2OBPA

Crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative DNA-binding protein (YP_298295.1) from Ralstonia eutropha JMP134 at 1.70 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 23
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2obpA00
4UXNA 1J75A 2GZWA 4I98B 3I58A 2A07F 2OQGA 4HW0A 1Z05A 2X4HA 5LHGA 3IC7A 3FM3A 4KFCA 3R0AA 3CO6C 4HYEA 1WQ2A 1KU2A 4ESFA 3COAC 2DU9A 2MC3A 4M9ZA 1K78B 4S05A 3RJPA 2M45A 1UB9A 1J9IA 1Q1HA 1I6XA 3TDUC 4M72A 5BPDA 5HLGA 3RKXA 1IZ1A 2LF7A 4L9TA 2EB7A 2FE3A 2Z5UA 4L9JA 3CDHA 3EYIA 4ZYHA 2RDPA 2PMHA 5LHHA 4GYGA 4WWCA 4I2OA 2J5OA 3LA2A 1G6NA 4RGXA 3E6BA 4NQWA 2MLGA 3RYPA 2EFPA 1B6AA 2VE8A 1R7JA 2P6TA 3JTGA 1GXPA 3HHGA 5JFRA 5ICEA 4BNCA 2EFWA 4A6DA 5H6RA 1S7OA 1XN7A 1TTYA 2FMYA 2FU4A 5L3EA 3S2WA 1FNNA 2CW0F 3H92A 1TW3A 1F5TA 5LGUA 1XD7A 3IKTA 3HHHA 2MA3A 2ACJA 5FGMA 3KE2A 3ABUA 3HRTA 1MD0A 3TDZC 2D1VA 1GHCA 3EDPA 2LKPA 3I59B 1T2KA 1E2XA 3HOSA 1BI2A 4ESJA 2D2WA 1YTYA 3TO7A 2VBWA 4UV8A 3LFKA 2XAFA 2GA1A 2IA2A 3MCZA 2UWMA 4I0BA 1IAWA 1ZRDA 1ZG5A 3I0TA 3B02A 5BPIA 2C6YA 2CG4A 4M71A 4KICA 2O8XA 2HDCA 1T38A 3RKWA 1FZPB 1WKMA 1O57A 4YG2F 3HRMA 1T0FA 1USTA 3FXRA 2E7WA 4IHSA 3RTRA 3I64A 4OIPF 2HYFA 2KIUA 2EWNA 2FNPA 3R0JA 3ZN0A 1ZRFA 3TGNA 2L4AA 3ZMUA 3L9FA 2CYYA 4HZFA 4OIRF 2XKPA 5CVIA 2PLYA 4PGGA 3E6MA 2FMLA 3GLXA 1KU9A 2PMUA 4DNCA 2XKOA 1YW8A 4E70A 3T5XA 2DTRA 2GQQA 2VC0A 3LAJA 3OV8A 3E5XA 1GVJA 4G7OF 3JTHA 1J59A 2TDXA 4YIFA 3W6KB 2VBZA 3C3WA 3R60A 2IRFG 4GGGA 2FQ3A 1IN4A 2AXLA 2XAJA 2RGVA 3ZMZA 2GAUA 2PJPA 4WXDA 2DQLA 3CTAA 1KQ9A 2V1UA 2EA2A 2CGPA 4KIBA 3QPHA 4WF2A 2IPQX 2W25A 1SD6A 1UHMA 3NRVA 2PBIA 4H0EA 3BZ6A 2PQ8A 1W5TA 3RDIA 2QVOA 1ULYA 4MTEA 3L7WA 1HSJA 3JW4A 3WU0A 1H0MA 3R61A 3T0YA 1RUOA 4R8HA 2WC2A 4AIJA 2HKOA 2BGCA 3G3ZA 1AWCA 2FEZA 4BXUA 2IJLA 2K4BA 2OD5A 3EYYA 4NB5A 2M30A 1I27A 4N9IA 3BPVA 3I5UA 5D5XB 3LA3A 2Q0OA 2H94A 1ZYRF 2BYVE 1QZYA 4HLXA 2X0LA 3R6SA 4I02A 3RPUA 2FXAA 5FO5A 3KLOA 5E1ZB 3HYIA 3F6VA 4KUMA 2LNBA 3F8BA 2HTJA 2VONA 4LLLA 2VT2A 4RGSA 2VOPA 2UZKA 4R79A 1I1SA 4D0PA 3ERED 2PN6A 3BP8A 3L00A 4GO1A 1R1TA 2M87A 4LFUA 1U5TC 2RV8A 3U1DA 2HYGD 4ZYGA 2P4WA 3F3XA 3VFZA 2WWYA 4AIKA 2QM3A 3BWGA 2D1HA 4ESBA 1SFEA 1IN8A 3R4KA 1TW2A 5DD4A 1FYLA 4JBAA 2ZXJA 2EA4A 2JSCA 4MEYF 4EGZA 4N9HA 1L3LA 4F7ZA 4MQVA 3DKWA 2ZFWA 3TOBA 4RGUA 3GX4X 3M8FA 5JHUA 1C0WA 2FBKA 3GZ5A 3BROA 1KYZA 1P6RA 3FXQA 4CDGA 5L3FA 1QQIA 3IL2A 1MJAA 3HSEA 2L3DA 4XSXF 3FWEA 2H6CA 2VT3A 2UXNA 3PFIA 1RUNA 3K1PA 1XGSA 3QRFF 3WGGA 5CYVA 3K1MA 3ISPA 3WTUC 3CO7C 3RKYA 4WX9A 2XASA 4EM2A 3WODF 4JK1X 3VEPA 4IRHA 1IN5A 4A0YA 2XVCA 2IP2A 1FYMA 1LDDA 1W7PD 1LDKB 2K02A 2MH2A 5IT3A 3TO9A 1R58A 3FMSA 3I71A 4YIIA 3KP6A 1QGPA 2Y48A 1ZAOA 2PEXA 4ZH4F 1YLFA 1EH8A 3ZMDA 3MZYA 1W5SA 1F4KA 5JR3A 1B9NA 1FT9A 4M73A 3K2ZA 1B4AA 3NEUA 3IRQA 4LB5A 2YX7A 1FSEA 2G9WA 2FSWA 2GA2A 5ICGA 1OYYA 2ZNZA 5LEJA 1XCVA 2W84A 4ENMA 4IJAA 2L54A 3JAMK 3F6OA 2E7XA 1BI3A 2Z99A 5EEGA 1B1BA 4LJZF 3I59A 3KP7A 2HGCA 2YPRA 5L3GA 3RPQA 4Y15A 1PP8F 1ZH5A 5DDGA 3SZPA 4KDPA 2O6GE 1W4MA 3GVAA 1G3YA 3K69A 4GYIA 4G6DA 2A69F 1LEAA 1R22A 2W24A 5KVRA 5FD6A 1WSUA 1XGNA 5EEHA 4G7ZF 2JPCA 1P2FA 4KYWA 4HDVA 3JSPA 5BOXA 5HDKA 4L9NA 3RI4A 2GIVA 1OYIA 4OIOF 3MQ0A 3FMQA 3IWZA 3TOAA 1S3JA 4M6XA 3QU6A 5HS9A 1P92A 1MDMB 3E6CC 1X3UA 2F5DA 2L02A 5F1RA 4WK8F 1ZG3A 2KJCA 3WGIA 3GWZA 5HVQC 2XHKA 3ULQB 1BC7C 2P6SA 2EJRA 1YQAA 3L2CA 2Q8KA 4XRFA 5A2QZ 2DK8A 5TJJA 3P9CA 1OYWA 3M7GA 1UCRA 3N4MA 2H27A 2F5FA 3O6BB 1TQPA 4MHGA 4O6JA 1W7PB 5L3CA 1FOKA 5CVRA 1D8KA 4U0YA 3BDDA 3GEZA 3N97A 3CLOA 1G3WA 1ZLJA 4XSZF 4OMYA 5CVJA 2HEOA 1LB2A 4ZZLA 5ILVA 2GWRA 3DXJF 1DP7P 3ZN1A 1WWXA 2EFOA 3F8NA 3KCCA 1S8NA 3ECHA 4KMFA 1U3EM 2WV0A 2ISZA 2E1NA 3E5QA 4R1HA 5KK1A 1EH7A 2KJBA 1K79A 2CWEA 1MKMA 5ICCA 1SD4A 2FBHA 2WTEA 4N0BA 3LQRA 2JRTA 4HF2A 3EETA 1O3TA 4IPAA 5DV5A 2V6CA 5D5UB 1SFUA 4EJVA 3LSTA 3TO6A 3V7RA 1IF1A 5IT9K 3KP3A 4HX8A 2OA4A 4G94A 4BQAA 1FP2A 3KP5A 4GCVA 1BIBA 3HRUA 4LGWA 4UVAA 4MQ9F 1YO5C 4M74A 4MGRA 1Y0UA 2YR2A 1MZBA 4K2EA 4HA8A 3V4GA 3AAFA 2BV6A 3KLNA 4P55A 4IXAA 5H20A 1FY7A 4WXCA 4EQQA 1IXSB 3BPXA 3W6JB 2JZYA 1CGPA 3GFLA 2ZMEB 3F23A 2F5EA 2A68F 2OBPA 5ILSA 1IXRC 4MTDA 4KIGA 3KZYA 4IHTA 1HW2A 3V8JA 5J6XA 1QZZA 3OOPA 1F1ZA 5E17F 2JPBA 2ZNYA 3KFWX 3ZMSA 2DLLA 1LJ9A 4JQFA 4RGRA 1KQ0A 2KRFA 3NQOA 2RVCA 2VODA 4KNYA 2BE5F 1V3FA 2NYXA 4FT8A 2ZCWA 2V79A 5K5QA 3WE2A 4PCQA 3MZHA 2GXGA 4UVCA 2DK5A 1U78A 2HOEA 3KEQA 3BJ6A 5FFZA 1ZRCA 3I53A 3WTWC 3QOPA 4LLGF 1XB4A 5LEKA 3K0LA 1O3SA 2AS5F 3GFMA 3DPTA 5E20A 3GW2A 1R5HA 3SQNA 4CXFA 3HOTA 2NS0A 2V1XA 3P9KA 1B59A 1HSTA 3GFJA 2MH9A 4ASNA 4FX0A 3Q5FA 2XGXA 5D8KB 3LQQA 3ML6A 4L0ZB 4CICA 2NNNA 1MJ9A 3K1NA 1EH6A 4KA4A 5DCMA 2R7DA 1OKRA 1BJAA 2ESHA 1PP7U 1J5YA 1S29A 1IRFA 2ZKZA 1IUYA 3CUOA 3VOEA 4L0YB 3SHFA 2M8EA 2ISYA 3BY6A 4Y13A 4HAMA 4G7HF 3TQNA 2ZO4A 4I0AA 2VBXA 2P7VB 3H3ZA 2ZJ2A 1XGOA 2YSRA 4OINF 4AD9A 2NNYA 1YS7A 5E1WA 4EM1A 3QAHA 5DUIA 5BQTA 1S6LA 2ZMEA 4Y17A 2DI3A 4WXHA 1QNTA 1YYVA 5K1YA 1T6SA 1IW7F 2Z33A 1SMTA 1R1VA 2QENA 2EFNA 2W85A 1V4RA 5D4SA 1ZN2A 1U5TB 1JXSA 4QLCU 1E17A 1TNSA 5J8FA 4CHUA 4EVIA 2RKHA 1OPCA 5J8CA 3P9IA 2VBYA 4U7BA 1RZ4A 5FFXA 4EMSA 1K6OA 1D3YA 1XDUA 3WTZA 5LGNA 1D5VA 1VTNC 2QQ9A 4O5VA 4AIHA 5HDNA 4IRGA 3RYRA 1DDNA 3WU1B 4HX4A 1XGMA 3WE3A 2PFBA 1LQ1A 3M1EA 4IVNA 2IA0A 4EM0B 4XBFA 4ENNA 1XMAA 2ADUA 5ICFA 5ED4A 5FLXK 1FBUA 2F5CA 2K86A 1R36A 4AWXB 2LF8A 2OZUA 1R23A 1TQMA 1LVAA 1QO0D 3KEOA 4LG0A 2EV0A 3CUQB 1ON2A 3U9GA 1TLHB 5IT9Z 1BOAA 4YFNF 4ENJA 5A2QK 4HF0A 3J81Z 2A3SA 2QQAA 5ERIA 5L3BA 1Z9CA 2KIMA 5K5RA 4B8XA 4P96A 2LSOA 5LLQA 5L3DA 5HLIA 3QP6A 1XMKA 3PQJA 3IRRA 4FX4A 4DQ2A 2RN7A 3P7NA 1HW5A 3WTYC 3H3UA 5D5WB 5DEQA 2XIGA 2F2EA 4I09A 5LBQA 3T1BA 5HS8A 3V8KA 4ZYDA 1YIOA 1G3TA 2KIFA 2DBBA 2A61A 3D0SA 1PDNC 4A12A 4LLNA 1KYWA 1FX7A 2E1CA 1GXQA 3J80Z 2DT5A 2A6HF 1P4XA 5BS6A 4G9YA 3FZVA 1EV7A 1KQ8A 4UNOA 2STTA 2W57A 3DQVC 3KETA 4U0VA 4WCGA 2XAQA 4RAYA 1A04A 2XROA 1BC8C 4KN4X 1Z1DA 1AOYA 1O7LA 4P9FA 1FC3A 2Z3YA 3C18A 3O2PE 4U0WA 3QU3A 4KIFA 3V7SA 4M9XA 1CF7B 4AVPA 4M9SA 5DUKA 4EGYA 4EJUA 5D6EA 2BBYA 3ELKA 4HV6A 2FNAA 2MBFA 2PI0A 4HQMA 1FLIA 2P5VA 3ZPLA 2UXXA 1HXDA 3KP2A 4OIQF 3DEUA 3WTTC 2IA1A 5DCFA 1HW1A 5AIPA 1ONVA 1SMYF 2HZTA 1Z7UA 4U7DA 2H09A 2PG4A 1ZARA 2OQRA 4ZZDA 1Z6TA 3B73A 3J7AO 1TQIA 1QPMA 4RB1A 4S04A 1U2WA 4M6YA 2ZBKA 2YU3A 2DQRA 2QBYA 4CO8A 4ON0A 4ENKA 4BHPA 2QLZA 2EFQA 3V7CA 1ZLKA 1XDSA 3U2RA 3GZ6A 3FMRA 3HUGA 3M9AA 3M8EA 1HKTA 1Z91A 4KMUX 3ROUA 2RNJA 1H9GA 3E5UA 1KU3A 6PAXA 1KGSA 4ZYEA 3LAPA 1P4WA 4BAYA 1J0RA 2EV6A 4L5IA 2FF4A 1ZHFA 1P4AA 5ILUA 3T8TA 5CJ9A 3O3KA 3FM5A 2JTVA 1RIOH 2QQBA 4L9VA 4LK0F 4I01A 1G4DA 2QZ8A 1TBXA 4P9UA 1F9NA 4HBLA 1U5TA 1T39A 5E18F 4LG0B 2H6BA 3L09A 3BOQA 2O0YA 1KU7A 1L0OC 5K5OA 1O3RA 1LEBA 5E1XA 1O7FA 4OMZA 4FHTA 1Z6RA 1LNWA 2NAZA 2FOKA 2G7HA 1G3SA 4YFKF 3CUQA 1FBSA 3E6DA 3ECOA 1RNLA 4CZZA 2NRAC 4MNUA 4EV0A 3MEXA 5LHIA 3PQKA 2IW5A 2K27A 1MDMA 4Q5SF 3MFKA 3T8RA 3CUQC 5HS7A 2Y75A 3REOA 3DF8A 2B0LA 2HWVA 2DFIA 4RAZA 3VB2A 3C7JA 3SXYA 1IN6A 1XSVA 4A5MA 4BHBA 1CF7A 2M1BA 3SZTA 1MJBA 3I4PA 4I7HA 1REPC 4BH9A 2A6EF 4HX7A 2RC4A 3GFIA 1JGSA 2BEOA 2JT1A 2KKOA 3J80K 4O3MA 4G6QA 3KZZA 2P8TA 3ZQ7A 2CSOA 1ZGJA 4Z2YA 1SD7A 3DP7A 3F72A 1NHAA 1K78A 1BIAA 4OOIA 3FHZA 4XLPF 4PDKA 3BJOA 4KT5C 1ZG1A 4PZJA 5DD8A 4LD5A 2VOOA 1BM9A 5TRDA 5D4RA 4RB0A 2GXBA 5FLXZ 2DAOA 1KA8A 2CQKA 2HFHA 1K7AA 1W7PA 4HOBA 4B09A 2G7UA 4MEXF 2L01A 3J81K 5CVUA 4RB2C 2MD5A 3E97A 2LDUA 1YG2A 3MAJA 2HQRA 1HQCA 4IRIA 2EK5A 2Y0MA 3F8CA 5HLHA 4CYDA 4GXOA 1STZA 3RIRA 5CLSA 4EJWA 4PGHA 5D8LB 4LMYA 2VN2A 1J7KA 2COMA 1USSA 4NHJA 3EUHA 2K4JA 1RI7A 5AONA 3HIFA 1YS6A 5E8IA 3GYHX 2FA5A 5H6QA 3WG9A 4UUVA 2M5WA 2VXZA 1DPUA 2Z9OA 2HKXA 2A5YB 2HTSA 2O03A 2V9VA 1QBJA 1FP1D 2OZ6A 2R7FA 5LRSA 3FXUA 4RB3C 2QBYB 3BJAA 1SFXA 4LB6B 1I5ZA 1JHHA 2DPUA 1R00A 1S7AA 3HTUA 3MWMA 1HKQA 5AIQA 5E8GA 2K7LA 4EJOA 5HOOA 3ABTA 1IN7A 2O61A 3WTVC 1UFMA 1DUXC 4L18B 4A0XA 5LGTA 2RQPA 4A6EA 1JHFA 4HF1A 3LA7A 3IHUA 3WGHA 4Q47A 4HDUA 3Q9VA 1T98A 3WTSC 1ODDA 3QP5A 3TKYA 4P5OA 5JI6A 3HRSA 3IWFA 2IT0A 3F8FA 5DCMB 2DPDA 4CGZA 5D5VB 1FSHA 4BYYA 2L4MA 3DFGA 4G8XA 3VODA 4A5NA 3F22A 1OMIA 1TNTA 2HS5A 2XUBA 1HBXG 3I54A 5LRRA 1FWZA 4A2UA 2ELHA 2HR3A 3LWFA 1J2XA 2VC1A 4A0ZA 2XRNA 2VE9A 4UHTA 4UV9A 2P7CB 1R5GA 1SD5A 3C1DA 2V1DA 4KN7X 2IVMA 3ZP5A 2CFXA 1XCBA 1YW9A 2FRHA 1YFHA 3HSRA 2DO7A 1IXCA 2STWA 2J5PA 3WTXC 2Q2EA 1SAXA 3FX3A 3CJNA 1ZREA 1WI9A 3JAMZ 1BI1A 3HTSB 2DW4A 2P5KA 1BI0A 4HLYA 1U6GA 5HDGA 3ZMVA 4IF4A 4TV7A 3JSOA 4EJTA 2MLKA 1B9MA 1JE8A 1WRJA 5JVTA 4HV5A 3KP4A 3ZMTA 4QWQA 3SFZA 1FBQA 1U8RA 2D45A 2P5LC 5DYMA 2XV4S 1ZGAA 4Q48A 2OAZA 2O3FA 2OU2A 3V8LA 2XAHA 1FYKA 1PUEE 2FBIA 2YX4A 1YW7A 1DPRA 3GO5A 4Q4ZF 1BN5A 2XAGA 2QYOA 5CVVA 5F64A 1BBYA 3HSFA 1XSDA 1IRGA 5D6FA 1FPQA 3F21A 3QPTA 3G73A 1XSXA 4BHCA 4UVBA 3GF2A 1O3QA 3E3VA 4OU0A 4U88A 4XLNF 4HQEA 3IKVA 5FB2A 3GUDA 5BMZA 2ESNA 5FD5A 4RS8A 2ETHA 2HQNA 3FF5A 2QWWA 1D8JA 3EQLF 2EV5A 1OR7A 1MGTA 4L5JA 3K9TA 3GXOA 3D5LA 2QUFA 2CO5A 1HKSA 4LK1F 3Q9SA 3F8MA 3DV8A 1UHWA 3DPLC 1ON1A 1R1UA 5F6FA 1LDJA 1I1GA 4YFXF 4ETSA 2R3SA 1H9TA
chains in the Genus database with same CATH superfamily
4XLHA 4UXNA 2JWTA 3BZCA 1SFOJ 2NS7A 4UB8C 4XR6A 3Q3SA 1O4XA 1J75A 1Z21A 1QHHD 2GZWA 4I98B 4BJ5C 3I58A 5F0HA 2LH9A 2A07F 2OQGA 1MW7A 1N75A 1LUJB 4HW0A 2M8GX 4ANJA 3HOYJ 4F92B 1Z05A 2X4HA 1VQKI 5LHGA 3IC7A 3FM3A 3M8JA 3HOWJ 4A3IJ 4KFCA 1ZKGA 3R0AA 3CO6C 4HPQA 2LRDA 3ZCOA 1IJWC 1YI2I 4HYEA 1WQ2A 2M7AA 3IH4A 1KU2A 1TWGJ 3ABKH 4ESFA 3PIPF 3CMYA 3COAC 2DU9A 1VQOI 4GDFA 4IKFA 2MC3A 1OQYA 2V9PA 4M9ZA 1K78B 4S05A 3H1CA 3ZQIA 2AQEA 3RJPA 2M45A 1UB9A 1J9IA 2RREA 1Q1HA 1I6XA 1E3OC 3TDUC 3W6VA 4M72A 5BPDA 1ETVA 3G2BA 5HLGA 4YELA 3RKXA 1IZ1A 2EQRA 2LD5A 2CV2A 2WAQN 2OCEA 2RAEA 1JKQC 1FOYA 2LF7A 2KL4A 2PMZN 1WFXA 4L9TA 2EB7A 2FE3A 2Z5UA 4L9JA 3VYUB 2R0QC 1T95A 3CDHA 3EYIA 4NUBA 4ZYHA 2RDPA 2IS1A 1BR4A 2PMHA 5LHHA 1S72I 4GYGA 4WWCA 4I2OA 3E0JB 4CCLA 2IGOA 2J5OA 2WB1A 3LA2A 3VPRA 1G6NA 4QSHA 4RGXA 3GZNB 3E6BA 2A6TA 4NQWA 2MLGA 3RYPA 2EFPA 4XRSA 1B6AA 1VQNI 4KISA 1MBKA 2VE8A 4RAFA 1R7JA 2P6TA 1X4OA 2P81A 3JTGA 1GXPA 1FOWA 2E2JJ 3HHGA 3AL0C 5JFRA 5ICEA 3H5NA 3QYFA 4BNCA 2EFWA 4A6DA 4RM2A 5H6RA 4BJ6C 1S7OA 3HOZJ 1XN7A 1TTYA 2FMYA 2LTPA 1SC7A 2FU4A 3ZQQA 5L3EA 2VKVA 4IHWA 3S2WA 2M4KA 1FNNA 2CW0F 2AQFA 3H92A 1TW3A 3JRFA 1F5TA 4XLFA 5LGUA 4PJMA 4IQJA 1DU6A 1XD7A 3IKTA 3HHHA 2R7TA 2MA3A 2ACJA 5FGMA 3KZIC 3KE2A 2IBDA 3ABUA 4KITB 3HRTA 1MD0A 2LOOA 1LPQA 3TDZC 2ZXIA 3DU6A 5EZHA 1TWAJ 1SVOA 3SFIA 4CH7A 4XRMA 2OC6A 2D1VA 1GHCA 4BUPA 1UELB 3EDPA 2LKPA 3I59B 1J09A 1S7EA 1T2KA 3L2RA 1ITYA 1E2XA 2CW8A 3HOSA 1BI2A 2OTJI 3ZQHA 4ESJA 2D2WA 3FDYA 2VKDA 1YTYA 1LE8A 1V5EA 2IGKA 3TO7A 2VBWA 4UV8A 5FKMA 2QF7A 4RM3A 1FMVA 3LFKA 4CA0A 2XAFA 1MH3A 2GA1A 2IA2A 3MCZA 2E1OA 2UWMA 4I0BA 3JCUC 1IAWA 1ZRDA 4C3HJ 1ZG5A 3GTOJ 3I0TA 3G4SI 3BTJA 1SEUA 2MD0A 3B02A 5BPIA 3BQZA 2CG4A 2C6YA 2DMPA 4M71A 3FXOA 4KICA 3OYAA 2O8XA 4BACA 5C4JJ 2HDCA 3GLLA 5FJ8J 1T38A 3RKWA 1IUFA 1FZPB 4XLAA 1WKMA 1O57A 4YG2F 2K5CA 3VYTB 3W3CA 5E3OA 3HRMA 1T0FA 2QSFX 3ASNH 1USTA 3FXRA 3H5AA 3JRBA 1DU0A 5JLWA 2E7WA 2OUMA 4IHSA 3RTRA 1U0JA 3I64A 1W0UA 4OIPF 2HYFA 2KIUA 1MMDA 2EWNA 1GV2A 3N05A 2FNPA 1YIJI 3R0JA 5GP9A 3HEFA 3ZN0A 1ZRFA 3TGNA 2L4AA 3BR0A 3L9FA 2M3AA 3ZMUA 2LC2A 2CYYA 3IH2A 1DP3A 2BHZA 3I4MJ 4HZFA 4OIRF 2JRMA 5B5EC 2XKPA 1N77A 3LSHA 4HSTA 4CCJA 5CVIA 2PLYA 1R4NB 2XB5A 3KX2A 4PGGA 5FLMJ 3E6MA 2FMLA 3GLXA 1KU9A 2PMUA 1A6IA 3LMMA 4DNCA 3A01B 1YRNB 2XKOA 1MBFA 1YW8A 1RC9A 4E70A 3NAUA 