5K5QA

Structure of aspa-dna complex: novel centromere bindng protein-centromere complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords AspA
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
total genus 29
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k5qA00
1BBYA 1BN5A 1TNTA 4MNUA 4M6XA 3CUOA 1ZAOA 2ZKZA 3GW2A 3D0SA 1MGTA 2FU4A 4LD5A 3V7CA 3ISPA 3ROUA 3IKTA 4HF1A 2VC0A 4ESBA 1B59A 3LQRA 1I27A 1QBJA 1FC3A 3DXJF 2A6EF 5ILUA 3GFJA 3KEQA 3U1DA 1MKMA 1D3YA 5DV5A 2PJPA 3FF5A 4P96A 4UVAA 4L9JA 1TQIA 2XHKA 2OBPA 4JQFA 1FP1D 4L5IA 2OAZA 2D2WA 1R22A 1BI1A 2DLLA 3QPTA 3E6CC 2JRTA 2HOEA 2Y48A 1KQ0A 5FLXZ 1LEBA 2H09A 3IRQA 2D45A 1R23A 4GGGA 2B0LA 2A6HF 3ZMVA 3I53A 2Z9OA 2D1VA 3E6MA 5ERIA 4U7DA 4KN7X 4LFUA 2A68F 3DEUA 3RKWA 3CJNA 3LA3A 1T2KA 1W7PA 1MJ9A 3H3UA 4F7ZA 2W85A 2DO7A 5ICGA 5K5QA 1MZBA 4EGYA 3E6DA 3P9CA 1F4KA 1Z1DA 5HLIA 5L3CA 3FWEA 3DKWA 5L3DA 1XSXA 2VOPA 2OZUA 2QUFA 5H20A 4IPAA 2A5YB 1MDMB 3GUDA 3LSTA 3NEUA 1ZLKA 2ESNA 5HDKA 1QNTA 5IT9Z 1MJBA 3I59B 3CUQB 2AXLA 1C0WA 5FB2A 3RI4A 4FX4A 1W5TA 1E17A 3P9IA 3FXRA 2IPQX 3EYIA 1TW2A 3COAC 3HRUA 1J59A 3ULQB 2V1UA 3V4GA 3DP7A 1B9NA 1O3SA 1IUYA 2OU2A 2XROA 1T39A 1DUXC 5AIPA 2IA0A 4IF4A 2XUBA 1R58A 1R7JA 2HZTA 4ZYGA 3AAFA 3KZZA 1LJ9A 2OA4A 4M72A 1ZG1A 1G6NA 1LQ1A 2ZJ2A 3QU6A 2JTVA 4M73A 3V8JA 1J0RA 3PFIA 1PUEE 2FRHA 5DCFA 5J6XA 3U9GA 4HF2A 3KP3A 4HLYA 2DPUA 1Z91A 3K0LA 3ZMDA 1DP7P 4OIOF 5AIQA 4L0YB 4U0WA 2EFNA 3MAJA 4JK1X 2DQLA 4GCVA 5LLQA 4AIHA 5LRSA 4M74A 1G3YA 2M87A 1YG2A 1I6XA 1QO0D 1YLFA 3RYRA 4KNYA 4I2OA 3GLXA 3JW4A 2KIUA 2G7HA 1I1GA 1U8RA 3FM3A 3WE3A 1U78A 3W6JB 4ENKA 1RUOA 1YS6A 3QOPA 2H94A 4RAZA 4A2UA 4MTDA 4ZYDA 5D5VB 3C7JA 2KKOA 2MA3A 2VXZA 1FZPB 1ZREA 1XCVA 4CYDA 4UUVA 2QWWA 1AWCA 5D5XB 2A69F 1RIOH 3BP8A 5FD5A 3BWGA 5ED4A 3VOEA 3VB2A 5D5UB 2DAOA 1SAXA 3WTTC 3QU3A 1G3WA 2A61A 2DTRA 1WRJA 1KQ9A 4WF2A 5AONA 2W84A 4L5JA 4EMSA 1W4MA 5IT9K 4PDKA 4Z2YA 2LF7A 4HYEA 1NHAA 3F8MA 4R8HA 1FYMA 3L00A 3GYHX 3HSEA 3L2CA 2EJRA 4ZYHA 1PP7U 2P7CB 3GZ6A 1GXPA 1U5TC 2K4JA 4IJAA 4EM0B 3L9FA 1ONVA 3L09A 2QBYA 3WTVC 2ZO4A 5TRDA 2P6SA 2CFXA 1S7OA 4N9IA 5EEGA 1IN4A 4IRIA 3ZMZA 3K1NA 4N0BA 1YIOA 3E97A 2K7LA 4EJWA 2PMUA 2HKOA 3F8CA 1D8JA 3TGNA 4EJUA 4RGXA 3I64A 4P9UA 4AIJA 1TQMA 2ZNYA 5KK1A 3VEPA 5K5RA 1SD4A 2YPRA 4ZZDA 3F8NA 3GWZA 3TO7A 2ZCWA 1W7PB 1Z6TA 3HHGA 2R7FA 1FBUA 2XAHA 1HW2A 2O61A 1ZGJA 2M8EA 5DD4A 1R1UA 1RUNA 5A2QK 4ENNA 5ILVA 4WCGA 1IXRC 3F6VA 3DFGA 5CVVA 2PI0A 1S6LA 1U5TA 5H6QA 3WU0A 2F5DA 2YSRA 2FE3A 2JPCA 4OMZA 5J8FA 3T0YA 4XLNF 5D4RA 1WQ2A 3E3VA 5HVQC 1MD0A 1YYVA 3RYPA 4Q4ZF 2BE5F 2KJBA 3LAPA 1J2XA 1WWXA 2TDXA 3O6BB 4LLLA 1FSEA 1XSVA 3F3XA 2NYXA 4ZH4F 1K78B 3ELKA 2KIFA 2LF8A 3BZ6A 2HEOA 1Z6RA 4HQMA 5FD6A 3ABUA 1SFXA 3ZMSA 2CGPA 4NHJA 2W24A 3HRMA 3SZPA 3DV8A 2E7WA 2J5PA 5DUKA 1R36A 1HXDA 2HFHA 3GVAA 1HKSA 2RC4A 4BHBA 2VONA 1P4XA 2L4AA 1L3LA 3RJPA 3CLOA 4WXDA 4DNCA 2M5WA 3TDZC 2F5EA 2VE9A 4CDGA 2VBWA 3IC7A 2HTSA 2HTJA 2V9VA 1W5SA 5ICFA 2PG4A 5LHGA 1RZ4A 4BYYA 3WTZA 2WWYA 4HAMA 1YS7A 2JT1A 2XAQA 2H6CA 5FFXA 2Z99A 3S2WA 3ML6A 1ON2A 3CO6C 2H27A 2STWA 3IHUA 2L54A 1XDSA 4G7HF 4L18B 1YTYA 3O3KA 2XKPA 4DQ2A 1HSJA 1R00A 3HSRA 3FHZA 4LG0A 5BMZA 2OZ6A 4KYWA 2K4BA 2MBFA 4I7HA 5CVUA 3Q5FA 2UXNA 2LKPA 1T6SA 4IVNA 2RGVA 2V1DA 3HYIA 3HSFA 4LMYA 3WU1B 2VC1A 3WE2A 3C3WA 4MHGA 1L0OC 1OR7A 4P9FA 2P4WA 4O3MA 5L3BA 4KIGA 3RPUA 1S7AA 1LDKB 5F64A 3TQNA 3KP4A 2GXBA 3QP6A 3QP5A 3EDPA 2RN7A 2BEOA 4UHTA 1TLHB 4LK0F 4NQWA 1WSUA 4RGUA 2EFQA 2ZMEB 4U88A 3P9KA 4BAYA 2HGCA 2FNAA 3HOSA 4HDVA 5CLSA 1UCRA 4HX7A 4HBLA 3I71A 2QBYB 2EFOA 4PZJA 3RIRA 5E20A 2PBIA 4UVBA 1ZARA 2EA2A 5CYVA 1U2WA 4PGHA 4YIIA 1HQCA 1YO5C 4UXNA 2DQRA 4KMFA 3HHHA 2PLYA 2VN2A 3FM5A 3E5QA 1TTYA 4MEYF 1EH6A 3U2RA 5J8CA 2EFPA 4A0YA 1ZGAA 4TV7A 5LHHA 1QPMA 3RDIA 4OMYA 2IW5A 4KMUX 1BI0A 5HS7A 2Z3YA 4RGRA 2ISYA 4HDUA 3EQLF 4A6DA 4WXHA 3F22A 2P8TA 2GA2A 1E2XA 1J9IA 2QYOA 3HTUA 1U5TB 2FF4A 4UNOA 1BOAA 3TO6A 1FPQA 1USSA 2CSOA 1KU9A 2ISZA 1ZRDA 4EGZA 5BPIA 1BIAA 2CYYA 1O3QA 3KP6A 1IRFA 2VE8A 4LLGF 3GFLA 5ICCA 1FOKA 4FT8A 3ZN1A 4M9ZA 3KP5A 1W7PD 1Y0UA 1KU2A 1BIBA 4EJVA 4MEXF 2IT0A 5ILSA 1IF1A 2DK8A 2DU9A 2ACJA 4B8XA 1T38A 1DDNA 2QENA 3ZMTA 1ODDA 3E5XA 2FBKA 1TQPA 3M7GA 4CHUA 1T98A 3V8KA 5A2QZ 2F5CA 1EH7A 2HWVA 3GO5A 2QLZA 2L01A 3DPTA 1SD5A 1XMAA 4BH9A 3J81K 4G94A 1X3UA 2COMA 5LEJA 1UHWA 5F6FA 3V7RA 1JHFA 2XGXA 5K5OA 1I5ZA 5D8KB 4EJTA 5JVTA 1KGSA 2BGCA 4EM2A 2RKHA 1CF7A 3BOQA 1KYZA 3WGHA 1IRGA 5BQTA 4WWCA 2DT5A 3B73A 2R7DA 2FMLA 3BJ6A 5FFZA 3GFIA 1HBXG 3KE2A 2K02A 4L0ZB 3IWZA 2A07F 1F9NA 4RGSA 1G3TA 4LG0B 5DCMA 4A5MA 3J80K 2HDCA 4LGWA 4ETSA 4ENJA 4GXOA 4WX9A 2YX4A 2Y75A 1KYWA 3F72A 2XIGA 3LA7A 4S04A 3QPHA 2ZMEA 1SD6A 4HOBA 3VFZA 1IN6A 4CGZA 3Q9SA 2AS5F 4WXCA 3JAMK 3JTHA 3FMSA 1K6OA 3IKVA 4EVIA 3EETA 2IA2A 4AWXB 3K1MA 2P6TA 2XAJA 1J5YA 4IHSA 3NRVA 2EWNA 3VODA 3KLOA 4XSZF 2DK5A 1CGPA 3R6SA 2GIVA 3B02A 3W6KB 1ZH5A 3WGIA 4YFKF 2XVCA 5D8LB 4Y13A 4CXFA 3K2ZA 3GEZA 3GF2A 2NNNA 4L9NA 1EV7A 3HIFA 4KIFA 2O03A 1P92A 2NRAC 3R4KA 2K27A 3BJAA 5BOXA 3FX3A 1HSTA 3RKXA 3WG9A 3ZN0A 2GXGA 3LAJA 3I54A 1MJAA 3C18A 4HV5A 2JSCA 4ZZLA 4HQEA 1IXSB 1KA8A 4YIFA 3FXUA 5LGNA 2DBBA 2VT2A 3SQNA 1F5TA 2UWMA 1RNLA 4G8XA 3CTAA 4HLXA 4M71A 3C1DA 3OOPA 2FNPA 4O6JA 1ZRCA 3WTXC 3QRFF 4KICA 5JFRA 2L3DA 3MZHA 4D0PA 1BM9A 1LNWA 1JGSA 5EEHA 3TO9A 2KIMA 2L02A 1OMIA 2VT3A 5DEQA 4BQAA 3BPVA 3ZQ7A 3CO7C 4IRHA 3I5UA 2FBHA 2X4HA 4AVPA 3JSOA 4UV8A 3F21A 3DF8A 4HV6A 5CJ9A 4WK8F 1OYYA 1OKRA 3ERED 2LDUA 5CVJA 4RAYA 2ZFWA 4OIQF 1ZLJA 5LHIA 5JR3A 2FA5A 2MD5A 4P55A 1J75A 4H0EA 2E1CA 1QZZA 2V79A 4HX8A 4XLPF 3J7AO 4L9VA 4XSXF 1O7LA 2CWEA 2FQ3A 3FZVA 3FMQA 2ZNZA 5HS9A 3DPLC 1FNNA 3REOA 3WTUC 2FMYA 3R60A 4QWQA 3KFWX 3KLNA 5LGTA 4MTEA 4HF0A 2OQGA 3K9TA 2Z33A 3RPQA 2E7XA 2X0LA 2V6CA 1FP2A 2PQ8A 4ENMA 1WI9A 2IA1A 4Y17A 4ON0A 4R79A 2DFIA 4OIPF 3R0AA 3BY6A 1PDNC 2O3FA 2YU3A 3BROA 2NAZA 4CICA 4CZZA 1S29A 4RB1A 2MH2A 4PCQA 1H9GA 4YFXF 1VTNC 4Q47A 1YW7A 1SFEA 1YQAA 2V1XA 1ULYA 3T8TA 4GYIA 3F8BA 2F2EA 5CVRA 1Z9CA 5E1XA 3Q9VA 1V4RA 1J7KA 2Q8KA 4ESFA 4KDPA 2K86A 3ZP5A 3IL2A 1CF7B 3WTYC 5BPDA 2MLGA 4LB5A 3ZMUA 1P4WA 3M1EA 2FXAA 1IW7F 1LDJA 5HS8A 1ZHFA 1IN5A 2IRFG 1IN7A 2XAFA 5K1YA 2VBZA 2CW0F 4OOIA 4KT5C 3N4MA 3HUGA 3MQ0A 4L9TA 3L7WA 3TDUC 5DCMB 1S8NA 2WV0A 1LDDA 4I02A 2XKOA 4N9HA 1ZYRF 2H6BA 2RQPA 4RS8A 2ETHA 1B4AA 4AIKA 1BC7C 3KP2A 3LWFA 3BDDA 2STTA 2IVMA 2E1NA 3TKYA 2HKXA 3LQQA 2FOKA 1EH8A 2EFWA 4ASNA 2R3SA 3HRSA 5KVRA 4BXUA 3H92A 3M9AA 4RB3C 1BJAA 5E1WA 2VODA 2MC3A 1JHHA 3J81Z 1UHMA 1XSDA 1IZ1A 4HZFA 2CG4A 2DPDA 3G3ZA 5JI6A 3FXQA 1IN8A 4RB2C 5FGMA 3RKYA 2P5KA 1FY7A 4A12A 1U6GA 1YFHA 1P4AA 1R1TA 4IHTA 2EK5A 4PGGA 4A0XA 5IT3A 5CVIA 5H6RA 1OYIA 5E8GA 1PP8F 3HOTA 2CQKA 4U7BA 2QQAA 4Q5SF 2C6YA 3WODF 2BBYA 3DQVC 4S05A 3F23A 3T5XA 4OU0A 3JTGA 4LJZF 3WGGA 1IXCA 2J5OA 4E70A 4KFCA 5HOOA 3D5LA 4G6DA 3J80Z 1UB9A 2EV6A 4EM1A 1KU7A 1STZA 1FT9A 2FSWA 1USTA 2L4MA 3EYYA 1FBQA 4NB5A 2GZWA 5L3FA 4I01A 2WTEA 1XGSA 2VBYA 1BI2A 1V3FA 2Y0MA 4OINF 2IJLA 3BPXA 2W25A 3BJOA 4GYGA 3JAMZ 1O7FA 1XCBA 1U3EM 4I09A 4FX0A 2LNBA 2O8XA 3NQOA 2VOOA 2A3SA 1G4DA 5D6EA 3I4PA 1K79A 5E17F 2JPBA 1A04A 1R5GA 4LK1F 4A6EA 1BI3A 5E8IA 3PQJA 3ZPLA 2RVCA 1HW1A 5D4SA 1H0MA 1OYWA 3T1BA 3LA2A 1XGMA 1WKMA 4MGRA 4IXAA 3V7SA 1TNSA 2XAGA 4U0VA 1P6RA 2NNYA 4LB6B 4FHTA 1D5VA 1JE8A 1O3TA 5TJJA 4GO1A 1R5HA 4HW0A 2XV4S 4M9SA 2Z5UA 4YFNF 3E6BA 1BC8C 3SHFA 2OQRA 1FX7A 3KETA 4MQVA 5ICEA 5D5WB 2YX7A 1Z7UA 3M8FA 2ZBKA 6PAXA 4Y15A 1LEAA 1OPCA 1UFMA 1GXQA 3I58A 3IWFA 1FSHA 2JZYA 1O57A 5FLXK 5LRRA 4EV0A 1K78A 4K2EA 4A5NA 2VBXA 4XBFA 4LLNA 5FO5A 1B9MA 1TW3A 3V8LA 2G7UA 1ZG3A 2P7VB 2XASA 1YW8A 5JHUA 3GX4X 3N97A 2QVOA 3RTRA 4G6QA 2RDPA 3K1PA 2CO5A 4KUMA 3OV8A 4BNCA 4KA4A 3MCZA 1FLIA 5HDGA 2EA4A 5L3EA 1JXSA 5D6FA 1FWZA 1DPRA 2GA1A 4I0AA 4U0YA 1K7AA 2GWRA 4O5VA 2XRNA 3G73A 4AD9A 4JBAA 5LBQA 5HLGA 1D8KA 5E18F 2NS0A 4RB0A 4EJOA 2P5VA 3GZ5A 3IRRA 4MQ9F 1H9TA 5LEKA 4KN4X 4YG2F 4P5OA 3SXYA 2O6GE 2MLKA 5DDGA 1ZRFA 1IAWA 2MH9A 3CUQC 2QM3A 1P2FA 1KU3A 4ZYEA 1XDUA 2D1HA 3E5UA 4BHCA 3R61A 1DPUA 1GHCA 2ZXJA 3GFMA 2BV6A 3M8EA 3JSPA 3MFKA 2PMHA 2Q2EA 3ABTA 1GVJA 2G9WA 1B6AA 2WC2A 2HS5A 2W57A 2PN6A 4B09A 2HR3A 1S3JA 1ZN2A 3K69A 4ESJA 3HRTA 4CO8A 1XGNA 3ECOA 1FBSA 2HYGD 3MZYA 5F1RA 2DI3A 3FMRA 3GXOA 1SD7A 2M45A 2BYVE 4BHPA 1O3RA 3SFZA 4G7OF 4OIRF 4HA8A 1I1SA 3KP7A 1XD7A 1XN7A 3SZTA 1RI7A 2ELHA 1R1VA 1MDMA 3P7NA 1TBXA 1F1ZA 5L3GA 3KEOA 1Q1HA 4G7ZF 3I59A 2GQQA 2M1BA 4HX4A 1HKTA 3CUQA 2QZ8A 5BS6A 5LGUA 3R0JA 2HYFA 2EV0A 2RV8A 1QQIA 3LFKA 4UVCA 1XMKA 1G3SA 1XGOA 1LB2A 2UZKA 3MEXA 3MWMA 4IRGA 3O2PE 5HDNA 3I0TA 3WTWC 3T8RA 1B1BA 1QGPA 5HLHA 3TOBA 1ON1A 2QQ9A 2M30A 2PFBA 2HQRA 4G9YA 4M9XA 4Q48A 5DD8A 4R1HA 5DUIA 3ECHA 3KZYA 2KJCA 2FEZA 3KCCA 4M6YA 4I0BA 2O0YA 2DW4A 2HQNA 3HTSB 4KIBA 1T0FA 4XRFA 1REPC 4UV9A 3PQKA 2PEXA 3F8FA 3H3ZA 3QAHA 4QLCU 2KRFA 5E1ZB 2IP2A 2EV5A 3WTSC 2Q0OA 1SFUA 1HW5A 1HKQA 1SMTA 2QQBA 3CDHA 1YW9A 3EUHA 2LSOA 3TOAA 3F6OA 2F5FA 1FYLA 1ZG5A 2P5LC 1SMYF 2RNJA 1QZYA 2ESHA 2FBIA 2UXXA 4I98B 1KQ8A 1Z05A 1FYKA 4A0ZA 2EB7A 1AOYA 2ADUA 1LVAA 2GAUA 2OD5A 1XB4A 2YR2A 4EQQA 5DYMA
chains in the Genus database with same CATH superfamily
3OYMA 1BBYA 3S8PA 3LOCA 2HZDA 2BW3A 1BN5A 2NVUB 1TNTA 3GTLJ 4MNUA 1MW7A 4M6XA 2EIJH 4BY1J 2VL8A 2BY3A 4QPQA 5IOZA 3CUOA 3KZIC 1ZAOA 1GUUA 2ZKZA 5EG0B 2IGOA 5C3EJ 3GW2A 3D0SA 1MGTA 3X2QH 2CH0A 3I3LA 2FU4A 5DM7F 4PFPA 2X1DA 4IEJA 5FKOA 2MC4A 4LD5A 2L2OA 2HVQA 3V7CA 3ISPA 2QGUA 3ROUA 2L9SA 2HVRA 1YX5A 2IS6A 3IKTA 4HF1A 3HM5A 2VC0A 1X4OA 4ESBA 2WAQN 3E0JB 4ZDPA 4BUPA 3HOWJ 2DMNA 1B59A 3LQRA 4BEHB 1WGXA 1I27A 1QBJA 4UUSB 1UG2A 1FC3A 3DXJF 2A6EF 1DGWY 5ILUA 1A6QA 3GFJA 3KEQA 1Y8RB 2OTLI 3U1DA 1MKMA 3L2UA 4A3EJ 1D3YA 1A35A 3PNYA 4YELA 4A3BJ 5DV5A 2X6YA 2Y30A 2PJPA 2JK3A 5H2FC 3FF5A 4P96A 4UVAA 4MLOA 4L9JA 1POGA 1TQIA 2QKMB 2XHKA 2OBPA 5KHDA 5TGTA 3TW7A 3JRHA 1P7JA 4JQFA 4P1WA 1TP4A 1FP1D 4L5IA 4XLHA 5K7FA 2OAZA 1VI0A 2D2WA 1R22A 1IV6A 1BI1A 3A0BC 2DLLA 2HVSA 3QPTA 3CZ6A 2VKHA 1HDPA 2CQQA 3E6CC 2G0EA 2JRTA 2HOEA 2Y48A 1KQ0A 2X85A 5FLXZ 2HXOA 1LEBA 2H09A 1NK3P 4XICA 3IRQA 1N77A 2TCTA 2D45A 2EPFA 3HXLA 1R23A 4GGGA 1MNEA 2B0LA 3M3YJ 2RQQA 4N4NB 1ACIA 3S93A 2XGEA 5HNHA 2L7MP 2A6HF 3ZMVA 2DYRH 3I53A 2Z9OA 5M5YJ 2D1VA 4CCJA 1ZR4A 2Q2EB 3E6MA 3HDDA 5ERIA 4U7DA 4KN7X 4LFUA 2A68F 3DEUA 1ETVA 4BDZA 1X3ZB 1E0EA 1K83J 2ECBA 2EZLA 3RKWA 2R5YA 3CJNA 2I8DA 3LA3A 1T2KA 1W7PA 1MJ9A 3H3UA 2HQ5A 1HOMA 4BY7J 2LLKA 3O8HA 5KNLA 4F7ZA 2W85A 3HPGA 2DO7A 5HODA 4E4HA 1XMXA 5ICGA 5K5QA 1MZBA 4EGYA 3E6DA 3P9CA 4KITB 1F4KA 3CD6I 2ICWG 1Z1DA 5HLIA 3BQZA 5L3CA 4ANJA 3FHNA 5EDNA 3FWEA 3DKWA 1N78A 4XLAA 5M5WJ 5L3DA 1XSXA 3IH3A 3QYEA 1D0ZA 3IH4A 3QQAA 4FISA 2L5QA 2VOPA 4BL0B 2OZUA 2QUFA 5H20A 4IPAA 1T33A 2A5YB 2K9LA 5GPAA 3GUDA 4ABZA 3LSTA 3NEUA 5IPAA 1MDMB 1ZLKA 3I56I 3I4NJ 2RREA 2ESNA 5HDKA 1QNTA 5IT9Z 3ZQIA 3ZQLA 5E3LA 1MJBA 1H89C 4CCKA 1EA3A 1MH3A 3I59B 1D0XA 3W3CA 3CUQB 1EF4A 1NTCA 2AXLA 3BR5A 1C0WA 3LSHA 1FTTA 3CLQA 5FB2A 3JRFA 1BW5A 5JLWA 4XLFA 4NDLA 1M1EB 5FLMJ 1ETOA 3RI4A 3S16J 2K9MA 3GCMA 5F27A 5BNGA 2OJED 4FX4A 3G1MA 1RC9A 1W5TA 1E17A 3P9IA 3AL0B 4RA2A 3HOUJ 2E1MC 3FXRA 2EZKA 3HBLA 4BQQA 4F3QA 2EIMH 2IPQX 3EYIA 2M0CA 1TW2A 3COAC 3HRUA 1J59A 3ULQB 4XKWA 2V1UA 1Z7LA 2X48A 4E7KA 1AKHA 3V4GA 2LBFA 3DKXA 3DP7A 3OYDA 1B9NA 1O3SA 1IUYA 3L2VA 2QF7A 3A03A 2OU2A 4XL9A 2XROA 1T39A 1DUXC 4A3CJ 5AIPA 2NVXJ 2YUSA 2IA0A 1ETKA 4IF4A 2XUBA 1WI3A 3PSFA 2XC7A 1R58A 1R7JA 3S2HJ 2HZTA 1SANA 4ZYGA 3AAFA 3KZZA 1WJCA 1LJ9A 2OA4A 1W0UA 2WAEA 4M72A 