5K5QA

Structure of aspa-dna complex: novel centromere bindng protein-centromere complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
b'STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
total genus 29
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k5qA00
5FFZA 3K0LA 1SAXA 4JQFA 3C1DA 3SHFA 1H9TA 2COMA 1TW3A 3I58A 3DEUA 4L9VA 3IKVA 3V8JA 2RV8A 3KE2A 2V9VA 4AWXB 2ZJ2A 1YO5C 4KMFA 4P9UA 3R60A 2Z33A 1QNTA 3F6VA 2JSCA 4YIIA 2DAOA 1KU9A 3ECHA 5J8FA 3F3XA 3QRFF 4KMUX 3KETA 1IW7F 3WU1B 4G94A 2M87A 2OBPA 2FNPA 4FT8A 2H6CA 2VBXA 1EH7A 2MD5A 2A6EF 3KLOA 5E8GA 2JT1A 2CQKA 2EFPA 4WXHA 3ZMDA 1ZRDA 4HF2A 1L0OC 3TDZC 1P92A 4MQVA 2DK8A 2BGCA 4EJOA 2DTRA 2QZ8A 4PCQA 2TDXA 3NEUA 2WC2A 4UVAA 1DP7P 2E7WA 2WTEA 2A5YB 2R3SA 4HW0A 1MGTA 4OU0A 1PP8F 4EGZA 3OOPA 1Z7UA 1XDSA 4KFCA 2NNNA 3KP7A 3U2RA 5D5VB 2Q8KA 3PQKA 1H9GA 1GXQA 2RGVA 2M45A 2R7DA 4PGGA 4RAYA 3ZMZA 2HOEA 1XN7A 3QPTA 4IPAA 1MKMA 3K69A 2ZKZA 2M1BA 2XVCA 3H92A 3GXOA 2EFWA 3ML6A 3LSTA 4KDPA 1LB2A 4H0EA 2UZKA 1G3YA 5DDGA 1FYLA 4CZZA 3KZYA 1XGSA 2MC3A 5CLSA 4OMZA 3ECOA 1MD0A 1J75A 1RI7A 4R1HA 2W25A 3EYYA 3KZZA 3QU3A 1I5ZA 2XKPA 2FRHA 5E17F 3HRTA 2PBIA 1LVAA 5HDKA 3V4GA 2K02A 1MDMB 1W5TA 2DI3A 1G3SA 1RUOA 2MH9A 3W6KB 4U88A 4KT5C 5D8LB 4LG0B 5K5QA 4M9XA 1OMIA 3R0JA 1IN8A 5ICGA 5F64A 5DD8A 3RKYA 1O7LA 4Q5SF 3RPUA 5LRRA 1U78A 3IRRA 1TQIA 1IAWA 4G6DA 1KYZA 2P7CB 1R22A 4WX9A 4YFXF 1TTYA 4WXDA 2VBWA 2NAZA 2ADUA 4N9HA 4TV7A 2IW5A 1Z91A 4XRFA 4L0YB 4O5VA 3BOQA 4UVBA 3LQRA 4ZYGA 1T2KA 2IPQX 2MLKA 3BPVA 4O6JA 2UWMA 2HS5A 1R00A 2GQQA 2FBIA 5CJ9A 4JK1X 3K9TA 2HFHA 3SXYA 1QZZA 1BOAA 2Q2EA 2ZMEB 4HQEA 1FBQA 1F4KA 3FMRA 4HZFA 1IN7A 1S29A 5L3GA 1O3SA 3K2ZA 1XSXA 4UNOA 4ENJA 2XV4S 1IRGA 2OA4A 3SFZA 3J7AO 3PFIA 2EV6A 4IJAA 3ZMSA 1IXCA 1IN6A 3ZN0A 2F5EA 1WKMA 3ABTA 4L9NA 1FSHA 1HSTA 5LGTA 5D5XB 1BIBA 3HOSA 2V1UA 4ENNA 4MHGA 2ISZA 1AOYA 4GO1A 3HRSA 3ELKA 1DUXC 2DPDA 3CUOA 3MFKA 3F23A 1U5TA 1ZG3A 1SD5A 3HUGA 2XAGA 4I0AA 5FFXA 1S3JA 5EEGA 2K4BA 2O3FA 1E2XA 2VXZA 1T0FA 5FLXZ 1HW1A 1KYWA 3F8NA 1J2XA 4HLXA 5BOXA 1ONVA 2QBYA 2D2WA 5LBQA 5DV5A 1RUNA 2OAZA 1K6OA 3JSOA 2KIUA 5DEQA 2OU2A 4HBLA 3WTYC 2LNBA 4LMYA 5A2QZ 3JSPA 1ZLKA 1BJAA 3HSFA 1U8RA 1NHAA 1ZREA 3GX4X 3M8EA 2ZFWA 3HHGA 1RNLA 3Q9SA 1B9NA 3WE3A 3HRMA 1Z6RA 2EFNA 2GA1A 4P55A 2B0LA 4KN4X 3W6JB 1PDNC 3HSEA 2RKHA 4OIOF 3T8TA 4HF0A 4M73A 5LHGA 1T6SA 1W5SA 4U0WA 1HW2A 1LJ9A 4U7DA 1A04A 4RB3C 1P2FA 3BP8A 5K1YA 5IT3A 2IA1A 4R8HA 3KP5A 2RVCA 1S7AA 5FD5A 1L3LA 2STWA 4S04A 4B8XA 1EV7A 2FMYA 2DO7A 2CFXA 4M9ZA 2PG4A 3TOBA 3MEXA 4IVNA 2EFOA 4GCVA 1OYIA 2EA2A 1EH6A 4FX4A 3VFZA 5D6EA 1YW7A 2L02A 2GA2A 4HX8A 2GZWA 4ZYEA 3HIFA 4M72A 4RGSA 2KJCA 2K7LA 4AIKA 1B9MA 3EETA 2ELHA 3MZYA 3FXUA 2LF8A 1TNTA 3DFGA 1HXDA 1UCRA 2FSWA 1MJAA 4LB6B 1BN5A 1BI0A 1SMTA 3F8BA 1SFUA 1CF7A 4I2OA 3CDHA 5ICFA 2F2EA 4HA8A 3TQNA 4BHPA 3CO6C 4KNYA 3VEPA 3L09A 4K2EA 3BWGA 2YPRA 3OV8A 3R0AA 5BQTA 4EGYA 3LAJA 5ILUA 3WTVC 5JI6A 1G6NA 3M7GA 2OZ6A 4I09A 3DP7A 1FSEA 3E97A 2C6YA 3O6BB 2P4WA 3LWFA 2FU4A 4M9SA 3LA2A 2HWVA 3F8CA 1FYKA 2RC4A 1P6RA 5D4SA 3N97A 2LKPA 1BC7C 1QPMA 2FEZA 1XGMA 4KUMA 3IKTA 4A0ZA 3IWFA 2XUBA 2JZYA 4RB1A 3GFIA 2HQRA 3T0YA 3P7NA 1K78A 1F5TA 3ZPLA 2VT3A 2L01A 2DT5A 3CLOA 4ESBA 4HX7A 5L3EA 2VONA 4A6DA 3IC7A 1IN4A 3GF2A 3GFLA 2MA3A 2Q0OA 2CGPA 1HKQA 2W57A 4YG2F 2KRFA 2FOKA 1KU3A 4XLPF 2V1DA 3WTXC 1DPUA 2IJLA 1I1SA 3EDPA 2O8XA 4OINF 4XLNF 1E17A 2HYGD 2PFBA 1R58A 3JAMZ 5L3BA 4UXNA 2V6CA 1R23A 5D5WB 3ZQ7A 2CWEA 1R5HA 1B6AA 3HHHA 2Z9OA 2RDPA 4ZH4F 1TLHB 4GXOA 4CDGA 3LA3A 3FMQA 1TW2A 3NRVA 1Z1DA 2GXBA 3F6OA 2DQRA 4L18B 1ON1A 4I02A 1USSA 2M30A 1ZG1A 1F1ZA 1SMYF 3C7JA 5F6FA 4AD9A 4IHSA 3RYPA 5K5RA 4KICA 4CICA 2G9WA 1ZRCA 4FHTA 2XHKA 4U7BA 1FX7A 2P8TA 3LFKA 4ZYDA 5IT9Z 1BI1A 1LDKB 2PJPA 4AIJA 2VE9A 4ETSA 5L3DA 1K7AA 1XCVA 1W7PA 4M6YA 3EUHA 1W4MA 2VBYA 1HKTA 5ICCA 2XRNA 3CO7C 3I59A 4XSXF 2EK5A 3KEQA 1SD4A 3WTZA 1LEBA 1FBSA 5CYVA 1ON2A 2IA0A 2ZNZA 1U5TB 2QQBA 2O0YA 4CXFA 2KIMA 2OQRA 2MH2A 5JR3A 5DUKA 4KA4A 1IUYA 4EMSA 2EV0A 3H3UA 4RGXA 4G8XA 1YS7A 1LDJA 4QLCU 1TBXA 1FT9A 2XIGA 5TJJA 1I1GA 2QUFA 4IRGA 1JGSA 1Y0UA 5E20A 1YYVA 4MEXF 2E1NA 2YR2A 3L00A 4G7ZF 1P4XA 1JE8A 4NHJA 2WWYA 4EVIA 1B59A 3CUQB 4HX4A 2QLZA 1YW8A 3KCCA 5KVRA 3FM3A 2EJRA 3I64A 2M5WA 2GXGA 2L4MA 2K27A 1AWCA 2XGXA 4EM1A 3IWZA 3PQJA 2L4AA 5H6RA 2OZUA 3IL2A 5AIQA 4RGUA 3C3WA 4L0ZB 1ZGAA 5LRSA 1P4AA 4Y13A 2BYVE 1KU2A 1IZ1A 4LFUA 1ZG5A 2HGCA 3WTUC 1C0WA 2CSOA 5F1RA 4N0BA 4AIHA 3JAMK 1ULYA 2P5VA 1FZPB 1O57A 3HSRA 3GZ6A 3ZMTA 2LSOA 4ESJA 4EV0A 3E6MA 2DQLA 2QVOA 1UFMA 4DQ2A 2CW0F 2YSRA 4UUVA 1FYMA 2DK5A 4KIFA 3MCZA 1QBJA 4M74A 3DPLC 4O3MA 4L5JA 2QQ9A 3FX3A 4A2UA 3RYRA 3FXQA 5HS9A 3BJAA 4HOBA 5HLGA 4ASNA 5LEKA 4IXAA 4MEYF 1WWXA 3EQLF 3RPQA 5D5UB 1X3UA 5IT9K 3RTRA 1BC8C 1XB4A 4OIQF 3GEZA 4G7HF 5FD6A 4PGHA 2NNYA 4IRHA 2J5PA 3CUQC 2DFIA 4RB0A 1DDNA 4LK1F 1ZAOA 2IRFG 2PQ8A 2XAHA 4RAZA 5HLIA 4YFKF 3RDIA 1SD7A 5E8IA 2ZBKA 1KU7A 2NRAC 2PN6A 3BROA 1LDDA 3TDUC 5FO5A 2P5LC 1XDUA 4ENKA 3J80Z 4A5MA 5HLHA 4MNUA 5LGNA 5D6FA 2RNJA 2PI0A 2A61A 2A69F 2NYXA 4LLLA 4LK0F 2A3SA 3ZMVA 2QENA 2XKOA 2ZNYA 3I0TA 4P96A 4LGWA 4D0PA 2UXXA 3MQ0A 3IHUA 4Z2YA 3GUDA 3P9KA 2FE3A 4L9JA 1LQ1A 3H3ZA 1OKRA 1MDMA 2GWRA 2VODA 4U0YA 2FBHA 1R36A 4BH9A 2VBZA 2CG4A 3DF8A 3ABUA 1GXPA 1GHCA 3G3ZA 3F8FA 4CYDA 4LG0A 1BIAA 5LLQA 3K1PA 4UV9A 4HF1A 3RI4A 4YIFA 4CO8A 3VOEA 2XAFA 1YTYA 3GLXA 3M1EA 4PDKA 2QQAA 5E1ZB 2G7HA 1OYYA 5KK1A 4S05A 2FXAA 2O61A 5LHIA 2O03A 4P9FA 1Z9CA 3J81Z 2H27A 2Y48A 2P5KA 1ZN2A 1J59A 2YX4A 1KGSA 3NQOA 3LA7A 4PZJA 4BAYA 2HKOA 1R7JA 3HYIA 1JXSA 1USTA 5DCFA 1OPCA 1FP1D 2VOPA 1IXSB 4UV8A 3KLNA 4WWCA 1U3EM 3DV8A 2EWNA 5HOOA 2FF4A 2K86A 2P7VB 3I54A 2YX7A 1T38A 1YIOA 3BJ6A 3VODA 4YFNF 2X0LA 1D8JA 1XSVA 3FWEA 2ZMEA 1Q1HA 5CVRA 1W7PB 2OQGA 3LQQA 3R4KA 3HTSB 3C18A 3HTUA 3Q5FA 3IRQA 3MWMA 2A07F 5ICEA 2EV5A 5FB2A 1MJ9A 1HSJA 2HQNA 3ISPA 5BS6A 4B09A 3SQNA 1G3WA 3GFJA 1J9IA 3MZHA 3E5XA 3O2PE 2LDUA 4IF4A 1ZRFA 1ZH5A 3WTWC 4HLYA 6PAXA 2HTSA 2DBBA 1FY7A 2RQPA 1SFEA 3J80K 2MLGA 4UHTA 3I4PA 3S2WA 3FXRA 3F22A 2IA2A 5FLXK 2XAQA 2D1VA 3WGHA 1F9NA 4L9TA 3ZP5A 2PLYA 1XSDA 1JHFA 4GYIA 4MTEA 1SD6A 4EM0B 2JPBA 4BHCA 1ZHFA 3N4MA 4ENMA 5LEJA 4GYGA 5A2QK 3GO5A 4LLNA 1V3FA 1YG2A 1YLFA 1BBYA 4HAMA 2ZO4A 2EB7A 4JBAA 1YS6A 4NQWA 2BV6A 2QYOA 4IRIA 3ZMUA 1XD7A 1R1TA 3QPHA 1U6GA 2HDCA 4I01A 1WQ2A 2A6HF 4OOIA 1UB9A 3JTHA 1O3TA 4G9YA 2DU9A 4BHBA 5L3CA 4Q4ZF 1ZGJA 2GAUA 3KP6A 3F72A 4EJTA 1T39A 1R1VA 2XROA 4RS8A 2HKXA 1I6XA 4EQQA 3E5QA 4G7OF 3G73A 1FC3A 3J81K 3M9AA 1XCBA 3QP6A 5AONA 2DW4A 1B1BA 3R61A 4BQAA 1WI9A 5EEHA 2AXLA 2F5CA 4QWQA 1BI2A 1G4DA 3RIRA 2PMHA 5DCMA 3KP2A 5JVTA 1HKSA 5DD4A 1O3QA 2AS5F 4Q47A 3T8RA 4OIRF 2JPCA 2KJBA 3V8LA 3TO9A 5CVJA 2X4HA 1IXRC 2FA5A 3JTGA 2QM3A 1O7FA 3WG9A 3FM5A 1S6LA 5K5OA 4HQMA 1TNSA 5D4RA 1V4RA 4R79A 1EH8A 3B02A 3GFMA 3CJNA 3K1MA 4I0BA 3KFWX 3TOAA 2HR3A 3L2CA 2JTVA 5H6QA 3V8KA 4A12A 3E3VA 4NB5A 2XASA 4U0VA 1ZYRF 4Y15A 1J7KA 1FP2A 1FNNA 1Z6TA 1CGPA 5BMZA 3D0SA 1D5VA 3GWZA 2G7UA 2UXNA 4L5IA 4XBFA 4KIBA 5HS8A 3V7CA 4UVCA 3V7SA 2KKOA 1ODDA 2PMUA 2QBYB 2ESHA 1LEAA 1XMKA 3ERED 4ZZLA 4DNCA 3QAHA 4A6EA 1WRJA 2P6SA 1HBXG 1BM9A 1YFHA 3TO6A 2Y75A 3REOA 1T98A 2DPUA 3DXJF 1D3YA 1REPC 5HS7A 4RGRA 1J5YA 3I71A 2VC0A 1BI3A 2VC1A 4WF2A 5L3FA 3EYIA 4EM2A 2F5FA 3WGIA 4HDVA 2Z99A 3TKYA 2VT2A 1HQCA 4MQ9F 3WTTC 1FPQA 1TQMA 2HYFA 2L54A 5DYMA 4I98B 5J8CA 2H94A 5CVIA 1QO0D 2EA4A 1IRFA 4ON0A 3D5LA 5ERIA 4HV5A 3SZPA 1S7OA 3RKXA 3QU6A 3RJPA 1KQ8A 2D1HA 4ZYHA 3BY6A 5FGMA 2Z5UA 2ETHA 3BZ6A 1U2WA 2D45A 1PP7U 2ZCWA 1ZLJA 3WU0A 2HTJA 3U9GA 1IN5A 2RN7A 2Z3YA 4LLGF 2PEXA 1U5TC 5D8KB 1Z05A 1P4WA 5ILVA 2V1XA 3SZTA 1MJBA 4M6XA 3TGNA 3T1BA 2BEOA 2F5DA 2LF7A 1R1UA 2YU3A 4EJUA 4KYWA 1R5GA 1RZ4A 3JW4A 3E6CC 2GIVA 3LAPA 3I5UA 4N9IA 1W7PD 4M71A 3U1DA 3I53A 4BXUA 1CF7B 5LGUA 5BPDA 3DQVC 4EJWA 3V7RA 3F21A 1TQPA 5JFRA 3DPTA 3ROUA 3HRUA 4HV6A 2FBKA 3FMSA 4OMYA 3M8FA 1XGOA 2STTA 2VOOA 4LD5A 3GYHX 3KP3A 2QWWA 2L3DA 3R6SA 5J6XA 4MGRA 1FOKA 3FF5A 1J0RA 2IT0A 4WCGA 1WSUA 1IF1A 1KQ9A 1S8NA 2OD5A 1JHHA 1G3TA 2E1CA 3HOTA 1UHMA 1QZYA 3ULQB 5LHHA 1QGPA 4I7HA 1GVJA 2MBFA 2ESNA 5CVUA 1K78B 3GVAA 4ESFA 2IVMA 1KQ0A 5H20A 4FX0A 4OIPF 4KN7X 3KEOA 2W85A 3CUQA 4CGZA 1FWZA 3O3KA 5CVVA 5E18F 4A0YA 4BNCA 3E5UA 3CTAA 3BDDA 2FQ3A 2EFQA 3WODF 2O6GE 4Y17A 2BE5F 3F8MA 4WXCA 5DUIA 5E1XA 2A68F 1K79A 3P9CA 1I27A 3GW2A 4A0XA 2V79A 1ZARA 2CO5A 2M8EA 2XAJA 3WE2A 1O3RA 4CHUA 4WK8F 3VB2A 2H09A 2HEOA 4GGGA 5HDNA 5HVQC 1YQAA 4P5OA 2VN2A 2K4JA 1SFXA 5ED4A 5JHUA 3KP4A 4LB5A 4E70A 1STZA 5DCMB 4XSZF 3MAJA 2P6TA 4RB2C 3P9IA 2H6BA 2ZXJA 1PUEE 2CYYA 4Q48A 2R7FA 3E6DA 1OR7A 5E1WA 5BPIA 2JRTA 4HDUA 3K1NA 2NS0A 4HYEA 2ISYA 3L7WA 2ACJA 4MTDA 3I59B 2FMLA 1KA8A 3FHZA 3L9FA 1FBUA 1RIOH 5ILSA 1UHWA 4BYYA 1H0MA 2VE8A 2HZTA 1MZBA 1QQIA 1B4AA 3QP5A 2IP2A 3DKWA 2Y0MA 1LNWA 3AAFA 2KIFA 1XGNA 3RKWA 5TRDA 1FLIA 3ZN1A 2J5OA 2BBYA 3FZVA 1HW5A 4KIGA 4A5NA 2FNAA 4G6QA 5AIPA 5HDGA 3TO7A 2W24A 4IHTA 1D8KA 4ZZDA 4LJZF 4EJVA 3WTSC 3COAC 3Q9VA 1XMAA 4AVPA 2W84A 2DLLA 3B73A 3QOPA 1YW9A 3GZ5A 3T5XA 4F7ZA 2WV0A 1VTNC 3E6BA 1DPRA 3WGGA 2E7XA 3BJOA 3BPXA 1OYWA
chains in the Genus database with same CATH superfamily
2DA1A 3BR2A 5FFZA 3K0LA 1SAXA 4JQFA 3G1OA 3L2WA 4PUSA 3K2AA 3C1DA 3SHFA 1H9TA 3VYUB 2COMA 1TW3A 3I58A 3I3LA 1W5CC 4JX6A 1HLVA 4XMYA 5CQEA 3CCEI 3A4CA 3DEUA 4L9VA 3IKVA 3V8JA 1IRXA 2HNHA 1MMSA 2TRTA 3H5AA 4PJJA 3DBHB 1VQ5I 2RV8A 3KE2A 2V9VA 3M3YJ 4AWXB 3WHBA 2HVQA 5EGOB 2ZJ2A 1WH7A 3K4KA 1LPQA 1YO5C 2MC4A 4KMFA 4P9UA 3R60A 2K9QA 5FKMA 1PYVA 2Z2SB 3SZGA 2Z33A 2KHMA 3IH3A 1QNTA 3F6VA 2JSCA 1X3WB 2OV7A 2DAOA 4YIIA 1KU9A 3ECHA 2QKMB 5J8FA 3F3XA 3QRFF 4XRSA 4E6KG 4HSRA 4KMUX 3EUHC 3KETA 1Y8RB 2EIJH 1IW7F 1BOBA 2ZFUA 3BTLA 3WU1B 1YIJI 4G94A 4BDZA 5J3LA 1TP4A 1OJLA 2OBPA 2M87A 2FNPA 2HOAA 3ABMH 4FT8A 2H6CA 4PFOA 2VBXA 1ETWA 1EH7A 2MD5A 1WJEA 2A6EF 2CQ7A 1MMNA 3KLOA 5E8GA 2JT1A 4X0GA 2CQKA 2EFPA 3HPGA 4WXHA 4XN3A 3ZMDA 1ZRDA 4HF2A 4RBOA 2EIMH 5FRNA 5F1JA 1L0OC 2E5NA 2DMQA 3VYRB 3TDZC 1P92A 1MSEC 4MQVA 3K70C 3ZCOA 4PSWA 2DK8A 2BGCA 4FISA 4EJOA 2DTRA 2QZ8A 4PCQA 3OYKA 2TDXA 2VUMJ 3OL4A 3NEUA 4B48A 2WC2A 2GBYA 2K9SA 4UVAA 5BNGA 1DP7P 2E7WA 2KPMA 2WTEA 2A5YB 1LKXA 2R3SA 2R92J 4A3MJ 4HW0A 3ZOBA 1MGTA 4XM3A 4OU0A 4KT6A 3A1YA 1Y39A 1PP8F 4EGZA 3OOPA 1Z7UA 1XDSA 4KFCA 2WB1A 2I8DA 3IAS2 3O8HA 1DGRM 2ME6A 2NNNA 3KP7A 3U2RA 4LITA 3WHCA 5D5VB 5CPRB 2Q8KA 3PQKA 1X1AA 1NH3A 1HC8A 3G2BA 2AO9A 3E0JB 1H9GA 1GXQA 2V26A 2LBFA 2RGVA 2CQQA 2M45A 5K7ZA 2R7DA 3BG3A 2R93J 4PGGA 4RAYA 3ZMZA 2HOEA 1XN7A 3QPTA 4FE4A 4IPAA 1MKMA 4LOCA 4XR6A 3K69A 1BW5A 2LY9A 3HGYA 2ZKZA 2PJRB 2M1BA 3LSKA 2VI6A 1T95A 4LG3A 2WY7Q 2XVCA 3OYAA 3H92A 4ABZA 3GXOA 4XKWA 1Y1WJ 2EFWA 3FKJA 3JRFA 3ML6A 1VQ7I 3U1KA 1U9NA 3AG1H 3LSTA 1AU7A 2ZC2A 4KDPA 1LB2A 4EEFG 4H0EA 2R7XA 4XLHA 2UZKA 1G3YA 3BCAA 1P9QC 5DDGA 3JR9A 1Y8QB 4CZZA 4FQGA 1FYLA 3KZYA 1BR4A 1OLTA 5C4JJ 2ZSHB 1XGSA 2MC3A 5FRMA 5CLSA 4OMZA 3ECOA 1MD0A 1IV8A 2WAFA 4XOTA 4C2UA 4C2TA 1J75A 4NC6A 1RI7A 4Y4RA 2CQXA 2XAUA 5F0HA 3S2HJ 3IH4A 4R1HA 1JKPC 2W25A 3EYYA 3KZZA 1R71A 3QU3A 1I5ZA 2H1LA 5EYRA 4II3A 2XKPA 4IKFA 3GLLA 5F27A 4A69C 4QTRA 1N77A 2FRHA 3K4BA 3CJRB 5E17F 3HRTA 3L2QA 3LSJA 3PM1A 3IAM2 2HDWA 2PBIA 3LSGA 4PJNA 1LVAA 3OOUA 2WY8Q 2X85A 3CMMA 3KEYA 5HDKA 3V4GA 3QODA 2K02A 1PJRA 1MDMB 3S93A 4D5CA 1W5TA 2DI3A 1G3SA 2JVHA 1RUOA 2LK2A 1X4PA 2MH9A 3F0CA 5IY5H 2VJJA 4M3EA 1FEXA 4GDFA 3W6KB 1E3HA 4U88A 3S32A 4KT5C 4B43A 1FIPA 5D8LB 4FTHA 5K5QA 4LG0B 4NC8A 2CJJA 4M9XA 1OMIA 3R0JA 3S16J 1IN8A 5ICGA 5F64A 5DD8A 