3T5XA 2DTRA 2GQQA 2VC0A 4B48A 3LAJA 3OV8A 3ZQCA 3M4OJ 3E7LA 3GTGJ 3E5XA 1GVJA 4PJJA 4G7OF 5F0CA 1GUUA 4N4NB 1I3AA 1UG0A 3LSKA 1WH7A 5IP9J 2XAUA 3JTHA 3LSPA 1J59A 2TDXA 4YIFA 3W6KB 2VBZA 3C3WA 3R60A 2W48A 2IRFG 2CQNA 3SDBA 1YJNI 3K4CA 2CV1A 4GGGA 2M34A 4IL6C 2FQ3A 4EATA 1IN4A 2AXLA 3CMEI 2XAJA 2RGVA 2B9SA 2JQ7A 3ZMZA 2GAUA 2PJPA 2MYSA 2QGUA 5HNFA 3OS1A 2HXOA 4WXDA 2DQLA 3CTAA 5C4XJ 1KQ9A 2WB1N 3OSFA 3BG7A 2V1UA 2EA2A 2CGPA 4KIBA 5J1UA 3QPHA 4WF2A 3SEQA 2IPQX 4BDZA 2W25A 4JP0A 1ZR2A 4GRIA 1SD6A 1UHMA 3NRVA 2PBIA 3H35A 3OYHA 2Q2EB 3A02A 4H0EA 3BZ6A 5LD2C 2PQ8A 2HDDA 2L7KA 4BQOA 2EIJH 1FMWA 1W5TA 3RDIA 2QVOA 1ULYA 3K70D 4MTEA 3LSIA 3L7WA 1HSJA 3JW4A 2DYRH 3WU0A 1H0MA 2X1EA 1V5FA 1UZCA 4RLFA 4IZZA 2CV0A 4JX5A 3R61A 3T0YA 1RUOA 4R8HA 3AG1H 2WC2A 3CP8A 3U21A 2Z16A 4AIJA 1LE8B 2HKOA 2BGCA 3G3ZA 3TP0A 3S2DJ 1AWCA 3C2BA 2FEZA 3CZ6A 2DTZA 1WI3A 4BXUA 3S3NA 2IJLA 2V6EA 2LR8A 4G12A 2K4BA 2LBFA 2OD5A 3EYYA 4HG2A 2R7QA 2M0MA 4ZYAA 4NB5A 4D5CA 1V5GA 2M30A 1I27A 1YITI 4N9IA 3BPVA 3I5UA 2K9QA 5D5XB 3LA3A 3JREA 3ZQLA 1SVMA 2Q0OA 2H94A 1ZYRF 1JKOC 2BYVE 3Q0WA 1QZYA 4HLXA 4V2GA 2DXIA 2ELKA 2X0LA 5FROA 4F52A 3A0BC 4I02A 3R6SA 3RPUA 2FXAA 5JHFA 5FO5A 2ME0A 3KLOA 5E1ZB 4W97A 1XC5A 3HYIA 3F6VA 4KUMA 2LNBA 3F8BA 2HTJA 2VONA 4Y4RA 4LLLA 2VT2A 4RGSA 3L2UA 5DS9A 1YX5A 2DFFA 4XLCA 2R92J 2VOPA 2V9KA 3G71I 2UZKA 2BY3A 2N8GA 2VQGA 4R79A 2E5NA 4D0PA 1I1SA 3ERED 3K4JA 2PN6A 3BP8A 3L00A 4GO1A 2DT6A 3E1SA 1R1TA 2M87A 3C2GA 4A3JJ 4LFUA 1U5TC 3FXMA 1VFCA 2HVRA 2RV8A 4BEHB 3U1DA 3TW6A 2HYGD 4ZYGA 2P4WA 5C44J 2LKXA 3ZRGA 3F3XA 3VFZA 1H89C 2WWYA 1JKPC 4AIKA 2QM3A 2DFHA 3O8HA 4DYQA 3OS2A 1A5JA 1F36A 3BWGA 1X58A 2D1HA 2H1LA 3CQZJ 4ESBA 1SFEA 1IN8A 3R4KA 4LOCA 1TW2A 5DD4A 1FYLA 4JBAA 2HNHA 5K7HA 4CYCA 2ZXJA 2EA4A 2V7FA 2JSCA 1ZK8A 4MEYF 4EGZA 3DTKA 4N9HA 1L3LA 2BXYA 2R5ZB 2BW3A 2Z1DA 4MQVA 4F7ZA 3DPUA 2QCOA 4AVZA 2X51A 3DKWA 2ZFWA 3JR9A 5B3SH 4XOTA 3TOBA 1W36C 3S32A 4RGUA 3GX4X 3M8FA 5JHUA 1C0WA 3A4CA 3PUBA 1Z0XA 4JOMA 2FBKA 2VQLA 2E2HJ 3GZ5A 3BROA 1T08B 3A2KA 1I6HJ 1VQ8I 3AFHA 3QYEA 1KYZA 3K4LA 1P6RA 3FXQA 4CDGA 2W4SA 4PSXA 5FKKA 1ETKA 4XORA 5L3FA 1QQIA 3IL2A 1QVUA 2VQHA 4ZC3A 1MJAA 2CU7A 3HSEA 2L3DA 4HSRA 4UY8I 4B43A 4XSXF 3FWEA 4M3BA 3I55I 2H6CA 1ZTRA 2ID6A 2UXNA 2VT3A 2XPVA 3CCQI 3PFIA 5B66C 1TL8A 5EEAA 1RUNA 1Y1VJ 2IS2A 3K1PA 2CRGA 5H2FC 1XGSA 3QRFF 3IUOA 1OLTA 3WGGA 4F55A 5CYVA 3PL8A 3K1MA 2L5QA 3ISPA 2HOTA 1X4PA 2NVUB 1OFCX 2E19A 3WTUC 3CO7C 4A3BJ 1TZLA 1QPIA 3RKYA 4WX9A 2XASA 2PX9A 1YHQI 2QQ8A 4EM2A 1FTZA 2FX0A 4UUTA 2HXIA 3PNYA 3WODF 4JK1X 4XNFA 3D5SC 2QSGX 4UUSA 3OYNA 4BE1A 3OWTA 3VEPA 1WZ2A 1OR7C 1F43A 4IRHA 1IN5A 1G8XA 4A0YA 4QIWN 4BY1J 4X6AJ 2XVCA 2IP2A 1FYMA 1LDDA 3J7ZI 1W7PD 4IEJA 1LDKB 2XRLA 2K02A 2MH2A 5IT3A 3WG7H 3KYLA 3TO9A 5K7ZA 1R58A 3DTEA 3HBLA 1Y1WJ 3HUGB 3S1NJ 2DA6A 5FRNA 3FMSA 4BXXJ 3I71A 2EIMH 3G6EI 1R49A 4FQGA 4M6VA 3HXLA 3L2WA 3FISA 2IS4A 2CQQA 4YIIA 2BVMA 1HCRA 1X3WB 2IGMA 3KP6A 3CCJI 4DBRA 3FXKA 4BGDA 1RRJA 1QGPA 2Y48A 4NQWB 1ZAOA 3DU5A 1VQLI 2PEXA 4ZH4F 1YLFA 1EH8A 3BR5A 3ZMDA 2V1NA 1GDTA 1Z7LA 2KIQA 3IH3A 2O8KA 2V4JC 3MZYA 2M9HA 1W5SA 1F4KA 1RKWA 5JR3A 1B9NA 1FT9A 4M73A 4Y7NJ 3K2ZA 1PUFA 1B4AA 3NEUA 3IRQA 4LB5A 2K9SA 2YX7A 2GXAA 1TWFJ 2BVLA 4HNVA 3BR3A 2KRCA 1BW5A 1FSEA 2G9WA 4YEJA 4ZTJA 2FSWA 1NH3A 2GA2A 5F04A 2EZKA 5ICGA 4C3IJ 4A3GJ 3OOUA 1OYYA 3UNGC 2ZNZA 3OL3A 1MMSA 3ESWB 5FKOA 5LEJA 3TL4X 5FLVA 2MC4A 4N4OB 3K7AJ 1VQ9I 1XCVA 2W84A 4ENMA 4IJAA 2L54A 2KDOA 3AG3H 3J7YJ 3JAMK 2FJ1A 3F6OA 2E7XA 4DOZA 1BI3A 2X9DA 4DJAA 2Z99A 5EEGA 1B1BA 4M3FA 4LJZF 4A69C 3I59A 2LYCA 3A0HC 1X2MA 2WBMA 3KP7A 3OYDA 1IRXA 2HGCA 2YPRA 5L3GA 3RPQA 4BE2A 4Y15A 1PP8F 2FD5A 1ZH5A 5DDGA 3SZPA 4KDPA 1IDZA 2ZJQF 2O6GE 1W4MA 3GVAA 1G3YA 5FKLA 3OR2C 3K69A 2E71A 4GYIA 4G6DA 2A69F 2ID3A 1AHDP 1TT0A 1LEAA 1R22A 1UMQA 2W24A 5KVRA 5FD6A 1WSUA 4D9JA 2L0KA 1AU7A 1XGNA 5EEHA 2K9MA 3MKLA 4G7ZF 1HA8A 1SVLA 2JPCA 1P2FA 4KYWA 4HDVA 3JSPA 5BOXA 4II2A 5HDKA 2OJED 2M0CA 4L9NA 2GIVA 3RI4A 4RDUA 1OYIA 4OIOF 1V54H 3LSRA 4L5EA 2DMTA 3MQ0A 3FMQA 1YRNA 1Z3YA 4XN3A 3DEEA 4BJTA 3ZXSA 3IWZA 3TOAA 2JMWA 1S3JA 4M6XA 3QU6A 5HS9A 3KEYA 2R5YB 1P92A 2LLKA 3SDGA 1MDMB 3E6CC 1Z77A 1X3UA 2F5DA 2JA8J 2L02A 5F1RA 4WK8F 3TW7A 3DCFA 1X19A 1ZG3A 2JJ7A 3IAS2 2KJCA 4CUGA 3WGIA 1R5ID 2O7OA 1OCRH 3GWZA 5HVQC 3NWTA 2XHKA 2JSPA 1MBGA 2L2OA 3EPZA 3EUAA 3ULQB 2WY7Q 1BC7C 1QRYA 2P6SA 3GTLJ 2Y9ZA 2EJRA 2OTLI 4LITA 1YQAA 3LSMA 3L2CA 2Q8KA 4XRFA 1FJLA 2WAFA 3OYGA 4B4CA 1B8IB 5A2QZ 2DK8A 5TJJA 2WV1A 3P9CA 2E2IJ 2BOLA 1OYWA 2L7ZA 3M7GA 2VKEA 1UCRA 3N4MA 2H27A 2F5FA 3O6BB 4E7ZA 1TQPA 4MHGA 4O6JA 3BG6A 1W7PB 3QPSA 5EJCA 5L3CA 1FOKA 5CVRA 1RR8C 3AG2H 3H9JA 3OS0A 1D8KA 4U0YA 4S0HB 1MSEC 3CC4I 3BDDA 2W00A 4YRVA 3GEZA 3N97A 5IOZA 3CLOA 3A01A 2WADA 1G3WA 2VKHA 1ZLJA 3PUFA 1OJLA 4Y52J 1YX3A 3PFYA 4XSZF 4Y33A 4XONA 3QODA 3JRCA 4D5FA 2CJJA 4OMYA 1X2NA 3BC8A 5CVJA 2XB0X 1Y39A 2MABA 2HEOA 1LB2A 4XLEA 4ZZLA 3QWLA 5ILVA 2GWRA 3DXJF 2X1CA 4P1WA 5TISC 3G1LA 1DP7P 3ZN1A 1WWXA 3PNVA 4BEHA 1K83J 1TWCJ 2EFOA 1X1DA 3F8NA 2ECBA 3KCCA 1XX5A 1S8NA 5HLTA 4A3MJ 3ECHA 4IHYA 4KMFA 5M3MJ 1SANA 4I99C 1U3EM 4D1QA 2JN6A 3CDLA 2ICWG 2WV0A 2MGQA 2X6WA 2ISZA 2IS6A 2E1NA 3LSJA 4DZJA 2XPWA 3E5QA 2R7ZJ 2KPMA 2Y69H 4R1HA 2CUZA 5KK1A 1EH7A 3S15J 2KJBA 3FK7A 4KJZA 2ME6A 1K79A 2CWEA 2QEXI 1MKMA 3BG3A 5ICCA 3MKZA 3RZOJ 1SD4A 2FBHA 1P9QC 2P0WA 2WTEA 4N0BA 3LQRA 2ZSIB 2JRTA 4HF2A 3EETA 1O3TA 1U9OA 3RQ4A 4IPAA 5DV5A 2V6CA 3CP2A 5D5UB 4Y3OA 4EJVA 3LSTA 3MVPA 3TO6A 3V7RA 2KLOA 2XSDC 1IF1A 5IT9K 2DA3A 3KP3A 5EDNA 2R7SA 1OCPA 1K4SA 4HX8A 2OA4A 2HU9A 4G94A 4BQAA 5E3LA 2R7XA 1XMXA 2KQRA 1XG1A 3BTLA 1FP2A 4PK4A 3CJRB 2K3FA 2VJ5A 3KP5A 4GCVA 1BIBA 3HRUA 4LGWA 4UVAA 3GTKJ 1LFUP 3KPHA 3MN2A 4MQ9F 5DM7F 2GLOA 1YO5C 2JA7J 3DBLB 2VL8A 3WU2C 1FTTA 2HPMA 4E7LA 4M74A 2YUSA 3NWSA 2LKSA 4MGRA 3AL0B 1Y0UA 2YR2A 1MBJA 1BL0A 1MZBA 4K2EA 4HA8A 3V4GA 3AAFA 4XM3A 2ZXWH 2BV6A 3KLNA 4P55A 4IXAA 5H20A 1FY7A 4WXCA 4EQQA 2NS8A 4A93J 1IXSB 3BPXA 3MKWB 2I10A 3W6JB 5FKNA 2JZYA 3VYSB 4XICA 1CGPA 3GFLA 4UB6C 5FRMA 2KP6A 2W1OA 5CPRB 5EZGA 4A3DJ 4XIDA 2W7NA 2ZMEB 3BG9A 5EGOB 3F23A 2F5EA 2A68F 2OBPA 5ILSA 1IXRC 4MTDA 4KIGA 5EGOA 3KZYA 2HDWA 3FXLA 4IHTA 1HW2A 3V8JA 5J6XA 5EF6A 4FTHA 3HDDA 2A05A 5IOYA 1KONA 1N25A 1QZZA 2Y31A 3OOPA 1F1ZA 5E17F 4BS9A 3EUKL 1U9NA 2JPBA 4W1UA 1BJZA 2ZNYA 3KFWX 2CQXA 1S9HA 3ZMSA 3OYMA 2DLLA 1LJ9A 4JQFA 4RGRA 3OIPA 1KQ0A 2KRFA 3NQOA 2RVCA 2VODA 2VPLA 4RA2A 4KNYA 3CJTB 2BE5F 1V3FA 2NYXA 4FT8A 1HDPA 2ZCWA 4IX7A 5E3MA 3RSNA 1ETXA 2V79A 5K5QA 4D7NA 3WE2A 1FIPA 1MMGA 4PCQA 4ZTFA 2VUMJ 3MZHA 2GXGA 1R71A 4UVCA 2DK5A 2Y30A 1U78A 2HOEA 3KEQA 3BJ6A 5FFZA 2BY2A 4BQQA 2L7MP 3I53A 4BXFA 1ZRCA 2VPRA 3WTWC 3ZGKA 3OYFA 3QOPA 1T33A 2VASA 4LLGF 1XB4A 2Q1ZB 5LEKA 3K0LA 3CF5F 1O3SA 3M3YJ 2E5ZA 2AS5F 4AU7A 3GFMA 3DPTA 4LIUA 2IGNA 4AYBA 2Y0SA 5E20A 1VQ6I 3ABMH 3GW2A 2EINH 5KAIC 1R5HA 3VWBA 5E79C 3SQNA 3K4BA 3NARA 4CXFA 5F08A 3EUHC 3HOTA 2NS0A 2NOJB 2V1XA 3P9KA 1ORKA 3DBHB 1B59A 1HSTA 3B6AA 3GFJA 1N78A 2MH9A 2YS9A 4FX0A 4ASNA 3Q5FA 3BR1A 4BL0B 2XGXA 5D8KB 3LQQA 3ML6A 2W82A 3K2AA 4XKVA 4L0ZB 1PYVA 1QVTA 5KHDA 2NNNA 4CICA 1YJWI 1MJ9A 3K1NA 1EH6A 4KA4A 5DCMA 2R7DA 4XKCA 3RZDJ 1OKRA 2EZLA 5DTDA 1BJAA 1R6RA 3SZGA 2ESHA 4QPOA 1PP7U 2BHYA 1MSFC 1J5YA 2M2EA 1YJ9I 1S29A 4V2FA 1ZQ3P 1IRFA 2ZKZA 1IUYA 3CUOA 3VOEA 4L0YB 3SHFA 2M8EA 1IGNA 2K9NA 2ZB9A 2ISYA 2MFZA 3BY6A 4XKWA 4Y13A 4HAMA 4G7HF 3ZQFA 3BQYA 3J7AY 3TQNA 2ZO4A 4F93B 4I0AA 4C30A 2PMZA 2VBXA 4FE4A 3ONQA 2P7VB 3H3ZA 5EG0A 3FBIB 2L9VA 2M4GA 4ZDLA 2ZJ2A 1XGOA 3LSGA 1YE9A 4CCOA 2YSRA 4OINF 5BNGA 2EPFA 4AD9A 2NNYA 1YS7A 1QU3A 3CCVI 5E1WA 4EM1A 1OCCH 3QAHA 2BY0A 3H9QA 2X85A 4RMNA 1ETYA 1G59A 3CLQA 5DUIA 1RESA 2DA2A 1UJ8A 5BQTA 5J40A 1YOVB 1H88C 1S6LA 1JUPA 2ZMEA 4Y17A 1Z3XA 2DI3A 4WXHA 1QNTA 1YYVA 3PSFA 5K1YA 1T6SA 1IW7F 2Z33A 1SMTA 1R1VA 2QENA 2EFNA 2W85A 3VDXA 1AKHA 1V4RA 5D4SA 3HL2A 1QZEA 2OV7A 1ZN2A 1U5TB 4OAYA 3U1KA 4QLCU 1JXSA 1E17A 3K6GA 5HODA 1TNSA 3KIOA 5J8FA 9ANTA 4CHUA 3CC7I 4EVIA 2E34A 4XN0A 2RKHA 1OPCA 3DKYA 5J8CA 4MLOA 3P9IA 3BR6A 2BY1A 2VBYA 4U7BA 3V42A 1RZ4A 1M1EB 2IXSA 5FFXA 4EMSA 1K6OA 1ENHA 1D3YA 3BTCA 3S1QJ 4E6KG 1KZHA 1XDUA 3WTZA 5LGNA 4QPQA 3LNQA 1D5VA 1VTNC 1GV5A 2QQ9A 4O5VA 3FKJA 4AIHA 4AIDA 5HDNA 1WJAA 4IRGA 2GIZA 2HQ5A 3RYRA 3CCSI 1DDNA 2DDBA 3WU1B 4HX4A 3FK6A 2BXZA 5JVGF 3HKZN 1XGMA 3WE3A 2PFBA 1AKHB 1LQ1A 1JT0A 3M1EA 2HVSA 1WPKA 2JA5J 3Q0UA 4IVNA 3H3VK 2IA0A 4EM0B 4IQ4A 4XBFA 4ENNA 3HC7A 4XMYA 2OPTA 3CC2I 1XMAA 2ADUA 5ICFA 2VXDA 3GMEA 5ED4A 5FLXK 1FBUA 2F5CA 2K86A 4HNUA 1R36A 4AWXB 2JUGA 1GT0C 2VJJA 2I8DA 2LF8A 2KMUA 2V26A 3DLAA 1FIAA 2OZUA 4E7JA 1R23A 1TQMA 1VQ7I 1LVAA 1QO0D 3RPUD 3KEOA 3H9GA 2R7RA 3HOVJ 4LG0A 2XF7A 2EV0A 3CUQB 3BG5A 3HPGA 4QTRA 5M5XJ 3BLYA 2COBA 4EEFG 1ON2A 3U9GA 4G6TB 1TLHB 5IT9Z 1X1BA 3A03A 4M3EA 1JT6A 3IAM2 4B47A 2JUCA 1P7IA 1BOAA 4PFPA 4YFNF 5A2QK 4ENJA 4HRIA 4HF0A 3BZKA 3J81Z 2ELJA 3BTIA 2A3SA 2L9NA 2H8WA 2QQAA 1I3QJ 1ZELA 5ERIA 2NOGA 4PJLA 5L3BA 1Z9CA 2KIMA 5K5RA 3CJQB 4B8XA 1IRZA 4P96A 2LSOA 5LLQA 5L3DA 5HLIA 3QP6A 1XMKA 2F5VA 3PQJA 4BQNA 1WJDA 3OIOA 3IRRA 4FX4A 4DQ2A 2RN7A 3P7NA 1HW5A 1ETQA 5D5WB 3H3UA 1MMNA 3WTYC 4NBQA 2DFEA 5DEQA 4BBRJ 2XIGA 2F2EA 4I09A 2D5VA 5LBQA 1RKTA 3T1BA 5HS8A 4MIMA 1MBHA 3ASOH 3V8KA 3K70C 4A3CJ 4ZYDA 1YIOA 1G3TA 2KIFA 1WJFA 2DBBA 2A61A 3CMAI 1X3ZB 3FIWA 1B8IA 3D0SA 1PDNC 3JRGA 2O9LA 2HVQA 4A12A 3ZQGA 4LLNA 1KYWA 1FX7A 3SYTA 1JTYA 2E1CA 5GPCA 3CCEI 3S3MA 4PUSA 2X6YA 1WCMJ 4B44A 1GXQA 3J80Z 2DT5A 3M07A 3MKYB 2XGCA 4BU2A 2A6HF 1P4XA 3BT9A 5BS6A 1APLC 1Y8QB 3OYLA 1MNDA 4C2UA 2VQCA 4G9YA 3FZVA 2ZC2A 1BR2A 1EV7A 1KQ8A 4UNOA 4XKBA 2STTA 1TP4A 1JGGA 2JK3A 2W57A 3DQVC 3RQIA 1JUSA 4AM3A 2LY1A 3KETA 5J47A 2HZDA 4BE0A 2IAIA 4U0VA 4WCGA 5F0FA 1E3HA 3HGGA 2XAQA 4RAYA 1XS9A 1A04A 4DIQA 5JLXA 2XROA 1BC8C 2F4MB 2LY2A 4KN4X 4HNTA 1Z1DA 1AOYA 1O7LA 3CESA 4P9FA 2K3PA 1Y8RB 1FC3A 2Z3YA 3C18A 3O2PE 3JRDA 4U0WA 3QU3A 4KIFA 3V7SA 3FXJA 2PJRA 4M9XA 1FEXA 1CF7B 4AVPA 2B63J 1WJCA 4M9SA 1WJEA 5J4VA 3LOCA 3GTJJ 1IG7A 3UKGA 5DUKA 2GOMA 4EGYA 3CD6I 1PVEA 4EJUA 5D6EA 2BBYA 3ELKA 2Y9YA 1P7JA 1W36D 3PM1A 1H8AC 4HV6A 5IYCJ 2FNAA 2DODA 4B3AA 1MH4A 1OCOH 2MBFA 2PI0A 4HQMA 1BOBA 5M5YJ 1B72A 3BCAA 1FLIA 2DMNA 2P5VA 4XL9A 3ZPLA 2GBYA 3FBNB 3OIQA 2UXXA 4B1RA 3S14J 1HXDA 2QKLB 2Z2SB 4D7MA 3GTMJ 3FKIJ 5KCMA 3FHNA 3KP2A 1NK3P 4AYBN 4OIQF 4FASD 3DEUA 3WTTC 3OSGA 2IA1A 5DCFA 1HW1A 5AIPA 3CCMI 2KRHA 1ONVA 1SMYF 2HZTA 5KNLA 1Z7UA 4U7DA 2H09A 2PG4A 2QKMB 3I3LA 3KYDB 3P5JA 5EYRA 1ZARA 1EJ9A 2OQRA 4ZZDA 2LP0A 1T8IA 1Z6TA 3B73A 3J7AO 1TQIA 2LG4A 1QPMA 4RB1A 3HOXJ 4S04A 4XQFA 3CF2A 1ETOA 4CCMA 5M5WJ 2R7UA 1U2WA 4M6YA 1NG6A 2ZBKA 2KHMA 3QPLA 3OYEA 2MG4A 2YU3A 1IV8A 2DQRA 3F9KA 1SAUA 2R4GA 2QBYA 2DYSH 4CO8A 3DEWA 4ON0A 3K4MA 4BHPA 4ENKA 2QLZA 3HG9A 2EFQA 3V7CA 1ZLKA 1XDSA 2NVXJ 2X48A 3U2RA 2L9SA 3GZ6A 3M1CA 4JX6A 3FMRA 3HUGA 2CFOA 3M9AA 3M8EA 1HKTA 1Z91A 4ABZA 1HDDC 1LFPA 1Y6IA 2VI6A 3HKZA 4IOCF 2KZVA 4E7KA 4KMUX 3ROUA 4IHXA 2RNJA 2GOXB 2R7OA 4IO9F 1H9GA 3E5UA 1KU3A 6PAXA 4KT6A 4J01A 1KGSA 4ZYEA 3LAPA 5GAEJ 1P4WA 4BAYA 1D0XA 1J0RA 2EBIA 2CW7A 5B1BH 5IY5H 3CCUI 2EV6A 4L5IA 2FF4A 1POGA 2E35A 1ZHFA 4RBOA 1P4AA 5ILUA 2DJNA 3T8TA 3F0CA 1W0TA 2GM4A 5CJ9A 2OF7A 4DW6A 3O3KA 3FM5A 3CCYA 2JTVA 1ZGWA 2G0EA 4A3KJ 4FISA 1RIOH 2QQBA 4L9VA 1NTCA 4LK0F 1K61A 2F4OB 3IP4B 1I50J 4FE7A 4I01A 4E7SA 1G4DA 2DOFA 2QZ8A 4RAGA 1TBXA 4P9UA 5IP6A 1TC3C 1Y0NA 1F9NA 2RNGA 2LFBA 4HBLA 1U5TA 2NXNB 2R5YA 1T39A 2UV1A 5E18F 3HM5A 5GAGJ 4LG0B 3CCLI 2ECCA 2DMQA 2DOAA 2L9RA 2H6BA 3L09A 3BOQA 2O0YA 