2OBPA

Crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA-binding protein
publication title Crystal structure of putative DNA-binding protein (YP_298295.1) from Ralstonia eutropha JMP134 at 1.70 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Dna binding protein
total genus 23
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2obpA00
1ZRDA 2Z33A 3DFGA 3EQLF 5KVRA 1YW8A 1CF7A 2MBFA 4HDUA 4RGXA 1REPC 4UVBA 3QP5A 1S8NA 2BV6A 1T2KA 5J8FA 4IJAA 4OINF 5F64A 1XMKA 3WGGA 1IN8A 2HTJA 1FX7A 3HOSA 3M8EA 2FMLA 3MAJA 2HEOA 4ENKA 4OIQF 2HQNA 1FP1D 2J5OA 1S7AA 4FX4A 4UXNA 5CVRA 3I4PA 3IRQA 4ENNA 2JT1A 2OBPA 3HRUA 2WC2A 4WX9A 1OMIA 4EM0B 3CUOA 2DPDA 3MZHA 3FMSA 1JHFA 3TO7A 4L5JA 5IT9K 1G3TA 2NNNA 1O3SA 4A2UA 1JE8A 1ON1A 2Q8KA 4AIHA 5L3CA 4G94A 2RQPA 1KU3A 4ASNA 3BPVA 4JK1X 1ZYRF 2E7XA 1QBJA 1IN4A 5CVVA 2P5LC 5EEGA 1FY7A 5CJ9A 2D1VA 1H9TA 2VN2A 3ZMUA 3L2CA 4A12A 2UWMA 2QM3A 1SMYF 5E20A 2EA2A 5H6QA 5JR3A 1HW2A 3KP7A 3MWMA 2DK8A 2PFBA 2QQAA 1FNNA 3F8FA 3ZMVA 4RS8A 4GGGA 3K1PA 2A69F 4BNCA 4HW0A 2M45A 3MQ0A 2YX4A 2M87A 3VFZA 2H6BA 3L09A 1Z1DA 1Z6TA 3FMQA 4KICA 2EK5A 1ZGJA 2O6GE 1B1BA 1TQPA 1O3RA 3BPXA 2NAZA 2IP2A 4IHTA 2EV6A 4WF2A 4XLPF 3LA2A 4IHSA 1MKMA 3ABUA 2BBYA 2YSRA 4DNCA 3HOTA 2K27A 4ENMA 5DUKA 3E3VA 3FWEA 2Y75A 3I0TA 4HYEA 3DQVC 5FB2A 1AWCA 3GFJA 4EV0A 4WXDA 3V4GA 4LJZF 3IHUA 4GXOA 3VB2A 2P6TA 2E7WA 2FSWA 2H09A 1OKRA 3IKVA 4YG2F 1BI3A 5FLXZ 1XCBA 4L9JA 1R36A 2JZYA 3RYPA 1B9MA 2UXNA 3U9GA 2IT0A 2GA2A 1QZYA 1KU9A 4KNYA 2NNYA 4RAYA 4HDVA 3KP5A 4O3MA 3WU1B 2DBBA 3I5UA 1W4MA 4EVIA 5D6FA 3RDIA 2DW4A 2CG4A 3R6SA 2STTA 2ZO4A 2HWVA 4I01A 3BJAA 2V9VA 1G3YA 1XGOA 4IXAA 1BIBA 5HDNA 4UHTA 1S7OA 1OYIA 2PI0A 1BI1A 1KGSA 3QAHA 2TDXA 4HQMA 2RKHA 1FWZA 4XRFA 4FX0A 2VOOA 5CYVA 4EM1A 2VE9A 1IAWA 3NRVA 2Q2EA 2VT3A 4MGRA 1XDSA 1BBYA 3HSRA 3IWZA 5FLXK 1QQIA 2JTVA 3QP6A 4LGWA 1KU7A 1IRGA 3GZ6A 4D0PA 3G73A 4KFCA 5LHHA 2Y0MA 4KYWA 3WE3A 1HSJA 1SFEA 4M6XA 1USTA 4CYDA 5ICEA 3F6VA 3DV8A 3ULQB 3F8MA 4XBFA 3ABTA 4AIKA 3RJPA 3LA3A 2EFQA 4I0AA 1TQMA 4I2OA 1GVJA 3BOQA 3V8JA 4HF1A 1QZZA 5TRDA 3ROUA 5LRRA 2XAJA 4Y13A 2PEXA 1FPQA 4CICA 4GCVA 1FZPB 4CHUA 2XRNA 3KCCA 2XKOA 1XGNA 2Q0OA 3TQNA 4HLYA 4Q5SF 1RIOH 5E1ZB 3HSEA 4O6JA 1FSEA 1Z05A 1KQ8A 3DPTA 1HW5A 2KIUA 5L3FA 2XUBA 4EQQA 4ZH4F 2FNAA 2ZMEA 2XAQA 4EM2A 3DP7A 1F5TA 4NHJA 4IRIA 3TOBA 3WU0A 5H20A 4WK8F 2O8XA 1YFHA 5D4SA 1MJBA 1XSVA 5AIQA 4LLGF 2VBZA 3C18A 1U8RA 2LDUA 3WTVC 2HR3A 5ICFA 5ERIA 2OQRA 1QO0D 4L9NA 2Z3YA 4FT8A 4KDPA 2QWWA 2E1CA 3GO5A 3U2RA 3FXQA 3DEUA 4BQAA 3N4MA 2RV8A 3ZN0A 3F8CA 5ILSA 3E5UA 3BP8A 2RN7A 1MGTA 5LBQA 6PAXA 1JHHA 2M5WA 2F5EA 4M6YA 3RKWA 3JAMZ 1OPCA 3KZZA 2V79A 1Q1HA 4U0VA 1HKSA 3FM3A 1J9IA 3JTHA 1PP8F 1T38A 4M71A 2EJRA 3LFKA 4P5OA 2IA1A 1LEBA 5HLHA 1D8KA 5A2QZ 4P9FA 3GFLA 4IPAA 1BJAA 4KIGA 3SXYA 2HS5A 1XSDA 2F5FA 1U3EM 2BGCA 1ZLKA 1ZG3A 4PGHA 5CLSA 4JBAA 3HRTA 1MJAA 1ULYA 2ADUA 3R0AA 5ILVA 1WRJA 5LGNA 3BJOA 3R0JA 1SD4A 2G7HA 3ZMZA 2VC0A 4UNOA 4WWCA 3W6KB 2VXZA 3OOPA 4EGYA 1QPMA 3TDUC 4Y17A 1NHAA 3F8BA 1VTNC 2FQ3A 3FX3A 3LWFA 1F4KA 3BJ6A 4Q47A 5HS8A 3QPTA 2P5KA 3I59A 2HGCA 4L5IA 4L0YB 4G7OF 1IUYA 1ON2A 3F8NA 3Q5FA 2VC1A 3AAFA 3RKXA 3F72A 4RB1A 2W57A 3IC7A 3P9CA 1XDUA 2KKOA 1H0MA 5IT3A 4PZJA 3JAMK 3K9TA 4L0ZB 3T8RA 2XASA 1BOAA 2A3SA 5HOOA 2D1HA 2W24A 3TGNA 3RYRA 1FP2A 2QZ8A 2GZWA 4OMZA 2P4WA 2DI3A 3E97A 3IRRA 3KP3A 1PP7U 2GIVA 5A2QK 1KQ0A 2Z99A 2L54A 1JGSA 1IRFA 3E6CC 4U0YA 1B9NA 4OIPF 5BS6A 3WGIA 1Z9CA 3GZ5A 1BI2A 1IZ1A 2ZKZA 3FM5A 3E6DA 3CUQA 4B8XA 1HXDA 2AXLA 3M9AA 3H92A 3HHGA 2EA4A 2VBXA 4UUVA 5AONA 4G6QA 3ZMSA 1K78A 3RI4A 1YS7A 1R7JA 5E18F 2QBYA 5EEHA 4HF0A 3WTUC 1MJ9A 2JRTA 1YQAA 2QLZA 4WXHA 2E1NA 3SZTA 3KETA 1XMAA 4HOBA 5BOXA 1FT9A 3L00A 5D4RA 2YR2A 3GUDA 4KUMA 3E6MA 5TJJA 5FO5A 2CFXA 4BHPA 2ISZA 1EH7A 4OU0A 2P6SA 1OYYA 1IXSB 1U6GA 4P9UA 2PBIA 4M73A 2P7CB 2DTRA 4ZYDA 3MFKA 2FEZA 2HKXA 3KP6A 2ELHA 5FD5A 2OU2A 4KT5C 2MH2A 3GXOA 4U7BA 1FBUA 1TNTA 1LDDA 2EV5A 3HTSB 2OZUA 4BXUA 1OYWA 1K7AA 1U5TC 3O2PE 2DFIA 2R3SA 1EV7A 4CDGA 2IVMA 1GHCA 3LQRA 2V1XA 2RDPA 4U0WA 5E8GA 1W7PB 2X0LA 1FYKA 3GX4X 3IWFA 4G9YA 2D2WA 5CVIA 3HSFA 2M1BA 4O5VA 4HAMA 4MNUA 1T6SA 4KIBA 1DDNA 4HQEA 3KP4A 4XSXF 1G6NA 3I71A 1ZRCA 3I54A 2ZJ2A 1J2XA 3KLOA 3TO9A 5AIPA 1I27A 3J81Z 3F23A 1T0FA 5LRSA 5BMZA 3WG9A 1TQIA 4XSZF 2F2EA 4U7DA 4LG0B 4BAYA 2CW0F 1W5SA 3NQOA 1A04A 4U88A 2WTEA 2Z5UA 2K02A 2GXGA 5K1YA 3TOAA 2XV4S 3RIRA 1R1VA 3F3XA 4N0BA 1XD7A 3WTSC 3DPLC 4HA8A 3I58A 2OA4A 3QPHA 4RB2C 4EMSA 1FBQA 2RC4A 2AS5F 1U2WA 2L3DA 1IN7A 1MD0A 2FU4A 3CO7C 4FHTA 3NEUA 1YYVA 2KJCA 4MEYF 4DQ2A 4M9XA 2NYXA 2FBKA 2ESNA 5E1WA 1ODDA 3I64A 2A5YB 3R4KA 3KEOA 4KIFA 1YS6A 3J81K 2PLYA 1L3LA 4ESFA 1V3FA 4I7HA 4ZYGA 5K5RA 1F9NA 2BEOA 2VT2A 4GYGA 5FD6A 2HDCA 4HF2A 1UCRA 2FOKA 1HQCA 1YO5C 1P4XA 1XSXA 1J75A 3KEQA 4H0EA 2QVOA 4A6EA 4MTEA 2F5CA 4Q4ZF 2H94A 2GXBA 1I1GA 5HLGA 1Y0UA 1ZREA 3WTYC 3EUHA 3E5XA 3LQQA 1ZH5A 4A5MA 4M74A 3HHHA 3ECHA 4UV9A 1ZG1A 4AVPA 1RUOA 2OZ6A 2X4HA 3U1DA 1LJ9A 4PGGA 1DP7P 4CGZA 4LG0A 4QLCU 5K5OA 3MCZA 5BPDA 4MTDA 5DUIA 2K7LA 1O3QA 1YG2A 1XGMA 2VONA 3K1MA 2XIGA 2V1UA 5DV5A 4ZZLA 1K79A 4KMFA 1G3WA 4EJWA 2W84A 2WWYA 4BHBA 2J5PA 3FMRA 3COAC 1KU2A 1TTYA 2FXAA 1P4WA 3KE2A 1SD7A 4HV6A 1P92A 3ZPLA 3P7NA 2ZCWA 4BH9A 3QU3A 3MZYA 1Z91A 1V4RA 2XHKA 1UFMA 2EFWA 5L3BA 3WE2A 1R5HA 5J6XA 3HIFA 3I53A 3WTZA 4ENJA 1PUEE 1KYWA 1IF1A 1ZRFA 2M30A 3GWZA 2HFHA 5D5WB 5K5QA 4N9IA 1FC3A 4M9ZA 1S29A 3TDZC 3OV8A 4WCGA 4EGZA 1USSA 2GAUA 3D5LA 3LSTA 3RKYA 1Z7UA 2OAZA 2FA5A 5H6RA 4L9VA 3ERED 4Z2YA 4PCQA 3CDHA 1J0RA 4LLNA 4LB6B 4M9SA 5HS7A 3BY6A 1HKQA 2UZKA 4ESBA 2P7VB 2MH9A 5D8KB 5ICGA 2LNBA 3TO6A 2DT5A 3WTXC 5D5VB 2HYFA 2H27A 5DCMB 3Q9SA 2C6YA 2P8TA 4NQWA 1GXQA 3JW4A 3R60A 1O57A 1X3UA 4RAZA 2KRFA 1U5TB 2BE5F 2LF7A 3RTRA 1LVAA 1YLFA 4I09A 3M1EA 2CYYA 4UVCA 3TKYA 4R8HA 5CVUA 4R1HA 4LK0F 3L7WA 4YFNF 2VE8A 1BC7C 2ZXJA 1GXPA 3P9KA 4YFXF 2LF8A 2L01A 3T0YA 3ECOA 5DDGA 5DEQA 4LFUA 1SD5A 3GW2A 1TLHB 3QRFF 3DKWA 1STZA 5CVJA 3FXRA 2XVCA 1I6XA 4OIRF 4A6DA 1XB4A 1FLIA 2FRHA 3PQKA 3DXJF 1T98A 4CO8A 3T1BA 1R5GA 2IA2A 3K0LA 4RGUA 5FFXA 3ML6A 2H6CA 1FSHA 2XKPA 4WXCA 1I1SA 1FOKA 4HX8A 1ZN2A 2W85A 2K4JA 3ISPA 1XCVA 1YTYA 4I02A 1G4DA 2VBWA 5DCFA 4I98B 1R1TA 2YU3A 3F21A 4MQVA 2ZBKA 3KZYA 1S6LA 1B6AA 1CGPA 1TNSA 2GQQA 3MEXA 4RB0A 4HV5A 4A0ZA 3J7AO 2IW5A 2ZFWA 5LEKA 4UVAA 5LEJA 4JQFA 5D5XB 2V1DA 3W6JB 1O7LA 3IL2A 3ELKA 5DCMA 3B73A 2OD5A 4ZYHA 2K4BA 2RVCA 1WQ2A 1UHWA 2Z9OA 1G3SA 1QGPA 4ETSA 1U5TA 1WWXA 2ZNYA 2PG4A 2M8EA 1TBXA 1F1ZA 2CO5A 5DD4A 2A61A 2QYOA 3T8TA 2FMYA 2G9WA 2EB7A 1ZG5A 5ED4A 1B4AA 3O3KA 3G3ZA 3C3WA 4EJOA 1TW3A 4F7ZA 1KA8A 2XAHA 1J5YA 1O7FA 5JVTA 3L9FA 3P9IA 3WODF 1FYLA 1LQ1A 3QOPA 3CUQC 2Y48A 4LLLA 2EFNA 3PFIA 5LHIA 2XAFA 1BN5A 3WTTC 2O0YA 2IPQX 2XGXA 2IJLA 3FF5A 4YFKF 1D3YA 1R23A 1R1UA 2VBYA 4GO1A 3BWGA 3HYIA 4IF4A 1FBSA 1ZGAA 3ZQ7A 3BROA 1HW1A 2QQ9A 2A07F 3GVAA 5LHGA 1S3JA 2G7UA 5HVQC 5LLQA 4LK1F 2RNJA 3K1NA 2HQRA 3FXUA 4G7ZF 1D8JA 5ILUA 5HS9A 4BYYA 5FGMA 1LEAA 4MQ9F 5L3DA 2GWRA 1LNWA 1RNLA 1SFXA 3QU6A 4EJTA 3JTGA 3GFIA 2CGPA 5JFRA 1P6RA 1ZARA 4A0YA 4ZZDA 2PQ8A 2YPRA 1TW2A 2DPUA 1R58A 1E17A 2ETHA 2L02A 4OMYA 2COMA 3M7GA 2P5VA 1ZAOA 5KK1A 2CQKA 4I0BA 3RPQA 3REOA 4G8XA 3JSPA 4AD9A 1IN5A 3CJNA 2PJPA 3ZN1A 1IXCA 3ZMTA 1IW7F 4KA4A 4EJVA 2DQRA 2EFOA 1LDKB 4MHGA 1P2FA 1H9GA 2MC3A 4M72A 3SQNA 1LDJA 1J59A 1YIOA 3J80Z 4S05A 2JPCA 3EYIA 3F6OA 1P4AA 1B59A 2R7DA 3N97A 5L3EA 5F6FA 2A68F 4YIFA 2FBHA 1U78A 2ACJA 4YIIA 3WTWC 1HSTA 2KIFA 4IRGA 5DD8A 1E2XA 4LB5A 2NS0A 4L18B 3O6BB 3GLXA 4ON0A 2ZMEB 3K2ZA 1HBXG 4HLXA 3HTUA 1QNTA 1R00A 3V8KA 3CO6C 3GEZA 4NB5A 4P96A 1RI7A 2KJBA 5LGUA 3F22A 2K86A 2FF4A 2B0LA 1Z6RA 1KYZA 5HDGA 5F1RA 3H3UA 1W7PA 3B02A 5FFZA 1LB2A 4OOIA 1I5ZA 2A6HF 2RGVA 1J7KA 2MLKA 3M8FA 3V7CA 2STWA 3V7RA 1BC8C 2ESHA 4HX7A 4KN4X 2HOEA 3KFWX 3T5XA 2O61A 3J80K 4HBLA 2MLGA 2JPBA 3ZMDA 2VODA 1BIAA 3VOEA 4AIJA 4HZFA 3K69A 4B09A 1SAXA 2HTSA 3ZP5A 3BZ6A 2D45A 4K2EA 2EV0A 2FE3A 2HYGD 2O03A 5D8LB 1JXSA 3JSOA 2BYVE 1D5VA 2QUFA 3HUGA 1XN7A 2EFPA 1OR7A 3S2WA 5ICCA 1ZHFA 1WI9A 5D6EA 2HKOA 5E17F 1W5TA 2DQLA 3FZVA 5HLIA 1WKMA 2CWEA 2O3FA 2IRFG 3LAJA 4OIOF 1SMTA 4A5NA 4UV8A 2ZNZA 3Q9VA 1UHMA 1DPRA 1MDMB 2PMUA 2LKPA 2LSOA 3SFZA 3I59B 1FYMA 5J8CA 2PMHA 4AWXB 1C0WA 3LA7A 4RGSA 1AOYA 4R79A 4P55A 3HRSA 4LD5A 2ISYA 1RUNA 2IA0A 4A0XA 1O3TA 4N9HA 2VOPA 4RGRA 2YX7A 2OQGA 1HKTA 4IRHA 4PDKA 2XAGA 4CXFA 4RB3C 5BPIA 4G6DA 3KP2A 2MA3A 1MZBA 2DLLA 1PDNC 1EH6A 4Y15A 1CF7B 2DU9A 3R61A 1T39A 3GFMA 3SHFA 3LAPA 5JHUA 2V6CA 1DPUA 1EH8A 4XLNF 4QWQA 3E6BA 2HZTA 3CUQB 2W25A 3VEPA 3CTAA 3D0SA 4LMYA 3E5QA 4GYIA 3BDDA 3C7JA 3CLOA 4EJUA 3GF2A 4ESJA 5LGTA 2DK5A 2GA1A 1IXRC 2CSOA 3WGHA 4KN7X 1K78B 1ZLJA 4BHCA 3RPUA 1UB9A 1R22A 2QBYB 1ONVA 5HDKA 2MD5A 2DAOA 4S04A 2L4MA 1RZ4A 3V7SA 4HX4A 2A6EF 3HRMA 1YW9A 5JI6A 3EDPA 1YW7A 4L9TA 3KLNA 4IVNA 4ZYEA 2PN6A 5DYMA 1XGSA 1WSUA 1SFUA 2DO7A 4G7HF 4CZZA 3FHZA 4KMUX 1BM9A 2FBIA 3PQJA 3EETA 3GYHX 4Q48A 3DF8A 3VODA 1W7PD 2QQBA 2EWNA 2R7FA 5BQTA 1DUXC 5D5UB 1BI0A 2XROA 2FNPA 1MDMA 2UXXA 2NRAC 4E70A 3IKTA 3H3ZA 2F5DA 3EYYA 2WV0A 5E1XA 5IT9Z 1L0OC 4MEXF 1KQ9A 3V8LA 2JSCA 1SD6A 5L3GA 2L4AA 3SZPA 3C1DA 1K6OA 4TV7A 2KIMA 5E8IA 1IN6A 2QENA
chains in the Genus database with same CATH superfamily
2R5YA 1ZRDA 2VKHA 2Z33A 2PX9A 3DFGA 5J1YA 3EQLF 3H3VK 3FXLA 5KVRA 2DODA 3BR1A 4IZZA 1YW8A 1CF7A 2MBFA 4HDUA 4RGXA 1REPC 4UVBA 2IS2A 2Q1ZB 4HRIA 3QP5A 3U21A 3LL7A 1S8NA 1JGGA 3HEFA 2BV6A 1T2KA 2R7XA 2AQEA 2H8RA 5J8FA 3BG6A 4IJAA 4OINF 2BY1A 1JUPA 5F64A 3RKQA 1TWAJ 4M3FA 3BCAA 1XMKA 2V1NA 1IN8A 3IUOA 3WGGA 1LE8A 2HTJA 1FX7A 3HOSA 3M8EA 1JT6A 2FMLA 2EZIA 2X85A 1NK3P 2E2IJ 3MAJA 2HEOA 4ENKA 4DYQA 2IS1A 4OIQF 2HQNA 1FP1D 2OTJI 2J5OA 2LY1A 1S7AA 2K9LA 4FX4A 4UXNA 4NUBA 5CVRA 3I4PA 3IRQA 4ENNA 3KEYA 2JT1A 2OBPA 3HRUA 4H4KC 2WC2A 4WX9A 1OMIA 4EM0B 3CF5F 3CUOA 2M2EA 2DPDA 3VYRB 2HI3A 3MZHA 4BBSJ 3FMSA 3K10A 4DYRA 1IV8A 1JHFA 3TO7A 2JVHA 4M3EA 4L5JA 1X1BA 1XS9A 5IT9K 1TZLA 4AM3A 1G3TA 2NNNA 3O8GA 4DJAA 1G8XA 1O3SA 4A2UA 3ZQHA 1JE8A 2M4KA 1ON1A 2Q8KA 4AIHA 1WFXA 2W82A 3AFHA 1N25A 1QPIA 2N8GA 5L3CA 4PJMA 3OS0A 4G94A 2RQPA 3JRDA 1KU3A 3K4MA 2E36A 4ASNA 3BPVA 1SVOA 4JK1X 5CQEA 1ZYRF 2O8KA 2E7XA 4M3GA 4A3GJ 5FKKA 1ETOA 1T33A 1MMSA 1QBJA 1HC8A 2MW8A 2LD5A 4D7MA 1IN4A 5CVVA 2P5LC 5EEGA 1OFCX 3ZOBA 3SEZA 1FY7A 2NVYJ 5CJ9A 2R7WA 1DU6A 2D1VA 1OJLA 1H9TA 2VN2A 3G1OA 3ZMUA 3L2CA 2VJ4A 4A12A 2UWMA 2QM3A 3RZDJ 5DTDA 2B9SA 1Z21A 1D1CA 4F93B 1SMYF 5E20A 2EA2A 5H6QA 5JR3A 1HW2A 3KP7A 2GM4A 4NNJA 2L5QA 2XB5A 3MWMA 1GV2A 2DK8A 5KAFC 2JSPA 2CFOA 2PFBA 2IGNA 4FISA 4NDLA 1TL8A 4F91B 3CJRB 4G12A 3OIOA 2QQAA 2AXTC 1FNNA 3F8FA 3ZMVA 2DFHA 1J09A 3CF2A 5F27A 4RS8A 4GGGA 2A5WA 3K1PA 2A69F 5J3LA 2Z1DA 2EH3A 4BNCA 4HW0A 2EZKA 1X2MA 2M45A 3MQ0A 4HPQA 3CJQB 1D0XA 2YX4A 3BTLA 1YJWI 2M87A 3LFUA 1N77A 3VFZA 2EPFA 2H6BA 3L09A 2DT6A 1Z1DA 1Z6TA 3WG7H 3FMQA 3IH3A 4KICA 4PJNA 2EK5A 4Y4RA 4EEFG 1ZGJA 4UB8C 2O6GE 1QHHD 3W3CA 1B1BA 3FXOA 1TQPA 3J7AY 3CCYA 2V7FA 1O3RA 3BPXA 2NAZA 2IP2A 4IHTA 4UUSB 2EV6A 4EATA 3A4CA 4WF2A 4XLPF 4F55A 2QKLB 3LA2A 4IHSA 1IO2A 1MKMA 3ZCOA 2JA7J 2FOWA 2O5RA 2CJJA 3ABUA 5IYCJ 2BBYA 2HOSA 1JUSA 1R5ID 2YSRA 4D5FA 4DNCA 3HOTA 2K27A 3ERMA 5GPCA 4ENMA 5DUKA 1MMGA 3E3VA 3FWEA 4P1WA 4QPOA 3L2RA 4A3BJ 1MNDA 2Y75A 3I0TA 3CESA 4HYEA 2JN6A 3HG9A 2ME6A 3DQVC 3MKZA 1X19A 5FB2A 1AWCA 1BA5A 3GFJA 4EV0A 4BQOA 2X1CA 4WXDA 5E3NA 3V4GA 4LJZF 2XPVA 3IHUA 2DCEA 4GXOA 4W1UA 4XRSG 3VB2A 4BE2A 2VXDA 4Y33A 1UMQA 2P6TA 2E7WA 2FSWA 4CZCA 2H09A 1OKRA 3M07A 3IKVA 4YG2F 3HZJA 1IGNA 2COBA 