2ETHA

Crystal structure of a marr-like transcriptional regulator (tm0816) from thermotoga maritima at 2.50 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
HMDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVEALSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Transcriptional regulator, putative, MAR family (tm0816) from Thermotoga maritima at 2.50 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords transcriptional regulator, putative, Mar family
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ethA00
2E1NA 3BJOA 2QBYA 1R1UA 1ONVA 2O6GE 4O3MA 3KCCA 3F72A 5FD6A 5K5OA 2XAQA 1QGPA 2EA4A 3HSFA 2JRTA 4DNCA 1U8RA 3Q5FA 3PQKA 2FXAA 3MCZA 4CDGA 2WV0A 1I1GA 2EV0A 4OIRF 1TQPA 2K4JA 3TO6A 3FMRA 1IXCA 2YR2A 4BNCA 4ASNA 4B09A 3F8FA 3WGIA 3IKVA 1FYKA 1O3SA 1CF7A 2CFXA 2A68F 2LKPA 3DPLC 2DLLA 1UHWA 4XSZF 1K78B 3GF2A 4KDPA 4A0XA 3BY6A 3RKXA 3BZ6A 1ZLJA 2XROA 4EJTA 1XSXA 5CVJA 2CQKA 1EV7A 1J2XA 4OU0A 4LB5A 1YIOA 5D8KB 2QWWA 3GLXA 2JSCA 3SZPA 3O6BB 2DBBA 4ZYHA 1FWZA 3KP6A 3E3VA 3FMSA 2ELHA 3WTUC 1ZRDA 1ZH5A 1BIBA 1MKMA 1ZN2A 2D2WA 1R7JA 4MTEA 2PJPA 2IPQX 2HDCA 3WTVC 4AWXB 3FM5A 2NS0A 2GA1A 1XCVA 1D3YA 1L0OC 3F6VA 4YG2F 4L5JA 2DQLA 4XLPF 2L3DA 3IKTA 1TNSA 4EJUA 5IT9K 2EV5A 3Q9VA 3IRQA 5DCMA 2Q8KA 3COAC 2D1VA 3ZMUA 5J6XA 2VE8A 3I59B 3WGHA 2M87A 2EFWA 2QQAA 5L3CA 3G3ZA 2FQ3A 4E70A 3FF5A 3K1PA 2FU4A 2YX4A 3CUQB 2F5DA 3DXJF 4LD5A 2A6HF 3ML6A 2FBIA 2NYXA 3ZP5A 3V7RA 2TDXA 1HXDA 4LJZF 1S3JA 3L7WA 3KP3A 1LJ9A 1OKRA 3F6OA 3K2ZA 1ZRCA 3ECHA 3MZHA 2ZNYA 5BS6A 5BOXA 5HLHA 4OIQF 4UVBA 1FYMA 1JHHA 5DYMA 4WWCA 1ON1A 2H6CA 3DEUA 4JQFA 2V1DA 3FMQA 5E8GA 1KQ8A 2OZ6A 3DF8A 4M6XA 4HX4A 3ERED 2FE3A 1BC7C 2QM3A 4U0YA 2PMUA 4PGHA 1QBJA 2FEZA 5ERIA 3JTHA 2Y48A 2ZBKA 1XDUA 4BH9A 5D5XB 3CLOA 2JTVA 1BI2A 5LRSA 3KP4A 3QP5A 1IN8A 5HDKA 4FT8A 3P9IA 2CSOA 3L00A 4G7HF 1STZA 3VFZA 2RV8A 1OYWA 5DD8A 2ISZA 2X0LA 1T6SA 3I64A 4M9XA 2Z5UA 4CICA 5D4SA 1USSA 1EH6A 3CUOA 5CYVA 1S29A 1TLHB 3HRSA 5ED4A 4BHCA 3GVAA 3ZMTA 1SD7A 2FNPA 3BROA 1DPRA 3L9FA 3G73A 4Y17A 3F8BA 4YIFA 4AVPA 3J81Z 1KU2A 3KP2A 1Z91A 3I59A 4OIOF 1ZG3A 4CXFA 2FMLA 1B6AA 3FWEA 2RDPA 5LGNA 1JGSA 4I09A 1ON2A 3QRFF 3D5LA 2W25A 4LK1F 2O0YA 2STWA 1IZ1A 2PN6A 2HQNA 1KQ0A 1XB4A 3RTRA 2RC4A 2KKOA 4OIPF 3V8LA 3LWFA 3RKWA 3R60A 2P5KA 1B9NA 3OOPA 2VXZA 3U9GA 4HX7A 4UNOA 2YPRA 4O5VA 3E6DA 3ZN0A 1ZG5A 4U7DA 1FY7A 1ZRFA 4KN4X 1RUOA 3F8MA 3RPQA 1R00A 1S8NA 2MD5A 1BI3A 3QAHA 1FZPB 4I98B 2PQ8A 2ETHA 5LHIA 1FYLA 4U88A 1MDMB 3ZMZA 4Q47A 5DEQA 2M8EA 3ZMDA 2GAUA 3BOQA 4NQWA 3I71A 3DV8A 2IA0A 4A2UA 4KIBA 4RB0A 3FXQA 3MAJA 4EM2A 1U5TA 3GX4X 4BYYA 1IW7F 1VTNC 4A12A 3V8JA 1SAXA 4G9YA 3J7AO 3RJPA 2QLZA 4HF0A 2DT5A 4L9TA 4OMZA 1G6NA 3J81K 2AS5F 3P9CA 1XCBA 1YQAA 5E8IA 5D5UB 2ISYA 4M73A 5DUKA 2XKOA 3RKYA 1G3YA 4G6QA 3PFIA 4A5MA 3ABUA 3KEQA 4UHTA 2K86A 2FA5A 5E1XA 3TO9A 4WXCA 1RNLA 2GQQA 1WI9A 2G9WA 1I6XA 2LDUA 3IHUA 1KU9A 2Z3YA 4RGUA 2LNBA 3JTGA 2HR3A 4XRFA 3P7NA 4B8XA 4HV6A 3KEOA 1BOAA 2XRNA 3HUGA 2HQRA 3HOTA 3R0JA 4ENJA 5E20A 2P6SA 4HAMA 4NHJA 2PG4A 1RIOH 4WXDA 1XMKA 1D8KA 2AXLA 1KU7A 3HHGA 1YFHA 1ZHFA 3BPVA 1HW1A 4CZZA 1LEAA 2MH9A 1XSDA 2EFOA 2YU3A 3CUQA 2MH2A 1P4WA 1B4AA 1FT9A 3V4GA 4S04A 4L9NA 5DCFA 1DP7P 2IT0A 5FGMA 3T0YA 5IT9Z 2HTSA 4RAZA 1DPUA 5FO5A 4I0BA 3EDPA 2MLKA 1IN5A 2IA1A 1BJAA 4GCVA 5DUIA 4HDUA 2M30A 2CGPA 1ODDA 4G6DA 3M8EA 1K6OA 4LB6B 3LFKA 2F5CA 2CW0F 4HDVA 5TJJA 4O6JA 2XHKA 1HKTA 2OAZA 4HQMA 1SD5A 3ZPLA 2WC2A 1FBUA 2RVCA 4IF4A 1A04A 4LG0A 5LEKA 5ICEA 4OMYA 4KMUX 3WU1B 1IRFA 3MEXA 2D45A 4BHBA 4I2OA 4LG0B 2VBXA 2VONA 5ILUA 1K78A 4HF1A 2OBPA 1TQIA 3GYHX 3GO5A 5H20A 1B1BA 1HQCA 1W4MA 2EA2A 5D6FA 1MD0A 1ZLKA 3IRRA 2GXGA 3CUQC 1F1ZA 3KLNA 4KIFA 3SFZA 4BXUA 5KVRA 2W57A 3BPXA 4KT5C 2CWEA 3F3XA 2ZKZA 4LLLA 3MWMA 1ZYRF 2ESHA 4WF2A 4H0EA 2XAJA 5AIQA 3KP5A 5FB2A 3GFMA 1BIAA 1HKSA 2QVOA 3I5UA 4RS8A 5LGUA 4S05A 4KFCA 3F22A 4N0BA 4BAYA 1F9NA 1LNWA 1IN4A 2RKHA 2GWRA 1FX7A 1PDNC 1JHFA 3E6CC 2LF7A 3NRVA 2FOKA 1IUYA 4YFKF 4HLXA 1MDMA 2CYYA 1B59A 5F64A 1J59A 3IL2A 2HS5A 4GYGA 2M5WA 3JSOA 1LVAA 2MBFA 3I53A 4A6EA 5BPIA 4HYEA 1J9IA 3GZ6A 2EK5A 4PGGA 3QP6A 4WX9A 2QBYB 3R0AA 4ESJA 1LDJA 1ZREA 3HTSB 4YIIA 1P4AA 5KK1A 1ZARA 3GZ5A 5FD5A 1TBXA 1DUXC 2ZMEB 5ICFA 4KICA 4EQQA 2ZCWA 4YFNF 1FBSA 4OOIA 2ZFWA 5A2QK 3J80Z 2VBWA 3QU6A 2V9VA 4P96A 2IJLA 1Z9CA 2DI3A 3K1NA 1U5TC 3V8KA 4Y15A 1O7FA 3JW4A 2E7XA 2RQPA 4HV5A 2K4BA 2COMA 3SHFA 1FC3A 4L0YB 1R5HA 2P5VA 1KGSA 2J5PA 1SMYF 5FFZA 3M8FA 2RNJA 1P6RA 3LA7A 4PDKA 3K69A 3JAMZ 3D0SA 2DFIA 5L3DA 2VE9A 3BJ6A 4ESBA 2P7CB 1IAWA 1K7AA 1CGPA 1REPC 1LDKB 3PQJA 5LHGA 1H0MA 3E5QA 5ICCA 1G3TA 4EJVA 2FF4A 1RZ4A 1TQMA 4BHPA 2A5YB 3E5UA 3GFJA 2MA3A 1YW7A 2W85A 1O7LA 2NNNA 2XV4S 4HX8A 5AONA 3P9KA 3KETA 5HLIA 2QZ8A 2FSWA 1AOYA 1KYWA 3HOSA 2DO7A 4MQ9F 2HFHA 4EGZA 3MQ0A 3N4MA 3LAPA 1Y0UA 2PLYA 3C18A 3HRMA 2UXNA 2GIVA 3ZQ7A 5JFRA 3QPTA 5FLXK 4NB5A 1WKMA 2V79A 1HW5A 4I02A 2FMYA 1OYYA 3HIFA 1AWCA 5LEJA 1XGNA 4M74A 2P6TA 5E1ZB 1R5GA 3WTYC 3DQVC 4GGGA 5LLQA 5JHUA 5HLGA 3BDDA 1O57A 2NRAC 1QZYA 4F7ZA 3CTAA 1X3UA 2XKPA 2DK8A 3HYIA 3WGGA 4GYIA 5HOOA 1LB2A 2HGCA 3TDZC 5ILSA 3WODF 2A3SA 1G3WA 1FOKA 1WQ2A 3IC7A 2VC1A 1U6GA 3HRUA 4IHTA 2PFBA 2YX7A 2JT1A 4UV8A 2MC3A 5J8CA 1D5VA 3ULQB 1HBXG 5CVUA 2VODA 5FLXZ 1TW3A 2ZMEA 4U7BA 2HOEA 2HYGD 2A6EF 4RAYA 2L4AA 2NNYA 1FP2A 5CVRA 2IVMA 4ENMA 2R3SA 3GFIA 4N9HA 4TV7A 3CDHA 1YYVA 1TNTA 4EJWA 2OD5A 1KA8A 4I01A 1FPQA 4LMYA 1O3QA 1U3EM 1I5ZA 3DFGA 1YS7A 1Z6RA 3GEZA 3SQNA 1R1VA 4G8XA 2O03A 3U2RA 1P4XA 3H3UA 1R36A 3TGNA 2Z33A 2M1BA 4Q4ZF 3FHZA 3T8TA 4ZYDA 4A0YA 4HQEA 2F5FA 2OA4A 3M7GA 3V7SA 5CLSA 2BEOA 2OZUA 3ZN1A 3EYIA 4AIJA 3F8CA 2GA2A 2EWNA 1FBQA 2D1HA 3KLOA 1T38A 4RB3C 1R58A 2O3FA 2XAHA 4OINF 1XD7A 4MTDA 2DAOA 1F5TA 1W5TA 3C7JA 1UB9A 1BI0A 1LDDA 3F23A 2BE5F 3WTZA 4EM1A 2MLGA 1MJ9A 4UXNA 4K2EA 2HEOA 4AD9A 2HKXA 1YG2A 1XN7A 1BI1A 1GHCA 3FXUA 2FRHA 4I7HA 3KZZA 3EETA 3U1DA 1IXRC 1KYZA 4ENKA 2ZJ2A 2J5OA 3JSPA 3WG9A 4LK0F 4KMFA 3NQOA 3HHHA 1K79A 3V7CA 1T39A 4KYWA 3R61A 5EEGA 3O2PE 5CJ9A 3T5XA 4JBAA 2VOOA 4G94A 4QLCU 1YTYA 3GWZA 1XSVA 3DP7A 4RB2C 1OMIA 5H6QA 1FSEA 2QQBA 5TRDA 3VEPA 4IVNA 2FNAA 5A2QZ 2YSRA 4HA8A 2KIUA 4MGRA 1GXPA 1DDNA 4Z2YA 5K5RA 4Q48A 2H09A 1YW8A 4UVAA 1J75A 4FX4A 3DKWA 4P9UA 3L2CA 4M9SA 2DU9A 5BMZA 1MJAA 2P7VB 3MZYA 1SFUA 2HZTA 2XGXA 3WE3A 1BC8C 1XGOA 3FZVA 3IWFA 2JPBA 2PEXA 3RYRA 1S7OA 1PP7U 1OYIA 5CVIA 2Z9OA 4IRHA 5HS8A 1ZGAA 5H6RA 2L4MA 4ENNA 1F4KA 3M1EA 4WK8F 1LEBA 6PAXA 5D8LB 2JPCA 1MJBA 2QYOA 3TDUC 4IRGA 5CVVA 1BBYA 3KP7A 5JVTA 3TO7A 1SMTA 2KRFA 4EMSA 3W6JB 2XVCA 2ESNA 1WWXA 5K5QA 3FM3A 2G7HA 3WE2A 4ZZDA 1R1TA 2H6BA 1U5TB 5F6FA 2HKOA 5L3BA 2G7UA 4A0ZA 1ZAOA 4EV0A 1RI7A 3BP8A 4HLYA 1YW9A 3E5XA 1T98A 4AIKA 2NAZA 1FP1D 4L9VA 3R4KA 1V3FA 5HDNA 2XUBA 3TOAA 4U0VA 2JZYA 1W5SA 5BQTA 2W24A 2XAFA 4UVCA 1LQ1A 5HVQC 3TOBA 2IP2A 2K27A 1I1SA 5D6EA 3RIRA 5IT3A 1R22A 2F2EA 4ZYGA 4ZZLA 2FBHA 4HBLA 1S6LA 2ACJA 2UXXA 5L3EA 1HSTA 2LF8A 5EEHA 4A5NA 4L5IA 4ETSA 3LAJA 4UV9A 3VOEA 1USTA 4KNYA 3T1BA 3SXYA 3QOPA 4RB1A 3QPHA 3W6KB 3REOA 