1DUXC

Elk-1/dna structure reveals how residues distal from dna-binding surface affect dna-recognition
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*AP*CP*CP*GP*GP*AP*AP*GP*TP*GP*T)-3')
publication title Structure of the elk-1-DNA complex reveals how DNA-distal residues affect ETS domain recognition of DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 26
structure length 86
sequence length 86
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1duxC00
1FBSA 4WXHA 2FE3A 2OA4A 2QM3A 4P5OA 3FX3A 3EQLF 1ZYRF 1O3RA 3L00A 2QQAA 4Q4ZF 1LDJA 5BQTA 3T0YA 1DP7P 3PQJA 2EFPA 2VE8A 2O03A 2XVCA 4L9TA 2Y75A 4HOBA 4I7HA 4U7DA 2M8EA 2DBBA 3KZZA 5FD5A 1DPRA 3F8MA 2HOEA 2HTSA 3KZYA 2HWVA 2AS5F 3CO7C 4U7BA 1MJBA 2C6YA 4I0BA 1KQ0A 5CVVA 3TKYA 1G3WA 3HRSA 2XIGA 2P5KA 1BOAA 4UHTA 1BI2A 3F72A 3KCCA 2IJLA 3ZN0A 3F21A 2WWYA 3O2PE 3WTTC 3E6DA 2PG4A 2PLYA 1TNSA 1G3YA 3O6BB 5ILSA 2PMUA 2EV6A 4M6XA 3ECOA 4ESBA 2WC2A 3HOTA 4HF0A 4AWXB 2CSOA 4ENJA 2A6HF 3FXUA 4R79A 2G7HA 3GZ6A 2V9VA 5E20A 2IPQX 1KQ8A 4Q47A 2HR3A 2K27A 4IHTA 2HQRA 2UXNA 2LDUA 2STTA 3EETA 4ZYEA 3TO6A 3WTVC 3M1EA 1XN7A 5A2QK 4H0EA 3JAMK 3WE2A 5LHGA 2FU4A 3U9GA 3REOA 3LAJA 4L0YB 2O3FA 4EMSA 4LLLA 4K2EA 4GYGA 5FFZA 3E3VA 5HLGA 1DPUA 4GO1A 1USSA 2LSOA 3GZ5A 5LRRA 4OMYA 1LB2A 3I58A 4MQ9F 2JPCA 1FC3A 1U78A 4M9XA 1DDNA 2HYGD 2R7DA 4GCVA 5A2QZ 3TDUC 2EJRA 1TQMA 4BQAA 3JAMZ 3AAFA 3BJOA 5D6FA 1O3QA 1FNNA 4U0VA 2QQ9A 3KP2A 3H92A 2QQBA 3U2RA 2W24A 3BZ6A 3KLNA 3FMSA 4CXFA 3K9TA 3KP4A 3TOAA 4A6EA 4GYIA 1W4MA 2BE5F 5DCMB 4HF1A 2FEZA 1G3SA 1LQ1A 2M30A 1LVAA 3QPHA 5LEKA 2DPDA 1ODDA 4YFKF 5L3CA 4KIBA 2E1CA 4WCGA 4MQVA 1KYZA 4RS8A 1ZGJA 2W57A 2K7LA 3LA3A 4LJZF 3F8FA 3L2CA 1JGSA 4MTDA 3ZQ7A 3TO7A 3RTRA 3NRVA 1FP2A 2AXLA 2ZNYA 4LLNA 4EJTA 3MAJA 3JW4A 1XGMA 3MZHA 1ON1A 4UVAA 1YQAA 2P8TA 3I64A 1U8RA 3WU0A 1TTYA 4FX0A 4EQQA 4BH9A 2FNAA 3WGHA 2FBHA 3K1PA 2KJBA 1HW1A 2BGCA 3JTGA 3N4MA 1QPMA 3WODF 2KIFA 4I2OA 5BS6A 2VODA 5FGMA 2J5PA 3LA7A 2EWNA 4AIJA 1K7AA 4HQMA 1ZGAA 1J0RA 1FY7A 5CVJA 4HDVA 3E6BA 2ZBKA 3K0LA 3VB2A 5D4RA 2CYYA 1K79A 2O0YA 1XMKA 3OOPA 2X0LA 4EGZA 1AWCA 1Z6TA 3BP8A 2DI3A 1W7PB 1BJAA 2HEOA 2QYOA 1R22A 4L9VA 2YU3A 4Y13A 2FQ3A 1I27A 2MH9A 5E1XA 4RB3C 4IXAA 4ESJA 2VOPA 1BM9A 1BN5A 2MA3A 1QZZA 1ZG5A 1QBJA 1P6RA 2KIMA 1U5TC 4AIKA 5LRSA 3ERED 3KLOA 5JHUA 5AIPA 2KJCA 3GWZA 4UNOA 4RGUA 4HX8A 3HRMA 2A69F 1UCRA 3MWMA 1FPQA 3C1DA 5CJ9A 1RZ4A 2OU2A 4OOIA 5LEJA 4HLXA 1LJ9A 2ZKZA 5HS7A 4EGYA 2IVMA 2P7VB 1S6LA 3GEZA 3I59A 1K6OA 4OIQF 4CYDA 3U1DA 1CF7B 4RGXA 3ZMUA 1RI7A 5ILVA 1LNWA 4P9FA 2HQNA 2GIVA 1R1VA 3VOEA 2HKXA 5F6FA 5H6QA 3BJAA 2GAUA 3V7SA 1TQPA 4G7OF 2BBYA 2JSCA 1T98A 3TQNA 3K69A 1OYIA 1ZH5A 5ICFA 1T39A 4Y17A 2XRNA 4HX7A 2FBKA 1IXCA 1ZRCA 4I09A 1TNTA 2EB7A 4A12A 2LF7A 2P7CB 1KU9A 5DDGA 3FMQA 3I0TA 1YLFA 3W6JB 4OIRF 1EH6A 1TBXA 1YO5C 3R0JA 3KP3A 3EUHA 4HV5A 1O7LA 3QAHA 5F1RA 3WGGA 5DCMA 2X4HA 1HSJA 3P9KA 3FXRA 1ZLJA 2VBYA 1R00A 2V79A 5BPDA 2KIUA 2L3DA 3P9IA 4PDKA 1L3LA 3GO5A 1IN6A 5EEHA 2P4WA 4PZJA 3EYYA 3E6CC 2UXXA 3CUQC 1SFXA 5CYVA 3EYIA 2P5LC 4A0YA 3QU6A 3L09A 1RNLA 2Q2EA 2FSWA 1I1GA 4N0BA 2Q8KA 3ZP5A 3CO6C 1IXSB 4RGRA 4L9NA 2UZKA 5K5QA 2FXAA 4NHJA 2GZWA 3E5XA 3HSFA 1XSXA 2RDPA 2VBXA 2EV5A 3CJNA 5ERIA 3LQQA 2XAFA 3E97A 1PP7U 2VOOA 3FM5A 4G6QA 3GW2A 1SD7A 4RAYA 2HTJA 3VEPA 4I01A 5HS8A 2FA5A 2HS5A 2VC0A 2XGXA 2QBYA 4LB6B 2PFBA 1FYLA 3R61A 3WTYC 4IHSA 1B9MA 2IA0A 3RKYA 3B02A 5CVUA 3TOBA 1W7PA 2E1NA 2Q0OA 2BYVE 2EFQA 1P4XA 4CHUA 1ZREA 3P9CA 2YX7A 2NS0A 3BOQA 4G7HF 1HQCA 3DPLC 4ESFA 3LWFA 1R1UA 3GFMA 3MCZA 2OD5A 4IRIA 1BI3A 1UB9A 2NRAC 4I0AA 5FLXK 3KEOA 4A2UA 3ZMSA 2OZ6A 5H6RA 2DT5A 1I6XA 4HBLA 1R23A 4HW0A 3FMRA 4HLYA 3F23A 2CWEA 2STWA 1B59A 2Z99A 3GFLA 2K02A 2DU9A 1G4DA 3ABTA 1ULYA 1WKMA 3KEQA 1T0FA 3ECHA 2EFNA 2JTVA 1CF7A 3QP5A 1PUEE 4U0WA 3BPVA 3WTSC 3I5UA 1SD5A 4G7ZF 2H09A 2Y48A 5HOOA 3BWGA 1XDSA 4Q48A 5FLXZ 1U2WA 2ADUA 1U5TB 2IA2A 4BNCA 1BI1A 4G6DA 3LAPA 5D5UB 4IJAA 3K1NA 1ON2A 3TO9A 4HDUA 1FP1D 5TRDA 2FMYA 5HDKA 2HKOA 2PEXA 3I59B 1HW2A 1IXRC 2WV0A 2F5CA 1OR7A 2XROA 4EM2A 3HHHA 1J9IA 3BPXA 2EA4A 4G94A 1IRGA 4G9YA 1FT9A 2A61A 5D5WB 5LHHA 3D5LA 1O3TA 2V1XA 1RIOH 5CVRA 4R8HA 4MNUA 3ROUA 4A6DA 1MKMA 2E7XA 2DK5A 2NNYA 1J2XA 1BI0A 3WG9A 1S29A 5H20A 2D1VA 4G8XA 3RI4A 3FM3A 3M8EA 5DV5A 4L18B 4KA4A 3N97A 1B9NA 4KN4X 5D4SA 1U6GA 4OMZA 5ICGA 1FX7A 4M73A 1ZLKA 2FNPA 3M7GA 1XCBA 4BHBA 2JPBA 4OIOF 4UV8A 4LMYA 3ZMVA 3HTSB 1QGPA 1XMAA 4ZYGA 3R6SA 1I1SA 2GA2A 2XV4S 5HLHA 5K5RA 3NQOA 2ETHA 4KDPA 1HKTA 3E6MA 5E1ZB 4ZZDA 1FBQA 3FXQA 4L0ZB 3DEUA 1TQIA 3IKVA 5HLIA 3WTZA 4S05A 3WU1B 1ZG3A 1FZPB 4LG0B 3DP7A 4E70A 1SAXA 4IRGA 5BOXA 5K1YA 4UVCA 5E8IA 1FSHA 3E5QA 1S7OA 2DPUA 3BJ6A 3CUQB 2FOKA 2RQPA 2M1BA 5JVTA 3F6VA 5HS9A 2ESHA 3SFZA 3ZMZA 4ENNA 1FOKA 1JHHA 4EV0A 4KMFA 2LNBA 1J5YA 4MEXF 3S2WA 3HHGA 2NAZA 4GGGA 1FYMA 2XASA 1J59A 4HF2A 1ZARA 1XGNA 3DV8A 2QBYB 5ICCA 3SZTA 1XGOA 4KFCA 4KN7X 2XKPA 1CGPA 4LGWA 1QQIA 1KA8A 3ELKA 4PGGA 2MBFA 2OQGA 5ILUA 2PBIA 4L5IA 4XLNF 3FZVA 4XRFA 2HZTA 4HQEA 4JQFA 1FBUA 1H0MA 1G3TA 2D2WA 4OU0A 3ZPLA 2WTEA 3GFJA 1PP8F 4GXOA 3QRFF 2VXZA 2Z33A 1EH7A 4P55A 5IT9K 1C0WA 1Z6RA 2O6GE 1JE8A 3ZMTA 2MH2A 5ED4A 5BPIA 2QLZA 3GXOA 3R4KA 1U5TA 3HSEA 2Z5UA 4A0XA 2COMA 2ZJ2A 2E7WA 1SFUA 2XAHA 1SMTA 2RNJA 2P6TA 4DQ2A 5KK1A 4I98B 1MJAA 5LGNA 5HDNA 1QZYA 1SFEA 1IN4A 2LF8A 3HRUA 4TV7A 3FF5A 2RVCA 3T8TA 2PN6A 5K5OA 1HXDA 3HRTA 5IT9Z 1MZBA 3J7AO 1Y0UA 4AD9A 2HGCA 4YG2F 2UWMA 1GXPA 2GXGA 3C3WA 5LHIA 4HZFA 2VT2A 2VN2A 1O57A 3F8BA 2NNNA 2PMHA 2ZFWA 5D8LB 3F8CA 2RC4A 1BC8C 4Q5SF 4FHTA 3IKTA 4LB5A 3E5UA 1HKQA 2H6CA 4AVPA 2DQLA 4HV6A 5J6XA 3I53A 4N9IA 3LQRA 1YS7A 2A6EF 5LBQA 2DFIA 3Q9SA 4M9ZA 4CGZA 3VFZA 5DEQA 1UHWA 1YS6A 2VBWA 1B1BA 3TGNA 4HAMA 4LD5A 4WX9A 5LGTA 5J8CA 4MTEA 2EK5A 1Z7UA 1SMYF 3C7JA 5J8FA 4U88A 1E17A 5ICEA 4YIIA 4BYYA 3IWFA 3GUDA 3JSPA 2EFOA 2OZUA 4CZZA 2K4JA 2VBZA 3HIFA 5JR3A 2DO7A 2EV0A 1S3JA 4DNCA 4LG0A 4F7ZA 2MLGA 1NHAA 2V6CA 4EM0B 4MHGA 3RDIA 1TW3A 1IZ1A 3NEUA 1R5GA 5IT3A 3CUQA 3GVAA 4ETSA 4EJUA 1OMIA 2FMLA 5L3BA 1R36A 1Z1DA 2VT3A 1B6AA 2KKOA 3WTXC 1T2KA 4A0ZA 3G73A 2XUBA 5DD8A 2ZCWA 2R3SA 3H3ZA 3F22A 3DQVC 2A68F 1H9TA 4JBAA 2R7FA 2RKHA 5D8KB 4RAZA 3HOSA 2XAGA 3GX4X 2CO5A 3TDZC 2G9WA 4NQWA 5KVRA 1YW7A 1IRFA 2W84A 4IVNA 2ZMEA 3MZYA 2D45A 3K2ZA 4PGHA 1REPC 3T8RA 2RGVA 4XBFA 1QNTA 1XDUA 1USTA 2XAQA 2L54A 1XSVA 3ULQB 3J80K 1RUNA 3Q9VA 2JZYA 2VC1A 5F64A 4EJVA 1AOYA 1YFHA 3KP7A 5DYMA 2V1DA 3WGIA 3KE2A 5L3GA 4M72A 1O3SA 1ZN2A 2GWRA 1Z05A 4A5MA 1YIOA 4IRHA 1ZHFA 3DPTA 2O61A 1MDMB 3T1BA 2ACJA 5BMZA 2PQ8A 4OINF 1OKRA 1K78B 3H3UA 4B8XA 2K4BA 1OYWA 4Z2YA 2MLKA 5JI6A 2XHKA 4WK8F 1V3FA 2L02A 2BEOA 1YW8A 2ELHA 3J80Z 4ON0A 1WWXA 1F1ZA 2M87A 1SD4A 1XD7A 3W6KB 3RJPA 5D6EA 1J7KA 3F6OA 2GXBA 2XAJA 4WF2A 3V4GA 4B09A 1BC7C 2F2EA 1I5ZA 1LDDA 5L3DA 2RV8A 3M8FA 3RYRA 5CVIA 3IRRA 3QOPA 3D0SA 4ENKA 2HYFA 2ZXJA 1EV7A 1R1TA 1S7AA 2IA1A 2FRHA 1LEBA 3MQ0A 4MGRA 5FB2A 4S04A 2OQRA 1BIBA 3V7RA 1IN5A 3DF8A 3IC7A 1T6SA 1STZA 1MGTA 2YSRA 5LGUA 2VONA 1F4KA 5AONA 1R7JA 2JT1A 4UVBA 5DUIA 2O8XA 3RIRA 4XLPF 4ZYDA 1PDNC 2A3SA 2DK8A 1LEAA 1BBYA 2KRFA 4IF4A 2G7UA 4R1HA 3HYIA 4ZYHA 3F3XA 2DTRA 2QENA 4KUMA 5EEGA 3F8NA 3IWZA 4NB5A 4RB0A 3VODA 3HUGA 1IN8A 1TLHB 4A5NA 1XB4A 1Z91A 3G3ZA 2XKOA 1P92A 4O5VA 3Q5FA 1HKSA 2ZO4A 1KU2A 1XGSA 3PQKA 4M71A 2ISZA 1YW9A 2QVOA 4YFXF 1WQ2A 1A04A 2B0LA 2DQRA 3EDPA 5HDGA 4KIGA 4XSZF 3CDHA 1UHMA 1GVJA 4L9JA 1WSUA 1XSDA 4O6JA 3OV8A 5L3EA 4OIPF 2CGPA 2V1UA 2CG4A 3GFIA 3K1MA 3JTHA 1IF1A 3R0AA 1T38A 2MC3A 4LK0F 2CW0F 4IPAA 3SXYA 1JHFA 2H6BA 5TJJA 2GQQA 3HTUA 1MJ9A 4RB1A 3M9AA 4UUVA 1L0OC 5E18F 4EJOA 3RKXA 3SZPA 2MD5A 5DD4A 4ZH4F 2F5DA 1Z9CA 3DXJF 5JFRA 1KGSA 2NYXA 3LFKA 1XCVA 4FT8A 3V8LA 2A5YB 1RUOA 3B73A 3T5XA 4D0PA 3I4PA 4UV9A 1MD0A 2K86A 3SHFA 3GLXA 1MDMA 3BY6A 3FWEA 1GXQA 4FX4A 3CUOA 3IL2A 2ZMEB 3KFWX 3ZMDA 1K78A 1ZG1A 6PAXA 4LFUA 3CTAA 1BIAA 5D5XB 3I54A 4CO8A 2H94A 4QWQA 2LKPA 1Q1HA 1F9NA 2IRFG 1UFMA 2HFHA 4RGSA 3RPQA 1DUXC 2Y0MA 3V8KA 2Z3YA 1X3UA 3BROA 5E8GA 3QU3A 3CLOA 5D5VB 3COAC 1U3EM 1FYKA 4YFNF 2M5WA 3P7NA 4U0YA 4WXDA 1D3YA 2EFWA 1KU3A 2TDXA 2F5FA 3ML6A 4KIFA 1D8KA 4HX4A 3JSOA 3QP6A 1WRJA 4BAYA 1GHCA 4L5JA 1IAWA 1SD6A 1R58A 4EM1A 1KU7A 1O7FA 4M74A 3I71A 1IUYA 4KT5C 3PFIA 3RKWA 3LSTA 1G6NA 3O3KA 4EJWA 5E1WA 2GA1A 2P5VA 3DKWA 2IT0A 2EA2A 3HSRA 4WXCA 2JRTA 5L3FA 1P2FA 2W25A 2ISYA 2QWWA 1YG2A 2W85A 4O3MA 2DLLA 3FHZA 2L4MA 2A07F 1KYWA 4QLCU 3SQNA 1ZRDA 2OAZA 1E2XA 4EVIA 4ZZLA 2QUFA 3C18A 2L01A 3ABUA 4ASNA 4M6YA 1LDKB 4PCQA 4KICA 3DFGA 2HDCA 5HVQC 3ZN1A 1W5SA 4KNYA 2IW5A 1V4RA 3RPUA 1W5TA 2BV6A 3KP6A 4AIHA 1QO0D 5DUKA 1JXSA 1B4AA 3L9FA 4N9HA 2VE9A 1F5TA 2J5OA 1OPCA 1ONVA 1HBXG 1D5VA 5FD6A 1S8NA 4M9SA 5FO5A 2PJPA 1YTYA 1P4AA 2PI0A 3MEXA 4Y15A 2FF4A 1FWZA 2F5EA 4BHPA 1OYYA 2ESNA 4I02A 4BHCA 4LLGF 5DCFA 2M45A 2ZNZA 2Z9OA 1VTNC 3J81K 3RYPA 4MEYF 5LLQA 2H27A 4LK1F 1HW5A 2QZ8A 1R5HA 5CLSA 1H9GA 2CQKA 3ISPA 3KETA 2YX4A 2FBIA 3BDDA 4JK1X 4RB2C 1TW2A 3GYHX 4UXNA 1J75A 3V8JA 3KP5A 2RN7A 1HSTA 3LA2A 5E17F 4ENMA 2YPRA 2IP2A 2DW4A 1FSEA 5AIQA 1D8JA 1EH8A 4HYEA 5FFXA 3J81Z 1KQ9A 1W7PD 4KYWA 3IRQA 2CFXA 4BXUA 3R60A 2P6SA 4CDGA 4WWCA 4HA8A 2DAOA 3QPTA 4P9UA 1WI9A 4P96A 1IN7A 1IW7F 3GF2A 4CICA 3MFKA 3WTWC 1P4WA 3V7CA 3L7WA 3WTUC 1FLIA 4KMUX 2D1HA 2YR2A 2OBPA 3WE3A 1YYVA 4XSXF 4YIFA 1ZAOA 2L4AA 3IHUA 1ZRFA
chains in the Genus database with same CATH superfamily
1BR1A 1FBSA 4WXHA 5KCMA 1ERDA 2FE3A 2OA4A 2QM3A 4P5OA 4XOTA 3FX3A 3EQLF 1ZYRF 1O3RA 2KDZA 3L00A 2QQAA 4Q4ZF 1B8IB 4OAZA 1LDJA 1OFCX 3LNQA 5BQTA 3T0YA 3G71I 4CZCA 1DP7P 4E6KG 1WJBA 3PQJA 2EFPA 3ONQA 1VQ5I 2VE8A 2O03A 1TT0A 1OCCH 4J01A 5J1YA 2XVCA 1GT0C 4L9TA 2DJIA 2Y75A 4HOBA 4I7HA 2OCCH 3GZNB 4U7DA 2M8EA 4IQJA 2DBBA 4BGDA 2LR8A 3KZZA 5FD5A 2CUZA 1DPRA 3LFUA 3S1NJ 4Z6YA 3F8MA 4BXFA 5E3NA 2HOEA 2HTSA 2HNHA 3KEYA 3KZYA 2BY2A 3VWBA 2K85A 1X1PA 2HWVA 2AS5F 3CO7C 4U7BA 4IHYA 1MJBA 1K83J 4C3HJ 2C6YA 2L5QA 4I0BA 4FCYA 1XG1A 1TWFJ 1KQ0A 4GDFA 2CW8A 4ZDPA 5CVVA 4XQFA 3IUOA 3PIOF 3TKYA 1G3WA 4PJLA 1Y0NA 3HRSA 2XIGA 2P5KA 3CMEI 1BOAA 3HKZA 3Q0VA 4UHTA 1BI2A 3F72A 2D5VA 2WAQN 3KCCA 2IJLA 4CH7A 5M5YJ 2FD5A 3OYHA 4QIWN 4BBRJ 3SJMA 2VQCA 3ZN0A 2K9MA 3OYNA 3F21A 1ZK8A 4IHXA 2WWYA 3O2PE 1T0FC 2BW3A 3E6DA 2PG4A 3WTTC 2PLYA 1ITYA 2FX0A 1TZLA 1TNSA 1VI0A 1G3YA 4BY7J 3O6BB 1JJ8C 2YS9A 2E60A 5F08A 2VLAA 1MMAA 3HOXJ 5ILSA 2PMUA 2DA6A 2EV6A 4M6XA 3ECOA 2GBYA 2WC2A 2VQGA 4ESBA 1QPIA 1EA3A 3HOTA 4HF0A 2CH0A 4AWXB 2CSOA 4ENJA 2A6HF 3I4MJ 3FXUA 5J3LA 4R79A 2G7HA 3DWLE 3GZ6A 2V9VA 5E20A 2IPQX 3CF2A 4YEJA 3ZQLA 1TC3C 4PJNA 1KQ8A 1RESA 4XNFA 2XB5A 3UR3C 4RAGA 2NVYJ 4Q47A 2HR3A 2UV1A 2K27A 1MBGA 3OSFA 4IHTA 1TWGJ 2DA5A 2HQRA 2UXNA 2LDUA 2K9QA 3EETA 2STTA 4ZYEA 3TO6A 3WTVC 2KZVA 3M1EA 1XN7A 5A2QK 1OR7C 4H0EA 5C4JJ 3MKZA 4C9YA 1NK2P 2ICWG 1YRNA 1MW7A 3BC8A 1DU6A 3IH3A 4BEHA 3JAMK 2HVSA 3HEFA 4UUSA 3WE2A 1U9NA 5LHGA 2FU4A 3U9GA 3PL8A 4M3GA 3HOVJ 1W5CC 2XSDC 2GXAA 3REOA 3LAJA 4JP0A 4L0YB 4XLEA 1A6QA 1DGWY 2O3FA 4EMSA 4LLLA 2XAUA 4GYGA 4K2EA 4NNJA 1XX5A 4KT6A 5FFZA 3OR2C 2LMDA 3E3VA 5HLGA 1XPXA 1DPUA 3K4CA 2DDBA 4GO1A 3ZQHA 1USSA 3DBRB 2LSOA 1MNDA 4XR6A 4PJMA 1YI2I 3BTIA 3GZ5A 1HDDC 5LRRA 4OMYA 3M4OJ 4S0HB 1Y1WJ 1YJWI 2H8RA 1LB2A 3I58A 4XKWA 4DYRA 3K4MA 4MQ9F 2JPCA 1FC3A 4XMYA 1U78A 2DJNA 4M9XA 1DDNA 1V55H 4PFOA 2BXZA 2HYGD 4CCOA 2R7DA 4GCVA 5A2QZ 2UUZA 3TDUC 2CW7A 2EJRA 3HGYA 2JN6A 1Z77A 3OL4A 3HL2A 1FTTA 1TQMA 2R7OA 4BQAA 3JAMZ 3AAFA 3BJOA 5D6FA 1O3QA 1FNNA 4NC8A 4U0VA 2O7OA 2QQ9A 3KP2A 3H92A 2QQBA 2N8GA 3U2RA 5C4XJ 3LSMA 2W24A 3BZ6A 4QPOA 3KLNA 3FMSA 3BCBA 2ZXWH 