1DUXC

Elk-1/dna structure reveals how residues distal from dna-binding surface affect dna-recognition
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the elk-1-DNA complex reveals how DNA-distal residues affect ETS domain recognition of DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*AP*CP*CP*GP*GP*AP*AP*GP*TP*GP*T)-3')
total genus 26
structure length 86
sequence length 86
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1duxC00
2IP2A 4Q48A 1WQ2A 1ZN2A 4BNCA 3B73A 2PQ8A 4P96A 2ZBKA 3RJPA 3TO7A 5DEQA 3KE2A 2H09A 3FF5A 5FB2A 4ESBA 2O61A 3KP7A 5E1ZB 3DFGA 1G6NA 1STZA 2W84A 4OIPF 1DPRA 1WRJA 1P2FA 4U0YA 1R5GA 2JTVA 1J2XA 2VBZA 3J81Z 1XN7A 3L2CA 3IRQA 2DAOA 1H9TA 4WXDA 4I2OA 1ZARA 3BDDA 3J80K 4G7HF 1SD7A 1K78A 4ENMA 2VE8A 2EV6A 3BROA 2XAJA 4DNCA 2D45A 3W6KB 3T1BA 1ZLJA 3V7CA 4KYWA 5F1RA 4KIGA 2HGCA 5CVIA 2F5EA 1MJBA 3H3UA 1O3RA 2A3SA 2RGVA 3MFKA 4HV5A 3ZPLA 1W4MA 4EV0A 2WTEA 4M9SA 1P4WA 1KA8A 2EV0A 1YS7A 3M9AA 5AONA 2CW0F 2F5FA 2ZCWA 3GEZA 3C1DA 1L3LA 3C7JA 2OA4A 2XAFA 2VOOA 4KDPA 1T98A 2Z3YA 4CZZA 2A69F 1ZH5A 4L5IA 2GXGA 2RN7A 3K1MA 1BM9A 4AIJA 2STTA 3O6BB 3SZTA 3RKWA 2FEZA 1YS6A 1B6AA 3GYHX 2HQRA 2WC2A 4HF0A 3I59A 1G3YA 1S7AA 3ECHA 2Z5UA 4P55A 1XDUA 1X3UA 4O5VA 3E97A 4S05A 3RDIA 2HWVA 1R7JA 2VC1A 4I0AA 3V8JA 3SHFA 4UUVA 1IXSB 3HSEA 3RYRA 2A61A 1IN5A 4RB1A 3RI4A 4G8XA 4G6DA 5D4SA 4U88A 1J0RA 4RGRA 4XSXF 3GFLA 4KNYA 4FHTA 2HTSA 2GA1A 3R4KA 4CO8A 4HX8A 4B8XA 2J5PA 2FMLA 1IXCA 2W24A 2PLYA 4EGZA 3GUDA 3T8RA 5F64A 4L9NA 3F6VA 3AAFA 3WTWC 2QUFA 4HYEA 2RQPA 2IT0A 4DQ2A 5DD4A 3I5UA 3K1NA 4K2EA 2VT3A 3TOAA 3GW2A 3GXOA 3LA3A 1O7LA 4OIQF 3LWFA 5IT9Z 3TDUC 3PQJA 5CJ9A 2MLGA 1FNNA 3FWEA 3TKYA 1FYMA 4ESFA 3BPVA 5FGMA 5CLSA 5ED4A 1HXDA 4L9JA 5E17F 1TW3A 2EFWA 2WV0A 5IT3A 1Y0UA 3MQ0A 4L0ZB 3RKXA 5LHIA 4PGHA 4QWQA 3M8FA 3R0JA 4KMUX 2GWRA 5HDKA 1NHAA 5FD6A 5LHGA 2K27A 1O3QA 4OU0A 1QZZA 5DCMA 4ZYDA 2D2WA 1FBQA 1Z6RA 2P7VB 4BHBA 1HKQA 1KQ8A 4CYDA 3FX3A 4ENKA 3WGHA 1QGPA 2EA4A 2YX7A 4IHTA 2P8TA 5LHHA 1ZGAA 1ULYA 4A2UA 1FZPB 2V1DA 1XGNA 1SFUA 4HV6A 1J59A 1W5TA 3K69A 2KIUA 2B0LA 1E2XA 1BC7C 5DUIA 4EQQA 4S04A 4GYGA 4RB0A 2RDPA 2ACJA 3O2PE 2QQAA 1DUXC 1RZ4A 4EM1A 2OQRA 1KU2A 3E6BA 1BC8C 2E7XA 2KRFA 4IJAA 4HZFA 2MH9A 1ZREA 3K1PA 5J6XA 5L3FA 1YG2A 1HKSA 4BHPA 1MJAA 1XSDA 2YSRA 3G73A 5KK1A 1WI9A 1HW5A 2IRFG 2R3SA 3F8MA 1C0WA 2EWNA 1XDSA 3C3WA 4R1HA 3FHZA 3F72A 1B9NA 3L7WA 4M71A 4O3MA 5E18F 3M7GA 4G9YA 3KP3A 4LJZF 2F5DA 1YO5C 5DDGA 3NEUA 2IVMA 3I0TA 1O3SA 3K0LA 4WF2A 5BPIA 1R00A 3I54A 2HFHA 4JQFA 4XSZF 5JI6A 5ICFA 2FBKA 1HKTA 3HOSA 3T5XA 1U6GA 2D1VA 1AWCA 1LB2A 3IWFA 4M72A 3JTGA 1I27A 1R1VA 1LEAA 3IKVA 1G3WA 5DCMB 2MLKA 1TLHB 4AD9A 2K02A 2KKOA 3KP4A 4KT5C 4A5MA 3IC7A 3TGNA 1Z6TA 2JPBA 2BGCA 3WU0A 2A68F 3LFKA 3QP5A 4MEXF 1HSJA 5HS7A 1K7AA 2IPQX 1B59A 2PMHA 2VBWA 2HYGD 4L9TA 2KIFA 4RB3C 3ECOA 3V8KA 5FLXZ 3ZP5A 1QNTA 1W7PD 1OPCA 2FXAA 4XLPF 4EMSA 4A5NA 3P7NA 1LDKB 4HF1A 2JSCA 3I64A 5LRRA 5EEHA 1XSVA 2E7WA 1SMYF 4YIIA 4MNUA 3HSFA 2XROA 4LB5A 1O7FA 1TQIA 5HS9A 3QU3A 2ETHA 2CQKA 3WU1B 4IRHA 2G7HA 3SXYA 4HX4A 4YFNF 3BZ6A 5IT9K 2DO7A 3GFMA 3PFIA 4RS8A 1IW7F 2Y48A 2ZJ2A 2JZYA 2M8EA 3DXJF 5L3CA 3WTSC 1EH7A 2CFXA 4HX7A 4ZYGA 3P9CA 5HDNA 2G7UA 2ZO4A 1ODDA 3B02A 2XVCA 3G3ZA 2PG4A 3QRFF 3KZYA 3JTHA 2IA2A 5D5UB 1LVAA 2NAZA 1QQIA 2Q2EA 1GVJA 1JE8A 3V7RA 3D0SA 3VODA 2DFIA 5ERIA 5FO5A 1ZG3A 3CJNA 2RKHA 2ZXJA 4A12A 2XAQA 2UZKA 2HR3A 4IVNA 1IRFA 2EFPA 1FBSA 5HLGA 4ZYEA 5CVVA 3TO6A 5D6EA 1T0FA 3J81K 1I6XA 4Q5SF 2AS5F 3R0AA 4PGGA 2OAZA 3E6MA 1XB4A 2W85A 2BEOA 4KFCA 1XD7A 2OU2A 1FYKA 1FWZA 4KN7X 2O8XA 2Z33A 1U5TC 4OINF 3KEOA 1DPUA 4UV8A 4D0PA 3CUOA 4JBAA 4G7OF 3RYPA 3KLOA 2LSOA 4OOIA 4Y13A 5K5RA 1FP1D 1UFMA 4CGZA 1P4XA 3M8EA 2ESHA 1YW8A 2L4MA 1R22A 2PN6A 2M30A 2KJBA 4HQMA 3ZMDA 3ROUA 4LK1F 1T39A 1IRGA 3ZQ7A 3I53A 1BIAA 2V79A 2DQLA 1T6SA 3N4MA 2FA5A 3MAJA 3CUQB 3HYIA 5J8FA 2JPCA 3HHHA 3CUQC 1BOAA 4RAZA 5TJJA 1K79A 2CG4A 4YFKF 2OQGA 1SD4A 5E20A 3KLNA 1BJAA 5A2QZ 4FT8A 5FD5A 2XV4S 5ILVA 4IXAA 1O3TA 4B09A 2XRNA 1MDMA 1SMTA 3SZPA 1F9NA 1JXSA 1LEBA 4GGGA 1H0MA 1P6RA 1KQ0A 4IRGA 4IF4A 4OIRF 2IW5A 2VT2A 5E1XA 1EH8A 4HOBA 4A0YA 5BOXA 2R7DA 5HLHA 5ILUA 1KU9A 3IKTA 3FZVA 2ISZA 4KIBA 1F4KA 2CGPA 3EYIA 4EJWA 1XMKA 4KICA 5LRSA 3MZYA 2GXBA 2DTRA 3ABUA 1UCRA 3VOEA 3WGIA 1I1GA 1PP7U 4OMYA 1R1TA 5L3GA 3F8CA 2Q8KA 5JR3A 2BBYA 2P5LC 2TDXA 4HF2A 4BH9A 1XCBA 5LLQA 3FXQA 1W7PB 3O3KA 4ZH4F 1HW1A 2JT1A 5FFZA 1ON1A 2HZTA 2MC3A 1J5YA 4HLYA 3KZZA 3HRUA 1D8JA 1IAWA 1CF7B 1T2KA 1KYWA 2GZWA 4UXNA 1G3SA 5L3DA 1Z9CA 2NYXA 1BN5A 3V7SA 2VODA 4UNOA 1J9IA 1Z05A 5E1WA 1H9GA 4U7BA 1DDNA 1R5HA 2HOEA 3ZMVA 3MWMA 1OYWA 1YYVA 4IRIA 5D5WB 5H6RA 3WTVC 4KUMA 2L3DA 3EETA 4HLXA 1K6OA 4LD5A 4LB6B 3RPUA 3I4PA 1FSEA 5DD8A 1MZBA 4MTDA 1SD5A 3KETA 3HIFA 5D6FA 2A6HF 4MEYF 1OKRA 3R60A 4LLGF 2H27A 3HHGA 3ZMZA 5A2QK 4MGRA 3KFWX 2DQRA 4WX9A 3TO9A 2D1HA 4L0YB 3ZMUA 1XGOA 2V6CA 4UVAA 1XMAA 3I71A 1VTNC 3C18A 2COMA 2OZUA 5DYMA 3WE2A 1ZG5A 4KMFA 4XLNF 3R6SA 2QQ9A 1P92A 3P9IA 5CVJA 4XBFA 1Z7UA 1OR7A 2MD5A 2PFBA 4F7ZA 3QPHA 1CGPA 3WTYC 3EDPA 1XSXA 2FU4A 2P6SA 2VXZA 3E3VA 3ELKA 3QAHA 2HKXA 3VB2A 2E1CA 2NRAC 1BIBA 5FLXK 1OYYA 4CHUA 4M6YA 4ZZDA 1FY7A 4WWCA 2EA2A 2L01A 4BHCA 5EEGA 3TDZC 4EM0B 3ZN0A 1O57A 2YPRA 5K5QA 2YR2A 2G9WA 4Y17A 1R58A 1R36A 2DW4A 3BY6A 3QU6A 3CTAA 4LMYA 2OD5A 2XAHA 2J5OA 3DEUA 3REOA 1U5TA 1U8RA 2FBHA 2FRHA 3WGGA 1ONVA 1K78B 1ZHFA 4U7DA 4I02A 2DK8A 3ZN1A 3FXRA 2FBIA 1AOYA 2P5KA 3HUGA 5HDGA 5BMZA 2W57A 2HQNA 3WTZA 2P6TA 5LEJA 3JAMK 2P4WA 2XUBA 4ZYHA 3MEXA 3WODF 1ZRCA 5DUKA 1F1ZA 4M74A 4WK8F 1YQAA 4I0BA 2W25A 5D5XB 4YIFA 4G7ZF 4I98B 5AIQA 3LA2A 3FXUA 3WTXC 1FP2A 3D5LA 3CDHA 4KIFA 1S3JA 1U78A 4LGWA 3L9FA 5F6FA 3WG9A 1E17A 4P5OA 3R61A 3F8BA 1J75A 2EFQA 2Z9OA 1LJ9A 3QPTA 2BV6A 5LBQA 4R79A 1YTYA 3LQRA 3GFIA 1MD0A 1EV7A 2VBXA 4N9IA 3COAC 3FMSA 4LLLA 2V1UA 3JSPA 2KIMA 1FX7A 4GO1A 2HYFA 3ULQB 1DP7P 2X4HA 4A6EA 5CVRA 1G4DA 2HDCA 2F2EA 3V8LA 2ZNZA 4L5JA 1ZGJA 2QZ8A 4RB2C 2M5WA 3DKWA 1YW9A 3BJ6A 2H6CA 1U3EM 1FBUA 2FF4A 2XIGA 2ELHA 1LNWA 2RV8A 1YLFA 3WTUC 2HKOA 1LDDA 4P9FA 2A07F 1R1UA 3BPXA 5KVRA 1RNLA 3WTTC 3U9GA 3TOBA 1MJ9A 6PAXA 5DCFA 2X0LA 4RGXA 5D8KB 1XGSA 4NB5A 2MA3A 3DV8A 2XKOA 3LSTA 1QPMA 5ICEA 1ON2A 1FT9A 2QENA 2ZFWA 2L02A 3GLXA 3F21A 1REPC 4MHGA 5JFRA 4RGSA 4N0BA 3Q5FA 2CO5A 2FNPA 2DT5A 1YW7A 2M1BA 1ZG1A 3EUHA 4HA8A 4M9XA 2R7FA 2Z99A 2ZMEA 3CLOA 3GF2A 5CVUA 1W5SA 5JHUA 1KU7A 5L3BA 1F5TA 5LGNA 3QOPA 5ILSA 2VC0A 1T38A 3LA7A 3KEQA 4I09A 3ERED 3Q9SA 2Y0MA 1J7KA 2CYYA 4L18B 4M9ZA 4PDKA 4GCVA 1PDNC 4HDVA 2L4AA 4Q47A 3VEPA 1SFXA 3HTSB 2OZ6A 3I59B 4EJOA 3GO5A 2QBYB 2QQBA 4G94A 2EB7A 2LNBA 4EM2A 2DK5A 2YU3A 3U2RA 1V4RA 2LDUA 1UHWA 4BQAA 1FOKA 1RUOA 1JGSA 2UWMA 4LG0B 2QLZA 3CO7C 4EVIA 4A0XA 1MDMB 3DP7A 2QM3A 1IN8A 4LG0A 2V9VA 3H3ZA 3GFJA 3HRMA 5TRDA 4HQEA 3RKYA 3GX4X 3ML6A 1FYLA 2XASA 1JHHA 4MTEA 1TNSA 2FE3A 2VONA 2LF7A 1WSUA 4HBLA 2DPDA 1S7OA 2IA0A 1B4AA 2WWYA 3BOQA 3RTRA 1PUEE 1A04A 3T8TA 4EJVA 3OOPA 1HSTA 2HTJA 5D4RA 2ADUA 2LF8A 1XCVA 2H94A 2DLLA 1D5VA 3GWZA 4ENNA 2FOKA 4OIOF 1MGTA 3FMRA 3RPQA 3K2ZA 2PI0A 1BBYA 1ZAOA 4U0WA 4EJTA 2PJPA 4ENJA 1IN4A 2EK5A 2UXXA 3KP2A 3MCZA 1YFHA 1I1SA 2RC4A 3ISPA 2A6EF 2VBYA 5H20A 4TV7A 3LAPA 1V3FA 4AVPA 4LLNA 1HW2A 3OV8A 4MQ9F 2ZMEB 1OMIA 5HLIA 3JSOA 2XKPA 2DI3A 2FNAA 4UVBA 2ISYA 1TNTA 4LK0F 1YIOA 2XGXA 2NNNA 2JRTA 2FSWA 1FSHA 2O0YA 2PBIA 3V4GA 5ICCA 2O3FA 3NQOA 3U1DA 3H92A 1KU3A 2K7LA 2RVCA 1IF1A 3TQNA 3IL2A 4UV9A 4HDUA 3IHUA 5HVQC 1S8NA 4G6QA 4WCGA 4NHJA 2K4JA 4Y15A 2A5YB 1LQ1A 2E1NA 2NNYA 5HOOA 2HS5A 4Q4ZF 4BAYA 4CDGA 2CSOA 1Z1DA 3F3XA 1ZYRF 1QBJA 3F6OA 1D8KA 3LQQA 1LDJA 2UXNA 4UHTA 2XAGA 2O6GE 2VE9A 4N9HA 1FPQA 1USSA 4ASNA 1UB9A 2RNJA 3PQKA 4IPAA 3BJAA 4RAYA 4ZZLA 3N97A 3CUQA 3E6CC 3Q9VA 3KP5A 1JHFA 1TBXA 1D3YA 5BS6A 2GIVA 2VOPA 2LKPA 3F8FA 1RIOH 4ON0A 3M1EA 3K9TA 2QWWA 3HOTA 4KN4X 3ZMSA 2DU9A 5D5VB 2QBYA 3JAMZ 1TW2A 3I58A 1IXRC 2EV5A 5K1YA 4R8HA 3E5UA 3HRSA 1GXPA 1TQMA 1I5ZA 5BQTA 3J7AO 4IHSA 2Y75A 5LEKA 5D8LB 2M45A 2EJRA 3CO6C 4KA4A 3ABTA 2FMYA 1FC3A 3SFZA 4AIHA 2GQQA 2QYOA 2ESNA 3LAJA 3W6JB 2PMUA 1QO0D 1B9MA 3JW4A 3HSRA 2YX4A 3MZHA 5BPDA 4WXCA 5L3EA 4Z2YA 1MKMA 4M73A 4M6XA 4FX4A 4I01A 4P9UA 1U5TB 4A0ZA 2GAUA 3VFZA 1L0OC 3DPLC 3F23A 2Q0OA 2EFOA 2MH2A 3DF8A 4YFXF 3FMQA 1TQPA 4FX0A 2XHKA 4JK1X 2AXLA 4AIKA 5E8IA 1BI1A 1IZ1A 2ZKZA 3F22A 1USTA 3BP8A 2MBFA 4XRFA 5LGUA 4WXHA 2KJCA 2C6YA 2K86A 1WKMA 3DPTA 3FM3A 2K4BA 5JVTA 5AIPA 2VN2A 1RI7A 3GZ6A 1IN6A 3KCCA 2IA1A 5ICGA 1GHCA 4ETSA 1KYZA 4L9VA 1GXQA 2NS0A 1UHMA 1IN7A 4I7HA 4EJUA 2STWA 4EGYA 1B1BA 2ZNYA 1EH6A 2BYVE 4A6DA 2L54A 1SFEA 2EFNA 4BXUA 3IWZA 2F5CA 2O03A 3DQVC 5CYVA 2DPUA 3P9KA 3E5XA 4NQWA 1HQCA 4CXFA 1S29A 1R23A 3WE3A 2V1XA 3EQLF 4QLCU 3J80Z 1BI0A 3F8NA 4PZJA 4AWXB 2IJLA 1IUYA 3ZMTA 2CWEA 1KQ9A 4PCQA 4O6JA 3E5QA 5J8CA 3RIRA 5E8GA 3KP6A 1SD6A 1PP8F 2HEOA 5DV5A 3T0YA 3EYYA 4HAMA 3FM5A 1RUNA 3BWGA 5H6QA 1BI2A 1TTYA 3GVAA 2H6BA 1SAXA 1FLIA 1Q1HA 4E70A 4YG2F 3GZ5A 3BJOA 3L09A 1G3TA 3HRTA 2DBBA 4RGUA 4UVCA 1QZYA 4MQVA 4H0EA 1U2WA 4U0VA 2BE5F 1WWXA 4LFUA 2P5VA 4BYYA 3HTUA 3S2WA 4GXOA 4GYIA 1P4AA 3SQNA 2OBPA 1KGSA 2GA2A 1W7PA 1Z91A 3IRRA 1CF7A 4CICA 5K5OA 5HS8A 1S6LA 1XGMA 4OMZA 1ZRDA 1BI3A 4ESJA 1ZLKA 2PEXA 5LGTA 2QVOA 2P7CB 3QP6A 1HBXG 1ZRFA 5FFXA 4HW0A 2M87A 3NRVA 2FQ3A 1OYIA 3L00A 3E6DA
chains in the Genus database with same CATH superfamily
1WJEA 2LY9A 4XLCA 3O8GA 3HKZA 2IP2A 4Q48A 1WQ2A 2ELKA 1ZN2A 4BNCA 3B73A 4XQFA 2PQ8A 3OIQA 2IGOA 2LY2A 4P96A 2ZBKA 3RJPA 4XRSG 3TO7A 4C2UA 5DEQA 4CA0A 3KE2A 4II3A 1WJAA 3S3MA 2CQXA 2H09A 3H35A 4YEJA 2PX9A 3S93A 4AUXA 3FF5A 3CC2I 5FB2A 3I4NJ 4ESBA 1MBKA 5J1YA 2O61A 4NDLA 3KP7A 5E1ZB 3DFGA 1G6NA 1STZA 2W84A 4B3AA 2CW7A 5IYBJ 4OIPF 1DPRA 3HJEA 3LSGA 1QHGA 1WRJA 2QKLB 3GTJJ 2MW8A 1O4XA 1LE8B 1YX3A 1P2FA 2K9NA 2G0EA 4U0YA 2XGCA 1R5GA 3CCEI 1WCMJ 2XDVA 2JTVA 1ZR4A 1J2XA 2DA6A 5K7ZA 2VBZA 3J81Z 2GIZA 1XN7A 1G8XA 2YS9A 1JUPA 2OCEA 2JJ7A 2WAQA 1Z0XA 3L2CA 5K7FA 1V55H 2IGMA 3IRQA 2PMZA 2DAOA 3QYFA 1H9TA 3IH4A 4WXDA 4I2OA 2NVQJ 2QF7A 2JUCA 4XLHA 1ZARA 3BDDA 3J80K 2AQFA 4MFEA 1UG2A 2KLOA 4G7HF 1JJ6C 1SD7A 5GAEJ 2LBFB 1K78A 2CUZA 5F0FA 2OTLI 4ENMA 2VE8A 2EV6A 3BROA 2GM4A 3HOZJ 4E4HA 5M3FJ 2XAJA 4DNCA 2D45A 3W6KB 3ZQLA 4CYCA 1UMQA 3T1BA 5GAGJ 1ZLJA 4M6VA 3QYEA 3ABMH 4JX4A 4Y4RA 3V7CA 4KYWA 5F1RA 4KIGA 2HGCA 1Y8QB 3GZNB 3HPHA 3V42A 2YU9J 1LVKA 1HC8A 3ESWB 4PJJA 5CVIA 2F5EA 4FISA 1MJBA 3H3UA 1O3RA 3HB9A 2A3SA 2LKXA 2E19A 2RGVA 4UUTA 4BQOA 3MFKA 2HPIA 4HV5A 1TWFJ 3ZPLA 1W4MA 4RLQA 4EV0A 4P1WA 2WTEA 4M9SA 1T95A 1P4WA 2EZIA 1VQOI 1KA8A 2EV0A 1TWHJ 1WJFA 1YS7A 3M9AA 4M3EA 3HOVJ 4V2FA 5AONA 4CYCB 2CW0F 2NVUB 3LL7A 2F5FA 2ZCWA 1BL0A 3GEZA 3C1DA 1L3LA 3H9QA 3C7JA 2OA4A 2XAFA 3L2QA 2DA1A 2VOOA 1VF9A 4BQNA 4KDPA 2BHYA 1T98A 2CV2A 3E0JB 2LH9A 2A05A 4YELA 2Z3YA 1N78A 4CZZA 2R7UA 4KT6A 2A69F 3CMAI 4C2TA 2E2JJ 2CS3A 2R7TA 5E3MA 2ZB9A 1ZH5A 4L5IA 1HA8A 2GXGA 2M4GA 2RN7A 2HOSA 1X1DA 3PM1A 3K1MA 2R5YA 1BM9A 4AIJA 2IEKA 2STTA 1OCTC 3S2DJ 3CQZJ 3O6BB 1YJNI 2ECCA 3SZTA 3RKWA 2FEZA 3Q3SA 1IGNA 5F0CA 1YS6A 1B6AA 1A6QA 3GYHX 1FIPA 4RM2A 2HQRA 2WC2A 4DYQA 4HF0A 3I59A 1G3YA 2V1NA 1S7AA 1S9HA 3F9KA 3ECHA 2Z5UA 4P55A 1N75A 2VJ5A 3I4MJ 3BR2A 3ERMA 1XDUA 1ERDA 1X3UA 2OV7A 4O5VA 3E97A 4S05A 2IXSA 2DOEA 4A3KJ 3RDIA 3H9JA 2HWVA 1R7JA 2VC1A 4I0AA 4GRIA 3SHFA 3V8JA 4UUVA 1IXSB 1HLVA 2OTJI 2E34A 3HSEA 3RYRA 2A61A 1IN5A 3BCAA 2HOTA 1G59A 2HPMA 4RB1A 2XSJC 3PJRA 1D1CA 3RI4A 4M3FA 4XN3A 1FIAA 2QKMB 4G8XA 1T8IA 2CQQA 4G6DA 5D4SA 4BJ6C 4ZJZA 2VKDA 1SVMA 1J0RA 4U88A 2M0MA 4X6AJ 4RGRA 1P7JA 4XSXF 3GFLA 