4MNUA

Crystal structure of uncharacterized slya-like transcription regulator from listeria monocytogenes
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
b'AMKDILRDIGVIARALDSISNIEFKELNLAKGQFIYLVRICENQGIIQEKLVDILKIDRTTASRAIKNLEKNGLIIKKQNKNNKKNKLLFPTEKGQQLYPLIIRENEYSNAVALKGFTEAEINMLTDALKKVKENIADDWLYVKKGNKRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SlyA-like transcription regulator
publication title Crystal Structure of Uncharacterized SlyA-like Transcription Regulator from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
total genus 53
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mnuA00
4YIFA 1TTYA 4AVPA 1XMAA 2XAQA 1K6OA 4ENMA 2ZFWA 5CVRA 2IA0A 1EV7A 2O03A 1FBUA 1GXPA 1KYZA 1Q1HA 1O7LA 2A3SA 3SHFA 2XASA 4BQAA 1YYVA 3LA3A 1QPMA 2X4HA 1U6GA 2Y0MA 3V8KA 4U88A 3ISPA 1CF7B 1E2XA 5LRRA 3QP6A 2D1VA 1S8NA 2EWNA 5D5WB 1P4WA 2DTRA 4CZZA 1Z7UA 2HWVA 1DPUA 3JAMK 4U0WA 5ILSA 1FX7A 1G6NA 5JVTA 4MEYF 4HAMA 3JTHA 3VFZA 1V3FA 1TQMA 4ENNA 3F6VA 4ZYEA 5H20A 4KN4X 1D8JA 4N9IA 4A0XA 2GXGA 1IN7A 3HIFA 3L9FA 2M5WA 3HHHA 3J80Z 2Y75A 5K5OA 3LAPA 2HFHA 5E8IA 1ZHFA 4ESJA 2PQ8A 2Q2EA 2ZMEB 2MC3A 1U2WA 4LGWA 1RUNA 4M74A 3DQVC 5DCMB 5D5VB 3R61A 1R5HA 1EH6A 2V6CA 3ZMZA 3WGGA 1QO0D 1W7PA 4BNCA 4S05A 2OQRA 1YQAA 1UCRA 4R1HA 1QZZA 3BJAA 1C0WA 5BPIA 1ZLKA 1IW7F 4LFUA 3C7JA 2EA2A 1B4AA 4G6DA 3EDPA 3JSOA 3V7RA 2P7VB 1HQCA 3K0LA 3LQQA 5CVJA 3E5XA 1PP8F 1MGTA 1ZG5A 3K1NA 4BH9A 4G8XA 1KQ0A 2MH9A 3L00A 3JTGA 4LLLA 3I54A 2GXBA 4OU0A 2K27A 3F72A 4A0YA 3GZ5A 3KETA 2GIVA 2EV6A 3WODF 1YFHA 4LG0B 4L5IA 3F6OA 3ROUA 5LHGA 1S6LA 4ESBA 4CHUA 3IWZA 1S29A 2P8TA 3GWZA 2JZYA 4M72A 5ICGA 5LRSA 1RUOA 1SFUA 3FXUA 1LEBA 3LQRA 2RDPA 3KZZA 2OZUA 5HS8A 2FNAA 4OMYA 4A6EA 4WCGA 3FMQA 1J7KA 2DO7A 2KIFA 2QM3A 4Q48A 1U5TB 1IAWA 3MCZA 5E8GA 3IWFA 2W24A 4Q47A 1JHFA 4S04A 3HYIA 3HSRA 2P7CB 1ZG1A 3ECOA 4P9UA 1LVAA 2QBYB 1STZA 3T5XA 1K79A 3REOA 1G4DA 5HS7A 2GA1A 1P4XA 4GYGA 3M8EA 1HW1A 2STTA 2ISYA 3ELKA 3V7SA 1XSXA 2P5LC 3KP3A 4AIKA 5HLGA 1W5SA 2FSWA 3RKYA 1WSUA 1B6AA 4I09A 5K1YA 3HSEA 3F8MA 1TLHB 2HOEA 4GXOA 4A5MA 3L09A 2G7UA 4ENKA 4A0ZA 2H94A 3B73A 1BIAA 2K02A 2STWA 3J81Z 3E97A 2HYGD 2HYFA 5L3GA 2PFBA 5LHHA 3HRTA 2OQGA 3F8FA 4EV0A 3KEOA 4IXAA 3HRUA 2VBXA 3VEPA 1DUXC 4LLGF 1B9NA 5LEJA 4ZYGA 4HLXA 2DQRA 3FM5A 4LK0F 3LA2A 2KJCA 1G3YA 1J2XA 4Z2YA 3K69A 1D3YA 3E5QA 2FMYA 2K7LA 3LA7A 4FX0A 4XLPF 1SD4A 5HOOA 4IHTA 1YO5C 5E20A 2M30A 4KUMA 2IP2A 1FYLA 4H0EA 3N4MA 2F5DA 3MWMA 4KICA 3PFIA 1GVJA 3KLNA 3GO5A 2VN2A 2QQ9A 1MDMB 2FU4A 1R5GA 2XAFA 5LEKA 1FC3A 2K4JA 3EYIA 1T0FA 1R7JA 4P5OA 2FRHA 2XUBA 5HDGA 2M1BA 3RTRA 4LK1F 5L3EA 2DPDA 2VOOA 3DP7A 1AWCA 4RB3C 4ON0A 3WTSC 1AOYA 2QQAA 2L4AA 4CGZA 5ILUA 3RPUA 2VBWA 2W57A 4HOBA 4GCVA 2RVCA 3P7NA 4LB5A 2DBBA 2J5OA 3I58A 4IPAA 3MZHA 4IVNA 2HTJA 3P9KA 2DK8A 4M6XA 1YTYA 1LDKB 3DPLC 2HTSA 5DYMA 1B9MA 4M6YA 3U1DA 4L5JA 3TKYA 2HR3A 2COMA 4Y17A 3P9CA 5D5UB 2W25A 1O3QA 1SMYF 5FGMA 5HLHA 1HSJA 5DDGA 1RI7A 1J5YA 2L02A 5ED4A 4OMZA 4IRGA 1TNSA 2CO5A 1Z6RA 2EV0A 5A2QK 3BPVA 1ODDA 3E6MA 1YLFA 4PGHA 3G73A 2RKHA 3I4PA 2QLZA 2KIMA 2IJLA 2QQBA 1I1GA 2FA5A 4I0BA 1S7AA 1JXSA 3H92A 3VOEA 5EEGA 2OBPA 4Q4ZF 1IXSB 2OZ6A 3GFJA 3DF8A 1BI3A 1XDSA 1KU3A 3FWEA 5F1RA 1UB9A 5JI6A 3NEUA 2AXLA 1LEAA 1ZGAA 2OU2A 4QWQA 1K78A 2XAGA 1W4MA 5DEQA 2UXNA 2DFIA 4AIHA 4D0PA 3IL2A 1YS7A 3DXJF 1KGSA 2C6YA 1IN5A 4UXNA 2DU9A 1L0OC 4DNCA 5J6XA 1ZRCA 2VBYA 2K86A 1FLIA 1HW5A 3EETA 5HS9A 2CSOA 4U7DA 3HHGA 5LGNA 2QVOA 4I02A 1HBXG 1OYIA 1YG2A 1ON2A 1Z91A 3WE2A 2NRAC 2HS5A 4KIGA 2FQ3A 3KEQA 1P92A 4G94A 4RGSA 2HZTA 5BQTA 3I64A 2ZCWA 3JAMZ 1Z05A 4YFXF 5TRDA 2HKXA 4CXFA 1D5VA 5TJJA 4M71A 3WTWC 3TO9A 3F21A 3OV8A 1X3UA 5L3CA 1J0RA 2F5FA 2ZKZA 2XKOA 1IZ1A 2L3DA 5D4SA 5JFRA 3J7AO 5CJ9A 1ZRFA 2ZXJA 3RYPA 5LLQA 5AIQA 1U8RA 4EJWA 3BP8A 5ICCA 4KFCA 1QNTA 5H6QA 4EJUA 2J5PA 3JSPA 2F5CA 2CFXA 1U3EM 3RI4A 4M73A 1XCVA 1XMKA 2UWMA 3V7CA 1ZRDA 4YG2F 2FBHA 2ELHA 1F5TA 3DV8A 4RAZA 4U0VA 3GZ6A 2ETHA 3Q9VA 4EJVA 4UV8A 2XV4S 2VBZA 5K5QA 4IRIA 3LFKA 4G7OF 2EFOA 2CW0F 2JPCA 4ZZDA 4RB1A 3H3ZA 3I53A 4FT8A 3TDUC 5FLXZ 2DI3A 1HKQA 3CUOA 4RB0A 2Z5UA 4EQQA 4WWCA 4N0BA 2V79A 4OIOF 1LDDA 2G7HA 4RS8A 3TGNA 1GHCA 3B02A 4BYYA 3BJOA 3RPQA 2XHKA 2JRTA 1MJBA 2VE9A 2O61A 5JR3A 4Y13A 1J75A 5FLXK 4JQFA 4L9VA 2NNYA 1F4KA 3QAHA 3QPTA 5HDKA 1U5TA 4PZJA 1R36A 4OIQF 4E70A 1MJAA 1D8KA 4GGGA 4BHCA 3WGIA 2AS5F 1IN8A 4OOIA 4XRFA 3ZMSA 4MQ9F 3I5UA 4L9NA 2R7DA 4EGYA 1WQ2A 4A6DA 1W7PB 2JTVA 3BZ6A 1IF1A 1ONVA 2B0LA 4EMSA 3WTUC 5DD8A 1G3WA 1OKRA 4MTEA 3SZTA 4RAYA 4ETSA 2ISZA 3E6BA 2RV8A 4L18B 4U7BA 2M87A 2YX4A 1XN7A 3W6JB 1H9TA 4R79A 1PUEE 5LGUA 5K5RA 5FO5A 3HRMA 3ABTA 3FM3A 3F8NA 1TNTA 2UZKA 4WK8F 1FY7A 5AONA 1E17A 3K1MA 2Z9OA 2EB7A 2RGVA 2HQRA 4NQWA 2QYOA 1YS6A 4KA4A 3WTTC 4RGXA 2JPBA 5LGTA 1CGPA 4O6JA 3CUQA 1ZYRF 3GUDA 3U2RA 3V8LA 2M8EA 1FP1D 1FSHA 1BBYA 3HOTA 1QZYA 5CVUA 1BI2A 2E1NA 3T8RA 1ZN2A 4I2OA 1WI9A 1FYKA 6PAXA 1FSEA 2GWRA 4TV7A 3QP5A 1BI0A 2VC0A 3L2CA 3F23A 3E3VA 1I27A 1K7AA 2EFNA 2BBYA 3WGHA 1FPQA 3TO6A 1RZ4A 3I59B 2ZJ2A 2D45A 2A69F 4HQEA 3WU0A 3BOQA 4GYIA 2EK5A 5CVIA 2MLKA 1T38A 2W85A 3L7WA 2V1XA 3LSTA 3O2PE 3ZP5A 3E5UA 2V1UA 2IT0A 1IN4A 2RQPA 2RN7A 1XDUA 4YFKF 1IRFA 2DQLA 2QZ8A 4MHGA 4EM2A 2QUFA 3ERED 3RKXA 2ESNA 4FHTA 5D5XB 3TDZC 1S3JA 5HVQC 3LAJA 3EYYA 1V4RA 2LNBA 3GFIA 3BDDA 2OD5A 1O7FA 4MGRA 1LDJA 1BN5A 2PG4A 2XVCA 5D4RA 2L54A 3DKWA 5ERIA 1XSVA 4KMFA 4AIJA 1ZAOA 1PP7U 2XIGA 2EJRA 5F6FA 5E1XA 4BXUA 3SFZA 4F7ZA 5AIPA 4PDKA 3QRFF 1XGOA 1IXCA 4EJTA 1YW9A 1ZG3A 4L9TA 3K9TA 1R22A 3QU6A 3CJNA 1VTNC 5FD5A 2FOKA 1JE8A 1S7OA 4JK1X 1ULYA 1W7PD 2IVMA 3RDIA 4HZFA 2GAUA 3T8TA 3ZN1A 1I6XA 1BJAA 2IPQX 1DDNA 5FD6A 5J8CA 2OA4A 1XB4A 2NYXA 1H9GA 1MD0A 5A2QZ 3T1BA 2IW5A 2IA1A 1DPRA 4ENJA 5FB2A 3WTYC 3Q5FA 2D2WA 2P5KA 2UXXA 1R1TA 2MLGA 1QGPA 3R60A 3SZPA 4R8HA 4HV5A 5ICFA 1OPCA 2PMHA 2GQQA 3M8FA 2CG4A 1BC8C 4EGZA 1HKTA 1LJ9A 2KJBA 3HTUA 2GA2A 1IRGA 2HDCA 2O3FA 3IHUA 3ZQ7A 2P5VA 3N97A 5E17F 5BOXA 1ZH5A 4G6QA 1XGMA 5L3DA 3WTVC 2G9WA 3ULQB 1PDNC 3KCCA 1O3RA 1IUYA 5BPDA 4WXHA 4G9YA 2Q0OA 3HUGA 3E6DA 1L3LA 2JT1A 2CGPA 3R0AA 2BE5F 3ZMUA 4EM1A 4UVAA 5ICEA 3MQ0A 1HW2A 3M9AA 2ZNYA 4EVIA 4HDUA 4IRHA 2H6CA 2MH2A 2A6HF 4ZYHA 1SMTA 5DUKA 4O3MA 1LB2A 2H09A 4MEXF 3BROA 3F8CA 3ZN0A 5KK1A 2RC4A 5ILVA 4HW0A 1IXRC 2E7XA 2MBFA 2R7FA 2XAHA 3JW4A 4HV6A 1LNWA 1T98A 1R1UA 3EQLF 2CWEA 4A5NA 1J9IA 4NB5A 1CF7A 4KYWA 4XBFA 2DK5A 2M45A 3BY6A 3V4GA 3FHZA 3GEZA 3RJPA 3CO7C 1TW3A 4KT5C 3DEUA 2KRFA 2DLLA 3GW2A 2F2EA 2VOPA 4EJOA 3GLXA 2EA4A 2GZWA 3I71A 5FFXA 3ECHA 2VE8A 2VODA 1I1SA 1SD6A 2VC1A 2LF7A 3R0JA 4LMYA 1HKSA 1KU2A 5D8KB 2ZO4A 4B8XA 2BGCA 3GXOA 4MNUA 1Z6TA 3ABUA 2XRNA 1FZPB 1KA8A 2LDUA 3TO7A 3BJ6A 1WWXA 2ZMEA 4OINF 3CUQC 4XSXF 4AD9A 5IT9K 1SFXA 5BMZA 5HLIA 2TDXA 5DCMA 1YW8A 4KIFA 2JSCA 2FNPA 4KMUX 5E1ZB 1ON1A 3WU1B 5KVRA 1FWZA 2HEOA 2LF8A 3H3UA 1BI1A 2XROA 3WE3A 2Z33A 2A07F 5CLSA 5HDNA 1KU7A 4WXDA 3GYHX 2P6TA 4YIIA 1R58A 2YU3A 4KIBA 3FZVA 2ESHA 2EV5A 1UHWA 4HBLA 4O5VA 4OIRF 3PQKA 1TQPA 1JHHA 1TQIA 2VONA 4LG0A 4QLCU 2FE3A 2VT3A 1FYMA 3KLOA 4L0YB 1OYWA 3PQJA 3SQNA 4Y15A 4HX4A 1R23A 1WKMA 2BV6A 3Q9SA 2WC2A 3KZYA 1O3SA 4LD5A 1BC7C 2LSOA 2FEZA 4CICA 3SXYA 3J80K 5IT3A 2MA3A 3R4KA 2A5YB 3KP7A 3FMSA 5D6EA 1G3SA 1I5ZA 3ZMVA 2PEXA 4HA8A 2IRFG 1EH8A 2WTEA 1F9NA 1O3TA 2PMUA 1B59A 2QBYA 2L01A 3MEXA 2FXAA 3C3WA 4I7HA 3HSFA 3F22A 3KFWX 3M7GA 2FF4A 2BEOA 5JHUA 2DAOA 1G3TA 4FX4A 1ZLJA 2RNJA 4XSZF 4UHTA 5LHIA 5FFZA 1SD7A 3NQOA 1B1BA 4L9JA 1ZREA 3BWGA 2O8XA 3WG9A 3FX3A 3LWFA 2A6EF 4WX9A 1FP2A 5BS6A 4ZYDA 3GVAA 3IKTA 3W6KB 5F64A 1SFEA 4I0AA 4PCQA 4MTDA 1HSTA 3I59A 4EM0B 4G7HF 2O0YA 3WTXC 2FBKA 2WV0A 3KP2A 4CO8A 2E1CA 1FT9A 1JGSA 1WRJA 3FXQA 4B09A 4JBAA 3ZMDA 2Z3YA 1OYYA 5LBQA 2PJPA 1FBQA 2NNNA 3C18A 3RKWA 4KN7X 5L3BA 1FNNA 2ZNZA 4HX8A 4CYDA 2X0LA 3KE2A 3FXRA 1T6SA 3GF2A 4RB2C 1O57A 4P9FA 1ZGJA 4WXCA 5CVVA 1EH7A 1XCBA 4RGRA 4P55A 1XGSA 4BAYA 1MDMA 3RYRA 1REPC 3ZMTA 2YR2A 2YPRA 3TOBA 3KP4A 3NRVA 5DD4A 5EEHA 5H6RA 1F1ZA 4AWXB 2XAJA 3CUQB 3F8BA 4A12A 4XLNF 1Y0UA 2HKOA 4P96A 1USSA 1OR7A 3HRSA 2PBIA 3P9IA 3TOAA 2EFWA 1QBJA 3HTSB 3DFGA 5DV5A 2CQKA 3K2ZA 1P4AA 2O6GE 3R6SA 1USTA 5DCFA 4BHPA 2QWWA 1TW2A 2NS0A 4M9XA 4HF2A 3J81K 2YSRA 1OMIA 1MJ9A 1T2KA 4IHSA 1UFMA 4G7ZF 1NHAA 4ZH4F 4PGGA 2V9VA 3CDHA 3BPXA 3T0YA 4UNOA 1XGNA 3MFKA 2P4WA 3OOPA 4NHJA 2E7WA 5D6FA 2DW4A 1Z9CA 1HXDA 4UUVA 1J59A 1BOAA 2KKOA 1H0MA 3D0SA 2EFPA 4A2UA 2HGCA 3D5LA 4HF0A 2VT2A 2BYVE 2Y48A 3IC7A 4L0ZB 1IN6A 2A61A 3CO6C 3KP6A 2VXZA 5J8FA 1BIBA 1GXQA 1DP7P 3CLOA 3WTZA 3S2WA 3O6BB 1QQIA 4LB6B 3IKVA 2IA2A 4HX7A 4K2EA 2ADUA 1MKMA 2WWYA 2CYYA 2DT5A 1R1VA 4HYEA 3QPHA 3TQNA 2EFQA 2ZBKA 2NAZA 3GX4X 4HLYA 1SAXA 4GO1A 1KYWA 2FBIA 3C1DA 3FMRA 1U78A 3VB2A 2KIUA 3U9GA 3ZPLA 3DPTA 2FMLA 1ZARA 5L3FA 2ACJA 2P6SA 5DUIA 2HQNA 3COAC 4WF2A 1KQ8A 2PI0A 4LJZF 3KP5A 4UVBA 3ML6A 4HF1A 3CTAA 4RGUA 2XGXA 4BHBA 1RNLA 3I0TA 4HQMA 1RIOH 4Q5SF 2H27A 2H6BA 2QENA 4CDGA 3EUHA 4ASNA 4UVCA 2PLYA 2LKPA 2W84A 3FF5A 1UHMA 2R3SA 3AAFA 2A68F 1TBXA 4OIPF 4UV9A 4KNYA 3QU3A 2OAZA 3IRQA 2K4BA 4N9HA 3G3ZA 4M9ZA 4M9SA 1R00A 2D1HA 3MAJA 1P2FA 1KU9A 1SD5A 4KDPA 1FOKA 2V1DA 2XKPA 3QOPA 2Z99A 1Z1DA 3O3KA 3E6CC 1U5TC 4I98B 3GFMA 5D8LB 5E1WA 1BM9A 3IRRA 4U0YA 4ZZLA 3M1EA 4IJAA 2F5EA 1FBSA 1KQ9A 5E18F 1W5TA 1YIOA 1XSDA 4I01A 2L4MA 1MZBA 3GFLA 1LQ1A 2YX7A 4IF4A 1P6RA 3MZYA 4ESFA 1XD7A 4MQVA 2Q8KA 3RIRA 2DPUA 3VODA 4LLNA 1YW7A 1K78B 3K1PA 2MD5A 3HOSA 3F3XA 3V8JA 4HDVA 4DQ2A 1T39A 5CYVA 4YFNF 1A04A 2PN6A 5IT9Z
chains in the Genus database with same CATH superfamily
4YIFA 1TTYA 3KEYA 4AVPA 1X3ZB 4JOMA 1MNDA 1XMAA 1NK3P 2EPFA 2XAQA 2M9HA 1K6OA 4ENMA 1Z3YA 2ZXWH 2ZFWA 3HEFA 5CVRA 2IA0A 4E7KA 3UR3C 1EV7A 2O03A 1IRXA 1FBUA 3FKIJ 3OYEA 2LLKA 1B8IA 1IV6A 1GXPA 3CCJI 4I99C 1KYZA 1Q1HA 3C2GA 2IS6A 2R5ZA 4M3GA 2QCOA 1O7LA 3G6EI 2A3SA 1TWCJ 3SHFA 1YRNA 2XASA 3PIPF 5K7ZA 4BQAA 1YYVA 3LA3A 1ZTRA 3VPRA 3CC7I 1QPMA 2X4HA 1U6GA 2Y0MA 3V8KA 4U88A 3ISPA 4DIQA 1CF7B 1E2XA 5LRRA 4F92B 4HRIA 3QP6A 2D1VA 5B5EC 1S8NA 2EWNA 5D5WB 1P4WA 2DTRA 4CZZA 1Z7UA 3A0BC 2HWVA 2O9LA 1DPUA 2CMPA 3JAMK 4U0WA 5ILSA 1FX7A 4RBOA 1G6NA 5JVTA 4MEYF 4HAMA 3JTHA 3VFZA 1HOMA 1VF9A 3I55I 1AKHB 1V3FA 1Z67A 1TQMA 4MFDA 1JUPA 4ENNA 3F6VA 1HDDC 1TWFJ 4ZYEA 1I6HJ 5H20A 1BOBA 4KN4X 1FEXA 2HU9A 1CQTA 1D8JA 4RM2A 4N9IA 4A0XA 1GT0C 5J40A 2GXGA 3G1MA 3I3LA 1GLNA 3D5RC 3BR0A 1IN7A 3HIFA 4HSTA 1YE9A 4RLFA 2KRHA 2QA4I 3L9FA 1Q1VA 2M5WA 3HHHA 3J80Z 4A3KJ 2K9MA 1YIJI 5JVGF 4IOAF 2Y75A 4HEA2 2L9VA 5K5OA 3LAPA 3OYBA 1Y56A 3OYFA 2HFHA 5E8IA 1ZHFA 3TBIA 2HVSA 2LBFA 2NOGA 3EUKL 3VYSB 4ESJA 3JRAA 2JVGA 1X1AA 2KT0A 3CDLA 4XN3A 4IZZA 2PQ8A 2Q2EA 2ZMEB 2E34A 2CRGA 2MC3A 4A3BJ 2TRTA 1U2WA 2V1NA 2Z1DA 4LGWA 3CCLI 3V42A 1RUNA 4M74A 4XQFA 1OR7C 2LKSA 3DQVC 5DCMB 5D5VB 3R61A 1R5HA 1EH6A 1ETYA 3BR2A 1ZELA 4N4NB 2V6CA 3LSIA 3WGGA 1QO0D 3ZMZA 1M1EB 1W7PA 4BNCA 4S05A 2OQRA 1YQAA 1UCRA 1SVOA 1APLC 3I4MJ 2RAEA 5J1YA 3P5JA 3OR2C 4R1HA 1QZZA 3BJAA 1C0WA 5BPIA 3ZQLA 1ZLKA 1IW7F 2L2OA 3HKZN 4LFUA 3C7JA 2EA2A 1B4AA 4G6DA 2AQFA 2LKXA 3DEWA 3EDPA 3G1LA 1ERDA 2E5NA 1ITYA 3JSOA 5F04A 3V7RA 2P7VB 1HQCA 2BXZA 3K0LA 3LQQA 2OC6A 3TP0A 5CVJA 3E5XA 1PP8F 1MGTA 1ZG5A 2PX9A 3BCBA 3G1OA 3S14J 3K1NA 3OS1A 4A93J 4Y33A 4BH9A 3CF2A 4G8XA 1F36A 2VKDA 1KQ0A 2MH9A 3ABMH 3L00A 5J4VA 4MLOA 1VQ5I 1VNDA 1SAUA 3JTGA 4LLLA 3I54A 2GXBA 2E36A 4OU0A 2K27A 3F72A 4A0YA 3GZ5A 3KETA 3OR1C 2GIVA 2EV6A 3WODF 1YFHA 5CQEA 2EZLA 3EPZA 2ICWG 4LG0B 4L5IA 4PSWA 2K9LA 4CYCB 4ZC3A 2YU9J 2JA8J 3F6OA 3ROUA 1ETXA 5LHGA 1S6LA 4ESBA 4CHUA 2E1MC 3IWZA 1S29A 2P8TA 4UB8C 3GWZA 2JZYA 4M72A 3DBLB 5ICGA 