4CXFA 2M8GX 1SVOA 1QRYA 3FXKA 2LC2A 3BTJA 3K9TA 3KP4A 3TOAA 2DN0A 4A6EA 2ZXIA 2X6WA 1A5JA 4GYIA 2PJRB 1W4MA 2BE5F 5DCMB 3ZQQA 1HDPA 4HF1A 4QSHA 2FEZA 1G3SA 1LQ1A 3KYDB 1ENHA 2R7WA 2M30A 2R92J 1LVAA 2M4GA 3QPHA 5LEKA 2DPDA 1ODDA 4YFKF 5L3CA 4XK4A 3ZQCA 4A3FJ 4XICA 4KIBA 2E1CA 2W7NA 3BT9A 4WCGA 1R4MB 4MQVA 5M3MJ 3N05A 2LKXA 1ZKGA 2HPMA 1KYZA 2BZTA 4RS8A 5J1UA 1ZGJA 2W57A 2K7LA 2KZGA 3LA3A 4LJZF 1K4SA 3ASOH 3JCUC 4RM3A 2DA2A 1IDZA 3F8FA 3L2CA 2IS1A 1X1DA 4I99C 2ID6A 1JGSA 4MTDA 4QPQA 1MNMC 3ZQ7A 2M3AA 4II2A 2IEKA 5FRNA 1FIPA 1UHSA 3TO7A 3DU5A 3RTRA 1W36D 3NRVA 3VYSB 4PK4A 1I50J 1FP2A 2AXLA 2ZNYA 4LLNA 4EJTA 5KNLA 3MAJA 3JW4A 1TT5B 1XGMA 3MZHA 1ON1A 4UVAA 3OYBA 3B6CA 1P7IA 2XPWA 4NC6A 3DPUA 4Y3OA 1YQAA 1B8IA 2P8TA 3I64A 4QTRA 1U8RA 3WU0A 2JQ7A 1TTYA 4FX0A 2M0CA 4EQQA 2NVTJ 3OYCA 3CMMA 4BH9A 2FNAA 3WGHA 2LG4A 2FBHA 3JR9A 5K7HA 3K1PA 4C2TA 5DM6F 2KJBA 2X1DA 1RR8C 1HW1A 2BGCA 3JTGA 3N4MA 1LUJB 1NG6A 1QPMA 3WODF 2KIFA 4I2OA 5BS6A 2VODA 3JRAA 4RM2A 5FGMA 2J5PA 3LA7A 2EWNA 2M0MA 4AIJA 1X19A 1K7AA 3NARA 4AVZA 3DKXA 5CQEA 4HQMA 1ZGAA 4UB6C 2L7FP 1J0RA 3CCVI 1FY7A 3G1LA 3QWLA 2Y69H 3LSIA 5CVJA 1JUMA 4HDVA 3E6BA 2ZBKA 3DLLF 1HC8A 3K0LA 2ME6A 1WH7A 3VB2A 2EIMH 1BA5A 4D5FA 2PMZN 3CP2A 4BS9A 2CYYA 5D4RA 3CMAI 1K79A 3OOUA 2R7UA 2O0YA 2WAFA 1XMKA 3GTQJ 3OOPA 2X0LA 4EGZA 1AWCA 3CC7I 3AG1H 1Z6TA 3H36A 2CRGA 1T95A 3BP8A 2DI3A 1W7PB 3I56I 1BJAA 5IPAA 2HEOA 2QYOA 1R22A 1R71A 2VI6A 4L9VA 2BY3A 3GTPJ 2YU3A 4Y13A 3S16J 4Y7NJ 3DU6A 3OS0A 2FQ3A 1I27A 1U8BA 3HOYJ 4XN0A 2MH9A 2BOLA 5E1XA 4RB3C 4IXAA 4ESJA 1JKPC 3OYJA 5DS9A 2VOPA 1BM9A 3H5AA 1XS9A 3W2AA 1BN5A 2MA3A 2NOJB 1QZZA 2O8KA 1ZG5A 3ZOBA 2JA8J 4XKBA 1H8AC 1QBJA 1P6RA 2KIMA 1TWAJ 1U5TC 2OJED 4HSRA 4AIKA 5LRSA 3ERED 3KLOA 5JHUA 1JKRC 5AIPA 2KJCA 3GWZA 2R5YA 2I8DA 4M3BA 2DA1A 4UNOA 4RGUA 4HX8A 4B4CA 3HRMA 2A69F 1UCRA 3MWMA 1FJLA 4BJ6C 1FPQA 5GP9A 2HOTA 1XC5A 3C1DA 5CJ9A 1TL8A 1RZ4A 2OU2A 4OOIA 5J4YA 5LEJA 2BVLA 4HLXA 1LJ9A 2KPMA 2ZKZA 5HS7A 3ESWB 1SC7A 4W97A 4EGYA 2IVMA 2P7VB 3Q3SA 2ZJRF 4LIUA 2DXIA 1S6LA 3GEZA 2WY8Q 3I59A 1K6OA 4OIQF 5E3OA 1IRZA 4BBSJ 4CYDA 3U1DA 1CF7B 3W6VA 4RGXA 3ZMUA 1RI7A 2XPVA 5ILVA 4FE4A 1LNWA 4P9FA 1SANA 1E3HA 1QVUA 2GIVA 2HQNA 3VSKA 1R1VA 2HKXA 5F6FA 3VOEA 2IGNA 5H6QA 2BXYA 3BJAA 2GAUA 2IAIA 4UUTA 1WFXA 3RQIA 2QF7A 4A3JJ 3V7SA 1TQPA 3PNYA 5DTDA 3FHNA 4JX6A 4G7OF 2BBYA 5EJCA 4DBRA 2JSCA 1T98A 3TQNA 3K69A 1OYIA 3J7AY 3PJRA 1ZH5A 5ICFA 3GCMA 3K7AJ 4Y17A 1T39A 5KHDA 2XRNA 4HX7A 3FISA 2FBKA 1Y1VJ 2P81A 4CA0A 9ANTA 2RAEA 4B1RA 1LFPA 2DFHA 1IXCA 1ZRCA 4I09A 1TNTA 2EB7A 2R7VA 4GRIA 1EF4A 4BEHB 4A12A 2LF7A 1WJEA 2P7CB 3OL3A 1KU9A 5DDGA 5M3FJ 3CP8A 2KFDA 1BW5A 3FMQA 3I0TA 2VJIA 2X6OA 4BE1A 1YLFA 3BG9A 3PFYA 3W6JB 4OIRF 1EH6A 1TBXA 1YO5C 2HI3A 2L9SA 3R0JA 4YELA 1GV2A 3KP3A 3EPZA 3C2HA 4G12A 3FKIJ 3EUHA 5EZGA 4A69C 4HV5A 1O7LA 3HKZN 3QAHA 5F1RA 3WGGA 5DCMA 2X4HA 1HSJA 2E2IJ 3P9KA 1UG2A 3FXRA 3GTJJ 3S3OA 1ZLJA 2VBYA 3TP0A 4JX4A 2P0WA 4E7LA 2AQEA 1R00A 5DM7F 2V79A 5BPDA 2M34A 2KIUA 4PJJA 1ETWA 1S5LC 2L9VA 2L3DA 2MW8A 4B44A 3P9IA 4PDKA 3BR3A 2ZSHB 4BE0A 1L3LA 3CJTB 1Q1VA 1UG0A 5GAEJ 4D1QA 2HVQA 3GO5A 2H1LA 4ITVA 1IN6A 5B5EC 5EEHA 3JRIA 1FTZA 3CLQA 2CV0A 3OR1C 3OYIA 3WG7H 1AA7A 2P4WA 2JA2A 4PZJA 3EYYA 3H1CA 3G1OA 3HPGA 4XL9A 3E6CC 3HOZJ 3GTGJ 1BL0A 3PIPF 3CCMI 2M7BA 4LOCA 2UXXA 3CUQC 1JTYA 1SFXA 5CYVA 3U21A 3EYIA 4FTHA 1EKEA 2LRDA 3W2WA 2P5LC 4A0YA 3P5JA 1GVDA 3QU6A 3L09A 1RNLA 1V5EA 2Q2EA 2FSWA 3VPRA 2QEXI 1I1GA 1WPKA 1N25A 4N0BA 1OCPA 2Q8KA 3ZP5A 3CCRI 3CO6C 3CCLI 1TWCJ 2BVMA 1IXSB 1UMQA 2CUEA 4RGRA 3DKYA 2E5NA 4L9NA 1DP3A 2UZKA 5K5QA 2FXAA 4NHJA 2GZWA 3E5XA 3HSFA 1XMXA 1Y39A 1XSXA 2RDPA 2VBXA 2EV5A 4E7ZA 2EIKH 1JI8A 3CJNA 5ERIA 3LQQA 2XAFA 3E97A 2ZMEC 3H5RA 1PP7U 2VOOA 5GPAA 3FM5A 4G6QA 3GW2A 4U87A 1SD7A 2R4GA 4RAYA 1X3ZB 2HTJA 3SEQA 3VEPA 3SEZA 2ECCA 4I01A 5HS8A 2HOSA 3FXLA 1MBHA 4BQOA 2DMUA 2FA5A 2HS5A 2VC0A 2XGXA 4DW6A 1SVLA 4LB6B 2QBYA 5J4VA 2PFBA 2XPUA 1MH4A 2VKHA 4NC7A 3SDBA 3OIQA 1FYLA 1WI3A 1OCTC 2R93J 3R61A 2QQ8A 4RLQA 3WTYC 2JVHA 4IHSA 5K7ZA 2K5CA 3ZR8X 2V6EA 1B9MA 2MYSA 2IA0A 3RKYA 3B02A 2V4JC 5CVUA 1VQKI 4OWRB 2K3FA 3TOBA 1W7PA 2E1NA 1XTAA 3G2BA 2Q0OA 2BYVE 3CQZJ 2EFQA 1P4XA 4CHUA 1ZREA 3P9CA 5F1JA 2HXIA 2YX7A 1OLTA 4J00A 5IOYA 3OYKA 3CMYA 1PYVA 1NK3P 2NS0A 4V2FA 2O9LA 3BOQA 4G7HF 2E35A 1Z3YA 1IJWC 4D9JA 1HQCA 3A01B 3DPLC 4ESFA 4XRSG 2MFZA 3S1RJ 3LWFA 2XGDA 1R1UA 3GFMA 3K4NA 3MCZA 2OD5A 4IRIA 1BI3A 2E1MB 2X6YA 1UB9A 2NRAC 1LVKA 2HXOA 4I0AA 4E7IA 3GTKJ 5FLXK 2H8WA 1Y6IA 3KEOA 4A2UA 3ZMSA 2OZ6A 1TP4A 5F0FA 5H6RA 2EZKA 2DT5A 1QHGA 1I6XA 3PSIA 2LY2A 4HBLA 2LLKA 1R23A 1PUFB 2HVRA 1WJFA 4HW0A 3OS2A 4CCKA 2NVXJ 3OIOA 4AYBN 3FMRA 4HLYA 3F23A 1YE9A 3E0JB 2CWEA 2STWA 1B59A 4NBQA 3CZ6A 2VL8A 3RZOJ 3GBGA 1WCMJ 2Z99A 2KRHA 3M07A 3GFLA 2K02A 3OIPA 2DMQA 2ZXHA 2DU9A 1G4DA 2F4MB 1ULYA 1WKMA 3ABTA 3KEQA 3S93A 1T0FA 1T56A 3ECHA 3ABLH 3VDXA 2EFNA 2PX9A 3BG5A 2JTVA 1CF7A 1ETQA 3QQAA 3QP5A 1PUEE 4U0WA 1V5FA 3RQ4A 3BPVA 3WTSC 4HEA2 3I5UA 4RAFA 1SD5A 3BCAA 2VJJA 4G7ZF 2H09A 2BHZA 2Z2SB 2Y48A 5B66C 3ZQGA 5HOOA 3BWGA 1XDSA 3DLAA 3LSHA 2E34A 4Q48A 3M8JA 2R5YB 5K7FA 3CCSI 5FLXZ 4HNVA 2DOFA 1HF0A 1U2WA 4Y33A 2B63J 2ADUA 1U5TB 2LYCA 2DMPA 1S72I 2IA2A 1JUSA 1I3AA 1SFKA 1OCZH 3K6GA 4BNCA 2M4KA 1BI1A 4G6DA 1VQ4I 3LAPA 5D5UB 4IJAA 3TW7A 1YJ9I 2DYRH 2XB0X 3K1NA 1ON2A 1YX3A 1R5ID 3EUKL 4XRMA 3TO9A 1IV8A 4HDUA 3B6AA 4HRIA 1FP1D 2AHQA 5TRDA 2FMYA 2DOAA 5HDKA 1T33A 2HKOA 2L0KA 1FMWA 2PEXA 4F55A 3I59B 1HW2A 1IXRC 4NDLA 2WV0A 2F5CA 1OR7A 2XROA 4EM2A 2KIQA 2ELJA 2HDWA 2W4SA 3A0HC 3S2DJ 3HHHA 3OYGA 1WJ5A 4XN3A 1J9IA 5J47A 5FLVA 1ORKA 3BPXA 2X9DA 4A93J 2LFBA 2EA4A 3DEEA 3S17J 4G94A 1WGXA 2YUSA 1IRGA 3BR5A 5FKKA 3GTLJ 4G9YA 1OISA 1WVRA 1FT9A 1X1AA 1DU0A 2A61A 3DTKA 5D5WB 5LHHA 3D5LA 1O3TA 2I5UA 3UKGA 2V1XA 2XDVA 4FETA 1RIOH 5CVRA 4R8HA 4MNUA 4A3DJ 3ROUA 4XONA 4A6DA 1LPQA 2R7ZJ 1MKMA 4LITA 2E7XA 3A0BC 2DK5A 2NNYA 1FMVA 1J2XA 1BI0A 2ZC2A 3WG9A 1S29A 5H20A 2D1VA 4G8XA 3J7YJ 1NTCA 3RI4A 5HNHA 1UAAA 3TP3A 3FM3A 3M8EA 5DV5A 4L18B 2DTZA 4KA4A 3N97A 1RRJA 1B9NA 1KZHA 4KN4X 5D4SA 2EZHA 1U6GA 2K40A 1IDYA 4IKFA 4OMZA 5ICGA 1FX7A 4M73A 1ZLKA 2FNPA 2DMNA 3M7GA 2HOAA 4BL0B 1XCBA 4BHBA 3J7ZI 2JPBA 2MD0A 4OIOF 4UV8A 1AKHB 3OYAA 4LMYA 1ACIA 1TWHJ 3ZMVA 3HTSB 1QGPA 2K3PA 1XMAA 2ELKA 4ZYGA 4CUGA 3R6SA 1VQPI 1I1SA 2GA2A 5C3EJ 2B9SA 2XV4S 5HLHA 3BG3A 5K5RA 3AL0C 3NQOA 3QODA 2ETHA 4KDPA 1HKTA 2HQAA 3E6MA 5E1ZB 2R7TA 3V42A 1FBQA 4ZZDA 1VNDA 3FXQA 3FK7A 4L0ZB 5EGOA 2GOXB 1FOYA 3BTCA 3DEUA 4N4NB 1TQIA 3HPHA 3IKVA 2V9PA 5HLIA 3WTZA 4FISA 4XM3A 2QSGX 4S05A 3WU1B 1ZG3A 5CQGA 1FZPB 3OY9A 5JHFA 4LG0B 3S32A 4XOPA 3DP7A 4E70A 4XLAA 1SAXA 4IRGA 3DBHB 3FXJA 4MFEA 5BOXA 5K1YA 4UVCA 1BW6A 5E8IA 3M1CA 1FSHA 3E5QA 4X0GA 4Y4RA 3L2WA 5FROA 1S7OA 1SEUA 2Q2EB 1IV6A 2VUMJ 3BQZA 3LMMA 5EG0B 3OYLA 3Q0UA 3BJ6A 3BZCA 3CUQB 2DPUA 3LL7A 1IGNA 1M1EB 2FOKA 3HZJA 2LH9A 2M1BA 2RQPA 3F6VA 5JVTA 4IL6C 5HS9A 4YIRX 2ESHA 2JSPA 3SFZA 3VYUB 2F4OB 3CD6I 4IEJA 1A35A 3ZMZA 3BR2A 4ENNA 3OMYA 1FOKA 4DJAA 1JHHA 4EV0A 4KMFA 4IHWA 2LNBA 1J5YA 4MEXF 2CU7A 3S2WA 3CCYA 2KHMA 1N75A 2NAZA 3HHGA 1MIJA 4BU2A 4GGGA 2DT7B 1FYMA 2JK3A 2XASA 1FOWA 1J59A 2AQFA 3LOCA 3A01A 4HF2A 2NXNB 3L2VA 1ZR2A 1ZARA 4NQWB 2IGOA 3HG9A 2RNGA 3GTMJ 3LSRA 1WZ2A 2CMPA 1XGNA 3DV8A 5IOZA 2QBYB 2OCEA 1MMDA 5ICCA 5J1RA 3SZTA 2XSJC 2HPIA 3SYTA 3HXLA 1XGOA 3TEDA 4KFCA 4KN7X 2XKPA 1CGPA 4LGWA 2W00A 1QQIA 5IY5H 3FIWA 4BQQA 1KA8A 3ELKA 4PGGA 4DIQA 1PUFA 2MBFA 2OQGA 5TGTA 2JA5J 4MIMA 5ILUA 1JT0A 2PBIA 2EZLA 3BG7A 1V5GA 4L5IA 1LFBA 4ZC3A 4XLNF 3FZVA 2L7KA 1QZEA 1WJAA 4XRFA 2KRCA 2HZTA 4HQEA 4JQFA 4YRVA 1FBUA 3TL4X 1H0MA 1ZGWA 1WJCA 1JT6A 1G3TA 2R5ZB 1VQMI 2D2WA 4ZDLA 4OU0A 3ZPLA 2WTEA 3GFJA 1PP8F 2VQLA 3C2GA 2X51A 2BY1A 4GXOA 3QRFF 2VB6A 2VXZA 2Z33A 5EF6A 4BACA 2V26A 1POGA 1RETA 2L9NA 1EH7A 1IUFA 4P55A 3CCUI 3BG6A 5GAHJ 5IT9K 1C0WA 1Z6RA 2Q1ZB 2G0EA 2O6GE 1JE8A 3ZMTA 2MH2A 3KZIC 2R7QA 5ED4A 5BPIA 4XIDA 2QLZA 3PO3J 2MABA 2DODA 2KP6A 1MBEA 3GXOA 3R4KA 3JREA 1U5TA 2TCTA 3HSEA 2Z5UA 5FRMA 4A0XA 2XGCA 3JRHA 2COMA 2ZJ2A 2BY0A 2E7WA 1SFUA 2XAHA 1SMTA 2RNJA 2P6TA 4DQ2A 5KK1A 4I98B 3D1NI 1MJAA 4FE7A 5LGNA 3MN2A 1OJLA 1Z3XA 1VF9A 5HDNA 2JVGA 1QZYA 1V54H 3RZDJ 1SFEA 2E19A 1IN4A 2LF8A 3HRUA 2V7FA 4TV7A 3FF5A 4IOAF 3O8GA 2RVCA 3T8TA 2PN6A 2MGQA 3BR6A 4DBQA 5K5OA 1H88C 4ZDOA 3S14J 1HXDA 3IAM2 3HRTA 5CKTA 5B3SH 3NWSA 4F91B 1T8IA 5IT9Z 3QYBA 1MZBA 4B3XA 2M2EA 1MMGA 3J7AO 1Y0UA 4AD9A 2L7ZA 2HGCA 2VPRA 4H4KC 4YG2F 1HLVA 3ERMA 4BKXA 2UWMA 1GXPA 2GXGA 3C3WA 5LHIA 4HZFA 2WY7Q 1LFUP 3BQYA 1MBKA 2VT2A 1D0ZA 2VN2A 1O57A 3F8BA 2NNNA 2IBDA 1GLNA 2PMHA 2ZFWA 3OWTA 3MKWB 2GOMA 3F8CA 2RC4A 5D8LB 1BC8C 2NS7A 4LIVA 4FHTA 4Q5SF 3IKTA 4LB5A 3H3VK 3E5UA 2ID3A 4PFPA 4BDZA 2EILH 1HKQA 2H6CA 3WHBA 4AVPA 1MMSA 2DQLA 4HV6A 4UB8C 5J6XA 3H9QA 3I53A 2WB1A 2CQNA 4N9IA 3LQRA 3G6EI 1A31A 2LK2A 3I55I 3ASNH 1YS7A 1WH5A 1G8XA 2IGMA 3K2AA 2OUMA 2A6EF 5LBQA 3G1MA 1GDTA 2DFIA 2A5WA 3Q0WA 2XC7A 4A3EJ 3Q9SA 1Y8QB 1ZTRA 4M9ZA 3VYTB 4CGZA 2ECBA 3VFZA 4XRSA 1U9OA 5DEQA 3EUHC 1UHWA 1YS6A 1UJ8A 1B1BA 2VBWA 3TGNA 4HAMA 3MKLA 3AG3H 4LD5A 4WX9A 5LGTA 2JA6J 3OYFA 2QSFX 3K4BA 2DT6A 5J8CA 2JWTA 4RDUA 1Z0XA 5GADJ 4FQGA 4MTEA 2EK5A 4XORA 5EEAA 2VQHA 1AKHA 1Z7UA 3HUGB 1JKOC 1SMYF 2NOGA 3C7JA 4C2MJ 5J8FA 4U88A 1E3PA 2R7XA 1E17A 3FDYA 5ICEA 4YIIA 1YHQI 4BYYA 3IWFA 3GUDA 3JSPA 2EFOA 2OZUA 4CYCB 3JRGA 1MBFA 4CZZA 2CUJA 3AFHA 2K4JA 4M3EA 4BJ5C 1OCRH 2VBZA 3HIFA 5JR3A 1X2NA 2CQQA 1MSFC 2DO7A 3CJRB 4DGWB 2EV0A 1S3JA 3CCQI 4DNCA 1PVEA 4LG0A 4F7ZA 3O8HA 4XKVA 1PJRA 2MLGA 3K4JA 1NHAA 1IRXA 2V6CA 1MSEC 4AUXA 4EM0B 4MHGA 2A05A 2H1KA 2EQRA 3RDIA 2JUCA 1TW3A 3MVPA 1K4TA 2X85A 1IZ1A 3NEUA 1R5GA 4MLOA 3GLLA 5IT3A 1N77A 4XLHA 1BJZA 5EG0A 3LSGA 3CUQA 4A3MJ 3GVAA 2LBFA 5IYCJ 4ETSA 4EJUA 4KJZA 1OMIA 2FMLA 4M3DA 4ZTJA 4B43A 5L3BA 5JVGF 1R36A 1AU7A 2WAEA 2OTJI 2LTPA 5H2FC 1X1BA 1Z1DA 2VT3A 1B6AA 2KKOA 2VXDA 4JOMA 3DBLB 4A0ZA 5HNFA 3WTXC 3G73A 3IH4A 2XUBA 1T2KA 1FOXA 2KISA 3BTLA 5DD8A 2ZCWA 2R3SA 4GFBA 4A3CJ 3H3ZA 4CSWA 3F22A 3MD2A 3DQVC 4IOCF 2BHYA 2A68F 1H9TA 4JBAA 2Y31A 2R7FA 2RKHA 5D8KB 4RAZA 2L7MP 5EGOB 3HOSA 2XAGA 3GX4X 3BR1A 2CO5A 1ETXA 5KAFC 3TDZC 2G9WA 4NQWA 2CV2A 2ZB9A 4AIDA 5KVRA 3PNTA 1YW7A 1IRFA 2W84A 4IVNA 4CCMA 2QSHX 3AL0B 1HOMA 4CCLA 2ZMEA 3MZYA 3AG2H 3QOEA 2LY9A 3ZQFA 4BUPA 2D45A 3K2ZA 3QYFA 1J09A 4RBOA 4PGHA 1IG7A 1REPC 3T8RA 5C44J 2L9RA 1X4PA 2RGVA 1VQOI 4XBFA 4C3IJ 1QNTA 3HC7A 1XDUA 3GTOJ 1W0TA 1DGRM 1USTA 2FUG2 1YOVB 2XAQA 2L54A 3CESA 1XSVA 4F3QA 3ULQB 3J80K 1RUNA 2L2OA 1RR7A 2OTLI 3Q9VA 2IXSA 4C3JJ 3K4LA 2JZYA 2VC1A 5F64A 4E7KA 4EJVA 1AOYA 1YFHA 3KP7A 4AC0A 5DYMA 3WHCA 1YITI 2V1DA 2WBMA 3WGIA 3KE2A 4IQ4A 1F43A 3ABMH 3I9V2 5L3GA 3S3MA 4M72A 1O3SA 1ZN2A 2GWRA 4M6VA 4BQNA 4A3GJ 1Z05A 4HPQA 1SFOJ 4A5MA 4D5CA 1YIOA 1ETKA 1MNEA 4M3FA 2R5ZA 3H35A 4IRHA 1ZHFA 3DPTA 2JMWA 2O61A 1MDMB 2ZSIB 3T1BA 2X48A 3UNGC 2K9SA 2ACJA 5BMZA 2W48A 3HBLA 2PQ8A 3OS1A 2R0QC 1BOBA 1VQ8I 4OINF 2QKMB 1OKRA 1K78B 3H3UA 2VPLA 4I76A 4B8XA 4X1EA 2K4BA 1OYWA 1NG7A 3L1PA 4DYCA 4XLFA 1Y8RB 2MLKA 3MMYB 4Z2YA 3A2KA 3S2HJ 2ZJPF 2MG4A 5JI6A 1Z21A 2XHKA 2AXTC 5HLTA 4WK8F 1V3FA 3W3CA 2L02A 3DCFA 2BEOA 1YW8A 2ELHA 3J80Z 3RKQA 3E1SA 4ON0A 1WWXA 4AU7A 1F1ZA 1E3OC 2M87A 4G6TB 1SD4A 3LSPA 1K61A 4ZYAA 1XD7A 3W6KB 3RJPA 2XF5A 5D6EA 2LKSA 1J7KA 3F6OA 2GXBA 2V9KA 3IP4B 1W0UA 2XAJA 1ETVA 2Y9YA 4WF2A 3V4GA 1U0JA 4B09A 1BC7C 4DZPA 2F2EA 1I5ZA 2DCEA 1LDDA 3A4CA 3K10A 2CS3A 3FXMA 5L3DA 3SFIA 2RV8A 1ZQ3P 3M8FA 2LOOA 2VASA 2Y0SA 4C2UA 4V19K 4E4HA 3RYRA 5CVIA 3IRRA 3QOPA 3D0SA 4ENKA 3KYCB 2HYFA 2ZXJA 1OCOH 