2OBPA

Crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
publication title Crystal structure of putative DNA-binding protein (YP_298295.1) from Ralstonia eutropha JMP134 at 1.70 A resolution
rcsb
source organism Ralstonia eutropha
total genus 23
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2obpA00
4O5VA 4Q47A 3VB2A 3EETA 1W7PB 1IN4A 2NYXA 4HDVA 3ZMVA 3TDZC 3T5XA 2A5YB 1OR7A 4G9YA 1Z6TA 1ZARA 3ISPA 3RDIA 3B02A 3KETA 4YFKF 1YIOA 2D2WA 3E97A 5FLXZ 4ZYEA 2IJLA 3M8FA 2VT3A 3KLOA 4MEYF 1JGSA 1R5GA 3H92A 3LWFA 1P4XA 3V8LA 1D5VA 5LGUA 3ECHA 3CO6C 3CUQC 4YG2F 5A2QZ 4PZJA 5CVIA 2F5FA 4BHPA 1R36A 2JPBA 1ZG5A 3FF5A 5L3BA 1C0WA 1BM9A 2O0YA 4OIPF 1SD4A 2COMA 2VC0A 2VODA 2O6GE 3GEZA 1QGPA 3RKYA 4E70A 4M6XA 4GYGA 5ILVA 2ZNZA 2Z3YA 3LQQA 4UVAA 1T38A 3HOTA 2JRTA 2O3FA 4MTDA 2L54A 2EJRA 2JSCA 1K78A 4OIOF 2QVOA 4WXDA 2CO5A 3EDPA 2LDUA 3O2PE 4UUVA 1XB4A 1XCVA 2CFXA 3HRTA 1Q1HA 1MGTA 4LG0A 2HTJA 4HOBA 4M6YA 1PUEE 3R0JA 1YYVA 4L5JA 4HF0A 1AOYA 3WE2A 1U5TB 2OA4A 1HBXG 1JHHA 2MD5A 3WGGA 2EFOA 4IJAA 1XGOA 4KUMA 3FX3A 4DNCA 3IRRA 5LLQA 1OKRA 2MC3A 4RB3C 3EQLF 3KFWX 3I54A 3HYIA 2HEOA 4JBAA 4OOIA 3WTTC 2P7CB 3FMQA 4HLXA 1HXDA 2PI0A 3HOSA 1RZ4A 1Z1DA 1T0FA 1MJAA 1G6NA 1FP1D 3K0LA 2V1UA 2ISYA 3HSEA 3L09A 4AIKA 5DD8A 2MH2A 3VFZA 4EQQA 1IXCA 3BY6A 2DO7A 2EK5A 4RS8A 4S05A 1R1VA 1G3YA 1MD0A 3RJPA 2OQRA 3GFMA 4IVNA 2EV6A 2HWVA 4L5IA 1SD5A 3GYHX 3CDHA 4K2EA 3WTVC 3SZPA 3IKVA 1RUOA 3N97A 4QWQA 3QAHA 2Z99A 3KP3A 1U3EM 3TO7A 2DW4A 3J7AO 3RYRA 1DP7P 1YG2A 3FXQA 3ZP5A 4IF4A 5IT3A 3LAJA 1FSHA 4U0YA 5FB2A 1A04A 1V3FA 4EJUA 2PN6A 2XAJA 1FLIA 2R3SA 4ESBA 3BPVA 4DQ2A 2VOPA 1WKMA 5BPIA 4MEXF 1IF1A 2XAHA 4EM2A 3J80K 1IXRC 2G7HA 2H6CA 4IHTA 1S29A 4WX9A 4HF1A 1FT9A 3E6DA 5LGTA 1WI9A 4G94A 2PMHA 1XCBA 1ODDA 4TV7A 3P7NA 3DXJF 1KU2A 2W84A 1R22A 4Y15A 3WE3A 2PEXA 4LLGF 3GW2A 3GVAA 2CSOA 5ICCA 2A61A 1I27A 1K6OA 2OBPA 3ZMSA 4EMSA 4KICA 4FHTA 3JAMK 1S6LA 2VE9A 3V7SA 4XSZF 3KP5A 1ZGJA 2IA0A 1JHFA 3JTHA 5DD4A 3KP7A 3ZMUA 4EVIA 2H09A 2YU3A 2HFHA 5D5WB 1RIOH 4LGWA 3ROUA 2HZTA 2Z5UA 4L9NA 2AXLA 3MZHA 3TO6A 2ISZA 3CUOA 2PBIA 1KYZA 3F8CA 3RIRA 2LKPA 1QBJA 2ZO4A 4RB0A 2E1NA 2H6BA 3C18A 5DDGA 5ICGA 3LA3A 5F6FA 3ZMDA 1ZRCA 4LD5A 2DFIA 1ON1A 2WV0A 3COAC 3I59A 5H6RA 2HOEA 4L0YB 1FBSA 3U9GA 3ZN0A 1ZGAA 3LQRA 1U5TC 1IN5A 2FMYA 1KU9A 1XN7A 3GLXA 4LJZF 4F7ZA 2FBIA 4YFNF 3ERED 1F9NA 1W4MA 2WTEA 4XLPF 3O3KA 1O3TA 5LRRA 1U6GA 2RV8A 1XDUA 1H0MA 4ENNA 2KRFA 3V4GA 4BQAA 3P9IA 1WWXA 5F64A 2G7UA 3RKXA 4CO8A 5HOOA 3CUQA 3WODF 2QQAA 3SZTA 3SXYA 5CVRA 1H9GA 2FMLA 1K7AA 3IRQA 3E6CC 1R1TA 2KKOA 4EGZA 1YS6A 2G9WA 1BBYA 2P6TA 3GFLA 3V8KA 2IP2A 3KP2A 4MGRA 1IZ1A 2IW5A 1UFMA 2P8TA 4MTEA 2VBZA 3DPLC 3FMRA 1BN5A 4BYYA 1JE8A 1S7AA 2L4MA 1FNNA 3T1BA 1ON2A 3K1PA 3ZPLA 2X4HA 2BV6A 1IN6A 2ESNA 4RGXA 1B59A 1LDJA 1USSA 2FOKA 1T39A 2OU2A 4OIQF 4LB5A 2FU4A 5L3CA 2ZMEB 4UHTA 3BPXA 5J8FA 2ETHA 2K7LA 1P6RA 4KN7X 2GZWA 1L0OC 4EJTA 1OMIA 5FD5A 5JR3A 2KIMA 2V6CA 4Q48A 5BQTA 2KIUA 5L3GA 2FNAA 1EH7A 3ECOA 4CDGA 1MJBA 2QQ9A 1MZBA 2XUBA 3AAFA 1BI0A 1Z7UA 2P7VB 4A0XA 1EH6A 1P2FA 3J80Z 4KT5C 2HQRA 4AWXB 4ZYDA 5K5RA 3PQJA 4CGZA 3HHHA 4AIHA 1HKQA 3GFJA 2D45A 2CWEA 4L18B 5BS6A 1MDMB 2ELHA 1J0RA 2HDCA 4KIBA 2A07F 3WGHA 1NHAA 1LEAA 3M1EA 2F5CA 4CZZA 2XKPA 5ICEA 1FOKA 2R7FA 1OYWA 1Z6RA 4UNOA 1W5SA 5ILUA 5HS8A 3NEUA 2K4BA 1K79A 3LSTA 2W24A 2KJBA 5CVVA 2Q0OA 1KU3A 1FY7A 3JAMZ 1ZN2A 2VC1A 5DYMA 3SFZA 3GZ5A 5DCMA 4MHGA 4KYWA 1I1SA 3VEPA 1SFXA 4XBFA 1H9TA 2UWMA 1X3UA 2WC2A 3I71A 3HRMA 4WXCA 2R7DA 2GQQA 6PAXA 3P9KA 2KJCA 2O61A 3TOAA 2XASA 3BZ6A 3IHUA 3K1MA 4HX7A 1AWCA 2QENA 1W7PA 3M9AA 3OOPA 5HS9A 2EFNA 4HQEA 2DQLA 3LA2A 1LQ1A 2MBFA 1U2WA 2J5PA 4Z2YA 2L3DA 1W5TA 5TRDA 3FHZA 2FSWA 3D5LA 1RUNA 4RAZA 1T6SA 5DCFA 2OAZA 5KVRA 5ED4A 3CO7C 5BOXA 5KK1A 3TO9A 2W57A 2DBBA 2FBKA 2BEOA 4WWCA 3KCCA 3W6KB 1TNSA 4BHBA 4UV9A 1U8RA 4ESFA 1HSTA 1FSEA 1KQ0A 1XSVA 2E7XA 3WTZA 4ENMA 3I64A 4XLNF 2P5LC 4I02A 3U1DA 1U78A 2Y0MA 5AIQA 2GAUA 3K9TA 2FA5A 2A69F 2QBYB 2XKOA 1I5ZA 4P55A 4ESJA 4ETSA 4CYDA 2FEZA 4BXUA 1TBXA 4IRGA 2NS0A 2ACJA 1DPUA 2PQ8A 3HRSA 4UVBA 3ZMTA 2GIVA 5TJJA 4WF2A 1RNLA 2RVCA 1B4AA 2P4WA 1FX7A 2IVMA 4G6DA 2MLGA 4GYIA 1XDSA 1O3SA 3EYIA 1U5TA 2HYGD 5D5VB 5HLIA 3EYYA 2K27A 4BHCA 2VT2A 3I0TA 3E6BA 4HX8A 3R6SA 5AONA 1I6XA 2IT0A 3FZVA 2EV0A 1LJ9A 2M30A 3BJ6A 4Y13A 5HDGA 2A6HF 2DQRA 5DUKA 1YTYA 1BI3A 3L9FA 3VODA 1J2XA 3GWZA 4LMYA 2RGVA 2V79A 3E5UA 2EA4A 2EA2A 3KP4A 5HS7A 2O03A 1FYLA 2D1HA 3QU3A 2HYFA 1P4AA 4RGUA 3WTYC 5E8GA 1LNWA 5K1YA 3DV8A 1R00A 2P5KA 3KEQA 3LFKA 1XD7A 4IRIA 2MLKA 4U7BA 2A3SA 4I01A 1GVJA 2FE3A 5L3DA 1YW8A 1HQCA 4A6DA 5H6QA 2M8EA 4NQWA 4NB5A 5ILSA 4I0BA 4P96A 4YFXF 3NRVA 4MNUA 3F3XA 4M9ZA 5LEKA 3ABTA 1LDDA 2V1XA 2E1CA 3F8FA 2ZXJA 3BJOA 1F4KA 4ZYHA 1IW7F 4FT8A 4GO1A 2FXAA 3DP7A 1HW5A 1JXSA 3E6MA 4AD9A 4G8XA 2GXGA 2K86A 3I58A 2QM3A 4N0BA 3TKYA 5D6EA 3JTGA 1R23A 1G3WA 3V7RA 1DPRA 2DPDA 4G6QA 1ZHFA 2NAZA 3K2ZA 1XGMA 1ZG1A 1IN8A 2QYOA 3GF2A 3KLNA 1ZREA 4HDUA 2QUFA 2Q8KA 3FM3A 1ZRDA 4R1HA 1B6AA 1DDNA 2HKXA 1PDNC 2L02A 3KZYA 2GA2A 1SMYF 2B0LA 2C6YA 1KQ8A 1FBQA 1KYWA 1MKMA 2JTVA 2IRFG 4M9XA 3WU0A 1J9IA 4HBLA 1D8KA 1ZRFA 1HKSA 3F6VA 2RC4A 4KDPA 3HUGA 4N9HA 1TQIA 3L00A 4Y17A 4RB1A 2NRAC 1SD6A 3JSPA 3CUQB 4I7HA 5HDKA 4U0VA 4H0EA 1BC7C 5HDNA 2GWRA 5HLGA 3DPTA 2ESHA 3BOQA 2JPCA 5DUIA 3F72A 2RQPA 4L9VA 4JQFA 1ULYA 2HS5A 3DFGA 2H94A 2CGPA 3F6OA 1R1UA 3F8BA 1T2KA 1UHMA 3E5XA 2RN7A 5DEQA 1IUYA 1O7LA 1CF7B 4ENJA 2M45A 1R7JA 5HLHA 4KIGA 2PFBA 3ZQ7A 1XGNA 3R0AA 2L4AA 4O6JA 3HSFA 2XRNA 3ZMZA 2DT5A 1XGSA 2FF4A 2BYVE 3KEOA 5D8KB 3FM5A 3R61A 5BPDA 1YW9A 3KZZA 1W7PD 4XSXF 4L9TA 4BNCA 1LDKB 2VE8A 1YS7A 3MQ0A 2YR2A 2V1DA 2ZFWA 3ULQB 2K4JA 3H3UA 2W25A 1FZPB 1GHCA 2W85A 3I53A 2DK8A 2Z9OA 3BP8A 1TQMA 4OIRF 3HSRA 4G7HF 1QQIA 2OQGA 1D8JA 3R4KA 3OV8A 1T98A 3DF8A 1BI1A 3V8JA 3BROA 3CLOA 3SHFA 5EEGA 4LLLA 1FBUA 3J81K 3QU6A 2H27A 4HZFA 3HTSB 1HKTA 1WSUA 4LK0F 2BE5F 2RDPA 1KA8A 4G7ZF 3PQKA 3F8NA 1Z9CA 5L3EA 3V7CA 2STWA 1Z91A 2XAGA 2ZMEA 1PP8F 3RKWA 2ZBKA 2XV4S 5LHHA 2PLYA 3K69A 3T0YA 2Z33A 3C1DA 3L7WA 3QP5A 2QWWA 3RTRA 4N9IA 1D3YA 1XSDA 4HYEA 2ZCWA 4CXFA 2M1BA 5CLSA 3RYPA 2GA1A 1VTNC 2ZJ2A 2F5DA 2OZ6A 1FPQA 4ON0A 2CYYA 1WQ2A 3C3WA 2QZ8A 1F1ZA 3GUDA 5JFRA 1USTA 1K78B 1TW3A 1BI2A 4EJOA 1QPMA 2DU9A 5D4SA 4ZZLA 4L0ZB 2OD5A 1J5YA 4I2OA 2EFQA 4LG0B 3P9CA 2BGCA 1MDMA 3F22A 4P5OA 2D1VA 4U0WA 4UVCA 2P6SA 4FX0A 2ZKZA 4EJWA 1BIAA 3FXRA 2M87A 4U88A 1B9NA 3F8MA 1I1GA 2M5WA 3QPHA 5CVUA 1F5TA 4I98B 2UZKA 1B1BA 1TNTA 1LEBA 2HKOA 1ONVA 4KFCA 4HQMA 2XAFA 4GCVA 4OU0A 5LRSA 1KGSA 3Q5FA 1STZA 4EGYA 3WTWC 2A68F 4XRFA 2XGXA 4M9SA 4RGRA 2DI3A 5LHIA 2LNBA 4ZZDA 3WTUC 1UCRA 5D4RA 5E1WA 5JI6A 2QQBA 4LLNA 5E1ZB 3I4PA 3TDUC 2CG4A 2L01A 2J5OA 3IWFA 5E20A 3W6JB 3MFKA 4IPAA 2IA1A 3GZ6A 1EH8A 3MCZA 4PCQA 3VOEA 3SQNA 2ADUA 4ASNA 2FNPA 4A6EA 3ZN1A 2Y48A 4KN4X 5JHUA 3GFIA 4D0PA 4EM1A 2BBYA 1SFUA 5FD6A 3TQNA 4ZYGA 4RGSA 4ENKA 1SMTA 3WTSC 4A0ZA 2VOOA 2LF8A 1QZYA 1FWZA 2HGCA 2YSRA 5IT9K 1J7KA 2EB7A 2NNYA 5F1RA 3ABUA 2VBXA 3M8EA 3PFIA 2F2EA 4IXAA 3FXUA 3IL2A 1J59A 3HIFA 1SD7A 3T8RA 3FWEA 2E7WA 1IXSB 4KMUX 1QO0D 1IRGA 2YPRA 4RB2C 3RI4A 5LEJA 1IAWA 2DTRA 4FX4A 5LHGA 4A5MA 4L9JA 4IHSA 4I09A 4YIIA 3BDDA 1XMAA 1B9MA 4KIFA 3GXOA 1BJAA 3ML6A 2EFWA 4WK8F 3N4MA 3E3VA 1S8NA 4OMYA 1ZAOA 2QBYA 3IKTA 4R79A 2IA2A 3QPTA 2MH9A 1YFHA 4HW0A 2WWYA 2JT1A 2DPUA 2CQKA 5LGNA 3J81Z 3R60A 4HA8A 3H3ZA 2GXBA 1O3RA 2VONA 1WRJA 4HF2A 4QLCU 2RKHA 2ZNYA 2KIFA 1TTYA 1SAXA 5FFXA 4RAYA 3WG9A 1UHWA 2P5VA 3G73A 3HRUA 3MAJA 5D6FA 1PP7U 1R58A 4PDKA 5FO5A 2A6EF 4PGHA 4B8XA 3BJAA 1G4DA 4UXNA 3DKWA 4KA4A 2DK5A 2EV5A 4M71A 5E18F 4OINF 5BMZA 4AVPA 1FC3A 1Z05A 1YO5C 3S2WA 4A5NA 3TOBA 4EM0B 2MA3A 1BOAA 2IPQX 2HQNA 1OYIA 2DLLA 4HLYA 5L3FA 2VBYA 4M74A 1P4WA 3HTUA 3WTXC 2V9VA 1S7OA 4WCGA 4UV8A 1TLHB 3I59B 3RPQA 3LA7A 2QLZA 5J8CA 3JW4A 1V4RA 1KQ9A 5FLXK 1ZG3A 3RPUA 2NNNA 1OPCA 2DAOA 3MZYA 4MQ9F 2RNJA 3QRFF 4NHJA 4MQVA 4WXHA 4EV0A 3LAPA 3M7GA 3Q9SA 5K5OA 4PGGA 5DV5A 2CW0F 5FGMA 1OYYA 1S3JA 5A2QK 3FMSA 5D5XB 1O7FA 1XMKA 1LVAA 3Q9VA 2FRHA 1GXQA 2O8XA 4U7DA 2UXNA 5EEHA 1ZH5A 5J6XA 2JZYA 5D8LB 5ICFA 3ELKA 3IWZA 5E17F 3QP6A 1TW2A 2PJPA 3I5UA 3REOA 1IRFA 3DEUA 1GXPA 4G7OF 4B09A 5CJ9A 1R5HA 5ERIA 1FYKA 2STTA 1EV7A 3EUHA 1ZLKA 1HSJA 2Q2EA 4I0AA 1O57A 4R8HA 5K5QA 4S04A 3IC7A 1G3SA 4HAMA 3D0SA 3U2RA 4KMFA 4ZH4F 2Y75A 4A12A 4BAYA 4BH9A 1IN7A 1KU7A 1FYMA 4M73A 4LB6B 1Y0UA 3T8TA 3GX4X 4HV5A 2X0LA 2VBWA 4GGGA 4EJVA 1SFEA 3K1NA 2EFPA 1L3LA 4YIFA 2VN2A 4P9FA 3CTAA 2AS5F 3E5QA 4IRHA 5CVJA 4Q4ZF 2PMUA 3MWMA 5IT9Z 4AIJA 2F5EA 3F23A 4LFUA 5LBQA 4P9UA 5E1XA 3TGNA 3L2CA 1DUXC 5CYVA 3NQOA 3G3ZA 1QZZA 4KNYA 2UXXA 1TQPA 2FBHA 2LSOA 2XAQA 4HV6A 1G3TA 4Q5SF 1YW7A 2HR3A 2OZUA 5HVQC 2PG4A 5H20A 5D5UB 3DQVC 1QNTA 2LF7A 4O3MA 2XROA 1E2XA 1ZLJA 3KE2A 1CF7A 1MJ9A 2EWNA 4A0YA 1REPC 2VXZA 3QOPA 4LK1F 3KP6A 3BWGA 3C7JA 1J75A 2TDXA 3WGIA 3MEXA 1ZYRF 1YQAA 2HTSA 2XIGA 3WU1B 5E8IA 1BC8C 1LB2A 2K02A 3B73A 1YLFA 4M72A 1HW2A 1E17A 3CJNA 1BIBA 1UB9A 4OMZA 3JSOA 2YX4A 3O6BB 3GO5A 5DCMB 5FFZA 2XVCA 3F21A 3HHGA 1XSXA 4JK1X 5JVTA 1HW1A 1O3QA 4CHUA 1P92A 4A2UA 4HX4A 1FP2A 1RI7A 4CICA 2FQ3A 2YX7A 2XHKA 4GXOA 1CGPA 5AIPA
chains in the Genus database with same CATH superfamily
4O5VA 4Q47A 3VB2A 1ZKGA 3AG3H 3EETA 4A3BJ 4B44A 2DTZA 1W7PB 1IN4A 2NYXA 2R4GA 3BR3A 1JTXA 1Z0XA 3HC7A 4HDVA 1OCCH 3OOUA 3TDZC 3ZMVA 3T5XA 3VSKA 1X3WB 1FIAA 3A1YA 2A5YB 1EKEA 2NOJB 1OR7A 1EA3A 1U0JA 2Y0SN 1G8XA 4G9YA 1Z6TA 1ZARA 3ISPA 3RDIA 3EUHC 5DS9A 2XRLA 2EIJH 3B02A 3KETA 1I50J 2NVYJ 4YFKF 1YIOA 4JP0A 3FXOA 4XKWA 2D2WA 2XPUA 2P7CB 3E97A 2W82A 1I6HJ 5FLXZ 5JLWA 4ZYEA 2DOEA 1I39A 2IJLA 5F0FA 3PJRA 3M8FA 1A5JA 3OL3A 2VT3A 3KLOA 3OSGA 2CV1A 1AU7A 4MEYF 1JGSA 1R5GA 1DP3A 4RDUA 2LBFA 3H92A 2IS4A 3LWFA 1P4XA 3V8LA 3FBNB 1D5VA 3FDYA 1TZLA 2L9RA 1JKPC 5LGUA 2VQHA 3ECHA 1VQ6I 3CO6C 5HNFA 1MH4A 3CUQC 4YG2F 5A2QZ 3DCFA 4IHYA 2BZTA 4PZJA 5CVIA 2F5FA 1EJ9A 4BHPA 1R36A 2JPBA 4JX5A 1ZG5A 3FF5A 4F3QA 3OYLA 5L3BA 1C0WA 2R93J 1BM9A 3KZIC 2O0YA 4OIPF 1SD4A 2COMA 2VC0A 5TISC 2VODA 2ID3A 2O6GE 5FROA 3GEZA 1OCOH 2KL4A 3TBIA 1QGPA 2B9SA 3RKYA 2AQEA 2IGKA 4E70A 2HOSA 4M6XA 4GYGA 5GTHC 5ILVA 4UUTA 2ZNZA 3JRBA 3OY9A 2Z3YA 3PNTA 3LQQA 4UVAA 1T38A 2MD0A 3HOTA 2JRTA 2R5ZA 2O3FA 4MTDA 3O8GA 2L54A 2EJRA 2JSCA 1K78A 4OIOF 2QQ8A 2QVOA 4WXDA 1IC8A 2CO5A 1POGA 4M3GA 3EDPA 2LDUA 3O2PE 4RLQA 4UUVA 3A4CA 1XB4A 1MBFA 1XCVA 3DLAA 2CQNA 2CFXA 4F52A 4CSWA 3HRTA 2QEXI 1Q1HA 3UNGC 1MGTA 4LG0A 4E7LA 2HTJA 3BR1A 3WHCA 4HOBA 4M6YA 5GAHJ 1PUEE 3R0JA 4RM3A 1YYVA 2PMZA 4L5JA 4HF0A 1A36A 1JKOC 1AOYA 3WE2A 1U5TB 2OA4A 2ECBA 1HBXG 2L7MP 1JHHA 1GVDA 4DIQA 2MD5A 3WGGA 3MMYB 3OYJA 2EFOA 3JRIA 1H8AC 2DT7B 4IJAA 4A3CJ 1XGOA 3CJRB 4KUMA 2R0QC 3FX3A 4DNCA 4KISA 5GPCA 3DTEA 3LSGA 3IRRA 5LLQA 1OKRA 4RAGA 4XQFA 2LD5A 3RPUD 4M3DA 3HEFA 5EJCA 3EUAA 2KT0A 2MC3A 3F9KA 4RB3C 1WCMJ 3L2RA 3EQLF 4F92B 3KEYA 3KFWX 1QHHD 3I54A 1YX5A 3HYIA 2HEOA 4LOCA 4JBAA 3M07A 4OOIA 3WTTC 1YRNA 3BLYA 3FMQA 1HXDA 4HLXA 5EG0A 3HOSA 2PI0A 1RZ4A 4MFDA 1Z1DA 1T0FA 1MJAA 1G6NA 1FP1D 3K0LA 5F27A 2V1UA 2VJJA 2ISYA 3GTLJ 1D1CA 2X48A 3H9QA 1JKRC 2E36A 3HSEA 1WPKA 1WI3A 3L09A 4AIKA 5DD8A 5EDNA 2MH2A 3HZJA 3VFZA 4EQQA 2KZGA 2DMUA 1IXCA 3BY6A 2DO7A 2EK5A 1WVRA 2DN0A 1ENHA 1GLNA 4RS8A 2NVXJ 4S05A 1R1VA 1G3YA 1MD0A 3RJPA 1VQNI 2OQRA 5FKMA 4ZDOA 3GFMA 4IVNA 3OR2C 2EV6A 2HWVA 1MNDA 4L5IA 1SD5A 3PIOF 1R5ID 3PUFA 3GYHX 3CDHA 4K2EA 1V5EA 2F48A 1OISA 4HEA2 2WY8Q 2QSHX 3BC8A 3WTVC 4DBQA 3SZPA 2XGCA 3IKVA 1FIPA 1ETOA 1RUOA 3N97A 1VQ8I 4QWQA 1LFBA 2H1LA 3FBIB 3QAHA 4FCYA 