1IV6A 1KU7A 1L0OC 5K5OA 3IV5A 1O3RA 3S17J 1LEBA 3WHCA 5E1XA 1O7FA 3OYBA 4OMZA 4II3A 5J4YA 2XC7A 4MO7A 4FHTA 1I39A 1Z6RA 4NNJA 1DGWY 3SEZA 1LNWA 1EF4A 5KAFC 1UHSA 1U8BA 4ZDPA 2NAZA 2FOKA 1A35A 2G7HA 1G3SA 4YFKF 3PSIA 3CUQA 1BW6A 1FBSA 3HPHA 1ETWA 2CH0A 3E6DA 3ECOA 3JRAA 1R9TJ 1JJ8C 3PIOF 1XPXA 1RNLA 4CZZA 2NRAC 2IEKA 2RQQA 4MNUA 4EV0A 2HPIA 3CDIA 2FUG2 3MEXA 5LHIA 3PQKA 2IW5A 2K27A 1MDMA 1QHGA 4Q5SF 3MFKA 3T8RA 3CUQC 5EG0B 2UUZA 3CMMA 3DKXA 2AHQA 4DBQA 2B7EA 2MW8A 5HS7A 2Y75A 4LG3A 3REOA 3OYKA 1A31A 3DF8A 3MD2A 2B0LA 1WHUA 2HWVA 2DA1A 2DFIA 3A1YA 4RAZA 4A3EJ 3VB2A 2TCTA 3C7JA 3SXYA 3OYJA 1IN6A 1XSVA 4A5MA 4BHBA 1CF7A 2K85A 3I4NJ 5LFAA 2R93J 3H0GJ 2HI3A 2M1BA 3SZTA 1MJBA 2KT0A 3I4PA 3S8PA 1VI0A 4I7HA 1REPC 4BH9A 2A6EF 1D0ZA 2XPUA 4HX7A 5E3NA 3OR1C 1VQMI 2RC4A 3OMYA 3GFIA 1JGSA 3OYCA 2BEOA 1DGRM 2F4IA 1ACIA 2K9LA 5GTIC 1VF9A 4PJ0C 4E7IA 3C2HA 3ABLH 2JT1A 2KKOA 3J80K 4O3MA 4PSWA 3PO2J 4J00A 4G6QA 1QA6A 1HOMA 2Y2ZA 2VJ4A 3KZZA 2P8TA 3ZQ7A 3D1NI 2EH3A 2CSOA 5GADJ 4I6ZA 1D1BA 3I56I 1D1AA 1ZGJA 2XF6A 4Z2YA 1SD7A 3MMYB 4XOPA 3DP7A 3LFUA 3F72A 1NHAA 1MBEA 1TWHJ 2VIXA 1BIAA 1K78A 4OOIA 3I9V2 3FHZA 4XLPF 3RKQA 4PDKA 3BJOA 4KT5C 1ZG1A 4PZJA 2X6XA 5DD8A 4LD5A 3JRHA 2VOOA 1BM9A 2BZTA 3OYIA 5TRDA 4IOAF 5D4RA 4RB0A 2GXBA 5FLXZ 2DAOA 1KA8A 2CQKA 2HFHA 2ZSHB 3TP3A 1K7AA 1W7PA 1ERDA 4HOBA 4B09A 2F48A 1W5CC 2CS3A 3UR3C 2G7UA 3H5RA 4ITVA 4MEXF 4F91B 5CQGA 3S2HJ 4CCKA 2L01A 1K4TA 1JKRC 3J81K 5CVUA 1SFUA 3TBIA 1JJ6C 3JRIA 5K7FA 2CUJA 3HOUJ 5F27A 4I76A 2DA5A 4RB2C 2MD5A 3E97A 2HOAA 1VQ5I 2KFDA 1YG2A 2LDUA 3MAJA 2HQRA 1HQCA 2Y0MA 2EK5A 3F8CA 4C3JJ 3S1RJ 4IRIA 5HLHA 4CYDA 1ZR4A 4GXOA 1STZA 3RIRA 5CLSA 4EJWA 4PGHA 5D8LB 1X1CA 5TGTA 4LMYA 1SFKA 4F3QA 2VN2A 1J7KA 1HF0A 2COMA 1USSA 4NHJA 3EUHA 4BDYA 1AA7A 2K4JA 1RI7A 3GTQJ 5AONA 3HIFA 1XTAA 1YS6A 3L2VA 2PJRB 5E8IA 3GYHX 1TT5B 4UUSB 2FA5A 2HQAA 5H6QA 1MMAA 3WG9A 1RETA 2EZHA 2WAEA 1JUMA 1WJ5A 1NG7A 4RLQA 4UUVA 2M5WA 3HZJA 2VXZA 1DPUA 2Z9OA 2JVGA 1X1PA 2HKXA 2A5YB 2HTSA 2VJIA 1RPWA 2DN0A 2O03A 3DBRB 3L1PA 2V9VA 1QBJA 2DOEA 3K4KA 2R5ZA 1FP1D 4HEA2 3TMOA 2E60A 1D0YA 2F6CA 2OZ6A 4BBSJ 2R7FA 3VSLA 3HB9A 4ZJZA 1V55H 5J1RA 1E3PA 5LRSA 1VNDA 2YU9J 3FXUA 4X1EA 4RB3C 3ZR8X 2QBYB 4FCYA 1T0FC 4H4KC 3BJAA 2MSYA 5F1JA 1MNEA 1SFXA 4LB6B 1VQPI 1UAAA 1I5ZA 1JHHA 2DPUA 1R00A 4M3GA 2KISA 2CQ7A 4XRSG 1S7AA 3HTUA 3MWMA 1HKQA 5AIQA 5E8GA 2K7LA 1LKXA 2BW3B 2EZIA 2X6OA 4EJOA 3PO3J 3S16J 4V19K 2ZJRF 3DTIA 5HOOA 1WVRA 2ZJPF 1PJRA 2NVQJ 3ABTA 2VLAA 1IN7A 2H8RA 2DA7A 2O61A 3PJRA 2JVHA 3BR2A 4X0GA 1UFMA 3WTVC 3SJMA 3QYBA 1DUXC 4L18B 2CUEA 1G2HA 4A0XA 2E1MB 5LGTA 2RQPA 4A6EA 1GVDA 1JHFA 1PUFB 4HF1A 3LA7A 1LVKA 3ERMA 2DDAA 3IHUA 3WGHA 4Q47A 4HDUA 2H1KA 3Q9VA 2DCEA 2A5WA 1T98A 4NC8A 2Y0SN 3WTSC 3KYCB 1K6YA 1ODDA 3LL7A 3QP5A 3TKYA 3DWLE 4P5OA 5JI6A 3L2QA 2CMPA 3HRSA 3IWFA 1Q1VA 2IT0A 3F8FA 5DCMB 2DPDA 4CGZA 4DYRA 1JTXA 5D5VB 1FSHA 4BYYA 2L4MA 3DFGA 1WGXA 4G8XA 3VODA 3VSKA 3VYRB 1DQUA 4A5NA 3F22A 3B6CA 1OMIA 2X1DA 4DGWB 4E4HA 1TNTA 2HS5A 2XUBA 4NDLA 3G1OA 2NVYJ 4E7HA 1HBXG 3I54A 4LIVA 5LRRA 2JA6J 1FWZA 4A2UA 2ELHA 3DLLF 5CKTA 1HC8A 2VB6A 3W2VA 1A6QA 5IP7J 3X2QH 4BKXA 3H0DA 2R7VA 4FETA 1UG2A 5IYDJ 1BA5A 1FOXA 1WJBA 2AXTC 1NK2P 2HR3A 1Z67A 2FQ4A 4C9YA 3LWFA 4XK4A 1J2XA 2VC1A 4U87A 5GAHJ 4A0ZA 3MZ8A 2XRNA 4M3DA 5DM6F 3HJEA 2VE9A 4UHTA 2HYJA 2TRTA 2QSHX 4UV9A 5CQEA 2P7CB 1R5GA 1SD5A 3C1DA 2AO9A 1LFBA 1EA3A 2V1DA 1T56A 3K10A 2O5RA 1WH5A 4KN7X 1W1WE 2IVMA 3ZP5A 2CFXA 5IYBJ 1XCBA 1YW9A 3W2AA 2EIKH 2FRHA 2XGEA 1CQTA 4AUXA 1YFHA 3S1MJ 1HLVA 3HSRA 2QA4I 2XDVA 1IXCA 2DO7A 2STWA 2J5PA 3RCOA 3WTXC 2Q2EA 1SAXA 1A36A 1OCTC 5J1YA 3FX3A 3CJNA 1IDYA 2OCCH 4CSWA 2DA4A 2ZXHA 1ZREA 1WI9A 3JAMZ 4C2TA 4NC6A 3K4NA 1MNMC 3O8GA 4B3XA 1BI1A 1B72B 4YIRX 3HTSB 2DW4A 2P5KA 2E1MC 2FOWA 5GPAA 1BI0A 4HLYA 1VZ0A 1U6GA 5HDGA 3ZMVA 1D1CA 1RR7A 3QOEA 4IF4A 1MIJA 4CCNA 5M3FJ 4TV7A 2I5UA 3JSOA 4EJTA 2MLKA 1R4MB 3TEDA 1D5YA 2L7FP 1B9MA 1JE8A 1WRJA 3OY9A 4HV5A 3KP4A 5JVTA 3ZMTA 2LREA 4QWQA 3SFZA 1FBQA 4J19A 4AC0A 2D45A 1U8RA 4C2MJ 2ZFUA 2P5LC 4BY7J 5DYMA 2XV4S 1ZGAA 3GCMA 4Q48A 2OAZA 2O3FA 4CYCB 3HGYA 1GLNA 1Y56A 5B1AH 2OU2A 2KDZA 3V8LA 2XAHA 3PNTA 3S3OA 1FYKA 2XGDA 1PUEE 2DMUA 3AKZA 4IHVA 2LK2A 3ZOBA 2FBIA 2YX4A 2XSJC 4MFEA 4A3LJ 2DT7B 2LY9A 1YW7A 1DPRA 5IPAA 3GO5A 2ZMEC 2HOSA 4GFBA 2CUFA 3S93A 5HNHA 4NC7A 4Q4ZF 1BN5A 2XAGA 4CZCA 5J3LA 1OCZH 2R7WA 2QYOA 2JA2A 5CVVA 5F64A 1BBYA 2E36A 3HSFA 1XSDA 1IRGA 3GTPJ 4OWRB 2K40A 4PJNA 3GBGA 5D6FA 1FPQA 3H36A 3F21A 1S5LC 3QPTA 3G73A 2EILH 4OAZA 2LVSA 2DJIA 1XSXA 2KZGA 4BHCA 5GTHC 4UVBA 3GF2A 3Q0VA 3W2WA 1O3QA 3E3VA 4OU0A 4U88A 4XLNF 4HQEA 3IKVA 3G1MA 2LMDA 5FB2A 3GUDA 2M7BA 5BMZA 4ZDOA 2ESNA 5FD5A 1VQ4I 4RS8A 2ETHA 2HQNA 4JYKA 3FF5A 2QWWA 2NVTJ 3QQAA 2WA0A 4DYCA 1D8JA 3CCRI 3EQLF 4PFOA 2EV5A 2WAQA 1OR7A 1MGTA 4L5JA 4DZPA 1E0EA 3K9TA 3GXOA 1IC8A 1BR1A 3D5LA 1JI8A 1EKEA 4Z6YA 3AG4H 2QUFA 2XF5A 2CO5A 4A3FJ 1HKSA 4JX4A 1IO2A 4LK1F 3OL4A 1OISA 3Q9SA 3WHBA 5C3EJ 3F8MA 3DV8A 3D5RC 1X1AA 1UHWA 2WY8Q 3DPLC 1ON1A 1R1UA 5F6FA 2LBFB 3BCBA 1LDJA 1I1GA 4MFDA 4YFXF 4ETSA 2R3SA 1H9TA
chains in the Genus database with same CATH topology
4UXNA 1J75A 2GZWA 4I98B 3I58A 2A07F 2OQGA 4HW0A 1Z05A 2X4HA 5LHGA 3IC7A 3FM3A 4KFCA 3R0AA 3CO6C 4HYEA 1WQ2A 1KU2A 4ESFA 3COAC 2DU9A 2MC3A 4M9ZA 1K78B 4S05A 3RJPA 2M45A 1UB9A 1J9IA 1Q1HA 1I6XA 3TDUC 4M72A 5BPDA 5HLGA 3RKXA 1IZ1A 2LF7A 4L9TA 2EB7A 2FE3A 2Z5UA 4L9JA 3CDHA 3EYIA 4ZYHA 2RDPA 2PMHA 5LHHA 4GYGA 4WWCA 4I2OA 2J5OA 3LA2A 1G6NA 4RGXA 3E6BA 4NQWA 2MLGA 3RYPA 2EFPA 1B6AA 2VE8A 1R7JA 2P6TA 3JTGA 1GXPA 3HHGA 5JFRA 5ICEA 4BNCA 2EFWA 4A6DA 5H6RA 1S7OA 1XN7A 1TTYA 2FMYA 2FU4A 5L3EA 3S2WA 1FNNA 2CW0F 3H92A 1TW3A 1F5TA 5LGUA 1XD7A 3IKTA 3HHHA 2MA3A 2ACJA 5FGMA 3KE2A 3ABUA 3HRTA 1MD0A 3TDZC 2D1VA 1GHCA 3EDPA 2LKPA 3I59B 1T2KA 1E2XA 3HOSA 1BI2A 4ESJA 2D2WA 1YTYA 3TO7A 2VBWA 4UV8A 3LFKA 2XAFA 2GA1A 2IA2A 3MCZA 2UWMA 4I0BA 1IAWA 1ZRDA 1ZG5A 3I0TA 3B02A 5BPIA 2C6YA 2CG4A 4M71A 4KICA 2O8XA 2HDCA 1T38A 3RKWA 1FZPB 1WKMA 1O57A 4YG2F 3HRMA 1T0FA 1USTA 3FXRA 2E7WA 4IHSA 3RTRA 3I64A 4OIPF 2HYFA 2KIUA 2EWNA 2FNPA 3R0JA 3ZN0A 1ZRFA 3TGNA 2L4AA 3ZMUA 3L9FA 2CYYA 4HZFA 4OIRF 2XKPA 5CVIA 2PLYA 4PGGA 3E6MA 2FMLA 3GLXA 1KU9A 2PMUA 4DNCA 2XKOA 1YW8A 4E70A 3T5XA 2DTRA 2GQQA 2VC0A 3LAJA 3OV8A 3E5XA 1GVJA 4G7OF 3JTHA 1J59A 2TDXA 4YIFA 3W6KB 2VBZA 3C3WA 3R60A 2IRFG 4GGGA 2FQ3A 1IN4A 2AXLA 2XAJA 2RGVA 3ZMZA 2GAUA 2PJPA 4WXDA 2DQLA 3CTAA 1KQ9A 2V1UA 2EA2A 2CGPA 4KIBA 3QPHA 4WF2A 2IPQX 2W25A 1SD6A 1UHMA 3NRVA 2PBIA 4H0EA 3BZ6A 2PQ8A 1W5TA 3RDIA 2QVOA 1ULYA 4MTEA 3L7WA 1HSJA 3JW4A 3WU0A 1H0MA 3R61A 3T0YA 1RUOA 4R8HA 2WC2A 4AIJA 2HKOA 2BGCA 3G3ZA 1AWCA 2FEZA 4BXUA 2IJLA 2K4BA 2OD5A 3EYYA 4NB5A 2M30A 1I27A 4N9IA 3BPVA 3I5UA 5D5XB 3LA3A 2Q0OA 2H94A 1ZYRF 2BYVE 1QZYA 4HLXA 2X0LA 3R6SA 4I02A 3RPUA 2FXAA 5FO5A 3KLOA 5E1ZB 3HYIA 3F6VA 4KUMA 2LNBA 3F8BA 2HTJA 2VONA 4LLLA 2VT2A 4RGSA 2VOPA 2UZKA 4R79A 1I1SA 4D0PA 3ERED 2PN6A 3BP8A 3L00A 4GO1A 1R1TA 2M87A 4LFUA 1U5TC 2RV8A 3U1DA 2HYGD 4ZYGA 2P4WA 3F3XA 3VFZA 2WWYA 4AIKA 2QM3A 3BWGA 2D1HA 4ESBA 1SFEA 1IN8A 3R4KA 1TW2A 5DD4A 1FYLA 4JBAA 2ZXJA 2EA4A 2JSCA 4MEYF 4EGZA 4N9HA 1L3LA 4F7ZA 4MQVA 3DKWA 2ZFWA 3TOBA 4RGUA 3GX4X 3M8FA 5JHUA 1C0WA 2FBKA 3GZ5A 3BROA 1KYZA 1P6RA 3FXQA 4CDGA 5L3FA 1QQIA 3IL2A 1MJAA 3HSEA 2L3DA 4XSXF 3FWEA 2H6CA 2VT3A 2UXNA 3PFIA 1RUNA 3K1PA 1XGSA 3QRFF 3WGGA 5CYVA 3K1MA 3ISPA 3WTUC 3CO7C 3RKYA 4WX9A 2XASA 4EM2A 3WODF 4JK1X 3VEPA 4IRHA 1IN5A 4A0YA 2XVCA 2IP2A 1FYMA 1LDDA 1W7PD 1LDKB 2K02A 2MH2A 5IT3A 3TO9A 1R58A 3FMSA 3I71A 4YIIA 3KP6A 1QGPA 2Y48A 1ZAOA 2PEXA 4ZH4F 1YLFA 1EH8A 3ZMDA 3MZYA 1W5SA 1F4KA 5JR3A 1B9NA 1FT9A 4M73A 3K2ZA 1B4AA 3NEUA 3IRQA 4LB5A 2YX7A 1FSEA 2G9WA 2FSWA 2GA2A 5ICGA 1OYYA 2ZNZA 5LEJA 1XCVA 2W84A 4ENMA 4IJAA 2L54A 3JAMK 3F6OA 2E7XA 1BI3A 2Z99A 5EEGA 1B1BA 4LJZF 3I59A 3KP7A 2HGCA 2YPRA 5L3GA 3RPQA 4Y15A 1PP8F 1ZH5A 5DDGA 3SZPA 4KDPA 2O6GE 1W4MA 3GVAA 1G3YA 3K69A 4GYIA 4G6DA 2A69F 1LEAA 1R22A 2W24A 5KVRA 5FD6A 1WSUA 1XGNA 5EEHA 4G7ZF 2JPCA 1P2FA 4KYWA 4HDVA 3JSPA 5BOXA 5HDKA 4L9NA 3RI4A 2GIVA 1OYIA 4OIOF 3MQ0A 3FMQA 3IWZA 3TOAA 1S3JA 4M6XA 3QU6A 5HS9A 1P92A 1MDMB 3E6CC 1X3UA 2F5DA 2L02A 5F1RA 4WK8F 1ZG3A 2KJCA 3WGIA 3GWZA 5HVQC 2XHKA 3ULQB 1BC7C 2P6SA 2EJRA 1YQAA 3L2CA 2Q8KA 4XRFA 5A2QZ 2DK8A 5TJJA 3P9CA 1OYWA 3M7GA 1UCRA 3N4MA 2H27A 2F5FA 3O6BB 1TQPA 4MHGA 4O6JA 1W7PB 5L3CA 1FOKA 5CVRA 1D8KA 4U0YA 3BDDA 3GEZA 3N97A 3CLOA 1G3WA 1ZLJA 4XSZF 4OMYA 5CVJA 2HEOA 1LB2A 4ZZLA 5ILVA 2GWRA 3DXJF 1DP7P 3ZN1A 1WWXA 2EFOA 3F8NA 3KCCA 1S8NA 3ECHA 4KMFA 1U3EM 2WV0A 2ISZA 2E1NA 3E5QA 4R1HA 5KK1A 1EH7A 2KJBA 1K79A 2CWEA 1MKMA 5ICCA 1SD4A 2FBHA 2WTEA 4N0BA 3LQRA 2JRTA 4HF2A 3EETA 1O3TA 4IPAA 5DV5A 2V6CA 5D5UB 1SFUA 4EJVA 3LSTA 3TO6A 3V7RA 1IF1A 5IT9K 3KP3A 4HX8A 2OA4A 4G94A 4BQAA 1FP2A 3KP5A 4GCVA 1BIBA 3HRUA 4LGWA 4UVAA 4MQ9F 1YO5C 4M74A 4MGRA 1Y0UA 2YR2A 1MZBA 4K2EA 4HA8A 3V4GA 3AAFA 2BV6A 3KLNA 4P55A 4IXAA 5H20A 1FY7A 4WXCA 4EQQA 1IXSB 3BPXA 3W6JB 2JZYA 1CGPA 3GFLA 2ZMEB 3F23A 2F5EA 2A68F 2OBPA 5ILSA 1IXRC 4MTDA 4KIGA 3KZYA 4IHTA 1HW2A 3V8JA 5J6XA 1QZZA 3OOPA 1F1ZA 5E17F 2JPBA 2ZNYA 3KFWX 3ZMSA 2DLLA 1LJ9A 4JQFA 4RGRA 1KQ0A 2KRFA 3NQOA 2RVCA 2VODA 4KNYA 2BE5F 1V3FA 2NYXA 4FT8A 2ZCWA 2V79A 5K5QA 3WE2A 4PCQA 3MZHA 2GXGA 4UVCA 2DK5A 1U78A 2HOEA 3KEQA 3BJ6A 5FFZA 1ZRCA 3I53A 3WTWC 3QOPA 4LLGF 1XB4A 5LEKA 3K0LA 1O3SA 2AS5F 3GFMA 3DPTA 5E20A 3GW2A 1R5HA 3SQNA 4CXFA 3HOTA 2NS0A 2V1XA 3P9KA 1B59A 1HSTA 3GFJA 2MH9A 4ASNA 4FX0A 3Q5FA 2XGXA 5D8KB 3LQQA 3ML6A 4L0ZB 4CICA 2NNNA 1MJ9A 3K1NA 1EH6A 4KA4A 5DCMA 2R7DA 1OKRA 1BJAA 2ESHA 1PP7U 1J5YA 1S29A 1IRFA 2ZKZA 1IUYA 3CUOA 3VOEA 4L0YB 3SHFA 2M8EA 2ISYA 3BY6A 4Y13A 4HAMA 4G7HF 3TQNA 2ZO4A 4I0AA 2VBXA 2P7VB 3H3ZA 2ZJ2A 1XGOA 2YSRA 4OINF 4AD9A 2NNYA 1YS7A 5E1WA 4EM1A 3QAHA 5DUIA 5BQTA 1S6LA 2ZMEA 4Y17A 2DI3A 4WXHA 1QNTA 1YYVA 5K1YA 1T6SA 1IW7F 2Z33A 1SMTA 1R1VA 2QENA 2EFNA 2W85A 1V4RA 5D4SA 1ZN2A 1U5TB 1JXSA 4QLCU 1E17A 1TNSA 5J8FA 4CHUA 4EVIA 2RKHA 1OPCA 5J8CA 3P9IA 2VBYA 4U7BA 1RZ4A 5FFXA 4EMSA 1K6OA 1D3YA 1XDUA 3WTZA 5LGNA 1D5VA 1VTNC 2QQ9A 4O5VA 4AIHA 5HDNA 4IRGA 3RYRA 1DDNA 3WU1B 4HX4A 1XGMA 3WE3A 2PFBA 1LQ1A 3M1EA 4IVNA 2IA0A 4EM0B 4XBFA 4ENNA 1XMAA 2ADUA 5ICFA 5ED4A 5FLXK 1FBUA 2F5CA 2K86A 1R36A 4AWXB 2LF8A 2OZUA 1R23A 1TQMA 1LVAA 1QO0D 3KEOA 4LG0A 2EV0A 3CUQB 1ON2A 3U9GA 1TLHB 5IT9Z 1BOAA 4YFNF 4ENJA 5A2QK 4HF0A 3J81Z 2A3SA 2QQAA 5ERIA 5L3BA 1Z9CA 2KIMA 5K5RA 4B8XA 4P96A 2LSOA 5LLQA 5L3DA 5HLIA 3QP6A 1XMKA 3PQJA 3IRRA 4FX4A 4DQ2A 2RN7A 3P7NA 1HW5A 3WTYC 3H3UA 5D5WB 5DEQA 2XIGA 2F2EA 4I09A 5LBQA 3T1BA 5HS8A 3V8KA 4ZYDA 1YIOA 1G3TA 2KIFA 2DBBA 2A61A 3D0SA 1PDNC 4A12A 4LLNA 1KYWA 1FX7A 2E1CA 1GXQA 3J80Z 2DT5A 2A6HF 1P4XA 5BS6A 4G9YA 3FZVA 1EV7A 1KQ8A 4UNOA 2STTA 2W57A 3DQVC 3KETA 4U0VA 4WCGA 2XAQA 4RAYA 1A04A 2XROA 1BC8C 4KN4X 1Z1DA 1AOYA 1O7LA 4P9FA 1FC3A 2Z3YA 3C18A 3O2PE 4U0WA 3QU3A 4KIFA 3V7SA 4M9XA 1CF7B 4AVPA 4M9SA 5DUKA 4EGYA 4EJUA 5D6EA 2BBYA 3ELKA 4HV6A 2FNAA 2MBFA 2PI0A 4HQMA 1FLIA 2P5VA 3ZPLA 2UXXA 1HXDA 3KP2A 4OIQF 3DEUA 3WTTC 2IA1A 5DCFA 1HW1A 5AIPA 1ONVA 1SMYF 2HZTA 1Z7UA 4U7DA 2H09A 2PG4A 1ZARA 2OQRA 4ZZDA 1Z6TA 3B73A 3J7AO 1TQIA 1QPMA 4RB1A 4S04A 1U2WA 4M6YA 2ZBKA 2YU3A 2DQRA 2QBYA 4CO8A 4ON0A 4ENKA 4BHPA 2QLZA 2EFQA 3V7CA 1ZLKA 1XDSA 3U2RA 3GZ6A 3FMRA 3HUGA 3M9AA 3M8EA 1HKTA 1Z91A 4KMUX 3ROUA 2RNJA 1H9GA 3E5UA 1KU3A 6PAXA 1KGSA 4ZYEA 3LAPA 1P4WA 4BAYA 1J0RA 2EV6A 4L5IA 2FF4A 1ZHFA 1P4AA 5ILUA 3T8TA 5CJ9A 3O3KA 3FM5A 2JTVA 1RIOH 2QQBA 4L9VA 4LK0F 4I01A 1G4DA 2QZ8A 