4MNUA

Crystal structure of uncharacterized slya-like transcription regulator from listeria monocytogenes
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
AMKDILRDIGVIARALDSISNIEFKELNLAKGQFIYLVRICENQGIIQEKLVDILKIDRTTASRAIKNLEKNGLIIKKQNKNNKKNKLLFPTEKGQQLYPLIIRENEYSNAVALKGFTEAEINMLTDALKKVKENIADDWLYVKKGNKRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uncharacterized SlyA-like Transcription Regulator from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
molecule keywords SlyA-like transcription regulator
total genus 53
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mnuA00
1U78A 4ON0A 1O7FA 5JVTA 4BXUA 5ERIA 2IRFG 3P9CA 4PGHA 1XMAA 3ABTA 3R0AA 4ASNA 1IXRC 3ML6A 2ZMEA 2HZTA 3F8FA 4IHTA 5JI6A 1D8KA 2ELHA 5D4RA 1I1GA 1R5GA 3LWFA 4YFNF 2CYYA 5ED4A 3PQJA 5L3GA 3TDZC 5AIQA 1GXQA 2CSOA 1W7PA 2UXXA 3WTYC 5J6XA 2A6EF 5LHHA 4LLLA 3ABUA 4WF2A 3F8BA 1B1BA 4I0BA 3J81Z 1U3EM 3MCZA 1U5TA 3M8EA 5LRSA 2XAJA 4WCGA 4E70A 4LB5A 1USTA 4JBAA 2ZNZA 1E17A 1BIBA 4LLGF 3L00A 1T38A 3H3ZA 5DCMB 3JTGA 1I1SA 4LK1F 1BC8C 4QWQA 3M1EA 2GA1A 3K9TA 1IF1A 3ULQB 2XKPA 2P5KA 4UXNA 1DP7P 2OZUA 2MD5A 4EJOA 1FZPB 5H6QA 4CICA 4Q5SF 1TTYA 1TW2A 1W5SA 5LGTA 2IJLA 4AVPA 4EM2A 4A0XA 1BI0A 3ELKA 3RDIA 1S6LA 1I6XA 1HSTA 3GX4X 2D1VA 2D45A 5TRDA 1Y0UA 1UHWA 3RJPA 4LFUA 4KIGA 3KLOA 1HW5A 3U1DA 2OQRA 5EEGA 4G6QA 2VOPA 2P6TA 2FXAA 4MTDA 1HXDA 4LJZF 1Z1DA 3GZ5A 1T6SA 2EA4A 3FM3A 4HX4A 5IT9Z 4G7HF 2GQQA 2RDPA 1VTNC 4MHGA 1BI1A 3WGGA 2YX7A 3DF8A 1G3WA 1IW7F 4RB3C 1RUOA 2MA3A 3WODF 1J2XA 2L01A 1DUXC 4YG2F 4I02A 2F5FA 1C0WA 4DNCA 1YLFA 4CHUA 4IHSA 2DO7A 1WRJA 5L3EA 1YQAA 2GWRA 1A04A 2FQ3A 1YS6A 1G3YA 3RIRA 1EH6A 4IRIA 5A2QZ 1B9NA 1DPRA 3BP8A 4CDGA 3LA2A 3D0SA 3HRTA 2O3FA 1ZG3A 2TDXA 1MD0A 4GXOA 5A2QK 3CTAA 2GXBA 3HRUA 3BY6A 3DXJF 5BOXA 4RGUA 4LG0B 3BDDA 2BGCA 3ZMUA 2VBYA 2QM3A 3QRFF 2HGCA 3MZYA 3R61A 1TQMA 3G3ZA 1B9MA 2W57A 3EYYA 3LSTA 3W6KB 2Z99A 1MJAA 5DCFA 4ZYDA 3L7WA 3GW2A 4EJTA 3LA3A 4O3MA 1YW9A 1BOAA 2JZYA 1T0FA 3ZP5A 4HLYA 3HUGA 1F9NA 1JGSA 3ECHA 5ILSA 4A0ZA 1YW7A 4XLPF 2ZNYA 4HF1A 2BV6A 1UB9A 4L9TA 2DK8A 1O7LA 2O8XA 3GUDA 2A61A 4M9XA 5L3CA 1Z05A 4LG0A 1TNSA 2EA2A 4L5JA 2R7FA 1GXPA 4RGRA 2ESHA 5ICFA 4B8XA 3FXQA 1S7OA 3QU3A 4ZZDA 1I27A 2YX4A 4PGGA 3QOPA 3T8RA 1QZZA 1HBXG 2DU9A 1BI2A 3I5UA 2CW0F 3E6MA 2NNNA 1W7PD 3GEZA 3VEPA 4MNUA 4HZFA 5CVJA 3LA7A 4RGSA 3GXOA 3TQNA 2A07F 5LGUA 1FBUA 3M8FA 4IRGA 3ZMDA 2A3SA 4Y17A 4MEXF 4Q4ZF 3I54A 1J0RA 5DD8A 1TQPA 2FOKA 2VODA 1AOYA 1F1ZA 5HDNA 3FZVA 2UXNA 5J8CA 1IUYA 4UVCA 5FGMA 1WWXA 4L0YB 4HF2A 1FP1D 1O57A 1HW1A 3DP7A 2VT3A 2PFBA 3V8JA 4L9NA 3OV8A 1R00A 2F5DA 2HKXA 2VT2A 3DPLC 1J7KA 2FNPA 2M5WA 1HSJA 5AONA 3E97A 4PZJA 5E8GA 3NEUA 3QAHA 4F7ZA 3B02A 3HRMA 1XMKA 3CUQB 1ZG1A 2F5EA 2IVMA 3WGHA 4NHJA 3HHGA 4M74A 4NB5A 3FX3A 3FHZA 3BROA 3HSFA 1MJ9A 5K5OA 1E2XA 1U8RA 1S29A 3QU6A 4UHTA 1PUEE 2EFNA 1ZHFA 1R1UA 2IP2A 4RS8A 2PG4A 3L9FA 4EGYA 1ZRDA 1ZLKA 2Z3YA 5LRRA 2STTA 3ROUA 1RNLA 4ZYGA 1EH7A 1XSXA 1ZYRF 4IF4A 4H0EA 3TKYA 2FF4A 4XSZF 1XB4A 2V1DA 1R58A 3F23A 2AS5F 3O2PE 2XRNA 4AIHA 3T1BA 2D1HA 2JPBA 3PQKA 3OOPA 1SFXA 2OA4A 3DV8A 4Q47A 3WTZA 2J5OA 1K79A 4R1HA 1T2KA 1KGSA 1KQ0A 1MKMA 1TNTA 1LDKB 3L09A 4BYYA 3IRRA 3HTUA 1FYLA 2H09A 3R60A 3KFWX 3DKWA 2O03A 4YIIA 5E1XA 4AIKA 3P7NA 1W7PB 2UWMA 1G3SA 3Q9VA 4KUMA 2BEOA 4PDKA 1OKRA 1IN7A 1LDJA 2RGVA 1KQ9A 2ZXJA 2NAZA 1ZAOA 1WKMA 2IW5A 4ZYHA 3Q5FA 2BE5F 4EMSA 1LDDA 2FBHA 3I59A 2CFXA 3KP5A 1BBYA 1BN5A 2CG4A 1ZLJA 5H6RA 2L02A 4U7BA 2HFHA 2QWWA 4G6DA 4HLXA 4KMFA 3K1PA 2ACJA 1KU3A 4I7HA 4P5OA 4KICA 2M8EA 4ENKA 1K78A 2DBBA 4LK0F 4U0VA 2GAUA 3V8KA 2ZMEB 3PFIA 4A6EA 2V1UA 5L3FA 2P4WA 3RYRA 4KMUX 3ZPLA 5L3BA 2H27A 5FLXZ 3RKWA 1F4KA 4BQAA 4R79A 1IXSB 4O5VA 3QP6A 3F8MA 2Q8KA 2CQKA 2PQ8A 2HEOA 4BNCA 5HS7A 1RIOH 2X0LA 4MQVA 3R4KA 5CLSA 2DAOA 1RZ4A 1QNTA 4U0YA 1LB2A 5FFXA 3ISPA 2XKOA 3KZYA 2RN7A 1YYVA 5K5RA 2HDCA 4JK1X 3RKYA 3T5XA 2EFWA 2GXGA 2JRTA 4LLNA 1BIAA 3WTSC 3JTHA 4GYIA 1XSDA 2FBKA 1QGPA 1ZGAA 1QQIA 4EJWA 1CGPA 2RKHA 2E1CA 1FBSA 2K4BA 1TQIA 3F21A 2XUBA 2FEZA 3J80K 5D5XB 3K0LA 3REOA 2A5YB 4CXFA 2VBWA 5FD6A 2W84A 3BPXA 3I64A 1DDNA 1QBJA 2Z5UA 5K1YA 1XGNA 2XAQA 5DUKA 5D5UB 5ICGA 2XROA 1ZG5A 2MH2A 3EETA 1Z7UA 4HF0A 4M71A 3LAJA 4DQ2A 2QZ8A 4RB2C 2HWVA 2E7XA 5HS8A 5FD5A 1S8NA 4HQMA 2O0YA 3DPTA 1HW2A 2WV0A 4ZH4F 3NRVA 4A2UA 3M7GA 1LEAA 1LVAA 3TOAA 1AWCA 3E5UA 2EFOA 2H94A 1XGMA 4HA8A 4JQFA 2LNBA 4KNYA 1EV7A 5E8IA 3GWZA 2IA0A 3O6BB 1IN5A 2PMHA 1YO5C 2MC3A 2WTEA 1STZA 3U2RA 2ZO4A 3CLOA 5LLQA 3GZ6A 1OPCA 3C3WA 3K2ZA 1YG2A 2XAFA 4KYWA 1X3UA 1FOKA 4AWXB 3CUQC 3F8NA 2W85A 4BHCA 4HAMA 4MEYF 2FA5A 2HYFA 1P92A 1ONVA 2EK5A 2QUFA 3CDHA 2A68F 1YS7A 1J59A 2PBIA 1J75A 1T98A 3HOTA 4P96A 2MLGA 2HTJA 1CF7A 3BJ6A 4HW0A 1KYWA 3VOEA 1XDSA 3HRSA 4U88A 4RB0A 2JTVA 3KCCA 3GF2A 2RC4A 4OIQF 3SFZA 3JAMK 5CVVA 2MLKA 2RQPA 4EJVA 2PLYA 2L4AA 2LKPA 5BQTA 3SQNA 1SAXA 2FU4A 4OIRF 3KP3A 3ECOA 2ZFWA 1LJ9A 1BC7C 4A5NA 3CO7C 2P6SA 5CYVA 1FYKA 2X4HA 1ON2A 3F6OA 5FFZA 2AXLA 4LB6B 5TJJA 3BOQA 4HX7A 5L3DA 1U6GA 1BM9A 2DW4A 1HQCA 1ULYA 3SHFA 3KP6A 3CUQA 2L4MA 5DDGA 1KU7A 2Y48A 3COAC 5DCMA 3HOSA 1BI3A 1U2WA 2HR3A 2HTSA 2YSRA 4L9JA 3I0TA 1FSHA 1R7JA 1U5TB 3V8LA 3IRQA 1SD5A 3J80Z 1YTYA 2MBFA 1W5TA 4FX0A 2K02A 3I71A 4ESJA 3GO5A 1B4AA 1IZ1A 1R36A 2OZ6A 5HS9A 2J5PA 4FHTA 1S7AA 3TO6A 5ICEA 4ENNA 2NNYA 3C7JA 1OYIA 3N97A 5J8FA 1LNWA 3I58A 2V6CA 2FBIA 1LEBA 2EWNA 4KIFA 3ZQ7A 4RGXA 3ZN1A 1P4AA 1KU9A 4P9UA 1SD7A 4HDVA 5FO5A 3T0YA 1PDNC 1P6RA 1K78B 1H9GA 5LBQA 1ZRFA 3VB2A 1P4WA 1QPMA 2VBXA 2GZWA 3TO7A 2FMYA 2DTRA 3MQ0A 3NQOA 3E6CC 4CYDA 3EUHA 3KZZA 1FC3A 5HLHA 1J5YA 4Y13A 1BJAA 4P55A 3MFKA 4I0AA 1P4XA 5D8LB 4EQQA 2NS0A 1FWZA 2JT1A 3QPTA 5D5VB 4QLCU 4TV7A 2LSOA 1O3QA 3KP4A 2COMA 1XGSA 4OMYA 5E1WA 4CO8A 4ZZLA 2WWYA 3I59B 3K1NA 3N4MA 1PP8F 4D0PA 1B59A 1YW8A 5CVUA 2IT0A 2E1NA 2BBYA 1JXSA 4WXCA 1MGTA 1U5TC 5ILVA 3IHUA 4G7ZF 5CJ9A 2LF7A 5E20A 3HHHA 4M72A 2QQBA 1ZRCA 1ZREA 3FM5A 2OBPA 2R3SA 4EVIA 3KP7A 2ISZA 4RAZA 1OMIA 3BZ6A 2OAZA 5HLIA 1RUNA 3B73A 1JHHA 3EYIA 3KE2A 5HDGA 4K2EA 3C18A 2EV0A 4ENJA 2QBYB 3FXRA 2RNJA 4I09A 1USSA 4U7DA 3V4GA 5AIPA 2Q0OA 3FMQA 2DLLA 4B09A 1KYZA 2L54A 2A69F 3Q9SA 3TOBA 5DEQA 3TDUC 2EJRA 4FX4A 3LAPA 4S05A 2DPDA 3MAJA 3RPUA 4MTEA 3DQVC 4Y15A 4AD9A 3K69A 1HKTA 2VE8A 3U9GA 4CZZA 5BPIA 1KU2A 1FYMA 5ICCA 2ZJ2A 4UNOA 3WE3A 1ODDA 2YU3A 1I5ZA 3G73A 3T8TA 3GVAA 3ZMVA 2K86A 4I98B 1XDUA 4EV0A 3I4PA 1R22A 2P7CB 2DK5A 1IAWA 2XASA 5BPDA 5CVRA 4GO1A 2IA1A 2CWEA 3RPQA 3ZN0A 1UHMA 1D5VA 2K4JA 2Q2EA 1D3YA 4P9FA 4XBFA 3CO6C 3J81K 4I2OA 1Z91A 1KQ8A 1FX7A 1V3FA 1G6NA 4RAYA 2VE9A 2XAHA 1FNNA 3WG9A 1JE8A 3FWEA 4LMYA 5HDKA 4YIFA 1SMYF 1W4MA 1FBQA 4RB1A 1PP7U 2LDUA 3QPHA 2XGXA 5D6FA 2FNAA 2XV4S 3EQLF 1Z6TA 4ESFA 3WTWC 2FRHA 2QVOA 4L18B 2UZKA 4WWCA 2VXZA 5LGNA 4R8HA 2H6CA 4HDUA 4A12A 5DD4A 5LEJA 2DI3A 1B6AA 2O6GE 3BPVA 3FMRA 4L9VA 5LEKA 2GIVA 3LQRA 3JSPA 4KIBA 3D5LA 2PN6A 4N9HA 3RKXA 2P5VA 5JR3A 4G7OF 2KIMA 4G8XA 4MGRA 4M6XA 5DUIA 2FE3A 2W24A 4A0YA 2ZKZA 5K5QA 2ETHA 2P5LC 4HQEA 2JPCA 3BJAA 5HVQC 1L3LA 4KN4X 2HYGD 1UFMA 2G7UA 1MZBA 5LHIA 1SFEA 2OD5A 1OR7A 3LQQA 2KIFA 2QYOA 1Z9CA 3KETA 4XLNF 2FMLA 4PCQA 5E18F 1T39A 3JSOA 3F8CA 2HOEA 3E6BA 4ESBA 1MJBA 3WTVC 1GHCA 5FLXK 4OINF 1P2FA 1XD7A 3L2CA 3SZTA 3FMSA 2H6BA 4UVAA 1IN4A 1IN8A 4HV5A 2M45A 4KFCA 3H3UA 2G9WA 3WTTC 2F5CA 2HS5A 4OIOF 4CGZA 4MQ9F 4OIPF 3RTRA 3ZMZA 3QP5A 1R23A 1WSUA 5H20A 2F2EA 4BHBA 1TW3A 1ON1A 4YFXF 3WGIA 4EGZA 1D8JA 4UV8A 5F1RA 2Z9OA 3MZHA 1DPUA 1K7AA 1JHFA 3FXUA 4KDPA 3HSRA 1QO0D 3O3KA 2KRFA 2W25A 4I01A 4OU0A 5DYMA 3BJOA 1XN7A 1H0MA 3J7AO 2VBZA 4EJUA 1SD4A 4KT5C 5CVIA 2EFQA 4A5MA 2A6HF 1ZN2A 1QZYA 2P8TA 3GFJA 3HTSB 1GVJA 2CGPA 1WI9A 1RI7A 4O6JA 4GYGA 4HOBA 2V1XA 4U0WA 3LFKA 1WQ2A 2R7DA 5EEHA 1O3RA 4HV6A 2D2WA 4ENMA 3JW4A 4HBLA 3H92A 3KEQA 3VODA 3GFIA 2BYVE 3R6SA 3HSEA 2EV5A 4S04A 5JFRA 2VC0A 3E5QA 1OYYA 3CJNA 3KEOA 2QLZA 4UUVA 3V7SA 1FT9A 2PJPA 3GFMA 3F6VA 2K27A 2KIUA 5IT3A 2G7HA 3WU0A 2O61A 1NHAA 3W6JB 6PAXA 3FF5A 1G4DA 1XCBA 2HQNA 2XIGA 2Y0MA 3V7RA 4IRHA 1Z6RA 2ZCWA 1Q1HA 2E7WA 4Z2YA 2V9VA 2VOOA 3F3XA 2M1BA 4OMZA 4L0ZB 4WK8F 2JSCA 4OOIA 2QENA 4UV9A 4G94A 3JAMZ 5F6FA 1YIOA 2VN2A 1SFUA 5F64A 2K7LA 2OU2A 2LF8A 1OYWA 2L3DA 3HYIA 2PEXA 4WX9A 4HYEA 1J9IA 3WE2A 3IC7A 3IKVA 2M30A 3ZMTA 2KJCA 4LD5A 1FY7A 3IWFA 2RVCA 3RI4A 4BH9A 1V4RA 2M87A 4L5IA 2ZBKA 4GGGA 5D5WB 5KK1A 5D6EA 2DT5A 1IRGA 3WU1B 4IPAA 1FP2A 2EFPA 3ERED 3MEXA 2B0LA 1MDMA 1ZH5A 1REPC 3VFZA 3WTXC 2EV6A 1LQ1A 4GCVA 3GYHX 4N9IA 2NRAC 5BS6A 4M9ZA 2V79A 1TLHB 4N0BA 2C6YA 3M9AA 1H9TA 4WXDA 3TO9A 1ZGJA 5D8KB 2ISYA 3KP2A 5E1ZB 3V7CA 2QQAA 3IWZA 3TGNA 2EB7A 3CUOA 3P9IA 1F5TA 3P9KA 1FLIA 2PMUA 4HX8A 2IPQX 3GLXA 3DEUA 2KJBA 1CF7B 3S2WA 4FT8A 1YFHA 5LHGA 3C1DA 5HOOA 5BMZA 2XHKA 2CO5A 1IXCA 3IL2A 1TBXA 5DV5A 3F72A 3I53A 4A6DA 2DQLA 1O3TA 5KVRA 5HLGA 1ZARA 2Y75A 1KA8A 1R5HA 4M73A 4EM1A 2RV8A 2MH9A 3ZMSA 2KKOA 4IXAA 3SXYA 3E3VA 2GA2A 5ILUA 2QBYA 2Z33A 3WTUC 2HKOA 2HQRA 4WXHA 4BHPA 4XSXF 4AIJA 1XGOA 1SMTA 1IRFA 3F22A 1L0OC 2VONA 2VC1A 2XAGA 4KA4A 4BAYA 2QQ9A 1FPQA 3SZPA 5E17F 5IT9K 1IN6A 2XVCA 1XSVA 4LGWA 1O3SA 3RYPA 4YFKF 1HKSA 1MDMB 1G3TA 2YPRA 3KLNA 2ADUA 4NQWA 2NYXA 1XCVA 3GFLA 3IKTA 2WC2A 4XRFA 3R0JA 2STWA 4KN7X 2PI0A 2DQRA 1UCRA 3HIFA 4EM0B 4ETSA 1FSEA 3DFGA 3K1MA 4ZYEA 3E6DA 3EDPA 1HKQA 2DPUA 5JHUA 2DFIA 3AAFA 1EH8A 2FSWA 4M6YA 5D4SA 3BWGA 2OQGA 4IVNA 2P7VB 2IA2A 4IJAA 1SD6A 3E5XA 4G9YA 2ESNA 5FB2A 2YR2A 3MWMA 1K6OA 1R1VA 1R1TA 1S3JA 4UVBA 4M9SA 4Q48A
chains in the Genus database with same CATH superfamily
1U78A 4ON0A 1O7FA 5JVTA 2IEKA 4BXUA 5ERIA 1K61A 2IRFG 3P9CA 4PGHA 2H8WA 2LVSA 4RAFA 1XMAA 3ABTA 3BZCA 3R0AA 4ASNA 3K2AA 5EF6A 5FLMJ 2WBMA 1IXRC 3ML6A 2ZMEA 2HZTA 1JUMA 5IYBJ 3F8FA 4IHTA 4UB8C 5JI6A 1D8KA 2ELHA 4B44A 3HKZN 4BU2A 5D4RA 1I1GA 1Z3XA 2L9RA 3MVPA 3QYBA 1R5GA 3LWFA 4YFNF 2CYYA 4XMYA 2Z2SB 2V4JC 5ED4A 3PQJA 4NQWB 5L3GA 3TDZC 3S14J 5AIQA 1GXQA 4Y52J 2CSOA 1IDZA 5B1BH 1W7PA 2UXXA 4I6ZA 2XSJC 5J6XA 2A6EF 3WTYC 5LHHA 4IL6C 3I56I 4LLLA 1QA6A 3ABUA 4WF2A 1QVTA 2GXAA 2X85A 3F8BA 2W4SA 1B1BA 4I0BA 1FTTA 3J81Z 1U3EM 4BE1A 3LSKA 4B3XA 1WFXA 3MCZA 2X48A 1U5TA 3G4SI 2V9KA 3M8EA 1JKRC 1TP4A 5LRSA 2XAJA 4WCGA 4E70A 4LB5A 1USTA 2IS4A 4JBAA 2ZNZA 2ECBA 3S1QJ 1E17A 1BIBA 4LLGF 1WJBA 3TEDA 2KFDA 4PJ0C 3L00A 2CMPA 3BQZA 4DOZA 1T38A 3H3ZA 5DCMB 3JTGA 1I1SA 4LK1F 1BC8C 3HDDA 4AYBA 4BXFA 2VLAA 3S93A 1SFKA 2FJ1A 4QWQA 3M1EA 2OCEA 3ZQFA 2GA1A 4PJLA 4BACA 1VQMI 1GDTA 3K9TA 2GIZA 3L2VA 3HKZA 1IF1A 4IKFA 2R7SA 3ULQB 2XKPA 4A69C 1MBHA 2P5KA 4UXNA 4A3GJ 4QSHA 1DP7P 3DU5A 2OZUA 2ZXWH 2L9VA 4RA2A 3HGYA 2MD5A 4EJOA 3K4KA 2HYJA 1FZPB 5H6QA 4CICA 4Q5SF 3S32A 3VDXA 2L0KA 1LFUP 2EQRA 1B72B 3OIPA 1TTYA 1TW2A 1W5SA 2KDOA 5LGTA 2IJLA 4AVPA 4EM2A 4HNUA 4A0XA 3AG3H 4E7JA 5KNLA 2VJJA 1BI0A 3ELKA 3RDIA 1W0UA 1JJ6C 4CH7A 4JX5A 1S6LA 3RZDJ 3G2BA 1I6XA 2IS2A 4MIMA 1HSTA 4DBRA 4NNJA 3GX4X 2CS3A 2D1VA 2JJ7A 2HPMA 2D45A 2VKDA 4CYCA 1F36A 5TRDA 1Y0UA 4NUBA 4Y4RA 1UHWA 3RJPA 4Y7NJ 4ZDLA 3MKYB 4LFUA 2CUZA 4ANJA 4KIGA 3KLOA 2VQGA 1HW5A 3U1DA 1OISA 2LLKA 2OQRA 3LMMA 4E7KA 2O8KA 5EEGA 2DODA 4G6QA 2VOPA 2P6TA 2FXAA 4MTDA 1HXDA 3LSJA 1MBKA 3AKZA 1ZR4A 1GT0C 1MMGA 4LJZF 5IP7J 1Z1DA 3H5NA 1NK3P 3GZ5A 1T6SA 2EA4A 1TT0A 4YEJA 1TWHJ 3CCJI 3FM3A 2HI3A 4HX4A 3BR6A 3VYTB 3VYSB 2R7QA 5IT9Z 2AHQA 4G7HF 1XTAA 2O9LA 2GQQA 2RDPA 3H5AA 2DA5A 3QPLA 1VTNC 4MHGA 4E7SA 1BI1A 5GPAA 3WGGA 2YX7A 3S15J 3DF8A 1G3WA 4XRSG 1IW7F 1MH3A 1WPKA 4RB3C 1RUOA 2MA3A 3WODF 1J2XA 4C9YA 2W48A 2L01A 2R0QC 1DUXC 1APLC 4NC7A 4YG2F 1A35A 4I02A 3LSMA 2F5FA 1C0WA 4IHVA 4PJJA 4DNCA 1RR7A 1YLFA 2KZVA 5JLXA 4CHUA 