5K5QA

Structure of aspa-dna complex: novel centromere bindng protein-centromere complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
total genus 29
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k5qA00
1KQ8A 4Q48A 1XDSA 4R79A 2J5OA 4KIFA 3F8BA 3M8EA 3O6BB 3E6MA 5CVJA 3CDHA 4JK1X 5CVVA 4XSXF 2G7HA 1B9MA 1V3FA 3KETA 4M6XA 3GFLA 2Q8KA 2K02A 5LHHA 2Y0MA 1SD5A 4YFXF 3GFMA 1U5TB 5CVRA 1ZN2A 4XLNF 5K5RA 1S7OA 1REPC 3KP5A 4UVCA 5D5XB 4HQMA 1D8KA 5J6XA 2OU2A 2ISZA 2GAUA 2KIUA 4XBFA 3F8CA 3WGIA 1LEAA 2DK5A 1STZA 3HRSA 5JR3A 3KEOA 1QGPA 3TKYA 2Z99A 3V7CA 2M45A 2XAFA 4MQVA 3IWFA 1XD7A 4LGWA 3RPUA 4IHSA 2ESNA 2KIFA 3ZMDA 3HTSB 1YQAA 3FM5A 4BXUA 2M5WA 4O5VA 5D8KB 1WQ2A 1IUYA 4KMUX 4LK1F 5KK1A 3T5XA 5BPIA 1U2WA 2IW5A 2V9VA 3HHHA 4BHBA 2OZUA 1R1TA 2D1VA 2XGXA 4LG0B 1G3YA 4BHCA 2VBWA 1B6AA 1W7PA 4OU0A 3DV8A 3E97A 1JE8A 5HLHA 4EGZA 4IHTA 4S05A 1IW7F 3NEUA 4IJAA 3I53A 2STWA 2DPUA 3E5XA 3KCCA 4LK0F 1H0MA 1IRGA 1H9GA 1YW7A 2M30A 1AWCA 3WTUC 1EV7A 3WU0A 1GHCA 1GXPA 2A61A 3I59B 5DUKA 2QBYA 2HOEA 3EDPA 1A04A 5JI6A 2O03A 1SD6A 1XCVA 3G73A 4WXCA 1ZG1A 2PQ8A 4KA4A 1HKTA 3I58A 5ILVA 2FNAA 3HHGA 4L5IA 3ZN1A 2TDXA 1UHMA 2KJBA 3I54A 4HDUA 2NYXA 5EEGA 4NB5A 1W4MA 4KIGA 3KZZA 4LJZF 2UWMA 2ZMEB 2EFNA 3RKYA 5L3FA 5AIQA 3NRVA 4ESBA 3LA3A 2K86A 2D45A 4KYWA 4AWXB 1KYZA 1TQMA 1R58A 4U0WA 3LWFA 1R1VA 3HRTA 1T38A 3C7JA 3BPVA 2JPCA 4Q4ZF 1ZRDA 3FM3A 1O7FA 1IRFA 4FT8A 1I1SA 1XMKA 3IKTA 3BROA 3E5QA 3QPTA 4EJVA 2L4MA 4Y17A 1RZ4A 3SHFA 2VC0A 3ZN0A 3VODA 4B8XA 1LDKB 3RI4A 5CVIA 4NQWA 3M7GA 2EJRA 2G7UA 3TO7A 1FP1D 3F6VA 1JGSA 1K7AA 4O3MA 5DCMB 3L2CA 4BH9A 4ENMA 3FXRA 3E3VA 4WK8F 2QQBA 3BOQA 1LNWA 2K27A 3J7AO 1XGSA 4CHUA 5LGNA 3MZYA 1FP2A 1XMAA 4A0ZA 4M74A 2QQ9A 3E5UA 4ESFA 4YIFA 1ON2A 4FX4A 2XHKA 2OQRA 1F9NA 1J9IA 5A2QZ 5CYVA 1U5TC 4A6DA 3GFJA 1U5TA 1FT9A 4KN4X 2KKOA 3COAC 4G7ZF 3EETA 5FLXK 5LEKA 3U2RA 1KQ9A 1B59A 1SD7A 4I0AA 1O3TA 1BM9A 4AIHA 1EH7A 4HV6A 2FBHA 5FB2A 2LF7A 1ULYA 3MAJA 5DCFA 3F3XA 2FBKA 2VC1A 4YIIA 5JHUA 1CGPA 3DP7A 2F5CA 3FXUA 2E7WA 2JPBA 1HSTA 2Z33A 3SFZA 3CTAA 3P7NA 2CO5A 2QLZA 1BC8C 4BHPA 1ZYRF 3ZMUA 5A2QK 4PDKA 2RVCA 1XN7A 1TNSA 3I4PA 4HF2A 3C3WA 3F8FA 3T0YA 3IRQA 4HDVA 5D5WB 3BZ6A 3QOPA 4UV9A 2D1HA 4Y13A 2ESHA 3WG9A 4HX7A 1OYIA 3LFKA 3CUOA 4LG0A 4G6QA 5L3GA 4KICA 2IP2A 2MLGA 3BDDA 4HZFA 1H9TA 2BBYA 2M1BA 2HKXA 4DQ2A 3IRRA 4CXFA 4L9VA 3U1DA 2P7VB 2OAZA 4I02A 2P6TA 1T6SA 4FX0A 5HDGA 4L5JA 5D6EA 4BNCA 1XDUA 5D5UB 3ZPLA 4KFCA 3K0LA 3V8LA 3I59A 5HLGA 2KRFA 1ZRFA 3HTUA 2A6EF 3BP8A 2EFQA 4L0ZB 5LBQA 2DLLA 4RGSA 3WU1B 1TLHB 5ICFA 3N97A 4M9SA 3QPHA 3S2WA 3SXYA 2COMA 3TOBA 1R23A 1QQIA 2VXZA 1FPQA 2HDCA 4G7HF 5ICCA 4A0YA 2MH9A 4HF1A 5D6FA 1OR7A 5DUIA 5E20A 4A5MA 2EV6A 2UXXA 2YX4A 4OIQF 3TDZC 1KU7A 1YG2A 2A69F 3GVAA 3F21A 1B1BA 3F22A 3WGGA 2VBZA 3R6SA 3FMSA 3I0TA 4KNYA 2M87A 4LLNA 3T8RA 4G7OF 2EB7A 4MHGA 1O57A 4G6DA 2E7XA 2NS0A 2XRNA 3WTYC 3MQ0A 4I2OA 1QNTA 1SMTA 2YX7A 4EJTA 3DXJF 3RKWA 1ODDA 1XGNA 2CG4A 2BYVE 1U3EM 1MGTA 5DCMA 4E70A 4JQFA 1XCBA 2P5VA 1IN4A 3R4KA 2RNJA 3VFZA 5IT3A 4YG2F 4KN7X 1ZH5A 1HKQA 5ICGA 3TO9A 1J75A 2ZCWA 5AIPA 2HTJA 1TBXA 3NQOA 2QVOA 3ELKA 2L3DA 2VN2A 1G3WA 3QAHA 2UZKA 2FSWA 5DEQA 1MJBA 5H6RA 1KA8A 2XAQA 1LDJA 3J81K 5JFRA 4ZYGA 1HW2A 2ZBKA 2GWRA 2FBIA 4Q5SF 3HRUA 2FQ3A 2V1DA 4A12A 5CLSA 3HYIA 5DD4A 1XSVA 3CUQB 1YW8A 2FNPA 3CLOA 4BAYA 1LQ1A 2KJCA 1FOKA 4ON0A 3PFIA 4UVBA 4MEYF 3QP5A 3L00A 3HOTA 3KZYA 1JHHA 3QP6A 3ABTA 2ADUA 1FYMA 1BI0A 4BQAA 4A0XA 2Y75A 1Z91A 2RV8A 2XAHA 1OKRA 1S7AA 3ULQB 4EM2A 4A2UA 1KU3A 1IN5A 3IHUA 4CDGA 4R1HA 2GA1A 1WI9A 1LJ9A 1UFMA 4IRIA 2IPQX 2QM3A 3HSRA 3M9AA 1IF1A 5FD6A 3V4GA 5ICEA 1TTYA 1WWXA 4IRHA 4U88A 2FA5A 3VOEA 2QWWA 2EA4A 4MTEA 5H20A 3IWZA 2XKPA 2FXAA 4OOIA 4HQEA 3REOA 1G3TA 1R00A 3WTZA 2M8EA 1DPUA 2DFIA 1ZG3A 5J8FA 2F5DA 2QZ8A 4ZH4F 4QWQA 1XSXA 3GO5A 3AAFA 3OOPA 3M8FA 2CYYA 2OBPA 4XSZF 1V4RA 2HGCA 2BGCA 2XKOA 1HSJA 4HA8A 2FF4A 4CYDA 1WSUA 2EV5A 2IA1A 3FMRA 1R5GA 4GCVA 1SMYF 3W6KB 2LSOA 5BOXA 1Z05A 4S04A 1IXRC 1MZBA 1ZAOA 3DEUA 3GZ5A 5HDNA 2FMLA 2AXLA 4HLYA 2DTRA 4G9YA 1P92A 3F23A 2Z3YA 2PG4A 5JVTA 2F5EA 1PDNC 5ED4A 2IJLA 5HS7A 2P5KA 1HXDA 1LDDA 1LEBA 3WGHA 3IL2A 3QU6A 1U6GA 1X3UA 3QRFF 1XGOA 2W84A 1XB4A 3HIFA 2ZO4A 1Z6RA 2STTA 1DUXC 4I09A 3TDUC 1NHAA 1L3LA 4OMYA 2HYGD 3PQKA 1P4XA 2K4JA 4MNUA 3H3UA 4P5OA 1YIOA 5ILUA 2NAZA 4KUMA 3BJAA 4Q47A 3GYHX 2DK8A 1B9NA 2ZFWA 4HOBA 1HQCA 3B02A 1G4DA 3KP3A 1FBSA 2BEOA 1DDNA 1TQIA 3W6JB 2DPDA 1KGSA 2PI0A 3RJPA 2FE3A 4A6EA 1PP7U 1FWZA 4ZYEA 1I6XA 3ZMSA 3G3ZA 3CUQC 3GFIA 1IN8A 5DD8A 5DV5A 5LHGA 3CUQA 3K2ZA 3DQVC 5E1WA 1C0WA 3V7RA 2LDUA 2Q2EA 4TV7A 2DO7A 4LB5A 3HSEA 1B4AA 4KMFA 4K2EA 1Z7UA 4ZZDA 4R8HA 3B73A 3P9KA 3TOAA 5F1RA 1SAXA 2K7LA 1BBYA 4UV8A 5ERIA 2GZWA 2FU4A 3ECOA 3K9TA 1ON1A 5LHIA 2A5YB 2HZTA 1JXSA 3P9IA 4HX4A 4ENKA 1ZARA 3Q5FA 4OMZA 2HKOA 3HRMA 2HQNA 3LQQA 3PQJA 2EA2A 3JSOA 5AONA 3TQNA 4MQ9F 3RIRA 4L9NA 3I71A 4EMSA 3GF2A 2XV4S 2WTEA 2NNYA 4GXOA 5FD5A 1L0OC 3CO6C 5BMZA 3K1PA 1QO0D 2O0YA 3WE2A 3FHZA 3FX3A 3SZPA 3LAJA 2W25A 1RI7A 3KEQA 2ETHA 2CGPA 5EEHA 2V79A 1R7JA 4IRGA 5FGMA 2A3SA 3GX4X 4IVNA 3VB2A 3GWZA 3LA2A 1AOYA 1LB2A 1BIAA 4L18B 4A5NA 3IKVA 2IA0A 1YLFA 1P4WA 4QLCU 1BOAA 3JTGA 4AD9A 5E1ZB 4CICA 3U9GA 2MH2A 3K1MA 1K78B 4EJOA 4HF0A 2Q0OA 3LSTA 3LAPA 3K1NA 5D4SA 3GW2A 3RYPA 2ACJA 5CJ9A 3WE3A 4L0YB 1S3JA 5LEJA 2DQRA 3SQNA 1YFHA 3BY6A 5F6FA 2A07F 4OIPF 3QU3A 1J2XA 3EQLF 3KP7A 2O61A 3KP2A 1BIBA 1O3SA 1Z6TA 4OIOF 1BN5A 1CF7B 4P9UA 2V6CA 2HWVA 4EGYA 4MTDA 2ZMEA 3KFWX 2YU3A 3BPXA 1SD4A 4GYGA 1U8RA 2L4AA 1USTA 1P4AA 2ZKZA 3R0JA 1J0RA 2FOKA 4DNCA 1MDMB 2QQAA 2RN7A 2VBYA 1FYLA 2XVCA 1T2KA 5D8LB 2LF8A 1IZ1A 5ILSA 4LFUA 4WF2A 1D5VA 5LLQA 3EYIA 1BI2A 2XIGA 1FLIA 2H09A 5BQTA 2MA3A 3E6DA 3TO6A 3Q9SA 3RYRA 3F6OA 2X4HA 1HW1A 2O6GE 3JAMZ 1Q1HA 4I98B 2H6BA 2DAOA 2EFOA 3ZQ7A 6PAXA 1FSHA 1E2XA 2R7FA 4KIBA 1K6OA 1R5HA 3RKXA 2OZ6A 1IN6A 5IT9Z 3LA7A 5H6QA 3L9FA 2IT0A 1Y0UA 5D5VB 5BS6A 1F1ZA 2A6HF 4RB3C 3C1DA 2XASA 3ABUA 1U78A 2L02A 1J59A 1ZG5A 4AIKA 3KP4A 3WTXC 2R7DA 2RDPA 2XUBA 3MEXA 4EJUA 2HFHA 4EV0A 4ZYDA 4ENJA 3L09A 3TGNA 3ISPA 1T0FA 5HVQC 3CO7C 2MC3A 3FZVA 1T39A 1R22A 1T98A 2MBFA 2VBXA 4HYEA 2F2EA 1E17A 5IT9K 3FMQA 1XSDA 4EM1A 4M72A 4YFKF 2FEZA 2RC4A 3V8JA 4HBLA 1EH8A 3F8NA 1ZREA 3H92A 3D5LA 3O3KA 1PP8F 3T8TA 4PGGA 3OV8A 4FHTA 2DBBA 2W24A 2L01A 4RAYA 1D8JA 1USSA 2A68F 4P9FA 4CO8A 4U0YA 1GVJA 1ONVA 3MCZA 1KQ0A 3CJNA 2HYFA 4N9HA 4I0BA 4N0BA 4NHJA 2FMYA 1YTYA 2P6SA 2G9WA 4RAZA 5FFZA 2PFBA 4RGUA 2EK5A 3WTSC 4HAMA 2MD5A 3GEZA 3ZP5A 1K78A 5E8IA 2VT3A 4UHTA 3BJOA 4N9IA 1IXCA 3MFKA 4Y15A 2DQLA 4IXAA 2XAJA 3WTTC 2GA2A 2AS5F 3VEPA 4WXDA 2W57A 5LGUA 2PEXA 3IC7A 1WRJA 4M6YA 1FYKA 3F8MA 2IA2A 2W85A 4WWCA 3R0AA 1O3RA 1K79A 2HEOA 3O2PE 2O3FA 4ASNA 2GQQA 1CF7A 2CSOA 4AVPA 2CFXA 1QBJA 3DKWA 2E1CA 4IF4A 2YSRA 1TNTA 5BPDA 2V1UA 2P8TA 4CZZA 1HKSA 3KE2A 1HW5A 1I27A 4EJWA 3WTWC 2ZNZA 4WX9A 1MDMA 4KDPA 2HR3A 4HV5A 1O7LA 1EH6A 2BV6A 2LKPA 3D0SA 5K1YA 1YO5C 4B09A 2XAGA 4UUVA 3N4MA 2EFWA 5L3CA 1FY7A 1TW3A 3DFGA 1UB9A 4LMYA 4RB0A 2JRTA 4F7ZA 3R61A 2BE5F 4PZJA 5L3EA 4LD5A 1ZRCA 3GXOA 4MEXF 4RS8A 2RGVA 5HOOA 3L7WA 3DPTA 1IAWA 4KT5C 2L54A 3ZMZA 2KIMA 1JHFA 4WCGA 2NRAC 3EYYA 4YFNF 2VOOA 1RNLA 3K69A 4LB6B 4EM0B 4Z2YA 1MJ9A 1Z9CA 1O3QA 1ZLJA 1QZZA 1RUOA 2P4WA 2YR2A 2PN6A 1F5TA 1ZLKA 4HLXA 3V7SA 4D0PA 3KP6A 3GZ6A 3WODF 4ENNA 2H94A 1OYYA 4H0EA 2P7CB 4UXNA 5J8CA 4ETSA 5FLXZ 1BI3A 1VTNC 2XROA 2OQGA 4UVAA 1RIOH 4HX8A 1PUEE 2JZYA 3ROUA 1DPRA 3R60A 2VONA 3T1BA 1SFUA 4GGGA 3HSFA 1ZGJA 3ZMVA 2B0LA 5DYMA 5E8GA 4WXHA 1KU9A 2DU9A 1OMIA 2PMUA 3ERED 2IVMA 3GLXA 2HS5A 1QZYA 5HS9A 2QYOA 4RGXA 5FFXA 5E1XA 2VODA 5TRDA 1P2FA 4MGRA 4HW0A 2E1NA 2FRHA 3JTHA 2VE8A 5FO5A 3HOSA 1S29A 2IRFG 2NNNA 3WTVC 4IPAA 1R36A 3BWGA 2D2WA 1TQPA 4G8XA 3JW4A 2PLYA 1S6LA 3I64A 5LGTA 2VOPA 4EQQA 4JBAA 4M9XA 4U0VA 5HS8A 5F64A 5E18F 2JT1A 2EFPA 4XRFA 3DPLC 1QPMA 2MLKA 4GO1A 4PCQA 5L3DA 1SFXA 3GUDA 5CVUA 4RB1A 1SFEA 2Z5UA 2DI3A 1YYVA 2VT2A 4GYIA 3C18A 4L9JA 3FF5A 4LLLA 5K5QA 3ZMTA 1MJAA 1FBQA 2UXNA 2WC2A 2DT5A 4U7DA 4RGRA 2JTVA 3LQRA 2ISYA 1S8NA 2OA4A 2CWEA 3V8KA 2X0LA 4L9TA 4RB2C 4O6JA 2Z9OA 3MWMA 2HTSA 4CGZA 3ML6A 3HUGA 4OINF 1TW2A 1ZGAA 1R1UA 1LVAA 1MKMA 2V1XA 3E6CC 2PBIA 3MZHA 4UNOA 4I01A 2JSCA 1YS7A 4ZYHA 2H6CA 1YW9A 3JSPA 1J5YA 2ELHA 4M9ZA 3EUHA 1FBUA 1W5SA 3E6BA 4P55A 3SZTA 3RPQA 2GIVA 2EWNA 4I7HA 5HLIA 2CQKA 1ZHFA 2ZXJA 2J5PA 1W7PB 1W5TA 3J80Z 1XGMA 3FXQA 3ECHA 3RTRA 1P6RA 2PJPA 5E17F 1FZPB 4PGHA 1Z1DA 2VE9A 2RQPA 3FWEA 1UCRA 1W7PD 1FC3A 2GXBA 5K5OA 2QBYB 1FSEA 2QENA 2ZNYA 4G94A 1G3SA 2PMHA 3M1EA 2WV0A 3BJ6A 5L3BA 4M73A 1I5ZA 1BI1A 2K4BA 4M71A 4EVIA 1GXQA 2EV0A 5LRSA 1RUNA 3J80K 2QUFA 1G6NA 2HQRA 1IXSB 2F5FA 2CW0F 1FNNA 3F72A 2R3SA 1D3YA 4ZZLA 1UHWA 5LRRA 2LNBA 2P5LC 4LLGF 3J81Z 5DDGA 3KLNA 3H3ZA 4BYYA 2GXGA 4U7BA 1HBXG 2H27A 1BJAA 1YS6A 2Y48A 3Q9VA 1MD0A 3P9CA 1IN7A 2C6YA 2RKHA 1BC7C 1OYWA 1I1GA 2OD5A 1OPCA 2ZJ2A 5HDKA 4ESJA 2YPRA 4OIRF 3I5UA 3DF8A 1J7KA 4P96A 3JAMK 1WKMA 3RDIA 2WWYA 5TJJA 4XLPF 3KLOA 1FX7A 5D4RA 1F4KA 2O8XA 1KYWA 4AIJA 1KU2A 5KVRA 1DP7P 2DW4A
chains in the Genus database with same CATH superfamily
1KQ8A 3JRFA 4Q48A 1XDSA 4R79A 2J5OA 4KIFA 4ZJZA 1A31A 3F8BA 3M8EA 2QQ8A 2V26A 3O6BB 2NOJB 3E6MA 5CVJA 4BY7J 3DKYA 3CDHA 4JK1X 5CVVA 4XSXF 2G7HA 1B9MA 1SVOA 2MG4A 1V3FA 3KETA 3CC7I 1JT6A 4M6XA 3GFLA 2Q8KA 2L0KA 2K9NA 2Q2EB 2K02A 5LHHA 2Y0MA 1SD5A 3GMEA 4YFXF 3GFMA 1U5TB 5CVRA 1ZN2A 4XLNF 5M3MJ 2XDVA 2DN0A 2OUMA 5K5RA 1S7OA 1REPC 2ZC2A 3ZCOA 5EF6A 5EDNA 3KP5A 2VIXA 4UVCA 5D5XB 1BW6A 4HQMA 2IGKA 1D8KA 2CJJA 5J6XA 2OU2A 5J1RA 2WAFA 3PNYA 2ISZA 2R5YB 3NWSA 2GAUA 1HDDC 2KIUA 2LK2A 2JA8J 3RZOJ 4XBFA 3F8CA 3WGIA 1LEAA 2DK5A 3IUOA 1STZA 3PIPF 3HRSA 1SAUA 3BTCA 4IQJA 5JR3A 2EQRA 3KEOA 3RZDJ 1QGPA 3VYUB 2DT6A 3TKYA 4DZPA 3E0JB 2XSDC 2Z99A 1EKEA 2LYCA 4IOCF 2E1MC 1EF4A 3V7CA 3K70D 2FD5A 4XLAA 2VJ5A 3KX2A 1QU3A 1RC9A 2R7UA 2M45A 2XAFA 1ETYA 1X1AA 4MQVA 5E3LA 3IWFA 4AIDA 4II2A 1XD7A 3KYCB 4LGWA 2EINH 3RPUA 4C2MJ 2R7VA 4IHSA 2ESNA 3GLLA 2KIFA 3ZMDA 3HTSB 2WV1A 2ZJPF 2WAQN 1YJ9I 5IOYA 1YQAA 2M4GA 5JLWA 2DA1A 3FM5A 3H0GJ 3GTMJ 4BXUA 3BR6A 3H9GA 1MNDA 2M5WA 3GZNB 4O5VA 5D8KB 1WQ2A 1IUYA 1ZGWA 4KMUX 4LK1F 1QHGA 5KK1A 3CCSI 3OYDA 3T5XA 5BPIA 2NVYJ 1U2WA 2IW5A 2V9VA 4Y3OA 3HHHA 3U1KA 1XG1A 4BHBA 2OZUA 3OYGA 2VI6A 5CPRB 4JX6A 3S14J 1R1TA 4B4CA 2D1VA 2XGXA 4ZYAA 4LG0B 5E79C 1ZK8A 1G3YA 2B7EA 3RKQA 4BHCA 2AHQA 2VBWA 1JTYA 1B6AA 3BQZA 1W7PA 4OU0A 3KYDB 3DV8A 3E97A 2LP0A 4XOTA 1OFCX 2BXZA 2V7FA 5GPAA 2W4SA 1JE8A 5HLHA 4EGZA 4IHTA 4S05A 1IW7F 3NEUA 1WI3A 3QWLA 4IJAA 3I53A 2STWA 2DPUA 3E5XA 4BU2A 3KCCA 1D0YA 3N05A 2ID3A 4LK0F 1H0MA 1VQNI 1IRGA 1H9GA 1YW7A 2M30A 5CQEA 1AWCA 3WTUC 1EV7A 3WU0A 1GHCA 1GXPA 2X6YA 2A61A 3I59B 2EIJH 5DUKA 2MFZA 2EIMH 1FMVA 2QBYA 4DJAA 2DA4A 2HOEA 3EDPA 2DA5A 1A04A 5JI6A 4X0GA 2O03A 1SD6A 2Q1ZB 1XCVA 3G73A 4WXCA 1ZG1A 2PQ8A 4KA4A 1HKTA 3I58A 2L9SA 5ILVA 4ZDPA 3JR9A 2FNAA 3HHGA 1H89C 3SJMA 4L5IA 3BZCA 3ZN1A 3L2QA 2TDXA 1Z21A 1UHMA 2KJBA 3I54A 4H4KC 4HDUA 2NYXA 5FRMA 5EEGA 5E3OA 3LSGA 4NBQA 4FETA 2XPWA 4NB5A 1W4MA 1LUJB 4KIGA 3LSMA 3KZZA 3VWBA 3DLAA 4LJZF 2KZGA 2BY1A 2UWMA 4A3LJ 2ZMEB 2XC7A 2EFNA 3RKYA 4XRSA 4BQQA 5L3FA 5AIQA 2QKMB 3NRVA 4ESBA 3LA3A 2K86A 4A3IJ 1YE9A 2D45A 4DW6A 4KYWA 3S2DJ 3IV5A 5FKNA 2ME6A 4AWXB 4BE2A 1KYZA 1TQMA 1R58A 3CDLA 2JJ7A 3LFUA 3PO3J 4U0WA 2DCEA 3LWFA 3VYSB 1R1VA 1TZLA 3HRTA 1XMXA 2VXDA 5EEAA 5CKTA 1T38A 3C7JA 2DOFA 4XLFA 1S72I 3BPVA 1S9HA 2DODA 2JPCA 4Q4ZF 1ZRDA 3FM3A 1YIJI 1O7FA 3AG1H 4IL6C 3RCOA 1IRFA 4FT8A 1I1SA 1XMKA 3IKTA 