1TBXA 4P9UA 1F9NA 4HBLA 1U5TA 1T39A 5E18F 4LG0B 2H6BA 3L09A 3BOQA 2O0YA 1KU7A 1L0OC 5K5OA 1O3RA 1LEBA 5E1XA 1O7FA 4OMZA 4FHTA 1Z6RA 1LNWA 2NAZA 2FOKA 2G7HA 1G3SA 4YFKF 3CUQA 1FBSA 3E6DA 3ECOA 1RNLA 4CZZA 2NRAC 4MNUA 4EV0A 3MEXA 5LHIA 3PQKA 2IW5A 2K27A 1MDMA 4Q5SF 3MFKA 3T8RA 3CUQC 5HS7A 2Y75A 3REOA 3DF8A 2B0LA 2HWVA 2DFIA 4RAZA 3VB2A 3C7JA 3SXYA 1IN6A 1XSVA 4A5MA 4BHBA 1CF7A 2M1BA 3SZTA 1MJBA 3I4PA 4I7HA 1REPC 4BH9A 2A6EF 4HX7A 2RC4A 3GFIA 1JGSA 2BEOA 2JT1A 2KKOA 3J80K 4O3MA 4G6QA 3KZZA 2P8TA 3ZQ7A 2CSOA 1ZGJA 4Z2YA 1SD7A 3DP7A 3F72A 1NHAA 1K78A 1BIAA 4OOIA 3FHZA 4XLPF 4PDKA 3BJOA 4KT5C 1ZG1A 4PZJA 5DD8A 4LD5A 2VOOA 1BM9A 5TRDA 5D4RA 4RB0A 2GXBA 5FLXZ 2DAOA 1KA8A 2CQKA 2HFHA 1K7AA 1W7PA 4HOBA 4B09A 2G7UA 4MEXF 2L01A 3J81K 5CVUA 4RB2C 2MD5A 3E97A 2LDUA 1YG2A 3MAJA 2HQRA 1HQCA 4IRIA 2EK5A 2Y0MA 3F8CA 5HLHA 4CYDA 4GXOA 1STZA 3RIRA 5CLSA 4EJWA 4PGHA 5D8LB 4LMYA 2VN2A 1J7KA 2COMA 1USSA 4NHJA 3EUHA 2K4JA 1RI7A 5AONA 3HIFA 1YS6A 5E8IA 3GYHX 2FA5A 5H6QA 3WG9A 4UUVA 2M5WA 2VXZA 1DPUA 2Z9OA 2HKXA 2A5YB 2HTSA 2O03A 2V9VA 1QBJA 1FP1D 2OZ6A 2R7FA 5LRSA 3FXUA 4RB3C 2QBYB 3BJAA 1SFXA 4LB6B 1I5ZA 1JHHA 2DPUA 1R00A 1S7AA 3HTUA 3MWMA 1HKQA 5AIQA 5E8GA 2K7LA 4EJOA 5HOOA 3ABTA 1IN7A 2O61A 3WTVC 1UFMA 1DUXC 4L18B 4A0XA 5LGTA 2RQPA 4A6EA 1JHFA 4HF1A 3LA7A 3IHUA 3WGHA 4Q47A 4HDUA 3Q9VA 1T98A 3WTSC 1ODDA 3QP5A 3TKYA 4P5OA 5JI6A 3HRSA 3IWFA 2IT0A 3F8FA 5DCMB 2DPDA 4CGZA 5D5VB 1FSHA 4BYYA 2L4MA 3DFGA 4G8XA 3VODA 4A5NA 3F22A 1OMIA 1TNTA 2HS5A 2XUBA 1HBXG 3I54A 5LRRA 1FWZA 4A2UA 2ELHA 2HR3A 3LWFA 1J2XA 2VC1A 4A0ZA 2XRNA 2VE9A 4UHTA 4UV9A 2P7CB 1R5GA 1SD5A 3C1DA 2V1DA 4KN7X 2IVMA 3ZP5A 2CFXA 1XCBA 1YW9A 2FRHA 1YFHA 3HSRA 2DO7A 1IXCA 2STWA 2J5PA 3WTXC 2Q2EA 1SAXA 3FX3A 3CJNA 1ZREA 1WI9A 3JAMZ 1BI1A 3HTSB 2DW4A 2P5KA 1BI0A 4HLYA 1U6GA 5HDGA 3ZMVA 4IF4A 4TV7A 3JSOA 4EJTA 2MLKA 1B9MA 1JE8A 1WRJA 5JVTA 4HV5A 3KP4A 3ZMTA 4QWQA 3SFZA 1FBQA 1U8RA 2D45A 2P5LC 5DYMA 2XV4S 1ZGAA 4Q48A 2OAZA 2O3FA 2OU2A 3V8LA 2XAHA 1FYKA 1PUEE 2FBIA 2YX4A 1YW7A 1DPRA 3GO5A 4Q4ZF 1BN5A 2XAGA 2QYOA 5CVVA 5F64A 1BBYA 3HSFA 1XSDA 1IRGA 5D6FA 1FPQA 3F21A 3QPTA 3G73A 1XSXA 4BHCA 4UVBA 3GF2A 1O3QA 3E3VA 4OU0A 4U88A 4XLNF 4HQEA 3IKVA 5FB2A 3GUDA 5BMZA 2ESNA 5FD5A 4RS8A 2ETHA 2HQNA 3FF5A 2QWWA 1D8JA 3EQLF 2EV5A 1OR7A 1MGTA 4L5JA 3K9TA 3GXOA 3D5LA 2QUFA 2CO5A 1HKSA 4LK1F 3Q9SA 3F8MA 3DV8A 1UHWA 3DPLC 1ON1A 1R1UA 5F6FA 1LDJA 1I1GA 4YFXF 4ETSA 2R3SA 1H9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXN A;  1J75 A;  2GZW A;  4I98 B;  3I58 A;  2A07 F;  2OQG A;  4HW0 A;  1Z05 A;  2X4H A;  5LHG A;  3IC7 A;  3FM3 A;  4KFC A;  3R0A A;  3CO6 C;  4HYE A;  1WQ2 A;  1KU2 A;  4ESF A;  3COA C;  2DU9 A;  2MC3 A;  4M9Z A;  1K78 B;  4S05 A;  3RJP A;  2M45 A;  1UB9 A;  1J9I A;  1Q1H A;  1I6X A;  3TDU C;  4M72 A;  5BPD A;  5HLG A;  3RKX A;  1IZ1 A;  2LF7 A;  4L9T A;  2EB7 A;  2FE3 A;  2Z5U A;  4L9J A;  3CDH A;  3EYI A;  4ZYH A;  2RDP A;  2PMH A;  5LHH A;  4GYG A;  4WWC A;  4I2O A;  2J5O A;  3LA2 A;  1G6N A;  4RGX A;  3E6B A;  4NQW A;  2MLG A;  3RYP A;  2EFP A;  1B6A A;  2VE8 A;  1R7J A;  2P6T A;  3JTG A;  1GXP A;  3HHG A;  5JFR A;  5ICE A;  4BNC A;  2EFW A;  4A6D A;  5H6R A;  1S7O A;  1XN7 A;  1TTY A;  2FMY A;  2FU4 A;  5L3E A;  3S2W A;  1FNN A;  2CW0 F;  3H92 A;  1TW3 A;  1F5T A;  5LGU A;  1XD7 A;  3IKT A;  3HHH A;  2MA3 A;  2ACJ A;  5FGM A;  3KE2 A;  3ABU A;  3HRT A;  1MD0 A;  3TDZ C;  2D1V A;  1GHC A;  3EDP A;  2LKP A;  3I59 B;  1T2K A;  1E2X A;  3HOS A;  1BI2 A;  4ESJ A;  2D2W A;  1YTY A;  3TO7 A;  2VBW A;  4UV8 A;  3LFK A;  2XAF A;  2GA1 A;  2IA2 A;  3MCZ A;  2UWM A;  4I0B A;  1IAW A;  1ZRD A;  1ZG5 A;  3I0T A;  3B02 A;  5BPI A;  2C6Y A;  2CG4 A;  4M71 A;  4KIC A;  2O8X A;  2HDC A;  1T38 A;  3RKW A;  1FZP B;  1WKM A;  1O57 A;  4YG2 F;  3HRM A;  1T0F A;  1UST A;  3FXR A;  2E7W A;  4IHS A;  3RTR A;  3I64 A;  4OIP F;  2HYF A;  2KIU A;  2EWN A;  2FNP A;  3R0J A;  3ZN0 A;  1ZRF A;  3TGN A;  2L4A A;  3ZMU A;  3L9F A;  2CYY A;  4HZF A;  4OIR F;  2XKP A;  5CVI A;  2PLY A;  4PGG A;  3E6M A;  2FML A;  3GLX A;  1KU9 A;  2PMU A;  4DNC A;  2XKO A;  1YW8 A;  4E70 A;  3T5X A;  2DTR A;  2GQQ A;  2VC0 A;  3LAJ A;  3OV8 A;  3E5X A;  1GVJ A;  4G7O F;  3JTH A;  1J59 A;  2TDX A;  4YIF A;  3W6K B;  2VBZ A;  3C3W A;  3R60 A;  2IRF G;  4GGG A;  2FQ3 A;  1IN4 A;  2AXL A;  2XAJ A;  2RGV A;  3ZMZ A;  2GAU A;  2PJP A;  4WXD A;  2DQL A;  3CTA A;  1KQ9 A;  2V1U A;  2EA2 A;  2CGP A;  4KIB A;  3QPH A;  4WF2 A;  2IPQ X;  2W25 A;  1SD6 A;  1UHM A;  3NRV A;  2PBI A;  4H0E A;  3BZ6 A;  2PQ8 A;  1W5T A;  3RDI A;  2QVO A;  1ULY A;  4MTE A;  3L7W A;  1HSJ A;  3JW4 A;  3WU0 A;  1H0M A;  3R61 A;  3T0Y A;  1RUO A;  4R8H A;  2WC2 A;  4AIJ A;  2HKO A;  2BGC A;  3G3Z A;  1AWC A;  2FEZ A;  4BXU A;  2IJL A;  2K4B A;  2OD5 A;  3EYY A;  4NB5 A;  2M30 A;  1I27 A;  4N9I A;  3BPV A;  3I5U A;  5D5X B;  3LA3 A;  2Q0O A;  2H94 A;  1ZYR F;  2BYV E;  1QZY A;  4HLX A;  2X0L A;  3R6S A;  4I02 A;  3RPU A;  2FXA A;  5FO5 A;  3KLO A;  5E1Z B;  3HYI A;  3F6V A;  4KUM A;  2LNB A;  3F8B A;  2HTJ A;  2VON A;  4LLL A;  2VT2 A;  4RGS A;  2VOP A;  2UZK A;  4R79 A;  1I1S A;  4D0P A;  3ERE D;  2PN6 A;  3BP8 A;  3L00 A;  4GO1 A;  1R1T A;  2M87 A;  4LFU A;  1U5T C;  2RV8 A;  3U1D A;  2HYG D;  4ZYG A;  2P4W A;  3F3X A;  3VFZ A;  2WWY A;  4AIK A;  2QM3 A;  3BWG A;  2D1H A;  4ESB A;  1SFE A;  1IN8 A;  3R4K A;  1TW2 A;  5DD4 A;  1FYL A;  4JBA A;  2ZXJ A;  2EA4 A;  2JSC A;  4MEY F;  4EGZ A;  4N9H A;  1L3L A;  4F7Z A;  4MQV A;  3DKW A;  2ZFW A;  3TOB A;  4RGU A;  3GX4 X;  3M8F A;  5JHU A;  1C0W A;  2FBK A;  3GZ5 A;  3BRO A;  1KYZ A;  1P6R A;  3FXQ A;  4CDG A;  5L3F A;  1QQI A;  3IL2 A;  1MJA A;  3HSE A;  2L3D A;  4XSX F;  3FWE A;  2H6C A;  2VT3 A;  2UXN A;  3PFI A;  1RUN A;  3K1P A;  1XGS A;  3QRF F;  3WGG A;  5CYV A;  3K1M A;  3ISP A;  3WTU C;  3CO7 C;  3RKY A;  4WX9 A;  2XAS A;  4EM2 A;  3WOD F;  4JK1 X;  3VEP A;  4IRH A;  1IN5 A;  4A0Y A;  2XVC A;  2IP2 A;  1FYM A;  1LDD A;  1W7P D;  1LDK B;  2K02 A;  2MH2 A;  5IT3 A;  3TO9 A;  1R58 A;  3FMS A;  3I71 A;  4YII A;  3KP6 A;  1QGP A;  2Y48 A;  1ZAO A;  2PEX A;  4ZH4 F;  1YLF A;  1EH8 A;  3ZMD A;  3MZY A;  1W5S A;  1F4K A;  5JR3 A;  1B9N A;  1FT9 A;  4M73 A;  3K2Z A;  1B4A A;  3NEU A;  3IRQ A;  4LB5 A;  2YX7 A;  1FSE A;  2G9W A;  2FSW A;  2GA2 A;  5ICG A;  1OYY A;  2ZNZ A;  5LEJ A;  1XCV A;  2W84 A;  4ENM A;  4IJA A;  2L54 A;  3JAM K;  3F6O A;  2E7X A;  1BI3 A;  2Z99 A;  5EEG A;  1B1B A;  4LJZ F;  3I59 A;  3KP7 A;  2HGC A;  2YPR A;  5L3G A;  3RPQ A;  4Y15 A;  1PP8 F;  1ZH5 A;  5DDG A;  3SZP A;  4KDP A;  2O6G E;  1W4M A;  3GVA A;  1G3Y A;  3K69 A;  4GYI A;  4G6D A;  2A69 F;  1LEA A;  1R22 A;  2W24 A;  5KVR A;  5FD6 A;  1WSU A;  1XGN A;  5EEH A;  4G7Z F;  2JPC A;  1P2F A;  4KYW A;  4HDV A;  3JSP A;  5BOX A;  5HDK A;  4L9N A;  3RI4 A;  2GIV A;  1OYI A;  4OIO F;  3MQ0 A;  3FMQ A;  3IWZ A;  3TOA A;  1S3J A;  4M6X A;  3QU6 A;  5HS9 A;  1P92 A;  1MDM B;  3E6C C;  1X3U A;  2F5D A;  2L02 A;  5F1R A;  4WK8 F;  1ZG3 A;  2KJC A;  3WGI A;  3GWZ A;  5HVQ C;  2XHK A;  3ULQ B;  1BC7 C;  2P6S A;  2EJR A;  1YQA A;  3L2C A;  2Q8K A;  4XRF A;  5A2Q Z;  2DK8 A;  5TJJ A;  3P9C A;  1OYW A;  3M7G A;  1UCR A;  3N4M A;  2H27 A;  2F5F A;  3O6B B;  1TQP A;  4MHG A;  4O6J A;  1W7P B;  5L3C A;  1FOK A;  5CVR A;  1D8K A;  4U0Y A;  3BDD A;  3GEZ A;  3N97 A;  3CLO A;  1G3W A;  1ZLJ A;  4XSZ F;  4OMY A;  5CVJ A;  2HEO A;  1LB2 A;  4ZZL A;  5ILV A;  2GWR A;  3DXJ F;  1DP7 P;  3ZN1 A;  1WWX A;  2EFO A;  3F8N A;  3KCC A;  1S8N A;  3ECH A;  4KMF A;  1U3E M;  2WV0 A;  2ISZ A;  2E1N A;  3E5Q A;  4R1H A;  5KK1 A;  1EH7 A;  2KJB A;  1K79 A;  2CWE A;  1MKM A;  5ICC A;  1SD4 A;  2FBH A;  2WTE A;  4N0B A;  3LQR A;  2JRT A;  4HF2 A;  3EET A;  1O3T A;  4IPA A;  5DV5 A;  2V6C A;  5D5U B;  1SFU A;  4EJV A;  3LST A;  3TO6 A;  3V7R A;  1IF1 A;  5IT9 K;  3KP3 A;  4HX8 A;  2OA4 A;  4G94 A;  4BQA A;  1FP2 A;  3KP5 A;  4GCV A;  1BIB A;  3HRU A;  4LGW A;  4UVA A;  4MQ9 F;  1YO5 C;  4M74 A;  4MGR A;  1Y0U A;  2YR2 A;  1MZB A;  4K2E A;  4HA8 A;  3V4G A;  3AAF A;  2BV6 A;  3KLN A;  4P55 A;  4IXA A;  5H20 A;  1FY7 A;  4WXC A;  4EQQ A;  1IXS B;  3BPX A;  3W6J B;  2JZY A;  1CGP A;  3GFL A;  2ZME B;  3F23 A;  2F5E A;  2A68 F;  2OBP A;  5ILS A;  1IXR C;  4MTD A;  4KIG A;  3KZY A;  4IHT A;  1HW2 A;  3V8J A;  5J6X A;  1QZZ A;  3OOP A;  1F1Z A;  5E17 F;  2JPB A;  2ZNY A;  3KFW X;  3ZMS A;  2DLL A;  1LJ9 A;  4JQF A;  4RGR A;  1KQ0 A;  2KRF A;  3NQO A;  2RVC A;  2VOD A;  4KNY A;  2BE5 F;  1V3F A;  2NYX A;  4FT8 A;  2ZCW A;  2V79 A;  5K5Q A;  3WE2 A;  4PCQ A;  3MZH A;  2GXG A;  4UVC A;  2DK5 A;  1U78 A;  2HOE A;  3KEQ A;  3BJ6 A;  5FFZ A;  1ZRC A;  3I53 A;  3WTW C;  3QOP A;  4LLG F;  1XB4 A;  5LEK A;  3K0L A;  1O3S A;  2AS5 F;  3GFM A;  3DPT A;  5E20 A;  3GW2 A;  1R5H A;  3SQN A;  4CXF A;  3HOT A;  2NS0 A;  2V1X A;  3P9K A;  1B59 A;  1HST A;  3GFJ A;  2MH9 A;  4ASN A;  4FX0 A;  3Q5F A;  2XGX A;  5D8K B;  3LQQ A;  3ML6 A;  4L0Z B;  4CIC A;  2NNN A;  1MJ9 A;  3K1N A;  1EH6 A;  4KA4 A;  5DCM A;  2R7D A;  1OKR A;  1BJA A;  2ESH A;  1PP7 U;  1J5Y A;  1S29 A;  1IRF A;  2ZKZ A;  1IUY A;  3CUO A;  3VOE A;  4L0Y B;  3SHF A;  2M8E A;  2ISY A;  3BY6 A;  4Y13 A;  4HAM A;  4G7H F;  3TQN A;  2ZO4 A;  4I0A A;  2VBX A;  2P7V B;  3H3Z A;  2ZJ2 A;  1XGO A;  2YSR A;  4OIN F;  4AD9 A;  2NNY A;  1YS7 A;  5E1W A;  4EM1 A;  3QAH A;  5DUI A;  5BQT A;  1S6L A;  2ZME A;  4Y17 A;  2DI3 A;  4WXH A;  1QNT A;  1YYV A;  5K1Y A;  1T6S A;  1IW7 F;  2Z33 A;  1SMT A;  1R1V A;  2QEN A;  2EFN A;  2W85 A;  1V4R A;  5D4S A;  1ZN2 A;  1U5T B;  1JXS A;  4QLC U;  1E17 A;  1TNS A;  5J8F A;  4CHU A;  4EVI A;  2RKH A;  1OPC A;  5J8C A;  3P9I A;  2VBY A;  4U7B A;  1RZ4 A;  5FFX A;  4EMS A;  1K6O A;  1D3Y A;  1XDU A;  3WTZ A;  5LGN A;  1D5V A;  1VTN C;  2QQ9 A;  4O5V A;  4AIH A;  5HDN A;  4IRG A;  3RYR A;  1DDN A;  3WU1 B;  4HX4 A;  1XGM A;  3WE3 A;  2PFB A;  1LQ1 A;  3M1E A;  4IVN A;  2IA0 A;  4EM0 B;  4XBF A;  4ENN A;  1XMA A;  2ADU A;  5ICF A;  5ED4 A;  5FLX K;  1FBU A;  2F5C A;  2K86 A;  1R36 A;  4AWX B;  2LF8 A;  2OZU A;  1R23 A;  1TQM A;  1LVA A;  1QO0 D;  3KEO A;  4LG0 A;  2EV0 A;  3CUQ B;  1ON2 A;  3U9G A;  1TLH B;  5IT9 Z;  1BOA A;  4YFN F;  4ENJ A;  5A2Q K;  4HF0 A;  3J81 Z;  2A3S A;  2QQA A;  5ERI A;  5L3B A;  1Z9C A;  2KIM A;  5K5R A;  4B8X A;  4P96 A;  2LSO A;  5LLQ A;  5L3D A;  5HLI A;  3QP6 A;  1XMK A;  3PQJ A;  3IRR A;  4FX4 A;  4DQ2 A;  2RN7 A;  3P7N A;  1HW5 A;  3WTY C;  3H3U A;  5D5W B;  5DEQ A;  2XIG A;  2F2E A;  4I09 A;  5LBQ A;  3T1B A;  5HS8 A;  3V8K A;  4ZYD A;  1YIO A;  1G3T A;  2KIF A;  2DBB A;  2A61 A;  3D0S A;  1PDN C;  4A12 A;  4LLN A;  1KYW A;  1FX7 A;  2E1C A;  1GXQ A;  3J80 Z;  2DT5 A;  2A6H F;  1P4X A;  5BS6 A;  4G9Y A;  3FZV A;  1EV7 A;  1KQ8 A;  4UNO A;  2STT A;  2W57 A;  3DQV C;  3KET A;  4U0V A;  4WCG A;  2XAQ A;  4RAY A;  1A04 A;  2XRO A;  1BC8 C;  4KN4 X;  1Z1D A;  1AOY A;  1O7L A;  4P9F A;  1FC3 A;  2Z3Y A;  3C18 A;  3O2P E;  4U0W A;  3QU3 A;  4KIF A;  3V7S A;  4M9X A;  1CF7 B;  4AVP A;  4M9S A;  5DUK A;  4EGY A;  4EJU A;  5D6E A;  2BBY A;  3ELK A;  4HV6 A;  2FNA A;  2MBF A;  2PI0 A;  4HQM A;  1FLI A;  2P5V A;  3ZPL A;  2UXX A;  1HXD A;  3KP2 A;  4OIQ F;  3DEU A;  3WTT C;  2IA1 A;  5DCF A;  1HW1 A;  5AIP A;  1ONV A;  1SMY F;  2HZT A;  1Z7U A;  4U7D A;  2H09 A;  2PG4 A;  1ZAR A;  2OQR A;  4ZZD A;  1Z6T A;  3B73 A;  3J7A O;  1TQI