1ZG1A 3OYGA 4MO7A 5E3NA 1G6NA 3OR1C 2O9LA 3IH2A 1LQ1A 1A36A 2ZJ2A 2E2JJ 3QU6A 2JTVA 4KISA 4M73A 3V8JA 4AYBN 1J0RA 2VLAA 3PFIA 1PUEE 3OL4A 3PO2J 1ETYA 2FRHA 1YITI 1LFBA 5DCFA 5J6XA 3U9GA 4HF2A 2FJ1A 3KP3A 4HLYA 2DPUA 4UY8I 1Z91A 2GBYA 3K0LA 3Q0UA 4M3DA 5DTDA 3ZMDA 5AIQA 3JRBA 1DP7P 2CV2A 4OIOF 2AQEA 1I50J 4L0YB 2K3PA 4FETA 4U0WA 1IO2A 4ZDLA 2EFNA 3MAJA 2WY8Q 3C2GA 1DQUA 2KPMA 3KIOA 5IP7J 4JK1X 4PSWA 3BCAA 4OAZA 2LD5A 4FTHA 2DQLA 4GCVA 5LLQA 3CCEI 3W2WA 3OIQA 4AIHA 2JN6A 1OISA 1S7EA 5LRSA 3HOYJ 1BL0A 4M74A 3FXLA 1G3YA 2M87A 4GRIA 1X1CA 1YG2A 2FUG2 1YRNA 4IHXA 1I6XA 1QO0D 1YLFA 2K5CA 3RYRA 2HI3A 1TWCJ 4KNYA 4I2OA 2VPLA 3GLXA 3JW4A 5EG0A 3FXOA 2KIUA 4LOCA 3BG7A 2G7HA 1I1GA 1U8RA 1QPIA 2UV1A 3FM3A 3WE3A 1U78A 3W6JB 4ENKA 1RUOA 1YS6A 3QOPA 1ZK8A 2H94A 3K2AA 4RAZA 4A2UA 2YS9A 1PJRA 4PJJA 1WCMJ 4MTDA 4ZYDA 5D5VB 1OCZH 3C7JA 2WY7Q 2KKOA 2MA3A 2VXZA 3FXJA 1FZPB 4BJ5C 4BU2A 4BE2A 1ZREA 2M34A 1TL8A 1XCVA 2Y69H 4Y7NJ 4CYDA 2BW3B 4UUVA 2QWWA 3ESWB 1AWCA 5D5XB 2A69F 1RIOH 3BP8A 5FD5A 3BWGA 2ZXWH 2M7BA 3VOEA 2IBDA 3VB2A 5ED4A 5D5UB 5J4YA 2DAOA 2NVYJ 2HDDA 1SAXA 4BBSJ 3WTTC 2M8GX 1G3WA 3QU3A 4M3FA 9ANTA 3ZCOA 4IHYA 2A61A 3DBHB 2DTRA 1WRJA 3HL2A 1KQ9A 4WF2A 2BXZA 4QSHA 4RM3A 5AONA 2W84A 4L5JA 4EMSA 2HOSA 1W4MA 5IT9K 4PDKA 4Z2YA 2LF7A 1UJ8A 4JX4A 2E2IJ 4HYEA 1NHAA 3F8MA 4R8HA 1FYMA 2L9NA 2VJ4A 2R7SA 2V26A 4B3XA 3L00A 3GYHX 1G2HA 3HSEA 4RAFA 5K7HA 3L2CA 2EJRA 1A6IA 4ZYHA 3TBIA 2DA6A 2WA0A 3GMEA 1PP7U 3FK6A 2P7CB 3GZ6A 2EINH 1GXPA 2R93J 1V55H 1GT0C 2CFOA 1U5TC 2KT0A 1SEUA 4BACA 4BQOA 4HSRA 2K4JA 3KYDB 4IJAA 4EM0B 4DYQA 2X51A 2NS7A 3L9FA 1ONVA 3L09A 3HOZJ 2QBYA 3WTVC 3G1OA 2EQRA 2ZO4A 5TRDA 2P6SA 4HPQA 1RR8C 2CFXA 5M3MJ 1S7OA 2KP6A 4N9IA 5EEGA 1MMDA 5J1YA 1IN4A 2M9HA 1Z67A 1K4SA 4IRIA 5B3SH 1OCOH 1S5LC 3MKLA 3ZMZA 1ZGWA 1VQ9I 3QYFA 3K1NA 3S1RJ 1MMGA 5IP6A 2R7ZJ 4N0BA 1YIOA 3E97A 4RMNA 1IUFA 1U0JA 1X2MA 3CMEI 2K7LA 4Y33A 3H5RA 1OCPA 4EJWA 3P5JA 3ZQCA 2PMUA 3S1NJ 2HKOA 2B7EA 3H9JA 2NOJB 3F8CA 3ZQQA 1D8JA 3TGNA 2VIXA 4EJUA 2LY9A 4RGXA 3I64A 4P9UA 4AIJA 1TQMA 2LTPA 2ZNYA 5KK1A 3VEPA 5KAFC 1W0TA 4NC8A 5K5RA 1SD4A 4CYCB 1T95A 3DLLF 2YPRA 2R5YB 3BT9A 4ZZDA 3F8NA 4IHWA 2L9VA 3GWZA 3TO7A 2KL4A 2ZCWA 4M3EA 1W7PB 1Z6TA 3HHGA 2R7FA 3WHCA 1FBUA 2XAHA 2XB0X 4PJ0C 2IEKA 1HW2A 2O61A 1ZGJA 3QODA 2M8EA 2V7FA 1R1UA 5DD4A 1RUNA 5A2QK 3UR3C 4ENNA 4CUGA 5ILVA 4WCGA 1UELB 1IXRC 1Y1VJ 3FIWA 3F6VA 3H5NA 1A5JA 3EUHC 1MSFC 1B72A 3DFGA 1MBGA 1JKOC 5CVVA 3BR6A 2PI0A 4FCYA 1VQMI 1ZR2A 1VQ4I 1S6LA 1U5TA 2DCEA 2LG4A 5H6QA 2F5DA 2YSRA 3WU0A 3JR9A 1Z3YA 4LITA 1XX5A 2FE3A 2JPCA 4OMZA 5J8FA 3T0YA 4XLNF 5D4RA 1WQ2A 3E3VA 2WV1A 1MD0A 1YYVA 2KZVA 3RYPA 5HVQC 4IZZA 5TISC 1YJWI 2IGKA 4LIVA 4Q4ZF 5GTIC 2BE5F 2KJBA 3JRGA 3K4KA 3LAPA 1WJ5A 4Y3OA 4F52A 4OAYA 4QTRA 1J2XA 1WWXA 4DYRA 2CUEA 2TDXA 2R7OA 3EUKL 3PIPF 3O6BB 1OQYA 2LH9A 3DKYA 3SEQA 4LLLA 1FSEA 1XSVA 1AA7A 4EEFG 3F3XA 4AIDA 3K4BA 3S3NA 1IDYA 3S1QJ 2NYXA 4B44A 4ZH4F 1K78B 3OYNA 5CQEA 1G59A 3ELKA 2KIFA 2DXIA 2LF8A 2PX9A 3IAM2 3BZ6A 2HEOA 3HPHA 3LSGA 5EF6A 1Z6RA 2NVQJ 4HQMA 5FD6A 3ABUA 2QSHX 1SFXA 3ZMSA 4J19A 2CGPA 4NHJA 2W24A 3HRMA 1YX3A 3SZPA 3DV8A 4A93J 2IGNA 2E7WA 2XAUA 3ASOH 1X2NA 2J5PA 3H36A 5DUKA 2JA5J 1R36A 1HXDA 2HFHA 3GVAA 3SEZA 1HKSA 1AKHB 1IC8A 2BVMA 2LBFB 2LKXA 1W5CC 5EJCA 4XOPA 2X9DA 3L2RA 2RC4A 4PK4A 4BHBA 2VONA 1P4XA 4Y4RA 3MMYB 2L4AA 1L3LA 3RJPA 4E7LA 3CLOA 1NG7A 2DN0A 4WXDA 5CKTA 4DNCA 3GTPJ 2LC2A 2M5WA 2R4GA 3TDZC 1OR7C 1MBEA 2VJ5A 3MKYB 2F5EA 2VE9A 4CDGA 2VBWA 5FKNA 2M4KA 3IC7A 3UNGC 2ZSHB 4CCMA 3DTEA 2HTSA 1Z21A 2HTJA 5B5EC 1FIAA 2ZXHA 3CC4I 3OSGA 2V9VA 1W5SA 5GTHC 5ICFA 4NC7A 4XORA 2IS2A 3CESA 2PG4A 5LHGA 1RZ4A 3BTLA 5IYBJ 2NOGA 4BYYA 4CZCA 3WTZA 2WWYA 4HAMA 1JJ8C 1YS7A 2JT1A 3GTMJ 3ZOBA 2OPTA 2KDOA 4PFOA 2XAQA 2H6CA 1WJFA 2WB1A 3SDGA 5FFXA 4B48A 3GTJJ 4ZYAA 2Z99A 3S2WA 3ML6A 1ON2A 3CO6C 2H27A 2STWA 3IUOA 4BE0A 3CC7I 3IHUA 2L54A 1XDSA 4G7HF 5J3LA 4L18B 1YTYA 1ORKA 2M2EA 3HB9A 3O3KA 2BHYA 2AO9A 4XKBA 5FRNA 2XKPA 4DQ2A 1BR2A 1HSJA 1EJ9A 5HLTA 1R00A 1YRNB 5GP9A 2O7OA 3HSRA 2KFDA 2DOFA 4S0HB 3PL8A 5FKMA 2E1MB 3FHZA 3WG7H 3ABKH 4LG0A 5BMZA 3CCSI 1JUMA 2OZ6A 4KYWA 2K4BA 2MBFA 2NS8A 4I7HA 5CVUA 3Q5FA 2UXNA 2LKPA 3JCUC 3S15J 2VQLA 3U1KA 1T6SA 4IVNA 2RGVA 1JUPA 2V1DA 2XGDA 4QPOA 3HYIA 3HSFA 3AG2H 4XN3A 3BQYA 4LMYA 3WU1B 2VC1A 1SAUA 3WE2A 1MIJA 2AQFA 3C3WA 4MHGA 3S2DJ 1L0OC 1OR7A 2PJRA 3RCOA 4P9FA 4D7NA 2P4WA 4W97A 3MKWB 1X58A 4O3MA 5L3BA 4I99C 4PJNA 2D5VA 4AU7A 2W82A 3H5AA 4KIGA 1SVOA 3VYTB 1ZKGA 3RPUA 1S7AA 3OWTA 1LDKB 5F64A 3TQNA 3PIOF 3KP4A 2GXBA 1X3WB 3OS1A 3QP6A 3QP5A 4XRSA 3EDPA 2KDZA 3CJRB 2RN7A 3GTQJ 4NBQA 2BEOA 4UHTA 4IO9F 1TLHB 3OIOA 2BXYA 4LK0F 3FK7A 4NQWA 5J47A 1H88C 1WSUA 4G6TB 3D5RC 4RGUA 1GVDA 2QA4I 1RR7A 2LMDA 2EFQA 2ZMEB 4U88A 3G1LA 3P9KA 4BAYA 3U21A 5IY5H 3L2WA 2HGCA 4HNUA 2CJJA 2FNAA 2XGCA 3FKJA 4M6VA 4F92B 3HOSA 2ME6A 1IRXA 3S17J 5F1JA 4HDVA 5CLSA 3H9GA 3ZR8X 2HDWA 1UCRA 4HX7A 2RNGA 4HBLA 5JHFA 3BG9A 4KJZA 1GV2A 3VSLA 1A31A 2KRHA 3I71A 5EGOA 2QBYB 2F6CA 3CDLA 5KCMA 2EFOA 1TT5B 4PZJA 3K70C 3PNTA 2EZIA 4CYCA 3RIRA 3A1YA 5E20A 2PBIA 3UKGA 4JX6A 3IV5A 4UVBA 1ZARA 3RKQA 2EA2A 1LFUP 5CYVA 1U2WA 2K40A 3JRAA 4I6ZA 2A6TA 2IGMA 3ZGKA 4PGHA 4YIIA 1HQCA 4XMYA 2DA4A 3HG9A 5FKLA 5IOYA 1FMVA 1YO5C 4UXNA 2DQRA 4KMFA 3OL3A 3RZDJ 1Y6IA 4DBQA 1X1DA 3HHHA 3H0DA 4RLFA 4BXFA 5JLXA 4A3JJ 2PLYA 2F4MB 2VN2A 1AU7A 4F93B 3FM5A 3HKZA 3M07A 4V2FA 5F0HA 3E5QA 4IQJA 3C2HA 2CQ7A 2VUMJ 1TTYA 4MEYF 1ZQ3P 2VQCA 1EH6A 5F0CA 3OS0A 2H1KA 3U2RA 5J8CA 2EFPA 1WPKA 4A0YA 3CMAI 1ZGAA 4TV7A 5LHHA 1QPMA 3BR1A 3F0CA 3RDIA 1JGGA 4OMYA 5EEAA 2IW5A 4KMUX 3OYHA 1BI0A 1LFPA 5HS7A 3CP2A 4HRIA 2Y0SN 2Z3YA 5F08A 3BG5A 1MBJA 2ISYA 3DCFA 4RGRA 3RPUD 4AM3A 4DJAA 5FLVA 4BXXJ 1HF0A 4HDUA 1GDTA 3EQLF 4A6DA 4DZJA 4WXHA 3F22A 2P8TA 1B72B 3Q0VA 2GA2A 1E2XA 3BG6A 3QPSA 1YJ9I 1J9IA 2QYOA 3HTUA 1Y8QB 1U5TB 2FF4A 5IYCJ 4XRMA 4RBOA 1AHDP 2KLOA 3E1SA 1T56A 1VQNI 3DU5A 3VSKA 2VQHA 4UNOA 1TWAJ 1BOAA 3TO6A 3LMMA 2UUZA 1FPQA 1RKWA 4ZC3A 3KYCB 4C3HJ 1USSA 2CSOA 1KU9A 2ISZA 2JUGA 3NWSA 1ZRDA 4EGZA 5BPIA 2YU9J 3RZOJ 1BIAA 1E3OC 1D1CA 2CYYA 1O3QA 1VQ6I 3KP6A 4B47A 4XOTA 3CCUI 3ZXSA 1IRFA 2VE8A 2HQAA 2CQXA 4LLGF 3GFLA 4NUBA 5ICCA 1FOKA 4FT8A 3ZN1A 3H3VK 1ETXA 4M9ZA 3FXMA 3KP5A 1W7PD 2DMQA 2JRMA 1LE8A 2BY2A 1Y0UA 1KU2A 1BIBA 4EJVA 4MEXF 2GIZA 2IT0A 2DMUA 3ZRGA 5ILSA 1IF1A 2DK8A 3K4LA 4C2TA 2DU9A 1R6RA 4II3A 2M7AA 2ACJA 1MMSA 4B8XA 1T38A 1DDNA 2FQ4A 2ID6A 2QENA 3K4MA 3ZMTA 1ODDA 3E5XA 2FBKA 1TQPA 1K61A 3OYCA 2ZMEC 3M7GA 3FDYA 4CHUA 5EZHA 1JKPC 1T98A 3V8KA 5A2QZ 2VJIA 4Y52J 2LY1A 2F5CA 1EH7A 2HWVA 3GO5A 2V1NA 1B8IB 2JA7J 2QLZA 2CMPA 4AVZA 2L01A 3MD2A 3DPTA 1SD5A 5J4VA 2HPMA 2B9SA 2E19A 1XMAA 2O5RA 4V19K 2V9KA 1XC5A 4BH9A 4HSTA 3J81K 4G94A 3CCRI 1X3UA 2BOLA 2COMA 4B4CA 1UHWA 5LEJA 3OSFA 5F6FA 3V7RA 3K4CA 1JHFA 3ABLH 2XGXA 5HNFA 1MBFA 3GZNB 5K5OA 1I5ZA 5D8KB 2XSJC 3BTJA 4EJTA 5JVTA 2EBIA 1YIJI 1KGSA 1V5FA 5DM6F 2L7KA 2BGCA 2R7QA 2RKHA 3W2VA 4EM2A 2WAFA 1CF7A 1J09A 3BOQA 1KYZA 3WGHA 4D5FA 1FIPA 3HKZN 1IRGA 5BQTA 4WWCA 1ETQA 2DT5A 4XLEA 2CV0A 3B73A 1WJAA 2R7DA 3K70D 2EIKH 3S32A 4RM2A 4C9YA 2FMLA 1D1AA 3BJ6A 5FFZA 3GFIA 1HBXG 3SDBA 3KE2A 3VWBA 4UUTA 1JKQC 2K02A 3D1NI 2XF5A 4XKVA 4L0ZB 3IWZA 2A07F 2HOAA 1F9NA 4RGSA 2DA2A 1G3TA 2PMZA 1BOBA 4LG0B 5DCMA 4A5MA 3J80K 2HDCA 4D5CA 1E3HA 4LGWA 4ETSA 4ENJA 2JA8J 5M5XJ 4N4OB 4GXOA 5GPCA 3HZJA 3KYLA 4A3GJ 4WX9A 2WADA 2YX4A 2Y75A 3CCJI 1KYWA 1BR1A 5F04A 3F72A 2XIGA 4NC6A 4PUSA 2E1OA 3LA7A 4S04A 3QPHA 2ZMEA 1SD6A 4HOBA 3OYIA 3VFZA 1IN6A 2PJRB 4CGZA 3H9QA 3Q9SA 1GV5A 4OWRB 1W36C 4ZTFA 2AS5F 4WXCA 3SYTA 3JAMK 3JTHA 2MW8A 4A3KJ 3FMSA 1K6OA 2DT7B 3IKVA 4EVIA 3LSRA 3WHBA 1OCCH 2OCCH 3EETA 2IA2A 2E36A 2R5ZB 4AWXB 3K1MA 1OJLA 1RRJA 4M3BA 2TRTA 2P6TA 2XAJA 1J5YA 3MZ8A 4IHSA 5C4JJ 3GTKJ 3NRVA 1F43A 2EWNA 1QHHD 3VODA 3IAS2 5K7ZA 3KLOA 2LY2A 4XSZF 2DK5A 4NQWB 3R6SA 2GIVA 1CGPA 3B02A 3W6KB 1ZH5A 3WGIA 3L2QA 4YFKF 2E35A 2GOXB 3PFYA 2F4OB 2XVCA 2Y9YA 5D8LB 3HEFA 4Y13A 4CXFA 3HOVJ 3K2ZA 4C2MJ 3OYFA 3LSJA 3GEZA 3GF2A 1JKRC 1QHGA 2NNNA 4L9NA 3JRDA 1HDDC 1EV7A 1KONA 1K6YA 3HIFA 1ETWA 3A4CA 3MVPA 3Q0WA 4KIFA 2O03A 4JP0A 1P92A 3A02A 2NRAC 3R4KA 5EGOB 2JVGA 1OCTC 3GLLA 2K27A 3BJAA 4ZJZA 5BOXA 3FX3A 1HSTA 3RKXA 4E7JA 4IOAF 1IDZA 3WG9A 3ZN0A 1YI2I 4XONA 2GXGA 3LAJA 3I54A 1MJAA 3C18A 4HV5A 2JSCA 4ZZLA 2BZTA 4HQEA 4MIMA 1IXSB 1KA8A 2QSFX 4D9JA 3FXUA 4YIFA 5LGNA 2LRDA 3B6AA 2L7ZA 2DBBA 2VT2A 3SQNA 1F5TA 5E79C 2DT6A 2UWMA 1RNLA 4G8XA 4DOZA 2K9SA 3CTAA 3CCLI 1QA6A 4HLXA 2DODA 4M71A 3C1DA 3K7AJ 2KIQA 3OOPA 2FNPA 3AG3H 4O6JA 1ZRCA 2IAIA 3WTXC 3QRFF 4KICA 5JFRA 2L3DA 1Z77A 2HU9A 4D0PA 3MZHA 1BM9A 1LNWA 1JGSA 4C30A 2QCOA 3DEEA 5EEHA 3TO9A 2KIMA 3I9V2 3KEYA 3CC2I 2L02A 1OMIA 2VT3A 2L9RA 3C2BA 5DEQA 4BQAA 3E7LA 3BPVA 3ZQ7A 3CO7C 4IRHA 2V4JC 3I5UA 2FBHA 2X4HA 4AVPA 2QKLB 3JSOA 2NVTJ 4UV8A 2LFBA 3F21A 3DF8A 1XG1A 4HV6A 5CJ9A 4Z6YA 4WK8F 2DA5A 1OYYA 1PUFA 3PM1A 3AKZA 1OKRA 3CCQI 2Y9ZA 3ERED 3LFUA 2LDUA 2XF7A 2DFHA 5CVJA 2GM4A 4RAYA 1IJWC 3BR3A 3VDXA 1T8IA 1R9TJ 1SC7A 2DDAA 1S72I 2ZFWA 1VQ5I 3MKZA 2XRLA 1KZHA 5E3OA 4OIQF 1IGNA 5FRMA 2MABA 1ZLJA 1X1PA 5LHIA 2XPVA 5FJ8J 2W1OA 2X1EA 2FA5A 5JR3A 1YJNI 2FX0A 3JRCA 2V6EA 2A05A 2MD5A 4P55A 4RLQA 3TL4X 1J75A 4H0EA 2E1CA 2OCEA 2KMUA 3BZCA 1Y39A 2Q1ZB 3VYUB 1GLNA 1QZZA 2V79A 4HX8A 4XLPF 1DU0A 4DGWB 2CV1A 3J7AO 4L9VA 4XSXF 3S1MJ 1O7LA 2CWEA 2FQ3A 1R4MB 2DMTA 3FZVA 3FMQA 4QIWN 2ZNZA 5HS9A 3DPLC 1FNNA 2L7FP 2W00A 2CW7A 3TEDA 1IRZA 1OLTA 3REOA 3CCYA 1MH4A 3WTUC 2HYJA 4X0GA 2M3AA 2FMYA 4D7MA 3CCVI 3R60A 1MNMC 4QWQA 4BE1A 3KFWX 3CJTB 3KLNA 5LGTA 1B8IA 1FMWA 4MTEA 4HF0A 1XS9A 2JWTA 2OQGA 3K9TA 3H0GJ 1EKEA 2Z33A 1VF9A 3FKIJ 4G12A 3RPQA 1LE8B 2IXSA 2E7XA 4M3GA 2X0LA 2V6CA 2X6OA 4E6KG 1FP2A 2PQ8A 4ENMA 1WI9A 2IA1A 4Y17A 4ON0A 1NK2P 4R79A 4IHVA 2DFIA 3CQZJ 4OIPF 1NH3A 1VQPI 2H8WA 1SVMA 1V54H 3R0AA 3BY6A 1PDNC 3LNQA 2O3FA 2YU3A 3BROA 2NAZA 4CICA 4CZZA 2R7VA 4CA0A 1S29A 2XF6A 5GAEJ 4RB1A 2MH2A 4PCQA 1WJDA 1R4NB 1H9GA 2BVLA 4YFXF 1VQOI 1VTNC 4Q47A 1YW7A 1U9NA 3CP8A 1ITYA 3LSMA 1NG6A 1SFEA 2CUFA 1YQAA 2V1XA 3HC7A 1ULYA 3K10A 3T8TA 4GYIA 2CW8A 3F8BA 3AG4H 2F2EA 1MMNA 2HPIA 4DIQA 4RDUA 5CVRA 1I3AA 3JRIA 1Z9CA 4C3IJ 5E1XA 1UZCA 3Q9VA 1V4RA 1J7KA 2Q8KA 4CCNA 4ESFA 1DP3A 4KDPA 1UMQA 4HNVA 3CJQB 2K86A 3DPUA 3ZP5A 4BJ6C 4YIRX 3IL2A 1CQTA 1CF7B 3WTYC 2L0KA 5BPDA 2MLGA 4LB5A 1SVLA 3ZMUA 1P4WA 1MNDA 2N8GA 3M1EA 3HGGA 2FXAA 1IW7F 1LDJA 5HS8A 1ZHFA 1XTAA 3BLYA 1H8AC 1IN5A 2V9PA 2IRFG 1IN7A 2XAFA 5K1YA 2H8RA 2O8KA 2Z16A 2VBZA 1LVKA 2E2HJ 3RQ4A 2CW0F 1FOXA 4OOIA 4KT5C 4AC0A 2R5ZA 2LREA 3ZQHA 3L1PA 3N4MA 1MMAA 2H1LA 3AFHA 3HUGA 3MQ0A 4L9TA 2JA6J 3L7WA 3TDUC 5DCMB 1S8NA 2VXDA 4XQFA 2WV0A 1LDDA 4I02A 2XKOA 3Q3SA 4N9HA 1FOYA 1ZYRF 2H6BA 2RQPA 4RS8A 2ETHA 2Z1DA 1B4AA 4IKFA 1RKTA 5GADJ 4XLCA 2JJ7A 4AIKA 1BC7C 1I6HJ 3KP2A 3BZKA 3LWFA 3BDDA 3BG3A 3OYLA 2STTA 3OS2A 2IVMA 2E1NA 2MGQA 5EZGA 1N75A 1JI8A 1X1BA 3MN2A 1BW6A 2E60A 1TC3C 3TKYA 2HKXA 2AXTC 3LQQA 2FOKA 2LOOA 1EH8A 2EFWA 4ASNA 1X19A 2R3SA 3HRSA 5KVRA 1WH7A 4AYBA 3G71I 4IX7A 4BXUA 3H92A 5J40A 4I76A 3M9AA 1QVTA 3S14J 5IYDJ 4RB3C 1BJAA 2CUJA 5E1WA 2JQ7A 2VODA 2MC3A 1JHHA 3J81Z 4LG3A 2OC6A 1UHMA 1XSDA 1FTZA 1IZ1A 4HZFA 2CG4A 3BTCA 3AG1H 3OYBA 2DPDA 3G3ZA 2OUMA 5JI6A 3FXQA 2JA2A 2JVHA 1IN8A 2HXIA 4CSWA 4RB2C 5FGMA 5F0FA 3RKYA 1ZELA 2P5KA 1FY7A 4A12A 1U6GA 1YFHA 5DS9A 3OYJA 1P4AA 2QSGX 1D5YA 1R1TA 4IHTA 2EK5A 4PGGA 4A0XA 5IT3A 4D1QA 2R7RA 2BHZA 5CVIA 1LPQA 3J7AY 1U8BA 5H6RA 2ZFUA 1OYIA 5E8GA 1PP8F 4BS9A 3HOTA 2FOWA 2CQKA 1ERDA 4U7BA 1WJBA 2DMPA 2QQAA 4Q5SF 2C6YA 