5LRSA 1RUOA 1SFUA 2CU7A 3FXUA 4HNVA 1LEBA 4I6ZA 2XSJC 2M3AA 3PNYA 2ZFUA 3LQRA 2RDPA 1VQNI 3KZZA 4XM3A 3ZOBA 3S1NJ 4DYCA 2OZUA 5HS8A 2FNAA 1TZLA 2VJ5A 4XNFA 3LSPA 3CCVI 1LFPA 4OMYA 4A6EA 4WCGA 2XPVA 3H9JA 3FMQA 1J7KA 2DO7A 2KIFA 2QM3A 4Q48A 3QOEA 4C30A 1U5TB 3S1RJ 2R7UA 1YHQI 4QIWN 1IAWA 3MCZA 5E8GA 3IWFA 4LITA 2W24A 4GDFA 4Q47A 2LC2A 1JHFA 4XLCA 2QGUA 2EIJH 4S04A 3HYIA 3OSGA 3HSRA 3L2RA 2P7CB 1ZG1A 3ECOA 4P9UA 1H8AC 1LVAA 5IOZA 2H1KA 4YIRX 2QBYB 1STZA 4ZDPA 5E3MA 3T5XA 5EG0A 1K79A 2XAUA 4BS9A 2JA6J 3REOA 1G4DA 5HS7A 3S3OA 2VPLA 2GA1A 3HG9A 1P4XA 4GYGA 4DYQA 3DU5A 3M8EA 1PVEA 3OWTA 1HW1A 4B3AA 3ZRGA 2F4IA 4J00A 2STTA 2ISYA 5EGOB 1QHGA 3ELKA 2LY1A 1XSXA 3V7SA 3PO3J 1P7JA 1JTYA 2CUZA 2MSYA 2P5LC 3KP3A 4AIKA 5HLGA 1W36C 2X85A 2DTZA 1W5SA 2FSWA 3RKYA 1MNMC 3FXKA 1WSUA 1B6AA 3A03A 1TT5B 2JUGA 2CJJA 4I09A 3HGYA 5K1YA 4A3JJ 3OIPA 3HSEA 3F8MA 1YJWI 2F5VA 1BR2A 3QWLA 3U1KA 1TLHB 2HOEA 4GXOA 4A5MA 3L09A 3S32A 2G7UA 2R93J 4F55A 5GPCA 1SEUA 4ENKA 4B3XA 4A0ZA 2H94A 3B73A 4QPQA 1BIAA 3MZ8A 2K02A 1LUJB 3M8JA 1K4TA 2STWA 1WHUA 2E71A 3E97A 3J81Z 1RR7A 2HYGD 2RQQA 2HYFA 1VQ8I 4HNUA 5L3GA 2PFBA 5LHHA 4IOCF 3HRTA 2OQGA 4XOPA 1UHSA 3F8FA 4EV0A 2KP6A 3KEOA 4IXAA 3HRUA 2VBXA 3VEPA 4HNTA 1Y39A 1DUXC 1NTCA 4LLGF 3SYTA 3EUHC 4BJ5C 4M3EA 1Z21A 2R7WA 3AKZA 1B9NA 3ZXSA 5LEJA 4ZYGA 4HLXA 4RAGA 4OAYA 2IS4A 2L9SA 2DQRA 5GTIC 2HQAA 3FM5A 4LK0F 2OCCH 3LA2A 2ZJRF 1XG1A 2KJCA 1VQMI 1G3YA 1J2XA 3LSHA 4Z2YA 3K69A 1D3YA 3E5QA 4E7IA 2FMYA 2CH0A 2K7LA 3CMAI 4IX7A 2R7ZJ 2DT7B 3LA7A 4FX0A 1RR8C 4XLPF 4HSRA 1R4NB 1JJ8C 1SD4A 5HOOA 1I50J 2Y30A 4IHTA 1YO5C 5E20A 3MKYB 2M30A 1V54H 3RSNA 2Y2ZA 2LY2A 4KUMA 3X2QH 2IP2A 5HNFA 1FYLA 4H0EA 3N4MA 2F5DA 3MWMA 3FBNB 5J47A 2R7VA 4KICA 3PFIA 1GVJA 5TGTA 3KLNA 3W3CA 1VFCA 1WGXA 4LIUA 3GO5A 1Z0XA 4E7SA 1OCPA 3SDGA 2VN2A 2M8GX 5C4XJ 4M6VA 3S3NA 2QQ9A 3CMEI 1MDMB 2FU4A 5E3LA 4B48A 1R5GA 2XAFA 5LEKA 1T33A 1FC3A 2FOWA 3N05A 3HKZA 5GADJ 2K4JA 3EYIA 1GDTA 1T0FA 5M5WJ 2K85A 3CCSI 1R7JA 5F0HA 3A0HC 1VZ0A 2FRHA 4P5OA 4XL9A 3JRGA 4IHWA 2XUBA 5HDGA 2M1BA 5C3EJ 3RTRA 2W82A 3H1CA 4LK1F 3IH4A 5L3EA 2DPDA 2VOOA 3DP7A 5FKOA 1AWCA 4RB3C 4ON0A 1TL8A 3OYAA 3WTSC 2WB1A 1NK2P 1AOYA 2CFOA 3VDXA 2QQAA 2L4AA 4IHXA 4CGZA 1SFOJ 2K3PA 5ILUA 3DWLE 4AYBA 2LOOA 3RPUA 3G2BA 2VBWA 2W57A 4HOBA 3RQ4A 2CV1A 4GCVA 3AFHA 2RVCA 3HM5A 5FROA 3P7NA 3S2HJ 4Y52J 1B72A 4LB5A 3I4NJ 1MBHA 3HPHA 3S93A 2DBBA 2J5OA 5IOYA 3I58A 2WAFA 1Y1VJ 4IPAA 2OJED 3PIOF 3MZHA 4IVNA 4EEFG 2XDVA 2HTJA 3P9KA 2V6EA 1MBKA 4KT6A 4B4CA 1IJWC 1DGWY 3IAS2 2DK8A 4M6XA 3OOUA 3M4OJ 2DCEA 2XSDC 1LDKB 1YTYA 3PM1A 3DPLC 3FHNA 4F3QA 2E1MB 1R6RA 1OCZH 2HTSA 3FXJA 3JRIA 2L5QA 5DYMA 2K40A 3CCUI 2FX0A 1X2MA 1JKOC 1B9MA 2DMNA 4M6YA 5KCMA 3U1DA 2QSGX 1Y8QB 1XTAA 4L5JA 3TKYA 1U9OA 2HR3A 1MIJA 2COMA 3K4KA 3A4CA 1QHHD 1X3WB 4Y17A 4AU7A 2QKMB 3P9CA 5D5UB 2W25A 3B6AA 2MG4A 3I56I 1O3QA 3OYLA 1SMYF 5FGMA 5HLHA 1HSJA 5DDGA 4BE2A 1RI7A 1J5YA 2L02A 1MW7A 4UUTA 1JT6A 5ED4A 4OMZA 4IRGA 1TNSA 2BVLA 3GZNB 3JR9A 3GTGJ 2CO5A 1Z6RA 2F4MB 2EV0A 5A2QK 1DU6A 4M3BA 1GVDA 3BPVA 4W97A 2L7MP 1ODDA 3E6MA 1YLFA 4PGHA 1D0YA 2DFHA 5F0CA 3D1NI 1SVMA 3GTKJ 4XORA 2LFBA 1ZK8A 2WA0A 4DZJA 1RKWA 3G73A 4XR6A 2RKHA 1I3AA 4AC0A 5IY5H 3A01B 3I4PA 2QLZA 5DS9A 2KIMA 1G59A 2IJLA 4BGDA 2QQBA 1N75A 1I1GA 2FA5A 3L1PA 4I0BA 2XPUA 1S7AA 2NXNB 1JXSA 1MMGA 3L2VA 4KISA 3H92A 2KDZA 3VOEA 5GTHC 5EEGA 2OBPA 4Q4ZF 2CV2A 3ZQHA 1IXSB 4C2UA 2OZ6A 3GFJA 3PUFA 3DF8A 4NC6A 1FIPA 1BI3A 1XDSA 1KU3A 4ZTFA 4X1EA 3FWEA 5F1RA 5LD2C 1UB9A 4PJLA 2CW7A 5JI6A 1UG0A 1E3OC 3SFIA 3NEUA 2AXLA 1QVTA 4DOZA 3S3MA 3W6VA 2VL8A 1LEAA 4XICA 1ZGAA 2OU2A 4QWQA 1K78A 4D5CA 1JTXA 2BW3B 2XAGA 1W4MA 5DEQA 2UXNA 4D1QA 1XC5A 2GXAA 1R49A 2DFIA 4AIHA 4D0PA 3IL2A 1YS7A 3DXJF 5CQGA 1KGSA 2C6YA 1IN5A 3ASNH 3B6CA 4UXNA 2DU9A 1L0OC 4DNCA 3J7ZI 5J6XA 1ZRCA 2VBYA 2K86A 2LD5A 5M5XJ 1FLIA 3MD2A 1HW5A 3EETA 5HS9A 1MMSA 2CSOA 1P7IA 4U7DA 2VJIA 3HHGA 3FDYA 5LGNA 3OYJA 2AHQA 2UUZA 2MFZA 1X1CA 2QVOA 4G6TB 2OTLI 3CCYA 4I02A 1X2NA 1HBXG 1OYIA 3IH2A 1YG2A 3AL0C 4X6AJ 1ON2A 1Z91A 3WE2A 1LE8A 2NRAC 3ZCOA 2HS5A 4KIGA 2FQ3A 3KEQA 4FISA 1OCRH 2JQ7A 2BVMA 3MKWB 1P92A 4G94A 3OS2A 2JA7J 4RGSA 2HZTA 5BQTA 3I64A 1BA5A 2ZCWA 3JAMZ 1YJ9I 3M3YJ 1Z05A 4YFXF 5TRDA 4AIDA 2LRDA 2HKXA 2R92J 4IO9F 3F9KA 3H5RA 4CXFA 1D5VA 3HDDA 2VKEA 1U9NA 5TJJA 3OIQA 2E2HJ 4M71A 5M3FJ 3WTWC 3CESA 2R7RA 3RZOJ 3TO9A 3F21A 3HB9A 4Y7NJ 2B7EA 3OV8A 1D1AA 1X3UA 3BTLA 2JVHA 5L3CA 1J0RA 2F5FA 2ZKZA 1HCRA 2XKOA 1IZ1A 2L3DA 2IXSA 5D4SA 5JFRA 1V5GA 3UKGA 2ECBA 5CJ9A 3J7AO 3K4MA 1PUFB 1ZRFA 2ZXJA 3RYPA 5LLQA 5AIQA 1U8RA 4EJWA 3BP8A 5ICCA 4CCKA 4KFCA 3PJRA 1IGNA 1QNTA 5H6QA 3CDIA 4XLFA 4EJUA 3CMYA 2J5PA 3JSPA 2F5CA 2CFXA 1U3EM 3CJTB 4M73A 3RI4A 1XCVA 1XMKA 2UWMA 3V7CA 1ZRDA 5FKKA 4YG2F 2QSHX 1X1PA 2FBHA 1JKPC 3QPSA 2ELHA 3BG5A 3ESWB 4V2GA 1F5TA 3DV8A 4RAZA 1J09A 4BEHA 4U0VA 2XF6A 1Z7LA 3GZ6A 2IGOA 1XX5A 3FKJA 2DXIA 3JRFA 2ETHA 1B8IB 3Q9VA 4EJVA 4UV8A 2XV4S 2VBZA 5FRMA 5K5QA 2BHZA 1HLVA 3L2WA 5CKTA 4IRIA 1F43A 3LFKA 4G7OF 2EFOA 4AVZA 2R5ZB 3JRDA 2CW0F 2EILH 5LFAA 2JPCA 1ETOA 4ZZDA 1OLTA 4RB1A 2AQEA 3H3ZA 1A5JA 1YRNB 3I53A 2X1CA 4BBSJ 3RQIA 3ZQCA 4FT8A 3DEEA 3TDUC 1RPWA 5FLXZ 1JKRC 2DI3A 1FOYA 3CUOA 1HKQA 1AA7A 2LH9A 2IS1A 4RB0A 2Z5UA 2X1DA 4KITB 1RETA 1U8BA 4EQQA 4WWCA 4N0BA 3HGGA 2V79A 4OIOF 1LDDA 2G7HA 1T08B 4RS8A 3TGNA 2DJIA 3IAM2 9ANTA 3AG2H 4BUPA 3LNQA 1GHCA 3CCRI 4C3HJ 3RCOA 3B02A 4BYYA 3IUOA 3HC7A 5FLVA 3BJOA 3RPQA 2XHKA 2JRTA 1W36D 4KJZA 1LPQA 1MJBA 1MBEA 2NOJB 3O8HA 3CQZJ 2VE9A 1KONA 2O61A 4GFBA 4A3CJ 2VIXA 5GAGJ 3DTKA 2PMZN 5F27A 2ZJQF 4NUBA 2EZHA 5JR3A 2HVQA 3FIWA 3SEQA 4Y13A 1J75A 4JQFA 4L9VA 3C2BA 2NNYA 1XS9A 5FLXK 1X1BA 3BG3A 1E3HA 1F4KA 3QAHA 2DA5A 2JMWA 2HOAA 2E19A 3QPTA 5HDKA 3W2WA 3OYMA 1U5TA 4BACA 2WAQN 4PZJA 1D0ZA 1R36A 5C4JJ 2VB6A 4OIQF 4E70A 1MJAA 2DOFA 4UB6C 2JN6A 2LBFB 2X48A 4DBRA 2E35A 1D8KA 4GGGA 4XK4A 2RNGA 1T0FC 3DPUA 2BY1A 4U87A 2DODA 4B44A 2Q2EB 2ZXHA 4BHCA 2KIQA 2R5YA 2V9KA 2CQNA 1SVLA 3WGIA 4BQNA 2I10A 3SEZA 1IN8A 4CCLA 4OOIA 2AS5F 4A3MJ 4XRFA 3ZMSA 4MQ9F 3A1YA 3I5UA 4XN0A 4L9NA 3A02A 2DOAA 2IEKA 2R7QA 2R7DA 4EGYA 1WQ2A 4A6DA 1W7PB 4QPOA 2JTVA 1HF0A 1X19A 3BZ6A 4A3DJ 2KPMA 1IF1A 1ONVA 2B0LA 5JLXA 4EMSA 3WTUC 5DD8A 1G3WA 1OKRA 4MTEA 3SZTA 4RAYA 4ETSA 2ISZA 4HG2A 3E6BA 2RV8A 1AHDP 1MSFC 4L18B 1X1DA 2Y9YA 4U7BA 2M87A 2YX4A 4QSHA 3HPGA 1XN7A 3W6JB 1H9TA 4R79A 1PUEE 2X51A 5LGUA 2PJRA 5K5RA 5FO5A 2E2JJ 3HRMA 1IO2A 1FIAA 3ABTA 1UZCA 4RMNA 3FM3A 3F8NA 2V26A 1TNTA 1T95A 3AG1H 3VSKA 2IAIA 3PUBA 3LSRA 2UZKA 1ZR4A 3DKYA 2HXIA 4WK8F 1FY7A 5AONA 1E17A 3KZIC 1T8IA 2JWTA 3NWSA 1BR1A 3K1MA 2Z9OA 2EB7A 2RGVA 3AL0B 3TP3A 3CCMI 2HQRA 4NQWA 2QYOA 1W1WE 1YS6A 4KA4A 2BY3A 3WTTC 4RGXA 3NAUA 2JPBA 5LGTA 1CGPA 4O6JA 3CUQA 2M0CA 1ZYRF 3GUDA 3U2RA 4Z6YA 2AO9A 1IDZA 2DMPA 3V8LA 2KZGA 2M8EA 4CZCA 5B3SH 2DA7A 2FUG2 4GRIA 1FP1D 3IV5A 1FSHA 1BBYA 2KMUA 2LK2A 5CVUA 1QZYA 3HOTA 4C9YA 1MMAA 2QF7A 5K7HA 1BI2A 2E1NA 3T8RA 3PFYA 1ZN2A 4I2OA 1WI9A 1FYKA 2D5VA 2LG4A 5DM6F 4A3FJ 6PAXA 1GV5A 1FSEA 1MMDA 5J1RA 1EJ9A 2GWRA 1LVKA 4TV7A 3QP5A 1BI0A 3H0GJ 5EJCA 2VC0A 3VWBA 3L2CA 3F23A 2KL4A 3E3VA 3OYGA 1I27A 4XMYA 2EFNA 1K7AA 2BBYA 3WGHA 1FPQA 3TO6A 1G2HA 4J01A 1RZ4A 3I59B 2ZJ2A 3ZQIA 2D45A 2A69F 1UAAA 2X6OA 4HQEA 3K70C 3OYHA 5EG0B 3WU0A 1IRZA 2DOEA 1FTZA 3BOQA 3KIOA 4B1RA 4GYIA 4JX4A 2EK5A 5CVIA 3SJMA 2MLKA 3K4NA 4BKXA 1T38A 3U21A 2W85A 2ZSHB 3L7WA 5GAEJ 2GLOA 5HODA 2V1XA 3LSTA 2MD0A 2EINH 4BL0B 2CV0A 3O2PE 3ZP5A 1FOXA 4CCNA 3E5UA 2V1UA 3S8PA 2IT0A 1IN4A 2RQPA 4F52A 2RN7A 1XDUA 2CUEA 2L9RA 4II3A 1IRFA 1I3QJ 2DQLA 4M3FA 2QZ8A 2Z2SB 4MHGA 5J4YA 1YJNI 3H9QA 5J3LA 3HOUJ 4EM2A 3GTOJ 2QUFA 3ERED 4MIMA 3RKXA 2ESNA 4FHTA 1Z3XA 3TDZC 1S3JA 5D5XB 4E7ZA 5JLWA 5HVQC 3LAJA 1H88C 1TWGJ 3EYYA 1I39A 2GOMA 1V4RA 2LNBA 3GFIA 3BDDA 2W00A 2OD5A 1IG7A 1O7FA 3VYUB 4MGRA 1LDJA 2NVQJ 2CUFA 3H36A 1N25A 2DMUA 1W0UA 1BN5A 3I9V2 4XLAA 2BOLA 1X4PA 1PYVA 4E4HA 2PG4A 3DLAA 2WBMA 3CP2A 5IYBJ 1JKQC 2XVCA 2XB0X 5D4RA 3VSLA 2L54A 3LFUA 2M34A 3DKWA 3CF5F 5CPRB 5ERIA 1XSVA 4KMFA 3H3VK 1JI8A 4ZJZA 1ZAOA 4AIJA 2HOSA 2V4JC 3ABLH 2PMZA 1PP7U 4A3EJ 2VJ4A 2XIGA 4BE1A 2EJRA 5F6FA 2CS3A 3CC2I 4YRVA 5E1XA 2VUMJ 4BXUA 2DA3A 3SFZA 1VQ4I 4BQQA 4F7ZA 5AIPA 4PDKA 4UUSA 3H5AA 3QRFF 2WAQA 1XGOA 1IXCA 1UMQA 4EJTA 1OFCX 1YW9A 1ZG3A 4IQ4A 4L9TA 1FTTA 3K9TA 1R22A 2EBIA 1YITI 3QU6A 3CJNA 3ASOH 2EIMH 2KLOA 2ZXIA 2HDDA 1VTNC 4JX5A 5FD5A 2FOKA 1JE8A 2DJNA 1SFKA 1S7OA 2NS7A 1N78A 1K61A 4XRSA 4EATA 4JK1X 2M2EA 3H5NA 2F4OB 1ULYA 1W7PD 2IVMA 4YFKF 2XRLA 1HC8A 3RDIA 4HZFA 1OQYA 2GAUA 4I76A 4ZDOA 3T8TA 3ZN1A 1I6XA 1BJAA 3BR5A 2IPQX 1DDNA 5FD6A 5J8CA 3BT9A 2OA4A 1XB4A 2VASA 2NYXA 1H9GA 4A69C 4YELA 2KHMA 1MD0A 5A2QZ 3T1BA 2IW5A 1WH7A 2VQLA 2IA1A 4E6KG 2LVSA 1P9QC 1DPRA 4ENJA 1EF4A 5FB2A 3WTYC 2QSFX 2O8KA 3Q5FA 2OV7A 2D2WA 2XGCA 3CC4I 4RAFA 2P5KA 2XF7A 2UXXA 1R1TA 2MLGA 3GTMJ 1QGPA 1RKTA 3R60A 2IGMA 5IYCJ 3A01A 2W7NA 3SZPA 4R8HA 2K9SA 5GAHJ 1WJBA 1RRJA 3FK7A 4HV5A 1WVRA 2JA2A 5ICFA 1OPCA 5TISC 2MC4A 2PMHA 2GQQA 3M8FA 2CG4A 4JYKA 1BR4A 2K5CA 1BC8C 2M0MA 2KISA 1ETVA 1NH3A 4EGZA 5BNGA 3MVPA 1HKTA 3E0JB 3HOVJ 2BXYA 2F48A 1B72B 4IKFA 3E1SA 3GTQJ 3TMOA 1LJ9A 2KJBA 2M7BA 2CQ7A 3HTUA 2ELJA 4PJJA 1R9TJ 2GA2A 1IC8A 1IRGA 4AUXA 2O3FA 3IHUA 3ZQ7A 2HDCA 3DU6A 2V7FA 3A2KA 3OYDA 3TEDA 4FCYA 2P5VA 3N97A 5E17F 5BOXA 3GTPJ 1BW6A 2FJ1A 1ZH5A 1R5ID 1D1BA 3J7AY 4G6QA 2X6XA 1XGMA 5L3DA 1S9HA 2HXOA 3GLLA 5F0FA 4BBRJ 2VQCA 3WTVC 2G9WA 3ZQFA 3ULQB 1PDNC 5KAIC 3KCCA 1MNEA 3F0CA 1QU3A 3IP4B 1O3RA 1ETQA 1IUYA 1VQLI 5BPDA 4WXHA 4G9YA 2Q0OA 3HUGA 3E6DA 3H35A 2L7ZA 2JT1A 1L3LA 2CGPA 2OF7A 5IYDJ 3R0AA 3BZCA 2Y9ZA 2BE5F 4E7JA 4QTRA 3ZMUA 2HVRA 1AU7A 4CCMA 2ELKA 3CJQB 4EM1A 2MYSA 2M7AA 4UVAA 5KHDA 5ICEA 3MQ0A 2HNHA 1HW2A 4Y3OA 2JRMA 4ZDLA 2ZJPF 3M9AA 2ZNYA 1A6QA 3HBLA 3OIOA 4EVIA 3H0DA 4HDUA 4IRHA 1N77A 2H6CA 3M07A 2MH2A 2DFFA 1YI2I 1GUUA 1OJLA 1QZEA 2A6HF 4ZYHA 1ETWA 1SMTA 5DUKA 4O3MA 1LB2A 2COBA 2H09A 1VQ6I 4MEXF 2ID6A 5DTDA 3BROA 3RZDJ 3MKZA 3F8CA 3S16J 2HQ5A 3ZN0A 5KK1A 2RC4A 5ILVA 4HW0A 4ZTJA 1IXRC 2E7XA 4PK4A 1JT0A 1K4SA 2LMDA 2MBFA 2R7FA 3JRBA 3BR3A 4DGWB 2XAHA 1OCTC 3JW4A 4HV6A 1LNWA 3MN2A 1DP3A 1T98A 1R1UA 1FOWA 3EQLF 2CWEA 1MBGA 1U0JA 4XKCA 4A5NA 3BTCA 3GBGA 4V19K 1J9IA 1VI0A 4NB5A 4CA0A 1CF7A 4MO7A 5B66C 2R0QC 2R7XA 2LYCA 4KYWA 4XBFA 2B63J 5GP9A 3BTIA 3FXMA 3FXLA 2DK5A 2M45A 3BY6A 3V4GA 3FHZA 4XKVA 3GEZA 2VKVA 3RJPA 1T56A 2M4GA 3CO7C 2I8DA 1TW3A 3UNGC 3O8GA 4XLEA 2LP0A 1H89C 4KT5C 2NVTJ 3DEUA 2KRFA 1AKHA 4C3JJ 5EEAA 2DLLA 3GW2A 1ORKA 2F2EA 2VOPA 4EJOA 3Q0WA 4PJMA 3GLXA 2EA4A 3ERMA 4CSWA 2GZWA 3I71A 3CJRB 3ECHA 5FFXA 1JUMA 2VE8A 2ME6A 3OY9A 2VODA 1I1SA 1SD6A 1TWAJ 1R71A 1WFXA 2VC1A 2LF7A 2IGKA 2BY0A 3R0JA 3BG6A 5IP7J 4LMYA 2LY9A 3LOCA 1HKSA 1KU2A 1K83J 4XKWA 3K6GA 3ABKH 3GMEA 2LR8A 5D8KB 3QYBA 4F93B 2ZO4A 2KQRA 5M5YJ 4B8XA 3H9GA 2BGCA 1LE8B 4B47A 3GXOA 4MNUA 1Z6TA 5FKMA 3ABUA 2XRNA 1A35A 1FZPB 1KA8A 2LDUA 3TO7A 3BJ6A 1WWXA 2ZMEA 4OINF 3CUQC 5FLMJ 4XSXF 4AD9A 3HOXJ 5IT9K 1SFXA 5BMZA 2VQGA 5HLIA 3K4BA 2JJ7A 4F91B 2TDXA 5DCMA 1YW8A 1FMWA 2Y0SN 4KIFA 2JSCA 2DDAA 2FNPA 4KMUX 5E1ZB 1ON1A 3SZGA 3WU1B 2E1OA 5KVRA 4II2A 1FWZA 2HEOA 2LF8A 3PNVA 3FBIB 3H3UA 1WJAA 1BI1A 2XROA 3WE3A 2Z33A 1O4XA 2JSPA 2A07F 1HDPA 3RPUD 4NC7A 2CW8A 1BL0A 3OL4A 5CLSA 5HDNA 2V9PA 1KU7A 4WXDA 2WADA 3GYHX 1Y8RB 4IHYA 3GTLJ 2P6TA 4PJNA 5HNHA 4YIIA 3DBHB 2LTPA 1R58A 2YU3A 1MH4A 4KIBA 2OPTA 3FZVA 2ESHA 2Q1ZB 1D0XA 2EV5A 3OMYA 3ZGKA 1E3PA 2K9QA 1UHWA 2QQ8A 2Z16A 4HBLA 3G71I 4O5VA 4OIRF 2DA1A 3PQKA 1TQPA 5FRNA 1HA8A 1JHHA 3GCMA 1TQIA 2VXDA 1SC7A 2VONA 3PSIA 4LG0A 1GV2A 3BG7A 2GBYA 5FKNA 