2ETHA

Crystal structure of a marr-like transcriptional regulator (tm0816) from thermotoga maritima at 2.50 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
HMDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVEALSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator, putative, Mar family
publication title Crystal structure of Transcriptional regulator, putative, MAR family (tm0816) from Thermotoga maritima at 2.50 A resolution
rcsb
source organism Thermotoga maritima
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ethA00
2MLKA 4AVPA 4E70A 3BY6A 5J6XA 4WXHA 2GQQA 1OKRA 1TQIA 3DV8A 3E3VA 2JSCA 2HOEA 2M87A 2OU2A 1MDMA 2PLYA 3T0YA 3LAJA 4P55A 5DUKA 3HIFA 1J5YA 3R61A 4RAYA 2EV5A 3EETA 3LAPA 1OYWA 1PP8F 1J2XA 2JT1A 1IF1A 1IN6A 2RGVA 2HDCA 3HRTA 2ZBKA 2YU3A 4Z2YA 4IF4A 2UZKA 1B4AA 3QP5A 3ELKA 3T1BA 2UXXA 3V7CA 1P4AA 1LVAA 3WTZA 3QAHA 3E6DA 3MFKA 4MEYF 1IAWA 4L9TA 2VXZA 2CYYA 1K7AA 1MGTA 3EYIA 3I59A 2W25A 5IT9K 2PMUA 4HBLA 2IPQX 1ZLJA 1SD6A 3BP8A 1SD4A 1TNTA 2QQBA 5BQTA 4WCGA 4IRHA 5JFRA 1B9NA 4A5MA 2X0LA 4LB6B 4I09A 2WWYA 4Y13A 2RC4A 3SZPA 5KK1A 1R5GA 2Y75A 1HW5A 5EEHA 2V9VA 5CVUA 3IL2A 4KICA 2DPDA 3U2RA 2UXNA 3HSFA 3DPTA 3I71A 1SMTA 2Q8KA 5IT3A 3ERED 3RKXA 4RGRA 3ULQB 1FY7A 4G7OF 3OV8A 4GYIA 3WGHA 5DD4A 4FX0A 2D2WA 1DUXC 2BGCA 4PDKA 3E6BA 1C0WA 3KP3A 4WF2A 4PGHA 4HDUA 1SD7A 4MTDA 3MZHA 1I5ZA 1W5TA 4HLXA 4M9SA 4CHUA 1MZBA 2ESNA 3D5LA 3VFZA 2CFXA 2O03A 4TV7A 2RN7A 3ZMUA 1CGPA 1O57A 2EA4A 4G9YA 3BZ6A 5ILVA 3K1MA 2W85A 4R79A 3HHHA 2P7CB 1R1UA 2D45A 2XAJA 5CLSA 5L3CA 5DCFA 1XGMA 1IN5A 1ON1A 4UVAA 2OBPA 5JI6A 1V3FA 3ABUA 5E8IA 4CGZA 1ZGJA 3VOEA 3I58A 3WGGA 2ZMEB 1FYKA 3GW2A 1IRGA 2ZXJA 3CUQC 2NYXA 4EGYA 2FMYA 4EJOA 1PP7U 3BOQA 1YW8A 5HS8A 3IC7A 3V8JA 1QZYA 3GF2A 4KIBA 3U1DA 1ZGAA 2BEOA 2HKOA 2YPRA 2BYVE 1ZRFA 2EFPA 1CF7B 3FWEA 4ESFA 2OD5A 3FMSA 2MBFA 3DKWA 1ZRDA 1Z7UA 1HBXG 3QP6A 3CTAA 2VC1A 2HZTA 3F8MA 4ZYHA 4UVCA 3TDZC 2O0YA 1A04A 4GCVA 3W6JB 2PFBA 3F8NA 5TRDA 1FYLA 4UHTA 1FNNA 1XDSA 1BI2A 4M73A 3WU0A 4Q5SF 4M72A 4HX7A 2KJCA 2W24A 2KIFA 4JK1X 1G6NA 5D5UB 3WTXC 1U5TC 4EMSA 4XBFA 1JGSA 3FXUA 3EYYA 1XD7A 2VONA 3E97A 4Q48A 3ZPLA 1LDJA 2FBHA 1FC3A 4HQEA 1K6OA 1IXSB 4MGRA 1EH8A 4M6XA 4ENKA 2PN6A 2GA2A 4HOBA 4RB1A 1ZRCA 2MA3A 2ETHA 2E7WA 1XDUA 1YTYA 4L5IA 3GZ6A 3TOAA 2L4MA 3LQQA 3HTSB 3E6MA 1WSUA 1RZ4A 1YS6A 5ILSA 4BH9A 1W7PB 4NB5A 3P9CA 2K4JA 3GZ5A 3R0JA 4ETSA 1Z1DA 1AOYA 1BBYA 5HS9A 2EFWA 5CJ9A 1TW3A 4KFCA 3M9AA 2KIUA 2FMLA 4L0YB 1P4XA 2K7LA 2EJRA 2Z33A 4JQFA 3K2ZA 1WWXA 2P8TA 1GXQA 1FSHA 1X3UA 2A61A 2FRHA 1RNLA 2V1XA 3Q5FA 3HSEA 1LB2A 2EA2A 3WTSC 3CUQB 2XAFA 3KE2A 4EM2A 3J81Z 1G4DA 2JTVA 2EV0A 1FYMA 2X4HA 1P92A 3LSTA 4LJZF 2VBZA 1LEBA 1D5VA 4HAMA 3F22A 2HS5A 4IXAA 4UUVA 4ZZLA 2OA4A 1XGOA 5F6FA 3TDUC 5K5OA 1S7AA 2QQAA 1FT9A 4BNCA 2XIGA 1QO0D 3MWMA 4HX8A 2EK5A 2H94A 4NQWA 3QPHA 1R36A 3CLOA 4IRIA 1F5TA 3KP2A 1BC7C 4BQAA 3VB2A 4U7BA 2PMHA 4FT8A 2DU9A 3ZQ7A 4HQMA 5TJJA 1O3SA 1XSDA 2VOOA 1BC8C 4L9NA 4G6DA 2GAUA 1ONVA 4A6EA 4LB5A 2ZCWA 2JPCA 3L2CA 1QNTA 2CG4A 4L9JA 4N9IA 2STWA 2DO7A 3PFIA 4AWXB 5D5WB 1YS7A 2XVCA 4LK0F 1CF7A 3F23A 2QQ9A 1B9MA 2F5EA 1HW2A 2MH2A 2DK5A 2WC2A 3ZMTA 2ZJ2A 3O3KA 4HYEA 4WXDA 3JAMZ 4A12A 2YR2A 3E5XA 3F8FA 5FFZA 5CYVA 1D8KA 2JZYA 3WGIA 1T38A 2BBYA 2DQLA 2VBXA 4N9HA 2XAGA 2FA5A 1WI9A 1OMIA 4YFKF 1MD0A 1P2FA 2PQ8A 4O5VA 4HLYA 1B59A 1BM9A 2VOPA 1FPQA 2FNPA 2GXBA 3IKVA 1IN4A 4MHGA 5A2QZ 5FO5A 2DI3A 4M9XA 4XSZF 1FWZA 5FLXK 3K9TA 1R58A 4RAZA 1RUNA 2E7XA 3KEOA 2K4BA 3KZYA 3J80K 1J9IA 2ISYA 4M9ZA 2O6GE 4FHTA 2QBYB 3I64A 1OYIA 2STTA 2K86A 3LFKA 3FM3A 5E1ZB 4AIJA 3R6SA 1FZPB 1TBXA 5L3EA 3F8CA 3I53A 1R1TA 2ZFWA 1T0FA 2Y48A 1I1GA 5K5RA 4OOIA 2QUFA 2RVCA 1XMAA 3F6VA 1E2XA 2CW0F 4UNOA 2IJLA 3HTUA 1W7PA 1ZAOA 3GXOA 2M1BA 4PCQA 2DLLA 2PEXA 4KDPA 3ZMZA 3QPTA 2K27A 5D5XB 1RIOH 3K1PA 3COAC 3BPVA 2DQRA 2O3FA 4HX4A 4LG0B 3ZN1A 5EEGA 4YG2F 5FGMA 3GLXA 3D0SA 4MNUA 4PZJA 2IA2A 1S8NA 3R4KA 3HRSA 1K78B 2EFNA 5F1RA 3WU1B 3ISPA 1BN5A 1G3TA 1S3JA 3RYPA 5LHGA 5L3DA 4KT5C 1KQ9A 3R0AA 2F5FA 5HDGA 3CUQA 5ICFA 1KA8A 1XSVA 3M8FA 2NS0A 4QLCU 5J8FA 1HKQA 1LJ9A 3MAJA 1WKMA 5CVVA 2FNAA 4BHCA 2Q0OA 4KMUX 4Y15A 4LGWA 2VBWA 2DFIA 1G3SA 4WK8F 3K1NA 1YLFA 4P96A 4LMYA 5LHIA 4IRGA 4EJWA 1UHWA 2RKHA 5BS6A 2CWEA 2KKOA 3KZZA 4LLGF 1YIOA 4IVNA 1PDNC 2FE3A 2A6HF 3RDIA 2QLZA 4EV0A 3Q9VA 3GWZA 2HTSA 3CO6C 1JHFA 2Y0MA 1YO5C 2EV6A 4A6DA 3GUDA 1O3QA 3RI4A 4GXOA 2GA1A 4ESBA 5HVQC 1KQ8A 4DNCA 3H92A 4MQVA 1EH7A 4KIFA 1QZZA 3M1EA 3ZMDA 2EWNA 1U5TA 2GWRA 3L7WA 1I1SA 3V7RA 2DK8A 2EFOA 1KGSA 3ML6A 3E6CC 2NNNA 3DFGA 5LRSA 2A69F 2K02A 3ECHA 3FF5A 1D3YA 1YW7A 4MTEA 1ZREA 1I27A 2L4AA 1HKTA 4EM1A 1EH6A 1ZARA 2Z9OA 4M74A 1ULYA 4G6QA 3FM5A 4DQ2A 4HW0A 2W84A 3VODA 3TKYA 1SMYF 4I0AA 3BROA 5D6FA 4KN4X 3IKTA 2PJPA 5ERIA 2CGPA 4L5JA 5KVRA 2HTJA 2L02A 3NEUA 1TQPA 3LA7A 5HS7A 2GXGA 2ZKZA 2HQRA 2W57A 4OMZA 3RPUA 3FXRA 2LDUA 2Z99A 2C6YA 3GFIA 4WX9A 3ECOA 4HF0A 5DCMB 3PQKA 2IW5A 4KUMA 1P6RA 1YYVA 3L09A 1W4MA 3FZVA 2KJBA 4GGGA 2XKPA 1GHCA 3WTUC 5E20A 4OIOF 3IRQA 3F72A 4Q4ZF 4M6YA 4LK1F 3GFJA 5AIQA 2VE8A 3QU3A 4BHBA 5F64A 1JHHA 3O6BB 4RGSA 2XAQA 3DP7A 3FMQA 3WE3A 1TQMA 5D4SA 1WRJA 3WG9A 2ZNZA 2ZO4A 4EM0B 4L9VA 2AS5F 2XGXA 1O3RA 1PUEE 1Y0UA 4O3MA 3FX3A 1WQ2A 3HYIA 1Z6TA 3V8LA 2WTEA 1U3EM 3FHZA 3QU6A 4LG0A 2JRTA 4NHJA 5IT9Z 4I0BA 3EUHA 1SAXA 1MDMB 1ZH5A 1FLIA 5K1YA 1P4WA 1F9NA 2J5OA 1HKSA 3IWFA 4YIFA 2A3SA 3GFLA 1KQ0A 1LEAA 2A6EF 2ELHA 2VN2A 2HKXA 1K78A 1DDNA 1U6GA 2MLGA 4R8HA 4UV9A 1LNWA 5BPIA 2RV8A 1IRFA 2FOKA 1IXRC 5DUIA 5JVTA 4QWQA 3I4PA 3M7GA 4XSXF 1H9GA 4HDVA 4IHSA 1MKMA 5H20A 5FD6A 2D1HA 4RB3C 1T2KA 3R60A 2FSWA 3KP6A 2YSRA 3L9FA 3DQVC 1XGNA 2M30A 4P9FA 1ZYRF 5JR3A 5CVIA 1BIBA 3KLOA 4PGGA 1T98A 2TDXA 4CXFA 1FBUA 1TLHB 2FBIA 1R7JA 3C18A 4HV6A 2H6BA 1T39A 2P6SA 4R1HA 4ZYDA 2FF4A 2R3SA 3C1DA 2XV4S 2DBBA 3HOSA 3BWGA 2PG4A 1Q1HA 5LGTA 3LQRA 3M8EA 1HSJA 4KIGA 5L3BA 1Z9CA 4CO8A 2HQNA 1IXCA 3TOBA 3SFZA 1YFHA 3H3UA 2HGCA 1FP1D 1J59A 4O6JA 4RGUA 4A0ZA 1B6AA 2IRFG 3GYHX 2XAHA 3OOPA 5LRRA 1IN8A 1OPCA 5ICGA 2EFQA 3C7JA 1H0MA 3E5QA 3DPLC 2PBIA 1HXDA 1ODDA 4A2UA 1W7PD 3AAFA 2FEZA 2OZUA 2Z3YA 2P5VA 2WV0A 1BI0A 5E1WA 3F21A 1W5SA 3P9IA 2ZMEA 3B02A 4S04A 2HWVA 3JTGA 2MH9A 1S29A 2LKPA 4LFUA 3T5XA 4P5OA 4H0EA 1U2WA 3HOTA 1STZA 1SFEA 1OYYA 3Q9SA 4ZYEA 2G9WA 1XCVA 2UWMA 4YIIA 1SFUA 2LF8A 2FXAA 4I02A 1HW1A 3MZYA 4HF1A 1BOAA 5BMZA 1H9TA 4G94A 2DPUA 4EVIA 1MJAA 1GXPA 1TW2A 2LNBA 3CO7C 5L3GA 3WODF 5E18F 1OR7A 3IWZA 1ZLKA 2F5CA 1USTA 4IPAA 3V8KA 5LHHA 2ISZA 3N4MA 1IN7A 2VT2A 1O3TA 4ENMA 3F3XA 4L0ZB 5DV5A 4GYGA 4LD5A 3WTVC 1K79A 2OAZA 3S2WA 4FX4A 3REOA 5HDKA 1I6XA 5HDNA 1XMKA 4CZZA 4BXUA 3JSPA 2V79A 1U78A 5CVRA 2IVMA 3K0LA 2LSOA 2RQPA 2XASA 4OU0A 4AD9A 5HLGA 4ZYGA 4YFXF 2F5DA 4HV5A 3ZMVA 4GO1A 3CJNA 4IHTA 5D8LB 2FQ3A 3G73A 3T8TA 4P9UA 1G3WA 2PI0A 3RJPA 1R22A 5BPDA 2A68F 2ZNYA 2E1CA 1SD5A 1UCRA 1S7OA 3NQOA 2D1VA 4KMFA 2A5YB 4Q47A 2R7DA 4AIKA 1O7FA 3L00A 3DEUA 3WTTC 2BV6A 4XLNF 3JSOA 3FMRA 4RB2C 1IUYA 2COMA 4G7ZF 4U88A 1G3YA 3TO9A 2OQGA 1FSEA 5ILUA 4YFNF 1TTYA 4I98B 3FXQA 5FFXA 3HSRA 3CUOA 2DW4A 5LLQA 1HSTA 1USSA 1FOKA 4M71A 1F4KA 2P5LC 2ADUA 2IA1A 1REPC 2HYGD 2V1DA 3BJOA 5AIPA 3BDDA 4Y17A 3MQ0A 4U0WA 5HLHA 4KYWA 4BHPA 1QBJA 2NNYA 2IP2A 5D4RA 1ZG1A 4ZZDA 1ON2A 2M5WA 3J7AO 1Z6RA 1UB9A 3LA2A 4HA8A 4EJVA 4EGZA 4S05A 2DTRA 1V4RA 5BOXA 2Z5UA 1AWCA 3RIRA 4UV8A 4L18B 5LGUA 1FBQA 1DP7P 2G7UA 3SQNA 1XSXA 3SXYA 4RS8A 3I5UA 2RDPA 4I01A 3WTWC 3ZN0A 1BIAA 2V6CA 4KA4A 2A07F 4JBAA 1BI1A 5HOOA 1J0RA 4U0YA 3J81K 4B8XA 1XGSA 1SFXA 2ACJA 3TO6A 4EJUA 4KNYA 1UHMA 3DF8A 3G3ZA 3I0TA 3KFWX 2DAOA 3LA3A 1JE8A 4OIPF 3RKYA 4LLNA 1YQAA 3KETA 4BAYA 1ZHFA 5DYMA 2CQKA 3KP7A 2XRNA 2VC0A 3EDPA 1ZN2A 1ZG3A 6PAXA 5FB2A 5DD8A 3WE2A 2YX4A 3GEZA 5E1XA 3JW4A 3ZP5A 3GVAA 4XRFA 1QPMA 3KP5A 1XCBA 1E17A 5H6QA 2F2EA 3C3WA 4HZFA 1J7KA 4U0VA 4F7ZA 2XROA 1TNSA 2LF7A 5AONA 5FLXZ 2VBYA 1BJAA 3CDHA 4I2OA 3GO5A 2R7FA 3J80Z 1R1VA 1XB4A 2QBYA 1QGPA 4B09A 3JAMK 2M8EA 2QWWA 4XLPF 2M45A 5D8KB 3TO7A 4A0XA 5H6RA 3GFMA 1QQIA 3VEPA 4D0PA 2V1UA 5E17F 3ROUA 5CVJA 2O61A 2HR3A 5JHUA 2IA0A 1U8RA 4OIRF 5A2QK 3HRUA 1ZG5A 4IJAA 2G7HA 2XHKA 5L3FA 3LWFA 3NRVA 2NAZA 3KP4A 3KCCA 2J5PA 1KU3A 3ZMSA 2P7VB 1J75A 2H27A 3QOPA 2OQRA 2P6TA 1LDKB 5LEKA 4RB0A 4UVBA 2EB7A 4ASNA 5DEQA 4G7HF 3PQJA 1VTNC 1KYWA 4BYYA 2QENA 4KN7X 1KU9A 4A0YA 3P9KA 2AXLA 1LQ1A 2L01A 2NRAC 4OINF 2HFHA 1B1BA 1FBSA 4EQQA 2H09A 3SZTA 2P5KA 2QYOA 5K5QA 2P4WA 3SHFA 3EQLF 5D6EA 1Z05A 2BE5F 2MC3A 2L54A 3TGNA 3I59B 4G8XA 3RPQA 1KU7A 4N0BA 4CICA 3H3ZA 3RKWA 1JXSA 2KIMA 3T8RA 2RNJA 4WWCA 1KU2A 5ED4A 1DPRA 1Z91A 1FP2A 2O8XA 2MD5A 4CDGA 2E1NA 3F8BA 4MQ9F 3RYRA 3O2PE 4ESJA 5E8GA 2L3DA 1L0OC 2QVOA 1FX7A 1R23A 3KEQA 2ESHA 4AIHA 5ICEA 1LDDA 2IT0A 2FU4A 3IHUA 2DT5A 1R5HA 5J8CA 4K2EA 1MJ9A 1MJBA 3JTHA 5LBQA 3RTRA 3N97A 4LLLA 5D5VB 5DDGA 4EJTA 4CYDA 3U9GA 1YG2A 5FD5A 2OZ6A 2CO5A 4WXCA 3V7SA 4ZH4F 3W6KB 4ENNA 2VODA 1XN7A 1L3LA 3BJ6A 3K69A 3MCZA 1DPUA 3P7NA 4MEXF 2H6CA 3GX4X 1D8JA 3HRMA 3KLNA 3BPXA 1YW9A 2Q2EA 1UFMA 3TQNA 2HYFA 1T6SA 2QZ8A 2GIVA 1IZ1A 1EV7A 1U5TB 1RUOA 3WTYC 1S6LA 2B0LA 1R00A 2CSOA 3QRFF 5LGNA 5HLIA 4A5NA 5DCMA 1O7LA 1NHAA 3I54A 5ICCA 4RGXA 3MEXA 4HF2A 3F6OA 3BJAA 1GVJA 2VT3A 3IRRA 4ENJA 2KRFA 2QM3A 3HHGA 2GZWA 1HQCA 2JPBA 3DXJF 4I7HA 4U7DA 1RI7A 4OMYA 4UXNA 4OIQF 2FBKA 1KYZA 2HEOA 3B73A 3V4GA 1F1ZA 3E5UA 2VE9A 5LEJA 2YX7A 2XUBA 3HUGA 2XKOA 1IW7F 3ABTA 4ON0A 1BI3A
chains in the Genus database with same CATH superfamily
2W82A 2MLKA 4AVPA 4BJTA 4E70A 3W2VA 2P0WA 3BY6A 4C3IJ 3OYHA 5J6XA 4WXHA 1Y8RB 2OV7A 2GQQA 2E19A 1OKRA 3PSIA 4M3GA 4ZJZA 3BG7A 1TQIA 3PNYA 3CMYA 1EKEA 4BQQA 1V54H 2DFHA 3DV8A 3E3VA 2Q1ZB 2JSCA 2LR8A 2HOEA 3CCRI 2M87A 2OU2A 1MDMA 2PLYA 3T0YA 3LAJA 2EIMH 4BQNA 3BG5A 5KAFC 2IGOA 4P55A 2HXIA 3E0JB 2KT0A 5DUKA 3HIFA 1J5YA 2M3AA 2WAFA 3R61A 4RAYA 3FK7A 2QSFX 1X19A 4YEJA 4DYRA 2EV5A 3EETA 3LAPA 1OYWA 1PP8F 2BW3A 1J2XA 1A5JA 1WGXA 2HVSA 4BXXJ 4XM3A 2JT1A 2BVLA 2VKEA 1IN6A 3X2QH 1IF1A 5IYDJ 2LK2A 2RGVA 2HDCA 2BY3A 3HRTA 1NTCA 1LKXA 4XIDA 4B48A 1WJBA 2ZBKA 2YU3A 4Y4RA 2DMTA 3LL7A 1JTXA 5J1YA 1ZK8A 4Z2YA 4D7NA 4IOAF 4IF4A 2UZKA 1B4AA 3QP5A 2JVHA 3ELKA 1HDDC 4AIDA 3T1BA 2UXXA 3V7CA 3L2UA 1POGA 3OR2C 1P4AA 2IS1A 1LVAA 3MVPA 3WTZA 2HQ5A 3QAHA 2XF7A 3E6DA 4YIRX 4DZJA 3MFKA 4MEYF 1IAWA 2NS7A 3I4MJ 2VL8A 1I50J 2F48A 4L9TA 2VXZA 4BEHB 2CYYA 4QSHA 1QHGA 3A01B 3RZOJ 1K7AA 2JK3A 1MGTA 4RLFA 2Y69H 5B3SH 3EYIA 2EPFA 3I59A 2W25A 5IT9K 2PMUA 1BW5A 4HBLA 2IPQX 2JMWA 2NVTJ 1ZLJA 1SD6A 3BP8A 3GLLA 4IQ4A 1SD4A 1TNTA 2DOAA 3KPHA 2QQBA 3EPZA 5BQTA 4WCGA 4IRHA 1W0UA 1WI3A 2EINH 5JFRA 1B9NA 4A5MA 2X0LA 4JYKA 2EH3A 1VQKI 1YX5A 1HA8A 2M9HA 4LB6B 4I09A 2CFOA 2WWYA 3ERMA 4Y13A 2RC4A 3ONQA 2VJIA 4CSWA 3SZPA 3BG9A 5KK1A 1R5GA 2Y75A 1APLC 1HW5A 5EEHA 2Z1DA 2V9VA 3D5RC 5CVUA 1U9OA 3IL2A 4KICA 4PFPA 2DPDA 3U2RA 1S72I 1JUMA 2OC6A 2KP6A 2UXNA 2CW7A 2WAQA 3LFUA 3HSFA 3ESWB 4XKVA 3DPTA 3BR5A 1SMTA 3I71A 1VQ6I 2Q8KA 5IT3A 3ERED 5IYBJ 3RKXA 4IOCF 4RGRA 3ULQB 1FY7A 2Y0SA 4G7OF 1KONA 3OV8A 4GYIA 3O8HA 3HOYJ 3WGHA 1JT6A 1Z21A 5DD4A 4FX0A 5M5WJ 2LH9A 3H5AA 4DW6A 2D2WA 1RPWA 2KL4A 1OCPA 2BGCA 1DUXC 1P9QC 4PDKA 2LMDA 3K7AJ 3E6BA 4PJJA 1C0WA 3KP3A 4WF2A 4E7LA 3AG2H 1I3AA 1ETQA 4PGHA 5F0FA 4HDUA 2HPIA 1T0FC 3MD2A 3LSRA 2M8GX 1SD7A 4MTDA 3MZHA 4FASD 1I5ZA 4ITVA 2M34A 3BTIA 1W5TA 4HLXA 5FLVA 4M9SA 4XR6A 4CHUA 1MZBA 1JJ6C 2XSDC 1Z7LA 2ESNA 3ZXSA 3K4LA 1JKQC 4UUSB 3D5LA 3VFZA 2DJIA 3ZGKA 2PMZA 2CFXA 2O03A 4TV7A 4PUSA 2RN7A 2BOLA 3ZMUA 1CGPA 1O57A 5EGOA 2EA4A 3RCOA 4G9YA 3BZ6A 5ILVA 2R7OA 5JLWA 2Y9YA 3K1MA 2W85A 4R79A 3HHHA 