1Y39A 3BR3A 3BROA 3E5QA 3QPTA 4EJVA 3CC2I 2L4MA 1O4XA 1VQ5I 3BCAA 4Y17A 1RZ4A 3SHFA 1NG6A 2VC0A 3ZN0A 3VODA 4UY8I 1YOVB 4B8XA 1LDKB 3RI4A 2X6WA 1D0ZA 4NQWA 1Z3XA 5CVIA 3M7GA 2IS4A 2BVLA 2EJRA 2G7UA 1FP1D 4XLHA 3TO7A 4XKBA 3HOUJ 3F6VA 1JGSA 1Z7LA 1K7AA 2M0MA 2WADA 4O3MA 5DCMB 3L2CA 4BH9A 2JRMA 4ENMA 3S16J 3FXRA 3E3VA 3FK6A 3CQZJ 4UUTA 4WK8F 2IS2A 3CP8A 2M3AA 2QQBA 3BOQA 1LNWA 2K27A 2W7NA 3J7AO 1XPXA 1XGSA 1Z67A 4CHUA 4E7HA 5LGNA 3MZYA 1FP2A 4XNFA 2EILH 1XMAA 3SDBA 3F0CA 4CH7A 4A0ZA 1QA6A 4LOCA 4M74A 2F4MB 2QQ9A 2GIZA 3E5UA 4ESFA 3JREA 2DDAA 4YIFA 4PJ0C 1ON2A 1UJ8A 3OY9A 4FX4A 2XHKA 2OQRA 4B47A 1VI0A 2E35A 1F9NA 5J1YA 1J9IA 4UUSA 4QPOA 5A2QZ 5CYVA 1U5TC 3ZQIA 1QVTA 4A6DA 2MYSA 2ZXIA 3GFJA 1U5TA 1JUMA 1FT9A 3OSFA 1NH3A 4KN4X 2NOGA 2KKOA 5HLTA 2JSPA 3COAC 4G7ZF 1BA5A 3EETA 5FLXK 5LEKA 3U2RA 1KQ9A 3FXMA 4BDZA 4RM2A 1B59A 2OTLI 2EZKA 3CJQB 4RM3A 3S3MA 5IYCJ 1SD7A 4I0AA 3UR3C 2R5YA 1O3TA 1BM9A 3DTEA 3W2AA 5C4XJ 2DT7B 4QSHA 4AIHA 1EH7A 4HV6A 2HPIA 1VQPI 2DXIA 2FBHA 4BE1A 5FB2A 2CQ7A 2LF7A 1ULYA 3MAJA 5DCFA 2HVSA 3F3XA 1G59A 2FBKA 3MKLA 2VC1A 2WB1A 4YIIA 1TWCJ 5JHUA 5EGOB 1CGPA 3DP7A 1IV6A 3J7AY 2F5CA 3FXUA 1R4MB 2E7WA 2JPBA 1HSTA 4CZCA 3SFZA 2Z33A 3CTAA 3AL0C 3P7NA 2CO5A 5J1UA 4L5EA 2QLZA 3JRDA 1TL8A 4Y33A 3HOWJ 3FXLA 4MFEA 1BC8C 2E71A 2V9KA 2KP6A 4ABZA 2WBMA 3P5JA 3UNGC 1RESA 1ZYRF 4BHPA 3ZMUA 5A2QK 4PDKA 2RVCA 1XN7A 1PVEA 1TNSA 5JHFA 3I4PA 4HF2A 3C3WA 4XMYA 4NUBA 3F8FA 1YITI 2PJRB 3T0YA 4QIWN 3IRQA 3K4BA 5B1BH 4HDVA 3HXLA 5D5WB 2NXNB 4XONA 5EZGA 3BZ6A 3AG3H 3QOPA 4UV9A 2D1HA 4XK4A 2ESHA 4Y13A 3A0BC 3WG9A 4HX7A 2K85A 3I4MJ 3LSRA 2O9LA 3UKGA 1OYIA 3LFKA 3CUOA 5KAFC 2BW3A 4LG0A 1IRZA 2M7AA 4C9YA 4G6QA 2KMUA 5L3GA 1T8IA 4I6ZA 4KICA 2IP2A 2XPUA 4XL9A 5C3EJ 4ZDOA 2K3PA 2DA2A 2MLGA 3BDDA 4HZFA 4KITB 1H9TA 2BBYA 2M1BA 1AHDP 3QYBA 2HKXA 3D1NI 4DQ2A 1IDYA 3IRRA 2KFDA 4L9VA 3U1DA 4CXFA 2P7VB 2OAZA 2UV1A 3GTQJ 1YX5A 2H8WA 1DU0A 3FXOA 4I02A 2P6TA 1T6SA 4XORA 4FX0A 2ZJRF 5HDGA 1RKTA 1MMDA 4L5JA 5D6EA 3L2WA 4BNCA 1XDUA 2XRLA 5D5UB 3ZPLA 4KFCA 3K0LA 3V8LA 3I59A 5HLGA 2KRFA 4DZJA 1ZRFA 3HTUA 1LKXA 2A6EF 3BP8A 2EFQA 4L0ZB 5LBQA 4DBRA 2DLLA 2MABA 2KRCA 1JI8A 4HRIA 4XKWA 5B66C 2VKDA 4RGSA 5GADJ 4XKCA 3WU1B 1TLHB 1ZTRA 5ICFA 3N97A 4MFDA 4M9SA 3QPHA 3S2WA 2ZSIB 3FHNA 1V54H 1ZELA 3SXYA 1ETOA 5EYRA 1HDPA 2COMA 3TOBA 1R23A 1JJ8C 4M3FA 3ZQLA 3CCJI 2R7QA 1QQIA 4EATA 2VXZA 2ZXWH 1FPQA 2HDCA 4G7HF 5ICCA 4A0YA 2FUG2 3OYLA 2HYJA 2MH9A 4HF1A 5D6FA 2ZMEC 3FISA 3QYFA 1OR7A 3LL7A 1S5LC 4XN0A 5DUIA 1DQUA 5HNHA 1D1AA 4PJMA 5E20A 2KDOA 4A5MA 2EV6A 2UXXA 2YX4A 1M1EB 4OIQF 3TDZC 2LOOA 1YG2A 4E7IA 2A69F 1KU7A 1UAAA 3GVAA 1QZEA 2CQQA 3F21A 2F5VA 1B1BA 3HL2A 3F22A 3WGGA 2HI3A 2VBZA 1WGXA 1OLTA 3R6SA 2COBA 2R7RA 3KIOA 3FMSA 3PUFA 3I0TA 4KNYA 2CW7A 2M87A 3K4KA 2I10A 4LLNA 4FISA 3T8RA 4G7OF 2EB7A 3CMMA 1O57A 2PMZA 4MHGA 4CYCB 4G6DA 5FROA 1SVLA 2CRGA 2E7XA 5DS9A 3A1YA 2NS0A 3SYTA 1VFCA 2XRNA 3H9JA 2XGCA 3WTYC 3MQ0A 4I2OA 1AA7A 2TRTA 4F92B 1QNTA 1SMTA 2YX7A 4EJTA 2WAEA 1SEUA 1U0JA 3DXJF 1BJZA 2LY9A 3ZR8X 5FLVA 3CMYA 3H36A 4YELA 3CCRI 2IS6A 2KIQA 1MBFA 3RKWA 1ODDA 1MBKA 4B48A 2JWTA 2MW8A 1JGGA 2KPMA 1XGNA 4BJ5C 1V5FA 2CG4A 2K5CA 2BYVE 3K2AA 1U3EM 1MGTA 5DCMA 1OCZH 2K3FA 2LY1A 1X1PA 5K7FA 4E70A 4JQFA 2OPTA 5LFAA 4S0HB 4IX7A 3K4NA 1XCBA 1WPKA 2P5VA 1IN4A 3R4KA 3CESA 3BTJA 1BL0A 4A3CJ 2RNJA 3VFZA 5IT3A 3U21A 1OCPA 4YG2F 4KN7X 3KZIC 2M4KA 1ZH5A 1HKQA 1I39A 5ICGA 3TO9A 1J75A 2ZCWA 1VQ6I 3S32A 3W6VA 5AIPA 3OIPA 4IKFA 2O7OA 3PUBA 2FX0A 4HPQA 5F27A 2CUJA 1TBXA 2HTJA 3NQOA 2QVOA 3ELKA 2BXYA 1JKOC 2L3DA 4RLFA 1WVRA 2VN2A 3DTIA 1ZR4A 2EZIA 3H5RA 3OL3A 1WCMJ 4KISA 1G3WA 3QAHA 2UZKA 1T95A 2L9NA 1PUFB 2FSWA 2HPMA 3S1MJ 1HCRA 5DEQA 1MJBA 1IGNA 5H6RA 3CC4I 2ZJQF 1KA8A 2XAQA 3JRCA 3B6CA 1LDJA 2VQHA 3J81K 5JFRA 3DTKA 3CLQA 4ZYGA 1HW2A 2ZBKA 2GWRA 2FBIA 4Q5SF 3HRUA 4C3HJ 2QSHX 2FQ3A 2V1DA 4A12A 2LBFA 2RREA 5CLSA 1DP3A 3HYIA 5F0FA 3DLLF 2XPVA 1T0FC 5DD4A 1XSVA 2X1CA 3CUQB 2X6XA 3ABMH 1JJ6C 1YI2I 1YW8A 2FNPA 2MC4A 1JTXA 3CLOA 4BAYA 2HQ5A 1W0UA 1MNMC 1LQ1A 3PFYA 2KJCA 4BKXA 1FOKA 4ON0A 3PFIA 3G1MA 4UVBA 2L9RA 4MEYF 1DU6A 3QP5A 2ELJA 1ZQ3P 1UG2A 3L00A 1RPWA 3HOTA 3KZYA 2CFOA 1JHHA 3HB9A 4M3GA 5EZHA 3QP6A 3ABTA 1APLC 2ADUA 2O5RA 4F93B 1FYMA 1BI0A 4BQAA 4A0XA 3CP2A 3MKYB 2Y75A 1Z91A 2RV8A 4FE4A 2VKVA 2XAHA 3ZOBA 1OKRA 1S7AA 3JRAA 3ULQB 3GTOJ 2XGEA 4EM2A 4A2UA 2YU9J 1KU3A 1IN5A 3IHUA 4CDGA 2M0CA 4R1HA 2PJRA 2M34A 1WFXA 4RLQA 2GA1A 1WI9A 1LJ9A 3IH2A 1UFMA 1TT0A 4IRIA 3OYHA 2IPQX 2QM3A 3HSRA 3M9AA 1IF1A 5FD6A 2H1LA 2VJIA 3V4GA 5ICEA 1E3OC 3AL0B 1TTYA 4B3AA 1WWXA 4IRHA 4U88A 1T08B 3DU5A 2FA5A 3VOEA 3S8PA 3V42A 4CCLA 5M5WJ 2HNHA 2QWWA 2W00A 4DBQA 2EA4A 5DM7F 4PSWA 4MTEA 1B72B 1HOMA 5H20A 3PL8A 3IWZA 1RKWA 3ZXSA 5EG0B 1FMWA 1TWHJ 1HLVA 2XKPA 3ONQA 1WJAA 2FXAA 4G6TB 2DMQA 4D5CA 4OOIA 3EUAA 3GBGA 1N78A 4HQEA 3REOA 3BR5A 3HOVJ 1G3TA 5IP7J 1R00A 2VLAA 1JT0A 3WTZA 2HQAA 2M8EA 2VASA 1DPUA 2DFIA 3QPSA 3L2UA 3A01A 1ZG3A 5J8FA 3E7LA 2F5DA 2QZ8A 4ZH4F 4QWQA 2NVQJ 4DYCA 1XSXA 2BY0A 3GO5A 3AAFA 2DJIA 3IAM2 5KHDA 2HDWA 3OOPA 1TC3C 3ABKH 3DPUA 3M8FA 2CYYA 4BEHB 4FQGA 3O8HA 1WJDA 2OBPA 4XSZF 1V4RA 2CH0A 2XSJC 1ETWA 1Q1VA 2HGCA 2XB0X 2BGCA 2XKOA 1Z77A 1HSJA 4JX5A 3W2VA 4HA8A 4E7KA 2NVTJ 3J7ZI 2QGUA 2FF4A 2I5UA 5M5YJ 3GTGJ 4CYDA 1WSUA 3GTLJ 2EV5A 2IA1A 1MW7A 1LFBA 3H3VK 1X4OA 3FMRA 1R5GA 3FDYA 4BE0A 4GCVA 1SMYF 3S1RJ 4HNTA 1SFKA 1X58A 3W6KB 2LSOA 5BOXA 1Z05A 4S04A 2IXSA 3PO2J 2EPFA 3FKIJ 1U8BA 1IXRC 1MZBA 3HZJA 4AYBA 3KEYA 1ZAOA 3M07A 3DEUA 4BACA 4C30A 3ZQQA 1R4NB 3GZ5A 2XF5A 5HDNA 2FMLA 2AXLA 4HLYA 2DTRA 3LSKA 4G9YA 4FASD 4AYBN 1MBEA 3BTIA 3G1LA 4CSWA 1W36D 2L7ZA 1VQOI 1P92A 3F23A 4IHYA 1AKHB 4CCMA 2Z3YA 1R5ID 2PG4A 4IEJA 5JVTA 2F5EA 1PDNC 1T33A 2EH3A 5ED4A 5HNFA 4F91B 4W1UA 2IJLA 2NVXJ 4ZTFA 2AXTC 3M8JA 5HS7A 4XN3A 1X3WB 2P5KA 2FJ1A 1HXDA 2Y69H 1LDDA 2FOWA 2JUGA 4XIDA 1LEBA 3WGHA 3IL2A 1YHQI 3S17J 1FEXA 2VJ4A 2CV2A 4X1EA 2P0WA 3QU6A 4N4NB 1U6GA 1X3UA 3OL4A 3QRFF 1XGOA 4RAFA 2W84A 2CUEA 2R5ZB 1XB4A 3HIFA 2ZO4A 1Z6RA 2STTA 1DUXC 4I09A 3TDUC 1NHAA 1L3LA 4NC7A 4OMYA 2I8DA 2HYGD 3PQKA 4IO9F 1MSEC 2MGQA 2HOSA 1P4XA 2M9HA 1Y8QB 1NK2P 2K4JA 4MNUA 3H3UA 4P5OA 5DM6F 2IEKA 1YIOA 1I50J 5ILUA 4X6AJ 2Y9YA 2LKSA 3CJRB 2NAZA 3CF5F 1Z0XA 4KUMA 3BJAA 2KLOA 3K4JA 2GXAA 4Q47A 4UB8C 3GYHX 2DK8A 1B9NA 2ZFWA 4HOBA 3TW7A 1PUFA 1HQCA 3B02A 3BTLA 5K7HA 1G4DA 4E7JA 3KP3A 1GV2A 3AG2H 1FBSA 2BEOA 1DDNA 1TQIA 2K9QA 2KQRA 3MD2A 3W6JB 3RQ4A 4HNUA 5J4VA 2RAEA 2DPDA 1KGSA 2PI0A 3RJPA 2EBIA 2FE3A 1D1CA 4A6EA 1PP7U 1FWZA 2ZB9A 4ZYEA 1I6XA 1P7JA 3CCVI 3WG7H 2QEXI 3ZMSA 1YJNI 2KRHA 3G3ZA 3CUQC 3GFIA 1IN8A 5DD8A 5DV5A 5LHGA 1H88C 1FIAA 3CUQA 3K2ZA 5KAIC 2EZHA 3DQVC 5E1WA 2KHMA 4NDLA 4XM3A 1C0WA 3V7RA 4ZDLA 1BOBA 2LDUA 2Q2EA 3PM1A 3OYMA 3ZQCA 2Y30A 4NC8A 3BC8A 4D9JA 1BW5A 4TV7A 2DO7A 4LB5A 2UUZA 2BZTA 3HSEA 2IGNA 4F3QA 3S2HJ 1B4AA 2CMPA 2F48A 4KMFA 2X9DA 2W1OA 4K2EA 3ZQGA 1Z7UA 4ZZDA 3DU6A 4R8HA 3B73A 2XF7A 3P9KA 3BG6A 3HG9A 2FQ4A 2OCEA 3TOAA 5F1RA 1SAXA 2E1OA 2K7LA 1BBYA 3EPZA 4UV8A 5ERIA 2GZWA 3ERMA 2CU7A 2FU4A 2DFEA 3OYEA 3ECOA 2LMDA 3K9TA 3G4SI 1ON1A 1R71A 5LHIA 1X1BA 2A5YB 4B44A 4D5FA 2HZTA 4A3KJ 1JXSA 3P9IA 4HX4A 1P9QC 2DDBA 2X85A 4ENKA 5F08A 2E19A 2K9MA 2WB1N 1ZARA 3Q5FA 4OMZA 1E0EA 1N25A 2HKOA 4PUSA 4LIUA 3HRMA 2HQNA 3LQQA 2JUCA 3DCFA 3PQJA 2B9SA 2A5WA 2ECBA 4AC0A 2E2JJ 1W1WE 1W0TA 3OMYA 2EA2A 3A0HC 4BY1J 2BHYA 2CQNA 3FBNB 1NTCA 3JSOA 4FCYA 5AONA 2QF7A 3IAS2 3TQNA 4MQ9F 4BJ6C 4P1WA 3RIRA 4L9NA 3I71A 2VKHA 4EMSA 3GF2A 5EG0A 2XV4S 2WTEA 2NNYA 4GXOA 5FD5A 1L0OC 3CO6C 5BMZA 5H2FC 3K1PA 1QO0D 5B5EC 2O0YA 3WE2A 3VSKA 3FHZA 3FX3A 3SZPA 3LAJA 3BG5A 5TISC 2E60A 1A6IA 2W25A 1RI7A 3KEQA 2ETHA 2CGPA 5M5XJ 5EEHA 2V79A 4U87A 4Y52J 1R7JA 4IRGA 5FGMA 2A3SA 2R93J 3S1NJ 4M3DA 3I55I 3GX4X 3C2HA 4IVNA 2MD0A 3GWZA 3VB2A 3LA2A 5FKKA 1AOYA 1LB2A 4GRIA 1BIAA 4L18B 5GAGJ 4A5NA 1R9TJ 4KJZA 3IKVA 5J4YA 2IA0A 1MIJA 1YLFA 3BLYA 3HOXJ 1LPQA 1P4WA 4QLCU 1BOAA 5FRNA 2VL8A 5IP6A 1A36A 3JTGA 1IG7A 3CDIA 3OR2C 4AD9A 5E1ZB 4CICA 2PX9A 1GLNA 3BR0A 5J47A 4AVZA 4RA2A 1XC5A 3U9GA 2MH2A 4A93J 3K1MA 3CCLI 1K78B 3PSFA 3IH4A 3ESWB 4EJOA 2DFFA 2Q0OA 3LSTA 4HF0A 3LAPA 1LFUP 1W36C 1W5CC 4PJNA 3K1NA 3DEWA 5D4SA 3JRGA 3GW2A 3TMOA 4BJTA 3RYPA 2L7MP 2ZSHB 2ACJA 2W48A 5CJ9A 1R49A 4V19K 2Z16A 3WE3A 2DOAA 4L0YB 1I3QJ 1S3JA 5LEJA 2DQRA 1OCTC 3SQNA 1HC8A 4BL0B 1YFHA 2ZFUA 3HPGA 3BY6A 5F6FA 2V1NA 2A07F 2Z1DA 1GT0C 3NAUA 3QU3A 1J2XA 2XF6A 4OIPF 2ID6A 3EQLF 3BG7A 4LIVA 1GDTA 5M3FJ 3D5RC 2R7TA 2R7WA 3KP7A 2O61A 3KP2A 1BIBA 1O3SA 3HEFA 2EZLA 4Y7NJ 1Z6TA 4OIOF 1BN5A 1H8AC 1CF7B 2XAUA 3J7YJ 1RRJA 2JVHA 4P9UA 2V6CA 2HWVA 4EGYA 5EJCA 2JA6J 3S3NA 3WU2C 4MTDA 2ZMEA 1IDZA 1IO2A 1IUFA 2YU3A 2L7FP 3BPXA 3KFWX 4XR6A 2H1KA 1SD4A 4GYGA 3OYAA 2L4AA 1U8RA 3GCMA 3TW6A 1GUUA 1USTA 1P4AA 1U9NA 3HBLA 1MSFC 2ZKZA 3R0JA 1X3ZB 1J0RA 2FOKA 4DNCA 1NG7A 3K10A 1KZHA 1MDMB 2VPLA 2QQAA 2RN7A 1UELB 2VBYA 5BNGA 2XVCA 1FYLA 4OAYA 1T2KA 4XRMA 3TP0A 5D8LB 2R5ZA 2LF8A 1IZ1A 1X1CA 5ILSA 2G0EA 2HOAA 3ZQHA 5F0HA 3PNVA 4V2GA 2PMZN 2GBYA 3O8GA 3CMAI 4LFUA 3S93A 5IYBJ 4WF2A 1D5VA 5LLQA 4HNVA 4CA0A 3EYIA 1BI2A 2XIGA 4N4OB 1FLIA 2V4JC 2H09A 5BQTA 2JA7J 2MA3A 1TP4A 2NS7A 3E6DA 3TO6A 4XICA 2MSYA 3Q9SA 1VQMI 2H8RA 2KISA 3RYRA 3F6OA 2X4HA 1HW1A 2O6GE 3ZQFA 1MBJA 3A4CA 2LY2A 2ZXHA 3JAMZ 3OYNA 2OF7A 4CUGA 1FIPA 3I56I 3BZKA 2JN6A 1Q1HA 4I98B 2H6BA 2CUFA 2DAOA 2EFOA 3ZQ7A 5C44J 1JKRC 6PAXA 1FSHA 4ANJA 4D7NA 1E2XA 5F1JA 2R7FA 4KIBA 1XTAA 1R5HA 1K6OA 3E1SA 1PYVA 2CUZA 3RKXA 2QA4I 2OZ6A 1IN6A 1TWAJ 2JVGA 1K4SA 3I3LA 2VUMJ 5IT9Z 1ETXA 2X1DA 3LA7A 3L9FA 5H6QA 5GTHC 1TWGJ 2LFBA 3LSJA 2IT0A 5HODA 1Y0UA 5D5VB 5BS6A 2N8GA 3GTJJ 3BT9A 3CCEI 2OTJI 1WJFA 2AO9A 1F1ZA 4NNJA 3K7AJ 2A6HF 3LSHA 3C1DA 4RB3C 2X48A 2XASA 3ABUA 1U78A 3VSLA 2LG4A 2L02A 5GAEJ 3PIOF 3HOZJ 3CJTB 4PFOA 1J59A 4C3JJ 2HOTA 2R0QC 1ZG5A 2CV1A 2ELKA 4AIKA 4NQWB 3KP4A 3WTXC 2R7DA 2RDPA 2XUBA 4PJJA 3MEXA 4EJUA 1X2MA 1FTTA 1WJEA 2HFHA 2E36A 4EV0A 4ZYDA 1GV5A 4ENJA 3L09A 2K40A 3TGNA 3ISPA 3TL4X 1T0FA 5HVQC 3CO7C 2MC3A 3OYFA 2DMUA 2WY7Q 3FZVA 4JP0A 1MMSA 1T39A 3VYRB 1AU7A 1R22A 3MKZA 1UMQA 2VQLA 1T98A 2MBFA 2VBXA 3DKXA 3HM5A 4HYEA 2F2EA 5EGOA 1WH5A 1IRXA 3MVPA 1E17A 5IT9K 3FMQA 1XSDA 4EM1A 4E4HA 4M72A 2LTPA 2GOXB 2B63J 2LD5A 4YFKF 2FEZA 3Q0VA 4DIQA 1Y6IA 2JA2A 4D7MA 4UUSB 1A5JA 2RC4A 1X1DA 3V8JA 3S1QJ 2DOEA 4HBLA 1EH8A 3MN2A 3F8NA 3SEQA 1MH4A 3DBHB 1ZREA 3H92A 2DMNA 3D5LA 3O3KA 4NC6A 1PP8F 1Z3YA 1N75A 3T8TA 4PGGA 2BOLA 5TGTA 4A3JJ 3OV8A 3FK7A 2DBBA 4FHTA 2W24A 2L01A 4RAYA 1D0XA 4M3BA 3OIOA 1D8JA 1USSA 3CMEI 1MMNA 2A68F 4P9FA 4CO8A 4U0YA 1MNEA 1GVJA 1ONVA 3OOUA 3CD6I 3MCZA 5JVGF 1KQ0A 1WH7A 1YX3A 3CJNA 3IP4B 2HYFA 4N9HA 3FXKA 4I0BA 4N0BA 5KCMA 4NHJA 2FMYA 4PFPA 3LNQA 1YTYA 2QSFX 1BR1A 2P6SA 3AG4H 2G9WA 4RAZA 3CCUI 1NK3P 3OYBA 3OYKA 2Y2ZA 5FFZA 1LE8B 2PFBA 4RGUA 4II3A 5K7ZA 2EK5A 4PSXA 3WTSC 1VNDA 4W97A 2BY2A 4HAMA 2WAQA 1FOYA 2MD5A 3GEZA 3ZP5A 1POGA 1K78A 3KPHA 5E8IA 1I3AA 4RAGA 2VT3A 2JMWA 4UHTA 3BJOA 1YRNB 4N9IA 4M3EA 4DOZA 1IXCA 5DTDA 3NWTA 2IGMA 4I76A 3MFKA 4Y15A 2E2HJ 2DQLA 4IXAA 2XAJA 3WTTC 4QPQA 2GA2A 4UB6C 2L2OA 5F0CA 3JCUC 1X4PA 2AS5F 2YS9A 3VEPA 3QODA 4WXDA 4E6KG 5FLMJ 2W57A 4A69C 5LGUA 2PEXA 3IC7A 1N77A 1VQKI 1FOWA 3ASNH 1WRJA 4BBRJ 4M6YA 1FYKA 1MBHA 3F8MA 2IA2A 2W85A 4WWCA 1YJWI 4LITA 3CCYA 3JRBA 1UHSA 3R0AA 1O3RA 2O8KA 3NARA 4ZC3A 4C2UA 2BW3B 1K79A 1FOXA 2HEOA 3O2PE 1OCCH 2O3FA 1LFPA 4ASNA 2GQQA 2K9SA 2QKLB 1CF7A 2CSOA 3HUGB 3QOEA 4AVPA 4BS9A 3ABLH 2CFXA 1QBJA 1QRYA 3WHCA 3DKWA 2E1CA 4IF4A 2YSRA 4IHXA 2R7SA 2AQFA 1TNTA 