4M6VA 3WHBA 2Z99A 5K7ZA 3KP3A 3DWLE 2JUCA 1OR7C 4NQWB 1U3EM 3D1NI 3TO7A 3HOYJ 1IUFA 2DW4A 2ICWG 1UELB 3J7AO 1X1AA 5J1RA 1RRJA 3RYRA 2AHQA 1DP7P 1YG2A 3FXQA 3ZP5A 4GRIA 4IF4A 1IV8A 3J7YJ 1UZCA 1R6RA 5IT3A 2GM4A 1WJBA 1X1PA 3LAJA 1JTYA 2A05A 1K4TA 2BY1A 5KAIC 4E7SA 1D1AA 1FSHA 4U0YA 1BA5A 1JT6A 5FB2A 2CRGA 1A04A 3K4KA 1V3FA 4EJUA 1VQMI 2PN6A 2XAJA 3B6AA 1FLIA 2DMTA 2R3SA 4ESBA 4BGDA 3BPVA 4DQ2A 4CA0A 2E2IJ 2VOPA 3PSIA 1WKMA 3DEWA 3SEZA 1Z67A 5BPIA 1NK2P 3CCVI 4MEXF 1IF1A 2XAHA 4EM2A 3L2UA 3J80K 4Y3OA 1IXRC 3BR5A 2HYJA 1RPWA 4BU2A 1YJ9I 1W5CC 2BVMA 2G7HA 5IPAA 2H6CA 1NH3A 2AO9A 4IHTA 3GTGJ 1XTAA 2Y69H 4I6ZA 1S29A 3CJQB 4WX9A 4HF1A 1FT9A 3E6DA 5LGTA 1FTTA 1FOYA 3G2BA 1HF0A 4GDFA 1WI9A 4G94A 2PMHA 1XCBA 1Z3YA 1ODDA 1XMXA 2LYCA 4TV7A 2HVSA 3P7NA 3DXJF 3VYRB 1KU2A 2W84A 1MBEA 1WH7A 1R22A 1VZ0A 2X6YA 4Y15A 3J7AY 1SEUA 3WE3A 2PEXA 4LLGF 1APLC 2HQAA 2W1OA 3GW2A 3OYMA 3HUGB 3GVAA 2CSOA 3CCSI 5ICCA 2A61A 1I27A 2DMNA 5EEAA 1K6OA 2HDWA 2DA2A 3PL8A 2OBPA 3ZMSA 4EMSA 2VQGA 4KICA 4FHTA 3JAMK 1S6LA 2VE9A 2WADA 3V7SA 3JR9A 2L9NA 2M34A 2BW3A 4XSZF 3CC4I 4BY1J 3KP5A 3OIPA 2DFHA 1ZGJA 2IA0A 2Q1ZB 3PM1A 1JHFA 1VQLI 2JA8J 3JTHA 1WJEA 5JVGF 5DD4A 2ZB9A 3PNYA 4EEFG 4I99C 3KP7A 1B8IA 2CW8A 3ZMUA 4E7IA 4V2FA 2CUJA 2H09A 2RREA 4EVIA 2YU3A 2GOXB 2HFHA 5D5WB 3H0DA 1RIOH 4LGWA 4UUSB 1X4OA 1S5LC 4C3IJ 3ROUA 2HZTA 3ABMH 2Z5UA 4L9NA 2DA6A 2AXLA 3PNVA 1B72B 3MZHA 1TWAJ 3TO6A 3S1MJ 4Y33A 3EPZA 1U9OA 2ISZA 4NC6A 4HG2A 3CUOA 2PBIA 1KYZA 3F8CA 4BEHA 3RIRA 1T0FC 2LKPA 1QBJA 2ZO4A 1XG1A 3BTJA 4RB0A 3CF2A 2E1NA 2H6BA 2K9NA 3C18A 5DDGA 5ICGA 5BNGA 1RC9A 3LA3A 5F6FA 3ZMDA 1YIJI 5E3LA 2Y31A 1ZRCA 4LD5A 2R5YA 1YOVB 4H4KC 2DFIA 2IEKA 4CCOA 1ON1A 2BHZA 2WV0A 3COAC 3I59A 1T8IA 5H6RA 1WJ5A 2MYSA 2HOEA 3VDXA 3OYDA 4L0YB 1FBSA 3W2VA 4CUGA 3N05A 3U9GA 1MBGA 4YELA 3ZN0A 2DA3A 1MH3A 1ZGAA 4E6KG 2KRHA 3LQRA 1U5TC 4IHXA 1MNEA 1IN5A 2FMYA 2XF7A 1KU9A 1XN7A 1FMVA 2GIZA 3GLXA 2CW7A 1QZEA 4LJZF 4F7ZA 1BR4A 2FBIA 4YFNF 3ERED 2B7EA 1F9NA 1IDYA 1W4MA 2WTEA 3QQAA 1QHGA 4XLPF 3O3KA 1O3TA 2Y2ZA 4QIWN 4CCKA 2E5NA 2HI3A 5LRRA 5KHDA 1IRZA 2E1MC 1U6GA 2RV8A 1XDUA 1H0MA 4ENNA 2KRFA 3V4GA 3JREA 3F0CA 4BQAA 1OLTA 1DGWY 3P9IA 2L2OA 2FX0A 1D0YA 1WWXA 2VPRA 1ETXA 2G7UA 5F64A 2VKEA 3RKXA 1JGGA 4CO8A 3E1SA 1VNDA 5HOOA 2M4KA 3CUQA 3CCJI 2HDDA 2XSDC 3WODF 3K4BA 3H3VK 2QQAA 3MZ8A 1MSEC 2VXDA 2QKMB 5TGTA 3SZTA 3LSPA 2ECCA 4X0GA 3SXYA 5CVRA 1H9GA 2FMLA 3HPGA 1K7AA 2VIXA 3IRQA 1OQYA 3E6CC 1YX3A 1R9TJ 1R1TA 2K5CA 1JJ8C 2KKOA 4EGZA 2HQ5A 2CJJA 1HLVA 3A03A 2NVQJ 3HOZJ 1YS6A 3WG7H 4IKFA 3OMYA 3PO2J 2G9WA 1BBYA 2NS8A 4RAFA 2P6TA 4XMYA 1JKQC 3GFLA 2V9KA 3V8KA 2IP2A 3KP2A 1FOWA 4MGRA 1IZ1A 4BY7J 2X9DA 2IW5A 1UFMA 2BXYA 2P8TA 4MTEA 2XC7A 4PJJA 5E3OA 2VBZA 3DPLC 1X1DA 4M3BA 1JUMA 3FMRA 2BY0A 4BDYA 1BN5A 4BYYA 3K6GA 1JE8A 3I4MJ 1S7AA 4YEJA 1LFPA 3OIOA 2JWTA 2L4MA 2R7SA 5J1UA 1FNNA 3OS2A 1ZTRA 3T1BA 4J00A 3KIOA 3LSHA 1X2MA 4E7JA 3GTQJ 1ON2A 2PMZN 3K1PA 1X1BA 2CS3A 3ZPLA 2X4HA 1F43A 2BV6A 5LFAA 1IN6A 2ESNA 2LFBA 4RGXA 4B1RA 3CCQI 1B59A 1LDJA 1USSA 2FOKA 5FRNA 1T39A 2OU2A 3NWTA 4OIQF 1MMGA 4UB6C 4LB5A 4Y52J 4A3EJ 2FU4A 4HSRA 2ZMEB 2JMWA 5L3CA 4FQGA 4UHTA 3BPXA 3AL0C 3JCUC 3TP0A 2P81A 5J8FA 1OCRH 3CDLA 2ETHA 3SEQA 2K7LA 1P6RA 3RSNA 4KN7X 4FISA 2GZWA 1L0OC 1S9HA 4BQNA 4A69C 3G1OA 4EJTA 2JVHA 1OMIA 1T08B 5FD5A 5JR3A 2KIMA 2V6CA 4Q48A 5BQTA 3OYEA 3VPRA 2KIUA 4A93J 2LK2A 3CESA 3JRFA 2HXOA 1D0XA 5L3GA 2FNAA 2R7UA 1EH7A 2CU7A 3ECOA 2JRMA 4DZJA 4CDGA 3H5RA 1MJBA 2M9HA 1SVLA 2QQ9A 1MZBA 2XUBA 4DYCA 2CMPA 3AAFA 1PUFA 1BI0A 1Z7UA 2P7VB 4Z6YA 4A0XA 1EH6A 1P2FA 3J80Z 2K3PA 4KT5C 2HQRA 1LKXA 3BR6A 5IYCJ 4AWXB 3E0JB 4ZYDA 4CCLA 1IJWC 5K5RA 1YITI 1R71A 2OCCH 3PQJA 4CGZA 4XL9A 3HOXJ 3HHHA 1JT0A 4AIHA 1HKQA 1HDPA 2VLAA 3KYLA 4A3JJ 2JA2A 3GFJA 2D45A 2CWEA 2LRDA 4PJ0C 2LBFB 4L18B 1RKWA 3QPSA 5BS6A 1LE8B 1MDMB 2ELHA 1W1WE 1J0RA 2HDCA 4KIBA 5HNHA 5M3MJ 1VQPI 2A07F 3WGHA 1NHAA 4ABZA 3CF5F 5FRMA 3A01A 1LEAA 1XPXA 3M1EA 2F5CA 4CZZA 2XKPA 5ICEA 4X6AJ 5GTIC 1FOKA 2R7FA 1OYWA 1Z6RA 4UNOA 2DODA 1W5SA 5ILUA 5HS8A 3NEUA 1K61A 3S1NJ 2K4BA 3PUBA 1K79A 3LSTA 1I3QJ 2W24A 2KJBA 5CVVA 2Q0OA 4B48A 3HGYA 1KU3A 3KYDB 1FY7A 3G1MA 2KDOA 3JAMZ 1ZN2A 2VC1A 1ZELA 2QSGX 5DYMA 3SFZA 5K7FA 4XN3A 3GZ5A 4DYRA 5DCMA 4MHGA 2H8RA 2OV7A 4KYWA 5EYRA 2M0CA 1I1SA 1XX5A 3VEPA 3Q0UA 2E19A 1SFXA 1OCPA 4PJLA 3M3YJ 3MN2A 4XBFA 5GADJ 1VQ5I 1TT5B 1H9TA 3BG9A 2UWMA 1X3UA 2A5WA 2WC2A 3OWTA 3I71A 3HRMA 4WXCA 4HNUA 2R7DA 2GQQA 4AVZA 2E2JJ 6PAXA 2M2EA 3P9KA 3QYEA 3CJTB 2KJCA 2O61A 4IQ4A 3TOAA 3FK6A 2XASA 3BZ6A 3SDGA 5F0HA 2R7QA 3IHUA 2I8DA 3K1MA 4HX7A 1AWCA 2QENA 1W7PA 3M9AA 5B3SH 2EZKA 2KP6A 2KMUA 1LVKA 3OOPA 5HS9A 2EFNA 4HQEA 3DLLF 3BQYA 2DQLA 5EGOA 3LA2A 4A3FJ 1LQ1A 2VQCA 2MBFA 1U2WA 2CUEA 2J5PA 4Z2YA 2L3DA 3IAM2 4EATA 4V2GA 1W5TA 2EQRA 5TRDA 3I56I 3FHZA 2FSWA 4HPQA 3D5LA 4FETA 1RUNA 4RAZA 1T6SA 5CQEA 2X85A 1Y8RB 5DCFA 2OAZA 1ETYA 2OCEA 3IH3A 5B1AH 5KVRA 5ED4A 3CO7C 5BOXA 4XNFA 5KK1A 2KPMA 2MSYA 4DOZA 1VQ4I 1YRNB 3TO9A 5EG0B 2F4OB 2W57A 1WJAA 2DBBA 2FBKA 3AFHA 2BEOA 2IAIA 3CD6I 3G71I 1FOXA 4WWCA 3ZQQA 3U21A 3KCCA 3W6KB 2QCOA 3ZQLA 1TNSA 4BHBA 4UV9A 1U8RA 3K70D 5GPAA 4ESFA 3H5NA 1HSTA 4E7HA 1FSEA 1KQ0A 1XSVA 2E7XA 3WTZA 4ENMA 2JA6J 3SYTA 3GLLA 3I64A 4XLNF 2P5LC 3AG1H 4I02A 3U1DA 1G2HA 1U78A 2R7RA 2OUMA 4BQQA 5GAGJ 2Y0MA 3IH4A 5AIQA 1U9NA 2GAUA 3K9TA 5IP9J 2FA5A 4I76A 2A69F 2QBYB 2XKOA 2MW8A 3H0GJ 1I5ZA 2EINH 1HOMA 4P55A 4ESJA 4F91B 3K2AA 4ETSA 4CYDA 1M1EB 2FEZA 4BXUA 1SAUA 2H1KA 1ZR2A 1TBXA 1V55H 4IRGA 4MO7A 2NS0A 1WH5A 2RQQA 1YHQI 5KCMA 1ETKA 2ACJA 3CMYA 1DPUA 4NC8A 2WV1A 2PQ8A 3HRSA 4UVBA 3ZMTA 2GIVA 5TJJA 2IGMA 4WF2A 2WAQA 1RNLA 3M4OJ 4RA2A 2RVCA 1B4AA 3KPHA 2P4WA 1MIJA 1FX7A 2BOLA 2IVMA 2KISA 2MLGA 4G6DA 4GYIA 1XDSA 1O3SA 2DMQA 3EYIA 1RESA 3DEEA 4CCMA 1U5TA 2HYGD 5D5VB 5HLIA 5FLMJ 4A3DJ 3EYYA 3OYAA 2YUSA 3LNQA 1UMQA 2WAEA 3GTPJ 1Z3XA 2K27A 4BHCA 4XM3A 2VT2A 3I0TA 2KLOA 1W0UA 4BE2A 3E6BA 4HX8A 3R6SA 4P1WA 5AONA 1N78A 3O8HA 4QPOA 4KT6A 3K4MA 1I6XA 2IT0A 3FZVA 2EV0A 4E7KA 1LJ9A 2NVUB 2M30A 2TRTA 2R7ZJ 3BJ6A 4Y13A 5HDGA 2B63J 1EF4A 3L2QA 2KIQA 4PSXA 2M3AA 2A6HF 3ONQA 1BL0A 2DQRA 4ZTFA 3DBLB 5DUKA 3HOVJ 5F08A 1YTYA 2QF7A 1BI3A 3L9FA 1UG0A 3VODA 2XDVA 2DA7A 3D5RC 2PJRB 1WHUA 1J2XA 3TEDA 2HPIA 3GWZA 5FKOA 4LMYA 3UR3C 4D5FA 2RGVA 2VJ4A 2V79A 3E5UA 2NS7A 3I3LA 2EA4A 2BY3A 1OCTC 3CC7I 2RNGA 2XSJC 1E3HA 2EA2A 3KP4A 5HS7A 2O03A 1FYLA 2D1HA 2LKXA 3QU3A 1VQOI 3S8PA 3LOCA 4E4HA 2HYFA 1P4AA 5DM7F 4RGUA 3WTYC 5E8GA 4LG3A 1LNWA 3LL7A 2ME0A 4LIUA 2OF7A 5IYBJ 5K1YA 3DV8A 1R00A 5JHFA 1N25A 4AYBA 1LUJB 2CQQA 3BTIA 3IV5A 2P5KA 3KEQA 3CCRI 3LFKA 5CKTA 1XD7A 2WA0A 2LTPA 4IRIA 2MLKA 1AKHB 4U7BA 2A3SA 2Y30A 3E7LA 4I01A 4XN0A 1RR8C 5J4YA 1GVJA 3FK7A 2FE3A 5L3DA 4FASD 1R49A 3SDBA 1Y1VJ 1YW8A 3GBGA 4A3KJ 1MSFC 1HQCA 3DU6A 4A6DA 4PSWA 5C44J 5H6QA 2R7WA 2M8EA 4XK4A 1GDTA 4BBSJ 4NQWA 4NB5A 1W36C 1QVTA 2HOTA 3C2BA 4IZZA 1JJ6C 3H5AA 3CP8A 4IOAF 5ILSA 3OYCA 3OYIA 4I0BA 4P96A 4YFXF 3HM5A 4IX7A 2XGEA 3A2KA 3NRVA 4MNUA 3GMEA 2W7NA 3F3XA 4M9ZA 3K4JA 2IBDA 2QSFX 5LEKA 4DBRA 1F36A 3ABTA 4XLCA 1LDDA 2V1XA 2E1CA 1OFCX 2Y9ZA 3F8FA 2ZXJA 3BJOA 1F4KA 1GUUA 1UHSA 2IGNA 4ZYHA 2QGUA 1IW7F 3QWLA 1U8BA 1IRXA 4HSTA 4FT8A 2IS1A 4XLEA 4GO1A 2CV2A 2FXAA 3OYKA 1FTZA 4XRMA 2L7FP 4B3XA 3DP7A 1HW5A 1JXSA 3E6MA 2K3FA 1QA6A 2Z2SB 2VQLA 2X6OA 4AD9A 2LY1A 4G8XA 2GXGA 2K86A 3I58A 2QM3A 4N0BA 5D6EA 3TKYA 3JTGA 1ERDA 1R23A 1BW5A 2OJED 1G3WA 2WB1A 3V7RA 1DPRA 2DPDA 4G6QA 1ZHFA 2NAZA 2X1EA 3BCAA 4IQJA 3Q0VA 3K2ZA 1ACIA 1XGMA 1ZG1A 1IN8A 2QYOA 4BJ6C 2GOMA 1UAAA 3GF2A 3KLNA 1ZREA 4HDUA 2QUFA 1X58A 1Z21A 2Q8KA 4ZC3A 3H35A 3FM3A 3ZQFA 1ZRDA 4R1HA 1B6AA 2Q2EB 1BW6A 1LFUP 5C4JJ 1DDNA 2HKXA 1PDNC 2L02A 3S1QJ 4U87A 3S17J 2ZSHB 1Y56A 1E3PA 3FXLA 3KZYA 2GA2A 1QVUA 3CMEI 3PFYA 1SMYF 2B0LA 1N77A 2C6YA 2F4IA 1KQ8A 1FBQA 1KYWA 1MKMA 1A35A 1TC3C 2JTVA 2LP0A 2IRFG 4M9XA 4BBRJ 3WU0A 1J9IA 4HBLA 2E2HJ 1D8KA 1ZRFA 2L7ZA 2BVLA 4LITA 3LSRA 1HKSA 4FE4A 5EF6A 2WBMA 3F6VA 2RC4A 4KDPA 3HUGA 4N9HA 1TQIA 3L00A 5M3FJ 4XONA 3UKGA 1VF9A 4Y17A 4RB1A 2NRAC 4XR6A 1SD6A 2JVGA 3JSPA 3S1RJ 4QTRA 3CUQB 4ITVA 1VQ7I 4I7HA 1TP4A 5E79C 5HDKA 3W2WA 4D1QA 2BY2A 2H8WA 3S3OA 1WFXA 4U0VA 3SZGA 4H0EA 1BC7C 5HDNA 4S0HB 2GWRA 5HLGA 3FKIJ 2V6EA 2QA4I 4GFBA 3TL4X 2DDAA 3DPTA 2ESHA 5FKKA 5FLVA 2O8KA 3BOQA 2AXTC 2JPCA 2V4JC 1W0TA 5DUIA 3KYCB 3F72A 1AHDP 2X6XA 2RQPA 4L9VA 3W3CA 4JQFA 3MKLA 1ULYA 1VFCA 2HS5A 1DU0A 3ZRGA 3DFGA 3MVPA 3ESWB 3JRDA 2H94A 4QSHA 4UUSA 5M5YJ 2CGPA 1XC5A 3F6OA 1R1UA 4V19K 3F8BA 1ZGWA 1B72A 1T2KA 3TMOA 5IOYA 2M0MA 3ZQIA 1UHMA 3E5XA 5E3NA 4AU7A 2RN7A 1TWGJ 4BDZA 1BR1A 2MABA 1SVOA 4AC0A 5DEQA 1PVEA 1IUYA 1O7LA 1CF7B 2L0KA 5J4VA 4ENJA 1QU3A 4A3GJ 3FXKA 2M45A 1R7JA 3Q3SA 1HDDC 5HLHA 4XIDA 4KIGA 4C3JJ 3BTCA 2PFBA 3ZQ7A 1XGNA 3R0AA 4CYCB 2L4AA 1X2NA 4O6JA 3HSFA 5FJ8J 2XRNA 4IOCF 4F93B 1XS9A 3ZMZA 2DT5A 1XGSA 3BR0A 5B5EC 2FF4A 3HBLA 2LOOA 2BYVE 1K4SA 3KEOA 5D8KB 3FM5A 3GZNB 3R61A 4B3AA 3VYUB 4B47A 2LY9A 5BPDA 1YW9A 3KZZA 2LLKA 1W7PD 4XSXF 4L9TA 2IS6A 2W4SA 4BNCA 3DPUA 3K4NA 4OWRB 1LDKB 4C30A 3GTJJ 2YS9A 2YU9J 2VE8A 2EH3A 3OS1A 1YS7A 3MQ0A 2M7BA 2YR2A 2V1DA 2ZFWA 2K85A 2MC4A 2I5UA 3ULQB 2K4JA 3H3UA 3FIWA 4XORA 4C2TA 3LSKA 2VKDA 2W25A 3ZCOA 1Y6IA 2DJIA 4A3IJ 1FZPB 1R4NB 3CMAI 1GHCA 3CLQA 2XB5A 2VKVA 3CQZJ 2W85A 3I53A 2DK8A 2R92J 1YJWI 2PX9A 3HG9A 2CUZA 3HPHA 4M3EA 3DU5A 1ZR4A 2Z9OA 3BP8A 2K9MA 5J40A 3CCEI 1TQMA 4B4CA 4OIRF 3HSRA 3JRHA 3WU2C 3X2QH 4D7MA 2X51A 1D0ZA 4G7HF 1QQIA 4NNJA 1IG7A 3G4SI 1D1BA 2V7FA 2OQGA 3ZQCA 3OSFA 1HCRA 1ETWA 1D8JA 4UB8C 2VB6A 3R4KA 5EZHA 5B66C 2HU9A 3OV8A 1T98A 1WJFA 3CCYA 4CCNA 3DF8A 3VYTB 1BI1A 2NXNB 1BOBA 3V8JA 3K7AJ 3BROA 3GTKJ 2ME6A 3CLOA 3SHFA 1KONA 5EEGA 4LLLA 3MKWB 4DZPA 1QPIA 1BR2A 4ZJZA 1FBUA 3J81K 4JX4A 3EUKL 3QU6A 1K83J 2H27A 5J1YA 3NAUA 4HZFA 1UG2A 2VJ5A 2WAQN 3FXMA 3HTSB 3S16J 1FEXA 1HKTA 4MFEA 1WSUA 4LK0F 4D5CA 2BE5F 2RDPA 3LFUA 2BHYA 2O5RA 1KA8A 3BT9A 2O7OA 4G7ZF 3CCMI 3K4CA 3PQKA 5E3MA 2ZJQF 4NC7A 3F8NA 1Z9CA 1RKTA 1MMAA 5L3EA 2MGQA 3V7CA 3HB9A 5CQGA 2HPMA 2STWA 3CC2I 1Z91A 1T95A 4XLHA 1X3ZB 2XAGA 4BE1A 1TWHJ 2ZMEA 1Y1WJ 1PP8F 3RKWA 2EILH 4IO9F 1HC8A 2ZBKA 4XICA 2XV4S 3BG5A 5KAFC 3K69A 5LHHA 2DFEA 5F04A 2PLYA 2CV0A 3T0YA 4LIVA 1SANA 4BJTA 2Z33A 3ABKH 3C1DA 3TW6A 4L5EA 3L7WA 2Z16A 5HLTA 3QP5A 2X6WA 2OPTA 2QWWA 3RTRA 4N9IA 1D3YA 1XSDA 4HYEA 2ZCWA 4CXFA 4DYQA 2M1BA 4G12A 4PUSA 2GXAA 5CLSA 4NBQA 3H9GA 3S2DJ 4BL0B 2K9SA 4PJNA 3RYPA 2GA1A 2JJ7A 2TCTA 5EGOB 1VTNC 2ZJ2A 2F5DA 2OZ6A 1FPQA 4X1EA 1Y39A 4ON0A 2CYYA 1WQ2A 2ID6A 3C3WA 3LSJA 5IP7J 2QZ8A 1F1ZA 4XRSG 3GUDA 5JFRA 2R5ZB 1QRYA 5LD2C 1USTA 1K78B 3MKYB 2VPLA 1TW3A 1BI2A 4EJOA 1QPMA 2DU9A 4OAZA 5D4SA 4ZZLA 4L0ZB 2KQRA 4AYBN 3DBRB 4C2MJ 2EZHA 2OD5A 4NUBA 3VWBA 3BZKA 4AIDA 3ZR8X 1J5YA 4I2OA 1LPQA 2EFQA 1VI0A 3AG2H 3HDDA 1K6YA 1LE8A 3P9CA 2BGCA 1MDMA 3F22A 4LG0B 4P5OA 2D1VA 4U0WA 2P6SA 4UVCA 2HOAA 2VL8A 2ZKZA 2VASA 4FX0A 3RQ4A 4OAYA 4EJWA 3GTOJ 3I9V2 3B6CA 1BIAA 3FXRA 2M87A 4U88A 1WZ2A 1B9NA 2VKHA 2LKSA 3F8MA 1I1GA 1D5YA 2M5WA 2DJNA 3QPHA 1MNMC 2JQ7A 5CVUA 1F5TA 3A0HC 5IY5H 4I98B 2DA1A 3BCBA 2UZKA 2JUGA 4MLOA 1G59A 3D5SC 1B1BA 1TNTA 3ASNH 4NDLA 2L9VA 1LEBA 2HKOA 1ONVA 4RMNA 2E35A 4KFCA 4HQMA 2XAFA 4GCVA 4OU0A 5LRSA 1KGSA 1TT0A 2HXIA 3Q5FA 1STZA 1HA8A 4EGYA 5M5XJ 3WTWC 1V54H 2A68F 3JRCA 4XRFA 2DYSH 1UJ8A 2XGXA 2DMPA 4M9SA 4RGRA 1GV2A 2ZC2A 4BS9A 3GTMJ 2BXZA 2CUFA 3IP4B 2DI3A 2WB1N 3QYFA 1J09A 3AG4H 3HKZA 5LHIA 2G0EA 4CZCA 2LNBA 3W6VA 5F0CA 1PJRA 4ZZDA 3WTUC 1UCRA 3V42A 3VYSB 5D4RA 5E1WA 3LSIA 5JI6A 2QQBA 4XKCA 4DGWB 4LLNA 1NK3P 5E1ZB 3I4PA 