1DUXC

Elk-1/dna structure reveals how residues distal from dna-binding surface affect dna-recognition
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the elk-1-DNA complex reveals how DNA-distal residues affect ETS domain recognition of DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*AP*CP*CP*GP*GP*AP*AP*GP*TP*GP*T)-3')
total genus 26
structure length 86
sequence length 86
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1duxC00
2QVOA 4L0YB 5ED4A 4R79A 1FC3A 2DTRA 2FE3A 2MH2A 1IUYA 1JXSA 4NB5A 5A2QK 2XAQA 2QBYA 1DPUA 2HOEA 1ZG5A 4HAMA 3F8FA 4ZYEA 1U5TC 4EM1A 1P4AA 2PMHA 3V7SA 5JVTA 3P9CA 1KU9A 4HX8A 2PEXA 3GUDA 5L3GA 2XIGA 1BI3A 4IHSA 2D1VA 1O7LA 2FOKA 1YIOA 2JT1A 5AONA 5ILVA 5HDNA 2XUBA 2ZMEA 3N97A 2UWMA 2XAGA 1OPCA 1FSHA 1U6GA 4EGZA 1AWCA 1TQIA 4EJTA 2YX7A 1ZGAA 1K78B 3EYIA 3T5XA 3IL2A 4LK0F 4RB3C 4MNUA 2W85A 1HSTA 1E17A 4LD5A 4M9ZA 4PGHA 3R6SA 1J5YA 4G7HF 1KQ8A 3SQNA 2A5YB 3E6CC 3QP5A 3FX3A 5F6FA 2FMLA 4KN7X 4I98B 5FFXA 2XAFA 3DP7A 3F21A 5BPDA 4RGUA 4M6XA 3RJPA 2YR2A 4GO1A 3V4GA 3CTAA 5L3BA 4WK8F 3G3ZA 4YFNF 3P7NA 4OINF 1D8KA 3MZHA 5F64A 4LG0A 3P9IA 2XVCA 1DUXC 4HDVA 3ZN1A 3HSFA 1XCVA 2DO7A 4KICA 3E3VA 1BC7C 1O3QA 2A6HF 4Q5SF 3SZTA 4A6DA 4AVPA 4H0EA 1SFXA 4RB0A 4I02A 3F8NA 3ECHA 3U1DA 4L0ZB 2J5OA 3F72A 2NNNA 4OMYA 4U0WA 2WTEA 3MEXA 3ABTA 3HRSA 2ZMEB 1IXCA 2M87A 2GA1A 3J7AO 2XGXA 2ADUA 1HW2A 2M30A 4E70A 1T98A 1Z6TA 4L18B 3Q9VA 5ILSA 3F23A 1JE8A 3F6VA 2OA4A 2UXNA 2GIVA 2RGVA 1GXPA 2W84A 3OV8A 1Z6RA 4RB1A 1QZZA 3RYRA 5A2QZ 1HKQA 2VODA 5BPIA 1KA8A 2LDUA 1WKMA 1FWZA 5D8KB 4HQMA 1HKSA 4UVAA 2ISZA 5FO5A 3Q9SA 4LG0B 2RNJA 1P92A 2BEOA 4WXHA 2O8XA 4U0YA 2H09A 1ONVA 3KLNA 2IPQX 2EB7A 1BM9A 4HW0A 5FFZA 1YO5C 1FPQA 2EA4A 4UV9A 2L54A 4HQEA 5HLIA 2FBKA 2E1NA 3C1DA 1ZN2A 2RKHA 3V7RA 4ESJA 3FMRA 1QO0D 4S04A 5EEHA 4HF2A 3GZ5A 1VTNC 5D8LB 3EUHA 1EH8A 1DPRA 2K7LA 3C7JA 4UVCA 1K7AA 3BY6A 1D5VA 3KEQA 4AWXB 2VN2A 5TRDA 3R0JA 4Y15A 1J9IA 1WWXA 2VXZA 2FMYA 3P9KA 4LB5A 1BIAA 2F2EA 1HXDA 4CZZA 1W5TA 4DNCA 3HRUA 3C18A 5KVRA 1YW7A 1ZYRF 3QOPA 1IXSB 2FNAA 4ESBA 3RKYA 4UUVA 1R36A 5E17F 3F3XA 2FSWA 2KRFA 1S7AA 3MQ0A 4R8HA 2L02A 1KU7A 1T39A 2R7FA 3WTUC 3HUGA 2VE8A 4EM2A 1XSDA 1I6XA 2PN6A 5LGTA 2Z5UA 1MZBA 3WTWC 2E1CA 3B73A 2HQNA 2P5VA 4OU0A 1J2XA 3DPLC 3ISPA 3I59A 3M1EA 1WSUA 3NEUA 2ZKZA 1FSEA 3TO7A 1TLHB 4HDUA 2L4MA 5H6QA 3TO9A 1FNNA 4AIHA 4Q48A 5IT9Z 4ASNA 4RGXA 5J8CA 5D4RA 3ZPLA 3R4KA 3ZMUA 3BJAA 5LLQA 2VOOA 2MLKA 2A6EF 3FM5A 3IHUA 2RV8A 2XRNA 1MJ9A 3MFKA 1FX7A 4U88A 3F8BA 6PAXA 1TNSA 1IAWA 5CVUA 4G7OF 3LQQA 1LJ9A 5JI6A 2WV0A 3JTGA 3ZP5A 3ZQ7A 1G3WA 3CUOA 3L9FA 2K86A 1USSA 3BPVA 4OIRF 1FLIA 2RC4A 1IN7A 3ML6A 1FY7A 4I2OA 3RKWA 5FGMA 3WODF 4GYIA 2MD5A 3BP8A 4M74A 4EJWA 2DLLA 1NHAA 4G9YA 3D0SA 1HQCA 1LEBA 4CO8A 4HBLA 1Z05A 3GVAA 3BROA 1ZAOA 4YIIA 1YQAA 2Z33A 1KU2A 4IF4A 5FLXK 3CO7C 1G3YA 4EJUA 1B4AA 1S29A 5BOXA 1S6LA 2H6CA 1G6NA 4G6QA 3H92A 3FZVA 5E8GA 3QU6A 3DV8A 2D45A 5JFRA 3R0AA 2IRFG 3U2RA 3K9TA 2F5EA 3TOAA 2EK5A 3RKXA 2MA3A 2HYGD 4N0BA 1O3TA 1IN5A 4G8XA 1SD4A 3TQNA 4XSXF 4U7DA 3ZMTA 2FQ3A 2TDXA 4P55A 5HLGA 2X0LA 4M6YA 2A69F 3V8JA 2L4AA 4OOIA 3ZMDA 2GZWA 4YG2F 1CGPA 5LGNA 5F1RA 2CO5A 3KP6A 4G7ZF 2F5CA 1FYLA 1SMYF 2EFNA 1T6SA 2EV6A 4IPAA 1IN6A 1OMIA 2BE5F 2ZNZA 1D8JA 3WTYC 4WXDA 2UZKA 1HBXG 4ZZLA 5HDGA 4EJOA 3CLOA 2EFOA 3QPTA 1KYZA 4OIQF 4ZZDA 1B1BA 1UB9A 2H94A 4KUMA 4HLXA 3TO6A 1UHWA 4G6DA 4FX0A 1X3UA 2DT5A 3WU1B 1Z9CA 1U3EM 3WE3A 4NQWA 3JSPA 3GFIA 2RDPA 3FWEA 4LLGF 3GXOA 5JR3A 3T0YA 1TTYA 3BZ6A 1BN5A 3MWMA 3J80Z 2Z3YA 1LVAA 5L3FA 1W7PB 3JTHA 3ABUA 1O57A 3K0LA 1QZYA 2JPCA 1MKMA 1B59A 3WE2A 1TNTA 2FNPA 2CYYA 1ZREA 2Y75A 2HTJA 1XD7A 1PUEE 2IP2A 2O6GE 1J0RA 5CYVA 2L01A 1J75A 4MTDA 5HOOA 3K1MA 3HRTA 3GX4X 5LGUA 2O0YA 3J81K 5K5OA 3L7WA 3DQVC 1IRFA 2PQ8A 4EV0A 3F6OA 1U2WA 3I71A 1ZLJA 1ZG1A 1BC8C 1BI1A 4WX9A 4XLPF 2BGCA 3GYHX 5K1YA 3E6DA 2MBFA 1PP7U 3KZYA 3D5LA 1FT9A 1ZRDA 4HA8A 2OQGA 2YU3A 3PQKA 4R1HA 5AIPA 4U7BA 3B02A 1TQPA 2K4BA 3IWFA 5D5XB 3FMSA 2F5FA 2VT2A 1ON1A 4XRFA 1P2FA 4K2EA 3F8CA 1R22A 1FZPB 1XSXA 3GFJA 4L5IA 3BJOA 2X4HA 3E5QA 2FRHA 3I59B 1DDNA 1LDJA 1OYYA 2MLGA 3ULQB 4Q4ZF 2VT3A 2YX4A 1W4MA 2HR3A 4A0XA 1KQ9A 2E7WA 2STTA 1O7FA 5LEKA 1ON2A 2DW4A 2MC3A 2LF7A 2P7CB 3HYIA 2KKOA 1SAXA 3MAJA 2DK8A 5DCMB 2V1DA 1P6RA 2O3FA 4O6JA 1WRJA 5L3DA 3IKVA 4I01A 4IRHA 1UFMA 2VC1A 1ZRCA 4KIFA 2BV6A 1F4KA 5JHUA 2QQBA 1LB2A 4A2UA 1KYWA 4UHTA 4XLNF 1ODDA 3NRVA 3LFKA 4F7ZA 3LA3A 1MDMB 2DPUA 1H0MA 3NQOA 5DCFA 2KIFA 4P9FA 1IXRC 2XASA 2P5KA 3CDHA 1R5GA 4P5OA 2VBWA 4EQQA 4A5NA 4Y17A 1SFEA 1MGTA 1P4XA 2RQPA 2NYXA 4UV8A 1CF7B 3CUQC 3GFLA 4N9HA 1YS6A 2GXGA 1YS7A 5K5RA 2P7VB 1SFUA 3KEOA 5CJ9A 4DQ2A 3FHZA 2EV5A 1XDUA 2LKPA 1IZ1A 4CICA 4RGRA 4JK1X 1B9NA 3DFGA 3O3KA 3BPXA 4BYYA 3BOQA 2DK5A 3QAHA 4KFCA 1YW8A 4ZYHA 1MJBA 4MGRA 3DPTA 1IRGA 2FXAA 1UHMA 4HF0A 1T2KA 1JHFA 3HTSB 2V79A 2ZJ2A 1Z7UA 3H3UA 2K02A 1ZGJA 1FBSA 3L2CA 3IRQA 1IF1A 5BQTA 2GA2A 1J59A 2P8TA 5CLSA 3F22A 4PZJA 1RIOH 1D3YA 4HV5A 3HOSA 2JSCA 3QPHA 2ZXJA 5ICGA 2ZBKA 4L9NA 3V7CA 2GQQA 1OR7A 2LSOA 4HZFA 1XMAA 5HS7A 1FP1D 1KGSA 3AAFA 3HHGA 4CXFA 1SD6A 2QM3A 1F5TA 3RDIA 2XV4S 2NNYA 2EV0A 4WXCA 2A68F 4JBAA 4KYWA 5DUKA 3SHFA 3TOBA 2FF4A 4ZYGA 2ZO4A 2P5LC 4G94A 1YTYA 2OU2A 1R58A 2LF8A 4I0AA 1W7PD 4MTEA 2L3DA 5E1WA 2IT0A 4KA4A 4AD9A 2JPBA 4BH9A 4KMUX 2FU4A 4YIFA 1KU3A 2B0LA 1BI0A 4FHTA 3M7GA 3M8EA 2K27A 3SZPA 1ZARA 4TV7A 4ENMA 1W7PA 1RI7A 1AOYA 5E1XA 1OYIA 4KNYA 2ZNYA 1IW7F 5TJJA 1HW5A 5IT3A 5ICEA 2VBYA 4D0PA 4EVIA 1KQ0A 4MQ9F 2STWA 3JAMZ 3ZMZA 5LEJA 2V6CA 3O2PE 3K2ZA 1BJAA 4QLCU 4ENKA 5D6EA 1LDDA 4PCQA 1S3JA 3HTUA 1S8NA 5L3CA 2QLZA 2V1UA 4LK1F 2NRAC 1XB4A 1OYWA 4IXAA 3T8TA 3L00A 2PFBA 3V8KA 3K1NA 2JTVA 3JW4A 4LMYA 3SFZA 1ZLKA 4WCGA 2EJRA 3BWGA 2EA2A 3WU0A 4PDKA 5DCMA 4BQAA 1E2XA 2Y0MA 4I09A 5ILUA 2OZUA 3VFZA 3LSTA 2CW0F 3QP6A 1RUOA 2XROA 1TW2A 5KK1A 4A0ZA 2GXBA 1QPMA 1U5TB 2VBZA 3WTTC 2CGPA 2XKOA 4ESFA 3WTXC 3RYPA 5CVIA 4GGGA 2OZ6A 1I27A 5LHIA 3TKYA 5EEGA 4A12A 3E6MA 5HLHA 1LEAA 4EMSA 1XDSA 1LNWA 2YPRA 1DP7P 1O3RA 3PFIA 2KJBA 1RUNA 3FM3A 2DFIA 1ZRFA 2AS5F 4N9IA 1TW3A 3I4PA 2VONA 5ICFA 1L0OC 1HW1A 4XSZF 3EDPA 4KDPA 2XAHA 2DU9A 1Z1DA 4P9UA 5J8FA 3KLOA 1ZH5A 3WTZA 2M45A 3ECOA 2RVCA 4LJZF 5FLXZ 5FD6A 3LAPA 1XSVA 1F9NA 3RPQA 3QU3A 4CGZA 3KZZA 2DAOA 2PJPA 2FA5A 1XGSA 4B09A 3KP7A 4M9XA 1R1TA 2OQRA 3FXRA 2J5PA 5AIQA 4EJVA 5D6FA 2EFWA 2V1XA 3VB2A 4LLNA 1HKTA 3IKTA 2A61A 4LGWA 3KCCA 3I64A 3I58A 1BI2A 1P4WA 3LA7A 1BOAA 3LQRA 3CJNA 2G7UA 1G4DA 4XBFA 1QBJA 3GFMA 5HS9A 1PDNC 4KN4X 3ROUA 3HHHA 3KP3A 1S7OA 4HOBA 4RB2C 3REOA 1TBXA 4BXUA 4A5MA 3I0TA 4WF2A 4Z2YA 5DYMA 2ZFWA 3CUQA 1ULYA 2KIUA 2BBYA 2Q2EA 3W6JB 2E7XA 2P6SA 1K6OA 2ELHA 2XKPA 2COMA 4OIPF 2QYOA 5IT9K 2D1HA 2FBIA 3WTSC 4M71A 2VC0A 2IA1A 3QRFF 1QNTA 4MHGA 2LNBA 4CDGA 1T0FA 1YYVA 2YSRA 4PGGA 3U9GA 2ISYA 1YG2A 2QWWA 3KETA 2R3SA 4LFUA 2QENA 1FBQA 2QQ9A 2QUFA 1U78A 2CQKA 3M8FA 3FF5A 2HDCA 4JQFA 5FB2A 2QQAA 3J80K 5ICCA 3WGIA 4IVNA 1B9MA 5D4SA 4HX7A 4O5VA 3GW2A 3R60A 2CFXA 1WI9A 2WWYA 1R23A 3GO5A 2CWEA 2H27A 3ELKA 4LB6B 3J81Z 3Q5FA 3S2WA 4Y13A 1MD0A 2ETHA 4FX4A 1GXQA 2ZCWA 4I0BA 2XHKA 2V9VA 2JRTA 4BHCA 1I1SA 2GWRA 4HYEA 1H9TA 2EWNA 5DDGA 2G9WA 2AXLA 4ZH4F 4B8XA 3TDZC 2A3SA 4UVBA 3E5UA 3RTRA 3L09A 3ZN0A 2WC2A 4HX4A 1ZHFA 1JHHA 5D5WB 1IN4A 4M9SA 2Q8KA 3ZMVA 3HSEA 4A6EA 1O3SA 3KE2A 5CVVA 2M1BA 3G73A 3E5XA 4MQVA 4RAZA 1Q1HA 1RNLA 3DXJF 4ETSA 1FOKA 5LHHA 1A04A 1R1VA 3I53A 5LRRA 3GZ6A 4YFKF 2G7HA 1HSJA 1XN7A 1T38A 1FBUA 4NHJA 3LWFA 4M72A 3WG9A 5ERIA 5HDKA 4WWCA 5BMZA 3LA2A 4HV6A 2P4WA 3FMQA 1XGNA 3H3ZA 3KFWX 4KT5C 1WQ2A 3W6KB 4IHTA 2EFQA 3E97A 1MDMA 2HZTA 3R61A 4GXOA 2Z99A 5CVJA 3JSOA 3T1BA 5LHGA 5CVRA 5DEQA 2DQLA 3C3WA 2ACJA 1USTA 5H6RA 3BDDA 3FXUA 3OOPA 1Z91A 1V4RA 5LBQA 4L9TA 1XGOA 2W25A 4L9JA 1YFHA 2IA2A 4HLYA 3VODA 2ESNA 4GCVA 2IA0A 5J6XA 1OKRA 1SD5A 2EFPA 3HRMA 1PP8F 1MJAA 4EM0B 3O6BB 3MCZA 1STZA 4O3MA 2HFHA 3EETA 1G3SA 1SMTA 1K78A 2W24A 2HQRA 3FXQA 2M5WA 3DF8A 2P6TA 1BIBA 5DV5A 2Q0OA 4HF1A 4UXNA 3K1PA 4U0VA 5FD5A 5K5QA 3ERED 2Y48A 4Q47A 1JGSA 2KIMA 1REPC 3VEPA 3F8MA 3GWZA 3TDUC 1CF7A 5D5VB 4ENJA 3MZYA 5H20A 1I1GA 4MEXF 5DD4A 4AIJA 2PG4A 4ENNA 2FBHA 2H6BA 3IRRA 3I5UA 5LRSA 2HWVA 2PMUA 2PBIA 1YW9A 2HEOA 1V3FA 2IVMA 2VE9A 5DUIA 4QWQA 3CO6C 1TQMA 2QZ8A 3HSRA 2A07F 1IN8A 1I5ZA 5E1ZB 5HS8A 5DD8A 3HIFA 1B6AA 2DPDA 4BAYA 1R7JA 3RI4A 4IRIA 2W57A 3DKWA 1RZ4A 3KP2A 2NAZA 2HGCA 1LQ1A 2DBBA 4A0YA 4KMFA 3N4MA 5E18F 3JAMK 3GEZA 1R1UA 2RN7A 4KIBA 2Z9OA 2BYVE 2HS5A 1G3TA 3HOTA 2FEZA 4P96A 3I54A 2HYFA 4GYGA 2ESHA 3KP5A 5BS6A 1Y0UA 2F5DA 5E8IA 1J7KA 1EV7A 1LDKB 2NS0A 2PLYA 2M8EA 2C6YA 4IRGA 4FT8A 2GAUA 1K79A 4CHUA 2HTSA 4LLLA 3WTVC 1FYMA 3SXYA 3T8RA 3PQJA 4KIGA 3GLXA 4ZYDA 4OIOF 1GVJA 3DEUA 3VOEA 2R7DA 4YFXF 1SD7A 2QBYB 2UXXA 3RPUA 2K4JA 3ZMSA 2HKXA 2OD5A 1QGPA 4ON0A 3KP4A 3COAC 4BHBA 2KJCA 4RGSA 3WGHA 2OBPA 2MH9A 3EQLF 4CYDA 1XGMA 2DI3A 4EGYA 3K69A 3M9AA 3CUQB 2D2WA 2HKOA 1FYKA 2PI0A 5HVQC 3WGGA 2IJLA 1GHCA 2CSOA 4IJAA 4RAYA 5D5UB 2DQRA 2VOPA 1BBYA 1U5TA 2VBXA 3GF2A 3IC7A 3IWZA 3BJ6A 4L5JA 4RS8A 1UCRA 3TGNA 4M73A 1W5SA 4AIKA 1R5HA 1XMKA 4UNOA 4OMZA 2JZYA 1QQIA 3RIRA 5L3EA 3LAJA 4I7HA 1FP2A 4L9VA 3V8LA 1F1ZA 1XCBA 1H9GA 1YLFA 3E6BA 2CG4A 4S05A 2OAZA 4BHPA 4MEYF 5E20A 3EYYA 1EH7A 2O03A 1ZG3A 2IW5A 2O61A 2XAJA 1EH6A 1C0WA 1R00A 4BNCA 1U8RA 1L3LA
chains in the Genus database with same CATH superfamily
2BZTA 2VKHA 2QVOA 4L0YB 2O5RA 5ED4A 4R79A 1RR7A 1FC3A 2WY8Q 5JLXA 3LNQA 2DTRA 2OC6A 1IV6A 2BY0A 2FE3A 2R5YB 2MH2A 3JRAA 1IUYA 1JXSA 4NB5A 4LIUA 5A2QK 2XAQA 2QBYA 1DPUA 2HOEA 1GDTA 1ZG5A 4HAMA 3F8FA 5M3FJ 4AYBN 1X1BA 2LP0A 4ZYEA 1U5TC 4EM1A 3KIOA 5IYCJ 4PJMA 1P4AA 4PJLA 1HC8A 2Y69H 2PMHA 3V7SA 2OTLI 5JVTA 1ACIA 3BCAA 4E6KG 3K4LA 3P9CA 1KU9A 4HX8A 2PEXA 5HNFA 2E2IJ 3GUDA 2LBFB 5L3GA 1LFUP 1XS9A 2XIGA 1BI3A 1ORKA 1POGA 1O7LA 2D1VA 3WU2C 4IHSA 2FOKA 1YIOA 2JT1A 4X6AJ 5AONA 5ILVA 5HDNA 5FRNA 2XUBA 2ZMEA 3N97A 2DMUA 2UWMA 1A31A 2XAGA 3AKZA 1OPCA 1FSHA 1U6GA 4EGZA 3KYDB 1AWCA 1TQIA 4CCJA 5J40A 4EJTA 2YX7A 4BY7J 4RM3A 2K9NA 2JA7J 3OS1A 1OCRH 3QQAA 1ZGAA 1ETXA 4GRIA 2X6XA 1Z77A 5TISC 2CJJA 1K78B 3EYIA 2EIMH 4UUTA 2WADA 3T5XA 3IL2A 1NTCA 4OAZA 3K4KA 4LK0F 4PUSA 4RB3C 4MNUA 3FHNA 2W85A 2Z2SB 1VQ4I 1QZEA 1HSTA 1E17A 4KITB 2JQ7A 1Y8RB 1R49A 4LD5A 2KDOA 4M9ZA 4PGHA 3R6SA 3MKWB 4ZTFA 3IAS2 3AG1H 3PUBA 4N4NB 5B1AH 1J5YA 4G7HF 4IKFA 1R6RA 1KQ8A 3SQNA 4I99C 2A5YB 3JRHA 3QP5A 3E6CC 1RR8C 2CS3A 3FX3A 5F6FA 2FMLA 2HDWA 4KN7X 4I98B 5FFXA 2IGNA 2KMUA 1MNDA 2E36A 3I55I 4CCOA 2XAFA 2XAUA 3DP7A 3F21A 5BPDA 4RGUA 4M6XA 3RJPA 5KHDA 2YR2A 4NBQA 3A02A 2Z16A 3OR1C 4V19K 4PJJA 4GO1A 3V4GA 3CTAA 3Q0UA 5L3BA 4V2FA 4WK8F 3G3ZA 3U21A 4YFNF 3P7NA 4OINF 1D8KA 1ETQA 3MZHA 1FOWA 5F64A 4LG0A 1UAAA 3P9IA 2GLOA 3ZXSA 3WG7H 4XORA 1VQOI 3BG9A 5M3MJ 1QPIA 4Y3OA 2X85A 2XVCA 1DUXC 4HDVA 4AU7A 3ZN1A 3GTMJ 3HSFA 1XCVA 1RC9A 2DO7A 4KICA 1VZ0A 3F9KA 2NVXJ 3OYEA 2W48A 2WAFA 3E3VA 4XR6A 1LE8B 1BC7C 1O3QA 3VPRA 3HPGA 2A6HF 2F4OB 4Q5SF 3SZTA 1FMVA 2VASA 4A6DA 3HC7A 3L2RA 4AVPA 4D1QA 2WAQN 4H0EA 1SFXA 4RB0A 4I02A 2BVLA 3F8NA 2ICWG 4BDYA 3ECHA 3RSNA 3CCRI 1W36D 5IYDJ 4OMYA 2IS6A 2OPTA 1X3WB 3U1DA 4L0ZB 2P81A 2LFBA 5EZGA 2KLOA 4NQWB 4ZDLA 1TT5B 4IHYA 2J5OA 3F72A 2NNNA 4M3FA 5IOYA 4F3QA 3PJRA 4U0WA 4IHVA 1D1CA 2WTEA 3MEXA 4XQFA 1SEUA 2L7FP 3DTKA 4E4HA 3ABTA 3HRSA 2ZMEB 1R4MB 1IXCA 2M87A 2GA1A 3J7AO 4IHWA 4XMYA 2W4SA 2LRDA 2XGXA 4JX5A 3ZOBA 2ADUA 1JUMA 3L2WA 1HW2A 2M30A 4E70A 5J4YA 4BJ5C 1T98A 1Z6TA 4L18B 3Q9VA 4RM2A 1NK2P 2Y2ZA 5ILSA 4GFBA 3S93A 3F23A 1JE8A 5B66C 1WPKA 3F6VA 3S1QJ 3MN2A 2OA4A 4RA2A 2UXNA 