2OBPA

Crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
b'GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA-binding protein
publication title Crystal structure of putative DNA-binding protein (YP_298295.1) from Ralstonia eutropha JMP134 at 1.70 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Dna binding protein
total genus 23
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2obpA00
3PQKA 4QLCU 5BPIA 5LHHA 2RV8A 1QQIA 3V8JA 1FP1D 3FF5A 2DI3A 2D2WA 2F5FA 3T5XA 5E18F 1Z6TA 3JAMK 3RYPA 2FA5A 1I6XA 4OIOF 4HLYA 4A2UA 4UVAA 5D5XB 3RI4A 3CO7C 2RN7A 2OZUA 1FBQA 4L9TA 1S6LA 4KMFA 3H92A 3KP6A 4ETSA 1FSHA 5BS6A 1KQ9A 1PP7U 4XLNF 2V6CA 2VT3A 5HS9A 2XAGA 3GZ5A 5FD6A 3WU0A 2K02A 3J80Z 4LMYA 5D8LB 4IRIA 4ESFA 5CYVA 3ZQ7A 4L5IA 1UCRA 3Q9VA 1MDMB 3QPHA 1RIOH 3HSEA 5L3CA 4Y17A 5DCMB 1SAXA 3HTUA 1MJBA 3KLNA 5CVIA 4YFKF 1R1VA 5BOXA 4OU0A 3PQJA 2EK5A 4ZYEA 1BJAA 5DD4A 2IPQX 2O0YA 1FBSA 3ZMUA 3J81Z 4KMUX 2A5YB 5J6XA 2VC1A 5IT3A 1L0OC 2D1VA 4P9UA 2COMA 2HKOA 1IXSB 2KJCA 1EH7A 2VBXA 3K1PA 3MWMA 1BC7C 2OZ6A 3RKYA 2L54A 4AIHA 4F7ZA 2DU9A 3R4KA 2K86A 3ZMSA 2JPBA 3P9IA 1HKQA 1W5SA 1J75A 5LLQA 4NB5A 4MQ9F 1YTYA 5FGMA 4R8HA 1O3QA 1QGPA 3F8MA 2BE5F 2Z5UA 2P4WA 3L09A 2OD5A 5E8GA 4IF4A 1XDSA 1XGOA 2WC2A 4IHTA 3WTSC 3ULQB 2MLKA 3IKVA 4OIPF 3R61A 2V1DA 1H9TA 1KYWA 1EH8A 2M87A 1SFUA 3GYHX 1T98A 2L3DA 1FZPB 2AS5F 3JAMZ 5D4RA 1MJ9A 1RZ4A 3E6MA 4N0BA 1U8RA 4OIQF 3WGGA 4A0XA 4BXUA 5HLHA 5K5QA 1RUNA 3EYYA 2EV0A 1J9IA 2KKOA 4LLGF 2FQ3A 4HX8A 3VOEA 4AIJA 2VONA 3DF8A 1P2FA 1I27A 2IP2A 4QWQA 3ABUA 1EH6A 3FWEA 4WWCA 3WGIA 4A6DA 4UXNA 1MGTA 4GYGA 4MEYF 2HGCA 3K1NA 1MD0A 5JR3A 3B02A 3CUQA 4L0ZB 5HDKA 3KEOA 5BMZA 2QUFA 3N97A 3BZ6A 1ZAOA 3AAFA 5DUKA 1HBXG 3I58A 4FT8A 4ENJA 3ZMVA 4U0YA 5CVRA 3IRQA 4I0AA 4U0WA 1PUEE 5E1XA 5E8IA 3M8EA 4PDKA 1XN7A 2UXNA 2W85A 3QOPA 2L01A 1R22A 2M5WA 3BWGA 3BPXA 3DQVC 5H6QA 5BPDA 1IXRC 3TO6A 1IZ1A 1H9GA 4EJUA 3L00A 4CZZA 1XMAA 3E3VA 4WF2A 4G6QA 3F23A 4ENMA 4AIKA 1K78B 4HV6A 5F1RA 3BPVA 3TKYA 3ML6A 2QM3A 4BYYA 3TQNA 5D5VB 1YYVA 4RGRA 2FU4A 2YU3A 1E17A 4ZZLA 4PCQA 2GA1A 4ZYGA 5ILUA 5HOOA 3H3UA 5ICFA 1Z9CA 1B1BA 4MTEA 1BI0A 4R79A 1G4DA 2V79A 3HYIA 2HQRA 2EWNA 3B73A 1G3YA 4M73A 4P55A 2Y75A 4PZJA 5ILSA 1J59A 3E5UA 1TQIA 1PP8F 1QO0D 4U7BA 2HQNA 5LGUA 1W5TA 3C1DA 2ACJA 1FLIA 3V8LA 1YW8A 4LG0B 3HTSB 2KIFA 3WODF 5ERIA 1W4MA 2DBBA 3DEUA 3C7JA 1LB2A 4LJZF 2ZCWA 4HF0A 4M9SA 1HW5A 4DQ2A 5HVQC 1ON1A 2FBHA 2FXAA 5FB2A 2RC4A 4HQEA 5KVRA 1IXCA 4DNCA 1V4RA 1FYLA 4HF2A 2NS0A 5D6FA 3QP5A 3I64A 2UWMA 3IHUA 3HRMA 1QZYA 3DV8A 1OYWA 3E6DA 5LRRA 2RDPA 4ZYHA 1LEBA 5JI6A 3O6BB 1OYYA 2VN2A 1BI3A 3ZN1A 2ZMEB 1FPQA 3I4PA 1SMYF 5E1WA 2QWWA 3PFIA 4NQWA 3REOA 2EA2A 4HDUA 5F64A 4XLPF 2A68F 1S7AA 5H20A 4Q5SF 2IA2A 2VOPA 3M9AA 2ZJ2A 2K4JA 1FP2A 4UVBA 1YFHA 3LA3A 4ESBA 5TRDA 2MBFA 1TTYA 3I54A 1FYMA 2PQ8A 4OMZA 2ISZA 2P5VA 1ZGJA 3FMQA 1MKMA 4I09A 2WWYA 4HYEA 4MQVA 1WI9A 3TOBA 3L7WA 4HX7A 3WTTC 2VC0A 5FFZA 2F5CA 2M30A 1SD6A 2HWVA 1UFMA 3KP2A 1XCVA 4P5OA 1FOKA 1HKTA 4O5VA 3GWZA 5ICGA 2R3SA 5L3EA 1BIBA 2ADUA 3EQLF 2W24A 1BC8C 2Z9OA 3T8RA 1TW3A 3DFGA 1JE8A 4UV8A 3MCZA 2EB7A 2L02A 4O6JA 4R1HA 2QQ9A 5K5OA 1S8NA 3O2PE 3M8FA 1J5YA 1ZRCA 2QLZA 5HDNA 3I0TA 3RKWA 3JTGA 1U6GA 2O61A 1P4AA 4L0YB 1W7PA 3WTYC 2D1HA 3DKWA 2HDCA 1YG2A 1R7JA 1S7OA 1HXDA 4EV0A 2XAFA 3FMSA 2ESNA 4L5JA 2CG4A 2PJPA 2OAZA 4Q47A 1GHCA 2QYOA 1R1TA 4YG2F 1XD7A 3IL2A 1R36A 4ESJA 1D8KA 3DPTA 3I53A 3F22A 2IVMA 2Y48A 2OU2A 1HSJA 4HBLA 2YPRA 3W6KB 3GO5A 3U9GA 1XSXA 1Q1HA 2NRAC 5JFRA 2JT1A 3DPLC 3HSFA 4I98B 2Z99A 1LNWA 1Z1DA 4UUVA 1Z05A 2FBKA 1X3UA 3O3KA 2G9WA 4U88A 5FD5A 5TJJA 4M9XA 2G7UA 2KIUA 2IRFG 3LWFA 3CTAA 2ESHA 5H6RA 1U2WA 1LEAA 3IRRA 2EFPA 2FF4A 2MH2A 3N4MA 2NNYA 5KK1A 1BM9A 4M71A 4KIGA 2H6CA 2HOEA 2MD5A 4A5NA 2H09A 2GAUA 2IW5A 3BJAA 1FY7A 4AWXB 2FMYA 3MEXA 1QPMA 2STTA 2E1CA 2O6GE 2XRNA 3V8KA 4TV7A 2O8XA 1FSEA 2XKPA 3CUQB 1DDNA 2KJBA 4MGRA 3RPUA 4KICA 1ZGAA 3T0YA 2ZBKA 5J8FA 2PEXA 2UXXA 1XSDA 3BP8A 4LB6B 2CWEA 3SXYA 1J0RA 1B4AA 4KFCA 4Y13A 1UHWA 4MNUA 2OQRA 4N9HA 2Z33A 1OR7A 3F8FA 3LFKA 2QBYA 2VBWA 4KIFA 1TBXA 2Y0MA 1BOAA 1OMIA 1ZARA 2LF8A 2W25A 1W7PD 1S3JA 1BN5A 3I59B 4IRHA 3LA2A 4WCGA 5F6FA 4HLXA 4LLLA 3WE3A 2STWA 5LGTA 3F6OA 2X4HA 3M1EA 3JSOA 2CQKA 3LQQA 1T39A 4CXFA 3U1DA 4LD5A 2X0LA 4HAMA 1J2XA 1B9MA 3QRFF 4RGUA 3WTXC 4RGSA 1BI1A 2BBYA 2W57A 2A6EF 3C18A 1MDMA 1YQAA 2DQLA 2OA4A 3RDIA 2IA0A 2DFIA 3MAJA 3KE2A 1IF1A 1KU7A 4PGGA 3EUHA 1YW7A 5D5WB 1U5TA 2Q0OA 2EA4A 1SFEA 4RB2C 1FWZA 2YX7A 2B0LA 2KRFA 1I5ZA 4OIRF 4LK0F 2CFXA 2MC3A 2ZKZA 4OMYA 3LAJA 2ELHA 3WTWC 2P7VB 5CJ9A 2ETHA 2VE8A 1AOYA 1SD5A 3JW4A 3ERED 3EETA 2EJRA 3F21A 3QP6A 1D8JA 4YFNF 5E1ZB 5L3BA 2H6BA 4RGXA 4Q48A 3E5QA 1T6SA 3V4GA 4M6YA 3ZMDA 5AIQA 4O3MA 1FC3A 4L9NA 2PN6A 3LQRA 1O3TA 5HS7A 4BHPA 3ZMTA 2DTRA 4L9JA 2XVCA 1DPUA 4A6EA 1XB4A 4KA4A 3FM3A 1Z6RA 1F1ZA 2H94A 3RTRA 1P4XA 4CO8A 2RKHA 2OBPA 1PDNC 4EMSA 3IKTA 2YX4A 1DUXC 4RB1A 4G7HF 1ZRDA 2ZFWA 5LHGA 2BEOA 1B59A 1YLFA 1ZG5A 2XAQA 4JK1X 4Q4ZF 4Z2YA 2LDUA 4PGHA 4I0BA 2L4AA 3ECOA 4IHSA 2KIMA 3V7SA 4G9YA 2E7WA 4L9VA 4LB5A 3FXQA 1P92A 1VTNC 1BI2A 3WTUC 3FZVA 1KU2A 3QPTA 3KEQA 1FX7A 3R0AA 3TDUC 1QZZA 2F2EA 2FSWA 2DPDA 5ICEA 4CGZA 1KU3A 1FNNA 1TLHB 4EGZA 1SD4A 1F5TA 1TQMA 2ISYA 2RVCA 3CUOA 4FX0A 4WK8F 2NYXA 4ZH4F 4P96A 2PLYA 2M8EA 1KA8A 4EM2A 4K2EA 4LK1F 2R7DA 1DP7P 4YIIA 1R58A 2GWRA 2P5LC 2F5DA 4A5MA 4Y15A 4U7DA 4G8XA 1R23A 1D3YA 4UHTA 3BOQA 1KQ0A 4ENNA 2GXGA 1ZYRF 3D5LA 2V1XA 1D5VA 3JSPA 3HOSA 3GF2A 1HW2A 2XAJA 1B9NA 5DV5A 4HDVA 1IN4A 4G7ZF 3G3ZA 3K0LA 3HRUA 2CYYA 2CW0F 1UB9A 5DUIA 4RB3C 4IPAA 1JHHA 1ZREA 3COAC 1SMTA 3ZP5A 4ASNA 4U0VA 2XROA 3V7RA 4YIFA 2VE9A 3V7CA 1XCBA 3RPQA 1H0MA 3GFLA 4LLNA 2XUBA 2VBZA 5DDGA 5D5UB 4S04A 2K4BA 3RJPA 1WQ2A 1I1SA 4D0PA 2VODA 2HYGD 2W84A 1Z91A 1EV7A 2RGVA 2K27A 2FNPA 4ZZDA 2V1UA 2FOKA 1I1GA 4E70A 1OKRA 5HLGA 4IRGA 4AVPA 4UVCA 3KETA 3ECHA 2HS5A 1YS6A 5HDGA 2HTJA 4I2OA 5IT9K 4IXAA 2IT0A 2P5KA 3WTZA 2ZO4A 4EM0B 2BGCA 3MQ0A 4A0YA 3H3ZA 4M72A 1MJAA 4NHJA 2J5OA 3DP7A 1GXQA 1ZLJA 4RS8A 1ZG1A 3HHHA 1G3WA 4WXDA 5CVUA 1LDDA 1ZH5A 3FX3A 1HQCA 1IN5A 1IW7F 1TNTA 2OQGA 4FX4A 2HYFA 4HF1A 4OINF 3KZZA 4HV5A 1C0WA 4I7HA 2H27A 3Q5FA 2DK5A 3F8CA 5D4SA 4EM1A 4N9IA 3F3XA 1XSVA 5L3GA 3KP7A 3FM5A 3GVAA 4HX4A 1ULYA 2K7LA 2QBYB 1MZBA 3KP5A 3QU3A 5LBQA 3E6BA 5D8KB 4B8XA 2QENA 2O3FA 3QAHA 4XSZF 3TO9A 1WKMA 3SFZA 2FRHA 1U5TC 4BAYA 3CJNA 2A61A 1CF7A 1IUYA 4MEXF 1HW1A 1DPRA 2ZMEA 1USTA 2QQAA 1YO5C 1FYKA 1LDKB 5K5RA 2PMHA 4IVNA 2HKXA 3CUQC 2NAZA 3ABTA 1NHAA 2A3SA 1B6AA 5HS8A 4M6XA 5CLSA 3U2RA 2LKPA 5ED4A 2EFOA 1A04A 1ZLKA 2VXZA 2ZNZA 3QU6A 3CLOA 3WU1B 1R5GA 3R0JA 5DD8A 3ROUA 1O3RA 1JXSA 4EQQA 1U5TB 2XKOA 3L2CA 1O7FA 3LAPA 2GA2A 3SHFA 2GQQA 1TQPA 3SZPA 2HEOA 1R1UA 3IWFA 5AONA 2IJLA 4I02A 3ZN0A 5IT9Z 5LRSA 3SZTA 3NRVA 1Y0UA 3NEUA 1IN8A 1STZA 2ZXJA 3BJ6A 1YIOA 4B09A 4OOIA 2JPCA 3L9FA 3FMRA 2LNBA 2E1NA 4RAZA 4KN4X 1YS7A 1O57A 4A0ZA 1G6NA 1F9NA 2HR3A 3BJOA 1BBYA 4WX9A 3E97A 3T1BA 3TO7A 3FXRA 3MFKA 2Q8KA 3HSRA 4I01A 3GX4X 2RQPA 3GLXA 3EYIA 3VEPA 5EEGA 1USSA 1LDJA 4AD9A 2QQBA 4HQMA 4BH9A 4EJOA 2HTSA 2XAHA 1K7AA 1TW2A 4EJVA 3OOPA 2UZKA 1FT9A 1LQ1A 5E17F 1ON2A 2EV5A 5LHIA 2R7FA 4UV9A 5A2QK 1CGPA 4JBAA 1YW9A 3GFIA 5LGNA 4BHBA 4HZFA 2XIGA 3BY6A 4XRFA 5DCMA 4GCVA 2GZWA 4P9FA 5K1YA 3K1MA 5DEQA 1P4WA 6PAXA 1XMKA 4XSXF 4KYWA 1OPCA 3K69A 2O03A 1ONVA 2G7HA 3HRTA 4G94A 3IWZA 1JHFA 2M45A 1XDUA 3OV8A 1GVJA 3GW2A 3J7AO 1BIAA 4BQAA 1K79A 2WV0A 4EJTA 1HKSA 2EFQA 4MTDA 1REPC 3WE2A 3GUDA 4HW0A 2GXBA 1TNSA 3KFWX 2A6HF 2Q2EA 3M7GA 2FE3A 1SFXA 2A69F 4HOBA 5HLIA 3LA7A 4CYDA 2P6TA 2EV6A 2XGXA 4EJWA 3VB2A 2C6YA 4LGWA 5LEJA 3EDPA 2P8TA 2DO7A 4IJAA 1WSUA 4LFUA 5FLXK 4KNYA 1LJ9A 1K6OA 1V3FA 4M74A 4M9ZA 1AWCA 3F72A 1GXPA 1XGMA 1ZG3A 3WTVC 3KLOA 3ISPA 3I59A 2LF7A 4ENKA 3RKXA 1KYZA 3JTHA 3BDDA 3KP4A 2A07F 2F5EA 4KN7X 4CICA 1S29A 2EFNA 5D6EA 3NQOA 3P7NA 3VFZA 2JTVA 3HOTA 3R6SA 4CHUA 2PBIA 2DT5A 2DW4A 4G7OF 1KGSA 2MH9A 3I5UA 2PMUA 3GEZA 1ODDA 3TDZC 4L18B 2MA3A 5A2QZ 5J8CA 3K2ZA 4RAYA 3HUGA 2BV6A 4GO1A 1IAWA 4A12A 3D0SA 3KCCA 1XGSA 2D45A 2VBYA 5JVTA 4BHCA 2EFWA 5L3DA 1ZHFA 3T8TA 2P7CB 3WGHA 1FBUA 1RNLA 3ELKA 1R5HA 3KP3A 3Q9SA 4GYIA 2VT2A 1R00A 3GFMA 4KDPA 4ON0A 3LSTA 1IN7A 2HFHA 2JSCA 1JGSA 3GXOA 3E6CC 2QVOA 4GGGA 1QBJA 3DXJF 2CO5A 5DYMA 1WWXA 3RYRA 2VOOA 5CVVA 2PFBA 2CGPA 5AIPA 4KT5C 3R60A 1KQ8A 3FXUA 2JZYA 3ZPLA 1W7PB 3HHGA 4MHGA 2XASA 3S2WA 2PI0A 2DAOA 4CDGA 2DPUA 3W6JB 4XBFA 4FHTA 5FLXZ 4KUMA 1K78A 5EEHA 3P9KA 3GZ6A 3SQNA 1XGNA 2XHKA 5JHUA 3F8NA 2FNAA 1SD7A 2JRTA 3GFJA 2AXLA 2IA1A 2L4MA 3MZYA 3BROA 2RNJA 2Z3YA 4EGYA 1IRGA 1F4KA 3J80K 1CF7B 2LSOA 2XV4S 1E2XA 1QNTA 2WTEA 1T2KA 3TGNA 3G73A 1RUOA 4KIBA 3ZMZA 4UNOA 3RIRA 1J7KA 5FFXA 4G6DA 1O7LA 3P9CA 1UHMA 2M1BA 5CVJA 4GXOA 2FBIA 5LEKA 3F8BA 3CO6C 4EVIA 2TDXA 3TOAA 2NNNA 2MLGA 2YR2A 4JQFA 1IN6A 1G3SA 2P6SA 4H0EA 2ZNYA 1IRFA 2YSRA 3MZHA 3C3WA 3J81K 1U78A 1LVAA 1ZN2A 1U3EM 3KZYA 2GIVA 3HIFA 3K9TA 5BQTA 4S05A 1O3SA 2FEZA 3FHZA 2BYVE 4ZYDA 3I71A 1Z7UA 3WG9A 2CSOA 2V9VA 1P6RA 5E20A 3VODA 2FMLA 2J5PA 4LG0A 5FO5A 4HA8A 2DLLA 1G3TA 1ZRFA 1WRJA 4BNCA 3CDHA 4WXHA 1OYIA 3E5XA 5L3FA 4RB0A 2QZ8A 5DCFA 1RI7A 4YFXF 1T0FA 1T38A 2E7XA 1KU9A 3F6VA 1HSTA 5ICCA 4WXCA 3HRSA 1L3LA 2DK8A 2HZTA 5ILVA 2PG4A 3IC7A 2DQRA
chains in the Genus database with same CATH superfamily
3PQKA 1TWHJ 5H2FC 4XMYA 4IEJA 4QLCU 2LFBA 3AG1H 3Q0UA 5BPIA 2QSFX 5LHHA 1JI8A 3ABMH 2LYCA 4DOZA 4QPQA 2RV8A 1QQIA 2LH9A 3M8JA 3V8JA 2JK3A 1FP1D 1EF4A 3FF5A 4NNJA 2O9LA 2DI3A 2D2WA 4PJJA 1YX5A 2F5FA 3T5XA 5E18F 1Z6TA 3JAMK 1VQMI 3RYPA 4BBSJ 2FA5A 3DBRB 3G2BA 2XDVA 3PIOF 1I6XA 4BQNA 5F1JA 3KZIC 4BUPA 2MABA 4OIOF 3H9JA 1RKWA 3Q0WA 4HLYA 2IS2A 4A2UA 4UVAA 4BDYA 5D5XB 3RI4A 3CO7C 2RN7A 2OZUA 1FBQA 4L9TA 1U8BA 1UG0A 2WA0A 1S6LA 4KMFA 3H92A 3KP6A 3JRFA 4ETSA 1FSHA 3AL0C 1A31A 5BS6A 1KQ9A 1S7EA 1PP7U 4NUBA 1NK2P 4XLNF 2V6CA 2VT3A 3BR5A 5HS9A 5DTDA 2AHQA 2XAGA 3GZ5A 1MBGA 5FD6A 3CCMI 2LG4A 3WU0A 1EKEA 3CJRB 1MMDA 2K02A 3J80Z 1ACIA 3QWLA 4LMYA 5D8LB 4IRIA 4ESFA 2ECBA 3HJEA 1XS9A 5CYVA 1S5LC 4KISA 3A4CA 3ZQ7A 4L5IA 2LK2A 1UCRA 4OAYA 3Q9VA 4UY8I 1MDMB 3QPHA 3BZCA 1RIOH 3RZDJ 3HSEA 5L3CA 3LNQA 3CDIA 4Y17A 5DCMB 1OCRH 1SAXA 3HTUA 1MJBA 3KLNA 4X1EA 1X1AA 1Y8RB 5CVIA 3A01B 4YFKF 2ID6A 1R1VA 5BOXA 5FLVA 4C2UA 1M1EB 4OU0A 3PQJA 2CW7A 1A6QA 2EK5A 4ZYEA 1BJAA 2ZJPF 5DD4A 3PSFA 2IPQX 3K4LA 2XGEA 4CA0A 2O0YA 4F52A 3BR2A 1FBSA 5HLTA 3FKJA 3ZMUA 3JRDA 4ZYAA 3J81Z 5HODA 4KMUX 2A5YB 5J6XA 2VC1A 5IT3A 3AL0B 1L0OC 3NWTA 2D1VA 1KZHA 3HPGA 4P9UA 2COMA 2LRDA 2HKOA 1IXSB 2KJCA 1WJBA 3IUOA 1EH7A 2LY2A 2LTPA 4FTHA 1RPWA 2VBXA 3K1PA 3SJMA 3MWMA 4XLHA 2KT0A 2CQ7A 3S93A 1BC7C 2M0MA 2OZ6A 4XN0A 1QRYA 3RKYA 1I6HJ 2DYSH 2L54A 4E7JA 3I4NJ 4AIHA 4F7ZA 2DU9A 1SAUA 3R4KA 2Q2EB 4HNTA 1ZELA 2K86A 3ZMSA 2JPBA 3OYIA 3HGGA 3P9IA 3OSFA 1HKQA 1W5SA 3VYRB 1X2MA 1J75A 5LLQA 2KQRA 2ZSHB 4NB5A 4I6ZA 2NVTJ 4MQ9F 3DCFA 4BEHA 3F0CA 5KAIC 5EGOA 3IV5A 1YTYA 3E0JB 5FGMA 4R8HA 1XMXA 1O3QA 1QGPA 4ABZA 3F8MA 2PJRA 2BE5F 2VKDA 2Z5UA 3H35A 2VPRA 2P4WA 3L09A 2OD5A 5E8GA 4BE1A 4DYCA 4IF4A 1XDSA 1B8IB 1XGOA 2WC2A 2WAEA 2A6TA 1N25A 4IHTA 3WTSC 3ULQB 3S2HJ 2MLKA 4XQFA 3BQZA 3IKVA 4OIPF 3R61A 2LBFB 2EH3A 2V1DA 1H9TA 2YU9J 1KYWA 2N8GA 1EH8A 2M87A 1X3ZB 3VYSB 4L5EA 1BOBA 3TBIA 5HNHA 1SFUA 1JJ6C 1VQ8I 3GYHX 1T98A 4F93B 2L3DA 1FZPB 3BCAA 2AS5F 3SEQA 1ENHA 3JAMZ 2ELKA 4PJLA 5D4RA 1MJ9A 4M3DA 1RZ4A 9ANTA 3E6MA 4DZJA 3VWBA 4N0BA 1U8RA 2VJIA 2HDDA 5M3FJ 3G1LA 5B1BH 2DOFA 4OIQF 4B1RA 1WPKA 2GLOA 3TEDA 3WGGA 4A0XA 4BXUA 5HLHA 3HEFA 5K5QA 4XRSG 1RUNA 3EYYA 2KZGA 2EV0A 