5BPDA 4A3FJ 2V1UA 2P8TA 4B1RA 4CZZA 5B3SH 1HKSA 3KE2A 2R4GA 1HW5A 1I27A 3FIWA 4EJWA 3G2BA 4BGDA 2ZNZA 3WTWC 4MLOA 1A35A 2X6OA 2ME0A 2BY3A 2E5ZA 3HGGA 3ASOH 4WX9A 1Y56A 1MDMA 4IQ4A 1D5YA 4KDPA 2XGDA 1VQLI 2HR3A 3M1CA 3BG3A 3ZRGA 2DJNA 4HV5A 3LSPA 1O7LA 1EH6A 1CQTA 4HSTA 3L1PA 2BV6A 4FE7A 1LVKA 4CYCA 5FKLA 2LKPA 3D0SA 5FJ8J 5FKOA 3RSNA 4F55A 4Z6YA 3AFHA 2KDZA 3PJRA 4E7ZA 1FTZA 5K1YA 1YO5C 3MMYB 4B09A 2Y9ZA 2XAGA 3WHBA 4UUVA 1EA3A 3DBRB 4JYKA 3N4MA 1ORKA 2P81A 1V55H 1T56A 3S3OA 2EFWA 5L3CA 1FY7A 2KL4A 1TW3A 3DFGA 1UB9A 2E5NA 4LMYA 3HOYJ 2JA5J 3OYJA 1B8IB 4RB0A 3SZGA 3A2KA 2JRTA 4F7ZA 3DEEA 3R61A 2BE5F 4PZJA 5L3EA 3OYCA 4LD5A 1ZRCA 3GXOA 4MEXF 4CCNA 3G6EI 5LD2C 3OS2A 2WA0A 4RS8A 4A3MJ 2DYRH 2DYSH 2R92J 2RGVA 2DA7A 4F52A 5HOOA 3L7WA 3DPTA 1IAWA 2WY8Q 4KT5C 3C2GA 2L54A 2TCTA 3ZMZA 1KONA 2KIMA 1JHFA 4A3DJ 2KT0A 4WCGA 3HDDA 2NRAC 3EYYA 4YFNF 5C4JJ 1XX5A 2VOOA 2VKEA 3BG9A 1RNLA 3K69A 4LB6B 2YUSA 2X51A 4EM0B 4Z2YA 1OQYA 1MJ9A 1Z9CA 1O3QA 3FBIB 2A6TA 1ZLJA 2K9LA 1QZZA 4BUPA 1RUOA 2P4WA 3A03A 4B43A 2V9PA 3X2QH 3SEZA 1WJBA 3H9QA 3MKWB 2YR2A 4CCJA 2PN6A 3Q0WA 1F5TA 1ERDA 2HVQA 1ZLKA 4HLXA 3V7SA 1WZ2A 4DYQA 4D0PA 2F4OB 3KP6A 3GZ6A 3WODF 4ENNA 2H94A 1OYYA 4H0EA 2P7CB 2HVRA 4UXNA 5J8CA 4ETSA 1RETA 5FLXZ 1BI3A 2M8GX 4YRVA 1VTNC 2XROA 1WJCA 2OQGA 5IYDJ 4UVAA 2D5VA 1RIOH 4HX8A 1PUEE 2JZYA 3ROUA 1DPRA 1SFOJ 3R60A 2VONA 3T1BA 1SFUA 1PJRA 4GGGA 2LREA 3OIQA 3HSFA 1ZGJA 3ZMVA 2B0LA 4A3GJ 1E3HA 4BXFA 1IV8A 1OISA 5DYMA 3HKZA 5E8GA 5GAHJ 2NVUB 1U9OA 5IY5H 1ETQA 2RQQA 4WXHA 4J00A 1KU9A 1RR7A 2DU9A 1OMIA 3DBLB 3K4LA 3JRHA 3HKZN 2PMUA 3ERED 2IVMA 3M4OJ 2EIKH 3Q0UA 1GVDA 3GLXA 2HS5A 1QZYA 2R7OA 3PSIA 2HU9A 1UG0A 5HS9A 2QYOA 1V5EA 4RGXA 4Y4RA 2CV0A 3FXJA 5FFXA 1JKPC 5E1XA 1ETKA 2VODA 4JOMA 5B1AH 4AU7A 5TRDA 1ITYA 1P2FA 4E7LA 4MGRA 2IGOA 1ZR2A 3B6AA 4HW0A 4BQOA 4ZTJA 2E1NA 1VQ8I 4OWRB 5IP9J 4RDUA 2FRHA 3JTHA 2DTZA 4QTRA 2VE8A 2DFHA 4B3XA 5GPCA 5CQGA 5FO5A 3HOSA 2E2IJ 1S29A 2JQ7A 2LR8A 2LRDA 2IRFG 1ZKGA 2NNNA 3WTVC 4IPAA 1MH3A 1R36A 2ECCA 4YIRX 3OWTA 1Y1WJ 3BWGA 3K70C 2D2WA 3FKJA 1TQPA 2GM4A 4G8XA 3JW4A 2LBFB 4HEA2 1DGRM 3AKZA 4CCKA 4D1QA 3JRIA 2PLYA 4XQFA 1S6LA 3I64A 2A05A 2IBDA 4J01A 1SVMA 1JUSA 3D5SC 5LGTA 2VOPA 5F04A 4JBAA 4EQQA 5KNLA 4M9XA 1B72A 1Y8RB 4RMNA 4U0VA 4E7SA 3EUKL 5HS8A 2KZVA 5F64A 5E18F 3CCQI 2JT1A 2EFPA 4XRFA 3DPLC 3LMMA 4YEJA 4DGWB 1LE8A 3M3YJ 3GTPJ 2IAIA 3K6GA 2M2EA 2QCOA 3H5NA 4XLCA 1QPMA 3S15J 5IOZA 2HXIA 2MLKA 3QQAA 4IOAF 4GO1A 1RR8C 1WHUA 4PCQA 5L3DA 1SFXA 3C2BA 3CF2A 3GTKJ 3GUDA 5CVUA 4RB1A 1SFEA 3W2WA 2RNGA 1YRNA 2Z5UA 2LC2A 2DI3A 4AUXA 2OCCH 2GOMA 1YYVA 4OAZA 4LG3A 2VT2A 4GYIA 2X1EA 3OS1A 3C18A 4L9JA 3FF5A 4LLLA 4IHWA 5K5QA 3ZMTA 9ANTA 1MJAA 1MMGA 1FBQA 2UXNA 2JK3A 2WC2A 1K6YA 2DT5A 2L5QA 2LKXA 4BEHA 4U7DA 1IJWC 4RGRA 2E1MB 4I99C 2JTVA 1IC8A 1X2NA 3LQRA 2ISYA 2Z2SB 1S8NA 3RQIA 2OA4A 2CWEA 3V8KA 3BCBA 1JKQC 2X0LA 4L9TA 4RB2C 3CZ6A 1Y0NA 1K83J 4O6JA 3G71I 2Z9OA 2R7ZJ 3MWMA 2HTSA 4CGZA 3ML6A 3HUGA 5GP9A 4OINF 1TW2A 2VQGA 1ZGAA 4EEFG 1R1UA 2F4IA 2V6EA 3K4MA 3HGYA 1DGWY 1LVAA 1MKMA 1ACIA 2V1XA 3BQYA 2PBIA 3E6CC 1F43A 3MZHA 4UNOA 4AM3A 1D1BA 4I01A 4XRSG 2JSCA 3OR1C 4BXXJ 3MZ8A 3H35A 2OC6A 1YS7A 4XKVA 4ZYHA 1UZCA 2ICWG 3OYIA 3RPUD 1BR4A 1YW9A 2H6CA 2BHZA 2CW8A 2OV7A 4M6VA 3JSPA 1J5YA 3EUHC 2ELHA 3H5AA 2HDDA 2BVMA 1MBGA 5J40A 4M9ZA 3I4NJ 3EUHA 1FBUA 1EJ9A 1J09A 3A02A 3A01B 3HC7A 3BR1A 1W5SA 3E6BA 4P55A 3VYTB 3SZTA 3RPQA 2GIVA 2R7XA 1HA8A 1HF0A 1OCRH 2EWNA 4I7HA 3L2RA 5HLIA 3L2VA 3TEDA 1AKHA 1X19A 4CCOA 4HSRA 2L9VA 4A3EJ 2CQKA 3W3CA 1ZHFA 2AQEA 2J5PA 2ZXJA 1W7PB 4V2FA 4RBOA 1W5TA 3J80Z 1XGMA 4FTHA 3FXQA 4IZZA 3ECHA 3RTRA 1P6RA 4C2TA 2LLKA 2PJPA 5E17F 4BQNA 2Y31A 1FZPB 1G2HA 4PGHA 3TP3A 1Z1DA 2VE9A 2RQPA 1B8IA 3FWEA 3I9V2 4DYRA 3F9KA 1UCRA 1W7PD 2QSGX 1OR7C 1OJLA 1FC3A 3HJEA 1VQ4I 2GXBA 1R6RA 3ZGKA 5K5OA 2QBYB 1FSEA 1Y1VJ 3KYLA 1SANA 2HXOA 1V5GA 4J19A 2QENA 2Y0SA 2L7KA 2ZNYA 3Q3SA 4G94A 4MIMA 4XOPA 5J3LA 1G3SA 2DMTA 2PMHA 3VDXA 1QVUA 3M1EA 2LH9A 2W82A 1S7EA 1TT5B 3IH3A 2WV0A 2Y0SN 3QPLA 1XS9A 3BJ6A 5L3BA 1K61A 4M73A 2GLOA 2VJJA 3OSGA 1I5ZA 4JX4A 1K4TA 1BI1A 2K4BA 4M71A 1MMAA 4EVIA 1GXQA 2EV0A 3PNTA 4HG2A 3SDGA 5LRSA 2CQXA 1RUNA 3J80K 2QUFA 4BDYA 1G6NA 2HQRA 1IXSB 2F5FA 2CW0F 3LSIA 1FNNA 3F72A 2R3SA 2HZDA 1D3YA 4ZZLA 3K4CA 2DA6A 1VF9A 1UHWA 4KT6A 1VQ7I 5LRRA 2LNBA 2P5LC 4LLGF 5E3MA 3G1OA 3J81Z 1WJ5A 1ETVA 5DDGA 4MO7A 3KLNA 3H3ZA 3QYEA 2M7BA 4BYYA 2GXGA 5GTIC 2XB5A 2CS3A 4XLEA 4U7BA 1HBXG 1QPIA 2H27A 1BJAA 1YS6A 2Y48A 3Q9VA 1F36A 1TWFJ 4ITVA 4A3BJ 1MD0A 3P9CA 3BR2A 1IN7A 2C6YA 2RKHA 1BC7C 1OYWA 1I1GA 2OD5A 3OS0A 1OPCA 1BR2A 1VZ0A 3H1CA 3HPHA 2ZJ2A 4G12A 5JLXA 2OJED 1FJLA 2VB6A 5HDKA 2VQCA 1SC7A 4ESJA 1QHHD 2NS8A 2YPRA 4OIRF 1ENHA 1VQ9I 2VPRA 4IHVA 3I5UA 2LVSA 3TBIA 3DF8A 1J7KA 2F6CA 4P96A 3JAMK 3DWLE 5FKMA 1WKMA 3RDIA 2WWYA 2IS1A 5TJJA 3SFIA 4XLPF 4C3IJ 1I6HJ 3KLOA 1FX7A 4PJLA 1JUPA 4PK4A 3H0DA 3CCMI 1E3PA 5D4RA 1F4KA 2DMPA 2O8XA 1KYWA 4BBSJ 5IPAA 4GFBA 4AIJA 2DA3A 1KU2A 4GDFA 5KVRA 1OCOH 3LOCA 3VPRA 2E34A 1P7IA 1DP7P 1A6QA 5E3NA 2DW4A 1G8XA
chains in the Genus database with same CATH topology
1KQ8A 4Q48A 1XDSA 4R79A 2J5OA 4KIFA 3F8BA 3M8EA 3O6BB 3E6MA 5CVJA 3CDHA 4JK1X 5CVVA 4XSXF 2G7HA 1B9MA 1V3FA 3KETA 4M6XA 3GFLA 2Q8KA 2K02A 5LHHA 2Y0MA 1SD5A 4YFXF 3GFMA 1U5TB 5CVRA 1ZN2A 4XLNF 5K5RA 1S7OA 1REPC 3KP5A 4UVCA 5D5XB 4HQMA 1D8KA 5J6XA 2OU2A 2ISZA 2GAUA 2KIUA 4XBFA 3F8CA 3WGIA 1LEAA 2DK5A 1STZA 3HRSA 5JR3A 3KEOA 1QGPA 3TKYA 2Z99A 3V7CA 2M45A 2XAFA 4MQVA 3IWFA 1XD7A 4LGWA 3RPUA 4IHSA 2ESNA 2KIFA 3ZMDA 3HTSB 1YQAA 3FM5A 4BXUA 2M5WA 4O5VA 5D8KB 1WQ2A 1IUYA 4KMUX 4LK1F 5KK1A 3T5XA 5BPIA 1U2WA 2IW5A 2V9VA 3HHHA 4BHBA 2OZUA 1R1TA 2D1VA 2XGXA 4LG0B 1G3YA 4BHCA 2VBWA 1B6AA 1W7PA 4OU0A 3DV8A 3E97A 1JE8A 5HLHA 4EGZA 4IHTA 4S05A 1IW7F 3NEUA 4IJAA 3I53A 2STWA 2DPUA 3E5XA 3KCCA 4LK0F 1H0MA 1IRGA 1H9GA 1YW7A 2M30A 1AWCA 3WTUC 1EV7A 3WU0A 1GHCA 1GXPA 2A61A 3I59B 5DUKA 2QBYA 2HOEA 3EDPA 1A04A 5JI6A 2O03A 1SD6A 1XCVA 3G73A 4WXCA 1ZG1A 2PQ8A 4KA4A 1HKTA 3I58A 5ILVA 2FNAA 3HHGA 4L5IA 3ZN1A 2TDXA 1UHMA 2KJBA 3I54A 4HDUA 2NYXA 5EEGA 4NB5A 1W4MA 4KIGA 3KZZA 4LJZF 2UWMA 2ZMEB 2EFNA 3RKYA 5L3FA 5AIQA 3NRVA 4ESBA 3LA3A 2K86A 2D45A 4KYWA 4AWXB 1KYZA 1TQMA 1R58A 4U0WA 3LWFA 1R1VA 3HRTA 1T38A 3C7JA 3BPVA 2JPCA 4Q4ZF 1ZRDA 3FM3A 1O7FA 1IRFA 4FT8A 1I1SA 1XMKA 3IKTA 3BROA 3E5QA 3QPTA 4EJVA 2L4MA 4Y17A 1RZ4A 3SHFA 2VC0A 3ZN0A 3VODA 4B8XA 1LDKB 3RI4A 5CVIA 4NQWA 3M7GA 2EJRA 2G7UA 3TO7A 1FP1D 3F6VA 1JGSA 1K7AA 4O3MA 5DCMB 3L2CA 4BH9A 4ENMA 3FXRA 3E3VA 4WK8F 2QQBA 3BOQA 1LNWA 2K27A 3J7AO 1XGSA 4CHUA 5LGNA 3MZYA 1FP2A 1XMAA 4A0ZA 4M74A 2QQ9A 3E5UA 4ESFA 4YIFA 1ON2A 4FX4A 2XHKA 2OQRA 1F9NA 1J9IA 5A2QZ 5CYVA 1U5TC 4A6DA 3GFJA 1U5TA 1FT9A 4KN4X 2KKOA 3COAC 4G7ZF 3EETA 5FLXK 5LEKA 3U2RA 1KQ9A 1B59A 1SD7A 4I0AA 1O3TA 1BM9A 4AIHA 1EH7A 4HV6A 2FBHA 5FB2A 2LF7A 1ULYA 3MAJA 5DCFA 3F3XA 2FBKA 2VC1A 4YIIA 5JHUA 1CGPA 3DP7A 2F5CA 3FXUA 2E7WA 2JPBA 1HSTA 2Z33A 3SFZA 3CTAA 3P7NA 2CO5A 2QLZA 1BC8C 4BHPA 1ZYRF 3ZMUA 5A2QK 4PDKA 2RVCA 1XN7A 1TNSA 3I4PA 4HF2A 3C3WA 3F8FA 3T0YA 3IRQA 4HDVA 5D5WB 3BZ6A 3QOPA 4UV9A 2D1HA 4Y13A 2ESHA 3WG9A 4HX7A 1OYIA 3LFKA 3CUOA 4LG0A 4G6QA 5L3GA 4KICA 2IP2A 2MLGA 3BDDA 4HZFA 1H9TA 2BBYA 2M1BA 2HKXA 4DQ2A 3IRRA 4CXFA 4L9VA 3U1DA 2P7VB 2OAZA 4I02A 2P6TA 1T6SA 4FX0A 5HDGA 4L5JA 5D6EA 4BNCA 1XDUA 5D5UB 3ZPLA 4KFCA 3K0LA 3V8LA 3I59A 5HLGA 2KRFA 1ZRFA 3HTUA 2A6EF 3BP8A 2EFQA 4L0ZB 5LBQA 2DLLA 4RGSA 3WU1B 1TLHB 5ICFA 3N97A 4M9SA 3QPHA 3S2WA 3SXYA 2COMA 3TOBA 1R23A 1QQIA 2VXZA 1FPQA 2HDCA 4G7HF 5ICCA 4A0YA 2MH9A 4HF1A 5D6FA 1OR7A 5DUIA 5E20A 4A5MA 2EV6A 2UXXA 2YX4A 4OIQF 3TDZC 1KU7A 1YG2A 2A69F 3GVAA 3F21A 1B1BA 3F22A 3WGGA 2VBZA 3R6SA 3FMSA 3I0TA 4KNYA 2M87A 4LLNA 3T8RA 4G7OF 2EB7A 4MHGA 1O57A 4G6DA 2E7XA 2NS0A 2XRNA 3WTYC 3MQ0A 4I2OA 1QNTA 1SMTA 2YX7A 4EJTA 3DXJF 3RKWA 1ODDA 1XGNA 2CG4A 2BYVE 1U3EM 1MGTA 5DCMA 4E70A 4JQFA 1XCBA 2P5VA 1IN4A 3R4KA 2RNJA 3VFZA 5IT3A 4YG2F 4KN7X 1ZH5A 1HKQA 5ICGA 3TO9A 1J75A 2ZCWA 5AIPA 2HTJA 1TBXA 3NQOA 2QVOA 3ELKA 2L3DA 2VN2A 1G3WA 3QAHA 2UZKA 2FSWA 5DEQA 1MJBA 5H6RA 1KA8A 2XAQA 1LDJA 3J81K 5JFRA 4ZYGA 1HW2A 2ZBKA 2GWRA 2FBIA 4Q5SF 3HRUA 2FQ3A 2V1DA 4A12A 5CLSA 3HYIA 5DD4A 1XSVA 3CUQB 1YW8A 2FNPA 3CLOA 4BAYA 1LQ1A 2KJCA 1FOKA 4ON0A 3PFIA 4UVBA 4MEYF 3QP5A 3L00A 3HOTA 3KZYA 1JHHA 3QP6A 3ABTA 2ADUA 1FYMA 1BI0A 4BQAA 4A0XA 2Y75A 1Z91A 2RV8A 2XAHA 1OKRA 1S7AA 3ULQB 4EM2A 4A2UA 1KU3A 1IN5A 3IHUA 4CDGA 4R1HA 2GA1A 1WI9A 1LJ9A 1UFMA 4IRIA 2IPQX 2QM3A 3HSRA 3M9AA 1IF1A 5FD6A 3V4GA 5ICEA 1TTYA 1WWXA 4IRHA 4U88A 2FA5A 3VOEA 2QWWA 2EA4A 4MTEA 5H20A 3IWZA 2XKPA 2FXAA 4OOIA 4HQEA 3REOA 1G3TA 1R00A 3WTZA 2M8EA 1DPUA 2DFIA 1ZG3A 5J8FA 2F5DA 2QZ8A 4ZH4F 4QWQA 1XSXA 3GO5A 3AAFA 3OOPA 3M8FA 2CYYA 2OBPA 4XSZF 1V4RA 2HGCA 2BGCA 2XKOA 1HSJA 4HA8A 2FF4A 4CYDA 1WSUA 2EV5A 2IA1A 3FMRA 1R5GA 4GCVA 1SMYF 3W6KB 2LSOA 5BOXA 1Z05A 4S04A 1IXRC 1MZBA 1ZAOA 3DEUA 3GZ5A 5HDNA 2FMLA 2AXLA 4HLYA 2DTRA 4G9YA 1P92A 3F23A 2Z3YA 2PG4A 5JVTA 2F5EA 1PDNC 5ED4A 2IJLA 5HS7A 2P5KA 1HXDA 1LDDA 1LEBA 3WGHA 3IL2A 3QU6A 1U6GA 1X3UA 3QRFF 1XGOA 2W84A 1XB4A 3HIFA 2ZO4A 1Z6RA 2STTA 1DUXC 4I09A 3TDUC 1NHAA 1L3LA 4OMYA 2HYGD 3PQKA 1P4XA 2K4JA 4MNUA 3H3UA 4P5OA 1YIOA 5ILUA 2NAZA 4KUMA 3BJAA 4Q47A 3GYHX 2DK8A 1B9NA 2ZFWA 4HOBA 1HQCA 3B02A 1G4DA 3KP3A 1FBSA 2BEOA 1DDNA 1TQIA 3W6JB 2DPDA 1KGSA 2PI0A 3RJPA 2FE3A 4A6EA 1PP7U 1FWZA 4ZYEA 1I6XA 3ZMSA 3G3ZA 3CUQC 3GFIA 1IN8A 5DD8A 5DV5A 5LHGA 3CUQA 3K2ZA 3DQVC 5E1WA 1C0WA 3V7RA 2LDUA 2Q2EA 4TV7A 2DO7A 4LB5A 3HSEA 1B4AA 4KMFA 4K2EA 1Z7UA 4ZZDA 4R8HA 3B73A 3P9KA 3TOAA 5F1RA 1SAXA 2K7LA 1BBYA 4UV8A 5ERIA 2GZWA 2FU4A 3ECOA 3K9TA 1ON1A 5LHIA 2A5YB 2HZTA 1JXSA 3P9IA 4HX4A 4ENKA 1ZARA 3Q5FA 4OMZA 2HKOA 3HRMA 2HQNA 3LQQA 3PQJA 2EA2A 3JSOA 5AONA 3TQNA 4MQ9F 3RIRA 4L9NA 3I71A 4EMSA 3GF2A 2XV4S 2WTEA 2NNYA 4GXOA 5FD5A 1L0OC 3CO6C 5BMZA 3K1PA 1QO0D 2O0YA 3WE2A 3FHZA 3FX3A 3SZPA 3LAJA 2W25A 1RI7A 3KEQA 2ETHA 2CGPA 5EEHA 2V79A 1R7JA 4IRGA 5FGMA 2A3SA 3GX4X 4IVNA 3VB2A 3GWZA 3LA2A 1AOYA 1LB2A 1BIAA 4L18B 4A5NA 3IKVA 2IA0A 1YLFA 1P4WA 4QLCU 1BOAA 3JTGA 4AD9A 5E1ZB 4CICA 3U9GA 2MH2A 3K1MA 1K78B 4EJOA 4HF0A 2Q0OA 3LSTA 3LAPA 3K1NA 5D4SA 3GW2A 3RYPA 2ACJA 5CJ9A 3WE3A 4L0YB 1S3JA 5LEJA 2DQRA 3SQNA 1YFHA 3BY6A 5F6FA 2A07F 4OIPF 3QU3A 1J2XA 3EQLF 3KP7A 2O61A 3KP2A 1BIBA 1O3SA 1Z6TA 4OIOF 1BN5A 1CF7B 4P9UA 2V6CA 2HWVA 4EGYA 4MTDA 2ZMEA 3KFWX 2YU3A 3BPXA 1SD4A 4GYGA 1U8RA 2L4AA 1USTA 1P4AA 2ZKZA 3R0JA 1J0RA 2FOKA 4DNCA 1MDMB 2QQAA 2RN7A 2VBYA 1FYLA 2XVCA 1T2KA 5D8LB 2LF8A 1IZ1A 5ILSA 4LFUA 4WF2A 1D5VA 5LLQA 3EYIA 1BI2A 2XIGA 1FLIA 2H09A 5BQTA 2MA3A 3E6DA 3TO6A 3Q9SA 3RYRA 3F6OA 2X4HA 1HW1A 2O6GE 3JAMZ 1Q1HA 4I98B 2H6BA 2DAOA 2EFOA 3ZQ7A 6PAXA 1FSHA 1E2XA 2R7FA 4KIBA 1K6OA 1R5HA 3RKXA 2OZ6A 1IN6A 5IT9Z 3LA7A 5H6QA 3L9FA 2IT0A 1Y0UA 5D5VB 5BS6A 1F1ZA 2A6HF 4RB3C 3C1DA 2XASA 3ABUA 1U78A 2L02A 1J59A 1ZG5A 4AIKA 3KP4A 3WTXC 2R7DA 2RDPA 2XUBA 3MEXA 4EJUA 2HFHA 4EV0A 4ZYDA 4ENJA 3L09A 3TGNA 3ISPA 1T0FA 5HVQC 3CO7C 2MC3A 3FZVA 1T39A 1R22A 1T98A 2MBFA 2VBXA 4HYEA 2F2EA 1E17A 5IT9K 3FMQA 1XSDA 4EM1A 4M72A 4YFKF 2FEZA 2RC4A 3V8JA 4HBLA 1EH8A 3F8NA 1ZREA 3H92A 3D5LA 3O3KA 1PP8F 3T8TA 4PGGA 3OV8A 4FHTA 2DBBA 2W24A 2L01A 4RAYA 1D8JA 1USSA 2A68F 4P9FA 4CO8A 4U0YA 1GVJA 1ONVA 3MCZA 1KQ0A 3CJNA 2HYFA 4N9HA 4I0BA 4N0BA 4NHJA 2FMYA 1YTYA 2P6SA 2G9WA 4RAZA 5FFZA 2PFBA 4RGUA 2EK5A 3WTSC 4HAMA 2MD5A 3GEZA 3ZP5A 1K78A 5E8IA 2VT3A 4UHTA 3BJOA 4N9IA 1IXCA 3MFKA 4Y15A 2DQLA 4IXAA 2XAJA 3WTTC 2GA2A 2AS5F 3VEPA 4WXDA 2W57A 