5LFAA 3WODF 1JT0A 2BBYA 3DQVC 4S05A 2E34A 3G4SI 3F23A 3T5XA 4OU0A 3JTGA 4LJZF 2WB1N 3WGGA 3PO3J 1IXCA 2J5OA 4J00A 2XPUA 3OYAA 4E70A 4II2A 4KFCA 5HOOA 3D5LA 4G6DA 3J80Z 1UB9A 4PJLA 2K85A 2EV6A 2KZGA 4EM1A 2GXAA 1KU7A 1TWGJ 1STZA 3GTGJ 3PUFA 1FT9A 2FSWA 3CMYA 1USTA 2L4MA 2VQGA 2CS3A 3EYYA 1FBQA 4NB5A 2GZWA 5L3FA 5JVGF 4A3FJ 4I01A 1V5GA 2DTZA 3TW6A 2WTEA 1XGSA 2VBYA 1BI2A 1V3FA 2Y0MA 4OINF 2IJLA 2LR8A 3BPXA 2W25A 3BJOA 4E7SA 3NWTA 4GYGA 1VNDA 2ELKA 1JUSA 3JAMZ 4E7HA 1O7FA 1XCBA 1U3EM 4I09A 4FX0A 2LNBA 1I39A 2O8XA 3NQOA 5J1RA 2VOOA 2A3SA 1G4DA 1TWHJ 5D6EA 2OF7A 2OV7A 3S3OA 3I4PA 2LYCA 2DOEA 1K79A 5C4XJ 3CMMA 5E17F 1X1AA 2JPBA 4C2UA 4CCLA 2ECCA 1A04A 1R5GA 4LK1F 4A6EA 1Z0XA 2XPWA 1BI3A 1Z3XA 4XN0A 3H35A 2ZC2A 5C44J 5E8IA 3PQJA 3ZPLA 1WZ2A 2KHMA 2CUZA 2RVCA 3H1CA 3OYKA 3J7ZI 1VFCA 1U9OA 3HJEA 3RQIA 1HW1A 3ONQA 2BY0A 1PUFB 2DFFA 5D4SA 3PJRA 1H0MA 1OYWA 2R92J 3T1BA 3LA2A 3A0HC 4UB6C 1XGMA 1WKMA 4DW6A 3VYRB 2XSDC 2VI6A 4MGRA 2VKDA 2IS1A 2GLOA 3TP0A 1VQLI 4IXAA 3SZGA 3V7SA 5B1BH 1T08B 1TNSA 2XAGA 3DEWA 3KX2A 1P6RA 4U0VA 4FASD 3QOEA 1O4XA 2XB5A 2NNYA 1V5EA 3BTIA 4LB6B 3TMOA 1HCRA 4FHTA 2LKSA 3S3MA 3DTKA 1D5VA 2M0MA 1JE8A 3TP3A 3B6CA 5TJJA 3A01A 1O3TA 4GO1A 1R5HA 4HW0A 1K4TA 2XV4S 4XRSG 4U87A 4M9SA 3IP4B 2DFEA 2EH3A 2R7WA 2Z5UA 3LSIA 4YFNF 2LVSA 2VJJA 3A2KA 3EPZA 4F91B 3E6BA 3KPHA 4B43A 1BC8C 1RESA 1MBKA 2KRCA 3SHFA 2OQRA 1FX7A 5KAIC 4V2GA 3KETA 4MQVA 5ICEA 2MG4A 5D5WB 3LL7A 1R5ID 2YX7A 1Z7UA 3M8FA 4BJTA 4EATA 2ZBKA 6PAXA 4A3IJ 4Y15A 4XR6A 1LEAA 1OPCA 1UFMA 1WHUA 5CPRB 1GXQA 3I58A 4YRVA 3OYEA 1SFKA 3IWFA 1FSHA 3ASNH 2R0QC 2VASA 4BDYA 2JZYA 1O57A 2B63J 5FLXK 5GAHJ 5LRRA 4YEJA 4EV0A 3G2BA 1K78A 4K2EA 5GAGJ 4A5NA 2E5ZA 3DBLB 2VBXA 2R7UA 3SJMA 4XBFA 4LLNA 5FO5A 4BGDA 1FJLA 1B9MA 1TW3A 3V8LA 3LSPA 3OY9A 5FROA 2G7UA 2XDVA 3K6GA 1VQKI 1ZG3A 2K9NA 2P7VB 3CDIA 3GTOJ 4LIUA 3D5SC 1R49A 1BA5A 2XASA 1YW8A 5JHUA 3GX4X 3N97A 1WFXA 1VQ8I 2QVOA 3DU6A 3RTRA 1MBHA 4G6QA 2RDPA 3K1PA 2CO5A 1OFCX 4KUMA 3OV8A 2MYSA 2DDBA 2DOAA 4BNCA 4KA4A 5B66C 3MCZA 2F48A 3FBIB 5HDGA 2M4GA 2EZHA 1FLIA 4A3DJ 2EA4A 4PJMA 5L3EA 1JXSA 1LKXA 1JTXA 5D6FA 1FWZA 1DPRA 3OIPA 2COBA 2GA1A 2IS4A 4I0AA 1DGRM 2JSPA 4XIDA 4U0YA 4BEHA 4ZDOA 4UUSA 1K7AA 2MFZA 2W48A 2GWRA 1VZ0A 3GBGA 4O5VA 1D1BA 2XRNA 1TWFJ 2W4SA 3G73A 2VPRA 4AD9A 4JBAA 1HA8A 2QQ8A 5LBQA 5HLGA 1D8KA 2P81A 2K9QA 5E18F 2NS0A 1JT6A 2ID3A 4RB0A 4EJOA 2HOTA 3M8JA 3VYSB 2P5VA 3GZ5A 3CCMI 3IRRA 1P7IA 4MQ9F 3W2AA 3PNVA 1H9TA 3ZQGA 5LEKA 4KN4X 4YG2F 4P5OA 3SXYA 5IP9J 2O6GE 2MLKA 5DDGA 1ZRFA 1IAWA 3HUGB 3DLAA 2MH9A 3CUQC 2QM3A 1OCRH 1E3PA 3V42A 1P2FA 3FXKA 1KU3A 4BBRJ 2BY1A 1S9HA 4ZYEA 2ZJRF 1XDUA 2D1HA 3QPLA 4L5EA 3E5UA 4H4KC 3WU2C 1QRYA 4BHCA 3R61A 5E3MA 1DPUA 1GHCA 3AL0C 2ZXJA 2ZJQF 3GFMA 2BV6A 2CQNA 3M8EA 3J7YJ 3JSPA 2P0WA 3MFKA 2PMHA 2HNHA 2Q2EA 3ABTA 3DBRB 1GVJA 2G9WA 1B6AA 2I5UA 2WC2A 3VPRA 2HS5A 2W57A 2PN6A 4RAGA 4B09A 2HR3A 4GDFA 4A69C 2MD0A 1S3JA 2RAEA 3O8GA 1ZN2A 2VB6A 3K69A 2F4IA 4NNJA 4ESJA 3PSIA 1Q1VA 3FISA 1PYVA 3HRTA 3W6VA 4AUXA 4CO8A 1XGNA 5B1AH 3ECOA 2DA1A 2Y31A 1N25A 1ZTRA 1FBSA 3HOXJ 2HYGD 2F5VA 3MZYA 5F1RA 2DI3A 1JTYA 1TT0A 4DZPA 3FMRA 3GXOA 1SD7A 1MSEC 1SFOJ 1P9QC 3NAUA 3K4JA 2X6XA 2M45A 3ABMH 2BYVE 1HLVA 3M4OJ 1HC8A 2CRGA 4BHPA 2GOMA 1O3RA 1Y0NA 4FE7A 3SFZA 4HEA2 4G7OF 4IOCF 4OIRF 1BJZA 4HA8A 2VKEA 3CF5F 1I1SA 1T0FC 2W7NA 3KP7A 1XD7A 1XN7A 3SZTA 1IG7A 1RI7A 2ELHA 1R1VA 1MDMA 3P7NA 4A3MJ 3QWLA 1TBXA 1F1ZA 2WBMA 3HGYA 5L3GA 3KEOA 1Q1HA 2QEXI 1WJEA 4G7ZF 1YE9A 3FBNB 2R7XA 3I59A 3BCBA 2GQQA 2M1BA 4HX4A 4X1EA 1HKTA 3CUQA 2QZ8A 3SFIA 2JUCA 1JJ6C 5BS6A 4E7ZA 5LGUA 1TZLA 3NARA 4IQ4A 2E71A 4X6AJ 3R0JA 1YHQI 2HYFA 2EILH 5M3FJ 2EV0A 3QYBA 4HG2A 2WAQA 2RV8A 1RETA 1QQIA 2ZJPF 3LFKA 4UVCA 1BR4A 1XMKA 1QZEA 1G3SA 1PVEA 2A5WA 1XGOA 1LB2A 4A3LJ 3MEXA 2UZKA 3MWMA 4IRGA 3O2PE 1Y56A 2ZSIB 5HDNA 3I0TA 5EYRA 3WTWC 3T8RA 1VQ7I 1B1BA 1QGPA 4HNTA 5HLHA 4JOMA 3TOBA 4B1RA 1ON1A 2QQ9A 3N05A 3EUAA 2M30A 2DJIA 2PMZN 1QVUA 2PFBA 3G6EI 1RPWA 1DU6A 3M1CA 2HQRA 4MFDA 4G9YA 1WVRA 3OOUA 4ITVA 4M9XA 4Q48A 4MFEA 5DD8A 2I10A 4R1HA 2ZXIA 5DUIA 3JREA 3I4MJ 1APLC 3ECHA 2CU7A 3BR0A 2AHQA 3KZYA 4FE4A 2OTJI 2KJCA 3F9KA 4XNFA 2Z2SB 4B3AA 2FEZA 2LP0A 2R7TA 1YOVB 2ELJA 4KT6A 3KCCA 4M6YA 1X4PA 3DWLE 4I0BA 2O0YA 2DW4A 2HQNA 3HTSB 2NXNB 3DTIA 4DYCA 2JMWA 4KIBA 1LUJB 1T0FA 4XRFA 4CCOA 1Y1WJ 3PUBA 3RSNA 3BC8A 2E5NA 4CH7A 2ZB9A 4UV9A 4F55A 1REPC 3PQKA 1IV8A 2PEXA 4JYKA 3F8FA 3H3ZA 3QAHA 4QLCU 2ME0A 2KRFA 5E1ZB 2IP2A 2EV5A 1QU3A 2LK2A 3WTSC 1UHSA 2Q0OA 3BR2A 1SFUA 1R71A 4ZTJA 2MSYA 1HW5A 1HKQA 1SMTA 5FKKA 2QQBA 1UG0A 4UB8C 1G8XA 3CDHA 3OMYA 1YW9A 3I55I 1W36D 2KQRA 4W1UA 4BKXA 4C3JJ 3EUHA 3A01B 2LSOA 2K3FA 3K4NA 2DJNA 3TOAA 1ENHA 3F6OA 2F5FA 1FYLA 4DBRA 1ZG5A 4JX5A 4XKCA 4PSXA 2P5LC 4GFBA 2DYSH 1SMYF 2DA7A 3CF2A 2RNJA 5LD2C 1QZYA 2ESHA 2FBIA 4IL6C 3OR2C 2UXXA 1FOWA 2KISA 4I98B 1F36A 5CQGA 1KQ8A 1W1WE 4FQGA 4BQNA 2DA3A 1Z05A 4J01A 2VKVA 1I3QJ 1D0YA 1FEXA 1FYKA 2X1CA 2Y2ZA 5J1UA 2FD5A 3ZQFA 1XPXA 4A0ZA 2EB7A 4E7IA 3LSKA 1WH5A 4XK4A 2X6WA 3ERMA 2ADUA 1LVAA 1AOYA 2Y0SA 2GAUA 2OD5A 4XM3A 1XB4A 2YR2A 4EQQA 1UAAA 5DYMA
chains in the Genus database with same CATH topology
1BBYA 1BN5A 1TNTA 4MNUA 4M6XA 3CUOA 1ZAOA 2ZKZA 3GW2A 3D0SA 1MGTA 2FU4A 4LD5A 3V7CA 3ISPA 3ROUA 3IKTA 4HF1A 2VC0A 4ESBA 1B59A 3LQRA 1I27A 1QBJA 1FC3A 3DXJF 2A6EF 5ILUA 3GFJA 3KEQA 3U1DA 1MKMA 1D3YA 5DV5A 2PJPA 3FF5A 4P96A 4UVAA 4L9JA 1TQIA 2XHKA 2OBPA 4JQFA 1FP1D 4L5IA 2OAZA 2D2WA 1R22A 1BI1A 2DLLA 3QPTA 3E6CC 2JRTA 2HOEA 2Y48A 1KQ0A 5FLXZ 1LEBA 2H09A 3IRQA 2D45A 1R23A 4GGGA 2B0LA 2A6HF 3ZMVA 3I53A 2Z9OA 2D1VA 3E6MA 5ERIA 4U7DA 4KN7X 4LFUA 2A68F 3DEUA 3RKWA 3CJNA 3LA3A 1T2KA 1W7PA 1MJ9A 3H3UA 4F7ZA 2W85A 2DO7A 5ICGA 5K5QA 1MZBA 4EGYA 3E6DA 3P9CA 1F4KA 1Z1DA 5HLIA 5L3CA 3FWEA 3DKWA 5L3DA 1XSXA 2VOPA 2OZUA 2QUFA 5H20A 4IPAA 2A5YB 1MDMB 3GUDA 3LSTA 3NEUA 1ZLKA 2ESNA 5HDKA 1QNTA 5IT9Z 1MJBA 3I59B 3CUQB 2AXLA 1C0WA 5FB2A 3RI4A 4FX4A 1W5TA 1E17A 3P9IA 3FXRA 2IPQX 3EYIA 1TW2A 3COAC 3HRUA 1J59A 3ULQB 2V1UA 3V4GA 3DP7A 1B9NA 1O3SA 1IUYA 2OU2A 2XROA 1T39A 1DUXC 5AIPA 2IA0A 4IF4A 2XUBA 1R58A 1R7JA 2HZTA 4ZYGA 3AAFA 3KZZA 1LJ9A 2OA4A 4M72A 1ZG1A 1G6NA 1LQ1A 2ZJ2A 3QU6A 2JTVA 4M73A 3V8JA 1J0RA 3PFIA 1PUEE 2FRHA 5DCFA 5J6XA 3U9GA 4HF2A 3KP3A 4HLYA 2DPUA 1Z91A 3K0LA 3ZMDA 1DP7P 4OIOF 5AIQA 4L0YB 4U0WA 2EFNA 3MAJA 4JK1X 2DQLA 4GCVA 5LLQA 4AIHA 5LRSA 4M74A 1G3YA 2M87A 1YG2A 1I6XA 1QO0D 1YLFA 3RYRA 4KNYA 4I2OA 3GLXA 3JW4A 2KIUA 2G7HA 1I1GA 1U8RA 3FM3A 3WE3A 1U78A 3W6JB 4ENKA 1RUOA 1YS6A 3QOPA 2H94A 4RAZA 4A2UA 4MTDA 4ZYDA 5D5VB 3C7JA 2KKOA 2MA3A 2VXZA 1FZPB 1ZREA 1XCVA 4CYDA 4UUVA 2QWWA 1AWCA 5D5XB 2A69F 1RIOH 3BP8A 5FD5A 3BWGA 5ED4A 3VOEA 3VB2A 5D5UB 2DAOA 1SAXA 3WTTC 3QU3A 1G3WA 2A61A 2DTRA 1WRJA 1KQ9A 4WF2A 5AONA 2W84A 4L5JA 4EMSA 1W4MA 5IT9K 4PDKA 4Z2YA 2LF7A 4HYEA 1NHAA 3F8MA 4R8HA 1FYMA 3L00A 3GYHX 3HSEA 3L2CA 2EJRA 4ZYHA 1PP7U 2P7CB 3GZ6A 1GXPA 1U5TC 2K4JA 4IJAA 4EM0B 3L9FA 1ONVA 3L09A 2QBYA 3WTVC 2ZO4A 5TRDA 2P6SA 2CFXA 1S7OA 4N9IA 5EEGA 1IN4A 4IRIA 3ZMZA 3K1NA 4N0BA 1YIOA 3E97A 2K7LA 4EJWA 2PMUA 2HKOA 3F8CA 1D8JA 3TGNA 4EJUA 4RGXA 3I64A 4P9UA 4AIJA 1TQMA 2ZNYA 5KK1A 3VEPA 5K5RA 1SD4A 2YPRA 4ZZDA 3F8NA 3GWZA 3TO7A 2ZCWA 1W7PB 1Z6TA 3HHGA 2R7FA 1FBUA 2XAHA 1HW2A 2O61A 1ZGJA 2M8EA 5DD4A 1R1UA 1RUNA 5A2QK 4ENNA 5ILVA 4WCGA 1IXRC 3F6VA 3DFGA 5CVVA 2PI0A 1S6LA 1U5TA 5H6QA 3WU0A 2F5DA 2YSRA 2FE3A 2JPCA 4OMZA 5J8FA 3T0YA 4XLNF 5D4RA 1WQ2A 3E3VA 5HVQC 1MD0A 1YYVA 3RYPA 4Q4ZF 2BE5F 2KJBA 3LAPA 1J2XA 1WWXA 2TDXA 3O6BB 4LLLA 1FSEA 1XSVA 3F3XA 2NYXA 4ZH4F 1K78B 3ELKA 2KIFA 2LF8A 3BZ6A 2HEOA 1Z6RA 4HQMA 5FD6A 3ABUA 1SFXA 3ZMSA 2CGPA 4NHJA 2W24A 3HRMA 3SZPA 3DV8A 2E7WA 2J5PA 5DUKA 1R36A 1HXDA 2HFHA 3GVAA 1HKSA 2RC4A 4BHBA 2VONA 1P4XA 2L4AA 1L3LA 3RJPA 3CLOA 4WXDA 4DNCA 2M5WA 3TDZC 2F5EA 2VE9A 4CDGA 2VBWA 3IC7A 2HTSA 2HTJA 2V9VA 1W5SA 5ICFA 2PG4A 5LHGA 1RZ4A 4BYYA 3WTZA 2WWYA 4HAMA 1YS7A 2JT1A 2XAQA 2H6CA 5FFXA 2Z99A 3S2WA 3ML6A 1ON2A 3CO6C 2H27A 2STWA 3IHUA 2L54A 1XDSA 4G7HF 4L18B 1YTYA 3O3KA 2XKPA 4DQ2A 1HSJA 1R00A 3HSRA 3FHZA 4LG0A 5BMZA 2OZ6A 4KYWA 2K4BA 2MBFA 4I7HA 5CVUA 3Q5FA 2UXNA 2LKPA 1T6SA 4IVNA 2RGVA 2V1DA 3HYIA 3HSFA 4LMYA 3WU1B 2VC1A 3WE2A 3C3WA 4MHGA 1L0OC 1OR7A 4P9FA 2P4WA 4O3MA 5L3BA 4KIGA 3RPUA 1S7AA 1LDKB 5F64A 3TQNA 3KP4A 2GXBA 3QP6A 3QP5A 3EDPA 2RN7A 2BEOA 4UHTA 1TLHB 4LK0F 4NQWA 1WSUA 4RGUA 2EFQA 2ZMEB 4U88A 3P9KA 4BAYA 2HGCA 2FNAA 3HOSA 4HDVA 5CLSA 1UCRA 4HX7A 4HBLA 3I71A 2QBYB 2EFOA 4PZJA 3RIRA 5E20A 2PBIA 4UVBA 1ZARA 2EA2A 5CYVA 1U2WA 4PGHA 4YIIA 1HQCA 1YO5C 4UXNA 2DQRA 4KMFA 3HHHA 2PLYA 2VN2A 3FM5A 3E5QA 1TTYA 4MEYF 1EH6A 3U2RA 5J8CA 2EFPA 4A0YA 1ZGAA 4TV7A 5LHHA 1QPMA 3RDIA 4OMYA 2IW5A 4KMUX 1BI0A 5HS7A 2Z3YA 4RGRA 2ISYA 4HDUA 3EQLF 4A6DA 4WXHA 3F22A 2P8TA 2GA2A 1E2XA 1J9IA 2QYOA 3HTUA 1U5TB 2FF4A 4UNOA 1BOAA 3TO6A 1FPQA 1USSA 2CSOA 1KU9A 2ISZA 1ZRDA 4EGZA 5BPIA 1BIAA 2CYYA 1O3QA 3KP6A 1IRFA 2VE8A 4LLGF 3GFLA 5ICCA 1FOKA 4FT8A 3ZN1A 4M9ZA 3KP5A 1W7PD 1Y0UA 1KU2A 1BIBA 4EJVA 4MEXF 2IT0A 5ILSA 1IF1A 2DK8A 2DU9A 2ACJA 4B8XA 1T38A 1DDNA 2QENA 3ZMTA 1ODDA 3E5XA 2FBKA 1TQPA 3M7GA 4CHUA 1T98A 3V8KA 5A2QZ 2F5CA 1EH7A 2HWVA 3GO5A 2QLZA 2L01A 3DPTA 1SD5A 1XMAA 4BH9A 3J81K 4G94A 1X3UA 2COMA 5LEJA 1UHWA 5F6FA 3V7RA 1JHFA 2XGXA 5K5OA 1I5ZA 5D8KB 4EJTA 5JVTA 1KGSA 2BGCA 4EM2A 2RKHA 1CF7A 3BOQA 1KYZA 3WGHA 1IRGA 5BQTA 4WWCA 2DT5A 3B73A 2R7DA 2FMLA 3BJ6A 5FFZA 3GFIA 1HBXG 3KE2A 2K02A 4L0ZB 3IWZA 2A07F 1F9NA 4RGSA 1G3TA 4LG0B 5DCMA 4A5MA 3J80K 2HDCA 4LGWA 4ETSA 4ENJA 4GXOA 4WX9A 2YX4A 2Y75A 1KYWA 3F72A 2XIGA 3LA7A 4S04A 3QPHA 2ZMEA 1SD6A 4HOBA 3VFZA 1IN6A 4CGZA 3Q9SA 2AS5F 4WXCA 3JAMK 3JTHA 3FMSA 1K6OA 3IKVA 4EVIA 3EETA 2IA2A 4AWXB 3K1MA 2P6TA 2XAJA 1J5YA 4IHSA 3NRVA 2EWNA 3VODA 3KLOA 4XSZF 2DK5A 1CGPA 3R6SA 2GIVA 3B02A 3W6KB 1ZH5A 3WGIA 4YFKF 2XVCA 5D8LB 4Y13A 4CXFA 3K2ZA 3GEZA 3GF2A 2NNNA 4L9NA 1EV7A 3HIFA 4KIFA 2O03A 1P92A 2NRAC 3R4KA 2K27A 3BJAA 5BOXA 3FX3A 1HSTA 3RKXA 3WG9A 3ZN0A 2GXGA 3LAJA 3I54A 1MJAA 3C18A 4HV5A 2JSCA 4ZZLA 4HQEA 1IXSB 1KA8A 4YIFA 3FXUA 5LGNA 2DBBA 2VT2A 3SQNA 1F5TA 2UWMA 1RNLA 4G8XA 3CTAA 4HLXA 4M71A 3C1DA 3OOPA 2FNPA 4O6JA 1ZRCA 3WTXC 3QRFF 4KICA 5JFRA 2L3DA 3MZHA 4D0PA 1BM9A 1LNWA 1JGSA 5EEHA 3TO9A 2KIMA 2L02A 1OMIA 2VT3A 5DEQA 4BQAA 3BPVA 3ZQ7A 3CO7C 4IRHA 3I5UA 2FBHA 2X4HA 4AVPA 3JSOA 4UV8A 3F21A 3DF8A 4HV6A 5CJ9A 4WK8F 1OYYA 1OKRA 3ERED 2LDUA 5CVJA 4RAYA 2ZFWA 4OIQF 1ZLJA 5LHIA 5JR3A 2FA5A 2MD5A 4P55A 1J75A 4H0EA 2E1CA 1QZZA 2V79A 4HX8A 4XLPF 3J7AO 4L9VA 4XSXF 1O7LA 2CWEA 2FQ3A 3FZVA 3FMQA 2ZNZA 5HS9A 3DPLC 1FNNA 3REOA 3WTUC 2FMYA 3R60A 4QWQA 3KFWX 3KLNA 5LGTA 4MTEA 4HF0A 2OQGA 3K9TA 2Z33A 3RPQA 2E7XA 2X0LA 2V6CA 1FP2A 2PQ8A 4ENMA 1WI9A 2IA1A 4Y17A 4ON0A 4R79A 2DFIA 4OIPF 3R0AA 3BY6A 1PDNC 2O3FA 2YU3A 3BROA 2NAZA 4CICA 4CZZA 1S29A 4RB1A 2MH2A 4PCQA 1H9GA 4YFXF 1VTNC 4Q47A 1YW7A 1SFEA 1YQAA 2V1XA 1ULYA 3T8TA 4GYIA 3F8BA 2F2EA 5CVRA 1Z9CA 5E1XA 3Q9VA 1V4RA 1J7KA 2Q8KA 4ESFA 4KDPA 2K86A 3ZP5A 3IL2A 1CF7B 3WTYC 5BPDA 2MLGA 4LB5A 3ZMUA 1P4WA 3M1EA 2FXAA 1IW7F 1LDJA 5HS8A 1ZHFA 1IN5A 2IRFG 1IN7A 2XAFA 5K1YA 2VBZA 2CW0F 4OOIA 4KT5C 3N4MA 3HUGA 3MQ0A 4L9TA 3L7WA 3TDUC 5DCMB 1S8NA 2WV0A 1LDDA 4I02A 2XKOA 4N9HA 1ZYRF 2H6BA 2RQPA 4RS8A 2ETHA 1B4AA 4AIKA 1BC7C 3KP2A 3LWFA 3BDDA 2STTA 2IVMA 2E1NA 3TKYA 2HKXA 3LQQA 2FOKA 1EH8A 2EFWA 4ASNA 2R3SA 3HRSA 5KVRA 4BXUA 3H92A 3M9AA 4RB3C 1BJAA 5E1WA 2VODA 2MC3A 1JHHA 3J81Z 1UHMA 1XSDA 1IZ1A 4HZFA 2CG4A 2DPDA 3G3ZA 5JI6A 3FXQA 1IN8A 4RB2C 5FGMA 3RKYA 2P5KA 1FY7A 4A12A 1U6GA 1YFHA 1P4AA 1R1TA 4IHTA 