4MNUA

Crystal structure of uncharacterized slya-like transcription regulator from listeria monocytogenes
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
AMKDILRDIGVIARALDSISNIEFKELNLAKGQFIYLVRICENQGIIQEKLVDILKIDRTTASRAIKNLEKNGLIIKKQNKNNKKNKLLFPTEKGQQLYPLIIRENEYSNAVALKGFTEAEINMLTDALKKVKENIADDWLYVKKGNKRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords SlyA-like transcription regulator
publication title Crystal Structure of Uncharacterized SlyA-like Transcription Regulator from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
total genus 53
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mnuA00
2HQRA 2L02A 1VTNC 4I0AA 2PQ8A 1B4AA 4HYEA 4LK0F 2P6SA 1KYZA 1NHAA 2XASA 5CVRA 4GCVA 3RPQA 2O6GE 1J0RA 2HS5A 4HDUA 3H3UA 2VBZA 3GVAA 1EH7A 2W25A 4EGYA 3TDZC 4ZYDA 2PN6A 1AOYA 2LNBA 2A5YB 2ESHA 3ZMTA 2MC3A 4A12A 4PDKA 2JTVA 2DAOA 2XKPA 4EJOA 4O6JA 1B1BA 4M74A 4XLPF 4KICA 4KN7X 1O3SA 1BC7C 2DT5A 2VT3A 4Y13A 3RKYA 5A2QK 2EB7A 3WU0A 2V9VA 2P5VA 1KU3A 3EETA 1ONVA 4KIFA 2FBKA 1QO0D 4M6XA 1FNNA 4EM2A 2CSOA 3KEOA 1BI1A 2O8XA 4R79A 2VC0A 3JAMZ 1QZYA 1HSTA 5CVIA 2QVOA 5J8FA 2ZBKA 1XCVA 5LRSA 1LNWA 4N0BA 5H20A 3T8TA 3IKTA 3RTRA 3T0YA 1R7JA 3E5UA 4IRGA 3FZVA 3RPUA 2DQRA 5AONA 1MDMB 2STWA 5D4SA 1KQ8A 3KP7A 2QWWA 4M72A 2GXBA 1G3WA 3B02A 2PFBA 2XROA 3JW4A 1ZGAA 5ILVA 2Z99A 3BROA 2O03A 1D8KA 3FMRA 3EYIA 3JSPA 4MTDA 4BHPA 2V6CA 1IAWA 1KQ9A 2XHKA 2D2WA 2RKHA 4ZZLA 2OAZA 3T1BA 2H6BA 2K4JA 4P55A 1R1VA 3WTWC 4Z2YA 3WODF 5D5XB 1IN8A 4UV8A 3COAC 3KZYA 4OOIA 3NQOA 1RUOA 2EJRA 2BE5F 2XAQA 4I01A 5JHUA 3L00A 2Z9OA 5E8IA 2VN2A 2COMA 3IRRA 1IXCA 2DI3A 1ULYA 4ESBA 1FP1D 5DD8A 3U2RA 3SZPA 4MEXF 4ENJA 3SFZA 1B9NA 3WU1B 1IF1A 4ZZDA 2ZKZA 1USSA 1TW3A 4WWCA 1UHWA 1GXQA 2BYVE 2P8TA 2J5OA 2XV4S 2WWYA 2EV6A 2KKOA 3TGNA 5ERIA 3QU3A 2IT0A 2K7LA 1W7PA 4L0YB 2OA4A 4AD9A 4NHJA 4HW0A 2XAHA 1U6GA 5JI6A 2P5KA 1R58A 2RNJA 1XN7A 1YFHA 3GWZA 2WV0A 2QZ8A 5LLQA 5KK1A 5LEJA 1FWZA 1PUEE 4OINF 4LLNA 1FC3A 1D5VA 3CUQA 3O6BB 4ZYHA 4I02A 4M9ZA 2BEOA 1OKRA 4IHTA 5IT9K 2RN7A 1IN6A 3BP8A 1F1ZA 2A61A 2NAZA 2W84A 3LWFA 4UV9A 1MJ9A 5D4RA 2LF8A 3MZHA 3LAPA 3GFLA 1BI2A 5L3FA 3RKWA 3H3ZA 4CDGA 2H27A 2VC1A 3IHUA 4EM1A 3QRFF 3F6OA 3F3XA 3R0JA 3DEUA 4YFNF 4LG0B 2ZJ2A 1YIOA 1S3JA 1KU2A 3MWMA 1XDSA 1H9TA 5FB2A 1UHMA 3QAHA 1QQIA 1FLIA 4M9SA 4WXHA 2VBXA 2MH9A 3FM5A 2EA4A 2RGVA 3K0LA 4KIGA 3WE3A 5HVQC 1O3TA 4Y15A 3ZP5A 4JK1X 2IJLA 4A2UA 2KRFA 2AXLA 2HR3A 2HKXA 3TQNA 5FO5A 5ILUA 1EH8A 4LFUA 3FF5A 1T6SA 3ZMZA 1IN5A 1B9MA 2HGCA 5H6RA 2BBYA 1LVAA 4FHTA 1E17A 5A2QZ 4QWQA 1U2WA 2ZFWA 1SFEA 4MNUA 1MJBA 2R7FA 3CDHA 4G6QA 4KNYA 1R5GA 1ZAOA 1BOAA 4Q48A 1LDJA 2OQRA 3WTVC 3C7JA 1HSJA 3O3KA 1IRGA 1H0MA 4JQFA 2EFOA 2FRHA 2GXGA 4A0ZA 3GZ6A 3KP3A 3NEUA 4BNCA 4IJAA 4UVBA 1KU7A 3I0TA 1MD0A 1SFXA 4EM0B 4MHGA 3HSEA 1XMAA 2VT2A 1DUXC 3P7NA 1HQCA 3KLOA 4BHCA 3I53A 2Y75A 2UZKA 1QBJA 3RYPA 2OZ6A 1LQ1A 4A0XA 2MLKA 4HLXA 4RAZA 1W5SA 4CYDA 3RIRA 4D0PA 5D5VB 4ESFA 2G9WA 1IUYA 3C3WA 3VODA 2FEZA 1P4WA 1Z9CA 2HQNA 3F22A 1ZARA 1ZHFA 1XSVA 2ZMEA 3IWZA 2E7WA 2WTEA 3TO9A 1U8RA 2QENA 2NNYA 3V8JA 2D45A 3GYHX 3DQVC 3WGGA 3E6MA 3BZ6A 2GZWA 1QPMA 3LAJA 4RGUA 1RZ4A 3EYYA 5FFXA 3GF2A 2NS0A 4G94A 3RI4A 2ACJA 1RI7A 5ICGA 3ELKA 4EGZA 2M87A 4MQ9F 2CFXA 4EJUA 4BYYA 2D1VA 3KFWX 4QLCU 4RGSA 2H6CA 3F8BA 4LB5A 1B6AA 1S6LA 3KETA 4BHBA 2CG4A 3HUGA 3QU6A 5L3CA 2GIVA 2XAGA 3ULQB 5HDKA 3FMSA 3CO6C 1Z6RA 2ETHA 4U0VA 4HQEA 3P9CA 5D8KB 2YU3A 3DPLC 3CTAA 4HZFA 1F4KA 4HQMA 2R3SA 2V1UA 1W5TA 3WTSC 3ABUA 1Z91A 5CJ9A 4YG2F 3ZMSA 2E1NA 2P7VB 1KGSA 2BGCA 3FXQA 2FSWA 3HSFA 4I98B 1IXRC 2X0LA 1ZGJA 4ASNA 4Y17A 3GO5A 1XCBA 2TDXA 4N9IA 1IN4A 5TRDA 1BN5A 3C18A 2QYOA 3EQLF 1ZRDA 2O0YA 3GLXA 3TKYA 2PMHA 5L3BA 2X4HA 1YW9A 3R4KA 1HXDA 4B09A 4EV0A 5LGUA 2G7HA 4HDVA 5HS7A 1E2XA 1FP2A 5LGNA 3SXYA 2QLZA 4HX4A 2A6HF 3J81Z 5H6QA 2XIGA 2VONA 3TO7A 1YQAA 4PGGA 2PJPA 4WK8F 3M1EA 3CO7C 4KIBA 2JRTA 4HBLA 1DPRA 5L3GA 3E5XA 1AWCA 1LDDA 1XDUA 3KCCA 1HW5A 4UNOA 2FQ3A 1KU9A 4EJTA 3ISPA 4LB6B 3FWEA 1R23A 5CVUA 2L01A 3KP5A 1R1TA 3OV8A 1I5ZA 2VOPA 2DK5A 4S04A 2KIFA 1Y0UA 4P5OA 1HBXG 1XD7A 3V4GA 3IWFA 1P4AA 5LRRA 4GXOA 4LLGF 2O3FA 2Y48A 3BY6A 2ZCWA 3W6KB 2EWNA 3V8LA 3HRSA 2EK5A 2HEOA 2KIUA 3O2PE 2HTSA 4I0BA 1TQIA 5E20A 2VOOA 5ICEA 2HFHA 2PI0A 4L18B 3HTUA 5D6FA 5DV5A 4H0EA 4FX0A 4IF4A 4P9UA 1G3SA 1IW7F 2Q0OA 2HOEA 2XUBA 1SD6A 3HRUA 4UVAA 1PP7U 3L2CA 1LB2A 3GZ5A 2Z33A 4G8XA 1B59A 5HOOA 3S2WA 4JBAA 4LK1F 1ON1A 4AIHA 4G7HF 3I54A 5CVVA 5HDNA 1RNLA 3HOSA 5CVJA 4CICA 3D5LA 2V1DA 1YO5C 1T39A 2M5WA 1T2KA 4PCQA 1K78B 4F7ZA 5DEQA 1WWXA 2VODA 2DU9A 3Q5FA 2MH2A 1FBSA 3CJNA 4AWXB 4L9VA 1J5YA 4FX4A 5HS8A 1I27A 1FT9A 3MQ0A 4YIFA 5BPDA 5L3DA 2XRNA 5FD6A 3FXRA 3U1DA 5E18F 3GFJA 5HLHA 2PEXA 2XAJA 3T8RA 5JVTA 3LA7A 2RC4A 3KP2A 1FYLA 5D6EA 1I1GA 1YS7A 1TW2A 1GHCA 3K9TA 2D1HA 3LA2A 4XRFA 2ELHA 4S05A 4EVIA 3F8MA 2IP2A 5D8LB 3WGHA 2MD5A 1LEAA 1JE8A 2NYXA 4RGRA 4U88A 4OIRF 3GX4X 2DQLA 3GUDA 1FBUA 2JT1A 3E97A 2L3DA 5J6XA 1EV7A 1YYVA 2ADUA 1S8NA 1XMKA 5E1ZB 1FZPB 1XGNA 2FMLA 4BH9A 2KJCA 1F5TA 4P96A 3KE2A 3BPXA 1BBYA 1MGTA 3WTXC 4Q47A 3G73A 1R1UA 1S7OA 2L4AA 2OQGA 4G9YA 4K2EA 4A0YA 5BOXA 5HLGA 4AIKA 3HOTA 2IRFG 2F5CA 1XGMA 3F8CA 3DP7A 4EJWA 3F6VA 2QBYA 2GA2A 1PP8F 2Y0MA 1YLFA 1V3FA 4CO8A 1Z05A 5D5WB 5DD4A 1U5TA 1ZRCA 3EDPA 1T0FA 5LHGA 4BQAA 1FOKA 5IT3A 4I2OA 1HW2A 2RVCA 3FXUA 2DW4A 1R22A 2STTA 4CHUA 2NRAC 2H94A 4MGRA 1ZLKA 4A5MA 2OZUA 1LEBA 4N9HA 1GXPA 5BQTA 4OMZA 2RV8A 1X3UA 2UXXA 4UUVA 4O3MA 2ZNZA 5EEGA 1P92A 3K2ZA 2E1CA 5ILSA 1D8JA 3L7WA 4XSZF 3V8KA 3WTTC 1I1SA 2GQQA 3JAMK 2CWEA 2HZTA 2QQAA 2J5PA 1JXSA 4BXUA 1O7FA 4I7HA 1DDNA 3QP5A 1KYWA 3HIFA 1Q1HA 3I71A 2DK8A 5ED4A 4HF0A 4A5NA 3BJ6A 3ML6A 5FLXK 2CO5A 4LJZF 4WF2A 4HV5A 1LJ9A 5AIPA 1BI3A 5AIQA 2EFWA 1J59A 4M9XA 4KDPA 4HLYA 5DUIA 2YSRA 4OIOF 1MDMA 1ZG3A 2PG4A 3ZMUA 2PBIA 1QNTA 4KUMA 1FY7A 4ENKA 1WSUA 1T38A 1QZZA 2FF4A 5K5OA 4RB3C 2R7DA 3FX3A 2F5DA 2PLYA 1ZYRF 1RIOH 1FBQA 1OMIA 3H92A 3CLOA 5L3EA 3ZPLA 5DCMA 4P9FA 2YX7A 3SZTA 2ISZA 3WGIA 2K02A 4IHSA 1OYIA 1U3EM 1G4DA 3CUQC 4ON0A 4L5JA 1XSDA 1FPQA 1TLHB 1R36A 4NQWA 1W7PB 4KMFA 2XAFA 5K5RA 1R00A 3E6DA 3MZYA 1Z7UA 1OPCA 3BWGA 4HV6A 1U78A 1ON2A 1A04A 3CUQB 5TJJA 1G3YA 1QGPA 5HDGA 1OR7A 4Q4ZF 4PZJA 1BJAA 3NRVA 1HKTA 3HSRA 4CXFA 5EEHA 2WC2A 3AAFA 3F23A 3LQQA 4ENMA 1IXSB 1TQPA 3ZMVA 5F6FA 5LGTA 2C6YA 2EFPA 3TOAA 4UVCA 4FT8A 5J8CA 4L0ZB 3K1NA 4KFCA 2LF7A 3SQNA 3Q9VA 1K79A 1S7AA 5LHHA 3W6JB 3N97A 4DNCA 1K6OA 4XSXF 5IT9Z 2QBYB 3R0AA 4CZZA 5D5UB 3JTGA 3HRMA 3R60A 2QQ9A 4OMYA 1V4RA 1BM9A 5LEKA 2MBFA 2FNPA 3G3ZA 2BV6A 1R5HA 4RB1A 2FOKA 2Z5UA 2FNAA 2FBIA 3DF8A 3I59A 1Z6TA 3L09A 4IRIA 1YW8A 5E8GA 2YR2A 2G7UA 4HF1A 3ZN0A 5F1RA 3KP4A 3P9KA 2M1BA 3RYRA 1BIBA 1O57A 2XKOA 1UCRA 1SD7A 3E6BA 4LG0A 3KP6A 4G6DA 1XGOA 2ZNYA 3KZZA 2JPCA 4I09A 1LDKB 3K1PA 2A3SA 3V7CA 2FE3A 4ZYEA 4RGXA 2RDPA 2HWVA 3HTSB 2MA3A 2KIMA 2IA0A 1TQMA 2IA2A 3OOPA 1P4XA 2RQPA 2O61A 4HOBA 2K4BA 3Q9SA 3DKWA 5E1XA 3BOQA 3KEQA 3I64A 2HTJA 2DTRA 1K7AA 1IRFA 2UXNA 1W7PD 5ICFA 5LBQA 2P4WA 1GVJA 2M45A 5BS6A 3SHFA 1XB4A 3GEZA 2ESNA 4IXAA 2DFIA 4YFKF 2ZO4A 2ZMEB 4WXDA 2VBYA 4G7ZF 1SD4A 3FM3A 2JPBA 4HA8A 2ZXJA 1UB9A 3MCZA 5K5QA 1BI0A 4YFXF 1G6NA 2FBHA 5FLXZ 3BDDA 3R6SA 2LKPA 4ENNA 1MZBA 4LD5A 1ZG1A 1L3LA 3IKVA 3FMQA 4HX8A 4RB2C 2DPDA 2QQBA 4M73A 4IPAA 2W24A 4A6DA 1F9NA 1TNTA 1ZH5A 2W57A 4XLNF 2EV0A 5DCMB 3D0SA 2V79A 2QM3A 3GFIA 4YIIA 4XBFA 3PQKA 3J80K 2ISYA 4IRHA 2HYGD 1SMTA 1CF7A 3WE2A 4ETSA 1WRJA 3LQRA 2DPUA 5K1YA 3MEXA 5BMZA 2CQKA 1G3TA 3DFGA 1OYWA 4R1HA 3VEPA 3M8EA 2QUFA 2JZYA 1D3YA 3WTZA 3KLNA 4KYWA 3K1MA 2EFQA 2XVCA 1EH6A 4AIJA 5DCFA 3MAJA 2M30A 1FX7A 2JSCA 2YPRA 5FGMA 4RAYA 1O3QA 3E6CC 1FYMA 4U7BA 4DQ2A 2LSOA 3JSOA 2M8EA 2CYYA 1XGSA 4GYIA 3WG9A 4U0YA 1I6XA 4KMUX 1DPUA 3HHHA 2AS5F 3PQJA 3LFKA 1YTYA 1HKQA 1H9GA 2P6TA 1USTA 1HKSA 4UXNA 2Z3YA 2Q8KA 3CUOA 4M71A 2YX4A 3WTYC 1FSHA 4KT5C 5E17F 1XSXA 1ZN2A 4LLLA 5KVRA 5CLSA 3I58A 5HS9A 2Q2EA 3I59B 3F21A 2OD5A 4GYGA 5BPIA 3J81K 1TTYA 1KQ0A 3R61A 3MFKA 3HHGA 3K69A 1SD5A 1HW1A 3ABTA 1SMYF 3TO6A 3BJAA 4MEYF 1P6RA 2VBWA 1RUNA 4ZH4F 3RJPA 1PDNC 4NB5A 1P2FA 3GW2A 4Q5SF 1WI9A 4RS8A 3VOEA 1TNSA 1ZRFA 3DXJF 4O5VA 3F8NA 3V7SA 2NNNA 4TV7A 3HRTA 2W85A 2HYFA 4GGGA 3VB2A 4HF2A 4AVPA 4MQVA 3ECOA 2VE8A 2IVMA 2HKOA 1ZREA 3RDIA 2L4MA 3QOPA 4KN4X 3N4MA 3F72A 1J7KA 4UHTA 2EA2A 1WQ2A 3IC7A 2GA1A 3REOA 4ZYGA 5LHIA 2CW0F 3DPTA 4ESJA 4OIPF 3U9GA 5F64A 3BPVA 2EV5A 1YW7A 4L9NA 4EJVA 4WX9A 2E7XA 4OIQF 2IW5A 4L5IA 1DP7P 3QP6A 2A6EF 4EQQA 2FXAA 2L54A 3QPTA 3HYIA 2IA1A 4G7OF 1S29A 1MJAA 4E70A 1SAXA 3F8FA 1W4MA 3ZN1A 1WKMA 2A07F 5DYMA 2MLGA 1YS6A 2DLLA 2OBPA 4PGHA 1TBXA 2GWRA 4CGZA 1JGSA 2UWMA 1CF7B 1YG2A 1UFMA 3QPHA 1ZLJA 3LSTA 5FD5A 3ROUA 1IN7A 4IVNA 3GFMA 5DDGA 2FU4A 2FMYA 1J2XA 2FA5A 2K27A 1OYYA 3M9AA 2LDUA 2F5FA 4EMSA 2DBBA 3ECHA 4L9TA 3IL2A 4GO1A 3J80Z 2V1XA 3FHZA 1FSEA 1T98A 3VFZA 1IZ1A 6PAXA 3BJOA 3B73A 3E5QA 3ZQ7A 2F5EA 2GAUA 1BIAA 2H09A 3P9IA 5E1WA 4HX7A 3T5XA 4LMYA 1SFUA 3C1DA 4RB0A 4BAYA 5FFZA 3TOBA 3DV8A 1O7LA 2PMUA 1STZA 3ERED 2F2EA 1BC8C 2P5LC 1C0WA 1FYKA 1JHHA 1K78A 4HAMA 4LGWA 3GXOA 4B8XA 4M6YA 1CGPA 3M7GA 4A6EA 4U0WA 3WTUC 4WCGA 5JR3A 3E3VA 4R8HA 3PFIA 4WXCA 3M8FA 3V7RA 3ZMDA 3I4PA 4KA4A 1L0OC 3JTHA 3TDUC 1O3RA 1REPC 4OU0A 2IPQX 4L9JA 2HDCA 1U5TC 2KJBA 3EUHA 1ZG5A 2A69F 1Z1DA 1JHFA 1ODDA 2OU2A 5JFRA 2K86A 3J7AO 5ICCA 2A68F 4U7DA 3I5UA 2VXZA 1J75A 2CGPA 2P7CB 3IRQA 3LA3A 5DUKA 3L9FA 2VE9A 2DO7A 1J9IA 2B0LA 5HLIA 3RKXA 2XGXA 4MTEA 1U5TB 1KA8A 2EFNA 5CYVA 1MKMA
chains in the Genus database with same CATH superfamily
1SEUA 2HQRA 2L02A 1SVOA 2LMDA 2XDVA 1WH5A 1VTNC 4DOZA 4I0AA 2ELJA 2PQ8A 3BTIA 1B4AA 1RR7A 2NOJB 4HYEA 4LK0F 2P6SA 1KYZA 3TBIA 1NHAA 2XASA 2F4OB 4F92B 5CVRA 2W82A 4GCVA 3RPQA 4QPQA 2TCTA 2O6GE 3UNGC 3JRAA 3FHNA 1J0RA 3LSKA 4FASD 3PSFA 2HS5A 4HDUA 3H3UA 3ABLH 2VBZA 3GVAA 3HJEA 1EH7A 3L2QA 2W25A 4EGYA 3GTKJ 3TDZC 4ZYDA 2WADA 3CCLI 2PN6A 1AOYA 2LNBA 2A5YB 4Y4RA 2EIKH 1RC9A 5TGTA 4YIRX 2ESHA 3ZMTA 2MC3A 5M3MJ 3BZKA 4A12A 1XS9A 5F27A 4E7IA 1IJWC 3WU2C 4PDKA 2JTVA 4MFDA 2DAOA 2XKPA 4EJOA 4O6JA 1B1BA 2L7FP 4M74A 4XLPF 4KICA 4KN7X 1O3SA 1BC7C 2DT5A 2DJIA 3IH4A 2VT3A 1MH3A 4BE1A 3BR1A 4HG2A 4Y13A 2CU7A 3RKYA 5A2QK 4PK4A 2EB7A 1ETYA 3WU0A 2V9VA 4F52A 2CRGA 4BXXJ 2P5VA 1IDZA 1KU3A 1K61A 3EETA 1ONVA 1JJ8C 4KIFA 3LSGA 2FBKA 1QO0D 1MIJA 4M6XA 1FNNA 4PFOA 4EM2A 2CSOA 3X2QH 3KEOA 1YIJI 1BI1A 4PJNA 2O8XA 2KMUA 1GLNA 4ABZA 4R79A 4A93J 2VC0A 3JRIA 1R49A 1S5LC 3JAMZ 1QZYA 1HSTA 5CVIA 2QVOA 5J8FA 1YRNB 3BLYA 2ZBKA 3W2WA 1TWFJ 4A3MJ 1XCVA 5LRSA 1LNWA 4IL6C 4N0BA 5H20A 4N4OB 5B66C 3FBNB 3W2AA 3T8TA 3IKTA 1OISA 4QTRA 3RTRA 4EEFG 2NVTJ 1W0TA 2AQFA 3T0YA 3SEQA 1R7JA 1N75A 3LL7A 4DYRA 3CQZJ 1GV2A 4XN0A 2MW8A 1EJ9A 1D1BA 1T95A 3E5UA 4IRGA 3KYLA 3FZVA 3RPUA 3JRFA 1IV6A 2DQRA 2O9LA 4AYBN 2K9QA 5AONA 1QVUA 4A3KJ 3K4KA 2KDOA 1SVMA 1MDMB 2STWA 5D4SA 1KQ8A 4XORA 3KP7A 4IOCF 2A5WA 2QWWA 4M72A 5DS9A 2KP6A 2RAEA 2GXBA 3M3YJ 1G3WA 4ZDLA 3B02A 1PUFB 3GTLJ 2HDWA 4V2FA 2PFBA 3BG9A 2XROA 1VQ8I 3JW4A 3LFUA 3VYSB 4BDZA 1ZGAA 2X6XA 5ILVA 2Z99A 3BROA 3L2WA 2O03A 1D8KA 3OYFA 5FLVA 5GP9A 1VQMI 3FMRA 3EYIA 3JSPA 4MTDA 2XPWA 4BHPA 3S14J 2H1KA 1DP3A 2V6CA 1ENHA 2CW8A 1MMSA 1IAWA 4A3GJ 1KQ9A 2PJRA 2XHKA 2D2WA 2RKHA 2M3AA 5HLTA 4ZZLA 4XKVA 2OAZA 4CCKA 3T1BA 3CMEI 2LY2A 2H6BA 2K4JA 4P55A 1R1VA 3WTWC 4D7MA 4Z2YA 3BTJA 3LMMA 2HU9A 1Y1WJ 3A2KA 3HOZJ 5J1UA 1OR7C 3WODF 1HDDC 5D5XB 1IN8A 3G2BA 4UV8A 3COAC 3KZYA 4LG3A 3J7YJ 1TWAJ 1TWCJ 4OOIA 2D5VA 2X6YA 1OCTC 3NQOA 1FOWA 1RUOA 2EJRA 1QA6A 3N05A 2CQNA 2BE5F 2DMPA 4A3LJ 2IGKA 2XAQA 4I01A 3WHBA 5JHUA 3L00A 2LK2A 