2OBPA

Crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative DNA-binding protein (YP_298295.1) from Ralstonia eutropha JMP134 at 1.70 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 23
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2obpA00
1ZLKA 2PQ8A 2KKOA 3R4KA 2OA4A 1HW5A 3BOQA 3ZN0A 4N0BA 3BJAA 3FM3A 1I27A 3FMSA 4B8XA 2O03A 2KIUA 3IL2A 4KDPA 2H6CA 3T0YA 4U0YA 2FXAA 3K1MA 1W7PA 3FHZA 3WTTC 2Q8KA 5F1RA 4D0PA 4Q4ZF 2CO5A 1ZGAA 2QQBA 2EB7A 4LLGF 1MD0A 2K7LA 2VONA 2J5PA 2PFBA 4NHJA 3CUOA 4XSZF 5FFXA 3LAPA 1XGOA 3LAJA 1XSDA 3HRTA 3FXRA 3ZMDA 4U7BA 4Z2YA 3QPTA 4CYDA 1T38A 1CF7A 2DQLA 1FPQA 2EV6A 1G3SA 1ZYRF 3WTSC 3K2ZA 4HA8A 2G9WA 2LF8A 2W84A 4BHPA 2MA3A 2VBXA 4U88A 1R58A 1V4RA 1JXSA 3CDHA 4LMYA 3I53A 1Y0UA 3FXQA 4YG2F 1QZZA 1I1SA 2DBBA 2XRNA 2VOPA 3LFKA 4P55A 4MEXF 1QO0D 2K4BA 2MLKA 1DPRA 3ZMVA 1Z9CA 3D0SA 2JT1A 1G6NA 2JTVA 2E1CA 1BBYA 2L02A 4M72A 3IKVA 4L9VA 5D6EA 4A0YA 3TDZC 4K2EA 1KU3A 3M8FA 3BJ6A 2B0LA 3CUQB 2K4JA 4ESJA 1F9NA 4AWXB 5L3FA 5FB2A 3V4GA 1IW7F 3M9AA 1DDNA 5LGTA 4R79A 5HS8A 5LLQA 3ERED 4PGGA 4MQVA 3ZPLA 4EJVA 1FYKA 3RKYA 1D5VA 1YFHA 4UV8A 3P9IA 4OMYA 2RVCA 4LG0A 4RAYA 3WE2A 3ABTA 4Y13A 3C1DA 2CW0F 1W7PD 2V9VA 1R1VA 1XN7A 5CVVA 4RAZA 3SFZA 2EWNA 2LF7A 2XHKA 3TGNA 3T8TA 4EGYA 3KE2A 2XAJA 2JRTA 3LQRA 2QYOA 2UXNA 2FSWA 3M8EA 4EM2A 1ULYA 3QRFF 5L3CA 1TLHB 3DV8A 2BYVE 3CTAA 3QPHA 4MTDA 3GO5A 2EJRA 4DNCA 2UWMA 5HDKA 2O61A 4HV5A 5DCMA 4M9SA 5ICFA 4M9XA 2RKHA 3GVAA 5ICEA 1UCRA 5LGUA 5K5RA 2QM3A 4P9UA 1Z91A 1BM9A 4HF1A 1R22A 3FF5A 1J59A 1USTA 1FP1D 2MD5A 2OZUA 3GLXA 3T1BA 1K79A 3R0JA 1XGMA 2ZKZA 2A69F 1S7AA 4IRHA 1P4XA 5DEQA 1U6GA 3P9KA 3HOSA 1KQ8A 2DI3A 5L3GA 3BPXA 3WTWC 4WWCA 3KZYA 2CG4A 2XIGA 3QU3A 3F23A 1B9NA 4WXHA 1WSUA 2DLLA 3S2WA 4HAMA 2ISYA 2ELHA 4KIBA 1EH8A 1HKSA 1XSVA 3E6MA 4OIOF 4KMFA 2KIMA 1UFMA 3EQLF 3NRVA 1SMYF 1U5TB 4FX0A 2QENA 3DPLC 1KYWA 2K02A 4M74A 4N9HA 4WXDA 3KP3A 2IA0A 2COMA 2H09A 1YS7A 5HLIA 3CUQC 1WRJA 1WWXA 4IRIA 4HV6A 2YR2A 3GEZA 4GGGA 2GQQA 3GF2A 1HSTA 1BJAA 3U1DA 5L3BA 1S29A 1P2FA 1XD7A 2NYXA 4KIGA 2JPBA 3W6KB 3BP8A 2H6BA 3M7GA 3EYYA 1E2XA 4ETSA 2JZYA 2XGXA 1I5ZA 2GZWA 3T8RA 1WI9A 4EM1A 5E18F 1TQIA 2E7WA 2IRFG 3FMRA 3WG9A 2A3SA 2LDUA 4OIPF 1IF1A 1BI1A 5AONA 3EYIA 2Z9OA 2FNPA 3DFGA 3TO9A 4LB6B 2IA2A 1HQCA 3P9CA 1FY7A 3OOPA 1YLFA 1GHCA 1ZRCA 3GFLA 3E3VA 1T2KA 3GW2A 1BI0A 2P6TA 3L9FA 1U2WA 1V3FA 1ZHFA 5IT9K 2HYGD 4ENMA 4RB2C 4IHSA 3E5XA 2VE9A 1Z7UA 2M5WA 2MH9A 3BDDA 4EJUA 1GXPA 2GXBA 2EA4A 2IVMA 1B6AA 3JAMZ 1K78A 1Q1HA 4I98B 3FM5A 3HIFA 5E17F 4UVCA 1FBSA 3WTVC 1EH6A 1WQ2A 4AIHA 1IN6A 4G94A 5ERIA 5D8KB 5H6QA 1HKTA 1R5HA 1LQ1A 4R1HA 2ZBKA 4ASNA 1AWCA 1SMTA 2VT2A 1KA8A 2VOOA 3RTRA 4QLCU 2P7VB 2RN7A 4OIRF 5E8GA 5TJJA 1IN4A 1WKMA 2GA1A 1FOKA 1IZ1A 3HRSA 2ZNYA 3U9GA 3O2PE 3E97A 3MQ0A 2IP2A 1T0FA 2LKPA 1PP8F 4KUMA 4Q47A 1U8RA 2F5EA 4CZZA 3BZ6A 5JFRA 2LNBA 5FD5A 2VBYA 1XCVA 1G4DA 3PQJA 4ENJA 3N97A 2M45A 2V6CA 2DPUA 2FMLA 5LHHA 3P7NA 3FX3A 2FNAA 1O3QA 3BWGA 1UHMA 4BNCA 3E5QA 3HOTA 2OQGA 3ZP5A 4Q5SF 3C7JA 4IJAA 3Q9VA 5EEHA 1P4AA 2EFNA 1OR7A 3IWFA 2CFXA 4CGZA 3LWFA 1TW2A 3EETA 3GZ5A 1S6LA 2Z3YA 2W57A 1ZLJA 4RGXA 2O3FA 5HVQC 3VB2A 4ZYDA 4EVIA 2XKOA 2QLZA 4AVPA 4OU0A 2L54A 4ZZLA 1YW7A 2Z33A 2DO7A 3K9TA 3I58A 4IPAA 2MC3A 5FFZA 5LGNA 2FRHA 1OYIA 1NHAA 3W6JB 3I0TA 2BV6A 4G8XA 2EV5A 4IXAA 5BMZA 2M1BA 1REPC 2P7CB 1USSA 4ESFA 3TO7A 4FX4A 2M8EA 4U0VA 1U5TC 1J0RA 5DYMA 3KP4A 5H20A 2ADUA 4BAYA 1YYVA 3BPVA 4WK8F 1Z6RA 2HQRA 5D8LB 2HGCA 4XLPF 1RNLA 2JPCA 5HS9A 2D45A 1MDMA 1MKMA 1FBQA 1SFEA 2XAHA 2DFIA 2QZ8A 1FWZA 3IKTA 2XV4S 5CLSA 2H27A 2VC0A 4HOBA 3I5UA 3L2CA 2QBYA 3Q5FA 5JR3A 5E1ZB 4CHUA 4JQFA 1K78B 1XMAA 3DPTA 5DUIA 1BI3A 1SFXA 4IF4A 5A2QK 1SD6A 3ABUA 3LSTA 1JHFA 5D5UB 5DCMB 1SD7A 2HTJA 2QQ9A 3F21A 3R6SA 5E1WA 2WWYA 3I59B 3HSFA 5K1YA 3R60A 4BYYA 1ZH5A 1FLIA 3GFJA 5F64A 2XAQA 1R5GA 3KETA 2E7XA 3B73A 1ZGJA 3I59A 4HYEA 3V8JA 1OKRA 1W7PB 2DTRA 4G6QA 2DQRA 3KP7A 3JSPA 1KYZA 2OAZA 2P4WA 3WGHA 5AIQA 3KEQA 1TNTA 3C18A 2DK5A 5JHUA 1ON1A 4MGRA 2XROA 2O0YA 3RKWA 5BS6A 2V1DA 1XCBA 1ZARA 3GWZA 3ECOA 3R61A 2HOEA 3F8FA 1YTYA 1TQPA 3F8MA 5D4SA 1IAWA 3DXJF 3TOBA 1JE8A 2RC4A 4LFUA 5KVRA 1F4KA 1RI7A 2BE5F 3RKXA 2L4MA 1YO5C 4QWQA 2FU4A 3T5XA 1QZYA 3KP2A 4I09A 5E20A 1FNNA 1T6SA 1IUYA 1ZG5A 3QOPA 2F2EA 4KYWA 1MJBA 4HBLA 1YW8A 5AIPA 5HLHA 1K7AA 1X3UA 4PGHA 4GYGA 4O3MA 3HYIA 1YG2A 3CLOA 4G9YA 2RV8A 3E6CC 4CDGA 4CXFA 2GAUA 3VODA 3BROA 2MH2A 1KQ0A 3KZZA 2YX4A 2YU3A 4S04A 5JVTA 2G7UA 4YFKF 2STTA 1RIOH 1Z05A 2GXGA 1R1UA 1ON2A 1TTYA 2PG4A 3ZMZA 3RYPA 1G3YA 3HTSB 4I01A 2VT3A 4O5VA 1ONVA 2OD5A 2EFOA 4NB5A 6PAXA 1OPCA 4LK0F 1S3JA 5HLGA 3NQOA 4OMZA 3GFMA 4L0ZB 4P96A 1S7OA 2V1UA 5KK1A 3HUGA 4ZH4F 4EGZA 4RS8A 1ZG1A 5L3EA 4OINF 1MJ9A 2PMUA 2ESHA 4L18B 4MTEA 3H3ZA 4HF0A 4MHGA 1FP2A 4BHBA 4YFNF 1STZA 1LDKB 3G3ZA 3FZVA 4I0AA 4ZYEA 1FC3A 3V8KA 4BXUA 1I6XA 2NAZA 1W4MA 2D1VA 5H6RA 2X4HA 1IRFA 2O6GE 1IN5A 4KT5C 3TO6A 3MWMA 1J5YA 1J9IA 5IT3A 4M9ZA 4ZZDA 4HDUA 1IRGA 3V7CA 1DP7P 5FO5A 4EJTA 1MGTA 1LEAA 4L5JA 1TW3A 4L9JA 5HDGA 3J80Z 5FLXZ 1BC7C 4LLNA 2L3DA 3HSRA 2ESNA 1D8KA 5J8CA 1A04A 2LSOA 2HFHA 3V8LA 1D8JA 4HX7A 3DKWA 2FEZA 2DK8A 5LHIA 3ZQ7A 3QAHA 4PCQA 1SD4A 2QQAA 1HSJA 3SQNA 2D1HA 4OIQF 5D5XB 3JAMK 2BGCA 3RJPA 1F1ZA 3OV8A 1MZBA 1FYLA 2RNJA 4YIFA 2F5CA 1IN8A 3D5LA 2R7FA 3CJNA 1ZREA 5J8FA 1RUOA 3ZMTA 3J80K 2PLYA 1BIAA 4LGWA 3E5UA 2A07F 2H94A 4FT8A 1FYMA 3IC7A 2VXZA 4A5MA 5HS7A 1LJ9A 5L3DA 5D5VB 3KP5A 4AIKA 2A61A 2E1NA 2OQRA 3Q9SA 3JTHA 3F72A 4UNOA 2MLGA 3M1EA 2BBYA 1R1TA 4WX9A 2IT0A 1ZG3A 1R7JA 2ZNZA 5ICCA 3K1NA 2A6HF 2ZMEA 2Y48A 4A5NA 4CO8A 3WU1B 4G7ZF 4N9IA 4DQ2A 4I02A 3RYRA 3RDIA 1G3TA 4UVBA 5CVUA 3CO6C 2ZJ2A 2FBIA 3FMQA 3F8CA 1LNWA 2FBHA 2HDCA 3MAJA 4EJOA 3BJOA 4UVAA 1TNSA 3GUDA 5BPDA 2J5OA 2HEOA 3B02A 1DPUA 5K5OA 4I0BA 3J81Z 3J7AO 1MJAA 1SD5A 2OU2A 3DF8A 3MFKA 5FGMA 1JHHA 4KA4A 1HXDA 1SAXA 3BY6A 5BOXA 3H3UA 3TDUC 3IWZA 4EMSA 2JSCA 2HZTA 2K27A 4RGSA 3GX4X 3GZ6A 5ILSA 1TQMA 3SXYA 3K69A 1I1GA 5ICGA 4KNYA 4IRGA 2V1XA 3O6BB 1B4AA 2DAOA 4RB0A 1XMKA 3R0AA 2F5FA 1LVAA 4M73A 1XGNA 3F6OA 3V7RA 2W25A 3IRQA 1MDMB 1PDNC 1R23A 2OZ6A 3C3WA 1T39A 1B59A 4FHTA 4AIJA 1BN5A 5DDGA 1DUXC 4XRFA 3I64A 4UXNA 4HW0A 4L9NA 3F8NA 2QBYB 5FLXK 3AAFA 2XVCA 5DD8A 4OOIA 3FWEA 3QU6A 3TOAA 3ELKA 3F6VA 3HSEA 2STWA 1L0OC 4P9FA 4LD5A 3DP7A 1RUNA 2IPQX 3HHGA 4KN4X 3CO7C 3FXUA 3N4MA 5CJ9A 2XUBA 4GCVA 4I7HA 3LA2A 3L09A 2PN6A 1XSXA 2FMYA 2P5LC 4ON0A 2FOKA 1G3WA 1FBUA 1HW1A 3WODF 3NEUA 2Z5UA 2OBPA 4MEYF 1J7KA 1J2XA 1Z1DA 2YSRA 3QP6A 2UZKA 3WE3A 1EH7A 2DT5A 3ZMSA 2WC2A 2HS5A 1KGSA 4HQMA 4UHTA 4RB1A 5LRRA 2FA5A 4GXOA 2Z99A 1OYWA 1QNTA 5DCFA 5JI6A 5DD4A 4A6DA 1FSHA 1BC8C 3IHUA 2QVOA 1QQIA 4M71A 4KIFA 4M6YA 4JK1X 4GO1A 2RGVA 3WGGA 3RPQA 2W24A 2HWVA 1EV7A 2NNNA 1U3EM 2CGPA 1YQAA 4EM0B 1B1BA 1BOAA 2VE8A 3QP5A 1O3SA 2P8TA 1YS6A 4KICA 3L7WA 3HRMA 1F5TA 4ZYGA 2P6SA 3F3XA 1PP7U 3DQVC 5D4RA 2L01A 4KFCA 1CF7B 1FZPB 2PMHA 1GXQA 4ESBA 2R3SA 3KCCA 3SZTA 3KLNA 1R36A 3WTXC 3KLOA 2ETHA 2O8XA 1TBXA 3VOEA 2TDXA 4YIIA 4M6XA 2HTSA 1O7LA 3TKYA 4WCGA 4NQWA 2FBKA 2DW4A 2IJLA 3ZN1A 5D5WB 1Z6TA 1QPMA 5TRDA 1T98A 5DV5A 4BH9A 1ZRDA 5E1XA 2M30A 1ODDA 3WU0A 2YX7A 4IVNA 3TQNA 5CYVA 3LQQA 2AS5F 2PEXA 1LEBA 2HQNA 2EK5A 1R00A 2KIFA 4E70A 4CICA 3HRUA 5D6FA 1H9GA 2RQPA 1IXRC 2V79A 2ZFWA 4IHTA 1QBJA 2VBZA 1KU9A 4HX8A 3MZHA 2HYFA 4XSXF 1LDJA 3REOA 1FT9A 1UB9A 1FX7A 2XASA 3DEUA 4ZYHA 4G7HF 4UV9A 5K5QA 1KQ9A 2ZO4A 3F22A 3I4PA 2XAFA 4LG0B 3RIRA 3J81K 2FE3A 3E6DA 5A2QZ 2KJBA 4KMUX 1LDDA 4PZJA 5E8IA 4HLXA 4P5OA 3G73A 2HKOA 2ZCWA 4F7ZA 5LBQA 2R7DA 4TV7A 4B09A 3KP6A 5EEGA 4UUVA 3WTZA 1O7FA 3RI4A 5ILUA 4H0EA 2A6EF 1RZ4A 5BPIA 4WXCA 4LJZF 4A2UA 3V7SA 1OYYA 2NS0A 2ACJA 2Q0OA 2KJCA 2NRAC 4HDVA 2WV0A 4Y17A 2G7HA 3IRRA 3PFIA 2L4AA 2PBIA 4KN7X 3ECHA 2Y75A 4HZFA 1S8NA 3K0LA 1J75A 2ISZA 4U7DA 5BQTA 3GFIA 4JBAA 2VODA 2FQ3A 1P92A 1O3TA 3RPUA 5F6FA 2M87A 3LA3A 2A5YB 4G6DA 2VC1A 1YIOA 4LK1F 1IXCA 4EJWA 1H0MA 1XDUA 2CQKA 2IW5A 2VBWA 2F5DA 2GWRA 2RDPA 4A12A 2BEOA 4U0WA 4AD9A 3K1PA 5CVIA 2HR3A 1O3RA 5CVRA 5DUKA 3HHHA 5LRSA 1VTNC 1IN7A 3MZYA 5HOOA 4YFXF 1U5TA 4G7OF 4L0YB 4BHCA 2PI0A 4Q48A 2PJPA 1B9MA 2CYYA 2X0LA 1ZRFA 4ENKA 4A6EA 3KEOA 1YW9A 3VEPA 4GYIA 5LHGA 2D2WA 2A68F 2MBFA 2Y0MA 4RGUA 4HF2A 3H92A 2EFQA 2UXXA 2KRFA 1W5TA 1AOYA 1O57A 4LLLA 2C6YA 1QGPA 2DPDA 3JW4A 1U78A 3L00A 1BI2A 5ED4A 2EFPA 3GXOA 1W5SA 4S05A 1KU7A 2NNYA 2P5VA 1ZAOA 5LEJA 3SHFA 2AXLA 2VN2A 1XDSA 2YPRA 4HQEA 4A0ZA 4HX4A 4R8HA 4BQAA 2XAGA 4EQQA 5HDNA 4ENNA 4LB5A 3O3KA 3MCZA 1HW2A 2EA2A 2WTEA 3GYHX 3ML6A 2QUFA 3PQKA 2CSOA 1OMIA 2CWEA 1KU2A 1JGSA 1P6RA 3ISPA 1FSEA 1HKQA 1XGSA 4A0XA 3LA7A 5LEKA 3ROUA 3I54A 2K86A 3VFZA 5IT9Z 3WTUC 2ZMEB 3ZMUA 2QWWA 1C0WA 1K6OA 2HKXA 3SZPA 1XB4A 2GIVA 4EV0A 4I2OA 3EDPA 3E6BA 4L5IA 5CVJA 2DU9A 4PDKA 5FD6A 1UHWA 2EV0A 4MNUA 1ZN2A 2Q2EA 4O6JA 3EUHA 1D3YA 3ULQB 4XBFA 1E17A 4XLNF 1L3LA 2EFWA 1CGPA 3I71A 1H9TA 4RGRA 2IA1A 1GVJA 3JTGA 4L9TA 3CUQA 1LB2A 1PUEE 3COAC 4MQ9F 5J6XA 2ZXJA 3MEXA 1IXSB 3WGIA 2P5KA 2GA2A 5ILVA 2FF4A 3JSOA 3WTYC 1BIBA 3HTUA 4WF2A 4RB3C 3F8BA 4Y15A 1HBXG 1P4WA 3KFWX 4HLYA 2W85A 3U2RA 2XKPA 1SFUA
chains in the Genus database with same CATH superfamily
1ZLKA 2PQ8A 1RR7A 2KKOA 3CESA 3R4KA 2K3PA 3BTLA 2OA4A 1HW5A 5DTDA 3BOQA 3K4BA 3ZN0A 4IX7A 3G6EI 3BLYA 2VJJA 4N0BA 3BJAA 3FM3A 1I27A 3FMSA 5GAGJ 2MSYA 2VXDA 1T33A 3OYMA 4B8XA 4CSWA 4KITB 2IBDA 2XB5A 3MVPA 1MBGA 4M3GA 2O03A 5EZHA 2KIUA 3IL2A 3KEYA 4KDPA 2H8RA 1GLNA 2H6CA 3T0YA 1T08B 4U0YA 2FXAA 3K1MA 1W7PA 3FHZA 2X6XA 1CQTA 2K9MA 4BQOA 3WTTC 2WB1N 2Q8KA 5F1RA 4D0PA 1FMWA 4Q4ZF 3S3NA 5FLMJ 2MW8A 4E7SA 3JRIA 2CO5A 1ZGAA 3OYEA 2QQBA 2EB7A 2XPUA 3KX2A 4LLGF 1MD0A 2K7LA 3BCAA 4FE7A 1W36D 4YIRX 1TP4A 2VONA 3F9KA 2EQRA 2J5PA 2PFBA 4DOZA 4NHJA 1X3ZB 2LKSA 1QHHD 3CUOA 4XSZF 5FFXA 3LAPA 1XGOA 1IRXA 4QSHA 3LAJA 3HRTA 1XSDA 3FXRA 3ONQA 3ZMDA 4U7BA 4J19A 4Z2YA 3FHNA 3QPTA 4CYDA 1T38A 1CF7A 3H9GA 5EYRA 4CYCB 1A5JA 2DQLA 1FPQA 2EV6A 1G3SA 3U21A 1K4SA 1MSEC 5FRNA 2PJRA 1V55H 2DOAA 2O7OA 1K6YA 5J4YA 4A3IJ 1BR2A 1ZYRF 4XLCA 3C2HA 3WTSC 3K2ZA 4HA8A 2G9WA 2LF8A 2W84A 2X85A 1D0ZA 3BG6A 1K83J 1YX3A 4BHPA 1SC7A 2MA3A 2VBXA 3FBIB 4U88A 1R58A 3OYGA 1V4RA 1JXSA 3CDHA 4LMYA 5C4XJ 5IYDJ 3I53A 1W0TA 2CW8A 1WCMJ 1Y0UA 3FXQA 4YG2F 3BR2A 1QZZA 1I1SA 2DBBA 2XRNA 4BJTA 2VOPA 4HSTA 4II2A 1VQ5I 3Q0VA 3CCEI 2DDAA 4II3A 2LH9A 3LFKA 4P55A 4XLFA 4MEXF 2KL4A 1A36A 4W1UA 1QO0D 2LOOA 1UELB 2K4BA 3DU6A 1TWCJ 3K4CA 2MLKA 1DPRA 3ZMVA 4FE4A 2L7MP 1Z9CA 2X6OA 5K7FA 3D0SA 2JT1A 3CJRB 2OTLI 2WA0A 1G6NA 3SZGA 2JTVA 3KYLA 2E1CA 1BBYA 1ENHA 2VJ5A 1JJ8C 2L02A 4M72A 3IKVA 2YUSA 4L9VA 5D6EA 4A0YA 2HXOA 3H5NA 2VQGA 1Z3YA 3TDZC 1VQ4I 4K2EA 5GTHC 4KT6A 3HOVJ 2R7WA 2DA4A 1KU3A 1W1WE 3BJ6A 3M8FA 4A3EJ 2B0LA 2VIXA 3CUQB 1H89C 2ZXIA 2XSJC 2K4JA 3K6GA 1F9NA 4AWXB 5L3FA 4ESJA 2O5RA 1YRNB 2CMPA 1U9OA 5FB2A 3V4GA 1IW7F 3DEEA 3MKWB 2VPLA 5B5EC 4A3CJ 3M9AA 4HEA2 1DDNA 5LGTA 1TL8A 1E0EA 3VYTB 4HNVA 5EF6A 3SDGA 2A05A 3ZQFA 4R79A 4C9YA 1OCRH 4BEHA 5HS8A 1BR1A 5LLQA 2K9QA 3ERED 4PGGA 1DU0A 2LY9A 4MQVA 1BW5A 3ASOH 3BTCA 5K7ZA 1H8AC 3ZPLA 1XMXA 3CDIA 2BW3B 2M7AA 3FXKA 4DYQA 4EJVA 1FYKA 3RKYA 5E79C 1D5VA 1YFHA 4UV8A 3P9IA 4OMYA 2RVCA 4RAFA 4LG0A 4RAYA 3WE2A 2DCEA 4BGDA 5J3LA 3ABTA 3VSKA 4Y13A 3PM1A 2OF7A 4DJAA 5J1YA 2JA2A 2E35A 3C1DA 4KJZA 4XICA 3A1YA 2M3AA 2IGKA 2Y31A 4B3AA 2CW0F 1RR8C 1W7PD 2V9VA 4DZPA 1R1VA 1UMQA 1XN7A 5F0CA 3CLQA 5CVVA 1OCPA 4PJLA 4RAZA 4BE1A 2IS4A 4X0GA 3S1QJ 1V5FA 2WBMA 3SFZA 2EWNA 2LF7A 3JRFA 1MBEA 2XHKA 1ZK8A 3TGNA 2KZGA 3T8TA 4LG3A 4EGYA 3NARA 3KE2A 2XAJA 2UUZA 