4DZPA 4KNYA 2IBDA 1YE9A 3OYJA 4FHTA 2HTSA 2GA1A 1Q1VA 3R4KA 4CO8A 4OWRB 4A3EJ 3W2VA 4HX8A 4B8XA 3EUAA 2J5PA 2HQ5A 2FMLA 5J1UA 1XS9A 1QVTA 4FQGA 1IXCA 2W24A 1EA3A 1DP3A 1X3ZB 2PLYA 4EGZA 2QGUA 3A2KA 3GUDA 3T8RA 5F64A 4QIWN 4L9NA 5GP9A 3F6VA 4LITA 3AAFA 1A36A 4XM3A 3WTWC 5TISC 1U9NA 2QUFA 4HNVA 1TC3C 2JQ7A 3DBRB 2AO9A 2K5CA 4HYEA 2RQPA 4DQ2A 2IT0A 5DD4A 3I5UA 3K1NA 4K2EA 2VT3A 3TOAA 1OQYA 1ETWA 2X1CA 3GW2A 3GXOA 1ETKA 2VUMJ 3LA3A 1O7LA 4OIQF 1D5YA 3CJQB 3LWFA 5IT9Z 1BR4A 3TDUC 3PQJA 3SDGA 1E3OC 2E1MC 1BOBA 5CJ9A 4EEFG 1OISA 2MLGA 3CC4I 1FNNA 3FWEA 2BW3A 1PYVA 3OYCA 3TKYA 3G4SI 1YRNB 4NNJA 1FYMA 4ESFA 2R7XA 2R7OA 3BPVA 2LP0A 5FGMA 5CLSA 1YJ9I 3OYEA 5ED4A 1HXDA 4L9JA 3CLQA 4W1UA 5LFAA 5E17F 1GUUA 1TW3A 2EFWA 2WV0A 5IT3A 2KP6A 3OYAA 1Y0UA 3CP8A 3MQ0A 4L0ZB 1QVUA 3RKXA 5LHIA 4PGHA 2WB1N 2I5UA 2L5QA 4QPOA 3K10A 5C4JJ 4QWQA 2LFBA 3M8FA 3R0JA 3HOXJ 4KMUX 5B66C 2GWRA 5HDKA 1NHAA 3VYRB 5FD6A 5LHGA 3OL4A 2K27A 5IPAA 1O3QA 2IS4A 1RETA 4OU0A 1QZZA 5DCMA 2IGNA 4ZYDA 2D2WA 1FBQA 1Z6RA 1YITI 3HKZN 4IOAF 2P7VB 4BHBA 1HKQA 1KQ8A 1X4PA 4CYDA 1WHUA 3FX3A 3JREA 3C2BA 3GTMJ 4ABZA 4ENKA 1MBGA 2P81A 3WGHA 4DZJA 2TCTA 2ZMEC 4B1RA 1QGPA 2RAEA 1T33A 2EA4A 1U0JA 2YX7A 3H0GJ 4IHTA 3H5NA 2P8TA 2VQCA 1VQLI 2FUG2 1J09A 5LHHA 1ZGAA 1ULYA 4A2UA 5HLTA 2E2HJ 2K9SA 1FZPB 3L2WA 2V1DA 2H1KA 1XGNA 1SFUA 4HV6A 5M5WJ 3BG5A 2OUMA 1J59A 2LYCA 1W5TA 2DA7A 3DU5A 3S1MJ 3FXKA 3K69A 1ETXA 2KIUA 2B0LA 1E2XA 1BC7C 5DUIA 4JYKA 1SFKA 4JX5A 4BY7J 2HU9A 1MIJA 4EQQA 4S04A 4GYGA 2R7QA 4RB0A 3DTIA 2KT0A 2RDPA 4A3DJ 5C3EJ 2ACJA 3O2PE 2QQAA 1DUXC 4BS9A 1RZ4A 4BJ5C 4EM1A 4A3LJ 2OQRA 2R7SA 2M34A 1KU2A 1UJ8A 2F4MB 2XF5A 3E6BA 2LLKA 4XK4A 4PJMA 3L2UA 3C2HA 1BC8C 1X1AA 2E7XA 2KRFA 4CSWA 2DXIA 4GDFA 5F1JA 4IJAA 4HZFA 1K6YA 2DFEA 2RREA 3LOCA 2MH9A 5EDNA 1UZCA 1ZREA 3K1PA 1CQTA 3AG3H 5J6XA 5L3FA 1YG2A 5GADJ 3MVPA 4PFOA 2LREA 2VQGA 1K4SA 2KMUA 1HKSA 4BHPA 2R93J 1MJAA 4M3BA 1XSDA 4UB8C 4HRIA 2YSRA 4HNTA 2DA3A 1K83J 3G73A 5KK1A 4CCMA 1R71A 1WI9A 1HW5A 2VKEA 3EUKL 2X48A 3HC7A 5EJCA 3OS2A 2IRFG 4LIVA 2R3SA 1KZHA 3OL3A 3F8MA 1C0WA 2EWNA 3HGYA 1XDSA 3C3WA 3TEDA 4R1HA 3FHZA 2Z2SB 3F72A 1B9NA 2MGQA 2XF7A 3L7WA 4M71A 4O3MA 3VWBA 3HM5A 5E18F 2R5YB 3M7GA 5TGTA 4G9YA 3KP3A 4LJZF 2F5DA 1YO5C 5DDGA 3BG3A 4RM3A 2ME0A 3NEUA 3SEQA 1KONA 3UNGC 2IVMA 3I0TA 1O3SA 1ITYA 3K0LA 3S3OA 4WF2A 5BPIA 5KCMA 1R00A 2WA0A 3I54A 4CUGA 3DBHB 2HFHA 3G6EI 4JQFA 1JI8A 1MBHA 2VJ4A 4XSZF 3PSIA 5JI6A 2NVYJ 3CCVI 4C2MJ 5ICFA 2L9RA 2LRDA 2JRMA 2FBKA 1HKTA 3HOSA 3T5XA 3VSLA 2HVSA 3K7AJ 3PNVA 3U21A 3A1YA 1JKOC 4L5EA 2F5VA 5GTHC 4BE2A 1U6GA 2D1VA 1AWCA 1LB2A 3IWFA 4M72A 3JTGA 3HOUJ 1ZGWA 1I27A 1R1VA 1LEAA 3IKVA 1G3WA 4B4CA 1IV6A 2HOAA 3CMEI 5DCMB 2MLKA 3KIOA 1MW7A 1TLHB 4AD9A 2K02A 4D7NA 2HVRA 2KKOA 3FXLA 3RSNA 3KP4A 4KT5C 4HG2A 4A5MA 3IC7A 4J00A 3TGNA 2Q1ZB 1Z6TA 2ZJPF 4Y33A 5FROA 2JPBA 5EGOA 2M4KA 4IO9F 2GOMA 2BGCA 3WU0A 2A68F 3LFKA 3QP5A 3QYBA 2EILH 4MEXF 1HSJA 5HS7A 1K7AA 2IPQX 2MSYA 1GV5A 3NWTA 1B59A 2BY3A 2HI3A 2PMHA 2VBWA 2HYGD 4L9TA 2KIFA 4RB3C 3ECOA 3HBLA 3V8KA 5FLXZ 4BXFA 1QNTA 1W7PD 1OPCA 3ZP5A 4E6KG 2FXAA 4XLPF 1FOWA 2R5ZA 4EMSA 4A5NA 3CCYA 3OS1A 3P7NA 1LDKB 4HF1A 2JSCA 1W1WE 3CJRB 1YJWI 2DA4A 3I64A 3AL0C 3PUBA 5LRRA 5EEHA 1XSVA 2E7WA 5IOYA 1SMYF 1E3PA 3FIWA 4YIIA 2CUEA 4IX7A 2OF7A 2ELJA 2KRCA 4MNUA 3HSFA 2XROA 1I39A 4LB5A 1O7FA 3S16J 2XB5A 1TQIA 3K2AA 5HS9A 3QU3A 2ETHA 3DBLB 2CQKA 4DIQA 3WU1B 4W97A 1PVEA 1PJRA 1V5FA 1LFBA 4IRHA 2G7HA 5F0HA 3SXYA 4HX4A 4YFNF 1GDTA 2VJJA 4ZTJA 3BZ6A 4RBOA 5IT9K 2DO7A 3GFMA 3PFIA 4CCOA 4B48A 4RS8A 1IW7F 2Y48A 2ZJ2A 3AG4H 2JZYA 2M8EA 4CCLA 5FKMA 1R6RA 1AKHB 3DXJF 5L3CA 1RKWA 2WBMA 4NC8A 3WTSC 1EH7A 3DPUA 2HDWA 2CFXA 4HX7A 4ZYGA 1GT0C 1HDDC 3P9CA 3AG1H 5HDNA 4EATA 2G7UA 2ZO4A 1ODDA 2EZKA 3B02A 4B44A 1UHSA 2XVCA 3JCUC 3O8HA 3G3ZA 1E3HA 2PG4A 4C9YA 3QRFF 4DJAA 3KZYA 1JKRC 3JTHA 2IA2A 5D5UB 1LVAA 2NAZA 1BJZA 1QQIA 2Q2EA 3QOEA 5FKNA 2KDOA 1GVJA 1JE8A 3JR9A 3V7RA 1X2MA 2E71A 3OYHA 3D0SA 3VODA 1LFPA 2DFIA 5ERIA 1TT5B 4YRVA 2L7KA 2M3AA 2L7FP 1NG6A 3CJTB 5FO5A 1ZG3A 3CJNA 2RKHA 1TZLA 1T08B 2ZXJA 1X1PA 2VB6A 4A12A 2XAQA 4A3IJ 2UZKA 1ZK8A 2HR3A 4IVNA 3TMOA 1IRFA 2EFPA 1I6HJ 3G1MA 1FBSA 5HLGA 4ZYEA 1AU7A 2KHMA 5CVVA 3TO6A 5D6EA 3M4OJ 4HSRA 3BTLA 1HCRA 3MKZA 2OC6A 3FISA 2NS8A 3N05A 3OYLA 5EZHA 1EKEA 1T0FA 3J81K 1I6XA 4Q5SF 2CU7A 3KPHA 2AS5F 3R0AA 1M1EB 4PGGA 1LFUP 3ONQA 4A69C 4UY8I 2OAZA 4CZCA 4ANJA 1UAAA 3E6MA 1XB4A 1JJ8C 2W85A 2ZXIA 2BEOA 3ZGKA 1DU6A 4KFCA 1XD7A 3BCBA 4XNFA 3W3CA 2OU2A 1FYKA 1Z7LA 1DGWY 1FWZA 4KN7X 2O8XA 2Z33A 3GCMA 1U5TC 4OINF 3KEOA 2V26A 5E3OA 4UV8A 4D0PA 1DPUA 4F52A 3CUOA 2FOWA 3PO3J 4JBAA 2R4GA 4G7OF 3C2GA 3G2BA 3RYPA 1BW5A 3KLOA 2LSOA 5IOZA 4OOIA 4Y13A 1MSFC 1U9OA 5K5RA 1FP1D 1UFMA 3IV5A 1TWGJ 3CCQI 1BR1A 4CGZA 2R7ZJ 1P4XA 3ZXSA 3CC7I 4I6ZA 4BEHB 3LSRA 3M8EA 2ESHA 1YW8A 5KNLA 4JOMA 1SC7A 2L4MA 1VQ5I 2NXNB 3RZDJ 3OYMA 2DDBA 3A03A 4ZTFA 1R22A 2PN6A 1ETVA 1WFXA 2M30A 2L2OA 4B3XA 2KJBA 4HQMA 2AQEA 1TWCJ 3ZMDA 3W2AA 3H0DA 1SVOA 3WU2C 3K4CA 3FK6A 3CDLA 1MSEC 3HPGA 3ZQGA 3ROUA 3JRGA 1Z67A 1Z21A 4LK1F 1T39A 1IRGA 2CUJA 3ZQ7A 4BJTA 3I53A 3S2HJ 5FRMA 1BIAA 3ZQHA 3HZJA 2V79A 2OPTA 2DQLA 1T6SA 3N4MA 2FA5A 3MAJA 2EBIA 4PFPA 2EZLA 5LD2C 3CUQB 5J1RA 3HYIA 5J8FA 2JPCA 3A02A 3HHHA 3CUQC 1BOAA 2W1OA 4RAZA 2M7AA 1D0YA 5TJJA 1K79A 2CG4A 4HPQA 4YFKF 2OQGA 1Y8RB 3DEEA 1QRYA 2NVXJ 2WY8Q 1SD4A 1BW6A 3S1RJ 5E20A 3L2VA 3KLNA 1BJAA 5A2QZ 3PIPF 4FT8A 5J4VA 2O8KA 5FD5A 2XV4S 4NQWB 5ILVA 5FKKA 2R0QC 4IXAA 1O3TA 4XLEA 1W0TA 4B09A 4HNUA 1YIJI 2XRNA 4BY1J 1MDMA 1SMTA 2GLOA 3SZPA 5EG0B 1F9NA 2W00A 2ECBA 3LSKA 3D1NI 1JXSA 1LEBA 1B8IA 1VQNI 4GGGA 1DU0A 1H0MA 1P6RA 1KQ0A 2XPUA 4IRGA 5M3MJ 3AL0B 2F4OB 4IF4A 4OIRF 2CJJA 2IW5A 2VT2A 2EIJH 2QA4I 3K4JA 4BBSJ 1JTXA 5E1XA 5GPAA 4XLFA 1AKHA 2ZC2A 1EH8A 3FKJA 4HOBA 4A0YA 5BOXA 2COBA 2IGKA 2WV1A 2R7DA 5HLHA 1SANA 1FOXA 5ILUA 1KU9A 3IKTA 3K4MA 1WGXA 3FZVA 2ISZA 4KIBA 1F4KA 2CGPA 3EYIA 2EQRA 4EJWA 1MMSA 2ZSHB 1XMKA 4KICA 5LRSA 3MZYA 3BR3A 2GXBA 2DTRA 2VKHA 3ABUA 1UCRA 3VOEA 4D1QA 4H4KC 3HOWJ 1X2NA 2MD0A 2JMWA 1WJ5A 3WGIA 4PUSA 1I1GA 2QCOA 2GOXB 1PP7U 4OMYA 1R1TA 1JUSA 5L3GA 3F8CA 2Q8KA 5JR3A 2BBYA 2P5LC 2TDXA 5GPCA 2DYSH 4X0GA 2W48A 1S7EA 1W36C 4HF2A 1JKQC 2QSHX 4BH9A 1XCBA 5LLQA 3FXQA 1W7PB 2WB1A 3BC8A 2JVGA 2X1EA 3O3KA 4ZH4F 1HW1A 4E7JA 1X1CA 1NTCA 1E0EA 3PO2J 2JT1A 5FFZA 1ON1A 1WJBA 1T0FC 3OOUA 5EEAA 2HZTA 2DOFA 3HGGA 2MC3A 4A93J 3LFUA 1J5YA 1R9TJ 4HLYA 3KZZA 3BR0A 3HRUA 1IAWA 1D0ZA 3GTQJ 1D8JA 3Q0WA 2VI6A 4DBQA 4C30A 3S32A 2Y0SA 1CF7B 1T2KA 1KYWA 1P9QC 3LSMA 3D5SC 3AFHA 2GZWA 4NUBA 5F04A 4UXNA 1G3SA 4IQ4A 5L3DA 5EYRA 1Z9CA 2VPRA 2NYXA 3K4BA 1BN5A 3V7SA 2VODA 3PSFA 4UNOA 1J9IA 4CH7A 1Z05A 5E1WA 3MKWB 1H9GA 4U7BA 2CQ7A 4MO7A 2R7VA 2CFOA 3GBGA 1DDNA 1NK3P 1R5HA 2HOEA 3ZMVA 4XOTA 3RPUD 9ANTA 3H36A 2M2EA 3MWMA 1OYWA 2DMQA 3DLAA 1YYVA 1ZTRA 1Z3XA 4E7HA 5D5WB 4IRIA 2A6TA 4IHWA 5H6RA 3VYSB 3WTVC 4KUMA 2L3DA 1S72I 1IV8A 1R4MB 3EETA 4DGWB 4HLXA 2M8GX 3QODA 1K6OA 2LKSA 4LD5A 4LB6B 3SEZA 4E7LA 2DODA 3RPUA 3I4PA 1FSEA 5DD8A 1MZBA 4M3DA 2O5RA 2VASA 4MTDA 3H1CA 1SD5A 3KETA 3HIFA 5HNHA 2LC2A 5D6FA 2A6HF 1DQUA 2Y9YA 4MEYF 1FMVA 1OKRA 3R60A 4LLGF 2H27A 3HHGA 3ZMZA 5A2QK 4MGRA 3KFWX 2DQRA 4WX9A 3SFIA 3TO9A 2AHQA 2D1HA 4L0YB 3DKYA 3ZMUA 1XGOA 2V6CA 1AA7A 2ZSIB 4UVAA 1XMAA 1ZQ3P 3I71A 3S1QJ 3DCFA 2BHZA 1VTNC 3C18A 2H8WA 1QHHD 2COMA 2EPFA 1MH3A 2OZUA 5DYMA 3WE2A 2IS1A 3LSIA 2B7EA 1GLNA 3H9GA 3MD2A 4BU2A 1I50J 1ZG5A 4KMFA 2DCEA 4XLNF 2K3PA 3R6SA 2QQ9A 4CCKA 1P92A 3P9IA 5CVJA 4XBFA 1Z7UA 1OR7A 2MD5A 2PFBA 4CCJA 3QWLA 4F7ZA 1R5ID 2BY1A 3ZCOA 3HEFA 3QPHA 1CGPA 3WTYC 3EDPA 1XSXA 4ZDPA 2FU4A 2P6SA 4OAZA 2L9NA 2VXZA 3E3VA 4AVZA 5B1AH 1A31A 3CZ6A 2W7NA 3TW7A 3ELKA 3KYLA 2R7RA 5BNGA 1OCZH 3QAHA 2HKXA 3VB2A 5KAFC 3K70C 2HDDA 1K4TA 2E1CA 2NRAC 2LD5A 1BIBA 5FLXK 3I3LA 1OYYA 4CHUA 1WZ2A 3LNQA 1VZ0A 4M6YA 1WI3A 4C3HJ 4DBRA 2ZXWH 2Y2ZA 1FY7A 3QPLA 4ZZDA 5B1BH 4WWCA 2WAFA 2EA2A 2L01A 4BHCA 5C44J 2E1MB 2X85A 5EEGA 5KAIC 5EZGA 3TDZC 5EGOB 4EM0B 5FKOA 3ZN0A 1O57A 2R5ZB 2EINH 2YPRA 5K5QA 2YR2A 3OYNA 2V7FA 3LSPA 1VFCA 2G9WA 3BG7A 4Y17A 4N4NB 3EPZA 1R58A 4UUSB 1R36A 2DW4A 1F36A 1BA5A 1VQ8I 2BW3B 3BY6A 3QU6A 2MYSA 3CTAA 4LMYA 2OD5A 5FJ8J 2XAHA 2J5OA 3DEUA 3HL2A 2XGEA 3K6GA 3NAUA 3REOA 1A35A 1U5TA 1U8RA 2FBHA 2FRHA 2JSPA 4RA2A 4Z6YA 3WGGA 1ONVA 3HUGB 1K78B 3A01A 2E60A 1UELB 3BG9A 3BR5A 4C3IJ 1ZHFA 4U7DA 1YHQI 4I02A 2DK8A 1XX5A 3ZN1A 1IDZA 2DFHA 2MC4A 3ZOBA 3FXRA 3OYBA 2FBIA 1IUFA 1AOYA 2P5KA 3HUGA 1K61A 3UR3C 5HDGA 5BMZA 2DDAA 3FXMA 4C3JJ 2W57A 4XRSA 1IJWC 2HQNA 3WTZA 2HXOA 2P6TA 4XL9A 5LEJA 3JAMK 3OIOA 1IDYA 2P4WA 4X1EA 2XUBA 4ZYHA 3MEXA 2E5NA 3WODF 4BE1A 1ZRCA 1XC5A 2CMPA 5DUKA 1F1ZA 4M74A 1LE8A 4WK8F 4LIUA 4D5FA 3S15J 1YQAA 4I0BA 3VPRA 1I3QJ 1YX5A 2W25A 5D5XB 4YIFA 4G7ZF 4I98B 4MIMA 2HZDA 4I99C 5AIQA 3LA2A 1SAUA 3FXUA 2EIMH 2WADA 3WTXC 1FP2A 3D5LA 3OSFA 3CDHA 2UUZA 4KIFA 1S3JA 2JVHA 2Y69H 4LGWA 1U78A 3MKLA 3L9FA 1OFCX 1Z3YA 2X6YA 5F6FA 3J7ZI 3WG9A 1R49A 2O9LA 1E17A 4P5OA 3R61A 2I8DA 3F8BA 4JX6A 3JRCA 1W36D 5J40A 1N77A 1OCRH 1WVRA 5JLWA 1YI2I 3KYDB 1VQMI 1J75A 2EFQA 2Z9OA 1IO2A 4IL6C 1LJ9A 3QPTA 5DS9A 2BV6A 5LBQA 1FTZA 4R79A 1YTYA 4CCNA 2CUFA 4RMNA 3LQRA 2DJNA 3GFIA 1MD0A 3G71I 2VPLA 1ZR2A 3GTOJ 2K9MA 3BQZA 2LG4A 1EV7A 2VBXA 4N9IA 4F92B 3COAC 1SFOJ 2OJED 3FMSA 2DJIA 4LLLA 2V1UA 3J7AY 3I56I 4XR6A 1FTTA 3JSPA 2XPVA 2KIMA 3TW6A 4BUPA 1FX7A 2E35A 4GO1A 2HYFA 3ULQB 1DP7P 2X4HA 1RR7A 2E1OA 2KPMA 4A6EA 5CVRA 3OYDA 2Y31A 5M5YJ 1G4DA 2HDCA 1RESA 2LOOA 3DEWA 3MN2A 2F2EA 1MNDA 1WH5A 3CMMA 1NH3A 5CQEA 3V8LA 2ZNZA 4L5JA 1ZGJA 3ZQCA 2QZ8A 3RQ4A 1D1BA 3HG9A 4RB2C 2M5WA 3DKWA 4F55A 1YW9A 2XB0X 5CPRB 3BJ6A 4F3QA 4BXXJ 2H6CA 1U8BA 3I55I 4A3MJ 1U3EM 1FBUA 1Y1WJ 2FF4A 2XIGA 3ZQFA 2L0KA 4A3CJ 1XTAA 3BG6A 2ELHA 2P0WA 1JUMA 1VQ4I 1LNWA 3DTEA 4XORA 3RKQA 2RV8A 1YLFA 3WTUC 1Y1VJ 2HKOA 4D7MA 2LVSA 2M0CA 1LDDA 4P9FA 3CCJI 2E5ZA 2A07F 1R1UA 2BXYA 3BPXA 2KQRA 5KVRA 2V9KA 1RNLA 3WTTC 3U9GA 3TOBA 4RAGA 1MJ9A 1VQKI 2TRTA 6PAXA 2ID6A 4BDZA 5DCFA 2X0LA 4RGXA 1SEUA 5D8KB 1XGSA 4NB5A 1QZEA 2MA3A 2QEXI 3W6VA 1RKTA 3DV8A 2XKOA 2ID3A 4XN0A 5E79C 5DM6F 3LSTA 1QPMA 2X6WA 5ICEA 2K85A 3ABLH 3CCMI 4Y3OA 3I9V2 1ON2A 1FT9A 2QENA 2ZFWA 3K4KA 5J3LA 1OCPA 2L02A 3GLXA 3F21A 1REPC 4MHGA 3BTJA 2DA5A 2H1LA 4RGSA 5JFRA 4N0BA 3FBIB 3Q5FA 2CO5A 2FNPA 2DT5A 2GXAA 1H8AC 1YW7A 2M1BA 1ZG1A 2FJ1A 2ZFUA 4UUSA 1MMNA 4PK4A 3EUHA 3K4NA 4HA8A 4M9XA 4LOCA 2R7FA 2FD5A 1VQ7I 4BE0A 1RPWA 2Z99A 2K9LA 3SYTA 2ZMEA 3CLOA 3GF2A 2QSFX 3GTPJ 2X6OA 2ME6A 1X3WB 5CVUA 1EF4A 1W5SA 3QQAA 4DW6A 1F43A 1TP4A 5JHUA 2L9VA 1KU7A 5L3BA 2NOJB 1F5TA 4RAFA 4BEHA 5LGNA 3QOPA 3CDIA 1Y56A 1IC8A 2CH0A 2DMUA 5ILSA 4MLOA 2VC0A 3IUOA 3K4LA 1T38A 4PSWA 2HYJA 3KEQA 3LA7A 2JA2A 4I09A 3TL4X 3ERED 1VQ6I 1UG0A 3BTCA 3Q9SA 1XPXA 4XKBA 2VKVA 2LR8A 2HNHA 2Y0MA 2MFZA 3K70D 1J7KA 2CYYA 4L18B 4A3FJ 4Y7NJ 5F27A 1YOVB 4M9ZA 4FETA 4PDKA 2VQHA 5EG0A 4GCVA 1PDNC 4HDVA 2L4AA 4Q47A 3VEPA 1HOMA 4KJZA 1SFXA 3ZQQA 3HTSB 1Y39A 2OZ6A 3I59B 4EJOA 2CQNA 1MNMC 3PL8A 3GO5A 2QBYB 2KL4A 2QQBA 4G94A 1A6IA 2Y0SN 2AXTC 2EB7A 2OCCH 2ZJQF 5E3LA 2LNBA 1IRXA 4EM2A 2DK5A 2YU3A 1FEXA 3U2RA 4D9JA 1V4RA 2L7ZA 2LDUA 1UHWA 4BKXA 4QTRA 1QU3A 4BQAA 1FOKA 1RUOA 1B72A 3IP4B 2JA5J 3B6CA 1JGSA 3CP2A 4XRMA 3Q0UA 3CCUI 1Z77A 3M3YJ 5C4XJ 2UWMA 4LG0B 4D5CA 2QLZA 4Y52J 4YIRX 3CO7C 2R7WA 4EVIA 3BQYA 4ITVA 2MG4A 4A0XA 1MDMB 3JRDA 3DP7A 2QM3A 1IN8A 2KFDA 3OYFA 3WG7H 5GTIC 4LG0A 3H3VK 2V9VA 3H3ZA 3GFJA 3S14J 4AYBN 3OYKA 2MABA 3DWLE 3HRMA 1ZKGA 3SJMA 1TL8A 5TRDA 4HQEA 3RKYA 3GX4X 3ML6A 1FYLA 3NARA 5E3NA 2WY7Q 2XASA 4XLAA 1JHHA 