2BYVE 4CYDA 2QENA 2Y75A 3E6MA 3KZYA 1CF7B 4I0AA 3EUHA 3I58A 4MEYF 4KUMA 4LLGF 2VT2A 5ILVA 3K0LA 4YFXF 3WU0A 1RUNA 1KQ9A 1QQIA 1EH8A 2XASA 1Z1DA 4G7ZF 4ESFA 2A69F 3R6SA 3T8RA 2L02A 1U2WA 2KJBA 5LGTA 4BQAA 3ECOA 2Z99A 1E17A 3KFWX 1FSHA 3HSRA 1IF1A 1W7PA 4FX0A 3LQRA 1SD6A 2R7FA 3F21A 1BM9A 1IN6A 2QUFA 4P9FA 5LHHA 1L3LA 4RGXA 5HS9A 1Q1HA 3FX3A 3QU3A 1YS6A 3TKYA 2RGVA 1ZGJA 1HSJA 4JK1X 1ZG1A 2H27A 3I4PA 2O61A 1U78A 1S7AA 2KIMA 3E6BA 4MNUA 4P5OA 5DV5A 1XMAA 3L09A 4ZH4F 3K1MA 1HKQA 5DDGA 3I0TA 1J7KA 4EJOA 4KN7X 2P8TA 4KA4A 5E18F 4L0ZB 1GVJA 3K9TA 2OU2A 2CO5A 3WTWC 4PZJA 2PBIA 2PMHA 4WCGA 4RGRA 2EFQA 2IRFG 4L9JA 1PUEE 2STTA 4R8HA 3GW2A 2L01A 2Q2EA 4XSXF 1XDSA 2OQRA 5L3GA 3O3KA 2ZXJA 4HW0A 4HF2A 2RN7A 2LSOA 1P2FA 3Q9SA 3RDIA 4FHTA 3WTXC 2EFPA 4A6DA 1G3SA 4KIGA 1B9MA 1MZBA 1JXSA 1BN5A 2HYFA 2GZWA 4HZFA 4MHGA 1QPMA 2R7DA 2ZNZA 4IPAA 1D8JA 2C6YA 2M45A 4ZYEA 5D4RA 1TW2A 2L54A 5DCMB 1OR7A 1W7PD 2IW5A 4QWQA 3RI4A 2Y0MA 5J8FA 3H92A 4U0WA 1IRGA 2VT3A 2HWVA 3ELKA 3LA3A 1GXQA 4D0PA 1KU3A 5F1RA 2BV6A 2E7WA 1R23A 2EJRA 1HW2A 4R79A 2WWYA 1J5YA 4PCQA 1G4DA 4IHSA 3H3ZA 3ABTA 2DPDA 2X4HA 2P5LC 3GUDA 2HTJA 4R1HA 3BJAA 4IJAA 4ON0A 4XLNF 4M6YA 3HRTA 3ISPA 5E17F 1WRJA 2DK5A 3KE2A 4LGWA 3CJNA 2VN2A 4UUVA 2A61A 3TQNA 1V4RA 3E97A 4GO1A 1PP8F 5FFXA 2P4WA 2ADUA 1O3TA 4CHUA 2VBYA 4AIHA 4P55A 2KIFA 3GFLA 2DPUA 1TTYA 1T0FA 2B0LA 5D5VB 2V1XA 2UZKA 3M9AA 1SFEA 3HTUA 1FNNA 2K02A 2Q0OA 2W84A 1E2XA 1XGSA 2EFNA 4M9ZA 2FBKA 1QNTA 3J80K 3LA2A 3C3WA 1JE8A 1IXSB 3N97A 5JR3A 1IN7A 1UCRA 4L18B 1Z7UA 2OQGA 1ULYA 3CO6C 5LRRA 3IWZA 2BBYA 2PI0A 4MQVA 4M71A 3JAMK 4LFUA 1EH7A 1WSUA 3EYYA 4EVIA 4CO8A 4N9IA 1SFXA 2EV6A 3NEUA 3F8NA 2DW4A 2F5EA 3S2WA 2BGCA 2IA2A 2CG4A 4EM0B 5DD4A 2K7LA 5HS7A 2H94A 1T2KA 4RGSA 2XAGA 2GXBA 3RPUA 3BWGA 3LSTA 1SD4A 4HOBA 3VODA 3ROUA 4M72A 1MGTA 5BPDA 1J0RA 1OPCA 3AAFA 1P92A 5AIPA 3I54A 3ZMSA 2VBZA 4WXHA 1YO5C 1YLFA 4GXOA 4EGYA 2KJCA 1UFMA 4Y13A 1QZZA 3B02A 1QO0D 5HDGA 5D5WB 3OV8A 4G7OF 2A07F 3C1DA 2UWMA 1NHAA 3B73A 5LBQA 5L3FA 2O8XA 1UHMA 1C0WA 3MFKA 2DQRA 4IRIA 3RYPA 2E1CA 3CO7C 2VC0A 2VOPA 1FLIA 2V6CA 1XGMA 3WTSC 5JI6A 2EB7A 4IXAA 2XIGA 3ZMVA 3SZTA 4CGZA 3EQLF 4DQ2A 5E1WA 1H9GA 4XBFA 1Z05A 3DPTA 5ICGA 3VB2A 3LQQA 1O3RA 2V1UA 4LLNA 3WTTC 5K1YA 1Z6TA 2ZO4A 3HSEA 1I27A 2QQ9A 4Q5SF 3FXRA 3GXOA 2DTRA 2WTEA 1W7PB 1H9TA 4MEXF
chains in the Genus database with same CATH superfamily
2DYRH 2E1NA 3BJOA 5JLWA 2ZXHA 2QBYA 1R1UA 1ONVA 4XIDA 1OCZH 2O6GE 4O3MA 3KCCA 3F72A 5FD6A 1GV2A 4B3AA 3D5SC 1FIPA 2QGUA 2XAQA 3CESA 4XLFA 1QGPA 2EA4A 3HSFA 5K5OA 2JRTA 2BY0A 3HOYJ 3MD2A 4DNCA 1U8RA 4PJLA 3Q5FA 3PQKA 2FXAA 5FRMA 2R5YB 2ZFUA 4HG2A 4HNUA 3MCZA 4CDGA 3E1SA 3IH4A 2WV0A 3S15J 3IAS2 2JQ7A 5M3MJ 5EZGA 1I1GA 4IO9F 2EV0A 3X2QH 4OIRF 1TQPA 3DPUA 3CJTB 2K4JA 3TO6A 3FMRA 1IXCA 2YR2A 2DA1A 3ZQCA 2VKVA 4BNCA 4ASNA 1B8IB 4A69C 4B09A 2K3PA 3KYLA 3F8FA 3WGIA 1IO2A 3IKVA 3PNTA 2ZMEC 5EJCA 1FYKA 1O3SA 1CF7A 2CFXA 1EF4A 2A68F 2LKPA 3LSGA 3DPLC 2E2HJ 2DLLA 1MH3A 4M3BA 3NARA 2CRGA 2YU9J 1UHWA 4XSZF 1K78B 3GF2A 3AFHA 4KDPA 3GTPJ 4A3JJ 4A0XA 5EEAA 3BY6A 4NQWB 3FKIJ 2ID3A 2X1CA 3RKXA 4BEHB 2ECCA 3BZ6A 1ZLJA 3PM1A 2XROA 5TGTA 3OYIA 4Y3OA 4EJTA 1TWCJ 3DLAA 1G8XA 1XSXA 5CVJA 2CQKA 1EV7A 1J2XA 4OU0A 2XGDA 4LB5A 1YIOA 5D8KB 2QWWA 3GLXA 1RC9A 2JSCA 4AIDA 3SZPA 2VXDA 3O6BB 2DBBA 2FJ1A 2O7OA 1SVOA 4XL9A 2L7KA 4FISA 3JRDA 4ZYHA 2H8RA 1K83J 1FWZA 1TZLA 3KP6A 3E3VA 4XKWA 4XRSG 3FMSA 2ELHA 3WTUC 3JREA 1RRJA 1ZRDA 2E1MB 4BL0B 1ZH5A 1BIBA 1MKMA 3HGYA 1ZN2A 2DCEA 3CDLA 4XKBA 2D2WA 3TP3A 2BY1A 1R7JA 2BZTA 4CCNA 5GTIC 1W7PB 4MTEA 2PJPA 2IPQX 5FKMA 3WTVC 2HDCA 2XF7A 5FKNA 4BE0A 4AWXB 1N25A 2HU9A 3FM5A 3MKYB 2B7EA 2L7ZA 1U8BA 3PIPF 1OISA 2NS0A 2DDBA 2GA1A 3LSIA 1XCVA 1D3YA 2R7VA 2F6CA 1L0OC 3OOUA 2LY2A 3BTLA 1H88C 1U9NA 2K40A 3F6VA 4YG2F 4CZCA 1MW7A 3OYBA 4F92B 4L5JA 2KISA 4KISA 2DQLA 4XLPF 2L3DA 3IKTA 1TNSA 4EJUA 5IT9K 3J7ZI 2ZJQF 2EV5A 3Q9VA 2XGCA 3IRQA 2JUGA 5DCMA 2Q8KA 3COAC 1OLTA 2D1VA 2HVSA 3KYCB 3ZMUA 5HNHA 2KQRA 4XKVA 5J6XA 4F93B 2VE8A 3I59B 1P9QC 3WGHA 2O8KA 3L2UA 2M87A 2EFWA 2QQAA 1POGA 2X1EA 5L3CA 1LE8B 1TWAJ 3G3ZA 2FQ3A 4E70A 2JVHA 3FF5A 1B8IA 3NWSA 3OYDA 3CJQB 3K1PA 2FU4A 3ZR8X 2VJ5A 3SZGA 1BR2A 2F4IA 2YX4A 3CUQB 2F5DA 3DXJF 3GTLJ 2MD0A 4LD5A 2R5YA 1V54H 2A6HF 3W2VA 3ML6A 4FE4A 3OYNA 2FBIA 1JTYA 2NYXA 3ONQA 9ANTA 3ZP5A 4QIWN 1I39A 2V7FA 5J40A 1IRXA 5LD2C 2VASA 4GDFA 3PO2J 2I8DA 5FRNA 3V7RA 2CUZA 1DP3A 1EA3A 2TDXA 2BY3A 4XQFA 1HXDA 4LJZF 2EINH 1TWFJ 1S3JA 2COBA 3L7WA 1UG0A 4IQJA 1I3QJ 3KP3A 1LJ9A 1OKRA 3F6OA 3K2ZA 1H8AC 1ZRCA 3ECHA 3K10A 3MZHA 2E5NA 3OR1C 2ZNYA 4PSWA 5BS6A 1ETXA 5BOXA 5C3EJ 5HLHA 4OIQF 4UVBA 1FYMA 1JHHA 5DYMA 3HL2A 4WWCA 1E3HA 1ON1A 1WJ5A 1RR7A 2H6CA 3G1LA 2IS4A 2W4SA 3DEUA 4XLAA 3FBNB 1AKHB 5FLMJ 4JQFA 5J47A 1HCRA 2WB1A 2KPMA 2V1DA 3FMQA 1XG1A 3H1CA 5E8GA 1KQ8A 2OZ6A 3DF8A 4M6XA 4HX4A 3ERED 2DN0A 3OYLA 3MKWB 1IV8A 2FE3A 1BC7C 2QM3A 4U0YA 2PMUA 4PGHA 5DS9A 1QBJA 2FEZA 3H5AA 3KPHA 5ERIA 3JTHA 3PSIA 3HXLA 4LIVA 2MABA 4ITVA 2Y48A 3RZDJ 2ZBKA 2OV7A 1XDUA 4BKXA 4A3DJ 4BH9A 2HOTA 2QQ8A 2E36A 5D5XB 5FKLA 3CLOA 2HVRA 2JTVA 1BI2A 3OY9A 4B1RA 1X19A 4PFOA 5LRSA 1JKOC 3KP4A 3QP5A 1IN8A 5HDKA 4FT8A 3P9IA 2CSOA 3L00A 4G7HF 3ZXSA 1MNMC 4II2A 1QZEA 1STZA 3VFZA 3SJMA 2RV8A 1OYWA 5DD8A 4A93J 1OCCH 2ISZA 2X0LA 2X85A 1T6SA 4ANJA 1PVEA 4CSWA 2XF5A 2Y69H 3I64A 4M9XA 3MZ8A 3VDXA 1VQ8I 2W7NA 3IUOA 3PL8A 3QOEA 2Z5UA 4CICA 2GM4A 5D4SA 1USSA 1EH6A 3CUOA 5CYVA 3Q0WA 1S29A 1TLHB 3HRSA 2CS3A 4NNJA 3S14J 5ED4A 4BHCA 3GVAA 1EKEA 3DBHB 3HC7A 3ZMTA 1SD7A 1B72B 2FNPA 4Y52J 3H35A 3CC7I 4YELA 4C9YA 3JRGA 3A1YA 3L1PA 1MIJA 2LY1A 2VJ4A 1VQPI 2LKXA 2ZXIA 3BROA 1DPRA 4ZYAA 3L9FA 3G73A 4Y17A 5JHFA 3F8BA 4YIFA 4AVPA 4QSHA 1K61A 3GMEA 4CCKA 3J81Z 3CCLI 1KU2A 5C4JJ 3CCJI 2VQHA 1Z91A 3KP2A 2GOMA 3J7YJ 2IGNA 2EBIA 3I59A 4PFPA 4OIOF 1ZG3A 1O4XA 4CXFA 2FMLA 1B6AA 1LPQA 3CCEI 3K4LA 3FWEA 2RDPA 5LGNA 1ETKA 5EF6A 2A5WA 1JGSA 4UUSB 2JA7J 4I09A 1ON2A 2AQFA 3QRFF 3OYKA 4RAFA 3QYBA 3VPRA 3D5LA 2W25A 4LK1F 2L5QA 2O0YA 5GPAA 2E2JJ 2STWA 1DQUA 1YIJI 1IZ1A 5M5YJ 1ACIA 3HPHA 2PN6A 2HQNA 1T56A 3ZGKA 3CC2I 1KQ0A 2ELJA 3GCMA 2VPLA 3DLLF 1XB4A 3G6EI 3RTRA 2RC4A 2KKOA 2R92J 4OIPF 2VI6A 3V8LA 3CMYA 3LWFA 3Q0UA 4BQNA 3LSHA 2Y31A 3BCBA 3RKWA 2LR8A 1UG2A 3R60A 2P5KA 2L9NA 2MFZA 3W2WA 1B9NA 2DDAA 4XICA 2HDDA 2IS6A 3OOPA 4RA2A 3LSMA 2VXZA 3U9GA 2AO9A 4HX7A 4UNOA 2YPRA 4O5VA 5FKKA 3E6DA 3ZN0A 1ZG5A 4U7DA 1FY7A 5EGOA 1ZRFA 1UAAA 3A03A 4KN4X 1RUOA 2JN6A 1FMVA 3IH3A 3F8MA 3RPQA 1R00A 1S8NA 2MD5A 1BI3A 2LKSA 3QAHA 1FZPB 4Y7NJ 2K3FA 4I98B 1YJWI 1MBHA 2NVQJ 1VQ6I 2PQ8A 1HDDC 2ETHA 5LHIA 1FYLA 4AYBN 4U88A 1MDMB 3ZMZA 4Q47A 1FEXA 5DEQA 2M8EA 3DTIA 4PJMA 3ZMDA 3H9JA 2JRMA 3CCYA 3D5RC 1B72A 2OCCH 1ZK8A 2GAUA 3BOQA 5B5EC 2CFOA 5CQGA 2DA2A 2RQQA 4NQWA 3I71A 3DV8A 3MN2A 4DW6A 2IA0A 2E1OA 4A2UA 4KIBA 4XNFA 4RB0A 3FXMA 4HNTA 1UJ8A 1GDTA 5IOZA 3FXQA 3MAJA 2M9HA 5TISC 4EM2A 4D1QA 3HKZA 3BG7A 2NVYJ 2CQ7A 2M34A 3OL4A 1Z7LA 2HYJA 2L7FP 1U5TA 3GX4X 2IS2A 4BYYA 2DMNA 1IW7F 1VTNC 4A12A 3V8JA 1W5CC 4NBQA 1SAXA 