2B63J 2GIVA 2RGVA 1GXPA 2ECCA 2IS4A 2F4MB 1MW7A 2W84A 3HJEA 3TMOA 4NUBA 4IOAF 3OV8A 4MFDA 1Z6RA 4RB1A 1QZZA 3RYRA 1YJWI 5A2QZ 1HDPA 1HKQA 2RNGA 2BXZA 1N25A 2IGOA 2VODA 4QTRA 5BPIA 1KA8A 2DCEA 2LDUA 4JX6A 1WKMA 1FWZA 4ANJA 4C3HJ 4F91B 1FMWA 4UUSA 3L1PA 3A2KA 3BR2A 3AG2H 2VXDA 5KCMA 5E3LA 3LSMA 2ZXIA 5D8KB 4HQMA 4A69C 1HKSA 4UVAA 3LSJA 2ISZA 3H36A 3FIWA 3H5AA 5FO5A 3PSIA 3K4CA 3Q9SA 2GXAA 3OYLA 2E34A 1X1DA 4G12A 2RNJA 2L2OA 4EEFG 4LG0B 1P92A 2BEOA 4WXHA 2O8XA 4U0YA 2H09A 3OY9A 1ONVA 3G6EI 3GTGJ 2V26A 2MW8A 1ENHA 3KLNA 2P0WA 2IPQX 3H0DA 4LIVA 2EB7A 1BM9A 1IDYA 4HW0A 5FFZA 3LSRA 4XNFA 1YO5C 1FPQA 2EA4A 4UV9A 2QCOA 2L54A 4HQEA 2VQHA 5HLIA 2FBKA 1WJFA 2E1NA 3C1DA 4PSWA 1ZN2A 2RKHA 3V7RA 4ESJA 4XKVA 3W3CA 3FMRA 3E0JB 4XIDA 1QO0D 2BOLA 4S04A 5EEHA 4HF2A 3GZ5A 1Y8QB 1VTNC 2VUMJ 5D8LB 3EUHA 1EH8A 1DPRA 3LSPA 3AG3H 4FISA 4A3CJ 1TWAJ 1V5EA 2HZDA 2CQ7A 2K7LA 3C7JA 2LG4A 4UVCA 1K7AA 2BY1A 3C2BA 1H8AC 3BY6A 4BJTA 1D5VA 1ETVA 3KEQA 2HI3A 4AWXB 2VN2A 5TRDA 3FBNB 1P9QC 3R0JA 1XPXA 4Y15A 4CCKA 4M3DA 2K5CA 3G1LA 2E2HJ 1J9IA 1BR4A 4CYCB 1WWXA 2VXZA 2FMYA 3P9KA 2E5NA 4LB5A 1VQ5I 2XRLA 2ID3A 1BIAA 2F2EA 1HXDA 4CZZA 2HVSA 1W5TA 4DNCA 2EZLA 3HRUA 4XKBA 3KYLA 1LFBA 3C18A 5KVRA 1BOBA 1YW7A 2DA3A 4IL6C 1ZYRF 3QOPA 1IXSB 2FNAA 1BA5A 4ESBA 3RKYA 2CV0A 4UUVA 2V7FA 1R36A 5E17F 1P7IA 3BR3A 3F3XA 2E2JJ 2FSWA 2E60A 2KRFA 1S7AA 3ESWB 3MQ0A 2CV2A 4R8HA 2Y9YA 2L02A 1KU7A 4DIQA 3P5JA 2UUZA 4YRVA 2R7FA 1T39A 5HNHA 3WTUC 2JA6J 5E79C 1IJWC 2WB1N 3HUGA 4HNUA 1A6IA 1VNDA 2VE8A 4EM2A 3L2UA 1XSDA 1YITI 4II2A 1I6XA 1IRXA 2PN6A 3K7AJ 5LGTA 2KRCA 2Z5UA 4A3JJ 1MZBA 3GTJJ 3WTWC 1DU0A 1JI8A 4I6ZA 2E1CA 4X0GA 3UKGA 3B73A 2HQNA 2W00A 2X9DA 3A0HC 5EJCA 1L3LA 2P5VA 3S32A 1V5GA 3KPHA 1J2XA 4OU0A 3ZQLA 3DPLC 5GAEJ 3ISPA 3I59A 3K6GA 2E1OA 2DJNA 3M1EA 1WSUA 2VB6A 2L9SA 3NEUA 2VKVA 5F08A 4Y7NJ 2ZKZA 1RESA 1FSEA 3TO7A 1IG7A 3S1RJ 1TLHB 2NOGA 1JJ6C 4HDUA 2L4MA 2KL4A 4B48A 2XGDA 3OIQA 5H6QA 3TO9A 1X3ZB 1FNNA 2JUGA 3K4BA 1GT0C 4W1UA 4HG2A 5CPRB 4AIHA 4Q48A 1ITYA 4CZCA 3PO2J 5BNGA 2DA5A 5CQGA 5IT9Z 3G71I 4ASNA 3A01B 4BUPA 4RGXA 3OYHA 5C44J 5J8CA 5D4RA 3ZPLA 3R4KA 3ZMUA 3S3MA 3BJAA 5LLQA 2VOOA 2MLKA 2DA2A 5E3OA 1W5CC 2M9HA 2A6EF 3DKXA 2DA7A 3FM5A 3IHUA 3QYEA 2RV8A 2XRNA 4LITA 2HOSA 1MJ9A 3CESA 3G2BA 1F43A 4XN0A 1WCMJ 3MFKA 1FX7A 4U88A 2R5ZA 3F8BA 3S15J 6PAXA 1TNSA 1IAWA 1B72B 1XX5A 5CVUA 4G7OF 3LQQA 5B3SH 5KNLA 4A3DJ 3OYJA 1LJ9A 3GMEA 2DODA 5JI6A 3D5RC 2WV0A 3VWBA 3H5NA 2HOTA 2HU9A 4E7IA 4B1RA 1AU7A 3JTGA 3ZP5A 1MNMC 5DM6F 3L2QA 3ZQ7A 3CCQI 1G3WA 3CUOA 3IH2A 3L9FA 2K86A 1USSA 2DDBA 3BPVA 3I9V2 4OIRF 2XGEA 5EG0A 1SVLA 1FLIA 2RC4A 1IN7A 3ML6A 1FY7A 2M4GA 4I2OA 1KZHA 4PFOA 3RKWA 2OTJI 5FGMA 1K4SA 1HCRA 3WODF 3I56I 4GYIA 1FTTA 2MD5A 2GM4A 2YS9A 4IO9F 3BP8A 4M74A 3ASOH 3DTEA 4EJWA 2DLLA 2ID6A 2W7NA 1NHAA 4XL9A 1P7JA 1I3QJ 2E1MB 4G9YA 3D0SA 2CUZA 1HQCA 1LEBA 4CO8A 4AIDA 1YHQI 2GOMA 4HBLA 1Z05A 4HNTA 1BW6A 3GVAA 3BROA 1ZAOA 4L5EA 5IOZA 4YIIA 2D5VA 1YQAA 2Z33A 1KU2A 4IF4A 4PSXA 5FLXK 3H5RA 3CO7C 3MKYB 3NAUA 1G3YA 3PUFA 1X4PA 4EJUA 4IZZA 1B4AA 1S29A 5BOXA 4XLAA 1S6LA 4AYBA 1I39A 2H6CA 1G6NA 4G6QA 1WJ5A 4J19A 2X1CA 3H92A 3FZVA 5E8GA 4J00A 4CCLA 3QU6A 3S8PA 2MGQA 3DV8A 1NK3P 2D45A 3CCVI 3ZQIA 1V55H 5JFRA 5J1UA 3R0AA 2IRFG 3U2RA 3K9TA 2F5EA 3TOAA 4RAFA 1S72I 3QODA 2EK5A 3RKXA 2DA6A 2MFZA 3GTPJ 5FJ8J 2MA3A 4XICA 2HYGD 4N0BA 2R7WA 1O3TA 4BKXA 1IN5A 3MD2A 4G8XA 1SD4A 3TQNA 4XSXF 4U7DA 3ZMTA 2FQ3A 2TDXA 2DA1A 4P55A 3TP0A 2NS8A 1W1WE 5HLGA 2X0LA 5TGTA 1ZGWA 1SVOA 3OOUA 4UUSB 4CCNA 4M6YA 2GOXB 1TWGJ 2A69F 1JKQC 3A01A 2VJJA 4FE7A 1Y1WJ 3V8JA 4PJNA 2LD5A 2L4AA 1Z21A 4OOIA 3ZMDA 5HLTA 3CCEI 2XC7A 2GZWA 4IQJA 2EQRA 4YG2F 1CGPA 2I10A 2VIXA 4DZJA 1QA6A 5LGNA 5F1RA 2CO5A 3KP6A 2E1MC 3HDDA 4G7ZF 2EZIA 2F5CA 2N8GA 1FYLA 2E19A 4CCMA 2COBA 1SMYF 2EFNA 4C2UA 1T6SA 2EV6A 1K4TA 1TT0A 4IPAA 1IN6A 1OMIA 2BE5F 3CP2A 2ZNZA 1D8JA 2IBDA 3WTYC 2K9SA 4C9YA 4DW6A 4WXDA 2R7OA 2UZKA 1HBXG 2JA5J 4ZZLA 3OYAA 4C3IJ 1MH4A 5HDGA 4EJOA 3CLOA 2EFOA 3QPTA 1KYZA 3OYIA 4OIQF 3M1CA 4ZZDA 1B1BA 1UB9A 2H94A 4KUMA 4HLXA 3TO6A 1UHWA 1WJBA 3LSHA 2HOAA 4G6DA 3E7LA 5KAFC 4MFEA 4FX0A 1X3UA 1TZLA 2DT5A 3WU1B 1Z9CA 2V4JC 2E35A 4BU2A 2HPMA 1U3EM 3OL3A 3ZGKA 2XDVA 3WE3A 2FQ4A 4NQWA 3JSPA 3GFIA 3FK7A 2RDPA 2VI6A 1X2MA 2DTZA 1VQ7I 1ETOA 3MMYB 3FWEA 3HB9A 3TP3A 2Y0SN 2NXNB 2UV1A 2ZC2A 4LLGF 2L9VA 3TW6A 2HYJA 1MSFC 3GXOA 5JR3A 3T0YA 1TTYA 1A36A 3BZ6A 3SEQA 1BN5A 2LY9A 2X1DA 3MWMA 2XSDC 3J80Z 2Z3YA 1LVAA 2YUSA 5L3FA 1W7PB 3JTHA 3ABUA 2LBFA 1PUFA 4ITVA 2IXSA 3PNTA 1ZR4A 1O57A 3K0LA 3MZ8A 1QZYA 3QYFA 2JPCA 3HKZN 1MKMA 1B59A 1OCPA 3WE2A 1TNTA 2FNPA 2CYYA 4KJZA 1ZREA 3W6VA 2V6EA 2Y75A 2HTJA 1XD7A 1PUEE 3GTKJ 1X1PA 1Z3XA 4NC7A 4RLQA 3O8HA 3OYDA 1R9TJ 2VQGA 2IP2A 2O6GE 1J0RA 5CYVA 2L01A 3IH3A 1J75A 1WH5A 4PFPA 3RZOJ 1LUJB 4MTDA 5HOOA 2R7SA 3K1MA 3HRTA 2DOEA 3GX4X 5DTDA 5LGUA 4C2MJ 3H35A 4MIMA 2O0YA 3S17J 2JRMA 3BTJA 2DFHA 2JMWA 3M8JA 2JN6A 3J81K 5K5OA 1VQ8I 3L7WA 3DQVC 4B4CA 2R4GA 1IRFA 1TWFJ 2PQ8A 4EV0A 5M5YJ 2WB1A 2A6TA 3F6OA 1Y39A 2X6WA 1U2WA 3I71A 1ZLJA 1X1CA 4RAGA 3BR0A 1FIPA 1ZG1A 3K4JA 1BC8C 1BI1A 4WX9A 1SAUA 4XLPF 2BGCA 3B6CA 3HGYA 3GYHX 5K1YA 2Y9ZA 3KEYA 2Y31A 3E6DA 2MBFA 4M3BA 1GV2A 4B47A 1PP7U 3KZYA 3D5LA 1FT9A 5F0FA 2VPRA 2KIQA 1ZRDA 4KISA 4HA8A 2OQGA 1UELB 5JVGF 2YU3A 3PQKA 4R1HA 4FQGA 5AIPA 4U7BA 3JRFA 3DKYA 3OYKA 1T33A 3B02A 2CUFA 3A1YA 1TQPA 5K7ZA 2K4BA 2PMZN 3IWFA 5D5XB 1ZKGA 3FMSA 1ETKA 2F5FA 5F0CA 2VT2A 1ON1A 4XRFA 1P2FA 1G8XA 2FOWA 3G1MA 4K2EA 3F8CA 5IP6A 1R22A 4ZC3A 1SFOJ 1XSXA 1HLVA 1FZPB 2YU9J 3GFJA 2BY3A 3D1NI 4L5IA 3BJOA 2QSFX 2X4HA 3HOVJ 3E5QA 3DEEA 2FRHA 2XPUA 3I59B 5DM7F 1DDNA 1LDJA 1EA3A 1OYYA 1S5LC 2AO9A 2MLGA 3ULQB 4Q4ZF 2VT3A 2YX4A 1MBJA 4OAYA 1AKHA 3DCFA 5JLWA 2WY7Q 4KT6A 4ZYAA 3CZ6A 1W4MA 2HR3A 1MMNA 2DFFA 3I3LA 4A0XA 1KQ9A 3S2DJ 2E7WA 2STTA 1O7FA 5LEKA 2ELKA 1ON2A 1U0JA 1T08B 2DW4A 3PNYA 2R7XA 4BDZA 2MC3A 4PK4A 2HNHA 2LF7A 3HOWJ 1N78A 2LVSA 2P7CB 3HYIA 1OJLA 2KKOA 1IRZA 1SAXA 1JKRC 2B7EA 3MAJA 1UG2A 4A93J 2EPFA 4CA0A 2DK8A 5DCMB 2AQFA 3D5SC 3PM1A 3N05A 4XOPA 4BL0B 4DJAA 5HODA 2V1DA 1YI2I 1YX3A 1P6RA 2O3FA 4A3LJ 4O6JA 2VJIA 4CSWA 4JX4A 3IV5A 1WRJA 5L3DA 4MO7A 3IKVA 1HF0A 4I01A 4IRHA 5FKNA 1UFMA 1Y6IA 1OCOH 1SC7A 2QSHX 2VC1A 1ZRCA 2VLAA 2NS7A 4KIFA 2MYSA 2BV6A 1F4KA 2R5ZB 2CUJA 5JHUA 4C30A 4IHXA 2X1EA 2QQBA 1LB2A 3L2VA 4A2UA 1KYWA 2IS1A 4UHTA 4XLNF 5K7HA 1ODDA 4BBRJ 3NRVA 3HG9A 1OCZH 1ZR2A 3LFKA 2FUG2 3VSLA 2R7RA 4XOTA 4F7ZA 1FIAA 3LA3A 1MDMB 2DPUA 4XKWA 2HQAA 1H0MA 3NQOA 5DCFA 2KIFA 1ETYA 1X1AA 4P9FA 4D5CA 1IXRC 4D7MA 2XASA 4AUXA 2EZKA 3NARA 2P5KA 3CDHA 1VI0A 1VQ9I 3QPLA 1R5GA 4P5OA 2VBWA 4EQQA 1X19A 4A5NA 4Y17A 1SFEA 1MGTA 1QVTA 1N77A 1FJLA 1P4XA 2TCTA 2RQPA 2NYXA 4UV8A 1CF7B 4YEJA 4Y33A 3CUQC 4E7LA 2HDDA 3GFLA 1LPQA 2V9KA 1IV8A 1JUPA 2QGUA 3OIPA 4BJ6C 5FKMA 3ERMA 3FK6A 3TBIA 3MKLA 1YS6A 2GXGA 4N9HA 1Z3YA 1YS7A 5K5RA 1GVDA 2P7VB 3FISA 1SFUA 3KEOA 2MABA 5CJ9A 4DQ2A 2XSJC 4BY1J 1DP3A 2K3FA 3FHZA 2M4KA 2WAQA 2EBIA 2BHYA 1XDUA 2EV5A 2LKPA 1IZ1A 4J01A 4A3GJ 1YRNB 2PX9A 2JUCA 5JHFA 1TC3C 2DYSH 4CICA 1WH7A 4RGRA 4JK1X 1B9NA 2KISA 5EZHA 2NVYJ 2LY2A 4DOZA 3ZR8X 3DFGA 1MH3A 3O3KA 2XF7A 4Y4RA 3BPXA 4BYYA 3BOQA 2DK5A 3QAHA 4KFCA 1GUUA 1YW8A 4W97A 4ZYHA 1MJBA 4MGRA 3CCLI 2QF7A 3DPTA 1IRGA 4IX7A 2FXAA 1UHMA 4HF0A 3ZQFA 1T2KA 2LC2A 5GADJ 1JHFA 3HTSB 2V79A 2ZJ2A 1Z7UA 3H3UA 3DWLE 1R71A 3PIOF 2K02A 3CMMA 2AQEA 3G4SI 1ZGJA 1FBSA 3JRBA 1U9OA 3L2CA 5EG0B 3IRQA 1IF1A 5GAGJ 5BQTA 1JKPC 2Y30A 3ABKH 1WJAA 2BW3A 3V42A 4F92B 3KZIC 2GA2A 2MD0A 5EEAA 2P8TA 1J59A 5CLSA 1VQLI 3F22A 1R4NB 1E3PA 4PZJA 4FETA 1RIOH 1D3YA 1O4XA 4BE2A 1MSEC 5C4JJ 2QSGX 4HV5A 4M3GA 3HOSA 1X2NA 3GTOJ 2JSCA 1H89C 2F48A 4NC8A 3QPHA 2ZXJA 1XG1A 3DBHB 5ICGA 1YX5A 2ZBKA 4L9NA 5M5XJ 3V7CA 2GQQA 1D1AA 1OR7A 3PSFA 2LSOA 3NWSA 1XMAA 4HZFA 4H4KC 5HS7A 3Q0VA 5K7FA 4XRSG 1FP1D 1KGSA 3AAFA 3HHGA 3TW7A 4CXFA 1SD6A 1OFCX 2DMTA 3DBLB 2QM3A 5J3LA 1F5TA 3RDIA 2XV4S 2NNYA 5FKLA 3B6AA 2EV0A 1X58A 4WXCA 2A68F 2KRHA 3FXOA 4JBAA 4KYWA 5DUKA 2V1NA 3BR5A 3SHFA 4NNJA 2ZJQF 1TP4A 3TOBA 1ZK8A 2FF4A 4ZYGA 2ZO4A 2P5LC 5IP7J 4G94A 3ONQA 1KONA 1YTYA 2OU2A 1R58A 2LF8A 4I0AA 3OYFA 4Y52J 3BG5A 1W7PD 2KQRA 4MTEA 1TWCJ 2L3DA 5E1WA 3CMAI 4F52A 1SVMA 2IT0A 4KA4A 3OL4A 4AD9A 2JPBA 4BH9A 4KMUX 2FU4A 1QHGA 3K70D 4YIFA 1KU3A 3VYRB 4DBQA 2QA4I 2B0LA 5EGOB 2ECBA 5FROA 3GCMA 1BI0A 4FHTA 2XGCA 3IAM2 3M7GA 4MLOA 5M5WJ 3M8EA 2K27A 1V54H 3SZPA 1ZARA 4Z6YA 3LOCA 4TV7A 4ENMA 1A5JA 3CJTB 1W7PA 1RETA 1RI7A 3BQYA 1AOYA 2CRGA 2CUEA 1XTAA 5E1XA 1JT6A 1OYIA 2F6CA 4KNYA 3AL0B 2ZNYA 1IW7F 2XF5A 3JRGA 5TJJA 1HW5A 5IT3A 5F0HA 2R93J 5ICEA 2VBYA 4II3A 4E7SA 4D0PA 4JOMA 1OR7C 1KQ0A 4EVIA 3K10A 3LSKA 4MQ9F 2STWA 2G0EA 3A0BC 2IAIA 2QKMB 3SFIA 2JJ7A 3JAMZ 3ZMZA 5LEJA 2V6CA 2PMZA 3CQZJ 5E3NA 3O2PE 2M2EA 1SFKA 3K2ZA 1TL8A 2R7VA 2LKSA 1BJAA 4S0HB 4QLCU 5LD2C 4ENKA 5GTIC 5D6EA 1LDDA 4PCQA 1S3JA 3HTUA 2JA8J 1S8NA 5L3CA 2QLZA 2V1UA 4A3FJ 4LK1F 2NRAC 3H0GJ 2HQ5A 1XB4A 1UJ8A 3NWTA 2RREA 1OYWA 2DXIA 4IXAA 1NH3A 3T8TA 1IGNA 3DU6A 3SYTA 3BQZA 3L00A 4M6VA 2PFBA 2IEKA 2VPLA 3CMEI 3V8KA 4QPQA 1A35A 3K1NA 2LMDA 2JTVA 3CMYA 3JW4A 4LMYA 3SFZA 1ZLKA 4WCGA 3GTLJ 2K3PA 1IUFA 3HM5A 5H2FC 1GLNA 2GIZA 2EJRA 4ABZA 3BWGA 2EA2A 4A3EJ 2CFOA 3WU0A 4DYCA 4PDKA 5DCMA 3BZKA 1W0TA 1B8IA 4BQAA 5DS9A 1AA7A 1E2XA 2XB0X 3OYNA 2Y0MA 3SJMA 2OUMA 4I09A 1ERDA 5ILUA 2OZUA 3VFZA 3LSTA 1JKOC 4XRSA 2CW0F 2NVUB 3QP6A 4P1WA 1RUOA 2XROA 1TW2A 2O7OA 2LR8A 5KK1A 4B3AA 3I4MJ 1Y0NA 4IQ4A 4A0ZA 2GXBA 1QPMA 1CQTA 1U5TB 1F36A 2VBZA 3WTTC 2CGPA 2XKOA 4ESFA 3FKJA 1R5ID 3OSGA 1AKHB 3WTXC 2BY2A 1B72A 3EUHC 2KZGA 2E5ZA 3RYPA 5CVIA 4OWRB 3SDGA 3VYTB 1D0XA 4GGGA 2XF6A 2OZ6A 1I27A 2K40A 5LHIA 3IH4A 3TKYA 3VSKA 5EEGA 4A12A 3E6MA 4LOCA 1JGGA 5HLHA 1LEAA 1D0ZA 4EMSA 1XDSA 1I50J 1LNWA 3PNVA 4JYKA 2YPRA 1DP7P 4FE4A 2NVTJ 2Y0SA 1E0EA 2KP6A 1O3RA 3PFIA 1APLC 1FTZA 2HXIA 5EGOA 2KJBA 2X51A 1RUNA 3FM3A 2DOAA 3FBIB 2DFIA 2M7BA 1ZRFA 2AS5F 1K83J 4HNVA 3W2VA 4N9IA 1TW3A 3I4PA 2VONA 5ICFA 3C2GA 5GAHJ 1BJZA 1L0OC 1HW1A 4XSZF 3EDPA 4KDPA 2XAHA 2DU9A 1Z1DA 3LSGA 4P9UA 5J8FA 3KLOA 1ZH5A 3C2HA 3WTZA 1MMDA 3CC2I 2M45A 5KAIC 4C3JJ 3G1OA 1YJ9I 3CCYA 4GDFA 1W36C 3JCUC 3ECOA 2H1KA 2RVCA 2M8GX 4LJZF 5FLXZ 5FD6A 4B44A 1T95A 1XSVA 4XLCA 3LAPA 1F9NA 3RPQA 3OYBA 3QU3A 2R5YA 2F5VA 4BGDA 4BACA 3BCBA 1BL0A 1HA8A 4CGZA 2A05A 3KZZA 2DAOA 2PJPA 2FA5A 1XGSA 1PUFB 4B09A 3KP7A 4M9XA 1R1TA 2A5WA 2OQRA 2RQQA 2DDAA 3FXRA 2J5PA 4EATA 2PJRA 2EIKH 2DA4A 5AIQA 2HVQA 4AM3A 2CW7A 3IUOA 3CC4I 4EJVA 5D6FA 3RKQA 2EFWA 5J1RA 1LKXA 4DBRA 2V1XA 3VB2A 4LLNA 1HKTA 3IKTA 2A61A 4LGWA 3KCCA 3M3YJ 3HZJA 4HSTA 4BQOA 3I64A 4BXFA 3I58A 1BI2A 1P4WA 3BTCA 3LA7A 1BOAA 3CDIA 3OMYA 3LQRA 3CJNA 2ZXHA 2G7UA 3FXJA 3OSFA 1G4DA 4XBFA 1OCCH 3LMMA 1QBJA 3GFMA 3FXLA 5HS9A 5GP9A 1PDNC 1QRYA 1VQPI 2JWTA 5FLMJ 4KN4X 4XLFA 3TL4X 2BW3B 3ROUA 3HHHA 3KP3A 1S7OA 4HOBA 4RB2C 3REOA 1TBXA 2X6YA 2AHQA 3PFYA 4BXUA 2K9LA 4A5MA 1G2HA 2FX0A 3I0TA 4D5FA 4WF2A 4Z2YA 2JSPA 2IS2A 2KZVA 2LOOA 5GPAA 3ZQHA 5DYMA 2ZFWA 3CUQA 4U87A 1ULYA 2V9PA 3PL8A 4X1EA 5E3MA 2JVHA 2KIUA 3QPSA 3MKZA 2K9QA 2CH0A 2BBYA 1MBHA 2Q2EA 3HL2A 3GZNB 2GBYA 1DGRM 4AVZA 1MNEA 2I5UA 3H9GA 3W6JB 2E7XA 2P6SA 1K6OA 2ELHA 3CCMI 2XKPA 2COMA 5J4VA 4OIPF 4UY8I 2QYOA 1OISA 2EIJH 5F1JA 5IT9K 2D1HA 2L7KA 1U9NA 2FBIA 2DYRH 3WTSC 1RRJA 4M71A 1I3AA 3FKIJ 3VYUB 4XKCA 2IA1A 3JRIA 3QRFF 1QNTA 4MHGA 2LNBA 3OS2A 5C3EJ 2ZJPF 1WJCA 4CDGA 1T0FA 2H8WA 3W2AA 1YYVA 2YSRA 4PGGA 1D1BA 4ZDPA 1ETWA 3U9GA 2ISYA 1YG2A 2QWWA 3KETA 1EF4A 2LKXA 2R3SA 4LFUA 2VJ4A 2ZJRF 2CQQA 3K4NA 2QENA 3M4OJ 1FBQA 2QQ9A 2QUFA 1U78A 3GBGA 