1D0YA 4RMNA 1G59A 1EV7A 1WJDA 1R1TA 1S7AA 2IA1A 2FRHA 4HNUA 2VIXA 3MZ8A 1LEBA 3MQ0A 4MGRA 5FB2A 2R7SA 3TMOA 4S04A 2OQRA 1BIBA 1QHHD 2JUGA 3V7RA 1VQNI 1IN5A 4BDYA 3DF8A 2DOEA 4P1WA 3LSJA 3IC7A 1CQTA 1T6SA 1T08B 3X2QH 1STZA 1MGTA 2YSRA 4C30A 4UY8I 5LGUA 5E79C 3LSKA 2V1NA 3AG4H 4PJ0C 5AONA 2R7RA 1F4KA 2VONA 1ZR4A 1R7JA 2JT1A 2OF7A 4UVBA 2LP0A 5DUIA 2O8XA 3RIRA 4XLPF 4ZYDA 1PDNC 1E0EA 3JRCA 3IH2A 3CDIA 2A3SA 2W82A 2DK8A 1A36A 1LEAA 2B7EA 5FKOA 1BBYA 4A3KJ 3OSGA 2KRFA 3BLYA 3PM1A 3CCJI 5GTIC 4IF4A 1VQ6I 2G7UA 1QVTA 1N78A 4R1HA 3HYIA 4ZYHA 3F3XA 2KT0A 2DTRA 2QENA 5FKMA 3KPHA 3EUAA 1KONA 3FBIB 4KUMA 5EEGA 3F8NA 3IWZA 4NB5A 1UZCA 3BR0A 4RB0A 1P9QC 3VODA 3HUGA 2TRTA 5LD2C 1IN8A 1TLHB 4A5NA 1I6HJ 4CCJA 1FIAA 1BR2A 4ABZA 1XB4A 2E5ZA 1Z91A 4ZJZA 2ME0A 4CYCA 2I10A 3G3ZA 2XKOA 1P92A 2VJ5A 4O5VA 3ZQIA 5M5XJ 3Q5FA 1HKSA 2GLOA 3OYDA 3L2RA 3JRFA 1JGGA 2ZO4A 1KU2A 1S9HA 1XGSA 3PQKA 5FJ8J 2E1OA 1LE8B 4M71A 2ISZA 2COBA 3H9JA 1UELB 3CDLA 1VQLI 1YW9A 2QVOA 5FKLA 2HQ5A 1MMNA 2M9HA 2NVQJ 1MH3A 5GTHC 3KX2A 1WQ2A 1A04A 4YFXF 1O4XA 4A3BJ 2B0LA 2DQRA 3EDPA 5HDGA 3IV5A 3QYEA 4KIGA 5IP7J 4XSZF 1YX5A 3CDHA 2VKEA 3ZRGA 1UHMA 2F6CA 5B1AH 1GVJA 2JJ7A 2Z16A 3PUBA 2WA0A 4L9JA 1WSUA 5FKNA 4DYQA 1XSDA 2HZDA 2Y30A 1X58A 1D1AA 3H0GJ 4O6JA 1WHUA 3L2UA 3OV8A 5L3EA 3HJEA 3DTEA 4OIPF 3E7LA 2CGPA 1VFCA 2HDDA 1VQ7I 1RKTA 2XGEA 1B72B 2V1UA 2CG4A 4JX5A 3GMEA 3GFIA 3K1MA 3JTHA 5FLMJ 1IF1A 2F5VA 3R0AA 5F27A 2CJJA 1GV5A 1T38A 3W2VA 2MC3A 2XRLA 5IP9J 4EATA 2GM4A 5EZHA 4LK0F 1LKXA 2CW0F 4IPAA 3PUFA 3SXYA 1JHFA 1JUPA 2H6BA 5TJJA 2E2HJ 2GQQA 1P7JA 3HTUA 1ETOA 4XLCA 1MJ9A 4RB1A 2VKVA 2WAQA 4DZJA 3M9AA 4UUVA 3DEWA 4BE2A 2DA7A 2NVUB 4AYBA 1L0OC 5E18F 4EJOA 4CCNA 3RKXA 3PO2J 3SZPA 2LVSA 5HODA 4AM3A 2MD5A 2F4IA 2E36A 3QPSA 4IZZA 5DD4A 4ZH4F 3PSFA 4ZTFA 1D1CA 1IC8A 2F5DA 2LBFB 1I39A 1Z9CA 4B48A 4LG3A 1A6IA 3DXJF 5JFRA 4FASD 2CFOA 3HM5A 1KGSA 5F0CA 4Y52J 2WB1N 2NYXA 3LFKA 4RLFA 3HDDA 1XCVA 4W1UA 4FT8A 2JA7J 3V8LA 2A5YB 2RQQA 3CC4I 1RUOA 3B73A 3T5XA 4D0PA 3KYLA 2X1EA 3I4PA 2CQXA 1DQUA 4UV9A 1MD0A 2K86A 3SHFA 4B3AA 3FK6A 4PSWA 2Z1DA 3GLXA 5JLWA 3HOWJ 1MDMA 2WADA 3K70D 3BY6A 3FWEA 1K6YA 1GXQA 1GUUA 2Y9ZA 4FX4A 1JKQC 3CUOA 3IL2A 4BY1J 2ZMEB 2K9LA 3KFWX 3ZMDA 1K78A 1ZG1A 6PAXA 4LFUA 2XF7A 3CTAA 3CCEI 3I4NJ 1BIAA 2EBIA 5D5XB 1NH3A 1MBJA 3I54A 4CO8A 2E1MC 3PNVA 2H94A 4QWQA 2FQ4A 2LKPA 1Q1HA 3SZGA 1F9NA 4BXXJ 4NUBA 2DA3A 4E7HA 4XKCA 2IRFG 4A3LJ 1UFMA 2HFHA 4RGSA 3RPQA 3ZXSA 1W36C 1DUXC 2JRMA 3CJQB 1I3QJ 2Y0MA 3V8KA 4F92B 2Z3YA 1X4OA 2EPFA 1X3UA 3BROA 5E8GA 3QU3A 3CLOA 5D5VB 5IYBJ 4DOZA 3COAC 1F36A 1U3EM 1FYKA 3BZKA 2M7AA 1Z67A 4YFNF 2Y2ZA 4II3A 2M5WA 3P7NA 4U0YA 4WXDA 1D3YA 2EFWA 4JYKA 1KU3A 1BR4A 4RA2A 2TDXA 2F5FA 3ML6A 2E71A 2CUFA 4KIFA 3K70C 1D8KA 2EZIA 3S15J 2W1OA 4HX4A 3JSOA 4D7NA 3QP6A 1WRJA 4BAYA 1QU3A 1GHCA 4L5JA 1IAWA 1SD6A 3RPUD 2OPTA 1R58A 4EM1A 1G2HA 2EH3A 1KU7A 1O7FA 2ZFUA 4M74A 2OC6A 3CF5F 3S3NA 4KISA 3I71A 2VKDA 1IUYA 4KT5C 3C2BA 3PFIA 5F04A 3RKWA 3LSTA 1G6NA 2KLOA 5EYRA 1X1CA 1W1WE 3O3KA 4EJWA 5E1WA 3ZGKA 4OAYA 5EDNA 2GA1A 4MFDA 4D7MA 5F0HA 2HYJA 3ZCOA 2P5VA 2QCOA 3JRDA 3A1YA 1X3WB 2DA4A 1OQYA 3DKWA 3WU2C 2IT0A 2EA2A 3HSRA 2GIZA 4WXCA 3L2QA 2K9NA 2QA4I 2JRTA 2VJ4A 1IO2A 5L3FA 3G4SI 2O5RA 1P2FA 2BW3B 2W25A 2ISYA 2QWWA 3MKYB 1YG2A 2IGKA 3D5RC 2W85A 4O3MA 2DLLA 3FHZA 2L4MA 2A07F 4ANJA 1YIJI 2KQRA 1KYWA 4QLCU 3S1QJ 1X2MA 3SQNA 1R49A 1ZRDA 2OAZA 1D0XA 4A3IJ 1E2XA 4EVIA 4ZZLA 1QA6A 1RPWA 2QUFA 3C18A 4PSXA 2HU9A 2L01A 1R6RA 1D1BA 2IS6A 5TISC 3ABUA 3OYEA 4ASNA 4M6YA 1LDKB 4PCQA 3OYMA 4KICA 3DFGA 3H9GA 2HDCA 5BNGA 3ZN1A 5HVQC 3CC2I 5E3LA 2E2JJ 1W5SA 4KNYA 3U1KA 2IW5A 1Z7LA 1V4RA 5B1BH 3RPUA 3TW6A 1W5TA 3H5NA 2BV6A 3KP6A 1SVMA 1ETYA 2X1CA 3S8PA 1QO0D 4AIHA 5DUKA 5KAIC 1SAUA 1JXSA 1B4AA 2EIJH 1RKWA 2KMUA 3L9FA 2QKLB 4HSTA 2OV7A 4MO7A 4N9HA 3IAS2 2VE9A 2A6TA 2DMTA 1F5TA 2J5OA 4IHVA 1LE8A 1OPCA 1ONVA 1HBXG 1D5VA 5FD6A 1S8NA 2QGUA 4M9SA 5FO5A 3TBIA 1HA8A 2PJPA 1YTYA 1R9TJ 1P4AA 3AKZA 1YRNB 2FJ1A 3HOUJ 3SDGA 2PI0A 2DFFA 3HB9A 4PUSA 3MEXA 4Y15A 2DDAA 4V2GA 4UUSB 3VYRB 2FF4A 1FWZA 3A03A 2F5EA 2DFEA 2YU9J 2LD5A 4BHPA 1OYYA 2ESNA 4I02A 4BHCA 4LLGF 5DCFA 2FOWA 2M45A 2ZNZA 4E7SA 5GAGJ 2Z9OA 3H0DA 3QPLA 5IYDJ 1VTNC 2LREA 2MC4A 3J81K 1Y56A 3F0CA 1B72A 2PJRA 3RYPA 3RSNA 5IP6A 4MEYF 5LLQA 2H27A 2LY1A 3NWTA 4KITB 4LK1F 4HG2A 1HW5A 3NAUA 2PMZA 4N4OB 1ZELA 2QZ8A 1R5HA 3RCOA 1AHDP 5CLSA 2Y0SN 1H9GA 2CQKA 4B47A 1D5YA 5LFAA 3JRBA 3DTIA 3KIOA 3K4KA 3ISPA 3KETA 2YX4A 2IS2A 2AO9A 2FBIA 3BDDA 3M3YJ 4JK1X 1EJ9A 1S7EA 4RB2C 1TW2A 4J19A 4BJTA 3GYHX 5M5WJ 4UXNA 1J75A 3V8JA 1APLC 1JTXA 4X6AJ 1RC9A 3KP5A 4E7JA 1HCRA 2RN7A 5J40A 1HSTA 4F52A 3LA2A 1FEXA 4L5EA 5GPCA 5E17F 3I3LA 4ENMA 2CV1A 2YPRA 2IP2A 2DW4A 1FSEA 2X6XA 5AIQA 1D8JA 5JLXA 2IS4A 1EH8A 4HYEA 5FFXA 3F9KA 2KDOA 2WV1A 3J81Z 1KQ9A 1W7PD 1VQ9I 4KYWA 1VZ0A 3IRQA 2CFXA 4BXUA 4I6ZA 2XF6A 4F93B 3R60A 2NS8A 2P6SA 4CDGA 3HGGA 5E3MA 3A02A 4HA8A 4WWCA 3ABKH 1YJNI 2DAOA 3VSLA 3QPTA 2DYSH 4P9UA 2KL4A 3FKJA 1WI9A 3FXOA 3FBNB 4P96A 4EEFG 5CPRB 2CQ7A 1IN7A 1IW7F 3GF2A 4CICA 3MFKA 2F48A 3WTWC 1H89C 4IX7A 1P4WA 4IO9F 3V7CA 3L7WA 2EINH 2RREA 3WTUC 1FLIA 4KMUX 3S1MJ 2D1HA 2YR2A 2ZJQF 2OBPA 1R4NB 3WE3A 1YYVA 4XSXF 4YIFA 3D5SC 1ZAOA 4HNTA 2L4AA 2MSYA 3IHUA 1JJ6C 1ZRFA
chains in the Genus database with same CATH topology
1FBSA 4WXHA 2FE3A 2OA4A 2QM3A 4P5OA 3FX3A 3EQLF 1ZYRF 1O3RA 3L00A 2QQAA 4Q4ZF 1LDJA 5BQTA 3T0YA 1DP7P 3PQJA 2EFPA 2VE8A 2O03A 2XVCA 4L9TA 2Y75A 4HOBA 4I7HA 4U7DA 2M8EA 2DBBA 3KZZA 5FD5A 1DPRA 3F8MA 2HOEA 2HTSA 3KZYA 2HWVA 2AS5F 3CO7C 4U7BA 1MJBA 2C6YA 4I0BA 1KQ0A 5CVVA 3TKYA 1G3WA 3HRSA 2XIGA 2P5KA 1BOAA 4UHTA 1BI2A 3F72A 3KCCA 2IJLA 3ZN0A 3F21A 2WWYA 3O2PE 3WTTC 3E6DA 2PG4A 2PLYA 1TNSA 1G3YA 3O6BB 5ILSA 2PMUA 2EV6A 4M6XA 3ECOA 4ESBA 2WC2A 3HOTA 4HF0A 4AWXB 2CSOA 4ENJA 2A6HF 3FXUA 4R79A 2G7HA 3GZ6A 2V9VA 5E20A 2IPQX 1KQ8A 4Q47A 2HR3A 2K27A 4IHTA 2HQRA 2UXNA 2LDUA 2STTA 3EETA 4ZYEA 3TO6A 3WTVC 3M1EA 1XN7A 5A2QK 4H0EA 3JAMK 3WE2A 5LHGA 2FU4A 3U9GA 3REOA 3LAJA 4L0YB 2O3FA 4EMSA 4LLLA 4K2EA 4GYGA 5FFZA 3E3VA 5HLGA 1DPUA 4GO1A 1USSA 2LSOA 3GZ5A 5LRRA 4OMYA 1LB2A 3I58A 4MQ9F 2JPCA 1FC3A 1U78A 4M9XA 1DDNA 2HYGD 2R7DA 4GCVA 5A2QZ 3TDUC 2EJRA 1TQMA 4BQAA 3JAMZ 3AAFA 3BJOA 5D6FA 1O3QA 1FNNA 4U0VA 2QQ9A 3KP2A 3H92A 2QQBA 3U2RA 2W24A 3BZ6A 3KLNA 3FMSA 4CXFA 3K9TA 3KP4A 3TOAA 4A6EA 4GYIA 1W4MA 2BE5F 5DCMB 4HF1A 2FEZA 1G3SA 1LQ1A 2M30A 1LVAA 3QPHA 5LEKA 2DPDA 1ODDA 4YFKF 5L3CA 4KIBA 2E1CA 4WCGA 4MQVA 1KYZA 4RS8A 1ZGJA 2W57A 2K7LA 3LA3A 4LJZF 3F8FA 3L2CA 1JGSA 4MTDA 3ZQ7A 3TO7A 3RTRA 3NRVA 1FP2A 2AXLA 2ZNYA 4LLNA 4EJTA 3MAJA 3JW4A 1XGMA 3MZHA 1ON1A 4UVAA 1YQAA 2P8TA 3I64A 1U8RA 3WU0A 1TTYA 4FX0A 4EQQA 4BH9A 2FNAA 3WGHA 2FBHA 3K1PA 2KJBA 1HW1A 2BGCA 3JTGA 3N4MA 1QPMA 3WODF 2KIFA 4I2OA 5BS6A 2VODA 5FGMA 2J5PA 3LA7A 2EWNA 4AIJA 1K7AA 4HQMA 1ZGAA 1J0RA 1FY7A 5CVJA 4HDVA 3E6BA 2ZBKA 3K0LA 3VB2A 5D4RA 2CYYA 1K79A 2O0YA 1XMKA 3OOPA 2X0LA 4EGZA 1AWCA 1Z6TA 3BP8A 2DI3A 1W7PB 1BJAA 2HEOA 2QYOA 1R22A 4L9VA 2YU3A 4Y13A 2FQ3A 1I27A 2MH9A 5E1XA 4RB3C 4IXAA 4ESJA 2VOPA 1BM9A 1BN5A 2MA3A 1QZZA 1ZG5A 1QBJA 1P6RA 2KIMA 1U5TC 4AIKA 5LRSA 3ERED 3KLOA 5JHUA 5AIPA 2KJCA 3GWZA 4UNOA 4RGUA 4HX8A 3HRMA 2A69F 1UCRA 3MWMA 1FPQA 3C1DA 5CJ9A 1RZ4A 2OU2A 4OOIA 5LEJA 4HLXA 1LJ9A 2ZKZA 5HS7A 4EGYA 2IVMA 2P7VB 1S6LA 3GEZA 3I59A 1K6OA 4OIQF 4CYDA 3U1DA 1CF7B 4RGXA 3ZMUA 1RI7A 5ILVA 1LNWA 4P9FA 2HQNA 2GIVA 1R1VA 3VOEA 2HKXA 5F6FA 5H6QA 3BJAA 2GAUA 3V7SA 1TQPA 4G7OF 2BBYA 2JSCA 1T98A 3TQNA 3K69A 1OYIA 1ZH5A 5ICFA 1T39A 4Y17A 2XRNA 4HX7A 2FBKA 1IXCA 1ZRCA 4I09A 1TNTA 2EB7A 4A12A 2LF7A 2P7CB 1KU9A 5DDGA 3FMQA 3I0TA 1YLFA 3W6JB 4OIRF 1EH6A 1TBXA 1YO5C 3R0JA 3KP3A 3EUHA 4HV5A 1O7LA 3QAHA 5F1RA 3WGGA 5DCMA 2X4HA 1HSJA 3P9KA 3FXRA 1ZLJA 2VBYA 1R00A 2V79A 5BPDA 2KIUA 2L3DA 3P9IA 4PDKA 1L3LA 3GO5A 1IN6A 5EEHA 2P4WA 4PZJA 3EYYA 3E6CC 2UXXA 3CUQC 1SFXA 5CYVA 3EYIA 2P5LC 4A0YA 3QU6A 3L09A 1RNLA 2Q2EA 2FSWA 1I1GA 4N0BA 2Q8KA 3ZP5A 3CO6C 1IXSB 4RGRA 4L9NA 2UZKA 5K5QA 2FXAA 4NHJA 2GZWA 3E5XA 3HSFA 1XSXA 2RDPA 2VBXA 2EV5A 3CJNA 5ERIA 3LQQA 2XAFA 3E97A 1PP7U 2VOOA 3FM5A 4G6QA 3GW2A 1SD7A 4RAYA 2HTJA 3VEPA 4I01A 5HS8A 2FA5A 2HS5A 2VC0A 2XGXA 2QBYA 4LB6B 2PFBA 1FYLA 3R61A 3WTYC 4IHSA 1B9MA 2IA0A 3RKYA 3B02A 5CVUA 3TOBA 1W7PA 2E1NA 2Q0OA 2BYVE 2EFQA 1P4XA 4CHUA 1ZREA 3P9CA 2YX7A 2NS0A 3BOQA 4G7HF 1HQCA 3DPLC 4ESFA 3LWFA 1R1UA 3GFMA 3MCZA 2OD5A 4IRIA 1BI3A 1UB9A 2NRAC 4I0AA 5FLXK 3KEOA 4A2UA 3ZMSA 2OZ6A 5H6RA 2DT5A 1I6XA 4HBLA 1R23A 4HW0A 3FMRA 4HLYA 3F23A 2CWEA 2STWA 1B59A 2Z99A 3GFLA 2K02A 2DU9A 1G4DA 3ABTA 1ULYA 1WKMA 3KEQA 1T0FA 3ECHA 2EFNA 2JTVA 1CF7A 3QP5A 1PUEE 4U0WA 3BPVA 3WTSC 3I5UA 1SD5A 4G7ZF 2H09A 2Y48A 5HOOA 3BWGA 1XDSA 4Q48A 5FLXZ 1U2WA 2ADUA 1U5TB 2IA2A 4BNCA 1BI1A 4G6DA 3LAPA 5D5UB 4IJAA 3K1NA 1ON2A 3TO9A 4HDUA 1FP1D 5TRDA 2FMYA 5HDKA 2HKOA 2PEXA 3I59B 1HW2A 1IXRC 2WV0A 2F5CA 1OR7A 2XROA 4EM2A 3HHHA 1J9IA 3BPXA 2EA4A 4G94A 1IRGA 4G9YA 1FT9A 2A61A 5D5WB 5LHHA 3D5LA 1O3TA 2V1XA 1RIOH 5CVRA 4R8HA 4MNUA 3ROUA 4A6DA 1MKMA 2E7XA 2DK5A 2NNYA 1J2XA 1BI0A 3WG9A 1S29A 5H20A 2D1VA 4G8XA 3RI4A 3FM3A 3M8EA 5DV5A 4L18B 4KA4A 3N97A 1B9NA 4KN4X 5D4SA 1U6GA 4OMZA 5ICGA 1FX7A 4M73A 1ZLKA 2FNPA 3M7GA 1XCBA 4BHBA 2JPBA 4OIOF 4UV8A 4LMYA 3ZMVA 3HTSB 1QGPA 1XMAA 4ZYGA 3R6SA 1I1SA 2GA2A 2XV4S 5HLHA 5K5RA 3NQOA 2ETHA 4KDPA 1HKTA 3E6MA 5E1ZB 4ZZDA 1FBQA 3FXQA 4L0ZB 3DEUA 1TQIA 3IKVA 5HLIA 3WTZA 4S05A 3WU1B 1ZG3A 1FZPB 4LG0B 3DP7A 4E70A 1SAXA 4IRGA 5BOXA 5K1YA 4UVCA 5E8IA 1FSHA 3E5QA 1S7OA 2DPUA 3BJ6A 3CUQB 2FOKA 2RQPA 2M1BA 5JVTA 3F6VA 5HS9A 2ESHA 3SFZA 3ZMZA 4ENNA 1FOKA 1JHHA 4EV0A 4KMFA 2LNBA 1J5YA 4MEXF 3S2WA 3HHGA 2NAZA 4GGGA 1FYMA 2XASA 1J59A 4HF2A 1ZARA 1XGNA 3DV8A 2QBYB 5ICCA 3SZTA 1XGOA 4KFCA 4KN7X 2XKPA 1CGPA 4LGWA 1QQIA 1KA8A 3ELKA 4PGGA 2MBFA 2OQGA 5ILUA 2PBIA 4L5IA 4XLNF 3FZVA 4XRFA 2HZTA 4HQEA 4JQFA 1FBUA 1H0MA 1G3TA 2D2WA 4OU0A 3ZPLA 2WTEA 3GFJA 1PP8F 4GXOA 3QRFF 2VXZA 2Z33A 1EH7A 4P55A 5IT9K 1C0WA 1Z6RA 2O6GE 1JE8A 3ZMTA 2MH2A 5ED4A 5BPIA 2QLZA 3GXOA 3R4KA 1U5TA 3HSEA 2Z5UA 4A0XA 2COMA 2ZJ2A 2E7WA 1SFUA 2XAHA 1SMTA 2RNJA 2P6TA 4DQ2A 5KK1A 4I98B 1MJAA 5LGNA 5HDNA 1QZYA 1SFEA 1IN4A 2LF8A 3HRUA 4TV7A 3FF5A 2RVCA 3T8TA 2PN6A 5K5OA 1HXDA 3HRTA 5IT9Z 1MZBA 3J7AO 1Y0UA 4AD9A 2HGCA 4YG2F 2UWMA 1GXPA 2GXGA 3C3WA 5LHIA 4HZFA 2VT2A 2VN2A 1O57A 3F8BA 2NNNA 2PMHA 2ZFWA 5D8LB 3F8CA 2RC4A 1BC8C 4Q5SF 4FHTA 3IKTA 4LB5A 3E5UA 1HKQA 2H6CA 4AVPA 2DQLA 4HV6A 5J6XA 3I53A 4N9IA 3LQRA 1YS7A 2A6EF 5LBQA 2DFIA 3Q9SA 4M9ZA 4CGZA 3VFZA 5DEQA 1UHWA 1YS6A 2VBWA 1B1BA 3TGNA 4HAMA 4LD5A 4WX9A 5LGTA 5J8CA 4MTEA 2EK5A 1Z7UA 1SMYF 3C7JA 5J8FA 4U88A 1E17A 5ICEA 4YIIA 4BYYA 3IWFA 3GUDA 3JSPA 2EFOA 2OZUA 4CZZA 2K4JA 2VBZA 3HIFA 5JR3A 2DO7A 2EV0A 1S3JA 4DNCA 4LG0A 4F7ZA 2MLGA 1NHAA 2V6CA 4EM0B 4MHGA 3RDIA 1TW3A 1IZ1A 3NEUA 1R5GA 5IT3A 3CUQA 3GVAA 4ETSA 4EJUA 1OMIA 2FMLA 5L3BA 1R36A 1Z1DA 2VT3A 1B6AA 2KKOA 3WTXC 1T2KA 4A0ZA 3G73A 2XUBA 5DD8A 2ZCWA 2R3SA 3H3ZA 3F22A 3DQVC 2A68F 1H9TA 4JBAA 2R7FA 2RKHA 5D8KB 4RAZA 3HOSA 2XAGA 3GX4X 2CO5A 3TDZC 2G9WA 4NQWA 5KVRA 1YW7A 1IRFA 2W84A 4IVNA 2ZMEA 3MZYA 2D45A 3K2ZA 4PGHA 1REPC 3T8RA 2RGVA 4XBFA 1QNTA 1XDUA 1USTA 2XAQA 2L54A 1XSVA 3ULQB 3J80K 1RUNA 3Q9VA 2JZYA 2VC1A 5F64A 4EJVA 1AOYA 1YFHA 3KP7A 5DYMA 2V1DA 3WGIA 3KE2A 5L3GA 4M72A 1O3SA 1ZN2A 2GWRA 1Z05A 4A5MA 1YIOA 4IRHA 1ZHFA 3DPTA 2O61A 1MDMB 3T1BA 2ACJA 5BMZA 2PQ8A 4OINF 1OKRA 1K78B 3H3UA 4B8XA 2K4BA 1OYWA 4Z2YA 2MLKA 5JI6A 2XHKA 4WK8F 1V3FA 2L02A 2BEOA 1YW8A 2ELHA 3J80Z 4ON0A 1WWXA 1F1ZA 2M87A 1SD4A 1XD7A 3W6KB 3RJPA 5D6EA 1J7KA 