4IHSA 2BHZA 4AYBN 1OCRH 1VQ9I 3KYDB 2M4GA 2DO7A 1WRJA 5L3EA 2LY2A 3NAUA 3OR1C 1BR2A 1Q1VA 1X1PA 2BY1A 2B63J 3AL0C 3IH3A 1PYVA 1YQAA 2GWRA 1A04A 3RKQA 2FQ3A 1YS6A 1G3YA 2CQQA 3RIRA 1EH6A 4IRIA 5EJCA 2MYSA 5A2QZ 1B9NA 1DPRA 4JYKA 3BP8A 4CDGA 3LSPA 1WJCA 3LA2A 4U87A 4QIWN 1Z0XA 3ZGKA 5GAGJ 4BJ5C 5B5EC 2YU9J 3D0SA 3HRTA 3CF5F 4A3KJ 1SEUA 2O3FA 1ZG3A 2TDXA 3CZ6A 1WJAA 1MD0A 4GXOA 5A2QK 3CTAA 2GXBA 3JRIA 3HRUA 3BY6A 3DXJF 1TL8A 5BOXA 3BCBA 4RGUA 4LG0B 3BDDA 2BGCA 2I10A 2VBYA 3ZMUA 5KCMA 2QM3A 3QRFF 3O8GA 4QPQA 5IY5H 2HGCA 5EYRA 3MZYA 1PUFB 3R61A 5EGOB 1TQMA 2CUJA 3G3ZA 1B9MA 2W57A 3EYYA 4XLFA 3LSTA 3W6KB 4M6VA 2Z99A 1N25A 1MJAA 4BL0B 5DCFA 3M1CA 4ZYDA 3L7WA 3GW2A 4EJTA 3LA3A 3SZGA 3FXLA 2Y9ZA 4O3MA 1HC8A 1YRNA 1MMAA 1IO2A 1MIJA 1YW9A 4IQ4A 1SC7A 2DOFA 1BOAA 2JZYA 1T0FA 3FKIJ 3TP0A 4F3QA 3ZP5A 4HLYA 1AU7A 3HUGA 1F9NA 1JGSA 1R49A 5M3FJ 3ECHA 5ILSA 4A0ZA 1YW7A 5C4JJ 4XLPF 2ZNYA 4HF1A 3CJTB 1X2MA 2BV6A 1UB9A 1OCCH 4L9TA 4XRMA 1X1AA 2DK8A 3VYUB 1O7LA 3A01B 2O8XA 3GUDA 4ABZA 2A61A 3BTJA 3OS2A 4M9XA 5L3CA 2HXIA 1NG7A 1Z05A 4LG0A 1TNSA 2EA2A 1D0XA 3G1LA 4L5JA 2R7FA 3N05A 4RM2A 2NOGA 3S3NA 1GXPA 4RGRA 2XRLA 2CH0A 1Y56A 1NTCA 2ESHA 2L5QA 4MLOA 5ICFA 4B8XA 1P7IA 2PMZN 3FXQA 1S7OA 2OJED 3QU3A 4ZZDA 2CW8A 2CV1A 4AUXA 5FJ8J 1I27A 1V55H 2YX4A 2K3FA 3B6CA 1MSFC 4PGGA 1X1BA 3QOPA 3AL0B 3T8RA 1QZZA 3H9GA 3M3YJ 5IPAA 1HBXG 2DU9A 4C2UA 1BI2A 2LMDA 3I5UA 3OYKA 2PJRA 3D5RC 2CW0F 3E6MA 3U21A 4XK4A 2NNNA 3LOCA 1W7PD 3GEZA 3VEPA 4MNUA 4HZFA 5CVJA 2CU7A 4BS9A 2R7TA 1A31A 3LA7A 1B72A 3HEFA 2FQ4A 3ONQA 4FE7A 3A0BC 4RGSA 3GXOA 3TQNA 5KHDA 1RESA 2XPVA 2A07F 3KX2A 5LGUA 1Z3YA 1FBUA 2GBYA 3A01A 2DT7B 3RPUD 1R6RA 2E2HJ 3M8FA 3K4MA 4IRGA 4RLQA 3ZMDA 2PJRB 4UB6C 2Y2ZA 2A3SA 1MMNA 4M3EA 4Y17A 4NC6A 4MEXF 4Q4ZF 2K5CA 3I54A 2MFZA 3X2QH 3ZQHA 1J0RA 5DD8A 2ZC2A 2LOOA 1TQPA 1ETYA 2FOKA 2VODA 1AOYA 1F1ZA 5HDNA 4A3DJ 3FZVA 1S9HA 2UXNA 5J8CA 1IUYA 4UVCA 5FGMA 1WWXA 3VPRA 3ABKH 4BJTA 4L0YB 4HF2A 1FP1D 4P1WA 1O57A 1HW1A 2KPMA 3DP7A 2F5VA 2VT3A 2PFBA 2V7FA 2LBFB 4AC0A 2W00A 3V8JA 1X4OA 1WVRA 4L9NA 3OV8A 1R00A 2F5DA 3OYHA 1G2HA 2BY3A 2HKXA 2VT2A 3S1RJ 3DPLC 1J7KA 2FNPA 2M5WA 1HSJA 5AONA 4PSXA 1E3PA 3S17J 3A03A 3JRDA 3E97A 2E1MB 4PZJA 5E8GA 3NEUA 3QAHA 4RM3A 4F7ZA 3GTMJ 1TWCJ 3KEYA 3EUKL 3B02A 1UG0A 2VKVA 3FDYA 3HRMA 2VJ5A 1XMKA 3CUQB 4ZYAA 2WAQN 5TGTA 2AQEA 1ZG1A 3H36A 2F5EA 2IVMA 5IP6A 1WJ5A 3WGHA 3PIPF 4A3IJ 5E3NA 1RRJA 4NHJA 3HHGA 5CKTA 2DT6A 4M74A 4NB5A 3FX3A 3FHZA 3BROA 3HSFA 2MABA 1W1WE 1K6YA 1MJ9A 5K5OA 2Z1DA 1E2XA 5LFAA 1U8RA 3LNQA 2NVQJ 1X3WB 2IAIA 2CV2A 4E4HA 1S29A 3QU6A 4UHTA 1PUEE 2EFNA 3H9QA 1ZHFA 3JRCA 1R1UA 2IP2A 3HOUJ 2DMQA 4RS8A 2O7OA 3TW6A 1T08B 1GUUA 2PG4A 3L9FA 4EGYA 1ZRDA 1ZLKA 1KONA 2Z3YA 2X1CA 4D7MA 3FXMA 1ERDA 5LRRA 2STTA 3BR3A 1ITYA 4IOAF 3ROUA 3DTIA 4MFEA 2JSPA 1BOBA 4CCMA 5C4XJ 1RNLA 4ZYGA 2KHMA 1EH7A 1XSXA 2NVTJ 1ZYRF 4IF4A 1VQ7I 3HOZJ 1OCTC 2V6EA 4H0EA 3TKYA 5J3LA 2FF4A 3H0DA 4XSZF 3SDBA 1JUSA 2DN0A 2EILH 3OYCA 5GPCA 1XB4A 2F6CA 2EZLA 2V1DA 2LY9A 1R58A 2ELJA 2KISA 3F23A 2AS5F 3O2PE 1JTXA 2XRNA 4AIHA 1UAAA 3T1BA 2D1HA 2JPBA 3PQKA 3OOPA 1SFXA 2OA4A 3DV8A 4Q47A 3WTZA 2J5OA 1K79A 4R1HA 4PFOA 2PX9A 5H2FC 1T2KA 3HB9A 1KGSA 1KQ0A 1MKMA 1TNTA 4A3CJ 1LDKB 2ME6A 2X6WA 3L09A 4BYYA 2CFOA 3IRRA 3HTUA 5JLWA 2CQ7A 1FYLA 2H09A 3R60A 2JMWA 3KFWX 3BZKA 4FISA 2F4MB 2E5NA 3DKWA 2O03A 1HCRA 5F1JA 4YIIA 5E1XA 4AIKA 1HLVA 3OS0A 3P7NA 4XN0A 5J4VA 2EZIA 3S1NJ 2L7KA 1W7PB 2UWMA 1WJFA 1G3SA 4LIVA 1VQ6I 2Y0SA 3Q9VA 3OYMA 4KUMA 4CZCA 2BEOA 4PDKA 3ZXSA 3K4LA 2BVMA 1N78A 3PUFA 1OKRA 3I4MJ 1IN7A 4DIQA 4V19K 5HNHA 1YJ9I 3BTCA 3H3VK 1QRYA 1LDJA 2RGVA 4J01A 1KQ9A 2ZXJA 3I4NJ 2NAZA 1ZAOA 1VI0A 1XG1A 1WKMA 2IW5A 4XOTA 3SEQA 4ZYHA 3Q5FA 4A3LJ 2LP0A 1U9NA 4GFBA 2BE5F 5F04A 4EMSA 1LDDA 2FBHA 3I59A 2ME0A 3HBLA 3A02A 2IGOA 2IBDA 2CFXA 3KP5A 1BBYA 4D5FA 1BN5A 3MN2A 2CG4A 1ZLJA 1ETXA 2X6XA 1WH5A 1MMSA 5H6RA 2L02A 4U7BA 2HFHA 2XPWA 2QWWA 4G6DA 4HLXA 3K1PA 4KMFA 2ACJA 1KU3A 4I7HA 4Y3OA 4P5OA 2LRDA 4KICA 2M8EA 1Z21A 4ENKA 1K78A 1IV6A 5CPRB 2DBBA 4LK0F 4U0VA 5FKOA 2JA7J 2GAUA 2QKLB 3V8KA 3ZOBA 2ZMEB 2I5UA 3PFIA 4A6EA 2V1UA 5L3FA 2P4WA 3CQZJ 3RYRA 2BVLA 4KMUX 3RZOJ 3ZPLA 5L3BA 2H27A 1Y0NA 2QF7A 3RKWA 2NVUB 3ZQGA 5FLXZ 2EINH 1F4KA 2HOSA 4BQAA 4UY8I 4HNVA 3E7LA 4R79A 1IXSB 3K4JA 3B6AA 4O5VA 2EZHA 3A0HC 3QP6A 4HPQA 2CQXA 3F8MA 3OSGA 2ZSIB 2HDWA 3L1PA 2CW7A 4I99C 3IUOA 3G1OA 4PUSA 2Q8KA 3K70D 1LE8B 2DA6A 2OV7A 2CQKA 5IOYA 1GVDA 2JUCA 2JA2A 2PQ8A 1A36A 2HEOA 2BW3A 4BNCA 1RPWA 5HS7A 1YOVB 1XMXA 1RIOH 2X0LA 1Z7LA 4MQVA 3S16J 2E60A 4DBQA 3J7ZI 3R4KA 1SVOA 2R7RA 1YHQI 1DU6A 2KMUA 5CLSA 2DAOA 4C2MJ 4DYRA 2R5ZA 4BBSJ 5GTIC 1R9TJ 1RZ4A 1VQKI 1QNTA 2KQRA 3VYRB 3MKZA 4U0YA 1LB2A 1YJWI 5FFXA 4XONA 3ISPA 2XKOA 1ZK8A 3KZYA 5LD2C 2WB1A 2RN7A 1YYVA 2KIQA 2HDDA 5K5RA 2HDCA 4JK1X 3RKYA 3T5XA 2EFWA 4QTRA 2GXGA 2JRTA 2XGDA 3RQIA 2UUZA 3CCUI 4LLNA 1BIAA 3WTSC 1EA3A 3FKJA 2IS6A 3DCFA 1HDDC 3JTHA 4GYIA 1XSDA 1AA7A 5BNGA 3TW7A 2FBKA 4JP0A 1QGPA 1ZGAA 1GV2A 5F0HA 1QQIA 3HPGA 4EJWA 1CGPA 2EH3A 2RKHA 2E1CA 1FBSA 2K4BA 1YRNB 1TQIA 2BY2A 3JRHA 3F21A 2XUBA 2FEZA 3J80K 2HOAA 3PSIA 5D5XB 2DYRH 3K0LA 3REOA 2JA6J 2A5YB 3FK6A 4CXFA 2VBWA 2VL8A 5FD6A 2W84A 3JCUC 1ZQ3P 3K4CA 4BEHB 3BPXA 3I64A 1U8BA 4F91B 1DDNA 1BR4A 1QBJA 2Z5UA 5K1YA 1YITI 2O5RA 3DLLF 1XGNA 1B8IA 1I3AA 4E7IA 3E0JB 3OL4A 1NH3A 2R7ZJ 2XAQA 5DUKA 2H8RA 2ECCA 4ZJZA 3TL4X 1AHDP 5D5UB 2HVRA 5ICGA 2XROA 1ZG5A 2MH2A 1IJWC 3EETA 5M3MJ 1H89C 1Z7UA 4HF0A 4M71A 1FJLA 1UZCA 3LAJA 4DQ2A 2UV1A 2E36A 3LSHA 2QZ8A 4E7HA 3I55I 4ITVA 4RB2C 4I76A 2HWVA 3EUHC 2WAFA 1HDPA 4L5EA 1Z77A 4HNTA 2E7XA 2W82A 5HS8A 2DFEA 2EIJH 5FD5A 1S8NA 2AXTC 2VKEA 4HQMA 3OYLA 3OYGA 2O0YA 4C3IJ 3DLAA 3DPTA 1HW2A 1DGRM 3NWTA 2DFFA 2VIXA 2WV0A 4ZH4F 3RQ4A 1CQTA 2FX0A 3NRVA 3OYNA 4A2UA 2XAUA 1VQNI 3M7GA 1LEAA 2BXZA 3CCYA 2JK3A 3PFYA 1LVAA 1W0TA 3BT9A 3TOAA 3G71I 1TT5B 1AWCA 3E5UA 4XLEA 2EFOA 2H94A 1XGMA 4HA8A 4JQFA 2LNBA 4XLCA 3U1KA 1T8IA 4IX7A 4KNYA 2XB0X 3BG3A 3DBLB 1EV7A 5E8IA 4DZPA 2JA8J 1HA8A 3GWZA 3DKYA 1RKTA 2IA0A 3O6BB 1IN5A 2PMHA 2RNGA 3ZQLA 1YO5C 1S5LC 2MC3A 2WTEA 4BY7J 1STZA 3U2RA 2VQLA 1VQ4I 2ZO4A 3CLOA 5JVGF 4BGDA 5LLQA 3GZ6A 1OPCA 3C3WA 5IYCJ 3HG9A 3ASOH 3K2ZA 4BQOA 3LL7A 1YG2A 4NC8A 2XAFA 1EJ9A 3CD6I 4KYWA 2K9LA 2KRCA 1X3UA 2DMTA 1R71A 1FOKA 3J7AY 4B47A 3HOWJ 4AWXB 2P81A 4AVZA 3CUQC 3F8NA 2W85A 4BHCA 1YI2I 4CCLA 3OYDA 4HAMA 4XLAA 4MEYF 1P7JA 1VZ0A 2FA5A 2LY1A 2HYFA 1P92A 1ONVA 2EK5A 2QUFA 3WG7H 4B43A 3OYJA 4C2TA 1JJ8C 2CV0A 3CDHA 5E79C 4HRIA 2A68F 3PJRA 3FIWA 1YS7A 2DA2A 3OYBA 2EZKA 1J59A 2PBIA 4XQFA 1J75A 1T98A 3G1MA 4XNFA 3HOTA 3DTEA 4P96A 1OCOH 2MLGA 2HTJA 1CF7A 1DQUA 3BJ6A 4G6TB 4HW0A 1KYWA 3VOEA 1FOXA 1XDSA 3HRSA 4U88A 3K70C 4RB0A 2ZB9A 3G6EI 3K7AJ 2JTVA 5EDNA 3AG1H 4RDUA 3KCCA 3GF2A 2RC4A 4OIQF 3SFZA 3QQAA 4X6AJ 3GTGJ 3PNTA 3JAMK 5CVVA 1IC8A 2MLKA 4XKWA 2RQPA 2QA4I 1R4NB 4B1RA 2BZTA 4EJVA 3HPHA 4HSTA 2HZDA 2PLYA 3CCLI 1OR7C 2L4AA 2LKPA 2PMZA 2FOWA 5BQTA 1SFOJ 3SQNA 3BC8A 5DM6F 2DTZA 3DKXA 2XB5A 2R5ZB 1SAXA 3CCSI 2HXOA 1RR8C 2FU4A 2DJNA 4OIRF 3KP3A 3ECOA 2ZFWA 3SYTA 1LJ9A 1BC7C 3OWTA 4E7ZA 4A5NA 1IUFA 1Y39A 3CO7C 2P6SA 2M7AA 5CYVA 3M07A 4MFDA 2DOAA 3CJRB 1FYKA 4FETA 2X4HA 1LUJB 3IV5A 1ON2A 3F6OA 5FFZA 2XC7A 2AXLA 2L7FP 3GLLA 3IAS2 4LB6B 5TJJA 3BOQA 3GTOJ 4HX7A 5L3DA 4C3HJ 3Q0UA 1U6GA 5KAIC 1VQPI 1R4MB 2E2JJ 1BM9A 4N4OB 2DW4A 1HQCA 1ULYA 3SHFA 3KP6A 3CUQA 3JRAA 3FBNB 2L4MA 5DDGA 4ZTJA 2OPTA 4LITA 5FKLA 1KU7A 2OTLI 2Y48A 4BY1J 3COAC 5DCMA 5M5YJ 3HOSA 3BCAA 4F55A 1BI3A 2L7MP 4XL9A 1U2WA 1V5EA 2HR3A 2HTSA 3CCQI 2X6YA 3HOYJ 2YSRA 4BXXJ 3HZJA 3J7YJ 4D9JA 2COBA 4L9JA 2DCEA 3I0TA 5DS9A 2V26A 1FSHA 1R7JA 1N75A 1DGWY 1FIAA 1U5TB 3V8LA 3IRQA 3GTLJ 3OMYA 2K85A 4XKVA 1SD5A 3GZNB 3J80Z 1YTYA 1H8AC 2MBFA 3E1SA 4BUPA 1W5TA 3L2QA 3PSFA 4PK4A 1LVKA 4FX0A 1WCMJ 2DA7A 2K02A 4NDLA 3I71A 4XICA 4ESJA 1T33A 3GO5A 5B3SH 1B4AA 1IZ1A 1R36A 2WA0A 2OZ6A 4X0GA 3S2DJ 1D1CA 4AIDA 5HS9A 1BW5A 3ZRGA 2L9SA 2OCCH 2JA5J 2E34A 1PVEA 2J5PA 4FHTA 3HXLA 1S7AA 2LC2A 3TO6A 4BQNA 5ICEA 4ENNA 2NNYA 3C7JA 1OYIA 3PL8A 2K9SA 4UUSA 3N97A 5J8FA 1LNWA 3ERMA 2H1LA 3I58A 2V6CA 2FBIA 3KPHA 1LEBA 2EWNA 4KIFA 5HNFA 2NVYJ 3ZQ7A 4KJZA 2R7WA 4YELA 2BHYA 2BY0A 4XLHA 4D7NA 4XM3A 1LPQA 2EIMH 1AKHB 4RGXA 3ZN1A 1P4AA 3P5JA 1KU9A 4P9UA 2WAEA 2X51A 1SD7A 3AG2H 4HDVA 4HSRA 3PO2J 3Q0WA 3QYFA 4XOPA 3JR9A 3S2HJ 3EPZA 5FO5A 3T0YA 2K9QA 1MBFA 1P6RA 1K78B 1BL0A 1PDNC 5IYDJ 4KT6A 1H9GA 5LBQA 1ZRFA 3VB2A 1P4WA 4V2GA 1QPMA 3Q3SA 3PUBA 3A1YA 3PNVA 2VBXA 2NXNB 2JQ7A 4Y33A 2GZWA 3TO7A 5K7ZA 2DTRA 2FMYA 2VJIA 3MQ0A 4FASD 1OLTA 3NQOA 3E6CC 4CYDA 4DYCA 3EUHA 3KZZA 1FC3A 5K7HA 5HLHA 2QSGX 3JRFA 1YJNI 1ETOA 2GLOA 1J5YA 4Y13A 1BJAA 2HU9A 4P55A 1HF0A 3MFKA 4I0AA 1P4XA 5D8LB 4EQQA 2NS0A 1FWZA 2JT1A 3QPTA 1QPIA 2HVQA 4QLCU 5D5VB 1XS9A 4TV7A 2EIKH 3SFIA 2LSOA 1O3QA 2XSDC 2CUEA 4RLFA 1M1EB 4CSWA 3L2UA 1K4SA 2P0WA 1SVMA 3KP4A 4FE4A 2COMA 1XGSA 3F9KA 4OMYA 2KDZA 5E1WA 2DDBA 4CO8A 4ZZLA 2WWYA 2MW8A 3I59B 3K1NA 3N4MA 1MBJA 4RAGA 1PP8F 2X6OA 4D0PA 1B59A 1YW8A 1MNDA 1YX3A 5CVUA 2IT0A 2E1NA 5TISC 3D1NI 4B4CA 2M8GX 3TBIA 2BBYA 1JXSA 1FMVA 4WXCA 1MGTA 1U5TC 5ILVA 3IHUA 4G7ZF 5CJ9A 3GTKJ 2LF7A 4BJ6C 5CQGA 2CRGA 2DJIA 5E20A 3HHHA 4M72A 2QQBA 3HUGB 1ZRCA 1ZREA 3FM5A 2OBPA 2R3SA 5J1UA 3QYEA 4EVIA 3KP7A 1Y6IA 2ISZA 3W2WA 4RAZA 1OMIA 3BZ6A 3ZQCA 4F92B 2NOJB 1A6IA 3ZQQA 3OYEA 2DYSH 2OAZA 5HLIA 3OSFA 1RUNA 2R7UA 3B73A 3H5RA 1JHHA 3EYIA 3KE2A 5HDGA 4K2EA 2B7EA 2MG4A 3C18A 3MZ8A 1LKXA 2Y69H 2EV0A 4ENJA 2Y31A 1VFCA 2QBYB 2M34A 3FXRA 2RNJA 3I9V2 3OL3A 4J19A 3BR5A 1OJLA 3FXJA 3HOXJ 4I09A 2WY8Q 1USSA 2GOXB 4U7DA 3V4GA 5AIPA 2Q0OA 3FMQA 2DLLA 4B09A 1TZLA 1KYZA 1E0EA 2L54A 2A69F 3Q9SA 2XGCA 4EATA 3TOBA 3CDLA 5DEQA 3TDUC 2EJRA 4BBRJ 3WU2C 4FX4A 2F4OB 1IG7A 2VB6A 1JI8A 1ACIA 3LAPA 3UNGC 2MSYA 4S05A 1PJRA 2F4IA 2DPDA 2DDAA 2KT0A 3MAJA 3RPUA 4MTEA 3DQVC 3AFHA 4Y15A 4AD9A 3K69A 1HKTA 2TCTA 1JKQC 2VE8A 3OOUA 1JT6A 4M3BA 3AG4H 2ZJPF 3U9GA 4CZZA 3OYFA 5BPIA 4OAZA 2LR8A 1KU2A 1P9QC 1FYMA 5C44J 4E7LA 1HOMA 5ICCA 2ZJ2A 4UNOA 4XKBA 1TWFJ 3UR3C 3WE3A 1ODDA 2YU3A 1I5ZA 2QSHX 3G73A 3T8TA 3GVAA 3ZMVA 2K86A 4A3FJ 3H35A 2VUMJ 4I98B 3ESWB 4M3GA 1XDUA 5GAEJ 4EV0A 3I4PA 4XRSA 1R22A 2P7CB 1JKPC 1BW6A 2DK5A 2V9PA 1IAWA 4OWRB 2NS7A 2XASA 5BPDA 5GAHJ 2WAQA 5CVRA 2MD0A 4F93B 3OY9A 4GO1A 2IA1A 3GTQJ 2CWEA 2QCOA 3RPQA 3ZN0A 1X2NA 4GRIA 1UHMA 1D5VA 3EUAA 1QHGA 2K9MA 4F52A 2K4JA 1PUFA 4KITB 1FMWA 2Q2EA 3M8JA 4M3FA 1D3YA 1I50J 4P9FA 5DTDA 4XBFA 1TWAJ 2ZMEC 3CO6C 3J81K 3CCVI 4JOMA 2K9NA 4I2OA 1TC3C 1Z91A 1OCZH 3ZCOA 2M7BA 1KQ8A 1FX7A 1V3FA 1G6NA 4RAYA 2ID3A 2VE9A 2XF6A 2XAHA 5GADJ 5IP9J 4IOCF 1FNNA 9ANTA 3WG9A 1JE8A 3FWEA 1UG2A 4LMYA 3S3OA 5DM7F 5HDKA 4UUSB 4A3JJ 3TP3A 4YIFA 1SMYF 1W4MA 1POGA 1FBQA 4RB1A 1PP7U 3LSRA 1AKHA 2LDUA 3QPHA 3CC2I 2NS8A 4LG3A 1WJEA 2XGXA 5D6FA 3BG6A 4QPOA 2FNAA 2XV4S 1Z67A 1Z6TA 2ZXHA 2E5ZA 3EQLF 2FRHA 3HC7A 4ESFA 3WTWC 1JTYA 2QVOA 3A2KA 1RC9A 4L18B 4PSWA 2UZKA 2KLOA 4WWCA 2VXZA 5LGNA 2V1NA 2H6CA 4R8HA 4HDUA 2M9HA 4A12A 5DD4A 2YUSA 3GBGA 5LEJA 2DI3A 2JVGA 1B6AA 2O6GE 3BPVA 3FMRA 4L9VA 1K83J 1UJ8A 5LEKA 3MKLA 2GIVA 3LQRA 5FRNA 3JSPA 1FOYA 4KIBA 1X1DA 2KL4A 1W36D 2TRTA 3D5LA 4XR6A 4BKXA 1FIPA 2PN6A 4N9HA 2R5YB 3RKXA 2P5VA 5JR3A 5J1RA 2M3AA 4G7OF 2KIMA 4G8XA 4MGRA 2LREA 1YE9A 4M6XA 4A93J 5DUIA 2ID6A 3CC7I 2FE3A 1V5FA 2W24A 5CQEA 1S72I 3WHCA 3PM1A 2KRHA 3W3CA 4A0YA 2LD5A 2ZKZA 5K5QA 3CC4I 2XF7A 2ETHA 3UKGA 2M4KA 3KIOA 4BDZA 3PIOF 2P5LC 5FLVA 4HQEA 4A3BJ 2JPCA 2XDVA 3BJAA 1N77A 3RSNA 5HVQC 3CDIA 1L3LA 2LK2A 4KN4X 3JREA 2FD5A 3O8HA 2HOTA 2HYGD 2FUG2 3H9JA 1UFMA 1Y8RB 1NG6A 2E1OA 2G7UA 3LSIA 