2CQKA 3M8FA 3FF5A 3E1SA 2HDCA 2CMPA 4BQNA 4JQFA 2QEXI 5FB2A 2QQAA 3J80K 5B5EC 5ICCA 3WGIA 3HEFA 4IVNA 1B9MA 3HKZA 3BG3A 5D4SA 4NDLA 1IC8A 4HX7A 4BEHA 5EYRA 4O5VA 3GW2A 1SANA 3R60A 2CFXA 2Z1DA 1WI9A 2WWYA 1R23A 3GO5A 4XLHA 2NVQJ 2ME6A 4FTHA 2CWEA 2H27A 4PJ0C 3ZRGA 1NG7A 3OYGA 1HDDC 3CCUI 3ELKA 4LB6B 3H1CA 2BXYA 3J81Z 4XK4A 3Q5FA 3J7AY 2M34A 3OWTA 3BR6A 3S2WA 2JA2A 4Y13A 1MD0A 3A03A 4XM3A 2ETHA 2VJ5A 1UMQA 4FX4A 1GXQA 3BG6A 2R7ZJ 2ZCWA 3OR2C 4I0BA 2XHKA 2V9VA 3DEWA 2JRTA 4RMNA 4BHCA 1I1SA 2ELJA 2GWRA 4HYEA 1H9TA 1EJ9A 2DMQA 2EWNA 5DDGA 2G9WA 3CF2A 2AXLA 2KFDA 4ZH4F 3CF5F 4B8XA 3H9QA 4RDUA 3TDZC 4BQQA 2ZFUA 3WHBA 2A3SA 3ABMH 4UVBA 2K9MA 3E5UA 2HVRA 3RTRA 1S7EA 1WGXA 4E7HA 3CDLA 2EZHA 3L09A 3AFHA 3ZN0A 2WC2A 4D7NA 4HX4A 3LL7A 3ZQQA 2L5QA 2HPIA 1ZHFA 1NG6A 1JHHA 1WJEA 5D5WB 1IN4A 4M9SA 2DT7B 2Q8KA 3ZMVA 3CCJI 3HSEA 4A6EA 4FASD 3ZQGA 4QIWN 1O3SA 3KE2A 5CVVA 2M1BA 4F93B 3RQIA 3G73A 3E5XA 4MQVA 4RAZA 2Q2EB 3JRCA 1Q1HA 1PVEA 1RNLA 2VQCA 4ZDOA 1IO2A 3DXJF 1LVKA 1WVRA 4ETSA 3IP4B 1JT0A 1FOKA 2ZSIB 2XPWA 2R7QA 3AG4H 3ABLH 1RPWA 5LHHA 2LTPA 1A04A 2W82A 1R1VA 4B3XA 1YRNA 3I53A 5LRRA 3F0CA 3GZ6A 2DOFA 4V2GA 4YFKF 2G7HA 1HSJA 3QYBA 4DGWB 1XN7A 2MC4A 1MIJA 1T38A 1FBUA 4G6TB 1BR1A 4NHJA 3LWFA 5FRMA 4M72A 3WG9A 5ERIA 5HDKA 3H9JA 4WWCA 5BMZA 1WFXA 2L9RA 3LA2A 2JK3A 4HV6A 2CW8A 2VQLA 2P4WA 3FMQA 4BE1A 1BW5A 1FOYA 1XGNA 3H3ZA 3KFWX 4KT5C 1JUSA 1WQ2A 3W6KB 4IHTA 3O8GA 1ZQ3P 2LYCA 3J7YJ 4AC0A 2EFQA 3E97A 1MDMA 1VF9A 2B9SA 2WV1A 2HZTA 3R61A 2BHZA 2KDZA 4GXOA 2Z99A 5CVJA 3JSOA 4IEJA 2QQ8A 3DU5A 3T1BA 4DYQA 3HOUJ 5LHGA 1G59A 5CVRA 5EDNA 5DEQA 2DQLA 3C3WA 3DLAA 3ASNH 1USTA 5H6RA 2ACJA 3GTQJ 3BDDA 2L9NA 3FXUA 5FLVA 1BR2A 3OOPA 1RKWA 2VKDA 1E3HA 1Z91A 1V4RA 2MG4A 4L9TA 2WA0A 5LBQA 1XGOA 1MBGA 5IPAA 4DYRA 1WI3A 4QPOA 3PIPF 1FOXA 1H88C 1Q1VA 2W25A 4L9JA 1YFHA 2IA2A 4HLYA 3VODA 2ESNA 3K70C 4FCYA 4GCVA 2K85A 1EKEA 2CQXA 2KPMA 2IA0A 2FD5A 4CH7A 1OKRA 5J6XA 1S9HA 1SD5A 2EFPA 3HRMA 5IY5H 1PP8F 1MJAA 3CCSI 4EM0B 2E71A 3O6BB 3HOXJ 3MCZA 3EPZA 2XB5A 1STZA 4O3MA 2HFHA 1Y56A 1LE8A 2BVMA 2DMNA 1G3SA 3EETA 4A3IJ 1SMTA 1QU3A 1K78A 2W24A 2HQRA 3FXQA 2M5WA 3DF8A 2P6TA 1BIBA 3BG7A 5DV5A 3SDBA 1YIJI 1I6HJ 2Q0OA 2R7TA 1DGWY 2Q1ZB 4HF1A 3CJRB 4UXNA 3U1KA 3K1PA 3CC7I 2M0CA 4U0VA 1QVUA 3HOZJ 1J09A 5FD5A 1T0FC 4YELA 3EUAA 3OYCA 5K5QA 3ERED 4C2TA 2Y48A 4RLFA 2O8KA 4Q47A 1JGSA 5CKTA 2ZMEC 1OLTA 3KX2A 4I76A 3X2QH 2KIMA 5B1BH 1REPC 1VQ6I 3VEPA 3F8MA 3GWZA 3TDUC 1CF7A 1JTYA 2CU7A 5D5VB 4ENJA 3FDYA 3MZYA 5C4XJ 1JTXA 4BBSJ 5H20A 1I1GA 5IP9J 2LH9A 2LREA 4ZJZA 4MEXF 5DD4A 4UB8C 4AIJA 1UZCA 3TEDA 2PG4A 2F4IA 5J1YA 4ENNA 3PO3J 3BLYA 1RKTA 1B8IB 2FBHA 2H6BA 3MVPA 2OV7A 3IRRA 1JJ8C 1VQKI 3SEZA 3WHCA 3I5UA 5LRSA 2HWVA 2PMUA 2PBIA 1YW9A 2HEOA 1V3FA 2NOJB 2IVMA 2VE9A 2EH3A 1N75A 1ZTRA 2MSYA 5DUIA 4QWQA 1OQYA 1TQMA 3CO6C 1AHDP 2L0KA 3UR3C 2QZ8A 3HSRA 1XMXA 2H1LA 1IN8A 2A07F 1VQMI 4BXXJ 1I5ZA 5E1ZB 5HS8A 5DD8A 3HIFA 4YIRX 4BE0A 1B6AA 3QOEA 2KHMA 1D0YA 2M3AA 2DPDA 4BAYA 2L7MP 4UB6C 1R7JA 2DFEA 2O9LA 3RI4A 4HRIA 4CYCA 3UNGC 4IRIA 2W57A 3DKWA 1WJDA 1RZ4A 3KP2A 2OCCH 2CV1A 4XRMA 2DJIA 2NAZA 3OYMA 1D5YA 4A3KJ 1WZ2A 2L7ZA 3EUKL 2HGCA 1GV5A 1LQ1A 2RAEA 2DBBA 4A0YA 4KMFA 3N4MA 1T56A 2QKLB 5E18F 3S16J 3JAMK 4A3MJ 1QHHD 2DMPA 1A6QA 3GEZA 1R1UA 1W0UA 2RN7A 1HOMA 1IDZA 3W2WA 4KIBA 5GTHC 5EF6A 4DZPA 2BYVE 2Z9OA 1VQNI 2HS5A 1G3TA 2I8DA 5IYBJ 1U8BA 3HOTA 3S2HJ 2FEZA 4P96A 3I54A 2HYFA 4GYGA 2ESHA 3KP5A 5BS6A 2R7UA 5F04A 3HUGB 1DQUA 4CUGA 1Y0UA 2F5DA 5FKKA 5E8IA 1J7KA 1EV7A 1LDKB 2NS0A 2XPVA 4E7KA 2PLYA 3LSIA 2M8EA 2ZSHB 2WAEA 2ZB9A 4IRGA 2C6YA 4FT8A 2GAUA 1K79A 4CHUA 3S3NA 2HTSA 3HXLA 3HOYJ 3JRDA 3BR1A 2IGKA 2OF7A 4LLLA 2KT0A 3WTVC 1FYMA 3SXYA 4QSHA 5LFAA 1K6YA 3T8RA 1FEXA 3PQJA 4KIGA 2LY1A 3GLXA 3K4MA 2H8RA 4ZYDA 4NC6A 3CLQA 3KYCB 3RQ4A 4OIOF 2WBMA 3BZCA 1DU6A 4M3EA 4D9JA 1E3OC 3BT9A 3ZCOA 3DEUA 1GVJA 3VOEA 2R7DA 4YFXF 1SD7A 1UG0A 4BS9A 2QBYB 2DN0A 9ANTA 3CP8A 3S3OA 3OIOA 1YJNI 3BTLA 2VKEA 2UXXA 3RPUD 1Z67A 1Z0XA 3RPUA 2K4JA 1LFPA 4B43A 3ZMSA 4E7ZA 2HKXA 2X6OA 4XONA 2OD5A 1MBFA 2LK2A 1QGPA 2DT6A 4ON0A 3KP4A 4BEHB 3I4NJ 3COAC 2KJCA 1X4OA 4BHBA 5GPCA 2ME0A 3DPUA 4RGSA 3WGHA 1XC5A 1WHUA 2OBPA 2MH9A 3H3VK 3BC8A 3EQLF 2IGMA 4CYDA 4XLEA 3Q3SA 1OCTC 3S1MJ 3BTIA 5F27A 1XGMA 2LLKA 2DI3A 4EGYA 3K69A 3M9AA 3CUQB 1M1EB 2OCEA 3K2AA 4XN3A 4E7JA 2D2WA 2FJ1A 3FXKA 2HKOA 1FYKA 2PI0A 5HVQC 3WGGA 3S14J 1MBKA 3CD6I 1ZELA 2IJLA 1GHCA 2EINH 2CSOA 4IJAA 3VYSB 4RAYA 4HPQA 5D5UB 5CQEA 3HGGA 4RBOA 2W1OA 4HEA2 2PJRB 3S1NJ 2DQRA 2VOPA 3AL0C 1BBYA 2TRTA 3CJQB 2R0QC 1Z7LA 1U5TA 2X48A 2VBXA 3FXMA 3GF2A 3IC7A 3IWZA 3OS0A 3BJ6A 4L5JA 1PYVA 2OJED 3HBLA 4RS8A 3DLLF 1MMGA 1PJRA 4HSRA 2R92J 1UCRA 3TGNA 3Q0WA 4M73A 2HXOA 3JREA 2AXTC 2JVGA 1W5SA 1K61A 3JR9A 4JP0A 4AIKA 1R5HA 1YE9A 3DTIA 3VDXA 1T8IA 1V5FA 1XMKA 2M7AA 3RZDJ 4UNOA 3SZGA 4N4OB 1Y1VJ 2M0MA 1YOVB 4OMZA 2JZYA 1QQIA 3RIRA 1UHSA 5L3EA 3LAJA 4I7HA 1FP2A 4L9VA 3V8LA 1VFCA 1F1ZA 3DBRB 5FKOA 1MBEA 3QWLA 1XCBA 1H9GA 1YLFA 4IOCF 3E6BA 2CG4A 2VL8A 1MMSA 4S05A 2OAZA 2CQNA 5J47A 4BHPA 3M07A 4ZTJA 4MEYF 4F55A 5E20A 1TWHJ 2ZXWH 3RCOA 3EYYA 1EH7A 2O03A 1ZG3A 2EILH 2IW5A 2O61A 1MMAA 2XAJA 3LFUA 1EH6A 3A4CA 3GLLA 1R00A 4LG3A 1C0WA 4BNCA 3J7ZI 4A3BJ 3ZQCA 1U8RA 3HPHA 2VC0A
chains in the Genus database with same CATH topology
2QVOA 4L0YB 5ED4A 4R79A 1FC3A 2DTRA 2FE3A 2MH2A 1IUYA 1JXSA 4NB5A 5A2QK 2XAQA 2QBYA 1DPUA 2HOEA 1ZG5A 4HAMA 3F8FA 4ZYEA 1U5TC 4EM1A 1P4AA 2PMHA 3V7SA 5JVTA 3P9CA 1KU9A 4HX8A 2PEXA 3GUDA 5L3GA 2XIGA 1BI3A 4IHSA 2D1VA 1O7LA 2FOKA 1YIOA 2JT1A 5AONA 5ILVA 5HDNA 2XUBA 2ZMEA 3N97A 2UWMA 2XAGA 1OPCA 1FSHA 1U6GA 4EGZA 1AWCA 1TQIA 4EJTA 2YX7A 1ZGAA 1K78B 3EYIA 3T5XA 3IL2A 4LK0F 4RB3C 4MNUA 2W85A 1HSTA 1E17A 4LD5A 4M9ZA 4PGHA 3R6SA 1J5YA 4G7HF 1KQ8A 3SQNA 2A5YB 3E6CC 3QP5A 3FX3A 5F6FA 2FMLA 4KN7X 4I98B 5FFXA 2XAFA 3DP7A 3F21A 5BPDA 4RGUA 4M6XA 3RJPA 2YR2A 4GO1A 3V4GA 3CTAA 5L3BA 4WK8F 3G3ZA 4YFNF 3P7NA 4OINF 1D8KA 3MZHA 5F64A 4LG0A 3P9IA 2XVCA 1DUXC 4HDVA 3ZN1A 3HSFA 1XCVA 2DO7A 4KICA 3E3VA 1BC7C 1O3QA 2A6HF 4Q5SF 3SZTA 4A6DA 4AVPA 4H0EA 1SFXA 4RB0A 4I02A 3F8NA 3ECHA 3U1DA 4L0ZB 2J5OA 3F72A 2NNNA 4OMYA 4U0WA 2WTEA 3MEXA 3ABTA 3HRSA 2ZMEB 1IXCA 2M87A 2GA1A 3J7AO 2XGXA 2ADUA 1HW2A 2M30A 4E70A 1T98A 1Z6TA 4L18B 3Q9VA 5ILSA 3F23A 1JE8A 3F6VA 2OA4A 2UXNA 2GIVA 2RGVA 1GXPA 2W84A 3OV8A 1Z6RA 4RB1A 1QZZA 3RYRA 5A2QZ 1HKQA 2VODA 5BPIA 1KA8A 2LDUA 1WKMA 1FWZA 5D8KB 4HQMA 1HKSA 4UVAA 2ISZA 5FO5A 3Q9SA 4LG0B 2RNJA 1P92A 2BEOA 4WXHA 2O8XA 4U0YA 2H09A 1ONVA 3KLNA 2IPQX 2EB7A 1BM9A 4HW0A 5FFZA 1YO5C 1FPQA 2EA4A 4UV9A 2L54A 4HQEA 5HLIA 2FBKA 2E1NA 3C1DA 1ZN2A 2RKHA 3V7RA 4ESJA 3FMRA 1QO0D 4S04A 5EEHA 4HF2A 3GZ5A 1VTNC 5D8LB 3EUHA 1EH8A 1DPRA 2K7LA 3C7JA 4UVCA 1K7AA 3BY6A 1D5VA 3KEQA 4AWXB 2VN2A 5TRDA 3R0JA 4Y15A 1J9IA 1WWXA 2VXZA 2FMYA 3P9KA 4LB5A 1BIAA 2F2EA 1HXDA 4CZZA 1W5TA 4DNCA 3HRUA 3C18A 5KVRA 1YW7A 1ZYRF 3QOPA 1IXSB 2FNAA 4ESBA 3RKYA 4UUVA 1R36A 5E17F 3F3XA 2FSWA 2KRFA 1S7AA 3MQ0A 4R8HA 2L02A 1KU7A 1T39A 2R7FA 3WTUC 3HUGA 2VE8A 4EM2A 1XSDA 1I6XA 2PN6A 5LGTA 2Z5UA 1MZBA 3WTWC 2E1CA 3B73A 2HQNA 2P5VA 4OU0A 1J2XA 3DPLC 3ISPA 3I59A 3M1EA 1WSUA 3NEUA 2ZKZA 1FSEA 3TO7A 1TLHB 4HDUA 2L4MA 5H6QA 3TO9A 1FNNA 4AIHA 4Q48A 5IT9Z 4ASNA 4RGXA 5J8CA 5D4RA 3ZPLA 3R4KA 3ZMUA 3BJAA 5LLQA 2VOOA 2MLKA 2A6EF 3FM5A 3IHUA 2RV8A 2XRNA 1MJ9A 3MFKA 1FX7A 4U88A 3F8BA 6PAXA 1TNSA 1IAWA 5CVUA 4G7OF 3LQQA 1LJ9A 5JI6A 2WV0A 3JTGA 3ZP5A 3ZQ7A 1G3WA 3CUOA 3L9FA 2K86A 1USSA 3BPVA 4OIRF 1FLIA 2RC4A 1IN7A 3ML6A 1FY7A 4I2OA 3RKWA 5FGMA 3WODF 4GYIA 2MD5A 3BP8A 4M74A 4EJWA 2DLLA 1NHAA 4G9YA 3D0SA 1HQCA 1LEBA 4CO8A 4HBLA 1Z05A 3GVAA 3BROA 1ZAOA 4YIIA 1YQAA 2Z33A 1KU2A 4IF4A 5FLXK 3CO7C 1G3YA 4EJUA 1B4AA 1S29A 5BOXA 1S6LA 2H6CA 1G6NA 4G6QA 3H92A 3FZVA 5E8GA 3QU6A 3DV8A 2D45A 5JFRA 3R0AA 2IRFG 3U2RA 3K9TA 2F5EA 3TOAA 2EK5A 3RKXA 2MA3A 2HYGD 4N0BA 1O3TA 1IN5A 4G8XA 1SD4A 3TQNA 4XSXF 4U7DA 3ZMTA 2FQ3A 2TDXA 4P55A 5HLGA 2X0LA 4M6YA 2A69F 3V8JA 2L4AA 4OOIA 3ZMDA 2GZWA 4YG2F 1CGPA 5LGNA 5F1RA 2CO5A 3KP6A 4G7ZF 2F5CA 1FYLA 1SMYF 2EFNA 1T6SA 2EV6A 4IPAA 1IN6A 1OMIA 2BE5F 2ZNZA 1D8JA 3WTYC 4WXDA 2UZKA 1HBXG 4ZZLA 5HDGA 4EJOA 3CLOA 2EFOA 3QPTA 1KYZA 4OIQF 4ZZDA 1B1BA 1UB9A 2H94A 4KUMA 4HLXA 3TO6A 1UHWA 4G6DA 4FX0A 1X3UA 2DT5A 3WU1B 1Z9CA 1U3EM 3WE3A 4NQWA 3JSPA 3GFIA 2RDPA 3FWEA 4LLGF 3GXOA 5JR3A 3T0YA 1TTYA 3BZ6A 1BN5A 3MWMA 3J80Z 2Z3YA 1LVAA 5L3FA 1W7PB 3JTHA 3ABUA 1O57A 3K0LA 1QZYA 2JPCA 1MKMA 1B59A 3WE2A 1TNTA 2FNPA 2CYYA 1ZREA 2Y75A 2HTJA 1XD7A 1PUEE 2IP2A 2O6GE 1J0RA 5CYVA 2L01A 1J75A 4MTDA 5HOOA 3K1MA 3HRTA 3GX4X 5LGUA 2O0YA 3J81K 5K5OA 3L7WA 3DQVC 1IRFA 2PQ8A 4EV0A 3F6OA 1U2WA 3I71A 1ZLJA 1ZG1A 1BC8C 1BI1A 4WX9A 4XLPF 2BGCA 3GYHX 5K1YA 3E6DA 2MBFA 1PP7U 3KZYA 3D5LA 1FT9A 1ZRDA 4HA8A 2OQGA 2YU3A 3PQKA 4R1HA 5AIPA 4U7BA 3B02A 1TQPA 2K4BA 3IWFA 5D5XB 3FMSA 2F5FA 2VT2A 1ON1A 4XRFA 1P2FA 4K2EA 3F8CA 1R22A 1FZPB 1XSXA 3GFJA 4L5IA 3BJOA 2X4HA 3E5QA 2FRHA 3I59B 1DDNA 1LDJA 1OYYA 2MLGA 3ULQB 4Q4ZF 2VT3A 2YX4A 1W4MA 2HR3A 4A0XA 1KQ9A 2E7WA 2STTA 1O7FA 5LEKA 1ON2A 2DW4A 2MC3A 2LF7A 2P7CB 3HYIA 2KKOA 1SAXA 3MAJA 2DK8A 5DCMB 2V1DA 1P6RA 2O3FA 4O6JA 1WRJA 5L3DA 3IKVA 4I01A 4IRHA 1UFMA 2VC1A 1ZRCA 4KIFA 2BV6A 1F4KA 5JHUA 2QQBA 1LB2A 4A2UA 1KYWA 4UHTA 4XLNF 1ODDA 3NRVA 3LFKA 4F7ZA 3LA3A 1MDMB 2DPUA 1H0MA 3NQOA 5DCFA 2KIFA 4P9FA 1IXRC 2XASA 2P5KA 3CDHA 1R5GA 4P5OA 2VBWA 4EQQA 4A5NA 4Y17A 1SFEA 1MGTA 1P4XA 2RQPA 2NYXA 4UV8A 1CF7B 3CUQC 3GFLA 4N9HA 1YS6A 2GXGA 1YS7A 5K5RA 2P7VB 1SFUA 3KEOA 5CJ9A 4DQ2A 3FHZA 2EV5A 1XDUA 2LKPA 1IZ1A 4CICA 4RGRA 4JK1X 1B9NA 3DFGA 3O3KA 3BPXA 4BYYA 3BOQA 2DK5A 3QAHA 4KFCA 1YW8A 4ZYHA 1MJBA 4MGRA 3DPTA 1IRGA 2FXAA 1UHMA 4HF0A 1T2KA 1JHFA 3HTSB 2V79A 2ZJ2A 1Z7UA 3H3UA 2K02A 1ZGJA 1FBSA 3L2CA 3IRQA 1IF1A 5BQTA 2GA2A 1J59A 2P8TA 5CLSA 3F22A 4PZJA 1RIOH 1D3YA 4HV5A 3HOSA 2JSCA 3QPHA 2ZXJA 5ICGA 2ZBKA 4L9NA 3V7CA 2GQQA 1OR7A 2LSOA 4HZFA 1XMAA 5HS7A 1FP1D 1KGSA 3AAFA 3HHGA 4CXFA 1SD6A 2QM3A 1F5TA 3RDIA 2XV4S 2NNYA 2EV0A 4WXCA 2A68F 4JBAA 4KYWA 5DUKA 3SHFA 3TOBA 2FF4A 4ZYGA 2ZO4A 2P5LC 4G94A 1YTYA 2OU2A 1R58A 2LF8A 4I0AA 1W7PD 4MTEA 2L3DA 5E1WA 2IT0A 4KA4A 4AD9A 2JPBA 4BH9A 4KMUX 2FU4A 4YIFA 1KU3A 2B0LA 1BI0A 4FHTA 3M7GA 3M8EA 2K27A 3SZPA 1ZARA 4TV7A 4ENMA 1W7PA 1RI7A 1AOYA 5E1XA 1OYIA 4KNYA 2ZNYA 1IW7F 5TJJA 1HW5A 5IT3A 5ICEA 2VBYA 4D0PA 4EVIA 1KQ0A 4MQ9F 2STWA 3JAMZ 3ZMZA 5LEJA 2V6CA 3O2PE 3K2ZA 1BJAA 4QLCU 4ENKA 5D6EA 1LDDA 4PCQA 1S3JA 3HTUA 1S8NA 5L3CA 2QLZA 2V1UA 4LK1F 2NRAC 1XB4A 1OYWA 4IXAA 3T8TA 3L00A 2PFBA 3V8KA 3K1NA 2JTVA 3JW4A 4LMYA 3SFZA 1ZLKA 4WCGA 2EJRA 3BWGA 2EA2A 3WU0A 4PDKA 5DCMA 4BQAA 1E2XA 2Y0MA 4I09A 5ILUA 2OZUA 3VFZA 3LSTA 2CW0F 3QP6A 1RUOA 2XROA 1TW2A 5KK1A 4A0ZA 2GXBA 1QPMA 1U5TB 2VBZA 3WTTC 2CGPA 2XKOA 4ESFA 3WTXC 3RYPA 5CVIA 4GGGA 2OZ6A 1I27A 5LHIA 3TKYA 5EEGA 4A12A 3E6MA 5HLHA 1LEAA 4EMSA 1XDSA 1LNWA 2YPRA 1DP7P 1O3RA 3PFIA 2KJBA 1RUNA 3FM3A 2DFIA 1ZRFA 2AS5F 4N9IA 1TW3A 3I4PA 2VONA 5ICFA 1L0OC 1HW1A 4XSZF 3EDPA 4KDPA 2XAHA 2DU9A 1Z1DA 4P9UA 5J8FA 3KLOA 1ZH5A 3WTZA 2M45A 3ECOA 2RVCA 4LJZF 5FLXZ 5FD6A 3LAPA 1XSVA 1F9NA 3RPQA 3QU3A 4CGZA 3KZZA 2DAOA 2PJPA 2FA5A 1XGSA 4B09A 3KP7A 4M9XA 1R1TA 2OQRA 3FXRA 2J5PA 5AIQA 4EJVA 5D6FA 2EFWA 2V1XA 3VB2A 4LLNA 1HKTA 3IKTA 2A61A 4LGWA 3KCCA 3I64A 3I58A 1BI2A 1P4WA 3LA7A 1BOAA 3LQRA 3CJNA 2G7UA 1G4DA 4XBFA 1QBJA 3GFMA 5HS9A 1PDNC 4KN4X 3ROUA 3HHHA 3KP3A 1S7OA 4HOBA 4RB2C 3REOA 1TBXA 4BXUA 4A5MA 3I0TA 4WF2A 4Z2YA 5DYMA 2ZFWA 3CUQA 1ULYA 2KIUA 2BBYA 2Q2EA 3W6JB 2E7XA 2P6SA 1K6OA 2ELHA 2XKPA 2COMA 4OIPF 2QYOA 5IT9K 2D1HA 2FBIA 3WTSC 