2BXZA 1BI3A 5FLXZ 1XCBA 1RKWA 1R36A 2JZYA 4L9JA 3S32A 2W1OA 4BQQA 3RYPA 1B9MA 2UXNA 2VKVA 4B48A 5TGTA 1E3PA 3U9GA 5DM7F 2IT0A 3IAM2 1K6YA 1FJLA 2GA2A 1QZYA 3JREA 1KU9A 2ELJA 1WZ2A 2CUZA 3VSLA 4KNYA 2QSGX 2NNYA 3LSRA 3ESWB 4RAYA 3BR0A 1PYVA 3KP5A 4HDVA 4O3MA 3WU1B 2DBBA 2DJNA 2LKSA 3H5AA 3I5UA 2RQQA 2TCTA 1W4MA 2X51A 4EVIA 5D6FA 4Z6YA 3RDIA 2DW4A 2GLOA 2CMPA 2CG4A 3ZQIA 3R6SA 2STTA 2IBDA 2ZO4A 4XKVA 3JRFA 2HWVA 4I01A 2MG4A 1Y56A 2K3FA 3BJAA 2X6OA 2ZXWH 1OCZH 2ZJQF 2CUEA 2V9VA 3ZRGA 1OLTA 1G3YA 1XGOA 4IXAA 1BIBA 5HDNA 2KISA 5J4VA 4QPQA 4BACA 2EBIA 4UHTA 1VQ7I 1S7OA 1OYIA 2PI0A 1BI1A 2V4JC 1KGSA 3QAHA 3M4OJ 2TDXA 4HQMA 2RKHA 4C2UA 3DU6A 1FWZA 3OYCA 1HDPA 2PJRB 4XRFA 1X4PA 4X0GA 4FX0A 3QWLA 5C3EJ 3RCOA 3RQ4A 1X2NA 3B6CA 4XN3A 1GT0C 4GRIA 2VOOA 5CYVA 1OCTC 4BBRJ 3OIQA 1P7JA 4IQ4A 1P9QC 3H1CA 4UUTA 4EM1A 2VE9A 1IRZA 1IAWA 3NRVA 2Q2EA 2CQQA 1H88C 3ABMH 2VT3A 4MGRA 1NK2P 1MBEA 1XDSA 2CQNA 1BBYA 2WV1A 3HSRA 5B1AH 2F48A 2V9KA 2L2OA 3IWZA 5FLXK 1OCPA 2X6XA 1QQIA 5M5XJ 2KFDA 2JTVA 3QP6A 4LGWA 1KU7A 1IRGA 3GZ6A 4G6TB 4D0PA 1BOBA 2E1MB 3TW7A 5LHHA 3G73A 4KFCA 2Y0MA 3BG3A 4KYWA 1B8IA 3WE3A 5B3SH 1VQ9I 1HSJA 1SFEA 5F1JA 4M6XA 4UUSA 2ZFUA 1VQ4I 1USTA 4RLFA 5F0HA 1D1AA 4BUPA 3CZ6A 2X6YA 2DOAA 3BC8A 3CCJI 4CYDA 1RPWA 5ICEA 3G4SI 2WAQN 4A3MJ 3F6VA 3DV8A 3ULQB 3F8MA 4AVZA 1FEXA 4NQWB 4XBFA 3ABKH 4E7HA 2Y0SN 3ABTA 5EDNA 2R7UA 4AIKA 1I50J 2KL4A 3RJPA 3LA3A 2EFQA 3FXKA 4LIUA 2L9RA 3TBIA 4I0AA 2WAFA 1TQMA 1B72B 4I2OA 1GVJA 3BOQA 3VYSB 4AU7A 3V8JA 3DCFA 1W5CC 3QPSA 4HF1A 1QZZA 3BCBA 3W2AA 3A1YA 1ETWA 5TRDA 3ROUA 5LRRA 2I10A 2XAJA 3HDDA 2E2JJ 1TT5B 4Y13A 2PEXA 1M1EB 1E3HA 1FPQA 4CICA 1GDTA 4GCVA 1FZPB 4CHUA 2XGEA 3J7ZI 2XRNA 3KCCA 2XKOA 1WJDA 2NXNB 1Y8RB 2AO9A 4A3LJ 3G2BA 1XGNA 3FKJA 5C44J 2DFEA 3DBLB 3NARA 2Q0OA 4XORA 3K4JA 3TQNA 4HLYA 3A03A 4Q5SF 2DMQA 2EZHA 1RIOH 4UY8I 5E1ZB 4PJ0C 2ID3A 4IOCF 3VWBA 3TP0A 3HSEA 4O6JA 1FSEA 1NTCA 1Z05A 1BW6A 4XMYA 1KQ8A 3DPTA 3PM1A 1HW5A 3B6AA 2KIUA 1XMXA 3CCRI 2VASA 1LFPA 3CP2A 3EUHC 5L3FA 2XUBA 4EQQA 2R7OA 2ELKA 2FNAA 2QCOA 4ZH4F 2ZMEA 2XAQA 4BU2A 1ORKA 4EM2A 2BXYA 3DP7A 1WJAA 1F5TA 4NHJA 4IRIA 3TOBA 4BEHB 2MSYA 1RKTA 3WU0A 1YITI 3BZCA 5H20A 1W0UA 3OYDA 3FISA 2O8XA 4WK8F 3U1KA 3SDGA 5CQGA 3AG1H 4M3BA 1YFHA 3HOWJ 5D4SA 1MJBA 1VQKI 1XSVA 5AIQA 4LLGF 2VBZA 1I3QJ 3C18A 4FETA 4HSTA 3TMOA 1U8RA 2PJRA 2LDUA 2A6TA 3WTVC 2HR3A 2IGOA 5ICFA 1RR7A 5FROA 5ERIA 5K7ZA 2OQRA 1MIJA 2LOOA 3IH4A 2LVSA 1QO0D 4XR6A 5H2FC 4L9NA 2KRHA 2DMTA 2Z3YA 4FT8A 3RQIA 4KDPA 2VKEA 2QWWA 1Y0NA 2YUSA 2E1CA 3ASNH 3GO5A 3HXLA 3U2RA 3FXQA 4BY7J 4LIVA 3DEUA 3BR2A 2KRCA 2DDBA 4AYBA 1IV6A 4BQAA 3FBNB 3N4MA 9ANTA 2RV8A 2Y2ZA 3ZN0A 4HNTA 1RETA 2MC4A 3F8CA 5ILSA 5FKOA 3E5UA 2KT0A 3BP8A 4B3AA 2RN7A 1MGTA 5LBQA 6PAXA 1JHHA 2M5WA 1ETVA 2IAIA 5FRMA 1QA6A 2F5EA 1X1AA 4M6YA 3Q0WA 3K4BA 3RKWA 2HZDA 3JAMZ 4BJ5C 1JKPC 2DTZA 1U9NA 2EIKH 4J00A 4XK4A 1OPCA 1YIJI 3KZZA 2V79A 1Q1HA 4U0VA 1HKSA 3FM3A 1J9IA 1UELB 3JTHA 1PP8F 2E1OA 1T38A 4JX4A 4M71A 4CCOA 2EJRA 4BKXA 3LFKA 4P5OA 2OF7A 2IA1A 1LEBA 5HLHA 1D8KA 5A2QZ 4P9FA 3GFLA 4IPAA 1B72A 1XG1A 2KPMA 1QZEA 1SFOJ 1BJAA 4KIGA 4MLOA 2HS5A 3SXYA 1XSDA 5EZGA 1MMNA 5EGOB 2F5FA 4A69C 1U3EM 2BGCA 1ZLKA 5IPAA 2Y9YA 1ZG3A 4PGHA 1EJ9A 5CLSA 2IEKA 1LFUP 4JBAA 4HNVA 3HRTA 4DIQA 5F08A 4I76A 5FRNA 3BG5A 1MJAA 1ULYA 1I6HJ 2YS9A 3I56I 2ADUA 3R0AA 2UV1A 5ILVA 1WRJA 5LGNA 3BJOA 4BDZA 3R0JA 1SD4A 2G7HA 3ZMZA 2VC0A 4UNOA 4WWCA 2JRMA 3S93A 3W6KB 2VXZA 3OOPA 4AUXA 5HNHA 4EGYA 1VQNI 1EKEA 3C2GA 1QPMA 3TDUC 4Y17A 1SANA 1NHAA 2Y69H 2CUJA 3F8BA 1AU7A 3SEQA 1VTNC 2KLOA 2FQ3A 3FX3A 3LWFA 1F4KA 3BJ6A 2HQ5A 4Q47A 3A02A 5HS8A 3CCVI 1VQOI 3QPTA 1WJBA 3HB9A 2LREA 4FTHA 2R7TA 2P5KA 3I59A 2HGCA 4L5IA 1T95A 2DOEA 2R7RA 4L0YB 4G7OF 1IUYA 1ON2A 1N75A 3F8NA 3Q5FA 2BHZA 1JJ8C 2VC1A 3AAFA 3RKXA 3DTEA 3FK6A 2D5VA 3F72A 4RB1A 3OYGA 2W57A 4RLQA 3IC7A 3L2UA 3P9CA 5EZHA 1XDUA 2KKOA 4BEHA 1H0MA 3LSJA 5IT3A 2L7ZA 4PZJA 3JAMK 3K9TA 4L0ZB 3T8RA 2BY3A 2XASA 2VI6A 1BOAA 2A3SA 5HOOA 1VZ0A 2D1HA 5F0CA 3OYJA 2W24A 3TGNA 3RYRA 1FP2A 2QZ8A 3BLYA 2GZWA 4OMZA 4V19K 2P4WA 2MD0A 2DI3A 2OJED 3E97A 3IRRA 3KP3A 1WH7A 1X3WB 1PP7U 5EG0B 2GIVA 5A2QK 1KQ0A 2Z99A 2L54A 1JGSA 1IRFA 2QQ8A 3E6CC 4U0YA 1B9NA 3H9JA 2M9HA 3KX2A 3CCLI 4RAGA 4OIPF 1R6RA 4XKWA 5BS6A 4CCMA 2YU9J 3WGIA 1Z9CA 3GZ5A 1BI2A 4HEA2 3OIPA 3G71I 1IZ1A 2ZKZA 1LFBA 3HC7A 3FM5A 3E6DA 1TP4A 3CUQA 1W36C 2W48A 5LFAA 1EF4A 2K9NA 1FIPA 2WAEA 4B8XA 1HXDA 2AXLA 3M9AA 3HKZN 3H92A 2CW7A 3HHGA 1MBGA 1MSFC 2VJ5A 1U9OA 2EA4A 2VBXA 4NC6A 5K7FA 3I55I 4C3JJ 3X2QH 4XRMA 4UUVA 2LLKA 5AONA 4G6QA 3ZMSA 1V5FA 2QSFX 1K78A 3MVPA 3RI4A 1NG6A 5GAHJ 4D5CA 2LH9A 2K9MA 1YS7A 1R7JA 1BL0A 5E18F 2CV1A 2QBYA 4NC8A 5EEHA 4HF0A 3WTUC 1MJ9A 2JRTA 5FLVA 1YQAA 2F4MB 2QLZA 1V54H 5EGOA 1QVUA 3DPUA 2W00A 3A01B 4WXHA 2E1NA 1GUUA 3ZR8X 3SZTA 2R92J 2IXSA 3KETA 5F04A 1XMAA 4HOBA 5BOXA 1FT9A 3AG3H 3L00A 5D4RA 2YR2A 3GUDA 3PSFA 3SZGA 4KUMA 1A6QA 1VQLI 2FX0A 3E6MA 5TJJA 5FO5A 2CFXA 4BHPA 2ISZA 2L9SA 3PUBA 2VQGA 1EH7A 4OU0A 4DGWB 1WJEA 2P6SA 1OYYA 1IXSB 1U6GA 4P9UA 2R7QA 2PBIA 1R71A 4M73A 3UR3C 2P7CB 4NBQA 2DTRA 4ZYDA 3MFKA 2E5ZA 2FEZA 2LY2A 1A31A 2LK2A 4XLCA 4B3XA 2HKXA 3KP6A 2ELHA 3VDXA 5FD5A 1RESA 4BS9A 2M8GX 2OU2A 4KT5C 1TC3C 2MH2A 3GXOA 4U7BA 2M34A 1FBUA 2LTPA 1TNTA 2CUFA 1I39A 1LDDA 1ACIA 2EV5A 5FKLA 2KIQA 3HTSB 4IHVA 2OZUA 3K4NA 2R93J 4BXUA 2R4GA 5J1RA 3CCMI 1OYWA 4YELA 3H0DA 1K7AA 3CDLA 1U5TC 3ZQFA 1X1CA 3FXJA 4FQGA 4CA0A 3O2PE 2DFIA 2R3SA 4PFPA 1EV7A 4CDGA 1UZCA 2IVMA 1GHCA 3LQRA 4DYCA 3HOXJ 2V1XA 2RDPA 2ZC2A 2DN0A 1V5EA 2L0KA 2ZXIA 4X1EA 5JLXA 4U0WA 5E8GA 1Z3YA 4J01A 1MBFA 3OYHA 2HDWA 1W7PB 2X0LA 4UB6C 1FYKA 3GX4X 1W0TA 1AKHB 3IWFA 1ETYA 4G9YA 2D2WA 1EA3A 5CVIA 3HSFA 3HBLA 1K61A 2WB1A 2IGMA 1X58A 2E60A 2M1BA 4O5VA 4HAMA 4MNUA 1S9HA 3OS2A 1T6SA 4KIBA 1ZTRA 4XLHA 4J19A 1U8BA 1DDNA 4HQEA 3KP4A 4XSXF 1G6NA 1Y8QB 3I71A 3TP3A 1ZRCA 2GOMA 3I54A 1DGWY 2ZJ2A 3VPRA 1J2XA 3KLOA 3TO9A 2L7KA 1WHUA 5AIPA 1I27A 3J81Z 5J40A 1T0FA 5LRSA 3F23A 2KHMA 3OR1C 5BMZA 2KP6A 3DTIA 3WG9A 1TQIA 3GZNB 4XSZF 5M3MJ 4ZDPA 2QSHX 2F2EA 2WADA 2VPLA 3FIWA 2XRLA 4U7DA 4LG0B 3CC4I 2DA4A 1HCRA 4BAYA 2CW0F 1W5SA 3NQOA 1A04A 4ZTJA 4U88A 4C3IJ 2WTEA 1ITYA 1X3ZB 2XSJC 2K02A 2Z5UA 2KQRA 2GXGA 3NAUA 2ZJRF 5K1YA 1TWHJ 3SDBA 3TOAA 2XV4S 4ABZA 3RIRA 3HUGB 1R1VA 3F3XA 1RC9A 2ECCA 4N0BA 2WBMA 1A36A 1XD7A 3WTSC 5KCMA 3QQAA 2X1EA 4E7JA 3DPLC 4HA8A 4MO7A 2VJJA 3I58A 2OA4A 3QPHA 2ZJPF 1PUFB 4RB2C 3S1NJ 2LY9A 4EMSA 1FBQA 3BTCA 2RC4A 5LD2C 1A5JA 2F6CA 2HU9A 3OYKA 2AS5F 1U2WA 2CRGA 2L3DA 4A3JJ 2O9LA 2VUMJ 1IN7A 1P7IA 3BTJA 1MD0A 2FU4A 3E1SA 1R49A 1YRNB 3CO7C 1U0JA 4FHTA 4JYKA 3EPZA 4QTRA 3NEUA 1YYVA 2KJCA 3PNTA 5KNLA 3H0GJ 1VQPI 4MEYF 3PO3J 4DQ2A 2VQCA 4M9XA 2NYXA 2X48A 4A3FJ 2FBKA 1DQUA 5IOYA 1ZGWA 2ESNA 3BR6A 1ODDA 5E1WA 4QSHA 3I64A 2A5YB 3R4KA 3KEOA 1VQMI 3S2HJ 2P0WA 1ETKA 4KIFA 1YS6A 1FTZA 3J81K 3K6GA 4F52A 2PLYA 1L3LA 3CCSI 2JJ7A 4ESFA 1V3FA 4X6AJ 4Y7NJ 4I7HA 4ZYGA 3L2QA 5M5YJ 2XAUA 1R4NB 4CYCB 3D5SC 3ZGKA 5K5RA 1ZK8A 2K40A 2W4SA 3A0BC 3QYBA 4RMNA 1F9NA 3GTMJ 2BEOA 2VT2A 3NWSA 4GYGA 3HPHA 5FD6A 2HDCA 4HF2A 1UCRA 1SFKA 1D1BA 2FOKA 3DWLE 1HQCA 1YO5C 5DM6F 1JTXA 1P4XA 1VQ5I 1XSXA 1J75A 1WJFA 3KEQA 5M3FJ 4H0EA 3D5RC 3OL3A 4ITVA 2QVOA 4A6EA 2X6WA 4BXXJ 3JRGA 2QA4I 1S72I 1AKHA 4HSRA 4MTEA 2OCCH 1H89C 2LR8A 3FHNA 2CH0A 2F5CA 4Q4ZF 1ZQ3P 2HNHA 2H94A 2GXBA 1I1GA 3KPHA 3G6EI 2HYJA 1WGXA 5HLGA 1JKQC 3S14J 3DEEA 3OYAA 1Y0UA 1ZREA 1WPKA 2BY0A 2KZGA 1O4XA 1ZR4A 4F3QA 3WTYC 3EUHA 3BR3A 3E5XA 1MH3A 3LQQA 1ZH5A 4W97A 3K70C 2M7AA 1YHQI 4A5MA 4M74A 1MBHA 3HHHA 1UHSA 4RA2A 1RR8C 3ECHA 4UV9A 1ZG1A 4AVPA 1RUOA 3TW6A 2OZ6A 2X4HA 2W7NA 3U1DA 1LJ9A 4PGGA 1DP7P 4XM3A 1FIAA 4LG0A 4QLCU 5K5OA 3MCZA 5BPDA 2QGUA 4CGZA 3H36A 3HOUJ 4BJTA 2KDZA 3QYEA 4MTDA 2O7OA 5DUIA 4ZDOA 2K7LA 3OSGA 1O3QA 1YG2A 1XGMA 5IY5H 2VONA 2R7VA 3CLQA 5IP7J 3K1MA 2XIGA 4MIMA 5DV5A 2V1UA 3LNQA 3TEDA 4ZZLA 1K79A 4KMFA 1G3WA 2DA7A 3LSGA 2WA0A 1TWFJ 4EJWA 2KMUA 1IRXA 2W84A 4JX6A 2WWYA 1SAUA 3LSKA 4BHBA 1TWGJ 3H5NA 2E35A 4BGDA 2OUMA 2EIJH 2J5PA 3GMEA 2ECBA 3FMRA 3COAC 1KU2A 3MN2A 1Y39A 1TTYA 2FXAA 1P4WA 3OYEA 1T8IA 1PUFA 3KE2A 1XX5A 5J1UA 1IG7A 4IKFA 1SD7A 2XGDA 4HV6A 3D1NI 3Q0UA 3HM5A 1P92A 4BE0A 3ZPLA 2BVLA 2OPTA 3KIOA 1SVLA 1X1PA 3P7NA 4B4CA 2ZCWA 1OCOH 3L2WA 2E2HJ 3DEWA 3PUFA 4BH9A 2ID6A 1WJ5A 3QU3A 2RAEA 2DFFA 3MZYA 1Z91A 1V4RA 1YJ9I 2XHKA 4XLFA 1UFMA 2EFWA 2GOXB 5L3BA 3WE2A 3JRIA 1R5HA 5J6XA 3HIFA 3I53A 3WTZA 1WCMJ 1DP3A 4ENJA 1PUEE 1KYWA 4D1QA 1T56A 2QF7A 1IF1A 1ZRFA 3BT9A 2MYSA 3LSMA 2NOJB 2VQLA 1MH4A 4IOAF 2M30A 3MD2A 3GWZA 2HFHA 5D5WB 5K5QA 4N9IA 1FC3A 1ZR2A 2OTLI 4M9ZA 1S29A 1IUFA 3TDZC 3ZQLA 3OV8A 4WCGA 4EGZA 2KZVA 1USSA 2GAUA 3D5LA 1X4OA 2BW3B 3LSTA 3RKYA 1Z7UA 1QRYA 4CUGA 1OR7C 1FMWA 2OAZA 2FA5A 3H9QA 1HF0A 5H6RA 4L9VA 3ERED 4CCLA 4Z2YA 3AG2H 3MZ8A 4PCQA 5IP9J 3CDHA 3CMYA 1J0RA 3C2HA 4LLNA 5JLWA 4LB6B 1W1WE 4M9SA 3AG4H 5HS7A 3BY6A 1I3AA 1JUMA 4PSWA 5BNGA 1HKQA 2OV7A 2UZKA 2M0MA 4ESBA 4OWRB 3QYFA 2P7VB 2MH9A 1GLNA 3E7LA 3FKIJ 1YX3A 1AHDP 5D8KB 3GTQJ 5ICGA 4II2A 4BJ6C 2LNBA 3TO6A 2DT5A 3WTXC 5D5VB 1T08B 2HYFA 2H27A 1UAAA 5DCMB 3Q9SA 3OOUA 3EUAA 3BG7A 1LE8B 2C6YA 2P8TA 4NQWA 2FD5A 1GXQA 3JW4A 3R60A 2Z2SB 2E34A 1O57A 1X3UA 3KZIC 4CH7A 2WY8Q 4XONA 4RAZA 2KRFA 2G0EA 2BOLA 1WJCA 1U5TB 2BE5F 2LF7A 3GTOJ 2VB6A 3RTRA 1R9TJ 4Y3OA 4DBQA 1LVAA 1YLFA 3OL4A 2JVGA 3DLLF 4I09A 1A6IA 3M1EA 2CYYA 4UVCA 2BHYA 2MGQA 3TKYA 1DU0A 4E7SA 2XDVA 4R8HA 5CVUA 4M3DA 4R1HA 1TWCJ 4LK0F 1ZKGA 3L7WA 3CMAI 4YFNF 2DXIA 2VE8A 2JUCA 3CQZJ 3SFIA 4AYBN 1BC7C 2ZXJA 1GXPA 1JT0A 3P9KA 4YFXF 3KYLA 1CQTA 2ME0A 2LF8A 1MMAA 2L01A 3HOVJ 3T0YA 3ECOA 2AHQA 3TL4X 5JVGF 4XLAA 5DDGA 2VPRA 5DEQA 3HOZJ 4LFUA 1SD5A 2HPIA 1Y1WJ 3GW2A 1TLHB 3QRFF 2XF6A 5M5WJ 3DBRB 2DT7B 2I8DA 4DZJA 3DKWA 2DYRH 1STZA 4JP0A 4B44A 5CVJA 3FXRA 1E3OC 2XVCA 3I4MJ 4PUSA 1I6XA 4OIRF 3WHBA 2Y30A 4BQNA 5F0FA 4A6DA 1XB4A 4A3IJ 1FLIA 2FRHA 3PQKA 3DXJF 2E5NA 1T98A 4ZC3A 4C30A 3T1BA 4CO8A 1R5GA 2OCEA 3M1CA 2IA2A 3K0LA 2H1KA 3FXMA 4RGUA 5FFXA 3UKGA 3ML6A 2H6CA 1FSHA 2XKPA 3VYTB 4WXCA 1I1SA 1FOKA 4HX8A 1ZN2A 2W85A 2K4JA 3ISPA 3KYDB 1WVRA 1XCVA 5K7HA 1YTYA 3P5JA 3OR2C 2B7EA 4I02A 1G4DA 2VBWA 4XOTA 5DCFA 2XF5A 4DW6A 1F36A 3K4LA 3S15J 4IO9F 3K7AJ 1S7EA 4I98B 5DS9A 4ANJA 1R1TA 2YU3A 3IAS2 1JI8A 2M0CA 3F21A 4MQVA 2ZBKA 3KZYA 1S6LA 2BW3A 3OYLA 2TRTA 5J47A 1B6AA 1CGPA 1TNSA 2GQQA 3MEXA 4BE1A 4OAZA 4RB0A 4HV5A 4A0ZA 3J7AO 4F92B 5B5EC 4FE7A 3MKYB 4XQFA 1IDYA 3W2WA 3EUKL 4XNFA 3PNVA 2IW5A 2M3AA 2ZFWA 5LEKA 4UVAA 1V55H 5LEJA 4JQFA 5D5XB 3BQYA 4XN0A 2V1DA 3W6JB 2LG4A 1BJZA 3KYCB 1O7LA 4IHYA 3IL2A 3CCUI 3S3MA 4IX7A 2LYCA 2MFZA 3ELKA 1BR1A 3GCMA 5DCMA 1FMVA 2R7SA 3B73A 3ZXSA 2OD5A 4JX5A 4ZYHA 1SC7A 2K4BA 3OSFA 3O8HA 2RVCA 3S17J 1ERDA 2ICWG 2V9PA 1WQ2A 1UHWA 3AL0C 4RM3A 4E4HA 2Z9OA 1G3SA 2DYSH 1QGPA 2LBFB 4ETSA 1Z0XA 1U5TA 1WWXA 5GTHC 2ZNYA 4HG2A 2PG4A 1YJNI 2M8EA 1TBXA 5C4XJ 1F1ZA 2CO5A 5DD4A 2A61A 1FOWA 2L9VA 2QYOA 3BTIA 1HLVA 3T8TA 2FMYA 3GTLJ 3JRBA 4E7LA 3G1LA 1G2HA 2G9WA 2EB7A 1ZG5A 5ED4A 1B4AA 2HDDA 3O3KA 3F9KA 2BZTA 3G3ZA 3S3NA 3DU5A 3C3WA 1QU3A 4EJOA 1TW3A 2NVTJ 1ETXA 1Z77A 4B43A 4F7ZA 4ZTFA 2WY7Q 2F4IA 1KA8A 2XAHA 1J5YA 2NS7A 3I3LA 5KAIC 1O7FA 3J7YJ 5JVTA 2GXAA 1GVDA 2EZLA 3L9FA 4NC7A 3P9IA 3WODF 1ENHA 4DOZA 1YE9A 3CP8A 1FYLA 1LQ1A 3MMYB 3QOPA 3CUQC 2Y48A 1KZHA 4BXFA 4JOMA 2VJIA 4LLLA 2EFNA 3VSKA 3PFIA 5LHIA 2XAFA 1BN5A 3WTTC 2O0YA 5E3OA 2IPQX 2XGXA 2R0QC 2IJLA 3SYTA 5B1BH 4I99C 1JKOC 3S8PA 3FF5A 4YFKF 1D3YA 2DOFA 1R23A 2GIZA 4MFDA 2BVMA 1R1UA 5CPRB 2VBYA 4GO1A 3BWGA 3HYIA 2R5ZB 2FUG2 4IF4A 5E3LA 1FBSA 