4MNUA

Crystal structure of uncharacterized slya-like transcription regulator from listeria monocytogenes
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
AMKDILRDIGVIARALDSISNIEFKELNLAKGQFIYLVRICENQGIIQEKLVDILKIDRTTASRAIKNLEKNGLIIKKQNKNNKKNKLLFPTEKGQQLYPLIIRENEYSNAVALKGFTEAEINMLTDALKKVKENIADDWLYVKKGNKRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uncharacterized SlyA-like Transcription Regulator from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
molecule keywords SlyA-like transcription regulator
total genus 53
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mnuA00
1S3JA 3HHGA 1ON2A 1R58A 2F5CA 1OYIA 3LQQA 2G7HA 2O0YA 3BROA 4O3MA 2A69F 1O7FA 4G7HF 2WWYA 3Q9VA 1H9TA 3P9CA 4EJOA 4ETSA 2VT3A 4MGRA 3O6BB 3VODA 5D5VB 1FYLA 1T38A 4GYGA 2HDCA 3TO9A 2JRTA 2ELHA 3M8FA 3GFJA 3I64A 2FBKA 2F5EA 2FOKA 5TJJA 5F6FA 3T1BA 1U6GA 1Z9CA 3DQVC 4M72A 1AWCA 1DUXC 2LNBA 4UV9A 3CDHA 4MQ9F 1Z1DA 2XIGA 2Q0OA 2V9VA 1R5HA 5ICGA 4XRFA 4OIRF 4YFNF 3RKXA 2DU9A 1SFXA 4H0EA 5J8CA 1LQ1A 4LG0B 5H20A 1KGSA 3H3ZA 3JTHA 1TW2A 4LB5A 1YIOA 2GXGA 4LK0F 3SXYA 2HFHA 2LKPA 5FO5A 2MLKA 4KICA 4OIOF 4MNUA 2PI0A 1EH6A 1S29A 2OQGA 4UNOA 3L9FA 2VE9A 1MJAA 4HLXA 1BBYA 1SD7A 4M9ZA 4L5IA 2GZWA 4A5MA 1JXSA 1KYWA 3PFIA 4EMSA 1R36A 2JTVA 1MJ9A 3KE2A 2RQPA 1IN5A 3IWFA 2H6BA 2ISYA 5D8LB 3I54A 2XHKA 4U7DA 2XKOA 1NHAA 4EM0B 5HDKA 1G4DA 4G7OF 1YYVA 1XCVA 2P8TA 2F2EA 2P7VB 3F21A 3SHFA 1KU9A 1XN7A 4DNCA 2IJLA 2Z99A 3BPVA 1U3EM 4HOBA 5ICFA 2OD5A 3TO6A 3T8RA 2P5KA 3R60A 1XCBA 3FMQA 1W7PA 3R0AA 1RIOH 5EEGA 2XKPA 5DV5A 2DT5A 4HW0A 3R4KA 1XSVA 3GZ6A 1QQIA 2IW5A 3L00A 2DI3A 2V1DA 1H9GA 4M9SA 3IWZA 3RKYA 4IRHA 2PEXA 4M74A 3W6JB 1U5TB 2DQRA 4I7HA 2IVMA 2GWRA 4ENMA 2STTA 1YW8A 2C6YA 2GA1A 3OOPA 3EETA 5JFRA 1Z7UA 1J75A 2VC0A 3F23A 5LEJA 3HTSB 2NS0A 3Q9SA 3N97A 1IW7F 3ZMVA 4LLLA 4MEXF 3GFIA 4ZH4F 4B8XA 1HKQA 2GAUA 4OIPF 2CYYA 1OMIA 3KP5A 1YQAA 4BQAA 2LF8A 1IAWA 1I5ZA 2JPCA 2W24A 3B02A 5FGMA 5FD5A 2QWWA 1IN6A 2A61A 4HDUA 4ENJA 3R0JA 2VE8A 3QAHA 1RUNA 5CVVA 4OIQF 3E5XA 5FFXA 3TGNA 1REPC 1KQ0A 4KYWA 4EM2A 4A2UA 4D0PA 3T5XA 3GVAA 2E7XA 3PQKA 3QRFF 2WTEA 1FLIA 2W25A 3FZVA 1KU3A 1O57A 3V4GA 3EUHA 1GVJA 5HLGA 3VOEA 4RGUA 1XSDA 4L0ZB 1ZHFA 4RB1A 4EJWA 4OMZA 4RB2C 3ECHA 5HS9A 1R22A 1RNLA 3GFLA 1G6NA 3N4MA 4UUVA 1FX7A 2BV6A 2JSCA 4HZFA 4UXNA 2HKXA 1QBJA 2FEZA 4TV7A 1BI1A 3LAJA 4E70A 2FE3A 4HBLA 5E8GA 1ZREA 2X4HA 5K5RA 3ABTA 2IA0A 4I0AA 1ODDA 1K6OA 1S7AA 3HRTA 2L54A 4IHTA 3K0LA 3GUDA 5L3FA 3V7SA 3RTRA 2VXZA 1SD6A 2CWEA 3I59B 3KLNA 2PG4A 3SZTA 1BM9A 2XAHA 1I27A 2VBWA 2OZ6A 2X0LA 4HX4A 2EV6A 2HQRA 2EFNA 1BI2A 3H92A 3HSRA 2EFOA 2RKHA 4MHGA 5FLXZ 4ENNA 5DUKA 1UCRA 1LDKB 2MLGA 4Q4ZF 1YLFA 2EFQA 1PDNC 3IKVA 1SMYF 3ZMUA 5FFZA 3RPQA 3RJPA 1CF7B 2M1BA 3KEQA 1KYZA 1E17A 4GYIA 4U0WA 2QYOA 3DPTA 2HZTA 2OQRA 2XRNA 4Q5SF 2CG4A 1BN5A 1OR7A 1MJBA 4HDVA 3GF2A 1EV7A 3TO7A 4KMUX 5JR3A 4I02A 4RB3C 3W6KB 3J81Z 3BJ6A 2KIMA 3DF8A 1C0WA 2ZBKA 5E17F 1VTNC 1IN7A 4K2EA 1YFHA 1XD7A 4ESJA 4KNYA 1ON1A 2V6CA 2UWMA 1QPMA 5D5UB 1LNWA 5DUIA 4P5OA 3VEPA 4DQ2A 1HW2A 1EH8A 3K1NA 3ZMDA 2COMA 3MFKA 1U8RA 3D0SA 2PN6A 5A2QZ 4UHTA 1P4WA 3L7WA 1TNTA 3U2RA 3ZN1A 3RI4A 4I98B 2CO5A 2DK5A 3EDPA 5BS6A 2IRFG 1IXRC 2OAZA 1G3SA 4AIJA 5DEQA 2CW0F 5JHUA 1K78B 2NRAC 2DK8A 5LRRA 1QZZA 1L0OC 1OKRA 3RIRA 1BC8C 1SAXA 1J2XA 1D8KA 4KDPA 2HYFA 1B59A 1L3LA 2PQ8A 1YS7A 3SFZA 5FB2A 4Z2YA 1ZAOA 1XB4A 1TBXA 5D5XB 5LGTA 3K9TA 1XMAA 1WQ2A 4CYDA 4F7ZA 3F6OA 5J6XA 1ZRFA 1KQ9A 3WGIA 2ESNA 1Z05A 4IF4A 1KA8A 3O2PE 2GXBA 4KT5C 2XAFA 2A3SA 2IPQX 5AIPA 2ZKZA 3E6DA 2ZMEA 4WF2A 5CLSA 2EFWA 3C18A 2QM3A 2A6HF 2HKOA 1HQCA 2O6GE 2UZKA 5LHIA 2XROA 2QQAA 5JI6A 2Z9OA 4O5VA 1J9IA 3F8NA 4RAYA 2E1CA 3C3WA 3Q5FA 3FMSA 5K1YA 3MQ0A 4RGSA 4EJVA 2B0LA 3RDIA 4LB6B 3CO7C 1Y0UA 5HS8A 2FA5A 1B6AA 3REOA 2HS5A 1WWXA 1Q1HA 4HLYA 1HSJA 2K27A 1I6XA 4JK1X 4GXOA 3KP7A 4FHTA 4HQEA 2ADUA 3SQNA 2L01A 2ZO4A 1FP2A 4P9FA 4HF0A 5DCMA 4L9TA 3WGHA 5HVQC 3K69A 4ZYDA 1I1SA 3QU3A 4ESBA 2FU4A 3C1DA 1YO5C 5DCFA 2AS5F 1W5SA 3ERED 2MC3A 5E20A 4S04A 4CZZA 5CVIA 4QLCU 2RV8A 2KJBA 2A07F 2YU3A 3FX3A 4CXFA 1FBUA 1ZG1A 3F8MA 1MD0A 4G6QA 5LRSA 4BAYA 2A6EF 4Q48A 4QWQA 5DYMA 1U5TC 1YS6A 3WODF 1TQPA 1ZGAA 2DLLA 3HSFA 3DXJF 4LJZF 5FD6A 4RS8A 3U9GA 1ZN2A 1IN4A 2Z5UA 1J59A 2DAOA 4IPAA 4L18B 2QBYA 1LB2A 1ZYRF 4U0YA 1HSTA 2M5WA 1D5VA 4U88A 3HIFA 1I1GA 4KIFA 3FM3A 5D8KB 4EJTA 1BOAA 2JZYA 4XSXF 2TDXA 1T98A 5D6FA 4YIIA 5F1RA 2Y0MA 5LHGA 2FF4A 4NB5A 4KN7X 2Z3YA 1G3YA 3ELKA 2GIVA 5HLHA 3F8CA 1YW7A 4B09A 4UVCA 3M7GA 2CGPA 4A0ZA 1U78A 5HLIA 4YG2F 2R7DA 2UXNA 4LG0A 2EWNA 2ZJ2A 4LGWA 5ILUA 3WTSC 4G8XA 3FHZA 3I5UA 2EA4A 4G6DA 3VFZA 4Y17A 3LA7A 3ZQ7A 3L2CA 4A0YA 3V8KA 2ACJA 1FZPB 4RB0A 4AIKA 1OPCA 3WE2A 1MZBA 2K02A 4S05A 3DEUA 1T39A 2Y75A 5LEKA 2YX4A 1A04A 2XVCA 2ZXJA 3GZ5A 5HDGA 4AIHA 2P6SA 2EV0A 3F72A 3FMRA 3CUQC 4XSZF 2XV4S 3LFKA 1XMKA 2UXXA 3RYRA 4FX4A 3COAC 1P92A 5E18F 3FXRA 1SMTA 3AAFA 3M8EA 2D2WA 1FT9A 3I58A 4WCGA 2G7UA 2L02A 2XUBA 2AXLA 3IKTA 2BBYA 3GO5A 2GQQA 1EH7A 1PP8F 2OZUA 1IRGA 3G3ZA 3F3XA 4ZYHA 4OMYA 2GA2A 2VBZA 2QLZA 2RN7A 1UHWA 2Y48A 1P2FA 1J7KA 1P4AA 2L4MA 3BWGA 1DP7P 2BYVE 3M1EA 4PGGA 2K4BA 1QNTA 3TDZC 1FBSA 3KEOA 2HTSA 1SFUA 2VOOA 1YTYA 4RGXA 1LEAA 1R1TA 4WXDA 1HXDA 4RGRA 1R7JA 4MQVA 5LLQA 5ILSA 1T0FA 2HR3A 1R00A 3KP6A 4RAZA 5H6QA 1F1ZA 3RYPA 5IT9K 1ZG5A 1E2XA 2VBYA 3J7AO 3JAMK 1CGPA 1DPRA 3HOTA 2O8XA 3JTGA 3GXOA 2WV0A 1BIAA 5K5OA 4UVBA 4IRGA 3P7NA 3E6BA 3CLOA 4P96A 5CVUA 4BH9A 3RPUA 5BQTA 2IA1A 3KETA 3BOQA 3ZMSA 2DQLA 4BXUA 1FWZA 2ZCWA 2DTRA 4N0BA 3ECOA 2EJRA 2VONA 3NRVA 3WGGA 1LDJA 2STWA 2PFBA 5LHHA 3E5QA 3ZP5A 1IRFA 1ZGJA 2Q2EA 3R6SA 3KP4A 1H0MA 3KLOA 4EQQA 3K1MA 3NQOA 2JT1A 3TQNA 2NYXA 1OYWA 2MH9A 1Z6TA 3WU1B 3CJNA 4JQFA 3I53A 3HRMA 4BHCA 1DDNA 2QQ9A 4HV5A 4CO8A 2P7CB 4MEYF 5KK1A 1T2KA 3E6CC 3IHUA 4M73A 4I09A 4EGZA 3FF5A 3E6MA 3MWMA 3GLXA 1TLHB 5D4SA 2FNAA 2V1UA 4HQMA 4BYYA 2DW4A 2D1VA 3O3KA 3MZHA 2BGCA 2RDPA 2QUFA 3CUOA 1KQ8A 2NAZA 1JHFA 4HF1A 2R7FA 2DO7A 4P55A 3BP8A 1FYKA 5JVTA 3WTWC 4WX9A 2V1XA 1O3RA 4KUMA 2F5DA 5DD4A 2JPBA 3H3UA 1IXSB 2YX7A 4NQWA 2O61A 1S8NA 2ZFWA 4HF2A 5HDNA 3QP5A 2HQNA 2M45A 3HRUA 4IVNA 5H6RA 2HEOA 1RI7A 4WXCA 2RC4A 2EA2A 2PBIA 2VT2A 4JBAA 1F4KA 2H27A 5E1ZB 1O7LA 1CF7A 1MGTA 3OV8A 3WTXC 4FT8A 3WTVC 3KZYA 3TKYA 2KJCA 3CO6C 2CFXA 2LSOA 5J8FA 4R8HA 1XDSA 2KIUA 2PLYA 4HX8A 4AWXB 1D3YA 5L3EA 2E7WA 5CJ9A 1ULYA 2XAJA 4N9IA 4ON0A 1TQIA 2J5PA 1GXPA 1SFEA 1UFMA 4HV6A 2ETHA 1UHMA 3V7RA 5LGNA 3JSPA 1U2WA 3P9KA 2P6TA 4IJAA 4U7BA 1KU2A 3J80Z 5HS7A 3TDUC 3HRSA 2FXAA 4WWCA 4AD9A 2D45A 3E3VA 1BIBA 4ENKA 5LBQA 1MKMA 3KFWX 4PGHA 4A0XA 4M9XA 1F9NA 1SD5A 2XGXA 2A5YB 3T8TA 1BI0A 3JAMZ 2DBBA 1MDMA 5E1XA 2QVOA 4A5NA 3DP7A 2J5OA 5E1WA 3J80K 5ICEA 1K7AA 2HGCA 2EK5A 1FC3A 1STZA 5AIQA 3SZPA 2R3SA 1HW1A 3ISPA 3R61A 1XGOA 1GHCA 5L3CA 1B9MA 5AONA 2YPRA 1S6LA 2VN2A 3GW2A 3TOAA 4R79A 3I71A 1HW5A 1XGNA 4BNCA 2FNPA 3GFMA 2A68F 4FX0A 4BHBA 1B1BA 5K5QA 3MAJA 1USSA 2K7LA 3ABUA 2P5VA 1OYYA 2O03A 4G94A 3T0YA 4BHPA 2HTJA 3MZYA 4ESFA 4KIGA 1QO0D 3LA3A 2LDUA 2CQKA 3QP6A 3DV8A 3FM5A 4O6JA 4Y13A 1K78A 1FSEA 5DDGA 2VBXA 3BJAA 2PJPA 4CDGA 3B73A 3BJOA 3QOPA 3V7CA 3I0TA 1ZG3A 3BY6A 1KU7A 3V8LA 3K2ZA 4M6XA 3LA2A 1O3TA 1R23A 2K4JA 1Z6RA 2LF7A 1HBXG 4L9VA 3I4PA 3S2WA 5ICCA 1U5TA 1X3UA 2MH2A 5IT3A 1DPUA 5BPDA 4M71A 3MCZA 4I2OA 3QPTA 1IZ1A 2W57A 5BMZA 1ZLKA 3I59A 3BZ6A 5ED4A 4CGZA 2OA4A 3F8BA 4I01A 4KA4A 1JHHA 3BPXA 2HYGD 2FMLA 5D4RA 4UV8A 1QGPA 2PMUA 3ZPLA 4LLNA 1FOKA 3QPHA 1IXCA 2BEOA 4U0VA 2L4AA 2IT0A 1YW9A 1J0RA 3IC7A 4KIBA 4KN4X 1LJ9A 2KRFA 4A6EA 4WK8F 1TNSA 2H6CA 2WC2A 3GEZA 2ISZA 4G9YA 3E5UA 3FWEA 5CVJA 2QQBA 5IT9Z 2NNNA 3V8JA 5DCMB 1HKSA 2MD5A 2P5LC 2KIFA 5BPIA 2NNYA 3WTUC 2DPUA 2PMHA 3FXQA 2KKOA 1ZRCA 4LMYA 2H94A 5KVRA 3EYYA 2VODA 2IA2A 4OINF 4HYEA 2M8EA 4UVAA 1ZLJA 5L3BA 1QZYA 3TOBA 1J5YA 3JW4A 1R1UA 3M9AA 1W7PB 2VC1A 3IRRA 3F8FA 1MDMB 1B4AA 2FRHA 1RUOA 4HA8A 1ZARA 1Z91A 2XASA 3ULQB 1P6RA 4YIFA 1W7PD 2EV5A 3WE3A 2QZ8A 3WU0A 4NHJA 4LLGF 1TQMA 4PDKA 4KMFA 4P9UA 1BC7C 4OOIA 5ERIA 2CSOA 5E8IA 3ML6A 2Q8KA 4GGGA 2V79A 2MBFA 3QU6A 3L09A 6PAXA 2HOEA 1YG2A 4N9HA 1ZRDA 4YFXF 4OU0A 5L3DA 3LAPA 4A12A 3WG9A 1R1VA 1IF1A 4XLNF 3KCCA 4L5JA 3GWZA 4CHUA 3BDDA 3ZMTA 4L0YB 1TTYA 4EVIA 3LWFA 1T6SA 3HTUA 5D5WB 5F64A 4WXHA 5CVRA 1AOYA 4PZJA 1IN8A 2W84A 1IUYA 4I0BA 1R5GA 3IRQA 1F5TA 3J81K 5LGUA 3MEXA 4AVPA 1FP1D 1FNNA 2DFIA 3P9IA 3HYIA 1O3QA 1XGSA 4ZYGA 3CUQB 2FQ3A 2FBIA 2O3FA 2HWVA 3ROUA 1FSHA 1K79A 3WTZA 3WTYC 4IHSA 1PP7U 1GXQA 3EQLF 4XLPF 2FBHA 3EYIA 2ZNZA 2F5FA 2OBPA 1G3TA 4EGYA 1FYMA 4A6DA 3ZMZA 4HX7A 3GYHX 1D8JA 4XBFA 5DD8A 1HKTA 2W85A 4KFCA 3DKWA 4LD5A 1BI3A 2QENA 4MTEA 4IRIA 2DPDA 3KP3A 2L3DA 1V3FA 3DPLC 4Q47A 2ESHA 4CICA 2FMYA 5EEHA 2ZMEB 2XAGA 2P4WA 4GO1A 2OU2A 3VB2A 1FBQA 3K1PA 1S7OA 3C7JA 1ONVA 5CYVA 1LVAA 1XGMA 3PQJA 1JE8A 4LFUA 5TRDA 3E97A 5ILVA 3CTAA 2XAQA 3G73A 1LDDA 4ZZDA 4PCQA 1G3WA 5A2QK 3IL2A 1USTA 3HOSA 1FPQA 3HHHA 4ASNA 4ZZLA 3D5LA 3HSEA 1WI9A 3F22A 1JGSA 5L3GA 4IXAA 2H09A 1W5TA 1SD4A 1V4RA 4Y15A 3U1DA 3KZZA 3FXUA 5HOOA 4EJUA 1LEBA 1B9NA 1ZH5A 5FLXK 4EV0A 4GCVA 1XSXA 2YSRA 1WRJA 2BE5F 1RZ4A 3F6VA 3NEUA 1WSUA 2D1HA 4MTDA 1BJAA 4L9NA 4HAMA 3HUGA 2QBYB 3CUQA 2ZNYA 2Z33A 1WKMA 2M30A 5BOXA 2G9WA 4L9JA 4EM1A 1P4XA 4ZYEA 4LK1F 1TW3A 2IP2A 3JSOA 3RKWA 1PUEE 2K86A 2EB7A 5D6EA 2MA3A 3LSTA 4M6YA 4YFKF 3WTTC 2M87A 2RGVA 3DFGA 2RNJA 2RVCA 1O3SA 2FSWA 3GX4X 4G7ZF 3KP2A 3ZN0A 3LQRA 2EFPA 4R1HA 1W4MA 2YR2A 1UB9A 2E1NA 2VOPA 1XDUA 1FY7A
chains in the Genus database with same CATH superfamily
3G71I 4XLFA 1S3JA 1YJ9I 1UELB 2ME6A 2LTPA 2VPLA 3HHGA 1ON2A 1T56A 2E19A 5F0FA 1XS9A 1R58A 2F5CA 1OYIA 4XKCA 3LQQA 4C30A 1OCPA 2G7HA 2LYCA 2O0YA 2Y0SA 3BROA 4F93B 4YELA 1VQ7I 4O3MA 2A69F 2L9RA 1O7FA 1BA5A 4RAFA 3RZDJ 2DCEA 4G7HF 2WWYA 3GTJJ 2K3FA 3E1SA 3Q9VA 1H9TA 1QZEA 4D1QA 1FTTA 3P9CA 4LITA 4EJOA 4ETSA 4E7JA 1UAAA 2VT3A 3K70D 2CV1A 4MGRA 3RQIA 4XKWA 4BKXA 3O6BB 3VODA 5D5VB 1FYLA 1GT0C 1T38A 4GYGA 2HDCA 3TO9A 3K2AA 3GTQJ 4B4CA 2JRTA 2ELHA 3M8FA 1VFCA 4DYRA 3GFJA 3I64A 2FBKA 2F5EA 2EIJH 3BCAA 1OJLA 2FOKA 2DJIA 5TJJA 5F6FA 3T1BA 1BJZA 1U6GA 1W5CC 1Z9CA 4A3JJ 3DQVC 2JMWA 1GV5A 1RRJA 4M72A 4UUSA 2BW3A 1AWCA 3MMYB 1DUXC 2LNBA 4AU7A 4UV9A 2ELKA 3CDHA 3KZIC 1JGGA 4MQ9F 2NVUB 1Z1DA 2XIGA 4ZC3A 4D5FA 2Q0OA 2V9VA 1R5HA 5ICGA 2JJ7A 4XRFA 2Y0SN 2EBIA 3CCUI 4D7MA 4DJAA 3LSJA 4OIRF 2QF7A 4YFNF 3RKXA 2DU9A 1SFXA 4H0EA 1SANA 2CJJA 1S72I 5J8CA 1LQ1A 5B3SH 1W0UA 4LG0B 3G2BA 4XN3A 4DOZA 5H20A 1KGSA 3H3ZA 3JTHA 1GDTA 4G6TB 1TW2A 4LB5A 1YIOA 2GXGA 4CSWA 1R71A 3DTEA 4LK0F 3SXYA 5DS9A 1RKTA 2HFHA 1ETYA 3MKYB 2LKPA 1WHUA 2MLKA 5FO5A 4KICA 2JSPA 4OIOF 1A6QA 3GTOJ 2MFZA 4MNUA 2WAQN 2PI0A 1EH6A 1S29A 2OQGA 4AM3A 4UNOA 3CCVI 3L9FA 2VE9A 1R4NB 1MJAA 4HLXA 1BBYA 3KYDB 2JA6J 1SD7A 1M1EB 4M9ZA 4L5IA 2GZWA 3G1LA 2CUJA 4A5MA 1BW5A 1JXSA 1KYWA 3PFIA 4EMSA 3L1PA 5M5WJ 1ZELA 2H8RA 1R36A 2JTVA 3SJMA 3GZNB 4A3IJ 1MJ9A 3KE2A 1X1PA 3S93A 2IBDA 2RQPA 3ONQA 1IN5A 3IWFA 2H6BA 2ISYA 2LRDA 5D8LB 4IQJA 3JR9A 3OL4A 4HEA2 4E7ZA 5C44J 3PSIA 3I54A 2XHKA 1VQ9I 4U7DA 2ECCA 2XKOA 3NAUA 1NHAA 4EM0B 5HDKA 1G4DA 4G7OF 1YYVA 2XSJC 3JRFA 1XCVA 1N77A 1N25A 3F9KA 4AIDA 3RZOJ 5FRNA 2P8TA 3OIQA 2F2EA 2HNHA 2P7VB 1TWHJ 4IO9F 1Z0XA 2UUZA 3F21A 1VQ5I 2HDDA 3SHFA 1KU9A 4MO7A 1XN7A 3CQZJ 2L0KA 4DNCA 2FD5A 2IJLA 1Q1VA 2ZFUA 3HM5A 2Z99A 1A6IA 3BPVA 1U3EM 4HOBA 1UJ8A 1G59A 1QU3A 5ICFA 4CCMA 4C3IJ 2E35A 4LOCA 2OD5A 3TO6A 1IC8A 1JTXA 2BY2A 1NH3A 4NQWB 2LY1A 2W82A 3T8RA 1MMGA 2P5KA 3R60A 4ZDPA 1XCBA 3ERMA 4C9YA 3FMQA 1W7PA 3R0AA 2DOAA 4II3A 1V5EA 1RIOH 2LY2A 5EEGA 2XKPA 3BLYA 5DV5A 4B3XA 3J7AY 