A 2P5VA 1HSJA 3O2PE 4HF2A 5HS9A 1FOKA 2PBIA 1FSEA 2XAGA 3LAPA 1U5TB 1HKSA 3ZN1A 2IA1A 5DDGA 4ENKA 2P4WA 1MJ9A 3SQNA 2H94A 2D45A 1MGTA 3CO6C 3M8FA 1R7JA 2HZTA 3TO6A 2YU3A 4DNCA 3D0SA 3IWFA 2BEOA 1P6RA 5KVRA 1G3WA 2F2EA 3R0JA 1KU9A 5DV5A 1T98A 1AWCA 1MJBA 2O0YA 2XIGA 1ULYA 4IHSA 3K2ZA 4LK1F 3IL2A 3HHHA 5CVVA 4XLNF 3GFMA 4M73A 1DP7P 3MQ0A 3N4MA 5H6RA 3V7SA 3KE2A 5LRSA 1G3YA 1OYWA 3ZMVA 4M71A 4IXAA 2ESHA 1LVAA 4ZZLA 2EK5A 1ZH5A 2A5YB 2VXZA 5BOXA 2JSCA 4UXNA 3TDUC 5D8KB 5LHHA 3GLXA 5CVIA 4D0PA 3R6SA 3RIRA 2MD5A 2QBYA 5HDNA 3PQJA 3K0LA 2UZKA 1B4AA 3T0YA 5D6EA 2ZXJA 2HQNA 4B09A 4CICA 2W57A 1XD7A 1BOAA 2DK8A 3KZZA 4OMYA 1T6SA 4LG0A 1IZ1A 3HHGA 2EB7A 1D5VA 1TTYA 5LGUA 4KYWA 2IJLA 3ZP5A 4BHPA 2K4BA 2RDPA 3M7GA 3V4GA 1RNLA 1MKMA 2CWEA 4WXCA 3E6MA 2HDCA 3GVAA 4AIJA 2GXBA 3IWZA 4I2OA 4K2EA 1FP1D 1X3UA 1YG2A 2DFIA 3MEXA 1R58A 2QQ9A 3ZMUA 2DW4A 1ZRDA 5E17F 3KETA 4KFCA 2E1CA 4FX4A 5K1YA 5CLSA 4YG2F 1QQIA 2IP2A 4NHJA 4O5VA 2Z3YA 1WI9A 3W6JB 4KIFA 1NHAA 2E7WA 3WE2A 2QVOA 3CUQA 3KLOA 5HLIA 1FYLA 2ISZA 3WTTC 3WTVC 2KIMA 4MQ9F 4ZYDA 1ODDA 3ROUA 2M45A 3M1EA 2MA3A 2VC0A 4OU0A 2BV6A 1H9TA 2AS5F 4MTEA 3O3KA 3BPVA 4MTDA 4XLPF 3BJOA 1R1UA 2QUFA 1ZN2A 1YTYA 4BHBA 3DKWA 2EA4A 2Q2EA 2D1VA 2VBWA 5EEHA 2L01A 4HX8A 1WQ2A 2P6TA 4EV0A 3I53A 2UWMA 3L7WA 1LDDA 5DUKA 3J7AO 2VOPA 2CQKA 2UXNA 3V8KA 5FFXA 1PP7U 4U88A 2VODA 3H92A 5LRRA 3MWMA 2CW0F 2ELHA 1Z91A 1H9GA 4KUMA 5DCMB 3O6BB 3M9AA 4EGYA 2FNAA 1KGSA 3G73A 1Z7UA 5D4RA 2D1HA 2Z33A 1ZRFA 2M30A 1GXQA 1USSA 4NB5A 4P55A 3N97A 3SZPA 4ZYEA 1UHWA 3H3ZA 1XSXA 5DD4A 1L0OC 1XN7A 2OBPA 4OOIA 3U9GA 3RI4A 1FLIA 2LF8A 4G94A 1BJAA 1KQ0A 5BQTA 1LEBA 4EGZA 5D5WB 5CVUA 4MGRA 5LGTA 2HTSA 3GFJA 2O6GE 5D5UB 1AOYA 3HIFA 4HX4A 3BROA 4A6DA 1FYKA 2EFOA 2NAZA 3I5UA 4I09A 4KMFA 4XRFA 4KT5C 4CHUA 1YS6A 3T8TA 3V7CA 1O3QA 1S7AA 4HF0A 2ZKZA 3C7JA 3FXUA 1LEAA 1LJ9A 4YFXF 3SXYA 3ZMTA 2ZMEA 3KP7A 3CUOA 4P5OA 2DBBA 4Q5SF 5ERIA 3KP6A 2V1DA 2WV0A 3GW2A 1QGPA 3CJNA 5KK1A 1USTA 1IXSB 2QM3A 1XCVA 3KEQA 4I98B 4A0YA 2MH2A 3MFKA 5BS6A 4L9VA 5E8GA 3LSTA 2XHKA 1O3SA 2VC1A 1J9IA 1I1GA 2HR3A 1BI1A 4LMYA 3H3UA 2GZWA 2FU4A 3WTUC 3GEZA 3GYHX 4F7ZA 5L3BA 3JAMZ 3P9CA 3LA7A 5IT9Z 5L3EA 4LD5A 2EV6A 4UVCA 3JAMK 5IT9K 2XUBA 2UXXA 2W25A 2PEXA 1O7LA 2XKOA 2FRHA 5ED4A 1IUYA 2W85A 3HRTA 4LK0F 1E2XA 4WF2A 1C0WA 2DPUA 3K69A 3CO7C 4UNOA 2XV4S 5DUIA 5LGNA 1T39A 4LLNA 1ZG5A 4YIIA 3RTRA 1EH6A 2QQAA 3SFZA 3FMSA 4CO8A 4QWQA 3PFIA 2D2WA 2FA5A 3U2RA 4S04A 3FMQA 2NS0A 5FO5A 4EJWA 4OINF 4DQ2A 4IF4A 1R00A 2CSOA 4KIGA 2R7FA 4EJOA 2CYYA 4Q4ZF 3F8NA 2KRFA 2OD5A 4M6XA 1S6LA 1LDJA 1J7KA 4HLYA 3DP7A 1MD0A 3ERED 1K6OA 2VBYA 1T38A 4A2UA 2FEZA 1G4DA 1W7PA 4MNUA 1DPRA 2EV0A 2VBXA 2OQRA 5CVRA 4FX0A 5BPIA 4KA4A 1XGMA 3QP6A 4IVNA 3JSPA 1ZREA 4A12A 5ILVA 3J81Z 3VOEA 4JQFA 1P4AA 2OA4A 5LLQA 4L9TA 1YS7A 1IN4A 2ZNZA 4BYYA 1J0RA 2QBYB 3FWEA 2HGCA 2STWA 1ZGJA 3DXJF 5TJJA 4IRGA 2LNBA 2DTRA 1JXSA 2F5CA 1REPC 3F3XA 2XVCA 1BI2A 1S7OA 1SD5A 3LQQA 3K9TA 3SHFA 3BY6A 3TO7A 2B0LA 4HF1A 5DCFA 1TW3A 4PGGA 1XDUA 5JR3A 2EWNA 4I0AA 1IRFA 5DYMA 2HOEA 5ICCA 2W84A 1CF7A 2PFBA 2RNJA 1XGOA 3TKYA 1R1VA 4ZZDA 4IPAA 2OAZA 2GA1A 5LBQA 4L18B 2MBFA 1VTNC 1V4RA 3R0AA 1BIBA 4EM2A 2RQPA 4XBFA 4YFKF 4M9XA 3CDHA 2O61A 5DEQA 2DQLA 3L00A 1JHFA 3CUQB 2XKPA 5A2QZ 3BJ6A 1O3TA 5FLXZ 1TNTA 1XSVA 2DAOA 4G8XA 2L54A 1OR7A 2Q8KA 4KICA 5A2QK 4I02A 3J80K 4GCVA 5FLXK 1FC3A 4LFUA 5K5RA 1ZLKA 5HS8A 2K02A 2GAUA 1OMIA 2EFWA 3ZN0A 1YYVA 3GZ5A 5D6FA 1J5YA 3DQVC 2XAQA 3R4KA 2PMHA 5EEGA 4EVIA 2G9WA 2L3DA 5K5QA 2QZ8A 4XSXF 3I59A 5TRDA 1G3SA 2IW5A 3EYYA 4B8XA 4G7HF 2VT3A 1B6AA 4ESBA 4HQEA 3EQLF 3W6KB 1U78A 3HSFA 1W5SA 3RKYA 5ICFA 2RV8A 1ZHFA 1HW1A 2ZCWA 3HTUA 3RKWA 2EJRA 4HYEA 3FM3A 2M8EA 2YX7A 2O8XA 1D3YA 3I54A 1U5TA 3TOAA 4YIFA 3ML6A 2XAJA 1GXPA 1SFXA 4BQAA 2M5WA 5HDGA 2L4MA 2OU2A 4E70A 2NNYA 2PQ8A 4GO1A 2V1UA 1DPUA 1E17A 2YX4A 3T5XA 4BHCA 4WK8F 1B59A 3BJAA 3WTZA 3FX3A 5D5VB 4KIBA 2GQQA 1UFMA 4YFNF 2Y48A 2JPBA 1BM9A 4U0YA 2QWWA 1UHMA 3DV8A 4RB3C 1STZA 1TQMA 2NNNA 1FT9A 2XGXA 2HKXA 3NEUA 2K27A 1JE8A 2EA2A 3KP3A 3AAFA 1UB9A 4RAZA 1OYIA 2Z9OA 2DI3A 4HZFA 3FMRA 2FBKA 4KN4X 1Z05A 4ENMA 2ZMEB 5E1XA 4Q47A 3ZMSA 3ZQ7A 3G3ZA 2XASA 3I58A 3Q9SA 1MZBA 5BPDA 3KP2A 4HLXA 4RB0A 1XCBA 3VB2A 5LHGA 1L3LA 3WTXC 4OIPF 2WWYA 3WE3A 3P7NA 4NQWA 2LF7A 4L0ZB 4RS8A 5F6FA 2HKOA 3PQKA 3FZVA 3T8RA 4S05A 5BMZA 1ONVA 2WC2A 2ZBKA 3BWGA 2HS5A 1R5GA 3IKTA 1Q1HA 1ZGAA 4GXOA 2L4AA 2AXLA 1XGNA 1IN6A 1HKTA 2R3SA 2YR2A 4UUVA 2EFQA 2VONA 1LQ1A 3ULQB 1HW5A 1Z1DA 4M9ZA 1YW7A 1Z6RA 4LLLA 2H27A 2HTJA 4M6YA 3BZ6A 2O3FA 2BGCA 2CFXA 5HS7A 3HRMA 2V1XA 1QPMA 3P9KA 1I5ZA 1KA8A 2IT0A 3HSEA 2GXGA 1RZ4A 1XMKA 3TO9A 2YPRA 4OIQF 3K1MA 2Y0MA 2GIVA 2A07F 4UVBA 2RN7A 2F5DA 1B9MA 4P9UA 4U7BA 1WWXA 2KKOA 3HOTA 2M1BA 1OYYA 1G3TA 1TLHB 5HLHA 4EMSA 5FB2A 4G6DA 4MQVA 4LLGF 4HV6A 2J5PA 3NQOA 2R7DA 4GGGA 1J2XA 1XDSA 2EV5A 2RGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9Y A;  2H6C A;  4AVP A;  4BH9 A;  3IHU A;  1R22 A;  1FSH A;  3QPT A;  2PLY A;  4FHT A;  3WTS C;  1I6X A;  3GFI A;  2KJC A;  2CG4 A;  3RPQ A;  3F8C A;  4WX9 A;  3GO5 A;  2PJP A;  2OZ6 A;  1A04 A;  1F9N A;  1Z6T A;  4I7H A;  4CGZ A;  3E97 A;  2Z99 A;  3ABT A;  5DCM A;  2EFP A;  1T0F A;  2E1N A;  1MDM A;  3ELK A;  2GWR A;  3IRR A;  3BDD A;  1U6G A;  2BE5 F;  4AIH A;  1TW2 A;  1U5T C;  3QAH A;  3V8L A;  2KIF A;  4HDU A;  4HDV A;  1ZRC A;  4PGH A;  1SD6 A;  3GX4 X;  1K78 A;  2V9V A;  3TDZ C;  3QRF F;  2JPC A;  4RAY A;  2FBH A;  5FFZ A;  4Y17 A;  4JK1 X;  5J8C A;  1R5H A;  1FBS A;  2ETH A;  1EH8 A;  1I27 A;  3F8F A;  3LQR A;  4IRI A;  4PDK A;  2HWV A;  3V8J A;  2VOO A;  3OOP A;  3WGG A;  4CYD A;  2PI0 A;  1IN7 A;  1KQ8 A;  1ON2 A;  4AWX B;  2IVM A;  2Z5U A;  2KJB A;  3TGN A;  4P9F A;  1ON1 A;  2W24 A;  5JI6 A;  2LSO A;  1FWZ A;  4U0W A;  2XAH A;  5CJ9 A;  1J59 A;  3HRU A;  2F5E A;  1ZYR F;  3KLN A;  5E8I A;  3HTS B;  1RUO A;  1ZG3 A;  2LKP A;  2HYF A;  2HQR A;  1PUE E;  5ICG A;  4N0B A;  4PZJ A;  1G6N A;  4AIK A;  3WTW C;  1TBX A;  1FZP B;  1O57 A;  3I4P A;  1JHH A;  4HBL A;  3GZ6 A;  3FM5 A;  2KIU A;  1CF7 B;  2XRO A;  4UVA A;  2ZNY A;  2STT A;  4CXF A;  1UCR A;  4XSZ F;  1IXC A;  3F22 A;  2XRN A;  1FY7 A;  3RKX A;  3R60 A;  3FXR A;  1PDN C;  3B02 A;  2FMY A;  2TDX A;  1FPQ A;  3D5L A;  2FML A;  1QO0 D;  1IN8 A;  1BN5 A;  2K4J A;  3M8E A;  5J6X A;  3LFK A;  1WKM A;  1TQP A;  1JGS A;  1FX7 A;  3E3V A;  2ADU A;  1TNS A;  2ZO4 A;  1QBJ A;  5JFR A;  3DFG A;  4HQM A;  2OQG A;  4CZZ A;  3Q5F A;  2ACJ A;  2C6Y A;  2A69 F;  3E5X A;  4EQQ A;  3E6C C;  2M87 A;  3P9I A;  3ABU A;  2JT1 A;  5L3C A;  1QNT A;  3WOD F;  4M9S A;  1IF1 A;  3RPU A;  5LHI A;  3I59 B;  3HSR A;  5AIP A;  1W5T A;  1HBX G;  4LG0 B;  1R23 A;  4IJA A;  4M74 A;  3F6V A;  4EM1 A;  3RYP A;  4RGU A;  1LNW A;  3VFZ A;  1ZG1 A;  4RGX A;  4BNC A;  1HQC A;  2BBY A;  4MHG A;  3C1D A;  3GF2 A;  3WU0 A;  3BOQ A;  4WWC A;  2P6S A;  1P4X A;  4IRH A;  3E6D A;  2LDU A;  1D8J A;  3E5U A;  1SAX A;  2FBI A;  4ZH4 F;  1W7P D;  5ILS A;  4R1H A;  1IN5 A;  4QLC U;  5FD5 A;  3RYR A;  3MAJ A;  5L3F A;  3KEO A;  4BXU A;  4FT8 A;  2VE8 A;  2PG4 A;  2P8T A;  4OMZ A;  3QU3 A;  1BI3 A;  1YQA A;  3ECH A;  2H09 A;  4ENJ A;  4ASN A;  4O6J A;  3FF5 A;  1RUN A;  2HEO A;  1LDK B;  3SZT A;  3MZY A;  3J80 Z;  2Y75 A;  2IRF G;  2HYG D;  3LAJ A;  3F72 A;  4AD9 A;  1FNN A;  4Q48 A;  4I0B A;  4R79 A;  1DDN A;  2ESN A;  2A3S A;  4RGS A;  2H6B A;  4HW0 A;  3L9F A;  1KU2 A;  3KFW X;  5E1W A;  2YSR A;  1LB2 A;  