2WV1A 2P7CB 1R1UA 4CCJA 2D45A 4HNUA 3LMMA 2DN0A 2XAJA 3E1SA 3OYBA 3G1MA 2Y31A 5CLSA 5E3OA 3HB9A 5DCFA 3A1YA 2HYJA 5L3CA 2IS4A 5F1JA 1XGMA 1ERDA 3B6CA 1IN5A 1ON1A 3H9GA 4UVAA 2OBPA 5JI6A 3D5SC 4KT6A 1V3FA 4PSWA 3ABUA 5E8IA 1Z9CA 4DJAA 4CGZA 4NBQA 4MO7A 1SAUA 1ZGJA 3VOEA 5C44J 3I58A 3OMYA 2WA0A 2ZMEB 3WGGA 3CCLI 2F6CA 1FYKA 3GW2A 4G6TB 1UG2A 2D5VA 2PJRB 1IRGA 1S7EA 2ZXJA 3W3CA 3CUQC 4XKWA 1QU3A 2NYXA 2FMYA 4EJOA 4EGYA 1PP7U 3BOQA 1YW8A 5HS8A 2X1EA 3IC7A 3V8JA 1QZYA 3GF2A 2OTLI 4KIBA 3U1DA 4MLOA 4BS9A 1ZGAA 2BEOA 2DOFA 2HKOA 2YPRA 2BYVE 1ZRFA 2TCTA 2EFPA 1CF7B 3FWEA 4ESFA 4A3FJ 2OD5A 4CCKA 4BU2A 3FMSA 4AYBA 2GOXB 4A69C 1KZHA 2MBFA 4ZDLA 3DKWA 3ZOBA 2X6OA 1ZRDA 4RA2A 1Z7UA 1H89C 4FISA 2X1DA 3M4OJ 1HBXG 4XL9A 3QP6A 4NNJA 2LVSA 3CTAA 1QA6A 3WG7H 2VC1A 2HZTA 4HG2A 2EIJH 1FIAA 3F8MA 2GIZA 4M3BA 4ZYHA 4UVCA 3TDZC 2O0YA 2BXZA 1A04A 4GCVA 3L2QA 3GTGJ 1ETYA 3W6JB 2PFBA 2IS2A 3W6VA 3F8NA 5TRDA 4A3KJ 1FYLA 3QWLA 3K4JA 4UHTA 1FNNA 4HPQA 1XDSA 1BI2A 4M73A 3WU0A 5IYCJ 4Q5SF 4M72A 4HX7A 2KJCA 5KCMA 5TISC 5EZHA 2QEXI 2M2EA 2VIXA 1OJLA 2F4MB 2ECBA 3HGGA 3LSJA 2W24A 2KIFA 3PNVA 3QYFA 3HBLA 3OSGA 2ZC2A 3PUBA 2K85A 4JK1X 1G6NA 5D5UB 2BY1A 3H9QA 3WTXC 4PK4A 2VKDA 2W7NA 1U5TC 3J7YJ 4EMSA 3S32A 4XBFA 2E36A 1JGSA 3OYNA 3FXUA 5F04A 2CQQA 2KRCA 3EYYA 1R49A 3WHCA 1XD7A 4F93B 3S2HJ 3I55I 3IH4A 2VONA 2CUJA 2CU7A 3E97A 4Q48A 2MG4A 4DYQA 3DBLB 3OYIA 3ZPLA 1LDJA 2FBHA 1FC3A 1MNDA 4HQEA 3CP8A 2HPMA 1K6OA 1IXSB 4M3DA 1FIPA 4MGRA 2Y30A 1JJ8C 1EH8A 4M6XA 4BEHA 3O8GA 4ENKA 2PN6A 5E3MA 3A01A 2GA2A 4HOBA 1T8IA 4RB1A 1ZRCA 2X85A 2MA3A 1XS9A 2ETHA 4RAGA 2E7WA 1XDUA 1YTYA 4L5IA 1R9TJ 3DPUA 3GZ6A 3TOAA 1TL8A 2L4MA 3LQQA 4C30A 1D1BA 3HTSB 3E6MA 1WSUA 3JRIA 1RZ4A 1YS6A 5ILSA 3S1MJ 2JA7J 1Y1WJ 4BH9A 1W7PB 3NWSA 4NB5A 9ANTA 2E2JJ 3P9CA 2K4JA 2R4GA 3ZQQA 1IRZA 3OYDA 5FJ8J 4MFDA 1MBHA 3GZ5A 5IY5H 3R0JA 4ETSA 1Z1DA 2WBMA 1IGNA 2R7XA 1V5FA 4BQOA 2R92J 2Y0SN 1AOYA 1BBYA 5HS9A 1HF0A 5HNFA 2X1CA 4C3JJ 2FX0A 2EFWA 4IHXA 3S15J 4YELA 4BBSJ 5CJ9A 1TW3A 2WY8Q 4KFCA 3S1RJ 3M9AA 4XN3A 1LVKA 1JUPA 2X48A 2KIUA 2FMLA 4L0YB 1P4XA 4BUPA 2DFEA 2K7LA 2EJRA 1VQNI 2Z33A 1ACIA 3NAUA 2HVQA 4E7JA 4JQFA 3K2ZA 2EQRA 4NUBA 2L7KA 1TWCJ 1WWXA 1D5YA 3C2BA 2P8TA 1GXQA 1FSHA 1Y1VJ 3M3YJ 3H1CA 1X3UA 2KHMA 3DBHB 2A61A 2FRHA 1RNLA 4Y3OA 2V1XA 1MMGA 4XLFA 3K4MA 2QF7A 4BKXA 2GLOA 3Q5FA 1HLVA 3HSEA 2R5YB 1LB2A 2M7AA 3HGYA 2EA2A 3WTSC 3Q0UA 5CKTA 3CF2A 2AO9A 3K4CA 3DKYA 3CUQB 2XAFA 3KE2A 4EM2A 3J81Z 1G4DA 3WU2C 3KZIC 2R5ZB 2JTVA 2EV0A 2K9QA 3MN2A 1VQ7I 3HOWJ 3HM5A 1FYMA 2X4HA 1P92A 3LSTA 4LJZF 4CCOA 4NC6A 1X1PA 2VBZA 1LEBA 5F0CA 4B47A 2R0QC 1D5VA 2AQEA 2M0CA 4HAMA 2IGKA 5M5YJ 4NC7A 2E34A 2EZKA 3F22A 4XRMA 1TT5B 1BR2A 3K4BA 2HS5A 3EUHC 2RREA 4IXAA 2LBFB 1IO2A 5EEAA 4UUVA 2XSJC 4ZZLA 5K7HA 2OA4A 1XGOA 2V9KA 5F6FA 1TP4A 4FETA 3TDUC 2KLOA 5K5OA 4CZCA 1RRJA 2DFFA 1S7AA 2QQAA 3HEFA 1FTZA 1FT9A 3CJTB 4PJMA 4BNCA 4OAYA 5GPCA 1ZKGA 2XIGA 1QO0D 3MWMA 4HX8A 2EK5A 2ID6A 2H94A 1W5CC 3PO3J 3CMMA 3UR3C 4NQWA 3QPHA 4V2FA 1R36A 2VI6A 3K6GA 2Z16A 1MSFC 3CLOA 4IRIA 1F5TA 3KP2A 2IXSA 1JKRC 1BC7C 4BQAA 2DT6A 2ZJPF 1T95A 4C2MJ 3VB2A 4U7BA 5E3LA 4B3XA 1ETXA 2PMHA 4FT8A 2DU9A 4AM3A 3ZQ7A 4CH7A 1OLTA 4HQMA 5TJJA 1O3SA 1XSDA 2VOOA 1BC8C 3H36A 3SEQA 1AHDP 2BHYA 4L9NA 4G6DA 2GAUA 1WJ5A 1ONVA 4A6EA 5DM6F 4LB5A 2DYSH 2ZCWA 1RKWA 2JPCA 3S93A 1QNTA 3ZQGA 3L2CA 2PJRA 1I3QJ 2CG4A 4Y7NJ 4L9JA 1MH3A 4N9IA 2STWA 2DO7A 2KRHA 3PFIA 4PJ0C 3S14J 4AWXB 5D5WB 1YS7A 2DMUA 2XVCA 4LK0F 3S1NJ 3M1CA 1CF7A 1IC8A 3QYEA 3F23A 5F08A 2QQ9A 5M3FJ 1B9MA 1X2NA 2F5EA 3PIOF 1HW2A 2MH2A 5GAHJ 1BR4A 2DK5A 2WC2A 3ZMTA 3CCVI 2ZJ2A 3O3KA 2OCCH 4HYEA 1U9NA 4WXDA 4X6AJ 3JAMZ 4HRIA 3DEWA 2K9SA 4A12A 2YR2A 3LSGA 1QPIA 2E1MC 2GM4A 3E5XA 2V1NA 3ABMH 3F8FA 1SFKA 3A4CA 3I9V2 5FFZA 2CV2A 5CYVA 1SEUA 1LFUP 4ABZA 4BDZA 1D8KA 2JZYA 2VASA 3WGIA 1T38A 2BBYA 2DQLA 1FOWA 2VBXA 4N9HA 2KPMA 2XAGA 2R93J 2FA5A 1WI9A 1OMIA 3D1NI 4YFKF 1MD0A 2KDOA 3MKZA 1P2FA 2PQ8A 5J1RA 4O5VA 4HLYA 1B59A 1V5EA 3BTLA 1BM9A 2VOPA 1FPQA 5B5EC 1PYVA 2FNPA 3OIQA 5EJCA 2GXBA 3FXOA 3IKVA 1N78A 4ZC3A 1IN4A 3KX2A 4MHGA 5A2QZ 3CESA 3HPHA 5FO5A 2DI3A 4M9XA 4XSZF 1FWZA 5FLXK 4PJNA 3SYTA 3K9TA 1R58A 4RAZA 3SDBA 1RUNA 5J47A 2E7XA 3KEOA 1MMSA 2K4BA 3KZYA 3LOCA 4BACA 1DQUA 3J80K 1K4TA 2ISYA 4M9ZA 2DODA 3OYAA 1J9IA 2O6GE 4FHTA 2QBYB 5CPRB 1GDTA 3I64A 3GTLJ 1OYIA 1JUSA 2STTA 2K86A 3LFKA 4QPQA 4JX6A 3IAM2 3FM3A 5E1ZB 4D7MA 4AIJA 4E7HA 1MMNA 2IBDA 3IH2A 3R6SA 1FZPB 1TBXA 5L3EA 3MZ8A 3K70D 3F8CA 2ZMEC 3I53A 1R1TA 2ZFWA 2QSHX 3VYTB 3PIPF 3CCEI 3BR3A 1T0FA 2Y48A 2XPWA 1I1GA 1MBKA 5K5RA 4OOIA 2QUFA 4HNTA 3BR0A 4FE7A 4EEFG 2RVCA 1XMAA 3F6VA 1E2XA 2CV0A 2CW0F 4DZPA 1E3PA 3GTPJ 4UNOA 2IJLA 4KITB 3HTUA 1W7PA 1ZAOA 3IH3A 1W1WE 3GXOA 2M1BA 4PCQA 1B8IB 3M8JA 2DLLA 4UB8C 2PEXA 4KDPA 4A3BJ 3ZMZA 3QPTA 2K27A 5D5XB 1RIOH 3K1PA 3COAC 3Q0WA 3BPVA 1WHUA 3EUAA 4Y52J 1E3HA 2DQRA 2HQAA 2O3FA 4HX4A 4LG0B 3ZN1A 2LY1A 3K10A 2XF5A 2I5UA 5E3NA 2KIQA 3L2RA 3MKLA 1OCRH 2QKMB 1ETVA 1YJWI 5EEGA 4YG2F 3HOZJ 5FGMA 3GLXA 2H8WA 3D0SA 4MNUA 4PZJA 2IA2A 1OR7C 1GT0C 1S8NA 3R4KA 3HRSA 1K78B 2P81A 3FK6A 3U21A 2KDZA 3JCUC 2EFNA 1GUUA 2ME0A 3CCYA 1QVUA 5F1RA 3WU1B 2BVMA 3RSNA 3ISPA 3QYBA 3RKQA 1BN5A 1S9HA 2W1OA 1G3TA 1S3JA 2EILH 4B43A 3DU6A 2WY7Q 3RYPA 5LHGA 3BTJA 2R5YA 2NVYJ 1HCRA 5L3DA 4M3EA 4OAZA 1NK3P 4KT5C 2ZXIA 1MW7A 1KQ9A 3R0AA 5LFAA 3CF5F 2R7VA 2F5FA 4N4NB 1P7IA 3OIPA 5HDGA 3CUQA 5ICFA 2QGUA 5K7ZA 1MMAA 1KA8A 1XSVA 3G71I 1YIJI 2B9SA 3M8FA 2NS0A 2Y2ZA 4QLCU 5J8FA 2R5ZA 1HKQA 3SEZA 4HNVA 1LJ9A 3MAJA 2VKHA 2UUZA 3F9KA 5M3MJ 1WKMA 5CVVA 2FNAA 4BHCA 2Q0OA 2L7FP 1HC8A 4KMUX 4Y15A 4LGWA 2VBWA 2DFIA 1G3SA 1WJEA 1Y8QB 4WK8F 3K1NA 1YLFA 3P5JA 4P96A 2KMUA 4LMYA 3KYLA 5LHIA 3S3MA 4IRGA 4BBRJ 4EJWA 1UHWA 2RKHA 1FJLA 3CP2A 4XKBA 2R7UA 4E7ZA 5BS6A 4D5FA 1YRNB 5E79C 2CWEA 2KKOA 2NOJB 5J4VA 3KZZA 4LLGF 1YIOA 2E1MB 2ZB9A 4G12A 4IVNA 1PDNC 2RQQA 3KIOA 2FE3A 4BY1J 1XMXA 2A6HF 2K3FA 2LC2A 3RDIA 5GAEJ 2QLZA 2FD5A 4EV0A 3L2WA 2DJNA 3GWZA 2HTSA 3Q9VA 3MKYB 3CO6C 1OCTC 1JHFA 2Y0MA 1YO5C 1X3WB 2EV6A 2HI3A 4A6DA 4W1UA 3GUDA 1O3QA 1YJ9I 1JGGA 2LOOA 3RI4A 2L9SA 4JX5A 1M1EB 4GXOA 2VQLA 4A3DJ 2GA1A 2Z2SB 2ZJQF 3HKZA 4J00A 1VQLI 4ESBA 5HVQC 2IAIA 5GTHC 1KQ8A 1VQMI 4DNCA 1PUFB 3FKJA 3OYKA 3H92A 4MQVA 1EH7A 4KIFA 1QZZA 1G59A 3M1EA 2L9VA 4NDLA 3ASNH 3ZMDA 4AUXA 2EWNA 3VYRB 1U5TA 2GWRA 3L7WA 2DCEA 5GAGJ 1I1SA 1DU0A 3V7RA 1R4MB 3K4NA 1OISA 2DK8A 2DDBA 2OPTA 2EFOA 1KGSA 3ML6A 3JRCA 3E6CC 3G1LA 1VQ9I 2NNNA 3OYJA 1ENHA 3DFGA 2ZFUA 2ZXWH 3PFYA 3TP0A 1R5ID 2A69F 5LRSA 2K02A 3ECHA 1X1DA 2DYRH 3FF5A 1D3YA 1YW7A 2EIKH 3LSKA 4MTEA 1JT0A 1ZREA 1I27A 1DGWY 2L4AA 1MBJA 2I8DA 4DIQA 1LUJB 1HKTA 1QZEA 2VB6A 3LSHA 4EM1A 2FQ4A 1EH6A 1ZARA 2Z9OA 4M74A 3HJEA 1ULYA 4G6QA 3FM5A 4DQ2A 5BNGA 4HW0A 1FOYA 2W84A 1IJWC 1TC3C 3ZQIA 2MYSA 4Y33A 3UNGC 3J7ZI 2CUEA 3VODA 1UELB 3OY9A 3TKYA 2R7RA 2DTZA 1UMQA 1SMYF 4I0AA 3BROA 1B72A 5D6FA 4KN4X 3IKTA 2PJPA 5ERIA 2CGPA 4L5JA 5KVRA 1NK2P 2HTJA 1WZ2A 4A3CJ 2L02A 3NEUA 1D0ZA 1TQPA 2VQGA 2XGCA 3DLAA 2VXDA 1BW6A 2VQCA 2RNGA 3LA7A 5HS7A 5DTDA 2ZSIB 2M4KA 1MBFA 1O4XA 2GXGA 2ZKZA 1E3OC 3U1KA 1BR1A 2XB0X 2HQRA 3PSFA 4XNFA 2DDAA 2W57A 4OMZA 1ZR2A 5EG0A 2G0EA 1MMDA 3RPUA 3FXRA 4XOTA 1W36D 5EDNA 2JSPA 2LDUA 2Z99A 2C6YA 3GFIA 1AKHB 5J40A 4WX9A 3ECOA 1IDYA 4HF0A 5DCMB 4BDYA 3PQKA 4IZZA 2IW5A 1ZGWA 4KUMA 1P6RA 2NXNB 2K5CA 1DU6A 1YYVA 3L09A 1W4MA 2LYCA 3FZVA 2KJBA 3HOUJ 3KYCB 4GGGA 2BZTA 2XKPA 1GHCA 3WTUC 5E20A 3CCJI 2CUZA 4OIOF 3IRQA 3F72A 3JRBA 3BT9A 4Q4ZF 1N77A 4LK1F 4M6YA 3GFJA 5AIQA 2VE8A 3QU3A 4BHBA 2ME6A 5F64A 1JHHA 1WFXA 2NOGA 4CYCB 2H8RA 1ZELA 3PJRA 1SANA 1BL0A 3O6BB 4RGSA 2FJ1A 2XAQA 1Z77A 5IPAA 3DP7A 4DOZA 3FMQA 3FXKA 3WE3A 1RR8C 1X2MA 1TQMA 5D4SA 1WRJA 3WG9A 2ZNZA 3DKXA 3FDYA 3H9JA 2ZO4A 3PL8A 4EM0B 3J7AY 2NS8A 4M3FA 3HDDA 2DMQA 2JJ7A 4L9VA 4IL6C 2AS5F 2DOEA 2XGXA 1O3RA 1PUEE 1Y0UA 3BR6A 2COBA 4E6KG 4RM3A 4O3MA 3L2VA 2AHQA 3FX3A 4XICA 5FKOA 1WQ2A 3HYIA 1B8IA 2KZGA 3B6AA 3OYFA 1Z6TA 3V8LA 2WTEA 1U3EM 2JUCA 5F27A 3G4SI 3DLLF 3FHZA 4QIWN 1DGRM 2CJJA 3QU6A 4LG0A 1RKTA 1NG7A 3ABKH 1YJNI 2JRTA 2Y9ZA 3S8PA 4NHJA 5IT9Z 1X1CA 3CC7I 3LSMA 4I0BA 3EUHA 1SAXA 1MDMB 1ZH5A 1FLIA 5K1YA 5KNLA 1P4WA 1F9NA 2J5OA 2CV1A 1HKSA 3IWFA 4YIFA 3S2DJ 2A3SA 4CCLA 3OS2A 3GFLA 1KQ0A 1LEAA 2A6EF 3L1PA 2ELHA 2VN2A 2EZHA 5J3LA 2HKXA 1K78A 3BLYA 1DDNA 1U6GA 2ZXHA 2MLGA 1YHQI 4R8HA 1PVEA 1TZLA 4XLAA 2IGMA 4UV9A 1LNWA 2VPRA 1NH3A 5BPIA 1Y0NA 1OFCX 2RV8A 4E7IA 1A6QA 3TW7A 1IRFA 3ZQLA 2FOKA 4IKFA 1IXRC 5DUIA 2MSYA 2V7FA 5JVTA 3JR9A 2L9NA 4I76A 4QWQA 3PO2J 3I4PA 3M7GA 4XSXF 1H9GA 4HDVA 4IHSA 1MIJA 1MKMA 4FQGA 4NC8A 5H20A 5FD6A 2D1HA 4RB3C 1T2KA 3R60A 2FSWA 3KP6A 2R7WA 4IX7A 2YSRA 2XGDA 3L9FA 3DQVC 4A3LJ 1XGNA 2EZLA 1ORKA 2M30A 2QCOA 4P9FA 1SVMA 1ZYRF 5JR3A 2LLKA 5CVIA 2W00A 1BIBA 3KLOA 4JX4A 4PGGA 3CQZJ 4I99C 4QTRA 4D1QA 3SZGA 1T98A 2TDXA 4CXFA 4A3JJ 3TEDA 2DA4A 2LTPA 1FBUA 5TGTA 1TLHB 2FBIA 3ZCOA 1R7JA 3HPGA 1SVOA 2MW8A 3C18A 4HV6A 2H6BA 2ZJRF 2CH0A 1T39A 2CS3A 2P6SA 3OR1C 1VQ4I 4R1HA 4ZYDA 2FF4A 2R3SA 3C1DA 2XV4S 2DBBA 3HOSA 5DS9A 3HKZN 2E35A 3VYSB 3OL3A 1MH4A 3BWGA 2PG4A 1Z3YA 2H1LA 4X1EA 1DP3A 2N8GA 1Q1HA 4E4HA 4UUSA 2F4OB 4ZDOA 3K4KA 1A36A 4XQFA 5LGTA 3LQRA 3M8EA 1HSJA 4KIGA 4A93J 1IRXA 2B7EA 4CO8A 5L3BA 1GV2A 2HQNA 3CJRB 1IXCA 2ECCA 2K40A 2RAEA 3TOBA 3BCAA 3SFZA 1YFHA 3H3UA 2HGCA 1PUFA 1FP1D 1J59A 3TP3A 4O6JA 4RGUA 2X51A 4XORA 4A0ZA 1B6AA 2IRFG 4XN0A 3GYHX 2XAHA 3OOPA 5EZGA 5LRRA 1FMVA 3GTJJ 2JA8J 3NWTA 1VQ8I 1IN8A 3OYCA 3VYUB 4B3AA 1OPCA 5ICGA 4ZTJA 2EFQA 1D1CA 3C7JA 1H0MA 2HOTA 3FBNB 1AU7A 4P1WA 3E5QA 3DPLC 3BQYA 5FRNA 1Y6IA 2PBIA 1HXDA 1ODDA 4A2UA 4RM2A 1W0TA 1W7PD 4IHYA 3AAFA 1TWHJ 4BE2A 2FEZA 2OZUA 2Z3YA 2P5VA 2WV0A 1BI0A 1T56A 4PFOA 5FKNA 4E7KA 2VPLA 5E1WA 3F21A 1W5SA 3P9IA 3G1OA 2ZMEA 5JHFA 3B02A 2E60A 4S04A 3OIOA 4X0GA 2HWVA 5HNHA 3JTGA 2MH9A 1S29A 4XLHA 2LKPA 4LFUA 3T5XA 4P5OA 4H0EA 1U2WA 3HOTA 3LSIA 4V19K 5GADJ 3A03A 5C3EJ 2R7QA 1GVDA 2JVGA 2LREA 3HG9A 1STZA 1SFEA 5EGOB 4N4OB 4C2TA 1OYYA 3Q9SA 4ZYEA 1D1AA 2G9WA 2E5NA 1XCVA 2UWMA 3JRFA 4YIIA 1SFUA 2LF8A 3FIWA 2FXAA 4I02A 2E2IJ 1HW1A 3MZYA 1XG1A 4HF1A 4FTHA 1BOAA 3TL4X 5BMZA 1H9TA 2QKLB 5F0HA 2IS6A 1OCOH 2EZIA 1AKHA 4G94A 3EUKL 2DPUA 4EVIA 1MJAA 1P7JA 1G8XA 4BE0A 1GXPA 1VF9A 1TW2A 2LNBA 3LSPA 3CO7C 5L3GA 1MBGA 4XLEA 4IQJA 3CDIA 3WODF 5E18F 1OR7A 3IWZA 3TBIA 1ZLKA 1WJCA 2DA7A 1K4SA 2BXYA 2F5CA 2K9LA 2X9DA 1USTA 4CCNA 3BZCA 1FOXA 4II3A 5FROA 2OUMA 4IPAA 3V8KA 1HDPA 2E5ZA 4A3EJ 2MFZA 5LHHA 2ISZA 3N4MA 1IN7A 2VT2A 1MSEC 1IDZA 3QQAA 1R71A 1O3TA 4ENMA 3G6EI 3CCUI 3F3XA 3KYDB 3ASOH 4L0ZB 2KISA 5DV5A 4GYGA 4LD5A 3WTVC 1K79A 1ITYA 2OAZA 3FXJA 3QODA 3REOA 3S2WA 4FX4A 5IOZA 2XB5A 3H5RA 5B1BH 1I6XA 5HDKA 5HDNA 1XMKA 4CZZA 4BXUA 3JSPA 3H35A 3N05A 2V79A 1U78A 5CVRA 2IVMA 3K0LA 4PJLA 3CMEI 1BOBA 2LSOA 2RQPA 2XASA 4OU0A 4F92B 4AD9A 1OQYA 4IHWA 2HZDA 5HLGA 4ZYGA 4YFXF 3NARA 1N25A 2F5DA 3I56I 2HU9A 4HV5A 3ZMVA 5KHDA 4GO1A 3CJNA 4IHTA 5D8LB 2IGNA 4FCYA 2H1KA 2FQ3A 3G73A 3T8TA 2OJED 4P9UA 1F43A 1G3WA 1X1AA 2PI0A 2E2HJ 3RJPA 1R22A 2LFBA 5KAIC 2X6WA 4BGDA 3GTQJ 5BPDA 5FRMA 1X1BA 2A68F 2ZNYA 2E1CA 1SD5A 1V55H 2ZSHB 1UCRA 1S7OA 3NQOA 2D1VA 3A02A 1YITI 5FKLA 1D0XA 4KMFA 3HC7A 4BXFA 4RDUA 2A5YB 3LNQA 1FEXA 2ELJA 1K61A 4Q47A 2R7DA 3CMAI 1O7FA 2HXOA 4AIKA 3L00A 3DEUA 3DEEA 3WTTC 1VNDA 2BV6A 4XLNF 3JSOA 2CW8A 3C2HA 4J19A 3SDGA 3FMRA 4CCMA 2CQ7A 4RB2C 3GCMA 2L9RA 1IUYA 3OYEA 2COMA 4G7ZF 3HOXJ 4U88A 3HZJA 1G3YA 3TO9A 3C2GA 2OQGA 2BY2A 1FSEA 3VDXA 1X4OA 5ILUA 4YFNF 1TTYA 4CA0A 4I98B 4MFEA 1H88C 2MGQA 4DBRA 3FXQA 2VJ4A 1UJ8A 3OOUA 4IO9F 1Z3XA 4LG3A 4XKCA 5J1UA 