4M71A 2VC0A 2IA1A 3QRFF 1QNTA 4MHGA 2LNBA 4CDGA 1T0FA 1YYVA 2YSRA 4PGGA 3U9GA 2ISYA 1YG2A 2QWWA 3KETA 2R3SA 4LFUA 2QENA 1FBQA 2QQ9A 2QUFA 1U78A 2CQKA 3M8FA 3FF5A 2HDCA 4JQFA 5FB2A 2QQAA 3J80K 5ICCA 3WGIA 4IVNA 1B9MA 5D4SA 4HX7A 4O5VA 3GW2A 3R60A 2CFXA 1WI9A 2WWYA 1R23A 3GO5A 2CWEA 2H27A 3ELKA 4LB6B 3J81Z 3Q5FA 3S2WA 4Y13A 1MD0A 2ETHA 4FX4A 1GXQA 2ZCWA 4I0BA 2XHKA 2V9VA 2JRTA 4BHCA 1I1SA 2GWRA 4HYEA 1H9TA 2EWNA 5DDGA 2G9WA 2AXLA 4ZH4F 4B8XA 3TDZC 2A3SA 4UVBA 3E5UA 3RTRA 3L09A 3ZN0A 2WC2A 4HX4A 1ZHFA 1JHHA 5D5WB 1IN4A 4M9SA 2Q8KA 3ZMVA 3HSEA 4A6EA 1O3SA 3KE2A 5CVVA 2M1BA 3G73A 3E5XA 4MQVA 4RAZA 1Q1HA 1RNLA 3DXJF 4ETSA 1FOKA 5LHHA 1A04A 1R1VA 3I53A 5LRRA 3GZ6A 4YFKF 2G7HA 1HSJA 1XN7A 1T38A 1FBUA 4NHJA 3LWFA 4M72A 3WG9A 5ERIA 5HDKA 4WWCA 5BMZA 3LA2A 4HV6A 2P4WA 3FMQA 1XGNA 3H3ZA 3KFWX 4KT5C 1WQ2A 3W6KB 4IHTA 2EFQA 3E97A 1MDMA 2HZTA 3R61A 4GXOA 2Z99A 5CVJA 3JSOA 3T1BA 5LHGA 5CVRA 5DEQA 2DQLA 3C3WA 2ACJA 1USTA 5H6RA 3BDDA 3FXUA 3OOPA 1Z91A 1V4RA 5LBQA 4L9TA 1XGOA 2W25A 4L9JA 1YFHA 2IA2A 4HLYA 3VODA 2ESNA 4GCVA 2IA0A 5J6XA 1OKRA 1SD5A 2EFPA 3HRMA 1PP8F 1MJAA 4EM0B 3O6BB 3MCZA 1STZA 4O3MA 2HFHA 3EETA 1G3SA 1SMTA 1K78A 2W24A 2HQRA 3FXQA 2M5WA 3DF8A 2P6TA 1BIBA 5DV5A 2Q0OA 4HF1A 4UXNA 3K1PA 4U0VA 5FD5A 5K5QA 3ERED 2Y48A 4Q47A 1JGSA 2KIMA 1REPC 3VEPA 3F8MA 3GWZA 3TDUC 1CF7A 5D5VB 4ENJA 3MZYA 5H20A 1I1GA 4MEXF 5DD4A 4AIJA 2PG4A 4ENNA 2FBHA 2H6BA 3IRRA 3I5UA 5LRSA 2HWVA 2PMUA 2PBIA 1YW9A 2HEOA 1V3FA 2IVMA 2VE9A 5DUIA 4QWQA 3CO6C 1TQMA 2QZ8A 3HSRA 2A07F 1IN8A 1I5ZA 5E1ZB 5HS8A 5DD8A 3HIFA 1B6AA 2DPDA 4BAYA 1R7JA 3RI4A 4IRIA 2W57A 3DKWA 1RZ4A 3KP2A 2NAZA 2HGCA 1LQ1A 2DBBA 4A0YA 4KMFA 3N4MA 5E18F 3JAMK 3GEZA 1R1UA 2RN7A 4KIBA 2Z9OA 2BYVE 2HS5A 1G3TA 3HOTA 2FEZA 4P96A 3I54A 2HYFA 4GYGA 2ESHA 3KP5A 5BS6A 1Y0UA 2F5DA 5E8IA 1J7KA 1EV7A 1LDKB 2NS0A 2PLYA 2M8EA 2C6YA 4IRGA 4FT8A 2GAUA 1K79A 4CHUA 2HTSA 4LLLA 3WTVC 1FYMA 3SXYA 3T8RA 3PQJA 4KIGA 3GLXA 4ZYDA 4OIOF 1GVJA 3DEUA 3VOEA 2R7DA 4YFXF 1SD7A 2QBYB 2UXXA 3RPUA 2K4JA 3ZMSA 2HKXA 2OD5A 1QGPA 4ON0A 3KP4A 3COAC 4BHBA 2KJCA 4RGSA 3WGHA 2OBPA 2MH9A 3EQLF 4CYDA 1XGMA 2DI3A 4EGYA 3K69A 3M9AA 3CUQB 2D2WA 2HKOA 1FYKA 2PI0A 5HVQC 3WGGA 2IJLA 1GHCA 2CSOA 4IJAA 4RAYA 5D5UB 2DQRA 2VOPA 1BBYA 1U5TA 2VBXA 3GF2A 3IC7A 3IWZA 3BJ6A 4L5JA 4RS8A 1UCRA 3TGNA 4M73A 1W5SA 4AIKA 1R5HA 1XMKA 4UNOA 4OMZA 2JZYA 1QQIA 3RIRA 5L3EA 3LAJA 4I7HA 1FP2A 4L9VA 3V8LA 1F1ZA 1XCBA 1H9GA 1YLFA 3E6BA 2CG4A 4S05A 2OAZA 4BHPA 4MEYF 5E20A 3EYYA 1EH7A 2O03A 1ZG3A 2IW5A 2O61A 2XAJA 1EH6A 1C0WA 1R00A 4BNCA 1U8RA 1L3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVO A;  4L0Y B;  5ED4 A;  4R79 A;  1FC3 A;  2DTR A;  2FE3 A;  2MH2 A;  1IUY A;  1JXS A;  4NB5 A;  5A2Q K;  2XAQ A;  2QBY A;  1DPU A;  2HOE A;  1ZG5 A;  4HAM A;  3F8F A;  4ZYE A;  1U5T C;  4EM1 A;  1P4A A;  2PMH A;  3V7S A;  5JVT A;  3P9C A;  1KU9 A;  4HX8 A;  2PEX A;  3GUD A;  5L3G A;  2XIG A;  1BI3 A;  4IHS A;  2D1V A;  1O7L A;  2FOK A;  1YIO A;  2JT1 A;  5AON A;  5ILV A;  5HDN A;  2XUB A;  2ZME A;  3N97 A;  2UWM A;  2XAG A;  1OPC A;  1FSH A;  1U6G A;  4EGZ A;  1AWC A;  1TQI A;  4EJT A;  2YX7 A;  1ZGA A;  1K78 B;  3EYI A;  3T5X A;  3IL2 A;  4LK0 F;  4RB3 C;  4MNU A;  2W85 A;  1HST A;  1E17 A;  4LD5 A;  4M9Z A;  4PGH A;  3R6S A;  1J5Y A;  4G7H F;  1KQ8 A;  3SQN A;  2A5Y B;  3E6C C;  3QP5 A;  3FX3 A;  5F6F A;  2FML A;  4KN7 X;  4I98 B;  5FFX A;  2XAF A;  3DP7 A;  3F21 A;  5BPD A;  4RGU A;  4M6X A;  3RJP A;  2YR2 A;  4GO1 A;  3V4G A;  3CTA A;  5L3B A;  4WK8 F;  3G3Z A;  4YFN F;  3P7N A;  4OIN F;  1D8K A;  3MZH A;  5F64 A;  4LG0 A;  3P9I A;  2XVC A;  1DUX C;  4HDV A;  3ZN1 A;  3HSF A;  1XCV A;  2DO7 A;  4KIC A;  3E3V A;  1BC7 C;  1O3Q A;  2A6H F;  4Q5S F;  3SZT A;  4A6D A;  4AVP A;  4H0E A;  1SFX A;  4RB0 A;  4I02 A;  3F8N A;  3ECH A;  3U1D A;  4L0Z B;  2J5O A;  3F72 A;  2NNN A;  4OMY A;  4U0W A;  2WTE A;  3MEX A;  3ABT A;  3HRS A;  2ZME B;  1IXC A;  2M87 A;  2GA1 A;  3J7A O;  2XGX A;  2ADU A;  1HW2 A;  2M30 A;  4E70 A;  1T98 A;  1Z6T A;  4L18 B;  3Q9V A;  5ILS A;  3F23 A;  1JE8 A;  3F6V A;  2OA4 A;  2UXN A;  2GIV A;  2RGV A;  1GXP A;  2W84 A;  3OV8 A;  1Z6R A;  4RB1 A;  1QZZ A;  3RYR A;  5A2Q Z;  1HKQ A;  2VOD A;  5BPI A;  1KA8 A;  2LDU A;  1WKM A;  1FWZ A;  5D8K B;  4HQM A;  1HKS A;  4UVA A;  2ISZ A;  5FO5 A;  3Q9S A;  4LG0 B;  2RNJ A;  1P92 A;  2BEO A;  4WXH A;  2O8X A;  4U0Y A;  2H09 A;  1ONV A;  3KLN A;  2IPQ X;  2EB7 A;  1BM9 A;  4HW0 A;  5FFZ A;  1YO5 C;  1FPQ A;  2EA4 A;  4UV9 A;  2L54 A;  4HQE A;  5HLI A;  2FBK A;  2E1N A;  3C1D A;  1ZN2 A;  2RKH A;  3V7R A;  4ESJ A;  3FMR A;  1QO0 D;  4S04 A;  5EEH A;  4HF2 A;  3GZ5 A;  1VTN C;  5D8L B;  3EUH A;  1EH8 A;  1DPR A;  2K7L A;  3C7J A;  4UVC A;  1K7A A;  3BY6 A;  1D5V A;  3KEQ A;  4AWX B;  2VN2 A;  5TRD A;  3R0J A;  4Y15 A;  1J9I A;  1WWX A;  2VXZ A;  2FMY A;  3P9K A;  4LB5 A;  1BIA A;  2F2E A;  1HXD A;  4CZZ A;  1W5T A;  4DNC A;  3HRU A;  3C18 A;  5KVR A;  1YW7 A;  1ZYR F;  3QOP A;  1IXS B;  2FNA A;  4ESB A;  3RKY A;  4UUV A;  1R36 A;  5E17 F;  3F3X A;  2FSW A;  2KRF A;  1S7A A;  3MQ0 A;  4R8H A;  2L02 A;  1KU7 A;  1T39 A;  2R7F A;  3WTU C;  3HUG A;  2VE8 A;  4EM2 A;  1XSD A;  1I6X A;  2PN6 A;  5LGT A;  2Z5U A;  1MZB A;  3WTW C;  2E1C A;  3B73 A;  2HQN A;  2P5V A;  4OU0 A;  1J2X A;  3DPL C;  3ISP A;  3I59 A;  3M1E A;  1WSU A;  3NEU A;  2ZKZ A;  1FSE A;  3TO7 A;  1TLH B;  4HDU A;  2L4M A;  5H6Q A;  3TO9 A;  1FNN A;  4AIH A;  4Q48 A;  5IT9 Z;  4ASN A;  4RGX A;  5J8C A;  5D4R A;  3ZPL A;  3R4K A;  3ZMU A;  3BJA A;  5LLQ A;  2VOO A;  2MLK A;  2A6E F;  3FM5 A;  3IHU A;  2RV8 A;  2XRN A;  1MJ9 A;  3MFK A;  1FX7 A;  4U88 A;  3F8B A;  6PAX A;  1TNS A;  1IAW A;  5CVU A;  4G7O F;  3LQQ A;  1LJ9 A;  5JI6 A;  2WV0 A;  3JTG A;  3ZP5 A;  3ZQ7 A;  1G3W A;  3CUO A;  3L9F A;  2K86 A;  1USS A;  3BPV A;  4OIR F;  1FLI A;  2RC4 A;  1IN7 A;  3ML6 A;  1FY7 A;  4I2O A;  3RKW A;  5FGM A;  3WOD F;  4GYI A;  2MD5 A;  3BP8 A;  4M74 A;  4EJW A;  2DLL A;  1NHA A;  4G9Y A;  3D0S A;  1HQC A;  1LEB A;  4CO8 A;  4HBL A;  1Z05 A;  3GVA A;  3BRO A;  1ZAO A;  4YII A;  1YQA A;  2Z33 A;  1KU2 A;  4IF4 A;  5FLX K;  3CO7 C;  1G3Y A;  4EJU A;  1B4A A;  1S29 A;  5BOX A;  1S6L A;  2H6C A;  1G6N A;  4G6Q A;  3H92 A;  3FZV A;  5E8G A;  3QU6 A;  3DV8 A;  2D45 A;  5JFR A;  3R0A A;  2IRF G;  3U2R A;  3K9T A;  2F5E A;  3TOA A;  2EK5 A;  3RKX A;  2MA3 A;  2HYG D;  4N0B A;  1O3T A;  1IN5 A;  4G8X A;  1SD4 A;  3TQN A;  4XSX F;  4U7D A;  3ZMT A;  2FQ3 A;  2TDX A;  4P55 A;  5HLG A;  2X0L A;  4M6Y A;  2A69 F;  3V8J A;  2L4A A;  4OOI A;  3ZMD A;  2GZW A;  4YG2 F;  1CGP A;  5LGN A;  5F1R A;  2CO5 A;  3KP6 A;  4G7Z F;  2F5C A;  1FYL A;  1SMY F;  2EFN A;  1T6S A;  2EV6 A;  4IPA A;  1IN6 A;  1OMI A;  2BE5 F;  2ZNZ A;  1D8J A;  3WTY C;  4WXD A;  2UZK A;  1HBX G;  4ZZL A;  5HDG A;  4EJO A;  3CLO A;  2EFO A;  3QPT A;  1KYZ A;  4OIQ F;  4ZZD A;  1B1B A;  1UB9 A;  2H94 A;  4KUM A;  4HLX A;  3TO6 A;  1UHW A;  4G6D A;  4FX0 A;  1X3U A;  2DT5 A;  3WU1 B;  1Z9C A;  1U3E M;  3WE3 A;  4NQW A;  3JSP A;  3GFI A;  2RDP A;  3FWE A;  4LLG F;  3GXO A;  5JR3 A;  3T0Y A;  1TTY A;  3BZ6 A;  1BN5 A;  3MWM A;  3J80 Z;  2Z3Y A;  1LVA A;  5L3F A;  1W7P B;  3JTH A;  3ABU A;  1O57 A;  3K0L A;  1QZY A;  2JPC A;  1MKM A;  1B59 A;  3WE2 A;  1TNT A;  2FNP A;  2CYY A;  1ZRE A;  2Y75 A;  2HTJ A;  1XD7 A;  1PUE E;  2IP2 A;  2O6G E;  1J0R A;  5CYV A;  2L01 A;  1J75 A;  4MTD A;  5HOO A;  3K1M A;  3HRT A;  3GX4 X;  5LGU A;  2O0Y A;  3J81 K;  5K5O A;  3L7W A;  3DQV C;  1IRF A;  2PQ8 A;  4EV0 A;  3F6O A;  1U2W A;  3I71 A;  1ZLJ A;  1ZG1 A;  1BC8 C;  1BI1 A;  4WX9 A;  4XLP F;  2BGC A;  3GYH X;  5K1Y A;  3E6D A;  2MBF A;  1PP7 U;  3KZY A;  3D5L A;  1FT9 A;  1ZRD A;  4HA8 A;  2OQG A;  2YU3 A;  3PQK A;  4R1H A;  5AIP A;  4U7B A;  3B02 A;  1TQP A;  2K4B A;  3IWF A;  5D5X B;  3FMS A;  2F5F A;  2VT2 A;  1ON1 A;  4XRF A;  1P2F A;  4K2E A;  3F8C A;  1R22 A;  1FZP B;  1XSX A;  3GFJ A;  4L5I A;  3BJO A;  2X4H A;  3E5Q A;  2FRH A;  3I59 B;  1DDN A;  1LDJ A;  1OYY A;  2MLG A;  3ULQ B;  4Q4Z F;  2VT3 A;  2YX4 A;  1W4M A;  2HR3 A;  4A0X A;  1KQ9 A;  2E7W A;  2STT A;  1O7F A;  5LEK A;  1ON2 A;  2DW4 A;  2MC3 A;  2LF7 A;  2P7C B;  3HYI A;  2KKO A;  1SAX A;  3MAJ A;  2DK8 A;  5DCM B;  2V1D A;  1P6R A;  2O3F A;  4O6J A;  1WRJ A;  5L3D A;  3IKV A;  4I01 A;  4IRH A;  1UFM A;  2VC1 A;  1ZRC A;  4KIF A;  2BV6 A;  1F4K A;  5JHU A;  2QQB A;  1LB2 A;  4A2U A;  1KYW A;  4UHT A;  4XLN F;  1ODD A;  3NRV A;  3LFK A;  4F7Z A;  3LA3 A;  1MDM B;  2DPU A;  1H0M A;  3NQO A;  5DCF A;  2KIF A;  4P9F A;  1IXR C;  2XAS A;  2P5K A;  3CDH A;  1R5G A;  4P5O A;  2VBW A;  4EQQ A;  4A5N A;  4Y17 A;  1SFE A;  1MGT A;  1P4X A;  2RQP A;  2NYX A;  4UV8 A;  1CF7 B;  3CUQ C;  3GFL A;  4N9H A;  1YS6 A;  2GXG A;  1YS7 A;  5K5R A;  2P7V B;  1SFU A;  3KEO A;  5CJ9 A;  4DQ2 A;  3FHZ A;  2EV5 A;  1XDU A;  2LKP A;  1IZ1 A;  4CIC A;  4RGR A;  4JK1 X;  1B9N A;  3DFG A;  3O3K A;  3BPX A;  4BYY A;  3BOQ A;  2DK5 A;  3QAH A;  4KFC A;  1YW8 A;  4ZYH A;  1MJB A;  4MGR A;  3DPT A;  1IRG A;  2FXA A;  1UHM A;  4HF0 A;  1T2K A;  1JHF A;  3HTS B;  2V79 A;  2ZJ2 A;  1Z7U A;  3H3U A;  2K02 A;  1ZGJ A;  1FBS A;  3L2C A;  3IRQ A;  1IF1 A;  5BQT A;  2GA2 A;  1J59 A;  2P8T A;  5CLS A;  3F22 A;  4PZJ A;  1RIO H;  1D3Y A;  4HV5 A;  3HOS A;  2JSC A;  3QPH A;  2ZXJ A;  5ICG A;  2ZBK A;  4L9N A;  3V7C A;  2GQQ A;  1OR7 A;  2LSO A;  4HZF A;  1XMA A;  5HS7 A;  1FP1 D;  1KGS A;  3AAF A;  3HHG A;  4CXF A;  1SD6 A;  2QM3 A;  1F5T A;  3RDI A;  2XV4 S;  2NNY A;  2EV0 A;  4WXC A;  2A68 F;  4JBA A;  4KYW A;  5DUK A;  3SHF A;  3TOB A;  2FF4 A;  4ZYG A;  2ZO4 A;  2P5L C;  4G94 A;  1YTY A;  2OU2 A;  1R58 A;  2LF8 A;  4I0A A;  1W7P D;  4MTE A;  2L3D A;  5E1W A;  2IT0 A;  4KA4 A;  4AD9 A;  2JPB A;  4BH9 A;  4KMU X;  2FU4 A;  4YIF A;  1KU3 A;  2B0L A;  1BI0 A;  4FHT A;  3M7G A;  3M8E A;  2K27 A;  3SZP A;  1ZAR A;  4TV7 A;  4ENM A;  1W7P A;  1RI7 A;  1AOY A;  5E1X A;  1OYI A;  4KNY A;  2ZNY A;  1IW7 F;  5TJJ A;  1HW5 A;  5IT3 A;  5ICE A;  2VBY A;  4D0P A;  4EVI A;  1KQ0 A;  4MQ9 F;  2STW A;  3JAM Z;  3ZMZ A;  5LEJ A;  2V6C A;  3O2P E;  3K2Z A;  1BJA A;  4QLC U;  4ENK A;  5D6E A;  1LDD A;  4PCQ A;  1S3J A;  3HTU A;  1S8N A;  5L3C A;  2QLZ A;  2V1U A;  4LK1 F;  2NRA C;  1XB4 A;  1OYW A;  4IXA A;  3T8T A;  3L00 A;  2PFB A;  3V8K A;  3K1N A;  2JTV A;  3JW4 A;  4LMY A;  3SFZ A;  1ZLK A;  4WCG A;  2EJR A;  3BWG A;  2EA2 A;  3WU0 A;  4PDK A;  5DCM A;  4BQA A;  1E2X A;  2Y0M A;  4I09 A;  5ILU A;  2OZU A;  3VFZ A;  3LST A;  2CW0 F;  3QP6 A;  1RUO A;  2XRO A;  1TW2 A;  5KK1 A;  4A0Z A;  2GXB A;  1QPM A;  1U5T B;  2VBZ A;  3WTT C;  2CGP A;  2XKO A;  4ESF A;  3WTX C;  3RYP A;  5CVI A;  4GGG A;  2OZ6 A;  1I27 A;  5LHI A;  3TKY A;  5EEG A;  4A12 A;  3E6M A;  5HLH A;  1LEA A;  4EMS A;  1XDS A;  1LNW A;  2YPR A;  1DP7 P;  1O3R A;  3PFI A;  2KJB A;  1RUN A;  3FM3 A;  2DFI A;  1ZRF A;  2AS5 F;  4N9I A;  1TW3 A;  3I4P A;  2VON A;  5ICF A;  1L0O C;  1HW1 A;  4XSZ F;  3EDP A;  4KDP A;  2XAH A;  2DU9 A;  1Z1D A;  4P9U A;  5J8F A;  3KLO A;  1ZH5 A;  3WTZ A;  2M45 A;  3ECO A;  2RVC A;  4LJZ F;  5FLX Z;  5FD6 A;  3LAP A;  1XSV A;  1F9N A;  3RPQ A;  3QU3 A;  4CGZ A;  3KZZ A;  2DAO A;  2PJP A;  2FA5 A;  1XGS A;  4B09 A;  3KP7 A;  4M9X A;  1R1T A;  2OQR A;  3FXR A;  2J5P A;  5AIQ A;  4EJV A;  5D6F A;  2EFW A;  2V1X A;  3VB2 A;  4LLN A;  1HKT A;  3IKT A;  2A61 A;  4LGW A;  3KCC A;  3I64 A;  