A;  1QPM A;  4RB1 A;  4S04 A;  1U2W A;  4M6Y A;  2ZBK A;  2YU3 A;  2DQR A;  2QBY A;  4CO8 A;  4ON0 A;  4ENK A;  4BHP A;  2QLZ A;  2EFQ A;  3V7C A;  1ZLK A;  1XDS A;  3U2R A;  3GZ6 A;  3FMR A;  3HUG A;  3M9A A;  3M8E A;  1HKT A;  1Z91 A;  4KMU X;  3ROU A;  2RNJ A;  1H9G A;  3E5U A;  1KU3 A;  6PAX A;  1KGS A;  4ZYE A;  3LAP A;  1P4W A;  4BAY A;  1J0R A;  2EV6 A;  4L5I A;  2FF4 A;  1ZHF A;  1P4A A;  5ILU A;  3T8T A;  5CJ9 A;  3O3K A;  3FM5 A;  2JTV A;  1RIO H;  2QQB A;  4L9V A;  4LK0 F;  4I01 A;  1G4D A;  2QZ8 A;  1TBX A;  4P9U A;  1F9N A;  4HBL A;  1U5T A;  1T39 A;  5E18 F;  4LG0 B;  2H6B A;  3L09 A;  3BOQ A;  2O0Y A;  1KU7 A;  1L0O C;  5K5O A;  1O3R A;  1LEB A;  5E1X A;  1O7F A;  4OMZ A;  4FHT A;  1Z6R A;  1LNW A;  2NAZ A;  2FOK A;  2G7H A;  1G3S A;  4YFK F;  3CUQ A;  1FBS A;  3E6D A;  3ECO A;  1RNL A;  4CZZ A;  2NRA C;  4MNU A;  4EV0 A;  3MEX A;  5LHI A;  3PQK A;  2IW5 A;  2K27 A;  1MDM A;  4Q5S F;  3MFK A;  3T8R A;  3CUQ C;  5HS7 A;  2Y75 A;  3REO A;  3DF8 A;  2B0L A;  2HWV A;  2DFI A;  4RAZ A;  3VB2 A;  3C7J A;  3SXY A;  1IN6 A;  1XSV A;  4A5M A;  4BHB A;  1CF7 A;  2M1B A;  3SZT A;  1MJB A;  3I4P A;  4I7H A;  1REP C;  4BH9 A;  2A6E F;  4HX7 A;  2RC4 A;  3GFI A;  1JGS A;  2BEO A;  2JT1 A;  2KKO A;  3J80 K;  4O3M A;  4G6Q A;  3KZZ A;  2P8T A;  3ZQ7 A;  2CSO A;  1ZGJ A;  4Z2Y A;  1SD7 A;  3DP7 A;  3F72 A;  1NHA A;  1K78 A;  1BIA A;  4OOI A;  3FHZ A;  4XLP F;  4PDK A;  3BJO A;  4KT5 C;  1ZG1 A;  4PZJ A;  5DD8 A;  4LD5 A;  2VOO A;  1BM9 A;  5TRD A;  5D4R A;  4RB0 A;  2GXB A;  5FLX Z;  2DAO A;  1KA8 A;  2CQK A;  2HFH A;  1K7A A;  1W7P A;  4HOB A;  4B09 A;  2G7U A;  4MEX F;  2L01 A;  3J81 K;  5CVU A;  4RB2 C;  2MD5 A;  3E97 A;  2LDU A;  1YG2 A;  3MAJ A;  2HQR A;  1HQC A;  4IRI A;  2EK5 A;  2Y0M A;  3F8C A;  5HLH A;  4CYD A;  4GXO A;  1STZ A;  3RIR A;  5CLS A;  4EJW A;  4PGH A;  5D8L B;  4LMY A;  2VN2 A;  1J7K A;  2COM A;  1USS A;  4NHJ A;  3EUH A;  2K4J A;  1RI7 A;  5AON A;  3HIF A;  1YS6 A;  5E8I A;  3GYH X;  2FA5 A;  5H6Q A;  3WG9 A;  4UUV A;  2M5W A;  2VXZ A;  1DPU A;  2Z9O A;  2HKX A;  2A5Y B;  2HTS A;  2O03 A;  2V9V A;  1QBJ A;  1FP1 D;  2OZ6 A;  2R7F A;  5LRS A;  3FXU A;  4RB3 C;  2QBY B;  3BJA A;  1SFX A;  4LB6 B;  1I5Z A;  1JHH A;  2DPU A;  1R00 A;  1S7A A;  3HTU A;  3MWM A;  1HKQ A;  5AIQ A;  5E8G A;  2K7L A;  4EJO A;  5HOO A;  3ABT A;  1IN7 A;  2O61 A;  3WTV C;  1UFM A;  1DUX C;  4L18 B;  4A0X A;  5LGT A;  2RQP A;  4A6E A;  1JHF A;  4HF1 A;  3LA7 A;  3IHU A;  3WGH A;  4Q47 A;  4HDU A;  3Q9V A;  1T98 A;  3WTS C;  1ODD A;  3QP5 A;  3TKY A;  4P5O A;  5JI6 A;  3HRS A;  3IWF A;  2IT0 A;  3F8F A;  5DCM B;  2DPD A;  4CGZ A;  5D5V B;  1FSH A;  4BYY A;  2L4M A;  3DFG A;  4G8X A;  3VOD A;  4A5N A;  3F22 A;  1OMI A;  1TNT A;  2HS5 A;  2XUB A;  1HBX G;  3I54 A;  5LRR A;  1FWZ A;  4A2U A;  2ELH A;  2HR3 A;  3LWF A;  1J2X A;  2VC1 A;  4A0Z A;  2XRN A;  2VE9 A;  4UHT A;  4UV9 A;  2P7C B;  1R5G A;  1SD5 A;  3C1D A;  2V1D A;  4KN7 X;  2IVM A;  3ZP5 A;  2CFX A;  1XCB A;  1YW9 A;  2FRH A;  1YFH A;  3HSR A;  2DO7 A;  1IXC A;  2STW A;  2J5P A;  3WTX C;  2Q2E A;  1SAX A;  3FX3 A;  3CJN A;  1ZRE A;  1WI9 A;  3JAM Z;  1BI1 A;  3HTS B;  2DW4 A;  2P5K A;  1BI0 A;  4HLY A;  1U6G A;  5HDG A;  3ZMV A;  4IF4 A;  4TV7 A;  3JSO A;  4EJT A;  2MLK A;  1B9M A;  1JE8 A;  1WRJ A;  5JVT A;  4HV5 A;  3KP4 A;  3ZMT A;  4QWQ A;  3SFZ A;  1FBQ A;  1U8R A;  2D45 A;  2P5L C;  5DYM A;  2XV4 S;  1ZGA A;  4Q48 A;  2OAZ A;  2O3F A;  2OU2 A;  3V8L A;  2XAH A;  1FYK A;  1PUE E;  2FBI A;  2YX4 A;  1YW7 A;  1DPR A;  3GO5 A;  4Q4Z F;  1BN5 A;  2XAG A;  2QYO A;  5CVV A;  5F64 A;  1BBY A;  3HSF A;  1XSD A;  1IRG A;  5D6F A;  1FPQ A;  3F21 A;  3QPT A;  3G73 A;  1XSX A;  4BHC A;  4UVB A;  3GF2 A;  1O3Q A;  3E3V A;  4OU0 A;  4U88 A;  4XLN F;  4HQE A;  3IKV A;  5FB2 A;  3GUD A;  5BMZ A;  2ESN A;  5FD5 A;  4RS8 A;  2ETH A;  2HQN A;  3FF5 A;  2QWW A;  1D8J A;  3EQL F;  2EV5 A;  1OR7 A;  1MGT A;  4L5J A;  3K9T A;  3GXO A;  3D5L A;  2QUF A;  2CO5 A;  1HKS A;  4LK1 F;  3Q9S A;  3F8M A;  3DV8 A;  1UHW A;  3DPL C;  1ON1 A;  1R1U A;  5F6F A;  1LDJ A;  1I1G A;  4YFX F;  4ETS A;  2R3S A;  1H9T A; 
#chains in the Genus database with same CATH topology
 4XLH A;  4UXN A;  2JWT A;  3BZC A;  1SFO J;  2NS7 A;  4UB8 C;  4XR6 A;  3Q3S A;  1O4X A;  1J75 A;  1Z21 A;  1QHH D;  2GZW A;  4I98 B;  4BJ5 C;  3I58 A;  5F0H A;  2LH9 A;  2A07 F;  2OQG A;  1MW7 A;  1N75 A;  1LUJ B;  4HW0 A;  2M8G X;  4ANJ A;  3HOY J;  4F92 B;  1Z05 A;  2X4H A;  1VQK I;  5LHG A;  3IC7 A;  3FM3 A;  3M8J A;  3HOW J;  4A3I J;  4KFC A;  1ZKG A;  3R0A A;  3CO6 C;  4HPQ A;  2LRD A;  3ZCO A;  1IJW C;  1YI2 I;  4HYE A;  1WQ2 A;  2M7A A;  3IH4 A;  1KU2 A;  1TWG J;  3ABK H;  4ESF A;  3PIP F;  3CMY A;  3COA C;  2DU9 A;  1VQO I;  4GDF A;  4IKF A;  2MC3 A;  1OQY A;  2V9P A;  4M9Z A;  1K78 B;  4S05 A;  3H1C A;  3ZQI A;  2AQE A;  3RJP A;  2M45 A;  1UB9 A;  1J9I A;  2RRE A;  1Q1H A;  1I6X A;  1E3O C;  3TDU C;  3W6V A;  4M72 A;  5BPD A;  1ETV A;  3G2B A;  5HLG A;  4YEL A;  3RKX A;  1IZ1 A;  2EQR A;  2LD5 A;  2CV2 A;  2WAQ N;  2OCE A;  2RAE A;  1JKQ C;  1FOY A;  2LF7 A;  2KL4 A;  2PMZ N;  1WFX A;  4L9T A;  2EB7 A;  2FE3 A;  2Z5U A;  4L9J A;  3VYU B;  2R0Q C;  1T95 A;  3CDH A;  3EYI A;  4NUB A;  4ZYH A;  2RDP A;  2IS1 A;  1BR4 A;  2PMH A;  5LHH A;  1S72 I;  4GYG A;  4WWC A;  4I2O A;  3E0J B;  4CCL A;  2IGO A;  2J5O A;  2WB1 A;  3LA2 A;  3VPR A;  1G6N A;  4QSH A;  4RGX A;  3GZN B;  3E6B A;  2A6T A;  4NQW A;  2MLG A;  3RYP A;  2EFP A;  4XRS A;  1B6A A;  1VQN I;  4KIS A;  1MBK A;  2VE8 A;  4RAF A;  1R7J A;  2P6T A;  1X4O A;  2P81 A;  3JTG A;  1GXP A;  1FOW A;  2E2J J;  3HHG A;  3AL0 C;  5JFR A;  5ICE A;  3H5N A;  3QYF A;  4BNC A;  2EFW A;  4A6D A;  4RM2 A;  5H6R A;  4BJ6 C;  1S7O A;  3HOZ J;  1XN7 A;  1TTY A;  2FMY A;  2LTP A;  1SC7 A;  2FU4 A;  3ZQQ A;  5L3E A;  2VKV A;  4IHW A;  3S2W A;  2M4K A;  1FNN A;  2CW0 F;  2AQF A;  3H92 A;  1TW3 A;  3JRF A;  1F5T A;  4XLF A;  5LGU A;  4PJM A;  4IQJ A;  1DU6 A;  1XD7 A;  3IKT A;  3HHH A;  2R7T A;  2MA3 A;  2ACJ A;  5FGM A;  3KZI C;  3KE2 A;  2IBD A;  3ABU A;  4KIT B;  3HRT A;  1MD0 A;  2LOO A;  1LPQ A;  3TDZ C;  2ZXI A;  3DU6 A;  5EZH A;  1TWA J;  1SVO A;  3SFI A;  4CH7 A;  4XRM A;  2OC6 A;  2D1V A;  1GHC A;  4BUP A;  1UEL B;  3EDP A;  2LKP A;  3I59 B;  1J09 A;  1S7E A;  1T2K A;  3L2R A;  1ITY A;  1E2X A;  2CW8 A;  3HOS A;  1BI2 A;  2OTJ I;  3ZQH A;  4ESJ A;  2D2W A;  3FDY A;  2VKD A;  1YTY A;  1LE8 A;  1V5E A;  2IGK A;  3TO7 A;  2VBW A;  4UV8 A;  5FKM A;  2QF7 A;  4RM3 A;  1FMV A;  3LFK A;  4CA0 A;  2XAF A;  1MH3 A;  2GA1 A;  2IA2 A;  3MCZ A;  2E1O A;  2UWM A;  4I0B A;  3JCU C;  1IAW A;  1ZRD A;  4C3H J;  1ZG5 A;  3GTO J;  3I0T A;  3G4S I;  3BTJ A;  1SEU A;  2MD0 A;  3B02 A;  5BPI A;  3BQZ A;  2CG4 A;  2C6Y A;  2DMP A;  4M71 A;  3FXO A;  4KIC A;  3OYA A;  2O8X A;  4BAC A;  5C4J J;  2HDC A;  3GLL A;  5FJ8 J;  1T38 A;  3RKW A;  1IUF A;  1FZP B;  4XLA A;  1WKM A;  1O57 A;  4YG2 F;  2K5C A;  3VYT B;  3W3C A;  5E3O A;  3HRM A;  1T0F A;  2QSF X;  3ASN H;  1UST A;  3FXR A;  3H5A A;  3JRB A;  1DU0 A;  5JLW A;  2E7W A;  2OUM A;  4IHS A;  3RTR A;  1U0J A;  3I64 A;  1W0U A;  4OIP F;  2HYF A;  2KIU A;  1MMD A;  2EWN A;  1GV2 A;  3N05 A;  2FNP A;  1YIJ I;  3R0J A;  5GP9 A;  3HEF A;  3ZN0 A;  1ZRF A;  3TGN A;  2L4A A;  3BR0 A;  3L9F A;  2M3A A;  3ZMU A;  2LC2 A;  2CYY A;  3IH2 A;  1DP3 A;  2BHZ A;  3I4M J;  4HZF A;  4OIR F;  2JRM A;  5B5E C;  2XKP A;  1N77 A;  3LSH A;  4HST A;  4CCJ A;  5CVI A;  2PLY A;  1R4N B;  2XB5 A;  3KX2 A;  4PGG A;  5FLM J;  3E6M A;  2FML A;  3GLX A;  1KU9 A;  2PMU A;  1A6I A;  3LMM A;  4DNC A;  3A01 B;  1YRN B;  2XKO A;  1MBF A;  1YW8 A;  1RC9 A;  4E70 A;  3NAU A;  3T5X A;  2DTR A;  2GQQ A;  2VC0 A;  4B48 A;  3LAJ A;  3OV8 A;  3ZQC A;  3M4O J;  3E7L A;  3GTG J;  3E5X A;  1GVJ A;  4PJJ A;  4G7O F;  5F0C A;  1GUU A;  4N4N B;  1I3A A;  1UG0 A;  3LSK A;  1WH7 A;  5IP9 J;  2XAU A;  3JTH A;  3LSP A;  1J59 A;  2TDX A;  4YIF A;  3W6K B;  2VBZ A;  3C3W A;  3R60 A;  2W48 A;  2IRF G;  2CQN A;  3SDB A;  1YJN I;  3K4C A;  2CV1 A;  4GGG A;  2M34 A;  4IL6 C;  2FQ3 A;  4EAT A;  1IN4 A;  2AXL A;  3CME I;  2XAJ A;  2RGV A;  2B9S A;  2JQ7 A;  3ZMZ A;  2GAU A;  2PJP A;  2MYS A;  2QGU A;  5HNF A;  3OS1 A;  2HXO A;  4WXD A;  2DQL A;  3CTA A;  5C4X J;  1KQ9 A;  2WB1 N;  3OSF A;  3BG7 A;  2V1U A;  2EA2 A;  2CGP A;  4KIB A;  5J1U A;  3QPH A;  4WF2 A;  3SEQ A;  2IPQ X;  4BDZ A;  2W25 A;  4JP0 A;  1ZR2 A;  4GRI A;  1SD6 A;  1UHM A;  3NRV A;  2PBI A;  3H35 A;  3OYH A;  2Q2E B;  3A02 A;  4H0E A;  3BZ6 A;  5LD2 C;  2PQ8 A;  2HDD A;  2L7K A;  4BQO A;  2EIJ H;  1FMW A;  1W5T A;  3RDI A;  2QVO A;  1ULY A;  3K70 D;  4MTE A;  3LSI A;  3L7W A;  1HSJ A;  3JW4 A;  2DYR H;  3WU0 A;  1H0M A;  2X1E A;  1V5F A;  1UZC A;  4RLF A;  4IZZ A;  2CV0 A;  4JX5 A;  3R61 A;  3T0Y A;  1RUO A;  4R8H A;  3AG1 H;  2WC2 A;  3CP8 A;  3U21 A;  2Z16 A;  4AIJ A;  1LE8 B;  2HKO A;  2BGC A;  3G3Z A;  3TP0 A;  3S2D J;  1AWC A;  3C2B A;  2FEZ A;  3CZ6 A;  2DTZ A;  1WI3 A;  4BXU A;  3S3N A;  2IJL A;  2V6E A;  2LR8 A;  4G12 A;  2K4B A;  2LBF A;  2OD5 A;  3EYY A;  4HG2 A;  2R7Q A;  2M0M A;  4ZYA A;  4NB5 A;  4D5C A;  1V5G A;  2M30 A;  1I27 A;  1YIT I;  4N9I A;  3BPV A;  3I5U A;  2K9Q A;  5D5X B;  3LA3 A;  3JRE A;  3ZQL A;  1SVM A;  2Q0O A;  2H94 A;  1ZYR F;  1JKO C;  2BYV E;  3Q0W A;  1QZY A;  4HLX A;  4V2G A;  2DXI A;  2ELK A;  2X0L A;  5FRO A;  4F52 A;  3A0B C;  4I02 A;  3R6S A;  3RPU A;  2FXA A;  5JHF A;  5FO5 A;  2ME0 A;  3KLO A;  5E1Z B;  4W97 A;  1XC5 A;  3HYI A;  3F6V A;  4KUM A;  2LNB A;  3F8B A;  2HTJ A;  2VON A;  4Y4R A;  4LLL A;  2VT2 A;  4RGS A;  3L2U A;  5DS9 A;  1YX5 A;  2DFF A;  4XLC A;  2R92 J;  2VOP A;  2V9K A;  3G71 I;  2UZK A;  2BY3 A;  2N8G A;  2VQG A;  4R79 A;  2E5N A;  4D0P A;  1I1S A;  3ERE D;  3K4J A;  2PN6 A;  3BP8 A;  3L00 A;  4GO1 A;  2DT6 A;  3E1S A;  1R1T A;  2M87 A;  3C2G A;  4A3J J;  4LFU A;  1U5T C;  3FXM A;  1VFC A;  2HVR A;  2RV8 A;  4BEH B;  3U1D A;  3TW6 A;  2HYG D;  4ZYG A;  2P4W A;  5C44 J;  2LKX A;  3ZRG A;  3F3X A;  3VFZ A;  1H89 C;  2WWY A;  1JKP C;  4AIK A;  2QM3 A;  2DFH A;  3O8H A;  4DYQ A;  3OS2 A;  1A5J A;  1F36 A;  3BWG A;  1X58 A;  2D1H A;  2H1L A;  3CQZ J;  4ESB A;  1SFE A;  1IN8 A;  3R4K A;  4LOC A;  1TW2 A;  5DD4 A;  1FYL A;  4JBA A;  2HNH A;  5K7H A;  4CYC A;  2ZXJ A;  2EA4 A;  2V7F A;  2JSC A;  1ZK8 A;  4MEY F;  4EGZ A;  3DTK A;  4N9H A;  1L3L A;  2BXY A;  2R5Z B;  2BW3 A;  2Z1D A;  4MQV A;  4F7Z A;  3DPU A;  2QCO A;  4AVZ A;  2X51 A;  3DKW A;  2ZFW A;  3JR9 A;  5B3S H;  4XOT A;  3TOB A;  1W36 C;  3S32 A;  4RGU A;  3GX4 X;  3M8F A;  5JHU A;  1C0W A;  3A4C A;  3PUB A;  1Z0X A;  4JOM A;  2FBK A;  2VQL A;  2E2H J;  3GZ5 A;  3BRO A;  1T08 B;  3A2K A;  1I6H J;  1VQ8 I;  3AFH A;  3QYE A;  1KYZ A;  3K4L A;  1P6R A;  3FXQ A;  4CDG A;  2W4S A;  4PSX A;  5FKK A;  1ETK A;  4XOR A;  5L3F A;  1QQI A;  3IL2 A;  1QVU A;  2VQH A;  4ZC3 A;  1MJA A;  2CU7 A;  3HSE A;  2L3D A;  4HSR A;  4UY8 I;  4B43 A;  4XSX F;  3FWE A;  4M3B A;  3I55 I;  2H6C A;  1ZTR A;  2ID6 A;  2UXN A;  2VT3 A;  2XPV A;  3CCQ I;  3PFI A;  5B66 C;  1TL8 A;  5EEA A;  1RUN A;  1Y1V J;  2IS2 A;  3K1P A;  2CRG A;  5H2F C;  1XGS A;  3QRF F;  3IUO A;  1OLT A;  3WGG A;  4F55 A;  5CYV A;  3PL8 A;  3K1M A;  2L5Q A;  3ISP A;  2HOT A;  1X4P A;  2NVU B;  1OFC X;  2E19 A;  3WTU C;  3CO7 C;  4A3B