1UZCA 4G9YA 4PJJA 4BUPA 3J7AO 4BXXJ 3RJPA 2HQAA 1QRYA 1E3PA 2QLZA 1GUUA 2DT5A 4HF0A 4IHWA 4L9TA 4OMZA 1G6NA 4ZDLA 3J81K 2AS5F 3P9CA 1BW6A 3CCRI 4AC0A 1XCBA 1MBGA 1YQAA 5E8IA 5K7HA 5D5UB 2ISYA 2Z16A 2QSHX 4M73A 5DUKA 2ME6A 4LITA 2XKOA 3RKYA 3S93A 1G3YA 4G6QA 5HODA 2UUZA 3PFIA 1ZR2A 3VYUB 4A5MA 1Y8QB 3ABUA 3DWLE 3KEQA 3FISA 4UHTA 2K86A 2FA5A 5E1XA 3KIOA 4V2FA 3JRAA 3TO9A 2AXTC 4WXCA 1RNLA 2GQQA 1WI9A 2G9WA 1J09A 1I6XA 1VF9A 2NXNB 4B48A 5K7FA 1WI3A 1IV6A 1AKHA 2KRCA 1U0JA 2LDUA 3DKYA 3GTOJ 3IHUA 1KU9A 2Z3YA 3VSLA 4RGUA 5BNGA 2LNBA 4D7MA 4DGWB 1SC7A 3S32A 3JTGA 2HR3A 4CCMA 4XRFA 3P7NA 3CMAI 2GOXB 4B8XA 4HV6A 3OYMA 2PJRA 3KEOA 1BOAA 4V2GA 2XRNA 3HUGA 2HQRA 3HOTA 1V5GA 3R0JA 5IYBJ 1R71A 1S7EA 4ENJA 1BL0A 5E20A 2JMWA 2P6SA 2PMZA 3H5RA 3RZOJ 4HAMA 4NHJA 2PG4A 3LNQA 1RIOH 2EH3A 4WXDA 1XMKA 1D8KA 1YRNA 3LSJA 2AXLA 2YS9A 4XM3A 1KU7A 4ZDPA 4D5CA 3HHGA 1YFHA 1ZHFA 2DTZA 2EIMH 3BPVA 2X6XA 1HW1A 3RSNA 3A01B 1X1CA 3C2BA 4CZZA 2M2EA 1LEAA 3G71I 2MH9A 3HGGA 2HPIA 3JRCA 1XSDA 2TCTA 2X6YA 2EFOA 2YU3A 3CUQA 1VZ0A 1XMXA 2MH2A 1HOMA 1P4WA 1B4AA 1FT9A 2DFFA 3IP4B 5DTDA 4XRMA 4MFEA 4W1UA 1OR7C 5K7ZA 2GLOA 1Y39A 3V4GA 4S04A 4XONA 2X6WA 4L9NA 5DCFA 1DP7P 2H1LA 3IH2A 3CCSI 2IT0A 1V5FA 3ZQQA 2IBDA 5FGMA 2OF7A 3T0YA 3KYDB 4A3BJ 5IT9Z 2HTSA 2HOSA 4RAZA 1DPUA 3SEZA 5FO5A 3EUAA 4I0BA 3EDPA 3I3LA 2VKDA 2OUMA 2MLKA 1IN5A 2F5VA 2CV0A 2F4MB 2IA1A 2RNGA 1BJAA 2LC2A 4GCVA 5DUIA 4P1WA 4HDUA 1KONA 2M30A 4X6AJ 2CGPA 1SFOJ 1ODDA 4NDLA 3BR1A 2D5VA 4G6DA 2HI3A 2EILH 3M8EA 3LSRA 1K6OA 4E7KA 4LB6B 5C4XJ 3LFKA 3MVPA 2F5CA 2CW0F 2EQRA 4HDVA 1SVMA 5TJJA 4O6JA 1Y0NA 4M3EA 2XHKA 1HKTA 2OAZA 4HQMA 3UNGC 3W6VA 4C3IJ 3BQYA 2V6EA 1SD5A 4BACA 1ZTRA 3ZPLA 4C2UA 2WC2A 1ETOA 3H9GA 1FBUA 2F4OB 2LP0A 1TWGJ 1Z21A 2RVCA 4IF4A 4YIRX 1A04A 1YHQI 4LG0A 1XPXA 1WCMJ 5LEKA 5ICEA 2VLAA 4OMYA 4DOZA 3BR0A 1QVTA 4KMUX 3H3VK 3WU1B 1IRFA 4E7ZA 3BC8A 4OAYA 3MEXA 2D45A 4XLCA 5CQEA 4BHBA 3E0JB 1Y1VJ 1Y1WJ 4I2OA 4A3CJ 2XC7A 4LG0B 2VBXA 5EYRA 3A0BC 2VONA 5ILUA 1VFCA 1TL8A 1K78A 4HF1A 2CUEA 2H1KA 2OBPA 2DA4A 1TQIA 3U21A 3GYHX 3S1MJ 4F91B 3GO5A 5H20A 1B1BA 5FKOA 1HQCA 2W00A 1W4MA 1X4OA 2EA2A 2JWTA 3AL0C 5D6FA 1RPWA 3BT9A 4UY8I 4MLOA 1MD0A 3MMYB 1ZLKA 3IRRA 3ERMA 4L5EA 2GXGA 3TW6A 2JJ7A 2X51A 1F1ZA 3CUQC 3KLNA 2WADA 2NS8A 2H8WA 4KIFA 3SFZA 2HQ5A 1G2HA 4CYCB 4A3MJ 4BXUA 3FIWA 5KVRA 2W57A 3BPXA 4DYQA 2BHYA 4KT5C 3BG3A 2CWEA 3F3XA 2CQQA 2ZKZA 3QODA 4LLLA 3MWMA 1ZYRF 5KHDA 2R0QC 2ESHA 4WF2A 4H0EA 1NG7A 1Q1VA 2XAJA 5AIQA 3KP5A 5FB2A 1ETVA 3I9V2 3I4MJ 2XPUA 3HG9A 3GFMA 5FLVA 2R7QA 2CMPA 5EZHA 3VYSB 1BIAA 1MBKA 2IEKA 3S16J 1HKSA 1X1BA 2QVOA 3I5UA 4RS8A 5LGUA 4S05A 4KFCA 3HB9A 3F22A 1UHSA 4N0BA 4BAYA 5B1AH 1F9NA 2IGOA 2LFBA 2DT6A 1LNWA 3IAM2 3K4BA 4IX7A 1QHGA 1IN4A 2VJIA 2V9KA 2RKHA 3K70D 5J1YA 2HNHA 1IGNA 3DTKA 3RQIA 2GWRA 1FX7A 4ZJZA 1PDNC 3L2WA 1JHFA 4J00A 1N77A 3E6CC 5J1UA 3GTKJ 2LF7A 1XS9A 1JTXA 2KMUA 2WAEA 2DA3A 5DM7F 3NRVA 3F0CA 2FOKA 3ABKH 4IKFA 4C3JJ 4YFKF 1IUYA 4HLXA 1T08B 2Y2ZA 1MDMA 4DIQA 2JA8J 2DA6A 2CYYA 4NUBA 2CQNA 3P5JA 4B44A 1B59A 1D1CA 1WPKA 5F64A 1J59A 1VQKI 3TL4X 4FASD 3IL2A 1W0TA 2HS5A 4BQOA 3S1QJ 3OR2C 4GYGA 2BY2A 2M5WA 5IP7J 1X4PA 1ZKGA 4CYCA 1LVAA 3JSOA 4FQGA 2R7WA 2MBFA 3I53A 4A6EA 3OYGA 5BPIA 4HYEA 3L2RA 1J9IA 2LH9A 3RKQA 3GZ6A 4I6ZA 2EK5A 3SFIA 3DBLB 4PGGA 1BJZA 1HC8A 3QP6A 4WX9A 2IGMA 2EPFA 1LFPA 2QBYB 3R0AA 1A31A 4ESJA 1Y56A 2OCEA 1LDJA 1UELB 4XRSA 3L2VA 1ZREA 3ZQFA 3HTSB 4YIIA 2R7RA 4HSTA 1MMSA 1P4AA 1WVRA 5KK1A 2FUG2 1ZARA 3W2AA 3GZ5A 1HLVA 5FD5A 1TBXA 1DUXC 2ZMEB 3HKZN 3HJEA 2KIQA 5ICFA 5IPAA 3DTEA 3S3MA 4BBSJ 3F9KA 2LTPA 2JUCA 4KICA 3W3CA 4EQQA 2ZCWA 3LSPA 1ETYA 3CF5F 1WH5A 1GLNA 4PJNA 4YFNF 2MYSA 1WJAA 1FBSA 1ERDA 2LVSA 4JP0A 2ZFWA 4OOIA 4CUGA 5A2QK 2VBWA 1F36A 1T33A 3J80Z 1X3ZB 3QU6A 2R5ZB 3PO3J 2V9VA 3C2GA 4E7HA 1LFBA 4P96A 2IJLA 1Z9CA 3GTGJ 2DI3A 2ZSHB 3K1NA 1U5TC 3V8KA 4Y15A 1O7FA 5IP9J 3JW4A 1ENHA 2XSDC 2E7XA 2RQPA 4AM3A 4HV5A 2K4BA 1VQOI 2ZB9A 3FXLA 2COMA 3CCVI 3SHFA 1FC3A 2R7ZJ 1SAUA 4D7NA 1K6YA 2XB5A 1YITI 2LLKA 4L0YB 1R5HA 3TP0A 4BJ5C 2P5VA 1R5ID 1KGSA 2BW3A 3H0GJ 2J5PA 5IOYA 1SMYF 4JOMA 3BCAA 5FFZA 3M8FA 2RNJA 1P6RA 3LA7A 2HPMA 5E3MA 4BE1A 4PDKA 2KHMA 2DMPA 3K69A 3NAUA 3JAMZ 2M0MA 3SDBA 3D0SA 2DFIA 5L3DA 2VE9A 1DU6A 3BJ6A 4ESBA 4F3QA 2P7CB 1IAWA 3HEFA 1K7AA 1D5YA 5B3SH 1CGPA 2Y9ZA 1REPC 2CV2A 1LDKB 4IHVA 3PQJA 5LHGA 1H0MA 3WU2C 4NC7A 3E5QA 4GRIA 5ICCA 3GTQJ 3M3YJ 1G3TA 1WGXA 4EJVA 2FF4A 2IXSA 1T95A 1RZ4A 1TQMA 4BHPA 3K4CA 2B9SA 1YX3A 1H89C 2A5YB 3E5UA 3GFJA 2MA3A 1YW7A 2W85A 2XPVA 2M0CA 1O7LA 3HOVJ 2NNNA 2XV4S 4HX8A 1EJ9A 5AONA 2HXIA 3P9KA 4Y4RA 3KETA 5HLIA 4XN0A 1SFKA 3BR3A 2QZ8A 4BQQA 3BR2A 2FSWA 1G59A 1AOYA 3QQAA 2IGKA 1KYWA 3HOSA 3ZQHA 4KITB 2DO7A 4MQ9F 3PNYA 1OQYA 2BHZA 2HFHA 4EGZA 3SEQA 2HVQA 3MQ0A 3ZOBA 1D0ZA 3N4MA 2DMUA 3LAPA 1Y0UA 2PLYA 3C18A 2R5ZA 3HRMA 2UXNA 2GIVA 3BQZA 3QPSA 2XSJC 3ZQ7A 5JFRA 3QPTA 5CKTA 5FLXK 5EG0B 4NB5A 1WKMA 3PJRA 2V79A 1HW5A 2JK3A 2LRDA 3S8PA 1Z3XA 4I02A 2FMYA 3K4KA 1OYYA 3HIFA 1MBJA 1AWCA 2PJRB 5LEJA 2WY8Q 4BBRJ 3V42A 4BY1J 1XGNA 4M74A 2P6TA 5E1ZB 1R5GA 3WTYC 2K9QA 3DQVC 1OFCX 2X6OA 4GGGA 5LLQA 1VI0A 2I10A 1RKWA 1JUMA 5JHUA 5HLGA 3BDDA 1O57A 3S1NJ 5DM6F 1K4SA 2NRAC 4N4NB 1QZYA 4NC8A 4F7ZA 3CTAA 1X3UA 2L0KA 2XKPA 2DK8A 2EZHA 3HYIA 4GYIA 3WGGA 5HOOA 1RKTA 1LB2A 1HDPA 2HGCA 3TDZC 2E60A 5F0FA 1Y6IA 4A3IJ 2EZIA 2KT0A 5ILSA 3WODF 4Y33A 3JR9A 2A3SA 3GLLA 5HLTA 4B3XA 3FHNA 3QYEA 1G3WA 2V1NA 1D0YA 1FOKA 1WQ2A 4ABZA 3A0HC 3IC7A 2VC1A 1U6GA 1YOVB 3HRUA 4IHTA 2DOEA 4ZDOA 2PFBA 3K4JA 2YX7A 2JT1A 4UV8A 2MC3A 5J8CA 2VQCA 1D5VA 3ULQB 3CCMI 1HBXG 1ZR4A 5CVUA 3TW7A 2VODA 2VJJA 5J1RA 2N8GA 5FLXZ 1YE9A 5KAFC 1JT0A 3CD6I 4FETA 1TW3A 3TMOA 2V4JC 2ZMEA 1FOYA 4U7BA 2K9SA 3Q3SA 3OMYA 2HOEA 2HYGD 2VL8A 2XDVA 3BR6A 3AKZA 2A6EF 4RAYA 2L4AA 2NNYA 1FP2A 1AU7A 5F08A 2O5RA 1K4TA 4UB8C 2WAQN 5CVRA 2IVMA 4ENMA 2R3SA 4XLEA 3GFIA 4N9HA 4TV7A 3ASOH 3CDHA 1YYVA 2EZLA 1TNTA 2Y0SN 4LOCA 1XX5A 3G1MA 4EJWA 1TT0A 3B6AA 2OD5A 5FROA 5JLXA 2Y9YA 4EATA 1KA8A 2LMDA 4I01A 1FPQA 2VKHA 5M3FJ 4LMYA 2YUSA 1A35A 2Y0SA 1NTCA 1O3QA 2NVUB 2RAEA 3WHBA 1MNDA 1I5ZA 3DFGA 1U3EM 1YS7A 1Z6RA 2HOAA 2ICWG 3GEZA 4UB6C 5E79C 1IC8A 5E3NA 3OYFA 3SQNA 1R1VA 2BXYA 4MIMA 3PUBA 3DCFA 4G8XA 2O03A 4XMYA 3U2RA 2W82A 1P4XA 1X2NA 1I6HJ 2KZVA 2LK2A 3H3UA 2V9PA 1R36A 3TGNA 3HOXJ 4FE7A 2Z33A 4PUSA 2QA4I 1UMQA 2M1BA 3OS2A 3BG9A 2DFHA 2X9DA 2BVLA 1WJFA 4Q4ZF 3S3OA 3FHZA 2BW3B 3T8TA 2KZGA 4ZYDA 1S9HA 2DXIA 4A0YA 4MFDA 4IHYA 1VQLI 3ABMH 4HQEA 2F5FA 1WJCA 3IV5A 3ZRGA 2OA4A 3M7GA 4KT6A 3V7SA 5CLSA 2L9SA 2W1OA 1P7JA 2DT7B 2GXAA 2BEOA 2OZUA 1X1DA 3ZN1A 3EYIA 4AIJA 2M3AA 4X0GA 3F8CA 2GA2A 1QVUA 5F0HA 2EWNA 3HBLA 1FBQA 2D1HA 1BR1A 2ZXWH 3KLOA 1T38A 3CC4I 4RB3C 1R58A 4D9JA 2O3FA 2XAHA 4OINF 1JT6A 4Z6YA 1XD7A 2Z1DA 4MTDA 1YRNB 2JA5J 1FMWA 2OTJI 2ZSIB 2DAOA 1F5TA 1W5TA 3C7JA 2VPRA 1UB9A 1BI0A 3QYFA 4A3EJ 3TBIA 1LDDA 4FCYA 3F23A 2BE5F 3WTZA 4EM1A 2JVGA 2MLGA 3CQZJ 2EZKA 1MJ9A 4UXNA 4K2EA 1GV5A 2HEOA 4DYCA 1NG6A 3ZQGA 3WHCA 4AD9A 2HKXA 1YG2A 1P7IA 1WJDA 1XN7A 1BI1A 3ABLH 1GHCA 