5FFXA 1FTTA 3HSRA 3CUOA 4BL0B 4KISA 2X6YA 2GXAA 1OCCH 1A6IA 1UG0A 3Q3SA 2DW4A 5LLQA 1HSTA 4A3GJ 1YOVB 3H5NA 1USSA 1FOKA 2XF6A 4C9YA 4M71A 1F4KA 2P5LC 2XPUA 2ADUA 2IA1A 1REPC 1VQPI 5JVGF 2HYGD 2V1DA 5IOYA 2LY2A 3BJOA 2VJ5A 2XC7A 5AIPA 2L5QA 3BDDA 4Y17A 3MQ0A 4DYCA 3RPUD 4EATA 4U0WA 5HLHA 4KYWA 4BHPA 1QBJA 2NNYA 1YX3A 4BE1A 1WJDA 2IP2A 3CC4I 5D4RA 3S16J 1ZG1A 1ETWA 1K6YA 4GDFA 2O7OA 4BJ6C 3UKGA 4ZZDA 1ON2A 2M5WA 3J7AO 1Z6RA 3BQZA 2DA3A 3IV5A 1IV6A 5J4YA 4UY8I 1UB9A 4XONA 3OYMA 3OWTA 3OL4A 3LA2A 4HA8A 4EJVA 4EGZA 4H4KC 4S05A 5IP9J 1X58A 1Z0XA 2DTRA 4DBQA 4XRSG 4L5EA 1V4RA 3QOEA 1J09A 5BOXA 3TMOA 2Z5UA 1WVRA 4S0HB 5IP6A 2V4JC 2LBFA 5C4JJ 1AWCA 1WJAA 3RIRA 4UV8A 1LE8B 5K7FA 4L18B 1RESA 5LGUA 1TT0A 3S1QJ 1FBQA 1DP7P 1JTYA 1D0YA 2G7UA 3SQNA 2XAUA 4OWRB 1XSXA 3AL0C 3SXYA 5FKKA 5GPAA 2QSGX 4GFBA 4RS8A 3I5UA 2RDPA 4I01A 2NVQJ 3CLQA 3WTWC 3ZN0A 4E7SA 3SJMA 1BIAA 3IP4B 3S3NA 2WAEA 2M0MA 2V6CA 4KA4A 4ZDPA 2A07F 2IEKA 4JBAA 1BI1A 1F36A 2VJJA 2JA6J 3M07A 5LD2C 5HOOA 1J0RA 4U0YA 3J81K 4B8XA 2R7TA 1XGSA 1SFXA 1X4PA 3FXLA 2ACJA 3TO6A 4EJUA 1TWFJ 2OTJI 3I3LA 4KNYA 1UHMA 3DF8A 2K9NA 3G3ZA 4RBOA 2E71A 3I0TA 2L0KA 3KFWX 2I10A 2DAOA 3LA3A 1JE8A 4OIPF 3H3VK 2QQ8A 2DA5A 2MC4A 4J01A 3A2KA 1XX5A 1H8AC 3RKYA 4LLNA 2DA6A 1ETKA 1I6HJ 1YQAA 3KETA 3DWLE 4HSRA 4A3IJ 3W2WA 1ZHFA 4BAYA 5DYMA 3DTIA 1VQ5I 2OCEA 4NQWB 4F55A 3WHBA 2CQKA 3KP7A 1SVLA 2XRNA 2BHZA 2VC0A 2A5WA 2B63J 4CUGA 2EBIA 3EDPA 1ZN2A 2L7MP 1WH5A 1ZG3A 4UB6C 1X3ZB 6PAXA 2Q2EB 3GBGA 5FB2A 5DD8A 4ZTFA 1IG7A 2M7BA 3FBIB 3WE2A 2YX4A 3GEZA 5E1XA 3JW4A 3CCMI 3ZP5A 3GVAA 2AXTC 3BZKA 1A35A 3HL2A 4XRFA 1V5GA 1QPMA 2O9LA 3KP5A 3FHNA 1XCBA 1E17A 4XOPA 5H6QA 4YRVA 2VUMJ 2F2EA 1I39A 2XDVA 3C3WA 3FISA 2GBYA 3DTKA 1XTAA 1MNEA 4HZFA 4UUTA 1J7KA 1WPKA 4U0VA 4F7ZA 2XROA 1NG6A 1TNSA 2LF7A 2XPVA 3QPLA 2WB1A 5AONA 4JOMA 4XMYA 5FLXZ 2R7ZJ 2VBYA 1HOMA 4B4CA 1BJAA 1BJZA 3CDHA 3IAS2 4I2OA 3GO5A 4RAFA 2R7FA 4I6ZA 2K3PA 3W2AA 3J80Z 1R1VA 2HOAA 3VSKA 1XB4A 2QBYA 4JP0A 4LITA 1QGPA 1LPQA 4F3QA 2LRDA 4QPOA 2ELKA 3S17J 4B09A 3BR1A 3JRAA 1N75A 1VZ0A 3JAMK 2M8EA 1Y39A 3ZR8X 3OS0A 2HOSA 1U0JA 4HEA2 3F0CA 2LD5A 2AQFA 3FXMA 3PUFA 3GTMJ 1XPXA 4XLCA 3DU5A 2LG4A 4B44A 2QWWA 3VSLA 3GZNB 3BG6A 3GTOJ 4XLPF 2LP0A 2M45A 4ANJA 5EF6A 3K70C 2O8KA 4A3MJ 5D8KB 3TO7A 3BTCA 4A0XA 3HUGB 2HDWA 5H6RA 2O5RA 3GFMA 3S3OA 1QQIA 3RQ4A 3VEPA 3Q0VA 4D0PA 2V1UA 5E17F 3ROUA 5CVJA 2O61A 3MMYB 2HR3A 2OF7A 5JHUA 3OSFA 1UHSA 2IA0A 4KJZA 4XRSA 1U8RA 4GRIA 2VQHA 5IP7J 4OIRF 1A31A 1YI2I 3RQIA 5A2QK 3HRUA 1MBEA 2CRGA 1ZG5A 2L2OA 3JRHA 3VWBA 4IJAA 2G7HA 3OYGA 2XHKA 4F91B 1VQOI 5L3FA 3G2BA 4Z6YA 3LWFA 3FKIJ 3NRVA 4C2UA 3PM1A 3DBRB 2NAZA 3KP4A 2HNHA 3A0BC 1AA7A 3KCCA 2J5PA 1KU3A 1UZCA 3ZMSA 2ID3A 2DXIA 2P7VB 3K2AA 1J75A 3QOPA 2OQRA 3BG3A 2H27A 2P6TA 1LDKB 4LIUA 2FOWA 5LEKA 2DT7B 3AL0B 1Z67A 4RB0A 4UVBA 3HOVJ 2EB7A 4ASNA 2BW3B 1Q1VA 5DEQA 4G7HF 2HVRA 3AG1H 3PQJA 1VTNC 1KYWA 4BYYA 2JA5J 2QENA 4KN7X 1VI0A 1KU9A 4II2A 1FMWA 4A0YA 2LKSA 2AXLA 3P9KA 1LQ1A 2L01A 1YE9A 1LFPA 2LY9A 1T33A 3RZDJ 2NRAC 4OINF 2HFHA 4RLQA 1B1BA 2WAQN 1FBSA 4EQQA 5H2FC 2NVXJ 2H09A 2JQ7A 3CDLA 2TRTA 4FE4A 3SZTA 2P5KA 2QYOA 3ZQFA 5K5QA 2P4WA 5GTIC 2QA4I 3SHFA 5B66C 3JREA 3EQLF 5D6EA 3CCQI 1Z05A 2A05A 2BE5F 2VLAA 2MC3A 2L54A 3TGNA 3I59B 4G8XA 3BCBA 3RPQA 1KU7A 4N0BA 4CICA 2KZVA 3CCSI 3H3ZA 3JRGA 1QHHD 4AVZA 3RKWA 1JXSA 2KIMA 3T8RA 4D9JA 2FUG2 2RNJA 4WWCA 1KU2A 3DTEA 5FKMA 3AKZA 5ED4A 2W48A 1LE8A 1DPRA 4W97A 3SFIA 1Z91A 1FP2A 1YRNA 1TWGJ 2O8XA 2JWTA 1GV5A 2MD5A 2BY0A 2DMNA 2R7SA 4CDGA 2E1NA 1T08B 2V6EA 3F8BA 1SC7A 4V2GA 2W4SA 4MQ9F 3RYRA 2X6XA 1S5LC 4DGWB 3O2PE 3V42A 1CQTA 4ESJA 1K83J 5E8GA 2L3DA 1L0OC 2QVOA 2CQNA 1ZQ3P 3OYLA 1FX7A 1R23A 2PMZN 1JI8A 4XK4A 4AU7A 4U87A 4IEJA 3KEQA 3CD6I 2ESHA 2V26A 3HXLA 4BJ5C 4AIHA 4IHVA 5ICEA 1LDDA 4D5CA 2FU4A 3AFHA 2DT5A 2L7ZA 3IHUA 1JKOC 2K9MA 1R5HA 5J8CA 1PJRA 1XC5A 4K2EA 4BY7J 1GLNA 1MJ9A 1MJBA 3JTHA 2ICWG 1RETA 5LBQA 1EJ9A 1RR7A 3RTRA 3N97A 2V9PA 2JA2A 4LLLA 1EA3A 5C4XJ 5D5VB 5DDGA 1VFCA 4EJTA 4CYDA 3U9GA 5HLTA 5GP9A 2YU9J 1YG2A 5FD5A 2HDDA 1ETOA 2OZ6A 2CO5A 3CJQB 4WXCA 3OS1A 2YUSA 3V7SA 4M6VA 4ZH4F 3ZQCA 2DMPA 3W6KB 4ENNA 2VODA 1XN7A 5EYRA 3BJ6A 3K69A 1L3LA 3MCZA 1DPUA 3P7NA 4MIMA 4LIVA 1WCMJ 2CMPA 1ZR4A 3QPSA 2JUGA 4MEXF 2LKXA 3KEYA 5HODA 2DA1A 3E7LA 2VKVA 3H0GJ 4PSXA 3TW6A 3AG3H 2H6CA 3GX4X 1JKPC 3ZQHA 3ZRGA 3IUOA 5JLXA 4F52A 1D8JA 1UAAA 2E1OA 3HRMA 1IV8A 3KLNA 3A0HC 3JRDA 3BPXA 1RC9A 4LOCA 2JN6A 1YW9A 2Q2EA 1UFMA 5FLMJ 1EF4A 3TQNA 1IUFA 2HYFA 2GOMA 3DCFA 1T6SA 1QVTA 2QZ8A 5CQEA 2GIVA 1R6RA 2WB1N 2UV1A 4C3HJ 3ABLH 3GMEA 1IZ1A 1EV7A 2YS9A 4AYBN 1U5TB 1RUOA 3VPRA 1WH7A 3WTYC 2F5VA 1S6LA 1U8BA 1TWAJ 2B0LA 1R00A 2CSOA 2KQRA 2JRMA 3QRFF 3GTKJ 5LGNA 5HLIA 3BR2A 2CUFA 5DCMA 4A5NA 1O7LA 4AC0A 1NHAA 4ZYAA 1W36C 1E0EA 3I54A 3CC2I 3BC8A 5ICCA 4RGXA 2CQXA 3MEXA 4HF2A 1Y56A 3F6OA 1G2HA 2F4IA 3BJAA 1GVJA 1QRYA 2VT3A 3IRRA 4ENJA 2KRFA 2XGEA 1WJFA 5B1AH 2QM3A 4RMNA 3HHGA 2GZWA 1HQCA 2JPBA 1BA5A 3DXJF 4I7HA 4B1RA 2KFDA 4HSTA 4U7DA 2WADA 1RI7A 4OMYA 3I4NJ 4UXNA 1OCZH 3PNTA 4OIQF 3CZ6A 2XRLA 1B72B 2A6TA 2FBKA 4CYCA 1ZTRA 1KYZA 2MABA 2HEOA 3B73A 5DM7F 3V4GA 1R4NB 1MNMC 2M4GA 1F1ZA 3E5UA 2VE9A 3AG4H 2MD0A 5LEJA 2IT0A 2YX7A 2PX9A 2XUBA 2NVUB 3HUGA 2XKOA 1IW7F 3ABTA 5M5XJ 3MKWB 4ON0A 5CQGA 2DA2A 3H0DA 1BI3A 1LFBA 1SFOJ 5EG0B
chains in the Genus database with same CATH topology
2MLKA 4AVPA 4E70A 3BY6A 5J6XA 4WXHA 2GQQA 1OKRA 1TQIA 3DV8A 3E3VA 2JSCA 2HOEA 2M87A 2OU2A 1MDMA 2PLYA 3T0YA 3LAJA 4P55A 5DUKA 3HIFA 1J5YA 3R61A 4RAYA 2EV5A 3EETA 3LAPA 1OYWA 1PP8F 1J2XA 2JT1A 1IF1A 1IN6A 2RGVA 2HDCA 3HRTA 2ZBKA 2YU3A 4Z2YA 4IF4A 2UZKA 1B4AA 3QP5A 3ELKA 3T1BA 2UXXA 3V7CA 1P4AA 1LVAA 3WTZA 3QAHA 3E6DA 3MFKA 4MEYF 1IAWA 4L9TA 2VXZA 2CYYA 1K7AA 1MGTA 3EYIA 3I59A 2W25A 5IT9K 2PMUA 4HBLA 2IPQX 1ZLJA 1SD6A 3BP8A 1SD4A 1TNTA 2QQBA 5BQTA 4WCGA 4IRHA 5JFRA 1B9NA 4A5MA 2X0LA 4LB6B 4I09A 2WWYA 4Y13A 2RC4A 3SZPA 5KK1A 1R5GA 2Y75A 1HW5A 5EEHA 2V9VA 5CVUA 3IL2A 4KICA 2DPDA 3U2RA 2UXNA 3HSFA 3DPTA 3I71A 1SMTA 2Q8KA 5IT3A 3ERED 3RKXA 4RGRA 3ULQB 1FY7A 4G7OF 3OV8A 4GYIA 3WGHA 5DD4A 4FX0A 2D2WA 1DUXC 2BGCA 4PDKA 3E6BA 1C0WA 3KP3A 4WF2A 4PGHA 4HDUA 1SD7A 4MTDA 3MZHA 1I5ZA 1W5TA 4HLXA 4M9SA 4CHUA 1MZBA 2ESNA 3D5LA 3VFZA 2CFXA 2O03A 4TV7A 2RN7A 3ZMUA 1CGPA 1O57A 2EA4A 4G9YA 3BZ6A 5ILVA 3K1MA 2W85A 4R79A 3HHHA 2P7CB 1R1UA 2D45A 2XAJA 5CLSA 5L3CA 5DCFA 1XGMA 1IN5A 1ON1A 4UVAA 2OBPA 5JI6A 1V3FA 3ABUA 5E8IA 4CGZA 1ZGJA 3VOEA 3I58A 3WGGA 2ZMEB 1FYKA 3GW2A 1IRGA 2ZXJA 3CUQC 2NYXA 4EGYA 2FMYA 4EJOA 1PP7U 3BOQA 1YW8A 5HS8A 3IC7A 3V8JA 1QZYA 3GF2A 4KIBA 3U1DA 1ZGAA 2BEOA 2HKOA 2YPRA 2BYVE 1ZRFA 2EFPA 1CF7B 3FWEA 4ESFA 2OD5A 3FMSA 2MBFA 3DKWA 1ZRDA 1Z7UA 1HBXG 3QP6A 3CTAA 2VC1A 2HZTA 3F8MA 4ZYHA 4UVCA 3TDZC 2O0YA 1A04A 4GCVA 3W6JB 2PFBA 3F8NA 5TRDA 1FYLA 4UHTA 1FNNA 1XDSA 1BI2A 4M73A 3WU0A 4Q5SF 4M72A 4HX7A 2KJCA 2W24A 2KIFA 4JK1X 1G6NA 5D5UB 3WTXC 1U5TC 4EMSA 4XBFA 1JGSA 3FXUA 3EYYA 1XD7A 2VONA 3E97A 4Q48A 3ZPLA 1LDJA 2FBHA 1FC3A 4HQEA 1K6OA 1IXSB 4MGRA 1EH8A 4M6XA 4ENKA 2PN6A 2GA2A 4HOBA 4RB1A 1ZRCA 2MA3A 2ETHA 2E7WA 1XDUA 1YTYA 4L5IA 3GZ6A 3TOAA 2L4MA 3LQQA 3HTSB 3E6MA 1WSUA 1RZ4A 1YS6A 5ILSA 4BH9A 1W7PB 4NB5A 3P9CA 2K4JA 3GZ5A 3R0JA 4ETSA 1Z1DA 1AOYA 1BBYA 5HS9A 2EFWA 5CJ9A 1TW3A 4KFCA 3M9AA 2KIUA 2FMLA 4L0YB 1P4XA 2K7LA 2EJRA 2Z33A 4JQFA 3K2ZA 1WWXA 2P8TA 1GXQA 1FSHA 1X3UA 2A61A 2FRHA 1RNLA 2V1XA 3Q5FA 3HSEA 1LB2A 2EA2A 3WTSC 3CUQB 2XAFA 3KE2A 4EM2A 3J81Z 1G4DA 2JTVA 2EV0A 1FYMA 2X4HA 1P92A 3LSTA 4LJZF 2VBZA 1LEBA 1D5VA 4HAMA 3F22A 2HS5A 4IXAA 4UUVA 4ZZLA 2OA4A 1XGOA 5F6FA 3TDUC 5K5OA 1S7AA 2QQAA 1FT9A 4BNCA 2XIGA 1QO0D 3MWMA 4HX8A 2EK5A 2H94A 4NQWA 3QPHA 1R36A 3CLOA 4IRIA 1F5TA 3KP2A 1BC7C 4BQAA 3VB2A 4U7BA 2PMHA 4FT8A 2DU9A 3ZQ7A 4HQMA 5TJJA 1O3SA 1XSDA 2VOOA 1BC8C 4L9NA 4G6DA 2GAUA 1ONVA 4A6EA 4LB5A 2ZCWA 2JPCA 3L2CA 1QNTA 2CG4A 4L9JA 4N9IA 2STWA 2DO7A 3PFIA 4AWXB 5D5WB 1YS7A 2XVCA 4LK0F 1CF7A 3F23A 2QQ9A 1B9MA 2F5EA 1HW2A 2MH2A 2DK5A 2WC2A 3ZMTA 2ZJ2A 3O3KA 4HYEA 4WXDA 3JAMZ 4A12A 2YR2A 3E5XA 3F8FA 5FFZA 5CYVA 1D8KA 2JZYA 3WGIA 1T38A 2BBYA 2DQLA 2VBXA 4N9HA 2XAGA 2FA5A 1WI9A 1OMIA 4YFKF 1MD0A 1P2FA 2PQ8A 4O5VA 4HLYA 1B59A 1BM9A 2VOPA 1FPQA 2FNPA 2GXBA 3IKVA 1IN4A 4MHGA 5A2QZ 5FO5A 2DI3A 4M9XA 4XSZF 1FWZA 5FLXK 3K9TA 1R58A 4RAZA 1RUNA 2E7XA 3KEOA 2K4BA 3KZYA 3J80K 1J9IA 2ISYA 4M9ZA 2O6GE 4FHTA 2QBYB 3I64A 1OYIA 2STTA 2K86A 3LFKA 3FM3A 5E1ZB 4AIJA 3R6SA 1FZPB 1TBXA 5L3EA 3F8CA 3I53A 1R1TA 2ZFWA 1T0FA 2Y48A 1I1GA 5K5RA 4OOIA 2QUFA 2RVCA 1XMAA 3F6VA 1E2XA 2CW0F 4UNOA 2IJLA 3HTUA 1W7PA 1ZAOA 3GXOA 2M1BA 4PCQA 2DLLA 2PEXA 4KDPA 3ZMZA 3QPTA 2K27A 5D5XB 1RIOH 3K1PA 3COAC 3BPVA 2DQRA 2O3FA 4HX4A 4LG0B 3ZN1A 5EEGA 4YG2F 5FGMA 3GLXA 3D0SA 4MNUA 4PZJA 2IA2A 1S8NA 3R4KA 3HRSA 1K78B 2EFNA 5F1RA 3WU1B 3ISPA 1BN5A 1G3TA 1S3JA 3RYPA 5LHGA 5L3DA 4KT5C 1KQ9A 3R0AA 2F5FA 5HDGA 3CUQA 5ICFA 1KA8A 1XSVA 3M8FA 2NS0A 4QLCU 5J8FA 1HKQA 1LJ9A 3MAJA 1WKMA 5CVVA 2FNAA 4BHCA 2Q0OA 4KMUX 4Y15A 4LGWA 2VBWA 2DFIA 1G3SA 4WK8F 3K1NA 1YLFA 4P96A 4LMYA 5LHIA 4IRGA 4EJWA 1UHWA 2RKHA 5BS6A 2CWEA 2KKOA 3KZZA 4LLGF 1YIOA 4IVNA 1PDNC 2FE3A 2A6HF 3RDIA 2QLZA 4EV0A 3Q9VA 3GWZA 2HTSA 3CO6C 1JHFA 2Y0MA 1YO5C 2EV6A 4A6DA 3GUDA 1O3QA 3RI4A 4GXOA 2GA1A 4ESBA 5HVQC 1KQ8A 4DNCA 3H92A 4MQVA 1EH7A 4KIFA 1QZZA 3M1EA 3ZMDA 2EWNA 1U5TA 2GWRA 3L7WA 1I1SA 3V7RA 2DK8A 2EFOA 1KGSA 3ML6A 3E6CC 2NNNA 3DFGA 5LRSA 2A69F 2K02A 3ECHA 3FF5A 1D3YA 1YW7A 4MTEA 1ZREA 1I27A 2L4AA 1HKTA 4EM1A 1EH6A 1ZARA 2Z9OA 4M74A 1ULYA 4G6QA 3FM5A 4DQ2A 4HW0A 2W84A 3VODA 3TKYA 1SMYF 4I0AA 3BROA 5D6FA 4KN4X 3IKTA 2PJPA 5ERIA 2CGPA 4L5JA 5KVRA 2HTJA 2L02A 3NEUA 1TQPA 3LA7A 5HS7A 2GXGA 2ZKZA 2HQRA 2W57A 4OMZA 3RPUA 3FXRA 2LDUA 2Z99A 2C6YA 3GFIA 4WX9A 3ECOA 4HF0A 5DCMB 3PQKA 2IW5A 4KUMA 1P6RA 1YYVA 3L09A 1W4MA 3FZVA 2KJBA 4GGGA 2XKPA 1GHCA 3WTUC 5E20A 4OIOF 3IRQA 3F72A 4Q4ZF 4M6YA 4LK1F 3GFJA 5AIQA 2VE8A 3QU3A 4BHBA 5F64A 1JHHA 3O6BB 4RGSA 2XAQA 3DP7A 3FMQA 3WE3A 1TQMA 5D4SA 1WRJA 3WG9A 2ZNZA 2ZO4A 4EM0B 4L9VA 2AS5F 2XGXA 1O3RA 1PUEE 1Y0UA 4O3MA 3FX3A 1WQ2A 3HYIA 1Z6TA 3V8LA 2WTEA 1U3EM 3FHZA 3QU6A 4LG0A 2JRTA 4NHJA 5IT9Z 4I0BA 3EUHA 1SAXA 1MDMB 1ZH5A 1FLIA 5K1YA 1P4WA 1F9NA 2J5OA 1HKSA 3IWFA 4YIFA 2A3SA 3GFLA 1KQ0A 1LEAA 2A6EF 2ELHA 2VN2A 2HKXA 1K78A 1DDNA 1U6GA 2MLGA 4R8HA 4UV9A 1LNWA 5BPIA 2RV8A 1IRFA 2FOKA 1IXRC 5DUIA 5JVTA 4QWQA 3I4PA 3M7GA 4XSXF 1H9GA 4HDVA 4IHSA 1MKMA 5H20A 5FD6A 2D1HA 4RB3C 1T2KA 3R60A 2FSWA 3KP6A 2YSRA 3L9FA 3DQVC 1XGNA 2M30A 4P9FA 1ZYRF 5JR3A 5CVIA 1BIBA 3KLOA 4PGGA 1T98A 2TDXA 4CXFA 1FBUA 1TLHB 2FBIA 1R7JA 3C18A 4HV6A 2H6BA 1T39A 2P6SA 4R1HA 4ZYDA 2FF4A 2R3SA 3C1DA 2XV4S 2DBBA 3HOSA 3BWGA 2PG4A 1Q1HA 5LGTA 3LQRA 3M8EA 1HSJA 4KIGA 5L3BA 1Z9CA 4CO8A 2HQNA 1IXCA 3TOBA 3SFZA 1YFHA 3H3UA 2HGCA 1FP1D 1J59A 4O6JA 4RGUA 4A0ZA 1B6AA 2IRFG 3GYHX 2XAHA 3OOPA 5LRRA 1IN8A 1OPCA 5ICGA 2EFQA 3C7JA 1H0MA 3E5QA 3DPLC 2PBIA 1HXDA 1ODDA 4A2UA 1W7PD 3AAFA 2FEZA 2OZUA 2Z3YA 2P5VA 2WV0A 1BI0A 5E1WA 3F21A 1W5SA 3P9IA 2ZMEA 3B02A 4S04A 2HWVA 3JTGA 2MH9A 1S29A 2LKPA 4LFUA 3T5XA 4P5OA 4H0EA 1U2WA 3HOTA 1STZA 1SFEA 1OYYA 3Q9SA 4ZYEA 2G9WA 1XCVA 2UWMA 4YIIA 1SFUA 2LF8A 2FXAA 4I02A 1HW1A 3MZYA 4HF1A 1BOAA 5BMZA 1H9TA 4G94A 2DPUA 4EVIA 1MJAA 1GXPA 1TW2A 2LNBA 3CO7C 5L3GA 3WODF 5E18F 1OR7A 3IWZA 1ZLKA 2F5CA 1USTA 4IPAA 3V8KA 5LHHA 2ISZA 3N4MA 1IN7A 2VT2A 1O3TA 4ENMA 3F3XA 4L0ZB 5DV5A 4GYGA 4LD5A 3WTVC 1K79A 2OAZA 3S2WA 4FX4A 3REOA 5HDKA 1I6XA 5HDNA 1XMKA 4CZZA 4BXUA 3JSPA 2V79A 1U78A 5CVRA 2IVMA 3K0LA 2LSOA 2RQPA 2XASA 4OU0A 4AD9A 5HLGA 4ZYGA 4YFXF 2F5DA 4HV5A 3ZMVA 4GO1A 