2FE3A 4QLCU 3CZ6A 3BCAA 2VT3A 4CYCA 1FYMA 3BLYA 3WG7H 2X1EA 3KLOA 3KYCB 1MSEC 2EZIA 5IP6A 4L0YB 1OYWA 3PQJA 4BEHB 3SQNA 3GTJJ 4Y15A 4HX4A 1IUFA 1R23A 3HOWJ 2HZDA 1WKMA 2BV6A 4ITVA 1OCOH 1RESA 3Q9SA 2NVUB 4BE0A 2WC2A 2X6WA 3KZYA 1VQ7I 1O3SA 4LD5A 1BC7C 3JRCA 4OWRB 3K7AJ 2LSOA 2FEZA 4A3GJ 2K3FA 4CICA 4A3IJ 3SXYA 3J80K 1ZGWA 4YEJA 5IT3A 2OTJI 4D9JA 2N8GA 2HPIA 2MA3A 3OL3A 3R4KA 5KNLA 4NBQA 2A5YB 1BJZA 1UJ8A 3KP7A 2G0EA 5J1UA 1W0TA 3FMSA 4DYRA 2XF5A 5D6EA 1WJFA 2XPWA 3HJEA 1W5CC 1G3SA 4FE4A 1I5ZA 2EZKA 1EKEA 3JCUC 3ZMVA 2PEXA 3K70D 4HA8A 3CCQI 3JRHA 2IRFG 4RM3A 1EH8A 2LREA 3C2HA 2WTEA 1F9NA 1V5FA 1O3TA 2KDOA 1B59A 2PMUA 2QBYA 2L01A 3MEXA 2FXAA 3C3WA 2BZTA 2WB1N 4I7HA 3BG9A 3HSFA 3CMMA 3F22A 3KFWX 3M7GA 3EUAA 1X58A 3QYEA 4FE7A 4N4OB 3HOYJ 2FF4A 4AYBN 2BEOA 3OSFA 2A05A 2UV1A 5JHUA 4E7HA 3QPLA 5B1BH 2DAOA 5EGOA 1G3TA 2IBDA 2H1LA 4FX4A 3DTIA 1JUSA 2W1OA 1ETKA 1DQUA 2DMTA 1ZLJA 2H8WA 4XIDA 2RNJA 4XSZF 4IL6C 3S2DJ 4UHTA 2OUMA 4S0HB 2DA2A 5LHIA 4CH7A 3LSGA 5FFZA 3OS0A 4RA2A 1S5LC 3L2UA 1SD7A 4C3IJ 3NQOA 5EYRA 1B1BA 4LOCA 2X6YA 2R7TA 1Y0NA 4L9JA 1ZREA 3BWGA 3BQYA 3DKXA 2ME0A 2O8XA 2FD5A 3K4JA 3WG9A 3KYLA 3FX3A 3NARA 3CD6I 2ID3A 3LWFA 5M3MJ 2A6EF 4WX9A 1FP2A 5BS6A 2R5YB 4ZYDA 3GVAA 3IKTA 3W6KB 5F64A 1SFEA 3W2VA 3QYFA 4I0AA 5KAFC 4BU2A 4PCQA 4MTDA 4C2TA 2JK3A 3QODA 1HSTA 3I59A 4EM0B 2W4SA 4P1WA 3DLLF 4G7HF 2O0YA 4IEJA 3WTXC 1TP4A 2FBKA 2XGDA 1QRYA 3PL8A 2WV0A 2BY2A 3KP2A 3PNTA 4CO8A 2E1CA 2GIZA 1FT9A 3E7LA 3HOZJ 1JGSA 1WRJA 3FXQA 1DGRM 4B09A 2NVXJ 5IP9J 3ONQA 3FXOA 2RREA 4JBAA 3ZMDA 4ANJA 4PUSA 2Z3YA 1OYYA 3LL7A 3TW7A 1ENHA 5LBQA 2PJPA 4BJ6C 4FTHA 4RDUA 1FBQA 2NNNA 4PSXA 3C18A 3RKWA 4KN7X 1XMXA 2TCTA 5L3BA 1UELB 1FNNA 5C44J 1VQPI 2PJRB 2ZNZA 4HX8A 4CYDA 2X0LA 4XKBA 3CCEI 3BZKA 3KE2A 3FXRA 1T6SA 2YS9A 3LSMA 2WY7Q 3GF2A 4RB2C 1V55H 2VI6A 3DBRB 1O57A 4P9FA 1ZGJA 1KZHA 2CUJA 1S7EA 1XPXA 4WXCA 5CVVA 4BDYA 1LKXA 1VQKI 2Y0SA 1EH7A 2VKHA 3PO2J 1XCBA 4RGRA 3AG3H 2HPMA 4P55A 1XGSA 4BAYA 1MDMA 1PJRA 3RYRA 3LMMA 1REPC 5JHFA 3ZMTA 2QKLB 4DBQA 4NQWB 2YR2A 1WPKA 2YPRA 3TOBA 3KP4A 3NRVA 5DD4A 5EEHA 5H6RA 1F1ZA 2DN0A 4XRSG 1A6IA 2CQQA 4AWXB 2XAJA 2E2IJ 3CUQB 3F8BA 4C2MJ 4A12A 2F6CA 2EQRA 2L7KA 4XLNF 4BXXJ 1Y0UA 2HKOA 3S15J 4D7NA 1ACIA 4P96A 1USSA 3K4CA 1OR7A 3HRSA 2XB5A 2PBIA 3G4SI 1D5YA 3J7YJ 5E79C 2Y31A 1R4MB 3P9IA 3TOAA 2JUCA 3AG4H 3OYCA 2EFWA 1QBJA 3HTSB 3DFGA 1MBFA 3CP8A 4V2FA 2CQKA 5DV5A 2R7OA 4FASD 2GM4A 3K2ZA 4CCOA 1P4AA 1S72I 2HOTA 2O6GE 3R6SA 1A31A 1UG2A 1USTA 5DCFA 4BHPA 4D7MA 2QWWA 3ZQGA 4HPQA 2WV1A 3ZQQA 1TW2A 2L7FP 4IQJA 2HYJA 2NS0A 3L2QA 4M9XA 4HF2A 3J81K 2ZB9A 2YSRA 1OMIA 1E0EA 1MJ9A 1T2KA 2R7SA 2A6TA 4IHSA 1UFMA 2HI3A 4CUGA 2O5RA 4G7ZF 1NHAA 4ZH4F 4H4KC 4PFOA 1TT0A 1V5EA 4JP0A 5F08A 4PGGA 5IPAA 2V9VA 2VPRA 3CDHA 1SANA 3BPXA 3T0YA 2ZSIB 4UNOA 3BQZA 1XGNA 3WHCA 4DZPA 3MFKA 4L5EA 2DA6A 5K7FA 1Y6IA 2P4WA 3KPHA 1WJ5A 1YOVB 3OOPA 4NHJA 4BQOA 2E7WA 5D6FA 2DW4A 4RLQA 1Z9CA 3S1QJ 1HXDA 4AM3A 5E3NA 4UUVA 2DT6A 1J59A 2IS2A 1BOAA 4BY1J 1QA6A 1QVUA 2KKOA 2B9SA 1H0MA 2OCEA 3HZJA 3D0SA 1OISA 2EFPA 4A2UA 3Q0VA 1NG7A 4LG3A 5B1AH 2HGCA 2AXTC 3D5SC 3D5LA 4DW6A 1K6YA 4W1UA 2ZC2A 2MW8A 4HF0A 2VT2A 1ZR2A 2E60A 3SDBA 2BYVE 2Y48A 2KRCA 1WI3A 1IN6A 3IC7A 4L0ZB 4LIVA 2FQ4A 2A61A 2DA4A 3CO6C 3KP6A 2VXZA 3LSJA 5J8FA 1WJEA 2M4KA 1BIBA 1GXQA 1DP7P 4G12A 2MGQA 3CLOA 2DYRH 2KZVA 3WTZA 3S2WA 3O6BB 1QQIA 4LB6B 1IV8A 3IKVA 3S17J 2IA2A 4HX7A 1Y1WJ 3K2AA 1RC9A 4D5FA 3IH3A 4K2EA 2ADUA 4FQGA 1YX3A 1POGA 1MKMA 2P0WA 4ZYAA 4UUSB 2WWYA 3M1CA 3OYNA 4CCJA 2YUSA 3WU2C 2DDBA 2CYYA 2DT5A 4M3DA 1R1VA 4BJTA 4HYEA 3QPHA 3TQNA 2DMQA 2Y69H 2EFQA 2ZBKA 2ZMEC 2NAZA 2WY8Q 3GX4X 4HLYA 1SAXA 4GO1A 1KYWA 4NC8A 2FBIA 2VLAA 1MH3A 2NS8A 4B43A 4UY8I 3C1DA 2E5ZA 1LFBA 2MABA 1TWHJ 3FMRA 1U78A 3VB2A 1YX5A 4BDZA 2WAEA 1WJDA 2KIUA 3U9GA 3BC8A 3ZPLA 1ZQ3P 3DPTA 2O7OA 2FMLA 4ABZA 2XC7A 1ZARA 5L3FA 2ACJA 5HLTA 2DFEA 1WCMJ 3HL2A 1MBJA 2P6SA 5DUIA 1D1CA 1DU0A 2BW3A 2HQNA 3COAC 4WF2A 3TW6A 1KQ8A 2PI0A 3Q3SA 4LJZF 2NVYJ 1LFUP 2HDWA 3KP5A 5EZHA 1WJCA 1IDYA 4UVBA 3ML6A 4HF1A 3CTAA 4RGUA 5EZGA 3TL4X 2XGXA 4BHBA 1RNLA 1Z77A 2IGNA 2VJJA 3KYDB 3HXLA 3I0TA 4HQMA 5EDNA 1RIOH 4Q5SF 2H27A 1JJ6C 2H6BA 2QENA 4CDGA 5EF6A 3S1MJ 3EUHA 2CQXA 3JREA 1FMVA 3QQAA 4J19A 3DCFA 4NDLA 3PSFA 2GOXB 1X4OA 4ASNA 4PJ0C 4UVCA 2L0KA 2PLYA 2LKPA 2W84A 2X9DA 2L9NA 3FF5A 5H2FC 1UHMA 2R3SA 5F1JA 4XOTA 4X0GA 3AAFA 2A68F 1MMNA 1TBXA 4BY7J 4OIPF 3VYTB 4UV9A 5E3OA 3K10A 4KNYA 3QU3A 5FJ8J 2OAZA 1NG6A 5DM7F 5FKLA 3IRQA 2K4BA 1BW5A 1A36A 4A3LJ 4N9HA 3G3ZA 1VQ9I 4M9ZA 4M9SA 1R00A 2D1HA 3MAJA 1P2FA 1KU9A 1SD5A 3MKLA 2EIKH 4KDPA 4DJAA 1FOKA 2V1DA 2XKPA 3MMYB 3QOPA 1WZ2A 2Z99A 1G8XA 4Y4RA 1Z1DA 1JGGA 3CLQA 3KX2A 1TC3C 3O3KA 4JX6A 4XRMA 3E6CC 1U5TC 4I98B 3GFMA 2JA5J 4NNJA 3FISA 4IHVA 4XLHA 5D8LB 5E1WA 3RKQA 3OYKA 1WH5A 1BM9A 3IRRA 1ZKGA 4ZZLA 4IJAA 3M1EA 4U0YA 2F5EA 2K9NA 1FBSA 2BHYA 4E7LA 1KQ9A 5E18F 1W5TA 1YIOA 1XSDA 2KFDA 3HUGB 5GPAA 2P81A 2DYSH 2XGEA 3K4LA 3ZR8X 1VQOI 4I01A 3DTEA 2L4MA 1MZBA 3GFLA 4BXFA 1LQ1A 2YX7A 4IF4A 1P6RA 3MZYA 4ESFA 1PUFA 4OAZA 4PFPA 4FETA 2QEXI 2EH3A 1QPIA 1XD7A 4MQVA 2Q8KA 3RIRA 2I5UA 3OYIA 2DPUA 3VODA 2ECCA 1EA3A 3BTJA 4LLNA 1YW7A 4MFEA 1K78B 3K1PA 2MD5A 3HOSA 3LSKA 3F3XA 3V8JA 3VYRB 2H8RA 4HDVA 4XONA 2VQHA 2W48A 1FJLA 4DQ2A 1T39A 3WHBA 3Q0UA 3W2AA 2A5WA 3BR6A 5CYVA 4YFNF 3FK6A 1A04A 2PN6A 3BR1A 1OCCH 2R4GA 5IT9Z 3NWTA
chains in the Genus database with same CATH topology
4YIFA 1TTYA 4AVPA 1XMAA 2XAQA 1K6OA 4ENMA 2ZFWA 5CVRA 2IA0A 1EV7A 2O03A 1FBUA 1GXPA 1KYZA 1Q1HA 1O7LA 2A3SA 3SHFA 2XASA 4BQAA 1YYVA 3LA3A 1QPMA 2X4HA 1U6GA 2Y0MA 3V8KA 4U88A 3ISPA 1CF7B 1E2XA 5LRRA 3QP6A 2D1VA 1S8NA 2EWNA 5D5WB 1P4WA 2DTRA 4CZZA 1Z7UA 2HWVA 1DPUA 3JAMK 4U0WA 5ILSA 1FX7A 1G6NA 5JVTA 4MEYF 4HAMA 3JTHA 3VFZA 1V3FA 1TQMA 4ENNA 3F6VA 4ZYEA 5H20A 4KN4X 1D8JA 4N9IA 4A0XA 2GXGA 1IN7A 3HIFA 3L9FA 2M5WA 3HHHA 3J80Z 2Y75A 5K5OA 3LAPA 2HFHA 5E8IA 1ZHFA 4ESJA 2PQ8A 2Q2EA 2ZMEB 2MC3A 1U2WA 4LGWA 1RUNA 4M74A 3DQVC 5DCMB 5D5VB 3R61A 1R5HA 1EH6A 2V6CA 3ZMZA 3WGGA 1QO0D 1W7PA 4BNCA 4S05A 2OQRA 1YQAA 1UCRA 4R1HA 1QZZA 3BJAA 1C0WA 5BPIA 1ZLKA 1IW7F 4LFUA 3C7JA 2EA2A 1B4AA 4G6DA 3EDPA 3JSOA 3V7RA 2P7VB 1HQCA 3K0LA 3LQQA 5CVJA 3E5XA 1PP8F 1MGTA 1ZG5A 3K1NA 4BH9A 4G8XA 1KQ0A 2MH9A 3L00A 3JTGA 4LLLA 3I54A 2GXBA 4OU0A 2K27A 3F72A 4A0YA 3GZ5A 3KETA 2GIVA 2EV6A 3WODF 1YFHA 4LG0B 4L5IA 3F6OA 3ROUA 5LHGA 1S6LA 4ESBA 4CHUA 3IWZA 1S29A 2P8TA 3GWZA 2JZYA 4M72A 5ICGA 5LRSA 1RUOA 1SFUA 3FXUA 1LEBA 3LQRA 2RDPA 3KZZA 2OZUA 5HS8A 2FNAA 4OMYA 4A6EA 4WCGA 3FMQA 1J7KA 2DO7A 2KIFA 2QM3A 4Q48A 1U5TB 1IAWA 3MCZA 5E8GA 3IWFA 2W24A 4Q47A 1JHFA 4S04A 3HYIA 3HSRA 2P7CB 1ZG1A 3ECOA 4P9UA 1LVAA 2QBYB 1STZA 3T5XA 1K79A 3REOA 1G4DA 5HS7A 2GA1A 1P4XA 4GYGA 3M8EA 1HW1A 2STTA 2ISYA 3ELKA 3V7SA 1XSXA 2P5LC 3KP3A 4AIKA 5HLGA 1W5SA 2FSWA 3RKYA 1WSUA 1B6AA 4I09A 5K1YA 3HSEA 3F8MA 1TLHB 2HOEA 4GXOA 4A5MA 3L09A 2G7UA 4ENKA 4A0ZA 2H94A 3B73A 1BIAA 2K02A 2STWA 3J81Z 3E97A 2HYGD 2HYFA 5L3GA 2PFBA 5LHHA 3HRTA 2OQGA 3F8FA 4EV0A 3KEOA 4IXAA 3HRUA 2VBXA 3VEPA 1DUXC 4LLGF 1B9NA 5LEJA 4ZYGA 4HLXA 2DQRA 3FM5A 4LK0F 3LA2A 2KJCA 1G3YA 1J2XA 4Z2YA 3K69A 1D3YA 3E5QA 2FMYA 2K7LA 3LA7A 4FX0A 4XLPF 1SD4A 5HOOA 4IHTA 1YO5C 5E20A 2M30A 4KUMA 2IP2A 1FYLA 4H0EA 3N4MA 2F5DA 3MWMA 4KICA 3PFIA 1GVJA 3KLNA 3GO5A 2VN2A 2QQ9A 1MDMB 2FU4A 1R5GA 2XAFA 5LEKA 1FC3A 2K4JA 3EYIA 1T0FA 1R7JA 4P5OA 2FRHA 2XUBA 5HDGA 2M1BA 3RTRA 4LK1F 5L3EA 2DPDA 2VOOA 3DP7A 1AWCA 4RB3C 4ON0A 3WTSC 1AOYA 2QQAA 2L4AA 4CGZA 5ILUA 3RPUA 2VBWA 2W57A 4HOBA 4GCVA 2RVCA 3P7NA 4LB5A 2DBBA 2J5OA 3I58A 4IPAA 3MZHA 4IVNA 2HTJA 3P9KA 2DK8A 4M6XA 1YTYA 1LDKB 3DPLC 2HTSA 5DYMA 1B9MA 4M6YA 3U1DA 4L5JA 3TKYA 2HR3A 2COMA 4Y17A 3P9CA 5D5UB 2W25A 1O3QA 1SMYF 5FGMA 5HLHA 1HSJA 5DDGA 1RI7A 1J5YA 2L02A 5ED4A 4OMZA 4IRGA 1TNSA 2CO5A 1Z6RA 2EV0A 5A2QK 3BPVA 1ODDA 3E6MA 1YLFA 4PGHA 3G73A 2RKHA 3I4PA 2QLZA 2KIMA 2IJLA 2QQBA 1I1GA 2FA5A 4I0BA 1S7AA 1JXSA 3H92A 3VOEA 5EEGA 2OBPA 4Q4ZF 1IXSB 2OZ6A 3GFJA 3DF8A 1BI3A 1XDSA 1KU3A 3FWEA 5F1RA 1UB9A 5JI6A 3NEUA 2AXLA 1LEAA 1ZGAA 2OU2A 4QWQA 1K78A 2XAGA 1W4MA 5DEQA 2UXNA 2DFIA 4AIHA 4D0PA 3IL2A 1YS7A 3DXJF 1KGSA 2C6YA 1IN5A 4UXNA 2DU9A 1L0OC 4DNCA 5J6XA 1ZRCA 2VBYA 2K86A 1FLIA 1HW5A 3EETA 5HS9A 2CSOA 4U7DA 3HHGA 5LGNA 2QVOA 4I02A 1HBXG 1OYIA 1YG2A 1ON2A 1Z91A 3WE2A 2NRAC 2HS5A 4KIGA 2FQ3A 3KEQA 1P92A 4G94A 4RGSA 2HZTA 5BQTA 3I64A 2ZCWA 3JAMZ 1Z05A 4YFXF 5TRDA 2HKXA 4CXFA 1D5VA 5TJJA 4M71A 3WTWC 3TO9A 3F21A 3OV8A 1X3UA 5L3CA 1J0RA 2F5FA 2ZKZA 2XKOA 1IZ1A 2L3DA 5D4SA 5JFRA 3J7AO 5CJ9A 1ZRFA 2ZXJA 3RYPA 5LLQA 5AIQA 1U8RA 4EJWA 3BP8A 5ICCA 4KFCA 1QNTA 5H6QA 4EJUA 2J5PA 3JSPA 2F5CA 2CFXA 1U3EM 3RI4A 4M73A 1XCVA 1XMKA 2UWMA 3V7CA 1ZRDA 4YG2F 2FBHA 2ELHA 1F5TA 3DV8A 4RAZA 4U0VA 3GZ6A 2ETHA 3Q9VA 4EJVA 4UV8A 2XV4S 2VBZA 5K5QA 4IRIA 3LFKA 4G7OF 2EFOA 2CW0F 2JPCA 4ZZDA 4RB1A 3H3ZA 3I53A 4FT8A 3TDUC 5FLXZ 2DI3A 1HKQA 3CUOA 4RB0A 2Z5UA 4EQQA 4WWCA 4N0BA 2V79A 4OIOF 1LDDA 2G7HA 4RS8A 3TGNA 1GHCA 3B02A 4BYYA 3BJOA 3RPQA 2XHKA 2JRTA 1MJBA 2VE9A 2O61A 5JR3A 4Y13A 1J75A 5FLXK 4JQFA 4L9VA 2NNYA 1F4KA 3QAHA 3QPTA 5HDKA 1U5TA 4PZJA 1R36A 4OIQF 4E70A 1MJAA 1D8KA 4GGGA 4BHCA 3WGIA 2AS5F 1IN8A 4OOIA 4XRFA 3ZMSA 4MQ9F 3I5UA 4L9NA 2R7DA 4EGYA 1WQ2A 4A6DA 1W7PB 2JTVA 3BZ6A 1IF1A 1ONVA 2B0LA 4EMSA 3WTUC 5DD8A 1G3WA 1OKRA 4MTEA 3SZTA 4RAYA 4ETSA 2ISZA 3E6BA 2RV8A 4L18B 4U7BA 2M87A 2YX4A 1XN7A 3W6JB 1H9TA 4R79A 1PUEE 5LGUA 5K5RA 5FO5A 3HRMA 3ABTA 3FM3A 3F8NA 1TNTA 2UZKA 4WK8F 1FY7A 5AONA 1E17A 3K1MA 2Z9OA 2EB7A 2RGVA 2HQRA 4NQWA 2QYOA 1YS6A 4KA4A 3WTTC 4RGXA 2JPBA 5LGTA 1CGPA 4O6JA 3CUQA 1ZYRF 3GUDA 3U2RA 3V8LA 2M8EA 1FP1D 1FSHA 1BBYA 3HOTA 1QZYA 5CVUA 1BI2A 2E1NA 3T8RA 1ZN2A 4I2OA 1WI9A 1FYKA 6PAXA 1FSEA 2GWRA 4TV7A 3QP5A 1BI0A 2VC0A 3L2CA 3F23A 3E3VA 1I27A 1K7AA 2EFNA 2BBYA 3WGHA 1FPQA 3TO6A 1RZ4A 3I59B 2ZJ2A 2D45A 2A69F 4HQEA 3WU0A 3BOQA 4GYIA 2EK5A 5CVIA 2MLKA 1T38A 2W85A 3L7WA 2V1XA 3LSTA 3O2PE 3ZP5A 3E5UA 2V1UA 2IT0A 1IN4A 2RQPA 2RN7A 1XDUA 4YFKF 1IRFA 2DQLA 2QZ8A 4MHGA 4EM2A 2QUFA 3ERED 3RKXA 2ESNA 4FHTA 5D5XB 3TDZC 1S3JA 5HVQC 3LAJA 3EYYA 1V4RA 2LNBA 3GFIA 3BDDA 2OD5A 1O7FA 4MGRA 1LDJA 1BN5A 2PG4A 2XVCA 5D4RA 2L54A 3DKWA 5ERIA 1XSVA 4KMFA 4AIJA 1ZAOA 1PP7U 2XIGA 2EJRA 5F6FA 5E1XA 4BXUA 3SFZA 4F7ZA 5AIPA 4PDKA 3QRFF 1XGOA 1IXCA 4EJTA 1YW9A 1ZG3A 4L9TA 3K9TA 1R22A 3QU6A 3CJNA 1VTNC 5FD5A 2FOKA 1JE8A 1S7OA 4JK1X 1ULYA 1W7PD 2IVMA 3RDIA 4HZFA 2GAUA 3T8TA 3ZN1A 1I6XA 1BJAA 2IPQX 1DDNA 5FD6A 5J8CA 2OA4A 1XB4A 2NYXA 1H9GA 1MD0A 5A2QZ 3T1BA 2IW5A 2IA1A 1DPRA 4ENJA 5FB2A 3WTYC 3Q5FA 2D2WA 2P5KA 2UXXA 1R1TA 2MLGA 1QGPA 3R60A 3SZPA 4R8HA 4HV5A 5ICFA 1OPCA 2PMHA 2GQQA 3M8FA 2CG4A 1BC8C 4EGZA 1HKTA 1LJ9A 2KJBA 3HTUA 2GA2A 1IRGA 2HDCA 2O3FA 3IHUA 3ZQ7A 2P5VA 3N97A 5E17F 5BOXA 1ZH5A 4G6QA 1XGMA 5L3DA 3WTVC 2G9WA 3ULQB 1PDNC 3KCCA 1O3RA 1IUYA 5BPDA 4WXHA 4G9YA 2Q0OA 3HUGA 3E6DA 1L3LA 2JT1A 2CGPA 3R0AA 2BE5F 3ZMUA 4EM1A 4UVAA 5ICEA 3MQ0A 1HW2A 3M9AA 2ZNYA 4EVIA 4HDUA 4IRHA 2H6CA 2MH2A 2A6HF 4ZYHA 1SMTA 5DUKA 4O3MA 1LB2A 2H09A 4MEXF 3BROA 3F8CA 3ZN0A 5KK1A 2RC4A 5ILVA 4HW0A 1IXRC 2E7XA 2MBFA 2R7FA 2XAHA 3JW4A 4HV6A 1LNWA 1T98A 1R1UA 3EQLF 2CWEA 4A5NA 1J9IA 4NB5A 1CF7A 4KYWA 4XBFA 2DK5A 2M45A 3BY6A 3V4GA 3FHZA 3GEZA 3RJPA 3CO7C 1TW3A 4KT5C 3DEUA 2KRFA 2DLLA 3GW2A 2F2EA 2VOPA 4EJOA 3GLXA 2EA4A 2GZWA 3I71A 5FFXA 3ECHA 2VE8A 2VODA 1I1SA 1SD6A 2VC1A 2LF7A 3R0JA 4LMYA 1HKSA 1KU2A 5D8KB 2ZO4A 4B8XA 2BGCA 3GXOA 4MNUA 1Z6TA 3ABUA 2XRNA 1FZPB 1KA8A 2LDUA 3TO7A 3BJ6A 1WWXA 2ZMEA 4OINF 3CUQC 4XSXF 4AD9A 5IT9K 1SFXA 5BMZA 5HLIA 2TDXA 5DCMA 1YW8A 4KIFA 2JSCA 