2OBPA

Crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative DNA-binding protein (YP_298295.1) from Ralstonia eutropha JMP134 at 1.70 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 23
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2obpA00
3I54A 2R3SA 3FMSA 5LLQA 2PEXA 4KFCA 2V6CA 4BQAA 2BV6A 3M9AA 5FFZA 4IRHA 3ML6A 4G7OF 1BJAA 2XV4S 2A69F 1R1TA 1GXPA 1G3TA 4AIKA 3M7GA 4ENKA 2MA3A 5LRRA 3JAMK 4N9IA 5J6XA 1I5ZA 2HKOA 1LQ1A 1DPRA 1OYIA 4GXOA 5LRSA 1HKTA 4EM2A 3GZ6A 1TQPA 4HDUA 3F23A 1K78A 4M6XA 3GXOA 3I53A 3DXJF 3F3XA 1LDDA 2O3FA 3R4KA 1ULYA 3V7RA 2F5EA 4A2UA 2IJLA 4D0PA 2ESNA 1IRFA 3OOPA 3GVAA 2Z5UA 4YFNF 2E1CA 4XLPF 4LB6B 2EV6A 4IHTA 1YYVA 4BNCA 5CLSA 2TDXA 5CVIA 3G3ZA 2EA4A 1G4DA 1IAWA 1X3UA 2CG4A 4LGWA 2V1DA 2KRFA 3I0TA 1IXRC 5D5VB 1ZG1A 4L9NA 1P2FA 3KP7A 4RB3C 4LD5A 5L3FA 4EGZA 4RB0A 4IPAA 2STTA 1MDMB 2NS0A 1C0WA 5K5RA 1UB9A 5FLXZ 3D0SA 2XAJA 1ZYRF 1I27A 2EV0A 3L09A 3QU6A 3D5LA 1T39A 4MQVA 5L3EA 1S7OA 3B73A 2FSWA 2M8EA 4EM1A 2KJCA 3BJAA 4L9TA 4NB5A 2DI3A 2RQPA 4O6JA 5ICEA 2NRAC 1HKSA 2COMA 5D5WB 2RNJA 5L3GA 5ED4A 1L0OC 1SFXA 2DW4A 2OZ6A 5FLXK 2UZKA 3L2CA 2RV8A 3R0JA 4HA8A 4M72A 4WF2A 3EYYA 4ENJA 1J9IA 1YW8A 2NNYA 1JHFA 3GFJA 4H0EA 5JVTA 3DP7A 2VBWA 2V1UA 5DD4A 2DFIA 3HRMA 3GLXA 3CUQA 2RVCA 2XAGA 1OYYA 2VC1A 4EJVA 1U5TA 3K0LA 4A5NA 4PCQA 2VT2A 4Z2YA 1JXSA 4KDPA 3V7CA 4WWCA 5KK1A 3LFKA 1R5HA 4XLNF 3ECOA 3WE2A 1S29A 1G6NA 2DK8A 2PJPA 3T5XA 3BZ6A 2OQGA 4YIFA 4RGXA 3HOSA 4EJUA 3NRVA 5CVVA 4RB2C 1BC7C 1XSVA 5D8KB 1B6AA 3DPTA 5A2QK 4A12A 3GZ5A 3FM5A 4U0VA 2KIMA 4EJOA 4UVBA 3S2WA 4LLLA 1FT9A 3SZPA 5DUIA 1GVJA 4HDVA 1KYZA 5LHHA 4HBLA 4L5JA 2C6YA 3KLNA 2GIVA 3GFLA 3GFMA 2PN6A 3SQNA 2JRTA 4KN4X 3TOBA 1ZRDA 4HQEA 3HUGA 2FQ3A 5F6FA 4HX8A 1S6LA 3HSFA 2AXLA 4MEXF 3WGIA 3JSOA 4HOBA 2F2EA 1IN8A 1HW1A 5HLGA 1MKMA 2J5PA 3BROA 3RKWA 3ULQB 3WTZA 1ON2A 2VE8A 4PZJA 2Y75A 2GQQA 1P4XA 2UWMA 4HF1A 3IRQA 2FA5A 4I01A 4A0XA 1ZG3A 4BAYA 3LWFA 3MEXA 5E1XA 1UHWA 3VFZA 1ONVA 1Z05A 1F4KA 3QP5A 4HQMA 3N4MA 2CFXA 3ZMTA 1W5TA 1O3QA 3RKXA 3GFIA 2EJRA 1YW7A 1O7LA 5DUKA 3IC7A 4P55A 1XB4A 3KE2A 3L7WA 2QENA 2RGVA 4ESJA 2EB7A 1ZG5A 2XAQA 1YS6A 2R7DA 3IWFA 3I64A 4BYYA 2AS5F 5L3CA 1T0FA 2KIFA 3QRFF 1KU7A 3T8TA 2D1VA 1U6GA 5BPDA 4IRIA 2XKPA 3L00A 3MWMA 2QM3A 2DU9A 1D8JA 1FYMA 2YPRA 1EH7A 1TBXA 1FP2A 2HGCA 4DNCA 1QQIA 4FHTA 4ENMA 5JHUA 5KVRA 4G8XA 1U3EM 5ILUA 2OU2A 2PBIA 2H09A 3HRTA 2DPUA 2M1BA 2OD5A 1HQCA 4HAMA 2LSOA 2QLZA 2YSRA 1XMAA 5D6FA 3LQQA 1XSDA 1WSUA 1SFUA 2P6TA 1B9NA 1IXCA 3K1PA 2F5FA 4EVIA 2ZBKA 3I58A 1G3WA 3TO9A 1B4AA 3WGGA 2KKOA 3BJOA 1D3YA 2F5DA 5ILVA 1BI0A 4ZYHA 1EV7A 4L9VA 5DCMA 3IHUA 2OAZA 3I59B 2HWVA 5F1RA 3HOTA 1I6XA 4M71A 1D5VA 1IW7F 5IT9K 3LA7A 1MJAA 2LF8A 1BBYA 4WXHA 3F21A 2QBYB 2GAUA 1BI1A 3AAFA 2GA2A 3MAJA 2OQRA 4UV9A 5K1YA 1R22A 3HYIA 3TGNA 1XGSA 2WWYA 4UVAA 3O6BB 5LHIA 3P7NA 2LNBA 2A3SA 2IA2A 3F8MA 2VOPA 4P9FA 3J80K 3P9KA 5D4SA 2PMUA 4RGUA 3RPQA 2H6BA 1G3SA 3M8FA 1T2KA 3MQ0A 3ZMVA 2EA2A 3F8CA 3LA2A 2JPCA 1KQ9A 2K4BA 4RAYA 1ZAOA 2RKHA 2L3DA 3U9GA 4WK8F 1R1UA 1FSHA 4G9YA 2LF7A 2ZCWA 2QVOA 2DQRA 5J8CA 3W6KB 4ENNA 1PP8F 4U0YA 2O6GE 3ZMUA 3RDIA 3WTSC 2FF4A 1WQ2A 4FX0A 4LMYA 1Z91A 5K5QA 2OA4A 4EV0A 4ZH4F 4LG0B 3U2RA 1CF7A 1XCBA 3CO6C 3FF5A 5LGTA 2EFQA 4BHBA 3J81Z 1BI2A 3LA3A 4E70A 1U5TB 5LEJA 1BN5A 3HHGA 1UCRA 1DDNA 2IW5A 3KP5A 1QPMA 1FSEA 4UV8A 2QBYA 2HZTA 3CUOA 3ZN1A 4XBFA 3HTSB 3PQJA 2D2WA 5D8LB 2ISYA 1S7AA 1TNTA 1FZPB 2PMHA 3ECHA 3R60A 5H20A 5DD8A 3RPUA 2E7WA 5FD5A 4B09A 3BPXA 2XASA 4LFUA 2FMYA 3IRRA 1DPUA 1YIOA 3B02A 4GYIA 2MLKA 2XVCA 3JTHA 5HS8A 2V79A 2ZXJA 3TKYA 5L3DA 2XIGA 2RN7A 4NHJA 3VODA 2PG4A 3FWEA 3ZMDA 2IA0A 3FZVA 4KIGA 2ZJ2A 1YQAA 3WTVC 4OIQF 4A6EA 1B1BA 3ABUA 3GYHX 3G73A 4ESBA 4KA4A 2K7LA 1V4RA 5HLHA 1ZN2A 1U5TC 3NEUA 1Q1HA 5HVQC 5AIPA 1DP7P 3O2PE 3KLOA 2QWWA 4HX4A 1DUXC 2MLGA 2HTSA 4LG0A 2O61A 2ZMEA 4WCGA 2QQBA 3GEZA 3JAMZ 3GUDA 2YR2A 3ERED 4U0WA 3P9CA 4L0YB 2IPQX 1ON1A 2WC2A 4HLXA 2KJBA 1J75A 2PI0A 1QZYA 3FM3A 4Q4ZF 1YFHA 2L4AA 2STWA 2UXNA 1ZARA 3GF2A 1LNWA 1E17A 2W85A 1PUEE 4KT5C 1KU2A 2OZUA 3Q9SA 5LGUA 3K2ZA 3SXYA 1MZBA 1YO5C 2H6CA 3RIRA 3QAHA 3DQVC 4N9HA 1GXQA 2ZMEB 5FB2A 3QP6A 2G9WA 3V8JA 4UVCA 1KA8A 2HDCA 1Z7UA 1HW5A 2FBIA 4Q48A 1R36A 2H27A 4L18B 4I98B 3ZQ7A 1GHCA 2P6SA 4M74A 1TTYA 1YW9A 5E17F 3TO7A 4RGRA 2DPDA 1BOAA 2VC0A 3KP2A 4Q5SF 4UXNA 2BBYA 3GW2A 2CWEA 5L3BA 1J5YA 3KP4A 2QQ9A 2ESHA 2GZWA 2DTRA 2ELHA 3KEQA 4M73A 3M8EA 5HDGA 3DKWA 3DV8A 3RTRA 4HV5A 3J81K 3CUQB 3IWZA 5HS9A 4EJTA 3E97A 5DCFA 1STZA 4L0ZB 2G7UA 2V9VA 5ILSA 2QUFA 5HDNA 1BIBA 2LKPA 1S3JA 1B9MA 2K86A 1SMYF 2X0LA 4TV7A 3CLOA 3T8RA 1HW2A 4UNOA 4ON0A 4HF2A 3Q9VA 2A68F 5D5UB 3CJNA 4OMYA 3ZPLA 2OBPA 5CVUA 1IF1A 1HBXG 5EEHA 4GO1A 4YFKF 3JSPA 3SHFA 1KU9A 3HTUA 1XD7A 4CO8A 3F8FA 2ZFWA 1XGNA 5H6RA 5A2QZ 4Q47A 4S05A 2RC4A 5E8IA 3P9IA 4M9ZA 3GX4X 3HSRA 3KZYA 2EFWA 2DBBA 3K1NA 5F64A 4HLYA 4DQ2A 1EH8A 3QOPA 4L9JA 3VOEA 1UFMA 4ZYGA 3QPHA 4BXUA 1VTNC 2CGPA 2ZO4A 3E6BA 5AIQA 2PQ8A 2Z3YA 2GWRA 5D5XB 4OOIA 2Z99A 4ZZLA 5HLIA 1I1GA 3DFGA 2KIUA 3C1DA 3LSTA 3VEPA 1YTYA 1HKQA 3C3WA 3BJ6A 3ZMZA 3HRSA 6PAXA 5K5OA 2Q2EA 3KCCA 2P8TA 5EEGA 1S8NA 4AWXB 1CF7B 2ZKZA 4LLGF 1W5SA 2A5YB 1QNTA 3C18A 4A0ZA 4ZZDA 3DEUA 1MD0A 4O5VA 1TW3A 1ZLJA 1J7KA 4ZYEA 4OINF 2H94A 1SMTA 1EH6A 1XCVA 2Z33A 2VXZA 3TDUC 3LQRA 4G6DA 1YLFA 3W6JB 1FBSA 2HR3A 2HQRA 3IKVA 3JTGA 3V8LA 3KETA 1W7PD 1F9NA 1IN4A 3ZMSA 3F8NA 4KNYA 3RYPA 2L54A 4WXDA 4B8XA 3CTAA 3WU0A 1FP1D 4L5IA 3WTWC 2A6EF 4IXAA 1FOKA 3T0YA 1O3RA 1LDKB 4LB5A 1TLHB 1ZREA 1USTA 4MQ9F 4OMZA 1BI3A 4HF0A 3QPTA 2VN2A 1LB2A 1I1SA 1OKRA 1QBJA 3GO5A 2XAHA 1W7PB 1R23A 3KZZA 2ETHA 4AIJA 3OV8A 4OIPF 2P5KA 4FT8A 2HFHA 2P5VA 4GGGA 1Z1DA 1LVAA 2CSOA 1XSXA 5JI6A 3RYRA 5FFXA 2FBKA 2EFPA 5DCMB 3E6MA 5ICFA 2J5OA 3T1BA 4HW0A 4AD9A 2GA1A 2P4WA 5JFRA 3JW4A 3FHZA 2O03A 2FOKA 4M9SA 3REOA 3F6OA 2XKOA 4RS8A 5LHGA 4IF4A 4I09A 3PFIA 3U1DA 4I7HA 2P7CB 1KGSA 1FYKA 1B59A 2ZNZA 4LK1F 1E2XA 5ICGA 4XRFA 3FMQA 1U78A 2CW0F 5E1ZB 1P4AA 2YX4A 1FPQA 3N97A 4EQQA 1WKMA 2GXGA 4LJZF 1XDUA 2JTVA 4XSZF 3DF8A 2XUBA 1D8KA 2MC3A 3EDPA 2JT1A 4YG2F 1TW2A 2IP2A 2NNNA 1WI9A 2XRNA 3MZHA 2WTEA 2NAZA 3FXRA 2CYYA 2E7XA 3ZP5A 4EGYA 1K78B 3F8BA 4KIFA 3TOAA 4EMSA 3TO6A 1QGPA 1J2XA 5LGNA 1R58A 1TNSA 4HV6A 4CICA 2ADUA 3KP6A 1ZH5A 1T98A 1J59A 2VT3A 3EETA 4I2OA 2QYOA 5BS6A 1F5TA 4N0BA 2BGCA 1LJ9A 1SFEA 2DT5A 4F7ZA 1V3FA 5HOOA 2MH9A 4AVPA 2M45A 4QLCU 2VBXA 3V8KA 1IZ1A 1OR7A 3KFWX 2O8XA 3K9TA 5LBQA 2BYVE 4P9UA 2MBFA 1IN6A 3V7SA 4MTEA 1JHHA 4P5OA 1XGMA 1AWCA 4BHCA 1ZGJA 4CZZA 2K27A 4RGSA 1REPC 4KMUX 2HKXA 2XAFA 5DV5A 4AIHA 1MDMA 2HEOA 2VONA 2EK5A 1FC3A 4MEYF 1XMKA 1O3SA 1R7JA 4IVNA 1XGOA 4GYGA 5LEKA 5BOXA 4K2EA 3PQKA 1LDJA 3FX3A 1HXDA 1O3TA 3I4PA 2BE5F 2LDUA 4XSXF 1P92A 4A5MA 3WODF 5AONA 2CQKA 1R1VA 1BIAA 4M6YA 3MFKA 1ZGAA 1PP7U 4IJAA 2W57A 1FX7A 3CUQC 5JR3A 1OMIA 1TQIA 3R0AA 1RI7A 5D6EA 3TQNA 3I5UA 2G7HA 2JPBA 4I0AA 2EWNA 2IA1A 1O57A 3E6CC 2DLLA 4PGGA 4RAZA 4UUVA 1L3LA 2QZ8A 2M5WA 3C7JA 1HSTA 1MGTA 1RZ4A 5H6QA 2FEZA 4Y17A 3R6SA 2P5LC 5CJ9A 2Y48A 1H0MA 2FBHA 4GCVA 2FNPA 4WXCA 2IVMA 3O3KA 5CYVA 4KYWA 3I71A 1W7PA 3IL2A 2K02A 2MH2A 3K69A 4OIOF 3H3ZA 2Y0MA 3BP8A 1OYWA 2XHKA 5E1WA 1YG2A 4EJWA 2HS5A 4RB1A 2DK5A 1FYLA 5BPIA 2YX7A 4ZYDA 1T6SA 2PLYA 1W4MA 5HS7A 3WTYC 2FU4A 1YS7A 2L4MA 1FBUA 3V4GA 2RDPA 3VB2A 2FMLA 2VODA 3FMRA 4ASNA 4Y15A 2R7FA 5E8GA 1JGSA 4MNUA 4R1HA 3J80Z 2YU3A 1Z9CA 1Y0UA 1ODDA 1WWXA 5FGMA 2EFNA 1U8RA 1KYWA 2HYGD 4R8HA 1Z6RA 5ERIA 2ACJA 3BPVA 1NHAA 3QU3A 2MD5A 1K7AA 1TQMA 3WE3A 1Z6TA 4MHGA 3COAC 2PFBA 2VBYA 2FE3A 4A0YA 3CO7C 1MJ9A 1MJBA 4CDGA 1XDSA 3WU1B 3FXQA 4CHUA 5J8FA 4KICA 2HOEA 5CVRA 2K4JA 1CGPA 1SAXA 4P96A 4HX7A 1H9TA 4S04A 5FO5A 5DYMA 1RIOH 1HSJA 1SD4A 1KQ8A 3TDZC 3BY6A 3RKYA 2EFOA 4BH9A 1RUOA 2ISZA 4FX4A 4LLNA 2W84A 4EM0B 2L02A 4JBAA 4KN7X 2Q8KA 4WX9A 1LEAA 3WTXC 4G7HF 1FWZA 3SFZA 4QWQA 5FD6A 1P6RA 2A61A 3BOQA 3F72A 4ETSA 1SD5A 1U2WA 2P7VB 4IHSA 3DPLC 2JZYA 2ZNYA 3HSEA 5E18F 3H3UA 3HRUA 4PGHA 5CVJA 1SD6A 3E5XA 4U7BA 3ROUA 3ISPA 1JE8A 3L9FA 5HDKA 4O3MA 2Q0OA 2XGXA 3FXUA 3KEOA 1OPCA 4I0BA 1K6OA 4PDKA 1K79A 1R00A 1O7FA 4OU0A 3CDHA 3RI4A 3EQLF 3WTUC 2VE9A 1IUYA 2W25A 3F22A 3E6DA 3IKTA 2V1XA 4NQWA 3EYIA 2W24A 1ZRCA 4CGZA 1RUNA 5BQTA 3ELKA 3MZYA 2XROA 2HTJA 4Y13A 2FRHA 3NQOA 3BDDA 3K1MA 5DEQA 5BMZA 2FXAA 3HHHA 3I59A 3E3VA 4I02A 1T38A 4MTDA 1G3YA 3WG9A 1LEBA 1FLIA 2UXXA 5D4RA 1AOYA 1IN5A 5IT9Z 3Q5FA 1P4WA 1F1ZA 3WTTC 4KIBA 3KP3A 3HIFA 4BHPA 4KMFA 2A07F 2DQLA 3MCZA 1UHMA 5E20A 2M30A 2M87A 3J7AO 5DDGA 1RNLA 1BC8C 4A6DA 3LAJA 1IN7A 2X4HA 4HZFA 2HYFA 4KUMA 2D1HA 2L01A 4IRGA 4U7DA 3F6VA 2VBZA 1H9GA 1QZZA 5TJJA 4HYEA 2GXBA 3WGHA 4JQFA 1IXSB 1WRJA 1FY7A 2IRFG 3ABTA 5TRDA 4G94A 3SZTA 3R61A 4OIRF 3LAPA 2HQNA 1XN7A 2VOOA 1ZLKA 2E1NA 2FNAA 1FBQA 4ESFA 4LK0F 3GWZA 4CXFA 2EV5A 2B0LA 2DO7A 4YFXF 1ZRFA 1IRGA 1PDNC 1SD7A 2CO5A 3E5UA 2IT0A 4U88A 3BWGA 2QQAA 2Z9OA 3ZN0A 2F5CA 4UHTA 2D45A 3M1EA 1USSA 1ZHFA 3RJPA 5ICCA 2DAOA 3EUHA 3H92A 2O0YA 2JSCA 3E5QA 4G6QA 4M9XA 1A04A 1KU3A 2NYXA 4MGRA 1BM9A 2A6HF 5IT3A 1QO0D 2BEOA 4YIIA 2WV0A 4R79A 1R5GA 4G7ZF 4JK1X 1FNNA 1KQ0A 4CYDA 1J0RA
chains in the Genus database with same CATH superfamily
3PL8A 1HF0A 3IH2A 3I54A 2R3SA 3FMSA 5LLQA 4CYCA 2R5ZB 2M7BA 1FIAA 4A3KJ 2E35A 4XK4A 2PEXA 4KFCA 1E3PA 2V6CA 1T33A 4BQAA 1XPXA 1MBHA 2BV6A 3M9AA 1ZR2A 5FFZA 4IRHA 3ML6A 2V9PA 4G7OF 3K6GA 4RAGA 1IV8A 1BJAA 2XV4S 2JA8J 2A69F 1K83J 1R1TA 3WHBA 1GXPA 1HDPA 1G3TA 4AIKA 3M7GA 2I5UA 3G1LA 2MA3A 4ENKA 4ZJZA 5LRRA 2VI6A 3HOWJ 1IUFA 3JAMK 4N9IA 5J6XA 1I5ZA 2HKOA 2GXAA 4RBOA 3Q0VA 1LQ1A 2GIZA 2MYSA 1DPRA 1OYIA 4GXOA 3U1KA 5LRSA 2HZDA 2VQLA 1HKTA 4E7JA 4EM2A 5KHDA 3CCJI 3CC4I 3S15J 3GZ6A 1TQPA 4HDUA 1B72B 3F23A 1K78A 2X9DA 3H1CA 4M6XA 4A69C 3GXOA 5BNGA 1X1BA 2IS2A 3I53A 3FXMA 3DXJF 2CQNA 1RKWA 3QWLA 3GZNB 5EJCA 1XG1A 3GTPJ 3F3XA 1LDDA 2O3FA 3R4KA 1ULYA 2LMDA 3HGGA 2NOGA 2FX0A 3V7RA 2F5EA 2OJED 4A2UA 2CQQA 2IJLA 3F0CA 2E19A 3M8JA 2TCTA 5K7FA 4D0PA 3OY9A 3H3VK 2ZXWH 5JHFA 2ECCA 3LSIA 2ESNA 4ZDLA 2EPFA 3ZRGA 5FLVA 2X1CA 2MFZA 1IRFA 3OOPA 3GVAA 4E7HA 2Z5UA 4YFNF 2E1CA 1ZK8A 3M3YJ 4XLPF 5GTIC 2CV0A 3CDIA 2QSGX 2H1LA 3H5RA 2E34A 4LB6B 3L2UA 2EV6A 4IHTA 2ELJA 4PSWA 4D7MA 1YYVA 4BUPA 3G2BA 2R92J 2JUGA 4BNCA 5CLSA 2Y0SA 2TDXA 3OYAA 5CVIA 2JA7J 1W0TA 3MKLA 3G3ZA 2EA4A 4ANJA 1JKPC 4ZTFA 1G4DA 1IAWA 2KRCA 1X3UA 2CG4A 1SANA 2DN0A 2OV7A 4LGWA 2Y31A 4CUGA 2V1DA 2XPUA 4A3JJ 2QF7A 2KRFA 2DJIA 2KRHA 1I3QJ 3FXOA 4EATA 3KYDB 1N78A 3GTJJ 3I0TA 1IXRC 2O9LA 3HGYA 3A0BC 5D5VB 5CQGA 1ZG1A 2BY2A 4L9NA 3ERMA 1P2FA 4BEHA 1WI3A 3KP7A 5FLMJ 4RB3C 4LD5A 5L3FA 4EGZA 4RB0A 2IS6A 4IPAA 2M2EA 1MMNA 2STTA 1MDMB 2JQ7A 2MW8A 2NS0A 2DFEA 1C0WA 3LOCA 4PJ0C 4XRMA 5K5RA 1Z3XA 1UB9A 2PMZA 5FLXZ 3D0SA 5J1YA 2XAJA 2CUZA 2HDDA 1ZYRF 1I27A 2EV0A 5IYBJ 1XMXA 3L09A 1MH3A 3RSNA 2CQXA 3QU6A 3D5LA 1T39A 4MQVA 3DEEA 5L3EA 1OR7C 1S7OA 3B73A 2DXIA 5J47A 2FSWA 2M8EA 2E5ZA 4EM1A 2KJCA 1YJWI 3BJAA 4L9TA 4NB5A 2NVQJ 2LR8A 2CW8A 1LFUP 2DI3A 1XS9A 2RQPA 4O6JA 5F04A 5ICEA 2NRAC 1W36C 1HKSA 2COMA 3FDYA 5D5WB 2RNJA 5L3GA 5ED4A 4HSTA 5EEAA 4DYQA 1L0OC 1SFXA 2DW4A 2OZ6A 1LPQA 5FLXK 1OCRH 2UZKA 1U9NA 3G6EI 3L2CA 2RV8A 3R0JA 4HA8A 4M72A 4WF2A 3EYYA 3K10A 4ENJA 1J9IA 1YW8A 2VL8A 2NNYA 1JHFA 3GFJA 4H0EA 5JVTA 1Y0NA 3DP7A 2AQFA 1N75A 2H8RA 4GRIA 2VBWA 1W1WE 2V1UA 4C3IJ 5DD4A 3HRMA 2DFIA 3GLXA 3PSIA 3CUQA 4XKWA 2RVCA 2XAGA 1OYYA 2QGUA 5TISC 2VC1A 2HVSA 4EJVA 1U5TA 3QOEA 3K0LA 4A5NA 5LFAA 2FJ1A 1VQNI 4PCQA 2VT2A 4QSHA 1YI2I 2PJRB 2ICWG 3QYBA 4Z2YA 1JXSA 3H0GJ 4KDPA 3V7CA 4WWCA 5KK1A 2BY1A 3S3NA 