1J9IA 2KKOA 4LLGF 5J1RA 2FQ3A 1D0XA 4HX8A 3VOEA 4AIJA 2VONA 3DF8A 1VQ4I 2JQ7A 1P2FA 2WY7Q 1I27A 2L7MP 2IP2A 4QWQA 4RLQA 3SFIA 3ABUA 3N05A 1EH6A 3VSLA 2QKMB 3FWEA 1X19A 1YOVB 4WWCA 1N75A 2BZTA 3WGIA 2KLOA 2M3AA 4A6DA 4BGDA 2E2IJ 4UXNA 3I55I 1MGTA 4MIMA 2DYRH 4GYGA 4A3FJ 2O5RA 4MEYF 4B47A 1NG7A 2HGCA 3K1NA 1H88C 1MD0A 3CCQI 5JR3A 1MMGA 3CDLA 3S2DJ 3EPZA 3BR3A 3B02A 3CUQA 4L0ZB 4DYRA 5HDKA 1HC8A 3KEOA 4RMNA 3DU6A 5BMZA 2QUFA 5FKLA 2DFHA 4KITB 3N97A 2DMNA 3BZ6A 1ZAOA 3AAFA 5DUKA 1R4MB 1HBXG 3I58A 4FT8A 4ENJA 3ZMVA 1N77A 2I10A 3VYUB 2VPLA 3OYJA 4E6KG 4U0YA 5CVRA 5FKOA 3IRQA 2K9SA 4A3GJ 2FJ1A 2DA3A 4I0AA 2P81A 5JLXA 4U0WA 2FUG2 1PUEE 1QHHD 5E1XA 5E8IA 3M8EA 2DA7A 4PDKA 1XN7A 2UXNA 2W85A 3QOPA 2IS1A 2IS6A 2L01A 4D9JA 1R22A 1MW7A 2M5WA 2JWTA 3BWGA 3BPXA 5KHDA 3DQVC 5C3EJ 3HOXJ 5H6QA 5BPDA 3PFYA 3VSKA 4CSWA 2QKLB 2HZDA 4B44A 1W0TA 1IXRC 3HXLA 3TO6A 1IZ1A 1H9GA 4EJUA 1LE8A 3PJRA 2XPWA 3BTLA 3L00A 3GTOJ 5J40A 1HDDC 3BT9A 3GTGJ 3H5NA 2XB0X 4JX6A 1ZR2A 3RSNA 4CZZA 3K2AA 1FJLA 1OCTC 2X48A 3G6EI 3UKGA 1XMAA 3E3VA 1K4SA 4WF2A 4G6QA 1OCCH 3F23A 4ENMA 4AIKA 1K78B 4HV6A 5B3SH 2ECCA 3K4MA 5F1RA 4XIDA 2DTZA 3BPVA 2V9KA 1R4NB 3TKYA 3ML6A 2QM3A 5FKNA 3CD6I 4BYYA 3TQNA 3CP8A 2KDZA 5D5VB 3CCLI 1YYVA 4RGRA 3CCSI 2FU4A 1WJCA 1NG6A 4H4KC 4XN3A 5J1YA 4AVZA 3Q3SA 2CMPA 3GZNB 2R4GA 3D1NI 2JJ7A 2YU3A 1E17A 1ITYA 4ZZLA 4PCQA 1VQKI 3BTJA 2GA1A 4ZYGA 1ETXA 5ILUA 1QU3A 2H8RA 5HOOA 1G8XA 1A35A 3H3UA 5ICFA 4RAFA 4UUTA 1Z9CA 1B1BA 4BKXA 4MTEA 1BI0A 1T0FC 4R79A 1G4DA 2V79A 3HYIA 2X1DA 2HQRA 2KRHA 3J7YJ 5C4XJ 2EWNA 3B73A 4ZDOA 1G3YA 4M73A 4P55A 1TP4A 3H5AA 2LREA 1V5EA 2LOOA 2Y75A 4PZJA 5ILSA 3CC7I 2DA6A 2HVRA 4GRIA 2JVGA 1J59A 2DA4A 3E5UA 2E2HJ 4DW6A 4MO7A 3RQIA 5F0FA 1TQIA 2FQ4A 1Q1VA 2V4JC 1PP8F 2LMDA 1QO0D 4U7BA 2HQNA 5LGUA 1V5FA 4ZDPA 1W5TA 3C1DA 2ACJA 1FLIA 3V8LA 1YW8A 2E60A 2RREA 3VDXA 1D1AA 2CRGA 4LITA 4LG0B 3HTSB 2KRCA 5J47A 1ZTRA 2KIFA 3WODF 5ERIA 1W4MA 2DBBA 2GBYA 3DEUA 3C2BA 3C7JA 1WFXA 1LB2A 4LJZF 5FKKA 3W2VA 2ZCWA 4HF0A 4M9SA 1HW5A 2LVSA 5EYRA 2MG4A 2KPMA 2ZMEC 5C44J 4DQ2A 3A02A 5HVQC 4IO9F 2BW3A 3BZKA 1ON1A 3CCRI 4XM3A 3NARA 5B66C 2FBHA 2W00A 1JKPC 2FXAA 5FB2A 2RC4A 4HQEA 5KVRA 2XF7A 1IXCA 3DKYA 4DNCA 4LG3A 1V4RA 2XPVA 1IDYA 1FYLA 4HF2A 1BJZA 1HDPA 1Y56A 1UJ8A 2NS0A 2Y69H 5D6FA 3QP5A 4IOAF 5TGTA 2CQNA 4UB8C 1HF0A 3I64A 3L2VA 5F0HA 2UWMA 1X1PA 3IHUA 1GLNA 2HPIA 1JKRC 4I76A 3HRMA 5CQEA 1IGNA 1QZYA 1PVEA 1TT0A 4QPOA 3DV8A 4W97A 4Y33A 2UUZA 1OYWA 3E6DA 3SDGA 5LRRA 2RDPA 2Y9YA 1TWGJ 4ZYHA 4HNVA 2RNGA 1LEBA 3V42A 1YE9A 5JI6A 3HOYJ 3EUKL 3O6BB 1OYYA 1AA7A 2XF5A 2R93J 2VN2A 1BI3A 3ZN1A 3LSIA 2ZMEB 1FPQA 3I4PA 3JREA 1VQ5I 2VQCA 3KIOA 1SMYF 2DJIA 3PNVA 1FOXA 2KISA 5E1WA 2QWWA 3PFIA 4NQWA 3REOA 3DLLF 2EA2A 1ZK8A 3K4CA 4HDUA 4AUXA 2JA2A 5F64A 1AHDP 3CCUI 4XLPF 3DLAA 4CYCA 2A68F 1S7AA 2OF7A 4XLAA 2IA2A 5H20A 3TL4X 1E3HA 4Q5SF 2VOPA 3M9AA 1XPXA 3BTIA 1MBKA 3GLLA 2ZJ2A 4A69C 1ETYA 1WVRA 1GDTA 2K4JA 1FP2A 4UVBA 3ASOH 1YFHA 2MC4A 2G0EA 3J7ZI 3LA3A 4BACA 4ESBA 2BXYA 3AG4H 1FMVA 5TRDA 2MBFA 1TTYA 3I54A 3K7AJ 1FYMA 4BY7J 2PQ8A 4A3LJ 4OMZA 2ISZA 4Y7NJ 4HG2A 2P5VA 1ZGJA 3FMQA 1MKMA 4I09A 4PFOA 2WWYA 4HYEA 4MQVA 1WI9A 2HPMA 4HPQA 3TOBA 3L7WA 4HX7A 4IHXA 3WTTC 2VC0A 4CCKA 5FFZA 2F5CA 1MBFA 2M30A 1SD6A 2HWVA 3BG6A 1UFMA 2X1EA 3KP2A 3BR0A 3BTCA 1XCVA 4Y3OA 4P5OA 3HZJA 1FOKA 2XGDA 2R5ZB 2ELJA 2Z1DA 4C9YA 3M3YJ 1HKTA 2MSYA 4O5VA 3GWZA 1HA8A 5ICGA 2CW8A 2R3SA 2V9PA 5L3EA 3LL7A 3TP3A 4IQ4A 1BIBA 2ADUA 3S32A 5IYCJ 3EQLF 2W24A 1IV8A 1BC8C 2Z9OA 3T8RA 1TW3A 3U1KA 3DFGA 1VQ9I 3DPUA 2R7OA 3G4SI 1JE8A 1P7IA 1YX3A 4UV8A 3MCZA 1VNDA 2EB7A 1Z77A 2L02A 4O6JA 4E7ZA 2EZIA 4R1HA 2QQ9A 5K5OA 1E0EA 1S8NA 3O2PE 3CZ6A 1J5YA 3M8FA 4RLFA 2QLZA 5JVGF 1ZRCA 4DYQA 5HDNA 2W4SA 3I0TA 3FBNB 3RKWA 2XPUA 3JTGA 1U6GA 1T8IA 1BL0A 2O61A 1P4AA 2ZJQF 4BEHB 4L0YB 1W7PA 1S9HA 3KPHA 4ANJA 3WTYC 2D1HA 3BC8A 2K3FA 3K4JA 3DKWA 2PJRB 2HDCA 1R9TJ 1YG2A 1R7JA 1S7OA 1HXDA 4EV0A 4XRMA 3PL8A 3ZQQA 2XAFA 3FMSA 1E3PA 2ESNA 3HC7A 2CG4A 4L5JA 2JA7J 2PJPA 2OAZA 1F43A 4Q47A 1GHCA 4CCJA 2QYOA 3FK7A 1R1TA 2GM4A 1Z3XA 1XD7A 4YG2F 2JUGA 3IL2A 1R36A 4M3EA 2O7OA 4ESJA 1D8KA 1JUMA 2IGNA 3DPTA 3I53A 3F22A 3H9QA 1VZ0A 2IVMA 2Y48A 2OU2A 1HSJA 4HBLA 2YPRA 3ABKH 3W6KB 2F4IA 3GO5A 3U9GA 1UELB 2KMUA 1XSXA 1Q1HA 2AQEA 3DEWA 2GOMA 3JRIA 2NRAC 5JFRA 2JT1A 3DPLC 2K3PA 3HSFA 4I98B 1YITI 2Z99A 1LNWA 1WH7A 2MFZA 1SEUA 1Z1DA 3CF5F 4E7IA 4UUVA 1V54H 1SVLA 1Z05A 3BG3A 2FBKA 1YRNA 1X3UA 3C2HA 4Y52J 3O3KA 2G9WA 4U88A 3LSGA 5FD5A 3OR2C 5TJJA 4M9XA 1YJNI 4LOCA 2H1LA 2QGUA 2G7UA 2KIUA 4JP0A 4X0GA 2NXNB 2IRFG 3LWFA 3OWTA 4B4CA 5KCMA 3CTAA 1GUUA 1Y0NA 2HXIA 2ESHA 5BNGA 5H6RA 4OWRB 1U2WA 1LEAA 1X3WB 2EFPA 4NDLA 3IRRA 2H8WA 3DTIA 4DJAA 2FF4A 2COBA 2MH2A 3N4MA 2NNYA 5KK1A 1BM9A 4M71A 1XC5A 1JUPA 2E71A 4KIGA 3H3VK 2H6CA 2HOEA 3J7AY 4XKWA 1AU7A 2MD5A 4FISA 1V5GA 2DN0A 2ME6A 4A5NA 4JX5A 2H09A 2GAUA 3QQAA 4GFBA 2IW5A 3A03A 3BJAA 2E5NA 4YRVA 1FY7A 2M8GX 4AWXB 2FMYA 3MEXA 1QPMA 2STTA 2M9HA 2IS4A 4II3A 1J09A 2DA5A 2VB6A 2E1CA 2O6GE 2XRNA 3V8KA 5GAGJ 4TV7A 2BXZA 2O8XA 1FSEA 2QF7A 5EG0A 4A3MJ 2XKPA 3CUQB 4AYBA 2BY2A 2AQFA 1DDNA 2F4OB 2KJBA 2M4KA 3QOEA 4MGRA 3RPUA 4KICA 2M2EA 2XAUA 3I3LA 1ZGAA 3T0YA 4UUSA 2ZBKA 2HOSA 1DU6A 1FTZA 5J8FA 2PEXA 2BY0A 5GAEJ 2UXXA 5FLMJ 1XSDA 1AKHA 3BQYA 4CUGA 3BP8A 3PNYA 3ZQCA 1JKQC 2W7NA 1LUJB 4LB6B 2CWEA 2CJJA 3C2GA 2GIZA 3SXYA 1J0RA 2Y9ZA 1B4AA 1NTCA 2ZXHA 1MBEA 4KFCA 4Y13A 1UHWA 1TWAJ 4MNUA 3ERMA 2OQRA 3HGYA 4GDFA 5TISC 3MD2A 4N9HA 1SC7A 1OLTA 3HPHA 2Z33A 3WU2C 3FXMA 1OR7A 3F8FA 3LFKA 4FE7A 2QBYA 2VBWA 4KIFA 1TBXA 2Y0MA 3MN2A 3HOZJ 1BOAA 1OMIA 1ZARA 3JRGA 2LF8A 2BVLA 2CS3A 1FIAA 1OQYA 1GT0C 3WHCA 4BE0A 2W25A 1W7PD 1S3JA 3S3MA 1BN5A 3I59B 2R0QC 4IRHA 1LE8B 3LA2A 2Q1ZB 2VUMJ 2DXIA 2F48A 4A3BJ 5J4YA 3W2WA 4WCGA 1KONA 5F6FA 4HLXA 3W2AA 3VPRA 1BA5A 4LLLA 1MNDA 5EZHA 5FKMA 3WE3A 2STWA 5LGTA 1U0JA 2GXAA 2E1OA 3F6OA 4JOMA 4ZTFA 2X4HA 3M1EA 3JSOA 5IP6A 2CQKA 3LQQA 1T39A 4CXFA 3U1DA 4LD5A 1W0UA 3CMEI 2X9DA 4RDUA 4BQOA 3PSIA 2X0LA 2B9SA 5KNLA 3HKZA 5FRNA 3PUFA 4HAMA 1EA3A 1J2XA 5J1UA 3SEZA 1B9MA 2W1OA 4BJ5C 3QRFF 4RGUA 1RKTA 3WTXC 4RGSA 3K70D 1BI1A 2BBYA 1HLVA 4DBRA 2X6XA 2M7AA 2W57A 4FETA 3I9V2 2NVYJ 1F5TA 4AIDA 2NS8A 2A6EF 3C18A 1MDMA 4XOPA 4J01A 1YQAA 4C30A 2DQLA 2OA4A 3RDIA 1U9OA 1X4OA 3RCOA 1G59A 1O4XA 2IA0A 5IYBJ 2DFIA 3MAJA 2DODA 3HUGB 3OL3A 1LFPA 3KE2A 2R7SA 1IF1A 1KU7A 4PGGA 3EUHA 1YW7A 2CV0A 5D5WB 1U5TA 2Q0OA 5B5EC 4N4NB 2QEXI 5E3LA 2EA4A 1SFEA 1Y6IA 1FWZA 2MW8A 2B0LA 2YX7A 4KJZA 4RB2C 3L2RA 1MSFC 2KRFA 3JRCA 1I5ZA 2M4GA 4OIRF 2LC2A 4LK0F 2CFXA 3ZCOA 4PK4A 2MC3A 4XLFA 2ZKZA 4OMYA 3LAJA 2ELHA 3WTWC 1BW5A 1WZ2A 2P7VB 5CJ9A 2ETHA 2VE8A 1AOYA 2JSPA 1W5CC 1SD5A 2ICWG 3JW4A 3A0BC 3ERED 3VYTB 1RC9A 2EIJH 4YEJA 3PIPF 1NK3P 2WV1A 1YHQI 3EETA 2EJRA 5M5WJ 2XC7A 3F21A 3QP6A 1D8JA 4D1QA 1DU0A 2QA4I 4XOTA 4BBRJ 2VJ5A 4YFNF 3LSPA 2CQXA 1ZKGA 3ZRGA 1E3OC 3K4KA 5E1ZB 2AXTC 3QPSA 5L3BA 2H6BA 4RGXA 4Q48A 3E5QA 1T6SA 2XSDC 4BY1J 3V4GA 2BW3B 4M6YA 3ZMDA 5AIQA 2E34A 4O3MA 1FC3A 2CUFA 5IP7J 4L9NA 2DT6A 2PN6A 3LQRA 1O3TA 4IKFA 5HS7A 2ID3A 4BHPA 2VI6A 4D5CA 2DOEA 3ZMTA 3GTJJ 2DTRA 4L9JA 4B3AA 2XVCA 1DPUA 5GADJ 4A6EA 1XB4A 3GCMA 4NBQA 3FM3A 1Z6RA 4KA4A 1PYVA 1F1ZA 5J4VA 3FIWA 4BE2A 2H94A 2M7BA 3OYAA 3RTRA 3PO2J 1OJLA 3M4OJ 1P4XA 4CO8A 3JR9A 4U87A 2RKHA 3PM1A 2OBPA 5CQGA 2YS9A 2EZHA 1WH5A 1PDNC 4EMSA 3IKTA 2YX4A 2K9NA 1OFCX 1LFUP 1DUXC 4RB1A 4P1WA 3CCEI 1R6RA 1VI0A 4G7HF 1ZRDA 3QPLA 2CFOA 4BDZA 1SFOJ 2ZFWA 2EBIA 3SDBA 4AYBN 3ABLH 5LHGA 3OYNA 2BEOA 1B59A 1Y1WJ 3GTQJ 1YLFA 3OYKA 1ZG5A 2XAQA 4JK1X 4Q4ZF 4Z2YA 4J00A 2LDUA 3A0HC 1WHUA 3LSMA 4PGHA 4I0BA 2L4AA 2ZSIB 3ECOA 1IDZA 4IHSA 4I99C 2KIMA 2HDWA 2KFDA 3V7SA 4G9YA 1YJWI 1HCRA 4DGWB 2DDAA 2E7WA 4L9VA 3OIPA 4LB5A 3L2UA 3FXQA 1K83J 2OUMA 2PX9A 4CYCB 4JX4A 1P92A 1VTNC 1BI2A 4B48A 4W1UA 3WTUC 3WG7H 3FZVA 1QVTA 1KU2A 3QPTA 3A2KA 3KEQA 4PJNA 1FX7A 1EJ9A 3R0AA 3TDUC 2HU9A 2ZB9A 1BR4A 2EINH 1ETVA 3OR1C 5GPCA 1QZZA 2F2EA 1I39A 5C4JJ 3G1MA 2E35A 2FSWA 2R7WA 2DPDA 5ICEA 3HBLA 1SVMA 4XK4A 4CGZA 5IYDJ 1KU3A 1FNNA 1TLHB 1WCMJ 3IH3A 1GVDA 4EGZA 4PJMA 1SD4A 2BHYA 1TQMA 2ISYA 3B6AA 1F36A 1TT5B 2RVCA 3DBLB 4XLEA 2X6YA 3JRBA 3CUOA 4FX0A 4WK8F 5B1AH 2NYXA 3LSRA 1W36D 3S1MJ 4E4HA 4ZH4F 3IAS2 4P96A 2PLYA 2R92J 2LR8A 2M8EA 1I3QJ 1LVKA 1X4PA 1KA8A 1SFKA 1WJ5A 1FMWA 4EM2A 4K2EA 4LK1F 4MLOA 2R7DA 2VQHA 3K4NA 4CH7A 1FIPA 1DP7P 4YIIA 1R58A 2AO9A 4IZZA 2GWRA 4LIUA 4G6TB 2P5LC 2F5DA 5DM6F 4A5MA 1BR2A 3HKZN 4Y15A 4B43A 4U7DA 2O8KA 1ZQ3P 4G8XA 1JTYA 3DEEA 1R23A 4X6AJ 5IP9J 2WAQA 1D3YA 4FASD 1OISA 4UHTA 1IRXA 1QPIA 2IXSA 3BOQA 1KQ0A 3PUBA 4ENNA 2GXGA 1RR8C 1R71A 4ZTJA 2HQAA 3L2QA 1ZYRF 2CH0A 3D5LA 2V1XA 1D5VA 3JSPA 3ESWB 2JN6A 4HRIA 3NAUA 1XX5A 1MNMC 3HOSA 3GF2A 5LFAA 1N78A 4ZJZA 2W48A 1V55H 3P5JA 4C3JJ 1D5YA 4HSRA 2EPFA 1H8AC 1JKOC 1HW2A 2XAJA 1VF9A 5IOZA 1B9NA 2HXOA 3DWLE 1K4TA 5DV5A 4HDVA 2R7UA 3F9KA 1IN4A 2WAFA 4G7ZF 3G3ZA 3K0LA 2VXDA 5M5XJ 3OSGA 3HRUA 4HEA2 3OS0A 2CYYA 2DJNA 2CW0F 1H89C 2R5YA 4XR6A 3TP0A 1UB9A 3FKIJ 5DUIA 3K10A 4RB3C 2M0CA 1JHHA 1DGWY 4IPAA 1ZREA 5JLWA 3CCYA 2EIMH 3COAC 1SMTA 4Y4RA 3ZP5A 4ASNA 4U0VA 2XROA 3V7RA 1GV2A 2DMTA 4YIFA 2L7KA 2VE9A 3V7CA 1XCBA 3RPQA 3ZOBA 3GFLA 1H0MA 2XUBA 4LLNA 2DT7B 2VBZA 2HYJA 5DDGA 3S17J 5D5UB 2LP0A 1RETA 3CC4I 1RR7A 3QODA 4S04A 1IJWC 2L5QA 2K4BA 1ERDA 3CESA 2RAEA 3RJPA 3JRHA 1WQ2A 2DDBA 4IL6C 1I1SA 1HOMA 3GTLJ 3QYEA 4D0PA 1BW6A 5IY5H 1YI2I 2VODA 3CCJI 2HYGD 4BQQA 1R49A 2BOLA 2W84A 3O8GA 3S16J 1Z91A 1EV7A 2F5VA 1YIJI 2RGVA 2K27A 2EIKH 2FNPA 4ZZDA 2V1UA 4XORA 2H1KA 5F04A 2FOKA 1I1GA 1I3AA 1OKRA 4E70A 1Y8QB 3D5SC 2DFFA 2NOGA 4IRGA 4RA2A 5HLGA 2R7ZJ 4AVPA 2E19A 1WJFA 4UVCA 5F0CA 3ECHA 2JMWA 3KETA 2HS5A 3FHNA 2QCOA 1X58A 1JT6A 1YS6A 2CQQA 3OYFA 5HDGA 2VKHA 2HTJA 4I2OA 1MIJA 2DFEA 5IT9K 4IXAA 2IT0A 4EATA 2P5KA 3WTZA 3FISA 2ZO4A 2WB1A 3MVPA 2L9RA 1SANA 2Y2ZA 4BJ6C 4EM0B 3IH2A 1FOYA 3OYLA 2BGCA 4M6VA 3MQ0A 4A0YA 2IGKA 1LPQA 2NOJB 3ZQLA 2X6WA 3H3ZA 3DU5A 4M72A 4NC8A 1MJAA 4NHJA 2J5OA 3DP7A 4HNUA 1MH3A 1GXQA 1ZLJA 1FEXA 4RS8A 5EEAA 3ZGKA 1ZG1A 3HHHA 1G3WA 3FK6A 4WXDA 5CVUA 3RQ4A 1PUFA 1LDDA 2K9QA 1ZH5A 3FX3A 4A93J 1HQCA 1IN5A 1IW7F 1TNTA 2CU7A 2OQGA 2XGCA 3CMYA 2IAIA 4FX4A 4QTRA 1T33A 2HYFA 2I5UA 3G71I 4HF1A 2DOAA 2HVQA 4OINF 3KZZA 3LSHA 1ETOA 1T95A 1AKHB 2ZC2A 4HV5A 4FCYA 1C0WA 4A3IJ 4I7HA 3QYBA 1X2NA 2DMQA 4CCNA 2H27A 3Q5FA 3BR6A 2F4MB 2DK5A 3F8CA 5EGOB 5D4SA 4EM1A 4N9IA 3F3XA 1XSVA 3BG7A 3WHBA 1GV5A 3KP7A 5L3GA 3FM5A 3GVAA 4HX4A 3MKYB 1UG2A 1ULYA 2K7LA 1UAAA 2QBYB 4LIVA 3ASNH 1MZBA 3KP5A 3QU3A 5LBQA 3E6BA 1B72A 3CC2I 4XONA 5F08A 5D8KB 1DGRM 2JRMA 4RM2A 4B8XA 2VQGA 2QENA 2O3FA 3OIOA 4FE4A 3QAHA 4XSZF 3ZXSA 3PO3J 3TO9A 2B63J 2LKXA 1SVOA 1WKMA 1Z67A 3EUHC 3SFZA 2KIQA 3H36A 1W36C 2FRHA 1U5TC 4BAYA 2FX0A 3CJNA 2A61A 2Y30A 2K9LA 1CF7A 1IUYA 1G2HA 1XG1A 4MEXF 1HW1A 1A6IA 2F6CA 2WBMA 3KYDB 1TZLA 1DPRA 2ZMEA 4C2TA 1USTA 1MSEC 2QQAA 1YO5C 1ZR4A 1FYKA 2R7XA 1LDKB 2FD5A 5K5RA 2PMHA 4IVNA 2WAQN 3I4MJ 2HKXA 2BY1A 3L1PA 5EDNA 3S1QJ 3CUQC 2NAZA 2JUCA 3ABTA 3AKZA 2B7EA 1NHAA 3G1OA 5K7ZA 4NC7A 2A3SA 1B6AA 4CCLA 1TL8A 3OYEA 4A3JJ 2CUEA 5HS8A 5IPAA 4M6XA 5CLSA 4C3HJ 3U2RA 2L7FP 4BXFA 2NVXJ 2CV1A 1QA6A 3Q0VA 3QYFA 2LKPA 3K4BA 4YIRX 3ZQIA 2EFOA 5ED4A 1A04A 5GAHJ 5E79C 1ZLKA 2VXZA 3FDYA 2ZNZA 3QU6A 3K6GA 2HOTA 2KHMA 3CLOA 3WU1B 1R5GA 2K9MA 3R0JA 3BG5A 5DD8A 2WY8Q 3ROUA 1D0ZA 2R7TA 4UB6C 1O3RA 1JXSA 3S8PA 1MMNA 4EQQA 1U5TB 3H0GJ 3OYCA 2XKOA 1JJ8C 1ORKA 4F3QA 5K7FA 3L2CA 1O7FA 3LAPA 1UHSA 5DM7F 2GA2A 4IX7A 2DCEA 5CPRB 3SHFA 2OC6A 3OYHA 1WGXA 3H5RA 3MZ8A 4JYKA 2GQQA 5EF6A 