3FXUA 2FRHA 2P81A 4E6KG 1MSFC 1XTAA 4I7HA 3RQ4A 3OSGA 3KZZA 3EETA 1AA7A 1T8IA 3U1DA 5GAHJ 1FJLA 2XGEA 2UV1A 1IXRC 1KYZA 4ENKA 1E3OC 2ZJ2A 2QKLB 2J5OA 3JSPA 2KP6A 1U9OA 1MMDA 5LFAA 3WG9A 3BTCA 4LK0F 1KZHA 4KMFA 3NQOA 3HHHA 4BJ6C 1WJEA 3B6CA 1K79A 3V7CA 1T39A 4KYWA 3R61A 5KNLA 5EEGA 3O2PE 5CJ9A 3T5XA 3OYCA 2R7SA 4JBAA 4AU7A 2Z2SB 4M6VA 2VOOA 4G94A 3AG2H 4QLCU 1YTYA 3GWZA 1XSVA 3DP7A 4RB2C 1GVDA 1OMIA 5H6QA 1HA8A 1FSEA 2QQBA 2IS1A 1MMAA 5TRDA 3VEPA 3ZCOA 4IVNA 2K9LA 2FNAA 5CPRB 5A2QZ 3G4SI 2YSRA 3FXJA 4HA8A 2KIUA 4MGRA 2ME0A 1GXPA 4AYBA 1DDNA 4Z2YA 5K5RA 3A02A 1OJLA 2DJIA 4Q48A 4HRIA 1WZ2A 2H09A 2RREA 1YW8A 5KAIC 4UVAA 1J75A 2BVMA 4FX4A 5M5XJ 3DKWA 5B66C 4P9UA 1IDYA 3OIQA 4M9SA 3KEYA 2I5UA 5F27A 3L2CA 3OWTA 1W36D 2E2IJ 2L7MP 1ORKA 2DU9A 5BMZA 1MJAA 2E34A 3OS1A 2P7VB 3MZYA 1SFUA 3PSFA 2HZTA 1LUJB 2WB1N 2XGXA 3WE3A 3ZQIA 1BC8C 1XGOA 3FZVA 2A6TA 2LYCA 3IWFA 3MKLA 2JPBA 2PEXA 3ZQLA 1WHUA 3RYRA 1Z67A 3HPGA 4XORA 1S7OA 3K4MA 1PP7U 2FOWA 2MC4A 1QU3A 2R7XA 1OYIA 2JSPA 5CVIA 3A4CA 2Z9OA 4IRHA 1JKPC 5HS8A 1MH4A 1ZGAA 3OYHA 2CU7A 5H6RA 2L4MA 3CP2A 4ENNA 1F4KA 1R4NB 4XN3A 1ETWA 3M1EA 4WK8F 1LEBA 3JRBA 3TEDA 1A6IA 2PMZN 6PAXA 5D8LB 3S17J 2DODA 2JPCA 1MJBA 2QYOA 3TDUC 2ELKA 3EUHC 4M3FA 4IRGA 5CVVA 2JA6J 1BBYA 3KP7A 5JVTA 3TO7A 3EPZA 1SMTA 4BU2A 1W1WE 2KRFA 4RLFA 3LSKA 3E7LA 3M1CA 2FQ4A 4XOPA 4EMSA 3W6JB 1X2MA 1DGRM 5J3LA 2XVCA 2ESNA 3AG4H 3K4NA 1WWXA 1D0XA 5K5QA 1QA6A 4BDYA 2A05A 3FM3A 4BS9A 3CF2A 2G7HA 1S5LC 4RAGA 3WE2A 4ZZDA 4G12A 1R1TA 2H6BA 1U5TB 5F6FA 2HKOA 1RESA 5L3BA 1VNDA 2G7UA 4A0ZA 1ZAOA 4EV0A 1RI7A 3BP8A 4HLYA 1YW9A 5IYDJ 3E5XA 1T98A 4AIKA 2Y30A 2NAZA 4NC6A 1IG7A 1FP1D 4RM3A 4L9VA 3FXKA 3R4KA 3H36A 1WH7A 3HZJA 3H5NA 1V3FA 3K7AJ 5HDNA 2XUBA 3TOAA 2NVXJ 4U0VA 2VKEA 2JZYA 3OL3A 1W5SA 1S72I 1X58A 3BR5A 4IQ4A 3OSFA 5BQTA 1Z77A 2GBYA 2W24A 2XAFA 4UVCA 1AHDP 1LQ1A 5HVQC 3TOBA 2IP2A 4E7SA 3GBGA 2K27A 2OPTA 1I1SA 1TC3C 2K85A 5D6EA 1YJ9I 3RIRA 5IT3A 4UUTA 1PUFB 1R22A 1FOXA 4BE2A 2F2EA 4ZYGA 1QPIA 1JGGA 2R7OA 1TWHJ 2FBHA 4ZZLA 4HBLA 3GZNB 1MBFA 1S6LA 1RETA 2FD5A 2KL4A 4V19K 2QEXI 1WFXA 3BG6A 2UXXA 3KZIC 5L3EA 2ACJA 2QF7A 3FKJA 1HSTA 1ITYA 1D1AA 2DJNA 4BY7J 2LBFA 2X1DA 2XB0X 1Z3YA 2LF8A 3JCUC 5EEHA 4A5NA 4L5IA 1JKRC 4AVZA 4ETSA 4J01A 3LAJA 4UV9A 4BXFA 3VOEA 2M7BA 1USTA 3GTMJ 3I56I 3JRFA 4KNYA 3T1BA 3SXYA 3QOPA 4RB1A 3L2QA 2NOJB 2XF6A 5GAEJ 3A01A 4YRVA 4RMNA 3QPHA 2OTLI 1APLC 3W6KB 3REOA 2BYVE 4CYDA 2OC6A 2QENA 1BW5A 2Y75A 3E6MA 3OYEA 2M7AA 3KZYA 4I0AA 1CF7B 3EUHA 3I58A 4MEYF 1A5JA 5J4VA 3G2BA 2VQGA 5E3LA 4KUMA 3HOWJ 4LLGF 2VT2A 5ILVA 2DMTA 3K0LA 4YFXF 3WU0A 3BTIA 1RUNA 1KQ9A 1QQIA 1EH8A 2XASA 1PUFA 1Z1DA 1NH3A 4G7ZF 4ESFA 2A69F 3OS0A 1IRZA 3R6SA 3T8RA 2L02A 1U2WA 2KJBA 1Y8RB 5LGTA 3CZ6A 3FK6A 4BQAA 2LY9A 3ECOA 3CJRB 2Z99A 1E17A 2XRLA 3KFWX 2CW7A 2LOOA 5J4YA 3HSRA 1FSHA 5E3OA 4FTHA 3FBIB 2R7TA 1IDZA 2MSYA 1IF1A 1IUFA 1W7PA 2ECBA 2MW8A 4FX0A 3LQRA 2K9NA 1SD6A 2R7FA 3F21A 1BM9A 1IN6A 2QUFA 4P9FA 5LHHA 1LKXA 1L3LA 4RGXA 5HS9A 1Q1HA 3FX3A 3QU3A 1YS6A 3TKYA 2RGVA 1ZGJA 1HSJA 4JK1X 1A36A 2EIKH 4HNVA 1ZG1A 1XC5A 2H27A 3I4PA 2O61A 4QPQA 2R93J 2L2OA 2TRTA 3EUKL 3HM5A 1U78A 1S7AA 2KIMA 3HDDA 1X3WB 2JA2A 3E6BA 3M8JA 4DZJA 1FTTA 4DBQA 4MNUA 4H4KC 1LE8A 1MMGA 4ZC3A 2R4GA 4DBRA 4P5OA 5DV5A 4N4OB 1XMAA 3L09A 4ZH4F 1ZGWA 3K1MA 1HKQA 1D1BA 5DDGA 5H2FC 3LFUA 3I0TA 3RPUD 1E0EA 1J7KA 4EJOA 3HOUJ 4KN7X 2P8TA 4IOCF 4BEHA 3PFYA 4KA4A 1TT5B 5E18F 4L0ZB 1GVJA 3K9TA 2CJJA 3AG3H 2OU2A 3HUGB 2CO5A 1JJ6C 3WTWC 4PZJA 5GPCA 2PBIA 2PMHA 2BXZA 4WCGA 3DKXA 4RGRA 2EFQA 2IRFG 1MBEA 4L9JA 1Z0XA 2KLOA 3S2DJ 5GAGJ 3LMMA 4JX4A 1PYVA 1SANA 4M3GA 1PUEE 2STTA 4R8HA 4LIUA 2R7UA 3GW2A 2L01A 2FX0A 1FOWA 4XKCA 4IZZA 2Q2EA 4XSXF 1F43A 1XDSA 2OQRA 3SDGA 5L3GA 4I76A 3O3KA 2ZXJA 4HW0A 1I3AA 4HF2A 2RN7A 2VIXA 4HPQA 4OWRB 2LSOA 1P2FA 3Q9SA 2DYSH 1VQNI 1MNEA 3RDIA 4FHTA 2WAFA 3WG7H 3WTXC 2EFPA 2HDWA 3QWLA 4A6DA 1G3SA 3PNVA 1JKQC 4KIGA 4DYRA 2DMQA 2LREA 1B9MA 1MZBA 2QSGX 1RR8C 5IP6A 1JXSA 1BN5A 4M3DA 2HYFA 2GZWA 4HZFA 4MHGA 1QPMA 4RDUA 2R7DA 2ZNZA 4IPAA 3QPLA 3J7AY 2CW8A 2M8GX 1D8JA 2C6YA 3BZCA 2Q2EB 4IOAF 3CCQI 2M45A 4ZYEA 5D4RA 1TW2A 2L54A 3DU6A 5KCMA 5DCMB 1OR7A 5JVGF 4B47A 2VUMJ 1W7PD 2IW5A 4QWQA 4E4HA 4ZTFA 2E1MC 3JRIA 1PJRA 2LBFB 3RI4A 2Y0MA 5J8FA 3H92A 4E7JA 4U0WA 5GADJ 1IRGA 2VT3A 5M5WJ 2IAIA 2HWVA 4JX5A 4B43A 3ELKA 3DU5A 3LA3A 1GXQA 1ETQA 3PIOF 3DEEA 4DJAA 4D0PA 2LG4A 3RCOA 1KU3A 5F1RA 5F0CA 1W0UA 4CCLA 2BV6A 1VQ9I 2E7WA 3Q0VA 3KX2A 1R23A 4DZPA 1OCRH 2EJRA 5FJ8J 3MKZA 1HW2A 2CUFA 4R79A 2WWYA 1J5YA 4PSXA 3A2KA 4PCQA 3H0DA 2ID6A 1G4DA 1YX5A 4IHSA 3FDYA 3H3ZA 4I99C 3ABTA 2MGQA 2DPDA 2X4HA 1A6QA 1BOBA 1FIAA 2P5LC 4A3GJ 3GUDA 2HTJA 4R1HA 1ZQ3P 2V26A 3CCUI 4MO7A 1X1AA 1M1EB 2F48A 3BJAA 1JUPA 4IJAA 2DOFA 4M6YA 4ON0A 4XLNF 3HRTA 3ISPA 5E17F 1WRJA 2DK5A 3KE2A 3PUFA 3HOZJ 2XAUA 1R49A 4A3KJ 4LGWA 3CJNA 2VN2A 4JX6A 4UUVA 3BTJA 3U1KA 2A61A 4QPOA 2XPWA 3TQNA 1V4RA 3E97A 4GO1A 3BZKA 3C2HA 4IHXA 1PP8F 4U87A 1DGWY 3DBRB 4XK4A 3GTJJ 5FFXA 2P4WA 4YEJA 2ADUA 5IY5H 1N75A 1O3TA 3CMEI 4CHUA 2WAQA 3S1RJ 3H9QA 5B1BH 2K5CA 3OYJA 1YI2I 2VBYA 4RLQA 4AIHA 4UUSA 2BOLA 4P55A 2KIFA 5F1JA 3GFLA 2DPUA 1TTYA 1T0FA 2QSFX 2HZDA 4CA0A 2B0LA 3K2AA 5D5VB 2V1XA 2UZKA 1OCTC 3M9AA 1SFEA 2KRHA 3HTUA 3NWTA 5EG0A 2M4KA 2QKMB 1FNNA 2K02A 1R9TJ 2CUJA 2Q0OA 2W84A 1E2XA 1XGSA 4PJ0C 2EFNA 2VQLA 2DA7A 3VYRB 4EEFG 2NVTJ 3FXOA 4M9ZA 4BGDA 2FBKA 1QNTA 2NS7A 3LA2A 3J80K 3I55I 1VQMI 4BDZA 2ZJPF 3C3WA 1IXSB 1JE8A 4J19A 3N97A 5EGOB 5JR3A 1IN7A 5EDNA 1YJNI 2L9RA 1UCRA 2LD5A 1LFUP 5GTHC 4L18B 4BJTA 1Z7UA 2OQGA 1ULYA 3S3NA 4B4CA 3CP8A 1VQ7I 3O8HA 3CO6C 5LRRA 4XOTA 3IWZA 1GT0C 2G0EA 1MSEC 3K70C 2O9LA 3BG5A 2BBYA 4G6TB 1FTZA 2E19A 4GFBA 2PI0A 1BA5A 1I50J 4MQVA 2EIJH 1SEUA 4IEJA 4M71A 3JAMK 2WBMA 2CH0A 4D5FA 1CQTA 4LFUA 1EH7A 1WSUA 3EYYA 4EVIA 1OCPA 2WV1A 5F04A 4CO8A 4N9IA 1VQ5I 3UR3C 4QTRA 2KDZA 1SFXA 2OJED 2EV6A 1R6RA 1X1PA 3NEUA 1OCOH 3F8NA 2KDOA 4E7IA 2DW4A 4RBOA 2F5EA 3S2WA 4OAZA 1WJBA 5HNFA 2BGCA 2IA2A 2CG4A 4EM0B 1V5EA 4LG3A 4X1EA 4JYKA 5DD4A 4A3LJ 2K7LA 5HS7A 2AQEA 2H94A 5GP9A 4RM2A 1T2KA 1JJ8C 1IJWC 1T0FC 4RGSA 2XAGA 2GXBA 3RPUA 4C2TA 2WA0A 3LL7A 4C30A 4W97A 3BWGA 2GIZA 3LSTA 1SD4A 2KFDA 4HOBA 3VODA 2VB6A 2QCOA 1TP4A 3AG1H 3ROUA 4IL6C 4M72A 1NK3P 1MGTA 5BPDA 3ESWB 1J0RA 2DFEA 3K6GA 2K9MA 1OPCA 1SVLA 3AAFA 1P92A 5AIPA 3O8GA 2DOAA 1V55H 3I54A 3ZMSA 2VBZA 3VWBA 2E5ZA 2B63J 4WXHA 1YO5C 1NK2P 1HF0A 4ZTJA 1YLFA 4GXOA 4EGYA 2KJCA 3ASNH 1UFMA 4Y13A 2CQXA 4CH7A 3AL0B 1QZZA 3OIPA 5IYCJ 2W48A 4E7LA 2WY7Q 4HEA2 2HXOA 3B02A 1QO0D 2L9VA 5HDGA 5D5WB 3OV8A 3G1OA 4G7OF 1MMNA 3C1DA 2A07F 3M07A 4C2MJ 2UWMA 1NHAA 3I4NJ 3B73A 3CMMA 5LBQA 2E35A 5L3FA 2O8XA 1UHMA 4II3A 1JI8A 1C0WA 4S0HB 3MFKA 2DQRA 3OIOA 4IRIA 3RYPA 2CV1A 3DEWA 2E1CA 3VYTB 3CO7C 2VC0A 2VOPA 3CLQA 2V6CA 1FLIA 1BR4A 4CCOA 1XGMA 3SYTA 3WTSC 3FK7A 3S2HJ 5JI6A 5C44J 1VQ4I 1JUSA 2EB7A 4IXAA 2XIGA 3N05A 3ZMVA 3SZTA 4CGZA 1W36C 3EQLF 4DQ2A 2DA5A 5E1WA 1QHHD 1ZELA 1H9GA 3LOCA 3VSKA 1DU0A 1N78A 4XBFA 4F52A 4C3HJ 1Z05A 3D1NI 3M4OJ 2P0WA 4CCJA 2E71A 3DPTA 2ZC2A 5ICGA 4AUXA 3VB2A 3LQQA 4F55A 3OYAA 1O3RA 2V1UA 2Q1ZB 4LLNA 3WTTC 4XLHA 5K1YA 1Z6TA 2MG4A 2ZO4A 3HSEA 2X48A 1I27A 3JRHA 4A3FJ 3CDIA 2QQ9A 2ZJRF 4Q5SF 3FXRA 2M4GA 2PX9A 2DTRA 3GXOA 4PK4A 1LVKA 4HSRA 4KJZA 1R4MB 3UKGA 4XR6A 2NOGA 2WTEA 3BLYA 1H9TA 4MEXF 2AHQA