5LGUA 2PEXA 3IC7A 1WRJA 4M6YA 1FYKA 3F8MA 2IA2A 2W85A 4WWCA 3R0AA 1O3RA 1K79A 2HEOA 3O2PE 2O3FA 4ASNA 2GQQA 1CF7A 2CSOA 4AVPA 2CFXA 1QBJA 3DKWA 2E1CA 4IF4A 2YSRA 1TNTA 5BPDA 2V1UA 2P8TA 4CZZA 1HKSA 3KE2A 1HW5A 1I27A 4EJWA 3WTWC 2ZNZA 4WX9A 1MDMA 4KDPA 2HR3A 4HV5A 1O7LA 1EH6A 2BV6A 2LKPA 3D0SA 5K1YA 1YO5C 4B09A 2XAGA 4UUVA 3N4MA 2EFWA 5L3CA 1FY7A 1TW3A 3DFGA 1UB9A 4LMYA 4RB0A 2JRTA 4F7ZA 3R61A 2BE5F 4PZJA 5L3EA 4LD5A 1ZRCA 3GXOA 4MEXF 4RS8A 2RGVA 5HOOA 3L7WA 3DPTA 1IAWA 4KT5C 2L54A 3ZMZA 2KIMA 1JHFA 4WCGA 2NRAC 3EYYA 4YFNF 2VOOA 1RNLA 3K69A 4LB6B 4EM0B 4Z2YA 1MJ9A 1Z9CA 1O3QA 1ZLJA 1QZZA 1RUOA 2P4WA 2YR2A 2PN6A 1F5TA 1ZLKA 4HLXA 3V7SA 4D0PA 3KP6A 3GZ6A 3WODF 4ENNA 2H94A 1OYYA 4H0EA 2P7CB 4UXNA 5J8CA 4ETSA 5FLXZ 1BI3A 1VTNC 2XROA 2OQGA 4UVAA 1RIOH 4HX8A 1PUEE 2JZYA 3ROUA 1DPRA 3R60A 2VONA 3T1BA 1SFUA 4GGGA 3HSFA 1ZGJA 3ZMVA 2B0LA 5DYMA 5E8GA 4WXHA 1KU9A 2DU9A 1OMIA 2PMUA 3ERED 2IVMA 3GLXA 2HS5A 1QZYA 5HS9A 2QYOA 4RGXA 5FFXA 5E1XA 2VODA 5TRDA 1P2FA 4MGRA 4HW0A 2E1NA 2FRHA 3JTHA 2VE8A 5FO5A 3HOSA 1S29A 2IRFG 2NNNA 3WTVC 4IPAA 1R36A 3BWGA 2D2WA 1TQPA 4G8XA 3JW4A 2PLYA 1S6LA 3I64A 5LGTA 2VOPA 4EQQA 4JBAA 4M9XA 4U0VA 5HS8A 5F64A 5E18F 2JT1A 2EFPA 4XRFA 3DPLC 1QPMA 2MLKA 4GO1A 4PCQA 5L3DA 1SFXA 3GUDA 5CVUA 4RB1A 1SFEA 2Z5UA 2DI3A 1YYVA 2VT2A 4GYIA 3C18A 4L9JA 3FF5A 4LLLA 5K5QA 3ZMTA 1MJAA 1FBQA 2UXNA 2WC2A 2DT5A 4U7DA 4RGRA 2JTVA 3LQRA 2ISYA 1S8NA 2OA4A 2CWEA 3V8KA 2X0LA 4L9TA 4RB2C 4O6JA 2Z9OA 3MWMA 2HTSA 4CGZA 3ML6A 3HUGA 4OINF 1TW2A 1ZGAA 1R1UA 1LVAA 1MKMA 2V1XA 3E6CC 2PBIA 3MZHA 4UNOA 4I01A 2JSCA 1YS7A 4ZYHA 2H6CA 1YW9A 3JSPA 1J5YA 2ELHA 4M9ZA 3EUHA 1FBUA 1W5SA 3E6BA 4P55A 3SZTA 3RPQA 2GIVA 2EWNA 4I7HA 5HLIA 2CQKA 1ZHFA 2ZXJA 2J5PA 1W7PB 1W5TA 3J80Z 1XGMA 3FXQA 3ECHA 3RTRA 1P6RA 2PJPA 5E17F 1FZPB 4PGHA 1Z1DA 2VE9A 2RQPA 3FWEA 1UCRA 1W7PD 1FC3A 2GXBA 5K5OA 2QBYB 1FSEA 2QENA 2ZNYA 4G94A 1G3SA 2PMHA 3M1EA 2WV0A 3BJ6A 5L3BA 4M73A 1I5ZA 1BI1A 2K4BA 4M71A 4EVIA 1GXQA 2EV0A 5LRSA 1RUNA 3J80K 2QUFA 1G6NA 2HQRA 1IXSB 2F5FA 2CW0F 1FNNA 3F72A 2R3SA 1D3YA 4ZZLA 1UHWA 5LRRA 2LNBA 2P5LC 4LLGF 3J81Z 5DDGA 3KLNA 3H3ZA 4BYYA 2GXGA 4U7BA 1HBXG 2H27A 1BJAA 1YS6A 2Y48A 3Q9VA 1MD0A 3P9CA 1IN7A 2C6YA 2RKHA 1BC7C 1OYWA 1I1GA 2OD5A 1OPCA 2ZJ2A 5HDKA 4ESJA 2YPRA 4OIRF 3I5UA 3DF8A 1J7KA 4P96A 3JAMK 1WKMA 3RDIA 2WWYA 5TJJA 4XLPF 3KLOA 1FX7A 5D4RA 1F4KA 2O8XA 1KYWA 4AIJA 1KU2A 5KVRA 1DP7P 2DW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ8 A;  4Q48 A;  1XDS A;  4R79 A;  2J5O A;  4KIF A;  3F8B A;  3M8E A;  3O6B B;  3E6M A;  5CVJ A;  3CDH A;  4JK1 X;  5CVV A;  4XSX F;  2G7H A;  1B9M A;  1V3F A;  3KET A;  4M6X A;  3GFL A;  2Q8K A;  2K02 A;  5LHH A;  2Y0M A;  1SD5 A;  4YFX F;  3GFM A;  1U5T B;  5CVR A;  1ZN2 A;  4XLN F;  5K5R A;  1S7O A;  1REP C;  3KP5 A;  4UVC A;  5D5X B;  4HQM A;  1D8K A;  5J6X A;  2OU2 A;  2ISZ A;  2GAU A;  2KIU A;  4XBF A;  3F8C A;  3WGI A;  1LEA A;  2DK5 A;  1STZ A;  3HRS A;  5JR3 A;  3KEO A;  1QGP A;  3TKY A;  2Z99 A;  3V7C A;  2M45 A;  2XAF A;  4MQV A;  3IWF A;  1XD7 A;  4LGW A;  3RPU A;  4IHS A;  2ESN A;  2KIF A;  3ZMD A;  3HTS B;  1YQA A;  3FM5 A;  4BXU A;  2M5W A;  4O5V A;  5D8K B;  1WQ2 A;  1IUY A;  4KMU X;  4LK1 F;  5KK1 A;  3T5X A;  5BPI A;  1U2W A;  2IW5 A;  2V9V A;  3HHH A;  4BHB A;  2OZU A;  1R1T A;  2D1V A;  2XGX A;  4LG0 B;  1G3Y A;  4BHC A;  2VBW A;  1B6A A;  1W7P A;  4OU0 A;  3DV8 A;  3E97 A;  1JE8 A;  5HLH A;  4EGZ A;  4IHT A;  4S05 A;  1IW7 F;  3NEU A;  4IJA A;  3I53 A;  2STW A;  2DPU A;  3E5X A;  3KCC A;  4LK0 F;  1H0M A;  1IRG A;  1H9G A;  1YW7 A;  2M30 A;  1AWC A;  3WTU C;  1EV7 A;  3WU0 A;  1GHC A;  1GXP A;  2A61 A;  3I59 B;  5DUK A;  2QBY A;  2HOE A;  3EDP A;  1A04 A;  5JI6 A;  2O03 A;  1SD6 A;  1XCV A;  3G73 A;  4WXC A;  1ZG1 A;  2PQ8 A;  4KA4 A;  1HKT A;  3I58 A;  5ILV A;  2FNA A;  3HHG A;  4L5I A;  3ZN1 A;  2TDX A;  1UHM A;  2KJB A;  3I54 A;  4HDU A;  2NYX A;  5EEG A;  4NB5 A;  1W4M A;  4KIG A;  3KZZ A;  4LJZ F;  2UWM A;  2ZME B;  2EFN A;  3RKY A;  5L3F A;  5AIQ A;  3NRV A;  4ESB A;  3LA3 A;  2K86 A;  2D45 A;  4KYW A;  4AWX B;  1KYZ A;  1TQM A;  1R58 A;  4U0W A;  3LWF A;  1R1V A;  3HRT A;  1T38 A;  3C7J A;  3BPV A;  2JPC A;  4Q4Z F;  1ZRD A;  3FM3 A;  1O7F A;  1IRF A;  4FT8 A;  1I1S A;  1XMK A;  3IKT A;  3BRO A;  3E5Q A;  3QPT A;  4EJV A;  2L4M A;  4Y17 A;  1RZ4 A;  3SHF A;  2VC0 A;  3ZN0 A;  3VOD A;  4B8X A;  1LDK B;  3RI4 A;  5CVI A;  4NQW A;  3M7G A;  2EJR A;  2G7U A;  3TO7 A;  1FP1 D;  3F6V A;  1JGS A;  1K7A A;  4O3M A;  5DCM B;  3L2C A;  4BH9 A;  4ENM A;  3FXR A;  3E3V A;  4WK8 F;  2QQB A;  3BOQ A;  1LNW A;  2K27 A;  3J7A O;  1XGS A;  4CHU A;  5LGN A;  3MZY A;  1FP2 A;  1XMA A;  4A0Z A;  4M74 A;  2QQ9 A;  3E5U A;  4ESF A;  4YIF A;  1ON2 A;  4FX4 A;  2XHK A;  2OQR A;  1F9N A;  1J9I A;  5A2Q Z;  5CYV A;  1U5T C;  4A6D A;  3GFJ A;  1U5T A;  1FT9 A;  4KN4 X;  2KKO A;  3COA C;  4G7Z F;  3EET A;  5FLX K;  5LEK A;  3U2R A;  1KQ9 A;  1B59 A;  1SD7 A;  4I0A A;  1O3T A;  1BM9 A;  4AIH A;  1EH7 A;  4HV6 A;  2FBH A;  5FB2 A;  2LF7 A;  1ULY A;  3MAJ A;  5DCF A;  3F3X A;  2FBK A;  2VC1 A;  4YII A;  5JHU A;  1CGP A;  3DP7 A;  2F5C A;  3FXU A;  2E7W A;  2JPB A;  1HST A;  2Z33 A;  3SFZ A;  3CTA A;  3P7N A;  2CO5 A;  2QLZ A;  1BC8 C;  4BHP A;  1ZYR F;  3ZMU A;  5A2Q K;  4PDK A;  2RVC A;  1XN7 A;  1TNS A;  3I4P A;  4HF2 A;  3C3W A;  3F8F A;  3T0Y A;  3IRQ A;  4HDV A;  5D5W B;  3BZ6 A;  3QOP A;  4UV9 A;  2D1H A;  4Y13 A;  2ESH A;  3WG9 A;  4HX7 A;  1OYI A;  3LFK A;  3CUO A;  4LG0 A;  4G6Q A;  5L3G A;  4KIC A;  2IP2 A;  2MLG A;  3BDD A;  4HZF A;  1H9T A;  2BBY A;  2M1B A;  2HKX A;  4DQ2 A;  3IRR A;  4CXF A;  4L9V A;  3U1D A;  2P7V B;  2OAZ A;  4I02 A;  2P6T A;  1T6S A;  4FX0 A;  5HDG A;  4L5J A;  5D6E A;  4BNC A;  1XDU A;  5D5U B;  3ZPL A;  4KFC A;  3K0L A;  3V8L A;  3I59 A;  5HLG A;  2KRF A;  1ZRF A;  3HTU A;  2A6E F;  3BP8 A;  2EFQ A;  4L0Z B;  5LBQ A;  2DLL A;  4RGS A;  3WU1 B;  1TLH B;  5ICF A;  3N97 A;  4M9S A;  3QPH A;  3S2W A;  3SXY A;  2COM A;  3TOB A;  1R23 A;  1QQI A;  2VXZ A;  1FPQ A;  2HDC A;  4G7H F;  5ICC A;  4A0Y A;  2MH9 A;  4HF1 A;  5D6F A;  1OR7 A;  5DUI A;  5E20 A;  4A5M A;  2EV6 A;  2UXX A;  2YX4 A;  4OIQ F;  3TDZ C;  1KU7 A;  1YG2 A;  2A69 F;  3GVA A;  3F21 A;  1B1B A;  3F22 A;  3WGG A;  2VBZ A;  3R6S A;  3FMS A;  3I0T A;  4KNY A;  2M87 A;  4LLN A;  3T8R A;  4G7O F;  2EB7 A;  4MHG A;  1O57 A;  4G6D A;  2E7X A;  2NS0 A;  2XRN A;  3WTY C;  3MQ0 A;  4I2O A;  1QNT A;  1SMT A;  2YX7 A;  4EJT A;  3DXJ F;  3RKW A;  1ODD A;  1XGN A;  2CG4 A;  2BYV E;  1U3E M;  1MGT A;  5DCM A;  4E70 A;  4JQF A;  1XCB A;  2P5V A;  1IN4 A;  3R4K A;  2RNJ A;  3VFZ A;  5IT3 A;  4YG2 F;  4KN7 X;  1ZH5 A;  1HKQ A;  5ICG A;  3TO9 A;  1J75 A;  2ZCW A;  5AIP A;  2HTJ A;  1TBX A;  3NQO A;  2QVO A;  3ELK A;  2L3D A;  2VN2 A;  1G3W A;  3QAH A;  2UZK A;  2FSW A;  5DEQ A;  1MJB A;  5H6R A;  1KA8 A;  2XAQ A;  1LDJ A;  3J81 K;  5JFR A;  4ZYG A;  1HW2 A;  2ZBK A;  2GWR A;  2FBI A;  4Q5S F;  3HRU A;  2FQ3 A;  2V1D A;  4A12 A;  5CLS A;  3HYI A;  5DD4 A;  1XSV A;  3CUQ B;  1YW8 A;  2FNP A;  3CLO A;  4BAY A;  1LQ1 A;  2KJC A;  1FOK A;  4ON0 A;  3PFI A;  4UVB A;  4MEY F;  3QP5 A;  3L00 A;  3HOT A;  3KZY A;  1JHH A;  3QP6 A;  3ABT A;  2ADU A;  1FYM A;  1BI0 A;  4BQA A;  4A0X A;  2Y75 A;  1Z91 A;  2RV8 A;  2XAH A;  1OKR A;  1S7A A;  3ULQ B;  4EM2 A;  4A2U A;  1KU3 A;  1IN5 A;  3IHU A;  4CDG A;  4R1H A;  2GA1 A;  1WI9 A;  1LJ9 A;  1UFM A;  4IRI A;  2IPQ X;  2QM3 A;  3HSR A;  3M9A A;  1IF1 A;  5FD6 A;  3V4G A;  5ICE A;  1TTY A;  1WWX A;  4IRH A;  4U88 A;  2FA5 A;  3VOE A;  2QWW A;  2EA4 A;  4MTE A;  5H20 A;  3IWZ A;  2XKP A;  2FXA A;  4OOI A;  4HQE A;  3REO A;  1G3T A;  1R00 A;  3WTZ A;  2M8E A;  1DPU A;  2DFI A;  1ZG3 A;  5J8F A;  2F5D A;  2QZ8 A;  4ZH4 F;  4QWQ A;  1XSX A;  3GO5 A;  3AAF A;  3OOP A;  3M8F A;  2CYY A;  2OBP A;  4XSZ F;  1V4R A;  2HGC A;  2BGC A;  2XKO A;  1HSJ A;  4HA8 A;  2FF4 A;  4CYD A;  1WSU A;  2EV5 A;  2IA1 A;  3FMR A;  1R5G A;  4GCV A;  1SMY F;  3W6K B;  2LSO A;  5BOX A;  1Z05 A;  4S04 A;  1IXR C;  1MZB A;  1ZAO A;  3DEU A;  3GZ5 A;  5HDN A;  2FML A;  2AXL A;  4HLY A;  2DTR A;  4G9Y A;  1P92 A;  3F23 A;  2Z3Y A;  2PG4 A;  5JVT A;  2F5E A;  1PDN C;  5ED4 A;  2IJL A;  5HS7 A;  2P5K A;  1HXD A;  1LDD A;  1LEB A;  3WGH A;  3IL2 A;  3QU6 A;  1U6G A;  1X3U A;  3QRF F;  1XGO A;  2W84 A;  1XB4 A;  3HIF A;  2ZO4 A;  1Z6R A;  2STT A;  1DUX C;  4I09 A;  3TDU C;  1NHA A;  1L3L A;  4OMY A;  2HYG D;  3PQK A;  1P4X A;  2K4J A;  4MNU A;  3H3U A;  4P5O A;  1YIO A;  5ILU A;  2NAZ A;  4KUM A;  3BJA A;  4Q47 A;  3GYH X;  2DK8 A;  1B9N A;  2ZFW A;  4HOB A;  1HQC A;  3B02 A;  1G4D A;  3KP3 A;  1FBS A;  2BEO A;  1DDN A;  1TQI A;  3W6J B;  2DPD A;  1KGS A;  2PI0 A;  3RJP A;  2FE3 A;  4A6E A;  1PP7 U;  1FWZ A;  4ZYE A;  1I6X A;  3ZMS A;  3G3Z A;  3CUQ C;  3GFI A;  1IN8 A;  5DD8 A;  5DV5 A;  5LHG A;  3CUQ A;  3K2Z A;  3DQV C;  5E1W A;  1C0W A;  3V7R A;  2LDU A;  2Q2E A;  4TV7 A;  2DO7 A;  4LB5 A;  3HSE A;  1B4A A;  4KMF A;  4K2E A;  1Z7U A;  4ZZD A;  4R8H A;  3B73 A;  3P9K A;  3TOA A;  5F1R A;  1SAX A;  2K7L A;  1BBY A;  4UV8 A;  5ERI A;  2GZW A;  2FU4 A;  3ECO A;  3K9T A;  1ON1 A;  5LHI A;  2A5Y B;  2HZT A;  1JXS A;  3P9I A;  4HX4 A;  4ENK A;  1ZAR A;  3Q5F A;  4OMZ A;  2HKO A;  3HRM A;  2HQN A;  3LQQ A;  3PQJ A;  2EA2 A;  3JSO A;  5AON A;  3TQN A;  4MQ9 F;  3RIR A;  4L9N A;  3I71 A;  4EMS A;  3GF2 A;  2XV4 S;  2WTE A;  2NNY A;  4GXO A;  5FD5 A;  1L0O C;  3CO6 C;  5BMZ A;  3K1P A;  1QO0 D;  2O0Y A;  3WE2 A;  3FHZ A;  3FX3 A;  3SZP A;  3LAJ A;  2W25 A;  1RI7 A;  3KEQ A;  2ETH A;  2CGP A;  5EEH A;  2V79 A;  1R7J A;  4IRG A;  5FGM A;  2A3S A;  3GX4 X;  4IVN A;  3VB2 A;  3GWZ A;  3LA2 A;  1AOY A;  1LB2 A;  1BIA A;  4L18 B;  4A5N A;  3IKV A;  2IA0 A;  1YLF A;  1P4W A;  4QLC U;  1BOA A;  3JTG A;  4AD9 A;  5E1Z B;  4CIC A;  3U9G A;  2MH2 A;  3K1M A;  1K78 B;  4EJO A;  4HF0 A;  2Q0O A;  3LST A;  3LAP A;  3K1N A;  5D4S A;  3GW2 A;  3RYP A;  2ACJ A;  5CJ9 A;  3WE3 A;  4L0Y B;  1S3J A;  5LEJ A;  2DQR A;  3SQN A;  1YFH A;  3BY6 A;  5F6F A;  2A07 F;  4OIP F;  3QU3 A;  1J2X A;  3EQL F;  3KP7 A;  2O61 A;  3KP2 A;  1BIB A;  1O3S A;  1Z6T A;  4OIO F;  1BN5 A;  1CF7 B;  4P9U A;  2V6C A;  2HWV A;  4EGY A;  4MTD A;  2ZME A;  3KFW X;  2YU3 A;  3BPX A;  1SD4 A;  4GYG A;  1U8R A;  2L4A A;  1UST A;  1P4A A;  2ZKZ A;  3R0J A;  1J0R A;  2FOK A;  4DNC A;  1MDM B;  2QQA A;  2RN7 A;  2VBY A;  1FYL A;  2XVC A;  1T2K A;  5D8L B;  2LF8 A;  1IZ1 A;  5ILS A;  4LFU A;  4WF2 A;  1D5V A;  5LLQ A;  3EYI A;  1BI2 A;  2XIG A;  1FLI A;  2H09 A;  5BQT A;  2MA3 A;  3E6D A;  3TO6 A;  3Q9S A;  3RYR A;  3F6O A;  2X4H A;  1HW1 A;  2O6G E;  3JAM Z;  1Q1H A;  4I98 B;  2H6B A;  2DAO A;  2EFO A;  3ZQ7 A;  6PAX A;  1FSH A;  1E2X A;  2R7F A;  4KIB A;  1K6O A;  1R5H A;  3RKX A;  2OZ6 A;  1IN6 A;  5IT9 Z;  3LA7 A;  5H6Q A;  3L9F A;  2IT0 A;  1Y0U A;  5D5V B;  5BS6 A;  1F1Z A;  2A6H F;  4RB3 C;  3C1D A;  2XAS A;  3ABU A;  1U78 A;  2L02 A;  1J59 A;  1ZG5 A;  4AIK A;  3KP4 A;  3WTX C;  2R7D A;  2RDP A;  2XUB A;  3MEX A;  4EJU A;  2HFH A;  4EV0 A;  4ZYD A;  4ENJ A;  3L09 A;  3TGN A;  3ISP A;  1T0F A;  5HVQ C;  3CO7 C;  2MC3 A;  3FZV A;  1T39 A;  1R22 A;  1T98 A;  2MBF A;  2VBX A;  4HYE A;  2F2E A;  1E17 A;  5IT9 K;  3FMQ A;  1XSD A;  4EM1 A;  4M72 A;  4YFK F;  2FEZ A;  2RC4 A;  3V8J A;  4HBL A;  1EH8 A;  3F8N A;  1ZRE A;  3H92 A;  