2FNPA 4KMUX 5E1ZB 1ON1A 3WU1B 5KVRA 1FWZA 2HEOA 2LF8A 3H3UA 1BI1A 2XROA 3WE3A 2Z33A 2A07F 5CLSA 5HDNA 1KU7A 4WXDA 3GYHX 2P6TA 4YIIA 1R58A 2YU3A 4KIBA 3FZVA 2ESHA 2EV5A 1UHWA 4HBLA 4O5VA 4OIRF 3PQKA 1TQPA 1JHHA 1TQIA 2VONA 4LG0A 4QLCU 2FE3A 2VT3A 1FYMA 3KLOA 4L0YB 1OYWA 3PQJA 3SQNA 4Y15A 4HX4A 1R23A 1WKMA 2BV6A 3Q9SA 2WC2A 3KZYA 1O3SA 4LD5A 1BC7C 2LSOA 2FEZA 4CICA 3SXYA 3J80K 5IT3A 2MA3A 3R4KA 2A5YB 3KP7A 3FMSA 5D6EA 1G3SA 1I5ZA 3ZMVA 2PEXA 4HA8A 2IRFG 1EH8A 2WTEA 1F9NA 1O3TA 2PMUA 1B59A 2QBYA 2L01A 3MEXA 2FXAA 3C3WA 4I7HA 3HSFA 3F22A 3KFWX 3M7GA 2FF4A 2BEOA 5JHUA 2DAOA 1G3TA 4FX4A 1ZLJA 2RNJA 4XSZF 4UHTA 5LHIA 5FFZA 1SD7A 3NQOA 1B1BA 4L9JA 1ZREA 3BWGA 2O8XA 3WG9A 3FX3A 3LWFA 2A6EF 4WX9A 1FP2A 5BS6A 4ZYDA 3GVAA 3IKTA 3W6KB 5F64A 1SFEA 4I0AA 4PCQA 4MTDA 1HSTA 3I59A 4EM0B 4G7HF 2O0YA 3WTXC 2FBKA 2WV0A 3KP2A 4CO8A 2E1CA 1FT9A 1JGSA 1WRJA 3FXQA 4B09A 4JBAA 3ZMDA 2Z3YA 1OYYA 5LBQA 2PJPA 1FBQA 2NNNA 3C18A 3RKWA 4KN7X 5L3BA 1FNNA 2ZNZA 4HX8A 4CYDA 2X0LA 3KE2A 3FXRA 1T6SA 3GF2A 4RB2C 1O57A 4P9FA 1ZGJA 4WXCA 5CVVA 1EH7A 1XCBA 4RGRA 4P55A 1XGSA 4BAYA 1MDMA 3RYRA 1REPC 3ZMTA 2YR2A 2YPRA 3TOBA 3KP4A 3NRVA 5DD4A 5EEHA 5H6RA 1F1ZA 4AWXB 2XAJA 3CUQB 3F8BA 4A12A 4XLNF 1Y0UA 2HKOA 4P96A 1USSA 1OR7A 3HRSA 2PBIA 3P9IA 3TOAA 2EFWA 1QBJA 3HTSB 3DFGA 5DV5A 2CQKA 3K2ZA 1P4AA 2O6GE 3R6SA 1USTA 5DCFA 4BHPA 2QWWA 1TW2A 2NS0A 4M9XA 4HF2A 3J81K 2YSRA 1OMIA 1MJ9A 1T2KA 4IHSA 1UFMA 4G7ZF 1NHAA 4ZH4F 4PGGA 2V9VA 3CDHA 3BPXA 3T0YA 4UNOA 1XGNA 3MFKA 2P4WA 3OOPA 4NHJA 2E7WA 5D6FA 2DW4A 1Z9CA 1HXDA 4UUVA 1J59A 1BOAA 2KKOA 1H0MA 3D0SA 2EFPA 4A2UA 2HGCA 3D5LA 4HF0A 2VT2A 2BYVE 2Y48A 3IC7A 4L0ZB 1IN6A 2A61A 3CO6C 3KP6A 2VXZA 5J8FA 1BIBA 1GXQA 1DP7P 3CLOA 3WTZA 3S2WA 3O6BB 1QQIA 4LB6B 3IKVA 2IA2A 4HX7A 4K2EA 2ADUA 1MKMA 2WWYA 2CYYA 2DT5A 1R1VA 4HYEA 3QPHA 3TQNA 2EFQA 2ZBKA 2NAZA 3GX4X 4HLYA 1SAXA 4GO1A 1KYWA 2FBIA 3C1DA 3FMRA 1U78A 3VB2A 2KIUA 3U9GA 3ZPLA 3DPTA 2FMLA 1ZARA 5L3FA 2ACJA 2P6SA 5DUIA 2HQNA 3COAC 4WF2A 1KQ8A 2PI0A 4LJZF 3KP5A 4UVBA 3ML6A 4HF1A 3CTAA 4RGUA 2XGXA 4BHBA 1RNLA 3I0TA 4HQMA 1RIOH 4Q5SF 2H27A 2H6BA 2QENA 4CDGA 3EUHA 4ASNA 4UVCA 2PLYA 2LKPA 2W84A 3FF5A 1UHMA 2R3SA 3AAFA 2A68F 1TBXA 4OIPF 4UV9A 4KNYA 3QU3A 2OAZA 3IRQA 2K4BA 4N9HA 3G3ZA 4M9ZA 4M9SA 1R00A 2D1HA 3MAJA 1P2FA 1KU9A 1SD5A 4KDPA 1FOKA 2V1DA 2XKPA 3QOPA 2Z99A 1Z1DA 3O3KA 3E6CC 1U5TC 4I98B 3GFMA 5D8LB 5E1WA 1BM9A 3IRRA 4U0YA 4ZZLA 3M1EA 4IJAA 2F5EA 1FBSA 1KQ9A 5E18F 1W5TA 1YIOA 1XSDA 4I01A 2L4MA 1MZBA 3GFLA 1LQ1A 2YX7A 4IF4A 1P6RA 3MZYA 4ESFA 1XD7A 4MQVA 2Q8KA 3RIRA 2DPUA 3VODA 4LLNA 1YW7A 1K78B 3K1PA 2MD5A 3HOSA 3F3XA 3V8JA 4HDVA 4DQ2A 1T39A 5CYVA 4YFNF 1A04A 2PN6A 5IT9Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIF A;  1TTY A;  4AVP A;  1XMA A;  2XAQ A;  1K6O A;  4ENM A;  2ZFW A;  5CVR A;  2IA0 A;  1EV7 A;  2O03 A;  1FBU A;  1GXP A;  1KYZ A;  1Q1H A;  1O7L A;  2A3S A;  3SHF A;  2XAS A;  4BQA A;  1YYV A;  3LA3 A;  1QPM A;  2X4H A;  1U6G A;  2Y0M A;  3V8K A;  4U88 A;  3ISP A;  1CF7 B;  1E2X A;  5LRR A;  3QP6 A;  2D1V A;  1S8N A;  2EWN A;  5D5W B;  1P4W A;  2DTR A;  4CZZ A;  1Z7U A;  2HWV A;  1DPU A;  3JAM K;  4U0W A;  5ILS A;  1FX7 A;  1G6N A;  5JVT A;  4MEY F;  4HAM A;  3JTH A;  3VFZ A;  1V3F A;  1TQM A;  4ENN A;  3F6V A;  4ZYE A;  5H20 A;  4KN4 X;  1D8J A;  4N9I A;  4A0X A;  2GXG A;  1IN7 A;  3HIF A;  3L9F A;  2M5W A;  3HHH A;  3J80 Z;  2Y75 A;  5K5O A;  3LAP A;  2HFH A;  5E8I A;  1ZHF A;  4ESJ A;  2PQ8 A;  2Q2E A;  2ZME B;  2MC3 A;  1U2W A;  4LGW A;  1RUN A;  4M74 A;  3DQV C;  5DCM B;  5D5V B;  3R61 A;  1R5H A;  1EH6 A;  2V6C A;  3ZMZ A;  3WGG A;  1QO0 D;  1W7P A;  4BNC A;  4S05 A;  2OQR A;  1YQA A;  1UCR A;  4R1H A;  1QZZ A;  3BJA A;  1C0W A;  5BPI A;  1ZLK A;  1IW7 F;  4LFU A;  3C7J A;  2EA2 A;  1B4A A;  4G6D A;  3EDP A;  3JSO A;  3V7R A;  2P7V B;  1HQC A;  3K0L A;  3LQQ A;  5CVJ A;  3E5X A;  1PP8 F;  1MGT A;  1ZG5 A;  3K1N A;  4BH9 A;  4G8X A;  1KQ0 A;  2MH9 A;  3L00 A;  3JTG A;  4LLL A;  3I54 A;  2GXB A;  4OU0 A;  2K27 A;  3F72 A;  4A0Y A;  3GZ5 A;  3KET A;  2GIV A;  2EV6 A;  3WOD F;  1YFH A;  4LG0 B;  4L5I A;  3F6O A;  3ROU A;  5LHG A;  1S6L A;  4ESB A;  4CHU A;  3IWZ A;  1S29 A;  2P8T A;  3GWZ A;  2JZY A;  4M72 A;  5ICG A;  5LRS A;  1RUO A;  1SFU A;  3FXU A;  1LEB A;  3LQR A;  2RDP A;  3KZZ A;  2OZU A;  5HS8 A;  2FNA A;  4OMY A;  4A6E A;  4WCG A;  3FMQ A;  1J7K A;  2DO7 A;  2KIF A;  2QM3 A;  4Q48 A;  1U5T B;  1IAW A;  3MCZ A;  5E8G A;  3IWF A;  2W24 A;  4Q47 A;  1JHF A;  4S04 A;  3HYI A;  3HSR A;  2P7C B;  1ZG1 A;  3ECO A;  4P9U A;  1LVA A;  2QBY B;  1STZ A;  3T5X A;  1K79 A;  3REO A;  1G4D A;  5HS7 A;  2GA1 A;  1P4X A;  4GYG A;  3M8E A;  1HW1 A;  2STT A;  2ISY A;  3ELK A;  3V7S A;  1XSX A;  2P5L C;  3KP3 A;  4AIK A;  5HLG A;  1W5S A;  2FSW A;  3RKY A;  1WSU A;  1B6A A;  4I09 A;  5K1Y A;  3HSE A;  3F8M A;  1TLH B;  2HOE A;  4GXO A;  4A5M A;  3L09 A;  2G7U A;  4ENK A;  4A0Z A;  2H94 A;  3B73 A;  1BIA A;  2K02 A;  2STW A;  3J81 Z;  3E97 A;  2HYG D;  2HYF A;  5L3G A;  2PFB A;  5LHH A;  3HRT A;  2OQG A;  3F8F A;  4EV0 A;  3KEO A;  4IXA A;  3HRU A;  2VBX A;  3VEP A;  1DUX C;  4LLG F;  1B9N A;  5LEJ A;  4ZYG A;  4HLX A;  2DQR A;  3FM5 A;  4LK0 F;  3LA2 A;  2KJC A;  1G3Y A;  1J2X A;  4Z2Y A;  3K69 A;  1D3Y A;  3E5Q A;  2FMY A;  2K7L A;  3LA7 A;  4FX0 A;  4XLP F;  1SD4 A;  5HOO A;  4IHT A;  1YO5 C;  5E20 A;  2M30 A;  4KUM A;  2IP2 A;  1FYL A;  4H0E A;  3N4M A;  2F5D A;  3MWM A;  4KIC A;  3PFI A;  1GVJ A;  3KLN A;  3GO5 A;  2VN2 A;  2QQ9 A;  1MDM B;  2FU4 A;  1R5G A;  2XAF A;  5LEK A;  1FC3 A;  2K4J A;  3EYI A;  1T0F A;  1R7J A;  4P5O A;  2FRH A;  2XUB A;  5HDG A;  2M1B A;  3RTR A;  4LK1 F;  5L3E A;  2DPD A;  2VOO A;  3DP7 A;  1AWC A;  4RB3 C;  4ON0 A;  3WTS C;  1AOY A;  2QQA A;  2L4A A;  4CGZ A;  5ILU A;  3RPU A;  2VBW A;  2W57 A;  4HOB A;  4GCV A;  2RVC A;  3P7N A;  4LB5 A;  2DBB A;  2J5O A;  3I58 A;  4IPA A;  3MZH A;  4IVN A;  2HTJ A;  3P9K A;  2DK8 A;  4M6X A;  1YTY A;  1LDK B;  3DPL C;  2HTS A;  5DYM A;  1B9M A;  4M6Y A;  3U1D A;  4L5J A;  3TKY A;  2HR3 A;  2COM A;  4Y17 A;  3P9C A;  5D5U B;  2W25 A;  1O3Q A;  1SMY F;  5FGM A;  5HLH A;  1HSJ A;  5DDG A;  1RI7 A;  1J5Y A;  2L02 A;  5ED4 A;  4OMZ A;  4IRG A;  1TNS A;  2CO5 A;  1Z6R A;  2EV0 A;  5A2Q K;  3BPV A;  1ODD A;  3E6M A;  1YLF A;  4PGH A;  3G73 A;  2RKH A;  3I4P A;  2QLZ A;  2KIM A;  2IJL A;  2QQB A;  1I1G A;  2FA5 A;  4I0B A;  1S7A A;  1JXS A;  3H92 A;  3VOE A;  5EEG A;  2OBP A;  4Q4Z F;  1IXS B;  2OZ6 A;  3GFJ A;  3DF8 A;  1BI3 A;  1XDS A;  1KU3 A;  3FWE A;  5F1R A;  1UB9 A;  5JI6 A;  3NEU A;  2AXL A;  1LEA A;  1ZGA A;  2OU2 A;  4QWQ A;  1K78 A;  2XAG A;  1W4M A;  5DEQ A;  2UXN A;  2DFI A;  4AIH A;  4D0P A;  3IL2 A;  1YS7 A;  3DXJ F;  1KGS A;  2C6Y A;  1IN5 A;  4UXN A;  2DU9 A;  1L0O C;  4DNC A;  5J6X A;  1ZRC A;  2VBY A;  2K86 A;  1FLI A;  1HW5 A;  3EET A;  5HS9 A;  2CSO A;  4U7D A;  3HHG A;  5LGN A;  2QVO A;  4I02 A;  1HBX G;  1OYI A;  1YG2 A;  1ON2 A;  1Z91 A;  3WE2 A;  2NRA C;  2HS5 A;  4KIG A;  2FQ3 A;  3KEQ A;  1P92 A;  4G94 A;  4RGS A;  2HZT A;  5BQT A;  3I64 A;  2ZCW A;  3JAM Z;  1Z05 A;  4YFX F;  5TRD A;  2HKX A;  4CXF A;  1D5V A;  5TJJ A;  4M71 A;  3WTW C;  3TO9 A;  3F21 A;  3OV8 A;  1X3U A;  5L3C A;  1J0R A;  2F5F A;  2ZKZ A;  2XKO A;  1IZ1 A;  2L3D A;  5D4S A;  5JFR A;  3J7A O;  5CJ9 A;  1ZRF A;  2ZXJ A;  3RYP A;  5LLQ A;  5AIQ A;  1U8R A;  4EJW A;  3BP8 A;  5ICC A;  4KFC A;  1QNT A;  5H6Q A;  4EJU A;  2J5P A;  3JSP A;  2F5C A;  2CFX A;  1U3E M;  3RI4 A;  4M73 A;  1XCV A;  1XMK A;  2UWM A;  3V7C A;  1ZRD A;  4YG2 F;  2FBH A;  2ELH A;  1F5T A;  3DV8 A;  4RAZ A;  4U0V A;  3GZ6 A;  2ETH A;  3Q9V A;  4EJV A;  4UV8 A;  2XV4 S;  2VBZ A;  5K5Q A;  4IRI A;  3LFK A;  4G7O F;  2EFO A;  2CW0 F;  2JPC A;  4ZZD A;  4RB1 A;  3H3Z A;  3I53 A;  4FT8 A;  3TDU C;  5FLX Z;  2DI3 A;  1HKQ A;  3CUO A;  4RB0 A;  2Z5U A;  4EQQ A;  4WWC A;  4N0B A;  2V79 A;  4OIO F;  1LDD A;  2G7H A;  4RS8 A;  3TGN A;  1GHC A;  3B02 A;  4BYY A;  3BJO A;  3RPQ A;  2XHK A;  2JRT A;  1MJB A;  2VE9 A;  2O61 A;  5JR3 A;  4Y13 A;  1J75 A;  5FLX K;  4JQF A;  4L9V A;  2NNY A;  1F4K A;  3QAH A;  3QPT A;  5HDK A;  1U5T A;  4PZJ A;  1R36 A;  4OIQ F;  4E70 A;  1MJA A;  1D8K A;  4GGG A;  4BHC A;  3WGI A;  2AS5 F;  1IN8 A;  4OOI A;  4XRF A;  3ZMS A;  4MQ9 F;  3I5U A;  4L9N A;  2R7D A;  4EGY A;  1WQ2 A;  4A6D A;  1W7P B;  2JTV A;  3BZ6 A;  1IF1 A;  1ONV A;  2B0L A;  4EMS A;  3WTU C;  5DD8 A;  1G3W A;  1OKR A;  4MTE A;  3SZT A;  4RAY A;  4ETS A;  2ISZ A;  3E6B A;  2RV8 A;  4L18 B;  4U7B A;  2M87 A;  2YX4 A;  1XN7 A;  3W6J B;  1H9T A;  4R79 A;  1PUE E;  5LGU A;  5K5R A;  5FO5 A;  3HRM A;  3ABT A;  3FM3 A;  3F8N A;  1TNT A;  2UZK A;  4WK8 F;  1FY7 A;  5AON A;  1E17 A;  3K1M A;  2Z9O A;  2EB7 A;  2RGV A;  2HQR A;  4NQW A;  2QYO A;  1YS6 A;  4KA4 A;  3WTT C;  4RGX A;  2JPB A;  5LGT A;  1CGP A;  4O6J A;  3CUQ A;  1ZYR F;  3GUD A;  3U2R A;  3V8L A;  2M8E A;  1FP1 D;  1FSH A;  1BBY A;  3HOT A;  1QZY A;  5CVU A;  1BI2 A;  2E1N A;  3T8R A;  1ZN2 A;  4I2O A;  1WI9 A;  1FYK A;  6PAX A;  1FSE A;  2GWR A;  4TV7 A;  3QP5 A;  1BI0 A;  2VC0 A;  3L2C A;  3F23 A;  3E3V A;  1I27 A;  1K7A A;  2EFN A;  2BBY A;  3WGH A;  1FPQ A;  3TO6 A;  1RZ4 A;  3I59 B;  2ZJ2 A;  2D45 A;  2A69 F;  4HQE A;  3WU0 A;  3BOQ A;  4GYI A;  2EK5 A;  5CVI A;  2MLK A;  1T38 A;  2W85 A;  3L7W A;  2V1X A;  3LST A;  3O2P E;  3ZP5 A;  3E5U A;  2V1U A;  2IT0 A;  1IN4 A;  2RQP A;  2RN7 A;  1XDU A;  4YFK F;  1IRF A;  2DQL A;  2QZ8 A;  4MHG A;  4EM2 A;  2QUF A;  3ERE D;  3RKX A;  2ESN A;  4FHT A;  5D5X B;  3TDZ C;  1S3J A;  5HVQ C;  3LAJ A;  3EYY A;  1V4R A;  2LNB A;  3GFI A;  3BDD A;  2OD5 A;  1O7F A;  4MGR A;  1LDJ A;  1BN5 A;  2PG4 A;  2XVC A;  5D4R A;  2L54 A;  3DKW A;  5ERI A;  1XSV A;  4KMF A;  4AIJ A;  1ZAO A;  1PP7 U;  2XIG A;  2EJR A;  5F6F A;  5E1X A;  4BXU A;  3SFZ A;  4F7Z A;  5AIP A;  4PDK A;  3QRF F;  1XGO A;  1IXC A;  4EJT A;  1YW9 A;  1ZG3 A;  4L9T A;  3K9T A;  1R22 A;  3QU6 A;  3CJN A;  1VTN C;  5FD5 A;  2FOK A;  1JE8 A;  1S7O A;  4JK1 X;  1ULY A;  1W7P D;  2IVM A;  3RDI A;  4HZF A;  2GAU A;  3T8T A;  3ZN1 A;  1I6X A;  1BJA A;  2IPQ X;  1DDN A;  5FD6 A;  5J8C A;  2OA4 A;  1XB4 A;  2NYX A;  1H9G A;  1MD0 A;  5A2Q Z;  3T1B A;  2IW5 A;  2IA1 A;  1DPR A;  4ENJ A;  5FB2 A;  3WTY C;  3Q5F A;  2D2W A;  2P5K A;  2UXX A;  1R1T A;  2MLG A;  1QGP A;  3R60 A;  3SZP A;  4R8H A;  4HV5 A;  5ICF A;  1OPC A;  2PMH A;  2GQQ A;  3M8F A;  2CG4 A;  1BC8 C;  4EGZ A;  1HKT A;  1LJ9 A;  2KJB A;  3HTU A;  2GA2 A;  1IRG A;  2HDC A;  2O3F A;  3IHU A;  3ZQ7 A;  2P5V A;  3N97 A;  5E17 F;  5BOX A;  1ZH5 A;  4G6Q A;  1XGM A;  5L3D A;  3WTV C;  2G9W A;  3ULQ B;  1PDN C;  3KCC A;  1O3R A;  1IUY A;  5BPD A;  4WXH A;  4G9Y A;  2Q0O A;  3HUG A;  3E6D A;  1L3L A;  2JT1 A;  2CGP A;  3R0A A;  2BE5 F;  3ZMU A;  4EM1 A;  4UVA A;  5ICE A;  3MQ0 A;  1HW2 A;  3M9A A;  2ZNY A;  4EVI A;  4HDU A;  4IRH A;  2H6C A;  2MH2 A;  2A6H F;  4ZYH A;  1SMT A;  5DUK A;  4O3M A;  1LB2 A;  2H09 A;  4MEX F;  3BRO A;  3F8C A;  3ZN0 A;  5KK1 A;  2RC4 A;  5ILV A;  4HW0 A;  1IXR C;  2E7X A;  2MBF A;  2R7F A;  2XAH A;  3JW4 A;  4HV6 A;  1LNW A;  1T98 A;  1R1U A;  3EQL F;  2CWE A;  4A5N A;  1J9I A;  4NB5 A;  1CF7 A;  4KYW A;  4XBF A;  2DK5 A;  2M45 A;  3BY6 A;  3V4G A;  3FHZ A;  3GEZ A;  3RJP A;  3CO7 C;  1TW3 A;  4KT5 C;  3DEU A;  2KRF A;  2DLL A;  3GW2 A;  2F2E A;  2VOP A;  4EJO A;  3GLX A;  2EA4 A;  2GZW A;  3I71 A;  5FFX A;  3ECH