2R92J 4H4KC 3FISA 3K10A 3DBHB 3C2HA 1MZBA 4GDFA 1IDYA 1TWGJ 5LHIA 1SFEA 2OD5A 2KP6A 3JRGA 1I3QJ 1V5GA 3CP2A 1OR7A 1X58A 2Q1ZB 1SVLA 3LQQA 3FXOA 2KIFA 3OIOA 3IAM2 2QYOA 1ETKA 1Z9CA 3IH2A 3DEEA 3KETA 4C3JJ 1DP3A 3HOVJ 1QHHD 3BG5A 4XLNF 2FMLA 4PCQA 3W2AA 5E18F 1T39A 3NWSA 3JSOA 2ELKA 3F8CA 1YIJI 2HOEA 3ABMH 3E6BA 4ESBA 3OIQA 1MJBA 4YIRX 3WTVC 1GHCA 1VNDA 2R7XA 5FLXK 4J00A 2G0EA 4OINF 3OS1A 1P2FA 1XD7A 2LG4A 1R5ID 3L2CA 1ZKGA 3QODA 3SZTA 3DU6A 3CMAI 3FMSA 1SAUA 2H6BA 4UVAA 3FHNA 1IN4A 1IN8A 2JWTA 4HV5A 2VPLA 2M45A 4YRVA 4E6KG 3H3UA 4KFCA 2G9WA 3WTTC 2F5CA 2HS5A 3S1MJ 4OIOF 1V54H 4CGZA 4MQ9F 4OIPF 3QWLA 1WHUA 3RTRA 3ZMZA 5M5WJ 2Y9YA 5FRMA 1D5YA 3PO3J 4BE0A 2QEXI 3QP5A 1R23A 1WSUA 5H20A 2F2EA 4CCKA 4BHBA 5KAFC 1TW3A 1ON1A 2D5VA 2HPIA 4YFXF 3C2GA 4V2FA 3WGIA 4EGZA 1D8JA 3KYLA 4LOCA 4UV8A 5F1RA 2A5WA 5FKNA 1QZEA 4KISA 2Z9OA 3MZHA 2DMNA 1DPUA 1K7AA 1JHFA 3FXUA 4KDPA 1GLNA 3HSRA 1QO0D 3O3KA 1DU0A 2KRFA 2W25A 2ZSHB 2JN6A 4I01A 4OU0A 5DYMA 1X4PA 2QQ8A 1NK2P 3BJOA 3BTLA 1XN7A 2EBIA 1H0MA 2IGNA 3J7AO 1ETWA 2VBZA 4EJUA 1SD4A 1OFCX 4KT5C 5CVIA 3QPSA 3LFUA 5FKMA 2EFQA 4C30A 4A5MA 3RCOA 1EKEA 2MGQA 2A6HF 2VQCA 1ZN2A 2RQQA 1OCPA 1QZYA 2P8TA 3GFJA 5GP9A 3HTSB 1GVJA 2OC6A 1J09A 2CGPA 1WI9A 1RI7A 4O6JA 4B48A 3QOEA 1D0ZA 2VASA 1ETQA 4GYGA 1MBGA 4HOBA 1VQOI 2V1XA 5F08A 5E3OA 3CCEI 4U0WA 3LFKA 2OF7A 2CUFA 1G59A 3CMMA 1WQ2A 2XGEA 2W1OA 2R7DA 2DA4A 2LFBA 5EEHA 2ZJRF 4MO7A 1MBEA 3GTJJ 1O3RA 4HV6A 2VXDA 2D2WA 2IGKA 4ENMA 3JW4A 5J1YA 4HBLA 1RETA 4W97A 4JX4A 3H92A 3KEQA 3VODA 3GFIA 2BYVE 2RREA 3R6SA 3WHBA 3MKWB 3HSEA 1XPXA 2EV5A 4S04A 5JFRA 2VC0A 4BE2A 4XN3A 3E5QA 4PJMA 3Q0VA 1OYYA 3CJNA 3KEOA 3BG9A 1BA5A 3IH4A 2HVSA 4DW6A 5F0CA 1ZR2A 2QLZA 4UUVA 1UHSA 3V7SA 1FT9A 2PJPA 3GFMA 3CCRI 3K6GA 3F6VA 2K27A 2KIUA 4CCOA 5IT3A 2G7HA 2M0CA 2ZXIA 3WU0A 2DA3A 3ZR8X 4AM3A 2O61A 1NHAA 3W6JB 6PAXA 3FF5A 1G4DA 1XCBA 4XKCA 2HQNA 1MNMC 3BTIA 2XIGA 1S7EA 2A6TA 1FOWA 2X9DA 2Y0MA 4IHXA 2LYCA 4X1EA 3V7RA 4IRHA 1Z6RA 2ZCWA 1T56A 3PNYA 1A6QA 1Q1HA 2E7WA 3A4CA 4Z2YA 2V9VA 4XIDA 2VOOA 1I6HJ 1W5CC 5K7FA 1JKOC 1GV5A 3HJEA 3F3XA 2BW3B 2RAEA 3BR1A 2M1BA 4OMZA 2B9SA 2DFHA 3H0GJ 5F0FA 4L0ZB 1Y1VJ 4WK8F 1K4TA 2JSCA 4PJNA 4OOIA 1YX5A 1D1BA 3F0CA 2QENA 2R93J 4UV9A 2LH9A 4G94A 4PFPA 4IQJA 2IXSA 2X1EA 3JAMZ 1Y1WJ 5F6FA 1YIOA 3L2WA 2E1MC 2VN2A 3M4OJ 3C2BA 2HQAA 1WJDA 1X19A 1SFUA 5F64A 2K7LA 4Z6YA 2OU2A 1UMQA 2LF8A 4CYCB 4UUTA 2LTPA 1OYWA 3FXKA 2L3DA 2CJJA 3HYIA 5EZHA 3CMEI 2PEXA 2DA1A 5HODA 2K40A 4HYEA 2F48A 4WX9A 4D1QA 1J9IA 3WE2A 3IC7A 3IKVA 5JHFA 3MD2A 4DYQA 2M30A 3ZMTA 1X3ZB 2KJCA 4LD5A 4IHWA 1FY7A 2L2OA 3IWFA 2RVCA 2Y0SN 3RI4A 4ZDOA 4W1UA 1LE8A 4BH9A 3L2RA 3S3MA 1V4RA 2M87A 3FBIB 4L5IA 3W2VA 2VKHA 2ICWG 5E3LA 4DJAA 2ZBKA 4GGGA 1E3OC 5D5WB 5KK1A 1JGGA 1VF9A 5D6EA 2GOMA 2DT5A 2ZJQF 2AQFA 1IRGA 3WU1B 4IPAA 1FEXA 4CA0A 1FP2A 2EFPA 3ERED 1EF4A 2R7VA 3MEXA 5FKKA 1VQLI 4IHYA 2B0LA 1H88C 5J4YA 3VWBA 1MDMA 1ZH5A 1MH4A 1ENHA 2AO9A 4LIUA 1REPC 3VFZA 1JUPA 1QVUA 3WTXC 4ZC3A 1B8IB 1QU3A 2EV6A 1LQ1A 1WZ2A 3JRBA 2R5YA 4GCVA 3CP8A 2EPFA 3GYHX 2W7NA 4N9IA 2NRAC 2Q2EB 2Y30A 5BS6A 4M9ZA 2V79A 4OAYA 3KZIC 1TLHB 4NBQA 4N0BA 2C6YA 2R4GA 1I39A 3DTKA 3M9AA 3SDGA 1H9TA 2QSFX 3HGGA 2LKXA 1FTZA 4WXDA 3DEWA 3TO9A 3K4NA 1ZGJA 5D8KB 1WGXA 2ISYA 2JVHA 1D0YA 2E71A 1U0JA 3KP2A 5E1ZB 5GTHC 3V7CA 1D1AA 2N8GA 1MNEA 2QQAA 3IWZA 3TGNA 2E19A 3CMYA 2EB7A 2A05A 3CUOA 4HEA2 3P9IA 4EEFG 1W36C 5EZGA 2NVXJ 1Y8QB 2MC4A 3FK7A 1KZHA 3P9KA 1F5TA 3LSGA 1FLIA 2PMUA 3BQYA 4HX8A 2IPQX 3GLXA 3DEUA 2KJBA 1CF7B 4XORA 3S2WA 4FT8A 5IOZA 3CLQA 3VSKA 1YFHA 5LHGA 5HLTA 3C1DA 2YS9A 5HOOA 5BMZA 3GTPJ 2XHKA 2CO5A 1IXCA 2X1DA 1ZELA 2WV1A 3IL2A 5B1AH 1TBXA 1MMDA 2HQ5A 5DV5A 4B3AA 4DGWB 3F72A 3S8PA 2VI6A 3I53A 4A6DA 2DQLA 1O3TA 5KVRA 2L9NA 3DWLE 5HLGA 1OQYA 1LFPA 2Y75A 1ZARA 3ABLH 1KA8A 1BJZA 1R5HA 2BXYA 2XPUA 1IV8A 2XF5A 1XX5A 4CUGA 3MMYB 1WH7A 4M73A 4EM1A 4RMNA 1LFBA 2BOLA 2RV8A 4FQGA 4RBOA 3HL2A 2K3PA 5J40A 5M5XJ 2MH9A 1VQ5I 3ZMSA 2KKOA 4HG2A 4IXAA 2WB1N 1BR1A 3SXYA 3E3VA 2GA2A 3DPUA 5ILUA 4II2A 3GMEA 4BQQA 2QBYA 4II3A 2Z33A 5F27A 2HKOA 3TMOA 3WTUC 2HQRA 3W6VA 4ZTFA 2DMUA 4WXHA 4BHPA 2R7OA 4XSXF 5EG0B 4AIJA 4S0HB 3K4BA 1UELB 4JX6A 1T0FC 1XGOA 2Z16A 1VQ8I 2WADA 1SMTA 2KZGA 1IRFA 3F22A 3CCMI 5C3EJ 2M0MA 1ETVA 2LBFA 3IP4B 1L0OC 2VONA 4DZJA 2VC1A 2XAGA 5J47A 4BAYA 4KA4A 4A3MJ 4ZDPA 3CESA 2QQ9A 2JRMA 3BR0A 1FPQA 2QGUA 3SZPA 5EEAA 5E17F 5IT9K 1IN6A 4CCNA 2LKSA 2HNHA 2XVCA 4A3EJ 1RKWA 1XSVA 4LGWA 4N4NB 1O3SA 3SJMA 2DXIA 3RYPA 4YFKF 2E2IJ 1HKSA 1MDMB 1G3TA 2YPRA 3KLNA 3CF2A 1O4XA 1IRXA 2ADUA 4NQWA 2IS1A 2NYXA 4IZZA 1XCVA 3GFLA 3IKTA 2WC2A 1ZTRA 3I3LA 1ZGWA 3CJQB 4IO9F 3OYIA 4XRFA 4IEJA 5EGOA 2GM4A 1X1CA 3D5SC 3R0JA 2STWA 3DBRB 4KN7X 2PI0A 2DQRA 4BEHA 1UCRA 1ORKA 3ZQIA 1A5JA 3HIFA 4EM0B 3OYAA 4ETSA 2JUGA 1FSEA 3DFGA 3K1MA 4G12A 3BR2A 4FTHA 4ZYEA 1E3HA 3ASNH 2QKMB 1MSEC 5B66C 2L7ZA 3H1CA 3BLYA 3EDPA 3E6DA 2ZFUA 3SEZA 1HKQA 4M3DA 2DPUA 1F43A 5JHUA 2OTJI 2H1KA 5E3MA 2DFIA 1G8XA 3NARA 3AAFA 3HM5A 2DOEA 3GCMA 1IGNA 2VQHA 2WY7Q 1EH8A 1MW7A 2FSWA 4M6YA 4FCYA 3BG7A 4BDYA 2VPRA 5D4SA 3BWGA 1IRZA 2OQGA 2M2EA 4IVNA 1JT0A 1XC5A 2P7VB 3OR2C 2IA2A 4IJAA 2DMPA 1SD6A 2VJ4A 2OUMA 3E5XA 1SANA 3V42A 3VSLA 4CCJA 1WI3A 4G9YA 2ESNA 2E35A 5FB2A 2IGMA 2YR2A 3MWMA 1K6OA 3KYCB 1R1VA 4D5CA 1U9OA 5FROA 2I8DA 5EG0A 1R1TA 1S3JA 4UVBA 4M9SA 2CQNA 4Q48A 1T95A 4AU7A
chains in the Genus database with same CATH topology
1U78A 4ON0A 1O7FA 5JVTA 4BXUA 5ERIA 2IRFG 3P9CA 4PGHA 1XMAA 3ABTA 3R0AA 4ASNA 1IXRC 3ML6A 2ZMEA 2HZTA 3F8FA 4IHTA 5JI6A 1D8KA 2ELHA 5D4RA 1I1GA 1R5GA 3LWFA 4YFNF 2CYYA 5ED4A 3PQJA 5L3GA 3TDZC 5AIQA 1GXQA 2CSOA 1W7PA 2UXXA 3WTYC 5J6XA 2A6EF 5LHHA 4LLLA 3ABUA 4WF2A 3F8BA 1B1BA 4I0BA 3J81Z 1U3EM 3MCZA 1U5TA 3M8EA 5LRSA 2XAJA 4WCGA 4E70A 4LB5A 1USTA 4JBAA 2ZNZA 1E17A 1BIBA 4LLGF 3L00A 1T38A 3H3ZA 5DCMB 3JTGA 1I1SA 4LK1F 1BC8C 4QWQA 3M1EA 2GA1A 3K9TA 1IF1A 3ULQB 2XKPA 2P5KA 4UXNA 1DP7P 2OZUA 2MD5A 4EJOA 1FZPB 5H6QA 4CICA 4Q5SF 1TTYA 1TW2A 1W5SA 5LGTA 2IJLA 4AVPA 4EM2A 4A0XA 1BI0A 3ELKA 3RDIA 1S6LA 1I6XA 1HSTA 3GX4X 2D1VA 2D45A 5TRDA 1Y0UA 1UHWA 3RJPA 4LFUA 4KIGA 3KLOA 1HW5A 3U1DA 2OQRA 5EEGA 4G6QA 2VOPA 2P6TA 2FXAA 4MTDA 1HXDA 4LJZF 1Z1DA 3GZ5A 1T6SA 2EA4A 3FM3A 4HX4A 5IT9Z 4G7HF 2GQQA 2RDPA 1VTNC 4MHGA 1BI1A 3WGGA 2YX7A 3DF8A 1G3WA 1IW7F 4RB3C 1RUOA 2MA3A 3WODF 1J2XA 2L01A 1DUXC 4YG2F 4I02A 2F5FA 1C0WA 4DNCA 1YLFA 4CHUA 4IHSA 2DO7A 1WRJA 5L3EA 1YQAA 2GWRA 1A04A 2FQ3A 1YS6A 1G3YA 3RIRA 1EH6A 4IRIA 5A2QZ 1B9NA 1DPRA 3BP8A 4CDGA 3LA2A 3D0SA 3HRTA 2O3FA 1ZG3A 2TDXA 1MD0A 4GXOA 5A2QK 3CTAA 2GXBA 3HRUA 3BY6A 3DXJF 5BOXA 4RGUA 4LG0B 3BDDA 2BGCA 3ZMUA 2VBYA 2QM3A 3QRFF 2HGCA 3MZYA 3R61A 1TQMA 3G3ZA 1B9MA 2W57A 3EYYA 3LSTA 3W6KB 2Z99A 1MJAA 5DCFA 4ZYDA 3L7WA 3GW2A 4EJTA 3LA3A 4O3MA 1YW9A 1BOAA 2JZYA 1T0FA 3ZP5A 4HLYA 3HUGA 1F9NA 1JGSA 3ECHA 5ILSA 4A0ZA 1YW7A 4XLPF 2ZNYA 4HF1A 2BV6A 1UB9A 4L9TA 2DK8A 1O7LA 2O8XA 3GUDA 2A61A 4M9XA 5L3CA 1Z05A 4LG0A 1TNSA 2EA2A 4L5JA 2R7FA 1GXPA 4RGRA 2ESHA 5ICFA 4B8XA 3FXQA 1S7OA 3QU3A 4ZZDA 1I27A 2YX4A 4PGGA 3QOPA 3T8RA 1QZZA 1HBXG 2DU9A 1BI2A 3I5UA 2CW0F 3E6MA 2NNNA 1W7PD 3GEZA 3VEPA 4MNUA 4HZFA 5CVJA 3LA7A 4RGSA 3GXOA 3TQNA 2A07F 5LGUA 1FBUA 3M8FA 4IRGA 3ZMDA 2A3SA 4Y17A 4MEXF 4Q4ZF 3I54A 1J0RA 5DD8A 1TQPA 2FOKA 2VODA 1AOYA 1F1ZA 5HDNA 3FZVA 2UXNA 5J8CA 1IUYA 4UVCA 5FGMA 1WWXA 4L0YB 4HF2A 1FP1D 1O57A 1HW1A 3DP7A 2VT3A 2PFBA 3V8JA 4L9NA 3OV8A 1R00A 2F5DA 2HKXA 2VT2A 3DPLC 1J7KA 2FNPA 2M5WA 1HSJA 5AONA 3E97A 4PZJA 5E8GA 3NEUA 3QAHA 4F7ZA 3B02A 3HRMA 1XMKA 3CUQB 1ZG1A 2F5EA 2IVMA 3WGHA 4NHJA 3HHGA 4M74A 4NB5A 3FX3A 3FHZA 3BROA 3HSFA 1MJ9A 5K5OA 1E2XA 1U8RA 1S29A 3QU6A 4UHTA 1PUEE 2EFNA 1ZHFA 1R1UA 2IP2A 4RS8A 2PG4A 3L9FA 4EGYA 1ZRDA 1ZLKA 2Z3YA 5LRRA 2STTA 3ROUA 1RNLA 4ZYGA 1EH7A 1XSXA 1ZYRF 4IF4A 4H0EA 3TKYA 2FF4A 4XSZF 1XB4A 2V1DA 1R58A 3F23A 2AS5F 3O2PE 2XRNA 4AIHA 3T1BA 2D1HA 2JPBA 3PQKA 3OOPA 1SFXA 2OA4A 3DV8A 4Q47A 3WTZA 2J5OA 1K79A 4R1HA 1T2KA 1KGSA 1KQ0A 1MKMA 1TNTA 1LDKB 3L09A 4BYYA 3IRRA 3HTUA 1FYLA 2H09A 3R60A 3KFWX 3DKWA 2O03A 4YIIA 5E1XA 4AIKA 3P7NA 1W7PB 2UWMA 1G3SA 3Q9VA 4KUMA 2BEOA 4PDKA 1OKRA 1IN7A 1LDJA 2RGVA 1KQ9A 2ZXJA 2NAZA 1ZAOA 1WKMA 2IW5A 4ZYHA 3Q5FA 2BE5F 4EMSA 1LDDA 2FBHA 3I59A 2CFXA 3KP5A 1BBYA 1BN5A 2CG4A 1ZLJA 5H6RA 2L02A 4U7BA 2HFHA 2QWWA 4G6DA 4HLXA 4KMFA 3K1PA 2ACJA 1KU3A 4I7HA 4P5OA 4KICA 2M8EA 4ENKA 1K78A 2DBBA 4LK0F 4U0VA 2GAUA 3V8KA 2ZMEB 3PFIA 4A6EA 2V1UA 5L3FA 2P4WA 3RYRA 4KMUX 3ZPLA 5L3BA 2H27A 5FLXZ 3RKWA 1F4KA 4BQAA 4R79A 1IXSB 4O5VA 3QP6A 3F8MA 2Q8KA 2CQKA 2PQ8A 2HEOA 4BNCA 5HS7A 1RIOH 2X0LA 4MQVA 3R4KA 5CLSA 2DAOA 1RZ4A 1QNTA 4U0YA 1LB2A 5FFXA 3ISPA 2XKOA 3KZYA 2RN7A 1YYVA 5K5RA 2HDCA 4JK1X 3RKYA 3T5XA 2EFWA 2GXGA 2JRTA 4LLNA 1BIAA 3WTSC 3JTHA 4GYIA 1XSDA 2FBKA 1QGPA 1ZGAA 1QQIA 4EJWA 1CGPA 2RKHA 2E1CA 1FBSA 2K4BA 1TQIA 3F21A 2XUBA 2FEZA 3J80K 5D5XB 3K0LA 3REOA 2A5YB 4CXFA 2VBWA 5FD6A 2W84A 3BPXA 3I64A 1DDNA 1QBJA 2Z5UA 5K1YA 1XGNA 2XAQA 5DUKA 5D5UB 5ICGA 2XROA 1ZG5A 2MH2A 3EETA 1Z7UA 4HF0A 4M71A 3LAJA 4DQ2A 2QZ8A 4RB2C 2HWVA 2E7XA 5HS8A 5FD5A 1S8NA 4HQMA 2O0YA 3DPTA 1HW2A 2WV0A 4ZH4F 3NRVA 4A2UA 3M7GA 1LEAA 1LVAA 3TOAA 1AWCA 3E5UA 2EFOA 2H94A 1XGMA 4HA8A 4JQFA 2LNBA 4KNYA 1EV7A 5E8IA 3GWZA 2IA0A 3O6BB 1IN5A 2PMHA 1YO5C 2MC3A 2WTEA 1STZA 3U2RA 2ZO4A 3CLOA 5LLQA 3GZ6A 1OPCA 3C3WA 3K2ZA 1YG2A 2XAFA 4KYWA 1X3UA 1FOKA 4AWXB 3CUQC 3F8NA 2W85A 4BHCA 4HAMA 4MEYF 2FA5A 2HYFA 1P92A 1ONVA 2EK5A 2QUFA 3CDHA 2A68F 1YS7A 1J59A 2PBIA 1J75A 1T98A 3HOTA 4P96A 2MLGA 2HTJA 1CF7A 3BJ6A 4HW0A 1KYWA 3VOEA 1XDSA 3HRSA 4U88A 4RB0A 2JTVA 3KCCA 3GF2A 2RC4A 4OIQF 3SFZA 3JAMK 5CVVA 2MLKA 2RQPA 4EJVA 2PLYA 2L4AA 2LKPA 5BQTA 3SQNA 1SAXA 2FU4A 4OIRF 3KP3A 3ECOA 2ZFWA 1LJ9A 1BC7C 4A5NA 3CO7C 2P6SA 5CYVA 1FYKA 2X4HA 1ON2A 3F6OA 5FFZA 2AXLA 4LB6B 5TJJA 3BOQA 4HX7A 5L3DA 1U6GA 1BM9A 2DW4A 1HQCA 1ULYA 3SHFA 3KP6A 3CUQA 2L4MA 5DDGA 1KU7A 2Y48A 3COAC 5DCMA 3HOSA 1BI3A 1U2WA 2HR3A 2HTSA 2YSRA 4L9JA 3I0TA 1FSHA 1R7JA 1U5TB 3V8LA 3IRQA 1SD5A 3J80Z 1YTYA 2MBFA 1W5TA 4FX0A 2K02A 3I71A 4ESJA 3GO5A 1B4AA 1IZ1A 1R36A 2OZ6A 5HS9A 2J5PA 4FHTA 1S7AA 3TO6A 5ICEA 4ENNA 2NNYA 3C7JA 1OYIA 3N97A 5J8FA 1LNWA 3I58A 2V6CA 2FBIA 1LEBA 2EWNA 4KIFA 3ZQ7A 4RGXA 3ZN1A 1P4AA 1KU9A 4P9UA 1SD7A 4HDVA 5FO5A 3T0YA 1PDNC 1P6RA 1K78B 1H9GA 5LBQA 1ZRFA 3VB2A 1P4WA 1QPMA 2VBXA 2GZWA 3TO7A 2FMYA 2DTRA 3MQ0A 3NQOA 3E6CC 4CYDA 3EUHA 3KZZA 1FC3A 5HLHA 1J5YA 4Y13A 1BJAA 4P55A 3MFKA 4I0AA 1P4XA 5D8LB 4EQQA 2NS0A 1FWZA 2JT1A 3QPTA 5D5VB 4QLCU 4TV7A 2LSOA 1O3QA 3KP4A 2COMA 1XGSA 4OMYA 5E1WA 4CO8A 4ZZLA 2WWYA 3I59B 3K1NA 3N4MA 1PP8F 4D0PA 1B59A 1YW8A 5CVUA 2IT0A 2E1NA 2BBYA 1JXSA 4WXCA 1MGTA 1U5TC 5ILVA 3IHUA 4G7ZF 5CJ9A 2LF7A 5E20A 3HHHA 4M72A 2QQBA 1ZRCA 1ZREA 3FM5A 2OBPA 2R3SA 4EVIA 3KP7A 2ISZA 4RAZA 1OMIA 3BZ6A 2OAZA 5HLIA 1RUNA 3B73A 1JHHA 3EYIA 3KE2A 5HDGA 4K2EA 3C18A 2EV0A 4ENJA 2QBYB 3FXRA 2RNJA 4I09A 1USSA 4U7DA 3V4GA 5AIPA 2Q0OA 3FMQA 2DLLA 4B09A 1KYZA 2L54A 2A69F 3Q9SA 3TOBA 5DEQA 3TDUC 2EJRA 4FX4A 3LAPA 4S05A 2DPDA 3MAJA 3RPUA 4MTEA 3DQVC 4Y15A 4AD9A 3K69A 1HKTA 2VE8A 3U9GA 4CZZA 5BPIA 1KU2A 1FYMA 5ICCA 2ZJ2A 4UNOA 3WE3A 1ODDA 2YU3A 1I5ZA 3G73A 3T8TA 3GVAA 3ZMVA 2K86A 4I98B 1XDUA 4EV0A 3I4PA 1R22A 2P7CB 2DK5A 1IAWA 2XASA 5BPDA 5CVRA 4GO1A 2IA1A 2CWEA 3RPQA 3ZN0A 1UHMA 1D5VA 2K4JA 2Q2EA 1D3YA 4P9FA 4XBFA 3CO6C 3J81K 4I2OA 1Z91A 1KQ8A 1FX7A 1V3FA 1G6NA 4RAYA 2VE9A 2XAHA 1FNNA 3WG9A 1JE8A 3FWEA 4LMYA 5HDKA 4YIFA 1SMYF 1W4MA 1FBQA 4RB1A 1PP7U 2LDUA 3QPHA 2XGXA 5D6FA 2FNAA 2XV4S 3EQLF 1Z6TA 4ESFA 3WTWC 2FRHA 2QVOA 4L18B 2UZKA 4WWCA 2VXZA 5LGNA 4R8HA 2H6CA 