2DT5A 4HW0A 2KFDA 4A3LJ 3R4KA 1XSVA 2MG4A 2OUMA 1QQIA 2IW5A 3L00A 3GZ6A 2DI3A 2V1DA 2GXAA 2F48A 1H9GA 4M9SA 3IWZA 3CC4I 2B63J 3RKYA 3H3VK 2KLOA 3HL2A 4IRHA 2DA6A 3HUGB 2PEXA 4M74A 3W6JB 3W6VA 1BL0A 2HVQA 1U5TB 2DQRA 1IJWC 4I7HA 2IVMA 2GWRA 5HLTA 4MFDA 4ENMA 2STTA 1YW8A 2C6YA 2GA1A 3OOPA 4JP0A 1PYVA 3DWLE 1H89C 2R92J 4ITVA 3EETA 5JFRA 2BW3B 1Z7UA 1J75A 2VC0A 3F23A 5LEJA 2LREA 3HC7A 2NS0A 3HTSB 3Q9SA 3N97A 3K4BA 4RLFA 2V6EA 1IW7F 3H5AA 4LLLA 3ZMVA 4MEXF 1PUFA 3GFIA 2HPIA 1OFCX 1H8AC 4ZH4F 4B8XA 1K83J 1EF4A 3BR1A 3IH2A 5C3EJ 1HKQA 2GAUA 1YHQI 2NXNB 4OIPF 2CYYA 1OMIA 4F55A 4IHVA 3PIPF 3KP5A 1YQAA 4BQAA 1P9QC 2LF8A 1IAWA 1LPQA 3FXLA 1I5ZA 2JPCA 2VQGA 3JRDA 2WAEA 2BHYA 2W24A 3B02A 5FGMA 4V19K 1WJFA 5FD5A 5M5XJ 2QWWA 1IN6A 2A61A 3W3CA 4HDUA 1WJBA 2R7WA 4ENJA 3R0JA 2CQXA 3RPUD 2VE8A 3QAHA 1Y1VJ 3DU5A 4CH7A 1RUNA 5CVVA 1HDPA 5K7HA 2WAFA 4OIQF 4DBQA 1R4MB 3E5XA 5FFXA 2COBA 2JA7J 3TGNA 1REPC 2GOXB 1KQ0A 4KYWA 1SVMA 4CYCA 4C2TA 4EM2A 1I39A 4A2UA 4D0PA 3T5XA 3GVAA 3ZQLA 2E7XA 4BU2A 3PQKA 3QRFF 2WTEA 2GIZA 1YJWI 1YE9A 1SFOJ 1FLIA 2W25A 1P7IA 3KEYA 3VPRA 3FZVA 1KU3A 1O57A 3DBHB 3V4GA 3EUHA 3H35A 1GVJA 2ID3A 5HLGA 4Y52J 3VOEA 2DA4A 4RGUA 5GADJ 1XSDA 4L0ZB 1ZHFA 1ZR2A 3GTKJ 3K4LA 3BQZA 4EJWA 4RB1A 3OR1C 4OMZA 4RB2C 2ECBA 3ECHA 5HS9A 5M5YJ 3LSIA 1R22A 3GTGJ 1RNLA 3GFLA 1G6NA 3A4CA 3N4MA 4UUVA 2KZVA 4F52A 3CCLI 4NNJA 1FX7A 2BV6A 2JSCA 2K9NA 1JKOC 4HZFA 4A3DJ 4UB8C 1ETQA 1CQTA 4UXNA 3BTJA 2R7XA 2HKXA 1QBJA 2FEZA 2FUG2 1BI1A 2HZDA 4TV7A 3ABKH 3LAJA 3D1NI 3D5RC 4E70A 1MNEA 2FE3A 4HBLA 5E8GA 4B3AA 2X4HA 1ZREA 3GMEA 3IH3A 5K5RA 5IP7J 3ABTA 2IA0A 2M4GA 2NOGA 4I0AA 3WHCA 1ODDA 1K6OA 1S7AA 3HRTA 2L54A 3J7YJ 3FKJA 4IHTA 3K0LA 3L2WA 3GUDA 1MSFC 4Y4RA 2O8KA 5L3FA 3TMOA 3RTRA 3V7SA 2X6OA 1MBKA 1JT0A 1N78A 3PJRA 2VXZA 1SD6A 3PUFA 5GPCA 2VKEA 3EUKL 2CWEA 4ANJA 2ICWG 1ETWA 3I59B 3KLNA 2PG4A 3SZTA 5J4YA 1BM9A 2P0WA 2XAHA 1I27A 2VBWA 4PK4A 2XF5A 2OZ6A 2DFHA 3O8GA 3H9JA 2X0LA 4HX4A 3KYLA 2E2JJ 2EV6A 2HQRA 3CP2A 2E34A 2EFNA 1BI2A 1D0YA 3H92A 4F92B 3HZJA 2R7SA 3HSRA 4EATA 5J40A 5J1UA 2EFOA 2RKHA 2Q2EB 4MHGA 1MBHA 3QWLA 5FLXZ 2WY7Q 1NG7A 4ENNA 1JUPA 4ZDLA 3DKYA 2R7UA 3LSRA 1IRXA 5DUKA 3HOVJ 1UCRA 1LDKB 2MLGA 4Q4ZF 4A3KJ 1YLFA 1UZCA 3NWSA 2EFQA 1PDNC 3IKVA 3CJTB 1SMYF 2DOEA 3ZMUA 2LH9A 5FFZA 3RPQA 4BE0A 3RJPA 2OJED 2CRGA 3L2UA 1CF7B 1X1AA 2M1BA 4B43A 3KEQA 4AVZA 1APLC 5H2FC 1KYZA 5KAIC 1E17A 4B47A 1ENHA 4GYIA 4U0WA 2QYOA 5LD2C 2EZKA 3DPTA 2HZTA 4HSRA 2OQRA 2XRNA 4Q5SF 4A3FJ 2CG4A 1PJRA 1BN5A 3U1KA 1W1WE 2YS9A 1Z67A 2PMZA 1OR7A 4JYKA 1MJBA 5KHDA 4HDVA 3AG3H 1ZKGA 3GF2A 1FTZA 4HSTA 4N4NB 1EV7A 1XX5A 3KIOA 2AO9A 5J1RA 1QVTA 3TO7A 2VIXA 4KMUX 5JR3A 4I02A 4RB3C 3W6KB 2L9VA 3J81Z 1YRNA 2V9PA 1RPWA 2O5RA 3CMEI 3BJ6A 2KIMA 5GPAA 2VJ5A 2CUFA 3DF8A 1C0WA 2ZBKA 4BQQA 5E17F 3TBIA 4X6AJ 1XMXA 1VTNC 4CA0A 2KT0A 1IN7A 4K2EA 3L2RA 1YFHA 3S2HJ 1XD7A 4ESJA 4KNYA 1W36C 1ON1A 3C2BA 5GTIC 2V6CA 3W2WA 2UWMA 5KNLA 2QEXI 1ZQ3P 1QPMA 2BOLA 5D5UB 1AHDP 1LNWA 5DUIA 2OV7A 3OSGA 4P5OA 4E7LA 2N8GA 3VEPA 3S3NA 3OYCA 4DQ2A 1HW2A 2K9LA 4ZTFA 1EH8A 3K1NA 3ZMDA 4DYCA 4RBOA 1K61A 2COMA 3MFKA 1U8RA 3I4NJ 3D0SA 1B8IB 2PN6A 5A2QZ 3H36A 4UHTA 4PSWA 5C4JJ 3QYBA 4I6ZA 1P4WA 3L7WA 3I3LA 1TNTA 2K9QA 2L2OA 2I10A 3U2RA 4BY7J 1HOMA 2QQ8A 3ZN1A 3LL7A 5KCMA 1Z77A 1LFPA 3RI4A 2BY0A 4I98B 2CO5A 2DK5A 2MD0A 4IHWA 1WH5A 2X9DA 4A3GJ 4HG2A 3EDPA 1VQKI 5BS6A 2IRFG 1IXRC 2X6WA 2XRLA 3QODA 2OAZA 1G3SA 4AIJA 2A6TA 5DEQA 1IG7A 2CW0F 5CPRB 5E3LA 5JHUA 3AG2H 1K78B 2NRAC 1SC7A 2DK8A 1X19A 4DBRA 5LRRA 1QZZA 3GLLA 2E2IJ 1L0OC 1OKRA 2KHMA 3RIRA 1DQUA 1BC8C 3VWBA 1SAXA 3IP4B 4H4KC 4XNFA 1J2XA 1D8KA 4KDPA 2R5ZB 4PJNA 2DFEA 4IHYA 1PUFB 2HYFA 1B59A 3ASOH 2X1DA 1ETOA 1L3LA 2B7EA 5B1BH 2PQ8A 4JOMA 1MW7A 4XK4A 1LE8A 1YS7A 1S9HA 3SFZA 5FB2A 1TZLA 4PJJA 4Z2YA 1ZAOA 1XB4A 2LKXA 1TBXA 5D5XB 5LGTA 5EGOB 3VSLA 3K9TA 1A36A 1XMAA 1WQ2A 4CYDA 4F7ZA 5EYRA 3F6OA 3OYGA 4J01A 5F0HA 5J6XA 1ZRFA 3RQ4A 1KQ9A 1JTYA 2VJIA 1V54H 2ZXIA 2WB1A 1IV8A 3WGIA 2ESNA 1Z05A 4IF4A 1KA8A 3O2PE 2GXBA 4KT5C 2PJRB 2XAFA 2IEKA 2A3SA 2IPQX 5AIPA 3CCYA 3HKZA 1WPKA 2ZKZA 3WG7H 4XMYA 3CLQA 3E6DA 3A01B 2ZMEA 1XC5A 3BR3A 5J47A 4WF2A 5CLSA 3I4MJ 2K40A 2EFWA 3C18A 2R7VA 2QM3A 2A6HF 2HKOA 1HQCA 1IDYA 2HQAA 1YJNI 2O6GE 3Q0UA 3G6EI 2UZKA 5LHIA 4LIVA 2DODA 2V7FA 4XLAA 1X1BA 2XROA 2QQAA 5JI6A 2HPMA 2Z9OA 2NVYJ 1YX3A 4O5VA 1J9IA 3F8NA 2X1CA 2HOAA 2V9KA 4RAYA 1FMWA 3C3WA 3Q5FA 2E1CA 3FMSA 3L2QA 3I56I 3CCJI 3GCMA 5K1YA 3MQ0A 2KRHA 3FIWA 3V42A 2A5WA 4CCJA 1LVKA 2M7BA 4RGSA 3CCSI 4YIRX 4XKVA 3S3MA 4EJVA 2B0LA 3BR6A 5B66C 3HPGA 3RDIA 4PJ0C 2EQRA 4LB6B 2KPMA 3CO7C 1Y0UA 1RKWA 5HS8A 2FA5A 1B6AA 3I9V2 3REOA 3LSMA 1MMSA 2HS5A 1WWXA 2DXIA 1Q1HA 2WBMA 2NVQJ 2GM4A 2IS4A 3QOEA 3OS1A 4W97A 2XC7A 1W0TA 2BXZA 4HLYA 1HSJA 2K27A 4X0GA 1I6XA 4JK1X 3N05A 4GXOA 1Y1WJ 3KP7A 4FHTA 4YEJA 4HQEA 2IAIA 2ADUA 4BJ6C 3SQNA 3CJRB 5KAFC 1MH4A 2L01A 1WVRA 5TISC 3SZGA 2ZO4A 1QHGA 2XF7A 1FP2A 4P9FA 1FOYA 1I3AA 4HF0A 2V26A 2Q1ZB 4L9TA 5DCMA 1GV2A 2AXTC 4OAZA 3K4JA 4BBRJ 1GUUA 3WGHA 4CYCB 1MBGA 5HVQC 2DA7A 2E1MB 3K69A 4ZYDA 1I1SA 3DEWA 3QU3A 4ESBA 1VQ4I 2FU4A 4ZYAA 3C1DA 2NS7A 1YO5C 1R49A 5DCFA 2AS5F 5CQGA 1W5SA 2JN6A 3ERED 2MC3A 5E20A 4S04A 3S15J 4CZZA 1MNMC 1POGA 2M8GX 1KONA 1WJDA 3QQAA 5CVIA 3A01A 1Y56A 4DZJA 4XRSG 4HNUA 2E5ZA 3ESWB 4QLCU 2RV8A 4HNVA 2KJBA 2A07F 4C3HJ 2YU3A 3FX3A 3WU2C 3GTLJ 1UMQA 4G12A 4CXFA 1FBUA 4XM3A 3X2QH 4ZTJA 1ZG1A 2LBFA 5FROA 3F8MA 1MD0A 5JHFA 4QPOA 4G6QA 4FETA 2K85A 5LRSA 4BAYA 2A6EF 4Q48A 3PM1A 4QWQA 4RMNA 5DYMA 1U5TC 4J19A 3H0DA 1YS6A 3WODF 1TQPA 1ZGAA 2DLLA 3DKXA 3HSFA 3DXJF 4LJZF 2R7TA 2ZC2A 5FD6A 4RS8A 3A03A 3U9GA 1ZN2A 2JVHA 1IN4A 2Z5UA 1NTCA 1J59A 2DAOA 4IPAA 3JRCA 4AUXA 1HLVA 1LKXA 2M9HA 4L18B 2QBYA 1LB2A 2Z2SB 3OYKA 1ZYRF 4U0YA 1HSTA 2QSFX 2DDAA 2W7NA 2M5WA 1D5VA 4U88A 3HIFA 5FLVA 1I1GA 1TWAJ 4KIFA 3BG5A 3FM3A 4PJLA 1JKQC 5D8KB 2LFBA 4BJTA 4EJTA 1BOAA 2JZYA 4XSXF 4KISA 2TDXA 1T98A 3OR2C 4XOPA 2XB0X 5D6FA 1K4SA 4YIIA 5F1RA 4IKFA 2Y0MA 5LHGA 1WZ2A 5M3MJ 2FF4A 3LSKA 4NB5A 1ETXA 2VB6A 4KN7X 2NS8A 4OWRB 2Z3YA 4XONA 1G3YA 1R9TJ 3ELKA 2GIVA 2NOJB 3BQYA 5HLHA 3F8CA 1YW7A 4GRIA 2K9SA 3DTKA 4B09A 1TC3C 3OOUA 2YU9J 4UVCA 3CCMI 4BQOA 1TWCJ 3M7GA 1BR4A 4A0ZA 2CGPA 1U78A 5HLIA 4XRMA 4YG2F 2EIMH 3S2DJ 3BR5A 2E5NA 2R7DA 3MKWB 2UXNA 4BEHA 1VF9A 4LG0A 1MMAA 2EWNA 2ZJ2A 3SYTA 2XSDC 2X48A 4LGWA 5ILUA 3AG4H 2BVMA 4BQNA 2LKSA 2L7FP 1U0JA 4NC8A 2ME0A 2L7MP 2QKMB 4G8XA 3WTSC 2KDZA 3G1MA 1E0EA 3FHZA 1ZR4A 3I5UA 2EA4A 4G6DA 3VFZA 4Y17A 3HGYA 3LSHA 3LA7A 3ZQ7A 3L2CA 4A0YA 3V8KA 2ACJA 1FZPB 1BR2A 4RB0A 4RM3A 4AIKA 1TT0A 1OPCA 3TL4X 3WE2A 3OYJA 3EPZA 1MZBA 2K02A 3J7ZI 4S05A 3DEUA 5JLWA 2H1KA 1T39A 2Y75A 5LEKA 2YX4A 1A04A 2XVCA 1ZK8A 2ZXJA 3H5NA 3GZ5A 4BY1J 1FEXA 5HDGA 3E0JB 2CV0A 3BR0A 4AIHA 3S14J 1TT5B 3A0BC 1I6HJ 2P6SA 2EV0A 1FIPA 3F72A 4A69C 1DU0A 4MFEA 3K4MA 2Y30A 2EPFA 2JA2A 5IYDJ 1QRYA 3FMRA 3ASNH 3OYDA 3CUQC 4PUSA 4XSZF 1IUFA 2XV4S 3LFKA 3M1CA 4U87A 1XMKA 1WJAA 2UXXA 1FOWA 4L5EA 1AA7A 3SDBA 3RYRA 3OYLA 4FX4A 3COAC 4BL0B 1P92A 4RA2A 4Z6YA 5E18F 3FXRA 3BZCA 1SMTA 3AAFA 3M8EA 2D2WA 3ABMH 1FT9A 2CQNA 3I58A 4WCGA 5FLMJ 2Y31A 1Z7LA 2G7UA 2XUBA 2L02A 3AL0B 2AXLA 2DYRH 1D1BA 3IKTA 3AG1H 2BBYA 3GO5A 4E7SA 2GQQA 1EH7A 1PP8F 3PNTA 2OZUA 1IRGA 4XR6A 2ZSIB 4CCKA 1HDDC 3A1YA 1I3QJ 1LFUP 3VYSB 1T95A 3CJQB 3HKZN 3CC7I 4C3JJ 2M0MA 3OYHA 5M3FJ 3G3ZA 3F3XA 1OR7C 4I99C 1AKHB 4ZYHA 2VLAA 2GA2A 4FE7A 2VBZA 4OMYA 2QLZA 2RN7A 3EUAA 1UHWA 1SAUA 4QPQA 4BACA 2Y48A 2HVRA 1P2FA 1Z3YA 1J7KA 2HXOA 5IYBJ 1P4AA 2L4MA 3BWGA 4E7KA 1VNDA 1HF0A 1DP7P 2BYVE 3M1EA 4PGGA 2K4BA 2KRCA 3MKZA 2VQCA 1UHSA 1QNTA 3TDZC 1FBSA 3KEOA 1X3ZB 2DMNA 2HTSA 3MD2A 1SFUA 2F4MB 2R5YA 2VOOA 1YTYA 4RGXA 2G0EA 3PL8A 1OQYA 3OYBA 4A3EJ 1LEAA 2HXIA 4XIDA 1R1TA 1JT6A 2K9MA 4WXDA 4RM2A 1VQMI 3GBGA 1HXDA 2Y69H 4RGRA 3S1QJ 1R7JA 4MQVA 2XB5A 5LLQA 5ILSA 4IHXA 2XPVA 2QSGX 1T0FA 3ZQCA 2HR3A 1ORKA 3FXMA 1LUJB 1R00A 3CMMA 3AFHA 2ZXHA 3DEEA 1X2NA 3KP6A 4CCOA 4RAZA 5H6QA 1F1ZA 3RYPA 1PVEA 3TEDA 5IT9K 1ZG5A 1VQ6I 2FX0A 2CW7A 2RAEA 5FJ8J 2NVXJ 1E2XA 2VBYA 3J7AO 3JAMK 1CGPA 4GDFA 4F3QA 4UB6C 5GTHC 5IPAA 1DPRA 4DZPA 3HOTA 2O8XA 3JTGA 4IX7A 2XGCA 3GXOA 2WV0A 5FRMA 2IS6A 1BIAA 3OIOA 5K5OA 4UVBA 4HNTA 3KPHA 2VKVA 4IRGA 1X58A 2LLKA 3OS0A 3P7NA 3E6BA 1K4TA 2DTZA 1TWFJ 2E1OA 3CLOA 4P96A 5CVUA 4BH9A 3RPUA 3FHNA 5DTDA 5BQTA 3HDDA 2IA1A 1WH7A 3TP3A 3KETA 1NK2P 2XPUA 3BOQA 4PSXA 3ZMSA 3BT9A 1Y39A 5J1YA 1R6RA 4ZJZA 2DQLA 4B1RA 4BXUA 1FWZA 5IP6A 3CD6I 2ZCWA 2R7ZJ 2DTRA 4N0BA 4B44A 3VYRB 2JA5J 1YOVB 3ECOA 2EJRA 1KZHA 2XPWA 2VONA 3NRVA 3WGGA 1LDJA 2STWA 4C2UA 2PFBA 1J09A 4DW6A 1SEUA 4AYBN 5LHHA 3QYFA 3E5QA 2LOOA 1O4XA 3ZP5A 2W48A 1Y6IA 1AU7A 2R0QC 2EZLA 5B5EC 3S1NJ 3CCQI 1BW6A 2EINH 2KDOA 1IRFA 2ZSHB 4XICA 1ZGJA 4M3FA 2Q2EA 1MBEA 1EJ9A 3R6SA 3KP4A 1G2HA 1H0MA 3LMMA 1VI0A 3PUBA 3KLOA 4EQQA 3FK6A 3K1MA 3NQOA 2JT1A 3TQNA 4DYQA 2NYXA 1OCOH 3CC2I 1OYWA 2MH9A 2XAUA 2R5ZA 3FBNB 1Z6TA 3JCUC 3WU1B 4M3GA 2R5YB 3CJNA 2FQ4A 4JQFA 2QA4I 4IL6C 3I53A 3HRMA 2CS3A 4BHCA 2V4JC 5K7FA 1DDNA 4UUSB 2QQ9A 4HV5A 4CO8A 2P7CB 4BDZA 3A2KA 4MEYF 5KK1A 2CH0A 1T2KA 3DCFA 3E6CC 3IHUA 3IUOA 2BY3A 4M73A 1SVOA 1WJCA 4I09A 4EGZA 3FF5A 3E6MA 3MWMA 3GLXA 2IGMA 1TLHB 5D4SA 2FNAA 5F27A 3OWTA 2V1UA 2XDVA 4HQMA 4II2A 4BYYA 2DW4A 2D1VA 3O3KA 4A3CJ 2VXDA 3MZHA 2BGCA 2RDPA 2QUFA 3BR2A 1AKHA 3CUOA 3TW7A 1X1CA 3DBLB 1KQ8A 2NAZA 1JHFA 2EZIA 3S8PA 2JQ7A 3PFYA 4HF1A 1HCRA 1BR1A 2R7FA 2DO7A 4P55A 3BP8A 1RR7A 1FYKA 2XGEA 5JVTA 3WTWC 4RDUA 4WX9A 2TCTA 2DYSH 2V1XA 1X1DA 4NDLA 1FJLA 5IYCJ 1O3RA 1A5JA 3TW6A 2Z1DA 4KUMA 2F5DA 4D5CA 5DD4A 2JPBA 5EDNA 3H3UA 1IXSB 2YX7A 4NQWA 2LBFB 1JJ8C 1EA3A 2VKHA 2O61A 3FXJA 1S8NA 2MYSA 3BTLA 2CU7A 2ZFWA 1S7EA 4XOTA 4HF2A 3O8HA 2EZHA 4QTRA 3S16J 1TP4A 5HDNA 2F5VA 3QP5A 1ZTRA 3D5SC 2HQNA 5FKKA 1YRNB 2HDWA 2L9NA 2M45A 3HRUA 4FISA 4IVNA 5H6RA 1IDZA 2D5VA 3BZKA 3VYUB 3CF2A 2HEOA 3BG6A 2IXSA 1RI7A 4WXCA 2RC4A 2M4KA 2EA2A 2PBIA 2M3AA 2VT2A 3LOCA 4JBAA 1DGWY 1F4KA 2H27A 2GOMA 3NARA 2LK2A 2JA8J 5E1ZB 1O7LA 1CF7A 1MGTA 3OV8A 3WTXC 2BZTA 2E60A 3G4SI 4FT8A 2L9SA 3KZYA 3WTVC 4ZDOA 3TKYA 2KJCA 3CO6C 3CCEI 2CFXA 2LSOA 5J8FA 4E7HA 2BXYA 4R8HA 3HOUJ 1XDSA 3HJEA 2KIUA 2PLYA 1IO2A 2ZXWH 3HG9A 4HX8A 4AWXB 1D3YA 4C2MJ 2GBYA 3PIOF 1I50J 4ABZA 1E3HA 2MSYA 5L3EA 4XN0A 2E7WA 2X6XA 5CJ9A 2F4IA 1ULYA 2XAJA 1JI8A 2B9SA 4N9IA 4BBSJ 1OCZH 4ON0A 3BG7A 1TQIA 2J5PA 4BEHB 3HOWJ 2ZJQF 1GXPA 1SFEA 5LFAA 2XF6A 3Q3SA 3C2GA 4FCYA 3K4NA 2ZJRF 1UFMA 1WFXA 4YRVA 2HVSA 1WJEA 4HV6A 4JX6A 2ETHA 1UHMA 3V7RA 5GP9A 2IGOA 2RQQA 1U2WA 3ZR8X 5LGNA 3JSPA 3P9KA 2VKDA 2X1EA 2P6TA 5CKTA 4IJAA 1ERDA 3VYTB 4U7BA 3ZQFA 1KU2A 2X85A 2VJJA 4NBQA 3ZXSA 3J80Z 2Y9ZA 5HS7A 3DU6A 2M0CA 3TDUC 3HRSA 2FXAA 4I76A 1YITI 4WWCA 4AD9A 2DA2A 1IV6A 2D45A 3E3VA 1BIBA 4ENKA 3CDIA 5LBQA 1MKMA 2Y2ZA 3KFWX 1JUMA 4PGHA 4A0XA 2DOFA 4M9XA 3S3OA 1U8BA 3CMYA 1JUSA 1SD5A 1F9NA 2XGXA 2A5YB 3MVPA 3T8TA 1H88C 1BI0A 3JAMZ 2DBBA 2DMPA 1MDMA 1QVUA 1YX5A 1OISA 2VASA 5E1XA 2VQHA 2QVOA 4FASD 4CCLA 3HGGA 4UUTA 3E7LA 4A5NA 3DP7A 4M3EA 2J5OA 1VQOI 5E1WA 3J80K 5ICEA 5HNFA 1K7AA 2HGCA 2PJRA 2EK5A 1SFKA 5J3LA 9ANTA 1FC3A 4PFOA 1STZA 5AIQA 1MMNA 1RESA 3SZPA 3OYIA 2R3SA 1A35A 3CCRI 4UY8I 2OCEA 4BGDA 1HW1A 3ABLH 3ISPA 4XLHA 3R61A 1XGOA 1GHCA 3PNYA 3K70C 5L3CA 1B9MA 3AKZA 1S5LC 5AONA 2YPRA 1S6LA 2VN2A 2R7QA 4V2GA 3GW2A 2OCCH 1V5GA 2JUGA 2V1NA 3TOAA 4R79A 3I71A 1HW5A 5FKNA 1XGNA 3JREA 2PMZN 1UG0A 5FKOA 4BNCA 2FNPA 3GFMA 3HOZJ 2A68F 4FX0A 4BHBA 1B1BA 4S0HB 3OL3A 5K5QA 3IAM2 3MAJA 1USSA 2K7LA 3RCOA 3ABUA 1VZ0A 2P5VA 3VDXA 1OYYA 4LG3A 2O03A 2L5QA 2DMTA 4G94A 1XPXA 3T0YA 4BHPA 2HTJA 5HNHA 4J00A 