1B1B A;  1FBQ A;  5D5X B;  1TQI A;  1W4M A;  2ZJ2 A;  2MH9 A;  1SFE A;  1P2F A;  1I1S A;  5IT3 A;  5ILU A;  2P5L C;  4UV8 A;  1SFU A;  1T2K A;  4G7Z F;  4ON0 A;  3WU1 B;  3ZMD A;  2FF4 A;  4EJU A;  2Q0O A;  3IC7 A;  4L9J A;  1K79 A;  2FSW A;  1XMA A;  3MCZ A;  1RIO H;  1BI0 A;  1J75 A;  5F1R A;  3E5Q A;  1KU3 A;  5CYV A;  3VEP A;  1YW9 A;  4G7O F;  5E20 A;  4L5I A;  1SD4 A;  3V7R A;  4A5M A;  2VBZ A;  2PN6 A;  3LA2 A;  3IKV A;  1QZY A;  1DUX C;  3QOP A;  1D8K A;  4M72 A;  1YO5 C;  4P96 A;  1U3E M;  2CO5 A;  3LA3 A;  2DLL A;  4EJT A;  1SMY F;  5CVJ A;  4LJZ F;  4LB6 B;  5HOO A;  3F8M A;  1GHC A;  3JW4 A;  4HOB A;  3RJP A;  4BAY A;  3ZMZ A;  3KP5 A;  1XSD A;  2FXA A;  3COA C;  4L5J A;  1S8N A;  3R61 A;  1IAW A;  3VOD A;  1KYZ A;  2QQB A;  2O03 A;  3C3W A;  2EFN A;  4MEY F;  3QU6 A;  1BC8 C;  4O3M A;  1KU7 A;  4LGW A;  1BBY A;  3OV8 A;  5HVQ C;  4EJV A;  2IPQ X;  2CGP A;  2MLK A;  3EET A;  2P7C B;  4ENN A;  2RC4 A;  1HKQ A;  3U1D A;  2J5O A;  3F6O A;  2X4H A;  2P7V B;  2COM A;  1FBU A;  3REO A;  3E6B A;  2OZU A;  2MLG A;  3WGI A;  5L3D A;  5JVT A;  4A0X A;  4U7D A;  2XAF A;  2FQ3 A;  2K7L A;  1F1Z A;  4RGR A;  1IW7 F;  4UHT A;  4KDP A;  3Q9V A;  1SD7 A;  3EUH A;  1R36 A;  1ZAR A;  1OPC A;  1YIO A;  1MDM B;  3GWZ A;  5E1Z B;  1Z9C A;  1IRG A;  3GUD A;  4ZYG A;  1YW8 A;  3ZPL A;  3DEU A;  5H6Q A;  3MZH A;  1SMT A;  4Y13 A;  4KMU X;  3WTY C;  4OIR F;  1BC7 C;  2P5K A;  4A5N A;  1HST A;  1K78 B;  3C18 A;  6PAX A;  5FD6 A;  2A61 A;  4RB1 A;  3I64 A;  1CGP A;  1ZAO A;  2RKH A;  5AON A;  4I01 A;  3TOB A;  5D8L B;  2FE3 A;  4CDG A;  4L0Y B;  3F8B A;  3BP8 A;  2JTV A;  2RVC A;  3CTA A;  3I0T A;  1B9N A;  1S3J A;  1KYW A;  4L9N A;  1U8R A;  2JRT A;  3I71 A;  2NYX A;  3RDI A;  1OKR A;  3DPL C;  4N9H A;  4Z2Y A;  3LWF A;  3F23 A;  4Y15 A;  3JTG A;  1BIA A;  2VT2 A;  2DK5 A;  1MJA A;  2DQR A;  3QPH A;  5F64 A;  4EM0 B;  4PCQ A;  4ZYH A;  3EDP A;  1KQ9 A;  3WGH A;  1EV7 A;  2E7X A;  2NRA C;  5D4S A;  3QP5 A;  4R8H A;  5HDK A;  2X0L A;  1Y0U A;  1W7P B;  4IHT A;  3L2C A;  5HLG A;  1F4K A;  4G6Q A;  5AIQ A;  1FP2 A;  2QLZ A;  1RI7 A;  2DO7 A;  2BYV E;  2FNP A;  4A6E A;  2IA0 A;  1P92 A;  3TQN A;  5H20 A;  4TV7 A;  3HUG A;  4LB5 A;  1S29 A;  5J8F A;  1R1T A;  2VN2 A;  5E18 F;  5JHU A;  3DF8 A;  3ISP A;  3GXO A;  1O7F A;  3KP4 A;  5ICE A;  1O3R A;  2A6H F;  3HOS A;  1HW2 A;  4N9I A;  4UV9 A;  4HA8 A;  2QEN A;  4HAM A;  2DU9 A;  1HXD A;  2FOK A;  1ZLJ A;  2ISY A;  3DPT A;  5L3G A;  4WXD A;  3T1B A;  2V79 A;  2IA2 A;  2G7U A;  3CUQ C;  2G7H A;  4JBA A;  3L09 A;  2VE9 A;  4A0Z A;  2F5F A;  2JZY A;  1IXR C;  3EYI A;  2A68 F;  3GFL A;  3JTH A;  4HV5 A;  1U2W A;  3HYI A;  4MEX F;  4GYG A;  2L02 A;  5LEK A;  1F5T A;  3S2W A;  1P4W A;  4WXH A;  2ZFW A;  4RB2 C;  4KN7 X;  2A6E F;  3WG9 A;  1WRJ A;  4ESF A;  3KCC A;  3K1P A;  3ECO A;  1QZZ A;  4ESJ A;  4U0V A;  3B73 A;  3NRV A;  1YLF A;  3F21 A;  2WTE A;  4GYI A;  2V6C A;  1FYM A;  2MC3 A;  1PP8 F;  2GA2 A;  4WCG A;  3IRQ A;  4H0E A;  5FGM A;  3KZY A;  4ETS A;  3JSO A;  4KNY A;  1WSU A;  3HRS A;  5DD8 A;  2PMU A;  4HX7 A;  1XB4 A;  4OIO F;  1V3F A;  1GVJ A;  2DPD A;  3BPX A;  3K1N A;  3FHZ A;  1YFH A;  2HFH A;  1EH7 A;  5LEJ A;  2K86 A;  1H0M A;  5K5O A;  3J81 K;  1XGS A;  2QYO A;  3CLO A;  1K7A A;  3FXQ A;  2DT5 A;  2P5V A;  1HSJ A;  3O2P E;  4HF2 A;  5HS9 A;  1FOK A;  2PBI A;  1FSE A;  2XAG A;  3LAP A;  1U5T B;  1HKS A;  3ZN1 A;  2IA1 A;  5DDG A;  4ENK A;  2P4W A;  1MJ9 A;  3SQN A;  2H94 A;  2D45 A;  1MGT A;  3CO6 C;  3M8F A;  1R7J A;  2HZT A;  3TO6 A;  2YU3 A;  4DNC A;  3D0S A;  3IWF A;  2BEO A;  1P6R A;  5KVR A;  1G3W A;  2F2E A;  3R0J A;  1KU9 A;  5DV5 A;  1T98 A;  1AWC A;  1MJB A;  2O0Y A;  2XIG A;  1ULY A;  4IHS A;  3K2Z A;  4LK1 F;  3IL2 A;  3HHH A;  5CVV A;  4XLN F;  3GFM A;  4M73 A;  1DP7 P;  3MQ0 A;  3N4M A;  5H6R A;  3V7S A;  3KE2 A;  5LRS A;  1G3Y A;  1OYW A;  3ZMV A;  4M71 A;  4IXA A;  2ESH A;  1LVA A;  4ZZL A;  2EK5 A;  1ZH5 A;  2A5Y B;  2VXZ A;  5BOX A;  2JSC A;  4UXN A;  3TDU C;  5D8K B;  5LHH A;  3GLX A;  5CVI A;  4D0P A;  3R6S A;  3RIR A;  2MD5 A;  2QBY A;  5HDN A;  3PQJ A;  3K0L A;  2UZK A;  1B4A A;  3T0Y A;  5D6E A;  2ZXJ A;  2HQN A;  4B09 A;  4CIC A;  2W57 A;  1XD7 A;  1BOA A;  2DK8 A;  3KZZ A;  4OMY A;  1T6S A;  4LG0 A;  1IZ1 A;  3HHG A;  2EB7 A;  1D5V A;  1TTY A;  5LGU A;  4KYW A;  2IJL A;  3ZP5 A;  4BHP A;  2K4B A;  2RDP A;  3M7G A;  3V4G A;  1RNL A;  1MKM A;  2CWE A;  4WXC A;  3E6M A;  2HDC A;  3GVA A;  4AIJ A;  2GXB A;  3IWZ A;  4I2O A;  4K2E A;  1FP1 D;  1X3U A;  1YG2 A;  2DFI A;  3MEX A;  1R58 A;  2QQ9 A;  3ZMU A;  2DW4 A;  1ZRD A;  5E17 F;  3KET A;  4KFC A;  2E1C A;  4FX4 A;  5K1Y A;  5CLS A;  4YG2 F;  1QQI A;  2IP2 A;  4NHJ A;  4O5V A;  2Z3Y A;  1WI9 A;  3W6J B;  4KIF A;  1NHA A;  2E7W A;  3WE2 A;  2QVO A;  3CUQ A;  3KLO A;  5HLI A;  1FYL A;  2ISZ A;  3WTT C;  3WTV C;  2KIM A;  4MQ9 F;  4ZYD A;  1ODD A;  3ROU A;  2M45 A;  3M1E A;  2MA3 A;  2VC0 A;  4OU0 A;  2BV6 A;  1H9T A;  2AS5 F;  4MTE A;  3O3K A;  3BPV A;  4MTD A;  4XLP F;  3BJO A;  1R1U A;  2QUF A;  1ZN2 A;  1YTY A;  4BHB A;  3DKW A;  2EA4 A;  2Q2E A;  2D1V A;  2VBW A;  5EEH A;  2L01 A;  4HX8 A;  1WQ2 A;  2P6T A;  4EV0 A;  3I53 A;  2UWM A;  3L7W A;  1LDD A;  5DUK A;  3J7A O;  2VOP A;  2CQK A;  2UXN A;  3V8K A;  5FFX A;  1PP7 U;  4U88 A;  2VOD A;  3H92 A;  5LRR A;  3MWM A;  2CW0 F;  2ELH A;  1Z91 A;  1H9G A;  4KUM A;  5DCM B;  3O6B B;  3M9A A;  4EGY A;  2FNA A;  1KGS A;  3G73 A;  1Z7U A;  5D4R A;  2D1H A;  2Z33 A;  1ZRF A;  2M30 A;  1GXQ A;  1USS A;  4NB5 A;  4P55 A;  3N97 A;  3SZP A;  4ZYE A;  1UHW A;  3H3Z A;  1XSX A;  5DD4 A;  1L0O C;  1XN7 A;  2OBP A;  4OOI A;  3U9G A;  3RI4 A;  1FLI A;  2LF8 A;  4G94 A;  1BJA A;  1KQ0 A;  5BQT A;  1LEB A;  4EGZ A;  5D5W B;  5CVU A;  4MGR A;  5LGT A;  2HTS A;  3GFJ A;  2O6G E;  5D5U B;  1AOY A;  3HIF A;  4HX4 A;  3BRO A;  4A6D A;  1FYK A;  2EFO A;  2NAZ A;  3I5U A;  4I09 A;  4KMF A;  4XRF A;  4KT5 C;  4CHU A;  1YS6 A;  3T8T A;  3V7C A;  1O3Q A;  1S7A A;  4HF0 A;  2ZKZ A;  3C7J A;  3FXU A;  1LEA A;  1LJ9 A;  4YFX F;  3SXY A;  3ZMT A;  2ZME A;  3KP7 A;  3CUO A;  4P5O A;  2DBB A;  4Q5S F;  5ERI A;  3KP6 A;  2V1D A;  2WV0 A;  3GW2 A;  1QGP A;  3CJN A;  5KK1 A;  1UST A;  1IXS B;  2QM3 A;  1XCV A;  3KEQ A;  4I98 B;  4A0Y A;  2MH2 A;  3MFK A;  5BS6 A;  4L9V A;  5E8G A;  3LST A;  2XHK A;  1O3S A;  2VC1 A;  1J9I A;  1I1G A;  2HR3 A;  1BI1 A;  4LMY A;  3H3U A;  2GZW A;  2FU4 A;  3WTU C;  3GEZ A;  3GYH X;  4F7Z A;  5L3B A;  3JAM Z;  3P9C A;  3LA7 A;  5IT9 Z;  5L3E A;  4LD5 A;  2EV6 A;  4UVC A;  3JAM K;  5IT9 K;  2XUB A;  2UXX A;  2W25 A;  2PEX A;  1O7L A;  2XKO A;  2FRH A;  5ED4 A;  1IUY A;  2W85 A;  3HRT A;  4LK0 F;  1E2X A;  4WF2 A;  1C0W A;  2DPU A;  3K69 A;  3CO7 C;  4UNO A;  2XV4 S;  5DUI A;  5LGN A;  1T39 A;  4LLN A;  1ZG5 A;  4YII A;  3RTR A;  1EH6 A;  2QQA A;  3SFZ A;  3FMS A;  4CO8 A;  4QWQ A;  3PFI A;  2D2W A;  2FA5 A;  3U2R A;  4S04 A;  3FMQ A;  2NS0 A;  5FO5 A;  4EJW A;  4OIN F;  4DQ2 A;  4IF4 A;  1R00 A;  2CSO A;  4KIG A;  2R7F A;  4EJO A;  2CYY A;  4Q4Z F;  3F8N A;  2KRF A;  2OD5 A;  4M6X A;  1S6L A;  1LDJ A;  1J7K A;  4HLY A;  3DP7 A;  1MD0 A;  3ERE D;  1K6O A;  2VBY A;  1T38 A;  4A2U A;  2FEZ A;  1G4D A;  1W7P A;  4MNU A;  1DPR A;  2EV0 A;  2VBX A;  2OQR A;  5CVR A;  4FX0 A;  5BPI A;  4KA4 A;  1XGM A;  3QP6 A;  4IVN A;  3JSP A;  1ZRE A;  4A12 A;  5ILV A;  