3CJNA 4IHTA 5D8LB 2FQ3A 3G73A 3T8TA 4P9UA 1G3WA 2PI0A 3RJPA 1R22A 5BPDA 2A68F 2ZNYA 2E1CA 1SD5A 1UCRA 1S7OA 3NQOA 2D1VA 4KMFA 2A5YB 4Q47A 2R7DA 4AIKA 1O7FA 3L00A 3DEUA 3WTTC 2BV6A 4XLNF 3JSOA 3FMRA 4RB2C 1IUYA 2COMA 4G7ZF 4U88A 1G3YA 3TO9A 2OQGA 1FSEA 5ILUA 4YFNF 1TTYA 4I98B 3FXQA 5FFXA 3HSRA 3CUOA 2DW4A 5LLQA 1HSTA 1USSA 1FOKA 4M71A 1F4KA 2P5LC 2ADUA 2IA1A 1REPC 2HYGD 2V1DA 3BJOA 5AIPA 3BDDA 4Y17A 3MQ0A 4U0WA 5HLHA 4KYWA 4BHPA 1QBJA 2NNYA 2IP2A 5D4RA 1ZG1A 4ZZDA 1ON2A 2M5WA 3J7AO 1Z6RA 1UB9A 3LA2A 4HA8A 4EJVA 4EGZA 4S05A 2DTRA 1V4RA 5BOXA 2Z5UA 1AWCA 3RIRA 4UV8A 4L18B 5LGUA 1FBQA 1DP7P 2G7UA 3SQNA 1XSXA 3SXYA 4RS8A 3I5UA 2RDPA 4I01A 3WTWC 3ZN0A 1BIAA 2V6CA 4KA4A 2A07F 4JBAA 1BI1A 5HOOA 1J0RA 4U0YA 3J81K 4B8XA 1XGSA 1SFXA 2ACJA 3TO6A 4EJUA 4KNYA 1UHMA 3DF8A 3G3ZA 3I0TA 3KFWX 2DAOA 3LA3A 1JE8A 4OIPF 3RKYA 4LLNA 1YQAA 3KETA 4BAYA 1ZHFA 5DYMA 2CQKA 3KP7A 2XRNA 2VC0A 3EDPA 1ZN2A 1ZG3A 6PAXA 5FB2A 5DD8A 3WE2A 2YX4A 3GEZA 5E1XA 3JW4A 3ZP5A 3GVAA 4XRFA 1QPMA 3KP5A 1XCBA 1E17A 5H6QA 2F2EA 3C3WA 4HZFA 1J7KA 4U0VA 4F7ZA 2XROA 1TNSA 2LF7A 5AONA 5FLXZ 2VBYA 1BJAA 3CDHA 4I2OA 3GO5A 2R7FA 3J80Z 1R1VA 1XB4A 2QBYA 1QGPA 4B09A 3JAMK 2M8EA 2QWWA 4XLPF 2M45A 5D8KB 3TO7A 4A0XA 5H6RA 3GFMA 1QQIA 3VEPA 4D0PA 2V1UA 5E17F 3ROUA 5CVJA 2O61A 2HR3A 5JHUA 2IA0A 1U8RA 4OIRF 5A2QK 3HRUA 1ZG5A 4IJAA 2G7HA 2XHKA 5L3FA 3LWFA 3NRVA 2NAZA 3KP4A 3KCCA 2J5PA 1KU3A 3ZMSA 2P7VB 1J75A 2H27A 3QOPA 2OQRA 2P6TA 1LDKB 5LEKA 4RB0A 4UVBA 2EB7A 4ASNA 5DEQA 4G7HF 3PQJA 1VTNC 1KYWA 4BYYA 2QENA 4KN7X 1KU9A 4A0YA 3P9KA 2AXLA 1LQ1A 2L01A 2NRAC 4OINF 2HFHA 1B1BA 1FBSA 4EQQA 2H09A 3SZTA 2P5KA 2QYOA 5K5QA 2P4WA 3SHFA 3EQLF 5D6EA 1Z05A 2BE5F 2MC3A 2L54A 3TGNA 3I59B 4G8XA 3RPQA 1KU7A 4N0BA 4CICA 3H3ZA 3RKWA 1JXSA 2KIMA 3T8RA 2RNJA 4WWCA 1KU2A 5ED4A 1DPRA 1Z91A 1FP2A 2O8XA 2MD5A 4CDGA 2E1NA 3F8BA 4MQ9F 3RYRA 3O2PE 4ESJA 5E8GA 2L3DA 1L0OC 2QVOA 1FX7A 1R23A 3KEQA 2ESHA 4AIHA 5ICEA 1LDDA 2IT0A 2FU4A 3IHUA 2DT5A 1R5HA 5J8CA 4K2EA 1MJ9A 1MJBA 3JTHA 5LBQA 3RTRA 3N97A 4LLLA 5D5VB 5DDGA 4EJTA 4CYDA 3U9GA 1YG2A 5FD5A 2OZ6A 2CO5A 4WXCA 3V7SA 4ZH4F 3W6KB 4ENNA 2VODA 1XN7A 1L3LA 3BJ6A 3K69A 3MCZA 1DPUA 3P7NA 4MEXF 2H6CA 3GX4X 1D8JA 3HRMA 3KLNA 3BPXA 1YW9A 2Q2EA 1UFMA 3TQNA 2HYFA 1T6SA 2QZ8A 2GIVA 1IZ1A 1EV7A 1U5TB 1RUOA 3WTYC 1S6LA 2B0LA 1R00A 2CSOA 3QRFF 5LGNA 5HLIA 4A5NA 5DCMA 1O7LA 1NHAA 3I54A 5ICCA 4RGXA 3MEXA 4HF2A 3F6OA 3BJAA 1GVJA 2VT3A 3IRRA 4ENJA 2KRFA 2QM3A 3HHGA 2GZWA 1HQCA 2JPBA 3DXJF 4I7HA 4U7DA 1RI7A 4OMYA 4UXNA 4OIQF 2FBKA 1KYZA 2HEOA 3B73A 3V4GA 1F1ZA 3E5UA 2VE9A 5LEJA 2YX7A 2XUBA 3HUGA 2XKOA 1IW7F 3ABTA 4ON0A 1BI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLK A;  4AVP A;  4E70 A;  3BY6 A;  5J6X A;  4WXH A;  2GQQ A;  1OKR A;  1TQI A;  3DV8 A;  3E3V A;  2JSC A;  2HOE A;  2M87 A;  2OU2 A;  1MDM A;  2PLY A;  3T0Y A;  3LAJ A;  4P55 A;  5DUK A;  3HIF A;  1J5Y A;  3R61 A;  4RAY A;  2EV5 A;  3EET A;  3LAP A;  1OYW A;  1PP8 F;  1J2X A;  2JT1 A;  1IF1 A;  1IN6 A;  2RGV A;  2HDC A;  3HRT A;  2ZBK A;  2YU3 A;  4Z2Y A;  4IF4 A;  2UZK A;  1B4A A;  3QP5 A;  3ELK A;  3T1B A;  2UXX A;  3V7C A;  1P4A A;  1LVA A;  3WTZ A;  3QAH A;  3E6D A;  3MFK A;  4MEY F;  1IAW A;  4L9T A;  2VXZ A;  2CYY A;  1K7A A;  1MGT A;  3EYI A;  3I59 A;  2W25 A;  5IT9 K;  2PMU A;  4HBL A;  2IPQ X;  1ZLJ A;  1SD6 A;  3BP8 A;  1SD4 A;  1TNT A;  2QQB A;  5BQT A;  4WCG A;  4IRH A;  5JFR A;  1B9N A;  4A5M A;  2X0L A;  4LB6 B;  4I09 A;  2WWY A;  4Y13 A;  2RC4 A;  3SZP A;  5KK1 A;  1R5G A;  2Y75 A;  1HW5 A;  5EEH A;  2V9V A;  5CVU A;  3IL2 A;  4KIC A;  2DPD A;  3U2R A;  2UXN A;  3HSF A;  3DPT A;  3I71 A;  1SMT A;  2Q8K A;  5IT3 A;  3ERE D;  3RKX A;  4RGR A;  3ULQ B;  1FY7 A;  4G7O F;  3OV8 A;  4GYI A;  3WGH A;  5DD4 A;  4FX0 A;  2D2W A;  1DUX C;  2BGC A;  4PDK A;  3E6B A;  1C0W A;  3KP3 A;  4WF2 A;  4PGH A;  4HDU A;  1SD7 A;  4MTD A;  3MZH A;  1I5Z A;  1W5T A;  4HLX A;  4M9S A;  4CHU A;  1MZB A;  2ESN A;  3D5L A;  3VFZ A;  2CFX A;  2O03 A;  4TV7 A;  2RN7 A;  3ZMU A;  1CGP A;  1O57 A;  2EA4 A;  4G9Y A;  3BZ6 A;  5ILV A;  3K1M A;  2W85 A;  4R79 A;  3HHH A;  2P7C B;  1R1U A;  2D45 A;  2XAJ A;  5CLS A;  5L3C A;  5DCF A;  1XGM A;  1IN5 A;  1ON1 A;  4UVA A;  2OBP A;  5JI6 A;  1V3F A;  3ABU A;  5E8I A;  4CGZ A;  1ZGJ A;  3VOE A;  3I58 A;  3WGG A;  2ZME B;  1FYK A;  3GW2 A;  1IRG A;  2ZXJ A;  3CUQ C;  2NYX A;  4EGY A;  2FMY A;  4EJO A;  1PP7 U;  3BOQ A;  1YW8 A;  5HS8 A;  3IC7 A;  3V8J A;  1QZY A;  3GF2 A;  4KIB A;  3U1D A;  1ZGA A;  2BEO A;  2HKO A;  2YPR A;  2BYV E;  1ZRF A;  2EFP A;  1CF7 B;  3FWE A;  4ESF A;  2OD5 A;  3FMS A;  2MBF A;  3DKW A;  1ZRD A;  1Z7U A;  1HBX G;  3QP6 A;  3CTA A;  2VC1 A;  2HZT A;  3F8M A;  4ZYH A;  4UVC A;  3TDZ C;  2O0Y A;  1A04 A;  4GCV A;  3W6J B;  2PFB A;  3F8N A;  5TRD A;  1FYL A;  4UHT A;  1FNN A;  1XDS A;  1BI2 A;  4M73 A;  3WU0 A;  4Q5S F;  4M72 A;  4HX7 A;  2KJC A;  2W24 A;  2KIF A;  4JK1 X;  1G6N A;  5D5U B;  3WTX C;  1U5T C;  4EMS A;  4XBF A;  1JGS A;  3FXU A;  3EYY A;  1XD7 A;  2VON A;  3E97 A;  4Q48 A;  3ZPL A;  1LDJ A;  2FBH A;  1FC3 A;  4HQE A;  1K6O A;  1IXS B;  4MGR A;  1EH8 A;  4M6X A;  4ENK A;  2PN6 A;  2GA2 A;  4HOB A;  4RB1 A;  1ZRC A;  2MA3 A;  2ETH A;  2E7W A;  1XDU A;  1YTY A;  4L5I A;  3GZ6 A;  3TOA A;  2L4M A;  3LQQ A;  3HTS B;  3E6M A;  1WSU A;  1RZ4 A;  1YS6 A;  5ILS A;  4BH9 A;  1W7P B;  4NB5 A;  3P9C A;  2K4J A;  3GZ5 A;  3R0J A;  4ETS A;  1Z1D A;  1AOY A;  1BBY A;  5HS9 A;  2EFW A;  5CJ9 A;  1TW3 A;  4KFC A;  3M9A A;  2KIU A;  2FML A;  4L0Y B;  1P4X A;  2K7L A;  2EJR A;  2Z33 A;  4JQF A;  3K2Z A;  1WWX A;  2P8T A;  1GXQ A;  1FSH A;  1X3U A;  2A61 A;  2FRH A;  1RNL A;  2V1X A;  3Q5F A;  3HSE A;  1LB2 A;  2EA2 A;  3WTS C;  3CUQ B;  2XAF A;  3KE2 A;  4EM2 A;  3J81 Z;  1G4D A;  2JTV A;  2EV0 A;  1FYM A;  2X4H A;  1P92 A;  3LST A;  4LJZ F;  2VBZ A;  1LEB A;  1D5V A;  4HAM A;  3F22 A;  2HS5 A;  4IXA A;  4UUV A;  4ZZL A;  2OA4 A;  1XGO A;  5F6F A;  3TDU C;  5K5O A;  1S7A A;  2QQA A;  1FT9 A;  4BNC A;  2XIG A;  1QO0 D;  3MWM A;  4HX8 A;  2EK5 A;  2H94 A;  4NQW A;  3QPH A;  1R36 A;  3CLO A;  4IRI A;  1F5T A;  3KP2 A;  1BC7 C;  4BQA A;  3VB2 A;  4U7B A;  2PMH A;  4FT8 A;  2DU9 A;  3ZQ7 A;  4HQM A;  5TJJ A;  1O3S A;  1XSD A;  2VOO A;  1BC8 C;  4L9N A;  4G6D A;  2GAU A;  1ONV A;  4A6E A;  4LB5 A;  2ZCW A;  2JPC A;  3L2C A;  1QNT A;  2CG4 A;  4L9J A;  4N9I A;  2STW A;  2DO7 A;  3PFI A;  4AWX B;  5D5W B;  1YS7 A;  2XVC A;  4LK0 F;  1CF7 A;  3F23 A;  2QQ9 A;  1B9M A;  2F5E A;  1HW2 A;  2MH2 A;  2DK5 A;  2WC2 A;  3ZMT A;  2ZJ2 A;  3O3K A;  4HYE A;  4WXD A;  3JAM Z;  4A12 A;  2YR2 A;  3E5X A;  3F8F A;  5FFZ A;  5CYV A;  1D8K A;  2JZY A;  3WGI A;  1T38 A;  2BBY A;  2DQL A;  2VBX A;  4N9H A;  2XAG A;  2FA5 A;  1WI9 A;  1OMI A;  4YFK F;  1MD0 A;  1P2F A;  2PQ8 A;  4O5V A;  4HLY A;  1B59 A;  1BM9 A;  2VOP A;  1FPQ A;  2FNP A;  2GXB A;  3IKV A;  1IN4 A;  4MHG A;  5A2Q Z;  5FO5 A;  2DI3 A;  4M9X A;  4XSZ F;  1FWZ A;  5FLX K;  3K9T A;  1R58 A;  4RAZ A;  1RUN A;  2E7X A;  3KEO A;  2K4B A;  3KZY A;  3J80 K;  1J9I A;  2ISY A;  4M9Z A;  2O6G E;  4FHT A;  2QBY B;  3I64 A;  1OYI A;  2STT A;  2K86 A;  3LFK A;  3FM3 A;  5E1Z B;  4AIJ A;  3R6S A;  1FZP B;  1TBX A;  5L3E A;  3F8C A;  3I53 A;  1R1T A;  2ZFW A;  1T0F A;  2Y48 A;  1I1G A;  5K5R A;  4OOI A;  2QUF A;  2RVC A;  1XMA A;  3F6V A;  1E2X A;  2CW0 F;  4UNO A;  2IJL A;  3HTU A;  1W7P A;  1ZAO A;  3GXO A;  2M1B A;  4PCQ A;  2DLL A;  2PEX A;  4KDP A;  3ZMZ A;  3QPT A;  2K27 A;  5D5X B;  1RIO H;  3K1P A;  3COA C;  3BPV A;  2DQR A;  2O3F A;  4HX4 A;  4LG0 B;  3ZN1 A;  5EEG A;  4YG2 F;  5FGM A;  3GLX A;  3D0S A;  4MNU A;  4PZJ A;  2IA2 A;  1S8N A;  3R4K A;  3HRS A;  1K78 B;  2EFN A;  5F1R A;  3WU1 B;  3ISP A;  1BN5 A;  1G3T A;  1S3J A;  3RYP A;  5LHG A;  5L3D A;  4KT5 C;  1KQ9 A;  3R0A A;  2F5F A;  5HDG A;  3CUQ A;  5ICF A;  1KA8 A;  1XSV A;  3M8F A;  2NS0 A;  4QLC U;  5J8F A;  1HKQ A;  1LJ9 A;  3MAJ A;  1WKM A;  5CVV A;  2FNA A;  4BHC A;  2Q0O A;  4KMU X;  4Y15 A;  4LGW A;  2VBW A;  2DFI A;  1G3S A;  4WK8 F;  3K1N A;  1YLF A;  4P96 A;  4LMY A;  5LHI A;  4IRG A;  4EJW A;  1UHW A;  2RKH A;  5BS6 A;  2CWE A;  2KKO A;  3KZZ A;  4LLG F;  1YIO A;  4IVN A;  1PDN C;  2FE3 A;  2A6H F;  3RDI A;  2QLZ A;  4EV0 A;  3Q9V A;  3GWZ A;  2HTS A;  3CO6 C;  1JHF A;  2Y0M A;  1YO5 C;  2EV6 A;  4A6D A;  3GUD A;  1O3Q A;  3RI4 A;  4GXO A;  2GA1 A;  4ESB A;  5HVQ C;  1KQ8 A;  4DNC A;  3H92 A;  4MQV A;  1EH7 A;  4KIF A;  1QZZ A;  3M1E A;  3ZMD A;  2EWN A;  1U5T A;  2GWR A;  3L7W A;  1I1S A;  3V7R A;  2DK8 A;  2EFO A;  1KGS A;  3ML6 A;  3E6C C;  2NNN A;  3DFG A;  5LRS A;  2A69 F;  2K02 A;  3ECH A;  3FF5 A;  1D3Y A;  1YW7 A;  4MTE A;  1ZRE A;  1I27 A;  2L4A A;  1HKT A;  4EM1 A;  1EH6 A;  1ZAR A;  2Z9O A;  4M74 A;  1ULY A;  4G6Q A;  3FM5 A;  4DQ2 A;  4HW0 A;  2W84 A;  3VOD A;  3TKY A;  1SMY F;  4I0A A;  3BRO A;  5D6F A;  4KN4 X;  3IKT A;  2PJP A;  5ERI A;  2CGP A;  4L5J A;  5KVR A;  2HTJ A;  2L02 A;  3NEU A;  1TQP A;  3LA7 A;  5HS7 A;  2GXG A;  2ZKZ A;  2HQR A;  2W57 A;  4OMZ A;  3RPU A;  3FXR A;  2LDU A;  2Z99 A;  2C6Y A;  3GFI A;  4WX9 A;  3ECO A;  4HF0 A;  5DCM B;  3PQK A;  2IW5 A;  4KUM A;  1P6R A;  1YYV A;  3L09 A;  1W4M A;  3FZV A;  2KJB A;  4GGG A;  2XKP A;  1GHC A;  3WTU C;  5E20 A;  4OIO F;  3IRQ A;  3F72 A;  4Q4Z F;  4M6Y A;  4LK1 F;  3GFJ A;  5AIQ A;  2VE8 A;  3QU3 A;  4BHB A;  5F64 A;  1JHH A;  3O6B B;  4RGS A;  2XAQ A;  3DP7 A;  3FMQ A;  3WE3 A;  1TQM A;  5D4S A;  1WRJ A;  3WG9 A;  2ZNZ A;  2ZO4 A;  4EM0 B;  4L9V A;  2AS5 F;  2XGX A;  1O3R A;  1PUE E;  1Y0U A;  4O3M A;  3FX3 A;  1WQ2 A;  3HYI A;  1Z6T A;  3V8L A;  2WTE A;  1U3E M;  3FHZ A;  3QU6 A;  4LG0 A;  2JRT A;  4NHJ A;  5IT9 Z;  4I0B A;  3EUH A;  1SAX A;  1MDM B;  1ZH5 A;  1FLI A;  5K1Y A;  1P4W A;  1F9N A;  2J5O A;  1HKS A;  3IWF A;  4YIF A;  2A3S A;  3GFL A;  1KQ0 A;  1LEA A;  2A6E F;  2ELH A;  2VN2 A;  2HKX A;  1K78 A;  1DDN A;  1U6G A;  2MLG A;  4R8H A;  4UV9 A;  1LNW A;  5BPI A;  2RV8 A;  1IRF A;  2FOK A;  1IXR C;  5DUI A;  5JVT A;  4QWQ A;  3I4P A;  3M7G A;  4XSX F;  1H9G A;  4HDV A;  4IHS A;  1MKM A;  5H20 A;  5FD6 A;  2D1H A;  4RB3 C;  1T2K A;  3R60 A;  2FSW A;  3KP6 A;  2YSR A;  3L9F A;  3DQV C;  1XGN A;  2M30 A;  4P9F A;  1ZYR F;  5JR3 A;  5CVI A;  1BIB A;  3KLO A;  4PGG A;  1T98 A;  2TDX A;  4CXF A;  1FBU A;  1TLH B;  2FBI A;  1R7J A;  3C18 A;  4HV6 A;  2H6B A;  1T39 A;  2P6S A;  4R1H A;  4ZYD A;  2FF4 A;  2R3S A;  3C1D A;  2XV4 S;  2DBB A;  3HOS A;  3BWG A;  2PG4 A;  1Q1H A;  5LGT A;  3LQR A;  3M8E A;  1HSJ A;  4KIG A;  5L3B A;  1Z9C A;  4CO8 A;  2HQN A;  1IXC A;  3TOB A;  3SFZ A;  1YFH A;  3H3U A;  2HGC A;  1FP1 D;  1J59 A;  4O6J A;  4RGU A;  4A0Z A;  1B6A A;  2IRF G;  3GYH X;  2XAH A;  3OOP A;  5LRR A;  1IN8 A;  1OPC A;  5ICG A;  2EFQ A;  3C7J A;  1H0M A;  3E5Q A;  3DPL C;  2PBI A;  1HXD A;  1ODD A;  4A2U A;  1W7P D;  3AAF A;  2FEZ A;  2OZU A;  2Z3Y A;  2P5V A;  2WV0 A;  1BI0 A;  5E1W A;  3F21 A;  1W5S A;  3P9I A;  2ZME A;  3B02 A;  4S04 A;  2HWV A;  3JTG A;  2MH9 A;  1S29 A;  2LKP A;  4LFU A;  3T5X A;  4P5O A;  4H0E A;  1U2W A;  3HOT A;  1STZ A;  1SFE A;  1OYY A;  3Q9S A;  4ZYE A;  2G9W A;  1XCV A;  2UWM A;  4YII A;  1SFU A;  2LF8 A;  2FXA A;  4I02 A;  1HW1 A;  3MZY A;  4HF1 A;  1BOA A;  5BMZ A;  1H9T A;  4G94 A;  2DPU A;  4EVI A;  1MJA A;  1GXP A;  1TW2 A;  2LNB A;  3CO7 C;  5L3G A;  3WOD F;  5E18 F;  1OR7 A;  3IWZ A;  1ZLK A;  2F5C A;  1UST A;  4IPA