3H36A 4H4KC 3LFKA 1R5HA 3G4SI 3BQYA 2X51A 4XLNF 3ECOA 3WE2A 1S29A 1G6NA 1BL0A 2DK8A 2PJPA 4DOZA 4E6KG 3ESWB 1Q1VA 2EIJH 4CCLA 3CF5F 3T5XA 4QIWN 3BZ6A 2MSYA 2OQGA 4YIFA 1TC3C 4RGXA 3S3OA 1PVEA 3HOSA 4EJUA 4B43A 1MBKA 3A01A 4BEHB 3ZQLA 3NRVA 5CVVA 4C2TA 1BA5A 4RB2C 1BC7C 3GTMJ 1XSVA 5D8KB 1FJLA 1U0JA 2MD0A 2Y30A 2Y2ZA 3BR6A 3MZ8A 4RM2A 1G2HA 1B6AA 3DPTA 5GAHJ 5A2QK 4A12A 4ZDOA 3GZ5A 3FM5A 4LOCA 4U0VA 3K4LA 2KIMA 4EJOA 4UVBA 3C2HA 3S2WA 3RPUD 4LLLA 2L7MP 1FT9A 1HDDC 1U9OA 3SZPA 5DUIA 2AHQA 1GVJA 4JX4A 3IP4B 4HDVA 4QTRA 1X58A 1KYZA 1JJ8C 5LHHA 2LY2A 2WY7Q 4HBLA 3MVPA 1XX5A 1POGA 4L5JA 4DW6A 2C6YA 2W48A 3JRCA 5EGOB 1X1PA 2BVLA 3KLNA 2GIVA 2CW7A 3GFLA 2IBDA 3GFMA 3VYTB 2PN6A 1ACIA 3SQNA 2JRTA 4KN4X 1EF4A 3TOBA 1ZRDA 4HQEA 3TMOA 3HUGA 3HC7A 4YRVA 2FQ3A 4RMNA 5F6FA 4BQQA 4IOAF 1G8XA 2W4SA 1RRJA 4HX8A 1S6LA 3HSFA 1U8BA 2AXLA 4MEXF 3CMAI 3J7AY 3WGIA 3OYJA 3JSOA 4HOBA 2XSJC 3GTKJ 1IN8A 2F2EA 3OYMA 1HW1A 1ORKA 5HLGA 2J5PA 1MKMA 1Z7LA 3BROA 1EKEA 1D1AA 1LUJB 3RKWA 3ULQB 3Q0WA 3WTZA 2LREA 1ON2A 2Z16A 3I56I 2VE8A 3S1QJ 1OCOH 4PZJA 2Y75A 2GQQA 3BG7A 1JGGA 1P4XA 1VI0A 4RLQA 4M3EA 2UWMA 5K7ZA 3PSFA 4HF1A 3J7YJ 3IRQA 2FA5A 4S0HB 4I01A 5C44J 4A0XA 3OS0A 2LD5A 1ZG3A 4BAYA 1GV2A 3LWFA 1GLNA 3MEXA 5E1XA 1UHWA 3J7ZI 3VFZA 2D5VA 1ONVA 1Z05A 1F4KA 3CCYA 3QP5A 4HSRA 4C2UA 2AQEA 4HQMA 3VWBA 2CFXA 4N4NB 3N4MA 2DDBA 4C9YA 4AYBA 1JI8A 1SEUA 1X3ZB 3ZMTA 3OYFA 2GLOA 1W5TA 1O3QA 2JN6A 3RKXA 1T0FC 3OR2C 3GFIA 3K70D 2EJRA 3PJRA 1YW7A 1O7LA 3BR1A 1Z3YA 5DUKA 2KT0A 2CMPA 4RLFA 5FROA 3IC7A 4P55A 1XB4A 3OR1C 5J1UA 1UG0A 3KE2A 3L7WA 2QENA 2PX9A 2RGVA 3K4CA 4XRSA 1H88C 4ESJA 1OISA 2EB7A 1ZG5A 2XAQA 4JX5A 1YS6A 4HNTA 1UZCA 2R7DA 1VQMI 3IWFA 3H9GA 1AKHB 3I64A 2XB0X 3HOZJ 4BYYA 3CCRI 3ONQA 3U21A 2AS5F 5F27A 1UAAA 5L3CA 3OS2A 2K3FA 1T0FA 2KIFA 3QRFF 4AU7A 1KU7A 4B44A 3T8TA 2D1VA 3RQ4A 1U6GA 5BPDA 4IRIA 2XKPA 3L00A 1S9HA 3BR5A 3MWMA 3FKIJ 2QM3A 4LIVA 2DU9A 1D8JA 2VKEA 1FYMA 2VASA 4DZJA 2YPRA 2MC4A 4B1RA 1EH7A 1TBXA 4BJ6C 1FP2A 3AG1H 1PJRA 2HGCA 3H9QA 3TW7A 4DNCA 1QQIA 1FTTA 1OCCH 2IGOA 4FHTA 2JVHA 4BKXA 1R71A 4XKCA 4ENMA 5JHUA 3S8PA 3HDDA 5KVRA 1WVRA 4G8XA 2DA3A 4U87A 4BE0A 1U3EM 5ILUA 2OU2A 2RQQA 2TRTA 4IQ4A 2DMQA 3W2AA 1KONA 2VQGA 1MMAA 2PBIA 2BW3A 2H09A 4DBQA 3HRTA 4IEJA 1VQPI 2DPUA 2M1BA 4IHYA 2W00A 2OD5A 2VQHA 4A93J 1HQCA 1AKHA 1P7IA 4HAMA 2LSOA 3CC7I 2XF5A 3OYGA 1WH7A 2QLZA 1T08B 2YSRA 1XMAA 2LH9A 5D6FA 3LQQA 1XSDA 1BJZA 1WSUA 1SFUA 2P6TA 1B9NA 1IXCA 4ABZA 3K1PA 2F5FA 3K7AJ 4EVIA 2NS8A 4BQOA 4V2FA 2ZBKA 2DA1A 3I58A 1G3WA 4BDZA 1DU6A 1S7EA 2LLKA 2R93J 3TO9A 3VYUB 1B4AA 3WGGA 3V42A 4AM3A 2KKOA 3BJOA 1D3YA 2M0CA 3DCFA 2WAFA 2F5DA 5ILVA 1BI0A 4ZYHA 5IP6A 1EV7A 4L9VA 5DCMA 3IHUA 4A3CJ 2OAZA 3I59B 2XF6A 2HWVA 1MIJA 2X48A 5F1RA 1WPKA 3HOTA 1ERDA 1I6XA 3PO3J 4W97A 1MMGA 3BTJA 4M71A 1CQTA 1IW7F 3S16J 5IT9K 1D5VA 3LA7A 1MJAA 2LF8A 1BBYA 1LFBA 4I99C 4WXHA 3F21A 1VQ5I 2QBYB 2GAUA 2XC7A 1NH3A 2L9SA 1VFCA 1FOWA 4C30A 4F55A 1BI1A 3A2KA 3AAFA 1QHGA 2GA2A 3MAJA 4JYKA 2JK3A 2OQRA 1JKQC 1ETOA 2E36A 5KAIC 4UV9A 3CD6I 1E3HA 1F43A 5K1YA 4CCMA 4RAFA 1R22A 5JLWA 2E60A 3HYIA 5B66C 4A3DJ 2YU9J 2VPRA 3TGNA 2PJRA 1XGSA 4BE1A 2WWYA 4UVAA 3O6BB 5LHIA 3P7NA 3M07A 5KAFC 2LNBA 2A3SA 2F4OB 2IA2A 2JUCA 4XMYA 5IP9J 3F8MA 2VOPA 4P9FA 3J80K 3P9KA 5D4SA 2RREA 1QRYA 2PMUA 4RGUA 3RPQA 1VQKI 1OQYA 2H6BA 2KP6A 1G3SA 3M8FA 3TBIA 1T2KA 2EINH 1ETYA 3MQ0A 3ZMVA 2EA2A 4J00A 3F8CA 3OYNA 3LA2A 2JPCA 1Y6IA 1KQ9A 2UV1A 2K4BA 4RAYA 4GDFA 1ZAOA 3H35A 4M3BA 2RKHA 2L3DA 3U9GA 4WK8F 3ZQIA 1R1UA 2M0MA 3C2BA 1FSHA 1OFCX 2FOWA 4G9YA 4ITVA 2LF7A 1MNDA 5E3LA 2ZCWA 1K6YA 2V26A 2QVOA 1D0YA 2WBMA 2DQRA 5J8CA 2DOFA 2KDOA 5E79C 3VYRB 3W6KB 4ENNA 2ZMEC 1PP8F 2HPIA 4U0YA 2DT6A 3OYIA 5FRMA 5B5EC 2O6GE 2B7EA 3ZMUA 1XTAA 2Y69H 4YIRX 3RDIA 2DMPA 3WTSC 2FF4A 3Q0UA 5EZHA 2ZJPF 1WQ2A 2EH3A 2VJ4A 4FX0A 4LMYA 4C3HJ 3G1MA 1Z91A 4LITA 5K5QA 3M1CA 3IAS2 1IRZA 3ZQGA 2OA4A 3SEQA 4EV0A 1UMQA 4ZH4F 1GDTA 4LG0B 1WCMJ 3U2RA 1CF7A 1XCBA 3VDXA 3CO6C 3FF5A 5LGTA 2EFQA 4BHBA 3J81Z 1BI2A 4MO7A 3LA3A 2E2IJ 2V6EA 4E70A 1U5TB 3KEYA 2LK2A 1BN5A 3HHGA 5LEJA 4UUSA 1UCRA 1G59A 1DDNA 1ZQ3P 2IW5A 4XLAA 4XLEA 1TT0A 2O7OA 3KP5A 1QPMA 2AXTC 1FSEA 2LBFA 4UV8A 2QBYA 1ETWA 2HZTA 3CUOA 3ZN1A 2E5NA 4XBFA 5FKMA 3HTSB 2ZJRF 3PQJA 2D2WA 2L9NA 1VNDA 4XICA 4NC7A 2HXIA 2ISYA 5D8LB 1WJBA 1S7AA 1TNTA 2HVRA 1FZPB 2K9QA 2PMHA 3DKXA 2F4MB 3ECHA 2COBA 3R60A 5H20A 2HVQA 1DQUA 2HI3A 5DD8A 3RPUA 4CYCB 2E7WA 2ZXIA 2GOXB 2X1EA 3HG9A 1GT0C 4FASD 5FD5A 5J4YA 3MD2A 1IV6A 3BTCA 2XGDA 5EG0A 4B09A 4JX6A 3BPXA 3ASNH 2JWTA 2XASA 4LFUA 2FMYA 1HA8A 1D1BA 3IRRA 1DPUA 1YIOA 3B02A 5KNLA 4I6ZA 4BBSJ 4GYIA 2MLKA 2XVCA 3JTHA 1P9QC 4NNJA 5HS8A 3DPUA 2V79A 5GTHC 2E1MB 2X85A 2ZXJA 5M5WJ 4HPQA 3TKYA 2JA6J 1X1AA 2CQ7A 2XIGA 2RN7A 2ME0A 3OIPA 4XLHA 5L3DA 3W3CA 4NHJA 2CUJA 3VODA 2OPTA 1IG7A 2PG4A 3FWEA 1VF9A 3ZMDA 2DODA 5IY5H 2WADA 2IA0A 3CCVI 3IV5A 3SDBA 1I39A 2NVYJ 2BXZA 3FZVA 2CUFA 1B72A 1PUFB 4KIGA 4IL6C 2ZJ2A 2E1MC 3MN2A 1YQAA 2OC6A 3WTVC 4OIQF 4A6EA 3FKJA 2WA0A 2OCCH 1B1BA 3ABUA 3HB9A 3GYHX 3G73A 3IH3A 3HUGB 3FHNA 1WJCA 4UB8C 3VSKA 4ESBA 4KA4A 2LVSA 4ZC3A 4XKBA 2K7LA 1V4RA 5HLHA 1ZN2A 2WB1A 1U5TC 3NEUA 4J19A 3CESA 1Q1HA 5HVQC 5AIPA 1DP7P 3ZQFA 2DT7B 3O2PE 4F52A 3KLOA 2QWWA 4HX4A 1DUXC 4XOTA 3OYCA 2MLGA 2HTSA 4LG0A 2WAEA 2O61A 1FEXA 3MKYB 2Q1ZB 3I4NJ 1JT6A 1WH5A 2ZMEA 4WCGA 3MMYB 2QQBA 3GEZA 3JAMZ 4KT6A 1TWFJ 3GUDA 2R7RA 2QSHX 2YR2A 5JLXA 3ERED 2ZFUA 4U0WA 3P9CA 1MSEC 5IYDJ 4L0YB 2IPQX 1ON1A 2WC2A 5IYCJ 2GOMA 4HLXA 2KJBA 1J75A 2PI0A 5F0HA 1QZYA 3FM3A 3FXKA 4Q4ZF 1YFHA 3B6AA 2ZB9A 2DJNA 2L4AA 5K7HA 3LSRA 4FTHA 2STWA 2UXNA 1ZARA 2K9SA 4LIUA 1WJDA 1LNWA 3GF2A 1E17A 2W85A 3K4MA 1PUEE 4KT5C 1YJNI 3HPGA 1KU2A 2OZUA 2LC2A 3Q9SA 5LGUA 3K2ZA 5EYRA 2QSFX 1VQ7I 3SXYA 4EEFG 3H5AA 1UHSA 1MZBA 1NG7A 1YO5C 1YIJI 2EIMH 3KYCB 4ZDPA 2H6CA 5FKKA 3RIRA 3QAHA 4PUSA 4XR6A 5IPAA 4RDUA 3DQVC 4N9HA 1GXQA 4XORA 4FQGA 4II3A 1SVOA 2ZMEB 5FB2A 3QP6A 5GADJ 1TT5B 1UJ8A 1B8IA 2G9WA 3V8JA 3RZDJ 4UVCA 1KA8A 2HDCA 2HOTA 1Z7UA 3BR0A 3MKZA 3AG4H 1Y8QB 1HW5A 1MNEA 2KL4A 2FBIA 3PNYA 4Q48A 5FKOA 1R36A 1WJEA 3FXLA 2H27A 1QPIA 4L18B 4II2A 4I98B 4E7IA 3ZQ7A 1GHCA 2IS4A 2P6SA 4M74A 1TTYA 1YW9A 3AG2H 4JOMA 2H1KA 5E17F 1PUFA 3TO7A 4RGRA 2K9LA 2DPDA 4BGDA 1BOAA 2VC0A 1NK3P 1D0XA 3PIPF 3KP2A 4Q5SF 3OYBA 4UXNA 2BBYA 3GLLA 3GW2A 3N05A 2X6XA 1ETKA 2CWEA 1J5YA 5L3BA 3KP4A 1A36A 1ZELA 2QQ9A 2ECBA 5FKNA 2ESHA 4BS9A 5IOZA 1LE8B 4A3LJ 3HOXJ 2GZWA 4D9JA 5KCMA 2DTRA 2ELHA 3KEQA 2FUG2 2VJJA 4DBRA 3HEFA 3PUFA 2HU9A 4M73A 3M8EA 2JJ7A 5HDGA 3DKWA 1ETVA 2DMNA 4E7LA 3DV8A 1WJAA 3CCUI 2XSDC 3OSGA 3FK7A 4MFEA 3RTRA 1LKXA 4HV5A 3J81K 3D5RC 3CUQB 3PIOF 1SVLA 2H8WA 3NARA 3IWZA 2P0WA 5HNFA 5HS9A 5B1AH 2VXDA 1H8AC 4EJTA 3E97A 5DCFA 1VQLI 1STZA 4L0ZB 2G7UA 3HL2A 1WGXA 2V9VA 3CC2I 5ILSA 3CCMI 2QUFA 1A31A 3A03A 5HDNA 1JUSA 1BIBA 2MABA 2LKPA 2HNHA 1S3JA 2ELKA 5B1BH 1B9MA 2K86A 3W2VA 1SMYF 2X0LA 3EUKL 1LVKA 2WAQN 4D5CA 2JA5J 2VUMJ 3S2HJ 4TV7A 4D1QA 5TGTA 3CLOA 1XC5A 2ID6A 3T8RA 1HW2A 4XONA 4UNOA 3NWTA 4ON0A 4HF2A 3Q9VA 2A68F 5D5UB 3CJNA 4OMYA 3ZPLA 1SVMA 3RCOA 5M5YJ 2OBPA 3PM1A 3F9KA 3LSPA 5CVUA 1QHHD 2UUZA 4MFDA 1IF1A 1HBXG 5EEHA 4GO1A 2BW3B 4YFKF 3JSPA 3HKZA 3SHFA 1KU9A 4IHWA 3HTUA 3A0HC 1XD7A 4CO8A 4HEA2 2DYRH 3F8FA 2ZFWA 3E0JB 2YS9A 4IOCF 2K85A 3AG3H 4M6VA 4X6AJ 1XGNA 2CUEA 5H6RA 3FXJA 3H9JA 3RQIA 5A2QZ 2VPLA 4XLCA 4Q47A 4L5EA 2RC4A 5E8IA 4S05A 3P9IA 4M9ZA 3CCEI 5GAGJ 2OF7A 3GX4X 3HSRA 3CF2A 3KZYA 2DBBA 2EFWA 2A6TA 3GTOJ 3K1NA 2X6YA 5F64A 4DQ2A 4RA2A 4HLYA 3BCBA 5FJ8J 1EH8A 1I3AA 3L2RA 3QOPA 4L9JA 3VOEA 2O8KA 1UFMA 4ZYGA 3SZGA 5J3LA 3QPHA 4BXUA 2ME6A 1VTNC 2CGPA 1OCTC 2ZO4A 1R9TJ 3E6BA 4FETA 5J4VA 5AIQA 4A3BJ 2PQ8A 1UELB 4E4HA 1D1CA 3CZ6A 2Z3YA 2GWRA 4NC8A 5D5XB 1LE8A 4OOIA 2Z99A 3QQAA 4DJAA 4ZZLA 4QPOA 4V19K 1JUMA 2VJIA 5HODA 5HLIA 1I1GA 3DFGA 4IO9F 2DA6A 2KIUA 3C1DA 3LSTA 3VEPA 2DFFA 1YTYA 1HKQA 2OUMA 3S1NJ 3C3WA 3BJ6A 3CLQA 3FK6A 4XM3A 4XN0A 3ZMZA 5E3OA 2L7ZA 5IP7J 3BCAA 1MBGA 2LFBA 2XPVA 3HRSA 4XNFA 2CV2A 3PNVA 6PAXA 4J01A 1EA3A 5K5OA 2Q2EA 3KCCA 2P8TA 3VPRA 3GBGA 3S17J 2Z1DA 5EEGA 3ABMH 5GPCA 1S8NA 2WV1A 2ZSIB 3MKWB 3H0DA 2R5YA 4AWXB 3I4MJ 1JTXA 2L2OA 3BC8A 1CF7B 2ZKZA 4BU2A 2R7OA 4LLGF 1N77A 1W5SA 2A5YB 1QNTA 3TP0A 3C18A 4BY1J 4A0ZA 4ZZDA 2CRGA 1QU3A 1RR7A 1ZKGA 2Y9ZA 3DEUA 1MD0A 4BXXJ 2LOOA 4O5VA 3BG6A 1YJ9I 1TW3A 4B3XA 1ZLJA 1X2MA 3I9V2 1K4TA 1J7KA 3K4NA 4ZYEA 4OINF 2H94A 1SMTA 2VKVA 4BE2A 1EH6A 1XCVA 1FOYA 2Z33A 2VXZA 3TDUC 1X4PA 3LQRA 1MMDA 1UG2A 1MBJA 1K4SA 4G6DA 2JMWA 1YLFA 3QYEA 3FBIB 3W6JB 4CSWA 3LL7A 2OTJI 1ETXA 3NAUA 1FBSA 1YHQI 2HR3A 5C4JJ 2HQRA 3IKVA 1QZEA 3JTGA 4G12A 3V8LA 2R7WA 3KETA 3SEZA 1W7PD 1F9NA 2X6WA 3FIWA 1A35A 1V5FA 2XB5A 1IN4A 3SDGA 3ZMSA 5EG0B 4Y33A 1W0UA 3F8NA 1M1EB 2R5YB 4XN3A 5F08A 1Y39A 3KPHA 4XL9A 4KNYA 3RYPA 2L54A 4WXDA 4B8XA 2M3AA 3HXLA 4X0GA 4D5FA 1TWGJ 3CTAA 4XQFA 3WU0A 1V5GA 4CCKA 3JRBA 1FP1D 3HBLA 4L5IA 3WTWC 5C4XJ 1D0ZA 1A6QA 2A6EF 3K70C 3CMYA 4IXAA 1Z0XA 1BW5A 4XRSG 2M4KA 3H5NA 1YRNA 1FOKA 2BHYA 1ZGWA 1V54H 3T0YA 1O3RA 3ASOH 1MSFC 2DYSH 2RNGA 2QCOA 1I6HJ 1LDKB 4LB5A 1TLHB 2JA2A 2XDVA 1ZREA 2QKMB 1USTA 4KITB 1Y1VJ 4MQ9F 4OMZA 1BI3A 2Y9YA 4HF0A 2ZXHA 3QPTA 2VN2A 4NBQA 3EUHC 3PNTA 1LB2A 1I1SA 1OKRA 1QBJA 1WFXA 3GO5A 1X19A 2XAHA 2K40A 1W7PB 1R23A 3IUOA 2HDWA 1IGNA 2K9MA 1MW7A 2Q2EB 2ETHA 3KZZA 3OV8A 4AIJA 2L7KA 4OIPF 2P5KA 4FT8A 3ZR8X 3OS1A 2HFHA 2P5VA 4GGGA 4E7KA 2DTZA 2CH0A 4G6TB 1Z1DA 1LVAA 3PUBA 1QVTA 3PO2J 1RC9A 1TZLA 2CSOA 1NG6A 1XSXA 2NXNB 4LG3A 2F5VA 5JI6A 3RYRA 4CZCA 2ZC2A 5FFXA 2FBKA 2EFPA 5DCMB 3E6MA 5ICFA 2J5OA 3JCUC 3T1BA 4HW0A 4AD9A 2GA1A 2P4WA 2XRLA 5JFRA 3JW4A 1OLTA 3FHZA 2CS3A 2O03A 4UUTA 2MG4A 2FOKA 4M9SA 3ZXSA 2XGEA 3SYTA 2A5WA 3REOA 3F6OA 2XKOA 4RS8A 5LHGA 3CCSI 4FCYA 2JSPA 3OL3A 2QKLB 2IAIA 4IF4A 4I09A 3O8HA 3I55I 3PFIA 4OWRB 1K61A 3U1DA 3A02A 4I7HA 2P7CB 1KGSA 2DMTA 1FYKA 1B59A 3CJRB 2JVGA 2ZNZA 4NQWB 4I76A 4LK1F 1E2XA 5ICGA 4MLOA 4XRFA 3CP2A 3FMQA 1FMVA 3QODA 1U78A 2CW0F 4AUXA 5E1ZB 1P4AA 2K3PA 2YX4A 1FPQA 3CP8A 3N97A 2NVUB 4EQQA 1ZTRA 1WKMA 2E2HJ 3ZCOA 2GXGA 1A5JA 4LJZF 2W7NA 1QVUA 3OOUA 4Z6YA 1XDUA 3DU5A 2JTVA 3K4KA 2IGKA 4XSZF 2R7VA 1F36A 3OYEA 1VQOI 2R7SA 5LD2C 3DF8A 2XAUA 2CFOA 1HLVA 3UNGC 1O4XA 2XUBA 1R4NB 1BR4A 1D8KA 3BT9A 2MC3A 4HNUA 3EDPA 1VQ6I 3A1YA 2JT1A 4YG2F 4IX7A 2B9SA 1TW2A 2DA4A 2IP2A 2NNNA 3OSFA 1WI9A 2EBIA 2HQ5A 2XRNA 3MZHA 2WTEA 3X2QH 1APLC 2LKXA 2NAZA 3FXRA 1DGRM 2B63J 2CYYA 2E7XA 2LY9A 2M34A 3ZP5A 4EGYA 2QQ8A 3KZIC 1TWAJ 3AL0C 1K78B 3M4OJ 2IGMA 2LYCA 3F8BA 4KIFA 3OYHA 5EDNA 2W1OA 2V9KA 1MBEA 3TOAA 4EMSA 3TO6A 3BR2A 1QGPA 1J2XA 2R7QA 5LGNA 1R58A 1TNSA 4HV6A 4CICA 2L9VA 1YOVB 4ZYAA 4HNVA 4C2MJ 3HOUJ 2ADUA 3KP6A 5C3EJ 2VQCA 1ZH5A 3PFYA 1T56A 1T98A 1J59A 2VT3A 3EETA 4I2OA 2QYOA 3RKQA 3BZCA 5BS6A 1F5TA 4N0BA 1SFKA 2I10A 1AHDP 2BGCA 4OAYA 3LNQA 1LJ9A 1IRXA 1SFEA 2ID3A 4A3GJ 3BQZA 2DT5A 4F7ZA 1V3FA 5HOOA 2MH9A 1ITYA 4D7NA 3QPSA 2NVXJ 2X1DA 2KQRA 1TWHJ 4UUSB 4AVPA 3OMYA 2M45A 4QLCU 2G0EA 2L9RA 4XKVA 2VBXA 3V8KA 1IZ1A 1OR7A 1PYVA 3JRGA 3KFWX 3L2WA 2O8XA 3CJQB 3K9TA 3JRHA 5LBQA 2BYVE 2Y0SN 3O8GA 1JUPA 3LSKA 4P9UA 3ZGKA 2MBFA 4DZPA 1IN6A 3V7SA 4MTEA 1JHHA 3LSMA 4P5OA 4FE7A 5GP9A 4GFBA 1FTZA 1XGMA 1AWCA 4BHCA 1EJ9A 1ZGJA 3DLAA 3GMEA 3UR3C 4CZZA 3HM5A 2K27A 4RGSA 1REPC 1IJWC 4KMUX 2HKXA 2XAFA 1WHUA 5DV5A 4AIHA 3FISA 3JRIA 3ZQHA 4X1EA 5DM7F 1MDMA 2VIXA 2LKSA 2O5RA 1D5YA 3S3MA 5CPRB 3S93A 2HEOA 1IC8A 1JJ6C 2VONA 2R0QC 2VKHA 2XGCA 2EK5A 1FC3A 4MEYF 1XMKA 1O3SA 1R7JA 4IVNA 1XGOA 2R7ZJ 4GYGA 4BDYA 3DU6A 3IAM2 5LEKA 5BOXA 4W1UA 4K2EA 2BVMA 