3RKYA 1O7LA 4Q5SF 3ONQA 3ZQLA 3S3OA 2LMDA 1VNDA 5F0CA 2DDBA 1LFUP 2Y9YA 3RPUA 1XC5A 5LRRA 5GTIC 1U78A 4V2GA 3IRRA 3BR5A 2M4GA 1TQIA 1IAWA 1NK2P 2VASA 4G6DA 3BZKA 1KYZA 2DMTA 4BJ5C 2P7CB 1R22A 4WX9A 4YFXF 3I55I 3G1MA 2AQEA 3PO2J 1TTYA 4WXDA 2VBWA 3QYBA 2NAZA 1G8XA 2X6OA 2ZSIB 2CFOA 2R7UA 5DS9A 5IOZA 2DJNA 2ADUA 3A0BC 5IP6A 4N9HA 3HKZN 5EJCA 4TV7A 3X2QH 2IW5A 1Z91A 2OF7A 4XRFA 2Y9ZA 5EZGA 4I76A 1ETVA 4L0YB 2JA6J 2OPTA 4O5VA 1T56A 1ORKA 1V55H 3BOQA 1MH4A 4UVBA 3LQRA 2DODA 3CCRI 4ZYGA 3ZQFA 1T2KA 2IPQX 4Y33A 1ETOA 2MLKA 3BQZA 3BPVA 4U87A 3GTPJ 4O6JA 2UWMA 3NAUA 2HS5A 1R00A 2CUZA 3WG7H 2GQQA 3ZGKA 2DYSH 3FBNB 2FBIA 5FLMJ 5CJ9A 1I39A 4JK1X 1MBGA 3K9TA 2DFEA 2HFHA 3M07A 3SXYA 1Z7LA 2Y0SN 1QZZA 1BOAA 2Q2EA 4P1WA 4BQQA 1D1CA 2ZMEB 2CW7A 4HQEA 1FBQA 2E1MB 1F4KA 2WV1A 3FMRA 1ZELA 2DA5A 1UAAA 4NC7A 4HZFA 3A01A 1NK3P 1BA5A 2M3AA 3BR3A 1IN7A 1S29A 5L3GA 1O3SA 4XN0A 3K2ZA 1XSXA 4UNOA 4ENJA 2XV4S 4KITB 2HOSA 1IRGA 2OA4A 1JKOC 1EA3A 4RLQA 5EF6A 2DXIA 3SFZA 3J7AO 5E3NA 1JT6A 3PFIA 3LSRA 5DM6F 1UG2A 2BZTA 1O4XA 3CCLI 2M2EA 4RAGA 4UUSB 2CUJA 2EV6A 5F0FA 4IJAA 3ZMSA 1IXCA 1W36C 2VPRA 1IN6A 3ZN0A 3GCMA 2VJ5A 2F5EA 3K70D 1WKMA 3ABTA 4L9NA 1FSHA 4J01A 1SFOJ 1HSTA 5LGTA 5D5XB 1BIBA 3HOSA 2ZJQF 4DOZA 1MIJA 2V1UA 4F93B 4ENNA 4MHGA 2ISZA 1I3AA 1AOYA 4GO1A 3HRSA 3SDGA 1V5EA 4DBRA 5KAFC 1JTXA 3ELKA 3H35A 3SEZA 1DUXC 2R7VA 2Y30A 3FBIB 2DPDA 2EQRA 3CUOA 1EKEA 3MFKA 3F23A 4XKCA 3SFIA 1U5TA 1ZG3A 1D1BA 2E19A 1VQOI 1SD5A 3HUGA 2XAGA 4BQNA 4I0AA 5FFXA 2NVUB 4BQOA 1S3JA 5EEGA 2K4BA 2DT6A 2O3FA 2VLAA 3KZIC 5B5EC 2CS3A 1K6YA 4Z6YA 3LFUA 1E2XA 2DJIA 2VXZA 1T0FA 2RQQA 4AYBN 1P7IA 4A3EJ 4XIDA 2I10A 5FLXZ 1HW1A 3PUBA 4RM3A 1KYWA 2IGKA 3F8NA 1J2XA 1VI0A 4HLXA 5BOXA 1ONVA 4FASD 1NG7A 2QBYA 4B47A 2D2WA 2XDVA 4Y7NJ 5LBQA 1VQMI 5DV5A 1H8AC 2NS8A 1OCZH 1RUNA 2OAZA 1FMVA 1K6OA 3JSOA 1B8IA 3K10A 4A3KJ 2KIUA 2NXNB 4RA2A 5DEQA 2VIXA 2OU2A 4HBLA 2JK3A 3WTYC 3WU2C 2LNBA 4LMYA 5A2QZ 3JSPA 1ZLKA 1BJAA 1U0JA 2LY2A 4AU7A 1RC9A 2JVGA 3HSFA 1U8RA 1NHAA 1ZREA 3GX4X 3M8EA 2R5ZA 2ZFWA 2K3PA 4IX7A 1JI8A 2K40A 2L9NA 1VQ4I 3HHGA 4A3FJ 1RNLA 1VZ0A 3Q9SA 4F52A 1B9NA 1D0YA 2ECBA 3WE3A 3HRMA 3HOYJ 1Z6RA 2EFNA 2GA1A 4P55A 4D1QA 1VQPI 2B0LA 2ZMEC 1WJCA 2E1MC 4BBRJ 2XSDC 4KN4X 3W6JB 2GOMA 1PDNC 2HXIA 3CP8A 1WJBA 3HSEA 1PUFA 2RKHA 4OIOF 3QYFA 3T8TA 4HF0A 3HGGA 4M73A 5LHGA 1T6SA 3SYTA 3UKGA 5TGTA 2M0CA 3V42A 4AC0A 4BKXA 1W5SA 3LSPA 4U0WA 1HW2A 1LJ9A 1YITI 4U7DA 1A04A 2CH0A 3RQ4A 4CZCA 2LKSA 4RB3C 1P2FA 1WJAA 3CC2I 3BP8A 5K1YA 5IT3A 2IA1A 4R8HA 3KP5A 2RVCA 1S9HA 1S7AA 5FD5A 3OY9A 1L3LA 1WJDA 5CQGA 2STWA 4S04A 3D5RC 4B8XA 4PJMA 3HJEA 4ZC3A 1EV7A 1TWGJ 2FMYA 4HNVA 2DO7A 4E7JA 3MVPA 2IS1A 4V19K 2CFXA 4M9ZA 2PG4A 1OCRH 1A5JA 1FOYA 2JA8J 3TOBA 4ZTFA 3MEXA 4IVNA 2EFOA 2IGMA 2GXAA 3DEWA 2DDAA 5B1AH 1MSFC 2F5VA 4CCJA 4GCVA 1OYIA 1MMAA 2EA2A 1HDDC 1EH6A 5IP7J 2A05A 4FX4A 3DU6A 3O8GA 3VFZA 1X19A 3M4OJ 5D6EA 1YW7A 2L02A 2E34A 5F04A 2GA2A 4HX8A 2GZWA 3A0HC 3BTJA 4ZYEA 1YX5A 3HIFA 3EUKL 1XMXA 2VJ4A 4M72A 4RGSA 9ANTA 2KJCA 1FOXA 2K7LA 4AIKA 1B9MA 3CDIA 1FTZA 3K6GA 3EETA 3RCOA 2ELHA 3MZYA 1ENHA 3FXUA 1B72A 2R7OA 2FUG2 1TNTA 2LF8A 3DFGA 1HXDA 1UCRA 1H89C 1MNDA 2FSWA 1MJAA 4PJ0C 4LB6B 3C2BA 2BHZA 1BN5A 1SMTA 1BI0A 3F8BA 1SFUA 1CF7A 4C3JJ 2DT7B 4I2OA 4CSWA 2M8GX 1J09A 1SFKA 3VSKA 3CDHA 5ICFA 2F2EA 2HQ5A 4B3XA 4HA8A 2FJ1A 4XORA 1DU6A 4D7NA 3TQNA 4BHPA 3CO6C 4KNYA 3VEPA 3L09A 2KZGA 5DM7F 4E4HA 4RDUA 3TW6A 4K2EA 2E2HJ 3BWGA 4XKBA 2BW3B 2YPRA 3OV8A 3R0AA 5BQTA 1X2NA 4EGYA 2K9NA 4A3CJ 3LAJA 5ILUA 3WTVC 4IOCF 1TL8A 2CV1A 3ZQCA 5JI6A 1G6NA 3M7GA 3GTJJ 2OZ6A 4I09A 3KYLA 3DP7A 1FSEA 3E97A 2C6YA 2F4OB 3O6BB 2GM4A 2P4WA 3LWFA 4B4CA 3DLLF 2FU4A 4M9SA 1YI2I 3LA2A 2HWVA 3KYCB 3F8CA 2OUMA 3HZJA 3BTCA 1FYKA 2RC4A 1P6RA 1LFBA 5D4SA 3N97A 2LKPA 3S1MJ 2JWTA 1BC7C 3OYBA 1QPMA 3JRIA 2FEZA 1W36D 2E2JJ 3QOEA 3OYFA 1XGMA 3K4LA 1HDPA 3CCMI 1JGGA 4KUMA 2VQGA 3IKTA 4A0ZA 3UR3C 3IWFA 3BG9A 1RKTA 2XUBA 2JZYA 4RB1A 4DBQA 3GFIA 2NOGA 4BEHB 2HQRA 3T0YA 3P7NA 1K78A 3H1CA 1F5TA 3ZPLA 2VT3A 2L01A 2LY1A 2DT5A 4UY8I 1H88C 3IV5A 3CLOA 4ESBA 4HX7A 2HXOA 3K7AJ 3CP2A 3VDXA 5GPCA 5L3EA 2VONA 4A6DA 4A3DJ 3ZXSA 3IC7A 4YELA 3ZQGA 1IN4A 1IGNA 3GF2A 3GFLA 2MA3A 2Q0OA 4F92B 3GMEA 4XL9A 2CGPA 1HKQA 4V2FA 2W57A 3BR0A 3L2UA 1HF0A 4YG2F 2KRFA 5M5YJ 2KRHA 3TP0A 2FOKA 1KU3A 4XLPF 1IDZA 2V1DA 3WTXC 1DPUA 1G59A 2IJLA 1ETXA 1I1SA 4M3FA 3EDPA 2O8XA 4OINF 4XLNF 3E7LA 2ZJPF 1E17A 2HYGD 1GT0C 4CUGA 2PFBA 1R58A 3H9GA 3JAMZ 1ZQ3P 5L3BA 4UXNA 3J7YJ 2V6CA 1R23A 2WA0A 5D5WB 5FROA 3ZQ7A 3EPZA 2CWEA 4IQJA 1R5HA 3TL4X 2WBMA 1B6AA 3S2DJ 4UUTA 4BE0A 2JA2A 3HHHA 2Z9OA 2RDPA 4ZH4F 2KZVA 1TLHB 4GXOA 4CDGA 5FKOA 2IS6A 2HU9A 1V5GA 3LA3A 1QZEA 3FMQA 1FJLA 3DLAA 2HPMA 2OTLI 2BXYA 1TW2A 3K4JA 5EZHA 5GAEJ 4IEJA 1AKHA 3NRVA 1Z1DA 2GXBA 4XLEA 3F6OA 1VFCA 2DQRA 1X4OA 4L18B 1XG1A 3FKIJ 1ON1A 4I02A 3JCUC 3K4CA 4XKVA 2LLKA 1USSA 2M30A 1P7JA 1ZG1A 2CRGA 3S1QJ 1N78A 2BXZA 1F1ZA 1SMYF 3C7JA 5F6FA 1FIAA 4AD9A 4IHSA 3RYPA 5K5RA 1ETQA 4KICA 5E3LA 4CICA 5K7FA 2G9WA 1ZRCA 3CCJI 3MKYB 3D1NI 4FHTA 2XHKA 2HDDA 4U7BA 1FX7A 1FMWA 2P8TA 3LFKA 5KNLA 2R5YA 3H5NA 1RESA 4ZYDA 5IT9Z 2MFZA 3CJTB 3G6EI 1BI1A 1LDKB 2PJPA 1R6RA 3S17J 4AIJA 2VE9A 1MBKA 4ETSA 5L3DA 3W2AA 3PSFA 1K7AA 1XCVA 2K9LA 1W7PA 1TWAJ 4M6YA 2FOWA 2WAEA 3CF2A 3EUHA 1W4MA 3Q0VA 2BY2A 2VBYA 1HKTA 5ICCA 2XRNA 3CO7C 3TBIA 3I59A 3HL2A 4A3JJ 3PNYA 2ME0A 3CQZJ 4XSXF 1QHHD 2EK5A 2V1NA 3KEQA 2DA3A 2LVSA 1SD4A 3WTZA 2M9HA 1LFPA 1LEBA 1FBSA 1YRNA 5LD2C 1GUUA 4D7MA 4A3BJ 4DZPA 1GVDA 1XX5A 5CYVA 1ON2A 2IA0A 2ZNZA 2QQBA 1U5TB 2K3FA 2O0YA 2CW8A 4CXFA 1R4MB 5GTHC 2KIMA 2OQRA 2L9VA 3HUGB 1WFXA 2MH2A 1MNMC 2VKEA 2W48A 5JR3A 5DUKA 2X6WA 4KA4A 1IUYA 4EMSA 2EV0A 3H3UA 4RGXA 4G8XA 4RLFA 5EG0A 2CU7A 1YS7A 1X1PA 2ELJA 1LDJA 2JRMA 4QLCU 1TBXA 1FT9A 2XIGA 4OAZA 5TJJA 1I1GA 3L1PA 2QUFA 4IRGA 1JGSA 1Y0UA 2M34A 2KL4A 5E20A 1YYVA 3HKZA 4BE2A 2KQRA 2KT0A 4MFDA 1WHUA 4MEXF 2KDOA 2E1NA 2YR2A 2M0MA 3L00A 4G7ZF 1P4XA 1LE8B 1A31A 2XF6A 1JE8A 3M8JA 2WWYA 4EVIA 4NHJA 2DOAA 1YX3A 1B59A 3CUQB 4HX4A 1TC3C 2QLZA 2JA7J 1SVOA 1IDYA 1YW8A 2XGCA 3KCCA 5KVRA 3EUAA 4XICA 3FM3A 3CCSI 2EJRA 3I64A 2M5WA 1DP3A 2GXGA 2F4IA 3A2KA 2L4MA 2XF7A 3DTKA 2LR8A 2K27A 1AWCA 2XGXA 5CKTA 1F36A 2E60A 4EM1A 2VKVA 4X6AJ 1WH5A 2H8WA 4G12A 4NBQA 3IWZA 3PQJA 1UG0A 1KZHA 2L4AA 5H6RA 1X1CA 2OZUA 3I9V2 5KAIC 1U9OA 3ZQHA 4FCYA 3IL2A 5AIQA 4RGUA 4F91B 3C3WA 4N4NB 1CQTA 4L0ZB 1ZGAA 5LRSA 2P0WA 3JRAA 1P4AA 3I4NJ 4XOPA 4HG2A 1D5YA 2IS2A 3BTIA 4Y13A 4HNUA 2BYVE 1KU2A 1IZ1A 2DA6A 4LFUA 1JUMA 1ZG5A 2HGCA 5EEAA 2OJED 5EGOA 1QVTA 3WTUC 1C0WA 2CSOA 5F1RA 1IO2A 4N0BA 4AIHA 1DGWY 5FJ8J 3JAMK 1ULYA 2QSHX 3PNVA 2P5VA 1MNEA 1WPKA 1FZPB 2L7KA 1O57A 3HSRA 3ZR8X 2PMZN 3GZ6A 3ZMTA 2LSOA 4ESJA 1YHQI 4EV0A 4MLOA 3E6MA 3M1CA 1XTAA 2ICWG 3MZ8A 1Y0NA 2DQLA 3LSIA 3HOVJ 2QVOA 2V7FA 3K4NA 1UFMA 3MKWB 4DQ2A 1E3OC 4EATA 2CW0F 2YSRA 5KHDA 1VQLI 4UUVA 1FYMA 2DK5A 4KIFA 3MCZA 1Z3XA 1QBJA 4M74A 3OSFA 3LMMA 2LP0A 3DPLC 4O3MA 3S8PA 4L5JA 5JLWA 2QQ9A 3FX3A 4A2UA 2LRDA 1YOVB 3RYRA 3GTGJ 3FXQA 4ZJZA 2QKLB 3BJAA 5HS9A 4HOBA 5HLGA 3ABLH 4ASNA 5LEKA 3HEFA 5FLVA 4IXAA 4MEYF 1X3ZB 4BJ6C 1DQUA 5GP9A 1WWXA 5K7HA 3EQLF 3RPQA 3W3CA 4QPOA 5D5UB 5IYDJ 3QYEA 1X3UA 2QA4I 5IT9K 4NUBA 3RTRA 1BC8C 1XB4A 4OIQF 3GEZA 4G7HF 3MD2A 5FD6A 4BY1J 4PGHA 2NNYA 4IRHA 2J5PA 2LTPA 1X1BA 1JKQC 3CUQC 2DFIA 4RB0A 1DDNA 2L7FP 4LK1F 2BVMA 3VSLA 4I99C 1F43A 1ZAOA 2MGQA 2XC7A 2IRFG 4IOAF 5J40A 2E36A 2PQ8A 2JN6A 1TT0A 2MG4A 4PK4A 2JJ7A 2XAHA 3H36A 2E1OA 4RAZA 2OCCH 3OYGA 5HLIA 3CC7I 1A36A 3OS1A 2PJRA 1IUFA 1UJ8A 4YFKF 1NTCA 3RDIA 5EDNA 1SD7A 2K9MA 5E8IA 2R7TA 2AXTC 2M4KA 2ZBKA 5KCMA 1KU7A 5IP9J 2NRAC 4IO9F 2PN6A 3BROA 1LDDA 3TDUC 5FO5A 4IHXA 5J47A 4PJLA 2P5LC 2O9LA 1XDUA 4ENKA 3J80Z 4A5MA 1GDTA 3Q0UA 5HLHA 2XF5A 3HOXJ 1JUSA 1R5ID 3PUFA 1GV2A 4MNUA 5LGNA 2N8GA 5D6FA 2RNJA 2PI0A 2A61A 2GOXB 4C2MJ 4E7ZA 1SVMA 1I50J 2A69F 5E3MA 3GTMJ 2NYXA 2W82A 4LLLA 4LK0F 2A3SA 2X6XA 3ZMVA 2QENA 2XKOA 2QGUA 2ZNYA 4M3DA 3E1SA 3S1NJ 3I0TA 4Y3OA 4CH7A 2XPUA 3TW7A 1IG7A 2HI3A 5M5WJ 4P96A 4LGWA 4D0PA 2UXXA 3MQ0A 3IHUA 4N4OB 4Z2YA 1WZ2A 1VF9A 4E7HA 3GUDA 3N05A 4QPQA 3P9KA 2FE3A 4L9JA 4CCKA 2CUFA 2VL8A 1LQ1A 2X1DA 3RPUD 2EPFA 2JMWA 3H3ZA 1OKRA 1MDMA 2GWRA 2VODA 1OR7C 4U0YA 2G0EA 2FBHA 3MKZA 3CCVI 1R36A 3K4MA 2CMPA 1ZGWA 4BH9A 5M3MJ 2VBZA 2CG4A 3DF8A 2Q1ZB 3H5RA 3ABUA 1GXPA 1A6QA 3HOUJ 1GHCA 1Q1VA 3G3ZA 3F8FA 4CYDA 4LG0A 1BIAA 1W0TA 2IS4A 1AHDP 5LLQA 3CJQB 3K1PA 4UV9A 4HF1A 3RI4A 1BW6A 1X2MA 3OMYA 4CO8A 4YIFA 3VOEA 2XAFA 2X51A 1YTYA 4CYCA 3GLXA 2IBDA 1RR8C 3W2WA 3HDDA 3M1EA 3ERMA 4OAYA 4PDKA 2QQAA 5E1ZB 2G7HA 2A5WA 1OYYA 3AFHA 4JX5A 2E2IJ 4BXFA 5KK1A 3CF5F 4CCLA 4S05A 3W2VA 1PVEA 2FXAA 2O61A 3A02A 5LHIA 2O03A 3DTEA 4P9FA 1Z9CA 1LVKA 3OYHA 1MBFA 2HVRA 3J81Z 2H27A 2Y48A 1RETA 2P5KA 3HC7A 3DU5A 1ZN2A 1MBJA 2YX4A 4E7LA 2P81A 1J59A 1KGSA 3NQOA 4J00A 5HNHA 4UB8C 2AQFA 3LA7A 4PZJA 3ZRGA 5F08A 2GIZA 4BAYA 4A93J 1TWHJ 2DOEA 2HKOA 1R7JA 3HYIA 3MKLA 5J4VA 4RMNA 1JXSA 1USTA 4X1EA 4LIVA 5DCFA 1OPCA 1N25A 1Y1VJ 2FX0A 2VJIA 4BS9A 1FP1D 4DZJA 2VOPA 1VQNI 4B3AA 1ITYA 1IXSB 2K5CA 4UV8A 3KLNA 5IOYA 4WWCA 1U3EM 1POGA 1N75A 2HPIA 3DV8A 2EWNA 2HVSA 5HOOA 2FF4A 3RQIA 2JSPA 2K86A 2L5QA 2P7VB 3I54A 2YX7A 3W6VA 4XLCA 3OYLA 1T38A 3NWSA 3AKZA 1GLNA 2W4SA 1YIOA 2L9SA 2LBFB 3NWTA 3BJ6A 2R5YB 3OYCA 4CCNA 3VODA 3QQAA 1UMQA 5IYBJ 4YFNF 2X0LA 1D8JA 1XSVA 3FWEA 2VQCA 4IHWA 2MD0A 2ZMEA 3Q3SA 1Q1HA 5CVRA 1D1AA 1W7PB 2OQGA 3LQQA 3R4KA 3HTSB 2EZIA 3C18A 3HTUA 3Q5FA 3IRQA 3BG6A 4NNJA 3MWMA 2A07F 3BG7A 2BHYA 5ICEA 2EV5A 5FB2A 3UNGC 1MJ9A 1HSJA 2HQNA 1G2HA 3ISPA 3DPUA 5BS6A 2EZKA 4B09A 2VB6A 4D5FA 1R9TJ 1UHSA 3VYTB 4LIUA 3OIQA 2XB5A 4B1RA 4UUSA 2IGOA 4YRVA 4JYKA 3SQNA 1G3WA 3GFJA 1J9IA 3MZHA 3CLQA 3E5XA 3BR1A 3O2PE 3AG4H 1QPIA 2LDUA 2MABA 4IF4A 2XSJC 1ZRFA 3FXLA 1ZH5A 3FXMA 3SJMA 2H1KA 3WTWC 4HLYA 1IC8A 2L7ZA 6PAXA 5M5XJ 1BR1A 2HTSA 3U21A 3H0DA 2DBBA 1FY7A 2RQPA 1SFEA 1SC7A 3J80K 2MLGA 1K4TA 3CCUI 4UHTA 1X1DA 3I4PA 3S2WA 3FXRA 2R7SA 2DA4A 3F22A 2IA2A 4XNFA 2XAQA 3OIPA 3J7ZI 3OSGA 2D1VA 5FLXK 3WGHA 1F9NA 3HOZJ 3H0GJ 2R7RA 3S3MA 4L9TA 3ZP5A 2XPWA 2PLYA 3LSHA 4ITVA 2MW8A 2ZXWH 1XSDA 1JHFA 2R4GA 4GYIA 4MTEA 3G71I 3GTKJ 2IXSA 1SD6A 3OR2C 4EM0B 5E79C 4BXXJ 2JPBA 4BHCA 3GTOJ 3CCQI 4A3GJ 1ZHFA 4BJTA 3N4MA 4RAFA 4ENMA 3FISA 5LEJA 2CUEA 4GYGA 4HRIA 4AIDA 1MH3A 2QF7A 4W1UA 4QSHA 5A2QK 3GO5A 3MMYB 5GAHJ 4LLNA 1V3FA 1YG2A 1YLFA 1BBYA 4HAMA 2ZO4A 2EB7A 4YEJA 4JBAA 1EJ9A 1YS6A 3CZ6A 5IPAA 2NVXJ 4NQWA 2BV6A 2QYOA 4C3HJ 2B9SA 1RKWA 2EBIA 4DJAA 1A6IA 2KFDA 3HM5A 5J1YA 4IRIA 1OCCH 3ZMUA 3GTQJ 2ID6A 1XD7A 1WVRA 1R1TA 2ID3A 3QPHA 1OCPA 1U6GA 2HDCA 4I01A 1VQ6I 1WQ2A 2A6HF 4OOIA 2WAQN 1UB9A 3HPHA 3JTHA 1O3TA 1Z0XA 4G9YA 4HEA2 2DU9A 4BHBA 5L3CA 3KYDB 4Q4ZF 1ZGJA 2GAUA 3KP6A 4DIQA 3JRCA 3CD6I 3F72A 4XQFA 1OFCX 2X1CA 1K61A 4EJTA 4UB6C 1T39A 4ZDPA 5B1BH 1R1VA 1ZTRA 2XROA 1UZCA 3H3VK 4W97A 4PFPA 2X6YA 4RS8A 2HKXA 1I6XA 1KONA 2BY0A 4EQQA 5JVGF 1UELB 3E5QA 3BG5A 1APLC 2LD5A 4G7OF 3CCYA 3G73A 2OCEA 1FC3A 3PO3J 3FXOA 4II2A 3L2VA 2O8KA 1QU3A 1I3QJ 3J81K 3M9AA 1XCBA 2QQ8A 4MFEA 3QP6A 5AONA 2L2OA 5HNFA 2DW4A 2ZJRF 2LKXA 1B1BA 3R61A 5C3EJ 4BQAA 1ZR4A 1WJFA 1MW7A 2LFBA 2NOJB 1XPXA 1TT5B 1VQ8I 3D5SC 1WI9A 2JUGA 5EEHA 4ZTJA 2AXLA 2F5CA 4QWQA 4A3LJ 2LC2A 5J1UA 1WCMJ 1BI2A 1G4DA 2Q2EB 3DKXA 1I6HJ 3BLYA 3RIRA 1JUPA 2Z16A 1ZK8A 2PMHA 2V4JC 3CMAI 3GBGA 1TWFJ 5DCMA 3KP2A 5JVTA 1HKSA 5DD4A 3BC8A 3A01B 1MBHA 3HG9A 1V54H 1SVLA 1O3QA 2AS5F 4Q47A 3T8RA 1S5LC 4OIRF 1DU0A 2JPCA 2KJBA 3PSIA 4OWRB 3V8LA 3RZDJ 3TO9A 5CVJA 1U8BA 2BY3A 2X4HA 1LUJB 1IXRC 