4ZDLA 1TQPA 3SZPA 3DBHB 2R5ZA 2HEOA 1R1UA 3AFHA 3IWFA 5AONA 4IOCF 2WADA 3NWSA 4PSXA 4CZCA 2IJLA 4I02A 3ZN0A 5IT9Z 4ITVA 5LRSA 3HM5A 1JT0A 2MD0A 3NRVA 3SZTA 4A3KJ 2OTLI 1Y0UA 3NEUA 1IN8A 1VQNI 5E3NA 3FXOA 1STZA 4RM3A 2ZXJA 4XL9A 3BJ6A 2R7RA 1YIOA 4BXXJ 3ZQHA 4B09A 4OOIA 3GTPJ 2JPCA 1DP3A 2CUJA 3CJTB 1MBJA 3IH4A 3L9FA 3FMRA 4EEFG 2LNBA 3L2WA 2I8DA 2OCCH 2E1NA 4E7LA 2LKSA 4RAZA 2JA5J 3HDDA 4KN4X 5GP9A 1YS7A 2OTJI 1O57A 1T56A 4A0ZA 3OL4A 1G6NA 1F9NA 2HR3A 3BJOA 3KYCB 1BBYA 4WX9A 3E97A 5J3LA 3T1BA 3TO7A 3FXRA 3MFKA 1VQ6I 2Q8KA 2V6EA 4CCMA 3HSRA 4I01A 3GX4X 3BCBA 2RQPA 3S3OA 3GLXA 3EYIA 3VEPA 3S3NA 1ETWA 2EZLA 3H0DA 2WB1N 5EEGA 1USSA 2NVQJ 1LDJA 2VL8A 3LSJA 1I50J 3GBGA 4AD9A 2QQBA 1TWFJ 4HQMA 5KAFC 1RRJA 4BH9A 3MKLA 1QVUA 4EJOA 3OMYA 4BU2A 1ZGWA 3HOVJ 1QZEA 2L0KA 3FXLA 3HL2A 2HTSA 2XAHA 1K7AA 1XTAA 2OV7A 4CCOA 1TW2A 2R7QA 4EJVA 3E1SA 3OOPA 2UZKA 4A3CJ 1FT9A 1OCPA 1WJAA 4QIWN 1LQ1A 5E17F 4QSHA 3DKXA 1ON2A 2ZXWH 2EV5A 2L9SA 5LHIA 2R7FA 2A05A 2KL4A 4UV9A 2KP6A 5A2QK 1CGPA 4XRSA 5EZGA 5E3OA 4JBAA 2X1CA 1YW9A 2YUSA 3FXJA 3GFIA 5LGNA 4M3BA 2K5CA 4HZFA 4BHBA 2XIGA 3BY6A 4XRFA 5DCMA 4AC0A 4GCVA 1K61A 2GZWA 3RZOJ 4P9FA 4ZC3A 2L9VA 3KX2A 3A01A 1Y1VJ 1IV6A 5K1YA 3K1MA 4G12A 1P4WA 5DEQA 1T08B 1MMSA 4NC6A 6PAXA 3S14J 4B3XA 4XICA 1XMKA 4XSXF 2QSHX 4KYWA 1OPCA 3CQZJ 3K69A 1W1WE 2O03A 1ONVA 2G7HA 3HRTA 2JVHA 1D1BA 4G94A 3IWZA 1IC8A 2OCEA 3LSKA 3OS1A 4IHVA 1JHFA 2DA1A 2M45A 2X85A 1XDUA 2L9NA 1GVJA 3OV8A 2JA8J 3GW2A 2X51A 3J7AO 2LY9A 1BIAA 4C2MJ 2CUZA 3UR3C 4BQAA 2R7VA 1K79A 2WV0A 3JCUC 3E7LA 3X2QH 2V1NA 2OJED 1YJ9I 4EJTA 1IUFA 1HKSA 2EFQA 1VQPI 2IGOA 4MTDA 1S72I 1DQUA 1REPC 3WE2A 3RPUD 1P9QC 3GUDA 3HB9A 4HW0A 1IO2A 3H1CA 1TNSA 3KFWX 2GXBA 2MGQA 3OYDA 1U9NA 1Z3YA 2A6HF 5FRMA 2Q2EA 3M7GA 2FE3A 1SFXA 2A69F 4C3IJ 4HOBA 5HNFA 5HLIA 3LA7A 3FBIB 2P6TA 4CYDA 2VJJA 2EV6A 4BJTA 1POGA 2XGXA 4PUSA 2RQQA 2BVMA 4EJWA 2L7ZA 3VB2A 5LD2C 2C6YA 4LGWA 5LEJA 3OY9A 4E7KA 4F92B 4F91B 3EDPA 2L2OA 2P8TA 2EILH 3MMYB 2DO7A 2KDOA 4IJAA 4OAZA 1VQLI 1WSUA 3GTMJ 1UMQA 3PNTA 4LFUA 5FLXK 3TW7A 4KNYA 1LJ9A 1VFCA 1K6OA 2CV2A 1V3FA 1B8IA 2V26A 2BY3A 4M74A 4V2GA 4M9ZA 1AWCA 3F72A 3M07A 1GXPA 1XGMA 1ZG3A 3WTVC 3KLOA 4XKVA 3BR1A 3ISPA 3I59A 2LF7A 4ENKA 2LBFA 1JGGA 2TRTA 3RKXA 4V2FA 1KYZA 3JTHA 3BDDA 3KP4A 1VQOI 2F5EA 4MFDA 2A07F 4KN7X 4IHWA 3A1YA 4CICA 1S29A 2EFNA 1OCOH 3HOWJ 4DBQA 5D6EA 4KT6A 3NQOA 3P7NA 5DS9A 2V7FA 4RBOA 2NVUB 3VFZA 2JTVA 3HOTA 3DTEA 3CCVI 1PJRA 2TCTA 2R5YB 1D1CA 3R6SA 5FJ8J 2DMPA 4D7NA 4CHUA 1Y39A 2PBIA 2Z2SB 2DT5A 1MBHA 4RAGA 4NQWB 3ZR8X 5M3MJ 2DW4A 4D7MA 3ZQFA 2JA6J 4G7OF 1X1BA 1KGSA 3ZQGA 5GPAA 2HI3A 5M5YJ 2HQ5A 2IEKA 2E36A 1WJEA 2MH9A 3I5UA 2Y31A 2PMZA 3EUAA 2GOXB 1BR1A 2PMUA 4D5FA 2ME0A 3GEZA 2Y0SA 1MNEA 3KYLA 1ODDA 1Z7LA 4DZPA 4S0HB 3TDZC 1NH3A 3U21A 4L18B 2MA3A 4V19K 1X1DA 1WJDA 5CKTA 5A2QZ 2E5ZA 3OOUA 4M3FA 4YELA 5J8CA 3K2ZA 4RAYA 2VQLA 3HUGA 2BV6A 4GO1A 2KZVA 1IAWA 4A12A 3FXKA 4HSTA 3D0SA 5EJCA 3KCCA 1XGSA 2D45A 2X6OA 4M3GA 2VBYA 5JVTA 2QSGX 4BS9A 4PFPA 4BHCA 2E2JJ 4BL0B 1APLC 3BLYA 1JUSA 2E1MC 2FOWA 2EFWA 1D0YA 1LFBA 5L3DA 1ZHFA 3T8TA 2EQRA 3W6VA 2P7CB 4XKBA 5JHFA 3WGHA 1FBUA 1RNLA 2HVSA 3LOCA 3ELKA 4A3DJ 2OPTA 3D5RC 1R5HA 3KP3A 3Q9SA 2DA2A 4GYIA 2VT2A 3M1CA 1R00A 3GFMA 4KDPA 4ON0A 3TMOA 3LSTA 1IN7A 2ZJRF 2HFHA 2VKEA 3OS2A 2JSCA 2HOAA 1JGSA 4N4OB 3GXOA 3E6CC 3S1RJ 2QVOA 4GGGA 1PUFB 1QBJA 1TWCJ 4Z6YA 3DXJF 2CO5A 5DYMA 3CLQA 1WWXA 2UV1A 3RYRA 4XNFA 4E7SA 2VOOA 3BG9A 5CVVA 2PFBA 2CGPA 3KEYA 5AIPA 2Z16A 4KT5C 3R60A 3K70C 4FQGA 2XSJC 1KQ8A 3FXUA 3SYTA 2JZYA 1A36A 1IG7A 3MKWB 2M34A 3W3CA 3ZPLA 2DMUA 2IGMA 1W7PB 3HHGA 4MHGA 2XASA 3S2WA 2E1MB 2VLAA 2PI0A 2DAOA 1P7JA 3GMEA 4CDGA 5F27A 2DPUA 2IBDA 1RESA 2XRLA 3W6JB 4XBFA 3H9GA 4FHTA 5FLXZ 1B72B 3OYMA 3LFUA 4KUMA 1K78A 5EEHA 3P9KA 2NS7A 3GZ6A 3SQNA 1XGNA 2XHKA 5FROA 2XF6A 3F8NA 5JHUA 2FNAA 1SD7A 3IAM2 2JRTA 3GFJA 2AXLA 2XB5A 4E7HA 2IA1A 4PJ0C 2L4MA 3I56I 3MZYA 1X1CA 2LLKA 3BROA 2LY1A 2RNJA 2Z3YA 4EGYA 1IRGA 1F4KA 3B6CA 4IHYA 3J80K 1CF7B 2LSOA 1A5JA 2P0WA 1JTXA 2XV4S 3MKZA 1E2XA 2VASA 4J19A 1QNTA 2WTEA 4AM3A 1ETKA 1T2KA 3TGNA 1FTTA 3G73A 2W82A 4KIBA 1RUOA 3DTKA 4AU7A 3S1NJ 3ZMZA 4UNOA 3RIRA 1MH4A 2MYSA 1J7KA 4II2A 5FFXA 4G6DA 1O7LA 3P9CA 1YRNB 1UHMA 3IP4B 2M1BA 5CVJA 1LKXA 4GXOA 2FBIA 5LEKA 3OYGA 3AG3H 3F8BA 3CO6C 4EVIA 4DIQA 1R5ID 2TDXA 1CQTA 3TOAA 2NNNA 1QHGA 2MLGA 4XLCA 2YR2A 5IOYA 4JQFA 1IN6A 1G3SA 2VIXA 5K7HA 1WI3A 2P6SA 5GTHC 4H0EA 1VQ7I 2ZNYA 1IRFA 2YSRA 3MZHA 4PSWA 3C3WA 3J81K 1TC3C 1U78A 1K6YA 1LVAA 1OR7C 1ZN2A 1U3EM 3KZYA 2GIVA 3HIFA 3K9TA 5BQTA 4S05A 1O3SA 2FEZA 2VKVA 3FHZA 2BYVE 4ZYDA 3AG2H 3S15J 3I71A 1Z7UA 4F55A 3WG9A 3SZGA 1UZCA 2CSOA 2V9VA 3CJQB 3TW6A 2K85A 3UNGC 1P6RA 2ZFUA 3CF2A 5E20A 3VODA 2FMLA 2J5PA 4LG0A 5FO5A 3O8HA 1MMAA 4HA8A 4A3EJ 2BHZA 2DLLA 1G3TA 3LMMA 1ZRFA 1WRJA 2EZKA 4MFEA 5GTIC 4BNCA 3CDHA 5EG0B 4WXHA 1Z21A 1OYIA 3E5XA 2D5VA 5L3FA 5E3MA 1ETQA 2A5WA 2QZ8A 4RB0A 4UUSB 2HNHA 1OCZH 5DCFA 1RI7A 3HG9A 2PMZN 4YFXF 3OYBA 1T0FA 2K40A 3CMAI 1T38A 3HOUJ 2E7XA 2Y0SN 3CMMA 4XKCA 4IQJA 2QQ8A 1KU9A 3F6VA 1HSTA 5ICCA 2LD5A 4WXCA 1IRZA 1Z0XA 3HRSA 3RKQA 3GTKJ 3CP2A 1L3LA 1FOWA 2ZXIA 3JRAA 2DK8A 3OIQA 3ONQA 2HZTA 5ILVA 2VJ4A 2PG4A 3IC7A 2DQRA
chains in the Genus database with same CATH topology
3PQKA 4QLCU 5BPIA 5LHHA 2RV8A 1QQIA 3V8JA 1FP1D 3FF5A 2DI3A 2D2WA 2F5FA 3T5XA 5E18F 1Z6TA 3JAMK 3RYPA 2FA5A 1I6XA 4OIOF 4HLYA 4A2UA 4UVAA 5D5XB 3RI4A 3CO7C 2RN7A 2OZUA 1FBQA 4L9TA 1S6LA 4KMFA 3H92A 3KP6A 4ETSA 1FSHA 5BS6A 1KQ9A 1PP7U 4XLNF 2V6CA 2VT3A 5HS9A 2XAGA 3GZ5A 5FD6A 3WU0A 2K02A 3J80Z 4LMYA 5D8LB 4IRIA 4ESFA 5CYVA 3ZQ7A 4L5IA 1UCRA 3Q9VA 1MDMB 3QPHA 1RIOH 3HSEA 5L3CA 4Y17A 5DCMB 1SAXA 3HTUA 1MJBA 3KLNA 5CVIA 4YFKF 1R1VA 5BOXA 4OU0A 3PQJA 2EK5A 4ZYEA 1BJAA 5DD4A 2IPQX 2O0YA 1FBSA 3ZMUA 3J81Z 4KMUX 2A5YB 5J6XA 2VC1A 5IT3A 1L0OC 2D1VA 4P9UA 2COMA 2HKOA 1IXSB 2KJCA 1EH7A 2VBXA 3K1PA 3MWMA 1BC7C 2OZ6A 3RKYA 2L54A 4AIHA 4F7ZA 2DU9A 3R4KA 2K86A 3ZMSA 2JPBA 3P9IA 1HKQA 1W5SA 1J75A 5LLQA 4NB5A 4MQ9F 1YTYA 5FGMA 4R8HA 1O3QA 1QGPA 3F8MA 2BE5F 2Z5UA 2P4WA 3L09A 2OD5A 5E8GA 4IF4A 1XDSA 1XGOA 2WC2A 4IHTA 3WTSC 3ULQB 2MLKA 3IKVA 4OIPF 3R61A 2V1DA 1H9TA 1KYWA 1EH8A 2M87A 1SFUA 3GYHX 1T98A 2L3DA 1FZPB 2AS5F 3JAMZ 5D4RA 1MJ9A 1RZ4A 3E6MA 4N0BA 1U8RA 4OIQF 3WGGA 4A0XA 4BXUA 5HLHA 5K5QA 1RUNA 3EYYA 2EV0A 1J9IA 2KKOA 4LLGF 2FQ3A 4HX8A 3VOEA 4AIJA 2VONA 3DF8A 1P2FA 1I27A 2IP2A 4QWQA 3ABUA 1EH6A 3FWEA 4WWCA 3WGIA 4A6DA 4UXNA 1MGTA 4GYGA 4MEYF 2HGCA 3K1NA 1MD0A 5JR3A 3B02A 3CUQA 4L0ZB 5HDKA 3KEOA 5BMZA 2QUFA 3N97A 3BZ6A 1ZAOA 3AAFA 5DUKA 1HBXG 3I58A 4FT8A 4ENJA 3ZMVA 4U0YA 5CVRA 3IRQA 4I0AA 4U0WA 1PUEE 5E1XA 5E8IA 3M8EA 4PDKA 1XN7A 2UXNA 2W85A 3QOPA 2L01A 1R22A 2M5WA 3BWGA 3BPXA 3DQVC 5H6QA 5BPDA 1IXRC 3TO6A 1IZ1A 1H9GA 4EJUA 3L00A 4CZZA 1XMAA 3E3VA 4WF2A 4G6QA 3F23A 4ENMA 4AIKA 1K78B 4HV6A 5F1RA 3BPVA 3TKYA 3ML6A 2QM3A 4BYYA 3TQNA 5D5VB 1YYVA 4RGRA 2FU4A 2YU3A 1E17A 4ZZLA 4PCQA 2GA1A 4ZYGA 5ILUA 5HOOA 3H3UA 5ICFA 1Z9CA 1B1BA 4MTEA 1BI0A 4R79A 1G4DA 2V79A 3HYIA 2HQRA 2EWNA 3B73A 1G3YA 4M73A 4P55A 2Y75A 4PZJA 5ILSA 1J59A 3E5UA 1TQIA 1PP8F 1QO0D 4U7BA 2HQNA 5LGUA 1W5TA 3C1DA 2ACJA 1FLIA 3V8LA 1YW8A 4LG0B 3HTSB 2KIFA 3WODF 5ERIA 1W4MA 2DBBA 3DEUA 3C7JA 1LB2A 4LJZF 2ZCWA 4HF0A 4M9SA 1HW5A 4DQ2A 5HVQC 1ON1A 2FBHA 2FXAA 5FB2A 2RC4A 4HQEA 5KVRA 1IXCA 4DNCA 1V4RA 1FYLA 4HF2A 2NS0A 5D6FA 3QP5A 3I64A 2UWMA 3IHUA 3HRMA 1QZYA 3DV8A 1OYWA 3E6DA 5LRRA 2RDPA 4ZYHA 1LEBA 5JI6A 3O6BB 1OYYA 2VN2A 1BI3A 3ZN1A 2ZMEB 1FPQA 3I4PA 1SMYF 5E1WA 2QWWA 3PFIA 4NQWA 3REOA 2EA2A 4HDUA 5F64A 4XLPF 2A68F 1S7AA 5H20A 4Q5SF 2IA2A 2VOPA 3M9AA 2ZJ2A 2K4JA 1FP2A 4UVBA 1YFHA 3LA3A 4ESBA 5TRDA 2MBFA 1TTYA 3I54A 1FYMA 2PQ8A 4OMZA 2ISZA 2P5VA 1ZGJA 3FMQA 1MKMA 4I09A 2WWYA 4HYEA 4MQVA 1WI9A 3TOBA 3L7WA 4HX7A 3WTTC 2VC0A 5FFZA 2F5CA 2M30A 1SD6A 2HWVA 1UFMA 3KP2A 1XCVA 4P5OA 1FOKA 1HKTA 4O5VA 3GWZA 5ICGA 2R3SA 5L3EA 1BIBA 2ADUA 3EQLF 2W24A 1BC8C 2Z9OA 3T8RA 1TW3A 3DFGA 1JE8A 4UV8A 3MCZA 2EB7A 2L02A 4O6JA 4R1HA 2QQ9A 5K5OA 1S8NA 3O2PE 3M8FA 1J5YA 1ZRCA 2QLZA 5HDNA 3I0TA 3RKWA 3JTGA 1U6GA 2O61A 1P4AA 4L0YB 1W7PA 3WTYC 2D1HA 3DKWA 2HDCA 1YG2A 1R7JA 1S7OA 1HXDA 4EV0A 2XAFA 3FMSA 2ESNA 4L5JA 2CG4A 2PJPA 2OAZA 4Q47A 1GHCA 2QYOA 1R1TA 4YG2F 1XD7A 3IL2A 1R36A 4ESJA 1D8KA 3DPTA 3I53A 3F22A 2IVMA 2Y48A 2OU2A 1HSJA 4HBLA 2YPRA 3W6KB 3GO5A 3U9GA 1XSXA 1Q1HA 2NRAC 5JFRA 2JT1A 3DPLC 3HSFA 4I98B 2Z99A 1LNWA 1Z1DA 4UUVA 1Z05A 2FBKA 1X3UA 3O3KA 2G9WA 4U88A 5FD5A 5TJJA 4M9XA 2G7UA 2KIUA 2IRFG 3LWFA 3CTAA 2ESHA 5H6RA 1U2WA 1LEAA 3IRRA 2EFPA 2FF4A 2MH2A 3N4MA 2NNYA 5KK1A 1BM9A 4M71A 4KIGA 2H6CA 2HOEA 2MD5A 4A5NA 2H09A 2GAUA 2IW5A 3BJAA 1FY7A 4AWXB 2FMYA 3MEXA 1QPMA 2STTA 2E1CA 2O6GE 2XRNA 3V8KA 4TV7A 2O8XA 1FSEA 2XKPA 3CUQB 1DDNA 2KJBA 4MGRA 3RPUA 4KICA 1ZGAA 3T0YA 2ZBKA 5J8FA 2PEXA 2UXXA 1XSDA 3BP8A 4LB6B 2CWEA 3SXYA 1J0RA 1B4AA 4KFCA 4Y13A 1UHWA 4MNUA 2OQRA 4N9HA 2Z33A 1OR7A 3F8FA 3LFKA 2QBYA 2VBWA 4KIFA 1TBXA 2Y0MA 1BOAA 1OMIA 1ZARA 2LF8A 2W25A 1W7PD 1S3JA 1BN5A 3I59B 4IRHA 3LA2A 4WCGA 5F6FA 4HLXA 4LLLA 3WE3A 2STWA 5LGTA 3F6OA 2X4HA 3M1EA 3JSOA 2CQKA 3LQQA 1T39A 4CXFA 3U1DA 4LD5A 2X0LA 4HAMA 1J2XA 1B9MA 3QRFF 4RGUA 3WTXC 4RGSA 1BI1A 2BBYA 2W57A 2A6EF 3C18A 1MDMA 1YQAA 2DQLA 2OA4A 3RDIA 2IA0A 2DFIA 3MAJA 3KE2A 1IF1A 1KU7A 4PGGA 3EUHA 1YW7A 5D5WB 1U5TA 2Q0OA 2EA4A 1SFEA 4RB2C 1FWZA 2YX7A 2B0LA 2KRFA 1I5ZA 4OIRF 4LK0F 2CFXA 2MC3A 2ZKZA 4OMYA 3LAJA 2ELHA 3WTWC 2P7VB 5CJ9A 2ETHA 2VE8A 1AOYA 1SD5A 3JW4A 3ERED 3EETA 2EJRA 3F21A 3QP6A 1D8JA 4YFNF 5E1ZB 5L3BA 2H6BA 4RGXA 4Q48A 3E5QA 1T6SA 3V4GA 4M6YA 3ZMDA 5AIQA 4O3MA 1FC3A 4L9NA 2PN6A 3LQRA 1O3TA 5HS7A 4BHPA 3ZMTA 2DTRA 4L9JA 2XVCA 1DPUA 4A6EA 1XB4A 4KA4A 3FM3A 1Z6RA 1F1ZA 2H94A 3RTRA 1P4XA 4CO8A 2RKHA 2OBPA 1PDNC 4EMSA 3IKTA 2YX4A 1DUXC 4RB1A 4G7HF 1ZRDA 2ZFWA 5LHGA 2BEOA 1B59A 1YLFA 1ZG5A 2XAQA 4JK1X 4Q4ZF 4Z2YA 2LDUA 4PGHA 4I0BA 2L4AA 3ECOA 4IHSA 2KIMA 3V7SA 4G9YA 2E7WA 4L9VA 4LB5A 3FXQA 1P92A 1VTNC 1BI2A 3WTUC 3FZVA 1KU2A 3QPTA 3KEQA 1FX7A 3R0AA 3TDUC 1QZZA 2F2EA 2FSWA 2DPDA 5ICEA 4CGZA 1KU3A 1FNNA 1TLHB 4EGZA 1SD4A 1F5TA 1TQMA 2ISYA 2RVCA 3CUOA 4FX0A 4WK8F 2NYXA 4ZH4F 4P96A 2PLYA 2M8EA 1KA8A 4EM2A 4K2EA 4LK1F 2R7DA 1DP7P 4YIIA 1R58A 2GWRA 2P5LC 2F5DA 4A5MA 4Y15A 4U7DA 4G8XA 1R23A 1D3YA 4UHTA 3BOQA 1KQ0A 4ENNA 2GXGA 1ZYRF 3D5LA 2V1XA 1D5VA 3JSPA 3HOSA 3GF2A 1HW2A 2XAJA 1B9NA 5DV5A 4HDVA 1IN4A 4G7ZF 3G3ZA 3K0LA 3HRUA 2CYYA 2CW0F 1UB9A 5DUIA 4RB3C 4IPAA 1JHHA 1ZREA 3COAC 1SMTA 3ZP5A 4ASNA 4U0VA 2XROA 3V7RA 4YIFA 2VE9A 3V7CA 1XCBA 3RPQA 1H0MA 3GFLA 4LLNA 2XUBA 2VBZA 5DDGA 5D5UB 4S04A 2K4BA 3RJPA 1WQ2A 1I1SA 4D0PA 2VODA 2HYGD 2W84A 1Z91A 1EV7A 2RGVA 2K27A 2FNPA 4ZZDA 2V1UA 2FOKA 1I1GA 4E70A 1OKRA 5HLGA 4IRGA 4AVPA 4UVCA 3KETA 3ECHA 2HS5A 1YS6A 5HDGA 2HTJA 4I2OA 5IT9K 4IXAA 2IT0A 2P5KA 3WTZA 2ZO4A 4EM0B 2BGCA 3MQ0A 4A0YA 3H3ZA 4M72A 1MJAA 4NHJA 2J5OA 3DP7A 1GXQA 1ZLJA 4RS8A 1ZG1A 3HHHA 1G3WA 4WXDA 5CVUA 1LDDA 1ZH5A 3FX3A 1HQCA 1IN5A 1IW7F 1TNTA 2OQGA 4FX4A 2HYFA 4HF1A 4OINF 3KZZA 4HV5A 1C0WA 4I7HA 2H27A 3Q5FA 2DK5A 3F8CA 5D4SA 4EM1A 4N9IA 3F3XA 1XSVA 5L3GA 3KP7A 3FM5A 3GVAA 4HX4A 1ULYA 2K7LA 2QBYB 1MZBA 3KP5A 3QU3A 5LBQA 3E6BA 5D8KB 4B8XA 2QENA 2O3FA 3QAHA 4XSZF 3TO9A 1WKMA 3SFZA 2FRHA 1U5TC 4BAYA 3CJNA 2A61A 1CF7A 1IUYA 4MEXF 1HW1A 1DPRA 2ZMEA 1USTA 2QQAA 1YO5C 1FYKA 1LDKB 5K5RA 2PMHA 4IVNA 2HKXA 3CUQC 2NAZA 3ABTA 1NHAA 2A3SA 1B6AA 5HS8A 4M6XA 5CLSA 3U2RA 2LKPA 5ED4A 2EFOA 1A04A 1ZLKA 2VXZA 2ZNZA 3QU6A 3CLOA 3WU1B 1R5GA 3R0JA 5DD8A 3ROUA 1O3RA 1JXSA 4EQQA 1U5TB 2XKOA 3L2CA 1O7FA 3LAPA 2GA2A 