2CUEA 3MZYA 2TRTA 3JRHA 1X2MA 1A31A 4ESFA 4KIGA 1QO0D 3LA3A 1T0FC 2LDUA 4JX4A 2CQKA 3QP6A 2K3PA 3DV8A 3FM5A 3NWTA 4O6JA 4Y13A 2HI3A 1K78A 1FSEA 2DT7B 5DDGA 3LNQA 2VBXA 3BJAA 2PJPA 4CDGA 2O7OA 5EJCA 3B73A 3BJOA 3QOPA 3V7CA 5IOYA 3PO2J 1ETKA 3A0HC 2BY1A 3I0TA 3LFUA 1ZG3A 3BY6A 1BOBA 2Y9YA 2BVLA 4E4HA 1KU7A 2W4SA 3V8LA 3WHBA 2DJNA 2HQ5A 3K2ZA 2E1MC 3OYNA 4HPQA 5F08A 2UV1A 4EEFG 1MSEC 4M6XA 3SFIA 3LA2A 1X4OA 3CMAI 1O3TA 1R23A 5BNGA 2LC2A 2WAQA 2K4JA 1MH3A 1Z6RA 2LF7A 1HBXG 4L9VA 3I4PA 3S2WA 5ICCA 2EIKH 3HEFA 5DM7F 4V2FA 1ACIA 1VQLI 1V5FA 1U5TA 3F0CA 1XTAA 1X3UA 2I5UA 2MH2A 5IT3A 1JKRC 2KQRA 5C4XJ 5F04A 1B72A 2WV1A 4NC6A 5BPDA 5IP9J 1DPUA 2QGUA 3FXOA 4M71A 3B6AA 2M2EA 3MCZA 4I2OA 1D5YA 4QSHA 3QPTA 1NG6A 3HOXJ 1IZ1A 2W57A 4E7IA 5BMZA 1ZLKA 3I59A 3BZ6A 4E6KG 5ED4A 4CGZA 5B1AH 3QPSA 3BG9A 2OA4A 3L2VA 3F8BA 4I01A 2LP0A 4XRSA 1JHHA 4KA4A 2I8DA 3DLLF 2HOTA 3ZOBA 3BPXA 2HYGD 3OMYA 3C2HA 2FMLA 5D4RA 4UV8A 2LVSA 3ZQQA 1QGPA 2PMUA 4PFPA 2CFOA 2ZJPF 1FOKA 3ZPLA 4LLNA 3QPHA 1IXCA 5IOZA 3ZCOA 2BEOA 4U0VA 1D1CA 2L4AA 4BE2A 4A93J 2IT0A 5HODA 3OYEA 5EEAA 4IOCF 1Y8QB 1YW9A 1OCTC 1J0RA 2KMUA 3DBRB 3IC7A 4KIBA 4KN4X 3OYAA 1LJ9A 3OS2A 2KRFA 2WA0A 5GAGJ 4Y7NJ 2JRMA 3OIPA 4A6EA 2GLOA 4WK8F 1TNSA 2H6CA 2WC2A 3GEZA 1TL8A 2ISZA 2LD5A 2R93J 3S1MJ 4G9YA 2LMDA 2R7RA 3E5UA 1RR8C 3FWEA 5CVJA 2QQBA 3HXLA 3CDLA 5IT9Z 2NNNA 2AQEA 4Y33A 3V8JA 5DCMB 1HKSA 3LSPA 2MD5A 1IRZA 2E36A 2P5LC 3H9GA 1T33A 3UNGC 2KIFA 5BPIA 4LIUA 4BXFA 4AYBA 2NNYA 3VSKA 2JUCA 3WTUC 2DPUA 2DDBA 2W00A 1E3PA 3MZ8A 2DFFA 3MN2A 2PMHA 1QPIA 4N4OB 3FXQA 3QYEA 2KKOA 3JRAA 3S32A 1Y8RB 5IY5H 1ZRCA 4LMYA 2DA1A 2QCOA 2H94A 5KVRA 1F36A 3EYYA 3JRBA 4CUGA 2IA2A 4OINF 3IV5A 3CF5F 2VODA 3ZQGA 1JKPC 2CQ7A 1VQNI 4HYEA 2MW8A 2YUSA 2M8EA 4D9JA 1WCMJ 4UVAA 3HBLA 3OY9A 1XG1A 3BTIA 1MMDA 2DA5A 4DGWB 4CCNA 1ZLJA 2NVTJ 5L3BA 5F0CA 1QZYA 3CZ6A 4XL9A 4M3BA 3TOBA 1J5YA 3JW4A 1R1UA 3M9AA 1Y0NA 1W7PB 2VC1A 5DM6F 3Q0VA 3IRRA 3F8FA 1MDMB 1B4AA 3BG3A 3UKGA 1FMVA 2FRHA 2WADA 5FKLA 2EILH 1RUOA 4HA8A 1ZARA 3UR3C 1Z91A 3U21A 2XASA 1X3WB 3ULQB 2MGQA 1P6RA 4YIFA 1W7PD 2Z16A 4XLCA 3QPLA 3A02A 5EZGA 4F91B 3B6CA 1E3OC 2DA3A 5JVGF 2EV5A 3KYCB 3WE3A 2QZ8A 4B48A 1QHHD 2X6YA 3WU0A 3FXKA 4NHJA 1LFBA 5EG0B 4LLGF 1F43A 1TQMA 4PDKA 3OYFA 4KMFA 1OLTA 3ZRGA 1YIJI 3JRIA 4P9UA 1WI3A 1BC7C 4OOIA 5ERIA 2CSOA 5E8IA 3ML6A 1B8IA 2Q8KA 1X4PA 1Z3XA 2EH3A 4GGGA 2ZB9A 4XQFA 2O9LA 5JLXA 2V79A 3M3YJ 4Y3OA 3W2VA 2MBFA 3QU6A 2DN0A 3L09A 6PAXA 2HOEA 1YG2A 4N9HA 1ZRDA 2VPRA 4YFXF 1DGRM 4OU0A 5L3DA 3ZQHA 3IH4A 3W2AA 3S17J 1GLNA 3LAPA 4A12A 3WG9A 1R1VA 1IF1A 4XLNF 4DIQA 3KCCA 4L5JA 4RAGA 4M3DA 1V55H 3GWZA 2JK3A 3SEZA 4CHUA 4BDYA 3PO3J 3BDDA 1HC8A 3ZMTA 4L0YB 1TTYA 2OPTA 4EVIA 2F6CA 3H9QA 3LWFA 1T6SA 3HTUA 5D5WB 3LSGA 5F64A 4WXHA 2L7ZA 4MLOA 2KIQA 4BE1A 2K5CA 5CVRA 3OSFA 2L7KA 2P81A 5K7ZA 1AOYA 3GTPJ 4PZJA 2LR8A 1IN8A 2W84A 1IUYA 4PJMA 4I0BA 5F1JA 3OYMA 1R5GA 3IRQA 4XKBA 2XGDA 1F5TA 3J81K 5E3NA 5LGUA 2DT6A 3MEXA 1K6YA 2CMPA 1NK3P 4AVPA 1YI2I 2JWTA 1FP1D 2DMUA 1UG2A 3M4OJ 1FNNA 2KL4A 3K4KA 3M07A 1U9OA 2DFIA 2LY9A 3P9IA 3HYIA 1XGSA 1O3QA 1Z21A 4ZYGA 5EG0A 2CW8A 3CUQB 3FBIB 1P7JA 1ETVA 2FQ3A 3AL0C 2FBIA 2O3FA 2HWVA 3ROUA 3GTMJ 4BS9A 1WJ5A 2OC6A 1MBJA 1FSHA 1K79A 1U9NA 4IEJA 2CUZA 3WTZA 4NC7A 3WTYC 4IHSA 4CZCA 1PP7U 1GXQA 3EQLF 3DLAA 2ID6A 4XLPF 1IGNA 2FBHA 2KISA 3EYIA 3MKLA 2ZNZA 2F5FA 1LE8B 2HU9A 2OBPA 3HB9A 1G3TA 4EGYA 1FYMA 2R4GA 3Q0WA 4X1EA 1G8XA 5E79C 4A6DA 3ZMZA 2RREA 4HX7A 3TP0A 3GYHX 3BTCA 1D8JA 4XBFA 2MC4A 3K6GA 5DD8A 1HKTA 2W85A 4KFCA 1MBFA 2VJ4A 2WY8Q 3CESA 3DKWA 4LD5A 1ITYA 1D0ZA 1SVLA 2IGNA 1BI3A 2QENA 2R7OA 4MTEA 4D7NA 2IS2A 3KX2A 3M8JA 4IRIA 2DPDA 1N75A 3BCBA 5J4VA 3KP3A 3P5JA 3RSNA 1VQPI 4XLEA 3K10A 3ZGKA 1T08B 2L3DA 1V3FA 1DU6A 3DPLC 4Q47A 4FQGA 2ESHA 3H1CA 3K7AJ 2FMYA 4CICA 3DTIA 5EEHA 5FKMA 2ZMEB 4KT6A 2XAGA 2P4WA 4AC0A 4GO1A 2A05A 2OU2A 2ELJA 3IAS2 3VB2A 1EKEA 2M7AA 1FBQA 3FDYA 3K1PA 4BJ5C 1S7OA 3C7JA 4IOAF 5GAHJ 1ONVA 5CYVA 1LVAA 5TGTA 4A3BJ 1XGMA 1FIAA 1D1AA 2VL8A 4QIWN 2E2HJ 3PQJA 3EUHC 2H8WA 4FE4A 1JE8A 2AHQA 3H5RA 2CV2A 2VI6A 3ZQIA 3PSFA 4LFUA 2BHZA 5EGOA 2E71A 5TRDA 1ZGWA 1OCRH 2W1OA 3E97A 2F4OB 5ILVA 2ZMEC 3CTAA 3G1OA 2XAQA 3G73A 1LDDA 4ZZDA 4PCQA 1G3WA 5A2QK 3IL2A 1USTA 4KITB 3HOSA 1FPQA 3HHHA 4ASNA 4ZZLA 4HRIA 2IS1A 3D5LA 3HSEA 1WI9A 2AQFA 4NUBA 3F22A 3RKQA 1JGSA 5L3GA 1RC9A 3BC8A 4IXAA 1TWGJ 2H09A 4XORA 3FISA 5EF6A 1MIJA 1W5TA 1SD4A 1V4RA 4Y15A 5EZHA 3U1DA 3KZZA 2QSHX 2FOWA 1JJ6C 3FXUA 2MABA 3PNVA 2H1LA 1OCCH 5HOOA 4RLQA 4EJUA 1LEBA 3SEQA 2OF7A 2M34A 5E3OA 1DP3A 1B9NA 3CP8A 1ZH5A 4IZZA 2QKLB 4OAYA 5FLXK 4EV0A 1WGXA 1XSXA 4GCVA 1QA6A 1T8IA 2YSRA 1MNDA 1B72B 4W1UA 1WRJA 2BE5F 3K4CA 3HOYJ 1RZ4A 3F6VA 2RNGA 4GFBA 4JX5A 3NEUA 1WSUA 2D1HA 4MTDA 1BJAA 2FJ1A 4L9NA 4HAMA 3HUGA 2QBYB 3H0GJ 2JVGA 3CUQA 2ZNYA 2Z33A 5CQEA 1WKMA 2PX9A 2DMQA 2KP6A 2OTJI 3DPUA 1GVDA 3HPHA 2M30A 1R5ID 3FK7A 5E3MA 2G9WA 2LG4A 5BOXA 1W36D 2IGKA 3FKIJ 4FTHA 4L9JA 4EM1A 1P4XA 5GAEJ 4ZYEA 4LK1F 2HOSA 1TW3A 2IP2A 4M6VA 3JSOA 3RKWA 1PUEE 4MIMA 2K86A 2EB7A 5D6EA 2MA3A 2OTLI 3LSTA 4M6YA 4YFKF 1VQ8I 3SDGA 3WTTC 2M87A 2RGVA 4A3MJ 3DFGA 2RNJA 2RVCA 2VQLA 1O3SA 1D0XA 2VUMJ 2FSWA 4BUPA 3GX4X 4P1WA 4G7ZF 3JRGA 3S1RJ 1RETA 3KP2A 2X51A 3ZN0A 3LQRA 2EFPA 4R1HA 4KJZA 1W4MA 2WB1N 4BXXJ 1FOXA 2YR2A 2KZGA 1UB9A 2E1NA 3I55I 2VOPA 1XDUA 2HYJA 1HA8A 4IQ4A 2CQQA 1FY7A
chains in the Genus database with same CATH topology
1S3JA 3HHGA 1ON2A 1R58A 2F5CA 1OYIA 3LQQA 2G7HA 2O0YA 3BROA 4O3MA 2A69F 1O7FA 4G7HF 2WWYA 3Q9VA 1H9TA 3P9CA 4EJOA 4ETSA 2VT3A 4MGRA 3O6BB 3VODA 5D5VB 1FYLA 1T38A 4GYGA 2HDCA 3TO9A 2JRTA 2ELHA 3M8FA 3GFJA 3I64A 2FBKA 2F5EA 2FOKA 5TJJA 5F6FA 3T1BA 1U6GA 1Z9CA 3DQVC 4M72A 1AWCA 1DUXC 2LNBA 4UV9A 3CDHA 4MQ9F 1Z1DA 2XIGA 2Q0OA 2V9VA 1R5HA 5ICGA 4XRFA 4OIRF 4YFNF 3RKXA 2DU9A 1SFXA 4H0EA 5J8CA 1LQ1A 4LG0B 5H20A 1KGSA 3H3ZA 3JTHA 1TW2A 4LB5A 1YIOA 2GXGA 4LK0F 3SXYA 2HFHA 2LKPA 5FO5A 2MLKA 4KICA 4OIOF 4MNUA 2PI0A 1EH6A 1S29A 2OQGA 4UNOA 3L9FA 2VE9A 1MJAA 4HLXA 1BBYA 1SD7A 4M9ZA 4L5IA 2GZWA 4A5MA 1JXSA 1KYWA 3PFIA 4EMSA 1R36A 2JTVA 1MJ9A 3KE2A 2RQPA 1IN5A 3IWFA 2H6BA 2ISYA 5D8LB 3I54A 2XHKA 4U7DA 2XKOA 1NHAA 4EM0B 5HDKA 1G4DA 4G7OF 1YYVA 1XCVA 2P8TA 2F2EA 2P7VB 3F21A 3SHFA 1KU9A 1XN7A 4DNCA 2IJLA 2Z99A 3BPVA 1U3EM 4HOBA 5ICFA 2OD5A 3TO6A 3T8RA 2P5KA 3R60A 1XCBA 3FMQA 1W7PA 3R0AA 1RIOH 5EEGA 2XKPA 5DV5A 2DT5A 4HW0A 3R4KA 1XSVA 3GZ6A 1QQIA 2IW5A 3L00A 2DI3A 2V1DA 1H9GA 4M9SA 3IWZA 3RKYA 4IRHA 2PEXA 4M74A 3W6JB 1U5TB 2DQRA 4I7HA 2IVMA 2GWRA 4ENMA 2STTA 1YW8A 2C6YA 2GA1A 3OOPA 3EETA 5JFRA 1Z7UA 1J75A 2VC0A 3F23A 5LEJA 3HTSB 2NS0A 3Q9SA 3N97A 1IW7F 3ZMVA 4LLLA 4MEXF 3GFIA 4ZH4F 4B8XA 1HKQA 2GAUA 4OIPF 2CYYA 1OMIA 3KP5A 1YQAA 4BQAA 2LF8A 1IAWA 1I5ZA 2JPCA 2W24A 3B02A 5FGMA 5FD5A 2QWWA 1IN6A 2A61A 4HDUA 4ENJA 3R0JA 2VE8A 3QAHA 1RUNA 5CVVA 4OIQF 3E5XA 5FFXA 3TGNA 1REPC 1KQ0A 4KYWA 4EM2A 4A2UA 4D0PA 3T5XA 3GVAA 2E7XA 3PQKA 3QRFF 2WTEA 1FLIA 2W25A 3FZVA 1KU3A 1O57A 3V4GA 3EUHA 1GVJA 5HLGA 3VOEA 4RGUA 1XSDA 4L0ZB 1ZHFA 4RB1A 4EJWA 4OMZA 4RB2C 3ECHA 5HS9A 1R22A 1RNLA 3GFLA 1G6NA 3N4MA 4UUVA 1FX7A 2BV6A 2JSCA 4HZFA 4UXNA 2HKXA 1QBJA 2FEZA 4TV7A 1BI1A 3LAJA 4E70A 2FE3A 4HBLA 5E8GA 1ZREA 2X4HA 5K5RA 3ABTA 2IA0A 4I0AA 1ODDA 1K6OA 1S7AA 3HRTA 2L54A 4IHTA 3K0LA 3GUDA 5L3FA 3V7SA 3RTRA 2VXZA 1SD6A 2CWEA 3I59B 3KLNA 2PG4A 3SZTA 1BM9A 2XAHA 1I27A 2VBWA 2OZ6A 2X0LA 4HX4A 2EV6A 2HQRA 2EFNA 1BI2A 3H92A 3HSRA 2EFOA 2RKHA 4MHGA 5FLXZ 4ENNA 5DUKA 1UCRA 1LDKB 2MLGA 4Q4ZF 1YLFA 2EFQA 1PDNC 3IKVA 1SMYF 3ZMUA 5FFZA 3RPQA 3RJPA 1CF7B 2M1BA 3KEQA 1KYZA 1E17A 4GYIA 4U0WA 2QYOA 3DPTA 2HZTA 2OQRA 2XRNA 4Q5SF 2CG4A 1BN5A 1OR7A 1MJBA 4HDVA 3GF2A 1EV7A 3TO7A 4KMUX 5JR3A 4I02A 4RB3C 3W6KB 3J81Z 3BJ6A 2KIMA 3DF8A 1C0WA 2ZBKA 5E17F 1VTNC 1IN7A 4K2EA 1YFHA 1XD7A 4ESJA 4KNYA 1ON1A 2V6CA 2UWMA 1QPMA 5D5UB 1LNWA 5DUIA 4P5OA 3VEPA 4DQ2A 1HW2A 1EH8A 3K1NA 3ZMDA 2COMA 3MFKA 1U8RA 3D0SA 2PN6A 5A2QZ 4UHTA 1P4WA 3L7WA 1TNTA 3U2RA 3ZN1A 3RI4A 4I98B 2CO5A 2DK5A 3EDPA 5BS6A 2IRFG 1IXRC 2OAZA 1G3SA 4AIJA 5DEQA 2CW0F 5JHUA 1K78B 2NRAC 2DK8A 5LRRA 1QZZA 1L0OC 1OKRA 3RIRA 1BC8C 1SAXA 1J2XA 1D8KA 4KDPA 2HYFA 1B59A 1L3LA 2PQ8A 1YS7A 3SFZA 5FB2A 4Z2YA 1ZAOA 1XB4A 1TBXA 5D5XB 5LGTA 3K9TA 1XMAA 1WQ2A 4CYDA 4F7ZA 3F6OA 5J6XA 1ZRFA 1KQ9A 3WGIA 2ESNA 1Z05A 4IF4A 1KA8A 3O2PE 2GXBA 4KT5C 2XAFA 2A3SA 2IPQX 5AIPA 2ZKZA 3E6DA 2ZMEA 4WF2A 5CLSA 2EFWA 3C18A 2QM3A 2A6HF 2HKOA 1HQCA 2O6GE 2UZKA 5LHIA 2XROA 2QQAA 5JI6A 2Z9OA 4O5VA 1J9IA 3F8NA 4RAYA 2E1CA 3C3WA 3Q5FA 3FMSA 5K1YA 3MQ0A 4RGSA 4EJVA 2B0LA 3RDIA 4LB6B 3CO7C 1Y0UA 5HS8A 2FA5A 1B6AA 3REOA 2HS5A 1WWXA 1Q1HA 4HLYA 1HSJA 2K27A 1I6XA 4JK1X 4GXOA 3KP7A 4FHTA 4HQEA 2ADUA 3SQNA 2L01A 2ZO4A 1FP2A 4P9FA 4HF0A 5DCMA 4L9TA 3WGHA 5HVQC 3K69A 4ZYDA 1I1SA 3QU3A 4ESBA 2FU4A 3C1DA 1YO5C 5DCFA 2AS5F 1W5SA 3ERED 2MC3A 5E20A 4S04A 4CZZA 5CVIA 4QLCU 2RV8A 2KJBA 2A07F 2YU3A 3FX3A 4CXFA 1FBUA 1ZG1A 3F8MA 1MD0A 4G6QA 5LRSA 4BAYA 2A6EF 4Q48A 4QWQA 5DYMA 1U5TC 1YS6A 3WODF 1TQPA 1ZGAA 2DLLA 3HSFA 3DXJF 4LJZF 5FD6A 4RS8A 3U9GA 1ZN2A 1IN4A 2Z5UA 1J59A 2DAOA 4IPAA 4L18B 2QBYA 1LB2A 1ZYRF 4U0YA 1HSTA 2M5WA 1D5VA 4U88A 3HIFA 1I1GA 4KIFA 3FM3A 5D8KB 4EJTA 1BOAA 2JZYA 4XSXF 2TDXA 1T98A 5D6FA 4YIIA 5F1RA 2Y0MA 5LHGA 2FF4A 4NB5A 4KN7X 2Z3YA 1G3YA 3ELKA 2GIVA 5HLHA 3F8CA 1YW7A 4B09A 4UVCA 3M7GA 2CGPA 4A0ZA 1U78A 5HLIA 4YG2F 2R7DA 2UXNA 4LG0A 2EWNA 2ZJ2A 4LGWA 5ILUA 3WTSC 4G8XA 3FHZA 3I5UA 2EA4A 4G6DA 3VFZA 4Y17A 3LA7A 3ZQ7A 3L2CA 4A0YA 3V8KA 2ACJA 1FZPB 4RB0A 4AIKA 1OPCA 3WE2A 1MZBA 2K02A 4S05A 3DEUA 1T39A 2Y75A 5LEKA 2YX4A 1A04A 2XVCA 2ZXJA 3GZ5A 5HDGA 4AIHA 2P6SA 2EV0A 3F72A 3FMRA 3CUQC 4XSZF 2XV4S 3LFKA 1XMKA 2UXXA 3RYRA 4FX4A 3COAC 1P92A 5E18F 3FXRA 1SMTA 3AAFA 3M8EA 2D2WA 1FT9A 3I58A 4WCGA 2G7UA 2L02A 2XUBA 2AXLA 3IKTA 2BBYA 3GO5A 2GQQA 1EH7A 1PP8F 2OZUA 1IRGA 3G3ZA 3F3XA 4ZYHA 4OMYA 2GA2A 2VBZA 2QLZA 2RN7A 1UHWA 2Y48A 1P2FA 1J7KA 1P4AA 2L4MA 3BWGA 1DP7P 2BYVE 3M1EA 4PGGA 2K4BA 1QNTA 3TDZC 1FBSA 3KEOA 2HTSA 1SFUA 2VOOA 1YTYA 4RGXA 1LEAA 1R1TA 4WXDA 1HXDA 4RGRA 1R7JA 4MQVA 5LLQA 5ILSA 1T0FA 2HR3A 1R00A 3KP6A 4RAZA 5H6QA 1F1ZA 3RYPA 5IT9K 1ZG5A 1E2XA 2VBYA 3J7AO 3JAMK 1CGPA 1DPRA 3HOTA 2O8XA 3JTGA 3GXOA 2WV0A 1BIAA 5K5OA 4UVBA 4IRGA 3P7NA 3E6BA 3CLOA 4P96A 5CVUA 4BH9A 3RPUA 5BQTA 2IA1A 3KETA 3BOQA 3ZMSA 2DQLA 4BXUA 1FWZA 2ZCWA 2DTRA 4N0BA 3ECOA 2EJRA 2VONA 3NRVA 3WGGA 1LDJA 2STWA 2PFBA 5LHHA 3E5QA 3ZP5A 1IRFA 1ZGJA 2Q2EA 3R6SA 3KP4A 1H0MA 3KLOA 4EQQA 3K1MA 3NQOA 2JT1A 3TQNA 2NYXA 1OYWA 2MH9A 1Z6TA 3WU1B 3CJNA 4JQFA 3I53A 3HRMA 4BHCA 1DDNA 2QQ9A 4HV5A 4CO8A 2P7CB 4MEYF 5KK1A 1T2KA 3E6CC 3IHUA 4M73A 4I09A 4EGZA 3FF5A 3E6MA 3MWMA 3GLXA 1TLHB 5D4SA 2FNAA 2V1UA 4HQMA 4BYYA 2DW4A 2D1VA 3O3KA 3MZHA 2BGCA 2RDPA 2QUFA 3CUOA 1KQ8A 2NAZA 1JHFA 4HF1A 2R7FA 2DO7A 4P55A 3BP8A 1FYKA 5JVTA 3WTWC 4WX9A 2V1XA 1O3RA 4KUMA 2F5DA 5DD4A 2JPBA 3H3UA 1IXSB 2YX7A 4NQWA 2O61A 1S8NA 2ZFWA 4HF2A 5HDNA 3QP5A 2HQNA 2M45A 3HRUA 4IVNA 5H6RA 2HEOA 1RI7A 4WXCA 2RC4A 2EA2A 2PBIA 2VT2A 4JBAA 1F4KA 2H27A 5E1ZB 1O7LA 1CF7A 1MGTA 3OV8A 3WTXC 4FT8A 3WTVC 3KZYA 3TKYA 2KJCA 3CO6C 2CFXA 2LSOA 5J8FA 4R8HA 1XDSA 2KIUA 2PLYA 4HX8A 4AWXB 1D3YA 5L3EA 2E7WA 5CJ9A 1ULYA 2XAJA 4N9IA 4ON0A 1TQIA 2J5PA 1GXPA 1SFEA 1UFMA 4HV6A 2ETHA 1UHMA 3V7RA 5LGNA 3JSPA 1U2WA 3P9KA 2P6TA 4IJAA 4U7BA 1KU2A 3J80Z 5HS7A 3TDUC 3HRSA 2FXAA 4WWCA 4AD9A 2D45A 3E3VA 1BIBA 4ENKA 5LBQA 1MKMA 3KFWX 4PGHA 4A0XA 4M9XA 1F9NA 1SD5A 2XGXA 2A5YB 3T8TA 1BI0A 3JAMZ 2DBBA 1MDMA 5E1XA 2QVOA 4A5NA 3DP7A 2J5OA 5E1WA 3J80K 5ICEA 1K7AA 2HGCA 2EK5A 1FC3A 1STZA 5AIQA 3SZPA 2R3SA 1HW1A 3ISPA 