2E2IJ 2JRTA 1IV8A 2EZLA 2JWTA 3LQRA 2QYOA 2V7FA 4E7JA 2UXNA 2FSWA 2K5CA 3M8EA 3D1NI 3GTKJ 4EM2A 3N05A 1ULYA 3X2QH 3QRFF 4F52A 2WB1A 3CJTB 5L3CA 2KISA 1RESA 4HNTA 5FKKA 1TLHB 3DV8A 3L2VA 2FJ1A 3GLLA 2FQ4A 3HOWJ 2BYVE 2EIJH 2CFOA 4CCMA 3CTAA 1JKQC 1LUJB 3BR1A 1VZ0A 3QPHA 4MTDA 3GO5A 2EJRA 2HU9A 4DNCA 3OS1A 2UWMA 3E1SA 4IOCF 5HDKA 4A3JJ 2O61A 4HV5A 1D1BA 5DCMA 4M9SA 5ICFA 1FOXA 3HL2A 4M9XA 5IOZA 2RKHA 3GVAA 5ICEA 3CCVI 1UCRA 4XKVA 5LGUA 2JUGA 5K5RA 1MH4A 3BG5A 2QM3A 3VPRA 3K4MA 4P9UA 3EUKL 3AL0C 1Z91A 1BM9A 3A0BC 5IY5H 1R22A 1RPWA 4HF1A 3FF5A 4XN3A 2AXTC 3CCJI 1USTA 2DODA 1J59A 1FP1D 2MD5A 2OZUA 3GLXA 3GTPJ 3BTJA 1J09A 3T1BA 3O8HA 1K79A 1VQ8I 3DKYA 1R5ID 1XC5A 3R0JA 1XGMA 2ZKZA 5FROA 2Y0SA 2A69F 4RM3A 4DGWB 4E7KA 5FLVA 1IC8A 2MYSA 1S7AA 3MMYB 4UB6C 3HPGA 4IRHA 1P4XA 2O8KA 5DEQA 1U6GA 5JLXA 3P9KA 5GTIC 3HOSA 1KQ8A 2DI3A 1BJZA 5L3GA 3HGYA 2WAFA 1ZR2A 4F91B 3BPXA 5J1UA 3WTWC 4WWCA 2XAUA 3KZYA 2CG4A 2XIGA 4D5FA 1G8XA 3I4MJ 3QU3A 3F23A 3GMEA 1MSFC 1B9NA 4WXHA 1NK3P 1WSUA 3BG3A 4CUGA 2DLLA 2WADA 3S2WA 1Z67A 1EJ9A 4HAMA 2ISYA 2ELHA 4KIBA 1EH8A 1ZKGA 2CV0A 1WJCA 1HKSA 2JMWA 1XSVA 3E6MA 3BQZA 1W0UA 2IGNA 4OIOF 1Z0XA 4KMFA 2KIMA 1UFMA 3EQLF 4YELA 2E5NA 3NRVA 1SMYF 1U5TB 2D5VA 1NH3A 3NWSA 2LBFA 1WJ5A 4FX0A 2QENA 3DBLB 2EIMH 2XSDC 1LFUP 4A93J 3DPLC 1JKPC 1VF9A 1KYWA 2K02A 1EKEA 4M74A 4N9HA 4WXDA 2GIZA 3KP3A 2KDZA 1VQLI 2IA0A 2COMA 2H09A 4LIVA 1YS7A 5HLIA 3CUQC 5J1RA 1WRJA 1WWXA 4IRIA 4HV6A 2YR2A 1N25A 3GEZA 4GGGA 1DQUA 1I50J 2VKEA 2GQQA 3GF2A 2RAEA 1HSTA 2BOLA 1S9HA 4MFDA 1BJAA 3P5JA 3U1DA 1S29A 5L3BA 1P2FA 1XD7A 2NYXA 2XPWA 2JPBA 4KIGA 3W6KB 4AIDA 2F6CA 3BP8A 5FJ8J 2H6BA 1VQPI 3M7GA 3EYYA 4B47A 2V9KA 3OSGA 1E2XA 4ETSA 1TWGJ 2JZYA 1QHGA 3FXLA 1X4PA 4A3BJ 3A03A 2F4IA 2GOXB 2XGXA 1I5ZA 3V42A 2GZWA 3W3CA 3T8RA 2IS6A 1WI9A 2LG4A 4EM1A 1BA5A 2QKLB 5E18F 1TQIA 5FRMA 2W1OA 2E7WA 2XF7A 5GAHJ 2M0MA 2H1LA 1TWHJ 2E71A 2IRFG 1AHDP 1R4NB 3FMRA 2X51A 2LP0A 5H2FC 3WG9A 2LBFB 2A3SA 1ETKA 5KNLA 2LDUA 4E7LA 1DGWY 1QPIA 4OIPF 1IF1A 1BI1A 5AONA 3EYIA 1Y1VJ 2PJRB 2Z9OA 5C4JJ 1W36C 3SJMA 4BE2A 3OYCA 1ZR4A 2XRLA 2FNPA 3MKYB 2DJIA 3DFGA 3JRGA 1QA6A 3TO9A 2CQ7A 4LB6B 2IA2A 1I6HJ 1HQCA 3P9CA 3DTEA 3MKLA 1FY7A 4CYCA 3OOPA 2VKHA 1YLFA 1GHCA 1N75A 2V1NA 3GFLA 1ZRCA 3ZXSA 3SFIA 1YJ9I 3E3VA 1T2KA 2XB0X 3GW2A 1BI0A 2P6TA 3L9FA 1U2WA 2VQHA 1XS9A 3OYLA 1V3FA 1ZHFA 5EZGA 5IT9K 2HYGD 2K9LA 4ENMA 4RB2C 1IGNA 4IHSA 1S72I 1ITYA 3E5XA 4ZDPA 3HKZA 2VE9A 2X9DA 1Z7UA 2M5WA 2MH9A 3HOXJ 3BDDA 4HSRA 4EJUA 3BC8A 1Y8RB 1GXPA 2GXBA 1X58A 2OTJI 3DLAA 2EA4A 2IVMA 1B6AA 3JAMZ 1K78A 1Q1HA 4I98B 3FM5A 3MZ8A 1R4MB 4NC7A 2R7OA 2JN6A 3HIFA 4B44A 5E17F 1VQKI 3HDDA 4C2MJ 4UVCA 4PFPA 1FBSA 3HBLA 3WTVC 1EH6A 1WQ2A 4AIHA 1R49A 1JTYA 1LFBA 3WG7H 1TZLA 4JX4A 3LFUA 1IN6A 5EG0A 3ZRGA 4G94A 1GT0C 2ZMEC 5ERIA 5D8KB 5H6QA 2VJ4A 1D1AA 1HKTA 1R5HA 2E36A 2LMDA 4AU7A 1LQ1A 4R1HA 3DPUA 2ZBKA 4ASNA 2LD5A 3HM5A 1YE9A 4BXXJ 2KQRA 3CQZJ 1SMTA 4IZZA 1AWCA 2VT2A 3QODA 3FDYA 1KA8A 2VOOA 3PNYA 3RTRA 4QLCU 4IO9F 4IL6C 2P7VB 5C44J 2M34A 3OL4A 2R7ZJ 3S16J 2RN7A 2TRTA 3RCOA 4OIRF 5E8GA 5TJJA 2M9HA 3GTGJ 1IN4A 1WKMA 1FEXA 2M2EA 2GOMA 4BXFA 2R0QC 3RQ4A 5LD2C 2E19A 1VI0A 3GTQJ 2GA1A 1N77A 1PJRA 1FOKA 1IZ1A 1HCRA 3HRSA 1OLTA 2ZNYA 3I3LA 2BVLA 3D5SC 3U9GA 4F3QA 3O2PE 1RRJA 3E97A 3B6AA 3HXLA 3MQ0A 1A6QA 2IP2A 1T0FA 2KDOA 3RKQA 2LKPA 3NWTA 1PP8F 4KUMA 4Q47A 1U8RA 2Z16A 2F5EA 4CZZA 3BZ6A 5JFRA 2LNBA 5FD5A 3TEDA 4BJ6C 4NDLA 2VBYA 2W00A 1EF4A 1XCVA 4V19K 4JP0A 1G4DA 3PQJA 1SVLA 4ENJA 3N97A 1D0YA 2M45A 2V6CA 2DPUA 1T56A 2FMLA 3CC2I 5K7HA 5TISC 5LHHA 3P7NA 2NOGA 3FX3A 5J40A 3CC4I 2FNAA 1O3QA 3BWGA 1UHMA 4BNCA 4BY7J 3E5QA 5E3OA 2QF7A 1D0XA 3K10A 3HOTA 2OQGA 4D1QA 2QEXI 3ZP5A 4ZYAA 4Q5SF 2CV1A 2LLKA 3C7JA 2HDWA 4IJAA 3Q9VA 4CZCA 5EEHA 3MN2A 1P4AA 1HA8A 2EFNA 1ZGWA 1OR7A 3IWFA 2CFXA 2R7RA 4A69C 4CGZA 3QYBA 3LWFA 1TW2A 3EETA 1QVTA 3GZ5A 1P9QC 3CP2A 2OV7A 2F48A 1XPXA 1S6LA 2Z3YA 2W57A 4N4OB 1HDPA 1TT5B 1ZLJA 3FXOA 4RGXA 5CPRB 2O3FA 5EEAA 5HVQC 3L2WA 3VB2A 3LL7A 3QYFA 1IDYA 2KRHA 4FCYA 3ABKH 1KZHA 4ZYDA 2R7TA 3S8PA 4EVIA 2XKOA 1I39A 4H4KC 2QLZA 4XKCA 4XORA 4AVPA 4OU0A 2L54A 4ZZLA 2P81A 4UUSA 1YW7A 4A3MJ 2Z33A 1WJDA 2DO7A 2HDDA 4UB8C 2CU7A 3K9TA 3I58A 4XMYA 3ZQLA 5FKLA 4IPAA 2MC3A 3VDXA 2JQ7A 5FFZA 5LGNA 3K4NA 2FRHA 3L1PA 1OYIA 1RC9A 2K3FA 1NHAA 3W6JB 3I0TA 2BV6A 3G1MA 1OCZH 4G8XA 2EV5A 3JR9A 2MFZA 4IXAA 5BMZA 2M1BA 3PO2J 2YU9J 2NS8A 1REPC 3LSGA 2P7CB 3ESWB 1USSA 4ESFA 2X6YA 1WPKA 3TO7A 4FX4A 2M8EA 4U0VA 1ETVA 1JGGA 1U5TC 4CA0A 1OFCX 1J0RA 5DYMA 3HOUJ 2CH0A 3KP4A 3QPSA 4Y4RA 5H20A 2ADUA 3OR1C 4JOMA 4BAYA 4DYRA 4EATA 1ERDA 5KCMA 1YYVA 2QGUA 2CUZA 3GTJJ 3BG9A 3H1CA 4YRVA 3TW6A 3BPVA 2ZXWH 3BQYA 4WK8F 2L2OA 1Z6RA 2HQRA 2JA5J 3FK6A 5D8LB 1IG7A 4ZTJA 2HGCA 4XLPF 2XF5A 1RNLA 2JPCA 2LFBA 3AKZA 5HS9A 1IRZA 3K70C 1WJFA 2WAQN 3FKJA 3LOCA 2L7FP 2D45A 1X19A 4XONA 1MDMA 2E2HJ 3CMAI 1Y39A 2FD5A 1MKMA 1FBQA 1SFEA 3M8JA 2XAHA 3RQIA 4BKXA 2DFIA 2QZ8A 1FWZA 3IKTA 2RNGA 2LC2A 2XV4S 4MFEA 5CLSA 2MD0A 3WHCA 2H27A 2M0CA 2DOFA 2VC0A 3OWTA 4ITVA 2I10A 3I5UA 4HOBA 5JVGF 3L2CA 3U1KA 2QBYA 3Q5FA 2CV2A 1MMSA 3EPZA 5JR3A 5E1ZB 3J7ZI 1YHQI 1FOWA 4CHUA 4JQFA 1XMAA 2WY7Q 1K78B 1Y0NA 3DPTA 5DUIA 1BI3A 1SFXA 4IF4A 5A2QK 1JKRC 1SD6A 3ABUA 2LRDA 3LSTA 1JHFA 1AKHB 5D5UB 2V26A 4F92B 5DCMB 2GM4A 1SD7A 2CUEA 2CW7A 2HTJA 2QQ9A 5HODA 3F21A 2DOEA 3R6SA 5E1WA 2WWYA 4NQWB 1MW7A 3I59B 3HSFA 1Y8QB 4BQQA 5K1YA 3R60A 4BYYA 4ABZA 1ZH5A 1FLIA 3GFJA 1QU3A 5F64A 3FKIJ 4XK4A 1Q1VA 2QQ8A 1UHSA 2B7EA 2XAQA 1V5EA 1R5GA 4RBOA 5TGTA 3W2VA 2I8DA 3KETA 3A4CA 5EJCA 2E7XA 2XF6A 3B73A 1ZGJA 3I59A 4HYEA 3JRBA 3V8JA 2V9PA 2KMUA 1OKRA 2JA6J 2A5WA 1W7PB 3S1MJ 3DU5A 1G59A 2DTRA 4G6QA 2DQRA 3KP7A 5CKTA 3JSPA 3A01B 1KYZA 1OJLA 3OYBA 2OAZA 2P4WA 4RMNA 1WI3A 3WGHA 4DIQA 3BR6A 5AIQA 3CF5F 1YJWI 4BU2A 2EH3A 4E7HA 1VQNI 3ZQGA 3KEQA 1TNTA 3C18A 2DK5A 1JKOC 5JHUA 3JRAA 2RREA 1ON1A 3CDLA 4MGRA 2O0YA 2AQEA 2IXSA 3RKWA 5BS6A 2XROA 2V1DA 1XCBA 2XGEA 4G6TB 2ELJA 1ZARA 3WHBA 4E7ZA 5BNGA 3GWZA 4V2GA 4AYBA 1QRYA 3ECOA 3R61A 1FJLA 2EILH 3AG3H 3EUHC 2HOEA 3F8FA 1YTYA 1A35A 1TQPA 2KT0A 3F8MA 2VL8A 3G1OA 3DXJF 5D4SA 1IAWA 3HJEA 3TOBA 4BE0A 1JE8A 2L7ZA 2RC4A 5GPCA 2KFDA 3SEZA 4LFUA 5KVRA 3UKGA 1F4KA 1FOYA 4S0HB 1RI7A 2BE5F 3ZOBA 4LIUA 3RKXA 3PSIA 1SEUA 2L4MA 1YO5C 4QWQA 2FU4A 1POGA 3JCUC 3T5XA 3W2WA 1QZYA 3KP2A 4I09A 5E20A 1FNNA 1T6SA 1IUYA 1ZG5A 3QOPA 5DS9A 2F2EA 5HNHA 3GZNB 4KYWA 1MJBA 4HBLA 1YW8A 5AIPA 5HLHA 1O4XA 1X3UA 1K7AA 4PGHA 2R7XA 3BT9A 4GYGA 4O3MA 3HYIA 1YG2A 3CLOA 4G9YA 2RV8A 3E6CC 5FKOA 1OCOH 4CDGA 4BDYA 3TW7A 1XX5A 2GAUA 2QSFX 4MLOA 4CXFA 3QOEA 3QYEA 3VODA 2K9NA 3BROA 2F4MB 2MH2A 2GLOA 3W2AA 5IPAA 2DA1A 1KQ0A 3DKXA 3KZZA 3OIPA 5IP7J 3HZJA 5B3SH 2YX4A 2YU3A 4S04A 4I6ZA 2HPMA 5JVTA 2G7UA 4YFKF 2STTA 1MNMC 1RIOH 2BXZA 4C30A 1OCCH 2QKMB 1Z05A 2GXGA 1TTYA 1R1UA 1BOBA 1ON2A 2PG4A 4ZTFA 2DA7A 4N4NB 3ZMZA 1JI8A 1SVOA 2FX0A 3RYPA 3TBIA 1G3YA 2CS3A 3HTSB 4I01A 3G71I 1FIPA 4BACA 2BZTA 2XC7A 2VT3A 3IH4A 5F0FA 4O5VA 2E1MB 1ONVA 4G12A 2DFFA 3KPHA 2KLOA 2OD5A 2EFOA 4NB5A 3ZGKA 1OPCA 2OCCH 3DTIA 6PAXA 4LK0F 1VQ6I 1MNDA 1S3JA 1MMAA 4JX5A 5HLGA 4IKFA 3NQOA 4BL0B 4OMZA 3GFMA 4Y7NJ 3AFHA 5B1BH 2R92J 4L0ZB 3M4OJ 4P96A 1S7OA 2UV1A 1R71A 2V1UA 3I4NJ 2M8GX 4IOAF 5KK1A 3HUGA 1APLC 4ZH4F 1PVEA 4EGZA 1R6RA 4RS8A 4PJNA 4XKWA 3ABMH 5L3EA 4OINF 1ZG1A 1MJ9A 2PMUA 3KIOA 2ESHA 4L18B 4MTEA 4NC6A 3H3ZA 3H35A 4HF0A 2TCTA 4MHGA 2DYSH 5M3FJ 2JUCA 1FP2A 3ZQCA 3LNQA 4BHBA 4YFNF 4XLEA 3L2RA 2Y9YA 1NK2P 1STZA 1LDKB 5E3LA 2Y30A 3G3ZA 3MD2A 3FZVA 3K4JA 2E2JJ 4I0AA 2OUMA 2IGMA 4IQ4A 1OQYA 4Y33A 4ZYEA 1FC3A 2H1KA 2O9LA 3V8KA 3H3VK 4BXUA 4C2TA 3D5RC 4UY8I 4F93B 3S32A 1I6XA 3DCFA 2NAZA 2ZXHA 2R5ZB 3K2AA 1W4MA 2DDBA 2D1VA 1ACIA 1V54H 4A3GJ 1WZ2A 5H6RA 3HEFA 2IS2A 4BBRJ 2X4HA 3JRCA 2R5YA 1WJEA 1IRFA 2O6GE 1IN5A 3FISA 4KT5C 3Q0UA 3TO6A 3MWMA 4BJ5C 1J5YA 2DFHA 1J9IA 4PJMA 4D7NA 2RQQA 5FKMA 5IT3A 4M9ZA 4ZZDA 3DBRB 2YS9A 4HDUA 1IRGA 3GTMJ 3V7CA 1DP7P 2K85A 5FO5A 5HNFA 4EJTA 1MGTA 2VUMJ 1LEAA 1WH5A 4L5JA 1TW3A 4L9JA 2M7BA 1MMDA 5HDGA 3J80Z 3H5AA 5FLXZ 1KONA 3K4LA 1BC7C 2R7QA 4LLNA 2JJ7A 2L3DA 3BR3A 2L9NA 3HSRA 2ESNA 1D8KA 2DMUA 3Q0WA 4CCKA 5J8CA 1A04A 2ICWG 2LSOA 4HG2A 2HFHA 3V8LA 4D5CA 3S1NJ 3QQAA 1D8JA 4RM2A 4HX7A 3DKWA 2FEZA 5EGOA 2EIKH 1JUPA 3NAUA 2HOTA 2DK8A 5LHIA 2N8GA 3ZQ7A 1LE8B 3QAHA 4PCQA 2Q1ZB 1SD4A 3ZR8X 2KPMA 2QQAA 1HSJA 3BG7A 2NOJB 3LSKA 5M5XJ 1RKTA 2OCEA 3SQNA 3J7AY 2D1HA 1DU6A 4OIQF 5EG0B 5D5XB 3A0HC 2G0EA 5E3NA 2F4OB 1JT0A 2BGCA 3RJPA 1E3PA 3JAMK 1F1ZA 3DWLE 3OV8A 1MZBA 1TC3C 2RNJA 1FYLA 4XOTA 3BR5A 4YIFA 2F5CA 1IN8A 5E3MA 4X6AJ 4M3BA 3D5LA 1WHUA 3E7LA 3HKZN 1YIJI 2R7FA 3CJNA 1ZREA 3CCSI 4GFBA 5CQEA 5J8FA 1LVKA 2X1DA 2CRGA 1RUOA 1QVUA 1JTXA 2R4GA 3ZMTA 3J80K 2ZJRF 2PLYA 3IAS2 1BIAA 3PSFA 4LGWA 3G2BA 3E5UA 2A07F 2Y9ZA 1FTTA 2H94A 4FT8A 3K70D 1FYMA 3IC7A 1U0JA 4PSXA 2K40A 2L0KA 2VXZA 1JUMA 4A5MA 5HS7A 4I76A 1LJ9A 3I56I 4NC8A 5L3DA 1Y56A 3SEQA 5D5VB 3KP5A 4AIKA 2A61A 5C3EJ 1UG0A 2DA3A 2E1NA 2OQRA 3Q9SA 4ZDOA 3JTHA 3F72A 4XM3A 5B66C 4BBSJ 4M3DA 4UNOA 2MLGA 2VI6A 3M1EA 2HVRA 4PJ0C 2BBYA 1R1TA 4CCNA 4WX9A 2IT0A 1ZG3A 1R7JA 1H88C 4BY1J 2ZNZA 3CCLI 5ICCA 3SYTA 2QA4I 3K1NA 1TT0A 1S5LC 2Y2ZA 2A6HF 2NVUB 2ZMEA 2Y48A 4A5NA 4CO8A 3WU1B 4GRIA 1K61A 4G7ZF 3O8GA 3IV5A 4N9IA 4DQ2A 3IH2A 4I02A 3RYRA 4Y3OA 2WAEA 3QPLA 3G4SI 3GTLJ 3PNVA 2PX9A 3RDIA 3CC7I 1X1DA 1G3TA 4UVBA 3ZCOA 1ZELA 4PK4A 3OSFA 5CVUA 3CO6C 2ZJ2A 2FBIA 3FMQA 3F8CA 1LNWA 4B1RA 2FBHA 5B1AH 2HDCA 2VASA 3MAJA 2LR8A 2KP6A 4EJOA 4W97A 1NTCA 1LFPA 1DP3A 1X4OA 3FXJA 3BJOA 2EZKA 2PMZA 4UVAA 3H5RA 5FKNA 1JJ6C 1Y1WJ 3DBHB 2L9VA 1SAUA 1TNSA 1ZTRA 3GUDA 4CH7A 1U8BA 4UUTA 2J5OA 1P7JA 5BPDA 2HEOA 2JA7J 3DTKA 5IP9J 2AO9A 2BW3A 3B02A 1YX5A 4M3EA 4AYBN 2MGQA 5GAEJ 3A01A 1X2MA 1DPUA 2EPFA 5K5OA 1MIJA 4I0BA 2NS7A 3J81Z 3M07A 3J7AO 1FTZA 4XRMA 4PSWA 1MJAA 1SD5A 2OU2A 3DF8A 3MFKA 2EINH 4NBQA 5FGMA 1XTAA 1JHHA 1LPQA 2KIQA 3OIOA 4KA4A 1HXDA 3I55I 3WU2C 2JRMA 3FIWA 4JYKA 2BHYA 1SAXA 4LOCA 1YRNA 3BY6A 2W4SA 5BOXA 3H3UA 3TDUC 4C3IJ 2KRCA 1G2HA 3IWZA 4EMSA 3OYAA 2FOWA 2JSCA 2HZTA 2K27A 1OR7C 3GCMA 3K4KA 4P1WA 4RGSA 4HNUA 3GX4X 3GZ6A 3S1RJ 5ILSA 4D7MA 1TQMA 2DMNA 3SXYA 1BR4A 2OC6A 4IEJA 2MABA 3K69A 1I1GA 5ICGA 4LITA 4KNYA 3VWBA 4IRGA 2V1XA 3O6BB 1B4AA 2DAOA 2DA6A 4OAYA 2HI3A 4RB0A 1XMKA 3R0AA 4IHYA 2F5FA 1LVAA 4DYCA 4M73A 3VYUB 3JREA 1ZQ3P 2CUJA 1UJ8A 1XGNA 1B72B 2LREA 1Z77A 3F6OA 1VQ9I 3CCRI 3V7RA 1MMGA 3CF2A 2A6TA 2W25A 3IRQA 1MDMB 2VPRA 1IO2A 2OPTA 1PDNC 1LE8A 1R23A 5KHDA 1FIAA 2LY1A 2B63J 2OZ6A 1S7EA 3C3WA 1B59A 5EGOB 3B6CA 4FHTA 1T39A 4AIJA 1BN5A 2HQAA 1M1EB 5DDGA 1DUXC 1X1AA 4XRFA 3I64A 4DBQA 2DN0A 4UXNA 2E5ZA 3A2KA 3PNTA 4QPOA 4XOPA 4HW0A 4L9NA 3F8NA 2QBYB 5FLXK 2IEKA 1ETQA 2LTPA 1U9NA 4C2UA 4XLHA 3TL4X 3AAFA 2XVCA 4XRSA 5DD8A 4OOIA 2L9SA 3FWEA 1X1PA 3OY9A 3QU6A 3TOAA 3ELKA 2DMTA 2Y69H 1PUFB 2Y0SN 1T0FC 4Y52J 2KHMA 3F6VA 3HSEA 2STWA 1L0OC 4P9FA 3OYNA 4LD5A 1F36A 4X1EA 2WY8Q 3OL3A 3DP7A 9ANTA 1RUNA 5GPAA 2IPQX 3HHGA 4KN4X 3CO7C 4F55A 3FXUA 3N4MA 2M4GA 5DM6F 5CJ9A 2XUBA 2K9SA 4GCVA 4I7HA 3LA2A 2IGOA 2PN6A 1XSXA 3L09A 2FMYA 2ELKA 2P5LC 4ON0A 2BY0A 1G3WA 1FBUA 2FOKA 1HW1A 3WODF 2VKVA 3NEUA 2Z5UA 4B4CA 1GUUA 2OBPA 5IP6A 4MEYF 1SFOJ 2ID6A 3CJQB 1J7KA 2DT6A 2NVQJ 1J2XA 1V5GA 1Z1DA 2YSRA 3QP6A 2UZKA 3WE3A 1EH7A 2DT5A 3ZMSA 2WC2A 1JUSA 3LSIA 3KZIC 4A3LJ 2R7UA 3PIOF 2HS5A 1KGSA 3ZQQA 4HQMA 4UHTA 1E3OC 4RB1A 1WJBA 5LRRA 2FA5A 4GXOA 2E1MC 5IYCJ 2EBIA 4OAZA 4UUSB 2DXIA 1T95A 3HPHA 5M5WJ 2FUG2 2Z99A 4KISA 3TMOA 1OYWA 1QNTA 5DCFA 5JI6A 2ZJPF 4E6KG 5DD4A 3A02A 2LYCA 4A6DA 