chains in the Genus database with same CATH topology
2E1NA 3BJOA 2QBYA 1R1UA 1ONVA 2O6GE 4O3MA 3KCCA 3F72A 5FD6A 5K5OA 2XAQA 1QGPA 2EA4A 3HSFA 2JRTA 4DNCA 1U8RA 3Q5FA 3PQKA 2FXAA 3MCZA 4CDGA 2WV0A 1I1GA 2EV0A 4OIRF 1TQPA 2K4JA 3TO6A 3FMRA 1IXCA 2YR2A 4BNCA 4ASNA 4B09A 3F8FA 3WGIA 3IKVA 1FYKA 1O3SA 1CF7A 2CFXA 2A68F 2LKPA 3DPLC 2DLLA 1UHWA 4XSZF 1K78B 3GF2A 4KDPA 4A0XA 3BY6A 3RKXA 3BZ6A 1ZLJA 2XROA 4EJTA 1XSXA 5CVJA 2CQKA 1EV7A 1J2XA 4OU0A 4LB5A 1YIOA 5D8KB 2QWWA 3GLXA 2JSCA 3SZPA 3O6BB 2DBBA 4ZYHA 1FWZA 3KP6A 3E3VA 3FMSA 2ELHA 3WTUC 1ZRDA 1ZH5A 1BIBA 1MKMA 1ZN2A 2D2WA 1R7JA 4MTEA 2PJPA 2IPQX 2HDCA 3WTVC 4AWXB 3FM5A 2NS0A 2GA1A 1XCVA 1D3YA 1L0OC 3F6VA 4YG2F 4L5JA 2DQLA 4XLPF 2L3DA 3IKTA 1TNSA 4EJUA 5IT9K 2EV5A 3Q9VA 3IRQA 5DCMA 2Q8KA 3COAC 2D1VA 3ZMUA 5J6XA 2VE8A 3I59B 3WGHA 2M87A 2EFWA 2QQAA 5L3CA 3G3ZA 2FQ3A 4E70A 3FF5A 3K1PA 2FU4A 2YX4A 3CUQB 2F5DA 3DXJF 4LD5A 2A6HF 3ML6A 2FBIA 2NYXA 3ZP5A 3V7RA 2TDXA 1HXDA 4LJZF 1S3JA 3L7WA 3KP3A 1LJ9A 1OKRA 3F6OA 3K2ZA 1ZRCA 3ECHA 3MZHA 2ZNYA 5BS6A 5BOXA 5HLHA 4OIQF 4UVBA 1FYMA 1JHHA 5DYMA 4WWCA 1ON1A 2H6CA 3DEUA 4JQFA 2V1DA 3FMQA 5E8GA 1KQ8A 2OZ6A 3DF8A 4M6XA 4HX4A 3ERED 2FE3A 1BC7C 2QM3A 4U0YA 2PMUA 4PGHA 1QBJA 2FEZA 5ERIA 3JTHA 2Y48A 2ZBKA 1XDUA 4BH9A 5D5XB 3CLOA 2JTVA 1BI2A 5LRSA 3KP4A 3QP5A 1IN8A 5HDKA 4FT8A 3P9IA 2CSOA 3L00A 4G7HF 1STZA 3VFZA 2RV8A 1OYWA 5DD8A 2ISZA 2X0LA 1T6SA 3I64A 4M9XA 2Z5UA 4CICA 5D4SA 1USSA 1EH6A 3CUOA 5CYVA 1S29A 1TLHB 3HRSA 5ED4A 4BHCA 3GVAA 3ZMTA 1SD7A 2FNPA 3BROA 1DPRA 3L9FA 3G73A 4Y17A 3F8BA 4YIFA 4AVPA 3J81Z 1KU2A 3KP2A 1Z91A 3I59A 4OIOF 1ZG3A 4CXFA 2FMLA 1B6AA 3FWEA 2RDPA 5LGNA 1JGSA 4I09A 1ON2A 3QRFF 3D5LA 2W25A 4LK1F 2O0YA 2STWA 1IZ1A 2PN6A 2HQNA 1KQ0A 1XB4A 3RTRA 2RC4A 2KKOA 4OIPF 3V8LA 3LWFA 3RKWA 3R60A 2P5KA 1B9NA 3OOPA 2VXZA 3U9GA 4HX7A 4UNOA 2YPRA 4O5VA 3E6DA 3ZN0A 1ZG5A 4U7DA 1FY7A 1ZRFA 4KN4X 1RUOA 3F8MA 3RPQA 1R00A 1S8NA 2MD5A 1BI3A 3QAHA 1FZPB 4I98B 2PQ8A 2ETHA 5LHIA 1FYLA 4U88A 1MDMB 3ZMZA 4Q47A 5DEQA 2M8EA 3ZMDA 2GAUA 3BOQA 4NQWA 3I71A 3DV8A 2IA0A 4A2UA 4KIBA 4RB0A 3FXQA 3MAJA 4EM2A 1U5TA 3GX4X 4BYYA 1IW7F 1VTNC 4A12A 3V8JA 1SAXA 4G9YA 3J7AO 3RJPA 2QLZA 4HF0A 2DT5A 4L9TA 4OMZA 1G6NA 3J81K 2AS5F 3P9CA 1XCBA 1YQAA 5E8IA 5D5UB 2ISYA 4M73A 5DUKA 2XKOA 3RKYA 1G3YA 4G6QA 3PFIA 4A5MA 3ABUA 3KEQA 4UHTA 2K86A 2FA5A 5E1XA 3TO9A 4WXCA 1RNLA 2GQQA 1WI9A 2G9WA 1I6XA 2LDUA 3IHUA 1KU9A 2Z3YA 4RGUA 2LNBA 3JTGA 2HR3A 4XRFA 3P7NA 4B8XA 4HV6A 3KEOA 1BOAA 2XRNA 3HUGA 2HQRA 3HOTA 3R0JA 4ENJA 5E20A 2P6SA 4HAMA 4NHJA 2PG4A 1RIOH 4WXDA 1XMKA 1D8KA 2AXLA 1KU7A 3HHGA 1YFHA 1ZHFA 3BPVA 1HW1A 4CZZA 1LEAA 2MH9A 1XSDA 2EFOA 2YU3A 3CUQA 2MH2A 1P4WA 1B4AA 1FT9A 3V4GA 4S04A 4L9NA 5DCFA 1DP7P 2IT0A 5FGMA 3T0YA 5IT9Z 2HTSA 4RAZA 1DPUA 5FO5A 4I0BA 3EDPA 2MLKA 1IN5A 2IA1A 1BJAA 4GCVA 5DUIA 4HDUA 2M30A 2CGPA 1ODDA 4G6DA 3M8EA 1K6OA 4LB6B 3LFKA 2F5CA 2CW0F 4HDVA 5TJJA 4O6JA 2XHKA 1HKTA 2OAZA 4HQMA 1SD5A 3ZPLA 2WC2A 1FBUA 2RVCA 4IF4A 1A04A 4LG0A 5LEKA 5ICEA 4OMYA 4KMUX 3WU1B 1IRFA 3MEXA 2D45A 4BHBA 4I2OA 4LG0B 2VBXA 2VONA 5ILUA 1K78A 4HF1A 2OBPA 1TQIA 3GYHX 3GO5A 5H20A 1B1BA 1HQCA 1W4MA 2EA2A 5D6FA 1MD0A 1ZLKA 3IRRA 2GXGA 3CUQC 1F1ZA 3KLNA 4KIFA 3SFZA 4BXUA 5KVRA 2W57A 3BPXA 4KT5C 2CWEA 3F3XA 2ZKZA 4LLLA 3MWMA 1ZYRF 2ESHA 4WF2A 4H0EA 2XAJA 5AIQA 3KP5A 5FB2A 3GFMA 1BIAA 1HKSA 2QVOA 3I5UA 4RS8A 5LGUA 4S05A 4KFCA 3F22A 4N0BA 4BAYA 1F9NA 1LNWA 1IN4A 2RKHA 2GWRA 1FX7A 1PDNC 1JHFA 3E6CC 2LF7A 3NRVA 2FOKA 1IUYA 4YFKF 4HLXA 1MDMA 2CYYA 1B59A 5F64A 1J59A 3IL2A 2HS5A 4GYGA 2M5WA 3JSOA 1LVAA 2MBFA 3I53A 4A6EA 5BPIA 4HYEA 1J9IA 3GZ6A 2EK5A 4PGGA 3QP6A 4WX9A 2QBYB 3R0AA 4ESJA 1LDJA 1ZREA 3HTSB 4YIIA 1P4AA 5KK1A 1ZARA 3GZ5A 5FD5A 1TBXA 1DUXC 2ZMEB 5ICFA 4KICA 4EQQA 2ZCWA 4YFNF 1FBSA 4OOIA 2ZFWA 5A2QK 3J80Z 2VBWA 3QU6A 2V9VA 4P96A 2IJLA 1Z9CA 2DI3A 3K1NA 1U5TC 3V8KA 4Y15A 1O7FA 3JW4A 2E7XA 2RQPA 4HV5A 2K4BA 2COMA 3SHFA 1FC3A 4L0YB 1R5HA 2P5VA 1KGSA 2J5PA 1SMYF 5FFZA 3M8FA 2RNJA 1P6RA 3LA7A 4PDKA 3K69A 3JAMZ 3D0SA 2DFIA 5L3DA 2VE9A 3BJ6A 4ESBA 2P7CB 1IAWA 1K7AA 1CGPA 1REPC 1LDKB 3PQJA 5LHGA 1H0MA 3E5QA 5ICCA 1G3TA 4EJVA 2FF4A 1RZ4A 1TQMA 4BHPA 2A5YB 3E5UA 3GFJA 2MA3A 1YW7A 2W85A 1O7LA 2NNNA 2XV4S 4HX8A 5AONA 3P9KA 3KETA 5HLIA 2QZ8A 2FSWA 1AOYA 1KYWA 3HOSA 2DO7A 4MQ9F 2HFHA 4EGZA 3MQ0A 3N4MA 3LAPA 1Y0UA 2PLYA 3C18A 3HRMA 2UXNA 2GIVA 3ZQ7A 5JFRA 3QPTA 5FLXK 4NB5A 1WKMA 2V79A 1HW5A 4I02A 2FMYA 1OYYA 3HIFA 1AWCA 5LEJA 1XGNA 4M74A 2P6TA 5E1ZB 1R5GA 3WTYC 3DQVC 4GGGA 5LLQA 5JHUA 5HLGA 3BDDA 1O57A 2NRAC 1QZYA 4F7ZA 3CTAA 1X3UA 2XKPA 2DK8A 3HYIA 3WGGA 4GYIA 5HOOA 1LB2A 2HGCA 3TDZC 5ILSA 3WODF 2A3SA 1G3WA 1FOKA 1WQ2A 3IC7A 2VC1A 1U6GA 3HRUA 4IHTA 2PFBA 2YX7A 2JT1A 4UV8A 2MC3A 5J8CA 1D5VA 3ULQB 1HBXG 5CVUA 2VODA 5FLXZ 1TW3A 2ZMEA 4U7BA 2HOEA 2HYGD 2A6EF 4RAYA 2L4AA 2NNYA 1FP2A 5CVRA 2IVMA 4ENMA 2R3SA 3GFIA 4N9HA 4TV7A 3CDHA 1YYVA 1TNTA 4EJWA 2OD5A 1KA8A 4I01A 1FPQA 4LMYA 1O3QA 1U3EM 1I5ZA 3DFGA 1YS7A 1Z6RA 3GEZA 3SQNA 1R1VA 4G8XA 2O03A 3U2RA 1P4XA 3H3UA 1R36A 3TGNA 2Z33A 2M1BA 4Q4ZF 3FHZA 3T8TA 4ZYDA 4A0YA 4HQEA 2F5FA 2OA4A 3M7GA 3V7SA 5CLSA 2BEOA 2OZUA 3ZN1A 3EYIA 4AIJA 3F8CA 2GA2A 2EWNA 1FBQA 2D1HA 3KLOA 1T38A 4RB3C 1R58A 2O3FA 2XAHA 4OINF 1XD7A 4MTDA 2DAOA 1F5TA 1W5TA 3C7JA 1UB9A 1BI0A 1LDDA 3F23A 2BE5F 3WTZA 4EM1A 2MLGA 1MJ9A 4UXNA 4K2EA 2HEOA 4AD9A 2HKXA 1YG2A 1XN7A 1BI1A 1GHCA 3FXUA 2FRHA 4I7HA 3KZZA 3EETA 3U1DA 1IXRC 1KYZA 4ENKA 2ZJ2A 2J5OA 3JSPA 3WG9A 4LK0F 4KMFA 3NQOA 3HHHA 1K79A 3V7CA 1T39A 4KYWA 3R61A 5EEGA 3O2PE 5CJ9A 3T5XA 4JBAA 2VOOA 4G94A 4QLCU 1YTYA 3GWZA 1XSVA 3DP7A 4RB2C 1OMIA 5H6QA 1FSEA 2QQBA 5TRDA 3VEPA 4IVNA 2FNAA 5A2QZ 2YSRA 4HA8A 2KIUA 4MGRA 1GXPA 1DDNA 4Z2YA 5K5RA 4Q48A 2H09A 1YW8A 4UVAA 1J75A 4FX4A 3DKWA 4P9UA 3L2CA 4M9SA 2DU9A 5BMZA 1MJAA 2P7VB 3MZYA 1SFUA 2HZTA 2XGXA 3WE3A 1BC8C 1XGOA 3FZVA 3IWFA 2JPBA 2PEXA 3RYRA 1S7OA 1PP7U 1OYIA 5CVIA 2Z9OA 4IRHA 5HS8A 1ZGAA 5H6RA 2L4MA 4ENNA 1F4KA 3M1EA 4WK8F 1LEBA 6PAXA 5D8LB 2JPCA 1MJBA 2QYOA 3TDUC 4IRGA 5CVVA 1BBYA 3KP7A 5JVTA 3TO7A 1SMTA 2KRFA 4EMSA 3W6JB 2XVCA 2ESNA 1WWXA 5K5QA 3FM3A 2G7HA 3WE2A 4ZZDA 1R1TA 2H6BA 1U5TB 5F6FA 2HKOA 5L3BA 2G7UA 4A0ZA 1ZAOA 4EV0A 1RI7A 3BP8A 4HLYA 1YW9A 3E5XA 1T98A 4AIKA 2NAZA 1FP1D 4L9VA 3R4KA 1V3FA 5HDNA 2XUBA 3TOAA 4U0VA 2JZYA 1W5SA 5BQTA 2W24A 2XAFA 4UVCA 1LQ1A 5HVQC 3TOBA 2IP2A 2K27A 1I1SA 5D6EA 3RIRA 5IT3A 1R22A 2F2EA 4ZYGA 4ZZLA 2FBHA 4HBLA 1S6LA 2ACJA 2UXXA 5L3EA 1HSTA 2LF8A 5EEHA 4A5NA 4L5IA 4ETSA 3LAJA 4UV9A 3VOEA 1USTA 4KNYA 3T1BA 3SXYA 3QOPA 4RB1A 3QPHA 3W6KB 3REOA 2BYVE 4CYDA 2QENA 2Y75A 3E6MA 3KZYA 1CF7B 4I0AA 3EUHA 3I58A 4MEYF 4KUMA 4LLGF 2VT2A 5ILVA 3K0LA 4YFXF 3WU0A 1RUNA 1KQ9A 1QQIA 1EH8A 2XASA 1Z1DA 4G7ZF 4ESFA 2A69F 3R6SA 3T8RA 2L02A 1U2WA 2KJBA 5LGTA 4BQAA 