2Z9OA 2UUZA 5E8IA 2H8WA 5HODA 2VN2A 2COMA 3IRRA 1IXCA 1OJLA 3O8GA 1QRYA 2DA2A 2DI3A 1ULYA 3DTIA 2E1OA 1FP1D 4ESBA 5DD8A 3U2RA 5IY5H 2JJ7A 4B43A 4M3DA 4IOAF 3FISA 3SZPA 2R5YB 2BW3B 4MEXF 3NWTA 4ENJA 3SFZA 1B9NA 3WU1B 4OWRB 1IF1A 2KZGA 3S17J 3B6AA 4CUGA 4ZZDA 2ZJRF 2CS3A 2ZKZA 1OCOH 2MC4A 3NAUA 3G4SI 1ACIA 1IRXA 1USSA 3H36A 5EDNA 3LSMA 1TW3A 2VB6A 4WWCA 2ICWG 1UHWA 1GXQA 3PL8A 2ZSIB 1DU0A 4XL9A 4M3GA 2BYVE 5IP6A 3OYAA 2AO9A 2J5OA 2P8TA 4W1UA 2XV4S 2WWYA 2LOOA 4XICA 3S8PA 3OYHA 3G1OA 2EZLA 4HPQA 2EV6A 4XLEA 2KKOA 3TGNA 2L9RA 1D5YA 2Y0SA 3PNVA 3QWLA 2CUFA 5ERIA 3QU3A 4J01A 2IT0A 2K7LA 1W7PA 4L0YB 1YJNI 2CUZA 1VFCA 2OA4A 4YELA 4AD9A 4NHJA 4HW0A 2XAHA 1U6GA 3OWTA 5JI6A 2ECBA 4J19A 2P5KA 2K9NA 1R58A 2RNJA 1XN7A 4XOPA 3SDGA 3S93A 3GWZA 1YFHA 2WV0A 2QZ8A 2VQLA 5LLQA 3D5SC 5C4XJ 5KK1A 5LEJA 1FWZA 2ID6A 1AU7A 1PUEE 4OINF 4B44A 4LLNA 1FC3A 1D5VA 3CUQA 3O6BB 3S1RJ 4ZYHA 2DCEA 1VQ9I 4I02A 4M9ZA 1RKWA 1LE8B 2BEOA 1OKRA 5FRMA 4IHTA 2V1NA 3I4MJ 3OSGA 3UKGA 5IT9K 1UHSA 3JRCA 2RN7A 4B48A 4CA0A 5FJ8J 1IN6A 2XF5A 4XLFA 3BP8A 3NARA 1F1ZA 5IYBJ 2A61A 2ME6A 2LC2A 2NAZA 4AM3A 2W84A 3G71I 3SYTA 3LWFA 5H2FC 4IX7A 1LFPA 4UV9A 1WJ5A 1MJ9A 5D4RA 2LF8A 3MZHA 3LAPA 3GFLA 1BI2A 5L3FA 2EINH 3CESA 2JVHA 3RKWA 1ETVA 3H3ZA 1N25A 4CDGA 2H27A 2QA4I 2VC1A 3IHUA 2W4SA 3VYTB 4EM1A 1N78A 3CCUI 1A5JA 3QRFF 3F6OA 5F04A 2I5UA 3F3XA 3R0JA 3DEUA 4YFNF 5IOYA 3A01B 1GUUA 1Z21A 2ZJ2A 1BR2A 1YIOA 1S3JA 2HPMA 4LG0B 1KU2A 4MIMA 4M3BA 3MWMA 1XDSA 1H9TA 2LBFA 5FB2A 1UHMA 3QAHA 1QQIA 1FLIA 5FKMA 4QPOA 4M9SA 2IS2A 4WXHA 2VBXA 3JRGA 2MH9A 4BBRJ 3FM5A 2EA4A 2RGVA 3K0LA 2E1MC 4KIGA 5FKOA 3WE3A 5HVQC 1O3TA 2XF7A 3M1CA 4JK1X 2IJLA 4Y15A 3ZP5A 2JA8J 3OIOA 1TWHJ 4A2UA 2KRFA 2AXLA 1JT0A 1NK3P 2HR3A 4D7NA 3OYKA 2HKXA 3TQNA 5FO5A 5ILUA 1EH8A 4LFUA 3FF5A 1T6SA 3ZMZA 1IN5A 1B9MA 2HGCA 2DN0A 3ZR8X 3GTJJ 3CP2A 5H6RA 1MW7A 2BBYA 1LVAA 4FHTA 2HVQA 4HNVA 1E17A 4BJ5C 1WCMJ 2E1MB 3L2RA 2EBIA 5A2QZ 4QWQA 1U2WA 4E7KA 2XRLA 2Y30A 2ZFWA 1RKTA 3CF2A 4JOMA 4UUSB 1SFEA 4MNUA 1MJBA 2R7FA 3AKZA 3CDHA 4KISA 1TWGJ 4G6QA 2CH0A 4KNYA 2DA1A 1R5GA 1ZAOA 2RREA 1BOAA 3HOXJ 3PNTA 2R7ZJ 4Q48A 5TISC 1LDJA 2OQRA 3FXLA 3WTVC 3C7JA 1HSJA 2V9KA 3O3KA 4BY7J 1IRGA 1H0MA 2GIZA 4JQFA 2EFOA 2FRHA 3FK6A 2GXGA 2K3PA 2X6OA 1LFUP 4A0ZA 1X4PA 2NVYJ 3GZ6A 4HRIA 3KP3A 3NEUA 4BNCA 3G1LA 4IJAA 1U0JA 4UVBA 1KU7A 1GV5A 3BG5A 3I0TA 3CCJI 1MD0A 3OYIA 1SFXA 5F0HA 4EM0B 4MHGA 4ZTJA 4RM3A 3HSEA 1HC8A 1XMAA 2VT2A 1I50J 1DUXC 3P7NA 1HQCA 2X85A 3KLOA 4BHCA 1UELB 3I53A 2Y75A 2UZKA 1QBJA 4ANJA 3RYPA 2OZ6A 2ZXHA 1OCRH 1LQ1A 4F93B 4A0XA 2MLKA 4HLXA 3RQ4A 4RAZA 1K83J 3ABMH 1W5SA 3GZNB 3KYCB 2M7AA 1W36C 1ZR4A 2WV1A 4CYDA 3RIRA 4D0PA 5D5VB 4A3IJ 4ESFA 2G9WA 4A69C 3HPGA 1IUYA 3C3WA 5EF6A 5C44J 3VODA 2Y0SN 2FEZA 2PJRB 4XRSG 1P4WA 1Z9CA 2HQNA 3F22A 3OY9A 2K85A 4JP0A 2IXSA 1VI0A 1ZARA 5EYRA 1ZHFA 1MBHA 3I4NJ 1XSVA 2NVXJ 5EEAA 2K3FA 2ZMEA 2LTPA 3IWZA 5IYCJ 2E7WA 2WTEA 1VQ7I 3ZRGA 3TO9A 3HOWJ 1U8RA 2DTZA 2QENA 2LRDA 2NNYA 3MZ8A 3V8JA 2D45A 1R4NB 3GYHX 3GLLA 4D9JA 3DQVC 3WGGA 3E6MA 3K10A 4XK4A 1KONA 3BZ6A 4C9YA 2GZWA 1QPMA 3LAJA 2KRCA 4RGUA 1RZ4A 3EYYA 2MFZA 5FFXA 3BG3A 4BEHA 2MSYA 3GF2A 1SC7A 2NS0A 4G94A 4C3IJ 3RI4A 2F48A 2F5VA 1FIAA 2VPRA 2R7OA 2ACJA 2NS7A 1RI7A 5ICGA 4CCLA 3BG7A 3ELKA 4EGZA 1EKEA 4IHXA 4KT6A 2CMPA 2M87A 2Q1ZB 2CFXA 4MQ9F 5E3LA 4EJUA 2JUCA 2QSFX 4BYYA 2D1VA 2V4JC 1F43A 1R9TJ 3KFWX 4HEA2 4QLCU 2Y9ZA 2DMNA 4RGSA 3S1MJ 2H6CA 3F8BA 2V7FA 4CH7A 4LB5A 1B6AA 3L2VA 5GADJ 5DM6F 1S6LA 3CC7I 3KETA 2E5NA 3CJRB 4BHBA 2CG4A 1SVLA 4B4CA 3FKIJ 3HUGA 3QU6A 5L3CA 2VJJA 4PSWA 2GIVA 2XAGA 3ULQB 4XRMA 5HDKA 3FMSA 3HL2A 5J3LA 1LKXA 1Z6RA 3CO6C 2ETHA 2XGCA 4U0VA 5J1YA 4HQEA 2YS9A 1ZR2A 2KLOA 3P9CA 3P5JA 2W7NA 5D8KB 3H9GA 1E3OC 2YU3A 4B3XA 4DBQA 2JQ7A 2KQRA 3F9KA 2KHMA 3DPLC 3CTAA 4HZFA 1F4KA 4HQMA 2R3SA 2V1UA 1R4MB 3OL4A 1W5TA 3WTSC 3ABUA 1Z91A 1G59A 5FRNA 1IC8A 1VNDA 3LSJA 4JX5A 5CJ9A 3DTEA 4YG2F 3ZMSA 2E1NA 2OC6A 2P7VB 4XONA 1KGSA 2BGCA 2OUMA 3FXQA 3TW7A 4PJJA 2QCOA 2FSWA 3HSFA 2FX0A 2QQ8A 4I98B 1IXRC 2X0LA 3EUKL 3I9V2 4M3FA 1WJBA 1ZGJA 2DA5A 1MBEA 1XG1A 1RRJA 4ASNA 2XPUA 2E35A 1FOYA 1JKPC 2IGNA 4Y17A 1OQYA 3GO5A 1XCBA 2TDXA 3CJTB 4N9IA 1IN4A 5TRDA 1Y39A 1BN5A 1DQUA 2KL4A 2V6EA 2DDBA 3C18A 2QYOA 3EQLF 4PFPA 1ZRDA 2KRHA 2XPVA 1X2MA 2O0YA 2EH3A 3GLXA 3TKYA 5E3MA 2PMHA 1JUSA 5L3BA 4HNTA 2X4HA 2EIMH 1YW9A 4GFBA 3R4KA 4BY1J 5EZGA 1HXDA 4RA2A 4C2MJ 1OCZH 3H35A 3TP3A 4XKWA 2IGMA 4B09A 1VQ4I 4BBSJ 4EV0A 1ZTRA 4AC0A 1D0ZA 2EILH 5LGUA 3DBRB 3HC7A 2G7HA 2Y69H 2K9SA 4HDVA 4CZCA 5HS7A 1E2XA 2WAQN 1FP2A 4BU2A 1X1DA 5LGNA 3SXYA 3H0GJ 2QLZA 3JRDA 4HX4A 2A6HF 4C2UA 1A31A 1JJ6C 3J81Z 3ZQCA 2VL8A 3QYEA 5H6QA 5M5XJ 3HB9A 2XIGA 2VONA 3TO7A 4BGDA 1G8XA 3BCBA 1UJ8A 1YQAA 2VASA 3PSIA 1B72B 4PGGA 2PJPA 4WK8F 3M1EA 3Q3SA 3CO7C 2A6TA 1NTCA 2EPFA 4CSWA 4I6ZA 4KIBA 2JRTA 2W1OA 4HBLA 2R5ZA 1DPRA 2M34A 5L3GA 2W00A 3E5XA 3K4LA 2X9DA 4ZYAA 2VKVA 3CCRI 4IHYA 1AWCA 4DW6A 2JA6J 1LDDA 1XDUA 2B7EA 1S72I 2DT6A 3KCCA 1HW5A 4BS9A 1OCPA 3CC2I 2EQRA 1W36D 5HNHA 4UNOA 2FQ3A 1POGA 1KU9A 4EJTA 1VQOI 3B6CA 3ISPA 4LB6B 1FMWA 1NG7A 2WY8Q 1MMNA 3FWEA 3LSPA 3HOUJ 1R23A 5CVUA 3OSFA 2VQHA 2L01A 3KP5A 1Y8QB 2L2OA 4BXFA 1H89C 1R1TA 3OV8A 1I5ZA 2VOPA 2DK5A 2HI3A 2M7BA 4S04A 3VYUB 2KIFA 4E7HA 3A4CA 3AFHA 1Y0UA 3A03A 1YHQI 1BW5A 3OS1A 4P5OA 4BJTA 1HBXG 3OIQA 1XD7A 5M5WJ 2BVLA 2M0MA 3V4GA 5GAGJ 3BQYA 1XC5A 3IWFA 2LD5A 1P4AA 5FROA 2HPIA 4F3QA 1YOVB 5LRRA 3M4OJ 4GXOA 4LLGF 2O3FA 4XLCA 2P0WA 2Y48A 5JLXA 5E3NA 1O4XA 1GDTA 3BY6A 1Z0XA 1ETKA 1HCRA 2XSJC 2ZCWA 3QPLA 1V5GA 3W6KB 2E60A 3ERMA 1T8IA 2EWNA 3RSNA 3V8LA 2BHZA 2EK5A 3HRSA 2KIUA 3O2PE 5LD2C 2HEOA 2HTSA 2LLKA 3ONQA 3S2DJ 4I0BA 1S7EA 3C2BA 5F0FA 1TQIA 5E20A 4DZPA 2R7TA 2VOOA 1JTXA 3AG2H 5ICEA 4XR6A 5IOZA 3OMYA 2HFHA 2PI0A 4L18B 2CV2A 1DGWY 3HTUA 1LUJB 3FXJA 5D6FA 1YITI 5DV5A 4FX0A 4H0EA 4IF4A 1HOMA 4P9UA 2IEKA 1G3SA 2JSPA 2KDZA 4AU7A 1IW7F 4BE0A 2XF6A 2CUJA 2Q0OA 2L0KA 2HOEA 2XUBA 3SJMA 1SD6A 3HRUA 4UVAA 1PP7U 3L2CA 4NC7A 1LB2A 3GZ5A 3IH3A 2Z33A 4G8XA 1B59A 3M07A 5HOOA 3S2WA 5C4JJ 2NXNB 2BY3A 1Y0NA 4JBAA 5CQEA 5FKNA 4LK1F 1ON1A 4CCOA 1IO2A 4AIHA 4G7HF 1NG6A 1XMXA 3I54A 5CVVA 5E79C 2E5ZA 3BR5A 2DA4A 1F36A 2ECCA 1V5FA 2VKHA 3AG3H 2GLOA 1RESA 2RNGA 5HDNA 1RNLA 4NBQA 4Y52J 3HOSA 1BA5A 3K4BA 5CVJA 4CICA 3AG4H 2YU9J 1VQ5I 3D5LA 2VQCA 3HUGB 4LIUA 1FJLA 2V1DA 1YO5C 4DYCA 3QQAA 1SFOJ 1ETQA 4DJAA 4D5CA 2DMQA 3JREA 2HVSA 1T39A 2M5WA 3BG6A 1T2KA 1AKHB 2MGQA 4PCQA 4V19K 5EG0A 4CYCA 3ASOH 1K78B 4F7ZA 5DEQA 1X19A 3CCQI 3S3MA 2X6WA 4E7JA 3EUHC 1WWXA 2VODA 2LVSA 3OYNA 2DU9A 3Q5FA 1WI3A 1J09A 3Q0VA 2MH2A 1FBSA 3CJNA 3FXOA 2R7XA 4AWXB 4L9VA 4XIDA 1J5YA 2XGEA 4FX4A 3AL0C 1E3PA 5HS8A 1I27A 1T56A 1GVDA 1FT9A 3MQ0A 4E7SA 4YIFA 3FDYA 5BPDA 5L3DA 2XRNA 5FD6A 3FXRA 2EZKA 3U1DA 1QPIA 5E18F 3GFJA 1D1AA 5HLHA 3H3VK 4E4HA 2PEXA 2XAJA 3T8RA 5JVTA 2R4GA 3LA7A 3EUAA 2Y9YA 2K5CA 3QPSA 4E6KG 4XQFA 2RC4A 3KP2A 1FYLA 3PFYA 5D6EA 3CDIA 3WG7H 3HDDA 1I1GA 1YS7A 1Y8RB 1E0EA 1TW2A 3GTOJ 1GHCA 3BT9A 3K9TA 2D1HA 3LA2A 1I3QJ 3H9JA 3C2GA 3AL0B 4IHWA 4XRFA 3H1CA 2ELHA 4S05A 4EVIA 3F8MA 2IP2A 4XMYA 3HOYJ 5D8LB 3BCAA 2WY7Q 3WGHA 4D1QA 1X1CA 2MD5A 1LEAA 1JE8A 2NYXA 4RGRA 2BVMA 4U88A 4OIRF 3GX4X 1ZGWA 2DQLA 3GUDA 3K70C 4NDLA 1FBUA 4V2GA 3G1MA 1SFKA 1WGXA 3C2HA 2JT1A 3K6GA 1TP4A 3E97A 2L3DA 3TW6A 5J6XA 1EV7A 1YYVA 4OAYA 2ADUA 1S8NA 2LKXA 1XMKA 2HYJA 2L7MP 5E1ZB 2QF7A 5F1JA 1FZPB 2OTJI 1XGNA 2FMLA 2E71A 4BH9A 1MSFC 2EZIA 1X1AA 3HKZN 5BNGA 2KJCA 1TL8A 1F5TA 1EA3A 2L5QA 2WAEA 4F55A 4P96A 1LFBA 1BW6A 1Z77A 3BPXA 3KE2A 3TMOA 4BACA 1BBYA 1MGTA 3WTXC 4Q47A 3G73A 1R1UA 1S7OA 3CDLA 1FOXA 1P9QC 1A6IA 3VPRA 2L4AA 3LSHA 2OQGA 4G9YA 5J1RA 2R5ZB 2LP0A 4FTHA 4K2EA 2VKEA 4A0YA 2KISA 5BOXA 4BE2A 4H4KC 5HLGA 1T08B 4FCYA 4AIKA 3HOTA 2IRFG 2F5CA 1XGMA 4EATA 2NVUB 3F8CA 3DP7A 4EJWA 3ZQLA 5KCMA 3F6VA 2QBYA 2GA2A 1HDPA 1YX3A 1OFCX 4F91B 2BY2A 3KZIC 5B3SH 1PP8F 1ERDA 2Y0MA 1JUPA 1YLFA 1V3FA 4CO8A 1Z05A 5D5WB 1V55H 5DD4A 1U5TA 3CCEI 1ZRCA 3EDPA 1T0FA 5LHGA 4C30A 3JRHA 3K7AJ 3S16J 4BQAA 2V26A 2XSDC 1FOKA 1MNEA 5IT3A 3CD6I 4I2OA 1HA8A 3BR2A 1HW2A 2Z1DA 1Z3XA 4B47A 2NVQJ 2F6CA 2RVCA 3FXUA 2DW4A 1R22A 3H5AA 4BQOA 3OYDA 2XB5A 2STTA 4CHUA 5EGOA 2NRAC 2H94A 3W2VA 4MGRA 1ZLKA 4A5MA 2OZUA 1LEBA 1K4TA 4N9HA 4UB8C 2FOWA 1N77A 1Y56A 1GXPA 3KEYA 2DT7B 5BQTA 3CCYA 4OMZA 4UY8I 4ZC3A 2RV8A 3S2HJ 1X3UA 2FD5A 2LH9A 2UXXA 2F4MB 3SDBA 3V42A 2Z16A 4UUVA 4O3MA 1B8IA 2ZNZA 5EEGA 1P92A 3K2ZA 4QSHA 2JN6A 4IO9F 2DFFA 1JKOC 2E1CA 4M3EA 5ILSA 2MABA 1D8JA 3L7WA 4C3JJ 4LOCA 3DKYA 4XSZF 3DCFA 2CQQA 3V8KA 3WTTC 2PX9A 1JKQC 1I1SA 2MYSA 1TT0A 2GQQA 3JAMK 2CWEA 2HZTA 2QQAA 1P7JA 2M0CA 2ZFUA 1UZCA 2J5PA 3ZQGA 1ETWA 1JXSA 3VSLA 2Y31A 1FTZA 4UUTA 2WAQA 4BXUA 1O7FA 2R7RA 4I7HA 1DDNA 1QHHD 3QP5A 1ZQ3P 4JYKA 1QU3A 1TC3C 1KYWA 3HIFA 1Q1HA 3MMYB 1MBJA 3I71A 1WH7A 2DK8A 2OCCH 4NC8A 1GT0C 5ED4A 4HF0A 3S1NJ 2VQGA 1YRNA 4A5NA 3BJ6A 3ML6A 3VWBA 5FLXK 2DJNA 2CO5A 4LJZF 4WF2A 4HV5A 2HDDA 3LSRA 2R7UA 1LJ9A 1Z3YA 4I76A 3S3NA 2ZXIA 5AIPA 1BI3A 2R7WA 4GDFA 5AIQA 2E34A 3PO3J 4FISA 2EFWA 1K4SA 1WPKA 4Y33A 1QVTA 1J59A 4M9XA 4KDPA 3J7AY 1MMGA 4HLYA 2IS1A 5DUIA 5E3OA 1MBFA 1BR1A 3ZOBA 3CF5F 2DDAA 2H8RA 2YSRA 4OIOF 1MDMA 5EG0B 2DOEA 5GAHJ 2ZB9A 3H0DA 1ZG3A 2L9NA 2PG4A 3ZMUA 2PBIA 3OR1C 1QNTA 4KUMA 3QODA 4S0HB 1FY7A 2E19A 4ENKA 1WSUA 2GOMA 4M6VA 1T38A 1PUFA 1QZZA 2FF4A 3K70D 4ZTFA 4BJ6C 5K5OA 4RB3C 2PMZN 2R7DA 3FX3A 4BKXA 4I99C 1JT6A 2F5DA 2O7OA 2GXAA 2M4GA 2PLYA 1WZ2A 1ZYRF 1RIOH 4BQNA 3A0HC 1FBQA 3A02A 1SAUA 3HGYA 4DBRA 1OMIA 2R0QC 2JWTA 2VPLA 3H92A 3GMEA 3FBIB 3CLOA 5L3EA 2VXDA 3ZPLA 5DCMA 3GTMJ 4XLAA 4P9FA 1IRZA 1UG2A 2WBMA 2YX7A 3SZTA 2B63J 4QIWN 1IUFA 2ISZA 1JUMA 3GBGA 3WGIA 1I3AA 1MSEC 2DOFA 2K02A 4IHSA 1OYIA 3DWLE 1U3EM 1G4DA 4Z6YA 3CUQC 4ON0A 4L5JA 5IP7J 4A3DJ 1XSDA 1U9OA 2E2HJ 1FPQA 1TLHB 4ZJZA 1R36A 3GTQJ 4NQWA 1W7PB 4KMFA 2XAFA 5F08A 5K5RA 1R00A 3E6DA 5IP9J 3MZYA 4XM3A 2IS6A 2MD0A 1Z7UA 2HOAA 2G0EA 2E2IJ 1IDYA 2F4IA 4DGWB 3FIWA 4II3A 3OIPA 1OPCA 1LPQA 1NK2P 3BWGA 2LG4A 3D5RC 2XB0X 4HV6A 1U78A 1ON2A 1A04A 3I56I 3CUQB 1VQ6I 5TJJA 1G3YA 2IBDA 1QGPA 3BTCA 5HDGA 1OR7A 2X1EA 2X51A 5KHDA 4Q4ZF 4PZJA 3DLLF 1BJAA 3NRVA 3H5NA 1HKTA 4XKCA 3ZQFA 3ZGKA 3HSRA 4CXFA 1FEXA 5EEHA 1HLVA 2BW3A 1DGRM 3W3CA 2JA2A 1X2NA 2WC2A 3RPUD 4Y7NJ 3BR0A 1JI8A 3FKJA 3AAFA 3F23A 3LQQA 4ENMA 1IXSB 1TQPA 3ZMVA 5F6FA 5LGTA 2C6YA 3OYGA 2EFPA 3TOAA 5KAFC 4UVCA 4FT8A 3KPHA 5J8CA 4L0ZB 3K1NA 4KFCA 2LF7A 3SQNA 3Q9VA 1K79A 3HG9A 1S7AA 5LHHA 2DA7A 3K2AA 3W6JB 1IG7A 3N97A 4DNCA 2LBFB 1K6OA 2M4KA 4XSXF 5IT9Z 2QBYB 3R0AA 4CZZA 5D5UB 1PVEA 3JTGA 3HRMA 4G6TB 1FMVA 3R60A 2X48A 2QQ9A 4U87A 4OMYA 1R5ID 1V4RA 2DYSH 1BM9A 4DZJA 4B1RA 4PJMA 1R6RA 5LEKA 2MBFA 3ASNH 4HSRA 2FNPA 3G3ZA 3RZDJ 1BJZA 2BV6A 1R5HA 4ZDOA 3DLAA 1MBKA 4RB1A 2FOKA 1LE8A 5EGOB 2Z5UA 4YRVA 2FNAA 2FBIA 3DF8A 1P7IA 3I59A 2I8DA 3S1QJ 2UV1A 3OL3A 4E7LA 2BZTA 2KFDA 1Z6TA 3L09A 2R93J 2Y2ZA 2GBYA 5B1AH 3DKXA 1YW8A 5E8GA 2YR2A 4IRIA 4AVZA 2G7UA 5LFAA 2JA7J 4HF1A 3ZN0A 4LITA 3ABKH 1B8IB 5F1RA 3KP4A 3P9KA 2M1BA 2L7ZA 3VDXA 2W48A 4RM2A 3RYRA 1BIBA 1O57A 1WVRA 3FXKA 3OS0A 2ZXWH 2OF7A 1A6QA 2XKOA 1IV8A 1UCRA 2K9MA 2L9SA 1SD7A 3DEEA 5K7FA 3E6BA 3A01A 1FTTA 4LG0A 3KP6A 4G6DA 2JUGA 1XGOA 2ZNYA 3KZZA 2JPCA 4I09A 1LDKB 3K1PA 2A3SA 3V7CA 4FE4A 2FE3A 4ZYEA 4RGXA 2V9PA 2RDPA 1APLC 2BY0A 3MKWB 3IV5A 3DTKA 5F0CA 2HWVA 3HTSB 3OYEA 2MA3A 4A3FJ 4RAFA 2KIMA 2DYRH 3PO2J 2IA0A 1TQMA 2IA2A 2HOSA 3OOPA 1P4XA 2VKDA 2RQPA 1A35A 1PYVA 2O61A 4HOBA 2R7SA 2KT0A 2XGDA 2ZMEC 2K4BA 3CMAI 3Q9SA 3DKWA 1V5EA 5E1XA 3BOQA 2DMTA 2L7KA 5JHFA 3HKZA 4X0GA 5M3FJ 4G12A 3KEQA 2QKMB 3A1YA 3I64A 4RDUA 