4MNUA

Crystal structure of uncharacterized slya-like transcription regulator from listeria monocytogenes
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
AMKDILRDIGVIARALDSISNIEFKELNLAKGQFIYLVRICENQGIIQEKLVDILKIDRTTASRAIKNLEKNGLIIKKQNKNNKKNKLLFPTEKGQQLYPLIIRENEYSNAVALKGFTEAEINMLTDALKKVKENIADDWLYVKKGNKRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SlyA-like transcription regulator
publication title Crystal Structure of Uncharacterized SlyA-like Transcription Regulator from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
total genus 53
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mnuA00
1W7PA 3VODA 4G7OF 1G3YA 3IRQA 3CLOA 2FRHA 5LHIA 4LLNA 3VB2A 4RGSA 4HLYA 2BEOA 4WX9A 4UVCA 3HSFA 5F6FA 3T0YA 1OMIA 3MFKA 3NQOA 2ZO4A 4P9FA 4M73A 2J5PA 2HEOA 2Z3YA 3HSRA 1ZN2A 3SZTA 2CSOA 4BHPA 2EFOA 4HOBA 4MEXF 3KP5A 1RUNA 4L9JA 4R1HA 4MNUA 2PJPA 4AIKA 4R79A 2W85A 2GWRA 3F8FA 5H6RA 2HFHA 2GA2A 3IWZA 3GUDA 1WSUA 4ZZDA 3KP3A 1IRFA 3RPQA 1FBSA 1XSVA 4EM2A 1R1UA 4LMYA 4CDGA 2O8XA 1H9TA 4LG0A 1S8NA 3MZYA 2FBIA 2A6HF 4LGWA 3J80K 1HBXG 3QRFF 1BOAA 1KU9A 2PQ8A 4HDVA 2XKPA 2NYXA 2F5FA 5LHHA 1BJAA 4XLNF 1XGOA 3KZZA 1XSDA 2HZTA 2V1XA 4YIFA 5KK1A 4ZZLA 1BI2A 2ETHA 3BJAA 3U2RA 4MQ9F 3O2PE 1R23A 4YFNF 2CYYA 2PFBA 1K6OA 4F7ZA 3CUQB 1YS6A 3ELKA 3WU1B 2M8EA 3F6OA 3BZ6A 4A6EA 4G7HF 5AONA 2K27A 3GFJA 4HF2A 2IP2A 5BS6A 2ISYA 3WTTC 4HV6A 5HDNA 3HHHA 1B59A 2XAQA 2ZCWA 3SHFA 5JI6A 3V8KA 3M7GA 1YS7A 4ON0A 3WTWC 4UUVA 1S6LA 4XBFA 4KDPA 1G4DA 1ZLJA 5EEGA 3F8CA 4G6DA 3D0SA 1BBYA 1O7FA 1XMAA 1ZG3A 2P6SA 3F8NA 5LRSA 1TNSA 2XHKA 3F6VA 2VXZA 4OMYA 3BY6A 2KJCA 4KIBA 1MD0A 3ROUA 3KP2A 2O0YA 5BQTA 4FT8A 1LDKB 1F1ZA 4KT5C 3CO7C 3Q9SA 1K78A 2ESNA 1F5TA 1EV7A 2B0LA 5HS8A 3HSEA 4A5NA 1EH7A 2VE8A 1P92A 3SQNA 1B6AA 2VBYA 2NNYA 3O6BB 2EFPA 4QWQA 3ZMUA 3LA7A 3HRUA 3HIFA 1WKMA 2VE9A 1FNNA 2A6EF 2F5DA 2RNJA 4G7ZF 4CO8A 2RN7A 2A68F 3F21A 3HTSB 4KYWA 3WG9A 1ZRFA 4I7HA 2XRNA 3H92A 1T0FA 1YW8A 1QO0D 1FPQA 4MTDA 2E1CA 5FD5A 2IA2A 2EFQA 5IT9K 1T39A 2QBYB 3RKWA 3HTUA 2EFWA 2EWNA 3M1EA 2MA3A 4M6YA 4HA8A 5H6QA 2VBZA 4HDUA 4O6JA 3FM3A 5DUIA 4GXOA 3ECHA 3C1DA 4LB5A 2XAGA 3R0JA 3KE2A 2NRAC 2HQNA 3GX4X 1KGSA 1ZRDA 3ML6A 2H6CA 2V1UA 4PGGA 3LSTA 3L9FA 4L5JA 1JHFA 2DU9A 1U78A 3MAJA 1IUYA 4MGRA 1UCRA 1SFEA 4ZYHA 2DO7A 2W84A 2GQQA 1ZRCA 4XSZF 1HXDA 2Q8KA 2OAZA 2RKHA 4O5VA 1SMYF 1UHMA 4U0WA 3E3VA 1UFMA 2L4AA 2BBYA 2W25A 4I2OA 2PI0A 2VT3A 2ADUA 1KQ0A 3F3XA 2Q2EA 3F22A 5D4RA 1NHAA 2IRFG 3NRVA 1DUXC 5FD6A 3BROA 2DI3A 3CTAA 3JAMZ 1FC3A 4EJUA 3IKVA 2EV6A 1ON1A 2BGCA 3ABTA 2UXNA 3BPXA 3EYIA 1IRGA 3WE2A 3C7JA 5E20A 3K0LA 5HDGA 2Z9OA 3COAC 3O3KA 1WWXA 2H94A 1D3YA 2D45A 2A69F 3ABUA 4M71A 2YPRA 1SFUA 2LF7A 3IC7A 3JTGA 2W57A 1SFXA 4KNYA 4JK1X 2UZKA 5JR3A 4G8XA 3T8RA 4WXCA 3FX3A 5DUKA 3OOPA 1HKTA 1YQAA 2OD5A 3Q5FA 1ONVA 3L00A 5A2QZ 2D1HA 3AAFA 1U8RA 1O3SA 3JW4A 3M8EA 1UHWA 1L0OC 2Z99A 3TO6A 2IPQX 2VBWA 3J80Z 2KIUA 4Y13A 3LQQA 3S2WA 3CUQA 4B8XA 3MCZA 4LJZF 3E6DA 4YG2F 2O61A 1U5TA 4RAYA 2G7UA 3TGNA 1HQCA 2AXLA 4GO1A 2YX7A 4PGHA 1DP7P 2M30A 1WQ2A 1E2XA 1HSJA 4HYEA 2G9WA 1ODDA 2ELHA 4A2UA 1HKSA 3QAHA 2C6YA 5ILVA 4L5IA 2WWYA 4IRIA 2LSOA 3QPHA 2XVCA 1ZG5A 2M1BA 1IXSB 4BNCA 1J0RA 1O3TA 2KJBA 3PQJA 4BHBA 5BMZA 2KIFA 4BYYA 5IT3A 2DLLA 2EFNA 3P7NA 3WTYC 5ED4A 1AOYA 4HBLA 3DV8A 1KU3A 1FYKA 2CQKA 1ZHFA 2K02A 2KRFA 4OIPF 1CF7B 3WGHA 3LQRA 4EJWA 2ZNYA 1H0MA 4U7BA 2L01A 4XSXF 3WGIA 4HX4A 4U88A 3MEXA 2EV0A 1IN4A 3I59B 3DPLC 1I27A 2CO5A 2HYGD 3KLNA 4IHSA 1YFHA 2IA1A 2RGVA 1Z91A 5LEJA 1FX7A 1TW3A 2OZUA 3DKWA 1OR7A 5E8GA 2NAZA 2VOPA 1EH8A 2CW0F 4KFCA 1J5YA 5CVJA 2E7XA 1OYIA 4I0AA 3TOAA 2OBPA 3GZ5A 3T8TA 3JAMK 3ZMSA 1XGMA 4IXAA 3TDUC 1MDMB 1W5TA 4UVBA 2MC3A 4EGZA 4OMZA 4P5OA 4G9YA 2L4MA 2MD5A 2EA4A 1T98A 2GAUA 5IT9Z 3FMRA 4YFKF 4ENNA 1ZARA 4RB0A 5HS7A 1S7OA 4IJAA 4M6XA 3JSOA 1RNLA 3DQVC 1QNTA 4KN7X 2OU2A 2EJRA 3EUHA 1OPCA 2DK8A 2QYOA 4LB6B 3SXYA 1R22A 1P2FA 4ZYEA 2P7CB 4PDKA 5TRDA 1LEBA 4Q47A 4OIQF 5E17F 2ZNZA 1FSHA 1IZ1A 5F1RA 5A2QK 4NHJA 5BPDA 3GO5A 4RGXA 1SMTA 2HKOA 1X3UA 2M87A 1R36A 3K69A 1MGTA 5JFRA 3N97A 3WTUC 1RIOH 4S04A 4I0BA 3V4GA 5J6XA 4BQAA 2HOEA 2CFXA 2X0LA 1ZGJA 3FWEA 1XB4A 2LNBA 2W24A 1U5TC 1R5GA 1A04A 1Z9CA 2JT1A 4IHTA 3ZN0A 2HYFA 2EB7A 3E6MA 2GXGA 3RPUA 3GZ6A 4CHUA 1XSXA 3IWFA 4Q5SF 1LQ1A 3I58A 4XLPF 4HLXA 2DPUA 1SD6A 3M8FA 3DXJF 3V7CA 2OZ6A 1YW7A 3H3UA 1QZZA 2KKOA 2HGCA 1YLFA 3WE3A 2FBHA 4L18B 4S05A 1GHCA 3G3ZA 1Z6RA 2QUFA 3GYHX 2YR2A 2QLZA 1U6GA 2PEXA 4FHTA 2JPCA 3WODF 3I53A 3W6JB 3MWMA 2LF8A 2E1NA 4ETSA 4MTEA 5K5QA 4H0EA 1USTA 1SD7A 4KN4X 3QU3A 2BE5F 2QQAA 4WXDA 2Y75A 3TKYA 5LRRA 5CVIA 3FXRA 2GIVA 4UV9A 2UWMA 4A6DA 5DDGA 2JZYA 2NNNA 1QGPA 1B9MA 1ON2A 3V7SA 2PLYA 3LA2A 1BIBA 4PCQA 3F72A 2IVMA 4KICA 2Z33A 4ASNA 4M9SA 5D5WB 1FYLA 2QQBA 4JQFA 3RYRA 4IVNA 3QOPA 2O6GE 4U7DA 5E1ZB 5D5VB 3E6BA 1I1GA 1BI1A 1FP1D 4ESJA 5D8LB 5DCMB 4ESBA 2NS0A 2X4HA 3LFKA 2G7HA 2COMA 3U1DA 4R8HA 2L3DA 3TQNA 4EMSA 2PG4A 3L7WA 1HW5A 4GGGA 5CVRA 3BPVA 3IL2A 3FHZA 3CJNA 5JVTA 3HRTA 3G73A 2DPDA 1W7PB 4I98B 3CO6C 3HRMA 3K1NA 2Z5UA 4A5MA 1P4AA 4HX7A 5HOOA 5FO5A 5KVRA 3REOA 4K2EA 1SD4A 1TW2A 4G94A 4WWCA 1S7AA 3BJOA 2LKPA 3KZYA 3F23A 1K7AA 1UB9A 3QP5A 5E8IA 4PZJA 2DFIA 5DD4A 3J7AO 3VOEA 5H20A 2FU4A 2K7LA 4IPAA 3HOTA 5L3CA 4M72A 4RGUA 1O3QA 1JHHA 1FYMA 2J5OA 3ULQB 1IN7A 4UXNA 1JXSA 2R7FA 3BWGA 5ILUA 3GLXA 4MEYF 3KP6A 4DQ2A 1SAXA 5ILSA 3K1PA 3GEZA 2XUBA 3BOQA 1RZ4A 3QP6A 2MH9A 4LG0B 2V6CA 1ZYRF 5FLXZ 3FM5A 4D0PA 2EV5A 1HW1A 1ZH5A 3FXQA 4L0ZB 2P5KA 3TO9A 4HF1A 3PFIA 2GXBA 3R61A 1TQMA 3IKTA 1H9GA 5J8CA 1S3JA 2D2WA 3I54A 2GA1A 4ZH4F 2YX4A 1KU7A 4MQVA 3M9AA 1IW7F 2ZBKA 2VC0A 4WK8F 3RTRA 2F5EA 4OINF 2QWWA 1IN8A 4UHTA 3GFIA 3DF8A 4N9IA 5FFXA 2ZFWA 2JTVA 3IHUA 4A0ZA 5CVVA 1I5ZA 4RB3C 1O57A 1WI9A 3KP4A 3BDDA 1Z7UA 3MZHA 1B1BA 2YSRA 4UNOA 2A07F 1F9NA 1IAWA 2FE3A 4L9VA 4QLCU 2GZWA 3ISPA 3TDZC 2DK5A 1G3TA 2XV4S 1XGSA 5HLHA 1WRJA 4ESFA 3DP7A 4BXUA 2RQPA 2DTRA 1BC8C 2STWA 2FMLA 2IT0A 4UVAA 1W7PD 2MLKA 2K4BA 3FZVA 4B09A 2ESHA 3R4KA 4IRHA 4HV5A 5D6FA 1QZYA 2EK5A 4OOIA 3B73A 3K2ZA 3SZPA 3KEOA 6PAXA 3N4MA 3HRSA 1FZPB 3RIRA 1IXRC 4GYIA 4RB2C 4ZYGA 3OV8A 4CZZA 3GW2A 4U0YA 1LEAA 3QU6A 2HWVA 4M9ZA 1U2WA 2P5LC 2ZMEB 2DQLA 3I0TA 2VOOA 3ZMTA 4NB5A 2PMUA 2ZXJA 1REPC 2ACJA 3ERED 1CGPA 1PUEE 3EETA 1W5SA 2IA0A 2BYVE 5DCMA 4EV0A 4CGZA 4YIIA 1XCVA 2JSCA 3T1BA 2QBYA 2MBFA 1FY7A 1OYYA 2EA2A 1LDJA 3I4PA 2HR3A 1LB2A 3U9GA 1B4AA 1D8KA 4A0YA 5LGTA 2FOKA 4KIGA 4CICA 3FXUA 4LK1F 2JRTA 2HTSA 1TBXA 3C18A 5LLQA 3B02A 1J7KA 3TOBA 4AD9A 1B9NA 4CXFA 4P96A 1T6SA 2VC1A 4GYGA 4P9UA 5E1XA 2QZ8A 3WTVC 2VT2A 1T2KA 5FLXK 4UV8A 1IN6A 3WTXC 3ZP5A 5FB2A 2P5VA 2VN2A 3VEPA 2RVCA 2Q0OA 2PN6A 4OIRF 4XRFA 3TO7A 5D8KB 3RI4A 1LDDA 5HDKA 4Z2YA 1XDUA 1Z1DA 5FFZA 5LHGA 1TTYA 5F64A 1PP8F 3E5QA 4O3MA 4MHGA 1KQ9A 3K1MA 4L9TA 1PP7U 1K79A 3ZMZA 3KEQA 2WC2A 3GVAA 1XN7A 1GVJA 5CVUA 3MQ0A 5TJJA 5E18F 4KMUX 1P6RA 5BPIA 2RC4A 2MLGA 1Z6TA 3CUQC 2HDCA 5D5UB 2WTEA 4EJVA 3HUGA 1J75A 2E7WA 4EM1A 3EQLF 1USSA 2A61A 1R00A 1BN5A 1E17A 1EH6A 1ZAOA 2H27A 5FGMA 1XDSA 1KQ8A 1HW2A 1R1VA 2L54A 2AS5F 4HQEA 1SD5A 1PDNC 1O7LA 5L3GA 3EDPA 3HOSA 2DW4A 2O03A 2IJLA 3ZN1A 2H6BA 3P9CA 2TDXA 2L02A 3PQKA 4JBAA 4CYDA 2YU3A 1YG2A 1O3RA 4RB1A 1U3EM 1KYWA 1FT9A 4E70A 3GF2A 4HW0A 1HSTA 4Y15A 5ICFA 3DFGA 4LD5A 5AIQA 3JTHA 4EJTA 2VBXA 3RDIA 5L3BA 1BIAA 1U5TB 5LBQA 3BJ6A 1ZGAA 4KMFA 3IRRA 1ZLKA 3R6SA 4HF0A 1FLIA 2STTA 2P8TA 2XAHA 4LK0F 3JSPA 2VODA 3LAJA 1HKQA 1YW9A 2CG4A 4I02A 5CYVA 3E6CC 2R3SA 4EJOA 5L3DA 2K86A 1TLHB 4ENJA 1S29A 2HQRA 2V9VA 2OQGA 3F8MA 4KA4A 1TQPA 1D5VA 3EYYA 3ZMVA 5L3EA 4G6QA 5ICEA 1QQIA 3ZQ7A 1STZA 2F2EA 1RI7A 4OU0A 5LEKA 1ZREA 1ULYA 1RUOA 4ENKA 1V3FA 1Z05A 3V8LA 3WGGA 4HQMA 3RJPA 4DNCA 2CWEA 4EQQA 1G6NA 1FBUA 3J81Z 4U0VA 3V8JA 2IW5A 1CF7A 5ICGA 4KIFA 3CUOA 2V79A 4HZFA 1XCBA 2HKXA 2XGXA 4FX4A 1ZG1A 1QBJA 1LJ9A 4Y17A 1DPUA 1OYWA 2ISZA 4P55A 2ZMEA 3I59A 4A12A 5HLIA 2K4JA 4RS8A 3ZPLA 2XAJA 3KP7A 2P4WA 4TV7A 1YTYA 1FBQA 5D5XB 2P6TA 1G3SA 1FOKA 4I09A 1I1SA 1R1TA 1XD7A 2FXAA 2DT5A 4FX0A 5DV5A 4AIHA 3P9IA 4Q4ZF 3T5XA 1MDMA 2QQ9A 1KA8A 4IF4A 3K9TA 5E1WA 1JE8A 3SFZA 3I71A 1MZBA 2HS5A 3C3WA 2D1VA 3HHGA 3E5UA 1DDNA 1BC7C 1C0WA 5HS9A 3LWFA 2FF4A 4BAYA 5LGUA 2FQ3A 3E97A 1MJAA 3F8BA 3I5UA 2QM3A 4M74A 1FWZA 1AWCA 3ECOA 2P7VB 2OA4A 5L3FA 1DPRA 4EGYA 1J59A 4IRGA 2M45A 1IXCA 1D8JA 4KUMA 1XMKA 3I64A 5AIPA 1R5HA 4GCVA 2FNAA 1IF1A 2WV0A 2RDPA 1YIOA 1LVAA 1MKMA 3NEUA 4LLGF 4N9HA 2XKOA 2FSWA 4WXHA 1BI0A 5D6EA 3LAPA 3RKXA 1KYZA 3R0AA 1FSEA 3GFLA 2HTJA 3E5XA 4L0YB 2DBBA 1Q1HA 3WTZA 4I01A 3L09A 5D4SA 2ZJ2A 5DD8A 2ZKZA 3KLOA 2DQRA 2R7DA 2JPBA 5JHUA 4YFXF 3CDHA 2KIMA 1GXPA 2LDUA 1MJ9A 3VFZA 1W4MA 2DAOA 1FP2A 4HAMA 3R60A 3W6KB 2BV6A 4NQWA 3KFWX 5J8FA 4LLLA 5HLGA 3GWZA 4WF2A 5CLSA 4N0BA 2O3FA 1TNTA 1BI3A 3Q9VA 4LFUA 4AWXB 3GFMA 2UXXA 3QPTA 3HYIA 1I6XA 5LGNA 2FNPA 2V1DA 2VONA 2MH2A 3L2CA 1LNWA 2PMHA 3FMQA 4AVPA 3J81K 5DEQA 1JGSA 2QENA 4ENMA 1Y0UA 4M9XA 1V4RA 3WU0A 1L3LA 3FF5A 1VTNC 5EEHA 5ICCA 2FA5A 1QPMA 1P4WA 2H09A 1P4XA 2FEZA 4ZYDA 2OQRA 2Y0MA 1K78B 3V7RA 4A0XA 1GXQA 2CGPA 4BHCA 4HX8A 1BM9A 4EVIA 2PBIA 2XROA 5K5OA 3FMSA 3GXOA 2FMYA 1OKRA 4RAZA 3BP8A 1YO5C 4OIOF 1R58A 4BH9A 5ERIA 3WTSC 3DPTA 5K1YA 2XASA 2F5CA 5K5RA 3KCCA 1R7JA 4Q48A 4EM0B 2A5YB 2FBKA 5BOXA 3H3ZA 3D5LA 5DYMA 2RV8A 1G3WA 1MJBA 1F4KA 1IN5A 1KU2A 3LA3A 1T38A 3DEUA 5CJ9A 2XAFA 5HVQC 1XGNA 4RGRA 1J2XA 1TQIA 2A3SA 3KETA 4AIJA 2XIGA 4L9NA 1YYVA 2M5WA 3RKYA 1J9IA 2QVOA 3RYPA 2Y48A 5DCFA 4WCGA 3ZMDA 3P9KA
chains in the Genus database with same CATH superfamily
1W7PA 4B47A 3HOXJ 1Y6IA 3H36A 3VODA 4G7OF 1X1BA 1MW7A 1G3YA 3IRQA 3CLOA 2FRHA 2E2HJ 2IS2A 3B6AA 1D1AA 5LHIA 1MNMC 5B1AH 4LLNA 3VB2A 4JP0A 4RGSA 4HLYA 2BEOA 4A3BJ 4WX9A 4UVCA 2NXNB 2X9DA 3HSFA 1PUFB 2HI3A 5F6FA 3IV5A 3BQYA 1U8BA 3T0YA 1OMIA 4F91B 3JRCA 2HVQA 3KYCB 3MFKA 3NQOA 2ZO4A 5J4VA 1I3QJ 2HQAA 3CJRB 4P9FA 4M73A 2J5PA 3RPUD 3SYTA 4XRSG 3ZQGA 5H2FC 2HEOA 3KX2A 2Z3YA 3HSRA 1ZN2A 3SZTA 5KAIC 2R7XA 2CSOA 4BHPA 4A3JJ 4A69C 2EFOA 2EIJH 2JA6J 4HOBA 4G12A 4MEXF 3KP5A 1RUNA 4L9JA 4R1HA 1RR8C 4XLHA 2X51A 5FKKA 4MNUA 2PJPA 3AFHA 4AIKA 4RMNA 2JSPA 3BC8A 2VJ4A 3HGGA 2EIKH 4R79A 2W85A 2GWRA 3F8FA 1EA3A 3FDYA 5H6RA 2HFHA 4PJNA 2GA2A 3IWZA 3SDBA 3GUDA 1RR7A 3BQZA 2KPMA 1WSUA 4ZZDA 3KP3A 4A3IJ 2XPUA 1IRFA 3RPQA 4BBRJ 2JRMA 3S16J 5EYRA 3DU6A 1FBSA 4A3MJ 1XSVA 4EM2A 5HNHA 1R1UA 1WJEA 3ABKH 4LMYA 2CV0A 4CDGA 2L9VA 3IP4B 2Y9ZA 3K7AJ 2H1KA 5K7HA 2O8XA 1H9TA 1BA5A 5F08A 3OSFA 3CC7I 2IBDA 4LG0A 2JA2A 1TWAJ 5J1UA 1HC8A 1S8NA 2DA3A 3MZYA 2X6OA 2FBIA 3G1LA 3TL4X 4A3KJ 2A6HF 3K6GA 4M3GA 1RESA 4LGWA 3ZCOA 4BDZA 3J80K 2XC7A 1HBXG 3FXKA 3QRFF 1X2NA 2BY1A 1BOAA 3V42A 1KU9A 2OPTA 2E19A 2PQ8A 4HDVA 5F0CA 2XKPA 2NYXA 2F5FA 2HYJA 5LHHA 1BJAA 2XGDA 5LD2C 4XLNF 2QKMB 2OC6A 1XGOA 3KZZA 1N25A 1XSDA 2BY2A 2HZTA 5EEAA 3AG4H 4PFOA 2V1XA 4YIFA 5KK1A 4ZZLA 2IGKA 1BI2A 2WV1A 2ETHA 3BJAA 3U2RA 3S1RJ 1IRZA 4MQ9F 4PJLA 3O2PE 1R23A 4YFNF 3S14J 2CYYA 4PUSA 4NUBA 4CH7A 2PFBA 5M5YJ 1K6OA 1X3ZB 4F7ZA 3OOUA 4H4KC 4XRMA 2XB5A 3CUQB 2LKSA 3VPRA 1YS6A 1ZK8A 4RLFA 2VB6A 3ELKA 3WU1B 2M8EA 2V6EA 5M5WJ 3F6OA 3CZ6A 1YJ9I 3BZ6A 3OYKA 2MFZA 2VKHA 1ZKGA 4A6EA 4IX7A 1WJBA 5AONA 3I3LA 4G7HF 2M3AA 2JA8J 3UNGC 2K27A 3GFJA 4HF2A 2CUFA 2IP2A 5BS6A 2ISYA 3WTTC 2HVSA 3IH3A 4HV6A 2NVUB 3L2WA 1XG1A 4V2FA 1VQOI 5HDNA 4KT6A 4IQ4A 3HHHA 1B59A 2IGOA 1D0ZA 2XAQA 2ZCWA 3SHFA 5JI6A 3K4KA 3V8KA 3HKZA 3M7GA 2L0KA 2M34A 1YS7A 4ON0A 1WJCA 3GMEA 3WTWC 4UUVA 5M3FJ 1S6LA 4XBFA 2X1CA 4YELA 5GAEJ 4KDPA 4QTRA 2KZVA 1G4DA 1ZLJA 3LOCA 5EEGA 2FJ1A 1BW5A 2KMUA 2IS1A 3F8CA 4AYBA 4G6DA 3D0SA 1BBYA 