2LP0A 4RAFA 1ZGAA 3ZQ7A 1K4TA 3BROA 2H1LA 1HW1A 2QQ9A 3PIPF 2A07F 4A3DJ 3GVAA 4XLEA 1R4MB 1S3JA 2G7UA 5LHGA 3VYUB 5HVQC 5LLQA 4LK1F 5EG0A 1MNEA 2RNJA 3BG9A 3E0JB 3K1NA 2HQRA 4E7ZA 5EJCA 4KT6A 3FXUA 4G7ZF 1D8JA 4V2FA 2RNGA 5ILUA 3OYNA 4C2TA 5HS9A 2Q2EB 4BYYA 5FGMA 4YRVA 2F5VA 5GAGJ 1LEAA 4MQ9F 5L3DA 3RPUD 2DMUA 5CKTA 3OWTA 2GWRA 3JRAA 2DA3A 1AA7A 1LNWA 1PJRA 1RNLA 1SFXA 3HPGA 5FLMJ 3QU6A 3CDIA 4N4OB 4EJTA 3JTGA 3GFIA 5GTIC 2CGPA 4D9JA 2JA8J 1B8IB 2ZB9A 5JFRA 4A3KJ 1APLC 1P6RA 1ZARA 4A0YA 4ZZDA 1LKXA 2PQ8A 5HODA 2YPRA 1TW2A 2DPUA 2R7ZJ 1R58A 1E17A 4ZJZA 2ETHA 3CC7I 2L02A 2VKDA 3PNYA 1FTTA 4OMYA 2COMA 3M7GA 2P5VA 1ZAOA 3HOYJ 2XGCA 5KK1A 2CQKA 4CCNA 3OY9A 1JKRC 4I0BA 4DBRA 3ABLH 3K4CA 3RPQA 1VQ8I 3REOA 4E7KA 4G8XA 1BR4A 3JSPA 4AD9A 5FKNA 2DA1A 4KITB 1W36D 4QIWN 1IN5A 3DTKA 3ONQA 1Y6IA 2PMZA 2L7MP 1MMDA 3CJNA 1XPXA 2PJPA 3ZN1A 5FKMA 1IXCA 3ZMTA 1IW7F 4KA4A 2LBFA 4EJVA 3N05A 2DQRA 2EFOA 1LDKB 2B63J 4YEJA 4MHGA 1P2FA 3A01A 1H9GA 2DDAA 2WB1N 1VFCA 5E79C 2MC3A 4M72A 3SQNA 4HNUA 4Y52J 4DZPA 2DJIA 1F43A 2GBYA 3PJRA 1LDJA 1J59A 1YIOA 2IGKA 2V6EA 2DA5A 1Q1VA 1WH5A 3J80Z 4S05A 4FCYA 4CCKA 2AQFA 2JPCA 3WHCA 2LFBA 2X9DA 5J4YA 2Y31A 2HXIA 4ZDLA 3EYIA 2JMWA 2K5CA 5EYRA 4AC0A 3F6OA 1P4AA 1E0EA 1B59A 2R7DA 4E7IA 5L3EA 5F6FA 3N97A 4IHWA 2A68F 4YIFA 1UJ8A 2FBHA 1U78A 1D0YA 2ACJA 4YIIA 2VL8A 4YIRX 1H8AC 1Y1VJ 3WTWC 1HSTA 2KIFA 2E71A 2CU7A 3JCUC 1E2XA 1Z67A 1DGRM 4IRGA 1YOVB 5DD8A 3OYMA 1YI2I 4LB5A 1N78A 2NS0A 2L9NA 2CQXA 1LUJB 4C2MJ 4L18B 2HPMA 2DMNA 3O6BB 3GLXA 4ON0A 3UNGC 3ZQQA 2ZMEB 3HL2A 3K2ZA 1IDZA 1T0FC 1HBXG 3A2KA 1NG7A 4II3A 2M4GA 4HLXA 4E6KG 4I6ZA 2FQ4A 5IYDJ 1UG2A 3HTUA 1ETQA 2M7BA 1QNTA 1R00A 3HJEA 3V8KA 2WAQA 1TT0A 4ZYAA 4XL9A 3GEZA 3CO6C 4B47A 4NB5A 4P96A 1RI7A 5GADJ 3PL8A 2KJBA 2Y0SA 2PMZN 5LGUA 4PK4A 3F22A 2HOTA 1WI3A 4PFOA 5B66C 2K86A 1RRJA 2EINH 2FF4A 3JRHA 2B0LA 4XIDA 2R5ZA 1Z6RA 5GAEJ 1MSEC 1KYZA 5HDGA 5F1RA 1OISA 4AIDA 4RM2A 2JA5J 1PVEA 2FJ1A 3C2BA 3H3UA 1W7PA 3B02A 5FFZA 5GP9A 5E3MA 1LB2A 4OOIA 1I5ZA 1Z7LA 4LG3A 5IP6A 2A6HF 2RGVA 4CSWA 3CMMA 1J7KA 2MLKA 3I4NJ 3M8FA 3H5RA 3V7CA 2VLAA 2L7FP 3S3OA 3V7RA 3DBHB 2STWA 2K3PA 4BY1J 1SVMA 1UG0A 2CV2A 1IC8A 3QPLA 2HOAA 4KJZA 2MABA 3OYBA 2XPWA 1BC8C 1JTYA 2ESHA 4HX7A 4KN4X 4GDFA 2HOEA 3KFWX 3T5XA 2O61A 3J80K 4IEJA 4HBLA 2MLGA 2JPBA 2V26A 3ZMDA 2HVRA 4BL0B 2VODA 3S2DJ 3G1MA 1V5GA 2A05A 1BIAA 2LRDA 2ZSIB 3VOEA 2NVUB 3MKLA 3ZQGA 4AIJA 2IS4A 4B1RA 4HZFA 3K69A 1K83J 3L1PA 1QHGA 3CCQI 4B09A 3OMYA 1SAXA 4FASD 2HTSA 3ZP5A 3BZ6A 2K9SA 2K85A 3CD6I 3GBGA 2D45A 5KHDA 4C9YA 4K2EA 2EV0A 4D7NA 2FE3A 2HYGD 2O03A 3DKXA 4IL6C 4PSXA 5D8LB 2JA6J 2JK3A 1JXSA 3JSOA 2BYVE 4C3HJ 1D5VA 2QUFA 3W2VA 3HUGA 3Q0VA 1XN7A 3M3YJ 2EFPA 4GFBA 3V42A 1OR7A 3S2WA 5ICCA 1ZHFA 1OCCH 1WI9A 1K4SA 5D6EA 2HKOA 1D5YA 3IH2A 5E17F 1W5TA 2DQLA 2XC7A 2JQ7A 5TISC 3PFYA 4IQJA 3BZKA 4XICA 2HQAA 3FZVA 5HLIA 1WKMA 4L5EA 2CWEA 3QODA 2NVQJ 2O3FA 5IYBJ 2IRFG 2H8WA 2XSDC 3LAJA 2UUZA 4OIOF 1SMTA 4S0HB 4A5NA 4UV8A 1D0ZA 2ZNZA 2LC2A 3QOEA 1G59A 1YRNA 2XB0X 3Q9VA 1UHMA 2QEXI 1ZELA 1DPRA 3CCEI 5EF6A 1MDMB 2CQ7A 2PMUA 2LKPA 5HLTA 1XTAA 2LSOA 5GPAA 3SFZA 3GTPJ 3I59B 3BR5A 1FYMA 2E19A 5J8CA 1OCRH 2PMHA 4AWXB 1C0WA 2CS3A 2JUGA 3H9GA 3LA7A 4RGSA 1AOYA 3S1RJ 3S1QJ 1JJ6C 2RREA 4BDYA 4R79A 1A35A 3AL0B 2I5UA 3PO2J 4P55A 2EQRA 3HRSA 3RZOJ 4LD5A 2ISYA 3LSHA 1HA8A 1RUNA 2CW8A 2IA0A 4A0XA 4MFEA 2Y9ZA 1SEUA 1O3TA 4FE4A 4N9HA 2VOPA 4RGRA 4CYCA 2YX7A 3BQZA 1KONA 2Z16A 2DA2A 2EILH 2OQGA 1HKTA 4IRHA 3LSIA 2XAGA 4PDKA 2R5YB 4PJLA 2LKXA 1MNMC 2QKMB 4CXFA 4N4NB 4RB3C 5BPIA 4G6DA 4A3EJ 3KP2A 2MA3A 1MZBA 1YX5A 2DLLA 1VQ6I 1PDNC 1EH6A 2EIMH 4LOCA 1MW7A 4Y15A 1LPQA 3S16J 1HOMA 1CF7B 2DU9A 4RDUA 1X1DA 3R61A 1BW5A 1POGA 1T39A 3GFMA 4U87A 3SHFA 3LAPA 4RBOA 2XF7A 5JHUA 2V6CA 1DPUA 3H35A 1EH8A 3A0HC 4XLNF 3PIOF 1QVTA 4QWQA 2KDOA 1Z3XA 1LVKA 3E6BA 2HZTA 4LITA 3ASOH 3CUQB 1IJWC 3GTGJ 5EEAA 2NOGA 2W25A 3VEPA 3CTAA 3D0SA 4LMYA 3E5QA 4GYIA 3BDDA 3C7JA 2ZMEC 3CLOA 1GV5A 4PJJA 1FOXA 4EJUA 3GF2A 4ESJA 3M8JA 4IHXA 5LGTA 1MBJA 2DK5A 2GA1A 1IXRC 2CSOA 3WGHA 4KN7X 1K78B 1ZLJA 3HGGA 2OC6A 4BHCA 3RPUA 3FDYA 2F4OB 3GTJJ 3LSPA 1UB9A 1VI0A 1R22A 1HDDC 2QBYB 1ONVA 3CMEI 5HDKA 2HVSA 2MD5A 3PSIA 2DAOA 4V2GA 3LMMA 4S04A 2L4MA 2ZXHA 3SJMA 3IP4B 3DKYA 1RZ4A 3K70D 5JHFA 3OS1A 3V7SA 3JRCA 4HX4A 3Q3SA 2A6EF 3HRMA 1YW9A 5JI6A 3EDPA 2NVXJ 3I9V2 2K9QA 3GTKJ 1YW7A 4L9TA 2BY2A 3KLNA 2LMDA 4IVNA 4ZYEA 3RSNA 3OYIA 3K2AA 2DA6A 2PN6A 1NH3A 5DYMA 1XGSA 1WSUA 1SFUA 2DO7A 2JWTA 3ZQCA 3W6VA 4G7HF 3FK7A 3DLAA 2ZSHB 4CZZA 3FHZA 4XRSA 2XPUA 4KMUX 1BM9A 3S1MJ 1XC5A 3L2VA 2FBIA 3PQJA 3EETA 2P81A 3GYHX 4Q48A 3DF8A 3FBIB 2VQHA 4A93J 2CV0A 3VODA 1MBKA 2IS6A 1W7PD 2X1DA 2QQBA 2E1MC 1S5LC 2EWNA 2R7FA 3GLLA 5BQTA 3OYFA 1DUXC 3F0CA 5D5UB 4XOPA 3NWTA 1BI0A 1VF9A 2XROA 3JR9A 3AKZA 3IV5A 5HNFA 3WU2C 2FNPA 3CC2I 1MDMA 2UXXA 2NRAC 4XKBA 4A3CJ 1BR2A 2NS8A 4E70A 3IKTA 3H3ZA 3LOCA 1OQYA 2F5DA 3EYYA 3CJTB 4OAYA 5FJ8J 1FOYA 2WV0A 3HKZA 5E1XA 3HGYA 5IT9Z 2JA2A 1L0OC 2HVQA 3MKWB 4MEXF 3K4KA 1KQ9A 3V8LA 2JSCA 1SD6A 5L3GA 4CCJA 5IOZA 4XKCA 2L4AA 2VIXA 3SZPA 2DMPA 2HXOA 5C4JJ 4KISA 3C1DA 1K6OA 1VNDA 4TV7A 2KIMA 4M6VA 5E8IA 1IN6A 2QENA
chains in the Genus database with same CATH topology
1ZRDA 2Z33A 3DFGA 3EQLF 5KVRA 1YW8A 1CF7A 2MBFA 4HDUA 4RGXA 1REPC 4UVBA 3QP5A 1S8NA 2BV6A 1T2KA 5J8FA 4IJAA 4OINF 5F64A 1XMKA 3WGGA 1IN8A 2HTJA 1FX7A 3HOSA 3M8EA 2FMLA 3MAJA 2HEOA 4ENKA 4OIQF 2HQNA 1FP1D 2J5OA 1S7AA 4FX4A 4UXNA 5CVRA 3I4PA 3IRQA 4ENNA 2JT1A 2OBPA 3HRUA 2WC2A 4WX9A 1OMIA 4EM0B 3CUOA 2DPDA 3MZHA 3FMSA 1JHFA 3TO7A 4L5JA 5IT9K 1G3TA 2NNNA 1O3SA 4A2UA 1JE8A 1ON1A 2Q8KA 4AIHA 5L3CA 4G94A 2RQPA 1KU3A 4ASNA 3BPVA 4JK1X 1ZYRF 2E7XA 1QBJA 1IN4A 5CVVA 2P5LC 5EEGA 1FY7A 5CJ9A 2D1VA 1H9TA 2VN2A 3ZMUA 3L2CA 4A12A 2UWMA 2QM3A 1SMYF 5E20A 2EA2A 5H6QA 5JR3A 1HW2A 3KP7A 3MWMA 2DK8A 2PFBA 2QQAA 1FNNA 3F8FA 3ZMVA 4RS8A 4GGGA 3K1PA 2A69F 4BNCA 4HW0A 2M45A 3MQ0A 2YX4A 2M87A 3VFZA 2H6BA 3L09A 1Z1DA 1Z6TA 3FMQA 4KICA 2EK5A 1ZGJA 2O6GE 1B1BA 1TQPA 1O3RA 3BPXA 2NAZA 2IP2A 4IHTA 2EV6A 4WF2A 4XLPF 3LA2A 4IHSA 1MKMA 3ABUA 2BBYA 2YSRA 4DNCA 3HOTA 2K27A 4ENMA 5DUKA 3E3VA 3FWEA 2Y75A 3I0TA 4HYEA 3DQVC 5FB2A 1AWCA 3GFJA 4EV0A 4WXDA 3V4GA 4LJZF 3IHUA 4GXOA 3VB2A 2P6TA 2E7WA 2FSWA 2H09A 1OKRA 3IKVA 4YG2F 1BI3A 5FLXZ 1XCBA 4L9JA 1R36A 2JZYA 3RYPA 1B9MA 2UXNA 3U9GA 2IT0A 2GA2A 1QZYA 1KU9A 4KNYA 2NNYA 4RAYA 4HDVA 3KP5A 4O3MA 3WU1B 2DBBA 3I5UA 1W4MA 4EVIA 5D6FA 3RDIA 2DW4A 2CG4A 3R6SA 2STTA 2ZO4A 2HWVA 4I01A 3BJAA 2V9VA 1G3YA 1XGOA 4IXAA 1BIBA 5HDNA 4UHTA 1S7OA 1OYIA 2PI0A 1BI1A 1KGSA 3QAHA 2TDXA 4HQMA 2RKHA 1FWZA 4XRFA 4FX0A 2VOOA 5CYVA 4EM1A 2VE9A 1IAWA 3NRVA 2Q2EA 2VT3A 4MGRA 1XDSA 1BBYA 3HSRA 3IWZA 5FLXK 1QQIA 2JTVA 3QP6A 4LGWA 1KU7A 1IRGA 3GZ6A 4D0PA 3G73A 4KFCA 5LHHA 2Y0MA 4KYWA 3WE3A 1HSJA 1SFEA 4M6XA 1USTA 4CYDA 5ICEA 3F6VA 3DV8A 3ULQB 3F8MA 4XBFA 3ABTA 4AIKA 3RJPA 3LA3A 2EFQA 4I0AA 1TQMA 4I2OA 1GVJA 3BOQA 3V8JA 4HF1A 1QZZA 5TRDA 3ROUA 5LRRA 2XAJA 4Y13A 2PEXA 1FPQA 4CICA 4GCVA 1FZPB 4CHUA 2XRNA 3KCCA 2XKOA 1XGNA 2Q0OA 3TQNA 4HLYA 4Q5SF 1RIOH 5E1ZB 3HSEA 4O6JA 1FSEA 1Z05A 1KQ8A 3DPTA 1HW5A 2KIUA 5L3FA 2XUBA 4EQQA 4ZH4F 2FNAA 2ZMEA 2XAQA 4EM2A 3DP7A 1F5TA 4NHJA 4IRIA 3TOBA 3WU0A 5H20A 4WK8F 2O8XA 1YFHA 5D4SA 1MJBA 1XSVA 5AIQA 4LLGF 2VBZA 3C18A 1U8RA 2LDUA 3WTVC 2HR3A 5ICFA 5ERIA 2OQRA 1QO0D 4L9NA 2Z3YA 4FT8A 4KDPA 2QWWA 2E1CA 3GO5A 3U2RA 3FXQA 3DEUA 4BQAA 3N4MA 2RV8A 3ZN0A 3F8CA 5ILSA 3E5UA 3BP8A 2RN7A 1MGTA 5LBQA 6PAXA 1JHHA 2M5WA 2F5EA 4M6YA 3RKWA 3JAMZ 1OPCA 3KZZA 2V79A 1Q1HA 4U0VA 1HKSA 3FM3A 1J9IA 3JTHA 1PP8F 1T38A 4M71A 2EJRA 3LFKA 4P5OA 2IA1A 1LEBA 5HLHA 1D8KA 5A2QZ 4P9FA 3GFLA 4IPAA 1BJAA 4KIGA 3SXYA 2HS5A 1XSDA 2F5FA 1U3EM 2BGCA 1ZLKA 1ZG3A 4PGHA 5CLSA 4JBAA 3HRTA 1MJAA 1ULYA 2ADUA 3R0AA 5ILVA 1WRJA 5LGNA 3BJOA 3R0JA 1SD4A 2G7HA 3ZMZA 2VC0A 4UNOA 4WWCA 3W6KB 2VXZA 3OOPA 4EGYA 1QPMA 3TDUC 4Y17A 1NHAA 3F8BA 1VTNC 2FQ3A 3FX3A 3LWFA 1F4KA 3BJ6A 4Q47A 5HS8A 3QPTA 2P5KA 3I59A 2HGCA 4L5IA 4L0YB 4G7OF 1IUYA 1ON2A 3F8NA 3Q5FA 2VC1A 3AAFA 3RKXA 3F72A 4RB1A 2W57A 3IC7A 3P9CA 1XDUA 2KKOA 1H0MA 5IT3A 4PZJA 3JAMK 3K9TA 4L0ZB 3T8RA 2XASA 1BOAA 2A3SA 5HOOA 2D1HA 2W24A 3TGNA 3RYRA 1FP2A 2QZ8A 2GZWA 4OMZA 2P4WA 2DI3A 3E97A 3IRRA 3KP3A 1PP7U 2GIVA 5A2QK 1KQ0A 2Z99A 2L54A 1JGSA 1IRFA 3E6CC 4U0YA 1B9NA 4OIPF 5BS6A 3WGIA 1Z9CA 3GZ5A 1BI2A 1IZ1A 2ZKZA 3FM5A 3E6DA 3CUQA 4B8XA 1HXDA 2AXLA 3M9AA 3H92A 3HHGA 2EA4A 2VBXA 4UUVA 5AONA 4G6QA 3ZMSA 1K78A 3RI4A 1YS7A 1R7JA 5E18F 2QBYA 5EEHA 4HF0A 3WTUC 1MJ9A 2JRTA 1YQAA 2QLZA 4WXHA 2E1NA 3SZTA 3KETA 1XMAA 4HOBA 5BOXA 1FT9A 3L00A 5D4RA 2YR2A 3GUDA 4KUMA 3E6MA 5TJJA 5FO5A 2CFXA 4BHPA 2ISZA 1EH7A 4OU0A 2P6SA 1OYYA 1IXSB 1U6GA 4P9UA 2PBIA 4M73A 2P7CB 2DTRA 4ZYDA 3MFKA 2FEZA 2HKXA 3KP6A 2ELHA 5FD5A 2OU2A 4KT5C 2MH2A 3GXOA 4U7BA 1FBUA 1TNTA 1LDDA 2EV5A 3HTSB 2OZUA 4BXUA 1OYWA 1K7AA 1U5TC 3O2PE 2DFIA 2R3SA 1EV7A 4CDGA 2IVMA 1GHCA 3LQRA 2V1XA 2RDPA 4U0WA 5E8GA 1W7PB 2X0LA 1FYKA 3GX4X 3IWFA 4G9YA 2D2WA 5CVIA 3HSFA 2M1BA 4O5VA 4HAMA 4MNUA 1T6SA 4KIBA 1DDNA 4HQEA 3KP4A 4XSXF 1G6NA 3I71A 1ZRCA 3I54A 2ZJ2A 1J2XA 3KLOA 3TO9A 5AIPA 1I27A 3J81Z 3F23A 1T0FA 5LRSA 5BMZA 3WG9A 1TQIA 4XSZF 2F2EA 4U7DA 4LG0B 4BAYA 2CW0F 1W5SA 3NQOA 1A04A 4U88A 2WTEA 2Z5UA 2K02A 2GXGA 5K1YA 3TOAA 2XV4S 3RIRA 1R1VA 3F3XA 4N0BA 1XD7A 3WTSC 3DPLC 4HA8A 3I58A 2OA4A 3QPHA 4RB2C 4EMSA 1FBQA 2RC4A 2AS5F 1U2WA 2L3DA 1IN7A 1MD0A 2FU4A 3CO7C 4FHTA 3NEUA 1YYVA 2KJCA 4MEYF 4DQ2A 4M9XA 2NYXA 2FBKA 2ESNA 5E1WA 1ODDA 3I64A 2A5YB 3R4KA 3KEOA 4KIFA 1YS6A 3J81K 2PLYA 1L3LA 4ESFA 1V3FA 4I7HA 4ZYGA 5K5RA 1F9NA 2BEOA 2VT2A 4GYGA 5FD6A 2HDCA 4HF2A 1UCRA 2FOKA 1HQCA 1YO5C 1P4XA 1XSXA 1J75A 3KEQA 4H0EA 2QVOA 4A6EA 4MTEA 2F5CA 4Q4ZF 2H94A 2GXBA 1I1GA 5HLGA 1Y0UA 1ZREA 3WTYC 3EUHA 3E5XA 3LQQA 1ZH5A 4A5MA 4M74A 3HHHA 3ECHA 4UV9A 1ZG1A 4AVPA 1RUOA 2OZ6A 2X4HA 3U1DA 1LJ9A 4PGGA 1DP7P 4CGZA 4LG0A 4QLCU 5K5OA 3MCZA 5BPDA 4MTDA 5DUIA 2K7LA 1O3QA 1YG2A 1XGMA 2VONA 3K1MA 2XIGA 2V1UA 5DV5A 4ZZLA 1K79A 4KMFA 1G3WA 4EJWA 2W84A 2WWYA 4BHBA 2J5PA 3FMRA 3COAC 1KU2A 1TTYA 2FXAA 1P4WA 3KE2A 1SD7A 4HV6A 1P92A 3ZPLA 3P7NA 2ZCWA 4BH9A 3QU3A 3MZYA 1Z91A 1V4RA 2XHKA 1UFMA 2EFWA 5L3BA 3WE2A 1R5HA 5J6XA 3HIFA 3I53A 3WTZA 4ENJA 1PUEE 1KYWA 1IF1A 1ZRFA 2M30A 3GWZA 2HFHA 5D5WB 5K5QA 4N9IA 1FC3A 4M9ZA 1S29A 3TDZC 3OV8A 4WCGA 4EGZA 1USSA 2GAUA 3D5LA 3LSTA 3RKYA 1Z7UA 2OAZA 2FA5A 5H6RA 4L9VA 3ERED 4Z2YA 4PCQA 3CDHA 1J0RA 4LLNA 4LB6B 4M9SA 5HS7A 3BY6A 1HKQA 2UZKA 4ESBA 2P7VB 2MH9A 5D8KB 5ICGA 2LNBA 3TO6A 2DT5A 3WTXC 5D5VB 2HYFA 2H27A 5DCMB 3Q9SA 2C6YA 2P8TA 4NQWA 1GXQA 3JW4A 3R60A 1O57A 1X3UA 4RAZA 2KRFA 1U5TB 2BE5F 2LF7A 3RTRA 1LVAA 1YLFA 4I09A 3M1EA 2CYYA 4UVCA 3TKYA 4R8HA 5CVUA 4R1HA 4LK0F 3L7WA 4YFNF 2VE8A 1BC7C 2ZXJA 1GXPA 3P9KA 4YFXF 2LF8A 2L01A 3T0YA 3ECOA 5DDGA 5DEQA 4LFUA 1SD5A 3GW2A 1TLHB 3QRFF 3DKWA 1STZA 5CVJA 3FXRA 2XVCA 1I6XA 4OIRF 4A6DA 1XB4A 1FLIA 2FRHA 3PQKA 3DXJF 1T98A 4CO8A 3T1BA 1R5GA 2IA2A 3K0LA 4RGUA 5FFXA 3ML6A 2H6CA 1FSHA 2XKPA 4WXCA 1I1SA 1FOKA 4HX8A 1ZN2A 2W85A 2K4JA 3ISPA 1XCVA 1YTYA 4I02A 1G4DA 2VBWA 5DCFA 4I98B 1R1TA 2YU3A 3F21A 4MQVA 2ZBKA 3KZYA 1S6LA 1B6AA 1CGPA 1TNSA 2GQQA 3MEXA 4RB0A 4HV5A 4A0ZA 3J7AO 2IW5A 2ZFWA 5LEKA 4UVAA 5LEJA 4JQFA 5D5XB 2V1DA 3W6JB 1O7LA 3IL2A 3ELKA 5DCMA 3B73A 2OD5A 4ZYHA 2K4BA 2RVCA 1WQ2A 1UHWA 2Z9OA 1G3SA 1QGPA 4ETSA 1U5TA 1WWXA 2ZNYA 2PG4A 2M8EA 1TBXA 1F1ZA 2CO5A 5DD4A 2A61A 2QYOA 3T8TA 2FMYA 2G9WA 2EB7A 1ZG5A 5ED4A 1B4AA 3O3KA 3G3ZA 3C3WA 4EJOA 1TW3A 4F7ZA 1KA8A 2XAHA 1J5YA 1O7FA 5JVTA 3L9FA 3P9IA 3WODF 1FYLA 1LQ1A 