2EK5A 4PGGA 4A0XA 5IT3A 5CVIA 5H6RA 1OYIA 5E8GA 1PP8F 3HOTA 2CQKA 4U7BA 2QQAA 4Q5SF 2C6YA 3WODF 2BBYA 3DQVC 4S05A 3F23A 3T5XA 4OU0A 3JTGA 4LJZF 3WGGA 1IXCA 2J5OA 4E70A 4KFCA 5HOOA 3D5LA 4G6DA 3J80Z 1UB9A 2EV6A 4EM1A 1KU7A 1STZA 1FT9A 2FSWA 1USTA 2L4MA 3EYYA 1FBQA 4NB5A 2GZWA 5L3FA 4I01A 2WTEA 1XGSA 2VBYA 1BI2A 1V3FA 2Y0MA 4OINF 2IJLA 3BPXA 2W25A 3BJOA 4GYGA 3JAMZ 1O7FA 1XCBA 1U3EM 4I09A 4FX0A 2LNBA 2O8XA 3NQOA 2VOOA 2A3SA 1G4DA 5D6EA 3I4PA 1K79A 5E17F 2JPBA 1A04A 1R5GA 4LK1F 4A6EA 1BI3A 5E8IA 3PQJA 3ZPLA 2RVCA 1HW1A 5D4SA 1H0MA 1OYWA 3T1BA 3LA2A 1XGMA 1WKMA 4MGRA 4IXAA 3V7SA 1TNSA 2XAGA 4U0VA 1P6RA 2NNYA 4LB6B 4FHTA 1D5VA 1JE8A 1O3TA 5TJJA 4GO1A 1R5HA 4HW0A 2XV4S 4M9SA 2Z5UA 4YFNF 3E6BA 1BC8C 3SHFA 2OQRA 1FX7A 3KETA 4MQVA 5ICEA 5D5WB 2YX7A 1Z7UA 3M8FA 2ZBKA 6PAXA 4Y15A 1LEAA 1OPCA 1UFMA 1GXQA 3I58A 3IWFA 1FSHA 2JZYA 1O57A 5FLXK 5LRRA 4EV0A 1K78A 4K2EA 4A5NA 2VBXA 4XBFA 4LLNA 5FO5A 1B9MA 1TW3A 3V8LA 2G7UA 1ZG3A 2P7VB 2XASA 1YW8A 5JHUA 3GX4X 3N97A 2QVOA 3RTRA 4G6QA 2RDPA 3K1PA 2CO5A 4KUMA 3OV8A 4BNCA 4KA4A 3MCZA 1FLIA 5HDGA 2EA4A 5L3EA 1JXSA 5D6FA 1FWZA 1DPRA 2GA1A 4I0AA 4U0YA 1K7AA 2GWRA 4O5VA 2XRNA 3G73A 4AD9A 4JBAA 5LBQA 5HLGA 1D8KA 5E18F 2NS0A 4RB0A 4EJOA 2P5VA 3GZ5A 3IRRA 4MQ9F 1H9TA 5LEKA 4KN4X 4YG2F 4P5OA 3SXYA 2O6GE 2MLKA 5DDGA 1ZRFA 1IAWA 2MH9A 3CUQC 2QM3A 1P2FA 1KU3A 4ZYEA 1XDUA 2D1HA 3E5UA 4BHCA 3R61A 1DPUA 1GHCA 2ZXJA 3GFMA 2BV6A 3M8EA 3JSPA 3MFKA 2PMHA 2Q2EA 3ABTA 1GVJA 2G9WA 1B6AA 2WC2A 2HS5A 2W57A 2PN6A 4B09A 2HR3A 1S3JA 1ZN2A 3K69A 4ESJA 3HRTA 4CO8A 1XGNA 3ECOA 1FBSA 2HYGD 3MZYA 5F1RA 2DI3A 3FMRA 3GXOA 1SD7A 2M45A 2BYVE 4BHPA 1O3RA 3SFZA 4G7OF 4OIRF 4HA8A 1I1SA 3KP7A 1XD7A 1XN7A 3SZTA 1RI7A 2ELHA 1R1VA 1MDMA 3P7NA 1TBXA 1F1ZA 5L3GA 3KEOA 1Q1HA 4G7ZF 3I59A 2GQQA 2M1BA 4HX4A 1HKTA 3CUQA 2QZ8A 5BS6A 5LGUA 3R0JA 2HYFA 2EV0A 2RV8A 1QQIA 3LFKA 4UVCA 1XMKA 1G3SA 1XGOA 1LB2A 2UZKA 3MEXA 3MWMA 4IRGA 3O2PE 5HDNA 3I0TA 3WTWC 3T8RA 1B1BA 1QGPA 5HLHA 3TOBA 1ON1A 2QQ9A 2M30A 2PFBA 2HQRA 4G9YA 4M9XA 4Q48A 5DD8A 4R1HA 5DUIA 3ECHA 3KZYA 2KJCA 2FEZA 3KCCA 4M6YA 4I0BA 2O0YA 2DW4A 2HQNA 3HTSB 4KIBA 1T0FA 4XRFA 1REPC 4UV9A 3PQKA 2PEXA 3F8FA 3H3ZA 3QAHA 4QLCU 2KRFA 5E1ZB 2IP2A 2EV5A 3WTSC 2Q0OA 1SFUA 1HW5A 1HKQA 1SMTA 2QQBA 3CDHA 1YW9A 3EUHA 2LSOA 3TOAA 3F6OA 2F5FA 1FYLA 1ZG5A 2P5LC 1SMYF 2RNJA 1QZYA 2ESHA 2FBIA 2UXXA 4I98B 1KQ8A 1Z05A 1FYKA 4A0ZA 2EB7A 1AOYA 2ADUA 1LVAA 2GAUA 2OD5A 1XB4A 2YR2A 4EQQA 5DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBY A;  1BN5 A;  1TNT A;  4MNU A;  4M6X A;  3CUO A;  1ZAO A;  2ZKZ A;  3GW2 A;  3D0S A;  1MGT A;  2FU4 A;  4LD5 A;  3V7C A;  3ISP A;  3ROU A;  3IKT A;  4HF1 A;  2VC0 A;  4ESB A;  1B59 A;  3LQR A;  1I27 A;  1QBJ A;  1FC3 A;  3DXJ F;  2A6E F;  5ILU A;  3GFJ A;  3KEQ A;  3U1D A;  1MKM A;  1D3Y A;  5DV5 A;  2PJP A;  3FF5 A;  4P96 A;  4UVA A;  4L9J A;  1TQI A;  2XHK A;  2OBP A;  4JQF A;  1FP1 D;  4L5I A;  2OAZ A;  2D2W A;  1R22 A;  1BI1 A;  2DLL A;  3QPT A;  3E6C C;  2JRT A;  2HOE A;  2Y48 A;  1KQ0 A;  5FLX Z;  1LEB A;  2H09 A;  3IRQ A;  2D45 A;  1R23 A;  4GGG A;  2B0L A;  2A6H F;  3ZMV A;  3I53 A;  2Z9O A;  2D1V A;  3E6M A;  5ERI A;  4U7D A;  4KN7 X;  4LFU A;  2A68 F;  3DEU A;  3RKW A;  3CJN A;  3LA3 A;  1T2K A;  1W7P A;  1MJ9 A;  3H3U A;  4F7Z A;  2W85 A;  2DO7 A;  5ICG A;  5K5Q A;  1MZB A;  4EGY A;  3E6D A;  3P9C A;  1F4K A;  1Z1D A;  5HLI A;  5L3C A;  3FWE A;  3DKW A;  5L3D A;  1XSX A;  2VOP A;  2OZU A;  2QUF A;  5H20 A;  4IPA A;  2A5Y B;  1MDM B;  3GUD A;  3LST A;  3NEU A;  1ZLK A;  2ESN A;  5HDK A;  1QNT A;  5IT9 Z;  1MJB A;  3I59 B;  3CUQ B;  2AXL A;  1C0W A;  5FB2 A;  3RI4 A;  4FX4 A;  1W5T A;  1E17 A;  3P9I A;  3FXR A;  2IPQ X;  3EYI A;  1TW2 A;  3COA C;  3HRU A;  1J59 A;  3ULQ B;  2V1U A;  3V4G A;  3DP7 A;  1B9N A;  1O3S A;  1IUY A;  2OU2 A;  2XRO A;  1T39 A;  1DUX C;  5AIP A;  2IA0 A;  4IF4 A;  2XUB A;  1R58 A;  1R7J A;  2HZT A;  4ZYG A;  3AAF A;  3KZZ A;  1LJ9 A;  2OA4 A;  4M72 A;  1ZG1 A;  1G6N A;  1LQ1 A;  2ZJ2 A;  3QU6 A;  2JTV A;  4M73 A;  3V8J A;  1J0R A;  3PFI A;  1PUE E;  2FRH A;  5DCF A;  5J6X A;  3U9G A;  4HF2 A;  3KP3 A;  4HLY A;  2DPU A;  1Z91 A;  3K0L A;  3ZMD A;  1DP7 P;  4OIO F;  5AIQ A;  4L0Y B;  4U0W A;  2EFN A;  3MAJ A;  4JK1 X;  2DQL A;  4GCV A;  5LLQ A;  4AIH A;  5LRS A;  4M74 A;  1G3Y A;  2M87 A;  1YG2 A;  1I6X A;  1QO0 D;  1YLF A;  3RYR A;  4KNY A;  4I2O A;  3GLX A;  3JW4 A;  2KIU A;  2G7H A;  1I1G A;  1U8R A;  3FM3 A;  3WE3 A;  1U78 A;  3W6J B;  4ENK A;  1RUO A;  1YS6 A;  3QOP A;  2H94 A;  4RAZ A;  4A2U A;  4MTD A;  4ZYD A;  5D5V B;  3C7J A;  2KKO A;  2MA3 A;  2VXZ A;  1FZP B;  1ZRE A;  1XCV A;  4CYD A;  4UUV A;  2QWW A;  1AWC A;  5D5X B;  2A69 F;  1RIO H;  3BP8 A;  5FD5 A;  3BWG A;  5ED4 A;  3VOE A;  3VB2 A;  5D5U B;  2DAO A;  1SAX A;  3WTT C;  3QU3 A;  1G3W A;  2A61 A;  2DTR A;  1WRJ A;  1KQ9 A;  4WF2 A;  5AON A;  2W84 A;  4L5J A;  4EMS A;  1W4M A;  5IT9 K;  4PDK A;  4Z2Y A;  2LF7 A;  4HYE A;  1NHA A;  3F8M A;  4R8H A;  1FYM A;  3L00 A;  3GYH X;  3HSE A;  3L2C A;  2EJR A;  4ZYH A;  1PP7 U;  2P7C B;  3GZ6 A;  1GXP A;  1U5T C;  2K4J A;  4IJA A;  4EM0 B;  3L9F A;  1ONV A;  3L09 A;  2QBY A;  3WTV C;  2ZO4 A;  5TRD A;  2P6S A;  2CFX A;  1S7O A;  4N9I A;  5EEG A;  1IN4 A;  4IRI A;  3ZMZ A;  3K1N A;  4N0B A;  1YIO A;  3E97 A;  2K7L A;  4EJW A;  2PMU A;  2HKO A;  3F8C A;  1D8J A;  3TGN A;  4EJU A;  4RGX A;  3I64 A;  4P9U A;  4AIJ A;  1TQM A;  2ZNY A;  5KK1 A;  3VEP A;  5K5R A;  1SD4 A;  2YPR A;  4ZZD A;  3F8N A;  3GWZ A;  3TO7 A;  2ZCW A;  1W7P B;  1Z6T A;  3HHG A;  2R7F A;  1FBU A;  2XAH A;  1HW2 A;  2O61 A;  1ZGJ A;  2M8E A;  5DD4 A;  1R1U A;  1RUN A;  5A2Q K;  4ENN A;  5ILV A;  4WCG A;  1IXR C;  3F6V A;  3DFG A;  5CVV A;  2PI0 A;  1S6L A;  1U5T A;  5H6Q A;  3WU0 A;  2F5D A;  2YSR A;  2FE3 A;  2JPC A;  4OMZ A;  5J8F A;  3T0Y A;  4XLN F;  5D4R A;  1WQ2 A;  3E3V A;  5HVQ C;  1MD0 A;  1YYV A;  3RYP A;  4Q4Z F;  2BE5 F;  2KJB A;  3LAP A;  1J2X A;  1WWX A;  2TDX A;  3O6B B;  4LLL A;  1FSE A;  1XSV A;  3F3X A;  2NYX A;  4ZH4 F;  1K78 B;  3ELK A;  2KIF A;  2LF8 A;  3BZ6 A;  2HEO A;  1Z6R A;  4HQM A;  5FD6 A;  3ABU A;  1SFX A;  3ZMS A;  2CGP A;  4NHJ A;  2W24 A;  3HRM A;  3SZP A;  3DV8 A;  2E7W A;  2J5P A;  5DUK A;  1R36 A;  1HXD A;  2HFH A;  3GVA A;  1HKS A;  2RC4 A;  4BHB A;  2VON A;  1P4X A;  2L4A A;  1L3L A;  3RJP A;  3CLO A;  4WXD A;  4DNC A;  2M5W A;  3TDZ C;  2F5E A;  2VE9 A;  4CDG A;  2VBW A;  3IC7 A;  2HTS A;  2HTJ A;  2V9V A;  1W5S A;  5ICF A;  2PG4 A;  5LHG A;  1RZ4 A;  4BYY A;  3WTZ A;  2WWY A;  4HAM A;  1YS7 A;  2JT1 A;  2XAQ A;  2H6C A;  5FFX A;  2Z99 A;  3S2W A;  3ML6 A;  1ON2 A;  3CO6 C;  2H27 A;  2STW A;  3IHU A;  2L54 A;  1XDS A;  4G7H F;  4L18 B;  1YTY A;  3O3K A;  2XKP A;  4DQ2 A;  1HSJ A;  1R00 A;  3HSR A;  3FHZ A;  4LG0 A;  5BMZ A;  2OZ6 A;  4KYW A;  2K4B A;  2MBF A;  4I7H A;  5CVU A;  3Q5F A;  2UXN A;  2LKP A;  1T6S A;  4IVN A;  2RGV A;  2V1D A;  3HYI A;  3HSF A;  4LMY A;  3WU1 B;  2VC1 A;  3WE2 A;  3C3W A;  4MHG A;  1L0O C;  1OR7 A;  4P9F A;  2P4W A;  4O3M A;  5L3B A;  4KIG A;  3RPU A;  1S7A A;  1LDK B;  5F64 A;  3TQN A;  3KP4 A;  2GXB A;  3QP6 A;  3QP5 A;  3EDP A;  2RN7 A;  2BEO A;  4UHT A;  1TLH B;  4LK0 F;  4NQW A;  1WSU A;  4RGU A;  2EFQ A;  2ZME B;  4U88 A;  3P9K A;  4BAY A;  2HGC A;  2FNA A;  3HOS A;  4HDV A;  5CLS A;  1UCR A;  4HX7 A;  4HBL A;  3I71 A;  2QBY B;  2EFO A;  4PZJ A;  3RIR A;  5E20 A;  2PBI A;  4UVB A;  1ZAR A;  2EA2 A;  5CYV A;  1U2W A;  4PGH A;  4YII A;  1HQC A;  1YO5 C;  4UXN A;  2DQR A;  4KMF A;  3HHH A;  2PLY A;  2VN2 A;  3FM5 A;  3E5Q A;  1TTY A;  4MEY F;  1EH6 A;  3U2R A;  5J8C A;  2EFP A;  4A0Y A;  1ZGA A;  4TV7 A;  5LHH A;  1QPM A;  3RDI A;  4OMY A;  2IW5 A;  4KMU X;  1BI0 A;  5HS7 A;  2Z3Y A;  4RGR A;  2ISY A;  4HDU A;  3EQL F;  4A6D A;  4WXH A;  3F22 A;  2P8T A;  2GA2 A;  1E2X A;  1J9I A;  2QYO A;  3HTU A;  1U5T B;  2FF4 A;  4UNO A;  1BOA A;  3TO6 A;  1FPQ A;  1USS A;  2CSO A;  1KU9 A;  2ISZ A;  1ZRD A;  4EGZ A;  5BPI A;  1BIA A;  2CYY A;  1O3Q A;  3KP6 A;  1IRF A;  2VE8 A;  4LLG F;  3GFL A;  5ICC A;  1FOK A;  4FT8 A;  3ZN1 A;  4M9Z A;  3KP5 A;  1W7P D;  1Y0U A;  1KU2 A;  1BIB A;  4EJV A;  4MEX F;  2IT0 A;  5ILS A;  1IF1 A;  2DK8 A;  2DU9 A;  2ACJ A;  4B8X A;  1T38 A;  1DDN A;  2QEN A;  3ZMT A;  1ODD A;  3E5X A;  2FBK A;  1TQP A;  3M7G A;  4CHU A;  1T98 A;  3V8K A;  5A2Q Z;  2F5C A;  1EH7 A;  2HWV A;  3GO5 A;  2QLZ A;  2L01 A;  3DPT A;  1SD5 A;  1XMA A;  4BH9 A;  3J81 K;  4G94 A;  1X3U A;  2COM A;  5LEJ A;  1UHW A;  5F6F A;  3V7R A;  1JHF A;  2XGX A;  5K5O A;  1I5Z A;  5D8K B;  4EJT A;  5JVT A;  1KGS A;  2BGC A;  4EM2 A;  2RKH A;  1CF7 A;  3BOQ A;  1KYZ A;  3WGH A;  1IRG A;  5BQT A;  4WWC A;  2DT5 A;  3B73 A;  2R7D A;  2FML A;  3BJ6 A;  5FFZ A;  3GFI A;  1HBX G;  3KE2 A;  2K02 A;  4L0Z B;  3IWZ A;  2A07 F;  1F9N A;  4RGS A;  1G3T A;  4LG0 B;  5DCM A;  4A5M A;  3J80 K;  2HDC A;  4LGW A;  4ETS A;  4ENJ A;  4GXO A;  4WX9 A;  2YX4 A;  2Y75 A;  1KYW A;  3F72 A;  2XIG A;  3LA7 A;  4S04 A;  3QPH A;  2ZME A;  1SD6 A;  4HOB A;  3VFZ A;  1IN6 A;  4CGZ A;  3Q9S A;  2AS5 F;  4WXC A;  3JAM K;  3JTH A;  3FMS A;  1K6O A;  3IKV A;  4EVI A;  3EET A;  2IA2 A;  4AWX B;  3K1M A;  2P6T A;  2XAJ A;  1J5Y A;  4IHS A;  3NRV A;  2EWN A;  3VOD A;  3KLO A;  4XSZ F;  2DK5 A;  1CGP A;  3R6S A;  2GIV A;  3B02 A;  3W6K B;  1ZH5 A;  3WGI A;  4YFK F;  2XVC A;  5D8L B;  4Y13 A;  4CXF A;  3K2Z A;  3GEZ A;  3GF2 A;  2NNN A;  4L9N A;  1EV7 A;  3HIF A;  4KIF A;  2O03 A;  1P92 A;  2NRA C;  3R4K A;  2K27 A;  3BJA A;  5BOX A;  3FX3 A;  1HST A;  3RKX A;  3WG9 A;  3ZN0 A;  2GXG A;  3LAJ A;  3I54 A;  1MJA A;  3C18 A;  4HV5 A;  2JSC A;  4ZZL A;  4HQE A;  1IXS B;  1KA8 A;  4YIF A;  3FXU A;  5LGN A;  2DBB A;  2VT2 A;  3SQN A;  1F5T A;  2UWM A;  1RNL A;  4G8X A;  3CTA A;  4HLX A;  4M71 A;  3C1D A;  3OOP A;  2FNP A;  4O6J A;  1ZRC A;  3WTX C;  3QRF F;  4KIC A;  5JFR A;  2L3D A;  3MZH A;  4D0P A;  1BM9 A;  1LNW A;  1JGS A;  5EEH A;  3TO9 A;  2KIM A;  2L02 A;  1OMI A;  2VT3 A;  5DEQ A;  4BQA A;  3BPV A;  3ZQ7 A;  3CO7 C;  4IRH A;  3I5U A;  2FBH A;  2X4H A;  4AVP A;  3JSO A;  4UV8 A;  3F21 A;  3DF8 A;  4HV6 A;  5CJ9 A;  4WK8 F;  1OYY A;  1OKR A;  3ERE D;  2LDU A;  5CVJ A;  4RAY A;  2ZFW A;  4OIQ F;  1ZLJ A;  5LHI A;  5JR3 A;  2FA5 A;  2MD5 A;  4P55 A;  1J75 A;  4H0E A;  2E1C A;  1QZZ A;  2V79 A;  4HX8 A;  4XLP F;  3J7A O;  4L9V A;  4XSX F;  1O7L A;  2CWE A;  2FQ3 A;  3FZV A;  3FMQ A;  2ZNZ A;  5HS9 A;  3DPL C;  1FNN A;  3REO A;  3WTU C;  2FMY A;  3R60 A;  4QWQ A;  3KFW X;  3KLN A;  5LGT A;  4MTE A;  4HF0 A;  2OQG A;  3K9T A;  2Z33 A;  3RPQ A;  2E7X A;  2X0L A;  2V6C A;  1FP2 A;  2PQ8 A;  4ENM A;  1WI9 A;  2IA1 A;  4Y17 A;  4ON0 A;  4R79 A;  2DFI A;  4OIP F;  3R0A A;  3BY6 A;  1PDN C;  2O3F A;  2YU3 A;  3BRO A;  2NAZ A;  4CIC A;  4CZZ A;  1S29 A;  4RB1 A;  2MH2 A;  4PCQ A;  1H9G A;  4YFX F;  1VTN C;  4Q47 A;  1YW7 A;  1SFE A;  1YQA A;  2V1X A;  1ULY A;  3T8T A;  4GYI A;  3F8B A;  2F2E A;  5CVR A;  1Z9C A;  5E1X A;  3Q9V A;  1V4R A;  1J7K A;  2Q8K A;  4ESF A;  4KDP A;  2K86 A;  3ZP5 A;  3IL2 A;  1CF7 B;  3WTY C;  5BPD A;  2MLG A;  4LB5 A;  3ZMU A;  1P4W A;  3M1E A;  2FXA A;  1IW7 F;  1LDJ A;  5HS8 A;  1ZHF A;  1IN5 A;  2IRF G;  1IN7 A;  2XAF A;  5K1Y A;  2VBZ A;  2CW0 F;  4OOI A;  4KT5 C;  3N4M A;  3HUG A;  3MQ0 A;  4L9T A;  3L7W A;  3TDU C;  5DCM B;  1S8N A;  2WV0 A;  1LDD A;  4I02 A;  2XKO