1V5GA 3TDUC 3JRAA 2XGDA 2CG4A 2L01A 2J5OA 3IWFA 4II2A 3HL2A 5E20A 3W6JB 4AUXA 5IOZA 3MFKA 4IPAA 2IA1A 2JK3A 1EH8A 2W48A 3MCZA 4PCQA 4PFOA 3ZQHA 3GZ6A 2F5VA 1VQKI 3VOEA 3SQNA 2A6TA 2OTLI 2ADUA 4ZTJA 1IV6A 1SFKA 2DCEA 4ASNA 2FNPA 4A6EA 3ZN1A 2K9LA 2Y48A 4KN4X 1WGXA 5JHUA 2K40A 3GFIA 4AM3A 3G1LA 4D0PA 4EM1A 2BBYA 2V9PA 2HZDA 1MBHA 4XRSA 2NVTJ 2E1MB 4J19A 1SFUA 5FD6A 3TQNA 2ZXHA 1RETA 4A3MJ 4BACA 2FOWA 4ZYGA 4RGSA 4PFPA 2R7XA 1SC7A 4ENKA 1SMTA 3PSFA 1VQ9I 2QKLB 3WTSC 1MBKA 4A0ZA 3M8JA 2VOOA 2LF8A 2R7TA 1QZYA 1FWZA 2HGCA 2UUZA 2YSRA 5IT9K 1J7KA 2EB7A 2NNYA 2O9LA 1SFOJ 5F1RA 3ABUA 3DKXA 2VBXA 1T56A 3M8EA 3BG7A 3CZ6A 3PFIA 2F2EA 4IXAA 5FKNA 3FXUA 2V26A 3IL2A 1IDZA 1J59A 3A0BC 1MW7A 4QPQA 3HIFA 2E5ZA 1NG7A 1SD7A 2W00A 3T8RA 3FWEA 1P7JA 2E7WA 1IXSB 4KMUX 1QO0D 2ZMEC 1DU6A 1IRGA 2YPRA 4RB2C 3RI4A 3CP2A 5LEJA 1IAWA 2DTRA 2Y9YA 4FX4A 4W97A 4HNVA 5LHGA 4A5MA 3BR2A 4L9JA 4W1UA 4IHSA 4RBOA 4C9YA 1FMWA 1CQTA 2ELKA 5IYDJ 4I09A 1GT0C 4YIIA 3BDDA 1XMAA 1B9MA 3RZDJ 3RZOJ 4KIFA 4BXFA 3GXOA 1BJAA 3ML6A 3CCLI 4ANJA 2EFWA 4DW6A 4WK8F 1E3OC 3N4MA 3E3VA 5H2FC 1S8NA 4OMYA 3S32A 1ZAOA 3MKZA 2QBYA 1MMDA 3IKTA 4R79A 1KZHA 3OL4A 1WJDA 1OCZH 3I4NJ 2IA2A 3NARA 2MH9A 3FKJA 3QPTA 2Y0SA 1AA7A 1PYVA 2XF6A 1YFHA 4XOPA 1IO2A 4HW0A 1JUSA 2WWYA 2JT1A 5GP9A 3HGGA 2DPUA 2HVRA 2CQKA 5LGNA 3J81Z 3R60A 2N8GA 4HA8A 2CFOA 3H3ZA 2ELJA 2GXBA 1O3RA 2VONA 1WRJA 4HF2A 4QLCU 2RKHA 2ZNYA 4UY8I 2VUMJ 1A6IA 2KIFA 1TTYA 1SAXA 5FFXA 3AL0B 4RAYA 3BG6A 2GLOA 5C3EJ 3S93A 3U1KA 3WG9A 3S2HJ 4BXXJ 1UHWA 2P5VA 4BJ5C 1Y8QB 3S15J 3G73A 3HRUA 3MAJA 5D6FA 4ZDPA 4IHVA 1PP7U 1R58A 2X1DA 5J3LA 4PDKA 2BW3B 4ZYAA 2F6CA 5K7HA 5FO5A 2A6EF 3BG3A 3CDIA 4PJMA 4PGHA 3PIPF 4B8XA 1E0EA 3BJAA 1ZQ3P 2LG4A 1G4DA 4UXNA 4II3A 3ZXSA 4BKXA 3DKWA 4KA4A 2DK5A 3TP3A 4YRVA 2EV5A 4M71A 1B8IB 5FKLA 3ABLH 2JA5J 5E18F 4OINF 2LC2A 5BMZA 2PJRA 2EZLA 4AVPA 1IGNA 3S14J 1FC3A 1Z05A 1YO5C 3S2WA 4A5NA 3TOBA 2ZFUA 3OYGA 4EM0B 2MA3A 3LMMA 1BOAA 1JI8A 2IPQX 4BEHB 1R4MB 1Z7LA 2HQNA 3PO3J 1OYIA 2DLLA 4J01A 3DTIA 1WJCA 4HLYA 5L3FA 2VBYA 4M74A 1P4WA 3HTUA 4E7ZA 2DA4A 3WTXC 3RKQA 4BE0A 2COBA 4N4NB 2IS2A 5CPRB 2V9VA 1S7OA 3BZCA 2EBIA 2R5YB 4WCGA 2XB0X 3IH2A 4UV8A 1TWCJ 1TLHB 2HVQA 4JX6A 3H1CA 3I59B 3FISA 3RPQA 4XKBA 3LA7A 5B1BH 1AKHA 1ETVA 3IAS2 2QLZA 2KRCA 1MMNA 2FD5A 5F1JA 5J8CA 3DTKA 3MD2A 4CCJA 3JW4A 1YJNI 1V4RA 4KITB 1Z77A 1KQ9A 2ZSIB 4ZDLA 5FLXK 1ZG3A 3RPUA 2LR8A 3L1PA 2NNNA 4RLFA 2EIMH 1OPCA 2DAOA 3MZYA 1TWFJ 3AKZA 3ZOBA 2CQXA 3K10A 2I10A 1P7IA 4MQ9F 2RNJA 3QRFF 4NHJA 5DTDA 4MQVA 1Q1VA 3OIQA 2LVSA 3ZQGA 4FTHA 4WXHA 4EV0A 3LAPA 3M7GA 1NTCA 3Q9SA 4BUPA 5K5OA 1NG6A 3HOUJ 1YI2I 2JSPA 4PGGA 3OYBA 5DV5A 2DOFA 2CW0F 2E34A 5FGMA 3S3NA 3CMMA 1OYYA 1S3JA 5A2QK 1N75A 3TW7A 4XKVA 2KFDA 2MG4A 4IHWA 3FMSA 5D5XB 1O7FA 2M7AA 1XMKA 1LVAA 1H89C 3Q9VA 2FRHA 1GXQA 2O8XA 4U7DA 2DXIA 3HOWJ 2E1OA 2UXNA 5EEHA 2FUG2 2XPVA 1YE9A 3H36A 5J6XA 1ZH5A 3DKYA 2JZYA 3L2VA 3HXLA 5D8LB 3L2WA 2RAEA 3OS0A 2FJ1A 5ICFA 3NWSA 1X19A 3ELKA 3FHNA 3IWZA 4HRIA 5E17F 3QP6A 3LSMA 1TW2A 2PJPA 3I5UA 3REOA 2KHMA 1IRFA 3DEUA 1GXPA 2E60A 2LY2A 4G7OF 3H9JA 3ASOH 3OYHA 2F4MB 4B09A 2LREA 4Y4RA 5CJ9A 4DJAA 4XLAA 1R5HA 2UV1A 5ERIA 3CCUI 1Y0NA 3M1CA 3RQIA 1FYKA 1OJLA 1EV7A 2STTA 3EUHA 1ZLKA 2IXSA 1HSJA 2Q2EA 4I0AA 2ZJRF 1O57A 1GV5A 4R8HA 5K5QA 3BQZA 2X1CA 4S04A 9ANTA 2NOGA 1G3SA 3IC7A 3QODA 4HAMA 2L5QA 3D0SA 1V5FA 3U2RA 4KMFA 2FQ4A 4FE7A 4ZH4F 2GBYA 2R7VA 4JYKA 2Y75A 4A12A 4BAYA 4BH9A 1IN7A 1KU7A 1FYMA 4M73A 4A3LJ 2JN6A 4PK4A 1Y0UA 4LB6B 2P0WA 3T8TA 3GX4X 4HV5A 2X0LA 2EIKH 2ZJPF 2VBWA 3Q0WA 4GGGA 2M8GX 1TL8A 4KJZA 3KX2A 4EJVA 2WAFA 1ZK8A 4IEJA 1SFEA 3P5JA 3K1NA 2EFPA 1L3LA 4YIFA 1T33A 2VN2A 2LMDA 2E71A 3CTAA 3HJEA 4P9FA 2DDBA 4F55A 4BQOA 3E5QA 2AS5F 4IRHA 2Z1DA 5CVJA 4Q4ZF 2PMUA 3MWMA 5IP6A 3I55I 5IT9Z 4AIJA 2F5EA 2EZIA 2D5VA 3F23A 4LFUA 2WY7Q 5LBQA 2LH9A 1O4XA 4P9UA 4M3FA 3QPLA 5E1XA 3TGNA 3ERMA 3L2CA 2DA5A 2V1NA 1DUXC 5CYVA 1A6QA 3NQOA 3G3ZA 1QZZA 4CH7A 4KNYA 2UXXA 1TQPA 4HNTA 2FBHA 2LSOA 1W36D 2XPWA 2XAQA 4HV6A 1G3TA 1P9QC 1FJLA 4Q5SF 3SJMA 1YW7A 2DFFA 2HR3A 2XAUA 4Y7NJ 2OZUA 5HVQC 5C4XJ 5HODA 3HKZN 2PG4A 3W2AA 2DOAA 4D7NA 1PUFB 2XF5A 5H20A 5D5UB 3DQVC 1QNTA 5JLXA 4JOMA 1RR7A 2LF7A 4O3MA 2XROA 1E2XA 5DM6F 1ZLJA 3KE2A 2ZXWH 1CF7A 1MJ9A 2EWNA 4A0YA 4D9JA 1X1CA 4N4OB 1REPC 3GCMA 2CH0A 3A02A 2R7OA 5M5WJ 2ZXIA 3OYNA 1A31A 2MFZA 3SFIA 2JA7J 2VXZA 1ORKA 3QOPA 3KP6A 4LK1F 4MIMA 4C3HJ 3BWGA 3C7JA 4CYCA 2DT6A 1J75A 3ZGKA 2TDXA 5KNLA 3WGIA 2OC6A 2L9SA 1JUPA 3C2GA 3MEXA 1ZYRF 1YQAA 1BJZA 2HTSA 2HNHA 1ETQA 2CQ7A 2VJIA 2XIGA 3WU1B 3K4LA 3A01B 5E8IA 1S7EA 3K70C 1BC8C 2M4GA 3G6EI 3QYBA 1LB2A 4YIRX 2K02A 1MMSA 3B73A 1DQUA 4C2UA 1YLFA 1I3AA 2IGOA 2L7KA 4M72A 1HW2A 1E17A 3BTLA 3J7ZI 3CJNA 1BIBA 3C2HA 1UB9A 4OMZA 1ITYA 3FXJA 3JSOA 2YX4A 3VSLA 3O6BB 4XLFA 3S3MA 3GO5A 5J47A 2EPFA 1S72I 5DCMB 5FFZA 3JRGA 3OYFA 2XVCA 2DYRH 3F21A 3HHGA 4IL6C 4XOTA 2KDZA 2VI6A 3DBHB 1DGRM 1MBJA 1XSXA 2AQFA 4JK1X 2KZVA 5JVTA 1HW1A 1O3QA 1SVMA 4G6TB 5EZGA 4B43A 3QOEA 4CHUA 1P92A 4A2UA 3RCOA 2K9QA 3IUOA 5GAEJ 4HX4A 1FP2A 1RI7A 4CICA 2FQ3A 4RM2A 2YX7A 1X4PA 2XHKA 4GXOA 1CGPA 1H88C 2OTJI 3OR1C 5AIPA
chains in the Genus database with same CATH topology
4O5VA 4Q47A 3VB2A 3EETA 1W7PB 1IN4A 2NYXA 4HDVA 3ZMVA 3TDZC 3T5XA 2A5YB 1OR7A 4G9YA 1Z6TA 1ZARA 3ISPA 3RDIA 3B02A 3KETA 4YFKF 1YIOA 2D2WA 3E97A 5FLXZ 4ZYEA 2IJLA 3M8FA 2VT3A 3KLOA 4MEYF 1JGSA 1R5GA 3H92A 3LWFA 1P4XA 3V8LA 1D5VA 5LGUA 3ECHA 3CO6C 3CUQC 4YG2F 5A2QZ 4PZJA 5CVIA 2F5FA 4BHPA 1R36A 2JPBA 1ZG5A 3FF5A 5L3BA 1C0WA 1BM9A 2O0YA 4OIPF 1SD4A 2COMA 2VC0A 2VODA 2O6GE 3GEZA 1QGPA 3RKYA 4E70A 4M6XA 4GYGA 5ILVA 2ZNZA 2Z3YA 3LQQA 4UVAA 1T38A 3HOTA 2JRTA 2O3FA 4MTDA 2L54A 2EJRA 2JSCA 1K78A 4OIOF 2QVOA 4WXDA 2CO5A 3EDPA 2LDUA 3O2PE 4UUVA 1XB4A 1XCVA 2CFXA 3HRTA 1Q1HA 1MGTA 4LG0A 2HTJA 4HOBA 4M6YA 1PUEE 3R0JA 1YYVA 4L5JA 4HF0A 1AOYA 3WE2A 1U5TB 2OA4A 1HBXG 1JHHA 2MD5A 3WGGA 2EFOA 4IJAA 1XGOA 4KUMA 3FX3A 4DNCA 3IRRA 5LLQA 1OKRA 2MC3A 4RB3C 3EQLF 3KFWX 3I54A 3HYIA 2HEOA 4JBAA 4OOIA 3WTTC 2P7CB 3FMQA 4HLXA 1HXDA 2PI0A 3HOSA 1RZ4A 1Z1DA 1T0FA 1MJAA 1G6NA 1FP1D 3K0LA 2V1UA 2ISYA 3HSEA 3L09A 4AIKA 5DD8A 2MH2A 3VFZA 4EQQA 1IXCA 3BY6A 2DO7A 2EK5A 4RS8A 4S05A 1R1VA 1G3YA 1MD0A 3RJPA 2OQRA 3GFMA 4IVNA 2EV6A 2HWVA 4L5IA 1SD5A 3GYHX 3CDHA 4K2EA 3WTVC 3SZPA 3IKVA 1RUOA 3N97A 4QWQA 3QAHA 2Z99A 3KP3A 1U3EM 3TO7A 2DW4A 3J7AO 3RYRA 1DP7P 1YG2A 3FXQA 3ZP5A 4IF4A 5IT3A 3LAJA 1FSHA 4U0YA 5FB2A 1A04A 1V3FA 4EJUA 2PN6A 2XAJA 1FLIA 2R3SA 4ESBA 3BPVA 4DQ2A 2VOPA 1WKMA 5BPIA 4MEXF 1IF1A 2XAHA 4EM2A 3J80K 1IXRC 2G7HA 2H6CA 4IHTA 1S29A 4WX9A 4HF1A 1FT9A 3E6DA 5LGTA 1WI9A 4G94A 2PMHA 1XCBA 1ODDA 4TV7A 3P7NA 3DXJF 1KU2A 2W84A 1R22A 4Y15A 3WE3A 2PEXA 4LLGF 3GW2A 3GVAA 2CSOA 5ICCA 2A61A 1I27A 1K6OA 2OBPA 3ZMSA 4EMSA 4KICA 4FHTA 3JAMK 1S6LA 2VE9A 3V7SA 4XSZF 3KP5A 1ZGJA 2IA0A 1JHFA 3JTHA 5DD4A 3KP7A 3ZMUA 4EVIA 2H09A 2YU3A 2HFHA 5D5WB 1RIOH 4LGWA 3ROUA 2HZTA 2Z5UA 4L9NA 2AXLA 3MZHA 3TO6A 2ISZA 3CUOA 2PBIA 1KYZA 3F8CA 3RIRA 2LKPA 1QBJA 2ZO4A 4RB0A 2E1NA 2H6BA 3C18A 5DDGA 5ICGA 3LA3A 5F6FA 3ZMDA 1ZRCA 4LD5A 2DFIA 1ON1A 2WV0A 3COAC 3I59A 5H6RA 2HOEA 4L0YB 1FBSA 3U9GA 3ZN0A 1ZGAA 3LQRA 1U5TC 1IN5A 2FMYA 1KU9A 1XN7A 3GLXA 4LJZF 4F7ZA 2FBIA 4YFNF 3ERED 1F9NA 1W4MA 2WTEA 4XLPF 3O3KA 1O3TA 5LRRA 1U6GA 2RV8A 1XDUA 1H0MA 4ENNA 2KRFA 3V4GA 4BQAA 3P9IA 1WWXA 5F64A 2G7UA 3RKXA 4CO8A 5HOOA 3CUQA 3WODF 2QQAA 3SZTA 3SXYA 5CVRA 1H9GA 2FMLA 1K7AA 3IRQA 3E6CC 1R1TA 2KKOA 4EGZA 1YS6A 2G9WA 1BBYA 2P6TA 3GFLA 3V8KA 2IP2A 3KP2A 4MGRA 1IZ1A 2IW5A 1UFMA 2P8TA 4MTEA 2VBZA 3DPLC 3FMRA 1BN5A 4BYYA 1JE8A 1S7AA 2L4MA 1FNNA 3T1BA 1ON2A 3K1PA 3ZPLA 2X4HA 2BV6A 1IN6A 2ESNA 4RGXA 1B59A 1LDJA 1USSA 2FOKA 1T39A 2OU2A 4OIQF 4LB5A 2FU4A 5L3CA 2ZMEB 4UHTA 3BPXA 5J8FA 2ETHA 2K7LA 1P6RA 4KN7X 2GZWA 1L0OC 4EJTA 1OMIA 5FD5A 5JR3A 2KIMA 2V6CA 4Q48A 5BQTA 2KIUA 5L3GA 2FNAA 1EH7A 3ECOA 4CDGA 1MJBA 2QQ9A 1MZBA 2XUBA 3AAFA 1BI0A 1Z7UA 2P7VB 4A0XA 1EH6A 1P2FA 3J80Z 4KT5C 2HQRA 4AWXB 4ZYDA 5K5RA 3PQJA 4CGZA 3HHHA 4AIHA 1HKQA 3GFJA 2D45A 2CWEA 4L18B 5BS6A 1MDMB 2ELHA 1J0RA 2HDCA 4KIBA 2A07F 3WGHA 1NHAA 1LEAA 3M1EA 2F5CA 4CZZA 2XKPA 5ICEA 1FOKA 2R7FA 1OYWA 1Z6RA 4UNOA 1W5SA 5ILUA 5HS8A 3NEUA 2K4BA 1K79A 3LSTA 2W24A 2KJBA 5CVVA 2Q0OA 1KU3A 1FY7A 3JAMZ 1ZN2A 2VC1A 5DYMA 3SFZA 3GZ5A 5DCMA 4MHGA 4KYWA 1I1SA 3VEPA 1SFXA 4XBFA 1H9TA 2UWMA 1X3UA 2WC2A 3I71A 3HRMA 4WXCA 2R7DA 2GQQA 6PAXA 3P9KA 2KJCA 2O61A 3TOAA 2XASA 3BZ6A 3IHUA 3K1MA 4HX7A 1AWCA 2QENA 1W7PA 3M9AA 3OOPA 5HS9A 2EFNA 4HQEA 2DQLA 3LA2A 1LQ1A 2MBFA 1U2WA 2J5PA 4Z2YA 2L3DA 1W5TA 5TRDA 3FHZA 2FSWA 3D5LA 1RUNA 4RAZA 1T6SA 5DCFA 2OAZA 5KVRA 5ED4A 3CO7C 5BOXA 5KK1A 3TO9A 2W57A 2DBBA 2FBKA 2BEOA 4WWCA 3KCCA 3W6KB 1TNSA 4BHBA 4UV9A 1U8RA 4ESFA 1HSTA 1FSEA 1KQ0A 1XSVA 2E7XA 3WTZA 4ENMA 3I64A 4XLNF 2P5LC 4I02A 3U1DA 1U78A 2Y0MA 5AIQA 2GAUA 3K9TA 2FA5A 2A69F 2QBYB 2XKOA 1I5ZA 4P55A 4ESJA 4ETSA 4CYDA 2FEZA 4BXUA 1TBXA 4IRGA 2NS0A 2ACJA 1DPUA 2PQ8A 3HRSA 4UVBA 3ZMTA 2GIVA 5TJJA 4WF2A 1RNLA 2RVCA 1B4AA 2P4WA 1FX7A 2IVMA 4G6DA 2MLGA 4GYIA 1XDSA 1O3SA 3EYIA 1U5TA 2HYGD 5D5VB 5HLIA 3EYYA 2K27A 4BHCA 2VT2A 3I0TA 3E6BA 4HX8A 3R6SA 5AONA 1I6XA 2IT0A 3FZVA 2EV0A 1LJ9A 2M30A 3BJ6A 4Y13A 5HDGA 2A6HF 2DQRA 5DUKA 1YTYA 1BI3A 3L9FA 3VODA 1J2XA 3GWZA 4LMYA 2RGVA 2V79A 3E5UA 2EA4A 2EA2A 3KP4A 5HS7A 2O03A 1FYLA 2D1HA 3QU3A 2HYFA 1P4AA 4RGUA 3WTYC 5E8GA 1LNWA 5K1YA 3DV8A 1R00A 2P5KA 3KEQA 3LFKA 1XD7A 4IRIA 2MLKA 4U7BA 2A3SA 4I01A 1GVJA 2FE3A 5L3DA 1YW8A 1HQCA 4A6DA 5H6QA 2M8EA 4NQWA 4NB5A 5ILSA 4I0BA 4P96A 4YFXF 3NRVA 4MNUA 3F3XA 4M9ZA 5LEKA 3ABTA 1LDDA 2V1XA 2E1CA 3F8FA 2ZXJA 3BJOA 1F4KA 4ZYHA 1IW7F 4FT8A 4GO1A 2FXAA 3DP7A 1HW5A 1JXSA 3E6MA 4AD9A 4G8XA 2GXGA 2K86A 3I58A 2QM3A 4N0BA 3TKYA 5D6EA 3JTGA 1R23A 1G3WA 3V7RA 1DPRA 2DPDA 4G6QA 1ZHFA 2NAZA 3K2ZA 1XGMA 1ZG1A 1IN8A 2QYOA 3GF2A 3KLNA 1ZREA 4HDUA 2QUFA 2Q8KA 3FM3A 1ZRDA 4R1HA 1B6AA 1DDNA 2HKXA 1PDNC 2L02A 3KZYA 2GA2A 1SMYF 2B0LA 2C6YA 1KQ8A 1FBQA 1KYWA 1MKMA 2JTVA 2IRFG 4M9XA 3WU0A 1J9IA 4HBLA 1D8KA 1ZRFA 1HKSA 3F6VA 2RC4A 4KDPA 3HUGA 4N9HA 1TQIA 3L00A 4Y17A 4RB1A 2NRAC 1SD6A 3JSPA 3CUQB 4I7HA 5HDKA 4U0VA 4H0EA 1BC7C 5HDNA 2GWRA 5HLGA 3DPTA 2ESHA 3BOQA 2JPCA 5DUIA 3F72A 2RQPA 4L9VA 4JQFA 1ULYA 2HS5A 3DFGA 2H94A 2CGPA 3F6OA 1R1UA 3F8BA 1T2KA 1UHMA 3E5XA 2RN7A 5DEQA 1IUYA 1O7LA 1CF7B 4ENJA 2M45A 1R7JA 5HLHA 4KIGA 2PFBA 3ZQ7A 1XGNA 3R0AA 2L4AA 4O6JA 3HSFA 2XRNA 3ZMZA 2DT5A 1XGSA 2FF4A 2BYVE 3KEOA 5D8KB 3FM5A 3R61A 5BPDA 1YW9A 3KZZA 1W7PD 4XSXF 4L9TA 4BNCA 1LDKB 2VE8A 1YS7A 3MQ0A 2YR2A 2V1DA 2ZFWA 3ULQB 2K4JA 3H3UA 2W25A 1FZPB 1GHCA 2W85A 3I53A 2DK8A 2Z9OA 3BP8A 1TQMA 4OIRF 3HSRA 4G7HF 1QQIA 2OQGA 1D8JA 3R4KA 3OV8A 1T98A 3DF8A 1BI1A 3V8JA 3BROA 3CLOA 3SHFA 5EEGA 4LLLA 1FBUA 3J81K 3QU6A 2H27A 4HZFA 3HTSB 1HKTA 1WSUA 4LK0F 2BE5F 2RDPA 1KA8A 4G7ZF 3PQKA 3F8NA 1Z9CA 5L3EA 3V7CA 2STWA 1Z91A 2XAGA 2ZMEA 1PP8F 3RKWA 2ZBKA 2XV4S 5LHHA 2PLYA 3K69A 3T0YA 2Z33A 3C1DA 3L7WA 3QP5A 2QWWA 3RTRA 4N9IA 1D3YA 1XSDA 4HYEA 2ZCWA 4CXFA 2M1BA 5CLSA 3RYPA 2GA1A 1VTNC 2ZJ2A 2F5DA 2OZ6A 1FPQA 4ON0A 2CYYA 1WQ2A 3C3WA 2QZ8A 1F1ZA 3GUDA 5JFRA 1USTA 1K78B 1TW3A 1BI2A 4EJOA 1QPMA 2DU9A 5D4SA 4ZZLA 4L0ZB 2OD5A 1J5YA 4I2OA 2EFQA 4LG0B 3P9CA 2BGCA 1MDMA 3F22A 4P5OA 2D1VA 4U0WA 4UVCA 2P6SA 4FX0A 2ZKZA 4EJWA 1BIAA 3FXRA 2M87A 4U88A 1B9NA 3F8MA 1I1GA 2M5WA 3QPHA 5CVUA 1F5TA 4I98B 2UZKA 1B1BA 1TNTA 1LEBA 2HKOA 1ONVA 4KFCA 4HQMA 2XAFA 4GCVA 4OU0A 5LRSA 1KGSA 3Q5FA 1STZA 4EGYA 3WTWC 2A68F 4XRFA 2XGXA 4M9SA 4RGRA 2DI3A 5LHIA 2LNBA 4ZZDA 3WTUC 1UCRA 5D4RA 5E1WA 5JI6A 