4HDUA 4A12A 5DD4A 5LEJA 2DI3A 1B6AA 2O6GE 3BPVA 3FMRA 4L9VA 5LEKA 2GIVA 3LQRA 3JSPA 4KIBA 3D5LA 2PN6A 4N9HA 3RKXA 2P5VA 5JR3A 4G7OF 2KIMA 4G8XA 4MGRA 4M6XA 5DUIA 2FE3A 2W24A 4A0YA 2ZKZA 5K5QA 2ETHA 2P5LC 4HQEA 2JPCA 3BJAA 5HVQC 1L3LA 4KN4X 2HYGD 1UFMA 2G7UA 1MZBA 5LHIA 1SFEA 2OD5A 1OR7A 3LQQA 2KIFA 2QYOA 1Z9CA 3KETA 4XLNF 2FMLA 4PCQA 5E18F 1T39A 3JSOA 3F8CA 2HOEA 3E6BA 4ESBA 1MJBA 3WTVC 1GHCA 5FLXK 4OINF 1P2FA 1XD7A 3L2CA 3SZTA 3FMSA 2H6BA 4UVAA 1IN4A 1IN8A 4HV5A 2M45A 4KFCA 3H3UA 2G9WA 3WTTC 2F5CA 2HS5A 4OIOF 4CGZA 4MQ9F 4OIPF 3RTRA 3ZMZA 3QP5A 1R23A 1WSUA 5H20A 2F2EA 4BHBA 1TW3A 1ON1A 4YFXF 3WGIA 4EGZA 1D8JA 4UV8A 5F1RA 2Z9OA 3MZHA 1DPUA 1K7AA 1JHFA 3FXUA 4KDPA 3HSRA 1QO0D 3O3KA 2KRFA 2W25A 4I01A 4OU0A 5DYMA 3BJOA 1XN7A 1H0MA 3J7AO 2VBZA 4EJUA 1SD4A 4KT5C 5CVIA 2EFQA 4A5MA 2A6HF 1ZN2A 1QZYA 2P8TA 3GFJA 3HTSB 1GVJA 2CGPA 1WI9A 1RI7A 4O6JA 4GYGA 4HOBA 2V1XA 4U0WA 3LFKA 1WQ2A 2R7DA 5EEHA 1O3RA 4HV6A 2D2WA 4ENMA 3JW4A 4HBLA 3H92A 3KEQA 3VODA 3GFIA 2BYVE 3R6SA 3HSEA 2EV5A 4S04A 5JFRA 2VC0A 3E5QA 1OYYA 3CJNA 3KEOA 2QLZA 4UUVA 3V7SA 1FT9A 2PJPA 3GFMA 3F6VA 2K27A 2KIUA 5IT3A 2G7HA 3WU0A 2O61A 1NHAA 3W6JB 6PAXA 3FF5A 1G4DA 1XCBA 2HQNA 2XIGA 2Y0MA 3V7RA 4IRHA 1Z6RA 2ZCWA 1Q1HA 2E7WA 4Z2YA 2V9VA 2VOOA 3F3XA 2M1BA 4OMZA 4L0ZB 4WK8F 2JSCA 4OOIA 2QENA 4UV9A 4G94A 3JAMZ 5F6FA 1YIOA 2VN2A 1SFUA 5F64A 2K7LA 2OU2A 2LF8A 1OYWA 2L3DA 3HYIA 2PEXA 4WX9A 4HYEA 1J9IA 3WE2A 3IC7A 3IKVA 2M30A 3ZMTA 2KJCA 4LD5A 1FY7A 3IWFA 2RVCA 3RI4A 4BH9A 1V4RA 2M87A 4L5IA 2ZBKA 4GGGA 5D5WB 5KK1A 5D6EA 2DT5A 1IRGA 3WU1B 4IPAA 1FP2A 2EFPA 3ERED 3MEXA 2B0LA 1MDMA 1ZH5A 1REPC 3VFZA 3WTXC 2EV6A 1LQ1A 4GCVA 3GYHX 4N9IA 2NRAC 5BS6A 4M9ZA 2V79A 1TLHB 4N0BA 2C6YA 3M9AA 1H9TA 4WXDA 3TO9A 1ZGJA 5D8KB 2ISYA 3KP2A 5E1ZB 3V7CA 2QQAA 3IWZA 3TGNA 2EB7A 3CUOA 3P9IA 1F5TA 3P9KA 1FLIA 2PMUA 4HX8A 2IPQX 3GLXA 3DEUA 2KJBA 1CF7B 3S2WA 4FT8A 1YFHA 5LHGA 3C1DA 5HOOA 5BMZA 2XHKA 2CO5A 1IXCA 3IL2A 1TBXA 5DV5A 3F72A 3I53A 4A6DA 2DQLA 1O3TA 5KVRA 5HLGA 1ZARA 2Y75A 1KA8A 1R5HA 4M73A 4EM1A 2RV8A 2MH9A 3ZMSA 2KKOA 4IXAA 3SXYA 3E3VA 2GA2A 5ILUA 2QBYA 2Z33A 3WTUC 2HKOA 2HQRA 4WXHA 4BHPA 4XSXF 4AIJA 1XGOA 1SMTA 1IRFA 3F22A 1L0OC 2VONA 2VC1A 2XAGA 4KA4A 4BAYA 2QQ9A 1FPQA 3SZPA 5E17F 5IT9K 1IN6A 2XVCA 1XSVA 4LGWA 1O3SA 3RYPA 4YFKF 1HKSA 1MDMB 1G3TA 2YPRA 3KLNA 2ADUA 4NQWA 2NYXA 1XCVA 3GFLA 3IKTA 2WC2A 4XRFA 3R0JA 2STWA 4KN7X 2PI0A 2DQRA 1UCRA 3HIFA 4EM0B 4ETSA 1FSEA 3DFGA 3K1MA 4ZYEA 3E6DA 3EDPA 1HKQA 2DPUA 5JHUA 2DFIA 3AAFA 1EH8A 2FSWA 4M6YA 5D4SA 3BWGA 2OQGA 4IVNA 2P7VB 2IA2A 4IJAA 1SD6A 3E5XA 4G9YA 2ESNA 5FB2A 2YR2A 3MWMA 1K6OA 1R1VA 1R1TA 1S3JA 4UVBA 4M9SA 4Q48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U78 A;  4ON0 A;  1O7F A;  5JVT A;  4BXU A;  5ERI A;  2IRF G;  3P9C A;  4PGH A;  1XMA A;  3ABT A;  3R0A A;  4ASN A;  1IXR C;  3ML6 A;  2ZME A;  2HZT A;  3F8F A;  4IHT A;  5JI6 A;  1D8K A;  2ELH A;  5D4R A;  1I1G A;  1R5G A;  3LWF A;  4YFN F;  2CYY A;  5ED4 A;  3PQJ A;  5L3G A;  3TDZ C;  5AIQ A;  1GXQ A;  2CSO A;  1W7P A;  2UXX A;  3WTY C;  5J6X A;  2A6E F;  5LHH A;  4LLL A;  3ABU A;  4WF2 A;  3F8B A;  1B1B A;  4I0B A;  3J81 Z;  1U3E M;  3MCZ A;  1U5T A;  3M8E A;  5LRS A;  2XAJ A;  4WCG A;  4E70 A;  4LB5 A;  1UST A;  4JBA A;  2ZNZ A;  1E17 A;  1BIB A;  4LLG F;  3L00 A;  1T38 A;  3H3Z A;  5DCM B;  3JTG A;  1I1S A;  4LK1 F;  1BC8 C;  4QWQ A;  3M1E A;  2GA1 A;  3K9T A;  1IF1 A;  3ULQ B;  2XKP A;  2P5K A;  4UXN A;  1DP7 P;  2OZU A;  2MD5 A;  4EJO A;  1FZP B;  5H6Q A;  4CIC A;  4Q5S F;  1TTY A;  1TW2 A;  1W5S A;  5LGT A;  2IJL A;  4AVP A;  4EM2 A;  4A0X A;  1BI0 A;  3ELK A;  3RDI A;  1S6L A;  1I6X A;  1HST A;  3GX4 X;  2D1V A;  2D45 A;  5TRD A;  1Y0U A;  1UHW A;  3RJP A;  4LFU A;  4KIG A;  3KLO A;  1HW5 A;  3U1D A;  2OQR A;  5EEG A;  4G6Q A;  2VOP A;  2P6T A;  2FXA A;  4MTD A;  1HXD A;  4LJZ F;  1Z1D A;  3GZ5 A;  1T6S A;  2EA4 A;  3FM3 A;  4HX4 A;  5IT9 Z;  4G7H F;  2GQQ A;  2RDP A;  1VTN C;  4MHG A;  1BI1 A;  3WGG A;  2YX7 A;  3DF8 A;  1G3W A;  1IW7 F;  4RB3 C;  1RUO A;  2MA3 A;  3WOD F;  1J2X A;  2L01 A;  1DUX C;  4YG2 F;  4I02 A;  2F5F A;  1C0W A;  4DNC A;  1YLF A;  4CHU A;  4IHS A;  2DO7 A;  1WRJ A;  5L3E A;  1YQA A;  2GWR A;  1A04 A;  2FQ3 A;  1YS6 A;  1G3Y A;  3RIR A;  1EH6 A;  4IRI A;  5A2Q Z;  1B9N A;  1DPR A;  3BP8 A;  4CDG A;  3LA2 A;  3D0S A;  3HRT A;  2O3F A;  1ZG3 A;  2TDX A;  1MD0 A;  4GXO A;  5A2Q K;  3CTA A;  2GXB A;  3HRU A;  3BY6 A;  3DXJ F;  5BOX A;  4RGU A;  4LG0 B;  3BDD A;  2BGC A;  3ZMU A;  2VBY A;  2QM3 A;  3QRF F;  2HGC A;  3MZY A;  3R61 A;  1TQM A;  3G3Z A;  1B9M A;  2W57 A;  3EYY A;  3LST A;  3W6K B;  2Z99 A;  1MJA A;  5DCF A;  4ZYD A;  3L7W A;  3GW2 A;  4EJT A;  3LA3 A;  4O3M A;  1YW9 A;  1BOA A;  2JZY A;  1T0F A;  3ZP5 A;  4HLY A;  3HUG A;  1F9N A;  1JGS A;  3ECH A;  5ILS A;  4A0Z A;  1YW7 A;  4XLP F;  2ZNY A;  4HF1 A;  2BV6 A;  1UB9 A;  4L9T A;  2DK8 A;  1O7L A;  2O8X A;  3GUD A;  2A61 A;  4M9X A;  5L3C A;  1Z05 A;  4LG0 A;  1TNS A;  2EA2 A;  4L5J A;  2R7F A;  1GXP A;  4RGR A;  2ESH A;  5ICF A;  4B8X A;  3FXQ A;  1S7O A;  3QU3 A;  4ZZD A;  1I27 A;  2YX4 A;  4PGG A;  3QOP A;  3T8R A;  1QZZ A;  1HBX G;  2DU9 A;  1BI2 A;  3I5U A;  2CW0 F;  3E6M A;  2NNN A;  1W7P D;  3GEZ A;  3VEP A;  4MNU A;  4HZF A;  5CVJ A;  3LA7 A;  4RGS A;  3GXO A;  3TQN A;  2A07 F;  5LGU A;  1FBU A;  3M8F A;  4IRG A;  3ZMD A;  2A3S A;  4Y17 A;  4MEX F;  4Q4Z F;  3I54 A;  1J0R A;  5DD8 A;  1TQP A;  2FOK A;  2VOD A;  1AOY A;  1F1Z A;  5HDN A;  3FZV A;  2UXN A;  5J8C A;  1IUY A;  4UVC A;  5FGM A;  1WWX A;  4L0Y B;  4HF2 A;  1FP1 D;  1O57 A;  1HW1 A;  3DP7 A;  2VT3 A;  2PFB A;  3V8J A;  4L9N A;  3OV8 A;  1R00 A;  2F5D A;  2HKX A;  2VT2 A;  3DPL C;  1J7K A;  2FNP A;  2M5W A;  1HSJ A;  5AON A;  3E97 A;  4PZJ A;  5E8G A;  3NEU A;  3QAH A;  4F7Z A;  3B02 A;  3HRM A;  1XMK A;  3CUQ B;  1ZG1 A;  2F5E A;  2IVM A;  3WGH A;  4NHJ A;  3HHG A;  4M74 A;  4NB5 A;  3FX3 A;  3FHZ A;  3BRO A;  3HSF A;  1MJ9 A;  5K5O A;  1E2X A;  1U8R A;  1S29 A;  3QU6 A;  4UHT A;  1PUE E;  2EFN A;  1ZHF A;  1R1U A;  2IP2 A;  4RS8 A;  2PG4 A;  3L9F A;  4EGY A;  1ZRD A;  1ZLK A;  2Z3Y A;  5LRR A;  2STT A;  3ROU A;  1RNL A;  4ZYG A;  1EH7 A;  1XSX A;  1ZYR F;  4IF4 A;  4H0E A;  3TKY A;  2FF4 A;  4XSZ F;  1XB4 A;  2V1D A;  1R58 A;  3F23 A;  2AS5 F;  3O2P E;  2XRN A;  4AIH A;  3T1B A;  2D1H A;  2JPB A;  3PQK A;  3OOP A;  1SFX A;  2OA4 A;  3DV8 A;  4Q47 A;  3WTZ A;  2J5O A;  1K79 A;  4R1H A;  1T2K A;  1KGS A;  1KQ0 A;  1MKM A;  1TNT A;  1LDK B;  3L09 A;  4BYY A;  3IRR A;  3HTU A;  1FYL A;  2H09 A;  3R60 A;  3KFW X;  3DKW A;  2O03 A;  4YII A;  5E1X A;  4AIK A;  3P7N A;  1W7P B;  2UWM A;  1G3S A;  3Q9V A;  4KUM A;  2BEO A;  4PDK A;  1OKR A;  1IN7 A;  1LDJ A;  2RGV A;  1KQ9 A;  2ZXJ A;  2NAZ A;  1ZAO A;  1WKM A;  2IW5 A;  4ZYH A;  3Q5F A;  2BE5 F;  4EMS A;  1LDD A;  2FBH A;  3I59 A;  2CFX A;  3KP5 A;  1BBY A;  1BN5 A;  2CG4 A;  1ZLJ A;  5H6R A;  2L02 A;  4U7B A;  2HFH A;  2QWW A;  4G6D A;  4HLX A;  4KMF A;  3K1P A;  2ACJ A;  1KU3 A;  4I7H A;  4P5O A;  4KIC A;  2M8E A;  4ENK A;  1K78 A;  2DBB A;  4LK0 F;  4U0V A;  2GAU A;  3V8K A;  2ZME B;  3PFI A;  4A6E A;  2V1U A;  5L3F A;  2P4W A;  3RYR A;  4KMU X;  3ZPL A;  5L3B A;  2H27 A;  5FLX Z;  3RKW A;  1F4K A;  4BQA A;  4R79 A;  1IXS B;  4O5V A;  3QP6 A;  3F8M A;  2Q8K A;  2CQK A;  2PQ8 A;  2HEO A;  4BNC A;  5HS7 A;  1RIO H;  2X0L A;  4MQV A;  3R4K A;  5CLS A;  2DAO A;  1RZ4 A;  1QNT A;  4U0Y A;  1LB2 A;  5FFX A;  3ISP A;  2XKO A;  3KZY A;  2RN7 A;  1YYV A;  5K5R A;  2HDC A;  4JK1 X;  3RKY A;  3T5X A;  2EFW A;  2GXG A;  2JRT A;  4LLN A;  1BIA A;  3WTS C;  3JTH A;  4GYI A;  1XSD A;  2FBK A;  1QGP A;  1ZGA A;  1QQI A;  4EJW A;  1CGP A;  2RKH A;  2E1C A;  1FBS A;  2K4B A;  1TQI A;  3F21 A;  2XUB A;  2FEZ A;  3J80 K;  5D5X B;  3K0L A;  3REO A;  2A5Y B;  4CXF A;  2VBW A;  5FD6 A;  2W84 A;  3BPX A;  3I64 A;  1DDN A;  1QBJ A;  2Z5U A;  5K1Y A;  1XGN A;  2XAQ A;  5DUK A;  5D5U B;  5ICG A;  2XRO A;  1ZG5 A;  2MH2 A;  3EET A;  1Z7U A;  4HF0 A;  4M71 A;  3LAJ A;  4DQ2 A;  2QZ8 A;  4RB2 C;  2HWV A;  2E7X A;  5HS8 A;  5FD5 A;  1S8N A;  4HQM A;  2O0Y A;  3DPT A;  1HW2 A;  2WV0 A;  4ZH4 F;  3NRV A;  4A2U A;  3M7G A;  1LEA A;  1LVA A;  3TOA A;  1AWC A;  3E5U A;  2EFO A;  2H94 A;  1XGM A;  4HA8 A;  4JQF A;  2LNB A;  4KNY A;  1EV7 A;  5E8I A;  3GWZ A;  2IA0 A;  3O6B B;  1IN5 A;  2PMH A;  1YO5 C;  2MC3 A;  2WTE A;  1STZ A;  3U2R A;  2ZO4 A;  3CLO A;  5LLQ A;  3GZ6 A;  1OPC A;  3C3W A;  3K2Z A;  1YG2 A;  2XAF A;  4KYW A;  1X3U A;  1FOK A;  4AWX B;  3CUQ C;  3F8N A;  2W85 A;  4BHC A;  4HAM A;  4MEY F;  2FA5 A;  2HYF A;  1P92 A;  1ONV A;  2EK5 A;  2QUF A;  3CDH A;  2A68 F;  1YS7 A;  1J59 A;  2PBI A;  1J75 A;  1T98 A;  3HOT A;  4P96 A;  2MLG A;  2HTJ A;  1CF7 A;  3BJ6 A;  4HW0 A;  1KYW A;  3VOE A;  1XDS A;  3HRS A;  4U88 A;  4RB0 A;  2JTV A;  3KCC A;  3GF2 A;  2RC4 A;  4OIQ F;  3SFZ A;  3JAM K;  5CVV A;  2MLK A;  2RQP A;  4EJV A;  2PLY A;  2L4A A;  2LKP A;  5BQT A;  3SQN A;  1SAX A;  2FU4 A;  4OIR F;  3KP3 A;  3ECO A;  2ZFW A;  1LJ9 A;  1BC7 C;  4A5N A;  3CO7 C;  2P6S A;  5CYV A;  1FYK A;  2X4H A;  1ON2 A;  3F6O A;  5FFZ A;  2AXL A;  4LB6 B;  5TJJ A;  3BOQ A;  4HX7 A;  5L3D A;  1U6G A;  1BM9 A;  2DW4 A;  1HQC A;  1ULY A;  3SHF A;  3KP6 A;  3CUQ A;  2L4M A;  5DDG A;  1KU7 A;  2Y48 A;  3COA C;  5DCM A;  3HOS A;  1BI3 A;  1U2W A;  2HR3 A;  2HTS A;  2YSR A;  4L9J A;  3I0T A;  1FSH A;  1R7J A;  1U5T B;  3V8L A;  3IRQ A;  1SD5 A;  3J80 Z;  1YTY A;  2MBF A;  1W5T A;  4FX0 A;  2K02 A;  3I71 A;  4ESJ A;  3GO5 A;  1B4A A;  1IZ1 A;  1R36 A;  2OZ6 A;  5HS9 A;  2J5P A;  4FHT A;  1S7A A;  3TO6 A;  5ICE A;  4ENN A;  2NNY A;  3C7J A;  1OYI A;  3N97 A;  5J8F A;  1LNW A;  3I58 A;  2V6C A;  2FBI A;  1LEB A;  2EWN A;  4KIF A;  3ZQ7 A;  4RGX A;  3ZN1 A;  1P4A A;  1KU9 A;  4P9U A;  1SD7 A;  4HDV A;  5FO5 A;  3T0Y A;  1PDN C;  1P6R A;  1K78 B;  1H9G A;  5LBQ A;  1ZRF A;  3VB2 A;  1P4W A;  1QPM A;  2VBX A;  2GZW A;  3TO7 A;  2FMY A;  2DTR A;  3MQ0 A;  3NQO A;  3E6C C;  4CYD A;  3EUH A;  3KZZ A;  1FC3 A;  5HLH A;  1J5Y A;  4Y13 A;  1BJA A;  4P55 A;  3MFK A;  4I0A A;  1P4X A;  5D8L B;  4EQQ A;  2NS0 A;  1FWZ A;  2JT1 A;  3QPT A;  5D5V B;  4QLC U;  4TV7 A;  2LSO A;  1O3Q A;  3KP4 A;  2COM A;  1XGS A;  4OMY A;  5E1W A;  4CO8 A;  4ZZL A;  2WWY A;  3I59 B;  3K1N A;  3N4M A;  1PP8 F;  4D0P A;  1B59 A;  1YW8 A;  5CVU A;  2IT0 A;  2E1N A;  2BBY A;  1JXS A;  4WXC A;  1MGT A;  1U5T C;  5ILV A;  3IHU A;  4G7Z F;  5CJ9 A;  2LF7 A;  5E20 A;  3HHH A;  4M72 A;  2QQB A;  1ZRC A;  1ZRE A;  3FM5 A;  2OBP A;  2R3S A;  4EVI A;  3KP7 A;  2ISZ A;  4RAZ A;  1OMI A;  3BZ6 A;  2OAZ A;  5HLI A;  1RUN A;  3B73 A;  1JHH A;  3EYI A;  3KE2 A;  5HDG A;  4K2E A;  3C18 A;  2EV0 A;  4ENJ A;  2QBY B;  3FXR A;  2RNJ A;  4I09 A;  1USS A;  4U7D A;  3V4G A;  5AIP A;  2Q0O A;  3FMQ A;  2DLL A;  4B09 A;  1KYZ A;  2L54 A;  2A69 F;  3Q9S A;  3TOB A;  5DEQ A;  3TDU C;  2EJR A;  4FX4 A;  3LAP A;  4S05 A;  2DPD A;  3MAJ A;  3RPU A;  4MTE A;  3DQV C;  4Y15 A;  4AD9 A;  3K69 A;  1HKT A;  2VE8 A;  3U9G A;  4CZZ A;  5BPI A;  1KU2 A;  1FYM A;  5ICC A;  2ZJ2 A;  4UNO A;  3WE3 A;  1ODD A;  2YU3 A;  1I5Z A;  3G73 A;  3T8T A;  3GVA A;  3ZMV A;  2K86 A;  4I98 B;  1XDU A;  4EV0 A;  3I4P A;  1R22 A;  2P7C B;  2DK5 A;  1IAW A;  2XAS A;  5BPD A;  5CVR A;  4GO1 A;  2IA1 A;  2CWE A;  3RPQ A;  3ZN0 A;  1UHM A;  1D5V A;  2K4J A;  2Q2E A;  1D3Y A;  4P9F A;  4XBF A;  3CO6 