3R61A 1XGOA 1GHCA 5L3CA 1B9MA 5AONA 2YPRA 1S6LA 2VN2A 3GW2A 3TOAA 4R79A 3I71A 1HW5A 1XGNA 4BNCA 2FNPA 3GFMA 2A68F 4FX0A 4BHBA 1B1BA 5K5QA 3MAJA 1USSA 2K7LA 3ABUA 2P5VA 1OYYA 2O03A 4G94A 3T0YA 4BHPA 2HTJA 3MZYA 4ESFA 4KIGA 1QO0D 3LA3A 2LDUA 2CQKA 3QP6A 3DV8A 3FM5A 4O6JA 4Y13A 1K78A 1FSEA 5DDGA 2VBXA 3BJAA 2PJPA 4CDGA 3B73A 3BJOA 3QOPA 3V7CA 3I0TA 1ZG3A 3BY6A 1KU7A 3V8LA 3K2ZA 4M6XA 3LA2A 1O3TA 1R23A 2K4JA 1Z6RA 2LF7A 1HBXG 4L9VA 3I4PA 3S2WA 5ICCA 1U5TA 1X3UA 2MH2A 5IT3A 1DPUA 5BPDA 4M71A 3MCZA 4I2OA 3QPTA 1IZ1A 2W57A 5BMZA 1ZLKA 3I59A 3BZ6A 5ED4A 4CGZA 2OA4A 3F8BA 4I01A 4KA4A 1JHHA 3BPXA 2HYGD 2FMLA 5D4RA 4UV8A 1QGPA 2PMUA 3ZPLA 4LLNA 1FOKA 3QPHA 1IXCA 2BEOA 4U0VA 2L4AA 2IT0A 1YW9A 1J0RA 3IC7A 4KIBA 4KN4X 1LJ9A 2KRFA 4A6EA 4WK8F 1TNSA 2H6CA 2WC2A 3GEZA 2ISZA 4G9YA 3E5UA 3FWEA 5CVJA 2QQBA 5IT9Z 2NNNA 3V8JA 5DCMB 1HKSA 2MD5A 2P5LC 2KIFA 5BPIA 2NNYA 3WTUC 2DPUA 2PMHA 3FXQA 2KKOA 1ZRCA 4LMYA 2H94A 5KVRA 3EYYA 2VODA 2IA2A 4OINF 4HYEA 2M8EA 4UVAA 1ZLJA 5L3BA 1QZYA 3TOBA 1J5YA 3JW4A 1R1UA 3M9AA 1W7PB 2VC1A 3IRRA 3F8FA 1MDMB 1B4AA 2FRHA 1RUOA 4HA8A 1ZARA 1Z91A 2XASA 3ULQB 1P6RA 4YIFA 1W7PD 2EV5A 3WE3A 2QZ8A 3WU0A 4NHJA 4LLGF 1TQMA 4PDKA 4KMFA 4P9UA 1BC7C 4OOIA 5ERIA 2CSOA 5E8IA 3ML6A 2Q8KA 4GGGA 2V79A 2MBFA 3QU6A 3L09A 6PAXA 2HOEA 1YG2A 4N9HA 1ZRDA 4YFXF 4OU0A 5L3DA 3LAPA 4A12A 3WG9A 1R1VA 1IF1A 4XLNF 3KCCA 4L5JA 3GWZA 4CHUA 3BDDA 3ZMTA 4L0YB 1TTYA 4EVIA 3LWFA 1T6SA 3HTUA 5D5WB 5F64A 4WXHA 5CVRA 1AOYA 4PZJA 1IN8A 2W84A 1IUYA 4I0BA 1R5GA 3IRQA 1F5TA 3J81K 5LGUA 3MEXA 4AVPA 1FP1D 1FNNA 2DFIA 3P9IA 3HYIA 1O3QA 1XGSA 4ZYGA 3CUQB 2FQ3A 2FBIA 2O3FA 2HWVA 3ROUA 1FSHA 1K79A 3WTZA 3WTYC 4IHSA 1PP7U 1GXQA 3EQLF 4XLPF 2FBHA 3EYIA 2ZNZA 2F5FA 2OBPA 1G3TA 4EGYA 1FYMA 4A6DA 3ZMZA 4HX7A 3GYHX 1D8JA 4XBFA 5DD8A 1HKTA 2W85A 4KFCA 3DKWA 4LD5A 1BI3A 2QENA 4MTEA 4IRIA 2DPDA 3KP3A 2L3DA 1V3FA 3DPLC 4Q47A 2ESHA 4CICA 2FMYA 5EEHA 2ZMEB 2XAGA 2P4WA 4GO1A 2OU2A 3VB2A 1FBQA 3K1PA 1S7OA 3C7JA 1ONVA 5CYVA 1LVAA 1XGMA 3PQJA 1JE8A 4LFUA 5TRDA 3E97A 5ILVA 3CTAA 2XAQA 3G73A 1LDDA 4ZZDA 4PCQA 1G3WA 5A2QK 3IL2A 1USTA 3HOSA 1FPQA 3HHHA 4ASNA 4ZZLA 3D5LA 3HSEA 1WI9A 3F22A 1JGSA 5L3GA 4IXAA 2H09A 1W5TA 1SD4A 1V4RA 4Y15A 3U1DA 3KZZA 3FXUA 5HOOA 4EJUA 1LEBA 1B9NA 1ZH5A 5FLXK 4EV0A 4GCVA 1XSXA 2YSRA 1WRJA 2BE5F 1RZ4A 3F6VA 3NEUA 1WSUA 2D1HA 4MTDA 1BJAA 4L9NA 4HAMA 3HUGA 2QBYB 3CUQA 2ZNYA 2Z33A 1WKMA 2M30A 5BOXA 2G9WA 4L9JA 4EM1A 1P4XA 4ZYEA 4LK1F 1TW3A 2IP2A 3JSOA 3RKWA 1PUEE 2K86A 2EB7A 5D6EA 2MA3A 3LSTA 4M6YA 4YFKF 3WTTC 2M87A 2RGVA 3DFGA 2RNJA 2RVCA 1O3SA 2FSWA 3GX4X 4G7ZF 3KP2A 3ZN0A 3LQRA 2EFPA 4R1HA 1W4MA 2YR2A 1UB9A 2E1NA 2VOPA 1XDUA 1FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3J A;  3HHG A;  1ON2 A;  1R58 A;  2F5C A;  1OYI A;  3LQQ A;  2G7H A;  2O0Y A;  3BRO A;  4O3M A;  2A69 F;  1O7F A;  4G7H F;  2WWY A;  3Q9V A;  1H9T A;  3P9C A;  4EJO A;  4ETS A;  2VT3 A;  4MGR A;  3O6B B;  3VOD A;  5D5V B;  1FYL A;  1T38 A;  4GYG A;  2HDC A;  3TO9 A;  2JRT A;  2ELH A;  3M8F A;  3GFJ A;  3I64 A;  2FBK A;  2F5E A;  2FOK A;  5TJJ A;  5F6F A;  3T1B A;  1U6G A;  1Z9C A;  3DQV C;  4M72 A;  1AWC A;  1DUX C;  2LNB A;  4UV9 A;  3CDH A;  4MQ9 F;  1Z1D A;  2XIG A;  2Q0O A;  2V9V A;  1R5H A;  5ICG A;  4XRF A;  4OIR F;  4YFN F;  3RKX A;  2DU9 A;  1SFX A;  4H0E A;  5J8C A;  1LQ1 A;  4LG0 B;  5H20 A;  1KGS A;  3H3Z A;  3JTH A;  1TW2 A;  4LB5 A;  1YIO A;  2GXG A;  4LK0 F;  3SXY A;  2HFH A;  2LKP A;  5FO5 A;  2MLK A;  4KIC A;  4OIO F;  4MNU A;  2PI0 A;  1EH6 A;  1S29 A;  2OQG A;  4UNO A;  3L9F A;  2VE9 A;  1MJA A;  4HLX A;  1BBY A;  1SD7 A;  4M9Z A;  4L5I A;  2GZW A;  4A5M A;  1JXS A;  1KYW A;  3PFI A;  4EMS A;  1R36 A;  2JTV A;  1MJ9 A;  3KE2 A;  2RQP A;  1IN5 A;  3IWF A;  2H6B A;  2ISY A;  5D8L B;  3I54 A;  2XHK A;  4U7D A;  2XKO A;  1NHA A;  4EM0 B;  5HDK A;  1G4D A;  4G7O F;  1YYV A;  1XCV A;  2P8T A;  2F2E A;  2P7V B;  3F21 A;  3SHF A;  1KU9 A;  1XN7 A;  4DNC A;  2IJL A;  2Z99 A;  3BPV A;  1U3E M;  4HOB A;  5ICF A;  2OD5 A;  3TO6 A;  3T8R A;  2P5K A;  3R60 A;  1XCB A;  3FMQ A;  1W7P A;  3R0A A;  1RIO H;  5EEG A;  2XKP A;  5DV5 A;  2DT5 A;  4HW0 A;  3R4K A;  1XSV A;  3GZ6 A;  1QQI A;  2IW5 A;  3L00 A;  2DI3 A;  2V1D A;  1H9G A;  4M9S A;  3IWZ A;  3RKY A;  4IRH A;  2PEX A;  4M74 A;  3W6J B;  1U5T B;  2DQR A;  4I7H A;  2IVM A;  2GWR A;  4ENM A;  2STT A;  1YW8 A;  2C6Y A;  2GA1 A;  3OOP A;  3EET A;  5JFR A;  1Z7U A;  1J75 A;  2VC0 A;  3F23 A;  5LEJ A;  3HTS B;  2NS0 A;  3Q9S A;  3N97 A;  1IW7 F;  3ZMV A;  4LLL A;  4MEX F;  3GFI A;  4ZH4 F;  4B8X A;  1HKQ A;  2GAU A;  4OIP F;  2CYY A;  1OMI A;  3KP5 A;  1YQA A;  4BQA A;  2LF8 A;  1IAW A;  1I5Z A;  2JPC A;  2W24 A;  3B02 A;  5FGM A;  5FD5 A;  2QWW A;  1IN6 A;  2A61 A;  4HDU A;  4ENJ A;  3R0J A;  2VE8 A;  3QAH A;  1RUN A;  5CVV A;  4OIQ F;  3E5X A;  5FFX A;  3TGN A;  1REP C;  1KQ0 A;  4KYW A;  4EM2 A;  4A2U A;  4D0P A;  3T5X A;  3GVA A;  2E7X A;  3PQK A;  3QRF F;  2WTE A;  1FLI A;  2W25 A;  3FZV A;  1KU3 A;  1O57 A;  3V4G A;  3EUH A;  1GVJ A;  5HLG A;  3VOE A;  4RGU A;  1XSD A;  4L0Z B;  1ZHF A;  4RB1 A;  4EJW A;  4OMZ A;  4RB2 C;  3ECH A;  5HS9 A;  1R22 A;  1RNL A;  3GFL A;  1G6N A;  3N4M A;  4UUV A;  1FX7 A;  2BV6 A;  2JSC A;  4HZF A;  4UXN A;  2HKX A;  1QBJ A;  2FEZ A;  4TV7 A;  1BI1 A;  3LAJ A;  4E70 A;  2FE3 A;  4HBL A;  5E8G A;  1ZRE A;  2X4H A;  5K5R A;  3ABT A;  2IA0 A;  4I0A A;  1ODD A;  1K6O A;  1S7A A;  3HRT A;  2L54 A;  4IHT A;  3K0L A;  3GUD A;  5L3F A;  3V7S A;  3RTR A;  2VXZ A;  1SD6 A;  2CWE A;  3I59 B;  3KLN A;  2PG4 A;  3SZT A;  1BM9 A;  2XAH A;  1I27 A;  2VBW A;  2OZ6 A;  2X0L A;  4HX4 A;  2EV6 A;  2HQR A;  2EFN A;  1BI2 A;  3H92 A;  3HSR A;  2EFO A;  2RKH A;  4MHG A;  5FLX Z;  4ENN A;  5DUK A;  1UCR A;  1LDK B;  2MLG A;  4Q4Z F;  1YLF A;  2EFQ A;  1PDN C;  3IKV A;  1SMY F;  3ZMU A;  5FFZ A;  3RPQ A;  3RJP A;  1CF7 B;  2M1B A;  3KEQ A;  1KYZ A;  1E17 A;  4GYI A;  4U0W A;  2QYO A;  3DPT A;  2HZT A;  2OQR A;  2XRN A;  4Q5S F;  2CG4 A;  1BN5 A;  1OR7 A;  1MJB A;  4HDV A;  3GF2 A;  1EV7 A;  3TO7 A;  4KMU X;  5JR3 A;  4I02 A;  4RB3 C;  3W6K B;  3J81 Z;  3BJ6 A;  2KIM A;  3DF8 A;  1C0W A;  2ZBK A;  5E17 F;  1VTN C;  1IN7 A;  4K2E A;  1YFH A;  1XD7 A;  4ESJ A;  4KNY A;  1ON1 A;  2V6C A;  2UWM A;  1QPM A;  5D5U B;  1LNW A;  5DUI A;  4P5O A;  3VEP A;  4DQ2 A;  1HW2 A;  1EH8 A;  3K1N A;  3ZMD A;  2COM A;  3MFK A;  1U8R A;  3D0S A;  2PN6 A;  5A2Q Z;  4UHT A;  1P4W A;  3L7W A;  1TNT A;  3U2R A;  3ZN1 A;  3RI4 A;  4I98 B;  2CO5 A;  2DK5 A;  3EDP A;  5BS6 A;  2IRF G;  1IXR C;  2OAZ A;  1G3S A;  4AIJ A;  5DEQ A;  2CW0 F;  5JHU A;  1K78 B;  2NRA C;  2DK8 A;  5LRR A;  1QZZ A;  1L0O C;  1OKR A;  3RIR A;  1BC8 C;  1SAX A;  1J2X A;  1D8K A;  4KDP A;  2HYF A;  1B59 A;  1L3L A;  2PQ8 A;  1YS7 A;  3SFZ A;  5FB2 A;  4Z2Y A;  1ZAO A;  1XB4 A;  1TBX A;  5D5X B;  5LGT A;  3K9T A;  1XMA A;  1WQ2 A;  4CYD A;  4F7Z A;  3F6O A;  5J6X A;  1ZRF A;  1KQ9 A;  3WGI A;  2ESN A;  1Z05 A;  4IF4 A;  1KA8 A;  3O2P E;  2GXB A;  4KT5 C;  2XAF A;  2A3S A;  2IPQ X;  5AIP A;  2ZKZ A;  3E6D A;  2ZME A;  4WF2 A;  5CLS A;  2EFW A;  3C18 A;  2QM3 A;  2A6H F;  2HKO A;  1HQC A;  2O6G E;  2UZK A;  5LHI A;  2XRO A;  2QQA A;  5JI6 A;  2Z9O A;  4O5V A;  1J9I A;  3F8N A;  4RAY A;  2E1C A;  3C3W A;  3Q5F A;  3FMS A;  5K1Y A;  3MQ0 A;  4RGS A;  4EJV A;  2B0L A;  3RDI A;  4LB6 B;  3CO7 C;  1Y0U A;  5HS8 A;  2FA5 A;  1B6A A;  3REO A;  2HS5 A;  1WWX A;  1Q1H A;  4HLY A;  1HSJ A;  2K27 A;  1I6X A;  4JK1 X;  4GXO A;  3KP7 A;  4FHT A;  4HQE A;  2ADU A;  3SQN A;  2L01 A;  2ZO4 A;  1FP2 A;  4P9F A;  4HF0 A;  5DCM A;  4L9T A;  3WGH A;  5HVQ C;  3K69 A;  4ZYD A;  1I1S A;  3QU3 A;  4ESB A;  2FU4 A;  3C1D A;  1YO5 C;  5DCF A;  2AS5 F;  1W5S A;  3ERE D;  2MC3 A;  5E20 A;  4S04 A;  4CZZ A;  5CVI A;  4QLC U;  2RV8 A;  2KJB A;  2A07 F;  2YU3 A;  3FX3 A;  4CXF A;  1FBU A;  1ZG1 A;  3F8M A;  1MD0 A;  4G6Q A;  5LRS A;  4BAY A;  2A6E F;  4Q48 A;  4QWQ A;  5DYM A;  1U5T C;  1YS6 A;  3WOD F;  1TQP A;  1ZGA A;  2DLL A;  3HSF A;  3DXJ F;  4LJZ F;  5FD6 A;  4RS8 A;  3U9G A;  1ZN2 A;  1IN4 A;  2Z5U A;  1J59 A;  2DAO A;  4IPA A;  4L18 B;  2QBY A;  1LB2 A;  1ZYR F;  4U0Y A;  1HST A;  2M5W A;  1D5V A;  4U88 A;  3HIF A;  1I1G A;  4KIF A;  3FM3 A;  5D8K B;  4EJT A;  1BOA A;  2JZY A;  4XSX F;  2TDX A;  1T98 A;  5D6F A;  4YII A;  5F1R A;  2Y0M A;  5LHG A;  2FF4 A;  4NB5 A;  4KN7 X;  2Z3Y A;  1G3Y A;  3ELK A;  2GIV A;  5HLH A;  3F8C A;  1YW7 A;  4B09 A;  4UVC A;  3M7G A;  2CGP A;  4A0Z A;  1U78 A;  5HLI A;  4YG2 F;  2R7D A;  2UXN A;  4LG0 A;  2EWN A;  2ZJ2 A;  4LGW A;  5ILU A;  3WTS C;  4G8X A;  3FHZ A;  3I5U A;  2EA4 A;  4G6D A;  3VFZ A;  4Y17 A;  3LA7 A;  3ZQ7 A;  3L2C A;  4A0Y A;  3V8K A;  2ACJ A;  1FZP B;  4RB0 A;  4AIK A;  1OPC A;  3WE2 A;  1MZB A;  2K02 A;  4S05 A;  3DEU A;  1T39 A;  2Y75 A;  5LEK A;  2YX4 A;  1A04 A;  2XVC A;  2ZXJ A;  3GZ5 A;  5HDG A;  4AIH A;  2P6S A;  2EV0 A;  3F72 A;  3FMR A;  3CUQ C;  4XSZ F;  2XV4 S;  3LFK A;  1XMK A;  2UXX A;  3RYR A;  4FX4 A;  3COA C;  1P92 A;  5E18 F;  3FXR A;  1SMT A;  3AAF A;  3M8E A;  2D2W A;  1FT9 A;  3I58 A;  4WCG A;  2G7U A;  2L02 A;  2XUB A;  2AXL A;  3IKT A;  2BBY A;  3GO5 A;  2GQQ A;  1EH7 A;  1PP8 F;  2OZU A;  1IRG A;  3G3Z A;  3F3X A;  4ZYH A;  4OMY A;  2GA2 A;  2VBZ A;  2QLZ A;  2RN7 A;  1UHW A;  2Y48 A;  1P2F A;  1J7K A;  1P4A A;  2L4M A;  3BWG A;  1DP7 P;  2BYV E;  3M1E A;  4PGG A;  2K4B A;  1QNT A;  3TDZ C;  1FBS A;  3KEO A;  2HTS A;  1SFU A;  2VOO A;  1YTY A;  4RGX A;  1LEA A;  1R1T A;  4WXD A;  1HXD A;  4RGR A;  1R7J A;  4MQV A;  5LLQ A;  5ILS A;  1T0F A;  2HR3 A;  1R00 A;  3KP6 A;  4RAZ A;  5H6Q A;  1F1Z A;  3RYP A;  5IT9 K;  1ZG5 A;  1E2X A;  2VBY A;  3J7A O;  3JAM K;  1CGP A;  1DPR A;  3HOT A;  2O8X A;  3JTG A;  3GXO A;  2WV0 A;  1BIA A;  5K5O A;  4UVB A;  4IRG A;  3P7N A;  3E6B A;  3CLO A;  4P96 A;  5CVU A;  4BH9 A;  3RPU A;  5BQT A;  2IA1 A;  3KET A;  3BOQ A;  3ZMS A;  2DQL A;  4BXU A;  1FWZ A;  2ZCW A;  2DTR A;  4N0B A;  3ECO A;  2EJR A;  2VON A;  3NRV A;  3WGG A;  1LDJ A;  2STW A;  2PFB A;  5LHH A;  3E5Q A;  3ZP5 A;  1IRF A;  1ZGJ A;  2Q2E A;  3R6S A;  3KP4 A;  1H0M A;  3KLO A;  4EQQ A;  3K1M A;  3NQO A;  2JT1 A;  3TQN A;  2NYX A;  1OYW A;  2MH9 A;  1Z6T A;  3WU1 B;  3CJN A;  4JQF A;  3I53 A;  3HRM A;  4BHC A;  1DDN A;  2QQ9 A;  4HV5 A;  4CO8 A;  2P7C B;  4MEY F;  5KK1 A;  1T2K A;  3E6C C;  3IHU A;  4M73 A;  4I09 A;  4EGZ A;  3FF5 A;  3E6M A;  3MWM A;  3GLX A;  1TLH B;  5D4S A;  2FNA A;  2V1U A;  4HQM A;  4BYY A;  2DW4 A;  2D1V A;  3O3K A;  3MZH A;  2BGC A;  2RDP A;  2QUF A;  3CUO A;  1KQ8 A;  2NAZ A;  1JHF A;  4HF1 A;  2R7F A;  2DO7 A;  4P55 A;  3BP8 A;  1FYK A;  5JVT A;  3WTW C;  4WX9 A;  2V1X A;  1O3R A;  4KUM A;  2F5D A;  5DD4 A;  2JPB A;  3H3U A;  1IXS B;  2YX7 A;  4NQW A;  2O61 A;  1S8N A;  2ZFW A;  4HF2 A;  5HDN A;  3QP5 A;  2HQN A;  2M45 A;  3HRU A;  4IVN A;  5H6R A;  2HEO A;  1RI7 A;  4WXC A;  2RC4 A;  2EA2 A;  2PBI A;  2VT2 A;  4JBA A;  1F4K A;  2H27 A;  5E1Z B;  1O7L A;  1CF7 A;  1MGT A;  3OV8 A;  3WTX C;  4FT8 A;  3WTV C;  3KZY A;  3TKY A;  2KJC A;  3CO6 C;  2CFX A;  2LSO A;  5J8F A;  4R8H A;  1XDS A;  2KIU A;  2PLY A;  4HX8 A;  4AWX B;  1D3Y A;  5L3E A;  2E7W A;  5CJ9 A;  1ULY A;  2XAJ A;  4N9I A;  4ON0 A;  1TQI A;  2J5P A;  1GXP A;  1SFE A;  1UFM A;  4HV6 A;  2ETH A;  1UHM A;  3V7R A;  5LGN A;  3JSP A;  1U2W A;  3P9K A;  2P6T A;  4IJA A;  4U7B A;  1KU2 A;  3J80 Z;  5HS7 A;  3TDU C;  3HRS A;  