3ECOA 2Z99A 1E17A 3KFWX 1FSHA 3HSRA 1IF1A 1W7PA 4FX0A 3LQRA 1SD6A 2R7FA 3F21A 1BM9A 1IN6A 2QUFA 4P9FA 5LHHA 1L3LA 4RGXA 5HS9A 1Q1HA 3FX3A 3QU3A 1YS6A 3TKYA 2RGVA 1ZGJA 1HSJA 4JK1X 1ZG1A 2H27A 3I4PA 2O61A 1U78A 1S7AA 2KIMA 3E6BA 4MNUA 4P5OA 5DV5A 1XMAA 3L09A 4ZH4F 3K1MA 1HKQA 5DDGA 3I0TA 1J7KA 4EJOA 4KN7X 2P8TA 4KA4A 5E18F 4L0ZB 1GVJA 3K9TA 2OU2A 2CO5A 3WTWC 4PZJA 2PBIA 2PMHA 4WCGA 4RGRA 2EFQA 2IRFG 4L9JA 1PUEE 2STTA 4R8HA 3GW2A 2L01A 2Q2EA 4XSXF 1XDSA 2OQRA 5L3GA 3O3KA 2ZXJA 4HW0A 4HF2A 2RN7A 2LSOA 1P2FA 3Q9SA 3RDIA 4FHTA 3WTXC 2EFPA 4A6DA 1G3SA 4KIGA 1B9MA 1MZBA 1JXSA 1BN5A 2HYFA 2GZWA 4HZFA 4MHGA 1QPMA 2R7DA 2ZNZA 4IPAA 1D8JA 2C6YA 2M45A 4ZYEA 5D4RA 1TW2A 2L54A 5DCMB 1OR7A 1W7PD 2IW5A 4QWQA 3RI4A 2Y0MA 5J8FA 3H92A 4U0WA 1IRGA 2VT3A 2HWVA 3ELKA 3LA3A 1GXQA 4D0PA 1KU3A 5F1RA 2BV6A 2E7WA 1R23A 2EJRA 1HW2A 4R79A 2WWYA 1J5YA 4PCQA 1G4DA 4IHSA 3H3ZA 3ABTA 2DPDA 2X4HA 2P5LC 3GUDA 2HTJA 4R1HA 3BJAA 4IJAA 4ON0A 4XLNF 4M6YA 3HRTA 3ISPA 5E17F 1WRJA 2DK5A 3KE2A 4LGWA 3CJNA 2VN2A 4UUVA 2A61A 3TQNA 1V4RA 3E97A 4GO1A 1PP8F 5FFXA 2P4WA 2ADUA 1O3TA 4CHUA 2VBYA 4AIHA 4P55A 2KIFA 3GFLA 2DPUA 1TTYA 1T0FA 2B0LA 5D5VB 2V1XA 2UZKA 3M9AA 1SFEA 3HTUA 1FNNA 2K02A 2Q0OA 2W84A 1E2XA 1XGSA 2EFNA 4M9ZA 2FBKA 1QNTA 3J80K 3LA2A 3C3WA 1JE8A 1IXSB 3N97A 5JR3A 1IN7A 1UCRA 4L18B 1Z7UA 2OQGA 1ULYA 3CO6C 5LRRA 3IWZA 2BBYA 2PI0A 4MQVA 4M71A 3JAMK 4LFUA 1EH7A 1WSUA 3EYYA 4EVIA 4CO8A 4N9IA 1SFXA 2EV6A 3NEUA 3F8NA 2DW4A 2F5EA 3S2WA 2BGCA 2IA2A 2CG4A 4EM0B 5DD4A 2K7LA 5HS7A 2H94A 1T2KA 4RGSA 2XAGA 2GXBA 3RPUA 3BWGA 3LSTA 1SD4A 4HOBA 3VODA 3ROUA 4M72A 1MGTA 5BPDA 1J0RA 1OPCA 3AAFA 1P92A 5AIPA 3I54A 3ZMSA 2VBZA 4WXHA 1YO5C 1YLFA 4GXOA 4EGYA 2KJCA 1UFMA 4Y13A 1QZZA 3B02A 1QO0D 5HDGA 5D5WB 3OV8A 4G7OF 2A07F 3C1DA 2UWMA 1NHAA 3B73A 5LBQA 5L3FA 2O8XA 1UHMA 1C0WA 3MFKA 2DQRA 4IRIA 3RYPA 2E1CA 3CO7C 2VC0A 2VOPA 1FLIA 2V6CA 1XGMA 3WTSC 5JI6A 2EB7A 4IXAA 2XIGA 3ZMVA 3SZTA 4CGZA 3EQLF 4DQ2A 5E1WA 1H9GA 4XBFA 1Z05A 3DPTA 5ICGA 3VB2A 3LQQA 1O3RA 2V1UA 4LLNA 3WTTC 5K1YA 1Z6TA 2ZO4A 3HSEA 1I27A 2QQ9A 4Q5SF 3FXRA 3GXOA 2DTRA 2WTEA 1W7PB 1H9TA 4MEXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1N A;  3BJO A;  2QBY A;  1R1U A;  1ONV A;  2O6G E;  4O3M A;  3KCC A;  3F72 A;  5FD6 A;  5K5O A;  2XAQ A;  1QGP A;  2EA4 A;  3HSF A;  2JRT A;  4DNC A;  1U8R A;  3Q5F A;  3PQK A;  2FXA A;  3MCZ A;  4CDG A;  2WV0 A;  1I1G A;  2EV0 A;  4OIR F;  1TQP A;  2K4J A;  3TO6 A;  3FMR A;  1IXC A;  2YR2 A;  4BNC A;  4ASN A;  4B09 A;  3F8F A;  3WGI A;  3IKV A;  1FYK A;  1O3S A;  1CF7 A;  2CFX A;  2A68 F;  2LKP A;  3DPL C;  2DLL A;  1UHW A;  4XSZ F;  1K78 B;  3GF2 A;  4KDP A;  4A0X A;  3BY6 A;  3RKX A;  3BZ6 A;  1ZLJ A;  2XRO A;  4EJT A;  1XSX A;  5CVJ A;  2CQK A;  1EV7 A;  1J2X A;  4OU0 A;  4LB5 A;  1YIO A;  5D8K B;  2QWW A;  3GLX A;  2JSC A;  3SZP A;  3O6B B;  2DBB A;  4ZYH A;  1FWZ A;  3KP6 A;  3E3V A;  3FMS A;  2ELH A;  3WTU C;  1ZRD A;  1ZH5 A;  1BIB A;  1MKM A;  1ZN2 A;  2D2W A;  1R7J A;  4MTE A;  2PJP A;  2IPQ X;  2HDC A;  3WTV C;  4AWX B;  3FM5 A;  2NS0 A;  2GA1 A;  1XCV A;  1D3Y A;  1L0O C;  3F6V A;  4YG2 F;  4L5J A;  2DQL A;  4XLP F;  2L3D A;  3IKT A;  1TNS A;  4EJU A;  5IT9 K;  2EV5 A;  3Q9V A;  3IRQ A;  5DCM A;  2Q8K A;  3COA C;  2D1V A;  3ZMU A;  5J6X A;  2VE8 A;  3I59 B;  3WGH A;  2M87 A;  2EFW A;  2QQA A;  5L3C A;  3G3Z A;  2FQ3 A;  4E70 A;  3FF5 A;  3K1P A;  2FU4 A;  2YX4 A;  3CUQ B;  2F5D A;  3DXJ F;  4LD5 A;  2A6H F;  3ML6 A;  2FBI A;  2NYX A;  3ZP5 A;  3V7R A;  2TDX A;  1HXD A;  4LJZ F;  1S3J A;  3L7W A;  3KP3 A;  1LJ9 A;  1OKR A;  3F6O A;  3K2Z A;  1ZRC A;  3ECH A;  3MZH A;  2ZNY A;  5BS6 A;  5BOX A;  5HLH A;  4OIQ F;  4UVB A;  1FYM A;  1JHH A;  5DYM A;  4WWC A;  1ON1 A;  2H6C A;  3DEU A;  4JQF A;  2V1D A;  3FMQ A;  5E8G A;  1KQ8 A;  2OZ6 A;  3DF8 A;  4M6X A;  4HX4 A;  3ERE D;  2FE3 A;  1BC7 C;  2QM3 A;  4U0Y A;  2PMU A;  4PGH A;  1QBJ A;  2FEZ A;  5ERI A;  3JTH A;  2Y48 A;  2ZBK A;  1XDU A;  4BH9 A;  5D5X B;  3CLO A;  2JTV A;  1BI2 A;  5LRS A;  3KP4 A;  3QP5 A;  1IN8 A;  5HDK A;  4FT8 A;  3P9I A;  2CSO A;  3L00 A;  4G7H F;  1STZ A;  3VFZ A;  2RV8 A;  1OYW A;  5DD8 A;  2ISZ A;  2X0L A;  1T6S A;  3I64 A;  4M9X A;  2Z5U A;  4CIC A;  5D4S A;  1USS A;  1EH6 A;  3CUO A;  5CYV A;  1S29 A;  1TLH B;  3HRS A;  5ED4 A;  4BHC A;  3GVA A;  3ZMT A;  1SD7 A;  2FNP A;  3BRO A;  1DPR A;  3L9F A;  3G73 A;  4Y17 A;  3F8B A;  4YIF A;  4AVP A;  3J81 Z;  1KU2 A;  3KP2 A;  1Z91 A;  3I59 A;  4OIO F;  1ZG3 A;  4CXF A;  2FML A;  1B6A A;  3FWE A;  2RDP A;  5LGN A;  1JGS A;  4I09 A;  1ON2 A;  3QRF F;  3D5L A;  2W25 A;  4LK1 F;  2O0Y A;  2STW A;  1IZ1 A;  2PN6 A;  2HQN A;  1KQ0 A;  1XB4 A;  3RTR A;  2RC4 A;  2KKO A;  4OIP F;  3V8L A;  3LWF A;  3RKW A;  3R60 A;  2P5K A;  1B9N A;  3OOP A;  2VXZ A;  3U9G A;  4HX7 A;  4UNO A;  2YPR A;  4O5V A;  3E6D A;  3ZN0 A;  1ZG5 A;  4U7D A;  1FY7 A;  1ZRF A;  4KN4 X;  1RUO A;  3F8M A;  3RPQ A;  1R00 A;  1S8N A;  2MD5 A;  1BI3 A;  3QAH A;  1FZP B;  4I98 B;  2PQ8 A;  2ETH A;  5LHI A;  1FYL A;  4U88 A;  1MDM B;  3ZMZ A;  4Q47 A;  5DEQ A;  2M8E A;  3ZMD A;  2GAU A;  3BOQ A;  4NQW A;  3I71 A;  3DV8 A;  2IA0 A;  4A2U A;  4KIB A;  4RB0 A;  3FXQ A;  3MAJ A;  4EM2 A;  1U5T A;  3GX4 X;  4BYY A;  1IW7 F;  1VTN C;  4A12 A;  3V8J A;  1SAX A;  4G9Y A;  3J7A O;  3RJP A;  2QLZ A;  4HF0 A;  2DT5 A;  4L9T A;  4OMZ A;  1G6N A;  3J81 K;  2AS5 F;  3P9C A;  1XCB A;  1YQA A;  5E8I A;  5D5U B;  2ISY A;  4M73 A;  5DUK A;  2XKO A;  3RKY A;  1G3Y A;  4G6Q A;  3PFI A;  4A5M A;  3ABU A;  3KEQ A;  4UHT A;  2K86 A;  2FA5 A;  5E1X A;  3TO9 A;  4WXC A;  1RNL A;  2GQQ A;  1WI9 A;  2G9W A;  1I6X A;  2LDU A;  3IHU A;  1KU9 A;  2Z3Y A;  4RGU A;  2LNB A;  3JTG A;  2HR3 A;  4XRF A;  3P7N A;  4B8X A;  4HV6 A;  3KEO A;  1BOA A;  2XRN A;  3HUG A;  2HQR A;  3HOT A;  3R0J A;  4ENJ A;  5E20 A;  2P6S A;  4HAM A;  4NHJ A;  2PG4 A;  1RIO H;  4WXD A;  1XMK A;  1D8K A;  2AXL A;  1KU7 A;  3HHG A;  1YFH A;  1ZHF A;  3BPV A;  1HW1 A;  4CZZ A;  1LEA A;  2MH9 A;  1XSD A;  2EFO A;  2YU3 A;  3CUQ A;  2MH2 A;  1P4W A;  1B4A A;  1FT9 A;  3V4G A;  4S04 A;  4L9N A;  5DCF A;  1DP7 P;  2IT0 A;  5FGM A;  3T0Y A;  5IT9 Z;  2HTS A;  4RAZ A;  1DPU A;  5FO5 A;  4I0B A;  3EDP A;  2MLK A;  1IN5 A;  2IA1 A;  1BJA A;  4GCV A;  5DUI A;  4HDU A;  2M30 A;  2CGP A;  1ODD A;  4G6D A;  3M8E A;  1K6O A;  4LB6 B;  3LFK A;  2F5C A;  2CW0 F;  4HDV A;  5TJJ A;  4O6J A;  2XHK A;  1HKT A;  2OAZ A;  4HQM A;  1SD5 A;  3ZPL A;  2WC2 A;  1FBU A;  2RVC A;  4IF4 A;  1A04 A;  4LG0 A;  5LEK A;  5ICE A;  4OMY A;  4KMU X;  3WU1 B;  1IRF A;  3MEX A;  2D45 A;  4BHB A;  4I2O A;  4LG0 B;  2VBX A;  2VON A;  5ILU A;  1K78 A;  4HF1 A;  2OBP A;  1TQI A;  3GYH X;  3GO5 A;  5H20 A;  1B1B A;  1HQC A;  1W4M A;  2EA2 A;  5D6F A;  1MD0 A;  1ZLK A;  3IRR A;  2GXG A;  3CUQ C;  1F1Z A;  3KLN A;  4KIF A;  3SFZ A;  4BXU A;  5KVR A;  2W57 A;  3BPX A;  4KT5 C;  2CWE A;  3F3X A;  2ZKZ A;  4LLL A;  3MWM A;  1ZYR F;  2ESH A;  4WF2 A;  