4FTHA 1FSHA 1BC8C 2HOSA 4I99C 1IJWC 3IHUA 2JVGA 2QVOA 4HPQA 1QQIA 4M71A 4KIFA 4M6YA 4JK1X 4GO1A 2RGVA 3WGGA 4IHWA 1NG6A 2BXYA 2JA8J 3RPQA 5GADJ 2W24A 2LKXA 3IP4B 2HWVA 1EV7A 2NNNA 5F0HA 1U3EM 4QTRA 1MNEA 2JSPA 2CGPA 3UNGC 2VKDA 1YQAA 3OYHA 2IAIA 3GBGA 3HC7A 4EM0B 2XPVA 1B1BA 3H9JA 4BEHB 1BOAA 3CP8A 2VE8A 3H9QA 2DMQA 1LKXA 3QP5A 3BZCA 3HGGA 3S15J 1O3SA 2P8TA 1YS6A 4KICA 3L7WA 2VLAA 3HRMA 5GP9A 1N78A 1F5TA 4ZYGA 2JVHA 4XL9A 2P6SA 3F3XA 2F5VA 1PP7U 3DQVC 4BDZA 2DA5A 5D4RA 3L2QA 2L01A 2Z1DA 1F43A 2DT7B 1MBKA 4KFCA 1CF7B 1FZPB 2PMHA 4NNJA 1GXQA 4XIDA 2NXNB 1OCTC 4ESBA 2R3SA 3KCCA 4OWRB 3SZTA 2DJNA 3KLNA 3TP0A 3K7AJ 1R36A 2E60A 3WTXC 3KLOA 1T8IA 2ETHA 1YITI 4Z6YA 2O8XA 5F27A 1TBXA 3OS2A 3VOEA 2W7NA 2TDXA 4J01A 5IOYA 4YIIA 1SFKA 2VB6A 4M6XA 3ZQHA 3CMYA 3J7YJ 4RA2A 1X3WB 1GV5A 2HTSA 1O7LA 3FBNB 1X1CA 3TKYA 4WCGA 1Y6IA 4NQWA 2FBKA 2DW4A 2IJLA 2CQNA 5F04A 3TP3A 3ZN1A 5D5WB 3S14J 4J00A 1Z6TA 4A3FJ 1QPMA 5TRDA 1T98A 5DV5A 4BH9A 2NVXJ 4DW6A 3BZKA 1ZRDA 5E1XA 2M30A 3S3OA 1ODDA 3WU0A 2CQQA 3JRHA 2YX7A 5M3MJ 2LY2A 5J47A 4IVNA 1SVMA 1OISA 3TQNA 4NUBA 1JT6A 4BUPA 2KZVA 5CYVA 3LQQA 2AS5F 2PEXA 1LEBA 2HQNA 2GXAA 1PYVA 4V2FA 2HQ5A 4HRIA 2B9SA 1A31A 1Z3XA 2EK5A 1R00A 2KIFA 2GBYA 4E70A 3LMMA 4PJJA 4CICA 3EUAA 4XQFA 4L5EA 3HRUA 2ID3A 3OS0A 5D6FA 3IAM2 1H9GA 2RQPA 3CD6I 3DEWA 4RLFA 1IXRC 2BY2A 2V79A 4A3KJ 2ZFWA 4IHTA 1QBJA 2VBZA 1KU9A 3HUGB 1HF0A 4B48A 4HX8A 4RDUA 3MZHA 1E3HA 2HYFA 3I9V2 4M6VA 4XSXF 2I5UA 3RZDJ 1LDJA 3REOA 1FT9A 1UB9A 1FX7A 3M3YJ 1IUFA 2XASA 3DEUA 3BTIA 2ZB9A 4FASD 4ZYHA 4UV9A 5HLTA 4G7HF 5K5QA 1KQ9A 1AU7A 1B8IB 2ZO4A 4AC0A 3I4PA 3F22A 2XAFA 3HOZJ 4LG0B 2R5YB 3RIRA 1TWFJ 1HC8A 2MC4A 4ZDLA 3J81K 3VYSB 2FE3A 1A6IA 3E6DA 2BVMA 5A2QZ 3OR2C 1WVRA 3S93A 5DM7F 1VFCA 2KJBA 1B8IA 3VSLA 2R93J 3L2UA 4KMUX 1LDDA 3UR3C 4PZJA 2BY1A 5E8IA 4A3DJ 4HLXA 4P5OA 3G73A 2DYRH 2HKOA 2ZCWA 2HZDA 4C3JJ 4F7ZA 5LBQA 2R7DA 4TV7A 4B09A 1AA7A 2XDVA 3KP6A 1VNDA 5EEGA 4UUVA 3RSNA 2LVSA 3WTZA 1GV2A 1O7FA 3RI4A 2HNHA 1VQOI 1UZCA 5ILUA 5KAIC 4H0EA 2A6EF 5JLWA 1RZ4A 5BPIA 2ECBA 2V6EA 4IHXA 2CUFA 4ZC3A 4WXCA 4LJZF 1QZEA 1MBFA 3V7SA 4A2UA 1OYYA 1R9TJ 1Z7LA 1ORKA 2NS0A 2ACJA 2Q0OA 5KAFC 2KJCA 2VQCA 2NRAC 4HDVA 3PFYA 3GTOJ 2WV0A 5F08A 2HOAA 4Y17A 2G7HA 3IRRA 2ZSHB 2AQFA 3HOYJ 2PMZN 4EEFG 3PFIA 2L4AA 2PBIA 4QIWN 1FMVA 4ZJZA 2HVQA 4KN7X 3ECHA 2Y75A 3LSJA 4HZFA 1S8NA 3K0LA 4DZJA 1J75A 2ISZA 4U7DA 1MBJA 5BQTA 1I3QJ 3CMEI 4XR6A 3OIQA 2Z2SB 1VQMI 2HVSA 3CCMI 4U87A 3GFIA 2VJIA 4JBAA 2VODA 4CCJA 2FQ3A 2ZC2A 1P92A 1O3TA 3RPUA 5F6FA 3W6VA 2M87A 3LA3A 2A5YB 1MMNA 2HYJA 4G6DA 3S17J 3RZOJ 5EDNA 2XGDA 2VC1A 1YIOA 3ZQIA 3PL8A 4LK1F 1IXCA 4EJWA 3DLLF 1H0MA 1XG1A 1XDUA 2CQKA 2IW5A 4RLQA 3OYFA 2VBWA 2F5DA 3PUFA 1WH7A 3IUOA 3CCYA 2GWRA 2RDPA 4A12A 2BEOA 4U0WA 4AD9A 1BL0A 3K1PA 2HPIA 1X2NA 5CVIA 2HR3A 1O3RA 5CVRA 5DUKA 3HHHA 2NVYJ 5LRSA 1UG2A 1VTNC 4AUXA 3KYCB 1P7IA 1IN7A 3MZYA 2ECCA 2W48A 2VQLA 3ABLH 5HOOA 3OMYA 4YFXF 1U5TA 1IDZA 4G7OF 3H0GJ 4L0YB 4BHCA 2WAQA 2PI0A 3HG9A 3OYDA 4Q48A 2PJPA 4E7IA 3SDBA 1WFXA 2E34A 1B9MA 2CQXA 2CYYA 2X0LA 1ZRFA 4XKBA 1EA3A 4AM3A 2L9RA 1DGRM 4ENKA 4A6EA 3PJRA 3OYIA 2COBA 1HDDC 3KEOA 1YW9A 2CJJA 3VEPA 2JK3A 4GYIA 1D5YA 4PFOA 5LHGA 1BW6A 1YOVB 2D2WA 1YJNI 2A68F 4GDFA 3VYRB 3ERMA 2QCOA 2MBFA 2Y0MA 4RGUA 2ZSIB 4HF2A 4IHVA 3H92A 4QPQA 2EFQA 2UXXA 4FQGA 2KRFA 3OYJA 1W5TA 4XLAA 2R5ZA 1O57A 1B72A 1AOYA 3H36A 4LLLA 2MG4A 2LK2A 4B3XA 3FK7A 2C6YA 1QGPA 2DPDA 3JW4A 2DMPA 3F0CA 1U78A 4XRSG 3G1LA 3L00A 3CCUI 1GVDA 2DFEA 4MIMA 1BI2A 5J4VA 2IS1A 1WGXA 5ED4A 2X48A 2EFPA 3GXOA 4D9JA 4C3HJ 2ME6A 2BHZA 1W5SA 3CMMA 3M1CA 3LSPA 1K4TA 4S05A 1KU7A 2ZJQF 3IH3A 3LSHA 4AVZA 3RPUD 3HB9A 2NNYA 3CCQI 3LSMA 2P5VA 1MH3A 1ZAOA 2L5QA 5LEJA 4E4HA 2DTZA 3SHFA 1TWAJ 2AXLA 2VN2A 4IQJA 1XDSA 2YPRA 4HQEA 4A0ZA 4HX4A 3H0DA 1PUFA 3FXMA 4R8HA 4BQAA 5IYBJ 1ETOA 2XAGA 4EQQA 3C2GA 5HDNA 4ENNA 4LB5A 3S2HJ 2OJED 3O3KA 3MCZA 1HW2A 2WV1A 3BR0A 2EA2A 2WTEA 5JHFA 3GYHX 3ML6A 2QUFA 1GDTA 2NVTJ 4BS9A 2H8WA 1ETXA 2CSOA 3PQKA 3PIPF 2EZHA 2DA2A 1MBHA 3JRDA 1OMIA 2CWEA 1KU2A 2AHQA 3PO3J 1JGSA 1P6RA 4PUSA 2M4KA 3ISPA 3KYDB 1FSEA 1Z21A 3C2BA 1HKQA 3ASNH 1XGSA 4A0XA 3LA7A 5LEKA 3ROUA 4CCLA 3I54A 1HLVA 1X1BA 4ANJA 1WJAA 2K86A 3Q3SA 3LSRA 2Q2EB 3VFZA 3E0JB 5IT9Z 4CCOA 3WTUC 3AL0B 2ZMEB 3ZMUA 2QWWA 1C0WA 1K6OA 2HKXA 2ME0A 1XB4A 3SZPA 2X1EA 2GIVA 4EV0A 3S3MA 2X6WA 4I2OA 4B43A 3OOUA 3EDPA 3E6BA 4L5IA 5CVJA 4YEJA 2DU9A 2V4JC 2W82A 4PDKA 4BQNA 5FD6A 2X1CA 1UHWA 2EV0A 3AG4H 4M3FA 4MNUA 1ZN2A 2Q2EA 4O6JA 2E1OA 3EUHA 1RETA 1D3YA 2EZIA 2XGCA 4JX6A 4XBFA 3ULQB 3S2DJ 1E17A 2HXIA 4XLNF 1NG7A 3MKZA 1L3LA 2R7SA 2EFWA 5F1JA 1CGPA 3CZ6A 1ETYA 3I71A 1UAAA 1H9TA 4RGRA 3BCBA 3PUBA 5CQGA 1W5CC 2IA1A 1VQ7I 1HOMA 1GVJA 3JTGA 5LFAA 4L9TA 4RAGA 4FETA 3CUQA 1LB2A 1PUEE 1RKWA 4XN0A 3COAC 4MQ9F 5J6XA 2ZXJA 2QSGX 4MO7A 1IV6A 3MEXA 1SANA 1IXSB 1ETWA 4XNFA 3WGIA 1AKHA 2P5KA 1D1CA 4DBRA 2GA2A 5ILVA 2FF4A 2ZFUA 3OYKA 3WTYC 1BIBA 3HTUA 4WF2A 3JSOA 1I3AA 4RB3C 2P0WA 3F8BA 2R7VA 2QSHX 1YI2I 2BY3A 4Y15A 1HBXG 3AG2H 2L7KA 4FISA 1P4WA 3KFWX 4HLYA 2W85A 5M5YJ 3U2RA 2XKPA 3QWLA 1SFUA 3AG1H
chains in the Genus database with same CATH topology
1ZLKA 2PQ8A 2KKOA 3R4KA 2OA4A 1HW5A 3BOQA 3ZN0A 4N0BA 3BJAA 3FM3A 1I27A 3FMSA 4B8XA 2O03A 2KIUA 3IL2A 4KDPA 2H6CA 3T0YA 4U0YA 2FXAA 3K1MA 1W7PA 3FHZA 3WTTC 2Q8KA 5F1RA 4D0PA 4Q4ZF 2CO5A 1ZGAA 2QQBA 2EB7A 4LLGF 1MD0A 2K7LA 2VONA 2J5PA 2PFBA 4NHJA 3CUOA 4XSZF 5FFXA 3LAPA 1XGOA 3LAJA 1XSDA 3HRTA 3FXRA 3ZMDA 4U7BA 4Z2YA 3QPTA 4CYDA 1T38A 1CF7A 2DQLA 1FPQA 2EV6A 1G3SA 1ZYRF 3WTSC 3K2ZA 4HA8A 2G9WA 2LF8A 2W84A 4BHPA 2MA3A 2VBXA 4U88A 1R58A 1V4RA 1JXSA 3CDHA 4LMYA 3I53A 1Y0UA 3FXQA 4YG2F 1QZZA 1I1SA 2DBBA 2XRNA 2VOPA 3LFKA 4P55A 4MEXF 1QO0D 2K4BA 2MLKA 1DPRA 3ZMVA 1Z9CA 3D0SA 2JT1A 1G6NA 2JTVA 2E1CA 1BBYA 2L02A 4M72A 3IKVA 4L9VA 5D6EA 4A0YA 3TDZC 4K2EA 1KU3A 3M8FA 3BJ6A 2B0LA 3CUQB 2K4JA 4ESJA 1F9NA 4AWXB 5L3FA 5FB2A 3V4GA 1IW7F 3M9AA 1DDNA 5LGTA 4R79A 5HS8A 5LLQA 3ERED 4PGGA 4MQVA 3ZPLA 4EJVA 1FYKA 3RKYA 1D5VA 1YFHA 4UV8A 3P9IA 4OMYA 2RVCA 4LG0A 4RAYA 3WE2A 3ABTA 4Y13A 3C1DA 2CW0F 1W7PD 2V9VA 1R1VA 1XN7A 5CVVA 4RAZA 3SFZA 2EWNA 2LF7A 2XHKA 3TGNA 3T8TA 4EGYA 3KE2A 2XAJA 2JRTA 3LQRA 2QYOA 2UXNA 2FSWA 3M8EA 4EM2A 1ULYA 3QRFF 5L3CA 1TLHB 3DV8A 2BYVE 3CTAA 3QPHA 4MTDA 3GO5A 2EJRA 4DNCA 2UWMA 5HDKA 2O61A 4HV5A 5DCMA 4M9SA 5ICFA 4M9XA 2RKHA 3GVAA 5ICEA 1UCRA 5LGUA 5K5RA 2QM3A 4P9UA 1Z91A 1BM9A 4HF1A 1R22A 3FF5A 1J59A 1USTA 1FP1D 2MD5A 2OZUA 3GLXA 3T1BA 1K79A 3R0JA 1XGMA 2ZKZA 2A69F 1S7AA 4IRHA 1P4XA 5DEQA 1U6GA 3P9KA 3HOSA 1KQ8A 2DI3A 5L3GA 3BPXA 3WTWC 4WWCA 3KZYA 2CG4A 2XIGA 3QU3A 3F23A 1B9NA 4WXHA 1WSUA 2DLLA 3S2WA 4HAMA 2ISYA 2ELHA 4KIBA 1EH8A 1HKSA 1XSVA 3E6MA 4OIOF 4KMFA 2KIMA 1UFMA 3EQLF 3NRVA 1SMYF 1U5TB 4FX0A 2QENA 3DPLC 1KYWA 2K02A 4M74A 4N9HA 4WXDA 3KP3A 2IA0A 2COMA 2H09A 1YS7A 5HLIA 3CUQC 1WRJA 1WWXA 4IRIA 4HV6A 2YR2A 3GEZA 4GGGA 2GQQA 3GF2A 1HSTA 1BJAA 3U1DA 5L3BA 1S29A 1P2FA 1XD7A 2NYXA 4KIGA 2JPBA 3W6KB 3BP8A 2H6BA 3M7GA 3EYYA 1E2XA 4ETSA 2JZYA 2XGXA 1I5ZA 2GZWA 3T8RA 1WI9A 4EM1A 5E18F 1TQIA 2E7WA 2IRFG 3FMRA 3WG9A 2A3SA 2LDUA 4OIPF 1IF1A 1BI1A 5AONA 3EYIA 2Z9OA 2FNPA 3DFGA 3TO9A 4LB6B 2IA2A 1HQCA 3P9CA 1FY7A 3OOPA 1YLFA 1GHCA 1ZRCA 3GFLA 3E3VA 1T2KA 3GW2A 1BI0A 2P6TA 3L9FA 1U2WA 1V3FA 1ZHFA 5IT9K 2HYGD 4ENMA 4RB2C 4IHSA 3E5XA 2VE9A 1Z7UA 2M5WA 2MH9A 3BDDA 4EJUA 1GXPA 2GXBA 2EA4A 2IVMA 1B6AA 3JAMZ 1K78A 1Q1HA 4I98B 3FM5A 3HIFA 5E17F 4UVCA 1FBSA 3WTVC 1EH6A 1WQ2A 4AIHA 1IN6A 4G94A 5ERIA 5D8KB 5H6QA 1HKTA 1R5HA 1LQ1A 4R1HA 2ZBKA 4ASNA 1AWCA 1SMTA 2VT2A 1KA8A 2VOOA 3RTRA 4QLCU 2P7VB 2RN7A 4OIRF 5E8GA 5TJJA 1IN4A 1WKMA 2GA1A 1FOKA 1IZ1A 3HRSA 2ZNYA 3U9GA 3O2PE 3E97A 3MQ0A 2IP2A 1T0FA 2LKPA 1PP8F 4KUMA 4Q47A 1U8RA 2F5EA 4CZZA 3BZ6A 5JFRA 2LNBA 5FD5A 2VBYA 1XCVA 1G4DA 3PQJA 4ENJA 3N97A 2M45A 2V6CA 2DPUA 2FMLA 5LHHA 3P7NA 3FX3A 2FNAA 1O3QA 3BWGA 1UHMA 4BNCA 3E5QA 3HOTA 2OQGA 3ZP5A 4Q5SF 3C7JA 4IJAA 3Q9VA 5EEHA 1P4AA 2EFNA 1OR7A 3IWFA 2CFXA 4CGZA 3LWFA 1TW2A 3EETA 3GZ5A 1S6LA 2Z3YA 2W57A 1ZLJA 4RGXA 2O3FA 5HVQC 3VB2A 4ZYDA 4EVIA 2XKOA 2QLZA 4AVPA 4OU0A 2L54A 4ZZLA 1YW7A 2Z33A 2DO7A 3K9TA 3I58A 4IPAA 2MC3A 5FFZA 5LGNA 2FRHA 1OYIA 1NHAA 3W6JB 3I0TA 2BV6A 4G8XA 2EV5A 4IXAA 5BMZA 2M1BA 1REPC 2P7CB 1USSA 4ESFA 3TO7A 4FX4A 2M8EA 4U0VA 1U5TC 1J0RA 5DYMA 3KP4A 5H20A 2ADUA 4BAYA 1YYVA 3BPVA 4WK8F 1Z6RA 2HQRA 5D8LB 2HGCA 4XLPF 1RNLA 2JPCA 5HS9A 2D45A 1MDMA 1MKMA 1FBQA 1SFEA 2XAHA 2DFIA 2QZ8A 1FWZA 3IKTA 2XV4S 5CLSA 2H27A 2VC0A 4HOBA 3I5UA 3L2CA 2QBYA 3Q5FA 5JR3A 5E1ZB 4CHUA 4JQFA 1K78B 1XMAA 3DPTA 5DUIA 1BI3A 1SFXA 4IF4A 5A2QK 1SD6A 3ABUA 3LSTA 1JHFA 5D5UB 5DCMB 1SD7A 2HTJA 2QQ9A 3F21A 3R6SA 5E1WA 2WWYA 3I59B 3HSFA 5K1YA 3R60A 4BYYA 1ZH5A 1FLIA 3GFJA 5F64A 2XAQA 1R5GA 3KETA 2E7XA 3B73A 1ZGJA 3I59A 4HYEA 3V8JA 1OKRA 1W7PB 2DTRA 4G6QA 2DQRA 3KP7A 3JSPA 1KYZA 2OAZA 2P4WA 3WGHA 5AIQA 3KEQA 1TNTA 3C18A 2DK5A 5JHUA 1ON1A 4MGRA 2XROA 2O0YA 3RKWA 5BS6A 2V1DA 1XCBA 1ZARA 3GWZA 3ECOA 3R61A 2HOEA 3F8FA 1YTYA 1TQPA 3F8MA 5D4SA 1IAWA 3DXJF 3TOBA 1JE8A 2RC4A 4LFUA 5KVRA 1F4KA 1RI7A 2BE5F 3RKXA 2L4MA 1YO5C 4QWQA 2FU4A 3T5XA 1QZYA 3KP2A 4I09A 5E20A 1FNNA 1T6SA 1IUYA 1ZG5A 3QOPA 2F2EA 4KYWA 1MJBA 4HBLA 1YW8A 5AIPA 5HLHA 1K7AA 1X3UA 4PGHA 4GYGA 4O3MA 3HYIA 1YG2A 3CLOA 4G9YA 2RV8A 3E6CC 4CDGA 4CXFA 2GAUA 3VODA 3BROA 2MH2A 1KQ0A 3KZZA 2YX4A 2YU3A 4S04A 5JVTA 2G7UA 4YFKF 2STTA 1RIOH 1Z05A 2GXGA 1R1UA 1ON2A 1TTYA 2PG4A 3ZMZA 3RYPA 1G3YA 3HTSB 4I01A 2VT3A 4O5VA 1ONVA 2OD5A 2EFOA 4NB5A 6PAXA 1OPCA 4LK0F 1S3JA 5HLGA 3NQOA 4OMZA 3GFMA 4L0ZB 4P96A 1S7OA 2V1UA 5KK1A 3HUGA 4ZH4F 4EGZA 4RS8A 1ZG1A 5L3EA 4OINF 1MJ9A 2PMUA 2ESHA 4L18B 4MTEA 3H3ZA 4HF0A 4MHGA 1FP2A 4BHBA 4YFNF 1STZA 1LDKB 3G3ZA 3FZVA 4I0AA 4ZYEA 1FC3A 3V8KA 4BXUA 1I6XA 2NAZA 1W4MA 2D1VA 5H6RA 2X4HA 1IRFA 2O6GE 1IN5A 4KT5C 3TO6A 3MWMA 1J5YA 1J9IA 5IT3A 4M9ZA 4ZZDA 4HDUA 1IRGA 3V7CA 1DP7P 5FO5A 4EJTA 1MGTA 1LEAA 4L5JA 1TW3A 4L9JA 5HDGA 3J80Z 5FLXZ 1BC7C 4LLNA 2L3DA 3HSRA 2ESNA 1D8KA 5J8CA 1A04A 2LSOA 2HFHA 3V8LA 1D8JA 4HX7A 3DKWA 2FEZA 2DK8A 5LHIA 3ZQ7A 3QAHA 4PCQA 1SD4A 2QQAA 1HSJA 3SQNA 2D1HA 4OIQF 5D5XB 3JAMK 2BGCA 3RJPA 1F1ZA 3OV8A 1MZBA 1FYLA 2RNJA 4YIFA 2F5CA 1IN8A 3D5LA 2R7FA 3CJNA 1ZREA 5J8FA 1RUOA 3ZMTA 3J80K 2PLYA 1BIAA 4LGWA 3E5UA 2A07F 2H94A 4FT8A 1FYMA 3IC7A 2VXZA 4A5MA 5HS7A 1LJ9A 5L3DA 5D5VB 3KP5A 4AIKA 2A61A 2E1NA 2OQRA 3Q9SA 3JTHA 3F72A 4UNOA 2MLGA 3M1EA 2BBYA 1R1TA 4WX9A 2IT0A 1ZG3A 1R7JA 2ZNZA 5ICCA 3K1NA 2A6HF 2ZMEA 2Y48A 4A5NA 4CO8A 3WU1B 4G7ZF 4N9IA 4DQ2A 4I02A 3RYRA 3RDIA 1G3TA 4UVBA 5CVUA 3CO6C 2ZJ2A 2FBIA 3FMQA 3F8CA 1LNWA 2FBHA 2HDCA 3MAJA 4EJOA 3BJOA 4UVAA 1TNSA 3GUDA 5BPDA 2J5OA 2HEOA 3B02A 1DPUA 5K5OA 4I0BA 3J81Z 3J7AO 1MJAA 1SD5A 2OU2A 3DF8A 3MFKA 5FGMA 1JHHA 4KA4A 1HXDA 1SAXA 3BY6A 5BOXA 3H3UA 3TDUC 3IWZA 4EMSA 2JSCA 2HZTA 2K27A 4RGSA 3GX4X 3GZ6A 5ILSA 1TQMA 3SXYA 3K69A 1I1GA 5ICGA 4KNYA 4IRGA 2V1XA 3O6BB 1B4AA 2DAOA 4RB0A 1XMKA 3R0AA 2F5FA 1LVAA 4M73A 1XGNA 3F6OA 3V7RA 2W25A 3IRQA 1MDMB 1PDNC 1R23A 2OZ6A 3C3WA 1T39A 1B59A 4FHTA 4AIJA 1BN5A 5DDGA 1DUXC 4XRFA 3I64A 4UXNA 4HW0A 4L9NA 3F8NA 2QBYB 5FLXK 3AAFA 2XVCA 5DD8A 4OOIA 3FWEA 3QU6A 3TOAA 3ELKA 3F6VA 3HSEA 2STWA 1L0OC 4P9FA 4LD5A 3DP7A 1RUNA 2IPQX 3HHGA 4KN4X 3CO7C 3FXUA 3N4MA 5CJ9A 2XUBA 4GCVA 4I7HA 3LA2A 3L09A 2PN6A 1XSXA 2FMYA 2P5LC 4ON0A 2FOKA 1G3WA 1FBUA 1HW1A 3WODF 3NEUA 2Z5UA 2OBPA 4MEYF 1J7KA 1J2XA 1Z1DA 2YSRA 3QP6A 2UZKA 3WE3A 1EH7A 2DT5A 3ZMSA 2WC2A 2HS5A 1KGSA 4HQMA 4UHTA 4RB1A 5LRRA 2FA5A 4GXOA 2Z99A 1OYWA 1QNTA 5DCFA 5JI6A 5DD4A 4A6DA 1FSHA 