3PQKA 1LDJA 3FX3A 1HXDA 1O3TA 3I4PA 2BE5F 2OTLI 2LDUA 3L1PA 4XSXF 1P92A 4A5MA 3WODF 5AONA 2CQKA 1E0EA 1R1VA 1BIAA 3C2GA 4M6YA 2HXOA 3MFKA 4IHXA 1ZGAA 2IGNA 1FMWA 2KISA 1PP7U 4IJAA 2W57A 3K2AA 1FX7A 3CUQC 5JR3A 1OMIA 1TQIA 4UB6C 3K4BA 3R0AA 4AVZA 1RI7A 5D6EA 1WJ5A 3TQNA 3I5UA 2BXYA 2W82A 2G7HA 3OIQA 3TP3A 3KX2A 2IS1A 4BACA 4BJTA 2JPBA 3P5JA 4I0AA 2EZIA 2XF7A 4M3GA 5E3MA 2EWNA 3DLLF 2IA1A 3EPZA 5GAEJ 1O57A 3ZOBA 3DKYA 1RETA 5FKLA 4JP0A 3E6CC 3OWTA 2YUSA 2DLLA 2LRDA 3LMMA 4E7ZA 4PGGA 2E2JJ 4RAZA 4UUVA 3SFIA 1YE9A 2R7XA 1L3LA 5J40A 2QZ8A 2M5WA 3S1MJ 4F3QA 2DOAA 3C7JA 4CCNA 1YITI 4V2GA 1HSTA 1MGTA 4M3DA 1RZ4A 5H6QA 2FEZA 4A3IJ 4Y17A 3R6SA 2P5LC 5CJ9A 2Y48A 1H0MA 2KHMA 4IZZA 2FBHA 4XIDA 2DCEA 4ZTJA 4GCVA 4NDLA 2FNPA 3HOYJ 4WXCA 2IVMA 3O3KA 5CYVA 4KYWA 3I71A 2KPMA 3VSLA 1W7PA 3IL2A 2K02A 3IH4A 2MH2A 4DGWB 2KMUA 3K69A 4OIOF 3H3ZA 2Y0MA 2Z2SB 1BW6A 4A3MJ 2M4GA 2F4IA 2A05A 2XPWA 3BP8A 1Y56A 1OYWA 2XHKA 3BLYA 1SAUA 5E1WA 4B48A 1YG2A 1VQ8I 1DP3A 2IEKA 2ZSHB 2R4GA 4EJWA 1W5CC 2HS5A 3BTIA 4RB1A 2DK5A 4Y4RA 1KZHA 1IDYA 1X2NA 1FYLA 3WG7H 3BG9A 5BPIA 4XOPA 2YX7A 5CQEA 5EZGA 1MH4A 4ZYDA 5F0CA 1T6SA 2DFHA 1W4MA 5HS7A 2PLYA 4CH7A 3WTYC 2LY1A 2FU4A 1YS7A 2L4MA 2X6OA 1FBUA 2KLOA 3V4GA 1GV5A 5HNHA 1SC7A 2RDPA 4KISA 5DTDA 1OCZH 4P1WA 2LP0A 3VB2A 2FMLA 2VODA 3OL4A 2EZKA 1WJFA 4E7SA 3FMRA 4ASNA 3TW6A 4Y15A 2R7FA 5FRNA 5E8GA 1TP4A 3GTGJ 4BJ5C 1JGSA 4MNUA 4R1HA 3W6VA 2AO9A 3J80Z 3LFUA 1TWCJ 3VYSB 2KZVA 2WY8Q 2YU3A 3WU2C 1Z9CA 3JRDA 1Y0UA 1ODDA 3OIOA 2KFDA 1RKTA 1WWXA 2EFNA 5FGMA 1U8RA 2MGQA 1KYWA 2HYGD 4R8HA 1Z6RA 2DMUA 3BR3A 5ERIA 3ZQCA 2ACJA 4BY7J 3BPVA 2BOLA 1NHAA 3QU3A 3AFHA 2MD5A 4CCJA 2EZHA 2DOEA 1K7AA 3CMMA 3CCLI 1R4MB 1TQMA 3WE3A 1Z6TA 4MHGA 3COAC 2KIQA 2PFBA 2M7AA 1RR8C 4IKFA 1BOBA 2VBYA 4PJJA 3CMEI 1JT0A 2FE3A 2DDAA 4A0YA 3CO7C 4F92B 2ZJQF 2R5ZA 2R7TA 1MJ9A 1IO2A 2R7UA 1MJBA 4CDGA 1XDSA 3WU1B 4FE4A 5DS9A 3FXQA 4CHUA 5J8FA 2LG4A 4KICA 4HG2A 1T95A 3HPHA 2HOEA 3BG5A 5CVRA 3SJMA 4UY8I 5CKTA 2K4JA 4B47A 1QA6A 4YEJA 2QEXI 1CGPA 1SAXA 3JR9A 4P96A 3KIOA 4HX7A 1H9TA 1V5EA 4S04A 5FO5A 5DYMA 2RAEA 4F93B 2HOSA 1RIOH 1HSJA 1SD4A 1KQ8A 3TDZC 4RM3A 3BY6A 3RKYA 2EFOA 4BH9A 1RUOA 2ISZA 1RESA 5B3SH 3D1NI 4FX4A 3GTLJ 4LLNA 4A3EJ 2W84A 4EM0B 1Z67A 2L02A 4JBAA 4KN7X 2Q8KA 4DYCA 1X1DA 4WX9A 5HLTA 1LEAA 3WTXC 3QYFA 4G7HF 5M5XJ 4Y3OA 2KZGA 2BY0A 1FWZA 3SFZA 2CV1A 3BG3A 4QWQA 5FD6A 3BOQA 1P6RA 2A61A 1X4OA 3S2DJ 2VKDA 3F72A 3S32A 1Y8RB 1U2WA 1SD5A 4ETSA 3S1RJ 4DIQA 2P7VB 4IHSA 1TL8A 1HCRA 4B3AA 3DPLC 2JZYA 1NTCA 2ZNYA 3HSEA 2DA5A 4AIDA 5E18F 5E3NA 4N4OB 3UKGA 3HOVJ 3DWLE 3H3UA 3HRUA 3OYDA 1H89C 2M8GX 4PGHA 5CVJA 1W36D 4Y52J 1MBFA 4Y7NJ 1SD6A 3E5XA 4U7BA 3ROUA 3ISPA 4OAZA 4BL0B 3DBRB 1JE8A 3L9FA 5HDKA 2EILH 4O3MA 1AA7A 2Q0OA 2XGXA 3HJEA 3FXUA 3KEOA 1OPCA 3HZJA 4I0BA 4NUBA 3FBNB 1K6OA 3G71I 3DTKA 4A3FJ 1AU7A 4PDKA 1K79A 2GM4A 1R00A 4DYRA 5IOYA 2OCEA 3CQZJ 1O7FA 5M3FJ 2HQAA 3QPLA 3HKZN 3RZOJ 2CJJA 3CDHA 4OU0A 3RI4A 3EQLF 1GUUA 2CU7A 3Q3SA 2WAQA 3LSGA 3WTUC 4NC6A 1JKOC 2VE9A 1B8IB 2P81A 1IUYA 2W25A 3F22A 3E6DA 3IKTA 4QPQA 2V1XA 4NQWA 3EYIA 1ETQA 2GBYA 2W24A 2VJ5A 1ZRCA 4IHVA 4CGZA 1RUNA 5BQTA 1GVDA 2WB1N 5GPAA 1OJLA 4KJZA 1IDZA 3ELKA 2NOJB 3MZYA 2XROA 2N8GA 2HTJA 4PFOA 2V4JC 3GTQJ 4Y13A 4F91B 2FRHA 3K4JA 2HPMA 2K5CA 2KDZA 3NQOA 3BDDA 3W2WA 2QA4I 1BR2A 3DBLB 3K1MA 5DEQA 5BMZA 1DU0A 2FXAA 3JRFA 4M3FA 3EUAA 3HHHA 3I59A 3E3VA 4I02A 4PFPA 1R6RA 1T38A 1OCPA 4MTDA 1G3YA 3WG9A 1LEBA 1X1CA 2L7FP 1R49A 3A4CA 3ABKH 4BQNA 1FLIA 2UXXA 5D4RA 1AOYA 1IN5A 4PJNA 1ZR4A 3TL4X 5IT9Z 1P7JA 3OYKA 3AL0B 5M3MJ 1N25A 3Q5FA 1P4WA 3DEWA 1F1ZA 1V55H 3WTTC 2F6CA 4KIBA 3KP3A 4FISA 5JVGF 3HIFA 4BHPA 4YELA 3TEDA 2V7FA 4KMFA 2A07F 2E71A 1JTYA 3BZKA 2DQLA 1I50J 1JKRC 3MCZA 1UHMA 5E20A 2M30A 2M87A 2F48A 3J7AO 2HOAA 3E1SA 2BHZA 1NK2P 5DDGA 2K9NA 1VQ9I 3JRAA 1RNLA 2JRMA 1BC8C 4A6DA 2M9HA 4C3JJ 3LAJA 2VB6A 1IN7A 1Y1WJ 2X4HA 4HZFA 2HYFA 3L2VA 5F0FA 1Z77A 1YX3A 3G1OA 4KUMA 2D1HA 3NWSA 3KYLA 2L01A 1A6IA 1VQ4I 5EGOA 4IRGA 1VZ0A 4U7DA 2FD5A 3F6VA 2VBZA 1SFOJ 1YX5A 1H9GA 2NVTJ 1LFPA 9ANTA 1QZZA 5TJJA 5F1JA 1MMSA 5DM6F 4HYEA 2I8DA 2DA2A 4CCOA 3I3LA 3E7LA 2GXBA 3WGHA 1YRNB 4PJLA 2L0KA 3DTEA 4JQFA 2E1OA 1IXSB 1WRJA 1FY7A 5J1RA 2IRFG 3ABTA 3LSJA 5TRDA 4G94A 2HYJA 3R61A 3SZTA 1J09A 2VLAA 4OIRF 4HRIA 3LAPA 2HQNA 1XN7A 3S14J 1MNMC 2VOOA 3CDLA 1ZLKA 2E1NA 1X3WB 1FBQA 2FNAA 4MIMA 1T8IA 3CJTB 1BR1A 4ESFA 3BTLA 4LK0F 1FOXA 3GWZA 4CXFA 2EV5A 2B0LA 2DO7A 4YFXF 3D5SC 4BXFA 1ZRFA 4B4CA 4PK4A 1IRGA 4PJMA 3A01B 3OYLA 1SD7A 1Z21A 2CO5A 3E5UA 3WHCA 3CCQI 1PDNC 2IT0A 4U88A 4CA0A 3BWGA 2QQAA 2Z9OA 3ZN0A 1S5LC 5H2FC 2F5CA 4UHTA 3M1EA 2D45A 1USSA 1E3OC 1ZHFA 2NS7A 3RJPA 5ICCA 1HC8A 1HOMA 1FIPA 2DAOA 3B6CA 4AC0A 3H92A 3EUHA 2PMZN 2FQ4A 3GCMA 2EQRA 2O0YA 2JSCA 3E5QA 4G6QA 4BBRJ 3JREA 1R5ID 1WZ2A 4AYBN 4PSXA 2V1NA 3L2QA 4M9XA 1A04A 1KU3A 2DA7A 2EZLA 2NYXA 4MGRA 1BM9A 2LTPA 2A6HF 2EIKH 5IT3A 3ABLH 1QO0D 2BEOA 3AKZA 4YIIA 2LBFB 3DTIA 1RPWA 2WV0A 3ZQQA 4IQJA 4XLFA 4R79A 2L5QA 1R5GA 4G7ZF 4JK1X 1DGWY 1FNNA 1S72I 2BZTA 5EF6A 1ENHA 3DBHB 1KQ0A 3LSHA 2BY3A 2IXSA 4CYDA 1J0RA
chains in the Genus database with same CATH topology
3I54A 2R3SA 3FMSA 5LLQA 2PEXA 4KFCA 2V6CA 4BQAA 2BV6A 3M9AA 5FFZA 4IRHA 3ML6A 4G7OF 1BJAA 2XV4S 2A69F 1R1TA 1GXPA 1G3TA 4AIKA 3M7GA 4ENKA 2MA3A 5LRRA 3JAMK 4N9IA 5J6XA 1I5ZA 2HKOA 1LQ1A 1DPRA 1OYIA 4GXOA 5LRSA 1HKTA 4EM2A 3GZ6A 1TQPA 4HDUA 3F23A 1K78A 4M6XA 3GXOA 3I53A 3DXJF 3F3XA 1LDDA 2O3FA 3R4KA 1ULYA 3V7RA 2F5EA 4A2UA 2IJLA 4D0PA 2ESNA 1IRFA 3OOPA 3GVAA 2Z5UA 4YFNF 2E1CA 4XLPF 4LB6B 2EV6A 4IHTA 1YYVA 4BNCA 5CLSA 2TDXA 5CVIA 3G3ZA 2EA4A 1G4DA 1IAWA 1X3UA 2CG4A 4LGWA 2V1DA 2KRFA 3I0TA 1IXRC 5D5VB 1ZG1A 4L9NA 1P2FA 3KP7A 4RB3C 4LD5A 5L3FA 4EGZA 4RB0A 4IPAA 2STTA 1MDMB 2NS0A 1C0WA 5K5RA 1UB9A 5FLXZ 3D0SA 2XAJA 1ZYRF 1I27A 2EV0A 3L09A 3QU6A 3D5LA 1T39A 4MQVA 5L3EA 1S7OA 3B73A 2FSWA 2M8EA 4EM1A 2KJCA 3BJAA 4L9TA 4NB5A 2DI3A 2RQPA 4O6JA 5ICEA 2NRAC 1HKSA 2COMA 5D5WB 2RNJA 5L3GA 5ED4A 1L0OC 1SFXA 2DW4A 2OZ6A 5FLXK 2UZKA 3L2CA 2RV8A 3R0JA 4HA8A 4M72A 4WF2A 3EYYA 4ENJA 1J9IA 1YW8A 2NNYA 1JHFA 3GFJA 4H0EA 5JVTA 3DP7A 2VBWA 2V1UA 5DD4A 2DFIA 3HRMA 3GLXA 3CUQA 2RVCA 2XAGA 1OYYA 2VC1A 4EJVA 1U5TA 3K0LA 4A5NA 4PCQA 2VT2A 4Z2YA 1JXSA 4KDPA 3V7CA 4WWCA 5KK1A 3LFKA 1R5HA 4XLNF 3ECOA 3WE2A 1S29A 1G6NA 2DK8A 2PJPA 3T5XA 3BZ6A 2OQGA 4YIFA 4RGXA 3HOSA 4EJUA 3NRVA 5CVVA 4RB2C 1BC7C 1XSVA 5D8KB 1B6AA 3DPTA 5A2QK 4A12A 3GZ5A 3FM5A 4U0VA 2KIMA 4EJOA 4UVBA 3S2WA 4LLLA 1FT9A 3SZPA 5DUIA 1GVJA 4HDVA 1KYZA 5LHHA 4HBLA 4L5JA 2C6YA 3KLNA 2GIVA 3GFLA 3GFMA 2PN6A 3SQNA 2JRTA 4KN4X 3TOBA 1ZRDA 4HQEA 3HUGA 2FQ3A 5F6FA 4HX8A 1S6LA 3HSFA 2AXLA 4MEXF 3WGIA 3JSOA 4HOBA 2F2EA 1IN8A 1HW1A 5HLGA 1MKMA 2J5PA 3BROA 3RKWA 3ULQB 3WTZA 1ON2A 2VE8A 4PZJA 2Y75A 2GQQA 1P4XA 2UWMA 4HF1A 3IRQA 2FA5A 4I01A 4A0XA 1ZG3A 4BAYA 3LWFA 3MEXA 5E1XA 1UHWA 3VFZA 1ONVA 1Z05A 1F4KA 3QP5A 4HQMA 3N4MA 2CFXA 3ZMTA 1W5TA 1O3QA 3RKXA 3GFIA 2EJRA 1YW7A 1O7LA 5DUKA 3IC7A 4P55A 1XB4A 3KE2A 3L7WA 2QENA 2RGVA 4ESJA 2EB7A 1ZG5A 2XAQA 1YS6A 2R7DA 3IWFA 3I64A 4BYYA 2AS5F 5L3CA 1T0FA 2KIFA 3QRFF 1KU7A 3T8TA 2D1VA 1U6GA 5BPDA 4IRIA 2XKPA 3L00A 3MWMA 2QM3A 2DU9A 1D8JA 1FYMA 2YPRA 1EH7A 1TBXA 1FP2A 2HGCA 4DNCA 1QQIA 4FHTA 4ENMA 5JHUA 5KVRA 4G8XA 1U3EM 5ILUA 2OU2A 2PBIA 2H09A 3HRTA 2DPUA 2M1BA 2OD5A 1HQCA 4HAMA 2LSOA 2QLZA 2YSRA 1XMAA 5D6FA 3LQQA 1XSDA 1WSUA 1SFUA 2P6TA 1B9NA 1IXCA 3K1PA 2F5FA 4EVIA 2ZBKA 3I58A 1G3WA 3TO9A 1B4AA 3WGGA 2KKOA 3BJOA 1D3YA 2F5DA 5ILVA 1BI0A 4ZYHA 1EV7A 4L9VA 5DCMA 3IHUA 2OAZA 3I59B 2HWVA 5F1RA 3HOTA 1I6XA 4M71A 1D5VA 1IW7F 5IT9K 3LA7A 1MJAA 2LF8A 1BBYA 4WXHA 3F21A 2QBYB 2GAUA 1BI1A 3AAFA 2GA2A 3MAJA 2OQRA 4UV9A 5K1YA 1R22A 3HYIA 3TGNA 1XGSA 2WWYA 4UVAA 3O6BB 5LHIA 3P7NA 2LNBA 2A3SA 2IA2A 3F8MA 2VOPA 4P9FA 3J80K 3P9KA 5D4SA 2PMUA 4RGUA 3RPQA 2H6BA 1G3SA 3M8FA 1T2KA 3MQ0A 3ZMVA 2EA2A 3F8CA 3LA2A 2JPCA 1KQ9A 2K4BA 4RAYA 1ZAOA 2RKHA 2L3DA 3U9GA 4WK8F 1R1UA 1FSHA 4G9YA 2LF7A 2ZCWA 2QVOA 2DQRA 5J8CA 3W6KB 4ENNA 1PP8F 4U0YA 2O6GE 3ZMUA 3RDIA 3WTSC 2FF4A 1WQ2A 4FX0A 4LMYA 1Z91A 5K5QA 2OA4A 4EV0A 4ZH4F 4LG0B 3U2RA 1CF7A 1XCBA 3CO6C 3FF5A 5LGTA 2EFQA 4BHBA 3J81Z 1BI2A 3LA3A 4E70A 1U5TB 5LEJA 1BN5A 3HHGA 1UCRA 1DDNA 2IW5A 3KP5A 1QPMA 1FSEA 4UV8A 2QBYA 2HZTA 3CUOA 3ZN1A 4XBFA 3HTSB 3PQJA 2D2WA 5D8LB 2ISYA 1S7AA 1TNTA 1FZPB 2PMHA 3ECHA 3R60A 5H20A 5DD8A 3RPUA 2E7WA 5FD5A 4B09A 3BPXA 2XASA 4LFUA 2FMYA 3IRRA 1DPUA 1YIOA 3B02A 4GYIA 2MLKA 2XVCA 3JTHA 5HS8A 2V79A 2ZXJA 3TKYA 5L3DA 2XIGA 2RN7A 4NHJA 3VODA 2PG4A 3FWEA 3ZMDA 2IA0A 3FZVA 4KIGA 2ZJ2A 1YQAA 3WTVC 4OIQF 4A6EA 1B1BA 3ABUA 3GYHX 3G73A 4ESBA 4KA4A 2K7LA 1V4RA 5HLHA 1ZN2A 1U5TC 3NEUA 1Q1HA 5HVQC 5AIPA 1DP7P 3O2PE 3KLOA 2QWWA 4HX4A 1DUXC 2MLGA 2HTSA 4LG0A 2O61A 2ZMEA 4WCGA 2QQBA 3GEZA 3JAMZ 3GUDA 2YR2A 3ERED 4U0WA 3P9CA 4L0YB 2IPQX 1ON1A 2WC2A 4HLXA 2KJBA 1J75A 2PI0A 1QZYA 3FM3A 4Q4ZF 1YFHA 2L4AA 2STWA 2UXNA 1ZARA 3GF2A 1LNWA 1E17A 2W85A 1PUEE 4KT5C 1KU2A 2OZUA 3Q9SA 5LGUA 3K2ZA 3SXYA 1MZBA 1YO5C 2H6CA 3RIRA 3QAHA 3DQVC 4N9HA 1GXQA 2ZMEB 5FB2A 3QP6A 2G9WA 3V8JA 4UVCA 1KA8A 2HDCA 1Z7UA 1HW5A 2FBIA 4Q48A 1R36A 2H27A 4L18B 4I98B 3ZQ7A 1GHCA 2P6SA 4M74A 1TTYA 1YW9A 5E17F 3TO7A 4RGRA 2DPDA 1BOAA 2VC0A 3KP2A 4Q5SF 4UXNA 2BBYA 3GW2A 2CWEA 5L3BA 1J5YA 3KP4A 2QQ9A 2ESHA 2GZWA 2DTRA 2ELHA 3KEQA 4M73A 3M8EA 5HDGA 3DKWA 3DV8A 3RTRA 4HV5A 3J81K 3CUQB 3IWZA 5HS9A 4EJTA 3E97A 5DCFA 1STZA 4L0ZB 2G7UA 2V9VA 5ILSA 2QUFA 5HDNA 1BIBA 2LKPA 1S3JA 1B9MA 2K86A 1SMYF 2X0LA 4TV7A 3CLOA 3T8RA 1HW2A 4UNOA 4ON0A 4HF2A 3Q9VA 2A68F 5D5UB 3CJNA 4OMYA 3ZPLA 2OBPA 5CVUA 1IF1A 1HBXG 5EEHA 4GO1A 4YFKF 3JSPA 3SHFA 1KU9A 3HTUA 1XD7A 4CO8A 3F8FA 2ZFWA 1XGNA 5H6RA 5A2QZ 4Q47A 4S05A 2RC4A 5E8IA 3P9IA 4M9ZA 3GX4X 3HSRA 3KZYA 2EFWA 2DBBA 3K1NA 5F64A 4HLYA 4DQ2A 1EH8A 3QOPA 4L9JA 3VOEA 1UFMA 4ZYGA 3QPHA 4BXUA 1VTNC 2CGPA 2ZO4A 3E6BA 5AIQA 2PQ8A 2Z3YA 2GWRA 5D5XB 4OOIA 2Z99A 4ZZLA 5HLIA 1I1GA 3DFGA 2KIUA 3C1DA 3LSTA 3VEPA 1YTYA 1HKQA 3C3WA 3BJ6A 3ZMZA 3HRSA 6PAXA 5K5OA 2Q2EA 3KCCA 2P8TA 5EEGA 1S8NA 4AWXB 1CF7B 2ZKZA 4LLGF 1W5SA 2A5YB 1QNTA 3C18A 4A0ZA 4ZZDA 3DEUA 1MD0A 4O5VA 1TW3A 1ZLJA 1J7KA 4ZYEA 4OINF 2H94A 1SMTA 1EH6A 1XCVA 2Z33A 2VXZA 3TDUC 3LQRA 4G6DA 1YLFA 3W6JB 1FBSA 2HR3A 2HQRA 3IKVA 3JTGA 3V8LA 3KETA 1W7PD 1F9NA 1IN4A 3ZMSA 3F8NA 4KNYA 3RYPA 2L54A 4WXDA 4B8XA 3CTAA 3WU0A 1FP1D 4L5IA 3WTWC 2A6EF 4IXAA 1FOKA 3T0YA 1O3RA 1LDKB 4LB5A 1TLHB 1ZREA 1USTA 4MQ9F 4OMZA 1BI3A 4HF0A 3QPTA 2VN2A 1LB2A 1I1SA 1OKRA 1QBJA 3GO5A 2XAHA 1W7PB 1R23A 3KZZA 2ETHA 4AIJA 3OV8A 4OIPF 2P5KA 4FT8A 2HFHA 2P5VA 4GGGA 1Z1DA 1LVAA 2CSOA 1XSXA 5JI6A 3RYRA 5FFXA 2FBKA 2EFPA 5DCMB 3E6MA 5ICFA 2J5OA 3T1BA 4HW0A 4AD9A 2GA1A 2P4WA 5JFRA 3JW4A 3FHZA 2O03A 2FOKA 4M9SA 3REOA 3F6OA 2XKOA 4RS8A 5LHGA 4IF4A 4I09A 3PFIA 3U1DA 4I7HA 2P7CB 1KGSA 1FYKA 1B59A 2ZNZA 4LK1F 1E2XA 5ICGA 4XRFA 3FMQA 1U78A 2CW0F 5E1ZB 1P4AA 2YX4A 1FPQA 3N97A 4EQQA 1WKMA 2GXGA 4LJZF 1XDUA 2JTVA 4XSZF 3DF8A 2XUBA 1D8KA 2MC3A 3EDPA 2JT1A 4YG2F 1TW2A 2IP2A 2NNNA 1WI9A 2XRNA 3MZHA 2WTEA 2NAZA 3FXRA 2CYYA 2E7XA 3ZP5A 4EGYA 1K78B 3F8BA 4KIFA 3TOAA 4EMSA 3TO6A 1QGPA 1J2XA 5LGNA 1R58A 1TNSA 4HV6A 4CICA 2ADUA 3KP6A 1ZH5A 1T98A 1J59A 2VT3A 3EETA 4I2OA 2QYOA 5BS6A 1F5TA 4N0BA 2BGCA 1LJ9A 1SFEA 2DT5A 4F7ZA 1V3FA 5HOOA 2MH9A 4AVPA 2M45A 4QLCU 2VBXA 3V8KA 1IZ1A 1OR7A 3KFWX 2O8XA 3K9TA 5LBQA 2BYVE 4P9UA 2MBFA 1IN6A 3V7SA 4MTEA 1JHHA 4P5OA 1XGMA 1AWCA 4BHCA 1ZGJA 4CZZA 2K27A 4RGSA 1REPC 4KMUX 2HKXA 2XAFA 5DV5A 4AIHA 1MDMA 2HEOA 2VONA 2EK5A 1FC3A 4MEYF 1XMKA 1O3SA 1R7JA 4IVNA 1XGOA 