C;  3J81 K;  4I2O A;  1Z91 A;  1KQ8 A;  1FX7 A;  1V3F A;  1G6N A;  4RAY A;  2VE9 A;  2XAH A;  1FNN A;  3WG9 A;  1JE8 A;  3FWE A;  4LMY A;  5HDK A;  4YIF A;  1SMY F;  1W4M A;  1FBQ A;  4RB1 A;  1PP7 U;  2LDU A;  3QPH A;  2XGX A;  5D6F A;  2FNA A;  2XV4 S;  3EQL F;  1Z6T A;  4ESF A;  3WTW C;  2FRH A;  2QVO A;  4L18 B;  2UZK A;  4WWC A;  2VXZ A;  5LGN A;  4R8H A;  2H6C A;  4HDU A;  4A12 A;  5DD4 A;  5LEJ A;  2DI3 A;  1B6A A;  2O6G E;  3BPV A;  3FMR A;  4L9V A;  5LEK A;  2GIV A;  3LQR A;  3JSP A;  4KIB A;  3D5L A;  2PN6 A;  4N9H A;  3RKX A;  2P5V A;  5JR3 A;  4G7O F;  2KIM A;  4G8X A;  4MGR A;  4M6X A;  5DUI A;  2FE3 A;  2W24 A;  4A0Y A;  2ZKZ A;  5K5Q A;  2ETH A;  2P5L C;  4HQE A;  2JPC A;  3BJA A;  5HVQ C;  1L3L A;  4KN4 X;  2HYG D;  1UFM A;  2G7U A;  1MZB A;  5LHI A;  1SFE A;  2OD5 A;  1OR7 A;  3LQQ A;  2KIF A;  2QYO A;  1Z9C A;  3KET A;  4XLN F;  2FML A;  4PCQ A;  5E18 F;  1T39 A;  3JSO A;  3F8C A;  2HOE A;  3E6B A;  4ESB A;  1MJB A;  3WTV C;  1GHC A;  5FLX K;  4OIN F;  1P2F A;  1XD7 A;  3L2C A;  3SZT A;  3FMS A;  2H6B A;  4UVA A;  1IN4 A;  1IN8 A;  4HV5 A;  2M45 A;  4KFC A;  3H3U A;  2G9W A;  3WTT C;  2F5C A;  2HS5 A;  4OIO F;  4CGZ A;  4MQ9 F;  4OIP F;  3RTR A;  3ZMZ A;  3QP5 A;  1R23 A;  1WSU A;  5H20 A;  2F2E A;  4BHB A;  1TW3 A;  1ON1 A;  4YFX F;  3WGI A;  4EGZ A;  1D8J A;  4UV8 A;  5F1R A;  2Z9O A;  3MZH A;  1DPU A;  1K7A A;  1JHF A;  3FXU A;  4KDP A;  3HSR A;  1QO0 D;  3O3K A;  2KRF A;  2W25 A;  4I01 A;  4OU0 A;  5DYM A;  3BJO A;  1XN7 A;  1H0M A;  3J7A O;  2VBZ A;  4EJU A;  1SD4 A;  4KT5 C;  5CVI A;  2EFQ A;  4A5M A;  2A6H F;  1ZN2 A;  1QZY A;  2P8T A;  3GFJ A;  3HTS B;  1GVJ A;  2CGP A;  1WI9 A;  1RI7 A;  4O6J A;  4GYG A;  4HOB A;  2V1X A;  4U0W A;  3LFK A;  1WQ2 A;  2R7D A;  5EEH A;  1O3R A;  4HV6 A;  2D2W A;  4ENM A;  3JW4 A;  4HBL A;  3H92 A;  3KEQ A;  3VOD A;  3GFI A;  2BYV E;  3R6S A;  3HSE A;  2EV5 A;  4S04 A;  5JFR A;  2VC0 A;  3E5Q A;  1OYY A;  3CJN A;  3KEO A;  2QLZ A;  4UUV A;  3V7S A;  1FT9 A;  2PJP A;  3GFM A;  3F6V A;  2K27 A;  2KIU A;  5IT3 A;  2G7H A;  3WU0 A;  2O61 A;  1NHA A;  3W6J B;  6PAX A;  3FF5 A;  1G4D A;  1XCB A;  2HQN A;  2XIG A;  2Y0M A;  3V7R A;  4IRH A;  1Z6R A;  2ZCW A;  1Q1H A;  2E7W A;  4Z2Y A;  2V9V A;  2VOO A;  3F3X A;  2M1B A;  4OMZ A;  4L0Z B;  4WK8 F;  2JSC A;  4OOI A;  2QEN A;  4UV9 A;  4G94 A;  3JAM Z;  5F6F A;  1YIO A;  2VN2 A;  1SFU A;  5F64 A;  2K7L A;  2OU2 A;  2LF8 A;  1OYW A;  2L3D A;  3HYI A;  2PEX A;  4WX9 A;  4HYE A;  1J9I A;  3WE2 A;  3IC7 A;  3IKV A;  2M30 A;  3ZMT A;  2KJC A;  4LD5 A;  1FY7 A;  3IWF A;  2RVC A;  3RI4 A;  4BH9 A;  1V4R A;  2M87 A;  4L5I A;  2ZBK A;  4GGG A;  5D5W B;  5KK1 A;  5D6E A;  2DT5 A;  1IRG A;  3WU1 B;  4IPA A;  1FP2 A;  2EFP A;  3ERE D;  3MEX A;  2B0L A;  1MDM A;  1ZH5 A;  1REP C;  3VFZ A;  3WTX C;  2EV6 A;  1LQ1 A;  4GCV A;  3GYH X;  4N9I A;  2NRA C;  5BS6 A;  4M9Z A;  2V79 A;  1TLH B;  4N0B A;  2C6Y A;  3M9A A;  1H9T A;  4WXD A;  3TO9 A;  1ZGJ A;  5D8K B;  2ISY A;  3KP2 A;  5E1Z B;  3V7C A;  2QQA A;  3IWZ A;  3TGN A;  2EB7 A;  3CUO A;  3P9I A;  1F5T A;  3P9K A;  1FLI A;  2PMU A;  4HX8 A;  2IPQ X;  3GLX A;  3DEU A;  2KJB A;  1CF7 B;  3S2W A;  4FT8 A;  1YFH A;  5LHG A;  3C1D A;  5HOO A;  5BMZ A;  2XHK A;  2CO5 A;  1IXC A;  3IL2 A;  1TBX A;  5DV5 A;  3F72 A;  3I53 A;  4A6D A;  2DQL A;  1O3T A;  5KVR A;  5HLG A;  1ZAR A;  2Y75 A;  1KA8 A;  1R5H A;  4M73 A;  4EM1 A;  2RV8 A;  2MH9 A;  3ZMS A;  2KKO A;  4IXA A;  3SXY A;  3E3V A;  2GA2 A;  5ILU A;  2QBY A;  2Z33 A;  3WTU C;  2HKO A;  2HQR A;  4WXH A;  4BHP A;  4XSX F;  4AIJ A;  1XGO A;  1SMT A;  1IRF A;  3F22 A;  1L0O C;  2VON A;  2VC1 A;  2XAG A;  4KA4 A;  4BAY A;  2QQ9 A;  1FPQ A;  3SZP A;  5E17 F;  5IT9 K;  1IN6 A;  2XVC A;  1XSV A;  4LGW A;  1O3S A;  3RYP A;  4YFK F;  1HKS A;  1MDM B;  1G3T A;  2YPR A;  3KLN A;  2ADU A;  4NQW A;  2NYX A;  1XCV A;  3GFL A;  3IKT A;  2WC2 A;  4XRF A;  3R0J A;  2STW A;  4KN7 X;  2PI0 A;  2DQR A;  1UCR A;  3HIF A;  4EM0 B;  4ETS A;  1FSE A;  3DFG A;  3K1M A;  4ZYE A;  3E6D A;  3EDP A;  1HKQ A;  2DPU A;  5JHU A;  2DFI A;  3AAF A;  1EH8 A;  2FSW A;  4M6Y A;  5D4S A;  3BWG A;  2OQG A;  4IVN A;  2P7V B;  2IA2 A;  4IJA A;  1SD6 A;  3E5X A;  4G9Y A;  2ESN A;  5FB2 A;  2YR2 A;  3MWM A;  1K6O A;  1R1V A;  1R1T A;  1S3J A;  4UVB A;  4M9S A;  4Q48 A; 
#chains in the Genus database with same CATH topology
 1U78 A;  4ON0 A;  1O7F A;  5JVT A;  2IEK A;  4BXU A;  5ERI A;  1K61 A;  2IRF G;  3P9C A;  4PGH A;  2H8W A;  2LVS A;  4RAF A;  1XMA A;  3ABT A;  3BZC A;  3R0A A;  4ASN A;  3K2A A;  5EF6 A;  5FLM J;  2WBM A;  1IXR C;  3ML6 A;  2ZME A;  2HZT A;  1JUM A;  5IYB J;  3F8F A;  4IHT A;  4UB8 C;  5JI6 A;  1D8K A;  2ELH A;  4B44 A;  3HKZ N;  4BU2 A;  5D4R A;  1I1G A;  1Z3X A;  2L9R A;  3MVP A;  3QYB A;  1R5G A;  3LWF A;  4YFN F;  2CYY A;  4XMY A;  2Z2S B;  2V4J C;  5ED4 A;  3PQJ A;  4NQW B;  5L3G A;  3TDZ C;  3S14 J;  5AIQ A;  1GXQ A;  4Y52 J;  2CSO A;  1IDZ A;  5B1B H;  1W7P A;  2UXX A;  4I6Z A;  2XSJ C;  5J6X A;  2A6E F;  3WTY C;  5LHH A;  4IL6 C;  3I56 I;  4LLL A;  1QA6 A;  3ABU A;  4WF2 A;  1QVT A;  2GXA A;  2X85 A;  3F8B A;  2W4S A;  1B1B A;  4I0B A;  1FTT A;  3J81 Z;  1U3E M;  4BE1 A;  3LSK A;  4B3X A;  1WFX A;  3MCZ A;  2X48 A;  1U5T A;  3G4S I;  2V9K A;  3M8E A;  1JKR C;  1TP4 A;  5LRS A;  2XAJ A;  4WCG A;  4E70 A;  4LB5 A;  1UST A;  2IS4 A;  4JBA A;  2ZNZ A;  2ECB A;  3S1Q J;  1E17 A;  1BIB A;  4LLG F;  1WJB A;  3TED A;  2KFD A;  4PJ0 C;  3L00 A;  2CMP A;  3BQZ A;  4DOZ A;  1T38 A;  3H3Z A;  5DCM B;  3JTG A;  1I1S A;  4LK1 F;  1BC8 C;  3HDD A;  4AYB A;  4BXF A;  2VLA A;  3S93 A;  1SFK A;  2FJ1 A;  4QWQ A;  3M1E A;  2OCE A;  3ZQF A;  2GA1 A;  4PJL A;  4BAC A;  1VQM I;  1GDT A;  3K9T A;  2GIZ A;  3L2V A;  3HKZ A;  1IF1 A;  4IKF A;  2R7S A;  3ULQ B;  2XKP A;  4A69 C;  1MBH A;  2P5K A;  4UXN A;  4A3G J;  4QSH A;  1DP7 P;  3DU5 A;  2OZU A;  2ZXW H;  2L9V A;  4RA2 A;  3HGY A;  2MD5 A;  4EJO A;  3K4K A;  2HYJ A;  1FZP B;  5H6Q A;  4CIC A;  4Q5S F;  3S32 A;  3VDX A;  2L0K A;  1LFU P;  2EQR A;  1B72 B;  3OIP A;  1TTY A;  1TW2 A;  1W5S A;  2KDO A;  5LGT A;  2IJL A;  4AVP A;  4EM2 A;  4HNU A;  4A0X A;  3AG3 H;  4E7J A;  5KNL A;  2VJJ A;  1BI0 A;  3ELK A;  3RDI A;  1W0U A;  1JJ6 C;  4CH7 A;  4JX5 A;  1S6L A;  3RZD J;  3G2B A;  1I6X A;  2IS2 A;  4MIM A;  1HST A;  4DBR A;  4NNJ A;  3GX4 X;  2CS3 A;  2D1V A;  2JJ7 A;  2HPM A;  2D45 A;  2VKD A;  4CYC A;  1F36 A;  5TRD A;  1Y0U A;  4NUB A;  4Y4R A;  1UHW A;  3RJP A;  4Y7N J;  4ZDL A;  3MKY B;  4LFU A;  2CUZ A;  4ANJ A;  4KIG A;  3KLO A;  2VQG A;  1HW5 A;  3U1D A;  1OIS A;  2LLK A;  2OQR A;  3LMM A;  4E7K A;  2O8K A;  5EEG A;  2DOD A;  4G6Q A;  2VOP A;  2P6T A;  2FXA A;  4MTD A;  1HXD A;  3LSJ A;  1MBK A;  3AKZ A;  1ZR4 A;  1GT0 C;  1MMG A;  4LJZ F;  5IP7 J;  1Z1D A;  3H5N A;  1NK3 P;  3GZ5 A;  1T6S A;  2EA4 A;  1TT0 A;  4YEJ A;  1TWH J;  3CCJ I;  3FM3 A;  2HI3 A;  4HX4 A;  3BR6 A;  3VYT B;  3VYS B;  2R7Q A;  5IT9 Z;  2AHQ A;  4G7H F;  1XTA A;  2O9L A;  2GQQ A;  2RDP A;  3H5A A;  2DA5 A;  3QPL A;  1VTN C;  4MHG A;  4E7S A;  1BI1 A;  5GPA A;  3WGG A;  2YX7 A;  3S15 J;  3DF8 A;  1G3W A;  4XRS G;  1IW7 F;  1MH3 A;  1WPK A;  4RB3 C;  1RUO A;  2MA3 A;  3WOD F;  1J2X A;  4C9Y A;  2W48 A;  2L01 A;  2R0Q C;  1DUX C;  1APL C;  4NC7 A;  4YG2 F;  1A35 A;  4I02 A;  3LSM A;  2F5F A;  1C0W A;  4IHV A;  4PJJ A;  4DNC A;  1RR7 A;  1YLF A;  2KZV A;  5JLX A;  4CHU A;  4IHS A;  2BHZ A;  4AYB N;  1OCR H;  1VQ9 I;  3KYD B;  2M4G A;  2DO7 A;  1WRJ A;  5L3E A;  2LY2 A;  3NAU A;  3OR1 C;  1BR2 A;  1Q1V A;  1X1P A;  2BY1 A;  2B63 J;  3AL0 C;  3IH3 A;  1PYV A;  1YQA A;  2GWR A;  1A04 A;  3RKQ A;  2FQ3 A;  1YS6 A;  1G3Y A;  2CQQ A;  3RIR A;  1EH6 A;  4IRI A;  5EJC A;  2MYS A;  5A2Q Z;  1B9N A;  1DPR A;  4JYK A;  3BP8 A;  4CDG A;  3LSP A;  1WJC A;  3LA2 A;  4U87 A;  4QIW N;  1Z0X A;  3ZGK A;  5GAG J;  4BJ5 C;  5B5E C;  2YU9 J;  3D0S A;  3HRT A;  3CF5 F;  4A3K J;  1SEU A;  2O3F A;  1ZG3 A;  2TDX A;  3CZ6 A;  1WJA A;  1MD0 A;  4GXO A;  5A2Q K;  3CTA A;  2GXB A;  3JRI A;  3HRU A;  3BY6 A;  3DXJ F;  1TL8 A;  5BOX A;  3BCB A;  4RGU A;  4LG0 B;  3BDD A;  2BGC A;  2I10 A;  2VBY A;  3ZMU A;  5KCM A;  2QM3 A;  3QRF F;  3O8G A;  4QPQ A;  5IY5 H;  2HGC A;  5EYR A;  3MZY A;  1PUF B;  3R61 A;  5EGO B;  1TQM A;  2CUJ A;  3G3Z A;  1B9M A;  2W57 A;  3EYY A;  4XLF A;  3LST A;  3W6K B;  4M6V A;  2Z99 A;  1N25 A;  1MJA A;  4BL0 B;  5DCF A;  3M1C A;  4ZYD A;  3L7W A;  3GW2 A;  4EJT A;  3LA3 A;  3SZG A;  3FXL A;  2Y9Z A;  4O3M A;  1HC8 A;  1YRN A;  1MMA A;  1IO2 A;  1MIJ A;  1YW9 A;  4IQ4 A;  1SC7 A;  2DOF A;  1BOA A;  2JZY A;  1T0F A;  3FKI J;  3TP0 A;  4F3Q A;  3ZP5 A;  4HLY A;  1AU7 A;  3HUG A;  1F9N A;  1JGS A;  1R49 A;  5M3F J;  3ECH A;  5ILS A;  4A0Z A;  1YW7 A;  5C4J J;  4XLP F;  2ZNY A;  4HF1 A;  3CJT B;  1X2M A;  2BV6 A;  1UB9 A;  1OCC H;  4L9T A;  4XRM A;  1X1A A;  2DK8 A;  3VYU B;  1O7L A;  3A01 B;  2O8X A;  3GUD A;  4ABZ A;  2A61 A;  3BTJ A;  3OS2 A;  4M9X A;  5L3C A;  2HXI A;  1NG7 A;  1Z05 A;  4LG0 A;  1TNS A;  2EA2 A;  1D0X A;  3G1L A;  4L5J A;  2R7F A;  3N05 A;  4RM2 A;  2NOG A;  3S3N A;  1GXP A;  4RGR A;  2XRL A;  2CH0 A;  1Y56 A;  1NTC A;  2ESH A;  2L5Q A;  4MLO A;  5ICF A;  4B8X A;  1P7I A;  2PMZ N;  3FXQ A;  1S7O A;  2OJE D;  3QU3 A;  4ZZD A;  2CW8 A;  2CV1 A;  4AUX A;  5FJ8 J;  1I27 A;  1V55 H;  2YX4 A;  2K3F A;  3B6C A;  1MSF C;  4PGG A;  1X1B A;  3QOP A;  3AL0 B;  3T8R A;  1QZZ A;  3H9G A;  3M3Y J;  5IPA A;  1HBX G;  2DU9 A;  4C2U A;  1BI2 A;  2LMD A;  3I5U A;  3OYK A;  2PJR A;  3D5R C;  2CW0 F;  3E6M A;  3U21 A;  4XK4 A;  2NNN A;  3LOC A;  1W7P D;  3GEZ A;  3VEP A;  4MNU A;  4HZF A;  5CVJ A;  2CU7 A;  4BS9 A;  2R7T A;  1A31 A;  3LA7 A;  1B72 A;  3HEF A;  2FQ4 A;  3ONQ A;  4FE7 A;  3A0B C;  4RGS A;  3GXO A;  3TQN A;  5KHD A;  1RES A;  2XPV A;  2A07 F;  3KX2 A;  5LGU A;  1Z3Y A;  1FBU A;  2GBY A;  3A01 A;  2DT7 B;  3RPU D;  1R6R A;  2E2H J;  3M8F A;  3K4M A;  4IRG A;  4RLQ A;  3ZMD A;  2PJR B;  4UB6 C;  2Y2Z A;  2A3S A;  1MMN A;  4M3E A;  4Y17 A;  4NC6 A;  4MEX F;  4Q4Z F;  2K5C A;  3I54 A;  2MFZ A;  3X2Q H;  3ZQH A;  1J0R A;  5DD8 A;  2ZC2 A;  2LOO A;  1TQP A;  1ETY A;  2FOK A;  2VOD A;  1AOY A;  1F1Z A;  5HDN A;  4A3D J;  3FZV A;  1S9H A;  2UXN A;  5J8C A;  1IUY A;  4UVC A;  5FGM A;  1WWX A;  3VPR A;  3ABK H;  4BJT A;  4L0Y B;  4HF2 A;  1FP1 D;  4P1W A;  1O57 A;  1HW1 A;  2KPM A;  3DP7 A;  2F5V A;  2VT3 A;  2PFB A;  2V7F A;  2LBF B;  4AC0 A;  2W00 A;  3V8J A;  1X4O A;  1WVR A;  4L9N A;  3OV8 A;  1R00 A;  2F5D A;  3OYH A;  1G2H A;  2BY3 A;  2HKX A;  2VT2 A;  3S1R J;  3DPL C;  1J7K A;  2FNP A;  2M5W A;  1HSJ A;  5AON A;  4PSX A;  1E3P A;  3S17 J;  3A03 A;  3JRD A;  3E97 A;  2E1M B;  4PZJ A;  5E8G A;  3NEU A;  3QAH A;  4RM3 A;  4F7Z A;  3GTM J;  1TWC J;  3KEY A;  3EUK L;  3B02 A;  1UG0 A;  2VKV A;  3FDY A;  3HRM A;  2VJ5 A;  1XMK A;  3CUQ B;  4ZYA A;  2WAQ N;  5TGT A;  2AQE A;  1ZG1 A;  3H36 A;  2F5E A;  2IVM A;  5IP6 A;  1WJ5 A;  3WGH A;  3PIP F;  4A3I J;  5E3N A;  1RRJ A;  4NHJ A;  3HHG A;  5CKT A;  2DT6 A;  4M74 A;  4NB5 A;  3FX3 A;  3FHZ A;  3BRO A;  3HSF A;  2MAB A;  1W1W E;  1K6Y A;  1MJ9 A;  5K5O A;  2Z1D A;  1E2X A;  5LFA A;  1U8R A;  3LNQ A;  2NVQ J;  1X3W B;  2IAI A;  2CV2 A;  4E4H A;  1S29 A;  3QU6 A;  4UHT A;  1PUE E;  2EFN A;  3H9Q A;  1ZHF A;  3JRC A;  1R1U A;  2IP2 A;  3HOU J;  2DMQ A;  4RS8 A;  2O7O A;  3TW6 A;  1T08 B;  