3D5L A;  3O3K A;  1PP8 F;  3T8T A;  4PGG A;  3OV8 A;  4FHT A;  2DBB A;  2W24 A;  2L01 A;  4RAY A;  1D8J A;  1USS A;  2A68 F;  4P9F A;  4CO8 A;  4U0Y A;  1GVJ A;  1ONV A;  3MCZ A;  1KQ0 A;  3CJN A;  2HYF A;  4N9H A;  4I0B A;  4N0B A;  4NHJ A;  2FMY A;  1YTY A;  2P6S A;  2G9W A;  4RAZ A;  5FFZ A;  2PFB A;  4RGU A;  2EK5 A;  3WTS C;  4HAM A;  2MD5 A;  3GEZ A;  3ZP5 A;  1K78 A;  5E8I A;  2VT3 A;  4UHT A;  3BJO A;  4N9I A;  1IXC A;  3MFK A;  4Y15 A;  2DQL A;  4IXA A;  2XAJ A;  3WTT C;  2GA2 A;  2AS5 F;  3VEP A;  4WXD A;  2W57 A;  5LGU A;  2PEX A;  3IC7 A;  1WRJ A;  4M6Y A;  1FYK A;  3F8M A;  2IA2 A;  2W85 A;  4WWC A;  3R0A A;  1O3R A;  1K79 A;  2HEO A;  3O2P E;  2O3F A;  4ASN A;  2GQQ A;  1CF7 A;  2CSO A;  4AVP A;  2CFX A;  1QBJ A;  3DKW A;  2E1C A;  4IF4 A;  2YSR A;  1TNT A;  5BPD A;  2V1U A;  2P8T A;  4CZZ A;  1HKS A;  3KE2 A;  1HW5 A;  1I27 A;  4EJW A;  3WTW C;  2ZNZ A;  4WX9 A;  1MDM A;  4KDP A;  2HR3 A;  4HV5 A;  1O7L A;  1EH6 A;  2BV6 A;  2LKP A;  3D0S A;  5K1Y A;  1YO5 C;  4B09 A;  2XAG A;  4UUV A;  3N4M A;  2EFW A;  5L3C A;  1FY7 A;  1TW3 A;  3DFG A;  1UB9 A;  4LMY A;  4RB0 A;  2JRT A;  4F7Z A;  3R61 A;  2BE5 F;  4PZJ A;  5L3E A;  4LD5 A;  1ZRC A;  3GXO A;  4MEX F;  4RS8 A;  2RGV A;  5HOO A;  3L7W A;  3DPT A;  1IAW A;  4KT5 C;  2L54 A;  3ZMZ A;  2KIM A;  1JHF A;  4WCG A;  2NRA C;  3EYY A;  4YFN F;  2VOO A;  1RNL A;  3K69 A;  4LB6 B;  4EM0 B;  4Z2Y A;  1MJ9 A;  1Z9C A;  1O3Q A;  1ZLJ A;  1QZZ A;  1RUO A;  2P4W A;  2YR2 A;  2PN6 A;  1F5T A;  1ZLK A;  4HLX A;  3V7S A;  4D0P A;  3KP6 A;  3GZ6 A;  3WOD F;  4ENN A;  2H94 A;  1OYY A;  4H0E A;  2P7C B;  4UXN A;  5J8C A;  4ETS A;  5FLX Z;  1BI3 A;  1VTN C;  2XRO A;  2OQG A;  4UVA A;  1RIO H;  4HX8 A;  1PUE E;  2JZY A;  3ROU A;  1DPR A;  3R60 A;  2VON A;  3T1B A;  1SFU A;  4GGG A;  3HSF A;  1ZGJ A;  3ZMV A;  2B0L A;  5DYM A;  5E8G A;  4WXH A;  1KU9 A;  2DU9 A;  1OMI A;  2PMU A;  3ERE D;  2IVM A;  3GLX A;  2HS5 A;  1QZY A;  5HS9 A;  2QYO A;  4RGX A;  5FFX A;  5E1X A;  2VOD A;  5TRD A;  1P2F A;  4MGR A;  4HW0 A;  2E1N A;  2FRH A;  3JTH A;  2VE8 A;  5FO5 A;  3HOS A;  1S29 A;  2IRF G;  2NNN A;  3WTV C;  4IPA A;  1R36 A;  3BWG A;  2D2W A;  1TQP A;  4G8X A;  3JW4 A;  2PLY A;  1S6L A;  3I64 A;  5LGT A;  2VOP A;  4EQQ A;  4JBA A;  4M9X A;  4U0V A;  5HS8 A;  5F64 A;  5E18 F;  2JT1 A;  2EFP A;  4XRF A;  3DPL C;  1QPM A;  2MLK A;  4GO1 A;  4PCQ A;  5L3D A;  1SFX A;  3GUD A;  5CVU A;  4RB1 A;  1SFE A;  2Z5U A;  2DI3 A;  1YYV A;  2VT2 A;  4GYI A;  3C18 A;  4L9J A;  3FF5 A;  4LLL A;  5K5Q A;  3ZMT A;  1MJA A;  1FBQ A;  2UXN A;  2WC2 A;  2DT5 A;  4U7D A;  4RGR A;  2JTV A;  3LQR A;  2ISY A;  1S8N A;  2OA4 A;  2CWE A;  3V8K A;  2X0L A;  4L9T A;  4RB2 C;  4O6J A;  2Z9O A;  3MWM A;  2HTS A;  4CGZ A;  3ML6 A;  3HUG A;  4OIN F;  1TW2 A;  1ZGA A;  1R1U A;  1LVA A;  1MKM A;  2V1X A;  3E6C C;  2PBI A;  3MZH A;  4UNO A;  4I01 A;  2JSC A;  1YS7 A;  4ZYH A;  2H6C A;  1YW9 A;  3JSP A;  1J5Y A;  2ELH A;  4M9Z A;  3EUH A;  1FBU A;  1W5S A;  3E6B A;  4P55 A;  3SZT A;  3RPQ A;  2GIV A;  2EWN A;  4I7H A;  5HLI A;  2CQK A;  1ZHF A;  2ZXJ A;  2J5P A;  1W7P B;  1W5T A;  3J80 Z;  1XGM A;  3FXQ A;  3ECH A;  3RTR A;  1P6R A;  2PJP A;  5E17 F;  1FZP B;  4PGH A;  1Z1D A;  2VE9 A;  2RQP A;  3FWE A;  1UCR A;  1W7P D;  1FC3 A;  2GXB A;  5K5O A;  2QBY B;  1FSE A;  2QEN A;  2ZNY A;  4G94 A;  1G3S A;  2PMH A;  3M1E A;  2WV0 A;  3BJ6 A;  5L3B A;  4M73 A;  1I5Z A;  1BI1 A;  2K4B A;  4M71 A;  4EVI A;  1GXQ A;  2EV0 A;  5LRS A;  1RUN A;  3J80 K;  2QUF A;  1G6N A;  2HQR A;  1IXS B;  2F5F A;  2CW0 F;  1FNN A;  3F72 A;  2R3S A;  1D3Y A;  4ZZL A;  1UHW A;  5LRR A;  2LNB A;  2P5L C;  4LLG F;  3J81 Z;  5DDG A;  3KLN A;  3H3Z A;  4BYY A;  2GXG A;  4U7B A;  1HBX G;  2H27 A;  1BJA A;  1YS6 A;  2Y48 A;  3Q9V A;  1MD0 A;  3P9C A;  1IN7 A;  2C6Y A;  2RKH A;  1BC7 C;  1OYW A;  1I1G A;  2OD5 A;  1OPC A;  2ZJ2 A;  5HDK A;  4ESJ A;  2YPR A;  4OIR F;  3I5U A;  3DF8 A;  1J7K A;  4P96 A;  3JAM K;  1WKM A;  3RDI A;  2WWY A;  5TJJ A;  4XLP F;  3KLO A;  1FX7 A;  5D4R A;  1F4K A;  2O8X A;  1KYW A;  4AIJ A;  1KU2 A;  5KVR A;  1DP7 P;  2DW4 A; 
#chains in the Genus database with same CATH topology
 1KQ8 A;  3JRF A;  4Q48 A;  1XDS A;  4R79 A;  2J5O A;  4KIF A;  4ZJZ A;  1A31 A;  3F8B A;  3M8E A;  2QQ8 A;  2V26 A;  3O6B B;  2NOJ B;  3E6M A;  5CVJ A;  4BY7 J;  3DKY A;  3CDH A;  4JK1 X;  5CVV A;  4XSX F;  2G7H A;  1B9M A;  1SVO A;  2MG4 A;  1V3F A;  3KET A;  3CC7 I;  1JT6 A;  4M6X A;  3GFL A;  2Q8K A;  2L0K A;  2K9N A;  2Q2E B;  2K02 A;  5LHH A;  2Y0M A;  1SD5 A;  3GME A;  4YFX F;  3GFM A;  1U5T B;  5CVR A;  1ZN2 A;  4XLN F;  5M3M J;  2XDV A;  2DN0 A;  2OUM A;  5K5R A;  1S7O A;  1REP C;  2ZC2 A;  3ZCO A;  5EF6 A;  5EDN A;  3KP5 A;  2VIX A;  4UVC A;  5D5X B;  1BW6 A;  4HQM A;  2IGK A;  1D8K A;  2CJJ A;  5J6X A;  2OU2 A;  5J1R A;  2WAF A;  3PNY A;  2ISZ A;  2R5Y B;  3NWS A;  2GAU A;  1HDD C;  2KIU A;  2LK2 A;  2JA8 J;  3RZO J;  4XBF A;  3F8C A;  3WGI A;  1LEA A;  2DK5 A;  3IUO A;  1STZ A;  3PIP F;  3HRS A;  1SAU A;  3BTC A;  4IQJ A;  5JR3 A;  2EQR A;  3KEO A;  3RZD J;  1QGP A;  3VYU B;  2DT6 A;  3TKY A;  4DZP A;  3E0J B;  2XSD C;  2Z99 A;  1EKE A;  2LYC A;  4IOC F;  2E1M C;  1EF4 A;  3V7C A;  3K70 D;  2FD5 A;  4XLA A;  2VJ5 A;  3KX2 A;  1QU3 A;  1RC9 A;  2R7U A;  2M45 A;  2XAF A;  1ETY A;  1X1A A;  4MQV A;  5E3L A;  3IWF A;  4AID A;  4II2 A;  1XD7 A;  3KYC B;  4LGW A;  2EIN H;  3RPU A;  4C2M J;  2R7V A;  4IHS A;  2ESN A;  3GLL A;  2KIF A;  3ZMD A;  3HTS B;  2WV1 A;  2ZJP F;  2WAQ N;  1YJ9 I;  5IOY A;  1YQA A;  2M4G A;  5JLW A;  2DA1 A;  3FM5 A;  3H0G J;  3GTM J;  4BXU A;  3BR6 A;  3H9G A;  1MND A;  2M5W A;  3GZN B;  4O5V A;  5D8K B;  1WQ2 A;  1IUY A;  1ZGW A;  4KMU X;  4LK1 F;  1QHG A;  5KK1 A;  3CCS I;  3OYD A;  3T5X A;  5BPI A;  2NVY J;  1U2W A;  2IW5 A;  2V9V A;  4Y3O A;  3HHH A;  3U1K A;  1XG1 A;  4BHB A;  2OZU A;  3OYG A;  2VI6 A;  5CPR B;  4JX6 A;  3S14 J;  1R1T A;  4B4C A;  2D1V A;  2XGX A;  4ZYA A;  4LG0 B;  5E79 C;  1ZK8 A;  1G3Y A;  2B7E A;  3RKQ A;  4BHC A;  2AHQ A;  2VBW A;  1JTY A;  1B6A A;  3BQZ A;  1W7P A;  4OU0 A;  3KYD B;  3DV8 A;  3E97 A;  2LP0 A;  4XOT A;  1OFC X;  2BXZ A;  2V7F A;  5GPA A;  2W4S A;  1JE8 A;  5HLH A;  4EGZ A;  4IHT A;  4S05 A;  1IW7 F;  3NEU A;  1WI3 A;  3QWL A;  4IJA A;  3I53 A;  2STW A;  2DPU A;  3E5X A;  4BU2 A;  3KCC A;  1D0Y A;  3N05 A;  2ID3 A;  4LK0 F;  1H0M A;  1VQN I;  1IRG A;  1H9G A;  1YW7 A;  2M30 A;  5CQE A;  1AWC A;  3WTU C;  1EV7 A;  3WU0 A;  1GHC A;  1GXP A;  2X6Y A;  2A61 A;  3I59 B;  2EIJ H;  5DUK A;  2MFZ A;  2EIM H;  1FMV A;  2QBY A;  4DJA A;  2DA4 A;  2HOE A;  3EDP A;  2DA5 A;  1A04 A;  5JI6 A;  4X0G A;  2O03 A;  1SD6 A;  2Q1Z B;  1XCV A;  3G73 A;  4WXC A;  1ZG1 A;  2PQ8 A;  4KA4 A;  1HKT A;  3I58 A;  2L9S A;  5ILV A;  4ZDP A;  3JR9 A;  2FNA A;  3HHG A;  1H89 C;  3SJM A;  4L5I A;  3BZC A;  3ZN1 A;  3L2Q A;  2TDX A;  1Z21 A;  1UHM A;  2KJB A;  3I54 A;  4H4K C;  4HDU A;  2NYX A;  5FRM A;  5EEG A;  5E3O A;  3LSG A;  4NBQ A;  4FET A;  2XPW A;  4NB5 A;  1W4M A;  1LUJ B;  4KIG A;  3LSM A;  3KZZ A;  3VWB A;  3DLA A;  4LJZ F;  2KZG A;  2BY1 A;  2UWM A;  4A3L J;  2ZME B;  2XC7 A;  2EFN A;  3RKY A;  4XRS A;  4BQQ A;  5L3F A;  5AIQ A;  2QKM B;  3NRV A;  4ESB A;  3LA3 A;  2K86 A;  4A3I J;  1YE9 A;  2D45 A;  4DW6 A;  4KYW A;  3S2D J;  3IV5 A;  5FKN A;  2ME6 A;  4AWX B;  4BE2 A;  1KYZ A;  1TQM A;  1R58 A;  3CDL A;  2JJ7 A;  3LFU A;  3PO3 J;  4U0W A;  2DCE A;  3LWF A;  3VYS B;  1R1V A;  1TZL A;  3HRT A;  1XMX A;  2VXD A;  5EEA A;  5CKT A;  1T38 A;  3C7J A;  2DOF A;  4XLF A;  1S72 I;  3BPV A;  1S9H A;  2DOD A;  2JPC A;  4Q4Z F;  1ZRD A;  3FM3 A;  1YIJ I;  1O7F A;  3AG1 H;  4IL6 C;  3RCO A;  1IRF A;  4FT8 A;  1I1S A;  1XMK A;  3IKT A;  1Y39 A;  3BR3 A;  3BRO A;  3E5Q A;  3QPT A;  4EJV A;  3CC2 I;  2L4M A;  1O4X A;  1VQ5 I;  3BCA A;  4Y17 A;  1RZ4 A;  3SHF A;  1NG6 A;  2VC0 A;  3ZN0 A;  3VOD A;  4UY8 I;  1YOV B;  4B8X A;  1LDK B;  3RI4 A;  2X6W A;  1D0Z A;  4NQW A;  1Z3X A;  5CVI A;  3M7G A;  2IS4 A;  2BVL A;  2EJR A;  2G7U A;  1FP1 D;  4XLH A;  3TO7 A;  4XKB A;  3HOU J;  3F6V A;  1JGS A;  1Z7L A;  1K7A A;  2M0M A;  2WAD A;  4O3M A;  5DCM B;  3L2C A;  4BH9 A;  2JRM A;  4ENM A;  3S16 J;  3FXR A;  3E3V A;  3FK6 A;  3CQZ J;  4UUT A;  4WK8 F;  2IS2 A;  3CP8 A;  2M3A A;  2QQB A;  3BOQ A;  1LNW A;  2K27 A;  2W7N A;  3J7A O;  1XPX A;  1XGS A;  1Z67 A;  4CHU A;  4E7H A;  5LGN A;  3MZY A;  1FP2 A;  4XNF A;  2EIL H;  1XMA A;  3SDB A;  3F0C A;  4CH7 A;  4A0Z A;  1QA6 A;  4LOC A;  4M74 A;  2F4M B;  2QQ9 A;  2GIZ A;  3E5U A;  4ESF A;  3JRE A;  2DDA A;  4YIF A;  4PJ0 C;  1ON2 A;  1UJ8 A;  3OY9 A;  4FX4 A;  2XHK A;  2OQR A;  4B47 A;  1VI0 A;  2E35 A;  1F9N A;  5J1Y A;  1J9I A;  4UUS A;  4QPO A;  5A2Q Z;  5CYV A;  1U5T C;  3ZQI A;  1QVT A;  4A6D A;  2MYS A;  2ZXI A;  3GFJ A;  1U5T A;  1JUM A;  1FT9 A;  3OSF A;  1NH3 A;  4KN4 X;  2NOG A;  2KKO A;  5HLT A;  2JSP A;  3COA C;  4G7Z F;  1BA5 A;  3EET A;  5FLX K;  5LEK A;  3U2R A;  1KQ9 A;  3FXM A;  4BDZ A;  4RM2 A;  1B59 A;  2OTL I;  2EZK A;  3CJQ B;  4RM3 A;  3S3M A;  5IYC J;  1SD7 A;  4I0A A;  3UR3 C;  2R5Y A;  1O3T A;  1BM9 A;  3DTE A;  3W2A A;  5C4X J;  2DT7 B;  4QSH A;  4AIH A;  1EH7 A;  4HV6 A;  2HPI A;  1VQP I;  2DXI A;  2FBH A;  4BE1 A;  5FB2 A;  2CQ7 A;  2LF7 A;  1ULY A;  3MAJ A;  5DCF A;  2HVS A;  3F3X A;  1G59 A;  2FBK A;  3MKL A;  2VC1 A;  2WB1 A;  4YII A;  1TWC J;  5JHU A;  5EGO B;  1CGP A;  3DP7 A;  1IV6 A;  3J7A Y;  2F5C A;  3FXU A;  1R4M B;  2E7W A;  2JPB A;  1HST A;  4CZC A;  3SFZ A;  2Z33 A;  3CTA A;  3AL0 C;  3P7N A;  2CO5 A;  5J1U A;  4L5E A;  2QLZ A;  3JRD A;  1TL8 A;  4Y33 A;  3HOW J;  3FXL A;  4MFE A;  1BC8 C;  2E71 A;  2V9K A;  2KP6 A;  4ABZ A;  2WBM A;  3P5J A;  3UNG C;  1RES A;  1ZYR F;  4BHP A;  3ZMU A;  5A2Q K;  4PDK A;  2RVC A;  1XN7 A;  1PVE A;  1TNS A;  5JHF A;  3I4P A;  4HF2 A;  3C3W A;  4XMY A;  4NUB A;  3F8F A;  1YIT I;  2PJR B;  3T0Y A;  4QIW N;  3IRQ A;  3K4B A;  5B1B H;  4HDV A;  3HXL A;  5D5W B;  2NXN B;  4XON A;  5EZG A;  3BZ6 A;  3AG3 H;  3QOP A;  4UV9 A;  2D1H A;  4XK4 A;  2ESH A;  4Y13 A;  3A0B C;  3WG9 A;  4HX7 A;  2K85 A;  3I4M J;  3LSR A;  2O9L A;  3UKG A;  1OYI A;  3LFK A;  3CUO A;  5KAF C;  2BW3 A;  4LG0 A;  1IRZ A;  2M7A A;  4C9Y A;  4G6Q A;  2KMU A;  5L3G A;  1T8I A;  4I6Z A;  4KIC A;  2IP2 A;  2XPU A;  4XL9 A;  5C3E J;  4ZDO A;  2K3P A;  2DA2 A;  2MLG A;  3BDD A;  4HZF A;  4KIT B;  1H9T A;  2BBY A;  2M1B A;  1AHD P;  3QYB A;  2HKX A;  3D1N I;  4DQ2 A;  1IDY A;  3IRR A;  2KFD A;  4L9V A;  3U1D A;  4CXF A;  2P7V B;  2OAZ A;  2UV1 A;  3GTQ J;  1YX5 A;  2H8W A;  1DU0 A;  3FXO A;  4I02 A;  2P6T A;  1T6S A;  4XOR A;  4FX0 A;  2ZJR F;  5HDG A;  1RKT A;  1MMD A;  4L5J A;  5D6E A;  3L2W A;  4BNC A;  1XDU A;  2XRL A;  5D5U B;  3ZPL A;  4KFC A;  3K0L A;  3V8L A;  3I59 A;  5HLG A;  2KRF A;  4DZJ A;  1ZRF A;  3HTU A;  1LKX A;  2A6E F;  3BP8 A;  2EFQ A;  4L0Z B;  5LBQ A;  4DBR A;  2DLL A;  2MAB A;  2KRC A;  1JI8 A;  4HRI A;  4XKW A;  5B66 C;  2VKD A;  4RGS A;  5GAD J;  4XKC A;  3WU1 B;  1TLH B;  1ZTR A;  5ICF A;  3N97 A;  4MFD A;  4M9S A;  3QPH A;  3S2W A;  2ZSI B;  3FHN A;  1V54 H;  1ZEL A;  3SXY A;  1ETO A;  5EYR A;  1HDP A;  2COM A;  3TOB A;  1R23 A;  1JJ8 C;  4M3F A;  3ZQL A;  3CCJ I;  2R7Q A;  1QQI A;  4EAT A;  2VXZ A;  2ZXW H;  1FPQ A;  2HDC A;  4G7H F;  5ICC A;  4A0Y A;  