2HTJA 2DTRA 1K7AA 1IRFA 2UXNA 3PUFA 1W7PD 1Z67A 2IAIA 2P4WA 1GVJA 5ICFA 4ITVA 5LBQA 2M45A 5BS6A 3SHFA 4P1WA 4XKBA 1YJWI 1XB4A 1ZKGA 4UUSA 3GEZA 2ESNA 4IXAA 2DFIA 3QYFA 4YFKF 2QGUA 1WHUA 2ZO4A 2ZMEB 2CFOA 1OCCH 4WXDA 4RBOA 2VBYA 1AHDP 1M1EB 4G7ZF 4Y3OA 5CQGA 3RCOA 1SD4A 3FM3A 5B5EC 2JPBA 1X3ZB 2A05A 3I55I 1MMAA 1NH3A 1WJEA 3LNQA 4HA8A 1AA7A 2ZXJA 1UB9A 3MCZA 3MVPA 4MO7A 2OTLI 2VJ4A 5K5QA 1BI0A 3IAM2 4BEHB 3BQZA 4XN3A 1G6NA 4YFXF 2FBHA 3BC8A 4YEJA 5FLXZ 4D5FA 3BDDA 2R7VA 4NC6A 5JLWA 3E0JB 5IPAA 3R6SA 4IHVA 2LKPA 1ETOA 1ZK8A 1EF4A 4ENNA 1MZBA 4LD5A 3UR3C 1ZG1A 1L3LA 1VQKI 3IKVA 3FMQA 4NUBA 3JR9A 4HX8A 4RB2C 2DPDA 2QQBA 4M73A 1ZELA 4IPAA 3SEZA 2W24A 1T33A 4A6DA 1F9NA 1TNTA 3TL4X 2VLAA 1ZH5A 2OV7A 2HXIA 2B9SA 3Q0WA 2OCEA 2W57A 4XLNF 2EV0A 3S3OA 5DCMB 3D1NI 4RAGA 3D0SA 2V79A 4JX4A 2QM3A 2M8GX 3GFIA 4YIIA 4XBFA 3PQKA 3J80K 1UG0A 2ISYA 4IRHA 4XRSA 2HYGD 1SMTA 2OJED 2AHQA 2KPMA 1CF7A 3WE2A 1ETXA 3KIOA 4ETSA 2IGOA 3HEFA 1WRJA 3LQRA 2DPUA 5K7ZA 5K1YA 9ANTA 3IAS2 3MEXA 4KITB 5BMZA 4GRIA 2CQKA 4NQWB 4MFEA 1G3TA 2FJ1A 3F0CA 3DFGA 1CQTA 5FKLA 1OYWA 4R1HA 3VEPA 3M8EA 1VQPI 1FIPA 2QUFA 4CCJA 3KYDB 3SFIA 2QEXI 2JZYA 1D3YA 3W6VA 3CMMA 3WTZA 3KLNA 3PIOF 3DPUA 4IZZA 2VJIA 3SZGA 4KYWA 3U21A 3K1MA 1X3WB 2EFQA 3K4MA 2XVCA 4XNFA 3DBLB 1EH6A 4AIJA 1UAAA 1PJRA 5DCFA 5M5YJ 5IYDJ 4PSXA 2ZSHB 3MAJA 2M30A 1FX7A 3J7ZI 2JSCA 2IS4A 2YPRA 4JX6A 5FGMA 4RAYA 1O3QA 4A3CJ 1X4OA 2EZHA 3G6EI 2HVRA 3E6CC 4UB6C 1FYMA 4CCMA 2Z2SB 4U7BA 5J47A 3WHCA 3JCUC 4DQ2A 2LSOA 3JSOA 2M8EA 2CYYA 2JMWA 1XGSA 4GYIA 1MBGA 2QSGX 2DMUA 4J00A 3HGGA 4IKFA 2CW7A 3QYBA 1YI2I 1A36A 3WG9A 1SANA 4U0YA 1I6XA 4KMUX 2HOTA 1DPUA 2DOAA 2LY9A 3CJQB 3HHHA 4A3EJ 2AS5F 3PQJA 4BDYA 2WA0A 3LFKA 3RZOJ 4DYQA 3BTLA 3DEWA 2L9VA 3U1KA 1I6HJ 2DFEA 2EIJH 1YTYA 1HKQA 2CV0A 1D0YA 1H9GA 1E3HA 2P6TA 1USTA 3BR6A 2K9LA 4BUPA 1IGNA 1HKSA 4UXNA 1WFXA 2Z3YA 3CLQA 2Q8KA 5J40A 4DIQA 3CUOA 3CCVI 4X1EA 4M71A 2YX4A 3WTYC 3HXLA 3KX2A 1FSHA 4A3BJ 2PMZA 4KT5C 5E17F 4W97A 1XSXA 3AG1H 1MMDA 3BZCA 1ZN2A 4LLLA 2GM4A 2KIQA 5KVRA 5CLSA 3I58A 5HS9A 2Q2EA 3I59B 3QOEA 4RMNA 2K40A 2X1CA 2NS8A 3HPHA 3OYJA 3F21A 3L2UA 4FETA 3OYLA 2OD5A 4GYGA 2CJJA 1RPWA 4OAZA 5BPIA 3J81K 1TTYA 1KQ0A 3R61A 3MFKA 3HHGA 2ELKA 3K69A 4XLHA 1SD5A 1HW1A 4II2A 1XPXA 3ABTA 2HNHA 3HOVJ 1SMYF 4BQQA 3TO6A 3BJAA 1MNMC 5GAEJ 4MEYF 1P6RA 1JGGA 2VBWA 3HBLA 2O8KA 2QSHX 1RUNA 4ZH4F 3RJPA 5GPCA 1PDNC 4NB5A 1KZHA 1P2FA 3ZQQA 3GW2A 2LFBA 2BOLA 4RLQA 4Q5SF 1WI9A 3ESWB 4RS8A 3VOEA 3OS2A 1TNSA 1ZRFA 2VUMJ 3DXJF 4O5VA 3PIPF 3F8NA 2ZJPF 3TEDA 3V7SA 2NNNA 4TV7A 1D1CA 3HRTA 2I10A 4PUSA 1B72A 2OPTA 1U9NA 2O5RA 1X58A 1WJCA 2YUSA 3LOCA 2W85A 1JKRC 2XC7A 1TT5B 2HYFA 2CUEA 4GGGA 3VB2A 4HF2A 2VJ5A 1TZLA 4AVPA 5DTDA 2JRMA 1MH4A 3ZQIA 1QHGA 3IH2A 3GTPJ 4MQVA 3ECOA 2VE8A 4PJ0C 2IVMA 2HKOA 1ZREA 3OOUA 3RDIA 2L4MA 3QOPA 2HQ5A 4KN4X 4LIVA 3N4MA 2JVGA 1BR4A 3F72A 1K6YA 1WJAA 1Y1VJ 2QKLB 1J7KA 4UHTA 2EA2A 1WQ2A 3ZQHA 3IC7A 2GA1A 3PUBA 3MN2A 3REOA 4ZYGA 2WB1A 3LSIA 5LHIA 2TRTA 2CW0F 3DPTA 3CC4I 4ESJA 5C3EJ 4AUXA 1XTAA 4A3JJ 4OIPF 5GTIC 2BXYA 3IUOA 2E36A 4HNUA 3U9GA 1XX5A 5F64A 1DU6A 3BPVA 2EV5A 1I39A 4C3HJ 1YW7A 1LVKA 4L9NA 2CQXA 1Q1VA 1W1WE 3H9QA 4EJVA 1HF0A 2LYCA 5DM7F 2BXZA 4WX9A 4FE7A 2E7XA 4OIQF 5JVGF 2JA5J 2IW5A 1R71A 2KZVA 4L5IA 3Q0UA 2DFHA 1DP7P 3QP6A 2A6EF 2COBA 4AIDA 3CP8A 4EQQA 2FXAA 3L1PA 2L54A 3QPTA 3HYIA 3MKYB 2IA1A 4G7OF 3RQIA 4KJZA 3TP0A 1S29A 2R92J 1BOBA 2ZJQF 5EJCA 1MJAA 4E70A 1SAXA 1Y6IA 2AXTC 2H1LA 5KNLA 3E7LA 3F8FA 1W4MA 2GOXB 2N8GA 1VQNI 2P81A 3ZN1A 2MG4A 3OYCA 1WKMA 2A07F 4E7ZA 5CKTA 5DYMA 2MLGA 5EZHA 3ZCOA 1YS6A 1H88C 2DLLA 3OR2C 2OBPA 3PM1A 4BL0B 1BL0A 2CV1A 1RETA 2HXOA 4FQGA 4PGHA 1TBXA 2GWRA 1X1PA 1S9HA 4CGZA 3MKLA 3OYMA 1W5CC 1JGSA 4CYCB 2UWMA 1CF7B 1YG2A 5CPRB 1UFMA 3QPHA 1ZLJA 3CZ6A 3LSTA 5FD5A 3ROUA 1YE9A 4MLOA 1IN7A 4IVNA 3GFMA 2AQEA 5DDGA 2FU4A 4B3AA 2FMYA 1J2XA 3K4NA 3S32A 3BR3A 4IQ4A 2FA5A 2K27A 1JTYA 4PJLA 1OYYA 2LY1A 3M9AA 2LDUA 2CQ7A 2F5FA 2XAUA 4IEJA 4EMSA 3E1SA 3DU6A 4X6AJ 2DBBA 2R7QA 1Z7LA 3ECHA 4L9TA 4CCNA 2DODA 2M9HA 5K7HA 2BY1A 3IL2A 4GO1A 3J80Z 3MKZA 3K4CA 2V1XA 1H8AC 3FHZA 1FSEA 1T98A 3VFZA 1IZ1A 2WAFA 2X1DA 3RKQA 3HM5A 6PAXA 3FXMA 3BJOA 3B73A 3NWSA 3E5QA 1WJFA 3M8JA 3ZQ7A 3MD2A 2F5EA 2NOGA 2GAUA 2DA6A 1BIAA 2H09A 3P9IA 1VQLI 2DXIA 5E1WA 4HX7A 3T5XA 1OLTA 4LMYA 2ME0A 1SFUA 3C1DA 5GTHC 4RB0A 4BAYA 4RLFA 5FFZA 2ID3A 3TOBA 2HQAA 3DV8A 1O7LA 2HZDA 3GTGJ 1YJ9I 2PMUA 3GCMA 5HNFA 5J4YA 1AKHA 2DA3A 1QZEA 1STZA 3ERED 2F2EA 1BC8C 1ITYA 2P5LC 1C0WA 1FYKA 1JHHA 1K78A 4HAMA 4LGWA 3GXOA 1D0XA 4B8XA 1U8BA 2LREA 3DU5A 4M6YA 2JK3A 2VI6A 3ZXSA 1CGPA 4HSTA 3JRBA 4AYBA 2LR8A 3M7GA 5FLMJ 5J4VA 3EPZA 4A6EA 4U0WA 3FK7A 3CCMI 1W0UA 2LKSA 3WTUC 1VF9A 3K4JA 3PNYA 1VZ0A 4WCGA 5JR3A 2VIXA 3A0BC 3E3VA 4R8HA 3PFIA 4WXCA 1X1BA 2R5YA 3M8FA 3DBHB 3V7RA 3ZMDA 3I4PA 2FQ4A 1L0OC 1V54H 3JTHA 5B1BH 3TDUC 4KA4A 1O3RA 1ORKA 2M2EA 3OYBA 1REPC 4OU0A 3S15J 2IPQX 3VSKA 1G2HA 4L9JA 2HDCA 1U5TC 2KJBA 3EUHA 4C2TA 4XOTA 1ZG5A 2BHYA 2Q2EB 5FKKA 2A69F 2WB1N 1Z1DA 2RQQA 1JHFA 1ODDA 2OU2A 5JFRA 1T0FC 1RR8C 4IQJA 1MNDA 2K86A 1YX5A 1UMQA 3J7AO 5ICCA 2A68F 4U7DA 3O8HA 3I5UA 2VXZA 3I3LA 3H5RA 1J75A 2CGPA 3PJRA 4L5EA 2P7CB 4N4NB 3HZJA 4ZDPA 1WJDA 3LA3A 5DUKA 3IRQA 3IP4B 3L9FA 2VE9A 3VYRB 5KAIC 3CMYA 2DO7A 1J9IA 5GPAA 2B0LA 5HLIA 3RKXA 3CCSI 2XGXA 4NNJA 2FUG2 4MTEA 1U5TB 1KA8A 2ZC2A 2E2JJ 2EFNA 5CYVA 1MKMA
chains in the Genus database with same CATH topology
2HQRA 2L02A 1VTNC 4I0AA 2PQ8A 1B4AA 4HYEA 4LK0F 2P6SA 1KYZA 1NHAA 2XASA 5CVRA 4GCVA 3RPQA 2O6GE 1J0RA 2HS5A 4HDUA 3H3UA 2VBZA 3GVAA 1EH7A 2W25A 4EGYA 3TDZC 4ZYDA 2PN6A 1AOYA 2LNBA 2A5YB 2ESHA 3ZMTA 2MC3A 4A12A 4PDKA 2JTVA 2DAOA 2XKPA 4EJOA 4O6JA 1B1BA 4M74A 4XLPF 4KICA 4KN7X 1O3SA 1BC7C 2DT5A 2VT3A 4Y13A 3RKYA 5A2QK 2EB7A 3WU0A 2V9VA 2P5VA 1KU3A 3EETA 1ONVA 4KIFA 2FBKA 1QO0D 4M6XA 1FNNA 4EM2A 2CSOA 3KEOA 1BI1A 2O8XA 4R79A 2VC0A 3JAMZ 1QZYA 1HSTA 5CVIA 2QVOA 5J8FA 2ZBKA 1XCVA 5LRSA 1LNWA 4N0BA 5H20A 3T8TA 3IKTA 3RTRA 3T0YA 1R7JA 3E5UA 4IRGA 3FZVA 3RPUA 2DQRA 5AONA 1MDMB 2STWA 5D4SA 1KQ8A 3KP7A 2QWWA 4M72A 2GXBA 1G3WA 3B02A 2PFBA 2XROA 3JW4A 1ZGAA 5ILVA 2Z99A 3BROA 2O03A 1D8KA 3FMRA 3EYIA 3JSPA 4MTDA 4BHPA 2V6CA 1IAWA 1KQ9A 2XHKA 2D2WA 2RKHA 4ZZLA 2OAZA 3T1BA 2H6BA 2K4JA 4P55A 1R1VA 3WTWC 4Z2YA 3WODF 5D5XB 1IN8A 4UV8A 3COAC 3KZYA 4OOIA 3NQOA 1RUOA 2EJRA 2BE5F 2XAQA 4I01A 5JHUA 3L00A 2Z9OA 5E8IA 2VN2A 2COMA 3IRRA 1IXCA 2DI3A 1ULYA 4ESBA 1FP1D 5DD8A 3U2RA 3SZPA 4MEXF 4ENJA 3SFZA 1B9NA 3WU1B 1IF1A 4ZZDA 2ZKZA 1USSA 1TW3A 4WWCA 1UHWA 1GXQA 2BYVE 2P8TA 2J5OA 2XV4S 2WWYA 2EV6A 2KKOA 3TGNA 5ERIA 3QU3A 2IT0A 2K7LA 1W7PA 4L0YB 2OA4A 4AD9A 4NHJA 4HW0A 2XAHA 1U6GA 5JI6A 2P5KA 1R58A 2RNJA 1XN7A 1YFHA 3GWZA 2WV0A 2QZ8A 5LLQA 5KK1A 5LEJA 1FWZA 1PUEE 4OINF 4LLNA 1FC3A 1D5VA 3CUQA 3O6BB 4ZYHA 4I02A 4M9ZA 2BEOA 1OKRA 4IHTA 5IT9K 2RN7A 1IN6A 3BP8A 1F1ZA 2A61A 2NAZA 2W84A 3LWFA 4UV9A 1MJ9A 5D4RA 2LF8A 3MZHA 3LAPA 3GFLA 1BI2A 5L3FA 3RKWA 3H3ZA 4CDGA 2H27A 2VC1A 3IHUA 4EM1A 3QRFF 3F6OA 3F3XA 3R0JA 3DEUA 4YFNF 4LG0B 2ZJ2A 1YIOA 1S3JA 1KU2A 3MWMA 1XDSA 1H9TA 5FB2A 1UHMA 3QAHA 1QQIA 1FLIA 4M9SA 4WXHA 2VBXA 2MH9A 3FM5A 2EA4A 2RGVA 3K0LA 4KIGA 3WE3A 5HVQC 1O3TA 4Y15A 3ZP5A 4JK1X 2IJLA 4A2UA 2KRFA 2AXLA 2HR3A 2HKXA 3TQNA 5FO5A 5ILUA 1EH8A 4LFUA 3FF5A 1T6SA 3ZMZA 1IN5A 1B9MA 2HGCA 5H6RA 2BBYA 1LVAA 4FHTA 1E17A 5A2QZ 4QWQA 1U2WA 2ZFWA 1SFEA 4MNUA 1MJBA 2R7FA 3CDHA 4G6QA 4KNYA 1R5GA 1ZAOA 1BOAA 4Q48A 1LDJA 2OQRA 3WTVC 3C7JA 1HSJA 3O3KA 1IRGA 1H0MA 4JQFA 2EFOA 2FRHA 2GXGA 4A0ZA 3GZ6A 3KP3A 3NEUA 4BNCA 4IJAA 4UVBA 1KU7A 3I0TA 1MD0A 1SFXA 4EM0B 4MHGA 3HSEA 1XMAA 2VT2A 1DUXC 3P7NA 1HQCA 3KLOA 4BHCA 3I53A 2Y75A 2UZKA 1QBJA 3RYPA 2OZ6A 1LQ1A 4A0XA 2MLKA 4HLXA 4RAZA 1W5SA 4CYDA 3RIRA 4D0PA 5D5VB 4ESFA 2G9WA 1IUYA 3C3WA 3VODA 2FEZA 1P4WA 1Z9CA 2HQNA 3F22A 1ZARA 1ZHFA 1XSVA 2ZMEA 3IWZA 2E7WA 2WTEA 3TO9A 1U8RA 2QENA 2NNYA 3V8JA 2D45A 3GYHX 3DQVC 3WGGA 3E6MA 3BZ6A 2GZWA 1QPMA 3LAJA 4RGUA 1RZ4A 3EYYA 5FFXA 3GF2A 2NS0A 4G94A 3RI4A 2ACJA 1RI7A 5ICGA 3ELKA 4EGZA 2M87A 4MQ9F 2CFXA 4EJUA 4BYYA 2D1VA 3KFWX 4QLCU 4RGSA 2H6CA 3F8BA 4LB5A 1B6AA 1S6LA 3KETA 4BHBA 2CG4A 3HUGA 3QU6A 5L3CA 2GIVA 2XAGA 3ULQB 5HDKA 3FMSA 3CO6C 1Z6RA 2ETHA 4U0VA 4HQEA 3P9CA 5D8KB 2YU3A 3DPLC 3CTAA 4HZFA 1F4KA 4HQMA 2R3SA 2V1UA 1W5TA 3WTSC 3ABUA 1Z91A 5CJ9A 4YG2F 3ZMSA 2E1NA 2P7VB 1KGSA 2BGCA 3FXQA 2FSWA 3HSFA 4I98B 1IXRC 2X0LA 1ZGJA 4ASNA 4Y17A 3GO5A 1XCBA 2TDXA 4N9IA 1IN4A 5TRDA 1BN5A 3C18A 2QYOA 3EQLF 1ZRDA 2O0YA 3GLXA 3TKYA 2PMHA 5L3BA 2X4HA 1YW9A 3R4KA 1HXDA 4B09A 4EV0A 5LGUA 2G7HA 4HDVA 5HS7A 1E2XA 1FP2A 5LGNA 3SXYA 2QLZA 4HX4A 2A6HF 3J81Z 5H6QA 2XIGA 2VONA 3TO7A 1YQAA 4PGGA 2PJPA 4WK8F 3M1EA 3CO7C 4KIBA 2JRTA 4HBLA 1DPRA 5L3GA 3E5XA 1AWCA 1LDDA 1XDUA 3KCCA 1HW5A 4UNOA 2FQ3A 1KU9A 4EJTA 3ISPA 4LB6B 3FWEA 1R23A 5CVUA 2L01A 3KP5A 1R1TA 3OV8A 1I5ZA 2VOPA 2DK5A 4S04A 2KIFA 1Y0UA 4P5OA 1HBXG 1XD7A 3V4GA 3IWFA 1P4AA 5LRRA 4GXOA 4LLGF 2O3FA 2Y48A 3BY6A 2ZCWA 3W6KB 2EWNA 3V8LA 3HRSA 2EK5A 2HEOA 2KIUA 3O2PE 2HTSA 4I0BA 1TQIA 5E20A 2VOOA 5ICEA 2HFHA 2PI0A 4L18B 3HTUA 5D6FA 5DV5A 4H0EA 4FX0A 4IF4A 4P9UA 1G3SA 1IW7F 2Q0OA 2HOEA 2XUBA 1SD6A 3HRUA 4UVAA 1PP7U 3L2CA 1LB2A 3GZ5A 2Z33A 4G8XA 1B59A 5HOOA 3S2WA 4JBAA 4LK1F 1ON1A 4AIHA 4G7HF 3I54A 5CVVA 5HDNA 1RNLA 3HOSA 5CVJA 4CICA 3D5LA 2V1DA 1YO5C 1T39A 2M5WA 1T2KA 4PCQA 1K78B 4F7ZA 5DEQA 1WWXA 2VODA 2DU9A 3Q5FA 2MH2A 1FBSA 3CJNA 4AWXB 4L9VA 1J5YA 4FX4A 5HS8A 1I27A 1FT9A 3MQ0A 4YIFA 5BPDA 5L3DA 2XRNA 5FD6A 3FXRA 3U1DA 5E18F 3GFJA 5HLHA 2PEXA 2XAJA 3T8RA 5JVTA 3LA7A 2RC4A 3KP2A 1FYLA 5D6EA 1I1GA 1YS7A 1TW2A 1GHCA 3K9TA 2D1HA 3LA2A 4XRFA 2ELHA 4S05A 4EVIA 3F8MA 2IP2A 5D8LB 3WGHA 2MD5A 1LEAA 1JE8A 2NYXA 4RGRA 4U88A 4OIRF 3GX4X 2DQLA 3GUDA 1FBUA 2JT1A 3E97A 2L3DA 5J6XA 1EV7A 1YYVA 2ADUA 1S8NA 1XMKA 5E1ZB 1FZPB 1XGNA 2FMLA 4BH9A 2KJCA 1F5TA 4P96A 3KE2A 3BPXA 1BBYA 1MGTA 3WTXC 4Q47A 3G73A 1R1UA 1S7OA 2L4AA 2OQGA 4G9YA 4K2EA 4A0YA 5BOXA 5HLGA 4AIKA 3HOTA 2IRFG 2F5CA 1XGMA 3F8CA 3DP7A 4EJWA 3F6VA 2QBYA 2GA2A 1PP8F 2Y0MA 1YLFA 1V3FA 4CO8A 1Z05A 5D5WB 5DD4A 1U5TA 1ZRCA 3EDPA 1T0FA 5LHGA 4BQAA 1FOKA 5IT3A 4I2OA 1HW2A 2RVCA 3FXUA 2DW4A 1R22A 2STTA 4CHUA 2NRAC 2H94A 4MGRA 1ZLKA 4A5MA 2OZUA 1LEBA 4N9HA 1GXPA 5BQTA 4OMZA 2RV8A 1X3UA 2UXXA 4UUVA 4O3MA 2ZNZA 5EEGA 1P92A 3K2ZA 2E1CA 5ILSA 1D8JA 3L7WA 4XSZF 3V8KA 3WTTC 1I1SA 2GQQA 3JAMK 2CWEA 2HZTA 2QQAA 2J5PA 1JXSA 4BXUA 1O7FA 4I7HA 1DDNA 3QP5A 1KYWA 3HIFA 1Q1HA 3I71A 2DK8A 5ED4A 4HF0A 4A5NA 3BJ6A 3ML6A 5FLXK 2CO5A 4LJZF 4WF2A 4HV5A 1LJ9A 5AIPA 1BI3A 5AIQA 2EFWA 1J59A 4M9XA 4KDPA 4HLYA 5DUIA 2YSRA 4OIOF 1MDMA 1ZG3A 2PG4A 3ZMUA 2PBIA 1QNTA 4KUMA 1FY7A 4ENKA 1WSUA 1T38A 1QZZA 2FF4A 5K5OA 4RB3C 2R7DA 3FX3A 2F5DA 2PLYA 1ZYRF 1RIOH 1FBQA 1OMIA 3H92A 3CLOA 5L3EA 3ZPLA 5DCMA 4P9FA 2YX7A 3SZTA 2ISZA 3WGIA 2K02A 4IHSA 1OYIA 1U3EM 1G4DA 3CUQC 4ON0A 4L5JA 1XSDA 1FPQA 1TLHB 1R36A 4NQWA 1W7PB 4KMFA 2XAFA 5K5RA 1R00A 3E6DA 3MZYA 1Z7UA 1OPCA 3BWGA 4HV6A 1U78A 1ON2A 1A04A 3CUQB 5TJJA 1G3YA 1QGPA 5HDGA 1OR7A 4Q4ZF 4PZJA 1BJAA 3NRVA 1HKTA 3HSRA 4CXFA 5EEHA 2WC2A 3AAFA 3F23A 3LQQA 4ENMA 1IXSB 1TQPA 3ZMVA 5F6FA 5LGTA 2C6YA 2EFPA 3TOAA 4UVCA 4FT8A 5J8CA 4L0ZB 3K1NA 4KFCA 2LF7A 3SQNA 3Q9VA 1K79A 1S7AA 5LHHA 3W6JB 3N97A 4DNCA 1K6OA 4XSXF 5IT9Z 2QBYB 3R0AA 4CZZA 5D5UB 3JTGA 3HRMA 3R60A 2QQ9A 4OMYA 1V4RA 1BM9A 5LEKA 2MBFA 2FNPA 3G3ZA 2BV6A 1R5HA 4RB1A 2FOKA 2Z5UA 2FNAA 2FBIA 3DF8A 3I59A 1Z6TA 3L09A 4IRIA 1YW8A 5E8GA 2YR2A 2G7UA 4HF1A 3ZN0A 5F1RA 3KP4A 3P9KA 2M1BA 3RYRA 1BIBA 1O57A 2XKOA 1UCRA 1SD7A 3E6BA 4LG0A 3KP6A 4G6DA 1XGOA 2ZNYA 3KZZA 2JPCA 4I09A 