1GUU A;  2PG4 A;  3L9F A;  4EGY A;  1ZRD A;  1ZLK A;  1KON A;  2Z3Y A;  2X1C A;  4D7M A;  3FXM A;  1ERD A;  5LRR A;  2STT A;  3BR3 A;  1ITY A;  4IOA F;  3ROU A;  3DTI A;  4MFE A;  2JSP A;  1BOB A;  4CCM A;  5C4X J;  1RNL A;  4ZYG A;  2KHM A;  1EH7 A;  1XSX A;  2NVT J;  1ZYR F;  4IF4 A;  1VQ7 I;  3HOZ J;  1OCT C;  2V6E A;  4H0E A;  3TKY A;  5J3L A;  2FF4 A;  3H0D A;  4XSZ F;  3SDB A;  1JUS A;  2DN0 A;  2EIL H;  3OYC A;  5GPC A;  1XB4 A;  2F6C A;  2EZL A;  2V1D A;  2LY9 A;  1R58 A;  2ELJ A;  2KIS A;  3F23 A;  2AS5 F;  3O2P E;  1JTX A;  2XRN A;  4AIH A;  1UAA A;  3T1B A;  2D1H A;  2JPB A;  3PQK A;  3OOP A;  1SFX A;  2OA4 A;  3DV8 A;  4Q47 A;  3WTZ A;  2J5O A;  1K79 A;  4R1H A;  4PFO A;  2PX9 A;  5H2F C;  1T2K A;  3HB9 A;  1KGS A;  1KQ0 A;  1MKM A;  1TNT A;  4A3C J;  1LDK B;  2ME6 A;  2X6W A;  3L09 A;  4BYY A;  2CFO A;  3IRR A;  3HTU A;  5JLW A;  2CQ7 A;  1FYL A;  2H09 A;  3R60 A;  2JMW A;  3KFW X;  3BZK A;  4FIS A;  2F4M B;  2E5N A;  3DKW A;  2O03 A;  1HCR A;  5F1J A;  4YII A;  5E1X A;  4AIK A;  1HLV A;  3OS0 A;  3P7N A;  4XN0 A;  5J4V A;  2EZI A;  3S1N J;  2L7K A;  1W7P B;  2UWM A;  1WJF A;  1G3S A;  4LIV A;  1VQ6 I;  2Y0S A;  3Q9V A;  3OYM A;  4KUM A;  4CZC A;  2BEO A;  4PDK A;  3ZXS A;  3K4L A;  2BVM A;  1N78 A;  3PUF A;  1OKR A;  3I4M J;  1IN7 A;  4DIQ A;  4V19 K;  5HNH A;  1YJ9 I;  3BTC A;  3H3V K;  1QRY A;  1LDJ A;  2RGV A;  4J01 A;  1KQ9 A;  2ZXJ A;  3I4N J;  2NAZ A;  1ZAO A;  1VI0 A;  1XG1 A;  1WKM A;  2IW5 A;  4XOT A;  3SEQ A;  4ZYH A;  3Q5F A;  4A3L J;  2LP0 A;  1U9N A;  4GFB A;  2BE5 F;  5F04 A;  4EMS A;  1LDD A;  2FBH A;  3I59 A;  2ME0 A;  3HBL A;  3A02 A;  2IGO A;  2IBD A;  2CFX A;  3KP5 A;  1BBY A;  4D5F A;  1BN5 A;  3MN2 A;  2CG4 A;  1ZLJ A;  1ETX A;  2X6X A;  1WH5 A;  1MMS A;  5H6R A;  2L02 A;  4U7B A;  2HFH A;  2XPW A;  2QWW A;  4G6D A;  4HLX A;  3K1P A;  4KMF A;  2ACJ A;  1KU3 A;  4I7H A;  4Y3O A;  4P5O A;  2LRD A;  4KIC A;  2M8E A;  1Z21 A;  4ENK A;  1K78 A;  1IV6 A;  5CPR B;  2DBB A;  4LK0 F;  4U0V A;  5FKO A;  2JA7 J;  2GAU A;  2QKL B;  3V8K A;  3ZOB A;  2ZME B;  2I5U A;  3PFI A;  4A6E A;  2V1U A;  5L3F A;  2P4W A;  3CQZ J;  3RYR A;  2BVL A;  4KMU X;  3RZO J;  3ZPL A;  5L3B A;  2H27 A;  1Y0N A;  2QF7 A;  3RKW A;  2NVU B;  3ZQG A;  5FLX Z;  2EIN H;  1F4K A;  2HOS A;  4BQA A;  4UY8 I;  4HNV A;  3E7L A;  4R79 A;  1IXS B;  3K4J A;  3B6A A;  4O5V A;  2EZH A;  3A0H C;  3QP6 A;  4HPQ A;  2CQX A;  3F8M A;  3OSG A;  2ZSI B;  2HDW A;  3L1P A;  2CW7 A;  4I99 C;  3IUO A;  3G1O A;  4PUS A;  2Q8K A;  3K70 D;  1LE8 B;  2DA6 A;  2OV7 A;  2CQK A;  5IOY A;  1GVD A;  2JUC A;  2JA2 A;  2PQ8 A;  1A36 A;  2HEO A;  2BW3 A;  4BNC A;  1RPW A;  5HS7 A;  1YOV B;  1XMX A;  1RIO H;  2X0L A;  1Z7L A;  4MQV A;  3S16 J;  2E60 A;  4DBQ A;  3J7Z I;  3R4K A;  1SVO A;  2R7R A;  1YHQ I;  1DU6 A;  2KMU A;  5CLS A;  2DAO A;  4C2M J;  4DYR A;  2R5Z A;  4BBS J;  5GTI C;  1R9T J;  1RZ4 A;  1VQK I;  1QNT A;  2KQR A;  3VYR B;  3MKZ A;  4U0Y A;  1LB2 A;  1YJW I;  5FFX A;  4XON A;  3ISP A;  2XKO A;  1ZK8 A;  3KZY A;  5LD2 C;  2WB1 A;  2RN7 A;  1YYV A;  2KIQ A;  2HDD A;  5K5R A;  2HDC A;  4JK1 X;  3RKY A;  3T5X A;  2EFW A;  4QTR A;  2GXG A;  2JRT A;  2XGD A;  3RQI A;  2UUZ A;  3CCU I;  4LLN A;  1BIA A;  3WTS C;  1EA3 A;  3FKJ A;  2IS6 A;  3DCF A;  1HDD C;  3JTH A;  4GYI A;  1XSD A;  1AA7 A;  5BNG A;  3TW7 A;  2FBK A;  4JP0 A;  1QGP A;  1ZGA A;  1GV2 A;  5F0H A;  1QQI A;  3HPG A;  4EJW A;  1CGP A;  2EH3 A;  2RKH A;  2E1C A;  1FBS A;  2K4B A;  1YRN B;  1TQI A;  2BY2 A;  3JRH A;  3F21 A;  2XUB A;  2FEZ A;  3J80 K;  2HOA A;  3PSI A;  5D5X B;  2DYR H;  3K0L A;  3REO A;  2JA6 J;  2A5Y B;  3FK6 A;  4CXF A;  2VBW A;  2VL8 A;  5FD6 A;  2W84 A;  3JCU C;  1ZQ3 P;  3K4C A;  4BEH B;  3BPX A;  3I64 A;  1U8B A;  4F91 B;  1DDN A;  1BR4 A;  1QBJ A;  2Z5U A;  5K1Y A;  1YIT I;  2O5R A;  3DLL F;  1XGN A;  1B8I A;  1I3A A;  4E7I A;  3E0J B;  3OL4 A;  1NH3 A;  2R7Z J;  2XAQ A;  5DUK A;  2H8R A;  2ECC A;  4ZJZ A;  3TL4 X;  1AHD P;  5D5U B;  2HVR A;  5ICG A;  2XRO A;  1ZG5 A;  2MH2 A;  1IJW C;  3EET A;  5M3M J;  1H89 C;  1Z7U A;  4HF0 A;  4M71 A;  1FJL A;  1UZC A;  3LAJ A;  4DQ2 A;  2UV1 A;  2E36 A;  3LSH A;  2QZ8 A;  4E7H A;  3I55 I;  4ITV A;  4RB2 C;  4I76 A;  2HWV A;  3EUH C;  2WAF A;  1HDP A;  4L5E A;  1Z77 A;  4HNT A;  2E7X A;  2W82 A;  5HS8 A;  2DFE A;  2EIJ H;  5FD5 A;  1S8N A;  2AXT C;  2VKE A;  4HQM A;  3OYL A;  3OYG A;  2O0Y A;  4C3I J;  3DLA A;  3DPT A;  1HW2 A;  1DGR M;  3NWT A;  2DFF A;  2VIX A;  2WV0 A;  4ZH4 F;  3RQ4 A;  1CQT A;  2FX0 A;  3NRV A;  3OYN A;  4A2U A;  2XAU A;  1VQN I;  3M7G A;  1LEA A;  2BXZ A;  3CCY A;  2JK3 A;  3PFY A;  1LVA A;  1W0T A;  3BT9 A;  3TOA A;  3G71 I;  1TT5 B;  1AWC A;  3E5U A;  4XLE A;  2EFO A;  2H94 A;  1XGM A;  4HA8 A;  4JQF A;  2LNB A;  4XLC A;  3U1K A;  1T8I A;  4IX7 A;  4KNY A;  2XB0 X;  3BG3 A;  3DBL B;  1EV7 A;  5E8I A;  4DZP A;  2JA8 J;  1HA8 A;  3GWZ A;  3DKY A;  1RKT A;  2IA0 A;  3O6B B;  1IN5 A;  2PMH A;  2RNG A;  3ZQL A;  1YO5 C;  1S5L C;  2MC3 A;  2WTE A;  4BY7 J;  1STZ A;  3U2R A;  2VQL A;  1VQ4 I;  2ZO4 A;  3CLO A;  5JVG F;  4BGD A;  5LLQ A;  3GZ6 A;  1OPC A;  3C3W A;  5IYC J;  3HG9 A;  3ASO H;  3K2Z A;  4BQO A;  3LL7 A;  1YG2 A;  4NC8 A;  2XAF A;  1EJ9 A;  3CD6 I;  4KYW A;  2K9L A;  2KRC A;  1X3U A;  2DMT A;  1R71 A;  1FOK A;  3J7A Y;  4B47 A;  3HOW J;  4AWX B;  2P81 A;  4AVZ A;  3CUQ C;  3F8N A;  2W85 A;  4BHC A;  1YI2 I;  4CCL A;  3OYD A;  4HAM A;  4XLA A;  4MEY F;  1P7J A;  1VZ0 A;  2FA5 A;  2LY1 A;  2HYF A;  1P92 A;  1ONV A;  2EK5 A;  2QUF A;  3WG7 H;  4B43 A;  3OYJ A;  4C2T A;  1JJ8 C;  2CV0 A;  3CDH A;  5E79 C;  4HRI A;  2A68 F;  3PJR A;  3FIW A;  1YS7 A;  2DA2 A;  3OYB A;  2EZK A;  1J59 A;  2PBI A;  4XQF A;  1J75 A;  1T98 A;  3G1M A;  4XNF A;  3HOT A;  3DTE A;  4P96 A;  1OCO H;  2MLG A;  2HTJ A;  1CF7 A;  1DQU A;  3BJ6 A;  4G6T B;  4HW0 A;  1KYW A;  3VOE A;  1FOX A;  1XDS A;  3HRS A;  4U88 A;  3K70 C;  4RB0 A;  2ZB9 A;  3G6E I;  3K7A J;  2JTV A;  5EDN A;  3AG1 H;  4RDU A;  3KCC A;  3GF2 A;  2RC4 A;  4OIQ F;  3SFZ A;  3QQA A;  4X6A J;  3GTG J;  3PNT A;  3JAM K;  5CVV A;  1IC8 A;  2MLK A;  4XKW A;  2RQP A;  2QA4 I;  1R4N B;  4B1R A;  2BZT A;  4EJV A;  3HPH A;  4HST A;  2HZD A;  2PLY A;  3CCL I;  1OR7 C;  2L4A A;  2LKP A;  2PMZ A;  2FOW A;  5BQT A;  1SFO J;  3SQN A;  3BC8 A;  5DM6 F;  2DTZ A;  3DKX A;  2XB5 A;  2R5Z B;  1SAX A;  3CCS I;  2HXO A;  1RR8 C;  2FU4 A;  2DJN A;  4OIR F;  3KP3 A;  3ECO A;  2ZFW A;  3SYT A;  1LJ9 A;  1BC7 C;  3OWT A;  4E7Z A;  4A5N A;  1IUF A;  1Y39 A;  3CO7 C;  2P6S A;  2M7A A;  5CYV A;  3M07 A;  4MFD A;  2DOA A;  3CJR B;  1FYK A;  4FET A;  2X4H A;  1LUJ B;  3IV5 A;  1ON2 A;  3F6O A;  5FFZ A;  2XC7 A;  2AXL A;  2L7F P;  3GLL A;  3IAS 2;  4LB6 B;  5TJJ A;  3BOQ A;  3GTO J;  4HX7 A;  5L3D A;  4C3H J;  3Q0U A;  1U6G A;  5KAI C;  1VQP I;  1R4M B;  2E2J J;  1BM9 A;  4N4O B;  2DW4 A;  1HQC A;  1ULY A;  3SHF A;  3KP6 A;  3CUQ A;  3JRA A;  3FBN B;  2L4M A;  5DDG A;  4ZTJ A;  2OPT A;  4LIT A;  5FKL A;  1KU7 A;  2OTL I;  2Y48 A;  4BY1 J;  3COA C;  5DCM A;  5M5Y J;  3HOS A;  3BCA A;  4F55 A;  1BI3 A;  2L7M P;  4XL9 A;  1U2W A;  1V5E A;  2HR3 A;  2HTS A;  3CCQ I;  2X6Y A;  3HOY J;  2YSR A;  4BXX J;  3HZJ A;  3J7Y J;  4D9J A;  2COB A;  4L9J A;  2DCE A;  3I0T A;  5DS9 A;  2V26 A;  1FSH A;  1R7J A;  1N75 A;  1DGW Y;  1FIA A;  1U5T B;  3V8L A;  3IRQ A;  3GTL J;  3OMY A;  2K85 A;  4XKV A;  1SD5 A;  3GZN B;  3J80 Z;  1YTY A;  1H8A C;  2MBF A;  3E1S A;  4BUP A;  1W5T A;  3L2Q A;  3PSF A;  4PK4 A;  1LVK A;  4FX0 A;  1WCM J;  2DA7 A;  2K02 A;  4NDL A;  3I71 A;  4XIC A;  4ESJ A;  1T33 A;  3GO5 A;  5B3S H;  1B4A A;  1IZ1 A;  1R36 A;  2WA0 A;  2OZ6 A;  4X0G A;  3S2D J;  1D1C A;  4AID A;  5HS9 A;  1BW5 A;  3ZRG A;  2L9S A;  2OCC H;  2JA5 J;  2E34 A;  1PVE A;  2J5P A;  4FHT A;  3HXL A;  1S7A A;  2LC2 A;  3TO6 A;  4BQN A;  5ICE A;  4ENN A;  2NNY A;  3C7J A;  1OYI A;  3PL8 A;  2K9S A;  4UUS A;  3N97 A;  5J8F A;  1LNW A;  3ERM A;  2H1L A;  3I58 A;  2V6C A;  2FBI A;  3KPH A;  1LEB A;  2EWN A;  4KIF A;  5HNF A;  2NVY J;  3ZQ7 A;  4KJZ A;  2R7W A;  4YEL A;  2BHY A;  2BY0 A;  4XLH A;  4D7N A;  4XM3 A;  1LPQ A;  2EIM H;  1AKH B;  4RGX A;  3ZN1 A;  1P4A A;  3P5J A;  1KU9 A;  4P9U A;  2WAE A;  2X51 A;  1SD7 A;  3AG2 H;  4HDV A;  4HSR A;  3PO2 J;  3Q0W A;  3QYF A;  4XOP A;  3JR9 A;  3S2H J;  3EPZ A;  5FO5 A;  3T0Y A;  2K9Q A;  1MBF A;  1P6R A;  1K78 B;  1BL0 A;  1PDN C;  5IYD J;  4KT6 A;  1H9G A;  5LBQ A;  1ZRF A;  3VB2 A;  1P4W A;  4V2G A;  1QPM A;  3Q3S A;  3PUB A;  3A1Y A;  3PNV A;  2VBX A;  2NXN B;  2JQ7 A;  4Y33 A;  2GZW A;  3TO7 A;  5K7Z A;  2DTR A;  2FMY A;  2VJI A;  3MQ0 A;  4FAS D;  1OLT A;  3NQO A;  3E6C C;  4CYD A;  4DYC A;  3EUH A;  3KZZ A;  1FC3 A;  5K7H A;  5HLH A;  2QSG X;  3JRF A;  1YJN I;  1ETO A;  2GLO A;  1J5Y A;  4Y13 A;  1BJA A;  2HU9 A;  4P55 A;  1HF0 A;  3MFK A;  4I0A A;  1P4X A;  5D8L B;  4EQQ A;  2NS0 A;  1FWZ A;  2JT1 A;  3QPT A;  1QPI A;  2HVQ A;  4QLC U;  5D5V B;  1XS9 A;  4TV7 A;  2EIK H;  3SFI A;  2LSO A;  1O3Q A;  2XSD C;  2CUE A;  4RLF A;  1M1E B;  4CSW A;  3L2U A;  1K4S A;  2P0W A;  1SVM A;  3KP4 A;  4FE4 A;  2COM A;  1XGS A;  3F9K A;  4OMY A;  2KDZ A;  5E1W A;  2DDB A;  4CO8 A;  4ZZL A;  2WWY A;  2MW8 A;  3I59 B;  3K1N A;  3N4M A;  1MBJ A;  4RAG A;  1PP8 F;  2X6O A;  4D0P A;  1B59 A;  1YW8 A;  1MND A;  1YX3 A;  5CVU A;  2IT0 A;  2E1N A;  5TIS C;  3D1N I;  4B4C A;  2M8G X;  3TBI A;  2BBY A;  1JXS A;  1FMV A;  4WXC A;  1MGT A;  1U5T C;  5ILV A;  3IHU A;  4G7Z F;  5CJ9 A;  3GTK J;  2LF7 A;  4BJ6 C;  5CQG A;  2CRG A;  2DJI A;  5E20 A;  3HHH A;  4M72 A;  2QQB A;  3HUG B;  1ZRC A;  1ZRE A;  3FM5 A;  2OBP A;  2R3S A;  5J1U A;  3QYE A;  4EVI A;  3KP7 A;  1Y6I A;  2ISZ A;  3W2W A;  4RAZ A;  1OMI A;  3BZ6 A;  3ZQC A;  4F92 B;  2NOJ B;  1A6I A;  3ZQQ A;  3OYE A;  2DYS H;  2OAZ A;  5HLI A;  3OSF A;  1RUN A;  2R7U A;  3B73 A;  3H5R A;  1JHH A;  3EYI A;  3KE2 A;  5HDG A;  4K2E A;  2B7E A;  2MG4 A;  3C18 A;  3MZ8 A;  1LKX A;  2Y69 H;  2EV0 A;  4ENJ A;  2Y31 A;  1VFC A;  2QBY B;  2M34 A;  3FXR A;  2RNJ A;  3I9V 2;  3OL3 A;  4J19 A;  3BR5 A;  1OJL A;  3FXJ A;  3HOX J;  4I09 A;  2WY8 Q;  1USS A;  2GOX B;  4U7D A;  3V4G A;  5AIP A;  2Q0O A;  3FMQ A;  2DLL A;  4B09 A;  1TZL A;  1KYZ A;  1E0E A;  2L54 A;  2A69 F;  3Q9S A;  2XGC A;  4EAT A;  3TOB A;  3CDL A;  5DEQ A;  3TDU C;  2EJR A;  4BBR J;  3WU2 C;  4FX4 A;  2F4O B;  1IG7 A;  2VB6 A;  1JI8 A;  1ACI A;  3LAP A;  3UNG C;  2MSY A;  4S05 A;  1PJR A;  2F4I A;  2DPD A;  2DDA A;  2KT0 A;  3MAJ A;  3RPU A;  4MTE A;  3DQV C;  3AFH A;  4Y15 A;  4AD9 A;  3K69 A;  1HKT A;  2TCT A;  1JKQ C;  2VE8 A;  3OOU A;  1JT6 A;  4M3B A;  3AG4 H;  2ZJP F;  3U9G A;  4CZZ A;  3OYF A;  5BPI A;  4OAZ A;  2LR8 A;  1KU2 A;  1P9Q C;  1FYM A;  5C44 J;  4E7L A;  1HOM A;  5ICC A;  2ZJ2 A;  4UNO A;  4XKB A;  1TWF J;  3UR3 C;  3WE3 A;  1ODD A;  2YU3 A;  1I5Z A;  2QSH X;  3G73 A;  3T8T A;  3GVA A;  3ZMV A;  2K86 A;  4A3F J;  3H35 A;  2VUM J;  4I98 B;  3ESW B;  4M3G A;  1XDU A;  5GAE J;  4EV0 A;  3I4P A;  4XRS A;  1R22 A;  2P7C B;  1JKP C;  1BW6 A;  2DK5 A;  2V9P A;  1IAW A;  4OWR B;  2NS7 A;  2XAS A;  5BPD A;  5GAH J;  2WAQ A;  5CVR A;  2MD0 A;  4F93 B;  3OY9 A;  4GO1 A;  2IA1 A;  3GTQ J;  2CWE A;  2QCO A;  3RPQ A;  3ZN0 A;  1X2N A;  4GRI A;  1UHM A;  1D5V A;  3EUA A;  1QHG A;  2K9M A;  4F52 A;  2K4J A;  1PUF A;  4KIT B;  1FMW A;  2Q2E A;  3M8J A;  4M3F A;  1D3Y