2FA5A 2X9DA 3JTGA 3OR1C 2QM3A 1O7FA 5DTDA 3WG9A 1W0UA 3FM5A 1S6LA 4DYRA 2D5VA 1TWCJ 4JOMA 2L9RA 2X1EA 2IEKA 4M3BA 3FDYA 2V9KA 1IV6A 2EIKH 4GFBA 3DKYA 3AG3H 5K5OA 1RR7A 3ZQQA 2R7ZJ 4HQMA 1TNSA 1A35A 1Z77A 3H9JA 5D4RA 1V4RA 4M3GA 1EH8A 4R79A 3BQYA 3B02A 3BR6A 3GFMA 3CJNA 3K1MA 4I0BA 1YJNI 2ZXHA 3KFWX 3TOAA 3H9QA 2HR3A 4Y52J 3L2CA 2LYCA 2JTVA 3G1LA 5H6QA 3VPRA 3V8KA 4A12A 3E3VA 4NB5A 1ACIA 2XASA 1ZYRF 4U0VA 4Y15A 1J7KA 1FP2A 1RRJA 3QPSA 1FNNA 2E35A 4CCMA 1Z6TA 3TEDA 1CGPA 5BMZA 2WADA 3D0SA 1D5VA 3GWZA 2G7UA 3S14J 4S0HB 2QSFX 2UXNA 4L5IA 3KPHA 3OWTA 4KIBA 4XBFA 1V5FA 3V7CA 5HS8A 4UVCA 3V7SA 2KKOA 1ODDA 2PMUA 1BL0A 2QBYB 2ESHA 1LEAA 2Z1DA 1XMKA 3BZCA 2BW3A 2R0QC 3ERED 4ZZLA 4DNCA 3QAHA 2AHQA 4A6EA 1B8IB 1WRJA 1SANA 2WB1N 2P6SA 2PMZA 3LSMA 5M3FJ 1HBXG 2QSGX 4XK4A 1BM9A 1YFHA 3TO6A 2Y75A 3REOA 3FXJA 5LFAA 2E71A 1T98A 1JT0A 3DBRB 2DPUA 3DXJF 5IYCJ 1D3YA 1REPC 5HS7A 2HYJA 4JX4A 5GADJ 3GTLJ 2W1OA 4RGRA 1J5YA 3I71A 1JJ6C 2R5ZB 5C44J 4DW6A 2KMUA 3S3NA 2VC0A 4C9YA 3AG2H 1BI3A 1Z67A 2VC1A 2VKDA 4WF2A 5L3FA 4EM2A 3EYIA 1GV5A 2F5FA 4DGWB 2KIQA 4F3QA 3WGIA 4HDVA 3RKQA 2X48A 2Z99A 3I56I 2Y0SA 3TKYA 2VT2A 2EZLA 2YUSA 3JREA 1HQCA 4AM3A 3P5JA 4MQ9F 3WTTC 1FPQA 1TQMA 2HYFA 3BT9A 1PUFB 2L54A 5DYMA 3ZQIA 4I98B 1YJWI 2JQ7A 4BEHA 5J8CA 2DA2A 2H94A 5CVIA 4PSXA 1QO0D 2JUCA 2DCEA 2EA4A 1IRFA 4CYCB 4ON0A 4AUXA 3D5LA 5ERIA 4HV5A 2Y2ZA 3A03A 2IGNA 4E7KA 3SZPA 1ZR2A 1S7OA 2R7WA 3RKXA 1OCTC 2R7QA 3QU6A 2CV2A 2W00A 3RJPA 3PIOF 1E0EA 3NARA 2ELKA 1KQ8A 2D1HA 3ASNH 5E3OA 4ZYHA 2DN0A 3BY6A 5B66C 5FGMA 2Z5UA 2BVLA 2MSYA 1ZKGA 3CESA 3CC4I 4L5EA 2RREA 2NVTJ 1SEUA 2ETHA 3BZ6A 4FETA 1U2WA 3S1RJ 2D45A 1W1WE 1Y56A 2W7NA 3LL7A 4E7SA 1D0XA 3G4SI 1PP7U 3PFYA 2ZCWA 2RNGA 1ZLJA 3WU0A 1FOWA 2DMPA 5HODA 2HTJA 3U9GA 1IN5A 2RN7A 1M1EB 2Z3YA 4IQ4A 1WJ5A 2PEXA 1U5TC 1T08B 4LLGF 5D8KB 5C4XJ 2O5RA 1EF4A 1TZLA 2DFHA 3QPLA 4C30A 2M7BA 1JJ8C 1Z05A 5GAGJ 3OYJA 1P4WA 5ILVA 2V1XA 2MYSA 4ZDLA 3RZOJ 3SZTA 1MJBA 1HOMA 4M6XA 4BL0B 4XRSG 2K85A 2L7MP 3HBLA 2A6TA 3FIWA 1T0FC 2NVYJ 3TGNA 1Z3YA 3T1BA 4BY7J 1OCOH 3ABKH 4AYBA 5TISC 2BEOA 2F5DA 2LF7A 3HB9A 3TP3A 1R1UA 2YU3A 1HA8A 2KLOA 4EJUA 1B72B 4KYWA 1R5GA 1RZ4A 3JW4A 3E6CC 3PIPF 4XLFA 2GIVA 3LAPA 3L2RA 3I5UA 4N9IA 2UUZA 2EZHA 1W7PD 1QVUA 4M71A 2DYRH 3U1DA 4GRIA 3I53A 4BXUA 1CF7B 1YJ9I 1IRZA 2COBA 2DMUA 5LGUA 5BPDA 3DQVC 4IHVA 1MMDA 3PJRA 4EJWA 3V7RA 1D0ZA 1MBEA 3IH2A 2GLOA 3F21A 1TQPA 5JFRA 3ASOH 3PL8A 3DPTA 3ROUA 3HRUA 2ZB9A 3ESWB 2HZDA 4DYQA 4HV6A 2FBKA 3AL0B 3FMSA 4OMYA 3M8FA 1XGOA 4KJZA 2B7EA 2STTA 2M7AA 2VOOA 4LD5A 5B3SH 4XRMA 4AVZA 3GYHX 3KP3A 2QWWA 2L3DA 1VQ9I 3R6SA 2XGDA 3OS2A 3JRDA 2VKHA 5J6XA 3OYMA 4MGRA 1FOKA 3PNTA 3FF5A 1J0RA 2IT0A 4WCGA 2EH3A 5J1RA 1Y6IA 5J4YA 1WSUA 1OISA 2LOOA 2NVQJ 2BOLA 3VWBA 1IF1A 3CDLA 1KQ9A 3MN2A 4QIWN 2FD5A 3QWLA 4B44A 3OYEA 1S8NA 2OD5A 2ZXIA 1RPWA 1JHHA 2DA7A 1AA7A 1G3TA 2E1CA 3HOTA 1UHMA 1QZYA 3I4MJ 2O7OA 3ULQB 2YS9A 5LHHA 1S7EA 1QGPA 4FE7A 1R49A 4BU2A 5JHFA 3DCFA 2XB0X 4I7HA 1GVJA 2MBFA 2ESNA 5H2FC 4ANJA 5CVUA 1K78B 3GVAA 4ESFA 4BUPA 2IVMA 1KQ0A 5H20A 4FX0A 1R4NB 4RM2A 4NQWB 4OIPF 1VQKI 5FKKA 1LE8A 3C2HA 3OYIA 4ZDOA 2BY1A 4KN7X 3KEOA 4E7IA 2W85A 3CUQA 4CGZA 3SEQA 2DMNA 1FWZA 3O3KA 2H8RA 3DWLE 5CVVA 4ZYAA 2DFFA 3SDBA 5E18F 4A0YA 4BBSJ 4NDLA 4BNCA 3E5UA 3CTAA 3BDDA 1K4SA 2FQ3A 1WGXA 2EFQA 1S72I 2QCOA 4KISA 1BR2A 2PX9A 1QHGA 3WODF 2KRCA 2O6GE 4Y17A 2BE5F 3KIOA 3Q0WA 5JLXA 3HOWJ 3F8MA 4WXCA 5DUIA 2QEXI 2LH9A 4H4KC 2EILH 2FQ4A 2Y69H 5E1XA 2A68F 2ECCA 3P9CA 3OYNA 1K79A 1I27A 2L0KA 2XPVA 3GW2A 1T33A 4HSTA 4A0XA 4C3IJ 1HCRA 2V79A 1ZARA 3FXKA 2CO5A 2M8EA 2VQLA 4HPQA 2E5ZA 5GPAA 4YIRX 2XAJA 3WE2A 1X58A 1JTYA 1O3RA 4CHUA 1ETKA 4WK8F 2KP6A 2IAIA 3VB2A 2H09A 2HEOA 5FKNA 4GGGA 5HDNA 2I5UA 3AL0C 5HVQC 1YQAA 4P5OA 2VN2A 2HOTA 1AKHB 2CV0A 2K4JA 1SFXA 5ED4A 4MIMA 4BE1A 5JHUA 3KP4A 3JRHA 2VQHA 2HQAA 2YU9J 4LB5A 3DTIA 4E70A 4BACA 1STZA 2VXDA 5DCMB 4CCOA 4XSZF 3MAJA 4I6ZA 3IUOA 2P6TA 4RB2C 3P9IA 1Z21A 2H6BA 4G6TB 4IZZA 3J7AY 2ZXJA 1OQYA 2KISA 1PUEE 1BJZA 2CYYA 2UV1A 1WI3A 4Q48A 2R7FA 1ETYA 3DBLB 3OS0A 3E6DA 1OR7A 3LOCA 5E1WA 5BPIA 4IL6C 1MMGA 1IJWC 2JRTA 5HLTA 4HDUA 3K1NA 2NS0A 2LREA 3C2GA 3RSNA 4HYEA 2F4MB 2LG4A 2JA5J 2ISYA 3L7WA 4XONA 2ACJA 4MTDA 3I59B 2FMLA 1KA8A 3FK6A 3OL3A 4MO7A 3JRGA 3FHZA 4BGDA 2VPLA 2V9PA 3L9FA 1FBUA 1RIOH 5ILSA 2OC6A 1UHWA 3CMEI 1YRNB 4BYYA 1H0MA 2VE8A 2HZTA 1MZBA 1YE9A 1QQIA 1E3PA 4JP0A 3VYSB 1B4AA 3HXLA 4M6VA 2XRLA 3QP5A 2IP2A 4A3IJ 1K83J 3DKWA 3TMOA 3CMYA 2DTZA 2Y0MA 4F55A 1LNWA 2F48A 1T8IA 5EG0B 2OTJI 2WAQA 3AAFA 2KIFA 2RAEA 3DEEA 1XGNA 2NS7A 3OIOA 3RKWA 3JRBA 3LNQA 5TRDA 1FLIA 3FHNA 3ZN1A 2J5OA 1NG6A 3IP4B 2BBYA 3FZVA 1HW5A 4KIGA 1FTTA 2Y31A 4A5NA 2XGEA 3OYDA 4IHYA 1ERDA 2FNAA 2F6CA 4G6QA 2B63J 5AIPA 5HDGA 3TO7A 3B6AA 4CA0A 2W24A 4IHTA 1D8KA 4ZZDA 4BDYA 3B6CA 4LJZF 4EJVA 3WTSC 4D9JA 1QRYA 2CQNA 2EINH 4DYCA 4J19A 3GZNB 3COAC 3Q9VA 4HNTA 1XMAA 3BCBA 1JKRC 2V6EA 4AVPA 1QA6A 2W84A 3FK7A 2DLLA 3B73A 3QOPA 1YW9A 3GZ5A 2TCTA 3T5XA 3F9KA 4F7ZA 2WV0A 3KX2A 1XS9A 3S15J 1VTNC 1SAUA 3E6BA 4XLAA 1DPRA 3WGGA 2E7XA 3BJOA 2KDZA 3BPXA 2DOFA 1OYWA 5FKLA
chains in the Genus database with same CATH topology
5FFZA 3K0LA 1SAXA 4JQFA 3C1DA 3SHFA 1H9TA 2COMA 1TW3A 3I58A 3DEUA 4L9VA 3IKVA 3V8JA 2RV8A 3KE2A 2V9VA 4AWXB 2ZJ2A 1YO5C 4KMFA 4P9UA 3R60A 2Z33A 1QNTA 3F6VA 2JSCA 4YIIA 2DAOA 1KU9A 3ECHA 5J8FA 3F3XA 3QRFF 4KMUX 3KETA 1IW7F 3WU1B 4G94A 2M87A 2OBPA 2FNPA 4FT8A 2H6CA 2VBXA 1EH7A 2MD5A 2A6EF 3KLOA 5E8GA 2JT1A 2CQKA 2EFPA 4WXHA 3ZMDA 1ZRDA 4HF2A 1L0OC 3TDZC 1P92A 4MQVA 2DK8A 2BGCA 4EJOA 2DTRA 2QZ8A 4PCQA 2TDXA 3NEUA 2WC2A 4UVAA 1DP7P 2E7WA 2WTEA 2A5YB 2R3SA 4HW0A 1MGTA 4OU0A 1PP8F 4EGZA 3OOPA 1Z7UA 1XDSA 4KFCA 2NNNA 3KP7A 3U2RA 5D5VB 2Q8KA 3PQKA 1H9GA 1GXQA 2RGVA 2M45A 2R7DA 4PGGA 4RAYA 3ZMZA 2HOEA 1XN7A 3QPTA 4IPAA 1MKMA 3K69A 2ZKZA 2M1BA 2XVCA 3H92A 3GXOA 2EFWA 3ML6A 3LSTA 4KDPA 1LB2A 4H0EA 2UZKA 1G3YA 5DDGA 1FYLA 4CZZA 3KZYA 1XGSA 2MC3A 5CLSA 4OMZA 3ECOA 1MD0A 1J75A 1RI7A 4R1HA 2W25A 3EYYA 3KZZA 3QU3A 1I5ZA 2XKPA 2FRHA 5E17F 3HRTA 2PBIA 1LVAA 5HDKA 3V4GA 2K02A 1MDMB 1W5TA 2DI3A 1G3SA 1RUOA 2MH9A 3W6KB 4U88A 4KT5C 5D8LB 4LG0B 5K5QA 4M9XA 1OMIA 3R0JA 1IN8A 5ICGA 5F64A 5DD8A 3RKYA 1O7LA 4Q5SF 3RPUA 5LRRA 1U78A 3IRRA 1TQIA 1IAWA 4G6DA 1KYZA 2P7CB 1R22A 4WX9A 4YFXF 1TTYA 4WXDA 2VBWA 2NAZA 2ADUA 4N9HA 4TV7A 2IW5A 1Z91A 4XRFA 4L0YB 4O5VA 3BOQA 4UVBA 3LQRA 4ZYGA 1T2KA 2IPQX 2MLKA 3BPVA 4O6JA 2UWMA 2HS5A 1R00A 2GQQA 2FBIA 5CJ9A 4JK1X 3K9TA 2HFHA 3SXYA 1QZZA 1BOAA 2Q2EA 2ZMEB 4HQEA 1FBQA 1F4KA 3FMRA 4HZFA 1IN7A 1S29A 5L3GA 1O3SA 3K2ZA 1XSXA 4UNOA 4ENJA 2XV4S 1IRGA 2OA4A 3SFZA 3J7AO 3PFIA 2EV6A 4IJAA 3ZMSA 1IXCA 1IN6A 3ZN0A 2F5EA 1WKMA 3ABTA 4L9NA 1FSHA 1HSTA 5LGTA 5D5XB 1BIBA 3HOSA 2V1UA 4ENNA 4MHGA 2ISZA 1AOYA 4GO1A 3HRSA 3ELKA 1DUXC 2DPDA 3CUOA 3MFKA 3F23A 1U5TA 1ZG3A 1SD5A 3HUGA 2XAGA 4I0AA 5FFXA 1S3JA 5EEGA 2K4BA 2O3FA 1E2XA 2VXZA 1T0FA 5FLXZ 1HW1A 1KYWA 3F8NA 1J2XA 4HLXA 5BOXA 1ONVA 2QBYA 2D2WA 5LBQA 5DV5A 1RUNA 2OAZA 1K6OA 3JSOA 2KIUA 5DEQA 2OU2A 4HBLA 3WTYC 2LNBA 4LMYA 5A2QZ 3JSPA 1ZLKA 1BJAA 3HSFA 1U8RA 1NHAA 1ZREA 3GX4X 3M8EA 2ZFWA 3HHGA 1RNLA 3Q9SA 1B9NA 3WE3A 3HRMA 1Z6RA 2EFNA 2GA1A 4P55A 2B0LA 4KN4X 3W6JB 1PDNC 3HSEA 2RKHA 4OIOF 3T8TA 4HF0A 4M73A 5LHGA 1T6SA 1W5SA 4U0WA 1HW2A 1LJ9A 4U7DA 1A04A 4RB3C 1P2FA 3BP8A 5K1YA 5IT3A 2IA1A 4R8HA 3KP5A 2RVCA 1S7AA 5FD5A 1L3LA 2STWA 4S04A 4B8XA 1EV7A 2FMYA 2DO7A 2CFXA 4M9ZA 2PG4A 3TOBA 3MEXA 4IVNA 2EFOA 4GCVA 1OYIA 2EA2A 1EH6A 4FX4A 3VFZA 5D6EA 1YW7A 2L02A 2GA2A 4HX8A 2GZWA 4ZYEA 3HIFA 4M72A 4RGSA 2KJCA 2K7LA 4AIKA 1B9MA 3EETA 2ELHA 3MZYA 3FXUA 2LF8A 1TNTA 3DFGA 1HXDA 1UCRA 2FSWA 1MJAA 4LB6B 1BN5A 1BI0A 1SMTA 3F8BA 1SFUA 1CF7A 4I2OA 3CDHA 5ICFA 2F2EA 4HA8A 3TQNA 4BHPA 3CO6C 4KNYA 3VEPA 3L09A 4K2EA 3BWGA 2YPRA 3OV8A 3R0AA 5BQTA 4EGYA 3LAJA 5ILUA 3WTVC 5JI6A 1G6NA 3M7GA 2OZ6A 4I09A 3DP7A 1FSEA 3E97A 2C6YA 3O6BB 2P4WA 3LWFA 2FU4A 4M9SA 3LA2A 2HWVA 3F8CA 1FYKA 2RC4A 1P6RA 5D4SA 3N97A 2LKPA 1BC7C 1QPMA 2FEZA 1XGMA 4KUMA 3IKTA 4A0ZA 3IWFA 2XUBA 2JZYA 4RB1A 3GFIA 2HQRA 3T0YA 3P7NA 1K78A 1F5TA 3ZPLA 2VT3A 2L01A 2DT5A 3CLOA 4ESBA 4HX7A 5L3EA 2VONA 4A6DA 3IC7A 1IN4A 3GF2A 3GFLA 2MA3A 2Q0OA 2CGPA 1HKQA 2W57A 4YG2F 2KRFA 2FOKA 1KU3A 4XLPF 2V1DA 3WTXC 1DPUA 2IJLA 1I1SA 3EDPA 2O8XA 4OINF 4XLNF 1E17A 2HYGD 2PFBA 1R58A 3JAMZ 5L3BA 4UXNA 2V6CA 1R23A 5D5WB 3ZQ7A 2CWEA 1R5HA 1B6AA 3HHHA 2Z9OA 2RDPA 4ZH4F 1TLHB 4GXOA 4CDGA 3LA3A 3FMQA 1TW2A 3NRVA 1Z1DA 2GXBA 3F6OA 2DQRA 4L18B 1ON1A 4I02A 1USSA 2M30A 1ZG1A 1F1ZA 1SMYF 3C7JA 5F6FA 4AD9A 4IHSA 3RYPA 5K5RA 4KICA 4CICA 2G9WA 1ZRCA 4FHTA 2XHKA 4U7BA 1FX7A 2P8TA 3LFKA 4ZYDA 5IT9Z 1BI1A 1LDKB 2PJPA 4AIJA 2VE9A 4ETSA 5L3DA 1K7AA 1XCVA 1W7PA 4M6YA 3EUHA 1W4MA 2VBYA 1HKTA 5ICCA 2XRNA 3CO7C 3I59A 4XSXF 2EK5A 3KEQA 1SD4A 3WTZA 1LEBA 1FBSA 5CYVA 1ON2A 2IA0A 2ZNZA 1U5TB 2QQBA 2O0YA 4CXFA 2KIMA 2OQRA 2MH2A 5JR3A 5DUKA 4KA4A 1IUYA 4EMSA 2EV0A 3H3UA 4RGXA 4G8XA 1YS7A 1LDJA 4QLCU 1TBXA 1FT9A 2XIGA 5TJJA 1I1GA 2QUFA 4IRGA 1JGSA 1Y0UA 5E20A 1YYVA 4MEXF 2E1NA 2YR2A 3L00A 4G7ZF 1P4XA 1JE8A 4NHJA 2WWYA 4EVIA 1B59A 3CUQB 4HX4A 2QLZA 1YW8A 3KCCA 5KVRA 3FM3A 2EJRA 3I64A 2M5WA 2GXGA 2L4MA 2K27A 1AWCA 2XGXA 4EM1A 3IWZA 3PQJA 2L4AA 5H6RA 2OZUA 3IL2A 5AIQA 4RGUA 3C3WA 4L0ZB 1ZGAA 5LRSA 1P4AA 4Y13A 2BYVE 1KU2A 1IZ1A 4LFUA 1ZG5A 2HGCA 3WTUC 1C0WA 2CSOA 5F1RA 4N0BA 4AIHA 3JAMK 1ULYA 2P5VA 1FZPB 1O57A 3HSRA 3GZ6A 3ZMTA 2LSOA 4ESJA 4EV0A 3E6MA 2DQLA 2QVOA 1UFMA 4DQ2A 2CW0F 2YSRA 4UUVA 1FYMA 2DK5A 4KIFA 3MCZA 1QBJA 4M74A 3DPLC 4O3MA 4L5JA 2QQ9A 3FX3A 4A2UA 3RYRA 3FXQA 5HS9A 3BJAA 4HOBA 5HLGA 4ASNA 5LEKA 4IXAA 4MEYF 1WWXA 3EQLF 3RPQA 5D5UB 1X3UA 5IT9K 3RTRA 1BC8C 1XB4A 4OIQF 3GEZA 4G7HF 5FD6A 4PGHA 2NNYA 4IRHA 2J5PA 3CUQC 2DFIA 4RB0A 1DDNA 4LK1F 1ZAOA 2IRFG 2PQ8A 2XAHA 4RAZA 5HLIA 4YFKF 3RDIA 1SD7A 5E8IA 2ZBKA 1KU7A 2NRAC 2PN6A 3BROA 1LDDA 3TDUC 5FO5A 2P5LC 1XDUA 4ENKA 3J80Z 4A5MA 5HLHA 4MNUA 5LGNA 5D6FA 2RNJA 2PI0A 2A61A 2A69F 2NYXA 4LLLA 4LK0F 2A3SA 3ZMVA 2QENA 2XKOA 2ZNYA 3I0TA 4P96A 4LGWA 4D0PA 2UXXA 3MQ0A 3IHUA 4Z2YA 3GUDA 3P9KA 2FE3A 4L9JA 1LQ1A 3H3ZA 1OKRA 1MDMA 2GWRA 2VODA 4U0YA 2FBHA 1R36A 4BH9A 2VBZA 2CG4A 3DF8A 3ABUA 1GXPA 1GHCA 3G3ZA 3F8FA 4CYDA 4LG0A 1BIAA 5LLQA 3K1PA 4UV9A 4HF1A 3RI4A 4YIFA 4CO8A 3VOEA 2XAFA 1YTYA 3GLXA 3M1EA 4PDKA 2QQAA 5E1ZB 2G7HA 1OYYA 5KK1A 4S05A 2FXAA 2O61A 5LHIA 2O03A 4P9FA 1Z9CA 3J81Z 2H27A 2Y48A 2P5KA 1ZN2A 1J59A 2YX4A 1KGSA 3NQOA 3LA7A 4PZJA 4BAYA 2HKOA 1R7JA 3HYIA 1JXSA 1USTA 5DCFA 1OPCA 1FP1D 2VOPA 1IXSB 4UV8A 3KLNA 4WWCA 1U3EM 3DV8A 2EWNA 5HOOA 2FF4A 2K86A 2P7VB 3I54A 2YX7A 1T38A 1YIOA 3BJ6A 3VODA 4YFNF 2X0LA 1D8JA 1XSVA 3FWEA 2ZMEA 1Q1HA 5CVRA 1W7PB 2OQGA 3LQQA 3R4KA 3HTSB 3C18A 3HTUA 3Q5FA 3IRQA 3MWMA 2A07F 5ICEA 2EV5A 5FB2A 1MJ9A 1HSJA 2HQNA 3ISPA 5BS6A 4B09A 3SQNA 1G3WA 3GFJA 1J9IA 3MZHA 3E5XA 3O2PE 2LDUA 4IF4A 1ZRFA 1ZH5A 3WTWC 4HLYA 6PAXA 2HTSA 2DBBA 1FY7A 2RQPA 1SFEA 3J80K 2MLGA 4UHTA 3I4PA 3S2WA 3FXRA 3F22A 2IA2A 5FLXK 2XAQA 2D1VA 3WGHA 1F9NA 4L9TA 3ZP5A 2PLYA 1XSDA 1JHFA 4GYIA 4MTEA 1SD6A 4EM0B 2JPBA 4BHCA 1ZHFA 3N4MA 4ENMA 5LEJA 4GYGA 5A2QK 3GO5A 4LLNA 1V3FA 1YG2A 1YLFA 1BBYA 4HAMA 2ZO4A 2EB7A 4JBAA 1YS6A 4NQWA 2BV6A 2QYOA 4IRIA 3ZMUA 1XD7A 1R1TA 3QPHA 1U6GA 2HDCA 4I01A 1WQ2A 2A6HF 4OOIA 1UB9A 3JTHA 1O3TA 4G9YA 2DU9A 4BHBA 5L3CA 4Q4ZF 1ZGJA 2GAUA 3KP6A 3F72A 4EJTA 1T39A 1R1VA 2XROA 4RS8A 2HKXA 1I6XA 4EQQA 3E5QA 4G7OF 3G73A 1FC3A 3J81K 3M9AA 1XCBA 3QP6A 5AONA 2DW4A 1B1BA 3R61A 4BQAA 1WI9A 5EEHA 2AXLA 2F5CA 4QWQA 1BI2A 1G4DA 3RIRA 2PMHA 5DCMA 3KP2A 5JVTA 1HKSA 