2FUG 2;  3OYL A;  2HYJ A;  2MH9 A;  4HF1 A;  5D6F A;  2ZME C;  3FIS A;  3QYF A;  1OR7 A;  3LL7 A;  1S5L C;  4XN0 A;  5DUI A;  1DQU A;  5HNH A;  1D1A A;  4PJM A;  5E20 A;  2KDO A;  4A5M A;  2EV6 A;  2UXX A;  2YX4 A;  1M1E B;  4OIQ F;  3TDZ C;  2LOO A;  1YG2 A;  4E7I A;  2A69 F;  1KU7 A;  1UAA A;  3GVA A;  1QZE A;  2CQQ A;  3F21 A;  2F5V A;  1B1B A;  3HL2 A;  3F22 A;  3WGG A;  2HI3 A;  2VBZ A;  1WGX A;  1OLT A;  3R6S A;  2COB A;  2R7R A;  3KIO A;  3FMS A;  3PUF A;  3I0T A;  4KNY A;  2CW7 A;  2M87 A;  3K4K A;  2I10 A;  4LLN A;  4FIS A;  3T8R A;  4G7O F;  2EB7 A;  3CMM A;  1O57 A;  2PMZ A;  4MHG A;  4CYC B;  4G6D A;  5FRO A;  1SVL A;  2CRG A;  2E7X A;  5DS9 A;  3A1Y A;  2NS0 A;  3SYT A;  1VFC A;  2XRN A;  3H9J A;  2XGC A;  3WTY C;  3MQ0 A;  4I2O A;  1AA7 A;  2TRT A;  4F92 B;  1QNT A;  1SMT A;  2YX7 A;  4EJT A;  2WAE A;  1SEU A;  1U0J A;  3DXJ F;  1BJZ A;  2LY9 A;  3ZR8 X;  5FLV A;  3CMY A;  3H36 A;  4YEL A;  3CCR I;  2IS6 A;  2KIQ A;  1MBF A;  3RKW A;  1ODD A;  1MBK A;  4B48 A;  2JWT A;  2MW8 A;  1JGG A;  2KPM A;  1XGN A;  4BJ5 C;  1V5F A;  2CG4 A;  2K5C A;  2BYV E;  3K2A A;  1U3E M;  1MGT A;  5DCM A;  1OCZ H;  2K3F A;  2LY1 A;  1X1P A;  5K7F A;  4E70 A;  4JQF A;  2OPT A;  5LFA A;  4S0H B;  4IX7 A;  3K4N A;  1XCB A;  1WPK A;  2P5V A;  1IN4 A;  3R4K A;  3CES A;  3BTJ A;  1BL0 A;  4A3C J;  2RNJ A;  3VFZ A;  5IT3 A;  3U21 A;  1OCP A;  4YG2 F;  4KN7 X;  3KZI C;  2M4K A;  1ZH5 A;  1HKQ A;  1I39 A;  5ICG A;  3TO9 A;  1J75 A;  2ZCW A;  1VQ6 I;  3S32 A;  3W6V A;  5AIP A;  3OIP A;  4IKF A;  2O7O A;  3PUB A;  2FX0 A;  4HPQ A;  5F27 A;  2CUJ A;  1TBX A;  2HTJ A;  3NQO A;  2QVO A;  3ELK A;  2BXY A;  1JKO C;  2L3D A;  4RLF A;  1WVR A;  2VN2 A;  3DTI A;  1ZR4 A;  2EZI A;  3H5R A;  3OL3 A;  1WCM J;  4KIS A;  1G3W A;  3QAH A;  2UZK A;  1T95 A;  2L9N A;  1PUF B;  2FSW A;  2HPM A;  3S1M J;  1HCR A;  5DEQ A;  1MJB A;  1IGN A;  5H6R A;  3CC4 I;  2ZJQ F;  1KA8 A;  2XAQ A;  3JRC A;  3B6C A;  1LDJ A;  2VQH A;  3J81 K;  5JFR A;  3DTK A;  3CLQ A;  4ZYG A;  1HW2 A;  2ZBK A;  2GWR A;  2FBI A;  4Q5S F;  3HRU A;  4C3H J;  2QSH X;  2FQ3 A;  2V1D A;  4A12 A;  2LBF A;  2RRE A;  5CLS A;  1DP3 A;  3HYI A;  5F0F A;  3DLL F;  2XPV A;  1T0F C;  5DD4 A;  1XSV A;  2X1C A;  3CUQ B;  2X6X A;  3ABM H;  1JJ6 C;  1YI2 I;  1YW8 A;  2FNP A;  2MC4 A;  1JTX A;  3CLO A;  4BAY A;  2HQ5 A;  1W0U A;  1MNM C;  1LQ1 A;  3PFY A;  2KJC A;  4BKX A;  1FOK A;  4ON0 A;  3PFI A;  3G1M A;  4UVB A;  2L9R A;  4MEY F;  1DU6 A;  3QP5 A;  2ELJ A;  1ZQ3 P;  1UG2 A;  3L00 A;  1RPW A;  3HOT A;  3KZY A;  2CFO A;  1JHH A;  3HB9 A;  4M3G A;  5EZH A;  3QP6 A;  3ABT A;  1APL C;  2ADU A;  2O5R A;  4F93 B;  1FYM A;  1BI0 A;  4BQA A;  4A0X A;  3CP2 A;  3MKY B;  2Y75 A;  1Z91 A;  2RV8 A;  4FE4 A;  2VKV A;  2XAH A;  3ZOB A;  1OKR A;  1S7A A;  3JRA A;  3ULQ B;  3GTO J;  2XGE A;  4EM2 A;  4A2U A;  2YU9 J;  1KU3 A;  1IN5 A;  3IHU A;  4CDG A;  2M0C A;  4R1H A;  2PJR A;  2M34 A;  1WFX A;  4RLQ A;  2GA1 A;  1WI9 A;  1LJ9 A;  3IH2 A;  1UFM A;  1TT0 A;  4IRI A;  3OYH A;  2IPQ X;  2QM3 A;  3HSR A;  3M9A A;  1IF1 A;  5FD6 A;  2H1L A;  2VJI A;  3V4G A;  5ICE A;  1E3O C;  3AL0 B;  1TTY A;  4B3A A;  1WWX A;  4IRH A;  4U88 A;  1T08 B;  3DU5 A;  2FA5 A;  3VOE A;  3S8P A;  3V42 A;  4CCL A;  5M5W J;  2HNH A;  2QWW A;  2W00 A;  4DBQ A;  2EA4 A;  5DM7 F;  4PSW A;  4MTE A;  1B72 B;  1HOM A;  5H20 A;  3PL8 A;  3IWZ A;  1RKW A;  3ZXS A;  5EG0 B;  1FMW A;  1TWH J;  1HLV A;  2XKP A;  3ONQ A;  1WJA A;  2FXA A;  4G6T B;  2DMQ A;  4D5C A;  4OOI A;  3EUA A;  3GBG A;  1N78 A;  4HQE A;  3REO A;  3BR5 A;  3HOV J;  1G3T A;  5IP7 J;  1R00 A;  2VLA A;  1JT0 A;  3WTZ A;  2HQA A;  2M8E A;  2VAS A;  1DPU A;  2DFI A;  3QPS A;  3L2U A;  3A01 A;  1ZG3 A;  5J8F A;  3E7L A;  2F5D A;  2QZ8 A;  4ZH4 F;  4QWQ A;  2NVQ J;  4DYC A;  1XSX A;  2BY0 A;  3GO5 A;  3AAF A;  2DJI A;  3IAM 2;  5KHD A;  2HDW A;  3OOP A;  1TC3 C;  3ABK H;  3DPU A;  3M8F A;  2CYY A;  4BEH B;  4FQG A;  3O8H A;  1WJD A;  2OBP A;  4XSZ F;  1V4R A;  2CH0 A;  2XSJ C;  1ETW A;  1Q1V A;  2HGC A;  2XB0 X;  2BGC A;  2XKO A;  1Z77 A;  1HSJ A;  4JX5 A;  3W2V A;  4HA8 A;  4E7K A;  2NVT J;  3J7Z I;  2QGU A;  2FF4 A;  2I5U A;  5M5Y J;  3GTG J;  4CYD A;  1WSU A;  3GTL J;  2EV5 A;  2IA1 A;  1MW7 A;  1LFB A;  3H3V K;  1X4O A;  3FMR A;  1R5G A;  3FDY A;  4BE0 A;  4GCV A;  1SMY F;  3S1R J;  4HNT A;  1SFK A;  1X58 A;  3W6K B;  2LSO A;  5BOX A;  1Z05 A;  4S04 A;  2IXS A;  3PO2 J;  2EPF A;  3FKI J;  1U8B A;  1IXR C;  1MZB A;  3HZJ A;  4AYB A;  3KEY A;  1ZAO A;  3M07 A;  3DEU A;  4BAC A;  4C30 A;  3ZQQ A;  1R4N B;  3GZ5 A;  2XF5 A;  5HDN A;  2FML A;  2AXL A;  4HLY A;  2DTR A;  3LSK A;  4G9Y A;  4FAS D;  4AYB N;  1MBE A;  3BTI A;  3G1L A;  4CSW A;  1W36 D;  2L7Z A;  1VQO I;  1P92 A;  3F23 A;  4IHY A;  1AKH B;  4CCM A;  2Z3Y A;  1R5I D;  2PG4 A;  4IEJ A;  5JVT A;  2F5E A;  1PDN C;  1T33 A;  2EH3 A;  5ED4 A;  5HNF A;  4F91 B;  4W1U A;  2IJL A;  2NVX J;  4ZTF A;  2AXT C;  3M8J A;  5HS7 A;  4XN3 A;  1X3W B;  2P5K A;  2FJ1 A;  1HXD A;  2Y69 H;  1LDD A;  2FOW A;  2JUG A;  4XID A;  1LEB A;  3WGH A;  3IL2 A;  1YHQ I;  3S17 J;  1FEX A;  2VJ4 A;  2CV2 A;  4X1E A;  2P0W A;  3QU6 A;  4N4N B;  1U6G A;  1X3U A;  3OL4 A;  3QRF F;  1XGO A;  4RAF A;  2W84 A;  2CUE A;  2R5Z B;  1XB4 A;  3HIF A;  2ZO4 A;  1Z6R A;  2STT A;  1DUX C;  4I09 A;  3TDU C;  1NHA A;  1L3L A;  4NC7 A;  4OMY A;  2I8D A;  2HYG D;  3PQK A;  4IO9 F;  1MSE C;  2MGQ A;  2HOS A;  1P4X A;  2M9H A;  1Y8Q B;  1NK2 P;  2K4J A;  4MNU A;  3H3U A;  4P5O A;  5DM6 F;  2IEK A;  1YIO A;  1I50 J;  5ILU A;  4X6A J;  2Y9Y A;  2LKS A;  3CJR B;  2NAZ A;  3CF5 F;  1Z0X A;  4KUM A;  3BJA A;  2KLO A;  3K4J A;  2GXA A;  4Q47 A;  4UB8 C;  3GYH X;  2DK8 A;  1B9N A;  2ZFW A;  4HOB A;  3TW7 A;  1PUF A;  1HQC A;  3B02 A;  3BTL A;  5K7H A;  1G4D A;  4E7J A;  3KP3 A;  1GV2 A;  3AG2 H;  1FBS A;  2BEO A;  1DDN A;  1TQI A;  2K9Q A;  2KQR A;  3MD2 A;  3W6J B;  3RQ4 A;  4HNU A;  5J4V A;  2RAE A;  2DPD A;  1KGS A;  2PI0 A;  3RJP A;  2EBI A;  2FE3 A;  1D1C A;  4A6E A;  1PP7 U;  1FWZ A;  2ZB9 A;  4ZYE A;  1I6X A;  1P7J A;  3CCV I;  3WG7 H;  2QEX I;  3ZMS A;  1YJN I;  2KRH A;  3G3Z A;  3CUQ C;  3GFI A;  1IN8 A;  5DD8 A;  5DV5 A;  5LHG A;  1H88 C;  1FIA A;  3CUQ A;  3K2Z A;  5KAI C;  2EZH A;  3DQV C;  5E1W A;  2KHM A;  4NDL A;  4XM3 A;  1C0W A;  3V7R A;  4ZDL A;  1BOB A;  2LDU A;  2Q2E A;  3PM1 A;  3OYM A;  3ZQC A;  2Y30 A;  4NC8 A;  3BC8 A;  4D9J A;  1BW5 A;  4TV7 A;  2DO7 A;  4LB5 A;  2UUZ A;  2BZT A;  3HSE A;  2IGN A;  4F3Q A;  3S2H J;  1B4A A;  2CMP A;  2F48 A;  4KMF A;  2X9D A;  2W1O A;  4K2E A;  3ZQG A;  1Z7U A;  4ZZD A;  3DU6 A;  4R8H A;  3B73 A;  2XF7 A;  3P9K A;  3BG6 A;  3HG9 A;  2FQ4 A;  2OCE A;  3TOA A;  5F1R A;  1SAX A;  2E1O A;  2K7L A;  1BBY A;  3EPZ A;  4UV8 A;  5ERI A;  2GZW A;  3ERM A;  2CU7 A;  2FU4 A;  2DFE A;  3OYE A;  3ECO A;  2LMD A;  3K9T A;  3G4S I;  1ON1 A;  1R71 A;  5LHI A;  1X1B A;  2A5Y B;  4B44 A;  4D5F A;  2HZT A;  4A3K J;  1JXS A;  3P9I A;  4HX4 A;  1P9Q C;  2DDB A;  2X85 A;  4ENK A;  5F08 A;  2E19 A;  2K9M A;  2WB1 N;  1ZAR A;  3Q5F A;  4OMZ A;  1E0E A;  1N25 A;  2HKO A;  4PUS A;  4LIU A;  3HRM A;  2HQN A;  3LQQ A;  2JUC A;  3DCF A;  3PQJ A;  2B9S A;  2A5W A;  2ECB A;  4AC0 A;  2E2J J;  1W1W E;  1W0T A;  3OMY A;  2EA2 A;  3A0H C;  4BY1 J;  2BHY A;  2CQN A;  3FBN B;  1NTC A;  3JSO A;  4FCY A;  5AON A;  2QF7 A;  3IAS 2;  3TQN A;  4MQ9 F;  4BJ6 C;  4P1W A;  3RIR A;  4L9N A;  3I71 A;  2VKH A;  4EMS A;  3GF2 A;  5EG0 A;  2XV4 S;  2WTE A;  2NNY A;  4GXO A;  5FD5 A;  1L0O C;  3CO6 C;  5BMZ A;  5H2F C;  3K1P A;  1QO0 D;  5B5E C;  2O0Y A;  3WE2 A;  3VSK A;  3FHZ A;  3FX3 A;  3SZP A;  3LAJ A;  3BG5 A;  5TIS C;  2E60 A;  1A6I A;  2W25 A;  1RI7 A;  3KEQ A;  2ETH A;  2CGP A;  5M5X J;  5EEH A;  2V79 A;  4U87 A;  4Y52 J;  1R7J A;  4IRG A;  5FGM A;  2A3S A;  2R93 J;  3S1N J;  4M3D A;  3I55 I;  3GX4 X;  3C2H A;  4IVN A;  2MD0 A;  3GWZ A;  3VB2 A;  3LA2 A;  5FKK A;  1AOY A;  1LB2 A;  4GRI A;  1BIA A;  4L18 B;  5GAG J;  4A5N A;  1R9T J;  4KJZ A;  3IKV A;  5J4Y A;  2IA0 A;  1MIJ A;  1YLF A;  3BLY A;  3HOX J;  1LPQ A;  1P4W A;  4QLC U;  1BOA A;  5FRN A;  2VL8 A;  5IP6 A;  1A36 A;  3JTG A;  1IG7 A;  3CDI A;  3OR2 C;  4AD9 A;  5E1Z B;  4CIC A;  2PX9 A;  1GLN A;  3BR0 A;  5J47 A;  4AVZ A;  4RA2 A;  1XC5 A;  3U9G A;  2MH2 A;  4A93 J;  3K1M A;  3CCL I;  1K78 B;  3PSF A;  3IH4 A;  3ESW B;  4EJO A;  2DFF A;  2Q0O A;  3LST A;  4HF0 A;  3LAP A;  1LFU P;  1W36 C;  1W5C C;  4PJN A;  3K1N A;  3DEW A;  5D4S A;  3JRG A;  3GW2 A;  3TMO A;  4BJT A;  3RYP A;  2L7M P;  2ZSH B;  2ACJ A;  2W48 A;  5CJ9 A;  1R49 A;  4V19 K;  2Z16 A;  3WE3 A;  2DOA A;  4L0Y B;  1I3Q J;  1S3J A;  5LEJ A;  2DQR A;  1OCT C;  3SQN A;  1HC8 A;  4BL0 B;  1YFH A;  2ZFU A;  3HPG A;  3BY6 A;  5F6F A;  2V1N A;  2A07 F;  2Z1D A;  1GT0 C;  3NAU A;  3QU3 A;  1J2X A;  2XF6 A;  4OIP F;  2ID6 A;  3EQL F;  3BG7 A;  4LIV A;  1GDT A;  5M3F J;  3D5R C;  2R7T A;  2R7W A;  3KP7 A;  2O61 A;  3KP2 A;  1BIB A;  1O3S A;  3HEF A;  2EZL A;  4Y7N J;  1Z6T A;  4OIO F;  1BN5 A;  1H8A C;  1CF7 B;  2XAU A;  3J7Y J;  1RRJ A;  2JVH A;  4P9U A;  2V6C A;  2HWV A;  4EGY A;  5EJC A;  2JA6 J;  3S3N A;  3WU2 C;  4MTD A;  2ZME A;  1IDZ A;  1IO2 A;  1IUF A;  2YU3 A;  2L7F P;  3BPX A;  3KFW X;  4XR6 A;  2H1K A;  1SD4 A;  4GYG A;  3OYA A;  2L4A A;  1U8R A;  3GCM A;  3TW6 A;  1GUU A;  1UST A;  1P4A A;  1U9N A;  3HBL A;  1MSF C;  2ZKZ A;  3R0J A;  1X3Z B;  1J0R A;  2FOK A;  4DNC A;  1NG7 A;  3K10 A;  1KZH A;  1MDM B;  2VPL A;  2QQA A;  2RN7 A;  1UEL B;  2VBY A;  5BNG A;  2XVC A;  1FYL A;  4OAY A;  1T2K A;  4XRM A;  3TP0 A;  5D8L B;  2R5Z A;  2LF8 A;  1IZ1 A;  1X1C A;  5ILS A;  2G0E A;  2HOA A;  3ZQH A;  5F0H A;  3PNV A;  4V2G A;  2PMZ N;  2GBY A;  3O8G A;  3CMA I;  4LFU A;  3S93 A;  5IYB J;  4WF2 A;  1D5V A;  5LLQ A;  4HNV A;  4CA0 A;  3EYI A;  1BI2 A;  2XIG A;  4N4O B;  1FLI A;  2V4J C;  2H09 A;  5BQT A;  2JA7 J;  2MA3 A;  1TP4 A;  2NS7 A;  3E6D A;  3TO6 A;  4XIC A;  2MSY A;  3Q9S A;  1VQM I;  2H8R A;  2KIS A;  3RYR A;  3F6O A;  2X4H A;  1HW1 A;  2O6G E;  3ZQF A;  1MBJ A;  3A4C A;  2LY2 A;  2ZXH A;  3JAM Z;  3OYN A;  2OF7 A;  4CUG A;  1FIP A;  3I56 I;  3BZK A;  2JN6 A;  1Q1H A;  4I98 B;  2H6B A;  2CUF A;  2DAO A;  2EFO A;  3ZQ7 A;  5C44 J;  1JKR C;  6PAX A;  1FSH A;  4ANJ A;  4D7N A;  1E2X A;  5F1J A;  2R7F A;  4KIB A;  1XTA A;  1R5H A;  1K6O A;  3E1S A;  1PYV A;  2CUZ A;  3RKX A;  2QA4 I;  2OZ6 A;  1IN6 A;  1TWA J;  2JVG A;  1K4S A;  3I3L A;  2VUM J;  5IT9 Z;  1ETX A;  2X1D A;  3LA7 A;  3L9F A;  5H6Q A;  5GTH C;  1TWG J;  2LFB A;  3LSJ A;  2IT0 A;  5HOD A;  1Y0U A;  5D5V B;  5BS6 A;  2N8G A;  3GTJ J;  3BT9 A;  3CCE I;  2OTJ I;  1WJF A;  2AO9 A;  1F1Z A;  4NNJ A;  3K7A J;  2A6H F;  3LSH A;  3C1D A;  4RB3 C;  2X48 A;  2XAS A;  3ABU A;  1U78 A;  3VSL A;  2LG4 A;  2L02 A;  5GAE J;  3PIO F;  3HOZ J;  3CJT B;  4PFO A;  1J59 A;  4C3J J;  2HOT A;  2R0Q C;  1ZG5 A;  2CV1 A;  2ELK A;  4AIK A;  4NQW B;  3KP4 A;  3WTX C;  2R7D A;  2RDP A;  2XUB A;  4PJJ A;  3MEX A;  4EJU A;  1X2M A;  1FTT A;  1WJE A;  2HFH A;  2E36 A;  4EV0 A;  4ZYD A;  1GV5 A;  4ENJ A;  3L09 A;  2K40 A;  3TGN A;  3ISP A;  3TL4 X;  1T0F A;  5HVQ C;  3CO7 C;  2MC3 A;  3OYF A;  2DMU A;  2WY7 Q;  3FZV A;  4JP0 A;  1MMS A;  1T39 A;  3VYR B;  1AU7 A;  1R22 A;  3MKZ A;  1UMQ A;  2VQL A;  1T98 A;  2MBF A;  2VBX A;  3DKX A;  3HM5 A;  4HYE