A;  3V8K A;  5LHH A;  2ISZ A;  3N4M A;  1IN7 A;  2VT2 A;  1O3T A;  4ENM A;  3F3X A;  4L0Z B;  5DV5 A;  4GYG A;  4LD5 A;  3WTV C;  1K79 A;  2OAZ A;  3S2W A;  4FX4 A;  3REO A;  5HDK A;  1I6X A;  5HDN A;  1XMK A;  4CZZ A;  4BXU A;  3JSP A;  2V79 A;  1U78 A;  5CVR A;  2IVM A;  3K0L A;  2LSO A;  2RQP A;  2XAS A;  4OU0 A;  4AD9 A;  5HLG A;  4ZYG A;  4YFX F;  2F5D A;  4HV5 A;  3ZMV A;  4GO1 A;  3CJN A;  4IHT A;  5D8L B;  2FQ3 A;  3G73 A;  3T8T A;  4P9U A;  1G3W A;  2PI0 A;  3RJP A;  1R22 A;  5BPD A;  2A68 F;  2ZNY A;  2E1C A;  1SD5 A;  1UCR A;  1S7O A;  3NQO A;  2D1V A;  4KMF A;  2A5Y B;  4Q47 A;  2R7D A;  4AIK A;  1O7F A;  3L00 A;  3DEU A;  3WTT C;  2BV6 A;  4XLN F;  3JSO A;  3FMR A;  4RB2 C;  1IUY A;  2COM A;  4G7Z F;  4U88 A;  1G3Y A;  3TO9 A;  2OQG A;  1FSE A;  5ILU A;  4YFN F;  1TTY A;  4I98 B;  3FXQ A;  5FFX A;  3HSR A;  3CUO A;  2DW4 A;  5LLQ A;  1HST A;  1USS A;  1FOK A;  4M71 A;  1F4K A;  2P5L C;  2ADU A;  2IA1 A;  1REP C;  2HYG D;  2V1D A;  3BJO A;  5AIP A;  3BDD A;  4Y17 A;  3MQ0 A;  4U0W A;  5HLH A;  4KYW A;  4BHP A;  1QBJ A;  2NNY A;  2IP2 A;  5D4R A;  1ZG1 A;  4ZZD A;  1ON2 A;  2M5W A;  3J7A O;  1Z6R A;  1UB9 A;  3LA2 A;  4HA8 A;  4EJV A;  4EGZ A;  4S05 A;  2DTR A;  1V4R A;  5BOX A;  2Z5U A;  1AWC A;  3RIR A;  4UV8 A;  4L18 B;  5LGU A;  1FBQ A;  1DP7 P;  2G7U A;  3SQN A;  1XSX A;  3SXY A;  4RS8 A;  3I5U A;  2RDP A;  4I01 A;  3WTW C;  3ZN0 A;  1BIA A;  2V6C A;  4KA4 A;  2A07 F;  4JBA A;  1BI1 A;  5HOO A;  1J0R A;  4U0Y A;  3J81 K;  4B8X A;  1XGS A;  1SFX A;  2ACJ A;  3TO6 A;  4EJU A;  4KNY A;  1UHM A;  3DF8 A;  3G3Z A;  3I0T A;  3KFW X;  2DAO A;  3LA3 A;  1JE8 A;  4OIP F;  3RKY A;  4LLN A;  1YQA A;  3KET A;  4BAY A;  1ZHF A;  5DYM A;  2CQK A;  3KP7 A;  2XRN A;  2VC0 A;  3EDP A;  1ZN2 A;  1ZG3 A;  6PAX A;  5FB2 A;  5DD8 A;  3WE2 A;  2YX4 A;  3GEZ A;  5E1X A;  3JW4 A;  3ZP5 A;  3GVA A;  4XRF A;  1QPM A;  3KP5 A;  1XCB A;  1E17 A;  5H6Q A;  2F2E A;  3C3W A;  4HZF A;  1J7K A;  4U0V A;  4F7Z A;  2XRO A;  1TNS A;  2LF7 A;  5AON A;  5FLX Z;  2VBY A;  1BJA A;  3CDH A;  4I2O A;  3GO5 A;  2R7F A;  3J80 Z;  1R1V A;  1XB4 A;  2QBY A;  1QGP A;  4B09 A;  3JAM K;  2M8E A;  2QWW A;  4XLP F;  2M45 A;  5D8K B;  3TO7 A;  4A0X A;  5H6R A;  3GFM A;  1QQI A;  3VEP A;  4D0P A;  2V1U A;  5E17 F;  3ROU A;  5CVJ A;  2O61 A;  2HR3 A;  5JHU A;  2IA0 A;  1U8R A;  4OIR F;  5A2Q K;  3HRU A;  1ZG5 A;  4IJA A;  2G7H A;  2XHK A;  5L3F A;  3LWF A;  3NRV A;  2NAZ A;  3KP4 A;  3KCC A;  2J5P A;  1KU3 A;  3ZMS A;  2P7V B;  1J75 A;  2H27 A;  3QOP A;  2OQR A;  2P6T A;  1LDK B;  5LEK A;  4RB0 A;  4UVB A;  2EB7 A;  4ASN A;  5DEQ A;  4G7H F;  3PQJ A;  1VTN C;  1KYW A;  4BYY A;  2QEN A;  4KN7 X;  1KU9 A;  4A0Y A;  3P9K A;  2AXL A;  1LQ1 A;  2L01 A;  2NRA C;  4OIN F;  2HFH A;  1B1B A;  1FBS A;  4EQQ A;  2H09 A;  3SZT A;  2P5K A;  2QYO A;  5K5Q A;  2P4W A;  3SHF A;  3EQL F;  5D6E A;  1Z05 A;  2BE5 F;  2MC3 A;  2L54 A;  3TGN A;  3I59 B;  4G8X A;  3RPQ A;  1KU7 A;  4N0B A;  4CIC A;  3H3Z A;  3RKW A;  1JXS A;  2KIM A;  3T8R A;  2RNJ A;  4WWC A;  1KU2 A;  5ED4 A;  1DPR A;  1Z91 A;  1FP2 A;  2O8X A;  2MD5 A;  4CDG A;  2E1N A;  3F8B A;  4MQ9 F;  3RYR A;  3O2P E;  4ESJ A;  5E8G A;  2L3D A;  1L0O C;  2QVO A;  1FX7 A;  1R23 A;  3KEQ A;  2ESH A;  4AIH A;  5ICE A;  1LDD A;  2IT0 A;  2FU4 A;  3IHU A;  2DT5 A;  1R5H A;  5J8C A;  4K2E A;  1MJ9 A;  1MJB A;  3JTH A;  5LBQ A;  3RTR A;  3N97 A;  4LLL A;  5D5V B;  5DDG A;  4EJT A;  4CYD A;  3U9G A;  1YG2 A;  5FD5 A;  2OZ6 A;  2CO5 A;  4WXC A;  3V7S A;  4ZH4 F;  3W6K B;  4ENN A;  2VOD A;  1XN7 A;  1L3L A;  3BJ6 A;  3K69 A;  3MCZ A;  1DPU A;  3P7N A;  4MEX F;  2H6C A;  3GX4 X;  1D8J A;  3HRM A;  3KLN A;  3BPX A;  1YW9 A;  2Q2E A;  1UFM A;  3TQN A;  2HYF A;  1T6S A;  2QZ8 A;  2GIV A;  1IZ1 A;  1EV7 A;  1U5T B;  1RUO A;  3WTY C;  1S6L A;  2B0L A;  1R00 A;  2CSO A;  3QRF F;  5LGN A;  5HLI A;  4A5N A;  5DCM A;  1O7L A;  1NHA A;  3I54 A;  5ICC A;  4RGX A;  3MEX A;  4HF2 A;  3F6O A;  3BJA A;  1GVJ A;  2VT3 A;  3IRR A;  4ENJ A;  2KRF A;  2QM3 A;  3HHG A;  2GZW A;  1HQC A;  2JPB A;  3DXJ F;  4I7H A;  4U7D A;  1RI7 A;  4OMY A;  4UXN A;  4OIQ F;  2FBK A;  1KYZ A;  2HEO A;  3B73 A;  3V4G A;  1F1Z A;  3E5U A;  2VE9 A;  5LEJ A;  2YX7 A;  2XUB A;  3HUG A;  2XKO A;  1IW7 F;  3ABT A;  4ON0 A;  1BI3 A; 
#chains in the Genus database with same CATH topology
 2W82 A;  2MLK A;  4AVP A;  4BJT A;  4E70 A;  3W2V A;  2P0W A;  3BY6 A;  4C3I J;  3OYH A;  5J6X A;  4WXH A;  1Y8R B;  2OV7 A;  2GQQ A;  2E19 A;  1OKR A;  3PSI A;  4M3G A;  4ZJZ A;  3BG7 A;  1TQI A;  3PNY A;  3CMY A;  1EKE A;  4BQQ A;  1V54 H;  2DFH A;  3DV8 A;  3E3V A;  2Q1Z B;  2JSC A;  2LR8 A;  2HOE A;  3CCR I;  2M87 A;  2OU2 A;  1MDM A;  2PLY A;  3T0Y A;  3LAJ A;  2EIM H;  4BQN A;  3BG5 A;  5KAF C;  2IGO A;  4P55 A;  2HXI A;  3E0J B;  2KT0 A;  5DUK A;  3HIF A;  1J5Y A;  2M3A A;  2WAF A;  3R61 A;  4RAY A;  3FK7 A;  2QSF X;  1X19 A;  4YEJ A;  4DYR A;  2EV5 A;  3EET A;  3LAP A;  1OYW A;  1PP8 F;  2BW3 A;  1J2X A;  1A5J A;  1WGX A;  2HVS A;  4BXX J;  4XM3 A;  2JT1 A;  2BVL A;  2VKE A;  1IN6 A;  3X2Q H;  1IF1 A;  5IYD J;  2LK2 A;  2RGV A;  2HDC A;  2BY3 A;  3HRT A;  1NTC A;  1LKX A;  4XID A;  4B48 A;  1WJB A;  2ZBK A;  2YU3 A;  4Y4R A;  2DMT A;  3LL7 A;  1JTX A;  5J1Y A;  1ZK8 A;  4Z2Y A;  4D7N A;  4IOA F;  4IF4 A;  2UZK A;  1B4A A;  3QP5 A;  2JVH A;  3ELK A;  1HDD C;  4AID A;  3T1B A;  2UXX A;  3V7C A;  3L2U A;  1POG A;  3OR2 C;  1P4A A;  2IS1 A;  1LVA A;  3MVP A;  3WTZ A;  2HQ5 A;  3QAH A;  2XF7 A;  3E6D A;  4YIR X;  4DZJ A;  3MFK A;  4MEY F;  1IAW A;  2NS7 A;  3I4M J;  2VL8 A;  1I50 J;  2F48 A;  4L9T A;  2VXZ A;  4BEH B;  2CYY A;  4QSH A;  1QHG A;  3A01 B;  3RZO J;  1K7A A;  2JK3 A;  1MGT A;  4RLF A;  2Y69 H;  5B3S H;  3EYI A;  2EPF A;  3I59 A;  2W25 A;  5IT9 K;  2PMU A;  1BW5 A;  4HBL A;  2IPQ X;  2JMW A;  2NVT J;  1ZLJ A;  1SD6 A;  3BP8 A;  3GLL A;  4IQ4 A;  1SD4 A;  1TNT A;  2DOA A;  3KPH A;  2QQB A;  3EPZ A;  5BQT A;  4WCG A;  4IRH A;  1W0U A;  1WI3 A;  2EIN H;  5JFR A;  1B9N A;  4A5M A;  2X0L A;  4JYK A;  2EH3 A;  1VQK I;  1YX5 A;  1HA8 A;  2M9H A;  4LB6 B;  4I09 A;  2CFO A;  2WWY A;  3ERM A;  4Y13 A;  2RC4 A;  3ONQ A;  2VJI A;  4CSW A;  3SZP A;  3BG9 A;  5KK1 A;  1R5G A;  2Y75 A;  1APL C;  1HW5 A;  5EEH A;  2Z1D A;  2V9V A;  3D5R C;  5CVU A;  1U9O A;  3IL2 A;  4KIC A;  4PFP A;  2DPD A;  3U2R A;  1S72 I;  1JUM A;  2OC6 A;  2KP6 A;  2UXN A;  2CW7 A;  2WAQ A;  3LFU A;  3HSF A;  3ESW B;  4XKV A;  3DPT A;  3BR5 A;  1SMT A;  3I71 A;  1VQ6 I;  2Q8K A;  5IT3 A;  3ERE D;  5IYB J;  3RKX A;  4IOC F;  4RGR A;  3ULQ B;  1FY7 A;  2Y0S A;  4G7O F;  1KON A;  3OV8 A;  4GYI A;  3O8H A;  3HOY J;  3WGH A;  1JT6 A;  1Z21 A;  5DD4 A;  4FX0 A;  5M5W J;  2LH9 A;  3H5A A;  4DW6 A;  2D2W A;  1RPW A;  2KL4 A;  1OCP A;  2BGC A;  1DUX C;  1P9Q C;  4PDK A;  2LMD A;  3K7A J;  3E6B A;  4PJJ A;  1C0W A;  3KP3 A;  4WF2 A;  4E7L A;  3AG2 H;  1I3A A;  1ETQ A;  4PGH A;  5F0F A;  4HDU A;  2HPI A;  1T0F C;  3MD2 A;  3LSR A;  2M8G X;  1SD7 A;  4MTD A;  3MZH A;  4FAS D;  1I5Z A;  4ITV A;  2M34 A;  3BTI A;  1W5T A;  4HLX A;  5FLV A;  4M9S A;  4XR6 A;  4CHU A;  1MZB A;  1JJ6 C;  2XSD C;  1Z7L A;  2ESN A;  3ZXS A;  3K4L A;  1JKQ C;  4UUS B;  3D5L A;  3VFZ A;  2DJI A;  3ZGK A;  2PMZ A;  2CFX A;  2O03 A;  4TV7 A;  4PUS A;  2RN7 A;  2BOL A;  3ZMU A;  1CGP A;  1O57 A;  5EGO A;  2EA4 A;  3RCO A;  4G9Y A;  3BZ6 A;  5ILV A;  2R7O A;  5JLW A;  2Y9Y A;  3K1M A;  2W85 A;  4R79 A;  3HHH A;  2WV1 A;  2P7C B;  1R1U A;  4CCJ A;  2D45 A;  4HNU A;  3LMM A;  2DN0 A;  2XAJ A;  3E1S A;  3OYB A;  3G1M A;  2Y31 A;  5CLS A;  5E3O A;  3HB9 A;  5DCF A;  3A1Y A;  2HYJ A;  5L3C A;  2IS4 A;  5F1J A;  1XGM A;  1ERD A;  3B6C A;  1IN5 A;  1ON1 A;  3H9G A;  4UVA A;  2OBP A;  5JI6 A;  3D5S C;  4KT6 A;  1V3F A;  4PSW A;  3ABU A;  5E8I A;  1Z9C A;  4DJA A;  4CGZ A;  4NBQ A;  4MO7 A;  1SAU A;  1ZGJ A;  3VOE A;  5C44 J;  3I58 A;  3OMY A;  2WA0 A;  2ZME B;  3WGG A;  3CCL I;  2F6C A;  1FYK A;  3GW2 A;  4G6T B;  1UG2 A;  2D5V A;  2PJR B;  1IRG A;  1S7E A;  2ZXJ A;  3W3C A;  3CUQ C;  4XKW A;  1QU3 A;  2NYX A;  2FMY A;  4EJO A;  4EGY A;  1PP7 U;  3BOQ A;  1YW8 A;  5HS8 A;  2X1E A;  3IC7 A;  3V8J A;  1QZY A;  3GF2 A;  2OTL I;  4KIB A;  3U1D A;  4MLO A;  4BS9 A;  1ZGA A;  2BEO A;  2DOF A;  2HKO A;  2YPR A;  2BYV E;  1ZRF A;  2TCT A;  2EFP A;  1CF7 B;  3FWE A;  4ESF A;  4A3F J;  2OD5 A;  4CCK A;  4BU2 A;  3FMS A;  4AYB A;  2GOX B;  4A69 C;  1KZH A;  2MBF A;  4ZDL A;  3DKW A;  3ZOB A;  2X6O A;  1ZRD A;  4RA2 A;  1Z7U A;  1H89 C;  4FIS A;  2X1D A;  3M4O J;  1HBX G;  4XL9 A;  3QP6 A;  4NNJ A;  2LVS A;  3CTA A;  1QA6 A;  3WG7 H;  2VC1 A;  2HZT A;  4HG2 A;  2EIJ H;  1FIA A;  3F8M A;  2GIZ A;  4M3B A;  4ZYH A;  4UVC A;  3TDZ C;  2O0Y A;  2BXZ A;  1A04 A;  4GCV A;  3L2Q A;  3GTG J;  1ETY A;  3W6J B;  2PFB A;  2IS2 A;  3W6V A;  3F8N A;  5TRD A;  4A3K J;  1FYL A;  3QWL A;  3K4J A;  4UHT A;  1FNN A;  4HPQ A;  1XDS A;  1BI2 A;  4M73 A;  3WU0 A;  5IYC J;  4Q5S F;  4M72 A;  4HX7 A;  2KJC A;  5KCM A;  5TIS C;  5EZH A;  2QEX I;  2M2E A;  2VIX A;  1OJL A;  2F4M B;  2ECB A;  3HGG A;  3LSJ A;  2W24 A;  2KIF A;  3PNV A;  3QYF A;  3HBL A;  3OSG A;  2ZC2 A;  3PUB A;  2K85 A;  4JK1 X;  1G6N A;  5D5U B;  2BY1 A;  3H9Q A;  3WTX C;  4PK4 A;  2VKD A;  2W7N A;  1U5T C;  3J7Y J;  4EMS A;  3S32 A;  4XBF A;  2E36 A;  1JGS A;  3OYN A;  3FXU A;  5F04 A;  2CQQ A;  2KRC A;  3EYY A;  1R49 A;  3WHC A;  1XD7 A;  4F93 B;  3S2H J;  3I55 I;  3IH4 A;  2VON A;  2CUJ A;  2CU7 A;  3E97 A;  4Q48 A;  2MG4 A;  4DYQ A;  3DBL B;  3OYI A;  3ZPL A;  1LDJ A;  2FBH A;  1FC3 A;  1MND A;  4HQE A;  3CP8 A;  2HPM A;  1K6O A;  1IXS B;  4M3D A;  1FIP A;  4MGR A;  2Y30 A;  1JJ8 C;  1EH8 A;  4M6X A;  4BEH A;  3O8G A;  4ENK A;  2PN6 A;  5E3M A;  3A01 A;  2GA2 A;  4HOB A;  1T8I A;  4RB1 A;  1ZRC A;  2X85 A;  2MA3 A;  1XS9 A;  2ETH A;  4RAG A;  2E7W A;  1XDU A;  1YTY A;  4L5I A;  1R9T J;  3DPU A;  3GZ6 A;  3TOA A;  1TL8 A;  2L4M A;  3LQQ A;  4C30 A;  1D1B A;  3HTS B;  3E6M A;  1WSU A;  3JRI A;  1RZ4 A;  1YS6 A;  5ILS A;  3S1M J;  2JA7 J;  1Y1W J;  4BH9 A;  1W7P B;  3NWS A;  4NB5 A;  9ANT A;  2E2J J;  3P9C A;  2K4J A;  2R4G A;  3ZQQ A;  1IRZ A;  3OYD A;  5FJ8 J;  4MFD A;  1MBH A;  3GZ5 A;  5IY5 H;  3R0J A;  4ETS A;  1Z1D A;  2WBM A;  1IGN A;  2R7X A;  1V5F A;  4BQO A;  2R92 J;  2Y0S N;  1AOY A;  1BBY A;  5HS9 A;  1HF0 A;  5HNF A;  2X1C A;  4C3J J;  2FX0 A;  2EFW A;  4IHX A;  3S15 J;  4YEL A;  4BBS J;  5CJ9 A;  1TW3 A;  2WY8 Q;  4KFC A;  3S1R J;  3M9A A;  4XN3 A;  1LVK A;  1JUP A;  2X48 A;  2KIU A;  2FML A;  4L0Y B;  1P4X A;  4BUP A;  2DFE A;  2K7L A;  2EJR A;  1VQN I;  2Z33 A;  1ACI A;  3NAU A;  2HVQ A;  4E7J A;  4JQF A;  3K2Z A;  2EQR A;  4NUB A;  2L7K A;  1TWC J;  1WWX A;  1D5Y A;  3C2B A;  2P8T A;  1GXQ A;  1FSH A;  1Y1V J;  3M3Y J;  3H1C A;  1X3U A;  2KHM A;  3DBH B;  2A61 A;  2FRH A;  1RNL A;  4Y3O A;  2V1X A;  1MMG A;  4XLF A;  3K4M A;  2QF7 A;  4BKX A;  2GLO A;  3Q5F A;  1HLV A;  3HSE A;  2R5Y B;  1LB2 A;  2M7A A;  3HGY A;  2EA2 A;  3WTS C;  3Q0U A;  5CKT A;  3CF2 A;  2AO9 A;  3K4C A;  3DKY A;  3CUQ B;  2XAF A;  3KE2 A;  4EM2 A;  3J81 Z;  1G4D A;  3WU2 C;  3KZI C;  2R5Z B;  2JTV A;  2EV0 A;  2K9Q A;  3MN2 A;  1VQ7 I;  3HOW J;  3HM5 A;  1FYM A;  2X4H A;  1P92 A;  3LST A;  4LJZ F;  4CCO A;  4NC6 A;  1X1P A;  2VBZ A;  1LEB A;  5F0C A;  4B47 A;  2R0Q C;  1D5V A;  2AQE A;  2M0C A;  4HAM A;  2IGK A;  5M5Y