5DD4A 1O3QA 2AS5F 4Q47A 3T8RA 4OIRF 2JPCA 2KJBA 3V8LA 3TO9A 5CVJA 2X4HA 1IXRC 2FA5A 3JTGA 2QM3A 1O7FA 3WG9A 3FM5A 1S6LA 5K5OA 4HQMA 1TNSA 5D4RA 1V4RA 4R79A 1EH8A 3B02A 3GFMA 3CJNA 3K1MA 4I0BA 3KFWX 3TOAA 2HR3A 3L2CA 2JTVA 5H6QA 3V8KA 4A12A 3E3VA 4NB5A 2XASA 4U0VA 1ZYRF 4Y15A 1J7KA 1FP2A 1FNNA 1Z6TA 1CGPA 5BMZA 3D0SA 1D5VA 3GWZA 2G7UA 2UXNA 4L5IA 4XBFA 4KIBA 5HS8A 3V7CA 4UVCA 3V7SA 2KKOA 1ODDA 2PMUA 2QBYB 2ESHA 1LEAA 1XMKA 3ERED 4ZZLA 4DNCA 3QAHA 4A6EA 1WRJA 2P6SA 1HBXG 1BM9A 1YFHA 3TO6A 2Y75A 3REOA 1T98A 2DPUA 3DXJF 1D3YA 1REPC 5HS7A 4RGRA 1J5YA 3I71A 2VC0A 1BI3A 2VC1A 4WF2A 5L3FA 3EYIA 4EM2A 2F5FA 3WGIA 4HDVA 2Z99A 3TKYA 2VT2A 1HQCA 4MQ9F 3WTTC 1FPQA 1TQMA 2HYFA 2L54A 5DYMA 4I98B 5J8CA 2H94A 5CVIA 1QO0D 2EA4A 1IRFA 4ON0A 3D5LA 5ERIA 4HV5A 3SZPA 1S7OA 3RKXA 3QU6A 3RJPA 1KQ8A 2D1HA 4ZYHA 3BY6A 5FGMA 2Z5UA 2ETHA 3BZ6A 1U2WA 2D45A 1PP7U 2ZCWA 1ZLJA 3WU0A 2HTJA 3U9GA 1IN5A 2RN7A 2Z3YA 4LLGF 2PEXA 1U5TC 5D8KB 1Z05A 1P4WA 5ILVA 2V1XA 3SZTA 1MJBA 4M6XA 3TGNA 3T1BA 2BEOA 2F5DA 2LF7A 1R1UA 2YU3A 4EJUA 4KYWA 1R5GA 1RZ4A 3JW4A 3E6CC 2GIVA 3LAPA 3I5UA 4N9IA 1W7PD 4M71A 3U1DA 3I53A 4BXUA 1CF7B 5LGUA 5BPDA 3DQVC 4EJWA 3V7RA 3F21A 1TQPA 5JFRA 3DPTA 3ROUA 3HRUA 4HV6A 2FBKA 3FMSA 4OMYA 3M8FA 1XGOA 2STTA 2VOOA 4LD5A 3GYHX 3KP3A 2QWWA 2L3DA 3R6SA 5J6XA 4MGRA 1FOKA 3FF5A 1J0RA 2IT0A 4WCGA 1WSUA 1IF1A 1KQ9A 1S8NA 2OD5A 1JHHA 1G3TA 2E1CA 3HOTA 1UHMA 1QZYA 3ULQB 5LHHA 1QGPA 4I7HA 1GVJA 2MBFA 2ESNA 5CVUA 1K78B 3GVAA 4ESFA 2IVMA 1KQ0A 5H20A 4FX0A 4OIPF 4KN7X 3KEOA 2W85A 3CUQA 4CGZA 1FWZA 3O3KA 5CVVA 5E18F 4A0YA 4BNCA 3E5UA 3CTAA 3BDDA 2FQ3A 2EFQA 3WODF 2O6GE 4Y17A 2BE5F 3F8MA 4WXCA 5DUIA 5E1XA 2A68F 1K79A 3P9CA 1I27A 3GW2A 4A0XA 2V79A 1ZARA 2CO5A 2M8EA 2XAJA 3WE2A 1O3RA 4CHUA 4WK8F 3VB2A 2H09A 2HEOA 4GGGA 5HDNA 5HVQC 1YQAA 4P5OA 2VN2A 2K4JA 1SFXA 5ED4A 5JHUA 3KP4A 4LB5A 4E70A 1STZA 5DCMB 4XSZF 3MAJA 2P6TA 4RB2C 3P9IA 2H6BA 2ZXJA 1PUEE 2CYYA 4Q48A 2R7FA 3E6DA 1OR7A 5E1WA 5BPIA 2JRTA 4HDUA 3K1NA 2NS0A 4HYEA 2ISYA 3L7WA 2ACJA 4MTDA 3I59B 2FMLA 1KA8A 3FHZA 3L9FA 1FBUA 1RIOH 5ILSA 1UHWA 4BYYA 1H0MA 2VE8A 2HZTA 1MZBA 1QQIA 1B4AA 3QP5A 2IP2A 3DKWA 2Y0MA 1LNWA 3AAFA 2KIFA 1XGNA 3RKWA 5TRDA 1FLIA 3ZN1A 2J5OA 2BBYA 3FZVA 1HW5A 4KIGA 4A5NA 2FNAA 4G6QA 5AIPA 5HDGA 3TO7A 2W24A 4IHTA 1D8KA 4ZZDA 4LJZF 4EJVA 3WTSC 3COAC 3Q9VA 1XMAA 4AVPA 2W84A 2DLLA 3B73A 3QOPA 1YW9A 3GZ5A 3T5XA 4F7ZA 2WV0A 1VTNC 3E6BA 1DPRA 3WGGA 2E7XA 3BJOA 3BPXA 1OYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFZ A;  3K0L A;  1SAX A;  4JQF A;  3C1D A;  3SHF A;  1H9T A;  2COM A;  1TW3 A;  3I58 A;  3DEU A;  4L9V A;  3IKV A;  3V8J A;  2RV8 A;  3KE2 A;  2V9V A;  4AWX B;  2ZJ2 A;  1YO5 C;  4KMF A;  4P9U A;  3R60 A;  2Z33 A;  1QNT A;  3F6V A;  2JSC A;  4YII A;  2DAO A;  1KU9 A;  3ECH A;  5J8F A;  3F3X A;  3QRF F;  4KMU X;  3KET A;  1IW7 F;  3WU1 B;  4G94 A;  2M87 A;  2OBP A;  2FNP A;  4FT8 A;  2H6C A;  2VBX A;  1EH7 A;  2MD5 A;  2A6E F;  3KLO A;  5E8G A;  2JT1 A;  2CQK A;  2EFP A;  4WXH A;  3ZMD A;  1ZRD A;  4HF2 A;  1L0O C;  3TDZ C;  1P92 A;  4MQV A;  2DK8 A;  2BGC A;  4EJO A;  2DTR A;  2QZ8 A;  4PCQ A;  2TDX A;  3NEU A;  2WC2 A;  4UVA A;  1DP7 P;  2E7W A;  2WTE A;  2A5Y B;  2R3S A;  4HW0 A;  1MGT A;  4OU0 A;  1PP8 F;  4EGZ A;  3OOP A;  1Z7U A;  1XDS A;  4KFC A;  2NNN A;  3KP7 A;  3U2R A;  5D5V B;  2Q8K A;  3PQK A;  1H9G A;  1GXQ A;  2RGV A;  2M45 A;  2R7D A;  4PGG A;  4RAY A;  3ZMZ A;  2HOE A;  1XN7 A;  3QPT A;  4IPA A;  1MKM A;  3K69 A;  2ZKZ A;  2M1B A;  2XVC A;  3H92 A;  3GXO A;  2EFW A;  3ML6 A;  3LST A;  4KDP A;  1LB2 A;  4H0E A;  2UZK A;  1G3Y A;  5DDG A;  1FYL A;  4CZZ A;  3KZY A;  1XGS A;  2MC3 A;  5CLS A;  4OMZ A;  3ECO A;  1MD0 A;  1J75 A;  1RI7 A;  4R1H A;  2W25 A;  3EYY A;  3KZZ A;  3QU3 A;  1I5Z A;  2XKP A;  2FRH A;  5E17 F;  3HRT A;  2PBI A;  1LVA A;  5HDK A;  3V4G A;  2K02 A;  1MDM B;  1W5T A;  2DI3 A;  1G3S A;  1RUO A;  2MH9 A;  3W6K B;  4U88 A;  4KT5 C;  5D8L B;  4LG0 B;  5K5Q A;  4M9X A;  1OMI A;  3R0J A;  1IN8 A;  5ICG A;  5F64 A;  5DD8 A;  3RKY A;  1O7L A;  4Q5S F;  3RPU A;  5LRR A;  1U78 A;  3IRR A;  1TQI A;  1IAW A;  4G6D A;  1KYZ A;  2P7C B;  1R22 A;  4WX9 A;  4YFX F;  1TTY A;  4WXD A;  2VBW A;  2NAZ A;  2ADU A;  4N9H A;  4TV7 A;  2IW5 A;  1Z91 A;  4XRF A;  4L0Y B;  4O5V A;  3BOQ A;  4UVB A;  3LQR A;  4ZYG A;  1T2K A;  2IPQ X;  2MLK A;  3BPV A;  4O6J A;  2UWM A;  2HS5 A;  1R00 A;  2GQQ A;  2FBI A;  5CJ9 A;  4JK1 X;  3K9T A;  2HFH A;  3SXY A;  1QZZ A;  1BOA A;  2Q2E A;  2ZME B;  4HQE A;  1FBQ A;  1F4K A;  3FMR A;  4HZF A;  1IN7 A;  1S29 A;  5L3G A;  1O3S A;  3K2Z A;  1XSX A;  4UNO A;  4ENJ A;  2XV4 S;  1IRG A;  2OA4 A;  3SFZ A;  3J7A O;  3PFI A;  2EV6 A;  4IJA A;  3ZMS A;  1IXC A;  1IN6 A;  3ZN0 A;  2F5E A;  1WKM A;  3ABT A;  4L9N A;  1FSH A;  1HST A;  5LGT A;  5D5X B;  1BIB A;  3HOS A;  2V1U A;  4ENN A;  4MHG A;  2ISZ A;  1AOY A;  4GO1 A;  3HRS A;  3ELK A;  1DUX C;  2DPD A;  3CUO A;  3MFK A;  3F23 A;  1U5T A;  1ZG3 A;  1SD5 A;  3HUG A;  2XAG A;  4I0A A;  5FFX A;  1S3J A;  5EEG A;  2K4B A;  2O3F A;  1E2X A;  2VXZ A;  1T0F A;  5FLX Z;  1HW1 A;  1KYW A;  3F8N A;  1J2X A;  4HLX A;  5BOX A;  1ONV A;  2QBY A;  2D2W A;  5LBQ A;  5DV5 A;  1RUN A;  2OAZ A;  1K6O A;  3JSO A;  2KIU A;  5DEQ A;  2OU2 A;  4HBL A;  3WTY C;  2LNB A;  4LMY A;  5A2Q Z;  3JSP A;  1ZLK A;  1BJA A;  3HSF A;  1U8R A;  1NHA A;  1ZRE A;  3GX4 X;  3M8E A;  2ZFW A;  3HHG A;  1RNL A;  3Q9S A;  1B9N A;  3WE3 A;  3HRM A;  1Z6R A;  2EFN A;  2GA1 A;  4P55 A;  2B0L A;  4KN4 X;  3W6J B;  1PDN C;  3HSE A;  2RKH A;  4OIO F;  3T8T A;  4HF0 A;  4M73 A;  5LHG A;  1T6S A;  1W5S A;  4U0W A;  1HW2 A;  1LJ9 A;  4U7D A;  1A04 A;  4RB3 C;  1P2F A;  3BP8 A;  5K1Y A;  5IT3 A;  2IA1 A;  4R8H A;  3KP5 A;  2RVC A;  1S7A A;  5FD5 A;  1L3L A;  2STW A;  4S04 A;  4B8X A;  1EV7 A;  2FMY A;  2DO7 A;  2CFX A;  4M9Z A;  2PG4 A;  3TOB A;  3MEX A;  4IVN A;  2EFO A;  4GCV A;  1OYI A;  2EA2 A;  1EH6 A;  4FX4 A;  3VFZ A;  5D6E A;  1YW7 A;  2L02 A;  2GA2 A;  4HX8 A;  2GZW A;  4ZYE A;  3HIF A;  4M72 A;  4RGS A;  2KJC A;  2K7L A;  4AIK A;  1B9M A;  3EET A;  2ELH A;  3MZY A;  3FXU A;  2LF8 A;  1TNT A;  3DFG A;  1HXD A;  1UCR A;  2FSW A;  1MJA A;  4LB6 B;  1BN5 A;  1BI0 A;  1SMT A;  3F8B A;  1SFU A;  1CF7 A;  4I2O A;  3CDH A;  5ICF A;  2F2E A;  4HA8 A;  3TQN A;  4BHP A;  3CO6 C;  4KNY A;  3VEP A;  3L09 A;  4K2E A;  3BWG A;  2YPR A;  3OV8 A;  3R0A A;  5BQT A;  4EGY A;  3LAJ A;  5ILU A;  3WTV C;  5JI6 A;  1G6N A;  3M7G A;  2OZ6 A;  4I09 A;  3DP7 A;  1FSE A;  3E97 A;  2C6Y A;  3O6B B;  2P4W A;  3LWF A;  2FU4 A;  4M9S A;  3LA2 A;  2HWV A;  3F8C A;  1FYK A;  2RC4 A;  1P6R A;  5D4S A;  3N97 A;  2LKP A;  1BC7 C;  1QPM A;  2FEZ A;  1XGM A;  4KUM A;  3IKT A;  4A0Z A;  3IWF A;  2XUB A;  2JZY A;  4RB1 A;  3GFI A;  2HQR A;  3T0Y A;  3P7N A;  1K78 A;  1F5T A;  3ZPL A;  2VT3 A;  2L01 A;  2DT5 A;  3CLO A;  4ESB A;  4HX7 A;  5L3E A;  2VON A;  4A6D A;  3IC7 A;  1IN4 A;  3GF2 A;  3GFL A;  2MA3 A;  2Q0O A;  2CGP A;  1HKQ A;  2W57 A;  4YG2 F;  2KRF A;  2FOK A;  1KU3 A;  4XLP F;  2V1D A;  3WTX C;  1DPU A;  2IJL A;  1I1S A;  3EDP A;  2O8X A;  4OIN F;  4XLN F;  1E17 A;  2HYG D;  2PFB A;  1R58 A;  3JAM Z;  5L3B A;  4UXN A;  2V6C A;  1R23 A;  5D5W B;  3ZQ7 A;  2CWE A;  1R5H A;  1B6A A;  3HHH A;  2Z9O A;  2RDP A;  4ZH4 F;  1TLH B;  4GXO A;  4CDG A;  3LA3 A;  3FMQ A;  1TW2 A;  3NRV A;  1Z1D A;  2GXB A;  3F6O A;  2DQR A;  4L18 B;  1ON1 A;  4I02 A;  1USS A;  2M30 A;  1ZG1 A;  1F1Z A;  1SMY F;  3C7J A;  5F6F A;  4AD9 A;  4IHS A;  3RYP A;  5K5R A;  4KIC A;  4CIC A;  2G9W A;  1ZRC A;  4FHT A;  2XHK A;  4U7B A;  1FX7 A;  2P8T A;  3LFK A;  4ZYD A;  5IT9 Z;  1BI1 A;  1LDK B;  2PJP A;  4AIJ A;  2VE9 A;  4ETS A;  5L3D A;  1K7A A;  1XCV A;  1W7P A;  4M6Y A;  3EUH A;  1W4M A;  2VBY A;  1HKT A;  5ICC A;  2XRN A;  3CO7 C;  3I59 A;  4XSX F;  2EK5 A;  3KEQ A;  1SD4 A;  3WTZ A;  1LEB A;  1FBS A;  5CYV A;  1ON2 A;  2IA0 A;  2ZNZ A;  1U5T B;  2QQB A;  2O0Y A;  4CXF A;  2KIM A;  2OQR A;  2MH2 A;  5JR3 A;  5DUK A;  4KA4 A;  1IUY A;  4EMS A;  2EV0 A;  3H3U A;  4RGX A;  4G8X A;  1YS7 A;  1LDJ A;  4QLC U;  1TBX A;  1FT9 A;  2XIG A;  5TJJ A;  1I1G A;  2QUF A;  4IRG A;  1JGS A;  1Y0U A;  5E20 A;  1YYV A;  4MEX F;  2E1N A;  2YR2 A;  3L00 A;  4G7Z F;  1P4X A;  1JE8 A;  4NHJ A;  2WWY A;  4EVI A;  1B59 A;  3CUQ B;  4HX4 A;  2QLZ A;  1YW8 A;  3KCC A;  5KVR A;  3FM3 A;  2EJR A;  3I64 A;  2M5W A;  2GXG A;  2L4M A;  2K27 A;  1AWC A;  2XGX A;  4EM1 A;  3IWZ A;  3PQJ A;  2L4A A;  5H6R A;  2OZU A;  3IL2 A;  5AIQ A;  4RGU A;  3C3W A;  4L0Z B;  1ZGA A;  5LRS A;  1P4A A;  4Y13 A;  2BYV E;  1KU2 A;  1IZ1 A;  4LFU A;  1ZG5 A;  2HGC A;  3WTU C;  1C0W A;  2CSO A;  5F1R A;  4N0B A;  4AIH A;  3JAM K;  1ULY A;  2P5V A;  1FZP B;  1O57 A;  3HSR A;  3GZ6 A;  3ZMT A;  2LSO A;  4ESJ A;  4EV0 A;  3E6M A;  2DQL A;  2QVO A;  1UFM A;  4DQ2 A;  2CW0 F;  2YSR A;  4UUV A;  1FYM A;  2DK5 A;  4KIF A;  3MCZ A;  1QBJ A;  4M74 A;  3DPL C;  4O3M A;  4L5J A;  2QQ9 A;  3FX3 A;  4A2U A;  3RYR A;  3FXQ A;  5HS9 A;  3BJA A;  4HOB A;  5HLG A;  4ASN A;  5LEK A;  4IXA A;  4MEY F;  1WWX A;  3EQL F;  3RPQ A;  5D5U B;  1X3U A;  5IT9 K;  3RTR A;  1BC8 C;  1XB4 A;  4OIQ F;  3GEZ A;  4G7H F;  5FD6 A;  4PGH A;  2NNY A;  4IRH A;  2J5P A;  3CUQ C;  2DFI A;  4RB0 A;  1DDN A;  4LK1 F;  1ZAO A;  2IRF G;  2PQ8 A;  2XAH A;  4RAZ A;  5HLI A;  4YFK F;  3RDI A;  1SD7 A;  5E8I A;  2ZBK A;  1KU7 A;  2NRA C;  2PN6 A;  3BRO A;  1LDD A;  3TDU C;  5FO5 A;  2P5L C;  1XDU A;  4ENK A;  3J80 Z;  4A5M A;  5HLH A;  4MNU A;  5LGN A;  5D6F A;  2RNJ A;  2PI0 A;  2A61 A;  2A69 F;  2NYX A;  4LLL A;  4LK0 F;  2A3S A;  3ZMV A;  2QEN A;  2XKO A;  2ZNY A;  3I0T A;  4P96 A;  4LGW A;  4D0P A;  2UXX A;  3MQ0 A;  3IHU A;  4Z2Y A;  3GUD A;  3P9K A;  2FE3 A;  4L9J A;  1LQ1 A;  3H3Z A;  1OKR A;  1MDM A;  2GWR A;  2VOD A;  4U0Y A;  2FBH A;  1R36 A;  4BH9 A;  2VBZ A;  2CG4 A;  3DF8 A;  3ABU A;  1GXP A;  1GHC A;  3G3Z A;  3F8F A;  4CYD A;  4LG0 A;  1BIA A;  5LLQ A;  3K1P A;  4UV9 A;  4HF1 A;  3RI4 A;  4YIF A;  4CO8 A;  3VOE A;  2XAF A;  1YTY A;  3GLX A;  3M1E A;  4PDK A;  2QQA A;  5E1Z B;  2G7H A;  1OYY A;  5KK1 A;  4S05 A;  2FXA A;  2O61 A;  5LHI A;  2O03 A;  4P9F A;  1Z9C A;  3J81 Z;  2H27 A;  2Y48 A;  2P5K A;  1ZN2 A;  1J59 A;  2YX4 A;  1KGS A;  3NQO A;  3LA7 A;  4PZJ A;  4BAY A;  2HKO A;  1R7J A;  3HYI A;  1JXS A;  1UST A;  5DCF A;  1OPC A;  1FP1 D;  2VOP A;  1IXS B;  4UV8 A;  3KLN A;  4WWC A;  1U3E M;  3DV8 A;  2EWN A;  5HOO A;  2FF4 A;  2K86 A;  2P7V B;  3I54 A;  2YX7 A;  1T38 A;  1YIO A;  3BJ6 A;  3VOD A;  4YFN F;  2X0L A;  1D8J A;  1XSV A;  3FWE A;  2ZME A;  1Q1H A;  5CVR A;  1W7P B;  2OQG A;  3LQQ A;  3R4K A;  3HTS B;  3C18 A;  3HTU A;  3Q5F A;  3IRQ A;  3MWM A;  2A07 F;  5ICE A;  2EV5 A;  5FB2 A;  1MJ9 A;  1HSJ A;  2HQN A;  3ISP A;  5BS6 A;  4B09 A;  3SQN A;  1G3W A;  3GFJ A;  1J9I A;  3MZH A;  3E5X A;  3O2P E;  2LDU A;  4IF4 A;  1ZRF A;  1ZH5 A;  3WTW C;  4HLY A;  6PAX A;  2HTS A;  2DBB A;  1FY7 A;  2RQP A;  1SFE A;  3J80 K;  2MLG A;  4UHT A;  3I4P A;  3S2W A;  3FXR A;  3F22 A;  2IA2 A;  5FLX K;  2XAQ A;  2D1V A;  3WGH A;  1F9N A;  4L9T A;  3ZP5 A;  2PLY A;  1XSD A;  1JHF A;  4GYI A;  4MTE A;  1SD6 A;  4EM0 B;  2JPB A;  4BHC A;  1ZHF A;  3N4M A;  4ENM A;  5LEJ A;  4GYG A;  5A2Q K;  3GO5 A;  4LLN A;  1V3F A;  1YG2 A;  1YLF A;  1BBY A;  4HAM A;  2ZO4 A;  2EB7 A;  4JBA A;  1YS6 A;  4NQW A;  2BV6 A;  2QYO A;  4IRI A;  