3J81 Z;  3VOE A;  4JQF A;  1P4A A;  2OA4 A;  5LLQ A;  4L9T A;  1YS7 A;  1IN4 A;  2ZNZ A;  4BYY A;  1J0R A;  2QBY B;  3FWE A;  2HGC A;  2STW A;  1ZGJ A;  3DXJ F;  5TJJ A;  4IRG A;  2LNB A;  2DTR A;  1JXS A;  2F5C A;  1REP C;  3F3X A;  2XVC A;  1BI2 A;  1S7O A;  1SD5 A;  3LQQ A;  3K9T A;  3SHF A;  3BY6 A;  3TO7 A;  2B0L A;  4HF1 A;  5DCF A;  1TW3 A;  4PGG A;  1XDU A;  5JR3 A;  2EWN A;  4I0A A;  1IRF A;  5DYM A;  2HOE A;  5ICC A;  2W84 A;  1CF7 A;  2PFB A;  2RNJ A;  1XGO A;  3TKY A;  1R1V A;  4ZZD A;  4IPA A;  2OAZ A;  2GA1 A;  5LBQ A;  4L18 B;  2MBF A;  1VTN C;  1V4R A;  3R0A A;  1BIB A;  4EM2 A;  2RQP A;  4XBF A;  4YFK F;  4M9X A;  3CDH A;  2O61 A;  5DEQ A;  2DQL A;  3L00 A;  1JHF A;  3CUQ B;  2XKP A;  5A2Q Z;  3BJ6 A;  1O3T A;  5FLX Z;  1TNT A;  1XSV A;  2DAO A;  4G8X A;  2L54 A;  1OR7 A;  2Q8K A;  4KIC A;  5A2Q K;  4I02 A;  3J80 K;  4GCV A;  5FLX K;  1FC3 A;  4LFU A;  5K5R A;  1ZLK A;  5HS8 A;  2K02 A;  2GAU A;  1OMI A;  2EFW A;  3ZN0 A;  1YYV A;  3GZ5 A;  5D6F A;  1J5Y A;  3DQV C;  2XAQ A;  3R4K A;  2PMH A;  5EEG A;  4EVI A;  2G9W A;  2L3D A;  5K5Q A;  2QZ8 A;  4XSX F;  3I59 A;  5TRD A;  1G3S A;  2IW5 A;  3EYY A;  4B8X A;  4G7H F;  2VT3 A;  1B6A A;  4ESB A;  4HQE A;  3EQL F;  3W6K B;  1U78 A;  3HSF A;  1W5S A;  3RKY A;  5ICF A;  2RV8 A;  1ZHF A;  1HW1 A;  2ZCW A;  3HTU A;  3RKW A;  2EJR A;  4HYE A;  3FM3 A;  2M8E A;  2YX7 A;  2O8X A;  1D3Y A;  3I54 A;  1U5T A;  3TOA A;  4YIF A;  3ML6 A;  2XAJ A;  1GXP A;  1SFX A;  4BQA A;  2M5W A;  5HDG A;  2L4M A;  2OU2 A;  4E70 A;  2NNY A;  2PQ8 A;  4GO1 A;  2V1U A;  1DPU A;  1E17 A;  2YX4 A;  3T5X A;  4BHC A;  4WK8 F;  1B59 A;  3BJA A;  3WTZ A;  3FX3 A;  5D5V B;  4KIB A;  2GQQ A;  1UFM A;  4YFN F;  2Y48 A;  2JPB A;  1BM9 A;  4U0Y A;  2QWW A;  1UHM A;  3DV8 A;  4RB3 C;  1STZ A;  1TQM A;  2NNN A;  1FT9 A;  2XGX A;  2HKX A;  3NEU A;  2K27 A;  1JE8 A;  2EA2 A;  3KP3 A;  3AAF A;  1UB9 A;  4RAZ A;  1OYI A;  2Z9O A;  2DI3 A;  4HZF A;  3FMR A;  2FBK A;  4KN4 X;  1Z05 A;  4ENM A;  2ZME B;  5E1X A;  4Q47 A;  3ZMS A;  3ZQ7 A;  3G3Z A;  2XAS A;  3I58 A;  3Q9S A;  1MZB A;  5BPD A;  3KP2 A;  4HLX A;  4RB0 A;  1XCB A;  3VB2 A;  5LHG A;  1L3L A;  3WTX C;  4OIP F;  2WWY A;  3WE3 A;  3P7N A;  4NQW A;  2LF7 A;  4L0Z B;  4RS8 A;  5F6F A;  2HKO A;  3PQK A;  3FZV A;  3T8R A;  4S05 A;  5BMZ A;  1ONV A;  2WC2 A;  2ZBK A;  3BWG A;  2HS5 A;  1R5G A;  3IKT A;  1Q1H A;  1ZGA A;  4GXO A;  2L4A A;  2AXL A;  1XGN A;  1IN6 A;  1HKT A;  2R3S A;  2YR2 A;  4UUV A;  2EFQ A;  2VON A;  1LQ1 A;  3ULQ B;  1HW5 A;  1Z1D A;  4M9Z A;  1YW7 A;  1Z6R A;  4LLL A;  2H27 A;  2HTJ A;  4M6Y A;  3BZ6 A;  2O3F A;  2BGC A;  2CFX A;  5HS7 A;  3HRM A;  2V1X A;  1QPM A;  3P9K A;  1I5Z A;  1KA8 A;  2IT0 A;  3HSE A;  2GXG A;  1RZ4 A;  1XMK A;  3TO9 A;  2YPR A;  4OIQ F;  3K1M A;  2Y0M A;  2GIV A;  2A07 F;  4UVB A;  2RN7 A;  2F5D A;  1B9M A;  4P9U A;  4U7B A;  1WWX A;  2KKO A;  3HOT A;  2M1B A;  1OYY A;  1G3T A;  1TLH B;  5HLH A;  4EMS A;  5FB2 A;  4G6D A;  4MQV A;  4LLG F;  4HV6 A;  2J5P A;  3NQO A;  2R7D A;  4GGG A;  1J2X A;  1XDS A;  2EV5 A;  2RGV A; 
#chains in the Genus database with same CATH topology
 2Y0S N;  4G9Y A;  2H6C A;  5F04 A;  4AVP A;  3IHU A;  1R22 A;  4BH9 A;  1FSH A;  1MH3 A;  3M4O J;  2BY0 A;  3QPT A;  2PLY A;  4FHT A;  1IO2 A;  4M3G A;  3WTS C;  1I6X A;  3OSG A;  5HNF A;  3GFI A;  4OAY A;  2KJC A;  2CG4 A;  3RPQ A;  1YJW I;  3F8C A;  4RA2 A;  1I39 A;  4D7N A;  4D9J A;  4WX9 A;  2KDZ A;  3GO5 A;  2X85 A;  2E1O A;  3EUA A;  2PJP A;  3FDY A;  1UG2 A;  4NC6 A;  2OZ6 A;  3IH4 A;  3ONQ A;  1A04 A;  4YIR X;  3ZGK A;  1F9N A;  4IEJ A;  1Z6T A;  1A5J A;  3BLY A;  3JR9 A;  3PM1 A;  4I7H A;  4CGZ A;  3E97 A;  4E7Z A;  2Z99 A;  3ABT A;  5DCM A;  1JT6 A;  1WJC A;  2F5V A;  2EFP A;  2HXI A;  4RBO A;  1ZTR A;  3TP0 A;  1T0F A;  2DYS H;  2E1N A;  2Q1Z B;  2CUZ A;  1MDM A;  3D5R C;  2R7Q A;  3ELK A;  2GWR A;  3HZJ A;  3IRR A;  3BDD A;  1U6G A;  2BE5 F;  4AIH A;  1TW2 A;  4NC8 A;  2LY9 A;  1U5T C;  3QAH A;  4CCK A;  5M3M J;  3V8L A;  1V5E A;  1P7I A;  2KIF A;  4RAF A;  5IOY A;  2PMZ N;  4HDU A;  3G2B A;  4XLC A;  3U1K A;  3AG2 H;  3OS2 A;  3CME I;  3GTG J;  3L2V A;  1A6I A;  3HJE A;  4HDV A;  1XG1 A;  1ZRC A;  4PGH A;  1ACI A;  1SD6 A;  4B4C A;  3MKY B;  3GX4 X;  1K78 A;  1AKH A;  2V9V A;  4PUS A;  3TDZ C;  2JPC A;  3QRF F;  4RAY A;  3CZ6 A;  2FBH A;  1X3Z B;  4LIU A;  3HOU J;  5GTH C;  5FFZ A;  4Y17 A;  4JK1 X;  5J8C A;  1R5H A;  2WB1 A;  1FBS A;  2ETH A;  1EH8 A;  1FOW A;  1I27 A;  4XKV A;  1KZH A;  5IP6 A;  3F8F A;  5E3N A;  3LQR A;  4IRI A;  1K83 J;  4PDK A;  1LE8 B;  2HWV A;  3CMY A;  1X1P A;  3V8J A;  1VQ8 I;  4BS9 A;  2VOO A;  3OOP A;  3WGG A;  4CYD A;  4RAG A;  4AC0 A;  2PI0 A;  1IN7 A;  2VXD A;  1KQ8 A;  2CRG A;  1ON2 A;  4AWX B;  1ITY A;  2L9R A;  1LKX A;  2OCC H;  2IVM A;  2Z5U A;  4DGW B;  2KJB A;  3TGN A;  4UUS B;  4A3K J;  3W3C A;  1OCC H;  2UUZ A;  4QPQ A;  2FQ4 A;  5GAH J;  4P9F A;  1ON1 A;  2W24 A;  3BG7 A;  5JI6 A;  1BW5 A;  2LSO A;  1FWZ A;  3QYB A;  2IS4 A;  2ICW G;  2OV7 A;  3GLL A;  4U0W A;  2XAH A;  5CJ9 A;  3LSJ A;  1J59 A;  3HRU A;  2F5E A;  2DFH A;  3JRA A;  1ZYR F;  3KLN A;  5E8I A;  1RC9 A;  2P0W A;  2VLA A;  1JJ6 C;  2O7O A;  3HTS B;  1RUO A;  5IYB J;  1ZG3 A;  2LKP A;  2HYF A;  2HQR A;  3VYS B;  1PUE E;  3PFY A;  2NVU B;  5ICG A;  4N0B A;  4PZJ A;  3PNY A;  1ZQ3 P;  1G6N A;  4AIK A;  3WTW C;  2EBI A;  2DTZ A;  1TBX A;  1FZP B;  1O57 A;  3I4P A;  1JHH A;  3I9V 2;  4HBL A;  3GZ6 A;  3FM5 A;  2KIU A;  3F0C A;  1CF7 B;  2Y30 A;  1X4O A;  2XRO A;  4UVA A;  5FLV A;  2ZNY A;  3Q0U A;  2STT A;  4CXF A;  1UCR A;  3OYF A;  4XSZ F;  1IXC A;  2VQH A;  3F22 A;  2XRN A;  1JI8 A;  1FY7 A;  3RKX A;  3R60 A;  2Y69 H;  3FXR A;  2XGE A;  4HNU A;  1PDN C;  1X2M A;  2VJ4 A;  3B02 A;  2FMY A;  2TDX A;  1FPQ A;  1XPX A;  3D5L A;  5EDN A;  3CJR B;  2R7W A;  2FML A;  2KMU A;  2V9K A;  1QO0 D;  1IN8 A;  1BN5 A;  2ZC2 A;  2K4J A;  4W97 A;  1DP3 A;  4XLF A;  1PVE A;  3M8E A;  5J6X A;  3LFK A;  1WKM A;  4M3B A;  3K4K A;  1TQP A;  2E1M B;  2LG4 A;  1JGS A;  1JUS A;  4BJ5 C;  1FX7 A;  3E3V A;  3UR3 C;  2ADU A;  3C2B A;  5B5E C;  1TNS A;  2ZO4 A;  3HPH A;  1QBJ A;  5JFR A;  3DFG A;  2M8G X;  1FTT A;  4HQM A;  2OQG A;  4G6T B;  3FIW A;  4CZZ A;  3Q5F A;  2ACJ A;  2C6Y A;  2A69 F;  3CLQ A;  3E5X A;  4EQQ A;  3E6C C;  2M87 A;  3P9I A;  3ABU A;  2JT1 A;  5L3C A;  1QNT A;  3WOD F;  1DU0 A;  4M9S A;  1BR1 A;  1IF1 A;  3RPU A;  5LHI A;  3I59 B;  2H1K A;  2KRC A;  3HSR A;  5AIP A;  4MLO A;  2A05 A;  5C44 J;  1W5T A;  1TT5 B;  1HBX G;  4LG0 B;  1R23 A;  2VIX A;  1YHQ I;  4IJA A;  1QVT A;  4IX7 A;  4M74 A;  3F6V A;  4EM1 A;  3GCM A;  3RYP A;  4IQJ A;  1MMA A;  2ZJP F;  2JUG A;  2CW7 A;  2FUG 2;  1FIP A;  4RGU A;  1G59 A;  2F4O B;  1LNW A;  3VFZ A;  2L9V A;  4DJA A;  1ZG1 A;  4RGX A;  4BNC A;  1HQC A;  1XTA A;  2BBY A;  1OCO H;  2K9S A;  2ZXH A;  3C1D A;  2DMT A;  4MHG A;  3GF2 A;  2NVX J;  3CCY A;  1WH7 A;  3WU0 A;  1R71 A;  4HNT A;  3BOQ A;  3JRG A;  4WWC A;  1ZKG A;  2P6S A;  1P4X A;  4IRH A;  3KX2 A;  2X51 A;  3E6D A;  2LDU A;  1SAU A;  3AKZ A;  3C2H A;  1D8J A;  2WAQ N;  3E5U A;  2B7E A;  2BXZ A;  1SAX A;  2FBI A;  4ZH4 F;  1W7P D;  5ILS A;  2IS2 A;  2V1N A;  2WB1 N;  4R1H A;  3VSK A;  1S72 I;  1EF4 A;  1IGN A;  1IN5 A;  2HZD A;  3QPS A;  4QLC U;  5FD5 A;  2BW3 B;  3S1Q J;  3RYR A;  3MAJ A;  3WU2 C;  5L3F A;  2R7X A;  3KEO A;  