J;  1TZL A;  1QPI A;  3RKY A;  4WX9 A;  2XAS A;  2PX9 A;  1YHQ I;  2QQ8 A;  4EM2 A;  1FTZ A;  2FX0 A;  4UUT A;  2HXI A;  3PNY A;  3WOD F;  4JK1 X;  4XNF A;  3D5S C;  2QSG X;  4UUS A;  3OYN A;  4BE1 A;  3OWT A;  3VEP A;  1WZ2 A;  1OR7 C;  1F43 A;  4IRH A;  1IN5 A;  1G8X A;  4A0Y A;  4QIW N;  4BY1 J;  4X6A J;  2XVC A;  2IP2 A;  1FYM A;  1LDD A;  3J7Z I;  1W7P D;  4IEJ A;  1LDK B;  2XRL A;  2K02 A;  2MH2 A;  5IT3 A;  3WG7 H;  3KYL A;  3TO9 A;  5K7Z A;  1R58 A;  3DTE A;  3HBL A;  1Y1W J;  3HUG B;  3S1N J;  2DA6 A;  5FRN A;  3FMS A;  4BXX J;  3I71 A;  2EIM H;  3G6E I;  1R49 A;  4FQG A;  4M6V A;  3HXL A;  3L2W A;  3FIS A;  2IS4 A;  2CQQ A;  4YII A;  2BVM A;  1HCR A;  1X3W B;  2IGM A;  3KP6 A;  3CCJ I;  4DBR A;  3FXK A;  4BGD A;  1RRJ A;  1QGP A;  2Y48 A;  4NQW B;  1ZAO A;  3DU5 A;  1VQL I;  2PEX A;  4ZH4 F;  1YLF A;  1EH8 A;  3BR5 A;  3ZMD A;  2V1N A;  1GDT A;  1Z7L A;  2KIQ A;  3IH3 A;  2O8K A;  2V4J C;  3MZY A;  2M9H A;  1W5S A;  1F4K A;  1RKW A;  5JR3 A;  1B9N A;  1FT9 A;  4M73 A;  4Y7N J;  3K2Z A;  1PUF A;  1B4A A;  3NEU A;  3IRQ A;  4LB5 A;  2K9S A;  2YX7 A;  2GXA A;  1TWF J;  2BVL A;  4HNV A;  3BR3 A;  2KRC A;  1BW5 A;  1FSE A;  2G9W A;  4YEJ A;  4ZTJ A;  2FSW A;  1NH3 A;  2GA2 A;  5F04 A;  2EZK A;  5ICG A;  4C3I J;  4A3G J;  3OOU A;  1OYY A;  3UNG C;  2ZNZ A;  3OL3 A;  1MMS A;  3ESW B;  5FKO A;  5LEJ A;  3TL4 X;  5FLV A;  2MC4 A;  4N4O B;  3K7A J;  1VQ9 I;  1XCV A;  2W84 A;  4ENM A;  4IJA A;  2L54 A;  2KDO A;  3AG3 H;  3J7Y J;  3JAM K;  2FJ1 A;  3F6O A;  2E7X A;  4DOZ A;  1BI3 A;  2X9D A;  4DJA A;  2Z99 A;  5EEG A;  1B1B A;  4M3F A;  4LJZ F;  4A69 C;  3I59 A;  2LYC A;  3A0H C;  1X2M A;  2WBM A;  3KP7 A;  3OYD A;  1IRX A;  2HGC A;  2YPR A;  5L3G A;  3RPQ A;  4BE2 A;  4Y15 A;  1PP8 F;  2FD5 A;  1ZH5 A;  5DDG A;  3SZP A;  4KDP A;  1IDZ A;  2ZJQ F;  2O6G E;  1W4M A;  3GVA A;  1G3Y A;  5FKL A;  3OR2 C;  3K69 A;  2E71 A;  4GYI A;  4G6D A;  2A69 F;  2ID3 A;  1AHD P;  1TT0 A;  1LEA A;  1R22 A;  1UMQ A;  2W24 A;  5KVR A;  5FD6 A;  1WSU A;  4D9J A;  2L0K A;  1AU7 A;  1XGN A;  5EEH A;  2K9M A;  3MKL A;  4G7Z F;  1HA8 A;  1SVL A;  2JPC A;  1P2F A;  4KYW A;  4HDV A;  3JSP A;  5BOX A;  4II2 A;  5HDK A;  2OJE D;  2M0C A;  4L9N A;  2GIV A;  3RI4 A;  4RDU A;  1OYI A;  4OIO F;  1V54 H;  3LSR A;  4L5E A;  2DMT A;  3MQ0 A;  3FMQ A;  1YRN A;  1Z3Y A;  4XN3 A;  3DEE A;  4BJT A;  3ZXS A;  3IWZ A;  3TOA A;  2JMW A;  1S3J A;  4M6X A;  3QU6 A;  5HS9 A;  3KEY A;  2R5Y B;  1P92 A;  2LLK A;  3SDG A;  1MDM B;  3E6C C;  1Z77 A;  1X3U A;  2F5D A;  2JA8 J;  2L02 A;  5F1R A;  4WK8 F;  3TW7 A;  3DCF A;  1X19 A;  1ZG3 A;  2JJ7 A;  3IAS 2;  2KJC A;  4CUG A;  3WGI A;  1R5I D;  2O7O A;  1OCR H;  3GWZ A;  5HVQ C;  3NWT A;  2XHK A;  2JSP A;  1MBG A;  2L2O A;  3EPZ A;  3EUA A;  3ULQ B;  2WY7 Q;  1BC7 C;  1QRY A;  2P6S A;  3GTL J;  2Y9Z A;  2EJR A;  2OTL I;  4LIT A;  1YQA A;  3LSM A;  3L2C A;  2Q8K A;  4XRF A;  1FJL A;  2WAF A;  3OYG A;  4B4C A;  1B8I B;  5A2Q Z;  2DK8 A;  5TJJ A;  2WV1 A;  3P9C A;  2E2I J;  2BOL A;  1OYW A;  2L7Z A;  3M7G A;  2VKE A;  1UCR A;  3N4M A;  2H27 A;  2F5F A;  3O6B B;  4E7Z A;  1TQP A;  4MHG A;  4O6J A;  3BG6 A;  1W7P B;  3QPS A;  5EJC A;  5L3C A;  1FOK A;  5CVR A;  1RR8 C;  3AG2 H;  3H9J A;  3OS0 A;  1D8K A;  4U0Y A;  4S0H B;  1MSE C;  3CC4 I;  3BDD A;  2W00 A;  4YRV A;  3GEZ A;  3N97 A;  5IOZ A;  3CLO A;  3A01 A;  2WAD A;  1G3W A;  2VKH A;  1ZLJ A;  3PUF A;  1OJL A;  4Y52 J;  1YX3 A;  3PFY A;  4XSZ F;  4Y33 A;  4XON A;  3QOD A;  3JRC A;  4D5F A;  2CJJ A;  4OMY A;  1X2N A;  3BC8 A;  5CVJ A;  2XB0 X;  1Y39 A;  2MAB A;  2HEO A;  1LB2 A;  4XLE A;  4ZZL A;  3QWL A;  5ILV A;  2GWR A;  3DXJ F;  2X1C A;  4P1W A;  5TIS C;  3G1L A;  1DP7 P;  3ZN1 A;  1WWX A;  3PNV A;  4BEH A;  1K83 J;  1TWC J;  2EFO A;  1X1D A;  3F8N A;  2ECB A;  3KCC A;  1XX5 A;  1S8N A;  5HLT A;  4A3M J;  3ECH A;  4IHY A;  4KMF A;  5M3M J;  1SAN A;  4I99 C;  1U3E M;  4D1Q A;  2JN6 A;  3CDL A;  2ICW G;  2WV0 A;  2MGQ A;  2X6W A;  2ISZ A;  2IS6 A;  2E1N A;  3LSJ A;  4DZJ A;  2XPW A;  3E5Q A;  2R7Z J;  2KPM A;  2Y69 H;  4R1H A;  2CUZ A;  5KK1 A;  1EH7 A;  3S15 J;  2KJB A;  3FK7 A;  4KJZ A;  2ME6 A;  1K79 A;  2CWE A;  2QEX I;  1MKM A;  3BG3 A;  5ICC A;  3MKZ A;  3RZO J;  1SD4 A;  2FBH A;  1P9Q C;  2P0W A;  2WTE A;  4N0B A;  3LQR A;  2ZSI B;  2JRT A;  4HF2 A;  3EET A;  1O3T A;  1U9O A;  3RQ4 A;  4IPA A;  5DV5 A;  2V6C A;  3CP2 A;  5D5U B;  4Y3O A;  4EJV A;  3LST A;  3MVP A;  3TO6 A;  3V7R A;  2KLO A;  2XSD C;  1IF1 A;  5IT9 K;  2DA3 A;  3KP3 A;  5EDN A;  2R7S A;  1OCP A;  1K4S A;  4HX8 A;  2OA4 A;  2HU9 A;  4G94 A;  4BQA A;  5E3L A;  2R7X A;  1XMX A;  2KQR A;  1XG1 A;  3BTL A;  1FP2 A;  4PK4 A;  3CJR B;  2K3F A;  2VJ5 A;  3KP5 A;  4GCV A;  1BIB A;  3HRU A;  4LGW A;  4UVA A;  3GTK J;  1LFU P;  3KPH A;  3MN2 A;  4MQ9 F;  5DM7 F;  2GLO A;  1YO5 C;  2JA7 J;  3DBL B;  2VL8 A;  3WU2 C;  1FTT A;  2HPM A;  4E7L A;  4M74 A;  2YUS A;  3NWS A;  2LKS A;  4MGR A;  3AL0 B;  1Y0U A;  2YR2 A;  1MBJ A;  1BL0 A;  1MZB A;  4K2E A;  4HA8 A;  3V4G A;  3AAF A;  4XM3 A;  2ZXW H;  2BV6 A;  3KLN A;  4P55 A;  4IXA A;  5H20 A;  1FY7 A;  4WXC A;  4EQQ A;  2NS8 A;  4A93 J;  1IXS B;  3BPX A;  3MKW B;  2I10 A;  3W6J B;  5FKN A;  2JZY A;  3VYS B;  4XIC A;  1CGP A;  3GFL A;  4UB6 C;  5FRM A;  2KP6 A;  2W1O A;  5CPR B;  5EZG A;  4A3D J;  4XID A;  2W7N A;  2ZME B;  3BG9 A;  5EGO B;  3F23 A;  2F5E A;  2A68 F;  2OBP A;  5ILS A;  1IXR C;  4MTD A;  4KIG A;  5EGO A;  3KZY A;  2HDW A;  3FXL A;  4IHT A;  1HW2 A;  3V8J A;  5J6X A;  5EF6 A;  4FTH A;  3HDD A;  2A05 A;  5IOY A;  1KON A;  1N25 A;  1QZZ A;  2Y31 A;  3OOP A;  1F1Z A;  5E17 F;  4BS9 A;  3EUK L;  1U9N A;  2JPB A;  4W1U A;  1BJZ A;  2ZNY A;  3KFW X;  2CQX A;  1S9H A;  3ZMS A;  3OYM A;  2DLL A;  1LJ9 A;  4JQF A;  4RGR A;  3OIP A;  1KQ0 A;  2KRF A;  3NQO A;  2RVC A;  2VOD A;  2VPL A;  4RA2 A;  4KNY A;  3CJT B;  2BE5 F;  1V3F A;  2NYX A;  4FT8 A;  1HDP A;  2ZCW A;  4IX7 A;  5E3M A;  3RSN A;  1ETX A;  2V79 A;  5K5Q A;  4D7N A;  3WE2 A;  1FIP A;  1MMG A;  4PCQ A;  4ZTF A;  2VUM J;  3MZH A;  2GXG A;  1R71 A;  4UVC A;  2DK5 A;  2Y30 A;  1U78 A;  2HOE A;  3KEQ A;  3BJ6 A;  5FFZ A;  2BY2 A;  4BQQ A;  2L7M P;  3I53 A;  4BXF A;  1ZRC A;  2VPR A;  3WTW C;  3ZGK A;  3OYF A;  3QOP A;  1T33 A;  2VAS A;  4LLG F;  1XB4 A;  2Q1Z B;  5LEK A;  3K0L A;  3CF5 F;  1O3S A;  3M3Y J;  2E5Z A;  2AS5 F;  4AU7 A;  3GFM A;  3DPT A;  4LIU A;  2IGN A;  4AYB A;  2Y0S A;  5E20 A;  1VQ6 I;  3ABM H;  3GW2 A;  2EIN H;  5KAI C;  1R5H A;  3VWB A;  5E79 C;  3SQN A;  3K4B A;  3NAR A;  4CXF A;  5F08 A;  3EUH C;  3HOT A;  2NS0 A;  2NOJ B;  2V1X A;  3P9K A;  1ORK A;  3DBH B;  1B59 A;  1HST A;  3B6A A;  3GFJ A;  1N78 A;  2MH9 A;  2YS9 A;  4FX0 A;  4ASN A;  3Q5F A;  3BR1 A;  4BL0 B;  2XGX A;  5D8K B;  3LQQ A;  3ML6 A;  2W82 A;  3K2A A;  4XKV A;  4L0Z B;  1PYV A;  1QVT A;  5KHD A;  2NNN A;  4CIC A;  1YJW I;  1MJ9 A;  3K1N A;  1EH6 A;  4KA4 A;  5DCM A;  2R7D A;  4XKC A;  3RZD J;  1OKR A;  2EZL A;  5DTD A;  1BJA A;  1R6R A;  3SZG A;  2ESH A;  4QPO A;  1PP7 U;  2BHY A;  1MSF C;  1J5Y A;  2M2E A;  1YJ9 I;  1S29 A;  4V2F A;  1ZQ3 P;  1IRF A;  2ZKZ A;  1IUY A;  3CUO A;  3VOE A;  4L0Y B;  3SHF A;  2M8E A;  1IGN A;  2K9N A;  2ZB9 A;  2ISY A;  2MFZ A;  3BY6 A;  4XKW A;  4Y13 A;  4HAM A;  4G7H F;  3ZQF A;  3BQY A;  3J7A Y;  3TQN A;  2ZO4 A;  4F93 B;  4I0A A;  4C30 A;  2PMZ A;  2VBX A;  4FE4 A;  3ONQ A;  2P7V B;  3H3Z A;  5EG0 A;  3FBI B;  2L9V A;  2M4G A;  4ZDL A;  2ZJ2 A;  1XGO A;  3LSG A;  1YE9 A;  4CCO A;  2YSR A;  4OIN F;  5BNG A;  2EPF A;  4AD9 A;  2NNY A;  1YS7 A;  1QU3 A;  3CCV I;  5E1W A;  4EM1 A;  1OCC H;  3QAH A;  2BY0 A;  3H9Q A;  2X85 A;  4RMN A;  1ETY A;  1G59 A;  3CLQ A;  5DUI A;  1RES A;  2DA2 A;  1UJ8 A;  5BQT A;  5J40 A;  1YOV B;  1H88 C;  1S6L A;  1JUP A;  2ZME A;  4Y17 A;  1Z3X A;  2DI3 A;  4WXH A;  1QNT A;  1YYV A;  3PSF A;  5K1Y A;  1T6S A;  1IW7 F;  2Z33 A;  1SMT A;  1R1V A;  2QEN A;  2EFN A;  2W85 A;  3VDX A;  1AKH A;  1V4R A;  5D4S A;  3HL2 A;  1QZE A;  2OV7 A;  1ZN2 A;  1U5T B;  4OAY A;  3U1K A;  4QLC U;  1JXS A;  1E17 A;  3K6G A;  5HOD A;  1TNS A;  3KIO A;  5J8F A;  9ANT A;  4CHU A;  3CC7 I;  4EVI A;  2E34 A;  4XN0 A;  2RKH A;  1OPC A;  3DKY A;  5J8C A;  4MLO A;  3P9I A;  3BR6 A;  2BY1 A;  2VBY A;  4U7B A;  3V42 A;  1RZ4 A;  1M1E B;  2IXS A;  5FFX A;  4EMS A;  1K6O A;  1ENH A;  1D3Y A;  3BTC A;  3S1Q J;  4E6K G;  1KZH A;  1XDU A;  3WTZ A;  5LGN A;  4QPQ A;  3LNQ A;  1D5V A;  1VTN C;  1GV5 A;  2QQ9 A;  4O5V A;  3FKJ A;  4AIH A;  4AID A;  5HDN A;  1WJA A;  4IRG A;  2GIZ A;  2HQ5 A;  3RYR A;  3CCS I;  1DDN A;  2DDB A;  3WU1 B;  4HX4 A;  3FK6 A;  2BXZ A;  5JVG F;  3HKZ N;  1XGM A;  3WE3 A;  2PFB A;  1AKH B;  1LQ1 A;  1JT0 A;  3M1E A;  2HVS A;  1WPK A;  2JA5 J;  3Q0U A;  4IVN A;  3H3V K;  2IA0 A;  4EM0 B;  4IQ4 A;  4XBF A;  4ENN A;  3HC7 A;  4XMY A;  2OPT A;  3CC2 I;  1XMA A;  2ADU A;  5ICF A;  2VXD A;  3GME A;  5ED4 A;  5FLX K;  1FBU A;  2F5C A;  2K86 A;  4HNU A;  1R36 A;  4AWX B;  2JUG A;  1GT0 C;  2VJJ A;  2I8D A;  2LF8 A;  2KMU A;  2V26 A;  3DLA A;  1FIA A;  2OZU A;  4E7J A;  1R23 A;  1TQM A;  1VQ7 I;  1LVA A;  1QO0 D;  3RPU D;  3KEO A;  3H9G A;  2R7R A;  3HOV J;  4LG0 A;  2XF7 A;  2EV0 A;  3CUQ B;  3BG5 A;  3HPG A;  4QTR A;  5M5X J;  3BLY A;  2COB A;  4EEF G;  1ON2 A;  3U9G A;  4G6T B;  1TLH B;  5IT9 Z;  1X1B A;  3A03 A;  4M3E A;  1JT6 A;  3IAM 2;  4B47 A;  2JUC A;  1P7I A;  1BOA A;  4PFP A;  4YFN F;  5A2Q K;  4ENJ A;  4HRI A;  4HF0 A;  3BZK A;  3J81 Z;  2ELJ A;  3BTI A;  2A3S A;  2L9N A;  2H8W A;  2QQA A;  1I3Q J;  1ZEL A;  5ERI A;  2NOG A;  4PJL A;  5L3B A;  1Z9C A;  2KIM A;  5K5R A;  3CJQ B;  4B8X A;  1IRZ A;  4P96 A;  2LSO A;  5LLQ A;  5L3D A;  5HLI A;  3QP6 A;  1XMK A;  2F5V A;  3PQJ A;  4BQN A;  1WJD A;  3OIO A;  3IRR A;  4FX4 A;  4DQ2 A;  2RN7 A;  3P7N A;  1HW5 A;  1ETQ A;  5D5W B;  3H3U A;  1MMN A;  3WTY C;  4NBQ A;  2DFE A;  5DEQ A;  4BBR J;  2XIG A;  2F2E A;  4I09 A;  2D5V A;  5LBQ A;  1RKT A;  3T1B A;  5HS8 A;  4MIM A;  1MBH A;  3ASO H;  3V8K A;  3K70 C;  4A3C J;  4ZYD A;  1YIO A;  1G3T A;  2KIF A;  1WJF A;  2DBB A;  2A61 A;  3CMA I;  1X3Z B;  3FIW A;  1B8I A;  3D0S A;  1PDN C;  3JRG A;  2O9L A;  2HVQ A;  4A12 A;  3ZQG A;  4LLN A;  1KYW A;  1FX7 A;  3SYT A;  1JTY A;  2E1C A;  5GPC A;  3CCE I;  3S3M A;  4PUS A;  2X6Y A;  1WCM J;  4B44 A;  1GXQ A;  3J80 Z;  2DT5 A;  3M07 A;  3MKY B;  2XGC A;  4BU2 A;  2A6H F;  1P4X A;  3BT9 A;  5BS6 A;  1APL C;  1Y8Q B;  3OYL A;  1MND A;  4C2U A;  2VQC A;  4G9Y A;  3FZV A;  2ZC2 A;  1BR2 A;  1EV7 A;  1KQ8 A;  4UNO A;  4XKB A;  2STT A;  1TP4 A;  1JGG A;  2JK3 A;  2W57 A;  3DQV C;  3RQI A;  1JUS A;  4AM3 A;  2LY1 A;  3KET A;  5J47 A;  2HZD A;  4BE0 A;  2IAI A;  4U0V A;  4WCG A;  5F0F A;  1E3H A;  3HGG A;  2XAQ A;  4RAY A;  1XS9 A;  1A04 A;  4DIQ A;  5JLX A;  2XRO A;  1BC8 C;  2F4M B;  2LY2 A;  4KN4 X;  4HNT A;  1Z1D A;  1AOY A;  1O7L A;  3CES A;  4P9F A;  2K3P A;  1Y8R B;  1FC3 A;  2Z3Y A;  3C18 A;  3O2P E;  3JRD A;  4U0W A;  3QU3 A;  4KIF A;  3V7S A;  3FXJ A;  2PJR A;  4M9X A;  1FEX A;  1CF7 B;  4AVP A;  2B63 J;  1WJC A;  4M9S A;  1WJE A;  5J4V A;  3LOC A;  3GTJ J;  1IG7 A;  3UKG A;  5DUK A;  2GOM A;  4EGY A;  3CD6 I;  1PVE A;  4EJU A;  5D6E A;  2BBY A;  3ELK A;  2Y9Y A;  1P7J A;  1W36 D;  3PM1 A;  1H8A C;  4HV6 A;  5IYC J;  2FNA A;  2DOD A;  4B3A A;  1MH4 A;  1OCO H;  2MBF A;  