3ZMU A;  1XD7 A;  1R1T A;  3QPH A;  1U6G A;  2HDC A;  4I01 A;  1WQ2 A;  2A6H F;  4OOI A;  1UB9 A;  3JTH A;  1O3T A;  4G9Y A;  2DU9 A;  4BHB A;  5L3C A;  4Q4Z F;  1ZGJ A;  2GAU A;  3KP6 A;  3F72 A;  4EJT A;  1T39 A;  1R1V A;  2XRO A;  4RS8 A;  2HKX A;  1I6X A;  4EQQ A;  3E5Q A;  4G7O F;  3G73 A;  1FC3 A;  3J81 K;  3M9A A;  1XCB A;  3QP6 A;  5AON A;  2DW4 A;  1B1B A;  3R61 A;  4BQA A;  1WI9 A;  5EEH A;  2AXL A;  2F5C A;  4QWQ A;  1BI2 A;  1G4D A;  3RIR A;  2PMH A;  5DCM A;  3KP2 A;  5JVT A;  1HKS A;  5DD4 A;  1O3Q A;  2AS5 F;  4Q47 A;  3T8R A;  4OIR F;  2JPC A;  2KJB A;  3V8L A;  3TO9 A;  5CVJ A;  2X4H A;  1IXR C;  2FA5 A;  3JTG A;  2QM3 A;  1O7F A;  3WG9 A;  3FM5 A;  1S6L A;  5K5O A;  4HQM A;  1TNS A;  5D4R A;  1V4R A;  4R79 A;  1EH8 A;  3B02 A;  3GFM A;  3CJN A;  3K1M A;  4I0B A;  3KFW X;  3TOA A;  2HR3 A;  3L2C A;  2JTV A;  5H6Q A;  3V8K A;  4A12 A;  3E3V A;  4NB5 A;  2XAS A;  4U0V A;  1ZYR F;  4Y15 A;  1J7K A;  1FP2 A;  1FNN A;  1Z6T A;  1CGP A;  5BMZ A;  3D0S A;  1D5V A;  3GWZ A;  2G7U A;  2UXN A;  4L5I A;  4XBF A;  4KIB A;  5HS8 A;  3V7C A;  4UVC A;  3V7S A;  2KKO A;  1ODD A;  2PMU A;  2QBY B;  2ESH A;  1LEA A;  1XMK A;  3ERE D;  4ZZL A;  4DNC A;  3QAH A;  4A6E A;  1WRJ A;  2P6S A;  1HBX G;  1BM9 A;  1YFH A;  3TO6 A;  2Y75 A;  3REO A;  1T98 A;  2DPU A;  3DXJ F;  1D3Y A;  1REP C;  5HS7 A;  4RGR A;  1J5Y A;  3I71 A;  2VC0 A;  1BI3 A;  2VC1 A;  4WF2 A;  5L3F A;  3EYI A;  4EM2 A;  2F5F A;  3WGI A;  4HDV A;  2Z99 A;  3TKY A;  2VT2 A;  1HQC A;  4MQ9 F;  3WTT C;  1FPQ A;  1TQM A;  2HYF A;  2L54 A;  5DYM A;  4I98 B;  5J8C A;  2H94 A;  5CVI A;  1QO0 D;  2EA4 A;  1IRF A;  4ON0 A;  3D5L A;  5ERI A;  4HV5 A;  3SZP A;  1S7O A;  3RKX A;  3QU6 A;  3RJP A;  1KQ8 A;  2D1H A;  4ZYH A;  3BY6 A;  5FGM A;  2Z5U A;  2ETH A;  3BZ6 A;  1U2W A;  2D45 A;  1PP7 U;  2ZCW A;  1ZLJ A;  3WU0 A;  2HTJ A;  3U9G A;  1IN5 A;  2RN7 A;  2Z3Y A;  4LLG F;  2PEX A;  1U5T C;  5D8K B;  1Z05 A;  1P4W A;  5ILV A;  2V1X A;  3SZT A;  1MJB A;  4M6X A;  3TGN A;  3T1B A;  2BEO A;  2F5D A;  2LF7 A;  1R1U A;  2YU3 A;  4EJU A;  4KYW A;  1R5G A;  1RZ4 A;  3JW4 A;  3E6C C;  2GIV A;  3LAP A;  3I5U A;  4N9I A;  1W7P D;  4M71 A;  3U1D A;  3I53 A;  4BXU A;  1CF7 B;  5LGU A;  5BPD A;  3DQV C;  4EJW A;  3V7R A;  3F21 A;  1TQP A;  5JFR A;  3DPT A;  3ROU A;  3HRU A;  4HV6 A;  2FBK A;  3FMS A;  4OMY A;  3M8F A;  1XGO A;  2STT A;  2VOO A;  4LD5 A;  3GYH X;  3KP3 A;  2QWW A;  2L3D A;  3R6S A;  5J6X A;  4MGR A;  1FOK A;  3FF5 A;  1J0R A;  2IT0 A;  4WCG A;  1WSU A;  1IF1 A;  1KQ9 A;  1S8N A;  2OD5 A;  1JHH A;  1G3T A;  2E1C A;  3HOT A;  1UHM A;  1QZY A;  3ULQ B;  5LHH A;  1QGP A;  4I7H A;  1GVJ A;  2MBF A;  2ESN A;  5CVU A;  1K78 B;  3GVA A;  4ESF A;  2IVM A;  1KQ0 A;  5H20 A;  4FX0 A;  4OIP F;  4KN7 X;  3KEO A;  2W85 A;  3CUQ A;  4CGZ A;  1FWZ A;  3O3K A;  5CVV A;  5E18 F;  4A0Y A;  4BNC A;  3E5U A;  3CTA A;  3BDD A;  2FQ3 A;  2EFQ A;  3WOD F;  2O6G E;  4Y17 A;  2BE5 F;  3F8M A;  4WXC A;  5DUI A;  5E1X A;  2A68 F;  1K79 A;  3P9C A;  1I27 A;  3GW2 A;  4A0X A;  2V79 A;  1ZAR A;  2CO5 A;  2M8E A;  2XAJ A;  3WE2 A;  1O3R A;  4CHU A;  4WK8 F;  3VB2 A;  2H09 A;  2HEO A;  4GGG A;  5HDN A;  5HVQ C;  1YQA A;  4P5O A;  2VN2 A;  2K4J A;  1SFX A;  5ED4 A;  5JHU A;  3KP4 A;  4LB5 A;  4E70 A;  1STZ A;  5DCM B;  4XSZ F;  3MAJ A;  2P6T A;  4RB2 C;  3P9I A;  2H6B A;  2ZXJ A;  1PUE E;  2CYY A;  4Q48 A;  2R7F A;  3E6D A;  1OR7 A;  5E1W A;  5BPI A;  2JRT A;  4HDU A;  3K1N A;  2NS0 A;  4HYE A;  2ISY A;  3L7W A;  2ACJ A;  4MTD A;  3I59 B;  2FML A;  1KA8 A;  3FHZ A;  3L9F A;  1FBU A;  1RIO H;  5ILS A;  1UHW A;  4BYY A;  1H0M A;  2VE8 A;  2HZT A;  1MZB A;  1QQI A;  1B4A A;  3QP5 A;  2IP2 A;  3DKW A;  2Y0M A;  1LNW A;  3AAF A;  2KIF A;  1XGN A;  3RKW A;  5TRD A;  1FLI A;  3ZN1 A;  2J5O A;  2BBY A;  3FZV A;  1HW5 A;  4KIG A;  4A5N A;  2FNA A;  4G6Q A;  5AIP A;  5HDG A;  3TO7 A;  2W24 A;  4IHT A;  1D8K A;  4ZZD A;  4LJZ F;  4EJV A;  3WTS C;  3COA C;  3Q9V A;  1XMA A;  4AVP A;  2W84 A;  2DLL A;  3B73 A;  3QOP A;  1YW9 A;  3GZ5 A;  3T5X A;  4F7Z A;  2WV0 A;  1VTN C;  3E6B A;  1DPR A;  3WGG A;  2E7X A;  3BJO A;  3BPX A;  1OYW A; 
#chains in the Genus database with same CATH topology
 2DA1 A;  3BR2 A;  5FFZ A;  3K0L A;  1SAX A;  4JQF A;  3G1O A;  3L2W A;  4PUS A;  3K2A A;  3C1D A;  3SHF A;  1H9T A;  3VYU B;  2COM A;  1TW3 A;  3I58 A;  3I3L A;  1W5C C;  4JX6 A;  1HLV A;  4XMY A;  5CQE A;  3CCE I;  3A4C A;  3DEU A;  4L9V A;  3IKV A;  3V8J A;  1IRX A;  2HNH A;  1MMS A;  2TRT A;  3H5A A;  4PJJ A;  3DBH B;  1VQ5 I;  2RV8 A;  3KE2 A;  2V9V A;  3M3Y J;  4AWX B;  3WHB A;  2HVQ A;  5EGO B;  2ZJ2 A;  1WH7 A;  3K4K A;  1LPQ A;  1YO5 C;  2MC4 A;  4KMF A;  4P9U A;  3R60 A;  2K9Q A;  5FKM A;  1PYV A;  2Z2S B;  3SZG A;  2Z33 A;  2KHM A;  3IH3 A;  1QNT A;  3F6V A;  2JSC A;  1X3W B;  2OV7 A;  2DAO A;  4YII A;  1KU9 A;  3ECH A;  2QKM B;  5J8F A;  3F3X A;  3QRF F;  4XRS A;  4E6K G;  4HSR A;  4KMU X;  3EUH C;  3KET A;  1Y8R B;  2EIJ H;  1IW7 F;  1BOB A;  2ZFU A;  3BTL A;  3WU1 B;  1YIJ I;  4G94 A;  4BDZ A;  5J3L A;  1TP4 A;  1OJL A;  2OBP A;  2M87 A;  2FNP A;  2HOA A;  3ABM H;  4FT8 A;  2H6C A;  4PFO A;  2VBX A;  1ETW A;  1EH7 A;  2MD5 A;  1WJE A;  2A6E F;  2CQ7 A;  1MMN A;  3KLO A;  5E8G A;  2JT1 A;  4X0G A;  2CQK A;  2EFP A;  3HPG A;  4WXH A;  4XN3 A;  3ZMD A;  1ZRD A;  4HF2 A;  4RBO A;  2EIM H;  5FRN A;  5F1J A;  1L0O C;  2E5N A;  2DMQ A;  3VYR B;  3TDZ C;  1P92 A;  1MSE C;  4MQV A;  3K70 C;  3ZCO A;  4PSW A;  2DK8 A;  2BGC A;  4FIS A;  4EJO A;  2DTR A;  2QZ8 A;  4PCQ A;  3OYK A;  2TDX A;  2VUM J;  3OL4 A;  3NEU A;  4B48 A;  2WC2 A;  2GBY A;  2K9S A;  4UVA A;  5BNG A;  1DP7 P;  2E7W A;  2KPM A;  2WTE A;  2A5Y B;  1LKX A;  2R3S A;  2R92 J;  4A3M J;  4HW0 A;  3ZOB A;  1MGT A;  4XM3 A;  4OU0 A;  4KT6 A;  3A1Y A;  1Y39 A;  1PP8 F;  4EGZ A;  3OOP A;  1Z7U A;  1XDS A;  4KFC A;  2WB1 A;  2I8D A;  3IAS 2;  3O8H A;  1DGR M;  2ME6 A;  2NNN A;  3KP7 A;  3U2R A;  4LIT A;  3WHC A;  5D5V B;  5CPR B;  2Q8K A;  3PQK A;  1X1A A;  1NH3 A;  1HC8 A;  3G2B A;  2AO9 A;  3E0J B;  1H9G A;  1GXQ A;  2V26 A;  2LBF A;  2RGV A;  2CQQ A;  2M45 A;  5K7Z A;  2R7D A;  3BG3 A;  2R93 J;  4PGG A;  4RAY A;  3ZMZ A;  2HOE A;  1XN7 A;  3QPT A;  4FE4 A;  4IPA A;  1MKM A;  4LOC A;  4XR6 A;  3K69 A;  1BW5 A;  2LY9 A;  3HGY A;  2ZKZ A;  2PJR B;  2M1B A;  3LSK A;  2VI6 A;  1T95 A;  4LG3 A;  2WY7 Q;  2XVC A;  3OYA A;  3H92 A;  4ABZ A;  3GXO A;  4XKW A;  1Y1W J;  2EFW A;  3FKJ A;  3JRF A;  3ML6 A;  1VQ7 I;  3U1K A;  1U9N A;  3AG1 H;  3LST A;  1AU7 A;  2ZC2 A;  4KDP A;  1LB2 A;  4EEF G;  4H0E A;  2R7X A;  4XLH A;  2UZK A;  1G3Y A;  3BCA A;  1P9Q C;  5DDG A;  3JR9 A;  1Y8Q B;  4CZZ A;  4FQG A;  1FYL A;  3KZY A;  1BR4 A;  1OLT A;  5C4J J;  2ZSH B;  1XGS A;  2MC3 A;  5FRM A;  5CLS A;  4OMZ A;  3ECO A;  1MD0 A;  1IV8 A;  2WAF A;  4XOT A;  4C2U A;  4C2T A;  1J75 A;  4NC6 A;  1RI7 A;  4Y4R A;  2CQX A;  2XAU A;  5F0H A;  3S2H J;  3IH4 A;  4R1H A;  1JKP C;  2W25 A;  3EYY A;  3KZZ A;  1R71 A;  3QU3 A;  1I5Z A;  2H1L A;  5EYR A;  4II3 A;  2XKP A;  4IKF A;  3GLL A;  5F27 A;  4A69 C;  4QTR A;  1N77 A;  2FRH A;  3K4B A;  3CJR B;  5E17 F;  3HRT A;  3L2Q A;  3LSJ A;  3PM1 A;  3IAM 2;  2HDW A;  2PBI A;  3LSG A;  4PJN A;  1LVA A;  3OOU A;  2WY8 Q;  2X85 A;  3CMM A;  3KEY A;  5HDK A;  3V4G A;  3QOD A;  2K02 A;  1PJR A;  1MDM B;  3S93 A;  4D5C A;  1W5T A;  2DI3 A;  1G3S A;  2JVH A;  1RUO A;  2LK2 A;  1X4P A;  2MH9 A;  3F0C A;  5IY5 H;  2VJJ A;  4M3E A;  1FEX A;  4GDF A;  3W6K B;  1E3H A;  4U88 A;  3S32 A;  4KT5 C;  4B43 A;  1FIP A;  5D8L B;  4FTH A;  5K5Q A;  4LG0 B;  4NC8 A;  2CJJ A;  4M9X A;  1OMI A;  3R0J A;  3S16 J;  1IN8 A;  5ICG A;  5F64 A;  5DD8 A;  3RKY A;  1O7L A;  4Q5S F;  3ONQ A;  3ZQL A;  3S3O A;  2LMD A;  1VND A;  5F0C A;  2DDB A;  1LFU P;  2Y9Y A;  3RPU A;  1XC5 A;  5LRR A;  5GTI C;  1U78 A;  4V2G A;  3IRR A;  3BR5 A;  2M4G A;  1TQI A;  1IAW A;  1NK2 P;  2VAS A;  4G6D A;  3BZK A;  1KYZ A;  2DMT A;  4BJ5 C;  2P7C B;  1R22 A;  4WX9 A;  4YFX F;  3I55 I;  3G1M A;  2AQE A;  3PO2 J;  1TTY A;  4WXD A;  2VBW A;  3QYB A;  2NAZ A;  1G8X A;  2X6O A;  2ZSI B;  2CFO A;  2R7U A;  5DS9 A;  5IOZ A;  2DJN A;  2ADU A;  3A0B C;  5IP6 A;  4N9H A;  3HKZ N;  5EJC A;  4TV7 A;  3X2Q H;  2IW5 A;  1Z91 A;  2OF7 A;  4XRF A;  2Y9Z A;  5EZG A;  4I76 A;  1ETV A;  4L0Y B;  2JA6 J;  2OPT A;  4O5V A;  1T56 A;  1ORK A;  1V55 H;  3BOQ A;  1MH4 A;  4UVB A;  3LQR A;  2DOD A;  3CCR I;  4ZYG A;  3ZQF A;  1T2K A;  2IPQ X;  4Y33 A;  1ETO A;  2MLK A;  3BQZ A;  3BPV A;  4U87 A;  3GTP J;  4O6J A;  2UWM A;  3NAU A;  2HS5 A;  1R00 A;  2CUZ A;  3WG7 H;  2GQQ A;  3ZGK A;  2DYS H;  3FBN B;  2FBI A;  5FLM J;  5CJ9 A;  1I39 A;  4JK1 X;  1MBG A;  3K9T A;  2DFE A;  2HFH A;  3M07 A;  3SXY A;  1Z7L A;  2Y0S N;  1QZZ A;  1BOA A;  2Q2E A;  4P1W A;  4BQQ A;  1D1C A;  2ZME B;  2CW7 A;  4HQE A;  1FBQ A;  2E1M B;  1F4K A;  2WV1 A;  3FMR A;  1ZEL A;  2DA5 A;  1UAA A;  4NC7 A;  4HZF A;  3A01 A;  1NK3 P;  1BA5 A;  2M3A A;  3BR3 A;  1IN7 A;  1S29 A;  5L3G A;  1O3S A;  4XN0 A;  3K2Z A;  1XSX A;  4UNO A;  4ENJ A;  2XV4 S;  4KIT B;  2HOS A;  1IRG A;  2OA4 A;  1JKO C;  1EA3 A;  4RLQ A;  5EF6 A;  2DXI A;  3SFZ A;  3J7A O;  5E3N A;  1JT6 A;  3PFI A;  3LSR A;  5DM6 F;  1UG2 A;  2BZT A;  1O4X A;  3CCL I;  2M2E A;  4RAG A;  4UUS B;  2CUJ A;  2EV6 A;  5F0F A;  4IJA A;  3ZMS A;  1IXC A;  1W36 C;  2VPR A;  1IN6 A;  3ZN0 A;  3GCM A;  2VJ5 A;  2F5E A;  3K70 D;  1WKM A;  3ABT A;  4L9N A;  1FSH A;  4J01 A;  1SFO J;  1HST A;  5LGT A;  5D5X B;  1BIB A;  3HOS A;  2ZJQ F;  4DOZ A;  1MIJ A;  2V1U A;  4F93 B;  4ENN A;  4MHG A;  2ISZ A;  1I3A A;  1AOY A;  4GO1 A;  3HRS A;  3SDG A;  1V5E A;  4DBR A;  5KAF C;  1JTX A;  3ELK A;  3H35 A;  3SEZ A;  1DUX C;  2R7V A;  2Y30 A;  3FBI B;  2DPD A;  2EQR A;  3CUO A;  1EKE A;  3MFK A;  3F23 A;  4XKC A;  3SFI A;  1U5T A;  1ZG3 A;  1D1B A;  2E19 A;  1VQO I;  1SD5 A;  3HUG A;  2XAG A;  4BQN A;  4I0A A;  5FFX A;  2NVU B;  4BQO A;  1S3J A;  5EEG A;  2K4B A;  2DT6 A;  2O3F A;  2VLA A;  3KZI C;  5B5E C;  2CS3 A;  1K6Y A;  4Z6Y A;  3LFU A;  1E2X A;  2DJI A;  2VXZ A;  1T0F A;  2RQQ A;  4AYB N;  1P7I A;  4A3E J;  4XID A;  2I10 A;  5FLX Z;  1HW1 A;  3PUB A;  4RM3 A;  1KYW A;  2IGK A;  3F8N A;  1J2X A;  1VI0 A;  4HLX A;  5BOX A;  1ONV A;  4FAS D;  1NG7 A;  2QBY A;  4B47 A;  2D2W A;  2XDV A;  4Y7N J;  5LBQ A;  1VQM I;  5DV5 A;  1H8A C;  2NS8 A;  1OCZ H;  1RUN A;  2OAZ A;  1FMV A;  1K6O A;  3JSO A;  1B8I A;  3K10 A;  4A3K J;  2KIU A;  2NXN B;  4RA2 A;  5DEQ A;  2VIX A;  2OU2 A;  4HBL A;  2JK3 A;  3WTY C;  3WU2 C;  2LNB A;  4LMY A;  5A2Q Z;  3JSP A;  1ZLK A;  1BJA A;  1U0J A;  2LY2 A;  4AU7 A;  1RC9 A;  2JVG A;  3HSF A;  1U8R A;  1NHA A;  1ZRE A;  3GX4 X;  3M8E A;  2R5Z A;  2ZFW A;  2K3P A;  4IX7 A;  1JI8 A;  2K40 A;  2L9N A;  1VQ4 I;  3HHG A;  4A3F J;  1RNL A;  1VZ0 A;  3Q9S A;  4F52 A;  1B9N A;  1D0Y A;  2ECB A;  3WE3 A;  3HRM A;  3HOY J;  1Z6R A;  2EFN A;  2GA1 A;  4P55 A;  4D1Q A;  1VQP I;  2B0L A;  2ZME C;  1WJC A;  2E1M C;  4BBR J;  2XSD C;  4KN4 X;  3W6J B;  2GOM A;  1PDN C;  2HXI A;  3CP8 A;  1WJB A;  3HSE A;  1PUF A;  2RKH A;  4OIO F;  3QYF A;  3T8T A;  4HF0 A;  3HGG A;  4M73 A;  5LHG A;  1T6S A;  3SYT A;  3UKG A;  5TGT A;  2M0C A;  3V42 A;  4AC0 A;  4BKX A;  1W5S A;  3LSP A;  4U0W A;  1HW2 A;  1LJ9 A;  1YIT I;  4U7D A;  1A04 A;  2CH0 A;  3RQ4 A;  4CZC A;  2LKS