A;  2VE8 A;  2VOD A;  1I1S A;  1SD6 A;  2VC1 A;  2LF7 A;  3R0J A;  4LMY A;  1HKS A;  1KU2 A;  5D8K B;  2ZO4 A;  4B8X A;  2BGC A;  3GXO A;  4MNU A;  1Z6T A;  3ABU A;  2XRN A;  1FZP B;  1KA8 A;  2LDU A;  3TO7 A;  3BJ6 A;  1WWX A;  2ZME A;  4OIN F;  3CUQ C;  4XSX F;  4AD9 A;  5IT9 K;  1SFX A;  5BMZ A;  5HLI A;  2TDX A;  5DCM A;  1YW8 A;  4KIF A;  2JSC A;  2FNP A;  4KMU X;  5E1Z B;  1ON1 A;  3WU1 B;  5KVR A;  1FWZ A;  2HEO A;  2LF8 A;  3H3U A;  1BI1 A;  2XRO A;  3WE3 A;  2Z33 A;  2A07 F;  5CLS A;  5HDN A;  1KU7 A;  4WXD A;  3GYH X;  2P6T A;  4YII A;  1R58 A;  2YU3 A;  4KIB A;  3FZV A;  2ESH A;  2EV5 A;  1UHW A;  4HBL A;  4O5V A;  4OIR F;  3PQK A;  1TQP A;  1JHH A;  1TQI A;  2VON A;  4LG0 A;  4QLC U;  2FE3 A;  2VT3 A;  1FYM A;  3KLO A;  4L0Y B;  1OYW A;  3PQJ A;  3SQN A;  4Y15 A;  4HX4 A;  1R23 A;  1WKM A;  2BV6 A;  3Q9S A;  2WC2 A;  3KZY A;  1O3S A;  4LD5 A;  1BC7 C;  2LSO A;  2FEZ A;  4CIC A;  3SXY A;  3J80 K;  5IT3 A;  2MA3 A;  3R4K A;  2A5Y B;  3KP7 A;  3FMS A;  5D6E A;  1G3S A;  1I5Z A;  3ZMV A;  2PEX A;  4HA8 A;  2IRF G;  1EH8 A;  2WTE A;  1F9N A;  1O3T A;  2PMU A;  1B59 A;  2QBY A;  2L01 A;  3MEX A;  2FXA A;  3C3W A;  4I7H A;  3HSF A;  3F22 A;  3KFW X;  3M7G A;  2FF4 A;  2BEO A;  5JHU A;  2DAO A;  1G3T A;  4FX4 A;  1ZLJ A;  2RNJ A;  4XSZ F;  4UHT A;  5LHI A;  5FFZ A;  1SD7 A;  3NQO A;  1B1B A;  4L9J A;  1ZRE A;  3BWG A;  2O8X A;  3WG9 A;  3FX3 A;  3LWF A;  2A6E F;  4WX9 A;  1FP2 A;  5BS6 A;  4ZYD A;  3GVA A;  3IKT A;  3W6K B;  5F64 A;  1SFE A;  4I0A A;  4PCQ A;  4MTD A;  1HST A;  3I59 A;  4EM0 B;  4G7H F;  2O0Y A;  3WTX C;  2FBK A;  2WV0 A;  3KP2 A;  4CO8 A;  2E1C A;  1FT9 A;  1JGS A;  1WRJ A;  3FXQ A;  4B09 A;  4JBA A;  3ZMD A;  2Z3Y A;  1OYY A;  5LBQ A;  2PJP A;  1FBQ A;  2NNN A;  3C18 A;  3RKW A;  4KN7 X;  5L3B A;  1FNN A;  2ZNZ A;  4HX8 A;  4CYD A;  2X0L A;  3KE2 A;  3FXR A;  1T6S A;  3GF2 A;  4RB2 C;  1O57 A;  4P9F A;  1ZGJ A;  4WXC A;  5CVV A;  1EH7 A;  1XCB A;  4RGR A;  4P55 A;  1XGS A;  4BAY A;  1MDM A;  3RYR A;  1REP C;  3ZMT A;  2YR2 A;  2YPR A;  3TOB A;  3KP4 A;  3NRV A;  5DD4 A;  5EEH A;  5H6R A;  1F1Z A;  4AWX B;  2XAJ A;  3CUQ B;  3F8B A;  4A12 A;  4XLN F;  1Y0U A;  2HKO A;  4P96 A;  1USS A;  1OR7 A;  3HRS A;  2PBI A;  3P9I A;  3TOA A;  2EFW A;  1QBJ A;  3HTS B;  3DFG A;  5DV5 A;  2CQK A;  3K2Z A;  1P4A A;  2O6G E;  3R6S A;  1UST A;  5DCF A;  4BHP A;  2QWW A;  1TW2 A;  2NS0 A;  4M9X A;  4HF2 A;  3J81 K;  2YSR A;  1OMI A;  1MJ9 A;  1T2K A;  4IHS A;  1UFM A;  4G7Z F;  1NHA A;  4ZH4 F;  4PGG A;  2V9V A;  3CDH A;  3BPX A;  3T0Y A;  4UNO A;  1XGN A;  3MFK A;  2P4W A;  3OOP A;  4NHJ A;  2E7W A;  5D6F A;  2DW4 A;  1Z9C A;  1HXD A;  4UUV A;  1J59 A;  1BOA A;  2KKO A;  1H0M A;  3D0S A;  2EFP A;  4A2U A;  2HGC A;  3D5L A;  4HF0 A;  2VT2 A;  2BYV E;  2Y48 A;  3IC7 A;  4L0Z B;  1IN6 A;  2A61 A;  3CO6 C;  3KP6 A;  2VXZ A;  5J8F A;  1BIB A;  1GXQ A;  1DP7 P;  3CLO A;  3WTZ A;  3S2W A;  3O6B B;  1QQI A;  4LB6 B;  3IKV A;  2IA2 A;  4HX7 A;  4K2E A;  2ADU A;  1MKM A;  2WWY A;  2CYY A;  2DT5 A;  1R1V A;  4HYE A;  3QPH A;  3TQN A;  2EFQ A;  2ZBK A;  2NAZ A;  3GX4 X;  4HLY A;  1SAX A;  4GO1 A;  1KYW A;  2FBI A;  3C1D A;  3FMR A;  1U78 A;  3VB2 A;  2KIU A;  3U9G A;  3ZPL A;  3DPT A;  2FML A;  1ZAR A;  5L3F A;  2ACJ A;  2P6S A;  5DUI A;  2HQN A;  3COA C;  4WF2 A;  1KQ8 A;  2PI0 A;  4LJZ F;  3KP5 A;  4UVB A;  3ML6 A;  4HF1 A;  3CTA A;  4RGU A;  2XGX A;  4BHB A;  1RNL A;  3I0T A;  4HQM A;  1RIO H;  4Q5S F;  2H27 A;  2H6B A;  2QEN A;  4CDG A;  3EUH A;  4ASN A;  4UVC A;  2PLY A;  2LKP A;  2W84 A;  3FF5 A;  1UHM A;  2R3S A;  3AAF A;  2A68 F;  1TBX A;  4OIP F;  4UV9 A;  4KNY A;  3QU3 A;  2OAZ A;  3IRQ A;  2K4B A;  4N9H A;  3G3Z A;  4M9Z A;  4M9S A;  1R00 A;  2D1H A;  3MAJ A;  1P2F A;  1KU9 A;  1SD5 A;  4KDP A;  1FOK A;  2V1D A;  2XKP A;  3QOP A;  2Z99 A;  1Z1D A;  3O3K A;  3E6C C;  1U5T C;  4I98 B;  3GFM A;  5D8L B;  5E1W A;  1BM9 A;  3IRR A;  4U0Y A;  4ZZL A;  3M1E A;  4IJA A;  2F5E A;  1FBS A;  1KQ9 A;  5E18 F;  1W5T A;  1YIO A;  1XSD A;  4I01 A;  2L4M A;  1MZB A;  3GFL A;  1LQ1 A;  2YX7 A;  4IF4 A;  1P6R A;  3MZY A;  4ESF A;  1XD7 A;  4MQV A;  2Q8K A;  3RIR A;  2DPU A;  3VOD A;  4LLN A;  1YW7 A;  1K78 B;  3K1P A;  2MD5 A;  3HOS A;  3F3X A;  3V8J A;  4HDV A;  4DQ2 A;  1T39 A;  5CYV A;  4YFN F;  1A04 A;  2PN6 A;  5IT9 Z; 
#chains in the Genus database with same CATH topology
 4YIF A;  1TTY A;  3KEY A;  4AVP A;  1X3Z B;  4JOM A;  1MND A;  1XMA A;  1NK3 P;  2EPF A;  2XAQ A;  2M9H A;  1K6O A;  4ENM A;  1Z3Y A;  2ZXW H;  2ZFW A;  3HEF A;  5CVR A;  2IA0 A;  4E7K A;  3UR3 C;  1EV7 A;  2O03 A;  1IRX A;  1FBU A;  3FKI J;  3OYE A;  2LLK A;  1B8I A;  1IV6 A;  1GXP A;  3CCJ I;  4I99 C;  1KYZ A;  1Q1H A;  3C2G A;  2IS6 A;  2R5Z A;  4M3G A;  2QCO A;  1O7L A;  3G6E I;  2A3S A;  1TWC J;  3SHF A;  1YRN A;  2XAS A;  3PIP F;  5K7Z A;  4BQA A;  1YYV A;  3LA3 A;  1ZTR A;  3VPR A;  3CC7 I;  1QPM A;  2X4H A;  1U6G A;  2Y0M A;  3V8K A;  4U88 A;  3ISP A;  4DIQ A;  1CF7 B;  1E2X A;  5LRR A;  4F92 B;  4HRI A;  3QP6 A;  2D1V A;  5B5E C;  1S8N A;  2EWN A;  5D5W B;  1P4W A;  2DTR A;  4CZZ A;  1Z7U A;  3A0B C;  2HWV A;  2O9L A;  1DPU A;  2CMP A;  3JAM K;  4U0W A;  5ILS A;  1FX7 A;  4RBO A;  1G6N A;  5JVT A;  4MEY F;  4HAM A;  3JTH A;  3VFZ A;  1HOM A;  1VF9 A;  3I55 I;  1AKH B;  1V3F A;  1Z67 A;  1TQM A;  4MFD A;  1JUP A;  4ENN A;  3F6V A;  1HDD C;  1TWF J;  4ZYE A;  1I6H J;  5H20 A;  1BOB A;  4KN4 X;  1FEX A;  2HU9 A;  1CQT A;  1D8J A;  4RM2 A;  4N9I A;  4A0X A;  1GT0 C;  5J40 A;  2GXG A;  3G1M A;  3I3L A;  1GLN A;  3D5R C;  3BR0 A;  1IN7 A;  3HIF A;  4HST A;  1YE9 A;  4RLF A;  2KRH A;  2QA4 I;  3L9F A;  1Q1V A;  2M5W A;  3HHH A;  3J80 Z;  4A3K J;  2K9M A;  1YIJ I;  5JVG F;  4IOA F;  2Y75 A;  4HEA 2;  2L9V A;  5K5O A;  3LAP A;  3OYB A;  1Y56 A;  3OYF A;  2HFH A;  5E8I A;  1ZHF A;  3TBI A;  2HVS A;  2LBF A;  2NOG A;  3EUK L;  3VYS B;  4ESJ A;  3JRA A;  2JVG A;  1X1A A;  2KT0 A;  3CDL A;  4XN3 A;  4IZZ A;  2PQ8 A;  2Q2E A;  2ZME B;  2E34 A;  2CRG A;  2MC3 A;  4A3B J;  2TRT A;  1U2W A;  2V1N A;  2Z1D A;  4LGW A;  3CCL I;  3V42 A;  1RUN A;  4M74 A;  4XQF A;  1OR7 C;  2LKS A;  3DQV C;  5DCM B;  5D5V B;  3R61 A;  1R5H A;  1EH6 A;  1ETY A;  3BR2 A;  1ZEL A;  4N4N B;  2V6C A;  3LSI A;  3WGG A;  1QO0 D;  3ZMZ A;  1M1E B;  1W7P A;  4BNC A;  4S05 A;  2OQR A;  1YQA A;  1UCR A;  1SVO A;  1APL C;  3I4M J;  2RAE A;  5J1Y A;  3P5J A;  3OR2 C;  4R1H A;  1QZZ A;  3BJA A;  1C0W A;  5BPI A;  3ZQL A;  1ZLK A;  1IW7 F;  2L2O A;  3HKZ N;  4LFU A;  3C7J A;  2EA2 A;  1B4A A;  4G6D A;  2AQF A;  2LKX A;  3DEW A;  3EDP A;  3G1L A;  1ERD A;  2E5N A;  1ITY A;  3JSO A;  5F04 A;  3V7R A;  2P7V B;  1HQC A;  2BXZ A;  3K0L A;  3LQQ A;  2OC6 A;  3TP0 A;  5CVJ A;  3E5X A;  1PP8 F;  1MGT A;  1ZG5 A;  2PX9 A;  3BCB A;  3G1O A;  3S14 J;  3K1N A;  3OS1 A;  4A93 J;  4Y33 A;  4BH9 A;  3CF2 A;  4G8X A;  1F36 A;  2VKD A;  1KQ0 A;  2MH9 A;  3ABM H;  3L00 A;  5J4V A;  4MLO A;  1VQ5 I;  1VND A;  1SAU A;  3JTG A;  4LLL A;  3I54 A;  2GXB A;  2E36 A;  4OU0 A;  2K27 A;  3F72 A;  4A0Y A;  3GZ5 A;  3KET A;  3OR1 C;  2GIV A;  2EV6 A;  3WOD F;  1YFH A;  5CQE A;  2EZL A;  3EPZ A;  2ICW G;  4LG0 B;  4L5I A;  4PSW A;  2K9L A;  4CYC B;  4ZC3 A;  2YU9 J;  2JA8 J;  3F6O A;  3ROU A;  1ETX A;  5LHG A;  1S6L A;  4ESB A;  4CHU A;  2E1M C;  3IWZ A;  1S29 A;  2P8T A;  4UB8 C;  3GWZ A;  2JZY A;  4M72 A;  3DBL B;  5ICG A;  5LRS A;  1RUO A;  1SFU A;  2CU7 A;  3FXU A;  4HNV A;  1LEB A;  4I6Z A;  2XSJ C;  2M3A A;  3PNY A;  2ZFU A;  3LQR A;  2RDP A;  1VQN I;  3KZZ A;  4XM3 A;  3ZOB A;  3S1N J;  4DYC A;  2OZU A;  5HS8 A;  2FNA A;  1TZL A;  2VJ5 A;  4XNF A;  3LSP A;  3CCV I;  1LFP A;  4OMY A;  4A6E A;  4WCG A;  2XPV A;  3H9J A;  3FMQ A;  1J7K A;  2DO7 A;  2KIF A;  2QM3 A;  4Q48 A;  3QOE A;  4C30 A;  1U5T B;  3S1R J;  2R7U A;  1YHQ I;  4QIW N;  1IAW A;  3MCZ A;  5E8G A;  3IWF A;  4LIT A;  2W24 A;  4GDF A;  4Q47 A;  2LC2 A;  1JHF A;  4XLC A;  2QGU A;  2EIJ H;  4S04 A;  3HYI A;  3OSG A;  3HSR A;  3L2R A;  2P7C B;  1ZG1 A;  3ECO A;  4P9U A;  1H8A C;  1LVA A;  5IOZ A;  2H1K A;  4YIR X;  2QBY B;  1STZ A;  4ZDP A;  5E3M A;  3T5X A;  5EG0 A;  1K79 A;  2XAU A;  4BS9 A;  2JA6 J;  3REO A;  1G4D A;  5HS7 A;  3S3O A;  2VPL A;  2GA1 A;  3HG9 A;  1P4X A;  4GYG A;  4DYQ A;  3DU5 A;  3M8E A;  1PVE A;  3OWT A;  1HW1 A;  4B3A A;  3ZRG A;  2F4I A;  4J00 A;  2STT A;  2ISY A;  5EGO B;  1QHG A;  3ELK A;  2LY1 A;  1XSX A;  3V7S A;  3PO3 J;  1P7J A;  1JTY A;  2CUZ A;  2MSY A;  2P5L C;  3KP3 A;  4AIK A;  5HLG A;  1W36 C;  2X85 A;  2DTZ A;  1W5S A;  2FSW A;  3RKY A;  1MNM C;  3FXK A;  1WSU A;  1B6A A;  3A03 A;  1TT5 B;  2JUG A;  2CJJ A;  4I09 A;  3HGY A;  5K1Y A;  4A3J J;  3OIP A;  3HSE A;  3F8M A;  1YJW I;  2F5V A;  1BR2 A;  3QWL A;  3U1K A;  1TLH B;  2HOE A;  4GXO A;  4A5M A;  3L09 A;  3S32 A;  2G7U A;  2R93 J;  4F55 A;  5GPC A;  1SEU A;  4ENK A;  4B3X A;  4A0Z A;  2H94 A;  3B73 A;  4QPQ A;  1BIA A;  3MZ8 A;  2K02 A;  1LUJ B;  3M8J A;  1K4T A;  2STW A;  1WHU A;  2E71 A;  3E97 A;  3J81 Z;  1RR7 A;  2HYG D;  2RQQ A;  2HYF A;  1VQ8 I;  4HNU A;  5L3G A;  2PFB A;  5LHH A;  4IOC F;  3HRT A;  2OQG A;  4XOP A;  1UHS A;  3F8F A;  4EV0 A;  2KP6 A;  3KEO A;  4IXA A;  3HRU A;  2VBX A;  3VEP A;  4HNT A;  1Y39 A;  1DUX C;  1NTC A;  4LLG F;  3SYT A;  3EUH C;  4BJ5 C;  4M3E A;  1Z21 A;  2R7W A;  3AKZ A;  1B9N A;  3ZXS A;  5LEJ A;  4ZYG A;  4HLX A;  4RAG A;  4OAY A;  2IS4 A;  2L9S A;  2DQR A;  5GTI C;  2HQA A;  3FM5 A;  4LK0 F;  2OCC H;  3LA2 A;  2ZJR F;  1XG1 A;  2KJC A;  1VQM I;  1G3Y A;  1J2X A;  3LSH A;  4Z2Y A;  3K69 A;  1D3Y A;  3E5Q A;  4E7I A;  2FMY A;  2CH0 A;  2K7L A;  3CMA I;  4IX7 A;  2R7Z J;  2DT7 B;  3LA7 A;  4FX0 A;  1RR8 C;  4XLP F;  4HSR A;  1R4N B;  1JJ8 C;  1SD4 A;  5HOO A;  1I50 J;  2Y30 A;  4IHT A;  1YO5 C;  5E20 A;  3MKY B;  2M30 A;  1V54 H;  3RSN A;  2Y2Z A;  2LY2 A;  4KUM A;  3X2Q H;  2IP2 A;  5HNF A;  1FYL A;  4H0E A;  3N4M A;  2F5D A;  3MWM A;  3FBN B;  5J47 A;  2R7V A;  4KIC A;  3PFI A;  1GVJ A;  5TGT A;  3KLN A;  3W3C A;  1VFC A;  1WGX A;  4LIU A;  3GO5 A;  1Z0X A;  4E7S A;  1OCP A;  3SDG A;  2VN2 A;  2M8G X;  5C4X J;  4M6V A;  3S3N A;  2QQ9 A;  3CME I;  1MDM B;  2FU4 A;  5E3L A;  4B48 A;  1R5G A;  2XAF A;  5LEK A;  1T33 A;  1FC3 A;  2FOW A;  3N05 A;  3HKZ A;  5GAD J;  2K4J A;  3EYI A;  1GDT A;  1T0F A;  5M5W J;  2K85 A;  3CCS I;  1R7J A;  5F0H A;  3A0H C;  1VZ0 A;  2FRH A;  4P5O A;  4XL9 A;  3JRG A;  4IHW A;  2XUB A;  5HDG A;  2M1B A;  5C3E J;  3RTR A;  2W82 A;  3H1C A;  4LK1 F;  3IH4 A;  5L3E A;  2DPD A;  2VOO A;  3DP7 A;  5FKO A;  1AWC A;  4RB3 C;  4ON0 A;  1TL8 A;  3OYA A;  3WTS C;  2WB1 A;  1NK2 P;  1AOY A;  2CFO A;  3VDX A;  2QQA A;  2L4A A;  4IHX A;  4CGZ A;  1SFO J;  2K3P A;  5ILU A;  3DWL E;  4AYB A;  2LOO A;  3RPU A;  3G2B A;  2VBW A;  2W57 A;  4HOB A;  3RQ4 A;  2CV1 A;  4GCV A;  3AFH A;  2RVC A;  3HM5 A;  5FRO A;  3P7N A;  3S2H J;  4Y52 J;  1B72 A;  4LB5 A;  3I4N J;  1MBH A;  3HPH A;  3S93 A;  2DBB A;  2J5O A;  5IOY A;  3I58 A;  2WAF A;  1Y1V J;  4IPA A;  2OJE D;  3PIO F;  3MZH A;  4IVN A;  4EEF G;  2XDV A;  2HTJ A;  3P9K A;  2V6E A;  1MBK A;  4KT6 A;  4B4C A;  1IJW C;  1DGW Y;  3IAS 2;  2DK8 A;  4M6X A;  3OOU A;  3M4O J;  2DCE A;  2XSD C;  1LDK B;  1YTY A;  3PM1 A;  3DPL C;  3FHN A;  4F3Q A;  2E1M B;  1R6R A;  1OCZ H;  2HTS A;  3FXJ A;  3JRI A;  2L5Q A;  5DYM A;  2K40 A;  3CCU I;  2FX0 A;  1X2M A;  1JKO C;  1B9M