4GYGA 5LEKA 5BOXA 4K2EA 3PQKA 1LDJA 3FX3A 1HXDA 1O3TA 3I4PA 2BE5F 2LDUA 4XSXF 1P92A 4A5MA 3WODF 5AONA 2CQKA 1R1VA 1BIAA 4M6YA 3MFKA 1ZGAA 1PP7U 4IJAA 2W57A 1FX7A 3CUQC 5JR3A 1OMIA 1TQIA 3R0AA 1RI7A 5D6EA 3TQNA 3I5UA 2G7HA 2JPBA 4I0AA 2EWNA 2IA1A 1O57A 3E6CC 2DLLA 4PGGA 4RAZA 4UUVA 1L3LA 2QZ8A 2M5WA 3C7JA 1HSTA 1MGTA 1RZ4A 5H6QA 2FEZA 4Y17A 3R6SA 2P5LC 5CJ9A 2Y48A 1H0MA 2FBHA 4GCVA 2FNPA 4WXCA 2IVMA 3O3KA 5CYVA 4KYWA 3I71A 1W7PA 3IL2A 2K02A 2MH2A 3K69A 4OIOF 3H3ZA 2Y0MA 3BP8A 1OYWA 2XHKA 5E1WA 1YG2A 4EJWA 2HS5A 4RB1A 2DK5A 1FYLA 5BPIA 2YX7A 4ZYDA 1T6SA 2PLYA 1W4MA 5HS7A 3WTYC 2FU4A 1YS7A 2L4MA 1FBUA 3V4GA 2RDPA 3VB2A 2FMLA 2VODA 3FMRA 4ASNA 4Y15A 2R7FA 5E8GA 1JGSA 4MNUA 4R1HA 3J80Z 2YU3A 1Z9CA 1Y0UA 1ODDA 1WWXA 5FGMA 2EFNA 1U8RA 1KYWA 2HYGD 4R8HA 1Z6RA 5ERIA 2ACJA 3BPVA 1NHAA 3QU3A 2MD5A 1K7AA 1TQMA 3WE3A 1Z6TA 4MHGA 3COAC 2PFBA 2VBYA 2FE3A 4A0YA 3CO7C 1MJ9A 1MJBA 4CDGA 1XDSA 3WU1B 3FXQA 4CHUA 5J8FA 4KICA 2HOEA 5CVRA 2K4JA 1CGPA 1SAXA 4P96A 4HX7A 1H9TA 4S04A 5FO5A 5DYMA 1RIOH 1HSJA 1SD4A 1KQ8A 3TDZC 3BY6A 3RKYA 2EFOA 4BH9A 1RUOA 2ISZA 4FX4A 4LLNA 2W84A 4EM0B 2L02A 4JBAA 4KN7X 2Q8KA 4WX9A 1LEAA 3WTXC 4G7HF 1FWZA 3SFZA 4QWQA 5FD6A 1P6RA 2A61A 3BOQA 3F72A 4ETSA 1SD5A 1U2WA 2P7VB 4IHSA 3DPLC 2JZYA 2ZNYA 3HSEA 5E18F 3H3UA 3HRUA 4PGHA 5CVJA 1SD6A 3E5XA 4U7BA 3ROUA 3ISPA 1JE8A 3L9FA 5HDKA 4O3MA 2Q0OA 2XGXA 3FXUA 3KEOA 1OPCA 4I0BA 1K6OA 4PDKA 1K79A 1R00A 1O7FA 4OU0A 3CDHA 3RI4A 3EQLF 3WTUC 2VE9A 1IUYA 2W25A 3F22A 3E6DA 3IKTA 2V1XA 4NQWA 3EYIA 2W24A 1ZRCA 4CGZA 1RUNA 5BQTA 3ELKA 3MZYA 2XROA 2HTJA 4Y13A 2FRHA 3NQOA 3BDDA 3K1MA 5DEQA 5BMZA 2FXAA 3HHHA 3I59A 3E3VA 4I02A 1T38A 4MTDA 1G3YA 3WG9A 1LEBA 1FLIA 2UXXA 5D4RA 1AOYA 1IN5A 5IT9Z 3Q5FA 1P4WA 1F1ZA 3WTTC 4KIBA 3KP3A 3HIFA 4BHPA 4KMFA 2A07F 2DQLA 3MCZA 1UHMA 5E20A 2M30A 2M87A 3J7AO 5DDGA 1RNLA 1BC8C 4A6DA 3LAJA 1IN7A 2X4HA 4HZFA 2HYFA 4KUMA 2D1HA 2L01A 4IRGA 4U7DA 3F6VA 2VBZA 1H9GA 1QZZA 5TJJA 4HYEA 2GXBA 3WGHA 4JQFA 1IXSB 1WRJA 1FY7A 2IRFG 3ABTA 5TRDA 4G94A 3SZTA 3R61A 4OIRF 3LAPA 2HQNA 1XN7A 2VOOA 1ZLKA 2E1NA 2FNAA 1FBQA 4ESFA 4LK0F 3GWZA 4CXFA 2EV5A 2B0LA 2DO7A 4YFXF 1ZRFA 1IRGA 1PDNC 1SD7A 2CO5A 3E5UA 2IT0A 4U88A 3BWGA 2QQAA 2Z9OA 3ZN0A 2F5CA 4UHTA 2D45A 3M1EA 1USSA 1ZHFA 3RJPA 5ICCA 2DAOA 3EUHA 3H92A 2O0YA 2JSCA 3E5QA 4G6QA 4M9XA 1A04A 1KU3A 2NYXA 4MGRA 1BM9A 2A6HF 5IT3A 1QO0D 2BEOA 4YIIA 2WV0A 4R79A 1R5GA 4G7ZF 4JK1X 1FNNA 1KQ0A 4CYDA 1J0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I54 A;  2R3S A;  3FMS A;  5LLQ A;  2PEX A;  4KFC A;  2V6C A;  4BQA A;  2BV6 A;  3M9A A;  5FFZ A;  4IRH A;  3ML6 A;  4G7O F;  1BJA A;  2XV4 S;  2A69 F;  1R1T A;  1GXP A;  1G3T A;  4AIK A;  3M7G A;  4ENK A;  2MA3 A;  5LRR A;  3JAM K;  4N9I A;  5J6X A;  1I5Z A;  2HKO A;  1LQ1 A;  1DPR A;  1OYI A;  4GXO A;  5LRS A;  1HKT A;  4EM2 A;  3GZ6 A;  1TQP A;  4HDU A;  3F23 A;  1K78 A;  4M6X A;  3GXO A;  3I53 A;  3DXJ F;  3F3X A;  1LDD A;  2O3F A;  3R4K A;  1ULY A;  3V7R A;  2F5E A;  4A2U A;  2IJL A;  4D0P A;  2ESN A;  1IRF A;  3OOP A;  3GVA A;  2Z5U A;  4YFN F;  2E1C A;  4XLP F;  4LB6 B;  2EV6 A;  4IHT A;  1YYV A;  4BNC A;  5CLS A;  2TDX A;  5CVI A;  3G3Z A;  2EA4 A;  1G4D A;  1IAW A;  1X3U A;  2CG4 A;  4LGW A;  2V1D A;  2KRF A;  3I0T A;  1IXR C;  5D5V B;  1ZG1 A;  4L9N A;  1P2F A;  3KP7 A;  4RB3 C;  4LD5 A;  5L3F A;  4EGZ A;  4RB0 A;  4IPA A;  2STT A;  1MDM B;  2NS0 A;  1C0W A;  5K5R A;  1UB9 A;  5FLX Z;  3D0S A;  2XAJ A;  1ZYR F;  1I27 A;  2EV0 A;  3L09 A;  3QU6 A;  3D5L A;  1T39 A;  4MQV A;  5L3E A;  1S7O A;  3B73 A;  2FSW A;  2M8E A;  4EM1 A;  2KJC A;  3BJA A;  4L9T A;  4NB5 A;  2DI3 A;  2RQP A;  4O6J A;  5ICE A;  2NRA C;  1HKS A;  2COM A;  5D5W B;  2RNJ A;  5L3G A;  5ED4 A;  1L0O C;  1SFX A;  2DW4 A;  2OZ6 A;  5FLX K;  2UZK A;  3L2C A;  2RV8 A;  3R0J A;  4HA8 A;  4M72 A;  4WF2 A;  3EYY A;  4ENJ A;  1J9I A;  1YW8 A;  2NNY A;  1JHF A;  3GFJ A;  4H0E A;  5JVT A;  3DP7 A;  2VBW A;  2V1U A;  5DD4 A;  2DFI A;  3HRM A;  3GLX A;  3CUQ A;  2RVC A;  2XAG A;  1OYY A;  2VC1 A;  4EJV A;  1U5T A;  3K0L A;  4A5N A;  4PCQ A;  2VT2 A;  4Z2Y A;  1JXS A;  4KDP A;  3V7C A;  4WWC A;  5KK1 A;  3LFK A;  1R5H A;  4XLN F;  3ECO A;  3WE2 A;  1S29 A;  1G6N A;  2DK8 A;  2PJP A;  3T5X A;  3BZ6 A;  2OQG A;  4YIF A;  4RGX A;  3HOS A;  4EJU A;  3NRV A;  5CVV A;  4RB2 C;  1BC7 C;  1XSV A;  5D8K B;  1B6A A;  3DPT A;  5A2Q K;  4A12 A;  3GZ5 A;  3FM5 A;  4U0V A;  2KIM A;  4EJO A;  4UVB A;  3S2W A;  4LLL A;  1FT9 A;  3SZP A;  5DUI A;  1GVJ A;  4HDV A;  1KYZ A;  5LHH A;  4HBL A;  4L5J A;  2C6Y A;  3KLN A;  2GIV A;  3GFL A;  3GFM A;  2PN6 A;  3SQN A;  2JRT A;  4KN4 X;  3TOB A;  1ZRD A;  4HQE A;  3HUG A;  2FQ3 A;  5F6F A;  4HX8 A;  1S6L A;  3HSF A;  2AXL A;  4MEX F;  3WGI A;  3JSO A;  4HOB A;  2F2E A;  1IN8 A;  1HW1 A;  5HLG A;  1MKM A;  2J5P A;  3BRO A;  3RKW A;  3ULQ B;  3WTZ A;  1ON2 A;  2VE8 A;  4PZJ A;  2Y75 A;  2GQQ A;  1P4X A;  2UWM A;  4HF1 A;  3IRQ A;  2FA5 A;  4I01 A;  4A0X A;  1ZG3 A;  4BAY A;  3LWF A;  3MEX A;  5E1X A;  1UHW A;  3VFZ A;  1ONV A;  1Z05 A;  1F4K A;  3QP5 A;  4HQM A;  3N4M A;  2CFX A;  3ZMT A;  1W5T A;  1O3Q A;  3RKX A;  3GFI A;  2EJR A;  1YW7 A;  1O7L A;  5DUK A;  3IC7 A;  4P55 A;  1XB4 A;  3KE2 A;  3L7W A;  2QEN A;  2RGV A;  4ESJ A;  2EB7 A;  1ZG5 A;  2XAQ A;  1YS6 A;  2R7D A;  3IWF A;  3I64 A;  4BYY A;  2AS5 F;  5L3C A;  1T0F A;  2KIF A;  3QRF F;  1KU7 A;  3T8T A;  2D1V A;  1U6G A;  5BPD A;  4IRI A;  2XKP A;  3L00 A;  3MWM A;  2QM3 A;  2DU9 A;  1D8J A;  1FYM A;  2YPR A;  1EH7 A;  1TBX A;  1FP2 A;  2HGC A;  4DNC A;  1QQI A;  4FHT A;  4ENM A;  5JHU A;  5KVR A;  4G8X A;  1U3E M;  5ILU A;  2OU2 A;  2PBI A;  2H09 A;  3HRT A;  2DPU A;  2M1B A;  2OD5 A;  1HQC A;  4HAM A;  2LSO A;  2QLZ A;  2YSR A;  1XMA A;  5D6F A;  3LQQ A;  1XSD A;  1WSU A;  1SFU A;  2P6T A;  1B9N A;  1IXC A;  3K1P A;  2F5F A;  4EVI A;  2ZBK A;  3I58 A;  1G3W A;  3TO9 A;  1B4A A;  3WGG A;  2KKO A;  3BJO A;  1D3Y A;  2F5D A;  5ILV A;  1BI0 A;  4ZYH A;  1EV7 A;  4L9V A;  5DCM A;  3IHU A;  2OAZ A;  3I59 B;  2HWV A;  5F1R A;  3HOT A;  1I6X A;  4M71 A;  1D5V A;  1IW7 F;  5IT9 K;  3LA7 A;  1MJA A;  2LF8 A;  1BBY A;  4WXH A;  3F21 A;  2QBY B;  2GAU A;  1BI1 A;  3AAF A;  2GA2 A;  3MAJ A;  2OQR A;  4UV9 A;  5K1Y A;  1R22 A;  3HYI A;  3TGN A;  1XGS A;  2WWY A;  4UVA A;  3O6B B;  5LHI A;  3P7N A;  2LNB A;  2A3S A;  2IA2 A;  3F8M A;  2VOP A;  4P9F A;  3J80 K;  3P9K A;  5D4S A;  2PMU A;  4RGU A;  3RPQ A;  2H6B A;  1G3S A;  3M8F A;  1T2K A;  3MQ0 A;  3ZMV A;  2EA2 A;  3F8C A;  3LA2 A;  2JPC A;  1KQ9 A;  2K4B A;  4RAY A;  1ZAO A;  2RKH A;  2L3D A;  3U9G A;  4WK8 F;  1R1U A;  1FSH A;  4G9Y A;  2LF7 A;  2ZCW A;  2QVO A;  2DQR A;  5J8C A;  3W6K B;  4ENN A;  1PP8 F;  4U0Y A;  2O6G E;  3ZMU A;  3RDI A;  3WTS C;  2FF4 A;  1WQ2 A;  4FX0 A;  4LMY A;  1Z91 A;  5K5Q A;  2OA4 A;  4EV0 A;  4ZH4 F;  4LG0 B;  3U2R A;  1CF7 A;  1XCB A;  3CO6 C;  3FF5 A;  5LGT A;  2EFQ A;  4BHB A;  3J81 Z;  1BI2 A;  3LA3 A;  4E70 A;  1U5T B;  5LEJ A;  1BN5 A;  3HHG A;  1UCR A;  1DDN A;  2IW5 A;  3KP5 A;  1QPM A;  1FSE A;  4UV8 A;  2QBY A;  2HZT A;  3CUO A;  3ZN1 A;  4XBF A;  3HTS B;  3PQJ A;  2D2W A;  5D8L B;  2ISY A;  1S7A A;  1TNT A;  1FZP B;  2PMH A;  3ECH A;  3R60 A;  5H20 A;  5DD8 A;  3RPU A;  2E7W A;  5FD5 A;  4B09 A;  3BPX A;  2XAS A;  4LFU A;  2FMY A;  3IRR A;  1DPU A;  1YIO A;  3B02 A;  4GYI A;  2MLK A;  2XVC A;  3JTH A;  5HS8 A;  2V79 A;  2ZXJ A;  3TKY A;  5L3D A;  2XIG A;  2RN7 A;  4NHJ A;  3VOD A;  2PG4 A;  3FWE A;  3ZMD A;  2IA0 A;  3FZV A;  4KIG A;  2ZJ2 A;  1YQA A;  3WTV C;  4OIQ F;  4A6E A;  1B1B A;  3ABU A;  3GYH X;  3G73 A;  4ESB A;  4KA4 A;  2K7L A;  1V4R A;  5HLH A;  1ZN2 A;  1U5T C;  3NEU A;  1Q1H A;  5HVQ C;  5AIP A;  1DP7 P;  3O2P E;  3KLO A;  2QWW A;  4HX4 A;  1DUX C;  2MLG A;  2HTS A;  4LG0 A;  2O61 A;  2ZME A;  4WCG A;  2QQB A;  3GEZ A;  3JAM Z;  3GUD A;  2YR2 A;  3ERE D;  4U0W A;  3P9C A;  4L0Y B;  2IPQ X;  1ON1 A;  2WC2 A;  4HLX A;  2KJB A;  1J75 A;  2PI0 A;  1QZY A;  3FM3 A;  4Q4Z F;  1YFH A;  2L4A A;  2STW A;  2UXN A;  1ZAR A;  3GF2 A;  1LNW A;  1E17 A;  2W85 A;  1PUE E;  4KT5 C;  1KU2 A;  2OZU A;  3Q9S A;  5LGU A;  3K2Z A;  3SXY A;  1MZB A;  1YO5 C;  2H6C A;  3RIR A;  3QAH A;  3DQV C;  4N9H A;  1GXQ A;  2ZME B;  5FB2 A;  3QP6 A;  2G9W A;  3V8J A;  4UVC A;  1KA8 A;  2HDC A;  1Z7U A;  1HW5 A;  2FBI A;  4Q48 A;  1R36 A;  2H27 A;  4L18 B;  4I98 B;  3ZQ7 A;  1GHC A;  2P6S A;  4M74 A;  1TTY A;  1YW9 A;  5E17 F;  3TO7 A;  4RGR A;  2DPD A;  1BOA A;  2VC0 A;  3KP2 A;  4Q5S F;  4UXN A;  2BBY A;  3GW2 A;  2CWE A;  5L3B A;  1J5Y A;  3KP4 A;  2QQ9 A;  2ESH A;  2GZW A;  2DTR A;  2ELH A;  3KEQ A;  4M73 A;  3M8E A;  5HDG A;  3DKW A;  3DV8 A;  3RTR A;  4HV5 A;  3J81 K;  3CUQ B;  3IWZ A;  5HS9 A;  4EJT A;  3E97 A;  5DCF A;  1STZ A;  4L0Z B;  2G7U A;  2V9V A;  5ILS A;  2QUF A;  5HDN A;  1BIB A;  2LKP A;  1S3J A;  1B9M A;  2K86 A;  1SMY F;  2X0L A;  4TV7 A;  3CLO A;  3T8R A;  1HW2 A;  4UNO A;  4ON0 A;  4HF2 A;  3Q9V A;  2A68 F;  5D5U B;  3CJN A;  4OMY A;  3ZPL A;  2OBP A;  5CVU A;  1IF1 A;  1HBX G;  5EEH A;  4GO1 A;  4YFK F;  3JSP A;  3SHF A;  1KU9 A;  3HTU A;  1XD7 A;  4CO8 A;  3F8F A;  2ZFW A;  1XGN A;  5H6R A;  5A2Q Z;  4Q47 A;  4S05 A;  2RC4 A;  5E8I A;  3P9I A;  4M9Z A;  3GX4 X;  3HSR A;  3KZY A;  2EFW A;  2DBB A;  3K1N A;  5F64 A;  4HLY A;  4DQ2 A;  1EH8 A;  3QOP A;  4L9J A;  3VOE A;  1UFM A;  4ZYG A;  3QPH A;  4BXU A;  1VTN C;  2CGP A;  2ZO4 A;  3E6B A;  5AIQ A;  2PQ8 A;  2Z3Y A;  2GWR A;  5D5X B;  4OOI A;  2Z99 A;  4ZZL A;  5HLI A;  1I1G A;  3DFG A;  2KIU A;  3C1D A;  3LST A;  3VEP A;  1YTY A;  1HKQ A;  3C3W A;  3BJ6 A;  3ZMZ A;  3HRS A;  6PAX A;  5K5O A;  2Q2E A;  3KCC A;  2P8T A;  5EEG A;  1S8N A;  4AWX B;  1CF7 B;  2ZKZ A;  4LLG F;  1W5S A;  2A5Y B;  1QNT A;  3C18 A;  4A0Z A;  4ZZD A;  3DEU A;  1MD0 A;  4O5V A;  1TW3 A;  1ZLJ A;  1J7K A;  4ZYE A;  4OIN F;  2H94 A;  1SMT A;  1EH6 A;  1XCV A;  2Z33 A;  2VXZ A;  3TDU C;  3LQR A;  4G6D A;  1YLF A;  3W6J B;  1FBS A;  2HR3 A;  2HQR A;  3IKV A;  3JTG A;  3V8L A;  3KET A;  1W7P D;  1F9N A;  1IN4 A;  3ZMS A;  3F8N A;  4KNY A;  3RYP A;  2L54 A;  4WXD A;  4B8X A;  3CTA A;  3WU0 A;  1FP1 D;  4L5I A;  3WTW C;  2A6E F;  4IXA A;  1FOK A;  3T0Y A;  1O3R A;  1LDK B;  4LB5 A;  1TLH B;  1ZRE A;  1UST A;  4MQ9 F;  4OMZ A;  1BI3 A;  4HF0 A;  3QPT A;  2VN2 A;  1LB2 A;  1I1S A;  1OKR A;  1QBJ A;  3GO5 A;  2XAH A;  1W7P B;  1R23 A;  3KZZ A;  2ETH A;  4AIJ A;  3OV8 A;  4OIP F;  2P5K A;  4FT8 A;  2HFH A;  2P5V A;  4GGG A;  1Z1D A;  1LVA A;  2CSO A;  1XSX A;  5JI6 A;  3RYR A;  5FFX A;  2FBK A;  2EFP A;  5DCM B;  3E6M A;  5ICF A;  2J5O A;  3T1B A;  4HW0 A;  4AD9 A;  2GA1 A;  2P4W A;  5JFR A;  3JW4 A;  3FHZ A;  2O03 A;  2FOK A;  4M9S A;  3REO A;  3F6O A;  2XKO A;  4RS8 A;  5LHG A;  4IF4 A;  4I09 A;  3PFI A;  3U1D A;  4I7H A;  2P7C B;  1KGS A;  1FYK A;  1B59 A;  2ZNZ A;  4LK1 F;  1E2X A;  5ICG A;  4XRF A;  3FMQ A;  1U78 A;  2CW0 F;  5E1Z B;  1P4A A;  2YX4 A;  1FPQ A;  3N97 A;  4EQQ A;  1WKM A;  2GXG A;  4LJZ F;  1XDU A;  2JTV A;  4XSZ F;  3DF8 A;  2XUB A;  1D8K A;  2MC3 A;  3EDP A;  2JT1 A;  4YG2 F;  1TW2 A;  2IP2 A;  2NNN A;  1WI9 A;  2XRN A;  3MZH A;  2WTE A;  2NAZ A;  3FXR A;  2CYY A;  2E7X A;  3ZP5 A;  4EGY A;  1K78 B;  3F8B A;  4KIF A;  3TOA A;  4EMS A;  3TO6 A;  1QGP A;  1J2X A;  5LGN A;  1R58 A;  1TNS A;  4HV6 A;  4CIC A;  2ADU A;  3KP6 A;  1ZH5 A;  1T98 A;  1J59 A;  2VT3 