A;  4RB3 C;  1P2F A;  1WJA A;  3CC2 I;  3BP8 A;  5K1Y A;  5IT3 A;  2IA1 A;  4R8H A;  3KP5 A;  2RVC A;  1S9H A;  1S7A A;  5FD5 A;  3OY9 A;  1L3L A;  1WJD A;  5CQG A;  2STW A;  4S04 A;  3D5R C;  4B8X A;  4PJM A;  3HJE A;  4ZC3 A;  1EV7 A;  1TWG J;  2FMY A;  4HNV A;  2DO7 A;  4E7J A;  3MVP A;  2IS1 A;  4V19 K;  2CFX A;  4M9Z A;  2PG4 A;  1OCR H;  1A5J A;  1FOY A;  2JA8 J;  3TOB A;  4ZTF A;  3MEX A;  4IVN A;  2EFO A;  2IGM A;  2GXA A;  3DEW A;  2DDA A;  5B1A H;  1MSF C;  2F5V A;  4CCJ A;  4GCV A;  1OYI A;  1MMA A;  2EA2 A;  1HDD C;  1EH6 A;  5IP7 J;  2A05 A;  4FX4 A;  3DU6 A;  3O8G A;  3VFZ A;  1X19 A;  3M4O J;  5D6E A;  1YW7 A;  2L02 A;  2E34 A;  5F04 A;  2GA2 A;  4HX8 A;  2GZW A;  3A0H C;  3BTJ A;  4ZYE A;  1YX5 A;  3HIF A;  3EUK L;  1XMX A;  2VJ4 A;  4M72 A;  4RGS A;  9ANT A;  2KJC A;  1FOX A;  2K7L A;  4AIK A;  1B9M A;  3CDI A;  1FTZ A;  3K6G A;  3EET A;  3RCO A;  2ELH A;  3MZY A;  1ENH A;  3FXU A;  1B72 A;  2R7O A;  2FUG 2;  1TNT A;  2LF8 A;  3DFG A;  1HXD A;  1UCR A;  1H89 C;  1MND A;  2FSW A;  1MJA A;  4PJ0 C;  4LB6 B;  3C2B A;  2BHZ A;  1BN5 A;  1SMT A;  1BI0 A;  3F8B A;  1SFU A;  1CF7 A;  4C3J J;  2DT7 B;  4I2O A;  4CSW A;  2M8G X;  1J09 A;  1SFK A;  3VSK A;  3CDH A;  5ICF A;  2F2E A;  2HQ5 A;  4B3X A;  4HA8 A;  2FJ1 A;  4XOR A;  1DU6 A;  4D7N A;  3TQN A;  4BHP A;  3CO6 C;  4KNY A;  3VEP A;  3L09 A;  2KZG A;  5DM7 F;  4E4H A;  4RDU A;  3TW6 A;  4K2E A;  2E2H J;  3BWG A;  4XKB A;  2BW3 B;  2YPR A;  3OV8 A;  3R0A A;  5BQT A;  1X2N A;  4EGY A;  2K9N A;  4A3C J;  3LAJ A;  5ILU A;  3WTV C;  4IOC F;  1TL8 A;  2CV1 A;  3ZQC A;  5JI6 A;  1G6N A;  3M7G A;  3GTJ J;  2OZ6 A;  4I09 A;  3KYL A;  3DP7 A;  1FSE A;  3E97 A;  2C6Y A;  2F4O B;  3O6B B;  2GM4 A;  2P4W A;  3LWF A;  4B4C A;  3DLL F;  2FU4 A;  4M9S A;  1YI2 I;  3LA2 A;  2HWV A;  3KYC B;  3F8C A;  2OUM A;  3HZJ A;  3BTC A;  1FYK A;  2RC4 A;  1P6R A;  1LFB A;  5D4S A;  3N97 A;  2LKP A;  3S1M J;  2JWT A;  1BC7 C;  3OYB A;  1QPM A;  3JRI A;  2FEZ A;  1W36 D;  2E2J J;  3QOE A;  3OYF A;  1XGM A;  3K4L A;  1HDP A;  3CCM I;  1JGG A;  4KUM A;  2VQG A;  3IKT A;  4A0Z A;  3UR3 C;  3IWF A;  3BG9 A;  1RKT A;  2XUB A;  2JZY A;  4RB1 A;  4DBQ A;  3GFI A;  2NOG A;  4BEH B;  2HQR A;  3T0Y A;  3P7N A;  1K78 A;  3H1C A;  1F5T A;  3ZPL A;  2VT3 A;  2L01 A;  2LY1 A;  2DT5 A;  4UY8 I;  1H88 C;  3IV5 A;  3CLO A;  4ESB A;  4HX7 A;  2HXO A;  3K7A J;  3CP2 A;  3VDX A;  5GPC A;  5L3E A;  2VON A;  4A6D A;  4A3D J;  3ZXS A;  3IC7 A;  4YEL A;  3ZQG A;  1IN4 A;  1IGN A;  3GF2 A;  3GFL A;  2MA3 A;  2Q0O A;  4F92 B;  3GME A;  4XL9 A;  2CGP A;  1HKQ A;  4V2F A;  2W57 A;  3BR0 A;  3L2U A;  1HF0 A;  4YG2 F;  2KRF A;  5M5Y J;  2KRH A;  3TP0 A;  2FOK A;  1KU3 A;  4XLP F;  1IDZ A;  2V1D A;  3WTX C;  1DPU A;  1G59 A;  2IJL A;  1ETX A;  1I1S A;  4M3F A;  3EDP A;  2O8X A;  4OIN F;  4XLN F;  3E7L A;  2ZJP F;  1E17 A;  2HYG D;  1GT0 C;  4CUG A;  2PFB A;  1R58 A;  3H9G A;  3JAM Z;  1ZQ3 P;  5L3B A;  4UXN A;  3J7Y J;  2V6C A;  1R23 A;  2WA0 A;  5D5W B;  5FRO A;  3ZQ7 A;  3EPZ A;  2CWE A;  4IQJ A;  1R5H A;  3TL4 X;  2WBM A;  1B6A A;  3S2D J;  4UUT A;  4BE0 A;  2JA2 A;  3HHH A;  2Z9O A;  2RDP A;  4ZH4 F;  2KZV A;  1TLH B;  4GXO A;  4CDG A;  5FKO A;  2IS6 A;  2HU9 A;  1V5G A;  3LA3 A;  1QZE A;  3FMQ A;  1FJL A;  3DLA A;  2HPM A;  2OTL I;  2BXY A;  1TW2 A;  3K4J A;  5EZH A;  5GAE J;  4IEJ A;  1AKH A;  3NRV A;  1Z1D A;  2GXB A;  4XLE A;  3F6O A;  1VFC A;  2DQR A;  1X4O A;  4L18 B;  1XG1 A;  3FKI J;  1ON1 A;  4I02 A;  3JCU C;  3K4C A;  4XKV A;  2LLK A;  1USS A;  2M30 A;  1P7J A;  1ZG1 A;  2CRG A;  3S1Q J;  1N78 A;  2BXZ A;  1F1Z A;  1SMY F;  3C7J A;  5F6F A;  1FIA A;  4AD9 A;  4IHS A;  3RYP A;  5K5R A;  1ETQ A;  4KIC A;  5E3L A;  4CIC A;  5K7F A;  2G9W A;  1ZRC A;  3CCJ I;  3MKY B;  3D1N I;  4FHT A;  2XHK A;  2HDD A;  4U7B A;  1FX7 A;  1FMW A;  2P8T A;  3LFK A;  5KNL A;  2R5Y A;  3H5N A;  1RES A;  4ZYD A;  5IT9 Z;  2MFZ A;  3CJT B;  3G6E I;  1BI1 A;  1LDK B;  2PJP A;  1R6R A;  3S17 J;  4AIJ A;  2VE9 A;  1MBK A;  4ETS A;  5L3D A;  3W2A A;  3PSF A;  1K7A A;  1XCV A;  2K9L A;  1W7P A;  1TWA J;  4M6Y A;  2FOW A;  2WAE A;  3CF2 A;  3EUH A;  1W4M A;  3Q0V A;  2BY2 A;  2VBY A;  1HKT A;  5ICC A;  2XRN A;  3CO7 C;  3TBI A;  3I59 A;  3HL2 A;  4A3J J;  3PNY A;  2ME0 A;  3CQZ J;  4XSX F;  1QHH D;  2EK5 A;  2V1N A;  3KEQ A;  2DA3 A;  2LVS A;  1SD4 A;  3WTZ A;  2M9H A;  1LFP A;  1LEB A;  1FBS A;  1YRN A;  5LD2 C;  1GUU A;  4D7M A;  4A3B J;  4DZP A;  1GVD A;  1XX5 A;  5CYV A;  1ON2 A;  2IA0 A;  2ZNZ A;  2QQB A;  1U5T B;  2K3F A;  2O0Y A;  2CW8 A;  4CXF A;  1R4M B;  5GTH C;  2KIM A;  2OQR A;  2L9V A;  3HUG B;  1WFX A;  2MH2 A;  1MNM C;  2VKE A;  2W48 A;  5JR3 A;  5DUK A;  2X6W A;  4KA4 A;  1IUY A;  4EMS A;  2EV0 A;  3H3U A;  4RGX A;  4G8X A;  4RLF A;  5EG0 A;  2CU7 A;  1YS7 A;  1X1P A;  2ELJ A;  1LDJ A;  2JRM A;  4QLC U;  1TBX A;  1FT9 A;  2XIG A;  4OAZ A;  5TJJ A;  1I1G A;  3L1P A;  2QUF A;  4IRG A;  1JGS A;  1Y0U A;  2M34 A;  2KL4 A;  5E20 A;  1YYV A;  3HKZ A;  4BE2 A;  2KQR A;  2KT0 A;  4MFD A;  1WHU A;  4MEX F;  2KDO A;  2E1N A;  2YR2 A;  2M0M A;  3L00 A;  4G7Z F;  1P4X A;  1LE8 B;  1A31 A;  2XF6 A;  1JE8 A;  3M8J A;  2WWY A;  4EVI A;  4NHJ A;  2DOA A;  1YX3 A;  1B59 A;  3CUQ B;  4HX4 A;  1TC3 C;  2QLZ A;  2JA7 J;  1SVO A;  1IDY A;  1YW8 A;  2XGC A;  3KCC A;  5KVR A;  3EUA A;  4XIC A;  3FM3 A;  3CCS I;  2EJR A;  3I64 A;  2M5W A;  1DP3 A;  2GXG A;  2F4I A;  3A2K A;  2L4M A;  2XF7 A;  3DTK A;  2LR8 A;  2K27 A;  1AWC A;  2XGX A;  5CKT A;  1F36 A;  2E60 A;  4EM1 A;  2VKV A;  4X6A J;  1WH5 A;  2H8W A;  4G12 A;  4NBQ A;  3IWZ A;  3PQJ A;  1UG0 A;  1KZH A;  2L4A A;  5H6R A;  1X1C A;  2OZU A;  3I9V 2;  5KAI C;  1U9O A;  3ZQH A;  4FCY A;  3IL2 A;  5AIQ A;  4RGU A;  4F91 B;  3C3W A;  4N4N B;  1CQT A;  4L0Z B;  1ZGA A;  5LRS A;  2P0W A;  3JRA A;  1P4A A;  3I4N J;  4XOP A;  4HG2 A;  1D5Y A;  2IS2 A;  3BTI A;  4Y13 A;  4HNU A;  2BYV E;  1KU2 A;  1IZ1 A;  2DA6 A;  4LFU A;  1JUM A;  1ZG5 A;  2HGC A;  5EEA A;  2OJE D;  5EGO A;  1QVT A;  3WTU C;  1C0W A;  2CSO A;  5F1R A;  1IO2 A;  4N0B A;  4AIH A;  1DGW Y;  5FJ8 J;  3JAM K;  1ULY A;  2QSH X;  3PNV A;  2P5V A;  1MNE A;  1WPK A;  1FZP B;  2L7K A;  1O57 A;  3HSR A;  3ZR8 X;  2PMZ N;  3GZ6 A;  3ZMT A;  2LSO A;  4ESJ A;  1YHQ I;  4EV0 A;  4MLO A;  3E6M A;  3M1C A;  1XTA A;  2ICW G;  3MZ8 A;  1Y0N A;  2DQL A;  3LSI A;  3HOV J;  2QVO A;  2V7F A;  3K4N A;  1UFM A;  3MKW B;  4DQ2 A;  1E3O C;  4EAT A;  2CW0 F;  2YSR A;  5KHD A;  1VQL I;  4UUV A;  1FYM A;  2DK5 A;  4KIF A;  3MCZ A;  1Z3X A;  1QBJ A;  4M74 A;  3OSF A;  3LMM A;  2LP0 A;  3DPL C;  4O3M A;  3S8P A;  4L5J A;  5JLW A;  2QQ9 A;  3FX3 A;  4A2U A;  2LRD A;  1YOV B;  3RYR A;  3GTG J;  3FXQ A;  4ZJZ A;  2QKL B;  3BJA A;  5HS9 A;  4HOB A;  5HLG A;  3ABL H;  4ASN A;  5LEK A;  3HEF A;  5FLV A;  4IXA A;  4MEY F;  1X3Z B;  4BJ6 C;  1DQU A;  5GP9 A;  1WWX A;  5K7H A;  3EQL F;  3RPQ A;  3W3C A;  4QPO A;  5D5U B;  5IYD J;  3QYE A;  1X3U A;  2QA4 I;  5IT9 K;  4NUB A;  3RTR A;  1BC8 C;  1XB4 A;  4OIQ F;  3GEZ A;  4G7H F;  3MD2 A;  5FD6 A;  4BY1 J;  4PGH A;  2NNY A;  4IRH A;  2J5P A;  2LTP A;  1X1B A;  1JKQ C;  3CUQ C;  2DFI A;  4RB0 A;  1DDN A;  2L7F P;  4LK1 F;  2BVM A;  3VSL A;  4I99 C;  1F43 A;  1ZAO A;  2MGQ A;  2XC7 A;  2IRF G;  4IOA F;  5J40 A;  2E36 A;  2PQ8 A;  2JN6 A;  1TT0 A;  2MG4 A;  4PK4 A;  2JJ7 A;  2XAH A;  3H36 A;  2E1O A;  4RAZ A;  2OCC H;  3OYG A;  5HLI A;  3CC7 I;  1A36 A;  3OS1 A;  2PJR A;  1IUF A;  1UJ8 A;  4YFK F;  1NTC A;  3RDI A;  5EDN A;  1SD7 A;  2K9M A;  5E8I A;  2R7T A;  2AXT C;  2M4K A;  2ZBK A;  5KCM A;  1KU7 A;  5IP9 J;  2NRA C;  4IO9 F;  2PN6 A;  3BRO A;  1LDD A;  3TDU C;  5FO5 A;  4IHX A;  5J47 A;  4PJL A;  2P5L C;  2O9L A;  1XDU A;  4ENK A;  3J80 Z;  4A5M A;  1GDT A;  3Q0U A;  5HLH A;  2XF5 A;  3HOX J;  1JUS A;  1R5I D;  3PUF A;  1GV2 A;  4MNU A;  5LGN A;  2N8G A;  5D6F A;  2RNJ A;  2PI0 A;  2A61 A;  2GOX B;  4C2M J;  4E7Z A;  1SVM A;  1I50 J;  2A69 F;  5E3M A;  3GTM J;  2NYX A;  2W82 A;  4LLL A;  4LK0 F;  2A3S A;  2X6X A;  3ZMV A;  2QEN A;  2XKO A;  2QGU A;  2ZNY A;  4M3D A;  3E1S A;  3S1N J;  3I0T A;  4Y3O A;  4CH7 A;  2XPU A;  3TW7 A;  1IG7 A;  2HI3 A;  5M5W J;  4P96 A;  4LGW A;  4D0P A;  2UXX A;  3MQ0 A;  3IHU A;  4N4O B;  4Z2Y A;  1WZ2 A;  1VF9 A;  4E7H A;  3GUD A;  3N05 A;  4QPQ A;  3P9K A;  2FE3 A;  4L9J A;  4CCK A;  2CUF A;  2VL8 A;  1LQ1 A;  2X1D A;  3RPU D;  2EPF A;  2JMW A;  3H3Z A;  1OKR A;  1MDM A;  2GWR A;  2VOD A;  1OR7 C;  4U0Y A;  2G0E A;  2FBH A;  3MKZ A;  3CCV I;  1R36 A;  3K4M A;  2CMP A;  1ZGW A;  4BH9 A;  5M3M J;  2VBZ A;  2CG4 A;  3DF8 A;  2Q1Z B;  3H5R A;  3ABU A;  1GXP A;  1A6Q A;  3HOU J;  1GHC A;  1Q1V A;  3G3Z A;  3F8F A;  4CYD A;  4LG0 A;  1BIA A;  1W0T A;  2IS4 A;  1AHD P;  5LLQ A;  3CJQ B;  3K1P A;  4UV9 A;  4HF1 A;  3RI4 A;  1BW6 A;  1X2M A;  3OMY A;  4CO8 A;  4YIF A;  3VOE A;  2XAF A;  2X51 A;  1YTY A;  4CYC A;  3GLX A;  2IBD A;  1RR8 C;  3W2W A;  3HDD A;  3M1E A;  3ERM A;  4OAY A;  4PDK A;  2QQA A;  5E1Z B;  2G7H A;  2A5W A;  1OYY A;  3AFH A;  4JX5 A;  2E2I J;  4BXF A;  5KK1 A;  3CF5 F;  4CCL A;  4S05 A;  3W2V A;  1PVE A;  2FXA A;  2O61 A;  3A02 A;  5LHI A;  2O03 A;  3DTE A;  4P9F A;  1Z9C A;  1LVK A;  3OYH A;  1MBF A;  2HVR A;  3J81 Z;  2H27 A;  2Y48 A;  1RET A;  2P5K A;  3HC7 A;  3DU5 A;  1ZN2 A;  1MBJ A;  2YX4 A;  4E7L A;  2P81 A;  1J59 A;  1KGS A;  3NQO A;  4J00 A;  5HNH A;  4UB8 C;  2AQF A;  3LA7 A;  4PZJ A;  3ZRG A;  5F08 A;  2GIZ A;  4BAY A;  4A93 J;  1TWH J;  2DOE A;  2HKO A;  1R7J A;  3HYI A;  3MKL A;  5J4V A;  4RMN A;  1JXS A;  1UST A;  4X1E A;  4LIV A;  5DCF A;  1OPC A;  1N25 A;  1Y1V J;  2FX0 A;  2VJI A;  4BS9 A;  1FP1 D;  4DZJ A;  2VOP A;  1VQN I;  4B3A A;  1ITY A;  1IXS B;  2K5C A;  4UV8 A;  3KLN A;  5IOY A;  4WWC A;  1U3E M;  1POG A;  1N75 A;  2HPI A;  3DV8 A;  2EWN A;  2HVS A;  5HOO A;  2FF4 A;  3RQI A;  2JSP A;  2K86 A;  2L5Q A;  2P7V B;  3I54 A;  2YX7 A;  3W6V A;  4XLC A;  3OYL A;  1T38 A;  3NWS A;  3AKZ A;  1GLN A;  2W4S A;  1YIO A;  2L9S A;  2LBF B;  3NWT A;  3BJ6 A;  2R5Y B;  3OYC A;  4CCN A;  3VOD A;  3QQA A;  1UMQ A;  5IYB J;  4YFN F;  2X0L A;  1D8J A;  1XSV A;  3FWE A;  2VQC A;  4IHW A;  2MD0 A;  2ZME A;  3Q3S A;  1Q1H A;  5CVR A;  1D1A A;  1W7P B;  2OQG A;  3LQQ A;  3R4K A;  3HTS B;  2EZI A;  3C18 A;  3HTU A;  3Q5F A;  3IRQ A;  3BG6 A;  4NNJ A;  3MWM A;  2A07 F;  3BG7 A;  2BHY A;  5ICE A;  2EV5 A;  5FB2 A;  3UNG C;  1MJ9 A;  1HSJ A;  2HQN A;  1G2H A;  3ISP A;  3DPU A;  5BS6 A;  2EZK A;  4B09 A;  2VB6 A;  4D5F A;  1R9T J;  1UHS A;  3VYT B;  4LIU A;  3OIQ A;  2XB5 A;  4B1R A;  4UUS A;  2IGO A;  4YRV A;  4JYK A;  3SQN A;  1G3W A;  3GFJ A;  1J9I A;  3MZH A;  3CLQ A;  3E5X A;  3BR1 A;  3O2P E;  3AG4 H;  1QPI A;  2LDU A;  2MAB A;  4IF4 A;  2XSJ C;  1ZRF A;  3FXL A;  1ZH5 A;  3FXM A;  3SJM A;  2H1K A;  3WTW C;  4HLY A;  1IC8 A;  2L7Z A;  6PAX A;  5M5X J;  1BR1 A;  2HTS A;  3U21 A;  3H0D A;  2DBB A;  1FY7 A;  2RQP A;  1SFE A;  1SC7 A;  3J80 K;  2MLG A;  1K4T A;  3CCU I;  4UHT A;  1X1D A;  3I4P A;  3S2W A;  3FXR A;  2R7S A;  2DA4 A;  3F22 A;  2IA2 A;  4XNF A;  2XAQ A;  3OIP A;  3J7Z I;  3OSG A;  2D1V A;  5FLX K;  3WGH A;  1F9N A;  3HOZ J;  3H0G J;  2R7R A;  3S3M A;  4L9T A;  3ZP5 A;  2XPW A;  2PLY A;  3LSH A;  4ITV A;  2MW8 A;  2ZXW H;  1XSD A;  1JHF A;  2R4G A;  4GYI A;  4MTE A;  3G71 I;  3GTK J;  2IXS A;  1SD6 