1LDKB 3K1PA 2A3SA 3V7CA 2FE3A 4ZYEA 4RGXA 2RDPA 2HWVA 3HTSB 2MA3A 2KIMA 2IA0A 1TQMA 2IA2A 3OOPA 1P4XA 2RQPA 2O61A 4HOBA 2K4BA 3Q9SA 3DKWA 5E1XA 3BOQA 3KEQA 3I64A 2HTJA 2DTRA 1K7AA 1IRFA 2UXNA 1W7PD 5ICFA 5LBQA 2P4WA 1GVJA 2M45A 5BS6A 3SHFA 1XB4A 3GEZA 2ESNA 4IXAA 2DFIA 4YFKF 2ZO4A 2ZMEB 4WXDA 2VBYA 4G7ZF 1SD4A 3FM3A 2JPBA 4HA8A 2ZXJA 1UB9A 3MCZA 5K5QA 1BI0A 4YFXF 1G6NA 2FBHA 5FLXZ 3BDDA 3R6SA 2LKPA 4ENNA 1MZBA 4LD5A 1ZG1A 1L3LA 3IKVA 3FMQA 4HX8A 4RB2C 2DPDA 2QQBA 4M73A 4IPAA 2W24A 4A6DA 1F9NA 1TNTA 1ZH5A 2W57A 4XLNF 2EV0A 5DCMB 3D0SA 2V79A 2QM3A 3GFIA 4YIIA 4XBFA 3PQKA 3J80K 2ISYA 4IRHA 2HYGD 1SMTA 1CF7A 3WE2A 4ETSA 1WRJA 3LQRA 2DPUA 5K1YA 3MEXA 5BMZA 2CQKA 1G3TA 3DFGA 1OYWA 4R1HA 3VEPA 3M8EA 2QUFA 2JZYA 1D3YA 3WTZA 3KLNA 4KYWA 3K1MA 2EFQA 2XVCA 1EH6A 4AIJA 5DCFA 3MAJA 2M30A 1FX7A 2JSCA 2YPRA 5FGMA 4RAYA 1O3QA 3E6CC 1FYMA 4U7BA 4DQ2A 2LSOA 3JSOA 2M8EA 2CYYA 1XGSA 4GYIA 3WG9A 4U0YA 1I6XA 4KMUX 1DPUA 3HHHA 2AS5F 3PQJA 3LFKA 1YTYA 1HKQA 1H9GA 2P6TA 1USTA 1HKSA 4UXNA 2Z3YA 2Q8KA 3CUOA 4M71A 2YX4A 3WTYC 1FSHA 4KT5C 5E17F 1XSXA 1ZN2A 4LLLA 5KVRA 5CLSA 3I58A 5HS9A 2Q2EA 3I59B 3F21A 2OD5A 4GYGA 5BPIA 3J81K 1TTYA 1KQ0A 3R61A 3MFKA 3HHGA 3K69A 1SD5A 1HW1A 3ABTA 1SMYF 3TO6A 3BJAA 4MEYF 1P6RA 2VBWA 1RUNA 4ZH4F 3RJPA 1PDNC 4NB5A 1P2FA 3GW2A 4Q5SF 1WI9A 4RS8A 3VOEA 1TNSA 1ZRFA 3DXJF 4O5VA 3F8NA 3V7SA 2NNNA 4TV7A 3HRTA 2W85A 2HYFA 4GGGA 3VB2A 4HF2A 4AVPA 4MQVA 3ECOA 2VE8A 2IVMA 2HKOA 1ZREA 3RDIA 2L4MA 3QOPA 4KN4X 3N4MA 3F72A 1J7KA 4UHTA 2EA2A 1WQ2A 3IC7A 2GA1A 3REOA 4ZYGA 5LHIA 2CW0F 3DPTA 4ESJA 4OIPF 3U9GA 5F64A 3BPVA 2EV5A 1YW7A 4L9NA 4EJVA 4WX9A 2E7XA 4OIQF 2IW5A 4L5IA 1DP7P 3QP6A 2A6EF 4EQQA 2FXAA 2L54A 3QPTA 3HYIA 2IA1A 4G7OF 1S29A 1MJAA 4E70A 1SAXA 3F8FA 1W4MA 3ZN1A 1WKMA 2A07F 5DYMA 2MLGA 1YS6A 2DLLA 2OBPA 4PGHA 1TBXA 2GWRA 4CGZA 1JGSA 2UWMA 1CF7B 1YG2A 1UFMA 3QPHA 1ZLJA 3LSTA 5FD5A 3ROUA 1IN7A 4IVNA 3GFMA 5DDGA 2FU4A 2FMYA 1J2XA 2FA5A 2K27A 1OYYA 3M9AA 2LDUA 2F5FA 4EMSA 2DBBA 3ECHA 4L9TA 3IL2A 4GO1A 3J80Z 2V1XA 3FHZA 1FSEA 1T98A 3VFZA 1IZ1A 6PAXA 3BJOA 3B73A 3E5QA 3ZQ7A 2F5EA 2GAUA 1BIAA 2H09A 3P9IA 5E1WA 4HX7A 3T5XA 4LMYA 1SFUA 3C1DA 4RB0A 4BAYA 5FFZA 3TOBA 3DV8A 1O7LA 2PMUA 1STZA 3ERED 2F2EA 1BC8C 2P5LC 1C0WA 1FYKA 1JHHA 1K78A 4HAMA 4LGWA 3GXOA 4B8XA 4M6YA 1CGPA 3M7GA 4A6EA 4U0WA 3WTUC 4WCGA 5JR3A 3E3VA 4R8HA 3PFIA 4WXCA 3M8FA 3V7RA 3ZMDA 3I4PA 4KA4A 1L0OC 3JTHA 3TDUC 1O3RA 1REPC 4OU0A 2IPQX 4L9JA 2HDCA 1U5TC 2KJBA 3EUHA 1ZG5A 2A69F 1Z1DA 1JHFA 1ODDA 2OU2A 5JFRA 2K86A 3J7AO 5ICCA 2A68F 4U7DA 3I5UA 2VXZA 1J75A 2CGPA 2P7CB 3IRQA 3LA3A 5DUKA 3L9FA 2VE9A 2DO7A 1J9IA 2B0LA 5HLIA 3RKXA 2XGXA 4MTEA 1U5TB 1KA8A 2EFNA 5CYVA 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQR A;  2L02 A;  1VTN C;  4I0A A;  2PQ8 A;  1B4A A;  4HYE A;  4LK0 F;  2P6S A;  1KYZ A;  1NHA A;  2XAS A;  5CVR A;  4GCV A;  3RPQ A;  2O6G E;  1J0R A;  2HS5 A;  4HDU A;  3H3U A;  2VBZ A;  3GVA A;  1EH7 A;  2W25 A;  4EGY A;  3TDZ C;  4ZYD A;  2PN6 A;  1AOY A;  2LNB A;  2A5Y B;  2ESH A;  3ZMT A;  2MC3 A;  4A12 A;  4PDK A;  2JTV A;  2DAO A;  2XKP A;  4EJO A;  4O6J A;  1B1B A;  4M74 A;  4XLP F;  4KIC A;  4KN7 X;  1O3S A;  1BC7 C;  2DT5 A;  2VT3 A;  4Y13 A;  3RKY A;  5A2Q K;  2EB7 A;  3WU0 A;  2V9V A;  2P5V A;  1KU3 A;  3EET A;  1ONV A;  4KIF A;  2FBK A;  1QO0 D;  4M6X A;  1FNN A;  4EM2 A;  2CSO A;  3KEO A;  1BI1 A;  2O8X A;  4R79 A;  2VC0 A;  3JAM Z;  1QZY A;  1HST A;  5CVI A;  2QVO A;  5J8F A;  2ZBK A;  1XCV A;  5LRS A;  1LNW A;  4N0B A;  5H20 A;  3T8T A;  3IKT A;  3RTR A;  3T0Y A;  1R7J A;  3E5U A;  4IRG A;  3FZV A;  3RPU A;  2DQR A;  5AON A;  1MDM B;  2STW A;  5D4S A;  1KQ8 A;  3KP7 A;  2QWW A;  4M72 A;  2GXB A;  1G3W A;  3B02 A;  2PFB A;  2XRO A;  3JW4 A;  1ZGA A;  5ILV A;  2Z99 A;  3BRO A;  2O03 A;  1D8K A;  3FMR A;  3EYI A;  3JSP A;  4MTD A;  4BHP A;  2V6C A;  1IAW A;  1KQ9 A;  2XHK A;  2D2W A;  2RKH A;  4ZZL A;  2OAZ A;  3T1B A;  2H6B A;  2K4J A;  4P55 A;  1R1V A;  3WTW C;  4Z2Y A;  3WOD F;  5D5X B;  1IN8 A;  4UV8 A;  3COA C;  3KZY A;  4OOI A;  3NQO A;  1RUO A;  2EJR A;  2BE5 F;  2XAQ A;  4I01 A;  5JHU A;  3L00 A;  2Z9O A;  5E8I A;  2VN2 A;  2COM A;  3IRR A;  1IXC A;  2DI3 A;  1ULY A;  4ESB A;  1FP1 D;  5DD8 A;  3U2R A;  3SZP A;  4MEX F;  4ENJ A;  3SFZ A;  1B9N A;  3WU1 B;  1IF1 A;  4ZZD A;  2ZKZ A;  1USS A;  1TW3 A;  4WWC A;  1UHW A;  1GXQ A;  2BYV E;  2P8T A;  2J5O A;  2XV4 S;  2WWY A;  2EV6 A;  2KKO A;  3TGN A;  5ERI A;  3QU3 A;  2IT0 A;  2K7L A;  1W7P A;  4L0Y B;  2OA4 A;  4AD9 A;  4NHJ A;  4HW0 A;  2XAH A;  1U6G A;  5JI6 A;  2P5K A;  1R58 A;  2RNJ A;  1XN7 A;  1YFH A;  3GWZ A;  2WV0 A;  2QZ8 A;  5LLQ A;  5KK1 A;  5LEJ A;  1FWZ A;  1PUE E;  4OIN F;  4LLN A;  1FC3 A;  1D5V A;  3CUQ A;  3O6B B;  4ZYH A;  4I02 A;  4M9Z A;  2BEO A;  1OKR A;  4IHT A;  5IT9 K;  2RN7 A;  1IN6 A;  3BP8 A;  1F1Z A;  2A61 A;  2NAZ A;  2W84 A;  3LWF A;  4UV9 A;  1MJ9 A;  5D4R A;  2LF8 A;  3MZH A;  3LAP A;  3GFL A;  1BI2 A;  5L3F A;  3RKW A;  3H3Z A;  4CDG A;  2H27 A;  2VC1 A;  3IHU A;  4EM1 A;  3QRF F;  3F6O A;  3F3X A;  3R0J A;  3DEU A;  4YFN F;  4LG0 B;  2ZJ2 A;  1YIO A;  1S3J A;  1KU2 A;  3MWM A;  1XDS A;  1H9T A;  5FB2 A;  1UHM A;  3QAH A;  1QQI A;  1FLI A;  4M9S A;  4WXH A;  2VBX A;  2MH9 A;  3FM5 A;  2EA4 A;  2RGV A;  3K0L A;  4KIG A;  3WE3 A;  5HVQ C;  1O3T A;  4Y15 A;  3ZP5 A;  4JK1 X;  2IJL A;  4A2U A;  2KRF A;  2AXL A;  2HR3 A;  2HKX A;  3TQN A;  5FO5 A;  5ILU A;  1EH8 A;  4LFU A;  3FF5 A;  1T6S A;  3ZMZ A;  1IN5 A;  1B9M A;  2HGC A;  5H6R A;  2BBY A;  1LVA A;  4FHT A;  1E17 A;  5A2Q Z;  4QWQ A;  1U2W A;  2ZFW A;  1SFE A;  4MNU A;  1MJB A;  2R7F A;  3CDH A;  4G6Q A;  4KNY A;  1R5G A;  1ZAO A;  1BOA A;  4Q48 A;  1LDJ A;  2OQR A;  3WTV C;  3C7J A;  1HSJ A;  3O3K A;  1IRG A;  1H0M A;  4JQF A;  2EFO A;  2FRH A;  2GXG A;  4A0Z A;  3GZ6 A;  3KP3 A;  3NEU A;  4BNC A;  4IJA A;  4UVB A;  1KU7 A;  3I0T A;  1MD0 A;  1SFX A;  4EM0 B;  4MHG A;  3HSE A;  1XMA A;  2VT2 A;  1DUX C;  3P7N A;  1HQC A;  3KLO A;  4BHC A;  3I53 A;  2Y75 A;  2UZK A;  1QBJ A;  3RYP A;  2OZ6 A;  1LQ1 A;  4A0X A;  2MLK A;  4HLX A;  4RAZ A;  1W5S A;  4CYD A;  3RIR A;  4D0P A;  5D5V B;  4ESF A;  2G9W A;  1IUY A;  3C3W A;  3VOD A;  2FEZ A;  1P4W A;  1Z9C A;  2HQN A;  3F22 A;  1ZAR A;  1ZHF A;  1XSV A;  2ZME A;  3IWZ A;  2E7W A;  2WTE A;  3TO9 A;  1U8R A;  2QEN A;  2NNY A;  3V8J A;  2D45 A;  3GYH X;  3DQV C;  3WGG A;  3E6M A;  3BZ6 A;  2GZW A;  1QPM A;  3LAJ A;  4RGU A;  1RZ4 A;  3EYY A;  5FFX A;  3GF2 A;  2NS0 A;  4G94 A;  3RI4 A;  2ACJ A;  1RI7 A;  5ICG A;  3ELK A;  4EGZ A;  2M87 A;  4MQ9 F;  2CFX A;  4EJU A;  4BYY A;  2D1V A;  3KFW X;  4QLC U;  4RGS A;  2H6C A;  3F8B A;  4LB5 A;  1B6A A;  1S6L A;  3KET A;  4BHB A;  2CG4 A;  3HUG A;  3QU6 A;  5L3C A;  2GIV A;  2XAG A;  3ULQ B;  5HDK A;  3FMS A;  3CO6 C;  1Z6R A;  2ETH A;  4U0V A;  4HQE A;  3P9C A;  5D8K B;  2YU3 A;  3DPL C;  3CTA A;  4HZF A;  1F4K A;  4HQM A;  2R3S A;  2V1U A;  1W5T A;  3WTS C;  3ABU A;  1Z91 A;  5CJ9 A;  4YG2 F;  3ZMS A;  2E1N A;  2P7V B;  1KGS A;  2BGC A;  3FXQ A;  2FSW A;  3HSF A;  4I98 B;  1IXR C;  2X0L A;  1ZGJ A;  4ASN A;  4Y17 A;  3GO5 A;  1XCB A;  2TDX A;  4N9I A;  1IN4 A;  5TRD A;  1BN5 A;  3C18 A;  2QYO A;  3EQL F;  1ZRD A;  2O0Y A;  3GLX A;  3TKY A;  2PMH A;  5L3B A;  2X4H A;  1YW9 A;  3R4K A;  1HXD A;  4B09 A;  4EV0 A;  5LGU A;  2G7H A;  4HDV A;  5HS7 A;  1E2X A;  1FP2 A;  5LGN A;  3SXY A;  2QLZ A;  4HX4 A;  2A6H F;  3J81 Z;  5H6Q A;  2XIG A;  2VON A;  3TO7 A;  1YQA A;  4PGG A;  2PJP A;  4WK8 F;  3M1E A;  3CO7 C;  4KIB A;  2JRT A;  4HBL A;  1DPR A;  5L3G A;  3E5X A;  1AWC A;  1LDD A;  1XDU A;  3KCC A;  1HW5 A;  4UNO A;  2FQ3 A;  1KU9 A;  4EJT A;  3ISP A;  4LB6 B;  3FWE A;  1R23 A;  5CVU A;  2L01 A;  3KP5 A;  1R1T A;  3OV8 A;  1I5Z A;  2VOP A;  2DK5 A;  4S04 A;  2KIF A;  1Y0U A;  4P5O A;  1HBX G;  1XD7 A;  3V4G A;  3IWF A;  1P4A A;  5LRR A;  4GXO A;  4LLG F;  2O3F A;  2Y48 A;  3BY6 A;  2ZCW A;  3W6K B;  2EWN A;  3V8L A;  3HRS A;  2EK5 A;  2HEO A;  2KIU A;  3O2P E;  2HTS A;  4I0B A;  1TQI A;  5E20 A;  2VOO A;  5ICE A;  2HFH A;  2PI0 A;  4L18 B;  3HTU A;  5D6F A;  5DV5 A;  4H0E A;  4FX0 A;  4IF4 A;  4P9U A;  1G3S A;  1IW7 F;  2Q0O A;  2HOE A;  2XUB A;  1SD6 A;  3HRU A;  4UVA A;  1PP7 U;  3L2C A;  1LB2 A;  3GZ5 A;  2Z33 A;  4G8X A;  1B59 A;  5HOO A;  3S2W A;  4JBA A;  4LK1 F;  1ON1 A;  4AIH A;  4G7H F;  3I54 A;  5CVV A;  5HDN A;  1RNL A;  3HOS A;  5CVJ A;  4CIC A;  3D5L A;  2V1D A;  1YO5 C;  1T39 A;  2M5W A;  1T2K A;  4PCQ A;  1K78 B;  4F7Z A;  5DEQ A;  1WWX A;  2VOD A;  2DU9 A;  3Q5F A;  2MH2 A;  1FBS A;  3CJN A;  4AWX B;  4L9V A;  1J5Y A;  4FX4 A;  5HS8 A;  1I27 A;  1FT9 A;  3MQ0 A;  4YIF A;  5BPD A;  5L3D A;  2XRN A;  5FD6 A;  3FXR A;  3U1D A;  5E18 F;  3GFJ A;  5HLH A;  2PEX A;  2XAJ A;  3T8R A;  5JVT A;  3LA7 A;  2RC4 A;  3KP2 A;  1FYL A;  5D6E A;  1I1G A;  1YS7 A;  1TW2 A;  1GHC A;  3K9T A;  2D1H A;  3LA2 A;  4XRF A;  2ELH A;  4S05 A;  4EVI A;  3F8M A;  2IP2 A;  5D8L B;  3WGH A;  2MD5 A;  1LEA A;  1JE8 A;  2NYX A;  4RGR A;  4U88 A;  4OIR F;  3GX4 X;  2DQL A;  3GUD A;  1FBU A;  2JT1 A;  3E97 A;  2L3D A;  5J6X A;  1EV7 A;  1YYV A;  2ADU A;  1S8N A;  1XMK A;  5E1Z B;  1FZP B;  1XGN A;  2FML A;  4BH9 A;  2KJC A;  1F5T A;  4P96 A;  3KE2 A;  3BPX A;  1BBY A;  1MGT A;  3WTX C;  4Q47 A;  3G73 A;  1R1U A;  1S7O A;  2L4A A;  2OQG A;  4G9Y A;  4K2E A;  4A0Y A;  5BOX A;  5HLG A;  4AIK A;  3HOT A;  2IRF G;  2F5C A;  1XGM A;  3F8C A;  3DP7 A;  4EJW A;  3F6V A;  2QBY A;  2GA2 A;  1PP8 F;  2Y0M A;  1YLF A;  1V3F A;  4CO8 A;  1Z05 A;  5D5W B;  5DD4 A;  1U5T A;  1ZRC A;  3EDP A;  1T0F A;  5LHG A;  4BQA A;  1FOK A;  5IT3 A;  4I2O A;  1HW2 A;  2RVC A;  3FXU A;  2DW4 A;  1R22 A;  2STT A;  4CHU A;  2NRA C;  2H94 A;  4MGR A;  1ZLK A;  4A5M A;  2OZU A;  1LEB A;  4N9H A;  1GXP A;  5BQT A;  4OMZ A;  2RV8 A;  1X3U A;  2UXX A;  4UUV A;  4O3M A;  2ZNZ A;  5EEG A;  1P92 A;  3K2Z A;  2E1C A;  5ILS A;  1D8J A;  3L7W A;  4XSZ F;  3V8K A;  3WTT C;  1I1S A;  2GQQ A;  3JAM K;  2CWE A;  2HZT A;  2QQA A;  2J5P A;  1JXS A;  4BXU A;  1O7F A;  4I7H A;  1DDN A;  3QP5 A;  1KYW A;  3HIF A;  1Q1H A;  3I71 A;  2DK8 A;  5ED4 A;  4HF0 A;  4A5N A;  3BJ6 A;  3ML6 A;  5FLX K;  2CO5 A;  4LJZ F;  4WF2 A;  4HV5 A;  1LJ9 A;  5AIP A;  1BI3 A;  5AIQ A;  2EFW A;  1J59 A;  4M9X A;  4KDP A;  4HLY A;  5DUI A;  2YSR A;  4OIO F;  1MDM A;  1ZG3 A;  2PG4 A;  3ZMU A;  2PBI A;  1QNT A;  4KUM A;  1FY7 A;  4ENK A;  1WSU A;  1T38 A;  1QZZ A;  2FF4 A;  5K5O A;  4RB3 C;  2R7D A;  3FX3 A;  2F5D A;  2PLY A;  1ZYR F;  1RIO H;  1FBQ A;  1OMI A;  3H92 A;  3CLO A;  5L3E A;  3ZPL A;  5DCM A;  4P9F A;  2YX7 A;  3SZT A;  2ISZ A;  3WGI A;  2K02 A;  4IHS A;  1OYI A;  1U3E M;  1G4D A;  3CUQ C;  4ON0 A;  4L5J A;  1XSD A;  1FPQ A;  1TLH B;  1R36 A;  4NQW A;  1W7P B;  4KMF A;  2XAF A;  5K5R A;  1R00 A;  3E6D A;  3MZY A;  1Z7U A;  1OPC A;  3BWG A;  4HV6 A;  1U78 A;  1ON2 A;  1A04 A;  3CUQ B;  5TJJ A;  1G3Y A;  1QGP A;  5HDG A;  1OR7 A;  4Q4Z F;  4PZJ A;  1BJA A;  3NRV A;  1HKT A;  3HSR A;  4CXF A;  5EEH A;  2WC2 A;  3AAF A;  3F23 A;  3LQQ A;  4ENM A;  1IXS B;  1TQP A;  3ZMV A;  5F6F A;  5LGT A;  2C6Y A;  2EFP A;  3TOA A;  4UVC A;  4FT8 A;  5J8C A;  4L0Z B;  3K1N A;  4KFC A;  2LF7 A;  3SQN A;  3Q9V A;  1K79 A;  1S7A A;  5LHH A;  3W6J B;  3N97 A;  4DNC A;  1K6O A;  4XSX F;  5IT9 Z;  2QBY B;  3R0A A;  4CZZ A;  5D5U B;  3JTG A;  3HRM A;  3R60 A;  2QQ9 A;  4OMY A;  1V4R A;  1BM9 A;  5LEK A;  2MBF A;  