A;  4N9H A;  1ZYR F;  2H6B A;  2RQP A;  4RS8 A;  2ETH A;  1B4A A;  4AIK A;  1BC7 C;  3KP2 A;  3LWF A;  3BDD A;  2STT A;  2IVM A;  2E1N A;  3TKY A;  2HKX A;  3LQQ A;  2FOK A;  1EH8 A;  2EFW A;  4ASN A;  2R3S A;  3HRS A;  5KVR A;  4BXU A;  3H92 A;  3M9A A;  4RB3 C;  1BJA A;  5E1W A;  2VOD A;  2MC3 A;  1JHH A;  3J81 Z;  1UHM A;  1XSD A;  1IZ1 A;  4HZF A;  2CG4 A;  2DPD A;  3G3Z A;  5JI6 A;  3FXQ A;  1IN8 A;  4RB2 C;  5FGM A;  3RKY A;  2P5K A;  1FY7 A;  4A12 A;  1U6G A;  1YFH A;  1P4A A;  1R1T A;  4IHT A;  2EK5 A;  4PGG A;  4A0X A;  5IT3 A;  5CVI A;  5H6R A;  1OYI A;  5E8G A;  1PP8 F;  3HOT A;  2CQK A;  4U7B A;  2QQA A;  4Q5S F;  2C6Y A;  3WOD F;  2BBY A;  3DQV C;  4S05 A;  3F23 A;  3T5X A;  4OU0 A;  3JTG A;  4LJZ F;  3WGG A;  1IXC A;  2J5O A;  4E70 A;  4KFC A;  5HOO A;  3D5L A;  4G6D A;  3J80 Z;  1UB9 A;  2EV6 A;  4EM1 A;  1KU7 A;  1STZ A;  1FT9 A;  2FSW A;  1UST A;  2L4M A;  3EYY A;  1FBQ A;  4NB5 A;  2GZW A;  5L3F A;  4I01 A;  2WTE A;  1XGS A;  2VBY A;  1BI2 A;  1V3F A;  2Y0M A;  4OIN F;  2IJL A;  3BPX A;  2W25 A;  3BJO A;  4GYG A;  3JAM Z;  1O7F A;  1XCB A;  1U3E M;  4I09 A;  4FX0 A;  2LNB A;  2O8X A;  3NQO A;  2VOO A;  2A3S A;  1G4D A;  5D6E A;  3I4P A;  1K79 A;  5E17 F;  2JPB A;  1A04 A;  1R5G A;  4LK1 F;  4A6E A;  1BI3 A;  5E8I A;  3PQJ A;  3ZPL A;  2RVC A;  1HW1 A;  5D4S A;  1H0M A;  1OYW A;  3T1B A;  3LA2 A;  1XGM A;  1WKM A;  4MGR A;  4IXA A;  3V7S A;  1TNS A;  2XAG A;  4U0V A;  1P6R A;  2NNY A;  4LB6 B;  4FHT A;  1D5V A;  1JE8 A;  1O3T A;  5TJJ A;  4GO1 A;  1R5H A;  4HW0 A;  2XV4 S;  4M9S A;  2Z5U A;  4YFN F;  3E6B A;  1BC8 C;  3SHF A;  2OQR A;  1FX7 A;  3KET A;  4MQV A;  5ICE A;  5D5W B;  2YX7 A;  1Z7U A;  3M8F A;  2ZBK A;  6PAX A;  4Y15 A;  1LEA A;  1OPC A;  1UFM A;  1GXQ A;  3I58 A;  3IWF A;  1FSH A;  2JZY A;  1O57 A;  5FLX K;  5LRR A;  4EV0 A;  1K78 A;  4K2E A;  4A5N A;  2VBX A;  4XBF A;  4LLN A;  5FO5 A;  1B9M A;  1TW3 A;  3V8L A;  2G7U A;  1ZG3 A;  2P7V B;  2XAS A;  1YW8 A;  5JHU A;  3GX4 X;  3N97 A;  2QVO A;  3RTR A;  4G6Q A;  2RDP A;  3K1P A;  2CO5 A;  4KUM A;  3OV8 A;  4BNC A;  4KA4 A;  3MCZ A;  1FLI A;  5HDG A;  2EA4 A;  5L3E A;  1JXS A;  5D6F A;  1FWZ A;  1DPR A;  2GA1 A;  4I0A A;  4U0Y A;  1K7A A;  2GWR A;  4O5V A;  2XRN A;  3G73 A;  4AD9 A;  4JBA A;  5LBQ A;  5HLG A;  1D8K A;  5E18 F;  2NS0 A;  4RB0 A;  4EJO A;  2P5V A;  3GZ5 A;  3IRR A;  4MQ9 F;  1H9T A;  5LEK A;  4KN4 X;  4YG2 F;  4P5O A;  3SXY A;  2O6G E;  2MLK A;  5DDG A;  1ZRF A;  1IAW A;  2MH9 A;  3CUQ C;  2QM3 A;  1P2F A;  1KU3 A;  4ZYE A;  1XDU A;  2D1H A;  3E5U A;  4BHC A;  3R61 A;  1DPU A;  1GHC A;  2ZXJ A;  3GFM A;  2BV6 A;  3M8E A;  3JSP A;  3MFK A;  2PMH A;  2Q2E A;  3ABT A;  1GVJ A;  2G9W A;  1B6A A;  2WC2 A;  2HS5 A;  2W57 A;  2PN6 A;  4B09 A;  2HR3 A;  1S3J A;  1ZN2 A;  3K69 A;  4ESJ A;  3HRT A;  4CO8 A;  1XGN A;  3ECO A;  1FBS A;  2HYG D;  3MZY A;  5F1R A;  2DI3 A;  3FMR A;  3GXO A;  1SD7 A;  2M45 A;  2BYV E;  4BHP A;  1O3R A;  3SFZ A;  4G7O F;  4OIR F;  4HA8 A;  1I1S A;  3KP7 A;  1XD7 A;  1XN7 A;  3SZT A;  1RI7 A;  2ELH A;  1R1V A;  1MDM A;  3P7N A;  1TBX A;  1F1Z A;  5L3G A;  3KEO A;  1Q1H A;  4G7Z F;  3I59 A;  2GQQ A;  2M1B A;  4HX4 A;  1HKT A;  3CUQ A;  2QZ8 A;  5BS6 A;  5LGU A;  3R0J A;  2HYF A;  2EV0 A;  2RV8 A;  1QQI A;  3LFK A;  4UVC A;  1XMK A;  1G3S A;  1XGO A;  1LB2 A;  2UZK A;  3MEX A;  3MWM A;  4IRG A;  3O2P E;  5HDN A;  3I0T A;  3WTW C;  3T8R A;  1B1B A;  1QGP A;  5HLH A;  3TOB A;  1ON1 A;  2QQ9 A;  2M30 A;  2PFB A;  2HQR A;  4G9Y A;  4M9X A;  4Q48 A;  5DD8 A;  4R1H A;  5DUI A;  3ECH A;  3KZY A;  2KJC A;  2FEZ A;  3KCC A;  4M6Y A;  4I0B A;  2O0Y A;  2DW4 A;  2HQN A;  3HTS B;  4KIB A;  1T0F A;  4XRF A;  1REP C;  4UV9 A;  3PQK A;  2PEX A;  3F8F A;  3H3Z A;  3QAH A;  4QLC U;  2KRF A;  5E1Z B;  2IP2 A;  2EV5 A;  3WTS C;  2Q0O A;  1SFU A;  1HW5 A;  1HKQ A;  1SMT A;  2QQB A;  3CDH A;  1YW9 A;  3EUH A;  2LSO A;  3TOA A;  3F6O A;  2F5F A;  1FYL A;  1ZG5 A;  2P5L C;  1SMY F;  2RNJ A;  1QZY A;  2ESH A;  2FBI A;  2UXX A;  4I98 B;  1KQ8 A;  1Z05 A;  1FYK A;  4A0Z A;  2EB7 A;  1AOY A;  2ADU A;  1LVA A;  2GAU A;  2OD5 A;  1XB4 A;  2YR2 A;  4EQQ A;  5DYM A; 
#chains in the Genus database with same CATH topology
 3OYM A;  1BBY A;  3S8P A;  3LOC A;  2HZD A;  2BW3 A;  1BN5 A;  2NVU B;  1TNT A;  3GTL J;  4MNU A;  1MW7 A;  4M6X A;  2EIJ H;  4BY1 J;  2VL8 A;  2BY3 A;  4QPQ A;  5IOZ A;  3CUO A;  3KZI C;  1ZAO A;  1GUU A;  2ZKZ A;  5EG0 B;  2IGO A;  5C3E J;  3GW2 A;  3D0S A;  1MGT A;  3X2Q H;  2CH0 A;  3I3L A;  2FU4 A;  5DM7 F;  4PFP A;  2X1D A;  4IEJ A;  5FKO A;  2MC4 A;  4LD5 A;  2L2O A;  2HVQ A;  3V7C A;  3ISP A;  2QGU A;  3ROU A;  2L9S A;  2HVR A;  1YX5 A;  2IS6 A;  3IKT A;  4HF1 A;  3HM5 A;  2VC0 A;  1X4O A;  4ESB A;  2WAQ N;  3E0J B;  4ZDP A;  4BUP A;  3HOW J;  2DMN A;  1B59 A;  3LQR A;  4BEH B;  1WGX A;  1I27 A;  1QBJ A;  4UUS B;  1UG2 A;  1FC3 A;  3DXJ F;  2A6E F;  1DGW Y;  5ILU A;  1A6Q A;  3GFJ A;  3KEQ A;  1Y8R B;  2OTL I;  3U1D A;  1MKM A;  3L2U A;  4A3E J;  1D3Y A;  1A35 A;  3PNY A;  4YEL A;  4A3B J;  5DV5 A;  2X6Y A;  2Y30 A;  2PJP A;  2JK3 A;  5H2F C;  3FF5 A;  4P96 A;  4UVA A;  4MLO A;  4L9J A;  1POG A;  1TQI A;  2QKM B;  2XHK A;  2OBP A;  5KHD A;  5TGT A;  3TW7 A;  3JRH A;  1P7J A;  4JQF A;  4P1W A;  1TP4 A;  1FP1 D;  4L5I A;  4XLH A;  5K7F A;  2OAZ A;  1VI0 A;  2D2W A;  1R22 A;  1IV6 A;  1BI1 A;  3A0B C;  2DLL A;  2HVS A;  3QPT A;  3CZ6 A;  2VKH A;  1HDP A;  2CQQ A;  3E6C C;  2G0E A;  2JRT A;  2HOE A;  2Y48 A;  1KQ0 A;  2X85 A;  5FLX Z;  2HXO A;  1LEB A;  2H09 A;  1NK3 P;  4XIC A;  3IRQ A;  1N77 A;  2TCT A;  2D45 A;  2EPF A;  3HXL A;  1R23 A;  4GGG A;  1MNE A;  2B0L A;  3M3Y J;  2RQQ A;  4N4N B;  1ACI A;  3S93 A;  2XGE A;  5HNH A;  2L7M P;  2A6H F;  3ZMV A;  2DYR H;  3I53 A;  2Z9O A;  5M5Y J;  2D1V A;  4CCJ A;  1ZR4 A;  2Q2E B;  3E6M A;  3HDD A;  5ERI A;  4U7D A;  4KN7 X;  4LFU A;  2A68 F;  3DEU A;  1ETV A;  4BDZ A;  1X3Z B;  1E0E A;  1K83 J;  2ECB A;  2EZL A;  3RKW A;  2R5Y A;  3CJN A;  2I8D A;  3LA3 A;  1T2K A;  1W7P A;  1MJ9 A;  3H3U A;  2HQ5 A;  1HOM A;  4BY7 J;  2LLK A;  3O8H A;  5KNL A;  4F7Z A;  2W85 A;  3HPG A;  2DO7 A;  5HOD A;  4E4H A;  1XMX A;  5ICG A;  5K5Q A;  1MZB A;  4EGY A;  3E6D A;  3P9C A;  4KIT B;  1F4K A;  3CD6 I;  2ICW G;  1Z1D A;  5HLI A;  3BQZ A;  5L3C A;  4ANJ A;  3FHN A;  5EDN A;  3FWE A;  3DKW A;  1N78 A;  4XLA A;  5M5W J;  5L3D A;  1XSX A;  3IH3 A;  3QYE A;  1D0Z A;  3IH4 A;  3QQA A;  4FIS A;  2L5Q A;  2VOP A;  4BL0 B;  2OZU A;  2QUF A;  5H20 A;  4IPA A;  1T33 A;  2A5Y B;  2K9L A;  5GPA A;  3GUD A;  4ABZ A;  3LST A;  3NEU A;  5IPA A;  1MDM B;  1ZLK A;  3I56 I;  3I4N J;  2RRE A;  2ESN A;  5HDK A;  1QNT A;  5IT9 Z;  3ZQI A;  3ZQL A;  5E3L A;  1MJB A;  1H89 C;  4CCK A;  1EA3 A;  1MH3 A;  3I59 B;  1D0X A;  3W3C A;  3CUQ B;  1EF4 A;  1NTC A;  2AXL A;  3BR5 A;  1C0W A;  3LSH A;  1FTT A;  3CLQ A;  5FB2 A;  3JRF A;  1BW5 A;  5JLW A;  4XLF A;  4NDL A;  1M1E B;  5FLM J;  1ETO A;  3RI4 A;  3S16 J;  2K9M A;  3GCM A;  5F27 A;  5BNG A;  2OJE D;  4FX4 A;  3G1M A;  1RC9 A;  1W5T A;  1E17 A;  3P9I A;  3AL0 B;  4RA2 A;  3HOU J;  2E1M C;  3FXR A;  2EZK A;  3HBL A;  4BQQ A;  4F3Q A;  2EIM H;  2IPQ X;  3EYI A;  2M0C A;  1TW2 A;  3COA C;  3HRU A;  1J59 A;  3ULQ B;  4XKW A;  2V1U A;  1Z7L A;  2X48 A;  4E7K A;  1AKH A;  3V4G A;  2LBF A;  3DKX A;  3DP7 A;  3OYD A;  1B9N A;  1O3S A;  1IUY A;  3L2V A;  2QF7 A;  3A03 A;  2OU2 A;  4XL9 A;  2XRO A;  1T39 A;  1DUX C;  4A3C J;  5AIP A;  2NVX J;  2YUS A;  2IA0 A;  1ETK A;  4IF4 A;  2XUB A;  1WI3 A;  3PSF A;  2XC7 A;  1R58 A;  1R7J A;  3S2H J;  2HZT A;  1SAN A;  4ZYG A;  3AAF A;  3KZZ A;  1WJC A;  1LJ9 A;  2OA4 A;  1W0U A;  2WAE A;  4M72 A;  1ZG1 A;  3OYG A;  4MO7 A;  5E3N A;  1G6N A;  3OR1 C;  2O9L A;  3IH2 A;  1LQ1 A;  1A36 A;  2ZJ2 A;  2E2J J;  3QU6 A;  2JTV A;  4KIS A;  4M73 A;  3V8J A;  4AYB N;  1J0R A;  2VLA A;  3PFI A;  1PUE E;  3OL4 A;  3PO2 J;  1ETY A;  2FRH A;  1YIT I;  1LFB A;  5DCF A;  5J6X A;  3U9G A;  4HF2 A;  2FJ1 A;  3KP3 A;  4HLY A;  2DPU A;  4UY8 I;  1Z91 A;  2GBY A;  3K0L A;  3Q0U A;  4M3D A;  5DTD A;  3ZMD A;  5AIQ A;  3JRB A;  1DP7 P;  2CV2 A;  4OIO F;  2AQE A;  1I50 J;  4L0Y B;  2K3P A;  4FET A;  4U0W A;  1IO2 A;  4ZDL A;  2EFN A;  3MAJ A;  2WY8 Q;  3C2G A;  1DQU A;  2KPM A;  3KIO A;  5IP7 J;  4JK1 X;  4PSW A;  3BCA A;  4OAZ A;  2LD5 A;  4FTH A;  2DQL A;  4GCV A;  5LLQ A;  3CCE I;  3W2W A;  3OIQ A;  4AIH A;  2JN6 A;  1OIS A;  1S7E A;  5LRS A;  3HOY J;  1BL0 A;  4M74 A;  3FXL A;  1G3Y A;  2M87 A;  4GRI A;  1X1C A;  1YG2 A;  2FUG 2;  1YRN A;  4IHX A;  1I6X A;  1QO0 D;  1YLF A;  2K5C A;  3RYR A;  2HI3 A;  1TWC J;  4KNY A;  4I2O A;  2VPL A;  3GLX A;  3JW4 A;  5EG0 A;  3FXO A;  2KIU A;  4LOC A;  3BG7 A;  2G7H A;  1I1G A;  1U8R A;  1QPI A;  2UV1 A;  3FM3 A;  3WE3 A;  1U78 A;  3W6J B;  4ENK A;  1RUO A;  1YS6 A;  3QOP A;  1ZK8 A;  2H94 A;  3K2A A;  4RAZ A;  4A2U A;  2YS9 A;  1PJR A;  4PJJ A;  1WCM J;  4MTD A;  4ZYD A;  5D5V B;  1OCZ H;  3C7J A;  2WY7 Q;  2KKO A;  2MA3 A;  2VXZ A;  3FXJ A;  1FZP B;  4BJ5 C;  4BU2 A;  4BE2 A;  1ZRE A;  2M34 A;  1TL8 A;  1XCV A;  2Y69 H;  4Y7N J;  4CYD A;  2BW3 B;  4UUV A;  2QWW A;  3ESW B;  1AWC A;  5D5X B;  2A69 F;  1RIO H;  3BP8 A;  5FD5 A;  3BWG A;  2ZXW H;  2M7B A;  3VOE A;  2IBD A;  3VB2 A;  5ED4 A;  5D5U B;  5J4Y A;  2DAO A;  2NVY J;  2HDD A;  1SAX A;  4BBS J;  3WTT C;  2M8G X;  1G3W A;  3QU3 A;  4M3F A;  9ANT A;  3ZCO A;  4IHY A;  2A61 A;  3DBH B;  2DTR A;  1WRJ A;  3HL2 A;  1KQ9 A;  4WF2 A;  2BXZ A;  4QSH A;  4RM3 A;  5AON A;  2W84 A;  4L5J A;  4EMS A;  2HOS A;  1W4M A;  5IT9 K;  4PDK A;  4Z2Y A;  2LF7 A;  1UJ8 A;  4JX4 A;  2E2I J;  4HYE A;  1NHA A;  3F8M A;  4R8H A;  1FYM A;  2L9N A;  2VJ4 A;  2R7S A;  2V26 A;  4B3X A;  3L00 A;  3GYH X;  1G2H A;  3HSE A;  4RAF A;  5K7H A;  3L2C A;  2EJR A;  1A6I A;  4ZYH A;  3TBI A;  2DA6 A;  2WA0 A;  3GME A;  1PP7 U;  3FK6 A;  2P7C B;  3GZ6 A;  2EIN H;  1GXP A;  2R93 J;  1V55 H;  1GT0 C;  2CFO A;  1U5T C;  2KT0 A;  1SEU A;  4BAC A;  4BQO A;  4HSR A;  2K4J A;  3KYD B;  4IJA A;  4EM0 B;  4DYQ A;  2X51 A;  2NS7 A;  3L9F A;  1ONV A;  3L09 A;  3HOZ J;  2QBY A;  3WTV C;  3G1O A;  2EQR A;  2ZO4 A;  5TRD A;  2P6S A;  4HPQ A;  1RR8 C;  2CFX A;  5M3M J;  1S7O A;  2KP6 A;  4N9I A;  5EEG A;  1MMD A;  5J1Y A;  1IN4 A;  2M9H A;  1Z67 A;  1K4S A;  4IRI A;  5B3S H;  1OCO H;  1S5L C;  3MKL A;  3ZMZ A;  1ZGW A;  1VQ9 I;  3QYF A;  3K1N A;  3S1R J;  1MMG A;  5IP6 A;  2R7Z J;  4N0B A;  1YIO A;  3E97 A;  4RMN A;  1IUF A;  1U0J A;  1X2M A;  3CME I;  2K7L A;  4Y33 A;  3H5R A;  1OCP A;  4EJW A;  3P5J A;  3ZQC A;  2PMU A;  3S1N J;  2HKO A;  2B7E A;  3H9J A;  2NOJ B;  3F8C A;  3ZQQ A;  1D8J A;  3TGN A;  2VIX A;  4EJU A;  2LY9 A;  4RGX A;  3I64 A;  4P9U A;  4AIJ A;  1TQM A;  2LTP A;  2ZNY A;  5KK1 A;  3VEP A;  5KAF C;  1W0T A;  4NC8 A;  5K5R A;  1SD4 A;  4CYC B;  1T95 A;  3DLL F;  2YPR A;  2R5Y B;  3BT9 A;  4ZZD A;  3F8N A;  4IHW A;  2L9V A;  3GWZ A;  3TO7 A;  2KL4 A;  2ZCW A;  4M3E A;  1W7P B;  1Z6T A;  3HHG A;  2R7F A;  3WHC A;  1FBU A;  2XAH A;  2XB0 X;  4PJ0 C;  2IEK A;  1HW2 A;  2O61 A;  1ZGJ A;  3QOD A;  2M8E A;  2V7F A;  1R1U A;  5DD4 A;  1RUN A;  5A2Q K;  3UR3 C;  4ENN A;  4CUG A;  5ILV A;  4WCG A;  1UEL B;  1IXR C;  1Y1V J;  3FIW A;  3F6V A;  3H5N A;  1A5J A;  3EUH C;  1MSF C;  1B72 A;  3DFG A;  1MBG A;  1JKO C;  5CVV A;  3BR6 A;  2PI0 A;  4FCY