A;  2F2E A;  5EGO A;  1WH5 A;  1IRX A;  3MVP A;  1E17 A;  5IT9 K;  3FMQ A;  1XSD A;  4EM1 A;  4E4H A;  4M72 A;  2LTP A;  2GOX B;  2B63 J;  2LD5 A;  4YFK F;  2FEZ A;  3Q0V A;  4DIQ A;  1Y6I A;  2JA2 A;  4D7M A;  4UUS B;  1A5J A;  2RC4 A;  1X1D A;  3V8J A;  3S1Q J;  2DOE A;  4HBL A;  1EH8 A;  3MN2 A;  3F8N A;  3SEQ A;  1MH4 A;  3DBH B;  1ZRE A;  3H92 A;  2DMN A;  3D5L A;  3O3K A;  4NC6 A;  1PP8 F;  1Z3Y A;  1N75 A;  3T8T A;  4PGG A;  2BOL A;  5TGT A;  4A3J J;  3OV8 A;  3FK7 A;  2DBB A;  4FHT A;  2W24 A;  2L01 A;  4RAY A;  1D0X A;  4M3B A;  3OIO A;  1D8J A;  1USS A;  3CME I;  1MMN A;  2A68 F;  4P9F A;  4CO8 A;  4U0Y A;  1MNE A;  1GVJ A;  1ONV A;  3OOU A;  3CD6 I;  3MCZ A;  5JVG F;  1KQ0 A;  1WH7 A;  1YX3 A;  3CJN A;  3IP4 B;  2HYF A;  4N9H A;  3FXK A;  4I0B A;  4N0B A;  5KCM A;  4NHJ A;  2FMY A;  4PFP A;  3LNQ A;  1YTY A;  2QSF X;  1BR1 A;  2P6S A;  3AG4 H;  2G9W A;  4RAZ A;  3CCU I;  1NK3 P;  3OYB A;  3OYK A;  2Y2Z A;  5FFZ A;  1LE8 B;  2PFB A;  4RGU A;  4II3 A;  5K7Z A;  2EK5 A;  4PSX A;  3WTS C;  1VND A;  4W97 A;  2BY2 A;  4HAM A;  2WAQ A;  1FOY A;  2MD5 A;  3GEZ A;  3ZP5 A;  1POG A;  1K78 A;  3KPH A;  5E8I A;  1I3A A;  4RAG A;  2VT3 A;  2JMW A;  4UHT A;  3BJO A;  1YRN B;  4N9I A;  4M3E A;  4DOZ A;  1IXC A;  5DTD A;  3NWT A;  2IGM A;  4I76 A;  3MFK A;  4Y15 A;  2E2H J;  2DQL A;  4IXA A;  2XAJ A;  3WTT C;  4QPQ A;  2GA2 A;  4UB6 C;  2L2O A;  5F0C A;  3JCU C;  1X4P A;  2AS5 F;  2YS9 A;  3VEP A;  3QOD A;  4WXD A;  4E6K G;  5FLM J;  2W57 A;  4A69 C;  5LGU A;  2PEX A;  3IC7 A;  1N77 A;  1VQK I;  1FOW A;  3ASN H;  1WRJ A;  4BBR J;  4M6Y A;  1FYK A;  1MBH A;  3F8M A;  2IA2 A;  2W85 A;  4WWC A;  1YJW I;  4LIT A;  3CCY A;  3JRB A;  1UHS A;  3R0A A;  1O3R A;  2O8K A;  3NAR A;  4ZC3 A;  4C2U A;  2BW3 B;  1K79 A;  1FOX A;  2HEO A;  3O2P E;  1OCC H;  2O3F A;  1LFP A;  4ASN A;  2GQQ A;  2K9S A;  2QKL B;  1CF7 A;  2CSO A;  3HUG B;  3QOE A;  4AVP A;  4BS9 A;  3ABL H;  2CFX A;  1QBJ A;  1QRY A;  3WHC A;  3DKW A;  2E1C A;  4IF4 A;  2YSR A;  4IHX A;  2R7S A;  2AQF A;  1TNT A;  5BPD A;  4A3F J;  2V1U A;  2P8T A;  4B1R A;  4CZZ A;  5B3S H;  1HKS A;  3KE2 A;  2R4G A;  1HW5 A;  1I27 A;  3FIW A;  4EJW A;  3G2B A;  4BGD A;  2ZNZ A;  3WTW C;  4MLO A;  1A35 A;  2X6O A;  2ME0 A;  2BY3 A;  2E5Z A;  3HGG A;  3ASO H;  4WX9 A;  1Y56 A;  1MDM A;  4IQ4 A;  1D5Y A;  4KDP A;  2XGD A;  1VQL I;  2HR3 A;  3M1C A;  3BG3 A;  3ZRG A;  2DJN A;  4HV5 A;  3LSP A;  1O7L A;  1EH6 A;  1CQT A;  4HST A;  3L1P A;  2BV6 A;  4FE7 A;  1LVK A;  4CYC A;  5FKL A;  2LKP A;  3D0S A;  5FJ8 J;  5FKO A;  3RSN A;  4F55 A;  4Z6Y A;  3AFH A;  2KDZ A;  3PJR A;  4E7Z A;  1FTZ A;  5K1Y A;  1YO5 C;  3MMY B;  4B09 A;  2Y9Z A;  2XAG A;  3WHB A;  4UUV A;  1EA3 A;  3DBR B;  4JYK A;  3N4M A;  1ORK A;  2P81 A;  1V55 H;  1T56 A;  3S3O A;  2EFW A;  5L3C A;  1FY7 A;  2KL4 A;  1TW3 A;  3DFG A;  1UB9 A;  2E5N A;  4LMY A;  3HOY J;  2JA5 J;  3OYJ A;  1B8I B;  4RB0 A;  3SZG A;  3A2K A;  2JRT A;  4F7Z A;  3DEE A;  3R61 A;  2BE5 F;  4PZJ A;  5L3E A;  3OYC A;  4LD5 A;  1ZRC A;  3GXO A;  4MEX F;  4CCN A;  3G6E I;  5LD2 C;  3OS2 A;  2WA0 A;  4RS8 A;  4A3M J;  2DYR H;  2DYS H;  2R92 J;  2RGV A;  2DA7 A;  4F52 A;  5HOO A;  3L7W A;  3DPT A;  1IAW A;  2WY8 Q;  4KT5 C;  3C2G A;  2L54 A;  2TCT A;  3ZMZ A;  1KON A;  2KIM A;  1JHF A;  4A3D J;  2KT0 A;  4WCG A;  3HDD A;  2NRA C;  3EYY A;  4YFN F;  5C4J J;  1XX5 A;  2VOO A;  2VKE A;  3BG9 A;  1RNL A;  3K69 A;  4LB6 B;  2YUS A;  2X51 A;  4EM0 B;  4Z2Y A;  1OQY A;  1MJ9 A;  1Z9C A;  1O3Q A;  3FBI B;  2A6T A;  1ZLJ A;  2K9L A;  1QZZ A;  4BUP A;  1RUO A;  2P4W A;  3A03 A;  4B43 A;  2V9P A;  3X2Q H;  3SEZ A;  1WJB A;  3H9Q A;  3MKW B;  2YR2 A;  4CCJ A;  2PN6 A;  3Q0W A;  1F5T A;  1ERD A;  2HVQ A;  1ZLK A;  4HLX A;  3V7S A;  1WZ2 A;  4DYQ A;  4D0P A;  2F4O B;  3KP6 A;  3GZ6 A;  3WOD F;  4ENN A;  2H94 A;  1OYY A;  4H0E A;  2P7C B;  2HVR A;  4UXN A;  5J8C A;  4ETS A;  1RET A;  5FLX Z;  1BI3 A;  2M8G X;  4YRV A;  1VTN C;  2XRO A;  1WJC A;  2OQG A;  5IYD J;  4UVA A;  2D5V A;  1RIO H;  4HX8 A;  1PUE E;  2JZY A;  3ROU A;  1DPR A;  1SFO J;  3R60 A;  2VON A;  3T1B A;  1SFU A;  1PJR A;  4GGG A;  2LRE A;  3OIQ A;  3HSF A;  1ZGJ A;  3ZMV A;  2B0L A;  4A3G J;  1E3H A;  4BXF A;  1IV8 A;  1OIS A;  5DYM A;  3HKZ A;  5E8G A;  5GAH J;  2NVU B;  1U9O A;  5IY5 H;  1ETQ A;  2RQQ A;  4WXH A;  4J00 A;  1KU9 A;  1RR7 A;  2DU9 A;  1OMI A;  3DBL B;  3K4L A;  3JRH A;  3HKZ N;  2PMU A;  3ERE D;  2IVM A;  3M4O J;  2EIK H;  3Q0U A;  1GVD A;  3GLX A;  2HS5 A;  1QZY A;  2R7O A;  3PSI A;  2HU9 A;  1UG0 A;  5HS9 A;  2QYO A;  1V5E A;  4RGX A;  4Y4R A;  2CV0 A;  3FXJ A;  5FFX A;  1JKP C;  5E1X A;  1ETK A;  2VOD A;  4JOM A;  5B1A H;  4AU7 A;  5TRD A;  1ITY A;  1P2F A;  4E7L A;  4MGR A;  2IGO A;  1ZR2 A;  3B6A A;  4HW0 A;  4BQO A;  4ZTJ A;  2E1N A;  1VQ8 I;  4OWR B;  5IP9 J;  4RDU A;  2FRH A;  3JTH A;  2DTZ A;  4QTR A;  2VE8 A;  2DFH A;  4B3X A;  5GPC A;  5CQG A;  5FO5 A;  3HOS A;  2E2I J;  1S29 A;  2JQ7 A;  2LR8 A;  2LRD A;  2IRF G;  1ZKG A;  2NNN A;  3WTV C;  4IPA A;  1MH3 A;  1R36 A;  2ECC A;  4YIR X;  3OWT A;  1Y1W J;  3BWG A;  3K70 C;  2D2W A;  3FKJ A;  1TQP A;  2GM4 A;  4G8X A;  3JW4 A;  2LBF B;  4HEA 2;  1DGR M;  3AKZ A;  4CCK A;  4D1Q A;  3JRI A;  2PLY A;  4XQF A;  1S6L A;  3I64 A;  2A05 A;  2IBD A;  4J01 A;  1SVM A;  1JUS A;  3D5S C;  5LGT A;  2VOP A;  5F04 A;  4JBA A;  4EQQ A;  5KNL A;  4M9X A;  1B72 A;  1Y8R B;  4RMN A;  4U0V A;  4E7S A;  3EUK L;  5HS8 A;  2KZV A;  5F64 A;  5E18 F;  3CCQ I;  2JT1 A;  2EFP A;  4XRF A;  3DPL C;  3LMM A;  4YEJ A;  4DGW B;  1LE8 A;  3M3Y J;  3GTP J;  2IAI A;  3K6G A;  2M2E A;  2QCO A;  3H5N A;  4XLC A;  1QPM A;  3S15 J;  5IOZ A;  2HXI A;  2MLK A;  3QQA A;  4IOA F;  4GO1 A;  1RR8 C;  1WHU A;  4PCQ A;  5L3D A;  1SFX A;  3C2B A;  3CF2 A;  3GTK J;  3GUD A;  5CVU A;  4RB1 A;  1SFE A;  3W2W A;  2RNG A;  1YRN A;  2Z5U A;  2LC2 A;  2DI3 A;  4AUX A;  2OCC H;  2GOM A;  1YYV A;  4OAZ A;  4LG3 A;  2VT2 A;  4GYI A;  2X1E A;  3OS1 A;  3C18 A;  4L9J A;  3FF5 A;  4LLL A;  4IHW A;  5K5Q A;  3ZMT A;  9ANT A;  1MJA A;  1MMG A;  1FBQ A;  2UXN A;  2JK3 A;  2WC2 A;  1K6Y A;  2DT5 A;  2L5Q A;  2LKX A;  4BEH A;  4U7D A;  1IJW C;  4RGR A;  2E1M B;  4I99 C;  2JTV A;  1IC8 A;  1X2N A;  3LQR A;  2ISY A;  2Z2S B;  1S8N A;  3RQI A;  2OA4 A;  2CWE A;  3V8K A;  3BCB A;  1JKQ C;  2X0L A;  4L9T A;  4RB2 C;  3CZ6 A;  1Y0N A;  1K83 J;  4O6J A;  3G71 I;  2Z9O A;  2R7Z J;  3MWM A;  2HTS A;  4CGZ A;  3ML6 A;  3HUG A;  5GP9 A;  4OIN F;  1TW2 A;  2VQG A;  1ZGA A;  4EEF G;  1R1U A;  2F4I A;  2V6E A;  3K4M A;  3HGY A;  1DGW Y;  1LVA A;  1MKM A;  1ACI A;  2V1X A;  3BQY A;  2PBI A;  3E6C C;  1F43 A;  3MZH A;  4UNO A;  4AM3 A;  1D1B A;  4I01 A;  4XRS G;  2JSC A;  3OR1 C;  4BXX J;  3MZ8 A;  3H35 A;  2OC6 A;  1YS7 A;  4XKV A;  4ZYH A;  1UZC A;  2ICW G;  3OYI A;  3RPU D;  1BR4 A;  1YW9 A;  2H6C A;  2BHZ A;  2CW8 A;  2OV7 A;  4M6V A;  3JSP A;  1J5Y A;  3EUH C;  2ELH A;  3H5A A;  2HDD A;  2BVM A;  1MBG A;  5J40 A;  4M9Z A;  3I4N J;  3EUH A;  1FBU A;  1EJ9 A;  1J09 A;  3A02 A;  3A01 B;  3HC7 A;  3BR1 A;  1W5S A;  3E6B A;  4P55 A;  3VYT B;  3SZT A;  3RPQ A;  2GIV A;  2R7X A;  1HA8 A;  1HF0 A;  1OCR H;  2EWN A;  4I7H A;  3L2R A;  5HLI A;  3L2V A;  3TED A;  1AKH A;  1X19 A;  4CCO A;  4HSR A;  2L9V A;  4A3E J;  2CQK A;  3W3C A;  1ZHF A;  2AQE A;  2J5P A;  2ZXJ A;  1W7P B;  4V2F A;  4RBO A;  1W5T A;  3J80 Z;  1XGM A;  4FTH A;  3FXQ A;  4IZZ A;  3ECH A;  3RTR A;  1P6R A;  4C2T A;  2LLK A;  2PJP A;  5E17 F;  4BQN A;  2Y31 A;  1FZP B;  1G2H A;  4PGH A;  3TP3 A;  1Z1D A;  2VE9 A;  2RQP A;  1B8I A;  3FWE A;  3I9V 2;  4DYR A;  3F9K A;  1UCR A;  1W7P D;  2QSG X;  1OR7 C;  1OJL A;  1FC3 A;  3HJE A;  1VQ4 I;  2GXB A;  1R6R A;  3ZGK A;  5K5O A;  2QBY B;  1FSE A;  1Y1V J;  3KYL A;  1SAN A;  2HXO A;  1V5G A;  4J19 A;  2QEN A;  2Y0S A;  2L7K A;  2ZNY A;  3Q3S A;  4G94 A;  4MIM A;  4XOP A;  5J3L A;  1G3S A;  2DMT A;  2PMH A;  3VDX A;  1QVU A;  3M1E A;  2LH9 A;  2W82 A;  1S7E A;  1TT5 B;  3IH3 A;  2WV0 A;  2Y0S N;  3QPL A;  1XS9 A;  3BJ6 A;  5L3B A;  1K61 A;  4M73 A;  2GLO A;  2VJJ A;  3OSG A;  1I5Z A;  4JX4 A;  1K4T A;  1BI1 A;  2K4B A;  4M71 A;  1MMA A;  4EVI A;  1GXQ A;  2EV0 A;  3PNT A;  4HG2 A;  3SDG A;  5LRS A;  2CQX A;  1RUN A;  3J80 K;  2QUF A;  4BDY A;  1G6N A;  2HQR A;  1IXS B;  2F5F A;  2CW0 F;  3LSI A;  1FNN A;  3F72 A;  2R3S A;  2HZD A;  1D3Y A;  4ZZL A;  3K4C A;  2DA6 A;  1VF9 A;  1UHW A;  4KT6 A;  1VQ7 I;  5LRR A;  2LNB A;  2P5L C;  4LLG F;  5E3M A;  3G1O A;  3J81 Z;  1WJ5 A;  1ETV A;  5DDG A;  4MO7 A;  3KLN A;  3H3Z A;  3QYE A;  2M7B A;  4BYY A;  2GXG A;  5GTI C;  2XB5 A;  2CS3 A;  4XLE A;  4U7B A;  1HBX G;  1QPI A;  2H27 A;  1BJA A;  1YS6 A;  2Y48 A;  3Q9V A;  1F36 A;  1TWF J;  4ITV A;  4A3B J;  1MD0 A;  3P9C A;  3BR2 A;  1IN7 A;  2C6Y A;  2RKH A;  1BC7 C;  1OYW A;  1I1G A;  2OD5 A;  3OS0 A;  1OPC A;  1BR2 A;  1VZ0 A;  3H1C A;  3HPH A;  2ZJ2 A;  4G12 A;  5JLX A;  2OJE D;  1FJL A;  2VB6 A;  5HDK A;  2VQC A;  1SC7 A;  4ESJ A;  1QHH D;  2NS8 A;  2YPR A;  4OIR F;  1ENH A;  1VQ9 I;  2VPR A;  4IHV A;  3I5U A;  2LVS A;  3TBI A;  3DF8 A;  1J7K A;  2F6C A;  4P96 A;  3JAM K;  3DWL E;  5FKM A;  1WKM A;  3RDI A;  2WWY A;  2IS1 A;  5TJJ A;  3SFI A;  4XLP F;  4C3I J;  1I6H J;  3KLO A;  1FX7 A;  4PJL A;  1JUP A;  4PK4 A;  3H0D A;  3CCM I;  1E3P A;  5D4R A;  1F4K A;  2DMP A;  2O8X A;  1KYW A;  4BBS J;  5IPA A;  4GFB A;  4AIJ A;  2DA3 A;  1KU2 A;  4GDF A;  5KVR A;  1OCO H;  3LOC A;  3VPR A;  2E34 A;  1P7I A;  1DP7 P;  1A6Q A;  5E3N A;  2DW4 A;  1G8X A; 
#chains in the Genus database with same CATH homology
 1KQ8 A;  4Q48 A;  1XDS A;  4R79 A;  2J5O A;  4KIF A;  3F8B A;  3M8E A;  3O6B B;  3E6M A;  5CVJ A;  3CDH A;  4JK1 X;  5CVV A;  4XSX F;  2G7H A;  1B9M A;  1V3F A;  3KET A;  4M6X A;  3GFL A;  2Q8K A;  2K02 A;  5LHH A;  2Y0M A;  1SD5 A;  4YFX F;  3GFM A;  1U5T B;  5CVR A;  1ZN2 A;  4XLN F;  5K5R A;  1S7O A;  1REP C;  3KP5 A;  4UVC A;  5D5X B;  4HQM A;  1D8K A;  5J6X A;  2OU2 A;  2ISZ A;  2GAU A;  2KIU A;  4XBF A;  3F8C A;  3WGI A;  1LEA A;  2DK5 A;  1STZ A;  3HRS A;  5JR3 A;  3KEO A;  1QGP A;  3TKY A;  2Z99 A;  3V7C A;  2M45 A;  2XAF A;  4MQV A;  3IWF A;  1XD7 A;  4LGW A;  3RPU A;  4IHS A;  2ESN A;  2KIF A;  3ZMD A;  3HTS B;  1YQA A;  3FM5 A;  4BXU A;  2M5W A;  4O5V A;  5D8K B;  1WQ2 A;  1IUY A;  4KMU X;  4LK1 F;  5KK1 A;  3T5X A;  5BPI A;  1U2W A;  2IW5 A;  2V9V A;  3HHH A;  4BHB A;  2OZU A;  1R1T A;  2D1V A;  2XGX A;  4LG0 B;  1G3Y A;  4BHC A;  2VBW A;  1B6A A;  1W7P A;  4OU0 A;  3DV8 A;  3E97 A;  1JE8 A;  5HLH A;  4EGZ A;  4IHT A;  4S05 A;  1IW7 F;  3NEU A;  4IJA A;  3I53 A;  2STW A;  2DPU A;  3E5X A;  3KCC A;  4LK0 F;  1H0M A;  1IRG A;  1H9G A;  1YW7 A;  2M30 A;  1AWC A;  3WTU C;  1EV7 A;  3WU0 A;  1GHC A;  1GXP A;  2A61 A;  3I59 B;  5DUK A;  2QBY A;  2HOE A;  3EDP A;  1A04 A;  5JI6 A;  2O03 A;  1SD6 A;  1XCV A;  3G73 A;  4WXC A;  1ZG1 A;  2PQ8 A;  4KA4 A;  1HKT A;  3I58 A;  5ILV A;  2FNA A;  3HHG A;  4L5I A;  3ZN1 A;  2TDX A;  1UHM A;  2KJB A;  3I54 A;  4HDU A;  2NYX A;  5EEG A;  4NB5 A;  1W4M A;  4KIG A;  3KZZ A;  4LJZ F;  2UWM A;  2ZME B;  2EFN A;  3RKY A;  5L3F A;  5AIQ A;  3NRV A;  4ESB A;  3LA3 A;  2K86 A;  2D45 A;  4KYW A;  4AWX B;  1KYZ A;  1TQM A;  1R58 A;  4U0W A;  3LWF A;  1R1V A;  3HRT A;  1T38 A;  3C7J A;  3BPV A;  2JPC A;  4Q4Z F;  1ZRD A;  3FM3 