2FXA A;  4WWC A;  4AD9 A;  2D45 A;  3E3V A;  1BIB A;  4ENK A;  5LBQ A;  1MKM A;  3KFW X;  4PGH A;  4A0X A;  4M9X A;  1F9N A;  1SD5 A;  2XGX A;  2A5Y B;  3T8T A;  1BI0 A;  3JAM Z;  2DBB A;  1MDM A;  5E1X A;  2QVO A;  4A5N A;  3DP7 A;  2J5O A;  5E1W A;  3J80 K;  5ICE A;  1K7A A;  2HGC A;  2EK5 A;  1FC3 A;  1STZ A;  5AIQ A;  3SZP A;  2R3S A;  1HW1 A;  3ISP A;  3R61 A;  1XGO A;  1GHC A;  5L3C A;  1B9M A;  5AON A;  2YPR A;  1S6L A;  2VN2 A;  3GW2 A;  3TOA A;  4R79 A;  3I71 A;  1HW5 A;  1XGN A;  4BNC A;  2FNP A;  3GFM A;  2A68 F;  4FX0 A;  4BHB A;  1B1B A;  5K5Q A;  3MAJ A;  1USS A;  2K7L A;  3ABU A;  2P5V A;  1OYY A;  2O03 A;  4G94 A;  3T0Y A;  4BHP A;  2HTJ A;  3MZY A;  4ESF A;  4KIG A;  1QO0 D;  3LA3 A;  2LDU A;  2CQK A;  3QP6 A;  3DV8 A;  3FM5 A;  4O6J A;  4Y13 A;  1K78 A;  1FSE A;  5DDG A;  2VBX A;  3BJA A;  2PJP A;  4CDG A;  3B73 A;  3BJO A;  3QOP A;  3V7C A;  3I0T A;  1ZG3 A;  3BY6 A;  1KU7 A;  3V8L A;  3K2Z A;  4M6X A;  3LA2 A;  1O3T A;  1R23 A;  2K4J A;  1Z6R A;  2LF7 A;  1HBX G;  4L9V A;  3I4P A;  3S2W A;  5ICC A;  1U5T A;  1X3U A;  2MH2 A;  5IT3 A;  1DPU A;  5BPD A;  4M71 A;  3MCZ A;  4I2O A;  3QPT A;  1IZ1 A;  2W57 A;  5BMZ A;  1ZLK A;  3I59 A;  3BZ6 A;  5ED4 A;  4CGZ A;  2OA4 A;  3F8B A;  4I01 A;  4KA4 A;  1JHH A;  3BPX A;  2HYG D;  2FML A;  5D4R A;  4UV8 A;  1QGP A;  2PMU A;  3ZPL A;  4LLN A;  1FOK A;  3QPH A;  1IXC A;  2BEO A;  4U0V A;  2L4A A;  2IT0 A;  1YW9 A;  1J0R A;  3IC7 A;  4KIB A;  4KN4 X;  1LJ9 A;  2KRF A;  4A6E A;  4WK8 F;  1TNS A;  2H6C A;  2WC2 A;  3GEZ A;  2ISZ A;  4G9Y A;  3E5U A;  3FWE A;  5CVJ A;  2QQB A;  5IT9 Z;  2NNN A;  3V8J A;  5DCM B;  1HKS A;  2MD5 A;  2P5L C;  2KIF A;  5BPI A;  2NNY A;  3WTU C;  2DPU A;  2PMH A;  3FXQ A;  2KKO A;  1ZRC A;  4LMY A;  2H94 A;  5KVR A;  3EYY A;  2VOD A;  2IA2 A;  4OIN F;  4HYE A;  2M8E A;  4UVA A;  1ZLJ A;  5L3B A;  1QZY A;  3TOB A;  1J5Y A;  3JW4 A;  1R1U A;  3M9A A;  1W7P B;  2VC1 A;  3IRR A;  3F8F A;  1MDM B;  1B4A A;  2FRH A;  1RUO A;  4HA8 A;  1ZAR A;  1Z91 A;  2XAS A;  3ULQ B;  1P6R A;  4YIF A;  1W7P D;  2EV5 A;  3WE3 A;  2QZ8 A;  3WU0 A;  4NHJ A;  4LLG F;  1TQM A;  4PDK A;  4KMF A;  4P9U A;  1BC7 C;  4OOI A;  5ERI A;  2CSO A;  5E8I A;  3ML6 A;  2Q8K A;  4GGG A;  2V79 A;  2MBF A;  3QU6 A;  3L09 A;  6PAX A;  2HOE A;  1YG2 A;  4N9H A;  1ZRD A;  4YFX F;  4OU0 A;  5L3D A;  3LAP A;  4A12 A;  3WG9 A;  1R1V A;  1IF1 A;  4XLN F;  3KCC A;  4L5J A;  3GWZ A;  4CHU A;  3BDD A;  3ZMT A;  4L0Y B;  1TTY A;  4EVI A;  3LWF A;  1T6S A;  3HTU A;  5D5W B;  5F64 A;  4WXH A;  5CVR A;  1AOY A;  4PZJ A;  1IN8 A;  2W84 A;  1IUY A;  4I0B A;  1R5G A;  3IRQ A;  1F5T A;  3J81 K;  5LGU A;  3MEX A;  4AVP A;  1FP1 D;  1FNN A;  2DFI A;  3P9I A;  3HYI A;  1O3Q A;  1XGS A;  4ZYG A;  3CUQ B;  2FQ3 A;  2FBI A;  2O3F A;  2HWV A;  3ROU A;  1FSH A;  1K79 A;  3WTZ A;  3WTY C;  4IHS A;  1PP7 U;  1GXQ A;  3EQL F;  4XLP F;  2FBH A;  3EYI A;  2ZNZ A;  2F5F A;  2OBP A;  1G3T A;  4EGY A;  1FYM A;  4A6D A;  3ZMZ A;  4HX7 A;  3GYH X;  1D8J A;  4XBF A;  5DD8 A;  1HKT A;  2W85 A;  4KFC A;  3DKW A;  4LD5 A;  1BI3 A;  2QEN A;  4MTE A;  4IRI A;  2DPD A;  3KP3 A;  2L3D A;  1V3F A;  3DPL C;  4Q47 A;  2ESH A;  4CIC A;  2FMY A;  5EEH A;  2ZME B;  2XAG A;  2P4W A;  4GO1 A;  2OU2 A;  3VB2 A;  1FBQ A;  3K1P A;  1S7O A;  3C7J A;  1ONV A;  5CYV A;  1LVA A;  1XGM A;  3PQJ A;  1JE8 A;  4LFU A;  5TRD A;  3E97 A;  5ILV A;  3CTA A;  2XAQ A;  3G73 A;  1LDD A;  4ZZD A;  4PCQ A;  1G3W A;  5A2Q K;  3IL2 A;  1UST A;  3HOS A;  1FPQ A;  3HHH A;  4ASN A;  4ZZL A;  3D5L A;  3HSE A;  1WI9 A;  3F22 A;  1JGS A;  5L3G A;  4IXA A;  2H09 A;  1W5T A;  1SD4 A;  1V4R A;  4Y15 A;  3U1D A;  3KZZ A;  3FXU A;  5HOO A;  4EJU A;  1LEB A;  1B9N A;  1ZH5 A;  5FLX K;  4EV0 A;  4GCV A;  1XSX A;  2YSR A;  1WRJ A;  2BE5 F;  1RZ4 A;  3F6V A;  3NEU A;  1WSU A;  2D1H A;  4MTD A;  1BJA A;  4L9N A;  4HAM A;  3HUG A;  2QBY B;  3CUQ A;  2ZNY A;  2Z33 A;  1WKM A;  2M30 A;  5BOX A;  2G9W A;  4L9J A;  4EM1 A;  1P4X A;  4ZYE A;  4LK1 F;  1TW3 A;  2IP2 A;  3JSO A;  3RKW A;  1PUE E;  2K86 A;  2EB7 A;  5D6E A;  2MA3 A;  3LST A;  4M6Y A;  4YFK F;  3WTT C;  2M87 A;  2RGV A;  3DFG A;  2RNJ A;  2RVC A;  1O3S A;  2FSW A;  3GX4 X;  4G7Z F;  3KP2 A;  3ZN0 A;  3LQR A;  2EFP A;  4R1H A;  1W4M A;  2YR2 A;  1UB9 A;  2E1N A;  2VOP A;  1XDU A;  1FY7 A; 
#chains in the Genus database with same CATH topology
 3G71 I;  4XLF A;  1S3J A;  1YJ9 I;  1UEL B;  2ME6 A;  2LTP A;  2VPL A;  3HHG A;  1ON2 A;  1T56 A;  2E19 A;  5F0F A;  1XS9 A;  1R58 A;  2F5C A;  1OYI A;  4XKC A;  3LQQ A;  4C30 A;  1OCP A;  2G7H A;  2LYC A;  2O0Y A;  2Y0S A;  3BRO A;  4F93 B;  4YEL A;  1VQ7 I;  4O3M A;  2A69 F;  2L9R A;  1O7F A;  1BA5 A;  4RAF A;  3RZD J;  2DCE A;  4G7H F;  2WWY A;  3GTJ J;  2K3F A;  3E1S A;  3Q9V A;  1H9T A;  1QZE A;  4D1Q A;  1FTT A;  3P9C A;  4LIT A;  4EJO A;  4ETS A;  4E7J A;  1UAA A;  2VT3 A;  3K70 D;  2CV1 A;  4MGR A;  3RQI A;  4XKW A;  4BKX A;  3O6B B;  3VOD A;  5D5V B;  1FYL A;  1GT0 C;  1T38 A;  4GYG A;  2HDC A;  3TO9 A;  3K2A A;  3GTQ J;  4B4C A;  2JRT A;  2ELH A;  3M8F A;  1VFC A;  4DYR A;  3GFJ A;  3I64 A;  2FBK A;  2F5E A;  2EIJ H;  3BCA A;  1OJL A;  2FOK A;  2DJI A;  5TJJ A;  5F6F A;  3T1B A;  1BJZ A;  1U6G A;  1W5C C;  1Z9C A;  4A3J J;  3DQV C;  2JMW A;  1GV5 A;  1RRJ A;  4M72 A;  4UUS A;  2BW3 A;  1AWC A;  3MMY B;  1DUX C;  2LNB A;  4AU7 A;  4UV9 A;  2ELK A;  3CDH A;  3KZI C;  1JGG A;  4MQ9 F;  2NVU B;  1Z1D A;  2XIG A;  4ZC3 A;  4D5F A;  2Q0O A;  2V9V A;  1R5H A;  5ICG A;  2JJ7 A;  4XRF A;  2Y0S N;  2EBI A;  3CCU I;  4D7M A;  4DJA A;  3LSJ A;  4OIR F;  2QF7 A;  4YFN F;  3RKX A;  2DU9 A;  1SFX A;  4H0E A;  1SAN A;  2CJJ A;  1S72 I;  5J8C A;  1LQ1 A;  5B3S H;  1W0U A;  4LG0 B;  3G2B A;  4XN3 A;  4DOZ A;  5H20 A;  1KGS A;  3H3Z A;  3JTH A;  1GDT A;  4G6T B;  1TW2 A;  4LB5 A;  1YIO A;  2GXG A;  4CSW A;  1R71 A;  3DTE A;  4LK0 F;  3SXY A;  5DS9 A;  1RKT A;  2HFH A;  1ETY A;  3MKY B;  2LKP A;  1WHU A;  2MLK A;  5FO5 A;  4KIC A;  2JSP A;  4OIO F;  1A6Q A;  3GTO J;  2MFZ A;  4MNU A;  2WAQ N;  2PI0 A;  1EH6 A;  1S29 A;  2OQG A;  4AM3 A;  4UNO A;  3CCV I;  3L9F A;  2VE9 A;  1R4N B;  1MJA A;  4HLX A;  1BBY A;  3KYD B;  2JA6 J;  1SD7 A;  1M1E B;  4M9Z A;  4L5I A;  2GZW A;  3G1L A;  2CUJ A;  4A5M A;  1BW5 A;  1JXS A;  1KYW A;  3PFI A;  4EMS A;  3L1P A;  5M5W J;  1ZEL A;  2H8R A;  1R36 A;  2JTV A;  3SJM A;  3GZN B;  4A3I J;  1MJ9 A;  3KE2 A;  1X1P A;  3S93 A;  2IBD A;  2RQP A;  3ONQ A;  1IN5 A;  3IWF A;  2H6B A;  2ISY A;  2LRD A;  5D8L B;  4IQJ A;  3JR9 A;  3OL4 A;  4HEA 2;  4E7Z A;  5C44 J;  3PSI A;  3I54 A;  2XHK A;  1VQ9 I;  4U7D A;  2ECC A;  2XKO A;  3NAU A;  1NHA A;  4EM0 B;  5HDK A;  1G4D A;  4G7O F;  1YYV A;  2XSJ C;  3JRF A;  1XCV A;  1N77 A;  1N25 A;  3F9K A;  4AID A;  3RZO J;  5FRN A;  2P8T A;  3OIQ A;  2F2E A;  2HNH A;  2P7V B;  1TWH J;  4IO9 F;  1Z0X A;  2UUZ A;  3F21 A;  1VQ5 I;  2HDD A;  3SHF A;  1KU9 A;  4MO7 A;  1XN7 A;  3CQZ J;  2L0K A;  4DNC A;  2FD5 A;  2IJL A;  1Q1V A;  2ZFU A;  3HM5 A;  2Z99 A;  1A6I A;  3BPV A;  1U3E M;  4HOB A;  1UJ8 A;  1G59 A;  1QU3 A;  5ICF A;  4CCM A;  4C3I J;  2E35 A;  4LOC A;  2OD5 A;  3TO6 A;  1IC8 A;  1JTX A;  2BY2 A;  1NH3 A;  4NQW B;  2LY1 A;  2W82 A;  3T8R A;  1MMG A;  2P5K A;  3R60 A;  4ZDP A;  1XCB A;  3ERM A;  4C9Y A;  3FMQ A;  1W7P A;  3R0A A;  2DOA A;  4II3 A;  1V5E A;  1RIO H;  2LY2 A;  5EEG A;  2XKP A;  3BLY A;  5DV5 A;  4B3X A;  3J7A Y;  2DT5 A;  4HW0 A;  2KFD A;  4A3L J;  3R4K A;  1XSV A;  2MG4 A;  2OUM A;  1QQI A;  2IW5 A;  3L00 A;  3GZ6 A;  2DI3 A;  2V1D A;  2GXA A;  2F48 A;  1H9G A;  4M9S A;  3IWZ A;  3CC4 I;  2B63 J;  3RKY A;  3H3V K;  2KLO A;  3HL2 A;  4IRH A;  2DA6 A;  3HUG B;  2PEX A;  4M74 A;  3W6J B;  3W6V A;  1BL0 A;  2HVQ A;  1U5T B;  2DQR A;  1IJW C;  4I7H A;  2IVM A;  2GWR A;  5HLT A;  4MFD A;  4ENM A;  2STT A;  1YW8 A;  2C6Y A;  2GA1 A;  3OOP A;  4JP0 A;  1PYV A;  3DWL E;  1H89 C;  2R92 J;  4ITV A;  3EET A;  5JFR A;  2BW3 B;  1Z7U A;  1J75 A;  2VC0 A;  3F23 A;  5LEJ A;  2LRE A;  3HC7 A;  2NS0 A;  3HTS B;  3Q9S A;  3N97 A;  3K4B A;  4RLF A;  2V6E A;  1IW7 F;  3H5A A;  4LLL A;  3ZMV A;  4MEX F;  1PUF A;  3GFI A;  2HPI A;  1OFC X;  1H8A C;  4ZH4 F;  4B8X A;  1K83 J;  1EF4 A;  3BR1 A;  3IH2 A;  5C3E J;  1HKQ A;  2GAU A;  1YHQ I;  2NXN B;  4OIP F;  2CYY A;  1OMI A;  4F55 A;  4IHV A;  3PIP F;  3KP5 A;  1YQA A;  4BQA A;  1P9Q C;  2LF8 A;  1IAW A;  1LPQ A;  3FXL A;  1I5Z A;  2JPC A;  2VQG A;  3JRD A;  2WAE A;  2BHY A;  2W24 A;  3B02 A;  5FGM A;  4V19 K;  1WJF A;  5FD5 A;  5M5X J;  2QWW A;  1IN6 A;  2A61 A;  3W3C A;  4HDU A;  1WJB A;  2R7W A;  4ENJ A;  3R0J A;  2CQX A;  3RPU D;  2VE8 A;  3QAH A;  1Y1V J;  3DU5 A;  4CH7 A;  1RUN A;  5CVV A;  1HDP A;  5K7H A;  2WAF A;  4OIQ F;  4DBQ A;  1R4M B;  3E5X A;  5FFX A;  2COB A;  2JA7 J;  3TGN A;  1REP C;  2GOX B;  1KQ0 A;  4KYW A;  1SVM A;  4CYC A;  4C2T A;  4EM2 A;  1I39 A;  4A2U A;  4D0P A;  3T5X A;  3GVA A;  3ZQL A;  2E7X A;  4BU2 A;  3PQK A;  3QRF F;  2WTE A;  2GIZ A;  1YJW I;  1YE9 A;  1SFO J;  1FLI A;  2W25 A;  1P7I A;  3KEY A;  3VPR A;  3FZV A;  1KU3 A;  1O57 A;  3DBH B;  3V4G A;  3EUH A;  3H35 A;  1GVJ A;  2ID3 A;  5HLG A;  4Y52 J;  3VOE A;  2DA4 A;  4RGU A;  5GAD J;  1XSD A;  4L0Z B;  1ZHF A;  1ZR2 A;  3GTK J;  3K4L A;  3BQZ A;  4EJW A;  4RB1 A;  3OR1 C;  4OMZ A;  4RB2 C;  2ECB A;  3ECH A;  5HS9 A;  5M5Y J;  3LSI A;  1R22 A;  3GTG J;  1RNL A;  3GFL A;  1G6N A;  3A4C A;  3N4M A;  4UUV A;  2KZV A;  4F52 A;  3CCL I;  4NNJ A;  1FX7 A;  2BV6 A;  2JSC A;  2K9N A;  1JKO C;  4HZF A;  4A3D J;  4UB8 C;  1ETQ A;  1CQT A;  4UXN A;  3BTJ A;  2R7X A;  2HKX A;  1QBJ A;  2FEZ A;  2FUG 2;  1BI1 A;  2HZD A;  4TV7 A;  3ABK H;  3LAJ A;  3D1N I;  3D5R C;  4E70 A;  1MNE A;  2FE3 A;  4HBL A;  5E8G A;  4B3A A;  2X4H A;  1ZRE A;  3GME A;  3IH3 A;  5K5R A;  5IP7 J;  3ABT A;  2IA0 A;  2M4G A;  2NOG A;  4I0A A;  3WHC A;  1ODD A;  1K6O A;  1S7A A;  3HRT A;  2L54 A;  3J7Y J;  3FKJ A;  4IHT A;  3K0L A;  3L2W A;  3GUD A;  1MSF C;  4Y4R A;  2O8K A;  5L3F A;  3TMO A;  3RTR A;  3V7S A;  2X6O A;  1MBK A;  1JT0 A;  1N78 A;  3PJR A;  2VXZ A;  1SD6 A;  3PUF A;  5GPC A;  2VKE A;  3EUK L;  2CWE A;  4ANJ A;  2ICW G;  1ETW A;  3I59 B;  3KLN A;  2PG4 A;  3SZT A;  5J4Y A;  1BM9 A;  2P0W A;  2XAH A;  1I27 A;  2VBW A;  4PK4 A;  2XF5 A;  2OZ6 A;  2DFH A;  3O8G A;  3H9J A;  2X0L A;  4HX4 A;  3KYL A;  2E2J J;  2EV6 A;  2HQR A;  3CP2 A;  2E34 A;  2EFN A;  1BI2 A;  1D0Y A;  3H92 A;  4F92 B;  3HZJ A;  2R7S A;  3HSR A;  4EAT A;  5J40 A;  5J1U A;  2EFO A;  2RKH A;  2Q2E B;  4MHG A;  1MBH A;  3QWL A;  5FLX Z;  2WY7 Q;  1NG7 A;  4ENN A;  1JUP A;  4ZDL A;  3DKY A;  2R7U A;  3LSR A;  1IRX A;  5DUK A;  3HOV J;  1UCR A;  1LDK B;  2MLG A;  4Q4Z F;  4A3K J;  1YLF A;  1UZC A;  3NWS A;  2EFQ A;  1PDN C;  3IKV A;  3CJT B;  1SMY F;  2DOE A;  3ZMU A;  2LH9 A;  5FFZ A;  3RPQ A;  4BE0 A;  3RJP A;  2OJE D;  2CRG A;  3L2U A;  1CF7 B;  1X1A A;  2M1B A;  4B43 A;  3KEQ A;  4AVZ A;  1APL C;  5H2F C;  1KYZ A;  5KAI C;  1E17 A;  4B47 A;  1ENH A;  4GYI A;  4U0W A;  2QYO A;  5LD2 C;  2EZK A;  3DPT A;  2HZT A;  4HSR A;  2OQR A;  2XRN A;  4Q5S F;  4A3F J;  2CG4 A;  1PJR A;  1BN5 A;  3U1K A;  1W1W E;  2YS9 A;  1Z67 A;  2PMZ A;  1OR7 A;  4JYK A;  1MJB A;  5KHD A;  4HDV A;  3AG3 H;  1ZKG A;  3GF2 A;  1FTZ A;  4HST A;  4N4N B;  1EV7 A;  1XX5 A;  3KIO A;  2AO9 A;  5J1R A;  1QVT A;  3TO7 A;  2VIX A;  4KMU X;  5JR3 A;  4I02 A;  