3SHFA 2GQQA 1TQPA 3SZPA 2HEOA 1R1UA 3IWFA 5AONA 2IJLA 4I02A 3ZN0A 5IT9Z 5LRSA 3SZTA 3NRVA 1Y0UA 3NEUA 1IN8A 1STZA 2ZXJA 3BJ6A 1YIOA 4B09A 4OOIA 2JPCA 3L9FA 3FMRA 2LNBA 2E1NA 4RAZA 4KN4X 1YS7A 1O57A 4A0ZA 1G6NA 1F9NA 2HR3A 3BJOA 1BBYA 4WX9A 3E97A 3T1BA 3TO7A 3FXRA 3MFKA 2Q8KA 3HSRA 4I01A 3GX4X 2RQPA 3GLXA 3EYIA 3VEPA 5EEGA 1USSA 1LDJA 4AD9A 2QQBA 4HQMA 4BH9A 4EJOA 2HTSA 2XAHA 1K7AA 1TW2A 4EJVA 3OOPA 2UZKA 1FT9A 1LQ1A 5E17F 1ON2A 2EV5A 5LHIA 2R7FA 4UV9A 5A2QK 1CGPA 4JBAA 1YW9A 3GFIA 5LGNA 4BHBA 4HZFA 2XIGA 3BY6A 4XRFA 5DCMA 4GCVA 2GZWA 4P9FA 5K1YA 3K1MA 5DEQA 1P4WA 6PAXA 1XMKA 4XSXF 4KYWA 1OPCA 3K69A 2O03A 1ONVA 2G7HA 3HRTA 4G94A 3IWZA 1JHFA 2M45A 1XDUA 3OV8A 1GVJA 3GW2A 3J7AO 1BIAA 4BQAA 1K79A 2WV0A 4EJTA 1HKSA 2EFQA 4MTDA 1REPC 3WE2A 3GUDA 4HW0A 2GXBA 1TNSA 3KFWX 2A6HF 2Q2EA 3M7GA 2FE3A 1SFXA 2A69F 4HOBA 5HLIA 3LA7A 4CYDA 2P6TA 2EV6A 2XGXA 4EJWA 3VB2A 2C6YA 4LGWA 5LEJA 3EDPA 2P8TA 2DO7A 4IJAA 1WSUA 4LFUA 5FLXK 4KNYA 1LJ9A 1K6OA 1V3FA 4M74A 4M9ZA 1AWCA 3F72A 1GXPA 1XGMA 1ZG3A 3WTVC 3KLOA 3ISPA 3I59A 2LF7A 4ENKA 3RKXA 1KYZA 3JTHA 3BDDA 3KP4A 2A07F 2F5EA 4KN7X 4CICA 1S29A 2EFNA 5D6EA 3NQOA 3P7NA 3VFZA 2JTVA 3HOTA 3R6SA 4CHUA 2PBIA 2DT5A 2DW4A 4G7OF 1KGSA 2MH9A 3I5UA 2PMUA 3GEZA 1ODDA 3TDZC 4L18B 2MA3A 5A2QZ 5J8CA 3K2ZA 4RAYA 3HUGA 2BV6A 4GO1A 1IAWA 4A12A 3D0SA 3KCCA 1XGSA 2D45A 2VBYA 5JVTA 4BHCA 2EFWA 5L3DA 1ZHFA 3T8TA 2P7CB 3WGHA 1FBUA 1RNLA 3ELKA 1R5HA 3KP3A 3Q9SA 4GYIA 2VT2A 1R00A 3GFMA 4KDPA 4ON0A 3LSTA 1IN7A 2HFHA 2JSCA 1JGSA 3GXOA 3E6CC 2QVOA 4GGGA 1QBJA 3DXJF 2CO5A 5DYMA 1WWXA 3RYRA 2VOOA 5CVVA 2PFBA 2CGPA 5AIPA 4KT5C 3R60A 1KQ8A 3FXUA 2JZYA 3ZPLA 1W7PB 3HHGA 4MHGA 2XASA 3S2WA 2PI0A 2DAOA 4CDGA 2DPUA 3W6JB 4XBFA 4FHTA 5FLXZ 4KUMA 1K78A 5EEHA 3P9KA 3GZ6A 3SQNA 1XGNA 2XHKA 5JHUA 3F8NA 2FNAA 1SD7A 2JRTA 3GFJA 2AXLA 2IA1A 2L4MA 3MZYA 3BROA 2RNJA 2Z3YA 4EGYA 1IRGA 1F4KA 3J80K 1CF7B 2LSOA 2XV4S 1E2XA 1QNTA 2WTEA 1T2KA 3TGNA 3G73A 1RUOA 4KIBA 3ZMZA 4UNOA 3RIRA 1J7KA 5FFXA 4G6DA 1O7LA 3P9CA 1UHMA 2M1BA 5CVJA 4GXOA 2FBIA 5LEKA 3F8BA 3CO6C 4EVIA 2TDXA 3TOAA 2NNNA 2MLGA 2YR2A 4JQFA 1IN6A 1G3SA 2P6SA 4H0EA 2ZNYA 1IRFA 2YSRA 3MZHA 3C3WA 3J81K 1U78A 1LVAA 1ZN2A 1U3EM 3KZYA 2GIVA 3HIFA 3K9TA 5BQTA 4S05A 1O3SA 2FEZA 3FHZA 2BYVE 4ZYDA 3I71A 1Z7UA 3WG9A 2CSOA 2V9VA 1P6RA 5E20A 3VODA 2FMLA 2J5PA 4LG0A 5FO5A 4HA8A 2DLLA 1G3TA 1ZRFA 1WRJA 4BNCA 3CDHA 4WXHA 1OYIA 3E5XA 5L3FA 4RB0A 2QZ8A 5DCFA 1RI7A 4YFXF 1T0FA 1T38A 2E7XA 1KU9A 3F6VA 1HSTA 5ICCA 4WXCA 3HRSA 1L3LA 2DK8A 2HZTA 5ILVA 2PG4A 3IC7A 2DQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PQK A;  4QLC U;  5BPI A;  5LHH A;  2RV8 A;  1QQI A;  3V8J A;  1FP1 D;  3FF5 A;  2DI3 A;  2D2W A;  2F5F A;  3T5X A;  5E18 F;  1Z6T A;  3JAM K;  3RYP A;  2FA5 A;  1I6X A;  4OIO F;  4HLY A;  4A2U A;  4UVA A;  5D5X B;  3RI4 A;  3CO7 C;  2RN7 A;  2OZU A;  1FBQ A;  4L9T A;  1S6L A;  4KMF A;  3H92 A;  3KP6 A;  4ETS A;  1FSH A;  5BS6 A;  1KQ9 A;  1PP7 U;  4XLN F;  2V6C A;  2VT3 A;  5HS9 A;  2XAG A;  3GZ5 A;  5FD6 A;  3WU0 A;  2K02 A;  3J80 Z;  4LMY A;  5D8L B;  4IRI A;  4ESF A;  5CYV A;  3ZQ7 A;  4L5I A;  1UCR A;  3Q9V A;  1MDM B;  3QPH A;  1RIO H;  3HSE A;  5L3C A;  4Y17 A;  5DCM B;  1SAX A;  3HTU A;  1MJB A;  3KLN A;  5CVI A;  4YFK F;  1R1V A;  5BOX A;  4OU0 A;  3PQJ A;  2EK5 A;  4ZYE A;  1BJA A;  5DD4 A;  2IPQ X;  2O0Y A;  1FBS A;  3ZMU A;  3J81 Z;  4KMU X;  2A5Y B;  5J6X A;  2VC1 A;  5IT3 A;  1L0O C;  2D1V A;  4P9U A;  2COM A;  2HKO A;  1IXS B;  2KJC A;  1EH7 A;  2VBX A;  3K1P A;  3MWM A;  1BC7 C;  2OZ6 A;  3RKY A;  2L54 A;  4AIH A;  4F7Z A;  2DU9 A;  3R4K A;  2K86 A;  3ZMS A;  2JPB A;  3P9I A;  1HKQ A;  1W5S A;  1J75 A;  5LLQ A;  4NB5 A;  4MQ9 F;  1YTY A;  5FGM A;  4R8H A;  1O3Q A;  1QGP A;  3F8M A;  2BE5 F;  2Z5U A;  2P4W A;  3L09 A;  2OD5 A;  5E8G A;  4IF4 A;  1XDS A;  1XGO A;  2WC2 A;  4IHT A;  3WTS C;  3ULQ B;  2MLK A;  3IKV A;  4OIP F;  3R61 A;  2V1D A;  1H9T A;  1KYW A;  1EH8 A;  2M87 A;  1SFU A;  3GYH X;  1T98 A;  2L3D A;  1FZP B;  2AS5 F;  3JAM Z;  5D4R A;  1MJ9 A;  1RZ4 A;  3E6M A;  4N0B A;  1U8R A;  4OIQ F;  3WGG A;  4A0X A;  4BXU A;  5HLH A;  5K5Q A;  1RUN A;  3EYY A;  2EV0 A;  1J9I A;  2KKO A;  4LLG F;  2FQ3 A;  4HX8 A;  3VOE A;  4AIJ A;  2VON A;  3DF8 A;  1P2F A;  1I27 A;  2IP2 A;  4QWQ A;  3ABU A;  1EH6 A;  3FWE A;  4WWC A;  3WGI A;  4A6D A;  4UXN A;  1MGT A;  4GYG A;  4MEY F;  2HGC A;  3K1N A;  1MD0 A;  5JR3 A;  3B02 A;  3CUQ A;  4L0Z B;  5HDK A;  3KEO A;  5BMZ A;  2QUF A;  3N97 A;  3BZ6 A;  1ZAO A;  3AAF A;  5DUK A;  1HBX G;  3I58 A;  4FT8 A;  4ENJ A;  3ZMV A;  4U0Y A;  5CVR A;  3IRQ A;  4I0A A;  4U0W A;  1PUE E;  5E1X A;  5E8I A;  3M8E A;  4PDK A;  1XN7 A;  2UXN A;  2W85 A;  3QOP A;  2L01 A;  1R22 A;  2M5W A;  3BWG A;  3BPX A;  3DQV C;  5H6Q A;  5BPD A;  1IXR C;  3TO6 A;  1IZ1 A;  1H9G A;  4EJU A;  3L00 A;  4CZZ A;  1XMA A;  3E3V A;  4WF2 A;  4G6Q A;  3F23 A;  4ENM A;  4AIK A;  1K78 B;  4HV6 A;  5F1R A;  3BPV A;  3TKY A;  3ML6 A;  2QM3 A;  4BYY A;  3TQN A;  5D5V B;  1YYV A;  4RGR A;  2FU4 A;  2YU3 A;  1E17 A;  4ZZL A;  4PCQ A;  2GA1 A;  4ZYG A;  5ILU A;  5HOO A;  3H3U A;  5ICF A;  1Z9C A;  1B1B A;  4MTE A;  1BI0 A;  4R79 A;  1G4D A;  2V79 A;  3HYI A;  2HQR A;  2EWN A;  3B73 A;  1G3Y A;  4M73 A;  4P55 A;  2Y75 A;  4PZJ A;  5ILS A;  1J59 A;  3E5U A;  1TQI A;  1PP8 F;  1QO0 D;  4U7B A;  2HQN A;  5LGU A;  1W5T A;  3C1D A;  2ACJ A;  1FLI A;  3V8L A;  1YW8 A;  4LG0 B;  3HTS B;  2KIF A;  3WOD F;  5ERI A;  1W4M A;  2DBB A;  3DEU A;  3C7J A;  1LB2 A;  4LJZ F;  2ZCW A;  4HF0 A;  4M9S A;  1HW5 A;  4DQ2 A;  5HVQ C;  1ON1 A;  2FBH A;  2FXA A;  5FB2 A;  2RC4 A;  4HQE A;  5KVR A;  1IXC A;  4DNC A;  1V4R A;  1FYL A;  4HF2 A;  2NS0 A;  5D6F A;  3QP5 A;  3I64 A;  2UWM A;  3IHU A;  3HRM A;  1QZY A;  3DV8 A;  1OYW A;  3E6D A;  5LRR A;  2RDP A;  4ZYH A;  1LEB A;  5JI6 A;  3O6B B;  1OYY A;  2VN2 A;  1BI3 A;  3ZN1 A;  2ZME B;  1FPQ A;  3I4P A;  1SMY F;  5E1W A;  2QWW A;  3PFI A;  4NQW A;  3REO A;  2EA2 A;  4HDU A;  5F64 A;  4XLP F;  2A68 F;  1S7A A;  5H20 A;  4Q5S F;  2IA2 A;  2VOP A;  3M9A A;  2ZJ2 A;  2K4J A;  1FP2 A;  4UVB A;  1YFH A;  3LA3 A;  4ESB A;  5TRD A;  2MBF A;  1TTY A;  3I54 A;  1FYM A;  2PQ8 A;  4OMZ A;  2ISZ A;  2P5V A;  1ZGJ A;  3FMQ A;  1MKM A;  4I09 A;  2WWY A;  4HYE A;  4MQV A;  1WI9 A;  3TOB A;  3L7W A;  4HX7 A;  3WTT C;  2VC0 A;  5FFZ A;  2F5C A;  2M30 A;  1SD6 A;  2HWV A;  1UFM A;  3KP2 A;  1XCV A;  4P5O A;  1FOK A;  1HKT A;  4O5V A;  3GWZ A;  5ICG A;  2R3S A;  5L3E A;  1BIB A;  2ADU A;  3EQL F;  2W24 A;  1BC8 C;  2Z9O A;  3T8R A;  1TW3 A;  3DFG A;  1JE8 A;  4UV8 A;  3MCZ A;  2EB7 A;  2L02 A;  4O6J A;  4R1H A;  2QQ9 A;  5K5O A;  1S8N A;  3O2P E;  3M8F A;  1J5Y A;  1ZRC A;  2QLZ A;  5HDN A;  3I0T A;  3RKW A;  3JTG A;  1U6G A;  2O61 A;  1P4A A;  4L0Y B;  1W7P A;  3WTY C;  2D1H A;  3DKW A;  2HDC A;  1YG2 A;  1R7J A;  1S7O A;  1HXD A;  4EV0 A;  2XAF A;  3FMS A;  2ESN A;  4L5J A;  2CG4 A;  2PJP A;  2OAZ A;  4Q47 A;  1GHC A;  2QYO A;  1R1T A;  4YG2 F;  1XD7 A;  3IL2 A;  1R36 A;  4ESJ A;  1D8K A;  3DPT A;  3I53 A;  3F22 A;  2IVM A;  2Y48 A;  2OU2 A;  1HSJ A;  4HBL A;  2YPR A;  3W6K B;  3GO5 A;  3U9G A;  1XSX A;  1Q1H A;  2NRA C;  5JFR A;  2JT1 A;  3DPL C;  3HSF A;  4I98 B;  2Z99 A;  1LNW A;  1Z1D A;  4UUV A;  1Z05 A;  2FBK A;  1X3U A;  3O3K A;  2G9W A;  4U88 A;  5FD5 A;  5TJJ A;  4M9X A;  2G7U A;  2KIU A;  2IRF G;  3LWF A;  3CTA A;  2ESH A;  5H6R A;  1U2W A;  1LEA A;  3IRR A;  2EFP A;  2FF4 A;  2MH2 A;  3N4M A;  2NNY A;  5KK1 A;  1BM9 A;  4M71 A;  4KIG A;  2H6C A;  2HOE A;  2MD5 A;  4A5N A;  2H09 A;  2GAU A;  2IW5 A;  3BJA A;  1FY7 A;  4AWX B;  2FMY A;  3MEX A;  1QPM A;  2STT A;  2E1C A;  2O6G E;  2XRN A;  3V8K A;  4TV7 A;  2O8X A;  1FSE A;  2XKP A;  3CUQ B;  1DDN A;  2KJB A;  4MGR A;  3RPU A;  4KIC A;  1ZGA A;  3T0Y A;  2ZBK A;  5J8F A;  2PEX A;  2UXX A;  1XSD A;  3BP8 A;  4LB6 B;  2CWE A;  3SXY A;  1J0R A;  1B4A A;  4KFC A;  4Y13 A;  1UHW A;  4MNU A;  2OQR A;  4N9H A;  2Z33 A;  1OR7 A;  3F8F A;  3LFK A;  2QBY A;  2VBW A;  4KIF A;  1TBX A;  2Y0M A;  1BOA A;  1OMI A;  1ZAR A;  2LF8 A;  2W25 A;  1W7P D;  1S3J A;  1BN5 A;  3I59 B;  4IRH A;  3LA2 A;  4WCG A;  5F6F A;  4HLX A;  4LLL A;  3WE3 A;  2STW A;  5LGT A;  3F6O A;  2X4H A;  3M1E A;  3JSO A;  2CQK A;  3LQQ A;  1T39 A;  4CXF A;  3U1D A;  4LD5 A;  2X0L A;  4HAM A;  1J2X A;  1B9M A;  3QRF F;  4RGU A;  3WTX C;  4RGS A;  1BI1 A;  2BBY A;  2W57 A;  2A6E F;  3C18 A;  1MDM A;  1YQA A;  2DQL A;  2OA4 A;  3RDI A;  2IA0 A;  2DFI A;  3MAJ A;  3KE2 A;  1IF1 A;  1KU7 A;  4PGG A;  3EUH A;  1YW7 A;  5D5W B;  1U5T A;  2Q0O A;  2EA4 A;  1SFE A;  4RB2 C;  1FWZ A;  2YX7 A;  2B0L A;  2KRF A;  1I5Z A;  4OIR F;  4LK0 F;  2CFX A;  2MC3 A;  2ZKZ A;  4OMY A;  3LAJ A;  2ELH A;  3WTW C;  2P7V B;  5CJ9 A;  2ETH A;  2VE8 A;  1AOY A;  1SD5 A;  3JW4 A;  3ERE D;  3EET A;  2EJR A;  3F21 A;  3QP6 A;  1D8J A;  4YFN F;  5E1Z B;  5L3B A;  2H6B A;  4RGX A;  4Q48 A;  3E5Q A;  1T6S A;  3V4G A;  4M6Y A;  3ZMD A;  5AIQ A;  4O3M A;  1FC3 A;  4L9N A;  2PN6 A;  3LQR A;  1O3T A;  5HS7 A;  4BHP A;  3ZMT A;  2DTR A;  4L9J A;  2XVC A;  1DPU A;  4A6E A;  1XB4 A;  4KA4 A;  3FM3 A;  1Z6R A;  1F1Z A;  2H94 A;  3RTR A;  1P4X A;  4CO8 A;  2RKH A;  2OBP A;  1PDN C;  4EMS A;  3IKT A;  2YX4 A;  1DUX C;  4RB1 A;  4G7H F;  1ZRD A;  2ZFW A;  5LHG A;  2BEO A;  1B59 A;  1YLF A;  1ZG5 A;  2XAQ A;  4JK1 X;  4Q4Z F;  4Z2Y A;  2LDU A;  4PGH A;  4I0B A;  2L4A A;  3ECO A;  4IHS A;  2KIM A;  3V7S A;  4G9Y A;  2E7W A;  4L9V A;  4LB5 A;  3FXQ A;  1P92 A;  1VTN C;  1BI2 A;  3WTU C;  3FZV A;  1KU2 A;  3QPT A;  3KEQ A;  1FX7 A;  3R0A A;  3TDU C;  1QZZ A;  2F2E A;  2FSW A;  2DPD A;  5ICE A;  4CGZ A;  1KU3 A;  1FNN A;  1TLH B;  4EGZ A;  1SD4 A;  1F5T A;  1TQM A;  2ISY A;  2RVC A;  3CUO A;  4FX0 A;  4WK8 F;  2NYX A;  4ZH4 F;  4P96 A;  2PLY A;  2M8E A;  1KA8 A;  4EM2 A;  4K2E A;  4LK1 F;  2R7D A;  1DP7 P;  4YII A;  1R58 A;  2GWR A;  2P5L C;  2F5D A;  4A5M A;  4Y15 A;  4U7D A;  4G8X A;  1R23 A;  1D3Y A;  4UHT A;  3BOQ A;  1KQ0 A;  4ENN A;  2GXG A;  1ZYR F;  3D5L A;  2V1X A;  1D5V A;  3JSP A;  3HOS A;  3GF2 A;  1HW2 A;  2XAJ A;  1B9N A;  5DV5 A;  4HDV A;  1IN4 A;  4G7Z F;  3G3Z A;  3K0L A;  3HRU A;  2CYY A;  2CW0 F;  1UB9 A;  5DUI A;  4RB3 C;  4IPA A;  1JHH A;  1ZRE A;  3COA C;  1SMT A;  3ZP5 A;  4ASN A;  4U0V A;  2XRO A;  3V7R A;  4YIF A;  2VE9 A;  3V7C A;  1XCB A;  3RPQ A;  1H0M A;  3GFL A;  4LLN A;  2XUB A;  2VBZ A;  5DDG A;  5D5U B;  4S04 A;  2K4B A;  3RJP A;  1WQ2 A;  1I1S A;  4D0P A;  2VOD A;  2HYG D;  2W84 A;  1Z91 A;  1EV7 A;  2RGV A;  2K27 A;  2FNP A;  4ZZD A;  2V1U A;  2FOK A;  1I1G A;  4E70 A;  1OKR A;  5HLG A;  4IRG A;  4AVP A;  4UVC A;  3KET A;  3ECH A;  2HS5 A;  1YS6 A;  5HDG A;  2HTJ A;  4I2O A;  5IT9 K;  4IXA A;  2IT0 A;  2P5K A;  3WTZ A;  2ZO4 A;  4EM0 B;  2BGC A;  3MQ0 A;  4A0Y A;  3H3Z A;  4M72 A;  1MJA A;  4NHJ A;  2J5O A;  3DP7 A;  1GXQ A;  1ZLJ A;  4RS8 A;  1ZG1 A;  3HHH A;  1G3W A;  4WXD A;  5CVU A;  1LDD A;  1ZH5 A;  3FX3 A;  1HQC A;  1IN5 A;  1IW7 F;  1TNT A;  2OQG A;  4FX4 A;  2HYF A;  4HF1 A;  4OIN F;  3KZZ A;  4HV5 A;  1C0W A;  4I7H A;  2H27 A;  3Q5F A;  2DK5 A;  3F8C A;  5D4S A;  4EM1 A;  4N9I A;  3F3X A;  1XSV A;  5L3G A;  3KP7 A;  3FM5 A;  3GVA A;  4HX4 A;  1ULY A;  2K7L A;  2QBY B;  1MZB A;  3KP5 A;  3QU3 A;  5LBQ A;  3E6B A;  5D8K B;  4B8X A;  2QEN A;  2O3F A;  3QAH A;  4XSZ F;  3TO9 A;  1WKM A;  3SFZ A;  2FRH A;  1U5T C;  4BAY A;  3CJN