2ETHA

Crystal structure of a marr-like transcriptional regulator (tm0816) from thermotoga maritima at 2.50 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
HMDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVEALSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, putative, Mar family
publication title Crystal structure of Transcriptional regulator, putative, MAR family (tm0816) from Thermotoga maritima at 2.50 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ethA00
5J8CA 3F8CA 1TQPA 4LJZF 3H3UA 3TDZC 1G4DA 4Y17A 2X0LA 2R7FA 1DUXC 2XV4S 2HOEA 3BJAA 4KNYA 4M73A 4LD5A 2XKOA 2K27A 2L4MA 6PAXA 4PDKA 3GYHX 1GHCA 3DFGA 2GAUA 1R23A 1S6LA 3IKTA 2VBWA 1RUOA 3FXRA 1O3QA 1MZBA 2QYOA 4QWQA 4LB5A 2VT3A 1D3YA 2QM3A 3BWGA 2DT5A 1XDSA 1FBSA 3LSTA 2BE5F 1BM9A 3ULQB 3HHGA 2ACJA 4CZZA 4UV8A 4RGUA 1XCVA 2DLLA 1Z9CA 3DQVC 2HYFA 3H92A 2BEOA 1Y0UA 5FLXK 2L54A 1TBXA 4XLPF 4PZJA 1YW7A 2NNNA 1CGPA 1I6XA 3WE2A 3QRFF 2XRNA 5F1RA 3I54A 3BY6A 3QU6A 5D6FA 4ZYHA 4HZFA 4CGZA 2GWRA 2HKXA 4GGGA 5LGNA 2BYVE 2F5EA 2OAZA 2MH2A 4YIIA 5LRSA 1ON1A 2QQAA 2OZUA 5LBQA 3KP2A 4MTDA 1I5ZA 2H27A 4CYDA 3F3XA 1PP8F 5LHIA 2KJBA 3TGNA 2VOOA 3C7JA 3BOQA 1G3WA 3WTWC 4EMSA 3EDPA 2FRHA 2A07F 2H6CA 3HSEA 5L3EA 1TQIA 4RS8A 1J5YA 3HSFA 3HYIA 5FB2A 5JR3A 2PLYA 2QQ9A 3F8NA 2P6SA 1YG2A 2Q8KA 2MA3A 3RIRA 1U8RA 3T1BA 4RGRA 4M6YA 3WTZA 1HSJA 5DEQA 2D45A 2XVCA 5E20A 4WCGA 1LQ1A 4LK1F 4Y13A 4RB2C 1OYYA 4BYYA 5D4RA 2DFIA 2YX4A 5H20A 1BIAA 2LSOA 4YIFA 1KYWA 1BN5A 3J80K 5HLHA 1R1TA 4KYWA 3M8EA 3TO6A 1FBUA 3RPUA 1KU3A 3WGGA 2FMLA 4ZH4F 5TJJA 1H9TA 2M45A 2EV6A 5K5OA 2CWEA 4P55A 5CVJA 1R7JA 2ELHA 2XKPA 3I58A 3VEPA 3JW4A 1FSHA 1QPMA 3ABUA 5IT9Z 1LDJA 4G7ZF 3G3ZA 1ZH5A 1ZLKA 3L7WA 5L3GA 4R8HA 2Y0MA 1RI7A 2RKHA 3DP7A 5DD8A 1YS6A 1XGSA 1O7FA 4Z2YA 2O8XA 2XAGA 2PG4A 3ZMSA 2OU2A 3MFKA 1J2XA 3ZMZA 2P4WA 4F7ZA 4ZZDA 1ZREA 1SD6A 1ZN2A 1KA8A 3GO5A 2IVMA 1K78A 2VXZA 2Z33A 2D1VA 3N4MA 2E1NA 5AONA 4AIKA 4IHTA 4HX4A 2JT1A 2Q0OA 4CDGA 5H6QA 4NQWA 1LNWA 4KIFA 1TW2A 4FX4A 3ZN0A 3JAMK 1IXSB 3R6SA 1Z05A 4G7HF 4ON0A 1R1UA 5J6XA 4KMFA 3QP5A 5A2QK 4FHTA 4RB1A 1R22A 3FX3A 5JFRA 1IXRC 4KICA 4XLNF 2EA4A 2K02A 2FNPA 2M1BA 1ZHFA 2F5FA 5K5QA 4RB3C 3HTUA 1V3FA 2UXNA 3T8TA 3U9GA 4KIGA 4WWCA 4I02A 4EJVA 1TNTA 1SD4A 1B59A 3J7AO 4LLNA 5JVTA 4KA4A 3MZHA 4BHPA 4YFKF 1Z6RA 1KU2A 1Q1HA 1SMTA 1HW1A 2CFXA 3QAHA 1FT9A 2OBPA 2FEZA 5JI6A 1XB4A 3MZYA 4OIQF 3JAMZ 4OMYA 2IJLA 2RC4A 1PP7U 3E6DA 3HTSB 5FD6A 5BPIA 1QNTA 2OQRA 3D0SA 3OOPA 5DCMB 1XD7A 4E70A 5A2QZ 2XROA 2VOPA 1P6RA 1LDDA 2KIMA 1UHMA 2O6GE 1LEBA 2QWWA 3ZP5A 1F1ZA 1V4RA 2HFHA 2WTEA 2M30A 3RDIA 4ETSA 3VB2A 3ECOA 3R0AA 4D0PA 2YU3A 3BPVA 2O0YA 3KE2A 4AWXB 4JBAA 5E17F 4RAZA 3LQRA 2RNJA 2NRAC 2NNYA 2EWNA 3O3KA 1DPRA 1JHFA 4YFXF 1YS7A 5ILSA 5ICEA 3R0JA 2RGVA 3GVAA 3W6JB 2DTRA 4A6EA 2A68F 2FQ3A 1I1SA 3TOBA 1OR7A 3M7GA 1JXSA 1QZYA 3HUGA 4JQFA 3Q9VA 4EM2A 1IN5A 4AIJA 2EA2A 1E2XA 1SFUA 1HSTA 4U0YA 1VTNC 2GQQA 2FE3A 1AOYA 2HS5A 1FYLA 2UZKA 4BHBA 2WWYA 1PDNC 5LGTA 1T39A 2CGPA 2EFOA 4IRGA 1EH8A 5HDKA 1PUEE 4M72A 3WE3A 1WRJA 2V79A 2HEOA 4Q4ZF 3F72A 4A0ZA 2W24A 1T6SA 3LA3A 3IWFA 3SHFA 4HF2A 4M71A 1FX7A 2C6YA 4JK1X 1QO0D 4AVPA 2V1UA 3VOEA 4KMUX 3V8LA 2J5PA 1IN8A 2G9WA 2MLGA 3COAC 3D5LA 3E6MA 2YSRA 4MNUA 3JSOA 4A0XA 2QENA 4HBLA 1IN7A 3E5UA 2PMHA 2FSWA 5ERIA 5D5XB 2HYGD 2PN6A 2GA1A 4I0AA 4UXNA 2D1HA 3WODF 2A69F 3WU1B 5E18F 1FP2A 4Q5SF 2STWA 5LRRA 3MWMA 4EM0B 5HS8A 4OOIA 2K4BA 1U5TB 5E1XA 1XGMA 3IL2A 2KKOA 2QQBA 1ZRCA 4ESFA 5D8KB 4KUMA 1AWCA 4IPAA 2R7DA 4GYGA 3LWFA 4EJTA 2KRFA 1R1VA 3OV8A 1YIOA 2D2WA 4ESJA 5FD5A 1SD7A 1W7PB 1O3RA 1IXCA 4EV0A 3MAJA 2VT2A 2LNBA 2M8EA 1SD5A 5E8GA 2Y75A 2O3FA 4M74A 4HF1A 2TDXA 5HS9A 3R4KA 3PQKA 4EM1A 3IWZA 2VBYA 2ESNA 3M1EA 2F5DA 3U2RA 4LFUA 2VONA 4OINF 4MHGA 3ZN1A 3MEXA 1MDMB 3F21A 3K0LA 2VN2A 4RAYA 3T8RA 3WTXC 3ABTA 2BV6A 2EV0A 1OYWA 4R79A 2P7VB 4KN4X 5HLIA 2GXGA 3V4GA 2NS0A 2FBHA 3TO9A 2UXXA 3ECHA 1RNLA 1ZYRF 2YR2A 5DYMA 4DNCA 1G3SA 2FU4A 4XSXF 3KZZA 2OA4A 4HYEA 3S2WA 2FMYA 1FSEA 2ESHA 1RIOH 1BI0A 1FNNA 2L4AA 2WC2A 2DPUA 4DQ2A 3F22A 1ULYA 2VC1A 3E6BA 2DI3A 4MTEA 1USTA 1FZPB 3GEZA 2H94A 5CVIA 1EV7A 4LG0A 3VFZA 4L9TA 2VBXA 1I27A 4M6XA 5IT9K 3O6BB 4MEYF 1P92A 5ICCA 2A5YB 1KQ8A 2ZFWA 1G3TA 5BS6A 3I64A 4ENMA 1HKSA 2Z9OA 2F5CA 1ONVA 1R5HA 3RYRA 4ZYDA 2H09A 3L00A 4BHCA 2W84A 3ZQ7A 1JGSA 1UFMA 2ZJ2A 5TRDA 2P8TA 5CVRA 1F5TA 2JPBA 1L3LA 1SFEA 2ZKZA 2PI0A 4A0YA 2JZYA 2P7CB 1BI2A 4IJAA 2ADUA 3V7SA 1S7AA 5E1ZB 3JTGA 3I59B 3KCCA 4GXOA 1XMAA 4A2UA 1YFHA 3ZMDA 3DPTA 4EQQA 4YG2F 3WTYC 1BIBA 1USSA 2O61A 3TOAA 2EFPA 1YQAA 3WG9A 3HRTA 5DUIA 2HKOA 4G94A 2YX7A 2XIGA 1KU7A 4GCVA 3FM5A 4EVIA 5ILVA 4IVNA 3HIFA 2RQPA 1J0RA 1H9GA 2ZO4A 1IUYA 2Z99A 3C3WA 3KP7A 1W7PD 2Y48A 1R5GA 4HDVA 1ZAOA 3F6VA 3G73A 2PFBA 3M9AA 2J5OA 3GF2A 1ZG1A 3J81K 1S29A 4HV6A 4LLLA 2FOKA 2IP2A 2FA5A 1R36A 3DXJF 1ZG3A 3LFKA 2KIUA 2CO5A 4L18B 2MH9A 4U7DA 2CW0F 2QBYB 5BQTA 1C0WA 4UHTA 3SXYA 3GFLA 1FOKA 3CLOA 1T38A 3I53A 3E3VA 2HQNA 3N97A 4P5OA 4ESBA 2ZCWA 2MC3A 2FF4A 1LEAA 4LMYA 1Z7UA 4UVBA 5ICGA 5L3FA 1W5TA 3J81Z 2EV5A 4L0YB 3FXUA 3U1DA 3I4PA 2RVCA 1CF7A 1EH6A 1HW2A 1B4AA 1QBJA 3Q9SA 4I09A 2P6TA 4LK0F 3FHZA 1P4WA 3GWZA 4UV9A 2DPDA 4ENJA 1E17A 4WK8F 1KGSA 2QLZA 4L9NA 4IRIA 4ZYGA 4ENKA 5ICFA 3SZPA 2XAQA 1TNSA 3QP6A 1IN4A 1T0FA 2QVOA 2DW4A 4PGGA 2XAHA 3L2CA 4TV7A 1O57A 5LHGA 4EJUA 2KJCA 1Z6TA 1LVAA 3WTUC 2P5LC 1GXPA 2OZ6A 5LEJA 3LAPA 4L0ZB 3JSPA 1X3UA 2A3SA 2GXBA 2LF7A 4KIBA 5BMZA 2BBYA 4XBFA 1J59A 3RKXA 3L9FA 2IA0A 2G7UA 3SQNA 5CVUA 4O6JA 3HSRA 4R1HA 2Z3YA 3LA7A 2ZMEA 5LGUA 3IKVA 3WTVC 3BP8A 3REOA 4I2OA 3GUDA 4S05A 2FNAA 1HKQA 2P5VA 2HGCA 1MD0A 5LEKA 2CSOA 5FFZA 1OPCA 5ILUA 3KP5A 3EETA 4G8XA 3T5XA 2EK5A 2ZNZA 5J8FA 3WTTC 2V1DA 2ZXJA 3H3ZA 2XHKA 3GXOA 1P4AA 4WF2A 2COMA 4IXAA 3PFIA 1F9NA 5F6FA 2HR3A 1ZRFA 5L3CA 1HW5A 4XRFA 3WGIA 4HA8A 3CUQB 1L0OC 1XSDA 2STTA 2DBBA 2VBZA 2CYYA 3WU0A 1UCRA 3HHHA 3DPLC 1FBQA 4I01A 2GIVA 3B73A 2XGXA 1U5TC 2GZWA 1DPUA 3E5XA 1WKMA 1BI1A 4U88A 1S8NA 5BOXA 1F4KA 1U5TA 1G6NA 3LQQA 2W57A 1QGPA 2M87A 2OD5A 3NQOA 5KK1A 1SFXA 2HWVA 1K79A 5F64A 4UUVA 5IT3A 3K2ZA 2PBIA 5K1YA 3ELKA 5CJ9A 3W6KB 2L02A 1DP7P 5JHUA 1NHAA 1FC3A 1MKMA 2FXAA 3R60A 4HW0A 1RUNA 3SFZA 4PGHA 1FY7A 3QOPA 3ISPA 2EJRA 3RPQA 1WSUA 5L3DA 4O5VA 4HDUA 2W85A 2EFQA 3GFIA 2NAZA 3V8JA 4AD9A 4N9HA 3P7NA 4RGSA 1YO5C 4WXHA 3FWEA 4H0EA 5D5UB 5K5RA 2DQLA 3MQ0A 1TQMA 2X4HA 4Q47A 1BI3A 3V8KA 1MDMA 4M9XA 4BAYA 1D8JA 2HQRA 2IRFG 2V9VA 5AIQA 4I7HA 3M8FA 1U78A 4P9FA 1U3EM 2AS5F 3GFJA 4QLCU 4BH9A 1XSXA 4KT5C 2NYXA 3B02A 1XGNA 1HBXG 2E7WA 1HKTA 1ON2A 1WI9A 5LLQA 5E1WA 5HOOA 1UHWA 1T2KA 3CDHA 3HRUA 3FM3A 4OU0A 4A5MA 3CO6C 1U2WA 5AIPA 2ISZA 3GZ5A 1H0MA 1FYMA 1BOAA 4L9JA 3CO7C 1FLIA 1HQCA 1XN7A 1J9IA 4N9IA 4G6QA 4LLGF 5LHHA 4A5NA 3C1DA 4HAMA 1STZA 3GX4X 1IRFA 3GW2A 4A6DA 1ZARA 3I5UA 4NHJA 4FX0A 2A61A 3F8MA 1Z1DA 5E8IA 2CQKA 4OIRF 3I71A 1FPQA 3LA2A 2OQGA 4Y15A 4U0WA 3GLXA 3FF5A 2DAOA 3I59A 2VC0A 1TLHB 1MJAA 1LJ9A 2HTSA 5HS7A 4IRHA 4UVAA 1YLFA 1OYIA 1IN6A 3NRVA 5FLXZ 2IA1A 3Q5FA 2F2EA 1D5VA 1IZ1A 3IRRA 4OIPF 3KLOA 4KN7X 4LG0B 3DV8A 4XSZF 2IT0A 3FZVA 5BPDA 4BQAA 4MQVA 4LGWA 3HOSA 2V1XA 3DF8A 4MGRA 2RDPA 4ZZLA 3HOTA 2K4JA 3DEUA 1I1GA 1EH7A 1XCBA 4OIOF 4ASNA 4AIHA 4HQMA 1YYVA 1XGOA 4ENNA 2IPQX 2K86A 3ERED 4B8XA 2IA2A 1QQIA 3FMQA 3KP6A 4K2EA 3BROA 5D5VB 3O2PE 4FT8A 4M9SA 3GFMA 2UWMA 3HRSA 1SAXA 3K1MA 4Q48A 3ZPLA 1XMKA 4L9VA 2K7LA 3F6OA 3RKWA 1BBYA 1OKRA 1WQ2A 3CTAA 2ZBKA 3ZMVA 4A12A 2O03A 3KETA 4HV5A 4CHUA 2A6EF 2QBYA 1ZRDA 2W25A 1D8KA 3EYIA 3WGHA 3J80Z 2QUFA 5DDGA 2XAFA 3P9CA 1K6OA 3K69A 2M5WA 4RGXA 5CVVA 3FXQA 3F23A 1SMYF 2XUBA 3KZYA 2GA2A 2Z5UA 1FYKA 2EFNA 4CXFA 2PJPA 2A6HF 3GZ6A 4WXDA 1FP1D 2MBFA 5CLSA 2R3SA 1XDUA 3F8FA 3IRQA 1K78B 2G7HA 4MQ9F 1KQ9A 4GYIA 2PMUA 4ZYEA 4IHSA 1YTYA 3EQLF 3QPHA 1Z91A 5DCFA 1IW7F 4EJOA 1S3JA 2XAJA 5L3BA 3C18A 1REPC 3KP4A 2ETHA 3BZ6A 3RTRA 5D4SA 3F8BA 2VE9A 1P2FA 1UB9A 5CYVA 5DCMA 3I0TA 2EB7A 4I98B 1JHHA 3TO7A 2LDUA 1YW9A 2LF8A 2HDCA 5H6RA 2DU9A 4LB6B 1IRGA 1J75A 2RN7A 1P4XA 5D6EA 3NEUA 2DQRA 1ZGJA 4EGYA 5D5WB 3FMSA 2IW5A 2YPRA 3RYPA 1BC8C 2JRTA 3PQJA 1J7KA 3E6CC 4HLYA 1LB2A 2VODA 2EFWA 1O3SA 1KU9A 2MD5A 1HXDA 4I0BA 2ISYA 2H6BA 2LKPA 4HOBA 1YW8A 3T0YA 4P96A 3E97A 1CF7B 3P9IA 3R61A 4BXUA 1W4MA 4RB0A 2BGCA 4S04A 3K9TA 3ZMUA 5HDNA 3BDDA 3MCZA 2AXLA 1O7LA 4G6DA 3JTHA 4WX9A 3CJNA 1A04A 4MEXF 3K1NA 2KIFA 5EEHA 3E5QA 4M9ZA 1BJAA 2ZNYA 1MJBA 3RKYA 4L5JA 1ZG5A 2DK8A 2L01A 3RJPA 1RZ4A 3CUOA 3ROUA 4YFNF 4P9UA 2WV0A 3EYYA 3FMRA 4PCQA 3WTSC 3P9KA 1ZGAA 3ZMTA 4EJWA 2HZTA 3TQNA 4N0BA 3K1PA 1T98A 2VE8A 1B6AA 4O3MA 1ODDA 1TTYA 1IF1A 2JPCA 3VODA 1WWXA 5HDGA 4CO8A 1B1BA 4U7BA 4G7OF 1S7OA 2PQ8A 5DD4A 4OMZA 3CUQC 5HVQC 3TDUC 2PEXA 1R00A 5FO5A 3KEQA 3KLNA 1W5SA 3CUQA 4UVCA 2B0LA 4HX8A 1K7AA 2MLKA 2XASA 2JTVA 1LDKB 5HLGA 1B9NA 5DV5A 4KDPA 2Q2EA 4HLXA 4KFCA 4BNCA 4IF4A 4EGZA 2FBIA 5DUKA 2ZMEB 1MJ9A 3DKWA 3BJ6A 1TW3A 3KEOA 4NB5A 1KQ0A 1FWZA 3SZTA 2HTJA 1IAWA 1GVJA 1OMIA 4UNOA 3TKYA 2L3DA 4WXCA 2DO7A 2RV8A 1B9MA 3IC7A 1BC7C 1G3YA 1QZZA 5KVRA 1GXQA 1DDNA 2V6CA 5FFXA 5FGMA 3KP3A 5D8LB 4CICA 1JE8A 3QU3A 1KYZA 1MGTA 3HRMA 5ED4A 3EUHA 2DK5A 2QZ8A 4GO1A 2E7XA 5EEGA 4G9YA 2FBKA 4B09A 3V7CA 1O3TA 3V7RA 3KFWX 3RI4A 3LAJA 1XSVA 2P5KA 4HX7A 1R58A 1W7PA 1U6GA 4HF0A 3BJOA 4U0VA 3L09A 3QPTA 3AAFA 3ML6A 2CG4A 3BPXA 2JSCA 2E1CA 1ZLJA 3IHUA 4HQEA 4L5IA
chains in the Genus database with same CATH superfamily
5J8CA 2Z2SB 3CC2I 4PSXA 3OYGA 1FIAA 4MFDA 3F8CA 1TQPA 1ETKA 3K2AA 3A2KA 3QYFA 4LJZF 4ITVA 3PM1A 3H3UA 3TDZC 4LIUA 4Y17A 4BUPA 2X0LA 1G4DA 2NS8A 1NTCA 1K6YA 2R7FA 1DUXC 2XV4S 2HOEA 3BJAA 1AHDP 4IOAF 2GOMA 4KNYA 4M73A 2K3PA 4LD5A 2XKOA 3JRFA 1FJLA 3Q0VA 2K27A 2L4MA 6PAXA 4PDKA 2R5YA 2O9LA 4L5EA 3GYHX 2E2IJ 1GHCA 2XAUA 2V9PA 3ZCOA 4I99C 4IQ4A 5EDNA 2CFOA 3OSFA 2M0CA 2XF6A 1IV6A 2WV1A 3DFGA 1X2NA 2GAUA 2HVQA 5FKOA 1JJ8C 1R23A 4A93J 1S6LA 4FTHA 3IKTA 2VBWA 1RUOA 3FXRA 2XRLA 1O3QA 3BC8A 1MZBA 2QYOA 3CF2A 4QWQA 4LB5A 5EYRA 2VT3A 5C4JJ 3G1OA 1D3YA 4E7SA 2QM3A 3K6GA 3BWGA 2DT5A 4MO7A 4D5CA 1XDSA 1FBSA 3LSTA 1OQYA 2JJ7A 3DBLB 3HOVJ 2BE5F 1BM9A 3SDBA 3ULQB 3HHGA 2ACJA 2JSPA 3OIQA 4RGUA 4UV8A 4CZZA 1HLVA 1XCVA 4C3IJ 4C30A 1IDZA 2DLLA 1Z9CA 3DQVC 2HYFA 2X1CA 1SEUA 3H92A 2BEOA 1Y0UA 1Y56A 1Z3YA 3BTCA 4DJAA 3PSFA 5FLXK 2L54A 3ASNH 1TBXA 4XLPF 4PZJA 3BTIA 1QVTA 1NG7A 1YW7A 2NNNA 4AUXA 1CGPA 1I6XA 1ZR4A 3WE2A 4G12A 2XRNA 3QRFF 2IS6A 1JTXA 1S72I 3HOWJ 5F1RA 4RM3A 3W6VA 1PYVA 3I54A 3BY6A 3QU6A 5D6FA 4ZYHA 2EINH 4HZFA 5K7HA 4CGZA 2GWRA 2VPRA 4F91B 2HKXA 4GGGA 2QQ8A 5LGNA 2BYVE 3AKZA 2F5EA 2GOXB 2MH2A 2AXTC 2OAZA 4YIIA 3ZQFA 5LRSA 4W1UA 1ON1A 2QQAA 2NOGA 4Y7NJ 2OZUA 5LBQA 3KP2A 4MTDA 1I5ZA 4RLQA 2H27A 4CYDA 3CZ6A 1JT0A 5JVGF 3F3XA 2CUJA 4Y3OA 5LHIA 1PP8F 4BS9A 2V7FA 4BQNA 2KJBA 3DWLE 3TGNA 3TW6A 3EPZA 3CCQI 3O8GA 2VOOA 3CESA 2ZC2A 3C7JA 3QPSA 1B8IA 4I76A 1D1CA 4IOCF 3BTJA 2DFFA 1GLNA 2X1EA 1W0TA 3BOQA 1X1DA 2IS1A 1G3WA 3WTWC 4EMSA 3EDPA 1LKXA 2FRHA 2A07F 5GTHC 1VQNI 2AQEA 4B48A 1IRZA 2H6CA 5IP6A 3G71I 3HSEA 5L3EA 2JA8J 1TQIA 1FMWA 4RS8A 3DBHB 2W82A 4A3EJ 1J5YA 3HSFA 1SVLA 1S7EA 4UUSA 3HYIA 5FB2A 1U9OA 5JR3A 3D1NI 1GV2A 3UR3C 2PLYA 3QQAA 2QQ9A 3F8NA 2P6SA 2O8KA 1YG2A 4IHVA 4AM3A 2Q8KA 2MA3A 3RIRA 1U8RA 1EF4A 3T1BA 2DMPA 4XKVA 3A02A 3HC7A 4RGRA 1IJWC 3J7AY 4M6YA 3WTZA 1HSJA 5DEQA 2D45A 1X58A 2LREA 2XVCA 2RQQA 4I6ZA 5IYDJ 5E20A 4F52A 4XOPA 3BG6A 4WCGA 1LE8A 1LQ1A 1EKEA 4YEJA 4LK1F 4Y13A 4RB2C 1OYYA 4BYYA 5D4RA 2DFIA 3E0JB 2IEKA 2YX4A 4FETA 1BIAA 5H20A 2LSOA 4YIFA 1KYWA 1BN5A 3J80K 1VQOI 2X51A 3OL3A 1R1TA 4BQOA 5HLHA 4KYWA 3M8EA 3TO6A 1FBUA 