4RB3 C;  3W6K B;  2L9V A;  3J81 Z;  1YRN A;  2V9P A;  1RPW A;  2O5R A;  3CME I;  3BJ6 A;  2KIM A;  5GPA A;  2VJ5 A;  2CUF A;  3DF8 A;  1C0W A;  2ZBK A;  4BQQ A;  5E17 F;  3TBI A;  4X6A J;  1XMX A;  1VTN C;  4CA0 A;  2KT0 A;  1IN7 A;  4K2E A;  3L2R A;  1YFH A;  3S2H J;  1XD7 A;  4ESJ A;  4KNY A;  1W36 C;  1ON1 A;  3C2B A;  5GTI C;  2V6C A;  3W2W A;  2UWM A;  5KNL A;  2QEX I;  1ZQ3 P;  1QPM A;  2BOL A;  5D5U B;  1AHD P;  1LNW A;  5DUI A;  2OV7 A;  3OSG A;  4P5O A;  4E7L A;  2N8G A;  3VEP A;  3S3N A;  3OYC A;  4DQ2 A;  1HW2 A;  2K9L A;  4ZTF A;  1EH8 A;  3K1N A;  3ZMD A;  4DYC A;  4RBO A;  1K61 A;  2COM A;  3MFK A;  1U8R A;  3I4N J;  3D0S A;  1B8I B;  2PN6 A;  5A2Q Z;  3H36 A;  4UHT A;  4PSW A;  5C4J J;  3QYB A;  4I6Z A;  1P4W A;  3L7W A;  3I3L A;  1TNT A;  2K9Q A;  2L2O A;  2I10 A;  3U2R A;  4BY7 J;  1HOM A;  2QQ8 A;  3ZN1 A;  3LL7 A;  5KCM A;  1Z77 A;  1LFP A;  3RI4 A;  2BY0 A;  4I98 B;  2CO5 A;  2DK5 A;  2MD0 A;  4IHW A;  1WH5 A;  2X9D A;  4A3G J;  4HG2 A;  3EDP A;  1VQK I;  5BS6 A;  2IRF G;  1IXR C;  2X6W A;  2XRL A;  3QOD A;  2OAZ A;  1G3S A;  4AIJ A;  2A6T A;  5DEQ A;  1IG7 A;  2CW0 F;  5CPR B;  5E3L A;  5JHU A;  3AG2 H;  1K78 B;  2NRA C;  1SC7 A;  2DK8 A;  1X19 A;  4DBR A;  5LRR A;  1QZZ A;  3GLL A;  2E2I J;  1L0O C;  1OKR A;  2KHM A;  3RIR A;  1DQU A;  1BC8 C;  3VWB A;  1SAX A;  3IP4 B;  4H4K C;  4XNF A;  1J2X A;  1D8K A;  4KDP A;  2R5Z B;  4PJN A;  2DFE A;  4IHY A;  1PUF B;  2HYF A;  1B59 A;  3ASO H;  2X1D A;  1ETO A;  1L3L A;  2B7E A;  5B1B H;  2PQ8 A;  4JOM A;  1MW7 A;  4XK4 A;  1LE8 A;  1YS7 A;  1S9H A;  3SFZ A;  5FB2 A;  1TZL A;  4PJJ A;  4Z2Y A;  1ZAO A;  1XB4 A;  2LKX A;  1TBX A;  5D5X B;  5LGT A;  5EGO B;  3VSL A;  3K9T A;  1A36 A;  1XMA A;  1WQ2 A;  4CYD A;  4F7Z A;  5EYR A;  3F6O A;  3OYG A;  4J01 A;  5F0H A;  5J6X A;  1ZRF A;  3RQ4 A;  1KQ9 A;  1JTY A;  2VJI A;  1V54 H;  2ZXI A;  2WB1 A;  1IV8 A;  3WGI A;  2ESN A;  1Z05 A;  4IF4 A;  1KA8 A;  3O2P E;  2GXB A;  4KT5 C;  2PJR B;  2XAF A;  2IEK A;  2A3S A;  2IPQ X;  5AIP A;  3CCY A;  3HKZ A;  1WPK A;  2ZKZ A;  3WG7 H;  4XMY A;  3CLQ A;  3E6D A;  3A01 B;  2ZME A;  1XC5 A;  3BR3 A;  5J47 A;  4WF2 A;  5CLS A;  3I4M J;  2K40 A;  2EFW A;  3C18 A;  2R7V A;  2QM3 A;  2A6H F;  2HKO A;  1HQC A;  1IDY A;  2HQA A;  1YJN I;  2O6G E;  3Q0U A;  3G6E I;  2UZK A;  5LHI A;  4LIV A;  2DOD A;  2V7F A;  4XLA A;  1X1B A;  2XRO A;  2QQA A;  5JI6 A;  2HPM A;  2Z9O A;  2NVY J;  1YX3 A;  4O5V A;  1J9I A;  3F8N A;  2X1C A;  2HOA A;  2V9K A;  4RAY A;  1FMW A;  3C3W A;  3Q5F A;  2E1C A;  3FMS A;  3L2Q A;  3I56 I;  3CCJ I;  3GCM A;  5K1Y A;  3MQ0 A;  2KRH A;  3FIW A;  3V42 A;  2A5W A;  4CCJ A;  1LVK A;  2M7B A;  4RGS A;  3CCS I;  4YIR X;  4XKV A;  3S3M A;  4EJV A;  2B0L A;  3BR6 A;  5B66 C;  3HPG A;  3RDI A;  4PJ0 C;  2EQR A;  4LB6 B;  2KPM A;  3CO7 C;  1Y0U A;  1RKW A;  5HS8 A;  2FA5 A;  1B6A A;  3I9V 2;  3REO A;  3LSM A;  1MMS A;  2HS5 A;  1WWX A;  2DXI A;  1Q1H A;  2WBM A;  2NVQ J;  2GM4 A;  2IS4 A;  3QOE A;  3OS1 A;  4W97 A;  2XC7 A;  1W0T A;  2BXZ A;  4HLY A;  1HSJ A;  2K27 A;  4X0G A;  1I6X A;  4JK1 X;  3N05 A;  4GXO A;  1Y1W J;  3KP7 A;  4FHT A;  4YEJ A;  4HQE A;  2IAI A;  2ADU A;  4BJ6 C;  3SQN A;  3CJR B;  5KAF C;  1MH4 A;  2L01 A;  1WVR A;  5TIS C;  3SZG A;  2ZO4 A;  1QHG A;  2XF7 A;  1FP2 A;  4P9F A;  1FOY A;  1I3A A;  4HF0 A;  2V26 A;  2Q1Z B;  4L9T A;  5DCM A;  1GV2 A;  2AXT C;  4OAZ A;  3K4J A;  4BBR J;  1GUU A;  3WGH A;  4CYC B;  1MBG A;  5HVQ C;  2DA7 A;  2E1M B;  3K69 A;  4ZYD A;  1I1S A;  3DEW A;  3QU3 A;  4ESB A;  1VQ4 I;  2FU4 A;  4ZYA A;  3C1D A;  2NS7 A;  1YO5 C;  1R49 A;  5DCF A;  2AS5 F;  5CQG A;  1W5S A;  2JN6 A;  3ERE D;  2MC3 A;  5E20 A;  4S04 A;  3S15 J;  4CZZ A;  1MNM C;  1POG A;  2M8G X;  1KON A;  1WJD A;  3QQA A;  5CVI A;  3A01 A;  1Y56 A;  4DZJ A;  4XRS G;  4HNU A;  2E5Z A;  3ESW B;  4QLC U;  2RV8 A;  4HNV A;  2KJB A;  2A07 F;  4C3H J;  2YU3 A;  3FX3 A;  3WU2 C;  3GTL J;  1UMQ A;  4G12 A;  4CXF A;  1FBU A;  4XM3 A;  3X2Q H;  4ZTJ A;  1ZG1 A;  2LBF A;  5FRO A;  3F8M A;  1MD0 A;  5JHF A;  4QPO A;  4G6Q A;  4FET A;  2K85 A;  5LRS A;  4BAY A;  2A6E F;  4Q48 A;  3PM1 A;  4QWQ A;  4RMN A;  5DYM A;  1U5T C;  4J19 A;  3H0D A;  1YS6 A;  3WOD F;  1TQP A;  1ZGA A;  2DLL A;  3DKX A;  3HSF A;  3DXJ F;  4LJZ F;  2R7T A;  2ZC2 A;  5FD6 A;  4RS8 A;  3A03 A;  3U9G A;  1ZN2 A;  2JVH A;  1IN4 A;  2Z5U A;  1NTC A;  1J59 A;  2DAO A;  4IPA A;  3JRC A;  4AUX A;  1HLV A;  1LKX A;  2M9H A;  4L18 B;  2QBY A;  1LB2 A;  2Z2S B;  3OYK A;  1ZYR F;  4U0Y A;  1HST A;  2QSF X;  2DDA A;  2W7N A;  2M5W A;  1D5V A;  4U88 A;  3HIF A;  5FLV A;  1I1G A;  1TWA J;  4KIF A;  3BG5 A;  3FM3 A;  4PJL A;  1JKQ C;  5D8K B;  2LFB A;  4BJT A;  4EJT A;  1BOA A;  2JZY A;  4XSX F;  4KIS A;  2TDX A;  1T98 A;  3OR2 C;  4XOP A;  2XB0 X;  5D6F A;  1K4S A;  4YII A;  5F1R A;  4IKF A;  2Y0M A;  5LHG A;  1WZ2 A;  5M3M J;  2FF4 A;  3LSK A;  4NB5 A;  1ETX A;  2VB6 A;  4KN7 X;  2NS8 A;  4OWR B;  2Z3Y A;  4XON A;  1G3Y A;  1R9T J;  3ELK A;  2GIV A;  2NOJ B;  3BQY A;  5HLH A;  3F8C A;  1YW7 A;  4GRI A;  2K9S A;  3DTK A;  4B09 A;  1TC3 C;  3OOU A;  2YU9 J;  4UVC A;  3CCM I;  4BQO A;  1TWC J;  3M7G A;  1BR4 A;  4A0Z A;  2CGP A;  1U78 A;  5HLI A;  4XRM A;  4YG2 F;  2EIM H;  3S2D J;  3BR5 A;  2E5N A;  2R7D A;  3MKW B;  2UXN A;  4BEH A;  1VF9 A;  4LG0 A;  1MMA A;  2EWN A;  2ZJ2 A;  3SYT A;  2XSD C;  2X48 A;  4LGW A;  5ILU A;  3AG4 H;  2BVM A;  4BQN A;  2LKS A;  2L7F P;  1U0J A;  4NC8 A;  2ME0 A;  2L7M P;  2QKM B;  4G8X A;  3WTS C;  2KDZ A;  3G1M A;  1E0E A;  3FHZ A;  1ZR4 A;  3I5U A;  2EA4 A;  4G6D A;  3VFZ A;  4Y17 A;  3HGY A;  3LSH A;  3LA7 A;  3ZQ7 A;  3L2C A;  4A0Y A;  3V8K A;  2ACJ A;  1FZP B;  1BR2 A;  4RB0 A;  4RM3 A;  4AIK A;  1TT0 A;  1OPC A;  3TL4 X;  3WE2 A;  3OYJ A;  3EPZ A;  1MZB A;  2K02 A;  3J7Z I;  4S05 A;  3DEU A;  5JLW A;  2H1K A;  1T39 A;  2Y75 A;  5LEK A;  2YX4 A;  1A04 A;  2XVC A;  1ZK8 A;  2ZXJ A;  3H5N A;  3GZ5 A;  4BY1 J;  1FEX A;  5HDG A;  3E0J B;  2CV0 A;  3BR0 A;  4AIH A;  3S14 J;  1TT5 B;  3A0B C;  1I6H J;  2P6S A;  2EV0 A;  1FIP A;  3F72 A;  4A69 C;  1DU0 A;  4MFE A;  3K4M A;  2Y30 A;  2EPF A;  2JA2 A;  5IYD J;  1QRY A;  3FMR A;  3ASN H;  3OYD A;  3CUQ C;  4PUS A;  4XSZ F;  1IUF A;  2XV4 S;  3LFK A;  3M1C A;  4U87 A;  1XMK A;  1WJA A;  2UXX A;  1FOW A;  4L5E A;  1AA7 A;  3SDB A;  3RYR A;  3OYL A;  4FX4 A;  3COA C;  4BL0 B;  1P92 A;  4RA2 A;  4Z6Y A;  5E18 F;  3FXR A;  3BZC A;  1SMT A;  3AAF A;  3M8E A;  2D2W A;  3ABM H;  1FT9 A;  2CQN A;  3I58 A;  4WCG A;  5FLM J;  2Y31 A;  1Z7L A;  2G7U A;  2XUB A;  2L02 A;  3AL0 B;  2AXL A;  2DYR H;  1D1B A;  3IKT A;  3AG1 H;  2BBY A;  3GO5 A;  4E7S A;  2GQQ A;  1EH7 A;  1PP8 F;  3PNT A;  2OZU A;  1IRG A;  4XR6 A;  2ZSI B;  4CCK A;  1HDD C;  3A1Y A;  1I3Q J;  1LFU P;  3VYS B;  1T95 A;  3CJQ B;  3HKZ N;  3CC7 I;  4C3J J;  2M0M A;  3OYH A;  5M3F J;  3G3Z A;  3F3X A;  1OR7 C;  4I99 C;  1AKH B;  4ZYH A;  2VLA A;  2GA2 A;  4FE7 A;  2VBZ A;  4OMY A;  2QLZ A;  2RN7 A;  3EUA A;  1UHW A;  1SAU A;  4QPQ A;  4BAC A;  2Y48 A;  2HVR A;  1P2F A;  1Z3Y A;  1J7K A;  2HXO A;  5IYB J;  1P4A A;  2L4M A;  3BWG A;  4E7K A;  1VND A;  1HF0 A;  1DP7 P;  2BYV E;  3M1E A;  4PGG A;  2K4B A;  2KRC A;  3MKZ A;  2VQC A;  1UHS A;  1QNT A;  3TDZ C;  1FBS A;  3KEO A;  1X3Z B;  2DMN A;  2HTS A;  3MD2 A;  1SFU A;  2F4M B;  2R5Y A;  2VOO A;  1YTY A;  4RGX A;  2G0E A;  3PL8 A;  1OQY A;  3OYB A;  4A3E J;  1LEA A;  2HXI A;  4XID A;  1R1T A;  1JT6 A;  2K9M A;  4WXD A;  4RM2 A;  1VQM I;  3GBG A;  1HXD A;  2Y69 H;  4RGR A;  3S1Q J;  1R7J A;  4MQV A;  2XB5 A;  5LLQ A;  5ILS A;  4IHX A;  2XPV A;  2QSG X;  1T0F A;  3ZQC A;  2HR3 A;  1ORK A;  3FXM A;  1LUJ B;  1R00 A;  3CMM A;  3AFH A;  2ZXH A;  3DEE A;  1X2N A;  3KP6 A;  4CCO A;  4RAZ A;  5H6Q A;  1F1Z A;  3RYP A;  1PVE A;  3TED A;  5IT9 K;  1ZG5 A;  1VQ6 I;  2FX0 A;  2CW7 A;  2RAE A;  5FJ8 J;  2NVX J;  1E2X A;  2VBY A;  3J7A O;  3JAM K;  1CGP A;  4GDF A;  4F3Q A;  4UB6 C;  5GTH C;  5IPA A;  1DPR A;  4DZP A;  3HOT A;  2O8X A;  3JTG A;  4IX7 A;  2XGC A;  3GXO A;  2WV0 A;  5FRM A;  2IS6 A;  1BIA A;  3OIO A;  5K5O A;  4UVB A;  4HNT A;  3KPH A;  2VKV A;  4IRG A;  1X58 A;  2LLK A;  3OS0 A;  3P7N A;  3E6B A;  1K4T A;  2DTZ A;  1TWF J;  2E1O A;  3CLO A;  4P96 A;  5CVU A;  4BH9 A;  3RPU A;  3FHN A;  5DTD A;  5BQT A;  3HDD A;  2IA1 A;  1WH7 A;  3TP3 A;  3KET A;  1NK2 P;  2XPU A;  3BOQ A;  4PSX A;  3ZMS A;  3BT9 A;  1Y39 A;  5J1Y A;  1R6R A;  4ZJZ A;  2DQL A;  4B1R A;  4BXU A;  1FWZ A;  5IP6 A;  3CD6 I;  2ZCW A;  2R7Z J;  2DTR A;  4N0B A;  4B44 A;  3VYR B;  2JA5 J;  1YOV B;  3ECO A;  2EJR A;  1KZH A;  2XPW A;  2VON A;  3NRV A;  3WGG A;  1LDJ A;  2STW A;  4C2U A;  2PFB A;  1J09 A;  4DW6 A;  1SEU A;  4AYB N;  5LHH A;  3QYF A;  3E5Q A;  2LOO A;  1O4X A;  3ZP5 A;  2W48 A;  1Y6I A;  1AU7 A;  2R0Q C;  2EZL A;  5B5E C;  3S1N J;  3CCQ I;  1BW6 A;  2EIN H;  2KDO A;  1IRF A;  2ZSH B;  4XIC A;  1ZGJ A;  4M3F A;  2Q2E A;  1MBE A;  1EJ9 A;  3R6S A;  3KP4 A;  1G2H A;  1H0M A;  3LMM A;  1VI0 A;  3PUB A;  3KLO A;  4EQQ A;  3FK6 A;  3K1M A;  3NQO A;  2JT1 A;  3TQN A;  4DYQ A;  2NYX A;  1OCO H;  3CC2 I;  1OYW A;  2MH9 A;  2XAU A;  2R5Z A;  3FBN B;  1Z6T A;  3JCU C;  3WU1 B;  4M3G A;  2R5Y B;  3CJN A;  2FQ4 A;  4JQF A;  2QA4 I;  4IL6 C;  3I53 A;  3HRM A;  2CS3 A;  4BHC A;  2V4J C;  5K7F A;  1DDN A;  4UUS B;  2QQ9 A;  4HV5 A;  4CO8 A;  2P7C B;  4BDZ A;  3A2K A;  4MEY F;  5KK1 A;  2CH0 A;  1T2K A;  3DCF A;  3E6C C;  3IHU A;  3IUO A;  2BY3 A;  4M73 A;  1SVO A;  1WJC A;  4I09 A;  4EGZ A;  3FF5 A;  3E6M A;  3MWM A;  3GLX A;  2IGM A;  1TLH B;  5D4S A;  2FNA A;  5F27 A;  3OWT A;  2V1U A;  2XDV A;  4HQM A;  4II2 A;  4BYY A;  2DW4 A;  2D1V A;  3O3K A;  4A3C J;  2VXD A;  3MZH A;  2BGC A;  2RDP A;  2QUF A;  3BR2 A;  1AKH A;  3CUO A;  3TW7 A;  1X1C A;  3DBL B;  1KQ8 A;  2NAZ A;  1JHF A;  2EZI A;  3S8P A;  2JQ7 A;  3PFY A;  4HF1 A;  1HCR A;  1BR1 A;  2R7F A;  2DO7 A;  4P55 A;  3BP8 A;  1RR7 A;  1FYK A;  2XGE A;  5JVT A;  3WTW C;  4RDU A;  4WX9 A;  2TCT A;  2DYS H;  2V1X A;  1X1D A;  4NDL A;  1FJL A;  5IYC J;  1O3R A;  1A5J A;  3TW6 A;  2Z1D A;  4KUM A;  2F5D A;  4D5C A;  5DD4 A;  2JPB A;  5EDN A;  3H3U A;  1IXS B;  2YX7 A;  4NQW A;  2LBF B;  1JJ8 C;  1EA3 A;  2VKH A;  2O61 A;  3FXJ A;  1S8N A;  2MYS A;  3BTL A;  2CU7 A;  2ZFW A;  1S7E A;  4XOT A;  4HF2 A;  3O8H A;  2EZH A;  4QTR A;  3S16 J;  1TP4 A;  5HDN A;  2F5V A;  3QP5 A;  1ZTR A;  3D5S C;  2HQN A;  5FKK A;  1YRN B;  2HDW A;  2L9N A;  2M45 A;  3HRU A;  4FIS A;  4IVN A;  5H6R A;  1IDZ A;  2D5V A;  3BZK A;  3VYU B;  3CF2 A;  2HEO A;  3BG6 A;  2IXS A;  1RI7 A;  4WXC A;  2RC4 A;  2M4K A;  2EA2 A;  2PBI A;  2M3A A;  2VT2 A;  3LOC A;  4JBA A;  1DGW Y;  1F4K A;  2H27 A;  2GOM A;  3NAR A;  2LK2 A;  2JA8 J;  5E1Z B;  1O7L A;  1CF7 A;  1MGT A;  3OV8 A;  3WTX C;  2BZT A;  2E60 A;  3G4S I;  4FT8 A;  2L9S A;  3KZY A;  3WTV C;  4ZDO A;  3TKY A;  2KJC A;  3CO6 C;  3CCE I;  2CFX A;  2LSO A;  5J8F A;  4E7H A;  2BXY A;  4R8H A;  3HOU J;  1XDS A;  3HJE A;  2KIU A;  2PLY A;  1IO2 A;  2ZXW H;  3HG9 A;  4HX8 A;  4AWX B;  1D3Y A;  4C2M J;  2GBY A;  3PIO F;  1I50 J;  4ABZ A;  1E3H A;  2MSY A;  5L3E A;  4XN0 A;  2E7W A;  2X6X A;  5CJ9 A;  2F4I A;  1ULY A;  2XAJ A;  1JI8 A;  2B9S A;  4N9I A;  4BBS J;  1OCZ H;  4ON0 A;  3BG7 A;  1TQI A;  2J5P A;  4BEH B;  3HOW J;  2ZJQ F;  1GXP A;  1SFE A;  5LFA A;  2XF6 A;  3Q3S A;  3C2G A;  4FCY A;  3K4N