3I58 A;  1BI2 A;  1P4W A;  3LA7 A;  1BOA A;  3LQR A;  3CJN A;  2G7U A;  1G4D A;  4XBF A;  1QBJ A;  3GFM A;  5HS9 A;  1PDN C;  4KN4 X;  3ROU A;  3HHH A;  3KP3 A;  1S7O A;  4HOB A;  4RB2 C;  3REO A;  1TBX A;  4BXU A;  4A5M A;  3I0T A;  4WF2 A;  4Z2Y A;  5DYM A;  2ZFW A;  3CUQ A;  1ULY A;  2KIU A;  2BBY A;  2Q2E A;  3W6J B;  2E7X A;  2P6S A;  1K6O A;  2ELH A;  2XKP A;  2COM A;  4OIP F;  2QYO A;  5IT9 K;  2D1H A;  2FBI A;  3WTS C;  4M71 A;  2VC0 A;  2IA1 A;  3QRF F;  1QNT A;  4MHG A;  2LNB A;  4CDG A;  1T0F A;  1YYV A;  2YSR A;  4PGG A;  3U9G A;  2ISY A;  1YG2 A;  2QWW A;  3KET A;  2R3S A;  4LFU A;  2QEN A;  1FBQ A;  2QQ9 A;  2QUF A;  1U78 A;  2CQK A;  3M8F A;  3FF5 A;  2HDC A;  4JQF A;  5FB2 A;  2QQA A;  3J80 K;  5ICC A;  3WGI A;  4IVN A;  1B9M A;  5D4S A;  4HX7 A;  4O5V A;  3GW2 A;  3R60 A;  2CFX A;  1WI9 A;  2WWY A;  1R23 A;  3GO5 A;  2CWE A;  2H27 A;  3ELK A;  4LB6 B;  3J81 Z;  3Q5F A;  3S2W A;  4Y13 A;  1MD0 A;  2ETH A;  4FX4 A;  1GXQ A;  2ZCW A;  4I0B A;  2XHK A;  2V9V A;  2JRT A;  4BHC A;  1I1S A;  2GWR A;  4HYE A;  1H9T A;  2EWN A;  5DDG A;  2G9W A;  2AXL A;  4ZH4 F;  4B8X A;  3TDZ C;  2A3S A;  4UVB A;  3E5U A;  3RTR A;  3L09 A;  3ZN0 A;  2WC2 A;  4HX4 A;  1ZHF A;  1JHH A;  5D5W B;  1IN4 A;  4M9S A;  2Q8K A;  3ZMV A;  3HSE A;  4A6E A;  1O3S A;  3KE2 A;  5CVV A;  2M1B A;  3G73 A;  3E5X A;  4MQV A;  4RAZ A;  1Q1H A;  1RNL A;  3DXJ F;  4ETS A;  1FOK A;  5LHH A;  1A04 A;  1R1V A;  3I53 A;  5LRR A;  3GZ6 A;  4YFK F;  2G7H A;  1HSJ A;  1XN7 A;  1T38 A;  1FBU A;  4NHJ A;  3LWF A;  4M72 A;  3WG9 A;  5ERI A;  5HDK A;  4WWC A;  5BMZ A;  3LA2 A;  4HV6 A;  2P4W A;  3FMQ A;  1XGN A;  3H3Z A;  3KFW X;  4KT5 C;  1WQ2 A;  3W6K B;  4IHT A;  2EFQ A;  3E97 A;  1MDM A;  2HZT A;  3R61 A;  4GXO A;  2Z99 A;  5CVJ A;  3JSO A;  3T1B A;  5LHG A;  5CVR A;  5DEQ A;  2DQL A;  3C3W A;  2ACJ A;  1UST A;  5H6R A;  3BDD A;  3FXU A;  3OOP A;  1Z91 A;  1V4R A;  5LBQ A;  4L9T A;  1XGO A;  2W25 A;  4L9J A;  1YFH A;  2IA2 A;  4HLY A;  3VOD A;  2ESN A;  4GCV A;  2IA0 A;  5J6X A;  1OKR A;  1SD5 A;  2EFP A;  3HRM A;  1PP8 F;  1MJA A;  4EM0 B;  3O6B B;  3MCZ A;  1STZ A;  4O3M A;  2HFH A;  3EET A;  1G3S A;  1SMT A;  1K78 A;  2W24 A;  2HQR A;  3FXQ A;  2M5W A;  3DF8 A;  2P6T A;  1BIB A;  5DV5 A;  2Q0O A;  4HF1 A;  4UXN A;  3K1P A;  4U0V A;  5FD5 A;  5K5Q A;  3ERE D;  2Y48 A;  4Q47 A;  1JGS A;  2KIM A;  1REP C;  3VEP A;  3F8M A;  3GWZ A;  3TDU C;  1CF7 A;  5D5V B;  4ENJ A;  3MZY A;  5H20 A;  1I1G A;  4MEX F;  5DD4 A;  4AIJ A;  2PG4 A;  4ENN A;  2FBH A;  2H6B A;  3IRR A;  3I5U A;  5LRS A;  2HWV A;  2PMU A;  2PBI A;  1YW9 A;  2HEO A;  1V3F A;  2IVM A;  2VE9 A;  5DUI A;  4QWQ A;  3CO6 C;  1TQM A;  2QZ8 A;  3HSR A;  2A07 F;  1IN8 A;  1I5Z A;  5E1Z B;  5HS8 A;  5DD8 A;  3HIF A;  1B6A A;  2DPD A;  4BAY A;  1R7J A;  3RI4 A;  4IRI A;  2W57 A;  3DKW A;  1RZ4 A;  3KP2 A;  2NAZ A;  2HGC A;  1LQ1 A;  2DBB A;  4A0Y A;  4KMF A;  3N4M A;  5E18 F;  3JAM K;  3GEZ A;  1R1U A;  2RN7 A;  4KIB A;  2Z9O A;  2BYV E;  2HS5 A;  1G3T A;  3HOT A;  2FEZ A;  4P96 A;  3I54 A;  2HYF A;  4GYG A;  2ESH A;  3KP5 A;  5BS6 A;  1Y0U A;  2F5D A;  5E8I A;  1J7K A;  1EV7 A;  1LDK B;  2NS0 A;  2PLY A;  2M8E A;  2C6Y A;  4IRG A;  4FT8 A;  2GAU A;  1K79 A;  4CHU A;  2HTS A;  4LLL A;  3WTV C;  1FYM A;  3SXY A;  3T8R A;  3PQJ A;  4KIG A;  3GLX A;  4ZYD A;  4OIO F;  1GVJ A;  3DEU A;  3VOE A;  2R7D A;  4YFX F;  1SD7 A;  2QBY B;  2UXX A;  3RPU A;  2K4J A;  3ZMS A;  2HKX A;  2OD5 A;  1QGP A;  4ON0 A;  3KP4 A;  3COA C;  4BHB A;  2KJC A;  4RGS A;  3WGH A;  2OBP A;  2MH9 A;  3EQL F;  4CYD A;  1XGM A;  2DI3 A;  4EGY A;  3K69 A;  3M9A A;  3CUQ B;  2D2W A;  2HKO A;  1FYK A;  2PI0 A;  5HVQ C;  3WGG A;  2IJL A;  1GHC A;  2CSO A;  4IJA A;  4RAY A;  5D5U B;  2DQR A;  2VOP A;  1BBY A;  1U5T A;  2VBX A;  3GF2 A;  3IC7 A;  3IWZ A;  3BJ6 A;  4L5J A;  4RS8 A;  1UCR A;  3TGN A;  4M73 A;  1W5S A;  4AIK A;  1R5H A;  1XMK A;  4UNO A;  4OMZ A;  2JZY A;  1QQI A;  3RIR A;  5L3E A;  3LAJ A;  4I7H A;  1FP2 A;  4L9V A;  3V8L A;  1F1Z A;  1XCB A;  1H9G A;  1YLF A;  3E6B A;  2CG4 A;  4S05 A;  2OAZ A;  4BHP A;  4MEY F;  5E20 A;  3EYY A;  1EH7 A;  2O03 A;  1ZG3 A;  2IW5 A;  2O61 A;  2XAJ A;  1EH6 A;  1C0W A;  1R00 A;  4BNC A;  1U8R A;  1L3L A; 
#chains in the Genus database with same CATH topology
 2BZT A;  2VKH A;  2QVO A;  4L0Y B;  2O5R A;  5ED4 A;  4R79 A;  1RR7 A;  1FC3 A;  2WY8 Q;  5JLX A;  3LNQ A;  2DTR A;  2OC6 A;  1IV6 A;  2BY0 A;  2FE3 A;  2R5Y B;  2MH2 A;  3JRA A;  1IUY A;  1JXS A;  4NB5 A;  4LIU A;  5A2Q K;  2XAQ A;  2QBY A;  1DPU A;  2HOE A;  1GDT A;  1ZG5 A;  4HAM A;  3F8F A;  5M3F J;  4AYB N;  1X1B A;  2LP0 A;  4ZYE A;  1U5T C;  4EM1 A;  3KIO A;  5IYC J;  4PJM A;  1P4A A;  4PJL A;  1HC8 A;  2Y69 H;  2PMH A;  3V7S A;  2OTL I;  5JVT A;  1ACI A;  3BCA A;  4E6K G;  3K4L A;  3P9C A;  1KU9 A;  4HX8 A;  2PEX A;  5HNF A;  2E2I J;  3GUD A;  2LBF B;  5L3G A;  1LFU P;  1XS9 A;  2XIG A;  1BI3 A;  1ORK A;  1POG A;  1O7L A;  2D1V A;  3WU2 C;  4IHS A;  2FOK A;  1YIO A;  2JT1 A;  4X6A J;  5AON A;  5ILV A;  5HDN A;  5FRN A;  2XUB A;  2ZME A;  3N97 A;  2DMU A;  2UWM A;  1A31 A;  2XAG A;  3AKZ A;  1OPC A;  1FSH A;  1U6G A;  4EGZ A;  3KYD B;  1AWC A;  1TQI A;  4CCJ A;  5J40 A;  4EJT A;  2YX7 A;  4BY7 J;  4RM3 A;  2K9N A;  2JA7 J;  3OS1 A;  1OCR H;  3QQA A;  1ZGA A;  1ETX A;  4GRI A;  2X6X A;  1Z77 A;  5TIS C;  2CJJ A;  1K78 B;  3EYI A;  2EIM H;  4UUT A;  2WAD A;  3T5X A;  3IL2 A;  1NTC A;  4OAZ A;  3K4K A;  4LK0 F;  4PUS A;  4RB3 C;  4MNU A;  3FHN A;  2W85 A;  2Z2S B;  1VQ4 I;  1QZE A;  1HST A;  1E17 A;  4KIT B;  2JQ7 A;  1Y8R B;  1R49 A;  4LD5 A;  2KDO A;  4M9Z A;  4PGH A;  3R6S A;  3MKW B;  4ZTF A;  3IAS 2;  3AG1 H;  3PUB A;  4N4N B;  5B1A H;  1J5Y A;  4G7H F;  4IKF A;  1R6R A;  1KQ8 A;  3SQN A;  4I99 C;  2A5Y B;  3JRH A;  3QP5 A;  3E6C C;  1RR8 C;  2CS3 A;  3FX3 A;  5F6F A;  2FML A;  2HDW A;  4KN7 X;  4I98 B;  5FFX A;  2IGN A;  2KMU A;  1MND A;  2E36 A;  3I55 I;  4CCO A;  2XAF A;  2XAU A;  3DP7 A;  3F21 A;  5BPD A;  4RGU A;  4M6X A;  3RJP A;  5KHD A;  2YR2 A;  4NBQ A;  3A02 A;  2Z16 A;  3OR1 C;  4V19 K;  4PJJ A;  4GO1 A;  3V4G A;  3CTA A;  3Q0U A;  5L3B A;  4V2F A;  4WK8 F;  3G3Z A;  3U21 A;  4YFN F;  3P7N A;  4OIN F;  1D8K A;  1ETQ A;  3MZH A;  1FOW A;  5F64 A;  4LG0 A;  1UAA A;  3P9I A;  2GLO A;  3ZXS A;  3WG7 H;  4XOR A;  1VQO I;  3BG9 A;  5M3M J;  1QPI A;  4Y3O A;  2X85 A;  2XVC A;  1DUX C;  4HDV A;  4AU7 A;  3ZN1 A;  3GTM J;  3HSF A;  1XCV A;  1RC9 A;  2DO7 A;  4KIC A;  1VZ0 A;  3F9K A;  2NVX J;  3OYE A;  2W48 A;  2WAF A;  3E3V A;  4XR6 A;  1LE8 B;  1BC7 C;  1O3Q A;  3VPR A;  3HPG A;  2A6H F;  2F4O B;  4Q5S F;  3SZT A;  1FMV A;  2VAS A;  4A6D A;  3HC7 A;  3L2R A;  4AVP A;  4D1Q A;  2WAQ N;  4H0E A;  1SFX A;  4RB0 A;  4I02 A;  2BVL A;  3F8N A;  2ICW G;  4BDY A;  3ECH A;  3RSN A;  3CCR I;  1W36 D;  5IYD J;  4OMY A;  2IS6 A;  2OPT A;  1X3W B;  3U1D A;  4L0Z B;  2P81 A;  2LFB A;  5EZG A;  2KLO A;  4NQW B;  4ZDL A;  1TT5 B;  4IHY A;  2J5O A;  3F72 A;  2NNN A;  4M3F A;  5IOY A;  4F3Q A;  3PJR A;  4U0W A;  4IHV A;  1D1C A;  2WTE A;  3MEX A;  4XQF A;  1SEU A;  2L7F P;  3DTK A;  4E4H A;  3ABT A;  3HRS A;  2ZME B;  1R4M B;  1IXC A;  2M87 A;  2GA1 A;  3J7A O;  4IHW A;  4XMY A;  2W4S A;  2LRD A;  2XGX A;  4JX5 A;  3ZOB A;  2ADU A;  1JUM A;  3L2W A;  1HW2 A;  2M30 A;  4E70 A;  5J4Y A;  4BJ5 C;  1T98 A;  1Z6T A;  4L18 B;  3Q9V A;  4RM2 A;  1NK2 P;  2Y2Z A;  5ILS A;  4GFB A;  3S93 A;  3F23 A;  1JE8 A;  5B66 C;  1WPK A;  3F6V A;  3S1Q J;  3MN2 A;  2OA4 A;  4RA2 A;  2UXN A;  2B63 J;  2GIV A;  2RGV A;  1GXP A;  2ECC A;  2IS4 A;  2F4M B;  1MW7 A;  2W84 A;  3HJE A;  3TMO A;  4NUB A;  4IOA F;  3OV8 A;  4MFD A;  1Z6R A;  4RB1 A;  1QZZ A;  3RYR A;  1YJW I;  5A2Q Z;  1HDP A;  1HKQ A;  2RNG A;  2BXZ A;  1N25 A;  2IGO A;  2VOD A;  4QTR A;  5BPI A;  1KA8 A;  2DCE A;  2LDU A;  4JX6 A;  1WKM A;  1FWZ A;  4ANJ A;  4C3H J;  4F91 B;  1FMW A;  4UUS A;  3L1P A;  3A2K A;  3BR2 A;  3AG2 H;  2VXD A;  5KCM A;  5E3L A;  3LSM A;  2ZXI A;  5D8K B;  4HQM A;  4A69 C;  1HKS A;  4UVA A;  3LSJ A;  2ISZ A;  3H36 A;  3FIW A;  3H5A A;  5FO5 A;  3PSI A;  3K4C A;  3Q9S A;  2GXA A;  3OYL A;  2E34 A;  1X1D A;  4G12 A;  2RNJ A;  2L2O A;  4EEF G;  4LG0 B;  1P92 A;  2BEO A;  4WXH A;  2O8X A;  4U0Y A;  2H09 A;  3OY9 A;  1ONV A;  3G6E I;  3GTG J;  2V26 A;  2MW8 A;  1ENH A;  3KLN A;  2P0W A;  2IPQ X;  3H0D A;  4LIV A;  2EB7 A;  1BM9 A;  1IDY A;  4HW0 A;  5FFZ A;  3LSR A;  4XNF A;  1YO5 C;  1FPQ A;  2EA4 A;  4UV9 A;  2QCO A;  2L54 A;  4HQE A;  2VQH A;  5HLI A;  2FBK A;  1WJF A;  2E1N A;  3C1D A;  4PSW A;  1ZN2 A;  2RKH A;  3V7R A;  4ESJ A;  4XKV A;  3W3C A;  3FMR A;  3E0J B;  4XID A;  1QO0 D;  2BOL A;  4S04 A;  5EEH A;  4HF2 A;  3GZ5 A;  1Y8Q B;  1VTN C;  2VUM J;  5D8L B;  3EUH A;  1EH8 A;  1DPR A;  3LSP A;  3AG3 H;  4FIS A;  4A3C J;  1TWA J;  1V5E A;  2HZD A;  2CQ7 A;  2K7L A;  3C7J A;  2LG4 A;  4UVC A;  1K7A A;  2BY1 A;  3C2B A;  1H8A C;  3BY6 A;  4BJT A;  1D5V A;  1ETV A;  3KEQ A;  2HI3 A;  4AWX B;  2VN2 A;  5TRD A;  3FBN B;  1P9Q C;  3R0J A;  1XPX A;  4Y15 A;  4CCK A;  4M3D A;  2K5C A;  3G1L A;  2E2H J;  1J9I A;  1BR4 A;  4CYC B;  1WWX A;  2VXZ A;  2FMY A;  3P9K A;  2E5N A;  4LB5 A;  1VQ5 I;  2XRL A;  2ID3 A;  1BIA A;  2F2E A;  1HXD A;  4CZZ A;  2HVS A;  1W5T A;  4DNC A;  2EZL A;  3HRU A;  4XKB A;  3KYL A;  1LFB A;  3C18 A;  5KVR A;  1BOB A;  1YW7 A;  2DA3 A;  4IL6 C;  1ZYR F;  3QOP A;  1IXS B;  2FNA A;  1BA5 A;  4ESB A;  3RKY A;  2CV0 A;  4UUV A;  2V7F A;  1R36 A;  5E17 F;  1P7I A;  3BR3 A;  3F3X A;  2E2J J;  2FSW A;  2E60 A;  2KRF A;  1S7A A;  3ESW B;  3MQ0 A;  2CV2 A;  4R8H A;  2Y9Y A;  2L02 A;  1KU7 A;  4DIQ A;  3P5J A;  2UUZ A;  4YRV A;  2R7F A;  1T39 A;  5HNH A;  3WTU C;  2JA6 J;  5E79 C;  1IJW C;  2WB1 N;  3HUG A;  4HNU A;  1A6I A;  1VND A;  2VE8 A;  4EM2 A;  3L2U A;  1XSD A;  1YIT I;  4II2 A;  1I6X A;  1IRX A;  2PN6 A;  3K7A J;  5LGT A;  2KRC A;  2Z5U A;  4A3J J;  1MZB A;  3GTJ J;  3WTW C;  1DU0 A;  1JI8 A;  4I6Z A;  2E1C A;  4X0G A;  3UKG A;  3B73 A;  2HQN A;  2W00 A;  2X9D A;  3A0H C;  5EJC A;  1L3L A;  2P5V A;  3S32 A;  1V5G A;  3KPH A;  1J2X A;  4OU0 A;  3ZQL A;  3DPL C;  5GAE J;  3ISP A;  3I59 A;  3K6G A;  2E1O A;  2DJN A;  3M1E A;  1WSU A;  2VB6 A;  2L9S A;  3NEU A;  2VKV A;  5F08 A;  4Y7N J;  2ZKZ A;  1RES A;  1FSE A;  3TO7 A;  1IG7 A;  3S1R J;  1TLH B;  2NOG A;  1JJ6 C;  4HDU A;  2L4M A;  2KL4 A;  4B48 A;  2XGD A;  3OIQ A;  5H6Q A;  3TO9 A;  1X3Z B;  1FNN A;  2JUG A;  3K4B A;  1GT0 C;  4W1U A;  4HG2 A;  5CPR B;  4AIH A;  4Q48 A;  1ITY A;  4CZC A;  3PO2 J;  5BNG A;  2DA5 A;  5CQG A;  5IT9 Z;  3G71 I;  4ASN A;  3A01 B;  4BUP A;  4RGX A;  3OYH A;  5C44 J;  5J8C A;  5D4R A;  3ZPL A;  3R4K A;  3ZMU A;  3S3M A;  3BJA A;  5LLQ A;  2VOO A;  2MLK A;  2DA2 A;  5E3O A;  1W5C C;  2M9H A;  2A6E F;  3DKX A;  2DA7 A;  3FM5 A;  3IHU A;  3QYE A;  2RV8 A;  2XRN A;  4LIT A;  2HOS A;  1MJ9 A;  3CES A;  3G2B A;  1F43 A;  4XN0 A;  1WCM J;  3MFK A;  1FX7 A;  4U88 A;  2R5Z A;  3F8B A;  3S15 J;  6PAX A;  1TNS A;  1IAW A;  1B72 B;  1XX5 A;  5CVU A;  4G7O F;  3LQQ A;  5B3S H;  5KNL A;  4A3D J;  3OYJ A;  1LJ9 A;  3GME A;  2DOD A;  5JI6 A;  3D5R C;  2WV0 A;  3VWB A;  3H5N A;  2HOT A;  2HU9 A;  4E7I A;  4B1R A;  1AU7 A;  3JTG A;  3ZP5 A;  1MNM C;  5DM6 F;  3L2Q A;  3ZQ7 A;  3CCQ I;  1G3W A;  3CUO A;  3IH2 A;  3L9F A;  2K86 A;  1USS A;  2DDB A;  3BPV A;  3I9V 