2PI0 A;  4HQM A;  1BOB A;  5M5Y J;  1B72 A;  3BCA A;  1FLI A;  2DMN A;  2P5V A;  4XL9 A;  3ZPL A;  2GBY A;  3FBN B;  3OIQ A;  2UXX A;  4B1R A;  3S14 J;  1HXD A;  2QKL B;  2Z2S B;  4D7M A;  3GTM J;  3FKI J;  5KCM A;  3FHN A;  3KP2 A;  1NK3 P;  4AYB N;  4OIQ F;  4FAS D;  3DEU A;  3WTT C;  3OSG A;  2IA1 A;  5DCF A;  1HW1 A;  5AIP A;  3CCM I;  2KRH A;  1ONV A;  1SMY F;  2HZT A;  5KNL A;  1Z7U A;  4U7D A;  2H09 A;  2PG4 A;  2QKM B;  3I3L A;  3KYD B;  3P5J A;  5EYR A;  1ZAR A;  1EJ9 A;  2OQR A;  4ZZD A;  2LP0 A;  1T8I A;  1Z6T A;  3B73 A;  3J7A O;  1TQI A;  2LG4 A;  1QPM A;  4RB1 A;  3HOX J;  4S04 A;  4XQF A;  3CF2 A;  1ETO A;  4CCM A;  5M5W J;  2R7U A;  1U2W A;  4M6Y A;  1NG6 A;  2ZBK A;  2KHM A;  3QPL A;  3OYE A;  2MG4 A;  2YU3 A;  1IV8 A;  2DQR A;  3F9K A;  1SAU A;  2R4G A;  2QBY A;  2DYS H;  4CO8 A;  3DEW A;  4ON0 A;  3K4M A;  4BHP A;  4ENK A;  2QLZ A;  3HG9 A;  2EFQ A;  3V7C A;  1ZLK A;  1XDS A;  2NVX J;  2X48 A;  3U2R A;  2L9S A;  3GZ6 A;  3M1C A;  4JX6 A;  3FMR A;  3HUG A;  2CFO A;  3M9A A;  3M8E A;  1HKT A;  1Z91 A;  4ABZ A;  1HDD C;  1LFP A;  1Y6I A;  2VI6 A;  3HKZ A;  4IOC F;  2KZV A;  4E7K A;  4KMU X;  3ROU A;  4IHX A;  2RNJ A;  2GOX B;  2R7O A;  4IO9 F;  1H9G A;  3E5U A;  1KU3 A;  6PAX A;  4KT6 A;  4J01 A;  1KGS A;  4ZYE A;  3LAP A;  5GAE J;  1P4W A;  4BAY A;  1D0X A;  1J0R A;  2EBI A;  2CW7 A;  5B1B H;  5IY5 H;  3CCU I;  2EV6 A;  4L5I A;  2FF4 A;  1POG A;  2E35 A;  1ZHF A;  4RBO A;  1P4A A;  5ILU A;  2DJN A;  3T8T A;  3F0C A;  1W0T A;  2GM4 A;  5CJ9 A;  2OF7 A;  4DW6 A;  3O3K A;  3FM5 A;  3CCY A;  2JTV A;  1ZGW A;  2G0E A;  4A3K J;  4FIS A;  1RIO H;  2QQB A;  4L9V A;  1NTC A;  4LK0 F;  1K61 A;  2F4O B;  3IP4 B;  1I50 J;  4FE7 A;  4I01 A;  4E7S A;  1G4D A;  2DOF A;  2QZ8 A;  4RAG A;  1TBX A;  4P9U A;  5IP6 A;  1TC3 C;  1Y0N A;  1F9N A;  2RNG A;  2LFB A;  4HBL A;  1U5T A;  2NXN B;  2R5Y A;  1T39 A;  2UV1 A;  5E18 F;  3HM5 A;  5GAG J;  4LG0 B;  3CCL I;  2ECC A;  2DMQ A;  2DOA A;  2L9R A;  2H6B A;  3L09 A;  3BOQ A;  2O0Y A;  1IV6 A;  1KU7 A;  1L0O C;  5K5O A;  3IV5 A;  1O3R A;  3S17 J;  1LEB A;  3WHC A;  5E1X A;  1O7F A;  3OYB A;  4OMZ A;  4II3 A;  5J4Y A;  2XC7 A;  4MO7 A;  4FHT A;  1I39 A;  1Z6R A;  4NNJ A;  1DGW Y;  3SEZ A;  1LNW A;  1EF4 A;  5KAF C;  1UHS A;  1U8B A;  4ZDP A;  2NAZ A;  2FOK A;  1A35 A;  2G7H A;  1G3S A;  4YFK F;  3PSI A;  3CUQ A;  1BW6 A;  1FBS A;  3HPH A;  1ETW A;  2CH0 A;  3E6D A;  3ECO A;  3JRA A;  1R9T J;  1JJ8 C;  3PIO F;  1XPX A;  1RNL A;  4CZZ A;  2NRA C;  2IEK A;  2RQQ A;  4MNU A;  4EV0 A;  2HPI A;  3CDI A;  2FUG 2;  3MEX A;  5LHI A;  3PQK A;  2IW5 A;  2K27 A;  1MDM A;  1QHG A;  4Q5S F;  3MFK A;  3T8R A;  3CUQ C;  5EG0 B;  2UUZ A;  3CMM A;  3DKX A;  2AHQ A;  4DBQ A;  2B7E A;  2MW8 A;  5HS7 A;  2Y75 A;  4LG3 A;  3REO A;  3OYK A;  1A31 A;  3DF8 A;  3MD2 A;  2B0L A;  1WHU A;  2HWV A;  2DA1 A;  2DFI A;  3A1Y A;  4RAZ A;  4A3E J;  3VB2 A;  2TCT A;  3C7J A;  3SXY A;  3OYJ A;  1IN6 A;  1XSV A;  4A5M A;  4BHB A;  1CF7 A;  2K85 A;  3I4N J;  5LFA A;  2R93 J;  3H0G J;  2HI3 A;  2M1B A;  3SZT A;  1MJB A;  2KT0 A;  3I4P A;  3S8P A;  1VI0 A;  4I7H A;  1REP C;  4BH9 A;  2A6E F;  1D0Z A;  2XPU A;  4HX7 A;  5E3N A;  3OR1 C;  1VQM I;  2RC4 A;  3OMY A;  3GFI A;  1JGS A;  3OYC A;  2BEO A;  1DGR M;  2F4I A;  1ACI A;  2K9L A;  5GTI C;  1VF9 A;  4PJ0 C;  4E7I A;  3C2H A;  3ABL H;  2JT1 A;  2KKO A;  3J80 K;  4O3M A;  4PSW A;  3PO2 J;  4J00 A;  4G6Q A;  1QA6 A;  1HOM A;  2Y2Z A;  2VJ4 A;  3KZZ A;  2P8T A;  3ZQ7 A;  3D1N I;  2EH3 A;  2CSO A;  5GAD J;  4I6Z A;  1D1B A;  3I56 I;  1D1A A;  1ZGJ A;  2XF6 A;  4Z2Y A;  1SD7 A;  3MMY B;  4XOP A;  3DP7 A;  3LFU A;  3F72 A;  1NHA A;  1MBE A;  1TWH J;  2VIX A;  1BIA A;  1K78 A;  4OOI A;  3I9V 2;  3FHZ A;  4XLP F;  3RKQ A;  4PDK A;  3BJO A;  4KT5 C;  1ZG1 A;  4PZJ A;  2X6X A;  5DD8 A;  4LD5 A;  3JRH A;  2VOO A;  1BM9 A;  2BZT A;  3OYI A;  5TRD A;  4IOA F;  5D4R A;  4RB0 A;  2GXB A;  5FLX Z;  2DAO A;  1KA8 A;  2CQK A;  2HFH A;  2ZSH B;  3TP3 A;  1K7A A;  1W7P A;  1ERD A;  4HOB A;  4B09 A;  2F48 A;  1W5C C;  2CS3 A;  3UR3 C;  2G7U A;  3H5R A;  4ITV A;  4MEX F;  4F91 B;  5CQG A;  3S2H J;  4CCK A;  2L01 A;  1K4T A;  1JKR C;  3J81 K;  5CVU A;  1SFU A;  3TBI A;  1JJ6 C;  3JRI A;  5K7F A;  2CUJ A;  3HOU J;  5F27 A;  4I76 A;  2DA5 A;  4RB2 C;  2MD5 A;  3E97 A;  2HOA A;  1VQ5 I;  2KFD A;  1YG2 A;  2LDU A;  3MAJ A;  2HQR A;  1HQC A;  2Y0M A;  2EK5 A;  3F8C A;  4C3J J;  3S1R J;  4IRI A;  5HLH A;  4CYD A;  1ZR4 A;  4GXO A;  1STZ A;  3RIR A;  5CLS A;  4EJW A;  4PGH A;  5D8L B;  1X1C A;  5TGT A;  4LMY A;  1SFK A;  4F3Q A;  2VN2 A;  1J7K A;  1HF0 A;  2COM A;  1USS A;  4NHJ A;  3EUH A;  4BDY A;  1AA7 A;  2K4J A;  1RI7 A;  3GTQ J;  5AON A;  3HIF A;  1XTA A;  1YS6 A;  3L2V A;  2PJR B;  5E8I A;  3GYH X;  1TT5 B;  4UUS B;  2FA5 A;  2HQA A;  5H6Q A;  1MMA A;  3WG9 A;  1RET A;  2EZH A;  2WAE A;  1JUM A;  1WJ5 A;  1NG7 A;  4RLQ A;  4UUV A;  2M5W A;  3HZJ A;  2VXZ A;  1DPU A;  2Z9O A;  2JVG A;  1X1P A;  2HKX A;  2A5Y B;  2HTS A;  2VJI A;  1RPW A;  2DN0 A;  2O03 A;  3DBR B;  3L1P A;  2V9V A;  1QBJ A;  2DOE A;  3K4K A;  2R5Z A;  1FP1 D;  4HEA 2;  3TMO A;  2E60 A;  1D0Y A;  2F6C A;  2OZ6 A;  4BBS J;  2R7F A;  3VSL A;  3HB9 A;  4ZJZ A;  1V55 H;  5J1R A;  1E3P A;  5LRS A;  1VND A;  2YU9 J;  3FXU A;  4X1E A;  4RB3 C;  3ZR8 X;  2QBY B;  4FCY A;  1T0F C;  4H4K C;  3BJA A;  2MSY A;  5F1J A;  1MNE A;  1SFX A;  4LB6 B;  1VQP I;  1UAA A;  1I5Z A;  1JHH A;  2DPU A;  1R00 A;  4M3G A;  2KIS A;  2CQ7 A;  4XRS G;  1S7A A;  3HTU A;  3MWM A;  1HKQ A;  5AIQ A;  5E8G A;  2K7L A;  1LKX A;  2BW3 B;  2EZI A;  2X6O A;  4EJO A;  3PO3 J;  3S16 J;  4V19 K;  2ZJR F;  3DTI A;  5HOO A;  1WVR A;  2ZJP F;  1PJR A;  2NVQ J;  3ABT A;  2VLA A;  1IN7 A;  2H8R A;  2DA7 A;  2O61 A;  3PJR A;  2JVH A;  3BR2 A;  4X0G A;  1UFM A;  3WTV C;  3SJM A;  3QYB A;  1DUX C;  4L18 B;  2CUE A;  1G2H A;  4A0X A;  2E1M B;  5LGT A;  2RQP A;  4A6E A;  1GVD A;  1JHF A;  1PUF B;  4HF1 A;  3LA7 A;  1LVK A;  3ERM A;  2DDA A;  3IHU A;  3WGH A;  4Q47 A;  4HDU A;  2H1K A;  3Q9V A;  2DCE A;  2A5W A;  1T98 A;  4NC8 A;  2Y0S N;  3WTS C;  3KYC B;  1K6Y A;  1ODD A;  3LL7 A;  3QP5 A;  3TKY A;  3DWL E;  4P5O A;  5JI6 A;  3L2Q A;  2CMP A;  3HRS A;  3IWF A;  1Q1V A;  2IT0 A;  3F8F A;  5DCM B;  2DPD A;  4CGZ A;  4DYR A;  1JTX A;  5D5V B;  1FSH A;  4BYY A;  2L4M A;  3DFG A;  1WGX A;  4G8X A;  3VOD A;  3VSK A;  3VYR B;  1DQU A;  4A5N A;  3F22 A;  3B6C A;  1OMI A;  2X1D A;  4DGW B;  4E4H A;  1TNT A;  2HS5 A;  2XUB A;  4NDL A;  3G1O A;  2NVY J;  4E7H A;  1HBX G;  3I54 A;  4LIV A;  5LRR A;  2JA6 J;  1FWZ A;  4A2U A;  2ELH A;  3DLL F;  5CKT A;  1HC8 A;  2VB6 A;  3W2V A;  1A6Q A;  5IP7 J;  3X2Q H;  4BKX A;  3H0D A;  2R7V A;  4FET A;  1UG2 A;  5IYD J;  1BA5 A;  1FOX A;  1WJB A;  2AXT C;  1NK2 P;  2HR3 A;  1Z67 A;  2FQ4 A;  4C9Y A;  3LWF A;  4XK4 A;  1J2X A;  2VC1 A;  4U87 A;  5GAH J;  4A0Z A;  3MZ8 A;  2XRN A;  4M3D A;  5DM6 F;  3HJE A;  2VE9 A;  4UHT A;  2HYJ A;  2TRT A;  2QSH X;  4UV9 A;  5CQE A;  2P7C B;  1R5G A;  1SD5 A;  3C1D A;  2AO9 A;  1LFB A;  1EA3 A;  2V1D A;  1T56 A;  3K10 A;  2O5R A;  1WH5 A;  4KN7 X;  1W1W E;  2IVM A;  3ZP5 A;  2CFX A;  5IYB J;  1XCB A;  1YW9 A;  3W2A A;  2EIK H;  2FRH A;  2XGE A;  1CQT A;  4AUX A;  1YFH A;  3S1M J;  1HLV A;  3HSR A;  2QA4 I;  2XDV A;  1IXC A;  2DO7 A;  2STW A;  2J5P A;  3RCO A;  3WTX C;  2Q2E A;  1SAX A;  1A36 A;  1OCT C;  5J1Y A;  3FX3 A;  3CJN A;  1IDY A;  2OCC H;  4CSW A;  2DA4 A;  2ZXH A;  1ZRE A;  1WI9 A;  3JAM Z;  4C2T A;  4NC6 A;  3K4N A;  1MNM C;  3O8G A;  4B3X A;  1BI1 A;  1B72 B;  4YIR X;  3HTS B;  2DW4 A;  2P5K A;  2E1M C;  2FOW A;  5GPA A;  1BI0 A;  4HLY A;  1VZ0 A;  1U6G A;  5HDG A;  3ZMV A;  1D1C A;  1RR7 A;  3QOE A;  4IF4 A;  1MIJ A;  4CCN A;  5M3F J;  4TV7 A;  2I5U A;  3JSO A;  4EJT A;  2MLK A;  1R4M B;  3TED A;  1D5Y A;  2L7F P;  1B9M A;  1JE8 A;  1WRJ A;  3OY9 A;  4HV5 A;  3KP4 A;  5JVT A;  3ZMT A;  2LRE A;  4QWQ A;  3SFZ A;  1FBQ A;  4J19 A;  4AC0 A;  2D45 A;  1U8R A;  4C2M J;  2ZFU A;  2P5L C;  4BY7 J;  5DYM A;  2XV4 S;  1ZGA A;  3GCM A;  4Q48 A;  2OAZ A;  2O3F A;  4CYC B;  3HGY A;  1GLN A;  1Y56 A;  5B1A H;  2OU2 A;  2KDZ A;  3V8L A;  2XAH A;  3PNT A;  3S3O A;  1FYK A;  2XGD A;  1PUE E;  2DMU A;  3AKZ A;  4IHV A;  2LK2 A;  3ZOB A;  2FBI A;  2YX4 A;  2XSJ C;  4MFE A;  4A3L J;  2DT7 B;  2LY9 A;  1YW7 A;  1DPR A;  5IPA A;  3GO5 A;  2ZME C;  2HOS A;  4GFB A;  2CUF A;  3S93 A;  5HNH A;  4NC7 A;  4Q4Z F;  1BN5 A;  2XAG A;  4CZC A;  5J3L A;  1OCZ H;  2R7W A;  2QYO A;  2JA2 A;  5CVV A;  5F64 A;  1BBY A;  2E36 A;  3HSF A;  1XSD A;  1IRG A;  3GTP J;  4OWR B;  2K40 A;  4PJN A;  3GBG A;  5D6F A;  1FPQ A;  3H36 A;  3F21 A;  1S5L C;  3QPT A;  3G73 A;  2EIL H;  4OAZ A;  2LVS A;  2DJI A;  1XSX A;  2KZG A;  4BHC A;  5GTH C;  4UVB A;  3GF2 A;  3Q0V A;  3W2W A;  1O3Q A;  3E3V A;  4OU0 A;  4U88 A;  4XLN F;  4HQE A;  3IKV A;  3G1M A;  2LMD A;  5FB2 A;  3GUD A;  2M7B A;  5BMZ A;  4ZDO A;  2ESN A;  5FD5 A;  1VQ4 I;  4RS8 A;  2ETH A;  2HQN A;  4JYK A;  3FF5 A;  2QWW A;  2NVT J;  3QQA A;  2WA0 A;  4DYC A;  1D8J A;  3CCR I;  3EQL F;  4PFO A;  2EV5 A;  2WAQ A;  1OR7 A;  1MGT A;  4L5J A;  4DZP A;  1E0E A;  3K9T A;  3GXO A;  1IC8 A;  1BR1 A;  3D5L A;  1JI8 A;  1EKE A;  4Z6Y A;  3AG4 H;  2QUF A;  2XF5 A;  2CO5 A;  4A3F J;  1HKS A;  4JX4 A;  1IO2 A;  4LK1 F;  3OL4 A;  1OIS A;  3Q9S A;  3WHB A;  5C3E J;  3F8M A;  3DV8 A;  3D5R C;  1X1A A;  1UHW A;  2WY8 Q;  3DPL C;  1ON1 A;  1R1U A;  5F6F A;  2LBF B;  3BCB A;  1LDJ A;  1I1G A;  4MFD A;  4YFX F;  4ETS A;  2R3S A;  1H9T A; 
#chains in the Genus database with same CATH homology
 4UXN A;  1J75 A;  2GZW A;  4I98 B;  3I58 A;  2A07 F;  2OQG A;  4HW0 A;  1Z05 A;  2X4H A;  5LHG A;  3IC7 A;  3FM3 A;  4KFC A;  3R0A A;  3CO6 C;  4HYE A;  1WQ2 A;  1KU2 A;  4ESF A;  3COA C;  2DU9 A;  2MC3 A;  4M9Z A;  1K78 B;  4S05 A;  3RJP A;  2M45 A;  1UB9 A;  1J9I A;  1Q1H A;  1I6X A;  3TDU C;  4M72 A;  5BPD A;  5HLG A;  3RKX A;  1IZ1 A;  2LF7 A;  4L9T A;  2EB7 A;  2FE3 A;  2Z5U A;  4L9J A;  3CDH A;  3EYI A;  4ZYH A;  2RDP A;  2PMH A;  5LHH A;  4GYG A;  4WWC A;  4I2O A;  2J5O A;  3LA2 A;  1G6N A;  4RGX A;  3E6B A;  4NQW A;  2MLG A;  3RYP A;  2EFP A;  1B6A A;  2VE8 A;  1R7J A;  2P6T A;  3JTG A;  1GXP A;  3HHG A;  5JFR A;  5ICE A;  4BNC A;  2EFW A;  4A6D A;  5H6R A;  1S7O A;  1XN7 A;  1TTY A;  2FMY A;  2FU4 A;  5L3E A;  3S2W A;  1FNN A;  2CW0 F;  3H92 A;  1TW3 A;  1F5T A;  5LGU A;  1XD7 A;  3IKT A;  3HHH A;  2MA3 A;  2ACJ A;  5FGM A;  3KE2 A;  3ABU A;  3HRT A;  1MD0 A;  3TDZ C;  2D1V A;  1GHC A;  3EDP A;  2LKP A;  3I59 B;  1T2K A;  1E2X A;  3HOS A;  1BI2 A;  4ESJ A;  2D2W A;  1YTY A;  3TO7 A;  2VBW A;  4UV8 A;  3LFK A;  2XAF A;  2GA1 A;  2IA2 A;  3MCZ A;  2UWM A;  4I0B A;  1IAW A;  1ZRD A;  1ZG5 A;  3I0T A;  3B02 A;  5BPI A;  2C6Y A;  2CG4 A;  4M71 A;  4KIC A;  2O8X A;  2HDC A;  1T38 A;  3RKW A;  1FZP B;  1WKM A;  1O57 A;  4YG2 F;  3HRM A;  1T0F A;  1UST A;  3FXR A;  2E7W A;  4IHS A;  3RTR A;  3I64 A;  4OIP F;  2HYF A;  2KIU A;  2EWN A;  2FNP A;  3R0J A;  3ZN0 A;  1ZRF A;  3TGN A;  2L4A A;  3ZMU A;  3L9F A;  2CYY A;  4HZF A;  4OIR F;  2XKP A;  5CVI A;  2PLY A;  4PGG A;  3E6M A;  2FML A;  3GLX A;  1KU9 A;  2PMU A;  4DNC A;  2XKO A;  1YW8 A;  4E70 A;  3T5X A;  2DTR A;  2GQQ A;  2VC0 A;  3LAJ A;  3OV8 A;  3E5X A;  1GVJ A;  4G7O F;  3JTH A;  1J59 A;  2TDX