2V26 A;  4BXU A;  4FT8 A;  2VE8 A;  2PG4 A;  4MFE A;  1YRN B;  4BDY A;  2BHZ A;  1ETW A;  2P8T A;  1MW7 A;  4AYB A;  2VKH A;  4OMZ A;  3QU3 A;  1BI3 A;  1YQA A;  1Y8R B;  3ECH A;  2H09 A;  4ENJ A;  2DMQ A;  4N4O B;  4ASN A;  3PL8 A;  3CCS I;  5GTI C;  4O6J A;  3FF5 A;  1RUN A;  2HEO A;  2QSF X;  2DN0 A;  4C3H J;  2KPM A;  1LDK B;  4FE4 A;  3SZT A;  3MZY A;  3J80 Z;  2Y75 A;  2IRF G;  2HYG D;  3S2D J;  3S3M A;  3LAJ A;  3F72 A;  3I4N J;  4AD9 A;  1FNN A;  4BEH B;  4Q48 A;  4I0B A;  4R79 A;  4XL9 A;  4YRV A;  1DDN A;  2ESN A;  2A3S A;  2JN6 A;  3OR1 C;  2H6B A;  4HW0 A;  4KT6 A;  3L9F A;  4RGS A;  3G6E I;  3CF5 F;  1ERD A;  2VQL A;  2BVM A;  2X6X A;  3FIS A;  1KU2 A;  1B8I A;  3KFW X;  5E1W A;  1WGX A;  1ETO A;  5CQE A;  5EJC A;  1VQP I;  2YSR A;  3A01 A;  5DM6 F;  2ME0 A;  1N25 A;  1LB2 A;  4IHY A;  2XSJ C;  2OTL I;  2FOW A;  2DJI A;  1B1B A;  4CSW A;  1FBQ A;  3L2Q A;  3PO2 J;  2VL8 A;  1XMX A;  2NXN B;  3B6A A;  1PJR A;  5J47 A;  5D5X B;  1TQI A;  4C3J J;  3FXJ A;  1Y39 A;  3OIO A;  1W4M A;  4A3C J;  2ZJ2 A;  1QA6 A;  2MH9 A;  1SFE A;  3OYL A;  1GV2 A;  1P2F A;  1I1S A;  1QHH D;  5IT3 A;  5ILU A;  1WPK A;  2P5L C;  1X2N A;  4UV8 A;  1SFU A;  1X1D A;  2BOL A;  1T2K A;  4G7Z F;  4ON0 A;  1RET A;  1MMS A;  1FOX A;  2HDW A;  3WU1 B;  3RZO J;  3S1R J;  3BR3 A;  3ZMD A;  1UJ8 A;  2FF4 A;  2E2H J;  4EJU A;  4IOC F;  3OYD A;  2Q0O A;  3IC7 A;  2L2O A;  2DMU A;  5HNH A;  3OIQ A;  3PO3 J;  4L9J A;  2X6W A;  1K79 A;  4NQW B;  4Y7N J;  5JHF A;  2W7N A;  2GLO A;  3KYL A;  2FSW A;  3S93 A;  1XMA A;  2CQN A;  3PIO F;  4KIT B;  4QIW N;  3MCZ A;  2EIJ H;  1RIO H;  2QCO A;  1BI0 A;  3VSL A;  5LD2 C;  1J75 A;  5F1R A;  4L5E A;  3E5Q A;  2JMW A;  1KU3 A;  5CYV A;  3VEP A;  2JA7 J;  1YW9 A;  1X1B A;  4G7O F;  5E20 A;  4F91 B;  1SVL A;  3HGY A;  4LIT A;  4L5I A;  1SD4 A;  1R5I D;  3V7R A;  1YJN I;  4A5M A;  1Z3Y A;  2VBZ A;  5M5Y J;  2ZJR F;  2PN6 A;  4BQQ A;  2AO9 A;  4RM3 A;  1HDD C;  3LA2 A;  2OCE A;  3IKV A;  1QZY A;  5IP9 J;  1DUX C;  3QOP A;  2K9N A;  1D8K A;  4M72 A;  4B43 A;  1SAN A;  2XC7 A;  1YO5 C;  1P7J A;  4P96 A;  1N75 A;  2Y0S A;  1U3E M;  2CO5 A;  3LA3 A;  2DLL A;  4E7I A;  2XF5 A;  4EJT A;  3LMM A;  1SMY F;  2KQR A;  2QGU A;  4LJZ F;  5CVJ A;  3CC7 I;  4LB6 B;  5HOO A;  4DBR A;  3F8M A;  1GHC A;  2WV1 A;  2E19 A;  3JW4 A;  4HOB A;  2E5N A;  3RJP A;  4BAY A;  3ZMZ A;  2BY3 A;  3KP5 A;  4D5F A;  1XSD A;  2FXA A;  2XPU A;  3COA C;  4L5J A;  1S8N A;  4ANJ A;  2EZH A;  3LSM A;  3R61 A;  1IAW A;  3VOD A;  3SDG A;  5GAE J;  1KYZ A;  2QQB A;  2O03 A;  3L2R A;  3C3W A;  2EFN A;  1X1A A;  4MEY F;  3QU6 A;  4C9Y A;  3LSP A;  1BC8 C;  4O3M A;  2V9P A;  4PJJ A;  1KU7 A;  1RR7 A;  4LGW A;  1BBY A;  2ZJQ F;  1UG0 A;  3OV8 A;  5HVQ C;  4EJV A;  2WAF A;  2IPQ X;  2CGP A;  4XLH A;  2AXT C;  4ZDP A;  2MLK A;  3EET A;  1BR4 A;  2ID6 A;  4C2U A;  2P7C B;  4ENN A;  3CMM A;  2RC4 A;  3QWL A;  1HKQ A;  3L2U A;  1XS9 A;  3U1D A;  3KEY A;  2J5O A;  3F6O A;  4BJ6 C;  1E3P A;  2X4H A;  4IKF A;  2P7V B;  1TWA J;  4EEF G;  2TRT A;  4AYB N;  1VQM I;  2COM A;  1FBU A;  4V2F A;  4YEJ A;  2DOF A;  3REO A;  3E6B A;  3DKX A;  2VJI A;  1D0X A;  2OZU A;  2MLG A;  3WGI A;  5L3D A;  1F36 A;  5JVT A;  4M3E A;  4N4N B;  2EIK H;  4M3F A;  4A0X A;  1TZL A;  3TL4 X;  4U7D A;  2XAF A;  2FQ3 A;  3A0B C;  3G1L A;  2K7L A;  3DWL E;  1F1Z A;  3BTJ A;  1JKR C;  2B63 J;  4IHV A;  1RKW A;  4RGR A;  1IW7 F;  3CCU I;  2R0Q C;  2HOT A;  4UHT A;  4KDP A;  3Q9V A;  3QYF A;  2BY1 A;  1SD7 A;  3EUH A;  1R36 A;  1ZAR A;  3RQ4 A;  1OPC A;  1YIO A;  3GTQ J;  2R5Y A;  2DFE A;  1MDM B;  3GWZ A;  5HLT A;  5E1Z B;  3HOX J;  1Z9C A;  1IRG A;  2BXY A;  3GUD A;  3CP2 A;  4ZYG A;  1YW8 A;  1K4S A;  3ZPL A;  3PUF A;  3VYT B;  1FMV A;  3BQZ A;  3K4M A;  2MAB A;  3DEU A;  2H1L A;  5H6Q A;  1UZC A;  2LFB A;  2E2I J;  4BJT A;  3MZH A;  1SMT A;  4Y13 A;  4KMU X;  3WTY C;  4OIR F;  5EZH A;  1O4X A;  1BC7 C;  1K61 A;  3PNT A;  2P5K A;  4A5N A;  3A03 A;  1HST A;  1K78 B;  3C18 A;  1AKH B;  1NK3 P;  4MFD A;  6PAX A;  5B66 C;  5FD6 A;  2A61 A;  4DOZ A;  4ZTJ A;  4RB1 A;  1TWG J;  3I64 A;  4A93 J;  1CGP A;  1ZAO A;  3OYJ A;  2RKH A;  5AON A;  2L9N A;  4I01 A;  5F08 A;  3TOB A;  1F43 A;  5D8L B;  2FE3 A;  3M07 A;  3FXL A;  3CD6 I;  1E3O C;  1T56 A;  2YU9 J;  3F9K A;  4CDG A;  1MBE A;  4L0Y B;  3JCU C;  3LFU A;  3F8B A;  3LSR A;  2VPR A;  4QSH A;  2VKE A;  3BP8 A;  2JTV A;  1WCM J;  2RVC A;  2EQR A;  4BUP A;  2YS9 A;  3CTA A;  2IGO A;  3I0T A;  2W82 A;  1B9N A;  3CDL A;  2D5V A;  3OR2 C;  4FQG A;  1S3J A;  1KYW A;  3JRI A;  4L9N A;  1U8R A;  3J7Y J;  1MMN A;  4DW6 A;  4II2 A;  2KHM A;  2JRT A;  3I71 A;  1ZR2 A;  2NYX A;  2K9L A;  3RDI A;  5JVG F;  1KON A;  1OKR A;  3DPL C;  4N9H A;  1OCR H;  4Z2Y A;  1YE9 A;  5C4J J;  2L7M P;  3LWF A;  4M3D A;  2COB A;  3F23 A;  4D7M A;  4A3E J;  4Y15 A;  3JTG A;  4KIS A;  1WJA A;  2E36 A;  2QSH X;  5LFA A;  3C2G A;  1BIA A;  2VT2 A;  2DK5 A;  2QKL B;  1MJA A;  2DQR A;  3QPH A;  5F64 A;  4EM0 B;  1W36 D;  4PCQ A;  4ZYH A;  2IS1 A;  3GTK J;  3EDP A;  1KQ9 A;  1BR2 A;  1EV7 A;  3WGH A;  2E7X A;  4B44 A;  5D4S A;  2NRA C;  2EPF A;  3QP5 A;  4R8H A;  1MMG A;  5F0H A;  5HDK A;  1K4T A;  2X0L A;  1Y0U A;  1W7P B;  4IHT A;  1LUJ B;  2L7Z A;  3L2C A;  4M6V A;  5HLG A;  3TP3 A;  1TL8 A;  1F4K A;  2HVR A;  1Y0N A;  1VF9 A;  1W0T A;  2OJE D;  4G6Q A;  5AIQ A;  1FP2 A;  2QLZ A;  1RI7 A;  3BTC A;  4CCN A;  2DO7 A;  2L5Q A;  2BYV E;  3BTI A;  2OC6 A;  4XLE A;  2FNP A;  4A6E A;  2IA0 A;  2M4G A;  3J7Z I;  3V42 A;  2EZK A;  3HDD A;  1P92 A;  3TQN A;  3GTM J;  2BHY A;  5H20 A;  3HOW J;  4TV7 A;  1IG7 A;  1YIT I;  3HUG A;  3S1M J;  2WAQ A;  4LB5 A;  1S29 A;  5J8F A;  1R1T A;  2VN2 A;  5E18 F;  4RMN A;  5JHU A;  3DF8 A;  3ISP A;  3GXO A;  1O7F A;  3OWT A;  3KP4 A;  5FKK A;  5GP9 A;  4FE7 A;  2LMD A;  2VJJ A;  5B3S H;  2DA4 A;  5ICE A;  1O3R A;  2A6H F;  3HOS A;  2LOO A;  1X1C A;  1HW2 A;  4N9I A;  5HOD A;  1TC3 C;  1M1E B;  2P81 A;  4UV9 A;  2LK2 A;  4HA8 A;  2QEN A;  4LG3 A;  3HG9 A;  4BY7 J;  3D5S C;  4HAM A;  1MBG A;  3IV5 A;  2DU9 A;  1HXD A;  4CH7 A;  1MBH A;  3GME A;  2FOK A;  1ZLJ A;  2ISY A;  2DT6 A;  3DPT A;  5L3G A;  4WXD A;  3T1B A;  1FTZ A;  1B72 A;  2V79 A;  2IA2 A;  2G7U A;  2R7O A;  4XN0 A;  3CUQ C;  2G7H A;  4JBA A;  4ZTF A;  3OIP A;  5J1R A;  2R7R A;  3L09 A;  2EIM H;  1NTC A;  2E71 A;  1T33 A;  2Z1D A;  4F92 B;  2X6O A;  2VE9 A;  4A0Z A;  2Y31 A;  3MKZ A;  2F5F A;  2JZY A;  1IXR C;  1MH4 A;  3EYI A;  4X0G A;  2DJN A;  2A68 F;  3ESW B;  3GFL A;  2WA0 A;  3UKG A;  3JTH A;  3G71 I;  4HV5 A;  4RLQ A;  1U2W A;  4E6K G;  2LD5 A;  3CCQ I;  3HYI A;  2R5Z A;  1QHG A;  4MEX F;  4GYG A;  2N8G A;  3LSI A;  5B1B H;  2L02 A;  5LEK A;  1F5T A;  2CUF A;  3S2W A;  3KYC B;  1P4W A;  4WXH A;  2ZFW A;  4ZC3 A;  4RB2 C;  4BKX A;  3CCL I;  1A35 A;  4KN7 X;  2K9Q A;  3HOY J;  2A6E F;  3WG9 A;  5K7H A;  1WRJ A;  4B48 A;  4ESF A;  3KCC A;  3K1P A;  3ECO A;  1JTX A;  1QZZ A;  3SEZ A;  4ESJ A;  4U0V A;  1T95 A;  1TWH J;  5B1A H;  2VQG A;  3B73 A;  2LH9 A;  3NRV A;  1YLF A;  4JOM A;  3F21 A;  3B6C A;  1D1C A;  1A31 A;  3EUH C;  2WTE A;  3ASN H;  3E0J B;  4ZDO A;  1RPW A;  4GYI A;  4BU2 A;  3HC7 A;  2V6C A;  1FYM A;  3VDX A;  2MC3 A;  1PP8 F;  2GA2 A;  4CUG A;  4E7S A;  1E3H A;  4WCG A;  3IRQ A;  1I50 J;  2QF7 A;  4H0E A;  2HDD A;  5FGM A;  1VFC A;  2LBF B;  5EYR A;  3H3V K;  3DEW A;  