2QQBA 4LLNA 5E1ZB 3I4PA 3TDUC 2CG4A 2L01A 2J5OA 3IWFA 5E20A 3W6JB 3MFKA 4IPAA 2IA1A 3GZ6A 1EH8A 3MCZA 4PCQA 3VOEA 3SQNA 2ADUA 4ASNA 2FNPA 4A6EA 3ZN1A 2Y48A 4KN4X 5JHUA 3GFIA 4D0PA 4EM1A 2BBYA 1SFUA 5FD6A 3TQNA 4ZYGA 4RGSA 4ENKA 1SMTA 3WTSC 4A0ZA 2VOOA 2LF8A 1QZYA 1FWZA 2HGCA 2YSRA 5IT9K 1J7KA 2EB7A 2NNYA 5F1RA 3ABUA 2VBXA 3M8EA 3PFIA 2F2EA 4IXAA 3FXUA 3IL2A 1J59A 3HIFA 1SD7A 3T8RA 3FWEA 2E7WA 1IXSB 4KMUX 1QO0D 1IRGA 2YPRA 4RB2C 3RI4A 5LEJA 1IAWA 2DTRA 4FX4A 5LHGA 4A5MA 4L9JA 4IHSA 4I09A 4YIIA 3BDDA 1XMAA 1B9MA 4KIFA 3GXOA 1BJAA 3ML6A 2EFWA 4WK8F 3N4MA 3E3VA 1S8NA 4OMYA 1ZAOA 2QBYA 3IKTA 4R79A 2IA2A 3QPTA 2MH9A 1YFHA 4HW0A 2WWYA 2JT1A 2DPUA 2CQKA 5LGNA 3J81Z 3R60A 4HA8A 3H3ZA 2GXBA 1O3RA 2VONA 1WRJA 4HF2A 4QLCU 2RKHA 2ZNYA 2KIFA 1TTYA 1SAXA 5FFXA 4RAYA 3WG9A 1UHWA 2P5VA 3G73A 3HRUA 3MAJA 5D6FA 1PP7U 1R58A 4PDKA 5FO5A 2A6EF 4PGHA 4B8XA 3BJAA 1G4DA 4UXNA 3DKWA 4KA4A 2DK5A 2EV5A 4M71A 5E18F 4OINF 5BMZA 4AVPA 1FC3A 1Z05A 1YO5C 3S2WA 4A5NA 3TOBA 4EM0B 2MA3A 1BOAA 2IPQX 2HQNA 1OYIA 2DLLA 4HLYA 5L3FA 2VBYA 4M74A 1P4WA 3HTUA 3WTXC 2V9VA 1S7OA 4WCGA 4UV8A 1TLHB 3I59B 3RPQA 3LA7A 2QLZA 5J8CA 3JW4A 1V4RA 1KQ9A 5FLXK 1ZG3A 3RPUA 2NNNA 1OPCA 2DAOA 3MZYA 4MQ9F 2RNJA 3QRFF 4NHJA 4MQVA 4WXHA 4EV0A 3LAPA 3M7GA 3Q9SA 5K5OA 4PGGA 5DV5A 2CW0F 5FGMA 1OYYA 1S3JA 5A2QK 3FMSA 5D5XB 1O7FA 1XMKA 1LVAA 3Q9VA 2FRHA 1GXQA 2O8XA 4U7DA 2UXNA 5EEHA 1ZH5A 5J6XA 2JZYA 5D8LB 5ICFA 3ELKA 3IWZA 5E17F 3QP6A 1TW2A 2PJPA 3I5UA 3REOA 1IRFA 3DEUA 1GXPA 4G7OF 4B09A 5CJ9A 1R5HA 5ERIA 1FYKA 2STTA 1EV7A 3EUHA 1ZLKA 1HSJA 2Q2EA 4I0AA 1O57A 4R8HA 5K5QA 4S04A 3IC7A 1G3SA 4HAMA 3D0SA 3U2RA 4KMFA 4ZH4F 2Y75A 4A12A 4BAYA 4BH9A 1IN7A 1KU7A 1FYMA 4M73A 4LB6B 1Y0UA 3T8TA 3GX4X 4HV5A 2X0LA 2VBWA 4GGGA 4EJVA 1SFEA 3K1NA 2EFPA 1L3LA 4YIFA 2VN2A 4P9FA 3CTAA 2AS5F 3E5QA 4IRHA 5CVJA 4Q4ZF 2PMUA 3MWMA 5IT9Z 4AIJA 2F5EA 3F23A 4LFUA 5LBQA 4P9UA 5E1XA 3TGNA 3L2CA 1DUXC 5CYVA 3NQOA 3G3ZA 1QZZA 4KNYA 2UXXA 1TQPA 2FBHA 2LSOA 2XAQA 4HV6A 1G3TA 4Q5SF 1YW7A 2HR3A 2OZUA 5HVQC 2PG4A 5H20A 5D5UB 3DQVC 1QNTA 2LF7A 4O3MA 2XROA 1E2XA 1ZLJA 3KE2A 1CF7A 1MJ9A 2EWNA 4A0YA 1REPC 2VXZA 3QOPA 4LK1F 3KP6A 3BWGA 3C7JA 1J75A 2TDXA 3WGIA 3MEXA 1ZYRF 1YQAA 2HTSA 2XIGA 3WU1B 5E8IA 1BC8C 1LB2A 2K02A 3B73A 1YLFA 4M72A 1HW2A 1E17A 3CJNA 1BIBA 1UB9A 4OMZA 3JSOA 2YX4A 3O6BB 3GO5A 5DCMB 5FFZA 2XVCA 3F21A 3HHGA 1XSXA 4JK1X 5JVTA 1HW1A 1O3QA 4CHUA 1P92A 4A2UA 4HX4A 1FP2A 1RI7A 4CICA 2FQ3A 2YX7A 2XHKA 4GXOA 1CGPA 5AIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5V A;  4Q47 A;  3VB2 A;  3EET A;  1W7P B;  1IN4 A;  2NYX A;  4HDV A;  3ZMV A;  3TDZ C;  3T5X A;  2A5Y B;  1OR7 A;  4G9Y A;  1Z6T A;  1ZAR A;  3ISP A;  3RDI A;  3B02 A;  3KET A;  4YFK F;  1YIO A;  2D2W A;  3E97 A;  5FLX Z;  4ZYE A;  2IJL A;  3M8F A;  2VT3 A;  3KLO A;  4MEY F;  1JGS A;  1R5G A;  3H92 A;  3LWF A;  1P4X A;  3V8L A;  1D5V A;  5LGU A;  3ECH A;  3CO6 C;  3CUQ C;  4YG2 F;  5A2Q Z;  4PZJ A;  5CVI A;  2F5F A;  4BHP A;  1R36 A;  2JPB A;  1ZG5 A;  3FF5 A;  5L3B A;  1C0W A;  1BM9 A;  2O0Y A;  4OIP F;  1SD4 A;  2COM A;  2VC0 A;  2VOD A;  2O6G E;  3GEZ A;  1QGP A;  3RKY A;  4E70 A;  4M6X A;  4GYG A;  5ILV A;  2ZNZ A;  2Z3Y A;  3LQQ A;  4UVA A;  1T38 A;  3HOT A;  2JRT A;  2O3F A;  4MTD A;  2L54 A;  2EJR A;  2JSC A;  1K78 A;  4OIO F;  2QVO A;  4WXD A;  2CO5 A;  3EDP A;  2LDU A;  3O2P E;  4UUV A;  1XB4 A;  1XCV A;  2CFX A;  3HRT A;  1Q1H A;  1MGT A;  4LG0 A;  2HTJ A;  4HOB A;  4M6Y A;  1PUE E;  3R0J A;  1YYV A;  4L5J A;  4HF0 A;  1AOY A;  3WE2 A;  1U5T B;  2OA4 A;  1HBX G;  1JHH A;  2MD5 A;  3WGG A;  2EFO A;  4IJA A;  1XGO A;  4KUM A;  3FX3 A;  4DNC A;  3IRR A;  5LLQ A;  1OKR A;  2MC3 A;  4RB3 C;  3EQL F;  3KFW X;  3I54 A;  3HYI A;  2HEO A;  4JBA A;  4OOI A;  3WTT C;  2P7C B;  3FMQ A;  4HLX A;  1HXD A;  2PI0 A;  3HOS A;  1RZ4 A;  1Z1D A;  1T0F A;  1MJA A;  1G6N A;  1FP1 D;  3K0L A;  2V1U A;  2ISY A;  3HSE A;  3L09 A;  4AIK A;  5DD8 A;  2MH2 A;  3VFZ A;  4EQQ A;  1IXC A;  3BY6 A;  2DO7 A;  2EK5 A;  4RS8 A;  4S05 A;  1R1V A;  1G3Y A;  1MD0 A;  3RJP A;  2OQR A;  3GFM A;  4IVN A;  2EV6 A;  2HWV A;  4L5I A;  1SD5 A;  3GYH X;  3CDH A;  4K2E A;  3WTV C;  3SZP A;  3IKV A;  1RUO A;  3N97 A;  4QWQ A;  3QAH A;  2Z99 A;  3KP3 A;  1U3E M;  3TO7 A;  2DW4 A;  3J7A O;  3RYR A;  1DP7 P;  1YG2 A;  3FXQ A;  3ZP5 A;  4IF4 A;  5IT3 A;  3LAJ A;  1FSH A;  4U0Y A;  5FB2 A;  1A04 A;  1V3F A;  4EJU A;  2PN6 A;  2XAJ A;  1FLI A;  2R3S A;  4ESB A;  3BPV A;  4DQ2 A;  2VOP A;  1WKM A;  5BPI A;  4MEX F;  1IF1 A;  2XAH A;  4EM2 A;  3J80 K;  1IXR C;  2G7H A;  2H6C A;  4IHT A;  1S29 A;  4WX9 A;  4HF1 A;  1FT9 A;  3E6D A;  5LGT A;  1WI9 A;  4G94 A;  2PMH A;  1XCB A;  1ODD A;  4TV7 A;  3P7N A;  3DXJ F;  1KU2 A;  2W84 A;  1R22 A;  4Y15 A;  3WE3 A;  2PEX A;  4LLG F;  3GW2 A;  3GVA A;  2CSO A;  5ICC A;  2A61 A;  1I27 A;  1K6O A;  2OBP A;  3ZMS A;  4EMS A;  4KIC A;  4FHT A;  3JAM K;  1S6L A;  2VE9 A;  3V7S A;  4XSZ F;  3KP5 A;  1ZGJ A;  2IA0 A;  1JHF A;  3JTH A;  5DD4 A;  3KP7 A;  3ZMU A;  4EVI A;  2H09 A;  2YU3 A;  2HFH A;  5D5W B;  1RIO H;  4LGW A;  3ROU A;  2HZT A;  2Z5U A;  4L9N A;  2AXL A;  3MZH A;  3TO6 A;  2ISZ A;  3CUO A;  2PBI A;  1KYZ A;  3F8C A;  3RIR A;  2LKP A;  1QBJ A;  2ZO4 A;  4RB0 A;  2E1N A;  2H6B A;  3C18 A;  5DDG A;  5ICG A;  3LA3 A;  5F6F A;  3ZMD A;  1ZRC A;  4LD5 A;  2DFI A;  1ON1 A;  2WV0 A;  3COA C;  3I59 A;  5H6R A;  2HOE A;  4L0Y B;  1FBS A;  3U9G A;  3ZN0 A;  1ZGA A;  3LQR A;  1U5T C;  1IN5 A;  2FMY A;  1KU9 A;  1XN7 A;  3GLX A;  4LJZ F;  4F7Z A;  2FBI A;  4YFN F;  3ERE D;  1F9N A;  1W4M A;  2WTE A;  4XLP F;  3O3K A;  1O3T A;  5LRR A;  1U6G A;  2RV8 A;  1XDU A;  1H0M A;  4ENN A;  2KRF A;  3V4G A;  4BQA A;  3P9I A;  1WWX A;  5F64 A;  2G7U A;  3RKX A;  4CO8 A;  5HOO A;  3CUQ A;  3WOD F;  2QQA A;  3SZT A;  3SXY A;  5CVR A;  1H9G A;  2FML A;  1K7A A;  3IRQ A;  3E6C C;  1R1T A;  2KKO A;  4EGZ A;  1YS6 A;  2G9W A;  1BBY A;  2P6T A;  3GFL A;  3V8K A;  2IP2 A;  3KP2 A;  4MGR A;  1IZ1 A;  2IW5 A;  1UFM A;  2P8T A;  4MTE A;  2VBZ A;  3DPL C;  3FMR A;  1BN5 A;  4BYY A;  1JE8 A;  1S7A A;  2L4M A;  1FNN A;  3T1B A;  1ON2 A;  3K1P A;  3ZPL A;  2X4H A;  2BV6 A;  1IN6 A;  2ESN A;  4RGX A;  1B59 A;  1LDJ A;  1USS A;  2FOK A;  1T39 A;  2OU2 A;  4OIQ F;  4LB5 A;  2FU4 A;  5L3C A;  2ZME B;  4UHT A;  3BPX A;  5J8F A;  2ETH A;  2K7L A;  1P6R A;  4KN7 X;  2GZW A;  1L0O C;  4EJT A;  1OMI A;  5FD5 A;  5JR3 A;  2KIM A;  2V6C A;  4Q48 A;  5BQT A;  2KIU A;  5L3G A;  2FNA A;  1EH7 A;  3ECO A;  4CDG A;  1MJB A;  2QQ9 A;  1MZB A;  2XUB A;  3AAF A;  1BI0 A;  1Z7U A;  2P7V B;  4A0X A;  1EH6 A;  1P2F A;  3J80 Z;  4KT5 C;  2HQR A;  4AWX B;  4ZYD A;  5K5R A;  3PQJ A;  4CGZ A;  3HHH A;  4AIH A;  1HKQ A;  3GFJ A;  2D45 A;  2CWE A;  4L18 B;  5BS6 A;  1MDM B;  2ELH A;  1J0R A;  2HDC A;  4KIB A;  2A07 F;  3WGH A;  1NHA A;  1LEA A;  3M1E A;  2F5C A;  4CZZ A;  2XKP A;  5ICE A;  1FOK A;  2R7F A;  1OYW A;  1Z6R A;  4UNO A;  1W5S A;  5ILU A;  5HS8 A;  3NEU A;  2K4B A;  1K79 A;  3LST A;  2W24 A;  2KJB A;  5CVV A;  2Q0O A;  1KU3 A;  1FY7 A;  3JAM Z;  1ZN2 A;  2VC1 A;  5DYM A;  3SFZ A;  3GZ5 A;  5DCM A;  4MHG A;  4KYW A;  1I1S A;  3VEP A;  1SFX A;  4XBF A;  1H9T A;  2UWM A;  1X3U A;  2WC2 A;  3I71 A;  3HRM A;  4WXC A;  2R7D A;  2GQQ A;  6PAX A;  3P9K A;  2KJC A;  2O61 A;  3TOA A;  2XAS A;  3BZ6 A;  3IHU A;  3K1M A;  4HX7 A;  1AWC A;  2QEN A;  1W7P A;  3M9A A;  3OOP A;  5HS9 A;  2EFN A;  4HQE A;  2DQL A;  3LA2 A;  1LQ1 A;  2MBF A;  1U2W A;  2J5P A;  4Z2Y A;  2L3D A;  1W5T A;  5TRD A;  3FHZ A;  2FSW A;  3D5L A;  1RUN A;  4RAZ A;  1T6S A;  5DCF A;  2OAZ A;  5KVR A;  5ED4 A;  3CO7 C;  5BOX A;  5KK1 A;  3TO9 A;  2W57 A;  2DBB A;  2FBK A;  2BEO A;  4WWC A;  3KCC A;  3W6K B;  1TNS A;  4BHB A;  4UV9 A;  1U8R A;  4ESF A;  1HST A;  1FSE A;  1KQ0 A;  1XSV A;  2E7X A;  3WTZ A;  4ENM A;  3I64 A;  4XLN F;  2P5L C;  4I02 A;  3U1D A;  1U78 A;  2Y0M A;  5AIQ A;  2GAU A;  3K9T A;  2FA5 A;  2A69 F;  2QBY B;  2XKO A;  1I5Z A;  4P55 A;  4ESJ A;  4ETS A;  4CYD A;  2FEZ A;  4BXU A;  1TBX A;  4IRG A;  2NS0 A;  2ACJ A;  1DPU A;  2PQ8 A;  3HRS A;  4UVB A;  3ZMT A;  2GIV A;  5TJJ A;  4WF2 A;  1RNL A;  2RVC A;  1B4A A;  2P4W A;  1FX7 A;  2IVM A;  4G6D A;  2MLG A;  4GYI A;  1XDS A;  1O3S A;  3EYI A;  1U5T A;  2HYG D;  5D5V B;  5HLI A;  3EYY A;  2K27 A;  4BHC A;  2VT2 A;  3I0T A;  3E6B A;  4HX8 A;  3R6S A;  5AON A;  1I6X A;  2IT0 A;  3FZV A;  2EV0 A;  1LJ9 A;  2M30 A;  3BJ6 A;  4Y13 A;  5HDG A;  2A6H F;  2DQR A;  5DUK A;  1YTY A;  1BI3 A;  3L9F A;  3VOD A;  1J2X A;  3GWZ A;  4LMY A;  2RGV A;  2V79 A;  3E5U A;  2EA4 A;  2EA2 A;  3KP4 A;  5HS7 A;  2O03 A;  1FYL A;  2D1H A;  3QU3 A;  2HYF A;  1P4A A;  4RGU A;  3WTY C;  5E8G A;  1LNW A;  5K1Y A;  3DV8 A;  1R00 A;  2P5K A;  3KEQ A;  3LFK A;  1XD7 A;  4IRI A;  2MLK A;  4U7B A;  2A3S A;  4I01 A;  1GVJ A;  2FE3 A;  5L3D A;  1YW8 A;  1HQC A;  4A6D A;  5H6Q A;  2M8E A;  4NQW A;  4NB5 A;  5ILS A;  4I0B A;  4P96 A;  4YFX F;  3NRV A;  4MNU A;  3F3X A;  4M9Z A;  5LEK A;  3ABT A;  1LDD A;  2V1X A;  2E1C A;  3F8F A;  2ZXJ A;  3BJO A;  1F4K A;  4ZYH A;  1IW7 F;  4FT8 A;  4GO1 A;  2FXA A;  3DP7 A;  1HW5 A;  1JXS A;  3E6M A;  4AD9 A;  4G8X A;  2GXG A;  2K86 A;  3I58 A;  2QM3 A;  4N0B A;  3TKY A;  5D6E A;  3JTG A;  1R23 A;  1G3W A;  3V7R A;  1DPR A;  2DPD A;  4G6Q A;  1ZHF A;  2NAZ A;  3K2Z A;  1XGM A;  1ZG1 A;  1IN8 A;  2QYO A;  3GF2 A;  3KLN A;  1ZRE A;  4HDU A;  2QUF A;  2Q8K A;  3FM3 A;  1ZRD A;  4R1H A;  1B6A A;  1DDN A;  2HKX A;  1PDN C;  2L02 A;  3KZY A;  2GA2 A;  1SMY F;  2B0L A;  2C6Y A;  1KQ8 A;  1FBQ A;  1KYW A;  1MKM A;  2JTV A;  2IRF G;  4M9X A;  3WU0 A;  1J9I A;  4HBL A;  1D8K A;  1ZRF A;  1HKS A;  3F6V A;  2RC4 A;  4KDP A;  3HUG A;  4N9H A;  1TQI A;  3L00 A;  4Y17 A;  4RB1 A;  2NRA C;  1SD6 A;  3JSP A;  3CUQ B;  4I7H A;  5HDK A;  4U0V A;  4H0E A;  1BC7 C;  5HDN A;  2GWR A;  5HLG A;  3DPT A;  2ESH A;  3BOQ A;  2JPC A;  5DUI A;  3F72 A;  2RQP A;  4L9V A;  4JQF A;  1ULY A;  2HS5 A;  3DFG A;  2H94 A;  2CGP A;  3F6O A;  1R1U A;  3F8B A;  1T2K A;  1UHM A;  3E5X A;  2RN7 A;  5DEQ A;  1IUY A;  1O7L A;  1CF7 B;  4ENJ A;  2M45 A;  1R7J A;  5HLH A;  4KIG A;  2PFB A;  3ZQ7 A;  1XGN A;  3R0A A;  2L4A A;  4O6J A;  3HSF A;  2XRN A;  3ZMZ A;  2DT5 A;  1XGS A;  2FF4 A;  2BYV E;  3KEO A;  5D8K B;  3FM5 A;  3R61 A;  5BPD A;  1YW9 A;  3KZZ A;  1W7P D;  4XSX F;  4L9T A;  4BNC A;  1LDK B;  2VE8 A;  1YS7 A;  3MQ0 A;  2YR2 A;  2V1D A;  2ZFW A;  3ULQ B;  2K4J A;  3H3U A;  2W25 A;  1FZP B;  1GHC A;  2W85 A;  3I53 A;  2DK8 A;  2Z9O A;  3BP8 A;  1TQM A;  4OIR F;  3HSR A;  4G7H F;  1QQI A;  2OQG A;  1D8J A;  3R4K A;  3OV8 A;  1T98 A;  3DF8 A;  1BI1 A;  3V8J A;  3BRO A;  3CLO A;  3SHF A;  5EEG A;  4LLL A;  1FBU A;  3J81 K;  3QU6 A;  2H27 A;  4HZF A;  3HTS B;  1HKT A;  1WSU A;  4LK0 F;  2BE5 F;  2RDP A;  1KA8 A;  4G7Z F;  3PQK A;  3F8N A;  1Z9C A;  5L3E A;  3V7C A;  2STW A;  1Z91 A;  2XAG A;  2ZME A;  1PP8 F;  3RKW A;  2ZBK A;  2XV4 S;  5LHH A;  2PLY A;  3K69 A;  3T0Y A;  2Z33 A;  3C1D A;  3L7W A;  3QP5 A;  2QWW A;  3RTR A;  4N9I A;  1D3Y A;  1XSD A;  4HYE A;  2ZCW A;  4CXF A;  2M1B A;  5CLS A;  3RYP A;  2GA1 A;  1VTN C;  2ZJ2 A;  2F5D A;  2OZ6 A;  1FPQ A;  4ON0 A;  2CYY A;  1WQ2 A;  3C3W A;  2QZ8 A;  1F1Z A;  3GUD A;  5JFR A;  1UST A;  1K78 B;  1TW3 A;  1BI2 A;  4EJO A;  1QPM A;  2DU9 A;  5D4S A;  4ZZL A;  4L0Z B;  2OD5 A;  1J5Y A;  4I2O A;  2EFQ A;  4LG0 B;  3P9C