A;  2DMN A;  4M6Y A;  5KCM A;  3U1D A;  2QSG X;  1Y8Q B;  1XTA A;  4L5J A;  3TKY A;  1U9O A;  2HR3 A;  1MIJ A;  2COM A;  3K4K A;  3A4C A;  1QHH D;  1X3W B;  4Y17 A;  4AU7 A;  2QKM B;  3P9C A;  5D5U B;  2W25 A;  3B6A A;  2MG4 A;  3I56 I;  1O3Q A;  3OYL A;  1SMY F;  5FGM A;  5HLH A;  1HSJ A;  5DDG A;  4BE2 A;  1RI7 A;  1J5Y A;  2L02 A;  1MW7 A;  4UUT A;  1JT6 A;  5ED4 A;  4OMZ A;  4IRG A;  1TNS A;  2BVL A;  3GZN B;  3JR9 A;  3GTG J;  2CO5 A;  1Z6R A;  2F4M B;  2EV0 A;  5A2Q K;  1DU6 A;  4M3B A;  1GVD A;  3BPV A;  4W97 A;  2L7M P;  1ODD A;  3E6M A;  1YLF A;  4PGH A;  1D0Y A;  2DFH A;  5F0C A;  3D1N I;  1SVM A;  3GTK J;  4XOR A;  2LFB A;  1ZK8 A;  2WA0 A;  4DZJ A;  1RKW A;  3G73 A;  4XR6 A;  2RKH A;  1I3A A;  4AC0 A;  5IY5 H;  3A01 B;  3I4P A;  2QLZ A;  5DS9 A;  2KIM A;  1G59 A;  2IJL A;  4BGD A;  2QQB A;  1N75 A;  1I1G A;  2FA5 A;  3L1P A;  4I0B A;  2XPU A;  1S7A A;  2NXN B;  1JXS A;  1MMG A;  3L2V A;  4KIS A;  3H92 A;  2KDZ A;  3VOE A;  5GTH C;  5EEG A;  2OBP A;  4Q4Z F;  2CV2 A;  3ZQH A;  1IXS B;  4C2U A;  2OZ6 A;  3GFJ A;  3PUF A;  3DF8 A;  4NC6 A;  1FIP A;  1BI3 A;  1XDS A;  1KU3 A;  4ZTF A;  4X1E A;  3FWE A;  5F1R A;  5LD2 C;  1UB9 A;  4PJL A;  2CW7 A;  5JI6 A;  1UG0 A;  1E3O C;  3SFI A;  3NEU A;  2AXL A;  1QVT A;  4DOZ A;  3S3M A;  3W6V A;  2VL8 A;  1LEA A;  4XIC A;  1ZGA A;  2OU2 A;  4QWQ A;  1K78 A;  4D5C A;  1JTX A;  2BW3 B;  2XAG A;  1W4M A;  5DEQ A;  2UXN A;  4D1Q A;  1XC5 A;  2GXA A;  1R49 A;  2DFI A;  4AIH A;  4D0P A;  3IL2 A;  1YS7 A;  3DXJ F;  5CQG A;  1KGS A;  2C6Y A;  1IN5 A;  3ASN H;  3B6C A;  4UXN A;  2DU9 A;  1L0O C;  4DNC A;  3J7Z I;  5J6X A;  1ZRC A;  2VBY A;  2K86 A;  2LD5 A;  5M5X J;  1FLI A;  3MD2 A;  1HW5 A;  3EET A;  5HS9 A;  1MMS A;  2CSO A;  1P7I A;  4U7D A;  2VJI A;  3HHG A;  3FDY A;  5LGN A;  3OYJ A;  2AHQ A;  2UUZ A;  2MFZ A;  1X1C A;  2QVO A;  4G6T B;  2OTL I;  3CCY A;  4I02 A;  1X2N A;  1HBX G;  1OYI A;  3IH2 A;  1YG2 A;  3AL0 C;  4X6A J;  1ON2 A;  1Z91 A;  3WE2 A;  1LE8 A;  2NRA C;  3ZCO A;  2HS5 A;  4KIG A;  2FQ3 A;  3KEQ A;  4FIS A;  1OCR H;  2JQ7 A;  2BVM A;  3MKW B;  1P92 A;  4G94 A;  3OS2 A;  2JA7 J;  4RGS A;  2HZT A;  5BQT A;  3I64 A;  1BA5 A;  2ZCW A;  3JAM Z;  1YJ9 I;  3M3Y J;  1Z05 A;  4YFX F;  5TRD A;  4AID A;  2LRD A;  2HKX A;  2R92 J;  4IO9 F;  3F9K A;  3H5R A;  4CXF A;  1D5V A;  3HDD A;  2VKE A;  1U9N A;  5TJJ A;  3OIQ A;  2E2H J;  4M71 A;  5M3F J;  3WTW C;  3CES A;  2R7R A;  3RZO J;  3TO9 A;  3F21 A;  3HB9 A;  4Y7N J;  2B7E A;  3OV8 A;  1D1A A;  1X3U A;  3BTL A;  2JVH A;  5L3C A;  1J0R A;  2F5F A;  2ZKZ A;  1HCR A;  2XKO A;  1IZ1 A;  2L3D A;  2IXS A;  5D4S A;  5JFR A;  1V5G A;  3UKG A;  2ECB A;  5CJ9 A;  3J7A O;  3K4M A;  1PUF B;  1ZRF A;  2ZXJ A;  3RYP A;  5LLQ A;  5AIQ A;  1U8R A;  4EJW A;  3BP8 A;  5ICC A;  4CCK A;  4KFC A;  3PJR A;  1IGN A;  1QNT A;  5H6Q A;  3CDI A;  4XLF A;  4EJU A;  3CMY A;  2J5P A;  3JSP A;  2F5C A;  2CFX A;  1U3E M;  3CJT B;  4M73 A;  3RI4 A;  1XCV A;  1XMK A;  2UWM A;  3V7C A;  1ZRD A;  5FKK A;  4YG2 F;  2QSH X;  1X1P A;  2FBH A;  1JKP C;  3QPS A;  2ELH A;  3BG5 A;  3ESW B;  4V2G A;  1F5T A;  3DV8 A;  4RAZ A;  1J09 A;  4BEH A;  4U0V A;  2XF6 A;  1Z7L A;  3GZ6 A;  2IGO A;  1XX5 A;  3FKJ A;  2DXI A;  3JRF A;  2ETH A;  1B8I B;  3Q9V A;  4EJV A;  4UV8 A;  2XV4 S;  2VBZ A;  5FRM A;  5K5Q A;  2BHZ A;  1HLV A;  3L2W A;  5CKT A;  4IRI A;  1F43 A;  3LFK A;  4G7O F;  2EFO A;  4AVZ A;  2R5Z B;  3JRD A;  2CW0 F;  2EIL H;  5LFA A;  2JPC A;  1ETO A;  4ZZD A;  1OLT A;  4RB1 A;  2AQE A;  3H3Z A;  1A5J A;  1YRN B;  3I53 A;  2X1C A;  4BBS J;  3RQI A;  3ZQC A;  4FT8 A;  3DEE A;  3TDU C;  1RPW A;  5FLX Z;  1JKR C;  2DI3 A;  1FOY A;  3CUO A;  1HKQ A;  1AA7 A;  2LH9 A;  2IS1 A;  4RB0 A;  2Z5U A;  2X1D A;  4KIT B;  1RET A;  1U8B A;  4EQQ A;  4WWC A;  4N0B A;  3HGG A;  2V79 A;  4OIO F;  1LDD A;  2G7H A;  1T08 B;  4RS8 A;  3TGN A;  2DJI A;  3IAM 2;  9ANT A;  3AG2 H;  4BUP A;  3LNQ A;  1GHC A;  3CCR I;  4C3H J;  3RCO A;  3B02 A;  4BYY A;  3IUO A;  3HC7 A;  5FLV A;  3BJO A;  3RPQ A;  2XHK A;  2JRT A;  1W36 D;  4KJZ A;  1LPQ A;  1MJB A;  1MBE A;  2NOJ B;  3O8H A;  3CQZ J;  2VE9 A;  1KON A;  2O61 A;  4GFB A;  4A3C J;  2VIX A;  5GAG J;  3DTK A;  2PMZ N;  5F27 A;  2ZJQ F;  4NUB A;  2EZH A;  5JR3 A;  2HVQ A;  3FIW A;  3SEQ A;  4Y13 A;  1J75 A;  4JQF A;  4L9V A;  3C2B A;  2NNY A;  1XS9 A;  5FLX K;  1X1B A;  3BG3 A;  1E3H A;  1F4K A;  3QAH A;  2DA5 A;  2JMW A;  2HOA A;  2E19 A;  3QPT A;  5HDK A;  3W2W A;  3OYM A;  1U5T A;  4BAC A;  2WAQ N;  4PZJ A;  1D0Z A;  1R36 A;  5C4J J;  2VB6 A;  4OIQ F;  4E70 A;  1MJA A;  2DOF A;  4UB6 C;  2JN6 A;  2LBF B;  2X48 A;  4DBR A;  2E35 A;  1D8K A;  4GGG A;  4XK4 A;  2RNG A;  1T0F C;  3DPU A;  2BY1 A;  4U87 A;  2DOD A;  4B44 A;  2Q2E B;  2ZXH A;  4BHC A;  2KIQ A;  2R5Y A;  2V9K A;  2CQN A;  1SVL A;  3WGI A;  4BQN A;  2I10 A;  3SEZ A;  1IN8 A;  4CCL A;  4OOI A;  2AS5 F;  4A3M J;  4XRF A;  3ZMS A;  4MQ9 F;  3A1Y A;  3I5U A;  4XN0 A;  4L9N A;  3A02 A;  2DOA A;  2IEK A;  2R7Q A;  2R7D A;  4EGY A;  1WQ2 A;  4A6D A;  1W7P B;  4QPO A;  2JTV A;  1HF0 A;  1X19 A;  3BZ6 A;  4A3D J;  2KPM A;  1IF1 A;  1ONV A;  2B0L A;  5JLX A;  4EMS A;  3WTU C;  5DD8 A;  1G3W A;  1OKR A;  4MTE A;  3SZT A;  4RAY A;  4ETS A;  2ISZ A;  4HG2 A;  3E6B A;  2RV8 A;  1AHD P;  1MSF C;  4L18 B;  1X1D A;  2Y9Y A;  4U7B A;  2M87 A;  2YX4 A;  4QSH A;  3HPG A;  1XN7 A;  3W6J B;  1H9T A;  4R79 A;  1PUE E;  2X51 A;  5LGU A;  2PJR A;  5K5R A;  5FO5 A;  2E2J J;  3HRM A;  1IO2 A;  1FIA A;  3ABT A;  1UZC A;  4RMN A;  3FM3 A;  3F8N A;  2V26 A;  1TNT A;  1T95 A;  3AG1 H;  3VSK A;  2IAI A;  3PUB A;  3LSR A;  2UZK A;  1ZR4 A;  3DKY A;  2HXI A;  4WK8 F;  1FY7 A;  5AON A;  1E17 A;  3KZI C;  1T8I A;  2JWT A;  3NWS A;  1BR1 A;  3K1M A;  2Z9O A;  2EB7 A;  2RGV A;  3AL0 B;  3TP3 A;  3CCM I;  2HQR A;  4NQW A;  2QYO A;  1W1W E;  1YS6 A;  4KA4 A;  2BY3 A;  3WTT C;  4RGX A;  3NAU A;  2JPB A;  5LGT A;  1CGP A;  4O6J A;  3CUQ A;  2M0C A;  1ZYR F;  3GUD A;  3U2R A;  4Z6Y A;  2AO9 A;  1IDZ A;  2DMP A;  3V8L A;  2KZG A;  2M8E A;  4CZC A;  5B3S H;  2DA7 A;  2FUG 2;  4GRI A;  1FP1 D;  3IV5 A;  1FSH A;  1BBY A;  2KMU A;  2LK2 A;  5CVU A;  1QZY A;  3HOT A;  4C9Y A;  1MMA A;  2QF7 A;  5K7H A;  1BI2 A;  2E1N A;  3T8R A;  3PFY A;  1ZN2 A;  4I2O A;  1WI9 A;  1FYK A;  2D5V A;  2LG4 A;  5DM6 F;  4A3F J;  6PAX A;  1GV5 A;  1FSE A;  1MMD A;  5J1R A;  1EJ9 A;  2GWR A;  1LVK A;  4TV7 A;  3QP5 A;  1BI0 A;  3H0G J;  5EJC A;  2VC0 A;  3VWB A;  3L2C A;  3F23 A;  2KL4 A;  3E3V A;  3OYG A;  1I27 A;  4XMY A;  2EFN A;  1K7A A;  2BBY A;  3WGH A;  1FPQ A;  3TO6 A;  1G2H A;  4J01 A;  1RZ4 A;  3I59 B;  2ZJ2 A;  3ZQI A;  2D45 A;  2A69 F;  1UAA A;  2X6O A;  4HQE A;  3K70 C;  3OYH A;  5EG0 B;  3WU0 A;  1IRZ A;  2DOE A;  1FTZ A;  3BOQ A;  3KIO A;  4B1R A;  4GYI A;  4JX4 A;  2EK5 A;  5CVI A;  3SJM A;  2MLK A;  3K4N A;  4BKX A;  1T38 A;  3U21 A;  2W85 A;  2ZSH B;  3L7W A;  5GAE J;  2GLO A;  5HOD A;  2V1X A;  3LST A;  2MD0 A;  2EIN H;  4BL0 B;  2CV0 A;  3O2P E;  3ZP5 A;  1FOX A;  4CCN A;  3E5U A;  2V1U A;  3S8P A;  2IT0 A;  1IN4 A;  2RQP A;  4F52 A;  2RN7 A;  1XDU A;  2CUE A;  2L9R A;  4II3 A;  1IRF A;  1I3Q J;  2DQL A;  4M3F A;  2QZ8 A;  2Z2S B;  4MHG A;  5J4Y A;  1YJN I;  3H9Q A;  5J3L A;  3HOU J;  4EM2 A;  3GTO J;  2QUF A;  3ERE D;  4MIM A;  3RKX A;  2ESN A;  4FHT A;  1Z3X A;  3TDZ C;  1S3J A;  5D5X B;  4E7Z A;  5JLW A;  5HVQ C;  3LAJ A;  1H88 C;  1TWG J;  3EYY A;  1I39 A;  2GOM A;  1V4R A;  2LNB A;  3GFI A;  3BDD A;  2W00 A;  2OD5 A;  1IG7 A;  1O7F A;  3VYU B;  4MGR A;  1LDJ A;  2NVQ J;  2CUF A;  3H36 A;  1N25 A;  2DMU A;  1W0U A;  1BN5 A;  3I9V 2;  4XLA A;  2BOL A;  1X4P A;  1PYV A;  4E4H A;  2PG4 A;  3DLA A;  2WBM A;  3CP2 A;  5IYB J;  1JKQ C;  2XVC A;  2XB0 X;  5D4R A;  3VSL A;  2L54 A;  3LFU A;  2M34 A;  3DKW A;  3CF5 F;  5CPR B;  5ERI A;  1XSV A;  4KMF A;  3H3V K;  1JI8 A;  4ZJZ A;  1ZAO A;  4AIJ A;  2HOS A;  2V4J C;  3ABL H;  2PMZ A;  1PP7 U;  4A3E J;  2VJ4 A;  2XIG A;  4BE1 A;  2EJR A;  5F6F A;  2CS3 A;  3CC2 I;  4YRV A;  5E1X A;  2VUM J;  4BXU A;  2DA3 A;  3SFZ A;  1VQ4 I;  4BQQ A;  4F7Z A;  5AIP A;  4PDK A;  4UUS A;  3H5A A;  3QRF F;  2WAQ A;  1XGO A;  1IXC A;  1UMQ A;  4EJT A;  1OFC X;  1YW9 A;  1ZG3 A;  4IQ4 A;  4L9T A;  1FTT A;  3K9T A;  1R22 A;  2EBI A;  1YIT I;  3QU6 A;  3CJN A;  3ASO H;  2EIM H;  2KLO A;  2ZXI A;  2HDD A;  1VTN C;  4JX5 A;  5FD5 A;  2FOK A;  1JE8 A;  2DJN A;  1SFK A;  1S7O A;  2NS7 A;  1N78 A;  1K61 A;  4XRS A;  4EAT A;  4JK1 X;  2M2E A;  3H5N A;  2F4O B;  1ULY A;  1W7P D;  2IVM A;  4YFK F;  2XRL A;  1HC8 A;  3RDI A;  4HZF A;  1OQY A;  2GAU A;  4I76 A;  4ZDO A;  3T8T A;  3ZN1 A;  1I6X A;  1BJA A;  3BR5 A;  2IPQ X;  1DDN A;  5FD6 A;  5J8C A;  3BT9 A;  2OA4 A;  1XB4 A;  2VAS A;  2NYX A;  1H9G A;  4A69 C;  4YEL A;  2KHM A;  1MD0 A;  5A2Q Z;  3T1B A;  2IW5 A;  1WH7 A;  2VQL A;  2IA1 A;  4E6K G;  2LVS A;  1P9Q C;  1DPR A;  4ENJ A;  1EF4 A;  5FB2 A;  3WTY C;  2QSF X;  2O8K A;  3Q5F A;  2OV7 A;  2D2W A;  2XGC A;  3CC4 I;  4RAF A;  2P5K A;  2XF7 A;  2UXX A;  1R1T A;  2MLG A;  3GTM J;  1QGP A;  1RKT A;  3R60 A;  2IGM A;  5IYC J;  3A01 A;  2W7N A;  3SZP A;  4R8H A;  2K9S A;  5GAH J;  1WJB A;  1RRJ A;  3FK7 A;  4HV5 A;  1WVR A;  2JA2 A;  5ICF A;  1OPC A;  5TIS C;  2MC4 A;  2PMH A;  2GQQ A;  3M8F A;  2CG4 A;  4JYK A;  1BR4 A;  2K5C A;  1BC8 C;  2M0M A;  2KIS A;  1ETV A;  1NH3 A;  4EGZ A;  5BNG A;  3MVP A;  1HKT A;  3E0J B;  3HOV J;  2BXY A;  2F48 A;  1B72 B;  4IKF A;  3E1S A;  3GTQ J;  3TMO A;  1LJ9 A;  2KJB A;  2M7B A;  2CQ7 A;  3HTU A;  2ELJ A;  4PJJ A;  1R9T J;  2GA2 A;  1IC8 A;  1IRG A;  4AUX A;  2O3F A;  3IHU A;  3ZQ7 A;  2HDC A;  3DU6 A;  2V7F A;  3A2K A;  3OYD A;  3TED A;  4FCY A;  2P5V A;  3N97 A;  5E17 F;  5BOX A;  3GTP J;  1BW6 A;  2FJ1 A;  1ZH5 A;  1R5I D;  1D1B A;  3J7A Y;  4G6Q A;  2X6X A;  1XGM A;  5L3D A;  1S9H A;  2HXO A;  3GLL A;  5F0F A;  4BBR J;  2VQC A;  3WTV C;  2G9W A;  3ZQF A;  3ULQ B;  1PDN C;  5KAI C;  3KCC A;  1MNE A;  3F0C A;  1QU3 A;  3IP4 B;  1O3R A;  1ETQ A;  1IUY A;  1VQL I;  5BPD A;  4WXH A;  4G9Y A;  2Q0O A;  3HUG A;  3E6D A;  3H35 A;  2L7Z A;  2JT1 A;  1L3L A;  2CGP A;  2OF7 A;  5IYD J;  3R0A A;  3BZC A;  2Y9Z A;  2BE5 F;  4E7J A;  4QTR A;  3ZMU A;  2HVR A;  1AU7 A;  4CCM A;  2ELK A;  3CJQ B;  4EM1 A;  2MYS A;  2M7A A;  4UVA A;  5KHD A;  5ICE A;  3MQ0 A;  2HNH A;  1HW2 A;  4Y3O A;  2JRM A;  4ZDL A;  2ZJP F;  3M9A A;  2ZNY A;  1A6Q A;  3HBL A;  3OIO A;  4EVI A;  3H0D A;  4HDU A;  4IRH A;  1N77 A;  2H6C A;  3M07 A;  2MH2 A;  2DFF A;  1YI2 I;  1GUU A;  1OJL A;  1QZE A;  2A6H F;  4ZYH A;  1ETW A;  1SMT A;  5DUK A;  4O3M A;  1LB2 A;  2COB A;  2H09 A;  1VQ6 I;  4MEX F;  2ID6 A;  5DTD A;  3BRO A;  3RZD J;  3MKZ A;  3F8C A;  3S16 J;  2HQ5 A;  3ZN0 A;  5KK1 A;  2RC4 A;  5ILV A;  4HW0 A;  4ZTJ A;  1IXR C;  2E7X A;  4PK4 A;  1JT0 A;  1K4S A;  2LMD A;  2MBF A;  2R7F A;  3JRB A;  3BR3 A;  4DGW B;  2XAH A;  1OCT C;  3JW4 A;  4HV6 A;  1LNW A;  3MN2 A;  1DP3 A;  1T98 A;  1R1U A;  1FOW A;  3EQL F;  2CWE A;  1MBG A;  1U0J A;  4XKC A;  4A5N A;  3BTC A;  3GBG A;  4V19 K;  1J9I A;  1VI0 A;  4NB5 A;  4CA0 A;  1CF7 A;  4MO7 A;  5B66 C;  2R0Q C;  2R7X A;  2LYC A;  4KYW A;  4XBF A;  2B63 J;  5GP9 A;  3BTI A;  3FXM A;  3FXL A;  2DK5 A;  2M45 A;  3BY6 A;  3V4G A;  3FHZ A;  4XKV A;  3GEZ A;  2VKV A;  3RJP A;  1T56 A;  2M4G A;  3CO7 C;  2I8D A;  1TW3 A;  3UNG C;  3O8G A;  4XLE A;  2LP0 A;  