A;  2ZJR F;  1UFM A;  1WFX A;  4YRV A;  2HVS A;  1WJE A;  4HV6 A;  4JX6 A;  2ETH A;  1UHM A;  3V7R A;  5GP9 A;  2IGO A;  2RQQ A;  1U2W A;  3ZR8 X;  5LGN A;  3JSP A;  3P9K A;  2VKD A;  2X1E A;  2P6T A;  5CKT A;  4IJA A;  1ERD A;  3VYT B;  4U7B A;  3ZQF A;  1KU2 A;  2X85 A;  2VJJ A;  4NBQ A;  3ZXS A;  3J80 Z;  2Y9Z A;  5HS7 A;  3DU6 A;  2M0C A;  3TDU C;  3HRS A;  2FXA A;  4I76 A;  1YIT I;  4WWC A;  4AD9 A;  2DA2 A;  1IV6 A;  2D45 A;  3E3V A;  1BIB A;  4ENK A;  3CDI A;  5LBQ A;  1MKM A;  2Y2Z A;  3KFW X;  1JUM A;  4PGH A;  4A0X A;  2DOF A;  4M9X A;  3S3O A;  1U8B A;  3CMY A;  1JUS A;  1SD5 A;  1F9N A;  2XGX A;  2A5Y B;  3MVP A;  3T8T A;  1H88 C;  1BI0 A;  3JAM Z;  2DBB A;  2DMP A;  1MDM A;  1QVU A;  1YX5 A;  1OIS A;  2VAS A;  5E1X A;  2VQH A;  2QVO A;  4FAS D;  4CCL A;  3HGG A;  4UUT A;  3E7L A;  4A5N A;  3DP7 A;  4M3E A;  2J5O A;  1VQO I;  5E1W A;  3J80 K;  5ICE A;  5HNF A;  1K7A A;  2HGC A;  2PJR A;  2EK5 A;  1SFK A;  5J3L A;  9ANT A;  1FC3 A;  4PFO A;  1STZ A;  5AIQ A;  1MMN A;  1RES A;  3SZP A;  3OYI A;  2R3S A;  1A35 A;  3CCR I;  4UY8 I;  2OCE A;  4BGD A;  1HW1 A;  3ABL H;  3ISP A;  4XLH A;  3R61 A;  1XGO A;  1GHC A;  3PNY A;  3K70 C;  5L3C A;  1B9M A;  3AKZ A;  1S5L C;  5AON A;  2YPR A;  1S6L A;  2VN2 A;  2R7Q A;  4V2G A;  3GW2 A;  2OCC H;  1V5G A;  2JUG A;  2V1N A;  3TOA A;  4R79 A;  3I71 A;  1HW5 A;  5FKN A;  1XGN A;  3JRE A;  2PMZ N;  1UG0 A;  5FKO A;  4BNC A;  2FNP A;  3GFM A;  3HOZ J;  2A68 F;  4FX0 A;  4BHB A;  1B1B A;  4S0H B;  3OL3 A;  5K5Q A;  3IAM 2;  3MAJ A;  1USS A;  2K7L A;  3RCO A;  3ABU A;  1VZ0 A;  2P5V A;  3VDX A;  1OYY A;  4LG3 A;  2O03 A;  2L5Q A;  2DMT A;  4G94 A;  1XPX A;  3T0Y A;  4BHP A;  2HTJ A;  5HNH A;  4J00 A;  2CUE A;  3MZY A;  2TRT A;  3JRH A;  1X2M A;  1A31 A;  4ESF A;  4KIG A;  1QO0 D;  3LA3 A;  1T0F C;  2LDU A;  4JX4 A;  2CQK A;  3QP6 A;  2K3P A;  3DV8 A;  3FM5 A;  3NWT A;  4O6J A;  4Y13 A;  2HI3 A;  1K78 A;  1FSE A;  2DT7 B;  5DDG A;  3LNQ A;  2VBX A;  3BJA A;  2PJP A;  4CDG A;  2O7O A;  5EJC A;  3B73 A;  3BJO A;  3QOP A;  3V7C A;  5IOY A;  3PO2 J;  1ETK A;  3A0H C;  2BY1 A;  3I0T A;  3LFU A;  1ZG3 A;  3BY6 A;  1BOB A;  2Y9Y A;  2BVL A;  4E4H A;  1KU7 A;  2W4S A;  3V8L A;  3WHB A;  2DJN A;  2HQ5 A;  3K2Z A;  2E1M C;  3OYN A;  4HPQ A;  5F08 A;  2UV1 A;  4EEF G;  1MSE C;  4M6X A;  3SFI A;  3LA2 A;  1X4O A;  3CMA I;  1O3T A;  1R23 A;  5BNG A;  2LC2 A;  2WAQ A;  2K4J A;  1MH3 A;  1Z6R A;  2LF7 A;  1HBX G;  4L9V A;  3I4P A;  3S2W A;  5ICC A;  2EIK H;  3HEF A;  5DM7 F;  4V2F A;  1ACI A;  1VQL I;  1V5F A;  1U5T A;  3F0C A;  1XTA A;  1X3U A;  2I5U A;  2MH2 A;  5IT3 A;  1JKR C;  2KQR A;  5C4X J;  5F04 A;  1B72 A;  2WV1 A;  4NC6 A;  5BPD A;  5IP9 J;  1DPU A;  2QGU A;  3FXO A;  4M71 A;  3B6A A;  2M2E A;  3MCZ A;  4I2O A;  1D5Y A;  4QSH A;  3QPT A;  1NG6 A;  3HOX J;  1IZ1 A;  2W57 A;  4E7I A;  5BMZ A;  1ZLK A;  3I59 A;  3BZ6 A;  4E6K G;  5ED4 A;  4CGZ A;  5B1A H;  3QPS A;  3BG9 A;  2OA4 A;  3L2V A;  3F8B A;  4I01 A;  2LP0 A;  4XRS A;  1JHH A;  4KA4 A;  2I8D A;  3DLL F;  2HOT A;  3ZOB A;  3BPX A;  2HYG D;  3OMY A;  3C2H A;  2FML A;  5D4R A;  4UV8 A;  2LVS A;  3ZQQ A;  1QGP A;  2PMU A;  4PFP A;  2CFO A;  2ZJP F;  1FOK A;  3ZPL A;  4LLN A;  3QPH A;  1IXC A;  5IOZ A;  3ZCO A;  2BEO A;  4U0V A;  1D1C A;  2L4A A;  4BE2 A;  4A93 J;  2IT0 A;  5HOD A;  3OYE A;  5EEA A;  4IOC F;  1Y8Q B;  1YW9 A;  1OCT C;  1J0R A;  2KMU A;  3DBR B;  3IC7 A;  4KIB A;  4KN4 X;  3OYA A;  1LJ9 A;  3OS2 A;  2KRF A;  2WA0 A;  5GAG J;  4Y7N J;  2JRM A;  3OIP A;  4A6E A;  2GLO A;  4WK8 F;  1TNS A;  2H6C A;  2WC2 A;  3GEZ A;  1TL8 A;  2ISZ A;  2LD5 A;  2R93 J;  3S1M J;  4G9Y A;  2LMD A;  2R7R A;  3E5U A;  1RR8 C;  3FWE A;  5CVJ A;  2QQB A;  3HXL A;  3CDL A;  5IT9 Z;  2NNN A;  2AQE A;  4Y33 A;  3V8J A;  5DCM B;  1HKS A;  3LSP A;  2MD5 A;  1IRZ A;  2E36 A;  2P5L C;  3H9G A;  1T33 A;  3UNG C;  2KIF A;  5BPI A;  4LIU A;  4BXF A;  4AYB A;  2NNY A;  3VSK A;  2JUC A;  3WTU C;  2DPU A;  2DDB A;  2W00 A;  1E3P A;  3MZ8 A;  2DFF A;  3MN2 A;  2PMH A;  1QPI A;  4N4O B;  3FXQ A;  3QYE A;  2KKO A;  3JRA A;  3S32 A;  1Y8R B;  5IY5 H;  1ZRC A;  4LMY A;  2DA1 A;  2QCO A;  2H94 A;  5KVR A;  1F36 A;  3EYY A;  3JRB A;  4CUG A;  2IA2 A;  4OIN F;  3IV5 A;  3CF5 F;  2VOD A;  3ZQG A;  1JKP C;  2CQ7 A;  1VQN I;  4HYE A;  2MW8 A;  2YUS A;  2M8E A;  4D9J A;  1WCM J;  4UVA A;  3HBL A;  3OY9 A;  1XG1 A;  3BTI A;  1MMD A;  2DA5 A;  4DGW B;  4CCN A;  1ZLJ A;  2NVT J;  5L3B A;  5F0C A;  1QZY A;  3CZ6 A;  4XL9 A;  4M3B A;  3TOB A;  1J5Y A;  3JW4 A;  1R1U A;  3M9A A;  1Y0N A;  1W7P B;  2VC1 A;  5DM6 F;  3Q0V A;  3IRR A;  3F8F A;  1MDM B;  1B4A A;  3BG3 A;  3UKG A;  1FMV A;  2FRH A;  2WAD A;  5FKL A;  2EIL H;  1RUO A;  4HA8 A;  1ZAR A;  3UR3 C;  1Z91 A;  3U21 A;  2XAS A;  1X3W B;  3ULQ B;  2MGQ A;  1P6R A;  4YIF A;  1W7P D;  2Z16 A;  4XLC A;  3QPL A;  3A02 A;  5EZG A;  4F91 B;  3B6C A;  1E3O C;  2DA3 A;  5JVG F;  2EV5 A;  3KYC B;  3WE3 A;  2QZ8 A;  4B48 A;  1QHH D;  2X6Y A;  3WU0 A;  3FXK A;  4NHJ A;  1LFB A;  5EG0 B;  4LLG F;  1F43 A;  1TQM A;  4PDK A;  3OYF A;  4KMF A;  1OLT A;  3ZRG A;  1YIJ I;  3JRI A;  4P9U A;  1WI3 A;  1BC7 C;  4OOI A;  5ERI A;  2CSO A;  5E8I A;  3ML6 A;  1B8I A;  2Q8K A;  1X4P A;  1Z3X A;  2EH3 A;  4GGG A;  2ZB9 A;  4XQF A;  2O9L A;  5JLX A;  2V79 A;  3M3Y J;  4Y3O A;  3W2V A;  2MBF A;  3QU6 A;  2DN0 A;  3L09 A;  6PAX A;  2HOE A;  1YG2 A;  4N9H A;  1ZRD A;  2VPR A;  4YFX F;  1DGR M;  4OU0 A;  5L3D A;  3ZQH A;  3IH4 A;  3W2A A;  3S17 J;  1GLN A;  3LAP A;  4A12 A;  3WG9 A;  1R1V A;  1IF1 A;  4XLN F;  4DIQ A;  3KCC A;  4L5J A;  4RAG A;  4M3D A;  1V55 H;  3GWZ A;  2JK3 A;  3SEZ A;  4CHU A;  4BDY A;  3PO3 J;  3BDD A;  1HC8 A;  3ZMT A;  4L0Y B;  1TTY A;  2OPT A;  4EVI A;  2F6C A;  3H9Q A;  3LWF A;  1T6S A;  3HTU A;  5D5W B;  3LSG A;  5F64 A;  4WXH A;  2L7Z A;  4MLO A;  2KIQ A;  4BE1 A;  2K5C A;  5CVR A;  3OSF A;  2L7K A;  2P81 A;  5K7Z A;  1AOY A;  3GTP J;  4PZJ A;  2LR8 A;  1IN8 A;  2W84 A;  1IUY A;  4PJM A;  4I0B A;  5F1J A;  3OYM A;  1R5G A;  3IRQ A;  4XKB A;  2XGD A;  1F5T A;  3J81 K;  5E3N A;  5LGU A;  2DT6 A;  3MEX A;  1K6Y A;  2CMP A;  1NK3 P;  4AVP A;  1YI2 I;  2JWT A;  1FP1 D;  2DMU A;  1UG2 A;  3M4O J;  1FNN A;  2KL4 A;  3K4K A;  3M07 A;  1U9O A;  2DFI A;  2LY9 A;  3P9I A;  3HYI A;  1XGS A;  1O3Q A;  1Z21 A;  4ZYG A;  5EG0 A;  2CW8 A;  3CUQ B;  3FBI B;  1P7J A;  1ETV A;  2FQ3 A;  3AL0 C;  2FBI A;  2O3F A;  2HWV A;  3ROU A;  3GTM J;  4BS9 A;  1WJ5 A;  2OC6 A;  1MBJ A;  1FSH A;  1K79 A;  1U9N A;  4IEJ A;  2CUZ A;  3WTZ A;  4NC7 A;  3WTY C;  4IHS A;  4CZC A;  1PP7 U;  1GXQ A;  3EQL F;  3DLA A;  2ID6 A;  4XLP F;  1IGN A;  2FBH A;  2KIS A;  3EYI A;  3MKL A;  2ZNZ A;  2F5F A;  1LE8 B;  2HU9 A;  2OBP A;  3HB9 A;  1G3T A;  4EGY A;  1FYM A;  2R4G A;  3Q0W A;  4X1E A;  1G8X A;  5E79 C;  4A6D A;  3ZMZ A;  2RRE A;  4HX7 A;  3TP0 A;  3GYH X;  3BTC A;  1D8J A;  4XBF A;  2MC4 A;  3K6G A;  5DD8 A;  1HKT A;  2W85 A;  4KFC A;  1MBF A;  2VJ4 A;  2WY8 Q;  3CES A;  3DKW A;  4LD5 A;  1ITY A;  1D0Z A;  1SVL A;  2IGN A;  1BI3 A;  2QEN A;  2R7O A;  4MTE A;  4D7N A;  2IS2 A;  3KX2 A;  3M8J A;  4IRI A;  2DPD A;  1N75 A;  3BCB A;  5J4V A;  3KP3 A;  3P5J A;  3RSN A;  1VQP I;  4XLE A;  3K10 A;  3ZGK A;  1T08 B;  2L3D A;  1V3F A;  1DU6 A;  3DPL C;  4Q47 A;  4FQG A;  2ESH A;  3H1C A;  3K7A J;  2FMY A;  4CIC A;  3DTI A;  5EEH A;  5FKM A;  2ZME B;  4KT6 A;  2XAG A;  2P4W A;  4AC0 A;  4GO1 A;  2A05 A;  2OU2 A;  2ELJ A;  3IAS 2;  3VB2 A;  1EKE A;  2M7A A;  1FBQ A;  3FDY A;  3K1P A;  4BJ5 C;  1S7O A;  3C7J A;  4IOA F;  5GAH J;  1ONV A;  5CYV A;  1LVA A;  5TGT A;  4A3B J;  1XGM A;  1FIA A;  1D1A A;  2VL8 A;  4QIW N;  2E2H J;  3PQJ A;  3EUH C;  2H8W A;  4FE4 A;  1JE8 A;  2AHQ A;  3H5R A;  2CV2 A;  2VI6 A;  3ZQI A;  3PSF A;  4LFU A;  2BHZ A;  5EGO A;  2E71 A;  5TRD A;  1ZGW A;  1OCR H;  2W1O A;  3E97 A;  2F4O B;  5ILV A;  2ZME C;  3CTA A;  3G1O A;  2XAQ A;  3G73 A;  1LDD A;  4ZZD A;  4PCQ A;  1G3W A;  5A2Q K;  3IL2 A;  1UST A;  4KIT B;  3HOS A;  1FPQ A;  3HHH A;  4ASN A;  4ZZL A;  4HRI A;  2IS1 A;  3D5L A;  3HSE A;  1WI9 A;  2AQF A;  4NUB A;  3F22 A;  3RKQ A;  1JGS A;  5L3G A;  1RC9 A;  3BC8 A;  4IXA A;  1TWG J;  2H09 A;  4XOR A;  3FIS A;  5EF6 A;  1MIJ A;  1W5T A;  1SD4 A;  1V4R A;  4Y15 A;  5EZH A;  3U1D A;  3KZZ A;  2QSH X;  2FOW A;  1JJ6 C;  3FXU A;  2MAB A;  3PNV A;  2H1L A;  1OCC H;  5HOO A;  4RLQ A;  4EJU A;  1LEB A;  3SEQ A;  2OF7 A;  2M34 A;  5E3O A;  1DP3 A;  1B9N A;  3CP8 A;  1ZH5 A;  4IZZ A;  2QKL B;  4OAY A;  5FLX K;  4EV0 A;  1WGX A;  1XSX A;  4GCV A;  1QA6 A;  1T8I A;  2YSR A;  1MND A;  1B72 B;  4W1U A;  1WRJ A;  2BE5 F;  3K4C A;  3HOY J;  1RZ4 A;  3F6V A;  2RNG A;  4GFB A;  4JX5 A;  3NEU A;  1WSU A;  2D1H A;  4MTD A;  1BJA A;  2FJ1 A;  4L9N A;  4HAM A;  3HUG A;  2QBY B;  3H0G J;  2JVG A;  3CUQ A;  2ZNY A;  2Z33 A;  5CQE A;  1WKM A;  2PX9 A;  2DMQ A;  2KP6 A;  2OTJ I;  3DPU A;  1GVD A;  3HPH A;  2M30 A;  1R5I D;  3FK7 A;  5E3M A;  2G9W A;  2LG4 A;  5BOX A;  1W36 D;  2IGK A;  3FKI J;  4FTH A;  4L9J A;  4EM1 A;  1P4X A;  5GAE J;  4ZYE A;  4LK1 F;  2HOS A;  1TW3 A;  2IP2 A;  4M6V A;  3JSO A;  3RKW A;  1PUE E;  4MIM A;  2K86 A;  2EB7 A;  5D6E A;  2MA3 A;  2OTL I;  3LST A;  4M6Y A;  4YFK F;  1VQ8 I;  3SDG A;  3WTT C;  2M87 A;  2RGV A;  4A3M J;  3DFG A;  2RNJ A;  2RVC A;  2VQL A;  1O3S A;  1D0X A;  2VUM J;  2FSW A;  4BUP A;  3GX4 X;  4P1W A;  4G7Z F;  3JRG A;  3S1R J;  1RET A;  3KP2 A;  2X51 A;  3ZN0 A;  3LQR A;  2EFP A;  4R1H A;  4KJZ A;  1W4M A;  2WB1 N;  4BXX J;  1FOX A;  2YR2 A;  2KZG A;  1UB9 A;  2E1N A;  3I55 I;  2VOP A;  1XDU A;  2HYJ A;  1HA8 A;  4IQ4 A;  2CQQ A;  1FY7 A; 
#chains in the Genus database with same CATH homology