1BC8C 3IHUA 2QVOA 1QQIA 4M71A 4KIFA 4M6YA 4JK1X 4GO1A 2RGVA 3WGGA 3RPQA 2W24A 2HWVA 1EV7A 2NNNA 1U3EM 2CGPA 1YQAA 4EM0B 1B1BA 1BOAA 2VE8A 3QP5A 1O3SA 2P8TA 1YS6A 4KICA 3L7WA 3HRMA 1F5TA 4ZYGA 2P6SA 3F3XA 1PP7U 3DQVC 5D4RA 2L01A 4KFCA 1CF7B 1FZPB 2PMHA 1GXQA 4ESBA 2R3SA 3KCCA 3SZTA 3KLNA 1R36A 3WTXC 3KLOA 2ETHA 2O8XA 1TBXA 3VOEA 2TDXA 4YIIA 4M6XA 2HTSA 1O7LA 3TKYA 4WCGA 4NQWA 2FBKA 2DW4A 2IJLA 3ZN1A 5D5WB 1Z6TA 1QPMA 5TRDA 1T98A 5DV5A 4BH9A 1ZRDA 5E1XA 2M30A 1ODDA 3WU0A 2YX7A 4IVNA 3TQNA 5CYVA 3LQQA 2AS5F 2PEXA 1LEBA 2HQNA 2EK5A 1R00A 2KIFA 4E70A 4CICA 3HRUA 5D6FA 1H9GA 2RQPA 1IXRC 2V79A 2ZFWA 4IHTA 1QBJA 2VBZA 1KU9A 4HX8A 3MZHA 2HYFA 4XSXF 1LDJA 3REOA 1FT9A 1UB9A 1FX7A 2XASA 3DEUA 4ZYHA 4G7HF 4UV9A 5K5QA 1KQ9A 2ZO4A 3F22A 3I4PA 2XAFA 4LG0B 3RIRA 3J81K 2FE3A 3E6DA 5A2QZ 2KJBA 4KMUX 1LDDA 4PZJA 5E8IA 4HLXA 4P5OA 3G73A 2HKOA 2ZCWA 4F7ZA 5LBQA 2R7DA 4TV7A 4B09A 3KP6A 5EEGA 4UUVA 3WTZA 1O7FA 3RI4A 5ILUA 4H0EA 2A6EF 1RZ4A 5BPIA 4WXCA 4LJZF 4A2UA 3V7SA 1OYYA 2NS0A 2ACJA 2Q0OA 2KJCA 2NRAC 4HDVA 2WV0A 4Y17A 2G7HA 3IRRA 3PFIA 2L4AA 2PBIA 4KN7X 3ECHA 2Y75A 4HZFA 1S8NA 3K0LA 1J75A 2ISZA 4U7DA 5BQTA 3GFIA 4JBAA 2VODA 2FQ3A 1P92A 1O3TA 3RPUA 5F6FA 2M87A 3LA3A 2A5YB 4G6DA 2VC1A 1YIOA 4LK1F 1IXCA 4EJWA 1H0MA 1XDUA 2CQKA 2IW5A 2VBWA 2F5DA 2GWRA 2RDPA 4A12A 2BEOA 4U0WA 4AD9A 3K1PA 5CVIA 2HR3A 1O3RA 5CVRA 5DUKA 3HHHA 5LRSA 1VTNC 1IN7A 3MZYA 5HOOA 4YFXF 1U5TA 4G7OF 4L0YB 4BHCA 2PI0A 4Q48A 2PJPA 1B9MA 2CYYA 2X0LA 1ZRFA 4ENKA 4A6EA 3KEOA 1YW9A 3VEPA 4GYIA 5LHGA 2D2WA 2A68F 2MBFA 2Y0MA 4RGUA 4HF2A 3H92A 2EFQA 2UXXA 2KRFA 1W5TA 1AOYA 1O57A 4LLLA 2C6YA 1QGPA 2DPDA 3JW4A 1U78A 3L00A 1BI2A 5ED4A 2EFPA 3GXOA 1W5SA 4S05A 1KU7A 2NNYA 2P5VA 1ZAOA 5LEJA 3SHFA 2AXLA 2VN2A 1XDSA 2YPRA 4HQEA 4A0ZA 4HX4A 4R8HA 4BQAA 2XAGA 4EQQA 5HDNA 4ENNA 4LB5A 3O3KA 3MCZA 1HW2A 2EA2A 2WTEA 3GYHX 3ML6A 2QUFA 3PQKA 2CSOA 1OMIA 2CWEA 1KU2A 1JGSA 1P6RA 3ISPA 1FSEA 1HKQA 1XGSA 4A0XA 3LA7A 5LEKA 3ROUA 3I54A 2K86A 3VFZA 5IT9Z 3WTUC 2ZMEB 3ZMUA 2QWWA 1C0WA 1K6OA 2HKXA 3SZPA 1XB4A 2GIVA 4EV0A 4I2OA 3EDPA 3E6BA 4L5IA 5CVJA 2DU9A 4PDKA 5FD6A 1UHWA 2EV0A 4MNUA 1ZN2A 2Q2EA 4O6JA 3EUHA 1D3YA 3ULQB 4XBFA 1E17A 4XLNF 1L3LA 2EFWA 1CGPA 3I71A 1H9TA 4RGRA 2IA1A 1GVJA 3JTGA 4L9TA 3CUQA 1LB2A 1PUEE 3COAC 4MQ9F 5J6XA 2ZXJA 3MEXA 1IXSB 3WGIA 2P5KA 2GA2A 5ILVA 2FF4A 3JSOA 3WTYC 1BIBA 3HTUA 4WF2A 4RB3C 3F8BA 4Y15A 1HBXG 1P4WA 3KFWX 4HLYA 2W85A 3U2RA 2XKPA 1SFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLK A;  2PQ8 A;  2KKO A;  3R4K A;  2OA4 A;  1HW5 A;  3BOQ A;  3ZN0 A;  4N0B A;  3BJA A;  3FM3 A;  1I27 A;  3FMS A;  4B8X A;  2O03 A;  2KIU A;  3IL2 A;  4KDP A;  2H6C A;  3T0Y A;  4U0Y A;  2FXA A;  3K1M A;  1W7P A;  3FHZ A;  3WTT C;  2Q8K A;  5F1R A;  4D0P A;  4Q4Z F;  2CO5 A;  1ZGA A;  2QQB A;  2EB7 A;  4LLG F;  1MD0 A;  2K7L A;  2VON A;  2J5P A;  2PFB A;  4NHJ A;  3CUO A;  4XSZ F;  5FFX A;  3LAP A;  1XGO A;  3LAJ A;  1XSD A;  3HRT A;  3FXR A;  3ZMD A;  4U7B A;  4Z2Y A;  3QPT A;  4CYD A;  1T38 A;  1CF7 A;  2DQL A;  1FPQ A;  2EV6 A;  1G3S A;  1ZYR F;  3WTS C;  3K2Z A;  4HA8 A;  2G9W A;  2LF8 A;  2W84 A;  4BHP A;  2MA3 A;  2VBX A;  4U88 A;  1R58 A;  1V4R A;  1JXS A;  3CDH A;  4LMY A;  3I53 A;  1Y0U A;  3FXQ A;  4YG2 F;  1QZZ A;  1I1S A;  2DBB A;  2XRN A;  2VOP A;  3LFK A;  4P55 A;  4MEX F;  1QO0 D;  2K4B A;  2MLK A;  1DPR A;  3ZMV A;  1Z9C A;  3D0S A;  2JT1 A;  1G6N A;  2JTV A;  2E1C A;  1BBY A;  2L02 A;  4M72 A;  3IKV A;  4L9V A;  5D6E A;  4A0Y A;  3TDZ C;  4K2E A;  1KU3 A;  3M8F A;  3BJ6 A;  2B0L A;  3CUQ B;  2K4J A;  4ESJ A;  1F9N A;  4AWX B;  5L3F A;  5FB2 A;  3V4G A;  1IW7 F;  3M9A A;  1DDN A;  5LGT A;  4R79 A;  5HS8 A;  5LLQ A;  3ERE D;  4PGG A;  4MQV A;  3ZPL A;  4EJV A;  1FYK A;  3RKY A;  1D5V A;  1YFH A;  4UV8 A;  3P9I A;  4OMY A;  2RVC A;  4LG0 A;  4RAY A;  3WE2 A;  3ABT A;  4Y13 A;  3C1D A;  2CW0 F;  1W7P D;  2V9V A;  1R1V A;  1XN7 A;  5CVV A;  4RAZ A;  3SFZ A;  2EWN A;  2LF7 A;  2XHK A;  3TGN A;  3T8T A;  4EGY A;  3KE2 A;  2XAJ A;  2JRT A;  3LQR A;  2QYO A;  2UXN A;  2FSW A;  3M8E A;  4EM2 A;  1ULY A;  3QRF F;  5L3C A;  1TLH B;  3DV8 A;  2BYV E;  3CTA A;  3QPH A;  4MTD A;  3GO5 A;  2EJR A;  4DNC A;  2UWM A;  5HDK A;  2O61 A;  4HV5 A;  5DCM A;  4M9S A;  5ICF A;  4M9X A;  2RKH A;  3GVA A;  5ICE A;  1UCR A;  5LGU A;  5K5R A;  2QM3 A;  4P9U A;  1Z91 A;  1BM9 A;  4HF1 A;  1R22 A;  3FF5 A;  1J59 A;  1UST A;  1FP1 D;  2MD5 A;  2OZU A;  3GLX A;  3T1B A;  1K79 A;  3R0J A;  1XGM A;  2ZKZ A;  2A69 F;  1S7A A;  4IRH A;  1P4X A;  5DEQ A;  1U6G A;  3P9K A;  3HOS A;  1KQ8 A;  2DI3 A;  5L3G A;  3BPX A;  3WTW C;  4WWC A;  3KZY A;  2CG4 A;  2XIG A;  3QU3 A;  3F23 A;  1B9N A;  4WXH A;  1WSU A;  2DLL A;  3S2W A;  4HAM A;  2ISY A;  2ELH A;  4KIB A;  1EH8 A;  1HKS A;  1XSV A;  3E6M A;  4OIO F;  4KMF A;  2KIM A;  1UFM A;  3EQL F;  3NRV A;  1SMY F;  1U5T B;  4FX0 A;  2QEN A;  3DPL C;  1KYW A;  2K02 A;  4M74 A;  4N9H A;  4WXD A;  3KP3 A;  2IA0 A;  2COM A;  2H09 A;  1YS7 A;  5HLI A;  3CUQ C;  1WRJ A;  1WWX A;  4IRI A;  4HV6 A;  2YR2 A;  3GEZ A;  4GGG A;  2GQQ A;  3GF2 A;  1HST A;  1BJA A;  3U1D A;  5L3B A;  1S29 A;  1P2F A;  1XD7 A;  2NYX A;  4KIG A;  2JPB A;  3W6K B;  3BP8 A;  2H6B A;  3M7G A;  3EYY A;  1E2X A;  4ETS A;  2JZY A;  2XGX A;  1I5Z A;  2GZW A;  3T8R A;  1WI9 A;  4EM1 A;  5E18 F;  1TQI A;  2E7W A;  2IRF G;  3FMR A;  3WG9 A;  2A3S A;  2LDU A;  4OIP F;  1IF1 A;  1BI1 A;  5AON A;  3EYI A;  2Z9O A;  2FNP A;  3DFG A;  3TO9 A;  4LB6 B;  2IA2 A;  1HQC A;  3P9C A;  1FY7 A;  3OOP A;  1YLF A;  1GHC A;  1ZRC A;  3GFL A;  3E3V A;  1T2K A;  3GW2 A;  1BI0 A;  2P6T A;  3L9F A;  1U2W A;  1V3F A;  1ZHF A;  5IT9 K;  2HYG D;  4ENM A;  4RB2 C;  4IHS A;  3E5X A;  2VE9 A;  1Z7U A;  2M5W A;  2MH9 A;  3BDD A;  4EJU A;  1GXP A;  2GXB A;  2EA4 A;  2IVM A;  1B6A A;  3JAM Z;  1K78 A;  1Q1H A;  4I98 B;  3FM5 A;  3HIF A;  5E17 F;  4UVC A;  1FBS A;  3WTV C;  1EH6 A;  1WQ2 A;  4AIH A;  1IN6 A;  4G94 A;  5ERI A;  5D8K B;  5H6Q A;  1HKT A;  1R5H A;  1LQ1 A;  4R1H A;  2ZBK A;  4ASN A;  1AWC A;  1SMT A;  2VT2 A;  1KA8 A;  2VOO A;  3RTR A;  4QLC U;  2P7V B;  2RN7 A;  4OIR F;  5E8G A;  5TJJ A;  1IN4 A;  1WKM A;  2GA1 A;  1FOK A;  1IZ1 A;  3HRS A;  2ZNY A;  3U9G A;  3O2P E;  3E97 A;  3MQ0 A;  2IP2 A;  1T0F A;  2LKP A;  1PP8 F;  4KUM A;  4Q47 A;  1U8R A;  2F5E A;  4CZZ A;  3BZ6 A;  5JFR A;  2LNB A;  5FD5 A;  2VBY A;  1XCV A;  1G4D A;  3PQJ A;  4ENJ A;  3N97 A;  2M45 A;  2V6C A;  2DPU A;  2FML A;  5LHH A;  3P7N A;  3FX3 A;  2FNA A;  1O3Q A;  3BWG A;  1UHM A;  4BNC A;  3E5Q A;  3HOT A;  2OQG A;  3ZP5 A;  4Q5S F;  3C7J A;  4IJA A;  3Q9V A;  5EEH A;  1P4A A;  2EFN A;  1OR7 A;  3IWF A;  2CFX A;  4CGZ A;  3LWF A;  1TW2 A;  3EET A;  3GZ5 A;  1S6L A;  2Z3Y A;  2W57 A;  1ZLJ A;  4RGX A;  2O3F A;  5HVQ C;  3VB2 A;  4ZYD A;  4EVI A;  2XKO A;  2QLZ A;  4AVP A;  4OU0 A;  2L54 A;  4ZZL A;  1YW7 A;  2Z33 A;  2DO7 A;  3K9T A;  3I58 A;  4IPA A;  2MC3 A;  5FFZ A;  5LGN A;  2FRH A;  1OYI A;  1NHA A;  3W6J B;  3I0T A;  2BV6 A;  4G8X A;  2EV5 A;  4IXA A;  5BMZ A;  2M1B A;  1REP C;  2P7C B;  1USS A;  4ESF A;  3TO7 A;  4FX4 A;  2M8E A;  4U0V A;  1U5T C;  1J0R A;  5DYM A;  3KP4 A;  5H20 A;  2ADU A;  4BAY A;  1YYV A;  3BPV A;  4WK8 F;  1Z6R A;  2HQR A;  5D8L B;  2HGC A;  4XLP F;  1RNL A;  2JPC A;  5HS9 A;  2D45 A;  1MDM A;  1MKM A;  1FBQ A;  1SFE A;  2XAH A;  2DFI A;  2QZ8 A;  1FWZ A;  3IKT A;  2XV4 S;  5CLS A;  2H27 A;  2VC0 A;  4HOB A;  3I5U A;  3L2C A;  2QBY A;  3Q5F A;  5JR3 A;  5E1Z B;  4CHU A;  4JQF A;  1K78 B;  1XMA A;  3DPT A;  5DUI A;  1BI3 A;  1SFX A;  4IF4 A;  5A2Q K;  1SD6 A;  3ABU A;  3LST A;  1JHF A;  5D5U B;  5DCM B;  1SD7 A;  2HTJ A;  2QQ9 A;  3F21 A;  3R6S A;  5E1W A;  2WWY A;  3I59 B;  3HSF A;  5K1Y A;  3R60 A;  4BYY A;  1ZH5 A;  1FLI A;  3GFJ A;  5F64 A;  2XAQ A;  1R5G A;  3KET A;  2E7X A;  3B73 A;  1ZGJ A;  3I59 A;  4HYE A;  3V8J A;  1OKR A;  1W7P B;  2DTR A;  4G6Q A;  2DQR A;  3KP7 A;  3JSP A;  1KYZ A;  2OAZ A;  2P4W A;  3WGH A;  5AIQ A;  3KEQ A;  1TNT A;  3C18 A;  2DK5 A;  5JHU A;  1ON1 A;  4MGR A;  2XRO A;  2O0Y A;  3RKW A;  5BS6 A;  2V1D A;  1XCB A;  1ZAR A;  3GWZ A;  3ECO A;  3R61 A;  2HOE A;  3F8F A;  1YTY A;  1TQP A;  3F8M A;  5D4S A;  1IAW A;  3DXJ F;  3TOB A;  1JE8 A;  2RC4 A;  4LFU A;  5KVR A;  1F4K A;  1RI7 A;  2BE5 F;  3RKX A;  2L4M A;  1YO5 C;  4QWQ A;  2FU4 A;  3T5X A;  1QZY A;  3KP2 A;  4I09 A;  5E20 A;  1FNN A;  1T6S A;  1IUY A;  1ZG5 A;  3QOP A;  2F2E A;  4KYW A;  1MJB A;  4HBL A;  1YW8 A;  5AIP A;  5HLH A;  1K7A A;  1X3U A;  4PGH A;  4GYG A;  4O3M A;  3HYI A;  1YG2 A;  3CLO A;  4G9Y A;  2RV8 A;  3E6C C;  4CDG A;  4CXF A;  2GAU A;  3VOD A;  3BRO A;  2MH2 A;  1KQ0 A;  3KZZ A;  2YX4 A;  2YU3 A;  4S04 A;  5JVT A;  2G7U A;  4YFK F;  2STT A;  1RIO H;  1Z05 A;  2GXG A;  1R1U A;  1ON2 A;  1TTY A;  2PG4 A;  3ZMZ A;  3RYP A;  1G3Y A;  3HTS B;  4I01 A;  2VT3 A;  4O5V A;  1ONV A;  2OD5 A;  2EFO A;  4NB5 A;  6PAX A;  1OPC A;  4LK0 F;  1S3J A;  5HLG A;  3NQO A;  4OMZ A;  3GFM A;  4L0Z B;  4P96 A;  1S7O A;  2V1U A;  5KK1 A;  3HUG A;  4ZH4 F;  4EGZ A;  4RS8 A;  1ZG1 A;  5L3E A;  4OIN F;  1MJ9 A;  2PMU A;  2ESH A;  4L18 B;  4MTE A;  3H3Z A;  4HF0 A;  4MHG A;  1FP2 A;  4BHB A;  4YFN F;  1STZ A;  1LDK B;  3G3Z A;  3FZV A;  4I0A A;  4ZYE A;  1FC3 A;  3V8K A;  4BXU A;  1I6X A;  2NAZ A;  1W4M A;  2D1V A;  5H6R A;  2X4H A;  1IRF A;  2O6G E;  1IN5 A;  4KT5 C;  3TO6 A;  3MWM A;  1J5Y A;  1J9I A;  5IT3 A;  4M9Z A;  4ZZD A;  4HDU A;  1IRG A;  3V7C A;  1DP7 P;  5FO5 A;  4EJT A;  1MGT A;  1LEA A;  4L5J A;  1TW3 A;  4L9J A;  5HDG A;  3J80 Z;  5FLX Z;  1BC7 C;  4LLN A;  2L3D A;  3HSR A;  2ESN A;  1D8K A;  5J8C A;  1A04 A;  2LSO A;  2HFH A;  3V8L A;  1D8J A;  4HX7 A;  3DKW A;  2FEZ A;  2DK8 A;  5LHI A;  3ZQ7 A;  3QAH A;  4PCQ A;  1SD4 A;  2QQA A;  1HSJ A;  3SQN A;  2D1H A;  4OIQ F;  5D5X B;  3JAM K;  2BGC A;  3RJP A;  1F1Z A;  3OV8 A;  1MZB A;  1FYL A;  2RNJ A;  4YIF A;  2F5C A;  1IN8 A;  3D5L A;  2R7F A;  3CJN A;  1ZRE A;  5J8F A;  1RUO A;  3ZMT A;  3J80 K;  2PLY A;  1BIA A;  4LGW A;  3E5U A;  2A07 F;  2H94 A;  4FT8 A;  1FYM A;  3IC7 A;  2VXZ A;  4A5M A;  5HS7 A;  1LJ9 A;  5L3D A;  5D5V B;  3KP5 A;  4AIK A;  2A61 A;  2E1N A;  2OQR A;  3Q9S A;  3JTH A;  3F72 A;  4UNO A;  2MLG A;  3M1E A;  2BBY A;  1R1T A;  4WX9 A;  2IT0 A;  1ZG3 A;  1R7J A;  2ZNZ A;  5ICC A;  3K1N A;  2A6H F;  2ZME A;  2Y48 A;  4A5N A;  4CO8 A;  3WU1 B;  4G7Z F;  4N9I A;  4DQ2 A;  4I02 A;  3RYR A;  3RDI A;  1G3T A;  4UVB A;  5CVU A;  3CO6 C;  2ZJ2 A;  2FBI A;  3FMQ A;  3F8C A;  1LNW A;  2FBH A;  2HDC A;  3MAJ A;  4EJO A;  3BJO A;  4UVA A;  1TNS A;  3GUD A;  5BPD A;  2J5O A;  2HEO A;  3B02 A;  1DPU A;  5K5O A;  4I0B A;  3J81 Z;  3J7A O;  1MJA A;  1SD5 A;  2OU2 A;  3DF8 A;  3MFK A;  5FGM A;  1JHH A;  4KA4 A;  1HXD A;  1SAX A;  3BY6 A;  5BOX A;  3H3U A;  3TDU C;  3IWZ A;  4EMS A;  2JSC A;  2HZT A;  2K27 A;  4RGS A;  3GX4 X;  3GZ6 A;  5ILS A;  1TQM A;  3SXY A;  3K69 A;  1I1G A;  5ICG A;  4KNY A;  4IRG A;  2V1X A;  3O6B B;  1B4A A;  2DAO A;  4RB0 A;  1XMK A;  3R0A A;  2F5F A;  1LVA A;  4M73 A;  1XGN A;  3F6O A;  3V7R A;  2W25 A;  3IRQ A;  1MDM B;  1PDN C;  1R23 A;  2OZ6 A;  3C3W A;  1T39 A;  1B59 A;  4FHT A;  4AIJ A;  1BN5 A;  5DDG A;  1DUX C;  4XRF A;  3I64 A;  4UXN A;  4HW0 A;  4L9N A;  3F8N A;  2QBY B;  5FLX K;  3AAF A;  2XVC A;  5DD8 A;  4OOI A;  3FWE A;  3QU6 A;  3TOA A;  3ELK A;  3F6V A;  3HSE A;  2STW A;  1L0O