2TCTA 3RPUA 3FKJA 3V42A 1KU3A 3H35A 4FQGA 3WGGA 4IQJA 2IAIA 1YJWI 3CMEI 2FMLA 3GTLJ 4ZH4F 5TJJA 1H9TA 2ELJA 5LFAA 1SVOA 4XLHA 2M45A 2EV6A 2OPTA 3CCRI 5K5OA 2B7EA 2CWEA 4P55A 5CVJA 4RM2A 3IAS2 1R7JA 4JX4A 3H3VK 1F43A 2ELHA 1TT0A 2XKPA 2X9DA 4ABZA 3I58A 4JX5A 3VEPA 3JW4A 3U1KA 1PUFA 1QRYA 1FSHA 1QPMA 3ABUA 1P7JA 5IT9Z 1LDJA 2X85A 3CQZJ 4JX6A 4G7ZF 4U87A 3GBGA 2CU7A 3G3ZA 1ZH5A 1ZLKA 3L7WA 5L3GA 4R8HA 2GM4A 2Y0MA 1RI7A 2RKHA 3DP7A 5DD8A 3IH4A 1YS6A 1XGSA 1O7FA 3FXOA 3QOEA 4Z2YA 2HYJA 4PJJA 2O8XA 2XAGA 5IP7J 1TT5B 2PG4A 3OYDA 3ZMSA 2HDWA 2BVLA 2OU2A 3MFKA 5DS9A 1J2XA 2R0QC 3ZMZA 2P4WA 4F7ZA 1MSFC 4ZZDA 4HPQA 1ZREA 1A5JA 1FOWA 1SD6A 4IEJA 1ZN2A 4BACA 1KA8A 3ESWB 2R7QA 2XPWA 5EG0B 3K10A 3L2WA 3GO5A 1JKOC 2IVMA 1K78A 3I3LA 3M1CA 2HXOA 2VXZA 2Z33A 2VJ4A 1MMDA 2D1VA 1RRJA 3N4MA 2E1NA 5AONA 4CYCB 4AIKA 4IHTA 2HVRA 4IO9F 2F4IA 1YITI 2CQQA 1WPKA 4HX4A 4ANJA 2BVMA 2JT1A 2Q0OA 2UUZA 5H6QA 4NQWA 4CDGA 5IPAA 1JKQC 2ZSHB 3AG1H 3C2GA 1IUFA 2BHYA 1LNWA 4KIFA 1TW2A 1WVRA 4FX4A 4FE4A 2NVQJ 3PSIA 4CCJA 3ZN0A 3JAMK 5KAIC 1IXSB 2JN6A 1WCMJ 1I3QJ 2QKMB 3R6SA 1Z05A 4G7HF 4NC6A 4ON0A 5J40A 1R1UA 5J6XA 3K70C 4KMFA 3QP5A 5A2QK 4BKXA 4FHTA 4BQQA 4RB1A 1R22A 3FX3A 4XQFA 5JFRA 1IXRC 4YRVA 4KICA 2L0KA 4XLNF 2EA4A 2K02A 2FNPA 2M1BA 3HEFA 1ZHFA 2F5FA 3OY9A 3ZXSA 5K5QA 2EQRA 4RB3C 1UHSA 5GTIC 2A05A 3HTUA 1V3FA 4D1QA 3OYKA 2E71A 1ETOA 2UXNA 3T8TA 3U9GA 2XF5A 4KIGA 4D5FA 4WWCA 4I02A 3S14J 2KPMA 5E3LA 4EJVA 2IS2A 1TNTA 3CMYA 1SD4A 1WHUA 1B59A 1JJ6C 4LLNA 3J7AO 1VQ9I 1JTYA 1ETYA 2LBFA 5JVTA 3RQ4A 4KA4A 3LSMA 3MZHA 4BHPA 4YFKF 1Z6RA 3HB9A 1KU2A 1Q1HA 4AVZA 1SMTA 1HW1A 2CFXA 1Y0NA 4RAFA 3QAHA 3H5AA 2GXAA 1FT9A 5FJ8J 3H9JA 1QA6A 2OBPA 1XG1A 2FEZA 5JI6A 1XB4A 3MZYA 3KZIC 3MKZA 4OIQF 1LFPA 3JAMZ 1T8IA 4OMYA 2IJLA 2RC4A 2CW7A 5GPCA 1PP7U 1YIJI 1SFKA 2PJRB 3E6DA 3HTSB 5FD6A 1WH5A 5BPIA 3BR6A 1QNTA 3S32A 4PUSA 4HEA2 2OQRA 3D0SA 3OOPA 5DCMB 1XD7A 4E70A 5A2QZ 4X6AJ 2CUEA 2XROA 2X6XA 2VOPA 1B72B 1P6RA 1FTTA 1LDDA 2DN0A 2KIMA 3M3YJ 2V1NA 1G8XA 1UHMA 3MVPA 2O6GE 3ZQHA 3LNQA 1LEBA 2ZSIB 3JRIA 2KT0A 1K4TA 4XOTA 2QWWA 3ZP5A 1FEXA 1F1ZA 1V4RA 2HFHA 4H4KC 2WTEA 2M30A 3PNYA 1MSEC 2Q1ZB 4KITB 5M3FJ 2Z1DA 3CJQB 3RDIA 3ONQA 4ETSA 3VB2A 3ECOA 1NK3P 3FXMA 1OFCX 2VJ5A 2LY9A 5M5XJ 5J4VA 3H5NA 3R0AA 4D0PA 1BW5A 3BR0A 2EIJH 2YU3A 2L5QA 3BPVA 2O0YA 3KE2A 4BE1A 4AWXB 1JKPC 4JBAA 5E17F 3M8JA 1ACIA 2M2EA 4RAZA 3LQRA 2RNJA 2NRAC 1YRNB 2NNYA 2EWNA 1MBFA 2Y69H 3O3KA 4JP0A 3FKIJ 4BL0B 2WAEA 1DPRA 1JHFA 3MMYB 1YS7A 5ILSA 4YFXF 2ZMEC 5ICEA 3HGGA 2YU9J 3R0JA 2RGVA 3GVAA 4G6TB 1QHHD 3W6JB 2DTRA 4A6EA 5FKMA 2A68F 1VQ7I 2FQ3A 1I1SA 2L9SA 3TOBA 1OR7A 3HBLA 3M7GA 1JXSA 4EEFG 2DCEA 3SJMA 2QF7A 4UUTA 1QZYA 3HUGA 4ZJZA 4JQFA 3FDYA 3Q9VA 4EM2A 2ZJRF 4B43A 2DT6A 1IN5A 2X6OA 3ZQIA 4AIJA 1OJLA 1U8BA 2EA2A 1GT0C 1E2XA 1SFUA 1HSTA 4U0YA 2VIXA 5IYBJ 1VTNC 2GQQA 2MG4A 5CPRB 2FE3A 1AOYA 4XORA 2HS5A 3L1PA 1FOXA 5E3OA 2JQ7A 1FYLA 3SEZA 2CH0A 2UZKA 2MD0A 2BOLA 3OS0A 3DCFA 4BHBA 3MD2A 3BCAA 2WWYA 1VQ4I 1DU6A 4Y52J 1X1PA 2BHZA 3ZQCA 1PDNC 2H1KA 5LGTA 1T39A 2CGPA 2EFOA 2R7VA 4IRGA 1EH8A 5HDKA 4KISA 3FBIB 1PUEE 4M72A 3WE3A 2NXNB 1WRJA 1SC7A 2V79A 3Q0UA 2XSJC 2HEOA 2KLOA 3K4BA 4Q4ZF 3F72A 4A0ZA 2W24A 3CCEI 1T6SA 4DZPA 1ETVA 5FLVA 3LA3A 4XKBA 3IWFA 3SHFA 4HF2A 1OISA 2Y30A 4M71A 4AIDA 1FX7A 2LVSA 2LR8A 2C6YA 1VQLI 2VQCA 1I50J 2CRGA 4JK1X 1QO0D 3PUBA 4PFPA 2OC6A 3OIOA 4AVPA 2V1UA 3VOEA 4HSTA 4KMUX 1AKHA 3V8LA 3JCUC 2J5PA 1IN8A 2OUMA 2G9WA 2MLGA 2L9VA 3COAC 3D5LA 3E6MA 2YSRA 4MNUA 3JSOA 4A0XA 4XMYA 4XNFA 2QENA 1X4OA 3FHNA 4HBLA 1IN7A 3E5UA 2PMHA 2FSWA 5ERIA 5D5XB 2HYGD 2R7WA 2PN6A 1UG2A 2IGNA 1A36A 3K4NA 2GA1A 4E4HA 2L7ZA 3AG3H 4I0AA 1U9NA 2HU9A 4UXNA 2D1HA 4FCYA 3WODF 1R71A 2A69F 3LSJA 3WU1B 5E18F 1W36D 2L7KA 1FP2A 3CCYA 2XGEA 4Q5SF 2GIZA 2DYSH 2OV7A 5CQGA 3L2VA 3G6EI 1E3OC 3HL2A 3S15J 2STWA 2R7ZJ 5LRRA 3MWMA 2K9LA 3PNTA 4EM0B 1D0YA 3BR5A 5HS8A 2DA4A 2K4BA 1TWGJ 4OOIA 1U5TB 1MNMC 2X1DA 1LVKA 4J19A 5E1XA 5F08A 1XGMA 2ME0A 3IL2A 2KKOA 2QQBA 1ZRCA 4ESFA 3G2BA 5D8KB 2HOSA 4CCNA 1RC9A 3HOZJ 4KUMA 1AWCA 2AQFA 1D5YA 4BGDA 4IPAA 5EZGA 2R7DA 4GYGA 3UKGA 3LWFA 3CCVI 4EJTA 2X48A 3HG9A 2IS4A 2KRFA 1R1VA 1Z77A 3OV8A 2HDDA 2BY1A 5F0FA 2M9HA 1YIOA 2D2WA 4ESJA 2HQAA 3OYMA 1HF0A 2AO9A 5FD5A 1SD7A 5B3SH 1W7PB 1O3RA 1IXCA 1WJAA 4EV0A 5DM7F 3MAJA 2VT2A 2XB5A 2LNBA 3IP4B 2M8EA 1SD5A 5E8GA 1XS9A 2BZTA 2Y75A 5LD2C 2EZIA 2O3FA 4M74A 4M3FA 4HF1A 4AC0A 2TDXA 1J09A 3KYLA 5HS9A 3FK6A 3R4KA 2R5ZB 2JUCA 2M4GA 5B66C 3GZNB 2WADA 3PQKA 3S93A 2M7AA 2XGCA 3IWZA 4EM1A 2NS7A 3AG4H 3I4NJ 1OCZH 3QYBA 1SFOJ 1JUSA 2VBYA 1T56A 2LD5A 4D7MA 2ESNA 2ZXHA 3M1EA 4OAYA 2F5DA 3ABLH 3U2RA 1DGRM 3VYUB 5B5EC 5J1RA 4LFUA 2VONA 4OINF 2MC4A 3S17J 4MHGA 3ZN1A 3MEXA 9ANTA 1MDMB 3F21A 3K0LA 2VN2A 4RAYA 3T8RA 5EF6A 3WTXC 4DOZA 2BXYA 4DBRA 4BY1J 2R92J 3LSPA 3ABTA 2R7RA 2BV6A 2EV0A 1I39A 1OYWA 3OR2C 4R79A 2P7VB 4KN4X 5HLIA 2GXGA 4XM3A 2R5YB 3V4GA 3OS2A 2NS0A 5IOYA 2FBHA 2CUZA 2KISA 2M34A 3BG9A 3TO9A 3TBIA 5HNHA 2UXXA 3ECHA 1RNLA 1ZYRF 2YR2A 2LYCA 1G59A 4BXXJ 5DYMA 4BJTA 4DNCA 1G3SA 3A0HC 2FU4A 4XSXF 2DOFA 1M1EB 2OA4A 3KZZA 4HYEA 3B6AA 3S2WA 4IX7A 4E6KG 2ZXIA 2FMYA 2DYRH 1FSEA 4YIRX 2ESHA 1R9TJ 1RIOH 2H1LA 2E34A 5M3MJ 1BI0A 1OCRH 4CH7A 1FNNA 2VQHA 2L4AA 2WC2A 3HKZA 2DPUA 4DQ2A 2VQGA 3F22A 4F93B 1ULYA 1ETQA 2ECBA 4A3MJ 2VC1A 3E6BA 2DI3A 4MTEA 1USTA 1FZPB 3GEZA 2H94A 1X1AA 5CVIA 4DYQA 1EV7A 3IH2A 1X4PA 4LG0A 3VFZA 4L9TA 3GTKJ 1GDTA 2VBXA 1I27A 2E35A 4M6XA 2MW8A 5IT9K 2E60A 4CCOA 5E3NA 3O6BB 4MEYF 1P92A 5J3LA 5ICCA 2A5YB 2WAFA 3ZQQA 1KQ8A 2ZFWA 1QU3A 1G3TA 5BS6A 3I64A 3VWBA 2PMZA 1XMXA 3DBRB 4ENMA 1HKSA 2Z9OA 3SFIA 2F5CA 3GTMJ 1ONVA 1R5HA 3RYRA 4ZYDA 2IBDA 2H09A 3U21A 3L00A 3WU2C 4BHCA 2W84A 1VI0A 3ZQ7A 1WH7A 2E36A 2LK2A 2MABA 5FRMA 3A03A 1JGSA 1UFMA 2ZJ2A 3DTIA 5TRDA 4E7IA 2P8TA 3ZQGA 3HJEA 5CVRA 1F5TA 2JPBA 2COBA 1SFEA 1L3LA 2ZKZA 2PI0A 2V26A 4D7NA 4A0YA 2JZYA 2P7CB 1BI2A 4IJAA 3GLLA 2ADUA 3V7SA 5BNGA 1S7AA 5E1ZB 3A01B 5GP9A 2EZHA 2XPUA 3I59B 3JTGA 2ZJPF 2JWTA 3KCCA 4GXOA 4ZDPA 2K9QA 1XMAA 2FD5A 2ICWG 4A2UA 1YFHA 3ZMDA 2R7UA 3VYSB 3DPTA 3OMYA 5GAEJ 4EQQA 1Z7LA 1K4SA 2E5NA 4PSWA 4YG2F 3WTYC 2O7OA 1BIBA 1USSA 2O61A 3TOAA 1MBHA 2EFPA 1YQAA 3WG9A 3HRTA 3LSKA 5DUIA 2HKOA 4G94A 2YX7A 2XIGA 1KU7A 4GCVA 3FM5A 4BJ6C 4EVIA 4W97A 3LL7A 2K40A 5ILVA 4IVNA 5CQEA 4BBSJ 3HIFA 2B63J 1BOBA 5EG0A 3SDGA 1VFCA 3BCBA 2RQPA 1J0RA 1H9GA 1LUJB 1YX3A 2BW3A 3PUFA 1MBGA 2LLKA 2ZO4A 1DGWY 1OCTC 2HNHA 3QPLA 1ETWA 1IUYA 2VI6A 2Z99A 2VJJA 3C3WA 4BDZA 3KP7A 1W7PD 3GTQJ 1WJCA 4CZCA 2Y48A 1R5GA 4HDVA 1ZAOA 3F6VA 3G73A 2CV1A 2ECCA 1GVDA 2PFBA 3KIOA 3CCLI 3M9AA 2DA2A 2J5OA 2N8GA 2EPFA 3PNVA 3GF2A 4XRMA 2MYSA 1ZG1A 1MMNA 4BXFA 2K3FA 3J81K 3ABKH 2E1OA 1S29A 4A3JJ 1AU7A 4HV6A 4F55A 4LLLA 4XLFA 2FOKA 2IP2A 2CQXA 1IG7A 2FA5A 1BL0A 3S16J 5IY5H 1R36A 3DXJF 1MIJA 2GLOA 2VL8A 1ZG3A 5JLWA 3GMEA 3LFKA 4A3LJ 2KIUA 2P0WA 1EA3A 3CDIA 2CO5A 1WGXA 1JUMA 5F04A 4L18B 4ZYAA 1P7IA 1A31A 3BLYA 2MH9A 3LSHA 4XRSA 4J01A 3OL4A 2CW0F 4U7DA 2QBYB 5BQTA 2R93J 2GBYA 4PK4A 2JVGA 2JA2A 3PL8A 1C0WA 4UHTA 2L9NA 3SXYA 3GFLA 3CCJI 3OYEA 3CLOA 1FOKA 4QIWN 1T38A 1WJFA 2K9SA 3W2WA 3NAUA 3I53A 3E3VA 2HQNA 5GAGJ 3N97A 4IHWA 1N25A 2BY3A 3RQIA 3GTOJ 4PJMA 5C4XJ 4P5OA 2LFBA 1RKTA 2E2HJ 2K9NA 4ESBA 2I8DA 2ZCWA 2MC3A 2FF4A 1LEAA 4LMYA 4Y33A 1Z7UA 4UVBA 5ICGA 1POGA 2KRHA 4JYKA 4ZTJA 2NVTJ 5L3FA 1W5TA 2NOJB 3J81Z 2EV5A 4L0YB 3FXUA 1YX5A 3U1DA 4RAGA 2PJRA 3I4PA 4II2A 2RVCA 3CCSI 1V55H 1CF7A 3NWTA 3G1MA 1EH6A 2G0EA 1HW2A 1A6IA 1R6RA 2ELKA 4XIDA 1A35A 3G1LA 1B4AA 1QBJA 3Q9SA 4I09A 2P6TA 2VXDA 4LK0F 3FHZA 1P4WA 1SAUA 3GWZA 4A3DJ 4II3A 4UV9A 2DPDA 1JGGA 4LIVA 2FUG2 4ENJA 4HSRA 2CJJA 4RA2A 3DEEA 2DXIA 1E17A 2LY1A 4V2GA 1N75A 4WK8F 1KGSA 1VQKI 2QLZA 1OLTA 3BTLA 1T0FC 2LOOA 3FISA 4L9NA 1N78A 4DW6A 2DT7B 4IRIA 4ZYGA 4UY8I 4ENKA 2DA5A 3BT9A 2XAQA 5ICFA 4V2FA 1TNSA 4BY7J 3SZPA 5K7ZA 2Y9ZA 3QP6A 1IN4A 1T0FA 2DFHA 2CW8A 3EUKL 1F36A 1WJEA 3NWSA 2QVOA 4M3DA 3SEQA 4C2TA 2DW4A 4PGGA 2LBFB 2XAHA 1TL8A 3HXLA 1MNEA 4TV7A 3L2CA 1O57A 3PO3J 5LHGA 2W48A 4EJUA 2KJCA 3HKZN 1Z6TA 1YRNA 1UAAA 1LVAA 3H9GA 3WTUC 1APLC 2P5LC 1BA5A 1GXPA 2OZ6A 5LEJA 3LAPA 1UG0A 3WG7H 4L0ZB 4XONA 3JSPA 3CMMA 1X3UA 3P5JA 2DMUA 1TP4A 4XL9A 3F9KA 5JLXA 4C3HJ 3G4SI 2WBMA 1ITYA 2A3SA 1A6QA 3VYRB 5JHFA 2GXBA 1WJBA 4RLFA 3S8PA 2LF7A 3S1NJ 2CV2A 4E7ZA 4KIBA 5BMZA 3IAM2 2BBYA 2VKHA 4XBFA 1J59A 1WJDA 2VKEA 3RKXA 3AL0C 3CP2A 1HOMA 2PMZN 3L9FA 2IA0A 2G7UA 1ZKGA 2V6EA 1I6HJ 3SQNA 5CVUA 4RDUA 1U0JA 2EIMH 3HM5A 4O6JA 2HZDA 2JRMA 3HSRA 1VZ0A 2Z3YA 3LA7A 4R1HA 2ZMEA 3JRCA 4FASD 5LGUA 2OTJI 3IKVA 3WTVC 3BZCA 4IZZA 4DIQA 3BP8A 2KRCA 4BE0A 3DU5A 3A4CA 3CC4I 3REOA 4I2OA 1NG6A 3RPUD 2WB1A 3GUDA 4S05A 2FNAA 1HKQA 2P5VA 4PFOA 3JREA 2HGCA 1MD0A 2DJIA 3M07A 4MIMA 4BEHB 5LEKA 2CSOA 3JRGA 3I4MJ 3RZOJ 5FFZA 2WY7Q 2X6WA 3AL0B 1OPCA 5ILUA 2IGMA 3CJRB 3FXKA 2LTPA 3KP5A 3GCMA 3EETA 2DOEA 4G8XA 3T5XA 1IC8A 2X6YA 2JA6J 2EK5A 3JRAA 2RREA 1QPIA 3VSLA 2ZNZA 3MKYB 5J8FA 1QVUA 4S0HB 2FJ1A 2W4SA 3WTTC 2ZFUA 3S1RJ 1X19A 2V1DA 3ABMH 2ZXJA 3J7YJ 3H3ZA 2XHKA 1DQUA 3GXOA 1P4AA 4WF2A 2COMA 4GFBA 3MKWB 3F0CA 4IXAA 1E3PA 1F9NA 3D5RC 3PFIA 5F6FA 4OWRB 3K4KA 3FXJA 2LKSA 2V4JC 3JRDA 4PJLA 3K7AJ 2KL4A 4EATA 3O8HA 3I55I 3MZ8A 2XGDA 2HR3A 1ZRFA 5L3CA 1Y8RB 1HW5A 2EZKA 4XRFA 3WGIA 4HA8A 3D5SC 3CUQB 2CMPA 5E3MA 2CUFA 2LH9A 1L0OC 1XSDA 2STTA 2DBBA 2Q2EB 2VBZA 4F3QA 2CYYA 3WU0A 3OYIA 1UCRA 1Z0XA 2VLAA 3FK7A 4BBRJ 1Y39A 3HHHA 5EZHA 3DPLC 2ME6A 3X2QH 1FBQA 4I01A 2GIVA 1MMAA 2XGXA 3B73A 4ZTFA 1U5TC 2GZWA 5J1YA 1DPUA 3E5XA 5CKTA 1WKMA 1BI1A 4NDLA 4U88A 3TP3A 1S8NA 3L2UA 4HRIA 5BOXA 4YELA 1W0UA 2L2OA 3OWTA 4IKFA 1X3ZB 4GRIA 1RPWA 1F4KA 1U5TA 4RMNA 2LP0A 3EUHC 1G6NA 1JI8A 3LQQA 3H0DA 2W57A 1QGPA 2M87A 1IGNA 2OD5A 1ENHA 1VNDA 3NQOA 2H8WA 5KK1A 1SFXA 2WAQA 3PIOF 3OIPA 5KNLA 2HWVA 1D1BA 1K79A 5F64A 4UUVA 5IT3A 3K2ZA 1R5ID 5FKKA 5DM6F 2PBIA 5K1YA 2QA4I 5EGOB 1YJ9I 3ELKA 5CJ9A 1Z3XA 4XLAA 3ZQLA 3W6KB 5K7FA 3K4CA 5TISC 2CS3A 2L02A 1DP7P 5JHUA 3DU6A 1NHAA 1FC3A 2R7OA 2MFZA 2OJED 1MKMA 2FXAA 3R60A 4HW0A 2NVXJ 1RUNA 3SFZA 4PGHA 4B44A 1FY7A 2VPLA 3QOPA 1MNDA 3ISPA 3S1MJ 3VSKA 4E7HA 3QYEA 2I5UA 2EJRA 3GTGJ 3K70D 3RPQA 1WSUA 5M5YJ 2CQ7A 5L3DA 4P1WA 2DODA 4O5VA 4HG2A 5F27A 4HDUA 2W85A 2EFQA 3GFIA 2NAZA 1MMSA 3KPHA 3V8JA 2E5ZA 4N9HA 4AD9A 3KX2A 3P7NA 4RGSA 3BG5A 1TWFJ 1YO5C 1V5EA 5F0CA 4WXHA 3FWEA 4H0EA 5D5UB 5K5RA 2DQLA 3MQ0A 1TQMA 2X4HA 4Q47A 3CC7I 1BI3A 3V8KA 1PVEA 1RR8C 3W3CA 1HA8A 1MDMA 1LFUP 4M9XA 4BAYA 2ZJQF 1D8JA 2HQRA 2IRFG 1MMGA 2DA6A 2Y2ZA 4BJ5C 1W5CC 2V9VA 1TC3C 5AIQA 1X2MA 4I7HA 4D9JA 3M8FA 4IHXA 1U78A 1BJZA 4P9FA 2FX0A 1U3EM 4Z6YA 2AS5F 4MFEA 3GFJA 4QLCU 4BH9A 1XSXA 4KT5C 3PJRA 4C2MJ 2DOAA 1HDDC 2NYXA 4KT6A 1UJ8A 1ZTRA 1TWAJ 4A3CJ 1ZGWA 4BE2A 3B02A 1VQPI 4C2UA 5IOZA 1XGNA 2KZGA 3WHCA 1HBXG 1MW7A 2E7WA 2XDVA 1HKTA 1ON2A 1WI9A 2DMQA 2DMTA 5LLQA 1BR2A 1SANA 5E1WA 1UMQA 3TMOA 5H2FC 5GPAA 1V5GA 4JOMA 4PJNA 1FIPA 5HOOA 1UHWA 1E3HA 1T2KA 1RESA 3CDHA 3OOUA 3HRUA 3FM3A 3BZKA 4OU0A 2VB6A 3HDDA 3LSIA 4B47A 4A5MA 5GAHJ 3CO6C 1U2WA 4XICA 3HOUJ 5AIPA 2ISZA 2KQRA 2E2JJ 1HC8A 3GZ5A 1H0MA 1VQ8I 3PFYA 2CV0A 1FYMA 1I3AA 1BOAA 2DA3A 1O4XA 4M3BA 4A3BJ 3PIPF 3CD6I 4QTRA 3S3OA 2ID3A 2VKVA 4L9JA 4UB8C 2Z16A 3CO7C 1FLIA 2B9SA 2F6CA 1HQCA 4N4NB 3S3NA 1XN7A 4B1RA 1J9IA 4N9IA 2E1MC 1V54H 4G6QA 3KYDB 4KJZA 3KYCB 4LLGF 2LG4A 4E7LA 1SVMA 5LHHA 2R4GA 3LMMA 1WZ2A 4A5NA 3C1DA 3RKQA 2K5CA 2M7BA 3J7ZI 2H8RA 2QCOA 4HAMA 1STZA 3GX4X 1IRFA 5M5WJ 5DTDA 3GW2A 4A6DA 2Y9YA 4GDFA 1G2HA 1JKRC 1ZARA 3QWLA 3HPGA 3I5UA 4NHJA 2L9RA 4FX0A 3OYFA 1T95A 4XLEA 2A61A 3F8MA 1PJRA 2E19A 1QZEA 