J;  4NC7 A;  2E34 A;  2EZK A;  3F22 A;  4XRM A;  1TT5 B;  1BR2 A;  3K4B A;  2HS5 A;  3EUH C;  2RRE A;  4IXA A;  2LBF B;  1IO2 A;  5EEA A;  4UUV A;  2XSJ C;  4ZZL A;  5K7H A;  2OA4 A;  1XGO A;  2V9K A;  5F6F A;  1TP4 A;  4FET A;  3TDU C;  2KLO A;  5K5O A;  4CZC A;  1RRJ A;  2DFF A;  1S7A A;  2QQA A;  3HEF A;  1FTZ A;  1FT9 A;  3CJT B;  4PJM A;  4BNC A;  4OAY A;  5GPC A;  1ZKG A;  2XIG A;  1QO0 D;  3MWM A;  4HX8 A;  2EK5 A;  2ID6 A;  2H94 A;  1W5C C;  3PO3 J;  3CMM A;  3UR3 C;  4NQW A;  3QPH A;  4V2F A;  1R36 A;  2VI6 A;  3K6G A;  2Z16 A;  1MSF C;  3CLO A;  4IRI A;  1F5T A;  3KP2 A;  2IXS A;  1JKR C;  1BC7 C;  4BQA A;  2DT6 A;  2ZJP F;  1T95 A;  4C2M J;  3VB2 A;  4U7B A;  5E3L A;  4B3X A;  1ETX A;  2PMH A;  4FT8 A;  2DU9 A;  4AM3 A;  3ZQ7 A;  4CH7 A;  1OLT A;  4HQM A;  5TJJ A;  1O3S A;  1XSD A;  2VOO A;  1BC8 C;  3H36 A;  3SEQ A;  1AHD P;  2BHY A;  4L9N A;  4G6D A;  2GAU A;  1WJ5 A;  1ONV A;  4A6E A;  5DM6 F;  4LB5 A;  2DYS H;  2ZCW A;  1RKW A;  2JPC A;  3S93 A;  1QNT A;  3ZQG A;  3L2C A;  2PJR A;  1I3Q J;  2CG4 A;  4Y7N J;  4L9J A;  1MH3 A;  4N9I A;  2STW A;  2DO7 A;  2KRH A;  3PFI A;  4PJ0 C;  3S14 J;  4AWX B;  5D5W B;  1YS7 A;  2DMU A;  2XVC A;  4LK0 F;  3S1N J;  3M1C A;  1CF7 A;  1IC8 A;  3QYE A;  3F23 A;  5F08 A;  2QQ9 A;  5M3F J;  1B9M A;  1X2N A;  2F5E A;  3PIO F;  1HW2 A;  2MH2 A;  5GAH J;  1BR4 A;  2DK5 A;  2WC2 A;  3ZMT A;  3CCV I;  2ZJ2 A;  3O3K A;  2OCC H;  4HYE A;  1U9N A;  4WXD A;  4X6A J;  3JAM Z;  4HRI A;  3DEW A;  2K9S A;  4A12 A;  2YR2 A;  3LSG A;  1QPI A;  2E1M C;  2GM4 A;  3E5X A;  2V1N A;  3ABM H;  3F8F A;  1SFK A;  3A4C A;  3I9V 2;  5FFZ A;  2CV2 A;  5CYV A;  1SEU A;  1LFU P;  4ABZ A;  4BDZ A;  1D8K A;  2JZY A;  2VAS A;  3WGI A;  1T38 A;  2BBY A;  2DQL A;  1FOW A;  2VBX A;  4N9H A;  2KPM A;  2XAG A;  2R93 J;  2FA5 A;  1WI9 A;  1OMI A;  3D1N I;  4YFK F;  1MD0 A;  2KDO A;  3MKZ A;  1P2F A;  2PQ8 A;  5J1R A;  4O5V A;  4HLY A;  1B59 A;  1V5E A;  3BTL A;  1BM9 A;  2VOP A;  1FPQ A;  5B5E C;  1PYV A;  2FNP A;  3OIQ A;  5EJC A;  2GXB A;  3FXO A;  3IKV A;  1N78 A;  4ZC3 A;  1IN4 A;  3KX2 A;  4MHG A;  5A2Q Z;  3CES A;  3HPH A;  5FO5 A;  2DI3 A;  4M9X A;  4XSZ F;  1FWZ A;  5FLX K;  4PJN A;  3SYT A;  3K9T A;  1R58 A;  4RAZ A;  3SDB A;  1RUN A;  5J47 A;  2E7X A;  3KEO A;  1MMS A;  2K4B A;  3KZY A;  3LOC A;  4BAC A;  1DQU A;  3J80 K;  1K4T A;  2ISY A;  4M9Z A;  2DOD A;  3OYA A;  1J9I A;  2O6G E;  4FHT A;  2QBY B;  5CPR B;  1GDT A;  3I64 A;  3GTL J;  1OYI A;  1JUS A;  2STT A;  2K86 A;  3LFK A;  4QPQ A;  4JX6 A;  3IAM 2;  3FM3 A;  5E1Z B;  4D7M A;  4AIJ A;  4E7H A;  1MMN A;  2IBD A;  3IH2 A;  3R6S A;  1FZP B;  1TBX A;  5L3E A;  3MZ8 A;  3K70 D;  3F8C A;  2ZME C;  3I53 A;  1R1T A;  2ZFW A;  2QSH X;  3VYT B;  3PIP F;  3CCE I;  3BR3 A;  1T0F A;  2Y48 A;  2XPW A;  1I1G A;  1MBK A;  5K5R A;  4OOI A;  2QUF A;  4HNT A;  3BR0 A;  4FE7 A;  4EEF G;  2RVC A;  1XMA A;  3F6V A;  1E2X A;  2CV0 A;  2CW0 F;  4DZP A;  1E3P A;  3GTP J;  4UNO A;  2IJL A;  4KIT B;  3HTU A;  1W7P A;  1ZAO A;  3IH3 A;  1W1W E;  3GXO A;  2M1B A;  4PCQ A;  1B8I B;  3M8J A;  2DLL A;  4UB8 C;  2PEX A;  4KDP A;  4A3B J;  3ZMZ A;  3QPT A;  2K27 A;  5D5X B;  1RIO H;  3K1P A;  3COA C;  3Q0W A;  3BPV A;  1WHU A;  3EUA A;  4Y52 J;  1E3H A;  2DQR A;  2HQA A;  2O3F A;  4HX4 A;  4LG0 B;  3ZN1 A;  2LY1 A;  3K10 A;  2XF5 A;  2I5U A;  5E3N A;  2KIQ A;  3L2R A;  3MKL A;  1OCR H;  2QKM B;  1ETV A;  1YJW I;  5EEG A;  4YG2 F;  3HOZ J;  5FGM A;  3GLX A;  2H8W A;  3D0S A;  4MNU A;  4PZJ A;  2IA2 A;  1OR7 C;  1GT0 C;  1S8N A;  3R4K A;  3HRS A;  1K78 B;  2P81 A;  3FK6 A;  3U21 A;  2KDZ A;  3JCU C;  2EFN A;  1GUU A;  2ME0 A;  3CCY A;  1QVU A;  5F1R A;  3WU1 B;  2BVM A;  3RSN A;  3ISP A;  3QYB A;  3RKQ A;  1BN5 A;  1S9H A;  2W1O A;  1G3T A;  1S3J A;  2EIL H;  4B43 A;  3DU6 A;  2WY7 Q;  3RYP A;  5LHG A;  3BTJ A;  2R5Y A;  2NVY J;  1HCR A;  5L3D A;  4M3E A;  4OAZ A;  1NK3 P;  4KT5 C;  2ZXI A;  1MW7 A;  1KQ9 A;  3R0A A;  5LFA A;  3CF5 F;  2R7V A;  2F5F A;  4N4N B;  1P7I A;  3OIP A;  5HDG A;  3CUQ A;  5ICF A;  2QGU A;  5K7Z A;  1MMA A;  1KA8 A;  1XSV A;  3G71 I;  1YIJ I;  2B9S A;  3M8F A;  2NS0 A;  2Y2Z A;  4QLC U;  5J8F A;  2R5Z A;  1HKQ A;  3SEZ A;  4HNV A;  1LJ9 A;  3MAJ A;  2VKH A;  2UUZ A;  3F9K A;  5M3M J;  1WKM A;  5CVV A;  2FNA A;  4BHC A;  2Q0O A;  2L7F P;  1HC8 A;  4KMU X;  4Y15 A;  4LGW A;  2VBW A;  2DFI A;  1G3S A;  1WJE A;  1Y8Q B;  4WK8 F;  3K1N A;  1YLF A;  3P5J A;  4P96 A;  2KMU A;  4LMY A;  3KYL A;  5LHI A;  3S3M A;  4IRG A;  4BBR J;  4EJW A;  1UHW A;  2RKH A;  1FJL A;  3CP2 A;  4XKB A;  2R7U A;  4E7Z A;  5BS6 A;  4D5F A;  1YRN B;  5E79 C;  2CWE A;  2KKO A;  2NOJ B;  5J4V A;  3KZZ A;  4LLG F;  1YIO A;  2E1M B;  2ZB9 A;  4G12 A;  4IVN A;  1PDN C;  2RQQ A;  3KIO A;  2FE3 A;  4BY1 J;  1XMX A;  2A6H F;  2K3F A;  2LC2 A;  3RDI A;  5GAE J;  2QLZ A;  2FD5 A;  4EV0 A;  3L2W A;  2DJN A;  3GWZ A;  2HTS A;  3Q9V A;  3MKY B;  3CO6 C;  1OCT C;  1JHF A;  2Y0M A;  1YO5 C;  1X3W B;  2EV6 A;  2HI3 A;  4A6D A;  4W1U A;  3GUD A;  1O3Q A;  1YJ9 I;  1JGG A;  2LOO A;  3RI4 A;  2L9S A;  4JX5 A;  1M1E B;  4GXO A;  2VQL A;  4A3D J;  2GA1 A;  2Z2S B;  2ZJQ F;  3HKZ A;  4J00 A;  1VQL I;  4ESB A;  5HVQ C;  2IAI A;  5GTH C;  1KQ8 A;  1VQM I;  4DNC A;  1PUF B;  3FKJ A;  3OYK A;  3H92 A;  4MQV A;  1EH7 A;  4KIF A;  1QZZ A;  1G59 A;  3M1E A;  2L9V A;  4NDL A;  3ASN H;  3ZMD A;  4AUX A;  2EWN A;  3VYR B;  1U5T A;  2GWR A;  3L7W A;  2DCE A;  5GAG J;  1I1S A;  1DU0 A;  3V7R A;  1R4M B;  3K4N A;  1OIS A;  2DK8 A;  2DDB A;  2OPT A;  2EFO A;  1KGS A;  3ML6 A;  3JRC A;  3E6C C;  3G1L A;  1VQ9 I;  2NNN A;  3OYJ A;  1ENH A;  3DFG A;  2ZFU A;  2ZXW H;  3PFY A;  3TP0 A;  1R5I D;  2A69 F;  5LRS A;  2K02 A;  3ECH A;  1X1D A;  2DYR H;  3FF5 A;  1D3Y A;  1YW7 A;  2EIK H;  3LSK A;  4MTE A;  1JT0 A;  1ZRE A;  1I27 A;  1DGW Y;  2L4A A;  1MBJ A;  2I8D A;  4DIQ A;  1LUJ B;  1HKT A;  1QZE A;  2VB6 A;  3LSH A;  4EM1 A;  2FQ4 A;  1EH6 A;  1ZAR A;  2Z9O A;  4M74 A;  3HJE A;  1ULY A;  4G6Q A;  3FM5 A;  4DQ2 A;  5BNG A;  4HW0 A;  1FOY A;  2W84 A;  1IJW C;  1TC3 C;  3ZQI A;  2MYS A;  4Y33 A;  3UNG C;  3J7Z I;  2CUE A;  3VOD A;  1UEL B;  3OY9 A;  3TKY A;  2R7R A;  2DTZ A;  1UMQ A;  1SMY F;  4I0A A;  3BRO A;  1B72 A;  5D6F A;  4KN4 X;  3IKT A;  2PJP A;  5ERI A;  2CGP A;  4L5J A;  5KVR A;  1NK2 P;  2HTJ A;  1WZ2 A;  4A3C J;  2L02 A;  3NEU A;  1D0Z A;  1TQP A;  2VQG A;  2XGC A;  3DLA A;  2VXD A;  1BW6 A;  2VQC A;  2RNG A;  3LA7 A;  5HS7 A;  5DTD A;  2ZSI B;  2M4K A;  1MBF A;  1O4X A;  2GXG A;  2ZKZ A;  1E3O C;  3U1K A;  1BR1 A;  2XB0 X;  2HQR A;  3PSF A;  4XNF A;  2DDA A;  2W57 A;  4OMZ A;  1ZR2 A;  5EG0 A;  2G0E A;  1MMD A;  3RPU A;  3FXR A;  4XOT A;  1W36 D;  5EDN A;  2JSP A;  2LDU A;  2Z99 A;  2C6Y A;  3GFI A;  1AKH B;  5J40 A;  4WX9 A;  3ECO A;  1IDY A;  4HF0 A;  5DCM B;  4BDY A;  3PQK A;  4IZZ A;  2IW5 A;  1ZGW A;  4KUM A;  1P6R A;  2NXN B;  2K5C A;  1DU6 A;  1YYV A;  3L09 A;  1W4M A;  2LYC A;  3FZV A;  2KJB A;  3HOU J;  3KYC B;  4GGG A;  2BZT A;  2XKP A;  1GHC A;  3WTU C;  5E20 A;  3CCJ I;  2CUZ A;  4OIO F;  3IRQ A;  3F72 A;  3JRB A;  3BT9 A;  4Q4Z F;  1N77 A;  4LK1 F;  4M6Y A;  3GFJ A;  5AIQ A;  2VE8 A;  3QU3 A;  4BHB A;  2ME6 A;  5F64 A;  1JHH A;  1WFX A;  2NOG A;  4CYC B;  2H8R A;  1ZEL A;  3PJR A;  1SAN A;  1BL0 A;  3O6B B;  4RGS A;  2FJ1 A;  2XAQ A;  1Z77 A;  5IPA A;  3DP7 A;  4DOZ A;  3FMQ A;  3FXK A;  3WE3 A;  1RR8 C;  1X2M A;  1TQM A;  5D4S A;  1WRJ A;  3WG9 A;  2ZNZ A;  3DKX A;  3FDY A;  3H9J A;  2ZO4 A;  3PL8 A;  4EM0 B;  3J7A Y;  2NS8 A;  4M3F A;  3HDD A;  2DMQ A;  2JJ7 A;  4L9V A;  4IL6 C;  2AS5 F;  2DOE A;  2XGX A;  1O3R A;  1PUE E;  1Y0U A;  3BR6 A;  2COB A;  4E6K G;  4RM3 A;  4O3M A;  3L2V A;  2AHQ A;  3FX3 A;  4XIC A;  5FKO A;  1WQ2 A;  3HYI A;  1B8I A;  2KZG A;  3B6A A;  3OYF A;  1Z6T A;  3V8L A;  2WTE A;  1U3E M;  2JUC A;  5F27 A;  3G4S I;  3DLL F;  3FHZ A;  4QIW N;  1DGR M;  2CJJ A;  3QU6 A;  4LG0 A;  1RKT A;  1NG7 A;  3ABK H;  1YJN I;  2JRT A;  2Y9Z A;  3S8P A;  4NHJ A;  5IT9 Z;  1X1C A;  3CC7 I;  3LSM A;  4I0B A;  3EUH A;  1SAX A;  1MDM B;  1ZH5 A;  1FLI A;  5K1Y A;  5KNL A;  1P4W A;  1F9N A;  2J5O A;  2CV1 A;  1HKS A;  3IWF A;  4YIF A;  3S2D J;  2A3S A;  4CCL A;  3OS2 A;  3GFL A;  1KQ0 A;  1LEA A;  2A6E F;  3L1P A;  2ELH A;  2VN2 A;  2EZH A;  5J3L A;  2HKX A;  1K78 A;  3BLY A;  1DDN A;  1U6G A;  2ZXH A;  2MLG A;  1YHQ I;  4R8H A;  1PVE A;  1TZL A;  4XLA A;  2IGM A;  4UV9 A;  1LNW A;  2VPR A;  1NH3 A;  5BPI A;  1Y0N A;  1OFC X;  2RV8 A;  4E7I A;  1A6Q A;  3TW7 A;  1IRF A;  3ZQL A;  2FOK A;  4IKF A;  1IXR C;  5DUI A;  2MSY A;  2V7F A;  5JVT A;  3JR9 A;  2L9N A;  4I76 A;  4QWQ A;  3PO2 J;  3I4P A;  3M7G A;  4XSX F;  1H9G A;  4HDV A;  4IHS A;  1MIJ A;  1MKM A;  4FQG A;  4NC8 A;  5H20 A;  5FD6 A;  2D1H A;  4RB3 C;  1T2K A;  3R60 A;  2FSW A;  3KP6 A;  2R7W A;  4IX7 A;  2YSR A;  2XGD A;  3L9F A;  3DQV C;  4A3L J;  1XGN A;  2EZL A;  1ORK A;  2M30 A;  2QCO A;  4P9F A;  1SVM A;  1ZYR F;  5JR3 A;  2LLK A;  5CVI A;  2W00 A;  1BIB A;  3KLO A;  4JX4 A;  4PGG A;  3CQZ J;  4I99 C;  4QTR A;  4D1Q A;  3SZG A;  1T98 A;  2TDX A;  4CXF A;  4A3J J;  3TED A;  2DA4 A;  2LTP A;  1FBU A;  5TGT A;  1TLH B;  2FBI A;  3ZCO A;  1R7J A;  3HPG A;  1SVO A;  2MW8 A;  3C18 A;  4HV6 A;  2H6B A;  2ZJR F;  2CH0 A;  1T39 A;  2CS3 A;  2P6S A;  3OR1 C;  1VQ4 I;  4R1H A;  4ZYD A;  2FF4 A;  2R3S A;  3C1D A;  2XV4 S;  2DBB A;  3HOS A;  5DS9 A;  3HKZ N;  2E35 A;  3VYS B;  3OL3 A;  1MH4 A;  3BWG A;  2PG4 A;  1Z3Y A;  2H1L A;  4X1E A;  1DP3 A;  2N8G A;  1Q1H A;  4E4H A;  4UUS A;  2F4O B;  4ZDO A;  3K4K A;  1A36 A;  4XQF A;  5LGT A;  3LQR A;  3M8E A;  1HSJ A;  4KIG A;  4A93 J;  1IRX A;  2B7E A;  4CO8 A;  5L3B A;  1GV2 A;  2HQN A;  3CJR B;  1IXC A;  2ECC A;  2K40 A;  2RAE A;  3TOB A;  3BCA A;  3SFZ A;  1YFH A;  3H3U A;  2HGC A;  1PUF A;  1FP1 D;  1J59 A;  3TP3 A;  4O6J A;  4RGU A;  2X51 A;  4XOR A;  4A0Z A;  1B6A A;  2IRF G;  4XN0 A;  3GYH X;  2XAH A;  3OOP A;  5EZG A;  5LRR A;  1FMV A;  3GTJ J;  2JA8 J;  3NWT A;  1VQ8 I;  1IN8 A;  3OYC A;  3VYU B;  4B3A A;  1OPC A;  5ICG A;  4ZTJ A;  2EFQ A;  1D1C A;  3C7J A;  1H0M A;  2HOT A;  3FBN B;  1AU7 A;  4P1W A;  3E5Q A;  3DPL C;  3BQY A;  5FRN A;  1Y6I A;  2PBI A;  1HXD A;  1ODD A;  4A2U A;  4RM2 A;  1W0T A;  1W7P D;  4IHY A;  3AAF A;  1TWH J;  4BE2 A;  2FEZ A;  2OZU A;  2Z3Y A;  2P5V A;  2WV0 A;  1BI0 A;  1T56 A;  4PFO A;  5FKN A;  4E7K A;  2VPL A;  5E1W A;  3F21 A;  1W5S A;  3P9I A;  3G1O A;  2ZME A;  5JHF A;  3B02 A;  2E60 A;  4S04 A;  3OIO A;  4X0G A;  2HWV A;  5HNH A;  3JTG A;  2MH9 A;  1S29 A;  4XLH A;  2LKP A;  4LFU A;  3T5X A;  4P5O A;  4H0E A;  1U2W A;  3HOT A;  3LSI A;  4V19 K;  5GAD J;  3A03 A;  5C3E J;  2R7Q A;  1GVD A;  2JVG A;  2LRE A;  3HG9 A;  1STZ A;  1SFE A;  5EGO B;  4N4O B;  4C2T A;  1OYY A;  3Q9S A;  4ZYE A;  1D1A A;  2G9W A;  2E5N A;  1XCV A;  2UWM A;  3JRF A;  4YII A;  1SFU A;  2LF8 A;  3FIW A;  2FXA A;  4I02 A;  2E2I J;  1HW1 A;  3MZY A;  1XG1 A;  4HF1 A;  4FTH A;  1BOA A;  3TL4 X;  5BMZ A;  1H9T A;  2QKL B;  5F0H A;  2IS6 A;  1OCO H;  2EZI A;  1AKH A;  4G94 A;  3EUK L;  2DPU A;  4EVI A;  1MJA A;  1P7J A;  1G8X A;  4BE0 A;  1GXP A;  1VF9 A;  1TW2 A;  2LNB A;  3LSP A;  3CO7 C;  5L3G A;  1MBG A;  4XLE A;  4IQJ A;  3CDI A;  3WOD F;  5E18 F;  1OR7 A;  3IWZ A;  3TBI A;  1ZLK A;  1WJC A;  2DA7 A;  1K4S A;  2BXY A;  2F5C A;  2K9L A;  2X9D A;  1UST A;  