1WZ2A 5EGOB 1O7FA 1XMAA 3RSNA 2XF7A 2KQRA 1ZG3A 2LYCA 1OCTC 2P6SA 3F8NA 1UHSA 3HGYA 5LRSA 3BCAA 4M3DA 3NARA 5FROA 1TNSA 2XHKA 3F6VA 2VXZA 4OMYA 3CQZJ 2DDBA 3BY6A 1UG0A 2KJCA 2FOWA 2BY3A 1T33A 4KIBA 2R5YB 1MD0A 3ROUA 3KPHA 3KP2A 2O0YA 4AUXA 2ME6A 5BQTA 1E0EA 1FOXA 3K4LA 3OS0A 3QWLA 4FT8A 1LDKB 1F1ZA 2CUZA 1YX5A 4KT5C 5DM7F 2IXSA 3CO7C 3Q9SA 1HDPA 1K78A 1I50J 2ESNA 1F5TA 1EV7A 2B0LA 3G1MA 4RLQA 5B5EC 5HS8A 3HSEA 3TW6A 1IV6A 4A5NA 1EH7A 2BOLA 2VE8A 3FKJA 1P92A 2VPRA 4BQQA 3SQNA 1B6AA 2VBYA 2NNYA 3TEDA 2VQGA 3O6BB 2EFPA 2HDDA 4QWQA 2W7NA 3G1OA 3ZMUA 3LA7A 3HRUA 3E1SA 3HIFA 2DYSH 1WKMA 2VE9A 1FNNA 2A6EF 3ZQCA 2VJ5A 1MSFC 2F5DA 2RNJA 2E2IJ 4G7ZF 1B72A 1OQYA 2EZIA 4CO8A 2RN7A 2A68F 3F21A 4BEHB 3HTSB 1N77A 4KYWA 3VYSB 4IEJA 3WG9A 2R7TA 1ZRFA 1V55H 4I7HA 3OR2C 2XRNA 3H92A 1T0FA 1YW8A 1QO0D 2CMPA 1D1BA 2WADA 2BHZA 1ERDA 2QF7A 4UB8C 1FPQA 4MTDA 2LRDA 3OYDA 2E1CA 1MBHA 3OSGA 5FD5A 2CUEA 4BQNA 2IA2A 1QPIA 2DMNA 1X2MA 3WU2C 1H88C 2EFQA 3PM1A 3JRGA 1U0JA 3FHNA 3TBIA 5E3OA 5IT9K 3I9V2 1T56A 4GRIA 1T39A 4DYCA 3RKWA 2QBYB 3A4CA 1VQLI 3HTUA 2EFWA 2EWNA 1F43A 1GLNA 1JTYA 3M1EA 5KCMA 2MA3A 4M6YA 2OCCH 1G8XA 3MD2A 3MMYB 4HA8A 3BG7A 1G59A 3C2HA 2Y69H 5H6QA 4IL6C 2MSYA 2MC4A 2VBZA 4HDUA 2CQXA 1FIAA 3FXJA 4F92B 4O6JA 3FM3A 3PSIA 5DUIA 2VL8A 4GXOA 3A0BC 2FQ4A 3FK7A 1MIJA 3ECHA 1FMVA 3C1DA 4DBRA 4PSWA 4LB5A 2KDZA 2XAGA 3R0JA 3KE2A 2L2OA 2NRAC 3HDDA 2HQNA 3K4JA 3GX4X 3HPHA 5FLVA 3KYDB 2IS4A 3DBLB 5JLWA 4HRIA 1KGSA 2I8DA 1ZRDA 2R5ZB 3ML6A 3GTLJ 2H6CA 3AL0C 2V1UA 4PGGA 3LSTA 1OCRH 2NS7A 3L9FA 2M2EA 4L5JA 3DBHB 1JKRC 1YITI 3K2AA 1JHFA 2G0EA 2DU9A 2KISA 1U78A 3MAJA 1IUYA 4MGRA 1UCRA 2PX9A 2A5WA 1SFEA 4MFEA 4ZYHA 3L2VA 1HLVA 2DO7A 2W84A 1HOMA 2GQQA 4DIQA 1ZRCA 2FD5A 4J00A 3DCFA 1BR2A 1HXDA 1RPWA 3BR2A 3IAS2 4MO7A 4XSZF 2OAZA 2Q8KA 2RKHA 4O5VA 4KISA 3ERMA 1SMYF 1QA6A 1UHMA 4U0WA 3E3VA 3S2HJ 1UFMA 4A3CJ 2L4AA 2BBYA 1N75A 2W25A 4XRSA 4I2OA 3OWTA 3HOUJ 2EQRA 2PI0A 2VT3A 2ADUA 1KQ0A 3F3XA 1XMXA 2Q2EA 3F22A 5D4RA 1NHAA 4E4HA 2IRFG 2ID3A 3NRVA 1DUXC 5FD6A 3BROA 2DI3A 3CTAA 2XGEA 3JAMZ 1FC3A 4EJUA 5IP9J 1Z3YA 4C3HJ 1DU6A 3IKVA 3K70C 2EV6A 5GAGJ 3H35A 2YUSA 3VSKA 3H9QA 1ON1A 2BGCA 3ABTA 3BPXA 2UXNA 3EYIA 1VQNI 1IRGA 2EIMH 3C7JA 3HUGB 3WE2A 2R7RA 3ZR8X 5E20A 2ZJQF 2V4JC 3K0LA 5HDGA 5EZGA 2Z9OA 3COAC 3O3KA 1WWXA 2ME0A 2H94A 2B9SA 5LFAA 5C4XJ 1D3YA 2D45A 3BG3A 2A69F 1IO2A 3ABUA 4AU7A 3GTPJ 4M71A 4XKCA 4ZJZA 2YPRA 1SFUA 3OYLA 2L7ZA 2LF7A 3U21A 3D1NI 2EZLA 3MN2A 3HM5A 3IC7A 4F52A 2DJIA 4OAYA 4HEA2 2W57A 3RCOA 1SFXA 3JTGA 4KNYA 4JK1X 2UZKA 1MSEC 2E2JJ 5JR3A 3FXOA 4G8XA 3T8RA 4WXCA 3FX3A 5EG0A 5DUKA 3OOPA 1HKTA 2LREA 3H0GJ 1YQAA 2OD5A 1Z67A 3Q5FA 1ONVA 3L00A 1S7EA 1OISA 5A2QZ 2D1HA 3AAFA 1U8RA 2O9LA 2DA2A 2DMUA 2HU9A 3SZGA 1O3SA 1MH4A 3JW4A 2BY0A 2Y31A 4M3EA 2KIQA 1IRXA 3M8EA 2ID6A 4XLEA 1UHWA 3M07A 4LITA 1L0OC 5BNGA 2IS6A 5CPRB 2Z99A 3TO6A 2IPQX 2DJNA 3Q0WA 1E3PA 2XDVA 2VBWA 3J80Z 1WCMJ 2KIUA 4Y13A 3LQQA 3S2WA 3CUQA 4B8XA 3MCZA 2NVYJ 4Z6YA 2HZDA 4LJZF 4BJ6C 3E6DA 3IH2A 2EILH 2N8GA 4YG2F 5FKNA 3VWBA 2O61A 5F0FA 1BR4A 1RRJA 5M5XJ 1AU7A 1U5TA 4RAYA 3SEQA 1BR1A 2G7UA 3TGNA 1HQCA 2AXLA 4GO1A 2YX7A 4PGHA 1DP7P 2M30A 2F4OB 1WQ2A 3JRHA 3DU5A 1E2XA 1HSJA 4HYEA 2JK3A 2G9WA 1ODDA 2ELHA 2DXIA 1IUFA 2HPMA 4A2UA 1HKSA 3QAHA 1T0FC 1NK3P 2C6YA 5ILVA 4L5IA 2WWYA 4IRIA 2LSOA 2F6CA 3WHBA 3QPHA 2NS8A 2XVCA 1ZG5A 2ZMEC 1WHUA 2M1BA 3HL2A 1IXSB 4BNCA 1YE9A 1J0RA 1O3TA 2KJBA 5EGOA 3MZ8A 3LSJA 3PQJA 4BHBA 5BMZA 1FTTA 3HJEA 2KIFA 1TT5B 4BYYA 4CYCA 5IT3A 2DLLA 2W48A 3LSKA 2F4MB 2EFNA 3PO3J 3P7NA 3WTYC 1ETYA 2R4GA 5ED4A 1AOYA 4HBLA 3CDLA 2ZSHB 3PIOF 3DV8A 1KU3A 4MLOA 1FYKA 1DGRM 2CQKA 1ZHFA 2K02A 3IAM2 4B3AA 2DMQA 3PL8A 2KRFA 4N4OB 4OIPF 1CF7B 3WGHA 3LQRA 2XF6A 4L5EA 4EJWA 2ZNYA 2PJRA 1H0MA 3QYEA 4U7BA 3S3NA 1TZLA 5IYBJ 1NH3A 4MFDA 3TP0A 1JGGA 2L01A 4XSXF 3BG6A 3ZXSA 2JUCA 3WGIA 3HG9A 4HX4A 5IP6A 4U88A 3MEXA 2EV0A 4E7LA 1IN4A 3I59B 4I76A 3DPLC 3M4OJ 4C2UA 2WAFA 3FXLA 1I27A 1OJLA 5HLTA 5FLMJ 2CO5A 1JT6A 2HYGD 3KLNA 4IHSA 1YFHA 2R92J 3S8PA 2IA1A 2H1LA 2RGVA 5J1YA 1Z91A 4BY1J 3PUBA 1K4TA 4UUTA 5LEJA 1FX7A 1TW3A 2OZUA 2UUZA 3DKWA 2W1OA 3UR3C 1OR7A 2JA7J 5B1BH 4C30A 4M6VA 5E8GA 2NAZA 4RM3A 2VOPA 1EH8A 4ZTJA 4KITB 4BXFA 5B3SH 2CW0F 4KFCA 4QPOA 1J5YA 4BU2A 5CVJA 1VI0A 2PMZA 1X58A 2XAUA 4NC6A 3DTKA 2E7XA 1OYIA 4I0AA 3TOAA 4B3XA 1A35A 4RBOA 3HOVJ 3ZOBA 1WPKA 1WJAA 2OBPA 3GZ5A 3T8TA 3JAMK 2ZXWH 1XGMA 3ZMSA 4IXAA 2V9PA 4PFPA 2DMTA 3TDUC 1MDMB 1W5TA 4UVBA 3BG9A 2MC3A 4EGZA 4OMZA 4P5OA 2VXDA 2L4MA 2DFEA 2MD5A 4G9YA 2EA4A 2CH0A 3BT9A 1T98A 3W3CA 2E36A 2GAUA 3GCMA 5IT9Z 2R7OA 5GTIC 3FMRA 4YFKF 1V5FA 3OYAA 4BE0A 1R49A 2R7ZJ 3CP8A 4ENNA 4Y3OA 4D7NA 1ZARA 4RB0A 5HS7A 1S7OA 4IJAA 4M6XA 3JSOA 1RNLA 4DJAA 3DQVC 1QNTA 4KN7X 2OU2A 1YJWI 3S15J 2EZHA 3PJRA 4D5FA 2EJRA 3EUHA 2DA6A 1LPQA 1AHDP 1OPCA 1SAUA 2DK8A 2QYOA 4LB6B 3SXYA 1R22A 1P2FA 4ZYEA 2NVXJ 4U87A 1UELB 2P7CB 3QYBA 4PDKA 5TRDA 1LEBA 3O8HA 4J19A 4Q47A 4DYQA 4ZTFA 4OIQF 2MW8A 3GTOJ 1Y0NA 5E17F 2CU7A 2ZNZA 3VYTB 2R7SA 1P7JA 2GIZA 4IHVA 3I56I 1FSHA 1IZ1A 5F1RA 5A2QK 1VQ9I 1S5LC 3ZQIA 3AG2H 4NHJA 5BPDA 3GO5A 2LMDA 4RGXA 3CLQA 3EPZA 1ZQ3P 1I6HJ 1SMTA 2HKOA 1X3UA 2CQ7A 1U9NA 1R36A 2M87A 3H5NA 3G71I 1APLC 3K69A 1MGTA 5JFRA 3N97A 1H8AC 1JT0A 1R4NB 3LSIA 3O8GA 3M1CA 4ITVA 1LFUP 3BTIA 3WTUC 1RIOH 4S04A 1NK2P 4I0BA 3V4GA 5J6XA 4BQAA 3L1PA 2HOEA 2CFXA 2ZC2A 2X0LA 4PSXA 2ZXHA 1ZGJA 1YHQI 4M3FA 1OCCH 1ENHA 3FWEA 1XB4A 2R7WA 2ZB9A 2LNBA 2Y2ZA 2W24A 3OS1A 1U5TC 1R5GA 4W1UA 2HDWA 1A04A 1JKPC 3DPUA 1Z9CA 2KL4A 4C9YA 2JT1A 4IHTA 4IZZA 1MBFA 3ZN0A 2ZXIA 2HYFA 2EB7A 2UV1A 5IY5H 2BVMA 1WJ5A 3E6MA 2GXGA 3RPUA 1QVTA 2NVQJ 4UUSA 2WBMA 3GZ6A 1Y8QB 2X1EA 3CCVI 4CHUA 1XSXA 3IWFA 3VDXA 4Q5SF 1LQ1A 3I58A 4YEJA 4XLPF 4HLXA 2DDAA 2LY1A 2DPUA 4D9JA 1SD6A 4BBSJ 4C3JJ 1V5EA 3M8FA 3DXJF 3V7CA 2OZ6A 1YW7A 4IOCF 1WVRA 3H3UA 3WHCA 5FKOA 4PJMA 1QZZA 1FMWA 2KKOA 3DKYA 2B7EA 2HGCA 1YLFA 3WE3A 2FBHA 4L18B 4S05A 1GHCA 1EF4A 2E1MC 1B8IB 5GP9A 1X1PA 2RAEA 3G3ZA 1AKHB 1Z6RA 2QUFA 3GYHX 1ETXA 1EJ9A 4NC8A 2YR2A 2QLZA 5GAHJ 3ZQLA 1HA8A 4IOAF 3PNTA 4X6AJ 1LFPA 2AXTC 1IGNA 3TP3A 1U6GA 2PEXA 4FHTA 4XKWA 2JPCA 3WODF 3S1NJ 3I53A 4YRVA 2EZKA 3Q0VA 3W6JB 1ORKA 3MWMA 2LF8A 2E1NA 4ETSA 4MTEA 1R4MB 5K5QA 1YRNA 3BR6A 3ZQFA 1K4SA 2XB0X 4H0EA 2LBFA 1USTA 1VQ6I 1SD7A 4KN4X 3QU3A 2BE5F 2QQAA 1JUSA 4F93B 1AA7A 4WXDA 2Y75A 3TKYA 2DFHA 5LRRA 2F48A 2LVSA 5CVIA 3FXRA 2GBYA 2GIVA 1VQ7I 4UV9A 2UWMA 2DMPA 4A6DA 5DDGA 2JZYA 2MD0A 2NNNA 2Z16A 3DWLE 2QSHX 1QGPA 5JLXA 2KLOA 1H89C 3H0DA 3ABMH 1E3HA 1B9MA 3P5JA 1ON2A 3V7SA 2PLYA 2QKLB 3LA2A 1BIBA 4II3A 4PCQA 3JRFA 2BHYA 3F72A 3U1KA 4BE2A 4E7JA 5TGTA 1SVMA 2IVMA 3CCMI 4KICA 4HNTA 1QHHD 2Z33A 2K5CA 2Y9YA 5IPAA 1YX3A 1KONA 2K9MA 4ASNA 2K9LA 4M9SA 5D5WB 1FYLA 1LFBA 4E7ZA 2QQBA 1T8IA 4JQFA 2DN0A 2XRLA 2M4GA 3RYRA 4IVNA 4XM3A 1X1CA 1PJRA 3QOPA 3L2RA 2O6GE 4U7DA 5E1ZB 5D5VB 3E6BA 1I1GA 2GOMA 1BI1A 2IGNA 1FP1D 4IKFA 4FE7A 4P1WA 3KIOA 4ESJA 5D8LB 5DCMB 2E5ZA 4Y4RA 1JJ6C 2M7AA 4ESBA 2VJIA 3OR1C 2NS0A 2R93J 4A3GJ 1VQ4I 2X4HA 3LFKA 3OYFA 2G7HA 4EATA 1ETKA 1OCOH 2COMA 1X4PA 5K7ZA 3PSFA 3U1DA 4R8HA 2CS3A 2L3DA 3TQNA 4EMSA 2PG4A 2KP6A 5KAFC 3FXMA 3L7WA 1HW5A 4GGGA 5CVRA 3OYJA 1MH3A 3BPVA 5DTDA 3EUHC 3IL2A 3FHZA 3CJNA 2QGUA 5JVTA 3OY9A 2HVRA 3HRTA 3JRAA 3G73A 1UAAA 4DYRA 1W0TA 2DPDA 1W7PB 2ZJPF 4I98B 4XNFA 4XOTA 3CO6C 3HRMA 3SDGA 3K1NA 2JUGA 2Z5UA 1P4AA 4A5MA 4HX7A 4FASD 5HOOA 3K4CA 5FO5A 5DM6F 1GV5A 3G6EI 5EDNA 1SANA 3KZIC 5KVRA 3REOA 3H1CA 2L5QA 4K2EA 4FTHA 5F27A 1SD4A 4BE1A 1TW2A 1R5ID 2RNGA 3ASNH 3JCUC 4G94A 1WH7A 1ZELA 4WWCA 3CC4I 1S7AA 3BJOA 3CMMA 1K83J 2LKPA 1MNDA 3KZYA 1YOVB 4XIDA 3I55I 3F23A 3A01B 1K7AA 1MBKA 3LSPA 1UB9A 1D0XA 1PUFA 3QP5A 5E8IA 4PZJA 2DFIA 5DD4A 3JRDA 3S17J 3J7AO 3VOEA 5H20A 4ZDPA 3W2WA 2LK2A 1UJ8A 2FU4A 2K7LA 1ETOA 4IPAA 3HOTA 1JI8A 5L3CA 4M72A 4Y52J 1TWFJ 1QZEA 4XKBA 3A2KA 1CQTA 1XPXA 3K4MA 4RGUA 3PNYA 1O3QA 3HOWJ 1JHHA 2DOEA 1FYMA 2J5OA 3ULQB 2CRGA 3CJQB 1IN7A 2JVGA 5J47A 2OTLI 2AO9A 4UXNA 4V19K 1JXSA 2R7FA 4DZPA 4IHXA 3S2DJ 3M3YJ 3W2VA 4DGWB 3BWGA 5ILUA 3GLXA 5HNFA 4MEYF 5FKLA 2X6XA 3KP6A 4DQ2A 1SAXA 3AL0B 5ILSA 3K1PA 4HSRA 4JX5A 3GEZA 2XUBA 3S1MJ 1TL8A 3BOQA 2VKDA 3MKYB 1RZ4A 2W00A 2D5VA 4C3IJ 4JYKA 1IG7A 2BXYA 3ZQHA 1XC5A 3QP6A 2MH9A 3RZDJ 3ESWB 4LG0B 2V6CA 2K40A 4B44A 1ZYRF 5FLXZ 3FM5A 1V5GA 4D0PA 2M7BA 2EV5A 1HW1A 4CCMA 1X19A 1ZH5A 1OCPA 3S32A 2ICWG 3FXQA 4L0ZB 2P5KA 4RAGA 3TO9A 3PFIA 2YU9J 4HF1A 2GXBA 3R61A 1TQMA 1ETWA 3IKTA 1H9GA 2VI6A 1S3JA 5J8CA 4IO9F 1FOWA 2D2WA 5J4YA 3I54A 1LE8B 2KFDA 4V2GA 3PUFA 3BLYA 3IUOA 2GA1A 4ZH4F 2DT7B 2OUMA 2YX4A 1KU7A 3E0JB 5IOZA 2VPLA 4MQVA 1X4OA 3M9AA 4A3FJ 1PYVA 1IW7F 2ZBKA 2VC0A 1TC3C 4DW6A 2MYSA 5C44J 3LFUA 4WK8F 3RTRA 2VQHA 1YI2I 3KEYA 3IH4A 5JVGF 2F5EA 4FISA 3NAUA 4OINF 5C4JJ 2QWWA 1IN8A 3BZCA 4UHTA 3GFIA 3DF8A 4N9IA 1UZCA 1QVUA 3DTIA 5FFXA 2ZFWA 3N05A 5KNLA 2B63J 2JTVA 3IHUA 4A0ZA 5CVVA 3OMYA 2A05A 4S0HB 4LIUA 2TCTA 1Z3XA 1I5ZA 9ANTA 4RB3C 2K85A 1GUUA 2P81A 2M0MA 2VKVA 1BL0A 1O57A 1SVLA 1WI9A 3KP4A 1MMGA 3BDDA 2MABA 1Z7UA 2XGCA 3BTCA 2IEKA 4HPQA 1X1DA 3MZHA 1B1BA 2YSRA 5F1JA 4UNOA 4PJJA 2A07F 1F9NA 1IAWA 3GTKJ 4XL9A 1SVOA 3RQ4A 5FRNA 2FE3A 4L9VA 4QLCU 3F9KA 1O4XA 1TWCJ 2E71A 2GZWA 4JOMA 3ISPA 3TDZC 1Y56A 2DK5A 1G3TA 2XV4S 1XGSA 2LD5A 5HLHA 1WRJA 2JJ7A 4I99C 4ESFA 1MBEA 3S3OA 3DP7A 2L9SA 4RM2A 3LSHA 4B1RA 4BXUA 2RQPA 2DTRA 1BC8C 5FKMA 4CCKA 2STWA 2ELKA 2FMLA 3OIOA 2IT0A 4UVAA 2VUMJ 1W7PD 1Y1VJ 3GTGJ 2MLKA 5IP7J 2K4BA 2L7FP 3FZVA 4B09A 3DTEA 2ESHA 2R5YA 2XSDC 3R4KA 4AIDA 4IRHA 4HV5A 5D6FA 1QZYA 2EK5A 3HEFA 4OOIA 3B73A 3HXLA 3K2ZA 3SZPA 3KEOA 6PAXA 2Z2SB 3N4MA 1S72I 3HRSA 1FZPB 4Y33A 3RIRA 2IGMA 5CQEA 5KHDA 1IXRC 4GYIA 4RB2C 1RETA 4XLFA 4DOZA 2X85A 4BL0B 4ZYGA 2HXOA 3OV8A 1OCZH 2BW3B 4CZZA 1VQ5I 1Z77A 4FE4A 1B72B 3GW2A 1GVDA 4FETA 3K4NA 3C2GA 2GXAA 2LKXA 4U0YA 3RKQA 4A93J 1LEAA 3QU6A 1QRYA 2DOAA 2HWVA 3QPSA 1MMSA 4ZDOA 4M9ZA 3WG7H 1U2WA 2KRCA 2P5LC 3H5AA 4BQOA 2DODA 2LG4A 2DTZA 4II2A 1J09A 3F0CA 4BEHA 4E7KA 4BDYA 4RDUA 2ZMEB 2O7OA 1E3OC 1JTXA 3OL4A 3CD6I 2CW7A 2DQLA 2F5VA 4E7HA 3I0TA 2VOOA 3ZMTA 4NB5A 2PMUA 2ZXJA 2O8KA 2ZSIB 3BTJA 2ACJA 1REPC 3ERED 1CGPA 1PUEE 4BJTA 3EETA 3K10A 3W6VA 1W5SA 1POGA 2IA0A 2VKEA 2VASA 2BYVE 2WAQN 3FBNB 5DCMA 4BKXA 4EV0A 4YIIA 4CGZA 2EH3A 1BOBA 2LH9A 1XCVA 2JSCA 1K6YA 3T1BA 2QBYA 2MBFA 2LY9A 3A0HC 1FY7A 1OYYA 1PVEA 2JN6A 2EA2A 1LDJA 3I4PA 3ASOH 5TISC 3BR0A 2HR3A 1LB2A 3BR5A 4J01A 3U9GA 1FJLA 1B4AA 1D8KA 1IDZA 4XOPA 4JX4A 4A0YA 1W36C 1U9OA 2LOOA 5LGTA 4BUPA 2FOKA 2CW8A 4KIGA 5EJCA 4CCLA 4CICA 3FXUA 4LK1F 1A36A 2JRTA 2HTSA 1TBXA 3C18A 3OIPA 5LLQA 3DEEA 3B02A 1J7KA 1P7IA 3TOBA 3ONQA 4AD9A 2VQLA 1B9NA 4CXFA 1VQ8I 4CUGA 4P96A 1T6SA 2VC1A 3OL3A 4GYGA 4P9UA 3CCJI 3BR3A 2K3PA 2R5ZA 2O5RA 5E1XA 2HOAA 4E7IA 3J7AY 2QZ8A 1Q1VA 3WTVC 3DLLF 1X1AA 2VT2A 1T2KA 5FLXK 2Q1ZB 4UV8A 1NG6A 1IN6A 2VIXA 2XSJC 3WTXC 3ZP5A 3JRBA 5FB2A 4AM3A 2P5VA 2VN2A 3LMMA 3A01A 1T08B 3VEPA 3ZRGA 2KDOA 3SEZA 3K70D 2GM4A 2RVCA 5E3LA 2Q0OA 3QPLA 2PN6A 4XLAA 1XX5A 2X48A 1GDTA 1TWGJ 4OIRF 3H9GA 5HODA 4XKVA 4XRFA 2QSFX 1VZ0A 1WFXA 3TO7A 4B48A 5D8KB 3RI4A 3RQIA 1LDDA 1FOYA 5GPAA 5HDKA 3X2QH 2JWTA 3AG1H 3VSLA 2Q2EB 4Z2YA 1XDUA 1MMDA 1Z1DA 3J7YJ 5FFZA 3BCBA 2KZGA 5LHGA 2R0QC 1K61A 1TTYA 3LSGA 5F64A 1PP8F 3E5QA 4QIWN 3OYIA 4O3MA 4MHGA 1KQ9A 3K1MA 4L9TA 4XORA 2LY2A 1PP7U 1K79A 3ZMZA 3PFYA 3KEQA 2NOGA 2WC2A 3CDIA 4C2MJ 1DQUA 3GVAA 1XN7A 1GVJA 5CVUA 1Z7LA 3MQ0A 2GOXB 5TJJA 4AC0A 5E18F 4KMUX 1P6RA 3QYFA 2RC4A 5BPIA 3H5RA 2MLGA 1Z6TA 2HPIA 3CUQC 2HDCA 3B6CA 2ZFUA 5D5UB 2WTEA 1UG2A 4EJVA 3HUGA 1JUPA 3ZQQA 2E7WA 4HNUA 1J75A 4D1QA 4CZCA 4EM1A 3EQLF 1USSA 1LVKA 2QSGX 2AHQA 1W5CC 2A61A 1R00A 4CCNA 1BN5A 1E17A 1EH6A 2W82A 1XS9A 1ZAOA 2XPWA 2H27A 5FGMA 1P9QC 2X6WA 4RA2A 1ZR2A 1XDSA 1KQ8A 3FK6A 3JRIA 1HW2A 1ZR4A 1GT0C 1R1VA 2L54A 2QCOA 2AS5F 4HQEA 1SD5A 2BZTA 5F04A 5EG0B 1HCRA 2CUJA 1FTZA 1PDNC 2K9NA 1O7LA 5L3GA 4X1EA 4EEFG 4AVZA 1LE8A 1KZHA 3EDPA 4NQWB 3HOSA 2DW4A 2O03A 3I4MJ 2IJLA 3HBLA 4NC7A 3ZN1A 2JQ7A 2H6BA 3P9CA 2WA0A 2TDXA 2L02A 3DEWA 3PQKA 1OFCX 4A3DJ 4JBAA 3OYBA 4KJZA 3QQAA 2LTPA 4CYDA 5DS9A 2YU3A 5B66C 2AQEA 1Y39A 1YG2A 1YJNI 1ACIA 1O3RA 4RB1A 2M4KA 1U3EM 1WJDA 3PIPF 1KYWA 1FT9A 2V9KA 4E70A 3GF2A 4HW0A 1HSTA 2QA4I 4Y15A 5ICFA 2RREA 3DFGA 4LD5A 4HG2A 5AIQA 3JTHA 4EJTA 2VBXA 3PNVA 3RDIA 3HPGA 1VQMI 3E7LA 5L3BA 1BIAA 2XPVA 1U5TB 2BXZA 5LBQA 1R71A 3BJ6A 5J3LA 1ZGAA 4KMFA 3IRRA 1ZLKA 3R6SA 1YIJI 4LOCA 4HF0A 2DFFA 1FLIA 2STTA 1F36A 2P8TA 2XAHA 4LK0F 4ZDLA 1A6IA 2FUG2 3JSPA 3LAJA 1HDDC 2VODA 2TRTA 1HKQA 1YW9A 2CG4A 4I02A 5CYVA 3E6CC 1G2HA 2R3SA 4EJOA 3MKWB 5L3DA 2K86A 1TLHB 4ENJA 1LUJB 1X3WB 3S1QJ 4IHYA 1S29A 2HQRA 2V9VA 1IJWC 2OQGA 3F8MA 1D5YA 3MKZA 4KA4A 1TQPA 4W97A 1BJZA 4XMYA 1XTAA 1D5VA 3EYYA 3ZMVA 3TMOA 3GLLA 1MMAA 1RKTA 2ECBA 4RAFA 1WH5A 5L3EA 1MBGA 2E34A 4CYCB 2EINH 4G6QA 5ICEA 1QQIA 3S93A 2QEXI 3OYNA 3OS2A 3ZQ7A 3D5SC 1UMQA 3FISA 4BS9A 1STZA 2F2EA 1R6RA 2K9SA 1RI7A 2AQFA 4OWRB 2OF7A 4OU0A 1OR7C 5LEKA 1ZREA 1ULYA 5FJ8J 1RUOA 4ENKA 1V3FA 1NTCA 1Z05A 3AG3H 2E1MB 3V8LA 3CMEI 3WGGA 4HQMA 4IQJA 4XK4A 3RJPA 4DNCA 4PJ0C 2EBIA 2V26A 2CWEA 4DZJA 4EQQA 1G6NA 3CCQI 1FBUA 2PJRB 2WAQA 3J81Z 1QU3A 3FBIB 2I5UA 2E60A 4U0VA 3V8JA 2IW5A 4UY8I 1HF0A 1CF7A 1SFOJ 2HXIA 5ICGA 4KIFA 3CUOA 2DYRH 4F55A 4C2TA 2V79A 2BW3A 4HZFA 1XCBA 2CJJA 3DKXA 1VF9A 3CP2A 2HKXA 1JJ8C 2XGXA 4FX4A 2LC2A 1ZG1A 1QBJA 1LJ9A 3A02A 4Y17A 4BJ5C 2OCEA 1DPUA 3CJTB 1OYWA 2ISZA 4P55A 4F3QA 3H3VK 2ZMEA 3I59A 1W36D 4A12A 2M0CA 3CMAI 2DA4A 5HLIA 2WB1N 3W2AA 3CCRI 2K4JA 4RS8A 3ZPLA 2XAJA 3KP7A 2P4WA 3J7ZI 4TV7A 2OV7A 1YTYA 1FBQA 3FKIJ 4HSTA 5D5XB 1ZGWA 4LG3A 2ECCA 4G6TB 1GV2A 4B43A 1R9TJ 2P6TA 1QHGA 2ZJRF 1G3SA 4HNVA 1FOKA 5CKTA 2YS9A 4I09A 2VLAA 2Z1DA 2IAIA 3C2BA 1I1SA 2L9NA 4BGDA 1R1TA 1XD7A 2FXAA 2DT5A 4FX0A 1RC9A 2L9RA 5M3MJ 5DV5A 2LP0A 4AIHA 3HB9A 1VQKI 2FX0A 3P9IA 3JREA 4Q4ZF 3HC7A 4Y7NJ 4QSHA 1VQPI 3T5XA 1VFCA 5GTHC 1MDMA 1Z21A 2QQ9A 1KA8A 4IF4A 2QQ8A 3K9TA 3UKGA 4D7MA 2Y0SN 1SEUA 1MBJA 5E1WA 1TT0A 2K3FA 3TW7A 1JE8A 3SFZA 3AKZA 3I71A 1MZBA 4NBQA 1I39A 1JKQC 1RKWA 4NDLA 4BY7J 2HS5A 3C3WA 2D1VA 3HHGA 2V1NA 3E5UA 2XF5A 3GBGA 1FIPA 1DDNA 2OTJI 1BC7C 3OYGA 2PMZN 3QOEA 1C0WA 2KT0A 5HS9A 2COBA 1N78A 4CCJA 2NOJB 2FF4A 3LWFA 4BAYA 5LGUA 4A3LJ 1SC7A 2FQ3A 3E97A 1SFKA 1ETVA 1MJAA 3D5RC 3VYRB 3F8BA 4CCOA 3I5UA 2QM3A 4M74A 1TP4A 3OYMA 1FWZA 1AWCA 1A31A 1EKEA 3ECOA 2P7VB 2OA4A 1M1EB 5L3FA 1DPRA 2E35A 2ELJA 4EGYA 1J59A 1V54H 4IRGA 2M45A 1IXCA 2P0WA 1D8JA 4KUMA 1VNDA 1XMKA 3I64A 5AIPA 2CQQA 1I3AA 1R5HA 4GCVA 2WAEA 2FNAA 1IF1A 4XICA 2WV0A 5EZHA 2RDPA 5E79C 2KHMA 1YIOA 1A6QA 1LVAA 3CCEI 1MKMA 2CV2A 2NVTJ 3NEUA 4LLGF 4N9HA 4MIMA 2MG4A 3SJMA 2XKOA 1WJFA 2WY7Q 2FSWA 4WXHA 2M8GX 1JKOC 3OYHA 1BI0A 3GZNB 3RZOJ 4LIVA 5D6EA 3LAPA 2CFOA 3RKXA 1KYZA 3R0AA 5JHFA 3Q0UA 1FSEA 2KRHA 4NNJA 3GFLA 2HTJA 2R7QA 3E5XA 4L0YB 4XONA 5IYCJ 2DBBA 1Q1HA 3WTZA 3BR1A 4I01A 2LLKA 3NWTA 2HOTA 3L09A 4ABZA 4M3BA 2ZJ2A 5D4SA 4BXXJ 5DD8A 3VYUB 2ZKZA 5J1RA 2R7VA 3KLOA 2CQNA 1WI3A 2DQRA 2R7DA 3CF5F 2M9HA 2DA5A 2JPBA 3H9JA 5JHUA 4YFXF 5C3EJ 3ABLH 3CDHA 3PO2J 3L2QA 1TWHJ 2EPFA 4UUSB 5IOYA 4OAZA 4X0GA 2KIMA 3GTJJ 1GXPA 2LDUA 1MJ9A 2HOSA 2A6TA 3VFZA 1W4MA 2DAOA 2LFBA 1FP2A 4HAMA 3CCLI 3R60A 1MNEA 2RQQA 1WGXA 2LR8A 2BV6A 1IV8A 3LSMA 3W6KB 4NQWA 3KFWX 5J8FA 4LLLA 3CF2A 4ZC3A 3CMYA 5HLGA 1ETQA 2VJJA 3HOZJ 3Q3SA 3GWZA 4WF2A 1D0YA 4FCYA 5CLSA 4N0BA 2E1OA 2L7MP 2R7UA 2O3FA 1TNTA 1BI3A 3Q9VA 3MVPA 2V7FA 3MKLA 4LFUA 4AWXB 3GFMA 2UXXA 3QPTA 3HYIA 3CESA 5FRMA 3K4BA 4IHWA 2Y30A 2X6YA 2W4SA 1I6XA 4GDFA 4UB6C 5LGNA 2JA5J 2V1DA 2FNPA 2VONA 2MH2A 3L2CA 1LNWA 2PMHA 3FMQA 4AVPA 1B8IA 1AKHA 3J81K 2CV1A 3BG5A 3KYLA 2E5NA 1OLTA 1ITYA 1FEXA 5DEQA 3HOYJ 3I4NJ 1JGSA 2QENA 2OJED 3CCSI 4ENMA 4ZYAA 1YRNB 2H8WA 5CQGA 1Y0UA 3CCUI 4ANJA 5GADJ 4M9XA 3LNQA 3A1YA 1V4RA 3WU0A 2LBFB 2VQCA 5K7FA 1L3LA 3FF5A 1VTNC 5EEHA 5ICCA 2FA5A 1QPMA 3FIWA 4D5CA 4XQFA 1P4WA 5E3MA 2H8RA 2H09A 2WY8Q 1P4XA 2FEZA 4ZYDA 2OQRA 4BACA 2Y0MA 2JVHA 1K78B 3V7RA 4A0XA 1GXQA 2CGPA 4BHCA 3GTMJ 3HKZN 1Y8RB 3BZKA 4E7SA 1W1WE 1T95A 4HX8A 3GTQJ 1LKXA 1BM9A 4EVIA 3NWSA 3G4SI 2PBIA 3OYEA 2XROA 3LL7A 1MMNA 4AYBN 5K5OA 5F0HA 3ZGKA 3FMSA 3QODA 2DCEA 1BW6A 3GXOA 2FMYA 1OKRA 1Z0XA 4RAZA 1W0UA 1DGWY 3BP8A 1YO5C 2DA1A 3LSRA 4PK4A 4OIOF 1R58A 3G2BA 4E6KG 4BH9A 5ERIA 3BTLA 3WTSC 5IYDJ 2JMWA 3DPTA 3OIQA 3EUAA 2DT6A 2HQ5A 5K1YA 2XASA 2F5CA 4N4NB 4XR6A 5K5RA 3KCCA 1R7JA 2WB1A 2L7KA 4Q48A 4EM0B 3M8JA 1DP3A 2A5YB 2FBKA 5BOXA 3H3ZA 2X1DA 3OYCA 3D5LA 3DBRB 5DYMA 4YIRX 1A5JA 2GLOA 2I10A 2RV8A 1DU0A 1G3WA 2DA7A 3HZJA 1Y1WJ 3EUKL 1MJBA 5EF6A 1F4KA 3A03A 1IN5A 1IC8A 4XN0A 4I6ZA 1KU2A 3CC2I 2MGQA 4XLCA 4XN3A 2K9QA 3LA3A 3S3MA 1T38A 3DEUA 5CJ9A 2XAFA 5HVQC 3CCYA 2HNHA 3DLAA 1D1CA 1S9HA 2F4IA 1XGNA 4RGRA 1J2XA 1TQIA 4CA0A 2BVLA 2A3SA 3KETA 4AIJA 4GFBA 1ZTRA 2XIGA 4L9NA 1YYVA 4B4CA 4CSWA 5E3NA 4QPQA 4JX6A 2M5WA 1NG7A 3RKYA 4A3EJ 5J40A 3SFIA 1J9IA 2QVOA 2Y0SA 1IDYA 2DOFA 4DBQA 3RYPA 3JR9A 3L2UA 2Y48A 5DCFA 1JUMA 4WCGA 3ZMDA 4FQGA 3P9KA 5GPCA
chains in the Genus database with same CATH topology
1W7PA 3VODA 4G7OF 1G3YA 3IRQA 3CLOA 2FRHA 5LHIA 4LLNA 3VB2A 4RGSA 4HLYA 2BEOA 4WX9A 4UVCA 3HSFA 5F6FA 3T0YA 1OMIA 3MFKA 3NQOA 2ZO4A 4P9FA 4M73A 2J5PA 2HEOA 2Z3YA 3HSRA 1ZN2A 3SZTA 2CSOA 4BHPA 2EFOA 4HOBA 4MEXF 3KP5A 1RUNA 4L9JA 4R1HA 4MNUA 2PJPA 4AIKA 4R79A 2W85A 2GWRA 3F8FA 5H6RA 2HFHA 2GA2A 3IWZA 3GUDA 1WSUA 4ZZDA 3KP3A 1IRFA 3RPQA 1FBSA 1XSVA 4EM2A 1R1UA 4LMYA 4CDGA 2O8XA 1H9TA 4LG0A 1S8NA 3MZYA 2FBIA 2A6HF 4LGWA 3J80K 1HBXG 3QRFF 1BOAA 1KU9A 2PQ8A 4HDVA 2XKPA 2NYXA 2F5FA 5LHHA 1BJAA 4XLNF 1XGOA 3KZZA 1XSDA 2HZTA 2V1XA 4YIFA 5KK1A 4ZZLA 1BI2A 2ETHA 3BJAA 3U2RA 4MQ9F 3O2PE 1R23A 4YFNF 2CYYA 2PFBA 1K6OA 4F7ZA 3CUQB 1YS6A 3ELKA 3WU1B 2M8EA 3F6OA 3BZ6A 4A6EA 4G7HF 5AONA 2K27A 3GFJA 4HF2A 2IP2A 5BS6A 2ISYA 3WTTC 4HV6A 5HDNA 3HHHA 1B59A 2XAQA 2ZCWA 3SHFA 5JI6A 3V8KA 3M7GA 1YS7A 4ON0A 3WTWC 4UUVA 1S6LA 4XBFA 4KDPA 1G4DA 1ZLJA 5EEGA 3F8CA 4G6DA 3D0SA 1BBYA 1O7FA 1XMAA 1ZG3A 2P6SA 3F8NA 5LRSA 1TNSA 2XHKA 3F6VA 2VXZA 4OMYA 3BY6A 2KJCA 4KIBA 1MD0A 3ROUA 3KP2A 2O0YA 5BQTA 4FT8A 1LDKB 1F1ZA 4KT5C 3CO7C 3Q9SA 1K78A 2ESNA 1F5TA 1EV7A 2B0LA 5HS8A 3HSEA 4A5NA 1EH7A 2VE8A 1P92A 3SQNA 1B6AA 2VBYA 2NNYA 3O6BB 2EFPA 4QWQA 3ZMUA 3LA7A 3HRUA 3HIFA 1WKMA 2VE9A 1FNNA 2A6EF 2F5DA 2RNJA 4G7ZF 4CO8A 2RN7A 2A68F 3F21A 3HTSB 4KYWA 3WG9A 1ZRFA 4I7HA 2XRNA 3H92A 1T0FA 1YW8A 1QO0D 1FPQA 4MTDA 2E1CA 5FD5A 2IA2A 2EFQA 5IT9K 1T39A 2QBYB 3RKWA 3HTUA 2EFWA 2EWNA 3M1EA 2MA3A 4M6YA 4HA8A 5H6QA 2VBZA 4HDUA 4O6JA 3FM3A 5DUIA 4GXOA 3ECHA 3C1DA 4LB5A 2XAGA 3R0JA 3KE2A 2NRAC 2HQNA 3GX4X 1KGSA 1ZRDA 3ML6A 2H6CA 2V1UA 4PGGA 3LSTA 3L9FA 4L5JA 1JHFA 2DU9A 1U78A 3MAJA 1IUYA 4MGRA 1UCRA 1SFEA 4ZYHA 2DO7A 2W84A 2GQQA 1ZRCA 4XSZF 1HXDA 2Q8KA 2OAZA 2RKHA 4O5VA 1SMYF 1UHMA 4U0WA 3E3VA 1UFMA 2L4AA 2BBYA 2W25A 4I2OA 2PI0A 2VT3A 2ADUA 1KQ0A 3F3XA 2Q2EA 3F22A 5D4RA 1NHAA 2IRFG 3NRVA 1DUXC 5FD6A 3BROA 2DI3A 3CTAA 3JAMZ 1FC3A 4EJUA 3IKVA 2EV6A 1ON1A 2BGCA 3ABTA 2UXNA 3BPXA 3EYIA 1IRGA 3WE2A 3C7JA 5E20A 3K0LA 5HDGA 2Z9OA 3COAC 3O3KA 1WWXA 2H94A 1D3YA 2D45A 2A69F 3ABUA 4M71A 2YPRA 1SFUA 2LF7A 3IC7A 3JTGA 2W57A 1SFXA 4KNYA 4JK1X 2UZKA 5JR3A 4G8XA 3T8RA 4WXCA 3FX3A 5DUKA 3OOPA 1HKTA 1YQAA 2OD5A 3Q5FA 1ONVA 3L00A 5A2QZ 2D1HA 3AAFA 1U8RA 1O3SA 3JW4A 3M8EA 1UHWA 1L0OC 2Z99A 3TO6A 2IPQX 2VBWA 3J80Z 2KIUA 4Y13A 3LQQA 3S2WA 3CUQA 4B8XA 3MCZA 4LJZF 3E6DA 4YG2F 2O61A 1U5TA 4RAYA 2G7UA 3TGNA 1HQCA 2AXLA 4GO1A 2YX7A 4PGHA 1DP7P 2M30A 1WQ2A 1E2XA 1HSJA 4HYEA 2G9WA 1ODDA 2ELHA 4A2UA 1HKSA 3QAHA 2C6YA 5ILVA 4L5IA 2WWYA 4IRIA 2LSOA 3QPHA 2XVCA 1ZG5A 2M1BA 1IXSB 4BNCA 1J0RA 1O3TA 2KJBA 3PQJA 4BHBA 5BMZA 2KIFA 4BYYA 5IT3A 2DLLA 2EFNA 3P7NA 3WTYC 5ED4A 1AOYA 4HBLA 3DV8A 1KU3A 1FYKA 2CQKA 1ZHFA 2K02A 2KRFA 4OIPF 1CF7B 3WGHA 3LQRA 4EJWA 2ZNYA 1H0MA 4U7BA 2L01A 4XSXF 3WGIA 4HX4A 4U88A 3MEXA 2EV0A 1IN4A 3I59B 3DPLC 1I27A 2CO5A 2HYGD 3KLNA 4IHSA 1YFHA 2IA1A 2RGVA 1Z91A 5LEJA 1FX7A 1TW3A 2OZUA 3DKWA 1OR7A 5E8GA 2NAZA 2VOPA 1EH8A 2CW0F 4KFCA 1J5YA 5CVJA 2E7XA 1OYIA 4I0AA 3TOAA 2OBPA 3GZ5A 3T8TA 3JAMK 3ZMSA 1XGMA 4IXAA 3TDUC 1MDMB 1W5TA 4UVBA 2MC3A 4EGZA 4OMZA 4P5OA 4G9YA 2L4MA 2MD5A 2EA4A 1T98A 2GAUA 5IT9Z 3FMRA 4YFKF 4ENNA 1ZARA 4RB0A 5HS7A 1S7OA 4IJAA 4M6XA 3JSOA 1RNLA 3DQVC 1QNTA 4KN7X 2OU2A 2EJRA 3EUHA 1OPCA 2DK8A 2QYOA 4LB6B 3SXYA 1R22A 1P2FA 4ZYEA 2P7CB 4PDKA 5TRDA 1LEBA 4Q47A 4OIQF 5E17F 2ZNZA 1FSHA 1IZ1A 5F1RA 5A2QK 4NHJA 5BPDA 3GO5A 4RGXA 1SMTA 2HKOA 1X3UA 2M87A 1R36A 3K69A 1MGTA 5JFRA 3N97A 3WTUC 1RIOH 4S04A 4I0BA 3V4GA 5J6XA 4BQAA 2HOEA 2CFXA 2X0LA 1ZGJA 3FWEA 1XB4A 2LNBA 2W24A 1U5TC 1R5GA 1A04A 1Z9CA 2JT1A 4IHTA 3ZN0A 2HYFA 2EB7A 3E6MA 2GXGA 3RPUA 3GZ6A 4CHUA 1XSXA 3IWFA 4Q5SF 1LQ1A 3I58A 4XLPF 4HLXA 2DPUA 1SD6A 3M8FA 3DXJF 3V7CA 2OZ6A 1YW7A 3H3UA 1QZZA 2KKOA 2HGCA 1YLFA 3WE3A 2FBHA 4L18B 4S05A 1GHCA 3G3ZA 1Z6RA 2QUFA 3GYHX 2YR2A 2QLZA 1U6GA 2PEXA 4FHTA 2JPCA 3WODF 3I53A 3W6JB 3MWMA 2LF8A 2E1NA 4ETSA 4MTEA 5K5QA 4H0EA 1USTA 1SD7A 4KN4X 3QU3A 2BE5F 2QQAA 4WXDA 2Y75A 3TKYA 5LRRA 5CVIA 3FXRA 2GIVA 4UV9A 2UWMA 4A6DA 5DDGA 2JZYA 2NNNA 1QGPA 1B9MA 1ON2A 3V7SA 2PLYA 3LA2A 1BIBA 4PCQA 3F72A 2IVMA 4KICA 2Z33A 4ASNA 4M9SA 5D5WB 1FYLA 2QQBA 4JQFA 3RYRA 4IVNA 3QOPA 2O6GE 4U7DA 5E1ZB 5D5VB 3E6BA 1I1GA 1BI1A 1FP1D 4ESJA 5D8LB 5DCMB 4ESBA 2NS0A 2X4HA 3LFKA 2G7HA 2COMA 3U1DA 4R8HA 2L3DA 3TQNA 4EMSA 2PG4A 3L7WA 1HW5A 4GGGA 5CVRA 3BPVA 3IL2A 3FHZA 3CJNA 5JVTA 3HRTA 3G73A 2DPDA 1W7PB 4I98B 3CO6C 3HRMA 3K1NA 2Z5UA 4A5MA 1P4AA 4HX7A 5HOOA 5FO5A 5KVRA 3REOA 4K2EA 1SD4A 1TW2A 4G94A 4WWCA 1S7AA 3BJOA 2LKPA 3KZYA 3F23A 1K7AA 1UB9A 3QP5A 5E8IA 4PZJA 2DFIA 5DD4A 3J7AO 3VOEA 5H20A 2FU4A 2K7LA 4IPAA 3HOTA 5L3CA 4M72A 4RGUA 1O3QA 1JHHA 1FYMA 2J5OA 3ULQB 1IN7A 4UXNA 1JXSA 2R7FA 3BWGA 5ILUA 3GLXA 4MEYF 3KP6A 4DQ2A 1SAXA 5ILSA 3K1PA 3GEZA 2XUBA 3BOQA 1RZ4A 3QP6A 2MH9A 4LG0B 2V6CA 1ZYRF 5FLXZ 3FM5A 4D0PA 2EV5A 1HW1A 1ZH5A 3FXQA 4L0ZB 2P5KA 3TO9A 4HF1A 3PFIA 2GXBA 3R61A 1TQMA 3IKTA 1H9GA 5J8CA 1S3JA 2D2WA 3I54A 2GA1A 4ZH4F 2YX4A 1KU7A 4MQVA 3M9AA 1IW7F 2ZBKA 2VC0A 4WK8F 3RTRA 2F5EA 4OINF 2QWWA 1IN8A 4UHTA 3GFIA 3DF8A 4N9IA 5FFXA 2ZFWA 2JTVA 3IHUA 4A0ZA 5CVVA 1I5ZA 4RB3C 1O57A 1WI9A 3KP4A 3BDDA 1Z7UA 3MZHA 1B1BA 2YSRA 4UNOA 2A07F 1F9NA 1IAWA 2FE3A 4L9VA 4QLCU 2GZWA 3ISPA 3TDZC 2DK5A 1G3TA 2XV4S 1XGSA 5HLHA 1WRJA 4ESFA 3DP7A 4BXUA 2RQPA 2DTRA 1BC8C 2STWA 2FMLA 2IT0A 4UVAA 1W7PD 2MLKA 2K4BA 3FZVA 4B09A 2ESHA 3R4KA 4IRHA 4HV5A 5D6FA 1QZYA 2EK5A 4OOIA 3B73A 3K2ZA 3SZPA 3KEOA 6PAXA 3N4MA 3HRSA 1FZPB 3RIRA 1IXRC 4GYIA 4RB2C 4ZYGA 3OV8A 4CZZA 3GW2A 4U0YA 1LEAA 3QU6A 2HWVA 4M9ZA 1U2WA 2P5LC 2ZMEB 2DQLA 3I0TA 2VOOA 3ZMTA 4NB5A 2PMUA 2ZXJA 1REPC 2ACJA 3ERED 1CGPA 1PUEE 3EETA 1W5SA 2IA0A 2BYVE 5DCMA 4EV0A 4CGZA 4YIIA 1XCVA 2JSCA 3T1BA 2QBYA 2MBFA 1FY7A 1OYYA 2EA2A 1LDJA 3I4PA 2HR3A 1LB2A 3U9GA 1B4AA 1D8KA 4A0YA 5LGTA 2FOKA 4KIGA 4CICA 3FXUA 4LK1F 2JRTA 2HTSA 1TBXA 3C18A 5LLQA 3B02A 1J7KA 3TOBA 4AD9A 1B9NA 4CXFA 4P96A 1T6SA 2VC1A 4GYGA 4P9UA 5E1XA 2QZ8A 3WTVC 2VT2A 1T2KA 5FLXK 4UV8A 1IN6A 3WTXC 3ZP5A 5FB2A 2P5VA 2VN2A 3VEPA 2RVCA 2Q0OA 2PN6A 4OIRF 4XRFA 3TO7A 5D8KB 3RI4A 1LDDA 5HDKA 4Z2YA 1XDUA 1Z1DA 5FFZA 5LHGA 1TTYA 5F64A 1PP8F 3E5QA 4O3MA 4MHGA 