1Z1DA 4AYBN 5E8IA 5HLTA 2CQKA 3DEWA 4OIRF 3I71A 2E1MB 1FPQA 3CP8A 3LA2A 2OQGA 1V5FA 4Y15A 3S1QJ 2WB1N 4U0WA 4Y4RA 2M3AA 2W00A 3GLXA 2HVSA 2I10A 3FF5A 3NARA 1FOYA 2EBIA 3A01A 1IDYA 2DAOA 3I59A 2IGOA 2JK3A 2KZVA 2VC0A 2OCEA 1TLHB 1MJAA 1S5LC 1LJ9A 2HTSA 5HS7A 2YS9A 4IRHA 1ZR2A 4UVAA 4M3GA 1EJ9A 1YLFA 1OYIA 1DU0A 1IN6A 2HXIA 1YOVB 3NRVA 5FLXZ 2IA1A 1VQ5I 4A69C 3Q5FA 2F2EA 1D5VA 1IZ1A 1B8IB 3OYLA 3IUOA 3IRRA 4OIPF 1MBKA 4X0GA 1KONA 1BR1A 3KLOA 3BR1A 4AU7A 4KN7X 1LPQA 3GTPJ 4LG0B 3DV8A 4XSZF 3C2BA 2IT0A 3FZVA 5BPDA 4BQAA 4MQVA 4LGWA 1TWCJ 3HOSA 2ZXWH 4C3JJ 2V1XA 3DF8A 4MGRA 2RDPA 4ZZLA 5F1JA 2K4JA 3DEUA 1I1GA 2LRDA 2DFEA 1EH7A 2M0MA 2NVUB 5E79C 3OYNA 2EZLA 4UUSB 4A3GJ 2RAEA 3OS1A 1XCBA 4OIOF 4ASNA 3RSNA 1CQTA 1N77A 3FXLA 1MBEA 3MKLA 3H36A 3M4OJ 2EIKH 3AFHA 3CJTB 2DDAA 5KHDA 1X1BA 4AIHA 2F4MB 4HQMA 1ZK8A 1IO2A 1YYVA 4QSHA 1XGOA 4ENNA 2IPQX 4N4OB 5IYCJ 2K86A 4NUBA 3ERED 4B8XA 2Y31A 3ERMA 2IA2A 1QQIA 3FMQA 3KP6A 4K2EA 3LSRA 1LE8B 3BROA 5D5VB 3O2PE 1QHGA 4FT8A 3JRHA 2R7TA 2VASA 4M9SA 1ZELA 5KCMA 3DKYA 3GFMA 3VPRA 2UWMA 2Y0SA 3HRSA 1SAXA 3K1MA 3HOTA 2DA7A 1XX5A 4Q48A 3HZJA 1XMKA 3QODA 4L9VA 4CYCA 2K7LA 3ZPLA 3F6OA 3RKWA 3K4MA 1X1CA 2WAQN 3CDLA 1UELB 5F0HA 1R49A 1BBYA 1OKRA 1WQ2A 3CTAA 3CMAI 2ZBKA 3ZMVA 2HI3A 4A12A 4DBQA 2O03A 1OCOH 3DTEA 4B4CA 2XPVA 1RETA 3H9QA 3KETA 4XKCA 4M6VA 4HV5A 1Q1VA 4CHUA 2AHQA 1MH4A 4DYCA 1GUUA 1PUFB 1FTZA 1GV5A 2A6EF 2DTZA 1W1WE 3TL4X 3A0BC 2QBYA 3IV5A 1ZRDA 2W25A 1T33A 1D8KA 5FKNA 3EYIA 3WGHA 3J80Z 2QUFA 3CCMI 2XB0X 1T08B 5DDGA 1VQMI 1OCCH 3VDXA 2BW3B 2XAFA 3EUAA 3P9CA 3TP0A 1K6OA 3K69A 2M5WA 3DTKA 2W1OA 1LFBA 4RGXA 2M4KA 4NNJA 3FXQA 5CVVA 1W36C 2V9KA 4QPQA 3F23A 1SMYF 3PO2J 2XUBA 3KZYA 2GA2A 3SYTA 2Z5UA 2F5VA 1FYKA 2EFNA 4CXFA 2PJPA 2A6HF 3BQZA 2JA5J 3GZ6A 2O5RA 4WXDA 2HOTA 1R4NB 5J47A 1FP1D 1XTAA 2MBFA 5CLSA 2BXZA 2OF7A 3OR1C 2R3SA 1XDUA 3F8FA 1ZQ3P 4B3AA 3IRQA 5B1AH 2HQ5A 3H0GJ 1K78B 2G7HA 3E7LA 4MQ9F 2QSHX 3ZOBA 3S2DJ 1KQ9A 4J00A 2CQNA 2JUGA 4GYIA 3K4LA 2PMUA 4ZYEA 4IHSA 1YTYA 2QSGX 1HDPA 3EQLF 3QPHA 2RNGA 4XN0A 5FKLA 2VUMJ 1Z91A 5DCFA 1IW7F 4EJOA 3LOCA 4NQWB 1S3JA 1H88C 3CLQA 2XAJA 1JT6A 3OSGA 3VYTB 5L3BA 3C18A 2R7XA 2PX9A 2DJNA 1TWHJ 1YI2I 1REPC 5IP9J 3KP4A 3ZR8X 2ETHA 1P9QC 2P81A 3BZ6A 3RTRA 2W7NA 2OTLI 5D4SA 3F8BA 2VE9A 1P2FA 5J4YA 1UB9A 5CYVA 5DCMA 1DP3A 3I0TA 2EB7A 4F92B 2LKXA 4I98B 1B72A 1JHHA 5FRNA 3TO7A 3KEYA 2LDUA 3FIWA 1YW9A 2LF8A 2HDCA 3TEDA 5H6RA 2DU9A 5B1BH 3IH3A 1WI3A 2KDOA 4LB6B 1IRGA 2M8GX 2R7SA 1J75A 1XPXA 2RN7A 2XF7A 1P4XA 5D6EA 3NEUA 2DQRA 3CF5F 1ZGJA 4EGYA 5D5WB 4ZC3A 2MGQA 3FMSA 4HNUA 3HOYJ 2IW5A 2YPRA 3RYPA 1BC8C 2D5VA 1K83J 2JRTA 3N05A 3PQJA 5EJCA 3HOXJ 1J7KA 3E6CC 4DZJA 4XKWA 4XLCA 3BG7A 4HLYA 1LB2A 2VODA 2DMNA 2TRTA 2EFWA 3RCOA 5HODA 3H5RA 2F48A 1O3SA 1KU9A 4C9YA 2MD5A 5TGTA 1HXDA 4I0BA 2ISYA 5GADJ 2H6BA 4DYRA 4RBOA 2LKPA 4X1EA 4HOBA 3OYHA 1YW8A 3T0YA 3TW7A 1Z21A 1H8AC 1WFXA 3BQYA 4P96A 3E97A 4BDYA 1CF7B 3P9IA 3R61A 4BXUA 5FLMJ 1HCRA 1W4MA 4RB0A 5FROA 2BGCA 2DDBA 4S04A 3K9TA 4CCMA 1D1AA 3ZMUA 1JUPA 1UZCA 3BDDA 5HDNA 3S3MA 1VF9A 3MCZA 2AXLA 2MSYA 1NK2P 1O7LA 4G6DA 3JTHA 4IHYA 2KFDA 2IGKA 4WX9A 3CJNA 1A04A 4FE7A 3E1SA 4MEXF 4CUGA 4M3EA 3HPHA 3K1NA 3OYCA 2A5WA 2KIFA 5EEHA 3E5QA 2QEXI 4IL6C 3CCUI 3LFUA 4M9ZA 4A3IJ 1BJAA 2ZNYA 5KAFC 3FBNB 4PJ0C 3I9V2 4NBQA 1NH3A 4QPOA 1MJBA 4DGWB 4NC8A 3RKYA 4L5JA 3B6CA 1ZG5A 2DK8A 2L01A 3RJPA 3I56I 1RZ4A 2KMUA 3OYJA 1ORKA 3JRBA 2OCCH 3CUOA 2WY8Q 3ROUA 4BEHA 4YFNF 4P9UA 2KDZA 1Y6IA 2WV0A 3EYYA 3FMRA 4HNTA 4PCQA 3BR3A 2ID6A 2JMWA 3WTSC 4FISA 4E7KA 4OAZA 3P9KA 1RKWA 2VJIA 1ZGAA 2KP6A 4MLOA 1X3WB 2XSDC 3DLAA 4ZDOA 3ZMTA 4EJWA 2HZTA 1ETXA 2LMDA 3TQNA 4N0BA 5C3EJ 3K1PA 1K61A 2VKDA 4CCKA 4AYBA 1T98A 2VE8A 1B6AA 1FMVA 4O3MA 1ODDA 4B3XA 1TTYA 1IF1A 4A3FJ 2JPCA 1WWXA 3VODA 4XR6A 1OR7C 1B1BA 5HDGA 4CO8A 3W2AA 4U7BA 3DLLF 4G7OF 3S2HJ 1S7OA 2PQ8A 5DD4A 1MBJA 3CUQC 3Q3SA 1D0XA 2QSFX 4OMZA 1Z67A 5HVQC 3Q0WA 2K9MA 1E0EA 4XRSG 3BG3A 3TDUC 2PEXA 4LITA 1R00A 2F4OB 5FO5A 2LC2A 1ERDA 3KEQA 4ZDLA 3KLNA 2K85A 2EH3A 3CUQA 1W5SA 2L7MP 4UVCA 2B0LA 4HX8A 2UV1A 2BY2A 1K7AA 3HGYA 2MLKA 2XASA 2JTVA 3ASOH 3SZGA 2HPIA 1LDKB 2WA0A 5HLGA 1S9HA 1B9NA 1KZHA 5DV5A 4KDPA 2Q2EA 4HLXA 4KFCA 3JR9A 4BNCA 4IF4A 1XC5A 4EGZA 4LOCA 1TZLA 4CCLA 2FBIA 5DUKA 2ZMEB 1MJ9A 1RR7A 3DKWA 1YHQI 3BJ6A 1R4MB 1TW3A 5C44J 3C2HA 3KEOA 4NB5A 3HUGB 2KIQA 1KQ0A 4V19K 1FWZA 1D0ZA 3SZTA 4CA0A 3ZGKA 2L7FP 2BY0A 1OCPA 2HTJA 2QKLB 2Y0SN 1IAWA 4A3KJ 4HNVA 2EILH 3L2RA 3OYAA 1GVJA 1Y1WJ 1MH3A 1OMIA 4UNOA 4XN3A 3TKYA 2L3DA 3WHBA 2FQ4A 2JA7J 2KHMA 4WXCA 2HPMA 2DO7A 2RV8A 3LSGA 5J1UA 3W2VA 1B9MA 3IC7A 1BC7C 1G3YA 2QGUA 1QZZA 5EEAA 3ZRGA 5KVRA 1GXQA 1DDNA 2V6CA 1WJ5A 5FFXA 5EGOA 5FGMA 2HOAA 3KP3A 3DPUA 5D8LB 3L2QA 4CICA 1JE8A 3QU3A 1KYZA 1MGTA 3RZDJ 3HRMA 3MN2A 1BR4A 1Y1VJ 2DK5A 3EUHA 2QZ8A 5ED4A 4E7JA 4GO1A 4CSWA 3BR2A 2E7XA 2YUSA 5EEGA 2A6TA 3AG2H 4G9YA 2FBKA 4B09A 4BU2A 3V7CA 1O3TA 3V7RA 2VQLA 3KFWX 3RI4A 3LAJA 1XSVA 1AA7A 1H89C 2P5KA 4LG3A 3A1YA 4HX7A 1VQ6I 3K4JA 2NVYJ 1AKHB 1R58A 1W7PA 2XC7A 1BW6A 1U6GA 4HF0A 4UB6C 3GTJJ 1IRXA 3BJOA 4U0VA 1Y8QB 3L09A 3QPTA 3AAFA 2DA1A 4NC7A 3ML6A 3OYBA 2CG4A 3BPXA 1IV8A 2JSCA 3H1CA 2E1CA 1YJNI 5HNFA 2IXSA 2ZB9A 1ZLJA 3IHUA 2JVHA 3UNGC 1YE9A 3DKXA 4HQEA 2LY2A 2FOWA 4XK4A 2R5ZA 4L5IA
chains in the Genus database with same CATH topology
5J8CA 3F8CA 1TQPA 4LJZF 3H3UA 3TDZC 1G4DA 4Y17A 2X0LA 2R7FA 1DUXC 2XV4S 2HOEA 3BJAA 4KNYA 4M73A 4LD5A 2XKOA 2K27A 2L4MA 6PAXA 4PDKA 3GYHX 1GHCA 3DFGA 2GAUA 1R23A 1S6LA 3IKTA 2VBWA 1RUOA 3FXRA 1O3QA 1MZBA 2QYOA 4QWQA 4LB5A 2VT3A 1D3YA 2QM3A 3BWGA 2DT5A 1XDSA 1FBSA 3LSTA 2BE5F 1BM9A 3ULQB 3HHGA 2ACJA 4CZZA 4UV8A 4RGUA 1XCVA 2DLLA 1Z9CA 3DQVC 2HYFA 3H92A 2BEOA 1Y0UA 5FLXK 2L54A 1TBXA 4XLPF 4PZJA 1YW7A 2NNNA 1CGPA 1I6XA 3WE2A 3QRFF 2XRNA 5F1RA 3I54A 3BY6A 3QU6A 5D6FA 4ZYHA 4HZFA 4CGZA 2GWRA 2HKXA 4GGGA 5LGNA 2BYVE 2F5EA 2OAZA 2MH2A 4YIIA 5LRSA 1ON1A 2QQAA 2OZUA 5LBQA 3KP2A 4MTDA 1I5ZA 2H27A 4CYDA 3F3XA 1PP8F 5LHIA 2KJBA 3TGNA 2VOOA 3C7JA 3BOQA 1G3WA 3WTWC 4EMSA 3EDPA 2FRHA 2A07F 2H6CA 3HSEA 5L3EA 1TQIA 4RS8A 1J5YA 3HSFA 3HYIA 5FB2A 5JR3A 2PLYA 2QQ9A 3F8NA 2P6SA 1YG2A 2Q8KA 2MA3A 3RIRA 1U8RA 3T1BA 4RGRA 4M6YA 3WTZA 1HSJA 5DEQA 2D45A 2XVCA 5E20A 4WCGA 1LQ1A 4LK1F 4Y13A 4RB2C 1OYYA 4BYYA 5D4RA 2DFIA 2YX4A 5H20A 1BIAA 2LSOA 4YIFA 1KYWA 1BN5A 3J80K 5HLHA 1R1TA 4KYWA 3M8EA 3TO6A 1FBUA 3RPUA 1KU3A 3WGGA 2FMLA 4ZH4F 5TJJA 1H9TA 2M45A 2EV6A 5K5OA 2CWEA 4P55A 5CVJA 1R7JA 2ELHA 2XKPA 3I58A 3VEPA 3JW4A 1FSHA 1QPMA 3ABUA 5IT9Z 1LDJA 4G7ZF 3G3ZA 1ZH5A 1ZLKA 3L7WA 5L3GA 4R8HA 2Y0MA 1RI7A 2RKHA 3DP7A 5DD8A 1YS6A 1XGSA 1O7FA 4Z2YA 2O8XA 2XAGA 2PG4A 3ZMSA 2OU2A 3MFKA 1J2XA 3ZMZA 2P4WA 4F7ZA 4ZZDA 1ZREA 1SD6A 1ZN2A 1KA8A 3GO5A 2IVMA 1K78A 2VXZA 2Z33A 2D1VA 3N4MA 2E1NA 5AONA 4AIKA 4IHTA 4HX4A 2JT1A 2Q0OA 4CDGA 5H6QA 4NQWA 1LNWA 4KIFA 1TW2A 4FX4A 3ZN0A 3JAMK 1IXSB 3R6SA 1Z05A 4G7HF 4ON0A 1R1UA 5J6XA 4KMFA 3QP5A 5A2QK 4FHTA 4RB1A 1R22A 3FX3A 5JFRA 1IXRC 4KICA 4XLNF 2EA4A 2K02A 2FNPA 2M1BA 1ZHFA 2F5FA 5K5QA 4RB3C 3HTUA 1V3FA 2UXNA 3T8TA 3U9GA 4KIGA 4WWCA 4I02A 4EJVA 1TNTA 1SD4A 1B59A 3J7AO 4LLNA 5JVTA 4KA4A 3MZHA 4BHPA 4YFKF 1Z6RA 1KU2A 1Q1HA 1SMTA 1HW1A 2CFXA 3QAHA 1FT9A 2OBPA 2FEZA 5JI6A 1XB4A 3MZYA 4OIQF 3JAMZ 4OMYA 2IJLA 2RC4A 1PP7U 3E6DA 3HTSB 5FD6A 5BPIA 1QNTA 2OQRA 3D0SA 3OOPA 5DCMB 1XD7A 4E70A 5A2QZ 2XROA 2VOPA 1P6RA 1LDDA 2KIMA 1UHMA 2O6GE 1LEBA 2QWWA 3ZP5A 1F1ZA 1V4RA 2HFHA 2WTEA 2M30A 3RDIA 4ETSA 3VB2A 3ECOA 3R0AA 4D0PA 2YU3A 3BPVA 2O0YA 3KE2A 4AWXB 4JBAA 5E17F 4RAZA 3LQRA 2RNJA 2NRAC 2NNYA 2EWNA 3O3KA 1DPRA 1JHFA 4YFXF 1YS7A 5ILSA 5ICEA 3R0JA 2RGVA 3GVAA 3W6JB 2DTRA 4A6EA 2A68F 2FQ3A 1I1SA 3TOBA 1OR7A 3M7GA 1JXSA 1QZYA 3HUGA 4JQFA 3Q9VA 4EM2A 1IN5A 4AIJA 2EA2A 1E2XA 1SFUA 1HSTA 4U0YA 1VTNC 2GQQA 2FE3A 1AOYA 2HS5A 1FYLA 2UZKA 4BHBA 2WWYA 1PDNC 5LGTA 1T39A 2CGPA 2EFOA 4IRGA 1EH8A 5HDKA 1PUEE 4M72A 3WE3A 1WRJA 2V79A 2HEOA 4Q4ZF 3F72A 4A0ZA 2W24A 1T6SA 3LA3A 3IWFA 3SHFA 4HF2A 4M71A 1FX7A 2C6YA 4JK1X 1QO0D 4AVPA 2V1UA 3VOEA 4KMUX 3V8LA 2J5PA 1IN8A 2G9WA 2MLGA 3COAC 3D5LA 3E6MA 2YSRA 4MNUA 3JSOA 4A0XA 2QENA 4HBLA 1IN7A 3E5UA 2PMHA 2FSWA 5ERIA 5D5XB 2HYGD 2PN6A 2GA1A 4I0AA 4UXNA 2D1HA 3WODF 2A69F 3WU1B 5E18F 1FP2A 4Q5SF 2STWA 5LRRA 3MWMA 4EM0B 5HS8A 4OOIA 2K4BA 1U5TB 5E1XA 1XGMA 3IL2A 2KKOA 2QQBA 1ZRCA 4ESFA 5D8KB 4KUMA 1AWCA 4IPAA 2R7DA 4GYGA 3LWFA 4EJTA 2KRFA 1R1VA 3OV8A 1YIOA 2D2WA 4ESJA 5FD5A 1SD7A 1W7PB 1O3RA 1IXCA 4EV0A 3MAJA 2VT2A 2LNBA 2M8EA 1SD5A 5E8GA 2Y75A 2O3FA 4M74A 4HF1A 2TDXA 5HS9A 3R4KA 3PQKA 4EM1A 3IWZA 2VBYA 2ESNA 3M1EA 2F5DA 3U2RA 4LFUA 2VONA 4OINF 4MHGA 3ZN1A 3MEXA 1MDMB 3F21A 3K0LA 2VN2A 4RAYA 3T8RA 3WTXC 3ABTA 2BV6A 2EV0A 1OYWA 4R79A 2P7VB 4KN4X 5HLIA 2GXGA 3V4GA 2NS0A 2FBHA 3TO9A 2UXXA 3ECHA 1RNLA 1ZYRF 2YR2A 5DYMA 4DNCA 1G3SA 2FU4A 4XSXF 3KZZA 2OA4A 4HYEA 3S2WA 2FMYA 1FSEA 2ESHA 1RIOH 1BI0A 1FNNA 2L4AA 2WC2A 2DPUA 4DQ2A 3F22A 1ULYA 2VC1A 3E6BA 2DI3A 4MTEA 1USTA 1FZPB 3GEZA 2H94A 5CVIA 1EV7A 4LG0A 3VFZA 4L9TA 2VBXA 1I27A 4M6XA 5IT9K 3O6BB 4MEYF 1P92A 5ICCA 2A5YB 1KQ8A 2ZFWA 1G3TA 5BS6A 3I64A 4ENMA 1HKSA 2Z9OA 2F5CA 1ONVA 1R5HA 3RYRA 4ZYDA 2H09A 3L00A 4BHCA 2W84A 3ZQ7A 1JGSA 1UFMA 2ZJ2A 5TRDA 2P8TA 5CVRA 1F5TA 2JPBA 1L3LA 1SFEA 2ZKZA 2PI0A 4A0YA 2JZYA 2P7CB 1BI2A 4IJAA 2ADUA 3V7SA 1S7AA 5E1ZB 3JTGA 3I59B 3KCCA 4GXOA 1XMAA 4A2UA 1YFHA 3ZMDA 3DPTA 4EQQA 4YG2F 3WTYC 1BIBA 1USSA 2O61A 3TOAA 2EFPA 1YQAA 3WG9A 3HRTA 5DUIA 2HKOA 4G94A 2YX7A 2XIGA 1KU7A 4GCVA 3FM5A 4EVIA 5ILVA 4IVNA 3HIFA 2RQPA 1J0RA 1H9GA 2ZO4A 1IUYA 2Z99A 3C3WA 3KP7A 1W7PD 2Y48A 1R5GA 4HDVA 1ZAOA 3F6VA 3G73A 2PFBA 3M9AA 2J5OA 3GF2A 1ZG1A 3J81K 1S29A 4HV6A 4LLLA 2FOKA 2IP2A 2FA5A 1R36A 3DXJF 1ZG3A 3LFKA 2KIUA 2CO5A 4L18B 2MH9A 4U7DA 2CW0F 2QBYB 5BQTA 1C0WA 4UHTA 3SXYA 3GFLA 1FOKA 3CLOA 1T38A 3I53A 3E3VA 2HQNA 3N97A 4P5OA 4ESBA 2ZCWA 2MC3A 2FF4A 1LEAA 4LMYA 1Z7UA 4UVBA 5ICGA 5L3FA 1W5TA 3J81Z 2EV5A 4L0YB 3FXUA 3U1DA 3I4PA 2RVCA 1CF7A 1EH6A 1HW2A 1B4AA 1QBJA 3Q9SA 4I09A 2P6TA 4LK0F 3FHZA 1P4WA 3GWZA 4UV9A 2DPDA 4ENJA 1E17A 4WK8F 1KGSA 2QLZA 4L9NA 4IRIA 4ZYGA 4ENKA 5ICFA 3SZPA 2XAQA 1TNSA 3QP6A 1IN4A 1T0FA 2QVOA 2DW4A 4PGGA 2XAHA 3L2CA 4TV7A 1O57A 5LHGA 4EJUA 2KJCA 1Z6TA 1LVAA 3WTUC 2P5LC 1GXPA 2OZ6A 5LEJA 3LAPA 4L0ZB 3JSPA 1X3UA 2A3SA 2GXBA 2LF7A 4KIBA 5BMZA 2BBYA 4XBFA 1J59A 3RKXA 3L9FA 2IA0A 2G7UA 3SQNA 5CVUA 4O6JA 3HSRA 4R1HA 2Z3YA 3LA7A 2ZMEA 5LGUA 3IKVA 3WTVC 3BP8A 3REOA 4I2OA 3GUDA 4S05A 2FNAA 1HKQA 2P5VA 2HGCA 1MD0A 5LEKA 2CSOA 5FFZA 1OPCA 5ILUA 3KP5A 3EETA 4G8XA 3T5XA 2EK5A 2ZNZA 5J8FA 3WTTC 2V1DA 2ZXJA 3H3ZA 2XHKA 3GXOA 1P4AA 4WF2A 2COMA 4IXAA 3PFIA 1F9NA 5F6FA 2HR3A 1ZRFA 5L3CA 1HW5A 4XRFA 3WGIA 4HA8A 3CUQB 1L0OC 1XSDA 2STTA 2DBBA 2VBZA 2CYYA 3WU0A 1UCRA 3HHHA 3DPLC 1FBQA 4I01A 2GIVA 3B73A 2XGXA 1U5TC 2GZWA 1DPUA 3E5XA 1WKMA 1BI1A 4U88A 1S8NA 5BOXA 1F4KA 1U5TA 1G6NA 3LQQA 2W57A 1QGPA 2M87A 2OD5A 3NQOA 5KK1A 1SFXA 2HWVA 1K79A 5F64A 4UUVA 5IT3A 3K2ZA 2PBIA 5K1YA 3ELKA 5CJ9A 3W6KB 2L02A 1DP7P 5JHUA 1NHAA 1FC3A 1MKMA 2FXAA 3R60A 4HW0A 1RUNA 3SFZA 4PGHA 1FY7A 3QOPA 3ISPA 2EJRA 3RPQA 1WSUA 5L3DA 4O5VA 4HDUA 2W85A 2EFQA 3GFIA 2NAZA 3V8JA 4AD9A 4N9HA 3P7NA 4RGSA 1YO5C 4WXHA 3FWEA 4H0EA 5D5UB 5K5RA 2DQLA 3MQ0A 1TQMA 2X4HA 4Q47A 1BI3A 3V8KA 1MDMA 4M9XA 4BAYA 1D8JA 2HQRA 2IRFG 2V9VA 5AIQA 4I7HA 3M8FA 1U78A 4P9FA 1U3EM 2AS5F 3GFJA 4QLCU 4BH9A 1XSXA 4KT5C 2NYXA 3B02A 1XGNA 1HBXG 2E7WA 1HKTA 1ON2A 1WI9A 5LLQA 5E1WA 5HOOA 1UHWA 1T2KA 3CDHA 3HRUA 3FM3A 4OU0A 4A5MA 3CO6C 1U2WA 5AIPA 2ISZA 3GZ5A 1H0MA 1FYMA 1BOAA 4L9JA 3CO7C 1FLIA 1HQCA 1XN7A 1J9IA 4N9IA 4G6QA 