4H0E A;  2XAJ A;  5AIQ A;  3KP5 A;  5FB2 A;  3GFM A;  1BIA A;  1HKS A;  2QVO A;  3I5U A;  4RS8 A;  5LGU A;  4S05 A;  4KFC A;  3F22 A;  4N0B A;  4BAY A;  1F9N A;  1LNW A;  1IN4 A;  2RKH A;  2GWR A;  1FX7 A;  1PDN C;  1JHF A;  3E6C C;  2LF7 A;  3NRV A;  2FOK A;  1IUY A;  4YFK F;  4HLX A;  1MDM A;  2CYY A;  1B59 A;  5F64 A;  1J59 A;  3IL2 A;  2HS5 A;  4GYG A;  2M5W A;  3JSO A;  1LVA A;  2MBF A;  3I53 A;  4A6E A;  5BPI A;  4HYE A;  1J9I A;  3GZ6 A;  2EK5 A;  4PGG A;  3QP6 A;  4WX9 A;  2QBY B;  3R0A A;  4ESJ A;  1LDJ A;  1ZRE A;  3HTS B;  4YII A;  1P4A A;  5KK1 A;  1ZAR A;  3GZ5 A;  5FD5 A;  1TBX A;  1DUX C;  2ZME B;  5ICF A;  4KIC A;  4EQQ A;  2ZCW A;  4YFN F;  1FBS A;  4OOI A;  2ZFW A;  5A2Q K;  3J80 Z;  2VBW A;  3QU6 A;  2V9V A;  4P96 A;  2IJL A;  1Z9C A;  2DI3 A;  3K1N A;  1U5T C;  3V8K A;  4Y15 A;  1O7F A;  3JW4 A;  2E7X A;  2RQP A;  4HV5 A;  2K4B A;  2COM A;  3SHF A;  1FC3 A;  4L0Y B;  1R5H A;  2P5V A;  1KGS A;  2J5P A;  1SMY F;  5FFZ A;  3M8F A;  2RNJ A;  1P6R A;  3LA7 A;  4PDK A;  3K69 A;  3JAM Z;  3D0S A;  2DFI A;  5L3D A;  2VE9 A;  3BJ6 A;  4ESB A;  2P7C B;  1IAW A;  1K7A A;  1CGP A;  1REP C;  1LDK B;  3PQJ A;  5LHG A;  1H0M A;  3E5Q A;  5ICC A;  1G3T A;  4EJV A;  2FF4 A;  1RZ4 A;  1TQM A;  4BHP A;  2A5Y B;  3E5U A;  3GFJ A;  2MA3 A;  1YW7 A;  2W85 A;  1O7L A;  2NNN A;  2XV4 S;  4HX8 A;  5AON A;  3P9K A;  3KET A;  5HLI A;  2QZ8 A;  2FSW A;  1AOY A;  1KYW A;  3HOS A;  2DO7 A;  4MQ9 F;  2HFH A;  4EGZ A;  3MQ0 A;  3N4M A;  3LAP A;  1Y0U A;  2PLY A;  3C18 A;  3HRM A;  2UXN A;  2GIV A;  3ZQ7 A;  5JFR A;  3QPT A;  5FLX K;  4NB5 A;  1WKM A;  2V79 A;  1HW5 A;  4I02 A;  2FMY A;  1OYY A;  3HIF A;  1AWC A;  5LEJ A;  1XGN A;  4M74 A;  2P6T A;  5E1Z B;  1R5G A;  3WTY C;  3DQV C;  4GGG A;  5LLQ A;  5JHU A;  5HLG A;  3BDD A;  1O57 A;  2NRA C;  1QZY A;  4F7Z A;  3CTA A;  1X3U A;  2XKP A;  2DK8 A;  3HYI A;  3WGG A;  4GYI A;  5HOO A;  1LB2 A;  2HGC A;  3TDZ C;  5ILS A;  3WOD F;  2A3S A;  1G3W A;  1FOK A;  1WQ2 A;  3IC7 A;  2VC1 A;  1U6G A;  3HRU A;  4IHT A;  2PFB A;  2YX7 A;  2JT1 A;  4UV8 A;  2MC3 A;  5J8C A;  1D5V A;  3ULQ B;  1HBX G;  5CVU A;  2VOD A;  5FLX Z;  1TW3 A;  2ZME A;  4U7B A;  2HOE A;  2HYG D;  2A6E F;  4RAY A;  2L4A A;  2NNY A;  1FP2 A;  5CVR A;  2IVM A;  4ENM A;  2R3S A;  3GFI A;  4N9H A;  4TV7 A;  3CDH A;  1YYV A;  1TNT A;  4EJW A;  2OD5 A;  1KA8 A;  4I01 A;  1FPQ A;  4LMY A;  1O3Q A;  1U3E M;  1I5Z A;  3DFG A;  1YS7 A;  1Z6R A;  3GEZ A;  3SQN A;  1R1V A;  4G8X A;  2O03 A;  3U2R A;  1P4X A;  3H3U A;  1R36 A;  3TGN A;  2Z33 A;  2M1B A;  4Q4Z F;  3FHZ A;  3T8T A;  4ZYD A;  4A0Y A;  4HQE A;  2F5F A;  2OA4 A;  3M7G A;  3V7S A;  5CLS A;  2BEO A;  2OZU A;  3ZN1 A;  3EYI A;  4AIJ A;  3F8C A;  2GA2 A;  2EWN A;  1FBQ A;  2D1H A;  3KLO A;  1T38 A;  4RB3 C;  1R58 A;  2O3F A;  2XAH A;  4OIN F;  1XD7 A;  4MTD A;  2DAO A;  1F5T A;  1W5T A;  3C7J A;  1UB9 A;  1BI0 A;  1LDD A;  3F23 A;  2BE5 F;  3WTZ A;  4EM1 A;  2MLG A;  1MJ9 A;  4UXN A;  4K2E A;  2HEO A;  4AD9 A;  2HKX A;  1YG2 A;  1XN7 A;  1BI1 A;  1GHC A;  3FXU A;  2FRH A;  4I7H A;  3KZZ A;  3EET A;  3U1D A;  1IXR C;  1KYZ A;  4ENK A;  2ZJ2 A;  2J5O A;  3JSP A;  3WG9 A;  4LK0 F;  4KMF A;  3NQO A;  3HHH A;  1K79 A;  3V7C A;  1T39 A;  4KYW A;  3R61 A;  5EEG A;  3O2P E;  5CJ9 A;  3T5X A;  4JBA A;  2VOO A;  4G94 A;  4QLC U;  1YTY A;  3GWZ A;  1XSV A;  3DP7 A;  4RB2 C;  1OMI A;  5H6Q A;  1FSE A;  2QQB A;  5TRD A;  3VEP A;  4IVN A;  2FNA A;  5A2Q Z;  2YSR A;  4HA8 A;  2KIU A;  4MGR A;  1GXP A;  1DDN A;  4Z2Y A;  5K5R A;  4Q48 A;  2H09 A;  1YW8 A;  4UVA A;  1J75 A;  4FX4 A;  3DKW A;  4P9U A;  3L2C A;  4M9S A;  2DU9 A;  5BMZ A;  1MJA A;  2P7V B;  3MZY A;  1SFU A;  2HZT A;  2XGX A;  3WE3 A;  1BC8 C;  1XGO A;  3FZV A;  3IWF A;  2JPB A;  2PEX A;  3RYR A;  1S7O A;  1PP7 U;  1OYI A;  5CVI A;  2Z9O A;  4IRH A;  5HS8 A;  1ZGA A;  5H6R A;  2L4M A;  4ENN A;  1F4K A;  3M1E A;  4WK8 F;  1LEB A;  6PAX A;  5D8L B;  2JPC A;  1MJB A;  2QYO A;  3TDU C;  4IRG A;  5CVV A;  1BBY A;  3KP7 A;  5JVT A;  3TO7 A;  1SMT A;  2KRF A;  4EMS A;  3W6J B;  2XVC A;  2ESN A;  1WWX A;  5K5Q A;  3FM3 A;  2G7H A;  3WE2 A;  4ZZD A;  1R1T A;  2H6B A;  1U5T B;  5F6F A;  2HKO A;  5L3B A;  2G7U A;  4A0Z A;  1ZAO A;  4EV0 A;  1RI7 A;  3BP8 A;  4HLY A;  1YW9 A;  3E5X A;  1T98 A;  4AIK A;  2NAZ A;  1FP1 D;  4L9V A;  3R4K A;  1V3F A;  5HDN A;  2XUB A;  3TOA A;  4U0V A;  2JZY A;  1W5S A;  5BQT A;  2W24 A;  2XAF A;  4UVC A;  1LQ1 A;  5HVQ C;  3TOB A;  2IP2 A;  2K27 A;  1I1S A;  5D6E A;  3RIR A;  5IT3 A;  1R22 A;  2F2E A;  4ZYG A;  4ZZL A;  2FBH A;  4HBL A;  1S6L A;  2ACJ A;  2UXX A;  5L3E A;  1HST A;  2LF8 A;  5EEH A;  4A5N A;  4L5I A;  4ETS A;  3LAJ A;  4UV9 A;  3VOE A;  1UST A;  4KNY A;  3T1B A;  3SXY A;  3QOP A;  4RB1 A;  3QPH A;  3W6K B;  3REO A;  2BYV E;  4CYD A;  2QEN A;  2Y75 A;  3E6M A;  3KZY A;  1CF7 B;  4I0A A;  3EUH A;  3I58 A;  4MEY F;  4KUM A;  4LLG F;  2VT2 A;  5ILV A;  3K0L A;  4YFX F;  3WU0 A;  1RUN A;  1KQ9 A;  1QQI A;  1EH8 A;  2XAS A;  1Z1D A;  4G7Z F;  4ESF A;  2A69 F;  3R6S A;  3T8R A;  2L02 A;  1U2W A;  2KJB A;  5LGT A;  4BQA A;  3ECO A;  2Z99 A;  1E17 A;  3KFW X;  1FSH A;  3HSR A;  1IF1 A;  1W7P A;  4FX0 A;  3LQR A;  1SD6 A;  2R7F A;  3F21 A;  1BM9 A;  1IN6 A;  2QUF A;  4P9F A;  5LHH A;  1L3L A;  4RGX A;  5HS9 A;  1Q1H A;  3FX3 A;  3QU3 A;  1YS6 A;  3TKY A;  2RGV A;  1ZGJ A;  1HSJ A;  4JK1 X;  1ZG1 A;  2H27 A;  3I4P A;  2O61 A;  1U78 A;  1S7A A;  2KIM A;  3E6B A;  4MNU A;  4P5O A;  5DV5 A;  1XMA A;  3L09 A;  4ZH4 F;  3K1M A;  1HKQ A;  5DDG A;  3I0T A;  1J7K A;  4EJO A;  4KN7 X;  2P8T A;  4KA4 A;  5E18 F;  4L0Z B;  1GVJ A;  3K9T A;  2OU2 A;  2CO5 A;  3WTW C;  4PZJ A;  2PBI A;  2PMH A;  4WCG A;  4RGR A;  2EFQ A;  2IRF G;  4L9J A;  1PUE E;  2STT A;  4R8H A;  3GW2 A;  2L01 A;  2Q2E A;  4XSX F;  1XDS A;  2OQR A;  5L3G A;  3O3K A;  2ZXJ A;  4HW0 A;  4HF2 A;  2RN7 A;  2LSO A;  1P2F A;  3Q9S A;  3RDI A;  4FHT A;  3WTX C;  2EFP A;  4A6D A;  1G3S A;  4KIG A;  1B9M A;  1MZB A;  1JXS A;  1BN5 A;  2HYF A;  2GZW A;  4HZF A;  4MHG A;  1QPM A;  2R7D A;  2ZNZ A;  4IPA A;  1D8J A;  2C6Y A;  2M45 A;  4ZYE A;  5D4R A;  1TW2 A;  2L54 A;  5DCM B;  1OR7 A;  1W7P D;  2IW5 A;  4QWQ A;  3RI4 A;  2Y0M A;  5J8F A;  3H92 A;  4U0W A;  1IRG A;  2VT3 A;  2HWV A;  3ELK A;  3LA3 A;  1GXQ A;  4D0P A;  1KU3 A;  5F1R A;  2BV6 A;  2E7W A;  1R23 A;  2EJR A;  1HW2 A;  4R79 A;  2WWY A;  1J5Y A;  4PCQ A;  1G4D A;  4IHS A;  3H3Z A;  3ABT A;  2DPD A;  2X4H A;  2P5L C;  3GUD A;  2HTJ A;  4R1H A;  3BJA A;  4IJA A;  4ON0 A;  4XLN F;  4M6Y A;  3HRT A;  3ISP A;  5E17 F;  1WRJ A;  2DK5 A;  3KE2 A;  4LGW A;  3CJN A;  2VN2 A;  4UUV A;  2A61 A;  3TQN A;  1V4R A;  3E97 A;  4GO1 A;  1PP8 F;  5FFX A;  2P4W A;  2ADU A;  1O3T A;  4CHU A;  2VBY A;  4AIH A;  4P55 A;  2KIF A;  3GFL A;  2DPU A;  1TTY A;  1T0F A;  2B0L A;  5D5V B;  2V1X A;  2UZK A;  3M9A A;  1SFE A;  3HTU A;  1FNN A;  2K02 A;  2Q0O A;  2W84 A;  1E2X