4MTEA 1TNSA 2FE3A 2VONA 1JKPC 2PJRA 2LF7A 1TWAJ 1WSUA 2D5VA 2JA6J 4AYBA 1GVDA 2XC7A 4HBLA 2DPDA 4ZDOA 1S7OA 2ICWG 2IA0A 3UKGA 1B4AA 2O7OA 2XRLA 2WWYA 3CMYA 3BOQA 3RTRA 1ETOA 1PUEE 1VNDA 3P5JA 1A04A 4NBQA 5K7HA 2FX0A 3T8TA 2X1DA 4EJVA 5IP7J 3OOPA 2KDZA 1HSTA 1TT0A 2HTJA 3B6AA 3FXJA 5D4RA 2ADUA 2LF8A 1XCVA 2H94A 2RQQA 4XIDA 2DLLA 1D5VA 3GWZA 2FOKA 3IAM2 3X2QH 2X9DA 4ENNA 5B3SH 4OIOF 1V54H 1MMAA 1V5GA 1MGTA 3FMRA 1G2HA 2B9SA 3RPQA 3A01B 3K2ZA 3VSKA 2PI0A 3OSGA 3ASOH 1BBYA 1ZAOA 2JN6A 4U0WA 4EJTA 2VXDA 3RZOJ 3BZCA 1A5JA 2VJIA 2PJPA 5IY5H 4U87A 2KISA 2X51A 4ENJA 1IN4A 3PUFA 2EK5A 4M3GA 2DN0A 2W4SA 3FXOA 2UXXA 1EJ9A 3OIPA 2E2IJ 3KP2A 3MCZA 1YFHA 1I1SA 2RC4A 3ISPA 2A6EF 2VBYA 5H20A 3LSHA 4FE7A 4TV7A 2Z1DA 1V3FA 4AVPA 3LAPA 4LLNA 1HW2A 1WJCA 2EH3A 3OV8A 3RQIA 2NOGA 2R92J 2BOLA 3Q0VA 2LBFA 4MQ9F 2DA2A 3BT9A 5JHFA 2ZMEB 3KZIC 1OMIA 1QA6A 5HLIA 3H5RA 3JRIA 1IG7A 3JSOA 2XKPA 2DI3A 1X58A 2FNAA 2IS2A 3ASNH 4UVBA 2I10A 2ISYA 2KIQA 1TNTA 4LK0F 3IH3A 1OCOH 2BY0A 3JRBA 1YIOA 2BVLA 2XGXA 1DGRM 2NNNA 3D5RC 2JRTA 1W5CC 2FSWA 4FASD 1FSHA 5DTDA 4AC0A 4F91B 2DMTA 2O0YA 2PBIA 3V4GA 5ICCA 3A0HC 2IAIA 2O3FA 3NQOA 2ZXHA 3U1DA 2PJRB 3H92A 2L7MP 1KU3A 4A3BJ 2K7LA 2RVCA 1AHDP 1WJDA 1IF1A 2LK2A 3TQNA 3IL2A 3OR2C 4UV9A 3JRAA 4HDUA 3BTIA 3IHUA 5IYCJ 5HVQC 1S8NA 5EF6A 4G6QA 2XSDC 4WCGA 4NHJA 2WAQN 2K4JA 4Y15A 1RR8C 4G6TB 2A5YB 3G1LA 1ETYA 1LQ1A 2HXIA 2E1NA 2Q2EB 1H88C 4F93B 3LSJA 4PJNA 3A4CA 2NNYA 5HOOA 2K9QA 2HS5A 1IRZA 1V5EA 4Q4ZF 1VQPI 4BAYA 4CDGA 2CSOA 1ORKA 4PJ0C 1Z1DA 4IHVA 2UV1A 3F3XA 5FLVA 1ZYRF 2DT6A 2V4JC 1QBJA 2XAUA 3F6OA 1D8KA 1B72B 3LQQA 3HXLA 4XMYA 1LDJA 4RDUA 4E7SA 2UXNA 4UHTA 2DFFA 2DTZA 2M9HA 4NC7A 2A5WA 2XAGA 2O6GE 2VE9A 4N9HA 1FPQA 3TBIA 1USSA 1T56A 4GFBA 3CCSI 4ASNA 1UB9A 2RNJA 3PQKA 5HNFA 4IPAA 2H8RA 3BJAA 4RAYA 1Y6IA 3SDBA 1MBJA 4ZZLA 3N97A 3CUQA 3E6CC 3EUHC 3Q9VA 3GMEA 3KP5A 1JHFA 1TBXA 2DMNA 4RLFA 1D3YA 5BS6A 4I76A 1ENHA 5FLMJ 4UB6C 3MZ8A 2GIVA 2VOPA 3VDXA 3VYUB 2LKPA 3F8FA 1RIOH 4ON0A 3ZR8X 3QPSA 3M1EA 3K9TA 2QWWA 3HOTA 4KN4X 1JT6A 3FDYA 4A3JJ 4V2GA 5H2FC 3OWTA 3ZMSA 3E1SA 4AU7A 2DU9A 2VIXA 4BBRJ 5D5VB 1W0UA 2QBYA 2N8GA 1TW2A 3I58A 3JAMZ 1IXRC 4ZC3A 3WHBA 2EIKH 2EV5A 1PUFB 5K1YA 4R8HA 5IP9J 3E5UA 4DYRA 3HRSA 3S8PA 1GXPA 1TQMA 1I5ZA 5GAHJ 2W82A 4XONA 1D1AA 5BQTA 2QSGX 3J7AO 4IHSA 2Y75A 3J7YJ 4B43A 4ZDLA 5LEKA 5D8LB 2M45A 2EJRA 3CO6C 4KA4A 3JRFA 4S0HB 2V6EA 4QPQA 3ABTA 2FMYA 1FC3A 4V19K 2HQAA 2CW8A 3SFZA 4AIHA 2GQQA 2QYOA 1OCCH 2Z16A 2ESNA 3LAJA 3W6JB 2PMUA 4B47A 1QO0D 1B9MA 3JW4A 1VI0A 3HSRA 2F6CA 5FRNA 2YX4A 3MZHA 5CKTA 3M1CA 5BPDA 4WXCA 5L3EA 4XKWA 4Z2YA 1YRNA 3OY9A 1MKMA 3IAS2 1XG1A 4M73A 3H5AA 4M6XA 4FX4A 2Y9ZA 1X19A 2F48A 4I01A 3CCLI 2XF6A 4P9UA 2JA8J 1PUFA 1U5TB 4A0ZA 2GAUA 3VFZA 1L0OC 2F4IA 3DPLC 3F23A 2Q0OA 1HF0A 2EFOA 2MH2A 4QSHA 3CF5F 4FCYA 3DF8A 4YFXF 3FMQA 3S3NA 1TQPA 1D0XA 2IS6A 4FX0A 5HODA 2BY2A 1FOYA 2XHKA 4JK1X 4IHXA 2JWTA 2AXLA 4J01A 4NC6A 4AIKA 5E8IA 1BI1A 1IZ1A 2ZKZA 3F22A 1USTA 3BP8A 4IHYA 2MBFA 5IP6A 4XRFA 3M8JA 2GBYA 1H89C 3OMYA 5LGUA 3OYGA 3DKXA 1JTYA 5B5EC 4WXHA 3HDDA 1X1BA 3KYCB 2KJCA 3E7LA 2C6YA 1HDPA 3OR1C 3NWSA 4PJLA 2K86A 1WKMA 3DPTA 5M5XJ 3S1NJ 3PIOF 2LTPA 3FM3A 2K4BA 2NS7A 5JVTA 4A3GJ 2XGDA 2DOAA 5AIPA 2JUGA 2VN2A 1LKXA 1RI7A 2VL8A 3CESA 3GZ6A 2CV0A 1IN6A 3KCCA 4IOCF 5J4YA 1MBEA 2WAEA 2X6XA 3L2RA 1MMDA 2IA1A 2KZGA 4XICA 5ICGA 1GHCA 1OR7C 4IEJA 4ETSA 3AG2H 2JA7J 2VLAA 4MFDA 1KYZA 2HVQA 2YUSA 4L9VA 1WH7A 5JVGF 1GXQA 2NS0A 1UHMA 1IN7A 4I7HA 2CV1A 4IQJA 4EJUA 1ETQA 1MH4A 3RCOA 1OJLA 1NK2P 1OLTA 4BGDA 1LUJB 2STWA 4EGYA 3VYTB 3PNTA 4N4OB 1APLC 1B1BA 2ZNYA 1EH6A 2BYVE 4A6DA 3BR6A 3OYIA 1RC9A 3U1KA 2V9PA 2L54A 4E7IA 1SFEA 2EFNA 4BXUA 3IWZA 3L1PA 1S5LC 2BZTA 2F5CA 3GTGJ 2KZVA 1R4NB 2O03A 3DQVC 5CYVA 2DPUA 3P9KA 3E5XA 4J19A 2B63J 4NQWA 1HQCA 4BACA 2RNGA 4CXFA 1S29A 1R23A 2CRGA 3WE3A 2V1XA 3ZRGA 3EQLF 4QLCU 3J80Z 1BI0A 3F8NA 4PZJA 2LMDA 4AWXB 2IJLA 4IKFA 2DYRH 1BR2A 4IZZA 2XPWA 2ZJRF 1IUYA 4AM3A 3ZMTA 4DOZA 2CWEA 5JLXA 1KQ9A 4PCQA 4E7KA 3DTKA 2BXZA 3W2WA 4O6JA 3DU6A 5KHDA 3PNYA 3E5QA 2DMPA 3FBNB 5J8CA 4KISA 3RIRA 5E8GA 3KP6A 2JK3A 3MKYB 3A0BC 1POGA 3CD6I 1SD6A 3GTKJ 1PP8F 4BQQA 4XOPA 1MMGA 5DV5A 1JT0A 2HEOA 3T0YA 2VQLA 3EYYA 4HAMA 3FK7A 3FM5A 1RUNA 4BL0B 3BWGA 5H6QA 2PMZN 1BI2A 3FHNA 1TTYA 3GVAA 2H6BA 1SAXA 3IH2A 4XKVA 1FLIA 5FKLA 1Q1HA 3SZGA 1I3AA 4E70A 4YG2F 3GZ5A 3BZKA 4II2A 2EZHA 3BJOA 3L09A 3KEYA 4HEA2 1G3TA 1FJLA 3HRTA 2DBBA 3GTLJ 4PSXA 2E36A 4RGUA 4UVCA 1QZYA 4MQVA 3WHCA 4H0EA 2LY1A 1U2WA 3PFYA 3MMYB 4U0VA 2BE5F 2DT7B 1WWXA 5CQGA 4LFUA 3CCRI 3M07A 3TP0A 1Y0NA 5IYDJ 1ACIA 2P5VA 3FKIJ 1VQ9I 2Y30A 2KRHA 4BYYA 3GLLA 3HTUA 3KX2A 3S2WA 1LPQA 4HSTA 4GXOA 4GYIA 4BDYA 4FTHA 1QPIA 1P4AA 2L9SA 3SQNA 4JP0A 2OBPA 1KGSA 1NG7A 1RRJA 2GA2A 1B8IB 1W7PA 4KITB 3ABKH 5F08A 1Z91A 3ZQIA 3IRRA 1FMWA 4CICA 4DYCA 1N25A 5K5OA 3OS0A 3AKZA 1CF7A 2BVMA 2QQ8A 1JGGA 3G1OA 3F0CA 5HS8A 3S17J 1S6LA 2FQ4A 2K3FA 1XGMA 4FE4A 3HOYJ 1X4OA 4OMZA 3CF2A 1ZRDA 1BI3A 4ZYAA 2K40A 1MNEA 4ESJA 2M7BA 1ZLKA 1ZELA 2PEXA 5J47A 3TP3A 5LGTA 3BLYA 5DM7F 1XMXA 2QVOA 2P7CB 1P7IA 4XKCA 3QP6A 3BR1A 3JRHA 1HBXG 1ZRFA 4LG3A 5FFXA 4G12A 4HW0A 1GV2A 2NVTJ 4AIDA 2M87A 1MBFA 1WPKA 3NRVA 3DLLF 2FQ3A 3LMMA 1OYIA 3L00A 3E6DA 1SVLA 4E7ZA 4OAYA
chains in the Genus database with same CATH topology
2IP2A 4Q48A 1WQ2A 1ZN2A 4BNCA 3B73A 2PQ8A 4P96A 2ZBKA 3RJPA 3TO7A 5DEQA 3KE2A 2H09A 3FF5A 5FB2A 4ESBA 2O61A 3KP7A 5E1ZB 3DFGA 1G6NA 1STZA 2W84A 4OIPF 1DPRA 1WRJA 1P2FA 4U0YA 1R5GA 2JTVA 1J2XA 2VBZA 3J81Z 1XN7A 3L2CA 3IRQA 2DAOA 1H9TA 4WXDA 4I2OA 1ZARA 3BDDA 3J80K 4G7HF 1SD7A 1K78A 4ENMA 2VE8A 2EV6A 3BROA 2XAJA 4DNCA 2D45A 3W6KB 3T1BA 1ZLJA 3V7CA 4KYWA 5F1RA 4KIGA 2HGCA 5CVIA 2F5EA 1MJBA 3H3UA 1O3RA 2A3SA 2RGVA 3MFKA 4HV5A 3ZPLA 1W4MA 4EV0A 2WTEA 4M9SA 1P4WA 1KA8A 2EV0A 1YS7A 3M9AA 5AONA 2CW0F 2F5FA 2ZCWA 3GEZA 3C1DA 1L3LA 3C7JA 2OA4A 2XAFA 2VOOA 4KDPA 1T98A 2Z3YA 4CZZA 2A69F 1ZH5A 4L5IA 2GXGA 2RN7A 3K1MA 1BM9A 4AIJA 2STTA 3O6BB 3SZTA 3RKWA 2FEZA 1YS6A 1B6AA 3GYHX 2HQRA 2WC2A 4HF0A 3I59A 1G3YA 1S7AA 3ECHA 2Z5UA 4P55A 1XDUA 1X3UA 4O5VA 3E97A 4S05A 3RDIA 2HWVA 1R7JA 2VC1A 4I0AA 3V8JA 3SHFA 4UUVA 1IXSB 3HSEA 3RYRA 2A61A 1IN5A 4RB1A 3RI4A 4G8XA 4G6DA 5D4SA 4U88A 1J0RA 4RGRA 4XSXF 3GFLA 4KNYA 4FHTA 2HTSA 2GA1A 3R4KA 4CO8A 4HX8A 4B8XA 2J5PA 2FMLA 1IXCA 2W24A 2PLYA 4EGZA 3GUDA 3T8RA 5F64A 4L9NA 3F6VA 3AAFA 3WTWC 2QUFA 4HYEA 2RQPA 2IT0A 4DQ2A 5DD4A 3I5UA 3K1NA 4K2EA 2VT3A 3TOAA 3GW2A 3GXOA 3LA3A 1O7LA 4OIQF 3LWFA 5IT9Z 3TDUC 3PQJA 5CJ9A 2MLGA 1FNNA 3FWEA 3TKYA 1FYMA 4ESFA 3BPVA 5FGMA 5CLSA 5ED4A 1HXDA 4L9JA 5E17F 1TW3A 2EFWA 2WV0A 5IT3A 1Y0UA 3MQ0A 4L0ZB 3RKXA 5LHIA 4PGHA 4QWQA 3M8FA 3R0JA 4KMUX 2GWRA 5HDKA 1NHAA 5FD6A 5LHGA 2K27A 1O3QA 4OU0A 1QZZA 5DCMA 4ZYDA 2D2WA 1FBQA 1Z6RA 2P7VB 4BHBA 1HKQA 1KQ8A 4CYDA 3FX3A 4ENKA 3WGHA 1QGPA 2EA4A 2YX7A 4IHTA 2P8TA 5LHHA 1ZGAA 1ULYA 4A2UA 1FZPB 2V1DA 1XGNA 1SFUA 4HV6A 1J59A 1W5TA 3K69A 2KIUA 2B0LA 1E2XA 1BC7C 5DUIA 4EQQA 4S04A 4GYGA 4RB0A 2RDPA 2ACJA 3O2PE 2QQAA 1DUXC 1RZ4A 4EM1A 2OQRA 1KU2A 3E6BA 1BC8C 2E7XA 2KRFA 4IJAA 4HZFA 2MH9A 1ZREA 3K1PA 5J6XA 5L3FA 1YG2A 1HKSA 4BHPA 1MJAA 1XSDA 2YSRA 3G73A 5KK1A 1WI9A 1HW5A 2IRFG 2R3SA 3F8MA 1C0WA 2EWNA 1XDSA 3C3WA 4R1HA 3FHZA 3F72A 1B9NA 3L7WA 4M71A 4O3MA 5E18F 3M7GA 4G9YA 3KP3A 4LJZF 2F5DA 1YO5C 5DDGA 3NEUA 2IVMA 3I0TA 1O3SA 3K0LA 4WF2A 5BPIA 1R00A 3I54A 2HFHA 4JQFA 4XSZF 5JI6A 5ICFA 2FBKA 1HKTA 3HOSA 3T5XA 1U6GA 2D1VA 1AWCA 1LB2A 3IWFA 4M72A 3JTGA 1I27A 1R1VA 1LEAA 3IKVA 1G3WA 5DCMB 2MLKA 1TLHB 4AD9A 2K02A 2KKOA 3KP4A 4KT5C 4A5MA 3IC7A 3TGNA 1Z6TA 2JPBA 2BGCA 3WU0A 2A68F 3LFKA 3QP5A 4MEXF 1HSJA 5HS7A 1K7AA 2IPQX 1B59A 2PMHA 2VBWA 2HYGD 4L9TA 2KIFA 4RB3C 3ECOA 3V8KA 5FLXZ 3ZP5A 1QNTA 1W7PD 1OPCA 2FXAA 4XLPF 4EMSA 4A5NA 3P7NA 1LDKB 4HF1A 2JSCA 3I64A 5LRRA 5EEHA 1XSVA 2E7WA 1SMYF 4YIIA 4MNUA 3HSFA 2XROA 4LB5A 1O7FA 1TQIA 5HS9A 3QU3A 2ETHA 2CQKA 3WU1B 4IRHA 2G7HA 3SXYA 4HX4A 4YFNF 3BZ6A 5IT9K 2DO7A 3GFMA 3PFIA 4RS8A 1IW7F 2Y48A 2ZJ2A 2JZYA 2M8EA 3DXJF 5L3CA 3WTSC 1EH7A 2CFXA 4HX7A 4ZYGA 3P9CA 5HDNA 2G7UA 2ZO4A 1ODDA 3B02A 2XVCA 3G3ZA 2PG4A 3QRFF 3KZYA 3JTHA 2IA2A 5D5UB 1LVAA 2NAZA 1QQIA 2Q2EA 1GVJA 1JE8A 3V7RA 3D0SA 3VODA 2DFIA 5ERIA 5FO5A 1ZG3A 3CJNA 2RKHA 2ZXJA 4A12A 2XAQA 2UZKA 2HR3A 4IVNA 1IRFA 2EFPA 1FBSA 5HLGA 4ZYEA 5CVVA 3TO6A 5D6EA 1T0FA 3J81K 1I6XA 4Q5SF 2AS5F 3R0AA 4PGGA 2OAZA 3E6MA 1XB4A 2W85A 2BEOA 4KFCA 1XD7A 2OU2A 1FYKA 1FWZA 4KN7X 2O8XA 2Z33A 1U5TC 4OINF 3KEOA 1DPUA 4UV8A 4D0PA 3CUOA 4JBAA 4G7OF 3RYPA 3KLOA 2LSOA 4OOIA 4Y13A 5K5RA 1FP1D 1UFMA 4CGZA 1P4XA 3M8EA 2ESHA 1YW8A 2L4MA 1R22A 2PN6A 2M30A 2KJBA 4HQMA 3ZMDA 3ROUA 4LK1F 1T39A 1IRGA 3ZQ7A 3I53A 1BIAA 2V79A 2DQLA 1T6SA 3N4MA 2FA5A 3MAJA 3CUQB 3HYIA 5J8FA 2JPCA 3HHHA 3CUQC 1BOAA 4RAZA 5TJJA 1K79A 2CG4A 4YFKF 2OQGA 1SD4A 5E20A 3KLNA 1BJAA 5A2QZ 4FT8A 5FD5A 2XV4S 5ILVA 4IXAA 1O3TA 4B09A 2XRNA 1MDMA 1SMTA 3SZPA 1F9NA 1JXSA 1LEBA 4GGGA 1H0MA 1P6RA 1KQ0A 4IRGA 4IF4A 4OIRF 2IW5A 2VT2A 5E1XA 1EH8A 4HOBA 4A0YA 5BOXA 2R7DA 5HLHA 5ILUA 1KU9A 3IKTA 3FZVA 2ISZA 4KIBA 1F4KA 2CGPA 3EYIA 4EJWA 1XMKA 4KICA 5LRSA 3MZYA 2GXBA 2DTRA 3ABUA 1UCRA 3VOEA 3WGIA 1I1GA 1PP7U 4OMYA 1R1TA 5L3GA 3F8CA 2Q8KA 5JR3A 2BBYA 2P5LC 2TDXA 4HF2A 4BH9A 1XCBA 5LLQA 3FXQA 1W7PB 3O3KA 4ZH4F 1HW1A 2JT1A 5FFZA 1ON1A 2HZTA 2MC3A 1J5YA 4HLYA 3KZZA 3HRUA 1D8JA 1IAWA 1CF7B 1T2KA 1KYWA 2GZWA 4UXNA 1G3SA 5L3DA 1Z9CA 2NYXA 1BN5A 3V7SA 2VODA 4UNOA 1J9IA 1Z05A 5E1WA 1H9GA 4U7BA 1DDNA 1R5HA 2HOEA 3ZMVA 3MWMA 1OYWA 1YYVA 4IRIA 5D5WB 5H6RA 3WTVC 4KUMA 2L3DA 3EETA 4HLXA 1K6OA 4LD5A 4LB6B 3RPUA 3I4PA 1FSEA 5DD8A 1MZBA 4MTDA 1SD5A 3KETA 3HIFA 5D6FA 2A6HF 4MEYF 1OKRA 3R60A 4LLGF 2H27A 3HHGA 3ZMZA 5A2QK 4MGRA 3KFWX 2DQRA 4WX9A 3TO9A 2D1HA 4L0YB 3ZMUA 1XGOA 2V6CA 4UVAA 1XMAA 3I71A 1VTNC 3C18A 2COMA 2OZUA 5DYMA 3WE2A 1ZG5A 4KMFA 4XLNF 3R6SA 2QQ9A 1P92A 3P9IA 5CVJA 4XBFA 1Z7UA 1OR7A 2MD5A 2PFBA 4F7ZA 3QPHA 1CGPA 3WTYC 3EDPA 1XSXA 2FU4A 2P6SA 2VXZA 3E3VA 3ELKA 3QAHA 2HKXA 3VB2A 2E1CA 2NRAC 1BIBA 5FLXK 1OYYA 4CHUA 4M6YA 4ZZDA 1FY7A 4WWCA 2EA2A 2L01A 4BHCA 5EEGA 3TDZC 4EM0B 3ZN0A 1O57A 2YPRA 5K5QA 2YR2A 2G9WA 4Y17A 1R58A 1R36A 2DW4A 3BY6A 3QU6A 3CTAA 4LMYA 2OD5A 2XAHA 2J5OA 3DEUA 3REOA 1U5TA 1U8RA 2FBHA 2FRHA 3WGGA 1ONVA 1K78B 1ZHFA 4U7DA 4I02A 2DK8A 3ZN1A 3FXRA 2FBIA 1AOYA 2P5KA 3HUGA 5HDGA 5BMZA 2W57A 2HQNA 3WTZA 2P6TA 5LEJA 3JAMK 2P4WA 2XUBA 4ZYHA 3MEXA 3WODF 1ZRCA 5DUKA 1F1ZA 4M74A 4WK8F 1YQAA 4I0BA 2W25A 5D5XB 4YIFA 4G7ZF 4I98B 5AIQA 3LA2A 3FXUA 3WTXC 1FP2A 3D5LA 3CDHA 4KIFA 1S3JA 1U78A 4LGWA 3L9FA 5F6FA 3WG9A 1E17A 4P5OA 3R61A 3F8BA 1J75A 2EFQA 2Z9OA 1LJ9A 3QPTA 2BV6A 5LBQA 4R79A 1YTYA 3LQRA 3GFIA 1MD0A 1EV7A 2VBXA 4N9IA 3COAC 3FMSA 4LLLA 2V1UA 3JSPA 2KIMA 1FX7A 4GO1A 2HYFA 3ULQB 1DP7P 2X4HA 4A6EA 5CVRA 1G4DA 2HDCA 2F2EA 3V8LA 2ZNZA 4L5JA 1ZGJA 2QZ8A 4RB2C 2M5WA 3DKWA 1YW9A 3BJ6A 2H6CA 1U3EM 1FBUA 2FF4A 2XIGA 2ELHA 1LNWA 2RV8A 1YLFA 3WTUC 2HKOA 1LDDA 4P9FA 2A07F 1R1UA 3BPXA 5KVRA 1RNLA 3WTTC 3U9GA 3TOBA 1MJ9A 6PAXA 5DCFA 2X0LA 4RGXA 5D8KB 1XGSA 4NB5A 2MA3A 3DV8A 2XKOA 3LSTA 1QPMA 5ICEA 1ON2A 1FT9A 2QENA 2ZFWA 2L02A 3GLXA 3F21A 1REPC 4MHGA 5JFRA 4RGSA 4N0BA 3Q5FA 2CO5A 2FNPA 2DT5A 1YW7A 2M1BA 1ZG1A 3EUHA 4HA8A 4M9XA 2R7FA 2Z99A 2ZMEA 3CLOA 3GF2A 5CVUA 1W5SA 5JHUA 1KU7A 5L3BA 1F5TA 5LGNA 3QOPA 5ILSA 2VC0A 1T38A 3LA7A 3KEQA 4I09A 3ERED 3Q9SA 2Y0MA 1J7KA 2CYYA 4L18B 4M9ZA 4PDKA 4GCVA 1PDNC 4HDVA 2L4AA 4Q47A 3VEPA 1SFXA 3HTSB 2OZ6A 3I59B 4EJOA 3GO5A 2QBYB 2QQBA 4G94A 2EB7A 2LNBA 4EM2A 2DK5A 2YU3A 3U2RA 1V4RA 2LDUA 1UHWA 4BQAA 1FOKA 1RUOA 1JGSA 2UWMA 4LG0B 2QLZA 