A;  3OR2 C;  4EM0 B;  5E79 C;  4BXX J;  2JPB A;  4BHC A;  3GTO J;  3CCQ I;  4A3G J;  1ZHF A;  4BJT A;  3N4M A;  4RAF A;  4ENM A;  3FIS A;  5LEJ A;  2CUE A;  4GYG A;  4HRI A;  4AID A;  1MH3 A;  2QF7 A;  4W1U A;  4QSH A;  5A2Q K;  3GO5 A;  3MMY B;  5GAH J;  4LLN A;  1V3F A;  1YG2 A;  1YLF A;  1BBY A;  4HAM A;  2ZO4 A;  2EB7 A;  4YEJ A;  4JBA A;  1EJ9 A;  1YS6 A;  3CZ6 A;  5IPA A;  2NVX J;  4NQW A;  2BV6 A;  2QYO A;  4C3H J;  2B9S A;  1RKW A;  2EBI A;  4DJA A;  1A6I A;  2KFD A;  3HM5 A;  5J1Y A;  4IRI A;  1OCC H;  3ZMU A;  3GTQ J;  2ID6 A;  1XD7 A;  1WVR A;  1R1T A;  2ID3 A;  3QPH A;  1OCP A;  1U6G A;  2HDC A;  4I01 A;  1VQ6 I;  1WQ2 A;  2A6H F;  4OOI A;  2WAQ N;  1UB9 A;  3HPH A;  3JTH A;  1O3T A;  1Z0X A;  4G9Y A;  4HEA 2;  2DU9 A;  4BHB A;  5L3C A;  3KYD B;  4Q4Z F;  1ZGJ A;  2GAU A;  3KP6 A;  4DIQ A;  3JRC A;  3CD6 I;  3F72 A;  4XQF A;  1OFC X;  2X1C A;  1K61 A;  4EJT A;  4UB6 C;  1T39 A;  4ZDP A;  5B1B H;  1R1V A;  1ZTR A;  2XRO A;  1UZC A;  3H3V K;  4W97 A;  4PFP A;  2X6Y A;  4RS8 A;  2HKX A;  1I6X A;  1KON A;  2BY0 A;  4EQQ A;  5JVG F;  1UEL B;  3E5Q A;  3BG5 A;  1APL C;  2LD5 A;  4G7O F;  3CCY A;  3G73 A;  2OCE A;  1FC3 A;  3PO3 J;  3FXO A;  4II2 A;  3L2V A;  2O8K A;  1QU3 A;  1I3Q J;  3J81 K;  3M9A A;  1XCB A;  2QQ8 A;  4MFE A;  3QP6 A;  5AON A;  2L2O A;  5HNF A;  2DW4 A;  2ZJR F;  2LKX A;  1B1B A;  3R61 A;  5C3E J;  4BQA A;  1ZR4 A;  1WJF A;  1MW7 A;  2LFB A;  2NOJ B;  1XPX A;  1TT5 B;  1VQ8 I;  3D5S C;  1WI9 A;  2JUG A;  5EEH A;  4ZTJ A;  2AXL A;  2F5C A;  4QWQ A;  4A3L J;  2LC2 A;  5J1U A;  1WCM J;  1BI2 A;  1G4D A;  2Q2E B;  3DKX A;  1I6H J;  3BLY A;  3RIR A;  1JUP A;  2Z16 A;  1ZK8 A;  2PMH A;  2V4J C;  3CMA I;  3GBG A;  1TWF J;  5DCM A;  3KP2 A;  5JVT A;  1HKS A;  5DD4 A;  3BC8 A;  3A01 B;  1MBH A;  3HG9 A;  1V54 H;  1SVL A;  1O3Q A;  2AS5 F;  4Q47 A;  3T8R A;  1S5L C;  4OIR F;  1DU0 A;  2JPC A;  2KJB A;  3PSI A;  4OWR B;  3V8L A;  3RZD J;  3TO9 A;  5CVJ A;  1U8B A;  2BY3 A;  2X4H A;  1LUJ B;  1IXR C;  2FA5 A;  2X9D A;  3JTG A;  3OR1 C;  2QM3 A;  1O7F A;  5DTD A;  3WG9 A;  1W0U A;  3FM5 A;  1S6L A;  4DYR A;  2D5V A;  1TWC J;  4JOM A;  2L9R A;  2X1E A;  2IEK A;  4M3B A;  3FDY A;  2V9K A;  1IV6 A;  2EIK H;  4GFB A;  3DKY A;  3AG3 H;  5K5O A;  1RR7 A;  3ZQQ A;  2R7Z J;  4HQM A;  1TNS A;  1A35 A;  1Z77 A;  3H9J A;  5D4R A;  1V4R A;  4M3G A;  1EH8 A;  4R79 A;  3BQY A;  3B02 A;  3BR6 A;  3GFM A;  3CJN A;  3K1M A;  4I0B A;  1YJN I;  2ZXH A;  3KFW X;  3TOA A;  3H9Q A;  2HR3 A;  4Y52 J;  3L2C A;  2LYC A;  2JTV A;  3G1L A;  5H6Q A;  3VPR A;  3V8K A;  4A12 A;  3E3V A;  4NB5 A;  1ACI A;  2XAS A;  1ZYR F;  4U0V A;  4Y15 A;  1J7K A;  1FP2 A;  1RRJ A;  3QPS A;  1FNN A;  2E35 A;  4CCM A;  1Z6T A;  3TED A;  1CGP A;  5BMZ A;  2WAD A;  3D0S A;  1D5V A;  3GWZ A;  2G7U A;  3S14 J;  4S0H B;  2QSF X;  2UXN A;  4L5I A;  3KPH A;  3OWT A;  4KIB A;  4XBF A;  1V5F A;  3V7C A;  5HS8 A;  4UVC A;  3V7S A;  2KKO A;  1ODD A;  2PMU A;  1BL0 A;  2QBY B;  2ESH A;  1LEA A;  2Z1D A;  1XMK A;  3BZC A;  2BW3 A;  2R0Q C;  3ERE D;  4ZZL A;  4DNC A;  3QAH A;  2AHQ A;  4A6E A;  1B8I B;  1WRJ A;  1SAN A;  2WB1 N;  2P6S A;  2PMZ A;  3LSM A;  5M3F J;  1HBX G;  2QSG X;  4XK4 A;  1BM9 A;  1YFH A;  3TO6 A;  2Y75 A;  3REO A;  3FXJ A;  5LFA A;  2E71 A;  1T98 A;  1JT0 A;  3DBR B;  2DPU A;  3DXJ F;  5IYC J;  1D3Y A;  1REP C;  5HS7 A;  2HYJ A;  4JX4 A;  5GAD J;  3GTL J;  2W1O A;  4RGR A;  1J5Y A;  3I71 A;  1JJ6 C;  2R5Z B;  5C44 J;  4DW6 A;  2KMU A;  3S3N A;  2VC0 A;  4C9Y A;  3AG2 H;  1BI3 A;  1Z67 A;  2VC1 A;  2VKD A;  4WF2 A;  5L3F A;  4EM2 A;  3EYI A;  1GV5 A;  2F5F A;  4DGW B;  2KIQ A;  4F3Q A;  3WGI A;  4HDV A;  3RKQ A;  2X48 A;  2Z99 A;  3I56 I;  2Y0S A;  3TKY A;  2VT2 A;  2EZL A;  2YUS A;  3JRE A;  1HQC A;  4AM3 A;  3P5J A;  4MQ9 F;  3WTT C;  1FPQ A;  1TQM A;  2HYF A;  3BT9 A;  1PUF B;  2L54 A;  5DYM A;  3ZQI A;  4I98 B;  1YJW I;  2JQ7 A;  4BEH A;  5J8C A;  2DA2 A;  2H94 A;  5CVI A;  4PSX A;  1QO0 D;  2JUC A;  2DCE A;  2EA4 A;  1IRF A;  4CYC B;  4ON0 A;  4AUX A;  3D5L A;  5ERI A;  4HV5 A;  2Y2Z A;  3A03 A;  2IGN A;  4E7K A;  3SZP A;  1ZR2 A;  1S7O A;  2R7W A;  3RKX A;  1OCT C;  2R7Q A;  3QU6 A;  2CV2 A;  2W00 A;  3RJP A;  3PIO F;  1E0E A;  3NAR A;  2ELK A;  1KQ8 A;  2D1H A;  3ASN H;  5E3O A;  4ZYH A;  2DN0 A;  3BY6 A;  5B66 C;  5FGM A;  2Z5U A;  2BVL A;  2MSY A;  1ZKG A;  3CES A;  3CC4 I;  4L5E A;  2RRE A;  2NVT J;  1SEU A;  2ETH A;  3BZ6 A;  4FET A;  1U2W A;  3S1R J;  2D45 A;  1W1W E;  1Y56 A;  2W7N A;  3LL7 A;  4E7S A;  1D0X A;  3G4S I;  1PP7 U;  3PFY A;  2ZCW A;  2RNG A;  1ZLJ A;  3WU0 A;  1FOW A;  2DMP A;  5HOD A;  2HTJ A;  3U9G A;  1IN5 A;  2RN7 A;  1M1E B;  2Z3Y A;  4IQ4 A;  1WJ5 A;  2PEX A;  1U5T C;  1T08 B;  4LLG F;  5D8K B;  5C4X J;  2O5R A;  1EF4 A;  1TZL A;  2DFH A;  3QPL A;  4C30 A;  2M7B A;  1JJ8 C;  1Z05 A;  5GAG J;  3OYJ A;  1P4W A;  5ILV A;  2V1X A;  2MYS A;  4ZDL A;  3RZO J;  3SZT A;  1MJB A;  1HOM A;  4M6X A;  4BL0 B;  4XRS G;  2K85 A;  2L7M P;  3HBL A;  2A6T A;  3FIW A;  1T0F C;  2NVY J;  3TGN A;  1Z3Y A;  3T1B A;  4BY7 J;  1OCO H;  3ABK H;  4AYB A;  5TIS C;  2BEO A;  2F5D A;  2LF7 A;  3HB9 A;  3TP3 A;  1R1U A;  2YU3 A;  1HA8 A;  2KLO A;  4EJU A;  1B72 B;  4KYW A;  1R5G A;  1RZ4 A;  3JW4 A;  3E6C C;  3PIP F;  4XLF A;  2GIV A;  3LAP A;  3L2R A;  3I5U A;  4N9I A;  2UUZ A;  2EZH A;  1W7P D;  1QVU A;  4M71 A;  2DYR H;  3U1D A;  4GRI A;  3I53 A;  4BXU A;  1CF7 B;  1YJ9 I;  1IRZ A;  2COB A;  2DMU A;  5LGU A;  5BPD A;  3DQV C;  4IHV A;  1MMD A;  3PJR A;  4EJW A;  3V7R A;  1D0Z A;  1MBE A;  3IH2 A;  2GLO A;  3F21 A;  1TQP A;  5JFR A;  3ASO H;  3PL8 A;  3DPT A;  3ROU A;  3HRU A;  2ZB9 A;  3ESW B;  2HZD A;  4DYQ A;  4HV6 A;  2FBK A;  3AL0 B;  3FMS A;  4OMY A;  3M8F A;  1XGO A;  4KJZ A;  2B7E A;  2STT A;  2M7A A;  2VOO A;  4LD5 A;  5B3S H;  4XRM A;  4AVZ A;  3GYH X;  3KP3 A;  2QWW A;  2L3D A;  1VQ9 I;  3R6S A;  2XGD A;  3OS2 A;  3JRD A;  2VKH A;  5J6X A;  3OYM A;  4MGR A;  1FOK A;  3PNT A;  3FF5 A;  1J0R A;  2IT0 A;  4WCG A;  2EH3 A;  5J1R A;  1Y6I A;  5J4Y A;  1WSU A;  1OIS A;  2LOO A;  2NVQ J;  2BOL A;  3VWB A;  1IF1 A;  3CDL A;  1KQ9 A;  3MN2 A;  4QIW N;  2FD5 A;  3QWL A;  4B44 A;  3OYE A;  1S8N A;  2OD5 A;  2ZXI A;  1RPW A;  1JHH A;  2DA7 A;  1AA7 A;  1G3T A;  2E1C A;  3HOT A;  1UHM A;  1QZY A;  3I4M J;  2O7O A;  3ULQ B;  2YS9 A;  5LHH A;  1S7E A;  1QGP A;  4FE7 A;  1R49 A;  4BU2 A;  5JHF A;  3DCF A;  2XB0 X;  4I7H A;  1GVJ A;  2MBF A;  2ESN A;  5H2F C;  4ANJ A;  5CVU A;  1K78 B;  3GVA A;  4ESF A;  4BUP A;  2IVM A;  1KQ0 A;  5H20 A;  4FX0 A;  1R4N B;  4RM2 A;  4NQW B;  4OIP F;  1VQK I;  5FKK A;  1LE8 A;  3C2H A;  3OYI A;  4ZDO A;  2BY1 A;  4KN7 X;  3KEO A;  4E7I A;  2W85 A;  3CUQ A;  4CGZ A;  3SEQ A;  2DMN A;  1FWZ A;  3O3K A;  2H8R A;  3DWL E;  5CVV A;  4ZYA A;  2DFF A;  3SDB A;  5E18 F;  4A0Y A;  4BBS J;  4NDL A;  4BNC A;  3E5U A;  3CTA A;  3BDD A;  1K4S A;  2FQ3 A;  1WGX A;  2EFQ A;  1S72 I;  2QCO A;  4KIS A;  1BR2 A;  2PX9 A;  1QHG A;  3WOD F;  2KRC A;  2O6G E;  4Y17 A;  2BE5 F;  3KIO A;  3Q0W A;  5JLX A;  3HOW J;  3F8M A;  4WXC A;  5DUI A;  2QEX I;  2LH9 A;  4H4K C;  2EIL H;  2FQ4 A;  2Y69 H;  5E1X A;  2A68 F;  2ECC A;  3P9C A;  3OYN A;  1K79 A;  1I27 A;  2L0K A;  2XPV A;  3GW2 A;  1T33 A;  4HST A;  4A0X A;  4C3I J;  1HCR A;  2V79 A;  1ZAR A;  3FXK A;  2CO5 A;  2M8E A;  2VQL A;  4HPQ A;  2E5Z A;  5GPA A;  4YIR X;  2XAJ A;  3WE2 A;  1X58 A;  1JTY A;  1O3R A;  4CHU A;  1ETK A;  4WK8 F;  2KP6 A;  2IAI A;  3VB2 A;  2H09 A;  2HEO A;  5FKN A;  4GGG A;  5HDN A;  2I5U A;  3AL0 C;  5HVQ C;  1YQA A;  4P5O A;  2VN2 A;  2HOT A;  1AKH B;  2CV0 A;  2K4J A;  1SFX A;  5ED4 A;  4MIM A;  4BE1 A;  5JHU A;  3KP4 A;  3JRH A;  2VQH A;  2HQA A;  2YU9 J;  4LB5 A;  3DTI A;  4E70 A;  4BAC A;  1STZ A;  2VXD A;  5DCM B;  4CCO A;  4XSZ F;  3MAJ A;  4I6Z A;  3IUO A;  2P6T A;  4RB2 C;  3P9I A;  1Z21 A;  2H6B A;  4G6T B;  4IZZ A;  3J7A Y;  2ZXJ A;  1OQY A;  2KIS A;  1PUE E;  1BJZ A;  2CYY A;  2UV1 A;  1WI3 A;  4Q48 A;  2R7F A;  1ETY A;  3DBL B;  3OS0 A;  3E6D A;  1OR7 A;  3LOC A;  5E1W A;  5BPI A;  4IL6 C;  1MMG A;  1IJW C;  2JRT A;  5HLT A;  4HDU A;  3K1N A;  2NS0 A;  2LRE A;  3C2G A;  3RSN A;  4HYE A;  2F4M B;  2LG4 A;  2JA5 J;  2ISY A;  3L7W A;  4XON A;  2ACJ A;  4MTD A;  3I59 B;  2FML A;  1KA8 A;  3FK6 A;  3OL3 A;  4MO7 A;  3JRG A;  3FHZ A;  4BGD A;  2VPL A;  2V9P A;  3L9F A;  1FBU A;  1RIO H;  5ILS A;  2OC6 A;  1UHW A;  3CME I;  1YRN B;  4BYY A;  1H0M A;  2VE8 A;  2HZT A;  1MZB A;  1YE9 A;  1QQI A;  1E3P A;  4JP0 A;  3VYS B;  1B4A A;  3HXL A;  4M6V A;  2XRL A;  3QP5 A;  2IP2 A;  4A3I J;  1K83 J;  3DKW A;  3TMO A;  3CMY A;  2DTZ A;  2Y0M A;  4F55 A;  1LNW A;  2F48 A;  1T8I A;  5EG0 B;  2OTJ I;  2WAQ A;  3AAF A;  2KIF A;  2RAE A;  3DEE A;  1XGN A;  2NS7 A;  3OIO A;  3RKW A;  3JRB A;  3LNQ A;  5TRD A;  1FLI A;  3FHN A;  3ZN1 A;  2J5O A;  1NG6 A;  3IP4 B;  2BBY A;  3FZV A;  1HW5 A;  4KIG A;  1FTT A;  2Y31 A;  4A5N A;  2XGE A;  3OYD A;  4IHY A;  1ERD A;  2FNA A;  2F6C A;  4G6Q A;  2B63 J;  5AIP A;  5HDG A;  3TO7 A;  3B6A A;  4CA0 A;  2W24 A;  4IHT A;  1D8K A;  4ZZD A;  4BDY A;  3B6C A;  4LJZ F;  4EJV A;  3WTS C;  4D9J A;  1QRY A;  2CQN A;  2EIN H;  4DYC A;  4J19 A;  3GZN B;  3COA C;  3Q9V A;  4HNT A;  1XMA A;  3BCB A;  1JKR C;  2V6E A;  4AVP A;  1QA6 A;  2W84 A;  3FK7 A;  2DLL A;  3B73 A;  3QOP A;  1YW9 A;  3GZ5 A;  2TCT A;  3T5X A;  3F9K A;  4F7Z A;  2WV0 A;  3KX2 A;  1XS9 A;  3S15 J;  1VTN C;  1SAU A;  3E6B A;  4XLA A;  1DPR A;  3WGG A;  2E7X A;  3BJO A;  2KDZ A;  3BPX A;  2DOF A;  1OYW A;  5FKL A; 
#chains in the Genus database with same CATH homology
 5FFZ A;  3K0L A;  1SAX A;  4JQF A;  3C1D A;  3SHF A;  1H9T A;  2COM A;  1TW3 A;  3I58 A;  3DEU A;  4L9V A;  3IKV A;  3V8J A;  2RV8 A;  3KE2 A;  2V9V A;  4AWX B;  2ZJ2 A;  1YO5 C;  4KMF A;  4P9U A;  3R60 A;  2Z33 A;  1QNT A;  3F6V A;  2JSC A;  4YII A;  2DAO A;  1KU9 A;  3ECH A;  5J8F A;  3F3X A;  3QRF F;  4KMU X;  3KET A;  1IW7 F;  3WU1 B;  4G94 A;  2M87 A;  2OBP A;  2FNP A;  4FT8 A;  2H6C A;  2VBX A;  1EH7 A;  2MD5 A;  2A6E F;  3KLO A;  5E8G A;  2JT1 A;  2CQK A;  2EFP A;  4WXH A;  3ZMD A;  1ZRD A;  4HF2 A;  1L0O C;  3TDZ C;  1P92 A;  4MQV A;  2DK8 A;  2BGC A;  4EJO A;  2DTR A;  2QZ8 A;  4PCQ A;  2TDX A;  3NEU A;  2WC2 A;  4UVA A;  1DP7 P;  2E7W A;  2WTE A;  2A5Y B;  2R3S A;  4HW0 A;  1MGT A;  4OU0 A;  1PP8 F;  4EGZ A;  3OOP A;  1Z7U A;  1XDS A;  4KFC A;  2NNN A;  3KP7 A;  3U2R A;  5D5V B;  2Q8K A;  3PQK A;  1H9G A;  1GXQ A;  2RGV A;  2M45 A;  2R7D A;  4PGG A;  4RAY A;  3ZMZ A;  2HOE A;  1XN7 A;  3QPT A;  4IPA A;  1MKM A;  3K69 A;  2ZKZ A;  2M1B A;  2XVC A;  3H92 A;  3GXO A;  2EFW A;  3ML6 A;  3LST A;  4KDP A;  1LB2 A;  4H0E A;  2UZK A;  1G3Y A;  5DDG A;  1FYL A;  4CZZ A;  3KZY A;  1XGS A;  2MC3 A;  5CLS A;  4OMZ A;  3ECO A;  1MD0 A;  1J75 A;  1RI7 A;  4R1H A;  2W25 A;  3EYY A;  3KZZ A;  3QU3 A;  1I5Z A;  2XKP A;  2FRH A;  5E17 F;  3HRT A;  2PBI A;  1LVA A;  5HDK A;  3V4G A;  2K02 A;  1MDM B;  1W5T A;  2DI3 A;  1G3S A;  1RUO A;  2MH9 A;  3W6K B;  4U88 A;  4KT5 C;  5D8L B;  4LG0 B;  5K5Q A;  4M9X A;  1OMI A;  3R0J A;  1IN8 A;  5ICG A;  5F64 A;  5DD8 A;  3RKY A;  1O7L A;  4Q5S F;  3RPU A;  5LRR A;  1U78 A;  3IRR A;  1TQI A;  1IAW A;  4G6D A;  1KYZ A;  2P7C B;  1R22 A;  4WX9 A;  4YFX F;  1TTY A;  4WXD A;  2VBW A;  2NAZ A;  2ADU A;  4N9H A;  4TV7 A;  2IW5 