C;  4P9F A;  4LD5 A;  3DP7 A;  1RUN A;  2IPQ X;  3HHG A;  4KN4 X;  3CO7 C;  3FXU A;  3N4M A;  5CJ9 A;  2XUB A;  4GCV A;  4I7H A;  3LA2 A;  3L09 A;  2PN6 A;  1XSX A;  2FMY A;  2P5L C;  4ON0 A;  2FOK A;  1G3W A;  1FBU A;  1HW1 A;  3WOD F;  3NEU A;  2Z5U A;  2OBP A;  4MEY F;  1J7K A;  1J2X A;  1Z1D A;  2YSR A;  3QP6 A;  2UZK A;  3WE3 A;  1EH7 A;  2DT5 A;  3ZMS A;  2WC2 A;  2HS5 A;  1KGS A;  4HQM A;  4UHT A;  4RB1 A;  5LRR A;  2FA5 A;  4GXO A;  2Z99 A;  1OYW A;  1QNT A;  5DCF A;  5JI6 A;  5DD4 A;  4A6D A;  1FSH A;  1BC8 C;  3IHU A;  2QVO A;  1QQI A;  4M71 A;  4KIF A;  4M6Y A;  4JK1 X;  4GO1 A;  2RGV A;  3WGG A;  3RPQ A;  2W24 A;  2HWV A;  1EV7 A;  2NNN A;  1U3E M;  2CGP A;  1YQA A;  4EM0 B;  1B1B A;  1BOA A;  2VE8 A;  3QP5 A;  1O3S A;  2P8T A;  1YS6 A;  4KIC A;  3L7W A;  3HRM A;  1F5T A;  4ZYG A;  2P6S A;  3F3X A;  1PP7 U;  3DQV C;  5D4R A;  2L01 A;  4KFC A;  1CF7 B;  1FZP B;  2PMH A;  1GXQ A;  4ESB A;  2R3S A;  3KCC A;  3SZT A;  3KLN A;  1R36 A;  3WTX C;  3KLO A;  2ETH A;  2O8X A;  1TBX A;  3VOE A;  2TDX A;  4YII A;  4M6X A;  2HTS A;  1O7L A;  3TKY A;  4WCG A;  4NQW A;  2FBK A;  2DW4 A;  2IJL A;  3ZN1 A;  5D5W B;  1Z6T A;  1QPM A;  5TRD A;  1T98 A;  5DV5 A;  4BH9 A;  1ZRD A;  5E1X A;  2M30 A;  1ODD A;  3WU0 A;  2YX7 A;  4IVN A;  3TQN A;  5CYV A;  3LQQ A;  2AS5 F;  2PEX A;  1LEB A;  2HQN A;  2EK5 A;  1R00 A;  2KIF A;  4E70 A;  4CIC A;  3HRU A;  5D6F A;  1H9G A;  2RQP A;  1IXR C;  2V79 A;  2ZFW A;  4IHT A;  1QBJ A;  2VBZ A;  1KU9 A;  4HX8 A;  3MZH A;  2HYF A;  4XSX F;  1LDJ A;  3REO A;  1FT9 A;  1UB9 A;  1FX7 A;  2XAS A;  3DEU A;  4ZYH A;  4G7H F;  4UV9 A;  5K5Q A;  1KQ9 A;  2ZO4 A;  3F22 A;  3I4P A;  2XAF A;  4LG0 B;  3RIR A;  3J81 K;  2FE3 A;  3E6D A;  5A2Q Z;  2KJB A;  4KMU X;  1LDD A;  4PZJ A;  5E8I A;  4HLX A;  4P5O A;  3G73 A;  2HKO A;  2ZCW A;  4F7Z A;  5LBQ A;  2R7D A;  4TV7 A;  4B09 A;  3KP6 A;  5EEG A;  4UUV A;  3WTZ A;  1O7F A;  3RI4 A;  5ILU A;  4H0E A;  2A6E F;  1RZ4 A;  5BPI A;  4WXC A;  4LJZ F;  4A2U A;  3V7S A;  1OYY A;  2NS0 A;  2ACJ A;  2Q0O A;  2KJC A;  2NRA C;  4HDV A;  2WV0 A;  4Y17 A;  2G7H A;  3IRR A;  3PFI A;  2L4A A;  2PBI A;  4KN7 X;  3ECH A;  2Y75 A;  4HZF A;  1S8N A;  3K0L A;  1J75 A;  2ISZ A;  4U7D A;  5BQT A;  3GFI A;  4JBA A;  2VOD A;  2FQ3 A;  1P92 A;  1O3T A;  3RPU A;  5F6F A;  2M87 A;  3LA3 A;  2A5Y B;  4G6D A;  2VC1 A;  1YIO A;  4LK1 F;  1IXC A;  4EJW A;  1H0M A;  1XDU A;  2CQK A;  2IW5 A;  2VBW A;  2F5D A;  2GWR A;  2RDP A;  4A12 A;  2BEO A;  4U0W A;  4AD9 A;  3K1P A;  5CVI A;  2HR3 A;  1O3R A;  5CVR A;  5DUK A;  3HHH A;  5LRS A;  1VTN C;  1IN7 A;  3MZY A;  5HOO A;  4YFX F;  1U5T A;  4G7O F;  4L0Y B;  4BHC A;  2PI0 A;  4Q48 A;  2PJP A;  1B9M A;  2CYY A;  2X0L A;  1ZRF A;  4ENK A;  4A6E A;  3KEO A;  1YW9 A;  3VEP A;  4GYI A;  5LHG A;  2D2W A;  2A68 F;  2MBF A;  2Y0M A;  4RGU A;  4HF2 A;  3H92 A;  2EFQ A;  2UXX A;  2KRF A;  1W5T A;  1AOY A;  1O57 A;  4LLL A;  2C6Y A;  1QGP A;  2DPD A;  3JW4 A;  1U78 A;  3L00 A;  1BI2 A;  5ED4 A;  2EFP A;  3GXO A;  1W5S A;  4S05 A;  1KU7 A;  2NNY A;  2P5V A;  1ZAO A;  5LEJ A;  3SHF A;  2AXL A;  2VN2 A;  1XDS A;  2YPR A;  4HQE A;  4A0Z A;  4HX4 A;  4R8H A;  4BQA A;  2XAG A;  4EQQ A;  5HDN A;  4ENN A;  4LB5 A;  3O3K A;  3MCZ A;  1HW2 A;  2EA2 A;  2WTE A;  3GYH X;  3ML6 A;  2QUF A;  3PQK A;  2CSO A;  1OMI A;  2CWE A;  1KU2 A;  1JGS A;  1P6R A;  3ISP A;  1FSE A;  1HKQ A;  1XGS A;  4A0X A;  3LA7 A;  5LEK A;  3ROU A;  3I54 A;  2K86 A;  3VFZ A;  5IT9 Z;  3WTU C;  2ZME B;  3ZMU A;  2QWW A;  1C0W A;  1K6O A;  2HKX A;  3SZP A;  1XB4 A;  2GIV A;  4EV0 A;  4I2O A;  3EDP A;  3E6B A;  4L5I A;  5CVJ A;  2DU9 A;  4PDK A;  5FD6 A;  1UHW A;  2EV0 A;  4MNU A;  1ZN2 A;  2Q2E A;  4O6J A;  3EUH A;  1D3Y A;  3ULQ B;  4XBF A;  1E17 A;  4XLN F;  1L3L A;  2EFW A;  1CGP A;  3I71 A;  1H9T A;  4RGR A;  2IA1 A;  1GVJ A;  3JTG A;  4L9T A;  3CUQ A;  1LB2 A;  1PUE E;  3COA C;  4MQ9 F;  5J6X A;  2ZXJ A;  3MEX A;  1IXS B;  3WGI A;  2P5K A;  2GA2 A;  5ILV A;  2FF4 A;  3JSO A;  3WTY C;  1BIB A;  3HTU A;  4WF2 A;  4RB3 C;  3F8B A;  4Y15 A;  1HBX G;  1P4W A;  3KFW X;  4HLY A;  2W85 A;  3U2R A;  2XKP A;  1SFU A; 
#chains in the Genus database with same CATH topology
 1ZLK A;  2PQ8 A;  1RR7 A;  2KKO A;  3CES A;  3R4K A;  2K3P A;  3BTL A;  2OA4 A;  1HW5 A;  5DTD A;  3BOQ A;  3K4B A;  3ZN0 A;  4IX7 A;  3G6E I;  3BLY A;  2VJJ A;  4N0B A;  3BJA A;  3FM3 A;  1I27 A;  3FMS A;  5GAG J;  2MSY A;  2VXD A;  1T33 A;  3OYM A;  4B8X A;  4CSW A;  4KIT B;  2IBD A;  2XB5 A;  3MVP A;  1MBG A;  4M3G A;  2O03 A;  5EZH A;  2KIU A;  3IL2 A;  3KEY A;  4KDP A;  2H8R A;  1GLN A;  2H6C A;  3T0Y A;  1T08 B;  4U0Y A;  2FXA A;  3K1M A;  1W7P A;  3FHZ A;  2X6X A;  1CQT A;  2K9M A;  4BQO A;  3WTT C;  2WB1 N;  2Q8K A;  5F1R A;  4D0P A;  1FMW A;  4Q4Z F;  3S3N A;  5FLM J;  2MW8 A;  4E7S A;  3JRI A;  2CO5 A;  1ZGA A;  3OYE A;  2QQB A;  2EB7 A;  2XPU A;  3KX2 A;  4LLG F;  1MD0 A;  2K7L A;  3BCA A;  4FE7 A;  1W36 D;  4YIR X;  1TP4 A;  2VON A;  3F9K A;  2EQR A;  2J5P A;  2PFB A;  4DOZ A;  4NHJ A;  1X3Z B;  2LKS A;  1QHH D;  3CUO A;  4XSZ F;  5FFX A;  3LAP A;  1XGO A;  1IRX A;  4QSH A;  3LAJ A;  3HRT A;  1XSD A;  3FXR A;  3ONQ A;  3ZMD A;  4U7B A;  4J19 A;  4Z2Y A;  3FHN A;  3QPT A;  4CYD A;  1T38 A;  1CF7 A;  3H9G A;  5EYR A;  4CYC B;  1A5J A;  2DQL A;  1FPQ A;  2EV6 A;  1G3S A;  3U21 A;  1K4S A;  1MSE C;  5FRN A;  2PJR A;  1V55 H;  2DOA A;  2O7O A;  1K6Y A;  5J4Y A;  4A3I J;  1BR2 A;  1ZYR F;  4XLC A;  3C2H A;  3WTS C;  3K2Z A;  4HA8 A;  2G9W A;  2LF8 A;  2W84 A;  2X85 A;  1D0Z A;  3BG6 A;  1K83 J;  1YX3 A;  4BHP A;  1SC7 A;  2MA3 A;  2VBX A;  3FBI B;  4U88 A;  1R58 A;  3OYG A;  1V4R A;  1JXS A;  3CDH A;  4LMY A;  5C4X J;  5IYD J;  3I53 A;  1W0T A;  2CW8 A;  1WCM J;  1Y0U A;  3FXQ A;  4YG2 F;  3BR2 A;  1QZZ A;  1I1S A;  2DBB A;  2XRN A;  4BJT A;  2VOP A;  4HST A;  4II2 A;  1VQ5 I;  3Q0V A;  3CCE I;  2DDA A;  4II3 A;  2LH9 A;  3LFK A;  4P55 A;  4XLF A;  4MEX F;  2KL4 A;  1A36 A;  4W1U A;  1QO0 D;  2LOO A;  1UEL B;  2K4B A;  3DU6 A;  1TWC J;  3K4C A;  2MLK A;  1DPR A;  3ZMV A;  4FE4 A;  2L7M P;  1Z9C A;  2X6O A;  5K7F A;  3D0S A;  2JT1 A;  3CJR B;  2OTL I;  2WA0 A;  1G6N A;  3SZG A;  2JTV A;  3KYL A;  2E1C A;  1BBY A;  1ENH A;  2VJ5 A;  1JJ8 C;  2L02 A;  4M72 A;  3IKV A;  2YUS A;  4L9V A;  5D6E A;  4A0Y A;  2HXO A;  3H5N A;  2VQG A;  1Z3Y A;  3TDZ C;  1VQ4 I;  4K2E A;  5GTH C;  4KT6 A;  3HOV J;  2R7W A;  2DA4 A;  1KU3 A;  1W1W E;  3BJ6 A;  3M8F A;  4A3E J;  2B0L A;  2VIX A;  3CUQ B;  1H89 C;  2ZXI A;  2XSJ C;  2K4J A;  3K6G A;  1F9N A;  4AWX B;  5L3F A;  4ESJ A;  2O5R A;  1YRN B;  2CMP A;  1U9O A;  5FB2 A;  3V4G A;  1IW7 F;  3DEE A;  3MKW B;  2VPL A;  5B5E C;  4A3C J;  3M9A A;  4HEA 2;  1DDN A;  5LGT A;  1TL8 A;  1E0E A;  3VYT B;  4HNV A;  5EF6 A;  3SDG A;  2A05 A;  3ZQF A;  4R79 A;  4C9Y A;  1OCR H;  4BEH A;  5HS8 A;  1BR1 A;  5LLQ A;  2K9Q A;  3ERE D;  4PGG A;  1DU0 A;  2LY9 A;  4MQV A;  1BW5 A;  3ASO H;  3BTC A;  5K7Z A;  1H8A C;  3ZPL A;  1XMX A;  3CDI A;  2BW3 B;  2M7A A;  3FXK A;  4DYQ A;  4EJV A;  1FYK A;  3RKY A;  5E79 C;  1D5V A;  1YFH A;  4UV8 A;  3P9I A;  4OMY A;  2RVC A;  4RAF A;  4LG0 A;  4RAY A;  3WE2 A;  2DCE A;  4BGD A;  5J3L A;  3ABT A;  3VSK A;  4Y13 A;  3PM1 A;  2OF7 A;  4DJA A;  5J1Y A;  2JA2 A;  2E35 A;  3C1D A;  4KJZ A;  4XIC A;  3A1Y A;  2M3A A;  2IGK A;  2Y31 A;  4B3A A;  2CW0 F;  1RR8 C;  1W7P D;  2V9V A;  4DZP A;  1R1V A;  1UMQ A;  1XN7 A;  5F0C A;  3CLQ A;  5CVV A;  1OCP A;  4PJL A;  4RAZ A;  4BE1 A;  2IS4 A;  4X0G A;  3S1Q J;  1V5F A;  2WBM A;  3SFZ A;  2EWN A;  2LF7 A;  3JRF A;  1MBE A;  2XHK A;  1ZK8 A;  3TGN A;  2KZG A;  3T8T A;  4LG3 A;  4EGY A;  3NAR A;  3KE2 A;  2XAJ A;  2UUZ A;  2E2I J;  2JRT A;  1IV8 A;  2EZL A;  2JWT A;  3LQR A;  2QYO A;  2V7F A;  4E7J A;  2UXN A;  2FSW A;  2K5C A;  3M8E A;  3D1N I;  3GTK J;  4EM2 A;  3N05 A;  1ULY A;  3X2Q H;  3QRF F;  4F52 A;  2WB1 A;  3CJT B;  5L3C A;  2KIS A;  1RES A;  4HNT A;  5FKK A;  1TLH B;  3DV8 A;  3L2V A;  2FJ1 A;  3GLL A;  2FQ4 A;  3HOW J;  2BYV E;  2EIJ H;  2CFO A;  4CCM A;  3CTA A;  1JKQ C;  1LUJ B;  3BR1 A;  1VZ0 A;  3QPH A;  4MTD A;  3GO5 A;  2EJR A;  2HU9 A;  4DNC A;  3OS1 A;  2UWM A;  3E1S A;  4IOC F;  5HDK A;  4A3J J;  2O61 A;  4HV5 A;  1D1B A;  5DCM A;  4M9S A;  5ICF A;  1FOX A;  3HL2 A;  4M9X A;  5IOZ A;  2RKH A;  3GVA A;  5ICE A;  3CCV I;  1UCR A;  4XKV A;  5LGU A;  2JUG A;  5K5R A;  1MH4 A;  3BG5 A;  2QM3 A;  3VPR A;  3K4M A;  4P9U A;  3EUK L;  3AL0 C;  1Z91 A;  1BM9 A;  3A0B C;  5IY5 H;  1R22 A;  1RPW A;  4HF1 A;  3FF5 A;  4XN3 A;  2AXT C;  3CCJ I;  1UST A;  2DOD A;  1J59 A;  1FP1 D;  2MD5 A;  2OZU A;  3GLX A;  3GTP J;  3BTJ A;  1J09 A;  3T1B A;  3O8H A;  1K79 A;  1VQ8 I;  3DKY A;  1R5I D;  1XC5 A;  3R0J A;  1XGM A;  2ZKZ A;  5FRO A;  2Y0S A;  2A69 F;  4RM3 A;  4DGW B;  4E7K A;  5FLV A;  1IC8 A;  2MYS A;  1S7A A;  3MMY B;  4UB6 C;  3HPG A;  4IRH A;  1P4X A;  2O8K A;  5DEQ A;  1U6G A;  5JLX A;  3P9K A;  5GTI C;  3HOS A;  1KQ8 A;  2DI3 A;  1BJZ A;  5L3G A;  3HGY A;  2WAF A;  1ZR2 A;  4F91 B;  3BPX A;  5J1U A;  3WTW C;  4WWC A;  2XAU A;  3KZY A;  2CG4 A;  2XIG A;  4D5F A;  1G8X A;  3I4M J;  3QU3 A;  3F23 A;  3GME A;  1MSF C;  1B9N A;  4WXH A;  1NK3 P;  1WSU A;  3BG3 A;  4CUG A;  2DLL A;  2WAD A;  3S2W A;  1Z67 A;  1EJ9 A;  4HAM A;  2ISY A;  2ELH A;  4KIB A;  1EH8 A;  1ZKG A;  2CV0 A;  1WJC A;  1HKS A;  2JMW A;  1XSV A;  3E6M A;  3BQZ A;  1W0U A;  2IGN A;  4OIO F;  1Z0X A;  4KMF A;  2KIM A;  1UFM A;  3EQL F;  4YEL A;  2E5N A;  3NRV A;  1SMY F;  1U5T B;  2D5V A;  1NH3 A;  3NWS A;  2LBF A;  1WJ5 A;  4FX0 A;  2QEN A;  3DBL B;  2EIM H;  2XSD C;  1LFU P;  4A93 J;  3DPL C;  1JKP C;  1VF9 A;  1KYW A;  2K02 A;  1EKE A;  4M74 A;  4N9H A;  4WXD A;  2GIZ A;  3KP3 A;  2KDZ A;  1VQL I;  2IA0 A;  2COM A;  2H09 A;  4LIV A;  1YS7 A;  5HLI A;  3CUQ C;  5J1R A;  1WRJ A;  1WWX A;  4IRI A;  4HV6 A;  2YR2 A;  1N25 A;  3GEZ A;  4GGG A;  1DQU A;  1I50 J;  2VKE A;  2GQQ A;  3GF2 A;  2RAE A;  1HST A;  2BOL A;  1S9H A;  4MFD A;  1BJA A;  3P5J A;  3U1D A;  1S29 A;  5L3B A;  1P2F A;  1XD7 A;  2NYX A;  2XPW A;  2JPB A;  4KIG A;  3W6K B;  4AID A;  2F6C A;  3BP8 A;  5FJ8 J;  2H6B A;  1VQP I;  3M7G A;  3EYY A;  4B47 A;  2V9K A;  3OSG A;  1E2X A;  4ETS A;  1TWG J;  2JZY A;  1QHG A;  3FXL A;  1X4P A;  4A3B J;  3A03 A;  2F4I A;  2GOX B;  2XGX A;  1I5Z A;  3V42 A;  2GZW A;  3W3C A;  3T8R A;  2IS6 A;  1WI9 A;  2LG4 A;  4EM1 A;  1BA5 A;  2QKL B;  5E18 F;  1TQI A;  5FRM A;  2W1O A;  2E7W A;  2XF7 A;  5GAH J;  2M0M A;  2H1L A;  1TWH J;  2E71 A;  2IRF G;  1AHD P;  1R4N B;  3FMR A;  2X51 A;  2LP0 A;  5H2F C;  3WG9 A;  2LBF B;  2A3S A;  1ETK A;  5KNL A;  2LDU A;  4E7L A;  1DGW Y;  1QPI A;  4OIP F;  1IF1 A;  1BI1 A;  5AON A;  3EYI A;  1Y1V J;  2PJR B;  2Z9O A;  5C4J J;  1W36 C;  3SJM A;  4BE2 A;  3OYC A;  1ZR4 A;  2XRL A;  2FNP A;  3MKY B;  2DJI A;  3DFG A;  3JRG A;  1QA6 A;  3TO9 A;  2CQ7 A;  4LB6 B;  2IA2 A;  1I6H J;  1HQC A;  3P9C A;  3DTE A;  3MKL A;  1FY7 A;  4CYC A;  3OOP A;  2VKH A;  1YLF A;  1GHC A;  1N75 A;  2V1N A;  3GFL A;  1ZRC A;  3ZXS A;  3SFI A;  1YJ9 I;  3E3V A;  1T2K A;  2XB0 X;  3GW2 A;  1BI0 A;  2P6T A;  3L9F A;  1U2W A;  2VQH A;  1XS9 A;  3OYL A;  1V3F A;  1ZHF A;  5EZG A;  5IT9 K;  2HYG D;  2K9L A;  4ENM A;  4RB2 C;  1IGN A;  4IHS A;  1S72 I;  1ITY A;  3E5X A;  4ZDP A;  3HKZ A;  2VE9 A;  2X9D A;  1Z7U