3CO7C 4EVIA 4A0XA 1MDMB 3DP7A 2QM3A 1IN8A 4LG0A 2V9VA 3H3ZA 3GFJA 3HRMA 5TRDA 4HQEA 3RKYA 3GX4X 3ML6A 1FYLA 2XASA 1JHHA 4MTEA 1TNSA 2FE3A 2VONA 2LF7A 1WSUA 4HBLA 2DPDA 1S7OA 2IA0A 1B4AA 2WWYA 3BOQA 3RTRA 1PUEE 1A04A 3T8TA 4EJVA 3OOPA 1HSTA 2HTJA 5D4RA 2ADUA 2LF8A 1XCVA 2H94A 2DLLA 1D5VA 3GWZA 4ENNA 2FOKA 4OIOF 1MGTA 3FMRA 3RPQA 3K2ZA 2PI0A 1BBYA 1ZAOA 4U0WA 4EJTA 2PJPA 4ENJA 1IN4A 2EK5A 2UXXA 3KP2A 3MCZA 1YFHA 1I1SA 2RC4A 3ISPA 2A6EF 2VBYA 5H20A 4TV7A 3LAPA 1V3FA 4AVPA 4LLNA 1HW2A 3OV8A 4MQ9F 2ZMEB 1OMIA 5HLIA 3JSOA 2XKPA 2DI3A 2FNAA 4UVBA 2ISYA 1TNTA 4LK0F 1YIOA 2XGXA 2NNNA 2JRTA 2FSWA 1FSHA 2O0YA 2PBIA 3V4GA 5ICCA 2O3FA 3NQOA 3U1DA 3H92A 1KU3A 2K7LA 2RVCA 1IF1A 3TQNA 3IL2A 4UV9A 4HDUA 3IHUA 5HVQC 1S8NA 4G6QA 4WCGA 4NHJA 2K4JA 4Y15A 2A5YB 1LQ1A 2E1NA 2NNYA 5HOOA 2HS5A 4Q4ZF 4BAYA 4CDGA 2CSOA 1Z1DA 3F3XA 1ZYRF 1QBJA 3F6OA 1D8KA 3LQQA 1LDJA 2UXNA 4UHTA 2XAGA 2O6GE 2VE9A 4N9HA 1FPQA 1USSA 4ASNA 1UB9A 2RNJA 3PQKA 4IPAA 3BJAA 4RAYA 4ZZLA 3N97A 3CUQA 3E6CC 3Q9VA 3KP5A 1JHFA 1TBXA 1D3YA 5BS6A 2GIVA 2VOPA 2LKPA 3F8FA 1RIOH 4ON0A 3M1EA 3K9TA 2QWWA 3HOTA 4KN4X 3ZMSA 2DU9A 5D5VB 2QBYA 3JAMZ 1TW2A 3I58A 1IXRC 2EV5A 5K1YA 4R8HA 3E5UA 3HRSA 1GXPA 1TQMA 1I5ZA 5BQTA 3J7AO 4IHSA 2Y75A 5LEKA 5D8LB 2M45A 2EJRA 3CO6C 4KA4A 3ABTA 2FMYA 1FC3A 3SFZA 4AIHA 2GQQA 2QYOA 2ESNA 3LAJA 3W6JB 2PMUA 1QO0D 1B9MA 3JW4A 3HSRA 2YX4A 3MZHA 5BPDA 4WXCA 5L3EA 4Z2YA 1MKMA 4M73A 4M6XA 4FX4A 4I01A 4P9UA 1U5TB 4A0ZA 2GAUA 3VFZA 1L0OC 3DPLC 3F23A 2Q0OA 2EFOA 2MH2A 3DF8A 4YFXF 3FMQA 1TQPA 4FX0A 2XHKA 4JK1X 2AXLA 4AIKA 5E8IA 1BI1A 1IZ1A 2ZKZA 3F22A 1USTA 3BP8A 2MBFA 4XRFA 5LGUA 4WXHA 2KJCA 2C6YA 2K86A 1WKMA 3DPTA 3FM3A 2K4BA 5JVTA 5AIPA 2VN2A 1RI7A 3GZ6A 1IN6A 3KCCA 2IA1A 5ICGA 1GHCA 4ETSA 1KYZA 4L9VA 1GXQA 2NS0A 1UHMA 1IN7A 4I7HA 4EJUA 2STWA 4EGYA 1B1BA 2ZNYA 1EH6A 2BYVE 4A6DA 2L54A 1SFEA 2EFNA 4BXUA 3IWZA 2F5CA 2O03A 3DQVC 5CYVA 2DPUA 3P9KA 3E5XA 4NQWA 1HQCA 4CXFA 1S29A 1R23A 3WE3A 2V1XA 3EQLF 4QLCU 3J80Z 1BI0A 3F8NA 4PZJA 4AWXB 2IJLA 1IUYA 3ZMTA 2CWEA 1KQ9A 4PCQA 4O6JA 3E5QA 5J8CA 3RIRA 5E8GA 3KP6A 1SD6A 1PP8F 2HEOA 5DV5A 3T0YA 3EYYA 4HAMA 3FM5A 1RUNA 3BWGA 5H6QA 1BI2A 1TTYA 3GVAA 2H6BA 1SAXA 1FLIA 1Q1HA 4E70A 4YG2F 3GZ5A 3BJOA 3L09A 1G3TA 3HRTA 2DBBA 4RGUA 4UVCA 1QZYA 4MQVA 4H0EA 1U2WA 4U0VA 2BE5F 1WWXA 4LFUA 2P5VA 4BYYA 3HTUA 3S2WA 4GXOA 4GYIA 1P4AA 3SQNA 2OBPA 1KGSA 2GA2A 1W7PA 1Z91A 3IRRA 1CF7A 4CICA 5K5OA 5HS8A 1S6LA 1XGMA 4OMZA 1ZRDA 1BI3A 4ESJA 1ZLKA 2PEXA 5LGTA 2QVOA 2P7CB 3QP6A 1HBXG 1ZRFA 5FFXA 4HW0A 2M87A 3NRVA 2FQ3A 1OYIA 3L00A 3E6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IP2 A;  4Q48 A;  1WQ2 A;  1ZN2 A;  4BNC A;  3B73 A;  2PQ8 A;  4P96 A;  2ZBK A;  3RJP A;  3TO7 A;  5DEQ A;  3KE2 A;  2H09 A;  3FF5 A;  5FB2 A;  4ESB A;  2O61 A;  3KP7 A;  5E1Z B;  3DFG A;  1G6N A;  1STZ A;  2W84 A;  4OIP F;  1DPR A;  1WRJ A;  1P2F A;  4U0Y A;  1R5G A;  2JTV A;  1J2X A;  2VBZ A;  3J81 Z;  1XN7 A;  3L2C A;  3IRQ A;  2DAO A;  1H9T A;  4WXD A;  4I2O A;  1ZAR A;  3BDD A;  3J80 K;  4G7H F;  1SD7 A;  1K78 A;  4ENM A;  2VE8 A;  2EV6 A;  3BRO A;  2XAJ A;  4DNC A;  2D45 A;  3W6K B;  3T1B A;  1ZLJ A;  3V7C A;  4KYW A;  5F1R A;  4KIG A;  2HGC A;  5CVI A;  2F5E A;  1MJB A;  3H3U A;  1O3R A;  2A3S A;  2RGV A;  3MFK A;  4HV5 A;  3ZPL A;  1W4M A;  4EV0 A;  2WTE A;  4M9S A;  1P4W A;  1KA8 A;  2EV0 A;  1YS7 A;  3M9A A;  5AON A;  2CW0 F;  2F5F A;  2ZCW A;  3GEZ A;  3C1D A;  1L3L A;  3C7J A;  2OA4 A;  2XAF A;  2VOO A;  4KDP A;  1T98 A;  2Z3Y A;  4CZZ A;  2A69 F;  1ZH5 A;  4L5I A;  2GXG A;  2RN7 A;  3K1M A;  1BM9 A;  4AIJ A;  2STT A;  3O6B B;  3SZT A;  3RKW A;  2FEZ A;  1YS6 A;  1B6A A;  3GYH X;  2HQR A;  2WC2 A;  4HF0 A;  3I59 A;  1G3Y A;  1S7A A;  3ECH A;  2Z5U A;  4P55 A;  1XDU A;  1X3U A;  4O5V A;  3E97 A;  4S05 A;  3RDI A;  2HWV A;  1R7J A;  2VC1 A;  4I0A A;  3V8J A;  3SHF A;  4UUV A;  1IXS B;  3HSE A;  3RYR A;  2A61 A;  1IN5 A;  4RB1 A;  3RI4 A;  4G8X A;  4G6D A;  5D4S A;  4U88 A;  1J0R A;  4RGR A;  4XSX F;  3GFL A;  4KNY A;  4FHT A;  2HTS A;  2GA1 A;  3R4K A;  4CO8 A;  4HX8 A;  4B8X A;  2J5P A;  2FML A;  1IXC A;  2W24 A;  2PLY A;  4EGZ A;  3GUD A;  3T8R A;  5F64 A;  4L9N A;  3F6V A;  3AAF A;  3WTW C;  2QUF A;  4HYE A;  2RQP A;  2IT0 A;  4DQ2 A;  5DD4 A;  3I5U A;  3K1N A;  4K2E A;  2VT3 A;  3TOA A;  3GW2 A;  3GXO A;  3LA3 A;  1O7L A;  4OIQ F;  3LWF A;  5IT9 Z;  3TDU C;  3PQJ A;  5CJ9 A;  2MLG A;  1FNN A;  3FWE A;  3TKY A;  1FYM A;  4ESF A;  3BPV A;  5FGM A;  5CLS A;  5ED4 A;  1HXD A;  4L9J A;  5E17 F;  1TW3 A;  2EFW A;  2WV0 A;  5IT3 A;  1Y0U A;  3MQ0 A;  4L0Z B;  3RKX A;  5LHI A;  4PGH A;  4QWQ A;  3M8F A;  3R0J A;  4KMU X;  2GWR A;  5HDK A;  1NHA A;  5FD6 A;  5LHG A;  2K27 A;  1O3Q A;  4OU0 A;  1QZZ A;  5DCM A;  4ZYD A;  2D2W A;  1FBQ A;  1Z6R A;  2P7V B;  4BHB A;  1HKQ A;  1KQ8 A;  4CYD A;  3FX3 A;  4ENK A;  3WGH A;  1QGP A;  2EA4 A;  2YX7 A;  4IHT A;  2P8T A;  5LHH A;  1ZGA A;  1ULY A;  4A2U A;  1FZP B;  2V1D A;  1XGN A;  1SFU A;  4HV6 A;  1J59 A;  1W5T A;  3K69 A;  2KIU A;  2B0L A;  1E2X A;  1BC7 C;  5DUI A;  4EQQ A;  4S04 A;  4GYG A;  4RB0 A;  2RDP A;  2ACJ A;  3O2P E;  2QQA A;  1DUX C;  1RZ4 A;  4EM1 A;  2OQR A;  1KU2 A;  3E6B A;  1BC8 C;  2E7X A;  2KRF A;  4IJA A;  4HZF A;  2MH9 A;  1ZRE A;  3K1P A;  5J6X A;  5L3F A;  1YG2 A;  1HKS A;  4BHP A;  1MJA A;  1XSD A;  2YSR A;  3G73 A;  5KK1 A;  1WI9 A;  1HW5 A;  2IRF G;  2R3S A;  3F8M A;  1C0W A;  2EWN A;  1XDS A;  3C3W A;  4R1H A;  3FHZ A;  3F72 A;  1B9N A;  3L7W A;  4M71 A;  4O3M A;  5E18 F;  3M7G A;  4G9Y A;  3KP3 A;  4LJZ F;  2F5D A;  1YO5 C;  5DDG A;  3NEU A;  2IVM A;  3I0T A;  1O3S A;  3K0L A;  4WF2 A;  5BPI A;  1R00 A;  3I54 A;  2HFH A;  4JQF A;  4XSZ F;  5JI6 A;  5ICF A;  2FBK A;  1HKT A;  3HOS A;  3T5X A;  1U6G A;  2D1V A;  1AWC A;  1LB2 A;  3IWF A;  4M72 A;  3JTG A;  1I27 A;  1R1V A;  1LEA A;  3IKV A;  1G3W A;  5DCM B;  2MLK A;  1TLH B;  4AD9 A;  2K02 A;  2KKO A;  3KP4 A;  4KT5 C;  4A5M A;  3IC7 A;  3TGN A;  1Z6T A;  2JPB A;  2BGC A;  3WU0 A;  2A68 F;  3LFK A;  3QP5 A;  4MEX F;  1HSJ A;  5HS7 A;  1K7A A;  2IPQ X;  1B59 A;  2PMH A;  2VBW A;  2HYG D;  4L9T A;  2KIF A;  4RB3 C;  3ECO A;  3V8K A;  5FLX Z;  3ZP5 A;  1QNT A;  1W7P D;  1OPC A;  2FXA A;  4XLP F;  4EMS A;  4A5N A;  3P7N A;  1LDK B;  4HF1 A;  2JSC A;  3I64 A;  5LRR A;  5EEH A;  1XSV A;  2E7W A;  1SMY F;  4YII A;  4MNU A;  3HSF A;  2XRO A;  4LB5 A;  1O7F A;  1TQI A;  5HS9 A;  3QU3 A;  2ETH A;  2CQK A;  3WU1 B;  4IRH A;  2G7H A;  3SXY A;  4HX4 A;  4YFN F;  3BZ6 A;  5IT9 K;  2DO7 A;  3GFM A;  3PFI A;  4RS8 A;  1IW7 F;  2Y48 A;  2ZJ2 A;  2JZY A;  2M8E A;  3DXJ F;  5L3C A;  3WTS C;  1EH7 A;  2CFX A;  4HX7 A;  4ZYG A;  3P9C A;  5HDN A;  2G7U A;  2ZO4 A;  1ODD A;  3B02 A;  2XVC A;  3G3Z A;  2PG4 A;  3QRF F;  3KZY A;  3JTH A;  2IA2 A;  5D5U B;  1LVA A;  2NAZ A;  1QQI A;  2Q2E A;  1GVJ A;  1JE8 A;  3V7R A;  3D0S A;  3VOD A;  2DFI A;  5ERI A;  5FO5 A;  1ZG3 A;  3CJN A;  2RKH A;  2ZXJ A;  4A12 A;  2XAQ A;  2UZK A;  2HR3 A;  4IVN A;  1IRF A;  2EFP A;  1FBS A;  5HLG A;  4ZYE A;  5CVV A;  3TO6 A;  5D6E A;  1T0F A;  3J81 K;  1I6X A;  4Q5S F;  2AS5 F;  3R0A A;  4PGG A;  2OAZ A;  3E6M A;  1XB4 A;  2W85 A;  2BEO A;  4KFC A;  1XD7 A;  2OU2 A;  1FYK A;  1FWZ A;  4KN7 X;  2O8X A;  2Z33 A;  1U5T C;  4OIN F;  3KEO A;  1DPU A;  4UV8 A;  4D0P A;  3CUO A;  4JBA A;  4G7O F;  3RYP A;  3KLO A;  2LSO A;  4OOI A;  4Y13 A;  5K5R A;  1FP1 D;  1UFM A;  4CGZ A;  1P4X A;  3M8E A;  2ESH A;  1YW8 A;  2L4M A;  1R22 A;  2PN6 A;  2M30 A;  2KJB A;  4HQM A;  3ZMD A;  3ROU A;  4LK1 F;  1T39 A;  1IRG A;  3ZQ7 A;  3I53 A;  1BIA A;  2V79 A;  2DQL A;  1T6S A;  3N4M A;  2FA5 A;  3MAJ A;  3CUQ B;  3HYI A;  5J8F A;  2JPC A;  3HHH A;  3CUQ C;  1BOA A;  4RAZ A;  5TJJ A;  1K79 A;  2CG4 A;  4YFK F;  2OQG A;  1SD4 A;  5E20 A;  3KLN A;  1BJA A;  5A2Q Z;  4FT8 A;  5FD5 A;  2XV4 S;  5ILV A;  4IXA A;  1O3T A;  4B09 A;  2XRN A;  1MDM A;  1SMT A;  3SZP A;  1F9N A;  1JXS A;  1LEB A;  4GGG A;  1H0M A;  1P6R A;  1KQ0 A;  4IRG A;  4IF4 A;  4OIR F;  2IW5 A;  2VT2 A;  5E1X A;  1EH8 A;  4HOB A;  4A0Y A;  5BOX A;  2R7D A;  5HLH A;  5ILU A;  1KU9 A;  3IKT A;  3FZV A;  2ISZ A;  4KIB A;  1F4K A;  2CGP A;  3EYI A;  4EJW A;  1XMK A;  4KIC A;  5LRS A;  3MZY A;  2GXB A;  2DTR A;  3ABU A;  1UCR A;  3VOE A;  3WGI A;  1I1G A;  1PP7 U;  4OMY A;  1R1T A;  5L3G A;  3F8C A;  2Q8K A;  5JR3 A;  2BBY A;  2P5L C;  2TDX A;  4HF2 A;  4BH9 A;  1XCB A;  5LLQ A;  3FXQ A;  1W7P B;  3O3K A;  4ZH4 F;  1HW1 A;  2JT1 A;  5FFZ A;  1ON1 A;  2HZT A;  2MC3 A;  1J5Y A;  4HLY A;  3KZZ A;  3HRU A;  1D8J A;  1IAW A;  1CF7 B;  1T2K A;  1KYW A;  2GZW A;  4UXN A;  1G3S A;  5L3D A;  1Z9C A;  2NYX A;  1BN5 A;  3V7S A;  2VOD A;  4UNO A;  1J9I A;  1Z05 A;  5E1W A;  1H9G A;  4U7B A;  1DDN A;  1R5H A;  2HOE A;  3ZMV A;  3MWM A;  1OYW A;  1YYV A;  4IRI A;  5D5W B;  5H6R A;  3WTV C;  4KUM A;  2L3D A;  3EET A;  4HLX A;  1K6O A;  4LD5 A;  4LB6 B;  3RPU A;  3I4P A;  1FSE A;  5DD8 A;  1MZB A;  4MTD A;  1SD5 A;  3KET A;  3HIF A;  5D6F A;  2A6H F;  4MEY F;  1OKR A;  3R60 A;  4LLG F;  2H27 A;  3HHG A;  3ZMZ A;  5A2Q K;  4MGR A;  3KFW X;  2DQR A;  4WX9 A;  3TO9 A;  2D1H A;  4L0Y B;  3ZMU A;  1XGO A;  2V6C A;  4UVA A;  1XMA A;  3I71 A;  1VTN C;  3C18 A;  2COM A;  2OZU A;  5DYM A;  3WE2 A;  1ZG5 A;  4KMF A;  4XLN F;  3R6S A;  2QQ9 A;  1P92 A;  3P9I A;  5CVJ A;  4XBF A;  1Z7U A;  1OR7 A;  2MD5 A;  2PFB A;  4F7Z A;  3QPH A;  1CGP A;  3WTY C;  3EDP A;  1XSX A;  2FU4 A;  2P6S A;  2VXZ A;  3E3V A;  3ELK A;  3QAH A;  2HKX A;  3VB2 A;  2E1C A;  2NRA C;  1BIB A;  5FLX K;  1OYY A;  4CHU A;  4M6Y A;  4ZZD A;  1FY7 A;  4WWC A;  2EA2 A;  2L01 A;  4BHC A;  5EEG A;  3TDZ C;  4EM0 B;  3ZN0 A;  1O57 A;  2YPR A;  5K5Q A;  2YR2 A;  2G9W A;  4Y17 A;  1R58 A;  1R36 A;  2DW4 A;  3BY6 A;  3QU6 A;  3CTA A;  4LMY A;  2OD5 A;  2XAH A;  2J5O A;  3DEU A;  3REO A;  1U5T A;  1U8R A;  2FBH A;  2FRH A;  3WGG A;  1ONV A;  1K78 B;  1ZHF A;  4U7D A;  4I02 A;  2DK8 A;  3ZN1 A;  3FXR A;  2FBI A;  1AOY A;  2P5K A;  3HUG A;  5HDG A;  5BMZ A;  2W57 A;  2HQN A;  3WTZ A;  2P6T A;  5LEJ A;  3JAM K;  2P4W A;  2XUB A;  4ZYH A;  3MEX A;  3WOD F;  1ZRC A;  5DUK A;  1F1Z A;  4M74 A;  4WK8 F;  1YQA A;  4I0B A;  2W25 A;  5D5X B;  4YIF A;  4G7Z F;  4I98 B;  5AIQ A;  3LA2 A;  3FXU A;  3WTX C;  1FP2 A;  3D5L A;  3CDH A;  4KIF A;  1S3J A;  1U78 A;  4LGW A;  3L9F A;  5F6F A;  3WG9 A;  1E17 A;  4P5O A;  3R61 A;  3F8B A;  1J75 A;  2EFQ A;  2Z9O A;  1LJ9 A;  3QPT A;  2BV6 A;  5LBQ A;  4R79 A;  1YTY A;  3LQR A;  3GFI A;  1MD0 A;  1EV7 A;  2VBX A;  4N9I A;  3COA C;  3FMS A;  4LLL A;  2V1U A;  3JSP A;  2KIM A;  1FX7 A;  4GO1 A;  2HYF A;  3ULQ B;  1DP7 P;  2X4H A;  4A6E A;  5CVR A;  1G4D A;  2HDC A;  2F2E A;  3V8L A;  2ZNZ A;  4L5J A;  1ZGJ A;  2QZ8 A;  4RB2 C;  2M5W A;  3DKW A;  1YW9 A;  3BJ6 A;  2H6C A;  1U3E M;  1FBU A;  2FF4 A;  2XIG A;  2ELH A;  1LNW A;  2RV8 A;  1YLF A;  3WTU C;  2HKO A;  1LDD A;  4P9F A;  2A07 F;  1R1U A;  3BPX A;  5KVR A;  1RNL A;  3WTT C;  3U9G A;  3TOB A;  1MJ9 A;  6PAX A;  5DCF A;  2X0L A;  4RGX A;  5D8K B;  1XGS A;  4NB5 A;  2MA3 A;  3DV8 A;  2XKO A;  3LST A;  1QPM A;  5ICE A;  1ON2 A;  1FT9 A;  2QEN A;  2ZFW A;  2L02 A;  3GLX A;  3F21 A;  1REP C;  4MHG A;  5JFR A;  4RGS A;  4N0B A;  3Q5F A;  2CO5 A;  2FNP A;  2DT5 A;  1YW7 A;  2M1B A;  1ZG1 A;  3EUH A;  4HA8 A;  4M9X A;  2R7F A;  2Z99 A;  2ZME A;  3CLO A;  3GF2 A;  5CVU A;  1W5S A;  5JHU A;  1KU7 A;  5L3B A;  