3KZY A;  4ETS A;  3GZN B;  3JSO A;  4KNY A;  2ELJ A;  1JGG A;  5GAD J;  3OYN A;  1WSU A;  1A36 A;  3HRS A;  5DD8 A;  3X2Q H;  3A01 B;  1BA5 A;  2PMU A;  3K4C A;  2IGK A;  4HX7 A;  1XB4 A;  3CCR I;  1WI3 A;  4FIS A;  4I99 C;  4OIO F;  1V3F A;  1GVJ A;  3S8P A;  2DPD A;  3BPX A;  3K1N A;  3FHZ A;  4B3A A;  1YFH A;  2HFH A;  3M1C A;  1EH7 A;  1Z0X A;  5LEJ A;  2K86 A;  3WHC A;  1H0M A;  5K5O A;  1VQ9 I;  4J19 A;  3GTP J;  3J81 K;  2X1D A;  4DYC A;  1FOY A;  1J09 A;  3BR6 A;  1XGS A;  1MBK A;  3G1M A;  2QYO A;  3HB9 A;  3CLO A;  4Y52 J;  1K7A A;  3FXQ A;  2DT5 A;  2P5V A;  2LR8 A;  1HSJ A;  2K3P A;  3O2P E;  3OYI A;  1VND A;  4XOT A;  4HG2 A;  4HF2 A;  4RM2 A;  5HS9 A;  1FOK A;  2ZXW H;  3BG3 A;  2PBI A;  3PIP F;  1Z3X A;  3AL0 C;  1VQ4 I;  3BTL A;  2ZB9 A;  1FSE A;  2XAG A;  3LAP A;  3TMO A;  1U8B A;  1OQY A;  1U5T B;  1HKS A;  3ZN1 A;  3GTJ J;  5EG0 B;  2E2J J;  2IA1 A;  3KZI C;  5DDG A;  4BDZ A;  4ENK A;  2IEK A;  2P4W A;  1MJ9 A;  3SQN A;  2H94 A;  2D45 A;  1DQU A;  1MGT A;  3M8F A;  3CO6 C;  3FK7 A;  1R7J A;  4BE0 A;  2HZT A;  2W48 A;  3W6V A;  3L1P A;  2G0E A;  3TO6 A;  4IHX A;  2RAE A;  2YU3 A;  4DNC A;  2HI3 A;  3D0S A;  2ZME C;  3IWF A;  2BEO A;  5FKO A;  1LFU P;  1P6R A;  5KVR A;  1G3W A;  2F2E A;  3R0J A;  1KU9 A;  5J1U A;  4OAZ A;  5DV5 A;  5BNG A;  3OYB A;  4XM3 A;  1T98 A;  4XON A;  1AWC A;  1MJB A;  1PUF A;  2O0Y A;  2XIG A;  1ULY A;  4E7H A;  4IHS A;  1R4N B;  2JWT A;  3K2Z A;  4LK1 F;  3HHH A;  3IL2 A;  3LNQ A;  5CVV A;  4XLN F;  3GFM A;  3L2W A;  4A69 C;  2BY2 A;  4M73 A;  1DP7 P;  3MQ0 A;  1YX3 A;  3N4M A;  5IYC J;  5H6R A;  2F4M B;  4MIM A;  3V7S A;  4CCJ A;  3BG6 A;  1T08 B;  3PNV A;  2PX9 A;  3KE2 A;  5LRS A;  1G3Y A;  1OYW A;  3ZMV A;  3O8G A;  4IXA A;  4M71 A;  2ESH A;  1LVA A;  3RPU D;  4ZZL A;  2LP0 A;  4JX6 A;  1RR8 C;  3MVP A;  2IS6 A;  2HQ5 A;  3DLA A;  5J4Y A;  3OYA A;  2EK5 A;  2HU9 A;  1FEX A;  1ZH5 A;  2A5Y B;  2VXZ A;  1HDP A;  5BOX A;  2LLK A;  2JSC A;  2OPT A;  4UXN A;  3TDU C;  1IRZ A;  5D8K B;  5LHH A;  3GLX A;  5CVI A;  1V55 H;  4D0P A;  3R6S A;  4BQN A;  3JRD A;  3RIR A;  5DTD A;  4E4H A;  2MD5 A;  4HNV A;  2QBY A;  2AQF A;  2KIQ A;  2NOJ B;  1N78 A;  4XIC A;  1MND A;  4XKB A;  1WJB A;  2CH0 A;  3ZQG A;  5HDN A;  3H5A A;  3PQJ A;  3K0L A;  2UZK A;  1B4A A;  3K70 D;  2M9H A;  3T0Y A;  5D6E A;  3CMA I;  2ZXJ A;  2HQN A;  3H9G A;  4B09 A;  4CIC A;  2W57 A;  1XD7 A;  2FJ1 A;  3JRE A;  1BOA A;  2DK8 A;  3KZZ A;  4OMY A;  3DKY A;  1T6S A;  4LG0 A;  4PJ0 C;  1IZ1 A;  2IXS A;  3AFH A;  5C3E J;  3HHG A;  4BBS J;  2EB7 A;  2K85 A;  5IYD J;  1D5V A;  1TTY A;  5LGU A;  1MSE C;  2K40 A;  4KYW A;  1BJZ A;  2IJL A;  1POG A;  2NVY J;  3ZP5 A;  4BHP A;  1OCP A;  4LIV A;  1YJ9 I;  2K4B A;  5IOZ A;  1SFK A;  2CU7 A;  2RDP A;  2DMN A;  2I10 A;  2MD0 A;  3GTO J;  1ZEL A;  3M7G A;  1QZE A;  4C30 A;  1RNL A;  3V4G A;  5KAF C;  4J01 A;  4XKW A;  3MD2 A;  1MKM A;  2CWE A;  4WXC A;  2KT0 A;  1K6Y A;  2X6Y A;  3M8J A;  3FBN B;  5JLX A;  4Y3O A;  3E6M A;  2HDC A;  5IPA A;  3GVA A;  2KP6 A;  3RZD J;  4AIJ A;  2GXB A;  1LVK A;  2MC4 A;  1QU3 A;  3IWZ A;  3TW6 A;  3MKL A;  4I2O A;  5GAG J;  1WJ5 A;  3AG1 H;  4K2E A;  1FP1 D;  3CES A;  4XID A;  1X3U A;  4B1R A;  3S15 J;  1YG2 A;  2DFI A;  3MEX A;  3PSI A;  2MFZ A;  1R58 A;  2QQ9 A;  2NOG A;  3ZMU A;  2DW4 A;  1MNM C;  1ZRD A;  5E17 F;  3KET A;  4KFC A;  1X4P A;  2E1C A;  2Y9Y A;  4BE2 A;  4FX4 A;  2CMP A;  5K1Y A;  5CLS A;  4YG2 F;  1QQI A;  2ECC A;  3E1S A;  3H9Q A;  2IP2 A;  4BXX J;  4NHJ A;  4O5V A;  3OL3 A;  2XPV A;  4AID A;  4PSX A;  2Z3Y A;  1WI9 A;  3W6J B;  4ABZ A;  4KIF A;  1NHA A;  2E7W A;  3RCO A;  3WE2 A;  1LFB A;  2CQQ A;  2JQ7 A;  2QVO A;  3FXO A;  3CUQ A;  3KLO A;  2X1E A;  5HLI A;  2ELK A;  1FYL A;  2ISZ A;  3E7L A;  3K4B A;  3QYE A;  2KL4 A;  3WTT C;  1R9T J;  3WTV C;  2KIM A;  4MQ9 F;  1E0E A;  4MO7 A;  5EGO A;  4ZYD A;  1ODD A;  3ROU A;  2M45 A;  4HPQ A;  3M1E A;  2MA3 A;  2VC0 A;  4H4K C;  2BV6 A;  4OU0 A;  1ZGW A;  1R49 A;  1H9T A;  1S9H A;  2AS5 F;  4MTE A;  2O5R A;  3O3K A;  3BPV A;  3KIO A;  5E3M A;  2DA6 A;  2CS3 A;  1WH5 A;  2OTJ I;  4MTD A;  4XLP F;  3BJO A;  1R1U A;  1OCT C;  2QUF A;  1ZN2 A;  5J1Y A;  4BHB A;  1OFC X;  3DKW A;  1YTY A;  4A3F J;  2EA4 A;  2Q2E A;  1VZ0 A;  2D1V A;  1SC7 A;  1BW6 A;  1EKE A;  1MBJ A;  2VBW A;  4NUB A;  5EEH A;  2L01 A;  3S17 J;  4B47 A;  4HX8 A;  2HVS A;  1WQ2 A;  4W1U A;  2E34 A;  4NNJ A;  2P6T A;  4EV0 A;  2XPW A;  3BR1 A;  3I53 A;  1VQ7 I;  2UWM A;  3L7W A;  3QOD A;  1LDD A;  5DUK A;  3BC8 A;  3J7A O;  2VOP A;  2A5W A;  1EJ9 A;  2CQK A;  2UXN A;  3V8K A;  2XDV A;  3N05 A;  5FFX A;  3DBR B;  2NS7 A;  1PP7 U;  2DT7 B;  4A3B J;  4U88 A;  2VOD A;  3H92 A;  5LRR A;  3MWM A;  4F3Q A;  3HOZ J;  4DIQ A;  1OLT A;  1ORK A;  2CW0 F;  3FXK A;  2ELH A;  4D5C A;  3BCA A;  2CV0 A;  1Z91 A;  1H9G A;  1YIJ I;  1Z21 A;  1WVR A;  4KUM A;  3O6B B;  3M9A A;  5DCM B;  1AHD P;  3CC4 I;  4EGY A;  2FNA A;  1KGS A;  4IL6 C;  2BVL A;  3G73 A;  4F55 A;  3ZOB A;  1T8I A;  4A3L J;  1Z7U A;  2E35 A;  3G1O A;  5IP7 J;  4AM3 A;  2KRH A;  5D4R A;  2D1H A;  3H9J A;  3U21 A;  2Z33 A;  5FRM A;  3HPG A;  3OY9 A;  2VKD A;  4YEL A;  2V4J C;  1ZRF A;  1HOM A;  4NC7 A;  2O9L A;  2M30 A;  5DS9 A;  2DA2 A;  1GXQ A;  4XN3 A;  2E5Z A;  3BCB A;  3H0G J;  1USS A;  2XB0 X;  1NK2 P;  3H36 A;  3DLL F;  4NB5 A;  4P55 A;  5M5X J;  3N97 A;  2EZI A;  2R93 J;  3SZP A;  3HUG B;  4ZYE A;  1UHW A;  3H3Z A;  1XSX A;  5DD4 A;  1L0O C;  1XN7 A;  2OBP A;  4OOI A;  3HGG A;  3U9G A;  3H0D A;  3RI4 A;  1TT0 A;  1FLI A;  2DOE A;  3RKQ A;  1JTY A;  2LF8 A;  3WG7 H;  4G94 A;  1BJA A;  2JA2 A;  2LKX A;  3HBL A;  1KQ0 A;  3FBI B;  5BQT A;  1LEB A;  4EGZ A;  3J7A Y;  3K10 A;  1GLN A;  5D5W B;  5CVU A;  2I8D A;  1QPI A;  4MGR A;  5JLW A;  2JSP A;  5LGT A;  1D0Z A;  1JUM A;  2HTS A;  3GFJ A;  3H5N A;  2O6G E;  2F48 A;  5D5U B;  1VQL I;  4XNF A;  1AOY A;  2GM4 A;  3EUK L;  2Z2S B;  3HIF A;  4HX4 A;  1H89 C;  3BRO A;  3S2H J;  4A6D A;  3I56 I;  1FYK A;  3ZQH A;  1U9O A;  3AG4 H;  3CQZ J;  4GFB A;  2EFO A;  2NAZ A;  3I5U A;  1XX5 A;  4I09 A;  1B72 B;  1MSF C;  2CFO A;  4KMF A;  4XRF A;  4KT5 C;  1I3Q J;  2I5U A;  1JUP A;  4NDL A;  1MNE A;  2O8K A;  3H1C A;  4CHU A;  1YS6 A;  3T8T A;  3I4M J;  2W4S A;  3V7C A;  3O8H A;  3S1N J;  1O3Q A;  1S7A A;  1Y1V J;  4HF0 A;  2ZKZ A;  3C7J A;  3S32 A;  3FXU A;  1G8X A;  1LEA A;  2X9D A;  4FET A;  1LJ9 A;  4YFX F;  1Z7L A;  2HPM A;  2JVG A;  3SXY A;  3ZMT A;  2ZME A;  1OR7 C;  2E1M C;  3KP7 A;  5F0F A;  3CUO A;  2JA5 J;  2W1O A;  3VYR B;  1JKO C;  4RLF A;  4P5O A;  3IH3 A;  2DXI A;  3OYC A;  2DBB A;  4Q5S F;  5ERI A;  3KP6 A;  2V1D A;  2WV0 A;  3GW2 A;  1QGP A;  2R5Z B;  3CJN A;  5J3L A;  5KHD A;  3TBI A;  2LTP A;  4XQF A;  3CP8 A;  5KK1 A;  1UST A;  2WAD A;  2R4G A;  4PJL A;  1IXS B;  3S14 J;  2H8R A;  2QM3 A;  1XCV A;  3KEQ A;  4I98 B;  1Q1V A;  4ZJZ A;  4A0Y A;  1QRY A;  2MH2 A;  3MFK A;  4V2G A;  1W1W E;  5BS6 A;  4L9V A;  3A4C A;  2CW8 A;  5E8G A;  3LST A;  2XHK A;  5J40 A;  4F52 A;  2M7A A;  1O3S A;  3S3N A;  2VC1 A;  1J9I A;  4HSR A;  3AG3 H;  1I1G A;  2HR3 A;  1BI1 A;  4XRM A;  4LMY A;  3H3U A;  4CYC A;  4UUT A;  2GZW A;  2FU4 A;  2LYC A;  3WHB A;  2F4I A;  2VQC A;  3WTU C;  2CQX A;  3GEZ A;  3GYH X;  3CCV I;  2HYJ A;  3EPZ A;  4F93 B;  4IOA F;  4F7Z A;  4BY1 J;  5L3B A;  1ETY A;  3JAM Z;  4IO9 F;  3P9C A;  2UV1 A;  