3F6OA 2GXBA 2XAJA 4WF2A 3V4GA 4B09A 1BC7C 2F2EA 1I5ZA 1LDDA 5L3DA 2RV8A 3M8FA 3RYRA 5CVIA 3IRRA 3QOPA 3D0SA 4ENKA 2HYFA 2ZXJA 1EV7A 1R1TA 1S7AA 2IA1A 2FRHA 1LEBA 3MQ0A 4MGRA 5FB2A 4S04A 2OQRA 1BIBA 3V7RA 1IN5A 3DF8A 3IC7A 1T6SA 1STZA 1MGTA 2YSRA 5LGUA 2VONA 1F4KA 5AONA 1R7JA 2JT1A 4UVBA 5DUIA 2O8XA 3RIRA 4XLPF 4ZYDA 1PDNC 2A3SA 2DK8A 1LEAA 1BBYA 2KRFA 4IF4A 2G7UA 4R1HA 3HYIA 4ZYHA 3F3XA 2DTRA 2QENA 4KUMA 5EEGA 3F8NA 3IWZA 4NB5A 4RB0A 3VODA 3HUGA 1IN8A 1TLHB 4A5NA 1XB4A 1Z91A 3G3ZA 2XKOA 1P92A 4O5VA 3Q5FA 1HKSA 2ZO4A 1KU2A 1XGSA 3PQKA 4M71A 2ISZA 1YW9A 2QVOA 4YFXF 1WQ2A 1A04A 2B0LA 2DQRA 3EDPA 5HDGA 4KIGA 4XSZF 3CDHA 1UHMA 1GVJA 4L9JA 1WSUA 1XSDA 4O6JA 3OV8A 5L3EA 4OIPF 2CGPA 2V1UA 2CG4A 3GFIA 3K1MA 3JTHA 1IF1A 3R0AA 1T38A 2MC3A 4LK0F 2CW0F 4IPAA 3SXYA 1JHFA 2H6BA 5TJJA 2GQQA 3HTUA 1MJ9A 4RB1A 3M9AA 4UUVA 1L0OC 5E18F 4EJOA 3RKXA 3SZPA 2MD5A 5DD4A 4ZH4F 2F5DA 1Z9CA 3DXJF 5JFRA 1KGSA 2NYXA 3LFKA 1XCVA 4FT8A 3V8LA 2A5YB 1RUOA 3B73A 3T5XA 4D0PA 3I4PA 4UV9A 1MD0A 2K86A 3SHFA 3GLXA 1MDMA 3BY6A 3FWEA 1GXQA 4FX4A 3CUOA 3IL2A 2ZMEB 3KFWX 3ZMDA 1K78A 1ZG1A 6PAXA 4LFUA 3CTAA 1BIAA 5D5XB 3I54A 4CO8A 2H94A 4QWQA 2LKPA 1Q1HA 1F9NA 2IRFG 1UFMA 2HFHA 4RGSA 3RPQA 1DUXC 2Y0MA 3V8KA 2Z3YA 1X3UA 3BROA 5E8GA 3QU3A 3CLOA 5D5VB 3COAC 1U3EM 1FYKA 4YFNF 2M5WA 3P7NA 4U0YA 4WXDA 1D3YA 2EFWA 1KU3A 2TDXA 2F5FA 3ML6A 4KIFA 1D8KA 4HX4A 3JSOA 3QP6A 1WRJA 4BAYA 1GHCA 4L5JA 1IAWA 1SD6A 1R58A 4EM1A 1KU7A 1O7FA 4M74A 3I71A 1IUYA 4KT5C 3PFIA 3RKWA 3LSTA 1G6NA 3O3KA 4EJWA 5E1WA 2GA1A 2P5VA 3DKWA 2IT0A 2EA2A 3HSRA 4WXCA 2JRTA 5L3FA 1P2FA 2W25A 2ISYA 2QWWA 1YG2A 2W85A 4O3MA 2DLLA 3FHZA 2L4MA 2A07F 1KYWA 4QLCU 3SQNA 1ZRDA 2OAZA 1E2XA 4EVIA 4ZZLA 2QUFA 3C18A 2L01A 3ABUA 4ASNA 4M6YA 1LDKB 4PCQA 4KICA 3DFGA 2HDCA 5HVQC 3ZN1A 1W5SA 4KNYA 2IW5A 1V4RA 3RPUA 1W5TA 2BV6A 3KP6A 4AIHA 1QO0D 5DUKA 1JXSA 1B4AA 3L9FA 4N9HA 2VE9A 1F5TA 2J5OA 1OPCA 1ONVA 1HBXG 1D5VA 5FD6A 1S8NA 4M9SA 5FO5A 2PJPA 1YTYA 1P4AA 2PI0A 3MEXA 4Y15A 2FF4A 1FWZA 2F5EA 4BHPA 1OYYA 2ESNA 4I02A 4BHCA 4LLGF 5DCFA 2M45A 2ZNZA 2Z9OA 1VTNC 3J81K 3RYPA 4MEYF 5LLQA 2H27A 4LK1F 1HW5A 2QZ8A 1R5HA 5CLSA 1H9GA 2CQKA 3ISPA 3KETA 2YX4A 2FBIA 3BDDA 4JK1X 4RB2C 1TW2A 3GYHX 4UXNA 1J75A 3V8JA 3KP5A 2RN7A 1HSTA 3LA2A 5E17F 4ENMA 2YPRA 2IP2A 2DW4A 1FSEA 5AIQA 1D8JA 1EH8A 4HYEA 5FFXA 3J81Z 1KQ9A 1W7PD 4KYWA 3IRQA 2CFXA 4BXUA 3R60A 2P6SA 4CDGA 4WWCA 4HA8A 2DAOA 3QPTA 4P9UA 1WI9A 4P96A 1IN7A 1IW7F 3GF2A 4CICA 3MFKA 3WTWC 1P4WA 3V7CA 3L7WA 3WTUC 1FLIA 4KMUX 2D1HA 2YR2A 2OBPA 3WE3A 1YYVA 4XSXF 4YIFA 1ZAOA 2L4AA 3IHUA 1ZRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBS A;  4WXH A;  2FE3 A;  2OA4 A;  2QM3 A;  4P5O A;  3FX3 A;  3EQL F;  1ZYR F;  1O3R A;  3L00 A;  2QQA A;  4Q4Z F;  1LDJ A;  5BQT A;  3T0Y A;  1DP7 P;  3PQJ A;  2EFP A;  2VE8 A;  2O03 A;  2XVC A;  4L9T A;  2Y75 A;  4HOB A;  4I7H A;  4U7D A;  2M8E A;  2DBB A;  3KZZ A;  5FD5 A;  1DPR A;  3F8M A;  2HOE A;  2HTS A;  3KZY A;  2HWV A;  2AS5 F;  3CO7 C;  4U7B A;  1MJB A;  2C6Y A;  4I0B A;  1KQ0 A;  5CVV A;  3TKY A;  1G3W A;  3HRS A;  2XIG A;  2P5K A;  1BOA A;  4UHT A;  1BI2 A;  3F72 A;  3KCC A;  2IJL A;  3ZN0 A;  3F21 A;  2WWY A;  3O2P E;  3WTT C;  3E6D A;  2PG4 A;  2PLY A;  1TNS A;  1G3Y A;  3O6B B;  5ILS A;  2PMU A;  2EV6 A;  4M6X A;  3ECO A;  4ESB A;  2WC2 A;  3HOT A;  4HF0 A;  4AWX B;  2CSO A;  4ENJ A;  2A6H F;  3FXU A;  4R79 A;  2G7H A;  3GZ6 A;  2V9V A;  5E20 A;  2IPQ X;  1KQ8 A;  4Q47 A;  2HR3 A;  2K27 A;  4IHT A;  2HQR A;  2UXN A;  2LDU A;  2STT A;  3EET A;  4ZYE A;  3TO6 A;  3WTV C;  3M1E A;  1XN7 A;  5A2Q K;  4H0E A;  3JAM K;  3WE2 A;  5LHG A;  2FU4 A;  3U9G A;  3REO A;  3LAJ A;  4L0Y B;  2O3F A;  4EMS A;  4LLL A;  4K2E A;  4GYG A;  5FFZ A;  3E3V A;  5HLG A;  1DPU A;  4GO1 A;  1USS A;  2LSO A;  3GZ5 A;  5LRR A;  4OMY A;  1LB2 A;  3I58 A;  4MQ9 F;  2JPC A;  1FC3 A;  1U78 A;  4M9X A;  1DDN A;  2HYG D;  2R7D A;  4GCV A;  5A2Q Z;  3TDU C;  2EJR A;  1TQM A;  4BQA A;  3JAM Z;  3AAF A;  3BJO A;  5D6F A;  1O3Q A;  1FNN A;  4U0V A;  2QQ9 A;  3KP2 A;  3H92 A;  2QQB A;  3U2R A;  2W24 A;  3BZ6 A;  3KLN A;  3FMS A;  4CXF A;  3K9T A;  3KP4 A;  3TOA A;  4A6E A;  4GYI A;  1W4M A;  2BE5 F;  5DCM B;  4HF1 A;  2FEZ A;  1G3S A;  1LQ1 A;  2M30 A;  1LVA A;  3QPH A;  5LEK A;  2DPD A;  1ODD A;  4YFK F;  5L3C A;  4KIB A;  2E1C A;  4WCG A;  4MQV A;  1KYZ A;  4RS8 A;  1ZGJ A;  2W57 A;  2K7L A;  3LA3 A;  4LJZ F;  3F8F A;  3L2C A;  1JGS A;  4MTD A;  3ZQ7 A;  3TO7 A;  3RTR A;  3NRV A;  1FP2 A;  2AXL A;  2ZNY A;  4LLN A;  4EJT A;  3MAJ A;  3JW4 A;  1XGM A;  3MZH A;  1ON1 A;  4UVA A;  1YQA A;  2P8T A;  3I64 A;  1U8R A;  3WU0 A;  1TTY A;  4FX0 A;  4EQQ A;  4BH9 A;  2FNA A;  3WGH A;  2FBH A;  3K1P A;  2KJB A;  1HW1 A;  2BGC A;  3JTG A;  3N4M A;  1QPM A;  3WOD F;  2KIF A;  4I2O A;  5BS6 A;  2VOD A;  5FGM A;  2J5P A;  3LA7 A;  2EWN A;  4AIJ A;  1K7A A;  4HQM A;  1ZGA A;  1J0R A;  1FY7 A;  5CVJ A;  4HDV A;  3E6B A;  2ZBK A;  3K0L A;  3VB2 A;  5D4R A;  2CYY A;  1K79 A;  2O0Y A;  1XMK A;  3OOP A;  2X0L A;  4EGZ A;  1AWC A;  1Z6T A;  3BP8 A;  2DI3 A;  1W7P B;  1BJA A;  2HEO A;  2QYO A;  1R22 A;  4L9V A;  2YU3 A;  4Y13 A;  2FQ3 A;  1I27 A;  2MH9 A;  5E1X A;  4RB3 C;  4IXA A;  4ESJ A;  2VOP A;  1BM9 A;  1BN5 A;  2MA3 A;  1QZZ A;  1ZG5 A;  1QBJ A;  1P6R A;  2KIM A;  1U5T C;  4AIK A;  5LRS A;  3ERE D;  3KLO A;  5JHU A;  5AIP A;  2KJC A;  3GWZ A;  4UNO A;  4RGU A;  4HX8 A;  3HRM A;  2A69 F;  1UCR A;  3MWM A;  1FPQ A;  3C1D A;  5CJ9 A;  1RZ4 A;  2OU2 A;  4OOI A;  5LEJ A;  4HLX A;  1LJ9 A;  2ZKZ A;  5HS7 A;  4EGY A;  2IVM A;  2P7V B;  1S6L A;  3GEZ A;  3I59 A;  1K6O A;  4OIQ F;  4CYD A;  3U1D A;  1CF7 B;  4RGX A;  3ZMU A;  1RI7 A;  5ILV A;  1LNW A;  4P9F A;  2HQN A;  2GIV A;  1R1V A;  3VOE A;  2HKX A;  5F6F A;  5H6Q A;  3BJA A;  2GAU A;  3V7S A;  1TQP A;  4G7O F;  2BBY A;  2JSC A;  1T98 A;  3TQN A;  3K69 A;  1OYI A;  1ZH5 A;  5ICF A;  1T39 A;  4Y17 A;  2XRN A;  4HX7 A;  2FBK A;  1IXC A;  1ZRC A;  4I09 A;  1TNT A;  2EB7 A;  4A12 A;  2LF7 A;  2P7C B;  1KU9 A;  5DDG A;  3FMQ A;  3I0T A;  1YLF A;  3W6J B;  4OIR F;  1EH6 A;  1TBX A;  1YO5 C;  3R0J A;  3KP3 A;  3EUH A;  4HV5 A;  1O7L A;  3QAH A;  5F1R A;  3WGG A;  5DCM A;  2X4H A;  1HSJ A;  3P9K A;  3FXR A;  1ZLJ A;  2VBY A;  1R00 A;  2V79 A;  5BPD A;  2KIU A;  2L3D A;  3P9I A;  4PDK A;  1L3L A;  3GO5 A;  1IN6 A;  5EEH A;  2P4W A;  4PZJ A;  3EYY A;  3E6C C;  2UXX A;  3CUQ C;  1SFX A;  5CYV A;  3EYI A;  2P5L C;  4A0Y A;  3QU6 A;  3L09 A;  1RNL A;  2Q2E A;  2FSW A;  1I1G A;  4N0B A;  2Q8K A;  3ZP5 A;  3CO6 C;  1IXS B;  4RGR A;  4L9N A;  2UZK A;  5K5Q A;  2FXA A;  4NHJ A;  2GZW A;  3E5X A;  3HSF A;  1XSX A;  2RDP A;  2VBX A;  2EV5 A;  3CJN A;  5ERI A;  3LQQ A;  2XAF A;  3E97 A;  1PP7 U;  2VOO A;  3FM5 A;  4G6Q A;  3GW2 A;  1SD7 A;  4RAY A;  2HTJ A;  3VEP A;  4I01 A;  5HS8 A;  2FA5 A;  2HS5 A;  2VC0 A;  2XGX A;  2QBY A;  4LB6 B;  2PFB A;  1FYL A;  3R61 A;  3WTY C;  4IHS A;  1B9M A;  2IA0 A;  3RKY A;  3B02 A;  5CVU A;  3TOB A;  1W7P A;  2E1N A;  2Q0O A;  2BYV E;  2EFQ A;  1P4X A;  4CHU A;  1ZRE A;  3P9C A;  2YX7 A;  2NS0 A;  3BOQ A;  4G7H F;  1HQC A;  3DPL C;  4ESF A;  3LWF A;  1R1U A;  3GFM A;  3MCZ A;  2OD5 A;  4IRI A;  1BI3 A;  1UB9 A;  2NRA C;  4I0A A;  5FLX K;  3KEO A;  4A2U A;  3ZMS A;  2OZ6 A;  5H6R A;  2DT5 A;  1I6X A;  4HBL A;  1R23 A;  4HW0 A;  3FMR A;  4HLY A;  3F23 A;  2CWE A;  2STW A;  1B59 A;  2Z99 A;  3GFL A;  2K02 A;  2DU9 A;  1G4D A;  3ABT A;  1ULY A;  1WKM A;  3KEQ A;  1T0F A;  3ECH A;  2EFN A;  2JTV A;  1CF7 A;  3QP5 A;  1PUE E;  4U0W A;  3BPV A;  3WTS C;  3I5U A;  1SD5 A;  4G7Z F;  2H09 A;  2Y48 A;  5HOO A;  3BWG A;  1XDS A;  4Q48 A;  5FLX Z;  1U2W A;  2ADU A;  1U5T B;  2IA2 A;  4BNC A;  1BI1 A;  4G6D A;  3LAP A;  5D5U B;  4IJA A;  3K1N A;  1ON2 A;  3TO9 A;  4HDU A;  1FP1 D;  5TRD A;  2FMY A;  5HDK A;  2HKO A;  2PEX A;  3I59 B;  1HW2 A;  1IXR C;  2WV0 A;  2F5C A;  1OR7 A;  2XRO A;  4EM2 A;  3HHH A;  1J9I A;  3BPX A;  2EA4 A;  4G94 A;  1IRG A;  4G9Y A;  1FT9 A;  2A61 A;  5D5W B;  5LHH A;  3D5L A;  1O3T A;  2V1X A;  1RIO H;  5CVR A;  4R8H A;  4MNU A;  3ROU A;  4A6D A;  1MKM A;  2E7X A;  2DK5 A;  2NNY A;  1J2X A;  1BI0 A;  3WG9 A;  1S29 A;  5H20 A;  2D1V A;  4G8X A;  3RI4 A;  3FM3 A;  3M8E A;  5DV5 A;  4L18 B;  4KA4 A;  3N97 A;  1B9N A;  4KN4 X;  5D4S A;  1U6G A;  4OMZ A;  5ICG A;  1FX7 A;  4M73 A;  1ZLK A;  2FNP A;  3M7G A;  1XCB A;  4BHB A;  2JPB A;  4OIO F;  4UV8 A;  4LMY A;  3ZMV A;  3HTS B;  1QGP A;  1XMA A;  4ZYG A;  3R6S A;  1I1S A;  2GA2 A;  2XV4 S;  5HLH A;  5K5R A;  3NQO A;  2ETH A;  4KDP A;  1HKT A;  3E6M A;  5E1Z B;  4ZZD A;  1FBQ A;  3FXQ A;  4L0Z B;  3DEU A;  1TQI A;  3IKV A;  5HLI A;  3WTZ A;  4S05 A;  3WU1 B;  1ZG3 A;  1FZP B;  4LG0 B;  3DP7 A;  4E70 A;  1SAX A;  4IRG A;  5BOX A;  5K1Y A;  4UVC A;  5E8I A;  1FSH A;  3E5Q A;  1S7O A;  2DPU A;  3BJ6 A;  3CUQ B;  2FOK A;  2RQP A;  2M1B A;  5JVT A;  3F6V A;  5HS9 A;  2ESH A;  3SFZ A;  3ZMZ A;  4ENN A;  1FOK A;  1JHH A;  4EV0 A;  4KMF A;  2LNB A;  1J5Y A;  4MEX F;  3S2W A;  3HHG A;  2NAZ A;  4GGG A;  1FYM A;  2XAS A;  1J59 A;  4HF2 A;  1ZAR A;  1XGN A;  3DV8 A;  2QBY B;  5ICC A;  3SZT A;  1XGO A;  4KFC A;  4KN7 X;  2XKP A;  1CGP A;  4LGW A;  1QQI A;  1KA8 A;  3ELK A;  4PGG A;  2MBF A;  2OQG A;  5ILU A;  2PBI A;  4L5I A;  4XLN F;  3FZV A;  4XRF A;  2HZT A;  4HQE A;  4JQF A;  1FBU A;  1H0M A;  1G3T A;  2D2W A;  4OU0 A;  3ZPL A;  2WTE A;  3GFJ A;  1PP8 F;  4GXO A;  3QRF F;  2VXZ A;  2Z33 A;  1EH7 A;  4P55 A;  5IT9 K;  1C0W A;  1Z6R A;  2O6G E;  1JE8 A;  3ZMT A;  2MH2 A;  5ED4 A;  5BPI A;  2QLZ A;  3GXO A;  3R4K A;  1U5T A;  3HSE A;  2Z5U A;  4A0X A;  2COM A;  2ZJ2 A;  2E7W A;  1SFU A;  2XAH A;  1SMT A;  2RNJ A;  2P6T A;  4DQ2 A;  5KK1 A;  4I98 B;  1MJA A;  5LGN A;  5HDN A;  1QZY A;  1SFE A;  1IN4 A;  2LF8 A;  3HRU A;  4TV7 A;  3FF5 A;  2RVC A;  3T8T A;  2PN6 A;  5K5O A;  1HXD A;  3HRT A;  5IT9 Z;  1MZB A;  3J7A O;  1Y0U A;  4AD9 A;  2HGC A;  4YG2 F;  2UWM A;  1GXP A;  2GXG A;  3C3W A;  5LHI A;  4HZF A;  2VT2 A;  2VN2 A;  1O57 A;  3F8B A;  2NNN A;  2PMH A;  2ZFW A;  5D8L B;  3F8C A;  2RC4 A;  1BC8 C;  4Q5S F;  4FHT A;  3IKT A;  4LB5 A;  3E5U A;  1HKQ A;  2H6C A;  4AVP A;  2DQL A;  4HV6 A;  5J6X A;  3I53 A;  4N9I A;  3LQR A;  1YS7 A;  2A6E F;  5LBQ A;  2DFI A;  3Q9S A;  4M9Z A;  4CGZ A;  3VFZ A;  5DEQ A;  1UHW A;  1YS6 A;  2VBW A;  1B1B A;  3TGN A;  4HAM A;  4LD5 A;  4WX9 A;  5LGT A;  5J8C A;  4MTE A;  2EK5 A;  1Z7U A;  1SMY F;  3C7J A;  5J8F A;  4U88 A;  1E17 A;  5ICE A;  4YII A;  4BYY A;  3IWF A;  3GUD A;  3JSP A;  2EFO A;  2OZU A;  4CZZ A;  2K4J A;  2VBZ A;  3HIF A;  5JR3 A;  2DO7 A;  2EV0 A;  1S3J A;  4DNC A;  4LG0 A;  4F7Z A;  2MLG A;  1NHA A;  2V6C A;  4EM0 B;  4MHG A;  3RDI A;  1TW3 A;  1IZ1 A;  3NEU A;  1R5G A;  5IT3 A;  3CUQ A;  3GVA A;  4ETS A;  4EJU A;  1OMI A;  2FML A;  5L3B A;  1R36 A;  1Z1D A;  2VT3 A;  1B6A A;  2KKO A;  3WTX C;  1T2K A;  4A0Z A;  3G73 A;  2XUB A;  5DD8 A;  2ZCW A;  2R3S A;  3H3Z A;  3F22 A;  3DQV C;  2A68 F;  1H9T A;  4JBA A;  2R7F A;  2RKH A;  5D8K B;  4RAZ A;  3HOS A;  2XAG A;  3GX4 X;  2CO5 A;  3TDZ C;  2G9W A;  4NQW A;  5KVR A;  1YW7 A;  1IRF A;  2W84 A;  4IVN A;  2ZME A;  3MZY A;  2D45 A;  3K2Z A;  4PGH A;  1REP C;  3T8R A;  2RGV A;  4XBF A;  1QNT A;  1XDU A;  1UST A;  2XAQ A;  2L54 A;  1XSV A;  3ULQ B;  3J80 K;  1RUN A;  3Q9V A;  2JZY A;  2VC1 A;  5F64 A;  4EJV A;  1AOY A;  1YFH A;  3KP7 A;  5DYM A;  2V1D A;  