A;  2M5W A;  2MH9 A;  3HOX J;  3BDD A;  4HSR A;  4EJU A;  3BC8 A;  1Y8R B;  1GXP A;  2GXB A;  1X58 A;  2OTJ I;  3DLA A;  2EA4 A;  2IVM A;  1B6A A;  3JAM Z;  1K78 A;  1Q1H A;  4I98 B;  3FM5 A;  3MZ8 A;  1R4M B;  4NC7 A;  2R7O A;  2JN6 A;  3HIF A;  4B44 A;  5E17 F;  1VQK I;  3HDD A;  4C2M J;  4UVC A;  4PFP A;  1FBS A;  3HBL A;  3WTV C;  1EH6 A;  1WQ2 A;  4AIH A;  1R49 A;  1JTY A;  1LFB A;  3WG7 H;  1TZL A;  4JX4 A;  3LFU A;  1IN6 A;  5EG0 A;  3ZRG A;  4G94 A;  1GT0 C;  2ZME C;  5ERI A;  5D8K B;  5H6Q A;  2VJ4 A;  1D1A A;  1HKT A;  1R5H A;  2E36 A;  2LMD A;  4AU7 A;  1LQ1 A;  4R1H A;  3DPU A;  2ZBK A;  4ASN A;  2LD5 A;  3HM5 A;  1YE9 A;  4BXX J;  2KQR A;  3CQZ J;  1SMT A;  4IZZ A;  1AWC A;  2VT2 A;  3QOD A;  3FDY A;  1KA8 A;  2VOO A;  3PNY A;  3RTR A;  4QLC U;  4IO9 F;  4IL6 C;  2P7V B;  5C44 J;  2M34 A;  3OL4 A;  2R7Z J;  3S16 J;  2RN7 A;  2TRT A;  3RCO A;  4OIR F;  5E8G A;  5TJJ A;  2M9H A;  3GTG J;  1IN4 A;  1WKM A;  1FEX A;  2M2E A;  2GOM A;  4BXF A;  2R0Q C;  3RQ4 A;  5LD2 C;  2E19 A;  1VI0 A;  3GTQ J;  2GA1 A;  1N77 A;  1PJR A;  1FOK A;  1IZ1 A;  1HCR A;  3HRS A;  1OLT A;  2ZNY A;  3I3L A;  2BVL A;  3D5S C;  3U9G A;  4F3Q A;  3O2P E;  1RRJ A;  3E97 A;  3B6A A;  3HXL A;  3MQ0 A;  1A6Q A;  2IP2 A;  1T0F A;  2KDO A;  3RKQ A;  2LKP A;  3NWT A;  1PP8 F;  4KUM A;  4Q47 A;  1U8R A;  2Z16 A;  2F5E A;  4CZZ A;  3BZ6 A;  5JFR A;  2LNB A;  5FD5 A;  3TED A;  4BJ6 C;  4NDL A;  2VBY A;  2W00 A;  1EF4 A;  1XCV A;  4V19 K;  4JP0 A;  1G4D A;  3PQJ A;  1SVL A;  4ENJ A;  3N97 A;  1D0Y A;  2M45 A;  2V6C A;  2DPU A;  1T56 A;  2FML A;  3CC2 I;  5K7H A;  5TIS C;  5LHH A;  3P7N A;  2NOG A;  3FX3 A;  5J40 A;  3CC4 I;  2FNA A;  1O3Q A;  3BWG A;  1UHM A;  4BNC A;  4BY7 J;  3E5Q A;  5E3O A;  2QF7 A;  1D0X A;  3K10 A;  3HOT A;  2OQG A;  4D1Q A;  2QEX I;  3ZP5 A;  4ZYA A;  4Q5S F;  2CV1 A;  2LLK A;  3C7J A;  2HDW A;  4IJA A;  3Q9V A;  4CZC A;  5EEH A;  3MN2 A;  1P4A A;  1HA8 A;  2EFN A;  1ZGW A;  1OR7 A;  3IWF A;  2CFX A;  2R7R A;  4A69 C;  4CGZ A;  3QYB A;  3LWF A;  1TW2 A;  3EET A;  1QVT A;  3GZ5 A;  1P9Q C;  3CP2 A;  2OV7 A;  2F48 A;  1XPX A;  1S6L A;  2Z3Y A;  2W57 A;  4N4O B;  1HDP A;  1TT5 B;  1ZLJ A;  3FXO A;  4RGX A;  5CPR B;  2O3F A;  5EEA A;  5HVQ C;  3L2W A;  3VB2 A;  3LL7 A;  3QYF A;  1IDY A;  2KRH A;  4FCY A;  3ABK H;  1KZH A;  4ZYD A;  2R7T A;  3S8P A;  4EVI A;  2XKO A;  1I39 A;  4H4K C;  2QLZ A;  4XKC A;  4XOR A;  4AVP A;  4OU0 A;  2L54 A;  4ZZL A;  2P81 A;  4UUS A;  1YW7 A;  4A3M J;  2Z33 A;  1WJD A;  2DO7 A;  2HDD A;  4UB8 C;  2CU7 A;  3K9T A;  3I58 A;  4XMY A;  3ZQL A;  5FKL A;  4IPA A;  2MC3 A;  3VDX A;  2JQ7 A;  5FFZ A;  5LGN A;  3K4N A;  2FRH A;  3L1P A;  1OYI A;  1RC9 A;  2K3F A;  1NHA A;  3W6J B;  3I0T A;  2BV6 A;  3G1M A;  1OCZ H;  4G8X A;  2EV5 A;  3JR9 A;  2MFZ A;  4IXA A;  5BMZ A;  2M1B A;  3PO2 J;  2YU9 J;  2NS8 A;  1REP C;  3LSG A;  2P7C B;  3ESW B;  1USS A;  4ESF A;  2X6Y A;  1WPK A;  3TO7 A;  4FX4 A;  2M8E A;  4U0V A;  1ETV A;  1JGG A;  1U5T C;  4CA0 A;  1OFC X;  1J0R A;  5DYM A;  3HOU J;  2CH0 A;  3KP4 A;  3QPS A;  4Y4R A;  5H20 A;  2ADU A;  3OR1 C;  4JOM A;  4BAY A;  4DYR A;  4EAT A;  1ERD A;  5KCM A;  1YYV A;  2QGU A;  2CUZ A;  3GTJ J;  3BG9 A;  3H1C A;  4YRV A;  3TW6 A;  3BPV A;  2ZXW H;  3BQY A;  4WK8 F;  2L2O A;  1Z6R A;  2HQR A;  2JA5 J;  3FK6 A;  5D8L B;  1IG7 A;  4ZTJ A;  2HGC A;  4XLP F;  2XF5 A;  1RNL A;  2JPC A;  2LFB A;  3AKZ A;  5HS9 A;  1IRZ A;  3K70 C;  1WJF A;  2WAQ N;  3FKJ A;  3LOC A;  2L7F P;  2D45 A;  1X19 A;  4XON A;  1MDM A;  2E2H J;  3CMA I;  1Y39 A;  2FD5 A;  1MKM A;  1FBQ A;  1SFE A;  3M8J A;  2XAH A;  3RQI A;  4BKX A;  2DFI A;  2QZ8 A;  1FWZ A;  3IKT A;  2RNG A;  2LC2 A;  2XV4 S;  4MFE A;  5CLS A;  2MD0 A;  3WHC A;  2H27 A;  2M0C A;  2DOF A;  2VC0 A;  3OWT A;  4ITV A;  2I10 A;  3I5U A;  4HOB A;  5JVG F;  3L2C A;  3U1K A;  2QBY A;  3Q5F A;  2CV2 A;  1MMS A;  3EPZ A;  5JR3 A;  5E1Z B;  3J7Z I;  1YHQ I;  1FOW A;  4CHU A;  4JQF A;  1XMA A;  2WY7 Q;  1K78 B;  1Y0N A;  3DPT A;  5DUI A;  1BI3 A;  1SFX A;  4IF4 A;  5A2Q K;  1JKR C;  1SD6 A;  3ABU A;  2LRD A;  3LST A;  1JHF A;  1AKH B;  5D5U B;  2V26 A;  4F92 B;  5DCM B;  2GM4 A;  1SD7 A;  2CUE A;  2CW7 A;  2HTJ A;  2QQ9 A;  5HOD A;  3F21 A;  2DOE A;  3R6S A;  5E1W A;  2WWY A;  4NQW B;  1MW7 A;  3I59 B;  3HSF A;  1Y8Q B;  4BQQ A;  5K1Y A;  3R60 A;  4BYY A;  4ABZ A;  1ZH5 A;  1FLI A;  3GFJ A;  1QU3 A;  5F64 A;  3FKI J;  4XK4 A;  1Q1V A;  2QQ8 A;  1UHS A;  2B7E A;  2XAQ A;  1V5E A;  1R5G A;  4RBO A;  5TGT A;  3W2V A;  2I8D A;  3KET A;  3A4C A;  5EJC A;  2E7X A;  2XF6 A;  3B73 A;  1ZGJ A;  3I59 A;  4HYE A;  3JRB A;  3V8J A;  2V9P A;  2KMU A;  1OKR A;  2JA6 J;  2A5W A;  1W7P B;  3S1M J;  3DU5 A;  1G59 A;  2DTR A;  4G6Q A;  2DQR A;  3KP7 A;  5CKT A;  3JSP A;  3A01 B;  1KYZ A;  1OJL A;  3OYB A;  2OAZ A;  2P4W A;  4RMN A;  1WI3 A;  3WGH A;  4DIQ A;  3BR6 A;  5AIQ A;  3CF5 F;  1YJW I;  4BU2 A;  2EH3 A;  4E7H A;  1VQN I;  3ZQG A;  3KEQ A;  1TNT A;  3C18 A;  2DK5 A;  1JKO C;  5JHU A;  3JRA A;  2RRE A;  1ON1 A;  3CDL A;  4MGR A;  2O0Y A;  2AQE A;  2IXS A;  3RKW A;  5BS6 A;  2XRO A;  2V1D A;  1XCB A;  2XGE A;  4G6T B;  2ELJ A;  1ZAR A;  3WHB A;  4E7Z A;  5BNG A;  3GWZ A;  4V2G A;  4AYB A;  1QRY A;  3ECO A;  3R61 A;  1FJL A;  2EIL H;  3AG3 H;  3EUH C;  2HOE A;  3F8F A;  1YTY A;  1A35 A;  1TQP A;  2KT0 A;  3F8M A;  2VL8 A;  3G1O A;  3DXJ F;  5D4S A;  1IAW A;  3HJE A;  3TOB A;  4BE0 A;  1JE8 A;  2L7Z A;  2RC4 A;  5GPC A;  2KFD A;  3SEZ A;  4LFU A;  5KVR A;  3UKG A;  1F4K A;  1FOY A;  4S0H B;  1RI7 A;  2BE5 F;  3ZOB A;  4LIU A;  3RKX A;  3PSI A;  1SEU A;  2L4M A;  1YO5 C;  4QWQ A;  2FU4 A;  1POG A;  3JCU C;  3T5X A;  3W2W A;  1QZY A;  3KP2 A;  4I09 A;  5E20 A;  1FNN A;  1T6S A;  1IUY A;  1ZG5 A;  3QOP A;  5DS9 A;  2F2E A;  5HNH A;  3GZN B;  4KYW A;  1MJB A;  4HBL A;  1YW8 A;  5AIP A;  5HLH A;  1O4X A;  1X3U A;  1K7A A;  4PGH A;  2R7X A;  3BT9 A;  4GYG A;  4O3M A;  3HYI A;  1YG2 A;  3CLO A;  4G9Y A;  2RV8 A;  3E6C C;  5FKO A;  1OCO H;  4CDG A;  4BDY A;  3TW7 A;  1XX5 A;  2GAU A;  2QSF X;  4MLO A;  4CXF A;  3QOE A;  3QYE A;  3VOD A;  2K9N A;  3BRO A;  2F4M B;  2MH2 A;  2GLO A;  3W2A A;  5IPA A;  2DA1 A;  1KQ0 A;  3DKX A;  3KZZ A;  3OIP A;  5IP7 J;  3HZJ A;  5B3S H;  2YX4 A;  2YU3 A;  4S04 A;  4I6Z A;  2HPM A;  5JVT A;  2G7U A;  4YFK F;  2STT A;  1MNM C;  1RIO H;  2BXZ A;  4C30 A;  1OCC H;  2QKM B;  1Z05 A;  2GXG A;  1TTY A;  1R1U A;  1BOB A;  1ON2 A;  2PG4 A;  4ZTF A;  2DA7 A;  4N4N B;  3ZMZ A;  1JI8 A;  1SVO A;  2FX0 A;  3RYP A;  3TBI A;  1G3Y A;  2CS3 A;  3HTS B;  4I01 A;  3G71 I;  1FIP A;  4BAC A;  2BZT A;  2XC7 A;  2VT3 A;  3IH4 A;  5F0F A;  4O5V A;  2E1M B;  1ONV A;  4G12 A;  2DFF A;  3KPH A;  2KLO A;  2OD5 A;  2EFO A;  4NB5 A;  3ZGK A;  1OPC A;  2OCC H;  3DTI A;  6PAX A;  4LK0 F;  1VQ6 I;  1MND A;  1S3J A;  1MMA A;  4JX5 A;  5HLG A;  4IKF A;  3NQO A;  4BL0 B;  4OMZ A;  3GFM A;  4Y7N J;  3AFH A;  5B1B H;  2R92 J;  4L0Z B;  3M4O J;  4P96 A;  1S7O A;  2UV1 A;  1R71 A;  2V1U A;  3I4N J;  2M8G X;  4IOA F;  5KK1 A;  3HUG A;  1APL C;  4ZH4 F;  1PVE A;  4EGZ A;  1R6R A;  4RS8 A;  4PJN A;  4XKW A;  3ABM H;  5L3E A;  4OIN F;  1ZG1 A;  1MJ9 A;  2PMU A;  3KIO A;  2ESH A;  4L18 B;  4MTE A;  4NC6 A;  3H3Z A;  3H35 A;  4HF0 A;  2TCT A;  4MHG A;  2DYS H;  5M3F J;  2JUC A;  1FP2 A;  3ZQC A;  3LNQ A;  4BHB A;  4YFN F;  4XLE A;  3L2R A;  2Y9Y A;  1NK2 P;  1STZ A;  1LDK B;  5E3L A;  2Y30 A;  3G3Z A;  3MD2 A;  3FZV A;  3K4J A;  2E2J J;  4I0A A;  2OUM A;  2IGM A;  4IQ4 A;  1OQY A;  4Y33 A;  4ZYE A;  1FC3 A;  2H1K A;  2O9L A;  3V8K A;  3H3V K;  4BXU A;  4C2T A;  3D5R C;  4UY8 I;  4F93 B;  3S32 A;  1I6X A;  3DCF A;  2NAZ A;  2ZXH A;  2R5Z B;  3K2A A;  1W4M A;  2DDB A;  2D1V A;  1ACI A;  1V54 H;  4A3G J;  1WZ2 A;  5H6R A;  3HEF A;  2IS2 A;  4BBR J;  2X4H A;  3JRC A;  2R5Y A;  1WJE A;  1IRF A;  2O6G E;  1IN5 A;  3FIS A;  4KT5 C;  3Q0U A;  3TO6 A;  3MWM A;  4BJ5 C;  1J5Y A;  2DFH A;  1J9I A;  4PJM A;  4D7N A;  2RQQ A;  5FKM A;  5IT3 A;  4M9Z A;  4ZZD A;  3DBR B;  2YS9 A;  4HDU A;  1IRG A;  3GTM J;  3V7C A;  1DP7 P;  2K85 A;  5FO5 A;  5HNF A;  4EJT A;  1MGT A;  2VUM J;  1LEA A;  1WH5 A;  4L5J A;  1TW3 A;  4L9J A;  2M7B A;  1MMD A;  5HDG A;  3J80 Z;  3H5A A;  5FLX Z;  1KON A;  3K4L A;  1BC7 C;  2R7Q A;  4LLN A;  2JJ7 A;  2L3D A;  3BR3 A;  2L9N A;  3HSR A;  2ESN A;  1D8K A;  2DMU A;  3Q0W A;  4CCK A;  5J8C A;  1A04 A;  2ICW G;  2LSO A;  4HG2 A;  2HFH A;  3V8L A;  4D5C A;  3S1N J;  3QQA A;  1D8J A;  4RM2 A;  4HX7 A;  3DKW A;  2FEZ A;  5EGO A;  2EIK H;  1JUP A;  3NAU A;  2HOT A;  2DK8 A;  5LHI A;  2N8G A;  3ZQ7 A;  1LE8 B;  3QAH A;  4PCQ A;  2Q1Z B;  1SD4 A;  3ZR8 X;  2KPM A;  2QQA A;  1HSJ A;  3BG7 A;  2NOJ B;  3LSK A;  5M5X J;  1RKT A;  2OCE A;  3SQN A;  3J7A Y;  2D1H A;  1DU6 A;  4OIQ F;  5EG0 B;  5D5X B;  3A0H C;  2G0E A;  5E3N A;  2F4O B;  1JT0 A;  2BGC A;  3RJP A;  1E3P A;  3JAM K;  1F1Z A;  3DWL E;  3OV8 A;  1MZB A;  1TC3 C;  2RNJ A;  1FYL A;  4XOT A;  3BR5 A;  4YIF A;  2F5C A;  1IN8 A;  5E3M A;  4X6A J;  4M3B A;  3D5L A;  1WHU A;  3E7L A;  3HKZ N;  1YIJ I;  2R7F A;  3CJN A;  1ZRE A;  3CCS I;  4GFB A;  5CQE A;  5J8F A;  1LVK A;  2X1D A;  2CRG A;  1RUO A;  1QVU A;  1JTX A;  2R4G A;  3ZMT A;  3J80 K;  2ZJR F;  2PLY A;  3IAS 2;  1BIA A;  3PSF A;  4LGW A;  3G2B A;  3E5U A;  2A07 F;  2Y9Z A;  1FTT A;  2H94 A;  4FT8 A;  3K70 D;  1FYM A;  3IC7 A;  1U0J A;  4PSX A;  2K40 A;  2L0K A;  2VXZ A;  1JUM A;  4A5M A;  5HS7 A;  4I76 A;  1LJ9 A;  3I56 I;  4NC8 A;  5L3D A;  1Y56 A;  3SEQ A;  5D5V B;  3KP5 A;  4AIK A;  2A61 A;  5C3E J;  1UG0 A;  2DA3 A;  2E1N A;  2OQR A;  3Q9S A;  4ZDO A;  3JTH A;  3F72 A;  4XM3 A;  5B66 C;  4BBS J;  4M3D A;  4UNO A;  2MLG A;  2VI6 A;  3M1E A;  2HVR A;  4PJ0 C;  2BBY A;  1R1T A;  4CCN A;  4WX9 A;  2IT0 A;  1ZG3 A;  1R7J A;  1H88 C;  4BY1 J;  2ZNZ A;  3CCL I;  5ICC A;  3SYT A;  2QA4 I;  3K1N A;  1TT0 A;  1S5L C;  2Y2Z A;  2A6H F;  2NVU B;  2ZME A;  2Y48 A;  4A5N A;  4CO8 A;  3WU1 B;  4GRI A;  1K61 A;  4G7Z F;  3O8G A;  3IV5 A;  4N9I A;  4DQ2 A;  3IH2 A;  4I02 A;  3RYR A;  4Y3O A;  2WAE A;  3QPL A;  3G4S I;  3GTL J;  3PNV A;  2PX9 A;  3RDI A;  3CC7 I;  1X1D A;  1G3T A;  4UVB A;  3ZCO A;  1ZEL A;  4PK4 A;  3OSF A;  5CVU A;  3CO6 C;  2ZJ2 A;  2FBI A;  3FMQ A;  3F8C A;  1LNW A;  4B1R A;  2FBH A;  5B1A H;  2HDC A;  2VAS A;  3MAJ A;  2LR8 A;  2KP6 A;  4EJO A;  4W97 A;  1NTC A;  1LFP A;  1DP3 A;  1X4O A;  3FXJ A;  3BJO A;  2EZK A;  2PMZ A;  4UVA A;  3H5R A;  5FKN A;  1JJ6 C;  1Y1W J;  3DBH B;  2L9V A;  1SAU A;  1TNS A;  1ZTR A;  3GUD A;  4CH7 A;  1U8B A;  4UUT A;  2J5O A;  1P7J A;  5BPD A;  2HEO A;  2JA7 J;  3DTK A;  5IP9 J;  2AO9 A;  2BW3 A;  3B02 A;  1YX5 A;  4M3E A;  4AYB N;  2MGQ A;  5GAE J;  3A01 A;  1X2M A;  1DPU A;  2EPF A;  5K5O A;  1MIJ A;  4I0B A;  2NS7 A;  3J81 Z;  3M07 A;  3J7A O;  1FTZ A;  4XRM A;  4PSW A;  1MJA A;  1SD5 A;  2OU2 A;  3DF8 A;  3MFK A;  2EIN H;  4NBQ A;  5FGM A;  1XTA A;  1JHH A;  1LPQ A;  2KIQ A;  3OIO A;  4KA4 A;  1HXD A;  3I55 I;  3WU2 C;  2JRM A;  3FIW A;  4JYK A;  2BHY A;  1SAX A;  4LOC A;  1YRN A;  3BY6 A;  2W4S A;  5BOX A;  3H3U A;  3TDU C;  4C3I J;  2KRC A;  1G2H A;  3IWZ A;  4EMS A;  3OYA A;  2FOW A;  2JSC A;  2HZT A;  2K27 A;  1OR7 C;  3GCM A;  3K4K A;  4P1W A;  4RGS A;  4HNU A;  3GX4 X;  3GZ6 A;  3S1R J;  5ILS A;  4D7M A;  1TQM A;  2DMN A;  3SXY A;  1BR4 A;  2OC6 A;  