A;  2BGC A;  1MDM A;  3F22 A;  4P5O A;  2D1V A;  4U0W A;  4UVC A;  2P6S A;  4FX0 A;  2ZKZ A;  4EJW A;  1BIA A;  3FXR A;  2M87 A;  4U88 A;  1B9N A;  3F8M A;  1I1G A;  2M5W A;  3QPH A;  5CVU A;  1F5T A;  4I98 B;  2UZK A;  1B1B A;  1TNT A;  1LEB A;  2HKO A;  1ONV A;  4KFC A;  4HQM A;  2XAF A;  4GCV A;  4OU0 A;  5LRS A;  1KGS A;  3Q5F A;  1STZ A;  4EGY A;  3WTW C;  2A68 F;  4XRF A;  2XGX A;  4M9S A;  4RGR A;  2DI3 A;  5LHI A;  2LNB A;  4ZZD A;  3WTU C;  1UCR A;  5D4R A;  5E1W A;  5JI6 A;  2QQB A;  4LLN A;  5E1Z B;  3I4P A;  3TDU C;  2CG4 A;  2L01 A;  2J5O A;  3IWF A;  5E20 A;  3W6J B;  3MFK A;  4IPA A;  2IA1 A;  3GZ6 A;  1EH8 A;  3MCZ A;  4PCQ A;  3VOE A;  3SQN A;  2ADU A;  4ASN A;  2FNP A;  4A6E A;  3ZN1 A;  2Y48 A;  4KN4 X;  5JHU A;  3GFI A;  4D0P A;  4EM1 A;  2BBY A;  1SFU A;  5FD6 A;  3TQN A;  4ZYG A;  4RGS A;  4ENK A;  1SMT A;  3WTS C;  4A0Z A;  2VOO A;  2LF8 A;  1QZY A;  1FWZ A;  2HGC A;  2YSR A;  5IT9 K;  1J7K A;  2EB7 A;  2NNY A;  5F1R A;  3ABU A;  2VBX A;  3M8E A;  3PFI A;  2F2E A;  4IXA A;  3FXU A;  3IL2 A;  1J59 A;  3HIF A;  1SD7 A;  3T8R A;  3FWE A;  2E7W A;  1IXS B;  4KMU X;  1QO0 D;  1IRG A;  2YPR A;  4RB2 C;  3RI4 A;  5LEJ A;  1IAW A;  2DTR A;  4FX4 A;  5LHG A;  4A5M A;  4L9J A;  4IHS A;  4I09 A;  4YII A;  3BDD A;  1XMA A;  1B9M A;  4KIF A;  3GXO A;  1BJA A;  3ML6 A;  2EFW A;  4WK8 F;  3N4M A;  3E3V A;  1S8N A;  4OMY A;  1ZAO A;  2QBY A;  3IKT A;  4R79 A;  2IA2 A;  3QPT A;  2MH9 A;  1YFH A;  4HW0 A;  2WWY A;  2JT1 A;  2DPU A;  2CQK A;  5LGN A;  3J81 Z;  3R60 A;  4HA8 A;  3H3Z A;  2GXB A;  1O3R A;  2VON A;  1WRJ A;  4HF2 A;  4QLC U;  2RKH A;  2ZNY A;  2KIF A;  1TTY A;  1SAX A;  5FFX A;  4RAY A;  3WG9 A;  1UHW A;  2P5V A;  3G73 A;  3HRU A;  3MAJ A;  5D6F A;  1PP7 U;  1R58 A;  4PDK A;  5FO5 A;  2A6E F;  4PGH A;  4B8X A;  3BJA A;  1G4D A;  4UXN A;  3DKW A;  4KA4 A;  2DK5 A;  2EV5 A;  4M71 A;  5E18 F;  4OIN F;  5BMZ A;  4AVP A;  1FC3 A;  1Z05 A;  1YO5 C;  3S2W A;  4A5N A;  3TOB A;  4EM0 B;  2MA3 A;  1BOA A;  2IPQ X;  2HQN A;  1OYI A;  2DLL A;  4HLY A;  5L3F A;  2VBY A;  4M74 A;  1P4W A;  3HTU A;  3WTX C;  2V9V A;  1S7O A;  4WCG A;  4UV8 A;  1TLH B;  3I59 B;  3RPQ A;  3LA7 A;  2QLZ A;  5J8C A;  3JW4 A;  1V4R A;  1KQ9 A;  5FLX K;  1ZG3 A;  3RPU A;  2NNN A;  1OPC A;  2DAO A;  3MZY A;  4MQ9 F;  2RNJ A;  3QRF F;  4NHJ A;  4MQV A;  4WXH A;  4EV0 A;  3LAP A;  3M7G A;  3Q9S A;  5K5O A;  4PGG A;  5DV5 A;  2CW0 F;  5FGM A;  1OYY A;  1S3J A;  5A2Q K;  3FMS A;  5D5X B;  1O7F A;  1XMK A;  1LVA A;  3Q9V A;  2FRH A;  1GXQ A;  2O8X A;  4U7D A;  2UXN A;  5EEH A;  1ZH5 A;  5J6X A;  2JZY A;  5D8L B;  5ICF A;  3ELK A;  3IWZ A;  5E17 F;  3QP6 A;  1TW2 A;  2PJP A;  3I5U A;  3REO A;  1IRF A;  3DEU A;  1GXP A;  4G7O F;  4B09 A;  5CJ9 A;  1R5H A;  5ERI A;  1FYK A;  2STT A;  1EV7 A;  3EUH A;  1ZLK A;  1HSJ A;  2Q2E A;  4I0A A;  1O57 A;  4R8H A;  5K5Q A;  4S04 A;  3IC7 A;  1G3S A;  4HAM A;  3D0S A;  3U2R A;  4KMF A;  4ZH4 F;  2Y75 A;  4A12 A;  4BAY A;  4BH9 A;  1IN7 A;  1KU7 A;  1FYM A;  4M73 A;  4LB6 B;  1Y0U A;  3T8T A;  3GX4 X;  4HV5 A;  2X0L A;  2VBW A;  4GGG A;  4EJV A;  1SFE A;  3K1N A;  2EFP A;  1L3L A;  4YIF A;  2VN2 A;  4P9F A;  3CTA A;  2AS5 F;  3E5Q A;  4IRH A;  5CVJ A;  4Q4Z F;  2PMU A;  3MWM A;  5IT9 Z;  4AIJ A;  2F5E A;  3F23 A;  4LFU A;  5LBQ A;  4P9U A;  5E1X A;  3TGN A;  3L2C A;  1DUX C;  5CYV A;  3NQO A;  3G3Z A;  1QZZ A;  4KNY A;  2UXX A;  1TQP A;  2FBH A;  2LSO A;  2XAQ A;  4HV6 A;  1G3T A;  4Q5S F;  1YW7 A;  2HR3 A;  2OZU A;  5HVQ C;  2PG4 A;  5H20 A;  5D5U B;  3DQV C;  1QNT A;  2LF7 A;  4O3M A;  2XRO A;  1E2X A;  1ZLJ A;  3KE2 A;  1CF7 A;  1MJ9 A;  2EWN A;  4A0Y A;  1REP C;  2VXZ A;  3QOP A;  4LK1 F;  3KP6 A;  3BWG A;  3C7J A;  1J75 A;  2TDX A;  3WGI A;  3MEX A;  1ZYR F;  1YQA A;  2HTS A;  2XIG A;  3WU1 B;  5E8I A;  1BC8 C;  1LB2 A;  2K02 A;  3B73 A;  1YLF A;  4M72 A;  1HW2 A;  1E17 A;  3CJN A;  1BIB A;  1UB9 A;  4OMZ A;  3JSO A;  2YX4 A;  3O6B B;  3GO5 A;  5DCM B;  5FFZ A;  2XVC A;  3F21 A;  3HHG A;  1XSX A;  4JK1 X;  5JVT A;  1HW1 A;  1O3Q A;  4CHU A;  1P92 A;  4A2U A;  4HX4 A;  1FP2 A;  1RI7 A;  4CIC A;  2FQ3 A;  2YX7 A;  2XHK A;  4GXO A;  1CGP A;  5AIP A; 
#chains in the Genus database with same CATH topology
 4O5V A;  4Q47 A;  3VB2 A;  1ZKG A;  3AG3 H;  3EET A;  4A3B J;  4B44 A;  2DTZ A;  1W7P B;  1IN4 A;  2NYX A;  2R4G A;  3BR3 A;  1JTX A;  1Z0X A;  3HC7 A;  4HDV A;  1OCC H;  3OOU A;  3TDZ C;  3ZMV A;  3T5X A;  3VSK A;  1X3W B;  1FIA A;  3A1Y A;  2A5Y B;  1EKE A;  2NOJ B;  1OR7 A;  1EA3 A;  1U0J A;  2Y0S N;  1G8X A;  4G9Y A;  1Z6T A;  1ZAR A;  3ISP A;  3RDI A;  3EUH C;  5DS9 A;  2XRL A;  2EIJ H;  3B02 A;  3KET A;  1I50 J;  2NVY J;  4YFK F;  1YIO A;  4JP0 A;  3FXO A;  4XKW A;  2D2W A;  2XPU A;  2P7C B;  3E97 A;  2W82 A;  1I6H J;  5FLX Z;  5JLW A;  4ZYE A;  2DOE A;  1I39 A;  2IJL A;  5F0F A;  3PJR A;  3M8F A;  1A5J A;  3OL3 A;  2VT3 A;  3KLO A;  3OSG A;  2CV1 A;  1AU7 A;  4MEY F;  1JGS A;  1R5G A;  1DP3 A;  4RDU A;  2LBF A;  3H92 A;  2IS4 A;  3LWF A;  1P4X A;  3V8L A;  3FBN B;  1D5V A;  3FDY A;  1TZL A;  2L9R A;  1JKP C;  5LGU A;  2VQH A;  3ECH A;  1VQ6 I;  3CO6 C;  5HNF A;  1MH4 A;  3CUQ C;  4YG2 F;  5A2Q Z;  3DCF A;  4IHY A;  2BZT A;  4PZJ A;  5CVI A;  2F5F A;  1EJ9 A;  4BHP A;  1R36 A;  2JPB A;  4JX5 A;  1ZG5 A;  3FF5 A;  4F3Q A;  3OYL A;  5L3B A;  1C0W A;  2R93 J;  1BM9 A;  3KZI C;  2O0Y A;  4OIP F;  1SD4 A;  2COM A;  2VC0 A;  5TIS C;  2VOD A;  2ID3 A;  2O6G E;  5FRO A;  3GEZ A;  1OCO H;  2KL4 A;  3TBI A;  1QGP A;  2B9S A;  3RKY A;  2AQE A;  2IGK A;  4E70 A;  2HOS A;  4M6X A;  4GYG A;  5GTH C;  5ILV A;  4UUT A;  2ZNZ A;  3JRB A;  3OY9 A;  2Z3Y A;  3PNT A;  3LQQ A;  4UVA A;  1T38 A;  2MD0 A;  3HOT A;  2JRT A;  2R5Z A;  2O3F A;  4MTD A;  3O8G A;  2L54 A;  2EJR A;  2JSC A;  1K78 A;  4OIO F;  2QQ8 A;  2QVO A;  4WXD A;  1IC8 A;  2CO5 A;  1POG A;  4M3G A;  3EDP A;  2LDU A;  3O2P E;  4RLQ A;  4UUV A;  3A4C A;  1XB4 A;  1MBF A;  1XCV A;  3DLA A;  2CQN A;  2CFX A;  4F52 A;  4CSW A;  3HRT A;  2QEX I;  1Q1H A;  3UNG C;  1MGT A;  4LG0 A;  4E7L A;  2HTJ A;  3BR1 A;  3WHC A;  4HOB A;  4M6Y A;  5GAH J;  1PUE E;  3R0J A;  4RM3 A;  1YYV A;  2PMZ A;  4L5J A;  4HF0 A;  1A36 A;  1JKO C;  1AOY A;  3WE2 A;  1U5T B;  2OA4 A;  2ECB A;  1HBX G;  2L7M P;  1JHH A;  1GVD A;  4DIQ A;  2MD5 A;  3WGG A;  3MMY B;  3OYJ A;  2EFO A;  3JRI A;  1H8A C;  2DT7 B;  4IJA A;  4A3C J;  1XGO A;  3CJR B;  4KUM A;  2R0Q C;  3FX3 A;  4DNC A;  4KIS A;  5GPC A;  3DTE A;  3LSG A;  3IRR A;  5LLQ A;  1OKR A;  4RAG A;  4XQF A;  2LD5 A;  3RPU D;  4M3D A;  3HEF A;  5EJC A;  3EUA A;  2KT0 A;  2MC3 A;  3F9K A;  4RB3 C;  1WCM J;  3L2R A;  3EQL F;  4F92 B;  3KEY A;  3KFW X;  1QHH D;  3I54 A;  1YX5 A;  3HYI A;  2HEO A;  4LOC A;  4JBA A;  3M07 A;  4OOI A;  3WTT C;  1YRN A;  3BLY A;  3FMQ A;  1HXD A;  4HLX A;  5EG0 A;  3HOS A;  2PI0 A;  1RZ4 A;  4MFD A;  1Z1D A;  1T0F A;  1MJA A;  1G6N A;  1FP1 D;  3K0L A;  5F27 A;  2V1U A;  2VJJ A;  2ISY A;  3GTL J;  1D1C A;  2X48 A;  3H9Q A;  1JKR C;  2E36 A;  3HSE A;  1WPK A;  1WI3 A;  3L09 A;  4AIK A;  5DD8 A;  5EDN A;  2MH2 A;  3HZJ A;  3VFZ A;  4EQQ A;  2KZG A;  2DMU A;  1IXC A;  3BY6 A;  2DO7 A;  2EK5 A;  1WVR A;  2DN0 A;  1ENH A;  1GLN A;  4RS8 A;  2NVX J;  4S05 A;  1R1V A;  1G3Y A;  1MD0 A;  3RJP A;  1VQN I;  2OQR A;  5FKM A;  4ZDO A;  3GFM A;  4IVN A;  3OR2 C;  2EV6 A;  2HWV A;  1MND A;  4L5I A;  1SD5 A;  3PIO F;  1R5I D;  3PUF A;  3GYH X;  3CDH A;  4K2E A;  1V5E A;  2F48 A;  1OIS A;  4HEA 2;  2WY8 Q;  2QSH X;  3BC8 A;  3WTV C;  4DBQ A;  3SZP A;  2XGC A;  3IKV A;  1FIP A;  1ETO A;  1RUO A;  3N97 A;  1VQ8 I;  4QWQ A;  1LFB A;  2H1L A;  3FBI B;  3QAH A;  4FCY A;  4M6V A;  3WHB A;  2Z99 A;  5K7Z A;  3KP3 A;  3DWL E;  2JUC A;  1OR7 C;  4NQW B;  1U3E M;  3D1N I;  3TO7 A;  3HOY J;  1IUF A;  2DW4 A;  2ICW G;  1UEL B;  3J7A O;  1X1A A;  5J1R A;  1RRJ A;  3RYR A;  2AHQ A;  1DP7 P;  1YG2 A;  3FXQ A;  3ZP5 A;  4GRI A;  4IF4 A;  1IV8 A;  3J7Y J;  1UZC A;  1R6R A;  5IT3 A;  2GM4 A;  1WJB A;  1X1P A;  3LAJ A;  1JTY A;  2A05 A;  1K4T A;  2BY1 A;  5KAI C;  4E7S A;  1D1A A;  1FSH A;  4U0Y A;  1BA5 A;  1JT6 A;  5FB2 A;  2CRG A;  1A04 A;  3K4K A;  1V3F A;  4EJU A;  1VQM I;  2PN6 A;  2XAJ A;  3B6A A;  1FLI A;  2DMT A;  2R3S A;  4ESB A;  4BGD A;  3BPV A;  4DQ2 A;  4CA0 A;  2E2I J;  2VOP A;  3PSI A;  1WKM A;  3DEW A;  3SEZ A;  1Z67 A;  5BPI A;  1NK2 P;  3CCV I;  4MEX F;  1IF1 A;  2XAH A;  4EM2 A;  3L2U A;  3J80 K;  4Y3O A;  1IXR C;  3BR5 A;  2HYJ A;  1RPW A;  4BU2 A;  1YJ9 I;  1W5C C;  2BVM A;  2G7H A;  5IPA A;  2H6C A;  1NH3 A;  2AO9 A;  4IHT A;  3GTG J;  1XTA A;  2Y69 H;  4I6Z A;  1S29 A;  3CJQ B;  4WX9 A;  4HF1 A;  1FT9 A;  3E6D A;  5LGT A;  1FTT A;  1FOY A;  3G2B A;  1HF0 A;  4GDF A;  1WI9 A;  4G94 A;  2PMH A;  1XCB A;  1Z3Y A;  1ODD A;  1XMX A;  2LYC A;  4TV7 A;  2HVS A;  3P7N A;  3DXJ F;  3VYR B;  1KU2 A;  2W84 A;  1MBE A;  1WH7 A;  1R22 A;  1VZ0 A;  2X6Y A;  4Y15 A;  3J7A Y;  1SEU A;  3WE3 A;  2PEX A;  4LLG F;  1APL C;  2HQA A;  2W1O A;  3GW2 A;  3OYM A;  3HUG B;  3GVA A;  2CSO A;  3CCS I;  5ICC A;  2A61 A;  1I27 A;  2DMN A;  5EEA A;  1K6O A;  2HDW A;  2DA2 A;  3PL8 A;  2OBP A;  3ZMS A;  4EMS A;  2VQG A;  4KIC A;  4FHT A;  3JAM K;  1S6L A;  2VE9 A;  2WAD A;  3V7S A;  3JR9 A;  2L9N A;  2M34 A;  2BW3 A;  4XSZ F;  3CC4 I;  4BY1 J;  3KP5 A;  3OIP A;  2DFH A;  1ZGJ A;  2IA0 A;  2Q1Z B;  3PM1 A;  1JHF A;  1VQL I;  2JA8 J;  3JTH A;  1WJE A;  5JVG F;  5DD4 A;  2ZB9 A;  3PNY A;  4EEF G;  4I99 C;  3KP7 A;  1B8I A;  2CW8 A;  3ZMU A;  4E7I A;  4V2F A;  2CUJ A;  2H09 A;  2RRE A;  4EVI A;  2YU3 A;  2GOX B;  2HFH A;  5D5W B;  3H0D A;  1RIO H;  4LGW A;  4UUS B;  1X4O A;  1S5L C;  4C3I J;  3ROU A;  2HZT A;  3ABM H;  2Z5U A;  4L9N A;  2DA6 A;  2AXL A;  3PNV A;  1B72 B;  3MZH A;  1TWA J;  3TO6 A;  3S1M J;  4Y33 A;  3EPZ A;  1U9O A;  2ISZ A;  4NC6 A;  4HG2 A;  3CUO A;  2PBI A;  1KYZ A;  3F8C A;  4BEH A;  3RIR A;  1T0F C;  2LKP A;  1QBJ A;  2ZO4 A;  1XG1 A;  3BTJ A;  4RB0 A;  3CF2 A;  2E1N A;  2H6B A;  2K9N A;  3C18 A;  5DDG A;  5ICG A;  5BNG A;  1RC9 A;  3LA3 A;  5F6F A;  3ZMD A;  1YIJ I;  5E3L A;  2Y31 A;  1ZRC A;  4LD5 A;  2R5Y A;  1YOV B;  4H4K C;  2DFI A;  2IEK A;  4CCO A;  1ON1 A;  2BHZ A;  2WV0 A;  3COA C;  3I59 A;  1T8I A;  5H6R A;  1WJ5 A;  2MYS A;  2HOE A;  3VDX A;  3OYD A;  4L0Y B;  1FBS A;  3W2V A;  4CUG A;  3N05 A;  3U9G A;  1MBG A;  4YEL A;  3ZN0 A;  2DA3 A;  1MH3 A;  1ZGA A;  4E6K G;  2KRH A;  3LQR A;  1U5T C;  4IHX A;  1MNE A;  1IN5 A;  2FMY A;  2XF7 A;  1KU9 A;  1XN7 A;  1FMV A;  2GIZ A;  3GLX A;  2CW7 A;  1QZE A;  4LJZ F;  4F7Z A;  1BR4 A;  2FBI A;  4YFN F;  3ERE D;  2B7E A;  1F9N A;  1IDY A;  1W4M A;  2WTE A;  3QQA A;  1QHG A;  4XLP F;  3O3K A;  1O3T A;  2Y2Z A;  4QIW N;  4CCK A;  2E5N A;  2HI3 A;  5LRR A;  5KHD A;  1IRZ A;  2E1M C;  1U6G A;  2RV8 A;  1XDU A;  1H0M A;  4ENN A;  2KRF A;  3V4G A;  3JRE A;  3F0C A;  4BQA A;  1OLT A;  1DGW Y;  3P9I A;  2L2O A;  2FX0 A;  1D0Y A;  1WWX A;  2VPR A;  1ETX A;  2G7U A;  5F64 A;  2VKE A;  3RKX A;  1JGG A;  4CO8 A;  3E1S A;  1VND A;  5HOO A;  2M4K A;  3CUQ A;  3CCJ I;  2HDD A;  2XSD C;  3WOD F;  3K4B A;  3H3V K;  2QQA A;  3MZ8 A;  1MSE C;  2VXD A;  2QKM B;  5TGT A;  3SZT A;  3LSP A;  2ECC A;  4X0G A;  3SXY A;  5CVR A;  1H9G A;  2FML A;  3HPG A;  1K7A A;  2VIX A;  3IRQ A;  1OQY A;  3E6C C;  1YX3 A;  1R9T J;  1R1T A;  2K5C A;  1JJ8 C;  2KKO A;  