3WGI A;  3KE2 A;  5L3G A;  4M72 A;  1O3S A;  1ZN2 A;  2GWR A;  1Z05 A;  4A5M A;  1YIO A;  4IRH A;  1ZHF A;  3DPT A;  2O61 A;  1MDM B;  3T1B A;  2ACJ A;  5BMZ A;  2PQ8 A;  4OIN F;  1OKR A;  1K78 B;  3H3U A;  4B8X A;  2K4B A;  1OYW A;  4Z2Y A;  2MLK A;  5JI6 A;  2XHK A;  4WK8 F;  1V3F A;  2L02 A;  2BEO A;  1YW8 A;  2ELH A;  3J80 Z;  4ON0 A;  1WWX A;  1F1Z A;  2M87 A;  1SD4 A;  1XD7 A;  3W6K B;  3RJP A;  5D6E A;  1J7K A;  3F6O A;  2GXB A;  2XAJ A;  4WF2 A;  3V4G A;  4B09 A;  1BC7 C;  2F2E A;  1I5Z A;  1LDD A;  5L3D A;  2RV8 A;  3M8F A;  3RYR A;  5CVI A;  3IRR A;  3QOP A;  3D0S A;  4ENK A;  2HYF A;  2ZXJ A;  1EV7 A;  1R1T A;  1S7A A;  2IA1 A;  2FRH A;  1LEB A;  3MQ0 A;  4MGR A;  5FB2 A;  4S04 A;  2OQR A;  1BIB A;  3V7R A;  1IN5 A;  3DF8 A;  3IC7 A;  1T6S A;  1STZ A;  1MGT A;  2YSR A;  5LGU A;  2VON A;  1F4K A;  5AON A;  1R7J A;  2JT1 A;  4UVB A;  5DUI A;  2O8X A;  3RIR A;  4XLP F;  4ZYD A;  1PDN C;  2A3S A;  2DK8 A;  1LEA A;  1BBY A;  2KRF A;  4IF4 A;  2G7U A;  4R1H A;  3HYI A;  4ZYH A;  3F3X A;  2DTR A;  2QEN A;  4KUM A;  5EEG A;  3F8N A;  3IWZ A;  4NB5 A;  4RB0 A;  3VOD A;  3HUG A;  1IN8 A;  1TLH B;  4A5N A;  1XB4 A;  1Z91 A;  3G3Z A;  2XKO A;  1P92 A;  4O5V A;  3Q5F A;  1HKS A;  2ZO4 A;  1KU2 A;  1XGS A;  3PQK A;  4M71 A;  2ISZ A;  1YW9 A;  2QVO A;  4YFX F;  1WQ2 A;  1A04 A;  2B0L A;  2DQR A;  3EDP A;  5HDG A;  4KIG A;  4XSZ F;  3CDH A;  1UHM A;  1GVJ A;  4L9J A;  1WSU A;  1XSD A;  4O6J A;  3OV8 A;  5L3E A;  4OIP F;  2CGP A;  2V1U A;  2CG4 A;  3GFI A;  3K1M A;  3JTH A;  1IF1 A;  3R0A A;  1T38 A;  2MC3 A;  4LK0 F;  2CW0 F;  4IPA A;  3SXY A;  1JHF A;  2H6B A;  5TJJ A;  2GQQ A;  3HTU A;  1MJ9 A;  4RB1 A;  3M9A A;  4UUV A;  1L0O C;  5E18 F;  4EJO A;  3RKX A;  3SZP A;  2MD5 A;  5DD4 A;  4ZH4 F;  2F5D A;  1Z9C A;  3DXJ F;  5JFR A;  1KGS A;  2NYX A;  3LFK A;  1XCV A;  4FT8 A;  3V8L A;  2A5Y B;  1RUO A;  3B73 A;  3T5X A;  4D0P A;  3I4P A;  4UV9 A;  1MD0 A;  2K86 A;  3SHF A;  3GLX A;  1MDM A;  3BY6 A;  3FWE A;  1GXQ A;  4FX4 A;  3CUO A;  3IL2 A;  2ZME B;  3KFW X;  3ZMD A;  1K78 A;  1ZG1 A;  6PAX A;  4LFU A;  3CTA A;  1BIA A;  5D5X B;  3I54 A;  4CO8 A;  2H94 A;  4QWQ A;  2LKP A;  1Q1H A;  1F9N A;  2IRF G;  1UFM A;  2HFH A;  4RGS A;  3RPQ A;  1DUX C;  2Y0M A;  3V8K A;  2Z3Y A;  1X3U A;  3BRO A;  5E8G A;  3QU3 A;  3CLO A;  5D5V B;  3COA C;  1U3E M;  1FYK A;  4YFN F;  2M5W A;  3P7N A;  4U0Y A;  4WXD A;  1D3Y A;  2EFW A;  1KU3 A;  2TDX A;  2F5F A;  3ML6 A;  4KIF A;  1D8K A;  4HX4 A;  3JSO A;  3QP6 A;  1WRJ A;  4BAY A;  1GHC A;  4L5J A;  1IAW A;  1SD6 A;  1R58 A;  4EM1 A;  1KU7 A;  1O7F A;  4M74 A;  3I71 A;  1IUY A;  4KT5 C;  3PFI A;  3RKW A;  3LST A;  1G6N A;  3O3K A;  4EJW A;  5E1W A;  2GA1 A;  2P5V A;  3DKW A;  2IT0 A;  2EA2 A;  3HSR A;  4WXC A;  2JRT A;  5L3F A;  1P2F A;  2W25 A;  2ISY A;  2QWW A;  1YG2 A;  2W85 A;  4O3M A;  2DLL A;  3FHZ A;  2L4M A;  2A07 F;  1KYW A;  4QLC U;  3SQN A;  1ZRD A;  2OAZ A;  1E2X A;  4EVI A;  4ZZL A;  2QUF A;  3C18 A;  2L01 A;  3ABU A;  4ASN A;  4M6Y A;  1LDK B;  4PCQ A;  4KIC A;  3DFG A;  2HDC A;  5HVQ C;  3ZN1 A;  1W5S A;  4KNY A;  2IW5 A;  1V4R A;  3RPU A;  1W5T A;  2BV6 A;  3KP6 A;  4AIH A;  1QO0 D;  5DUK A;  1JXS A;  1B4A A;  3L9F A;  4N9H A;  2VE9 A;  1F5T A;  2J5O A;  1OPC A;  1ONV A;  1HBX G;  1D5V A;  5FD6 A;  1S8N A;  4M9S A;  5FO5 A;  2PJP A;  1YTY A;  1P4A A;  2PI0 A;  3MEX A;  4Y15 A;  2FF4 A;  1FWZ A;  2F5E A;  4BHP A;  1OYY A;  2ESN A;  4I02 A;  4BHC A;  4LLG F;  5DCF A;  2M45 A;  2ZNZ A;  2Z9O A;  1VTN C;  3J81 K;  3RYP A;  4MEY F;  5LLQ A;  2H27 A;  4LK1 F;  1HW5 A;  2QZ8 A;  1R5H A;  5CLS A;  1H9G A;  2CQK A;  3ISP A;  3KET A;  2YX4 A;  2FBI A;  3BDD A;  4JK1 X;  4RB2 C;  1TW2 A;  3GYH X;  4UXN A;  1J75 A;  3V8J A;  3KP5 A;  2RN7 A;  1HST A;  3LA2 A;  5E17 F;  4ENM A;  2YPR A;  2IP2 A;  2DW4 A;  1FSE A;  5AIQ A;  1D8J A;  1EH8 A;  4HYE A;  5FFX A;  3J81 Z;  1KQ9 A;  1W7P D;  4KYW A;  3IRQ A;  2CFX A;  4BXU A;  3R60 A;  2P6S A;  4CDG A;  4WWC A;  4HA8 A;  2DAO A;  3QPT A;  4P9U A;  1WI9 A;  4P96 A;  1IN7 A;  1IW7 F;  3GF2 A;  4CIC A;  3MFK A;  3WTW C;  1P4W A;  3V7C A;  3L7W A;  3WTU C;  1FLI A;  4KMU X;  2D1H A;  2YR2 A;  2OBP A;  3WE3 A;  1YYV A;  4XSX F;  4YIF A;  1ZAO A;  2L4A A;  3IHU A;  1ZRF A; 
#chains in the Genus database with same CATH topology
 1BR1 A;  1FBS A;  4WXH A;  5KCM A;  1ERD A;  2FE3 A;  2OA4 A;  2QM3 A;  4P5O A;  4XOT A;  3FX3 A;  3EQL F;  1ZYR F;  1O3R A;  2KDZ A;  3L00 A;  2QQA A;  4Q4Z F;  1B8I B;  4OAZ A;  1LDJ A;  1OFC X;  3LNQ A;  5BQT A;  3T0Y A;  3G71 I;  4CZC A;  1DP7 P;  4E6K G;  1WJB A;  3PQJ A;  2EFP A;  3ONQ A;  1VQ5 I;  2VE8 A;  2O03 A;  1TT0 A;  1OCC H;  4J01 A;  5J1Y A;  2XVC A;  1GT0 C;  4L9T A;  2DJI A;  2Y75 A;  4HOB A;  4I7H A;  2OCC H;  3GZN B;  4U7D A;  2M8E A;  4IQJ A;  2DBB A;  4BGD A;  2LR8 A;  3KZZ A;  5FD5 A;  2CUZ A;  1DPR A;  3LFU A;  3S1N J;  4Z6Y A;  3F8M A;  4BXF A;  5E3N A;  2HOE A;  2HTS A;  2HNH A;  3KEY A;  3KZY A;  2BY2 A;  3VWB A;  2K85 A;  1X1P A;  2HWV A;  2AS5 F;  3CO7 C;  4U7B A;  4IHY A;  1MJB A;  1K83 J;  4C3H J;  2C6Y A;  2L5Q A;  4I0B A;  4FCY A;  1XG1 A;  1TWF J;  1KQ0 A;  4GDF A;  2CW8 A;  4ZDP A;  5CVV A;  4XQF A;  3IUO A;  3PIO F;  3TKY A;  1G3W A;  4PJL A;  1Y0N A;  3HRS A;  2XIG A;  2P5K A;  3CME I;  1BOA A;  3HKZ A;  3Q0V A;  4UHT A;  1BI2 A;  3F72 A;  2D5V A;  2WAQ N;  3KCC A;  2IJL A;  4CH7 A;  5M5Y J;  2FD5 A;  3OYH A;  4QIW N;  4BBR J;  3SJM A;  2VQC A;  3ZN0 A;  2K9M A;  3OYN A;  3F21 A;  1ZK8 A;  4IHX A;  2WWY A;  3O2P E;  1T0F C;  2BW3 A;  3E6D A;  2PG4 A;  3WTT C;  2PLY A;  1ITY A;  2FX0 A;  1TZL A;  1TNS A;  1VI0 A;  1G3Y A;  4BY7 J;  3O6B B;  1JJ8 C;  2YS9 A;  2E60 A;  5F08 A;  2VLA A;  1MMA A;  3HOX J;  5ILS A;  2PMU A;  2DA6 A;  2EV6 A;  4M6X A;  3ECO A;  2GBY A;  2WC2 A;  2VQG A;  4ESB A;  1QPI A;  1EA3 A;  3HOT A;  4HF0 A;  2CH0 A;  4AWX B;  2CSO A;  4ENJ A;  2A6H F;  3I4M J;  3FXU A;  5J3L A;  4R79 A;  2G7H A;  3DWL E;  3GZ6 A;  2V9V A;  5E20 A;  2IPQ X;  3CF2 A;  4YEJ A;  3ZQL A;  1TC3 C;  4PJN A;  1KQ8 A;  1RES A;  4XNF A;  2XB5 A;  3UR3 C;  4RAG A;  2NVY J;  4Q47 A;  2HR3 A;  2UV1 A;  2K27 A;  1MBG A;  3OSF A;  4IHT A;  1TWG J;  2DA5 A;  2HQR A;  2UXN A;  2LDU A;  2K9Q A;  3EET A;  2STT A;  4ZYE A;  3TO6 A;  3WTV C;  2KZV A;  3M1E A;  1XN7 A;  5A2Q K;  1OR7 C;  4H0E A;  5C4J J;  3MKZ A;  4C9Y A;  1NK2 P;  2ICW G;  1YRN A;  1MW7 A;  3BC8 A;  1DU6 A;  3IH3 A;  4BEH A;  3JAM K;  2HVS A;  3HEF A;  4UUS A;  3WE2 A;  1U9N A;  5LHG A;  2FU4 A;  3U9G A;  3PL8 A;  4M3G A;  3HOV J;  1W5C C;  2XSD C;  2GXA A;  3REO A;  3LAJ A;  4JP0 A;  4L0Y B;  4XLE A;  1A6Q A;  1DGW Y;  2O3F A;  4EMS A;  4LLL A;  2XAU A;  4GYG A;  4K2E A;  4NNJ A;  1XX5 A;  4KT6 A;  5FFZ A;  3OR2 C;  2LMD A;  3E3V A;  5HLG A;  1XPX A;  1DPU A;  3K4C A;  2DDB A;  4GO1 A;  3ZQH A;  1USS A;  3DBR B;  2LSO A;  1MND A;  4XR6 A;  4PJM A;  1YI2 I;  3BTI A;  3GZ5 A;  1HDD C;  5LRR A;  4OMY A;  3M4O J;  4S0H B;  1Y1W J;  1YJW I;  2H8R A;  1LB2 A;  3I58 A;  4XKW A;  4DYR A;  3K4M A;  4MQ9 F;  2JPC A;  1FC3 A;  4XMY A;  1U78 A;  2DJN A;  4M9X A;  1DDN A;  1V55 H;  4PFO A;  2BXZ A;  2HYG D;  4CCO A;  2R7D A;  4GCV A;  5A2Q Z;  2UUZ A;  3TDU C;  2CW7 A;  2EJR A;  3HGY A;  2JN6 A;  1Z77 A;  3OL4 A;  3HL2 A;  1FTT A;  1TQM A;  2R7O A;  4BQA A;  3JAM Z;  3AAF A;  3BJO A;  5D6F A;  1O3Q A;  1FNN A;  4NC8 A;  4U0V A;  2O7O A;  2QQ9 A;  3KP2 A;  3H92 A;  2QQB A;  2N8G A;  3U2R A;  5C4X J;  3LSM A;  2W24 A;  3BZ6 A;  4QPO A;  3KLN A;  3FMS A;  3BCB A;  2ZXW H;  4CXF A;  2M8G X;  1SVO A;  1QRY A;  3FXK A;  2LC2 A;  3BTJ A;  3K9T A;  3KP4 A;  3TOA A;  2DN0 A;  4A6E A;  2ZXI A;  2X6W A;  1A5J A;  4GYI A;  2PJR B;  1W4M A;  2BE5 F;  5DCM B;  3ZQQ A;  1HDP A;  4HF1 A;  4QSH A;  2FEZ A;  1G3S A;  1LQ1 A;  3KYD B;  1ENH A;  2R7W A;  2M30 A;  2R92 J;  1LVA A;  2M4G A;  3QPH A;  5LEK A;  2DPD A;  1ODD A;  4YFK F;  5L3C A;  4XK4 A;  3ZQC A;  4A3F J;  4XIC A;  4KIB A;  2E1C A;  2W7N A;  3BT9 A;  4WCG A;  1R4M B;  4MQV A;  5M3M J;  3N05 A;  2LKX A;  1ZKG A;  2HPM A;  1KYZ A;  2BZT A;  4RS8 A;  5J1U A;  1ZGJ A;  2W57 A;  2K7L A;  2KZG A;  3LA3 A;  4LJZ F;  1K4S A;  3ASO H;  3JCU C;  4RM3 A;  2DA2 A;  1IDZ A;  3F8F A;  3L2C A;  2IS1 A;  1X1D A;  4I99 C;  2ID6 A;  1JGS A;  4MTD A;  4QPQ A;  1MNM C;  3ZQ7 A;  2M3A A;  4II2 A;  2IEK A;  5FRN A;  1FIP A;  1UHS A;  3TO7 A;  3DU5 A;  3RTR A;  1W36 D;  3NRV A;  3VYS B;  4PK4 A;  1I50 J;  1FP2 A;  2AXL A;  2ZNY A;  4LLN A;  4EJT A;  5KNL A;  3MAJ A;  3JW4 A;  1TT5 B;  1XGM A;  3MZH A;  1ON1 A;  4UVA A;  3OYB A;  3B6C A;  1P7I A;  2XPW A;  4NC6 A;  3DPU A;  4Y3O A;  1YQA A;  1B8I A;  2P8T A;  3I64 A;  4QTR A;  1U8R A;  3WU0 A;  2JQ7 A;  1TTY A;  4FX0 A;  2M0C A;  4EQQ A;  2NVT J;  3OYC A;  3CMM A;  4BH9 A;  2FNA A;  3WGH A;  2LG4 A;  2FBH A;  3JR9 A;  5K7H A;  3K1P A;  4C2T A;  5DM6 F;  2KJB A;  2X1D A;  1RR8 C;  1HW1 A;  2BGC A;  3JTG A;  3N4M A;  1LUJ B;  1NG6 A;  1QPM A;  3WOD F;  2KIF A;  4I2O A;  5BS6 A;  2VOD A;  3JRA A;  4RM2 A;  5FGM A;  2J5P A;  3LA7 A;  2EWN A;  2M0M A;  4AIJ A;  1X19 A;  1K7A A;  3NAR A;  4AVZ A;  3DKX A;  5CQE A;  4HQM A;  1ZGA A;  4UB6 C;  2L7F P;  1J0R A;  3CCV I;  1FY7 A;  3G1L A;  3QWL A;  2Y69 H;  3LSI A;  5CVJ A;  1JUM A;  4HDV A;  3E6B A;  2ZBK A;  3DLL F;  1HC8 A;  3K0L A;  2ME6 A;  1WH7 A;  3VB2 A;  2EIM H;  1BA5 A;  4D5F A;  2PMZ N;  3CP2 A;  4BS9 A;  2CYY A;  5D4R A;  3CMA I;  1K79 A;  3OOU A;  2R7U A;  2O0Y A;  2WAF A;  1XMK A;  3GTQ J;  3OOP A;  2X0L A;  4EGZ A;  1AWC A;  3CC7 I;  3AG1 H;  1Z6T A;  3H36 A;  2CRG A;  1T95 A;  3BP8 A;  2DI3 A;  1W7P B;  3I56 I;  1BJA A;  5IPA A;  2HEO A;  2QYO A;  1R22 A;  1R71 A;  2VI6 A;  4L9V A;  2BY3 A;  3GTP J;  2YU3 A;  4Y13 A;  3S16 J;  4Y7N J;  3DU6 A;  3OS0 A;  2FQ3 A;  1I27 A;  1U8B A;  3HOY J;  4XN0 A;  2MH9 A;  2BOL A;  5E1X A;  4RB3 C;  4IXA A;  4ESJ A;  1JKP C;  3OYJ A;  5DS9 A;  2VOP A;  1BM9 A;  3H5A A;  1XS9 A;  3W2A A;  1BN5 A;  2MA3 A;  2NOJ B;  1QZZ A;  2O8K A;  1ZG5 A;  3ZOB A;  2JA8 J;  4XKB A;  1H8A C;  1QBJ A;  1P6R A;  2KIM A;  1TWA J;  1U5T C;  2OJE D;  4HSR A;  4AIK A;  5LRS A;  3ERE D;  3KLO A;  5JHU A;  1JKR C;  5AIP A;  2KJC A;  3GWZ A;  2R5Y A;  2I8D A;  4M3B A;  2DA1 A;  4UNO A;  4RGU A;  4HX8 A;  4B4C A;  3HRM A;  2A69 F;  1UCR A;  3MWM A;  1FJL A;  4BJ6 C;  1FPQ A;  5GP9 A;  2HOT A;  1XC5 A;  3C1D A;  5CJ9 A;  1TL8 A;  1RZ4 A;  2OU2 A;  4OOI A;  5J4Y A;  5LEJ A;  2BVL A;  4HLX A;  1LJ9 A;  2KPM A;  2ZKZ A;  5HS7 A;  3ESW B;  1SC7 A;  4W97 A;  4EGY A;  2IVM A;  2P7V B;  3Q3S A;  2ZJR F;  4LIU A;  2DXI A;  1S6L A;  3GEZ A;  2WY8 Q;  3I59 A;  1K6O A;  4OIQ F;  5E3O A;  1IRZ A;  4BBS J;  4CYD A;  3U1D A;  1CF7 B;  3W6V A;  4RGX A;  3ZMU A;  1RI7 A;  2XPV A;  5ILV A;  4FE4 A;  1LNW A;  4P9F A;  1SAN A;  1E3H A;  1QVU A;  2GIV A;  2HQN A;  3VSK A;  1R1V A;  2HKX A;  5F6F A;  3VOE A;  2IGN A;  5H6Q A;  2BXY A;  3BJA A;  2GAU A;  2IAI A;  4UUT A;  1WFX A;  3RQI A;  2QF7 A;  4A3J J;  3V7S A;  1TQP A;  3PNY A;  5DTD A;  3FHN A;  4JX6 A;  4G7O F;  2BBY A;  5EJC A;  4DBR A;  2JSC A;  1T98 A;  3TQN A;  3K69 A;  1OYI A;  3J7A Y;  3PJR A;  1ZH5 A;  5ICF A;  3GCM A;  3K7A J;  4Y17 A;  1T39 A;  5KHD A;  2XRN A;  4HX7 A;  3FIS A;  2FBK A;  1Y1V J;  2P81 A;  4CA0 A;  9ANT A;  2RAE A;  4B1R A;  1LFP A;  2DFH A;  1IXC A;  1ZRC A;  4I09 A;  1TNT A;  2EB7 A;  2R7V A;  4GRI A;  1EF4 A;  4BEH B;  4A12 