A;  2A61 A;  1CF7 A;  1IUY A;  4MEX F;  1HW1 A;  1DPR A;  2ZME A;  1UST A;  2QQA A;  1YO5 C;  1FYK A;  1LDK B;  5K5R A;  2PMH A;  4IVN A;  2HKX A;  3CUQ C;  2NAZ A;  3ABT A;  1NHA A;  2A3S A;  1B6A A;  5HS8 A;  4M6X A;  5CLS A;  3U2R A;  2LKP A;  5ED4 A;  2EFO A;  1A04 A;  1ZLK A;  2VXZ A;  2ZNZ A;  3QU6 A;  3CLO A;  3WU1 B;  1R5G A;  3R0J A;  5DD8 A;  3ROU A;  1O3R A;  1JXS A;  4EQQ A;  1U5T B;  2XKO A;  3L2C A;  1O7F A;  3LAP A;  2GA2 A;  3SHF A;  2GQQ A;  1TQP A;  3SZP A;  2HEO A;  1R1U A;  3IWF A;  5AON A;  2IJL A;  4I02 A;  3ZN0 A;  5IT9 Z;  5LRS A;  3SZT A;  3NRV A;  1Y0U A;  3NEU A;  1IN8 A;  1STZ A;  2ZXJ A;  3BJ6 A;  1YIO A;  4B09 A;  4OOI A;  2JPC A;  3L9F A;  3FMR A;  2LNB A;  2E1N A;  4RAZ A;  4KN4 X;  1YS7 A;  1O57 A;  4A0Z A;  1G6N A;  1F9N A;  2HR3 A;  3BJO A;  1BBY A;  4WX9 A;  3E97 A;  3T1B A;  3TO7 A;  3FXR A;  3MFK A;  2Q8K A;  3HSR A;  4I01 A;  3GX4 X;  2RQP A;  3GLX A;  3EYI A;  3VEP A;  5EEG A;  1USS A;  1LDJ A;  4AD9 A;  2QQB A;  4HQM A;  4BH9 A;  4EJO A;  2HTS A;  2XAH A;  1K7A A;  1TW2 A;  4EJV A;  3OOP A;  2UZK A;  1FT9 A;  1LQ1 A;  5E17 F;  1ON2 A;  2EV5 A;  5LHI A;  2R7F A;  4UV9 A;  5A2Q K;  1CGP A;  4JBA A;  1YW9 A;  3GFI A;  5LGN A;  4BHB A;  4HZF A;  2XIG A;  3BY6 A;  4XRF A;  5DCM A;  4GCV A;  2GZW A;  4P9F A;  5K1Y A;  3K1M A;  5DEQ A;  1P4W A;  6PAX A;  1XMK A;  4XSX F;  4KYW A;  1OPC A;  3K69 A;  2O03 A;  1ONV A;  2G7H A;  3HRT A;  4G94 A;  3IWZ A;  1JHF A;  2M45 A;  1XDU A;  3OV8 A;  1GVJ A;  3GW2 A;  3J7A O;  1BIA A;  4BQA A;  1K79 A;  2WV0 A;  4EJT A;  1HKS A;  2EFQ A;  4MTD A;  1REP C;  3WE2 A;  3GUD A;  4HW0 A;  2GXB A;  1TNS A;  3KFW X;  2A6H F;  2Q2E A;  3M7G A;  2FE3 A;  1SFX A;  2A69 F;  4HOB A;  5HLI A;  3LA7 A;  4CYD A;  2P6T A;  2EV6 A;  2XGX A;  4EJW A;  3VB2 A;  2C6Y A;  4LGW A;  5LEJ A;  3EDP A;  2P8T A;  2DO7 A;  4IJA A;  1WSU A;  4LFU A;  5FLX K;  4KNY A;  1LJ9 A;  1K6O A;  1V3F A;  4M74 A;  4M9Z A;  1AWC A;  3F72 A;  1GXP A;  1XGM A;  1ZG3 A;  3WTV C;  3KLO A;  3ISP A;  3I59 A;  2LF7 A;  4ENK A;  3RKX A;  1KYZ A;  3JTH A;  3BDD A;  3KP4 A;  2A07 F;  2F5E A;  4KN7 X;  4CIC A;  1S29 A;  2EFN A;  5D6E A;  3NQO A;  3P7N A;  3VFZ A;  2JTV A;  3HOT A;  3R6S A;  4CHU A;  2PBI A;  2DT5 A;  2DW4 A;  4G7O F;  1KGS A;  2MH9 A;  3I5U A;  2PMU A;  3GEZ A;  1ODD A;  3TDZ C;  4L18 B;  2MA3 A;  5A2Q Z;  5J8C A;  3K2Z A;  4RAY A;  3HUG A;  2BV6 A;  4GO1 A;  1IAW A;  4A12 A;  3D0S A;  3KCC A;  1XGS A;  2D45 A;  2VBY A;  5JVT A;  4BHC A;  2EFW A;  5L3D A;  1ZHF A;  3T8T A;  2P7C B;  3WGH A;  1FBU A;  1RNL A;  3ELK A;  1R5H A;  3KP3 A;  3Q9S A;  4GYI A;  2VT2 A;  1R00 A;  3GFM A;  4KDP A;  4ON0 A;  3LST A;  1IN7 A;  2HFH A;  2JSC A;  1JGS A;  3GXO A;  3E6C C;  2QVO A;  4GGG A;  1QBJ A;  3DXJ F;  2CO5 A;  5DYM A;  1WWX A;  3RYR A;  2VOO A;  5CVV A;  2PFB A;  2CGP A;  5AIP A;  4KT5 C;  3R60 A;  1KQ8 A;  3FXU A;  2JZY A;  3ZPL A;  1W7P B;  3HHG A;  4MHG A;  2XAS A;  3S2W A;  2PI0 A;  2DAO A;  4CDG A;  2DPU A;  3W6J B;  4XBF A;  4FHT A;  5FLX Z;  4KUM A;  1K78 A;  5EEH A;  3P9K A;  3GZ6 A;  3SQN A;  1XGN A;  2XHK A;  5JHU A;  3F8N A;  2FNA A;  1SD7 A;  2JRT A;  3GFJ A;  2AXL A;  2IA1 A;  2L4M A;  3MZY A;  3BRO A;  2RNJ A;  2Z3Y A;  4EGY A;  1IRG A;  1F4K A;  3J80 K;  1CF7 B;  2LSO A;  2XV4 S;  1E2X A;  1QNT A;  2WTE A;  1T2K A;  3TGN A;  3G73 A;  1RUO A;  4KIB A;  3ZMZ A;  4UNO A;  3RIR A;  1J7K A;  5FFX A;  4G6D A;  1O7L A;  3P9C A;  1UHM A;  2M1B A;  5CVJ A;  4GXO A;  2FBI A;  5LEK A;  3F8B A;  3CO6 C;  4EVI A;  2TDX A;  3TOA A;  2NNN A;  2MLG A;  2YR2 A;  4JQF A;  1IN6 A;  1G3S A;  2P6S A;  4H0E A;  2ZNY A;  1IRF A;  2YSR A;  3MZH A;  3C3W A;  3J81 K;  1U78 A;  1LVA A;  1ZN2 A;  1U3E M;  3KZY A;  2GIV A;  3HIF A;  3K9T A;  5BQT A;  4S05 A;  1O3S A;  2FEZ A;  3FHZ A;  2BYV E;  4ZYD A;  3I71 A;  1Z7U A;  3WG9 A;  2CSO A;  2V9V A;  1P6R A;  5E20 A;  3VOD A;  2FML A;  2J5P A;  4LG0 A;  5FO5 A;  4HA8 A;  2DLL A;  1G3T A;  1ZRF A;  1WRJ A;  4BNC A;  3CDH A;  4WXH A;  1OYI A;  3E5X A;  5L3F A;  4RB0 A;  2QZ8 A;  5DCF A;  1RI7 A;  4YFX F;  1T0F A;  1T38 A;  2E7X A;  1KU9 A;  3F6V A;  1HST A;  5ICC A;  4WXC A;  3HRS A;  1L3L A;  2DK8 A;  2HZT A;  5ILV A;  2PG4 A;  3IC7 A;  2DQR A; 
#chains in the Genus database with same CATH topology
 3PQK A;  1TWH J;  5H2F C;  4XMY A;  4IEJ A;  4QLC U;  2LFB A;  3AG1 H;  3Q0U A;  5BPI A;  2QSF X;  5LHH A;  1JI8 A;  3ABM H;  2LYC A;  4DOZ A;  4QPQ A;  2RV8 A;  1QQI A;  2LH9 A;  3M8J A;  3V8J A;  2JK3 A;  1FP1 D;  1EF4 A;  3FF5 A;  4NNJ A;  2O9L A;  2DI3 A;  2D2W A;  4PJJ A;  1YX5 A;  2F5F A;  3T5X A;  5E18 F;  1Z6T A;  3JAM K;  1VQM I;  3RYP A;  4BBS J;  2FA5 A;  3DBR B;  3G2B A;  2XDV A;  3PIO F;  1I6X A;  4BQN A;  5F1J A;  3KZI C;  4BUP A;  2MAB A;  4OIO F;  3H9J A;  1RKW A;  3Q0W A;  4HLY A;  2IS2 A;  4A2U A;  4UVA A;  4BDY A;  5D5X B;  3RI4 A;  3CO7 C;  2RN7 A;  2OZU A;  1FBQ A;  4L9T A;  1U8B A;  1UG0 A;  2WA0 A;  1S6L A;  4KMF A;  3H92 A;  3KP6 A;  3JRF A;  4ETS A;  1FSH A;  3AL0 C;  1A31 A;  5BS6 A;  1KQ9 A;  1S7E A;  1PP7 U;  4NUB A;  1NK2 P;  4XLN F;  2V6C A;  2VT3 A;  3BR5 A;  5HS9 A;  5DTD A;  2AHQ A;  2XAG A;  3GZ5 A;  1MBG A;  5FD6 A;  3CCM I;  2LG4 A;  3WU0 A;  1EKE A;  3CJR B;  1MMD A;  2K02 A;  3J80 Z;  1ACI A;  3QWL A;  4LMY A;  5D8L B;  4IRI A;  4ESF A;  2ECB A;  3HJE A;  1XS9 A;  5CYV A;  1S5L C;  4KIS A;  3A4C A;  3ZQ7 A;  4L5I A;  2LK2 A;  1UCR A;  4OAY A;  3Q9V A;  4UY8 I;  1MDM B;  3QPH A;  3BZC A;  1RIO H;  3RZD J;  3HSE A;  5L3C A;  3LNQ A;  3CDI A;  4Y17 A;  5DCM B;  1OCR H;  1SAX A;  3HTU A;  1MJB A;  3KLN A;  4X1E A;  1X1A A;  1Y8R B;  5CVI A;  3A01 B;  4YFK F;  2ID6 A;  1R1V A;  5BOX A;  5FLV A;  4C2U A;  1M1E B;  4OU0 A;  3PQJ A;  2CW7 A;  1A6Q A;  2EK5 A;  4ZYE A;  1BJA A;  2ZJP F;  5DD4 A;  3PSF A;  2IPQ X;  3K4L A;  2XGE A;  4CA0 A;  2O0Y A;  4F52 A;  3BR2 A;  1FBS A;  5HLT A;  3FKJ A;  3ZMU A;  3JRD A;  4ZYA A;  3J81 Z;  5HOD A;  4KMU X;  2A5Y B;  5J6X A;  2VC1 A;  5IT3 A;  3AL0 B;  1L0O C;  3NWT A;  2D1V A;  1KZH A;  3HPG A;  4P9U A;  2COM A;  2LRD A;  2HKO A;  1IXS B;  2KJC A;  1WJB A;  3IUO A;  1EH7 A;  2LY2 A;  2LTP A;  4FTH A;  1RPW A;  2VBX A;  3K1P A;  3SJM A;  3MWM A;  4XLH A;  2KT0 A;  2CQ7 A;  3S93 A;  1BC7 C;  2M0M A;  2OZ6 A;  4XN0 A;  1QRY A;  3RKY A;  1I6H J;  2DYS H;  2L54 A;  4E7J A;  3I4N J;  4AIH A;  4F7Z A;  2DU9 A;  1SAU A;  3R4K A;  2Q2E B;  4HNT A;  1ZEL A;  2K86 A;  3ZMS A;  2JPB A;  3OYI A;  3HGG A;  3P9I A;  3OSF A;  1HKQ A;  1W5S A;  3VYR B;  1X2M A;  1J75 A;  5LLQ A;  2KQR A;  2ZSH B;  4NB5 A;  4I6Z A;  2NVT J;  4MQ9 F;  3DCF A;  4BEH A;  3F0C A;  5KAI C;  5EGO A;  3IV5 A;  1YTY A;  3E0J B;  5FGM A;  4R8H A;  1XMX A;  1O3Q A;  1QGP A;  4ABZ A;  3F8M A;  2PJR A;  2BE5 F;  2VKD A;  2Z5U A;  3H35 A;  2VPR A;  2P4W A;  3L09 A;  2OD5 A;  5E8G A;  4BE1 A;  4DYC A;  4IF4 A;  1XDS A;  1B8I B;  1XGO A;  2WC2 A;  2WAE A;  2A6T A;  1N25 A;  4IHT A;  3WTS C;  3ULQ B;  3S2H J;  2MLK A;  4XQF A;  3BQZ A;  3IKV A;  4OIP F;  3R61 A;  2LBF B;  2EH3 A;  2V1D A;  1H9T A;  2YU9 J;  1KYW A;  2N8G A;  1EH8 A;  2M87 A;  1X3Z B;  3VYS B;  4L5E A;  1BOB A;  3TBI A;  5HNH A;  1SFU A;  1JJ6 C;  1VQ8 I;  3GYH X;  1T98 A;  4F93 B;  2L3D A;  1FZP B;  3BCA A;  2AS5 F;  3SEQ A;  1ENH A;  3JAM Z;  2ELK A;  4PJL A;  5D4R A;  1MJ9 A;  4M3D A;  1RZ4 A;  9ANT A;  3E6M A;  4DZJ A;  3VWB A;  4N0B A;  1U8R A;  2VJI A;  2HDD A;  5M3F J;  3G1L A;  5B1B H;  2DOF A;  4OIQ F;  4B1R A;  1WPK A;  2GLO A;  3TED A;  3WGG A;  4A0X A;  4BXU A;  5HLH A;  3HEF A;  5K5Q A;  4XRS G;  1RUN A;  3EYY A;  2KZG A;  2EV0 A;  1J9I A;  2KKO A;  4LLG F;  5J1R A;  2FQ3 A;  1D0X A;  4HX8 A;  3VOE A;  4AIJ A;  2VON A;  3DF8 A;  1VQ4 I;  2JQ7 A;  1P2F A;  2WY7 Q;  1I27 A;  2L7M P;  2IP2 A;  4QWQ A;  4RLQ A;  3SFI A;  3ABU A;  3N05 A;  1EH6 A;  3VSL A;  2QKM B;  3FWE A;  1X19 A;  1YOV B;  4WWC A;  1N75 A;  2BZT A;  3WGI A;  2KLO A;  2M3A A;  4A6D A;  4BGD A;  2E2I J;  4UXN A;  3I55 I;  1MGT A;  4MIM A;  2DYR H;  4GYG A;  4A3F J;  2O5R A;  4MEY F;  4B47 A;  1NG7 A;  2HGC A;  3K1N A;  1H88 C;  1MD0 A;  3CCQ I;  5JR3 A;  1MMG A;  3CDL A;  3S2D J;  3EPZ A;  3BR3 A;  3B02 A;  3CUQ A;  4L0Z B;  4DYR A;  5HDK A;  1HC8 A;  3KEO A;  4RMN A;  3DU6 A;  5BMZ A;  2QUF A;  5FKL A;  2DFH A;  4KIT B;  3N97 A;  2DMN A;  3BZ6 A;  1ZAO A;  3AAF A;  5DUK A;  1R4M B;  1HBX G;  3I58 A;  4FT8 A;  4ENJ A;  3ZMV A;  1N77 A;  2I10 A;  3VYU B;  2VPL A;  3OYJ A;  4E6K G;  4U0Y A;  5CVR A;  5FKO A;  3IRQ A;  2K9S A;  4A3G J;  2FJ1 A;  2DA3 A;  4I0A A;  2P81 A;  5JLX A;  4U0W A;  2FUG 2;  1PUE E;  1QHH D;  5E1X A;  5E8I A;  3M8E A;  2DA7 A;  4PDK A;  1XN7 A;  2UXN A;  2W85 A;  3QOP A;  2IS1 A;  2IS6 A;  2L01 A;  4D9J A;  1R22 A;  1MW7 A;  2M5W A;  2JWT A;  3BWG A;  3BPX A;  5KHD A;  3DQV C;  5C3E J;  3HOX J;  5H6Q A;  5BPD A;  3PFY A;  3VSK A;  4CSW A;  2QKL B;  2HZD A;  4B44 A;  1W0T A;  1IXR C;  3HXL A;  3TO6 A;  1IZ1 A;  1H9G A;  4EJU A;  1LE8 A;  3PJR A;  2XPW A;  3BTL A;  3L00 A;  3GTO J;  5J40 A;  1HDD C;  3BT9 A;  3GTG J;  3H5N A;  2XB0 X;  4JX6 A;  1ZR2 A;  3RSN A;  4CZZ A;  3K2A A;  1FJL A;  1OCT C;  2X48 A;  3G6E I;  3UKG A;  1XMA A;  3E3V A;  1K4S A;  4WF2 A;  4G6Q A;  1OCC H;  3F23 A;  4ENM A;  4AIK A;  1K78 B;  4HV6 A;  5B3S H;  2ECC A;  3K4M A;  5F1R A;  4XID A;  2DTZ A;  3BPV A;  2V9K A;  1R4N B;  3TKY A;  3ML6 A;  2QM3 A;  5FKN A;  3CD6 I;  4BYY A;  3TQN A;  3CP8 A;  2KDZ A;  5D5V B;  3CCL I;  1YYV A;  4RGR A;  3CCS I;  2FU4 A;  1WJC A;  1NG6 A;  4H4K C;  4XN3 A;  5J1Y A;  4AVZ A;  3Q3S A;  2CMP A;  3GZN B;  2R4G A;  3D1N I;  2JJ7 A;  2YU3 A;  1E17 A;  1ITY A;  4ZZL A;  4PCQ A;  1VQK I;  3BTJ A;  2GA1 A;  4ZYG A;  1ETX A;  5ILU A;  1QU3 A;  2H8R A;  5HOO A;  1G8X A;  1A35 A;  3H3U A;  5ICF A;  4RAF A;  4UUT A;  1Z9C A;  1B1B A;  4BKX A;  4MTE A;  1BI0 A;  1T0F C;  4R79 A;  1G4D A;  2V79 A;  3HYI A;  2X1D A;  2HQR A;  2KRH A;  3J7Y J;  5C4X J;  2EWN A;  3B73 A;  4ZDO A;  1G3Y A;  4M73 A;  4P55 A;  1TP4 A;  3H5A A;  2LRE A;  1V5E A;  2LOO A;  2Y75 A;  4PZJ A;  5ILS A;  3CC7 I;  2DA6 A;  2HVR A;  4GRI A;  2JVG A;  1J59 A;  2DA4 A;  3E5U A;  2E2H J;  4DW6 A;  4MO7 A;  3RQI A;  5F0F A;  1TQI A;  2FQ4 A;  1Q1V A;  2V4J C;  1PP8 F;  2LMD A;  1QO0 D;  4U7B A;  2HQN A;  5LGU A;  1V5F A;  4ZDP A;  1W5T A;  3C1D A;  2ACJ A;  1FLI A;  3V8L A;  1YW8 A;  2E60 A;  2RRE A;  3VDX A;  1D1A A;  2CRG A;  4LIT A;  4LG0 B;  3HTS B;  2KRC A;  5J47 A;  1ZTR A;  2KIF A;  3WOD F;  5ERI A;  1W4M A;  2DBB A;  2GBY A;  3DEU A;  3C2B A;  3C7J A;  1WFX A;  1LB2 A;  4LJZ F;  5FKK A;  3W2V A;  2ZCW A;  4HF0 A;  4M9S A;  1HW5 A;  2LVS A;  5EYR A;  2MG4 A;  2KPM A;  2ZME C;  5C44 J;  4DQ2 A;  3A02 A;  5HVQ C;  4IO9 F;  2BW3 A;  3BZK A;  1ON1 A;  3CCR I;  4XM3 A;  3NAR A;  5B66 C;  2FBH A;  2W00 A;  1JKP C;  2FXA A;  5FB2 A;  2RC4 A;  4HQE A;  5KVR A;  2XF7 A;  1IXC A;  3DKY A;  4DNC A;  4LG3 A;  1V4R A;  2XPV A;  1IDY A;  1FYL A;  4HF2 A;  1BJZ A;  1HDP A;  1Y56 A;  1UJ8 A;  2NS0 A;  2Y69 H;  5D6F A;  3QP5 A;  4IOA F;  5TGT A;  2CQN A;  4UB8 C;  1HF0 A;  3I64 A;  3L2V A;  5F0H A;  2UWM A;  1X1P A;  3IHU A;  1GLN A;  2HPI A;  1JKR C;  4I76 A;  3HRM A;  5CQE A;  1IGN A;  1QZY A;  1PVE A;  1TT0 A;  4QPO A;  3DV8 A;  4W97 A;  4Y33 A;  2UUZ A;  1OYW A;  3E6D A;  3SDG A;  5LRR A;  2RDP A;  2Y9Y A;  1TWG J;  4ZYH A;  4HNV A;  2RNG A;  1LEB A;  3V42 A;  1YE9 A;  5JI6 A;  