1F5T A;  5LGN A;  3QOP A;  5ILS A;  2VC0 A;  1T38 A;  3LA7 A;  3KEQ A;  4I09 A;  3ERE D;  3Q9S A;  2Y0M A;  1J7K A;  2CYY A;  4L18 B;  4M9Z A;  4PDK A;  4GCV A;  1PDN C;  4HDV A;  2L4A A;  4Q47 A;  3VEP A;  1SFX A;  3HTS B;  2OZ6 A;  3I59 B;  4EJO A;  3GO5 A;  2QBY B;  2QQB A;  4G94 A;  2EB7 A;  2LNB A;  4EM2 A;  2DK5 A;  2YU3 A;  3U2R A;  1V4R A;  2LDU A;  1UHW A;  4BQA A;  1FOK A;  1RUO A;  1JGS A;  2UWM A;  4LG0 B;  2QLZ A;  3CO7 C;  4EVI A;  4A0X A;  1MDM B;  3DP7 A;  2QM3 A;  1IN8 A;  4LG0 A;  2V9V A;  3H3Z A;  3GFJ A;  3HRM A;  5TRD A;  4HQE A;  3RKY A;  3GX4 X;  3ML6 A;  1FYL A;  2XAS A;  1JHH A;  4MTE A;  1TNS A;  2FE3 A;  2VON A;  2LF7 A;  1WSU A;  4HBL A;  2DPD A;  1S7O A;  2IA0 A;  1B4A A;  2WWY A;  3BOQ A;  3RTR A;  1PUE E;  1A04 A;  3T8T A;  4EJV A;  3OOP A;  1HST A;  2HTJ A;  5D4R A;  2ADU A;  2LF8 A;  1XCV A;  2H94 A;  2DLL A;  1D5V A;  3GWZ A;  4ENN A;  2FOK A;  4OIO F;  1MGT A;  3FMR A;  3RPQ A;  3K2Z A;  2PI0 A;  1BBY A;  1ZAO A;  4U0W A;  4EJT A;  2PJP A;  4ENJ A;  1IN4 A;  2EK5 A;  2UXX A;  3KP2 A;  3MCZ A;  1YFH A;  1I1S A;  2RC4 A;  3ISP A;  2A6E F;  2VBY A;  5H20 A;  4TV7 A;  3LAP A;  1V3F A;  4AVP A;  4LLN A;  1HW2 A;  3OV8 A;  4MQ9 F;  2ZME B;  1OMI A;  5HLI A;  3JSO A;  2XKP A;  2DI3 A;  2FNA A;  4UVB A;  2ISY A;  1TNT A;  4LK0 F;  1YIO A;  2XGX A;  2NNN A;  2JRT A;  2FSW A;  1FSH A;  2O0Y A;  2PBI A;  3V4G A;  5ICC A;  2O3F A;  3NQO A;  3U1D A;  3H92 A;  1KU3 A;  2K7L A;  2RVC A;  1IF1 A;  3TQN A;  3IL2 A;  4UV9 A;  4HDU A;  3IHU A;  5HVQ C;  1S8N A;  4G6Q A;  4WCG A;  4NHJ A;  2K4J A;  4Y15 A;  2A5Y B;  1LQ1 A;  2E1N A;  2NNY A;  5HOO A;  2HS5 A;  4Q4Z F;  4BAY A;  4CDG A;  2CSO A;  1Z1D A;  3F3X A;  1ZYR F;  1QBJ A;  3F6O A;  1D8K A;  3LQQ A;  1LDJ A;  2UXN A;  4UHT A;  2XAG A;  2O6G E;  2VE9 A;  4N9H A;  1FPQ A;  1USS A;  4ASN A;  1UB9 A;  2RNJ A;  3PQK A;  4IPA A;  3BJA A;  4RAY A;  4ZZL A;  3N97 A;  3CUQ A;  3E6C C;  3Q9V A;  3KP5 A;  1JHF A;  1TBX A;  1D3Y A;  5BS6 A;  2GIV A;  2VOP A;  2LKP A;  3F8F A;  1RIO H;  4ON0 A;  3M1E A;  3K9T A;  2QWW A;  3HOT A;  4KN4 X;  3ZMS A;  2DU9 A;  5D5V B;  2QBY A;  3JAM Z;  1TW2 A;  3I58 A;  1IXR C;  2EV5 A;  5K1Y A;  4R8H A;  3E5U A;  3HRS A;  1GXP A;  1TQM A;  1I5Z A;  5BQT A;  3J7A O;  4IHS A;  2Y75 A;  5LEK A;  5D8L B;  2M45 A;  2EJR A;  3CO6 C;  4KA4 A;  3ABT A;  2FMY A;  1FC3 A;  3SFZ A;  4AIH A;  2GQQ A;  2QYO A;  2ESN A;  3LAJ A;  3W6J B;  2PMU A;  1QO0 D;  1B9M A;  3JW4 A;  3HSR A;  2YX4 A;  3MZH A;  5BPD A;  4WXC A;  5L3E A;  4Z2Y A;  1MKM A;  4M73 A;  4M6X A;  4FX4 A;  4I01 A;  4P9U A;  1U5T B;  4A0Z A;  2GAU A;  3VFZ A;  1L0O C;  3DPL C;  3F23 A;  2Q0O A;  2EFO A;  2MH2 A;  3DF8 A;  4YFX F;  3FMQ A;  1TQP A;  4FX0 A;  2XHK A;  4JK1 X;  2AXL A;  4AIK A;  5E8I A;  1BI1 A;  1IZ1 A;  2ZKZ A;  3F22 A;  1UST A;  3BP8 A;  2MBF A;  4XRF A;  5LGU A;  4WXH A;  2KJC A;  2C6Y A;  2K86 A;  1WKM A;  3DPT A;  3FM3 A;  2K4B A;  5JVT A;  5AIP A;  2VN2 A;  1RI7 A;  3GZ6 A;  1IN6 A;  3KCC A;  2IA1 A;  5ICG A;  1GHC A;  4ETS A;  1KYZ A;  4L9V A;  1GXQ A;  2NS0 A;  1UHM A;  1IN7 A;  4I7H A;  4EJU A;  2STW A;  4EGY A;  1B1B A;  2ZNY A;  1EH6 A;  2BYV E;  4A6D A;  2L54 A;  1SFE A;  2EFN A;  4BXU A;  3IWZ A;  2F5C A;  2O03 A;  3DQV C;  5CYV A;  2DPU A;  3P9K A;  3E5X A;  4NQW A;  1HQC A;  4CXF A;  1S29 A;  1R23 A;  3WE3 A;  2V1X A;  3EQL F;  4QLC U;  3J80 Z;  1BI0 A;  3F8N A;  4PZJ A;  4AWX B;  2IJL A;  1IUY A;  3ZMT A;  2CWE A;  1KQ9 A;  4PCQ A;  4O6J A;  3E5Q A;  5J8C A;  3RIR A;  5E8G A;  3KP6 A;  1SD6 A;  1PP8 F;  2HEO A;  5DV5 A;  3T0Y A;  3EYY A;  4HAM A;  3FM5 A;  1RUN A;  3BWG A;  5H6Q A;  1BI2 A;  1TTY A;  3GVA A;  2H6B A;  1SAX A;  1FLI A;  1Q1H A;  4E70 A;  4YG2 F;  3GZ5 A;  3BJO A;  3L09 A;  1G3T A;  3HRT A;  2DBB A;  4RGU A;  4UVC A;  1QZY A;  4MQV A;  4H0E A;  1U2W A;  4U0V A;  2BE5 F;  1WWX A;  4LFU A;  2P5V A;  4BYY A;  3HTU A;  3S2W A;  4GXO A;  4GYI A;  1P4A A;  3SQN A;  2OBP A;  1KGS A;  2GA2 A;  1W7P A;  1Z91 A;  3IRR A;  1CF7 A;  4CIC A;  5K5O A;  5HS8 A;  1S6L A;  1XGM A;  4OMZ A;  1ZRD A;  1BI3 A;  4ESJ A;  1ZLK A;  2PEX A;  5LGT A;  2QVO A;  2P7C B;  3QP6 A;  1HBX G;  1ZRF A;  5FFX A;  4HW0 A;  2M87 A;  3NRV A;  2FQ3 A;  1OYI A;  3L00 A;  3E6D A; 
#chains in the Genus database with same CATH topology
 1WJE A;  2LY9 A;  4XLC A;  3O8G A;  3HKZ A;  2IP2 A;  4Q48 A;  1WQ2 A;  2ELK A;  1ZN2 A;  4BNC A;  3B73 A;  4XQF A;  2PQ8 A;  3OIQ A;  2IGO A;  2LY2 A;  4P96 A;  2ZBK A;  3RJP A;  4XRS G;  3TO7 A;  4C2U A;  5DEQ A;  4CA0 A;  3KE2 A;  4II3 A;  1WJA A;  3S3M A;  2CQX A;  2H09 A;  3H35 A;  4YEJ A;  2PX9 A;  3S93 A;  4AUX A;  3FF5 A;  3CC2 I;  5FB2 A;  3I4N J;  4ESB A;  1MBK A;  5J1Y A;  2O61 A;  4NDL A;  3KP7 A;  5E1Z B;  3DFG A;  1G6N A;  1STZ A;  2W84 A;  4B3A A;  2CW7 A;  5IYB J;  4OIP F;  1DPR A;  3HJE A;  3LSG A;  1QHG A;  1WRJ A;  2QKL B;  3GTJ J;  2MW8 A;  1O4X A;  1LE8 B;  1YX3 A;  1P2F A;  2K9N A;  2G0E A;  4U0Y A;  2XGC A;  1R5G A;  3CCE I;  1WCM J;  2XDV A;  2JTV A;  1ZR4 A;  1J2X A;  2DA6 A;  5K7Z A;  2VBZ A;  3J81 Z;  2GIZ A;  1XN7 A;  1G8X A;  2YS9 A;  1JUP A;  2OCE A;  2JJ7 A;  2WAQ A;  1Z0X A;  3L2C A;  5K7F A;  1V55 H;  2IGM A;  3IRQ A;  2PMZ A;  2DAO A;  3QYF A;  1H9T A;  3IH4 A;  4WXD A;  4I2O A;  2NVQ J;  2QF7 A;  2JUC A;  4XLH A;  1ZAR A;  3BDD A;  3J80 K;  2AQF A;  4MFE A;  1UG2 A;  2KLO A;  4G7H F;  1JJ6 C;  1SD7 A;  5GAE J;  2LBF B;  1K78 A;  2CUZ A;  5F0F A;  2OTL I;  4ENM A;  2VE8 A;  2EV6 A;  3BRO A;  2GM4 A;  3HOZ J;  4E4H A;  5M3F J;  2XAJ A;  4DNC A;  2D45 A;  3W6K B;  3ZQL A;  4CYC A;  1UMQ A;  3T1B A;  5GAG J;  1ZLJ A;  4M6V A;  3QYE A;  3ABM H;  4JX4 A;  4Y4R A;  3V7C A;  4KYW A;  5F1R A;  4KIG A;  2HGC A;  1Y8Q B;  3GZN B;  3HPH A;  3V42 A;  2YU9 J;  1LVK A;  1HC8 A;  3ESW B;  4PJJ A;  5CVI A;  2F5E A;  4FIS A;  1MJB A;  3H3U A;  1O3R A;  3HB9 A;  2A3S A;  2LKX A;  2E19 A;  2RGV A;  4UUT A;  4BQO A;  3MFK A;  2HPI A;  4HV5 A;  1TWF J;  3ZPL A;  1W4M A;  4RLQ A;  4EV0 A;  4P1W A;  2WTE A;  4M9S A;  1T95 A;  1P4W A;  2EZI A;  1VQO I;  1KA8 A;  2EV0 A;  1TWH J;  1WJF A;  1YS7 A;  3M9A A;  4M3E A;  3HOV J;  4V2F A;  5AON A;  4CYC B;  2CW0 F;  2NVU B;  3LL7 A;  2F5F A;  2ZCW A;  1BL0 A;  3GEZ A;  3C1D A;  1L3L A;  3H9Q A;  3C7J A;  2OA4 A;  2XAF A;  3L2Q A;  2DA1 A;  2VOO A;  1VF9 A;  4BQN A;  4KDP A;  2BHY A;  1T98 A;  2CV2 A;  3E0J B;  2LH9 A;  2A05 A;  4YEL A;  2Z3Y A;  1N78 A;  4CZZ A;  2R7U A;  4KT6 A;  2A69 F;  3CMA I;  4C2T A;  2E2J J;  2CS3 A;  2R7T A;  5E3M A;  2ZB9 A;  1ZH5 A;  4L5I A;  1HA8 A;  2GXG A;  2M4G A;  2RN7 A;  2HOS A;  1X1D A;  3PM1 A;  3K1M A;  2R5Y A;  1BM9 A;  4AIJ A;  2IEK A;  2STT A;  1OCT C;  3S2D J;  3CQZ J;  3O6B B;  1YJN I;  2ECC A;  3SZT A;  3RKW A;  2FEZ A;  3Q3S A;  1IGN A;  5F0C A;  1YS6 A;  1B6A A;  1A6Q A;  3GYH X;  1FIP A;  4RM2 A;  2HQR A;  2WC2 A;  4DYQ A;  4HF0 A;  3I59 A;  1G3Y A;  2V1N A;  1S7A A;  1S9H A;  3F9K A;  3ECH A;  2Z5U A;  4P55 A;  1N75 A;  2VJ5 A;  3I4M J;  3BR2 A;  3ERM A;  1XDU A;  1ERD A;  1X3U A;  2OV7 A;  4O5V A;  3E97 A;  4S05 A;  2IXS A;  2DOE A;  4A3K J;  3RDI A;  3H9J A;  2HWV A;  1R7J A;  2VC1 A;  4I0A A;  4GRI A;  3SHF A;  3V8J A;  4UUV A;  1IXS B;  1HLV A;  2OTJ I;  2E34 A;  3HSE A;  3RYR A;  2A61 A;  1IN5 A;  3BCA A;  2HOT A;  1G59 A;  2HPM A;  4RB1 A;  2XSJ C;  3PJR A;  1D1C A;  3RI4 A;  4M3F A;  4XN3 A;  1FIA A;  2QKM B;  4G8X A;  1T8I A;  2CQQ A;  4G6D A;  5D4S A;  4BJ6 C;  4ZJZ A;  2VKD A;  1SVM A;  1J0R A;  4U88 A;  2M0M A;  4X6A J;  4RGR A;  1P7J A;  4XSX F;  3GFL A;  4DZP A;  4KNY A;  2IBD A;  1YE9 A;  3OYJ A;  4FHT A;  2HTS A;  2GA1 A;  1Q1V A;  3R4K A;  4CO8 A;  4OWR B;  4A3E J;  3W2V A;  4HX8 A;  4B8X A;  3EUA A;  2J5P A;  2HQ5 A;  2FML A;  5J1U A;  1XS9 A;  1QVT A;  4FQG A;  1IXC A;  2W24 A;  1EA3 A;  1DP3 A;  1X3Z B;  2PLY A;  4EGZ A;  2QGU A;  3A2K A;  3GUD A;  3T8R A;  5F64 A;  4QIW N;  4L9N A;  5GP9 A;  3F6V A;  4LIT A;  3AAF A;  1A36 A;  4XM3 A;  3WTW C;  5TIS C;  1U9N A;  2QUF A;  4HNV A;  1TC3 C;  2JQ7 A;  3DBR B;  2AO9 A;  2K5C A;  4HYE A;  2RQP A;  4DQ2 A;  2IT0 A;  5DD4 A;  3I5U A;  3K1N A;  4K2E A;  2VT3 A;  3TOA A;  1OQY A;  1ETW A;  2X1C A;  3GW2 A;  3GXO A;  1ETK A;  2VUM J;  3LA3 A;  1O7L A;  4OIQ F;  1D5Y A;  3CJQ B;  3LWF A;  5IT9 Z;  1BR4 A;  3TDU C;  3PQJ A;  3SDG A;  1E3O C;  2E1M C;  1BOB A;  5CJ9 A;  4EEF G;  1OIS A;  2MLG A;  3CC4 I;  1FNN A;  3FWE A;  2BW3 A;  1PYV A;  3OYC A;  3TKY A;  3G4S I;  1YRN B;  4NNJ A;  1FYM A;  4ESF A;  2R7X A;  2R7O A;  3BPV A;  2LP0 A;  5FGM A;  5CLS A;  1YJ9 I;  3OYE A;  5ED4 A;  1HXD A;  4L9J A;  3CLQ A;  4W1U A;  5LFA A;  5E17 F;  1GUU A;  1TW3 A;  2EFW A;  2WV0 A;  5IT3 A;  2KP6 A;  3OYA A;  1Y0U A;  3CP8 A;  3MQ0 A;  4L0Z B;  1QVU A;  3RKX A;  5LHI A;  4PGH A;  2WB1 N;  2I5U A;  2L5Q A;  4QPO A;  3K10 A;  5C4J J;  4QWQ A;  2LFB A;  3M8F A;  3R0J A;  3HOX J;  4KMU X;  5B66 C;  2GWR A;  5HDK A;  1NHA A;  3VYR B;  5FD6 A;  5LHG A;  3OL4 A;  2K27 A;  5IPA A;  1O3Q A;  2IS4 A;  1RET A;  4OU0 A;  1QZZ A;  5DCM A;  2IGN A;  4ZYD A;  2D2W A;  1FBQ A;  1Z6R A;  1YIT I;  3HKZ N;  4IOA F;  2P7V B;  4BHB A;  1HKQ A;  1KQ8 A;  1X4P A;  4CYD A;  1WHU A;  3FX3 A;  3JRE A;  3C2B A;  3GTM J;  4ABZ A;  4ENK A;  1MBG A;  2P81 A;  3WGH A;  4DZJ A;  2TCT A;  2ZME C;  4B1R A;  1QGP A;  2RAE A;  1T33 A;  2EA4 A;  1U0J A;  2YX7 A;  3H0G J;  4IHT A;  3H5N A;  2P8T A;  2VQC A;  1VQL I;  2FUG 2;  1J09 A;  5LHH A;  1ZGA A;  1ULY A;  4A2U A;  5HLT A;  2E2H J;  2K9S A;  1FZP B;  3L2W A;  2V1D A;  2H1K A;  1XGN A;  1SFU A;  4HV6 A;  5M5W J;  3BG5 A;  2OUM A;  1J59 A;  2LYC A;  1W5T A;  2DA7 A;  3DU5 A;  3S1M J;  3FXK A;  3K69 A;  1ETX A;  2KIU A;  2B0L A;  1E2X A;  1BC7 C;  5DUI A;  4JYK A;  1SFK A;  4JX5 A;  4BY7 J;  2HU9 A;  1MIJ A;  4EQQ A;  4S04 A;  4GYG A;  2R7Q A;  4RB0 A;  3DTI A;  2KT0 A;  2RDP A;  4A3D J;  5C3E J;  2ACJ A;  3O2P E;  2QQA A;  1DUX C;  4BS9 A;  1RZ4 A;  4BJ5 C;  4EM1 A;  4A3L J;  2OQR A;  2R7S A;  2M34 A;  1KU2 A;  1UJ8 A;  2F4M B;  2XF5 A;  3E6B A;  2LLK A;  4XK4 A;  4PJM A;  3L2U A;  3C2H A;  1BC8 C;  1X1A A;  2E7X A;  2KRF A;  4CSW A;  2DXI A;  4GDF A;  5F1J A;  4IJA A;  4HZF A;  1K6Y A;  2DFE A;  2RRE A;  3LOC A;  2MH9 A;  5EDN A;  1UZC A;  1ZRE A;  3K1P A;  1CQT A;  3AG3 H;  5J6X A;  5L3F A;  1YG2 A;  5GAD J;  3MVP A;  4PFO A;  2LRE A;  2VQG A;  1K4S A;  2KMU A;  1HKS A;  4BHP A;  2R93 J;  1MJA A;  4M3B A;  1XSD A;  4UB8 C;  4HRI A;  2YSR A;  4HNT A;  2DA3 A;  1K83 J;  3G73 A;  5KK1 A;  4CCM A;  1R71 A;  1WI9 A;  1HW5 A;  2VKE A;  3EUK L;  2X48 A;  3HC7 A;  5EJC A;  3OS2 A;  2IRF G;  4LIV A;  2R3S A;  1KZH A;  3OL3 A;  3F8M A;  1C0W A;  2EWN A;  3HGY A;  1XDS A;  3C3W A;  3TED A;  4R1H A;  3FHZ A;  2Z2S B;  3F72 A;  1B9N A;  2MGQ A;  2XF7 A;  3L7W A;  4M71 A;  4O3M A;  3VWB A;  3HM5 A;  5E18 F;  2R5Y B;  3M7G A;  5TGT A;  4G9Y A;  3KP3 A;  4LJZ F;  2F5D A;  1YO5 C;  5DDG A;  3BG3 A;  4RM3 A;  2ME0 A;  3NEU A;  3SEQ A;  1KON A;  3UNG C;  2IVM A;  3I0T A;  1O3S A;  1ITY A;  3K0L A;  3S3O A;  4WF2 A;  5BPI A;  5KCM A;  1R00 A;  2WA0 A;  3I54 A;  4CUG A;  3DBH B;  2HFH A;  3G6E I;  4JQF A;  1JI8 A;  1MBH A;  2VJ4 A;  4XSZ F;  3PSI A;  5JI6 A;  2NVY J;  3CCV I;  4C2M J;  5ICF A;  2L9R A;  2LRD A;  2JRM A;  2FBK A;  1HKT A;  3HOS A;  3T5X A;  3VSL A;  2HVS A;  3K7A J;  3PNV A;  3U21 A;  3A1Y A;  1JKO C;  4L5E A;  2F5V A;  5GTH C;  4BE2 A;  1U6G