A;  4YIF A;  3W6K B;  2VBZ A;  3C3W A;  3R60 A;  2IRF G;  4GGG A;  2FQ3 A;  1IN4 A;  2AXL A;  2XAJ A;  2RGV A;  3ZMZ A;  2GAU A;  2PJP A;  4WXD A;  2DQL A;  3CTA A;  1KQ9 A;  2V1U A;  2EA2 A;  2CGP A;  4KIB A;  3QPH A;  4WF2 A;  2IPQ X;  2W25 A;  1SD6 A;  1UHM A;  3NRV A;  2PBI A;  4H0E A;  3BZ6 A;  2PQ8 A;  1W5T A;  3RDI A;  2QVO A;  1ULY A;  4MTE A;  3L7W A;  1HSJ A;  3JW4 A;  3WU0 A;  1H0M A;  3R61 A;  3T0Y A;  1RUO A;  4R8H A;  2WC2 A;  4AIJ A;  2HKO A;  2BGC A;  3G3Z A;  1AWC A;  2FEZ A;  4BXU A;  2IJL A;  2K4B A;  2OD5 A;  3EYY A;  4NB5 A;  2M30 A;  1I27 A;  4N9I A;  3BPV A;  3I5U A;  5D5X B;  3LA3 A;  2Q0O A;  2H94 A;  1ZYR F;  2BYV E;  1QZY A;  4HLX A;  2X0L A;  3R6S A;  4I02 A;  3RPU A;  2FXA A;  5FO5 A;  3KLO A;  5E1Z B;  3HYI A;  3F6V A;  4KUM A;  2LNB A;  3F8B A;  2HTJ A;  2VON A;  4LLL A;  2VT2 A;  4RGS A;  2VOP A;  2UZK A;  4R79 A;  1I1S A;  4D0P A;  3ERE D;  2PN6 A;  3BP8 A;  3L00 A;  4GO1 A;  1R1T A;  2M87 A;  4LFU A;  1U5T C;  2RV8 A;  3U1D A;  2HYG D;  4ZYG A;  2P4W A;  3F3X A;  3VFZ A;  2WWY A;  4AIK A;  2QM3 A;  3BWG A;  2D1H A;  4ESB A;  1SFE A;  1IN8 A;  3R4K A;  1TW2 A;  5DD4 A;  1FYL A;  4JBA A;  2ZXJ A;  2EA4 A;  2JSC A;  4MEY F;  4EGZ A;  4N9H A;  1L3L A;  4F7Z A;  4MQV A;  3DKW A;  2ZFW A;  3TOB A;  4RGU A;  3GX4 X;  3M8F A;  5JHU A;  1C0W A;  2FBK A;  3GZ5 A;  3BRO A;  1KYZ A;  1P6R A;  3FXQ A;  4CDG A;  5L3F A;  1QQI A;  3IL2 A;  1MJA A;  3HSE A;  2L3D A;  4XSX F;  3FWE A;  2H6C A;  2VT3 A;  2UXN A;  3PFI A;  1RUN A;  3K1P A;  1XGS A;  3QRF F;  3WGG A;  5CYV A;  3K1M A;  3ISP A;  3WTU C;  3CO7 C;  3RKY A;  4WX9 A;  2XAS A;  4EM2 A;  3WOD F;  4JK1 X;  3VEP A;  4IRH A;  1IN5 A;  4A0Y A;  2XVC A;  2IP2 A;  1FYM A;  1LDD A;  1W7P D;  1LDK B;  2K02 A;  2MH2 A;  5IT3 A;  3TO9 A;  1R58 A;  3FMS A;  3I71 A;  4YII A;  3KP6 A;  1QGP A;  2Y48 A;  1ZAO A;  2PEX A;  4ZH4 F;  1YLF A;  1EH8 A;  3ZMD A;  3MZY A;  1W5S A;  1F4K A;  5JR3 A;  1B9N A;  1FT9 A;  4M73 A;  3K2Z A;  1B4A A;  3NEU A;  3IRQ A;  4LB5 A;  2YX7 A;  1FSE A;  2G9W A;  2FSW A;  2GA2 A;  5ICG A;  1OYY A;  2ZNZ A;  5LEJ A;  1XCV A;  2W84 A;  4ENM A;  4IJA A;  2L54 A;  3JAM K;  3F6O A;  2E7X A;  1BI3 A;  2Z99 A;  5EEG A;  1B1B A;  4LJZ F;  3I59 A;  3KP7 A;  2HGC A;  2YPR A;  5L3G A;  3RPQ A;  4Y15 A;  1PP8 F;  1ZH5 A;  5DDG A;  3SZP A;  4KDP A;  2O6G E;  1W4M A;  3GVA A;  1G3Y A;  3K69 A;  4GYI A;  4G6D A;  2A69 F;  1LEA A;  1R22 A;  2W24 A;  5KVR A;  5FD6 A;  1WSU A;  1XGN A;  5EEH A;  4G7Z F;  2JPC A;  1P2F A;  4KYW A;  4HDV A;  3JSP A;  5BOX A;  5HDK A;  4L9N A;  3RI4 A;  2GIV A;  1OYI A;  4OIO F;  3MQ0 A;  3FMQ A;  3IWZ A;  3TOA A;  1S3J A;  4M6X A;  3QU6 A;  5HS9 A;  1P92 A;  1MDM B;  3E6C C;  1X3U A;  2F5D A;  2L02 A;  5F1R A;  4WK8 F;  1ZG3 A;  2KJC A;  3WGI A;  3GWZ A;  5HVQ C;  2XHK A;  3ULQ B;  1BC7 C;  2P6S A;  2EJR A;  1YQA A;  3L2C A;  2Q8K A;  4XRF A;  5A2Q Z;  2DK8 A;  5TJJ A;  3P9C A;  1OYW A;  3M7G A;  1UCR A;  3N4M A;  2H27 A;  2F5F A;  3O6B B;  1TQP A;  4MHG A;  4O6J A;  1W7P B;  5L3C A;  1FOK A;  5CVR A;  1D8K A;  4U0Y A;  3BDD A;  3GEZ A;  3N97 A;  3CLO A;  1G3W A;  1ZLJ A;  4XSZ F;  4OMY A;  5CVJ A;  2HEO A;  1LB2 A;  4ZZL A;  5ILV A;  2GWR A;  3DXJ F;  1DP7 P;  3ZN1 A;  1WWX A;  2EFO A;  3F8N A;  3KCC A;  1S8N A;  3ECH A;  4KMF A;  1U3E M;  2WV0 A;  2ISZ A;  2E1N A;  3E5Q A;  4R1H A;  5KK1 A;  1EH7 A;  2KJB A;  1K79 A;  2CWE A;  1MKM A;  5ICC A;  1SD4 A;  2FBH A;  2WTE A;  4N0B A;  3LQR A;  2JRT A;  4HF2 A;  3EET A;  1O3T A;  4IPA A;  5DV5 A;  2V6C A;  5D5U B;  1SFU A;  4EJV A;  3LST A;  3TO6 A;  3V7R A;  1IF1 A;  5IT9 K;  3KP3 A;  4HX8 A;  2OA4 A;  4G94 A;  4BQA A;  1FP2 A;  3KP5 A;  4GCV A;  1BIB A;  3HRU A;  4LGW A;  4UVA A;  4MQ9 F;  1YO5 C;  4M74 A;  4MGR A;  1Y0U A;  2YR2 A;  1MZB A;  4K2E A;  4HA8 A;  3V4G A;  3AAF A;  2BV6 A;  3KLN A;  4P55 A;  4IXA A;  5H20 A;  1FY7 A;  4WXC A;  4EQQ A;  1IXS B;  3BPX A;  3W6J B;  2JZY A;  1CGP A;  3GFL A;  2ZME B;  3F23 A;  2F5E A;  2A68 F;  2OBP A;  5ILS A;  1IXR C;  4MTD A;  4KIG A;  3KZY A;  4IHT A;  1HW2 A;  3V8J A;  5J6X A;  1QZZ A;  3OOP A;  1F1Z A;  5E17 F;  2JPB A;  2ZNY A;  3KFW X;  3ZMS A;  2DLL A;  1LJ9 A;  4JQF A;  4RGR A;  1KQ0 A;  2KRF A;  3NQO A;  2RVC A;  2VOD A;  4KNY A;  2BE5 F;  1V3F A;  2NYX A;  4FT8 A;  2ZCW A;  2V79 A;  5K5Q A;  3WE2 A;  4PCQ A;  3MZH A;  2GXG A;  4UVC A;  2DK5 A;  1U78 A;  2HOE A;  3KEQ A;  3BJ6 A;  5FFZ A;  1ZRC A;  3I53 A;  3WTW C;  3QOP A;  4LLG F;  1XB4 A;  5LEK A;  3K0L A;  1O3S A;  2AS5 F;  3GFM A;  3DPT A;  5E20 A;  3GW2 A;  1R5H A;  3SQN A;  4CXF A;  3HOT A;  2NS0 A;  2V1X A;  3P9K A;  1B59 A;  1HST A;  3GFJ A;  2MH9 A;  4ASN A;  4FX0 A;  3Q5F A;  2XGX A;  5D8K B;  3LQQ A;  3ML6 A;  4L0Z B;  4CIC A;  2NNN A;  1MJ9 A;  3K1N A;  1EH6 A;  4KA4 A;  5DCM A;  2R7D A;  1OKR A;  1BJA A;  2ESH A;  1PP7 U;  1J5Y A;  1S29 A;  1IRF A;  2ZKZ A;  1IUY A;  3CUO A;  3VOE A;  4L0Y B;  3SHF A;  2M8E A;  2ISY A;  3BY6 A;  4Y13 A;  4HAM A;  4G7H F;  3TQN A;  2ZO4 A;  4I0A A;  2VBX A;  2P7V B;  3H3Z A;  2ZJ2 A;  1XGO A;  2YSR A;  4OIN F;  4AD9 A;  2NNY A;  1YS7 A;  5E1W A;  4EM1 A;  3QAH A;  5DUI A;  5BQT A;  1S6L A;  2ZME A;  4Y17 A;  2DI3 A;  4WXH A;  1QNT A;  1YYV A;  5K1Y A;  1T6S A;  1IW7 F;  2Z33 A;  1SMT A;  1R1V A;  2QEN A;  2EFN A;  2W85 A;  1V4R A;  5D4S A;  1ZN2 A;  1U5T B;  1JXS A;  4QLC U;  1E17 A;  1TNS A;  5J8F A;  4CHU A;  4EVI A;  2RKH A;  1OPC A;  5J8C A;  3P9I A;  2VBY A;  4U7B A;  1RZ4 A;  5FFX A;  4EMS A;  1K6O A;  1D3Y A;  1XDU A;  3WTZ A;  5LGN A;  1D5V A;  1VTN C;  2QQ9 A;  4O5V A;  4AIH A;  5HDN A;  4IRG A;  3RYR A;  1DDN A;  3WU1 B;  4HX4 A;  1XGM A;  3WE3 A;  2PFB A;  1LQ1 A;  3M1E A;  4IVN A;  2IA0 A;  4EM0 B;  4XBF A;  4ENN A;  1XMA A;  2ADU A;  5ICF A;  5ED4 A;  5FLX K;  1FBU A;  2F5C A;  2K86 A;  1R36 A;  4AWX B;  2LF8 A;  2OZU A;  1R23 A;  1TQM A;  1LVA A;  1QO0 D;  3KEO A;  4LG0 A;  2EV0 A;  3CUQ B;  1ON2 A;  3U9G A;  1TLH B;  5IT9 Z;  1BOA A;  4YFN F;  4ENJ A;  5A2Q K;  4HF0 A;  3J81 Z;  2A3S A;  2QQA A;  5ERI A;  5L3B A;  1Z9C A;  2KIM A;  5K5R A;  4B8X A;  4P96 A;  2LSO A;  5LLQ A;  5L3D A;  5HLI A;  3QP6 A;  1XMK A;  3PQJ A;  3IRR A;  4FX4 A;  4DQ2 A;  2RN7 A;  3P7N A;  1HW5 A;  3WTY C;  3H3U A;  5D5W B;  5DEQ A;  2XIG A;  2F2E A;  4I09 A;  5LBQ A;  3T1B A;  5HS8 A;  3V8K A;  4ZYD A;  1YIO A;  1G3T A;  2KIF A;  2DBB A;  2A61 A;  3D0S A;  1PDN C;  4A12 A;  4LLN A;  1KYW A;  1FX7 A;  2E1C A;  1GXQ A;  3J80 Z;  2DT5 A;  2A6H F;  1P4X A;  5BS6 A;  4G9Y A;  3FZV A;  1EV7 A;  1KQ8 A;  4UNO A;  2STT A;  2W57 A;  3DQV C;  3KET A;  4U0V A;  4WCG A;  2XAQ A;  4RAY A;  1A04 A;  2XRO A;  1BC8 C;  4KN4 X;  1Z1D A;  1AOY A;  1O7L A;  4P9F A;  1FC3 A;  2Z3Y A;  3C18 A;  3O2P E;  4U0W A;  3QU3 A;  4KIF A;  3V7S A;  4M9X A;  1CF7 B;  4AVP A;  4M9S A;  5DUK A;  4EGY A;  4EJU A;  5D6E A;  2BBY A;  3ELK A;  4HV6 A;  2FNA A;  2MBF A;  2PI0 A;  4HQM A;  1FLI A;  2P5V A;  3ZPL A;  2UXX A;  1HXD A;  3KP2 A;  4OIQ F;  3DEU A;  3WTT C;  2IA1 A;  5DCF A;  1HW1 A;  5AIP A;  1ONV A;  1SMY F;  2HZT A;  1Z7U A;  4U7D A;  2H09 A;  2PG4 A;  1ZAR A;  2OQR A;  4ZZD A;  1Z6T A;  3B73 A;  3J7A O;  1TQI A;  1QPM A;  4RB1 A;  4S04 A;  1U2W A;  4M6Y A;  2ZBK A;  2YU3 A;  2DQR A;  2QBY A;  4CO8 A;  4ON0 A;  4ENK A;  4BHP A;  2QLZ A;  2EFQ A;  3V7C A;  1ZLK A;  1XDS A;  3U2R A;  3GZ6 A;  3FMR A;  3HUG A;  3M9A A;  3M8E A;  1HKT A;  1Z91 A;  4KMU X;  3ROU A;  2RNJ A;  1H9G A;  3E5U A;  1KU3 A;  6PAX A;  1KGS A;  4ZYE A;  3LAP A;  1P4W A;  4BAY A;  1J0R A;  2EV6 A;  4L5I A;  2FF4 A;  1ZHF A;  1P4A A;  5ILU A;  3T8T A;  5CJ9 A;  3O3K A;  3FM5 A;  2JTV A;  1RIO H;  2QQB A;  4L9V A;  4LK0 F;  4I01 A;  1G4D A;  2QZ8 A;  1TBX A;  4P9U A;  1F9N A;  4HBL A;  1U5T A;  1T39 A;  5E18 F;  4LG0 B;  2H6B A;  3L09 A;  3BOQ A;  2O0Y A;  1KU7 A;  1L0O C;  5K5O A;  1O3R A;  1LEB A;  5E1X A;  1O7F A;  4OMZ A;  4FHT A;  1Z6R A;  1LNW A;  2NAZ A;  2FOK A;  2G7H A;  1G3S A;  4YFK F;  3CUQ A;  1FBS A;  3E6D A;  3ECO A;  1RNL A;  4CZZ A;  2NRA C;  4MNU A;  4EV0 A;  3MEX A;  5LHI A;  3PQK A;  2IW5 A;  2K27 A;  1MDM A;  4Q5S F;  3MFK A;  3T8R A;  3CUQ C;  5HS7 A;  2Y75 A;  3REO A;  3DF8 A;  2B0L A;  2HWV A;  2DFI A;  4RAZ A;  3VB2 A;  3C7J A;  3SXY A;  1IN6 A;  1XSV A;  4A5M A;  4BHB A;  1CF7 A;  2M1B A;  3SZT A;  1MJB A;  3I4P A;  4I7H A;  1REP C;  4BH9 A;  2A6E F;  4HX7 A;  2RC4 A;  3GFI A;  1JGS A;  2BEO A;  2JT1 A;  2KKO A;  3J80 K;  4O3M A;  4G6Q A;  3KZZ A;  2P8T A;  3ZQ7 A;  2CSO A;  1ZGJ A;  4Z2Y A;  1SD7 A;  3DP7 A;  3F72 A;  1NHA A;  1K78 A;  1BIA A;  4OOI A;  3FHZ A;  4XLP F;  4PDK A;  3BJO A;  4KT5 C;  1ZG1 A;  4PZJ A;  5DD8 A;  4LD5 A;  2VOO A;  1BM9 A;  5TRD A;  5D4R A;  4RB0 A;  2GXB A;  5FLX Z;  2DAO A;  1KA8 A;  2CQK A;  2HFH A;  1K7A A;  1W7P A;  4HOB A;  4B09 A;  2G7U A;  4MEX F;  2L01 A;  3J81 K;  5CVU A;  4RB2 C;  2MD5 A;  3E97 A;  2LDU A;  1YG2 A;  3MAJ A;  2HQR A;  1HQC A;  4IRI A;  2EK5 A;  2Y0M A;  3F8C A;  5HLH A;  4CYD A;  4GXO A;  1STZ A;  3RIR A;  5CLS A;  4EJW A;  4PGH A;  5D8L B;  4LMY A;  2VN2 A;  1J7K A;  2COM A;  1USS A;  4NHJ A;  3EUH A;  2K4J A;  1RI7 A;  5AON A;  3HIF A;  1YS6 A;  5E8I A;  3GYH X;  2FA5 A;  5H6Q A;  3WG9 A;  4UUV A;  2M5W A;  2VXZ A;  1DPU A;  2Z9O A;  2HKX A;  2A5Y B;  2HTS A;  2O03 A;  2V9V A;  1QBJ A;  1FP1 D;  2OZ6 A;  2R7F A;  5LRS A;  3FXU A;  4RB3 C;  2QBY B;  3BJA A;  1SFX A;  4LB6 B;  1I5Z A;  1JHH A;  2DPU A;  1R00 A;  1S7A A;  3HTU A;  3MWM A;  1HKQ A;  5AIQ A;  5E8G A;  2K7L A;  4EJO A;  5HOO A;  3ABT A;  1IN7 A;  2O61 A;  3WTV C;  1UFM A;  1DUX C;  4L18 B;  4A0X A;  5LGT A;  2RQP A;  4A6E A;  1JHF A;  4HF1 A;  3LA7 A;  3IHU A;  3WGH A;  4Q47 A;  4HDU A;  3Q9V A;  1T98 A;  3WTS C;  1ODD A;  3QP5 A;  3TKY A;  4P5O A;  5JI6 A;  3HRS A;  3IWF A;  2IT0 A;  3F8F A;  5DCM B;  2DPD A;  4CGZ A;  5D5V B;  1FSH A;  4BYY A;  2L4M A;  3DFG A;  4G8X A;  3VOD A;  4A5N A;  3F22 A;  1OMI A;  1TNT A;  2HS5 A;  2XUB A;  1HBX G;  3I54 A;  5LRR A;  1FWZ A;  4A2U A;  2ELH A;  2HR3 A;  3LWF A;  1J2X A;  2VC1 A;  4A0Z A;  2XRN A;  2VE9 A;  4UHT A;  4UV9 A;  2P7C B;  1R5G A;  1SD5 A;  3C1D A;  2V1D A;  4KN7 X;  2IVM A;  3ZP5 A;  2CFX A;  1XCB A;  1YW9 A;  2FRH A;  1YFH A;  3HSR A;  2DO7 A;  1IXC A;  2STW A;  2J5P A;  3WTX C;  2Q2E A;  1SAX A;  3FX3 A;  3CJN A;  1ZRE A;  1WI9 A;  3JAM Z;  1BI1 A;  3HTS B;  2DW4 A;  2P5K A;  1BI0 A;  4HLY A;  1U6G A;  5HDG A;  3ZMV A;  4IF4 A;  4TV7 A;  3JSO A;  4EJT A;  2MLK A;  1B9M A;  1JE8 A;  1WRJ A;  5JVT A;  4HV5 A;  3KP4 A;  3ZMT A;  4QWQ A;  3SFZ A;  1FBQ A;  1U8R A;  2D45 A;  2P5L C;  5DYM A;  2XV4 S;  1ZGA A;  4Q48 A;  2OAZ A;  2O3F A;  2OU2 A;  3V8L A;  2XAH A;  1FYK A;  1PUE E;  2FBI A;  2YX4 A;  1YW7 A;  1DPR A;  3GO5 A;  4Q4Z F;  1BN5 A;  2XAG A;  2QYO A;  5CVV A;  5F64 A;  1BBY A;  3HSF A;  1XSD A;  1IRG A;  5D6F A;  1FPQ A;  3F21 A;  3QPT A;  3G73 A;  1XSX A;  4BHC A;  4UVB A;  3GF2 A;  1O3Q A;  3E3V A;  4OU0 A;  4U88 A;  4XLN F;  4HQE A;  3IKV A;  5FB2 A;  3GUD A;  5BMZ A;  2ESN A;  5FD5 A;  4RS8 A;  2ETH A;  2HQN A;  3FF5 A;  2QWW A;  1D8J A;  3EQL F;  2EV5 A;  1OR7 A;  1MGT A;  4L5J A;  3K9T A;  3GXO A;  3D5L A;  2QUF A;  2CO5 A;  1HKS A;  4LK1 F;  3Q9S A;  3F8M A;  3DV8 A;  1UHW A;  3DPL C;  1ON1 A;  1R1U A;  5F6F A;  1LDJ A;  1I1G A;  4YFX F;  4ETS A;  2R3S A;  1H9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...