2GOM A;  3LA7 A;  5IT9 Z;  4JP0 A;  5L3E A;  4LD5 A;  1ETK A;  4DZJ A;  2EV6 A;  1GV5 A;  3BG9 A;  3CDI A;  4UVC A;  2XF6 A;  3ZQI A;  5M5W J;  3D1N I;  3JAM K;  5IT9 K;  3Q0W A;  2M3A A;  2XUB A;  5IY5 H;  2LKS A;  3K4J A;  5EF6 A;  2UXX A;  2WBM A;  2XAU A;  2W25 A;  4RDU A;  2PEX A;  3A0H C;  1P9Q C;  3MMY B;  1O7L A;  2XKO A;  2JVH A;  2FRH A;  1TWC J;  5ED4 A;  4FAS D;  2R7U A;  1IUY A;  1H8A C;  2DDA A;  2W85 A;  2KZV A;  2IGM A;  3HRT A;  3JRC A;  4LK0 F;  4LOC A;  3MZ8 A;  5FRN A;  1E2X A;  1VI0 A;  3I55 I;  4WF2 A;  1C0W A;  2EH3 A;  2DPU A;  3QPL A;  2JK3 A;  3K2A A;  3K69 A;  3CO7 C;  5FLM J;  1IC8 A;  4XOP A;  4UNO A;  2XV4 S;  5DUI A;  5LGN A;  1T39 A;  4LLN A;  1ZG5 A;  4YII A;  4IQ4 A;  3NAU A;  3RTR A;  1EH6 A;  2QQA A;  2VPL A;  3SFZ A;  3FMS A;  2FX0 A;  2MW8 A;  4CO8 A;  4BE1 A;  2WY7 Q;  4QWQ A;  3JRB A;  3PFI A;  2D2W A;  2FA5 A;  3U2R A;  2PJR A;  2RNG A;  3HKZ N;  5EZG A;  4S04 A;  3FMQ A;  2NS0 A;  5FO5 A;  4EJW A;  3TED A;  4OIN F;  2XGD A;  2VJ5 A;  1VQK I;  4C2M J;  4S0H B;  1JKQ C;  4A3J J;  2WY8 Q;  4DQ2 A;  1UHS A;  4IF4 A;  4CA0 A;  1R6R A;  1R00 A;  2CSO A;  2E60 A;  3SEQ A;  4HRI A;  2K5C A;  3BR2 A;  4KIG A;  2R7F A;  1GVD A;  3FKJ A;  3HM5 A;  4EJO A;  2CYY A;  4Q4Z F;  2HOA A;  3IAM 2;  1FMW A;  1PYV A;  2LRE A;  1AA7 A;  1IDY A;  4E7K A;  4Z6Y A;  3DU5 A;  3H5R A;  3F8N A;  2KRF A;  2OD5 A;  3G4S I;  4JX5 A;  4M6X A;  1NH3 A;  4C3I J;  2X48 A;  3HXL A;  1S6L A;  4FTH A;  1LDJ A;  2NS8 A;  1J7K A;  2WAE A;  2F6C A;  1PUF B;  4BQO A;  3CCE I;  1VQO I;  4HLY A;  2NVT J;  4IHW A;  3DP7 A;  2LY1 A;  1MD0 A;  3IAS 2;  2AQE A;  3ERE D;  1K6O A;  2VBY A;  1T38 A;  4A2U A;  4ZYA A;  2DA5 A;  3ZR8 X;  4I76 A;  3DBH B;  2FEZ A;  4AUX A;  4NBQ A;  1G4D A;  3ZQF A;  4AU7 A;  4II3 A;  1W7P A;  4MNU A;  2KDO A;  4ZDL A;  3CJT B;  2VKV A;  1DPR A;  2KIS A;  2IBD A;  3OOU A;  2EV0 A;  5E3O A;  3IH2 A;  2VBX A;  1B8I B;  2ZSH B;  2R7Z J;  2OQR A;  5CVR A;  2Y9Z A;  3S16 J;  4FX0 A;  2TCT A;  5BPI A;  2IAI A;  4KA4 A;  1XGM A;  3QP6 A;  4IVN A;  5FJ8 J;  3JSP A;  4A3M J;  4XR6 A;  1ZRE A;  1CQT A;  4A12 A;  5ILV A;  1N77 A;  1WFX A;  3J81 Z;  3VOE A;  1AU7 A;  1A6Q A;  4JQF A;  1S5L C;  1P4A A;  2OA4 A;  2X1C A;  5LLQ A;  3BZK A;  4L9T A;  2HOS A;  1YS7 A;  1IN4 A;  2ZNZ A;  5M3F J;  4BBR J;  4V19 K;  5GPA A;  4EAT A;  1HF0 A;  4BYY A;  3VYU B;  1W36 C;  1J0R A;  2QBY B;  3FWE A;  4CCL A;  2HGC A;  2STW A;  3UNG C;  2HNH A;  4KJZ A;  3OYG A;  1WZ2 A;  4E7L A;  1ZGJ A;  2JA6 J;  3DXJ F;  5TJJ A;  4IRG A;  1LE8 A;  5C4X J;  2LNB A;  1Y56 A;  3DTI A;  2L0K A;  4PK4 A;  1WJF A;  2DTR A;  1JXS A;  2F5C A;  1REP C;  3F3X A;  3LSH A;  2XVC A;  1JKP C;  2ME6 A;  4P1W A;  4UUS A;  1ETQ A;  4CZC A;  4PJM A;  1BI2 A;  5J4V A;  4CCM A;  2FD5 A;  1S7O A;  5CKT A;  1SD5 A;  2R92 J;  4BGD A;  2EIL H;  3BQY A;  3LQQ A;  3NWS A;  5F0C A;  1HC8 A;  3K9T A;  3LL7 A;  3DTE A;  2XGC A;  2IGN A;  4UY8 I;  5FKL A;  3SHF A;  2ZSI B;  5DM7 F;  4QTR A;  1YOV B;  2M4K A;  1BL0 A;  5KCM A;  3BY6 A;  1HLV A;  1ETV A;  1IDZ A;  2OF7 A;  3TO7 A;  2B0L A;  4HF1 A;  4FCY A;  4UB8 C;  5DCF A;  1TW3 A;  4PGG A;  2M2E A;  4E7J A;  2ZXI A;  1XDU A;  2AHQ A;  2DFF A;  2EIN H;  3BT9 A;  5JR3 A;  2EWN A;  2LC2 A;  2DDB A;  4I0A A;  4UB6 C;  1IRF A;  4GDF A;  2R7T A;  5DYM A;  2HOE A;  3SYT A;  1DGW Y;  1Z67 A;  2XRL A;  4BXF A;  5ICC A;  2QKM B;  1APL C;  2W84 A;  3A2K A;  1CF7 A;  2PFB A;  2CV1 A;  2VAS A;  3ZQC A;  2RNJ A;  4X1E A;  2JA8 J;  1XGO A;  3TKY A;  1R1V A;  4ZZD A;  3GBG A;  4IPA A;  2OAZ A;  1UAA A;  3RQI A;  2JRM A;  2H8W A;  2GA1 A;  5LBQ A;  4L18 B;  2MBF A;  1VTN C;  2GBY A;  1V4R A;  2JUC A;  1BIB A;  3R0A A;  2RQP A;  4XBF A;  4EM2 A;  4YFK F;  3A1Y A;  5CPR B;  4M9X A;  2DA3 A;  3QOE A;  3CDH A;  2O61 A;  3ABL H;  2V7F A;  3ABM H;  5DEQ A;  2DQL A;  2R7V A;  3K6G A;  3L00 A;  4BAC A;  2ZFU A;  1JHF A;  3CUQ B;  1IRX A;  1U9N A;  2XKP A;  3BR5 A;  4CCO A;  2B9S A;  4U87 A;  5A2Q Z;  3I3L A;  2HPI A;  3BJ6 A;  1O3T A;  3DU6 A;  5FLX Z;  3JRH A;  1TNT A;  1OJL A;  2GOX B;  1G2H A;  1XSV A;  5EGO B;  4OWR B;  2DAO A;  3NAR A;  1T0F C;  3PSF A;  4G8X A;  2L54 A;  3OYM A;  1I6H J;  1OR7 A;  2Q8K A;  3SJM A;  4KIC A;  5A2Q K;  4GRI A;  4I02 A;  4DYR A;  2DA1 A;  4GCV A;  3J80 K;  1FC3 A;  5FLX K;  4HEA 2;  4LFU A;  5K5R A;  1U0J A;  1ZLK A;  5HS8 A;  1MIJ A;  2K02 A;  2LBF A;  4C2T A;  2VUM J;  3FKI J;  3OS1 A;  2DOA A;  2GAU A;  1OMI A;  2Q2E B;  5FRO A;  2EFW A;  3DBL B;  3H35 A;  3ZN0 A;  1RES A;  1YYV A;  2JJ7 A;  1SFO J;  3SDB A;  2QSG X;  3GZ5 A;  3K4N A;  2YUS A;  4XOR A;  1HCR A;  3BG5 A;  5D6F A;  3OYK A;  1J5Y A;  1I3A A;  1Y6I A;  2XAQ A;  3DQV C;  2PMH A;  3R4K A;  5EEG A;  4EVI A;  1GT0 C;  2G9W A;  2L3D A;  2MYS A;  5K5Q A;  1W5C C;  2QZ8 A;  4XSX F;  3HOV J;  1DGR M;  3I59 A;  5TRD A;  1TWF J;  1G3S A;  2IW5 A;  3EYY A;  4B8X A;  4G7H F;  3W2W A;  2VT3 A;  1B6A A;  3SFI A;  2DYR H;  3FK6 A;  4ESB A;  5KNL A;  4HQE A;  1H88 C;  3EQL F;  5K7Z A;  1ZK8 A;  3W6K B;  1U78 A;  2RRE A;  4XKC A;  3HSF A;  1XC5 A;  1W5S A;  3RKY A;  5ICF A;  1D5Y A;  2RV8 A;  3CCJ I;  3K7A J;  5K7F A;  2CUE A;  1UEL B;  1VQ6 I;  1ZHF A;  1HW1 A;  2ZCW A;  1JT0 A;  2R5Y B;  1D1B A;  2RQQ A;  3HTU A;  3RKW A;  3DEE A;  1GUU A;  2EJR A;  4PFO A;  4HYE A;  3FM3 A;  4A3D J;  2M8E A;  2YX7 A;  2ID3 A;  3W2A A;  2O8X A;  1D3Y A;  5F1J A;  4B3X A;  3I54 A;  5KAI C;  1U5T A;  3VPR A;  4JX4 A;  5EG0 A;  1IV8 A;  3TOA A;  4YIF A;  5H2F C;  2W00 A;  3ML6 A;  2XAJ A;  3OSF A;  1GXP A;  1SFX A;  4BQA A;  2M5W A;  3HEF A;  4HST A;  5HDG A;  1R4M B;  2L7K A;  3DTK A;  2L4M A;  3IP4 B;  2OU2 A;  1VQ5 I;  1DU6 A;  4E70 A;  2BW3 A;  2NNY A;  2PQ8 A;  4GO1 A;  4G12 A;  3S3O A;  1YX5 A;  3ZQL A;  3ZQQ A;  3SZG A;  1TP4 A;  2V1U A;  1DPU A;  1E17 A;  2YX4 A;  3Q3S A;  1YRN A;  1YI2 I;  3T5X A;  4BHC A;  1SEU A;  2CQ7 A;  4IZZ A;  2GXA A;  2L9S A;  4ITV A;  3GTL J;  4WK8 F;  2V6E A;  1B59 A;  3BJA A;  4XK4 A;  2LRD A;  2M34 A;  3WTZ A;  2NVQ J;  3FX3 A;  2QEX I;  5D5V B;  1NG6 A;  4KIB A;  2GQQ A;  1MMD A;  1UFM A;  2K3F A;  4YFN F;  3AL0 B;  2BZT A;  2Y48 A;  5TIS C;  2JPB A;  1BM9 A;  3CJQ B;  4U0Y A;  3OS0 A;  2QWW A;  3BZC A;  2XB5 A;  1UHM A;  3DV8 A;  4RB3 C;  1STZ A;  1TQM A;  4D1Q A;  2NNN A;  2OUM A;  4BEH A;  3ERM A;  1FT9 A;  2XGX A;  1SVM A;  1WJD A;  2HKX A;  3NEU A;  2K27 A;  2MGQ A;  1JE8 A;  2EA2 A;  3KP3 A;  2K9M A;  2HVQ A;  3AAF A;  1UB9 A;  2LVS A;  1NG7 A;  2HXO A;  1BOB A;  3ABK H;  4RAZ A;  4DZP A;  1S7E A;  1OYI A;  3Q0V A;  2DI3 A;  2Z9O A;  3LSK A;  4HZF A;  3OL4 A;  3FMR A;  2MSY A;  2FBK A;  1RKT A;  3ZCO A;  3MN2 A;  4DYQ A;  4KN4 X;  1Z05 A;  1ETX A;  3LSG A;  4ENM A;  2ZME B;  5E1X A;  4Y33 A;  4XMY A;  2CV2 A;  2LY2 A;  4Q47 A;  3ZMS A;  2DCE A;  1JJ8 C;  2QA4 I;  1UMQ A;  1D0Y A;  3TW7 A;  3CF2 A;  1ZR4 A;  5E3L A;  2PMZ A;  3ZQ7 A;  3G3Z A;  3LOC A;  2XAS A;  3I58 A;  1V54 H;  3Q9S A;  1MZB A;  4BL0 B;  5BPD A;  2XF7 A;  3KP2 A;  4HLX A;  4RB0 A;  4XRS G;  1XCB A;  4XLA A;  3ZRG A;  2CJJ A;  3VB2 A;  5LHG A;  1FIA A;  1L3L A;  3WTX C;  2Z16 A;  4OIP F;  3KYD B;  3RSN A;  1W0U A;  2DA7 A;  4A3I J;  2VB6 A;  2WWY A;  1FJL A;  3HL2 A;  3WE3 A;  1MBF A;  1OIS A;  2R7S A;  2ECB A;  2M7B A;  3P7N A;  4NQW A;  2XSD C;  2LF7 A;  1SVO A;  4L0Z B;  5CQG A;  3PUB A;  4JYK A;  3NWT A;  4RS8 A;  3VWB A;  3K4L A;  5F6F