A;  1VQM I;  1ZR2 A;  1VQ4 I;  1S6L A;  1U5T A;  2DCE A;  2LG4 A;  5H6Q A;  2F5D A;  2YSR A;  3WU0 A;  3JR9 A;  1Z3Y A;  4LIT A;  1XX5 A;  2FE3 A;  2JPC A;  4OMZ A;  5J8F A;  3T0Y A;  4XLN F;  5D4R A;  1WQ2 A;  3E3V A;  2WV1 A;  1MD0 A;  1YYV A;  2KZV A;  3RYP A;  5HVQ C;  4IZZ A;  5TIS C;  1YJW I;  2IGK A;  4LIV A;  4Q4Z F;  5GTI C;  2BE5 F;  2KJB A;  3JRG A;  3K4K A;  3LAP A;  1WJ5 A;  4Y3O A;  4F52 A;  4OAY A;  4QTR A;  1J2X A;  1WWX A;  4DYR A;  2CUE A;  2TDX A;  2R7O A;  3EUK L;  3PIP F;  3O6B B;  1OQY A;  2LH9 A;  3DKY A;  3SEQ A;  4LLL A;  1FSE A;  1XSV A;  1AA7 A;  4EEF G;  3F3X A;  4AID A;  3K4B A;  3S3N A;  1IDY A;  3S1Q J;  2NYX A;  4B44 A;  4ZH4 F;  1K78 B;  3OYN A;  5CQE A;  1G59 A;  3ELK A;  2KIF A;  2DXI A;  2LF8 A;  2PX9 A;  3IAM 2;  3BZ6 A;  2HEO A;  3HPH A;  3LSG A;  5EF6 A;  1Z6R A;  2NVQ J;  4HQM A;  5FD6 A;  3ABU A;  2QSH X;  1SFX A;  3ZMS A;  4J19 A;  2CGP A;  4NHJ A;  2W24 A;  3HRM A;  1YX3 A;  3SZP A;  3DV8 A;  4A93 J;  2IGN A;  2E7W A;  2XAU A;  3ASO H;  1X2N A;  2J5P A;  3H36 A;  5DUK A;  2JA5 J;  1R36 A;  1HXD A;  2HFH A;  3GVA A;  3SEZ A;  1HKS A;  1AKH B;  1IC8 A;  2BVM A;  2LBF B;  2LKX A;  1W5C C;  5EJC A;  4XOP A;  2X9D A;  3L2R A;  2RC4 A;  4PK4 A;  4BHB A;  2VON A;  1P4X A;  4Y4R A;  3MMY B;  2L4A A;  1L3L A;  3RJP A;  4E7L A;  3CLO A;  1NG7 A;  2DN0 A;  4WXD A;  5CKT A;  4DNC A;  3GTP J;  2LC2 A;  2M5W A;  2R4G A;  3TDZ C;  1OR7 C;  1MBE A;  2VJ5 A;  3MKY B;  2F5E A;  2VE9 A;  4CDG A;  2VBW A;  5FKN A;  2M4K A;  3IC7 A;  3UNG C;  2ZSH B;  4CCM A;  3DTE A;  2HTS A;  1Z21 A;  2HTJ A;  5B5E C;  1FIA A;  2ZXH A;  3CC4 I;  3OSG A;  2V9V A;  1W5S A;  5GTH C;  5ICF A;  4NC7 A;  4XOR A;  2IS2 A;  3CES A;  2PG4 A;  5LHG A;  1RZ4 A;  3BTL A;  5IYB J;  2NOG A;  4BYY A;  4CZC A;  3WTZ A;  2WWY A;  4HAM A;  1JJ8 C;  1YS7 A;  2JT1 A;  3GTM J;  3ZOB A;  2OPT A;  2KDO A;  4PFO A;  2XAQ A;  2H6C A;  1WJF A;  2WB1 A;  3SDG A;  5FFX A;  4B48 A;  3GTJ J;  4ZYA A;  2Z99 A;  3S2W A;  3ML6 A;  1ON2 A;  3CO6 C;  2H27 A;  2STW A;  3IUO A;  4BE0 A;  3CC7 I;  3IHU A;  2L54 A;  1XDS A;  4G7H F;  5J3L A;  4L18 B;  1YTY A;  1ORK A;  2M2E A;  3HB9 A;  3O3K A;  2BHY A;  2AO9 A;  4XKB A;  5FRN A;  2XKP A;  4DQ2 A;  1BR2 A;  1HSJ A;  1EJ9 A;  5HLT A;  1R00 A;  1YRN B;  5GP9 A;  2O7O A;  3HSR A;  2KFD A;  2DOF A;  4S0H B;  3PL8 A;  5FKM A;  2E1M B;  3FHZ A;  3WG7 H;  3ABK H;  4LG0 A;  5BMZ A;  3CCS I;  1JUM A;  2OZ6 A;  4KYW A;  2K4B A;  2MBF A;  2NS8 A;  4I7H A;  5CVU A;  3Q5F A;  2UXN A;  2LKP A;  3JCU C;  3S15 J;  2VQL A;  3U1K A;  1T6S A;  4IVN A;  2RGV A;  1JUP A;  2V1D A;  2XGD A;  4QPO A;  3HYI A;  3HSF A;  3AG2 H;  4XN3 A;  3BQY A;  4LMY A;  3WU1 B;  2VC1 A;  1SAU A;  3WE2 A;  1MIJ A;  2AQF A;  3C3W A;  4MHG A;  3S2D J;  1L0O C;  1OR7 A;  2PJR A;  3RCO A;  4P9F A;  4D7N A;  2P4W A;  4W97 A;  3MKW B;  1X58 A;  4O3M A;  5L3B A;  4I99 C;  4PJN A;  2D5V A;  4AU7 A;  2W82 A;  3H5A A;  4KIG A;  1SVO A;  3VYT B;  1ZKG A;  3RPU A;  1S7A A;  3OWT A;  1LDK B;  5F64 A;  3TQN A;  3PIO F;  3KP4 A;  2GXB A;  1X3W B;  3OS1 A;  3QP6 A;  3QP5 A;  4XRS A;  3EDP A;  2KDZ A;  3CJR B;  2RN7 A;  3GTQ J;  4NBQ A;  2BEO A;  4UHT A;  4IO9 F;  1TLH B;  3OIO A;  2BXY A;  4LK0 F;  3FK7 A;  4NQW A;  5J47 A;  1H88 C;  1WSU A;  4G6T B;  3D5R C;  4RGU A;  1GVD A;  2QA4 I;  1RR7 A;  2LMD A;  2EFQ A;  2ZME B;  4U88 A;  3G1L A;  3P9K A;  4BAY A;  3U21 A;  5IY5 H;  3L2W A;  2HGC A;  4HNU A;  2CJJ A;  2FNA A;  2XGC A;  3FKJ A;  4M6V A;  4F92 B;  3HOS A;  2ME6 A;  1IRX A;  3S17 J;  5F1J A;  4HDV A;  5CLS A;  3H9G A;  3ZR8 X;  2HDW A;  1UCR A;  4HX7 A;  2RNG A;  4HBL A;  5JHF A;  3BG9 A;  4KJZ A;  1GV2 A;  3VSL A;  1A31 A;  2KRH A;  3I71 A;  5EGO A;  2QBY B;  2F6C A;  3CDL A;  5KCM A;  2EFO A;  1TT5 B;  4PZJ A;  3K70 C;  3PNT A;  2EZI A;  4CYC A;  3RIR A;  3A1Y A;  5E20 A;  2PBI A;  3UKG A;  4JX6 A;  3IV5 A;  4UVB A;  1ZAR A;  3RKQ A;  2EA2 A;  1LFU P;  5CYV A;  1U2W A;  2K40 A;  3JRA A;  4I6Z A;  2A6T A;  2IGM A;  3ZGK A;  4PGH A;  4YII A;  1HQC A;  4XMY A;  2DA4 A;  3HG9 A;  5FKL A;  5IOY A;  1FMV A;  1YO5 C;  4UXN A;  2DQR A;  4KMF A;  3OL3 A;  3RZD J;  1Y6I A;  4DBQ A;  1X1D A;  3HHH A;  3H0D A;  4RLF A;  4BXF A;  5JLX A;  4A3J J;  2PLY A;  2F4M B;  2VN2 A;  1AU7 A;  4F93 B;  3FM5 A;  3HKZ A;  3M07 A;  4V2F A;  5F0H A;  3E5Q A;  4IQJ A;  3C2H A;  2CQ7 A;  2VUM J;  1TTY A;  4MEY F;  1ZQ3 P;  2VQC A;  1EH6 A;  5F0C A;  3OS0 A;  2H1K A;  3U2R A;  5J8C A;  2EFP A;  1WPK A;  4A0Y A;  3CMA I;  1ZGA A;  4TV7 A;  5LHH A;  1QPM A;  3BR1 A;  3F0C A;  3RDI A;  1JGG A;  4OMY A;  5EEA A;  2IW5 A;  4KMU X;  3OYH A;  1BI0 A;  1LFP A;  5HS7 A;  3CP2 A;  4HRI A;  2Y0S N;  2Z3Y A;  5F08 A;  3BG5 A;  1MBJ A;  2ISY A;  3DCF A;  4RGR A;  3RPU D;  4AM3 A;  4DJA A;  5FLV A;  4BXX J;  1HF0 A;  4HDU A;  1GDT A;  3EQL F;  4A6D A;  4DZJ A;  4WXH A;  3F22 A;  2P8T A;  1B72 B;  3Q0V A;  2GA2 A;  1E2X A;  3BG6 A;  3QPS A;  1YJ9 I;  1J9I A;  2QYO A;  3HTU A;  1Y8Q B;  1U5T B;  2FF4 A;  5IYC J;  4XRM A;  4RBO A;  1AHD P;  2KLO A;  3E1S A;  1T56 A;  1VQN I;  3DU5 A;  3VSK A;  2VQH A;  4UNO A;  1TWA J;  1BOA A;  3TO6 A;  3LMM A;  2UUZ A;  1FPQ A;  1RKW A;  4ZC3 A;  3KYC B;  4C3H J;  1USS A;  2CSO A;  1KU9 A;  2ISZ A;  2JUG A;  3NWS A;  1ZRD A;  4EGZ A;  5BPI A;  2YU9 J;  3RZO J;  1BIA A;  1E3O C;  1D1C A;  2CYY A;  1O3Q A;  1VQ6 I;  3KP6 A;  4B47 A;  4XOT A;  3CCU I;  3ZXS A;  1IRF A;  2VE8 A;  2HQA A;  2CQX A;  4LLG F;  3GFL A;  4NUB A;  5ICC A;  1FOK A;  4FT8 A;  3ZN1 A;  3H3V K;  1ETX A;  4M9Z A;  3FXM A;  3KP5 A;  1W7P D;  2DMQ A;  2JRM A;  1LE8 A;  2BY2 A;  1Y0U A;  1KU2 A;  1BIB A;  4EJV A;  4MEX F;  2GIZ A;  2IT0 A;  2DMU A;  3ZRG A;  5ILS A;  1IF1 A;  2DK8 A;  3K4L A;  4C2T A;  2DU9 A;  1R6R A;  4II3 A;  2M7A A;  2ACJ A;  1MMS A;  4B8X A;  1T38 A;  1DDN A;  2FQ4 A;  2ID6 A;  2QEN A;  3K4M A;  3ZMT A;  1ODD A;  3E5X A;  2FBK A;  1TQP A;  1K61 A;  3OYC A;  2ZME C;  3M7G A;  3FDY A;  4CHU A;  5EZH A;  1JKP C;  1T98 A;  3V8K A;  5A2Q Z;  2VJI A;  4Y52 J;  2LY1 A;  2F5C A;  1EH7 A;  2HWV A;  3GO5 A;  2V1N A;  1B8I B;  2JA7 J;  2QLZ A;  2CMP A;  4AVZ A;  2L01 A;  3MD2 A;  3DPT A;  1SD5 A;  5J4V A;  2HPM A;  2B9S A;  2E19 A;  1XMA A;  2O5R A;  4V19 K;  2V9K A;  1XC5 A;  4BH9 A;  4HST A;  3J81 K;  4G94 A;  3CCR I;  1X3U A;  2BOL A;  2COM A;  4B4C A;  1UHW A;  5LEJ A;  3OSF A;  5F6F A;  3V7R A;  3K4C A;  1JHF A;  3ABL H;  2XGX A;  5HNF A;  1MBF A;  3GZN B;  5K5O A;  1I5Z A;  5D8K B;  2XSJ C;  3BTJ A;  4EJT A;  5JVT A;  2EBI A;  1YIJ I;  1KGS A;  1V5F A;  5DM6 F;  2L7K A;  2BGC A;  2R7Q A;  2RKH A;  3W2V A;  4EM2 A;  2WAF A;  1CF7 A;  1J09 A;  3BOQ A;  1KYZ A;  3WGH A;  4D5F A;  1FIP A;  3HKZ N;  1IRG A;  5BQT A;  4WWC A;  1ETQ A;  2DT5 A;  4XLE A;  2CV0 A;  3B73 A;  1WJA A;  2R7D A;  3K70 D;  2EIK H;  3S32 A;  4RM2 A;  4C9Y A;  2FML A;  1D1A A;  3BJ6 A;  5FFZ A;  3GFI A;  1HBX G;  3SDB A;  3KE2 A;  3VWB A;  4UUT A;  1JKQ C;  2K02 A;  3D1N I;  2XF5 A;  4XKV A;  4L0Z B;  3IWZ A;  2A07 F;  2HOA A;  1F9N A;  4RGS A;  2DA2 A;  1G3T A;  2PMZ A;  1BOB A;  4LG0 B;  5DCM A;  4A5M A;  3J80 K;  2HDC A;  4D5C A;  1E3H A;  4LGW A;  4ETS A;  4ENJ A;  2JA8 J;  5M5X J;  4N4O B;  4GXO A;  5GPC A;  3HZJ A;  3KYL A;  4A3G J;  4WX9 A;  2WAD A;  2YX4 A;  2Y75 A;  3CCJ I;  1KYW A;  1BR1 A;  5F04 A;  3F72 A;  2XIG A;  4NC6 A;  4PUS A;  2E1O A;  3LA7 A;  4S04 A;  3QPH A;  2ZME A;  1SD6 A;  4HOB A;  3OYI A;  3VFZ A;  1IN6 A;  2PJR B;  4CGZ A;  3H9Q A;  3Q9S A;  1GV5 A;  4OWR B;  1W36 C;  4ZTF A;  2AS5 F;  4WXC A;  3SYT A;  3JAM K;  3JTH A;  2MW8 A;  4A3K J;  3FMS A;  1K6O A;  2DT7 B;  3IKV A;  4EVI A;  3LSR A;  3WHB A;  1OCC H;  2OCC H;  3EET A;  2IA2 A;  2E36 A;  2R5Z B;  4AWX B;  3K1M A;  1OJL A;  1RRJ A;  4M3B A;  2TRT A;  2P6T A;  2XAJ A;  1J5Y A;  3MZ8 A;  4IHS A;  5C4J J;  3GTK J;  3NRV A;  1F43 A;  2EWN A;  1QHH D;  3VOD A;  3IAS 2;  5K7Z A;  3KLO A;  2LY2 A;  4XSZ F;  2DK5 A;  4NQW B;  3R6S A;  2GIV A;  1CGP A;  3B02 A;  3W6K B;  1ZH5 A;  3WGI A;  3L2Q A;  4YFK F;  2E35 A;  2GOX B;  3PFY A;  2F4O B;  2XVC A;  2Y9Y A;  5D8L B;  3HEF A;  4Y13 A;  4CXF A;  3HOV J;  3K2Z A;  4C2M J;  3OYF A;  3LSJ A;  3GEZ A;  3GF2 A;  1JKR C;  1QHG A;  2NNN A;  4L9N A;  3JRD A;  1HDD C;  1EV7 A;  1KON A;  1K6Y A;  3HIF A;  1ETW A;  3A4C A;  3MVP A;  3Q0W A;  4KIF A;  2O03 A;  4JP0 A;  1P92 A;  3A02 A;  2NRA C;  3R4K A;  5EGO B;  2JVG A;  1OCT C;  3GLL A;  2K27 A;  3BJA A;  4ZJZ A;  5BOX A;  3FX3 A;  1HST A;  3RKX A;  4E7J A;  4IOA F;  1IDZ A;  3WG9 A;  3ZN0 A;  1YI2 I;  4XON A;  2GXG A;  3LAJ A;  3I54 A;  1MJA A;  3C18 A;  4HV5 A;  2JSC A;  4ZZL A;  2BZT A;  4HQE A;  4MIM A;  1IXS B;  1KA8 A;  2QSF X;  4D9J A;  3FXU A;  4YIF A;  5LGN A;  2LRD A;  3B6A A;  2L7Z A;  2DBB A;  2VT2 A;  3SQN A;  1F5T A;  5E79 C;  2DT6 A;  2UWM A;  1RNL A;  4G8X A;  4DOZ A;  2K9S A;  3CTA A;  3CCL I;  1QA6 A;  4HLX A;  2DOD A;  4M71 A;  3C1D A;  3K7A J;  2KIQ A;  3OOP A;  2FNP A;  3AG3 H;  4O6J A;  1ZRC A;  2IAI A;  3WTX C;  3QRF F;  4KIC A;  5JFR A;  2L3D A;  1Z77 A;  2HU9 A;  4D0P A;  3MZH A;  1BM9 A;  1LNW A;  1JGS A;  4C30 A;  2QCO A;  3DEE A;  5EEH A;  3TO9 A;  2KIM A;  3I9V 2;  3KEY A;  3CC2 I;  2L02 A;  1OMI A;  2VT3 A;  2L9R A;  3C2B A;  5DEQ A;  4BQA A;  3E7L A;  3BPV A;  3ZQ7 A;  3CO7 C;  4IRH A;  2V4J C;  3I5U A;  2FBH A;  2X4H A;  4AVP A;  2QKL B;  3JSO A;  2NVT J;  4UV8 A;  2LFB A;  3F21 A;  3DF8 A;  1XG1 A;  4HV6 A;  5CJ9 A;  4Z6Y A;  4WK8 F;  2DA5 A;  1OYY A;  1PUF A;  3PM1 A;  3AKZ A;  1OKR A;  3CCQ I;  2Y9Z A;  3ERE D;  3LFU A;  2LDU A;  2XF7 A;  2DFH A;  5CVJ A;  2GM4 A;  4RAY A;  1IJW C;  3BR3 A;  3VDX A;  1T8I A;  1R9T J;  1SC7 A;  2DDA A;  1S72 I;  2ZFW A;  1VQ5 I;  3MKZ A;  2XRL A;  1KZH A;  5E3O A;  4OIQ F;  1IGN A;  5FRM A;  2MAB A;  1ZLJ A;  1X1P A;  5LHI A;  2XPV A;  5FJ8 J;  2W1O A;  2X1E A;  2FA5 A;  5JR3 A;  1YJN I;  2FX0 A;  3JRC A;  2V6E A;  2A05 A;  2MD5 A;  4P55 A;  4RLQ A;  3TL4 X;  1J75 A;  4H0E A;  2E1C A;  2OCE A;  2KMU A;  3BZC A;  1Y39 A;  2Q1Z B;  3VYU B;  1GLN A;  1QZZ A;  2V79 A;  4HX8 A;  4XLP F;  1DU0 A;  4DGW B;  2CV1 A;  3J7A O;  4L9V A;  4XSX F;  3S1M J;  1O7L A;  2CWE A;  2FQ3 A;  1R4M B;  2DMT A;  3FZV A;  3FMQ A;  4QIW N;  2ZNZ A;  5HS9 A;  3DPL C;  1FNN A;  2L7F P;  2W00 A;  2CW7 A;  3TED A;  1IRZ A;  1OLT A;  3REO A;  3CCY A;  1MH4 A;  3WTU C;  2HYJ A;  4X0G A;  2M3A A;  2FMY A;  4D7M A;  3CCV I;  3R60 A;  1MNM C;  4QWQ A;  4BE1 A;  3KFW X;  3CJT B;  3KLN A;  5LGT A;  1B8I A;  1FMW A;  4MTE A;  4HF0 A;  1XS9 A;  2JWT A;  2OQG A;  3K9T A;  3H0G J;  1EKE A;  2Z33 A;  1VF9 A;  3FKI J;  4G12 A;  3RPQ A;  1LE8 B;  2IXS A;  2E7X A;  4M3G A;  2X0L A;  2V6C A;  2X6O A;  4E6K G;  1FP2 A;  2PQ8 A;  4ENM A;  1WI9 A;  2IA1 A;  4Y17 A;  4ON0 A;  1NK2 P;  4R79 A;  4IHV A;  2DFI A;  3CQZ J;  4OIP F;  1NH3 A;  1VQP I;  2H8W A;  1SVM A;  1V54 H;  3R0A A;  3BY6 A;  1PDN C;  3LNQ A;  2O3F A;  2YU3 A;  3BRO A;  2NAZ A;  4CIC A;  4CZZ A;  2R7V A;  4CA0 A;  1S29 A;  2XF6 A;  5GAE J;  4RB1 A;  2MH2 A;  4PCQ A;  1WJD A;  1R4N B;  1H9G A;  2BVL A;  4YFX F;  1VQO I;  1VTN C;  4Q47 A;  1YW7 A;  1U9N A;  3CP8 A;  1ITY A;  3LSM A;  1NG6 A;  1SFE A;  2CUF A;  1YQA A;  2V1X A;  3HC7 A;  1ULY A;  3K10 A;  3T8T A;  4GYI A;  2CW8 A;  3F8B A;  3AG4 H;  2F2E A;  1MMN A;  2HPI A;  4DIQ A;  4RDU A;  5CVR A;  1I3A A;  3JRI A;  1Z9C A;  4C3I J;  5E1X A;  1UZC