3HOY J;  3EUK L;  3O6B B;  1OYY A;  1AA7 A;  2XF5 A;  2R93 J;  2VN2 A;  1BI3 A;  3ZN1 A;  3LSI A;  2ZME B;  1FPQ A;  3I4P A;  3JRE A;  1VQ5 I;  2VQC A;  3KIO A;  1SMY F;  2DJI A;  3PNV A;  1FOX A;  2KIS A;  5E1W A;  2QWW A;  3PFI A;  4NQW A;  3REO A;  3DLL F;  2EA2 A;  1ZK8 A;  3K4C A;  4HDU A;  4AUX A;  2JA2 A;  5F64 A;  1AHD P;  3CCU I;  4XLP F;  3DLA A;  4CYC A;  2A68 F;  1S7A A;  2OF7 A;  4XLA A;  2IA2 A;  5H20 A;  3TL4 X;  1E3H A;  4Q5S F;  2VOP A;  3M9A A;  1XPX A;  3BTI A;  1MBK A;  3GLL A;  2ZJ2 A;  4A69 C;  1ETY A;  1WVR A;  1GDT A;  2K4J A;  1FP2 A;  4UVB A;  3ASO H;  1YFH A;  2MC4 A;  2G0E A;  3J7Z I;  3LA3 A;  4BAC A;  4ESB A;  2BXY A;  3AG4 H;  1FMV A;  5TRD A;  2MBF A;  1TTY A;  3I54 A;  3K7A J;  1FYM A;  4BY7 J;  2PQ8 A;  4A3L J;  4OMZ A;  2ISZ A;  4Y7N J;  4HG2 A;  2P5V A;  1ZGJ A;  3FMQ A;  1MKM A;  4I09 A;  4PFO A;  2WWY A;  4HYE A;  4MQV A;  1WI9 A;  2HPM A;  4HPQ A;  3TOB A;  3L7W A;  4HX7 A;  4IHX A;  3WTT C;  2VC0 A;  4CCK A;  5FFZ A;  2F5C A;  1MBF A;  2M30 A;  1SD6 A;  2HWV A;  3BG6 A;  1UFM A;  2X1E A;  3KP2 A;  3BR0 A;  3BTC A;  1XCV A;  4Y3O A;  4P5O A;  3HZJ A;  1FOK A;  2XGD A;  2R5Z B;  2ELJ A;  2Z1D A;  4C9Y A;  3M3Y J;  1HKT A;  2MSY A;  4O5V A;  3GWZ A;  1HA8 A;  5ICG A;  2CW8 A;  2R3S A;  2V9P A;  5L3E A;  3LL7 A;  3TP3 A;  4IQ4 A;  1BIB A;  2ADU A;  3S32 A;  5IYC J;  3EQL F;  2W24 A;  1IV8 A;  1BC8 C;  2Z9O A;  3T8R A;  1TW3 A;  3U1K A;  3DFG A;  1VQ9 I;  3DPU A;  2R7O A;  3G4S I;  1JE8 A;  1P7I A;  1YX3 A;  4UV8 A;  3MCZ A;  1VND A;  2EB7 A;  1Z77 A;  2L02 A;  4O6J A;  4E7Z A;  2EZI A;  4R1H A;  2QQ9 A;  5K5O A;  1E0E A;  1S8N A;  3O2P E;  3CZ6 A;  1J5Y A;  3M8F A;  4RLF A;  2QLZ A;  5JVG F;  1ZRC A;  4DYQ A;  5HDN A;  2W4S A;  3I0T A;  3FBN B;  3RKW A;  2XPU A;  3JTG A;  1U6G A;  1T8I A;  1BL0 A;  2O61 A;  1P4A A;  2ZJQ F;  4BEH B;  4L0Y B;  1W7P A;  1S9H A;  3KPH A;  4ANJ A;  3WTY C;  2D1H A;  3BC8 A;  2K3F A;  3K4J A;  3DKW A;  2PJR B;  2HDC A;  1R9T J;  1YG2 A;  1R7J A;  1S7O A;  1HXD A;  4EV0 A;  4XRM A;  3PL8 A;  3ZQQ A;  2XAF A;  3FMS A;  1E3P A;  2ESN A;  3HC7 A;  2CG4 A;  4L5J A;  2JA7 J;  2PJP A;  2OAZ A;  1F43 A;  4Q47 A;  1GHC A;  4CCJ A;  2QYO A;  3FK7 A;  1R1T A;  2GM4 A;  1Z3X A;  1XD7 A;  4YG2 F;  2JUG A;  3IL2 A;  1R36 A;  4M3E A;  2O7O A;  4ESJ A;  1D8K A;  1JUM A;  2IGN A;  3DPT A;  3I53 A;  3F22 A;  3H9Q A;  1VZ0 A;  2IVM A;  2Y48 A;  2OU2 A;  1HSJ A;  4HBL A;  2YPR A;  3ABK H;  3W6K B;  2F4I A;  3GO5 A;  3U9G A;  1UEL B;  2KMU A;  1XSX A;  1Q1H A;  2AQE A;  3DEW A;  2GOM A;  3JRI A;  2NRA C;  5JFR A;  2JT1 A;  3DPL C;  2K3P A;  3HSF A;  4I98 B;  1YIT I;  2Z99 A;  1LNW A;  1WH7 A;  2MFZ A;  1SEU A;  1Z1D A;  3CF5 F;  4E7I A;  4UUV A;  1V54 H;  1SVL A;  1Z05 A;  3BG3 A;  2FBK A;  1YRN A;  1X3U A;  3C2H A;  4Y52 J;  3O3K A;  2G9W A;  4U88 A;  3LSG A;  5FD5 A;  3OR2 C;  5TJJ A;  4M9X A;  1YJN I;  4LOC A;  2H1L A;  2QGU A;  2G7U A;  2KIU A;  4JP0 A;  4X0G A;  2NXN B;  2IRF G;  3LWF A;  3OWT A;  4B4C A;  5KCM A;  3CTA A;  1GUU A;  1Y0N A;  2HXI A;  2ESH A;  5BNG A;  5H6R A;  4OWR B;  1U2W A;  1LEA A;  1X3W B;  2EFP A;  4NDL A;  3IRR A;  2H8W A;  3DTI A;  4DJA A;  2FF4 A;  2COB A;  2MH2 A;  3N4M A;  2NNY A;  5KK1 A;  1BM9 A;  4M71 A;  1XC5 A;  1JUP A;  2E71 A;  4KIG A;  3H3V K;  2H6C A;  2HOE A;  3J7A Y;  4XKW A;  1AU7 A;  2MD5 A;  4FIS A;  1V5G A;  2DN0 A;  2ME6 A;  4A5N A;  4JX5 A;  2H09 A;  2GAU A;  3QQA A;  4GFB A;  2IW5 A;  3A03 A;  3BJA A;  2E5N A;  4YRV A;  1FY7 A;  2M8G X;  4AWX B;  2FMY A;  3MEX A;  1QPM A;  2STT A;  2M9H A;  2IS4 A;  4II3 A;  1J09 A;  2DA5 A;  2VB6 A;  2E1C A;  2O6G E;  2XRN A;  3V8K A;  5GAG J;  4TV7 A;  2BXZ A;  2O8X A;  1FSE A;  2QF7 A;  5EG0 A;  4A3M J;  2XKP A;  3CUQ B;  4AYB A;  2BY2 A;  2AQF A;  1DDN A;  2F4O B;  2KJB A;  2M4K A;  3QOE A;  4MGR A;  3RPU A;  4KIC A;  2M2E A;  2XAU A;  3I3L A;  1ZGA A;  3T0Y A;  4UUS A;  2ZBK A;  2HOS A;  1DU6 A;  1FTZ A;  5J8F A;  2PEX A;  2BY0 A;  5GAE J;  2UXX A;  5FLM J;  1XSD A;  1AKH A;  3BQY A;  4CUG A;  3BP8 A;  3PNY A;  3ZQC A;  1JKQ C;  2W7N A;  1LUJ B;  4LB6 B;  2CWE A;  2CJJ A;  3C2G A;  2GIZ A;  3SXY A;  1J0R A;  2Y9Z A;  1B4A A;  1NTC A;  2ZXH A;  1MBE A;  4KFC A;  4Y13 A;  1UHW A;  1TWA J;  4MNU A;  3ERM A;  2OQR A;  3HGY A;  4GDF A;  5TIS C;  3MD2 A;  4N9H A;  1SC7 A;  1OLT A;  3HPH A;  2Z33 A;  3WU2 C;  3FXM A;  1OR7 A;  3F8F A;  3LFK A;  4FE7 A;  2QBY A;  2VBW A;  4KIF A;  1TBX A;  2Y0M A;  3MN2 A;  3HOZ J;  1BOA A;  1OMI A;  1ZAR A;  3JRG A;  2LF8 A;  2BVL A;  2CS3 A;  1FIA A;  1OQY A;  1GT0 C;  3WHC A;  4BE0 A;  2W25 A;  1W7P D;  1S3J A;  3S3M A;  1BN5 A;  3I59 B;  2R0Q C;  4IRH A;  1LE8 B;  3LA2 A;  2Q1Z B;  2VUM J;  2DXI A;  2F48 A;  4A3B J;  5J4Y A;  3W2W A;  4WCG A;  1KON A;  5F6F A;  4HLX A;  3W2A A;  3VPR A;  1BA5 A;  4LLL A;  1MND A;  5EZH A;  5FKM A;  3WE3 A;  2STW A;  5LGT A;  1U0J A;  2GXA A;  2E1O A;  3F6O A;  4JOM A;  4ZTF A;  2X4H A;  3M1E A;  3JSO A;  5IP6 A;  2CQK A;  3LQQ A;  1T39 A;  4CXF A;  3U1D A;  4LD5 A;  1W0U A;  3CME I;  2X9D A;  4RDU A;  4BQO A;  3PSI A;  2X0L A;  2B9S A;  5KNL A;  3HKZ A;  5FRN A;  3PUF A;  4HAM A;  1EA3 A;  1J2X A;  5J1U A;  3SEZ A;  1B9M A;  2W1O A;  4BJ5 C;  3QRF F;  4RGU A;  1RKT A;  3WTX C;  4RGS A;  3K70 D;  1BI1 A;  2BBY A;  1HLV A;  4DBR A;  2X6X A;  2M7A A;  2W57 A;  4FET A;  3I9V 2;  2NVY J;  1F5T A;  4AID A;  2NS8 A;  2A6E F;  3C18 A;  1MDM A;  4XOP A;  4J01 A;  1YQA A;  4C30 A;  2DQL A;  2OA4 A;  3RDI A;  1U9O A;  1X4O A;  3RCO A;  1G59 A;  1O4X A;  2IA0 A;  5IYB J;  2DFI A;  3MAJ A;  2DOD A;  3HUG B;  3OL3 A;  1LFP A;  3KE2 A;  2R7S A;  1IF1 A;  1KU7 A;  4PGG A;  3EUH A;  1YW7 A;  2CV0 A;  5D5W B;  1U5T A;  2Q0O A;  5B5E C;  4N4N B;  2QEX I;  5E3L A;  2EA4 A;  1SFE A;  1Y6I A;  1FWZ A;  2MW8 A;  2B0L A;  2YX7 A;  4KJZ A;  4RB2 C;  3L2R A;  1MSF C;  2KRF A;  3JRC A;  1I5Z A;  2M4G A;  4OIR F;  2LC2 A;  4LK0 F;  2CFX A;  3ZCO A;  4PK4 A;  2MC3 A;  4XLF A;  2ZKZ A;  4OMY A;  3LAJ A;  2ELH A;  3WTW C;  1BW5 A;  1WZ2 A;  2P7V B;  5CJ9 A;  2ETH A;  2VE8 A;  1AOY A;  2JSP A;  1W5C C;  1SD5 A;  2ICW G;  3JW4 A;  3A0B C;  3ERE D;  3VYT B;  1RC9 A;  2EIJ H;  4YEJ A;  3PIP F;  1NK3 P;  2WV1 A;  1YHQ I;  3EET A;  2EJR A;  5M5W J;  2XC7 A;  3F21 A;  3QP6 A;  1D8J A;  4D1Q A;  1DU0 A;  2QA4 I;  4XOT A;  4BBR J;  2VJ5 A;  4YFN F;  3LSP A;  2CQX A;  1ZKG A;  3ZRG A;  1E3O C;  3K4K A;  5E1Z B;  2AXT C;  3QPS A;  5L3B A;  2H6B A;  4RGX A;  4Q48 A;  3E5Q A;  1T6S A;  2XSD C;  4BY1 J;  3V4G A;  2BW3 B;  4M6Y A;  3ZMD A;  5AIQ A;  2E34 A;  4O3M A;  1FC3 A;  2CUF A;  5IP7 J;  4L9N A;  2DT6 A;  2PN6 A;  3LQR A;  1O3T A;  4IKF A;  5HS7 A;  2ID3 A;  4BHP A;  2VI6 A;  4D5C A;  2DOE A;  3ZMT A;  3GTJ J;  2DTR A;  4L9J A;  4B3A A;  2XVC A;  1DPU A;  5GAD J;  4A6E A;  1XB4 A;  3GCM A;  4NBQ A;  3FM3 A;  1Z6R A;  4KA4 A;  1PYV A;  1F1Z A;  5J4V A;  3FIW A;  4BE2 A;  2H94 A;  2M7B A;  3OYA A;  3RTR A;  3PO2 J;  1OJL A;  3M4O J;  1P4X A;  4CO8 A;  3JR9 A;  4U87 A;  2RKH A;  3PM1 A;  2OBP A;  5CQG A;  2YS9 A;  2EZH A;  1WH5 A;  1PDN C;  4EMS A;  3IKT A;  2YX4 A;  2K9N A;  1OFC X;  1LFU P;  1DUX C;  4RB1 A;  4P1W A;  3CCE I;  1R6R A;  1VI0 A;  4G7H F;  1ZRD A;  3QPL A;  2CFO A;  4BDZ A;  1SFO J;  2ZFW A;  2EBI A;  3SDB A;  4AYB N;  3ABL H;  5LHG A;  3OYN A;  2BEO A;  1B59 A;  1Y1W J;  3GTQ J;  1YLF A;  3OYK A;  1ZG5 A;  2XAQ A;  4JK1 X;  4Q4Z F;  4Z2Y A;  4J00 A;  2LDU A;  3A0H C;  1WHU A;  3LSM A;  4PGH A;  4I0B A;  2L4A A;  2ZSI B;  3ECO A;  1IDZ A;  4IHS A;  4I99 C;  2KIM A;  2HDW A;  2KFD A;  3V7S A;  4G9Y A;  1YJW I;  1HCR A;  4DGW B;  2DDA A;  2E7W A;  4L9V A;  3OIP A;  4LB5 A;  3L2U A;  3FXQ A;  1K83 J;  2OUM A;  2PX9 A;  4CYC B;  4JX4 A;  1P92 A;  1VTN C;  1BI2 A;  4B48 A;  4W1U A;  3WTU C;  3WG7 H;  3FZV A;  1QVT A;  1KU2 A;  3QPT A;  3A2K A;  3KEQ A;  4PJN A;  1FX7 A;  1EJ9 A;  3R0A A;  3TDU C;  2HU9 A;  2ZB9 A;  1BR4 A;  2EIN H;  1ETV A;  3OR1 C;  5GPC A;  1QZZ A;  2F2E A;  1I39 A;  5C4J J;  3G1M A;  2E35 A;  2FSW A;  2R7W A;  2DPD A;  5ICE A;  3HBL A;  1SVM A;  4XK4 A;  4CGZ A;  5IYD J;  1KU3 A;  1FNN A;  1TLH B;  1WCM J;  3IH3 A;  1GVD A;  4EGZ A;  4PJM A;  1SD4 A;  2BHY A;  1TQM A;  2ISY A;  3B6A A;  1F36 A;  1TT5 B;  2RVC A;  3DBL B;  4XLE A;  2X6Y A;  3JRB A;  3CUO A;  4FX0 A;  4WK8 F;  5B1A H;  2NYX A;  3LSR A;  1W36 D;  3S1M J;  4E4H A;  4ZH4 F;  3IAS 2;  4P96 A;  2PLY A;  2R92 J;  2LR8 A;  2M8E A;  1I3Q J;  1LVK A;  1X4P A;  1KA8 A;  1SFK A;  1WJ5 A;  1FMW A;  4EM2 A;  4K2E A;  4LK1 F;  4MLO A;  2R7D A;  2VQH A;  3K4N A;  4CH7 A;  1FIP A;  1DP7 P;  4YII A;  1R58 A;  2AO9 A;  4IZZ A;  2GWR A;  4LIU A;  4G6T B;  2P5L C;  2F5D A;  5DM6 F;  4A5M A;  1BR2 A;  3HKZ N;  4Y15 A;  4B43 A;  4U7D A;  2O8K A;  1ZQ3 P;  4G8X A;  1JTY A;  3DEE A;  1R23 A;  4X6A J;  5IP9 J;  2WAQ A;  1D3Y A;  4FAS D;  1OIS A;  4UHT A;  1IRX A;  1QPI A;  2IXS A;  3BOQ A;  1KQ0 A;  3PUB A;  4ENN A;  2GXG A;  1RR8 C;  1R71 A;  4ZTJ A;  2HQA A;  3L2Q A;  1ZYR F;  2CH0 A;  3D5L A;  2V1X A;  1D5V A;  3JSP A;  3ESW B;  2JN6 A;  4HRI A;  3NAU A;  1XX5 A;  1MNM C;  3HOS A;  3GF2 A;  5LFA A;  1N78 A;  4ZJZ A;  2W48 A;  1V55 H;  3P5J A;  4C3J J;  1D5Y A;  4HSR A;  2EPF A;  1H8A C;  1JKO C;  1HW2 A;  2XAJ A;  1VF9 A;  5IOZ A;  1B9N A;  2HXO A;  3DWL E;  1K4T A;  5DV5 A;  4HDV A;  2R7U A;  3F9K A;  1IN4 A;  2WAF A;  4G7Z F;  3G3Z A;  3K0L A;  2VXD A;  5M5X J;  3OSG A;  3HRU A;  4HEA 2;  3OS0 A;  2CYY A;  2DJN A;  2CW0 F;  1H89 C;  2R5Y A;  4XR6 A;  3TP0 A;  1UB9 A;  3FKI J;  5DUI A;  3K10 A;  4RB3 C;  2M0C A;  1JHH A;  1DGW Y;  4IPA A;  1ZRE A;  5JLW A;  3CCY A;  2EIM H;  3COA C;  1SMT A;  4Y4R A;  3ZP5 A;  4ASN A;  4U0V A;  2XRO A;  3V7R A;  1GV2 A;  2DMT A;  4YIF A;  2L7K A;  2VE9 A;  3V7C A;  1XCB A;  3RPQ A;  3ZOB A;  3GFL A;  1H0M A;  2XUB A;  4LLN A;  2DT7 B;  2VBZ A;  2HYJ A;  5DDG A;  3S17 J;  5D5U B;  2LP0 A;  1RET A;  3CC4 I;  1RR7 A;  3QOD A;  4S04 A;  1IJW C;  2L5Q A;  2K4B A;  1ERD A;  3CES A;  2RAE A;  3RJP A;  3JRH A;  1WQ2 A;  2DDB A;  4IL6 C;  1I1S A;  1HOM A;  3GTL J;  3QYE A;  4D0P A;  1BW6 A;  5IY5 H;  1YI2 I;  2VOD A;  3CCJ I;  2HYG D;  4BQQ A;  1R49 A;  2BOL A;  2W84 A;  3O8G A;  3S16 J;  1Z91 A;  1EV7 A;  2F5V A;  1YIJ I;  2RGV A;  2K27 A;  2EIK H;  2FNP A;  4ZZD A;  2V1U A;  4XOR A;  2H1K A;  5F04 A;  2FOK A;  1I1G A;  1I3A A;  1OKR A;  4E70 A;  1Y8Q B;  3D5S C;  2DFF A;  2NOG A;  4IRG A;  4RA2 A;  5HLG A;  2R7Z J;  4AVP A;  2E19 A;  1WJF A;  4UVC A;  5F0C A;  3ECH A;  2JMW A;  3KET A;  2HS5 A;  3FHN A;  2QCO A;  1X58 A;  1JT6 A;  1YS6 A;  2CQQ A;  3OYF A;  5HDG A;  2VKH A;  2HTJ A;  4I2O A;  1MIJ A;  2DFE A;  5IT9 K;  4IXA A;  2IT0 A;  4EAT A;  2P5K A;  3WTZ A;  3FIS A;  2ZO4 A;  2WB1 A;  3MVP A;  2L9R A;  1SAN A;  2Y2Z A;  4BJ6 C;  4EM0 B;  3IH2 A;  1FOY A;  3OYL A;  2BGC A;  4M6V A;  3MQ0 A;  4A0Y A;  2IGK A;  1LPQ A;  2NOJ B;  3ZQL A;  2X6W A;  3H3Z A;  3DU5 A;  4M72 A;  4NC8 A;  1MJA A;  4NHJ A;  2J5O A;  3DP7 A;  4HNU A;  1MH3 A;  1GXQ A;  1ZLJ A;  1FEX A;  4RS8 A;  5EEA A;  3ZGK A;  1ZG1 A;  3HHH A;  1G3W A;  3FK6 A;  4WXD A;  5CVU A;  3RQ4 A;  1PUF A;  1LDD A;  2K9Q A;  1ZH5 A;  3FX3 A;  4A93 J;  1HQC A;  1IN5 A;  1IW7 F;  1TNT A;  2CU7 A;  2OQG A;  2XGC A;  3CMY A;  2IAI A;  4FX4 A;  4QTR A;  1T33 A;  2HYF A;  2I5U A;  3G71 I;  4HF1 A;  2DOA A;  2HVQ A;  4OIN F;  3KZZ A;  3LSH A;  1ETO A;  1T95 A;  1AKH B;  