4EGZ A;  2HQ5 A;  2CJJ A;  1HLV A;  3A03 A;  2NVQ J;  3HOZ J;  1YS6 A;  3WG7 H;  4IKF A;  3OMY A;  3PO2 J;  2G9W A;  1BBY A;  2NS8 A;  4RAF A;  2P6T A;  4XMY A;  1JKQ C;  3GFL A;  2V9K A;  3V8K A;  2IP2 A;  3KP2 A;  1FOW A;  4MGR A;  1IZ1 A;  4BY7 J;  2X9D A;  2IW5 A;  1UFM A;  2BXY A;  2P8T A;  4MTE A;  2XC7 A;  4PJJ A;  5E3O A;  2VBZ A;  3DPL C;  1X1D A;  4M3B A;  1JUM A;  3FMR A;  2BY0 A;  4BDY A;  1BN5 A;  4BYY A;  3K6G A;  1JE8 A;  3I4M J;  1S7A A;  4YEJ A;  1LFP A;  3OIO A;  2JWT A;  2L4M A;  2R7S A;  5J1U A;  1FNN A;  3OS2 A;  1ZTR A;  3T1B A;  4J00 A;  3KIO A;  3LSH A;  1X2M A;  4E7J A;  3GTQ J;  1ON2 A;  2PMZ N;  3K1P A;  1X1B A;  2CS3 A;  3ZPL A;  2X4H A;  1F43 A;  2BV6 A;  5LFA A;  1IN6 A;  2ESN A;  2LFB A;  4RGX A;  4B1R A;  3CCQ I;  1B59 A;  1LDJ A;  1USS A;  2FOK A;  5FRN A;  1T39 A;  2OU2 A;  3NWT A;  4OIQ F;  1MMG A;  4UB6 C;  4LB5 A;  4Y52 J;  4A3E J;  2FU4 A;  4HSR A;  2ZME B;  2JMW A;  5L3C A;  4FQG A;  4UHT A;  3BPX A;  3AL0 C;  3JCU C;  3TP0 A;  2P81 A;  5J8F A;  1OCR H;  3CDL A;  2ETH A;  3SEQ A;  2K7L A;  1P6R A;  3RSN A;  4KN7 X;  4FIS A;  2GZW A;  1L0O C;  1S9H A;  4BQN A;  4A69 C;  3G1O A;  4EJT A;  2JVH A;  1OMI A;  1T08 B;  5FD5 A;  5JR3 A;  2KIM A;  2V6C A;  4Q48 A;  5BQT A;  3OYE A;  3VPR A;  2KIU A;  4A93 J;  2LK2 A;  3CES A;  3JRF A;  2HXO A;  1D0X A;  5L3G A;  2FNA A;  2R7U A;  1EH7 A;  2CU7 A;  3ECO A;  2JRM A;  4DZJ A;  4CDG A;  3H5R A;  1MJB A;  2M9H A;  1SVL A;  2QQ9 A;  1MZB A;  2XUB A;  4DYC A;  2CMP A;  3AAF A;  1PUF A;  1BI0 A;  1Z7U A;  2P7V B;  4Z6Y A;  4A0X A;  1EH6 A;  1P2F A;  3J80 Z;  2K3P A;  4KT5 C;  2HQR A;  1LKX A;  3BR6 A;  5IYC J;  4AWX B;  3E0J B;  4ZYD A;  4CCL A;  1IJW C;  5K5R A;  1YIT I;  1R71 A;  2OCC H;  3PQJ A;  4CGZ A;  4XL9 A;  3HOX J;  3HHH A;  1JT0 A;  4AIH A;  1HKQ A;  1HDP A;  2VLA A;  3KYL A;  4A3J J;  2JA2 A;  3GFJ A;  2D45 A;  2CWE A;  2LRD A;  4PJ0 C;  2LBF B;  4L18 B;  1RKW A;  3QPS A;  5BS6 A;  1LE8 B;  1MDM B;  2ELH A;  1W1W E;  1J0R A;  2HDC A;  4KIB A;  5HNH A;  5M3M J;  1VQP I;  2A07 F;  3WGH A;  1NHA A;  4ABZ A;  3CF5 F;  5FRM A;  3A01 A;  1LEA A;  1XPX A;  3M1E A;  2F5C A;  4CZZ A;  2XKP A;  5ICE A;  4X6A J;  5GTI C;  1FOK A;  2R7F A;  1OYW A;  1Z6R A;  4UNO A;  2DOD A;  1W5S A;  5ILU A;  5HS8 A;  3NEU A;  1K61 A;  3S1N J;  2K4B A;  3PUB A;  1K79 A;  3LST A;  1I3Q J;  2W24 A;  2KJB A;  5CVV A;  2Q0O A;  4B48 A;  3HGY A;  1KU3 A;  3KYD B;  1FY7 A;  3G1M A;  2KDO A;  3JAM Z;  1ZN2 A;  2VC1 A;  1ZEL A;  2QSG X;  5DYM A;  3SFZ A;  5K7F A;  4XN3 A;  3GZ5 A;  4DYR A;  5DCM A;  4MHG A;  2H8R A;  2OV7 A;  4KYW A;  5EYR A;  2M0C A;  1I1S A;  1XX5 A;  3VEP A;  3Q0U A;  2E19 A;  1SFX A;  1OCP A;  4PJL A;  3M3Y J;  3MN2 A;  4XBF A;  5GAD J;  1VQ5 I;  1TT5 B;  1H9T A;  3BG9 A;  2UWM A;  1X3U A;  2A5W A;  2WC2 A;  3OWT A;  3I71 A;  3HRM A;  4WXC A;  4HNU A;  2R7D A;  2GQQ A;  4AVZ A;  2E2J J;  6PAX A;  2M2E A;  3P9K A;  3QYE A;  3CJT B;  2KJC A;  2O61 A;  4IQ4 A;  3TOA A;  3FK6 A;  2XAS A;  3BZ6 A;  3SDG A;  5F0H A;  2R7Q A;  3IHU A;  2I8D A;  3K1M A;  4HX7 A;  1AWC A;  2QEN A;  1W7P A;  3M9A A;  5B3S H;  2EZK A;  2KP6 A;  2KMU A;  1LVK A;  3OOP A;  5HS9 A;  2EFN A;  4HQE A;  3DLL F;  3BQY A;  2DQL A;  5EGO A;  3LA2 A;  4A3F J;  1LQ1 A;  2VQC A;  2MBF A;  1U2W A;  2CUE A;  2J5P A;  4Z2Y A;  2L3D A;  3IAM 2;  4EAT A;  4V2G A;  1W5T A;  2EQR A;  5TRD A;  3I56 I;  3FHZ A;  2FSW A;  4HPQ A;  3D5L A;  4FET A;  1RUN A;  4RAZ A;  1T6S A;  5CQE A;  2X85 A;  1Y8R B;  5DCF A;  2OAZ A;  1ETY A;  2OCE A;  3IH3 A;  5B1A H;  5KVR A;  5ED4 A;  3CO7 C;  5BOX A;  4XNF A;  5KK1 A;  2KPM A;  2MSY A;  4DOZ A;  1VQ4 I;  1YRN B;  3TO9 A;  5EG0 B;  2F4O B;  2W57 A;  1WJA A;  2DBB A;  2FBK A;  3AFH A;  2BEO A;  2IAI A;  3CD6 I;  3G71 I;  1FOX A;  4WWC A;  3ZQQ A;  3U21 A;  3KCC A;  3W6K B;  2QCO A;  3ZQL A;  1TNS A;  4BHB A;  4UV9 A;  1U8R A;  3K70 D;  5GPA A;  4ESF A;  3H5N A;  1HST A;  4E7H A;  1FSE A;  1KQ0 A;  1XSV A;  2E7X A;  3WTZ A;  4ENM A;  2JA6 J;  3SYT A;  3GLL A;  3I64 A;  4XLN F;  2P5L C;  3AG1 H;  4I02 A;  3U1D A;  1G2H A;  1U78 A;  2R7R A;  2OUM A;  4BQQ A;  5GAG J;  2Y0M A;  3IH4 A;  5AIQ A;  1U9N A;  2GAU A;  3K9T A;  5IP9 J;  2FA5 A;  4I76 A;  2A69 F;  2QBY B;  2XKO A;  2MW8 A;  3H0G J;  1I5Z A;  2EIN H;  1HOM A;  4P55 A;  4ESJ A;  4F91 B;  3K2A A;  4ETS A;  4CYD A;  1M1E B;  2FEZ A;  4BXU A;  1SAU A;  2H1K A;  1ZR2 A;  1TBX A;  1V55 H;  4IRG A;  4MO7 A;  2NS0 A;  1WH5 A;  2RQQ A;  1YHQ I;  5KCM A;  1ETK A;  2ACJ A;  3CMY A;  1DPU A;  4NC8 A;  2WV1 A;  2PQ8 A;  3HRS A;  4UVB A;  3ZMT A;  2GIV A;  5TJJ A;  2IGM A;  4WF2 A;  2WAQ A;  1RNL A;  3M4O J;  4RA2 A;  2RVC A;  1B4A A;  3KPH A;  2P4W A;  1MIJ A;  1FX7 A;  2BOL A;  2IVM A;  2KIS A;  2MLG A;  4G6D A;  4GYI A;  1XDS A;  1O3S A;  2DMQ A;  3EYI A;  1RES A;  3DEE A;  4CCM A;  1U5T A;  2HYG D;  5D5V B;  5HLI A;  5FLM J;  4A3D J;  3EYY A;  3OYA A;  2YUS A;  3LNQ A;  1UMQ A;  2WAE A;  3GTP J;  1Z3X A;  2K27 A;  4BHC A;  4XM3 A;  2VT2 A;  3I0T A;  2KLO A;  1W0U A;  4BE2 A;  3E6B A;  4HX8 A;  3R6S A;  4P1W A;  5AON A;  1N78 A;  3O8H A;  4QPO A;  4KT6 A;  3K4M A;  1I6X A;  2IT0 A;  3FZV A;  2EV0 A;  4E7K A;  1LJ9 A;  2NVU B;  2M30 A;  2TRT A;  2R7Z J;  3BJ6 A;  4Y13 A;  5HDG A;  2B63 J;  1EF4 A;  3L2Q A;  2KIQ A;  4PSX A;  2M3A A;  2A6H F;  3ONQ A;  1BL0 A;  2DQR A;  4ZTF A;  3DBL B;  5DUK A;  3HOV J;  5F08 A;  1YTY A;  2QF7 A;  1BI3 A;  3L9F A;  1UG0 A;  3VOD A;  2XDV A;  2DA7 A;  3D5R C;  2PJR B;  1WHU A;  1J2X A;  3TED A;  2HPI A;  3GWZ A;  5FKO A;  4LMY A;  3UR3 C;  4D5F A;  2RGV A;  2VJ4 A;  2V79 A;  3E5U A;  2NS7 A;  3I3L A;  2EA4 A;  2BY3 A;  1OCT C;  3CC7 I;  2RNG A;  2XSJ C;  1E3H A;  2EA2 A;  3KP4 A;  5HS7 A;  2O03 A;  1FYL A;  2D1H A;  2LKX A;  3QU3 A;  1VQO I;  3S8P A;  3LOC A;  4E4H A;  2HYF A;  1P4A A;  5DM7 F;  4RGU A;  3WTY C;  5E8G A;  4LG3 A;  1LNW A;  3LL7 A;  2ME0 A;  4LIU A;  2OF7 A;  5IYB J;  5K1Y A;  3DV8 A;  1R00 A;  5JHF A;  1N25 A;  4AYB A;  1LUJ B;  2CQQ A;  3BTI A;  3IV5 A;  2P5K A;  3KEQ A;  3CCR I;  3LFK A;  5CKT A;  1XD7 A;  2WA0 A;  2LTP A;  4IRI A;  2MLK A;  1AKH B;  4U7B A;  2A3S A;  2Y30 A;  3E7L A;  4I01 A;  4XN0 A;  1RR8 C;  5J4Y A;  1GVJ A;  3FK7 A;  2FE3 A;  5L3D A;  4FAS D;  1R49 A;  3SDB A;  1Y1V J;  1YW8 A;  3GBG A;  4A3K J;  1MSF C;  1HQC A;  3DU6 A;  4A6D A;  4PSW A;  5C44 J;  5H6Q A;  2R7W A;  2M8E A;  4XK4 A;  1GDT A;  4BBS J;  4NQW A;  4NB5 A;  1W36 C;  1QVT A;  2HOT A;  3C2B A;  4IZZ A;  1JJ6 C;  3H5A A;  3CP8 A;  4IOA F;  5ILS A;  3OYC A;  3OYI A;  4I0B A;  4P96 A;  4YFX F;  3HM5 A;  4IX7 A;  2XGE A;  3A2K A;  3NRV A;  4MNU A;  3GME A;  2W7N A;  3F3X A;  4M9Z A;  3K4J A;  2IBD A;  2QSF X;  5LEK A;  4DBR A;  1F36 A;  3ABT A;  4XLC A;  1LDD A;  2V1X A;  2E1C A;  1OFC X;  2Y9Z A;  3F8F A;  2ZXJ A;  3BJO A;  1F4K A;  1GUU A;  1UHS A;  2IGN A;  4ZYH A;  2QGU A;  1IW7 F;  3QWL A;  1U8B A;  1IRX A;  4HST A;  4FT8 A;  2IS1 A;  4XLE A;  4GO1 A;  2CV2 A;  2FXA A;  3OYK A;  1FTZ A;  4XRM A;  2L7F P;  4B3X A;  3DP7 A;  1HW5 A;  1JXS A;  3E6M A;  2K3F A;  1QA6 A;  2Z2S B;  2VQL A;  2X6O A;  4AD9 A;  2LY1 A;  4G8X A;  2GXG A;  2K86 A;  3I58 A;  2QM3 A;  4N0B A;  5D6E A;  3TKY A;  3JTG A;  1ERD A;  1R23 A;  1BW5 A;  2OJE D;  1G3W A;  2WB1 A;  3V7R A;  1DPR A;  2DPD A;  4G6Q A;  1ZHF A;  2NAZ A;  2X1E A;  3BCA A;  4IQJ A;  3Q0V A;  3K2Z A;  1ACI A;  1XGM A;  1ZG1 A;  1IN8 A;  2QYO A;  4BJ6 C;  2GOM A;  1UAA A;  3GF2 A;  3KLN A;  1ZRE A;  4HDU A;  2QUF A;  1X58 A;  1Z21 A;  2Q8K A;  4ZC3 A;  3H35 A;  3FM3 A;  3ZQF A;  1ZRD A;  4R1H A;  1B6A A;  2Q2E B;  1BW6 A;  1LFU P;  5C4J J;  1DDN A;  2HKX A;  1PDN C;  2L02 A;  3S1Q J;  4U87 A;  3S17 J;  2ZSH B;  1Y56 A;  1E3P A;  3FXL A;  3KZY A;  2GA2 A;  1QVU A;  3CME I;  3PFY A;  1SMY F;  2B0L A;  1N77 A;  2C6Y A;  2F4I A;  1KQ8 A;  1FBQ A;  1KYW A;  1MKM A;  1A35 A;  1TC3 C;  2JTV A;  2LP0 A;  2IRF G;  4M9X A;  4BBR J;  3WU0 A;  1J9I A;  4HBL A;  2E2H J;  1D8K A;  1ZRF A;  2L7Z A;  2BVL A;  4LIT A;  3LSR A;  1HKS A;  4FE4 A;  5EF6 A;  2WBM A;  3F6V A;  2RC4 A;  4KDP A;  3HUG A;  4N9H A;  1TQI A;  3L00 A;  5M3F J;  4XON A;  3UKG A;  1VF9 A;  4Y17 A;  4RB1 A;  2NRA C;  4XR6 A;  1SD6 A;  2JVG A;  3JSP A;  3S1R J;  4QTR A;  3CUQ B;  4ITV A;  1VQ7 I;  4I7H A;  1TP4 A;  5E79 C;  5HDK A;  3W2W A;  4D1Q A;  2BY2 A;  2H8W A;  3S3O A;  1WFX A;  4U0V A;  3SZG A;  4H0E A;  1BC7 C;  5HDN A;  4S0H B;  2GWR A;  5HLG A;  3FKI J;  2V6E A;  2QA4 I;  4GFB A;  3TL4 X;  2DDA A;  3DPT A;  2ESH A;  5FKK A;  5FLV A;  2O8K A;  3BOQ A;  2AXT C;  2JPC A;  2V4J C;  1W0T A;  5DUI A;  3KYC B;  3F72 A;  1AHD P;  2X6X A;  2RQP A;  4L9V A;  3W3C A;  4JQF A;  3MKL A;  1ULY A;  1VFC A;  2HS5 A;  1DU0 A;  3ZRG A;  3DFG A;  3MVP A;  3ESW B;  3JRD A;  2H94 A;  4QSH A;  4UUS A;  5M5Y J;  2CGP A;  1XC5 A;  3F6O A;  1R1U A;  4V19 K;  3F8B A;  1ZGW A;  1B72 A;  1T2K A;  3TMO A;  5IOY A;  2M0M A;  3ZQI A;  1UHM A;  3E5X A;  5E3N A;  4AU7 A;  2RN7 A;  1TWG J;  4BDZ A;  1BR1 A;  2MAB A;  1SVO A;  4AC0 A;  5DEQ A;  1PVE A;  1IUY A;  1O7L A;  1CF7 B;  2L0K A;  5J4V A;  4ENJ A;  1QU3 A;  4A3G J;  3FXK A;  2M45 A;  1R7J A;  3Q3S A;  1HDD C;  5HLH A;  4XID A;  4KIG A;  4C3J J;  3BTC A;  2PFB A;  3ZQ7 A;  1XGN A;  3R0A A;  4CYC B;  2L4A A;  1X2N A;  4O6J A;  3HSF A;  5FJ8 J;  2XRN A;  4IOC F;  4F93 B;  1XS9 A;  3ZMZ A;  2DT5 A;  1XGS A;  3BR0 A;  5B5E C;  2FF4 A;  3HBL A;  2LOO A;  2BYV E;  1K4S A;  3KEO A;  5D8K B;  3FM5 A;  3GZN B;  3R61 A;  4B3A A;  3VYU B;  4B47 A;  2LY9 A;  5BPD A;  1YW9 A;  3KZZ A;  2LLK A;  1W7P D;  4XSX F;  4L9T A;  2IS6 A;  2W4S A;  4BNC A;  3DPU A;  3K4N A;  4OWR B;  1LDK B;  4C30 A;  3GTJ J;  2YS9 A;  2YU9 J;  2VE8 A;  2EH3 A;  3OS1 A;  1YS7 A;  3MQ0 A;  2M7B A;  2YR2 A;  2V1D A;  2ZFW A;  2K85 A;  2MC4 A;  2I5U A;  3ULQ B;  2K4J A;  3H3U A;  3FIW A;  4XOR A;  4C2T A;  3LSK A;  2VKD A;  2W25 A;  3ZCO A;  1Y6I A;  2DJI A;  4A3I J;  1FZP B;  1R4N B;  3CMA I;  1GHC A;  3CLQ A;  2XB5 A;  2VKV A;  3CQZ J;  2W85 A;  3I53 A;  2DK8 A;  2R92 J;  1YJW I;  2PX9 A;  3HG9 A;  2CUZ A;  3HPH A;  4M3E A;  3DU5 A;  1ZR4 A;  2Z9O A;  3BP8 A;  2K9M A;  5J40 A;  3CCE I;  1TQM A;  4B4C A;  4OIR F;  3HSR A;  3JRH A;  3WU2 C;  3X2Q H;  4D7M A;  2X51 A;  1D0Z A;  4G7H F;  1QQI A;  4NNJ A;  1IG7 A;  3G4S I;  1D1B A;  2V7F A;  2OQG A;  3ZQC A;  3OSF A;  1HCR A;  1ETW A;  1D8J A;  4UB8 C;  2VB6 A;  3R4K A;  5EZH A;  5B66 C;  2HU9 A;  3OV8 A;  1T98 A;  1WJF A;  3CCY A;  4CCN A;  3DF8 A;  3VYT B;  1BI1 A;  2NXN B;  1BOB A;  3V8J A;  3K7A J;  3BRO A;  3GTK J;  2ME6 A;  3CLO A;  3SHF A;  1KON A;  5EEG A;  4LLL A;  3MKW B;  4DZP A;  1QPI A;  1BR2 A;  4ZJZ A;  1FBU A;  3J81 K;  4JX4 A;  3EUK L;  3QU6 A;  1K83 J;  2H27 A;  5J1Y A;  3NAU A;  4HZF A;  1UG2 A;  2VJ5 A;  2WAQ N;  3FXM A;  3HTS B;  3S16 J;  1FEX A;  1HKT A;  4MFE A;  1WSU A;  4LK0 F;  4D5C A;  2BE5 F;  2RDP A;  3LFU A;  2BHY A;  2O5R A;  1KA8 A;  3BT9 A;  2O7O A;  4G7Z F;  3CCM I;  3K4C A;  3PQK A;  5E3M A;  2ZJQ F;  4NC7 A;  3F8N A;  1Z9C A;  1RKT A;  1MMA A;  5L3E A;  2MGQ A;  3V7C A;  3HB9 A;  5CQG A;  2HPM A;  2STW A;  3CC2 I;  1Z91 A;  1T95 A;  4XLH A;  1X3Z B;  2XAG A;  4BE1 A;  1TWH J;  2ZME A;  1Y1W J;  1PP8 F;  3RKW A;  2EIL H;  4IO9 F;  1HC8 A;  2ZBK A;  4XIC A;  2XV4 S;  3BG5 A;  5KAF C;  3K69 A;  5LHH A;  2DFE A;  5F04 A;  2PLY A;  2CV0 A;  3T0Y A;  4LIV A;  1SAN