2;  4OIR F;  2XGE A;  5EG0 A;  1SVL A;  1FLI A;  2RC4 A;  1IN7 A;  3ML6 A;  1FY7 A;  2M4G A;  4I2O A;  1KZH A;  4PFO A;  3RKW A;  2OTJ I;  5FGM A;  1K4S A;  1HCR A;  3WOD F;  3I56 I;  4GYI A;  1FTT A;  2MD5 A;  2GM4 A;  2YS9 A;  4IO9 F;  3BP8 A;  4M74 A;  3ASO H;  3DTE A;  4EJW A;  2DLL A;  2ID6 A;  2W7N A;  1NHA A;  4XL9 A;  1P7J A;  1I3Q J;  2E1M B;  4G9Y A;  3D0S A;  2CUZ A;  1HQC A;  1LEB A;  4CO8 A;  4AID A;  1YHQ I;  2GOM A;  4HBL A;  1Z05 A;  4HNT A;  1BW6 A;  3GVA A;  3BRO A;  1ZAO A;  4L5E A;  5IOZ A;  4YII A;  2D5V A;  1YQA A;  2Z33 A;  1KU2 A;  4IF4 A;  4PSX A;  5FLX K;  3H5R A;  3CO7 C;  3MKY B;  3NAU A;  1G3Y A;  3PUF A;  1X4P A;  4EJU A;  4IZZ A;  1B4A A;  1S29 A;  5BOX A;  4XLA A;  1S6L A;  4AYB A;  1I39 A;  2H6C A;  1G6N A;  4G6Q A;  1WJ5 A;  4J19 A;  2X1C A;  3H92 A;  3FZV A;  5E8G A;  4J00 A;  4CCL A;  3QU6 A;  3S8P A;  2MGQ A;  3DV8 A;  1NK3 P;  2D45 A;  3CCV I;  3ZQI A;  1V55 H;  5JFR A;  5J1U A;  3R0A A;  2IRF G;  3U2R A;  3K9T A;  2F5E A;  3TOA A;  4RAF A;  1S72 I;  3QOD A;  2EK5 A;  3RKX A;  2DA6 A;  2MFZ A;  3GTP J;  5FJ8 J;  2MA3 A;  4XIC A;  2HYG D;  4N0B A;  2R7W A;  1O3T A;  4BKX A;  1IN5 A;  3MD2 A;  4G8X A;  1SD4 A;  3TQN A;  4XSX F;  4U7D A;  3ZMT A;  2FQ3 A;  2TDX A;  2DA1 A;  4P55 A;  3TP0 A;  2NS8 A;  1W1W E;  5HLG A;  2X0L A;  5TGT A;  1ZGW A;  1SVO A;  3OOU A;  4UUS B;  4CCN A;  4M6Y A;  2GOX B;  1TWG J;  2A69 F;  1JKQ C;  3A01 A;  2VJJ A;  4FE7 A;  1Y1W J;  3V8J A;  4PJN A;  2LD5 A;  2L4A A;  1Z21 A;  4OOI A;  3ZMD A;  5HLT A;  3CCE I;  2XC7 A;  2GZW A;  4IQJ A;  2EQR A;  4YG2 F;  1CGP A;  2I10 A;  2VIX A;  4DZJ A;  1QA6 A;  5LGN A;  5F1R A;  2CO5 A;  3KP6 A;  2E1M C;  3HDD A;  4G7Z F;  2EZI A;  2F5C A;  2N8G A;  1FYL A;  2E19 A;  4CCM A;  2COB A;  1SMY F;  2EFN A;  4C2U A;  1T6S A;  2EV6 A;  1K4T A;  1TT0 A;  4IPA A;  1IN6 A;  1OMI A;  2BE5 F;  3CP2 A;  2ZNZ A;  1D8J A;  2IBD A;  3WTY C;  2K9S A;  4C9Y A;  4DW6 A;  4WXD A;  2R7O A;  2UZK A;  1HBX G;  2JA5 J;  4ZZL A;  3OYA A;  4C3I J;  1MH4 A;  5HDG A;  4EJO A;  3CLO A;  2EFO A;  3QPT A;  1KYZ A;  3OYI A;  4OIQ F;  3M1C A;  4ZZD A;  1B1B A;  1UB9 A;  2H94 A;  4KUM A;  4HLX A;  3TO6 A;  1UHW A;  1WJB A;  3LSH A;  2HOA A;  4G6D A;  3E7L A;  5KAF C;  4MFE A;  4FX0 A;  1X3U A;  1TZL A;  2DT5 A;  3WU1 B;  1Z9C A;  2V4J C;  2E35 A;  4BU2 A;  2HPM A;  1U3E M;  3OL3 A;  3ZGK A;  2XDV A;  3WE3 A;  2FQ4 A;  4NQW A;  3JSP A;  3GFI A;  3FK7 A;  2RDP A;  2VI6 A;  1X2M A;  2DTZ A;  1VQ7 I;  1ETO A;  3MMY B;  3FWE A;  3HB9 A;  3TP3 A;  2Y0S N;  2NXN B;  2UV1 A;  2ZC2 A;  4LLG F;  2L9V A;  3TW6 A;  2HYJ A;  1MSF C;  3GXO A;  5JR3 A;  3T0Y A;  1TTY A;  1A36 A;  3BZ6 A;  3SEQ A;  1BN5 A;  2LY9 A;  2X1D A;  3MWM A;  2XSD C;  3J80 Z;  2Z3Y A;  1LVA A;  2YUS A;  5L3F A;  1W7P B;  3JTH A;  3ABU A;  2LBF A;  1PUF A;  4ITV A;  2IXS A;  3PNT A;  1ZR4 A;  1O57 A;  3K0L A;  3MZ8 A;  1QZY A;  3QYF A;  2JPC A;  3HKZ N;  1MKM A;  1B59 A;  1OCP A;  3WE2 A;  1TNT A;  2FNP A;  2CYY A;  4KJZ A;  1ZRE A;  3W6V A;  2V6E A;  2Y75 A;  2HTJ A;  1XD7 A;  1PUE E;  3GTK J;  1X1P A;  1Z3X A;  4NC7 A;  4RLQ A;  3O8H A;  3OYD A;  1R9T J;  2VQG A;  2IP2 A;  2O6G E;  1J0R A;  5CYV A;  2L01 A;  3IH3 A;  1J75 A;  1WH5 A;  4PFP A;  3RZO J;  1LUJ B;  4MTD A;  5HOO A;  2R7S A;  3K1M A;  3HRT A;  2DOE A;  3GX4 X;  5DTD A;  5LGU A;  4C2M J;  3H35 A;  4MIM A;  2O0Y A;  3S17 J;  2JRM A;  3BTJ A;  2DFH A;  2JMW A;  3M8J A;  2JN6 A;  3J81 K;  5K5O A;  1VQ8 I;  3L7W A;  3DQV C;  4B4C A;  2R4G A;  1IRF A;  1TWF J;  2PQ8 A;  4EV0 A;  5M5Y J;  2WB1 A;  2A6T A;  3F6O A;  1Y39 A;  2X6W A;  1U2W A;  3I71 A;  1ZLJ A;  1X1C A;  4RAG A;  3BR0 A;  1FIP A;  1ZG1 A;  3K4J A;  1BC8 C;  1BI1 A;  4WX9 A;  1SAU A;  4XLP F;  2BGC A;  3B6C A;  3HGY A;  3GYH X;  5K1Y A;  2Y9Z A;  3KEY A;  2Y31 A;  3E6D A;  2MBF A;  4M3B A;  1GV2 A;  4B47 A;  1PP7 U;  3KZY A;  3D5L A;  1FT9 A;  5F0F A;  2VPR A;  2KIQ A;  1ZRD A;  4KIS A;  4HA8 A;  2OQG A;  1UEL B;  5JVG F;  2YU3 A;  3PQK A;  4R1H A;  4FQG A;  5AIP A;  4U7B A;  3JRF A;  3DKY A;  3OYK A;  1T33 A;  3B02 A;  2CUF A;  3A1Y A;  1TQP A;  5K7Z A;  2K4B A;  2PMZ N;  3IWF A;  5D5X B;  1ZKG A;  3FMS A;  1ETK A;  2F5F A;  5F0C A;  2VT2 A;  1ON1 A;  4XRF A;  1P2F A;  1G8X A;  2FOW A;  3G1M A;  4K2E A;  3F8C A;  5IP6 A;  1R22 A;  4ZC3 A;  1SFO J;  1XSX A;  1HLV A;  1FZP B;  2YU9 J;  3GFJ A;  2BY3 A;  3D1N I;  4L5I A;  3BJO A;  2QSF X;  2X4H A;  3HOV J;  3E5Q A;  3DEE A;  2FRH A;  2XPU A;  3I59 B;  5DM7 F;  1DDN A;  1LDJ A;  1EA3 A;  1OYY A;  1S5L C;  2AO9 A;  2MLG A;  3ULQ B;  4Q4Z F;  2VT3 A;  2YX4 A;  1MBJ A;  4OAY A;  1AKH A;  3DCF A;  5JLW A;  2WY7 Q;  4KT6 A;  4ZYA A;  3CZ6 A;  1W4M A;  2HR3 A;  1MMN A;  2DFF A;  3I3L A;  4A0X A;  1KQ9 A;  3S2D J;  2E7W A;  2STT A;  1O7F A;  5LEK A;  2ELK A;  1ON2 A;  1U0J A;  1T08 B;  2DW4 A;  3PNY A;  2R7X A;  4BDZ A;  2MC3 A;  4PK4 A;  2HNH A;  2LF7 A;  3HOW J;  1N78 A;  2LVS A;  2P7C B;  3HYI A;  1OJL A;  2KKO A;  1IRZ A;  1SAX A;  1JKR C;  2B7E A;  3MAJ A;  1UG2 A;  4A93 J;  2EPF A;  4CA0 A;  2DK8 A;  5DCM B;  2AQF A;  3D5S C;  3PM1 A;  3N05 A;  4XOP A;  4BL0 B;  4DJA A;  5HOD A;  2V1D A;  1YI2 I;  1YX3 A;  1P6R A;  2O3F A;  4A3L J;  4O6J A;  2VJI A;  4CSW A;  4JX4 A;  3IV5 A;  1WRJ A;  5L3D A;  4MO7 A;  3IKV A;  1HF0 A;  4I01 A;  4IRH A;  5FKN A;  1UFM A;  1Y6I A;  1OCO H;  1SC7 A;  2QSH X;  2VC1 A;  1ZRC A;  2VLA A;  2NS7 A;  4KIF A;  2MYS A;  2BV6 A;  1F4K A;  2R5Z B;  2CUJ A;  5JHU A;  4C30 A;  4IHX A;  2X1E A;  2QQB A;  1LB2 A;  3L2V A;  4A2U A;  1KYW A;  2IS1 A;  4UHT A;  4XLN F;  5K7H A;  1ODD A;  4BBR J;  3NRV A;  3HG9 A;  1OCZ H;  1ZR2 A;  3LFK A;  2FUG 2;  3VSL A;  2R7R A;  4XOT A;  4F7Z A;  1FIA A;  3LA3 A;  1MDM B;  2DPU A;  4XKW A;  2HQA A;  1H0M A;  3NQO A;  5DCF A;  2KIF A;  1ETY A;  1X1A A;  4P9F A;  4D5C A;  1IXR C;  4D7M A;  2XAS A;  4AUX A;  2EZK A;  3NAR A;  2P5K A;  3CDH A;  1VI0 A;  1VQ9 I;  3QPL A;  1R5G A;  4P5O A;  2VBW A;  4EQQ A;  1X19 A;  4A5N A;  4Y17 A;  1SFE A;  1MGT A;  1QVT A;  1N77 A;  1FJL A;  1P4X A;  2TCT A;  2RQP A;  2NYX A;  4UV8 A;  1CF7 B;  4YEJ A;  4Y33 A;  3CUQ C;  4E7L A;  2HDD A;  3GFL A;  1LPQ A;  2V9K A;  1IV8 A;  1JUP A;  2QGU A;  3OIP A;  4BJ6 C;  5FKM A;  3ERM A;  3FK6 A;  3TBI A;  3MKL A;  1YS6 A;  2GXG A;  4N9H A;  1Z3Y A;  1YS7 A;  5K5R A;  1GVD A;  2P7V B;  3FIS A;  1SFU A;  3KEO A;  2MAB A;  5CJ9 A;  4DQ2 A;  2XSJ C;  4BY1 J;  1DP3 A;  2K3F A;  3FHZ A;  2M4K A;  2WAQ A;  2EBI A;  2BHY A;  1XDU A;  2EV5 A;  2LKP A;  1IZ1 A;  4J01 A;  4A3G J;  1YRN B;  2PX9 A;  2JUC A;  5JHF A;  1TC3 C;  2DYS H;  4CIC A;  1WH7 A;  4RGR A;  4JK1 X;  1B9N A;  2KIS A;  5EZH A;  2NVY J;  2LY2 A;  4DOZ A;  3ZR8 X;  3DFG A;  1MH3 A;  3O3K A;  2XF7 A;  4Y4R A;  3BPX A;  4BYY A;  3BOQ A;  2DK5 A;  3QAH A;  4KFC A;  1GUU A;  1YW8 A;  4W97 A;  4ZYH A;  1MJB A;  4MGR A;  3CCL I;  2QF7 A;  3DPT A;  1IRG A;  4IX7 A;  2FXA A;  1UHM A;  4HF0 A;  3ZQF A;  1T2K A;  2LC2 A;  5GAD J;  1JHF A;  3HTS B;  2V79 A;  2ZJ2 A;  1Z7U A;  3H3U A;  3DWL E;  1R71 A;  3PIO F;  2K02 A;  3CMM A;  2AQE A;  3G4S I;  1ZGJ A;  1FBS A;  3JRB A;  1U9O A;  3L2C A;  5EG0 B;  3IRQ A;  1IF1 A;  5GAG J;  5BQT A;  1JKP C;  2Y30 A;  3ABK H;  1WJA A;  2BW3 A;  3V42 A;  4F92 B;  3KZI C;  2GA2 A;  2MD0 A;  5EEA A;  2P8T A;  1J59 A;  5CLS A;  1VQL I;  3F22 A;  1R4N B;  1E3P A;  4PZJ A;  4FET A;  1RIO H;  1D3Y A;  1O4X A;  4BE2 A;  1MSE C;  5C4J J;  2QSG X;  4HV5 A;  4M3G A;  3HOS A;  1X2N A;  3GTO J;  2JSC A;  1H89 C;  2F48 A;  4NC8 A;  3QPH A;  2ZXJ A;  1XG1 A;  3DBH B;  5ICG A;  1YX5 A;  2ZBK A;  4L9N A;  5M5X J;  3V7C A;  2GQQ A;  1D1A A;  1OR7 A;  3PSF A;  2LSO A;  3NWS A;  1XMA A;  4HZF A;  4H4K C;  5HS7 A;  3Q0V A;  5K7F A;  4XRS G;  1FP1 D;  1KGS A;  3AAF A;  3HHG A;  3TW7 A;  4CXF A;  1SD6 A;  1OFC X;  2DMT A;  3DBL B;  2QM3 A;  5J3L A;  1F5T A;  3RDI A;  2XV4 S;  2NNY A;  5FKL A;  3B6A A;  2EV0 A;  1X58 A;  4WXC A;  2A68 F;  2KRH A;  3FXO A;  4JBA A;  4KYW A;  5DUK A;  2V1N A;  3BR5 A;  3SHF A;  4NNJ A;  2ZJQ F;  1TP4 A;  3TOB A;  1ZK8 A;  2FF4 A;  4ZYG A;  2ZO4 A;  2P5L C;  5IP7 J;  4G94 A;  3ONQ A;  1KON A;  1YTY A;  2OU2 A;  1R58 A;  2LF8 A;  4I0A A;  3OYF A;  4Y52 J;  3BG5 A;  1W7P D;  2KQR A;  4MTE A;  1TWC J;  2L3D A;  5E1W A;  3CMA I;  4F52 A;  1SVM A;  2IT0 A;  4KA4 A;  3OL4 A;  4AD9 A;  2JPB A;  4BH9 A;  4KMU X;  2FU4 A;  1QHG A;  3K70 D;  4YIF A;  1KU3 A;  3VYR B;  4DBQ A;  2QA4 I;  2B0L A;  5EGO B;  2ECB A;  5FRO A;  3GCM A;  1BI0 A;  4FHT A;  2XGC A;  3IAM 2;  3M7G A;  4MLO A;  5M5W J;  3M8E A;  2K27 A;  1V54 H;  3SZP A;  1ZAR A;  4Z6Y A;  3LOC A;  4TV7 A;  4ENM A;  1A5J A;  3CJT B;  1W7P A;  1RET A;  1RI7 A;  3BQY A;  1AOY A;  2CRG A;  2CUE A;  1XTA A;  5E1X A;  1JT6 A;  1OYI A;  2F6C A;  4KNY A;  3AL0 B;  2ZNY A;  1IW7 F;  2XF5 A;  3JRG A;  5TJJ A;  1HW5 A;  5IT3 A;  5F0H A;  2R93 J;  5ICE A;  2VBY A;  4II3 A;  4E7S A;  4D0P A;  4JOM A;  1OR7 C;  1KQ0 A;  4EVI A;  3K10 A;  3LSK A;  4MQ9 F;  2STW A;  2G0E A;  3A0B C;  2IAI A;  2QKM B;  3SFI A;  2JJ7 A;  3JAM Z;  3ZMZ A;  5LEJ A;  2V6C A;  2PMZ A;  3CQZ J;  5E3N A;  3O2P E;  2M2E A;  1SFK A;  3K2Z A;  1TL8 A;  2R7V A;  2LKS A;  1BJA A;  4S0H B;  4QLC U;  5LD2 C;  4ENK A;  5GTI C;  5D6E A;  1LDD A;  4PCQ A;  1S3J A;  3HTU A;  2JA8 J;  1S8N A;  5L3C A;  2QLZ A;  2V1U A;  4A3F J;  4LK1 F;  2NRA C;  3H0G J;  2HQ5 A;  1XB4 A;  1UJ8 A;  3NWT A;  2RRE A;  1OYW A;  2DXI A;  4IXA A;  1NH3 A;  3T8T A;  1IGN A;  3DU6 A;  3SYT A;  3BQZ A;  3L00 A;  4M6V A;  2PFB A;  2IEK A;  2VPL A;  3CME I;  3V8K A;  4QPQ A;  1A35 A;  3K1N A;  2LMD A;  2JTV A;  3CMY A;  3JW4 A;  4LMY A;  3SFZ A;  1ZLK A;  4WCG A;  3GTL J;  2K3P A;  1IUF A;  3HM5 A;  5H2F C;  1GLN A;  2GIZ A;  2EJR A;  4ABZ A;  3BWG A;  2EA2 A;  4A3E J;  2CFO A;  3WU0 A;  4DYC A;  4PDK A;  5DCM A;  3BZK A;  1W0T A;  1B8I A;  4BQA A;  5DS9 A;  1AA7 A;  1E2X A;  2XB0 X;  3OYN A;  2Y0M A;  3SJM A;  2OUM A;  4I09 A;  1ERD A;  5ILU A;  2OZU A;  3VFZ A;  3LST A;  1JKO C;  4XRS A;  2CW0 F;  2NVU B;  3QP6 A;  4P1W A;  1RUO A;  2XRO A;  1TW2 A;  2O7O A;  2LR8 A;  5KK1 A;  4B3A A;  3I4M J;  1Y0N A;  4IQ4 A;  4A0Z A;  2GXB A;  1QPM A;  1CQT A;  1U5T B;  1F36 A;  2VBZ A;  3WTT C;  2CGP A;  2XKO A;  4ESF A;  3FKJ A;  1R5I D;  3OSG A;  1AKH B;  3WTX C;  2BY2 A;  1B72 A;  3EUH C;  2KZG A;  2E5Z A;  3RYP A;  5CVI A;  4OWR B;  3SDG A;  3VYT B;  1D0X A;  4GGG A;  2XF6 A;  2OZ6 A;  1I27 A;  2K40 A;  5LHI A;  3IH4 A;  3TKY A;  3VSK A;  5EEG A;  4A12 A;  3E6M A;  4LOC A;  1JGG A;  5HLH A;  1LEA A;  1D0Z A;  4EMS A;  1XDS A;  1I50 J;  1LNW A;  3PNV A;  4JYK A;  2YPR A;  1DP7 P;  4FE4 A;  2NVT J;  2Y0S A;  1E0E A;  2KP6 A;  1O3R A;  3PFI A;  1APL C;  1FTZ A;  2HXI A;  5EGO A;  2KJB A;  2X51 A;  1RUN A;  3FM3 A;  2DOA A;  3FBI B;  2DFI A;  2M7B A;  1ZRF A;  2AS5 F;  1K83 J;  4HNV A;  3W2V A;  4N9I A;  1TW3 A;  3I4P A;  2VON A;  5ICF A;  3C2G A;  5GAH J;  1BJZ A;  1L0O C;  1HW1 A;  4XSZ F;  3EDP A;  4KDP A;  2XAH A;  2DU9 A;  1Z1D A;  3LSG A;  4P9U A;  5J8F A;  3KLO A;  1ZH5 A;  3C2H A;  3WTZ A;  1MMD A;  3CC2 I;  2M45 A;  5KAI C;  4C3J J;  3G1O A;  1YJ9 I;  3CCY A;  4GDF A;  1W36 C;  3JCU C;  3ECO A;  2H1K A;  2RVC A;  2M8G X;  4LJZ F;  5FLX Z;  5FD6 A;  4B44 A;  1T95 A;  1XSV A;  4XLC A;  3LAP A;  1F9N A;  3RPQ A;  3OYB A;  3QU3 A;  2R5Y A;  2F5V A;  4BGD A;  4BAC A;  3BCB A;  1BL0 A;  1HA8 A;  4CGZ A;  2A05 