 1S3J A;  3HHG A;  1ON2 A;  1R58 A;  2F5C A;  1OYI A;  3LQQ A;  2G7H A;  2O0Y A;  3BRO A;  4O3M A;  2A69 F;  1O7F A;  4G7H F;  2WWY A;  3Q9V A;  1H9T A;  3P9C A;  4EJO A;  4ETS A;  2VT3 A;  4MGR A;  3O6B B;  3VOD A;  5D5V B;  1FYL A;  1T38 A;  4GYG A;  2HDC A;  3TO9 A;  2JRT A;  2ELH A;  3M8F A;  3GFJ A;  3I64 A;  2FBK A;  2F5E A;  2FOK A;  5TJJ A;  5F6F A;  3T1B A;  1U6G A;  1Z9C A;  3DQV C;  4M72 A;  1AWC A;  1DUX C;  2LNB A;  4UV9 A;  3CDH A;  4MQ9 F;  1Z1D A;  2XIG A;  2Q0O A;  2V9V A;  1R5H A;  5ICG A;  4XRF A;  4OIR F;  4YFN F;  3RKX A;  2DU9 A;  1SFX A;  4H0E A;  5J8C A;  1LQ1 A;  4LG0 B;  5H20 A;  1KGS A;  3H3Z A;  3JTH A;  1TW2 A;  4LB5 A;  1YIO A;  2GXG A;  4LK0 F;  3SXY A;  2HFH A;  2LKP A;  5FO5 A;  2MLK A;  4KIC A;  4OIO F;  4MNU A;  2PI0 A;  1EH6 A;  1S29 A;  2OQG A;  4UNO A;  3L9F A;  2VE9 A;  1MJA A;  4HLX A;  1BBY A;  1SD7 A;  4M9Z A;  4L5I A;  2GZW A;  4A5M A;  1JXS A;  1KYW A;  3PFI A;  4EMS A;  1R36 A;  2JTV A;  1MJ9 A;  3KE2 A;  2RQP A;  1IN5 A;  3IWF A;  2H6B A;  2ISY A;  5D8L B;  3I54 A;  2XHK A;  4U7D A;  2XKO A;  1NHA A;  4EM0 B;  5HDK A;  1G4D A;  4G7O F;  1YYV A;  1XCV A;  2P8T A;  2F2E A;  2P7V B;  3F21 A;  3SHF A;  1KU9 A;  1XN7 A;  4DNC A;  2IJL A;  2Z99 A;  3BPV A;  1U3E M;  4HOB A;  5ICF A;  2OD5 A;  3TO6 A;  3T8R A;  2P5K A;  3R60 A;  1XCB A;  3FMQ A;  1W7P A;  3R0A A;  1RIO H;  5EEG A;  2XKP A;  5DV5 A;  2DT5 A;  4HW0 A;  3R4K A;  1XSV A;  3GZ6 A;  1QQI A;  2IW5 A;  3L00 A;  2DI3 A;  2V1D A;  1H9G A;  4M9S A;  3IWZ A;  3RKY A;  4IRH A;  2PEX A;  4M74 A;  3W6J B;  1U5T B;  2DQR A;  4I7H A;  2IVM A;  2GWR A;  4ENM A;  2STT A;  1YW8 A;  2C6Y A;  2GA1 A;  3OOP A;  3EET A;  5JFR A;  1Z7U A;  1J75 A;  2VC0 A;  3F23 A;  5LEJ A;  3HTS B;  2NS0 A;  3Q9S A;  3N97 A;  1IW7 F;  3ZMV A;  4LLL A;  4MEX F;  3GFI A;  4ZH4 F;  4B8X A;  1HKQ A;  2GAU A;  4OIP F;  2CYY A;  1OMI A;  3KP5 A;  1YQA A;  4BQA A;  2LF8 A;  1IAW A;  1I5Z A;  2JPC A;  2W24 A;  3B02 A;  5FGM A;  5FD5 A;  2QWW A;  1IN6 A;  2A61 A;  4HDU A;  4ENJ A;  3R0J A;  2VE8 A;  3QAH A;  1RUN A;  5CVV A;  4OIQ F;  3E5X A;  5FFX A;  3TGN A;  1REP C;  1KQ0 A;  4KYW A;  4EM2 A;  4A2U A;  4D0P A;  3T5X A;  3GVA A;  2E7X A;  3PQK A;  3QRF F;  2WTE A;  1FLI A;  2W25 A;  3FZV A;  1KU3 A;  1O57 A;  3V4G A;  3EUH A;  1GVJ A;  5HLG A;  3VOE A;  4RGU A;  1XSD A;  4L0Z B;  1ZHF A;  4RB1 A;  4EJW A;  4OMZ A;  4RB2 C;  3ECH A;  5HS9 A;  1R22 A;  1RNL A;  3GFL A;  1G6N A;  3N4M A;  4UUV A;  1FX7 A;  2BV6 A;  2JSC A;  4HZF A;  4UXN A;  2HKX A;  1QBJ A;  2FEZ A;  4TV7 A;  1BI1 A;  3LAJ A;  4E70 A;  2FE3 A;  4HBL A;  5E8G A;  1ZRE A;  2X4H A;  5K5R A;  3ABT A;  2IA0 A;  4I0A A;  1ODD A;  1K6O A;  1S7A A;  3HRT A;  2L54 A;  4IHT A;  3K0L A;  3GUD A;  5L3F A;  3V7S A;  3RTR A;  2VXZ A;  1SD6 A;  2CWE A;  3I59 B;  3KLN A;  2PG4 A;  3SZT A;  1BM9 A;  2XAH A;  1I27 A;  2VBW A;  2OZ6 A;  2X0L A;  4HX4 A;  2EV6 A;  2HQR A;  2EFN A;  1BI2 A;  3H92 A;  3HSR A;  2EFO A;  2RKH A;  4MHG A;  5FLX Z;  4ENN A;  5DUK A;  1UCR A;  1LDK B;  2MLG A;  4Q4Z F;  1YLF A;  2EFQ A;  1PDN C;  3IKV A;  1SMY F;  3ZMU A;  5FFZ A;  3RPQ A;  3RJP A;  1CF7 B;  2M1B A;  3KEQ A;  1KYZ A;  1E17 A;  4GYI A;  4U0W A;  2QYO A;  3DPT A;  2HZT A;  2OQR A;  2XRN A;  4Q5S F;  2CG4 A;  1BN5 A;  1OR7 A;  1MJB A;  4HDV A;  3GF2 A;  1EV7 A;  3TO7 A;  4KMU X;  5JR3 A;  4I02 A;  4RB3 C;  3W6K B;  3J81 Z;  3BJ6 A;  2KIM A;  3DF8 A;  1C0W A;  2ZBK A;  5E17 F;  1VTN C;  1IN7 A;  4K2E A;  1YFH A;  1XD7 A;  4ESJ A;  4KNY A;  1ON1 A;  2V6C A;  2UWM A;  1QPM A;  5D5U B;  1LNW A;  5DUI A;  4P5O A;  3VEP A;  4DQ2 A;  1HW2 A;  1EH8 A;  3K1N A;  3ZMD A;  2COM A;  3MFK A;  1U8R A;  3D0S A;  2PN6 A;  5A2Q Z;  4UHT A;  1P4W A;  3L7W A;  1TNT A;  3U2R A;  3ZN1 A;  3RI4 A;  4I98 B;  2CO5 A;  2DK5 A;  3EDP A;  5BS6 A;  2IRF G;  1IXR C;  2OAZ A;  1G3S A;  4AIJ A;  5DEQ A;  2CW0 F;  5JHU A;  1K78 B;  2NRA C;  2DK8 A;  5LRR A;  1QZZ A;  1L0O C;  1OKR A;  3RIR A;  1BC8 C;  1SAX A;  1J2X A;  1D8K A;  4KDP A;  2HYF A;  1B59 A;  1L3L A;  2PQ8 A;  1YS7 A;  3SFZ A;  5FB2 A;  4Z2Y A;  1ZAO A;  1XB4 A;  1TBX A;  5D5X B;  5LGT A;  3K9T A;  1XMA A;  1WQ2 A;  4CYD A;  4F7Z A;  3F6O A;  5J6X A;  1ZRF A;  1KQ9 A;  3WGI A;  2ESN A;  1Z05 A;  4IF4 A;  1KA8 A;  3O2P E;  2GXB A;  4KT5 C;  2XAF A;  2A3S A;  2IPQ X;  5AIP A;  2ZKZ A;  3E6D A;  2ZME A;  4WF2 A;  5CLS A;  2EFW A;  3C18 A;  2QM3 A;  2A6H F;  2HKO A;  1HQC A;  2O6G E;  2UZK A;  5LHI A;  2XRO A;  2QQA A;  5JI6 A;  2Z9O A;  4O5V A;  1J9I A;  3F8N A;  4RAY A;  2E1C A;  3C3W A;  3Q5F A;  3FMS A;  5K1Y A;  3MQ0 A;  4RGS A;  4EJV A;  2B0L A;  3RDI A;  4LB6 B;  3CO7 C;  1Y0U A;  5HS8 A;  2FA5 A;  1B6A A;  3REO A;  2HS5 A;  1WWX A;  1Q1H A;  4HLY A;  1HSJ A;  2K27 A;  1I6X A;  4JK1 X;  4GXO A;  3KP7 A;  4FHT A;  4HQE A;  2ADU A;  3SQN A;  2L01 A;  2ZO4 A;  1FP2 A;  4P9F A;  4HF0 A;  5DCM A;  4L9T A;  3WGH A;  5HVQ C;  3K69 A;  4ZYD A;  1I1S A;  3QU3 A;  4ESB A;  2FU4 A;  3C1D A;  1YO5 C;  5DCF A;  2AS5 F;  1W5S A;  3ERE D;  2MC3 A;  5E20 A;  4S04 A;  4CZZ A;  5CVI A;  4QLC U;  2RV8 A;  2KJB A;  2A07 F;  2YU3 A;  3FX3 A;  4CXF A;  1FBU A;  1ZG1 A;  3F8M A;  1MD0 A;  4G6Q A;  5LRS A;  4BAY A;  2A6E F;  4Q48 A;  4QWQ A;  5DYM A;  1U5T C;  1YS6 A;  3WOD F;  1TQP A;  1ZGA A;  2DLL A;  3HSF A;  3DXJ F;  4LJZ F;  5FD6 A;  4RS8 A;  3U9G A;  1ZN2 A;  1IN4 A;  2Z5U A;  1J59 A;  2DAO A;  4IPA A;  4L18 B;  2QBY A;  1LB2 A;  1ZYR F;  4U0Y A;  1HST A;  2M5W A;  1D5V A;  4U88 A;  3HIF A;  1I1G A;  4KIF A;  3FM3 A;  5D8K B;  4EJT A;  1BOA A;  2JZY A;  4XSX F;  2TDX A;  1T98 A;  5D6F A;  4YII A;  5F1R A;  2Y0M A;  5LHG A;  2FF4 A;  4NB5 A;  4KN7 X;  2Z3Y A;  1G3Y A;  3ELK A;  2GIV A;  5HLH A;  3F8C A;  1YW7 A;  4B09 A;  4UVC A;  3M7G A;  2CGP A;  4A0Z A;  1U78 A;  5HLI A;  4YG2 F;  2R7D A;  2UXN A;  4LG0 A;  2EWN A;  2ZJ2 A;  4LGW A;  5ILU A;  3WTS C;  4G8X A;  3FHZ A;  3I5U A;  2EA4 A;  4G6D A;  3VFZ A;  4Y17 A;  3LA7 A;  3ZQ7 A;  3L2C A;  4A0Y A;  3V8K A;  2ACJ A;  1FZP B;  4RB0 A;  4AIK A;  1OPC A;  3WE2 A;  1MZB A;  2K02 A;  4S05 A;  3DEU A;  1T39 A;  2Y75 A;  5LEK A;  2YX4 A;  1A04 A;  2XVC A;  2ZXJ A;  3GZ5 A;  5HDG A;  4AIH A;  2P6S A;  2EV0 A;  3F72 A;  3FMR A;  3CUQ C;  4XSZ F;  2XV4 S;  3LFK A;  1XMK A;  2UXX A;  3RYR A;  4FX4 A;  3COA C;  1P92 A;  5E18 F;  3FXR A;  1SMT A;  3AAF A;  3M8E A;  2D2W A;  1FT9 A;  3I58 A;  4WCG A;  2G7U A;  2L02 A;  2XUB A;  2AXL A;  3IKT A;  2BBY A;  3GO5 A;  2GQQ A;  1EH7 A;  1PP8 F;  2OZU A;  1IRG A;  3G3Z A;  3F3X A;  4ZYH A;  4OMY A;  2GA2 A;  2VBZ A;  2QLZ A;  2RN7 A;  1UHW A;  2Y48 A;  1P2F A;  1J7K A;  1P4A A;  2L4M A;  3BWG A;  1DP7 P;  2BYV E;  3M1E A;  4PGG A;  2K4B A;  1QNT A;  3TDZ C;  1FBS A;  3KEO A;  2HTS A;  1SFU A;  2VOO A;  1YTY A;  4RGX A;  1LEA A;  1R1T A;  4WXD A;  1HXD A;  4RGR A;  1R7J A;  4MQV A;  5LLQ A;  5ILS A;  1T0F A;  2HR3 A;  1R00 A;  3KP6 A;  4RAZ A;  5H6Q A;  1F1Z A;  3RYP A;  5IT9 K;  1ZG5 A;  1E2X A;  2VBY A;  3J7A O;  3JAM K;  1CGP A;  1DPR A;  3HOT A;  2O8X A;  3JTG A;  3GXO A;  2WV0 A;  1BIA A;  5K5O A;  4UVB A;  4IRG A;  3P7N A;  3E6B A;  3CLO A;  4P96 A;  5CVU A;  4BH9 A;  3RPU A;  5BQT A;  2IA1 A;  3KET A;  3BOQ A;  3ZMS A;  2DQL A;  4BXU A;  1FWZ A;  2ZCW A;  2DTR A;  4N0B A;  3ECO A;  2EJR A;  2VON A;  3NRV A;  3WGG A;  1LDJ A;  2STW A;  2PFB A;  5LHH A;  3E5Q A;  3ZP5 A;  1IRF A;  1ZGJ A;  2Q2E A;  3R6S A;  3KP4 A;  1H0M A;  3KLO A;  4EQQ A;  3K1M A;  3NQO A;  2JT1 A;  3TQN A;  2NYX A;  1OYW A;  2MH9 A;  1Z6T A;  3WU1 B;  3CJN A;  4JQF A;  3I53 A;  3HRM A;  4BHC A;  1DDN A;  2QQ9 A;  4HV5 A;  4CO8 A;  2P7C B;  4MEY F;  5KK1 A;  1T2K A;  3E6C C;  3IHU A;  4M73 A;  4I09 A;  4EGZ A;  3FF5 A;  3E6M A;  3MWM A;  3GLX A;  1TLH B;  5D4S A;  2FNA A;  2V1U A;  4HQM A;  4BYY A;  2DW4 A;  2D1V A;  3O3K A;  3MZH A;  2BGC A;  2RDP A;  2QUF A;  3CUO A;  1KQ8 A;  2NAZ A;  1JHF A;  4HF1 A;  2R7F A;  2DO7 A;  4P55 A;  3BP8 A;  1FYK A;  5JVT A;  3WTW C;  4WX9 A;  2V1X A;  1O3R A;  4KUM A;  2F5D A;  5DD4 A;  2JPB A;  3H3U A;  1IXS B;  2YX7 A;  4NQW A;  2O61 A;  1S8N A;  2ZFW A;  4HF2 A;  5HDN A;  3QP5 A;  2HQN A;  2M45 A;  3HRU A;  4IVN A;  5H6R A;  2HEO A;  1RI7 A;  4WXC A;  2RC4 A;  2EA2 A;  2PBI A;  2VT2 A;  4JBA A;  1F4K A;  2H27 A;  5E1Z B;  1O7L A;  1CF7 A;  1MGT A;  3OV8 A;  3WTX C;  4FT8 A;  3WTV C;  3KZY A;  3TKY A;  2KJC A;  3CO6 C;  2CFX A;  2LSO A;  5J8F A;  4R8H A;  1XDS A;  2KIU A;  2PLY A;  4HX8 A;  4AWX B;  1D3Y A;  5L3E A;  2E7W A;  5CJ9 A;  1ULY A;  2XAJ A;  4N9I A;  4ON0 A;  1TQI A;  2J5P A;  1GXP A;  1SFE A;  1UFM A;  4HV6 A;  2ETH A;  1UHM A;  3V7R A;  5LGN A;  3JSP A;  1U2W A;  3P9K A;  2P6T A;  4IJA A;  4U7B A;  1KU2 A;  3J80 Z;  5HS7 A;  3TDU C;  3HRS A;  2FXA A;  4WWC A;  4AD9 A;  2D45 A;  3E3V A;  1BIB A;  4ENK A;  5LBQ A;  1MKM A;  3KFW X;  4PGH A;  4A0X A;  4M9X A;  1F9N A;  1SD5 A;  2XGX A;  2A5Y B;  3T8T A;  1BI0 A;  3JAM Z;  2DBB A;  1MDM A;  5E1X A;  2QVO A;  4A5N A;  3DP7 A;  2J5O A;  5E1W A;  3J80 K;  5ICE A;  1K7A A;  2HGC A;  2EK5 A;  1FC3 A;  1STZ A;  5AIQ A;  3SZP A;  2R3S A;  1HW1 A;  3ISP A;  3R61 A;  1XGO A;  1GHC A;  5L3C A;  1B9M A;  5AON A;  2YPR A;  1S6L A;  2VN2 A;  3GW2 A;  3TOA A;  4R79 A;  3I71 A;  1HW5 A;  1XGN A;  4BNC A;  2FNP A;  3GFM A;  2A68 F;  4FX0 A;  4BHB A;  1B1B A;  5K5Q A;  3MAJ A;  1USS A;  2K7L A;  3ABU A;  2P5V A;  1OYY A;  2O03 A;  4G94 A;  3T0Y A;  4BHP A;  2HTJ A;  3MZY A;  4ESF A;  4KIG A;  1QO0 D;  3LA3 A;  2LDU A;  2CQK A;  3QP6 A;  3DV8 A;  3FM5 A;  4O6J A;  4Y13 A;  1K78 A;  1FSE A;  5DDG A;  2VBX A;  3BJA A;  2PJP A;  4CDG A;  3B73 A;  3BJO A;  3QOP A;  3V7C A;  3I0T A;  1ZG3 A;  3BY6 A;  1KU7 A;  3V8L A;  3K2Z A;  4M6X A;  3LA2 A;  1O3T A;  1R23 A;  2K4J A;  1Z6R A;  2LF7 A;  1HBX G;  4L9V A;  3I4P A;  3S2W A;  5ICC A;  1U5T A;  1X3U A;  2MH2 A;  5IT3 A;  1DPU A;  5BPD A;  4M71 A;  3MCZ A;  4I2O A;  3QPT A;  1IZ1 A;  2W57 A;  5BMZ A;  1ZLK A;  3I59 A;  3BZ6 A;  5ED4 A;  4CGZ A;  2OA4 A;  3F8B A;  4I01 A;  4KA4 A;  1JHH A;  3BPX A;  2HYG D;  2FML A;  5D4R A;  4UV8 A;  1QGP A;  2PMU A;  3ZPL A;  4LLN A;  1FOK A;  3QPH A;  1IXC A;  2BEO A;  4U0V A;  2L4A A;  2IT0 A;  1YW9 A;  1J0R A;  3IC7 A;  4KIB A;  4KN4 X;  1LJ9 A;  2KRF A;  4A6E A;  4WK8 F;  1TNS A;  2H6C A;  2WC2 A;  3GEZ A;  2ISZ A;  4G9Y A;  3E5U A;  3FWE A;  5CVJ A;  2QQB A;  5IT9 Z;  2NNN A;  3V8J A;  5DCM B;  1HKS A;  2MD5 A;  2P5L C;  2KIF A;  5BPI A;  2NNY A;  3WTU C;  2DPU A;  2PMH A;  3FXQ A;  2KKO A;  1ZRC A;  4LMY A;  2H94 A;  5KVR A;  3EYY A;  2VOD A;  2IA2 A;  4OIN F;  4HYE A;  2M8E A;  4UVA A;  1ZLJ A;  5L3B A;  1QZY A;  3TOB A;  1J5Y A;  3JW4 A;  1R1U A;  3M9A A;  1W7P B;  2VC1 A;  3IRR A;  3F8F A;  1MDM B;  1B4A A;  2FRH A;  1RUO A;  4HA8 A;  1ZAR A;  1Z91 A;  2XAS A;  3ULQ B;  1P6R A;  4YIF A;  1W7P D;  2EV5 A;  3WE3 A;  2QZ8 A;  3WU0 A;  4NHJ A;  4LLG F;  1TQM A;  4PDK A;  4KMF A;  4P9U A;  1BC7 C;  4OOI A;  5ERI A;  2CSO A;  5E8I A;  3ML6 A;  2Q8K A;  4GGG A;  2V79 A;  2MBF A;  3QU6 A;  3L09 A;  6PAX A;  2HOE A;  1YG2 A;  4N9H A;  1ZRD A;  4YFX F;  4OU0 A;  5L3D A;  3LAP A;  4A12 A;  3WG9 A;  1R1V A;  1IF1 A;  4XLN F;  3KCC A;  4L5J A;  3GWZ A;  4CHU A;  3BDD A;  3ZMT A;  4L0Y B;  1TTY A;  4EVI A;  3LWF A;  1T6S A;  3HTU A;  5D5W B;  5F64 A;  4WXH A;  5CVR A;  1AOY A;  4PZJ A;  1IN8 A;  2W84 A;  1IUY A;  4I0B A;  1R5G A;  3IRQ A;  1F5T A;  3J81 K;  5LGU A;  3MEX A;  4AVP A;  1FP1 D;  1FNN A;  2DFI A;  3P9I A;  3HYI A;  1O3Q A;  1XGS A;  4ZYG A;  3CUQ B;  2FQ3 A;  2FBI A;  2O3F A;  2HWV A;  3ROU A;  1FSH A;  1K79 A;  3WTZ A;  3WTY C;  4IHS A;  1PP7 U;  1GXQ A;  3EQL F;  4XLP F;  2FBH A;  3EYI A;  2ZNZ A;  2F5F A;  2OBP A;  1G3T A;  4EGY A;  1FYM A;  4A6D A;  3ZMZ A;  4HX7 A;  3GYH X;  1D8J A;  4XBF A;  5DD8 A;  1HKT A;  2W85 A;  4KFC A;  3DKW A;  4LD5 A;  1BI3 A;  2QEN A;  4MTE A;  4IRI A;  2DPD A;  3KP3 A;  2L3D A;  1V3F A;  3DPL C;  4Q47 A;  2ESH A;  4CIC A;  2FMY A;  5EEH A;  2ZME B;  2XAG A;  2P4W A;  4GO1 A;  2OU2 A;  3VB2 A;  1FBQ A;  3K1P A;  1S7O A;  3C7J A;  1ONV A;  5CYV A;  1LVA A;  1XGM A;  3PQJ A;  1JE8 A;  4LFU A;  5TRD A;  3E97 A;  5ILV A;  3CTA A;  2XAQ A;  3G73 A;  1LDD A;  4ZZD A;  4PCQ A;  1G3W A;  5A2Q K;  3IL2 A;  1UST A;  3HOS A;  1FPQ A;  3HHH A;  4ASN A;  4ZZL A;  3D5L A;  3HSE A;  1WI9 A;  3F22 A;  1JGS A;  5L3G A;  4IXA A;  2H09 A;  1W5T A;  1SD4 A;  1V4R A;  4Y15 A;  3U1D A;  3KZZ A;  3FXU A;  5HOO A;  4EJU A;  1LEB A;  1B9N A;  1ZH5 A;  5FLX K;  4EV0 A;  4GCV A;  1XSX A;  2YSR A;  1WRJ A;  2BE5 F;  1RZ4 A;  3F6V A;  3NEU A;  1WSU A;  2D1H A;  4MTD A;  1BJA A;  4L9N A;  4HAM A;  3HUG A;  2QBY B;  3CUQ A;  2ZNY A;  2Z33 A;  1WKM A;  2M30 A;  5BOX A;  2G9W A;  4L9J A;  4EM1 A;  1P4X A;  4ZYE A;  4LK1 F;  1TW3 A;  2IP2 A;  3JSO A;  3RKW A;  1PUE E;  2K86 A;  2EB7 A;  5D6E A;  2MA3 A;  3LST A;  4M6Y A;  4YFK F;  3WTT C;  2M87 A;  2RGV A;  3DFG A;  2RNJ A;  2RVC A;  1O3S A;  2FSW A;  3GX4 X;  4G7Z F;  3KP2 A;  3ZN0 A;  3LQR A;  2EFP A;  4R1H A;  1W4M A;  2YR2 A;  1UB9 A;  2E1N A;  2VOP A;  1XDU A;  1FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...