1KQ9A 3K1MA 4L9TA 1PP7U 1K79A 3ZMZA 3KEQA 2WC2A 3GVAA 1XN7A 1GVJA 5CVUA 3MQ0A 5TJJA 5E18F 4KMUX 1P6RA 5BPIA 2RC4A 2MLGA 1Z6TA 3CUQC 2HDCA 5D5UB 2WTEA 4EJVA 3HUGA 1J75A 2E7WA 4EM1A 3EQLF 1USSA 2A61A 1R00A 1BN5A 1E17A 1EH6A 1ZAOA 2H27A 5FGMA 1XDSA 1KQ8A 1HW2A 1R1VA 2L54A 2AS5F 4HQEA 1SD5A 1PDNC 1O7LA 5L3GA 3EDPA 3HOSA 2DW4A 2O03A 2IJLA 3ZN1A 2H6BA 3P9CA 2TDXA 2L02A 3PQKA 4JBAA 4CYDA 2YU3A 1YG2A 1O3RA 4RB1A 1U3EM 1KYWA 1FT9A 4E70A 3GF2A 4HW0A 1HSTA 4Y15A 5ICFA 3DFGA 4LD5A 5AIQA 3JTHA 4EJTA 2VBXA 3RDIA 5L3BA 1BIAA 1U5TB 5LBQA 3BJ6A 1ZGAA 4KMFA 3IRRA 1ZLKA 3R6SA 4HF0A 1FLIA 2STTA 2P8TA 2XAHA 4LK0F 3JSPA 2VODA 3LAJA 1HKQA 1YW9A 2CG4A 4I02A 5CYVA 3E6CC 2R3SA 4EJOA 5L3DA 2K86A 1TLHB 4ENJA 1S29A 2HQRA 2V9VA 2OQGA 3F8MA 4KA4A 1TQPA 1D5VA 3EYYA 3ZMVA 5L3EA 4G6QA 5ICEA 1QQIA 3ZQ7A 1STZA 2F2EA 1RI7A 4OU0A 5LEKA 1ZREA 1ULYA 1RUOA 4ENKA 1V3FA 1Z05A 3V8LA 3WGGA 4HQMA 3RJPA 4DNCA 2CWEA 4EQQA 1G6NA 1FBUA 3J81Z 4U0VA 3V8JA 2IW5A 1CF7A 5ICGA 4KIFA 3CUOA 2V79A 4HZFA 1XCBA 2HKXA 2XGXA 4FX4A 1ZG1A 1QBJA 1LJ9A 4Y17A 1DPUA 1OYWA 2ISZA 4P55A 2ZMEA 3I59A 4A12A 5HLIA 2K4JA 4RS8A 3ZPLA 2XAJA 3KP7A 2P4WA 4TV7A 1YTYA 1FBQA 5D5XB 2P6TA 1G3SA 1FOKA 4I09A 1I1SA 1R1TA 1XD7A 2FXAA 2DT5A 4FX0A 5DV5A 4AIHA 3P9IA 4Q4ZF 3T5XA 1MDMA 2QQ9A 1KA8A 4IF4A 3K9TA 5E1WA 1JE8A 3SFZA 3I71A 1MZBA 2HS5A 3C3WA 2D1VA 3HHGA 3E5UA 1DDNA 1BC7C 1C0WA 5HS9A 3LWFA 2FF4A 4BAYA 5LGUA 2FQ3A 3E97A 1MJAA 3F8BA 3I5UA 2QM3A 4M74A 1FWZA 1AWCA 3ECOA 2P7VB 2OA4A 5L3FA 1DPRA 4EGYA 1J59A 4IRGA 2M45A 1IXCA 1D8JA 4KUMA 1XMKA 3I64A 5AIPA 1R5HA 4GCVA 2FNAA 1IF1A 2WV0A 2RDPA 1YIOA 1LVAA 1MKMA 3NEUA 4LLGF 4N9HA 2XKOA 2FSWA 4WXHA 1BI0A 5D6EA 3LAPA 3RKXA 1KYZA 3R0AA 1FSEA 3GFLA 2HTJA 3E5XA 4L0YB 2DBBA 1Q1HA 3WTZA 4I01A 3L09A 5D4SA 2ZJ2A 5DD8A 2ZKZA 3KLOA 2DQRA 2R7DA 2JPBA 5JHUA 4YFXF 3CDHA 2KIMA 1GXPA 2LDUA 1MJ9A 3VFZA 1W4MA 2DAOA 1FP2A 4HAMA 3R60A 3W6KB 2BV6A 4NQWA 3KFWX 5J8FA 4LLLA 5HLGA 3GWZA 4WF2A 5CLSA 4N0BA 2O3FA 1TNTA 1BI3A 3Q9VA 4LFUA 4AWXB 3GFMA 2UXXA 3QPTA 3HYIA 1I6XA 5LGNA 2FNPA 2V1DA 2VONA 2MH2A 3L2CA 1LNWA 2PMHA 3FMQA 4AVPA 3J81K 5DEQA 1JGSA 2QENA 4ENMA 1Y0UA 4M9XA 1V4RA 3WU0A 1L3LA 3FF5A 1VTNC 5EEHA 5ICCA 2FA5A 1QPMA 1P4WA 2H09A 1P4XA 2FEZA 4ZYDA 2OQRA 2Y0MA 1K78B 3V7RA 4A0XA 1GXQA 2CGPA 4BHCA 4HX8A 1BM9A 4EVIA 2PBIA 2XROA 5K5OA 3FMSA 3GXOA 2FMYA 1OKRA 4RAZA 3BP8A 1YO5C 4OIOF 1R58A 4BH9A 5ERIA 3WTSC 3DPTA 5K1YA 2XASA 2F5CA 5K5RA 3KCCA 1R7JA 4Q48A 4EM0B 2A5YB 2FBKA 5BOXA 3H3ZA 3D5LA 5DYMA 2RV8A 1G3WA 1MJBA 1F4KA 1IN5A 1KU2A 3LA3A 1T38A 3DEUA 5CJ9A 2XAFA 5HVQC 1XGNA 4RGRA 1J2XA 1TQIA 2A3SA 3KETA 4AIJA 2XIGA 4L9NA 1YYVA 2M5WA 3RKYA 1J9IA 2QVOA 3RYPA 2Y48A 5DCFA 4WCGA 3ZMDA 3P9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7P A;  3VOD A;  4G7O F;  1G3Y A;  3IRQ A;  3CLO A;  2FRH A;  5LHI A;  4LLN A;  3VB2 A;  4RGS A;  4HLY A;  2BEO A;  4WX9 A;  4UVC A;  3HSF A;  5F6F A;  3T0Y A;  1OMI A;  3MFK A;  3NQO A;  2ZO4 A;  4P9F A;  4M73 A;  2J5P A;  2HEO A;  2Z3Y A;  3HSR A;  1ZN2 A;  3SZT A;  2CSO A;  4BHP A;  2EFO A;  4HOB A;  4MEX F;  3KP5 A;  1RUN A;  4L9J A;  4R1H A;  4MNU A;  2PJP A;  4AIK A;  4R79 A;  2W85 A;  2GWR A;  3F8F A;  5H6R A;  2HFH A;  2GA2 A;  3IWZ A;  3GUD A;  1WSU A;  4ZZD A;  3KP3 A;  1IRF A;  3RPQ A;  1FBS A;  1XSV A;  4EM2 A;  1R1U A;  4LMY A;  4CDG A;  2O8X A;  1H9T A;  4LG0 A;  1S8N A;  3MZY A;  2FBI A;  2A6H F;  4LGW A;  3J80 K;  1HBX G;  3QRF F;  1BOA A;  1KU9 A;  2PQ8 A;  4HDV A;  2XKP A;  2NYX A;  2F5F A;  5LHH A;  1BJA A;  4XLN F;  1XGO A;  3KZZ A;  1XSD A;  2HZT A;  2V1X A;  4YIF A;  5KK1 A;  4ZZL A;  1BI2 A;  2ETH A;  3BJA A;  3U2R A;  4MQ9 F;  3O2P E;  1R23 A;  4YFN F;  2CYY A;  2PFB A;  1K6O A;  4F7Z A;  3CUQ B;  1YS6 A;  3ELK A;  3WU1 B;  2M8E A;  3F6O A;  3BZ6 A;  4A6E A;  4G7H F;  5AON A;  2K27 A;  3GFJ A;  4HF2 A;  2IP2 A;  5BS6 A;  2ISY A;  3WTT C;  4HV6 A;  5HDN A;  3HHH A;  1B59 A;  2XAQ A;  2ZCW A;  3SHF A;  5JI6 A;  3V8K A;  3M7G A;  1YS7 A;  4ON0 A;  3WTW C;  4UUV A;  1S6L A;  4XBF A;  4KDP A;  1G4D A;  1ZLJ A;  5EEG A;  3F8C A;  4G6D A;  3D0S A;  1BBY A;  1O7F A;  1XMA A;  1ZG3 A;  2P6S A;  3F8N A;  5LRS A;  1TNS A;  2XHK A;  3F6V A;  2VXZ A;  4OMY A;  3BY6 A;  2KJC A;  4KIB A;  1MD0 A;  3ROU A;  3KP2 A;  2O0Y A;  5BQT A;  4FT8 A;  1LDK B;  1F1Z A;  4KT5 C;  3CO7 C;  3Q9S A;  1K78 A;  2ESN A;  1F5T A;  1EV7 A;  2B0L A;  5HS8 A;  3HSE A;  4A5N A;  1EH7 A;  2VE8 A;  1P92 A;  3SQN A;  1B6A A;  2VBY A;  2NNY A;  3O6B B;  2EFP A;  4QWQ A;  3ZMU A;  3LA7 A;  3HRU A;  3HIF A;  1WKM A;  2VE9 A;  1FNN A;  2A6E F;  2F5D A;  2RNJ A;  4G7Z F;  4CO8 A;  2RN7 A;  2A68 F;  3F21 A;  3HTS B;  4KYW A;  3WG9 A;  1ZRF A;  4I7H A;  2XRN A;  3H92 A;  1T0F A;  1YW8 A;  1QO0 D;  1FPQ A;  4MTD A;  2E1C A;  5FD5 A;  2IA2 A;  2EFQ A;  5IT9 K;  1T39 A;  2QBY B;  3RKW A;  3HTU A;  2EFW A;  2EWN A;  3M1E A;  2MA3 A;  4M6Y A;  4HA8 A;  5H6Q A;  2VBZ A;  4HDU A;  4O6J A;  3FM3 A;  5DUI A;  4GXO A;  3ECH A;  3C1D A;  4LB5 A;  2XAG A;  3R0J A;  3KE2 A;  2NRA C;  2HQN A;  3GX4 X;  1KGS A;  1ZRD A;  3ML6 A;  2H6C A;  2V1U A;  4PGG A;  3LST A;  3L9F A;  4L5J A;  1JHF A;  2DU9 A;  1U78 A;  3MAJ A;  1IUY A;  4MGR A;  1UCR A;  1SFE A;  4ZYH A;  2DO7 A;  2W84 A;  2GQQ A;  1ZRC A;  4XSZ F;  1HXD A;  2Q8K A;  2OAZ A;  2RKH A;  4O5V A;  1SMY F;  1UHM A;  4U0W A;  3E3V A;  1UFM A;  2L4A A;  2BBY A;  2W25 A;  4I2O A;  2PI0 A;  2VT3 A;  2ADU A;  1KQ0 A;  3F3X A;  2Q2E A;  3F22 A;  5D4R A;  1NHA A;  2IRF G;  3NRV A;  1DUX C;  5FD6 A;  3BRO A;  2DI3 A;  3CTA A;  3JAM Z;  1FC3 A;  4EJU A;  3IKV A;  2EV6 A;  1ON1 A;  2BGC A;  3ABT A;  2UXN A;  3BPX A;  3EYI A;  1IRG A;  3WE2 A;  3C7J A;  5E20 A;  3K0L A;  5HDG A;  2Z9O A;  3COA C;  3O3K A;  1WWX A;  2H94 A;  1D3Y A;  2D45 A;  2A69 F;  3ABU A;  4M71 A;  2YPR A;  1SFU A;  2LF7 A;  3IC7 A;  3JTG A;  2W57 A;  1SFX A;  4KNY A;  4JK1 X;  2UZK A;  5JR3 A;  4G8X A;  3T8R A;  4WXC A;  3FX3 A;  5DUK A;  3OOP A;  1HKT A;  1YQA A;  2OD5 A;  3Q5F A;  1ONV A;  3L00 A;  5A2Q Z;  2D1H A;  3AAF A;  1U8R A;  1O3S A;  3JW4 A;  3M8E A;  1UHW A;  1L0O C;  2Z99 A;  3TO6 A;  2IPQ X;  2VBW A;  3J80 Z;  2KIU A;  4Y13 A;  3LQQ A;  3S2W A;  3CUQ A;  4B8X A;  3MCZ A;  4LJZ F;  3E6D A;  4YG2 F;  2O61 A;  1U5T A;  4RAY A;  2G7U A;  3TGN A;  1HQC A;  2AXL A;  4GO1 A;  2YX7 A;  4PGH A;  1DP7 P;  2M30 A;  1WQ2 A;  1E2X A;  1HSJ A;  4HYE A;  2G9W A;  1ODD A;  2ELH A;  4A2U A;  1HKS A;  3QAH A;  2C6Y A;  5ILV A;  4L5I A;  2WWY A;  4IRI A;  2LSO A;  3QPH A;  2XVC A;  1ZG5 A;  2M1B A;  1IXS B;  4BNC A;  1J0R A;  1O3T A;  2KJB A;  3PQJ A;  4BHB A;  5BMZ A;  2KIF A;  4BYY A;  5IT3 A;  2DLL A;  2EFN A;  3P7N A;  3WTY C;  5ED4 A;  1AOY A;  4HBL A;  3DV8 A;  1KU3 A;  1FYK A;  2CQK A;  1ZHF A;  2K02 A;  2KRF A;  4OIP F;  1CF7 B;  3WGH A;  3LQR A;  4EJW A;  2ZNY A;  1H0M A;  4U7B A;  2L01 A;  4XSX F;  3WGI A;  4HX4 A;  4U88 A;  3MEX A;  2EV0 A;  1IN4 A;  3I59 B;  3DPL C;  1I27 A;  2CO5 A;  2HYG D;  3KLN A;  4IHS A;  1YFH A;  2IA1 A;  2RGV A;  1Z91 A;  5LEJ A;  1FX7 A;  1TW3 A;  2OZU A;  3DKW A;  1OR7 A;  5E8G A;  2NAZ A;  2VOP A;  1EH8 A;  2CW0 F;  4KFC A;  1J5Y A;  5CVJ A;  2E7X A;  1OYI A;  4I0A A;  3TOA A;  2OBP A;  3GZ5 A;  3T8T A;  3JAM K;  3ZMS A;  1XGM A;  4IXA A;  3TDU C;  1MDM B;  1W5T A;  4UVB A;  2MC3 A;  4EGZ A;  4OMZ A;  4P5O A;  4G9Y A;  2L4M A;  2MD5 A;  2EA4 A;  1T98 A;  2GAU A;  5IT9 Z;  3FMR A;  4YFK F;  4ENN A;  1ZAR A;  4RB0 A;  5HS7 A;  1S7O A;  4IJA A;  4M6X A;  3JSO A;  1RNL A;  3DQV C;  1QNT A;  4KN7 X;  2OU2 A;  2EJR A;  3EUH A;  1OPC A;  2DK8 A;  2QYO A;  4LB6 B;  3SXY A;  1R22 A;  1P2F A;  4ZYE A;  2P7C B;  4PDK A;  5TRD A;  1LEB A;  4Q47 A;  4OIQ F;  5E17 F;  2ZNZ A;  1FSH A;  1IZ1 A;  5F1R A;  5A2Q K;  4NHJ A;  5BPD A;  3GO5 A;  4RGX A;  1SMT A;  2HKO A;  1X3U A;  2M87 A;  1R36 A;  3K69 A;  1MGT A;  5JFR A;  3N97 A;  3WTU C;  1RIO H;  4S04 A;  4I0B A;  3V4G A;  5J6X A;  4BQA A;  2HOE A;  2CFX A;  2X0L A;  1ZGJ A;  3FWE A;  1XB4 A;  2LNB A;  2W24 A;  1U5T C;  1R5G A;  1A04 A;  1Z9C A;  2JT1 A;  4IHT A;  3ZN0 A;  2HYF A;  2EB7 A;  3E6M A;  2GXG A;  3RPU A;  3GZ6 A;  4CHU A;  1XSX A;  3IWF A;  4Q5S F;  1LQ1 A;  3I58 A;  4XLP F;  4HLX A;  2DPU A;  1SD6 A;  3M8F A;  3DXJ F;  3V7C A;  2OZ6 A;  1YW7 A;  3H3U A;  1QZZ A;  2KKO A;  2HGC A;  1YLF A;  3WE3 A;  2FBH A;  4L18 B;  4S05 A;  1GHC A;  3G3Z A;  1Z6R A;  2QUF A;  3GYH X;  2YR2 A;  2QLZ A;  1U6G A;  2PEX A;  4FHT A;  2JPC A;  3WOD F;  3I53 A;  3W6J B;  3MWM A;  2LF8 A;  2E1N A;  4ETS A;  4MTE A;  5K5Q A;  4H0E A;  1UST A;  1SD7 A;  4KN4 X;  3QU3 A;  2BE5 F;  2QQA A;  4WXD A;  2Y75 A;  3TKY A;  5LRR A;  5CVI A;  3FXR A;  2GIV A;  4UV9 A;  2UWM A;  4A6D A;  5DDG A;  2JZY A;  2NNN A;  1QGP A;  1B9M A;  1ON2 A;  3V7S A;  2PLY A;  3LA2 A;  1BIB A;  4PCQ A;  3F72 A;  2IVM A;  4KIC A;  2Z33 A;  4ASN A;  4M9S A;  5D5W B;  1FYL A;  2QQB A;  4JQF A;  3RYR A;  4IVN A;  3QOP A;  2O6G E;  4U7D A;  5E1Z B;  5D5V B;  3E6B A;  1I1G A;  1BI1 A;  1FP1 D;  4ESJ A;  5D8L B;  5DCM B;  4ESB A;  2NS0 A;  2X4H A;  3LFK A;  2G7H A;  2COM A;  3U1D A;  4R8H A;  2L3D A;  3TQN A;  4EMS A;  2PG4 A;  3L7W A;  1HW5 A;  4GGG A;  5CVR A;  3BPV A;  3IL2 A;  3FHZ A;  3CJN A;  5JVT A;  3HRT A;  3G73 A;  2DPD A;  1W7P B;  4I98 B;  3CO6 C;  3HRM A;  3K1N A;  2Z5U A;  4A5M A;  1P4A A;  4HX7 A;  5HOO A;  5FO5 A;  5KVR A;  3REO A;  4K2E A;  1SD4 A;  1TW2 A;  4G94 A;  4WWC A;  1S7A A;  3BJO A;  2LKP A;  3KZY A;  3F23 A;  1K7A A;  1UB9 A;  3QP5 A;  5E8I A;  4PZJ A;  2DFI A;  5DD4 A;  3J7A O;  3VOE A;  5H20 A;  2FU4 A;  2K7L A;  4IPA A;  3HOT A;  5L3C A;  4M72 A;  4RGU A;  1O3Q A;  1JHH A;  1FYM A;  2J5O A;  3ULQ B;  1IN7 A;  4UXN A;  1JXS A;  2R7F A;  3BWG A;  5ILU A;  3GLX A;  4MEY F;  3KP6 A;  4DQ2 A;  1SAX A;  5ILS A;  3K1P A;  3GEZ A;  2XUB A;  3BOQ A;  1RZ4 A;  3QP6 A;  2MH9 A;  4LG0 B;  2V6C A;  1ZYR F;  5FLX Z;  3FM5 A;  4D0P A;  2EV5 A;  1HW1 A;  1ZH5 A;  3FXQ A;  4L0Z B;  2P5K A;  3TO9 A;  4HF1 A;  3PFI A;  2GXB A;  3R61 A;  1TQM A;  3IKT A;  1H9G A;  5J8C A;  1S3J A;  2D2W A;  3I54 A;  2GA1 A;  4ZH4 F;  2YX4 A;  1KU7 A;  4MQV A;  3M9A A;  1IW7 F;  2ZBK A;  2VC0 A;  4WK8 F;  3RTR A;  2F5E A;  4OIN F;  2QWW A;  1IN8 A;  4UHT A;  3GFI A;  3DF8 A;  4N9I A;  5FFX A;  2ZFW A;  2JTV A;  3IHU A;  4A0Z A;  5CVV A;  1I5Z A;  4RB3 C;  1O57 A;  1WI9 A;  3KP4 A;  3BDD A;  1Z7U A;  3MZH A;  1B1B A;  2YSR A;  4UNO A;  2A07 F;  1F9N A;  1IAW A;  2FE3 A;  4L9V A;  4QLC U;  2GZW A;  3ISP A;  3TDZ C;  2DK5 A;  1G3T A;  2XV4 S;  1XGS A;  5HLH A;  1WRJ A;  4ESF A;  3DP7 A;  4BXU A;  2RQP A;  2DTR A;  1BC8 C;  2STW A;  2FML A;  2IT0 A;  4UVA A;  1W7P D;  2MLK A;  2K4B A;  3FZV A;  4B09 A;  2ESH A;  3R4K A;  4IRH A;  4HV5 A;  5D6F A;  1QZY A;  2EK5 A;  4OOI A;  3B73 A;  3K2Z A;  3SZP A;  3KEO A;  6PAX A;  3N4M A;  3HRS A;  1FZP B;  3RIR A;  1IXR C;  4GYI A;  4RB2 C;  4ZYG A;  3OV8 A;  4CZZ A;  3GW2 A;  4U0Y A;  1LEA A;  3QU6 A;  2HWV A;  4M9Z A;  1U2W A;  2P5L C;  2ZME B;  2DQL A;  3I0T A;  2VOO A;  3ZMT A;  4NB5 A;  2PMU A;  2ZXJ A;  1REP C;  2ACJ A;  3ERE D;  1CGP A;  1PUE E;  3EET A;  1W5S A;  2IA0 A;  2BYV E;  5DCM A;  4EV0 A;  4CGZ A;  4YII A;  1XCV A;  2JSC A;  3T1B A;  2QBY A;  2MBF A;  1FY7 A;  1OYY A;  2EA2 A;  1LDJ A;  3I4P A;  2HR3 A;  1LB2 A;  3U9G A;  1B4A A;  1D8K A;  4A0Y A;  5LGT A;  2FOK A;  4KIG A;  4CIC A;  3FXU A;  4LK1 F;  2JRT A;  2HTS A;  1TBX A;  3C18 A;  5LLQ A;  3B02 A;  1J7K A;  3TOB A;  4AD9 A;  1B9N A;  4CXF A;  4P96 