4IEJ A;  2MAB A;  3K69 A;  1I1G A;  5ICG A;  4LIT A;  4KNY A;  3VWB A;  4IRG A;  2V1X A;  3O6B B;  1B4A A;  2DAO A;  2DA6 A;  4OAY A;  2HI3 A;  4RB0 A;  1XMK A;  3R0A A;  4IHY A;  2F5F A;  1LVA A;  4DYC A;  4M73 A;  3VYU B;  3JRE A;  1ZQ3 P;  2CUJ A;  1UJ8 A;  1XGN A;  1B72 B;  2LRE A;  1Z77 A;  3F6O A;  1VQ9 I;  3CCR I;  3V7R A;  1MMG A;  3CF2 A;  2A6T A;  2W25 A;  3IRQ A;  1MDM B;  2VPR A;  1IO2 A;  2OPT A;  1PDN C;  1LE8 A;  1R23 A;  5KHD A;  1FIA A;  2LY1 A;  2B63 J;  2OZ6 A;  1S7E A;  3C3W A;  1B59 A;  5EGO B;  3B6C A;  4FHT A;  1T39 A;  4AIJ A;  1BN5 A;  2HQA A;  1M1E B;  5DDG A;  1DUX C;  1X1A A;  4XRF A;  3I64 A;  4DBQ A;  2DN0 A;  4UXN A;  2E5Z A;  3A2K A;  3PNT A;  4QPO A;  4XOP A;  4HW0 A;  4L9N A;  3F8N A;  2QBY B;  5FLX K;  2IEK A;  1ETQ A;  2LTP A;  1U9N A;  4C2U A;  4XLH A;  3TL4 X;  3AAF A;  2XVC A;  4XRS A;  5DD8 A;  4OOI A;  2L9S A;  3FWE A;  1X1P A;  3OY9 A;  3QU6 A;  3TOA A;  3ELK A;  2DMT A;  2Y69 H;  1PUF B;  2Y0S N;  1T0F C;  4Y52 J;  2KHM A;  3F6V A;  3HSE A;  2STW A;  1L0O C;  4P9F A;  3OYN A;  4LD5 A;  1F36 A;  4X1E A;  2WY8 Q;  3OL3 A;  3DP7 A;  9ANT A;  1RUN A;  5GPA A;  2IPQ X;  3HHG A;  4KN4 X;  3CO7 C;  4F55 A;  3FXU A;  3N4M A;  2M4G A;  5DM6 F;  5CJ9 A;  2XUB A;  2K9S A;  4GCV A;  4I7H A;  3LA2 A;  2IGO A;  2PN6 A;  1XSX A;  3L09 A;  2FMY A;  2ELK A;  2P5L C;  4ON0 A;  2BY0 A;  1G3W A;  1FBU A;  2FOK A;  1HW1 A;  3WOD F;  2VKV A;  3NEU A;  2Z5U A;  4B4C A;  1GUU A;  2OBP A;  5IP6 A;  4MEY F;  1SFO J;  2ID6 A;  3CJQ B;  1J7K A;  2DT6 A;  2NVQ J;  1J2X A;  1V5G A;  1Z1D A;  2YSR A;  3QP6 A;  2UZK A;  3WE3 A;  1EH7 A;  2DT5 A;  3ZMS A;  2WC2 A;  1JUS A;  3LSI A;  3KZI C;  4A3L J;  2R7U A;  3PIO F;  2HS5 A;  1KGS A;  3ZQQ A;  4HQM A;  4UHT A;  1E3O C;  4RB1 A;  1WJB A;  5LRR A;  2FA5 A;  4GXO A;  2E1M C;  5IYC J;  2EBI A;  4OAZ A;  4UUS B;  2DXI A;  1T95 A;  3HPH A;  5M5W J;  2FUG 2;  2Z99 A;  4KIS A;  3TMO A;  1OYW A;  1QNT A;  5DCF A;  5JI6 A;  2ZJP F;  4E6K G;  5DD4 A;  3A02 A;  2LYC A;  4A6D A;  4FTH A;  1FSH A;  1BC8 C;  2HOS A;  4I99 C;  1IJW C;  3IHU A;  2JVG A;  2QVO A;  4HPQ A;  1QQI A;  4M71 A;  4KIF A;  4M6Y A;  4JK1 X;  4GO1 A;  2RGV A;  3WGG A;  4IHW A;  1NG6 A;  2BXY A;  2JA8 J;  3RPQ A;  5GAD J;  2W24 A;  2LKX A;  3IP4 B;  2HWV A;  1EV7 A;  2NNN A;  5F0H A;  1U3E M;  4QTR A;  1MNE A;  2JSP A;  2CGP A;  3UNG C;  2VKD A;  1YQA A;  3OYH A;  2IAI A;  3GBG A;  3HC7 A;  4EM0 B;  2XPV A;  1B1B A;  3H9J A;  4BEH B;  1BOA A;  3CP8 A;  2VE8 A;  3H9Q A;  2DMQ A;  1LKX A;  3QP5 A;  3BZC A;  3HGG A;  3S15 J;  1O3S A;  2P8T A;  1YS6 A;  4KIC A;  3L7W A;  2VLA A;  3HRM A;  5GP9 A;  1N78 A;  1F5T A;  4ZYG A;  2JVH A;  4XL9 A;  2P6S A;  3F3X A;  2F5V A;  1PP7 U;  3DQV C;  4BDZ A;  2DA5 A;  5D4R A;  3L2Q A;  2L01 A;  2Z1D A;  1F43 A;  2DT7 B;  1MBK A;  4KFC A;  1CF7 B;  1FZP B;  2PMH A;  4NNJ A;  1GXQ A;  4XID A;  2NXN B;  1OCT C;  4ESB A;  2R3S A;  3KCC A;  4OWR B;  3SZT A;  2DJN A;  3KLN A;  3TP0 A;  3K7A J;  1R36 A;  2E60 A;  3WTX C;  3KLO A;  1T8I A;  2ETH A;  1YIT I;  4Z6Y A;  2O8X A;  5F27 A;  1TBX A;  3OS2 A;  3VOE A;  2W7N A;  2TDX A;  4J01 A;  5IOY A;  4YII A;  1SFK A;  2VB6 A;  4M6X A;  3ZQH A;  3CMY A;  3J7Y J;  4RA2 A;  1X3W B;  1GV5 A;  2HTS A;  1O7L A;  3FBN B;  1X1C A;  3TKY A;  4WCG A;  1Y6I A;  4NQW A;  2FBK A;  2DW4 A;  2IJL A;  2CQN A;  5F04 A;  3TP3 A;  3ZN1 A;  5D5W B;  3S14 J;  4J00 A;  1Z6T A;  4A3F J;  1QPM A;  5TRD A;  1T98 A;  5DV5 A;  4BH9 A;  2NVX J;  4DW6 A;  3BZK A;  1ZRD A;  5E1X A;  2M30 A;  3S3O A;  1ODD A;  3WU0 A;  2CQQ A;  3JRH A;  2YX7 A;  5M3M J;  2LY2 A;  5J47 A;  4IVN A;  1SVM A;  1OIS A;  3TQN A;  4NUB A;  1JT6 A;  4BUP A;  2KZV A;  5CYV A;  3LQQ A;  2AS5 F;  2PEX A;  1LEB A;  2HQN A;  2GXA A;  1PYV A;  4V2F A;  2HQ5 A;  4HRI A;  2B9S A;  1A31 A;  1Z3X A;  2EK5 A;  1R00 A;  2KIF A;  2GBY A;  4E70 A;  3LMM A;  4PJJ A;  4CIC A;  3EUA A;  4XQF A;  4L5E A;  3HRU A;  2ID3 A;  3OS0 A;  5D6F A;  3IAM 2;  1H9G A;  2RQP A;  3CD6 I;  3DEW A;  4RLF A;  1IXR C;  2BY2 A;  2V79 A;  4A3K J;  2ZFW A;  4IHT A;  1QBJ A;  2VBZ A;  1KU9 A;  3HUG B;  1HF0 A;  4B48 A;  4HX8 A;  4RDU A;  3MZH A;  1E3H A;  2HYF A;  3I9V 2;  4M6V A;  4XSX F;  2I5U A;  3RZD J;  1LDJ A;  3REO A;  1FT9 A;  1UB9 A;  1FX7 A;  3M3Y J;  1IUF A;  2XAS A;  3DEU A;  3BTI A;  2ZB9 A;  4FAS D;  4ZYH A;  4UV9 A;  5HLT A;  4G7H F;  5K5Q A;  1KQ9 A;  1AU7 A;  1B8I B;  2ZO4 A;  4AC0 A;  3I4P A;  3F22 A;  2XAF A;  3HOZ J;  4LG0 B;  2R5Y B;  3RIR A;  1TWF J;  1HC8 A;  2MC4 A;  4ZDL A;  3J81 K;  3VYS B;  2FE3 A;  1A6I A;  3E6D A;  2BVM A;  5A2Q Z;  3OR2 C;  1WVR A;  3S93 A;  5DM7 F;  1VFC A;  2KJB A;  1B8I A;  3VSL A;  2R93 J;  3L2U A;  4KMU X;  1LDD A;  3UR3 C;  4PZJ A;  2BY1 A;  5E8I A;  4A3D J;  4HLX A;  4P5O A;  3G73 A;  2DYR H;  2HKO A;  2ZCW A;  2HZD A;  4C3J J;  4F7Z A;  5LBQ A;  2R7D A;  4TV7 A;  4B09 A;  1AA7 A;  2XDV A;  3KP6 A;  1VND A;  5EEG A;  4UUV A;  3RSN A;  2LVS A;  3WTZ A;  1GV2 A;  1O7F A;  3RI4 A;  2HNH A;  1VQO I;  1UZC A;  5ILU A;  5KAI C;  4H0E A;  2A6E F;  5JLW A;  1RZ4 A;  5BPI A;  2ECB A;  2V6E A;  4IHX A;  2CUF A;  4ZC3 A;  4WXC A;  4LJZ F;  1QZE A;  1MBF A;  3V7S A;  4A2U A;  1OYY A;  1R9T J;  1Z7L A;  1ORK A;  2NS0 A;  2ACJ A;  2Q0O A;  5KAF C;  2KJC A;  2VQC A;  2NRA C;  4HDV A;  3PFY A;  3GTO J;  2WV0 A;  5F08 A;  2HOA A;  4Y17 A;  2G7H A;  3IRR A;  2ZSH B;  2AQF A;  3HOY J;  2PMZ N;  4EEF G;  3PFI A;  2L4A A;  2PBI A;  4QIW N;  1FMV A;  4ZJZ A;  2HVQ A;  4KN7 X;  3ECH A;  2Y75 A;  3LSJ A;  4HZF A;  1S8N A;  3K0L A;  4DZJ A;  1J75 A;  2ISZ A;  4U7D A;  1MBJ A;  5BQT A;  1I3Q J;  3CME I;  4XR6 A;  3OIQ A;  2Z2S B;  1VQM I;  2HVS A;  3CCM I;  4U87 A;  3GFI A;  2VJI A;  4JBA A;  2VOD A;  4CCJ A;  2FQ3 A;  2ZC2 A;  1P92 A;  1O3T A;  3RPU A;  5F6F A;  3W6V A;  2M87 A;  3LA3 A;  2A5Y B;  1MMN A;  2HYJ A;  4G6D A;  3S17 J;  3RZO J;  5EDN A;  2XGD A;  2VC1 A;  1YIO A;  3ZQI A;  3PL8 A;  4LK1 F;  1IXC A;  4EJW A;  3DLL F;  1H0M A;  1XG1 A;  1XDU A;  2CQK A;  2IW5 A;  4RLQ A;  3OYF A;  2VBW A;  2F5D A;  3PUF A;  1WH7 A;  3IUO A;  3CCY A;  2GWR A;  2RDP A;  4A12 A;  2BEO A;  4U0W A;  4AD9 A;  1BL0 A;  3K1P A;  2HPI A;  1X2N A;  5CVI A;  2HR3 A;  1O3R A;  5CVR A;  5DUK A;  3HHH A;  2NVY J;  5LRS A;  1UG2 A;  1VTN C;  4AUX A;  3KYC B;  1P7I A;  1IN7 A;  3MZY A;  2ECC A;  2W48 A;  2VQL A;  3ABL H;  5HOO A;  3OMY A;  4YFX F;  1U5T A;  1IDZ A;  4G7O F;  3H0G J;  4L0Y B;  4BHC A;  2WAQ A;  2PI0 A;  3HG9 A;  3OYD A;  4Q48 A;  2PJP A;  4E7I A;  3SDB A;  1WFX A;  2E34 A;  1B9M A;  2CQX A;  2CYY A;  2X0L A;  1ZRF A;  4XKB A;  1EA3 A;  4AM3 A;  2L9R A;  1DGR M;  4ENK A;  4A6E A;  3PJR A;  3OYI A;  2COB A;  1HDD C;  3KEO A;  1YW9 A;  2CJJ A;  3VEP A;  2JK3 A;  4GYI A;  1D5Y A;  4PFO A;  5LHG A;  1BW6 A;  1YOV B;  2D2W A;  1YJN I;  2A68 F;  4GDF A;  3VYR B;  3ERM A;  2QCO A;  2MBF A;  2Y0M A;  4RGU A;  2ZSI B;  4HF2 A;  4IHV A;  3H92 A;  4QPQ A;  2EFQ A;  2UXX A;  4FQG A;  2KRF A;  3OYJ A;  1W5T A;  4XLA A;  2R5Z A;  1O57 A;  1B72 A;  1AOY A;  3H36 A;  4LLL A;  2MG4 A;  2LK2 A;  4B3X A;  3FK7 A;  2C6Y A;  1QGP A;  2DPD A;  3JW4 A;  2DMP A;  3F0C A;  1U78 A;  4XRS G;  3G1L A;  3L00 A;  3CCU I;  1GVD A;  2DFE A;  4MIM A;  1BI2 A;  5J4V A;  2IS1 A;  1WGX A;  5ED4 A;  2X48 A;  2EFP A;  3GXO A;  4D9J A;  4C3H J;  2ME6 A;  2BHZ A;  1W5S A;  3CMM A;  3M1C A;  3LSP A;  1K4T A;  4S05 A;  1KU7 A;  2ZJQ F;  3IH3 A;  3LSH A;  4AVZ A;  3RPU D;  3HB9 A;  2NNY A;  3CCQ I;  3LSM A;  2P5V A;  1MH3 A;  1ZAO A;  2L5Q A;  5LEJ A;  4E4H A;  2DTZ A;  3SHF A;  1TWA J;  2AXL A;  2VN2 A;  4IQJ A;  1XDS A;  2YPR A;  4HQE A;  4A0Z A;  4HX4 A;  3H0D A;  1PUF A;  3FXM A;  4R8H A;  4BQA A;  5IYB J;  1ETO A;  2XAG A;  4EQQ A;  3C2G A;  5HDN A;  4ENN A;  4LB5 A;  3S2H J;  2OJE D;  3O3K A;  3MCZ A;  1HW2 A;  2WV1 A;  3BR0 A;  2EA2 A;  2WTE A;  5JHF A;  3GYH X;  3ML6 A;  2QUF A;  1GDT A;  2NVT J;  4BS9 A;  2H8W A;  1ETX A;  2CSO A;  3PQK A;  3PIP F;  2EZH A;  2DA2 A;  1MBH A;  3JRD A;  1OMI A;  2CWE A;  1KU2 A;  2AHQ A;  3PO3 J;  1JGS A;  1P6R A;  4PUS A;  2M4K A;  3ISP A;  3KYD B;  1FSE A;  1Z21 A;  3C2B A;  1HKQ A;  3ASN H;  1XGS A;  4A0X A;  3LA7 A;  5LEK A;  3ROU A;  4CCL A;  3I54 A;  1HLV A;  1X1B A;  4ANJ A;  1WJA A;  2K86 A;  3Q3S A;  3LSR A;  2Q2E B;  3VFZ A;  3E0J B;  5IT9 Z;  4CCO A;  3WTU C;  3AL0 B;  2ZME B;  3ZMU A;  2QWW A;  1C0W A;  1K6O A;  2HKX A;  2ME0 A;  1XB4 A;  3SZP A;  2X1E A;  2GIV A;  4EV0 A;  3S3M A;  2X6W A;  4I2O A;  4B43 A;  3OOU A;  3EDP A;  3E6B A;  4L5I A;  5CVJ A;  4YEJ A;  2DU9 A;  2V4J C;  2W82 A;  4PDK A;  4BQN A;  5FD6 A;  2X1C A;  1UHW A;  2EV0 A;  3AG4 H;  4M3F A;  4MNU A;  1ZN2 A;  2Q2E A;  4O6J A;  2E1O A;  3EUH A;  1RET A;  1D3Y A;  2EZI A;  2XGC A;  4JX6 A;  4XBF A;  3ULQ B;  3S2D J;  1E17 A;  2HXI A;  4XLN F;  1NG7 A;  3MKZ A;  1L3L A;  2R7S A;  2EFW A;  5F1J A;  1CGP A;  3CZ6 A;  1ETY A;  3I71 A;  1UAA A;  1H9T A;  4RGR A;  3BCB A;  3PUB A;  5CQG A;  1W5C C;  2IA1 A;  1VQ7 I;  1HOM A;  1GVJ A;  3JTG A;  5LFA A;  4L9T A;  4RAG A;  4FET A;  3CUQ A;  1LB2 A;  1PUE E;  1RKW A;  4XN0 A;  3COA C;  4MQ9 F;  5J6X A;  2ZXJ A;  2QSG X;  4MO7 A;  1IV6 A;  3MEX A;  1SAN A;  1IXS B;  1ETW A;  4XNF A;  3WGI A;  1AKH A;  2P5K A;  1D1C A;  4DBR A;  2GA2 A;  5ILV A;  2FF4 A;  2ZFU A;  3OYK A;  3WTY C;  1BIB A;  3HTU A;  4WF2 A;  3JSO A;  1I3A A;  4RB3 C;  2P0W A;  3F8B A;  2R7V A;  2QSH X;  1YI2 I;  2BY3 A;  4Y15 A;  1HBX G;  3AG2 H;  2L7K A;  4FIS A;  1P4W A;  3KFW X;  4HLY A;  2W85 A;  5M5Y J;  3U2R A;  2XKP A;  3QWL A;  1SFU A;  3AG1 H; 
#chains in the Genus database with same CATH homology
 1ZLK A;  2PQ8 A;  2KKO A;  3R4K A;  2OA4 A;  1HW5 A;  3BOQ A;  3ZN0 A;  4N0B A;  3BJA A;  3FM3 A;  1I27 A;  3FMS A;  4B8X A;  2O03 A;  2KIU A;  3IL2 A;  4KDP A;  2H6C A;  3T0Y A;  4U0Y A;  2FXA A;  3K1M A;  1W7P A;  3FHZ A;  3WTT C;  2Q8K A;  5F1R A;  4D0P A;  4Q4Z F;  2CO5 A;  1ZGA A;  2QQB A;  2EB7 A;  4LLG F;  1MD0 A;  2K7L A;  2VON A;  2J5P A;  2PFB A;  4NHJ A;  3CUO A;  4XSZ F;  5FFX A;  3LAP A;  1XGO A;  3LAJ A;  1XSD A;  3HRT A;  3FXR A;  3ZMD A;  4U7B A;  4Z2Y A;  3QPT A;  4CYD A;  1T38 A;  1CF7 A;  2DQL A;  1FPQ A;  2EV6 A;  1G3S A;  1ZYR F;  3WTS C;  3K2Z A;  4HA8 A;  2G9W A;  2LF8 A;  2W84 A;  4BHP A;  2MA3 A;  2VBX A;  4U88 A;  1R58 A;  1V4R A;  1JXS A;  3CDH A;  4LMY A;  3I53 A;  1Y0U A;  3FXQ A;  4YG2 F;  1QZZ A;  1I1S A;  2DBB A;  2XRN A;  2VOP A;  3LFK A;  4P55 A;  4MEX F;  1QO0 D;  2K4B A;  2MLK A;  1DPR A;  3ZMV A;  1Z9C A;  3D0S A;  2JT1 A;  1G6N A;  2JTV A;  2E1C A;  1BBY A;  2L02 A;  4M72 A;  3IKV A;  4L9V A;  5D6E A;  4A0Y A;  3TDZ C;  4K2E A;  1KU3 A;  3M8F A;  3BJ6 A;  2B0L A;  3CUQ B;  2K4J A;  4ESJ A;  1F9N A;  4AWX B;  5L3F A;  5FB2 A;  3V4G A;  1IW7 F;  3M9A A;  1DDN A;  5LGT A;  4R79 A;  5HS8 A;  5LLQ A;  3ERE D;  4PGG A;  4MQV A;  3ZPL A;  4EJV A;  1FYK A;  3RKY A;  1D5V A;  1YFH A;  4UV8 A;  3P9I A;  4OMY A;  2RVC A;  4LG0 A;  4RAY A;  3WE2 A;  3ABT A;  4Y13 A;  3C1D A;  2CW0 F;  1W7P D;  2V9V A;  1R1V A;  1XN7 A;  5CVV A;  4RAZ A;  3SFZ A;  2EWN A;  2LF7 A;  2XHK A;  3TGN A;  3T8T A;  4EGY A;  3KE2 A;  2XAJ A;  2JRT A;  3LQR A;  2QYO A;  2UXN A;  2FSW A;  3M8E A;  4EM2 A;  1ULY A;  3QRF F;  5L3C A;  1TLH B;  3DV8 A;  2BYV E;  3CTA A;  3QPH A;  4MTD A;  3GO5 A;  2EJR A;  4DNC A;  2UWM A;  5HDK A;  2O61 A;  4HV5 A;  5DCM