3QOPA 3CUQC 2Y48A 4LLLA 2EFNA 3PFIA 5LHIA 2XAFA 1BN5A 3WTTC 2O0YA 2IPQX 2XGXA 2IJLA 3FF5A 4YFKF 1D3YA 1R23A 1R1UA 2VBYA 4GO1A 3BWGA 3HYIA 4IF4A 1FBSA 1ZGAA 3ZQ7A 3BROA 1HW1A 2QQ9A 2A07F 3GVAA 5LHGA 1S3JA 2G7UA 5HVQC 5LLQA 4LK1F 2RNJA 3K1NA 2HQRA 3FXUA 4G7ZF 1D8JA 5ILUA 5HS9A 4BYYA 5FGMA 1LEAA 4MQ9F 5L3DA 2GWRA 1LNWA 1RNLA 1SFXA 3QU6A 4EJTA 3JTGA 3GFIA 2CGPA 5JFRA 1P6RA 1ZARA 4A0YA 4ZZDA 2PQ8A 2YPRA 1TW2A 2DPUA 1R58A 1E17A 2ETHA 2L02A 4OMYA 2COMA 3M7GA 2P5VA 1ZAOA 5KK1A 2CQKA 4I0BA 3RPQA 3REOA 4G8XA 3JSPA 4AD9A 1IN5A 3CJNA 2PJPA 3ZN1A 1IXCA 3ZMTA 1IW7F 4KA4A 4EJVA 2DQRA 2EFOA 1LDKB 4MHGA 1P2FA 1H9GA 2MC3A 4M72A 3SQNA 1LDJA 1J59A 1YIOA 3J80Z 4S05A 2JPCA 3EYIA 3F6OA 1P4AA 1B59A 2R7DA 3N97A 5L3EA 5F6FA 2A68F 4YIFA 2FBHA 1U78A 2ACJA 4YIIA 3WTWC 1HSTA 2KIFA 4IRGA 5DD8A 1E2XA 4LB5A 2NS0A 4L18B 3O6BB 3GLXA 4ON0A 2ZMEB 3K2ZA 1HBXG 4HLXA 3HTUA 1QNTA 1R00A 3V8KA 3CO6C 3GEZA 4NB5A 4P96A 1RI7A 2KJBA 5LGUA 3F22A 2K86A 2FF4A 2B0LA 1Z6RA 1KYZA 5HDGA 5F1RA 3H3UA 1W7PA 3B02A 5FFZA 1LB2A 4OOIA 1I5ZA 2A6HF 2RGVA 1J7KA 2MLKA 3M8FA 3V7CA 2STWA 3V7RA 1BC8C 2ESHA 4HX7A 4KN4X 2HOEA 3KFWX 3T5XA 2O61A 3J80K 4HBLA 2MLGA 2JPBA 3ZMDA 2VODA 1BIAA 3VOEA 4AIJA 4HZFA 3K69A 4B09A 1SAXA 2HTSA 3ZP5A 3BZ6A 2D45A 4K2EA 2EV0A 2FE3A 2HYGD 2O03A 5D8LB 1JXSA 3JSOA 2BYVE 1D5VA 2QUFA 3HUGA 1XN7A 2EFPA 1OR7A 3S2WA 5ICCA 1ZHFA 1WI9A 5D6EA 2HKOA 5E17F 1W5TA 2DQLA 3FZVA 5HLIA 1WKMA 2CWEA 2O3FA 2IRFG 3LAJA 4OIOF 1SMTA 4A5NA 4UV8A 2ZNZA 3Q9VA 1UHMA 1DPRA 1MDMB 2PMUA 2LKPA 2LSOA 3SFZA 3I59B 1FYMA 5J8CA 2PMHA 4AWXB 1C0WA 3LA7A 4RGSA 1AOYA 4R79A 4P55A 3HRSA 4LD5A 2ISYA 1RUNA 2IA0A 4A0XA 1O3TA 4N9HA 2VOPA 4RGRA 2YX7A 2OQGA 1HKTA 4IRHA 4PDKA 2XAGA 4CXFA 4RB3C 5BPIA 4G6DA 3KP2A 2MA3A 1MZBA 2DLLA 1PDNC 1EH6A 4Y15A 1CF7B 2DU9A 3R61A 1T39A 3GFMA 3SHFA 3LAPA 5JHUA 2V6CA 1DPUA 1EH8A 4XLNF 4QWQA 3E6BA 2HZTA 3CUQB 2W25A 3VEPA 3CTAA 3D0SA 4LMYA 3E5QA 4GYIA 3BDDA 3C7JA 3CLOA 4EJUA 3GF2A 4ESJA 5LGTA 2DK5A 2GA1A 1IXRC 2CSOA 3WGHA 4KN7X 1K78B 1ZLJA 4BHCA 3RPUA 1UB9A 1R22A 2QBYB 1ONVA 5HDKA 2MD5A 2DAOA 4S04A 2L4MA 1RZ4A 3V7SA 4HX4A 2A6EF 3HRMA 1YW9A 5JI6A 3EDPA 1YW7A 4L9TA 3KLNA 4IVNA 4ZYEA 2PN6A 5DYMA 1XGSA 1WSUA 1SFUA 2DO7A 4G7HF 4CZZA 3FHZA 4KMUX 1BM9A 2FBIA 3PQJA 3EETA 3GYHX 4Q48A 3DF8A 3VODA 1W7PD 2QQBA 2EWNA 2R7FA 5BQTA 1DUXC 5D5UB 1BI0A 2XROA 2FNPA 1MDMA 2UXXA 2NRAC 4E70A 3IKTA 3H3ZA 2F5DA 3EYYA 2WV0A 5E1XA 5IT9Z 1L0OC 4MEXF 1KQ9A 3V8LA 2JSCA 1SD6A 5L3GA 2L4AA 3SZPA 3C1DA 1K6OA 4TV7A 2KIMA 5E8IA 1IN6A 2QENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRD A;  2Z33 A;  3DFG A;  3EQL F;  5KVR A;  1YW8 A;  1CF7 A;  2MBF A;  4HDU A;  4RGX A;  1REP C;  4UVB A;  3QP5 A;  1S8N A;  2BV6 A;  1T2K A;  5J8F A;  4IJA A;  4OIN F;  5F64 A;  1XMK A;  3WGG A;  1IN8 A;  2HTJ A;  1FX7 A;  3HOS A;  3M8E A;  2FML A;  3MAJ A;  2HEO A;  4ENK A;  4OIQ F;  2HQN A;  1FP1 D;  2J5O A;  1S7A A;  4FX4 A;  4UXN A;  5CVR A;  3I4P A;  3IRQ A;  4ENN A;  2JT1 A;  2OBP A;  3HRU A;  2WC2 A;  4WX9 A;  1OMI A;  4EM0 B;  3CUO A;  2DPD A;  3MZH A;  3FMS A;  1JHF A;  3TO7 A;  4L5J A;  5IT9 K;  1G3T A;  2NNN A;  1O3S A;  4A2U A;  1JE8 A;  1ON1 A;  2Q8K A;  4AIH A;  5L3C A;  4G94 A;  2RQP A;  1KU3 A;  4ASN A;  3BPV A;  4JK1 X;  1ZYR F;  2E7X A;  1QBJ A;  1IN4 A;  5CVV A;  2P5L C;  5EEG A;  1FY7 A;  5CJ9 A;  2D1V A;  1H9T A;  2VN2 A;  3ZMU A;  3L2C A;  4A12 A;  2UWM A;  2QM3 A;  1SMY F;  5E20 A;  2EA2 A;  5H6Q A;  5JR3 A;  1HW2 A;  3KP7 A;  3MWM A;  2DK8 A;  2PFB A;  2QQA A;  1FNN A;  3F8F A;  3ZMV A;  4RS8 A;  4GGG A;  3K1P A;  2A69 F;  4BNC A;  4HW0 A;  2M45 A;  3MQ0 A;  2YX4 A;  2M87 A;  3VFZ A;  2H6B A;  3L09 A;  1Z1D A;  1Z6T A;  3FMQ A;  4KIC A;  2EK5 A;  1ZGJ A;  2O6G E;  1B1B A;  1TQP A;  1O3R A;  3BPX A;  2NAZ A;  2IP2 A;  4IHT A;  2EV6 A;  4WF2 A;  4XLP F;  3LA2 A;  4IHS A;  1MKM A;  3ABU A;  2BBY A;  2YSR A;  4DNC A;  3HOT A;  2K27 A;  4ENM A;  5DUK A;  3E3V A;  3FWE A;  2Y75 A;  3I0T A;  4HYE A;  3DQV C;  5FB2 A;  1AWC A;  3GFJ A;  4EV0 A;  4WXD A;  3V4G A;  4LJZ F;  3IHU A;  4GXO A;  3VB2 A;  2P6T A;  2E7W A;  2FSW A;  2H09 A;  1OKR A;  3IKV A;  4YG2 F;  1BI3 A;  5FLX Z;  1XCB A;  4L9J A;  1R36 A;  2JZY A;  3RYP A;  1B9M A;  2UXN A;  3U9G A;  2IT0 A;  2GA2 A;  1QZY A;  1KU9 A;  4KNY A;  2NNY A;  4RAY A;  4HDV A;  3KP5 A;  4O3M A;  3WU1 B;  2DBB A;  3I5U A;  1W4M A;  4EVI A;  5D6F A;  3RDI A;  2DW4 A;  2CG4 A;  3R6S A;  2STT A;  2ZO4 A;  2HWV A;  4I01 A;  3BJA A;  2V9V A;  1G3Y A;  1XGO A;  4IXA A;  1BIB A;  5HDN A;  4UHT A;  1S7O A;  1OYI A;  2PI0 A;  1BI1 A;  1KGS A;  3QAH A;  2TDX A;  4HQM A;  2RKH A;  1FWZ A;  4XRF A;  4FX0 A;  2VOO A;  5CYV A;  4EM1 A;  2VE9 A;  1IAW A;  3NRV A;  2Q2E A;  2VT3 A;  4MGR A;  1XDS A;  1BBY A;  3HSR A;  3IWZ A;  5FLX K;  1QQI A;  2JTV A;  3QP6 A;  4LGW A;  1KU7 A;  1IRG A;  3GZ6 A;  4D0P A;  3G73 A;  4KFC A;  5LHH A;  2Y0M A;  4KYW A;  3WE3 A;  1HSJ A;  1SFE A;  4M6X A;  1UST A;  4CYD A;  5ICE A;  3F6V A;  3DV8 A;  3ULQ B;  3F8M A;  4XBF A;  3ABT A;  4AIK A;  3RJP A;  3LA3 A;  2EFQ A;  4I0A A;  1TQM A;  4I2O A;  1GVJ A;  3BOQ A;  3V8J A;  4HF1 A;  1QZZ A;  5TRD A;  3ROU A;  5LRR A;  2XAJ A;  4Y13 A;  2PEX A;  1FPQ A;  4CIC A;  4GCV A;  1FZP B;  4CHU A;  2XRN A;  3KCC A;  2XKO A;  1XGN A;  2Q0O A;  3TQN A;  4HLY A;  4Q5S F;  1RIO H;  5E1Z B;  3HSE A;  4O6J A;  1FSE A;  1Z05 A;  1KQ8 A;  3DPT A;  1HW5 A;  2KIU A;  5L3F A;  2XUB A;  4EQQ A;  4ZH4 F;  2FNA A;  2ZME A;  2XAQ A;  4EM2 A;  3DP7 A;  1F5T A;  4NHJ A;  4IRI A;  3TOB A;  3WU0 A;  5H20 A;  4WK8 F;  2O8X A;  1YFH A;  5D4S A;  1MJB A;  1XSV A;  5AIQ A;  4LLG F;  2VBZ A;  3C18 A;  1U8R A;  2LDU A;  3WTV C;  2HR3 A;  5ICF A;  5ERI A;  2OQR A;  1QO0 D;  4L9N A;  2Z3Y A;  4FT8 A;  4KDP A;  2QWW A;  2E1C A;  3GO5 A;  3U2R A;  3FXQ A;  3DEU A;  4BQA A;  3N4M A;  2RV8 A;  3ZN0 A;  3F8C A;  5ILS A;  3E5U A;  3BP8 A;  2RN7 A;  1MGT A;  5LBQ A;  6PAX A;  1JHH A;  2M5W A;  2F5E A;  4M6Y A;  3RKW A;  3JAM Z;  1OPC A;  3KZZ A;  2V79 A;  1Q1H A;  4U0V A;  1HKS A;  3FM3 A;  1J9I A;  3JTH A;  1PP8 F;  1T38 A;  4M71 A;  2EJR A;  3LFK A;  4P5O A;  2IA1 A;  1LEB A;  5HLH A;  1D8K A;  5A2Q Z;  4P9F A;  3GFL A;  4IPA A;  1BJA A;  4KIG A;  3SXY A;  2HS5 A;  1XSD A;  2F5F A;  1U3E M;  2BGC A;  1ZLK A;  1ZG3 A;  4PGH A;  5CLS A;  4JBA A;  3HRT A;  1MJA A;  1ULY A;  2ADU A;  3R0A A;  5ILV A;  1WRJ A;  5LGN A;  3BJO A;  3R0J A;  1SD4 A;  2G7H A;  3ZMZ A;  2VC0 A;  4UNO A;  4WWC A;  3W6K B;  2VXZ A;  3OOP A;  4EGY A;  1QPM A;  3TDU C;  4Y17 A;  1NHA A;  3F8B A;  1VTN C;  2FQ3 A;  3FX3 A;  3LWF A;  1F4K A;  3BJ6 A;  4Q47 A;  5HS8 A;  3QPT A;  2P5K A;  3I59 A;  2HGC A;  4L5I A;  4L0Y B;  4G7O F;  1IUY A;  1ON2 A;  3F8N A;  3Q5F A;  2VC1 A;  3AAF A;  3RKX A;  3F72 A;  4RB1 A;  2W57 A;  3IC7 A;  3P9C A;  1XDU A;  2KKO A;  1H0M A;  5IT3 A;  4PZJ A;  3JAM K;  3K9T A;  4L0Z B;  3T8R A;  2XAS A;  1BOA A;  2A3S A;  5HOO A;  2D1H A;  2W24 A;  3TGN A;  3RYR A;  1FP2 A;  2QZ8 A;  2GZW A;  4OMZ A;  2P4W A;  2DI3 A;  3E97 A;  3IRR A;  3KP3 A;  1PP7 U;  2GIV A;  5A2Q K;  1KQ0 A;  2Z99 A;  2L54 A;  1JGS A;  1IRF A;  3E6C C;  4U0Y A;  1B9N A;  4OIP F;  5BS6 A;  3WGI A;  1Z9C A;  3GZ5 A;  1BI2 A;  1IZ1 A;  2ZKZ A;  3FM5 A;  3E6D A;  3CUQ A;  4B8X A;  1HXD A;  2AXL A;  3M9A A;  3H92 A;  3HHG A;  2EA4 A;  2VBX A;  4UUV A;  5AON A;  4G6Q A;  3ZMS A;  1K78 A;  3RI4 A;  1YS7 A;  1R7J A;  5E18 F;  2QBY A;  5EEH A;  4HF0 A;  3WTU C;  1MJ9 A;  2JRT A;  1YQA A;  2QLZ A;  4WXH A;  2E1N A;  3SZT A;  3KET A;  1XMA A;  4HOB A;  5BOX A;  1FT9 A;  3L00 A;  5D4R A;  2YR2 A;  3GUD A;  4KUM A;  3E6M A;  5TJJ A;  5FO5 A;  2CFX A;  4BHP A;  2ISZ A;  1EH7 A;  4OU0 A;  2P6S A;  1OYY A;  1IXS B;  1U6G A;  4P9U A;  2PBI A;  4M73 A;  2P7C B;  2DTR A;  4ZYD A;  3MFK A;  2FEZ A;  2HKX A;  3KP6 A;  2ELH A;  5FD5 A;  2OU2 A;  4KT5 C;  2MH2 A;  3GXO A;  4U7B A;  1FBU A;  1TNT A;  1LDD A;  2EV5 A;  3HTS B;  2OZU A;  4BXU A;  1OYW A;  1K7A A;  1U5T C;  3O2P E;  2DFI A;  2R3S A;  1EV7 A;  4CDG A;  2IVM A;  1GHC A;  3LQR A;  2V1X A;  2RDP A;  4U0W A;  5E8G A;  1W7P B;  2X0L A;  1FYK A;  3GX4 X;  3IWF A;  4G9Y A;  2D2W A;  5CVI A;  3HSF A;  2M1B A;  4O5V A;  4HAM A;  4MNU A;  1T6S A;  4KIB A;  1DDN A;  4HQE A;  3KP4 A;  4XSX F;  1G6N A;  3I71 A;  1ZRC A;  3I54 A;  2ZJ2 A;  1J2X A;  3KLO A;  3TO9 A;  5AIP A;  1I27 A;  3J81 Z;  3F23 A;  1T0F A;  5LRS A;  5BMZ A;  3WG9 A;  1TQI A;  4XSZ F;  2F2E A;  4U7D A;  4LG0 B;  4BAY A;  2CW0 F;  1W5S A;  3NQO A;  1A04 A;  4U88 A;  2WTE A;  2Z5U A;  2K02 A;  2GXG A;  5K1Y A;  3TOA A;  2XV4 S;  3RIR A;  1R1V A;  3F3X A;  4N0B A;  1XD7 A;  3WTS C;  3DPL C;  4HA8 A;  3I58 A;  2OA4 A;  3QPH A;  4RB2 C;  4EMS A;  1FBQ A;  2RC4 A;  2AS5 F;  1U2W A;  2L3D A;  1IN7 A;  1MD0 A;  2FU4 A;  3CO7 C;  4FHT A;  3NEU A;  1YYV A;  2KJC A;  4MEY F;  4DQ2 A;  4M9X A;  2NYX A;  2FBK A;  2ESN A;  5E1W A;  1ODD A;  3I64 A;  2A5Y B;  3R4K A;  3KEO A;  4KIF A;  1YS6 A;  3J81 K;  2PLY A;  1L3L A;  4ESF A;  1V3F A;  4I7H A;  4ZYG A;  5K5R A;  1F9N A;  2BEO A;  2VT2 A;  4GYG A;  5FD6 A;  2HDC A;  4HF2 A;  1UCR A;  2FOK A;  1HQC A;  1YO5 C;  1P4X A;  1XSX A;  1J75 A;  3KEQ A;  4H0E A;  2QVO A;  4A6E A;  4MTE A;  2F5C A;  4Q4Z F;  2H94 A;  2GXB A;  1I1G A;  5HLG A;  1Y0U A;  1ZRE A;  3WTY C;  3EUH A;  3E5X A;  3LQQ A;  1ZH5 A;  4A5M A;  4M74 A;  3HHH A;  3ECH A;  4UV9 A;  1ZG1 A;  4AVP A;  1RUO A;  2OZ6 A;  2X4H A;  3U1D A;  1LJ9 A;  4PGG A;  1DP7 P;  4CGZ A;  4LG0 A;  4QLC U;  5K5O A;  3MCZ A;  5BPD A;  4MTD A;  5DUI A;  2K7L A;  1O3Q A;  1YG2 A;  1XGM A;  2VON A;  3K1M A;  2XIG A;  2V1U A;  5DV5 A;  4ZZL A;  1K79 A;  4KMF A;  1G3W A;  4EJW A;  2W84 A;  2WWY A;  4BHB A;  2J5P A;  3FMR A;  3COA C;  1KU2 A;  1TTY A;  2FXA A;  1P4W A;  3KE2 A;  1SD7 A;  4HV6 A;  1P92 A;  3ZPL A;  3P7N A;  2ZCW A;  4BH9 A;  3QU3 A;  3MZY A;  1Z91 A;  1V4R A;  2XHK A;  1UFM A;  2EFW A;  5L3B A;  3WE2 A;  1R5H A;  5J6X A;  3HIF A;  3I53 A;  3WTZ A;  4ENJ A;  1PUE E;  1KYW A;  1IF1 A;  1ZRF A;  2M30 A;  3GWZ A;  2HFH A;  5D5W B;  5K5Q A;  4N9I A;  1FC3 A;  4M9Z A;  1S29 A;  3TDZ C;  3OV8 A;  4WCG A;  4EGZ A;  1USS A;  2GAU A;  3D5L A;  3LST A;  3RKY A;  1Z7U A;  2OAZ A;  2FA5 A;  5H6R A;  4L9V A;  3ERE D;  4Z2Y A;  4PCQ A;  3CDH A;  1J0R A;  4LLN A;  4LB6 B;  4M9S A;  5HS7 A;  3BY6 A;  1HKQ A;  2UZK A;  4ESB A;  2P7V B;  2MH9 A;  5D8K B;  5ICG A;  2LNB A;  3TO6 A;  2DT5 A;  3WTX C;  5D5V B;  2HYF A;  2H27 A;  5DCM B;  3Q9S A;  2C6Y A;  2P8T A;  4NQW A;  1GXQ A;  3JW4 A;  3R60 A;  1O57 A;  1X3U A;  4RAZ A;  2KRF A;  1U5T B;  2BE5 F;  2LF7 A;  3RTR A;  1LVA A;  1YLF A;  4I09 A;  3M1E A;  2CYY A;  4UVC A;  3TKY A;  4R8H A;  5CVU A;  4R1H A;  4LK0 F;  3L7W A;  4YFN F;  2VE8 A;  1BC7 C;  2ZXJ A;  1GXP A;  3P9K A;  4YFX F;  2LF8 A;  2L01 A;  3T0Y A;  3ECO A;  5DDG A;  5DEQ A;  4LFU A;  1SD5 A;  3GW2 A;  1TLH B;  3QRF F;  3DKW A;  1STZ A;  5CVJ A;  3FXR A;  2XVC A;  1I6X A;  4OIR F;  4A6D A;  1XB4 A;  1FLI A;  2FRH A;  3PQK A;  3DXJ F;  1T98 A;  4CO8 A;  3T1B A;  1R5G A;  2IA2 A;  3K0L A;  4RGU A;  5FFX A;  3ML6 A;  2H6C A;  1FSH A;  2XKP A;  4WXC A;  1I1S A;  1FOK A;  4HX8 A;  1ZN2 A;  2W85 A;  2K4J A;  3ISP A;  1XCV A;  1YTY A;  4I02 A;  1G4D A;  2VBW A;  5DCF A;  4I98 B;  1R1T A;  2YU3 A;  3F21 A;  4MQV A;  2ZBK A;  3KZY A;  1S6L A;  1B6A A;  1CGP A;  1TNS A;  2GQQ A;  3MEX A;  4RB0 A;  4HV5 A;  4A0Z A;  3J7A O;  2IW5 A;  2ZFW A;  5LEK A;  4UVA A;  5LEJ A;  4JQF