A;  1T6S A;  2VC1 A;  4GYG A;  4P9U A;  5E1X A;  2QZ8 A;  3WTV C;  2VT2 A;  1T2K A;  5FLX K;  4UV8 A;  1IN6 A;  3WTX C;  3ZP5 A;  5FB2 A;  2P5V A;  2VN2 A;  3VEP A;  2RVC A;  2Q0O A;  2PN6 A;  4OIR F;  4XRF A;  3TO7 A;  5D8K B;  3RI4 A;  1LDD A;  5HDK A;  4Z2Y A;  1XDU A;  1Z1D A;  5FFZ A;  5LHG A;  1TTY A;  5F64 A;  1PP8 F;  3E5Q A;  4O3M A;  4MHG A;  1KQ9 A;  3K1M A;  4L9T A;  1PP7 U;  1K79 A;  3ZMZ A;  3KEQ A;  2WC2 A;  3GVA A;  1XN7 A;  1GVJ A;  5CVU A;  3MQ0 A;  5TJJ A;  5E18 F;  4KMU X;  1P6R A;  5BPI A;  2RC4 A;  2MLG A;  1Z6T A;  3CUQ C;  2HDC A;  5D5U B;  2WTE A;  4EJV A;  3HUG A;  1J75 A;  2E7W A;  4EM1 A;  3EQL F;  1USS A;  2A61 A;  1R00 A;  1BN5 A;  1E17 A;  1EH6 A;  1ZAO A;  2H27 A;  5FGM A;  1XDS A;  1KQ8 A;  1HW2 A;  1R1V A;  2L54 A;  2AS5 F;  4HQE A;  1SD5 A;  1PDN C;  1O7L A;  5L3G A;  3EDP A;  3HOS A;  2DW4 A;  2O03 A;  2IJL A;  3ZN1 A;  2H6B A;  3P9C A;  2TDX A;  2L02 A;  3PQK A;  4JBA A;  4CYD A;  2YU3 A;  1YG2 A;  1O3R A;  4RB1 A;  1U3E M;  1KYW A;  1FT9 A;  4E70 A;  3GF2 A;  4HW0 A;  1HST A;  4Y15 A;  5ICF A;  3DFG A;  4LD5 A;  5AIQ A;  3JTH A;  4EJT A;  2VBX A;  3RDI A;  5L3B A;  1BIA A;  1U5T B;  5LBQ A;  3BJ6 A;  1ZGA A;  4KMF A;  3IRR A;  1ZLK A;  3R6S A;  4HF0 A;  1FLI A;  2STT A;  2P8T A;  2XAH A;  4LK0 F;  3JSP A;  2VOD A;  3LAJ A;  1HKQ A;  1YW9 A;  2CG4 A;  4I02 A;  5CYV A;  3E6C C;  2R3S A;  4EJO A;  5L3D A;  2K86 A;  1TLH B;  4ENJ A;  1S29 A;  2HQR A;  2V9V A;  2OQG A;  3F8M A;  4KA4 A;  1TQP A;  1D5V A;  3EYY A;  3ZMV A;  5L3E A;  4G6Q A;  5ICE A;  1QQI A;  3ZQ7 A;  1STZ A;  2F2E A;  1RI7 A;  4OU0 A;  5LEK A;  1ZRE A;  1ULY A;  1RUO A;  4ENK A;  1V3F A;  1Z05 A;  3V8L A;  3WGG A;  4HQM A;  3RJP A;  4DNC A;  2CWE A;  4EQQ A;  1G6N A;  1FBU A;  3J81 Z;  4U0V A;  3V8J A;  2IW5 A;  1CF7 A;  5ICG A;  4KIF A;  3CUO A;  2V79 A;  4HZF A;  1XCB A;  2HKX A;  2XGX A;  4FX4 A;  1ZG1 A;  1QBJ A;  1LJ9 A;  4Y17 A;  1DPU A;  1OYW A;  2ISZ A;  4P55 A;  2ZME A;  3I59 A;  4A12 A;  5HLI A;  2K4J A;  4RS8 A;  3ZPL A;  2XAJ A;  3KP7 A;  2P4W A;  4TV7 A;  1YTY A;  1FBQ A;  5D5X B;  2P6T A;  1G3S A;  1FOK A;  4I09 A;  1I1S A;  1R1T A;  1XD7 A;  2FXA A;  2DT5 A;  4FX0 A;  5DV5 A;  4AIH A;  3P9I A;  4Q4Z F;  3T5X A;  1MDM A;  2QQ9 A;  1KA8 A;  4IF4 A;  3K9T A;  5E1W A;  1JE8 A;  3SFZ A;  3I71 A;  1MZB A;  2HS5 A;  3C3W A;  2D1V A;  3HHG A;  3E5U A;  1DDN A;  1BC7 C;  1C0W A;  5HS9 A;  3LWF A;  2FF4 A;  4BAY A;  5LGU A;  2FQ3 A;  3E97 A;  1MJA A;  3F8B A;  3I5U A;  2QM3 A;  4M74 A;  1FWZ A;  1AWC A;  3ECO A;  2P7V B;  2OA4 A;  5L3F A;  1DPR A;  4EGY A;  1J59 A;  4IRG A;  2M45 A;  1IXC A;  1D8J A;  4KUM A;  1XMK A;  3I64 A;  5AIP A;  1R5H A;  4GCV A;  2FNA A;  1IF1 A;  2WV0 A;  2RDP A;  1YIO A;  1LVA A;  1MKM A;  3NEU A;  4LLG F;  4N9H A;  2XKO A;  2FSW A;  4WXH A;  1BI0 A;  5D6E A;  3LAP A;  3RKX A;  1KYZ A;  3R0A A;  1FSE A;  3GFL A;  2HTJ A;  3E5X A;  4L0Y B;  2DBB A;  1Q1H A;  3WTZ A;  4I01 A;  3L09 A;  5D4S A;  2ZJ2 A;  5DD8 A;  2ZKZ A;  3KLO A;  2DQR A;  2R7D A;  2JPB A;  5JHU A;  4YFX F;  3CDH A;  2KIM A;  1GXP A;  2LDU A;  1MJ9 A;  3VFZ A;  1W4M A;  2DAO A;  1FP2 A;  4HAM A;  3R60 A;  3W6K B;  2BV6 A;  4NQW A;  3KFW X;  5J8F A;  4LLL A;  5HLG A;  3GWZ A;  4WF2 A;  5CLS A;  4N0B A;  2O3F A;  1TNT A;  1BI3 A;  3Q9V A;  4LFU A;  4AWX B;  3GFM A;  2UXX A;  3QPT A;  3HYI A;  1I6X A;  5LGN A;  2FNP A;  2V1D A;  2VON A;  2MH2 A;  3L2C A;  1LNW A;  2PMH A;  3FMQ A;  4AVP A;  3J81 K;  5DEQ A;  1JGS A;  2QEN A;  4ENM A;  1Y0U A;  4M9X A;  1V4R A;  3WU0 A;  1L3L A;  3FF5 A;  1VTN C;  5EEH A;  5ICC A;  2FA5 A;  1QPM A;  1P4W A;  2H09 A;  1P4X A;  2FEZ A;  4ZYD A;  2OQR A;  2Y0M A;  1K78 B;  3V7R A;  4A0X A;  1GXQ A;  2CGP A;  4BHC A;  4HX8 A;  1BM9 A;  4EVI A;  2PBI A;  2XRO A;  5K5O A;  3FMS A;  3GXO A;  2FMY A;  1OKR A;  4RAZ A;  3BP8 A;  1YO5 C;  4OIO F;  1R58 A;  4BH9 A;  5ERI A;  3WTS C;  3DPT A;  5K1Y A;  2XAS A;  2F5C A;  5K5R A;  3KCC A;  1R7J A;  4Q48 A;  4EM0 B;  2A5Y B;  2FBK A;  5BOX A;  3H3Z A;  3D5L A;  5DYM A;  2RV8 A;  1G3W A;  1MJB A;  1F4K A;  1IN5 A;  1KU2 A;  3LA3 A;  1T38 A;  3DEU A;  5CJ9 A;  2XAF A;  5HVQ C;  1XGN A;  4RGR A;  1J2X A;  1TQI A;  2A3S A;  3KET A;  4AIJ A;  2XIG A;  4L9N A;  1YYV A;  2M5W A;  3RKY A;  1J9I A;  2QVO A;  3RYP A;  2Y48 A;  5DCF A;  4WCG A;  3ZMD A;  3P9K A; 
#chains in the Genus database with same CATH topology
 1W7P A;  4B47 A;  3HOX J;  1Y6I A;  3H36 A;  3VOD A;  4G7O F;  1X1B A;  1MW7 A;  1G3Y A;  3IRQ A;  3CLO A;  2FRH A;  2E2H J;  2IS2 A;  3B6A A;  1D1A A;  5LHI A;  1MNM C;  5B1A H;  4LLN A;  3VB2 A;  4JP0 A;  4RGS A;  4HLY A;  2BEO A;  4A3B J;  4WX9 A;  4UVC A;  2NXN B;  2X9D A;  3HSF A;  1PUF B;  2HI3 A;  5F6F A;  3IV5 A;  3BQY A;  1U8B A;  3T0Y A;  1OMI A;  4F91 B;  3JRC A;  2HVQ A;  3KYC B;  3MFK A;  3NQO A;  2ZO4 A;  5J4V A;  1I3Q J;  2HQA A;  3CJR B;  4P9F A;  4M73 A;  2J5P A;  3RPU D;  3SYT A;  4XRS G;  3ZQG A;  5H2F C;  2HEO A;  3KX2 A;  2Z3Y A;  3HSR A;  1ZN2 A;  3SZT A;  5KAI C;  2R7X A;  2CSO A;  4BHP A;  4A3J J;  4A69 C;  2EFO A;  2EIJ H;  2JA6 J;  4HOB A;  4G12 A;  4MEX F;  3KP5 A;  1RUN A;  4L9J A;  4R1H A;  1RR8 C;  4XLH A;  2X51 A;  5FKK A;  4MNU A;  2PJP A;  3AFH A;  4AIK A;  4RMN A;  2JSP A;  3BC8 A;  2VJ4 A;  3HGG A;  2EIK H;  4R79 A;  2W85 A;  2GWR A;  3F8F A;  1EA3 A;  3FDY A;  5H6R A;  2HFH A;  4PJN A;  2GA2 A;  3IWZ A;  3SDB A;  3GUD A;  1RR7 A;  3BQZ A;  2KPM A;  1WSU A;  4ZZD A;  3KP3 A;  4A3I J;  2XPU A;  1IRF A;  3RPQ A;  4BBR J;  2JRM A;  3S16 J;  5EYR A;  3DU6 A;  1FBS A;  4A3M J;  1XSV A;  4EM2 A;  5HNH A;  1R1U A;  1WJE A;  3ABK H;  4LMY A;  2CV0 A;  4CDG A;  2L9V A;  3IP4 B;  2Y9Z A;  3K7A J;  2H1K A;  5K7H A;  2O8X A;  1H9T A;  1BA5 A;  5F08 A;  3OSF A;  3CC7 I;  2IBD A;  4LG0 A;  2JA2 A;  1TWA J;  5J1U A;  1HC8 A;  1S8N A;  2DA3 A;  3MZY A;  2X6O A;  2FBI A;  3G1L A;  3TL4 X;  4A3K J;  2A6H F;  3K6G A;  4M3G A;  1RES A;  4LGW A;  3ZCO A;  4BDZ A;  3J80 K;  2XC7 A;  1HBX G;  3FXK A;  3QRF F;  1X2N A;  2BY1 A;  1BOA A;  3V42 A;  1KU9 A;  2OPT A;  2E19 A;  2PQ8 A;  4HDV A;  5F0C A;  2XKP A;  2NYX A;  2F5F A;  2HYJ A;  5LHH A;  1BJA A;  2XGD A;  5LD2 C;  4XLN F;  2QKM B;  2OC6 A;  1XGO A;  3KZZ A;  1N25 A;  1XSD A;  2BY2 A;  2HZT A;  5EEA A;  3AG4 H;  4PFO A;  2V1X A;  4YIF A;  5KK1 A;  4ZZL A;  2IGK A;  1BI2 A;  2WV1 A;  2ETH A;  3BJA A;  3U2R A;  3S1R J;  1IRZ A;  4MQ9 F;  4PJL A;  3O2P E;  1R23 A;  4YFN F;  3S14 J;  2CYY A;  4PUS A;  4NUB A;  4CH7 A;  2PFB A;  5M5Y J;  1K6O A;  1X3Z B;  4F7Z A;  3OOU A;  4H4K C;  4XRM A;  2XB5 A;  3CUQ B;  2LKS A;  3VPR A;  1YS6 A;  1ZK8 A;  4RLF A;  2VB6 A;  3ELK A;  3WU1 B;  2M8E A;  2V6E A;  5M5W J;  3F6O A;  3CZ6 A;  1YJ9 I;  3BZ6 A;  3OYK A;  2MFZ A;  2VKH A;  1ZKG A;  4A6E A;  4IX7 A;  1WJB A;  5AON A;  3I3L A;  4G7H F;  2M3A A;  2JA8 J;  3UNG C;  2K27 A;  3GFJ A;  4HF2 A;  2CUF A;  2IP2 A;  5BS6 A;  2ISY A;  3WTT C;  2HVS A;  3IH3 A;  4HV6 A;  2NVU B;  3L2W A;  1XG1 A;  4V2F A;  1VQO I;  5HDN A;  4KT6 A;  4IQ4 A;  3HHH A;  1B59 A;  2IGO A;  1D0Z A;  2XAQ A;  2ZCW A;  3SHF A;  5JI6 A;  3K4K A;  3V8K A;  3HKZ A;  3M7G A;  2L0K A;  2M34 A;  1YS7 A;  4ON0 A;  1WJC A;  3GME A;  3WTW C;  4UUV A;  5M3F J;  1S6L A;  4XBF A;  2X1C A;  4YEL A;  5GAE J;  4KDP A;  4QTR A;  2KZV A;  1G4D A;  1ZLJ A;  3LOC A;  5EEG A;  2FJ1 A;  1BW5 A;  2KMU A;  2IS1 A;  3F8C A;  4AYB A;  4G6D A;  3D0S A;  1BBY A;  1WZ2 A;  5EGO B;  1O7F A;  1XMA A;  3RSN A;  2XF7 A;  2KQR A;  1ZG3 A;  2LYC A;  1OCT C;  2P6S A;  3F8N A;  1UHS A;  3HGY A;  5LRS A;  3BCA A;  4M3D A;  3NAR A;  5FRO A;  1TNS A;  2XHK A;  3F6V A;  2VXZ A;  4OMY A;  3CQZ J;  2DDB A;  3BY6 A;  1UG0 A;  2KJC A;  2FOW A;  2BY3 A;  1T33 A;  4KIB A;  2R5Y B;  1MD0 A;  3ROU A;  3KPH A;  3KP2 A;  2O0Y A;  4AUX A;  2ME6 A;  5BQT A;  1E0E A;  1FOX A;  3K4L A;  3OS0 A;  3QWL A;  4FT8 A;  1LDK B;  1F1Z A;  2CUZ A;  1YX5 A;  4KT5 C;  5DM7 F;  2IXS A;  3CO7 C;  3Q9S A;  1HDP A;  1K78 A;  1I50 J;  2ESN A;  1F5T A;  1EV7 A;  2B0L A;  3G1M A;  4RLQ A;  5B5E C;  5HS8 A;  3HSE A;  3TW6 A;  1IV6 A;  4A5N A;  1EH7 A;  2BOL A;  2VE8 A;  3FKJ A;  1P92 A;  2VPR A;  4BQQ A;  3SQN A;  1B6A A;  2VBY A;  2NNY A;  3TED A;  2VQG A;  3O6B B;  2EFP A;  2HDD A;  4QWQ A;  2W7N A;  3G1O A;  3ZMU A;  3LA7 A;  3HRU A;  3E1S A;  3HIF A;  2DYS H;  1WKM A;  2VE9 A;  1FNN A;  2A6E F;  3ZQC A;  2VJ5 A;  1MSF C;  2F5D A;  2RNJ A;  2E2I J;  4G7Z F;  1B72 A;  1OQY A;  2EZI A;  4CO8 A;  2RN7 A;  2A68 F;  3F21 A;  4BEH B;  3HTS B;  1N77 A;  4KYW A;  3VYS B;  4IEJ A;  3WG9 A;  2R7T A;  1ZRF A;  1V55 H;  4I7H A;  3OR2 C;  2XRN A;  3H92 A;  1T0F A;  1YW8 A;  1QO0 D;  2CMP A;  1D1B A;  2WAD A;  2BHZ A;  1ERD A;  2QF7 A;  4UB8 C;  1FPQ A;  4MTD A;  2LRD A;  3OYD A;  2E1C A;  1MBH A;  3OSG A;  5FD5 A;  2CUE A;  4BQN A;  2IA2 A;  1QPI A;  2DMN A;  1X2M A;  3WU2 C;  1H88 C;  2EFQ A;  3PM1 A;  3JRG A;  1U0J A;  3FHN A;  3TBI A;  5E3O A;  5IT9 K;  3I9V 2;  1T56 A;  4GRI A;  1T39 A;  4DYC A;  3RKW A;  2QBY B;  3A4C A;  1VQL I;  3HTU A;  2EFW A;  2EWN A;  1F43 A;  1GLN A;  1JTY A;  3M1E A;  5KCM A;  2MA3 A;  4M6Y A;  2OCC H;  1G8X A;  3MD2 A;  3MMY B;  4HA8 A;  3BG7 A;  1G59 A;  3C2H A;  2Y69 H;  5H6Q A;  4IL6 C;  2MSY A;  2MC4 A;  2VBZ A;  4HDU A;  2CQX A;  1FIA A;  3FXJ A;  4F92 B;  4O6J A;  3FM3 A;  3PSI A;  5DUI A;  2VL8 A;  4GXO A;  3A0B C;  2FQ4 A;  3FK7 A;  1MIJ A;  3ECH A;  1FMV A;  3C1D A;  4DBR A;  4PSW A;  4LB5 A;  2KDZ A;  2XAG A;  3R0J A;  3KE2 A;  2L2O A;  2NRA C;  3HDD A;  2HQN A;  3K4J A;  3GX4 X;  3HPH A;  5FLV A;  3KYD B;  2IS4 A;  3DBL B;  5JLW A;  4HRI A;  1KGS A;  2I8D A;  1ZRD A;  2R5Z B;  3ML6 A;  3GTL J;  2H6C A;  3AL0 C;  2V1U A;  4PGG A;  3LST A;  1OCR H;  2NS7 A;  3L9F A;  2M2E A;  4L5J A;  3DBH B;  1JKR C;  1YIT I;  3K2A A;  1JHF A;  2G0E A;  2DU9 A;  2KIS A;  1U78 A;  3MAJ A;  1IUY A;  4MGR A;  1UCR A;  2PX9 A;  2A5W A;  1SFE A;  4MFE A;  4ZYH A;  3L2V A;  1HLV A;  2DO7 A;  2W84 A;  1HOM A;  2GQQ A;  4DIQ A;  1ZRC A;  2FD5 A;  4J00 A;  3DCF A;  1BR2 A;  1HXD A;  1RPW A;  3BR2 A;  3IAS 2;  4MO7 A;  4XSZ F;  2OAZ A;  2Q8K A;  2RKH A;  4O5V A;  4KIS A;  3ERM A;  1SMY F;  1QA6 A;  1UHM A;  4U0W A;  3E3V A;  3S2H J;  1UFM A;  4A3C J;  2L4A A;  2BBY A;  1N75 A;  2W25 A;  4XRS A;  4I2O A;  3OWT A;  3HOU J;  2EQR A;  2PI0 A;  2VT3 A;  2ADU A;  1KQ0 A;  3F3X A;  1XMX A;  2Q2E A;  3F22 A;  5D4R A;  1NHA A;  4E4H A;  2IRF G;  2ID3 A;  3NRV A;  1DUX C;  5FD6 A;  3BRO A;  2DI3 A;  3CTA A;  2XGE A;  3JAM Z;  1FC3 A;  4EJU A;  5IP9 J;  1Z3Y A;  4C3H J;  1DU6 A;  3IKV A;  3K70 C;  2EV6 A;  5GAG J;  3H35 A;  2YUS A;  3VSK A;  3H9Q A;  1ON1 A;  2BGC A;  3ABT A;  3BPX A;  2UXN A;  3EYI A;  1VQN I;  1IRG A;  2EIM H;  3C7J A;  3HUG B;  3WE2 A;  2R7R A;  3ZR8 X;  5E20 A;  2ZJQ F;  2V4J C;  3K0L A;  5HDG A;  5EZG A;  2Z9O A;  3COA C;  3O3K A;  1WWX A;  2ME0 A;  2H94 A;  2B9S A;  5LFA A;  5C4X J;  1D3Y A;  2D45 A;  3BG3 A;  2A69 F;  1IO2 A;  3ABU A;  4AU7 A;  3GTP J;  4M71 A;  4XKC A;  4ZJZ A;  2YPR A;  1SFU A;  3OYL A;  2L7Z A;  2LF7 A;  3U21 A;  3D1N I;  2EZL A;  3MN2 A;  3HM5 A;  3IC7 A;  4F52 A;  2DJI A;  4OAY A;  4HEA 2;  2W57 A;  3RCO A;  1SFX A;  3JTG A;  4KNY A;  4JK1 X;  2UZK A;  1MSE C;  2E2J J;  5JR3 A;  3FXO A;  4G8X A;  3T8R A;  4WXC A;  3FX3 A;  5EG0 A;  5DUK A;  3OOP A;  1HKT A;  2LRE A;  3H0G J;  1YQA A;  2OD5 A;  1Z67 A;  3Q5F A;  1ONV A;  3L00 A;  1S7E A;  1OIS A;  5A2Q