A;  3EET A;  4I2O A;  2QYO A;  5BS6 A;  1F5T A;  4N0B A;  2BGC A;  1LJ9 A;  1SFE A;  2DT5 A;  4F7Z A;  1V3F A;  5HOO A;  2MH9 A;  4AVP A;  2M45 A;  4QLC U;  2VBX A;  3V8K A;  1IZ1 A;  1OR7 A;  3KFW X;  2O8X A;  3K9T A;  5LBQ A;  2BYV E;  4P9U A;  2MBF A;  1IN6 A;  3V7S A;  4MTE A;  1JHH A;  4P5O A;  1XGM A;  1AWC A;  4BHC A;  1ZGJ A;  4CZZ A;  2K27 A;  4RGS A;  1REP C;  4KMU X;  2HKX A;  2XAF A;  5DV5 A;  4AIH A;  1MDM A;  2HEO A;  2VON A;  2EK5 A;  1FC3 A;  4MEY F;  1XMK A;  1O3S A;  1R7J A;  4IVN A;  1XGO A;  4GYG A;  5LEK A;  5BOX A;  4K2E A;  3PQK A;  1LDJ A;  3FX3 A;  1HXD A;  1O3T A;  3I4P A;  2BE5 F;  2LDU A;  4XSX F;  1P92 A;  4A5M A;  3WOD F;  5AON A;  2CQK A;  1R1V A;  1BIA A;  4M6Y A;  3MFK A;  1ZGA A;  1PP7 U;  4IJA A;  2W57 A;  1FX7 A;  3CUQ C;  5JR3 A;  1OMI A;  1TQI A;  3R0A A;  1RI7 A;  5D6E A;  3TQN A;  3I5U A;  2G7H A;  2JPB A;  4I0A A;  2EWN A;  2IA1 A;  1O57 A;  3E6C C;  2DLL A;  4PGG A;  4RAZ A;  4UUV A;  1L3L A;  2QZ8 A;  2M5W A;  3C7J A;  1HST A;  1MGT A;  1RZ4 A;  5H6Q A;  2FEZ A;  4Y17 A;  3R6S A;  2P5L C;  5CJ9 A;  2Y48 A;  1H0M A;  2FBH A;  4GCV A;  2FNP A;  4WXC A;  2IVM A;  3O3K A;  5CYV A;  4KYW A;  3I71 A;  1W7P A;  3IL2 A;  2K02 A;  2MH2 A;  3K69 A;  4OIO F;  3H3Z A;  2Y0M A;  3BP8 A;  1OYW A;  2XHK A;  5E1W A;  1YG2 A;  4EJW A;  2HS5 A;  4RB1 A;  2DK5 A;  1FYL A;  5BPI A;  2YX7 A;  4ZYD A;  1T6S A;  2PLY A;  1W4M A;  5HS7 A;  3WTY C;  2FU4 A;  1YS7 A;  2L4M A;  1FBU A;  3V4G A;  2RDP A;  3VB2 A;  2FML A;  2VOD A;  3FMR A;  4ASN A;  4Y15 A;  2R7F A;  5E8G A;  1JGS A;  4MNU A;  4R1H A;  3J80 Z;  2YU3 A;  1Z9C A;  1Y0U A;  1ODD A;  1WWX A;  5FGM A;  2EFN A;  1U8R A;  1KYW A;  2HYG D;  4R8H A;  1Z6R A;  5ERI A;  2ACJ A;  3BPV A;  1NHA A;  3QU3 A;  2MD5 A;  1K7A A;  1TQM A;  3WE3 A;  1Z6T A;  4MHG A;  3COA C;  2PFB A;  2VBY A;  2FE3 A;  4A0Y A;  3CO7 C;  1MJ9 A;  1MJB A;  4CDG A;  1XDS A;  3WU1 B;  3FXQ A;  4CHU A;  5J8F A;  4KIC A;  2HOE A;  5CVR A;  2K4J A;  1CGP A;  1SAX A;  4P96 A;  4HX7 A;  1H9T A;  4S04 A;  5FO5 A;  5DYM A;  1RIO H;  1HSJ A;  1SD4 A;  1KQ8 A;  3TDZ C;  3BY6 A;  3RKY A;  2EFO A;  4BH9 A;  1RUO A;  2ISZ A;  4FX4 A;  4LLN A;  2W84 A;  4EM0 B;  2L02 A;  4JBA A;  4KN7 X;  2Q8K A;  4WX9 A;  1LEA A;  3WTX C;  4G7H F;  1FWZ A;  3SFZ A;  4QWQ A;  5FD6 A;  1P6R A;  2A61 A;  3BOQ A;  3F72 A;  4ETS A;  1SD5 A;  1U2W A;  2P7V B;  4IHS A;  3DPL C;  2JZY A;  2ZNY A;  3HSE A;  5E18 F;  3H3U A;  3HRU A;  4PGH A;  5CVJ A;  1SD6 A;  3E5X A;  4U7B A;  3ROU A;  3ISP A;  1JE8 A;  3L9F A;  5HDK A;  4O3M A;  2Q0O A;  2XGX A;  3FXU A;  3KEO A;  1OPC A;  4I0B A;  1K6O A;  4PDK A;  1K79 A;  1R00 A;  1O7F A;  4OU0 A;  3CDH A;  3RI4 A;  3EQL F;  3WTU C;  2VE9 A;  1IUY A;  2W25 A;  3F22 A;  3E6D A;  3IKT A;  2V1X A;  4NQW A;  3EYI A;  2W24 A;  1ZRC A;  4CGZ A;  1RUN A;  5BQT A;  3ELK A;  3MZY A;  2XRO A;  2HTJ A;  4Y13 A;  2FRH A;  3NQO A;  3BDD A;  3K1M A;  5DEQ A;  5BMZ A;  2FXA A;  3HHH A;  3I59 A;  3E3V A;  4I02 A;  1T38 A;  4MTD A;  1G3Y A;  3WG9 A;  1LEB A;  1FLI A;  2UXX A;  5D4R A;  1AOY A;  1IN5 A;  5IT9 Z;  3Q5F A;  1P4W A;  1F1Z A;  3WTT C;  4KIB A;  3KP3 A;  3HIF A;  4BHP A;  4KMF A;  2A07 F;  2DQL A;  3MCZ A;  1UHM A;  5E20 A;  2M30 A;  2M87 A;  3J7A O;  5DDG A;  1RNL A;  1BC8 C;  4A6D A;  3LAJ A;  1IN7 A;  2X4H A;  4HZF A;  2HYF A;  4KUM A;  2D1H A;  2L01 A;  4IRG A;  4U7D A;  3F6V A;  2VBZ A;  1H9G A;  1QZZ A;  5TJJ A;  4HYE A;  2GXB A;  3WGH A;  4JQF A;  1IXS B;  1WRJ A;  1FY7 A;  2IRF G;  3ABT A;  5TRD A;  4G94 A;  3SZT A;  3R61 A;  4OIR F;  3LAP A;  2HQN A;  1XN7 A;  2VOO A;  1ZLK A;  2E1N A;  2FNA A;  1FBQ A;  4ESF A;  4LK0 F;  3GWZ A;  4CXF A;  2EV5 A;  2B0L A;  2DO7 A;  4YFX F;  1ZRF A;  1IRG A;  1PDN C;  1SD7 A;  2CO5 A;  3E5U A;  2IT0 A;  4U88 A;  3BWG A;  2QQA A;  2Z9O A;  3ZN0 A;  2F5C A;  4UHT A;  2D45 A;  3M1E A;  1USS A;  1ZHF A;  3RJP A;  5ICC A;  2DAO A;  3EUH A;  3H92 A;  2O0Y A;  2JSC A;  3E5Q A;  4G6Q A;  4M9X A;  1A04 A;  1KU3 A;  2NYX A;  4MGR A;  1BM9 A;  2A6H F;  5IT3 A;  1QO0 D;  2BEO A;  4YII A;  2WV0 A;  4R79 A;  1R5G A;  4G7Z F;  4JK1 X;  1FNN A;  1KQ0 A;  4CYD A;  1J0R A; 
#chains in the Genus database with same CATH topology
 3PL8 A;  1HF0 A;  3IH2 A;  3I54 A;  2R3S A;  3FMS A;  5LLQ A;  4CYC A;  2R5Z B;  2M7B A;  1FIA A;  4A3K J;  2E35 A;  4XK4 A;  2PEX A;  4KFC A;  1E3P A;  2V6C A;  1T33 A;  4BQA A;  1XPX A;  1MBH A;  2BV6 A;  3M9A A;  1ZR2 A;  5FFZ A;  4IRH A;  3ML6 A;  2V9P A;  4G7O F;  3K6G A;  4RAG A;  1IV8 A;  1BJA A;  2XV4 S;  2JA8 J;  2A69 F;  1K83 J;  1R1T A;  3WHB A;  1GXP A;  1HDP A;  1G3T A;  4AIK A;  3M7G A;  2I5U A;  3G1L A;  2MA3 A;  4ENK A;  4ZJZ A;  5LRR A;  2VI6 A;  3HOW J;  1IUF A;  3JAM K;  4N9I A;  5J6X A;  1I5Z A;  2HKO A;  2GXA A;  4RBO A;  3Q0V A;  1LQ1 A;  2GIZ A;  2MYS A;  1DPR A;  1OYI A;  4GXO A;  3U1K A;  5LRS A;  2HZD A;  2VQL A;  1HKT A;  4E7J A;  4EM2 A;  5KHD A;  3CCJ I;  3CC4 I;  3S15 J;  3GZ6 A;  1TQP A;  4HDU A;  1B72 B;  3F23 A;  1K78 A;  2X9D A;  3H1C A;  4M6X A;  4A69 C;  3GXO A;  5BNG A;  1X1B A;  2IS2 A;  3I53 A;  3FXM A;  3DXJ F;  2CQN A;  1RKW A;  3QWL A;  3GZN B;  5EJC A;  1XG1 A;  3GTP J;  3F3X A;  1LDD A;  2O3F A;  3R4K A;  1ULY A;  2LMD A;  3HGG A;  2NOG A;  2FX0 A;  3V7R A;  2F5E A;  2OJE D;  4A2U A;  2CQQ A;  2IJL A;  3F0C A;  2E19 A;  3M8J A;  2TCT A;  5K7F A;  4D0P A;  3OY9 A;  3H3V K;  2ZXW H;  5JHF A;  2ECC A;  3LSI A;  2ESN A;  4ZDL A;  2EPF A;  3ZRG A;  5FLV A;  2X1C A;  2MFZ A;  1IRF A;  3OOP A;  3GVA A;  4E7H A;  2Z5U A;  4YFN F;  2E1C A;  1ZK8 A;  3M3Y J;  4XLP F;  5GTI C;  2CV0 A;  3CDI A;  2QSG X;  2H1L A;  3H5R A;  2E34 A;  4LB6 B;  3L2U A;  2EV6 A;  4IHT A;  2ELJ A;  4PSW A;  4D7M A;  1YYV A;  4BUP A;  3G2B A;  2R92 J;  2JUG A;  4BNC A;  5CLS A;  2Y0S A;  2TDX A;  3OYA A;  5CVI A;  2JA7 J;  1W0T A;  3MKL A;  3G3Z A;  2EA4 A;  4ANJ A;  1JKP C;  4ZTF A;  1G4D A;  1IAW A;  2KRC A;  1X3U A;  2CG4 A;  1SAN A;  2DN0 A;  2OV7 A;  4LGW A;  2Y31 A;  4CUG A;  2V1D A;  2XPU A;  4A3J J;  2QF7 A;  2KRF A;  2DJI A;  2KRH A;  1I3Q J;  3FXO A;  4EAT A;  3KYD B;  1N78 A;  3GTJ J;  3I0T A;  1IXR C;  2O9L A;  3HGY A;  3A0B C;  5D5V B;  5CQG A;  1ZG1 A;  2BY2 A;  4L9N A;  3ERM A;  1P2F A;  4BEH A;  1WI3 A;  3KP7 A;  5FLM J;  4RB3 C;  4LD5 A;  5L3F A;  4EGZ A;  4RB0 A;  2IS6 A;  4IPA A;  2M2E A;  1MMN A;  2STT A;  1MDM B;  2JQ7 A;  2MW8 A;  2NS0 A;  2DFE A;  1C0W A;  3LOC A;  4PJ0 C;  4XRM A;  5K5R A;  1Z3X A;  1UB9 A;  2PMZ A;  5FLX Z;  3D0S A;  5J1Y A;  2XAJ A;  2CUZ A;  2HDD A;  1ZYR F;  1I27 A;  2EV0 A;  5IYB J;  1XMX A;  3L09 A;  1MH3 A;  3RSN A;  2CQX A;  3QU6 A;  3D5L A;  1T39 A;  4MQV A;  3DEE A;  5L3E A;  1OR7 C;  1S7O A;  3B73 A;  2DXI A;  5J47 A;  2FSW A;  2M8E A;  2E5Z A;  4EM1 A;  2KJC A;  1YJW I;  3BJA A;  4L9T A;  4NB5 A;  2NVQ J;  2LR8 A;  2CW8 A;  1LFU P;  2DI3 A;  1XS9 A;  2RQP A;  4O6J A;  5F04 A;  5ICE A;  2NRA C;  1W36 C;  1HKS A;  2COM A;  3FDY A;  5D5W B;  2RNJ A;  5L3G A;  5ED4 A;  4HST A;  5EEA A;  4DYQ A;  1L0O C;  1SFX A;  2DW4 A;  2OZ6 A;  1LPQ A;  5FLX K;  1OCR H;  2UZK A;  1U9N A;  3G6E I;  3L2C A;  2RV8 A;  3R0J A;  4HA8 A;  4M72 A;  4WF2 A;  3EYY A;  3K10 A;  4ENJ A;  1J9I A;  1YW8 A;  2VL8 A;  2NNY A;  1JHF A;  3GFJ A;  4H0E A;  5JVT A;  1Y0N A;  3DP7 A;  2AQF A;  1N75 A;  2H8R A;  4GRI A;  2VBW A;  1W1W E;  2V1U A;  4C3I J;  5DD4 A;  3HRM A;  2DFI A;  3GLX A;  3PSI A;  3CUQ A;  4XKW A;  2RVC A;  2XAG A;  1OYY A;  2QGU A;  5TIS C;  2VC1 A;  2HVS A;  4EJV A;  1U5T A;  3QOE A;  3K0L A;  4A5N A;  5LFA A;  2FJ1 A;  1VQN I;  4PCQ A;  2VT2 A;  4QSH A;  1YI2 I;  2PJR B;  2ICW G;  3QYB A;  4Z2Y A;  1JXS A;  3H0G J;  4KDP A;  3V7C A;  4WWC A;  5KK1 A;  2BY1 A;  3S3N A;  3H36 A;  4H4K C;  3LFK A;  1R5H A;  3G4S I;  3BQY A;  2X51 A;  4XLN F;  3ECO A;  3WE2 A;  1S29 A;  1G6N A;  1BL0 A;  2DK8 A;  2PJP A;  4DOZ A;  4E6K G;  3ESW B;  1Q1V A;  2EIJ H;  4CCL A;  3CF5 F;  3T5X A;  4QIW N;  3BZ6 A;  2MSY A;  2OQG A;  4YIF A;  1TC3 C;  4RGX A;  3S3O A;  1PVE A;  3HOS A;  4EJU A;  4B43 A;  1MBK A;  3A01 A;  4BEH B;  3ZQL A;  3NRV A;  5CVV A;  4C2T A;  1BA5 A;  4RB2 C;  1BC7 C;  3GTM J;  1XSV A;  5D8K B;  1FJL A;  1U0J A;  2MD0 A;  2Y30 A;  2Y2Z A;  3BR6 A;  3MZ8 A;  4RM2 A;  1G2H A;  1B6A A;  3DPT A;  5GAH J;  5A2Q K;  4A12 A;  4ZDO A;  3GZ5 A;  3FM5 A;  4LOC A;  4U0V A;  3K4L A;  2KIM A;  4EJO A;  4UVB A;  3C2H A;  3S2W A;  3RPU D;  4LLL A;  2L7M P;  1FT9 A;  1HDD C;  1U9O A;  3SZP A;  5DUI A;  2AHQ A;  1GVJ A;  4JX4 A;  3IP4 B;  4HDV A;  4QTR A;  1X58 A;  1KYZ A;  1JJ8 C;  5LHH A;  2LY2 A;  2WY7 Q;  4HBL A;  3MVP A;  1XX5 A;  1POG A;  4L5J A;  4DW6 A;  2C6Y A;  2W48 A;  3JRC A;  5EGO B;  1X1P A;  2BVL A;  3KLN A;  2GIV A;  2CW7 A;  3GFL A;  2IBD A;  3GFM A;  3VYT B;  2PN6 A;  1ACI A;  3SQN A;  2JRT A;  4KN4 X;  1EF4 A;  3TOB A;  1ZRD A;  4HQE A;  3TMO A;  3HUG A;  3HC7 A;  4YRV A;  2FQ3 A;  4RMN A;  5F6F A;  4BQQ A;  4IOA F;  1G8X A;  2W4S A;  1RRJ A;  4HX8 A;  1S6L A;  3HSF A;  1U8B A;  2AXL A;  4MEX F;  3CMA I;  3J7A Y;  3WGI A;  3OYJ A;  3JSO A;  4HOB A;  2XSJ C;  3GTK J;  1IN8 A;  2F2E A;  3OYM A;  1HW1 A;  1ORK A;  5HLG A;  2J5P A;  1MKM A;  1Z7L A;  3BRO A;  1EKE A;  1D1A A;  1LUJ B;  3RKW A;  3ULQ B;  3Q0W A;  3WTZ A;  2LRE A;  1ON2 A;  2Z16 A;  3I56 I;  2VE8 A;  3S1Q J;  1OCO H;  4PZJ A;  2Y75 A;  2GQQ A;  3BG7 A;  1JGG A;  1P4X A;  1VI0 A;  4RLQ A;  4M3E A;  2UWM A;  5K7Z A;  3PSF A;  4HF1 A;  3J7Y J;  3IRQ A;  2FA5 A;  4S0H B;  4I01 A;  5C44 J;  4A0X A;  3OS0 A;  2LD5 A;  1ZG3 A;  4BAY A;  1GV2 A;  3LWF A;  1GLN A;  3MEX A;  5E1X A;  1UHW A;  3J7Z I;  3VFZ A;  2D5V A;  1ONV A;  1Z05 A;  1F4K A;  3CCY A;  3QP5 A;  4HSR A;  4C2U A;  2AQE A;  4HQM A;  3VWB A;  2CFX A;  4N4N B;  3N4M A;  2DDB A;  4C9Y A;  4AYB A;  1JI8 A;  1SEU A;  1X3Z B;  3ZMT A;  3OYF A;  2GLO A;  1W5T A;  1O3Q A;  2JN6 A;  3RKX A;  1T0F C;  3OR2 C;  3GFI A;  3K70 D;  2EJR A;  3PJR A;  1YW7 A;  1O7L A;  3BR1 A;  1Z3Y A;  5DUK A;  2KT0 A;  2CMP A;  4RLF A;  5FRO A;  3IC7 A;  4P55 A;  1XB4 A;  3OR1 C;  5J1U A;  1UG0 A;  3KE2 A;  3L7W A;  2QEN A;  2PX9 A;  2RGV A;  3K4C A;  4XRS A;  1H88 C;  4ESJ A;  1OIS A;  2EB7 A;  1ZG5 A;  2XAQ A;  4JX5 A;  1YS6 A;  4HNT A;  1UZC A;  2R7D A;  1VQM I;  3IWF A;  3H9G A;  1AKH B;  3I64 A;  2XB0 X;  3HOZ J;  4BYY A;  3CCR I;  3ONQ A;  3U21 A;  2AS5 F;  5F27 A;  1UAA A;  5L3C A;  3OS2 A;  2K3F A;  1T0F A;  2KIF A;  3QRF F;  4AU7 A;  1KU7 A;  4B44 A;  3T8T A;  2D1V A;  3RQ4 A;  1U6G A;  5BPD A;  4IRI A;  2XKP A;  3L00 A;  1S9H A;  3BR5 A;  3MWM A;  3FKI J;  2QM3 A;  4LIV A;  2DU9 A;  1D8J A;  2VKE A;  1FYM A;  2VAS A;  4DZJ A;  2YPR A;  2MC4 A;  4B1R A;  1EH7 A;  1TBX A;  4BJ6 C;  1FP2 A;  3AG1 H;  1PJR A;  2HGC A;  3H9Q A;  3TW7 A;  4DNC A;  1QQI A;  1FTT A;  1OCC H;  2IGO A;  4FHT A;  2JVH A;  4BKX A;  1R71 A;  4XKC A;  4ENM A;  5JHU A;  3S8P A;  3HDD A;  5KVR A;  1WVR A;  4G8X A;  2DA3 A;  4U87 A;  4BE0 A;  1U3E M;  5ILU A;  2OU2 A;  2RQQ A;  2TRT A;  4IQ4 A;  2DMQ A;  3W2A A;  1KON A;  2VQG A;  1MMA A;  2PBI A;  2BW3 A;  2H09 A;  4DBQ A;  3HRT A;  4IEJ A;  1VQP I;  2DPU A;  2M1B A;  4IHY A;  2W00 A;  2OD5 A;  2VQH A;  4A93 J;  1HQC A;  1AKH A;  1P7I A;  4HAM A;  2LSO A;  3CC7 I;  2XF5 A;  3OYG A;  1WH7 A;  2QLZ A;  1T08 B;  2YSR A;  1XMA A;  2LH9 A;  5D6F A;  3LQQ A;  1XSD A;  1BJZ A;  1WSU A;  1SFU A;  2P6T A;  1B9N A;  