A;  2D1V A;  1AWC A;  1LB2 A;  3IWF A;  4M72 A;  3JTG A;  3HOU J;  1ZGW A;  1I27 A;  1R1V A;  1LEA A;  3IKV A;  1G3W A;  4B4C A;  1IV6 A;  2HOA A;  3CME I;  5DCM B;  2MLK A;  3KIO A;  1MW7 A;  1TLH B;  4AD9 A;  2K02 A;  4D7N A;  2HVR A;  2KKO A;  3FXL A;  3RSN A;  3KP4 A;  4KT5 C;  4HG2 A;  4A5M A;  3IC7 A;  4J00 A;  3TGN A;  2Q1Z B;  1Z6T A;  2ZJP F;  4Y33 A;  5FRO A;  2JPB A;  5EGO A;  2M4K A;  4IO9 F;  2GOM A;  2BGC A;  3WU0 A;  2A68 F;  3LFK A;  3QP5 A;  3QYB A;  2EIL H;  4MEX F;  1HSJ A;  5HS7 A;  1K7A A;  2IPQ X;  2MSY A;  1GV5 A;  3NWT A;  1B59 A;  2BY3 A;  2HI3 A;  2PMH A;  2VBW A;  2HYG D;  4L9T A;  2KIF A;  4RB3 C;  3ECO A;  3HBL A;  3V8K A;  5FLX Z;  4BXF A;  1QNT A;  1W7P D;  1OPC A;  3ZP5 A;  4E6K G;  2FXA A;  4XLP F;  1FOW A;  2R5Z A;  4EMS A;  4A5N A;  3CCY A;  3OS1 A;  3P7N A;  1LDK B;  4HF1 A;  2JSC A;  1W1W E;  3CJR B;  1YJW I;  2DA4 A;  3I64 A;  3AL0 C;  3PUB A;  5LRR A;  5EEH A;  1XSV A;  2E7W A;  5IOY A;  1SMY F;  1E3P A;  3FIW A;  4YII A;  2CUE A;  4IX7 A;  2OF7 A;  2ELJ A;  2KRC A;  4MNU A;  3HSF A;  2XRO A;  1I39 A;  4LB5 A;  1O7F A;  3S16 J;  2XB5 A;  1TQI A;  3K2A A;  5HS9 A;  3QU3 A;  2ETH A;  3DBL B;  2CQK A;  4DIQ A;  3WU1 B;  4W97 A;  1PVE A;  1PJR A;  1V5F A;  1LFB A;  4IRH A;  2G7H A;  5F0H A;  3SXY A;  4HX4 A;  4YFN F;  1GDT A;  2VJJ A;  4ZTJ A;  3BZ6 A;  4RBO A;  5IT9 K;  2DO7 A;  3GFM A;  3PFI A;  4CCO A;  4B48 A;  4RS8 A;  1IW7 F;  2Y48 A;  2ZJ2 A;  3AG4 H;  2JZY A;  2M8E A;  4CCL A;  5FKM A;  1R6R A;  1AKH B;  3DXJ F;  5L3C A;  1RKW A;  2WBM A;  4NC8 A;  3WTS C;  1EH7 A;  3DPU A;  2HDW A;  2CFX A;  4HX7 A;  4ZYG A;  1GT0 C;  1HDD C;  3P9C A;  3AG1 H;  5HDN A;  4EAT A;  2G7U A;  2ZO4 A;  1ODD A;  2EZK A;  3B02 A;  4B44 A;  1UHS A;  2XVC A;  3JCU C;  3O8H A;  3G3Z A;  1E3H A;  2PG4 A;  4C9Y A;  3QRF F;  4DJA A;  3KZY A;  1JKR C;  3JTH A;  2IA2 A;  5D5U B;  1LVA A;  2NAZ A;  1BJZ A;  1QQI A;  2Q2E A;  3QOE A;  5FKN A;  2KDO A;  1GVJ A;  1JE8 A;  3JR9 A;  3V7R A;  1X2M A;  2E71 A;  3OYH A;  3D0S A;  3VOD A;  1LFP A;  2DFI A;  5ERI A;  1TT5 B;  4YRV A;  2L7K A;  2M3A A;  2L7F P;  1NG6 A;  3CJT B;  5FO5 A;  1ZG3 A;  3CJN A;  2RKH A;  1TZL A;  1T08 B;  2ZXJ A;  1X1P A;  2VB6 A;  4A12 A;  2XAQ A;  4A3I J;  2UZK A;  1ZK8 A;  2HR3 A;  4IVN A;  3TMO A;  1IRF A;  2EFP A;  1I6H J;  3G1M A;  1FBS A;  5HLG A;  4ZYE A;  1AU7 A;  2KHM A;  5CVV A;  3TO6 A;  5D6E A;  3M4O J;  4HSR A;  3BTL A;  1HCR A;  3MKZ A;  2OC6 A;  3FIS A;  2NS8 A;  3N05 A;  3OYL A;  5EZH A;  1EKE A;  1T0F A;  3J81 K;  1I6X A;  4Q5S F;  2CU7 A;  3KPH A;  2AS5 F;  3R0A A;  1M1E B;  4PGG A;  1LFU P;  3ONQ A;  4A69 C;  4UY8 I;  2OAZ A;  4CZC A;  4ANJ A;  1UAA A;  3E6M A;  1XB4 A;  1JJ8 C;  2W85 A;  2ZXI A;  2BEO A;  3ZGK A;  1DU6 A;  4KFC A;  1XD7 A;  3BCB A;  4XNF A;  3W3C A;  2OU2 A;  1FYK A;  1Z7L A;  1DGW Y;  1FWZ A;  4KN7 X;  2O8X A;  2Z33 A;  3GCM A;  1U5T C;  4OIN F;  3KEO A;  2V26 A;  5E3O A;  4UV8 A;  4D0P A;  1DPU A;  4F52 A;  3CUO A;  2FOW A;  3PO3 J;  4JBA A;  2R4G A;  4G7O F;  3C2G A;  3G2B A;  3RYP A;  1BW5 A;  3KLO A;  2LSO A;  5IOZ A;  4OOI A;  4Y13 A;  1MSF C;  1U9O A;  5K5R A;  1FP1 D;  1UFM A;  3IV5 A;  1TWG J;  3CCQ I;  1BR1 A;  4CGZ A;  2R7Z J;  1P4X A;  3ZXS A;  3CC7 I;  4I6Z A;  4BEH B;  3LSR A;  3M8E A;  2ESH A;  1YW8 A;  5KNL A;  4JOM A;  1SC7 A;  2L4M A;  1VQ5 I;  2NXN B;  3RZD J;  3OYM A;  2DDB A;  3A03 A;  4ZTF A;  1R22 A;  2PN6 A;  1ETV A;  1WFX A;  2M30 A;  2L2O A;  4B3X A;  2KJB A;  4HQM A;  2AQE A;  1TWC J;  3ZMD A;  3W2A A;  3H0D A;  1SVO A;  3WU2 C;  3K4C A;  3FK6 A;  3CDL A;  1MSE C;  3HPG A;  3ZQG A;  3ROU A;  3JRG A;  1Z67 A;  1Z21 A;  4LK1 F;  1T39 A;  1IRG A;  2CUJ A;  3ZQ7 A;  4BJT A;  3I53 A;  3S2H J;  5FRM A;  1BIA A;  3ZQH A;  3HZJ A;  2V79 A;  2OPT A;  2DQL A;  1T6S A;  3N4M A;  2FA5 A;  3MAJ A;  2EBI A;  4PFP A;  2EZL A;  5LD2 C;  3CUQ B;  5J1R A;  3HYI A;  5J8F A;  2JPC A;  3A02 A;  3HHH A;  3CUQ C;  1BOA A;  2W1O A;  4RAZ A;  2M7A A;  1D0Y A;  5TJJ A;  1K79 A;  2CG4 A;  4HPQ A;  4YFK F;  2OQG A;  1Y8R B;  3DEE A;  1QRY A;  2NVX J;  2WY8 Q;  1SD4 A;  1BW6 A;  3S1R J;  5E20 A;  3L2V A;  3KLN A;  1BJA A;  5A2Q Z;  3PIP F;  4FT8 A;  5J4V A;  2O8K A;  5FD5 A;  2XV4 S;  4NQW B;  5ILV A;  5FKK A;  2R0Q C;  4IXA A;  1O3T A;  4XLE A;  1W0T A;  4B09 A;  4HNU A;  1YIJ I;  2XRN A;  4BY1 J;  1MDM A;  1SMT A;  2GLO A;  3SZP A;  5EG0 B;  1F9N A;  2W00 A;  2ECB A;  3LSK A;  3D1N I;  1JXS A;  1LEB A;  1B8I A;  1VQN I;  4GGG A;  1DU0 A;  1H0M A;  1P6R A;  1KQ0 A;  2XPU A;  4IRG A;  5M3M J;  3AL0 B;  2F4O B;  4IF4 A;  4OIR F;  2CJJ A;  2IW5 A;  2VT2 A;  2EIJ H;  2QA4 I;  3K4J A;  4BBS J;  1JTX A;  5E1X A;  5GPA A;  4XLF A;  1AKH A;  2ZC2 A;  1EH8 A;  3FKJ A;  4HOB A;  4A0Y A;  5BOX A;  2COB A;  2IGK A;  2WV1 A;  2R7D A;  5HLH A;  1SAN A;  1FOX A;  5ILU A;  1KU9 A;  3IKT A;  3K4M A;  1WGX A;  3FZV A;  2ISZ A;  4KIB A;  1F4K A;  2CGP A;  3EYI A;  2EQR A;  4EJW A;  1MMS A;  2ZSH B;  1XMK A;  4KIC A;  5LRS A;  3MZY A;  3BR3 A;  2GXB A;  2DTR A;  2VKH A;  3ABU A;  1UCR A;  3VOE A;  4D1Q A;  4H4K C;  3HOW J;  1X2N A;  2MD0 A;  2JMW A;  1WJ5 A;  3WGI A;  4PUS A;  1I1G A;  2QCO A;  2GOX B;  1PP7 U;  4OMY A;  1R1T A;  1JUS A;  5L3G A;  3F8C A;  2Q8K A;  5JR3 A;  2BBY A;  2P5L C;  2TDX A;  5GPC A;  2DYS H;  4X0G A;  2W48 A;  1S7E A;  1W36 C;  4HF2 A;  1JKQ C;  2QSH X;  4BH9 A;  1XCB A;  5LLQ A;  3FXQ A;  1W7P B;  2WB1 A;  3BC8 A;  2JVG A;  2X1E A;  3O3K A;  4ZH4 F;  1HW1 A;  4E7J A;  1X1C A;  1NTC A;  1E0E A;  3PO2 J;  2JT1 A;  5FFZ A;  1ON1 A;  1WJB A;  1T0F C;  3OOU A;  5EEA A;  2HZT A;  2DOF A;  3HGG A;  2MC3 A;  4A93 J;  3LFU A;  1J5Y A;  1R9T J;  4HLY A;  3KZZ A;  3BR0 A;  3HRU A;  1IAW A;  1D0Z A;  3GTQ J;  1D8J A;  3Q0W A;  2VI6 A;  4DBQ A;  4C30 A;  3S32 A;  2Y0S A;  1CF7 B;  1T2K A;  1KYW A;  1P9Q C;  3LSM A;  3D5S C;  3AFH A;  2GZW A;  4NUB A;  5F04 A;  4UXN A;  1G3S A;  4IQ4 A;  5L3D A;  5EYR A;  1Z9C A;  2VPR A;  2NYX A;  3K4B A;  1BN5 A;  3V7S A;  2VOD A;  3PSF A;  4UNO A;  1J9I A;  4CH7 A;  1Z05 A;  5E1W A;  3MKW B;  1H9G A;  4U7B A;  2CQ7 A;  4MO7 A;  2R7V A;  2CFO A;  3GBG A;  1DDN A;  1NK3 P;  1R5H A;  2HOE A;  3ZMV A;  4XOT A;  3RPU D;  9ANT A;  3H36 A;  2M2E A;  3MWM A;  1OYW A;  2DMQ A;  3DLA A;  1YYV A;  1ZTR A;  1Z3X A;  4E7H A;  5D5W B;  4IRI A;  2A6T A;  4IHW A;  5H6R A;  3VYS B;  3WTV C;  4KUM A;  2L3D A;  1S72 I;  1IV8 A;  1R4M B;  3EET A;  4DGW B;  4HLX A;  2M8G X;  3QOD A;  1K6O A;  2LKS A;  4LD5 A;  4LB6 B;  3SEZ A;  4E7L A;  2DOD A;  3RPU A;  3I4P A;  1FSE A;  5DD8 A;  1MZB A;  4M3D A;  2O5R A;  2VAS A;  4MTD A;  3H1C A;  1SD5 A;  3KET A;  3HIF A;  5HNH A;  2LC2 A;  5D6F A;  2A6H F;  1DQU A;  2Y9Y A;  4MEY F;  1FMV A;  1OKR A;  3R60 A;  4LLG F;  2H27 A;  3HHG A;  3ZMZ A;  5A2Q K;  4MGR A;  3KFW X;  2DQR A;  4WX9 A;  3SFI A;  3TO9 A;  2AHQ A;  2D1H A;  4L0Y B;  3DKY A;  3ZMU A;  1XGO A;  2V6C A;  1AA7 A;  2ZSI B;  4UVA A;  1XMA A;  1ZQ3 P;  3I71 A;  3S1Q J;  3DCF A;  2BHZ A;  1VTN C;  3C18 A;  2H8W A;  1QHH D;  2COM A;  2EPF A;  1MH3 A;  2OZU A;  5DYM A;  3WE2 A;  2IS1 A;  3LSI A;  2B7E A;  1GLN A;  3H9G A;  3MD2 A;  4BU2 A;  1I50 J;  1ZG5 A;  4KMF A;  2DCE A;  4XLN F;  2K3P A;  3R6S A;  2QQ9 A;  4CCK A;  1P92 A;  3P9I A;  5CVJ A;  4XBF A;  1Z7U A;  1OR7 A;  2MD5 A;  2PFB A;  4CCJ A;  3QWL A;  4F7Z A;  1R5I D;  2BY1 A;  3ZCO A;  3HEF A;  3QPH A;  1CGP A;  3WTY C;  3EDP A;  1XSX A;  4ZDP A;  2FU4 A;  2P6S A;  4OAZ A;  2L9N A;  2VXZ A;  3E3V A;  4AVZ A;  5B1A H;  1A31 A;  3CZ6 A;  2W7N A;  3TW7 A;  3ELK A;  3KYL A;  2R7R A;  5BNG A;  1OCZ H;  3QAH A;  2HKX A;  3VB2 A;  5KAF C;  3K70 C;  2HDD A;  1K4T A;  2E1C A;  2NRA C;  2LD5 A;  1BIB A;  5FLX K;  3I3L A;  1OYY A;  4CHU A;  1WZ2 A;  3LNQ A;  1VZ0 A;  4M6Y A;  1WI3 A;  4C3H J;  4DBR A;  2ZXW H;  2Y2Z A;  1FY7 A;  3QPL A;  4ZZD A;  5B1B H;  4WWC A;  2WAF A;  2EA2 A;  2L01 A;  4BHC A;  5C44 J;  2E1M B;  2X85 A;  5EEG A;  5KAI C;  5EZG A;  3TDZ C;  5EGO B;  4EM0 B;  5FKO A;  3ZN0 A;  1O57 A;  2R5Z B;  2EIN H;  2YPR A;  5K5Q A;  2YR2 A;  3OYN A;  2V7F A;  3LSP A;  1VFC A;  2G9W A;  3BG7 A;  4Y17 A;  4N4N B;  3EPZ A;  1R58 A;  4UUS B;  1R36 A;  2DW4 A;  1F36 A;  1BA5 A;  1VQ8 I;  2BW3 B;  3BY6 A;  3QU6 A;  2MYS A;  3CTA A;  4LMY A;  2OD5 A;  5FJ8 J;  2XAH A;  2J5O A;  3DEU A;  3HL2 A;  2XGE A;  3K6G A;  3NAU A;  3REO A;  1A35 A;  1U5T A;  1U8R A;  2FBH A;  2FRH A;  2JSP A;  4RA2 A;  4Z6Y A;  3WGG A;  1ONV A;  3HUG B;  1K78 B;  3A01 A;  2E60 A;  1UEL B;  3BG9 A;  3BR5 A;  4C3I J;  1ZHF A;  4U7D A;  1YHQ I;  4I02 A;  2DK8 A;  1XX5 A;  3ZN1 A;  1IDZ A;  2DFH A;  2MC4 A;  3ZOB A;  3FXR A;  3OYB A;  2FBI A;  1IUF A;  1AOY A;  2P5K A;  3HUG A;  1K61 A;  3UR3 C;  5HDG A;  5BMZ A;  2DDA A;  3FXM A;  4C3J J;  2W57 A;  4XRS A;  1IJW C;  2HQN A;  3WTZ A;  2HXO A;  2P6T A;  4XL9 A;  5LEJ A;  3JAM K;  3OIO A;  1IDY A;  2P4W A;  4X1E A;  2XUB A;  4ZYH A;  3MEX A;  2E5N A;  3WOD F;  4BE1 A;  1ZRC A;  1XC5 A;  2CMP A;  5DUK A;  1F1Z A;  4M74 A;  1LE8 A;  4WK8 F;  4LIU A;  4D5F A;  3S15 J;  1YQA A;  4I0B A;  3VPR A;  1I3Q J;  1YX5 A;  2W25 A;  5D5X B;  4YIF A;  4G7Z F;  4I98 B;  4MIM A;  2HZD A;  4I99 C;  5AIQ A;  3LA2 A;  1SAU A;  3FXU A;  2EIM H;  2WAD A;  3WTX C;  1FP2 A;  3D5L A;  3OSF A;  3CDH A;  2UUZ A;  4KIF A;  1S3J A;  2JVH A;  2Y69 H;  4LGW A;  1U78 A;  3MKL A;  3L9F A;  1OFC X;  1Z3Y A;  2X6Y A;  5F6F A;  3J7Z I;  3WG9 A;  1R49 A;  2O9L A;  1E17 A;  4P5O A;  3R61 A;  2I8D A;  3F8B A;  4JX6 A;  3JRC A;  1W36 D;  5J40 A;  1N77 A;  1OCR H;  1WVR A;  5JLW A;  1YI2 I;  3KYD B;  1VQM I;  1J75 A;  2EFQ A;  2Z9O A;  1IO2 A;  4IL6 C;  1LJ9 A;  3QPT A;  5DS9 A;  2BV6 A;  5LBQ A;  1FTZ A;  4R79 A;  1YTY A;  4CCN A;  2CUF A;  4RMN A;  3LQR A;  2DJN A;  3GFI A;  1MD0 A;  3G71 I;  2VPL A;  1ZR2 A;  3GTO J;  2K9M A;  3BQZ A;  2LG4 A;  1EV7 A;  2VBX A;  4N9I A;  4F92 B;  3COA C;  1SFO J;  2OJE D;  3FMS A;  2DJI A;  4LLL A;  2V1U A;  3J7A Y;  3I56 I;  4XR6 A;  1FTT A;  3JSP A;  2XPV A;  2KIM A;  3TW6 A;  4BUP A;  1FX7 A;  2E35 A;  4GO1 A;  2HYF A;  3ULQ B;  1DP7 P;  2X4H A;  1RR7 A;  2E1O A;  2KPM A;  4A6E A;  5CVR A;  3OYD A;  2Y31 A;  5M5Y J;  1G4D A;  2HDC A;  1RES A;  2LOO A;  3DEW A;  3MN2 A;  2F2E A;  1MND A;  1WH5 A;  3CMM A;  1NH3 A;  5CQE A;  3V8L A;  2ZNZ A;  4L5J A;  1ZGJ A;  3ZQC A;  2QZ8 A;  3RQ4 A;  1D1B A;  3HG9 A;  4RB2 C;  2M5W A;  3DKW A;  4F55 A;  1YW9 A;  2XB0 X;  5CPR B;  3BJ6 A;  4F3Q A;  4BXX J;  2H6C A;  1U8B A;  3I55 I;  4A3M J;  1U3E M;  1FBU A;  1Y1W J;  2FF4 A;  2XIG A;  3ZQF A;  2L0K A;  4A3C J;  1XTA A;  3BG6 A;  2ELH A;  2P0W A;  1JUM A;  1VQ4 I;  1LNW A;  3DTE A;  4XOR A;  3RKQ A;  2RV8 A;  1YLF A;  3WTU C;  1Y1V J;  2HKO A;  4D7M A;  2LVS A;  2M0C A;  1LDD A;  4P9F A;  3CCJ I;  2E5Z A;  2A07 F;  1R1U A;  2BXY A;  3BPX A;  2KQR A;  5KVR A;  2V9K A;  1RNL A;  3WTT C;  3U9G A;  3TOB A;  4RAG A;  1MJ9 A;  1VQK I;  2TRT A;  6PAX A;  2ID6 A;  4BDZ A;  5DCF A;  2X0L A;  4RGX A;  1SEU A;  5D8K B;  1XGS A;  4NB5 A;  1QZE A;  2MA3 A;  2QEX I;  3W6V A;  1RKT A;  3DV8 A;  2XKO A;  2ID3 A;  4XN0 A;  5E79 C;  5DM6 F;  3LST A;  1QPM A;  2X6W A;  5ICE A;  2K85 A;  3ABL H;  3CCM I;  4Y3O A;  3I9V 2;  1ON2 A;  1FT9 A;  2QEN A;  2ZFW A;  3K4K A;  5J3L A;  1OCP A;  2L02 A;  3GLX A;  3F21 A;  1REP C;  4MHG A;  3BTJ A;  2DA5 A;  2H1L A;  4RGS A;  5JFR A;  4N0B A;  3FBI B;  3Q5F A;  2CO5 A;  2FNP A;  2DT5 