Z;  2D1H A;  3AAF A;  1U8R A;  2O9L A;  2DA2 A;  2DMU A;  2HU9 A;  3SZG A;  1O3S A;  1MH4 A;  3JW4 A;  2BY0 A;  2Y31 A;  4M3E A;  2KIQ A;  1IRX A;  3M8E A;  2ID6 A;  4XLE A;  1UHW A;  3M07 A;  4LIT A;  1L0O C;  5BNG A;  2IS6 A;  5CPR B;  2Z99 A;  3TO6 A;  2IPQ X;  2DJN A;  3Q0W A;  1E3P A;  2XDV A;  2VBW A;  3J80 Z;  1WCM J;  2KIU A;  4Y13 A;  3LQQ A;  3S2W A;  3CUQ A;  4B8X A;  3MCZ A;  2NVY J;  4Z6Y A;  2HZD A;  4LJZ F;  4BJ6 C;  3E6D A;  3IH2 A;  2EIL H;  2N8G A;  4YG2 F;  5FKN A;  3VWB A;  2O61 A;  5F0F A;  1BR4 A;  1RRJ A;  5M5X J;  1AU7 A;  1U5T A;  4RAY A;  3SEQ A;  1BR1 A;  2G7U A;  3TGN A;  1HQC A;  2AXL A;  4GO1 A;  2YX7 A;  4PGH A;  1DP7 P;  2M30 A;  2F4O B;  1WQ2 A;  3JRH A;  3DU5 A;  1E2X A;  1HSJ A;  4HYE A;  2JK3 A;  2G9W A;  1ODD A;  2ELH A;  2DXI A;  1IUF A;  2HPM A;  4A2U A;  1HKS A;  3QAH A;  1T0F C;  1NK3 P;  2C6Y A;  5ILV A;  4L5I A;  2WWY A;  4IRI A;  2LSO A;  2F6C A;  3WHB A;  3QPH A;  2NS8 A;  2XVC A;  1ZG5 A;  2ZME C;  1WHU A;  2M1B A;  3HL2 A;  1IXS B;  4BNC A;  1YE9 A;  1J0R A;  1O3T A;  2KJB A;  5EGO A;  3MZ8 A;  3LSJ A;  3PQJ A;  4BHB A;  5BMZ A;  1FTT A;  3HJE A;  2KIF A;  1TT5 B;  4BYY A;  4CYC A;  5IT3 A;  2DLL A;  2W48 A;  3LSK A;  2F4M B;  2EFN A;  3PO3 J;  3P7N A;  3WTY C;  1ETY A;  2R4G A;  5ED4 A;  1AOY A;  4HBL A;  3CDL A;  2ZSH B;  3PIO F;  3DV8 A;  1KU3 A;  4MLO A;  1FYK A;  1DGR M;  2CQK A;  1ZHF A;  2K02 A;  3IAM 2;  4B3A A;  2DMQ A;  3PL8 A;  2KRF A;  4N4O B;  4OIP F;  1CF7 B;  3WGH A;  3LQR A;  2XF6 A;  4L5E A;  4EJW A;  2ZNY A;  2PJR A;  1H0M A;  3QYE A;  4U7B A;  3S3N A;  1TZL A;  5IYB J;  1NH3 A;  4MFD A;  3TP0 A;  1JGG A;  2L01 A;  4XSX F;  3BG6 A;  3ZXS A;  2JUC A;  3WGI A;  3HG9 A;  4HX4 A;  5IP6 A;  4U88 A;  3MEX A;  2EV0 A;  4E7L A;  1IN4 A;  3I59 B;  4I76 A;  3DPL C;  3M4O J;  4C2U A;  2WAF A;  3FXL A;  1I27 A;  1OJL A;  5HLT A;  5FLM J;  2CO5 A;  1JT6 A;  2HYG D;  3KLN A;  4IHS A;  1YFH A;  2R92 J;  3S8P A;  2IA1 A;  2H1L A;  2RGV A;  5J1Y A;  1Z91 A;  4BY1 J;  3PUB A;  1K4T A;  4UUT A;  5LEJ A;  1FX7 A;  1TW3 A;  2OZU A;  2UUZ A;  3DKW A;  2W1O A;  3UR3 C;  1OR7 A;  2JA7 J;  5B1B H;  4C30 A;  4M6V A;  5E8G A;  2NAZ A;  4RM3 A;  2VOP A;  1EH8 A;  4ZTJ A;  4KIT B;  4BXF A;  5B3S H;  2CW0 F;  4KFC A;  4QPO A;  1J5Y A;  4BU2 A;  5CVJ A;  1VI0 A;  2PMZ A;  1X58 A;  2XAU A;  4NC6 A;  3DTK A;  2E7X A;  1OYI A;  4I0A A;  3TOA A;  4B3X A;  1A35 A;  4RBO A;  3HOV J;  3ZOB A;  1WPK A;  1WJA A;  2OBP A;  3GZ5 A;  3T8T A;  3JAM K;  2ZXW H;  1XGM A;  3ZMS A;  4IXA A;  2V9P A;  4PFP A;  2DMT A;  3TDU C;  1MDM B;  1W5T A;  4UVB A;  3BG9 A;  2MC3 A;  4EGZ A;  4OMZ A;  4P5O A;  2VXD A;  2L4M A;  2DFE A;  2MD5 A;  4G9Y A;  2EA4 A;  2CH0 A;  3BT9 A;  1T98 A;  3W3C A;  2E36 A;  2GAU A;  3GCM A;  5IT9 Z;  2R7O A;  5GTI C;  3FMR A;  4YFK F;  1V5F A;  3OYA A;  4BE0 A;  1R49 A;  2R7Z J;  3CP8 A;  4ENN A;  4Y3O A;  4D7N A;  1ZAR A;  4RB0 A;  5HS7 A;  1S7O A;  4IJA A;  4M6X A;  3JSO A;  1RNL A;  4DJA A;  3DQV C;  1QNT A;  4KN7 X;  2OU2 A;  1YJW I;  3S15 J;  2EZH A;  3PJR A;  4D5F A;  2EJR A;  3EUH A;  2DA6 A;  1LPQ A;  1AHD P;  1OPC A;  1SAU A;  2DK8 A;  2QYO A;  4LB6 B;  3SXY A;  1R22 A;  1P2F A;  4ZYE A;  2NVX J;  4U87 A;  1UEL B;  2P7C B;  3QYB A;  4PDK A;  5TRD A;  1LEB A;  3O8H A;  4J19 A;  4Q47 A;  4DYQ A;  4ZTF A;  4OIQ F;  2MW8 A;  3GTO J;  1Y0N A;  5E17 F;  2CU7 A;  2ZNZ A;  3VYT B;  2R7S A;  1P7J A;  2GIZ A;  4IHV A;  3I56 I;  1FSH A;  1IZ1 A;  5F1R A;  5A2Q K;  1VQ9 I;  1S5L C;  3ZQI A;  3AG2 H;  4NHJ A;  5BPD A;  3GO5 A;  2LMD A;  4RGX A;  3CLQ A;  3EPZ A;  1ZQ3 P;  1I6H J;  1SMT A;  2HKO A;  1X3U A;  2CQ7 A;  1U9N A;  1R36 A;  2M87 A;  3H5N A;  3G71 I;  1APL C;  3K69 A;  1MGT A;  5JFR A;  3N97 A;  1H8A C;  1JT0 A;  1R4N B;  3LSI A;  3O8G A;  3M1C A;  4ITV A;  1LFU P;  3BTI A;  3WTU C;  1RIO H;  4S04 A;  1NK2 P;  4I0B A;  3V4G A;  5J6X A;  4BQA A;  3L1P A;  2HOE A;  2CFX A;  2ZC2 A;  2X0L A;  4PSX A;  2ZXH A;  1ZGJ A;  1YHQ I;  4M3F A;  1OCC H;  1ENH A;  3FWE A;  1XB4 A;  2R7W A;  2ZB9 A;  2LNB A;  2Y2Z A;  2W24 A;  3OS1 A;  1U5T C;  1R5G A;  4W1U A;  2HDW A;  1A04 A;  1JKP C;  3DPU A;  1Z9C A;  2KL4 A;  4C9Y A;  2JT1 A;  4IHT A;  4IZZ A;  1MBF A;  3ZN0 A;  2ZXI A;  2HYF A;  2EB7 A;  2UV1 A;  5IY5 H;  2BVM A;  1WJ5 A;  3E6M A;  2GXG A;  3RPU A;  1QVT A;  2NVQ J;  4UUS A;  2WBM A;  3GZ6 A;  1Y8Q B;  2X1E A;  3CCV I;  4CHU A;  1XSX A;  3IWF A;  3VDX A;  4Q5S F;  1LQ1 A;  3I58 A;  4YEJ A;  4XLP F;  4HLX A;  2DDA A;  2LY1 A;  2DPU A;  4D9J A;  1SD6 A;  4BBS J;  4C3J J;  1V5E A;  3M8F A;  3DXJ F;  3V7C A;  2OZ6 A;  1YW7 A;  4IOC F;  1WVR A;  3H3U A;  3WHC A;  5FKO A;  4PJM A;  1QZZ A;  1FMW A;  2KKO A;  3DKY A;  2B7E A;  2HGC A;  1YLF A;  3WE3 A;  2FBH A;  4L18 B;  4S05 A;  1GHC A;  1EF4 A;  2E1M C;  1B8I B;  5GP9 A;  1X1P A;  2RAE A;  3G3Z A;  1AKH B;  1Z6R A;  2QUF A;  3GYH X;  1ETX A;  1EJ9 A;  4NC8 A;  2YR2 A;  2QLZ A;  5GAH J;  3ZQL A;  1HA8 A;  4IOA F;  3PNT A;  4X6A J;  1LFP A;  2AXT C;  1IGN A;  3TP3 A;  1U6G A;  2PEX A;  4FHT A;  4XKW A;  2JPC A;  3WOD F;  3S1N J;  3I53 A;  4YRV A;  2EZK A;  3Q0V A;  3W6J B;  1ORK A;  3MWM A;  2LF8 A;  2E1N A;  4ETS A;  4MTE A;  1R4M B;  5K5Q A;  1YRN A;  3BR6 A;  3ZQF A;  1K4S A;  2XB0 X;  4H0E A;  2LBF A;  1UST A;  1VQ6 I;  1SD7 A;  4KN4 X;  3QU3 A;  2BE5 F;  2QQA A;  1JUS A;  4F93 B;  1AA7 A;  4WXD A;  2Y75 A;  3TKY A;  2DFH A;  5LRR A;  2F48 A;  2LVS A;  5CVI A;  3FXR A;  2GBY A;  2GIV A;  1VQ7 I;  4UV9 A;  2UWM A;  2DMP A;  4A6D A;  5DDG A;  2JZY A;  2MD0 A;  2NNN A;  2Z16 A;  3DWL E;  2QSH X;  1QGP A;  5JLX A;  2KLO A;  1H89 C;  3H0D A;  3ABM H;  1E3H A;  1B9M A;  3P5J A;  1ON2 A;  3V7S A;  2PLY A;  2QKL B;  3LA2 A;  1BIB A;  4II3 A;  4PCQ A;  3JRF A;  2BHY A;  3F72 A;  3U1K A;  4BE2 A;  4E7J A;  5TGT A;  1SVM A;  2IVM A;  3CCM I;  4KIC A;  4HNT A;  1QHH D;  2Z33 A;  2K5C A;  2Y9Y A;  5IPA A;  1YX3 A;  1KON A;  2K9M A;  4ASN A;  2K9L A;  4M9S A;  5D5W B;  1FYL A;  1LFB A;  4E7Z A;  2QQB A;  1T8I A;  4JQF A;  2DN0 A;  2XRL A;  2M4G A;  3RYR A;  4IVN A;  4XM3 A;  1X1C A;  1PJR A;  3QOP A;  3L2R A;  2O6G E;  4U7D A;  5E1Z B;  5D5V B;  3E6B A;  1I1G A;  2GOM A;  1BI1 A;  2IGN A;  1FP1 D;  4IKF A;  4FE7 A;  4P1W A;  3KIO A;  4ESJ A;  5D8L B;  5DCM B;  2E5Z A;  4Y4R A;  1JJ6 C;  2M7A A;  4ESB A;  2VJI A;  3OR1 C;  2NS0 A;  2R93 J;  4A3G J;  1VQ4 I;  2X4H A;  3LFK A;  3OYF A;  2G7H A;  4EAT A;  1ETK A;  1OCO H;  2COM A;  1X4P A;  5K7Z A;  3PSF A;  3U1D A;  4R8H A;  2CS3 A;  2L3D A;  3TQN A;  4EMS A;  2PG4 A;  2KP6 A;  5KAF C;  3FXM A;  3L7W A;  1HW5 A;  4GGG A;  5CVR A;  3OYJ A;  1MH3 A;  3BPV A;  5DTD A;  3EUH C;  3IL2 A;  3FHZ A;  3CJN A;  2QGU A;  5JVT A;  3OY9 A;  2HVR A;  3HRT A;  3JRA A;  3G73 A;  1UAA A;  4DYR A;  1W0T A;  2DPD A;  1W7P B;  2ZJP F;  4I98 B;  4XNF A;  4XOT A;  3CO6 C;  3HRM A;  3SDG A;  3K1N A;  2JUG A;  2Z5U A;  1P4A A;  4A5M A;  4HX7 A;  4FAS D;  5HOO A;  3K4C A;  5FO5 A;  5DM6 F;  1GV5 A;  3G6E I;  5EDN A;  1SAN A;  3KZI C;  5KVR A;  3REO A;  3H1C A;  2L5Q A;  4K2E A;  4FTH A;  5F27 A;  1SD4 A;  4BE1 A;  1TW2 A;  1R5I D;  2RNG A;  3ASN H;  3JCU C;  4G94 A;  1WH7 A;  1ZEL A;  4WWC A;  3CC4 I;  1S7A A;  3BJO A;  3CMM A;  1K83 J;  2LKP A;  1MND A;  3KZY A;  1YOV B;  4XID A;  3I55 I;  3F23 A;  3A01 B;  1K7A A;  1MBK A;  3LSP A;  1UB9 A;  1D0X A;  1PUF A;  3QP5 A;  5E8I A;  4PZJ A;  2DFI A;  5DD4 A;  3JRD A;  3S17 J;  3J7A O;  3VOE A;  5H20 A;  4ZDP A;  3W2W A;  2LK2 A;  1UJ8 A;  2FU4 A;  2K7L A;  1ETO A;  4IPA A;  3HOT A;  1JI8 A;  5L3C A;  4M72 A;  4Y52 J;  1TWF J;  1QZE A;  4XKB A;  3A2K A;  1CQT A;  1XPX A;  3K4M A;  4RGU A;  3PNY A;  1O3Q A;  3HOW J;  1JHH A;  2DOE A;  1FYM A;  2J5O A;  3ULQ B;  2CRG A;  3CJQ B;  1IN7 A;  2JVG A;  5J47 A;  2OTL I;  2AO9 A;  4UXN A;  4V19 K;  1JXS A;  2R7F A;  4DZP A;  4IHX A;  3S2D J;  3M3Y J;  3W2V A;  4DGW B;  3BWG A;  5ILU A;  3GLX A;  5HNF A;  4MEY F;  5FKL A;  2X6X A;  3KP6 A;  4DQ2 A;  1SAX A;  3AL0 B;  5ILS A;  3K1P A;  4HSR A;  4JX5 A;  3GEZ A;  2XUB A;  3S1M J;  1TL8 A;  3BOQ A;  2VKD A;  3MKY B;  1RZ4 A;  2W00 A;  2D5V A;  4C3I J;  4JYK A;  1IG7 A;  2BXY A;  3ZQH A;  1XC5 A;  3QP6 A;  2MH9 A;  3RZD J;  3ESW B;  4LG0 B;  2V6C A;  2K40 A;  4B44 A;  1ZYR F;  5FLX Z;  3FM5 A;  1V5G A;  4D0P A;  2M7B A;  2EV5 A;  1HW1 A;  4CCM A;  1X19 A;  1ZH5 A;  1OCP A;  3S32 A;  2ICW G;  3FXQ A;  4L0Z B;  2P5K A;  4RAG A;  3TO9 A;  3PFI A;  2YU9 J;  4HF1 A;  2GXB A;  3R61 A;  1TQM A;  1ETW A;  3IKT A;  1H9G A;  2VI6 A;  1S3J A;  5J8C A;  4IO9 F;  1FOW A;  2D2W A;  5J4Y A;  3I54 A;  1LE8 B;  2KFD A;  4V2G A;  3PUF A;  3BLY A;  3IUO A;  2GA1 A;  4ZH4 F;  2DT7 B;  2OUM A;  2YX4 A;  1KU7 A;  3E0J B;  5IOZ A;  2VPL A;  4MQV A;  1X4O A;  3M9A A;  4A3F J;  1PYV A;  1IW7 F;  2ZBK A;  2VC0 A;  1TC3 C;  4DW6 A;  2MYS A;  5C44 J;  3LFU A;  4WK8 F;  3RTR A;  2VQH A;  1YI2 I;  3KEY A;  3IH4 A;  5JVG F;  2F5E A;  4FIS A;  3NAU A;  4OIN F;  5C4J J;  2QWW A;  1IN8 A;  3BZC A;  4UHT A;  3GFI A;  3DF8 A;  4N9I A;  1UZC A;  1QVU A;  3DTI A;  5FFX A;  2ZFW A;  3N05 A;  5KNL A;  2B63 J;  2JTV A;  3IHU A;  4A0Z A;  5CVV A;  3OMY A;  2A05 A;  4S0H B;  4LIU A;  2TCT A;  1Z3X A;  1I5Z A;  9ANT A;  4RB3 C;  2K85 A;  1GUU A;  2P81 A;  2M0M A;  2VKV A;  1BL0 A;  1O57 A;  1SVL A;  1WI9 A;  3KP4 A;  1MMG A;  3BDD A;  2MAB A;  1Z7U A;  2XGC A;  3BTC A;  2IEK A;  4HPQ A;  1X1D A;  3MZH A;  1B1B A;  2YSR A;  5F1J A;  4UNO A;  4PJJ A;  2A07 F;  1F9N A;  1IAW A;  3GTK J;  4XL9 A;  1SVO A;  3RQ4 A;  5FRN A;  2FE3 A;  4L9V A;  4QLC U;  3F9K A;  1O4X A;  1TWC J;  2E71 A;  2GZW A;  4JOM A;  3ISP A;  3TDZ C;  1Y56 A;  2DK5 A;  1G3T A;  2XV4 S;  1XGS A;  2LD5 A;  5HLH A;  1WRJ A;  2JJ7 A;  4I99 C;  4ESF A;  1MBE A;  3S3O A;  3DP7 A;  2L9S A;  4RM2 A;  3LSH A;  4B1R A;  4BXU A;  2RQP A;  2DTR A;  1BC8 C;  5FKM A;  4CCK A;  2STW A;  2ELK A;  2FML A;  3OIO A;  2IT0 A;  4UVA A;  2VUM J;  1W7P D;  1Y1V J;  3GTG J;  2MLK A;  5IP7 J;  2K4B A;  2L7F P;  3FZV A;  4B09 A;  3DTE A;  2ESH A;  2R5Y A;  2XSD C;  3R4K A;  4AID A;  4IRH A;  4HV5 A;  5D6F A;  1QZY A;  2EK5 A;  3HEF A;  4OOI A;  3B73 A;  3HXL A;  3K2Z A;  3SZP A;  3KEO A;  6PAX A;  2Z2S B;  3N4M A;  1S72 I;  3HRS A;  1FZP B;  4Y33 A;  3RIR A;  2IGM A;  5CQE A;  5KHD A;  1IXR C;  4GYI A;  4RB2 C;  1RET A;  4XLF A;  4DOZ A;  2X85 A;  4BL0 B;  4ZYG A;  2HXO A;  3OV8 A;  1OCZ H;  2BW3 B;  4CZZ A;  1VQ5 I;  1Z77 A;  4FE4 A;  1B72 B;  3GW2 A;  1GVD A;  4FET A;  3K4N A;  3C2G A;  2GXA A;  2LKX A;  4U0Y A;  3RKQ A;  4A93 J;  1LEA A;  3QU6 A;  1QRY A;  2DOA A;  2HWV A;  3QPS A;  1MMS A;  4ZDO A;  4M9Z A;  3WG7 H;  1U2W A;  2KRC A;  2P5L C;  3H5A A;  4BQO A;  2DOD A;  2LG4 A;  2DTZ A;  4II2 A;  1J09 A;  3F0C A;  4BEH A;  4E7K A;  4BDY A;  4RDU A;  2ZME B;  2O7O A;  1E3O C;  1JTX A;  3OL4 A;  3CD6 I;  2CW7 A;  2DQL A;  2F5V A;  4E7H A;  3I0T A;  2VOO A;  3ZMT A;  4NB5 A;  2PMU A;  2ZXJ A;  2O8K A;  2ZSI B;  3BTJ A;  2ACJ A;  1REP C;  3ERE D;  1CGP A;  1PUE E;  4BJT A;  3EET A;  3K10 A;  3W6V A;  1W5S A;  1POG A;  2IA0 A;  2VKE A;  2VAS A;  2BYV E;  2WAQ N;  3FBN B;  5DCM A;  4BKX A;  4EV0 A;  4YII A;  4CGZ A;  2EH3 A;  1BOB A;  2LH9 A;  1XCV A;  2JSC A;  1K6Y A;  3T1B A;  2QBY A;  2MBF A;  2LY9 A;  3A0H C;  1FY7 A;  1OYY A;  1PVE A;  2JN6 A;  2EA2 A;  1LDJ A;  3I4P A;  3ASO H;  5TIS C;  3BR0 A;  2HR3 A;  1LB2 A;  3BR5 A;  4J01 A;  3U9G A;  1FJL A;  1B4A A;  1D8K A;  