A;  4BJT A;  2Z33 A;  3ABK H;  3C1D A;  3TW6 A;  4L5E A;  3L7W A;  2Z16 A;  5HLT A;  3QP5 A;  2X6W A;  2OPT A;  2QWW A;  3RTR A;  4N9I A;  1D3Y A;  1XSD A;  4HYE A;  2ZCW A;  4CXF A;  4DYQ A;  2M1B A;  4G12 A;  4PUS A;  2GXA A;  5CLS A;  4NBQ A;  3H9G A;  3S2D J;  4BL0 B;  2K9S A;  4PJN A;  3RYP A;  2GA1 A;  2JJ7 A;  2TCT A;  5EGO B;  1VTN C;  2ZJ2 A;  2F5D A;  2OZ6 A;  1FPQ A;  4X1E A;  1Y39 A;  4ON0 A;  2CYY A;  1WQ2 A;  2ID6 A;  3C3W A;  3LSJ A;  5IP7 J;  2QZ8 A;  1F1Z A;  4XRS G;  3GUD A;  5JFR A;  2R5Z B;  1QRY A;  5LD2 C;  1UST A;  1K78 B;  3MKY B;  2VPL A;  1TW3 A;  1BI2 A;  4EJO A;  1QPM A;  2DU9 A;  4OAZ A;  5D4S A;  4ZZL A;  4L0Z B;  2KQR A;  4AYB N;  3DBR B;  4C2M J;  2EZH A;  2OD5 A;  4NUB A;  3VWB A;  3BZK A;  4AID A;  3ZR8 X;  1J5Y A;  4I2O A;  1LPQ A;  2EFQ A;  1VI0 A;  3AG2 H;  3HDD A;  1K6Y A;  1LE8 A;  3P9C A;  2BGC A;  1MDM A;  3F22 A;  4LG0 B;  4P5O A;  2D1V A;  4U0W A;  2P6S A;  4UVC A;  2HOA A;  2VL8 A;  2ZKZ A;  2VAS A;  4FX0 A;  3RQ4 A;  4OAY A;  4EJW A;  3GTO J;  3I9V 2;  3B6C A;  1BIA A;  3FXR A;  2M87 A;  4U88 A;  1WZ2 A;  1B9N A;  2VKH A;  2LKS A;  3F8M A;  1I1G A;  1D5Y A;  2M5W A;  2DJN A;  3QPH A;  1MNM C;  2JQ7 A;  5CVU A;  1F5T A;  3A0H C;  5IY5 H;  4I98 B;  2DA1 A;  3BCB A;  2UZK A;  2JUG A;  4MLO A;  1G59 A;  3D5S C;  1B1B A;  1TNT A;  3ASN H;  4NDL A;  2L9V A;  1LEB A;  2HKO A;  1ONV A;  4RMN A;  2E35 A;  4KFC A;  4HQM A;  2XAF A;  4GCV A;  4OU0 A;  5LRS A;  1KGS A;  1TT0 A;  2HXI A;  3Q5F A;  1STZ A;  1HA8 A;  4EGY A;  5M5X J;  3WTW C;  1V54 H;  2A68 F;  3JRC A;  4XRF A;  2DYS H;  1UJ8 A;  2XGX A;  2DMP A;  4M9S A;  4RGR A;  1GV2 A;  2ZC2 A;  4BS9 A;  3GTM J;  2BXZ A;  2CUF A;  3IP4 B;  2DI3 A;  2WB1 N;  3QYF A;  1J09 A;  3AG4 H;  3HKZ A;  5LHI A;  2G0E A;  4CZC A;  2LNB A;  3W6V A;  5F0C A;  1PJR A;  4ZZD A;  3WTU C;  1UCR A;  3V42 A;  3VYS B;  5D4R A;  5E1W A;  3LSI A;  5JI6 A;  2QQB A;  4XKC A;  4DGW B;  4LLN A;  1NK3 P;  5E1Z B;  3I4P A;  1V5G A;  3TDU C;  3JRA A;  2XGD A;  2CG4 A;  2L01 A;  2J5O A;  3IWF A;  4II2 A;  3HL2 A;  5E20 A;  3W6J B;  4AUX A;  5IOZ A;  3MFK A;  4IPA A;  2IA1 A;  2JK3 A;  1EH8 A;  2W48 A;  3MCZ A;  4PCQ A;  4PFO A;  3ZQH A;  3GZ6 A;  2F5V A;  1VQK I;  3VOE A;  3SQN A;  2A6T A;  2OTL I;  2ADU A;  4ZTJ A;  1IV6 A;  1SFK A;  2DCE A;  4ASN A;  2FNP A;  4A6E A;  3ZN1 A;  2K9L A;  2Y48 A;  4KN4 X;  1WGX A;  5JHU A;  2K40 A;  3GFI A;  4AM3 A;  3G1L A;  4D0P A;  4EM1 A;  2BBY A;  2V9P A;  2HZD A;  1MBH A;  4XRS A;  2NVT J;  2E1M B;  4J19 A;  1SFU A;  5FD6 A;  3TQN A;  2ZXH A;  1RET A;  4A3M J;  4BAC A;  2FOW A;  4ZYG A;  4RGS A;  4PFP A;  2R7X A;  1SC7 A;  4ENK A;  1SMT A;  3PSF A;  1VQ9 I;  2QKL B;  3WTS C;  1MBK A;  4A0Z A;  3M8J A;  2VOO A;  2LF8 A;  2R7T A;  1QZY A;  1FWZ A;  2HGC A;  2UUZ A;  2YSR A;  5IT9 K;  1J7K A;  2EB7 A;  2NNY A;  2O9L A;  1SFO J;  5F1R A;  3ABU A;  3DKX A;  2VBX A;  1T56 A;  3M8E A;  3BG7 A;  3CZ6 A;  3PFI A;  2F2E A;  4IXA A;  5FKN A;  3FXU A;  2V26 A;  3IL2 A;  1IDZ A;  1J59 A;  3A0B C;  1MW7 A;  4QPQ A;  3HIF A;  2E5Z A;  1NG7 A;  1SD7 A;  2W00 A;  3T8R A;  3FWE A;  1P7J A;  2E7W A;  1IXS B;  4KMU X;  1QO0 D;  2ZME C;  1DU6 A;  1IRG A;  2YPR A;  4RB2 C;  3RI4 A;  3CP2 A;  5LEJ A;  1IAW A;  2DTR A;  2Y9Y A;  4FX4 A;  4W97 A;  4HNV A;  5LHG A;  4A5M A;  3BR2 A;  4L9J A;  4W1U A;  4IHS A;  4RBO A;  4C9Y A;  1FMW A;  1CQT A;  2ELK A;  5IYD J;  4I09 A;  1GT0 C;  4YII A;  3BDD A;  1XMA A;  1B9M A;  3RZD J;  3RZO J;  4KIF A;  4BXF A;  3GXO A;  1BJA A;  3ML6 A;  3CCL I;  4ANJ A;  2EFW A;  4DW6 A;  4WK8 F;  1E3O C;  3N4M A;  3E3V A;  5H2F C;  1S8N A;  4OMY A;  3S32 A;  1ZAO A;  3MKZ A;  2QBY A;  1MMD A;  3IKT A;  4R79 A;  1KZH A;  3OL4 A;  1WJD A;  1OCZ H;  3I4N J;  2IA2 A;  3NAR A;  2MH9 A;  3FKJ A;  3QPT A;  2Y0S A;  1AA7 A;  1PYV A;  2XF6 A;  1YFH A;  4XOP A;  1IO2 A;  4HW0 A;  1JUS A;  2WWY A;  2JT1 A;  5GP9 A;  3HGG A;  2DPU A;  2HVR A;  2CQK A;  5LGN A;  3J81 Z;  3R60 A;  2N8G A;  4HA8 A;  2CFO A;  3H3Z A;  2ELJ A;  2GXB A;  1O3R A;  2VON A;  1WRJ A;  4HF2 A;  4QLC U;  2RKH A;  2ZNY A;  4UY8 I;  2VUM J;  1A6I A;  2KIF A;  1TTY A;  1SAX A;  5FFX A;  3AL0 B;  4RAY A;  3BG6 A;  2GLO A;  5C3E J;  3S93 A;  3U1K A;  3WG9 A;  3S2H J;  4BXX J;  1UHW A;  2P5V A;  4BJ5 C;  1Y8Q B;  3S15 J;  3G73 A;  3HRU A;  3MAJ A;  5D6F A;  4ZDP A;  4IHV A;  1PP7 U;  1R58 A;  2X1D A;  5J3L A;  4PDK A;  2BW3 B;  4ZYA A;  2F6C A;  5K7H A;  5FO5 A;  2A6E F;  3BG3 A;  3CDI A;  4PJM A;  4PGH A;  3PIP F;  4B8X A;  1E0E A;  3BJA A;  1ZQ3 P;  2LG4 A;  1G4D A;  4UXN A;  4II3 A;  3ZXS A;  4BKX A;  3DKW A;  4KA4 A;  2DK5 A;  3TP3 A;  4YRV A;  2EV5 A;  4M71 A;  1B8I B;  5FKL A;  3ABL H;  2JA5 J;  5E18 F;  4OIN F;  2LC2 A;  5BMZ A;  2PJR A;  2EZL A;  4AVP A;  1IGN A;  3S14 J;  1FC3 A;  1Z05 A;  1YO5 C;  3S2W A;  4A5N A;  3TOB A;  2ZFU A;  3OYG A;  4EM0 B;  2MA3 A;  3LMM A;  1BOA A;  1JI8 A;  2IPQ X;  4BEH B;  1R4M B;  1Z7L A;  2HQN A;  3PO3 J;  1OYI A;  2DLL A;  4J01 A;  3DTI A;  1WJC A;  4HLY A;  5L3F A;  2VBY A;  4M74 A;  1P4W A;  3HTU A;  4E7Z A;  2DA4 A;  3WTX C;  3RKQ A;  4BE0 A;  2COB A;  4N4N B;  2IS2 A;  5CPR B;  2V9V A;  1S7O A;  3BZC A;  2EBI A;  2R5Y B;  4WCG A;  2XB0 X;  3IH2 A;  4UV8 A;  1TWC J;  1TLH B;  2HVQ A;  4JX6 A;  3H1C A;  3I59 B;  3FIS A;  3RPQ A;  4XKB A;  3LA7 A;  5B1B H;  1AKH A;  1ETV A;  3IAS 2;  2QLZ A;  2KRC A;  1MMN A;  2FD5 A;  5F1J A;  5J8C A;  3DTK A;  3MD2 A;  4CCJ A;  3JW4 A;  1YJN I;  1V4R A;  4KIT B;  1Z77 A;  1KQ9 A;  2ZSI B;  4ZDL A;  5FLX K;  1ZG3 A;  3RPU A;  2LR8 A;  3L1P A;  2NNN A;  4RLF A;  2EIM H;  1OPC A;  2DAO A;  3MZY A;  1TWF J;  3AKZ A;  3ZOB A;  2CQX A;  3K10 A;  2I10 A;  1P7I A;  4MQ9 F;  2RNJ A;  3QRF F;  4NHJ A;  5DTD A;  4MQV A;  1Q1V A;  3OIQ A;  2LVS A;  3ZQG A;  4FTH A;  4WXH A;  4EV0 A;  3LAP A;  3M7G A;  1NTC A;  3Q9S A;  4BUP A;  5K5O A;  1NG6 A;  3HOU J;  1YI2 I;  2JSP A;  4PGG A;  3OYB A;  5DV5 A;  2DOF A;  2CW0 F;  2E34 A;  5FGM A;  3S3N A;  3CMM A;  1OYY A;  1S3J A;  5A2Q K;  1N75 A;  3TW7 A;  4XKV A;  2KFD A;  2MG4 A;  4IHW A;  3FMS A;  5D5X B;  1O7F A;  2M7A A;  1XMK A;  1LVA A;  1H89 C;  3Q9V A;  2FRH A;  1GXQ A;  2O8X A;  4U7D A;  2DXI A;  3HOW J;  2E1O A;  2UXN A;  5EEH A;  2FUG 2;  2XPV A;  1YE9 A;  3H36 A;  5J6X A;  1ZH5 A;  3DKY A;  2JZY A;  3L2V A;  3HXL A;  5D8L B;  3L2W A;  2RAE A;  3OS0 A;  2FJ1 A;  5ICF A;  3NWS A;  1X19 A;  3ELK A;  3FHN A;  3IWZ A;  4HRI A;  5E17 F;  3QP6 A;  3LSM A;  1TW2 A;  2PJP A;  3I5U A;  3REO A;  2KHM A;  1IRF A;  3DEU A;  1GXP A;  2E60 A;  2LY2 A;  4G7O F;  3H9J A;  3ASO H;  3OYH A;  2F4M B;  4B09 A;  2LRE A;  4Y4R A;  5CJ9 A;  4DJA A;  4XLA A;  1R5H A;  2UV1 A;  5ERI A;  3CCU I;  1Y0N A;  3M1C A;  3RQI A;  1FYK A;  1OJL A;  1EV7 A;  2STT A;  3EUH A;  1ZLK A;  2IXS A;  1HSJ A;  2Q2E A;  4I0A A;  2ZJR F;  1O57 A;  1GV5 A;  4R8H A;  5K5Q A;  3BQZ A;  2X1C A;  4S04 A;  9ANT A;  2NOG A;  1G3S A;  3IC7 A;  3QOD A;  4HAM A;  2L5Q A;  3D0S A;  1V5F A;  3U2R A;  4KMF A;  2FQ4 A;  4FE7 A;  4ZH4 F;  2GBY A;  2R7V A;  4JYK A;  2Y75 A;  4A12 A;  4BAY A;  4BH9 A;  1IN7 A;  1KU7 A;  1FYM A;  4M73 A;  4A3L J;  2JN6 A;  4PK4 A;  1Y0U A;  4LB6 B;  2P0W A;  3T8T A;  3GX4 X;  4HV5 A;  2X0L A;  2EIK H;  2ZJP F;  2VBW A;  3Q0W A;  4GGG A;  2M8G X;  1TL8 A;  4KJZ A;  3KX2 A;  4EJV A;  2WAF A;  1ZK8 A;  4IEJ A;  1SFE A;  3P5J A;  3K1N A;  2EFP A;  1L3L A;  4YIF A;  1T33 A;  2VN2 A;  2LMD A;  2E71 A;  3CTA A;  3HJE A;  4P9F A;  2DDB A;  4F55 A;  4BQO A;  3E5Q A;  2AS5 F;  4IRH A;  2Z1D A;  5CVJ A;  4Q4Z F;  2PMU A;  3MWM A;  5IP6 A;  3I55 I;  5IT9 Z;  4AIJ A;  2F5E A;  2EZI A;  2D5V A;  3F23 A;  4LFU A;  2WY7 Q;  5LBQ A;  2LH9 A;  1O4X A;  4P9U A;  4M3F A;  3QPL A;  5E1X A;  3TGN A;  3ERM A;  3L2C A;  2DA5 A;  2V1N A;  1DUX C;  5CYV A;  1A6Q A;  3NQO A;  3G3Z A;  1QZZ A;  4CH7 A;  4KNY A;  2UXX A;  1TQP A;  4HNT A;  2FBH A;  2LSO A;  1W36 D;  2XPW A;  2XAQ A;  4HV6 A;  1G3T A;  1P9Q C;  1FJL A;  4Q5S F;  3SJM A;  1YW7 A;  2DFF A;  2HR3 A;  2XAU A;  4Y7N J;  2OZU A;  5HVQ C;  5C4X J;  5HOD A;  3HKZ N;  2PG4 A;  3W2A A;  2DOA A;  4D7N A;  1PUF B;  2XF5 A;  5H20 A;  5D5U B;  3DQV C;  1QNT A;  5JLX A;  4JOM A;  1RR7 A;  2LF7 A;  4O3M A;  2XRO A;  1E2X A;  5DM6 F;  1ZLJ A;  3KE2 A;  2ZXW H;  1CF7 A;  1MJ9 A;  2EWN A;  4A0Y A;  4D9J A;  1X1C A;  4N4O B;  1REP C;  3GCM A;  2CH0 A;  3A02 A;  2R7O A;  5M5W J;  2ZXI A;  3OYN A;  1A31 A;  2MFZ A;  3SFI A;  2JA7 J;  2VXZ A;  1ORK A;  3QOP A;  3KP6 A;  4LK1 F;  4MIM A;  4C3H J;  3BWG A;  3C7J A;  4CYC A;  2DT6 A;  1J75 A;  3ZGK A;  2TDX A;  5KNL A;  3WGI A;  2OC6 A;  2L9S A;  1JUP A;  3C2G A;  3MEX A;  1ZYR F;  1YQA A;  1BJZ A;  2HTS A;  2HNH A;  1ETQ A;  2CQ7 A;  2VJI A;  2XIG A;  3WU1 B;  3K4L A;  3A01 B;  5E8I A;  1S7E A;  3K70 C;  1BC8 C;  2M4G A;  3G6E I;  3QYB A;  1LB2 A;  4YIR X;  2K02 A;  1MMS A;  3B73 A;  1DQU A;  4C2U A;  1YLF A;  1I3A A;  2IGO A;  2L7K A;  4M72 A;  1HW2 A;  1E17 A;  3BTL A;  3J7Z I;  3CJN A;  1BIB A;  3C2H A;  1UB9 A;  4OMZ A;  1ITY A;  3FXJ A;  3JSO A;  2YX4 A;  3VSL A;  3O6B B;  4XLF A;  3S3M A;  3GO5 A;  5J47 A;  2EPF A;  1S72 I;  5DCM B;  5FFZ A;  3JRG A;  3OYF A;  2XVC A;  2DYR H;  3F21 A;  3HHG A;  4IL6 C;  4XOT A;  2KDZ A;  2VI6 A;  3DBH B;  1DGR M;  1MBJ A;  1XSX A;  2AQF A;  4JK1 X;  2KZV A;  5JVT A;  1HW1 A;  1O3Q A;  1SVM A;  4G6T B;  5EZG A;  4B43 A;  3QOE A;  4CHU A;  1P92 A;  4A2U A;  3RCO A;  2K9Q A;  3IUO A;  5GAE J;  4HX4 A;  1FP2 A;  1RI7 A;  4CIC A;  2FQ3 A;  4RM2 A;  2YX7 A;  1X4P A;  2XHK A;  4GXO A;  1CGP A;  1H88 C;  2OTJ I;  3OR1 C;  5AIP A; 
#chains in the Genus database with same CATH homology
 4O5V A;  4Q47 A;  3VB2 A;  3EET A;  1W7P B;  1IN4 A;  2NYX A;  4HDV A;  3ZMV A;  3TDZ C;  3T5X A;  2A5Y B;  1OR7 A;  4G9Y A;  1Z6T A;  1ZAR A;  3ISP A;  3RDI A;  3B02 A;  3KET A;  4YFK F;  1YIO A;  2D2W A;  3E97 A;  5FLX Z;  4ZYE A;  2IJL A;  3M8F A;  2VT3 A;  3KLO A;  4MEY F;  1JGS A;  1R5G A;  3H92 A;  3LWF A;  1P4X A;  3V8L A;  1D5V A;  5LGU A;  3ECH A;  3CO6 C;  3CUQ C;  4YG2 F;  5A2Q Z;  4PZJ A;  5CVI A;  2F5F A;  4BHP A;  1R36 A;  2JPB A;  1ZG5 A;  3FF5 A;  5L3B A;  1C0W A;  1BM9 A;  2O0Y A;  4OIP F;  1SD4 A;  2COM A;  2VC0 A;  2VOD A;  2O6G E;  3GEZ A;  1QGP A;  3RKY A;  4E70 A;  4M6X A;  4GYG A;  5ILV A;  2ZNZ A;  2Z3Y A;  3LQQ A;  4UVA A;  1T38 A;  3HOT A;  2JRT A;  2O3F A;  4MTD A;  2L54 A;  2EJR A;  2JSC A;  1K78 A;  4OIO F;  2QVO A;  4WXD A;  2CO5 A;  3EDP A;  2LDU A;  3O2P E;  4UUV A;  1XB4 A;  1XCV A;  2CFX A;  3HRT A;  1Q1H A;  1MGT A;  4LG0 A;  2HTJ A;  4HOB A;  4M6Y A;  1PUE E;  3R0J A;  1YYV A;  4L5J A;  4HF0 A;  1AOY A;  3WE2 A;  1U5T B;  2OA4 A;  1HBX G;  1JHH A;  2MD5 A;  3WGG A;  2EFO A;  4IJA A;  1XGO A;  4KUM A;  3FX3 A;  4DNC A;  3IRR A;  5LLQ A;  1OKR A;  2MC3 A;  4RB3 C;  3EQL F;  3KFW X;  3I54 A;  3HYI A;  2HEO A;  4JBA A;  4OOI A;  3WTT C;  2P7C B;  3FMQ A;  4HLX A;  1HXD A;  2PI0 A;  3HOS A;  1RZ4 A;  1Z1D A;  1T0F A;  1MJA A;  1G6N A;  1FP1 D;  3K0L A;  2V1U A;  2ISY A;  3HSE A;  3L09 A;  4AIK A;  5DD8 A;  2MH2 A;  3VFZ A;  4EQQ A;  1IXC A;  3BY6 A;  2DO7 A;  2EK5 A;  4RS8 A;  4S05 A;  1R1V A;  1G3Y A;  1MD0 A;  3RJP A;  2OQR A;  3GFM A;  4IVN A;  2EV6 A;  2HWV A;  4L5I A;  1SD5 A;  3GYH X;  3CDH A;  4K2E A;  3WTV C;  3SZP A;  3IKV A;  1RUO A;  3N97 A;  4QWQ A;  3QAH A;  2Z99 A;  3KP3 A;  1U3E M;  3TO7 A;  2DW4 A;  