A;  5D5X B;  2V1D A;  3W6J B;  1O7L A;  3IL2 A;  3ELK A;  5DCM A;  3B73 A;  2OD5 A;  4ZYH A;  2K4B A;  2RVC A;  1WQ2 A;  1UHW A;  2Z9O A;  1G3S A;  1QGP A;  4ETS A;  1U5T A;  1WWX A;  2ZNY A;  2PG4 A;  2M8E A;  1TBX A;  1F1Z A;  2CO5 A;  5DD4 A;  2A61 A;  2QYO A;  3T8T A;  2FMY A;  2G9W A;  2EB7 A;  1ZG5 A;  5ED4 A;  1B4A A;  3O3K A;  3G3Z A;  3C3W A;  4EJO A;  1TW3 A;  4F7Z A;  1KA8 A;  2XAH A;  1J5Y A;  1O7F A;  5JVT A;  3L9F A;  3P9I A;  3WOD F;  1FYL A;  1LQ1 A;  3QOP A;  3CUQ C;  2Y48 A;  4LLL A;  2EFN A;  3PFI A;  5LHI A;  2XAF A;  1BN5 A;  3WTT C;  2O0Y A;  2IPQ X;  2XGX A;  2IJL A;  3FF5 A;  4YFK F;  1D3Y A;  1R23 A;  1R1U A;  2VBY A;  4GO1 A;  3BWG A;  3HYI A;  4IF4 A;  1FBS A;  1ZGA A;  3ZQ7 A;  3BRO A;  1HW1 A;  2QQ9 A;  2A07 F;  3GVA A;  5LHG A;  1S3J A;  2G7U A;  5HVQ C;  5LLQ A;  4LK1 F;  2RNJ A;  3K1N A;  2HQR A;  3FXU A;  4G7Z F;  1D8J A;  5ILU A;  5HS9 A;  4BYY A;  5FGM A;  1LEA A;  4MQ9 F;  5L3D A;  2GWR A;  1LNW A;  1RNL A;  1SFX A;  3QU6 A;  4EJT A;  3JTG A;  3GFI A;  2CGP A;  5JFR A;  1P6R A;  1ZAR A;  4A0Y A;  4ZZD A;  2PQ8 A;  2YPR A;  1TW2 A;  2DPU A;  1R58 A;  1E17 A;  2ETH A;  2L02 A;  4OMY A;  2COM A;  3M7G A;  2P5V A;  1ZAO A;  5KK1 A;  2CQK A;  4I0B A;  3RPQ A;  3REO A;  4G8X A;  3JSP A;  4AD9 A;  1IN5 A;  3CJN A;  2PJP A;  3ZN1 A;  1IXC A;  3ZMT A;  1IW7 F;  4KA4 A;  4EJV A;  2DQR A;  2EFO A;  1LDK B;  4MHG A;  1P2F A;  1H9G A;  2MC3 A;  4M72 A;  3SQN A;  1LDJ A;  1J59 A;  1YIO A;  3J80 Z;  4S05 A;  2JPC A;  3EYI A;  3F6O A;  1P4A A;  1B59 A;  2R7D A;  3N97 A;  5L3E A;  5F6F A;  2A68 F;  4YIF A;  2FBH A;  1U78 A;  2ACJ A;  4YII A;  3WTW C;  1HST A;  2KIF A;  4IRG A;  5DD8 A;  1E2X A;  4LB5 A;  2NS0 A;  4L18 B;  3O6B B;  3GLX A;  4ON0 A;  2ZME B;  3K2Z A;  1HBX G;  4HLX A;  3HTU A;  1QNT A;  1R00 A;  3V8K A;  3CO6 C;  3GEZ A;  4NB5 A;  4P96 A;  1RI7 A;  2KJB A;  5LGU A;  3F22 A;  2K86 A;  2FF4 A;  2B0L A;  1Z6R A;  1KYZ A;  5HDG A;  5F1R A;  3H3U A;  1W7P A;  3B02 A;  5FFZ A;  1LB2 A;  4OOI A;  1I5Z A;  2A6H F;  2RGV A;  1J7K A;  2MLK A;  3M8F A;  3V7C A;  2STW A;  3V7R A;  1BC8 C;  2ESH A;  4HX7 A;  4KN4 X;  2HOE A;  3KFW X;  3T5X A;  2O61 A;  3J80 K;  4HBL A;  2MLG A;  2JPB A;  3ZMD A;  2VOD A;  1BIA A;  3VOE A;  4AIJ A;  4HZF A;  3K69 A;  4B09 A;  1SAX A;  2HTS A;  3ZP5 A;  3BZ6 A;  2D45 A;  4K2E A;  2EV0 A;  2FE3 A;  2HYG D;  2O03 A;  5D8L B;  1JXS A;  3JSO A;  2BYV E;  1D5V A;  2QUF A;  3HUG A;  1XN7 A;  2EFP A;  1OR7 A;  3S2W A;  5ICC A;  1ZHF A;  1WI9 A;  5D6E A;  2HKO A;  5E17 F;  1W5T A;  2DQL A;  3FZV A;  5HLI A;  1WKM A;  2CWE A;  2O3F A;  2IRF G;  3LAJ A;  4OIO F;  1SMT A;  4A5N A;  4UV8 A;  2ZNZ A;  3Q9V A;  1UHM A;  1DPR A;  1MDM B;  2PMU A;  2LKP A;  2LSO A;  3SFZ A;  3I59 B;  1FYM A;  5J8C A;  2PMH A;  4AWX B;  1C0W A;  3LA7 A;  4RGS A;  1AOY A;  4R79 A;  4P55 A;  3HRS A;  4LD5 A;  2ISY A;  1RUN A;  2IA0 A;  4A0X A;  1O3T A;  4N9H A;  2VOP A;  4RGR A;  2YX7 A;  2OQG A;  1HKT A;  4IRH A;  4PDK A;  2XAG A;  4CXF A;  4RB3 C;  5BPI A;  4G6D A;  3KP2 A;  2MA3 A;  1MZB A;  2DLL A;  1PDN C;  1EH6 A;  4Y15 A;  1CF7 B;  2DU9 A;  3R61 A;  1T39 A;  3GFM A;  3SHF A;  3LAP A;  5JHU A;  2V6C A;  1DPU A;  1EH8 A;  4XLN F;  4QWQ A;  3E6B A;  2HZT A;  3CUQ B;  2W25 A;  3VEP A;  3CTA A;  3D0S A;  4LMY A;  3E5Q A;  4GYI A;  3BDD A;  3C7J A;  3CLO A;  4EJU A;  3GF2 A;  4ESJ A;  5LGT A;  2DK5 A;  2GA1 A;  1IXR C;  2CSO A;  3WGH A;  4KN7 X;  1K78 B;  1ZLJ A;  4BHC A;  3RPU A;  1UB9 A;  1R22 A;  2QBY B;  1ONV A;  5HDK A;  2MD5 A;  2DAO A;  4S04 A;  2L4M A;  1RZ4 A;  3V7S A;  4HX4 A;  2A6E F;  3HRM A;  1YW9 A;  5JI6 A;  3EDP A;  1YW7 A;  4L9T A;  3KLN A;  4IVN A;  4ZYE A;  2PN6 A;  5DYM A;  1XGS A;  1WSU A;  1SFU A;  2DO7 A;  4G7H F;  4CZZ A;  3FHZ A;  4KMU X;  1BM9 A;  2FBI A;  3PQJ A;  3EET A;  3GYH X;  4Q48 A;  3DF8 A;  3VOD A;  1W7P D;  2QQB A;  2EWN A;  2R7F A;  5BQT A;  1DUX C;  5D5U B;  1BI0 A;  2XRO A;  2FNP A;  1MDM A;  2UXX A;  2NRA C;  4E70 A;  3IKT A;  3H3Z A;  2F5D A;  3EYY A;  2WV0 A;  5E1X A;  5IT9 Z;  1L0O C;  4MEX F;  1KQ9 A;  3V8L A;  2JSC A;  1SD6 A;  5L3G A;  2L4A A;  3SZP A;  3C1D A;  1K6O A;  4TV7 A;  2KIM A;  5E8I A;  1IN6 A;  2QEN A; 
#chains in the Genus database with same CATH topology
 2R5Y A;  1ZRD A;  2VKH A;  2Z33 A;  2PX9 A;  3DFG A;  5J1Y A;  3EQL F;  3H3V K;  3FXL A;  5KVR A;  2DOD A;  3BR1 A;  4IZZ A;  1YW8 A;  1CF7 A;  2MBF A;  4HDU A;  4RGX A;  1REP C;  4UVB A;  2IS2 A;  2Q1Z B;  4HRI A;  3QP5 A;  3U21 A;  3LL7 A;  1S8N A;  1JGG A;  3HEF A;  2BV6 A;  1T2K A;  2R7X A;  2AQE A;  2H8R A;  5J8F A;  3BG6 A;  4IJA A;  4OIN F;  2BY1 A;  1JUP A;  5F64 A;  3RKQ A;  1TWA J;  4M3F A;  3BCA A;  1XMK A;  2V1N A;  1IN8 A;  3IUO A;  3WGG A;  1LE8 A;  2HTJ A;  1FX7 A;  3HOS A;  3M8E A;  1JT6 A;  2FML A;  2EZI A;  2X85 A;  1NK3 P;  2E2I J;  3MAJ A;  2HEO A;  4ENK A;  4DYQ A;  2IS1 A;  4OIQ F;  2HQN A;  1FP1 D;  2OTJ I;  2J5O A;  2LY1 A;  1S7A A;  2K9L A;  4FX4 A;  4UXN A;  4NUB A;  5CVR A;  3I4P A;  3IRQ A;  4ENN A;  3KEY A;  2JT1 A;  2OBP A;  3HRU A;  4H4K C;  2WC2 A;  4WX9 A;  1OMI A;  4EM0 B;  3CF5 F;  3CUO A;  2M2E A;  2DPD A;  3VYR B;  2HI3 A;  3MZH A;  4BBS J;  3FMS A;  3K10 A;  4DYR A;  1IV8 A;  1JHF A;  3TO7 A;  2JVH A;  4M3E A;  4L5J A;  1X1B A;  1XS9 A;  5IT9 K;  1TZL A;  4AM3 A;  1G3T A;  2NNN A;  3O8G A;  4DJA A;  1G8X A;  1O3S A;  4A2U A;  3ZQH A;  1JE8 A;  2M4K A;  1ON1 A;  2Q8K A;  4AIH A;  1WFX A;  2W82 A;  3AFH A;  1N25 A;  1QPI A;  2N8G A;  5L3C A;  4PJM A;  3OS0 A;  4G94 A;  2RQP A;  3JRD A;  1KU3 A;  3K4M A;  2E36 A;  4ASN A;  3BPV A;  1SVO A;  4JK1 X;  5CQE A;  1ZYR F;  2O8K A;  2E7X A;  4M3G A;  4A3G J;  5FKK A;  1ETO A;  1T33 A;  1MMS A;  1QBJ A;  1HC8 A;  2MW8 A;  2LD5 A;  4D7M A;  1IN4 A;  5CVV A;  2P5L C;  5EEG A;  1OFC X;  3ZOB A;  3SEZ A;  1FY7 A;  2NVY J;  5CJ9 A;  2R7W A;  1DU6 A;  2D1V A;  1OJL A;  1H9T A;  2VN2 A;  3G1O A;  3ZMU A;  3L2C A;  2VJ4 A;  4A12 A;  2UWM A;  2QM3 A;  3RZD J;  5DTD A;  2B9S A;  1Z21 A;  1D1C A;  4F93 B;  1SMY F;  5E20 A;  2EA2 A;  5H6Q A;  5JR3 A;  1HW2 A;  3KP7 A;  2GM4 A;  4NNJ A;  2L5Q A;  2XB5 A;  3MWM A;  1GV2 A;  2DK8 A;  5KAF C;  2JSP A;  2CFO A;  2PFB A;  2IGN A;  4FIS A;  4NDL A;  1TL8 A;  4F91 B;  3CJR B;  4G12 A;  3OIO A;  2QQA A;  2AXT C;  1FNN A;  3F8F A;  3ZMV A;  2DFH A;  1J09 A;  3CF2 A;  5F27 A;  4RS8 A;  4GGG A;  2A5W A;  3K1P A;  2A69 F;  5J3L A;  2Z1D A;  2EH3 A;  4BNC A;  4HW0 A;  2EZK A;  1X2M A;  2M45 A;  3MQ0 A;  4HPQ A;  3CJQ B;  1D0X A;  2YX4 A;  3BTL A;  1YJW I;  2M87 A;  3LFU A;  1N77 A;  3VFZ A;  2EPF A;  2H6B A;  3L09 A;  2DT6 A;  1Z1D A;  1Z6T A;  3WG7 H;  3FMQ A;  3IH3 A;  4KIC A;  4PJN A;  2EK5 A;  4Y4R A;  4EEF G;  1ZGJ A;  4UB8 C;  2O6G E;  1QHH D;  3W3C A;  1B1B A;  3FXO A;  1TQP A;  3J7A Y;  3CCY A;  2V7F A;  1O3R A;  3BPX A;  2NAZ A;  2IP2 A;  4IHT A;  4UUS B;  2EV6 A;  4EAT A;  3A4C A;  4WF2 A;  4XLP F;  4F55 A;  2QKL B;  3LA2 A;  4IHS A;  1IO2 A;  1MKM A;  3ZCO A;  2JA7 J;  2FOW A;  2O5R A;  2CJJ A;  3ABU A;  5IYC J;  2BBY A;  2HOS A;  1JUS A;  1R5I D;  2YSR A;  4D5F A;  4DNC A;  3HOT A;  2K27 A;  3ERM A;  5GPC A;  4ENM A;  5DUK A;  1MMG A;  3E3V A;  3FWE A;  4P1W A;  4QPO A;  3L2R A;  4A3B J;  1MND A;  2Y75 A;  3I0T A;  3CES A;  4HYE A;  2JN6 A;  3HG9 A;  2ME6 A;  3DQV C;  3MKZ A;  1X19 A;  5FB2 A;  1AWC A;  1BA5 A;  3GFJ A;  4EV0 A;  4BQO A;  2X1C A;  4WXD A;  5E3N A;  3V4G A;  4LJZ F;  2XPV A;  3IHU A;  2DCE A;  4GXO A;  4W1U A;  4XRS G;  3VB2 A;  4BE2 A;  2VXD A;  4Y33 A;  1UMQ A;  2P6T A;  2E7W A;  2FSW A;  4CZC A;  2H09 A;  1OKR A;  3M07 A;  3IKV A;  4YG2 F;  3HZJ A;  1IGN A;  2COB A;  2BXZ A;  1BI3 A;  5FLX Z;  1XCB A;  1RKW A;  1R36 A;  2JZY A;  4L9J A;  3S32 A;  2W1O A;  4BQQ A;  3RYP A;  1B9M A;  2UXN A;  2VKV A;  4B48 A;  5TGT A;  1E3P A;  3U9G A;  5DM7 F;  2IT0 A;  3IAM 2;  1K6Y A;  1FJL A;  2GA2 A;  1QZY A;  3JRE A;  1KU9 A;  2ELJ A;  1WZ2 A;  2CUZ A;  3VSL A;  4KNY A;  2QSG X;  2NNY A;  3LSR A;  3ESW B;  4RAY A;  3BR0 A;  1PYV A;  3KP5 A;  4HDV A;  4O3M A;  3WU1 B;  2DBB A;  2DJN A;  2LKS A;  3H5A A;  3I5U A;  2RQQ A;  2TCT A;  1W4M A;  2X51 A;  4EVI A;  5D6F A;  4Z6Y A;  3RDI A;  2DW4 A;  2GLO A;  2CMP A;  2CG4 A;  3ZQI A;  3R6S A;  2STT A;  2IBD A;  2ZO4 A;  4XKV A;  3JRF A;  2HWV A;  4I01 A;  2MG4 A;  1Y56 A;  2K3F A;  3BJA A;  2X6O A;  2ZXW H;  1OCZ H;  2ZJQ F;  2CUE A;  2V9V A;  3ZRG A;  1OLT A;  1G3Y A;  1XGO A;  4IXA A;  1BIB A;  5HDN A;  2KIS A;  5J4V A;  4QPQ A;  4BAC A;  2EBI A;  4UHT A;  1VQ7 I;  1S7O A;  1OYI A;  2PI0 A;  1BI1 A;  2V4J C;  1KGS A;  3QAH A;  3M4O J;  2TDX A;  4HQM A;  2RKH A;  4C2U A;  3DU6 A;  1FWZ A;  3OYC A;  1HDP A;  2PJR B;  4XRF A;  1X4P A;  4X0G A;  4FX0 A;  3QWL A;  5C3E J;  3RCO A;  3RQ4 A;  1X2N A;  3B6C A;  4XN3 A;  1GT0 C;  4GRI A;  2VOO A;  5CYV A;  1OCT C;  4BBR J;  3OIQ A;  1P7J A;  4IQ4 A;  1P9Q C;  3H1C A;  4UUT A;  4EM1 A;  2VE9 A;  1IRZ A;  1IAW A;  3NRV A;  2Q2E A;  2CQQ A;  1H88 C;  3ABM H;  2VT3 A;  4MGR A;  1NK2 P;  1MBE A;  1XDS A;  2CQN A;  1BBY A;  2WV1 A;  3HSR A;  5B1A H;  2F48 A;  2V9K A;  2L2O A;  3IWZ A;  5FLX K;  1OCP A;  2X6X A;  1QQI A;  5M5X J;  2KFD A;  2JTV A;  3QP6 A;  4LGW A;  1KU7 A;  1IRG A;  3GZ6 A;  4G6T B;  4D0P A;  1BOB A;  2E1M B;  3TW7 A;  5LHH A;  3G73 A;  4KFC A;  2Y0M A;  3BG3 A;  4KYW A;  1B8I A;  3WE3 A;  5B3S H;  1VQ9 I;  1HSJ A;  1SFE A;  5F1J A;  4M6X A;  4UUS A;  2ZFU A;  1VQ4 I;  1UST A;  4RLF A;  5F0H A;  1D1A A;  4BUP A;  3CZ6 A;  2X6Y A;  2DOA A;  3BC8 A;  3CCJ I;  4CYD A;  1RPW A;  5ICE A;  3G4S I;  2WAQ N;  4A3M J;  3F6V A;  3DV8 A;  3ULQ B;  3F8M A;  4AVZ A;  1FEX A;  4NQW B;  4XBF A;  3ABK H;  4E7H A;  2Y0S N;  3ABT A;  5EDN A;  2R7U A;  4AIK A;  1I50 J;  2KL4 A;  3RJP A;  3LA3 A;  2EFQ A;  3FXK A;  4LIU A;  2L9R A;  3TBI A;  4I0A A;  2WAF A;  1TQM A;  1B72 B;  4I2O A;  1GVJ A;  3BOQ A;  3VYS B;  4AU7 A;  3V8J A;  3DCF A;  1W5C C;  3QPS A;  4HF1 A;  1QZZ A;  3BCB A;  3W2A A;  3A1Y A;  1ETW A;  5TRD A;  3ROU A;  5LRR A;  2I10 A;  2XAJ A;  3HDD A;  2E2J J;  1TT5 B;  4Y13 A;  2PEX A;  1M1E B;  1E3H A;  1FPQ A;  4CIC A;  1GDT A;  4GCV A;  1FZP B;  4CHU A;  2XGE A;  3J7Z I;  2XRN A;  3KCC A;  2XKO A;  1WJD A;  2NXN B;  1Y8R B;  2AO9 A;  4A3L J;  3G2B A;  1XGN A;  3FKJ A;  5C44 J;  2DFE A;  3DBL B;  3NAR A;  2Q0O A;  4XOR A;  3K4J A;  3TQN A;  4HLY A;  3A03 A;  4Q5S F;  2DMQ A;  2EZH A;  1RIO H;  4UY8 I;  5E1Z B;  4PJ0 C;  2ID3 A;  4IOC F;  3VWB A;  3TP0 A;  3HSE A;  4O6J A;  1FSE A;  1NTC A;  1Z05 A;  1BW6 A;  4XMY A;  1KQ8 A;  3DPT A;  3PM1 A;  1HW5 A;  3B6A A;  2KIU A;  1XMX A;  3CCR I;  2VAS A;  1LFP A;  3CP2 A;  3EUH C;  5L3F A;  2XUB A;  4EQQ A;  2R7O A;  2ELK A;  2FNA A;  2QCO A;  4ZH4 F;  2ZME A;  2XAQ A;  4BU2 A;  1ORK A;  4EM2 A;  2BXY A;  3DP7 A;  1WJA A;  1F5T A;  4NHJ A;  4IRI A;  3TOB A;  4BEH B;  2MSY A;  1RKT A;  3WU0 A;  1YIT I;  3BZC A;  5H20 A;  1W0U A;  3OYD A;  3FIS A;  2O8X A;  4WK8 F;  3U1K A;  3SDG A;  5CQG A;  3AG1 H;  4M3B A;  1YFH A;  3HOW J;  5D4S A;  1MJB A;  1VQK I;  1XSV A;  5AIQ A;  4LLG F;  2VBZ A;  1I3Q J;  3C18 A;  4FET A;  4HST A;  3TMO A;  1U8R A;  2PJR A;  2LDU A;  2A6T A;  3WTV C;  2HR3 A;  2IGO A;  5ICF A;  1RR7 A;  5FRO A;  5ERI A;  5K7Z A;  2OQR A;  1MIJ A;  2LOO A;  3IH4 A;  2LVS A;  1QO0 D;  4XR6 A;  5H2F C;  4L9N A;  2KRH A;  2DMT A;  2Z3Y A;  4FT8 A;  3RQI A;  4KDP A;  2VKE A;  2QWW