A;  1WJE A;  2HKO A;  2A6T A;  3PQK A;  1Y8Q B;  2VI6 A;  3FZV A;  5F27 A;  4CYC B;  3T8R A;  1ENH A;  5EEA A;  3OYE A;  4S05 A;  5BMZ A;  1ONV A;  2WC2 A;  2ZBK A;  3BWG A;  4PSW A;  2HS5 A;  3HKZ A;  1R5G A;  3IKT A;  2M0M A;  1Q1H A;  5GPC A;  3OYH A;  3M3Y J;  1QVU A;  2CUJ A;  1IUF A;  5E79 C;  5FKN A;  1ZGA A;  1GDT A;  4GXO A;  2L4A A;  2AXL A;  1XGN A;  3BR0 A;  1IN6 A;  4I6Z A;  1HKT A;  2HQA A;  1HA8 A;  3JRF A;  5TGT A;  2R3S A;  4QPO A;  3CC2 I;  2M0C A;  1X19 A;  2QQ8 A;  2DMP A;  2YR2 A;  3K70 C;  4UUV A;  2EFQ A;  3ZXS A;  2VON A;  2KLO A;  1LQ1 A;  3ULQ B;  1VQN I;  1HW5 A;  1Z1D A;  4M9Z A;  1YW7 A;  1Z6R A;  4LLL A;  2H27 A;  2HTJ A;  4M6Y A;  1LFP A;  3BZ6 A;  3DCF A;  1Y1W J;  3QQA A;  2O3F A;  2BGC A;  2CFX A;  5HS7 A;  1V5F A;  2L7F P;  4A3G J;  4AVZ A;  3HRM A;  1V5G A;  2V1X A;  1QPM A;  1X58 A;  3P9K A;  1I5Z A;  1KA8 A;  3OMY A;  2IT0 A;  3HSE A;  3P5J A;  2GXG A;  1RZ4 A;  3MKW B;  1XMK A;  3TO9 A;  1EA3 A;  5FKM A;  9ANT A;  3DPU A;  2YPR A;  4OIQ F;  3K1M A;  2Y0M A;  1RRJ A;  2GIV A;  2A07 F;  2Y2Z A;  4UVB A;  4X6A J;  3FXM A;  2RN7 A;  2F5D A;  2MG4 A;  4J00 A;  4XRS A;  1OCZ H;  2DOD A;  2GIZ A;  4PJN A;  1B9M A;  4P9U A;  4U7B A;  1WWX A;  2KKO A;  3HOT A;  2M1B A;  1OYY A;  1LPQ A;  1Z77 A;  1G3T A;  1TLH B;  1X3W B;  5HLH A;  4Y4R A;  1D1A A;  4EMS A;  3ASO H;  3KPH A;  4G6D A;  4MQV A;  5FB2 A;  2PJR B;  3A02 A;  3CCM I;  4LLG F;  4HV6 A;  2KFD A;  2KZG A;  3IUO A;  2J5P A;  4PFP A;  1WHU A;  1IJW C;  3FHN A;  1IV6 A;  3PJR A;  3W2V A;  3NQO A;  2R7D A;  4GGG A;  1J2X A;  1XDS A;  2EV5 A;  2RGV A;  4DBQ A;  2EZL A; 
#chains in the Genus database with same CATH homology
 4G9Y A;  2H6C A;  4AVP A;  4BH9 A;  3IHU A;  1R22 A;  1FSH A;  3QPT A;  2PLY A;  4FHT A;  3WTS C;  1I6X A;  3GFI A;  2KJC A;  2CG4 A;  3RPQ A;  3F8C A;  4WX9 A;  3GO5 A;  2PJP A;  2OZ6 A;  1A04 A;  1F9N A;  1Z6T A;  4I7H A;  4CGZ A;  3E97 A;  2Z99 A;  3ABT A;  5DCM A;  2EFP A;  1T0F A;  2E1N A;  1MDM A;  3ELK A;  2GWR A;  3IRR A;  3BDD A;  1U6G A;  2BE5 F;  4AIH A;  1TW2 A;  1U5T C;  3QAH A;  3V8L A;  2KIF A;  4HDU A;  4HDV A;  1ZRC A;  4PGH A;  1SD6 A;  3GX4 X;  1K78 A;  2V9V A;  3TDZ C;  3QRF F;  2JPC A;  4RAY A;  2FBH A;  5FFZ A;  4Y17 A;  4JK1 X;  5J8C A;  1R5H A;  1FBS A;  2ETH A;  1EH8 A;  1I27 A;  3F8F A;  3LQR A;  4IRI A;  4PDK A;  2HWV A;  3V8J A;  2VOO A;  3OOP A;  3WGG A;  4CYD A;  2PI0 A;  1IN7 A;  1KQ8 A;  1ON2 A;  4AWX B;  2IVM A;  2Z5U A;  2KJB A;  3TGN A;  4P9F A;  1ON1 A;  2W24 A;  5JI6 A;  2LSO A;  1FWZ A;  4U0W A;  2XAH A;  5CJ9 A;  1J59 A;  3HRU A;  2F5E A;  1ZYR F;  3KLN A;  5E8I A;  3HTS B;  1RUO A;  1ZG3 A;  2LKP A;  2HYF A;  2HQR A;  1PUE E;  5ICG A;  4N0B A;  4PZJ A;  1G6N A;  4AIK A;  3WTW C;  1TBX A;  1FZP B;  1O57 A;  3I4P A;  1JHH A;  4HBL A;  3GZ6 A;  3FM5 A;  2KIU A;  1CF7 B;  2XRO A;  4UVA A;  2ZNY A;  2STT A;  4CXF A;  1UCR A;  4XSZ F;  1IXC A;  3F22 A;  2XRN A;  1FY7 A;  3RKX A;  3R60 A;  3FXR A;  1PDN C;  3B02 A;  2FMY A;  2TDX A;  1FPQ A;  3D5L A;  2FML A;  1QO0 D;  1IN8 A;  1BN5 A;  2K4J A;  3M8E A;  5J6X A;  3LFK A;  1WKM A;  1TQP A;  1JGS A;  1FX7 A;  3E3V A;  2ADU A;  1TNS A;  2ZO4 A;  1QBJ A;  5JFR A;  3DFG A;  4HQM A;  2OQG A;  4CZZ A;  3Q5F A;  2ACJ A;  2C6Y A;  2A69 F;  3E5X A;  4EQQ A;  3E6C C;  2M87 A;  3P9I A;  3ABU A;  2JT1 A;  5L3C A;  1QNT A;  3WOD F;  4M9S A;  1IF1 A;  3RPU A;  5LHI A;  3I59 B;  3HSR A;  5AIP A;  1W5T A;  1HBX G;  4LG0 B;  1R23 A;  4IJA A;  4M74 A;  3F6V A;  4EM1 A;  3RYP A;  4RGU A;  1LNW A;  3VFZ A;  1ZG1 A;  4RGX A;  4BNC A;  1HQC A;  2BBY A;  4MHG A;  3C1D A;  3GF2 A;  3WU0 A;  3BOQ A;  4WWC A;  2P6S A;  1P4X A;  4IRH A;  3E6D A;  2LDU A;  1D8J A;  3E5U A;  1SAX A;  2FBI A;  4ZH4 F;  1W7P D;  5ILS A;  4R1H A;  1IN5 A;  4QLC U;  5FD5 A;  3RYR A;  3MAJ A;  5L3F A;  3KEO A;  4BXU A;  4FT8 A;  2VE8 A;  2PG4 A;  2P8T A;  4OMZ A;  3QU3 A;  1BI3 A;  1YQA A;  3ECH A;  2H09 A;  4ENJ A;  4ASN A;  4O6J A;  3FF5 A;  1RUN A;  2HEO A;  1LDK B;  3SZT A;  3MZY A;  3J80 Z;  2Y75 A;  2IRF G;  2HYG D;  3LAJ A;  3F72 A;  4AD9 A;  1FNN A;  4Q48 A;  4I0B A;  4R79 A;  1DDN A;  2ESN A;  2A3S A;  4RGS A;  2H6B A;  4HW0 A;  3L9F A;  1KU2 A;  3KFW X;  5E1W A;  2YSR A;  1LB2 A;  1B1B A;  1FBQ A;  5D5X B;  1TQI A;  1W4M A;  2ZJ2 A;  2MH9 A;  1SFE A;  1P2F A;  1I1S A;  5IT3 A;  5ILU A;  2P5L C;  4UV8 A;  1SFU A;  1T2K A;  4G7Z F;  4ON0 A;  3WU1 B;  3ZMD A;  2FF4 A;  4EJU A;  2Q0O A;  3IC7 A;  4L9J A;  1K79 A;  2FSW A;  1XMA A;  3MCZ A;  1RIO H;  1BI0 A;  1J75 A;  5F1R A;  3E5Q A;  1KU3 A;  5CYV A;  3VEP A;  1YW9 A;  4G7O F;  5E20 A;  4L5I A;  1SD4 A;  3V7R A;  4A5M A;  2VBZ A;  2PN6 A;  3LA2 A;  3IKV A;  1QZY A;  1DUX C;  3QOP A;  1D8K A;  4M72 A;  1YO5 C;  4P96 A;  1U3E M;  2CO5 A;  3LA3 A;  2DLL A;  4EJT A;  1SMY F;  5CVJ A;  4LJZ F;  4LB6 B;  5HOO A;  3F8M A;  1GHC A;  3JW4 A;  4HOB A;  3RJP A;  4BAY A;  3ZMZ A;  3KP5 A;  1XSD A;  2FXA A;  3COA C;  4L5J A;  1S8N A;  3R61 A;  1IAW A;  3VOD A;  1KYZ A;  2QQB A;  2O03 A;  3C3W A;  2EFN A;  4MEY F;  3QU6 A;  1BC8 C;  4O3M A;  1KU7 A;  4LGW A;  1BBY A;  3OV8 A;  5HVQ C;  4EJV A;  2IPQ X;  2CGP A;  2MLK A;  3EET A;  2P7C B;  4ENN A;  2RC4 A;  1HKQ A;  3U1D A;  2J5O A;  3F6O A;  2X4H A;  2P7V B;  2COM A;  1FBU A;  3REO A;  3E6B A;  2OZU A;  2MLG A;  3WGI A;  5L3D A;  5JVT A;  4A0X A;  4U7D A;  2XAF A;  2FQ3 A;  2K7L A;  1F1Z A;  4RGR A;  1IW7 F;  4UHT A;  4KDP A;  3Q9V A;  1SD7 A;  3EUH A;  1R36 A;  1ZAR A;  1OPC A;  1YIO A;  1MDM B;  3GWZ A;  5E1Z B;  1Z9C A;  1IRG A;  3GUD A;  4ZYG A;  1YW8 A;  3ZPL A;  3DEU A;  5H6Q A;  3MZH A;  1SMT A;  4Y13 A;  4KMU X;  3WTY C;  4OIR F;  1BC7 C;  2P5K A;  4A5N A;  1HST A;  1K78 B;  3C18 A;  6PAX A;  5FD6 A;  2A61 A;  4RB1 A;  3I64 A;  1CGP A;  1ZAO A;  2RKH A;  5AON A;  4I01 A;  3TOB A;  5D8L B;  2FE3 A;  4CDG A;  4L0Y B;  3F8B A;  3BP8 A;  2JTV A;  2RVC A;  3CTA A;  3I0T A;  1B9N A;  1S3J A;  1KYW A;  4L9N A;  1U8R A;  2JRT A;  3I71 A;  2NYX A;  3RDI A;  1OKR A;  3DPL C;  4N9H A;  4Z2Y A;  3LWF A;  3F23 A;  4Y15 A;  3JTG A;  1BIA A;  2VT2 A;  2DK5 A;  1MJA A;  2DQR A;  3QPH A;  5F64 A;  4EM0 B;  4PCQ A;  4ZYH A;  3EDP A;  1KQ9 A;  3WGH A;  1EV7 A;  2E7X A;  2NRA C;  5D4S A;  3QP5 A;  4R8H A;  5HDK A;  2X0L A;  1Y0U A;  1W7P B;  4IHT A;  3L2C A;  5HLG A;  1F4K A;  4G6Q A;  5AIQ A;  1FP2 A;  2QLZ A;  1RI7 A;  2DO7 A;  2BYV E;  2FNP A;  4A6E A;  2IA0 A;  1P92 A;  3TQN A;  5H20 A;  4TV7 A;  3HUG A;  4LB5 A;  1S29 A;  5J8F A;  1R1T A;  2VN2 A;  5E18 F;  5JHU A;  3DF8 A;  3ISP A;  3GXO A;  1O7F A;  3KP4 A;  5ICE A;  1O3R A;  2A6H F;  3HOS A;  1HW2 A;  4N9I A;  4UV9 A;  4HA8 A;  2QEN A;  4HAM A;  2DU9 A;  1HXD A;  2FOK A;  1ZLJ A;  2ISY A;  3DPT A;  5L3G A;  4WXD A;  3T1B A;  2V79 A;  2IA2 A;  2G7U A;  3CUQ C;  2G7H A;  4JBA A;  3L09 A;  2VE9 A;  4A0Z A;  2F5F A;  2JZY A;  1IXR C;  3EYI A;  2A68 F;  3GFL A;  3JTH A;  4HV5 A;  1U2W A;  3HYI A;  4MEX F;  4GYG A;  2L02 A;  5LEK A;  1F5T A;  3S2W A;  1P4W A;  4WXH A;  2ZFW A;  4RB2 C;  4KN7 X;  2A6E F;  3WG9 A;  1WRJ A;  4ESF A;  3KCC A;  3K1P A;  3ECO A;  1QZZ A;  4ESJ A;  4U0V A;  3B73 A;  3NRV A;  1YLF A;  3F21 A;  2WTE A;  4GYI A;  2V6C A;  1FYM A;  2MC3 A;  1PP8 F;  2GA2 A;  4WCG A;  3IRQ A;  4H0E A;  5FGM A;  3KZY A;  4ETS A;  3JSO A;  4KNY A;  1WSU A;  3HRS A;  5DD8 A;  2PMU A;  4HX7 A;  1XB4 A;  4OIO F;  1V3F A;  1GVJ A;  2DPD