4LLGF 5LHHA 4A5NA 3C1DA 4HAMA 1STZA 3GX4X 1IRFA 3GW2A 4A6DA 1ZARA 3I5UA 4NHJA 4FX0A 2A61A 3F8MA 1Z1DA 5E8IA 2CQKA 4OIRF 3I71A 1FPQA 3LA2A 2OQGA 4Y15A 4U0WA 3GLXA 3FF5A 2DAOA 3I59A 2VC0A 1TLHB 1MJAA 1LJ9A 2HTSA 5HS7A 4IRHA 4UVAA 1YLFA 1OYIA 1IN6A 3NRVA 5FLXZ 2IA1A 3Q5FA 2F2EA 1D5VA 1IZ1A 3IRRA 4OIPF 3KLOA 4KN7X 4LG0B 3DV8A 4XSZF 2IT0A 3FZVA 5BPDA 4BQAA 4MQVA 4LGWA 3HOSA 2V1XA 3DF8A 4MGRA 2RDPA 4ZZLA 3HOTA 2K4JA 3DEUA 1I1GA 1EH7A 1XCBA 4OIOF 4ASNA 4AIHA 4HQMA 1YYVA 1XGOA 4ENNA 2IPQX 2K86A 3ERED 4B8XA 2IA2A 1QQIA 3FMQA 3KP6A 4K2EA 3BROA 5D5VB 3O2PE 4FT8A 4M9SA 3GFMA 2UWMA 3HRSA 1SAXA 3K1MA 4Q48A 3ZPLA 1XMKA 4L9VA 2K7LA 3F6OA 3RKWA 1BBYA 1OKRA 1WQ2A 3CTAA 2ZBKA 3ZMVA 4A12A 2O03A 3KETA 4HV5A 4CHUA 2A6EF 2QBYA 1ZRDA 2W25A 1D8KA 3EYIA 3WGHA 3J80Z 2QUFA 5DDGA 2XAFA 3P9CA 1K6OA 3K69A 2M5WA 4RGXA 5CVVA 3FXQA 3F23A 1SMYF 2XUBA 3KZYA 2GA2A 2Z5UA 1FYKA 2EFNA 4CXFA 2PJPA 2A6HF 3GZ6A 4WXDA 1FP1D 2MBFA 5CLSA 2R3SA 1XDUA 3F8FA 3IRQA 1K78B 2G7HA 4MQ9F 1KQ9A 4GYIA 2PMUA 4ZYEA 4IHSA 1YTYA 3EQLF 3QPHA 1Z91A 5DCFA 1IW7F 4EJOA 1S3JA 2XAJA 5L3BA 3C18A 1REPC 3KP4A 2ETHA 3BZ6A 3RTRA 5D4SA 3F8BA 2VE9A 1P2FA 1UB9A 5CYVA 5DCMA 3I0TA 2EB7A 4I98B 1JHHA 3TO7A 2LDUA 1YW9A 2LF8A 2HDCA 5H6RA 2DU9A 4LB6B 1IRGA 1J75A 2RN7A 1P4XA 5D6EA 3NEUA 2DQRA 1ZGJA 4EGYA 5D5WB 3FMSA 2IW5A 2YPRA 3RYPA 1BC8C 2JRTA 3PQJA 1J7KA 3E6CC 4HLYA 1LB2A 2VODA 2EFWA 1O3SA 1KU9A 2MD5A 1HXDA 4I0BA 2ISYA 2H6BA 2LKPA 4HOBA 1YW8A 3T0YA 4P96A 3E97A 1CF7B 3P9IA 3R61A 4BXUA 1W4MA 4RB0A 2BGCA 4S04A 3K9TA 3ZMUA 5HDNA 3BDDA 3MCZA 2AXLA 1O7LA 4G6DA 3JTHA 4WX9A 3CJNA 1A04A 4MEXF 3K1NA 2KIFA 5EEHA 3E5QA 4M9ZA 1BJAA 2ZNYA 1MJBA 3RKYA 4L5JA 1ZG5A 2DK8A 2L01A 3RJPA 1RZ4A 3CUOA 3ROUA 4YFNF 4P9UA 2WV0A 3EYYA 3FMRA 4PCQA 3WTSC 3P9KA 1ZGAA 3ZMTA 4EJWA 2HZTA 3TQNA 4N0BA 3K1PA 1T98A 2VE8A 1B6AA 4O3MA 1ODDA 1TTYA 1IF1A 2JPCA 3VODA 1WWXA 5HDGA 4CO8A 1B1BA 4U7BA 4G7OF 1S7OA 2PQ8A 5DD4A 4OMZA 3CUQC 5HVQC 3TDUC 2PEXA 1R00A 5FO5A 3KEQA 3KLNA 1W5SA 3CUQA 4UVCA 2B0LA 4HX8A 1K7AA 2MLKA 2XASA 2JTVA 1LDKB 5HLGA 1B9NA 5DV5A 4KDPA 2Q2EA 4HLXA 4KFCA 4BNCA 4IF4A 4EGZA 2FBIA 5DUKA 2ZMEB 1MJ9A 3DKWA 3BJ6A 1TW3A 3KEOA 4NB5A 1KQ0A 1FWZA 3SZTA 2HTJA 1IAWA 1GVJA 1OMIA 4UNOA 3TKYA 2L3DA 4WXCA 2DO7A 2RV8A 1B9MA 3IC7A 1BC7C 1G3YA 1QZZA 5KVRA 1GXQA 1DDNA 2V6CA 5FFXA 5FGMA 3KP3A 5D8LB 4CICA 1JE8A 3QU3A 1KYZA 1MGTA 3HRMA 5ED4A 3EUHA 2DK5A 2QZ8A 4GO1A 2E7XA 5EEGA 4G9YA 2FBKA 4B09A 3V7CA 1O3TA 3V7RA 3KFWX 3RI4A 3LAJA 1XSVA 2P5KA 4HX7A 1R58A 1W7PA 1U6GA 4HF0A 3BJOA 4U0VA 3L09A 3QPTA 3AAFA 3ML6A 2CG4A 3BPXA 2JSCA 2E1CA 1ZLJA 3IHUA 4HQEA 4L5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8C A;  3F8C A;  1TQP A;  4LJZ F;  3H3U A;  3TDZ C;  1G4D A;  4Y17 A;  2X0L A;  2R7F A;  1DUX C;  2XV4 S;  2HOE A;  3BJA A;  4KNY A;  4M73 A;  4LD5 A;  2XKO A;  2K27 A;  2L4M A;  6PAX A;  4PDK A;  3GYH X;  1GHC A;  3DFG A;  2GAU A;  1R23 A;  1S6L A;  3IKT A;  2VBW A;  1RUO A;  3FXR A;  1O3Q A;  1MZB A;  2QYO A;  4QWQ A;  4LB5 A;  2VT3 A;  1D3Y A;  2QM3 A;  3BWG A;  2DT5 A;  1XDS A;  1FBS A;  3LST A;  2BE5 F;  1BM9 A;  3ULQ B;  3HHG A;  2ACJ A;  4CZZ A;  4UV8 A;  4RGU A;  1XCV A;  2DLL A;  1Z9C A;  3DQV C;  2HYF A;  3H92 A;  2BEO A;  1Y0U A;  5FLX K;  2L54 A;  1TBX A;  4XLP F;  4PZJ A;  1YW7 A;  2NNN A;  1CGP A;  1I6X A;  3WE2 A;  3QRF F;  2XRN A;  5F1R A;  3I54 A;  3BY6 A;  3QU6 A;  5D6F A;  4ZYH A;  4HZF A;  4CGZ A;  2GWR A;  2HKX A;  4GGG A;  5LGN A;  2BYV E;  2F5E A;  2OAZ A;  2MH2 A;  4YII A;  5LRS A;  1ON1 A;  2QQA A;  2OZU A;  5LBQ A;  3KP2 A;  4MTD A;  1I5Z A;  2H27 A;  4CYD A;  3F3X A;  1PP8 F;  5LHI A;  2KJB A;  3TGN A;  2VOO A;  3C7J A;  3BOQ A;  1G3W A;  3WTW C;  4EMS A;  3EDP A;  2FRH A;  2A07 F;  2H6C A;  3HSE A;  5L3E A;  1TQI A;  4RS8 A;  1J5Y A;  3HSF A;  3HYI A;  5FB2 A;  5JR3 A;  2PLY A;  2QQ9 A;  3F8N A;  2P6S A;  1YG2 A;  2Q8K A;  2MA3 A;  3RIR A;  1U8R A;  3T1B A;  4RGR A;  4M6Y A;  3WTZ A;  1HSJ A;  5DEQ A;  2D45 A;  2XVC A;  5E20 A;  4WCG A;  1LQ1 A;  4LK1 F;  4Y13 A;  4RB2 C;  1OYY A;  4BYY A;  5D4R A;  2DFI A;  2YX4 A;  5H20 A;  1BIA A;  2LSO A;  4YIF A;  1KYW A;  1BN5 A;  3J80 K;  5HLH A;  1R1T A;  4KYW A;  3M8E A;  3TO6 A;  1FBU A;  3RPU A;  1KU3 A;  3WGG A;  2FML A;  4ZH4 F;  5TJJ A;  1H9T A;  2M45 A;  2EV6 A;  5K5O A;  2CWE A;  4P55 A;  5CVJ A;  1R7J A;  2ELH A;  2XKP A;  3I58 A;  3VEP A;  3JW4 A;  1FSH A;  1QPM A;  3ABU A;  5IT9 Z;  1LDJ A;  4G7Z F;  3G3Z A;  1ZH5 A;  1ZLK A;  3L7W A;  5L3G A;  4R8H A;  2Y0M A;  1RI7 A;  2RKH A;  3DP7 A;  5DD8 A;  1YS6 A;  1XGS A;  1O7F A;  4Z2Y A;  2O8X A;  2XAG A;  2PG4 A;  3ZMS A;  2OU2 A;  3MFK A;  1J2X A;  3ZMZ A;  2P4W A;  4F7Z A;  4ZZD A;  1ZRE A;  1SD6 A;  1ZN2 A;  1KA8 A;  3GO5 A;  2IVM A;  1K78 A;  2VXZ A;  2Z33 A;  2D1V A;  3N4M A;  2E1N A;  5AON A;  4AIK A;  4IHT A;  4HX4 A;  2JT1 A;  2Q0O A;  4CDG A;  5H6Q A;  4NQW A;  1LNW A;  4KIF A;  1TW2 A;  4FX4 A;  3ZN0 A;  3JAM K;  1IXS B;  3R6S A;  1Z05 A;  4G7H F;  4ON0 A;  1R1U A;  5J6X A;  4KMF A;  3QP5 A;  5A2Q K;  4FHT A;  4RB1 A;  1R22 A;  3FX3 A;  5JFR A;  1IXR C;  4KIC A;  4XLN F;  2EA4 A;  2K02 A;  2FNP A;  2M1B A;  1ZHF A;  2F5F A;  5K5Q A;  4RB3 C;  3HTU A;  1V3F A;  2UXN A;  3T8T A;  3U9G A;  4KIG A;  4WWC A;  4I02 A;  4EJV A;  1TNT A;  1SD4 A;  1B59 A;  3J7A O;  4LLN A;  5JVT A;  4KA4 A;  3MZH A;  4BHP A;  4YFK F;  1Z6R A;  1KU2 A;  1Q1H A;  1SMT A;  1HW1 A;  2CFX A;  3QAH A;  1FT9 A;  2OBP A;  2FEZ A;  5JI6 A;  1XB4 A;  3MZY A;  4OIQ F;  3JAM Z;  4OMY A;  2IJL A;  2RC4 A;  1PP7 U;  3E6D A;  3HTS B;  5FD6 A;  5BPI A;  1QNT A;  2OQR A;  3D0S A;  3OOP A;  5DCM B;  1XD7 A;  4E70 A;  5A2Q Z;  2XRO A;  2VOP A;  1P6R A;  1LDD A;  2KIM A;  1UHM A;  2O6G E;  1LEB A;  2QWW A;  3ZP5 A;  1F1Z A;  1V4R A;  2HFH A;  2WTE A;  2M30 A;  3RDI A;  4ETS A;  3VB2 A;  3ECO A;  3R0A A;  4D0P A;  2YU3 A;  3BPV A;  2O0Y A;  3KE2 A;  4AWX B;  4JBA A;  5E17 F;  4RAZ A;  3LQR A;  2RNJ A;  2NRA C;  2NNY A;  2EWN A;  3O3K A;  1DPR A;  1JHF A;  4YFX F;  1YS7 A;  5ILS A;  5ICE A;  3R0J A;  2RGV A;  3GVA A;  3W6J B;  2DTR A;  4A6E A;  2A68 F;  2FQ3 A;  1I1S A;  3TOB A;  1OR7 A;  3M7G A;  1JXS A;  1QZY A;  3HUG A;  4JQF A;  3Q9V A;  4EM2 A;  1IN5 A;  4AIJ A;  2EA2 A;  1E2X A;  1SFU A;  1HST A;  4U0Y A;  1VTN C;  2GQQ A;  2FE3 A;  1AOY A;  2HS5 A;  1FYL A;  2UZK A;  4BHB A;  2WWY A;  1PDN C;  5LGT A;  1T39 A;  2CGP A;  2EFO A;  4IRG A;  1EH8 A;  5HDK A;  1PUE E;  4M72 A;  3WE3 A;  1WRJ A;  2V79 A;  2HEO A;  4Q4Z F;  3F72 A;  4A0Z A;  2W24 A;  1T6S A;  3LA3 A;  3IWF A;  3SHF A;  4HF2 A;  4M71 A;  1FX7 A;  2C6Y A;  4JK1 X;  1QO0 D;  4AVP A;  2V1U A;  3VOE A;  4KMU X;  3V8L A;  2J5P A;  1IN8 A;  2G9W A;  2MLG A;  3COA C;  3D5L A;  3E6M A;  2YSR A;  4MNU A;  3JSO A;  4A0X A;  2QEN A;  4HBL A;  1IN7 A;  3E5U A;  2PMH A;  2FSW A;  5ERI A;  5D5X B;  2HYG D;  2PN6 A;  2GA1 A;  4I0A A;  4UXN A;  2D1H A;  3WOD F;  2A69 F;  3WU1 B;  5E18 F;  1FP2 A;  4Q5S F;  2STW A;  5LRR A;  3MWM A;  4EM0 B;  5HS8 A;  4OOI A;  2K4B A;  1U5T B;  5E1X A;  1XGM A;  3IL2 A;  2KKO A;  2QQB A;  1ZRC A;  4ESF A;  5D8K B;  4KUM A;  1AWC A;  4IPA A;  2R7D A;  4GYG A;  3LWF A;  4EJT A;  2KRF A;  1R1V A;  3OV8 A;  1YIO A;  2D2W A;  4ESJ A;  5FD5 A;  1SD7 A;  1W7P B;  1O3R A;  1IXC A;  4EV0 A;  3MAJ A;  2VT2 A;  2LNB A;  2M8E A;  1SD5 A;  5E8G A;  2Y75 A;  2O3F A;  4M74 A;  4HF1 A;  2TDX A;  5HS9 A;  3R4K A;  3PQK A;  4EM1 A;  3IWZ A;  2VBY A;  2ESN A;  3M1E A;  2F5D A;  3U2R A;  4LFU A;  2VON A;  4OIN F;  4MHG A;  3ZN1 A;  3MEX A;  1MDM B;  3F21 A;  3K0L A;  2VN2 A;  4RAY A;  3T8R A;  3WTX C;  3ABT A;  2BV6 A;  2EV0 A;  1OYW A;  4R79 A;  2P7V B;  4KN4 X;  5HLI A;  2GXG A;  3V4G A;  2NS0 A;  2FBH A;  3TO9 A;  2UXX A;  3ECH A;  1RNL A;  1ZYR F;  2YR2 A;  5DYM A;  4DNC A;  1G3S A;  2FU4 A;  4XSX F;  3KZZ A;  2OA4 A;  4HYE A;  3S2W A;  2FMY A;  1FSE A;  2ESH A;  1RIO H;  1BI0 A;  1FNN A;  2L4A A;  2WC2 A;  2DPU A;  4DQ2 A;  3F22 A;  1ULY A;  2VC1 A;  3E6B A;  2DI3 A;  4MTE A;  1UST A;  1FZP B;  3GEZ A;  2H94 A;  5CVI A;  1EV7 A;  4LG0 A;  3VFZ A;  4L9T A;  2VBX A;  1I27 A;  4M6X A;  5IT9 K;  3O6B B;  4MEY F;  1P92 A;  5ICC A;  2A5Y B;  1KQ8 A;  2ZFW A;  1G3T A;  5BS6 A;  3I64 A;  4ENM A;  1HKS A;  2Z9O A;  2F5C A;  1ONV A;  1R5H A;  3RYR A;  4ZYD A;  2H09 A;  3L00 A;  4BHC A;  2W84 A;  3ZQ7 A;  1JGS A;  1UFM A;  2ZJ2 A;  5TRD A;  2P8T A;  5CVR A;  1F5T A;  2JPB A;  1L3L A;  1SFE A;  2ZKZ A;  2PI0 A;  4A0Y A;  2JZY A;  2P7C B;  1BI2 A;  4IJA A;  2ADU A;  3V7S A;  1S7A A;  5E1Z B;  3JTG A;  3I59 B;  3KCC A;  4GXO A;  1XMA A;  4A2U A;  1YFH A;  3ZMD A;  3DPT A;  4EQQ A;  4YG2 F;  3WTY C;  1BIB A;  1USS A;  2O61 A;  3TOA A;  2EFP A;  1YQA A;  3WG9 A;  3HRT A;  5DUI A;  2HKO A;  4G94 A;  2YX7 A;  2XIG A;  1KU7 A;  4GCV A;  3FM5 A;  4EVI A;  5ILV A;  4IVN A;  3HIF A;  2RQP A;  1J0R A;  1H9G A;  2ZO4 A;  1IUY A;  2Z99 A;  3C3W A;  3KP7 A;  1W7P D;  2Y48 A;  1R5G A;  4HDV A;  1ZAO A;  3F6V A;  3G73 A;  2PFB A;  3M9A A;  2J5O A;  3GF2 A;  1ZG1 A;  3J81 K;  1S29 A;  4HV6 A;  4LLL A;  2FOK A;  2IP2 A;  2FA5 A;  1R36 A;  3DXJ F;  1ZG3 A;  3LFK A;  2KIU A;  2CO5 A;  4L18 B;  2MH9 A;  4U7D A;  2CW0 F;  2QBY B;  5BQT A;  1C0W A;  4UHT A;  3SXY A;  3GFL A;  1FOK A;  3CLO A;  1T38 A;  3I53 A;  3E3V A;  2HQN A;  3N97 A;  4P5O A;  4ESB A;  2ZCW A;  2MC3 A;  2FF4 A;  1LEA A;  4LMY A;  1Z7U A;  4UVB A;  5ICG A;  5L3F A;  1W5T A;  3J81 Z;  2EV5 A;  4L0Y B;  3FXU A;  3U1D A;  3I4P A;  2RVC A;  1CF7 A;  1EH6 A;  1HW2 A;  1B4A A;  1QBJ A;  3Q9S A;  4I09 A;  2P6T A;  4LK0 F;  3FHZ A;  1P4W A;  3GWZ A;  4UV9 A;  2DPD A;  4ENJ A;  1E17 A;  4WK8 F;  1KGS A;  2QLZ A;  4L9N A;  4IRI A;  4ZYG A;  4ENK A;  5ICF A;  3SZP A;  2XAQ A;  1TNS A;  3QP6 A;  1IN4 A;  1T0F A;  2QVO A;  2DW4 A;  4PGG A;  2XAH A;  3L2C A;  4TV7 A;  1O57 A;  5LHG A;  4EJU A;  2KJC A;  1Z6T A;  1LVA A;  3WTU C;  2P5L C;  1GXP A;  2OZ6 A;  5LEJ A;  3LAP A;  4L0Z B;  3JSP A;  1X3U A;  2A3S A;  2GXB A;  2LF7 A;  4KIB A;  5BMZ A;  2BBY A;  4XBF A;  1J59 A;  3RKX A;  3L9F A;  2IA0 A;  2G7U A;  3SQN A;  5CVU A;  4O6J A;  3HSR A;  4R1H A;  2Z3Y A;  3LA7 A;  2ZME A;  5LGU A;  3IKV A;  3WTV C;  3BP8 A;  3REO A;  4I2O A;  3GUD A;  4S05 A;  2FNA A;  1HKQ A;  2P5V A;  2HGC A;  1MD0 A;  5LEK A;  2CSO A;  5FFZ A;  1OPC A;  5ILU A;  3KP5 A;  3EET A;  4G8X A;  3T5X A;  2EK5 A;  2ZNZ A;  5J8F A;  3WTT C;  2V1D A;  2ZXJ A;  3H3Z A;  2XHK A;  3GXO A;  1P4A A;  4WF2 A;  2COM A;  4IXA A;  3PFI A;  1F9N A;  5F6F A;  2HR3 A;  1ZRF A;  5L3C A;  1HW5 A;  4XRF A;  3WGI A;  4HA8 A;  3CUQ B;  1L0O C;  1XSD A;  2STT A;  2DBB A;  2VBZ A;  2CYY A;  3WU0 A;  1UCR A;  3HHH A;  3DPL C;  1FBQ A;  4I01 A;  2GIV A;  3B73 A;  2XGX A;  1U5T C;  2GZW A;  1DPU A;  3E5X A;  1WKM A;  1BI1 A;  4U88 A;  1S8N A;  5BOX A;  1F4K A;  1U5T A;  1G6N A;  3LQQ A;  2W57 A;  1QGP A;  2M87 A;  2OD5 A;  3NQO A;  5KK1 A;  1SFX A;  2HWV A;  1K79 A;  5F64 A;  4UUV A;  5IT3 A;  3K2Z A;  2PBI A;  5K1Y A;  3ELK A;  5CJ9 A;  3W6K B;  2L02 A;  1DP7 P;  5JHU A;  1NHA A;  1FC3 A;  1MKM A;  2FXA A;  3R60 A;  4HW0 A;  1RUN A;  3SFZ A;  4PGH A;  1FY7 A;  3QOP A;  3ISP A;  2EJR A;  3RPQ A;  1WSU A;  5L3D A;  4O5V A;  4HDU A;  2W85 A;  2EFQ A;  3GFI A;  2NAZ A;  3V8J A;  4AD9 A;  4N9H A;  3P7N A;  4RGS A;  1YO5 C;  4WXH A;  3FWE A;  4H0E A;  5D5U B;  5K5R A;  2DQL A;  3MQ0 A;  1TQM A;  2X4H A;  4Q47 A;  1BI3 A;  3V8K A;  1MDM A;  4M9X A;  4BAY A;  1D8J A;  2HQR A;  2IRF G;  2V9V A;  