2FNP A;  3G3Z A;  2BV6 A;  1R5H A;  4RB1 A;  2FOK A;  2Z5U A;  2FNA A;  2FBI A;  3DF8 A;  3I59 A;  1Z6T A;  3L09 A;  4IRI A;  1YW8 A;  5E8G A;  2YR2 A;  2G7U A;  4HF1 A;  3ZN0 A;  5F1R A;  3KP4 A;  3P9K A;  2M1B A;  3RYR A;  1BIB A;  1O57 A;  2XKO A;  1UCR A;  1SD7 A;  3E6B A;  4LG0 A;  3KP6 A;  4G6D A;  1XGO A;  2ZNY A;  3KZZ A;  2JPC A;  4I09 A;  1LDK B;  3K1P A;  2A3S A;  3V7C A;  2FE3 A;  4ZYE A;  4RGX A;  2RDP A;  2HWV A;  3HTS B;  2MA3 A;  2KIM A;  2IA0 A;  1TQM A;  2IA2 A;  3OOP A;  1P4X A;  2RQP A;  2O61 A;  4HOB A;  2K4B A;  3Q9S A;  3DKW A;  5E1X A;  3BOQ A;  3KEQ A;  3I64 A;  2HTJ A;  2DTR A;  1K7A A;  1IRF A;  2UXN A;  1W7P D;  5ICF A;  5LBQ A;  2P4W A;  1GVJ A;  2M45 A;  5BS6 A;  3SHF A;  1XB4 A;  3GEZ A;  2ESN A;  4IXA A;  2DFI A;  4YFK F;  2ZO4 A;  2ZME B;  4WXD A;  2VBY A;  4G7Z F;  1SD4 A;  3FM3 A;  2JPB A;  4HA8 A;  2ZXJ A;  1UB9 A;  3MCZ A;  5K5Q A;  1BI0 A;  4YFX F;  1G6N A;  2FBH A;  5FLX Z;  3BDD A;  3R6S A;  2LKP A;  4ENN A;  1MZB A;  4LD5 A;  1ZG1 A;  1L3L A;  3IKV A;  3FMQ A;  4HX8 A;  4RB2 C;  2DPD A;  2QQB A;  4M73 A;  4IPA A;  2W24 A;  4A6D A;  1F9N A;  1TNT A;  1ZH5 A;  2W57 A;  4XLN F;  2EV0 A;  5DCM B;  3D0S A;  2V79 A;  2QM3 A;  3GFI A;  4YII A;  4XBF A;  3PQK A;  3J80 K;  2ISY A;  4IRH A;  2HYG D;  1SMT A;  1CF7 A;  3WE2 A;  4ETS A;  1WRJ A;  3LQR A;  2DPU A;  5K1Y A;  3MEX A;  5BMZ A;  2CQK A;  1G3T A;  3DFG A;  1OYW A;  4R1H A;  3VEP A;  3M8E A;  2QUF A;  2JZY A;  1D3Y A;  3WTZ A;  3KLN A;  4KYW A;  3K1M A;  2EFQ A;  2XVC A;  1EH6 A;  4AIJ A;  5DCF A;  3MAJ A;  2M30 A;  1FX7 A;  2JSC A;  2YPR A;  5FGM A;  4RAY A;  1O3Q A;  3E6C C;  1FYM A;  4U7B A;  4DQ2 A;  2LSO A;  3JSO A;  2M8E A;  2CYY A;  1XGS A;  4GYI A;  3WG9 A;  4U0Y A;  1I6X A;  4KMU X;  1DPU A;  3HHH A;  2AS5 F;  3PQJ A;  3LFK A;  1YTY A;  1HKQ A;  1H9G A;  2P6T A;  1UST A;  1HKS A;  4UXN A;  2Z3Y A;  2Q8K A;  3CUO A;  4M71 A;  2YX4 A;  3WTY C;  1FSH A;  4KT5 C;  5E17 F;  1XSX A;  1ZN2 A;  4LLL A;  5KVR A;  5CLS A;  3I58 A;  5HS9 A;  2Q2E A;  3I59 B;  3F21 A;  2OD5 A;  4GYG A;  5BPI A;  3J81 K;  1TTY A;  1KQ0 A;  3R61 A;  3MFK A;  3HHG A;  3K69 A;  1SD5 A;  1HW1 A;  3ABT A;  1SMY F;  3TO6 A;  3BJA A;  4MEY F;  1P6R A;  2VBW A;  1RUN A;  4ZH4 F;  3RJP A;  1PDN C;  4NB5 A;  1P2F A;  3GW2 A;  4Q5S F;  1WI9 A;  4RS8 A;  3VOE A;  1TNS A;  1ZRF A;  3DXJ F;  4O5V A;  3F8N A;  3V7S A;  2NNN A;  4TV7 A;  3HRT A;  2W85 A;  2HYF A;  4GGG A;  3VB2 A;  4HF2 A;  4AVP A;  4MQV A;  3ECO A;  2VE8 A;  2IVM A;  2HKO A;  1ZRE A;  3RDI A;  2L4M A;  3QOP A;  4KN4 X;  3N4M A;  3F72 A;  1J7K A;  4UHT A;  2EA2 A;  1WQ2 A;  3IC7 A;  2GA1 A;  3REO A;  4ZYG A;  5LHI A;  2CW0 F;  3DPT A;  4ESJ A;  4OIP F;  3U9G A;  5F64 A;  3BPV A;  2EV5 A;  1YW7 A;  4L9N A;  4EJV A;  4WX9 A;  2E7X A;  4OIQ F;  2IW5 A;  4L5I A;  1DP7 P;  3QP6 A;  2A6E F;  4EQQ A;  2FXA A;  2L54 A;  3QPT A;  3HYI A;  2IA1 A;  4G7O F;  1S29 A;  1MJA A;  4E70 A;  1SAX A;  3F8F A;  1W4M A;  3ZN1 A;  1WKM A;  2A07 F;  5DYM A;  2MLG A;  1YS6 A;  2DLL A;  2OBP A;  4PGH A;  1TBX A;  2GWR A;  4CGZ A;  1JGS A;  2UWM A;  1CF7 B;  1YG2 A;  1UFM A;  3QPH A;  1ZLJ A;  3LST A;  5FD5 A;  3ROU A;  1IN7 A;  4IVN A;  3GFM A;  5DDG A;  2FU4 A;  2FMY A;  1J2X A;  2FA5 A;  2K27 A;  1OYY A;  3M9A A;  2LDU A;  2F5F A;  4EMS A;  2DBB A;  3ECH A;  4L9T A;  3IL2 A;  4GO1 A;  3J80 Z;  2V1X A;  3FHZ A;  1FSE A;  1T98 A;  3VFZ A;  1IZ1 A;  6PAX A;  3BJO A;  3B73 A;  3E5Q A;  3ZQ7 A;  2F5E A;  2GAU A;  1BIA A;  2H09 A;  3P9I A;  5E1W A;  4HX7 A;  3T5X A;  4LMY A;  1SFU A;  3C1D A;  4RB0 A;  4BAY A;  5FFZ A;  3TOB A;  3DV8 A;  1O7L A;  2PMU A;  1STZ A;  3ERE D;  2F2E A;  1BC8 C;  2P5L C;  1C0W A;  1FYK A;  1JHH A;  1K78 A;  4HAM A;  4LGW A;  3GXO A;  4B8X A;  4M6Y A;  1CGP A;  3M7G A;  4A6E A;  4U0W A;  3WTU C;  4WCG A;  5JR3 A;  3E3V A;  4R8H A;  3PFI A;  4WXC A;  3M8F A;  3V7R A;  3ZMD A;  3I4P A;  4KA4 A;  1L0O C;  3JTH A;  3TDU C;  1O3R A;  1REP C;  4OU0 A;  2IPQ X;  4L9J A;  2HDC A;  1U5T C;  2KJB A;  3EUH A;  1ZG5 A;  2A69 F;  1Z1D A;  1JHF A;  1ODD A;  2OU2 A;  5JFR A;  2K86 A;  3J7A O;  5ICC A;  2A68 F;  4U7D A;  3I5U A;  2VXZ A;  1J75 A;  2CGP A;  2P7C B;  3IRQ A;  3LA3 A;  5DUK A;  3L9F A;  2VE9 A;  2DO7 A;  1J9I A;  2B0L A;  5HLI A;  3RKX A;  2XGX A;  4MTE A;  1U5T B;  1KA8 A;  2EFN A;  5CYV A;  1MKM A; 
#chains in the Genus database with same CATH topology
 1SEU A;  2HQR A;  2L02 A;  1SVO A;  2LMD A;  2XDV A;  1WH5 A;  1VTN C;  4DOZ A;  4I0A A;  2ELJ A;  2PQ8 A;  3BTI A;  1B4A A;  1RR7 A;  2NOJ B;  4HYE A;  4LK0 F;  2P6S A;  1KYZ A;  3TBI A;  1NHA A;  2XAS A;  2F4O B;  4F92 B;  5CVR A;  2W82 A;  4GCV A;  3RPQ A;  4QPQ A;  2TCT A;  2O6G E;  3UNG C;  3JRA A;  3FHN A;  1J0R A;  3LSK A;  4FAS D;  3PSF A;  2HS5 A;  4HDU A;  3H3U A;  3ABL H;  2VBZ A;  3GVA A;  3HJE A;  1EH7 A;  3L2Q A;  2W25 A;  4EGY A;  3GTK J;  3TDZ C;  4ZYD A;  2WAD A;  3CCL I;  2PN6 A;  1AOY A;  2LNB A;  2A5Y B;  4Y4R A;  2EIK H;  1RC9 A;  5TGT A;  4YIR X;  2ESH A;  3ZMT A;  2MC3 A;  5M3M J;  3BZK A;  4A12 A;  1XS9 A;  5F27 A;  4E7I A;  1IJW C;  3WU2 C;  4PDK A;  2JTV A;  4MFD A;  2DAO A;  2XKP A;  4EJO A;  4O6J A;  1B1B A;  2L7F P;  4M74 A;  4XLP F;  4KIC A;  4KN7 X;  1O3S A;  1BC7 C;  2DT5 A;  2DJI A;  3IH4 A;  2VT3 A;  1MH3 A;  4BE1 A;  3BR1 A;  4HG2 A;  4Y13 A;  2CU7 A;  3RKY A;  5A2Q K;  4PK4 A;  2EB7 A;  1ETY A;  3WU0 A;  2V9V A;  4F52 A;  2CRG A;  4BXX J;  2P5V A;  1IDZ A;  1KU3 A;  1K61 A;  3EET A;  1ONV A;  1JJ8 C;  4KIF A;  3LSG A;  2FBK A;  1QO0 D;  1MIJ A;  4M6X A;  1FNN A;  4PFO A;  4EM2 A;  2CSO A;  3X2Q H;  3KEO A;  1YIJ I;  1BI1 A;  4PJN A;  2O8X A;  2KMU A;  1GLN A;  4ABZ A;  4R79 A;  4A93 J;  2VC0 A;  3JRI A;  1R49 A;  1S5L C;  3JAM Z;  1QZY A;  1HST A;  5CVI A;  2QVO A;  5J8F A;  1YRN B;  3BLY A;  2ZBK A;  3W2W A;  1TWF J;  4A3M J;  1XCV A;  5LRS A;  1LNW A;  4IL6 C;  4N0B A;  5H20 A;  4N4O B;  5B66 C;  3FBN B;  3W2A A;  3T8T A;  3IKT A;  1OIS A;  4QTR A;  3RTR A;  4EEF G;  2NVT J;  1W0T A;  2AQF A;  3T0Y A;  3SEQ A;  1R7J A;  1N75 A;  3LL7 A;  4DYR A;  3CQZ J;  1GV2 A;  4XN0 A;  2MW8 A;  1EJ9 A;  1D1B A;  1T95 A;  3E5U A;  4IRG A;  3KYL A;  3FZV A;  3RPU A;  3JRF A;  1IV6 A;  2DQR A;  2O9L A;  4AYB N;  2K9Q A;  5AON A;  1QVU A;  4A3K J;  3K4K A;  2KDO A;  1SVM A;  1MDM B;  2STW A;  5D4S A;  1KQ8 A;  4XOR A;  3KP7 A;  4IOC F;  2A5W A;  2QWW A;  4M72 A;  5DS9 A;  2KP6 A;  2RAE A;  2GXB A;  3M3Y J;  1G3W A;  4ZDL A;  3B02 A;  1PUF B;  3GTL J;  2HDW A;  4V2F A;  2PFB A;  3BG9 A;  2XRO A;  1VQ8 I;  3JW4 A;  3LFU A;  3VYS B;  4BDZ A;  1ZGA A;  2X6X A;  5ILV A;  2Z99 A;  3BRO A;  3L2W A;  2O03 A;  1D8K A;  3OYF A;  5FLV A;  5GP9 A;  1VQM I;  3FMR A;  3EYI A;  3JSP A;  4MTD A;  2XPW A;  4BHP A;  3S14 J;  2H1K A;  1DP3 A;  2V6C A;  1ENH A;  2CW8 A;  1MMS A;  1IAW A;  4A3G J;  1KQ9 A;  2PJR A;  2XHK A;  2D2W A;  2RKH A;  2M3A A;  5HLT A;  4ZZL A;  4XKV A;  2OAZ A;  4CCK A;  3T1B A;  3CME I;  2LY2 A;  2H6B A;  2K4J A;  4P55 A;  1R1V A;  3WTW C;  4D7M A;  4Z2Y A;  3BTJ A;  3LMM A;  2HU9 A;  1Y1W J;  3A2K A;  3HOZ J;  5J1U A;  1OR7 C;  3WOD F;  1HDD C;  5D5X B;  1IN8 A;  3G2B A;  4UV8 A;  3COA C;  3KZY A;  4LG3 A;  3J7Y J;  1TWA J;  1TWC J;  4OOI A;  2D5V A;  2X6Y A;  1OCT C;  3NQO A;  1FOW A;  1RUO A;  2EJR A;  1QA6 A;  3N05 A;  2CQN A;  2BE5 F;  2DMP A;  4A3L J;  2IGK A;  2XAQ A;  4I01 A;  3WHB A;  5JHU A;  3L00 A;  2LK2 A;  2Z9O A;  2UUZ A;  5E8I A;  2H8W A;  5HOD A;  2VN2 A;  2COM A;  3IRR A;  1IXC A;  1OJL A;  3O8G A;  1QRY A;  2DA2 A;  2DI3 A;  1ULY A;  3DTI A;  2E1O A;  1FP1 D;  4ESB A;  5DD8 A;  3U2R A;  5IY5 H;  2JJ7 A;  4B43 A;  4M3D A;  4IOA F;  3FIS A;  3SZP A;  2R5Y B;  2BW3 B;  4MEX F;  3NWT A;  4ENJ A;  3SFZ A;  1B9N A;  3WU1 B;  4OWR B;  1IF1 A;  2KZG A;  3S17 J;  3B6A A;  4CUG A;  4ZZD A;  2ZJR F;  2CS3 A;  2ZKZ A;  1OCO H;  2MC4 A;  3NAU A;  3G4S I;  1ACI A;  1IRX A;  1USS A;  3H36 A;  5EDN A;  3LSM A;  1TW3 A;  2VB6 A;  4WWC A;  2ICW G;  1UHW A;  1GXQ A;  3PL8 A;  2ZSI B;  1DU0 A;  4XL9 A;  4M3G A;  2BYV E;  5IP6 A;  3OYA A;  2AO9 A;  2J5O A;  2P8T A;  4W1U A;  2XV4 S;  2WWY A;  2LOO A;  4XIC A;  3S8P A;  3OYH A;  3G1O A;  2EZL A;  4HPQ A;  2EV6 A;  4XLE A;  2KKO A;  3TGN A;  2L9R A;  1D5Y A;  2Y0S A;  3PNV A;  3QWL A;  2CUF A;  5ERI A;  3QU3 A;  4J01 A;  2IT0 A;  2K7L A;  1W7P A;  4L0Y B;  1YJN I;  2CUZ A;  1VFC A;  2OA4 A;  4YEL A;  4AD9 A;  4NHJ A;  4HW0 A;  2XAH A;  1U6G A;  3OWT A;  5JI6 A;  2ECB A;  4J19 A;  2P5K A;  2K9N A;  1R58 A;  2RNJ A;  1XN7 A;  4XOP A;  3SDG A;  3S93 A;  3GWZ A;  1YFH A;  2WV0 A;  2QZ8 A;  2VQL A;  5LLQ A;  3D5S C;  5C4X J;  5KK1 A;  5LEJ A;  1FWZ A;  2ID6 A;  1AU7 A;  1PUE E;  4OIN F;  4B44 A;  4LLN A;  1FC3 A;  1D5V A;  3CUQ A;  3O6B B;  3S1R J;  4ZYH A;  2DCE A;  1VQ9 I;  4I02 A;  4M9Z A;  1RKW A;  1LE8 B;  2BEO A;  1OKR A;  5FRM A;  4IHT A;  2V1N A;  3I4M J;  3OSG A;  3UKG A;  5IT9 K;  1UHS A;  3JRC A;  2RN7 A;  4B48 A;  4CA0 A;  5FJ8 J;  1IN6 A;  2XF5 A;  4XLF A;  3BP8 A;  3NAR A;  1F1Z A;  5IYB J;  2A61 A;  2ME6 A;  2LC2 A;  2NAZ A;  4AM3 A;  2W84 A;  3G71 I;  3SYT A;  3LWF A;  5H2F C;  4IX7 A;  1LFP A;  4UV9 A;  1WJ5 A;  1MJ9 A;  5D4R A;  2LF8 A;  3MZH A;  3LAP A;  3GFL A;  1BI2 A;  5L3F A;  2EIN H;  3CES A;  2JVH A;  3RKW A;  1ETV A;  3H3Z A;  1N25 A;  4CDG A;  2H27 A;  2QA4 I;  2VC1 A;  3IHU A;  2W4S A;  3VYT B;  4EM1 A;  1N78 A;  3CCU I;  1A5J A;  3QRF F;  3F6O A;  5F04 A;  2I5U A;  3F3X A;  3R0J A;  3DEU A;  4YFN F;  5IOY A;  3A01 B;  1GUU A;  1Z21 A;  2ZJ2 A;  1BR2 A;  1YIO A;  1S3J A;  2HPM A;  4LG0 B;  1KU2 A;  4MIM A;  4M3B A;  3MWM A;  1XDS A;  1H9T A;  2LBF A;  5FB2 A;  1UHM A;  3QAH A;  1QQI A;  1FLI A;  5FKM A;  4QPO A;  4M9S A;  2IS2 A;  4WXH A;  2VBX A;  3JRG A;  2MH9 A;  4BBR J;  3FM5 A;  2EA4 A;  2RGV A;  3K0L A;  2E1M C;  4KIG A;  5FKO A;  3WE3 A;  5HVQ C;  1O3T A;  2XF7 A;  3M1C A;  4JK1 X;  2IJL A;  4Y15 A;  3ZP5 A;  2JA8 J;  3OIO A;  1TWH J;  4A2U A;  2KRF A;  2AXL A;  1JT0 A;  1NK3 P;  2HR3 A;  4D7N A;  3OYK A;  2HKX A;  3TQN A;  5FO5 A;  5ILU A;  1EH8 A;  4LFU A;  3FF5 A;  1T6S A;  3ZMZ A;  1IN5 A;  1B9M A;  2HGC A;  2DN0 A;  3ZR8 X;  3GTJ J;  3CP2 A;  5H6R A;  1MW7 A;  2BBY A;  1LVA A;  4FHT A;  2HVQ A;  4HNV A;  1E17 A;  4BJ5 C;  1WCM J;  2E1M B;  3L2R A;  2EBI A;  5A2Q Z;  4QWQ A;  1U2W A;  4E7K A;  2XRL A;  2Y30 A;  2ZFW A;  1RKT A;  3CF2 A;  4JOM A;  4UUS B;  1SFE A;  4MNU A;  1MJB A;  2R7F A;  3AKZ A;  3CDH A;  4KIS A;  1TWG J;  4G6Q A;  2CH0 A;  4KNY A;  2DA1 A;  1R5G A;  1ZAO A;  2RRE A;  1BOA A;  3HOX J;  3PNT A;  2R7Z J;  4Q48 A;  5TIS C;  1LDJ A;  2OQR A;  3FXL A;  3WTV C;  3C7J A;  1HSJ A;  2V9K A;  3O3K A;  4BY7 J;  1IRG A;  1H0M A;  2GIZ A;  4JQF A;  2EFO A;  2FRH A;  3FK6 A;  2GXG A;  2K3P A;  2X6O A;  1LFU P;  4A0Z A;  1X4P A;  2NVY J;  3GZ6 A;  4HRI A;  3KP3 A;  3NEU A;  4BNC A;  3G1L A;  4IJA A;  1U0J A;  4UVB A;  1KU7 A;  1GV5 A;  3BG5 A;  3I0T A;  3CCJ I;  1MD0 A;  3OYI A;  1SFX A;  5F0H A;  4EM0 B;  4MHG A;  4ZTJ A;  4RM3 A;  3HSE A;  1HC8 A;  1XMA A;  2VT2 A;  1I50 J;  1DUX C;  3P7N A;  1HQC A;  2X85 A;  3KLO A;  4BHC A;  1UEL B;  3I53 A;  2Y75 A;  2UZK A;  1QBJ A;  4ANJ A;  3RYP A;  2OZ6 A;  2ZXH A;  1OCR H;  1LQ1 A;  4F93 B;  4A0X A;  2MLK A;  4HLX A;  3RQ4 A;  4RAZ A;  1K83 J;  3ABM H;  1W5S A;  3GZN B;  3KYC B;  2M7A A;  1W36 C;  1ZR4 A;  2WV1 A;  4CYD A;  3RIR A;  4D0P A;  5D5V B;  4A3I J;  4ESF A;  2G9W A;  