A;  2LF7 A;  1WJE A;  2P7C B;  3OL3 A;  1KU9 A;  5DDG A;  5M3F J;  3CP8 A;  2KFD A;  1BW5 A;  3FMQ A;  3I0T A;  2VJI A;  2X6O A;  4BE1 A;  1YLF A;  3BG9 A;  3PFY A;  3W6J B;  4OIR F;  1EH6 A;  1TBX A;  1YO5 C;  2HI3 A;  2L9S A;  3R0J A;  4YEL A;  1GV2 A;  3KP3 A;  3EPZ A;  3C2H A;  4G12 A;  3FKI J;  3EUH A;  5EZG A;  4A69 C;  4HV5 A;  1O7L A;  3HKZ N;  3QAH A;  5F1R A;  3WGG A;  5DCM A;  2X4H A;  1HSJ A;  2E2I J;  3P9K A;  1UG2 A;  3FXR A;  3GTJ J;  3S3O A;  1ZLJ A;  2VBY A;  3TP0 A;  4JX4 A;  2P0W A;  4E7L A;  2AQE A;  1R00 A;  5DM7 F;  2V79 A;  5BPD A;  2M34 A;  2KIU A;  4PJJ A;  1ETW A;  1S5L C;  2L9V A;  2L3D A;  2MW8 A;  4B44 A;  3P9I A;  4PDK A;  3BR3 A;  2ZSH B;  4BE0 A;  1L3L A;  3CJT B;  1Q1V A;  1UG0 A;  5GAE J;  4D1Q A;  2HVQ A;  3GO5 A;  2H1L A;  4ITV A;  1IN6 A;  5B5E C;  5EEH A;  3JRI A;  1FTZ A;  3CLQ A;  2CV0 A;  3OR1 C;  3OYI A;  3WG7 H;  1AA7 A;  2P4W A;  2JA2 A;  4PZJ A;  3EYY A;  3H1C A;  3G1O A;  3HPG A;  4XL9 A;  3E6C C;  3HOZ J;  3GTG J;  1BL0 A;  3PIP F;  3CCM I;  2M7B A;  4LOC A;  2UXX A;  3CUQ C;  1JTY A;  1SFX A;  5CYV A;  3U21 A;  3EYI A;  4FTH A;  1EKE A;  2LRD A;  3W2W A;  2P5L C;  4A0Y A;  3P5J A;  1GVD A;  3QU6 A;  3L09 A;  1RNL A;  1V5E A;  2Q2E A;  2FSW A;  3VPR A;  2QEX I;  1I1G A;  1WPK A;  1N25 A;  4N0B A;  1OCP A;  2Q8K A;  3ZP5 A;  3CCR I;  3CO6 C;  3CCL I;  1TWC J;  2BVM A;  1IXS B;  1UMQ A;  2CUE A;  4RGR A;  3DKY A;  2E5N A;  4L9N A;  1DP3 A;  2UZK A;  5K5Q A;  2FXA A;  4NHJ A;  2GZW A;  3E5X A;  3HSF A;  1XMX A;  1Y39 A;  1XSX A;  2RDP A;  2VBX A;  2EV5 A;  4E7Z A;  2EIK H;  1JI8 A;  3CJN A;  5ERI A;  3LQQ A;  2XAF A;  3E97 A;  2ZME C;  3H5R A;  1PP7 U;  2VOO A;  5GPA A;  3FM5 A;  4G6Q A;  3GW2 A;  4U87 A;  1SD7 A;  2R4G A;  4RAY A;  1X3Z B;  2HTJ A;  3SEQ A;  3VEP A;  3SEZ A;  2ECC A;  4I01 A;  5HS8 A;  2HOS A;  3FXL A;  1MBH A;  4BQO A;  2DMU A;  2FA5 A;  2HS5 A;  2VC0 A;  2XGX A;  4DW6 A;  1SVL A;  4LB6 B;  2QBY A;  5J4V A;  2PFB A;  2XPU A;  1MH4 A;  2VKH A;  4NC7 A;  3SDB A;  3OIQ A;  1FYL A;  1WI3 A;  1OCT C;  2R93 J;  3R61 A;  2QQ8 A;  4RLQ A;  3WTY C;  2JVH A;  4IHS A;  5K7Z A;  2K5C A;  3ZR8 X;  2V6E A;  1B9M A;  2MYS A;  2IA0 A;  3RKY A;  3B02 A;  2V4J C;  5CVU A;  1VQK I;  4OWR B;  2K3F A;  3TOB A;  1W7P A;  2E1N A;  1XTA A;  3G2B A;  2Q0O A;  2BYV E;  3CQZ J;  2EFQ A;  1P4X A;  4CHU A;  1ZRE A;  3P9C A;  5F1J A;  2HXI A;  2YX7 A;  1OLT A;  4J00 A;  5IOY A;  3OYK A;  3CMY A;  1PYV A;  1NK3 P;  2NS0 A;  4V2F A;  2O9L A;  3BOQ A;  4G7H F;  2E35 A;  1Z3Y A;  1IJW C;  4D9J A;  1HQC A;  3A01 B;  3DPL C;  4ESF A;  4XRS G;  2MFZ A;  3S1R J;  3LWF A;  2XGD A;  1R1U A;  3GFM A;  3K4N A;  3MCZ A;  2OD5 A;  4IRI A;  1BI3 A;  2E1M B;  2X6Y A;  1UB9 A;  2NRA C;  1LVK A;  2HXO A;  4I0A A;  4E7I A;  3GTK J;  5FLX K;  2H8W A;  1Y6I A;  3KEO A;  4A2U A;  3ZMS A;  2OZ6 A;  1TP4 A;  5F0F A;  5H6R A;  2EZK A;  2DT5 A;  1QHG A;  1I6X A;  3PSI A;  2LY2 A;  4HBL A;  2LLK A;  1R23 A;  1PUF B;  2HVR A;  1WJF A;  4HW0 A;  3OS2 A;  4CCK A;  2NVX J;  3OIO A;  4AYB N;  3FMR A;  4HLY A;  3F23 A;  1YE9 A;  3E0J B;  2CWE A;  2STW A;  1B59 A;  4NBQ A;  3CZ6 A;  2VL8 A;  3RZO J;  3GBG A;  1WCM J;  2Z99 A;  2KRH A;  3M07 A;  3GFL A;  2K02 A;  3OIP A;  2DMQ A;  2ZXH A;  2DU9 A;  1G4D A;  2F4M B;  1ULY A;  1WKM A;  3ABT A;  3KEQ A;  3S93 A;  1T0F A;  1T56 A;  3ECH A;  3ABL H;  3VDX A;  2EFN A;  2PX9 A;  3BG5 A;  2JTV A;  1CF7 A;  1ETQ A;  3QQA A;  3QP5 A;  1PUE E;  4U0W A;  1V5F A;  3RQ4 A;  3BPV A;  3WTS C;  4HEA 2;  3I5U A;  4RAF A;  1SD5 A;  3BCA A;  2VJJ A;  4G7Z F;  2H09 A;  2BHZ A;  2Z2S B;  2Y48 A;  5B66 C;  3ZQG A;  5HOO A;  3BWG A;  1XDS A;  3DLA A;  3LSH A;  2E34 A;  4Q48 A;  3M8J A;  2R5Y B;  5K7F A;  3CCS I;  5FLX Z;  4HNV A;  2DOF A;  1HF0 A;  1U2W A;  4Y33 A;  2B63 J;  2ADU A;  1U5T B;  2LYC A;  2DMP A;  1S72 I;  2IA2 A;  1JUS A;  1I3A A;  1SFK A;  1OCZ H;  3K6G A;  4BNC A;  2M4K A;  1BI1 A;  4G6D A;  1VQ4 I;  3LAP A;  5D5U B;  4IJA A;  3TW7 A;  1YJ9 I;  2DYR H;  2XB0 X;  3K1N A;  1ON2 A;  1YX3 A;  1R5I D;  3EUK L;  4XRM A;  3TO9 A;  1IV8 A;  4HDU A;  3B6A A;  4HRI A;  1FP1 D;  2AHQ A;  5TRD A;  2FMY A;  2DOA A;  5HDK A;  1T33 A;  2HKO A;  2L0K A;  1FMW A;  2PEX A;  4F55 A;  3I59 B;  1HW2 A;  1IXR C;  4NDL A;  2WV0 A;  2F5C A;  1OR7 A;  2XRO A;  4EM2 A;  2KIQ A;  2ELJ A;  2HDW A;  2W4S A;  3A0H C;  3S2D J;  3HHH A;  3OYG A;  1WJ5 A;  4XN3 A;  1J9I A;  5J47 A;  5FLV A;  1ORK A;  3BPX A;  2X9D A;  4A93 J;  2LFB A;  2EA4 A;  3DEE A;  3S17 J;  4G94 A;  1WGX A;  2YUS A;  1IRG A;  3BR5 A;  5FKK A;  3GTL J;  4G9Y A;  1OIS A;  1WVR A;  1FT9 A;  1X1A A;  1DU0 A;  2A61 A;  3DTK A;  5D5W B;  5LHH A;  3D5L A;  1O3T A;  2I5U A;  3UKG A;  2V1X A;  2XDV A;  4FET A;  1RIO H;  5CVR A;  4R8H A;  4MNU A;  4A3D J;  3ROU A;  4XON A;  4A6D A;  1LPQ A;  2R7Z J;  1MKM A;  4LIT A;  2E7X A;  3A0B C;  2DK5 A;  2NNY A;  1FMV A;  1J2X A;  1BI0 A;  2ZC2 A;  3WG9 A;  1S29 A;  5H20 A;  2D1V A;  4G8X A;  3J7Y J;  1NTC A;  3RI4 A;  5HNH A;  1UAA A;  3TP3 A;  3FM3 A;  3M8E A;  5DV5 A;  4L18 B;  2DTZ A;  4KA4 A;  3N97 A;  1RRJ A;  1B9N A;  1KZH A;  4KN4 X;  5D4S A;  2EZH A;  1U6G A;  2K40 A;  1IDY A;  4IKF A;  4OMZ A;  5ICG A;  1FX7 A;  4M73 A;  1ZLK A;  2FNP A;  2DMN A;  3M7G A;  2HOA A;  4BL0 B;  1XCB A;  4BHB A;  3J7Z I;  2JPB A;  2MD0 A;  4OIO F;  4UV8 A;  1AKH B;  3OYA A;  4LMY A;  1ACI A;  1TWH J;  3ZMV A;  3HTS B;  1QGP A;  2K3P A;  1XMA A;  2ELK A;  4ZYG A;  4CUG A;  3R6S A;  1VQP I;  1I1S A;  2GA2 A;  5C3E J;  2B9S A;  2XV4 S;  5HLH A;  3BG3 A;  5K5R A;  3AL0 C;  3NQO A;  3QOD A;  2ETH A;  4KDP A;  1HKT A;  2HQA A;  3E6M A;  5E1Z B;  2R7T A;  3V42 A;  1FBQ A;  4ZZD A;  1VND A;  3FXQ A;  3FK7 A;  4L0Z B;  5EGO A;  2GOX B;  1FOY A;  3BTC A;  3DEU A;  4N4N B;  1TQI A;  3HPH A;  3IKV A;  2V9P A;  5HLI A;  3WTZ A;  4FIS A;  4XM3 A;  2QSG X;  4S05 A;  3WU1 B;  1ZG3 A;  5CQG A;  1FZP B;  3OY9 A;  5JHF A;  4LG0 B;  3S32 A;  4XOP A;  3DP7 A;  4E70 A;  4XLA A;  1SAX A;  4IRG A;  3DBH B;  3FXJ A;  4MFE A;  5BOX A;  5K1Y A;  4UVC A;  1BW6 A;  5E8I A;  3M1C A;  1FSH A;  3E5Q A;  4X0G A;  4Y4R A;  3L2W A;  5FRO A;  1S7O A;  1SEU A;  2Q2E B;  1IV6 A;  2VUM J;  3BQZ A;  3LMM A;  5EG0 B;  3OYL A;  3Q0U A;  3BJ6 A;  3BZC A;  3CUQ B;  2DPU A;  3LL7 A;  1IGN A;  1M1E B;  2FOK A;  3HZJ A;  2LH9 A;  2M1B A;  2RQP A;  3F6V A;  5JVT A;  4IL6 C;  5HS9 A;  4YIR X;  2ESH A;  2JSP A;  3SFZ A;  3VYU B;  2F4O B;  3CD6 I;  4IEJ A;  1A35 A;  3ZMZ A;  3BR2 A;  4ENN A;  3OMY A;  1FOK A;  4DJA A;  1JHH A;  4EV0 A;  4KMF A;  4IHW A;  2LNB A;  1J5Y A;  4MEX F;  2CU7 A;  3S2W A;  3CCY A;  2KHM A;  1N75 A;  2NAZ A;  3HHG A;  1MIJ A;  4BU2 A;  4GGG A;  2DT7 B;  1FYM A;  2JK3 A;  2XAS A;  1FOW A;  1J59 A;  2AQF A;  3LOC A;  3A01 A;  4HF2 A;  2NXN B;  3L2V A;  1ZR2 A;  1ZAR A;  4NQW B;  2IGO A;  3HG9 A;  2RNG A;  3GTM J;  3LSR A;  1WZ2 A;  2CMP A;  1XGN A;  3DV8 A;  5IOZ A;  2QBY B;  2OCE A;  1MMD A;  5ICC A;  5J1R A;  3SZT A;  2XSJ C;  2HPI A;  3SYT A;  3HXL A;  1XGO A;  3TED A;  4KFC A;  4KN7 X;  2XKP A;  1CGP A;  4LGW A;  2W00 A;  1QQI A;  5IY5 H;  3FIW A;  4BQQ A;  1KA8 A;  3ELK A;  4PGG A;  4DIQ A;  1PUF A;  2MBF A;  2OQG A;  5TGT A;  2JA5 J;  4MIM A;  5ILU A;  1JT0 A;  2PBI A;  2EZL A;  3BG7 A;  1V5G A;  4L5I A;  1LFB A;  4ZC3 A;  4XLN F;  3FZV A;  2L7K A;  1QZE A;  1WJA A;  4XRF A;  2KRC A;  2HZT A;  4HQE A;  4JQF A;  4YRV A;  1FBU A;  3TL4 X;  1H0M A;  1ZGW A;  1WJC A;  1JT6 A;  1G3T A;  2R5Z B;  1VQM I;  2D2W A;  4ZDL A;  4OU0 A;  3ZPL A;  2WTE A;  3GFJ A;  1PP8 F;  2VQL A;  3C2G A;  2X51 A;  2BY1 A;  4GXO A;  3QRF F;  2VB6 A;  2VXZ A;  2Z33 A;  5EF6 A;  4BAC A;  2V26 A;  1POG A;  1RET A;  2L9N A;  1EH7 A;  1IUF A;  4P55 A;  3CCU I;  3BG6 A;  5GAH J;  5IT9 K;  1C0W A;  1Z6R A;  2Q1Z B;  2G0E A;  2O6G E;  1JE8 A;  3ZMT A;  2MH2 A;  3KZI C;  2R7Q A;  5ED4 A;  5BPI A;  4XID A;  2QLZ A;  3PO3 J;  2MAB A;  2DOD A;  2KP6 A;  1MBE A;  3GXO A;  3R4K A;  3JRE A;  1U5T A;  2TCT A;  3HSE A;  2Z5U A;  5FRM A;  4A0X A;  2XGC A;  3JRH A;  2COM A;  2ZJ2 A;  2BY0 A;  2E7W A;  1SFU A;  2XAH A;  1SMT A;  2RNJ A;  2P6T A;  4DQ2 A;  5KK1 A;  4I98 B;  3D1N I;  1MJA A;  4FE7 A;  5LGN A;  3MN2 A;  1OJL A;  1Z3X A;  1VF9 A;  5HDN A;  2JVG A;  1QZY A;  1V54 H;  3RZD J;  1SFE A;  2E19 A;  1IN4 A;  2LF8 A;  3HRU A;  2V7F A;  4TV7 A;  3FF5 A;  4IOA F;  3O8G A;  2RVC A;  3T8T A;  2PN6 A;  2MGQ A;  3BR6 A;  4DBQ A;  5K5O A;  1H88 C;  4ZDO A;  3S14 J;  1HXD A;  3IAM 2;  3HRT A;  5CKT A;  5B3S H;  3NWS A;  4F91 B;  1T8I A;  5IT9 Z;  3QYB A;  1MZB A;  4B3X A;  2M2E A;  1MMG A;  3J7A O;  1Y0U A;  4AD9 A;  2L7Z A;  2HGC A;  2VPR A;  4H4K C;  4YG2 F;  1HLV A;  3ERM A;  4BKX A;  2UWM A;  1GXP A;  2GXG A;  3C3W A;  5LHI A;  4HZF A;  2WY7 Q;  1LFU P;  3BQY A;  1MBK A;  2VT2 A;  1D0Z A;  2VN2 A;  1O57 A;  3F8B A;  2NNN A;  2IBD A;  1GLN A;  2PMH A;  2ZFW A;  3OWT A;  3MKW B;  2GOM A;  3F8C A;  2RC4 A;  5D8L B;  1BC8 C;  2NS7 A;  4LIV A;  4FHT A;  4Q5S F;  3IKT A;  4LB5 A;  3H3V K;  3E5U A;  2ID3 A;  4PFP A;  4BDZ A;  2EIL H;  1HKQ A;  2H6C A;  3WHB A;  4AVP A;  1MMS A;  2DQL A;  4HV6 A;  4UB8 C;  5J6X A;  3H9Q A;  3I53 A;  2WB1 A;  2CQN A;  4N9I A;  3LQR A;  3G6E I;  1A31 A;  2LK2 A;  3I55 I;  3ASN H;  1YS7 A;  1WH5 A;  1G8X A;  2IGM A;  3K2A A;  2OUM A;  2A6E F;  5LBQ A;  3G1M A;  1GDT A;  2DFI A;  2A5W A;  3Q0W A;  2XC7 A;  4A3E J;  3Q9S A;  1Y8Q B;  1ZTR A;  4M9Z A;  3VYT B;  4CGZ A;  2ECB A;  3VFZ A;  4XRS A;  1U9O A;  5DEQ A;  3EUH C;  1UHW A;  1YS6 A;  1UJ8 A;  1B1B A;  2VBW A;  3TGN A;  4HAM A;  3MKL A;  3AG3 H;  4LD5 A;  4WX9 A;  5LGT A;  2JA6 J;  3OYF A;  2QSF X;  3K4B A;  2DT6 A;  5J8C A;  2JWT A;  4RDU A;  1Z0X A;  5GAD J;  4FQG A;  4MTE A;  2EK5 A;  4XOR A;  5EEA A;  2VQH A;  1AKH A;  1Z7U A;  3HUG B;  1JKO C;  1SMY F;  2NOG A;  3C7J A;  4C2M J;  5J8F A;  4U88 A;  1E3P A;  2R7X A;  1E17 A;  3FDY A;  5ICE A;  4YII A;  1YHQ I;  4BYY A;  3IWF A;  3GUD A;  3JSP A;  2EFO A;  2OZU A;  4CYC B;  3JRG A;  1MBF A;  4CZZ A;  2CUJ A;  3AFH A;  2K4J A;  4M3E A;  4BJ5 C;  1OCR H;  2VBZ A;  3HIF A;  5JR3 A;  1X2N A;  2CQQ A;  1MSF C;  2DO7 A;  3CJR B;  4DGW B;  2EV0 A;  1S3J A;  3CCQ I;  4DNC A;  1PVE A;  4LG0 A;  4F7Z A;  3O8H A;  4XKV A;  1PJR A;  2MLG A;  3K4J A;  1NHA A;  1IRX A;  2V6C A;  1MSE C;  4AUX A;  4EM0 B;  4MHG A;  2A05 A;  2H1K A;  2EQR A;  3RDI A;  2JUC A;  1TW3 A;  3MVP A;  1K4T A;  2X85 A;  1IZ1 A;  3NEU A;  1R5G A;  4MLO A;  3GLL A;  5IT3 A;  1N77 A;  4XLH A;  1BJZ A;  5EG0 A;  3LSG A;  3CUQ A;  4A3M J;  3GVA A;  2LBF A;  5IYC J;  4ETS A;  4EJU A;  4KJZ A;  1OMI A;  2FML A;  4M3D A;  4ZTJ A;  4B43 A;  5L3B A;  5JVG F;  1R36 A;  1AU7 A;  2WAE A;  2OTJ I;  2LTP A;  5H2F C;  1X1B A;  1Z1D A;  2VT3 A;  1B6A A;  2KKO A;  2VXD A;  4JOM A;  3DBL B;  4A0Z A;  5HNF A;  3WTX C;  3G73 A;  3IH4 A;  2XUB A;  1T2K A;  1FOX A;  2KIS A;  3BTL A;  5DD8 A;  2ZCW A;  2R3S A;  4GFB A;  4A3C J;  3H3Z A;  4CSW A;  3F22 A;  3MD2 A;  3DQV C;  4IOC F;  2BHY A;  2A68 F;  1H9T A;  4JBA A;  2Y31 A;  2R7F A;  2RKH A;  5D8K B;  4RAZ A;  2L7M P;  5EGO B;  3HOS A;  2XAG A;  3GX4 X;  3BR1 A;  2CO5 A;  1ETX A;  5KAF C;  3TDZ C;  2G9W A;  4NQW A;  2CV2 A;  2ZB9 A;  4AID A;  5KVR A;  3PNT A;  1YW7 A;  1IRF A;  2W84 A;  4IVN A;  4CCM A;  2QSH X;  3AL0 B;  1HOM A;  4CCL A;  2ZME A;  3MZY A;  3AG2 H;  3QOE A;  2LY9 A;  3ZQF A;  4BUP A;  2D45 A;  3K2Z A;  3QYF A;  