5AIQ A;  4I7H A;  3M8F A;  1U78 A;  4P9F A;  1U3E M;  2AS5 F;  3GFJ A;  4QLC U;  4BH9 A;  1XSX A;  4KT5 C;  2NYX A;  3B02 A;  1XGN A;  1HBX G;  2E7W A;  1HKT A;  1ON2 A;  1WI9 A;  5LLQ A;  5E1W A;  5HOO A;  1UHW A;  1T2K A;  3CDH A;  3HRU A;  3FM3 A;  4OU0 A;  4A5M A;  3CO6 C;  1U2W A;  5AIP A;  2ISZ A;  3GZ5 A;  1H0M A;  1FYM A;  1BOA A;  4L9J A;  3CO7 C;  1FLI A;  1HQC A;  1XN7 A;  1J9I A;  4N9I A;  4G6Q A;  4LLG F;  5LHH A;  4A5N A;  3C1D A;  4HAM A;  1STZ A;  3GX4 X;  1IRF A;  3GW2 A;  4A6D A;  1ZAR A;  3I5U A;  4NHJ A;  4FX0 A;  2A61 A;  3F8M A;  1Z1D A;  5E8I A;  2CQK A;  4OIR F;  3I71 A;  1FPQ A;  3LA2 A;  2OQG A;  4Y15 A;  4U0W A;  3GLX A;  3FF5 A;  2DAO A;  3I59 A;  2VC0 A;  1TLH B;  1MJA A;  1LJ9 A;  2HTS A;  5HS7 A;  4IRH A;  4UVA A;  1YLF A;  1OYI A;  1IN6 A;  3NRV A;  5FLX Z;  2IA1 A;  3Q5F A;  2F2E A;  1D5V A;  1IZ1 A;  3IRR A;  4OIP F;  3KLO A;  4KN7 X;  4LG0 B;  3DV8 A;  4XSZ F;  2IT0 A;  3FZV A;  5BPD A;  4BQA A;  4MQV A;  4LGW A;  3HOS A;  2V1X A;  3DF8 A;  4MGR A;  2RDP A;  4ZZL A;  3HOT A;  2K4J A;  3DEU A;  1I1G A;  1EH7 A;  1XCB A;  4OIO F;  4ASN A;  4AIH A;  4HQM A;  1YYV A;  1XGO A;  4ENN A;  2IPQ X;  2K86 A;  3ERE D;  4B8X A;  2IA2 A;  1QQI A;  3FMQ A;  3KP6 A;  4K2E A;  3BRO A;  5D5V B;  3O2P E;  4FT8 A;  4M9S A;  3GFM A;  2UWM A;  3HRS A;  1SAX A;  3K1M A;  4Q48 A;  3ZPL A;  1XMK A;  4L9V A;  2K7L A;  3F6O A;  3RKW A;  1BBY A;  1OKR A;  1WQ2 A;  3CTA A;  2ZBK A;  3ZMV A;  4A12 A;  2O03 A;  3KET A;  4HV5 A;  4CHU A;  2A6E F;  2QBY A;  1ZRD A;  2W25 A;  1D8K A;  3EYI A;  3WGH A;  3J80 Z;  2QUF A;  5DDG A;  2XAF A;  3P9C A;  1K6O A;  3K69 A;  2M5W A;  4RGX A;  5CVV A;  3FXQ A;  3F23 A;  1SMY F;  2XUB A;  3KZY A;  2GA2 A;  2Z5U A;  1FYK A;  2EFN A;  4CXF A;  2PJP A;  2A6H F;  3GZ6 A;  4WXD A;  1FP1 D;  2MBF A;  5CLS A;  2R3S A;  1XDU A;  3F8F A;  3IRQ A;  1K78 B;  2G7H A;  4MQ9 F;  1KQ9 A;  4GYI A;  2PMU A;  4ZYE A;  4IHS A;  1YTY A;  3EQL F;  3QPH A;  1Z91 A;  5DCF A;  1IW7 F;  4EJO A;  1S3J A;  2XAJ A;  5L3B A;  3C18 A;  1REP C;  3KP4 A;  2ETH A;  3BZ6 A;  3RTR A;  5D4S A;  3F8B A;  2VE9 A;  1P2F A;  1UB9 A;  5CYV A;  5DCM A;  3I0T A;  2EB7 A;  4I98 B;  1JHH A;  3TO7 A;  2LDU A;  1YW9 A;  2LF8 A;  2HDC A;  5H6R A;  2DU9 A;  4LB6 B;  1IRG A;  1J75 A;  2RN7 A;  1P4X A;  5D6E A;  3NEU A;  2DQR A;  1ZGJ A;  4EGY A;  5D5W B;  3FMS A;  2IW5 A;  2YPR A;  3RYP A;  1BC8 C;  2JRT A;  3PQJ A;  1J7K A;  3E6C C;  4HLY A;  1LB2 A;  2VOD A;  2EFW A;  1O3S A;  1KU9 A;  2MD5 A;  1HXD A;  4I0B A;  2ISY A;  2H6B A;  2LKP A;  4HOB A;  1YW8 A;  3T0Y A;  4P96 A;  3E97 A;  1CF7 B;  3P9I A;  3R61 A;  4BXU A;  1W4M A;  4RB0 A;  2BGC A;  4S04 A;  3K9T A;  3ZMU A;  5HDN A;  3BDD A;  3MCZ A;  2AXL A;  1O7L A;  4G6D A;  3JTH A;  4WX9 A;  3CJN A;  1A04 A;  4MEX F;  3K1N A;  2KIF A;  5EEH A;  3E5Q A;  4M9Z A;  1BJA A;  2ZNY A;  1MJB A;  3RKY A;  4L5J A;  1ZG5 A;  2DK8 A;  2L01 A;  3RJP A;  1RZ4 A;  3CUO A;  3ROU A;  4YFN F;  4P9U A;  2WV0 A;  3EYY A;  3FMR A;  4PCQ A;  3WTS C;  3P9K A;  1ZGA A;  3ZMT A;  4EJW A;  2HZT A;  3TQN A;  4N0B A;  3K1P A;  1T98 A;  2VE8 A;  1B6A A;  4O3M A;  1ODD A;  1TTY A;  1IF1 A;  2JPC A;  3VOD A;  1WWX A;  5HDG A;  4CO8 A;  1B1B A;  4U7B A;  4G7O F;  1S7O A;  2PQ8 A;  5DD4 A;  4OMZ A;  3CUQ C;  5HVQ C;  3TDU C;  2PEX A;  1R00 A;  5FO5 A;  3KEQ A;  3KLN A;  1W5S A;  3CUQ A;  4UVC A;  2B0L A;  4HX8 A;  1K7A A;  2MLK A;  2XAS A;  2JTV A;  1LDK B;  5HLG A;  1B9N A;  5DV5 A;  4KDP A;  2Q2E A;  4HLX A;  4KFC A;  4BNC A;  4IF4 A;  4EGZ A;  2FBI A;  5DUK A;  2ZME B;  1MJ9 A;  3DKW A;  3BJ6 A;  1TW3 A;  3KEO A;  4NB5 A;  1KQ0 A;  1FWZ A;  3SZT A;  2HTJ A;  1IAW A;  1GVJ A;  1OMI A;  4UNO A;  3TKY A;  2L3D A;  4WXC A;  2DO7 A;  2RV8 A;  1B9M A;  3IC7 A;  1BC7 C;  1G3Y A;  1QZZ A;  5KVR A;  1GXQ A;  1DDN A;  2V6C A;  5FFX A;  5FGM A;  3KP3 A;  5D8L B;  4CIC A;  1JE8 A;  3QU3 A;  1KYZ A;  1MGT A;  3HRM A;  5ED4 A;  3EUH A;  2DK5 A;  2QZ8 A;  4GO1 A;  2E7X A;  5EEG A;  4G9Y A;  2FBK A;  4B09 A;  3V7C A;  1O3T A;  3V7R A;  3KFW X;  3RI4 A;  3LAJ A;  1XSV A;  2P5K A;  4HX7 A;  1R58 A;  1W7P A;  1U6G A;  4HF0 A;  3BJO A;  4U0V A;  3L09 A;  3QPT A;  3AAF A;  3ML6 A;  2CG4 A;  3BPX A;  2JSC A;  2E1C A;  1ZLJ A;  3IHU A;  4HQE A;  4L5I A; 
#chains in the Genus database with same CATH topology
 5J8C A;  2Z2S B;  3CC2 I;  4PSX A;  3OYG A;  1FIA A;  4MFD A;  3F8C A;  1TQP A;  1ETK A;  3K2A A;  3A2K A;  3QYF A;  4LJZ F;  4ITV A;  3PM1 A;  3H3U A;  3TDZ C;  4LIU A;  4Y17 A;  4BUP A;  2X0L A;  1G4D A;  2NS8 A;  1NTC A;  1K6Y A;  2R7F A;  1DUX C;  2XV4 S;  2HOE A;  3BJA A;  1AHD P;  4IOA F;  2GOM A;  4KNY A;  4M73 A;  2K3P A;  4LD5 A;  2XKO A;  3JRF A;  1FJL A;  3Q0V A;  2K27 A;  2L4M A;  6PAX A;  4PDK A;  2R5Y A;  2O9L A;  4L5E A;  3GYH X;  2E2I J;  1GHC A;  2XAU A;  2V9P A;  3ZCO A;  4I99 C;  4IQ4 A;  5EDN A;  2CFO A;  3OSF A;  2M0C A;  2XF6 A;  1IV6 A;  2WV1 A;  3DFG A;  1X2N A;  2GAU A;  2HVQ A;  5FKO A;  1JJ8 C;  1R23 A;  4A93 J;  1S6L A;  4FTH A;  3IKT A;  2VBW A;  1RUO A;  3FXR A;  2XRL A;  1O3Q A;  3BC8 A;  1MZB A;  2QYO A;  3CF2 A;  4QWQ A;  4LB5 A;  5EYR A;  2VT3 A;  5C4J J;  3G1O A;  1D3Y A;  4E7S A;  2QM3 A;  3K6G A;  3BWG A;  2DT5 A;  4MO7 A;  4D5C A;  1XDS A;  1FBS A;  3LST A;  1OQY A;  2JJ7 A;  3DBL B;  3HOV J;  2BE5 F;  1BM9 A;  3SDB A;  3ULQ B;  3HHG A;  2ACJ A;  2JSP A;  3OIQ A;  4RGU A;  4UV8 A;  4CZZ A;  1HLV A;  1XCV A;  4C3I J;  4C30 A;  1IDZ A;  2DLL A;  1Z9C A;  3DQV C;  2HYF A;  2X1C A;  1SEU A;  3H92 A;  2BEO A;  1Y0U A;  1Y56 A;  1Z3Y A;  3BTC A;  4DJA A;  3PSF A;  5FLX K;  2L54 A;  3ASN H;  1TBX A;  4XLP F;  4PZJ A;  3BTI A;  1QVT A;  1NG7 A;  1YW7 A;  2NNN A;  4AUX A;  1CGP A;  1I6X A;  1ZR4 A;  3WE2 A;  4G12 A;  2XRN A;  3QRF F;  2IS6 A;  1JTX A;  1S72 I;  3HOW J;  5F1R A;  4RM3 A;  3W6V A;  1PYV A;  3I54 A;  3BY6 A;  3QU6 A;  5D6F A;  4ZYH A;  2EIN H;  4HZF A;  5K7H A;  4CGZ A;  2GWR A;  2VPR A;  4F91 B;  2HKX A;  4GGG A;  2QQ8 A;  5LGN A;  2BYV E;  3AKZ A;  2F5E A;  2GOX B;  2MH2 A;  2AXT C;  2OAZ A;  4YII A;  3ZQF A;  5LRS A;  4W1U A;  1ON1 A;  2QQA A;  2NOG A;  4Y7N J;  2OZU A;  5LBQ A;  3KP2 A;  4MTD A;  1I5Z A;  4RLQ A;  2H27 A;  4CYD A;  3CZ6 A;  1JT0 A;  5JVG F;  3F3X A;  2CUJ A;  4Y3O A;  5LHI A;  1PP8 F;  4BS9 A;  2V7F A;  4BQN A;  2KJB A;  3DWL E;  3TGN A;  3TW6 A;  3EPZ A;  3CCQ I;  3O8G A;  2VOO A;  3CES A;  2ZC2 A;  3C7J A;  3QPS A;  1B8I A;  4I76 A;  1D1C A;  4IOC F;  3BTJ A;  2DFF A;  1GLN A;  2X1E A;  1W0T A;  3BOQ A;  1X1D A;  2IS1 A;  1G3W A;  3WTW C;  4EMS A;  3EDP A;  1LKX A;  2FRH A;  2A07 F;  5GTH C;  1VQN I;  2AQE A;  4B48 A;  1IRZ A;  2H6C A;  5IP6 A;  3G71 I;  3HSE A;  5L3E A;  2JA8 J;  1TQI A;  1FMW A;  4RS8 A;  3DBH B;  2W82 A;  4A3E J;  1J5Y A;  3HSF A;  1SVL A;  1S7E A;  4UUS A;  3HYI A;  5FB2 A;  1U9O A;  5JR3 A;  3D1N I;  1GV2 A;  3UR3 C;  2PLY A;  3QQA A;  2QQ9 A;  3F8N A;  2P6S A;  2O8K A;  1YG2 A;  4IHV A;  4AM3 A;  2Q8K A;  2MA3 A;  3RIR A;  1U8R A;  1EF4 A;  3T1B A;  2DMP A;  4XKV A;  3A02 A;  3HC7 A;  4RGR A;  1IJW C;  3J7A Y;  4M6Y A;  3WTZ A;  1HSJ A;  5DEQ A;  2D45 A;  1X58 A;  2LRE A;  2XVC A;  2RQQ A;  4I6Z A;  5IYD J;  5E20 A;  4F52 A;  4XOP A;  3BG6 A;  4WCG A;  1LE8 A;  1LQ1 A;  1EKE A;  4YEJ A;  4LK1 F;  4Y13 A;  4RB2 C;  1OYY A;  4BYY A;  5D4R A;  2DFI A;  3E0J B;  2IEK A;  2YX4 A;  4FET A;  1BIA A;  5H20 A;  2LSO A;  4YIF A;  1KYW A;  1BN5 A;  3J80 K;  1VQO I;  2X51 A;  3OL3 A;  1R1T A;  4BQO A;  5HLH A;  4KYW A;  3M8E A;  3TO6 A;  1FBU A;  2TCT A;  3RPU A;  3FKJ A;  3V42 A;  1KU3 A;  3H35 A;  4FQG A;  3WGG A;  4IQJ A;  2IAI A;  1YJW I;  3CME I;  2FML A;  3GTL J;  4ZH4 F;  5TJJ A;  1H9T A;  2ELJ A;  5LFA A;  1SVO A;  4XLH A;  2M45 A;  2EV6 A;  2OPT A;  3CCR I;  5K5O A;  2B7E A;  2CWE A;  4P55 A;  5CVJ A;  4RM2 A;  3IAS 2;  1R7J A;  4JX4 A;  3H3V K;  1F43 A;  2ELH A;  1TT0 A;  2XKP A;  2X9D A;  4ABZ A;  3I58 A;  4JX5 A;  3VEP A;  3JW4 A;  3U1K A;  1PUF A;  1QRY A;  1FSH A;  1QPM A;  3ABU A;  1P7J A;  5IT9 Z;  1LDJ A;  2X85 A;  3CQZ J;  4JX6 A;  4G7Z F;  4U87 A;  3GBG A;  2CU7 A;  3G3Z A;  1ZH5 A;  1ZLK A;  3L7W A;  5L3G A;  4R8H A;  2GM4 A;  2Y0M A;  1RI7 A;  2RKH A;  3DP7 A;  5DD8 A;  3IH4 A;  1YS6 A;  1XGS A;  1O7F A;  3FXO A;  3QOE A;  4Z2Y A;  2HYJ A;  4PJJ A;  2O8X A;  2XAG A;  5IP7 J;  1TT5 B;  2PG4 A;  3OYD A;  3ZMS A;  2HDW A;  2BVL A;  2OU2 A;  3MFK A;  5DS9 A;  1J2X A;  2R0Q C;  3ZMZ A;  2P4W A;  4F7Z A;  1MSF C;  4ZZD A;  4HPQ A;  1ZRE A;  1A5J A;  1FOW A;  1SD6 A;  4IEJ A;  1ZN2 A;  4BAC A;  1KA8 A;  3ESW B;  2R7Q A;  2XPW A;  5EG0 B;  3K10 A;  3L2W A;  3GO5 A;  1JKO C;  2IVM A;  1K78 A;  3I3L A;  3M1C A;  2HXO A;  2VXZ A;  2Z33 A;  2VJ4 A;  1MMD A;  2D1V A;  1RRJ A;  3N4M A;  2E1N A;  5AON A;  4CYC B;  4AIK A;  4IHT A;  2HVR A;  4IO9 F;  2F4I A;  1YIT I;  2CQQ A;  1WPK A;  4HX4 A;  4ANJ A;  2BVM A;  2JT1 A;  2Q0O A;  2UUZ A;  5H6Q A;  4NQW A;  4CDG A;  5IPA A;  1JKQ C;  2ZSH B;  3AG1 H;  3C2G A;  1IUF A;  2BHY A;  1LNW A;  4KIF A;  1TW2 A;  1WVR A;  4FX4 A;  4FE4 A;  2NVQ J;  3PSI A;  4CCJ A;  3ZN0 A;  3JAM K;  5KAI C;  1IXS B;  2JN6 A;  1WCM J;  1I3Q J;  2QKM B;  3R6S A;  1Z05 A;  4G7H F;  4NC6 A;  4ON0 A;  5J40 A;  1R1U A;  5J6X A;  3K70 C;  4KMF A;  3QP5 A;  5A2Q K;  4BKX A;  4FHT A;  4BQQ A;  4RB1 A;  1R22 A;  3FX3 A;  4XQF A;  5JFR A;  1IXR C;  4YRV A;  4KIC A;  2L0K A;  4XLN F;  2EA4 A;  2K02 A;  2FNP A;  2M1B A;  3HEF A;  1ZHF A;  2F5F A;  3OY9 A;  3ZXS A;  5K5Q A;  2EQR A;  4RB3 C;  1UHS A;  5GTI C;  2A05 A;  3HTU A;  1V3F A;  4D1Q A;  3OYK A;  2E71 A;  1ETO A;  2UXN A;  3T8T A;  3U9G A;  2XF5 A;  4KIG A;  4D5F A;  4WWC A;  4I02 A;  3S14 J;  2KPM A;  5E3L A;  4EJV A;  2IS2 A;  1TNT A;  3CMY A;  1SD4 A;  1WHU A;  1B59 A;  1JJ6 C;  4LLN A;  3J7A O;  1VQ9 I;  1JTY A;  1ETY A;  2LBF A;  5JVT A;  3RQ4 A;  4KA4 A;  3LSM A;  3MZH A;  4BHP A;  4YFK F;  1Z6R A;  3HB9 A;  1KU2 A;  1Q1H A;  4AVZ A;  1SMT A;  1HW1 A;  2CFX A;  1Y0N A;  4RAF A;  3QAH A;  3H5A A;  2GXA A;  1FT9 A;  5FJ8 J;  3H9J A;  1QA6 A;  2OBP A;  1XG1 A;  2FEZ A;  5JI6 A;  1XB4 A;  3MZY A;  3KZI C;  3MKZ A;  4OIQ F;  1LFP A;  3JAM Z;  1T8I A;  4OMY A;  2IJL A;  2RC4 A;  2CW7 A;  5GPC A;  1PP7 U;  1YIJ I;  1SFK A;  2PJR B;  3E6D A;  3HTS B;  5FD6 A;  1WH5 A;  5BPI A;  3BR6 A;  1QNT A;  3S32 A;  4PUS A;  4HEA 2;  2OQR A;  3D0S A;  3OOP A;  5DCM B;  1XD7 A;  4E70 A;  5A2Q Z;  4X6A J;  2CUE A;  2XRO A;  2X6X A;  2VOP A;  1B72 B;  1P6R A;  1FTT A;  1LDD A;  2DN0 A;  2KIM A;  3M3Y J;  2V1N A;  1G8X A;  1UHM A;  3MVP A;  2O6G E;  3ZQH A;  3LNQ A;  1LEB A;  2ZSI B;  3JRI A;  2KT0 A;  1K4T A;  4XOT A;  2QWW A;  3ZP5 A;  1FEX A;  1F1Z A;  1V4R A;  2HFH A;  4H4K C;  2WTE A;  2M30 A;  3PNY A;  1MSE C;  2Q1Z B;  4KIT B;  5M3F J;  2Z1D A;  3CJQ B;  3RDI A;  3ONQ A;  4ETS A;  3VB2 A;  3ECO A;  1NK3 P;  3FXM A;  1OFC X;  2VJ5 A;  2LY9 A;  5M5X J;  5J4V A;  3H5N A;  3R0A A;  4D0P A;  1BW5 A;  3BR0 A;  2EIJ H;  2YU3 A;  2L5Q A;  3BPV A;  2O0Y A;  3KE2 A;  4BE1 A;  4AWX B;  1JKP C;  4JBA A;  5E17 F;  3M8J A;  1ACI A;  2M2E A;  4RAZ A;  3LQR A;  2RNJ A;  2NRA C;  1YRN B;  2NNY A;  2EWN A;  1MBF A;  2Y69 H;  3O3K A;  4JP0 A;  3FKI J;  4BL0 B;  2WAE A;  1DPR A;  1JHF A;  3MMY B;  1YS7 A;  5ILS A;  4YFX F;  2ZME C;  5ICE A;  3HGG A;  2YU9 J;  3R0J A;  2RGV A;  3GVA A;  4G6T B;  1QHH D;  3W6J B;  2DTR A;  4A6E A;  5FKM A;  2A68 F;  1VQ7 I;  2FQ3 