A;  3Q9V A;  1V4R A;  1J7K A;  2Q8K A;  4CCN A;  4ESF A;  1DP3 A;  4KDP A;  1UMQ A;  4HNV A;  3CJQ B;  2K86 A;  3DPU A;  3ZP5 A;  4BJ6 C;  4YIR X;  3IL2 A;  1CQT A;  1CF7 B;  3WTY C;  2L0K A;  5BPD A;  2MLG A;  4LB5 A;  1SVL A;  3ZMU A;  1P4W A;  1MND A;  2N8G A;  3M1E A;  3HGG A;  2FXA A;  1IW7 F;  1LDJ A;  5HS8 A;  1ZHF A;  1XTA A;  3BLY A;  1H8A C;  1IN5 A;  2V9P A;  2IRF G;  1IN7 A;  2XAF A;  5K1Y A;  2H8R A;  2O8K A;  2Z16 A;  2VBZ A;  1LVK A;  2E2H J;  3RQ4 A;  2CW0 F;  1FOX A;  4OOI A;  4KT5 C;  4AC0 A;  2R5Z A;  2LRE A;  3ZQH A;  3L1P A;  3N4M A;  1MMA A;  2H1L A;  3AFH A;  3HUG A;  3MQ0 A;  4L9T A;  2JA6 J;  3L7W A;  3TDU C;  5DCM B;  1S8N A;  2VXD A;  4XQF A;  2WV0 A;  1LDD A;  4I02 A;  2XKO A;  3Q3S A;  4N9H A;  1FOY A;  1ZYR F;  2H6B A;  2RQP A;  4RS8 A;  2ETH A;  2Z1D A;  1B4A A;  4IKF A;  1RKT A;  5GAD J;  4XLC A;  2JJ7 A;  4AIK A;  1BC7 C;  1I6H J;  3KP2 A;  3BZK A;  3LWF A;  3BDD A;  3BG3 A;  3OYL A;  2STT A;  3OS2 A;  2IVM A;  2E1N A;  2MGQ A;  5EZG A;  1N75 A;  1JI8 A;  1X1B A;  3MN2 A;  1BW6 A;  2E60 A;  1TC3 C;  3TKY A;  2HKX A;  2AXT C;  3LQQ A;  2FOK A;  2LOO A;  1EH8 A;  2EFW A;  4ASN A;  1X19 A;  2R3S A;  3HRS A;  5KVR A;  1WH7 A;  4AYB A;  3G71 I;  4IX7 A;  4BXU A;  3H92 A;  5J40 A;  4I76 A;  3M9A A;  1QVT A;  3S14 J;  5IYD J;  4RB3 C;  1BJA A;  2CUJ A;  5E1W A;  2JQ7 A;  2VOD A;  2MC3 A;  1JHH A;  3J81 Z;  4LG3 A;  2OC6 A;  1UHM A;  1XSD A;  1FTZ A;  1IZ1 A;  4HZF A;  2CG4 A;  3BTC A;  3AG1 H;  3OYB A;  2DPD A;  3G3Z A;  2OUM A;  5JI6 A;  3FXQ A;  2JA2 A;  2JVH A;  1IN8 A;  2HXI A;  4CSW A;  4RB2 C;  5FGM A;  5F0F A;  3RKY A;  1ZEL A;  2P5K A;  1FY7 A;  4A12 A;  1U6G A;  1YFH A;  5DS9 A;  3OYJ A;  1P4A A;  2QSG X;  1D5Y A;  1R1T A;  4IHT A;  2EK5 A;  4PGG A;  4A0X A;  5IT3 A;  4D1Q A;  2R7R A;  2BHZ A;  5CVI A;  1LPQ A;  3J7A Y;  1U8B A;  5H6R A;  2ZFU A;  1OYI A;  5E8G A;  1PP8 F;  4BS9 A;  3HOT A;  2FOW A;  2CQK A;  1ERD A;  4U7B A;  1WJB A;  2DMP A;  2QQA A;  4Q5S F;  2C6Y A;  5LFA A;  3WOD F;  1JT0 A;  2BBY A;  3DQV C;  4S05 A;  2E34 A;  3G4S I;  3F23 A;  3T5X A;  4OU0 A;  3JTG A;  4LJZ F;  2WB1 N;  3WGG A;  3PO3 J;  1IXC A;  2J5O A;  4J00 A;  2XPU A;  3OYA A;  4E70 A;  4II2 A;  4KFC A;  5HOO A;  3D5L A;  4G6D A;  3J80 Z;  1UB9 A;  4PJL A;  2K85 A;  2EV6 A;  2KZG A;  4EM1 A;  2GXA A;  1KU7 A;  1TWG J;  1STZ A;  3GTG J;  3PUF A;  1FT9 A;  2FSW A;  3CMY A;  1UST A;  2L4M A;  2VQG A;  2CS3 A;  3EYY A;  1FBQ A;  4NB5 A;  2GZW A;  5L3F A;  5JVG F;  4A3F J;  4I01 A;  1V5G A;  2DTZ A;  3TW6 A;  2WTE A;  1XGS A;  2VBY A;  1BI2 A;  1V3F A;  2Y0M A;  4OIN F;  2IJL A;  2LR8 A;  3BPX A;  2W25 A;  3BJO A;  4E7S A;  3NWT A;  4GYG A;  1VND A;  2ELK A;  1JUS A;  3JAM Z;  4E7H A;  1O7F A;  1XCB A;  1U3E M;  4I09 A;  4FX0 A;  2LNB A;  1I39 A;  2O8X A;  3NQO A;  5J1R A;  2VOO A;  2A3S A;  1G4D A;  1TWH J;  5D6E A;  2OF7 A;  2OV7 A;  3S3O A;  3I4P A;  2LYC A;  2DOE A;  1K79 A;  5C4X J;  3CMM A;  5E17 F;  1X1A A;  2JPB A;  4C2U A;  4CCL A;  2ECC A;  1A04 A;  1R5G A;  4LK1 F;  4A6E A;  1Z0X A;  2XPW A;  1BI3 A;  1Z3X A;  4XN0 A;  3H35 A;  2ZC2 A;  5C44 J;  5E8I A;  3PQJ A;  3ZPL A;  1WZ2 A;  2KHM A;  2CUZ A;  2RVC A;  3H1C A;  3OYK A;  3J7Z I;  1VFC A;  1U9O A;  3HJE A;  3RQI A;  1HW1 A;  3ONQ A;  2BY0 A;  1PUF B;  2DFF A;  5D4S A;  3PJR A;  1H0M A;  1OYW A;  2R92 J;  3T1B A;  3LA2 A;  3A0H C;  4UB6 C;  1XGM A;  1WKM A;  4DW6 A;  3VYR B;  2XSD C;  2VI6 A;  4MGR A;  2VKD A;  2IS1 A;  2GLO A;  3TP0 A;  1VQL I;  4IXA A;  3SZG A;  3V7S A;  5B1B H;  1T08 B;  1TNS A;  2XAG A;  3DEW A;  3KX2 A;  1P6R A;  4U0V A;  4FAS D;  3QOE A;  1O4X A;  2XB5 A;  2NNY A;  1V5E A;  3BTI A;  4LB6 B;  3TMO A;  1HCR A;  4FHT A;  2LKS A;  3S3M A;  3DTK A;  1D5V A;  2M0M A;  1JE8 A;  3TP3 A;  3B6C A;  5TJJ A;  3A01 A;  1O3T A;  4GO1 A;  1R5H A;  4HW0 A;  1K4T A;  2XV4 S;  4XRS G;  4U87 A;  4M9S A;  3IP4 B;  2DFE A;  2EH3 A;  2R7W A;  2Z5U A;  3LSI A;  4YFN F;  2LVS A;  2VJJ A;  3A2K A;  3EPZ A;  4F91 B;  3E6B A;  3KPH A;  4B43 A;  1BC8 C;  1RES A;  1MBK A;  2KRC A;  3SHF A;  2OQR A;  1FX7 A;  5KAI C;  4V2G A;  3KET A;  4MQV A;  5ICE A;  2MG4 A;  5D5W B;  3LL7 A;  1R5I D;  2YX7 A;  1Z7U A;  3M8F A;  4BJT A;  4EAT A;  2ZBK A;  6PAX A;  4A3I J;  4Y15 A;  4XR6 A;  1LEA A;  1OPC A;  1UFM A;  1WHU A;  5CPR B;  1GXQ A;  3I58 A;  4YRV A;  3OYE A;  1SFK A;  3IWF A;  1FSH A;  3ASN H;  2R0Q C;  2VAS A;  4BDY A;  2JZY A;  1O57 A;  2B63 J;  5FLX K;  5GAH J;  5LRR A;  4YEJ A;  4EV0 A;  3G2B A;  1K78 A;  4K2E A;  5GAG J;  4A5N A;  2E5Z A;  3DBL B;  2VBX A;  2R7U A;  3SJM A;  4XBF A;  4LLN A;  5FO5 A;  4BGD A;  1FJL A;  1B9M A;  1TW3 A;  3V8L A;  3LSP A;  3OY9 A;  5FRO A;  2G7U A;  2XDV A;  3K6G A;  1VQK I;  1ZG3 A;  2K9N A;  2P7V B;  3CDI A;  3GTO J;  4LIU A;  3D5S C;  1R49 A;  1BA5 A;  2XAS A;  1YW8 A;  5JHU A;  3GX4 X;  3N97 A;  1WFX A;  1VQ8 I;  2QVO A;  3DU6 A;  3RTR A;  1MBH A;  4G6Q A;  2RDP A;  3K1P A;  2CO5 A;  1OFC X;  4KUM A;  3OV8 A;  2MYS A;  2DDB A;  2DOA A;  4BNC A;  4KA4 A;  5B66 C;  3MCZ A;  2F48 A;  3FBI B;  5HDG A;  2M4G A;  2EZH A;  1FLI A;  4A3D J;  2EA4 A;  4PJM A;  5L3E A;  1JXS A;  1LKX A;  1JTX A;  5D6F A;  1FWZ A;  1DPR A;  3OIP A;  2COB A;  2GA1 A;  2IS4 A;  4I0A A;  1DGR M;  2JSP A;  4XID A;  4U0Y A;  4BEH A;  4ZDO A;  4UUS A;  1K7A A;  2MFZ A;  2W48 A;  2GWR A;  1VZ0 A;  3GBG A;  4O5V A;  1D1B A;  2XRN A;  1TWF J;  2W4S A;  3G73 A;  2VPR A;  4AD9 A;  4JBA A;  1HA8 A;  2QQ8 A;  5LBQ A;  5HLG A;  1D8K A;  2P81 A;  2K9Q A;  5E18 F;  2NS0 A;  1JT6 A;  2ID3 A;  4RB0 A;  4EJO A;  2HOT A;  3M8J A;  3VYS B;  2P5V A;  3GZ5 A;  3CCM I;  3IRR A;  1P7I A;  4MQ9 F;  3W2A A;  3PNV A;  1H9T A;  3ZQG A;  5LEK A;  4KN4 X;  4YG2 F;  4P5O A;  3SXY A;  5IP9 J;  2O6G E;  2MLK A;  5DDG A;  1ZRF A;  1IAW A;  3HUG B;  3DLA A;  2MH9 A;  3CUQ C;  2QM3 A;  1OCR H;  1E3P A;  3V42 A;  1P2F A;  3FXK A;  1KU3 A;  4BBR J;  2BY1 A;  1S9H A;  4ZYE A;  2ZJR F;  1XDU A;  2D1H A;  3QPL A;  4L5E A;  3E5U A;  4H4K C;  3WU2 C;  1QRY A;  4BHC A;  3R61 A;  5E3M A;  1DPU A;  1GHC A;  3AL0 C;  2ZXJ A;  2ZJQ F;  3GFM A;  2BV6 A;  2CQN A;  3M8E A;  3J7Y J;  3JSP A;  2P0W A;  3MFK A;  2PMH A;  2HNH A;  2Q2E A;  3ABT A;  3DBR B;  1GVJ A;  2G9W A;  1B6A A;  2I5U A;  2WC2 A;  3VPR A;  2HS5 A;  2W57 A;  2PN6 A;  4RAG A;  4B09 A;  2HR3 A;  4GDF A;  4A69 C;  2MD0 A;  1S3J A;  2RAE A;  3O8G A;  1ZN2 A;  2VB6 A;  3K69 A;  2F4I A;  4NNJ A;  4ESJ A;  3PSI A;  1Q1V A;  3FIS A;  1PYV A;  3HRT A;  3W6V A;  4AUX A;  4CO8 A;  1XGN A;  5B1A H;  3ECO A;  2DA1 A;  2Y31 A;  1N25 A;  1ZTR A;  1FBS A;  3HOX J;  2HYG D;  2F5V A;  3MZY A;  5F1R A;  2DI3 A;  1JTY A;  1TT0 A;  4DZP A;  3FMR A;  3GXO A;  1SD7 A;  1MSE C;  1SFO J;  1P9Q C;  3NAU A;  3K4J A;  2X6X A;  2M45 A;  3ABM H;  2BYV E;  1HLV A;  3M4O J;  1HC8 A;  2CRG A;  4BHP A;  2GOM A;  1O3R A;  1Y0N A;  4FE7 A;  3SFZ A;  4HEA 2;  4G7O F;  4IOC F;  4OIR F;  1BJZ A;  4HA8 A;  2VKE A;  3CF5 F;  1I1S A;  1T0F C;  2W7N A;  3KP7 A;  1XD7 A;  1XN7 A;  3SZT A;  1IG7 A;  1RI7 A;  2ELH A;  1R1V A;  1MDM A;  3P7N A;  4A3M J;  3QWL A;  1TBX A;  1F1Z A;  2WBM A;  3HGY A;  5L3G A;  3KEO A;  1Q1H A;  2QEX I;  1WJE A;  4G7Z F;  1YE9 A;  3FBN B;  2R7X A;  3I59 A;  3BCB A;  2GQQ A;  2M1B A;  4HX4 A;  4X1E A;  1HKT A;  3CUQ A;  2QZ8 A;  3SFI A;  2JUC A;  1JJ6 C;  5BS6 A;  4E7Z A;  5LGU A;  1TZL A;  3NAR A;  4IQ4 A;  2E71 A;  4X6A J;  3R0J A;  1YHQ I;  2HYF A;  2EIL H;  5M3F J;  2EV0 A;  3QYB A;  4HG2 A;  2WAQ A;  2RV8 A;  1RET A;  1QQI A;  2ZJP F;  3LFK A;  4UVC A;  1BR4 A;  1XMK A;  1QZE A;  1G3S A;  1PVE A;  2A5W A;  1XGO A;  1LB2 A;  4A3L J;  3MEX A;  2UZK A;  3MWM A;  4IRG A;  3O2P E;  1Y56 A;  2ZSI B;  5HDN A;  3I0T A;  5EYR A;  3WTW C;  3T8R A;  1VQ7 I;  1B1B A;  1QGP A;  4HNT A;  5HLH A;  4JOM A;  3TOB A;  4B1R A;  1ON1 A;  2QQ9 A;  3N05 A;  3EUA A;  2M30 A;  2DJI A;  2PMZ N;  1QVU A;  2PFB A;  3G6E I;  1RPW A;  1DU6 A;  3M1C A;  2HQR A;  4MFD A;  4G9Y A;  1WVR A;  3OOU A;  4ITV A;  4M9X A;  4Q48 A;  4MFE A;  5DD8 A;  2I10 A;  4R1H A;  2ZXI A;  5DUI A;  3JRE A;  3I4M J;  1APL C;  3ECH A;  2CU7 A;  3BR0 A;  2AHQ A;  3KZY A;  4FE4 A;  2OTJ I;  2KJC A;  3F9K A;  4XNF A;  2Z2S B;  4B3A A;  2FEZ A;  2LP0 A;  2R7T A;  1YOV B;  2ELJ A;  4KT6 A;  3KCC A;  4M6Y A;  1X4P A;  3DWL E;  4I0B A;  2O0Y A;  2DW4 A;  2HQN A;  3HTS B;  2NXN B;  3DTI A;  4DYC A;  2JMW A;  4KIB A;  1LUJ B;  1T0F A;  4XRF A;  4CCO A;  1Y1W J;  3PUB A;  3RSN A;  3BC8 A;  2E5N A;  4CH7 A;  2ZB9 A;  4UV9 A;  4F55 A;  1REP C;  3PQK A;  1IV8 A;  2PEX A;  4JYK A;  3F8F A;  3H3Z A;  3QAH A;  4QLC U;  2ME0 A;  2KRF A;  5E1Z B;  2IP2 A;  2EV5 A;  1QU3 A;  2LK2 A;  3WTS C;  1UHS A;  2Q0O A;  3BR2 A;  1SFU A;  1R71 A;  4ZTJ A;  2MSY A;  1HW5 A;  1HKQ A;  1SMT A;  5FKK A;  2QQB A;  1UG0 A;  4UB8 C;  1G8X A;  3CDH A;  3OMY A;  1YW9 A;  3I55 I;  1W36 D;  2KQR A;  4W1U A;  4BKX A;  4C3J J;  3EUH A;  3A01 B;  2LSO A;  2K3F A;  3K4N A;  2DJN A;  3TOA A;  1ENH A;  3F6O A;  2F5F A;  1FYL A;  4DBR A;  1ZG5 A;  4JX5 A;  4XKC A;  4PSX A;  2P5L C;  4GFB A;  2DYS H;  1SMY F;  2DA7 A;  3CF2 A;  2RNJ A;  5LD2 C;  1QZY A;  2ESH A;  2FBI A;  4IL6 C;  3OR2 C;  2UXX A;  1FOW A;  2KIS A;  4I98 B;  1F36 A;  5CQG A;  1KQ8 A;  1W1W E;  4FQG A;  4BQN A;  2DA3 A;  1Z05 A;  4J01 A;  2VKV A;  1I3Q J;  1D0Y A;  1FEX A;  1FYK A;  2X1C A;  2Y2Z A;  5J1U A;  2FD5 A;  3ZQF A;  1XPX A;  4A0Z A;  2EB7 A;  4E7I A;  3LSK A;  1WH5 A;  4XK4 A;  2X6W A;  3ERM A;  2ADU A;  1LVA A;  1AOY A;  2Y0S A;  2GAU A;  2OD5 A;  4XM3 A;  1XB4 A;  2YR2 A;  4EQQ A;  1UAA A;  5DYM A; 
#chains in the Genus database with same CATH homology
 1BBY A;  1BN5 A;  1TNT A;  4MNU A;  4M6X A;  3CUO A;  1ZAO A;  2ZKZ A;  3GW2 A;  3D0S A;  1MGT A;  2FU4 A;  4LD5 A;  3V7C A;  3ISP A;  3ROU A;  3IKT A;  4HF1 A;  2VC0 A;  4ESB A;  1B59 A;  3LQR A;  1I27 A;  1QBJ A;  1FC3 A;  3DXJ F;  2A6E F;  5ILU A;  3GFJ A;  3KEQ A;  3U1D A;  1MKM A;  1D3Y A;  5DV5 A;  2PJP A;  3FF5 A;  4P96 A;  4UVA A;  4L9J A;  1TQI A;  2XHK A;  2OBP A;  4JQF A;  1FP1 D;  4L5I A;  2OAZ A;  2D2W A;  1R22 A;  1BI1 A;  2DLL A;  3QPT A;  3E6C C;  2JRT A;  2HOE A;  2Y48 A;  1KQ0 A;  5FLX Z;  1LEB A;  2H09 A;  3IRQ A;  2D45 A;  1R23 A;  4GGG A;  2B0L A;  2A6H F;  3ZMV A;  3I53 A;  2Z9O A;  2D1V A;  3E6M A;  5ERI A;  4U7D A;  4KN7 X;  4LFU A;  2A68 F;  3DEU A;  3RKW A;  3CJN A;  3LA3 A;  1T2K A;  1W7P A;  1MJ9 A;  3H3U A;  4F7Z A;  2W85 A;  2DO7 A;  5ICG A;  5K5Q A;  1MZB A;  4EGY A;  3E6D A;  3P9C A;  1F4K A;  1Z1D A;  5HLI A;  5L3C A;  3FWE A;  3DKW A;  5L3D A;  1XSX A;  2VOP A;  2OZU A;  2QUF A;  5H20 A;  4IPA A;  2A5Y B;  1MDM B;  3GUD A;  3LST A;  3NEU A;  1ZLK A;  2ESN A;  5HDK A;  1QNT A;  5IT9 Z;  1MJB A;  3I59 B;  3CUQ B;  2AXL A;  1C0W A;  5FB2 A;  3RI4 A;  4FX4 A;  1W5T A;  1E17 A;  3P9I A;  3FXR A;  2IPQ X;  3EYI A;  1TW2 A;  3COA C;  3HRU A;  1J59 A;  3ULQ B;  2V1U A;  3V4G A;  3DP7 A;  1B9N A;  1O3S A;  1IUY A;  2OU2 A;  2XRO A;  1T39 A;  1DUX C;  5AIP A;  2IA0 A;  4IF4 A;  2XUB A;  1R58 A;  1R7J A;  2HZT A;  4ZYG A;  3AAF A;  3KZZ A;  1LJ9 A;  2OA4 A;  4M72 A;  1ZG1 A;  1G6N A;  1LQ1 A;  2ZJ2 A;  3QU6 A;  2JTV A;  4M73 A;  3V8J A;  1J0R A;  3PFI A;  1PUE E;  2FRH A;  5DCF A;  5J6X A;  3U9G A;  4HF2 A;  3KP3 A;  4HLY A;  2DPU A;  1Z91 A;  3K0L A;  3ZMD A;  1DP7 P;  4OIO F;  5AIQ A;  4L0Y B;  4U0W A;  2EFN A;  3MAJ A;  4JK1 