1J09 A;  4RBO A;  4PGH A;  1IG7 A;  1REP C;  3T8R A;  5C44 J;  2L9R A;  1X4P A;  2RGV A;  1VQO I;  4XBF A;  4C3I J;  1QNT A;  3HC7 A;  1XDU A;  3GTO J;  1W0T A;  1DGR M;  1UST A;  2FUG 2;  1YOV B;  2XAQ A;  2L54 A;  3CES A;  1XSV A;  4F3Q A;  3ULQ B;  3J80 K;  1RUN A;  2L2O A;  1RR7 A;  2OTL I;  3Q9V A;  2IXS A;  4C3J J;  3K4L A;  2JZY A;  2VC1 A;  5F64 A;  4E7K A;  4EJV A;  1AOY A;  1YFH A;  3KP7 A;  4AC0 A;  5DYM A;  3WHC A;  1YIT I;  2V1D A;  2WBM A;  3WGI A;  3KE2 A;  4IQ4 A;  1F43 A;  3ABM H;  3I9V 2;  5L3G A;  3S3M A;  4M72 A;  1O3S A;  1ZN2 A;  2GWR A;  4M6V A;  4BQN A;  4A3G J;  1Z05 A;  4HPQ A;  1SFO J;  4A5M A;  4D5C A;  1YIO A;  1ETK A;  1MNE A;  4M3F A;  2R5Z A;  3H35 A;  4IRH A;  1ZHF A;  3DPT A;  2JMW A;  2O61 A;  1MDM B;  2ZSI B;  3T1B A;  2X48 A;  3UNG C;  2K9S A;  2ACJ A;  5BMZ A;  2W48 A;  3HBL A;  2PQ8 A;  3OS1 A;  2R0Q C;  1BOB A;  1VQ8 I;  4OIN F;  2QKM B;  1OKR A;  1K78 B;  3H3U A;  2VPL A;  4I76 A;  4B8X A;  4X1E A;  2K4B A;  1OYW A;  1NG7 A;  3L1P A;  4DYC A;  4XLF A;  1Y8R B;  2MLK A;  3MMY B;  4Z2Y A;  3A2K A;  3S2H J;  2ZJP F;  2MG4 A;  5JI6 A;  1Z21 A;  2XHK A;  2AXT C;  5HLT A;  4WK8 F;  1V3F A;  3W3C A;  2L02 A;  3DCF A;  2BEO A;  1YW8 A;  2ELH A;  3J80 Z;  3RKQ A;  3E1S A;  4ON0 A;  1WWX A;  4AU7 A;  1F1Z A;  1E3O C;  2M87 A;  4G6T B;  1SD4 A;  3LSP A;  1K61 A;  4ZYA A;  1XD7 A;  3W6K B;  3RJP A;  2XF5 A;  5D6E A;  2LKS A;  1J7K A;  3F6O A;  2GXB A;  2V9K A;  3IP4 B;  1W0U A;  2XAJ A;  1ETV A;  2Y9Y A;  4WF2 A;  3V4G A;  1U0J A;  4B09 A;  1BC7 C;  4DZP A;  2F2E A;  1I5Z A;  2DCE A;  1LDD A;  3A4C A;  3K10 A;  2CS3 A;  3FXM A;  5L3D A;  3SFI A;  2RV8 A;  1ZQ3 P;  3M8F A;  2LOO A;  2VAS A;  2Y0S A;  4C2U A;  4V19 K;  4E4H A;  3RYR A;  5CVI A;  3IRR A;  3QOP A;  3D0S A;  4ENK A;  3KYC B;  2HYF A;  2ZXJ A;  1OCO H;  1D0Y A;  4RMN A;  1G59 A;  1EV7 A;  1WJD A;  1R1T A;  1S7A A;  2IA1 A;  2FRH A;  4HNU A;  2VIX A;  3MZ8 A;  1LEB A;  3MQ0 A;  4MGR A;  5FB2 A;  2R7S A;  3TMO A;  4S04 A;  2OQR A;  1BIB A;  1QHH D;  2JUG A;  3V7R A;  1VQN I;  1IN5 A;  4BDY A;  3DF8 A;  2DOE A;  4P1W A;  3LSJ A;  3IC7 A;  1CQT A;  1T6S A;  1T08 B;  3X2Q H;  1STZ A;  1MGT A;  2YSR A;  4C30 A;  4UY8 I;  5LGU A;  5E79 C;  3LSK A;  2V1N A;  3AG4 H;  4PJ0 C;  5AON A;  2R7R A;  1F4K A;  2VON A;  1ZR4 A;  1R7J A;  2JT1 A;  2OF7 A;  4UVB A;  2LP0 A;  5DUI A;  2O8X A;  3RIR A;  4XLP F;  4ZYD A;  1PDN C;  1E0E A;  3JRC A;  3IH2 A;  3CDI A;  2A3S A;  2W82 A;  2DK8 A;  1A36 A;  1LEA A;  2B7E A;  5FKO A;  1BBY A;  4A3K J;  3OSG A;  2KRF A;  3BLY A;  3PM1 A;  3CCJ I;  5GTI C;  4IF4 A;  1VQ6 I;  2G7U A;  1QVT A;  1N78 A;  4R1H A;  3HYI A;  4ZYH A;  3F3X A;  2KT0 A;  2DTR A;  2QEN A;  5FKM A;  3KPH A;  3EUA A;  1KON A;  3FBI B;  4KUM A;  5EEG A;  3F8N A;  3IWZ A;  4NB5 A;  1UZC A;  3BR0 A;  4RB0 A;  1P9Q C;  3VOD A;  3HUG A;  2TRT A;  5LD2 C;  1IN8 A;  1TLH B;  4A5N A;  1I6H J;  4CCJ A;  1FIA A;  1BR2 A;  4ABZ A;  1XB4 A;  2E5Z A;  1Z91 A;  4ZJZ A;  2ME0 A;  4CYC A;  2I10 A;  3G3Z A;  2XKO A;  1P92 A;  2VJ5 A;  4O5V A;  3ZQI A;  5M5X J;  3Q5F A;  1HKS A;  2GLO A;  3OYD A;  3L2R A;  3JRF A;  1JGG A;  2ZO4 A;  1KU2 A;  1S9H A;  1XGS A;  3PQK A;  5FJ8 J;  2E1O A;  1LE8 B;  4M71 A;  2ISZ A;  2COB A;  3H9J A;  1UEL B;  3CDL A;  1VQL I;  1YW9 A;  2QVO A;  5FKL A;  2HQ5 A;  1MMN A;  2M9H A;  2NVQ J;  1MH3 A;  5GTH C;  3KX2 A;  1WQ2 A;  1A04 A;  4YFX F;  1O4X A;  4A3B J;  2B0L A;  2DQR A;  3EDP A;  5HDG A;  3IV5 A;  3QYE A;  4KIG A;  5IP7 J;  4XSZ F;  1YX5 A;  3CDH A;  2VKE A;  3ZRG A;  1UHM A;  2F6C A;  5B1A H;  1GVJ A;  2JJ7 A;  2Z16 A;  3PUB A;  2WA0 A;  4L9J A;  1WSU A;  5FKN A;  4DYQ A;  1XSD A;  2HZD A;  2Y30 A;  1X58 A;  1D1A A;  3H0G J;  4O6J A;  1WHU A;  3L2U A;  3OV8 A;  5L3E A;  3HJE A;  3DTE A;  4OIP F;  3E7L A;  2CGP A;  1VFC A;  2HDD A;  1VQ7 I;  1RKT A;  2XGE A;  1B72 B;  2V1U A;  2CG4 A;  4JX5 A;  3GME A;  3GFI A;  3K1M A;  3JTH A;  5FLM J;  1IF1 A;  2F5V A;  3R0A A;  5F27 A;  2CJJ A;  1GV5 A;  1T38 A;  3W2V A;  2MC3 A;  2XRL A;  5IP9 J;  4EAT A;  2GM4 A;  5EZH A;  4LK0 F;  1LKX A;  2CW0 F;  4IPA A;  3PUF A;  3SXY A;  1JHF A;  1JUP A;  2H6B A;  5TJJ A;  2E2H J;  2GQQ A;  1P7J A;  3HTU A;  1ETO A;  4XLC A;  1MJ9 A;  4RB1 A;  2VKV A;  2WAQ A;  4DZJ A;  3M9A A;  4UUV A;  3DEW A;  4BE2 A;  2DA7 A;  2NVU B;  4AYB A;  1L0O C;  5E18 F;  4EJO A;  4CCN A;  3RKX A;  3PO2 J;  3SZP A;  2LVS A;  5HOD A;  4AM3 A;  2MD5 A;  2F4I A;  2E36 A;  3QPS A;  4IZZ A;  5DD4 A;  4ZH4 F;  3PSF A;  4ZTF A;  1D1C A;  1IC8 A;  2F5D A;  2LBF B;  1I39 A;  1Z9C A;  4B48 A;  4LG3 A;  1A6I A;  3DXJ F;  5JFR A;  4FAS D;  2CFO A;  3HM5 A;  1KGS A;  5F0C A;  4Y52 J;  2WB1 N;  2NYX A;  3LFK A;  4RLF A;  3HDD A;  1XCV A;  4W1U A;  4FT8 A;  2JA7 J;  3V8L A;  2A5Y B;  2RQQ A;  3CC4 I;  1RUO A;  3B73 A;  3T5X A;  4D0P A;  3KYL A;  2X1E A;  3I4P A;  2CQX A;  1DQU A;  4UV9 A;  1MD0 A;  2K86 A;  3SHF A;  4B3A A;  3FK6 A;  4PSW A;  2Z1D A;  3GLX A;  5JLW A;  3HOW J;  1MDM A;  2WAD A;  3K70 D;  3BY6 A;  3FWE A;  1K6Y A;  1GXQ A;  1GUU A;  2Y9Z A;  4FX4 A;  1JKQ C;  3CUO A;  3IL2 A;  4BY1 J;  2ZME B;  2K9L A;  3KFW X;  3ZMD A;  1K78 A;  1ZG1 A;  6PAX A;  4LFU A;  2XF7 A;  3CTA A;  3CCE I;  3I4N J;  1BIA A;  2EBI A;  5D5X B;  1NH3 A;  1MBJ A;  3I54 A;  4CO8 A;  2E1M C;  3PNV A;  2H94 A;  4QWQ A;  2FQ4 A;  2LKP A;  1Q1H A;  3SZG A;  1F9N A;  4BXX J;  4NUB A;  2DA3 A;  4E7H A;  4XKC A;  2IRF G;  4A3L J;  1UFM A;  2HFH A;  4RGS A;  3RPQ A;  3ZXS A;  1W36 C;  1DUX C;  2JRM A;  3CJQ B;  1I3Q J;  2Y0M A;  3V8K A;  4F92 B;  2Z3Y A;  1X4O A;  2EPF A;  1X3U A;  3BRO A;  5E8G A;  3QU3 A;  3CLO A;  5D5V B;  5IYB J;  4DOZ A;  3COA C;  1F36 A;  1U3E M;  1FYK A;  3BZK A;  2M7A A;  1Z67 A;  4YFN F;  2Y2Z A;  4II3 A;  2M5W A;  3P7N A;  4U0Y A;  4WXD A;  1D3Y A;  2EFW A;  4JYK A;  1KU3 A;  1BR4 A;  4RA2 A;  2TDX A;  2F5F A;  3ML6 A;  2E71 A;  2CUF A;  4KIF A;  3K70 C;  1D8K A;  2EZI A;  3S15 J;  2W1O A;  4HX4 A;  3JSO A;  4D7N A;  3QP6 A;  1WRJ A;  4BAY A;  1QU3 A;  1GHC A;  4L5J A;  1IAW A;  1SD6 A;  3RPU D;  2OPT A;  1R58 A;  4EM1 A;  1G2H A;  2EH3 A;  1KU7 A;  1O7F A;  2ZFU A;  4M74 A;  2OC6 A;  3CF5 F;  3S3N A;  4KIS A;  3I71 A;  2VKD A;  1IUY A;  4KT5 C;  3C2B A;  3PFI A;  5F04 A;  3RKW A;  3LST A;  1G6N A;  2KLO A;  5EYR A;  1X1C A;  1W1W E;  3O3K A;  4EJW A;  5E1W A;  3ZGK A;  4OAY A;  5EDN A;  2GA1 A;  4MFD A;  4D7M A;  5F0H A;  2HYJ A;  3ZCO A;  2P5V A;  2QCO A;  3JRD A;  3A1Y A;  1X3W B;  2DA4 A;  1OQY A;  3DKW A;  3WU2 C;  2IT0 A;  2EA2 A;  3HSR A;  2GIZ A;  4WXC A;  3L2Q A;  2K9N A;  2QA4 I;  2JRT A;  2VJ4 A;  1IO2 A;  5L3F A;  3G4S I;  2O5R A;  1P2F A;  2BW3 B;  2W25 A;  2ISY A;  2QWW A;  3MKY B;  1YG2 A;  2IGK A;  3D5R C;  2W85 A;  4O3M A;  2DLL A;  3FHZ A;  2L4M A;  2A07 F;  4ANJ A;  1YIJ I;  2KQR A;  1KYW A;  4QLC U;  3S1Q J;  1X2M A;  3SQN A;  1R49 A;  1ZRD A;  2OAZ A;  1D0X A;  4A3I J;  1E2X A;  4EVI A;  4ZZL A;  1QA6 A;  1RPW A;  2QUF A;  3C18 A;  4PSX A;  2HU9 A;  2L01 A;  1R6R A;  1D1B A;  2IS6 A;  5TIS C;  3ABU A;  3OYE A;  4ASN A;  4M6Y A;  1LDK B;  4PCQ A;  3OYM A;  4KIC A;  3DFG A;  3H9G A;  2HDC A;  5BNG A;  3ZN1 A;  5HVQ C;  3CC2 I;  5E3L A;  2E2J J;  1W5S A;  4KNY A;  3U1K A;  2IW5 A;  1Z7L A;  1V4R A;  5B1B H;  3RPU A;  3TW6 A;  1W5T A;  3H5N A;  2BV6 A;  3KP6 A;  1SVM A;  1ETY A;  2X1C A;  3S8P A;  1QO0 D;  4AIH A;  5DUK A;  5KAI C;  1SAU A;  1JXS A;  1B4A A;  2EIJ H;  1RKW A;  2KMU A;  3L9F A;  2QKL B;  4HST A;  2OV7 A;  4MO7 A;  4N9H A;  3IAS 2;  2VE9 A;  2A6T A;  2DMT A;  1F5T A;  2J5O A;  4IHV A;  1LE8 A;  1OPC A;  1ONV A;  1HBX G;  1D5V A;  5FD6 A;  1S8N A;  2QGU A;  4M9S A;  5FO5 A;  3TBI A;  1HA8 A;  2PJP A;  1YTY A;  1R9T J;  1P4A A;  3AKZ A;  1YRN B;  2FJ1 A;  3HOU J;  3SDG A;  2PI0 A;  2DFF A;  3HB9 A;  4PUS A;  3MEX A;  4Y15 A;  2DDA A;  4V2G A;  4UUS B;  3VYR B;  2FF4 A;  1FWZ A;  3A03 A;  2F5E A;  2DFE A;  2YU9 J;  2LD5 A;  4BHP A;  1OYY A;  2ESN A;  4I02 A;  4BHC A;  4LLG F;  5DCF A;  2FOW A;  2M45 A;  2ZNZ A;  4E7S A;  5GAG J;  2Z9O A;  3H0D A;  3QPL A;  5IYD J;  1VTN C;  2LRE A;  2MC4 A;  3J81 K;  1Y56 A;  3F0C A;  1B72 A;  2PJR A;  3RYP A;  3RSN A;  5IP6 A;  4MEY F;  5LLQ A;  2H27 A;  2LY1 A;  3NWT A;  4KIT B;  4LK1 F;  4HG2 A;  1HW5 A;  3NAU A;  2PMZ A;  4N4O B;  1ZEL A;  2QZ8 A;  1R5H A;  3RCO A;  1AHD P;  5CLS A;  2Y0S N;  1H9G A;  2CQK A;  4B47 A;  1D5Y A;  5LFA A;  3JRB A;  3DTI A;  3KIO A;  3K4K A;  3ISP A;  3KET A;  2YX4 A;  2IS2 A;  2AO9 A;  2FBI A;  3BDD A;  3M3Y J;  4JK1 X;  1EJ9 A;  1S7E A;  4RB2 C;  1TW2 A;  4J19 A;  4BJT A;  3GYH X;  5M5W J;  4UXN A;  1J75 A;  3V8J A;  1APL C;  1JTX A;  4X6A J;  1RC9 A;  3KP5 A;  4E7J A;  1HCR A;  2RN7 A;  5J40 A;  1HST A;  4F52 A;  3LA2 A;  1FEX A;  4L5E A;  5GPC A;  5E17 F;  3I3L A;  4ENM A;  2CV1 A;  2YPR A;  2IP2 A;  2DW4 A;  1FSE A;  2X6X A;  5AIQ A;  1D8J A;  5JLX A;  2IS4 A;  1EH8 A;  4HYE A;  5FFX A;  3F9K A;  2KDO A;  2WV1 A;  3J81 Z;  1KQ9 A;  1W7P D;  1VQ9 I;  4KYW A;  1VZ0 A;  3IRQ A;  2CFX A;  4BXU A;  4I6Z A;  2XF6 A;  4F93 B;  3R60 A;  2NS8 A;  2P6S A;  4CDG A;  3HGG A;  5E3M A;  3A02 A;  4HA8 A;  4WWC A;  3ABK H;  1YJN I;  2DAO A;  3VSL A;  3QPT A;  2DYS H;  4P9U A;  2KL4 A;  3FKJ A;  1WI9 A;  3FXO A;  3FBN B;  4P96 A;  4EEF G;  5CPR B;  2CQ7 A;  1IN7 A;  1IW7 F;  3GF2 A;  4CIC A;  3MFK A;  2F48 A;  3WTW C;  1H89 C;  4IX7 A;  1P4W A;  4IO9 F;  3V7C A;  3L7W A;  2EIN H;  2RRE A;  3WTU C;  1FLI A;  4KMU X;  3S1M J;  2D1H A;  2YR2 A;  2ZJQ F;  2OBP A;  1R4N B;  3WE3 A;  1YYV A;  4XSX F;  4YIF A;  3D5S C;  1ZAO A;  4HNT A;  2L4A A;  2MSY A;  3IHU A;  1JJ6 C;  1ZRF A; 
#chains in the Genus database with same CATH homology
 1FBS A;  4WXH A;  2FE3 A;  2OA4 A;  2QM3 A;  4P5O A;  3FX3 A;  3EQL F;  1ZYR F;  1O3R A;  3L00 A;  2QQA A;  4Q4Z F;  1LDJ A;  5BQT A;  3T0Y A;  1DP7 P;  3PQJ A;  2EFP A;  2VE8 A;  2O03 A;  2XVC A;  4L9T A;  2Y75 A;  4HOB A;  4I7H A;  4U7D A;  2M8E A;  2DBB A;  3KZZ A;  5FD5 A;  1DPR A;  3F8M A;  2HOE A;  2HTS A;  3KZY A;  2HWV A;  2AS5 F;  3CO7 C;  4U7B A;  1MJB A;  2C6Y A;  4I0B A;  1KQ0 A;  5CVV A;  3TKY A;  1G3W A;  3HRS A;  2XIG A;  2P5K A;  1BOA A;  4UHT A;  1BI2 A;  3F72 A;  3KCC A;  2IJL A;  3ZN0 A;  3F21 A;  2WWY A;  3O2P E;  3WTT C;  3E6D A;  2PG4 A;  2PLY A;  1TNS A;  1G3Y A;  3O6B B;  5ILS A;  2PMU A;  2EV6 A;  4M6X A;  3ECO A;  4ESB A;  2WC2 A;  3HOT A;  4HF0 A;  4AWX B;  2CSO A;  4ENJ A;  2A6H F;  3FXU A;  4R79 A;  2G7H A;  3GZ6 A;  2V9V A;  5E20 A;  2IPQ X;  1KQ8 A;  4Q47 A;  2HR3 A;  2K27 A;  4IHT A;  2HQR A;  2UXN A;  2LDU A;  2STT A;  3EET A;  4ZYE A;  3TO6 A;  3WTV C;  3M1E A;  1XN7 A;  5A2Q K;  4H0E A;  3JAM K;  3WE2 A;  5LHG A;  2FU4 A;  3U9G A;  3REO A;  3LAJ A;  4L0Y B;  2O3F A;  4EMS A;  4LLL A;  4K2E A;  4GYG A;  5FFZ A;  3E3V A;  5HLG A;  1DPU A;  4GO1 A;  1USS A;  2LSO A;  3GZ5 A;  5LRR A;  4OMY A;  1LB2 A;  3I58 A;  4MQ9 F;  2JPC A;  1FC3 A;  1U78 A;  4M9X A;  1DDN A;  2HYG D;  2R7D A;  4GCV A;  5A2Q Z;  3TDU C;  2EJR A;  1TQM A;  4BQA A;  3JAM Z;  3AAF A;  3BJO A;  5D6F A;  1O3Q A;  1FNN A;  4U0V A;  2QQ9 A;  3KP2 A;  3H92 A;  2QQB A;  3U2R A;  2W24 A;  3BZ6 A;  3KLN A;  3FMS A;  4CXF A;  3K9T A;  3KP4 A;  3TOA A;  4A6E A;  4GYI A;  1W4M A;  2BE5 F;  5DCM B;  4HF1 A;  2FEZ A;  1G3S A;  1LQ1 A;  2M30 A;  1LVA A;  3QPH A;  5LEK A;  2DPD A;  1ODD A;  4YFK F;  5L3C A;  4KIB A;  2E1C A;  4WCG A;  4MQV A;  