A;  1I1S A;  2L9S A;  3TOB A;  1OR7 A;  3HBL A;  3M7G A;  1JXS A;  4EEF G;  2DCE A;  3SJM A;  2QF7 A;  4UUT A;  1QZY A;  3HUG A;  4ZJZ A;  4JQF A;  3FDY A;  3Q9V A;  4EM2 A;  2ZJR F;  4B43 A;  2DT6 A;  1IN5 A;  2X6O A;  3ZQI A;  4AIJ A;  1OJL A;  1U8B A;  2EA2 A;  1GT0 C;  1E2X A;  1SFU A;  1HST A;  4U0Y A;  2VIX A;  5IYB J;  1VTN C;  2GQQ A;  2MG4 A;  5CPR B;  2FE3 A;  1AOY A;  4XOR A;  2HS5 A;  3L1P A;  1FOX A;  5E3O A;  2JQ7 A;  1FYL A;  3SEZ A;  2CH0 A;  2UZK A;  2MD0 A;  2BOL A;  3OS0 A;  3DCF A;  4BHB A;  3MD2 A;  3BCA A;  2WWY A;  1VQ4 I;  1DU6 A;  4Y52 J;  1X1P A;  2BHZ A;  3ZQC A;  1PDN C;  2H1K A;  5LGT A;  1T39 A;  2CGP A;  2EFO A;  2R7V A;  4IRG A;  1EH8 A;  5HDK A;  4KIS A;  3FBI B;  1PUE E;  4M72 A;  3WE3 A;  2NXN B;  1WRJ A;  1SC7 A;  2V79 A;  3Q0U A;  2XSJ C;  2HEO A;  2KLO A;  3K4B A;  4Q4Z F;  3F72 A;  4A0Z A;  2W24 A;  3CCE I;  1T6S A;  4DZP A;  1ETV A;  5FLV A;  3LA3 A;  4XKB A;  3IWF A;  3SHF A;  4HF2 A;  1OIS A;  2Y30 A;  4M71 A;  4AID A;  1FX7 A;  2LVS A;  2LR8 A;  2C6Y A;  1VQL I;  2VQC A;  1I50 J;  2CRG A;  4JK1 X;  1QO0 D;  3PUB A;  4PFP A;  2OC6 A;  3OIO A;  4AVP A;  2V1U A;  3VOE A;  4HST A;  4KMU X;  1AKH A;  3V8L A;  3JCU C;  2J5P A;  1IN8 A;  2OUM A;  2G9W A;  2MLG A;  2L9V A;  3COA C;  3D5L A;  3E6M A;  2YSR A;  4MNU A;  3JSO A;  4A0X A;  4XMY A;  4XNF A;  2QEN A;  1X4O A;  3FHN A;  4HBL A;  1IN7 A;  3E5U A;  2PMH A;  2FSW A;  5ERI A;  5D5X B;  2HYG D;  2R7W A;  2PN6 A;  1UG2 A;  2IGN A;  1A36 A;  3K4N A;  2GA1 A;  4E4H A;  2L7Z A;  3AG3 H;  4I0A A;  1U9N A;  2HU9 A;  4UXN A;  2D1H A;  4FCY A;  3WOD F;  1R71 A;  2A69 F;  3LSJ A;  3WU1 B;  5E18 F;  1W36 D;  2L7K A;  1FP2 A;  3CCY A;  2XGE A;  4Q5S F;  2GIZ A;  2DYS H;  2OV7 A;  5CQG A;  3L2V A;  3G6E I;  1E3O C;  3HL2 A;  3S15 J;  2STW A;  2R7Z J;  5LRR A;  3MWM A;  2K9L A;  3PNT A;  4EM0 B;  1D0Y A;  3BR5 A;  5HS8 A;  2DA4 A;  2K4B A;  1TWG J;  4OOI A;  1U5T B;  1MNM C;  2X1D A;  1LVK A;  4J19 A;  5E1X A;  5F08 A;  1XGM A;  2ME0 A;  3IL2 A;  2KKO A;  2QQB A;  1ZRC A;  4ESF A;  3G2B A;  5D8K B;  2HOS A;  4CCN A;  1RC9 A;  3HOZ J;  4KUM A;  1AWC A;  2AQF A;  1D5Y A;  4BGD A;  4IPA A;  5EZG A;  2R7D A;  4GYG A;  3UKG A;  3LWF A;  3CCV I;  4EJT A;  2X48 A;  3HG9 A;  2IS4 A;  2KRF A;  1R1V A;  1Z77 A;  3OV8 A;  2HDD A;  2BY1 A;  5F0F A;  2M9H A;  1YIO A;  2D2W A;  4ESJ A;  2HQA A;  3OYM A;  1HF0 A;  2AO9 A;  5FD5 A;  1SD7 A;  5B3S H;  1W7P B;  1O3R A;  1IXC A;  1WJA A;  4EV0 A;  5DM7 F;  3MAJ A;  2VT2 A;  2XB5 A;  2LNB A;  3IP4 B;  2M8E A;  1SD5 A;  5E8G A;  1XS9 A;  2BZT A;  2Y75 A;  5LD2 C;  2EZI A;  2O3F A;  4M74 A;  4M3F A;  4HF1 A;  4AC0 A;  2TDX A;  1J09 A;  3KYL A;  5HS9 A;  3FK6 A;  3R4K A;  2R5Z B;  2JUC A;  2M4G A;  5B66 C;  3GZN B;  2WAD A;  3PQK A;  3S93 A;  2M7A A;  2XGC A;  3IWZ A;  4EM1 A;  2NS7 A;  3AG4 H;  3I4N J;  1OCZ H;  3QYB A;  1SFO J;  1JUS A;  2VBY A;  1T56 A;  2LD5 A;  4D7M A;  2ESN A;  2ZXH A;  3M1E A;  4OAY A;  2F5D A;  3ABL H;  3U2R A;  1DGR M;  3VYU B;  5B5E C;  5J1R A;  4LFU A;  2VON A;  4OIN F;  2MC4 A;  3S17 J;  4MHG A;  3ZN1 A;  3MEX A;  9ANT A;  1MDM B;  3F21 A;  3K0L A;  2VN2 A;  4RAY A;  3T8R A;  5EF6 A;  3WTX C;  4DOZ A;  2BXY A;  4DBR A;  4BY1 J;  2R92 J;  3LSP A;  3ABT A;  2R7R A;  2BV6 A;  2EV0 A;  1I39 A;  1OYW A;  3OR2 C;  4R79 A;  2P7V B;  4KN4 X;  5HLI A;  2GXG A;  4XM3 A;  2R5Y B;  3V4G A;  3OS2 A;  2NS0 A;  5IOY A;  2FBH A;  2CUZ A;  2KIS A;  2M34 A;  3BG9 A;  3TO9 A;  3TBI A;  5HNH A;  2UXX A;  3ECH A;  1RNL A;  1ZYR F;  2YR2 A;  2LYC A;  1G59 A;  4BXX J;  5DYM A;  4BJT A;  4DNC A;  1G3S A;  3A0H C;  2FU4 A;  4XSX F;  2DOF A;  1M1E B;  2OA4 A;  3KZZ A;  4HYE A;  3B6A A;  3S2W A;  4IX7 A;  4E6K G;  2ZXI A;  2FMY A;  2DYR H;  1FSE A;  4YIR X;  2ESH A;  1R9T J;  1RIO H;  2H1L A;  2E34 A;  5M3M J;  1BI0 A;  1OCR H;  4CH7 A;  1FNN A;  2VQH A;  2L4A A;  2WC2 A;  3HKZ A;  2DPU A;  4DQ2 A;  2VQG A;  3F22 A;  4F93 B;  1ULY A;  1ETQ A;  2ECB A;  4A3M J;  2VC1 A;  3E6B A;  2DI3 A;  4MTE A;  1UST A;  1FZP B;  3GEZ A;  2H94 A;  1X1A A;  5CVI A;  4DYQ A;  1EV7 A;  3IH2 A;  1X4P A;  4LG0 A;  3VFZ A;  4L9T A;  3GTK J;  1GDT A;  2VBX A;  1I27 A;  2E35 A;  4M6X A;  2MW8 A;  5IT9 K;  2E60 A;  4CCO A;  5E3N A;  3O6B B;  4MEY F;  1P92 A;  5J3L A;  5ICC A;  2A5Y B;  2WAF A;  3ZQQ A;  1KQ8 A;  2ZFW A;  1QU3 A;  1G3T A;  5BS6 A;  3I64 A;  3VWB A;  2PMZ A;  1XMX A;  3DBR B;  4ENM A;  1HKS A;  2Z9O A;  3SFI A;  2F5C A;  3GTM J;  1ONV A;  1R5H A;  3RYR A;  4ZYD A;  2IBD A;  2H09 A;  3U21 A;  3L00 A;  3WU2 C;  4BHC A;  2W84 A;  1VI0 A;  3ZQ7 A;  1WH7 A;  2E36 A;  2LK2 A;  2MAB A;  5FRM A;  3A03 A;  1JGS A;  1UFM A;  2ZJ2 A;  3DTI A;  5TRD A;  4E7I A;  2P8T A;  3ZQG A;  3HJE A;  5CVR A;  1F5T A;  2JPB A;  2COB A;  1SFE A;  1L3L A;  2ZKZ A;  2PI0 A;  2V26 A;  4D7N A;  4A0Y A;  2JZY A;  2P7C B;  1BI2 A;  4IJA A;  3GLL A;  2ADU A;  3V7S A;  5BNG A;  1S7A A;  5E1Z B;  3A01 B;  5GP9 A;  2EZH A;  2XPU A;  3I59 B;  3JTG A;  2ZJP F;  2JWT A;  3KCC A;  4GXO A;  4ZDP A;  2K9Q A;  1XMA A;  2FD5 A;  2ICW G;  4A2U A;  1YFH A;  3ZMD A;  2R7U A;  3VYS B;  3DPT A;  3OMY A;  5GAE J;  4EQQ A;  1Z7L A;  1K4S A;  2E5N A;  4PSW A;  4YG2 F;  3WTY C;  2O7O A;  1BIB A;  1USS A;  2O61 A;  3TOA A;  1MBH A;  2EFP A;  1YQA A;  3WG9 A;  3HRT A;  3LSK A;  5DUI A;  2HKO A;  4G94 A;  2YX7 A;  2XIG A;  1KU7 A;  4GCV A;  3FM5 A;  4BJ6 C;  4EVI A;  4W97 A;  3LL7 A;  2K40 A;  5ILV A;  4IVN A;  5CQE A;  4BBS J;  3HIF A;  2B63 J;  1BOB A;  5EG0 A;  3SDG A;  1VFC A;  3BCB A;  2RQP A;  1J0R A;  1H9G A;  1LUJ B;  1YX3 A;  2BW3 A;  3PUF A;  1MBG A;  2LLK A;  2ZO4 A;  1DGW Y;  1OCT C;  2HNH A;  3QPL A;  1ETW A;  1IUY A;  2VI6 A;  2Z99 A;  2VJJ A;  3C3W A;  4BDZ A;  3KP7 A;  1W7P D;  3GTQ J;  1WJC A;  4CZC A;  2Y48 A;  1R5G A;  4HDV A;  1ZAO A;  3F6V A;  3G73 A;  2CV1 A;  2ECC A;  1GVD A;  2PFB A;  3KIO A;  3CCL I;  3M9A A;  2DA2 A;  2J5O A;  2N8G A;  2EPF A;  3PNV A;  3GF2 A;  4XRM A;  2MYS A;  1ZG1 A;  1MMN A;  4BXF A;  2K3F A;  3J81 K;  3ABK H;  2E1O A;  1S29 A;  4A3J J;  1AU7 A;  4HV6 A;  4F55 A;  4LLL A;  4XLF A;  2FOK A;  2IP2 A;  2CQX A;  1IG7 A;  2FA5 A;  1BL0 A;  3S16 J;  5IY5 H;  1R36 A;  3DXJ F;  1MIJ A;  2GLO A;  2VL8 A;  1ZG3 A;  5JLW A;  3GME A;  3LFK A;  4A3L J;  2KIU A;  2P0W A;  1EA3 A;  3CDI A;  2CO5 A;  1WGX A;  1JUM A;  5F04 A;  4L18 B;  4ZYA A;  1P7I A;  1A31 A;  3BLY A;  2MH9 A;  3LSH A;  4XRS A;  4J01 A;  3OL4 A;  2CW0 F;  4U7D A;  2QBY B;  5BQT A;  2R93 J;  2GBY A;  4PK4 A;  2JVG A;  2JA2 A;  3PL8 A;  1C0W A;  4UHT A;  2L9N A;  3SXY A;  3GFL A;  3CCJ I;  3OYE A;  3CLO A;  1FOK A;  4QIW N;  1T38 A;  1WJF A;  2K9S A;  3W2W A;  3NAU A;  3I53 A;  3E3V A;  2HQN A;  5GAG J;  3N97 A;  4IHW A;  1N25 A;  2BY3 A;  3RQI A;  3GTO J;  4PJM A;  5C4X J;  4P5O A;  2LFB A;  1RKT A;  2E2H J;  2K9N A;  4ESB A;  2I8D A;  2ZCW A;  2MC3 A;  2FF4 A;  1LEA A;  4LMY A;  4Y33 A;  1Z7U A;  4UVB A;  5ICG A;  1POG A;  2KRH A;  4JYK A;  4ZTJ A;  2NVT J;  5L3F A;  1W5T A;  2NOJ B;  3J81 Z;  2EV5 A;  4L0Y B;  3FXU A;  1YX5 A;  3U1D A;  4RAG A;  2PJR A;  3I4P A;  4II2 A;  2RVC A;  3CCS I;  1V55 H;  1CF7 A;  3NWT A;  3G1M A;  1EH6 A;  2G0E A;  1HW2 A;  1A6I A;  1R6R A;  2ELK A;  4XID A;  1A35 A;  3G1L A;  1B4A A;  1QBJ A;  3Q9S A;  4I09 A;  2P6T A;  2VXD A;  4LK0 F;  3FHZ A;  1P4W A;  1SAU A;  3GWZ A;  4A3D J;  4II3 A;  4UV9 A;  2DPD A;  1JGG A;  4LIV A;  2FUG 2;  4ENJ A;  4HSR A;  2CJJ A;  4RA2 A;  3DEE A;  2DXI A;  1E17 A;  2LY1 A;  4V2G A;  1N75 A;  4WK8 F;  1KGS A;  1VQK I;  2QLZ A;  1OLT A;  3BTL A;  1T0F C;  2LOO A;  3FIS A;  4L9N A;  1N78 A;  4DW6 A;  2DT7 B;  4IRI A;  4ZYG A;  4UY8 I;  4ENK A;  2DA5 A;  3BT9 A;  2XAQ A;  5ICF A;  4V2F A;  1TNS A;  4BY7 J;  3SZP A;  5K7Z A;  2Y9Z A;  3QP6 A;  1IN4 A;  1T0F A;  2DFH A;  2CW8 A;  3EUK L;  1F36 A;  1WJE A;  3NWS A;  2QVO A;  4M3D A;  3SEQ A;  4C2T A;  2DW4 A;  4PGG A;  2LBF B;  2XAH A;  1TL8 A;  3HXL A;  1MNE A;  4TV7 A;  3L2C A;  1O57 A;  3PO3 J;  5LHG A;  2W48 A;  4EJU A;  2KJC A;  3HKZ N;  1Z6T A;  1YRN A;  1UAA A;  1LVA A;  3H9G A;  3WTU C;  1APL C;  2P5L C;  1BA5 A;  1GXP A;  2OZ6 A;  5LEJ A;  3LAP A;  1UG0 A;  3WG7 H;  4L0Z B;  4XON A;  3JSP A;  3CMM A;  1X3U A;  3P5J A;  2DMU A;  1TP4 A;  4XL9 A;  3F9K A;  5JLX A;  4C3H J;  3G4S I;  2WBM A;  1ITY A;  2A3S A;  1A6Q A;  3VYR B;  5JHF A;  2GXB A;  1WJB A;  4RLF A;  3S8P A;  2LF7 A;  3S1N J;  2CV2 A;  4E7Z A;  4KIB A;  5BMZ A;  3IAM 2;  2BBY A;  2VKH A;  4XBF A;  1J59 A;  1WJD A;  2VKE A;  3RKX A;  3AL0 C;  3CP2 A;  1HOM A;  2PMZ N;  3L9F A;  2IA0 A;  2G7U A;  1ZKG A;  2V6E A;  1I6H J;  3SQN A;  5CVU A;  4RDU A;  1U0J A;  2EIM H;  3HM5 A;  4O6J A;  2HZD A;  2JRM A;  3HSR A;  1VZ0 A;  2Z3Y A;  3LA7 A;  4R1H A;  2ZME A;  3JRC A;  4FAS D;  5LGU A;  2OTJ I;  3IKV A;  3WTV C;  3BZC A;  4IZZ A;  4DIQ A;  3BP8 A;  2KRC A;  4BE0 A;  3DU5 A;  3A4C A;  3CC4 I;  3REO A;  4I2O A;  1NG6 A;  3RPU D;  2WB1 A;  3GUD A;  4S05 A;  2FNA A;  1HKQ A;  2P5V A;  4PFO A;  3JRE A;  2HGC A;  1MD0 A;  2DJI A;  3M07 A;  4MIM A;  4BEH B;  5LEK A;  2CSO A;  3JRG A;  3I4M J;  3RZO J;  5FFZ A;  2WY7 Q;  2X6W A;  3AL0 B;  1OPC A;  5ILU A;  2IGM A;  3CJR B;  3FXK A;  2LTP A;  3KP5 A;  3GCM A;  3EET A;  2DOE A;  4G8X A;  3T5X A;  1IC8 A;  2X6Y A;  2JA6 J;  2EK5 A;  3JRA A;  2RRE A;  1QPI A;  3VSL A;  2ZNZ A;  3MKY B;  5J8F A;  1QVU A;  4S0H B;  2FJ1 A;  2W4S A;  3WTT C;  2ZFU A;  3S1R J;  1X19 A;  2V1D A;  3ABM H;  2ZXJ A;  3J7Y J;  3H3Z A;  2XHK A;  1DQU A;  3GXO A;  1P4A A;  4WF2 A;  2COM A;  4GFB A;  3MKW B;  3F0C A;  4IXA A;  1E3P A;  1F9N A;  3D5R C;  3PFI A;  5F6F A;  4OWR B;  3K4K A;  3FXJ A;  2LKS A;  2V4J C;  3JRD A;  4PJL A;  3K7A J;  2KL4 A;  4EAT A;  3O8H A;  3I55 I;  3MZ8 A;  2XGD A;  2HR3 A;  1ZRF A;  5L3C A;  1Y8R B;  1HW5 A;  2EZK A;  4XRF A;  3WGI A;  4HA8 A;  3D5S C;  3CUQ B;  2CMP A;  5E3M A;  2CUF A;  2LH9 A;  1L0O C;  1XSD A;  2STT A;  2DBB A;  2Q2E B;  2VBZ A;  4F3Q A;  2CYY A;  3WU0 A;  3OYI A;  1UCR A;  1Z0X A;  2VLA A;  3FK7 A;  4BBR J;  1Y39 A;  3HHH A;  5EZH A;  3DPL C;  2ME6 A;  3X2Q H;  1FBQ A;  4I01 A;  2GIV A;  1MMA A;  2XGX A;  3B73 A;  4ZTF A;  1U5T C;  2GZW A;  5J1Y A;  1DPU A;  3E5X A;  5CKT A;  1WKM A;  1BI1 A;  4NDL A;  4U88 A;  3TP3 A;  1S8N A;  3L2U A;  4HRI A;  5BOX A;  4YEL A;  1W0U A;  2L2O A;  3OWT A;  4IKF A;  1X3Z B;  4GRI A;  1RPW A;  1F4K A;  1U5T A;  4RMN A;  2LP0 A;  3EUH C;  1G6N A;  1JI8 A;  3LQQ A;  3H0D A;  2W57 A;  1QGP A;  2M87 A;  1IGN A;  2OD5 A;  1ENH A;  1VND A;  3NQO A;  2H8W A;  5KK1 A;  1SFX A;  2WAQ A;  3PIO F;  3OIP A;  5KNL A;  2HWV A;  1D1B A;  1K79 A;  5F64 A;  4UUV A;  5IT3 A;  3K2Z A;  1R5I D;  5FKK A;  5DM6 F;  2PBI A;  5K1Y A;  2QA4 I;  5EGO B;  1YJ9 I;  3ELK A;  5CJ9 A;  1Z3X A;  4XLA A;  3ZQL A;  3W6K B;  5K7F A;  3K4C A;  5TIS C;  2CS3 A;  2L02 A;  1DP7 P;  5JHU A;  3DU6 A;  1NHA A;  1FC3 A;  2R7O A;  2MFZ A;  2OJE D;  1MKM A;  2FXA A;  3R60 A;  4HW0 A;  2NVX J;  1RUN A;  3SFZ A;  4PGH A;  4B44 A;  1FY7 A;  2VPL A;  3QOP A;  1MND A;  3ISP A;  3S1M J;  3VSK A;  4E7H A;  3QYE A;  2I5U A;  2EJR A;  3GTG J;  3K70 D;  3RPQ A;  1WSU A;  5M5Y J;  2CQ7 A;  5L3D A;  4P1W A;  2DOD A;  4O5V A;  4HG2 A;  5F27 A;  4HDU A;  2W85 A;  2EFQ A;  3GFI A;  2NAZ A;  1MMS A;  3KPH A;  3V8J A;  2E5Z A;  4N9H A;  4AD9 A;  3KX2 A;  3P7N A;  4RGS A;  3BG5 A;  1TWF J;  1YO5 C;  1V5E A;  5F0C A;  4WXH A;  3FWE A;  4H0E