A;  1Y0N A;  2YUS A;  2E1C A;  3ASN H;  3GO5 A;  3HXL A;  3U2R A;  3FXQ A;  4BY7 J;  4LIV A;  3DEU A;  3BR2 A;  2KRC A;  2DDB A;  4AYB A;  1IV6 A;  4BQA A;  3FBN B;  3N4M A;  9ANT A;  2RV8 A;  2Y2Z A;  3ZN0 A;  4HNT A;  1RET A;  2MC4 A;  3F8C A;  5ILS A;  5FKO A;  3E5U A;  2KT0 A;  3BP8 A;  4B3A A;  2RN7 A;  1MGT A;  5LBQ A;  6PAX A;  1JHH A;  2M5W A;  1ETV A;  2IAI A;  5FRM A;  1QA6 A;  2F5E A;  1X1A A;  4M6Y A;  3Q0W A;  3K4B A;  3RKW A;  2HZD A;  3JAM Z;  4BJ5 C;  1JKP C;  2DTZ A;  1U9N A;  2EIK H;  4J00 A;  4XK4 A;  1OPC A;  1YIJ I;  3KZZ A;  2V79 A;  1Q1H A;  4U0V A;  1HKS A;  3FM3 A;  1J9I A;  1UEL B;  3JTH A;  1PP8 F;  2E1O A;  1T38 A;  4JX4 A;  4M71 A;  4CCO A;  2EJR A;  4BKX A;  3LFK A;  4P5O A;  2OF7 A;  2IA1 A;  1LEB A;  5HLH A;  1D8K A;  5A2Q Z;  4P9F A;  3GFL A;  4IPA A;  1B72 A;  1XG1 A;  2KPM A;  1QZE A;  1SFO J;  1BJA A;  4KIG A;  4MLO A;  2HS5 A;  3SXY A;  1XSD A;  5EZG A;  1MMN A;  5EGO B;  2F5F A;  4A69 C;  1U3E M;  2BGC A;  1ZLK A;  5IPA A;  2Y9Y A;  1ZG3 A;  4PGH A;  1EJ9 A;  5CLS A;  2IEK A;  1LFU P;  4JBA A;  4HNV A;  3HRT A;  4DIQ A;  5F08 A;  4I76 A;  5FRN A;  3BG5 A;  1MJA A;  1ULY A;  1I6H J;  2YS9 A;  3I56 I;  2ADU A;  3R0A A;  2UV1 A;  5ILV A;  1WRJ A;  5LGN A;  3BJO A;  4BDZ A;  3R0J A;  1SD4 A;  2G7H A;  3ZMZ A;  2VC0 A;  4UNO A;  4WWC A;  2JRM A;  3S93 A;  3W6K B;  2VXZ A;  3OOP A;  4AUX A;  5HNH A;  4EGY A;  1VQN I;  1EKE A;  3C2G A;  1QPM A;  3TDU C;  4Y17 A;  1SAN A;  1NHA A;  2Y69 H;  2CUJ A;  3F8B A;  1AU7 A;  3SEQ A;  1VTN C;  2KLO A;  2FQ3 A;  3FX3 A;  3LWF A;  1F4K A;  3BJ6 A;  2HQ5 A;  4Q47 A;  3A02 A;  5HS8 A;  3CCV I;  1VQO I;  3QPT A;  1WJB A;  3HB9 A;  2LRE A;  4FTH A;  2R7T A;  2P5K A;  3I59 A;  2HGC A;  4L5I A;  1T95 A;  2DOE A;  2R7R A;  4L0Y B;  4G7O F;  1IUY A;  1ON2 A;  1N75 A;  3F8N A;  3Q5F A;  2BHZ A;  1JJ8 C;  2VC1 A;  3AAF A;  3RKX A;  3DTE A;  3FK6 A;  2D5V A;  3F72 A;  4RB1 A;  3OYG A;  2W57 A;  4RLQ A;  3IC7 A;  3L2U A;  3P9C A;  5EZH A;  1XDU A;  2KKO A;  4BEH A;  1H0M A;  3LSJ A;  5IT3 A;  2L7Z A;  4PZJ A;  3JAM K;  3K9T A;  4L0Z B;  3T8R A;  2BY3 A;  2XAS A;  2VI6 A;  1BOA A;  2A3S A;  5HOO A;  1VZ0 A;  2D1H A;  5F0C A;  3OYJ A;  2W24 A;  3TGN A;  3RYR A;  1FP2 A;  2QZ8 A;  3BLY A;  2GZW A;  4OMZ A;  4V19 K;  2P4W A;  2MD0 A;  2DI3 A;  2OJE D;  3E97 A;  3IRR A;  3KP3 A;  1WH7 A;  1X3W B;  1PP7 U;  5EG0 B;  2GIV A;  5A2Q K;  1KQ0 A;  2Z99 A;  2L54 A;  1JGS A;  1IRF A;  2QQ8 A;  3E6C C;  4U0Y A;  1B9N A;  3H9J A;  2M9H A;  3KX2 A;  3CCL I;  4RAG A;  4OIP F;  1R6R A;  4XKW A;  5BS6 A;  4CCM A;  2YU9 J;  3WGI A;  1Z9C A;  3GZ5 A;  1BI2 A;  4HEA 2;  3OIP A;  3G71 I;  1IZ1 A;  2ZKZ A;  1LFB A;  3HC7 A;  3FM5 A;  3E6D A;  1TP4 A;  3CUQ A;  1W36 C;  2W48 A;  5LFA A;  1EF4 A;  2K9N A;  1FIP A;  2WAE A;  4B8X A;  1HXD A;  2AXL A;  3M9A A;  3HKZ N;  3H92 A;  2CW7 A;  3HHG A;  1MBG A;  1MSF C;  2VJ5 A;  1U9O A;  2EA4 A;  2VBX A;  4NC6 A;  5K7F A;  3I55 I;  4C3J J;  3X2Q H;  4XRM A;  4UUV A;  2LLK A;  5AON A;  4G6Q A;  3ZMS A;  1V5F A;  2QSF X;  1K78 A;  3MVP A;  3RI4 A;  1NG6 A;  5GAH J;  4D5C A;  2LH9 A;  2K9M A;  1YS7 A;  1R7J A;  1BL0 A;  5E18 F;  2CV1 A;  2QBY A;  4NC8 A;  5EEH A;  4HF0 A;  3WTU C;  1MJ9 A;  2JRT A;  5FLV A;  1YQA A;  2F4M B;  2QLZ A;  1V54 H;  5EGO A;  1QVU A;  3DPU A;  2W00 A;  3A01 B;  4WXH A;  2E1N A;  1GUU A;  3ZR8 X;  3SZT A;  2R92 J;  2IXS A;  3KET A;  5F04 A;  1XMA A;  4HOB A;  5BOX A;  1FT9 A;  3AG3 H;  3L00 A;  5D4R A;  2YR2 A;  3GUD A;  3PSF A;  3SZG A;  4KUM A;  1A6Q A;  1VQL I;  2FX0 A;  3E6M A;  5TJJ A;  5FO5 A;  2CFX A;  4BHP A;  2ISZ A;  2L9S A;  3PUB A;  2VQG A;  1EH7 A;  4OU0 A;  4DGW B;  1WJE A;  2P6S A;  1OYY A;  1IXS B;  1U6G A;  4P9U A;  2R7Q A;  2PBI A;  1R71 A;  4M73 A;  3UR3 C;  2P7C B;  4NBQ A;  2DTR A;  4ZYD A;  3MFK A;  2E5Z A;  2FEZ A;  2LY2 A;  1A31 A;  2LK2 A;  4XLC A;  4B3X A;  2HKX A;  3KP6 A;  2ELH A;  3VDX A;  5FD5 A;  1RES A;  4BS9 A;  2M8G X;  2OU2 A;  4KT5 C;  1TC3 C;  2MH2 A;  3GXO A;  4U7B A;  2M34 A;  1FBU A;  2LTP A;  1TNT A;  2CUF A;  1I39 A;  1LDD A;  1ACI A;  2EV5 A;  5FKL A;  2KIQ A;  3HTS B;  4IHV A;  2OZU A;  3K4N A;  2R93 J;  4BXU A;  2R4G A;  5J1R A;  3CCM I;  1OYW A;  4YEL A;  3H0D A;  1K7A A;  3CDL A;  1U5T C;  3ZQF A;  1X1C A;  3FXJ A;  4FQG A;  4CA0 A;  3O2P E;  2DFI A;  2R3S A;  4PFP A;  1EV7 A;  4CDG A;  1UZC A;  2IVM A;  1GHC A;  3LQR A;  4DYC A;  3HOX J;  2V1X A;  2RDP A;  2ZC2 A;  2DN0 A;  1V5E A;  2L0K A;  2ZXI A;  4X1E A;  5JLX A;  4U0W A;  5E8G A;  1Z3Y A;  4J01 A;  1MBF A;  3OYH A;  2HDW A;  1W7P B;  2X0L A;  4UB6 C;  1FYK A;  3GX4 X;  1W0T A;  1AKH B;  3IWF A;  1ETY A;  4G9Y A;  2D2W A;  1EA3 A;  5CVI A;  3HSF A;  3HBL A;  1K61 A;  2WB1 A;  2IGM A;  1X58 A;  2E60 A;  2M1B A;  4O5V A;  4HAM A;  4MNU A;  1S9H A;  3OS2 A;  1T6S A;  4KIB A;  1ZTR A;  4XLH A;  4J19 A;  1U8B A;  1DDN A;  4HQE A;  3KP4 A;  4XSX F;  1G6N A;  1Y8Q B;  3I71 A;  3TP3 A;  1ZRC A;  2GOM A;  3I54 A;  1DGW Y;  2ZJ2 A;  3VPR A;  1J2X A;  3KLO A;  3TO9 A;  2L7K A;  1WHU A;  5AIP A;  1I27 A;  3J81 Z;  5J40 A;  1T0F A;  5LRS A;  3F23 A;  2KHM A;  3OR1 C;  5BMZ A;  2KP6 A;  3DTI A;  3WG9 A;  1TQI A;  3GZN B;  4XSZ F;  5M3M J;  4ZDP A;  2QSH X;  2F2E A;  2WAD A;  2VPL A;  3FIW A;  2XRL A;  4U7D A;  4LG0 B;  3CC4 I;  2DA4 A;  1HCR A;  4BAY A;  2CW0 F;  1W5S A;  3NQO A;  1A04 A;  4ZTJ A;  4U88 A;  4C3I J;  2WTE A;  1ITY A;  1X3Z B;  2XSJ C;  2K02 A;  2Z5U A;  2KQR A;  2GXG A;  3NAU A;  2ZJR F;  5K1Y A;  1TWH J;  3SDB A;  3TOA A;  2XV4 S;  4ABZ A;  3RIR A;  3HUG B;  1R1V A;  3F3X A;  1RC9 A;  2ECC A;  4N0B A;  2WBM A;  1A36 A;  1XD7 A;  3WTS C;  5KCM A;  3QQA A;  2X1E A;  4E7J A;  3DPL C;  4HA8 A;  4MO7 A;  2VJJ A;  3I58 A;  2OA4 A;  3QPH A;  2ZJP F;  1PUF B;  4RB2 C;  3S1N J;  2LY9 A;  4EMS A;  1FBQ A;  3BTC A;  2RC4 A;  5LD2 C;  1A5J A;  2F6C A;  2HU9 A;  3OYK A;  2AS5 F;  1U2W A;  2CRG A;  2L3D A;  4A3J J;  2O9L A;  2VUM J;  1IN7 A;  1P7I A;  3BTJ A;  1MD0 A;  2FU4 A;  3E1S A;  1R49 A;  1YRN B;  3CO7 C;  1U0J A;  4FHT A;  4JYK A;  3EPZ A;  4QTR A;  3NEU A;  1YYV A;  2KJC A;  3PNT A;  5KNL A;  3H0G J;  1VQP I;  4MEY F;  3PO3 J;  4DQ2 A;  2VQC A;  4M9X A;  2NYX A;  2X48 A;  4A3F J;  2FBK A;  1DQU A;  5IOY A;  1ZGW A;  2ESN A;  3BR6 A;  1ODD A;  5E1W A;  4QSH A;  3I64 A;  2A5Y B;  3R4K A;  3KEO A;  1VQM I;  3S2H J;  2P0W A;  1ETK A;  4KIF A;  1YS6 A;  1FTZ A;  3J81 K;  3K6G A;  4F52 A;  2PLY A;  1L3L A;  3CCS I;  2JJ7 A;  4ESF A;  1V3F A;  4X6A J;  4Y7N J;  4I7H A;  4ZYG A;  3L2Q A;  5M5Y J;  2XAU A;  1R4N B;  4CYC B;  3D5S C;  3ZGK A;  5K5R A;  1ZK8 A;  2K40 A;  2W4S A;  3A0B C;  3QYB A;  4RMN A;  1F9N A;  3GTM J;  2BEO A;  2VT2 A;  3NWS A;  4GYG A;  3HPH A;  5FD6 A;  2HDC A;  4HF2 A;  1UCR A;  1SFK A;  1D1B A;  2FOK A;  3DWL E;  1HQC A;  1YO5 C;  5DM6 F;  1JTX A;  1P4X A;  1VQ5 I;  1XSX A;  1J75 A;  1WJF A;  3KEQ A;  5M3F J;  4H0E A;  3D5R C;  3OL3 A;  4ITV A;  2QVO A;  4A6E A;  2X6W A;  4BXX J;  3JRG A;  2QA4 I;  1S72 I;  1AKH A;  4HSR A;  4MTE A;  2OCC H;  1H89 C;  2LR8 A;  3FHN A;  2CH0 A;  2F5C A;  4Q4Z F;  1ZQ3 P;  2HNH A;  2H94 A;  2GXB A;  1I1G A;  3KPH A;  3G6E I;  2HYJ A;  1WGX A;  5HLG A;  1JKQ C;  3S14 J;  3DEE A;  3OYA A;  1Y0U A;  1ZRE A;  1WPK A;  2BY0 A;  2KZG A;  1O4X A;  1ZR4 A;  4F3Q A;  3WTY C;  3EUH A;  3BR3 A;  3E5X A;  1MH3 A;  3LQQ A;  1ZH5 A;  4W97 A;  3K70 C;  2M7A A;  1YHQ I;  4A5M A;  4M74 A;  1MBH A;  3HHH A;  1UHS A;  4RA2 A;  1RR8 C;  3ECH A;  4UV9 A;  1ZG1 A;  4AVP A;  1RUO A;  3TW6 A;  2OZ6 A;  2X4H A;  2W7N A;  3U1D A;  1LJ9 A;  4PGG A;  1DP7 P;  4XM3 A;  1FIA A;  4LG0 A;  4QLC U;  5K5O A;  3MCZ A;  5BPD A;  2QGU A;  4CGZ A;  3H36 A;  3HOU J;  4BJT A;  2KDZ A;  3QYE A;  4MTD A;  2O7O A;  5DUI A;  4ZDO A;  2K7L A;  3OSG A;  1O3Q A;  1YG2 A;  1XGM A;  5IY5 H;  2VON A;  2R7V A;  3CLQ A;  5IP7 J;  3K1M A;  2XIG A;  4MIM A;  5DV5 A;  2V1U A;  3LNQ A;  3TED A;  4ZZL A;  1K79 A;  4KMF A;  1G3W A;  2DA7 A;  3LSG A;  2WA0 A;  1TWF J;  4EJW A;  2KMU A;  1IRX A;  2W84 A;  4JX6 A;  2WWY A;  1SAU A;  3LSK A;  4BHB A;  1TWG J;  3H5N A;  2E35 A;  4BGD A;  2OUM A;  2EIJ H;  2J5P A;  3GME A;  2ECB A;  3FMR A;  3COA C;  1KU2 A;  3MN2 A;  1Y39 A;  1TTY A;  2FXA A;  1P4W A;  3OYE A;  1T8I A;  1PUF A;  3KE2 A;  1XX5 A;  5J1U A;  1IG7 A;  4IKF A;  1SD7 A;  2XGD A;  4HV6 A;  3D1N I;  3Q0U A;  3HM5 A;  1P92 A;  4BE0 A;  3ZPL A;  2BVL A;  2OPT A;  3KIO A;  1SVL A;  1X1P A;  3P7N A;  4B4C A;  2ZCW A;  1OCO H;  3L2W A;  2E2H J;  3DEW A;  3PUF A;  4BH9 A;  2ID6 A;  1WJ5 A;  3QU3 A;  2RAE A;  2DFF A;  3MZY A;  1Z91 A;  1V4R A;  1YJ9 I;  2XHK A;  4XLF A;  1UFM A;  2EFW A;  2GOX B;  5L3B A;  3WE2 A;  3JRI A;  1R5H A;  5J6X A;  3HIF A;  3I53 A;  3WTZ A;  1WCM J;  1DP3 A;  4ENJ A;  1PUE E;  1KYW A;  4D1Q A;  1T56 A;  2QF7 A;  1IF1 A;  1ZRF A;  3BT9 A;  2MYS A;  3LSM A;  2NOJ B;  2VQL A;  1MH4 A;  4IOA F;  2M30 A;  3MD2 A;  3GWZ A;  2HFH A;  5D5W B;  5K5Q A;  4N9I A;  1FC3 A;  1ZR2 A;  2OTL I;  4M9Z A;  1S29 A;  1IUF A;  3TDZ C;  3ZQL A;  3OV8 A;  4WCG A;  4EGZ A;  2KZV A;  1USS A;  2GAU A;  3D5L A;  1X4O A;  2BW3 B;  3LST A;  3RKY A;  1Z7U A;  1QRY A;  4CUG A;  1OR7 C;  1FMW A;  2OAZ A;  2FA5 A;  3H9Q A;  1HF0 A;  5H6R A;  4L9V A;  3ERE D;  4CCL A;  4Z2Y A;  3AG2 H;  3MZ8 A;  4PCQ A;  5IP9 J;  3CDH A;  3CMY A;  1J0R A;  3C2H A;  4LLN A;  5JLW A;  4LB6 B;  1W1W E;  4M9S A;  3AG4 H;  5HS7 A;  3BY6 A;  1I3A A;  1JUM A;  4PSW A;  5BNG A;  1HKQ A;  2OV7 A;  2UZK A;  2M0M A;  4ESB A;  4OWR B;  3QYF A;  2P7V B;  2MH9 A;  1GLN A;  3E7L A;  3FKI J;  1YX3 A;  1AHD P;  5D8K B;  3GTQ J;  5ICG A;  4II2 A;  4BJ6 C;  2LNB A;  3TO6 A;  2DT5 A;  3WTX C;  5D5V B;  1T08 B;  2HYF A;  2H27 A;  1UAA A;  5DCM B;  3Q9S A;  3OOU A;  3EUA A;  3BG7 A;  1LE8 B;  2C6Y A;  2P8T A;  4NQW A;  2FD5 A;  1GXQ A;  3JW4 A;  3R60 A;  2Z2S B;  2E34 A;  1O57 A;  1X3U A;  3KZI C;  4CH7 A;  2WY8 Q;  4XON A;  4RAZ A;  2KRF A;  2G0E A;  2BOL A;  1WJC A;  1U5T B;  2BE5 F;  2LF7 A;  3GTO J;  2VB6 A;  3RTR A;  1R9T J;  4Y3O A;  4DBQ A;  1LVA A;  1YLF A;  3OL4 A;  2JVG A;  3DLL F;  4I09 A;  1A6I A;  3M1E A;  2CYY A;  4UVC A;  2BHY A;  2MGQ A;  3TKY A;  1DU0 A;  4E7S A;  2XDV A;  4R8H A;  5CVU A;  4M3D A;  4R1H A;  1TWC J;  4LK0 F;  1ZKG A;  3L7W A;  3CMA I;  4YFN F;  2DXI A;  2VE8 A;  2JUC A;  3CQZ J;  3SFI A;  4AYB N;  1BC7 C;  2ZXJ A;  1GXP A;  1JT0 A;  3P9K A;  4YFX F;  3KYL A;  1CQT A;  2ME0 A;  2LF8 A;  1MMA A;  2L01 A;  3HOV J;  3T0Y A;  3ECO A;  2AHQ A;  3TL4 X;  5JVG F;  4XLA A;  5DDG A;  2VPR A;  5DEQ A;  3HOZ J;  4LFU A;  1SD5 A;  2HPI A;  1Y1W J;  3GW2 A;  1TLH B;  3QRF F;  2XF6 A;  5M5W J;  3DBR B;  2DT7 B;  2I8D A;  4DZJ A;  3DKW A;  2DYR H;  1STZ A;  4JP0 A;  4B44 A;  5CVJ A;  3FXR A;  1E3O C;  2XVC A;  3I4M J;  4PUS A;  1I6X A;  4OIR F;  3WHB A;  2Y30 A;  4BQN A;  5F0F A;  4A6D A;  1XB4 A;  4A3I J;  1FLI A;  2FRH A;  3PQK A;  3DXJ F;  2E5N A;  1T98 A;  4ZC3 A;  4C30 A;  3T1B A;  4CO8 A;  1R5G A;  2OCE A;  3M1C A;  2IA2 A;  3K0L A;  2H1K A;  3FXM A;  4RGU A;  5FFX A;  3UKG A;  3ML6 A;  2H6C A;  1FSH A;  2XKP A;  3VYT B;  4WXC A;  1I1S A;  1FOK A;  4HX8 A;  1ZN2 A;  2W85 A;  2K4J A;  3ISP A;  3KYD B;  1WVR A;  1XCV A;  5K7H A;  1YTY A;  3P5J A;  3OR2 C;  2B7E A;  4I02 A;  1G4D A;  2VBW A;  4XOT A;  5DCF A;  2XF5 A;  4DW6 A;  1F36 A;  3K4L A;  3S15 J;  4IO9 F;  3K7A J;  1S7E A;  4I98 B;  5DS9 A;  4ANJ A;  1R1T A;  2YU3 A;  3IAS 2;  1JI8 A;  2M0C A;  3F21 A;  4MQV A;  2ZBK A;  3KZY A;  1S6L A;  2BW3 A;  3OYL A;  2TRT A;  5J47 A;  1B6A A;  1CGP A;  1TNS A;  2GQQ A;  3MEX A;  4BE1 A;  4OAZ A;  4RB0 A;  4HV5 A;  4A0Z A;  3J7A O;  4F92 B;  5B5E C;  4FE7 A;  3MKY B;  4XQF A;  1IDY A;  3W2W A;  3EUK L;  4XNF A;  3PNV A;  2IW5 A;  2M3A A;  2ZFW A;  5LEK A;  4UVA A;  1V55 H;  5LEJ A;  4JQF A;  5D5X B;  3BQY A;  4XN0 A;  2V1D A;  3W6J B;  2LG4 A;  1BJZ A;  3KYC B;  1O7L A;  4IHY A;  3IL2 A;  3CCU I;  3S3M A;  4IX7 A;  2LYC A;  2MFZ A;  3ELK A;  1BR1 A;  3GCM A;  5DCM A;  1FMV A;  2R7S A;  3B73 A;  3ZXS A;  2OD5 A;  4JX5 A;  4ZYH A;  1SC7 A;  2K4B A;  3OSF A;  3O8H A;  2RVC A;  3S17 J;  1ERD A;  2ICW G;  2V9P A;  1WQ2 A;  1UHW A;  3AL0 C;  4RM3 A;  4E4H A;  2Z9O A;  1G3S A;  2DYS H;  1QGP A;  2LBF B;  4ETS A;  1Z0X A;  1U5T A;  1WWX A;  5GTH C;  2ZNY A;  4HG2 A;  2PG4 A;  1YJN I;  2M8E A;  1TBX A;  5C4X J;  1F1Z A;  2CO5 A;  5DD4 A;  2A61 A;  1FOW A;  2L9V A;  2QYO A;  3BTI A;  1HLV A;  3T8T A;  2FMY A;  3GTL J;  3JRB A;  4E7L A;  3G1L A;  1G2H A;  2G9W A;  2EB7 A;  1ZG5 A;  5ED4 A;  1B4A A;  2HDD A;  3O3K A;  3F9K A;  2BZT A;  3G3Z A;  3S3N A;  3DU5 A;  3C3W A;  1QU3 A;  4EJO A;  1TW3 A;  2NVT J;  1ETX A;  1Z77 A;  4B43 A;  4F7Z A;  4ZTF A;  2WY7 Q;  2F4I A;  1KA8 A;  2XAH A;  1J5Y A;  2NS7 A;  3I3L A;  5KAI C;  1O7F A;  3J7Y J;  5JVT A;  2GXA A;  1GVD A;  2EZL A;  3L9F A;  4NC7 A;  3P9I A;  3WOD F;  1ENH A;  4DOZ A;  1YE9 A;  3CP8 A;  1FYL A;  1LQ1 A;  3MMY B;  3QOP A;  3CUQ C;  2Y48 A;  1KZH A;  4BXF A;  4JOM A;  2VJI A;  4LLL A;  2EFN A;  3VSK A;  3PFI A;  5LHI A;  2XAF A;  1BN5 A;  3WTT C;  2O0Y A;  5E3O A;  2IPQ X;  2XGX A;  2R0Q C;  2IJL A;  3SYT A;  5B1B H;  4I99 C;  1JKO C;  3S8P A;  3FF5 A;  4YFK F;  1D3Y A;  2DOF A;  1R23 A;  2GIZ A;  4MFD A;  2BVM A;  1R1U A;  5CPR B;  2VBY A;  4GO1 A;  3BWG A;  3HYI A;  2R5Z B;  2FUG 2;  4IF4 A;  5E3L A;  1FBS A;  2LP0 A;  4RAF A;  1ZGA A;  3ZQ7 A;  1K4T A;  3BRO A;  2H1L A;  1HW1 A;  2QQ9 A;  3PIP F;  2A07 F;  4A3D J;  3GVA A;  4XLE A;  1R4M B;  1S3J A;  2G7U A;  5LHG A;  3VYU B;  5HVQ C;  5LLQ A;  4LK1 F;  5EG0 A;  1MNE A;  2RNJ A;  3BG9 A;  3E0J B;  3K1N A;  2HQR A;  4E7Z A;  5EJC A;  4KT6 A;  3FXU A;  4G7Z F;  1D8J A;  4V2F A;  2RNG A;  5ILU A;  3OYN A;  4C2T A;  5HS9 A;  2Q2E B;  4BYY A;  5FGM A;  4YRV A;  2F5V A;  5GAG J;  1LEA A;  4MQ9 F;  5L3D A;  3RPU D;  2DMU A;  5CKT A;  3OWT A;  2GWR A;  3JRA A;  2DA3 A;  1AA7 A;  1LNW A;  1PJR A;  1RNL A;  1SFX A;  3HPG A;  5FLM J;  3QU6 A;  3CDI A;  4N4O B;  4EJT A;  3JTG A;  3GFI A;  5GTI C;  2CGP A;  4D9J A;  2JA8 J;  1B8I B;  2ZB9 A;  5JFR A;  4A3K J;  1APL C;  1P6R A;  1ZAR A;  4A0Y A;  4ZZD A;  1LKX A;  2PQ8 A;  5HOD A;  2YPR A;  1TW2 A;  2DPU A;  2R7Z J;  1R58 A;  1E17 A;  4ZJZ A;  2ETH A;  3CC7 I;  2L02 A;  2VKD A;  3PNY A;  1FTT A;  4OMY A;  2COM A;  3M7G A;  2P5V A;  1ZAO A;  3HOY J;  2XGC A;  5KK1 A;  2CQK A;  4CCN A;  3OY9 A;  1JKR C;  4I0B A;  4DBR A;  3ABL H;  3K4C A;  3RPQ A;  1VQ8 I;  3REO A;  4E7K A;  4G8X A;  1BR4 A;  3JSP A;  4AD9 A;  5FKN A;  2DA1 A;  4KIT B;  1W36 D;  4QIW N;  1IN5 A;  3DTK A;  3ONQ A;  1Y6I A;  2PMZ A;  2L7M P;  1MMD A;  3CJN A;  1XPX A;  2PJP A;  3ZN1 A;  5FKM A;  1IXC A;  3ZMT A;  1IW7 F;  4KA4 A;  2LBF A;  4EJV A;  3N05 A;  2DQR A;  2EFO A;  1LDK B;  2B63 J;  4YEJ A;  4MHG A;  1P2F A;  3A01 A;  1H9G A;  2DDA A;  2WB1 N;  1VFC A;  5E79 C;  2MC3 A;  4M72 A;  3SQN A;  4HNU A;  4Y52 J;  4DZP A;  2DJI A;  1F43 A;  2GBY A;  3PJR A;  1LDJ A;  1J59 A;  1YIO A;  2IGK A;  2V6E A;  2DA5 A;  1Q1V A;  1WH5 A;  3J80 Z;  4S05 A;  4FCY A;  4CCK A;  2AQF A;  2JPC A;  3WHC A;  2LFB A;  2X9D A;  5J4Y A;  2Y31 A;  2HXI A;  4ZDL A;  3EYI A;  2JMW A;  2K5C A;  5EYR A;  4AC0 A;  3F6O A;  1P4A A;  1E0E A;  1B59 A;  2R7D A;  4E7I A;  5L3E A;  5F6F A;  3N97 A;  4IHW A;  2A68 F;  4YIF A;  1UJ8 A;  2FBH A;  1U78 A;  1D0Y A;  2ACJ A;  4YII A;  2VL8 A;  4YIR X;  1H8A C;  1Y1V J;  3WTW C;  1HST A;  2KIF A;  2E71 A;  2CU7 A;  3JCU C;  1E2X A;  1Z67 A;  1DGR M;  4IRG A;  1YOV B;  5DD8 A;  3OYM A;  1YI2 I;  4LB5 A;  1N78 A;  2NS0 A;  2L9N A;  2CQX A;  1LUJ B;  4C2M J;  4L18 B;  2HPM A;  2DMN A;  3O6B B;  3GLX A;  4ON0 A;  3UNG C;  3ZQQ A;  2ZME B;  3HL2 A;  3K2Z A;  1IDZ A;  1T0F C;  1HBX G;  3A2K A;  1NG7 A;  4II3 A;  2M4G A;  4HLX A;  4E6K G;  4I6Z A;  2FQ4 A;  5IYD J;  1UG2 A;  3HTU A;  1ETQ A;  2M7B A;  1QNT A;  1R00 A;  3HJE A;  3V8K A;  2WAQ A;  1TT0 A;  4ZYA A;  4XL9 A;  3GEZ A;  3CO6 C;  4B47 A;  4NB5 A;  4P96 A;  1RI7 A;  5GAD J;  3PL8 A;  2KJB A;  2Y0S A;  2PMZ N;  5LGU A;  4PK4 A;  3F22 A;  2HOT A;  1WI3 A;  4PFO A;  5B66 C;  2K86 A;  1RRJ A;  2EIN H;  2FF4 A;  3JRH A;  2B0L A;  4XID A;  2R5Z A;  1Z6R A;  5GAE J;  1MSE C;  1KYZ A;  5HDG A;  5F1R A;  1OIS A;  4AID A;  4RM2 A;  2JA5 J;  1PVE A;  2FJ1 A;  3C2B A;  3H3U A;  1W7P A;  3B02 A;  5FFZ A;  5GP9 A;  5E3M A;  1LB2 A;  4OOI A;  1I5Z A;  1Z7L A;  4LG3 A;  5IP6 A;  2A6H F;  2RGV A;  4CSW A;  3CMM A;  1J7K A;  2MLK A;  3I4N J;  3M8F A;  3H5R A;  3V7C A;  2VLA A;  2L7F P;  3S3O A;  3V7R A;  3DBH B;  2STW A;  2K3P A;  4BY1 J;  1SVM A;  1UG0 A;  2CV2 A;  1IC8 A;  3QPL A;  2HOA A;  4KJZ A;  2MAB A;  3OYB A;  2XPW A;  1BC8 C;  1JTY A;  2ESH A;  4HX7 A;  4KN4 X;  4GDF A;  2HOE A;  3KFW X;  3T5X A;  2O61 A;  3J80 K;  4IEJ A;  4HBL A;  2MLG A;  2JPB A;  2V26 A;  3ZMD A;  2HVR A;  4BL0 B;  2VOD A;  3S2D J;  3G1M A;  1V5G A;  2A05 A;  1BIA A;  2LRD A;  2ZSI B;  3VOE A;  2NVU B;  3MKL A;  3ZQG A;  4AIJ A;  2IS4 A;  4B1R A;  4HZF A;  3K69 A;  1K83 J;  3L1P A;  1QHG A;  3CCQ I;  4B09 A;  3OMY A;  1SAX A;  4FAS D;  2HTS A;  3ZP5 A;  3BZ6 A;  2K9S A;  2K85 A;  3CD6 I;  3GBG A;  2D45 A;  5KHD A;  4C9Y A;  4K2E A;  2EV0 A;  4D7N A;  2FE3 A;  2HYG D;  2O03 A;  3DKX A;  4IL6 C;  4PSX A;  5D8L B;  2JA6 J;  2JK3 A;  1JXS A;  3JSO A;  2BYV E;  4C3H J;  1D5V A;  2QUF A;  3W2V A;  3HUG A;  3Q0V A;  1XN7 A;  3M3Y J;  2EFP A;  4GFB A;  3V42 A;  1OR7 A;  3S2W A;  5ICC A;  1ZHF A;  1OCC H;  1WI9 A;  1K4S A;  5D6E A;  2HKO A;  1D5Y A;  3IH2 A;  5E17 F;  1W5T A;  2DQL A;  2XC7 A;  2JQ7 A;  5TIS C;  3PFY A;  4IQJ A;  3BZK A;  4XIC A;  2HQA A;  3FZV A;  5HLI A;  1WKM A;  4L5E A;  2CWE A;  3QOD A;  2NVQ J;  2O3F A;  5IYB J;  2IRF G;  2H8W A;  2XSD C;  3LAJ A;  2UUZ A;  4OIO F;  1SMT A;  4S0H B;  4A5N A;  4UV8 A;  1D0Z A;  2ZNZ A;  2LC2 A;  3QOE A;  1G59 A;  1YRN A;  2XB0 X;  3Q9V A;  1UHM A;  2QEX I;  1ZEL A;  1DPR A;  3CCE I;  5EF6 A;  1MDM B;  2CQ7 A;  2PMU A;  2LKP A;  5HLT A;  1XTA A;  2LSO A;  5GPA A;  3SFZ A;  3GTP J;  3I59 B;  3BR5 A;  1FYM A;  2E19 A;  5J8C A;  1OCR H;  2PMH A;  4AWX B;  1C0W A;  2CS3 A;  2JUG A;  3H9G A;  3LA7 A;  4RGS A;  1AOY A;  3S1R J;  3S1Q J;  1JJ6 C;  2RRE A;  4BDY A;  4R79 A;  1A35 A;  3AL0 B;  2I5U A;  3PO2 J;  4P55 A;  2EQR A;  3HRS A;  3RZO J;  4LD5 A;  2ISY A;  3LSH A;  1HA8 A;  1RUN A;  2CW8 A;  2IA0 A;  4A0X A;  4MFE A;  2Y9Z A;  1SEU A;  1O3T A;  4FE4 A;  4N9H A;  2VOP A;  4RGR A;  4CYC A;  2YX7 A;  3BQZ A;  1KON A;  2Z16 A;  2DA2 A;  2EIL H;  2OQG A;  1HKT A;  4IRH A;  3LSI A;  2XAG A;  4PDK A;  2R5Y B;  4PJL A;  2LKX A;  1MNM C;  2QKM B;  4CXF A;  4N4N B;  4RB3 C;  5BPI A;  4G6D A;  4A3E J;  3KP2 A;  2MA3 A;  1MZB A;  1YX5 A;  2DLL A;  1VQ6 I;  1PDN C;  1EH6 A;  2EIM H;  4LOC A;  1MW7 A;  4Y15 A;  1LPQ A;  3S16 J;  1HOM A;  1CF7 B;  2DU9 A;  4RDU A;  1X1D A;  3R61 A;  1BW5 A;  1POG A;  1T39 A;  3GFM A;  4U87 A;  3SHF A;  3LAP A;  4RBO A;  2XF7 A;  5JHU A;  2V6C A;  1DPU A;  3H35 A;  1EH8 A;  3A0H C;  4XLN F;  3PIO F;  1QVT A;  4QWQ A;  2KDO A;  1Z3X A;  1LVK A;  3E6B A;  2HZT A;  4LIT A;  3ASO H;  3CUQ B;  1IJW C;  3GTG J;  5EEA A;  2NOG A;  2W25 A;  3VEP A;  3CTA A;  3D0S A;  4LMY A;  3E5Q A;  4GYI A;  3BDD A;  3C7J A;  2ZME C;  3CLO A;  1GV5 A;  4PJJ A;  1FOX A;  4EJU A;  3GF2 A;  4ESJ A;  3M8J A;  4IHX A;  5LGT A;  1MBJ A;  2DK5 A;  2GA1 A;  1IXR C;  2CSO A;  3WGH A;  4KN7 X;  1K78 B;  1ZLJ A;  3HGG A;  2OC6 A;  4BHC A;  3RPU A;  3FDY A;  2F4O B;  3GTJ J;  3LSP A;  1UB9 A;  1VI0 A;  1R22 A;  1HDD C;  2QBY B;  1ONV A;  3CME I;  5HDK A;  2HVS A;  2MD5 A;  3PSI A;  2DAO A;  4V2G A;  3LMM A;  4S04 A;  2L4M A;  2ZXH A;  3SJM A;  3IP4 B;  3DKY A;  1RZ4 A;  3K70 D;  5JHF A;  3OS1 A;  3V7S A;  3JRC A;  4HX4 A;  3Q3S A;  2A6E F;  3HRM A;  1YW9 A;  5JI6 A;  3EDP A;  2NVX J;  3I9V 2;  2K9Q A;  3GTK J;  1YW7 A;  4L9T A;  2BY2 A;  3KLN A;  2LMD A;  4IVN A;  4ZYE A;  3RSN A;  3OYI A;  3K2A A;  2DA6 A;  2PN6 A;  1NH3 A;  5DYM A;  1XGS A;  1WSU A;  1SFU A;  2DO7 A;  2JWT A;  3ZQC A;  3W6V A;  4G7H F;  3FK7 A;  3DLA A;  2ZSH B;  4CZZ A;  3FHZ A;  4XRS A;  2XPU A;  4KMU X;  1BM9 A;  3S1M J;  1XC5 A;  3L2V A;  2FBI A;  3PQJ A;  3EET A;  2P81 A;  3GYH X;  4Q48 A;  3DF8 A;  3FBI B;  2VQH A;  4A93 J;  2CV0 A;  3VOD A;  1MBK A;  2IS6 A;  1W7P D;  2X1D A;  2QQB A;  2E1M C;  1S5L C;  2EWN A;  2R7F A;  3GLL A;  5BQT A;  3OYF A;  1DUX C;  3F0C A;  5D5U B;  4XOP A;  3NWT A;  1BI0 A;  1VF9 A;  2XRO A;  3JR9 A;  3AKZ A;  3IV5 A;  5HNF A;  3WU2 C;  2FNP A;  3CC2 I;  1MDM A;  2UXX A;  2NRA C;  4XKB A;  4A3C J;  1BR2 A;  2NS8 A;  4E70 A;  3IKT A;  3H3Z A;  3LOC A;  1OQY A;  2F5D A;  3EYY A;  3CJT B;  4OAY A;  5FJ8 J;  1FOY A;  2WV0 A;  3HKZ A;  5E1X A;  3HGY A;  5IT9 Z;  2JA2 A;  1L0O C;  2HVQ A;  3MKW B;  4MEX F;  3K4K A;  1KQ9 A;  3V8L A;  2JSC A;  1SD6 A;  5L3G A;  4CCJ A;  5IOZ A;  4XKC A;  2L4A A;  2VIX A;  3SZP A;  2DMP A;  2HXO A;  5C4J J;  4KIS A;  3C1D A;  1K6O A;  1VND A;  4TV7 A;  2KIM A;  4M6V A;  5E8I A;  1IN6 A;  2QEN A; 
#chains in the Genus database with same CATH homology
 1ZRD A;  2Z33 A;  3DFG A;  3EQL F;  5KVR A;  1YW8 A;  1CF7 A;  2MBF A;  4HDU A;  4RGX A;  1REP C;  4UVB A;  3QP5 A;  1S8N A;  2BV6 A;  1T2K A;  5J8F A;  4IJA A;  4OIN F;  5F64 A;  1XMK A;  3WGG A;  1IN8 A;  2HTJ A;  1FX7 A;  3HOS A;  3M8E A;  2FML A;  3MAJ A;  2HEO A;  4ENK A;  4OIQ F;  2HQN A;  1FP1 D;  2J5O A;  1S7A A;  4FX4 A;  4UXN A;  5CVR A;  3I4P A;  3IRQ A;  4ENN A;  2JT1 A;  2OBP A;  3HRU A;  2WC2 A;  4WX9 A;  1OMI A;  4EM0 B;  3CUO A;  2DPD A;  3MZH A;  3FMS A;  1JHF A;  3TO7 A;  4L5J A;  5IT9 K;  1G3T A;  2NNN A;  1O3S A;  4A2U A;  1JE8 A;  1ON1 A;  2Q8K A;  4AIH A;  5L3C A;  4G94 A;  2RQP A;  1KU3 A;  4ASN A;  3BPV A;  4JK1 X;  1ZYR F;  2E7X A;  1QBJ A;  1IN4 A;  5CVV A;  2P5L C;  5EEG A;  1FY7 A;  5CJ9 A;  2D1V A;  1H9T A;  2VN2 A;  3ZMU A;  3L2C A;  4A12 A;  2UWM A;  2QM3 A;  1SMY F;  5E20 A;  2EA2 A;  5H6Q A;  5JR3 A;  1HW2 A;  3KP7 A;  3MWM A;  2DK8 A;  2PFB A;  2QQA A;  1FNN A;  3F8F A;  3ZMV A;  4RS8 A;  4GGG A;  3K1P A;  2A69 F;  4BNC A;  4HW0 A;  2M45 A;  3MQ0 A;  2YX4 A;  2M87 A;  3VFZ A;  2H6B A;  3L09 A;  1Z1D A;  1Z6T A;  3FMQ A;  4KIC A;  2EK5 A;  1ZGJ A;  2O6G E;  1B1B A;  1TQP A;  1O3R A;  3BPX A;  2NAZ A;  2IP2 A;  4IHT A;  2EV6 A;  4WF2 A;  4XLP F;  3LA2 A;  4IHS A;  1MKM A;  3ABU A;  2BBY A;  2YSR A;  4DNC A;  3HOT A;  2K27 A;  4ENM A;  5DUK A;  3E3V A;  3FWE A;  2Y75 A;  3I0T A;  4HYE A;  3DQV C;  5FB2 A;  1AWC A;  3GFJ A;  4EV0 A;  4WXD A;  3V4G A;  4LJZ F;  3IHU A;  4GXO A;  3VB2 A;  2P6T A;  2E7W A;  2FSW A;  2H09 A;  1OKR A;  3IKV A;  4YG2 F;  1BI3 A;  5FLX Z;  1XCB A;  4L9J A;  1R36 A;  2JZY A;  3RYP A;  1B9M A;  2UXN A;  3U9G A;  2IT0 A;  2GA2 A;  1QZY A;  1KU9 A;  4KNY A;  2NNY A;  4RAY A;  4HDV A;  3KP5 