A;  2GXA A;  1H8A C;  1YW7 A;  2M1B A;  1ZG1 A;  2FJ1 A;  2ZFU A;  4UUS A;  1MMN A;  4PK4 A;  3EUH A;  3K4N A;  4HA8 A;  4M9X A;  4LOC A;  2R7F A;  2FD5 A;  1VQ7 I;  4BE0 A;  1RPW A;  2Z99 A;  2K9L A;  3SYT A;  2ZME A;  3CLO A;  3GF2 A;  2QSF X;  3GTP J;  2X6O A;  2ME6 A;  1X3W B;  5CVU A;  1EF4 A;  1W5S A;  3QQA A;  4DW6 A;  1F43 A;  1TP4 A;  5JHU A;  2L9V A;  1KU7 A;  5L3B A;  2NOJ B;  1F5T A;  4RAF A;  4BEH A;  5LGN A;  3QOP A;  3CDI A;  1Y56 A;  1IC8 A;  2CH0 A;  2DMU A;  5ILS A;  4MLO A;  2VC0 A;  3IUO A;  3K4L A;  1T38 A;  4PSW A;  2HYJ A;  3KEQ A;  3LA7 A;  2JA2 A;  4I09 A;  3TL4 X;  3ERE D;  1VQ6 I;  1UG0 A;  3BTC A;  3Q9S A;  1XPX A;  4XKB A;  2VKV A;  2LR8 A;  2HNH A;  2Y0M A;  2MFZ A;  3K70 D;  1J7K A;  2CYY A;  4L18 B;  4A3F J;  4Y7N J;  5F27 A;  1YOV B;  4M9Z A;  4FET A;  4PDK A;  2VQH A;  5EG0 A;  4GCV A;  1PDN C;  4HDV A;  2L4A A;  4Q47 A;  3VEP A;  1HOM A;  4KJZ A;  1SFX A;  3ZQQ A;  3HTS B;  1Y39 A;  2OZ6 A;  3I59 B;  4EJO A;  2CQN A;  1MNM C;  3PL8 A;  3GO5 A;  2QBY B;  2KL4 A;  2QQB A;  4G94 A;  1A6I A;  2Y0S N;  2AXT C;  2EB7 A;  2OCC H;  2ZJQ F;  5E3L A;  2LNB A;  1IRX A;  4EM2 A;  2DK5 A;  2YU3 A;  1FEX A;  3U2R A;  4D9J A;  1V4R A;  2L7Z A;  2LDU A;  1UHW A;  4BKX A;  4QTR A;  1QU3 A;  4BQA A;  1FOK A;  1RUO A;  1B72 A;  3IP4 B;  2JA5 J;  3B6C A;  1JGS A;  3CP2 A;  4XRM A;  3Q0U A;  3CCU I;  1Z77 A;  3M3Y J;  5C4X J;  2UWM A;  4LG0 B;  4D5C A;  2QLZ A;  4Y52 J;  4YIR X;  3CO7 C;  2R7W A;  4EVI A;  3BQY A;  4ITV A;  2MG4 A;  4A0X A;  1MDM B;  3JRD A;  3DP7 A;  2QM3 A;  1IN8 A;  2KFD A;  3OYF A;  3WG7 H;  5GTI C;  4LG0 A;  3H3V K;  2V9V A;  3H3Z A;  3GFJ A;  3S14 J;  4AYB N;  3OYK A;  2MAB A;  3DWL E;  3HRM A;  1ZKG A;  3SJM A;  1TL8 A;  5TRD A;  4HQE A;  3RKY A;  3GX4 X;  3ML6 A;  1FYL A;  3NAR A;  5E3N A;  2WY7 Q;  2XAS A;  4XLA A;  1JHH A;  4MTE A;  1TNS A;  2FE3 A;  2VON A;  1JKP C;  2PJR A;  2LF7 A;  1TWA J;  1WSU A;  2D5V A;  2JA6 J;  4AYB A;  1GVD A;  2XC7 A;  4HBL A;  2DPD A;  4ZDO A;  1S7O A;  2ICW G;  2IA0 A;  3UKG A;  1B4A A;  2O7O A;  2XRL A;  2WWY A;  3CMY A;  3BOQ A;  3RTR A;  1ETO A;  1PUE E;  1VND A;  3P5J A;  1A04 A;  4NBQ A;  5K7H A;  2FX0 A;  3T8T A;  2X1D A;  4EJV A;  5IP7 J;  3OOP A;  2KDZ A;  1HST A;  1TT0 A;  2HTJ A;  3B6A A;  3FXJ A;  5D4R A;  2ADU A;  2LF8 A;  1XCV A;  2H94 A;  2RQQ A;  4XID A;  2DLL A;  1D5V A;  3GWZ A;  2FOK A;  3IAM 2;  3X2Q H;  2X9D A;  4ENN A;  5B3S H;  4OIO F;  1V54 H;  1MMA A;  1V5G A;  1MGT A;  3FMR A;  1G2H A;  2B9S A;  3RPQ A;  3A01 B;  3K2Z A;  3VSK A;  2PI0 A;  3OSG A;  3ASO H;  1BBY A;  1ZAO A;  2JN6 A;  4U0W A;  4EJT A;  2VXD A;  3RZO J;  3BZC A;  1A5J A;  2VJI A;  2PJP A;  5IY5 H;  4U87 A;  2KIS A;  2X51 A;  4ENJ A;  1IN4 A;  3PUF A;  2EK5 A;  4M3G A;  2DN0 A;  2W4S A;  3FXO A;  2UXX A;  1EJ9 A;  3OIP A;  2E2I J;  3KP2 A;  3MCZ A;  1YFH A;  1I1S A;  2RC4 A;  3ISP A;  2A6E F;  2VBY A;  5H20 A;  3LSH A;  4FE7 A;  4TV7 A;  2Z1D A;  1V3F A;  4AVP A;  3LAP A;  4LLN A;  1HW2 A;  1WJC A;  2EH3 A;  3OV8 A;  3RQI A;  2NOG A;  2R92 J;  2BOL A;  3Q0V A;  2LBF A;  4MQ9 F;  2DA2 A;  3BT9 A;  5JHF A;  2ZME B;  3KZI C;  1OMI A;  1QA6 A;  5HLI A;  3H5R A;  3JRI A;  1IG7 A;  3JSO A;  2XKP A;  2DI3 A;  1X58 A;  2FNA A;  2IS2 A;  3ASN H;  4UVB A;  2I10 A;  2ISY A;  2KIQ A;  1TNT A;  4LK0 F;  3IH3 A;  1OCO H;  2BY0 A;  3JRB A;  1YIO A;  2BVL A;  2XGX A;  1DGR M;  2NNN A;  3D5R C;  2JRT A;  1W5C C;  2FSW A;  4FAS D;  1FSH A;  5DTD A;  4AC0 A;  4F91 B;  2DMT A;  2O0Y A;  2PBI A;  3V4G A;  5ICC A;  3A0H C;  2IAI A;  2O3F A;  3NQO A;  2ZXH A;  3U1D A;  2PJR B;  3H92 A;  2L7M P;  1KU3 A;  4A3B J;  2K7L A;  2RVC A;  1AHD P;  1WJD A;  1IF1 A;  2LK2 A;  3TQN A;  3IL2 A;  3OR2 C;  4UV9 A;  3JRA A;  4HDU A;  3BTI A;  3IHU A;  5IYC J;  5HVQ C;  1S8N A;  5EF6 A;  4G6Q A;  2XSD C;  4WCG A;  4NHJ A;  2WAQ N;  2K4J A;  4Y15 A;  1RR8 C;  4G6T B;  2A5Y B;  3G1L A;  1ETY A;  1LQ1 A;  2HXI A;  2E1N A;  2Q2E B;  1H88 C;  4F93 B;  3LSJ A;  4PJN A;  3A4C A;  2NNY A;  5HOO A;  2K9Q A;  2HS5 A;  1IRZ A;  1V5E A;  4Q4Z F;  1VQP I;  4BAY A;  4CDG A;  2CSO A;  1ORK A;  4PJ0 C;  1Z1D A;  4IHV A;  2UV1 A;  3F3X A;  5FLV A;  1ZYR F;  2DT6 A;  2V4J C;  1QBJ A;  2XAU A;  3F6O A;  1D8K A;  1B72 B;  3LQQ A;  3HXL A;  4XMY A;  1LDJ A;  4RDU A;  4E7S A;  2UXN A;  4UHT A;  2DFF A;  2DTZ A;  2M9H A;  4NC7 A;  2A5W A;  2XAG A;  2O6G E;  2VE9 A;  4N9H A;  1FPQ A;  3TBI A;  1USS A;  1T56 A;  4GFB A;  3CCS I;  4ASN A;  1UB9 A;  2RNJ A;  3PQK A;  5HNF A;  4IPA A;  2H8R A;  3BJA A;  4RAY A;  1Y6I A;  3SDB A;  1MBJ A;  4ZZL A;  3N97 A;  3CUQ A;  3E6C C;  3EUH C;  3Q9V A;  3GME A;  3KP5 A;  1JHF A;  1TBX A;  2DMN A;  4RLF A;  1D3Y A;  5BS6 A;  4I76 A;  1ENH A;  5FLM J;  4UB6 C;  3MZ8 A;  2GIV A;  2VOP A;  3VDX A;  3VYU B;  2LKP A;  3F8F A;  1RIO H;  4ON0 A;  3ZR8 X;  3QPS A;  3M1E A;  3K9T A;  2QWW A;  3HOT A;  4KN4 X;  1JT6 A;  3FDY A;  4A3J J;  4V2G A;  5H2F C;  3OWT A;  3ZMS A;  3E1S A;  4AU7 A;  2DU9 A;  2VIX A;  4BBR J;  5D5V B;  1W0U A;  2QBY A;  2N8G A;  1TW2 A;  3I58 A;  3JAM Z;  1IXR C;  4ZC3 A;  3WHB A;  2EIK H;  2EV5 A;  1PUF B;  5K1Y A;  4R8H A;  5IP9 J;  3E5U A;  4DYR A;  3HRS A;  3S8P A;  1GXP A;  1TQM A;  1I5Z A;  5GAH J;  2W82 A;  4XON A;  1D1A A;  5BQT A;  2QSG X;  3J7A O;  4IHS A;  2Y75 A;  3J7Y J;  4B43 A;  4ZDL A;  5LEK A;  5D8L B;  2M45 A;  2EJR A;  3CO6 C;  4KA4 A;  3JRF A;  4S0H B;  2V6E A;  4QPQ A;  3ABT A;  2FMY A;  1FC3 A;  4V19 K;  2HQA A;  2CW8 A;  3SFZ A;  4AIH A;  2GQQ A;  2QYO A;  1OCC H;  2Z16 A;  2ESN A;  3LAJ A;  3W6J B;  2PMU A;  4B47 A;  1QO0 D;  1B9M A;  3JW4 A;  1VI0 A;  3HSR A;  2F6C A;  5FRN A;  2YX4 A;  3MZH A;  5CKT A;  3M1C A;  5BPD A;  4WXC A;  5L3E A;  4XKW A;  4Z2Y A;  1YRN A;  3OY9 A;  1MKM A;  3IAS 2;  1XG1 A;  4M73 A;  3H5A A;  4M6X A;  4FX4 A;  2Y9Z A;  1X19 A;  2F48 A;  4I01 A;  3CCL I;  2XF6 A;  4P9U A;  2JA8 J;  1PUF A;  1U5T B;  4A0Z A;  2GAU A;  3VFZ A;  1L0O C;  2F4I A;  3DPL C;  3F23 A;  2Q0O A;  1HF0 A;  2EFO A;  2MH2 A;  4QSH A;  3CF5 F;  4FCY A;  3DF8 A;  4YFX F;  3FMQ A;  3S3N A;  1TQP A;  1D0X A;  2IS6 A;  4FX0 A;  5HOD A;  2BY2 A;  1FOY A;  2XHK A;  4JK1 X;  4IHX A;  2JWT A;  2AXL A;  4J01 A;  4NC6 A;  4AIK A;  5E8I A;  1BI1 A;  1IZ1 A;  2ZKZ A;  3F22 A;  1UST A;  3BP8 A;  4IHY A;  2MBF A;  5IP6 A;  4XRF A;  3M8J A;  2GBY A;  1H89 C;  3OMY A;  5LGU A;  3OYG A;  3DKX A;  1JTY A;  5B5E C;  4WXH A;  3HDD A;  1X1B A;  3KYC B;  2KJC A;  3E7L A;  2C6Y A;  1HDP A;  3OR1 C;  3NWS A;  4PJL A;  2K86 A;  1WKM A;  3DPT A;  5M5X J;  3S1N J;  3PIO F;  2LTP A;  3FM3 A;  2K4B A;  2NS7 A;  5JVT A;  4A3G J;  2XGD A;  2DOA A;  5AIP A;  2JUG A;  2VN2 A;  1LKX A;  1RI7 A;  2VL8 A;  3CES A;  3GZ6 A;  2CV0 A;  1IN6 A;  3KCC A;  4IOC F;  5J4Y A;  1MBE A;  2WAE A;  2X6X A;  3L2R A;  1MMD A;  2IA1 A;  2KZG A;  4XIC A;  5ICG A;  1GHC A;  1OR7 C;  4IEJ A;  4ETS A;  3AG2 H;  2JA7 J;  2VLA A;  4MFD A;  1KYZ A;  2HVQ A;  2YUS A;  4L9V A;  1WH7 A;  5JVG F;  1GXQ A;  2NS0 A;  1UHM A;  1IN7 A;  4I7H A;  2CV1 A;  4IQJ A;  4EJU A;  1ETQ A;  1MH4 A;  3RCO A;  1OJL A;  1NK2 P;  1OLT A;  4BGD A;  1LUJ B;  2STW A;  4EGY A;  3VYT B;  3PNT A;  4N4O B;  1APL C;  1B1B A;  2ZNY A;  1EH6 A;  2BYV E;  4A6D A;  3BR6 A;  3OYI A;  1RC9 A;  3U1K A;  2V9P A;  2L54 A;  4E7I A;  1SFE A;  2EFN A;  4BXU A;  3IWZ A;  3L1P A;  1S5L C;  2BZT A;  2F5C A;  3GTG J;  2KZV A;  1R4N B;  2O03 A;  3DQV C;  5CYV A;  2DPU A;  3P9K A;  3E5X A;  4J19 A;  2B63 J;  4NQW A;  1HQC A;  4BAC A;  2RNG A;  4CXF A;  1S29 A;  1R23 A;  2CRG A;  3WE3 A;  2V1X A;  3ZRG A;  3EQL F;  4QLC U;  3J80 Z;  1BI0 A;  3F8N A;  4PZJ A;  2LMD A;  4AWX B;  2IJL A;  4IKF A;  2DYR H;  1BR2 A;  4IZZ A;  2XPW A;  2ZJR F;  1IUY A;  4AM3 A;  3ZMT A;  4DOZ A;  2CWE A;  5JLX A;  1KQ9 A;  4PCQ A;  4E7K A;  3DTK A;  2BXZ A;  3W2W A;  4O6J A;  3DU6 A;  5KHD A;  3PNY A;  3E5Q A;  2DMP A;  3FBN B;  5J8C A;  4KIS A;  3RIR A;  5E8G A;  3KP6 A;  2JK3 A;  3MKY B;  3A0B C;  1POG A;  3CD6 I;  1SD6 A;  3GTK J;  1PP8 F;  4BQQ A;  4XOP A;  1MMG A;  5DV5 A;  1JT0 A;  2HEO A;  3T0Y A;  2VQL A;  3EYY A;  4HAM A;  3FK7 A;  3FM5 A;  1RUN A;  4BL0 B;  3BWG A;  5H6Q A;  2PMZ N;  1BI2 A;  3FHN A;  1TTY A;  3GVA A;  2H6B A;  1SAX A;  3IH2 A;  4XKV A;  1FLI A;  5FKL A;  1Q1H A;  3SZG A;  1I3A A;  4E70 A;  4YG2 F;  3GZ5 A;  3BZK A;  4II2 A;  2EZH A;  3BJO A;  3L09 A;  3KEY A;  4HEA 2;  1G3T A;  1FJL A;  3HRT A;  2DBB A;  3GTL J;  4PSX A;  2E36 A;  4RGU A;  4UVC A;  1QZY A;  4MQV A;  3WHC A;  4H0E A;  2LY1 A;  1U2W A;  3PFY A;  3MMY B;  4U0V A;  2BE5 F;  2DT7 B;  1WWX A;  5CQG A;  4LFU A;  3CCR I;  3M07 A;  3TP0 A;  1Y0N A;  5IYD J;  1ACI A;  2P5V A;  3FKI J;  1VQ9 I;  2Y30 A;  2KRH A;  4BYY A;  3GLL A;  3HTU A;  3KX2 A;  3S2W A;  1LPQ A;  4HST A;  4GXO A;  4GYI A;  4BDY A;  4FTH A;  1QPI A;  1P4A A;  2L9S A;  3SQN A;  4JP0 A;  2OBP A;  1KGS A;  1NG7 A;  1RRJ A;  2GA2 A;  1B8I B;  1W7P A;  4KIT B;  3ABK H;  5F08 A;  1Z91 A;  3ZQI A;  3IRR A;  1FMW A;  4CIC A;  4DYC A;  1N25 A;  5K5O A;  3OS0 A;  3AKZ A;  1CF7 A;  2BVM A;  2QQ8 A;  1JGG A;  3G1O A;  3F0C A;  5HS8 A;  3S17 J;  1S6L A;  2FQ4 A;  2K3F A;  1XGM A;  4FE4 A;  3HOY J;  1X4O A;  4OMZ A;  3CF2 A;  1ZRD A;  1BI3 A;  4ZYA A;  2K40 A;  1MNE A;  4ESJ A;  2M7B A;  1ZLK A;  1ZEL A;  2PEX A;  5J47 A;  3TP3 A;  5LGT A;  3BLY A;  5DM7 F;  1XMX A;  2QVO A;  2P7C B;  1P7I A;  4XKC A;  3QP6 A;  3BR1 A;  3JRH A;  1HBX G;  1ZRF A;  4LG3 A;  5FFX A;  4G12 A;  4HW0 A;  1GV2 A;  2NVT J;  4AID A;  2M87 A;  1MBF A;  1WPK A;  3NRV A;  3DLL F;  2FQ3 A;  3LMM A;  1OYI A;  3L00 A;  3E6D A;  1SVL A;  4E7Z A;  4OAY A; 
#chains in the Genus database with same CATH homology
 2IP2 A;  4Q48 A;  1WQ2 A;  1ZN2 A;  4BNC A;  3B73 A;  2PQ8 A;  4P96 A;  2ZBK A;  3RJP A;  3TO7 A;  5DEQ A;  3KE2 A;  2H09 A;  3FF5 A;  5FB2 A;  4ESB A;  2O61 A;  3KP7 A;  5E1Z B;  3DFG A;  1G6N A;  1STZ A;  2W84 A;  4OIP F;  1DPR A;  1WRJ A;  1P2F A;  4U0Y A;  1R5G A;  2JTV A;  1J2X A;  2VBZ A;  3J81 Z;  1XN7 A;  3L2C A;  3IRQ A;  2DAO A;  1H9T A;  4WXD A;  4I2O A;  1ZAR A;  3BDD A;  3J80 K;  4G7H F;  1SD7 A;  1K78 A;  4ENM A;  2VE8 A;  2EV6 A;  3BRO A;  2XAJ A;  4DNC A;  2D45 A;  3W6K B;  3T1B A;  1ZLJ A;  3V7C A;  4KYW A;  5F1R A;  4KIG A;  2HGC A;  5CVI A;  2F5E A;  1MJB A;  3H3U A;  1O3R A;  2A3S A;  2RGV A;  3MFK A;  4HV5 A;  3ZPL A;  1W4M A;  4EV0 A;  2WTE A;  4M9S A;  1P4W A;  1KA8 A;  2EV0 A;  1YS7 A;  3M9A A;  5AON A;  2CW0 F;  2F5F A;  2ZCW A;  3GEZ A;  3C1D A;  1L3L A;  3C7J A;  2OA4 A;  2XAF A;  2VOO A;  4KDP A;  1T98 A;  2Z3Y A;  4CZZ A;  2A69 F;  1ZH5 A;  4L5I A;  2GXG A;  2RN7 A;  3K1M A;  1BM9 A;  4AIJ A;  2STT A;  3O6B B;  3SZT A;  3RKW A;  2FEZ A;  1YS6 A;  1B6A A;  3GYH X;  2HQR A;  2WC2 A;  4HF0 A;  3I59 A;  1G3Y A;  1S7A A;  3ECH A;  2Z5U A;  4P55 A;  1XDU A;  1X3U A;  4O5V A;  3E97 A;  4S05 A;  3RDI A;  2HWV A;  1R7J A;  2VC1 A;  4I0A A;  3V8J A;  3SHF A;  4UUV A;  1IXS B;  3HSE A;  3RYR A;  2A61 A;  1IN5 A;  4RB1 A;  3RI4 A;  4G8X A;  4G6D A;  5D4S A;  4U88 A;  1J0R A;  4RGR A;  4XSX F;  3GFL A;  4KNY A;  4FHT A;  2HTS A;  2GA1 A;  3R4K A;  4CO8 A;  4HX8 A;  4B8X A;  2J5P A;  2FML A;  1IXC A;  2W24 A;  2PLY A;  4EGZ A;  3GUD A;  3T8R A;  5F64 A;  4L9N A;  3F6V A;  3AAF A;  3WTW C;  2QUF A;  4HYE A;  2RQP A;  2IT0 A;  4DQ2 A;  5DD4 A;  3I5U A;  3K1N A;  4K2E A;  2VT3 A;  3TOA A;  3GW2 A;  3GXO A;  3LA3 A;  