A;  5D5U B;  5K5R A;  2DQL A;  3MQ0 A;  1TQM A;  2X4H A;  4Q47 A;  3CC7 I;  1BI3 A;  3V8K A;  1PVE A;  1RR8 C;  3W3C A;  1HA8 A;  1MDM A;  1LFU P;  4M9X A;  4BAY A;  2ZJQ F;  1D8J A;  2HQR A;  2IRF G;  1MMG A;  2DA6 A;  2Y2Z A;  4BJ5 C;  1W5C C;  2V9V A;  1TC3 C;  5AIQ A;  1X2M A;  4I7H A;  4D9J A;  3M8F A;  4IHX A;  1U78 A;  1BJZ A;  4P9F A;  2FX0 A;  1U3E M;  4Z6Y A;  2AS5 F;  4MFE A;  3GFJ A;  4QLC U;  4BH9 A;  1XSX A;  4KT5 C;  3PJR A;  4C2M J;  2DOA A;  1HDD C;  2NYX A;  4KT6 A;  1UJ8 A;  1ZTR A;  1TWA J;  4A3C J;  1ZGW A;  4BE2 A;  3B02 A;  1VQP I;  4C2U A;  5IOZ A;  1XGN A;  2KZG A;  3WHC A;  1HBX G;  1MW7 A;  2E7W A;  2XDV A;  1HKT A;  1ON2 A;  1WI9 A;  2DMQ A;  2DMT A;  5LLQ A;  1BR2 A;  1SAN A;  5E1W A;  1UMQ A;  3TMO A;  5H2F C;  5GPA A;  1V5G A;  4JOM A;  4PJN A;  1FIP A;  5HOO A;  1UHW A;  1E3H A;  1T2K A;  1RES A;  3CDH A;  3OOU A;  3HRU A;  3FM3 A;  3BZK A;  4OU0 A;  2VB6 A;  3HDD A;  3LSI A;  4B47 A;  4A5M A;  5GAH J;  3CO6 C;  1U2W A;  4XIC A;  3HOU J;  5AIP A;  2ISZ A;  2KQR A;  2E2J J;  1HC8 A;  3GZ5 A;  1H0M A;  1VQ8 I;  3PFY A;  2CV0 A;  1FYM A;  1I3A A;  1BOA A;  2DA3 A;  1O4X A;  4M3B A;  4A3B J;  3PIP F;  3CD6 I;  4QTR A;  3S3O A;  2ID3 A;  2VKV A;  4L9J A;  4UB8 C;  2Z16 A;  3CO7 C;  1FLI A;  2B9S A;  2F6C A;  1HQC A;  4N4N B;  3S3N A;  1XN7 A;  4B1R A;  1J9I A;  4N9I A;  2E1M C;  1V54 H;  4G6Q A;  3KYD B;  4KJZ A;  3KYC B;  4LLG F;  2LG4 A;  4E7L A;  1SVM A;  5LHH A;  2R4G A;  3LMM A;  1WZ2 A;  4A5N A;  3C1D A;  3RKQ A;  2K5C A;  2M7B A;  3J7Z I;  2H8R A;  2QCO A;  4HAM A;  1STZ A;  3GX4 X;  1IRF A;  5M5W J;  5DTD A;  3GW2 A;  4A6D A;  2Y9Y A;  4GDF A;  1G2H A;  1JKR C;  1ZAR A;  3QWL A;  3HPG A;  3I5U A;  4NHJ A;  2L9R A;  4FX0 A;  3OYF A;  1T95 A;  4XLE A;  2A61 A;  3F8M A;  1PJR A;  2E19 A;  1QZE A;  1Z1D A;  4AYB N;  5E8I A;  5HLT A;  2CQK A;  3DEW A;  4OIR F;  3I71 A;  2E1M B;  1FPQ A;  3CP8 A;  3LA2 A;  2OQG A;  1V5F A;  4Y15 A;  3S1Q J;  2WB1 N;  4U0W A;  4Y4R A;  2M3A A;  2W00 A;  3GLX A;  2HVS A;  2I10 A;  3FF5 A;  3NAR A;  1FOY A;  2EBI A;  3A01 A;  1IDY A;  2DAO A;  3I59 A;  2IGO A;  2JK3 A;  2KZV A;  2VC0 A;  2OCE A;  1TLH B;  1MJA A;  1S5L C;  1LJ9 A;  2HTS A;  5HS7 A;  2YS9 A;  4IRH A;  1ZR2 A;  4UVA A;  4M3G A;  1EJ9 A;  1YLF A;  1OYI A;  1DU0 A;  1IN6 A;  2HXI A;  1YOV B;  3NRV A;  5FLX Z;  2IA1 A;  1VQ5 I;  4A69 C;  3Q5F A;  2F2E A;  1D5V A;  1IZ1 A;  1B8I B;  3OYL A;  3IUO A;  3IRR A;  4OIP F;  1MBK A;  4X0G A;  1KON A;  1BR1 A;  3KLO A;  3BR1 A;  4AU7 A;  4KN7 X;  1LPQ A;  3GTP J;  4LG0 B;  3DV8 A;  4XSZ F;  3C2B A;  2IT0 A;  3FZV A;  5BPD A;  4BQA A;  4MQV A;  4LGW A;  1TWC J;  3HOS A;  2ZXW H;  4C3J J;  2V1X A;  3DF8 A;  4MGR A;  2RDP A;  4ZZL A;  5F1J A;  2K4J A;  3DEU A;  1I1G A;  2LRD A;  2DFE A;  1EH7 A;  2M0M A;  2NVU B;  5E79 C;  3OYN A;  2EZL A;  4UUS B;  4A3G J;  2RAE A;  3OS1 A;  1XCB A;  4OIO F;  4ASN A;  3RSN A;  1CQT A;  1N77 A;  3FXL A;  1MBE A;  3MKL A;  3H36 A;  3M4O J;  2EIK H;  3AFH A;  3CJT B;  2DDA A;  5KHD A;  1X1B A;  4AIH A;  2F4M B;  4HQM A;  1ZK8 A;  1IO2 A;  1YYV A;  4QSH A;  1XGO A;  4ENN A;  2IPQ X;  4N4O B;  5IYC J;  2K86 A;  4NUB A;  3ERE D;  4B8X A;  2Y31 A;  3ERM A;  2IA2 A;  1QQI A;  3FMQ A;  3KP6 A;  4K2E A;  3LSR A;  1LE8 B;  3BRO A;  5D5V B;  3O2P E;  1QHG A;  4FT8 A;  3JRH A;  2R7T A;  2VAS A;  4M9S A;  1ZEL A;  5KCM A;  3DKY A;  3GFM A;  3VPR A;  2UWM A;  2Y0S A;  3HRS A;  1SAX A;  3K1M A;  3HOT A;  2DA7 A;  1XX5 A;  4Q48 A;  3HZJ A;  1XMK A;  3QOD A;  4L9V A;  4CYC A;  2K7L A;  3ZPL A;  3F6O A;  3RKW A;  3K4M A;  1X1C A;  2WAQ N;  3CDL A;  1UEL B;  5F0H A;  1R49 A;  1BBY A;  1OKR A;  1WQ2 A;  3CTA A;  3CMA I;  2ZBK A;  3ZMV A;  2HI3 A;  4A12 A;  4DBQ A;  2O03 A;  1OCO H;  3DTE A;  4B4C A;  2XPV A;  1RET A;  3H9Q A;  3KET A;  4XKC A;  4M6V A;  4HV5 A;  1Q1V A;  4CHU A;  2AHQ A;  1MH4 A;  4DYC A;  1GUU A;  1PUF B;  1FTZ A;  1GV5 A;  2A6E F;  2DTZ A;  1W1W E;  3TL4 X;  3A0B C;  2QBY A;  3IV5 A;  1ZRD A;  2W25 A;  1T33 A;  1D8K A;  5FKN A;  3EYI A;  3WGH A;  3J80 Z;  2QUF A;  3CCM I;  2XB0 X;  1T08 B;  5DDG A;  1VQM I;  1OCC H;  3VDX A;  2BW3 B;  2XAF A;  3EUA A;  3P9C A;  3TP0 A;  1K6O A;  3K69 A;  2M5W A;  3DTK A;  2W1O A;  1LFB A;  4RGX A;  2M4K A;  4NNJ A;  3FXQ A;  5CVV A;  1W36 C;  2V9K A;  4QPQ A;  3F23 A;  1SMY F;  3PO2 J;  2XUB A;  3KZY A;  2GA2 A;  3SYT A;  2Z5U A;  2F5V A;  1FYK A;  2EFN A;  4CXF A;  2PJP A;  2A6H F;  3BQZ A;  2JA5 J;  3GZ6 A;  2O5R A;  4WXD A;  2HOT A;  1R4N B;  5J47 A;  1FP1 D;  1XTA A;  2MBF A;  5CLS A;  2BXZ A;  2OF7 A;  3OR1 C;  2R3S A;  1XDU A;  3F8F A;  1ZQ3 P;  4B3A A;  3IRQ A;  5B1A H;  2HQ5 A;  3H0G J;  1K78 B;  2G7H A;  3E7L A;  4MQ9 F;  2QSH X;  3ZOB A;  3S2D J;  1KQ9 A;  4J00 A;  2CQN A;  2JUG A;  4GYI A;  3K4L A;  2PMU A;  4ZYE A;  4IHS A;  1YTY A;  2QSG X;  1HDP A;  3EQL F;  3QPH A;  2RNG A;  4XN0 A;  5FKL A;  2VUM J;  1Z91 A;  5DCF A;  1IW7 F;  4EJO A;  3LOC A;  4NQW B;  1S3J A;  1H88 C;  3CLQ A;  2XAJ A;  1JT6 A;  3OSG A;  3VYT B;  5L3B A;  3C18 A;  2R7X A;  2PX9 A;  2DJN A;  1TWH J;  1YI2 I;  1REP C;  5IP9 J;  3KP4 A;  3ZR8 X;  2ETH A;  1P9Q C;  2P81 A;  3BZ6 A;  3RTR A;  2W7N A;  2OTL I;  5D4S A;  3F8B A;  2VE9 A;  1P2F A;  5J4Y A;  1UB9 A;  5CYV A;  5DCM A;  1DP3 A;  3I0T A;  2EB7 A;  4F92 B;  2LKX A;  4I98 B;  1B72 A;  1JHH A;  5FRN A;  3TO7 A;  3KEY A;  2LDU A;  3FIW A;  1YW9 A;  2LF8 A;  2HDC A;  3TED A;  5H6R A;  2DU9 A;  5B1B H;  3IH3 A;  1WI3 A;  2KDO A;  4LB6 B;  1IRG A;  2M8G X;  2R7S A;  1J75 A;  1XPX A;  2RN7 A;  2XF7 A;  1P4X A;  5D6E A;  3NEU A;  2DQR A;  3CF5 F;  1ZGJ A;  4EGY A;  5D5W B;  4ZC3 A;  2MGQ A;  3FMS A;  4HNU A;  3HOY J;  2IW5 A;  2YPR A;  3RYP A;  1BC8 C;  2D5V A;  1K83 J;  2JRT A;  3N05 A;  3PQJ A;  5EJC A;  3HOX J;  1J7K A;  3E6C C;  4DZJ A;  4XKW A;  4XLC A;  3BG7 A;  4HLY A;  1LB2 A;  2VOD A;  2DMN A;  2TRT A;  2EFW A;  3RCO A;  5HOD A;  3H5R A;  2F48 A;  1O3S A;  1KU9 A;  4C9Y A;  2MD5 A;  5TGT A;  1HXD A;  4I0B A;  2ISY A;  5GAD J;  2H6B A;  4DYR A;  4RBO A;  2LKP A;  4X1E A;  4HOB A;  3OYH A;  1YW8 A;  3T0Y A;  3TW7 A;  1Z21 A;  1H8A C;  1WFX A;  3BQY A;  4P96 A;  3E97 A;  4BDY A;  1CF7 B;  3P9I A;  3R61 A;  4BXU A;  5FLM J;  1HCR A;  1W4M A;  4RB0 A;  5FRO A;  2BGC A;  2DDB A;  4S04 A;  3K9T A;  4CCM A;  1D1A A;  3ZMU A;  1JUP A;  1UZC A;  3BDD A;  5HDN A;  3S3M A;  1VF9 A;  3MCZ A;  2AXL A;  2MSY A;  1NK2 P;  1O7L A;  4G6D A;  3JTH A;  4IHY A;  2KFD A;  2IGK A;  4WX9 A;  3CJN A;  1A04 A;  4FE7 A;  3E1S A;  4MEX F;  4CUG A;  4M3E A;  3HPH A;  3K1N A;  3OYC A;  2A5W A;  2KIF A;  5EEH A;  3E5Q A;  2QEX I;  4IL6 C;  3CCU I;  3LFU A;  4M9Z A;  4A3I J;  1BJA A;  2ZNY A;  5KAF C;  3FBN B;  4PJ0 C;  3I9V 2;  4NBQ A;  1NH3 A;  4QPO A;  1MJB A;  4DGW B;  4NC8 A;  3RKY A;  4L5J A;  3B6C A;  1ZG5 A;  2DK8 A;  2L01 A;  3RJP A;  3I56 I;  1RZ4 A;  2KMU A;  3OYJ A;  1ORK A;  3JRB A;  2OCC H;  3CUO A;  2WY8 Q;  3ROU A;  4BEH A;  4YFN F;  4P9U A;  2KDZ A;  1Y6I A;  2WV0 A;  3EYY A;  3FMR A;  4HNT A;  4PCQ A;  3BR3 A;  2ID6 A;  2JMW A;  3WTS C;  4FIS A;  4E7K A;  4OAZ A;  3P9K A;  1RKW A;  2VJI A;  1ZGA A;  2KP6 A;  4MLO A;  1X3W B;  2XSD C;  3DLA A;  4ZDO A;  3ZMT A;  4EJW A;  2HZT A;  1ETX A;  2LMD A;  3TQN A;  4N0B A;  5C3E J;  3K1P A;  1K61 A;  2VKD A;  4CCK A;  4AYB A;  1T98 A;  2VE8 A;  1B6A A;  1FMV A;  4O3M A;  1ODD A;  4B3X A;  1TTY A;  1IF1 A;  4A3F J;  2JPC A;  1WWX A;  3VOD A;  4XR6 A;  1OR7 C;  1B1B A;  5HDG A;  4CO8 A;  3W2A A;  4U7B A;  3DLL F;  4G7O F;  3S2H J;  1S7O A;  2PQ8 A;  5DD4 A;  1MBJ A;  3CUQ C;  3Q3S A;  1D0X A;  2QSF X;  4OMZ A;  1Z67 A;  5HVQ C;  3Q0W A;  2K9M A;  1E0E A;  4XRS G;  3BG3 A;  3TDU C;  2PEX A;  4LIT A;  1R00 A;  2F4O B;  5FO5 A;  2LC2 A;  1ERD A;  3KEQ A;  4ZDL A;  3KLN A;  2K85 A;  2EH3 A;  3CUQ A;  1W5S A;  2L7M P;  4UVC A;  2B0L A;  4HX8 A;  2UV1 A;  2BY2 A;  1K7A A;  3HGY A;  2MLK A;  2XAS A;  2JTV A;  3ASO H;  3SZG A;  2HPI A;  1LDK B;  2WA0 A;  5HLG A;  1S9H A;  1B9N A;  1KZH A;  5DV5 A;  4KDP A;  2Q2E A;  4HLX A;  4KFC A;  3JR9 A;  4BNC A;  4IF4 A;  1XC5 A;  4EGZ A;  4LOC A;  1TZL A;  4CCL A;  2FBI A;  5DUK A;  2ZME B;  1MJ9 A;  1RR7 A;  3DKW A;  1YHQ I;  3BJ6 A;  1R4M B;  1TW3 A;  5C44 J;  3C2H A;  3KEO A;  4NB5 A;  3HUG B;  2KIQ A;  1KQ0 A;  4V19 K;  1FWZ A;  1D0Z A;  3SZT A;  4CA0 A;  3ZGK A;  2L7F P;  2BY0 A;  1OCP A;  2HTJ A;  2QKL B;  2Y0S N;  1IAW A;  4A3K J;  4HNV A;  2EIL H;  3L2R A;  3OYA A;  1GVJ A;  1Y1W J;  1MH3 A;  1OMI A;  4UNO A;  4XN3 A;  3TKY A;  2L3D A;  3WHB A;  2FQ4 A;  2JA7 J;  2KHM A;  4WXC A;  2HPM A;  2DO7 A;  2RV8 A;  3LSG A;  5J1U A;  3W2V A;  1B9M A;  3IC7 A;  1BC7 C;  1G3Y A;  2QGU A;  1QZZ A;  5EEA A;  3ZRG A;  5KVR A;  1GXQ A;  1DDN A;  2V6C A;  1WJ5 A;  5FFX A;  5EGO A;  5FGM A;  2HOA A;  3KP3 A;  3DPU A;  5D8L B;  3L2Q A;  4CIC A;  1JE8 A;  3QU3 A;  1KYZ A;  1MGT A;  3RZD J;  3HRM A;  3MN2 A;  1BR4 A;  1Y1V J;  2DK5 A;  3EUH A;  2QZ8 A;  5ED4 A;  4E7J A;  4GO1 A;  4CSW A;  3BR2 A;  2E7X A;  2YUS A;  5EEG A;  2A6T A;  3AG2 H;  4G9Y A;  2FBK A;  4B09 A;  4BU2 A;  3V7C A;  1O3T A;  3V7R A;  2VQL A;  3KFW X;  3RI4 A;  3LAJ A;  1XSV A;  1AA7 A;  1H89 C;  2P5K A;  4LG3 A;  3A1Y A;  4HX7 A;  1VQ6 I;  3K4J A;  2NVY J;  1AKH B;  1R58 A;  1W7P A;  2XC7 A;  1BW6 A;  1U6G A;  4HF0 A;  4UB6 C;  3GTJ J;  1IRX A;  3BJO A;  4U0V A;  1Y8Q B;  3L09 A;  3QPT A;  3AAF A;  2DA1 A;  4NC7 A;  3ML6 A;  3OYB A;  2CG4 A;  3BPX A;  1IV8 A;  2JSC A;  3H1C A;  2E1C A;  1YJN I;  5HNF A;  2IXS A;  2ZB9 A;  1ZLJ A;  3IHU A;  2JVH A;  3UNG C;  1YE9 A;  3DKX A;  4HQE A;  2LY2 A;  2FOW A;  4XK4 A;  2R5Z A;  4L5I A; 
#chains in the Genus database with same CATH homology
 5J8C A;  3F8C A;  1TQP A;  4LJZ F;  3H3U A;  3TDZ C;  1G4D A;  4Y17 A;  2X0L A;  2R7F A;  1DUX C;  2XV4 S;  2HOE A;  3BJA A;  4KNY A;  4M73 A;  4LD5 A;  2XKO A;  2K27 A;  2L4M A;  6PAX A;  4PDK A;  3GYH X;  1GHC A;  3DFG A;  2GAU A;  1R23 A;  1S6L A;  3IKT A;  2VBW A;  1RUO A;  3FXR A;  1O3Q A;  1MZB A;  2QYO A;  4QWQ A;  4LB5 A;  2VT3 A;  1D3Y A;  2QM3 A;  3BWG A;  2DT5 A;  1XDS A;  1FBS A;  3LST A;  2BE5 F;  1BM9 A;  3ULQ B;  3HHG A;  2ACJ A;  4CZZ A;  4UV8 A;  4RGU A;  1XCV A;  2DLL A;  1Z9C A;  3DQV C;  2HYF A;  3H92 A;  2BEO A;  1Y0U A;  5FLX K;  2L54 A;  1TBX A;  4XLP F;  4PZJ A;  1YW7 A;  2NNN A;  1CGP A;  1I6X A;  3WE2 A;  3QRF F;  2XRN A;  5F1R A;  3I54 A;  3BY6 A;  3QU6 A;  5D6F A;  4ZYH A;  4HZF A;  4CGZ A;  2GWR A;  2HKX A;  4GGG A;  5LGN A;  2BYV E;  2F5E A;  2OAZ A;  2MH2 A;  4YII A;  5LRS A;  1ON1 A;  2QQA A;  2OZU A;  5LBQ A;  3KP2 A;  4MTD A;  1I5Z A;  2H27 A;  4CYD A;  3F3X A;  1PP8 F;  5LHI A;  2KJB A;  3TGN A;  2VOO A;  3C7J A;  3BOQ A;  1G3W A;  3WTW C;  4EMS A;  3EDP A;  2FRH A;  2A07 F;  2H6C A;  3HSE A;  5L3E A;  1TQI A;  4RS8 A;  1J5Y A;  3HSF A;  3HYI A;  5FB2 A;  5JR3 A;  2PLY A;  2QQ9 A;  3F8N A;  2P6S A;  1YG2 A;  2Q8K A;  2MA3 A;  3RIR A;  1U8R A;  3T1B A;  4RGR A;  4M6Y A;  3WTZ A;  1HSJ A;  5DEQ A;  2D45 A;  2XVC A;  5E20 A;  4WCG A;  1LQ1 A;  4LK1 F;  4Y13 A;  4RB2 C;  1OYY A;  4BYY A;  5D4R A;  2DFI A;  2YX4 A;  5H20 A;  1BIA A;  2LSO A;  4YIF A;  1KYW A;  1BN5 A;  3J80 K;  5HLH A;  1R1T A;  4KYW A;  3M8E A;  3TO6 A;  1FBU A;  3RPU A;  1KU3 A;  3WGG A;  2FML A;  4ZH4 F;  5TJJ A;  1H9T A;  2M45 A;  2EV6 A;  5K5O A;  2CWE A;  4P55 A;  5CVJ A;  1R7J A;  2ELH A;  2XKP A;  3I58 A;  3VEP A;  3JW4 