4A69 C;  3HPG A;  1IUY A;  3C3W A;  5EF6 A;  5C44 J;  3VOD A;  2Y0S N;  2FEZ A;  2PJR B;  4XRS G;  1P4W A;  1Z9C A;  2HQN A;  3F22 A;  3OY9 A;  2K85 A;  4JP0 A;  2IXS A;  1VI0 A;  1ZAR A;  5EYR A;  1ZHF A;  1MBH A;  3I4N J;  1XSV A;  2NVX J;  5EEA A;  2K3F A;  2ZME A;  2LTP A;  3IWZ A;  5IYC J;  2E7W A;  2WTE A;  1VQ7 I;  3ZRG A;  3TO9 A;  3HOW J;  1U8R A;  2DTZ A;  2QEN A;  2LRD A;  2NNY A;  3MZ8 A;  3V8J A;  2D45 A;  1R4N B;  3GYH X;  3GLL A;  4D9J A;  3DQV C;  3WGG A;  3E6M A;  3K10 A;  4XK4 A;  1KON A;  3BZ6 A;  4C9Y A;  2GZW A;  1QPM A;  3LAJ A;  2KRC A;  4RGU A;  1RZ4 A;  3EYY A;  2MFZ A;  5FFX A;  3BG3 A;  4BEH A;  2MSY A;  3GF2 A;  1SC7 A;  2NS0 A;  4G94 A;  4C3I J;  3RI4 A;  2F48 A;  2F5V A;  1FIA A;  2VPR A;  2R7O A;  2ACJ A;  2NS7 A;  1RI7 A;  5ICG A;  4CCL A;  3BG7 A;  3ELK A;  4EGZ A;  1EKE A;  4IHX A;  4KT6 A;  2CMP A;  2M87 A;  2Q1Z B;  2CFX A;  4MQ9 F;  5E3L A;  4EJU A;  2JUC A;  2QSF X;  4BYY A;  2D1V A;  2V4J C;  1F43 A;  1R9T J;  3KFW X;  4HEA 2;  4QLC U;  2Y9Z A;  2DMN A;  4RGS A;  3S1M J;  2H6C A;  3F8B A;  2V7F A;  4CH7 A;  4LB5 A;  1B6A A;  3L2V A;  5GAD J;  5DM6 F;  1S6L A;  3CC7 I;  3KET A;  2E5N A;  3CJR B;  4BHB A;  2CG4 A;  1SVL A;  4B4C A;  3FKI J;  3HUG A;  3QU6 A;  5L3C A;  2VJJ A;  4PSW A;  2GIV A;  2XAG A;  3ULQ B;  4XRM A;  5HDK A;  3FMS A;  3HL2 A;  5J3L A;  1LKX A;  1Z6R A;  3CO6 C;  2ETH A;  2XGC A;  4U0V A;  5J1Y A;  4HQE A;  2YS9 A;  1ZR2 A;  2KLO A;  3P9C A;  3P5J A;  2W7N A;  5D8K B;  3H9G A;  1E3O C;  2YU3 A;  4B3X A;  4DBQ A;  2JQ7 A;  2KQR A;  3F9K A;  2KHM A;  3DPL C;  3CTA A;  4HZF A;  1F4K A;  4HQM A;  2R3S A;  2V1U A;  1R4M B;  3OL4 A;  1W5T A;  3WTS C;  3ABU A;  1Z91 A;  1G59 A;  5FRN A;  1IC8 A;  1VND A;  3LSJ A;  4JX5 A;  5CJ9 A;  3DTE A;  4YG2 F;  3ZMS A;  2E1N A;  2OC6 A;  2P7V B;  4XON A;  1KGS A;  2BGC A;  2OUM A;  3FXQ A;  3TW7 A;  4PJJ A;  2QCO A;  2FSW A;  3HSF A;  2FX0 A;  2QQ8 A;  4I98 B;  1IXR C;  2X0L A;  3EUK L;  3I9V 2;  4M3F A;  1WJB A;  1ZGJ A;  2DA5 A;  1MBE A;  1XG1 A;  1RRJ A;  4ASN A;  2XPU A;  2E35 A;  1FOY A;  1JKP C;  2IGN A;  4Y17 A;  1OQY A;  3GO5 A;  1XCB A;  2TDX A;  3CJT B;  4N9I A;  1IN4 A;  5TRD A;  1Y39 A;  1BN5 A;  1DQU A;  2KL4 A;  2V6E A;  2DDB A;  3C18 A;  2QYO A;  3EQL F;  4PFP A;  1ZRD A;  2KRH A;  2XPV A;  1X2M A;  2O0Y A;  2EH3 A;  3GLX A;  3TKY A;  5E3M A;  2PMH A;  1JUS A;  5L3B A;  4HNT A;  2X4H A;  2EIM H;  1YW9 A;  4GFB A;  3R4K A;  4BY1 J;  5EZG A;  1HXD A;  4RA2 A;  4C2M J;  1OCZ H;  3H35 A;  3TP3 A;  4XKW A;  2IGM A;  4B09 A;  1VQ4 I;  4BBS J;  4EV0 A;  1ZTR A;  4AC0 A;  1D0Z A;  2EIL H;  5LGU A;  3DBR B;  3HC7 A;  2G7H A;  2Y69 H;  2K9S A;  4HDV A;  4CZC A;  5HS7 A;  1E2X A;  2WAQ N;  1FP2 A;  4BU2 A;  1X1D A;  5LGN A;  3SXY A;  3H0G J;  2QLZ A;  3JRD A;  4HX4 A;  2A6H F;  4C2U A;  1A31 A;  1JJ6 C;  3J81 Z;  3ZQC A;  2VL8 A;  3QYE A;  5H6Q A;  5M5X J;  3HB9 A;  2XIG A;  2VON A;  3TO7 A;  4BGD A;  1G8X A;  3BCB A;  1UJ8 A;  1YQA A;  2VAS A;  3PSI A;  1B72 B;  4PGG A;  2PJP A;  4WK8 F;  3M1E A;  3Q3S A;  3CO7 C;  2A6T A;  1NTC A;  2EPF A;  4CSW A;  4I6Z A;  4KIB A;  2JRT A;  2W1O A;  4HBL A;  2R5Z A;  1DPR A;  2M34 A;  5L3G A;  2W00 A;  3E5X A;  3K4L A;  2X9D A;  4ZYA A;  2VKV A;  3CCR I;  4IHY A;  1AWC A;  4DW6 A;  2JA6 J;  1LDD A;  1XDU A;  2B7E A;  1S72 I;  2DT6 A;  3KCC A;  1HW5 A;  4BS9 A;  1OCP A;  3CC2 I;  2EQR A;  1W36 D;  5HNH A;  4UNO A;  2FQ3 A;  1POG A;  1KU9 A;  4EJT A;  1VQO I;  3B6C A;  3ISP A;  4LB6 B;  1FMW A;  1NG7 A;  2WY8 Q;  1MMN A;  3FWE A;  3LSP A;  3HOU J;  1R23 A;  5CVU A;  3OSF A;  2VQH A;  2L01 A;  3KP5 A;  1Y8Q B;  2L2O A;  4BXF A;  1H89 C;  1R1T A;  3OV8 A;  1I5Z A;  2VOP A;  2DK5 A;  2HI3 A;  2M7B A;  4S04 A;  3VYU B;  2KIF A;  4E7H A;  3A4C A;  3AFH A;  1Y0U A;  3A03 A;  1YHQ I;  1BW5 A;  3OS1 A;  4P5O A;  4BJT A;  1HBX G;  3OIQ A;  1XD7 A;  5M5W J;  2BVL A;  2M0M A;  3V4G A;  5GAG J;  3BQY A;  1XC5 A;  3IWF A;  2LD5 A;  1P4A A;  5FRO A;  2HPI A;  4F3Q A;  1YOV B;  5LRR A;  3M4O J;  4GXO A;  4LLG F;  2O3F A;  4XLC A;  2P0W A;  2Y48 A;  5JLX A;  5E3N A;  1O4X A;  1GDT A;  3BY6 A;  1Z0X A;  1ETK A;  1HCR A;  2XSJ C;  2ZCW A;  3QPL A;  1V5G A;  3W6K B;  2E60 A;  3ERM A;  1T8I A;  2EWN A;  3RSN A;  3V8L A;  2BHZ A;  2EK5 A;  3HRS A;  2KIU A;  3O2P E;  5LD2 C;  2HEO A;  2HTS A;  2LLK A;  3ONQ A;  3S2D J;  4I0B A;  1S7E A;  3C2B A;  5F0F A;  1TQI A;  5E20 A;  4DZP A;  2R7T A;  2VOO A;  1JTX A;  3AG2 H;  5ICE A;  4XR6 A;  5IOZ A;  3OMY A;  2HFH A;  2PI0 A;  4L18 B;  2CV2 A;  1DGW Y;  3HTU A;  1LUJ B;  3FXJ A;  5D6F A;  1YIT I;  5DV5 A;  4FX0 A;  4H0E A;  4IF4 A;  1HOM A;  4P9U A;  2IEK A;  1G3S A;  2JSP A;  2KDZ A;  4AU7 A;  1IW7 F;  4BE0 A;  2XF6 A;  2CUJ A;  2Q0O A;  2L0K A;  2HOE A;  2XUB A;  3SJM A;  1SD6 A;  3HRU A;  4UVA A;  1PP7 U;  3L2C A;  4NC7 A;  1LB2 A;  3GZ5 A;  3IH3 A;  2Z33 A;  4G8X A;  1B59 A;  3M07 A;  5HOO A;  3S2W A;  5C4J J;  2NXN B;  2BY3 A;  1Y0N A;  4JBA A;  5CQE A;  5FKN A;  4LK1 F;  1ON1 A;  4CCO A;  1IO2 A;  4AIH A;  4G7H F;  1NG6 A;  1XMX A;  3I54 A;  5CVV A;  5E79 C;  2E5Z A;  3BR5 A;  2DA4 A;  1F36 A;  2ECC A;  1V5F A;  2VKH A;  3AG3 H;  2GLO A;  1RES A;  2RNG A;  5HDN A;  1RNL A;  4NBQ A;  4Y52 J;  3HOS A;  1BA5 A;  3K4B A;  5CVJ A;  4CIC A;  3AG4 H;  2YU9 J;  1VQ5 I;  3D5L A;  2VQC A;  3HUG B;  4LIU A;  1FJL A;  2V1D A;  1YO5 C;  4DYC A;  3QQA A;  1SFO J;  1ETQ A;  4DJA A;  4D5C A;  2DMQ A;  3JRE A;  2HVS A;  1T39 A;  2M5W A;  3BG6 A;  1T2K A;  1AKH B;  2MGQ A;  4PCQ A;  4V19 K;  5EG0 A;  4CYC A;  3ASO H;  1K78 B;  4F7Z A;  5DEQ A;  1X19 A;  3CCQ I;  3S3M A;  2X6W A;  4E7J A;  3EUH C;  1WWX A;  2VOD A;  2LVS A;  3OYN A;  2DU9 A;  3Q5F A;  1WI3 A;  1J09 A;  3Q0V A;  2MH2 A;  1FBS A;  3CJN A;  3FXO A;  2R7X A;  4AWX B;  4L9V A;  4XID A;  1J5Y A;  2XGE A;  4FX4 A;  3AL0 C;  1E3P A;  5HS8 A;  1I27 A;  1T56 A;  1GVD A;  1FT9 A;  3MQ0 A;  4E7S A;  4YIF A;  3FDY A;  5BPD A;  5L3D A;  2XRN A;  5FD6 A;  3FXR A;  2EZK A;  3U1D A;  1QPI A;  5E18 F;  3GFJ A;  1D1A A;  5HLH A;  3H3V K;  4E4H A;  2PEX A;  2XAJ A;  3T8R A;  5JVT A;  2R4G A;  3LA7 A;  3EUA A;  2Y9Y A;  2K5C A;  3QPS A;  4E6K G;  4XQF A;  2RC4 A;  3KP2 A;  1FYL A;  3PFY A;  5D6E A;  3CDI A;  3WG7 H;  3HDD A;  1I1G A;  1YS7 A;  1Y8R B;  1E0E A;  1TW2 A;  3GTO J;  1GHC A;  3BT9 A;  3K9T A;  2D1H A;  3LA2 A;  1I3Q J;  3H9J A;  3C2G A;  3AL0 B;  4IHW A;  4XRF A;  3H1C A;  2ELH A;  4S05 A;  4EVI A;  3F8M A;  2IP2 A;  4XMY A;  3HOY J;  5D8L B;  3BCA A;  2WY7 Q;  3WGH A;  4D1Q A;  1X1C A;  2MD5 A;  1LEA A;  1JE8 A;  2NYX A;  4RGR A;  2BVM A;  4U88 A;  4OIR F;  3GX4 X;  1ZGW A;  2DQL A;  3GUD A;  3K70 C;  4NDL A;  1FBU A;  4V2G A;  3G1M A;  1SFK A;  1WGX A;  3C2H A;  2JT1 A;  3K6G A;  1TP4 A;  3E97 A;  2L3D A;  3TW6 A;  5J6X A;  1EV7 A;  1YYV A;  4OAY A;  2ADU A;  1S8N A;  2LKX A;  1XMK A;  2HYJ A;  2L7M P;  5E1Z B;  2QF7 A;  5F1J A;  1FZP B;  2OTJ I;  1XGN A;  2FML A;  2E71 A;  4BH9 A;  1MSF C;  2EZI A;  1X1A A;  3HKZ N;  5BNG A;  2KJC A;  1TL8 A;  1F5T A;  1EA3 A;  2L5Q A;  2WAE A;  4F55 A;  4P96 A;  1LFB A;  1BW6 A;  1Z77 A;  3BPX A;  3KE2 A;  3TMO A;  4BAC A;  1BBY A;  1MGT A;  3WTX C;  4Q47 A;  3G73 A;  1R1U A;  1S7O A;  3CDL A;  1FOX A;  1P9Q C;  1A6I A;  3VPR A;  2L4A A;  3LSH A;  2OQG A;  4G9Y A;  5J1R A;  2R5Z B;  2LP0 A;  4FTH A;  4K2E A;  2VKE A;  4A0Y A;  2KIS A;  5BOX A;  4BE2 A;  4H4K C;  5HLG A;  1T08 B;  4FCY A;  4AIK A;  3HOT A;  2IRF G;  2F5C A;  1XGM A;  4EAT A;  2NVU B;  3F8C A;  3DP7 A;  4EJW A;  3ZQL A;  5KCM A;  3F6V A;  2QBY A;  2GA2 A;  1HDP A;  1YX3 A;  1OFC X;  4F91 B;  2BY2 A;  3KZI C;  5B3S H;  1PP8 F;  1ERD A;  2Y0M A;  1JUP A;  1YLF A;  1V3F A;  4CO8 A;  1Z05 A;  5D5W B;  1V55 H;  5DD4 A;  1U5T A;  3CCE I;  1ZRC A;  3EDP A;  1T0F A;  5LHG A;  4C30 A;  3JRH A;  3K7A J;  3S16 J;  4BQA A;  2V26 A;  2XSD C;  1FOK A;  1MNE A;  5IT3 A;  3CD6 I;  4I2O A;  1HA8 A;  3BR2 A;  1HW2 A;  2Z1D A;  1Z3X A;  4B47 A;  2NVQ J;  2F6C A;  2RVC A;  3FXU A;  2DW4 A;  1R22 A;  3H5A A;  4BQO A;  3OYD A;  2XB5 A;  2STT A;  4CHU A;  5EGO A;  2NRA C;  2H94 A;  3W2V A;  4MGR A;  1ZLK A;  4A5M A;  2OZU A;  1LEB A;  1K4T A;  4N9H A;  4UB8 C;  2FOW A;  1N77 A;  1Y56 A;  1GXP A;  3KEY A;  2DT7 B;  5BQT A;  3CCY A;  4OMZ A;  4UY8 I;  4ZC3 A;  2RV8 A;  3S2H J;  1X3U A;  2FD5 A;  2LH9 A;  2UXX A;  2F4M B;  3SDB A;  3V42 A;  2Z16 A;  4UUV A;  4O3M A;  1B8I A;  2ZNZ A;  5EEG A;  1P92 A;  3K2Z A;  4QSH A;  2JN6 A;  4IO9 F;  2DFF A;  1JKO C;  2E1C A;  4M3E A;  5ILS A;  2MAB A;  1D8J A;  3L7W A;  4C3J J;  4LOC A;  3DKY A;  4XSZ F;  3DCF A;  2CQQ A;  3V8K A;  3WTT C;  2PX9 A;  1JKQ C;  1I1S A;  2MYS A;  1TT0 A;  2GQQ A;  3JAM K;  2CWE A;  2HZT A;  2QQA A;  1P7J A;  2M0C A;  2ZFU A;  1UZC A;  2J5P A;  3ZQG A;  1ETW A;  1JXS A;  3VSL A;  2Y31 A;  1FTZ A;  4UUT A;  2WAQ A;  4BXU A;  1O7F A;  2R7R A;  4I7H A;  1DDN A;  1QHH D;  3QP5 A;  1ZQ3 P;  4JYK A;  1QU3 A;  1TC3 C;  1KYW A;  3HIF A;  1Q1H A;  3MMY B;  1MBJ A;  3I71 A;  1WH7 A;  2DK8 A;  2OCC H;  4NC8 A;  1GT0 C;  5ED4 A;  4HF0 A;  3S1N J;  2VQG A;  1YRN A;  4A5N A;  3BJ6 A;  3ML6 A;  3VWB A;  5FLX K;  2DJN A;  2CO5 A;  4LJZ F;  4WF2 A;  4HV5 A;  2HDD A;  3LSR A;  2R7U A;  1LJ9 A;  1Z3Y A;  4I76 A;  3S3N A;  2ZXI A;  5AIP A;  1BI3 A;  2R7W A;  4GDF A;  5AIQ A;  2E34 A;  3PO3 J;  4FIS A;  2EFW A;  1K4S A;  1WPK A;  4Y33 A;  1QVT A;  1J59 A;  4M9X A;  4KDP A;  3J7A Y;  1MMG A;  4HLY A;  2IS1 A;  5DUI A;  5E3O A;  1MBF A;  1BR1 A;  3ZOB A;  3CF5 F;  2DDA A;  2H8R A;  2YSR A;  4OIO F;  1MDM A;  5EG0 B;  2DOE A;  5GAH J;  2ZB9 A;  3H0D A;  1ZG3 A;  2L9N A;  2PG4 A;  3ZMU A;  2PBI A;  3OR1 C;  1QNT A;  4KUM A;  3QOD A;  4S0H B;  1FY7 A;  2E19 A;  4ENK A;  1WSU A;  2GOM A;  4M6V A;  1T38 A;  1PUF A;  1QZZ A;  2FF4 A;  3K70 D;  4ZTF A;  4BJ6 C;  5K5O A;  4RB3 C;  2PMZ N;  2R7D A;  3FX3 A;  4BKX A;  4I99 C;  1JT6 A;  2F5D A;  2O7O A;  2GXA A;  2M4G A;  2PLY A;  1WZ2 A;  1ZYR F;  1RIO H;  4BQN A;  3A0H C;  1FBQ A;  3A02 A;  1SAU A;  3HGY A;  4DBR A;  1OMI A;  2R0Q C;  2JWT A;  2VPL A;  3H92 A;  3GME A;  3FBI B;  3CLO A;  5L3E A;  2VXD A;  3ZPL A;  5DCM A;  3GTM J;  4XLA A;  4P9F A;  1IRZ A;  1UG2 A;  2WBM A;  2YX7 A;  3SZT A;  2B63 J;  4QIW N;  1IUF A;  2ISZ A;  1JUM A;  3GBG A;  3WGI A;  1I3A A;  1MSE C;  2DOF A;  2K02 A;  4IHS A;  1OYI A;  3DWL E;  1U3E M;  1G4D A;  4Z6Y A;  3CUQ C;  4ON0 A;  4L5J A;  5IP7 J;  4A3D J;  1XSD A;  1U9O A;  2E2H J;  1FPQ A;  1TLH B;  4ZJZ A;  1R36 A;  3GTQ J;  4NQW A;  1W7P B;  4KMF A;  2XAF A;  5F08 A;  5K5R A;  1R00 A;  3E6D A;  5IP9 J;  3MZY A;  4XM3 A;  2IS6 A;  2MD0 A;  1Z7U A;  2HOA A;  2G0E A;  2E2I J;  1IDY A;  2F4I A;  4DGW B;  3FIW A;  4II3 A;  3OIP A;  1OPC A;  1LPQ A;  1NK2 P;  3BWG A;  2LG4 A;  3D5R C;  2XB0 X;  4HV6 A;  1U78 A;  1ON2 A;  1A04 A;  3I56 I;  3CUQ B;  1VQ6 I;  5TJJ A;  1G3Y A;  2IBD A;  1QGP A;  3BTC A;  5HDG A;  1OR7 A;  2X1E A;  2X51 A;  5KHD A;  4Q4Z F;  4PZJ A;  3DLL F;  1BJA A;  3NRV A;  3H5N A;  1HKT A;  4XKC A;  3ZQF A;  3ZGK A;  3HSR A;  4CXF A;  1FEX A;  5EEH A;  1HLV A;  2BW3 A;  1DGR M;  3W3C A;  2JA2 A;  1X2N A;  2WC2 A;  3RPU D;  4Y7N J;  3BR0 A;  1JI8 A;  3FKJ A;  3AAF A;  3F23 A;  3LQQ A;  4ENM A;  1IXS B;  1TQP A;  3ZMV A;  5F6F A;  5LGT A;  2C6Y A;  3OYG A;  2EFP A;  3TOA A;  5KAF C;  4UVC A;  4FT8 A;  3KPH A;  5J8C A;  4L0Z B;  3K1N A;  4KFC A;  2LF7 A;  3SQN A;  3Q9V A;  1K79 A;  3HG9 A;  1S7A