1KYZ A;  4RS8 A;  1ZGJ A;  2W57 A;  2K7L A;  3LA3 A;  4LJZ F;  3F8F A;  3L2C A;  1JGS A;  4MTD A;  3ZQ7 A;  3TO7 A;  3RTR A;  3NRV A;  1FP2 A;  2AXL A;  2ZNY A;  4LLN A;  4EJT A;  3MAJ A;  3JW4 A;  1XGM A;  3MZH A;  1ON1 A;  4UVA A;  1YQA A;  2P8T A;  3I64 A;  1U8R A;  3WU0 A;  1TTY A;  4FX0 A;  4EQQ A;  4BH9 A;  2FNA A;  3WGH A;  2FBH A;  3K1P A;  2KJB A;  1HW1 A;  2BGC A;  3JTG A;  3N4M A;  1QPM A;  3WOD F;  2KIF A;  4I2O A;  5BS6 A;  2VOD A;  5FGM A;  2J5P A;  3LA7 A;  2EWN A;  4AIJ A;  1K7A A;  4HQM A;  1ZGA A;  1J0R A;  1FY7 A;  5CVJ A;  4HDV A;  3E6B A;  2ZBK A;  3K0L A;  3VB2 A;  5D4R A;  2CYY A;  1K79 A;  2O0Y A;  1XMK A;  3OOP A;  2X0L A;  4EGZ A;  1AWC A;  1Z6T A;  3BP8 A;  2DI3 A;  1W7P B;  1BJA A;  2HEO A;  2QYO A;  1R22 A;  4L9V A;  2YU3 A;  4Y13 A;  2FQ3 A;  1I27 A;  2MH9 A;  5E1X A;  4RB3 C;  4IXA A;  4ESJ A;  2VOP A;  1BM9 A;  1BN5 A;  2MA3 A;  1QZZ A;  1ZG5 A;  1QBJ A;  1P6R A;  2KIM A;  1U5T C;  4AIK A;  5LRS A;  3ERE D;  3KLO A;  5JHU A;  5AIP A;  2KJC A;  3GWZ A;  4UNO A;  4RGU A;  4HX8 A;  3HRM A;  2A69 F;  1UCR A;  3MWM A;  1FPQ A;  3C1D A;  5CJ9 A;  1RZ4 A;  2OU2 A;  4OOI A;  5LEJ A;  4HLX A;  1LJ9 A;  2ZKZ A;  5HS7 A;  4EGY A;  2IVM A;  2P7V B;  1S6L A;  3GEZ A;  3I59 A;  1K6O A;  4OIQ F;  4CYD A;  3U1D A;  1CF7 B;  4RGX A;  3ZMU A;  1RI7 A;  5ILV A;  1LNW A;  4P9F A;  2HQN A;  2GIV A;  1R1V A;  3VOE A;  2HKX A;  5F6F A;  5H6Q A;  3BJA A;  2GAU A;  3V7S A;  1TQP A;  4G7O F;  2BBY A;  2JSC A;  1T98 A;  3TQN A;  3K69 A;  1OYI A;  1ZH5 A;  5ICF A;  1T39 A;  4Y17 A;  2XRN A;  4HX7 A;  2FBK A;  1IXC A;  1ZRC A;  4I09 A;  1TNT A;  2EB7 A;  4A12 A;  2LF7 A;  2P7C B;  1KU9 A;  5DDG A;  3FMQ A;  3I0T A;  1YLF A;  3W6J B;  4OIR F;  1EH6 A;  1TBX A;  1YO5 C;  3R0J A;  3KP3 A;  3EUH A;  4HV5 A;  1O7L A;  3QAH A;  5F1R A;  3WGG A;  5DCM A;  2X4H A;  1HSJ A;  3P9K A;  3FXR A;  1ZLJ A;  2VBY A;  1R00 A;  2V79 A;  5BPD A;  2KIU A;  2L3D A;  3P9I A;  4PDK A;  1L3L A;  3GO5 A;  1IN6 A;  5EEH A;  2P4W A;  4PZJ A;  3EYY A;  3E6C C;  2UXX A;  3CUQ C;  1SFX A;  5CYV A;  3EYI A;  2P5L C;  4A0Y A;  3QU6 A;  3L09 A;  1RNL A;  2Q2E A;  2FSW A;  1I1G A;  4N0B A;  2Q8K A;  3ZP5 A;  3CO6 C;  1IXS B;  4RGR A;  4L9N A;  2UZK A;  5K5Q A;  2FXA A;  4NHJ A;  2GZW A;  3E5X A;  3HSF A;  1XSX A;  2RDP A;  2VBX A;  2EV5 A;  3CJN A;  5ERI A;  3LQQ A;  2XAF A;  3E97 A;  1PP7 U;  2VOO A;  3FM5 A;  4G6Q A;  3GW2 A;  1SD7 A;  4RAY A;  2HTJ A;  3VEP A;  4I01 A;  5HS8 A;  2FA5 A;  2HS5 A;  2VC0 A;  2XGX A;  2QBY A;  4LB6 B;  2PFB A;  1FYL A;  3R61 A;  3WTY C;  4IHS A;  1B9M A;  2IA0 A;  3RKY A;  3B02 A;  5CVU A;  3TOB A;  1W7P A;  2E1N A;  2Q0O A;  2BYV E;  2EFQ A;  1P4X A;  4CHU A;  1ZRE A;  3P9C A;  2YX7 A;  2NS0 A;  3BOQ A;  4G7H F;  1HQC A;  3DPL C;  4ESF A;  3LWF A;  1R1U A;  3GFM A;  3MCZ A;  2OD5 A;  4IRI A;  1BI3 A;  1UB9 A;  2NRA C;  4I0A A;  5FLX K;  3KEO A;  4A2U A;  3ZMS A;  2OZ6 A;  5H6R A;  2DT5 A;  1I6X A;  4HBL A;  1R23 A;  4HW0 A;  3FMR A;  4HLY A;  3F23 A;  2CWE A;  2STW A;  1B59 A;  2Z99 A;  3GFL A;  2K02 A;  2DU9 A;  1G4D A;  3ABT A;  1ULY A;  1WKM A;  3KEQ A;  1T0F A;  3ECH A;  2EFN A;  2JTV A;  1CF7 A;  3QP5 A;  1PUE E;  4U0W A;  3BPV A;  3WTS C;  3I5U A;  1SD5 A;  4G7Z F;  2H09 A;  2Y48 A;  5HOO A;  3BWG A;  1XDS A;  4Q48 A;  5FLX Z;  1U2W A;  2ADU A;  1U5T B;  2IA2 A;  4BNC A;  1BI1 A;  4G6D A;  3LAP A;  5D5U B;  4IJA A;  3K1N A;  1ON2 A;  3TO9 A;  4HDU A;  1FP1 D;  5TRD A;  2FMY A;  5HDK A;  2HKO A;  2PEX A;  3I59 B;  1HW2 A;  1IXR C;  2WV0 A;  2F5C A;  1OR7 A;  2XRO A;  4EM2 A;  3HHH A;  1J9I A;  3BPX A;  2EA4 A;  4G94 A;  1IRG A;  4G9Y A;  1FT9 A;  2A61 A;  5D5W B;  5LHH A;  3D5L A;  1O3T A;  2V1X A;  1RIO H;  5CVR A;  4R8H A;  4MNU A;  3ROU A;  4A6D A;  1MKM A;  2E7X A;  2DK5 A;  2NNY A;  1J2X A;  1BI0 A;  3WG9 A;  1S29 A;  5H20 A;  2D1V A;  4G8X A;  3RI4 A;  3FM3 A;  3M8E A;  5DV5 A;  4L18 B;  4KA4 A;  3N97 A;  1B9N A;  4KN4 X;  5D4S A;  1U6G A;  4OMZ A;  5ICG A;  1FX7 A;  4M73 A;  1ZLK A;  2FNP A;  3M7G A;  1XCB A;  4BHB A;  2JPB A;  4OIO F;  4UV8 A;  4LMY A;  3ZMV A;  3HTS B;  1QGP A;  1XMA A;  4ZYG A;  3R6S A;  1I1S A;  2GA2 A;  2XV4 S;  5HLH A;  5K5R A;  3NQO A;  2ETH A;  4KDP A;  1HKT A;  3E6M A;  5E1Z B;  4ZZD A;  1FBQ A;  3FXQ A;  4L0Z B;  3DEU A;  1TQI A;  3IKV A;  5HLI A;  3WTZ A;  4S05 A;  3WU1 B;  1ZG3 A;  1FZP B;  4LG0 B;  3DP7 A;  4E70 A;  1SAX A;  4IRG A;  5BOX A;  5K1Y A;  4UVC A;  5E8I A;  1FSH A;  3E5Q A;  1S7O A;  2DPU A;  3BJ6 A;  3CUQ B;  2FOK A;  2RQP A;  2M1B A;  5JVT A;  3F6V A;  5HS9 A;  2ESH A;  3SFZ A;  3ZMZ A;  4ENN A;  1FOK A;  1JHH A;  4EV0 A;  4KMF A;  2LNB A;  1J5Y A;  4MEX F;  3S2W A;  3HHG A;  2NAZ A;  4GGG A;  1FYM A;  2XAS A;  1J59 A;  4HF2 A;  1ZAR A;  1XGN A;  3DV8 A;  2QBY B;  5ICC A;  3SZT A;  1XGO A;  4KFC A;  4KN7 X;  2XKP A;  1CGP A;  4LGW A;  1QQI A;  1KA8 A;  3ELK A;  4PGG A;  2MBF A;  2OQG A;  5ILU A;  2PBI A;  4L5I A;  4XLN F;  3FZV A;  4XRF A;  2HZT A;  4HQE A;  4JQF A;  1FBU A;  1H0M A;  1G3T A;  2D2W A;  4OU0 A;  3ZPL A;  2WTE A;  3GFJ A;  1PP8 F;  4GXO A;  3QRF F;  2VXZ A;  2Z33 A;  1EH7 A;  4P55 A;  5IT9 K;  1C0W A;  1Z6R A;  2O6G E;  1JE8 A;  3ZMT A;  2MH2 A;  5ED4 A;  5BPI A;  2QLZ A;  3GXO A;  3R4K A;  1U5T A;  3HSE A;  2Z5U A;  4A0X A;  2COM A;  2ZJ2 A;  2E7W A;  1SFU A;  2XAH A;  1SMT A;  2RNJ A;  2P6T A;  4DQ2 A;  5KK1 A;  4I98 B;  1MJA A;  5LGN A;  5HDN A;  1QZY A;  1SFE A;  1IN4 A;  2LF8 A;  3HRU A;  4TV7 A;  3FF5 A;  2RVC A;  3T8T A;  2PN6 A;  5K5O A;  1HXD A;  3HRT A;  5IT9 Z;  1MZB A;  3J7A O;  1Y0U A;  4AD9 A;  2HGC A;  4YG2 F;  2UWM A;  1GXP A;  2GXG A;  3C3W A;  5LHI A;  4HZF A;  2VT2 A;  2VN2 A;  1O57 A;  3F8B A;  2NNN A;  2PMH A;  2ZFW A;  5D8L B;  3F8C A;  2RC4 A;  1BC8 C;  4Q5S F;  4FHT A;  3IKT A;  4LB5 A;  3E5U A;  1HKQ A;  2H6C A;  4AVP A;  2DQL A;  4HV6 A;  5J6X A;  3I53 A;  4N9I A;  3LQR A;  1YS7 A;  2A6E F;  5LBQ A;  2DFI A;  3Q9S A;  4M9Z A;  4CGZ A;  3VFZ A;  5DEQ A;  1UHW A;  1YS6 A;  2VBW A;  1B1B A;  3TGN A;  4HAM A;  4LD5 A;  4WX9 A;  5LGT A;  5J8C A;  4MTE A;  2EK5 A;  1Z7U A;  1SMY F;  3C7J A;  5J8F A;  4U88 A;  1E17 A;  5ICE A;  4YII A;  4BYY A;  3IWF A;  3GUD A;  3JSP A;  2EFO A;  2OZU A;  4CZZ A;  2K4J A;  2VBZ A;  3HIF A;  5JR3 A;  2DO7 A;  2EV0 A;  1S3J A;  4DNC A;  4LG0 A;  4F7Z A;  2MLG A;  1NHA A;  2V6C A;  4EM0 B;  4MHG A;  3RDI A;  1TW3 A;  1IZ1 A;  3NEU A;  1R5G A;  5IT3 A;  3CUQ A;  3GVA A;  4ETS A;  4EJU A;  1OMI A;  2FML A;  5L3B A;  1R36 A;  1Z1D A;  2VT3 A;  1B6A A;  2KKO A;  3WTX C;  1T2K A;  4A0Z A;  3G73 A;  2XUB A;  5DD8 A;  2ZCW A;  2R3S A;  3H3Z A;  3F22 A;  3DQV C;  2A68 F;  1H9T A;  4JBA A;  2R7F A;  2RKH A;  5D8K B;  4RAZ A;  3HOS A;  2XAG A;  3GX4 X;  2CO5 A;  3TDZ C;  2G9W A;  4NQW A;  5KVR A;  1YW7 A;  1IRF A;  2W84 A;  4IVN A;  2ZME A;  3MZY A;  2D45 A;  3K2Z A;  4PGH A;  1REP C;  3T8R A;  2RGV A;  4XBF A;  1QNT A;  1XDU A;  1UST A;  2XAQ A;  2L54 A;  1XSV A;  3ULQ B;  3J80 K;  1RUN A;  3Q9V A;  2JZY A;  2VC1 A;  5F64 A;  4EJV A;  1AOY A;  1YFH A;  3KP7 A;  5DYM A;  2V1D A;  3WGI A;  3KE2 A;  5L3G A;  4M72 A;  1O3S A;  1ZN2 A;  2GWR A;  1Z05 A;  4A5M A;  1YIO A;  4IRH A;  1ZHF A;  3DPT A;  2O61 A;  1MDM B;  3T1B A;  2ACJ A;  5BMZ A;  2PQ8 A;  4OIN F;  1OKR A;  1K78 B;  3H3U A;  4B8X A;  2K4B A;  1OYW A;  4Z2Y A;  2MLK A;  5JI6 A;  2XHK A;  4WK8 F;  1V3F A;  2L02 A;  2BEO A;  1YW8 A;  2ELH A;  3J80 Z;  4ON0 A;  1WWX A;  1F1Z A;  2M87 A;  1SD4 A;  1XD7 A;  3W6K B;  3RJP A;  5D6E A;  1J7K A;  3F6O A;  2GXB A;  2XAJ A;  4WF2 A;  3V4G A;  4B09 A;  1BC7 C;  2F2E A;  1I5Z A;  1LDD A;  5L3D A;  2RV8 A;  3M8F A;  3RYR A;  5CVI A;  3IRR A;  3QOP A;  3D0S A;  4ENK A;  2HYF A;  2ZXJ A;  1EV7 A;  1R1T A;  1S7A A;  2IA1 A;  2FRH A;  1LEB A;  3MQ0 A;  4MGR A;  5FB2 A;  4S04 A;  2OQR A;  1BIB A;  3V7R A;  1IN5 A;  3DF8 A;  3IC7 A;  1T6S A;  1STZ A;  1MGT A;  2YSR A;  5LGU A;  2VON A;  1F4K A;  5AON A;  1R7J A;  2JT1 A;  4UVB A;  5DUI A;  2O8X A;  3RIR A;  4XLP F;  4ZYD A;  1PDN C;  2A3S A;  2DK8 A;  1LEA A;  1BBY A;  2KRF A;  4IF4 A;  2G7U A;  4R1H A;  3HYI A;  4ZYH A;  3F3X A;  2DTR A;  2QEN A;  4KUM A;  5EEG A;  3F8N A;  3IWZ A;  4NB5 A;  4RB0 A;  3VOD A;  3HUG A;  1IN8 A;  1TLH B;  4A5N A;  1XB4 A;  1Z91 A;  3G3Z A;  2XKO A;  1P92 A;  4O5V A;  3Q5F A;  1HKS A;  2ZO4 A;  1KU2 A;  1XGS A;  3PQK A;  4M71 A;  2ISZ A;  1YW9 A;  2QVO A;  4YFX F;  1WQ2 A;  1A04 A;  2B0L A;  2DQR A;  3EDP A;  5HDG A;  4KIG A;  4XSZ F;  3CDH A;  1UHM A;  1GVJ A;  4L9J A;  1WSU A;  1XSD A;  4O6J A;  3OV8 A;  5L3E A;  4OIP F;  2CGP A;  2V1U A;  2CG4 A;  3GFI A;  3K1M A;  3JTH A;  1IF1 A;  3R0A A;  1T38 A;  2MC3 A;  4LK0 F;  2CW0 F;  4IPA A;  3SXY A;  1JHF A;  2H6B A;  5TJJ A;  2GQQ A;  3HTU A;  1MJ9 A;  4RB1 A;  3M9A A;  4UUV A;  1L0O C;  5E18 F;  4EJO A;  3RKX A;  3SZP A;  2MD5 A;  5DD4 A;  4ZH4 F;  2F5D A;  1Z9C A;  3DXJ F;  5JFR A;  1KGS A;  2NYX A;  3LFK A;  1XCV A;  4FT8 A;  3V8L A;  2A5Y B;  1RUO A;  3B73 A;  3T5X A;  4D0P A;  3I4P A;  4UV9 A;  1MD0 A;  2K86 A;  3SHF A;  3GLX A;  1MDM A;  3BY6 A;  3FWE A;  1GXQ A;  4FX4 A;  3CUO A;  3IL2 A;  2ZME B;  3KFW X;  3ZMD A;  1K78 A;  1ZG1 A;  6PAX A;  4LFU A;  3CTA A;  1BIA A;  5D5X B;  3I54 A;  4CO8 A;  2H94 A;  4QWQ A;  2LKP A;  1Q1H A;  1F9N A;  2IRF G;  1UFM A;  2HFH A;  4RGS A;  3RPQ A;  1DUX C;  2Y0M A;  3V8K A;  2Z3Y A;  1X3U A;  3BRO A;  5E8G A;  3QU3 A;  3CLO A;  5D5V B;  3COA C;  1U3E M;  1FYK A;  4YFN F;  2M5W A;  3P7N A;  4U0Y A;  4WXD A;  1D3Y A;  2EFW A;  1KU3 A;  2TDX A;  2F5F A;  3ML6 A;  4KIF A;  1D8K A;  4HX4 A;  3JSO A;  3QP6 A;  1WRJ A;  4BAY A;  1GHC A;  4L5J A;  1IAW A;  1SD6 A;  1R58 A;  4EM1 A;  1KU7 A;  1O7F A;  4M74 A;  3I71 A;  1IUY A;  4KT5 C;  3PFI A;  3RKW A;  3LST A;  1G6N A;  3O3K A;  4EJW A;  5E1W A;  2GA1 A;  2P5V A;  3DKW A;  2IT0 A;  2EA2 A;  3HSR A;  4WXC A;  2JRT A;  5L3F A;  1P2F A;  2W25 A;  2ISY A;  2QWW A;  1YG2 A;  2W85 A;  4O3M A;  2DLL A;  3FHZ A;  2L4M A;  2A07 F;  1KYW A;  4QLC U;  3SQN A;  1ZRD A;  2OAZ A;  1E2X A;  4EVI A;  4ZZL A;  2QUF A;  3C18 A;  2L01 A;  3ABU A;  4ASN A;  4M6Y A;  1LDK B;  4PCQ A;  4KIC A;  3DFG A;  2HDC A;  5HVQ C;  3ZN1 A;  1W5S A;  4KNY A;  2IW5 A;  1V4R A;  3RPU A;  1W5T A;  2BV6 A;  3KP6 A;  4AIH A;  1QO0 D;  5DUK A;  1JXS A;  1B4A A;  3L9F A;  4N9H A;  2VE9 A;  1F5T A;  2J5O A;  1OPC A;  1ONV A;  1HBX G;  1D5V A;  5FD6 A;  1S8N A;  4M9S A;  5FO5 A;  2PJP A;  1YTY A;  1P4A A;  2PI0 A;  3MEX A;  4Y15 A;  2FF4 A;  1FWZ A;  2F5E A;  4BHP A;  1OYY A;  2ESN A;  4I02 A;  4BHC A;  4LLG F;  5DCF A;  2M45 A;  2ZNZ A;  2Z9O A;  1VTN C;  3J81 K;  3RYP A;  4MEY F;  5LLQ A;  2H27 A;  4LK1 F;  1HW5 A;  2QZ8 A;  1R5H A;  5CLS A;  1H9G A;  2CQK A;  3ISP A;  3KET A;  2YX4 A;  2FBI A;  3BDD A;  4JK1 X;  4RB2 C;  1TW2 A;  3GYH X;  4UXN A;  1J75 A;  3V8J A;  3KP5 A;  2RN7 A;  1HST A;  3LA2 A;  5E17 F;  4ENM A;  2YPR A;  2IP2 A;  2DW4 A;  1FSE A;  5AIQ A;  1D8J A;  1EH8 A;  4HYE A;  5FFX A;  3J81 Z;  1KQ9 A;  1W7P D;  4KYW A;  3IRQ A;  2CFX A;  4BXU A;  3R60 A;  2P6S A;  4CDG A;  4WWC A;  4HA8 A;  2DAO A;  3QPT A;  4P9U A;  1WI9 A;  4P96 A;  1IN7 A;  1IW7 F;  3GF2 A;  4CIC A;  3MFK A;  3WTW C;  1P4W A;  3V7C A;  3L7W A;  3WTU C;  1FLI A;  4KMU X;  2D1H A;  2YR2 A;  2OBP A;  3WE3 A;  1YYV A;  4XSX F;  4YIF A;  1ZAO A;  2L4A A;  3IHU A;  1ZRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...