1O7L A;  4OIQ F;  3LWF A;  5IT9 Z;  3TDU C;  3PQJ A;  5CJ9 A;  2MLG A;  1FNN A;  3FWE A;  3TKY A;  1FYM A;  4ESF A;  3BPV A;  5FGM A;  5CLS A;  5ED4 A;  1HXD A;  4L9J A;  5E17 F;  1TW3 A;  2EFW A;  2WV0 A;  5IT3 A;  1Y0U A;  3MQ0 A;  4L0Z B;  3RKX A;  5LHI A;  4PGH A;  4QWQ A;  3M8F A;  3R0J A;  4KMU X;  2GWR A;  5HDK A;  1NHA A;  5FD6 A;  5LHG A;  2K27 A;  1O3Q A;  4OU0 A;  1QZZ A;  5DCM A;  4ZYD A;  2D2W A;  1FBQ A;  1Z6R A;  2P7V B;  4BHB A;  1HKQ A;  1KQ8 A;  4CYD A;  3FX3 A;  4ENK A;  3WGH A;  1QGP A;  2EA4 A;  2YX7 A;  4IHT A;  2P8T A;  5LHH A;  1ZGA A;  1ULY A;  4A2U A;  1FZP B;  2V1D A;  1XGN A;  1SFU A;  4HV6 A;  1J59 A;  1W5T A;  3K69 A;  2KIU A;  2B0L A;  1E2X A;  1BC7 C;  5DUI A;  4EQQ A;  4S04 A;  4GYG A;  4RB0 A;  2RDP A;  2ACJ A;  3O2P E;  2QQA A;  1DUX C;  1RZ4 A;  4EM1 A;  2OQR A;  1KU2 A;  3E6B A;  1BC8 C;  2E7X A;  2KRF A;  4IJA A;  4HZF A;  2MH9 A;  1ZRE A;  3K1P A;  5J6X A;  5L3F A;  1YG2 A;  1HKS A;  4BHP A;  1MJA A;  1XSD A;  2YSR A;  3G73 A;  5KK1 A;  1WI9 A;  1HW5 A;  2IRF G;  2R3S A;  3F8M A;  1C0W A;  2EWN A;  1XDS A;  3C3W A;  4R1H A;  3FHZ A;  3F72 A;  1B9N A;  3L7W A;  4M71 A;  4O3M A;  5E18 F;  3M7G A;  4G9Y A;  3KP3 A;  4LJZ F;  2F5D A;  1YO5 C;  5DDG A;  3NEU A;  2IVM A;  3I0T A;  1O3S A;  3K0L A;  4WF2 A;  5BPI A;  1R00 A;  3I54 A;  2HFH A;  4JQF A;  4XSZ F;  5JI6 A;  5ICF A;  2FBK A;  1HKT A;  3HOS A;  3T5X A;  1U6G A;  2D1V A;  1AWC A;  1LB2 A;  3IWF A;  4M72 A;  3JTG A;  1I27 A;  1R1V A;  1LEA A;  3IKV A;  1G3W A;  5DCM B;  2MLK A;  1TLH B;  4AD9 A;  2K02 A;  2KKO A;  3KP4 A;  4KT5 C;  4A5M A;  3IC7 A;  3TGN A;  1Z6T A;  2JPB A;  2BGC A;  3WU0 A;  2A68 F;  3LFK A;  3QP5 A;  4MEX F;  1HSJ A;  5HS7 A;  1K7A A;  2IPQ X;  1B59 A;  2PMH A;  2VBW A;  2HYG D;  4L9T A;  2KIF A;  4RB3 C;  3ECO A;  3V8K A;  5FLX Z;  3ZP5 A;  1QNT A;  1W7P D;  1OPC A;  2FXA A;  4XLP F;  4EMS A;  4A5N A;  3P7N A;  1LDK B;  4HF1 A;  2JSC A;  3I64 A;  5LRR A;  5EEH A;  1XSV A;  2E7W A;  1SMY F;  4YII A;  4MNU A;  3HSF A;  2XRO A;  4LB5 A;  1O7F A;  1TQI A;  5HS9 A;  3QU3 A;  2ETH A;  2CQK A;  3WU1 B;  4IRH A;  2G7H A;  3SXY A;  4HX4 A;  4YFN F;  3BZ6 A;  5IT9 K;  2DO7 A;  3GFM A;  3PFI A;  4RS8 A;  1IW7 F;  2Y48 A;  2ZJ2 A;  2JZY A;  2M8E A;  3DXJ F;  5L3C A;  3WTS C;  1EH7 A;  2CFX A;  4HX7 A;  4ZYG A;  3P9C A;  5HDN A;  2G7U A;  2ZO4 A;  1ODD A;  3B02 A;  2XVC A;  3G3Z A;  2PG4 A;  3QRF F;  3KZY A;  3JTH A;  2IA2 A;  5D5U B;  1LVA A;  2NAZ A;  1QQI A;  2Q2E A;  1GVJ A;  1JE8 A;  3V7R A;  3D0S A;  3VOD A;  2DFI A;  5ERI A;  5FO5 A;  1ZG3 A;  3CJN A;  2RKH A;  2ZXJ A;  4A12 A;  2XAQ A;  2UZK A;  2HR3 A;  4IVN A;  1IRF A;  2EFP A;  1FBS A;  5HLG A;  4ZYE A;  5CVV A;  3TO6 A;  5D6E A;  1T0F A;  3J81 K;  1I6X A;  4Q5S F;  2AS5 F;  3R0A A;  4PGG A;  2OAZ A;  3E6M A;  1XB4 A;  2W85 A;  2BEO A;  4KFC A;  1XD7 A;  2OU2 A;  1FYK A;  1FWZ A;  4KN7 X;  2O8X A;  2Z33 A;  1U5T C;  4OIN F;  3KEO A;  1DPU A;  4UV8 A;  4D0P A;  3CUO A;  4JBA A;  4G7O F;  3RYP A;  3KLO A;  2LSO A;  4OOI A;  4Y13 A;  5K5R A;  1FP1 D;  1UFM A;  4CGZ A;  1P4X A;  3M8E A;  2ESH A;  1YW8 A;  2L4M A;  1R22 A;  2PN6 A;  2M30 A;  2KJB A;  4HQM A;  3ZMD A;  3ROU A;  4LK1 F;  1T39 A;  1IRG A;  3ZQ7 A;  3I53 A;  1BIA A;  2V79 A;  2DQL A;  1T6S A;  3N4M A;  2FA5 A;  3MAJ A;  3CUQ B;  3HYI A;  5J8F A;  2JPC A;  3HHH A;  3CUQ C;  1BOA A;  4RAZ A;  5TJJ A;  1K79 A;  2CG4 A;  4YFK F;  2OQG A;  1SD4 A;  5E20 A;  3KLN A;  1BJA A;  5A2Q Z;  4FT8 A;  5FD5 A;  2XV4 S;  5ILV A;  4IXA A;  1O3T A;  4B09 A;  2XRN A;  1MDM A;  1SMT A;  3SZP A;  1F9N A;  1JXS A;  1LEB A;  4GGG A;  1H0M A;  1P6R A;  1KQ0 A;  4IRG A;  4IF4 A;  4OIR F;  2IW5 A;  2VT2 A;  5E1X A;  1EH8 A;  4HOB A;  4A0Y A;  5BOX A;  2R7D A;  5HLH A;  5ILU A;  1KU9 A;  3IKT A;  3FZV A;  2ISZ A;  4KIB A;  1F4K A;  2CGP A;  3EYI A;  4EJW A;  1XMK A;  4KIC A;  5LRS A;  3MZY A;  2GXB A;  2DTR A;  3ABU A;  1UCR A;  3VOE A;  3WGI A;  1I1G A;  1PP7 U;  4OMY A;  1R1T A;  5L3G A;  3F8C A;  2Q8K A;  5JR3 A;  2BBY A;  2P5L C;  2TDX A;  4HF2 A;  4BH9 A;  1XCB A;  5LLQ A;  3FXQ A;  1W7P B;  3O3K A;  4ZH4 F;  1HW1 A;  2JT1 A;  5FFZ A;  1ON1 A;  2HZT A;  2MC3 A;  1J5Y A;  4HLY A;  3KZZ A;  3HRU A;  1D8J A;  1IAW A;  1CF7 B;  1T2K A;  1KYW A;  2GZW A;  4UXN A;  1G3S A;  5L3D A;  1Z9C A;  2NYX A;  1BN5 A;  3V7S A;  2VOD A;  4UNO A;  1J9I A;  1Z05 A;  5E1W A;  1H9G A;  4U7B A;  1DDN A;  1R5H A;  2HOE A;  3ZMV A;  3MWM A;  1OYW A;  1YYV A;  4IRI A;  5D5W B;  5H6R A;  3WTV C;  4KUM A;  2L3D A;  3EET A;  4HLX A;  1K6O A;  4LD5 A;  4LB6 B;  3RPU A;  3I4P A;  1FSE A;  5DD8 A;  1MZB A;  4MTD A;  1SD5 A;  3KET A;  3HIF A;  5D6F A;  2A6H F;  4MEY F;  1OKR A;  3R60 A;  4LLG F;  2H27 A;  3HHG A;  3ZMZ A;  5A2Q K;  4MGR A;  3KFW X;  2DQR A;  4WX9 A;  3TO9 A;  2D1H A;  4L0Y B;  3ZMU A;  1XGO A;  2V6C A;  4UVA A;  1XMA A;  3I71 A;  1VTN C;  3C18 A;  2COM A;  2OZU A;  5DYM A;  3WE2 A;  1ZG5 A;  4KMF A;  4XLN F;  3R6S A;  2QQ9 A;  1P92 A;  3P9I A;  5CVJ A;  4XBF A;  1Z7U A;  1OR7 A;  2MD5 A;  2PFB A;  4F7Z A;  3QPH A;  1CGP A;  3WTY C;  3EDP A;  1XSX A;  2FU4 A;  2P6S A;  2VXZ A;  3E3V A;  3ELK A;  3QAH A;  2HKX A;  3VB2 A;  2E1C A;  2NRA C;  1BIB A;  5FLX K;  1OYY A;  4CHU A;  4M6Y A;  4ZZD A;  1FY7 A;  4WWC A;  2EA2 A;  2L01 A;  4BHC A;  5EEG A;  3TDZ C;  4EM0 B;  3ZN0 A;  1O57 A;  2YPR A;  5K5Q A;  2YR2 A;  2G9W A;  4Y17 A;  1R58 A;  1R36 A;  2DW4 A;  3BY6 A;  3QU6 A;  3CTA A;  4LMY A;  2OD5 A;  2XAH A;  2J5O A;  3DEU A;  3REO A;  1U5T A;  1U8R A;  2FBH A;  2FRH A;  3WGG A;  1ONV A;  1K78 B;  1ZHF A;  4U7D A;  4I02 A;  2DK8 A;  3ZN1 A;  3FXR A;  2FBI A;  1AOY A;  2P5K A;  3HUG A;  5HDG A;  5BMZ A;  2W57 A;  2HQN A;  3WTZ A;  2P6T A;  5LEJ A;  3JAM K;  2P4W A;  2XUB A;  4ZYH A;  3MEX A;  3WOD F;  1ZRC A;  5DUK A;  1F1Z A;  4M74 A;  4WK8 F;  1YQA A;  4I0B A;  2W25 A;  5D5X B;  4YIF A;  4G7Z F;  4I98 B;  5AIQ A;  3LA2 A;  3FXU A;  3WTX C;  1FP2 A;  3D5L A;  3CDH A;  4KIF A;  1S3J A;  1U78 A;  4LGW A;  3L9F A;  5F6F A;  3WG9 A;  1E17 A;  4P5O A;  3R61 A;  3F8B A;  1J75 A;  2EFQ A;  2Z9O A;  1LJ9 A;  3QPT A;  2BV6 A;  5LBQ A;  4R79 A;  1YTY A;  3LQR A;  3GFI A;  1MD0 A;  1EV7 A;  2VBX A;  4N9I A;  3COA C;  3FMS A;  4LLL A;  2V1U A;  3JSP A;  2KIM A;  1FX7 A;  4GO1 A;  2HYF A;  3ULQ B;  1DP7 P;  2X4H A;  4A6E A;  5CVR A;  1G4D A;  2HDC A;  2F2E A;  3V8L A;  2ZNZ A;  4L5J A;  1ZGJ A;  2QZ8 A;  4RB2 C;  2M5W A;  3DKW A;  1YW9 A;  3BJ6 A;  2H6C A;  1U3E M;  1FBU A;  2FF4 A;  2XIG A;  2ELH A;  1LNW A;  2RV8 A;  1YLF A;  3WTU C;  2HKO A;  1LDD A;  4P9F A;  2A07 F;  1R1U A;  3BPX A;  5KVR A;  1RNL A;  3WTT C;  3U9G A;  3TOB A;  1MJ9 A;  6PAX A;  5DCF A;  2X0L A;  4RGX A;  5D8K B;  1XGS A;  4NB5 A;  2MA3 A;  3DV8 A;  2XKO A;  3LST A;  1QPM A;  5ICE A;  1ON2 A;  1FT9 A;  2QEN A;  2ZFW A;  2L02 A;  3GLX A;  3F21 A;  1REP C;  4MHG A;  5JFR A;  4RGS A;  4N0B A;  3Q5F A;  2CO5 A;  2FNP A;  2DT5 A;  1YW7 A;  2M1B A;  1ZG1 A;  3EUH A;  4HA8 A;  4M9X A;  2R7F A;  2Z99 A;  2ZME A;  3CLO A;  3GF2 A;  5CVU A;  1W5S A;  5JHU A;  1KU7 A;  5L3B A;  1F5T A;  5LGN A;  3QOP A;  5ILS A;  2VC0 A;  1T38 A;  3LA7 A;  3KEQ A;  4I09 A;  3ERE D;  3Q9S A;  2Y0M A;  1J7K A;  2CYY A;  4L18 B;  4M9Z A;  4PDK A;  4GCV A;  1PDN C;  4HDV A;  2L4A A;  4Q47 A;  3VEP A;  1SFX A;  3HTS B;  2OZ6 A;  3I59 B;  4EJO A;  3GO5 A;  2QBY B;  2QQB A;  4G94 A;  2EB7 A;  2LNB A;  4EM2 A;  2DK5 A;  2YU3 A;  3U2R A;  1V4R A;  2LDU A;  1UHW A;  4BQA A;  1FOK A;  1RUO A;  1JGS A;  2UWM A;  4LG0 B;  2QLZ A;  3CO7 C;  4EVI A;  4A0X A;  1MDM B;  3DP7 A;  2QM3 A;  1IN8 A;  4LG0 A;  2V9V A;  3H3Z A;  3GFJ A;  3HRM A;  5TRD A;  4HQE A;  3RKY A;  3GX4 X;  3ML6 A;  1FYL A;  2XAS A;  1JHH A;  4MTE A;  1TNS A;  2FE3 A;  2VON A;  2LF7 A;  1WSU A;  4HBL A;  2DPD A;  1S7O A;  2IA0 A;  1B4A A;  2WWY A;  3BOQ A;  3RTR A;  1PUE E;  1A04 A;  3T8T A;  4EJV A;  3OOP A;  1HST A;  2HTJ A;  5D4R A;  2ADU A;  2LF8 A;  1XCV A;  2H94 A;  2DLL A;  1D5V A;  3GWZ A;  4ENN A;  2FOK A;  4OIO F;  1MGT A;  3FMR A;  3RPQ A;  3K2Z A;  2PI0 A;  1BBY A;  1ZAO A;  4U0W A;  4EJT A;  2PJP A;  4ENJ A;  1IN4 A;  2EK5 A;  2UXX A;  3KP2 A;  3MCZ A;  1YFH A;  1I1S A;  2RC4 A;  3ISP A;  2A6E F;  2VBY A;  5H20 A;  4TV7 A;  3LAP A;  1V3F A;  4AVP A;  4LLN A;  1HW2 A;  3OV8 A;  4MQ9 F;  2ZME B;  1OMI A;  5HLI A;  3JSO A;  2XKP A;  2DI3 A;  2FNA A;  4UVB A;  2ISY A;  1TNT A;  4LK0 F;  1YIO A;  2XGX A;  2NNN A;  2JRT A;  2FSW A;  1FSH A;  2O0Y A;  2PBI A;  3V4G A;  5ICC A;  2O3F A;  3NQO A;  3U1D A;  3H92 A;  1KU3 A;  2K7L A;  2RVC A;  1IF1 A;  3TQN A;  3IL2 A;  4UV9 A;  4HDU A;  3IHU A;  5HVQ C;  1S8N A;  4G6Q A;  4WCG A;  4NHJ A;  2K4J A;  4Y15 A;  2A5Y B;  1LQ1 A;  2E1N A;  2NNY A;  5HOO A;  2HS5 A;  4Q4Z F;  4BAY A;  4CDG A;  2CSO A;  1Z1D A;  3F3X A;  1ZYR F;  1QBJ A;  3F6O A;  1D8K A;  3LQQ A;  1LDJ A;  2UXN A;  4UHT A;  2XAG A;  2O6G E;  2VE9 A;  4N9H A;  1FPQ A;  1USS A;  4ASN A;  1UB9 A;  2RNJ A;  3PQK A;  4IPA A;  3BJA A;  4RAY A;  4ZZL A;  3N97 A;  3CUQ A;  3E6C C;  3Q9V A;  3KP5 A;  1JHF A;  1TBX A;  1D3Y A;  5BS6 A;  2GIV A;  2VOP A;  2LKP A;  3F8F A;  1RIO H;  4ON0 A;  3M1E A;  3K9T A;  2QWW A;  3HOT A;  4KN4 X;  3ZMS A;  2DU9 A;  5D5V B;  2QBY A;  3JAM Z;  1TW2 A;  3I58 A;  1IXR C;  2EV5 A;  5K1Y A;  4R8H A;  3E5U A;  3HRS A;  1GXP A;  1TQM A;  1I5Z A;  5BQT A;  3J7A O;  4IHS A;  2Y75 A;  5LEK A;  5D8L B;  2M45 A;  2EJR A;  3CO6 C;  4KA4 A;  3ABT A;  2FMY A;  1FC3 A;  3SFZ A;  4AIH A;  2GQQ A;  2QYO A;  2ESN A;  3LAJ A;  3W6J B;  2PMU A;  1QO0 D;  1B9M A;  3JW4 A;  3HSR A;  2YX4 A;  3MZH A;  5BPD A;  4WXC A;  5L3E A;  4Z2Y A;  1MKM A;  4M73 A;  4M6X A;  4FX4 A;  4I01 A;  4P9U A;  1U5T B;  4A0Z A;  2GAU A;  3VFZ A;  1L0O C;  3DPL C;  3F23 A;  2Q0O A;  2EFO A;  2MH2 A;  3DF8 A;  4YFX F;  3FMQ A;  1TQP A;  4FX0 A;  2XHK A;  4JK1 X;  2AXL A;  4AIK A;  5E8I A;  1BI1 A;  1IZ1 A;  2ZKZ A;  3F22 A;  1UST A;  3BP8 A;  2MBF A;  4XRF A;  5LGU A;  4WXH A;  2KJC A;  2C6Y A;  2K86 A;  1WKM A;  3DPT A;  3FM3 A;  2K4B A;  5JVT A;  5AIP A;  2VN2 A;  1RI7 A;  3GZ6 A;  1IN6 A;  3KCC A;  2IA1 A;  5ICG A;  1GHC A;  4ETS A;  1KYZ A;  4L9V A;  1GXQ A;  2NS0 A;  1UHM A;  1IN7 A;  4I7H A;  4EJU A;  2STW A;  4EGY A;  1B1B A;  2ZNY A;  1EH6 A;  2BYV E;  4A6D A;  2L54 A;  1SFE A;  2EFN A;  4BXU A;  3IWZ A;  2F5C A;  2O03 A;  3DQV C;  5CYV A;  2DPU A;  3P9K A;  3E5X A;  4NQW A;  1HQC A;  4CXF A;  1S29 A;  1R23 A;  3WE3 A;  2V1X A;  3EQL F;  4QLC U;  3J80 Z;  1BI0 A;  3F8N A;  4PZJ A;  4AWX B;  2IJL A;  1IUY A;  3ZMT A;  2CWE A;  1KQ9 A;  4PCQ A;  4O6J A;  3E5Q A;  5J8C A;  3RIR A;  5E8G A;  3KP6 A;  1SD6 A;  1PP8 F;  2HEO A;  5DV5 A;  3T0Y A;  3EYY A;  4HAM A;  3FM5 A;  1RUN A;  3BWG A;  5H6Q A;  1BI2 A;  1TTY A;  3GVA A;  2H6B A;  1SAX A;  1FLI A;  1Q1H A;  4E70 A;  4YG2 F;  3GZ5 A;  3BJO A;  3L09 A;  1G3T A;  3HRT A;  2DBB A;  4RGU A;  4UVC A;  1QZY A;  4MQV A;  4H0E A;  1U2W A;  4U0V A;  2BE5 F;  1WWX A;  4LFU A;  2P5V A;  4BYY A;  3HTU A;  3S2W A;  4GXO A;  4GYI A;  1P4A A;  3SQN A;  2OBP A;  1KGS A;  2GA2 A;  1W7P A;  1Z91 A;  3IRR A;  1CF7 A;  4CIC A;  5K5O A;  5HS8 A;  1S6L A;  1XGM A;  4OMZ A;  1ZRD A;  1BI3 A;  4ESJ A;  1ZLK A;  2PEX A;  5LGT A;  2QVO A;  2P7C B;  3QP6 A;  1HBX G;  1ZRF A;  5FFX A;  4HW0 A;  2M87 A;  3NRV A;  2FQ3 A;  1OYI A;  3L00 A;  3E6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...