X;  2DQL A;  4GCV A;  5LLQ A;  4AIH A;  5LRS A;  4M74 A;  1G3Y A;  2M87 A;  1YG2 A;  1I6X A;  1QO0 D;  1YLF A;  3RYR A;  4KNY A;  4I2O A;  3GLX A;  3JW4 A;  2KIU A;  2G7H A;  1I1G A;  1U8R A;  3FM3 A;  3WE3 A;  1U78 A;  3W6J B;  4ENK A;  1RUO A;  1YS6 A;  3QOP A;  2H94 A;  4RAZ A;  4A2U A;  4MTD A;  4ZYD A;  5D5V B;  3C7J A;  2KKO A;  2MA3 A;  2VXZ A;  1FZP B;  1ZRE A;  1XCV A;  4CYD A;  4UUV A;  2QWW A;  1AWC A;  5D5X B;  2A69 F;  1RIO H;  3BP8 A;  5FD5 A;  3BWG A;  5ED4 A;  3VOE A;  3VB2 A;  5D5U B;  2DAO A;  1SAX A;  3WTT C;  3QU3 A;  1G3W A;  2A61 A;  2DTR A;  1WRJ A;  1KQ9 A;  4WF2 A;  5AON A;  2W84 A;  4L5J A;  4EMS A;  1W4M A;  5IT9 K;  4PDK A;  4Z2Y A;  2LF7 A;  4HYE A;  1NHA A;  3F8M A;  4R8H A;  1FYM A;  3L00 A;  3GYH X;  3HSE A;  3L2C A;  2EJR A;  4ZYH A;  1PP7 U;  2P7C B;  3GZ6 A;  1GXP A;  1U5T C;  2K4J A;  4IJA A;  4EM0 B;  3L9F A;  1ONV A;  3L09 A;  2QBY A;  3WTV C;  2ZO4 A;  5TRD A;  2P6S A;  2CFX A;  1S7O A;  4N9I A;  5EEG A;  1IN4 A;  4IRI A;  3ZMZ A;  3K1N A;  4N0B A;  1YIO A;  3E97 A;  2K7L A;  4EJW A;  2PMU A;  2HKO A;  3F8C A;  1D8J A;  3TGN A;  4EJU A;  4RGX A;  3I64 A;  4P9U A;  4AIJ A;  1TQM A;  2ZNY A;  5KK1 A;  3VEP A;  5K5R A;  1SD4 A;  2YPR A;  4ZZD A;  3F8N A;  3GWZ A;  3TO7 A;  2ZCW A;  1W7P B;  1Z6T A;  3HHG A;  2R7F A;  1FBU A;  2XAH A;  1HW2 A;  2O61 A;  1ZGJ A;  2M8E A;  5DD4 A;  1R1U A;  1RUN A;  5A2Q K;  4ENN A;  5ILV A;  4WCG A;  1IXR C;  3F6V A;  3DFG A;  5CVV A;  2PI0 A;  1S6L A;  1U5T A;  5H6Q A;  3WU0 A;  2F5D A;  2YSR A;  2FE3 A;  2JPC A;  4OMZ A;  5J8F A;  3T0Y A;  4XLN F;  5D4R A;  1WQ2 A;  3E3V A;  5HVQ C;  1MD0 A;  1YYV A;  3RYP A;  4Q4Z F;  2BE5 F;  2KJB A;  3LAP A;  1J2X A;  1WWX A;  2TDX A;  3O6B B;  4LLL A;  1FSE A;  1XSV A;  3F3X A;  2NYX A;  4ZH4 F;  1K78 B;  3ELK A;  2KIF A;  2LF8 A;  3BZ6 A;  2HEO A;  1Z6R A;  4HQM A;  5FD6 A;  3ABU A;  1SFX A;  3ZMS A;  2CGP A;  4NHJ A;  2W24 A;  3HRM A;  3SZP A;  3DV8 A;  2E7W A;  2J5P A;  5DUK A;  1R36 A;  1HXD A;  2HFH A;  3GVA A;  1HKS A;  2RC4 A;  4BHB A;  2VON A;  1P4X A;  2L4A A;  1L3L A;  3RJP A;  3CLO A;  4WXD A;  4DNC A;  2M5W A;  3TDZ C;  2F5E A;  2VE9 A;  4CDG A;  2VBW A;  3IC7 A;  2HTS A;  2HTJ A;  2V9V A;  1W5S A;  5ICF A;  2PG4 A;  5LHG A;  1RZ4 A;  4BYY A;  3WTZ A;  2WWY A;  4HAM A;  1YS7 A;  2JT1 A;  2XAQ A;  2H6C A;  5FFX A;  2Z99 A;  3S2W A;  3ML6 A;  1ON2 A;  3CO6 C;  2H27 A;  2STW A;  3IHU A;  2L54 A;  1XDS A;  4G7H F;  4L18 B;  1YTY A;  3O3K A;  2XKP A;  4DQ2 A;  1HSJ A;  1R00 A;  3HSR A;  3FHZ A;  4LG0 A;  5BMZ A;  2OZ6 A;  4KYW A;  2K4B A;  2MBF A;  4I7H A;  5CVU A;  3Q5F A;  2UXN A;  2LKP A;  1T6S A;  4IVN A;  2RGV A;  2V1D A;  3HYI A;  3HSF A;  4LMY A;  3WU1 B;  2VC1 A;  3WE2 A;  3C3W A;  4MHG A;  1L0O C;  1OR7 A;  4P9F A;  2P4W A;  4O3M A;  5L3B A;  4KIG A;  3RPU A;  1S7A A;  1LDK B;  5F64 A;  3TQN A;  3KP4 A;  2GXB A;  3QP6 A;  3QP5 A;  3EDP A;  2RN7 A;  2BEO A;  4UHT A;  1TLH B;  4LK0 F;  4NQW A;  1WSU A;  4RGU A;  2EFQ A;  2ZME B;  4U88 A;  3P9K A;  4BAY A;  2HGC A;  2FNA A;  3HOS A;  4HDV A;  5CLS A;  1UCR A;  4HX7 A;  4HBL A;  3I71 A;  2QBY B;  2EFO A;  4PZJ A;  3RIR A;  5E20 A;  2PBI A;  4UVB A;  1ZAR A;  2EA2 A;  5CYV A;  1U2W A;  4PGH A;  4YII A;  1HQC A;  1YO5 C;  4UXN A;  2DQR A;  4KMF A;  3HHH A;  2PLY A;  2VN2 A;  3FM5 A;  3E5Q A;  1TTY A;  4MEY F;  1EH6 A;  3U2R A;  5J8C A;  2EFP A;  4A0Y A;  1ZGA A;  4TV7 A;  5LHH A;  1QPM A;  3RDI A;  4OMY A;  2IW5 A;  4KMU X;  1BI0 A;  5HS7 A;  2Z3Y A;  4RGR A;  2ISY A;  4HDU A;  3EQL F;  4A6D A;  4WXH A;  3F22 A;  2P8T A;  2GA2 A;  1E2X A;  1J9I A;  2QYO A;  3HTU A;  1U5T B;  2FF4 A;  4UNO A;  1BOA A;  3TO6 A;  1FPQ A;  1USS A;  2CSO A;  1KU9 A;  2ISZ A;  1ZRD A;  4EGZ A;  5BPI A;  1BIA A;  2CYY A;  1O3Q A;  3KP6 A;  1IRF A;  2VE8 A;  4LLG F;  3GFL A;  5ICC A;  1FOK A;  4FT8 A;  3ZN1 A;  4M9Z A;  3KP5 A;  1W7P D;  1Y0U A;  1KU2 A;  1BIB A;  4EJV A;  4MEX F;  2IT0 A;  5ILS A;  1IF1 A;  2DK8 A;  2DU9 A;  2ACJ A;  4B8X A;  1T38 A;  1DDN A;  2QEN A;  3ZMT A;  1ODD A;  3E5X A;  2FBK A;  1TQP A;  3M7G A;  4CHU A;  1T98 A;  3V8K A;  5A2Q Z;  2F5C A;  1EH7 A;  2HWV A;  3GO5 A;  2QLZ A;  2L01 A;  3DPT A;  1SD5 A;  1XMA A;  4BH9 A;  3J81 K;  4G94 A;  1X3U A;  2COM A;  5LEJ A;  1UHW A;  5F6F A;  3V7R A;  1JHF A;  2XGX A;  5K5O A;  1I5Z A;  5D8K B;  4EJT A;  5JVT A;  1KGS A;  2BGC A;  4EM2 A;  2RKH A;  1CF7 A;  3BOQ A;  1KYZ A;  3WGH A;  1IRG A;  5BQT A;  4WWC A;  2DT5 A;  3B73 A;  2R7D A;  2FML A;  3BJ6 A;  5FFZ A;  3GFI A;  1HBX G;  3KE2 A;  2K02 A;  4L0Z B;  3IWZ A;  2A07 F;  1F9N A;  4RGS A;  1G3T A;  4LG0 B;  5DCM A;  4A5M A;  3J80 K;  2HDC A;  4LGW A;  4ETS A;  4ENJ A;  4GXO A;  4WX9 A;  2YX4 A;  2Y75 A;  1KYW A;  3F72 A;  2XIG A;  3LA7 A;  4S04 A;  3QPH A;  2ZME A;  1SD6 A;  4HOB A;  3VFZ A;  1IN6 A;  4CGZ A;  3Q9S A;  2AS5 F;  4WXC A;  3JAM K;  3JTH A;  3FMS A;  1K6O A;  3IKV A;  4EVI A;  3EET A;  2IA2 A;  4AWX B;  3K1M A;  2P6T A;  2XAJ A;  1J5Y A;  4IHS A;  3NRV A;  2EWN A;  3VOD A;  3KLO A;  4XSZ F;  2DK5 A;  1CGP A;  3R6S A;  2GIV A;  3B02 A;  3W6K B;  1ZH5 A;  3WGI A;  4YFK F;  2XVC A;  5D8L B;  4Y13 A;  4CXF A;  3K2Z A;  3GEZ A;  3GF2 A;  2NNN A;  4L9N A;  1EV7 A;  3HIF A;  4KIF A;  2O03 A;  1P92 A;  2NRA C;  3R4K A;  2K27 A;  3BJA A;  5BOX A;  3FX3 A;  1HST A;  3RKX A;  3WG9 A;  3ZN0 A;  2GXG A;  3LAJ A;  3I54 A;  1MJA A;  3C18 A;  4HV5 A;  2JSC A;  4ZZL A;  4HQE A;  1IXS B;  1KA8 A;  4YIF A;  3FXU A;  5LGN A;  2DBB A;  2VT2 A;  3SQN A;  1F5T A;  2UWM A;  1RNL A;  4G8X A;  3CTA A;  4HLX A;  4M71 A;  3C1D A;  3OOP A;  2FNP A;  4O6J A;  1ZRC A;  3WTX C;  3QRF F;  4KIC A;  5JFR A;  2L3D A;  3MZH A;  4D0P A;  1BM9 A;  1LNW A;  1JGS A;  5EEH A;  3TO9 A;  2KIM A;  2L02 A;  1OMI A;  2VT3 A;  5DEQ A;  4BQA A;  3BPV A;  3ZQ7 A;  3CO7 C;  4IRH A;  3I5U A;  2FBH A;  2X4H A;  4AVP A;  3JSO A;  4UV8 A;  3F21 A;  3DF8 A;  4HV6 A;  5CJ9 A;  4WK8 F;  1OYY A;  1OKR A;  3ERE D;  2LDU A;  5CVJ A;  4RAY A;  2ZFW A;  4OIQ F;  1ZLJ A;  5LHI A;  5JR3 A;  2FA5 A;  2MD5 A;  4P55 A;  1J75 A;  4H0E A;  2E1C A;  1QZZ A;  2V79 A;  4HX8 A;  4XLP F;  3J7A O;  4L9V A;  4XSX F;  1O7L A;  2CWE A;  2FQ3 A;  3FZV A;  3FMQ A;  2ZNZ A;  5HS9 A;  3DPL C;  1FNN A;  3REO A;  3WTU C;  2FMY A;  3R60 A;  4QWQ A;  3KFW X;  3KLN A;  5LGT A;  4MTE A;  4HF0 A;  2OQG A;  3K9T A;  2Z33 A;  3RPQ A;  2E7X A;  2X0L A;  2V6C A;  1FP2 A;  2PQ8 A;  4ENM A;  1WI9 A;  2IA1 A;  4Y17 A;  4ON0 A;  4R79 A;  2DFI A;  4OIP F;  3R0A A;  3BY6 A;  1PDN C;  2O3F A;  2YU3 A;  3BRO A;  2NAZ A;  4CIC A;  4CZZ A;  1S29 A;  4RB1 A;  2MH2 A;  4PCQ A;  1H9G A;  4YFX F;  1VTN C;  4Q47 A;  1YW7 A;  1SFE A;  1YQA A;  2V1X A;  1ULY A;  3T8T A;  4GYI A;  3F8B A;  2F2E A;  5CVR A;  1Z9C A;  5E1X A;  3Q9V A;  1V4R A;  1J7K A;  2Q8K A;  4ESF A;  4KDP A;  2K86 A;  3ZP5 A;  3IL2 A;  1CF7 B;  3WTY C;  5BPD A;  2MLG A;  4LB5 A;  3ZMU A;  1P4W A;  3M1E A;  2FXA A;  1IW7 F;  1LDJ A;  5HS8 A;  1ZHF A;  1IN5 A;  2IRF G;  1IN7 A;  2XAF A;  5K1Y A;  2VBZ A;  2CW0 F;  4OOI A;  4KT5 C;  3N4M A;  3HUG A;  3MQ0 A;  4L9T A;  3L7W A;  3TDU C;  5DCM B;  1S8N A;  2WV0 A;  1LDD A;  4I02 A;  2XKO A;  4N9H A;  1ZYR F;  2H6B A;  2RQP A;  4RS8 A;  2ETH A;  1B4A A;  4AIK A;  1BC7 C;  3KP2 A;  3LWF A;  3BDD A;  2STT A;  2IVM A;  2E1N A;  3TKY A;  2HKX A;  3LQQ A;  2FOK A;  1EH8 A;  2EFW A;  4ASN A;  2R3S A;  3HRS A;  5KVR A;  4BXU A;  3H92 A;  3M9A A;  4RB3 C;  1BJA A;  5E1W A;  2VOD A;  2MC3 A;  1JHH A;  3J81 Z;  1UHM A;  1XSD A;  1IZ1 A;  4HZF A;  2CG4 A;  2DPD A;  3G3Z A;  5JI6 A;  3FXQ A;  1IN8 A;  4RB2 C;  5FGM A;  3RKY A;  2P5K A;  1FY7 A;  4A12 A;  1U6G A;  1YFH A;  1P4A A;  1R1T A;  4IHT A;  2EK5 A;  4PGG A;  4A0X A;  5IT3 A;  5CVI A;  5H6R A;  1OYI A;  5E8G A;  1PP8 F;  3HOT A;  2CQK A;  4U7B A;  2QQA A;  4Q5S F;  2C6Y A;  3WOD F;  2BBY A;  3DQV C;  4S05 A;  3F23 A;  3T5X A;  4OU0 A;  3JTG A;  4LJZ F;  3WGG A;  1IXC A;  2J5O A;  4E70 A;  4KFC A;  5HOO A;  3D5L A;  4G6D A;  3J80 Z;  1UB9 A;  2EV6 A;  4EM1 A;  1KU7 A;  1STZ A;  1FT9 A;  2FSW A;  1UST A;  2L4M A;  3EYY A;  1FBQ A;  4NB5 A;  2GZW A;  5L3F A;  4I01 A;  2WTE A;  1XGS A;  2VBY A;  1BI2 A;  1V3F A;  2Y0M A;  4OIN F;  2IJL A;  3BPX A;  2W25 A;  3BJO A;  4GYG A;  3JAM Z;  1O7F A;  1XCB A;  1U3E M;  4I09 A;  4FX0 A;  2LNB A;  2O8X A;  3NQO A;  2VOO A;  2A3S A;  1G4D A;  5D6E A;  3I4P A;  1K79 A;  5E17 F;  2JPB A;  1A04 A;  1R5G A;  4LK1 F;  4A6E A;  1BI3 A;  5E8I A;  3PQJ A;  3ZPL A;  2RVC A;  1HW1 A;  5D4S A;  1H0M A;  1OYW A;  3T1B A;  3LA2 A;  1XGM A;  1WKM A;  4MGR A;  4IXA A;  3V7S A;  1TNS A;  2XAG A;  4U0V A;  1P6R A;  2NNY A;  4LB6 B;  4FHT A;  1D5V A;  1JE8 A;  1O3T A;  5TJJ A;  4GO1 A;  1R5H A;  4HW0 A;  2XV4 S;  4M9S A;  2Z5U A;  4YFN F;  3E6B A;  1BC8 C;  3SHF A;  2OQR A;  1FX7 A;  3KET A;  4MQV A;  5ICE A;  5D5W B;  2YX7 A;  1Z7U A;  3M8F A;  2ZBK A;  6PAX A;  4Y15 A;  1LEA A;  1OPC A;  1UFM A;  1GXQ A;  3I58 A;  3IWF A;  1FSH A;  2JZY A;  1O57 A;  5FLX K;  5LRR A;  4EV0 A;  1K78 A;  4K2E A;  4A5N A;  2VBX A;  4XBF A;  4LLN A;  5FO5 A;  1B9M A;  1TW3 A;  3V8L A;  2G7U A;  1ZG3 A;  2P7V B;  2XAS A;  1YW8 A;  5JHU A;  3GX4 X;  3N97 A;  2QVO A;  3RTR A;  4G6Q A;  2RDP A;  3K1P A;  2CO5 A;  4KUM A;  3OV8 A;  4BNC A;  4KA4 A;  3MCZ A;  1FLI A;  5HDG A;  2EA4 A;  5L3E A;  1JXS A;  5D6F A;  1FWZ A;  1DPR A;  2GA1 A;  4I0A A;  4U0Y A;  1K7A A;  2GWR A;  4O5V A;  2XRN A;  3G73 A;  4AD9 A;  4JBA A;  5LBQ A;  5HLG A;  1D8K A;  5E18 F;  2NS0 A;  4RB0 A;  4EJO A;  2P5V A;  3GZ5 A;  3IRR A;  4MQ9 F;  1H9T A;  5LEK A;  4KN4 X;  4YG2 F;  4P5O A;  3SXY A;  2O6G E;  2MLK A;  5DDG A;  1ZRF A;  1IAW A;  2MH9 A;  3CUQ C;  2QM3 A;  1P2F A;  1KU3 A;  4ZYE A;  1XDU A;  2D1H A;  3E5U A;  4BHC A;  3R61 A;  1DPU A;  1GHC A;  2ZXJ A;  3GFM A;  2BV6 A;  3M8E A;  3JSP A;  3MFK A;  2PMH A;  2Q2E A;  3ABT A;  1GVJ A;  2G9W A;  1B6A A;  2WC2 A;  2HS5 A;  2W57 A;  2PN6 A;  4B09 A;  2HR3 A;  1S3J A;  1ZN2 A;  3K69 A;  4ESJ A;  3HRT A;  4CO8 A;  1XGN A;  3ECO A;  1FBS A;  2HYG D;  3MZY A;  5F1R A;  2DI3 A;  3FMR A;  3GXO A;  1SD7 A;  2M45 A;  2BYV E;  4BHP A;  1O3R A;  3SFZ A;  4G7O F;  4OIR F;  4HA8 A;  1I1S A;  3KP7 A;  1XD7 A;  1XN7 A;  3SZT A;  1RI7 A;  2ELH A;  1R1V A;  1MDM A;  3P7N A;  1TBX A;  1F1Z A;  5L3G A;  3KEO A;  1Q1H A;  4G7Z F;  3I59 A;  2GQQ A;  2M1B A;  4HX4 A;  1HKT A;  3CUQ A;  2QZ8 A;  5BS6 A;  5LGU A;  3R0J A;  2HYF A;  2EV0 A;  2RV8 A;  1QQI A;  3LFK A;  4UVC A;  1XMK A;  1G3S A;  1XGO A;  1LB2 A;  2UZK A;  3MEX A;  3MWM A;  4IRG A;  3O2P E;  5HDN A;  3I0T A;  3WTW C;  3T8R A;  1B1B A;  1QGP A;  5HLH A;  3TOB A;  1ON1 A;  2QQ9 A;  2M30 A;  2PFB A;  2HQR A;  4G9Y A;  4M9X A;  4Q48 A;  5DD8 A;  4R1H A;  5DUI A;  3ECH A;  3KZY A;  2KJC A;  2FEZ A;  3KCC A;  4M6Y A;  4I0B A;  2O0Y A;  2DW4 A;  2HQN A;  3HTS B;  4KIB A;  1T0F A;  4XRF A;  1REP C;  4UV9 A;  3PQK A;  2PEX A;  3F8F A;  3H3Z A;  3QAH A;  4QLC U;  2KRF A;  5E1Z B;  2IP2 A;  2EV5 A;  3WTS C;  2Q0O A;  1SFU A;  1HW5 A;  1HKQ A;  1SMT A;  2QQB A;  3CDH A;  1YW9 A;  3EUH A;  2LSO A;  3TOA A;  3F6O A;  2F5F A;  1FYL A;  1ZG5 A;  2P5L C;  1SMY F;  2RNJ A;  1QZY A;  2ESH A;  2FBI A;  2UXX A;  4I98 B;  1KQ8 A;  1Z05 A;  1FYK A;  4A0Z A;  2EB7 A;  1AOY A;  2ADU A;  1LVA A;  2GAU A;  2OD5 A;  1XB4 A;  2YR2 A;  4EQQ A;  5DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...