1IDZ A;  4XOP A;  4JX4 A;  4A0Y A;  1W36 C;  1U9O A;  2LOO A;  5LGT A;  4BUP A;  2FOK A;  2CW8 A;  4KIG A;  5EJC A;  4CCL A;  4CIC A;  3FXU A;  4LK1 F;  1A36 A;  2JRT A;  2HTS A;  1TBX A;  3C18 A;  3OIP A;  5LLQ A;  3DEE A;  3B02 A;  1J7K A;  1P7I A;  3TOB A;  3ONQ A;  4AD9 A;  2VQL A;  1B9N A;  4CXF A;  1VQ8 I;  4CUG A;  4P96 A;  1T6S A;  2VC1 A;  3OL3 A;  4GYG A;  4P9U A;  3CCJ I;  3BR3 A;  2K3P A;  2R5Z A;  2O5R A;  5E1X A;  2HOA A;  4E7I A;  3J7A Y;  2QZ8 A;  1Q1V A;  3WTV C;  3DLL F;  1X1A A;  2VT2 A;  1T2K A;  5FLX K;  2Q1Z B;  4UV8 A;  1NG6 A;  1IN6 A;  2VIX A;  2XSJ C;  3WTX C;  3ZP5 A;  3JRB A;  5FB2 A;  4AM3 A;  2P5V A;  2VN2 A;  3LMM A;  3A01 A;  1T08 B;  3VEP A;  3ZRG A;  2KDO A;  3SEZ A;  3K70 D;  2GM4 A;  2RVC A;  5E3L A;  2Q0O A;  3QPL A;  2PN6 A;  4XLA A;  1XX5 A;  2X48 A;  1GDT A;  1TWG J;  4OIR F;  3H9G A;  5HOD A;  4XKV A;  4XRF A;  2QSF X;  1VZ0 A;  1WFX A;  3TO7 A;  4B48 A;  5D8K B;  3RI4 A;  3RQI A;  1LDD A;  1FOY A;  5GPA A;  5HDK A;  3X2Q H;  2JWT A;  3AG1 H;  3VSL A;  2Q2E B;  4Z2Y A;  1XDU A;  1MMD A;  1Z1D A;  3J7Y J;  5FFZ A;  3BCB A;  2KZG A;  5LHG A;  2R0Q C;  1K61 A;  1TTY A;  3LSG A;  5F64 A;  1PP8 F;  3E5Q A;  4QIW N;  3OYI A;  4O3M A;  4MHG A;  1KQ9 A;  3K1M A;  4L9T A;  4XOR A;  2LY2 A;  1PP7 U;  1K79 A;  3ZMZ A;  3PFY A;  3KEQ A;  2NOG A;  2WC2 A;  3CDI A;  4C2M J;  1DQU A;  3GVA A;  1XN7 A;  1GVJ A;  5CVU A;  1Z7L A;  3MQ0 A;  2GOX B;  5TJJ A;  4AC0 A;  5E18 F;  4KMU X;  1P6R A;  3QYF A;  2RC4 A;  5BPI A;  3H5R A;  2MLG A;  1Z6T A;  2HPI A;  3CUQ C;  2HDC A;  3B6C A;  2ZFU A;  5D5U B;  2WTE A;  1UG2 A;  4EJV A;  3HUG A;  1JUP A;  3ZQQ A;  2E7W A;  4HNU A;  1J75 A;  4D1Q A;  4CZC A;  4EM1 A;  3EQL F;  1USS A;  1LVK A;  2QSG X;  2AHQ A;  1W5C C;  2A61 A;  1R00 A;  4CCN A;  1BN5 A;  1E17 A;  1EH6 A;  2W82 A;  1XS9 A;  1ZAO A;  2XPW A;  2H27 A;  5FGM A;  1P9Q C;  2X6W A;  4RA2 A;  1ZR2 A;  1XDS A;  1KQ8 A;  3FK6 A;  3JRI A;  1HW2 A;  1ZR4 A;  1GT0 C;  1R1V A;  2L54 A;  2QCO A;  2AS5 F;  4HQE A;  1SD5 A;  2BZT A;  5F04 A;  5EG0 B;  1HCR A;  2CUJ A;  1FTZ A;  1PDN C;  2K9N A;  1O7L A;  5L3G A;  4X1E A;  4EEF G;  4AVZ A;  1LE8 A;  1KZH A;  3EDP A;  4NQW B;  3HOS A;  2DW4 A;  2O03 A;  3I4M J;  2IJL A;  3HBL A;  4NC7 A;  3ZN1 A;  2JQ7 A;  2H6B A;  3P9C A;  2WA0 A;  2TDX A;  2L02 A;  3DEW A;  3PQK A;  1OFC X;  4A3D J;  4JBA A;  3OYB A;  4KJZ A;  3QQA A;  2LTP A;  4CYD A;  5DS9 A;  2YU3 A;  5B66 C;  2AQE A;  1Y39 A;  1YG2 A;  1YJN I;  1ACI A;  1O3R A;  4RB1 A;  2M4K A;  1U3E M;  1WJD A;  3PIP F;  1KYW A;  1FT9 A;  2V9K A;  4E70 A;  3GF2 A;  4HW0 A;  1HST A;  2QA4 I;  4Y15 A;  5ICF A;  2RRE A;  3DFG A;  4LD5 A;  4HG2 A;  5AIQ A;  3JTH A;  4EJT A;  2VBX A;  3PNV A;  3RDI A;  3HPG A;  1VQM I;  3E7L A;  5L3B A;  1BIA A;  2XPV A;  1U5T B;  2BXZ A;  5LBQ A;  1R71 A;  3BJ6 A;  5J3L A;  1ZGA A;  4KMF A;  3IRR A;  1ZLK A;  3R6S A;  1YIJ I;  4LOC A;  4HF0 A;  2DFF A;  1FLI A;  2STT A;  1F36 A;  2P8T A;  2XAH A;  4LK0 F;  4ZDL A;  1A6I A;  2FUG 2;  3JSP A;  3LAJ A;  1HDD C;  2VOD A;  2TRT A;  1HKQ A;  1YW9 A;  2CG4 A;  4I02 A;  5CYV A;  3E6C C;  1G2H A;  2R3S A;  4EJO A;  3MKW B;  5L3D A;  2K86 A;  1TLH B;  4ENJ A;  1LUJ B;  1X3W B;  3S1Q J;  4IHY A;  1S29 A;  2HQR A;  2V9V A;  1IJW C;  2OQG A;  3F8M A;  1D5Y A;  3MKZ A;  4KA4 A;  1TQP A;  4W97 A;  1BJZ A;  4XMY A;  1XTA A;  1D5V A;  3EYY A;  3ZMV A;  3TMO A;  3GLL A;  1MMA A;  1RKT A;  2ECB A;  4RAF A;  1WH5 A;  5L3E A;  1MBG A;  2E34 A;  4CYC B;  2EIN H;  4G6Q A;  5ICE A;  1QQI A;  3S93 A;  2QEX I;  3OYN A;  3OS2 A;  3ZQ7 A;  3D5S C;  1UMQ A;  3FIS A;  4BS9 A;  1STZ A;  2F2E A;  1R6R A;  2K9S A;  1RI7 A;  2AQF A;  4OWR B;  2OF7 A;  4OU0 A;  1OR7 C;  5LEK A;  1ZRE A;  1ULY A;  5FJ8 J;  1RUO A;  4ENK A;  1V3F A;  1NTC A;  1Z05 A;  3AG3 H;  2E1M B;  3V8L A;  3CME I;  3WGG A;  4HQM A;  4IQJ A;  4XK4 A;  3RJP A;  4DNC A;  4PJ0 C;  2EBI A;  2V26 A;  2CWE A;  4DZJ A;  4EQQ A;  1G6N A;  3CCQ I;  1FBU A;  2PJR B;  2WAQ A;  3J81 Z;  1QU3 A;  3FBI B;  2I5U A;  2E60 A;  4U0V A;  3V8J A;  2IW5 A;  4UY8 I;  1HF0 A;  1CF7 A;  1SFO J;  2HXI A;  5ICG A;  4KIF A;  3CUO A;  2DYR H;  4F55 A;  4C2T A;  2V79 A;  2BW3 A;  4HZF A;  1XCB A;  2CJJ A;  3DKX A;  1VF9 A;  3CP2 A;  2HKX A;  1JJ8 C;  2XGX A;  4FX4 A;  2LC2 A;  1ZG1 A;  1QBJ A;  1LJ9 A;  3A02 A;  4Y17 A;  4BJ5 C;  2OCE A;  1DPU A;  3CJT B;  1OYW A;  2ISZ A;  4P55 A;  4F3Q A;  3H3V K;  2ZME A;  3I59 A;  1W36 D;  4A12 A;  2M0C A;  3CMA I;  2DA4 A;  5HLI A;  2WB1 N;  3W2A A;  3CCR I;  2K4J A;  4RS8 A;  3ZPL A;  2XAJ A;  3KP7 A;  2P4W A;  3J7Z I;  4TV7 A;  2OV7 A;  1YTY A;  1FBQ A;  3FKI J;  4HST A;  5D5X B;  1ZGW A;  4LG3 A;  2ECC A;  4G6T B;  1GV2 A;  4B43 A;  1R9T J;  2P6T A;  1QHG A;  2ZJR F;  1G3S A;  4HNV A;  1FOK A;  5CKT A;  2YS9 A;  4I09 A;  2VLA A;  2Z1D A;  2IAI A;  3C2B A;  1I1S A;  2L9N A;  4BGD A;  1R1T A;  1XD7 A;  2FXA A;  2DT5 A;  4FX0 A;  1RC9 A;  2L9R A;  5M3M J;  5DV5 A;  2LP0 A;  4AIH A;  3HB9 A;  1VQK I;  2FX0 A;  3P9I A;  3JRE A;  4Q4Z F;  3HC7 A;  4Y7N J;  4QSH A;  1VQP I;  3T5X A;  1VFC A;  5GTH C;  1MDM A;  1Z21 A;  2QQ9 A;  1KA8 A;  4IF4 A;  2QQ8 A;  3K9T A;  3UKG A;  4D7M A;  2Y0S N;  1SEU A;  1MBJ A;  5E1W A;  1TT0 A;  2K3F A;  3TW7 A;  1JE8 A;  3SFZ A;  3AKZ A;  3I71 A;  1MZB A;  4NBQ A;  1I39 A;  1JKQ C;  1RKW A;  4NDL A;  4BY7 J;  2HS5 A;  3C3W A;  2D1V A;  3HHG A;  2V1N A;  3E5U A;  2XF5 A;  3GBG A;  1FIP A;  1DDN A;  2OTJ I;  1BC7 C;  3OYG A;  2PMZ N;  3QOE A;  1C0W A;  2KT0 A;  5HS9 A;  2COB A;  1N78 A;  4CCJ A;  2NOJ B;  2FF4 A;  3LWF A;  4BAY A;  5LGU A;  4A3L J;  1SC7 A;  2FQ3 A;  3E97 A;  1SFK A;  1ETV A;  1MJA A;  3D5R C;  3VYR B;  3F8B A;  4CCO A;  3I5U A;  2QM3 A;  4M74 A;  1TP4 A;  3OYM A;  1FWZ A;  1AWC A;  1A31 A;  1EKE A;  3ECO A;  2P7V B;  2OA4 A;  1M1E B;  5L3F A;  1DPR A;  2E35 A;  2ELJ A;  4EGY A;  1J59 A;  1V54 H;  4IRG A;  2M45 A;  1IXC A;  2P0W A;  1D8J A;  4KUM A;  1VND A;  1XMK A;  3I64 A;  5AIP A;  2CQQ A;  1I3A A;  1R5H A;  4GCV A;  2WAE A;  2FNA A;  1IF1 A;  4XIC A;  2WV0 A;  5EZH A;  2RDP A;  5E79 C;  2KHM A;  1YIO A;  1A6Q A;  1LVA A;  3CCE I;  1MKM A;  2CV2 A;  2NVT J;  3NEU A;  4LLG F;  4N9H A;  4MIM A;  2MG4 A;  3SJM A;  2XKO A;  1WJF A;  2WY7 Q;  2FSW A;  4WXH A;  2M8G X;  1JKO C;  3OYH A;  1BI0 A;  3GZN B;  3RZO J;  4LIV A;  5D6E A;  3LAP A;  2CFO A;  3RKX A;  1KYZ A;  3R0A A;  5JHF A;  3Q0U A;  1FSE A;  2KRH A;  4NNJ A;  3GFL A;  2HTJ A;  2R7Q A;  3E5X A;  4L0Y B;  4XON A;  5IYC J;  2DBB A;  1Q1H A;  3WTZ A;  3BR1 A;  4I01 A;  2LLK A;  3NWT A;  2HOT A;  3L09 A;  4ABZ A;  4M3B A;  2ZJ2 A;  5D4S A;  4BXX J;  5DD8 A;  3VYU B;  2ZKZ A;  5J1R A;  2R7V A;  3KLO A;  2CQN A;  1WI3 A;  2DQR A;  2R7D A;  3CF5 F;  2M9H A;  2DA5 A;  2JPB A;  3H9J A;  5JHU A;  4YFX F;  5C3E J;  3ABL H;  3CDH A;  3PO2 J;  3L2Q A;  1TWH J;  2EPF A;  4UUS B;  5IOY A;  4OAZ A;  4X0G A;  2KIM A;  3GTJ J;  1GXP A;  2LDU A;  1MJ9 A;  2HOS A;  2A6T A;  3VFZ A;  1W4M A;  2DAO A;  2LFB A;  1FP2 A;  4HAM A;  3CCL I;  3R60 A;  1MNE A;  2RQQ A;  1WGX A;  2LR8 A;  2BV6 A;  1IV8 A;  3LSM A;  3W6K B;  4NQW A;  3KFW X;  5J8F A;  4LLL A;  3CF2 A;  4ZC3 A;  3CMY A;  5HLG A;  1ETQ A;  2VJJ A;  3HOZ J;  3Q3S A;  3GWZ A;  4WF2 A;  1D0Y A;  4FCY A;  5CLS A;  4N0B A;  2E1O A;  2L7M P;  2R7U A;  2O3F A;  1TNT A;  1BI3 A;  3Q9V A;  3MVP A;  2V7F A;  3MKL A;  4LFU A;  4AWX B;  3GFM A;  2UXX A;  3QPT A;  3HYI A;  3CES A;  5FRM A;  3K4B A;  4IHW A;  2Y30 A;  2X6Y A;  2W4S A;  1I6X A;  4GDF A;  4UB6 C;  5LGN A;  2JA5 J;  2V1D A;  2FNP A;  2VON A;  2MH2 A;  3L2C A;  1LNW A;  2PMH A;  3FMQ A;  4AVP A;  1B8I A;  1AKH A;  3J81 K;  2CV1 A;  3BG5 A;  3KYL A;  2E5N A;  1OLT A;  1ITY A;  1FEX A;  5DEQ A;  3HOY J;  3I4N J;  1JGS A;  2QEN A;  2OJE D;  3CCS I;  4ENM A;  4ZYA A;  1YRN B;  2H8W A;  5CQG A;  1Y0U A;  3CCU I;  4ANJ A;  5GAD J;  4M9X A;  3LNQ A;  3A1Y A;  1V4R A;  3WU0 A;  2LBF B;  2VQC A;  5K7F A;  1L3L A;  3FF5 A;  1VTN C;  5EEH A;  5ICC A;  2FA5 A;  1QPM A;  3FIW A;  4D5C A;  4XQF A;  1P4W A;  5E3M A;  2H8R A;  2H09 A;  2WY8 Q;  1P4X A;  2FEZ A;  4ZYD A;  2OQR A;  4BAC A;  2Y0M A;  2JVH A;  1K78 B;  3V7R A;  4A0X A;  1GXQ A;  2CGP A;  4BHC A;  3GTM J;  3HKZ N;  1Y8R B;  3BZK A;  4E7S A;  1W1W E;  1T95 A;  4HX8 A;  3GTQ J;  1LKX A;  1BM9 A;  4EVI A;  3NWS A;  3G4S I;  2PBI A;  3OYE A;  2XRO A;  3LL7 A;  1MMN A;  4AYB N;  5K5O A;  5F0H A;  3ZGK A;  3FMS A;  3QOD A;  2DCE A;  1BW6 A;  3GXO A;  2FMY A;  1OKR A;  1Z0X A;  4RAZ A;  1W0U A;  1DGW Y;  3BP8 A;  1YO5 C;  2DA1 A;  3LSR A;  4PK4 A;  4OIO F;  1R58 A;  3G2B A;  4E6K G;  4BH9 A;  5ERI A;  3BTL A;  3WTS C;  5IYD J;  2JMW A;  3DPT A;  3OIQ A;  3EUA A;  2DT6 A;  2HQ5 A;  5K1Y A;  2XAS A;  2F5C A;  4N4N B;  4XR6 A;  5K5R A;  3KCC A;  1R7J A;  2WB1 A;  2L7K A;  4Q48 A;  4EM0 B;  3M8J A;  1DP3 A;  2A5Y B;  2FBK A;  5BOX A;  3H3Z A;  2X1D A;  3OYC A;  3D5L A;  3DBR B;  5DYM A;  4YIR X;  1A5J A;  2GLO A;  2I10 A;  2RV8 A;  1DU0 A;  1G3W A;  2DA7 A;  3HZJ A;  1Y1W J;  3EUK L;  1MJB A;  5EF6 A;  1F4K A;  3A03 A;  1IN5 A;  1IC8 A;  4XN0 A;  4I6Z A;  1KU2 A;  3CC2 I;  2MGQ A;  4XLC A;  4XN3 A;  2K9Q A;  3LA3 A;  3S3M A;  1T38 A;  3DEU A;  5CJ9 A;  2XAF A;  5HVQ C;  3CCY A;  2HNH A;  3DLA A;  1D1C A;  1S9H A;  2F4I A;  1XGN A;  4RGR A;  1J2X A;  1TQI A;  4CA0 A;  2BVL A;  2A3S A;  3KET A;  4AIJ A;  4GFB A;  1ZTR A;  2XIG A;  4L9N A;  1YYV A;  4B4C A;  4CSW A;  5E3N A;  4QPQ A;  4JX6 A;  2M5W A;  1NG7 A;  3RKY A;  4A3E J;  5J40 A;  3SFI A;  1J9I A;  2QVO A;  2Y0S A;  1IDY A;  2DOF A;  4DBQ A;  3RYP A;  3JR9 A;  3L2U A;  2Y48 A;  5DCF A;  1JUM A;  4WCG A;  3ZMD A;  4FQG A;  3P9K A;  5GPC A; 
#chains in the Genus database with same CATH homology