2ZC2 A;  4HV5 A;  4FCY A;  1C0W A;  4A3I J;  4I7H A;  3QYB A;  1X2N A;  2DMQ A;  4CCN A;  2H27 A;  3Q5F A;  3BR6 A;  2F4M B;  2DK5 A;  3F8C A;  5EGO B;  5D4S A;  4EM1 A;  4N9I A;  3F3X A;  1XSV A;  3BG7 A;  3WHB A;  1GV5 A;  3KP7 A;  5L3G A;  3FM5 A;  3GVA A;  4HX4 A;  3MKY B;  1UG2 A;  1ULY A;  2K7L A;  1UAA A;  2QBY B;  4LIV A;  3ASN H;  1MZB A;  3KP5 A;  3QU3 A;  5LBQ A;  3E6B A;  1B72 A;  3CC2 I;  4XON A;  5F08 A;  5D8K B;  1DGR M;  2JRM A;  4RM2 A;  4B8X A;  2VQG A;  2QEN A;  2O3F A;  3OIO A;  4FE4 A;  3QAH A;  4XSZ F;  3ZXS A;  3PO3 J;  3TO9 A;  2B63 J;  2LKX A;  1SVO A;  1WKM A;  1Z67 A;  3EUH C;  3SFZ A;  2KIQ A;  3H36 A;  1W36 C;  2FRH A;  1U5T C;  4BAY A;  2FX0 A;  3CJN A;  2A61 A;  2Y30 A;  2K9L A;  1CF7 A;  1IUY A;  1G2H A;  1XG1 A;  4MEX F;  1HW1 A;  1A6I A;  2F6C A;  2WBM A;  3KYD B;  1TZL A;  1DPR A;  2ZME A;  4C2T A;  1UST A;  1MSE C;  2QQA A;  1YO5 C;  1ZR4 A;  1FYK A;  2R7X A;  1LDK B;  2FD5 A;  5K5R A;  2PMH A;  4IVN A;  2WAQ N;  3I4M J;  2HKX A;  2BY1 A;  3L1P A;  5EDN A;  3S1Q J;  3CUQ C;  2NAZ A;  2JUC A;  3ABT A;  3AKZ A;  2B7E A;  1NHA A;  3G1O A;  5K7Z A;  4NC7 A;  2A3S A;  1B6A A;  4CCL A;  1TL8 A;  3OYE A;  4A3J J;  2CUE A;  5HS8 A;  5IPA A;  4M6X A;  5CLS A;  4C3H J;  3U2R A;  2L7F P;  4BXF A;  2NVX J;  2CV1 A;  1QA6 A;  3Q0V A;  3QYF A;  2LKP A;  3K4B A;  4YIR X;  3ZQI A;  2EFO A;  5ED4 A;  1A04 A;  5GAH J;  5E79 C;  1ZLK A;  2VXZ A;  3FDY A;  2ZNZ A;  3QU6 A;  3K6G A;  2HOT A;  2KHM A;  3CLO A;  3WU1 B;  1R5G A;  2K9M A;  3R0J A;  3BG5 A;  5DD8 A;  2WY8 Q;  3ROU A;  1D0Z A;  2R7T A;  4UB6 C;  1O3R A;  1JXS A;  3S8P A;  1MMN A;  4EQQ A;  1U5T B;  3H0G J;  3OYC A;  2XKO A;  1JJ8 C;  1ORK A;  4F3Q A;  5K7F A;  3L2C A;  1O7F A;  3LAP A;  1UHS A;  5DM7 F;  2GA2 A;  4IX7 A;  2DCE A;  5CPR B;  3SHF A;  2OC6 A;  3OYH A;  1WGX A;  3H5R A;  3MZ8 A;  4JYK A;  2GQQ A;  5EF6 A;  4ZDL A;  1TQP A;  3SZP A;  3DBH B;  2R5Z A;  2HEO A;  1R1U A;  3AFH A;  3IWF A;  5AON A;  4IOC F;  2WAD A;  3NWS A;  4PSX A;  4CZC A;  2IJL A;  4I02 A;  3ZN0 A;  5IT9 Z;  4ITV A;  5LRS A;  3HM5 A;  1JT0 A;  2MD0 A;  3NRV A;  3SZT A;  4A3K J;  2OTL I;  1Y0U A;  3NEU A;  1IN8 A;  1VQN I;  5E3N A;  3FXO A;  1STZ A;  4RM3 A;  2ZXJ A;  4XL9 A;  3BJ6 A;  2R7R A;  1YIO A;  4BXX J;  3ZQH A;  4B09 A;  4OOI A;  3GTP J;  2JPC A;  1DP3 A;  2CUJ A;  3CJT B;  1MBJ A;  3IH4 A;  3L9F A;  3FMR A;  4EEF G;  2LNB A;  3L2W A;  2I8D A;  2OCC H;  2E1N A;  4E7L A;  2LKS A;  4RAZ A;  2JA5 J;  3HDD A;  4KN4 X;  5GP9 A;  1YS7 A;  2OTJ I;  1O57 A;  1T56 A;  4A0Z A;  3OL4 A;  1G6N A;  1F9N A;  2HR3 A;  3BJO A;  3KYC B;  1BBY A;  4WX9 A;  3E97 A;  5J3L A;  3T1B A;  3TO7 A;  3FXR A;  3MFK A;  1VQ6 I;  2Q8K A;  2V6E A;  4CCM A;  3HSR A;  4I01 A;  3GX4 X;  3BCB A;  2RQP A;  3S3O A;  3GLX A;  3EYI A;  3VEP A;  3S3N A;  1ETW A;  2EZL A;  3H0D A;  2WB1 N;  5EEG A;  1USS A;  2NVQ J;  1LDJ A;  2VL8 A;  3LSJ A;  1I50 J;  3GBG A;  4AD9 A;  2QQB A;  1TWF J;  4HQM A;  5KAF C;  1RRJ A;  4BH9 A;  3MKL A;  1QVU A;  4EJO A;  3OMY A;  4BU2 A;  1ZGW A;  3HOV J;  1QZE A;  2L0K A;  3FXL A;  3HL2 A;  2HTS A;  2XAH A;  1K7A A;  1XTA A;  2OV7 A;  4CCO A;  1TW2 A;  2R7Q A;  4EJV A;  3E1S A;  3OOP A;  2UZK A;  4A3C J;  1FT9 A;  1OCP A;  1WJA A;  4QIW N;  1LQ1 A;  5E17 F;  4QSH A;  3DKX A;  1ON2 A;  2ZXW H;  2EV5 A;  2L9S A;  5LHI A;  2R7F A;  2A05 A;  2KL4 A;  4UV9 A;  2KP6 A;  5A2Q K;  1CGP A;  4XRS A;  5EZG A;  5E3O A;  4JBA A;  2X1C A;  1YW9 A;  2YUS A;  3FXJ A;  3GFI A;  5LGN A;  4M3B A;  2K5C A;  4HZF A;  4BHB A;  2XIG A;  3BY6 A;  4XRF A;  5DCM A;  4AC0 A;  4GCV A;  1K61 A;  2GZW A;  3RZO J;  4P9F A;  4ZC3 A;  2L9V A;  3KX2 A;  3A01 A;  1Y1V J;  1IV6 A;  5K1Y A;  3K1M A;  4G12 A;  1P4W A;  5DEQ A;  1T08 B;  1MMS A;  4NC6 A;  6PAX A;  3S14 J;  4B3X A;  4XIC A;  1XMK A;  4XSX F;  2QSH X;  4KYW A;  1OPC A;  3CQZ J;  3K69 A;  1W1W E;  2O03 A;  1ONV A;  2G7H A;  3HRT A;  2JVH A;  1D1B A;  4G94 A;  3IWZ A;  1IC8 A;  2OCE A;  3LSK A;  3OS1 A;  4IHV A;  1JHF A;  2DA1 A;  2M45 A;  2X85 A;  1XDU A;  2L9N A;  1GVJ A;  3OV8 A;  2JA8 J;  3GW2 A;  2X51 A;  3J7A O;  2LY9 A;  1BIA A;  4C2M J;  2CUZ A;  3UR3 C;  4BQA A;  2R7V A;  1K79 A;  2WV0 A;  3JCU C;  3E7L A;  3X2Q H;  2V1N A;  2OJE D;  1YJ9 I;  4EJT A;  1IUF A;  1HKS A;  2EFQ A;  1VQP I;  2IGO A;  4MTD A;  1S72 I;  1DQU A;  1REP C;  3WE2 A;  3RPU D;  1P9Q C;  3GUD A;  3HB9 A;  4HW0 A;  1IO2 A;  3H1C A;  1TNS A;  3KFW X;  2GXB A;  2MGQ A;  3OYD A;  1U9N A;  1Z3Y A;  2A6H F;  5FRM A;  2Q2E A;  3M7G A;  2FE3 A;  1SFX A;  2A69 F;  4C3I J;  4HOB A;  5HNF A;  5HLI A;  3LA7 A;  3FBI B;  2P6T A;  4CYD A;  2VJJ A;  2EV6 A;  4BJT A;  1POG A;  2XGX A;  4PUS A;  2RQQ A;  2BVM A;  4EJW A;  2L7Z A;  3VB2 A;  5LD2 C;  2C6Y A;  4LGW A;  5LEJ A;  3OY9 A;  4E7K A;  4F92 B;  4F91 B;  3EDP A;  2L2O A;  2P8T A;  2EIL H;  3MMY B;  2DO7 A;  2KDO A;  4IJA A;  4OAZ A;  1VQL I;  1WSU A;  3GTM J;  1UMQ A;  3PNT A;  4LFU A;  5FLX K;  3TW7 A;  4KNY A;  1LJ9 A;  1VFC A;  1K6O A;  2CV2 A;  1V3F A;  1B8I A;  2V26 A;  2BY3 A;  4M74 A;  4V2G A;  4M9Z A;  1AWC A;  3F72 A;  3M07 A;  1GXP A;  1XGM A;  1ZG3 A;  3WTV C;  3KLO A;  4XKV A;  3BR1 A;  3ISP A;  3I59 A;  2LF7 A;  4ENK A;  2LBF A;  1JGG A;  2TRT A;  3RKX A;  4V2F A;  1KYZ A;  3JTH A;  3BDD A;  3KP4 A;  1VQO I;  2F5E A;  4MFD A;  2A07 F;  4KN7 X;  4IHW A;  3A1Y A;  4CIC A;  1S29 A;  2EFN A;  1OCO H;  3HOW J;  4DBQ A;  5D6E A;  4KT6 A;  3NQO A;  3P7N A;  5DS9 A;  2V7F A;  4RBO A;  2NVU B;  3VFZ A;  2JTV A;  3HOT A;  3DTE A;  3CCV I;  1PJR A;  2TCT A;  2R5Y B;  1D1C A;  3R6S A;  5FJ8 J;  2DMP A;  4D7N A;  4CHU A;  1Y39 A;  2PBI A;  2Z2S B;  2DT5 A;  1MBH A;  4RAG A;  4NQW B;  3ZR8 X;  5M3M J;  2DW4 A;  4D7M A;  3ZQF A;  2JA6 J;  4G7O F;  1X1B A;  1KGS A;  3ZQG A;  5GPA A;  2HI3 A;  5M5Y J;  2HQ5 A;  2IEK A;  2E36 A;  1WJE A;  2MH9 A;  3I5U A;  2Y31 A;  2PMZ A;  3EUA A;  2GOX B;  1BR1 A;  2PMU A;  4D5F A;  2ME0 A;  3GEZ A;  2Y0S A;  1MNE A;  3KYL A;  1ODD A;  1Z7L A;  4DZP A;  4S0H B;  3TDZ C;  1NH3 A;  3U21 A;  4L18 B;  2MA3 A;  4V19 K;  1X1D A;  1WJD A;  5CKT A;  5A2Q Z;  2E5Z A;  3OOU A;  4M3F A;  4YEL A;  5J8C A;  3K2Z A;  4RAY A;  2VQL A;  3HUG A;  2BV6 A;  4GO1 A;  2KZV A;  1IAW A;  4A12 A;  3FXK A;  4HST A;  3D0S A;  5EJC A;  3KCC A;  1XGS A;  2D45 A;  2X6O A;  4M3G A;  2VBY A;  5JVT A;  2QSG X;  4BS9 A;  4PFP A;  4BHC A;  2E2J J;  4BL0 B;  1APL C;  3BLY A;  1JUS A;  2E1M C;  2FOW A;  2EFW A;  1D0Y A;  1LFB A;  5L3D A;  1ZHF A;  3T8T A;  2EQR A;  3W6V A;  2P7C B;  4XKB A;  5JHF A;  3WGH A;  1FBU A;  1RNL A;  2HVS A;  3LOC A;  3ELK A;  4A3D J;  2OPT A;  3D5R C;  1R5H A;  3KP3 A;  3Q9S A;  2DA2 A;  4GYI A;  2VT2 A;  3M1C A;  1R00 A;  3GFM A;  4KDP A;  4ON0 A;  3TMO A;  3LST A;  1IN7 A;  2ZJR F;  2HFH A;  2VKE A;  3OS2 A;  2JSC A;  2HOA A;  1JGS A;  4N4O B;  3GXO A;  3E6C C;  3S1R J;  2QVO A;  4GGG A;  1PUF B;  1QBJ A;  1TWC J;  4Z6Y A;  3DXJ F;  2CO5 A;  5DYM A;  3CLQ A;  1WWX A;  2UV1 A;  3RYR A;  4XNF A;  4E7S A;  2VOO A;  3BG9 A;  5CVV A;  2PFB A;  2CGP A;  3KEY A;  5AIP A;  2Z16 A;  4KT5 C;  3R60 A;  3K70 C;  4FQG A;  2XSJ C;  1KQ8 A;  3FXU A;  3SYT A;  2JZY A;  1A36 A;  1IG7 A;  3MKW B;  2M34 A;  3W3C A;  3ZPL A;  2DMU A;  2IGM A;  1W7P B;  3HHG A;  4MHG A;  2XAS A;  3S2W A;  2E1M B;  2VLA A;  2PI0 A;  2DAO A;  1P7J A;  3GME A;  4CDG A;  5F27 A;  2DPU A;  2IBD A;  1RES A;  2XRL A;  3W6J B;  4XBF A;  3H9G A;  4FHT A;  5FLX Z;  1B72 B;  3OYM A;  3LFU A;  4KUM A;  1K78 A;  5EEH A;  3P9K A;  2NS7 A;  3GZ6 A;  3SQN A;  1XGN A;  2XHK A;  5FRO A;  2XF6 A;  3F8N A;  5JHU A;  2FNA A;  1SD7 A;  3IAM 2;  2JRT A;  3GFJ A;  2AXL A;  2XB5 A;  4E7H A;  2IA1 A;  4PJ0 C;  2L4M A;  3I56 I;  3MZY A;  1X1C A;  2LLK A;  3BRO A;  2LY1 A;  2RNJ A;  2Z3Y A;  4EGY A;  1IRG A;  1F4K A;  3B6C A;  4IHY A;  3J80 K;  1CF7 B;  2LSO A;  1A5J A;  2P0W A;  1JTX A;  2XV4 S;  3MKZ A;  1E2X A;  2VAS A;  4J19 A;  1QNT A;  2WTE A;  4AM3 A;  1ETK A;  1T2K A;  3TGN A;  1FTT A;  3G73 A;  2W82 A;  4KIB A;  1RUO A;  3DTK A;  4AU7 A;  3S1N J;  3ZMZ A;  4UNO A;  3RIR A;  1MH4 A;  2MYS A;  1J7K A;  4II2 A;  5FFX A;  4G6D A;  1O7L A;  3P9C A;  1YRN B;  1UHM A;  3IP4 B;  2M1B A;  5CVJ A;  1LKX A;  4GXO A;  2FBI A;  5LEK A;  3OYG A;  3AG3 H;  3F8B A;  3CO6 C;  4EVI A;  4DIQ A;  1R5I D;  2TDX A;  1CQT A;  3TOA A;  2NNN A;  1QHG A;  2MLG A;  4XLC A;  2YR2 A;  5IOY A;  4JQF A;  1IN6 A;  1G3S A;  2VIX A;  5K7H A;  1WI3 A;  2P6S A;  5GTH C;  4H0E A;  1VQ7 I;  2ZNY A;  1IRF A;  2YSR A;  3MZH A;  4PSW A;  3C3W A;  3J81 K;  1TC3 C;  1U78 A;  1K6Y A;  1LVA A;  1OR7 C;  1ZN2 A;  1U3E M;  3KZY A;  2GIV A;  3HIF A;  3K9T A;  5BQT A;  4S05 A;  1O3S A;  2FEZ A;  2VKV A;  3FHZ A;  2BYV E;  4ZYD A;  3AG2 H;  3S15 J;  3I71 A;  1Z7U A;  4F55 A;  3WG9 A;  3SZG A;  1UZC A;  2CSO A;  2V9V A;  3CJQ B;  3TW6 A;  2K85 A;  3UNG C;  1P6R A;  2ZFU A;  3CF2 A;  5E20 A;  3VOD A;  2FML A;  2J5P A;  4LG0 A;  5FO5 A;  3O8H A;  1MMA A;  4HA8 A;  4A3E J;  2BHZ A;  2DLL A;  1G3T A;  3LMM A;  1ZRF A;  1WRJ A;  2EZK A;  4MFE A;  5GTI C;  4BNC A;  3CDH A;  5EG0 B;  4WXH A;  1Z21 A;  1OYI A;  3E5X A;  2D5V A;  5L3F A;  5E3M A;  1ETQ A;  2A5W A;  2QZ8 A;  4RB0 A;  4UUS B;  2HNH A;  1OCZ H;  5DCF A;  1RI7 A;  3HG9 A;  2PMZ N;  4YFX F;  3OYB A;  1T0F A;  2K40 A;  3CMA I;  1T38 A;  3HOU J;  2E7X A;  2Y0S N;  3CMM A;  4XKC A;  4IQJ A;  2QQ8 A;  1KU9 A;  3F6V A;  1HST A;  5ICC A;  2LD5 A;  4WXC A;  1IRZ A;  1Z0X A;  3HRS A;  3RKQ A;  3GTK J;  3CP2 A;  1L3L A;  1FOW A;  2ZXI A;  3JRA A;  2DK8 A;  3OIQ A;  3ONQ A;  2HZT A;  5ILV A;  2VJ4 A;  2PG4 A;  3IC7 A;  2DQR A; 
#chains in the Genus database with same CATH homology
 3PQK A;  4QLC U;  5BPI A;  5LHH A;  2RV8 A;  1QQI A;  3V8J A;  1FP1 D;  3FF5 A;  2DI3 A;  2D2W A;  2F5F A;  3T5X A;  5E18 F;  1Z6T A;  3JAM K;  3RYP A;  2FA5 A;  1I6X A;  4OIO F;  4HLY A;  4A2U A;  4UVA A;  5D5X B;  3RI4 A;  3CO7 C;  2RN7 A;  2OZU A;  1FBQ A;  4L9T A;  1S6L A;  4KMF A;  3H92 A;  3KP6 A;  4ETS A;  1FSH A;  5BS6 A;  1KQ9 A;  1PP7 U;  4XLN F;  2V6C A;  2VT3 A;  5HS9 A;  2XAG A;  3GZ5 A;  5FD6 A;  3WU0 A;  2K02 A;  3J80 Z;  4LMY A;  5D8L B;  4IRI A;  4ESF A;  5CYV A;  3ZQ7 A;  4L5I A;  1UCR A;  3Q9V A;  1MDM B;  3QPH A;  1RIO H;  3HSE A;  5L3C A;  4Y17 A;  5DCM B;  1SAX A;  3HTU A;  1MJB A;  3KLN A;  5CVI A;  4YFK F;  1R1V A;  5BOX A;  4OU0 A;  3PQJ A;  2EK5 A;  4ZYE A;  1BJA A;  5DD4 A;  2IPQ X;  2O0Y A;  1FBS A;  3ZMU A;  3J81 Z;  4KMU X;  2A5Y B;  5J6X A;  2VC1 A;  5IT3 A;  1L0O C;  2D1V A;  4P9U A;  2COM A;  2HKO A;  1IXS B;  2KJC A;  1EH7 A;  2VBX A;  3K1P A;  3MWM A;  1BC7 C;  2OZ6 A;  3RKY A;  2L54 A;  4AIH A;  4F7Z A;  2DU9 A;  3R4K A;  2K86 A;  3ZMS A;  2JPB A;  3P9I A;  1HKQ A;  1W5S A;  1J75 A;  5LLQ A;  4NB5 A;  4MQ9 F;  1YTY A;  5FGM A;  4R8H A;  1O3Q A;  1QGP A;  3F8M A;  2BE5 F;  2Z5U A;  2P4W A;  3L09 A;  2OD5 A;  5E8G A;  4IF4 A;  1XDS A;  1XGO A;  2WC2 A;  4IHT A;  3WTS C;  3ULQ B;  2MLK A;  3IKV A;  4OIP F;  3R61 A;  2V1D A;  1H9T A;  1KYW A;  1EH8 A;  2M87 A;  1SFU A;  3GYH X;  1T98 A;  2L3D A;  1FZP B;  2AS5 F;  3JAM Z;  5D4R A;  1MJ9 A;  1RZ4 A;  3E6M A;  4N0B A;  1U8R A;  4OIQ F;  3WGG A;  4A0X A;  4BXU A;  5HLH A;  5K5Q A;  1RUN A;  3EYY A;  2EV0 A;  1J9I A;  2KKO A;  4LLG F;  2FQ3 A;  4HX8 A;  3VOE A;  4AIJ A;  2VON A;  3DF8 A;  1P2F A;  1I27 A;  2IP2 A;  4QWQ A;  3ABU A;  1EH6 A;  3FWE A;  4WWC