3J7A O;  3RYR A;  1DP7 P;  1YG2 A;  3FXQ A;  3ZP5 A;  4IF4 A;  5IT3 A;  3LAJ A;  1FSH A;  4U0Y A;  5FB2 A;  1A04 A;  1V3F A;  4EJU A;  2PN6 A;  2XAJ A;  1FLI A;  2R3S A;  4ESB A;  3BPV A;  4DQ2 A;  2VOP A;  1WKM A;  5BPI A;  4MEX F;  1IF1 A;  2XAH A;  4EM2 A;  3J80 K;  1IXR C;  2G7H A;  2H6C A;  4IHT A;  1S29 A;  4WX9 A;  4HF1 A;  1FT9 A;  3E6D A;  5LGT A;  1WI9 A;  4G94 A;  2PMH A;  1XCB A;  1ODD A;  4TV7 A;  3P7N A;  3DXJ F;  1KU2 A;  2W84 A;  1R22 A;  4Y15 A;  3WE3 A;  2PEX A;  4LLG F;  3GW2 A;  3GVA A;  2CSO A;  5ICC A;  2A61 A;  1I27 A;  1K6O A;  2OBP A;  3ZMS A;  4EMS A;  4KIC A;  4FHT A;  3JAM K;  1S6L A;  2VE9 A;  3V7S A;  4XSZ F;  3KP5 A;  1ZGJ A;  2IA0 A;  1JHF A;  3JTH A;  5DD4 A;  3KP7 A;  3ZMU A;  4EVI A;  2H09 A;  2YU3 A;  2HFH A;  5D5W B;  1RIO H;  4LGW A;  3ROU A;  2HZT A;  2Z5U A;  4L9N A;  2AXL A;  3MZH A;  3TO6 A;  2ISZ A;  3CUO A;  2PBI A;  1KYZ A;  3F8C A;  3RIR A;  2LKP A;  1QBJ A;  2ZO4 A;  4RB0 A;  2E1N A;  2H6B A;  3C18 A;  5DDG A;  5ICG A;  3LA3 A;  5F6F A;  3ZMD A;  1ZRC A;  4LD5 A;  2DFI A;  1ON1 A;  2WV0 A;  3COA C;  3I59 A;  5H6R A;  2HOE A;  4L0Y B;  1FBS A;  3U9G A;  3ZN0 A;  1ZGA A;  3LQR A;  1U5T C;  1IN5 A;  2FMY A;  1KU9 A;  1XN7 A;  3GLX A;  4LJZ F;  4F7Z A;  2FBI A;  4YFN F;  3ERE D;  1F9N A;  1W4M A;  2WTE A;  4XLP F;  3O3K A;  1O3T A;  5LRR A;  1U6G A;  2RV8 A;  1XDU A;  1H0M A;  4ENN A;  2KRF A;  3V4G A;  4BQA A;  3P9I A;  1WWX A;  5F64 A;  2G7U A;  3RKX A;  4CO8 A;  5HOO A;  3CUQ A;  3WOD F;  2QQA A;  3SZT A;  3SXY A;  5CVR A;  1H9G A;  2FML A;  1K7A A;  3IRQ A;  3E6C C;  1R1T A;  2KKO A;  4EGZ A;  1YS6 A;  2G9W A;  1BBY A;  2P6T A;  3GFL A;  3V8K A;  2IP2 A;  3KP2 A;  4MGR A;  1IZ1 A;  2IW5 A;  1UFM A;  2P8T A;  4MTE A;  2VBZ A;  3DPL C;  3FMR A;  1BN5 A;  4BYY A;  1JE8 A;  1S7A A;  2L4M A;  1FNN A;  3T1B A;  1ON2 A;  3K1P A;  3ZPL A;  2X4H A;  2BV6 A;  1IN6 A;  2ESN A;  4RGX A;  1B59 A;  1LDJ A;  1USS A;  2FOK A;  1T39 A;  2OU2 A;  4OIQ F;  4LB5 A;  2FU4 A;  5L3C A;  2ZME B;  4UHT A;  3BPX A;  5J8F A;  2ETH A;  2K7L A;  1P6R A;  4KN7 X;  2GZW A;  1L0O C;  4EJT A;  1OMI A;  5FD5 A;  5JR3 A;  2KIM A;  2V6C A;  4Q48 A;  5BQT A;  2KIU A;  5L3G A;  2FNA A;  1EH7 A;  3ECO A;  4CDG A;  1MJB A;  2QQ9 A;  1MZB A;  2XUB A;  3AAF A;  1BI0 A;  1Z7U A;  2P7V B;  4A0X A;  1EH6 A;  1P2F A;  3J80 Z;  4KT5 C;  2HQR A;  4AWX B;  4ZYD A;  5K5R A;  3PQJ A;  4CGZ A;  3HHH A;  4AIH A;  1HKQ A;  3GFJ A;  2D45 A;  2CWE A;  4L18 B;  5BS6 A;  1MDM B;  2ELH A;  1J0R A;  2HDC A;  4KIB A;  2A07 F;  3WGH A;  1NHA A;  1LEA A;  3M1E A;  2F5C A;  4CZZ A;  2XKP A;  5ICE A;  1FOK A;  2R7F A;  1OYW A;  1Z6R A;  4UNO A;  1W5S A;  5ILU A;  5HS8 A;  3NEU A;  2K4B A;  1K79 A;  3LST A;  2W24 A;  2KJB A;  5CVV A;  2Q0O A;  1KU3 A;  1FY7 A;  3JAM Z;  1ZN2 A;  2VC1 A;  5DYM A;  3SFZ A;  3GZ5 A;  5DCM A;  4MHG A;  4KYW A;  1I1S A;  3VEP A;  1SFX A;  4XBF A;  1H9T A;  2UWM A;  1X3U A;  2WC2 A;  3I71 A;  3HRM A;  4WXC A;  2R7D A;  2GQQ A;  6PAX A;  3P9K A;  2KJC A;  2O61 A;  3TOA A;  2XAS A;  3BZ6 A;  3IHU A;  3K1M A;  4HX7 A;  1AWC A;  2QEN A;  1W7P A;  3M9A A;  3OOP A;  5HS9 A;  2EFN A;  4HQE A;  2DQL A;  3LA2 A;  1LQ1 A;  2MBF A;  1U2W A;  2J5P A;  4Z2Y A;  2L3D A;  1W5T A;  5TRD A;  3FHZ A;  2FSW A;  3D5L A;  1RUN A;  4RAZ A;  1T6S A;  5DCF A;  2OAZ A;  5KVR A;  5ED4 A;  3CO7 C;  5BOX A;  5KK1 A;  3TO9 A;  2W57 A;  2DBB A;  2FBK A;  2BEO A;  4WWC A;  3KCC A;  3W6K B;  1TNS A;  4BHB A;  4UV9 A;  1U8R A;  4ESF A;  1HST A;  1FSE A;  1KQ0 A;  1XSV A;  2E7X A;  3WTZ A;  4ENM A;  3I64 A;  4XLN F;  2P5L C;  4I02 A;  3U1D A;  1U78 A;  2Y0M A;  5AIQ A;  2GAU A;  3K9T A;  2FA5 A;  2A69 F;  2QBY B;  2XKO A;  1I5Z A;  4P55 A;  4ESJ A;  4ETS A;  4CYD A;  2FEZ A;  4BXU A;  1TBX A;  4IRG A;  2NS0 A;  2ACJ A;  1DPU A;  2PQ8 A;  3HRS A;  4UVB A;  3ZMT A;  2GIV A;  5TJJ A;  4WF2 A;  1RNL A;  2RVC A;  1B4A A;  2P4W A;  1FX7 A;  2IVM A;  4G6D A;  2MLG A;  4GYI A;  1XDS A;  1O3S A;  3EYI A;  1U5T A;  2HYG D;  5D5V B;  5HLI A;  3EYY A;  2K27 A;  4BHC A;  2VT2 A;  3I0T A;  3E6B A;  4HX8 A;  3R6S A;  5AON A;  1I6X A;  2IT0 A;  3FZV A;  2EV0 A;  1LJ9 A;  2M30 A;  3BJ6 A;  4Y13 A;  5HDG A;  2A6H F;  2DQR A;  5DUK A;  1YTY A;  1BI3 A;  3L9F A;  3VOD A;  1J2X A;  3GWZ A;  4LMY A;  2RGV A;  2V79 A;  3E5U A;  2EA4 A;  2EA2 A;  3KP4 A;  5HS7 A;  2O03 A;  1FYL A;  2D1H A;  3QU3 A;  2HYF A;  1P4A A;  4RGU A;  3WTY C;  5E8G A;  1LNW A;  5K1Y A;  3DV8 A;  1R00 A;  2P5K A;  3KEQ A;  3LFK A;  1XD7 A;  4IRI A;  2MLK A;  4U7B A;  2A3S A;  4I01 A;  1GVJ A;  2FE3 A;  5L3D A;  1YW8 A;  1HQC A;  4A6D A;  5H6Q A;  2M8E A;  4NQW A;  4NB5 A;  5ILS A;  4I0B A;  4P96 A;  4YFX F;  3NRV A;  4MNU A;  3F3X A;  4M9Z A;  5LEK A;  3ABT A;  1LDD A;  2V1X A;  2E1C A;  3F8F A;  2ZXJ A;  3BJO A;  1F4K A;  4ZYH A;  1IW7 F;  4FT8 A;  4GO1 A;  2FXA A;  3DP7 A;  1HW5 A;  1JXS A;  3E6M A;  4AD9 A;  4G8X A;  2GXG A;  2K86 A;  3I58 A;  2QM3 A;  4N0B A;  3TKY A;  5D6E A;  3JTG A;  1R23 A;  1G3W A;  3V7R A;  1DPR A;  2DPD A;  4G6Q A;  1ZHF A;  2NAZ A;  3K2Z A;  1XGM A;  1ZG1 A;  1IN8 A;  2QYO A;  3GF2 A;  3KLN A;  1ZRE A;  4HDU A;  2QUF A;  2Q8K A;  3FM3 A;  1ZRD A;  4R1H A;  1B6A A;  1DDN A;  2HKX A;  1PDN C;  2L02 A;  3KZY A;  2GA2 A;  1SMY F;  2B0L A;  2C6Y A;  1KQ8 A;  1FBQ A;  1KYW A;  1MKM A;  2JTV A;  2IRF G;  4M9X A;  3WU0 A;  1J9I A;  4HBL A;  1D8K A;  1ZRF A;  1HKS A;  3F6V A;  2RC4 A;  4KDP A;  3HUG A;  4N9H A;  1TQI A;  3L00 A;  4Y17 A;  4RB1 A;  2NRA C;  1SD6 A;  3JSP A;  3CUQ B;  4I7H A;  5HDK A;  4U0V A;  4H0E A;  1BC7 C;  5HDN A;  2GWR A;  5HLG A;  3DPT A;  2ESH A;  3BOQ A;  2JPC A;  5DUI A;  3F72 A;  2RQP A;  4L9V A;  4JQF A;  1ULY A;  2HS5 A;  3DFG A;  2H94 A;  2CGP A;  3F6O A;  1R1U A;  3F8B A;  1T2K A;  1UHM A;  3E5X A;  2RN7 A;  5DEQ A;  1IUY A;  1O7L A;  1CF7 B;  4ENJ A;  2M45 A;  1R7J A;  5HLH A;  4KIG A;  2PFB A;  3ZQ7 A;  1XGN A;  3R0A A;  2L4A A;  4O6J A;  3HSF A;  2XRN A;  3ZMZ A;  2DT5 A;  1XGS A;  2FF4 A;  2BYV E;  3KEO A;  5D8K B;  3FM5 A;  3R61 A;  5BPD A;  1YW9 A;  3KZZ A;  1W7P D;  4XSX F;  4L9T A;  4BNC A;  1LDK B;  2VE8 A;  1YS7 A;  3MQ0 A;  2YR2 A;  2V1D A;  2ZFW A;  3ULQ B;  2K4J A;  3H3U A;  2W25 A;  1FZP B;  1GHC A;  2W85 A;  3I53 A;  2DK8 A;  2Z9O A;  3BP8 A;  1TQM A;  4OIR F;  3HSR A;  4G7H F;  1QQI A;  2OQG A;  1D8J A;  3R4K A;  3OV8 A;  1T98 A;  3DF8 A;  1BI1 A;  3V8J A;  3BRO A;  3CLO A;  3SHF A;  5EEG A;  4LLL A;  1FBU A;  3J81 K;  3QU6 A;  2H27 A;  4HZF A;  3HTS B;  1HKT A;  1WSU A;  4LK0 F;  2BE5 F;  2RDP A;  1KA8 A;  4G7Z F;  3PQK A;  3F8N A;  1Z9C A;  5L3E A;  3V7C A;  2STW A;  1Z91 A;  2XAG A;  2ZME A;  1PP8 F;  3RKW A;  2ZBK A;  2XV4 S;  5LHH A;  2PLY A;  3K69 A;  3T0Y A;  2Z33 A;  3C1D A;  3L7W A;  3QP5 A;  2QWW A;  3RTR A;  4N9I A;  1D3Y A;  1XSD A;  4HYE A;  2ZCW A;  4CXF A;  2M1B A;  5CLS A;  3RYP A;  2GA1 A;  1VTN C;  2ZJ2 A;  2F5D A;  2OZ6 A;  1FPQ A;  4ON0 A;  2CYY A;  1WQ2 A;  3C3W A;  2QZ8 A;  1F1Z A;  3GUD A;  5JFR A;  1UST A;  1K78 B;  1TW3 A;  1BI2 A;  4EJO A;  1QPM A;  2DU9 A;  5D4S A;  4ZZL A;  4L0Z B;  2OD5 A;  1J5Y A;  4I2O A;  2EFQ A;  4LG0 B;  3P9C A;  2BGC A;  1MDM A;  3F22 A;  4P5O A;  2D1V A;  4U0W A;  4UVC A;  2P6S A;  4FX0 A;  2ZKZ A;  4EJW A;  1BIA A;  3FXR A;  2M87 A;  4U88 A;  1B9N A;  3F8M A;  1I1G A;  2M5W A;  3QPH A;  5CVU A;  1F5T A;  4I98 B;  2UZK A;  1B1B A;  1TNT A;  1LEB A;  2HKO A;  1ONV A;  4KFC A;  4HQM A;  2XAF A;  4GCV A;  4OU0 A;  5LRS A;  1KGS A;  3Q5F A;  1STZ A;  4EGY A;  3WTW C;  2A68 F;  4XRF A;  2XGX A;  4M9S A;  4RGR A;  2DI3 A;  5LHI A;  2LNB A;  4ZZD A;  3WTU C;  1UCR A;  5D4R A;  5E1W A;  5JI6 A;  2QQB A;  4LLN A;  5E1Z B;  3I4P A;  3TDU C;  2CG4 A;  2L01 A;  2J5O A;  3IWF A;  5E20 A;  3W6J B;  3MFK A;  4IPA A;  2IA1 A;  3GZ6 A;  1EH8 A;  3MCZ A;  4PCQ A;  3VOE A;  3SQN A;  2ADU A;  4ASN A;  2FNP A;  4A6E A;  3ZN1 A;  2Y48 A;  4KN4 X;  5JHU A;  3GFI A;  4D0P A;  4EM1 A;  2BBY A;  1SFU A;  5FD6 A;  3TQN A;  4ZYG A;  4RGS A;  4ENK A;  1SMT A;  3WTS C;  4A0Z A;  2VOO A;  2LF8 A;  1QZY A;  1FWZ A;  2HGC A;  2YSR A;  5IT9 K;  1J7K A;  2EB7 A;  2NNY A;  5F1R A;  3ABU A;  2VBX A;  3M8E A;  3PFI A;  2F2E A;  4IXA A;  3FXU A;  3IL2 A;  1J59 A;  3HIF A;  1SD7 A;  3T8R A;  3FWE A;  2E7W A;  1IXS B;  4KMU X;  1QO0 D;  1IRG A;  2YPR A;  4RB2 C;  3RI4 A;  5LEJ A;  1IAW A;  2DTR A;  4FX4 A;  5LHG A;  4A5M A;  4L9J A;  4IHS A;  4I09 A;  4YII A;  3BDD A;  1XMA A;  1B9M A;  4KIF A;  3GXO A;  1BJA A;  3ML6 A;  2EFW A;  4WK8 F;  3N4M A;  3E3V A;  1S8N A;  4OMY A;  1ZAO A;  2QBY A;  3IKT A;  4R79 A;  2IA2 A;  3QPT A;  2MH9 A;  1YFH A;  4HW0 A;  2WWY A;  2JT1 A;  2DPU A;  2CQK A;  5LGN A;  3J81 Z;  3R60 A;  4HA8 A;  3H3Z A;  2GXB A;  1O3R A;  2VON A;  1WRJ A;  4HF2 A;  4QLC U;  2RKH A;  2ZNY A;  2KIF A;  1TTY A;  1SAX A;  5FFX A;  4RAY A;  3WG9 A;  1UHW A;  2P5V A;  3G73 A;  3HRU A;  3MAJ A;  5D6F A;  1PP7 U;  1R58 A;  4PDK A;  5FO5 A;  2A6E F;  4PGH A;  4B8X A;  3BJA A;  1G4D A;  4UXN A;  3DKW A;  4KA4 A;  2DK5 A;  2EV5 A;  4M71 A;  5E18 F;  4OIN F;  5BMZ A;  4AVP A;  1FC3 A;  1Z05 A;  1YO5 C;  3S2W A;  4A5N A;  3TOB A;  4EM0 B;  2MA3 A;  1BOA A;  2IPQ X;  2HQN A;  1OYI A;  2DLL A;  4HLY A;  5L3F A;  2VBY A;  4M74 A;  1P4W A;  3HTU A;  3WTX C;  2V9V A;  1S7O A;  4WCG A;  4UV8 A;  1TLH B;  3I59 B;  3RPQ A;  3LA7 A;  2QLZ A;  5J8C A;  3JW4 A;  1V4R A;  1KQ9 A;  5FLX K;  1ZG3 A;  3RPU A;  2NNN A;  1OPC A;  2DAO A;  3MZY A;  4MQ9 F;  2RNJ A;  3QRF F;  4NHJ A;  4MQV A;  4WXH A;  4EV0 A;  3LAP A;  3M7G A;  3Q9S A;  5K5O A;  4PGG A;  5DV5 A;  2CW0 F;  5FGM A;  1OYY A;  1S3J A;  5A2Q K;  3FMS A;  5D5X B;  1O7F A;  1XMK A;  1LVA A;  3Q9V A;  2FRH A;  1GXQ A;  2O8X A;  4U7D A;  2UXN A;  5EEH A;  1ZH5 A;  5J6X A;  2JZY A;  5D8L B;  5ICF A;  3ELK A;  3IWZ A;  5E17 F;  3QP6 A;  1TW2 A;  2PJP A;  3I5U A;  3REO A;  1IRF A;  3DEU A;  1GXP A;  4G7O F;  4B09 A;  5CJ9 A;  1R5H A;  5ERI A;  1FYK A;  2STT A;  1EV7 A;  3EUH A;  1ZLK A;  1HSJ A;  2Q2E A;  4I0A A;  1O57 A;  4R8H A;  5K5Q A;  4S04 A;  3IC7 A;  1G3S A;  4HAM A;  3D0S A;  3U2R A;  4KMF A;  4ZH4 F;  2Y75 A;  4A12 A;  4BAY A;  4BH9 A;  1IN7 A;  1KU7 A;  1FYM A;  4M73 A;  4LB6 B;  1Y0U A;  3T8T A;  3GX4 X;  4HV5 A;  2X0L A;  2VBW A;  4GGG A;  4EJV A;  1SFE A;  3K1N A;  2EFP A;  1L3L A;  4YIF A;  2VN2 A;  4P9F A;  3CTA A;  2AS5 F;  3E5Q A;  4IRH A;  5CVJ A;  4Q4Z F;  2PMU A;  3MWM A;  5IT9 Z;  4AIJ A;  2F5E A;  3F23 A;  4LFU A;  5LBQ A;  4P9U A;  5E1X A;  3TGN A;  3L2C A;  1DUX C;  5CYV A;  3NQO A;  3G3Z A;  1QZZ A;  4KNY A;  2UXX A;  1TQP A;  2FBH A;  2LSO A;  2XAQ A;  4HV6 A;  1G3T A;  4Q5S F;  1YW7 A;  2HR3 A;  2OZU A;  5HVQ C;  2PG4 A;  5H20 A;  5D5U B;  3DQV C;  1QNT A;  2LF7 A;  4O3M A;  2XRO A;  1E2X A;  1ZLJ A;  3KE2 A;  1CF7 A;  1MJ9 A;  2EWN A;  4A0Y A;  1REP C;  2VXZ A;  3QOP A;  4LK1 F;  3KP6 A;  3BWG A;  3C7J A;  1J75 A;  2TDX A;  3WGI A;  3MEX A;  1ZYR F;  1YQA A;  2HTS A;  2XIG A;  3WU1 B;  5E8I A;  1BC8 C;  1LB2 A;  2K02 A;  3B73 A;  1YLF A;  4M72 A;  1HW2 A;  1E17 A;  3CJN A;  1BIB A;  1UB9 A;  4OMZ A;  3JSO A;  2YX4 A;  3O6B B;  3GO5 A;  5DCM B;  5FFZ A;  2XVC A;  3F21 A;  3HHG A;  1XSX A;  4JK1 X;  5JVT A;  1HW1 A;  1O3Q A;  4CHU A;  1P92 A;  4A2U A;  4HX4 A;  1FP2 A;  1RI7 A;  4CIC A;  2FQ3 A;  2YX7 A;  2XHK A;  4GXO A;  1CGP A;  5AIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...