 1W7P A;  3VOD A;  4G7O F;  1G3Y A;  3IRQ A;  3CLO A;  2FRH A;  5LHI A;  4LLN A;  3VB2 A;  4RGS A;  4HLY A;  2BEO A;  4WX9 A;  4UVC A;  3HSF A;  5F6F A;  3T0Y A;  1OMI A;  3MFK A;  3NQO A;  2ZO4 A;  4P9F A;  4M73 A;  2J5P A;  2HEO A;  2Z3Y A;  3HSR A;  1ZN2 A;  3SZT A;  2CSO A;  4BHP A;  2EFO A;  4HOB A;  4MEX F;  3KP5 A;  1RUN A;  4L9J A;  4R1H A;  4MNU A;  2PJP A;  4AIK A;  4R79 A;  2W85 A;  2GWR A;  3F8F A;  5H6R A;  2HFH A;  2GA2 A;  3IWZ A;  3GUD A;  1WSU A;  4ZZD A;  3KP3 A;  1IRF A;  3RPQ A;  1FBS A;  1XSV A;  4EM2 A;  1R1U A;  4LMY A;  4CDG A;  2O8X A;  1H9T A;  4LG0 A;  1S8N A;  3MZY A;  2FBI A;  2A6H F;  4LGW A;  3J80 K;  1HBX G;  3QRF F;  1BOA A;  1KU9 A;  2PQ8 A;  4HDV A;  2XKP A;  2NYX A;  2F5F A;  5LHH A;  1BJA A;  4XLN F;  1XGO A;  3KZZ A;  1XSD A;  2HZT A;  2V1X A;  4YIF A;  5KK1 A;  4ZZL A;  1BI2 A;  2ETH A;  3BJA A;  3U2R A;  4MQ9 F;  3O2P E;  1R23 A;  4YFN F;  2CYY A;  2PFB A;  1K6O A;  4F7Z A;  3CUQ B;  1YS6 A;  3ELK A;  3WU1 B;  2M8E A;  3F6O A;  3BZ6 A;  4A6E A;  4G7H F;  5AON A;  2K27 A;  3GFJ A;  4HF2 A;  2IP2 A;  5BS6 A;  2ISY A;  3WTT C;  4HV6 A;  5HDN A;  3HHH A;  1B59 A;  2XAQ A;  2ZCW A;  3SHF A;  5JI6 A;  3V8K A;  3M7G A;  1YS7 A;  4ON0 A;  3WTW C;  4UUV A;  1S6L A;  4XBF A;  4KDP A;  1G4D A;  1ZLJ A;  5EEG A;  3F8C A;  4G6D A;  3D0S A;  1BBY A;  1O7F A;  1XMA A;  1ZG3 A;  2P6S A;  3F8N A;  5LRS A;  1TNS A;  2XHK A;  3F6V A;  2VXZ A;  4OMY A;  3BY6 A;  2KJC A;  4KIB A;  1MD0 A;  3ROU A;  3KP2 A;  2O0Y A;  5BQT A;  4FT8 A;  1LDK B;  1F1Z A;  4KT5 C;  3CO7 C;  3Q9S A;  1K78 A;  2ESN A;  1F5T A;  1EV7 A;  2B0L A;  5HS8 A;  3HSE A;  4A5N A;  1EH7 A;  2VE8 A;  1P92 A;  3SQN A;  1B6A A;  2VBY A;  2NNY A;  3O6B B;  2EFP A;  4QWQ A;  3ZMU A;  3LA7 A;  3HRU A;  3HIF A;  1WKM A;  2VE9 A;  1FNN A;  2A6E F;  2F5D A;  2RNJ A;  4G7Z F;  4CO8 A;  2RN7 A;  2A68 F;  3F21 A;  3HTS B;  4KYW A;  3WG9 A;  1ZRF A;  4I7H A;  2XRN A;  3H92 A;  1T0F A;  1YW8 A;  1QO0 D;  1FPQ A;  4MTD A;  2E1C A;  5FD5 A;  2IA2 A;  2EFQ A;  5IT9 K;  1T39 A;  2QBY B;  3RKW A;  3HTU A;  2EFW A;  2EWN A;  3M1E A;  2MA3 A;  4M6Y A;  4HA8 A;  5H6Q A;  2VBZ A;  4HDU A;  4O6J A;  3FM3 A;  5DUI A;  4GXO A;  3ECH A;  3C1D A;  4LB5 A;  2XAG A;  3R0J A;  3KE2 A;  2NRA C;  2HQN A;  3GX4 X;  1KGS A;  1ZRD A;  3ML6 A;  2H6C A;  2V1U A;  4PGG A;  3LST A;  3L9F A;  4L5J A;  1JHF A;  2DU9 A;  1U78 A;  3MAJ A;  1IUY A;  4MGR A;  1UCR A;  1SFE A;  4ZYH A;  2DO7 A;  2W84 A;  2GQQ A;  1ZRC A;  4XSZ F;  1HXD A;  2Q8K A;  2OAZ A;  2RKH A;  4O5V A;  1SMY F;  1UHM A;  4U0W A;  3E3V A;  1UFM A;  2L4A A;  2BBY A;  2W25 A;  4I2O A;  2PI0 A;  2VT3 A;  2ADU A;  1KQ0 A;  3F3X A;  2Q2E A;  3F22 A;  5D4R A;  1NHA A;  2IRF G;  3NRV A;  1DUX C;  5FD6 A;  3BRO A;  2DI3 A;  3CTA A;  3JAM Z;  1FC3 A;  4EJU A;  3IKV A;  2EV6 A;  1ON1 A;  2BGC A;  3ABT A;  2UXN A;  3BPX A;  3EYI A;  1IRG A;  3WE2 A;  3C7J A;  5E20 A;  3K0L A;  5HDG A;  2Z9O A;  3COA C;  3O3K A;  1WWX A;  2H94 A;  1D3Y A;  2D45 A;  2A69 F;  3ABU A;  4M71 A;  2YPR A;  1SFU A;  2LF7 A;  3IC7 A;  3JTG A;  2W57 A;  1SFX A;  4KNY A;  4JK1 X;  2UZK A;  5JR3 A;  4G8X A;  3T8R A;  4WXC A;  3FX3 A;  5DUK A;  3OOP A;  1HKT A;  1YQA A;  2OD5 A;  3Q5F A;  1ONV A;  3L00 A;  5A2Q Z;  2D1H A;  3AAF A;  1U8R A;  1O3S A;  3JW4 A;  3M8E A;  1UHW A;  1L0O C;  2Z99 A;  3TO6 A;  2IPQ X;  2VBW A;  3J80 Z;  2KIU A;  4Y13 A;  3LQQ A;  3S2W A;  3CUQ A;  4B8X A;  3MCZ A;  4LJZ F;  3E6D A;  4YG2 F;  2O61 A;  1U5T A;  4RAY A;  2G7U A;  3TGN A;  1HQC A;  2AXL A;  4GO1 A;  2YX7 A;  4PGH A;  1DP7 P;  2M30 A;  1WQ2 A;  1E2X A;  1HSJ A;  4HYE A;  2G9W A;  1ODD A;  2ELH A;  4A2U A;  1HKS A;  3QAH A;  2C6Y A;  5ILV A;  4L5I A;  2WWY A;  4IRI A;  2LSO A;  3QPH A;  2XVC A;  1ZG5 A;  2M1B A;  1IXS B;  4BNC A;  1J0R A;  1O3T A;  2KJB A;  3PQJ A;  4BHB A;  5BMZ A;  2KIF A;  4BYY A;  5IT3 A;  2DLL A;  2EFN A;  3P7N A;  3WTY C;  5ED4 A;  1AOY A;  4HBL A;  3DV8 A;  1KU3 A;  1FYK A;  2CQK A;  1ZHF A;  2K02 A;  2KRF A;  4OIP F;  1CF7 B;  3WGH A;  3LQR A;  4EJW A;  2ZNY A;  1H0M A;  4U7B A;  2L01 A;  4XSX F;  3WGI A;  4HX4 A;  4U88 A;  3MEX A;  2EV0 A;  1IN4 A;  3I59 B;  3DPL C;  1I27 A;  2CO5 A;  2HYG D;  3KLN A;  4IHS A;  1YFH A;  2IA1 A;  2RGV A;  1Z91 A;  5LEJ A;  1FX7 A;  1TW3 A;  2OZU A;  3DKW A;  1OR7 A;  5E8G A;  2NAZ A;  2VOP A;  1EH8 A;  2CW0 F;  4KFC A;  1J5Y A;  5CVJ A;  2E7X A;  1OYI A;  4I0A A;  3TOA A;  2OBP A;  3GZ5 A;  3T8T A;  3JAM K;  3ZMS A;  1XGM A;  4IXA A;  3TDU C;  1MDM B;  1W5T A;  4UVB A;  2MC3 A;  4EGZ A;  4OMZ A;  4P5O A;  4G9Y A;  2L4M A;  2MD5 A;  2EA4 A;  1T98 A;  2GAU A;  5IT9 Z;  3FMR A;  4YFK F;  4ENN A;  1ZAR A;  4RB0 A;  5HS7 A;  1S7O A;  4IJA A;  4M6X A;  3JSO A;  1RNL A;  3DQV C;  1QNT A;  4KN7 X;  2OU2 A;  2EJR A;  3EUH A;  1OPC A;  2DK8 A;  2QYO A;  4LB6 B;  3SXY A;  1R22 A;  1P2F A;  4ZYE A;  2P7C B;  4PDK A;  5TRD A;  1LEB A;  4Q47 A;  4OIQ F;  5E17 F;  2ZNZ A;  1FSH A;  1IZ1 A;  5F1R A;  5A2Q K;  4NHJ A;  5BPD A;  3GO5 A;  4RGX A;  1SMT A;  2HKO A;  1X3U A;  2M87 A;  1R36 A;  3K69 A;  1MGT A;  5JFR A;  3N97 A;  3WTU C;  1RIO H;  4S04 A;  4I0B A;  3V4G A;  5J6X A;  4BQA A;  2HOE A;  2CFX A;  2X0L A;  1ZGJ A;  3FWE A;  1XB4 A;  2LNB A;  2W24 A;  1U5T C;  1R5G A;  1A04 A;  1Z9C A;  2JT1 A;  4IHT A;  3ZN0 A;  2HYF A;  2EB7 A;  3E6M A;  2GXG A;  3RPU A;  3GZ6 A;  4CHU A;  1XSX A;  3IWF A;  4Q5S F;  1LQ1 A;  3I58 A;  4XLP F;  4HLX A;  2DPU A;  1SD6 A;  3M8F A;  3DXJ F;  3V7C A;  2OZ6 A;  1YW7 A;  3H3U A;  1QZZ A;  2KKO A;  2HGC A;  1YLF A;  3WE3 A;  2FBH A;  4L18 B;  4S05 A;  1GHC A;  3G3Z A;  1Z6R A;  2QUF A;  3GYH X;  2YR2 A;  2QLZ A;  1U6G A;  2PEX A;  4FHT A;  2JPC A;  3WOD F;  3I53 A;  3W6J B;  3MWM A;  2LF8 A;  2E1N A;  4ETS A;  4MTE A;  5K5Q A;  4H0E A;  1UST A;  1SD7 A;  4KN4 X;  3QU3 A;  2BE5 F;  2QQA A;  4WXD A;  2Y75 A;  3TKY A;  5LRR A;  5CVI A;  3FXR A;  2GIV A;  4UV9 A;  2UWM A;  4A6D A;  5DDG A;  2JZY A;  2NNN A;  1QGP A;  1B9M A;  1ON2 A;  3V7S A;  2PLY A;  3LA2 A;  1BIB A;  4PCQ A;  3F72 A;  2IVM A;  4KIC A;  2Z33 A;  4ASN A;  4M9S A;  5D5W B;  1FYL A;  2QQB A;  4JQF A;  3RYR A;  4IVN A;  3QOP A;  2O6G E;  4U7D A;  5E1Z B;  5D5V B;  3E6B A;  1I1G A;  1BI1 A;  1FP1 D;  4ESJ A;  5D8L B;  5DCM B;  4ESB A;  2NS0 A;  2X4H A;  3LFK A;  2G7H A;  2COM A;  3U1D A;  4R8H A;  2L3D A;  3TQN A;  4EMS A;  2PG4 A;  3L7W A;  1HW5 A;  4GGG A;  5CVR A;  3BPV A;  3IL2 A;  3FHZ A;  3CJN A;  5JVT A;  3HRT A;  3G73 A;  2DPD A;  1W7P B;  4I98 B;  3CO6 C;  3HRM A;  3K1N A;  2Z5U A;  4A5M A;  1P4A A;  4HX7 A;  5HOO A;  5FO5 A;  5KVR A;  3REO A;  4K2E A;  1SD4 A;  1TW2 A;  4G94 A;  4WWC A;  1S7A A;  3BJO A;  2LKP A;  3KZY A;  3F23 A;  1K7A A;  1UB9 A;  3QP5 A;  5E8I A;  4PZJ A;  2DFI A;  5DD4 A;  3J7A O;  3VOE A;  5H20 A;  2FU4 A;  2K7L A;  4IPA A;  3HOT A;  5L3C A;  4M72 A;  4RGU A;  1O3Q A;  1JHH A;  1FYM A;  2J5O A;  3ULQ B;  1IN7 A;  4UXN A;  1JXS A;  2R7F A;  3BWG A;  5ILU A;  3GLX A;  4MEY F;  3KP6 A;  4DQ2 A;  1SAX A;  5ILS A;  3K1P A;  3GEZ A;  2XUB A;  3BOQ A;  1RZ4 A;  3QP6 A;  2MH9 A;  4LG0 B;  2V6C A;  1ZYR F;  5FLX Z;  3FM5 A;  4D0P A;  2EV5 A;  1HW1 A;  1ZH5 A;  3FXQ A;  4L0Z B;  2P5K A;  3TO9 A;  4HF1 A;  3PFI A;  2GXB A;  3R61 A;  1TQM A;  3IKT A;  1H9G A;  5J8C A;  1S3J A;  2D2W A;  3I54 A;  2GA1 A;  4ZH4 F;  2YX4 A;  1KU7 A;  4MQV A;  3M9A A;  1IW7 F;  2ZBK A;  2VC0 A;  4WK8 F;  3RTR A;  2F5E A;  4OIN F;  2QWW A;  1IN8 A;  4UHT A;  3GFI A;  3DF8 A;  4N9I A;  5FFX A;  2ZFW A;  2JTV A;  3IHU A;  4A0Z A;  5CVV A;  1I5Z A;  4RB3 C;  1O57 A;  1WI9 A;  3KP4 A;  3BDD A;  1Z7U A;  3MZH A;  1B1B A;  2YSR A;  4UNO A;  2A07 F;  1F9N A;  1IAW A;  2FE3 A;  4L9V A;  4QLC U;  2GZW A;  3ISP A;  3TDZ C;  2DK5 A;  1G3T A;  2XV4 S;  1XGS A;  5HLH A;  1WRJ A;  4ESF A;  3DP7 A;  4BXU A;  2RQP A;  2DTR A;  1BC8 C;  2STW A;  2FML A;  2IT0 A;  4UVA A;  1W7P D;  2MLK A;  2K4B A;  3FZV A;  4B09 A;  2ESH A;  3R4K A;  4IRH A;  4HV5 A;  5D6F A;  1QZY A;  2EK5 A;  4OOI A;  3B73 A;  3K2Z A;  3SZP A;  3KEO A;  6PAX A;  3N4M A;  3HRS A;  1FZP B;  3RIR A;  1IXR C;  4GYI A;  4RB2 C;  4ZYG A;  3OV8 A;  4CZZ A;  3GW2 A;  4U0Y A;  1LEA A;  3QU6 A;  2HWV A;  4M9Z A;  1U2W A;  2P5L C;  2ZME B;  2DQL A;  3I0T A;  2VOO A;  3ZMT A;  4NB5 A;  2PMU A;  2ZXJ A;  1REP C;  2ACJ A;  3ERE D;  1CGP A;  1PUE E;  3EET A;  1W5S A;  2IA0 A;  2BYV E;  5DCM A;  4EV0 A;  4CGZ A;  4YII A;  1XCV A;  2JSC A;  3T1B A;  2QBY A;  2MBF A;  1FY7 A;  1OYY A;  2EA2 A;  1LDJ A;  3I4P A;  2HR3 A;  1LB2 A;  3U9G A;  1B4A A;  1D8K A;  4A0Y A;  5LGT A;  2FOK A;  4KIG A;  4CIC A;  3FXU A;  4LK1 F;  2JRT A;  2HTS A;  1TBX A;  3C18 A;  5LLQ A;  3B02 A;  1J7K A;  3TOB A;  4AD9 A;  1B9N A;  4CXF A;  4P96 A;  1T6S A;  2VC1 A;  4GYG A;  4P9U A;  5E1X A;  2QZ8 A;  3WTV C;  2VT2 A;  1T2K A;  5FLX K;  4UV8 A;  1IN6 A;  3WTX C;  3ZP5 A;  5FB2 A;  2P5V A;  2VN2 A;  3VEP A;  2RVC A;  2Q0O A;  2PN6 A;  4OIR F;  4XRF A;  3TO7 A;  5D8K B;  3RI4 A;  1LDD A;  5HDK A;  4Z2Y A;  1XDU A;  1Z1D A;  5FFZ A;  5LHG A;  1TTY A;  5F64 A;  1PP8 F;  3E5Q A;  4O3M A;  4MHG A;  1KQ9 A;  3K1M A;  4L9T A;  1PP7 U;  1K79 A;  3ZMZ A;  3KEQ A;  2WC2 A;  3GVA A;  1XN7 A;  1GVJ A;  5CVU A;  3MQ0 A;  5TJJ A;  5E18 F;  4KMU X;  1P6R A;  5BPI A;  2RC4 A;  2MLG A;  1Z6T A;  3CUQ C;  2HDC A;  5D5U B;  2WTE A;  4EJV A;  3HUG A;  1J75 A;  2E7W A;  4EM1 A;  3EQL F;  1USS A;  2A61 A;  1R00 A;  1BN5 A;  1E17 A;  1EH6 A;  1ZAO A;  2H27 A;  5FGM A;  1XDS A;  1KQ8 A;  1HW2 A;  1R1V A;  2L54 A;  2AS5 F;  4HQE A;  1SD5 A;  1PDN C;  1O7L A;  5L3G A;  3EDP A;  3HOS A;  2DW4 A;  2O03 A;  2IJL A;  3ZN1 A;  2H6B A;  3P9C A;  2TDX A;  2L02 A;  3PQK A;  4JBA A;  4CYD A;  2YU3 A;  1YG2 A;  1O3R A;  4RB1 A;  1U3E M;  1KYW A;  1FT9 A;  4E70 A;  3GF2 A;  4HW0 A;  1HST A;  4Y15 A;  5ICF A;  3DFG A;  4LD5 A;  5AIQ A;  3JTH A;  4EJT A;  2VBX A;  3RDI A;  5L3B A;  1BIA A;  1U5T B;  5LBQ A;  3BJ6 A;  1ZGA A;  4KMF A;  3IRR A;  1ZLK A;  3R6S A;  4HF0 A;  1FLI A;  2STT A;  2P8T A;  2XAH A;  4LK0 F;  3JSP A;  2VOD A;  3LAJ A;  1HKQ A;  1YW9 A;  2CG4 A;  4I02 A;  5CYV A;  3E6C C;  2R3S A;  4EJO A;  5L3D A;  2K86 A;  1TLH B;  4ENJ A;  1S29 A;  2HQR A;  2V9V A;  2OQG A;  3F8M A;  4KA4 A;  1TQP A;  1D5V A;  3EYY A;  3ZMV A;  5L3E A;  4G6Q A;  5ICE A;  1QQI A;  3ZQ7 A;  1STZ A;  2F2E A;  1RI7 A;  4OU0 A;  5LEK A;  1ZRE A;  1ULY A;  1RUO A;  4ENK A;  1V3F A;  1Z05 A;  3V8L A;  3WGG A;  4HQM A;  3RJP A;  4DNC A;  2CWE A;  4EQQ A;  1G6N A;  1FBU A;  3J81 Z;  4U0V A;  3V8J A;  2IW5 A;  1CF7 A;  5ICG A;  4KIF A;  3CUO A;  2V79 A;  4HZF A;  1XCB A;  2HKX A;  2XGX A;  4FX4 A;  1ZG1 A;  1QBJ A;  1LJ9 A;  4Y17 A;  1DPU A;  1OYW A;  2ISZ A;  4P55 A;  2ZME A;  3I59 A;  4A12 A;  5HLI A;  2K4J A;  4RS8 A;  3ZPL A;  2XAJ A;  3KP7 A;  2P4W A;  4TV7 A;  1YTY A;  1FBQ A;  5D5X B;  2P6T A;  1G3S A;  1FOK A;  4I09 A;  1I1S A;  1R1T A;  1XD7 A;  2FXA A;  2DT5 A;  4FX0 A;  5DV5 A;  4AIH A;  3P9I A;  4Q4Z F;  3T5X A;  1MDM A;  2QQ9 A;  1KA8 A;  4IF4 A;  3K9T A;  5E1W A;  1JE8 A;  3SFZ A;  3I71 A;  1MZB A;  2HS5 A;  3C3W A;  2D1V A;  3HHG A;  3E5U A;  1DDN A;  1BC7 C;  1C0W A;  5HS9 A;  3LWF A;  2FF4 A;  4BAY A;  5LGU A;  2FQ3 A;  3E97 A;  1MJA A;  3F8B A;  3I5U A;  2QM3 A;  4M74 A;  1FWZ A;  1AWC A;  3ECO A;  2P7V B;  2OA4 A;  5L3F A;  1DPR A;  4EGY A;  1J59 A;  4IRG A;  2M45 A;  1IXC A;  1D8J A;  4KUM A;  1XMK A;  3I64 A;  5AIP A;  1R5H A;  4GCV A;  2FNA A;  1IF1 A;  2WV0 A;  2RDP A;  1YIO A;  1LVA A;  1MKM A;  3NEU A;  4LLG F;  4N9H A;  2XKO A;  2FSW A;  4WXH A;  1BI0 A;  5D6E A;  3LAP A;  3RKX A;  1KYZ A;  3R0A A;  1FSE A;  3GFL A;  2HTJ A;  3E5X A;  4L0Y B;  2DBB A;  1Q1H A;  3WTZ A;  4I01 A;  3L09 A;  5D4S A;  2ZJ2 A;  5DD8 A;  2ZKZ A;  3KLO A;  2DQR A;  2R7D A;  2JPB A;  5JHU A;  4YFX F;  3CDH A;  2KIM A;  1GXP A;  2LDU A;  1MJ9 A;  3VFZ A;  1W4M A;  2DAO A;  1FP2 A;  4HAM A;  3R60 A;  3W6K B;  2BV6 A;  4NQW A;  3KFW X;  5J8F A;  4LLL A;  5HLG A;  3GWZ A;  4WF2 A;  5CLS A;  4N0B A;  2O3F A;  1TNT A;  1BI3 A;  3Q9V A;  4LFU A;  4AWX B;  3GFM A;  2UXX A;  3QPT A;  3HYI A;  1I6X A;  5LGN A;  2FNP A;  2V1D A;  2VON A;  2MH2 A;  3L2C A;  1LNW A;  2PMH A;  3FMQ A;  4AVP A;  3J81 K;  5DEQ A;  1JGS A;  2QEN A;  4ENM A;  1Y0U A;  4M9X A;  1V4R A;  3WU0 A;  1L3L A;  3FF5 A;  1VTN C;  5EEH A;  5ICC A;  2FA5 A;  1QPM A;  1P4W A;  2H09 A;  1P4X A;  2FEZ A;  4ZYD A;  2OQR A;  2Y0M A;  1K78 B;  3V7R A;  4A0X A;  1GXQ A;  2CGP A;  4BHC A;  4HX8 A;  1BM9 A;  4EVI A;  2PBI A;  2XRO A;  5K5O A;  3FMS A;  3GXO A;  2FMY A;  1OKR A;  4RAZ A;  3BP8 A;  1YO5 C;  4OIO F;  1R58 A;  4BH9 A;  5ERI A;  3WTS C;  3DPT A;  5K1Y A;  2XAS A;  2F5C A;  5K5R A;  3KCC A;  1R7J A;  4Q48 A;  4EM0 B;  2A5Y B;  2FBK A;  5BOX A;  3H3Z A;  3D5L A;  5DYM A;  2RV8 A;  1G3W A;  1MJB A;  1F4K A;  1IN5 A;  1KU2 A;  3LA3 A;  1T38 A;  3DEU A;  5CJ9 A;  2XAF A;  5HVQ C;  1XGN A;  4RGR A;  1J2X A;  1TQI A;  2A3S A;  3KET A;  4AIJ A;  2XIG A;  4L9N A;  1YYV A;  2M5W A;  3RKY A;  1J9I A;  2QVO A;  3RYP A;  2Y48 A;  5DCF A;  4WCG A;  3ZMD A;  3P9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...