1H89 C;  4KT5 C;  2NVT J;  3DEU A;  2KRF A;  1AKH A;  4C3J J;  5EEA A;  2DLL A;  3GW2 A;  1ORK A;  2F2E A;  2VOP A;  4EJO A;  3Q0W A;  4PJM A;  3GLX A;  2EA4 A;  3ERM A;  4CSW A;  2GZW A;  3I71 A;  3CJR B;  3ECH A;  5FFX A;  1JUM A;  2VE8 A;  2ME6 A;  3OY9 A;  2VOD A;  1I1S A;  1SD6 A;  1TWA J;  1R71 A;  1WFX A;  2VC1 A;  2LF7 A;  2IGK A;  2BY0 A;  3R0J A;  3BG6 A;  5IP7 J;  4LMY A;  2LY9 A;  3LOC A;  1HKS A;  1KU2 A;  1K83 J;  4XKW A;  3K6G A;  3ABK H;  3GME A;  2LR8 A;  5D8K B;  3QYB A;  4F93 B;  2ZO4 A;  2KQR A;  5M5Y J;  4B8X A;  3H9G A;  2BGC A;  1LE8 B;  4B47 A;  3GXO A;  4MNU A;  1Z6T A;  5FKM A;  3ABU A;  2XRN A;  1A35 A;  1FZP B;  1KA8 A;  2LDU A;  3TO7 A;  3BJ6 A;  1WWX A;  2ZME A;  4OIN F;  3CUQ C;  5FLM J;  4XSX F;  4AD9 A;  3HOX J;  5IT9 K;  1SFX A;  5BMZ A;  2VQG A;  5HLI A;  3K4B A;  2JJ7 A;  4F91 B;  2TDX A;  5DCM A;  1YW8 A;  1FMW A;  2Y0S N;  4KIF A;  2JSC A;  2DDA A;  2FNP A;  4KMU X;  5E1Z B;  1ON1 A;  3SZG A;  3WU1 B;  2E1O A;  5KVR A;  4II2 A;  1FWZ A;  2HEO A;  2LF8 A;  3PNV A;  3FBI B;  3H3U A;  1WJA A;  1BI1 A;  2XRO A;  3WE3 A;  2Z33 A;  1O4X A;  2JSP A;  2A07 F;  1HDP A;  3RPU D;  4NC7 A;  2CW8 A;  1BL0 A;  3OL4 A;  5CLS A;  5HDN A;  2V9P A;  1KU7 A;  4WXD A;  2WAD A;  3GYH X;  1Y8R B;  4IHY A;  3GTL J;  2P6T A;  4PJN A;  5HNH A;  4YII A;  3DBH B;  2LTP A;  1R58 A;  2YU3 A;  1MH4 A;  4KIB A;  2OPT A;  3FZV A;  2ESH A;  2Q1Z B;  1D0X A;  2EV5 A;  3OMY A;  3ZGK A;  1E3P A;  2K9Q A;  1UHW A;  2QQ8 A;  2Z16 A;  4HBL A;  3G71 I;  4O5V A;  4OIR F;  2DA1 A;  3PQK A;  1TQP A;  5FRN A;  1HA8 A;  1JHH A;  3GCM A;  1TQI A;  2VXD A;  1SC7 A;  2VON A;  3PSI A;  4LG0 A;  1GV2 A;  3BG7 A;  2GBY A;  5FKN A;  2FE3 A;  4QLC U;  3CZ6 A;  3BCA A;  2VT3 A;  4CYC A;  1FYM A;  3BLY A;  3WG7 H;  2X1E A;  3KLO A;  3KYC B;  1MSE C;  2EZI A;  5IP6 A;  4L0Y B;  1OYW A;  3PQJ A;  4BEH B;  3SQN A;  3GTJ J;  4Y15 A;  4HX4 A;  1IUF A;  1R23 A;  3HOW J;  2HZD A;  1WKM A;  2BV6 A;  4ITV A;  1OCO H;  1RES A;  3Q9S A;  2NVU B;  4BE0 A;  2WC2 A;  2X6W A;  3KZY A;  1VQ7 I;  1O3S A;  4LD5 A;  1BC7 C;  3JRC A;  4OWR B;  3K7A J;  2LSO A;  2FEZ A;  4A3G J;  2K3F A;  4CIC A;  4A3I J;  3SXY A;  3J80 K;  1ZGW A;  4YEJ A;  5IT3 A;  2OTJ I;  4D9J A;  2N8G A;  2HPI A;  2MA3 A;  3OL3 A;  3R4K A;  5KNL A;  4NBQ A;  2A5Y B;  1BJZ A;  1UJ8 A;  3KP7 A;  2G0E A;  5J1U A;  1W0T A;  3FMS A;  4DYR A;  2XF5 A;  5D6E A;  1WJF A;  2XPW A;  3HJE A;  1W5C C;  1G3S A;  4FE4 A;  1I5Z A;  2EZK A;  1EKE A;  3JCU C;  3ZMV A;  2PEX A;  3K70 D;  4HA8 A;  3CCQ I;  3JRH A;  2IRF G;  4RM3 A;  1EH8 A;  2LRE A;  3C2H A;  2WTE A;  1F9N A;  1V5F A;  1O3T A;  2KDO A;  1B59 A;  2PMU A;  2QBY A;  2L01 A;  3MEX A;  2FXA A;  3C3W A;  2BZT A;  2WB1 N;  4I7H A;  3BG9 A;  3HSF A;  3CMM A;  3F22 A;  3KFW X;  3M7G A;  3EUA A;  1X58 A;  3QYE A;  4FE7 A;  4N4O B;  3HOY J;  2FF4 A;  4AYB N;  2BEO A;  3OSF A;  2A05 A;  2UV1 A;  5JHU A;  4E7H A;  3QPL A;  5B1B H;  2DAO A;  5EGO A;  1G3T A;  2IBD A;  2H1L A;  4FX4 A;  3DTI A;  1JUS A;  2W1O A;  1ETK A;  1DQU A;  2DMT A;  1ZLJ A;  2H8W A;  4XID A;  2RNJ A;  4XSZ F;  4IL6 C;  3S2D J;  4UHT A;  2OUM A;  4S0H B;  2DA2 A;  5LHI A;  4CH7 A;  3LSG A;  5FFZ A;  3OS0 A;  4RA2 A;  1S5L C;  3L2U A;  1SD7 A;  4C3I J;  3NQO A;  5EYR A;  1B1B A;  4LOC A;  2X6Y A;  2R7T A;  1Y0N A;  4L9J A;  1ZRE A;  3BWG A;  3BQY A;  3DKX A;  2ME0 A;  2O8X A;  2FD5 A;  3K4J A;  3WG9 A;  3KYL A;  3FX3 A;  3NAR A;  3CD6 I;  2ID3 A;  3LWF A;  5M3M J;  2A6E F;  4WX9 A;  1FP2 A;  5BS6 A;  2R5Y B;  4ZYD A;  3GVA A;  3IKT A;  3W6K B;  5F64 A;  1SFE A;  3W2V A;  3QYF A;  4I0A A;  5KAF C;  4BU2 A;  4PCQ A;  4MTD A;  4C2T A;  2JK3 A;  3QOD A;  1HST A;  3I59 A;  4EM0 B;  2W4S A;  4P1W A;  3DLL F;  4G7H F;  2O0Y A;  4IEJ A;  3WTX C;  1TP4 A;  2FBK A;  2XGD A;  1QRY A;  3PL8 A;  2WV0 A;  2BY2 A;  3KP2 A;  3PNT A;  4CO8 A;  2E1C A;  2GIZ A;  1FT9 A;  3E7L A;  3HOZ J;  1JGS A;  1WRJ A;  3FXQ A;  1DGR M;  4B09 A;  2NVX J;  5IP9 J;  3ONQ A;  3FXO A;  2RRE A;  4JBA A;  3ZMD A;  4ANJ A;  4PUS A;  2Z3Y A;  1OYY A;  3LL7 A;  3TW7 A;  1ENH A;  5LBQ A;  2PJP A;  4BJ6 C;  4FTH A;  4RDU A;  1FBQ A;  2NNN A;  4PSX A;  3C18 A;  3RKW A;  4KN7 X;  1XMX A;  2TCT A;  5L3B A;  1UEL B;  1FNN A;  5C44 J;  1VQP I;  2PJR B;  2ZNZ A;  4HX8 A;  4CYD A;  2X0L A;  4XKB A;  3CCE I;  3BZK A;  3KE2 A;  3FXR A;  1T6S A;  2YS9 A;  3LSM A;  2WY7 Q;  3GF2 A;  4RB2 C;  1V55 H;  2VI6 A;  3DBR B;  1O57 A;  4P9F A;  1ZGJ A;  1KZH A;  2CUJ A;  1S7E A;  1XPX A;  4WXC A;  5CVV A;  4BDY A;  1LKX A;  1VQK I;  2Y0S A;  1EH7 A;  2VKH A;  3PO2 J;  1XCB A;  4RGR A;  3AG3 H;  2HPM A;  4P55 A;  1XGS A;  4BAY A;  1MDM A;  1PJR A;  3RYR A;  3LMM A;  1REP C;  5JHF A;  3ZMT A;  2QKL B;  4DBQ A;  4NQW B;  2YR2 A;  1WPK A;  2YPR A;  3TOB A;  3KP4 A;  3NRV A;  5DD4 A;  5EEH A;  5H6R A;  1F1Z A;  2DN0 A;  4XRS G;  1A6I A;  2CQQ A;  4AWX B;  2XAJ A;  2E2I J;  3CUQ B;  3F8B A;  4C2M J;  4A12 A;  2F6C A;  2EQR A;  2L7K A;  4XLN F;  4BXX J;  1Y0U A;  2HKO A;  3S15 J;  4D7N A;  1ACI A;  4P96 A;  1USS A;  3K4C A;  1OR7 A;  3HRS A;  2XB5 A;  2PBI A;  3G4S I;  1D5Y A;  3J7Y J;  5E79 C;  2Y31 A;  1R4M B;  3P9I A;  3TOA A;  2JUC A;  3AG4 H;  3OYC A;  2EFW A;  1QBJ A;  3HTS B;  3DFG A;  1MBF A;  3CP8 A;  4V2F A;  2CQK A;  5DV5 A;  2R7O A;  4FAS D;  2GM4 A;  3K2Z A;  4CCO A;  1P4A A;  1S72 I;  2HOT A;  2O6G E;  3R6S A;  1A31 A;  1UG2 A;  1UST A;  5DCF A;  4BHP A;  4D7M A;  2QWW A;  3ZQG A;  4HPQ A;  2WV1 A;  3ZQQ A;  1TW2 A;  2L7F P;  4IQJ A;  2HYJ A;  2NS0 A;  3L2Q A;  4M9X A;  4HF2 A;  3J81 K;  2ZB9 A;  2YSR A;  1OMI A;  1E0E A;  1MJ9 A;  1T2K A;  2R7S A;  2A6T A;  4IHS A;  1UFM A;  2HI3 A;  4CUG A;  2O5R A;  4G7Z F;  1NHA A;  4ZH4 F;  4H4K C;  4PFO A;  1TT0 A;  1V5E A;  4JP0 A;  5F08 A;  4PGG A;  5IPA A;  2V9V A;  2VPR A;  3CDH A;  1SAN A;  3BPX A;  3T0Y A;  2ZSI B;  4UNO A;  3BQZ A;  1XGN A;  3WHC A;  4DZP A;  3MFK A;  4L5E A;  2DA6 A;  5K7F A;  1Y6I A;  2P4W A;  3KPH A;  1WJ5 A;  1YOV B;  3OOP A;  4NHJ A;  4BQO A;  2E7W A;  5D6F A;  2DW4 A;  4RLQ A;  1Z9C A;  3S1Q J;  1HXD A;  4AM3 A;  5E3N A;  4UUV A;  2DT6 A;  1J59 A;  2IS2 A;  1BOA A;  4BY1 J;  1QA6 A;  1QVU A;  2KKO A;  2B9S A;  1H0M A;  2OCE A;  3HZJ A;  3D0S A;  1OIS A;  2EFP A;  4A2U A;  3Q0V A;  1NG7 A;  4LG3 A;  5B1A H;  2HGC A;  2AXT C;  3D5S C;  3D5L A;  4DW6 A;  1K6Y A;  4W1U A;  2ZC2 A;  2MW8 A;  4HF0 A;  2VT2 A;  1ZR2 A;  2E60 A;  3SDB A;  2BYV E;  2Y48 A;  2KRC A;  1WI3 A;  1IN6 A;  3IC7 A;  4L0Z B;  4LIV A;  2FQ4 A;  2A61 A;  2DA4 A;  3CO6 C;  3KP6 A;  2VXZ A;  3LSJ A;  5J8F A;  1WJE A;  2M4K A;  1BIB A;  1GXQ A;  1DP7 P;  4G12 A;  2MGQ A;  3CLO A;  2DYR H;  2KZV A;  3WTZ A;  3S2W A;  3O6B B;  1QQI A;  4LB6 B;  1IV8 A;  3IKV A;  3S17 J;  2IA2 A;  4HX7 A;  1Y1W J;  3K2A A;  1RC9 A;  4D5F A;  3IH3 A;  4K2E A;  2ADU A;  4FQG A;  1YX3 A;  1POG A;  1MKM A;  2P0W A;  4ZYA A;  4UUS B;  2WWY A;  3M1C A;  3OYN A;  4CCJ A;  2YUS A;  3WU2 C;  2DDB A;  2CYY A;  2DT5 A;  4M3D A;  1R1V A;  4BJT A;  4HYE A;  3QPH A;  3TQN A;  2DMQ A;  2Y69 H;  2EFQ A;  2ZBK A;  2ZME C;  2NAZ A;  2WY8 Q;  3GX4 X;  4HLY A;  1SAX A;  4GO1 A;  1KYW A;  4NC8 A;  2FBI A;  2VLA A;  1MH3 A;  2NS8 A;  4B43 A;  4UY8 I;  3C1D A;  2E5Z A;  1LFB A;  2MAB A;  1TWH J;  3FMR A;  1U78 A;  3VB2 A;  1YX5 A;  4BDZ A;  2WAE A;  1WJD A;  2KIU A;  3U9G A;  3BC8 A;  3ZPL A;  1ZQ3 P;  3DPT A;  2O7O A;  2FML A;  4ABZ A;  2XC7 A;  1ZAR A;  5L3F A;  2ACJ A;  5HLT A;  2DFE A;  1WCM J;  3HL2 A;  1MBJ A;  2P6S A;  5DUI A;  1D1C A;  1DU0 A;  2BW3 A;  2HQN A;  3COA C;  4WF2 A;  3TW6 A;  1KQ8 A;  2PI0 A;  3Q3S A;  4LJZ F;  2NVY J;  1LFU P;  2HDW A;  3KP5 A;  5EZH A;  1WJC A;  1IDY A;  4UVB A;  3ML6 A;  4HF1 A;  3CTA A;  4RGU A;  5EZG A;  3TL4 X;  2XGX A;  4BHB A;  1RNL A;  1Z77 A;  2IGN A;  2VJJ A;  3KYD B;  3HXL A;  3I0T A;  4HQM A;  5EDN A;  1RIO H;  4Q5S F;  2H27 A;  1JJ6 C;  2H6B A;  2QEN A;  4CDG A;  5EF6 A;  3S1M J;  3EUH A;  2CQX A;  3JRE A;  1FMV A;  3QQA A;  4J19 A;  3DCF A;  4NDL A;  3PSF A;  2GOX B;  1X4O A;  4ASN A;  4PJ0 C;  4UVC A;  2L0K A;  2PLY A;  2LKP A;  2W84 A;  2X9D A;  2L9N A;  3FF5 A;  5H2F C;  1UHM A;  2R3S A;  5F1J A;  4XOT A;  4X0G A;  3AAF A;  2A68 F;  1MMN A;  1TBX A;  4BY7 J;  4OIP F;  3VYT B;  4UV9 A;  5E3O A;  3K10 A;  4KNY A;  3QU3 A;  5FJ8 J;  2OAZ A;  1NG6 A;  5DM7 F;  5FKL A;  3IRQ A;  2K4B A;  1BW5 A;  1A36 A;  4A3L J;  4N9H A;  3G3Z A;  1VQ9 I;  4M9Z A;  4M9S A;  1R00 A;  2D1H A;  3MAJ A;  1P2F A;  1KU9 A;  1SD5 A;  3MKL A;  2EIK H;  4KDP A;  4DJA A;  1FOK A;  2V1D A;  2XKP A;  3MMY B;  3QOP A;  1WZ2 A;  2Z99 A;  1G8X A;  4Y4R A;  1Z1D A;  1JGG A;  3CLQ A;  3KX2 A;  1TC3 C;  3O3K A;  4JX6 A;  4XRM A;  3E6C C;  1U5T C;  4I98 B;  3GFM A;  2JA5 J;  4NNJ A;  3FIS A;  4IHV A;  4XLH A;  5D8L B;  5E1W A;  3RKQ A;  3OYK A;  1WH5 A;  1BM9 A;  3IRR A;  1ZKG A;  4ZZL A;  4IJA A;  3M1E A;  4U0Y A;  2F5E A;  2K9N A;  1FBS A;  2BHY A;  4E7L A;  1KQ9 A;  5E18 F;  1W5T A;  1YIO A;  1XSD A;  2KFD A;  3HUG B;  5GPA A;  2P81 A;  2DYS H;  2XGE A;  3K4L A;  3ZR8 X;  1VQO I;  4I01 A;  3DTE A;  2L4M A;  1MZB A;  3GFL A;  4BXF A;  1LQ1 A;  2YX7 A;  4IF4 A;  1P6R A;  3MZY A;  4ESF A;  1PUF A;  4OAZ A;  4PFP A;  4FET A;  2QEX I;  2EH3 A;  1QPI A;  1XD7 A;  4MQV A;  2Q8K A;  3RIR A;  2I5U A;  3OYI A;  2DPU A;  3VOD A;  2ECC A;  1EA3 A;  3BTJ A;  4LLN A;  1YW7 A;  4MFE A;  1K78 B;  3K1P A;  2MD5 A;  3HOS A;  3LSK A;  3F3X A;  3V8J A;  3VYR B;  2H8R A;  4HDV A;  4XON A;  2VQH A;  2W48 A;  1FJL A;  4DQ2 A;  1T39 A;  3WHB A;  3Q0U A;  3W2A A;  2A5W A;  3BR6 A;  5CYV A;  4YFN F;  3FK6 A;  1A04 A;  2PN6 A;  3BR1 A;  1OCC H;  2R4G A;  5IT9 Z;  3NWT A; 
#chains in the Genus database with same CATH homology