A;  1O7F A;  1IRF A;  4FT8 A;  1I1S A;  1XMK A;  3IKT A;  3BRO A;  3E5Q A;  3QPT A;  4EJV A;  2L4M A;  4Y17 A;  1RZ4 A;  3SHF A;  2VC0 A;  3ZN0 A;  3VOD A;  4B8X A;  1LDK B;  3RI4 A;  5CVI A;  4NQW A;  3M7G A;  2EJR A;  2G7U A;  3TO7 A;  1FP1 D;  3F6V A;  1JGS A;  1K7A A;  4O3M A;  5DCM B;  3L2C A;  4BH9 A;  4ENM A;  3FXR A;  3E3V A;  4WK8 F;  2QQB A;  3BOQ A;  1LNW A;  2K27 A;  3J7A O;  1XGS A;  4CHU A;  5LGN A;  3MZY A;  1FP2 A;  1XMA A;  4A0Z A;  4M74 A;  2QQ9 A;  3E5U A;  4ESF A;  4YIF A;  1ON2 A;  4FX4 A;  2XHK A;  2OQR A;  1F9N A;  1J9I A;  5A2Q Z;  5CYV A;  1U5T C;  4A6D A;  3GFJ A;  1U5T A;  1FT9 A;  4KN4 X;  2KKO A;  3COA C;  4G7Z F;  3EET A;  5FLX K;  5LEK A;  3U2R A;  1KQ9 A;  1B59 A;  1SD7 A;  4I0A A;  1O3T A;  1BM9 A;  4AIH A;  1EH7 A;  4HV6 A;  2FBH A;  5FB2 A;  2LF7 A;  1ULY A;  3MAJ A;  5DCF A;  3F3X A;  2FBK A;  2VC1 A;  4YII A;  5JHU A;  1CGP A;  3DP7 A;  2F5C A;  3FXU A;  2E7W A;  2JPB A;  1HST A;  2Z33 A;  3SFZ A;  3CTA A;  3P7N A;  2CO5 A;  2QLZ A;  1BC8 C;  4BHP A;  1ZYR F;  3ZMU A;  5A2Q K;  4PDK A;  2RVC A;  1XN7 A;  1TNS A;  3I4P A;  4HF2 A;  3C3W A;  3F8F A;  3T0Y A;  3IRQ A;  4HDV A;  5D5W B;  3BZ6 A;  3QOP A;  4UV9 A;  2D1H A;  4Y13 A;  2ESH A;  3WG9 A;  4HX7 A;  1OYI A;  3LFK A;  3CUO A;  4LG0 A;  4G6Q A;  5L3G A;  4KIC A;  2IP2 A;  2MLG A;  3BDD A;  4HZF A;  1H9T A;  2BBY A;  2M1B A;  2HKX A;  4DQ2 A;  3IRR A;  4CXF A;  4L9V A;  3U1D A;  2P7V B;  2OAZ A;  4I02 A;  2P6T A;  1T6S A;  4FX0 A;  5HDG A;  4L5J A;  5D6E A;  4BNC A;  1XDU A;  5D5U B;  3ZPL A;  4KFC A;  3K0L A;  3V8L A;  3I59 A;  5HLG A;  2KRF A;  1ZRF A;  3HTU A;  2A6E F;  3BP8 A;  2EFQ A;  4L0Z B;  5LBQ A;  2DLL A;  4RGS A;  3WU1 B;  1TLH B;  5ICF A;  3N97 A;  4M9S A;  3QPH A;  3S2W A;  3SXY A;  2COM A;  3TOB A;  1R23 A;  1QQI A;  2VXZ A;  1FPQ A;  2HDC A;  4G7H F;  5ICC A;  4A0Y A;  2MH9 A;  4HF1 A;  5D6F A;  1OR7 A;  5DUI A;  5E20 A;  4A5M A;  2EV6 A;  2UXX A;  2YX4 A;  4OIQ F;  3TDZ C;  1KU7 A;  1YG2 A;  2A69 F;  3GVA A;  3F21 A;  1B1B A;  3F22 A;  3WGG A;  2VBZ A;  3R6S A;  3FMS A;  3I0T A;  4KNY A;  2M87 A;  4LLN A;  3T8R A;  4G7O F;  2EB7 A;  4MHG A;  1O57 A;  4G6D A;  2E7X A;  2NS0 A;  2XRN A;  3WTY C;  3MQ0 A;  4I2O A;  1QNT A;  1SMT A;  2YX7 A;  4EJT A;  3DXJ F;  3RKW A;  1ODD A;  1XGN A;  2CG4 A;  2BYV E;  1U3E M;  1MGT A;  5DCM A;  4E70 A;  4JQF A;  1XCB A;  2P5V A;  1IN4 A;  3R4K A;  2RNJ A;  3VFZ A;  5IT3 A;  4YG2 F;  4KN7 X;  1ZH5 A;  1HKQ A;  5ICG A;  3TO9 A;  1J75 A;  2ZCW A;  5AIP A;  2HTJ A;  1TBX A;  3NQO A;  2QVO A;  3ELK A;  2L3D A;  2VN2 A;  1G3W A;  3QAH A;  2UZK A;  2FSW A;  5DEQ A;  1MJB A;  5H6R A;  1KA8 A;  2XAQ A;  1LDJ A;  3J81 K;  5JFR A;  4ZYG A;  1HW2 A;  2ZBK A;  2GWR A;  2FBI A;  4Q5S F;  3HRU A;  2FQ3 A;  2V1D A;  4A12 A;  5CLS A;  3HYI A;  5DD4 A;  1XSV A;  3CUQ B;  1YW8 A;  2FNP A;  3CLO A;  4BAY A;  1LQ1 A;  2KJC A;  1FOK A;  4ON0 A;  3PFI A;  4UVB A;  4MEY F;  3QP5 A;  3L00 A;  3HOT A;  3KZY A;  1JHH A;  3QP6 A;  3ABT A;  2ADU A;  1FYM A;  1BI0 A;  4BQA A;  4A0X A;  2Y75 A;  1Z91 A;  2RV8 A;  2XAH A;  1OKR A;  1S7A A;  3ULQ B;  4EM2 A;  4A2U A;  1KU3 A;  1IN5 A;  3IHU A;  4CDG A;  4R1H A;  2GA1 A;  1WI9 A;  1LJ9 A;  1UFM A;  4IRI A;  2IPQ X;  2QM3 A;  3HSR A;  3M9A A;  1IF1 A;  5FD6 A;  3V4G A;  5ICE A;  1TTY A;  1WWX A;  4IRH A;  4U88 A;  2FA5 A;  3VOE A;  2QWW A;  2EA4 A;  4MTE A;  5H20 A;  3IWZ A;  2XKP A;  2FXA A;  4OOI A;  4HQE A;  3REO A;  1G3T A;  1R00 A;  3WTZ A;  2M8E A;  1DPU A;  2DFI A;  1ZG3 A;  5J8F A;  2F5D A;  2QZ8 A;  4ZH4 F;  4QWQ A;  1XSX A;  3GO5 A;  3AAF A;  3OOP A;  3M8F A;  2CYY A;  2OBP A;  4XSZ F;  1V4R A;  2HGC A;  2BGC A;  2XKO A;  1HSJ A;  4HA8 A;  2FF4 A;  4CYD A;  1WSU A;  2EV5 A;  2IA1 A;  3FMR A;  1R5G A;  4GCV A;  1SMY F;  3W6K B;  2LSO A;  5BOX A;  1Z05 A;  4S04 A;  1IXR C;  1MZB A;  1ZAO A;  3DEU A;  3GZ5 A;  5HDN A;  2FML A;  2AXL A;  4HLY A;  2DTR A;  4G9Y A;  1P92 A;  3F23 A;  2Z3Y A;  2PG4 A;  5JVT A;  2F5E A;  1PDN C;  5ED4 A;  2IJL A;  5HS7 A;  2P5K A;  1HXD A;  1LDD A;  1LEB A;  3WGH A;  3IL2 A;  3QU6 A;  1U6G A;  1X3U A;  3QRF F;  1XGO A;  2W84 A;  1XB4 A;  3HIF A;  2ZO4 A;  1Z6R A;  2STT A;  1DUX C;  4I09 A;  3TDU C;  1NHA A;  1L3L A;  4OMY A;  2HYG D;  3PQK A;  1P4X A;  2K4J A;  4MNU A;  3H3U A;  4P5O A;  1YIO A;  5ILU A;  2NAZ A;  4KUM A;  3BJA A;  4Q47 A;  3GYH X;  2DK8 A;  1B9N A;  2ZFW A;  4HOB A;  1HQC A;  3B02 A;  1G4D A;  3KP3 A;  1FBS A;  2BEO A;  1DDN A;  1TQI A;  3W6J B;  2DPD A;  1KGS A;  2PI0 A;  3RJP A;  2FE3 A;  4A6E A;  1PP7 U;  1FWZ A;  4ZYE A;  1I6X A;  3ZMS A;  3G3Z A;  3CUQ C;  3GFI A;  1IN8 A;  5DD8 A;  5DV5 A;  5LHG A;  3CUQ A;  3K2Z A;  3DQV C;  5E1W A;  1C0W A;  3V7R A;  2LDU A;  2Q2E A;  4TV7 A;  2DO7 A;  4LB5 A;  3HSE A;  1B4A A;  4KMF A;  4K2E A;  1Z7U A;  4ZZD A;  4R8H A;  3B73 A;  3P9K A;  3TOA A;  5F1R A;  1SAX A;  2K7L A;  1BBY A;  4UV8 A;  5ERI A;  2GZW A;  2FU4 A;  3ECO A;  3K9T A;  1ON1 A;  5LHI A;  2A5Y B;  2HZT A;  1JXS A;  3P9I A;  4HX4 A;  4ENK A;  1ZAR A;  3Q5F A;  4OMZ A;  2HKO A;  3HRM A;  2HQN A;  3LQQ A;  3PQJ A;  2EA2 A;  3JSO A;  5AON A;  3TQN A;  4MQ9 F;  3RIR A;  4L9N A;  3I71 A;  4EMS A;  3GF2 A;  2XV4 S;  2WTE A;  2NNY A;  4GXO A;  5FD5 A;  1L0O C;  3CO6 C;  5BMZ A;  3K1P A;  1QO0 D;  2O0Y A;  3WE2 A;  3FHZ A;  3FX3 A;  3SZP A;  3LAJ A;  2W25 A;  1RI7 A;  3KEQ A;  2ETH A;  2CGP A;  5EEH A;  2V79 A;  1R7J A;  4IRG A;  5FGM A;  2A3S A;  3GX4 X;  4IVN A;  3VB2 A;  3GWZ A;  3LA2 A;  1AOY A;  1LB2 A;  1BIA A;  4L18 B;  4A5N A;  3IKV A;  2IA0 A;  1YLF A;  1P4W A;  4QLC U;  1BOA A;  3JTG A;  4AD9 A;  5E1Z B;  4CIC A;  3U9G A;  2MH2 A;  3K1M A;  1K78 B;  4EJO A;  4HF0 A;  2Q0O A;  3LST A;  3LAP A;  3K1N A;  5D4S A;  3GW2 A;  3RYP A;  2ACJ A;  5CJ9 A;  3WE3 A;  4L0Y B;  1S3J A;  5LEJ A;  2DQR A;  3SQN A;  1YFH A;  3BY6 A;  5F6F A;  2A07 F;  4OIP F;  3QU3 A;  1J2X A;  3EQL F;  3KP7 A;  2O61 A;  3KP2 A;  1BIB A;  1O3S A;  1Z6T A;  4OIO F;  1BN5 A;  1CF7 B;  4P9U A;  2V6C A;  2HWV A;  4EGY A;  4MTD A;  2ZME A;  3KFW X;  2YU3 A;  3BPX A;  1SD4 A;  4GYG A;  1U8R A;  2L4A A;  1UST A;  1P4A A;  2ZKZ A;  3R0J A;  1J0R A;  2FOK A;  4DNC A;  1MDM B;  2QQA A;  2RN7 A;  2VBY A;  1FYL A;  2XVC A;  1T2K A;  5D8L B;  2LF8 A;  1IZ1 A;  5ILS A;  4LFU A;  4WF2 A;  1D5V A;  5LLQ A;  3EYI A;  1BI2 A;  2XIG A;  1FLI A;  2H09 A;  5BQT A;  2MA3 A;  3E6D A;  3TO6 A;  3Q9S A;  3RYR A;  3F6O A;  2X4H A;  1HW1 A;  2O6G E;  3JAM Z;  1Q1H A;  4I98 B;  2H6B A;  2DAO A;  2EFO A;  3ZQ7 A;  6PAX A;  1FSH A;  1E2X A;  2R7F A;  4KIB A;  1K6O A;  1R5H A;  3RKX A;  2OZ6 A;  1IN6 A;  5IT9 Z;  3LA7 A;  5H6Q A;  3L9F A;  2IT0 A;  1Y0U A;  5D5V B;  5BS6 A;  1F1Z A;  2A6H F;  4RB3 C;  3C1D A;  2XAS A;  3ABU A;  1U78 A;  2L02 A;  1J59 A;  1ZG5 A;  4AIK A;  3KP4 A;  3WTX C;  2R7D A;  2RDP A;  2XUB A;  3MEX A;  4EJU A;  2HFH A;  4EV0 A;  4ZYD A;  4ENJ A;  3L09 A;  3TGN A;  3ISP A;  1T0F A;  5HVQ C;  3CO7 C;  2MC3 A;  3FZV A;  1T39 A;  1R22 A;  1T98 A;  2MBF A;  2VBX A;  4HYE A;  2F2E A;  1E17 A;  5IT9 K;  3FMQ A;  1XSD A;  4EM1 A;  4M72 A;  4YFK F;  2FEZ A;  2RC4 A;  3V8J A;  4HBL A;  1EH8 A;  3F8N A;  1ZRE A;  3H92 A;  3D5L A;  3O3K A;  1PP8 F;  3T8T A;  4PGG A;  3OV8 A;  4FHT A;  2DBB A;  2W24 A;  2L01 A;  4RAY A;  1D8J A;  1USS A;  2A68 F;  4P9F A;  4CO8 A;  4U0Y A;  1GVJ A;  1ONV A;  3MCZ A;  1KQ0 A;  3CJN A;  2HYF A;  4N9H A;  4I0B A;  4N0B A;  4NHJ A;  2FMY A;  1YTY A;  2P6S A;  2G9W A;  4RAZ A;  5FFZ A;  2PFB A;  4RGU A;  2EK5 A;  3WTS C;  4HAM A;  2MD5 A;  3GEZ A;  3ZP5 A;  1K78 A;  5E8I A;  2VT3 A;  4UHT A;  3BJO A;  4N9I A;  1IXC A;  3MFK A;  4Y15 A;  2DQL A;  4IXA A;  2XAJ A;  3WTT C;  2GA2 A;  2AS5 F;  3VEP A;  4WXD A;  2W57 A;  5LGU A;  2PEX A;  3IC7 A;  1WRJ A;  4M6Y A;  1FYK A;  3F8M A;  2IA2 A;  2W85 A;  4WWC A;  3R0A A;  1O3R A;  1K79 A;  2HEO A;  3O2P E;  2O3F A;  4ASN A;  2GQQ A;  1CF7 A;  2CSO A;  4AVP A;  2CFX A;  1QBJ A;  3DKW A;  2E1C A;  4IF4 A;  2YSR A;  1TNT A;  5BPD A;  2V1U A;  2P8T A;  4CZZ A;  1HKS A;  3KE2 A;  1HW5 A;  1I27 A;  4EJW A;  3WTW C;  2ZNZ A;  4WX9 A;  1MDM A;  4KDP A;  2HR3 A;  4HV5 A;  1O7L A;  1EH6 A;  2BV6 A;  2LKP A;  3D0S A;  5K1Y A;  1YO5 C;  4B09 A;  2XAG A;  4UUV A;  3N4M A;  2EFW A;  5L3C A;  1FY7 A;  1TW3 A;  3DFG A;  1UB9 A;  4LMY A;  4RB0 A;  2JRT A;  4F7Z A;  3R61 A;  2BE5 F;  4PZJ A;  5L3E A;  4LD5 A;  1ZRC A;  3GXO A;  4MEX F;  4RS8 A;  2RGV A;  5HOO A;  3L7W A;  3DPT A;  1IAW A;  4KT5 C;  2L54 A;  3ZMZ A;  2KIM A;  1JHF A;  4WCG A;  2NRA C;  3EYY A;  4YFN F;  2VOO A;  1RNL A;  3K69 A;  4LB6 B;  4EM0 B;  4Z2Y A;  1MJ9 A;  1Z9C A;  1O3Q A;  1ZLJ A;  1QZZ A;  1RUO A;  2P4W A;  2YR2 A;  2PN6 A;  1F5T A;  1ZLK A;  4HLX A;  3V7S A;  4D0P A;  3KP6 A;  3GZ6 A;  3WOD F;  4ENN A;  2H94 A;  1OYY A;  4H0E A;  2P7C B;  4UXN A;  5J8C A;  4ETS A;  5FLX Z;  1BI3 A;  1VTN C;  2XRO A;  2OQG A;  4UVA A;  1RIO H;  4HX8 A;  1PUE E;  2JZY A;  3ROU A;  1DPR A;  3R60 A;  2VON A;  3T1B A;  1SFU A;  4GGG A;  3HSF A;  1ZGJ A;  3ZMV A;  2B0L A;  5DYM A;  5E8G A;  4WXH A;  1KU9 A;  2DU9 A;  1OMI A;  2PMU A;  3ERE D;  2IVM A;  3GLX A;  2HS5 A;  1QZY A;  5HS9 A;  2QYO A;  4RGX A;  5FFX A;  5E1X A;  2VOD A;  5TRD A;  1P2F A;  4MGR A;  4HW0 A;  2E1N A;  2FRH A;  3JTH A;  2VE8 A;  5FO5 A;  3HOS A;  1S29 A;  2IRF G;  2NNN A;  3WTV C;  4IPA A;  1R36 A;  3BWG A;  2D2W A;  1TQP A;  4G8X A;  3JW4 A;  2PLY A;  1S6L A;  3I64 A;  5LGT A;  2VOP A;  4EQQ A;  4JBA A;  4M9X A;  4U0V A;  5HS8 A;  5F64 A;  5E18 F;  2JT1 A;  2EFP A;  4XRF A;  3DPL C;  1QPM A;  2MLK A;  4GO1 A;  4PCQ A;  5L3D A;  1SFX A;  3GUD A;  5CVU A;  4RB1 A;  1SFE A;  2Z5U A;  2DI3 A;  1YYV A;  2VT2 A;  4GYI A;  3C18 A;  4L9J A;  3FF5 A;  4LLL A;  5K5Q A;  3ZMT A;  1MJA A;  1FBQ A;  2UXN A;  2WC2 A;  2DT5 A;  4U7D A;  4RGR A;  2JTV A;  3LQR A;  2ISY A;  1S8N A;  2OA4 A;  2CWE A;  3V8K A;  2X0L A;  4L9T A;  4RB2 C;  4O6J A;  2Z9O A;  3MWM A;  2HTS A;  4CGZ A;  3ML6 A;  3HUG A;  4OIN F;  1TW2 A;  1ZGA A;  1R1U A;  1LVA A;  1MKM A;  2V1X A;  3E6C C;  2PBI A;  3MZH A;  4UNO A;  4I01 A;  2JSC A;  1YS7 A;  4ZYH A;  2H6C A;  1YW9 A;  3JSP A;  1J5Y A;  2ELH A;  4M9Z A;  3EUH A;  1FBU A;  1W5S A;  3E6B A;  4P55 A;  3SZT A;  3RPQ A;  2GIV A;  2EWN A;  4I7H A;  5HLI A;  2CQK A;  1ZHF A;  2ZXJ A;  2J5P A;  1W7P B;  1W5T A;  3J80 Z;  1XGM A;  3FXQ A;  3ECH A;  3RTR A;  1P6R A;  2PJP A;  5E17 F;  1FZP B;  4PGH A;  1Z1D A;  2VE9 A;  2RQP A;  3FWE A;  1UCR A;  1W7P D;  1FC3 A;  2GXB A;  5K5O A;  2QBY B;  1FSE A;  2QEN A;  2ZNY A;  4G94 A;  1G3S A;  2PMH A;  3M1E A;  2WV0 A;  3BJ6 A;  5L3B A;  4M73 A;  1I5Z A;  1BI1 A;  2K4B A;  4M71 A;  4EVI A;  1GXQ A;  2EV0 A;  5LRS A;  1RUN A;  3J80 K;  2QUF A;  1G6N A;  2HQR A;  1IXS B;  2F5F A;  2CW0 F;  1FNN A;  3F72 A;  2R3S A;  1D3Y A;  4ZZL A;  1UHW A;  5LRR A;  2LNB A;  2P5L C;  4LLG F;  3J81 Z;  5DDG A;  3KLN A;  3H3Z A;  4BYY A;  2GXG A;  4U7B A;  1HBX G;  2H27 A;  1BJA A;  1YS6 A;  2Y48 A;  3Q9V A;  1MD0 A;  3P9C A;  1IN7 A;  2C6Y A;  2RKH A;  1BC7 C;  1OYW A;  1I1G A;  2OD5 A;  1OPC A;  2ZJ2 A;  5HDK A;  4ESJ A;  2YPR A;  4OIR F;  3I5U A;  3DF8 A;  1J7K A;  4P96 A;  3JAM K;  1WKM A;  3RDI A;  2WWY A;  5TJJ A;  4XLP F;  3KLO A;  1FX7 A;  5D4R A;  1F4K A;  2O8X A;  1KYW A;  4AIJ A;  1KU2 A;  5KVR A;  1DP7 P;  2DW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...