4CCN A;  3BZC A;  1FOX A;  4II3 A;  5FRO A;  2OUM A;  4IPA A;  3V8K A;  1HDP A;  2E5Z A;  4A3E J;  2MFZ A;  5LHH A;  2ISZ A;  3N4M A;  1IN7 A;  2VT2 A;  1MSE C;  1IDZ A;  3QQA A;  1R71 A;  1O3T A;  4ENM A;  3G6E I;  3CCU I;  3F3X A;  3KYD B;  3ASO H;  4L0Z B;  2KIS A;  5DV5 A;  4GYG A;  4LD5 A;  3WTV C;  1K79 A;  1ITY A;  2OAZ A;  3FXJ A;  3QOD A;  3REO A;  3S2W A;  4FX4 A;  5IOZ A;  2XB5 A;  3H5R A;  5B1B H;  1I6X A;  5HDK A;  5HDN A;  1XMK A;  4CZZ A;  4BXU A;  3JSP A;  3H35 A;  3N05 A;  2V79 A;  1U78 A;  5CVR A;  2IVM A;  3K0L A;  4PJL A;  3CME I;  1BOB A;  2LSO A;  2RQP A;  2XAS A;  4OU0 A;  4F92 B;  4AD9 A;  1OQY A;  4IHW A;  2HZD A;  5HLG A;  4ZYG A;  4YFX F;  3NAR A;  1N25 A;  2F5D A;  3I56 I;  2HU9 A;  4HV5 A;  3ZMV A;  5KHD A;  4GO1 A;  3CJN A;  4IHT A;  5D8L B;  2IGN A;  4FCY A;  2H1K A;  2FQ3 A;  3G73 A;  3T8T A;  2OJE D;  4P9U A;  1F43 A;  1G3W A;  1X1A A;  2PI0 A;  2E2H J;  3RJP A;  1R22 A;  2LFB A;  5KAI C;  2X6W A;  4BGD A;  3GTQ J;  5BPD A;  5FRM A;  1X1B A;  2A68 F;  2ZNY A;  2E1C A;  1SD5 A;  1V55 H;  2ZSH B;  1UCR A;  1S7O A;  3NQO A;  2D1V A;  3A02 A;  1YIT I;  5FKL A;  1D0X A;  4KMF A;  3HC7 A;  4BXF A;  4RDU A;  2A5Y B;  3LNQ A;  1FEX A;  2ELJ A;  1K61 A;  4Q47 A;  2R7D A;  3CMA I;  1O7F A;  2HXO A;  4AIK A;  3L00 A;  3DEU A;  3DEE A;  3WTT C;  1VND A;  2BV6 A;  4XLN F;  3JSO A;  2CW8 A;  3C2H A;  4J19 A;  3SDG A;  3FMR A;  4CCM A;  2CQ7 A;  4RB2 C;  3GCM A;  2L9R A;  1IUY A;  3OYE A;  2COM A;  4G7Z F;  3HOX J;  4U88 A;  3HZJ A;  1G3Y A;  3TO9 A;  3C2G A;  2OQG A;  2BY2 A;  1FSE A;  3VDX A;  1X4O A;  5ILU A;  4YFN F;  1TTY A;  4CA0 A;  4I98 B;  4MFE A;  1H88 C;  2MGQ A;  4DBR A;  3FXQ A;  2VJ4 A;  1UJ8 A;  3OOU A;  4IO9 F;  1Z3X A;  4LG3 A;  4XKC A;  5J1U A;  5FFX A;  1FTT A;  3HSR A;  3CUO A;  4BL0 B;  4KIS A;  2X6Y A;  2GXA A;  1OCC H;  1A6I A;  1UG0 A;  3Q3S A;  2DW4 A;  5LLQ A;  1HST A;  4A3G J;  1YOV B;  3H5N A;  1USS A;  1FOK A;  2XF6 A;  4C9Y A;  4M71 A;  1F4K A;  2P5L C;  2XPU A;  2ADU A;  2IA1 A;  1REP C;  1VQP I;  5JVG F;  2HYG D;  2V1D A;  5IOY A;  2LY2 A;  3BJO A;  2VJ5 A;  2XC7 A;  5AIP A;  2L5Q A;  3BDD A;  4Y17 A;  3MQ0 A;  4DYC A;  3RPU D;  4EAT A;  4U0W A;  5HLH A;  4KYW A;  4BHP A;  1QBJ A;  2NNY A;  1YX3 A;  4BE1 A;  1WJD A;  2IP2 A;  3CC4 I;  5D4R A;  3S16 J;  1ZG1 A;  1ETW A;  1K6Y A;  4GDF A;  2O7O A;  4BJ6 C;  3UKG A;  4ZZD A;  1ON2 A;  2M5W A;  3J7A O;  1Z6R A;  3BQZ A;  2DA3 A;  3IV5 A;  1IV6 A;  5J4Y A;  4UY8 I;  1UB9 A;  4XON A;  3OYM A;  3OWT A;  3OL4 A;  3LA2 A;  4HA8 A;  4EJV A;  4EGZ A;  4H4K C;  4S05 A;  5IP9 J;  1X58 A;  1Z0X A;  2DTR A;  4DBQ A;  4XRS G;  4L5E A;  1V4R A;  3QOE A;  1J09 A;  5BOX A;  3TMO A;  2Z5U A;  1WVR A;  4S0H B;  5IP6 A;  2V4J C;  2LBF A;  5C4J J;  1AWC A;  1WJA A;  3RIR A;  4UV8 A;  1LE8 B;  5K7F A;  4L18 B;  1RES A;  5LGU A;  1TT0 A;  3S1Q J;  1FBQ A;  1DP7 P;  1JTY A;  1D0Y A;  2G7U A;  3SQN A;  2XAU A;  4OWR B;  1XSX A;  3AL0 C;  3SXY A;  5FKK A;  5GPA A;  2QSG X;  4GFB A;  4RS8 A;  3I5U A;  2RDP A;  4I01 A;  2NVQ J;  3CLQ A;  3WTW C;  3ZN0 A;  4E7S A;  3SJM A;  1BIA A;  3IP4 B;  3S3N A;  2WAE A;  2M0M A;  2V6C A;  4KA4 A;  4ZDP A;  2A07 F;  2IEK A;  4JBA A;  1BI1 A;  1F36 A;  2VJJ A;  2JA6 J;  3M07 A;  5LD2 C;  5HOO A;  1J0R A;  4U0Y A;  3J81 K;  4B8X A;  2R7T A;  1XGS A;  1SFX A;  1X4P A;  3FXL A;  2ACJ A;  3TO6 A;  4EJU A;  1TWF J;  2OTJ I;  3I3L A;  4KNY A;  1UHM A;  3DF8 A;  2K9N A;  3G3Z A;  4RBO A;  2E71 A;  3I0T A;  2L0K A;  3KFW X;  2I10 A;  2DAO A;  3LA3 A;  1JE8 A;  4OIP F;  3H3V K;  2QQ8 A;  2DA5 A;  2MC4 A;  4J01 A;  3A2K A;  1XX5 A;  1H8A C;  3RKY A;  4LLN A;  2DA6 A;  1ETK A;  1I6H J;  1YQA A;  3KET A;  3DWL E;  4HSR A;  4A3I J;  3W2W A;  1ZHF A;  4BAY A;  5DYM A;  3DTI A;  1VQ5 I;  2OCE A;  4NQW B;  4F55 A;  3WHB A;  2CQK A;  3KP7 A;  1SVL A;  2XRN A;  2BHZ A;  2VC0 A;  2A5W A;  2B63 J;  4CUG A;  2EBI A;  3EDP A;  1ZN2 A;  2L7M P;  1WH5 A;  1ZG3 A;  4UB6 C;  1X3Z B;  6PAX A;  2Q2E B;  3GBG A;  5FB2 A;  5DD8 A;  4ZTF A;  1IG7 A;  2M7B A;  3FBI B;  3WE2 A;  2YX4 A;  3GEZ A;  5E1X A;  3JW4 A;  3CCM I;  3ZP5 A;  3GVA A;  2AXT C;  3BZK A;  1A35 A;  3HL2 A;  4XRF A;  1V5G A;  1QPM A;  2O9L A;  3KP5 A;  3FHN A;  1XCB A;  1E17 A;  4XOP A;  5H6Q A;  4YRV A;  2VUM J;  2F2E A;  1I39 A;  2XDV A;  3C3W A;  3FIS A;  2GBY A;  3DTK A;  1XTA A;  1MNE A;  4HZF A;  4UUT A;  1J7K A;  1WPK A;  4U0V A;  4F7Z A;  2XRO A;  1NG6 A;  1TNS A;  2LF7 A;  2XPV A;  3QPL A;  2WB1 A;  5AON A;  4JOM A;  4XMY A;  5FLX Z;  2R7Z J;  2VBY A;  1HOM A;  4B4C A;  1BJA A;  1BJZ A;  3CDH A;  3IAS 2;  4I2O A;  3GO5 A;  4RAF A;  2R7F A;  4I6Z A;  2K3P A;  3W2A A;  3J80 Z;  1R1V A;  2HOA A;  3VSK A;  1XB4 A;  2QBY A;  4JP0 A;  4LIT A;  1QGP A;  1LPQ A;  4F3Q A;  2LRD A;  4QPO A;  2ELK A;  3S17 J;  4B09 A;  3BR1 A;  3JRA A;  1N75 A;  1VZ0 A;  3JAM K;  2M8E A;  1Y39 A;  3ZR8 X;  3OS0 A;  2HOS A;  1U0J A;  4HEA 2;  3F0C A;  2LD5 A;  2AQF A;  3FXM A;  3PUF A;  3GTM J;  1XPX A;  4XLC A;  3DU5 A;  2LG4 A;  4B44 A;  2QWW A;  3VSL A;  3GZN B;  3BG6 A;  3GTO J;  4XLP F;  2LP0 A;  2M45 A;  4ANJ A;  5EF6 A;  3K70 C;  2O8K A;  4A3M J;  5D8K B;  3TO7 A;  3BTC A;  4A0X A;  3HUG B;  2HDW A;  5H6R A;  2O5R A;  3GFM A;  3S3O A;  1QQI A;  3RQ4 A;  3VEP A;  3Q0V A;  4D0P A;  2V1U A;  5E17 F;  3ROU A;  5CVJ A;  2O61 A;  3MMY B;  2HR3 A;  2OF7 A;  5JHU A;  3OSF A;  1UHS A;  2IA0 A;  4KJZ A;  4XRS A;  1U8R A;  4GRI A;  2VQH A;  5IP7 J;  4OIR F;  1A31 A;  1YI2 I;  3RQI A;  5A2Q K;  3HRU A;  1MBE A;  2CRG A;  1ZG5 A;  2L2O A;  3JRH A;  3VWB A;  4IJA A;  2G7H A;  3OYG A;  2XHK A;  4F91 B;  1VQO I;  5L3F A;  3G2B A;  4Z6Y A;  3LWF A;  3FKI J;  3NRV A;  4C2U A;  3PM1 A;  3DBR B;  2NAZ A;  3KP4 A;  2HNH A;  3A0B C;  1AA7 A;  3KCC A;  2J5P A;  1KU3 A;  1UZC A;  3ZMS A;  2ID3 A;  2DXI A;  2P7V B;  3K2A A;  1J75 A;  3QOP A;  2OQR A;  3BG3 A;  2H27 A;  2P6T A;  1LDK B;  4LIU A;  2FOW A;  5LEK A;  2DT7 B;  3AL0 B;  1Z67 A;  4RB0 A;  4UVB A;  3HOV J;  2EB7 A;  4ASN A;  2BW3 B;  1Q1V A;  5DEQ A;  4G7H F;  2HVR A;  3AG1 H;  3PQJ A;  1VTN C;  1KYW A;  4BYY A;  2JA5 J;  2QEN A;  4KN7 X;  1VI0 A;  1KU9 A;  4II2 A;  1FMW A;  4A0Y A;  2LKS A;  2AXL A;  3P9K A;  1LQ1 A;  2L01 A;  1YE9 A;  1LFP A;  2LY9 A;  1T33 A;  3RZD J;  2NRA C;  4OIN F;  2HFH A;  4RLQ A;  1B1B A;  2WAQ N;  1FBS A;  4EQQ A;  5H2F C;  2NVX J;  2H09 A;  2JQ7 A;  3CDL A;  2TRT A;  4FE4 A;  3SZT A;  2P5K A;  2QYO A;  3ZQF A;  5K5Q A;  2P4W A;  5GTI C;  2QA4 I;  3SHF A;  5B66 C;  3JRE A;  3EQL F;  5D6E A;  3CCQ I;  1Z05 A;  2A05 A;  2BE5 F;  2VLA A;  2MC3 A;  2L54 A;  3TGN A;  3I59 B;  4G8X A;  3BCB A;  3RPQ A;  1KU7 A;  4N0B A;  4CIC A;  2KZV A;  3CCS I;  3H3Z A;  3JRG A;  1QHH D;  4AVZ A;  3RKW A;  1JXS A;  2KIM A;  3T8R A;  4D9J A;  2FUG 2;  2RNJ A;  4WWC A;  1KU2 A;  3DTE A;  5FKM A;  3AKZ A;  5ED4 A;  2W48 A;  1LE8 A;  1DPR A;  4W97 A;  3SFI A;  1Z91 A;  1FP2 A;  1YRN A;  1TWG J;  2O8X A;  2JWT A;  1GV5 A;  2MD5 A;  2BY0 A;  2DMN A;  2R7S A;  4CDG A;  2E1N A;  1T08 B;  2V6E A;  3F8B A;  1SC7 A;  4V2G A;  2W4S A;  4MQ9 F;  3RYR A;  2X6X A;  1S5L C;  4DGW B;  3O2P E;  3V42 A;  1CQT A;  4ESJ A;  1K83 J;  5E8G A;  2L3D A;  1L0O C;  2QVO A;  2CQN A;  1ZQ3 P;  3OYL A;  1FX7 A;  1R23 A;  2PMZ N;  1JI8 A;  4XK4 A;  4AU7 A;  4U87 A;  4IEJ A;  3KEQ A;  3CD6 I;  2ESH A;  2V26 A;  3HXL A;  4BJ5 C;  4AIH A;  4IHV A;  5ICE A;  1LDD A;  4D5C A;  2FU4 A;  3AFH A;  2DT5 A;  2L7Z A;  3IHU A;  1JKO C;  2K9M A;  1R5H A;  5J8C A;  1PJR A;  1XC5 A;  4K2E A;  4BY7 J;  1GLN A;  1MJ9 A;  1MJB A;  3JTH A;  2ICW G;  1RET A;  5LBQ A;  1EJ9 A;  1RR7 A;  3RTR A;  3N97 A;  2V9P A;  2JA2 A;  4LLL A;  1EA3 A;  5C4X J;  5D5V B;  5DDG A;  1VFC A;  4EJT A;  4CYD A;  3U9G A;  5HLT A;  5GP9 A;  2YU9 J;  1YG2 A;  5FD5 A;  2HDD A;  1ETO A;  2OZ6 A;  2CO5 A;  3CJQ B;  4WXC A;  3OS1 A;  2YUS A;  3V7S A;  4M6V A;  4ZH4 F;  3ZQC A;  2DMP A;  3W6K B;  4ENN A;  2VOD A;  1XN7 A;  5EYR A;  3BJ6 A;  3K69 A;  1L3L A;  3MCZ A;  1DPU A;  3P7N A;  4MIM A;  4LIV A;  1WCM J;  2CMP A;  1ZR4 A;  3QPS A;  2JUG A;  4MEX F;  2LKX A;  3KEY A;  5HOD A;  2DA1 A;  3E7L A;  2VKV A;  3H0G J;  4PSX A;  3TW6 A;  3AG3 H;  2H6C A;  3GX4 X;  1JKP C;  3ZQH A;  3ZRG A;  3IUO A;  5JLX A;  4F52 A;  1D8J A;  1UAA A;  2E1O A;  3HRM A;  1IV8 A;  3KLN A;  3A0H C;  3JRD A;  3BPX A;  1RC9 A;  4LOC A;  2JN6 A;  1YW9 A;  2Q2E A;  1UFM A;  5FLM J;  1EF4 A;  3TQN A;  1IUF A;  2HYF A;  2GOM A;  3DCF A;  1T6S A;  1QVT A;  2QZ8 A;  5CQE A;  2GIV A;  1R6R A;  2WB1 N;  2UV1 A;  4C3H J;  3ABL H;  3GME A;  1IZ1 A;  1EV7 A;  2YS9 A;  4AYB N;  1U5T B;  1RUO A;  3VPR A;  1WH7 A;  3WTY C;  2F5V A;  1S6L A;  1U8B A;  1TWA J;  2B0L A;  1R00 A;  2CSO A;  2KQR A;  2JRM A;  3QRF F;  3GTK J;  5LGN A;  5HLI A;  3BR2 A;  2CUF A;  5DCM A;  4A5N A;  1O7L A;  4AC0 A;  1NHA A;  4ZYA A;  1W36 C;  1E0E A;  3I54 A;  3CC2 I;  3BC8 A;  5ICC A;  4RGX A;  2CQX A;  3MEX A;  4HF2 A;  1Y56 A;  3F6O A;  1G2H A;  2F4I A;  3BJA A;  1GVJ A;  1QRY A;  2VT3 A;  3IRR A;  4ENJ A;  2KRF A;  2XGE A;  1WJF A;  5B1A H;  2QM3 A;  4RMN A;  3HHG A;  2GZW A;  1HQC A;  2JPB A;  1BA5 A;  3DXJ F;  4I7H A;  4B1R A;  2KFD A;  4HST A;  4U7D A;  2WAD A;  1RI7 A;  4OMY A;  3I4N J;  4UXN A;  1OCZ H;  3PNT A;  4OIQ F;  3CZ6 A;  2XRL A;  1B72 B;  2A6T A;  2FBK A;  4CYC A;  1ZTR A;  1KYZ A;  2MAB A;  2HEO A;  3B73 A;  5DM7 F;  3V4G A;  1R4N B;  1MNM C;  2M4G A;  1F1Z A;  3E5U A;  2VE9 A;  3AG4 H;  2MD0 A;  5LEJ A;  2IT0 A;  2YX7 A;  2PX9 A;  2XUB A;  2NVU B;  3HUG A;  2XKO A;  1IW7 F;  3ABT A;  5M5X J;  3MKW B;  4ON0 A;  5CQG A;  2DA2 A;  3H0D A;  1BI3 A;  1LFB A;  1SFO J;  5EG0 B; 
#chains in the Genus database with same CATH homology