A;  3BPX A;  3K1N A;  3FHZ A;  1YFH A;  2HFH A;  1EH7 A;  5LEJ A;  2K86 A;  1H0M A;  5K5O A;  3J81 K;  1XGS A;  2QYO A;  3CLO A;  1K7A A;  3FXQ A;  2DT5 A;  2P5V A;  1HSJ A;  3O2P E;  4HF2 A;  5HS9 A;  1FOK A;  2PBI A;  1FSE A;  2XAG A;  3LAP A;  1U5T B;  1HKS A;  3ZN1 A;  2IA1 A;  5DDG A;  4ENK A;  2P4W A;  1MJ9 A;  3SQN A;  2H94 A;  2D45 A;  1MGT A;  3CO6 C;  3M8F A;  1R7J A;  2HZT A;  3TO6 A;  2YU3 A;  4DNC A;  3D0S A;  3IWF A;  2BEO A;  1P6R A;  5KVR A;  1G3W A;  2F2E A;  3R0J A;  1KU9 A;  5DV5 A;  1T98 A;  1AWC A;  1MJB A;  2O0Y A;  2XIG A;  1ULY A;  4IHS A;  3K2Z A;  4LK1 F;  3IL2 A;  3HHH A;  5CVV A;  4XLN F;  3GFM A;  4M73 A;  1DP7 P;  3MQ0 A;  3N4M A;  5H6R A;  3V7S A;  3KE2 A;  5LRS A;  1G3Y A;  1OYW A;  3ZMV A;  4M71 A;  4IXA A;  2ESH A;  1LVA A;  4ZZL A;  2EK5 A;  1ZH5 A;  2A5Y B;  2VXZ A;  5BOX A;  2JSC A;  4UXN A;  3TDU C;  5D8K B;  5LHH A;  3GLX A;  5CVI A;  4D0P A;  3R6S A;  3RIR A;  2MD5 A;  2QBY A;  5HDN A;  3PQJ A;  3K0L A;  2UZK A;  1B4A A;  3T0Y A;  5D6E A;  2ZXJ A;  2HQN A;  4B09 A;  4CIC A;  2W57 A;  1XD7 A;  1BOA A;  2DK8 A;  3KZZ A;  4OMY A;  1T6S A;  4LG0 A;  1IZ1 A;  3HHG A;  2EB7 A;  1D5V A;  1TTY A;  5LGU A;  4KYW A;  2IJL A;  3ZP5 A;  4BHP A;  2K4B A;  2RDP A;  3M7G A;  3V4G A;  1RNL A;  1MKM A;  2CWE A;  4WXC A;  3E6M A;  2HDC A;  3GVA A;  4AIJ A;  2GXB A;  3IWZ A;  4I2O A;  4K2E A;  1FP1 D;  1X3U A;  1YG2 A;  2DFI A;  3MEX A;  1R58 A;  2QQ9 A;  3ZMU A;  2DW4 A;  1ZRD A;  5E17 F;  3KET A;  4KFC A;  2E1C A;  4FX4 A;  5K1Y A;  5CLS A;  4YG2 F;  1QQI A;  2IP2 A;  4NHJ A;  4O5V A;  2Z3Y A;  1WI9 A;  3W6J B;  4KIF A;  1NHA A;  2E7W A;  3WE2 A;  2QVO A;  3CUQ A;  3KLO A;  5HLI A;  1FYL A;  2ISZ A;  3WTT C;  3WTV C;  2KIM A;  4MQ9 F;  4ZYD A;  1ODD A;  3ROU A;  2M45 A;  3M1E A;  2MA3 A;  2VC0 A;  4OU0 A;  2BV6 A;  1H9T A;  2AS5 F;  4MTE A;  3O3K A;  3BPV A;  4MTD A;  4XLP F;  3BJO A;  1R1U A;  2QUF A;  1ZN2 A;  1YTY A;  4BHB A;  3DKW A;  2EA4 A;  2Q2E A;  2D1V A;  2VBW A;  5EEH A;  2L01 A;  4HX8 A;  1WQ2 A;  2P6T A;  4EV0 A;  3I53 A;  2UWM A;  3L7W A;  1LDD A;  5DUK A;  3J7A O;  2VOP A;  2CQK A;  2UXN A;  3V8K A;  5FFX A;  1PP7 U;  4U88 A;  2VOD A;  3H92 A;  5LRR A;  3MWM A;  2CW0 F;  2ELH A;  1Z91 A;  1H9G A;  4KUM A;  5DCM B;  3O6B B;  3M9A A;  4EGY A;  2FNA A;  1KGS A;  3G73 A;  1Z7U A;  5D4R A;  2D1H A;  2Z33 A;  1ZRF A;  2M30 A;  1GXQ A;  1USS A;  4NB5 A;  4P55 A;  3N97 A;  3SZP A;  4ZYE A;  1UHW A;  3H3Z A;  1XSX A;  5DD4 A;  1L0O C;  1XN7 A;  2OBP A;  4OOI A;  3U9G A;  3RI4 A;  1FLI A;  2LF8 A;  4G94 A;  1BJA A;  1KQ0 A;  5BQT A;  1LEB A;  4EGZ A;  5D5W B;  5CVU A;  4MGR A;  5LGT A;  2HTS A;  3GFJ A;  2O6G E;  5D5U B;  1AOY A;  3HIF A;  4HX4 A;  3BRO A;  4A6D A;  1FYK A;  2EFO A;  2NAZ A;  3I5U A;  4I09 A;  4KMF A;  4XRF A;  4KT5 C;  4CHU A;  1YS6 A;  3T8T A;  3V7C A;  1O3Q A;  1S7A A;  4HF0 A;  2ZKZ A;  3C7J A;  3FXU A;  1LEA A;  1LJ9 A;  4YFX F;  3SXY A;  3ZMT A;  2ZME A;  3KP7 A;  3CUO A;  4P5O A;  2DBB A;  4Q5S F;  5ERI A;  3KP6 A;  2V1D A;  2WV0 A;  3GW2 A;  1QGP A;  3CJN A;  5KK1 A;  1UST A;  1IXS B;  2QM3 A;  1XCV A;  3KEQ A;  4I98 B;  4A0Y A;  2MH2 A;  3MFK A;  5BS6 A;  4L9V A;  5E8G A;  3LST A;  2XHK A;  1O3S A;  2VC1 A;  1J9I A;  1I1G A;  2HR3 A;  1BI1 A;  4LMY A;  3H3U A;  2GZW A;  2FU4 A;  3WTU C;  3GEZ A;  3GYH X;  4F7Z A;  5L3B A;  3JAM Z;  3P9C A;  3LA7 A;  5IT9 Z;  5L3E A;  4LD5 A;  2EV6 A;  4UVC A;  3JAM K;  5IT9 K;  2XUB A;  2UXX A;  2W25 A;  2PEX A;  1O7L A;  2XKO A;  2FRH A;  5ED4 A;  1IUY A;  2W85 A;  3HRT A;  4LK0 F;  1E2X A;  4WF2 A;  1C0W A;  2DPU A;  3K69 A;  3CO7 C;  4UNO A;  2XV4 S;  5DUI A;  5LGN A;  1T39 A;  4LLN A;  1ZG5 A;  4YII A;  3RTR A;  1EH6 A;  2QQA A;  3SFZ A;  3FMS A;  4CO8 A;  4QWQ A;  3PFI A;  2D2W A;  2FA5 A;  3U2R A;  4S04 A;  3FMQ A;  2NS0 A;  5FO5 A;  4EJW A;  4OIN F;  4DQ2 A;  4IF4 A;  1R00 A;  2CSO A;  4KIG A;  2R7F A;  4EJO A;  2CYY A;  4Q4Z F;  3F8N A;  2KRF A;  2OD5 A;  4M6X A;  1S6L A;  1LDJ A;  1J7K A;  4HLY A;  3DP7 A;  1MD0 A;  3ERE D;  1K6O A;  2VBY A;  1T38 A;  4A2U A;  2FEZ A;  1G4D A;  1W7P A;  4MNU A;  1DPR A;  2EV0 A;  2VBX A;  2OQR A;  5CVR A;  4FX0 A;  5BPI A;  4KA4 A;  1XGM A;  3QP6 A;  4IVN A;  3JSP A;  1ZRE A;  4A12 A;  5ILV A;  3J81 Z;  3VOE A;  4JQF A;  1P4A A;  2OA4 A;  5LLQ A;  4L9T A;  1YS7 A;  1IN4 A;  2ZNZ A;  4BYY A;  1J0R A;  2QBY B;  3FWE A;  2HGC A;  2STW A;  1ZGJ A;  3DXJ F;  5TJJ A;  4IRG A;  2LNB A;  2DTR A;  1JXS A;  2F5C A;  1REP C;  3F3X A;  2XVC A;  1BI2 A;  1S7O A;  1SD5 A;  3LQQ A;  3K9T A;  3SHF A;  3BY6 A;  3TO7 A;  2B0L A;  4HF1 A;  5DCF A;  1TW3 A;  4PGG A;  1XDU A;  5JR3 A;  2EWN A;  4I0A A;  1IRF A;  5DYM A;  2HOE A;  5ICC A;  2W84 A;  1CF7 A;  2PFB A;  2RNJ A;  1XGO A;  3TKY A;  1R1V A;  4ZZD A;  4IPA A;  2OAZ A;  2GA1 A;  5LBQ A;  4L18 B;  2MBF A;  1VTN C;  1V4R A;  3R0A A;  1BIB A;  4EM2 A;  2RQP A;  4XBF A;  4YFK F;  4M9X A;  3CDH A;  2O61 A;  5DEQ A;  2DQL A;  3L00 A;  1JHF A;  3CUQ B;  2XKP A;  5A2Q Z;  3BJ6 A;  1O3T A;  5FLX Z;  1TNT A;  1XSV A;  2DAO A;  4G8X A;  2L54 A;  1OR7 A;  2Q8K A;  4KIC A;  5A2Q K;  4I02 A;  3J80 K;  4GCV A;  5FLX K;  1FC3 A;  4LFU A;  5K5R A;  1ZLK A;  5HS8 A;  2K02 A;  2GAU A;  1OMI A;  2EFW A;  3ZN0 A;  1YYV A;  3GZ5 A;  5D6F A;  1J5Y A;  3DQV C;  2XAQ A;  3R4K A;  2PMH A;  5EEG A;  4EVI A;  2G9W A;  2L3D A;  5K5Q A;  2QZ8 A;  4XSX F;  3I59 A;  5TRD A;  1G3S A;  2IW5 A;  3EYY A;  4B8X A;  4G7H F;  2VT3 A;  1B6A A;  4ESB A;  4HQE A;  3EQL F;  3W6K B;  1U78 A;  3HSF A;  1W5S A;  3RKY A;  5ICF A;  2RV8 A;  1ZHF A;  1HW1 A;  2ZCW A;  3HTU A;  3RKW A;  2EJR A;  4HYE A;  3FM3 A;  2M8E A;  2YX7 A;  2O8X A;  1D3Y A;  3I54 A;  1U5T A;  3TOA A;  4YIF A;  3ML6 A;  2XAJ A;  1GXP A;  1SFX A;  4BQA A;  2M5W A;  5HDG A;  2L4M A;  2OU2 A;  4E70 A;  2NNY A;  2PQ8 A;  4GO1 A;  2V1U A;  1DPU A;  1E17 A;  2YX4 A;  3T5X A;  4BHC A;  4WK8 F;  1B59 A;  3BJA A;  3WTZ A;  3FX3 A;  5D5V B;  4KIB A;  2GQQ A;  1UFM A;  4YFN F;  2Y48 A;  2JPB A;  1BM9 A;  4U0Y A;  2QWW A;  1UHM A;  3DV8 A;  4RB3 C;  1STZ A;  1TQM A;  2NNN A;  1FT9 A;  2XGX A;  2HKX A;  3NEU A;  2K27 A;  1JE8 A;  2EA2 A;  3KP3 A;  3AAF A;  1UB9 A;  4RAZ A;  1OYI A;  2Z9O A;  2DI3 A;  4HZF A;  3FMR A;  2FBK A;  4KN4 X;  1Z05 A;  4ENM A;  2ZME B;  5E1X A;  4Q47 A;  3ZMS A;  3ZQ7 A;  3G3Z A;  2XAS A;  3I58 A;  3Q9S A;  1MZB A;  5BPD A;  3KP2 A;  4HLX A;  4RB0 A;  1XCB A;  3VB2 A;  5LHG A;  1L3L A;  3WTX C;  4OIP F;  2WWY A;  3WE3 A;  3P7N A;  4NQW A;  2LF7 A;  4L0Z B;  4RS8 A;  5F6F A;  2HKO A;  3PQK A;  3FZV A;  3T8R A;  4S05 A;  5BMZ A;  1ONV A;  2WC2 A;  2ZBK A;  3BWG A;  2HS5 A;  1R5G A;  3IKT A;  1Q1H A;  1ZGA A;  4GXO A;  2L4A A;  2AXL A;  1XGN A;  1IN6 A;  1HKT A;  2R3S A;  2YR2 A;  4UUV A;  2EFQ A;  2VON A;  1LQ1 A;  3ULQ B;  1HW5 A;  1Z1D A;  4M9Z A;  1YW7 A;  1Z6R A;  4LLL A;  2H27 A;  2HTJ A;  4M6Y A;  3BZ6 A;  2O3F A;  2BGC A;  2CFX A;  5HS7 A;  3HRM A;  2V1X A;  1QPM A;  3P9K A;  1I5Z A;  1KA8 A;  2IT0 A;  3HSE A;  2GXG A;  1RZ4 A;  1XMK A;  3TO9 A;  2YPR A;  4OIQ F;  3K1M A;  2Y0M A;  2GIV A;  2A07 F;  4UVB A;  2RN7 A;  2F5D A;  1B9M A;  4P9U A;  4U7B A;  1WWX A;  2KKO A;  3HOT A;  2M1B A;  1OYY A;  1G3T A;  1TLH B;  5HLH A;  4EMS A;  5FB2 A;  4G6D A;  4MQV A;  4LLG F;  4HV6 A;  2J5P A;  3NQO A;  2R7D A;  4GGG A;  1J2X A;  1XDS A;  2EV5 A;  2RGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...