A;  3KZZ A;  2DAO A;  2PJP A;  2FA5 A;  1XGS A;  1PUF B;  4B09 A;  3KP7 A;  4M9X A;  1R1T A;  2A5W A;  2OQR A;  2RQQ A;  2DDA A;  3FXR A;  2J5P A;  4EAT A;  2PJR A;  2EIK H;  2DA4 A;  5AIQ A;  2HVQ A;  4AM3 A;  2CW7 A;  3IUO A;  3CC4 I;  4EJV A;  5D6F A;  3RKQ A;  2EFW A;  5J1R A;  1LKX A;  4DBR A;  2V1X A;  3VB2 A;  4LLN A;  1HKT A;  3IKT A;  2A61 A;  4LGW A;  3KCC A;  3M3Y J;  3HZJ A;  4HST A;  4BQO A;  3I64 A;  4BXF A;  3I58 A;  1BI2 A;  1P4W A;  3BTC A;  3LA7 A;  1BOA A;  3CDI A;  3OMY A;  3LQR A;  3CJN A;  2ZXH A;  2G7U A;  3FXJ A;  3OSF A;  1G4D A;  4XBF A;  1OCC H;  3LMM A;  1QBJ A;  3GFM A;  3FXL A;  5HS9 A;  5GP9 A;  1PDN C;  1QRY A;  1VQP I;  2JWT A;  5FLM J;  4KN4 X;  4XLF A;  3TL4 X;  2BW3 B;  3ROU A;  3HHH A;  3KP3 A;  1S7O A;  4HOB A;  4RB2 C;  3REO A;  1TBX A;  2X6Y A;  2AHQ A;  3PFY A;  4BXU A;  2K9L A;  4A5M A;  1G2H A;  2FX0 A;  3I0T A;  4D5F A;  4WF2 A;  4Z2Y A;  2JSP A;  2IS2 A;  2KZV A;  2LOO A;  5GPA A;  3ZQH A;  5DYM A;  2ZFW A;  3CUQ A;  4U87 A;  1ULY A;  2V9P A;  3PL8 A;  4X1E A;  5E3M A;  2JVH A;  2KIU A;  3QPS A;  3MKZ A;  2K9Q A;  2CH0 A;  2BBY A;  1MBH A;  2Q2E A;  3HL2 A;  3GZN B;  2GBY A;  1DGR M;  4AVZ A;  1MNE A;  2I5U A;  3H9G A;  3W6J B;  2E7X A;  2P6S A;  1K6O A;  2ELH A;  3CCM I;  2XKP A;  2COM A;  5J4V A;  4OIP F;  4UY8 I;  2QYO A;  1OIS A;  2EIJ H;  5F1J A;  5IT9 K;  2D1H A;  2L7K A;  1U9N A;  2FBI A;  2DYR H;  3WTS C;  1RRJ A;  4M71 A;  1I3A A;  3FKI J;  3VYU B;  4XKC A;  2IA1 A;  3JRI A;  3QRF F;  1QNT A;  4MHG A;  2LNB A;  3OS2 A;  5C3E J;  2ZJP F;  1WJC A;  4CDG A;  1T0F A;  2H8W A;  3W2A A;  1YYV A;  2YSR A;  4PGG A;  1D1B A;  4ZDP A;  1ETW A;  3U9G A;  2ISY A;  1YG2 A;  2QWW A;  3KET A;  1EF4 A;  2LKX A;  2R3S A;  4LFU A;  2VJ4 A;  2ZJR F;  2CQQ A;  3K4N A;  2QEN A;  3M4O J;  1FBQ A;  2QQ9 A;  2QUF A;  1U78 A;  3GBG A;  2CQK A;  3M8F A;  3FF5 A;  3E1S A;  2HDC A;  2CMP A;  4BQN A;  4JQF A;  2QEX I;  5FB2 A;  2QQA A;  3J80 K;  5B5E C;  5ICC A;  3WGI A;  3HEF A;  4IVN A;  1B9M A;  3HKZ A;  3BG3 A;  5D4S A;  4NDL A;  1IC8 A;  4HX7 A;  4BEH A;  5EYR A;  4O5V A;  3GW2 A;  1SAN A;  3R60 A;  2CFX A;  2Z1D A;  1WI9 A;  2WWY A;  1R23 A;  3GO5 A;  4XLH A;  2NVQ J;  2ME6 A;  4FTH A;  2CWE A;  2H27 A;  4PJ0 C;  3ZRG A;  1NG7 A;  3OYG A;  1HDD C;  3CCU I;  3ELK A;  4LB6 B;  3H1C A;  2BXY A;  3J81 Z;  4XK4 A;  3Q5F A;  3J7A Y;  2M34 A;  3OWT A;  3BR6 A;  3S2W A;  2JA2 A;  4Y13 A;  1MD0 A;  3A03 A;  4XM3 A;  2ETH A;  2VJ5 A;  1UMQ A;  4FX4 A;  1GXQ A;  3BG6 A;  2R7Z J;  2ZCW A;  3OR2 C;  4I0B A;  2XHK A;  2V9V A;  3DEW A;  2JRT A;  4RMN A;  4BHC A;  1I1S A;  2ELJ A;  2GWR A;  4HYE A;  1H9T A;  1EJ9 A;  2DMQ A;  2EWN A;  5DDG A;  2G9W A;  3CF2 A;  2AXL A;  2KFD A;  4ZH4 F;  3CF5 F;  4B8X A;  3H9Q A;  4RDU A;  3TDZ C;  4BQQ A;  2ZFU A;  3WHB A;  2A3S A;  3ABM H;  4UVB A;  2K9M A;  3E5U A;  2HVR A;  3RTR A;  1S7E A;  1WGX A;  4E7H A;  3CDL A;  2EZH A;  3L09 A;  3AFH A;  3ZN0 A;  2WC2 A;  4D7N A;  4HX4 A;  3LL7 A;  3ZQQ A;  2L5Q A;  2HPI A;  1ZHF A;  1NG6 A;  1JHH A;  1WJE A;  5D5W B;  1IN4 A;  4M9S A;  2DT7 B;  2Q8K A;  3ZMV A;  3CCJ I;  3HSE A;  4A6E A;  4FAS D;  3ZQG A;  4QIW N;  1O3S A;  3KE2 A;  5CVV A;  2M1B A;  4F93 B;  3RQI A;  3G73 A;  3E5X A;  4MQV A;  4RAZ A;  2Q2E B;  3JRC A;  1Q1H A;  1PVE A;  1RNL A;  2VQC A;  4ZDO A;  1IO2 A;  3DXJ F;  1LVK A;  1WVR A;  4ETS A;  3IP4 B;  1JT0 A;  1FOK A;  2ZSI B;  2XPW A;  2R7Q A;  3AG4 H;  3ABL H;  1RPW A;  5LHH A;  2LTP A;  1A04 A;  2W82 A;  1R1V A;  4B3X A;  1YRN A;  3I53 A;  5LRR A;  3F0C A;  3GZ6 A;  2DOF A;  4V2G A;  4YFK F;  2G7H A;  1HSJ A;  3QYB A;  4DGW B;  1XN7 A;  2MC4 A;  1MIJ A;  1T38 A;  1FBU A;  4G6T B;  1BR1 A;  4NHJ A;  3LWF A;  5FRM A;  4M72 A;  3WG9 A;  5ERI A;  5HDK A;  3H9J A;  4WWC A;  5BMZ A;  1WFX A;  2L9R A;  3LA2 A;  2JK3 A;  4HV6 A;  2CW8 A;  2VQL A;  2P4W A;  3FMQ A;  4BE1 A;  1BW5 A;  1FOY A;  1XGN A;  3H3Z A;  3KFW X;  4KT5 C;  1JUS A;  1WQ2 A;  3W6K B;  4IHT A;  3O8G A;  1ZQ3 P;  2LYC A;  3J7Y J;  4AC0 A;  2EFQ A;  3E97 A;  1MDM A;  1VF9 A;  2B9S A;  2WV1 A;  2HZT A;  3R61 A;  2BHZ A;  2KDZ A;  4GXO A;  2Z99 A;  5CVJ A;  3JSO A;  4IEJ A;  2QQ8 A;  3DU5 A;  3T1B A;  4DYQ A;  3HOU J;  5LHG A;  1G59 A;  5CVR A;  5EDN A;  5DEQ A;  2DQL A;  3C3W A;  3DLA A;  3ASN H;  1UST A;  5H6R A;  2ACJ A;  3GTQ J;  3BDD A;  2L9N A;  3FXU A;  5FLV A;  1BR2 A;  3OOP A;  1RKW A;  2VKD A;  1E3H A;  1Z91 A;  1V4R A;  2MG4 A;  4L9T A;  2WA0 A;  5LBQ A;  1XGO A;  1MBG A;  5IPA A;  4DYR A;  1WI3 A;  4QPO A;  3PIP F;  1FOX A;  1H88 C;  1Q1V A;  2W25 A;  4L9J A;  1YFH A;  2IA2 A;  4HLY A;  3VOD A;  2ESN A;  3K70 C;  4FCY A;  4GCV A;  2K85 A;  1EKE A;  2CQX A;  2KPM A;  2IA0 A;  2FD5 A;  4CH7 A;  1OKR A;  5J6X A;  1S9H A;  1SD5 A;  2EFP A;  3HRM A;  5IY5 H;  1PP8 F;  1MJA A;  3CCS I;  4EM0 B;  2E71 A;  3O6B B;  3HOX J;  3MCZ A;  3EPZ A;  2XB5 A;  1STZ A;  4O3M A;  2HFH A;  1Y56 A;  1LE8 A;  2BVM A;  2DMN A;  1G3S A;  3EET A;  4A3I J;  1SMT A;  1QU3 A;  1K78 A;  2W24 A;  2HQR A;  3FXQ A;  2M5W A;  3DF8 A;  2P6T A;  1BIB A;  3BG7 A;  5DV5 A;  3SDB A;  1YIJ I;  1I6H J;  2Q0O A;  2R7T A;  1DGW Y;  2Q1Z B;  4HF1 A;  3CJR B;  4UXN A;  3U1K A;  3K1P A;  3CC7 I;  2M0C A;  4U0V A;  1QVU A;  3HOZ J;  1J09 A;  5FD5 A;  1T0F C;  4YEL A;  3EUA A;  3OYC A;  5K5Q A;  3ERE D;  4C2T A;  2Y48 A;  4RLF A;  2O8K A;  4Q47 A;  1JGS A;  5CKT A;  2ZME C;  1OLT A;  3KX2 A;  4I76 A;  3X2Q H;  2KIM A;  5B1B H;  1REP C;  1VQ6 I;  3VEP A;  3F8M A;  3GWZ A;  3TDU C;  1CF7 A;  1JTY A;  2CU7 A;  5D5V B;  4ENJ A;  3FDY A;  3MZY A;  5C4X J;  1JTX A;  4BBS J;  5H20 A;  1I1G A;  5IP9 J;  2LH9 A;  2LRE A;  4ZJZ A;  4MEX F;  5DD4 A;  4UB8 C;  4AIJ A;  1UZC A;  3TED A;  2PG4 A;  2F4I A;  5J1Y A;  4ENN A;  3PO3 J;  3BLY A;  1RKT A;  1B8I B;  2FBH A;  2H6B A;  3MVP A;  2OV7 A;  3IRR A;  1JJ8 C;  1VQK I;  3SEZ A;  3WHC A;  3I5U A;  5LRS A;  2HWV A;  2PMU A;  2PBI A;  1YW9 A;  2HEO A;  1V3F A;  2NOJ B;  2IVM A;  2VE9 A;  2EH3 A;  1N75 A;  1ZTR A;  2MSY A;  5DUI A;  4QWQ A;  1OQY A;  1TQM A;  3CO6 C;  1AHD P;  2L0K A;  3UR3 C;  2QZ8 A;  3HSR A;  1XMX A;  2H1L A;  1IN8 A;  2A07 F;  1VQM I;  4BXX J;  1I5Z A;  5E1Z B;  5HS8 A;  5DD8 A;  3HIF A;  4YIR X;  4BE0 A;  1B6A A;  3QOE A;  2KHM A;  1D0Y A;  2M3A A;  2DPD A;  4BAY A;  2L7M P;  4UB6 C;  1R7J A;  2DFE A;  2O9L A;  3RI4 A;  4HRI A;  4CYC A;  3UNG C;  4IRI A;  2W57 A;  3DKW A;  1WJD A;  1RZ4 A;  3KP2 A;  2OCC H;  2CV1 A;  4XRM A;  2DJI A;  2NAZ A;  3OYM A;  1D5Y A;  4A3K J;  1WZ2 A;  2L7Z A;  3EUK L;  2HGC A;  1GV5 A;  1LQ1 A;  2RAE A;  2DBB A;  4A0Y A;  4KMF A;  3N4M A;  1T56 A;  2QKL B;  5E18 F;  3S16 J;  3JAM K;  4A3M J;  1QHH D;  2DMP A;  1A6Q A;  3GEZ A;  1R1U A;  1W0U A;  2RN7 A;  1HOM A;  1IDZ A;  3W2W A;  4KIB A;  5GTH C;  5EF6 A;  4DZP A;  2BYV E;  2Z9O A;  1VQN I;  2HS5 A;  1G3T A;  2I8D A;  5IYB J;  1U8B A;  3HOT A;  3S2H J;  2FEZ A;  4P96 A;  3I54 A;  2HYF A;  4GYG A;  2ESH A;  3KP5 A;  5BS6 A;  2R7U A;  5F04 A;  3HUG B;  1DQU A;  4CUG A;  1Y0U A;  2F5D A;  5FKK A;  5E8I A;  1J7K A;  1EV7 A;  1LDK B;  2NS0 A;  2XPV A;  4E7K A;  2PLY A;  3LSI A;  2M8E A;  2ZSH B;  2WAE A;  2ZB9 A;  4IRG A;  2C6Y A;  4FT8 A;  2GAU A;  1K79 A;  4CHU A;  3S3N A;  2HTS A;  3HXL A;  3HOY J;  3JRD A;  3BR1 A;  2IGK A;  2OF7 A;  4LLL A;  2KT0 A;  3WTV C;  1FYM A;  3SXY A;  4QSH A;  5LFA A;  1K6Y A;  3T8R A;  1FEX A;  3PQJ A;  4KIG A;  2LY1 A;  3GLX A;  3K4M A;  2H8R A;  4ZYD A;  4NC6 A;  3CLQ A;  3KYC B;  3RQ4 A;  4OIO F;  2WBM A;  3BZC A;  1DU6 A;  4M3E A;  4D9J A;  1E3O C;  3BT9 A;  3ZCO A;  3DEU A;  1GVJ A;  3VOE A;  2R7D A;  4YFX F;  1SD7 A;  1UG0 A;  4BS9 A;  2QBY B;  2DN0 A;  9ANT A;  3CP8 A;  3S3O A;  3OIO A;  1YJN I;  3BTL A;  2VKE A;  2UXX A;  3RPU D;  1Z67 A;  1Z0X A;  3RPU A;  2K4J A;  1LFP A;  4B43 A;  3ZMS A;  4E7Z A;  2HKX A;  2X6O A;  4XON A;  2OD5 A;  1MBF A;  2LK2 A;  1QGP A;  2DT6 A;  4ON0 A;  3KP4 A;  4BEH B;  3I4N J;  3COA C;  2KJC A;  1X4O A;  4BHB A;  5GPC A;  2ME0 A;  3DPU A;  4RGS A;  3WGH A;  1XC5 A;  1WHU A;  2OBP A;  2MH9 A;  3H3V K;  3BC8 A;  3EQL F;  2IGM A;  4CYD A;  4XLE A;  3Q3S A;  1OCT C;  3S1M J;  3BTI A;  5F27 A;  1XGM A;  2LLK A;  2DI3 A;  4EGY A;  3K69 A;  3M9A A;  3CUQ B;  1M1E B;  2OCE A;  3K2A A;  4XN3 A;  4E7J A;  2D2W A;  2FJ1 A;  3FXK A;  2HKO A;  1FYK A;  2PI0 A;  5HVQ C;  3WGG A;  3S14 J;  1MBK A;  3CD6 I;  1ZEL A;  2IJL A;  1GHC A;  2EIN H;  2CSO A;  4IJA A;  3VYS B;  4RAY A;  4HPQ A;  5D5U B;  5CQE A;  3HGG A;  4RBO A;  2W1O A;  4HEA 2;  2PJR B;  3S1N J;  2DQR A;  2VOP A;  3AL0 C;  1BBY A;  2TRT A;  3CJQ B;  2R0Q C;  1Z7L A;  1U5T A;  2X48 A;  2VBX A;  3FXM A;  3GF2 A;  3IC7 A;  3IWZ A;  3OS0 A;  3BJ6 A;  4L5J A;  1PYV A;  2OJE D;  3HBL A;  4RS8 A;  3DLL F;  1MMG A;  1PJR A;  4HSR A;  2R92 J;  1UCR A;  3TGN A;  3Q0W A;  4M73 A;  2HXO A;  3JRE A;  2AXT C;  2JVG A;  1W5S A;  1K61 A;  3JR9 A;  4JP0 A;  4AIK A;  1R5H A;  1YE9 A;  3DTI A;  3VDX A;  1T8I A;  1V5F A;  1XMK A;  2M7A A;  3RZD J;  4UNO A;  3SZG A;  4N4O B;  1Y1V J;  2M0M A;  1YOV B;  4OMZ A;  2JZY A;  1QQI A;  3RIR A;  1UHS A;  5L3E A;  3LAJ A;  4I7H A;  1FP2 A;  4L9V A;  3V8L A;  1VFC A;  1F1Z A;  3DBR B;  5FKO A;  1MBE A;  3QWL A;  1XCB A;  1H9G A;  1YLF A;  4IOC F;  3E6B A;  2CG4 A;  2VL8 A;  1MMS A;  4S05 A;  2OAZ A;  2CQN A;  5J47 A;  4BHP A;  3M07 A;  4ZTJ A;  4MEY F;  4F55 A;  5E20 A;  1TWH J;  2ZXW H;  3RCO A;  3EYY A;  1EH7 A;  2O03 A;  1ZG3 A;  2EIL H;  2IW5 A;  2O61 A;  1MMA A;  2XAJ A;  3LFU A;  1EH6 A;  3A4C A;  3GLL A;  1R00 A;  4LG3 A;  1C0W A;  4BNC A;  3J7Z I;  4A3B J;  3ZQC A;  1U8R A;  3HPH A;  2VC0 A; 
#chains in the Genus database with same CATH homology
 2QVO A;  4L0Y B;  5ED4 A;  4R79 A;  1FC3 A;  2DTR A;  2FE3 A;  2MH2 A;  1IUY A;  1JXS A;  4NB5 A;  5A2Q K;  2XAQ A;  2QBY A;  1DPU A;  2HOE A;  1ZG5 A;  4HAM A;  3F8F A;  4ZYE A;  1U5T C;  4EM1 A;  1P4A A;  2PMH A;  3V7S A;  5JVT A;  3P9C A;  1KU9 A;  4HX8 A;  2PEX A;  3GUD A;  5L3G A;  2XIG A;  1BI3 A;  4IHS A;  2D1V A;  1O7L A;  2FOK A;  1YIO A;  2JT1 A;  5AON A;  5ILV A;  5HDN A;  2XUB A;  2ZME A;  3N97 A;  2UWM A;  2XAG A;  1OPC A;  1FSH A;  1U6G A;  4EGZ A;  1AWC A;  1TQI A;  4EJT A;  2YX7 A;  1ZGA A;  1K78 B;  3EYI A;  3T5X A;  3IL2 A;  4LK0 F;  4RB3 C;  4MNU A;  2W85 A;  1HST A;  1E17 A;  4LD5 A;  4M9Z A;  4PGH A;  3R6S A;  1J5Y A;  4G7H F;  1KQ8 A;  3SQN A;  2A5Y B;  3E6C C;  3QP5 A;  3FX3 A;  5F6F A;  2FML A;  4KN7 X;  4I98 B;  5FFX A;  2XAF A;  3DP7 A;  3F21 A;  5BPD A;  4RGU A;  4M6X A;  3RJP A;  2YR2 A;  4GO1 A;  3V4G A;  3CTA A;  5L3B A;  4WK8 F;  3G3Z A;  4YFN F;  3P7N A;  4OIN F;  1D8K A;  3MZH A;  5F64 A;  4LG0 A;  3P9I A;  2XVC A;  1DUX C;  4HDV A;  3ZN1 A;  3HSF A;  1XCV A;  2DO7 A;  4KIC A;  3E3V A;  1BC7 C;  1O3Q A;  2A6H F;  4Q5S F;  3SZT A;  4A6D A;  4AVP A;  4H0E A;  1SFX A;  4RB0 A;  4I02 A;  3F8N A;  3ECH A;  3U1D A;  4L0Z B;  2J5O A;  3F72 A;  2NNN A;  4OMY A;  4U0W A;  2WTE A;  3MEX A;  3ABT A;  3HRS A;  2ZME B;  1IXC A;  2M87 A;  2GA1 A;  3J7A O;  2XGX A;  2ADU A;  1HW2 A;  2M30 A;  4E70 A;  1T98 A;  1Z6T A;  4L18 B;  3Q9V A;  5ILS A;  3F23 A;  1JE8 A;  3F6V A;  2OA4 A;  2UXN A;  2GIV A;  2RGV A;  1GXP A;  2W84 A;  3OV8 A;  1Z6R A;  4RB1 A;  1QZZ A;  3RYR A;  5A2Q Z;  1HKQ A;  2VOD A;  5BPI A;  1KA8 A;  2LDU A;  1WKM A;  1FWZ A;  5D8K B;  4HQM A;  1HKS A;  4UVA A;  2ISZ A;  5FO5 A;  3Q9S A;  4LG0 B;  