A;  1FSH A;  1QPM A;  3ABU A;  5IT9 Z;  1LDJ A;  4G7Z F;  3G3Z A;  1ZH5 A;  1ZLK A;  3L7W A;  5L3G A;  4R8H A;  2Y0M A;  1RI7 A;  2RKH A;  3DP7 A;  5DD8 A;  1YS6 A;  1XGS A;  1O7F A;  4Z2Y A;  2O8X A;  2XAG A;  2PG4 A;  3ZMS A;  2OU2 A;  3MFK A;  1J2X A;  3ZMZ A;  2P4W A;  4F7Z A;  4ZZD A;  1ZRE A;  1SD6 A;  1ZN2 A;  1KA8 A;  3GO5 A;  2IVM A;  1K78 A;  2VXZ A;  2Z33 A;  2D1V A;  3N4M A;  2E1N A;  5AON A;  4AIK A;  4IHT A;  4HX4 A;  2JT1 A;  2Q0O A;  4CDG A;  5H6Q A;  4NQW A;  1LNW A;  4KIF A;  1TW2 A;  4FX4 A;  3ZN0 A;  3JAM K;  1IXS B;  3R6S A;  1Z05 A;  4G7H F;  4ON0 A;  1R1U A;  5J6X A;  4KMF A;  3QP5 A;  5A2Q K;  4FHT A;  4RB1 A;  1R22 A;  3FX3 A;  5JFR A;  1IXR C;  4KIC A;  4XLN F;  2EA4 A;  2K02 A;  2FNP A;  2M1B A;  1ZHF A;  2F5F A;  5K5Q A;  4RB3 C;  3HTU A;  1V3F A;  2UXN A;  3T8T A;  3U9G A;  4KIG A;  4WWC A;  4I02 A;  4EJV A;  1TNT A;  1SD4 A;  1B59 A;  3J7A O;  4LLN A;  5JVT A;  4KA4 A;  3MZH A;  4BHP A;  4YFK F;  1Z6R A;  1KU2 A;  1Q1H A;  1SMT A;  1HW1 A;  2CFX A;  3QAH A;  1FT9 A;  2OBP A;  2FEZ A;  5JI6 A;  1XB4 A;  3MZY A;  4OIQ F;  3JAM Z;  4OMY A;  2IJL A;  2RC4 A;  1PP7 U;  3E6D A;  3HTS B;  5FD6 A;  5BPI A;  1QNT A;  2OQR A;  3D0S A;  3OOP A;  5DCM B;  1XD7 A;  4E70 A;  5A2Q Z;  2XRO A;  2VOP A;  1P6R A;  1LDD A;  2KIM A;  1UHM A;  2O6G E;  1LEB A;  2QWW A;  3ZP5 A;  1F1Z A;  1V4R A;  2HFH A;  2WTE A;  2M30 A;  3RDI A;  4ETS A;  3VB2 A;  3ECO A;  3R0A A;  4D0P A;  2YU3 A;  3BPV A;  2O0Y A;  3KE2 A;  4AWX B;  4JBA A;  5E17 F;  4RAZ A;  3LQR A;  2RNJ A;  2NRA C;  2NNY A;  2EWN A;  3O3K A;  1DPR A;  1JHF A;  4YFX F;  1YS7 A;  5ILS A;  5ICE A;  3R0J A;  2RGV A;  3GVA A;  3W6J B;  2DTR A;  4A6E A;  2A68 F;  2FQ3 A;  1I1S A;  3TOB A;  1OR7 A;  3M7G A;  1JXS A;  1QZY A;  3HUG A;  4JQF A;  3Q9V A;  4EM2 A;  1IN5 A;  4AIJ A;  2EA2 A;  1E2X A;  1SFU A;  1HST A;  4U0Y A;  1VTN C;  2GQQ A;  2FE3 A;  1AOY A;  2HS5 A;  1FYL A;  2UZK A;  4BHB A;  2WWY A;  1PDN C;  5LGT A;  1T39 A;  2CGP A;  2EFO A;  4IRG A;  1EH8 A;  5HDK A;  1PUE E;  4M72 A;  3WE3 A;  1WRJ A;  2V79 A;  2HEO A;  4Q4Z F;  3F72 A;  4A0Z A;  2W24 A;  1T6S A;  3LA3 A;  3IWF A;  3SHF A;  4HF2 A;  4M71 A;  1FX7 A;  2C6Y A;  4JK1 X;  1QO0 D;  4AVP A;  2V1U A;  3VOE A;  4KMU X;  3V8L A;  2J5P A;  1IN8 A;  2G9W A;  2MLG A;  3COA C;  3D5L A;  3E6M A;  2YSR A;  4MNU A;  3JSO A;  4A0X A;  2QEN A;  4HBL A;  1IN7 A;  3E5U A;  2PMH A;  2FSW A;  5ERI A;  5D5X B;  2HYG D;  2PN6 A;  2GA1 A;  4I0A A;  4UXN A;  2D1H A;  3WOD F;  2A69 F;  3WU1 B;  5E18 F;  1FP2 A;  4Q5S F;  2STW A;  5LRR A;  3MWM A;  4EM0 B;  5HS8 A;  4OOI A;  2K4B A;  1U5T B;  5E1X A;  1XGM A;  3IL2 A;  2KKO A;  2QQB A;  1ZRC A;  4ESF A;  5D8K B;  4KUM A;  1AWC A;  4IPA A;  2R7D A;  4GYG A;  3LWF A;  4EJT A;  2KRF A;  1R1V A;  3OV8 A;  1YIO A;  2D2W A;  4ESJ A;  5FD5 A;  1SD7 A;  1W7P B;  1O3R A;  1IXC A;  4EV0 A;  3MAJ A;  2VT2 A;  2LNB A;  2M8E A;  1SD5 A;  5E8G A;  2Y75 A;  2O3F A;  4M74 A;  4HF1 A;  2TDX A;  5HS9 A;  3R4K A;  3PQK A;  4EM1 A;  3IWZ A;  2VBY A;  2ESN A;  3M1E A;  2F5D A;  3U2R A;  4LFU A;  2VON A;  4OIN F;  4MHG A;  3ZN1 A;  3MEX A;  1MDM B;  3F21 A;  3K0L A;  2VN2 A;  4RAY A;  3T8R A;  3WTX C;  3ABT A;  2BV6 A;  2EV0 A;  1OYW A;  4R79 A;  2P7V B;  4KN4 X;  5HLI A;  2GXG A;  3V4G A;  2NS0 A;  2FBH A;  3TO9 A;  2UXX A;  3ECH A;  1RNL A;  1ZYR F;  2YR2 A;  5DYM A;  4DNC A;  1G3S A;  2FU4 A;  4XSX F;  3KZZ A;  2OA4 A;  4HYE A;  3S2W A;  2FMY A;  1FSE A;  2ESH A;  1RIO H;  1BI0 A;  1FNN A;  2L4A A;  2WC2 A;  2DPU A;  4DQ2 A;  3F22 A;  1ULY A;  2VC1 A;  3E6B A;  2DI3 A;  4MTE A;  1UST A;  1FZP B;  3GEZ A;  2H94 A;  5CVI A;  1EV7 A;  4LG0 A;  3VFZ A;  4L9T A;  2VBX A;  1I27 A;  4M6X A;  5IT9 K;  3O6B B;  4MEY F;  1P92 A;  5ICC A;  2A5Y B;  1KQ8 A;  2ZFW A;  1G3T A;  5BS6 A;  3I64 A;  4ENM A;  1HKS A;  2Z9O A;  2F5C A;  1ONV A;  1R5H A;  3RYR A;  4ZYD A;  2H09 A;  3L00 A;  4BHC A;  2W84 A;  3ZQ7 A;  1JGS A;  1UFM A;  2ZJ2 A;  5TRD A;  2P8T A;  5CVR A;  1F5T A;  2JPB A;  1L3L A;  1SFE A;  2ZKZ A;  2PI0 A;  4A0Y A;  2JZY A;  2P7C B;  1BI2 A;  4IJA A;  2ADU A;  3V7S A;  1S7A A;  5E1Z B;  3JTG A;  3I59 B;  3KCC A;  4GXO A;  1XMA A;  4A2U A;  1YFH A;  3ZMD A;  3DPT A;  4EQQ A;  4YG2 F;  3WTY C;  1BIB A;  1USS A;  2O61 A;  3TOA A;  2EFP A;  1YQA A;  3WG9 A;  3HRT A;  5DUI A;  2HKO A;  4G94 A;  2YX7 A;  2XIG A;  1KU7 A;  4GCV A;  3FM5 A;  4EVI A;  5ILV A;  4IVN A;  3HIF A;  2RQP A;  1J0R A;  1H9G A;  2ZO4 A;  1IUY A;  2Z99 A;  3C3W A;  3KP7 A;  1W7P D;  2Y48 A;  1R5G A;  4HDV A;  1ZAO A;  3F6V A;  3G73 A;  2PFB A;  3M9A A;  2J5O A;  3GF2 A;  1ZG1 A;  3J81 K;  1S29 A;  4HV6 A;  4LLL A;  2FOK A;  2IP2 A;  2FA5 A;  1R36 A;  3DXJ F;  1ZG3 A;  3LFK A;  2KIU A;  2CO5 A;  4L18 B;  2MH9 A;  4U7D A;  2CW0 F;  2QBY B;  5BQT A;  1C0W A;  4UHT A;  3SXY A;  3GFL A;  1FOK A;  3CLO A;  1T38 A;  3I53 A;  3E3V A;  2HQN A;  3N97 A;  4P5O A;  4ESB A;  2ZCW A;  2MC3 A;  2FF4 A;  1LEA A;  4LMY A;  1Z7U A;  4UVB A;  5ICG A;  5L3F A;  1W5T A;  3J81 Z;  2EV5 A;  4L0Y B;  3FXU A;  3U1D A;  3I4P A;  2RVC A;  1CF7 A;  1EH6 A;  1HW2 A;  1B4A A;  1QBJ A;  3Q9S A;  4I09 A;  2P6T A;  4LK0 F;  3FHZ A;  1P4W A;  3GWZ A;  4UV9 A;  2DPD A;  4ENJ A;  1E17 A;  4WK8 F;  1KGS A;  2QLZ A;  4L9N A;  4IRI A;  4ZYG A;  4ENK A;  5ICF A;  3SZP A;  2XAQ A;  1TNS A;  3QP6 A;  1IN4 A;  1T0F A;  2QVO A;  2DW4 A;  4PGG A;  2XAH A;  3L2C A;  4TV7 A;  1O57 A;  5LHG A;  4EJU A;  2KJC A;  1Z6T A;  1LVA A;  3WTU C;  2P5L C;  1GXP A;  2OZ6 A;  5LEJ A;  3LAP A;  4L0Z B;  3JSP A;  1X3U A;  2A3S A;  2GXB A;  2LF7 A;  4KIB A;  5BMZ A;  2BBY A;  4XBF A;  1J59 A;  3RKX A;  3L9F A;  2IA0 A;  2G7U A;  3SQN A;  5CVU A;  4O6J A;  3HSR A;  4R1H A;  2Z3Y A;  3LA7 A;  2ZME A;  5LGU A;  3IKV A;  3WTV C;  3BP8 A;  3REO A;  4I2O A;  3GUD A;  4S05 A;  2FNA A;  1HKQ A;  2P5V A;  2HGC A;  1MD0 A;  5LEK A;  2CSO A;  5FFZ A;  1OPC A;  5ILU A;  3KP5 A;  3EET A;  4G8X A;  3T5X A;  2EK5 A;  2ZNZ A;  5J8F A;  3WTT C;  2V1D A;  2ZXJ A;  3H3Z A;  2XHK A;  3GXO A;  1P4A A;  4WF2 A;  2COM A;  4IXA A;  3PFI A;  1F9N A;  5F6F A;  2HR3 A;  1ZRF A;  5L3C A;  1HW5 A;  4XRF A;  3WGI A;  4HA8 A;  3CUQ B;  1L0O C;  1XSD A;  2STT A;  2DBB A;  2VBZ A;  2CYY A;  3WU0 A;  1UCR A;  3HHH A;  3DPL C;  1FBQ A;  4I01 A;  2GIV A;  3B73 A;  2XGX A;  1U5T C;  2GZW A;  1DPU A;  3E5X A;  1WKM A;  1BI1 A;  4U88 A;  1S8N A;  5BOX A;  1F4K A;  1U5T A;  1G6N A;  3LQQ A;  2W57 A;  1QGP A;  2M87 A;  2OD5 A;  3NQO A;  5KK1 A;  1SFX A;  2HWV A;  1K79 A;  5F64 A;  4UUV A;  5IT3 A;  3K2Z A;  2PBI A;  5K1Y A;  3ELK A;  5CJ9 A;  3W6K B;  2L02 A;  1DP7 P;  5JHU A;  1NHA A;  1FC3 A;  1MKM A;  2FXA A;  3R60 A;  4HW0 A;  1RUN A;  3SFZ A;  4PGH A;  1FY7 A;  3QOP A;  3ISP A;  2EJR A;  3RPQ A;  1WSU A;  5L3D A;  4O5V A;  4HDU A;  2W85 A;  2EFQ A;  3GFI A;  2NAZ A;  3V8J A;  4AD9 A;  4N9H A;  3P7N A;  4RGS A;  1YO5 C;  4WXH A;  3FWE A;  4H0E A;  5D5U B;  5K5R A;  2DQL A;  3MQ0 A;  1TQM A;  2X4H A;  4Q47 A;  1BI3 A;  3V8K A;  1MDM A;  4M9X A;  4BAY A;  1D8J A;  2HQR A;  2IRF G;  2V9V A;  5AIQ A;  4I7H A;  3M8F A;  1U78 A;  4P9F A;  1U3E M;  2AS5 F;  3GFJ A;  4QLC U;  4BH9 A;  1XSX A;  4KT5 C;  2NYX A;  3B02 A;  1XGN A;  1HBX G;  2E7W A;  1HKT A;  1ON2 A;  1WI9 A;  5LLQ A;  5E1W A;  5HOO A;  1UHW A;  1T2K A;  3CDH A;  3HRU A;  3FM3 A;  4OU0 A;  4A5M A;  3CO6 C;  1U2W A;  5AIP A;  2ISZ A;  3GZ5 A;  1H0M A;  1FYM A;  1BOA A;  4L9J A;  3CO7 C;  1FLI A;  1HQC A;  1XN7 A;  1J9I A;  4N9I A;  4G6Q A;  4LLG F;  5LHH A;  4A5N A;  3C1D A;  4HAM A;  1STZ A;  3GX4 X;  1IRF A;  3GW2 A;  4A6D A;  1ZAR A;  3I5U A;  4NHJ A;  4FX0 A;  2A61 A;  3F8M A;  1Z1D A;  5E8I A;  2CQK A;  4OIR F;  3I71 A;  1FPQ A;  3LA2 A;  2OQG A;  4Y15 A;  4U0W A;  3GLX A;  3FF5 A;  2DAO A;  3I59 A;  2VC0 A;  1TLH B;  1MJA A;  1LJ9 A;  2HTS A;  5HS7 A;  4IRH A;  4UVA A;  1YLF A;  1OYI A;  1IN6 A;  3NRV A;  5FLX Z;  2IA1 A;  3Q5F A;  2F2E A;  1D5V A;  1IZ1 A;  3IRR A;  4OIP F;  3KLO A;  4KN7 X;  4LG0 B;  3DV8 A;  4XSZ F;  2IT0 A;  3FZV A;  5BPD A;  4BQA A;  4MQV A;  4LGW A;  3HOS A;  2V1X A;  3DF8 A;  4MGR A;  2RDP A;  4ZZL A;  3HOT A;  2K4J A;  3DEU A;  1I1G A;  1EH7 A;  1XCB A;  4OIO F;  4ASN A;  4AIH A;  4HQM A;  1YYV A;  1XGO A;  4ENN A;  2IPQ X;  2K86 A;  3ERE D;  4B8X A;  2IA2 A;  1QQI A;  3FMQ A;  3KP6 A;  4K2E A;  3BRO A;  5D5V B;  3O2P E;  4FT8 A;  4M9S A;  3GFM A;  2UWM A;  3HRS A;  1SAX A;  3K1M A;  4Q48 A;  3ZPL A;  1XMK A;  4L9V A;  2K7L A;  3F6O A;  3RKW A;  1BBY A;  1OKR A;  1WQ2 A;  3CTA A;  2ZBK A;  3ZMV A;  4A12 A;  2O03 A;  3KET A;  4HV5 A;  4CHU A;  2A6E F;  2QBY A;  1ZRD A;  2W25 A;  1D8K A;  3EYI A;  3WGH A;  3J80 Z;  2QUF A;  5DDG A;  2XAF A;  3P9C A;  1K6O A;  3K69 A;  2M5W A;  4RGX A;  5CVV A;  3FXQ A;  3F23 A;  1SMY F;  2XUB A;  3KZY A;  2GA2 A;  2Z5U A;  1FYK A;  2EFN A;  4CXF A;  2PJP A;  2A6H F;  3GZ6 A;  4WXD A;  1FP1 D;  2MBF A;  5CLS A;  2R3S A;  1XDU A;  3F8F A;  3IRQ A;  1K78 B;  2G7H A;  4MQ9 F;  1KQ9 A;  4GYI A;  2PMU A;  4ZYE A;  4IHS A;  1YTY A;  3EQL F;  3QPH A;  1Z91 A;  5DCF A;  1IW7 F;  4EJO A;  1S3J A;  2XAJ A;  5L3B A;  3C18 A;  1REP C;  3KP4 A;  2ETH A;  3BZ6 A;  3RTR A;  5D4S A;  3F8B A;  2VE9 A;  1P2F A;  1UB9 A;  5CYV A;  5DCM A;  3I0T A;  2EB7 A;  4I98 B;  1JHH A;  3TO7 A;  2LDU A;  1YW9 A;  2LF8 A;  2HDC A;  5H6R A;  2DU9 A;  4LB6 B;  1IRG A;  1J75 A;  2RN7 A;  1P4X A;  5D6E A;  3NEU A;  2DQR A;  1ZGJ A;  4EGY A;  5D5W B;  3FMS A;  2IW5 A;  2YPR A;  3RYP A;  1BC8 C;  2JRT A;  3PQJ A;  1J7K A;  3E6C C;  4HLY A;  1LB2 A;  2VOD A;  2EFW A;  1O3S A;  1KU9 A;  2MD5 A;  1HXD A;  4I0B A;  2ISY A;  2H6B A;  2LKP A;  4HOB A;  1YW8 A;  3T0Y A;  4P96 A;  3E97 A;  1CF7 B;  3P9I A;  3R61 A;  4BXU A;  1W4M A;  4RB0 A;  2BGC A;  4S04 A;  3K9T A;  3ZMU A;  5HDN A;  3BDD A;  3MCZ A;  2AXL A;  1O7L A;  4G6D A;  3JTH A;  4WX9 A;  3CJN A;  1A04 A;  4MEX F;  3K1N A;  2KIF A;  5EEH A;  3E5Q A;  4M9Z A;  1BJA A;  2ZNY A;  1MJB A;  3RKY A;  4L5J A;  1ZG5 A;  2DK8 A;  2L01 A;  3RJP A;  1RZ4 A;  3CUO A;  3ROU A;  4YFN F;  4P9U A;  2WV0 A;  3EYY A;  3FMR A;  4PCQ A;  3WTS C;  3P9K A;  1ZGA A;  3ZMT A;  4EJW A;  2HZT A;  3TQN A;  4N0B A;  3K1P A;  1T98 A;  2VE8 A;  1B6A A;  4O3M A;  1ODD A;  1TTY A;  1IF1 A;  2JPC A;  3VOD A;  1WWX A;  5HDG A;  4CO8 A;  1B1B A;  4U7B A;  4G7O F;  1S7O A;  2PQ8 A;  5DD4 A;  4OMZ A;  3CUQ C;  5HVQ C;  3TDU C;  2PEX A;  1R00 A;  5FO5 A;  3KEQ A;  3KLN A;  1W5S A;  3CUQ A;  4UVC A;  2B0L A;  4HX8 A;  1K7A A;  2MLK A;  2XAS A;  2JTV A;  1LDK B;  5HLG A;  1B9N A;  5DV5 A;  4KDP A;  2Q2E A;  4HLX A;  4KFC A;  4BNC A;  4IF4 A;  4EGZ A;  2FBI A;  5DUK A;  2ZME B;  1MJ9 A;  3DKW A;  3BJ6 A;  1TW3 A;  3KEO A;  4NB5 A;  1KQ0 A;  1FWZ A;  3SZT A;  2HTJ A;  1IAW A;  1GVJ A;  1OMI A;  4UNO A;  3TKY A;  2L3D A;  4WXC A;  2DO7 A;  2RV8 A;  1B9M A;  3IC7 A;  1BC7 C;  1G3Y A;  1QZZ A;  5KVR A;  1GXQ A;  1DDN A;  2V6C A;  5FFX A;  5FGM A;  3KP3 A;  5D8L B;  4CIC A;  1JE8 A;  3QU3 A;  1KYZ A;  1MGT A;  3HRM A;  5ED4 A;  3EUH A;  2DK5 A;  2QZ8 A;  4GO1 A;  2E7X A;  5EEG A;  4G9Y A;  2FBK A;  4B09 A;  3V7C A;  1O3T A;  3V7R A;  3KFW X;  3RI4 A;  3LAJ A;  1XSV A;  2P5K A;  4HX7 A;  1R58 A;  1W7P A;  1U6G A;  4HF0 A;  3BJO A;  4U0V A;  3L09 A;  3QPT A;  3AAF A;  3ML6 A;  2CG4 A;  3BPX A;  2JSC A;  2E1C A;  1ZLJ A;  3IHU A;  4HQE A;  4L5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...