A;  3WGI A;  4A6D A;  4UXN A;  1MGT A;  4GYG A;  4MEY F;  2HGC A;  3K1N A;  1MD0 A;  5JR3 A;  3B02 A;  3CUQ A;  4L0Z B;  5HDK A;  3KEO A;  5BMZ A;  2QUF A;  3N97 A;  3BZ6 A;  1ZAO A;  3AAF A;  5DUK A;  1HBX G;  3I58 A;  4FT8 A;  4ENJ A;  3ZMV A;  4U0Y A;  5CVR A;  3IRQ A;  4I0A A;  4U0W A;  1PUE E;  5E1X A;  5E8I A;  3M8E A;  4PDK A;  1XN7 A;  2UXN A;  2W85 A;  3QOP A;  2L01 A;  1R22 A;  2M5W A;  3BWG A;  3BPX A;  3DQV C;  5H6Q A;  5BPD A;  1IXR C;  3TO6 A;  1IZ1 A;  1H9G A;  4EJU A;  3L00 A;  4CZZ A;  1XMA A;  3E3V A;  4WF2 A;  4G6Q A;  3F23 A;  4ENM A;  4AIK A;  1K78 B;  4HV6 A;  5F1R A;  3BPV A;  3TKY A;  3ML6 A;  2QM3 A;  4BYY A;  3TQN A;  5D5V B;  1YYV A;  4RGR A;  2FU4 A;  2YU3 A;  1E17 A;  4ZZL A;  4PCQ A;  2GA1 A;  4ZYG A;  5ILU A;  5HOO A;  3H3U A;  5ICF A;  1Z9C A;  1B1B A;  4MTE A;  1BI0 A;  4R79 A;  1G4D A;  2V79 A;  3HYI A;  2HQR A;  2EWN A;  3B73 A;  1G3Y A;  4M73 A;  4P55 A;  2Y75 A;  4PZJ A;  5ILS A;  1J59 A;  3E5U A;  1TQI A;  1PP8 F;  1QO0 D;  4U7B A;  2HQN A;  5LGU A;  1W5T A;  3C1D A;  2ACJ A;  1FLI A;  3V8L A;  1YW8 A;  4LG0 B;  3HTS B;  2KIF A;  3WOD F;  5ERI A;  1W4M A;  2DBB A;  3DEU A;  3C7J A;  1LB2 A;  4LJZ F;  2ZCW A;  4HF0 A;  4M9S A;  1HW5 A;  4DQ2 A;  5HVQ C;  1ON1 A;  2FBH A;  2FXA A;  5FB2 A;  2RC4 A;  4HQE A;  5KVR A;  1IXC A;  4DNC A;  1V4R A;  1FYL A;  4HF2 A;  2NS0 A;  5D6F A;  3QP5 A;  3I64 A;  2UWM A;  3IHU A;  3HRM A;  1QZY A;  3DV8 A;  1OYW A;  3E6D A;  5LRR A;  2RDP A;  4ZYH A;  1LEB A;  5JI6 A;  3O6B B;  1OYY A;  2VN2 A;  1BI3 A;  3ZN1 A;  2ZME B;  1FPQ A;  3I4P A;  1SMY F;  5E1W A;  2QWW A;  3PFI A;  4NQW A;  3REO A;  2EA2 A;  4HDU A;  5F64 A;  4XLP F;  2A68 F;  1S7A A;  5H20 A;  4Q5S F;  2IA2 A;  2VOP A;  3M9A A;  2ZJ2 A;  2K4J A;  1FP2 A;  4UVB A;  1YFH A;  3LA3 A;  4ESB A;  5TRD A;  2MBF A;  1TTY A;  3I54 A;  1FYM A;  2PQ8 A;  4OMZ A;  2ISZ A;  2P5V A;  1ZGJ A;  3FMQ A;  1MKM A;  4I09 A;  2WWY A;  4HYE A;  4MQV A;  1WI9 A;  3TOB A;  3L7W A;  4HX7 A;  3WTT C;  2VC0 A;  5FFZ A;  2F5C A;  2M30 A;  1SD6 A;  2HWV A;  1UFM A;  3KP2 A;  1XCV A;  4P5O A;  1FOK A;  1HKT A;  4O5V A;  3GWZ A;  5ICG A;  2R3S A;  5L3E A;  1BIB A;  2ADU A;  3EQL F;  2W24 A;  1BC8 C;  2Z9O A;  3T8R A;  1TW3 A;  3DFG A;  1JE8 A;  4UV8 A;  3MCZ A;  2EB7 A;  2L02 A;  4O6J A;  4R1H A;  2QQ9 A;  5K5O A;  1S8N A;  3O2P E;  3M8F A;  1J5Y A;  1ZRC A;  2QLZ A;  5HDN A;  3I0T A;  3RKW A;  3JTG A;  1U6G A;  2O61 A;  1P4A A;  4L0Y B;  1W7P A;  3WTY C;  2D1H A;  3DKW A;  2HDC A;  1YG2 A;  1R7J A;  1S7O A;  1HXD A;  4EV0 A;  2XAF A;  3FMS A;  2ESN A;  4L5J A;  2CG4 A;  2PJP A;  2OAZ A;  4Q47 A;  1GHC A;  2QYO A;  1R1T A;  4YG2 F;  1XD7 A;  3IL2 A;  1R36 A;  4ESJ A;  1D8K A;  3DPT A;  3I53 A;  3F22 A;  2IVM A;  2Y48 A;  2OU2 A;  1HSJ A;  4HBL A;  2YPR A;  3W6K B;  3GO5 A;  3U9G A;  1XSX A;  1Q1H A;  2NRA C;  5JFR A;  2JT1 A;  3DPL C;  3HSF A;  4I98 B;  2Z99 A;  1LNW A;  1Z1D A;  4UUV A;  1Z05 A;  2FBK A;  1X3U A;  3O3K A;  2G9W A;  4U88 A;  5FD5 A;  5TJJ A;  4M9X A;  2G7U A;  2KIU A;  2IRF G;  3LWF A;  3CTA A;  2ESH A;  5H6R A;  1U2W A;  1LEA A;  3IRR A;  2EFP A;  2FF4 A;  2MH2 A;  3N4M A;  2NNY A;  5KK1 A;  1BM9 A;  4M71 A;  4KIG A;  2H6C A;  2HOE A;  2MD5 A;  4A5N A;  2H09 A;  2GAU A;  2IW5 A;  3BJA A;  1FY7 A;  4AWX B;  2FMY A;  3MEX A;  1QPM A;  2STT A;  2E1C A;  2O6G E;  2XRN A;  3V8K A;  4TV7 A;  2O8X A;  1FSE A;  2XKP A;  3CUQ B;  1DDN A;  2KJB A;  4MGR A;  3RPU A;  4KIC A;  1ZGA A;  3T0Y A;  2ZBK A;  5J8F A;  2PEX A;  2UXX A;  1XSD A;  3BP8 A;  4LB6 B;  2CWE A;  3SXY A;  1J0R A;  1B4A A;  4KFC A;  4Y13 A;  1UHW A;  4MNU A;  2OQR A;  4N9H A;  2Z33 A;  1OR7 A;  3F8F A;  3LFK A;  2QBY A;  2VBW A;  4KIF A;  1TBX A;  2Y0M A;  1BOA A;  1OMI A;  1ZAR A;  2LF8 A;  2W25 A;  1W7P D;  1S3J A;  1BN5 A;  3I59 B;  4IRH A;  3LA2 A;  4WCG A;  5F6F A;  4HLX A;  4LLL A;  3WE3 A;  2STW A;  5LGT A;  3F6O A;  2X4H A;  3M1E A;  3JSO A;  2CQK A;  3LQQ A;  1T39 A;  4CXF A;  3U1D A;  4LD5 A;  2X0L A;  4HAM A;  1J2X A;  1B9M A;  3QRF F;  4RGU A;  3WTX C;  4RGS A;  1BI1 A;  2BBY A;  2W57 A;  2A6E F;  3C18 A;  1MDM A;  1YQA A;  2DQL A;  2OA4 A;  3RDI A;  2IA0 A;  2DFI A;  3MAJ A;  3KE2 A;  1IF1 A;  1KU7 A;  4PGG A;  3EUH A;  1YW7 A;  5D5W B;  1U5T A;  2Q0O A;  2EA4 A;  1SFE A;  4RB2 C;  1FWZ A;  2YX7 A;  2B0L A;  2KRF A;  1I5Z A;  4OIR F;  4LK0 F;  2CFX A;  2MC3 A;  2ZKZ A;  4OMY A;  3LAJ A;  2ELH A;  3WTW C;  2P7V B;  5CJ9 A;  2ETH A;  2VE8 A;  1AOY A;  1SD5 A;  3JW4 A;  3ERE D;  3EET A;  2EJR A;  3F21 A;  3QP6 A;  1D8J A;  4YFN F;  5E1Z B;  5L3B A;  2H6B A;  4RGX A;  4Q48 A;  3E5Q A;  1T6S A;  3V4G A;  4M6Y A;  3ZMD A;  5AIQ A;  4O3M A;  1FC3 A;  4L9N A;  2PN6 A;  3LQR A;  1O3T A;  5HS7 A;  4BHP A;  3ZMT A;  2DTR A;  4L9J A;  2XVC A;  1DPU A;  4A6E A;  1XB4 A;  4KA4 A;  3FM3 A;  1Z6R A;  1F1Z A;  2H94 A;  3RTR A;  1P4X A;  4CO8 A;  2RKH A;  2OBP A;  1PDN C;  4EMS A;  3IKT A;  2YX4 A;  1DUX C;  4RB1 A;  4G7H F;  1ZRD A;  2ZFW A;  5LHG A;  2BEO A;  1B59 A;  1YLF A;  1ZG5 A;  2XAQ A;  4JK1 X;  4Q4Z F;  4Z2Y A;  2LDU A;  4PGH A;  4I0B A;  2L4A A;  3ECO A;  4IHS A;  2KIM A;  3V7S A;  4G9Y A;  2E7W A;  4L9V A;  4LB5 A;  3FXQ A;  1P92 A;  1VTN C;  1BI2 A;  3WTU C;  3FZV A;  1KU2 A;  3QPT A;  3KEQ A;  1FX7 A;  3R0A A;  3TDU C;  1QZZ A;  2F2E A;  2FSW A;  2DPD A;  5ICE A;  4CGZ A;  1KU3 A;  1FNN A;  1TLH B;  4EGZ A;  1SD4 A;  1F5T A;  1TQM A;  2ISY A;  2RVC A;  3CUO A;  4FX0 A;  4WK8 F;  2NYX A;  4ZH4 F;  4P96 A;  2PLY A;  2M8E A;  1KA8 A;  4EM2 A;  4K2E A;  4LK1 F;  2R7D A;  1DP7 P;  4YII A;  1R58 A;  2GWR A;  2P5L C;  2F5D A;  4A5M A;  4Y15 A;  4U7D A;  4G8X A;  1R23 A;  1D3Y A;  4UHT A;  3BOQ A;  1KQ0 A;  4ENN A;  2GXG A;  1ZYR F;  3D5L A;  2V1X A;  1D5V A;  3JSP A;  3HOS A;  3GF2 A;  1HW2 A;  2XAJ A;  1B9N A;  5DV5 A;  4HDV A;  1IN4 A;  4G7Z F;  3G3Z A;  3K0L A;  3HRU A;  2CYY A;  2CW0 F;  1UB9 A;  5DUI A;  4RB3 C;  4IPA A;  1JHH A;  1ZRE A;  3COA C;  1SMT A;  3ZP5 A;  4ASN A;  4U0V A;  2XRO A;  3V7R A;  4YIF A;  2VE9 A;  3V7C A;  1XCB A;  3RPQ A;  1H0M A;  3GFL A;  4LLN A;  2XUB A;  2VBZ A;  5DDG A;  5D5U B;  4S04 A;  2K4B A;  3RJP A;  1WQ2 A;  1I1S A;  4D0P A;  2VOD A;  2HYG D;  2W84 A;  1Z91 A;  1EV7 A;  2RGV A;  2K27 A;  2FNP A;  4ZZD A;  2V1U A;  2FOK A;  1I1G A;  4E70 A;  1OKR A;  5HLG A;  4IRG A;  4AVP A;  4UVC A;  3KET A;  3ECH A;  2HS5 A;  1YS6 A;  5HDG A;  2HTJ A;  4I2O A;  5IT9 K;  4IXA A;  2IT0 A;  2P5K A;  3WTZ A;  2ZO4 A;  4EM0 B;  2BGC A;  3MQ0 A;  4A0Y A;  3H3Z A;  4M72 A;  1MJA A;  4NHJ A;  2J5O A;  3DP7 A;  1GXQ A;  1ZLJ A;  4RS8 A;  1ZG1 A;  3HHH A;  1G3W A;  4WXD A;  5CVU A;  1LDD A;  1ZH5 A;  3FX3 A;  1HQC A;  1IN5 A;  1IW7 F;  1TNT A;  2OQG A;  4FX4 A;  2HYF A;  4HF1 A;  4OIN F;  3KZZ A;  4HV5 A;  1C0W A;  4I7H A;  2H27 A;  3Q5F A;  2DK5 A;  3F8C A;  5D4S A;  4EM1 A;  4N9I A;  3F3X A;  1XSV A;  5L3G A;  3KP7 A;  3FM5 A;  3GVA A;  4HX4 A;  1ULY A;  2K7L A;  2QBY B;  1MZB A;  3KP5 A;  3QU3 A;  5LBQ A;  3E6B A;  5D8K B;  4B8X A;  2QEN A;  2O3F A;  3QAH A;  4XSZ F;  3TO9 A;  1WKM A;  3SFZ A;  2FRH A;  1U5T C;  4BAY A;  3CJN A;  2A61 A;  1CF7 A;  1IUY A;  4MEX F;  1HW1 A;  1DPR A;  2ZME A;  1UST A;  2QQA A;  1YO5 C;  1FYK A;  1LDK B;  5K5R A;  2PMH A;  4IVN A;  2HKX A;  3CUQ C;  2NAZ A;  3ABT A;  1NHA A;  2A3S A;  1B6A A;  5HS8 A;  4M6X A;  5CLS A;  3U2R A;  2LKP A;  5ED4 A;  2EFO A;  1A04 A;  1ZLK A;  2VXZ A;  2ZNZ A;  3QU6 A;  3CLO A;  3WU1 B;  1R5G A;  3R0J A;  5DD8 A;  3ROU A;  1O3R A;  1JXS A;  4EQQ A;  1U5T B;  2XKO A;  3L2C A;  1O7F A;  3LAP A;  2GA2 A;  3SHF A;  2GQQ A;  1TQP A;  3SZP A;  2HEO A;  1R1U A;  3IWF A;  5AON A;  2IJL A;  4I02 A;  3ZN0 A;  5IT9 Z;  5LRS A;  3SZT A;  3NRV A;  1Y0U A;  3NEU A;  1IN8 A;  1STZ A;  2ZXJ A;  3BJ6 A;  1YIO A;  4B09 A;  4OOI A;  2JPC A;  3L9F A;  3FMR A;  2LNB A;  2E1N A;  4RAZ A;  4KN4 X;  1YS7 A;  1O57 A;  4A0Z A;  1G6N A;  1F9N A;  2HR3 A;  3BJO A;  1BBY A;  4WX9 A;  3E97 A;  3T1B A;  3TO7 A;  3FXR A;  3MFK A;  2Q8K A;  3HSR A;  4I01 A;  3GX4 X;  2RQP A;  3GLX A;  3EYI A;  3VEP A;  5EEG A;  1USS A;  1LDJ A;  4AD9 A;  2QQB A;  4HQM A;  4BH9 A;  4EJO A;  2HTS A;  2XAH A;  1K7A A;  1TW2 A;  4EJV A;  3OOP A;  2UZK A;  1FT9 A;  1LQ1 A;  5E17 F;  1ON2 A;  2EV5 A;  5LHI A;  2R7F A;  4UV9 A;  5A2Q K;  1CGP A;  4JBA A;  1YW9 A;  3GFI A;  5LGN A;  4BHB A;  4HZF A;  2XIG A;  3BY6 A;  4XRF A;  5DCM A;  4GCV A;  2GZW A;  4P9F A;  5K1Y A;  3K1M A;  5DEQ A;  1P4W A;  6PAX A;  1XMK A;  4XSX F;  4KYW A;  1OPC A;  3K69 A;  2O03 A;  1ONV A;  2G7H A;  3HRT A;  4G94 A;  3IWZ A;  1JHF A;  2M45 A;  1XDU A;  3OV8 A;  1GVJ A;  3GW2 A;  3J7A O;  1BIA A;  4BQA A;  1K79 A;  2WV0 A;  4EJT A;  1HKS A;  2EFQ A;  4MTD A;  1REP C;  3WE2 A;  3GUD A;  4HW0 A;  2GXB A;  1TNS A;  3KFW X;  2A6H F;  2Q2E A;  3M7G A;  2FE3 A;  1SFX A;  2A69 F;  4HOB A;  5HLI A;  3LA7 A;  4CYD A;  2P6T A;  2EV6 A;  2XGX A;  4EJW A;  3VB2 A;  2C6Y A;  4LGW A;  5LEJ A;  3EDP A;  2P8T A;  2DO7 A;  4IJA A;  1WSU A;  4LFU A;  5FLX K;  4KNY A;  1LJ9 A;  1K6O A;  1V3F A;  4M74 A;  4M9Z A;  1AWC A;  3F72 A;  1GXP A;  1XGM A;  1ZG3 A;  3WTV C;  3KLO A;  3ISP A;  3I59 A;  2LF7 A;  4ENK A;  3RKX A;  1KYZ A;  3JTH A;  3BDD A;  3KP4 A;  2A07 F;  2F5E A;  4KN7 X;  4CIC A;  1S29 A;  2EFN A;  5D6E A;  3NQO A;  3P7N A;  3VFZ A;  2JTV A;  3HOT A;  3R6S A;  4CHU A;  2PBI A;  2DT5 A;  2DW4 A;  4G7O F;  1KGS A;  2MH9 A;  3I5U A;  2PMU A;  3GEZ A;  1ODD A;  3TDZ C;  4L18 B;  2MA3 A;  5A2Q Z;  5J8C A;  3K2Z A;  4RAY A;  3HUG A;  2BV6 A;  4GO1 A;  1IAW A;  4A12 A;  3D0S A;  3KCC A;  1XGS A;  2D45 A;  2VBY A;  5JVT A;  4BHC A;  2EFW A;  5L3D A;  1ZHF A;  3T8T A;  2P7C B;  3WGH A;  1FBU A;  1RNL A;  3ELK A;  1R5H A;  3KP3 A;  3Q9S A;  4GYI A;  2VT2 A;  1R00 A;  3GFM A;  4KDP A;  4ON0 A;  3LST A;  1IN7 A;  2HFH A;  2JSC A;  1JGS A;  3GXO A;  3E6C C;  2QVO A;  4GGG A;  1QBJ A;  3DXJ F;  2CO5 A;  5DYM A;  1WWX A;  3RYR A;  2VOO A;  5CVV A;  2PFB A;  2CGP A;  5AIP A;  4KT5 C;  3R60 A;  1KQ8 A;  3FXU A;  2JZY A;  3ZPL A;  1W7P B;  3HHG A;  4MHG A;  2XAS A;  3S2W A;  2PI0 A;  2DAO A;  4CDG A;  2DPU A;  3W6J B;  4XBF A;  4FHT A;  5FLX Z;  4KUM A;  1K78 A;  5EEH A;  3P9K A;  3GZ6 A;  3SQN A;  1XGN A;  2XHK A;  5JHU A;  3F8N A;  2FNA A;  1SD7 A;  2JRT A;  3GFJ A;  2AXL A;  2IA1 A;  2L4M A;  3MZY A;  3BRO A;  2RNJ A;  2Z3Y A;  4EGY A;  1IRG A;  1F4K A;  3J80 K;  1CF7 B;  2LSO A;  2XV4 S;  1E2X A;  1QNT A;  2WTE A;  1T2K A;  3TGN A;  3G73 A;  1RUO A;  4KIB A;  3ZMZ A;  4UNO A;  3RIR A;  1J7K A;  5FFX A;  4G6D A;  1O7L A;  3P9C A;  1UHM A;  2M1B A;  5CVJ A;  4GXO A;  2FBI A;  5LEK A;  3F8B A;  3CO6 C;  4EVI A;  2TDX A;  3TOA A;  2NNN A;  2MLG A;  2YR2 A;  4JQF A;  1IN6 A;  1G3S A;  2P6S A;  4H0E A;  2ZNY A;  1IRF A;  2YSR A;  3MZH A;  3C3W A;  3J81 K;  1U78 A;  1LVA A;  1ZN2 A;  1U3E M;  3KZY A;  2GIV A;  3HIF A;  3K9T A;  5BQT A;  4S05 A;  1O3S A;  2FEZ A;  3FHZ A;  2BYV E;  4ZYD A;  3I71 A;  1Z7U A;  3WG9 A;  2CSO A;  2V9V A;  1P6R A;  5E20 A;  3VOD A;  2FML A;  2J5P A;  4LG0 A;  5FO5 A;  4HA8 A;  2DLL A;  1G3T A;  1ZRF A;  1WRJ A;  4BNC A;  3CDH A;  4WXH A;  1OYI A;  3E5X A;  5L3F A;  4RB0 A;  2QZ8 A;  5DCF A;  1RI7 A;  4YFX F;  1T0F A;  1T38 A;  2E7X A;  1KU9 A;  3F6V A;  1HST A;  5ICC A;  4WXC A;  3HRS A;  1L3L A;  2DK8 A;  2HZT A;  5ILV A;  2PG4 A;  3IC7 A;  2DQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...