1IXC A;  4ABZ A;  3K1P A;  2F5F A;  3K7A J;  4EVI A;  2NS8 A;  4BQO A;  4V2F A;  2ZBK A;  2DA1 A;  3I58 A;  1G3W A;  4BDZ A;  1DU6 A;  1S7E A;  2LLK A;  2R93 J;  3TO9 A;  3VYU B;  1B4A A;  3WGG A;  3V42 A;  4AM3 A;  2KKO A;  3BJO A;  1D3Y A;  2M0C A;  3DCF A;  2WAF A;  2F5D A;  5ILV A;  1BI0 A;  4ZYH A;  5IP6 A;  1EV7 A;  4L9V A;  5DCM A;  3IHU A;  4A3C J;  2OAZ A;  3I59 B;  2XF6 A;  2HWV A;  1MIJ A;  2X48 A;  5F1R A;  1WPK A;  3HOT A;  1ERD A;  1I6X A;  3PO3 J;  4W97 A;  1MMG A;  3BTJ A;  4M71 A;  1CQT A;  1IW7 F;  3S16 J;  5IT9 K;  1D5V A;  3LA7 A;  1MJA A;  2LF8 A;  1BBY A;  1LFB A;  4I99 C;  4WXH A;  3F21 A;  1VQ5 I;  2QBY B;  2GAU A;  2XC7 A;  1NH3 A;  2L9S A;  1VFC A;  1FOW A;  4C30 A;  4F55 A;  1BI1 A;  3A2K A;  3AAF A;  1QHG A;  2GA2 A;  3MAJ A;  4JYK A;  2JK3 A;  2OQR A;  1JKQ C;  1ETO A;  2E36 A;  5KAI C;  4UV9 A;  3CD6 I;  1E3H A;  1F43 A;  5K1Y A;  4CCM A;  4RAF A;  1R22 A;  5JLW A;  2E60 A;  3HYI A;  5B66 C;  4A3D J;  2YU9 J;  2VPR A;  3TGN A;  2PJR A;  1XGS A;  4BE1 A;  2WWY A;  4UVA A;  3O6B B;  5LHI A;  3P7N A;  3M07 A;  5KAF C;  2LNB A;  2A3S A;  2F4O B;  2IA2 A;  2JUC A;  4XMY A;  5IP9 J;  3F8M A;  2VOP A;  4P9F A;  3J80 K;  3P9K A;  5D4S A;  2RRE A;  1QRY A;  2PMU A;  4RGU A;  3RPQ A;  1VQK I;  1OQY A;  2H6B A;  2KP6 A;  1G3S A;  3M8F A;  3TBI A;  1T2K A;  2EIN H;  1ETY A;  3MQ0 A;  3ZMV A;  2EA2 A;  4J00 A;  3F8C A;  3OYN A;  3LA2 A;  2JPC A;  1Y6I A;  1KQ9 A;  2UV1 A;  2K4B A;  4RAY A;  4GDF A;  1ZAO A;  3H35 A;  4M3B A;  2RKH A;  2L3D A;  3U9G A;  4WK8 F;  3ZQI A;  1R1U A;  2M0M A;  3C2B A;  1FSH A;  1OFC X;  2FOW A;  4G9Y A;  4ITV A;  2LF7 A;  1MND A;  5E3L A;  2ZCW A;  1K6Y A;  2V26 A;  2QVO A;  1D0Y A;  2WBM A;  2DQR A;  5J8C A;  2DOF A;  2KDO A;  5E79 C;  3VYR B;  3W6K B;  4ENN A;  2ZME C;  1PP8 F;  2HPI A;  4U0Y A;  2DT6 A;  3OYI A;  5FRM A;  5B5E C;  2O6G E;  2B7E A;  3ZMU A;  1XTA A;  2Y69 H;  4YIR X;  3RDI A;  2DMP A;  3WTS C;  2FF4 A;  3Q0U A;  5EZH A;  2ZJP F;  1WQ2 A;  2EH3 A;  2VJ4 A;  4FX0 A;  4LMY A;  4C3H J;  3G1M A;  1Z91 A;  4LIT A;  5K5Q A;  3M1C A;  3IAS 2;  1IRZ A;  3ZQG A;  2OA4 A;  3SEQ A;  4EV0 A;  1UMQ A;  4ZH4 F;  1GDT A;  4LG0 B;  1WCM J;  3U2R A;  1CF7 A;  1XCB A;  3VDX A;  3CO6 C;  3FF5 A;  5LGT A;  2EFQ A;  4BHB A;  3J81 Z;  1BI2 A;  4MO7 A;  3LA3 A;  2E2I J;  2V6E A;  4E70 A;  1U5T B;  3KEY A;  2LK2 A;  1BN5 A;  3HHG A;  5LEJ A;  4UUS A;  1UCR A;  1G59 A;  1DDN A;  1ZQ3 P;  2IW5 A;  4XLA A;  4XLE A;  1TT0 A;  2O7O A;  3KP5 A;  1QPM A;  2AXT C;  1FSE A;  2LBF A;  4UV8 A;  2QBY A;  1ETW A;  2HZT A;  3CUO A;  3ZN1 A;  2E5N A;  4XBF A;  5FKM A;  3HTS B;  2ZJR F;  3PQJ A;  2D2W A;  2L9N A;  1VND A;  4XIC A;  4NC7 A;  2HXI A;  2ISY A;  5D8L B;  1WJB A;  1S7A A;  1TNT A;  2HVR A;  1FZP B;  2K9Q A;  2PMH A;  3DKX A;  2F4M B;  3ECH A;  2COB A;  3R60 A;  5H20 A;  2HVQ A;  1DQU A;  2HI3 A;  5DD8 A;  3RPU A;  4CYC B;  2E7W A;  2ZXI A;  2GOX B;  2X1E A;  3HG9 A;  1GT0 C;  4FAS D;  5FD5 A;  5J4Y A;  3MD2 A;  1IV6 A;  3BTC A;  2XGD A;  5EG0 A;  4B09 A;  4JX6 A;  3BPX A;  3ASN H;  2JWT A;  2XAS A;  4LFU A;  2FMY A;  1HA8 A;  1D1B A;  3IRR A;  1DPU A;  1YIO A;  3B02 A;  5KNL A;  4I6Z A;  4BBS J;  4GYI A;  2MLK A;  2XVC A;  3JTH A;  1P9Q C;  4NNJ A;  5HS8 A;  3DPU A;  2V79 A;  5GTH C;  2E1M B;  2X85 A;  2ZXJ A;  5M5W J;  4HPQ A;  3TKY A;  2JA6 J;  1X1A A;  2CQ7 A;  2XIG A;  2RN7 A;  2ME0 A;  3OIP A;  4XLH A;  5L3D A;  3W3C A;  4NHJ A;  2CUJ A;  3VOD A;  2OPT A;  1IG7 A;  2PG4 A;  3FWE A;  1VF9 A;  3ZMD A;  2DOD A;  5IY5 H;  2WAD A;  2IA0 A;  3CCV I;  3IV5 A;  3SDB A;  1I39 A;  2NVY J;  2BXZ A;  3FZV A;  2CUF A;  1B72 A;  1PUF B;  4KIG A;  4IL6 C;  2ZJ2 A;  2E1M C;  3MN2 A;  1YQA A;  2OC6 A;  3WTV C;  4OIQ F;  4A6E A;  3FKJ A;  2WA0 A;  2OCC H;  1B1B A;  3ABU A;  3HB9 A;  3GYH X;  3G73 A;  3IH3 A;  3HUG B;  3FHN A;  1WJC A;  4UB8 C;  3VSK A;  4ESB A;  4KA4 A;  2LVS A;  4ZC3 A;  4XKB A;  2K7L A;  1V4R A;  5HLH A;  1ZN2 A;  2WB1 A;  1U5T C;  3NEU A;  4J19 A;  3CES A;  1Q1H A;  5HVQ C;  5AIP A;  1DP7 P;  3ZQF A;  2DT7 B;  3O2P E;  4F52 A;  3KLO A;  2QWW A;  4HX4 A;  1DUX C;  4XOT A;  3OYC A;  2MLG A;  2HTS A;  4LG0 A;  2WAE A;  2O61 A;  1FEX A;  3MKY B;  2Q1Z B;  3I4N J;  1JT6 A;  1WH5 A;  2ZME A;  4WCG A;  3MMY B;  2QQB A;  3GEZ A;  3JAM Z;  4KT6 A;  1TWF J;  3GUD A;  2R7R A;  2QSH X;  2YR2 A;  5JLX A;  3ERE D;  2ZFU A;  4U0W A;  3P9C A;  1MSE C;  5IYD J;  4L0Y B;  2IPQ X;  1ON1 A;  2WC2 A;  5IYC J;  2GOM A;  4HLX A;  2KJB A;  1J75 A;  2PI0 A;  5F0H A;  1QZY A;  3FM3 A;  3FXK A;  4Q4Z F;  1YFH A;  3B6A A;  2ZB9 A;  2DJN A;  2L4A A;  5K7H A;  3LSR A;  4FTH A;  2STW A;  2UXN A;  1ZAR A;  2K9S A;  4LIU A;  1WJD A;  1LNW A;  3GF2 A;  1E17 A;  2W85 A;  3K4M A;  1PUE E;  4KT5 C;  1YJN I;  3HPG A;  1KU2 A;  2OZU A;  2LC2 A;  3Q9S A;  5LGU A;  3K2Z A;  5EYR A;  2QSF X;  1VQ7 I;  3SXY A;  4EEF G;  3H5A A;  1UHS A;  1MZB A;  1NG7 A;  1YO5 C;  1YIJ I;  2EIM H;  3KYC B;  4ZDP A;  2H6C A;  5FKK A;  3RIR A;  3QAH A;  4PUS A;  4XR6 A;  5IPA A;  4RDU A;  3DQV C;  4N9H A;  1GXQ A;  4XOR A;  4FQG A;  4II3 A;  1SVO A;  2ZME B;  5FB2 A;  3QP6 A;  5GAD J;  1TT5 B;  1UJ8 A;  1B8I A;  2G9W A;  3V8J A;  3RZD J;  4UVC A;  1KA8 A;  2HDC A;  2HOT A;  1Z7U A;  3BR0 A;  3MKZ A;  3AG4 H;  1Y8Q B;  1HW5 A;  1MNE A;  2KL4 A;  2FBI A;  3PNY A;  4Q48 A;  5FKO A;  1R36 A;  1WJE A;  3FXL A;  2H27 A;  1QPI A;  4L18 B;  4II2 A;  4I98 B;  4E7I A;  3ZQ7 A;  1GHC A;  2IS4 A;  2P6S A;  4M74 A;  1TTY A;  1YW9 A;  3AG2 H;  4JOM A;  2H1K A;  5E17 F;  1PUF A;  3TO7 A;  4RGR A;  2K9L A;  2DPD A;  4BGD A;  1BOA A;  2VC0 A;  1NK3 P;  1D0X A;  3PIP F;  3KP2 A;  4Q5S F;  3OYB A;  4UXN A;  2BBY A;  3GLL A;  3GW2 A;  3N05 A;  2X6X A;  1ETK A;  2CWE A;  1J5Y A;  5L3B A;  3KP4 A;  1A36 A;  1ZEL A;  2QQ9 A;  2ECB A;  5FKN A;  2ESH A;  4BS9 A;  5IOZ A;  1LE8 B;  4A3L J;  3HOX J;  2GZW A;  4D9J A;  5KCM A;  2DTR A;  2ELH A;  3KEQ A;  2FUG 2;  2VJJ A;  4DBR A;  3HEF A;  3PUF A;  2HU9 A;  4M73 A;  3M8E A;  2JJ7 A;  5HDG A;  3DKW A;  1ETV A;  2DMN A;  4E7L A;  3DV8 A;  1WJA A;  3CCU I;  2XSD C;  3OSG A;  3FK7 A;  4MFE A;  3RTR A;  1LKX A;  4HV5 A;  3J81 K;  3D5R C;  3CUQ B;  3PIO F;  1SVL A;  2H8W A;  3NAR A;  3IWZ A;  2P0W A;  5HNF A;  5HS9 A;  5B1A H;  2VXD A;  1H8A C;  4EJT A;  3E97 A;  5DCF A;  1VQL I;  1STZ A;  4L0Z B;  2G7U A;  3HL2 A;  1WGX A;  2V9V A;  3CC2 I;  5ILS A;  3CCM I;  2QUF A;  1A31 A;  3A03 A;  5HDN A;  1JUS A;  1BIB A;  2MAB A;  2LKP A;  2HNH A;  1S3J A;  2ELK A;  5B1B H;  1B9M A;  2K86 A;  3W2V A;  1SMY F;  2X0L A;  3EUK L;  1LVK A;  2WAQ N;  4D5C A;  2JA5 J;  2VUM J;  3S2H J;  4TV7 A;  4D1Q A;  5TGT A;  3CLO A;  1XC5 A;  2ID6 A;  3T8R A;  1HW2 A;  4XON A;  4UNO A;  3NWT A;  4ON0 A;  4HF2 A;  3Q9V A;  2A68 F;  5D5U B;  3CJN A;  4OMY A;  3ZPL A;  1SVM A;  3RCO A;  5M5Y J;  2OBP A;  3PM1 A;  3F9K A;  3LSP A;  5CVU A;  1QHH D;  2UUZ A;  4MFD A;  1IF1 A;  1HBX G;  5EEH A;  4GO1 A;  2BW3 B;  4YFK F;  3JSP A;  3HKZ A;  3SHF A;  1KU9 A;  4IHW A;  3HTU A;  3A0H C;  1XD7 A;  4CO8 A;  4HEA 2;  2DYR H;  3F8F A;  2ZFW A;  3E0J B;  2YS9 A;  4IOC F;  2K85 A;  3AG3 H;  4M6V A;  4X6A J;  1XGN A;  2CUE A;  5H6R A;  3FXJ A;  3H9J A;  3RQI A;  5A2Q Z;  2VPL A;  4XLC A;  4Q47 A;  4L5E A;  2RC4 A;  5E8I A;  4S05 A;  3P9I A;  4M9Z A;  3CCE I;  5GAG J;  2OF7 A;  3GX4 X;  3HSR A;  3CF2 A;  3KZY A;  2DBB A;  2EFW A;  2A6T A;  3GTO J;  3K1N A;  2X6Y A;  5F64 A;  4DQ2 A;  4RA2 A;  4HLY A;  3BCB A;  5FJ8 J;  1EH8 A;  1I3A A;  3L2R A;  3QOP A;  4L9J A;  3VOE A;  2O8K A;  1UFM A;  4ZYG A;  3SZG A;  5J3L A;  3QPH A;  4BXU A;  2ME6 A;  1VTN C;  2CGP A;  1OCT C;  2ZO4 A;  1R9T J;  3E6B A;  4FET A;  5J4V A;  5AIQ A;  4A3B J;  2PQ8 A;  1UEL B;  4E4H A;  1D1C A;  3CZ6 A;  2Z3Y A;  2GWR A;  4NC8 A;  5D5X B;  1LE8 A;  4OOI A;  2Z99 A;  3QQA A;  4DJA A;  4ZZL A;  4QPO A;  4V19 K;  1JUM A;  2VJI A;  5HOD A;  5HLI A;  1I1G A;  3DFG A;  4IO9 F;  2DA6 A;  2KIU A;  3C1D A;  3LST A;  3VEP A;  2DFF A;  1YTY A;  1HKQ A;  2OUM A;  3S1N J;  3C3W A;  3BJ6 A;  3CLQ A;  3FK6 A;  4XM3 A;  4XN0 A;  3ZMZ A;  5E3O A;  2L7Z A;  5IP7 J;  3BCA A;  1MBG A;  2LFB A;  2XPV A;  3HRS A;  4XNF A;  2CV2 A;  3PNV A;  6PAX A;  4J01 A;  1EA3 A;  5K5O A;  2Q2E A;  3KCC A;  2P8T A;  3VPR A;  3GBG A;  3S17 J;  2Z1D A;  5EEG A;  3ABM H;  5GPC A;  1S8N A;  2WV1 A;  2ZSI B;  3MKW B;  3H0D A;  2R5Y A;  4AWX B;  3I4M J;  1JTX A;  2L2O A;  3BC8 A;  1CF7 B;  2ZKZ A;  4BU2 A;  2R7O A;  4LLG F;  1N77 A;  1W5S A;  2A5Y B;  1QNT A;  3TP0 A;  3C18 A;  4BY1 J;  4A0Z A;  4ZZD A;  2CRG A;  1QU3 A;  1RR7 A;  1ZKG A;  2Y9Z A;  3DEU A;  1MD0 A;  4BXX J;  2LOO A;  4O5V A;  3BG6 A;  1YJ9 I;  1TW3 A;  4B3X A;  1ZLJ A;  1X2M A;  3I9V 2;  1K4T A;  1J7K A;  3K4N A;  4ZYE A;  4OIN F;  2H94 A;  1SMT A;  2VKV A;  4BE2 A;  1EH6 A;  1XCV A;  1FOY A;  2Z33 A;  2VXZ A;  3TDU C;  1X4P A;  3LQR A;  1MMD A;  1UG2 A;  1MBJ A;  1K4S A;  4G6D A;  2JMW A;  1YLF A;  3QYE A;  3FBI B;  3W6J B;  4CSW A;  3LL7 A;  2OTJ I;  1ETX A;  3NAU A;  1FBS A;  1YHQ I;  2HR3 A;  5C4J J;  2HQR A;  3IKV A;  1QZE A;  3JTG A;  4G12 A;  3V8L A;  2R7W A;  3KET A;  3SEZ A;  1W7P D;  1F9N A;  2X6W A;  3FIW A;  1A35 A;  1V5F A;  2XB5 A;  1IN4 A;  3SDG A;  3ZMS A;  5EG0 B;  4Y33 A;  1W0U A;  3F8N A;  1M1E B;  2R5Y B;  4XN3 A;  5F08 A;  1Y39 A;  3KPH A;  4XL9 A;  4KNY A;  3RYP A;  2L54 A;  4WXD A;  4B8X A;  2M3A A;  3HXL A;  4X0G A;  4D5F A;  1TWG J;  3CTA A;  4XQF A;  3WU0 A;  1V5G A;  4CCK A;  3JRB A;  1FP1 D;  3HBL A;  4L5I A;  3WTW C;  5C4X J;  1D0Z A;  1A6Q A;  2A6E F;  3K70 C;  3CMY A;  4IXA A;  1Z0X A;  1BW5 A;  4XRS G;  2M4K A;  3H5N A;  1YRN A;  1FOK A;  2BHY A;  1ZGW A;  1V54 H;  3T0Y A;  1O3R A;  3ASO H;  1MSF C;  2DYS H;  2RNG A;  2QCO A;  1I6H J;  1LDK B;  4LB5 A;  1TLH B;  2JA2 A;  2XDV A;  1ZRE A;  2QKM B;  1UST A;  4KIT B;  1Y1V J;  4MQ9 F;  4OMZ A;  1BI3 A;  2Y9Y A;  4HF0 A;  2ZXH A;  3QPT A;  2VN2 A;  4NBQ A;  3EUH C;  3PNT A;  1LB2 A;  1I1S A;  1OKR A;  1QBJ A;  1WFX A;  3GO5 A;  1X19 A;  2XAH A;  2K40 A;  1W7P B;  1R23 A;  3IUO A;  2HDW A;  1IGN A;  2K9M A;  1MW7 A;  2Q2E B;  2ETH A;  3KZZ A;  3OV8 A;  4AIJ A;  2L7K A;  4OIP F;  2P5K A;  4FT8 A;  3ZR8 X;  3OS1 A;  2HFH A;  2P5V A;  4GGG A;  4E7K A;  2DTZ A;  2CH0 A;  4G6T B;  1Z1D A;  1LVA A;  3PUB A;  1QVT A;  3PO2 J;  1RC9 A;  1TZL A;  2CSO A;  1NG6 A;  1XSX A;  2NXN B;  4LG3 A;  2F5V A;  5JI6 A;  3RYR A;  4CZC A;  2ZC2 A;  5FFX A;  2FBK A;  2EFP A;  5DCM B;  3E6M A;  5ICF A;  2J5O A;  3JCU C;  3T1B A;  4HW0 A;  4AD9 A;  2GA1 A;  2P4W A;  2XRL A;  5JFR A;  3JW4 A;  1OLT A;  3FHZ A;  2CS3 A;  2O03 A;  4UUT A;  2MG4 A;  2FOK A;  4M9S A;  3ZXS A;  2XGE A;  3SYT A;  2A5W A;  3REO A;  3F6O A;  2XKO A;  4RS8 A;  5LHG A;  3CCS I;  4FCY A;  2JSP A;  3OL3 A;  2QKL B;  2IAI A;  4IF4 A;  4I09 A;  3O8H A;  3I55 I;  3PFI A;  4OWR B;  1K61 A;  3U1D A;  3A02 A;  4I7H A;  2P7C B;  1KGS A;  2DMT A;  1FYK A;  1B59 A;  3CJR B;  2JVG A;  2ZNZ A;  4NQW B;  4I76 A;  4LK1 F;  1E2X A;  5ICG A;  4MLO A;  4XRF A;  3CP2 A;  3FMQ A;  1FMV A;  3QOD A;  1U78 A;  2CW0 F;  4AUX A;  5E1Z B;  1P4A A;  2K3P A;  2YX4 A;  1FPQ A;  3CP8 A;  3N97 A;  2NVU B;  4EQQ A;  1ZTR A;  1WKM A;  2E2H J;  3ZCO A;  2GXG A;  1A5J A;  4LJZ F;  2W7N A;  1QVU A;  3OOU A;  4Z6Y A;  1XDU A;  3DU5 A;  2JTV A;  3K4K A;  2IGK A;  4XSZ F;  2R7V A;  1F36 A;  3OYE A;  1VQO I;  2R7S A;  