A;  1I50 J;  4P9F A;  5DTD A;  4XBF A;  1TWA J;  2ZME C;  3CO6 C;  3J81 K;  3CCV I;  4JOM A;  2K9N A;  4I2O A;  1TC3 C;  1Z91 A;  1OCZ H;  3ZCO A;  2M7B A;  1KQ8 A;  1FX7 A;  1V3F A;  1G6N A;  4RAY A;  2ID3 A;  2VE9 A;  2XF6 A;  2XAH A;  5GAD J;  5IP9 J;  4IOC F;  1FNN A;  9ANT A;  3WG9 A;  1JE8 A;  3FWE A;  1UG2 A;  4LMY A;  3S3O A;  5DM7 F;  5HDK A;  4UUS B;  4A3J J;  3TP3 A;  4YIF A;  1SMY F;  1W4M A;  1POG A;  1FBQ A;  4RB1 A;  1PP7 U;  3LSR A;  1AKH A;  2LDU A;  3QPH A;  3CC2 I;  2NS8 A;  4LG3 A;  1WJE A;  2XGX A;  5D6F A;  3BG6 A;  4QPO A;  2FNA A;  2XV4 S;  1Z67 A;  1Z6T A;  2ZXH A;  2E5Z A;  3EQL F;  2FRH A;  3HC7 A;  4ESF A;  3WTW C;  1JTY A;  2QVO A;  3A2K A;  1RC9 A;  4L18 B;  4PSW A;  2UZK A;  2KLO A;  4WWC A;  2VXZ A;  5LGN A;  2V1N A;  2H6C A;  4R8H A;  4HDU A;  2M9H A;  4A12 A;  5DD4 A;  2YUS A;  3GBG A;  5LEJ A;  2DI3 A;  2JVG A;  1B6A A;  2O6G E;  3BPV A;  3FMR A;  4L9V A;  1K83 J;  1UJ8 A;  5LEK A;  3MKL A;  2GIV A;  3LQR A;  5FRN A;  3JSP A;  1FOY A;  4KIB A;  1X1D A;  2KL4 A;  1W36 D;  2TRT A;  3D5L A;  4XR6 A;  4BKX A;  1FIP A;  2PN6 A;  4N9H A;  2R5Y B;  3RKX A;  2P5V A;  5JR3 A;  5J1R A;  2M3A A;  4G7O F;  2KIM A;  4G8X A;  4MGR A;  2LRE A;  1YE9 A;  4M6X A;  4A93 J;  5DUI A;  2ID6 A;  3CC7 I;  2FE3 A;  1V5F A;  2W24 A;  5CQE A;  1S72 I;  3WHC A;  3PM1 A;  2KRH A;  3W3C A;  4A0Y A;  2LD5 A;  2ZKZ A;  5K5Q A;  3CC4 I;  2XF7 A;  2ETH A;  3UKG A;  2M4K A;  3KIO A;  4BDZ A;  3PIO F;  2P5L C;  5FLV A;  4HQE A;  4A3B J;  2JPC A;  2XDV A;  3BJA A;  1N77 A;  3RSN A;  5HVQ C;  3CDI A;  1L3L A;  2LK2 A;  4KN4 X;  3JRE A;  2FD5 A;  3O8H A;  2HOT A;  2HYG D;  2FUG 2;  3H9J A;  1UFM A;  1Y8R B;  1NG6 A;  2E1O A;  2G7U A;  3LSI A;  2R92 J;  4H4K C;  3FIS A;  3K10 A;  3DBH B;  3C2H A;  1MZB A;  4GDF A;  1IDY A;  1TWG J;  5LHI A;  1SFE A;  2OD5 A;  2KP6 A;  3JRG A;  1I3Q J;  1V5G A;  3CP2 A;  1OR7 A;  1X58 A;  2Q1Z B;  1SVL A;  3LQQ A;  3FXO A;  2KIF A;  3OIO A;  3IAM 2;  2QYO A;  1ETK A;  1Z9C A;  3IH2 A;  3DEE A;  3KET A;  4C3J J;  1DP3 A;  3HOV J;  1QHH D;  3BG5 A;  4XLN F;  2FML A;  4PCQ A;  3W2A A;  5E18 F;  1T39 A;  3NWS A;  3JSO A;  2ELK A;  3F8C A;  1YIJ I;  2HOE A;  3ABM H;  3E6B A;  4ESB A;  3OIQ A;  1MJB A;  4YIR X;  3WTV C;  1GHC A;  1VND A;  2R7X A;  5FLX K;  4J00 A;  2G0E A;  4OIN F;  3OS1 A;  1P2F A;  1XD7 A;  2LG4 A;  1R5I D;  3L2C A;  1ZKG A;  3QOD A;  3SZT A;  3DU6 A;  3CMA I;  3FMS A;  1SAU A;  2H6B A;  4UVA A;  3FHN A;  1IN4 A;  1IN8 A;  2JWT A;  4HV5 A;  2VPL A;  2M45 A;  4YRV A;  4E6K G;  3H3U A;  4KFC A;  2G9W A;  3WTT C;  2F5C A;  2HS5 A;  3S1M J;  4OIO F;  1V54 H;  4CGZ A;  4MQ9 F;  4OIP F;  3QWL A;  1WHU A;  3RTR A;  3ZMZ A;  5M5W J;  2Y9Y A;  5FRM A;  1D5Y A;  3PO3 J;  4BE0 A;  2QEX I;  3QP5 A;  1R23 A;  1WSU A;  5H20 A;  2F2E A;  4CCK A;  4BHB A;  5KAF C;  1TW3 A;  1ON1 A;  2D5V A;  2HPI A;  4YFX F;  3C2G A;  4V2F A;  3WGI A;  4EGZ A;  1D8J A;  3KYL A;  4LOC A;  4UV8 A;  5F1R A;  2A5W A;  5FKN A;  1QZE A;  4KIS A;  2Z9O A;  3MZH A;  2DMN A;  1DPU A;  1K7A A;  1JHF A;  3FXU A;  4KDP A;  1GLN A;  3HSR A;  1QO0 D;  3O3K A;  1DU0 A;  2KRF A;  2W25 A;  2ZSH B;  2JN6 A;  4I01 A;  4OU0 A;  5DYM A;  1X4P A;  2QQ8 A;  1NK2 P;  3BJO A;  3BTL A;  1XN7 A;  2EBI A;  1H0M A;  2IGN A;  3J7A O;  1ETW A;  2VBZ A;  4EJU A;  1SD4 A;  1OFC X;  4KT5 C;  5CVI A;  3QPS A;  3LFU A;  5FKM A;  2EFQ A;  4C30 A;  4A5M A;  3RCO A;  1EKE A;  2MGQ A;  2A6H F;  2VQC A;  1ZN2 A;  2RQQ A;  1OCP A;  1QZY A;  2P8T A;  3GFJ A;  5GP9 A;  3HTS B;  1GVJ A;  2OC6 A;  1J09 A;  2CGP A;  1WI9 A;  1RI7 A;  4O6J A;  4B48 A;  3QOE A;  1D0Z A;  2VAS A;  1ETQ A;  4GYG A;  1MBG A;  4HOB A;  1VQO I;  2V1X A;  5F08 A;  5E3O A;  3CCE I;  4U0W A;  3LFK A;  2OF7 A;  2CUF A;  1G59 A;  3CMM A;  1WQ2 A;  2XGE A;  2W1O A;  2R7D A;  2DA4 A;  2LFB A;  5EEH A;  2ZJR F;  4MO7 A;  1MBE A;  3GTJ J;  1O3R A;  4HV6 A;  2VXD A;  2D2W A;  2IGK A;  4ENM A;  3JW4 A;  5J1Y A;  4HBL A;  1RET A;  4W97 A;  4JX4 A;  3H92 A;  3KEQ A;  3VOD A;  3GFI A;  2BYV E;  2RRE A;  3R6S A;  3WHB A;  3MKW B;  3HSE A;  1XPX A;  2EV5 A;  4S04 A;  5JFR A;  2VC0 A;  4BE2 A;  4XN3 A;  3E5Q A;  4PJM A;  3Q0V A;  1OYY A;  3CJN A;  3KEO A;  3BG9 A;  1BA5 A;  3IH4 A;  2HVS A;  4DW6 A;  5F0C A;  1ZR2 A;  2QLZ A;  4UUV A;  1UHS A;  3V7S A;  1FT9 A;  2PJP A;  3GFM A;  3CCR I;  3K6G A;  3F6V A;  2K27 A;  2KIU A;  4CCO A;  5IT3 A;  2G7H A;  2M0C A;  2ZXI A;  3WU0 A;  2DA3 A;  3ZR8 X;  4AM3 A;  2O61 A;  1NHA A;  3W6J B;  6PAX A;  3FF5 A;  1G4D A;  1XCB A;  4XKC A;  2HQN A;  1MNM C;  3BTI A;  2XIG A;  1S7E A;  2A6T A;  1FOW A;  2X9D A;  2Y0M A;  4IHX A;  2LYC A;  4X1E A;  3V7R A;  4IRH A;  1Z6R A;  2ZCW A;  1T56 A;  3PNY A;  1A6Q A;  1Q1H A;  2E7W A;  3A4C A;  4Z2Y A;  2V9V A;  4XID A;  2VOO A;  1I6H J;  1W5C C;  5K7F A;  1JKO C;  1GV5 A;  3HJE A;  3F3X A;  2BW3 B;  2RAE A;  3BR1 A;  2M1B A;  4OMZ A;  2B9S A;  2DFH A;  3H0G J;  5F0F A;  4L0Z B;  1Y1V J;  4WK8 F;  1K4T A;  2JSC A;  4PJN A;  4OOI A;  1YX5 A;  1D1B A;  3F0C A;  2QEN A;  2R93 J;  4UV9 A;  2LH9 A;  4G94 A;  4PFP A;  4IQJ A;  2IXS A;  2X1E A;  3JAM Z;  1Y1W J;  5F6F A;  1YIO A;  3L2W A;  2E1M C;  2VN2 A;  3M4O J;  3C2B A;  2HQA A;  1WJD A;  1X19 A;  1SFU A;  5F64 A;  2K7L A;  4Z6Y A;  2OU2 A;  1UMQ A;  2LF8 A;  4CYC B;  4UUT A;  2LTP A;  1OYW A;  3FXK A;  2L3D A;  2CJJ A;  3HYI A;  5EZH A;  3CME I;  2PEX A;  2DA1 A;  5HOD A;  2K40 A;  4HYE A;  2F48 A;  4WX9 A;  4D1Q A;  1J9I A;  3WE2 A;  3IC7 A;  3IKV A;  5JHF A;  3MD2 A;  4DYQ A;  2M30 A;  3ZMT A;  1X3Z B;  2KJC A;  4LD5 A;  4IHW A;  1FY7 A;  2L2O A;  3IWF A;  2RVC A;  2Y0S N;  3RI4 A;  4ZDO A;  4W1U A;  1LE8 A;  4BH9 A;  3L2R A;  3S3M A;  1V4R A;  2M87 A;  3FBI B;  4L5I A;  3W2V A;  2VKH A;  2ICW G;  5E3L A;  4DJA A;  2ZBK A;  4GGG A;  1E3O C;  5D5W B;  5KK1 A;  1JGG A;  1VF9 A;  5D6E A;  2GOM A;  2DT5 A;  2ZJQ F;  2AQF A;  1IRG A;  3WU1 B;  4IPA A;  1FEX A;  4CA0 A;  1FP2 A;  2EFP A;  3ERE D;  1EF4 A;  2R7V A;  3MEX A;  5FKK A;  1VQL I;  4IHY A;  2B0L A;  1H88 C;  5J4Y A;  3VWB A;  1MDM A;  1ZH5 A;  1MH4 A;  1ENH A;  2AO9 A;  4LIU A;  1REP C;  3VFZ A;  1JUP A;  1QVU A;  3WTX C;  4ZC3 A;  1B8I B;  1QU3 A;  2EV6 A;  1LQ1 A;  1WZ2 A;  3JRB A;  2R5Y A;  4GCV A;  3CP8 A;  2EPF A;  3GYH X;  2W7N A;  4N9I A;  2NRA C;  2Q2E B;  2Y30 A;  5BS6 A;  4M9Z A;  2V79 A;  4OAY A;  3KZI C;  1TLH B;  4NBQ A;  4N0B A;  2C6Y A;  2R4G A;  1I39 A;  3DTK A;  3M9A A;  3SDG A;  1H9T A;  2QSF X;  3HGG A;  2LKX A;  1FTZ A;  4WXD A;  3DEW A;  3TO9 A;  3K4N A;  1ZGJ A;  5D8K B;  1WGX A;  2ISY A;  2JVH A;  1D0Y A;  2E71 A;  1U0J A;  3KP2 A;  5E1Z B;  5GTH C;  3V7C A;  1D1A A;  2N8G A;  1MNE A;  2QQA A;  3IWZ A;  3TGN A;  2E19 A;  3CMY A;  2EB7 A;  2A05 A;  3CUO A;  4HEA 2;  3P9I A;  4EEF G;  1W36 C;  5EZG A;  2NVX J;  1Y8Q B;  2MC4 A;  3FK7 A;  1KZH A;  3P9K A;  1F5T A;  3LSG A;  1FLI A;  2PMU A;  3BQY A;  4HX8 A;  2IPQ X;  3GLX A;  3DEU A;  2KJB A;  1CF7 B;  4XOR A;  3S2W A;  4FT8 A;  5IOZ A;  3CLQ A;  3VSK A;  1YFH A;  5LHG A;  5HLT A;  3C1D A;  2YS9 A;  5HOO A;  5BMZ A;  3GTP J;  2XHK A;  2CO5 A;  1IXC A;  2X1D A;  1ZEL A;  2WV1 A;  3IL2 A;  5B1A H;  1TBX A;  1MMD A;  2HQ5 A;  5DV5 A;  4B3A A;  4DGW B;  3F72 A;  3S8P A;  2VI6 A;  3I53 A;  4A6D A;  2DQL A;  1O3T A;  5KVR A;  2L9N A;  3DWL E;  5HLG A;  1OQY A;  1LFP A;  2Y75 A;  1ZAR A;  3ABL H;  1KA8 A;  1BJZ A;  1R5H A;  2BXY A;  2XPU A;  1IV8 A;  2XF5 A;  1XX5 A;  4CUG A;  3MMY B;  1WH7 A;  4M73 A;  4EM1 A;  4RMN A;  1LFB A;  2BOL A;  2RV8 A;  4FQG A;  4RBO A;  3HL2 A;  2K3P A;  5J40 A;  5M5X J;  2MH9 A;  1VQ5 I;  3ZMS A;  2KKO A;  4HG2 A;  4IXA A;  2WB1 N;  1BR1 A;  3SXY A;  3E3V A;  2GA2 A;  3DPU A;  5ILU A;  4II2 A;  3GME A;  4BQQ A;  2QBY A;  4II3 A;  2Z33 A;  5F27 A;  2HKO A;  3TMO A;  3WTU C;  2HQR A;  3W6V A;  4ZTF A;  2DMU A;  4WXH A;  4BHP A;  2R7O A;  4XSX F;  5EG0 B;  4AIJ A;  4S0H B;  3K4B A;  1UEL B;  4JX6 A;  1T0F C;  1XGO A;  2Z16 A;  1VQ8 I;  2WAD A;  1SMT A;  2KZG A;  1IRF A;  3F22 A;  3CCM I;  5C3E J;  2M0M A;  1ETV A;  2LBF A;  3IP4 B;  1L0O C;  2VON A;  4DZJ A;  2VC1 A;  2XAG A;  5J47 A;  4BAY A;  4KA4 A;  4A3M J;  4ZDP A;  3CES A;  2QQ9 A;  2JRM A;  3BR0 A;  1FPQ A;  2QGU A;  3SZP A;  5EEA A;  5E17 F;  5IT9 K;  1IN6 A;  4CCN A;  2LKS A;  2HNH A;  2XVC A;  4A3E J;  1RKW A;  1XSV A;  4LGW A;  4N4N B;  1O3S A;  3SJM A;  2DXI A;  3RYP A;  4YFK F;  2E2I J;  1HKS A;  1MDM B;  1G3T A;  2YPR A;  3KLN A;  3CF2 A;  1O4X A;  1IRX A;  2ADU A;  4NQW A;  2IS1 A;  2NYX A;  4IZZ A;  1XCV A;  3GFL A;  3IKT A;  2WC2 A;  1ZTR A;  3I3L A;  1ZGW A;  3CJQ B;  4IO9 F;  3OYI A;  4XRF A;  4IEJ A;  5EGO A;  2GM4 A;  1X1C A;  3D5S C;  3R0J A;  2STW A;  3DBR B;  4KN7 X;  2PI0 A;  2DQR A;  4BEH A;  1UCR A;  1ORK A;  3ZQI A;  1A5J A;  3HIF A;  4EM0 B;  3OYA A;  4ETS A;  2JUG A;  1FSE A;  3DFG A;  3K1M A;  4G12 A;  3BR2 A;  4FTH A;  4ZYE A;  1E3H A;  3ASN H;  2QKM B;  1MSE C;  5B66 C;  2L7Z A;  3H1C A;  3BLY A;  3EDP A;  3E6D A;  2ZFU A;  3SEZ A;  1HKQ A;  4M3D A;  2DPU A;  1F43 A;  5JHU A;  2OTJ I;  2H1K A;  5E3M A;  2DFI A;  1G8X A;  3NAR A;  3AAF A;  3HM5 A;  2DOE A;  3GCM A;  1IGN A;  2VQH A;  2WY7 Q;  1EH8 A;  1MW7 A;  2FSW A;  4M6Y A;  4FCY A;  3BG7 A;  4BDY A;  2VPR A;  5D4S A;  3BWG A;  1IRZ A;  2OQG A;  2M2E A;  4IVN A;  1JT0 A;  1XC5 A;  2P7V B;  3OR2 C;  2IA2 A;  4IJA A;  2DMP A;  1SD6 A;  2VJ4 A;  2OUM A;  3E5X A;  1SAN A;  3V42 A;  3VSL A;  4CCJ A;  1WI3 A;  4G9Y A;  2ESN A;  2E35 A;  5FB2 A;  2IGM A;  2YR2 A;  3MWM A;  1K6O A;  3KYC B;  1R1V A;  4D5C A;  1U9O A;  5FRO A;  2I8D A;  5EG0 A;  1R1T A;  1S3J A;  4UVB A;  4M9S A;  2CQN A;  4Q48 A;  1T95 A;  4AU7 A; 
#chains in the Genus database with same CATH homology