 2MLK A;  4AVP A;  4E70 A;  3BY6 A;  5J6X A;  4WXH A;  2GQQ A;  1OKR A;  1TQI A;  3DV8 A;  3E3V A;  2JSC A;  2HOE A;  2M87 A;  2OU2 A;  1MDM A;  2PLY A;  3T0Y A;  3LAJ A;  4P55 A;  5DUK A;  3HIF A;  1J5Y A;  3R61 A;  4RAY A;  2EV5 A;  3EET A;  3LAP A;  1OYW A;  1PP8 F;  1J2X A;  2JT1 A;  1IF1 A;  1IN6 A;  2RGV A;  2HDC A;  3HRT A;  2ZBK A;  2YU3 A;  4Z2Y A;  4IF4 A;  2UZK A;  1B4A A;  3QP5 A;  3ELK A;  3T1B A;  2UXX A;  3V7C A;  1P4A A;  1LVA A;  3WTZ A;  3QAH A;  3E6D A;  3MFK A;  4MEY F;  1IAW A;  4L9T A;  2VXZ A;  2CYY A;  1K7A A;  1MGT A;  3EYI A;  3I59 A;  2W25 A;  5IT9 K;  2PMU A;  4HBL A;  2IPQ X;  1ZLJ A;  1SD6 A;  3BP8 A;  1SD4 A;  1TNT A;  2QQB A;  5BQT A;  4WCG A;  4IRH A;  5JFR A;  1B9N A;  4A5M A;  2X0L A;  4LB6 B;  4I09 A;  2WWY A;  4Y13 A;  2RC4 A;  3SZP A;  5KK1 A;  1R5G A;  2Y75 A;  1HW5 A;  5EEH A;  2V9V A;  5CVU A;  3IL2 A;  4KIC A;  2DPD A;  3U2R A;  2UXN A;  3HSF A;  3DPT A;  3I71 A;  1SMT A;  2Q8K A;  5IT3 A;  3ERE D;  3RKX A;  4RGR A;  3ULQ B;  1FY7 A;  4G7O F;  3OV8 A;  4GYI A;  3WGH A;  5DD4 A;  4FX0 A;  2D2W A;  1DUX C;  2BGC A;  4PDK A;  3E6B A;  1C0W A;  3KP3 A;  4WF2 A;  4PGH A;  4HDU A;  1SD7 A;  4MTD A;  3MZH A;  1I5Z A;  1W5T A;  4HLX A;  4M9S A;  4CHU A;  1MZB A;  2ESN A;  3D5L A;  3VFZ A;  2CFX A;  2O03 A;  4TV7 A;  2RN7 A;  3ZMU A;  1CGP A;  1O57 A;  2EA4 A;  4G9Y A;  3BZ6 A;  5ILV A;  3K1M A;  2W85 A;  4R79 A;  3HHH A;  2P7C B;  1R1U A;  2D45 A;  2XAJ A;  5CLS A;  5L3C A;  5DCF A;  1XGM A;  1IN5 A;  1ON1 A;  4UVA A;  2OBP A;  5JI6 A;  1V3F A;  3ABU A;  5E8I A;  4CGZ A;  1ZGJ A;  3VOE A;  3I58 A;  3WGG A;  2ZME B;  1FYK A;  3GW2 A;  1IRG A;  2ZXJ A;  3CUQ C;  2NYX A;  4EGY A;  2FMY A;  4EJO A;  1PP7 U;  3BOQ A;  1YW8 A;  5HS8 A;  3IC7 A;  3V8J A;  1QZY A;  3GF2 A;  4KIB A;  3U1D A;  1ZGA A;  2BEO A;  2HKO A;  2YPR A;  2BYV E;  1ZRF A;  2EFP A;  1CF7 B;  3FWE A;  4ESF A;  2OD5 A;  3FMS A;  2MBF A;  3DKW A;  1ZRD A;  1Z7U A;  1HBX G;  3QP6 A;  3CTA A;  2VC1 A;  2HZT A;  3F8M A;  4ZYH A;  4UVC A;  3TDZ C;  2O0Y A;  1A04 A;  4GCV A;  3W6J B;  2PFB A;  3F8N A;  5TRD A;  1FYL A;  4UHT A;  1FNN A;  1XDS A;  1BI2 A;  4M73 A;  3WU0 A;  4Q5S F;  4M72 A;  4HX7 A;  2KJC A;  2W24 A;  2KIF A;  4JK1 X;  1G6N A;  5D5U B;  3WTX C;  1U5T C;  4EMS A;  4XBF A;  1JGS A;  3FXU A;  3EYY A;  1XD7 A;  2VON A;  3E97 A;  4Q48 A;  3ZPL A;  1LDJ A;  2FBH A;  1FC3 A;  4HQE A;  1K6O A;  1IXS B;  4MGR A;  1EH8 A;  4M6X A;  4ENK A;  2PN6 A;  2GA2 A;  4HOB A;  4RB1 A;  1ZRC A;  2MA3 A;  2ETH A;  2E7W A;  1XDU A;  1YTY A;  4L5I A;  3GZ6 A;  3TOA A;  2L4M A;  3LQQ A;  3HTS B;  3E6M A;  1WSU A;  1RZ4 A;  1YS6 A;  5ILS A;  4BH9 A;  1W7P B;  4NB5 A;  3P9C A;  2K4J A;  3GZ5 A;  3R0J A;  4ETS A;  1Z1D A;  1AOY A;  1BBY A;  5HS9 A;  2EFW A;  5CJ9 A;  1TW3 A;  4KFC A;  3M9A A;  2KIU A;  2FML A;  4L0Y B;  1P4X A;  2K7L A;  2EJR A;  2Z33 A;  4JQF A;  3K2Z A;  1WWX A;  2P8T A;  1GXQ A;  1FSH A;  1X3U A;  2A61 A;  2FRH A;  1RNL A;  2V1X A;  3Q5F A;  3HSE A;  1LB2 A;  2EA2 A;  3WTS C;  3CUQ B;  2XAF A;  3KE2 A;  4EM2 A;  3J81 Z;  1G4D A;  2JTV A;  2EV0 A;  1FYM A;  2X4H A;  1P92 A;  3LST A;  4LJZ F;  2VBZ A;  1LEB A;  1D5V A;  4HAM A;  3F22 A;  2HS5 A;  4IXA A;  4UUV A;  4ZZL A;  2OA4 A;  1XGO A;  5F6F A;  3TDU C;  5K5O A;  1S7A A;  2QQA A;  1FT9 A;  4BNC A;  2XIG A;  1QO0 D;  3MWM A;  4HX8 A;  2EK5 A;  2H94 A;  4NQW A;  3QPH A;  1R36 A;  3CLO A;  4IRI A;  1F5T A;  3KP2 A;  1BC7 C;  4BQA A;  3VB2 A;  4U7B A;  2PMH A;  4FT8 A;  2DU9 A;  3ZQ7 A;  4HQM A;  5TJJ A;  1O3S A;  1XSD A;  2VOO A;  1BC8 C;  4L9N A;  4G6D A;  2GAU A;  1ONV A;  4A6E A;  4LB5 A;  2ZCW A;  2JPC A;  3L2C A;  1QNT A;  2CG4 A;  4L9J A;  4N9I A;  2STW A;  2DO7 A;  3PFI A;  4AWX B;  5D5W B;  1YS7 A;  2XVC A;  4LK0 F;  1CF7 A;  3F23 A;  2QQ9 A;  1B9M A;  2F5E A;  1HW2 A;  2MH2 A;  2DK5 A;  2WC2 A;  3ZMT A;  2ZJ2 A;  3O3K A;  4HYE A;  4WXD A;  3JAM Z;  4A12 A;  2YR2 A;  3E5X A;  3F8F A;  5FFZ A;  5CYV A;  1D8K A;  2JZY A;  3WGI A;  1T38 A;  2BBY A;  2DQL A;  2VBX A;  4N9H A;  2XAG A;  2FA5 A;  1WI9 A;  1OMI A;  4YFK F;  1MD0 A;  1P2F A;  2PQ8 A;  4O5V A;  4HLY A;  1B59 A;  1BM9 A;  2VOP A;  1FPQ A;  2FNP A;  2GXB A;  3IKV A;  1IN4 A;  4MHG A;  5A2Q Z;  5FO5 A;  2DI3 A;  4M9X A;  4XSZ F;  1FWZ A;  5FLX K;  3K9T A;  1R58 A;  4RAZ A;  1RUN A;  2E7X A;  3KEO A;  2K4B A;  3KZY A;  3J80 K;  1J9I A;  2ISY A;  4M9Z A;  2O6G E;  4FHT A;  2QBY B;  3I64 A;  1OYI A;  2STT A;  2K86 A;  3LFK A;  3FM3 A;  5E1Z B;  4AIJ A;  3R6S A;  1FZP B;  1TBX A;  5L3E A;  3F8C A;  3I53 A;  1R1T A;  2ZFW A;  1T0F A;  2Y48 A;  1I1G A;  5K5R A;  4OOI A;  2QUF A;  2RVC A;  1XMA A;  3F6V A;  1E2X A;  2CW0 F;  4UNO A;  2IJL A;  3HTU A;  1W7P A;  1ZAO A;  3GXO A;  2M1B A;  4PCQ A;  2DLL A;  2PEX A;  4KDP A;  3ZMZ A;  3QPT A;  2K27 A;  5D5X B;  1RIO H;  3K1P A;  3COA C;  3BPV A;  2DQR A;  2O3F A;  4HX4 A;  4LG0 B;  3ZN1 A;  5EEG A;  4YG2 F;  5FGM A;  3GLX A;  3D0S A;  4MNU A;  4PZJ A;  2IA2 A;  1S8N A;  3R4K A;  3HRS A;  1K78 B;  2EFN A;  5F1R A;  3WU1 B;  3ISP A;  1BN5 A;  1G3T A;  1S3J A;  3RYP A;  5LHG A;  5L3D A;  4KT5 C;  1KQ9 A;  3R0A A;  2F5F A;  5HDG A;  3CUQ A;  5ICF A;  1KA8 A;  1XSV A;  3M8F A;  2NS0 A;  4QLC U;  5J8F A;  1HKQ A;  1LJ9 A;  3MAJ A;  1WKM A;  5CVV A;  2FNA A;  4BHC A;  2Q0O A;  4KMU X;  4Y15 A;  4LGW A;  2VBW A;  2DFI A;  1G3S A;  4WK8 F;  3K1N A;  1YLF A;  4P96 A;  4LMY A;  5LHI A;  4IRG A;  4EJW A;  1UHW A;  2RKH A;  5BS6 A;  2CWE A;  2KKO A;  3KZZ A;  4LLG F;  1YIO A;  4IVN A;  1PDN C;  2FE3 A;  2A6H F;  3RDI A;  2QLZ A;  4EV0 A;  3Q9V A;  3GWZ A;  2HTS A;  3CO6 C;  1JHF A;  2Y0M A;  1YO5 C;  2EV6 A;  4A6D A;  3GUD A;  1O3Q A;  3RI4 A;  4GXO A;  2GA1 A;  4ESB A;  5HVQ C;  1KQ8 A;  4DNC A;  3H92 A;  4MQV A;  1EH7 A;  4KIF A;  1QZZ A;  3M1E A;  3ZMD A;  2EWN A;  1U5T A;  2GWR A;  3L7W A;  1I1S A;  3V7R A;  2DK8 A;  2EFO A;  1KGS A;  3ML6 A;  3E6C C;  2NNN A;  3DFG A;  5LRS A;  2A69 F;  2K02 A;  3ECH A;  3FF5 A;  1D3Y A;  1YW7 A;  4MTE A;  1ZRE A;  1I27 A;  2L4A A;  1HKT A;  4EM1 A;  1EH6 A;  1ZAR A;  2Z9O A;  4M74 A;  1ULY A;  4G6Q A;  3FM5 A;  4DQ2 A;  4HW0 A;  2W84 A;  3VOD A;  3TKY A;  1SMY F;  4I0A A;  3BRO A;  5D6F A;  4KN4 X;  3IKT A;  2PJP A;  5ERI A;  2CGP A;  4L5J A;  5KVR A;  2HTJ A;  2L02 A;  3NEU A;  1TQP A;  3LA7 A;  5HS7 A;  2GXG A;  2ZKZ A;  2HQR A;  2W57 A;  4OMZ A;  3RPU A;  3FXR A;  2LDU A;  2Z99 A;  2C6Y A;  3GFI A;  4WX9 A;  3ECO A;  4HF0 A;  5DCM B;  3PQK A;  2IW5 A;  4KUM A;  1P6R A;  1YYV A;  3L09 A;  1W4M A;  3FZV A;  2KJB A;  4GGG A;  2XKP A;  1GHC A;  3WTU C;  5E20 A;  4OIO F;  3IRQ A;  3F72 A;  4Q4Z F;  4M6Y A;  4LK1 F;  3GFJ A;  5AIQ A;  2VE8 A;  3QU3 A;  4BHB A;  5F64 A;  1JHH A;  3O6B B;  4RGS A;  2XAQ A;  3DP7 A;  3FMQ A;  3WE3 A;  1TQM A;  5D4S A;  1WRJ A;  3WG9 A;  2ZNZ A;  2ZO4 A;  4EM0 B;  4L9V A;  2AS5 F;  2XGX A;  1O3R A;  1PUE E;  1Y0U A;  4O3M A;  3FX3 A;  1WQ2 A;  3HYI A;  1Z6T A;  3V8L A;  2WTE A;  1U3E M;  3FHZ A;  3QU6 A;  4LG0 A;  2JRT A;  4NHJ A;  5IT9 Z;  4I0B A;  3EUH A;  1SAX A;  1MDM B;  1ZH5 A;  1FLI A;  5K1Y A;  1P4W A;  1F9N A;  2J5O A;  1HKS A;  3IWF A;  4YIF A;  2A3S A;  3GFL A;  1KQ0 A;  1LEA A;  2A6E F;  2ELH A;  2VN2 A;  2HKX A;  1K78 A;  1DDN A;  1U6G A;  2MLG A;  4R8H A;  4UV9 A;  1LNW A;  5BPI A;  2RV8 A;  1IRF A;  2FOK A;  1IXR C;  5DUI A;  5JVT A;  4QWQ A;  3I4P A;  3M7G A;  4XSX F;  1H9G A;  4HDV A;  4IHS A;  1MKM A;  5H20 A;  5FD6 A;  2D1H A;  4RB3 C;  1T2K A;  3R60 A;  2FSW A;  3KP6 A;  2YSR A;  3L9F A;  3DQV C;  1XGN A;  2M30 A;  4P9F A;  1ZYR F;  5JR3 A;  5CVI A;  1BIB A;  3KLO A;  4PGG A;  1T98 A;  2TDX A;  4CXF A;  1FBU A;  1TLH B;  2FBI A;  1R7J A;  3C18 A;  4HV6 A;  2H6B A;  1T39 A;  2P6S A;  4R1H A;  4ZYD A;  2FF4 A;  2R3S A;  3C1D A;  2XV4 S;  2DBB A;  3HOS A;  3BWG A;  2PG4 A;  1Q1H A;  5LGT A;  3LQR A;  3M8E A;  1HSJ A;  4KIG A;  5L3B A;  1Z9C A;  4CO8 A;  2HQN A;  1IXC A;  3TOB A;  3SFZ A;  1YFH A;  3H3U A;  2HGC A;  1FP1 D;  1J59 A;  4O6J A;  4RGU A;  4A0Z A;  1B6A A;  2IRF G;  3GYH X;  2XAH A;  3OOP A;  5LRR A;  1IN8 A;  1OPC A;  5ICG A;  2EFQ A;  3C7J A;  1H0M A;  3E5Q A;  3DPL C;  2PBI A;  1HXD A;  1ODD A;  4A2U A;  1W7P D;  3AAF A;  2FEZ A;  2OZU A;  2Z3Y A;  2P5V A;  2WV0 A;  1BI0 A;  5E1W A;  3F21 A;  1W5S A;  3P9I A;  2ZME A;  3B02 A;  4S04 A;  2HWV A;  3JTG A;  2MH9 A;  1S29 A;  2LKP A;  4LFU A;  3T5X A;  4P5O A;  4H0E A;  1U2W A;  3HOT A;  1STZ A;  1SFE A;  1OYY A;  3Q9S A;  4ZYE A;  2G9W A;  1XCV A;  2UWM A;  4YII A;  1SFU A;  2LF8 A;  2FXA A;  4I02 A;  1HW1 A;  3MZY A;  4HF1 A;  1BOA A;  5BMZ A;  1H9T A;  4G94 A;  2DPU A;  4EVI A;  1MJA A;  1GXP A;  1TW2 A;  2LNB A;  3CO7 C;  5L3G A;  3WOD F;  5E18 F;  1OR7 A;  3IWZ A;  1ZLK A;  2F5C A;  1UST A;  4IPA A;  3V8K A;  5LHH A;  2ISZ A;  3N4M A;  1IN7 A;  2VT2 A;  1O3T A;  4ENM A;  3F3X A;  4L0Z B;  5DV5 A;  4GYG A;  4LD5 A;  3WTV C;  1K79 A;  2OAZ A;  3S2W A;  4FX4 A;  3REO A;  5HDK A;  1I6X A;  5HDN A;  1XMK A;  4CZZ A;  4BXU A;  3JSP A;  2V79 A;  1U78 A;  5CVR A;  2IVM A;  3K0L A;  2LSO A;  2RQP A;  2XAS A;  4OU0 A;  4AD9 A;  5HLG A;  4ZYG A;  4YFX F;  2F5D A;  4HV5 A;  3ZMV A;  4GO1 A;  3CJN A;  4IHT A;  5D8L B;  2FQ3 A;  3G73 A;  3T8T A;  4P9U A;  1G3W A;  2PI0 A;  3RJP A;  1R22 A;  5BPD A;  2A68 F;  2ZNY A;  2E1C A;  1SD5 A;  1UCR A;  1S7O A;  3NQO A;  2D1V A;  4KMF A;  2A5Y B;  4Q47 A;  2R7D A;  4AIK A;  1O7F A;  3L00 A;  3DEU A;  3WTT C;  2BV6 A;  4XLN F;  3JSO A;  3FMR A;  4RB2 C;  1IUY A;  2COM A;  4G7Z F;  4U88 A;  1G3Y A;  3TO9 A;  2OQG A;  1FSE A;  5ILU A;  4YFN F;  1TTY A;  4I98 B;  3FXQ A;  5FFX A;  3HSR A;  3CUO A;  2DW4 A;  5LLQ A;  1HST A;  1USS A;  1FOK A;  4M71 A;  1F4K A;  2P5L C;  2ADU A;  2IA1 A;  1REP C;  2HYG D;  2V1D A;  3BJO A;  5AIP A;  3BDD A;  4Y17 A;  3MQ0 A;  4U0W A;  5HLH A;  4KYW A;  4BHP A;  1QBJ A;  2NNY A;  2IP2 A;  5D4R A;  1ZG1 A;  4ZZD A;  1ON2 A;  2M5W A;  3J7A O;  1Z6R A;  1UB9 A;  3LA2 A;  4HA8 A;  4EJV A;  4EGZ A;  4S05 A;  2DTR A;  1V4R A;  5BOX A;  2Z5U A;  1AWC A;  3RIR A;  4UV8 A;  4L18 B;  5LGU A;  1FBQ A;  1DP7 P;  2G7U A;  3SQN A;  1XSX A;  3SXY A;  4RS8 A;  3I5U A;  2RDP A;  4I01 A;  3WTW C;  3ZN0 A;  1BIA A;  2V6C A;  4KA4 A;  2A07 F;  4JBA A;  1BI1 A;  5HOO A;  1J0R A;  4U0Y A;  3J81 K;  4B8X A;  1XGS A;  1SFX A;  2ACJ A;  3TO6 A;  4EJU A;  4KNY A;  1UHM A;  3DF8 A;  3G3Z A;  3I0T A;  3KFW X;  2DAO A;  3LA3 A;  1JE8 A;  4OIP F;  3RKY A;  4LLN A;  1YQA A;  3KET A;  4BAY A;  1ZHF A;  5DYM A;  2CQK A;  3KP7 A;  2XRN A;  2VC0 A;  3EDP A;  1ZN2 A;  1ZG3 A;  6PAX A;  5FB2 A;  5DD8 A;  3WE2 A;  2YX4 A;  3GEZ A;  5E1X A;  3JW4 A;  3ZP5 A;  3GVA A;  4XRF A;  1QPM A;  3KP5 A;  1XCB A;  1E17 A;  5H6Q A;  2F2E A;  3C3W A;  4HZF A;  1J7K A;  4U0V A;  4F7Z A;  2XRO A;  1TNS A;  2LF7 A;  5AON A;  5FLX Z;  2VBY A;  1BJA A;  3CDH A;  4I2O A;  3GO5 A;  2R7F A;  3J80 Z;  1R1V A;  1XB4 A;  2QBY A;  1QGP A;  4B09 A;  3JAM K;  2M8E A;  2QWW A;  4XLP F;  2M45 A;  5D8K B;  3TO7 A;  4A0X A;  5H6R A;  3GFM A;  1QQI A;  3VEP A;  4D0P A;  2V1U A;  5E17 F;  3ROU A;  5CVJ A;  2O61 A;  2HR3 A;  5JHU A;  2IA0 A;  1U8R A;  4OIR F;  5A2Q K;  3HRU A;  1ZG5 A;  4IJA A;  2G7H A;  2XHK A;  5L3F A;  3LWF A;  3NRV A;  2NAZ A;  3KP4 A;  3KCC A;  2J5P A;  1KU3 A;  3ZMS A;  2P7V B;  1J75 A;  2H27 A;  3QOP A;  2OQR A;  2P6T A;  1LDK B;  5LEK A;  4RB0 A;  4UVB A;  2EB7 A;  4ASN A;  5DEQ A;  4G7H F;  3PQJ A;  1VTN C;  1KYW A;  4BYY A;  2QEN A;  4KN7 X;  1KU9 A;  4A0Y A;  3P9K A;  2AXL A;  1LQ1 A;  2L01 A;  2NRA C;  4OIN F;  2HFH A;  1B1B A;  1FBS A;  4EQQ A;  2H09 A;  3SZT A;  2P5K A;  2QYO A;  5K5Q A;  2P4W A;  3SHF A;  3EQL F;  5D6E A;  1Z05 A;  2BE5 F;  2MC3 A;  2L54 A;  3TGN A;  3I59 B;  4G8X A;  3RPQ A;  1KU7 A;  4N0B A;  4CIC A;  3H3Z A;  3RKW A;  1JXS A;  2KIM A;  3T8R A;  2RNJ A;  4WWC A;  1KU2 A;  5ED4 A;  1DPR A;  1Z91 A;  1FP2 A;  2O8X A;  2MD5 A;  4CDG A;  2E1N A;  3F8B A;  4MQ9 F;  3RYR A;  3O2P E;  4ESJ A;  5E8G A;  2L3D A;  1L0O C;  2QVO A;  1FX7 A;  1R23 A;  3KEQ A;  2ESH A;  4AIH A;  5ICE A;  1LDD A;  2IT0 A;  2FU4 A;  3IHU A;  2DT5 A;  1R5H A;  5J8C A;  4K2E A;  1MJ9 A;  1MJB A;  3JTH A;  5LBQ A;  3RTR A;  3N97 A;  4LLL A;  5D5V B;  5DDG A;  4EJT A;  4CYD A;  3U9G A;  1YG2 A;  5FD5 A;  2OZ6 A;  2CO5 A;  4WXC A;  3V7S A;  4ZH4 F;  3W6K B;  4ENN A;  2VOD A;  1XN7 A;  1L3L A;  3BJ6 A;  3K69 A;  3MCZ A;  1DPU A;  3P7N A;  4MEX F;  2H6C A;  3GX4 X;  1D8J A;  3HRM A;  3KLN A;  3BPX A;  1YW9 A;  2Q2E A;  1UFM A;  3TQN A;  2HYF A;  1T6S A;  2QZ8 A;  2GIV A;  1IZ1 A;  1EV7 A;  1U5T B;  1RUO A;  3WTY C;  1S6L A;  2B0L A;  1R00 A;  2CSO A;  3QRF F;  5LGN A;  5HLI A;  4A5N A;  5DCM A;  1O7L A;  1NHA A;  3I54 A;  5ICC A;  4RGX A;  3MEX A;  4HF2 A;  3F6O A;  3BJA A;  1GVJ A;  2VT3 A;  3IRR A;  4ENJ A;  2KRF A;  2QM3 A;  3HHG A;  2GZW A;  1HQC A;  2JPB A;  3DXJ F;  4I7H A;  4U7D A;  1RI7 A;  4OMY A;  4UXN A;  4OIQ F;  2FBK A;  1KYZ A;  2HEO A;  3B73 A;  3V4G A;  1F1Z A;  3E5U A;  2VE9 A;  5LEJ A;  2YX7 A;  2XUB A;  3HUG A;  2XKO A;  1IW7 F;  3ABT A;  4ON0 A;  1BI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...