5LD2 C;  3DF8 A;  2XAU A;  2CFO A;  1HLV A;  3UNG C;  1O4X A;  2XUB A;  1R4N B;  1BR4 A;  1D8K A;  3BT9 A;  2MC3 A;  4HNU A;  3EDP A;  1VQ6 I;  3A1Y A;  2JT1 A;  4YG2 F;  4IX7 A;  2B9S A;  1TW2 A;  2DA4 A;  2IP2 A;  2NNN A;  3OSF A;  1WI9 A;  2EBI A;  2HQ5 A;  2XRN A;  3MZH A;  2WTE A;  3X2Q H;  1APL C;  2LKX A;  2NAZ A;  3FXR A;  1DGR M;  2B63 J;  2CYY A;  2E7X A;  2LY9 A;  2M34 A;  3ZP5 A;  4EGY A;  2QQ8 A;  3KZI C;  1TWA J;  3AL0 C;  1K78 B;  3M4O J;  2IGM A;  2LYC A;  3F8B A;  4KIF A;  3OYH A;  5EDN A;  2W1O A;  2V9K A;  1MBE A;  3TOA A;  4EMS A;  3TO6 A;  3BR2 A;  1QGP A;  1J2X A;  2R7Q A;  5LGN A;  1R58 A;  1TNS A;  4HV6 A;  4CIC A;  2L9V A;  1YOV B;  4ZYA A;  4HNV A;  4C2M J;  3HOU J;  2ADU A;  3KP6 A;  5C3E J;  2VQC A;  1ZH5 A;  3PFY A;  1T56 A;  1T98 A;  1J59 A;  2VT3 A;  3EET A;  4I2O A;  2QYO A;  3RKQ A;  3BZC A;  5BS6 A;  1F5T A;  4N0B A;  1SFK A;  2I10 A;  1AHD P;  2BGC A;  4OAY A;  3LNQ A;  1LJ9 A;  1IRX A;  1SFE A;  2ID3 A;  4A3G J;  3BQZ A;  2DT5 A;  4F7Z A;  1V3F A;  5HOO A;  2MH9 A;  1ITY A;  4D7N A;  3QPS A;  2NVX J;  2X1D A;  2KQR A;  1TWH J;  4UUS B;  4AVP A;  3OMY A;  2M45 A;  4QLC U;  2G0E A;  2L9R A;  4XKV A;  2VBX A;  3V8K A;  1IZ1 A;  1OR7 A;  1PYV A;  3JRG A;  3KFW X;  3L2W A;  2O8X A;  3CJQ B;  3K9T A;  3JRH A;  5LBQ A;  2BYV E;  2Y0S N;  3O8G A;  1JUP A;  3LSK A;  4P9U A;  3ZGK A;  2MBF A;  4DZP A;  1IN6 A;  3V7S A;  4MTE A;  1JHH A;  3LSM A;  4P5O A;  4FE7 A;  5GP9 A;  4GFB A;  1FTZ A;  1XGM A;  1AWC A;  4BHC A;  1EJ9 A;  1ZGJ A;  3DLA A;  3GME A;  3UR3 C;  4CZZ A;  3HM5 A;  2K27 A;  4RGS A;  1REP C;  1IJW C;  4KMU X;  2HKX A;  2XAF A;  1WHU A;  5DV5 A;  4AIH A;  3FIS A;  3JRI A;  3ZQH A;  4X1E A;  5DM7 F;  1MDM A;  2VIX A;  2LKS A;  2O5R A;  1D5Y A;  3S3M A;  5CPR B;  3S93 A;  2HEO A;  1IC8 A;  1JJ6 C;  2VON A;  2R0Q C;  2VKH A;  2XGC A;  2EK5 A;  1FC3 A;  4MEY F;  1XMK A;  1O3S A;  1R7J A;  4IVN A;  1XGO A;  2R7Z J;  4GYG A;  4BDY A;  3DU6 A;  3IAM 2;  5LEK A;  5BOX A;  4W1U A;  4K2E A;  2BVM A;  3PQK A;  1LDJ A;  3FX3 A;  1HXD A;  1O3T A;  3I4P A;  2BE5 F;  2OTL I;  2LDU A;  3L1P A;  4XSX F;  1P92 A;  4A5M A;  3WOD F;  5AON A;  2CQK A;  1E0E A;  1R1V A;  1BIA A;  3C2G A;  4M6Y A;  2HXO A;  3MFK A;  4IHX A;  1ZGA A;  2IGN A;  1FMW A;  2KIS A;  1PP7 U;  4IJA A;  2W57 A;  3K2A A;  1FX7 A;  3CUQ C;  5JR3 A;  1OMI A;  1TQI A;  4UB6 C;  3K4B A;  3R0A A;  4AVZ A;  1RI7 A;  5D6E A;  1WJ5 A;  3TQN A;  3I5U A;  2BXY A;  2W82 A;  2G7H A;  3OIQ A;  3TP3 A;  3KX2 A;  2IS1 A;  4BAC A;  4BJT A;  2JPB A;  3P5J A;  4I0A A;  2EZI A;  2XF7 A;  4M3G A;  5E3M A;  2EWN A;  3DLL F;  2IA1 A;  3EPZ A;  5GAE J;  1O57 A;  3ZOB A;  3DKY A;  1RET A;  5FKL A;  4JP0 A;  3E6C C;  3OWT A;  2YUS A;  2DLL A;  2LRD A;  3LMM A;  4E7Z A;  4PGG A;  2E2J J;  4RAZ A;  4UUV A;  3SFI A;  1YE9 A;  2R7X A;  1L3L A;  5J40 A;  2QZ8 A;  2M5W A;  3S1M J;  4F3Q A;  2DOA A;  3C7J A;  4CCN A;  1YIT I;  4V2G A;  1HST A;  1MGT A;  4M3D A;  1RZ4 A;  5H6Q A;  2FEZ A;  4A3I J;  4Y17 A;  3R6S A;  2P5L C;  5CJ9 A;  2Y48 A;  1H0M A;  2KHM A;  4IZZ A;  2FBH A;  4XID A;  2DCE A;  4ZTJ A;  4GCV A;  4NDL A;  2FNP A;  3HOY J;  4WXC A;  2IVM A;  3O3K A;  5CYV A;  4KYW A;  3I71 A;  2KPM A;  3VSL A;  1W7P A;  3IL2 A;  2K02 A;  3IH4 A;  2MH2 A;  4DGW B;  2KMU A;  3K69 A;  4OIO F;  3H3Z A;  2Y0M A;  2Z2S B;  1BW6 A;  4A3M J;  2M4G A;  2F4I A;  2A05 A;  2XPW A;  3BP8 A;  1Y56 A;  1OYW A;  2XHK A;  3BLY A;  1SAU A;  5E1W A;  4B48 A;  1YG2 A;  1VQ8 I;  1DP3 A;  2IEK A;  2ZSH B;  2R4G A;  4EJW A;  1W5C C;  2HS5 A;  3BTI A;  4RB1 A;  2DK5 A;  4Y4R A;  1KZH A;  1IDY A;  1X2N A;  1FYL A;  3WG7 H;  3BG9 A;  5BPI A;  4XOP A;  2YX7 A;  5CQE A;  5EZG A;  1MH4 A;  4ZYD A;  5F0C A;  1T6S A;  2DFH A;  1W4M A;  5HS7 A;  2PLY A;  4CH7 A;  3WTY C;  2LY1 A;  2FU4 A;  1YS7 A;  2L4M A;  2X6O A;  1FBU A;  2KLO A;  3V4G A;  1GV5 A;  5HNH A;  1SC7 A;  2RDP A;  4KIS A;  5DTD A;  1OCZ H;  4P1W A;  2LP0 A;  3VB2 A;  2FML A;  2VOD A;  3OL4 A;  2EZK A;  1WJF A;  4E7S A;  3FMR A;  4ASN A;  3TW6 A;  4Y15 A;  2R7F A;  5FRN A;  5E8G A;  1TP4 A;  3GTG J;  4BJ5 C;  1JGS A;  4MNU A;  4R1H A;  3W6V A;  2AO9 A;  3J80 Z;  3LFU A;  1TWC J;  3VYS B;  2KZV A;  2WY8 Q;  2YU3 A;  3WU2 C;  1Z9C A;  3JRD A;  1Y0U A;  1ODD A;  3OIO A;  2KFD A;  1RKT A;  1WWX A;  2EFN A;  5FGM A;  1U8R A;  2MGQ A;  1KYW A;  2HYG D;  4R8H A;  1Z6R A;  2DMU A;  3BR3 A;  5ERI A;  3ZQC A;  2ACJ A;  4BY7 J;  3BPV A;  2BOL A;  1NHA A;  3QU3 A;  3AFH A;  2MD5 A;  4CCJ A;  2EZH A;  2DOE A;  1K7A A;  3CMM A;  3CCL I;  1R4M B;  1TQM A;  3WE3 A;  1Z6T A;  4MHG A;  3COA C;  2KIQ A;  2PFB A;  2M7A A;  1RR8 C;  4IKF A;  1BOB A;  2VBY A;  4PJJ A;  3CME I;  1JT0 A;  2FE3 A;  2DDA A;  4A0Y A;  3CO7 C;  4F92 B;  2ZJQ F;  2R5Z A;  2R7T A;  1MJ9 A;  1IO2 A;  2R7U A;  1MJB A;  4CDG A;  1XDS A;  3WU1 B;  4FE4 A;  5DS9 A;  3FXQ A;  4CHU A;  5J8F A;  2LG4 A;  4KIC A;  4HG2 A;  1T95 A;  3HPH A;  2HOE A;  3BG5 A;  5CVR A;  3SJM A;  4UY8 I;  5CKT A;  2K4J A;  4B47 A;  1QA6 A;  4YEJ A;  2QEX I;  1CGP A;  1SAX A;  3JR9 A;  4P96 A;  3KIO A;  4HX7 A;  1H9T A;  1V5E A;  4S04 A;  5FO5 A;  5DYM A;  2RAE A;  4F93 B;  2HOS A;  1RIO H;  1HSJ A;  1SD4 A;  1KQ8 A;  3TDZ C;  4RM3 A;  3BY6 A;  3RKY A;  2EFO A;  4BH9 A;  1RUO A;  2ISZ A;  1RES A;  5B3S H;  3D1N I;  4FX4 A;  3GTL J;  4LLN A;  4A3E J;  2W84 A;  4EM0 B;  1Z67 A;  2L02 A;  4JBA A;  4KN7 X;  2Q8K A;  4DYC A;  1X1D A;  4WX9 A;  5HLT A;  1LEA A;  3WTX C;  3QYF A;  4G7H F;  5M5X J;  4Y3O A;  2KZG A;  2BY0 A;  1FWZ A;  3SFZ A;  2CV1 A;  3BG3 A;  4QWQ A;  5FD6 A;  3BOQ A;  1P6R A;  2A61 A;  1X4O A;  3S2D J;  2VKD A;  3F72 A;  3S32 A;  1Y8R B;  1U2W A;  1SD5 A;  4ETS A;  3S1R J;  4DIQ A;  2P7V B;  4IHS A;  1TL8 A;  1HCR A;  4B3A A;  3DPL C;  2JZY A;  1NTC A;  2ZNY A;  3HSE A;  2DA5 A;  4AID A;  5E18 F;  5E3N A;  4N4O B;  3UKG A;  3HOV J;  3DWL E;  3H3U A;  3HRU A;  3OYD A;  1H89 C;  2M8G X;  4PGH A;  5CVJ A;  1W36 D;  4Y52 J;  1MBF A;  4Y7N J;  1SD6 A;  3E5X A;  4U7B A;  3ROU A;  3ISP A;  4OAZ A;  4BL0 B;  3DBR B;  1JE8 A;  3L9F A;  5HDK A;  2EIL H;  4O3M A;  1AA7 A;  2Q0O A;  2XGX A;  3HJE A;  3FXU A;  3KEO A;  1OPC A;  3HZJ A;  4I0B A;  4NUB A;  3FBN B;  1K6O A;  3G71 I;  3DTK A;  4A3F J;  1AU7 A;  4PDK A;  1K79 A;  2GM4 A;  1R00 A;  4DYR A;  5IOY A;  2OCE A;  3CQZ J;  1O7F A;  5M3F J;  2HQA A;  3QPL A;  3HKZ N;  3RZO J;  2CJJ A;  3CDH A;  4OU0 A;  3RI4 A;  3EQL F;  1GUU A;  2CU7 A;  3Q3S A;  2WAQ A;  3LSG A;  3WTU C;  4NC6 A;  1JKO C;  2VE9 A;  1B8I B;  2P81 A;  1IUY A;  2W25 A;  3F22 A;  3E6D A;  3IKT A;  4QPQ A;  2V1X A;  4NQW A;  3EYI A;  1ETQ A;  2GBY A;  2W24 A;  2VJ5 A;  1ZRC A;  4IHV A;  4CGZ A;  1RUN A;  5BQT A;  1GVD A;  2WB1 N;  5GPA A;  1OJL A;  4KJZ A;  1IDZ A;  3ELK A;  2NOJ B;  3MZY A;  2XRO A;  2N8G A;  2HTJ A;  4PFO A;  2V4J C;  3GTQ J;  4Y13 A;  4F91 B;  2FRH A;  3K4J A;  2HPM A;  2K5C A;  2KDZ A;  3NQO A;  3BDD A;  3W2W A;  2QA4 I;  1BR2 A;  3DBL B;  3K1M A;  5DEQ A;  5BMZ A;  1DU0 A;  2FXA A;  3JRF A;  4M3F A;  3EUA A;  3HHH A;  3I59 A;  3E3V A;  4I02 A;  4PFP A;  1R6R A;  1T38 A;  1OCP A;  4MTD A;  1G3Y A;  3WG9 A;  1LEB A;  1X1C A;  2L7F P;  1R49 A;  3A4C A;  3ABK H;  4BQN A;  1FLI A;  2UXX A;  5D4R A;  1AOY A;  1IN5 A;  4PJN A;  1ZR4 A;  3TL4 X;  5IT9 Z;  1P7J A;  3OYK A;  3AL0 B;  5M3M J;  1N25 A;  3Q5F A;  1P4W A;  3DEW A;  1F1Z A;  1V55 H;  3WTT C;  2F6C A;  4KIB A;  3KP3 A;  4FIS A;  5JVG F;  3HIF A;  4BHP A;  4YEL A;  3TED A;  2V7F A;  4KMF A;  2A07 F;  2E71 A;  1JTY A;  3BZK A;  2DQL A;  1I50 J;  1JKR C;  3MCZ A;  1UHM A;  5E20 A;  2M30 A;  2M87 A;  2F48 A;  3J7A O;  2HOA A;  3E1S A;  2BHZ A;  1NK2 P;  5DDG A;  2K9N A;  1VQ9 I;  3JRA A;  1RNL A;  2JRM A;  1BC8 C;  4A6D A;  2M9H A;  4C3J J;  3LAJ A;  2VB6 A;  1IN7 A;  1Y1W J;  2X4H A;  4HZF A;  2HYF A;  3L2V A;  5F0F A;  1Z77 A;  1YX3 A;  3G1O A;  4KUM A;  2D1H A;  3NWS A;  3KYL A;  2L01 A;  1A6I A;  1VQ4 I;  5EGO A;  4IRG A;  1VZ0 A;  4U7D A;  2FD5 A;  3F6V A;  2VBZ A;  1SFO J;  1YX5 A;  1H9G A;  2NVT J;  1LFP A;  9ANT A;  1QZZ A;  5TJJ A;  5F1J A;  1MMS A;  5DM6 F;  4HYE A;  2I8D A;  2DA2 A;  4CCO A;  3I3L A;  3E7L A;  2GXB A;  3WGH A;  1YRN B;  4PJL A;  2L0K A;  3DTE A;  4JQF A;  2E1O A;  1IXS B;  1WRJ A;  1FY7 A;  5J1R A;  2IRF G;  3ABT A;  3LSJ A;  5TRD A;  4G94 A;  2HYJ A;  3R61 A;  3SZT A;  1J09 A;  2VLA A;  4OIR F;  4HRI A;  3LAP A;  2HQN A;  1XN7 A;  3S14 J;  1MNM C;  2VOO A;  3CDL A;  1ZLK A;  2E1N A;  1X3W B;  1FBQ A;  2FNA A;  4MIM A;  1T8I A;  3CJT B;  1BR1 A;  4ESF A;  3BTL A;  4LK0 F;  1FOX A;  3GWZ A;  4CXF A;  2EV5 A;  2B0L A;  2DO7 A;  4YFX F;  3D5S C;  4BXF A;  1ZRF A;  4B4C A;  4PK4 A;  1IRG A;  4PJM A;  3A01 B;  3OYL A;  1SD7 A;  1Z21 A;  2CO5 A;  3E5U A;  3WHC A;  3CCQ I;  1PDN C;  2IT0 A;  4U88 A;  4CA0 A;  3BWG A;  2QQA A;  2Z9O A;  3ZN0 A;  1S5L C;  5H2F C;  2F5C A;  4UHT A;  3M1E A;  2D45 A;  1USS A;  1E3O C;  1ZHF A;  2NS7 A;  3RJP A;  5ICC A;  1HC8 A;  1HOM A;  1FIP A;  2DAO A;  3B6C A;  4AC0 A;  3H92 A;  3EUH A;  2PMZ N;  2FQ4 A;  3GCM A;  2EQR A;  2O0Y A;  2JSC A;  3E5Q A;  4G6Q A;  4BBR J;  3JRE A;  1R5I D;  1WZ2 A;  4AYB N;  4PSX A;  2V1N A;  3L2Q A;  4M9X A;  1A04 A;  1KU3 A;  2DA7 A;  2EZL A;  2NYX A;  4MGR A;  1BM9 A;  2LTP A;  2A6H F;  2EIK H;  5IT3 A;  3ABL H;  1QO0 D;  2BEO A;  3AKZ A;  4YII A;  2LBF B;  3DTI A;  1RPW A;  2WV0 A;  3ZQQ A;  4IQJ A;  4XLF A;  4R79 A;  2L5Q A;  1R5G A;  4G7Z F;  4JK1 X;  1DGW Y;  1FNN A;  1S72 I;  2BZT A;  5EF6 A;  1ENH A;  3DBH B;  1KQ0 A;  3LSH A;  2BY3 A;  2IXS A;  4CYD A;  1J0R A; 
#chains in the Genus database with same CATH homology
 3I54 A;  2R3S A;  3FMS A;  5LLQ A;  2PEX A;  4KFC A;  2V6C A;  4BQA A;  2BV6 A;  3M9A A;  5FFZ A;  4IRH A;  3ML6 A;  4G7O F;  1BJA A;  2XV4 S;  2A69 F;  1R1T A;  1GXP A;  1G3T A;  4AIK A;  3M7G A;  4ENK A;  2MA3 A;  5LRR A;  3JAM K;  4N9I A;  5J6X A;  1I5Z A;  2HKO A;  1LQ1 A;  1DPR A;  1OYI A;  4GXO A;  5LRS A;  1HKT A;  4EM2 A;  3GZ6 A;  1TQP A;  4HDU A;  3F23 A;  1K78 A;  4M6X A;  3GXO A;  3I53 A;  3DXJ F;  3F3X A;  1LDD A;  2O3F A;  3R4K A;  1ULY A;  3V7R A;  2F5E A;  4A2U A;  2IJL A;  4D0P A;  2ESN A;  1IRF A;  3OOP A;  3GVA A;  2Z5U A;  4YFN F;  2E1C A;  4XLP F;  4LB6 B;  2EV6 A;  4IHT A;  1YYV A;  4BNC A;  5CLS A;  2TDX A;  5CVI A;  3G3Z A;  2EA4 A;  1G4D A;  1IAW A;  1X3U A;  2CG4 A;  4LGW A;  2V1D A;  2KRF A;  3I0T A;  1IXR C;  5D5V B;  1ZG1 A;  4L9N A;  1P2F A;  3KP7 A;  4RB3 C;  4LD5 A;  5L3F A;  4EGZ A;  4RB0 A;  4IPA A;  2STT A;  1MDM B;  2NS0 A;  1C0W A;  5K5R A;  1UB9 A;  5FLX Z;  3D0S A;  2XAJ A;  1ZYR F;  1I27 A;  2EV0 A;  3L09 A;  3QU6 A;  3D5L A;  1T39 A;  4MQV A;  5L3E A;  1S7O A;  3B73 A;  2FSW A;  2M8E A;  4EM1 A;  2KJC A;  3BJA A;  4L9T A;  4NB5 A;  2DI3 A;  2RQP A;  4O6J A;  5ICE A;  2NRA C;  1HKS A;  2COM A;  5D5W B;  2RNJ A;  5L3G A;  5ED4 A;  1L0O C;  1SFX A;  2DW4 A;  2OZ6 A;  5FLX K;  2UZK A;  3L2C A;  2RV8 A;  3R0J A;  4HA8 A;  4M72 A;  4WF2 A;  3EYY A;  4ENJ A;  1J9I A;  1YW8 A;  2NNY A;  1JHF A;  3GFJ A;  4H0E A;  5JVT A;  3DP7 A;  2VBW A;  2V1U A;  5DD4 A;  2DFI A;  3HRM A;  3GLX A;  3CUQ A;  2RVC A;  2XAG A;  1OYY A;  2VC1 A;  4EJV A;  1U5T A;  3K0L A;  4A5N A;  4PCQ A;  2VT2 A;  4Z2Y A;  1JXS A;  4KDP A;  3V7C A;  4WWC A;  5KK1 A;  3LFK A;  1R5H A;  4XLN F;  3ECO A;  3WE2 A;  1S29 A;  1G6N A;  2DK8 A;  2PJP A;  3T5X