 4YIF A;  1TTY A;  4AVP A;  1XMA A;  2XAQ A;  1K6O A;  4ENM A;  2ZFW A;  5CVR A;  2IA0 A;  1EV7 A;  2O03 A;  1FBU A;  1GXP A;  1KYZ A;  1Q1H A;  1O7L A;  2A3S A;  3SHF A;  2XAS A;  4BQA A;  1YYV A;  3LA3 A;  1QPM A;  2X4H A;  1U6G A;  2Y0M A;  3V8K A;  4U88 A;  3ISP A;  1CF7 B;  1E2X A;  5LRR A;  3QP6 A;  2D1V A;  1S8N A;  2EWN A;  5D5W B;  1P4W A;  2DTR A;  4CZZ A;  1Z7U A;  2HWV A;  1DPU A;  3JAM K;  4U0W A;  5ILS A;  1FX7 A;  1G6N A;  5JVT A;  4MEY F;  4HAM A;  3JTH A;  3VFZ A;  1V3F A;  1TQM A;  4ENN A;  3F6V A;  4ZYE A;  5H20 A;  4KN4 X;  1D8J A;  4N9I A;  4A0X A;  2GXG A;  1IN7 A;  3HIF A;  3L9F A;  2M5W A;  3HHH A;  3J80 Z;  2Y75 A;  5K5O A;  3LAP A;  2HFH A;  5E8I A;  1ZHF A;  4ESJ A;  2PQ8 A;  2Q2E A;  2ZME B;  2MC3 A;  1U2W A;  4LGW A;  1RUN A;  4M74 A;  3DQV C;  5DCM B;  5D5V B;  3R61 A;  1R5H A;  1EH6 A;  2V6C A;  3ZMZ A;  3WGG A;  1QO0 D;  1W7P A;  4BNC A;  4S05 A;  2OQR A;  1YQA A;  1UCR A;  4R1H A;  1QZZ A;  3BJA A;  1C0W A;  5BPI A;  1ZLK A;  1IW7 F;  4LFU A;  3C7J A;  2EA2 A;  1B4A A;  4G6D A;  3EDP A;  3JSO A;  3V7R A;  2P7V B;  1HQC A;  3K0L A;  3LQQ A;  5CVJ A;  3E5X A;  1PP8 F;  1MGT A;  1ZG5 A;  3K1N A;  4BH9 A;  4G8X A;  1KQ0 A;  2MH9 A;  3L00 A;  3JTG A;  4LLL A;  3I54 A;  2GXB A;  4OU0 A;  2K27 A;  3F72 A;  4A0Y A;  3GZ5 A;  3KET A;  2GIV A;  2EV6 A;  3WOD F;  1YFH A;  4LG0 B;  4L5I A;  3F6O A;  3ROU A;  5LHG A;  1S6L A;  4ESB A;  4CHU A;  3IWZ A;  1S29 A;  2P8T A;  3GWZ A;  2JZY A;  4M72 A;  5ICG A;  5LRS A;  1RUO A;  1SFU A;  3FXU A;  1LEB A;  3LQR A;  2RDP A;  3KZZ A;  2OZU A;  5HS8 A;  2FNA A;  4OMY A;  4A6E A;  4WCG A;  3FMQ A;  1J7K A;  2DO7 A;  2KIF A;  2QM3 A;  4Q48 A;  1U5T B;  1IAW A;  3MCZ A;  5E8G A;  3IWF A;  2W24 A;  4Q47 A;  1JHF A;  4S04 A;  3HYI A;  3HSR A;  2P7C B;  1ZG1 A;  3ECO A;  4P9U A;  1LVA A;  2QBY B;  1STZ A;  3T5X A;  1K79 A;  3REO A;  1G4D A;  5HS7 A;  2GA1 A;  1P4X A;  4GYG A;  3M8E A;  1HW1 A;  2STT A;  2ISY A;  3ELK A;  3V7S A;  1XSX A;  2P5L C;  3KP3 A;  4AIK A;  5HLG A;  1W5S A;  2FSW A;  3RKY A;  1WSU A;  1B6A A;  4I09 A;  5K1Y A;  3HSE A;  3F8M A;  1TLH B;  2HOE A;  4GXO A;  4A5M A;  3L09 A;  2G7U A;  4ENK A;  4A0Z A;  2H94 A;  3B73 A;  1BIA A;  2K02 A;  2STW A;  3J81 Z;  3E97 A;  2HYG D;  2HYF A;  5L3G A;  2PFB A;  5LHH A;  3HRT A;  2OQG A;  3F8F A;  4EV0 A;  3KEO A;  4IXA A;  3HRU A;  2VBX A;  3VEP A;  1DUX C;  4LLG F;  1B9N A;  5LEJ A;  4ZYG A;  4HLX A;  2DQR A;  3FM5 A;  4LK0 F;  3LA2 A;  2KJC A;  1G3Y A;  1J2X A;  4Z2Y A;  3K69 A;  1D3Y A;  3E5Q A;  2FMY A;  2K7L A;  3LA7 A;  4FX0 A;  4XLP F;  1SD4 A;  5HOO A;  4IHT A;  1YO5 C;  5E20 A;  2M30 A;  4KUM A;  2IP2 A;  1FYL A;  4H0E A;  3N4M A;  2F5D A;  3MWM A;  4KIC A;  3PFI A;  1GVJ A;  3KLN A;  3GO5 A;  2VN2 A;  2QQ9 A;  1MDM B;  2FU4 A;  1R5G A;  2XAF A;  5LEK A;  1FC3 A;  2K4J A;  3EYI A;  1T0F A;  1R7J A;  4P5O A;  2FRH A;  2XUB A;  5HDG A;  2M1B A;  3RTR A;  4LK1 F;  5L3E A;  2DPD A;  2VOO A;  3DP7 A;  1AWC A;  4RB3 C;  4ON0 A;  3WTS C;  1AOY A;  2QQA A;  2L4A A;  4CGZ A;  5ILU A;  3RPU A;  2VBW A;  2W57 A;  4HOB A;  4GCV A;  2RVC A;  3P7N A;  4LB5 A;  2DBB A;  2J5O A;  3I58 A;  4IPA A;  3MZH A;  4IVN A;  2HTJ A;  3P9K A;  2DK8 A;  4M6X A;  1YTY A;  1LDK B;  3DPL C;  2HTS A;  5DYM A;  1B9M A;  4M6Y A;  3U1D A;  4L5J A;  3TKY A;  2HR3 A;  2COM A;  4Y17 A;  3P9C A;  5D5U B;  2W25 A;  1O3Q A;  1SMY F;  5FGM A;  5HLH A;  1HSJ A;  5DDG A;  1RI7 A;  1J5Y A;  2L02 A;  5ED4 A;  4OMZ A;  4IRG A;  1TNS A;  2CO5 A;  1Z6R A;  2EV0 A;  5A2Q K;  3BPV A;  1ODD A;  3E6M A;  1YLF A;  4PGH A;  3G73 A;  2RKH A;  3I4P A;  2QLZ A;  2KIM A;  2IJL A;  2QQB A;  1I1G A;  2FA5 A;  4I0B A;  1S7A A;  1JXS A;  3H92 A;  3VOE A;  5EEG A;  2OBP A;  4Q4Z F;  1IXS B;  2OZ6 A;  3GFJ A;  3DF8 A;  1BI3 A;  1XDS A;  1KU3 A;  3FWE A;  5F1R A;  1UB9 A;  5JI6 A;  3NEU A;  2AXL A;  1LEA A;  1ZGA A;  2OU2 A;  4QWQ A;  1K78 A;  2XAG A;  1W4M A;  5DEQ A;  2UXN A;  2DFI A;  4AIH A;  4D0P A;  3IL2 A;  1YS7 A;  3DXJ F;  1KGS A;  2C6Y A;  1IN5 A;  4UXN A;  2DU9 A;  1L0O C;  4DNC A;  5J6X A;  1ZRC A;  2VBY A;  2K86 A;  1FLI A;  1HW5 A;  3EET A;  5HS9 A;  2CSO A;  4U7D A;  3HHG A;  5LGN A;  2QVO A;  4I02 A;  1HBX G;  1OYI A;  1YG2 A;  1ON2 A;  1Z91 A;  3WE2 A;  2NRA C;  2HS5 A;  4KIG A;  2FQ3 A;  3KEQ A;  1P92 A;  4G94 A;  4RGS A;  2HZT A;  5BQT A;  3I64 A;  2ZCW A;  3JAM Z;  1Z05 A;  4YFX F;  5TRD A;  2HKX A;  4CXF A;  1D5V A;  5TJJ A;  4M71 A;  3WTW C;  3TO9 A;  3F21 A;  3OV8 A;  1X3U A;  5L3C A;  1J0R A;  2F5F A;  2ZKZ A;  2XKO A;  1IZ1 A;  2L3D A;  5D4S A;  5JFR A;  3J7A O;  5CJ9 A;  1ZRF A;  2ZXJ A;  3RYP A;  5LLQ A;  5AIQ A;  1U8R A;  4EJW A;  3BP8 A;  5ICC A;  4KFC A;  1QNT A;  5H6Q A;  4EJU A;  2J5P A;  3JSP A;  2F5C A;  2CFX A;  1U3E M;  3RI4 A;  4M73 A;  1XCV A;  1XMK A;  2UWM A;  3V7C A;  1ZRD A;  4YG2 F;  2FBH A;  2ELH A;  1F5T A;  3DV8 A;  4RAZ A;  4U0V A;  3GZ6 A;  2ETH A;  3Q9V A;  4EJV A;  4UV8 A;  2XV4 S;  2VBZ A;  5K5Q A;  4IRI A;  3LFK A;  4G7O F;  2EFO A;  2CW0 F;  2JPC A;  4ZZD A;  4RB1 A;  3H3Z A;  3I53 A;  4FT8 A;  3TDU C;  5FLX Z;  2DI3 A;  1HKQ A;  3CUO A;  4RB0 A;  2Z5U A;  4EQQ A;  4WWC A;  4N0B A;  2V79 A;  4OIO F;  1LDD A;  2G7H A;  4RS8 A;  3TGN A;  1GHC A;  3B02 A;  4BYY A;  3BJO A;  3RPQ A;  2XHK A;  2JRT A;  1MJB A;  2VE9 A;  2O61 A;  5JR3 A;  4Y13 A;  1J75 A;  5FLX K;  4JQF A;  4L9V A;  2NNY A;  1F4K A;  3QAH A;  3QPT A;  5HDK A;  1U5T A;  4PZJ A;  1R36 A;  4OIQ F;  4E70 A;  1MJA A;  1D8K A;  4GGG A;  4BHC A;  3WGI A;  2AS5 F;  1IN8 A;  4OOI A;  4XRF A;  3ZMS A;  4MQ9 F;  3I5U A;  4L9N A;  2R7D A;  4EGY A;  1WQ2 A;  4A6D A;  1W7P B;  2JTV A;  3BZ6 A;  1IF1 A;  1ONV A;  2B0L A;  4EMS A;  3WTU C;  5DD8 A;  1G3W A;  1OKR A;  4MTE A;  3SZT A;  4RAY A;  4ETS A;  2ISZ A;  3E6B A;  2RV8 A;  4L18 B;  4U7B A;  2M87 A;  2YX4 A;  1XN7 A;  3W6J B;  1H9T A;  4R79 A;  1PUE E;  5LGU A;  5K5R A;  5FO5 A;  3HRM A;  3ABT A;  3FM3 A;  3F8N A;  1TNT A;  2UZK A;  4WK8 F;  1FY7 A;  5AON A;  1E17 A;  3K1M A;  2Z9O A;  2EB7 A;  2RGV A;  2HQR A;  4NQW A;  2QYO A;  1YS6 A;  4KA4 A;  3WTT C;  4RGX A;  2JPB A;  5LGT A;  1CGP A;  4O6J A;  3CUQ A;  1ZYR F;  3GUD A;  3U2R A;  3V8L A;  2M8E A;  1FP1 D;  1FSH A;  1BBY A;  3HOT A;  1QZY A;  5CVU A;  1BI2 A;  2E1N A;  3T8R A;  1ZN2 A;  4I2O A;  1WI9 A;  1FYK A;  6PAX A;  1FSE A;  2GWR A;  4TV7 A;  3QP5 A;  1BI0 A;  2VC0 A;  3L2C A;  3F23 A;  3E3V A;  1I27 A;  1K7A A;  2EFN A;  2BBY A;  3WGH A;  1FPQ A;  3TO6 A;  1RZ4 A;  3I59 B;  2ZJ2 A;  2D45 A;  2A69 F;  4HQE A;  3WU0 A;  3BOQ A;  4GYI A;  2EK5 A;  5CVI A;  2MLK A;  1T38 A;  2W85 A;  3L7W A;  2V1X A;  3LST A;  3O2P E;  3ZP5 A;  3E5U A;  2V1U A;  2IT0 A;  1IN4 A;  2RQP A;  2RN7 A;  1XDU A;  4YFK F;  1IRF A;  2DQL A;  2QZ8 A;  4MHG A;  4EM2 A;  2QUF A;  3ERE D;  3RKX A;  2ESN A;  4FHT A;  5D5X B;  3TDZ C;  1S3J A;  5HVQ C;  3LAJ A;  3EYY A;  1V4R A;  2LNB A;  3GFI A;  3BDD A;  2OD5 A;  1O7F A;  4MGR A;  1LDJ A;  1BN5 A;  2PG4 A;  2XVC A;  5D4R A;  2L54 A;  3DKW A;  5ERI A;  1XSV A;  4KMF A;  4AIJ A;  1ZAO A;  1PP7 U;  2XIG A;  2EJR A;  5F6F A;  5E1X A;  4BXU A;  3SFZ A;  4F7Z A;  5AIP A;  4PDK A;  3QRF F;  1XGO A;  1IXC A;  4EJT A;  1YW9 A;  1ZG3 A;  4L9T A;  3K9T A;  1R22 A;  3QU6 A;  3CJN A;  1VTN C;  5FD5 A;  2FOK A;  1JE8 A;  1S7O A;  4JK1 X;  1ULY A;  1W7P D;  2IVM A;  3RDI A;  4HZF A;  2GAU A;  3T8T A;  3ZN1 A;  1I6X A;  1BJA A;  2IPQ X;  1DDN A;  5FD6 A;  5J8C A;  2OA4 A;  1XB4 A;  2NYX A;  1H9G A;  1MD0 A;  5A2Q Z;  3T1B A;  2IW5 A;  2IA1 A;  1DPR A;  4ENJ A;  5FB2 A;  3WTY C;  3Q5F A;  2D2W A;  2P5K A;  2UXX A;  1R1T A;  2MLG A;  1QGP A;  3R60 A;  3SZP A;  4R8H A;  4HV5 A;  5ICF A;  1OPC A;  2PMH A;  2GQQ A;  3M8F A;  2CG4 A;  1BC8 C;  4EGZ A;  1HKT A;  1LJ9 A;  2KJB A;  3HTU A;  2GA2 A;  1IRG A;  2HDC A;  2O3F A;  3IHU A;  3ZQ7 A;  2P5V A;  3N97 A;  5E17 F;  5BOX A;  1ZH5 A;  4G6Q A;  1XGM A;  5L3D A;  3WTV C;  2G9W A;  3ULQ B;  1PDN C;  3KCC A;  1O3R A;  1IUY A;  5BPD A;  4WXH A;  4G9Y A;  2Q0O A;  3HUG A;  3E6D A;  1L3L A;  2JT1 A;  2CGP A;  3R0A A;  2BE5 F;  3ZMU A;  4EM1 A;  4UVA A;  5ICE A;  3MQ0 A;  1HW2 A;  3M9A A;  2ZNY A;  4EVI A;  4HDU A;  4IRH A;  2H6C A;  2MH2 A;  2A6H F;  4ZYH A;  1SMT A;  5DUK A;  4O3M A;  1LB2 A;  2H09 A;  4MEX F;  3BRO A;  3F8C A;  3ZN0 A;  5KK1 A;  2RC4 A;  5ILV A;  4HW0 A;  1IXR C;  2E7X A;  2MBF A;  2R7F A;  2XAH A;  3JW4 A;  4HV6 A;  1LNW A;  1T98 A;  1R1U A;  3EQL F;  2CWE A;  4A5N A;  1J9I A;  4NB5 A;  1CF7 A;  4KYW A;  4XBF A;  2DK5 A;  2M45 A;  3BY6 A;  3V4G A;  3FHZ A;  3GEZ A;  3RJP A;  3CO7 C;  1TW3 A;  4KT5 C;  3DEU A;  2KRF A;  2DLL A;  3GW2 A;  2F2E A;  2VOP A;  4EJO A;  3GLX A;  2EA4 A;  2GZW A;  3I71 A;  5FFX A;  3ECH A;  2VE8 A;  2VOD A;  1I1S A;  1SD6 A;  2VC1 A;  2LF7 A;  3R0J A;  4LMY A;  1HKS A;  1KU2 A;  5D8K B;  2ZO4 A;  4B8X A;  2BGC A;  3GXO A;  4MNU A;  1Z6T A;  3ABU A;  2XRN A;  1FZP B;  1KA8 A;  2LDU A;  3TO7 A;  3BJ6 A;  1WWX A;  2ZME A;  4OIN F;  3CUQ C;  4XSX F;  4AD9 A;  5IT9 K;  1SFX A;  5BMZ A;  5HLI A;  2TDX A;  5DCM A;  1YW8 A;  4KIF A;  2JSC A;  2FNP A;  4KMU X;  5E1Z B;  1ON1 A;  3WU1 B;  5KVR A;  1FWZ A;  2HEO A;  2LF8 A;  3H3U A;  1BI1 A;  2XRO A;  3WE3 A;  2Z33 A;  2A07 F;  5CLS A;  5HDN A;  1KU7 A;  4WXD A;  3GYH X;  2P6T A;  4YII A;  1R58 A;  2YU3 A;  4KIB A;  3FZV A;  2ESH A;  2EV5 A;  1UHW A;  4HBL A;  4O5V A;  4OIR F;  3PQK A;  1TQP A;  1JHH A;  1TQI A;  2VON A;  4LG0 A;  4QLC U;  2FE3 A;  2VT3 A;  1FYM A;  3KLO A;  4L0Y B;  1OYW A;  3PQJ A;  3SQN A;  4Y15 A;  4HX4 A;  1R23 A;  1WKM A;  2BV6 A;  3Q9S A;  2WC2 A;  3KZY A;  1O3S A;  4LD5 A;  1BC7 C;  2LSO A;  2FEZ A;  4CIC A;  3SXY A;  3J80 K;  5IT3 A;  2MA3 A;  3R4K A;  2A5Y B;  3KP7 A;  3FMS A;  5D6E A;  1G3S A;  1I5Z A;  3ZMV A;  2PEX A;  4HA8 A;  2IRF G;  1EH8 A;  2WTE A;  1F9N A;  1O3T A;  2PMU A;  1B59 A;  2QBY A;  2L01 A;  3MEX A;  2FXA A;  3C3W A;  4I7H A;  3HSF A;  3F22 A;  3KFW X;  3M7G A;  2FF4 A;  2BEO A;  5JHU A;  2DAO A;  1G3T A;  4FX4 A;  1ZLJ A;  2RNJ A;  4XSZ F;  4UHT A;  5LHI A;  5FFZ A;  1SD7 A;  3NQO A;  1B1B A;  4L9J A;  1ZRE A;  3BWG A;  2O8X A;  3WG9 A;  3FX3 A;  3LWF A;  2A6E F;  4WX9 A;  1FP2 A;  5BS6 A;  4ZYD A;  3GVA A;  3IKT A;  3W6K B;  5F64 A;  1SFE A;  4I0A A;  4PCQ A;  4MTD A;  1HST A;  3I59 A;  4EM0 B;  4G7H F;  2O0Y A;  3WTX C;  2FBK A;  2WV0 A;  3KP2 A;  4CO8 A;  2E1C A;  1FT9 A;  1JGS A;  1WRJ A;  3FXQ A;  4B09 A;  4JBA A;  3ZMD A;  2Z3Y A;  1OYY A;  5LBQ A;  2PJP A;  1FBQ A;  2NNN A;  3C18 A;  3RKW A;  4KN7 X;  5L3B A;  1FNN A;  2ZNZ A;  4HX8 A;  4CYD A;  2X0L A;  3KE2 A;  3FXR A;  1T6S A;  3GF2 A;  4RB2 C;  1O57 A;  4P9F A;  1ZGJ A;  4WXC A;  5CVV A;  1EH7 A;  1XCB A;  4RGR A;  4P55 A;  1XGS A;  4BAY A;  1MDM A;  3RYR A;  1REP C;  3ZMT A;  2YR2 A;  2YPR A;  3TOB A;  3KP4 A;  3NRV A;  5DD4 A;  5EEH A;  5H6R A;  1F1Z A;  4AWX B;  2XAJ A;  3CUQ B;  3F8B A;  4A12 A;  4XLN F;  1Y0U A;  2HKO A;  4P96 A;  1USS A;  1OR7 A;  3HRS A;  2PBI A;  3P9I A;  3TOA A;  2EFW A;  1QBJ A;  3HTS B;  3DFG A;  5DV5 A;  2CQK A;  3K2Z A;  1P4A A;  2O6G E;  3R6S A;  1UST A;  5DCF A;  4BHP A;  2QWW A;  1TW2 A;  2NS0 A;  4M9X A;  4HF2 A;  3J81 K;  2YSR A;  1OMI A;  1MJ9 A;  1T2K A;  4IHS A;  1UFM A;  4G7Z F;  1NHA A;  4ZH4 F;  4PGG A;  2V9V A;  3CDH A;  3BPX A;  3T0Y A;  4UNO A;  1XGN A;  3MFK A;  2P4W A;  3OOP A;  4NHJ A;  2E7W A;  5D6F A;  2DW4 A;  1Z9C A;  1HXD A;  4UUV A;  1J59 A;  1BOA A;  2KKO A;  1H0M A;  3D0S A;  2EFP A;  4A2U A;  2HGC A;  3D5L A;  4HF0 A;  2VT2 A;  2BYV E;  2Y48 A;  3IC7 A;  4L0Z B;  1IN6 A;  2A61 A;  3CO6 C;  3KP6 A;  2VXZ A;  5J8F A;  1BIB A;  1GXQ A;  1DP7 P;  3CLO A;  3WTZ A;  3S2W A;  3O6B B;  1QQI A;  4LB6 B;  3IKV A;  2IA2 A;  4HX7 A;  4K2E A;  2ADU A;  1MKM A;  2WWY A;  2CYY A;  2DT5 A;  1R1V A;  4HYE A;  3QPH A;  3TQN A;  2EFQ A;  2ZBK A;  2NAZ A;  3GX4 X;  4HLY A;  1SAX A;  4GO1 A;  1KYW A;  2FBI A;  3C1D A;  3FMR A;  1U78 A;  3VB2 A;  2KIU A;  3U9G A;  3ZPL A;  3DPT A;  2FML A;  1ZAR A;  5L3F A;  2ACJ A;  2P6S A;  5DUI A;  2HQN A;  3COA C;  4WF2 A;  1KQ8 A;  2PI0 A;  4LJZ F;  3KP5 A;  4UVB A;  3ML6 A;  4HF1 A;  3CTA A;  4RGU A;  2XGX A;  4BHB A;  1RNL A;  3I0T A;  4HQM A;  1RIO H;  4Q5S F;  2H27 A;  2H6B A;  2QEN A;  4CDG A;  3EUH A;  4ASN A;  4UVC A;  2PLY A;  2LKP A;  2W84 A;  3FF5 A;  1UHM A;  2R3S A;  3AAF A;  2A68 F;  1TBX A;  4OIP F;  4UV9 A;  4KNY A;  3QU3 A;  2OAZ A;  3IRQ A;  2K4B A;  4N9H A;  3G3Z A;  4M9Z A;  4M9S A;  1R00 A;  2D1H A;  3MAJ A;  1P2F A;  1KU9 A;  1SD5 A;  4KDP A;  1FOK A;  2V1D A;  2XKP A;  3QOP A;  2Z99 A;  1Z1D A;  3O3K A;  3E6C C;  1U5T C;  4I98 B;  3GFM A;  5D8L B;  5E1W A;  1BM9 A;  3IRR A;  4U0Y A;  4ZZL A;  3M1E A;  4IJA A;  2F5E A;  1FBS A;  1KQ9 A;  5E18 F;  1W5T A;  1YIO A;  1XSD A;  4I01 A;  2L4M A;  1MZB A;  3GFL A;  1LQ1 A;  2YX7 A;  4IF4 A;  1P6R A;  3MZY A;  4ESF A;  1XD7 A;  4MQV A;  2Q8K A;  3RIR A;  2DPU A;  3VOD A;  4LLN A;  1YW7 A;  1K78 B;  3K1P A;  2MD5 A;  3HOS A;  3F3X A;  3V8J A;  4HDV A;  4DQ2 A;  1T39 A;  5CYV A;  4YFN F;  1A04 A;  2PN6 A;  5IT9 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...