2RNJ A;  1P92 A;  2BEO A;  4WXH A;  2O8X A;  4U0Y A;  2H09 A;  1ONV A;  3KLN A;  2IPQ X;  2EB7 A;  1BM9 A;  4HW0 A;  5FFZ A;  1YO5 C;  1FPQ A;  2EA4 A;  4UV9 A;  2L54 A;  4HQE A;  5HLI A;  2FBK A;  2E1N A;  3C1D A;  1ZN2 A;  2RKH A;  3V7R A;  4ESJ A;  3FMR A;  1QO0 D;  4S04 A;  5EEH A;  4HF2 A;  3GZ5 A;  1VTN C;  5D8L B;  3EUH A;  1EH8 A;  1DPR A;  2K7L A;  3C7J A;  4UVC A;  1K7A A;  3BY6 A;  1D5V A;  3KEQ A;  4AWX B;  2VN2 A;  5TRD A;  3R0J A;  4Y15 A;  1J9I A;  1WWX A;  2VXZ A;  2FMY A;  3P9K A;  4LB5 A;  1BIA A;  2F2E A;  1HXD A;  4CZZ A;  1W5T A;  4DNC A;  3HRU A;  3C18 A;  5KVR A;  1YW7 A;  1ZYR F;  3QOP A;  1IXS B;  2FNA A;  4ESB A;  3RKY A;  4UUV A;  1R36 A;  5E17 F;  3F3X A;  2FSW A;  2KRF A;  1S7A A;  3MQ0 A;  4R8H A;  2L02 A;  1KU7 A;  1T39 A;  2R7F A;  3WTU C;  3HUG A;  2VE8 A;  4EM2 A;  1XSD A;  1I6X A;  2PN6 A;  5LGT A;  2Z5U A;  1MZB A;  3WTW C;  2E1C A;  3B73 A;  2HQN A;  2P5V A;  4OU0 A;  1J2X A;  3DPL C;  3ISP A;  3I59 A;  3M1E A;  1WSU A;  3NEU A;  2ZKZ A;  1FSE A;  3TO7 A;  1TLH B;  4HDU A;  2L4M A;  5H6Q A;  3TO9 A;  1FNN A;  4AIH A;  4Q48 A;  5IT9 Z;  4ASN A;  4RGX A;  5J8C A;  5D4R A;  3ZPL A;  3R4K A;  3ZMU A;  3BJA A;  5LLQ A;  2VOO A;  2MLK A;  2A6E F;  3FM5 A;  3IHU A;  2RV8 A;  2XRN A;  1MJ9 A;  3MFK A;  1FX7 A;  4U88 A;  3F8B A;  6PAX A;  1TNS A;  1IAW A;  5CVU A;  4G7O F;  3LQQ A;  1LJ9 A;  5JI6 A;  2WV0 A;  3JTG A;  3ZP5 A;  3ZQ7 A;  1G3W A;  3CUO A;  3L9F A;  2K86 A;  1USS A;  3BPV A;  4OIR F;  1FLI A;  2RC4 A;  1IN7 A;  3ML6 A;  1FY7 A;  4I2O A;  3RKW A;  5FGM A;  3WOD F;  4GYI A;  2MD5 A;  3BP8 A;  4M74 A;  4EJW A;  2DLL A;  1NHA A;  4G9Y A;  3D0S A;  1HQC A;  1LEB A;  4CO8 A;  4HBL A;  1Z05 A;  3GVA A;  3BRO A;  1ZAO A;  4YII A;  1YQA A;  2Z33 A;  1KU2 A;  4IF4 A;  5FLX K;  3CO7 C;  1G3Y A;  4EJU A;  1B4A A;  1S29 A;  5BOX A;  1S6L A;  2H6C A;  1G6N A;  4G6Q A;  3H92 A;  3FZV A;  5E8G A;  3QU6 A;  3DV8 A;  2D45 A;  5JFR A;  3R0A A;  2IRF G;  3U2R A;  3K9T A;  2F5E A;  3TOA A;  2EK5 A;  3RKX A;  2MA3 A;  2HYG D;  4N0B A;  1O3T A;  1IN5 A;  4G8X A;  1SD4 A;  3TQN A;  4XSX F;  4U7D A;  3ZMT A;  2FQ3 A;  2TDX A;  4P55 A;  5HLG A;  2X0L A;  4M6Y A;  2A69 F;  3V8J A;  2L4A A;  4OOI A;  3ZMD A;  2GZW A;  4YG2 F;  1CGP A;  5LGN A;  5F1R A;  2CO5 A;  3KP6 A;  4G7Z F;  2F5C A;  1FYL A;  1SMY F;  2EFN A;  1T6S A;  2EV6 A;  4IPA A;  1IN6 A;  1OMI A;  2BE5 F;  2ZNZ A;  1D8J A;  3WTY C;  4WXD A;  2UZK A;  1HBX G;  4ZZL A;  5HDG A;  4EJO A;  3CLO A;  2EFO A;  3QPT A;  1KYZ A;  4OIQ F;  4ZZD A;  1B1B A;  1UB9 A;  2H94 A;  4KUM A;  4HLX A;  3TO6 A;  1UHW A;  4G6D A;  4FX0 A;  1X3U A;  2DT5 A;  3WU1 B;  1Z9C A;  1U3E M;  3WE3 A;  4NQW A;  3JSP A;  3GFI A;  2RDP A;  3FWE A;  4LLG F;  3GXO A;  5JR3 A;  3T0Y A;  1TTY A;  3BZ6 A;  1BN5 A;  3MWM A;  3J80 Z;  2Z3Y A;  1LVA A;  5L3F A;  1W7P B;  3JTH A;  3ABU A;  1O57 A;  3K0L A;  1QZY A;  2JPC A;  1MKM A;  1B59 A;  3WE2 A;  1TNT A;  2FNP A;  2CYY A;  1ZRE A;  2Y75 A;  2HTJ A;  1XD7 A;  1PUE E;  2IP2 A;  2O6G E;  1J0R A;  5CYV A;  2L01 A;  1J75 A;  4MTD A;  5HOO A;  3K1M A;  3HRT A;  3GX4 X;  5LGU A;  2O0Y A;  3J81 K;  5K5O A;  3L7W A;  3DQV C;  1IRF A;  2PQ8 A;  4EV0 A;  3F6O A;  1U2W A;  3I71 A;  1ZLJ A;  1ZG1 A;  1BC8 C;  1BI1 A;  4WX9 A;  4XLP F;  2BGC A;  3GYH X;  5K1Y A;  3E6D A;  2MBF A;  1PP7 U;  3KZY A;  3D5L A;  1FT9 A;  1ZRD A;  4HA8 A;  2OQG A;  2YU3 A;  3PQK A;  4R1H A;  5AIP A;  4U7B A;  3B02 A;  1TQP A;  2K4B A;  3IWF A;  5D5X B;  3FMS A;  2F5F A;  2VT2 A;  1ON1 A;  4XRF A;  1P2F A;  4K2E A;  3F8C A;  1R22 A;  1FZP B;  1XSX A;  3GFJ A;  4L5I A;  3BJO A;  2X4H A;  3E5Q A;  2FRH A;  3I59 B;  1DDN A;  1LDJ A;  1OYY A;  2MLG A;  3ULQ B;  4Q4Z F;  2VT3 A;  2YX4 A;  1W4M A;  2HR3 A;  4A0X A;  1KQ9 A;  2E7W A;  2STT A;  1O7F A;  5LEK A;  1ON2 A;  2DW4 A;  2MC3 A;  2LF7 A;  2P7C B;  3HYI A;  2KKO A;  1SAX A;  3MAJ A;  2DK8 A;  5DCM B;  2V1D A;  1P6R A;  2O3F A;  4O6J A;  1WRJ A;  5L3D A;  3IKV A;  4I01 A;  4IRH A;  1UFM A;  2VC1 A;  1ZRC A;  4KIF A;  2BV6 A;  1F4K A;  5JHU A;  2QQB A;  1LB2 A;  4A2U A;  1KYW A;  4UHT A;  4XLN F;  1ODD A;  3NRV A;  3LFK A;  4F7Z A;  3LA3 A;  1MDM B;  2DPU A;  1H0M A;  3NQO A;  5DCF A;  2KIF A;  4P9F A;  1IXR C;  2XAS A;  2P5K A;  3CDH A;  1R5G A;  4P5O A;  2VBW A;  4EQQ A;  4A5N A;  4Y17 A;  1SFE A;  1MGT A;  1P4X A;  2RQP A;  2NYX A;  4UV8 A;  1CF7 B;  3CUQ C;  3GFL A;  4N9H A;  1YS6 A;  2GXG A;  1YS7 A;  5K5R A;  2P7V B;  1SFU A;  3KEO A;  5CJ9 A;  4DQ2 A;  3FHZ A;  2EV5 A;  1XDU A;  2LKP A;  1IZ1 A;  4CIC A;  4RGR A;  4JK1 X;  1B9N A;  3DFG A;  3O3K A;  3BPX A;  4BYY A;  3BOQ A;  2DK5 A;  3QAH A;  4KFC A;  1YW8 A;  4ZYH A;  1MJB A;  4MGR A;  3DPT A;  1IRG A;  2FXA A;  1UHM A;  4HF0 A;  1T2K A;  1JHF A;  3HTS B;  2V79 A;  2ZJ2 A;  1Z7U A;  3H3U A;  2K02 A;  1ZGJ A;  1FBS A;  3L2C A;  3IRQ A;  1IF1 A;  5BQT A;  2GA2 A;  1J59 A;  2P8T A;  5CLS A;  3F22 A;  4PZJ A;  1RIO H;  1D3Y A;  4HV5 A;  3HOS A;  2JSC A;  3QPH A;  2ZXJ A;  5ICG A;  2ZBK A;  4L9N A;  3V7C A;  2GQQ A;  1OR7 A;  2LSO A;  4HZF A;  1XMA A;  5HS7 A;  1FP1 D;  1KGS A;  3AAF A;  3HHG A;  4CXF A;  1SD6 A;  2QM3 A;  1F5T A;  3RDI A;  2XV4 S;  2NNY A;  2EV0 A;  4WXC A;  2A68 F;  4JBA A;  4KYW A;  5DUK A;  3SHF A;  3TOB A;  2FF4 A;  4ZYG A;  2ZO4 A;  2P5L C;  4G94 A;  1YTY A;  2OU2 A;  1R58 A;  2LF8 A;  4I0A A;  1W7P D;  4MTE A;  2L3D A;  5E1W A;  2IT0 A;  4KA4 A;  4AD9 A;  2JPB A;  4BH9 A;  4KMU X;  2FU4 A;  4YIF A;  1KU3 A;  2B0L A;  1BI0 A;  4FHT A;  3M7G A;  3M8E A;  2K27 A;  3SZP A;  1ZAR A;  4TV7 A;  4ENM A;  1W7P A;  1RI7 A;  1AOY A;  5E1X A;  1OYI A;  4KNY A;  2ZNY A;  1IW7 F;  5TJJ A;  1HW5 A;  5IT3 A;  5ICE A;  2VBY A;  4D0P A;  4EVI A;  1KQ0 A;  4MQ9 F;  2STW A;  3JAM Z;  3ZMZ A;  5LEJ A;  2V6C A;  3O2P E;  3K2Z A;  1BJA A;  4QLC U;  4ENK A;  5D6E A;  1LDD A;  4PCQ A;  1S3J A;  3HTU A;  1S8N A;  5L3C A;  2QLZ A;  2V1U A;  4LK1 F;  2NRA C;  1XB4 A;  1OYW A;  4IXA A;  3T8T A;  3L00 A;  2PFB A;  3V8K A;  3K1N A;  2JTV A;  3JW4 A;  4LMY A;  3SFZ A;  1ZLK A;  4WCG A;  2EJR A;  3BWG A;  2EA2 A;  3WU0 A;  4PDK A;  5DCM A;  4BQA A;  1E2X A;  2Y0M A;  4I09 A;  5ILU A;  2OZU A;  3VFZ A;  3LST A;  2CW0 F;  3QP6 A;  1RUO A;  2XRO A;  1TW2 A;  5KK1 A;  4A0Z A;  2GXB A;  1QPM A;  1U5T B;  2VBZ A;  3WTT C;  2CGP A;  2XKO A;  4ESF A;  3WTX C;  3RYP A;  5CVI A;  4GGG A;  2OZ6 A;  1I27 A;  5LHI A;  3TKY A;  5EEG A;  4A12 A;  3E6M A;  5HLH A;  1LEA A;  4EMS A;  1XDS A;  1LNW A;  2YPR A;  1DP7 P;  1O3R A;  3PFI A;  2KJB A;  1RUN A;  3FM3 A;  2DFI A;  1ZRF A;  2AS5 F;  4N9I A;  1TW3 A;  3I4P A;  2VON A;  5ICF A;  1L0O C;  1HW1 A;  4XSZ F;  3EDP A;  4KDP A;  2XAH A;  2DU9 A;  1Z1D A;  4P9U A;  5J8F A;  3KLO A;  1ZH5 A;  3WTZ A;  2M45 A;  3ECO A;  2RVC A;  4LJZ F;  5FLX Z;  5FD6 A;  3LAP A;  1XSV A;  1F9N A;  3RPQ A;  3QU3 A;  4CGZ A;  3KZZ A;  2DAO A;  2PJP A;  2FA5 A;  1XGS A;  4B09 A;  3KP7 A;  4M9X A;  1R1T A;  2OQR A;  3FXR A;  2J5P A;  5AIQ A;  4EJV A;  5D6F A;  2EFW A;  2V1X A;  3VB2 A;  4LLN A;  1HKT A;  3IKT A;  2A61 A;  4LGW A;  3KCC A;  3I64 A;  3I58 A;  1BI2 A;  1P4W A;  3LA7 A;  1BOA A;  3LQR A;  3CJN A;  2G7U A;  1G4D A;  4XBF A;  1QBJ A;  3GFM A;  5HS9 A;  1PDN C;  4KN4 X;  3ROU A;  3HHH A;  3KP3 A;  1S7O A;  4HOB A;  4RB2 C;  3REO A;  1TBX A;  4BXU A;  4A5M A;  3I0T A;  4WF2 A;  4Z2Y A;  5DYM A;  2ZFW A;  3CUQ A;  1ULY A;  2KIU A;  2BBY A;  2Q2E A;  3W6J B;  2E7X A;  2P6S A;  1K6O A;  2ELH A;  2XKP A;  2COM A;  4OIP F;  2QYO A;  5IT9 K;  2D1H A;  2FBI A;  3WTS C;  4M71 A;  2VC0 A;  2IA1 A;  3QRF F;  1QNT A;  4MHG A;  2LNB A;  4CDG A;  1T0F A;  1YYV A;  2YSR A;  4PGG A;  3U9G A;  2ISY A;  1YG2 A;  2QWW A;  3KET A;  2R3S A;  4LFU A;  2QEN A;  1FBQ A;  2QQ9 A;  2QUF A;  1U78 A;  2CQK A;  3M8F A;  3FF5 A;  2HDC A;  4JQF A;  5FB2 A;  2QQA A;  3J80 K;  5ICC A;  3WGI A;  4IVN A;  1B9M A;  5D4S A;  4HX7 A;  4O5V A;  3GW2 A;  3R60 A;  2CFX A;  1WI9 A;  2WWY A;  1R23 A;  3GO5 A;  2CWE A;  2H27 A;  3ELK A;  4LB6 B;  3J81 Z;  3Q5F A;  3S2W A;  4Y13 A;  1MD0 A;  2ETH A;  4FX4 A;  1GXQ A;  2ZCW A;  4I0B A;  2XHK A;  2V9V A;  2JRT A;  4BHC A;  1I1S A;  2GWR A;  4HYE A;  1H9T A;  2EWN A;  5DDG A;  2G9W A;  2AXL A;  4ZH4 F;  4B8X A;  3TDZ C;  2A3S A;  4UVB A;  3E5U A;  3RTR A;  3L09 A;  3ZN0 A;  2WC2 A;  4HX4 A;  1ZHF A;  1JHH A;  5D5W B;  1IN4 A;  4M9S A;  2Q8K A;  3ZMV A;  3HSE A;  4A6E A;  1O3S A;  3KE2 A;  5CVV A;  2M1B A;  3G73 A;  3E5X A;  4MQV A;  4RAZ A;  1Q1H A;  1RNL A;  3DXJ F;  4ETS A;  1FOK A;  5LHH A;  1A04 A;  1R1V A;  3I53 A;  5LRR A;  3GZ6 A;  4YFK F;  2G7H A;  1HSJ A;  1XN7 A;  1T38 A;  1FBU A;  4NHJ A;  3LWF A;  4M72 A;  3WG9 A;  5ERI A;  5HDK A;  4WWC A;  5BMZ A;  3LA2 A;  4HV6 A;  2P4W A;  3FMQ A;  1XGN A;  3H3Z A;  3KFW X;  4KT5 C;  1WQ2 A;  3W6K B;  4IHT A;  2EFQ A;  3E97 A;  1MDM A;  2HZT A;  3R61 A;  4GXO A;  2Z99 A;  5CVJ A;  3JSO A;  3T1B A;  5LHG A;  5CVR A;  5DEQ A;  2DQL A;  3C3W A;  2ACJ A;  1UST A;  5H6R A;  3BDD A;  3FXU A;  3OOP A;  1Z91 A;  1V4R A;  5LBQ A;  4L9T A;  1XGO A;  2W25 A;  4L9J A;  1YFH A;  2IA2 A;  4HLY A;  3VOD A;  2ESN A;  4GCV A;  2IA0 A;  5J6X A;  1OKR A;  1SD5 A;  2EFP A;  3HRM A;  1PP8 F;  1MJA A;  4EM0 B;  3O6B B;  3MCZ A;  1STZ A;  4O3M A;  2HFH A;  3EET A;  1G3S A;  1SMT A;  1K78 A;  2W24 A;  2HQR A;  3FXQ A;  2M5W A;  3DF8 A;  2P6T A;  1BIB A;  5DV5 A;  2Q0O A;  4HF1 A;  4UXN A;  3K1P A;  4U0V A;  5FD5 A;  5K5Q A;  3ERE D;  2Y48 A;  4Q47 A;  1JGS A;  2KIM A;  1REP C;  3VEP A;  3F8M A;  3GWZ A;  3TDU C;  1CF7 A;  5D5V B;  4ENJ A;  3MZY A;  5H20 A;  1I1G A;  4MEX F;  5DD4 A;  4AIJ A;  2PG4 A;  4ENN A;  2FBH A;  2H6B A;  3IRR A;  3I5U A;  5LRS A;  2HWV A;  2PMU A;  2PBI A;  1YW9 A;  2HEO A;  1V3F A;  2IVM A;  2VE9 A;  5DUI A;  4QWQ A;  3CO6 C;  1TQM A;  2QZ8 A;  3HSR A;  2A07 F;  1IN8 A;  1I5Z A;  5E1Z B;  5HS8 A;  5DD8 A;  3HIF A;  1B6A A;  2DPD A;  4BAY A;  1R7J A;  3RI4 A;  4IRI A;  2W57 A;  3DKW A;  1RZ4 A;  3KP2 A;  2NAZ A;  2HGC A;  1LQ1 A;  2DBB A;  4A0Y A;  4KMF A;  3N4M A;  5E18 F;  3JAM K;  3GEZ A;  1R1U A;  2RN7 A;  4KIB A;  2Z9O A;  2BYV E;  2HS5 A;  1G3T A;  3HOT A;  2FEZ A;  4P96 A;  3I54 A;  2HYF A;  4GYG A;  2ESH A;  3KP5 A;  5BS6 A;  1Y0U A;  2F5D A;  5E8I A;  1J7K A;  1EV7 A;  1LDK B;  2NS0 A;  2PLY A;  2M8E A;  2C6Y A;  4IRG A;  4FT8 A;  2GAU A;  1K79 A;  4CHU A;  2HTS A;  4LLL A;  3WTV C;  1FYM A;  3SXY A;  3T8R A;  3PQJ A;  4KIG A;  3GLX A;  4ZYD A;  4OIO F;  1GVJ A;  3DEU A;  3VOE A;  2R7D A;  4YFX F;  1SD7 A;  2QBY B;  2UXX A;  3RPU A;  2K4J A;  3ZMS A;  2HKX A;  2OD5 A;  1QGP A;  4ON0 A;  3KP4 A;  3COA C;  4BHB A;  2KJC A;  4RGS A;  3WGH A;  2OBP A;  2MH9 A;  3EQL F;  4CYD A;  1XGM A;  2DI3 A;  4EGY A;  3K69 A;  3M9A A;  3CUQ B;  2D2W A;  2HKO A;  1FYK A;  2PI0 A;  5HVQ C;  3WGG A;  2IJL A;  1GHC A;  2CSO A;  4IJA A;  4RAY A;  5D5U B;  2DQR A;  2VOP A;  1BBY A;  1U5T A;  2VBX A;  3GF2 A;  3IC7 A;  3IWZ A;  3BJ6 A;  4L5J A;  4RS8 A;  1UCR A;  3TGN A;  4M73 A;  1W5S A;  4AIK A;  1R5H A;  1XMK A;  4UNO A;  4OMZ A;  2JZY A;  1QQI A;  3RIR A;  5L3E A;  3LAJ A;  4I7H A;  1FP2 A;  4L9V A;  3V8L A;  1F1Z A;  1XCB A;  1H9G A;  1YLF A;  3E6B A;  2CG4 A;  4S05 A;  2OAZ A;  4BHP A;  4MEY F;  5E20 A;  3EYY A;  1EH7 A;  2O03 A;  1ZG3 A;  2IW5 A;  2O61 A;  2XAJ A;  1EH6 A;  1C0W A;  1R00 A;  4BNC A;  1U8R A;  1L3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...