A;  4O3M A;  3WU1 B;  2DBB A;  3I5U A;  1W4M A;  4EVI A;  5D6F A;  3RDI A;  2DW4 A;  2CG4 A;  3R6S A;  2STT A;  2ZO4 A;  2HWV A;  4I01 A;  3BJA A;  2V9V A;  1G3Y A;  1XGO A;  4IXA A;  1BIB A;  5HDN A;  4UHT A;  1S7O A;  1OYI A;  2PI0 A;  1BI1 A;  1KGS A;  3QAH A;  2TDX A;  4HQM A;  2RKH A;  1FWZ A;  4XRF A;  4FX0 A;  2VOO A;  5CYV A;  4EM1 A;  2VE9 A;  1IAW A;  3NRV A;  2Q2E A;  2VT3 A;  4MGR A;  1XDS A;  1BBY A;  3HSR A;  3IWZ A;  5FLX K;  1QQI A;  2JTV A;  3QP6 A;  4LGW A;  1KU7 A;  1IRG A;  3GZ6 A;  4D0P A;  3G73 A;  4KFC A;  5LHH A;  2Y0M A;  4KYW A;  3WE3 A;  1HSJ A;  1SFE A;  4M6X A;  1UST A;  4CYD A;  5ICE A;  3F6V A;  3DV8 A;  3ULQ B;  3F8M A;  4XBF A;  3ABT A;  4AIK A;  3RJP A;  3LA3 A;  2EFQ A;  4I0A A;  1TQM A;  4I2O A;  1GVJ A;  3BOQ A;  3V8J A;  4HF1 A;  1QZZ A;  5TRD A;  3ROU A;  5LRR A;  2XAJ A;  4Y13 A;  2PEX A;  1FPQ A;  4CIC A;  4GCV A;  1FZP B;  4CHU A;  2XRN A;  3KCC A;  2XKO A;  1XGN A;  2Q0O A;  3TQN A;  4HLY A;  4Q5S F;  1RIO H;  5E1Z B;  3HSE A;  4O6J A;  1FSE A;  1Z05 A;  1KQ8 A;  3DPT A;  1HW5 A;  2KIU A;  5L3F A;  2XUB A;  4EQQ A;  4ZH4 F;  2FNA A;  2ZME A;  2XAQ A;  4EM2 A;  3DP7 A;  1F5T A;  4NHJ A;  4IRI A;  3TOB A;  3WU0 A;  5H20 A;  4WK8 F;  2O8X A;  1YFH A;  5D4S A;  1MJB A;  1XSV A;  5AIQ A;  4LLG F;  2VBZ A;  3C18 A;  1U8R A;  2LDU A;  3WTV C;  2HR3 A;  5ICF A;  5ERI A;  2OQR A;  1QO0 D;  4L9N A;  2Z3Y A;  4FT8 A;  4KDP A;  2QWW A;  2E1C A;  3GO5 A;  3U2R A;  3FXQ A;  3DEU A;  4BQA A;  3N4M A;  2RV8 A;  3ZN0 A;  3F8C A;  5ILS A;  3E5U A;  3BP8 A;  2RN7 A;  1MGT A;  5LBQ A;  6PAX A;  1JHH A;  2M5W A;  2F5E A;  4M6Y A;  3RKW A;  3JAM Z;  1OPC A;  3KZZ A;  2V79 A;  1Q1H A;  4U0V A;  1HKS A;  3FM3 A;  1J9I A;  3JTH A;  1PP8 F;  1T38 A;  4M71 A;  2EJR A;  3LFK A;  4P5O A;  2IA1 A;  1LEB A;  5HLH A;  1D8K A;  5A2Q Z;  4P9F A;  3GFL A;  4IPA A;  1BJA A;  4KIG A;  3SXY A;  2HS5 A;  1XSD A;  2F5F A;  1U3E M;  2BGC A;  1ZLK A;  1ZG3 A;  4PGH A;  5CLS A;  4JBA A;  3HRT A;  1MJA A;  1ULY A;  2ADU A;  3R0A A;  5ILV A;  1WRJ A;  5LGN A;  3BJO A;  3R0J A;  1SD4 A;  2G7H A;  3ZMZ A;  2VC0 A;  4UNO A;  4WWC A;  3W6K B;  2VXZ A;  3OOP A;  4EGY A;  1QPM A;  3TDU C;  4Y17 A;  1NHA A;  3F8B A;  1VTN C;  2FQ3 A;  3FX3 A;  3LWF A;  1F4K A;  3BJ6 A;  4Q47 A;  5HS8 A;  3QPT A;  2P5K A;  3I59 A;  2HGC A;  4L5I A;  4L0Y B;  4G7O F;  1IUY A;  1ON2 A;  3F8N A;  3Q5F A;  2VC1 A;  3AAF A;  3RKX A;  3F72 A;  4RB1 A;  2W57 A;  3IC7 A;  3P9C A;  1XDU A;  2KKO A;  1H0M A;  5IT3 A;  4PZJ A;  3JAM K;  3K9T A;  4L0Z B;  3T8R A;  2XAS A;  1BOA A;  2A3S A;  5HOO A;  2D1H A;  2W24 A;  3TGN A;  3RYR A;  1FP2 A;  2QZ8 A;  2GZW A;  4OMZ A;  2P4W A;  2DI3 A;  3E97 A;  3IRR A;  3KP3 A;  1PP7 U;  2GIV A;  5A2Q K;  1KQ0 A;  2Z99 A;  2L54 A;  1JGS A;  1IRF A;  3E6C C;  4U0Y A;  1B9N A;  4OIP F;  5BS6 A;  3WGI A;  1Z9C A;  3GZ5 A;  1BI2 A;  1IZ1 A;  2ZKZ A;  3FM5 A;  3E6D A;  3CUQ A;  4B8X A;  1HXD A;  2AXL A;  3M9A A;  3H92 A;  3HHG A;  2EA4 A;  2VBX A;  4UUV A;  5AON A;  4G6Q A;  3ZMS A;  1K78 A;  3RI4 A;  1YS7 A;  1R7J A;  5E18 F;  2QBY A;  5EEH A;  4HF0 A;  3WTU C;  1MJ9 A;  2JRT A;  1YQA A;  2QLZ A;  4WXH A;  2E1N A;  3SZT A;  3KET A;  1XMA A;  4HOB A;  5BOX A;  1FT9 A;  3L00 A;  5D4R A;  2YR2 A;  3GUD A;  4KUM A;  3E6M A;  5TJJ A;  5FO5 A;  2CFX A;  4BHP A;  2ISZ A;  1EH7 A;  4OU0 A;  2P6S A;  1OYY A;  1IXS B;  1U6G A;  4P9U A;  2PBI A;  4M73 A;  2P7C B;  2DTR A;  4ZYD A;  3MFK A;  2FEZ A;  2HKX A;  3KP6 A;  2ELH A;  5FD5 A;  2OU2 A;  4KT5 C;  2MH2 A;  3GXO A;  4U7B A;  1FBU A;  1TNT A;  1LDD A;  2EV5 A;  3HTS B;  2OZU A;  4BXU A;  1OYW A;  1K7A A;  1U5T C;  3O2P E;  2DFI A;  2R3S A;  1EV7 A;  4CDG A;  2IVM A;  1GHC A;  3LQR A;  2V1X A;  2RDP A;  4U0W A;  5E8G A;  1W7P B;  2X0L A;  1FYK A;  3GX4 X;  3IWF A;  4G9Y A;  2D2W A;  5CVI A;  3HSF A;  2M1B A;  4O5V A;  4HAM A;  4MNU A;  1T6S A;  4KIB A;  1DDN A;  4HQE A;  3KP4 A;  4XSX F;  1G6N A;  3I71 A;  1ZRC A;  3I54 A;  2ZJ2 A;  1J2X A;  3KLO A;  3TO9 A;  5AIP A;  1I27 A;  3J81 Z;  3F23 A;  1T0F A;  5LRS A;  5BMZ A;  3WG9 A;  1TQI A;  4XSZ F;  2F2E A;  4U7D A;  4LG0 B;  4BAY A;  2CW0 F;  1W5S A;  3NQO A;  1A04 A;  4U88 A;  2WTE A;  2Z5U A;  2K02 A;  2GXG A;  5K1Y A;  3TOA A;  2XV4 S;  3RIR A;  1R1V A;  3F3X A;  4N0B A;  1XD7 A;  3WTS C;  3DPL C;  4HA8 A;  3I58 A;  2OA4 A;  3QPH A;  4RB2 C;  4EMS A;  1FBQ A;  2RC4 A;  2AS5 F;  1U2W A;  2L3D A;  1IN7 A;  1MD0 A;  2FU4 A;  3CO7 C;  4FHT A;  3NEU A;  1YYV A;  2KJC A;  4MEY F;  4DQ2 A;  4M9X A;  2NYX A;  2FBK A;  2ESN A;  5E1W A;  1ODD A;  3I64 A;  2A5Y B;  3R4K A;  3KEO A;  4KIF A;  1YS6 A;  3J81 K;  2PLY A;  1L3L A;  4ESF A;  1V3F A;  4I7H A;  4ZYG A;  5K5R A;  1F9N A;  2BEO A;  2VT2 A;  4GYG A;  5FD6 A;  2HDC A;  4HF2 A;  1UCR A;  2FOK A;  1HQC A;  1YO5 C;  1P4X A;  1XSX A;  1J75 A;  3KEQ A;  4H0E A;  2QVO A;  4A6E A;  4MTE A;  2F5C A;  4Q4Z F;  2H94 A;  2GXB A;  1I1G A;  5HLG A;  1Y0U A;  1ZRE A;  3WTY C;  3EUH A;  3E5X A;  3LQQ A;  1ZH5 A;  4A5M A;  4M74 A;  3HHH A;  3ECH A;  4UV9 A;  1ZG1 A;  4AVP A;  1RUO A;  2OZ6 A;  2X4H A;  3U1D A;  1LJ9 A;  4PGG A;  1DP7 P;  4CGZ A;  4LG0 A;  4QLC U;  5K5O A;  3MCZ A;  5BPD A;  4MTD A;  5DUI A;  2K7L A;  1O3Q A;  1YG2 A;  1XGM A;  2VON A;  3K1M A;  2XIG A;  2V1U A;  5DV5 A;  4ZZL A;  1K79 A;  4KMF A;  1G3W A;  4EJW A;  2W84 A;  2WWY A;  4BHB A;  2J5P A;  3FMR A;  3COA C;  1KU2 A;  1TTY A;  2FXA A;  1P4W A;  3KE2 A;  1SD7 A;  4HV6 A;  1P92 A;  3ZPL A;  3P7N A;  2ZCW A;  4BH9 A;  3QU3 A;  3MZY A;  1Z91 A;  1V4R A;  2XHK A;  1UFM A;  2EFW A;  5L3B A;  3WE2 A;  1R5H A;  5J6X A;  3HIF A;  3I53 A;  3WTZ A;  4ENJ A;  1PUE E;  1KYW A;  1IF1 A;  1ZRF A;  2M30 A;  3GWZ A;  2HFH A;  5D5W B;  5K5Q A;  4N9I A;  1FC3 A;  4M9Z A;  1S29 A;  3TDZ C;  3OV8 A;  4WCG A;  4EGZ A;  1USS A;  2GAU A;  3D5L A;  3LST A;  3RKY A;  1Z7U A;  2OAZ A;  2FA5 A;  5H6R A;  4L9V A;  3ERE D;  4Z2Y A;  4PCQ A;  3CDH A;  1J0R A;  4LLN A;  4LB6 B;  4M9S A;  5HS7 A;  3BY6 A;  1HKQ A;  2UZK A;  4ESB A;  2P7V B;  2MH9 A;  5D8K B;  5ICG A;  2LNB A;  3TO6 A;  2DT5 A;  3WTX C;  5D5V B;  2HYF A;  2H27 A;  5DCM B;  3Q9S A;  2C6Y A;  2P8T A;  4NQW A;  1GXQ A;  3JW4 A;  3R60 A;  1O57 A;  1X3U A;  4RAZ A;  2KRF A;  1U5T B;  2BE5 F;  2LF7 A;  3RTR A;  1LVA A;  1YLF A;  4I09 A;  3M1E A;  2CYY A;  4UVC A;  3TKY A;  4R8H A;  5CVU A;  4R1H A;  4LK0 F;  3L7W A;  4YFN F;  2VE8 A;  1BC7 C;  2ZXJ A;  1GXP A;  3P9K A;  4YFX F;  2LF8 A;  2L01 A;  3T0Y A;  3ECO A;  5DDG A;  5DEQ A;  4LFU A;  1SD5 A;  3GW2 A;  1TLH B;  3QRF F;  3DKW A;  1STZ A;  5CVJ A;  3FXR A;  2XVC A;  1I6X A;  4OIR F;  4A6D A;  1XB4 A;  1FLI A;  2FRH A;  3PQK A;  3DXJ F;  1T98 A;  4CO8 A;  3T1B A;  1R5G A;  2IA2 A;  3K0L A;  4RGU A;  5FFX A;  3ML6 A;  2H6C A;  1FSH A;  2XKP A;  4WXC A;  1I1S A;  1FOK A;  4HX8 A;  1ZN2 A;  2W85 A;  2K4J A;  3ISP A;  1XCV A;  1YTY A;  4I02 A;  1G4D A;  2VBW A;  5DCF A;  4I98 B;  1R1T A;  2YU3 A;  3F21 A;  4MQV A;  2ZBK A;  3KZY A;  1S6L A;  1B6A A;  1CGP A;  1TNS A;  2GQQ A;  3MEX A;  4RB0 A;  4HV5 A;  4A0Z A;  3J7A O;  2IW5 A;  2ZFW A;  5LEK A;  4UVA A;  5LEJ A;  4JQF A;  5D5X B;  2V1D A;  3W6J B;  1O7L A;  3IL2 A;  3ELK A;  5DCM A;  3B73 A;  2OD5 A;  4ZYH A;  2K4B A;  2RVC A;  1WQ2 A;  1UHW A;  2Z9O A;  1G3S A;  1QGP A;  4ETS A;  1U5T A;  1WWX A;  2ZNY A;  2PG4 A;  2M8E A;  1TBX A;  1F1Z A;  2CO5 A;  5DD4 A;  2A61 A;  2QYO A;  3T8T A;  2FMY A;  2G9W A;  2EB7 A;  1ZG5 A;  5ED4 A;  1B4A A;  3O3K A;  3G3Z A;  3C3W A;  4EJO A;  1TW3 A;  4F7Z A;  1KA8 A;  2XAH A;  1J5Y A;  1O7F A;  5JVT A;  3L9F A;  3P9I A;  3WOD F;  1FYL A;  1LQ1 A;  3QOP A;  3CUQ C;  2Y48 A;  4LLL A;  2EFN A;  3PFI A;  5LHI A;  2XAF A;  1BN5 A;  3WTT C;  2O0Y A;  2IPQ X;  2XGX A;  2IJL A;  3FF5 A;  4YFK F;  1D3Y A;  1R23 A;  1R1U A;  2VBY A;  4GO1 A;  3BWG A;  3HYI A;  4IF4 A;  1FBS A;  1ZGA A;  3ZQ7 A;  3BRO A;  1HW1 A;  2QQ9 A;  2A07 F;  3GVA A;  5LHG A;  1S3J A;  2G7U A;  5HVQ C;  5LLQ A;  4LK1 F;  2RNJ A;  3K1N A;  2HQR A;  3FXU A;  4G7Z F;  1D8J A;  5ILU A;  5HS9 A;  4BYY A;  5FGM A;  1LEA A;  4MQ9 F;  5L3D A;  2GWR A;  1LNW A;  1RNL A;  1SFX A;  3QU6 A;  4EJT A;  3JTG A;  3GFI A;  2CGP A;  5JFR A;  1P6R A;  1ZAR A;  4A0Y A;  4ZZD A;  2PQ8 A;  2YPR A;  1TW2 A;  2DPU A;  1R58 A;  1E17 A;  2ETH A;  2L02 A;  4OMY A;  2COM A;  3M7G A;  2P5V A;  1ZAO A;  5KK1 A;  2CQK A;  4I0B A;  3RPQ A;  3REO A;  4G8X A;  3JSP A;  4AD9 A;  1IN5 A;  3CJN A;  2PJP A;  3ZN1 A;  1IXC A;  3ZMT A;  1IW7 F;  4KA4 A;  4EJV A;  2DQR A;  2EFO A;  1LDK B;  4MHG A;  1P2F A;  1H9G A;  2MC3 A;  4M72 A;  3SQN A;  1LDJ A;  1J59 A;  1YIO A;  3J80 Z;  4S05 A;  2JPC A;  3EYI A;  3F6O A;  1P4A A;  1B59 A;  2R7D A;  3N97 A;  5L3E A;  5F6F A;  2A68 F;  4YIF A;  2FBH A;  1U78 A;  2ACJ A;  4YII A;  3WTW C;  1HST A;  2KIF A;  4IRG A;  5DD8 A;  1E2X A;  4LB5 A;  2NS0 A;  4L18 B;  3O6B B;  3GLX A;  4ON0 A;  2ZME B;  3K2Z A;  1HBX G;  4HLX A;  3HTU A;  1QNT A;  1R00 A;  3V8K A;  3CO6 C;  3GEZ A;  4NB5 A;  4P96 A;  1RI7 A;  2KJB A;  5LGU A;  3F22 A;  2K86 A;  2FF4 A;  2B0L A;  1Z6R A;  1KYZ A;  5HDG A;  5F1R A;  3H3U A;  1W7P A;  3B02 A;  5FFZ A;  1LB2 A;  4OOI A;  1I5Z A;  2A6H F;  2RGV A;  1J7K A;  2MLK A;  3M8F A;  3V7C A;  2STW A;  3V7R A;  1BC8 C;  2ESH A;  4HX7 A;  4KN4 X;  2HOE A;  3KFW X;  3T5X A;  2O61 A;  3J80 K;  4HBL A;  2MLG A;  2JPB A;  3ZMD A;  2VOD A;  1BIA A;  3VOE A;  4AIJ A;  4HZF A;  3K69 A;  4B09 A;  1SAX A;  2HTS A;  3ZP5 A;  3BZ6 A;  2D45 A;  4K2E A;  2EV0 A;  2FE3 A;  2HYG D;  2O03 A;  5D8L B;  1JXS A;  3JSO A;  2BYV E;  1D5V A;  2QUF A;  3HUG A;  1XN7 A;  2EFP A;  1OR7 A;  3S2W A;  5ICC A;  1ZHF A;  1WI9 A;  5D6E A;  2HKO A;  5E17 F;  1W5T A;  2DQL A;  3FZV A;  5HLI A;  1WKM A;  2CWE A;  2O3F A;  2IRF G;  3LAJ A;  4OIO F;  1SMT A;  4A5N A;  4UV8 A;  2ZNZ A;  3Q9V A;  1UHM A;  1DPR A;  1MDM B;  2PMU A;  2LKP A;  2LSO A;  3SFZ A;  3I59 B;  1FYM A;  5J8C A;  2PMH A;  4AWX B;  1C0W A;  3LA7 A;  4RGS A;  1AOY A;  4R79 A;  4P55 A;  3HRS A;  4LD5 A;  2ISY A;  1RUN A;  2IA0 A;  4A0X A;  1O3T A;  4N9H A;  2VOP A;  4RGR A;  2YX7 A;  2OQG A;  1HKT A;  4IRH A;  4PDK A;  2XAG A;  4CXF A;  4RB3 C;  5BPI A;  4G6D A;  3KP2 A;  2MA3 A;  1MZB A;  2DLL A;  1PDN C;  1EH6 A;  4Y15 A;  1CF7 B;  2DU9 A;  3R61 A;  1T39 A;  3GFM A;  3SHF A;  3LAP A;  5JHU A;  2V6C A;  1DPU A;  1EH8 A;  4XLN F;  4QWQ A;  3E6B A;  2HZT A;  3CUQ B;  2W25 A;  3VEP A;  3CTA A;  3D0S A;  4LMY A;  3E5Q A;  4GYI A;  3BDD A;  3C7J A;  3CLO A;  4EJU A;  3GF2 A;  4ESJ A;  5LGT A;  2DK5 A;  2GA1 A;  1IXR C;  2CSO A;  3WGH A;  4KN7 X;  1K78 B;  1ZLJ A;  4BHC A;  3RPU A;  1UB9 A;  1R22 A;  2QBY B;  1ONV A;  5HDK A;  2MD5 A;  2DAO A;  4S04 A;  2L4M A;  1RZ4 A;  3V7S A;  4HX4 A;  2A6E F;  3HRM A;  1YW9 A;  5JI6 A;  3EDP A;  1YW7 A;  4L9T A;  3KLN A;  4IVN A;  4ZYE A;  2PN6 A;  5DYM A;  1XGS A;  1WSU A;  1SFU A;  2DO7 A;  4G7H F;  4CZZ A;  3FHZ A;  4KMU X;  1BM9 A;  2FBI A;  3PQJ A;  3EET A;  3GYH X;  4Q48 A;  3DF8 A;  3VOD A;  1W7P D;  2QQB A;  2EWN A;  2R7F A;  5BQT A;  1DUX C;  5D5U B;  1BI0 A;  2XRO A;  2FNP A;  1MDM A;  2UXX A;  2NRA C;  4E70 A;  3IKT A;  3H3Z A;  2F5D A;  3EYY A;  2WV0 A;  5E1X A;  5IT9 Z;  1L0O C;  4MEX F;  1KQ9 A;  3V8L A;  2JSC A;  1SD6 A;  5L3G A;  2L4A A;  3SZP A;  3C1D A;  1K6O A;  4TV7 A;  2KIM A;  5E8I A;  1IN6 A;  2QEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...