A;  4M9S A;  5ICF A;  4M9X A;  2RKH A;  3GVA A;  5ICE A;  1UCR A;  5LGU A;  5K5R A;  2QM3 A;  4P9U A;  1Z91 A;  1BM9 A;  4HF1 A;  1R22 A;  3FF5 A;  1J59 A;  1UST A;  1FP1 D;  2MD5 A;  2OZU A;  3GLX A;  3T1B A;  1K79 A;  3R0J A;  1XGM A;  2ZKZ A;  2A69 F;  1S7A A;  4IRH A;  1P4X A;  5DEQ A;  1U6G A;  3P9K A;  3HOS A;  1KQ8 A;  2DI3 A;  5L3G A;  3BPX A;  3WTW C;  4WWC A;  3KZY A;  2CG4 A;  2XIG A;  3QU3 A;  3F23 A;  1B9N A;  4WXH A;  1WSU A;  2DLL A;  3S2W A;  4HAM A;  2ISY A;  2ELH A;  4KIB A;  1EH8 A;  1HKS A;  1XSV A;  3E6M A;  4OIO F;  4KMF A;  2KIM A;  1UFM A;  3EQL F;  3NRV A;  1SMY F;  1U5T B;  4FX0 A;  2QEN A;  3DPL C;  1KYW A;  2K02 A;  4M74 A;  4N9H A;  4WXD A;  3KP3 A;  2IA0 A;  2COM A;  2H09 A;  1YS7 A;  5HLI A;  3CUQ C;  1WRJ A;  1WWX A;  4IRI A;  4HV6 A;  2YR2 A;  3GEZ A;  4GGG A;  2GQQ A;  3GF2 A;  1HST A;  1BJA A;  3U1D A;  5L3B A;  1S29 A;  1P2F A;  1XD7 A;  2NYX A;  4KIG A;  2JPB A;  3W6K B;  3BP8 A;  2H6B A;  3M7G A;  3EYY A;  1E2X A;  4ETS A;  2JZY A;  2XGX A;  1I5Z A;  2GZW A;  3T8R A;  1WI9 A;  4EM1 A;  5E18 F;  1TQI A;  2E7W A;  2IRF G;  3FMR A;  3WG9 A;  2A3S A;  2LDU A;  4OIP F;  1IF1 A;  1BI1 A;  5AON A;  3EYI A;  2Z9O A;  2FNP A;  3DFG A;  3TO9 A;  4LB6 B;  2IA2 A;  1HQC A;  3P9C A;  1FY7 A;  3OOP A;  1YLF A;  1GHC A;  1ZRC A;  3GFL A;  3E3V A;  1T2K A;  3GW2 A;  1BI0 A;  2P6T A;  3L9F A;  1U2W A;  1V3F A;  1ZHF A;  5IT9 K;  2HYG D;  4ENM A;  4RB2 C;  4IHS A;  3E5X A;  2VE9 A;  1Z7U A;  2M5W A;  2MH9 A;  3BDD A;  4EJU A;  1GXP A;  2GXB A;  2EA4 A;  2IVM A;  1B6A A;  3JAM Z;  1K78 A;  1Q1H A;  4I98 B;  3FM5 A;  3HIF A;  5E17 F;  4UVC A;  1FBS A;  3WTV C;  1EH6 A;  1WQ2 A;  4AIH A;  1IN6 A;  4G94 A;  5ERI A;  5D8K B;  5H6Q A;  1HKT A;  1R5H A;  1LQ1 A;  4R1H A;  2ZBK A;  4ASN A;  1AWC A;  1SMT A;  2VT2 A;  1KA8 A;  2VOO A;  3RTR A;  4QLC U;  2P7V B;  2RN7 A;  4OIR F;  5E8G A;  5TJJ A;  1IN4 A;  1WKM A;  2GA1 A;  1FOK A;  1IZ1 A;  3HRS A;  2ZNY A;  3U9G A;  3O2P E;  3E97 A;  3MQ0 A;  2IP2 A;  1T0F A;  2LKP A;  1PP8 F;  4KUM A;  4Q47 A;  1U8R A;  2F5E A;  4CZZ A;  3BZ6 A;  5JFR A;  2LNB A;  5FD5 A;  2VBY A;  1XCV A;  1G4D A;  3PQJ A;  4ENJ A;  3N97 A;  2M45 A;  2V6C A;  2DPU A;  2FML A;  5LHH A;  3P7N A;  3FX3 A;  2FNA A;  1O3Q A;  3BWG A;  1UHM A;  4BNC A;  3E5Q A;  3HOT A;  2OQG A;  3ZP5 A;  4Q5S F;  3C7J A;  4IJA A;  3Q9V A;  5EEH A;  1P4A A;  2EFN A;  1OR7 A;  3IWF A;  2CFX A;  4CGZ A;  3LWF A;  1TW2 A;  3EET A;  3GZ5 A;  1S6L A;  2Z3Y A;  2W57 A;  1ZLJ A;  4RGX A;  2O3F A;  5HVQ C;  3VB2 A;  4ZYD A;  4EVI A;  2XKO A;  2QLZ A;  4AVP A;  4OU0 A;  2L54 A;  4ZZL A;  1YW7 A;  2Z33 A;  2DO7 A;  3K9T A;  3I58 A;  4IPA A;  2MC3 A;  5FFZ A;  5LGN A;  2FRH A;  1OYI A;  1NHA A;  3W6J B;  3I0T A;  2BV6 A;  4G8X A;  2EV5 A;  4IXA A;  5BMZ A;  2M1B A;  1REP C;  2P7C B;  1USS A;  4ESF A;  3TO7 A;  4FX4 A;  2M8E A;  4U0V A;  1U5T C;  1J0R A;  5DYM A;  3KP4 A;  5H20 A;  2ADU A;  4BAY A;  1YYV A;  3BPV A;  4WK8 F;  1Z6R A;  2HQR A;  5D8L B;  2HGC A;  4XLP F;  1RNL A;  2JPC A;  5HS9 A;  2D45 A;  1MDM A;  1MKM A;  1FBQ A;  1SFE A;  2XAH A;  2DFI A;  2QZ8 A;  1FWZ A;  3IKT A;  2XV4 S;  5CLS A;  2H27 A;  2VC0 A;  4HOB A;  3I5U A;  3L2C A;  2QBY A;  3Q5F A;  5JR3 A;  5E1Z B;  4CHU A;  4JQF A;  1K78 B;  1XMA A;  3DPT A;  5DUI A;  1BI3 A;  1SFX A;  4IF4 A;  5A2Q K;  1SD6 A;  3ABU A;  3LST A;  1JHF A;  5D5U B;  5DCM B;  1SD7 A;  2HTJ A;  2QQ9 A;  3F21 A;  3R6S A;  5E1W A;  2WWY A;  3I59 B;  3HSF A;  5K1Y A;  3R60 A;  4BYY A;  1ZH5 A;  1FLI A;  3GFJ A;  5F64 A;  2XAQ A;  1R5G A;  3KET A;  2E7X A;  3B73 A;  1ZGJ A;  3I59 A;  4HYE A;  3V8J A;  1OKR A;  1W7P B;  2DTR A;  4G6Q A;  2DQR A;  3KP7 A;  3JSP A;  1KYZ A;  2OAZ A;  2P4W A;  3WGH A;  5AIQ A;  3KEQ A;  1TNT A;  3C18 A;  2DK5 A;  5JHU A;  1ON1 A;  4MGR A;  2XRO A;  2O0Y A;  3RKW A;  5BS6 A;  2V1D A;  1XCB A;  1ZAR A;  3GWZ A;  3ECO A;  3R61 A;  2HOE A;  3F8F A;  1YTY A;  1TQP A;  3F8M A;  5D4S A;  1IAW A;  3DXJ F;  3TOB A;  1JE8 A;  2RC4 A;  4LFU A;  5KVR A;  1F4K A;  1RI7 A;  2BE5 F;  3RKX A;  2L4M A;  1YO5 C;  4QWQ A;  2FU4 A;  3T5X A;  1QZY A;  3KP2 A;  4I09 A;  5E20 A;  1FNN A;  1T6S A;  1IUY A;  1ZG5 A;  3QOP A;  2F2E A;  4KYW A;  1MJB A;  4HBL A;  1YW8 A;  5AIP A;  5HLH A;  1K7A A;  1X3U A;  4PGH A;  4GYG A;  4O3M A;  3HYI A;  1YG2 A;  3CLO A;  4G9Y A;  2RV8 A;  3E6C C;  4CDG A;  4CXF A;  2GAU A;  3VOD A;  3BRO A;  2MH2 A;  1KQ0 A;  3KZZ A;  2YX4 A;  2YU3 A;  4S04 A;  5JVT A;  2G7U A;  4YFK F;  2STT A;  1RIO H;  1Z05 A;  2GXG A;  1R1U A;  1ON2 A;  1TTY A;  2PG4 A;  3ZMZ A;  3RYP A;  1G3Y A;  3HTS B;  4I01 A;  2VT3 A;  4O5V A;  1ONV A;  2OD5 A;  2EFO A;  4NB5 A;  6PAX A;  1OPC A;  4LK0 F;  1S3J A;  5HLG A;  3NQO A;  4OMZ A;  3GFM A;  4L0Z B;  4P96 A;  1S7O A;  2V1U A;  5KK1 A;  3HUG A;  4ZH4 F;  4EGZ A;  4RS8 A;  1ZG1 A;  5L3E A;  4OIN F;  1MJ9 A;  2PMU A;  2ESH A;  4L18 B;  4MTE A;  3H3Z A;  4HF0 A;  4MHG A;  1FP2 A;  4BHB A;  4YFN F;  1STZ A;  1LDK B;  3G3Z A;  3FZV A;  4I0A A;  4ZYE A;  1FC3 A;  3V8K A;  4BXU A;  1I6X A;  2NAZ A;  1W4M A;  2D1V A;  5H6R A;  2X4H A;  1IRF A;  2O6G E;  1IN5 A;  4KT5 C;  3TO6 A;  3MWM A;  1J5Y A;  1J9I A;  5IT3 A;  4M9Z A;  4ZZD A;  4HDU A;  1IRG A;  3V7C A;  1DP7 P;  5FO5 A;  4EJT A;  1MGT A;  1LEA A;  4L5J A;  1TW3 A;  4L9J A;  5HDG A;  3J80 Z;  5FLX Z;  1BC7 C;  4LLN A;  2L3D A;  3HSR A;  2ESN A;  1D8K A;  5J8C A;  1A04 A;  2LSO A;  2HFH A;  3V8L A;  1D8J A;  4HX7 A;  3DKW A;  2FEZ A;  2DK8 A;  5LHI A;  3ZQ7 A;  3QAH A;  4PCQ A;  1SD4 A;  2QQA A;  1HSJ A;  3SQN A;  2D1H A;  4OIQ F;  5D5X B;  3JAM K;  2BGC A;  3RJP A;  1F1Z A;  3OV8 A;  1MZB A;  1FYL A;  2RNJ A;  4YIF A;  2F5C A;  1IN8 A;  3D5L A;  2R7F A;  3CJN A;  1ZRE A;  5J8F A;  1RUO A;  3ZMT A;  3J80 K;  2PLY A;  1BIA A;  4LGW A;  3E5U A;  2A07 F;  2H94 A;  4FT8 A;  1FYM A;  3IC7 A;  2VXZ A;  4A5M A;  5HS7 A;  1LJ9 A;  5L3D A;  5D5V B;  3KP5 A;  4AIK A;  2A61 A;  2E1N A;  2OQR A;  3Q9S A;  3JTH A;  3F72 A;  4UNO A;  2MLG A;  3M1E A;  2BBY A;  1R1T A;  4WX9 A;  2IT0 A;  1ZG3 A;  1R7J A;  2ZNZ A;  5ICC A;  3K1N A;  2A6H F;  2ZME A;  2Y48 A;  4A5N A;  4CO8 A;  3WU1 B;  4G7Z F;  4N9I A;  4DQ2 A;  4I02 A;  3RYR A;  3RDI A;  1G3T A;  4UVB A;  5CVU A;  3CO6 C;  2ZJ2 A;  2FBI A;  3FMQ A;  3F8C A;  1LNW A;  2FBH A;  2HDC A;  3MAJ A;  4EJO A;  3BJO A;  4UVA A;  1TNS A;  3GUD A;  5BPD A;  2J5O A;  2HEO A;  3B02 A;  1DPU A;  5K5O A;  4I0B A;  3J81 Z;  3J7A O;  1MJA A;  1SD5 A;  2OU2 A;  3DF8 A;  3MFK A;  5FGM A;  1JHH A;  4KA4 A;  1HXD A;  1SAX A;  3BY6 A;  5BOX A;  3H3U A;  3TDU C;  3IWZ A;  4EMS A;  2JSC A;  2HZT A;  2K27 A;  4RGS A;  3GX4 X;  3GZ6 A;  5ILS A;  1TQM A;  3SXY A;  3K69 A;  1I1G A;  5ICG A;  4KNY A;  4IRG A;  2V1X A;  3O6B B;  1B4A A;  2DAO A;  4RB0 A;  1XMK A;  3R0A A;  2F5F A;  1LVA A;  4M73 A;  1XGN A;  3F6O A;  3V7R A;  2W25 A;  3IRQ A;  1MDM B;  1PDN C;  1R23 A;  2OZ6 A;  3C3W A;  1T39 A;  1B59 A;  4FHT A;  4AIJ A;  1BN5 A;  5DDG A;  1DUX C;  4XRF A;  3I64 A;  4UXN A;  4HW0 A;  4L9N A;  3F8N A;  2QBY B;  5FLX K;  3AAF A;  2XVC A;  5DD8 A;  4OOI A;  3FWE A;  3QU6 A;  3TOA A;  3ELK A;  3F6V A;  3HSE A;  2STW A;  1L0O C;  4P9F A;  4LD5 A;  3DP7 A;  1RUN A;  2IPQ X;  3HHG A;  4KN4 X;  3CO7 C;  3FXU A;  3N4M A;  5CJ9 A;  2XUB A;  4GCV A;  4I7H A;  3LA2 A;  3L09 A;  2PN6 A;  1XSX A;  2FMY A;  2P5L C;  4ON0 A;  2FOK A;  1G3W A;  1FBU A;  1HW1 A;  3WOD F;  3NEU A;  2Z5U A;  2OBP A;  4MEY F;  1J7K A;  1J2X A;  1Z1D A;  2YSR A;  3QP6 A;  2UZK A;  3WE3 A;  1EH7 A;  2DT5 A;  3ZMS A;  2WC2 A;  2HS5 A;  1KGS A;  4HQM A;  4UHT A;  4RB1 A;  5LRR A;  2FA5 A;  4GXO A;  2Z99 A;  1OYW A;  1QNT A;  5DCF A;  5JI6 A;  5DD4 A;  4A6D A;  1FSH A;  1BC8 C;  3IHU A;  2QVO A;  1QQI A;  4M71 A;  4KIF A;  4M6Y A;  4JK1 X;  4GO1 A;  2RGV A;  3WGG A;  3RPQ A;  2W24 A;  2HWV A;  1EV7 A;  2NNN A;  1U3E M;  2CGP A;  1YQA A;  4EM0 B;  1B1B A;  1BOA A;  2VE8 A;  3QP5 A;  1O3S A;  2P8T A;  1YS6 A;  4KIC A;  3L7W A;  3HRM A;  1F5T A;  4ZYG A;  2P6S A;  3F3X A;  1PP7 U;  3DQV C;  5D4R A;  2L01 A;  4KFC A;  1CF7 B;  1FZP B;  2PMH A;  1GXQ A;  4ESB A;  2R3S A;  3KCC A;  3SZT A;  3KLN A;  1R36 A;  3WTX C;  3KLO A;  2ETH A;  2O8X A;  1TBX A;  3VOE A;  2TDX A;  4YII A;  4M6X A;  2HTS A;  1O7L A;  3TKY A;  4WCG A;  4NQW A;  2FBK A;  2DW4 A;  2IJL A;  3ZN1 A;  5D5W B;  1Z6T A;  1QPM A;  5TRD A;  1T98 A;  5DV5 A;  4BH9 A;  1ZRD A;  5E1X A;  2M30 A;  1ODD A;  3WU0 A;  2YX7 A;  4IVN A;  3TQN A;  5CYV A;  3LQQ A;  2AS5 F;  2PEX A;  1LEB A;  2HQN A;  2EK5 A;  1R00 A;  2KIF A;  4E70 A;  4CIC A;  3HRU A;  5D6F A;  1H9G A;  2RQP A;  1IXR C;  2V79 A;  2ZFW A;  4IHT A;  1QBJ A;  2VBZ A;  1KU9 A;  4HX8 A;  3MZH A;  2HYF A;  4XSX F;  1LDJ A;  3REO A;  1FT9 A;  1UB9 A;  1FX7 A;  2XAS A;  3DEU A;  4ZYH A;  4G7H F;  4UV9 A;  5K5Q A;  1KQ9 A;  2ZO4 A;  3F22 A;  3I4P A;  2XAF A;  4LG0 B;  3RIR A;  3J81 K;  2FE3 A;  3E6D A;  5A2Q Z;  2KJB A;  4KMU X;  1LDD A;  4PZJ A;  5E8I A;  4HLX A;  4P5O A;  3G73 A;  2HKO A;  2ZCW A;  4F7Z A;  5LBQ A;  2R7D A;  4TV7 A;  4B09 A;  3KP6 A;  5EEG A;  4UUV A;  3WTZ A;  1O7F A;  3RI4 A;  5ILU A;  4H0E A;  2A6E F;  1RZ4 A;  5BPI A;  4WXC A;  4LJZ F;  4A2U A;  3V7S A;  1OYY A;  2NS0 A;  2ACJ A;  2Q0O A;  2KJC A;  2NRA C;  4HDV A;  2WV0 A;  4Y17 A;  2G7H A;  3IRR A;  3PFI A;  2L4A A;  2PBI A;  4KN7 X;  3ECH A;  2Y75 A;  4HZF A;  1S8N A;  3K0L A;  1J75 A;  2ISZ A;  4U7D A;  5BQT A;  3GFI A;  4JBA A;  2VOD A;  2FQ3 A;  1P92 A;  1O3T A;  3RPU A;  5F6F A;  2M87 A;  3LA3 A;  2A5Y B;  4G6D A;  2VC1 A;  1YIO A;  4LK1 F;  1IXC A;  4EJW A;  1H0M A;  1XDU A;  2CQK A;  2IW5 A;  2VBW A;  2F5D A;  2GWR A;  2RDP A;  4A12 A;  2BEO A;  4U0W A;  4AD9 A;  3K1P A;  5CVI A;  2HR3 A;  1O3R A;  5CVR A;  5DUK A;  3HHH A;  5LRS A;  1VTN C;  1IN7 A;  3MZY A;  5HOO A;  4YFX F;  1U5T A;  4G7O F;  4L0Y B;  4BHC A;  2PI0 A;  4Q48 A;  2PJP A;  1B9M A;  2CYY A;  2X0L A;  1ZRF A;  4ENK A;  4A6E A;  3KEO A;  1YW9 A;  3VEP A;  4GYI A;  5LHG A;  2D2W A;  2A68 F;  2MBF A;  2Y0M A;  4RGU A;  4HF2 A;  3H92 A;  2EFQ A;  2UXX A;  2KRF A;  1W5T A;  1AOY A;  1O57 A;  4LLL A;  2C6Y A;  1QGP A;  2DPD A;  3JW4 A;  1U78 A;  3L00 A;  1BI2 A;  5ED4 A;  2EFP A;  3GXO A;  1W5S A;  4S05 A;  1KU7 A;  2NNY A;  2P5V A;  1ZAO A;  5LEJ A;  3SHF A;  2AXL A;  2VN2 A;  1XDS A;  2YPR A;  4HQE A;  4A0Z A;  4HX4 A;  4R8H A;  4BQA A;  2XAG A;  4EQQ A;  5HDN A;  4ENN A;  4LB5 A;  3O3K A;  3MCZ A;  1HW2 A;  2EA2 A;  2WTE A;  3GYH X;  3ML6 A;  2QUF A;  3PQK A;  2CSO A;  1OMI A;  2CWE A;  1KU2 A;  1JGS A;  1P6R A;  3ISP A;  1FSE A;  1HKQ A;  1XGS A;  4A0X A;  3LA7 A;  5LEK A;  3ROU A;  3I54 A;  2K86 A;  3VFZ A;  5IT9 Z;  3WTU C;  2ZME B;  3ZMU A;  2QWW A;  1C0W A;  1K6O A;  2HKX A;  3SZP A;  1XB4 A;  2GIV A;  4EV0 A;  4I2O A;  3EDP A;  3E6B A;  4L5I A;  5CVJ A;  2DU9 A;  4PDK A;  5FD6 A;  1UHW A;  2EV0 A;  4MNU A;  1ZN2 A;  2Q2E A;  4O6J A;  3EUH A;  1D3Y A;  3ULQ B;  4XBF A;  1E17 A;  4XLN F;  1L3L A;  2EFW A;  1CGP A;  3I71 A;  1H9T A;  4RGR A;  2IA1 A;  1GVJ A;  3JTG A;  4L9T A;  3CUQ A;  1LB2 A;  1PUE E;  3COA C;  4MQ9 F;  5J6X A;  2ZXJ A;  3MEX A;  1IXS B;  3WGI A;  2P5K A;  2GA2 A;  5ILV A;  2FF4 A;  3JSO A;  3WTY C;  1BIB A;  3HTU A;  4WF2 A;  4RB3 C;  3F8B A;  4Y15 A;  1HBX G;  1P4W A;  3KFW X;  4HLY A;  2W85 A;  3U2R A;  2XKP A;  1SFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...