A;  1Z91 A;  4XRF A;  4L0Y B;  4O5V A;  3BOQ A;  4UVB A;  3LQR A;  4ZYG A;  1T2K A;  2IPQ X;  2MLK A;  3BPV A;  4O6J A;  2UWM A;  2HS5 A;  1R00 A;  2GQQ A;  2FBI A;  5CJ9 A;  4JK1 X;  3K9T A;  2HFH A;  3SXY A;  1QZZ A;  1BOA A;  2Q2E A;  2ZME B;  4HQE A;  1FBQ A;  1F4K A;  3FMR A;  4HZF A;  1IN7 A;  1S29 A;  5L3G A;  1O3S A;  3K2Z A;  1XSX A;  4UNO A;  4ENJ A;  2XV4 S;  1IRG A;  2OA4 A;  3SFZ A;  3J7A O;  3PFI A;  2EV6 A;  4IJA A;  3ZMS A;  1IXC A;  1IN6 A;  3ZN0 A;  2F5E A;  1WKM A;  3ABT A;  4L9N A;  1FSH A;  1HST A;  5LGT A;  5D5X B;  1BIB A;  3HOS A;  2V1U A;  4ENN A;  4MHG A;  2ISZ A;  1AOY A;  4GO1 A;  3HRS A;  3ELK A;  1DUX C;  2DPD A;  3CUO A;  3MFK A;  3F23 A;  1U5T A;  1ZG3 A;  1SD5 A;  3HUG A;  2XAG A;  4I0A A;  5FFX A;  1S3J A;  5EEG A;  2K4B A;  2O3F A;  1E2X A;  2VXZ A;  1T0F A;  5FLX Z;  1HW1 A;  1KYW A;  3F8N A;  1J2X A;  4HLX A;  5BOX A;  1ONV A;  2QBY A;  2D2W A;  5LBQ A;  5DV5 A;  1RUN A;  2OAZ A;  1K6O A;  3JSO A;  2KIU A;  5DEQ A;  2OU2 A;  4HBL A;  3WTY C;  2LNB A;  4LMY A;  5A2Q Z;  3JSP A;  1ZLK A;  1BJA A;  3HSF A;  1U8R A;  1NHA A;  1ZRE A;  3GX4 X;  3M8E A;  2ZFW A;  3HHG A;  1RNL A;  3Q9S A;  1B9N A;  3WE3 A;  3HRM A;  1Z6R A;  2EFN A;  2GA1 A;  4P55 A;  2B0L A;  4KN4 X;  3W6J B;  1PDN C;  3HSE A;  2RKH A;  4OIO F;  3T8T A;  4HF0 A;  4M73 A;  5LHG A;  1T6S A;  1W5S A;  4U0W A;  1HW2 A;  1LJ9 A;  4U7D A;  1A04 A;  4RB3 C;  1P2F A;  3BP8 A;  5K1Y A;  5IT3 A;  2IA1 A;  4R8H A;  3KP5 A;  2RVC A;  1S7A A;  5FD5 A;  1L3L A;  2STW A;  4S04 A;  4B8X A;  1EV7 A;  2FMY A;  2DO7 A;  2CFX A;  4M9Z A;  2PG4 A;  3TOB A;  3MEX A;  4IVN A;  2EFO A;  4GCV A;  1OYI A;  2EA2 A;  1EH6 A;  4FX4 A;  3VFZ A;  5D6E A;  1YW7 A;  2L02 A;  2GA2 A;  4HX8 A;  2GZW A;  4ZYE A;  3HIF A;  4M72 A;  4RGS A;  2KJC A;  2K7L A;  4AIK A;  1B9M A;  3EET A;  2ELH A;  3MZY A;  3FXU A;  2LF8 A;  1TNT A;  3DFG A;  1HXD A;  1UCR A;  2FSW A;  1MJA A;  4LB6 B;  1BN5 A;  1BI0 A;  1SMT A;  3F8B A;  1SFU A;  1CF7 A;  4I2O A;  3CDH A;  5ICF A;  2F2E A;  4HA8 A;  3TQN A;  4BHP A;  3CO6 C;  4KNY A;  3VEP A;  3L09 A;  4K2E A;  3BWG A;  2YPR A;  3OV8 A;  3R0A A;  5BQT A;  4EGY A;  3LAJ A;  5ILU A;  3WTV C;  5JI6 A;  1G6N A;  3M7G A;  2OZ6 A;  4I09 A;  3DP7 A;  1FSE A;  3E97 A;  2C6Y A;  3O6B B;  2P4W A;  3LWF A;  2FU4 A;  4M9S A;  3LA2 A;  2HWV A;  3F8C A;  1FYK A;  2RC4 A;  1P6R A;  5D4S A;  3N97 A;  2LKP A;  1BC7 C;  1QPM A;  2FEZ A;  1XGM A;  4KUM A;  3IKT A;  4A0Z A;  3IWF A;  2XUB A;  2JZY A;  4RB1 A;  3GFI A;  2HQR A;  3T0Y A;  3P7N A;  1K78 A;  1F5T A;  3ZPL A;  2VT3 A;  2L01 A;  2DT5 A;  3CLO A;  4ESB A;  4HX7 A;  5L3E A;  2VON A;  4A6D A;  3IC7 A;  1IN4 A;  3GF2 A;  3GFL A;  2MA3 A;  2Q0O A;  2CGP A;  1HKQ A;  2W57 A;  4YG2 F;  2KRF A;  2FOK A;  1KU3 A;  4XLP F;  2V1D A;  3WTX C;  1DPU A;  2IJL A;  1I1S A;  3EDP A;  2O8X A;  4OIN F;  4XLN F;  1E17 A;  2HYG D;  2PFB A;  1R58 A;  3JAM Z;  5L3B A;  4UXN A;  2V6C A;  1R23 A;  5D5W B;  3ZQ7 A;  2CWE A;  1R5H A;  1B6A A;  3HHH A;  2Z9O A;  2RDP A;  4ZH4 F;  1TLH B;  4GXO A;  4CDG A;  3LA3 A;  3FMQ A;  1TW2 A;  3NRV A;  1Z1D A;  2GXB A;  3F6O A;  2DQR A;  4L18 B;  1ON1 A;  4I02 A;  1USS A;  2M30 A;  1ZG1 A;  1F1Z A;  1SMY F;  3C7J A;  5F6F A;  4AD9 A;  4IHS A;  3RYP A;  5K5R A;  4KIC A;  4CIC A;  2G9W A;  1ZRC A;  4FHT A;  2XHK A;  4U7B A;  1FX7 A;  2P8T A;  3LFK A;  4ZYD A;  5IT9 Z;  1BI1 A;  1LDK B;  2PJP A;  4AIJ A;  2VE9 A;  4ETS A;  5L3D A;  1K7A A;  1XCV A;  1W7P A;  4M6Y A;  3EUH A;  1W4M A;  2VBY A;  1HKT A;  5ICC A;  2XRN A;  3CO7 C;  3I59 A;  4XSX F;  2EK5 A;  3KEQ A;  1SD4 A;  3WTZ A;  1LEB A;  1FBS A;  5CYV A;  1ON2 A;  2IA0 A;  2ZNZ A;  1U5T B;  2QQB A;  2O0Y A;  4CXF A;  2KIM A;  2OQR A;  2MH2 A;  5JR3 A;  5DUK A;  4KA4 A;  1IUY A;  4EMS A;  2EV0 A;  3H3U A;  4RGX A;  4G8X A;  1YS7 A;  1LDJ A;  4QLC U;  1TBX A;  1FT9 A;  2XIG A;  5TJJ A;  1I1G A;  2QUF A;  4IRG A;  1JGS A;  1Y0U A;  5E20 A;  1YYV A;  4MEX F;  2E1N A;  2YR2 A;  3L00 A;  4G7Z F;  1P4X A;  1JE8 A;  4NHJ A;  2WWY A;  4EVI A;  1B59 A;  3CUQ B;  4HX4 A;  2QLZ A;  1YW8 A;  3KCC A;  5KVR A;  3FM3 A;  2EJR A;  3I64 A;  2M5W A;  2GXG A;  2L4M A;  2K27 A;  1AWC A;  2XGX A;  4EM1 A;  3IWZ A;  3PQJ A;  2L4A A;  5H6R A;  2OZU A;  3IL2 A;  5AIQ A;  4RGU A;  3C3W A;  4L0Z B;  1ZGA A;  5LRS A;  1P4A A;  4Y13 A;  2BYV E;  1KU2 A;  1IZ1 A;  4LFU A;  1ZG5 A;  2HGC A;  3WTU C;  1C0W A;  2CSO A;  5F1R A;  4N0B A;  4AIH A;  3JAM K;  1ULY A;  2P5V A;  1FZP B;  1O57 A;  3HSR A;  3GZ6 A;  3ZMT A;  2LSO A;  4ESJ A;  4EV0 A;  3E6M A;  2DQL A;  2QVO A;  1UFM A;  4DQ2 A;  2CW0 F;  2YSR A;  4UUV A;  1FYM A;  2DK5 A;  4KIF A;  3MCZ A;  1QBJ A;  4M74 A;  3DPL C;  4O3M A;  4L5J A;  2QQ9 A;  3FX3 A;  4A2U A;  3RYR A;  3FXQ A;  5HS9 A;  3BJA A;  4HOB A;  5HLG A;  4ASN A;  5LEK A;  4IXA A;  4MEY F;  1WWX A;  3EQL F;  3RPQ A;  5D5U B;  1X3U A;  5IT9 K;  3RTR A;  1BC8 C;  1XB4 A;  4OIQ F;  3GEZ A;  4G7H F;  5FD6 A;  4PGH A;  2NNY A;  4IRH A;  2J5P A;  3CUQ C;  2DFI A;  4RB0 A;  1DDN A;  4LK1 F;  1ZAO A;  2IRF G;  2PQ8 A;  2XAH A;  4RAZ A;  5HLI A;  4YFK F;  3RDI A;  1SD7 A;  5E8I A;  2ZBK A;  1KU7 A;  2NRA C;  2PN6 A;  3BRO A;  1LDD A;  3TDU C;  5FO5 A;  2P5L C;  1XDU A;  4ENK A;  3J80 Z;  4A5M A;  5HLH A;  4MNU A;  5LGN A;  5D6F A;  2RNJ A;  2PI0 A;  2A61 A;  2A69 F;  2NYX A;  4LLL A;  4LK0 F;  2A3S A;  3ZMV A;  2QEN A;  2XKO A;  2ZNY A;  3I0T A;  4P96 A;  4LGW A;  4D0P A;  2UXX A;  3MQ0 A;  3IHU A;  4Z2Y A;  3GUD A;  3P9K A;  2FE3 A;  4L9J A;  1LQ1 A;  3H3Z A;  1OKR A;  1MDM A;  2GWR A;  2VOD A;  4U0Y A;  2FBH A;  1R36 A;  4BH9 A;  2VBZ A;  2CG4 A;  3DF8 A;  3ABU A;  1GXP A;  1GHC A;  3G3Z A;  3F8F A;  4CYD A;  4LG0 A;  1BIA A;  5LLQ A;  3K1P A;  4UV9 A;  4HF1 A;  3RI4 A;  4YIF A;  4CO8 A;  3VOE A;  2XAF A;  1YTY A;  3GLX A;  3M1E A;  4PDK A;  2QQA A;  5E1Z B;  2G7H A;  1OYY A;  5KK1 A;  4S05 A;  2FXA A;  2O61 A;  5LHI A;  2O03 A;  4P9F A;  1Z9C A;  3J81 Z;  2H27 A;  2Y48 A;  2P5K A;  1ZN2 A;  1J59 A;  2YX4 A;  1KGS A;  3NQO A;  3LA7 A;  4PZJ A;  4BAY A;  2HKO A;  1R7J A;  3HYI A;  1JXS A;  1UST A;  5DCF A;  1OPC A;  1FP1 D;  2VOP A;  1IXS B;  4UV8 A;  3KLN A;  4WWC A;  1U3E M;  3DV8 A;  2EWN A;  5HOO A;  2FF4 A;  2K86 A;  2P7V B;  3I54 A;  2YX7 A;  1T38 A;  1YIO A;  3BJ6 A;  3VOD A;  4YFN F;  2X0L A;  1D8J A;  1XSV A;  3FWE A;  2ZME A;  1Q1H A;  5CVR A;  1W7P B;  2OQG A;  3LQQ A;  3R4K A;  3HTS B;  3C18 A;  3HTU A;  3Q5F A;  3IRQ A;  3MWM A;  2A07 F;  5ICE A;  2EV5 A;  5FB2 A;  1MJ9 A;  1HSJ A;  2HQN A;  3ISP A;  5BS6 A;  4B09 A;  3SQN A;  1G3W A;  3GFJ A;  1J9I A;  3MZH A;  3E5X A;  3O2P E;  2LDU A;  4IF4 A;  1ZRF A;  1ZH5 A;  3WTW C;  4HLY A;  6PAX A;  2HTS A;  2DBB A;  1FY7 A;  2RQP A;  1SFE A;  3J80 K;  2MLG A;  4UHT A;  3I4P A;  3S2W A;  3FXR A;  3F22 A;  2IA2 A;  5FLX K;  2XAQ A;  2D1V A;  3WGH A;  1F9N A;  4L9T A;  3ZP5 A;  2PLY A;  1XSD A;  1JHF A;  4GYI A;  4MTE A;  1SD6 A;  4EM0 B;  2JPB A;  4BHC A;  1ZHF A;  3N4M A;  4ENM A;  5LEJ A;  4GYG A;  5A2Q K;  3GO5 A;  4LLN A;  1V3F A;  1YG2 A;  1YLF A;  1BBY A;  4HAM A;  2ZO4 A;  2EB7 A;  4JBA A;  1YS6 A;  4NQW A;  2BV6 A;  2QYO A;  4IRI A;  3ZMU A;  1XD7 A;  1R1T A;  3QPH A;  1U6G A;  2HDC A;  4I01 A;  1WQ2 A;  2A6H F;  4OOI A;  1UB9 A;  3JTH A;  1O3T A;  4G9Y A;  2DU9 A;  4BHB A;  5L3C A;  4Q4Z F;  1ZGJ A;  2GAU A;  3KP6 A;  3F72 A;  4EJT A;  1T39 A;  1R1V A;  2XRO A;  4RS8 A;  2HKX A;  1I6X A;  4EQQ A;  3E5Q A;  4G7O F;  3G73 A;  1FC3 A;  3J81 K;  3M9A A;  1XCB A;  3QP6 A;  5AON A;  2DW4 A;  1B1B A;  3R61 A;  4BQA A;  1WI9 A;  5EEH A;  2AXL A;  2F5C A;  4QWQ A;  1BI2 A;  1G4D A;  3RIR A;  2PMH A;  5DCM A;  3KP2 A;  5JVT A;  1HKS A;  5DD4 A;  1O3Q A;  2AS5 F;  4Q47 A;  3T8R A;  4OIR F;  2JPC A;  2KJB A;  3V8L A;  3TO9 A;  5CVJ A;  2X4H A;  1IXR C;  2FA5 A;  3JTG A;  2QM3 A;  1O7F A;  3WG9 A;  3FM5 A;  1S6L A;  5K5O A;  4HQM A;  1TNS A;  5D4R A;  1V4R A;  4R79 A;  1EH8 A;  3B02 A;  3GFM A;  3CJN A;  3K1M A;  4I0B A;  3KFW X;  3TOA A;  2HR3 A;  3L2C A;  2JTV A;  5H6Q A;  3V8K A;  4A12 A;  3E3V A;  4NB5 A;  2XAS A;  4U0V A;  1ZYR F;  4Y15 A;  1J7K A;  1FP2 A;  1FNN A;  1Z6T A;  1CGP A;  5BMZ A;  3D0S A;  1D5V A;  3GWZ A;  2G7U A;  2UXN A;  4L5I A;  4XBF A;  4KIB A;  5HS8 A;  3V7C A;  4UVC A;  3V7S A;  2KKO A;  1ODD A;  2PMU A;  2QBY B;  2ESH A;  1LEA A;  1XMK A;  3ERE D;  4ZZL A;  4DNC A;  3QAH A;  4A6E A;  1WRJ A;  2P6S A;  1HBX G;  1BM9 A;  1YFH A;  3TO6 A;  2Y75 A;  3REO A;  1T98 A;  2DPU A;  3DXJ F;  1D3Y A;  1REP C;  5HS7 A;  4RGR A;  1J5Y A;  3I71 A;  2VC0 A;  1BI3 A;  2VC1 A;  4WF2 A;  5L3F A;  3EYI A;  4EM2 A;  2F5F A;  3WGI A;  4HDV A;  2Z99 A;  3TKY A;  2VT2 A;  1HQC A;  4MQ9 F;  3WTT C;  1FPQ A;  1TQM A;  2HYF A;  2L54 A;  5DYM A;  4I98 B;  5J8C A;  2H94 A;  5CVI A;  1QO0 D;  2EA4 A;  1IRF A;  4ON0 A;  3D5L A;  5ERI A;  4HV5 A;  3SZP A;  1S7O A;  3RKX A;  3QU6 A;  3RJP A;  1KQ8 A;  2D1H A;  4ZYH A;  3BY6 A;  5FGM A;  2Z5U A;  2ETH A;  3BZ6 A;  1U2W A;  2D45 A;  1PP7 U;  2ZCW A;  1ZLJ A;  3WU0 A;  2HTJ A;  3U9G A;  1IN5 A;  2RN7 A;  2Z3Y A;  4LLG F;  2PEX A;  1U5T C;  5D8K B;  1Z05 A;  1P4W A;  5ILV A;  2V1X A;  3SZT A;  1MJB A;  4M6X A;  3TGN A;  3T1B A;  2BEO A;  2F5D A;  2LF7 A;  1R1U A;  2YU3 A;  4EJU A;  4KYW A;  1R5G A;  1RZ4 A;  3JW4 A;  3E6C C;  2GIV A;  3LAP A;  3I5U A;  4N9I A;  1W7P D;  4M71 A;  3U1D A;  3I53 A;  4BXU A;  1CF7 B;  5LGU A;  5BPD A;  3DQV C;  4EJW A;  3V7R A;  3F21 A;  1TQP A;  5JFR A;  3DPT A;  3ROU A;  3HRU A;  4HV6 A;  2FBK A;  3FMS A;  4OMY A;  3M8F A;  1XGO A;  2STT A;  2VOO A;  4LD5 A;  3GYH X;  3KP3 A;  2QWW A;  2L3D A;  3R6S A;  5J6X A;  4MGR A;  1FOK A;  3FF5 A;  1J0R A;  2IT0 A;  4WCG A;  1WSU A;  1IF1 A;  1KQ9 A;  1S8N A;  2OD5 A;  1JHH A;  1G3T A;  2E1C A;  3HOT A;  1UHM A;  1QZY A;  3ULQ B;  5LHH A;  1QGP A;  4I7H A;  1GVJ A;  2MBF A;  2ESN A;  5CVU A;  1K78 B;  3GVA A;  4ESF A;  2IVM A;  1KQ0 A;  5H20 A;  4FX0 A;  4OIP F;  4KN7 X;  3KEO A;  2W85 A;  3CUQ A;  4CGZ A;  1FWZ A;  3O3K A;  5CVV A;  5E18 F;  4A0Y A;  4BNC A;  3E5U A;  3CTA A;  3BDD A;  2FQ3 A;  2EFQ A;  3WOD F;  2O6G E;  4Y17 A;  2BE5 F;  3F8M A;  4WXC A;  5DUI A;  5E1X A;  2A68 F;  1K79 A;  3P9C A;  1I27 A;  3GW2 A;  4A0X A;  2V79 A;  1ZAR A;  2CO5 A;  2M8E A;  2XAJ A;  3WE2 A;  1O3R A;  4CHU A;  4WK8 F;  3VB2 A;  2H09 A;  2HEO A;  4GGG A;  5HDN A;  5HVQ C;  1YQA A;  4P5O A;  2VN2 A;  2K4J A;  1SFX A;  5ED4 A;  5JHU A;  3KP4 A;  4LB5 A;  4E70 A;  1STZ A;  5DCM B;  4XSZ F;  3MAJ A;  2P6T A;  4RB2 C;  3P9I A;  2H6B A;  2ZXJ A;  1PUE E;  2CYY A;  4Q48 A;  2R7F A;  3E6D A;  1OR7 A;  5E1W A;  5BPI A;  2JRT A;  4HDU A;  3K1N A;  2NS0 A;  4HYE A;  2ISY A;  3L7W A;  2ACJ A;  4MTD A;  3I59 B;  2FML A;  1KA8 A;  3FHZ A;  3L9F A;  1FBU A;  1RIO H;  5ILS A;  1UHW A;  4BYY A;  1H0M A;  2VE8 A;  2HZT A;  1MZB A;  1QQI A;  1B4A A;  3QP5 A;  2IP2 A;  3DKW A;  2Y0M A;  1LNW A;  3AAF A;  2KIF A;  1XGN A;  3RKW A;  5TRD A;  1FLI A;  3ZN1 A;  2J5O A;  2BBY A;  3FZV A;  1HW5 A;  4KIG A;  4A5N A;  2FNA A;  4G6Q A;  5AIP A;  5HDG A;  3TO7 A;  2W24 A;  4IHT A;  1D8K A;  4ZZD A;  4LJZ F;  4EJV A;  3WTS C;  3COA C;  3Q9V A;  1XMA A;  4AVP A;  2W84 A;  2DLL A;  3B73 A;  3QOP A;  1YW9 A;  3GZ5 A;  3T5X A;  4F7Z A;  2WV0 A;  1VTN C;  3E6B A;  1DPR A;  3WGG A;  2E7X A;  3BJO A;  3BPX A;  1OYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...