A;  5LHH A;  2DA7 A;  3K2A A;  3W6J B;  1IG7 A;  3N97 A;  4DNC A;  2LBF B;  1K6O A;  2M4K A;  4XSX F;  5IT9 Z;  2QBY B;  3R0A A;  4CZZ A;  5D5U B;  1PVE A;  3JTG A;  3HRM A;  4G6T B;  1FMV A;  3R60 A;  2X48 A;  2QQ9 A;  4U87 A;  4OMY A;  1R5I D;  1V4R A;  2DYS H;  1BM9 A;  4DZJ A;  4B1R A;  4PJM A;  1R6R A;  5LEK A;  2MBF A;  3ASN H;  4HSR A;  2FNP A;  3G3Z A;  3RZD J;  1BJZ A;  2BV6 A;  1R5H A;  4ZDO A;  3DLA A;  1MBK A;  4RB1 A;  2FOK A;  1LE8 A;  5EGO B;  2Z5U A;  4YRV A;  2FNA A;  2FBI A;  3DF8 A;  1P7I A;  3I59 A;  2I8D A;  3S1Q J;  2UV1 A;  3OL3 A;  4E7L A;  2BZT A;  2KFD A;  1Z6T A;  3L09 A;  2R93 J;  2Y2Z A;  2GBY A;  5B1A H;  3DKX A;  1YW8 A;  5E8G A;  2YR2 A;  4IRI A;  4AVZ A;  2G7U A;  5LFA A;  2JA7 J;  4HF1 A;  3ZN0 A;  4LIT A;  3ABK H;  1B8I B;  5F1R A;  3KP4 A;  3P9K A;  2M1B A;  2L7Z A;  3VDX A;  2W48 A;  4RM2 A;  3RYR A;  1BIB A;  1O57 A;  1WVR A;  3FXK A;  3OS0 A;  2ZXW H;  2OF7 A;  1A6Q A;  2XKO A;  1IV8 A;  1UCR A;  2K9M A;  2L9S A;  1SD7 A;  3DEE A;  5K7F A;  3E6B A;  3A01 A;  1FTT A;  4LG0 A;  3KP6 A;  4G6D A;  2JUG A;  1XGO A;  2ZNY A;  3KZZ A;  2JPC A;  4I09 A;  1LDK B;  3K1P A;  2A3S A;  3V7C A;  4FE4 A;  2FE3 A;  4ZYE A;  4RGX A;  2V9P A;  2RDP A;  1APL C;  2BY0 A;  3MKW B;  3IV5 A;  3DTK A;  5F0C A;  2HWV A;  3HTS B;  3OYE A;  2MA3 A;  4A3F J;  4RAF A;  2KIM A;  2DYR H;  3PO2 J;  2IA0 A;  1TQM A;  2IA2 A;  2HOS A;  3OOP A;  1P4X A;  2VKD A;  2RQP A;  1A35 A;  1PYV A;  2O61 A;  4HOB A;  2R7S A;  2KT0 A;  2XGD A;  2ZME C;  2K4B A;  3CMA I;  3Q9S A;  3DKW A;  1V5E A;  5E1X A;  3BOQ A;  2DMT A;  2L7K A;  5JHF A;  3HKZ A;  4X0G A;  5M3F J;  4G12 A;  3KEQ A;  2QKM B;  3A1Y A;  3I64 A;  4RDU A;  2HTJ A;  2DTR A;  1K7A A;  1IRF A;  2UXN A;  3PUF A;  1W7P D;  1Z67 A;  2IAI A;  2P4W A;  1GVJ A;  5ICF A;  4ITV A;  5LBQ A;  2M45 A;  5BS6 A;  3SHF A;  4P1W A;  4XKB A;  1YJW I;  1XB4 A;  1ZKG A;  4UUS A;  3GEZ A;  2ESN A;  4IXA A;  2DFI A;  3QYF A;  4YFK F;  2QGU A;  1WHU A;  2ZO4 A;  2ZME B;  2CFO A;  1OCC H;  4WXD A;  4RBO A;  2VBY A;  1AHD P;  1M1E B;  4G7Z F;  4Y3O A;  5CQG A;  3RCO A;  1SD4 A;  3FM3 A;  5B5E C;  2JPB A;  1X3Z B;  2A05 A;  3I55 I;  1MMA A;  1NH3 A;  1WJE A;  3LNQ A;  4HA8 A;  1AA7 A;  2ZXJ A;  1UB9 A;  3MCZ A;  3MVP A;  4MO7 A;  2OTL I;  2VJ4 A;  5K5Q A;  1BI0 A;  3IAM 2;  4BEH B;  3BQZ A;  4XN3 A;  1G6N A;  4YFX F;  2FBH A;  3BC8 A;  4YEJ A;  5FLX Z;  4D5F A;  3BDD A;  2R7V A;  4NC6 A;  5JLW A;  3E0J B;  5IPA A;  3R6S A;  4IHV A;  2LKP A;  1ETO A;  1ZK8 A;  1EF4 A;  4ENN A;  1MZB A;  4LD5 A;  3UR3 C;  1ZG1 A;  1L3L A;  1VQK I;  3IKV A;  3FMQ A;  4NUB A;  3JR9 A;  4HX8 A;  4RB2 C;  2DPD A;  2QQB A;  4M73 A;  1ZEL A;  4IPA A;  3SEZ A;  2W24 A;  1T33 A;  4A6D A;  1F9N A;  1TNT A;  3TL4 X;  2VLA A;  1ZH5 A;  2OV7 A;  2HXI A;  2B9S A;  3Q0W A;  2OCE A;  2W57 A;  4XLN F;  2EV0 A;  3S3O A;  5DCM B;  3D1N I;  4RAG A;  3D0S A;  2V79 A;  4JX4 A;  2QM3 A;  2M8G X;  3GFI A;  4YII A;  4XBF A;  3PQK A;  3J80 K;  1UG0 A;  2ISY A;  4IRH A;  4XRS A;  2HYG D;  1SMT A;  2OJE D;  2AHQ A;  2KPM A;  1CF7 A;  3WE2 A;  1ETX A;  3KIO A;  4ETS A;  2IGO A;  3HEF A;  1WRJ A;  3LQR A;  2DPU A;  5K7Z A;  5K1Y A;  9ANT A;  3IAS 2;  3MEX A;  4KIT B;  5BMZ A;  4GRI A;  2CQK A;  4NQW B;  4MFE A;  1G3T A;  2FJ1 A;  3F0C A;  3DFG A;  1CQT A;  5FKL A;  1OYW A;  4R1H A;  3VEP A;  3M8E A;  1VQP I;  1FIP A;  2QUF A;  4CCJ A;  3KYD B;  3SFI A;  2QEX I;  2JZY A;  1D3Y A;  3W6V A;  3CMM A;  3WTZ A;  3KLN A;  3PIO F;  3DPU A;  4IZZ A;  2VJI A;  3SZG A;  4KYW A;  3U21 A;  3K1M A;  1X3W B;  2EFQ A;  3K4M A;  2XVC A;  4XNF A;  3DBL B;  1EH6 A;  4AIJ A;  1UAA A;  1PJR A;  5DCF A;  5M5Y J;  5IYD J;  4PSX A;  2ZSH B;  3MAJ A;  2M30 A;  1FX7 A;  3J7Z I;  2JSC A;  2IS4 A;  2YPR A;  4JX6 A;  5FGM A;  4RAY A;  1O3Q A;  4A3C J;  1X4O A;  2EZH A;  3G6E I;  2HVR A;  3E6C C;  4UB6 C;  1FYM A;  4CCM A;  2Z2S B;  4U7B A;  5J47 A;  3WHC A;  3JCU C;  4DQ2 A;  2LSO A;  3JSO A;  2M8E A;  2CYY A;  2JMW A;  1XGS A;  4GYI A;  1MBG A;  2QSG X;  2DMU A;  4J00 A;  3HGG A;  4IKF A;  2CW7 A;  3QYB A;  1YI2 I;  1A36 A;  3WG9 A;  1SAN A;  4U0Y A;  1I6X A;  4KMU X;  2HOT A;  1DPU A;  2DOA A;  2LY9 A;  3CJQ B;  3HHH A;  4A3E J;  2AS5 F;  3PQJ A;  4BDY A;  2WA0 A;  3LFK A;  3RZO J;  4DYQ A;  3BTL A;  3DEW A;  2L9V A;  3U1K A;  1I6H J;  2DFE A;  2EIJ H;  1YTY A;  1HKQ A;  2CV0 A;  1D0Y A;  1H9G A;  1E3H A;  2P6T A;  1UST A;  3BR6 A;  2K9L A;  4BUP A;  1IGN A;  1HKS A;  4UXN A;  1WFX A;  2Z3Y A;  3CLQ A;  2Q8K A;  5J40 A;  4DIQ A;  3CUO A;  3CCV I;  4X1E A;  4M71 A;  2YX4 A;  3WTY C;  3HXL A;  3KX2 A;  1FSH A;  4A3B J;  2PMZ A;  4KT5 C;  5E17 F;  4W97 A;  1XSX A;  3AG1 H;  1MMD A;  3BZC A;  1ZN2 A;  4LLL A;  2GM4 A;  2KIQ A;  5KVR A;  5CLS A;  3I58 A;  5HS9 A;  2Q2E A;  3I59 B;  3QOE A;  4RMN A;  2K40 A;  2X1C A;  2NS8 A;  3HPH A;  3OYJ A;  3F21 A;  3L2U A;  4FET A;  3OYL A;  2OD5 A;  4GYG A;  2CJJ A;  1RPW A;  4OAZ A;  5BPI A;  3J81 K;  1TTY A;  1KQ0 A;  3R61 A;  3MFK A;  3HHG A;  2ELK A;  3K69 A;  4XLH A;  1SD5 A;  1HW1 A;  4II2 A;  1XPX A;  3ABT A;  2HNH A;  3HOV J;  1SMY F;  4BQQ A;  3TO6 A;  3BJA A;  1MNM C;  5GAE J;  4MEY F;  1P6R A;  1JGG A;  2VBW A;  3HBL A;  2O8K A;  2QSH X;  1RUN A;  4ZH4 F;  3RJP A;  5GPC A;  1PDN C;  4NB5 A;  1KZH A;  1P2F A;  3ZQQ A;  3GW2 A;  2LFB A;  2BOL A;  4RLQ A;  4Q5S F;  1WI9 A;  3ESW B;  4RS8 A;  3VOE A;  3OS2 A;  1TNS A;  1ZRF A;  2VUM J;  3DXJ F;  4O5V A;  3PIP F;  3F8N A;  2ZJP F;  3TED A;  3V7S A;  2NNN A;  4TV7 A;  1D1C A;  3HRT A;  2I10 A;  4PUS A;  1B72 A;  2OPT A;  1U9N A;  2O5R A;  1X58 A;  1WJC A;  2YUS A;  3LOC A;  2W85 A;  1JKR C;  2XC7 A;  1TT5 B;  2HYF A;  2CUE A;  4GGG A;  3VB2 A;  4HF2 A;  2VJ5 A;  1TZL A;  4AVP A;  5DTD A;  2JRM A;  1MH4 A;  3ZQI A;  1QHG A;  3IH2 A;  3GTP J;  4MQV A;  3ECO A;  2VE8 A;  4PJ0 C;  2IVM A;  2HKO A;  1ZRE A;  3OOU A;  3RDI A;  2L4M A;  3QOP A;  2HQ5 A;  4KN4 X;  4LIV A;  3N4M A;  2JVG A;  1BR4 A;  3F72 A;  1K6Y A;  1WJA A;  1Y1V J;  2QKL B;  1J7K A;  4UHT A;  2EA2 A;  1WQ2 A;  3ZQH A;  3IC7 A;  2GA1 A;  3PUB A;  3MN2 A;  3REO A;  4ZYG A;  2WB1 A;  3LSI A;  5LHI A;  2TRT A;  2CW0 F;  3DPT A;  3CC4 I;  4ESJ A;  5C3E J;  4AUX A;  1XTA A;  4A3J J;  4OIP F;  5GTI C;  2BXY A;  3IUO A;  2E36 A;  4HNU A;  3U9G A;  1XX5 A;  5F64 A;  1DU6 A;  3BPV A;  2EV5 A;  1I39 A;  4C3H J;  1YW7 A;  1LVK A;  4L9N A;  2CQX A;  1Q1V A;  1W1W E;  3H9Q A;  4EJV A;  1HF0 A;  2LYC A;  5DM7 F;  2BXZ A;  4WX9 A;  4FE7 A;  2E7X A;  4OIQ F;  5JVG F;  2JA5 J;  2IW5 A;  1R71 A;  2KZV A;  4L5I A;  3Q0U A;  2DFH A;  1DP7 P;  3QP6 A;  2A6E F;  2COB A;  4AID A;  3CP8 A;  4EQQ A;  2FXA A;  3L1P A;  2L54 A;  3QPT A;  3HYI A;  3MKY B;  2IA1 A;  4G7O F;  3RQI A;  4KJZ A;  3TP0 A;  1S29 A;  2R92 J;  1BOB A;  2ZJQ F;  5EJC A;  1MJA A;  4E70 A;  1SAX A;  1Y6I A;  2AXT C;  2H1L A;  5KNL A;  3E7L A;  3F8F A;  1W4M A;  2GOX B;  2N8G A;  1VQN I;  2P81 A;  3ZN1 A;  2MG4 A;  3OYC A;  1WKM A;  2A07 F;  4E7Z A;  5CKT A;  5DYM A;  2MLG A;  5EZH A;  3ZCO A;  1YS6 A;  1H88 C;  2DLL A;  3OR2 C;  2OBP A;  3PM1 A;  4BL0 B;  1BL0 A;  2CV1 A;  1RET A;  2HXO A;  4FQG A;  4PGH A;  1TBX A;  2GWR A;  1X1P A;  1S9H A;  4CGZ A;  3MKL A;  3OYM A;  1W5C C;  1JGS A;  4CYC B;  2UWM A;  1CF7 B;  1YG2 A;  5CPR B;  1UFM A;  3QPH A;  1ZLJ A;  3CZ6 A;  3LST A;  5FD5 A;  3ROU A;  1YE9 A;  4MLO A;  1IN7 A;  4IVN A;  3GFM A;  2AQE A;  5DDG A;  2FU4 A;  4B3A A;  2FMY A;  1J2X A;  3K4N A;  3S32 A;  3BR3 A;  4IQ4 A;  2FA5 A;  2K27 A;  1JTY A;  4PJL A;  1OYY A;  2LY1 A;  3M9A A;  2LDU A;  2CQ7 A;  2F5F A;  2XAU A;  4IEJ A;  4EMS A;  3E1S A;  3DU6 A;  4X6A J;  2DBB A;  2R7Q A;  1Z7L A;  3ECH A;  4L9T A;  4CCN A;  2DOD A;  2M9H A;  5K7H A;  2BY1 A;  3IL2 A;  4GO1 A;  3J80 Z;  3MKZ A;  3K4C A;  2V1X A;  1H8A C;  3FHZ A;  1FSE A;  1T98 A;  3VFZ A;  1IZ1 A;  2WAF A;  2X1D A;  3RKQ A;  3HM5 A;  6PAX A;  3FXM A;  3BJO A;  3B73 A;  3NWS A;  3E5Q A;  1WJF A;  3M8J A;  3ZQ7 A;  3MD2 A;  2F5E A;  2NOG A;  2GAU A;  2DA6 A;  1BIA A;  2H09 A;  3P9I A;  1VQL I;  2DXI A;  5E1W A;  4HX7 A;  3T5X A;  1OLT A;  4LMY A;  2ME0 A;  1SFU A;  3C1D A;  5GTH C;  4RB0 A;  4BAY A;  4RLF A;  5FFZ A;  2ID3 A;  3TOB A;  2HQA A;  3DV8 A;  1O7L A;  2HZD A;  3GTG J;  1YJ9 I;  2PMU A;  3GCM A;  5HNF A;  5J4Y A;  1AKH A;  2DA3 A;  1QZE A;  1STZ A;  3ERE D;  2F2E A;  1BC8 C;  1ITY A;  2P5L C;  1C0W A;  1FYK A;  1JHH A;  1K78 A;  4HAM A;  4LGW A;  3GXO A;  1D0X A;  4B8X A;  1U8B A;  2LRE A;  3DU5 A;  4M6Y A;  2JK3 A;  2VI6 A;  3ZXS A;  1CGP A;  4HST A;  3JRB A;  4AYB A;  2LR8 A;  3M7G A;  5FLM J;  5J4V A;  3EPZ A;  4A6E A;  4U0W A;  3FK7 A;  3CCM I;  1W0U A;  2LKS A;  3WTU C;  1VF9 A;  3K4J A;  3PNY A;  1VZ0 A;  4WCG A;  5JR3 A;  2VIX A;  3A0B C;  3E3V A;  4R8H A;  3PFI A;  4WXC A;  1X1B A;  2R5Y A;  3M8F A;  3DBH B;  3V7R A;  3ZMD A;  3I4P A;  2FQ4 A;  1L0O C;  1V54 H;  3JTH A;  5B1B H;  3TDU C;  4KA4 A;  1O3R A;  1ORK A;  2M2E A;  3OYB A;  1REP C;  4OU0 A;  3S15 J;  2IPQ X;  3VSK A;  1G2H A;  4L9J A;  2HDC A;  1U5T C;  2KJB A;  3EUH A;  4C2T A;  4XOT A;  1ZG5 A;  2BHY A;  2Q2E B;  5FKK A;  2A69 F;  2WB1 N;  1Z1D A;  2RQQ A;  1JHF A;  1ODD A;  2OU2 A;  5JFR A;  1T0F C;  1RR8 C;  4IQJ A;  1MND A;  2K86 A;  1YX5 A;  1UMQ A;  3J7A O;  5ICC A;  2A68 F;  4U7D A;  3O8H A;  3I5U A;  2VXZ A;  3I3L A;  3H5R A;  1J75 A;  2CGP A;  3PJR A;  4L5E A;  2P7C B;  4N4N B;  3HZJ A;  4ZDP A;  1WJD A;  3LA3 A;  5DUK A;  3IRQ A;  3IP4 B;  3L9F A;  2VE9 A;  3VYR B;  5KAI C;  3CMY A;  2DO7 A;  1J9I A;  5GPA A;  2B0L A;  5HLI A;  3RKX A;  3CCS I;  2XGX A;  4NNJ A;  2FUG 2;  4MTE A;  1U5T B;  1KA8 A;  2ZC2 A;  2E2J J;  2EFN A;  5CYV A;  1MKM A; 
#chains in the Genus database with same CATH homology