 1U78 A;  4ON0 A;  1O7F A;  5JVT A;  4BXU A;  5ERI A;  2IRF G;  3P9C A;  4PGH A;  1XMA A;  3ABT A;  3R0A A;  4ASN A;  1IXR C;  3ML6 A;  2ZME A;  2HZT A;  3F8F A;  4IHT A;  5JI6 A;  1D8K A;  2ELH A;  5D4R A;  1I1G A;  1R5G A;  3LWF A;  4YFN F;  2CYY A;  5ED4 A;  3PQJ A;  5L3G A;  3TDZ C;  5AIQ A;  1GXQ A;  2CSO A;  1W7P A;  2UXX A;  3WTY C;  5J6X A;  2A6E F;  5LHH A;  4LLL A;  3ABU A;  4WF2 A;  3F8B A;  1B1B A;  4I0B A;  3J81 Z;  1U3E M;  3MCZ A;  1U5T A;  3M8E A;  5LRS A;  2XAJ A;  4WCG A;  4E70 A;  4LB5 A;  1UST A;  4JBA A;  2ZNZ A;  1E17 A;  1BIB A;  4LLG F;  3L00 A;  1T38 A;  3H3Z A;  5DCM B;  3JTG A;  1I1S A;  4LK1 F;  1BC8 C;  4QWQ A;  3M1E A;  2GA1 A;  3K9T A;  1IF1 A;  3ULQ B;  2XKP A;  2P5K A;  4UXN A;  1DP7 P;  2OZU A;  2MD5 A;  4EJO A;  1FZP B;  5H6Q A;  4CIC A;  4Q5S F;  1TTY A;  1TW2 A;  1W5S A;  5LGT A;  2IJL A;  4AVP A;  4EM2 A;  4A0X A;  1BI0 A;  3ELK A;  3RDI A;  1S6L A;  1I6X A;  1HST A;  3GX4 X;  2D1V A;  2D45 A;  5TRD A;  1Y0U A;  1UHW A;  3RJP A;  4LFU A;  4KIG A;  3KLO A;  1HW5 A;  3U1D A;  2OQR A;  5EEG A;  4G6Q A;  2VOP A;  2P6T A;  2FXA A;  4MTD A;  1HXD A;  4LJZ F;  1Z1D A;  3GZ5 A;  1T6S A;  2EA4 A;  3FM3 A;  4HX4 A;  5IT9 Z;  4G7H F;  2GQQ A;  2RDP A;  1VTN C;  4MHG A;  1BI1 A;  3WGG A;  2YX7 A;  3DF8 A;  1G3W A;  1IW7 F;  4RB3 C;  1RUO A;  2MA3 A;  3WOD F;  1J2X A;  2L01 A;  1DUX C;  4YG2 F;  4I02 A;  2F5F A;  1C0W A;  4DNC A;  1YLF A;  4CHU A;  4IHS A;  2DO7 A;  1WRJ A;  5L3E A;  1YQA A;  2GWR A;  1A04 A;  2FQ3 A;  1YS6 A;  1G3Y A;  3RIR A;  1EH6 A;  4IRI A;  5A2Q Z;  1B9N A;  1DPR A;  3BP8 A;  4CDG A;  3LA2 A;  3D0S A;  3HRT A;  2O3F A;  1ZG3 A;  2TDX A;  1MD0 A;  4GXO A;  5A2Q K;  3CTA A;  2GXB A;  3HRU A;  3BY6 A;  3DXJ F;  5BOX A;  4RGU A;  4LG0 B;  3BDD A;  2BGC A;  3ZMU A;  2VBY A;  2QM3 A;  3QRF F;  2HGC A;  3MZY A;  3R61 A;  1TQM A;  3G3Z A;  1B9M A;  2W57 A;  3EYY A;  3LST A;  3W6K B;  2Z99 A;  1MJA A;  5DCF A;  4ZYD A;  3L7W A;  3GW2 A;  4EJT A;  3LA3 A;  4O3M A;  1YW9 A;  1BOA A;  2JZY A;  1T0F A;  3ZP5 A;  4HLY A;  3HUG A;  1F9N A;  1JGS A;  3ECH A;  5ILS A;  4A0Z A;  1YW7 A;  4XLP F;  2ZNY A;  4HF1 A;  2BV6 A;  1UB9 A;  4L9T A;  2DK8 A;  1O7L A;  2O8X A;  3GUD A;  2A61 A;  4M9X A;  5L3C A;  1Z05 A;  4LG0 A;  1TNS A;  2EA2 A;  4L5J A;  2R7F A;  1GXP A;  4RGR A;  2ESH A;  5ICF A;  4B8X A;  3FXQ A;  1S7O A;  3QU3 A;  4ZZD A;  1I27 A;  2YX4 A;  4PGG A;  3QOP A;  3T8R A;  1QZZ A;  1HBX G;  2DU9 A;  1BI2 A;  3I5U A;  2CW0 F;  3E6M A;  2NNN A;  1W7P D;  3GEZ A;  3VEP A;  4MNU A;  4HZF A;  5CVJ A;  3LA7 A;  4RGS A;  3GXO A;  3TQN A;  2A07 F;  5LGU A;  1FBU A;  3M8F A;  4IRG A;  3ZMD A;  2A3S A;  4Y17 A;  4MEX F;  4Q4Z F;  3I54 A;  1J0R A;  5DD8 A;  1TQP A;  2FOK A;  2VOD A;  1AOY A;  1F1Z A;  5HDN A;  3FZV A;  2UXN A;  5J8C A;  1IUY A;  4UVC A;  5FGM A;  1WWX A;  4L0Y B;  4HF2 A;  1FP1 D;  1O57 A;  1HW1 A;  3DP7 A;  2VT3 A;  2PFB A;  3V8J A;  4L9N A;  3OV8 A;  1R00 A;  2F5D A;  2HKX A;  2VT2 A;  3DPL C;  1J7K A;  2FNP A;  2M5W A;  1HSJ A;  5AON A;  3E97 A;  4PZJ A;  5E8G A;  3NEU A;  3QAH A;  4F7Z A;  3B02 A;  3HRM A;  1XMK A;  3CUQ B;  1ZG1 A;  2F5E A;  2IVM A;  3WGH A;  4NHJ A;  3HHG A;  4M74 A;  4NB5 A;  3FX3 A;  3FHZ A;  3BRO A;  3HSF A;  1MJ9 A;  5K5O A;  1E2X A;  1U8R A;  1S29 A;  3QU6 A;  4UHT A;  1PUE E;  2EFN A;  1ZHF A;  1R1U A;  2IP2 A;  4RS8 A;  2PG4 A;  3L9F A;  4EGY A;  1ZRD A;  1ZLK A;  2Z3Y A;  5LRR A;  2STT A;  3ROU A;  1RNL A;  4ZYG A;  1EH7 A;  1XSX A;  1ZYR F;  4IF4 A;  4H0E A;  3TKY A;  2FF4 A;  4XSZ F;  1XB4 A;  2V1D A;  1R58 A;  3F23 A;  2AS5 F;  3O2P E;  2XRN A;  4AIH A;  3T1B A;  2D1H A;  2JPB A;  3PQK A;  3OOP A;  1SFX A;  2OA4 A;  3DV8 A;  4Q47 A;  3WTZ A;  2J5O A;  1K79 A;  4R1H A;  1T2K A;  1KGS A;  1KQ0 A;  1MKM A;  1TNT A;  1LDK B;  3L09 A;  4BYY A;  3IRR A;  3HTU A;  1FYL A;  2H09 A;  3R60 A;  3KFW X;  3DKW A;  2O03 A;  4YII A;  5E1X A;  4AIK A;  3P7N A;  1W7P B;  2UWM A;  1G3S A;  3Q9V A;  4KUM A;  2BEO A;  4PDK A;  1OKR A;  1IN7 A;  1LDJ A;  2RGV A;  1KQ9 A;  2ZXJ A;  2NAZ A;  1ZAO A;  1WKM A;  2IW5 A;  4ZYH A;  3Q5F A;  2BE5 F;  4EMS A;  1LDD A;  2FBH A;  3I59 A;  2CFX A;  3KP5 A;  1BBY A;  1BN5 A;  2CG4 A;  1ZLJ A;  5H6R A;  2L02 A;  4U7B A;  2HFH A;  2QWW A;  4G6D A;  4HLX A;  4KMF A;  3K1P A;  2ACJ A;  1KU3 A;  4I7H A;  4P5O A;  4KIC A;  2M8E A;  4ENK A;  1K78 A;  2DBB A;  4LK0 F;  4U0V A;  2GAU A;  3V8K A;  2ZME B;  3PFI A;  4A6E A;  2V1U A;  5L3F A;  2P4W A;  3RYR A;  4KMU X;  3ZPL A;  5L3B A;  2H27 A;  5FLX Z;  3RKW A;  1F4K A;  4BQA A;  4R79 A;  1IXS B;  4O5V A;  3QP6 A;  3F8M A;  2Q8K A;  2CQK A;  2PQ8 A;  2HEO A;  4BNC A;  5HS7 A;  1RIO H;  2X0L A;  4MQV A;  3R4K A;  5CLS A;  2DAO A;  1RZ4 A;  1QNT A;  4U0Y A;  1LB2 A;  5FFX A;  3ISP A;  2XKO A;  3KZY A;  2RN7 A;  1YYV A;  5K5R A;  2HDC A;  4JK1 X;  3RKY A;  3T5X A;  2EFW A;  2GXG A;  2JRT A;  4LLN A;  1BIA A;  3WTS C;  3JTH A;  4GYI A;  1XSD A;  2FBK A;  1QGP A;  1ZGA A;  1QQI A;  4EJW A;  1CGP A;  2RKH A;  2E1C A;  1FBS A;  2K4B A;  1TQI A;  3F21 A;  2XUB A;  2FEZ A;  3J80 K;  5D5X B;  3K0L A;  3REO A;  2A5Y B;  4CXF A;  2VBW A;  5FD6 A;  2W84 A;  3BPX A;  3I64 A;  1DDN A;  1QBJ A;  2Z5U A;  5K1Y A;  1XGN A;  2XAQ A;  5DUK A;  5D5U B;  5ICG A;  2XRO A;  1ZG5 A;  2MH2 A;  3EET A;  1Z7U A;  4HF0 A;  4M71 A;  3LAJ A;  4DQ2 A;  2QZ8 A;  4RB2 C;  2HWV A;  2E7X A;  5HS8 A;  5FD5 A;  1S8N A;  4HQM A;  2O0Y A;  3DPT A;  1HW2 A;  2WV0 A;  4ZH4 F;  3NRV A;  4A2U A;  3M7G A;  1LEA A;  1LVA A;  3TOA A;  1AWC A;  3E5U A;  2EFO A;  2H94 A;  1XGM A;  4HA8 A;  4JQF A;  2LNB A;  4KNY A;  1EV7 A;  5E8I A;  3GWZ A;  2IA0 A;  3O6B B;  1IN5 A;  2PMH A;  1YO5 C;  2MC3 A;  2WTE A;  1STZ A;  3U2R A;  2ZO4 A;  3CLO A;  5LLQ A;  3GZ6 A;  1OPC A;  3C3W A;  3K2Z A;  1YG2 A;  2XAF A;  4KYW A;  1X3U A;  1FOK A;  4AWX B;  3CUQ C;  3F8N A;  2W85 A;  4BHC A;  4HAM A;  4MEY F;  2FA5 A;  2HYF A;  1P92 A;  1ONV A;  2EK5 A;  2QUF A;  3CDH A;  2A68 F;  1YS7 A;  1J59 A;  2PBI A;  1J75 A;  1T98 A;  3HOT A;  4P96 A;  2MLG A;  2HTJ A;  1CF7 A;  3BJ6 A;  4HW0 A;  1KYW A;  3VOE A;  1XDS A;  3HRS A;  4U88 A;  4RB0 A;  2JTV A;  3KCC A;  3GF2 A;  2RC4 A;  4OIQ F;  3SFZ A;  3JAM K;  5CVV A;  2MLK A;  2RQP A;  4EJV A;  2PLY A;  2L4A A;  2LKP A;  5BQT A;  3SQN A;  1SAX A;  2FU4 A;  4OIR F;  3KP3 A;  3ECO A;  2ZFW A;  1LJ9 A;  1BC7 C;  4A5N A;  3CO7 C;  2P6S A;  5CYV A;  1FYK A;  2X4H A;  1ON2 A;  3F6O A;  5FFZ A;  2AXL A;  4LB6 B;  5TJJ A;  3BOQ A;  4HX7 A;  5L3D A;  1U6G A;  1BM9 A;  2DW4 A;  1HQC A;  1ULY A;  3SHF A;  3KP6 A;  3CUQ A;  2L4M A;  5DDG A;  1KU7 A;  2Y48 A;  3COA C;  5DCM A;  3HOS A;  1BI3 A;  1U2W A;  2HR3 A;  2HTS A;  2YSR A;  4L9J A;  3I0T A;  1FSH A;  1R7J A;  1U5T B;  3V8L A;  3IRQ A;  1SD5 A;  3J80 Z;  1YTY A;  2MBF A;  1W5T A;  4FX0 A;  2K02 A;  3I71 A;  4ESJ A;  3GO5 A;  1B4A A;  1IZ1 A;  1R36 A;  2OZ6 A;  5HS9 A;  2J5P A;  4FHT A;  1S7A A;  3TO6 A;  5ICE A;  4ENN A;  2NNY A;  3C7J A;  1OYI A;  3N97 A;  5J8F A;  1LNW A;  3I58 A;  2V6C A;  2FBI A;  1LEB A;  2EWN A;  4KIF A;  3ZQ7 A;  4RGX A;  3ZN1 A;  1P4A A;  1KU9 A;  4P9U A;  1SD7 A;  4HDV A;  5FO5 A;  3T0Y A;  1PDN C;  1P6R A;  1K78 B;  1H9G A;  5LBQ A;  1ZRF A;  3VB2 A;  1P4W A;  1QPM A;  2VBX A;  2GZW A;  3TO7 A;  2FMY A;  2DTR A;  3MQ0 A;  3NQO A;  3E6C C;  4CYD A;  3EUH A;  3KZZ A;  1FC3 A;  5HLH A;  1J5Y A;  4Y13 A;  1BJA A;  4P55 A;  3MFK A;  4I0A A;  1P4X A;  5D8L B;  4EQQ A;  2NS0 A;  1FWZ A;  2JT1 A;  3QPT A;  5D5V B;  4QLC U;  4TV7 A;  2LSO A;  1O3Q A;  3KP4 A;  2COM A;  1XGS A;  4OMY A;  5E1W A;  4CO8 A;  4ZZL A;  2WWY A;  3I59 B;  3K1N A;  3N4M A;  1PP8 F;  4D0P A;  1B59 A;  1YW8 A;  5CVU A;  2IT0 A;  2E1N A;  2BBY A;  1JXS A;  4WXC A;  1MGT A;  1U5T C;  5ILV A;  3IHU A;  4G7Z F;  5CJ9 A;  2LF7 A;  5E20 A;  3HHH A;  4M72 A;  2QQB A;  1ZRC A;  1ZRE A;  3FM5 A;  2OBP A;  2R3S A;  4EVI A;  3KP7 A;  2ISZ A;  4RAZ A;  1OMI A;  3BZ6 A;  2OAZ A;  5HLI A;  1RUN A;  3B73 A;  1JHH A;  3EYI A;  3KE2 A;  5HDG A;  4K2E A;  3C18 A;  2EV0 A;  4ENJ A;  2QBY B;  3FXR A;  2RNJ A;  4I09 A;  1USS A;  4U7D A;  3V4G A;  5AIP A;  2Q0O A;  3FMQ A;  2DLL A;  4B09 A;  1KYZ A;  2L54 A;  2A69 F;  3Q9S A;  3TOB A;  5DEQ A;  3TDU C;  2EJR A;  4FX4 A;  3LAP A;  4S05 A;  2DPD A;  3MAJ A;  3RPU A;  4MTE A;  3DQV C;  4Y15 A;  4AD9 A;  3K69 A;  1HKT A;  2VE8 A;  3U9G A;  4CZZ A;  5BPI A;  1KU2 A;  1FYM A;  5ICC A;  2ZJ2 A;  4UNO A;  3WE3 A;  1ODD A;  2YU3 A;  1I5Z A;  3G73 A;  3T8T A;  3GVA A;  3ZMV A;  2K86 A;  4I98 B;  1XDU A;  4EV0 A;  3I4P A;  1R22 A;  2P7C B;  2DK5 A;  1IAW A;  2XAS A;  5BPD A;  5CVR A;  4GO1 A;  2IA1 A;  2CWE A;  3RPQ A;  3ZN0 A;  1UHM A;  1D5V A;  2K4J A;  2Q2E A;  1D3Y A;  4P9F A;  4XBF A;  3CO6 C;  3J81 K;  4I2O A;  1Z91 A;  1KQ8 A;  1FX7 A;  1V3F A;  1G6N A;  4RAY A;  2VE9 A;  2XAH A;  1FNN A;  3WG9 A;  1JE8 A;  3FWE A;  4LMY A;  5HDK A;  4YIF A;  1SMY F;  1W4M A;  1FBQ A;  4RB1 A;  1PP7 U;  2LDU A;  3QPH A;  2XGX A;  5D6F A;  2FNA A;  2XV4 S;  3EQL F;  1Z6T A;  4ESF A;  3WTW C;  2FRH A;  2QVO A;  4L18 B;  2UZK A;  4WWC A;  2VXZ A;  5LGN A;  4R8H A;  2H6C A;  4HDU A;  4A12 A;  5DD4 A;  5LEJ A;  2DI3 A;  1B6A A;  2O6G E;  3BPV A;  3FMR A;  4L9V A;  5LEK A;  2GIV A;  3LQR A;  3JSP A;  4KIB A;  3D5L A;  2PN6 A;  4N9H A;  3RKX A;  2P5V A;  5JR3 A;  4G7O F;  2KIM A;  4G8X A;  4MGR A;  4M6X A;  5DUI A;  2FE3 A;  2W24 A;  4A0Y A;  2ZKZ A;  5K5Q A;  2ETH A;  2P5L C;  4HQE A;  2JPC A;  3BJA A;  5HVQ C;  1L3L A;  4KN4 X;  2HYG D;  1UFM A;  2G7U A;  1MZB A;  5LHI A;  1SFE A;  2OD5 A;  1OR7 A;  3LQQ A;  2KIF A;  2QYO A;  1Z9C A;  3KET A;  4XLN F;  2FML A;  4PCQ A;  5E18 F;  1T39 A;  3JSO A;  3F8C A;  2HOE A;  3E6B A;  4ESB A;  1MJB A;  3WTV C;  1GHC A;  5FLX K;  4OIN F;  1P2F A;  1XD7 A;  3L2C A;  3SZT A;  3FMS A;  2H6B A;  4UVA A;  1IN4 A;  1IN8 A;  4HV5 A;  2M45 A;  4KFC A;  3H3U A;  2G9W A;  3WTT C;  2F5C A;  2HS5 A;  4OIO F;  4CGZ A;  4MQ9 F;  4OIP F;  3RTR A;  3ZMZ A;  3QP5 A;  1R23 A;  1WSU A;  5H20 A;  2F2E A;  4BHB A;  1TW3 A;  1ON1 A;  4YFX F;  3WGI A;  4EGZ A;  1D8J A;  4UV8 A;  5F1R A;  2Z9O A;  3MZH A;  1DPU A;  1K7A A;  1JHF A;  3FXU A;  4KDP A;  3HSR A;  1QO0 D;  3O3K A;  2KRF A;  2W25 A;  4I01 A;  4OU0 A;  5DYM A;  3BJO A;  1XN7 A;  1H0M A;  3J7A O;  2VBZ A;  4EJU A;  1SD4 A;  4KT5 C;  5CVI A;  2EFQ A;  4A5M A;  2A6H F;  1ZN2 A;  1QZY A;  2P8T A;  3GFJ A;  3HTS B;  1GVJ A;  2CGP A;  1WI9 A;  1RI7 A;  4O6J A;  4GYG A;  4HOB A;  2V1X A;  4U0W A;  3LFK A;  1WQ2 A;  2R7D A;  5EEH A;  1O3R A;  4HV6 A;  2D2W A;  4ENM A;  3JW4 A;  4HBL A;  3H92 A;  3KEQ A;  3VOD A;  3GFI A;  2BYV E;  3R6S A;  3HSE A;  2EV5 A;  4S04 A;  5JFR A;  2VC0 A;  3E5Q A;  1OYY A;  3CJN A;  3KEO A;  2QLZ A;  4UUV A;  3V7S A;  1FT9 A;  2PJP A;  3GFM A;  3F6V A;  2K27 A;  2KIU A;  5IT3 A;  2G7H A;  3WU0 A;  2O61 A;  1NHA A;  3W6J B;  6PAX A;  3FF5 A;  1G4D A;  1XCB A;  2HQN A;  2XIG A;  2Y0M A;  3V7R A;  4IRH A;  1Z6R A;  2ZCW A;  1Q1H A;  2E7W A;  4Z2Y A;  2V9V A;  2VOO A;  3F3X A;  2M1B A;  4OMZ A;  4L0Z B;  4WK8 F;  2JSC A;  4OOI A;  2QEN A;  4UV9 A;  4G94 A;  3JAM Z;  5F6F A;  1YIO A;  2VN2 A;  1SFU A;  5F64 A;  2K7L A;  2OU2 A;  2LF8 A;  1OYW A;  2L3D A;  3HYI A;  2PEX A;  4WX9 A;  4HYE A;  1J9I A;  3WE2 A;  3IC7 A;  3IKV A;  2M30 A;  3ZMT A;  2KJC A;  4LD5 A;  1FY7 A;  3IWF A;  2RVC A;  3RI4 A;  4BH9 A;  1V4R A;  2M87 A;  4L5I A;  2ZBK A;  4GGG A;  5D5W B;  5KK1 A;  5D6E A;  2DT5 A;  1IRG A;  3WU1 B;  4IPA A;  1FP2 A;  2EFP A;  3ERE D;  3MEX A;  2B0L A;  1MDM A;  1ZH5 A;  1REP C;  3VFZ A;  3WTX C;  2EV6 A;  1LQ1 A;  4GCV A;  3GYH X;  4N9I A;  2NRA C;  5BS6 A;  4M9Z A;  2V79 A;  1TLH B;  4N0B A;  2C6Y A;  3M9A A;  1H9T A;  4WXD A;  3TO9 A;  1ZGJ A;  5D8K B;  2ISY A;  3KP2 A;  5E1Z B;  3V7C A;  2QQA A;  3IWZ A;  3TGN A;  2EB7 A;  3CUO A;  3P9I A;  1F5T A;  3P9K A;  1FLI A;  2PMU A;  4HX8 A;  2IPQ X;  3GLX A;  3DEU A;  2KJB A;  1CF7 B;  3S2W A;  4FT8 A;  1YFH A;  5LHG A;  3C1D A;  5HOO A;  5BMZ A;  2XHK A;  2CO5 A;  1IXC A;  3IL2 A;  1TBX A;  5DV5 A;  3F72 A;  3I53 A;  4A6D A;  2DQL A;  1O3T A;  5KVR A;  5HLG A;  1ZAR A;  2Y75 A;  1KA8 A;  1R5H A;  4M73 A;  4EM1 A;  2RV8 A;  2MH9 A;  3ZMS A;  2KKO A;  4IXA A;  3SXY A;  3E3V A;  2GA2 A;  5ILU A;  2QBY A;  2Z33 A;  3WTU C;  2HKO A;  2HQR A;  4WXH A;  4BHP A;  4XSX F;  4AIJ A;  1XGO A;  1SMT A;  1IRF A;  3F22 A;  1L0O C;  2VON A;  2VC1 A;  2XAG A;  4KA4 A;  4BAY A;  2QQ9 A;  1FPQ A;  3SZP A;  5E17 F;  5IT9 K;  1IN6 A;  2XVC A;  1XSV A;  4LGW A;  1O3S A;  3RYP A;  4YFK F;  1HKS A;  1MDM B;  1G3T A;  2YPR A;  3KLN A;  2ADU A;  4NQW A;  2NYX A;  1XCV A;  3GFL A;  3IKT A;  2WC2 A;  4XRF A;  3R0J A;  2STW A;  4KN7 X;  2PI0 A;  2DQR A;  1UCR A;  3HIF A;  4EM0 B;  4ETS A;  1FSE A;  3DFG A;  3K1M A;  4ZYE A;  3E6D A;  3EDP A;  1HKQ A;  2DPU A;  5JHU A;  2DFI A;  3AAF A;  1EH8 A;  2FSW A;  4M6Y A;  5D4S A;  3BWG A;  2OQG A;  4IVN A;  2P7V B;  2IA2 A;  4IJA A;  1SD6 A;  3E5X A;  4G9Y A;  2ESN A;  5FB2 A;  2YR2 A;  3MWM A;  1K6O A;  1R1V A;  1R1T A;  1S3J A;  4UVB A;  4M9S A;  4Q48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...