A;  3BZ6 A;  2OQG A;  4YIF A;  4RGX A;  3HOS A;  4EJU A;  3NRV A;  5CVV A;  4RB2 C;  1BC7 C;  1XSV A;  5D8K B;  1B6A A;  3DPT A;  5A2Q K;  4A12 A;  3GZ5 A;  3FM5 A;  4U0V A;  2KIM A;  4EJO A;  4UVB A;  3S2W A;  4LLL A;  1FT9 A;  3SZP A;  5DUI A;  1GVJ A;  4HDV A;  1KYZ A;  5LHH A;  4HBL A;  4L5J A;  2C6Y A;  3KLN A;  2GIV A;  3GFL A;  3GFM A;  2PN6 A;  3SQN A;  2JRT A;  4KN4 X;  3TOB A;  1ZRD A;  4HQE A;  3HUG A;  2FQ3 A;  5F6F A;  4HX8 A;  1S6L A;  3HSF A;  2AXL A;  4MEX F;  3WGI A;  3JSO A;  4HOB A;  2F2E A;  1IN8 A;  1HW1 A;  5HLG A;  1MKM A;  2J5P A;  3BRO A;  3RKW A;  3ULQ B;  3WTZ A;  1ON2 A;  2VE8 A;  4PZJ A;  2Y75 A;  2GQQ A;  1P4X A;  2UWM A;  4HF1 A;  3IRQ A;  2FA5 A;  4I01 A;  4A0X A;  1ZG3 A;  4BAY A;  3LWF A;  3MEX A;  5E1X A;  1UHW A;  3VFZ A;  1ONV A;  1Z05 A;  1F4K A;  3QP5 A;  4HQM A;  3N4M A;  2CFX A;  3ZMT A;  1W5T A;  1O3Q A;  3RKX A;  3GFI A;  2EJR A;  1YW7 A;  1O7L A;  5DUK A;  3IC7 A;  4P55 A;  1XB4 A;  3KE2 A;  3L7W A;  2QEN A;  2RGV A;  4ESJ A;  2EB7 A;  1ZG5 A;  2XAQ A;  1YS6 A;  2R7D A;  3IWF A;  3I64 A;  4BYY A;  2AS5 F;  5L3C A;  1T0F A;  2KIF A;  3QRF F;  1KU7 A;  3T8T A;  2D1V A;  1U6G A;  5BPD A;  4IRI A;  2XKP A;  3L00 A;  3MWM A;  2QM3 A;  2DU9 A;  1D8J A;  1FYM A;  2YPR A;  1EH7 A;  1TBX A;  1FP2 A;  2HGC A;  4DNC A;  1QQI A;  4FHT A;  4ENM A;  5JHU A;  5KVR A;  4G8X A;  1U3E M;  5ILU A;  2OU2 A;  2PBI A;  2H09 A;  3HRT A;  2DPU A;  2M1B A;  2OD5 A;  1HQC A;  4HAM A;  2LSO A;  2QLZ A;  2YSR A;  1XMA A;  5D6F A;  3LQQ A;  1XSD A;  1WSU A;  1SFU A;  2P6T A;  1B9N A;  1IXC A;  3K1P A;  2F5F A;  4EVI A;  2ZBK A;  3I58 A;  1G3W A;  3TO9 A;  1B4A A;  3WGG A;  2KKO A;  3BJO A;  1D3Y A;  2F5D A;  5ILV A;  1BI0 A;  4ZYH A;  1EV7 A;  4L9V A;  5DCM A;  3IHU A;  2OAZ A;  3I59 B;  2HWV A;  5F1R A;  3HOT A;  1I6X A;  4M71 A;  1D5V A;  1IW7 F;  5IT9 K;  3LA7 A;  1MJA A;  2LF8 A;  1BBY A;  4WXH A;  3F21 A;  2QBY B;  2GAU A;  1BI1 A;  3AAF A;  2GA2 A;  3MAJ A;  2OQR A;  4UV9 A;  5K1Y A;  1R22 A;  3HYI A;  3TGN A;  1XGS A;  2WWY A;  4UVA A;  3O6B B;  5LHI A;  3P7N A;  2LNB A;  2A3S A;  2IA2 A;  3F8M A;  2VOP A;  4P9F A;  3J80 K;  3P9K A;  5D4S A;  2PMU A;  4RGU A;  3RPQ A;  2H6B A;  1G3S A;  3M8F A;  1T2K A;  3MQ0 A;  3ZMV A;  2EA2 A;  3F8C A;  3LA2 A;  2JPC A;  1KQ9 A;  2K4B A;  4RAY A;  1ZAO A;  2RKH A;  2L3D A;  3U9G A;  4WK8 F;  1R1U A;  1FSH A;  4G9Y A;  2LF7 A;  2ZCW A;  2QVO A;  2DQR A;  5J8C A;  3W6K B;  4ENN A;  1PP8 F;  4U0Y A;  2O6G E;  3ZMU A;  3RDI A;  3WTS C;  2FF4 A;  1WQ2 A;  4FX0 A;  4LMY A;  1Z91 A;  5K5Q A;  2OA4 A;  4EV0 A;  4ZH4 F;  4LG0 B;  3U2R A;  1CF7 A;  1XCB A;  3CO6 C;  3FF5 A;  5LGT A;  2EFQ A;  4BHB A;  3J81 Z;  1BI2 A;  3LA3 A;  4E70 A;  1U5T B;  5LEJ A;  1BN5 A;  3HHG A;  1UCR A;  1DDN A;  2IW5 A;  3KP5 A;  1QPM A;  1FSE A;  4UV8 A;  2QBY A;  2HZT A;  3CUO A;  3ZN1 A;  4XBF A;  3HTS B;  3PQJ A;  2D2W A;  5D8L B;  2ISY A;  1S7A A;  1TNT A;  1FZP B;  2PMH A;  3ECH A;  3R60 A;  5H20 A;  5DD8 A;  3RPU A;  2E7W A;  5FD5 A;  4B09 A;  3BPX A;  2XAS A;  4LFU A;  2FMY A;  3IRR A;  1DPU A;  1YIO A;  3B02 A;  4GYI A;  2MLK A;  2XVC A;  3JTH A;  5HS8 A;  2V79 A;  2ZXJ A;  3TKY A;  5L3D A;  2XIG A;  2RN7 A;  4NHJ A;  3VOD A;  2PG4 A;  3FWE A;  3ZMD A;  2IA0 A;  3FZV A;  4KIG A;  2ZJ2 A;  1YQA A;  3WTV C;  4OIQ F;  4A6E A;  1B1B A;  3ABU A;  3GYH X;  3G73 A;  4ESB A;  4KA4 A;  2K7L A;  1V4R A;  5HLH A;  1ZN2 A;  1U5T C;  3NEU A;  1Q1H A;  5HVQ C;  5AIP A;  1DP7 P;  3O2P E;  3KLO A;  2QWW A;  4HX4 A;  1DUX C;  2MLG A;  2HTS A;  4LG0 A;  2O61 A;  2ZME A;  4WCG A;  2QQB A;  3GEZ A;  3JAM Z;  3GUD A;  2YR2 A;  3ERE D;  4U0W A;  3P9C A;  4L0Y B;  2IPQ X;  1ON1 A;  2WC2 A;  4HLX A;  2KJB A;  1J75 A;  2PI0 A;  1QZY A;  3FM3 A;  4Q4Z F;  1YFH A;  2L4A A;  2STW A;  2UXN A;  1ZAR A;  3GF2 A;  1LNW A;  1E17 A;  2W85 A;  1PUE E;  4KT5 C;  1KU2 A;  2OZU A;  3Q9S A;  5LGU A;  3K2Z A;  3SXY A;  1MZB A;  1YO5 C;  2H6C A;  3RIR A;  3QAH A;  3DQV C;  4N9H A;  1GXQ A;  2ZME B;  5FB2 A;  3QP6 A;  2G9W A;  3V8J A;  4UVC A;  1KA8 A;  2HDC A;  1Z7U A;  1HW5 A;  2FBI A;  4Q48 A;  1R36 A;  2H27 A;  4L18 B;  4I98 B;  3ZQ7 A;  1GHC A;  2P6S A;  4M74 A;  1TTY A;  1YW9 A;  5E17 F;  3TO7 A;  4RGR A;  2DPD A;  1BOA A;  2VC0 A;  3KP2 A;  4Q5S F;  4UXN A;  2BBY A;  3GW2 A;  2CWE A;  5L3B A;  1J5Y A;  3KP4 A;  2QQ9 A;  2ESH A;  2GZW A;  2DTR A;  2ELH A;  3KEQ A;  4M73 A;  3M8E A;  5HDG A;  3DKW A;  3DV8 A;  3RTR A;  4HV5 A;  3J81 K;  3CUQ B;  3IWZ A;  5HS9 A;  4EJT A;  3E97 A;  5DCF A;  1STZ A;  4L0Z B;  2G7U A;  2V9V A;  5ILS A;  2QUF A;  5HDN A;  1BIB A;  2LKP A;  1S3J A;  1B9M A;  2K86 A;  1SMY F;  2X0L A;  4TV7 A;  3CLO A;  3T8R A;  1HW2 A;  4UNO A;  4ON0 A;  4HF2 A;  3Q9V A;  2A68 F;  5D5U B;  3CJN A;  4OMY A;  3ZPL A;  2OBP A;  5CVU A;  1IF1 A;  1HBX G;  5EEH A;  4GO1 A;  4YFK F;  3JSP A;  3SHF A;  1KU9 A;  3HTU A;  1XD7 A;  4CO8 A;  3F8F A;  2ZFW A;  1XGN A;  5H6R A;  5A2Q Z;  4Q47 A;  4S05 A;  2RC4 A;  5E8I A;  3P9I A;  4M9Z A;  3GX4 X;  3HSR A;  3KZY A;  2EFW A;  2DBB A;  3K1N A;  5F64 A;  4HLY A;  4DQ2 A;  1EH8 A;  3QOP A;  4L9J A;  3VOE A;  1UFM A;  4ZYG A;  3QPH A;  4BXU A;  1VTN C;  2CGP A;  2ZO4 A;  3E6B A;  5AIQ A;  2PQ8 A;  2Z3Y A;  2GWR A;  5D5X B;  4OOI A;  2Z99 A;  4ZZL A;  5HLI A;  1I1G A;  3DFG A;  2KIU A;  3C1D A;  3LST A;  3VEP A;  1YTY A;  1HKQ A;  3C3W A;  3BJ6 A;  3ZMZ A;  3HRS A;  6PAX A;  5K5O A;  2Q2E A;  3KCC A;  2P8T A;  5EEG A;  1S8N A;  4AWX B;  1CF7 B;  2ZKZ A;  4LLG F;  1W5S A;  2A5Y B;  1QNT A;  3C18 A;  4A0Z A;  4ZZD A;  3DEU A;  1MD0 A;  4O5V A;  1TW3 A;  1ZLJ A;  1J7K A;  4ZYE A;  4OIN F;  2H94 A;  1SMT A;  1EH6 A;  1XCV A;  2Z33 A;  2VXZ A;  3TDU C;  3LQR A;  4G6D A;  1YLF A;  3W6J B;  1FBS A;  2HR3 A;  2HQR A;  3IKV A;  3JTG A;  3V8L A;  3KET A;  1W7P D;  1F9N A;  1IN4 A;  3ZMS A;  3F8N A;  4KNY A;  3RYP A;  2L54 A;  4WXD A;  4B8X A;  3CTA A;  3WU0 A;  1FP1 D;  4L5I A;  3WTW C;  2A6E F;  4IXA A;  1FOK A;  3T0Y A;  1O3R A;  1LDK B;  4LB5 A;  1TLH B;  1ZRE A;  1UST A;  4MQ9 F;  4OMZ A;  1BI3 A;  4HF0 A;  3QPT A;  2VN2 A;  1LB2 A;  1I1S A;  1OKR A;  1QBJ A;  3GO5 A;  2XAH A;  1W7P B;  1R23 A;  3KZZ A;  2ETH A;  4AIJ A;  3OV8 A;  4OIP F;  2P5K A;  4FT8 A;  2HFH A;  2P5V A;  4GGG A;  1Z1D A;  1LVA A;  2CSO A;  1XSX A;  5JI6 A;  3RYR A;  5FFX A;  2FBK A;  2EFP A;  5DCM B;  3E6M A;  5ICF A;  2J5O A;  3T1B A;  4HW0 A;  4AD9 A;  2GA1 A;  2P4W A;  5JFR A;  3JW4 A;  3FHZ A;  2O03 A;  2FOK A;  4M9S A;  3REO A;  3F6O A;  2XKO A;  4RS8 A;  5LHG A;  4IF4 A;  4I09 A;  3PFI A;  3U1D A;  4I7H A;  2P7C B;  1KGS A;  1FYK A;  1B59 A;  2ZNZ A;  4LK1 F;  1E2X A;  5ICG A;  4XRF A;  3FMQ A;  1U78 A;  2CW0 F;  5E1Z B;  1P4A A;  2YX4 A;  1FPQ A;  3N97 A;  4EQQ A;  1WKM A;  2GXG A;  4LJZ F;  1XDU A;  2JTV A;  4XSZ F;  3DF8 A;  2XUB A;  1D8K A;  2MC3 A;  3EDP A;  2JT1 A;  4YG2 F;  1TW2 A;  2IP2 A;  2NNN A;  1WI9 A;  2XRN A;  3MZH A;  2WTE A;  2NAZ A;  3FXR A;  2CYY A;  2E7X A;  3ZP5 A;  4EGY A;  1K78 B;  3F8B A;  4KIF A;  3TOA A;  4EMS A;  3TO6 A;  1QGP A;  1J2X A;  5LGN A;  1R58 A;  1TNS A;  4HV6 A;  4CIC A;  2ADU A;  3KP6 A;  1ZH5 A;  1T98 A;  1J59 A;  2VT3 A;  3EET A;  4I2O A;  2QYO A;  5BS6 A;  1F5T A;  4N0B A;  2BGC A;  1LJ9 A;  1SFE A;  2DT5 A;  4F7Z A;  1V3F A;  5HOO A;  2MH9 A;  4AVP A;  2M45 A;  4QLC U;  2VBX A;  3V8K A;  1IZ1 A;  1OR7 A;  3KFW X;  2O8X A;  3K9T A;  5LBQ A;  2BYV E;  4P9U A;  2MBF A;  1IN6 A;  3V7S A;  4MTE A;  1JHH A;  4P5O A;  1XGM A;  1AWC A;  4BHC A;  1ZGJ A;  4CZZ A;  2K27 A;  4RGS A;  1REP C;  4KMU X;  2HKX A;  2XAF A;  5DV5 A;  4AIH A;  1MDM A;  2HEO A;  2VON A;  2EK5 A;  1FC3 A;  4MEY F;  1XMK A;  1O3S A;  1R7J A;  4IVN A;  1XGO A;  4GYG A;  5LEK A;  5BOX A;  4K2E A;  3PQK A;  1LDJ A;  3FX3 A;  1HXD A;  1O3T A;  3I4P A;  2BE5 F;  2LDU A;  4XSX F;  1P92 A;  4A5M A;  3WOD F;  5AON A;  2CQK A;  1R1V A;  1BIA A;  4M6Y A;  3MFK A;  1ZGA A;  1PP7 U;  4IJA A;  2W57 A;  1FX7 A;  3CUQ C;  5JR3 A;  1OMI A;  1TQI A;  3R0A A;  1RI7 A;  5D6E A;  3TQN A;  3I5U A;  2G7H A;  2JPB A;  4I0A A;  2EWN A;  2IA1 A;  1O57 A;  3E6C C;  2DLL A;  4PGG A;  4RAZ A;  4UUV A;  1L3L A;  2QZ8 A;  2M5W A;  3C7J A;  1HST A;  1MGT A;  1RZ4 A;  5H6Q A;  2FEZ A;  4Y17 A;  3R6S A;  2P5L C;  5CJ9 A;  2Y48 A;  1H0M A;  2FBH A;  4GCV A;  2FNP A;  4WXC A;  2IVM A;  3O3K A;  5CYV A;  4KYW A;  3I71 A;  1W7P A;  3IL2 A;  2K02 A;  2MH2 A;  3K69 A;  4OIO F;  3H3Z A;  2Y0M A;  3BP8 A;  1OYW A;  2XHK A;  5E1W A;  1YG2 A;  4EJW A;  2HS5 A;  4RB1 A;  2DK5 A;  1FYL A;  5BPI A;  2YX7 A;  4ZYD A;  1T6S A;  2PLY A;  1W4M A;  5HS7 A;  3WTY C;  2FU4 A;  1YS7 A;  2L4M A;  1FBU A;  3V4G A;  2RDP A;  3VB2 A;  2FML A;  2VOD A;  3FMR A;  4ASN A;  4Y15 A;  2R7F A;  5E8G A;  1JGS A;  4MNU A;  4R1H A;  3J80 Z;  2YU3 A;  1Z9C A;  1Y0U A;  1ODD A;  1WWX A;  5FGM A;  2EFN A;  1U8R A;  1KYW A;  2HYG D;  4R8H A;  1Z6R A;  5ERI A;  2ACJ A;  3BPV A;  1NHA A;  3QU3 A;  2MD5 A;  1K7A A;  1TQM A;  3WE3 A;  1Z6T A;  4MHG A;  3COA C;  2PFB A;  2VBY A;  2FE3 A;  4A0Y A;  3CO7 C;  1MJ9 A;  1MJB A;  4CDG A;  1XDS A;  3WU1 B;  3FXQ A;  4CHU A;  5J8F A;  4KIC A;  2HOE A;  5CVR A;  2K4J A;  1CGP A;  1SAX A;  4P96 A;  4HX7 A;  1H9T A;  4S04 A;  5FO5 A;  5DYM A;  1RIO H;  1HSJ A;  1SD4 A;  1KQ8 A;  3TDZ C;  3BY6 A;  3RKY A;  2EFO A;  4BH9 A;  1RUO A;  2ISZ A;  4FX4 A;  4LLN A;  2W84 A;  4EM0 B;  2L02 A;  4JBA A;  4KN7 X;  2Q8K A;  4WX9 A;  1LEA A;  3WTX C;  4G7H F;  1FWZ A;  3SFZ A;  4QWQ A;  5FD6 A;  1P6R A;  2A61 A;  3BOQ A;  3F72 A;  4ETS A;  1SD5 A;  1U2W A;  2P7V B;  4IHS A;  3DPL C;  2JZY A;  2ZNY A;  3HSE A;  5E18 F;  3H3U A;  3HRU A;  4PGH A;  5CVJ A;  1SD6 A;  3E5X A;  4U7B A;  3ROU A;  3ISP A;  1JE8 A;  3L9F A;  5HDK A;  4O3M A;  2Q0O A;  2XGX A;  3FXU A;  3KEO A;  1OPC A;  4I0B A;  1K6O A;  4PDK A;  1K79 A;  1R00 A;  1O7F A;  4OU0 A;  3CDH A;  3RI4 A;  3EQL F;  3WTU C;  2VE9 A;  1IUY A;  2W25 A;  3F22 A;  3E6D A;  3IKT A;  2V1X A;  4NQW A;  3EYI A;  2W24 A;  1ZRC A;  4CGZ A;  1RUN A;  5BQT A;  3ELK A;  3MZY A;  2XRO A;  2HTJ A;  4Y13 A;  2FRH A;  3NQO A;  3BDD A;  3K1M A;  5DEQ A;  5BMZ A;  2FXA A;  3HHH A;  3I59 A;  3E3V A;  4I02 A;  1T38 A;  4MTD A;  1G3Y A;  3WG9 A;  1LEB A;  1FLI A;  2UXX A;  5D4R A;  1AOY A;  1IN5 A;  5IT9 Z;  3Q5F A;  1P4W A;  1F1Z A;  3WTT C;  4KIB A;  3KP3 A;  3HIF A;  4BHP A;  4KMF A;  2A07 F;  2DQL A;  3MCZ A;  1UHM A;  5E20 A;  2M30 A;  2M87 A;  3J7A O;  5DDG A;  1RNL A;  1BC8 C;  4A6D A;  3LAJ A;  1IN7 A;  2X4H A;  4HZF A;  2HYF A;  4KUM A;  2D1H A;  2L01 A;  4IRG A;  4U7D A;  3F6V A;  2VBZ A;  1H9G A;  1QZZ A;  5TJJ A;  4HYE A;  2GXB A;  3WGH A;  4JQF A;  1IXS B;  1WRJ A;  1FY7 A;  2IRF G;  3ABT A;  5TRD A;  4G94 A;  3SZT A;  3R61 A;  4OIR F;  3LAP A;  2HQN A;  1XN7 A;  2VOO A;  1ZLK A;  2E1N A;  2FNA A;  1FBQ A;  4ESF A;  4LK0 F;  3GWZ A;  4CXF A;  2EV5 A;  2B0L A;  2DO7 A;  4YFX F;  1ZRF A;  1IRG A;  1PDN C;  1SD7 A;  2CO5 A;  3E5U A;  2IT0 A;  4U88 A;  3BWG A;  2QQA A;  2Z9O A;  3ZN0 A;  2F5C A;  4UHT A;  2D45 A;  3M1E A;  1USS A;  1ZHF A;  3RJP A;  5ICC A;  2DAO A;  3EUH A;  3H92 A;  2O0Y A;  2JSC A;  3E5Q A;  4G6Q A;  4M9X A;  1A04 A;  1KU3 A;  2NYX A;  4MGR A;  1BM9 A;  2A6H F;  5IT3 A;  1QO0 D;  2BEO A;  4YII A;  2WV0 A;  4R79 A;  1R5G A;  4G7Z F;  4JK1 X;  1FNN A;  1KQ0 A;  4CYD A;  1J0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...