 2HQR A;  2L02 A;  1VTN C;  4I0A A;  2PQ8 A;  1B4A A;  4HYE A;  4LK0 F;  2P6S A;  1KYZ A;  1NHA A;  2XAS A;  5CVR A;  4GCV A;  3RPQ A;  2O6G E;  1J0R A;  2HS5 A;  4HDU A;  3H3U A;  2VBZ A;  3GVA A;  1EH7 A;  2W25 A;  4EGY A;  3TDZ C;  4ZYD A;  2PN6 A;  1AOY A;  2LNB A;  2A5Y B;  2ESH A;  3ZMT A;  2MC3 A;  4A12 A;  4PDK A;  2JTV A;  2DAO A;  2XKP A;  4EJO A;  4O6J A;  1B1B A;  4M74 A;  4XLP F;  4KIC A;  4KN7 X;  1O3S A;  1BC7 C;  2DT5 A;  2VT3 A;  4Y13 A;  3RKY A;  5A2Q K;  2EB7 A;  3WU0 A;  2V9V A;  2P5V A;  1KU3 A;  3EET A;  1ONV A;  4KIF A;  2FBK A;  1QO0 D;  4M6X A;  1FNN A;  4EM2 A;  2CSO A;  3KEO A;  1BI1 A;  2O8X A;  4R79 A;  2VC0 A;  3JAM Z;  1QZY A;  1HST A;  5CVI A;  2QVO A;  5J8F A;  2ZBK A;  1XCV A;  5LRS A;  1LNW A;  4N0B A;  5H20 A;  3T8T A;  3IKT A;  3RTR A;  3T0Y A;  1R7J A;  3E5U A;  4IRG A;  3FZV A;  3RPU A;  2DQR A;  5AON A;  1MDM B;  2STW A;  5D4S A;  1KQ8 A;  3KP7 A;  2QWW A;  4M72 A;  2GXB A;  1G3W A;  3B02 A;  2PFB A;  2XRO A;  3JW4 A;  1ZGA A;  5ILV A;  2Z99 A;  3BRO A;  2O03 A;  1D8K A;  3FMR A;  3EYI A;  3JSP A;  4MTD A;  4BHP A;  2V6C A;  1IAW A;  1KQ9 A;  2XHK A;  2D2W A;  2RKH A;  4ZZL A;  2OAZ A;  3T1B A;  2H6B A;  2K4J A;  4P55 A;  1R1V A;  3WTW C;  4Z2Y A;  3WOD F;  5D5X B;  1IN8 A;  4UV8 A;  3COA C;  3KZY A;  4OOI A;  3NQO A;  1RUO A;  2EJR A;  2BE5 F;  2XAQ A;  4I01 A;  5JHU A;  3L00 A;  2Z9O A;  5E8I A;  2VN2 A;  2COM A;  3IRR A;  1IXC A;  2DI3 A;  1ULY A;  4ESB A;  1FP1 D;  5DD8 A;  3U2R A;  3SZP A;  4MEX F;  4ENJ A;  3SFZ A;  1B9N A;  3WU1 B;  1IF1 A;  4ZZD A;  2ZKZ A;  1USS A;  1TW3 A;  4WWC A;  1UHW A;  1GXQ A;  2BYV E;  2P8T A;  2J5O A;  2XV4 S;  2WWY A;  2EV6 A;  2KKO A;  3TGN A;  5ERI A;  3QU3 A;  2IT0 A;  2K7L A;  1W7P A;  4L0Y B;  2OA4 A;  4AD9 A;  4NHJ A;  4HW0 A;  2XAH A;  1U6G A;  5JI6 A;  2P5K A;  1R58 A;  2RNJ A;  1XN7 A;  1YFH A;  3GWZ A;  2WV0 A;  2QZ8 A;  5LLQ A;  5KK1 A;  5LEJ A;  1FWZ A;  1PUE E;  4OIN F;  4LLN A;  1FC3 A;  1D5V A;  3CUQ A;  3O6B B;  4ZYH A;  4I02 A;  4M9Z A;  2BEO A;  1OKR A;  4IHT A;  5IT9 K;  2RN7 A;  1IN6 A;  3BP8 A;  1F1Z A;  2A61 A;  2NAZ A;  2W84 A;  3LWF A;  4UV9 A;  1MJ9 A;  5D4R A;  2LF8 A;  3MZH A;  3LAP A;  3GFL A;  1BI2 A;  5L3F A;  3RKW A;  3H3Z A;  4CDG A;  2H27 A;  2VC1 A;  3IHU A;  4EM1 A;  3QRF F;  3F6O A;  3F3X A;  3R0J A;  3DEU A;  4YFN F;  4LG0 B;  2ZJ2 A;  1YIO A;  1S3J A;  1KU2 A;  3MWM A;  1XDS A;  1H9T A;  5FB2 A;  1UHM A;  3QAH A;  1QQI A;  1FLI A;  4M9S A;  4WXH A;  2VBX A;  2MH9 A;  3FM5 A;  2EA4 A;  2RGV A;  3K0L A;  4KIG A;  3WE3 A;  5HVQ C;  1O3T A;  4Y15 A;  3ZP5 A;  4JK1 X;  2IJL A;  4A2U A;  2KRF A;  2AXL A;  2HR3 A;  2HKX A;  3TQN A;  5FO5 A;  5ILU A;  1EH8 A;  4LFU A;  3FF5 A;  1T6S A;  3ZMZ A;  1IN5 A;  1B9M A;  2HGC A;  5H6R A;  2BBY A;  1LVA A;  4FHT A;  1E17 A;  5A2Q Z;  4QWQ A;  1U2W A;  2ZFW A;  1SFE A;  4MNU A;  1MJB A;  2R7F A;  3CDH A;  4G6Q A;  4KNY A;  1R5G A;  1ZAO A;  1BOA A;  4Q48 A;  1LDJ A;  2OQR A;  3WTV C;  3C7J A;  1HSJ A;  3O3K A;  1IRG A;  1H0M A;  4JQF A;  2EFO A;  2FRH A;  2GXG A;  4A0Z A;  3GZ6 A;  3KP3 A;  3NEU A;  4BNC A;  4IJA A;  4UVB A;  1KU7 A;  3I0T A;  1MD0 A;  1SFX A;  4EM0 B;  4MHG A;  3HSE A;  1XMA A;  2VT2 A;  1DUX C;  3P7N A;  1HQC A;  3KLO A;  4BHC A;  3I53 A;  2Y75 A;  2UZK A;  1QBJ A;  3RYP A;  2OZ6 A;  1LQ1 A;  4A0X A;  2MLK A;  4HLX A;  4RAZ A;  1W5S A;  4CYD A;  3RIR A;  4D0P A;  5D5V B;  4ESF A;  2G9W A;  1IUY A;  3C3W A;  3VOD A;  2FEZ A;  1P4W A;  1Z9C A;  2HQN A;  3F22 A;  1ZAR A;  1ZHF A;  1XSV A;  2ZME A;  3IWZ A;  2E7W A;  2WTE A;  3TO9 A;  1U8R A;  2QEN A;  2NNY A;  3V8J A;  2D45 A;  3GYH X;  3DQV C;  3WGG A;  3E6M A;  3BZ6 A;  2GZW A;  1QPM A;  3LAJ A;  4RGU A;  1RZ4 A;  3EYY A;  5FFX A;  3GF2 A;  2NS0 A;  4G94 A;  3RI4 A;  2ACJ A;  1RI7 A;  5ICG A;  3ELK A;  4EGZ A;  2M87 A;  4MQ9 F;  2CFX A;  4EJU A;  4BYY A;  2D1V A;  3KFW X;  4QLC U;  4RGS A;  2H6C A;  3F8B A;  4LB5 A;  1B6A A;  1S6L A;  3KET A;  4BHB A;  2CG4 A;  3HUG A;  3QU6 A;  5L3C A;  2GIV A;  2XAG A;  3ULQ B;  5HDK A;  3FMS A;  3CO6 C;  1Z6R A;  2ETH A;  4U0V A;  4HQE A;  3P9C A;  5D8K B;  2YU3 A;  3DPL C;  3CTA A;  4HZF A;  1F4K A;  4HQM A;  2R3S A;  2V1U A;  1W5T A;  3WTS C;  3ABU A;  1Z91 A;  5CJ9 A;  4YG2 F;  3ZMS A;  2E1N A;  2P7V B;  1KGS A;  2BGC A;  3FXQ A;  2FSW A;  3HSF A;  4I98 B;  1IXR C;  2X0L A;  1ZGJ A;  4ASN A;  4Y17 A;  3GO5 A;  1XCB A;  2TDX A;  4N9I A;  1IN4 A;  5TRD A;  1BN5 A;  3C18 A;  2QYO A;  3EQL F;  1ZRD A;  2O0Y A;  3GLX A;  3TKY A;  2PMH A;  5L3B A;  2X4H A;  1YW9 A;  3R4K A;  1HXD A;  4B09 A;  4EV0 A;  5LGU A;  2G7H A;  4HDV A;  5HS7 A;  1E2X A;  1FP2 A;  5LGN A;  3SXY A;  2QLZ A;  4HX4 A;  2A6H F;  3J81 Z;  5H6Q A;  2XIG A;  2VON A;  3TO7 A;  1YQA A;  4PGG A;  2PJP A;  4WK8 F;  3M1E A;  3CO7 C;  4KIB A;  2JRT A;  4HBL A;  1DPR A;  5L3G A;  3E5X A;  1AWC A;  1LDD A;  1XDU A;  3KCC A;  1HW5 A;  4UNO A;  2FQ3 A;  1KU9 A;  4EJT A;  3ISP A;  4LB6 B;  3FWE A;  1R23 A;  5CVU A;  2L01 A;  3KP5 A;  1R1T A;  3OV8 A;  1I5Z A;  2VOP A;  2DK5 A;  4S04 A;  2KIF A;  1Y0U A;  4P5O A;  1HBX G;  1XD7 A;  3V4G A;  3IWF A;  1P4A A;  5LRR A;  4GXO A;  4LLG F;  2O3F A;  2Y48 A;  3BY6 A;  2ZCW A;  3W6K B;  2EWN A;  3V8L A;  3HRS A;  2EK5 A;  2HEO A;  2KIU A;  3O2P E;  2HTS A;  4I0B A;  1TQI A;  5E20 A;  2VOO A;  5ICE A;  2HFH A;  2PI0 A;  4L18 B;  3HTU A;  5D6F A;  5DV5 A;  4H0E A;  4FX0 A;  4IF4 A;  4P9U A;  1G3S A;  1IW7 F;  2Q0O A;  2HOE A;  2XUB A;  1SD6 A;  3HRU A;  4UVA A;  1PP7 U;  3L2C A;  1LB2 A;  3GZ5 A;  2Z33 A;  4G8X A;  1B59 A;  5HOO A;  3S2W A;  4JBA A;  4LK1 F;  1ON1 A;  4AIH A;  4G7H F;  3I54 A;  5CVV A;  5HDN A;  1RNL A;  3HOS A;  5CVJ A;  4CIC A;  3D5L A;  2V1D A;  1YO5 C;  1T39 A;  2M5W A;  1T2K A;  4PCQ A;  1K78 B;  4F7Z A;  5DEQ A;  1WWX A;  2VOD A;  2DU9 A;  3Q5F A;  2MH2 A;  1FBS A;  3CJN A;  4AWX B;  4L9V A;  1J5Y A;  4FX4 A;  5HS8 A;  1I27 A;  1FT9 A;  3MQ0 A;  4YIF A;  5BPD A;  5L3D A;  2XRN A;  5FD6 A;  3FXR A;  3U1D A;  5E18 F;  3GFJ A;  5HLH A;  2PEX A;  2XAJ A;  3T8R A;  5JVT A;  3LA7 A;  2RC4 A;  3KP2 A;  1FYL A;  5D6E A;  1I1G A;  1YS7 A;  1TW2 A;  1GHC A;  3K9T A;  2D1H A;  3LA2 A;  4XRF A;  2ELH A;  4S05 A;  4EVI A;  3F8M A;  2IP2 A;  5D8L B;  3WGH A;  2MD5 A;  1LEA A;  1JE8 A;  2NYX A;  4RGR A;  4U88 A;  4OIR F;  3GX4 X;  2DQL A;  3GUD A;  1FBU A;  2JT1 A;  3E97 A;  2L3D A;  5J6X A;  1EV7 A;  1YYV A;  2ADU A;  1S8N A;  1XMK A;  5E1Z B;  1FZP B;  1XGN A;  2FML A;  4BH9 A;  2KJC A;  1F5T A;  4P96 A;  3KE2 A;  3BPX A;  1BBY A;  1MGT A;  3WTX C;  4Q47 A;  3G73 A;  1R1U A;  1S7O A;  2L4A A;  2OQG A;  4G9Y A;  4K2E A;  4A0Y A;  5BOX A;  5HLG A;  4AIK A;  3HOT A;  2IRF G;  2F5C A;  1XGM A;  3F8C A;  3DP7 A;  4EJW A;  3F6V A;  2QBY A;  2GA2 A;  1PP8 F;  2Y0M A;  1YLF A;  1V3F A;  4CO8 A;  1Z05 A;  5D5W B;  5DD4 A;  1U5T A;  1ZRC A;  3EDP A;  1T0F A;  5LHG A;  4BQA A;  1FOK A;  5IT3 A;  4I2O A;  1HW2 A;  2RVC A;  3FXU A;  2DW4 A;  1R22 A;  2STT A;  4CHU A;  2NRA C;  2H94 A;  4MGR A;  1ZLK A;  4A5M A;  2OZU A;  1LEB A;  4N9H A;  1GXP A;  5BQT A;  4OMZ A;  2RV8 A;  1X3U A;  2UXX A;  4UUV A;  4O3M A;  2ZNZ A;  5EEG A;  1P92 A;  3K2Z A;  2E1C A;  5ILS A;  1D8J A;  3L7W A;  4XSZ F;  3V8K A;  3WTT C;  1I1S A;  2GQQ A;  3JAM K;  2CWE A;  2HZT A;  2QQA A;  2J5P A;  1JXS A;  4BXU A;  1O7F A;  4I7H A;  1DDN A;  3QP5 A;  1KYW A;  3HIF A;  1Q1H A;  3I71 A;  2DK8 A;  5ED4 A;  4HF0 A;  4A5N A;  3BJ6 A;  3ML6 A;  5FLX K;  2CO5 A;  4LJZ F;  4WF2 A;  4HV5 A;  1LJ9 A;  5AIP A;  1BI3 A;  5AIQ A;  2EFW A;  1J59 A;  4M9X A;  4KDP A;  4HLY A;  5DUI A;  2YSR A;  4OIO F;  1MDM A;  1ZG3 A;  2PG4 A;  3ZMU A;  2PBI A;  1QNT A;  4KUM A;  1FY7 A;  4ENK A;  1WSU A;  1T38 A;  1QZZ A;  2FF4 A;  5K5O A;  4RB3 C;  2R7D A;  3FX3 A;  2F5D A;  2PLY A;  1ZYR F;  1RIO H;  1FBQ A;  1OMI A;  3H92 A;  3CLO A;  5L3E A;  3ZPL A;  5DCM A;  4P9F A;  2YX7 A;  3SZT A;  2ISZ A;  3WGI A;  2K02 A;  4IHS A;  1OYI A;  1U3E M;  1G4D A;  3CUQ C;  4ON0 A;  4L5J A;  1XSD A;  1FPQ A;  1TLH B;  1R36 A;  4NQW A;  1W7P B;  4KMF A;  2XAF A;  5K5R A;  1R00 A;  3E6D A;  3MZY A;  1Z7U A;  1OPC A;  3BWG A;  4HV6 A;  1U78 A;  1ON2 A;  1A04 A;  3CUQ B;  5TJJ A;  1G3Y A;  1QGP A;  5HDG A;  1OR7 A;  4Q4Z F;  4PZJ A;  1BJA A;  3NRV A;  1HKT A;  3HSR A;  4CXF A;  5EEH A;  2WC2 A;  3AAF A;  3F23 A;  3LQQ A;  4ENM A;  1IXS B;  1TQP A;  3ZMV A;  5F6F A;  5LGT A;  2C6Y A;  2EFP A;  3TOA A;  4UVC A;  4FT8 A;  5J8C A;  4L0Z B;  3K1N A;  4KFC A;  2LF7 A;  3SQN A;  3Q9V A;  1K79 A;  1S7A A;  5LHH A;  3W6J B;  3N97 A;  4DNC A;  1K6O A;  4XSX F;  5IT9 Z;  2QBY B;  3R0A A;  4CZZ A;  5D5U B;  3JTG A;  3HRM A;  3R60 A;  2QQ9 A;  4OMY A;  1V4R A;  1BM9 A;  5LEK A;  2MBF A;  2FNP A;  3G3Z A;  2BV6 A;  1R5H A;  4RB1 A;  2FOK A;  2Z5U A;  2FNA A;  2FBI A;  3DF8 A;  3I59 A;  1Z6T A;  3L09 A;  4IRI A;  1YW8 A;  5E8G A;  2YR2 A;  2G7U A;  4HF1 A;  3ZN0 A;  5F1R A;  3KP4 A;  3P9K A;  2M1B A;  3RYR A;  1BIB A;  1O57 A;  2XKO A;  1UCR A;  1SD7 A;  3E6B A;  4LG0 A;  3KP6 A;  4G6D A;  1XGO A;  2ZNY A;  3KZZ A;  2JPC A;  4I09 A;  1LDK B;  3K1P A;  2A3S A;  3V7C A;  2FE3 A;  4ZYE A;  4RGX A;  2RDP A;  2HWV A;  3HTS B;  2MA3 A;  2KIM A;  2IA0 A;  1TQM A;  2IA2 A;  3OOP A;  1P4X A;  2RQP A;  2O61 A;  4HOB A;  2K4B A;  3Q9S A;  3DKW A;  5E1X A;  3BOQ A;  3KEQ A;  3I64 A;  2HTJ A;  2DTR A;  1K7A A;  1IRF A;  2UXN A;  1W7P D;  5ICF A;  5LBQ A;  2P4W A;  1GVJ A;  2M45 A;  5BS6 A;  3SHF A;  1XB4 A;  3GEZ A;  2ESN A;  4IXA A;  2DFI A;  4YFK F;  2ZO4 A;  2ZME B;  4WXD A;  2VBY A;  4G7Z F;  1SD4 A;  3FM3 A;  2JPB A;  4HA8 A;  2ZXJ A;  1UB9 A;  3MCZ A;  5K5Q A;  1BI0 A;  4YFX F;  1G6N A;  2FBH A;  5FLX Z;  3BDD A;  3R6S A;  2LKP A;  4ENN A;  1MZB A;  4LD5 A;  1ZG1 A;  1L3L A;  3IKV A;  3FMQ A;  4HX8 A;  4RB2 C;  2DPD A;  2QQB A;  4M73 A;  4IPA A;  2W24 A;  4A6D A;  1F9N A;  1TNT A;  1ZH5 A;  2W57 A;  4XLN F;  2EV0 A;  5DCM B;  3D0S A;  2V79 A;  2QM3 A;  3GFI A;  4YII A;  4XBF A;  3PQK A;  3J80 K;  2ISY A;  4IRH A;  2HYG D;  1SMT A;  1CF7 A;  3WE2 A;  4ETS A;  1WRJ A;  3LQR A;  2DPU A;  5K1Y A;  3MEX A;  5BMZ A;  2CQK A;  1G3T A;  3DFG A;  1OYW A;  4R1H A;  3VEP A;  3M8E A;  2QUF A;  2JZY A;  1D3Y A;  3WTZ A;  3KLN A;  4KYW A;  3K1M A;  2EFQ A;  2XVC A;  1EH6 A;  4AIJ A;  5DCF A;  3MAJ A;  2M30 A;  1FX7 A;  2JSC A;  2YPR A;  5FGM A;  4RAY A;  1O3Q A;  3E6C C;  1FYM A;  4U7B A;  4DQ2 A;  2LSO A;  3JSO A;  2M8E A;  2CYY A;  1XGS A;  4GYI A;  3WG9 A;  4U0Y A;  1I6X A;  4KMU X;  1DPU A;  3HHH A;  2AS5 F;  3PQJ A;  3LFK A;  1YTY A;  1HKQ A;  1H9G A;  2P6T A;  1UST A;  1HKS A;  4UXN A;  2Z3Y A;  2Q8K A;  3CUO A;  4M71 A;  2YX4 A;  3WTY C;  1FSH A;  4KT5 C;  5E17 F;  1XSX A;  1ZN2 A;  4LLL A;  5KVR A;  5CLS A;  3I58 A;  5HS9 A;  2Q2E A;  3I59 B;  3F21 A;  2OD5 A;  4GYG A;  5BPI A;  3J81 K;  1TTY A;  1KQ0 A;  3R61 A;  3MFK A;  3HHG A;  3K69 A;  1SD5 A;  1HW1 A;  3ABT A;  1SMY F;  3TO6 A;  3BJA A;  4MEY F;  1P6R A;  2VBW A;  1RUN A;  4ZH4 F;  3RJP A;  1PDN C;  4NB5 A;  1P2F A;  3GW2 A;  4Q5S F;  1WI9 A;  4RS8 A;  3VOE A;  1TNS A;  1ZRF A;  3DXJ F;  4O5V A;  3F8N A;  3V7S A;  2NNN A;  4TV7 A;  3HRT A;  2W85 A;  2HYF A;  4GGG A;  3VB2 A;  4HF2 A;  4AVP A;  4MQV A;  3ECO A;  2VE8 A;  2IVM A;  2HKO A;  1ZRE A;  3RDI A;  2L4M A;  3QOP A;  4KN4 X;  3N4M A;  3F72 A;  1J7K A;  4UHT A;  2EA2 A;  1WQ2 A;  3IC7 A;  2GA1 A;  3REO A;  4ZYG A;  5LHI A;  2CW0 F;  3DPT A;  4ESJ A;  4OIP F;  3U9G A;  5F64 A;  3BPV A;  2EV5 A;  1YW7 A;  4L9N A;  4EJV A;  4WX9 A;  2E7X A;  4OIQ F;  2IW5 A;  4L5I A;  1DP7 P;  3QP6 A;  2A6E F;  4EQQ A;  2FXA A;  2L54 A;  3QPT A;  3HYI A;  2IA1 A;  4G7O F;  1S29 A;  1MJA A;  4E70 A;  1SAX A;  3F8F A;  1W4M A;  3ZN1 A;  1WKM A;  2A07 F;  5DYM A;  2MLG A;  1YS6 A;  2DLL A;  2OBP A;  4PGH A;  1TBX A;  2GWR A;  4CGZ A;  1JGS A;  2UWM A;  1CF7 B;  1YG2 A;  1UFM A;  3QPH A;  1ZLJ A;  3LST A;  5FD5 A;  3ROU A;  1IN7 A;  4IVN A;  3GFM A;  5DDG A;  2FU4 A;  2FMY A;  1J2X A;  2FA5 A;  2K27 A;  1OYY A;  3M9A A;  2LDU A;  2F5F A;  4EMS A;  2DBB A;  3ECH A;  4L9T A;  3IL2 A;  4GO1 A;  3J80 Z;  2V1X A;  3FHZ A;  1FSE A;  1T98 A;  3VFZ A;  1IZ1 A;  6PAX A;  3BJO A;  3B73 A;  3E5Q A;  3ZQ7 A;  2F5E A;  2GAU A;  1BIA A;  2H09 A;  3P9I A;  5E1W A;  4HX7 A;  3T5X A;  4LMY A;  1SFU A;  3C1D A;  4RB0 A;  4BAY A;  5FFZ A;  3TOB A;  3DV8 A;  1O7L A;  2PMU A;  1STZ A;  3ERE D;  2F2E A;  1BC8 C;  2P5L C;  1C0W A;  1FYK A;  1JHH A;  1K78 A;  4HAM A;  4LGW A;  3GXO A;  4B8X A;  4M6Y A;  1CGP A;  3M7G A;  4A6E A;  4U0W A;  3WTU C;  4WCG A;  5JR3 A;  3E3V A;  4R8H A;  3PFI A;  4WXC A;  3M8F A;  3V7R A;  3ZMD A;  3I4P A;  4KA4 A;  1L0O C;  3JTH A;  3TDU C;  1O3R A;  1REP C;  4OU0 A;  2IPQ X;  4L9J A;  2HDC A;  1U5T C;  2KJB A;  3EUH A;  1ZG5 A;  2A69 F;  1Z1D A;  1JHF A;  1ODD A;  2OU2 A;  5JFR A;  2K86 A;  3J7A O;  5ICC A;  2A68 F;  4U7D A;  3I5U A;  2VXZ A;  1J75 A;  2CGP A;  2P7C B;  3IRQ A;  3LA3 A;  5DUK A;  3L9F A;  2VE9 A;  2DO7 A;  1J9I A;  2B0L A;  5HLI A;  3RKX A;  2XGX A;  4MTE A;  1U5T B;  1KA8 A;  2EFN A;  5CYV A;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...