A;  1XGS A;  2EFN A;  4M9Z A;  2FBK A;  1QNT A;  3J80 K;  3LA2 A;  3C3W A;  1JE8 A;  1IXS B;  3N97 A;  5JR3 A;  1IN7 A;  1UCR A;  4L18 B;  1Z7U A;  2OQG A;  1ULY A;  3CO6 C;  5LRR A;  3IWZ A;  2BBY A;  2PI0 A;  4MQV A;  4M71 A;  3JAM K;  4LFU A;  1EH7 A;  1WSU A;  3EYY A;  4EVI A;  4CO8 A;  4N9I A;  1SFX A;  2EV6 A;  3NEU A;  3F8N A;  2DW4 A;  2F5E A;  3S2W A;  2BGC A;  2IA2 A;  2CG4 A;  4EM0 B;  5DD4 A;  2K7L A;  5HS7 A;  2H94 A;  1T2K A;  4RGS A;  2XAG A;  2GXB A;  3RPU A;  3BWG A;  3LST A;  1SD4 A;  4HOB A;  3VOD A;  3ROU A;  4M72 A;  1MGT A;  5BPD A;  1J0R A;  1OPC A;  3AAF A;  1P92 A;  5AIP A;  3I54 A;  3ZMS A;  2VBZ A;  4WXH A;  1YO5 C;  1YLF A;  4GXO A;  4EGY A;  2KJC A;  1UFM A;  4Y13 A;  1QZZ A;  3B02 A;  1QO0 D;  5HDG A;  5D5W B;  3OV8 A;  4G7O F;  2A07 F;  3C1D A;  2UWM A;  1NHA A;  3B73 A;  5LBQ A;  5L3F A;  2O8X A;  1UHM A;  1C0W A;  3MFK A;  2DQR A;  4IRI A;  3RYP A;  2E1C A;  3CO7 C;  2VC0 A;  2VOP A;  1FLI A;  2V6C A;  1XGM A;  3WTS C;  5JI6 A;  2EB7 A;  4IXA A;  2XIG A;  3ZMV A;  3SZT A;  4CGZ A;  3EQL F;  4DQ2 A;  5E1W A;  1H9G A;  4XBF A;  1Z05 A;  3DPT A;  5ICG A;  3VB2 A;  3LQQ A;  1O3R A;  2V1U A;  4LLN A;  3WTT C;  5K1Y A;  1Z6T A;  2ZO4 A;  3HSE A;  1I27 A;  2QQ9 A;  4Q5S F;  3FXR A;  3GXO A;  2DTR A;  2WTE A;  1W7P B;  1H9T A;  4MEX F; 
#chains in the Genus database with same CATH topology
 2DYR H;  2E1N A;  3BJO A;  5JLW A;  2ZXH A;  2QBY A;  1R1U A;  1ONV A;  4XID A;  1OCZ H;  2O6G E;  4O3M A;  3KCC A;  3F72 A;  5FD6 A;  1GV2 A;  4B3A A;  3D5S C;  1FIP A;  2QGU A;  2XAQ A;  3CES A;  4XLF A;  1QGP A;  2EA4 A;  3HSF A;  5K5O A;  2JRT A;  2BY0 A;  3HOY J;  3MD2 A;  4DNC A;  1U8R A;  4PJL A;  3Q5F A;  3PQK A;  2FXA A;  5FRM A;  2R5Y B;  2ZFU A;  4HG2 A;  4HNU A;  3MCZ A;  4CDG A;  3E1S A;  3IH4 A;  2WV0 A;  3S15 J;  3IAS 2;  2JQ7 A;  5M3M J;  5EZG A;  1I1G A;  4IO9 F;  2EV0 A;  3X2Q H;  4OIR F;  1TQP A;  3DPU A;  3CJT B;  2K4J A;  3TO6 A;  3FMR A;  1IXC A;  2YR2 A;  2DA1 A;  3ZQC A;  2VKV A;  4BNC A;  4ASN A;  1B8I B;  4A69 C;  4B09 A;  2K3P A;  3KYL A;  3F8F A;  3WGI A;  1IO2 A;  3IKV A;  3PNT A;  2ZME C;  5EJC A;  1FYK A;  1O3S A;  1CF7 A;  2CFX A;  1EF4 A;  2A68 F;  2LKP A;  3LSG A;  3DPL C;  2E2H J;  2DLL A;  1MH3 A;  4M3B A;  3NAR A;  2CRG A;  2YU9 J;  1UHW A;  4XSZ F;  1K78 B;  3GF2 A;  3AFH A;  4KDP A;  3GTP J;  4A3J J;  4A0X A;  5EEA A;  3BY6 A;  4NQW B;  3FKI J;  2ID3 A;  2X1C A;  3RKX A;  4BEH B;  2ECC A;  3BZ6 A;  1ZLJ A;  3PM1 A;  2XRO A;  5TGT A;  3OYI A;  4Y3O A;  4EJT A;  1TWC J;  3DLA A;  1G8X A;  1XSX A;  5CVJ A;  2CQK A;  1EV7 A;  1J2X A;  4OU0 A;  2XGD A;  4LB5 A;  1YIO A;  5D8K B;  2QWW A;  3GLX A;  1RC9 A;  2JSC A;  4AID A;  3SZP A;  2VXD A;  3O6B B;  2DBB A;  2FJ1 A;  2O7O A;  1SVO A;  4XL9 A;  2L7K A;  4FIS A;  3JRD A;  4ZYH A;  2H8R A;  1K83 J;  1FWZ A;  1TZL A;  3KP6 A;  3E3V A;  4XKW A;  4XRS G;  3FMS A;  2ELH A;  3WTU C;  3JRE A;  1RRJ A;  1ZRD A;  2E1M B;  4BL0 B;  1ZH5 A;  1BIB A;  1MKM A;  3HGY A;  1ZN2 A;  2DCE A;  3CDL A;  4XKB A;  2D2W A;  3TP3 A;  2BY1 A;  1R7J A;  2BZT A;  4CCN A;  5GTI C;  1W7P B;  4MTE A;  2PJP A;  2IPQ X;  5FKM A;  3WTV C;  2HDC A;  2XF7 A;  5FKN A;  4BE0 A;  4AWX B;  1N25 A;  2HU9 A;  3FM5 A;  3MKY B;  2B7E A;  2L7Z A;  1U8B A;  3PIP F;  1OIS A;  2NS0 A;  2DDB A;  2GA1 A;  3LSI A;  1XCV A;  1D3Y A;  2R7V A;  2F6C A;  1L0O C;  3OOU A;  2LY2 A;  3BTL A;  1H88 C;  1U9N A;  2K40 A;  3F6V A;  4YG2 F;  4CZC A;  1MW7 A;  3OYB A;  4F92 B;  4L5J A;  2KIS A;  4KIS A;  2DQL A;  4XLP F;  2L3D A;  3IKT A;  1TNS A;  4EJU A;  5IT9 K;  3J7Z I;  2ZJQ F;  2EV5 A;  3Q9V A;  2XGC A;  3IRQ A;  2JUG A;  5DCM A;  2Q8K A;  3COA C;  1OLT A;  2D1V A;  2HVS A;  3KYC B;  3ZMU A;  5HNH A;  2KQR A;  4XKV A;  5J6X A;  4F93 B;  2VE8 A;  3I59 B;  1P9Q C;  3WGH A;  2O8K A;  3L2U A;  2M87 A;  2EFW A;  2QQA A;  1POG A;  2X1E A;  5L3C A;  1LE8 B;  1TWA J;  3G3Z A;  2FQ3 A;  4E70 A;  2JVH A;  3FF5 A;  1B8I A;  3NWS A;  3OYD A;  3CJQ B;  3K1P A;  2FU4 A;  3ZR8 X;  2VJ5 A;  3SZG A;  1BR2 A;  2F4I A;  2YX4 A;  3CUQ B;  2F5D A;  3DXJ F;  3GTL J;  2MD0 A;  4LD5 A;  2R5Y A;  1V54 H;  2A6H F;  3W2V A;  3ML6 A;  4FE4 A;  3OYN A;  2FBI A;  1JTY A;  2NYX A;  3ONQ A;  9ANT A;  3ZP5 A;  4QIW N;  1I39 A;  2V7F A;  5J40 A;  1IRX A;  5LD2 C;  2VAS A;  4GDF A;  3PO2 J;  2I8D A;  5FRN A;  3V7R A;  2CUZ A;  1DP3 A;  1EA3 A;  2TDX A;  2BY3 A;  4XQF A;  1HXD A;  4LJZ F;  2EIN H;  1TWF J;  1S3J A;  2COB A;  3L7W A;  1UG0 A;  4IQJ A;  1I3Q J;  3KP3 A;  1LJ9 A;  1OKR A;  3F6O A;  3K2Z A;  1H8A C;  1ZRC A;  3ECH A;  3K10 A;  3MZH A;  2E5N A;  3OR1 C;  2ZNY A;  4PSW A;  5BS6 A;  1ETX A;  5BOX A;  5C3E J;  5HLH A;  4OIQ F;  4UVB A;  1FYM A;  1JHH A;  5DYM A;  3HL2 A;  4WWC A;  1E3H A;  1ON1 A;  1WJ5 A;  1RR7 A;  2H6C A;  3G1L A;  2IS4 A;  2W4S A;  3DEU A;  4XLA A;  3FBN B;  1AKH B;  5FLM J;  4JQF A;  5J47 A;  1HCR A;  2WB1 A;  2KPM A;  2V1D A;  3FMQ A;  1XG1 A;  3H1C A;  5E8G A;  1KQ8 A;  2OZ6 A;  3DF8 A;  4M6X A;  4HX4 A;  3ERE D;  2DN0 A;  3OYL A;  3MKW B;  1IV8 A;  2FE3 A;  1BC7 C;  2QM3 A;  4U0Y A;  2PMU A;  4PGH A;  5DS9 A;  1QBJ A;  2FEZ A;  3H5A A;  3KPH A;  5ERI A;  3JTH A;  3PSI A;  3HXL A;  4LIV A;  2MAB A;  4ITV A;  2Y48 A;  3RZD J;  2ZBK A;  2OV7 A;  1XDU A;  4BKX A;  4A3D J;  4BH9 A;  2HOT A;  2QQ8 A;  2E36 A;  5D5X B;  5FKL A;  3CLO A;  2HVR A;  2JTV A;  1BI2 A;  3OY9 A;  4B1R A;  1X19 A;  4PFO A;  5LRS A;  1JKO C;  3KP4 A;  3QP5 A;  1IN8 A;  5HDK A;  4FT8 A;  3P9I A;  2CSO A;  3L00 A;  4G7H F;  3ZXS A;  1MNM C;  4II2 A;  1QZE A;  1STZ A;  3VFZ A;  3SJM A;  2RV8 A;  1OYW A;  5DD8 A;  4A93 J;  1OCC H;  2ISZ A;  2X0L A;  2X85 A;  1T6S A;  4ANJ A;  1PVE A;  4CSW A;  2XF5 A;  2Y69 H;  3I64 A;  4M9X A;  3MZ8 A;  3VDX A;  1VQ8 I;  2W7N A;  3IUO A;  3PL8 A;  3QOE A;  2Z5U A;  4CIC A;  2GM4 A;  5D4S A;  1USS A;  1EH6 A;  3CUO A;  5CYV A;  3Q0W A;  1S29 A;  1TLH B;  3HRS A;  2CS3 A;  4NNJ A;  3S14 J;  5ED4 A;  4BHC A;  3GVA A;  1EKE A;  3DBH B;  3HC7 A;  3ZMT A;  1SD7 A;  1B72 B;  2FNP A;  4Y52 J;  3H35 A;  3CC7 I;  4YEL A;  4C9Y A;  3JRG A;  3A1Y A;  3L1P A;  1MIJ A;  2LY1 A;  2VJ4 A;  1VQP I;  2LKX A;  2ZXI A;  3BRO A;  1DPR A;  4ZYA A;  3L9F A;  3G73 A;  4Y17 A;  5JHF A;  3F8B A;  4YIF A;  4AVP A;  4QSH A;  1K61 A;  3GME A;  4CCK A;  3J81 Z;  3CCL I;  1KU2 A;  5C4J J;  3CCJ I;  2VQH A;  1Z91 A;  3KP2 A;  2GOM A;  3J7Y J;  2IGN A;  2EBI A;  3I59 A;  4PFP A;  4OIO F;  1ZG3 A;  1O4X A;  4CXF A;  2FML A;  1B6A A;  1LPQ A;  3CCE I;  3K4L A;  3FWE A;  2RDP A;  5LGN A;  1ETK A;  5EF6 A;  2A5W A;  1JGS A;  4UUS B;  2JA7 J;  4I09 A;  1ON2 A;  2AQF A;  3QRF F;  3OYK A;  4RAF A;  3QYB A;  3VPR A;  3D5L A;  2W25 A;  4LK1 F;  2L5Q A;  2O0Y A;  5GPA A;  2E2J J;  2STW A;  1DQU A;  1YIJ I;  1IZ1 A;  5M5Y J;  1ACI A;  3HPH A;  2PN6 A;  2HQN A;  1T56 A;  3ZGK A;  3CC2 I;  1KQ0 A;  2ELJ A;  3GCM A;  2VPL A;  3DLL F;  1XB4 A;  3G6E I;  3RTR A;  2RC4 A;  2KKO A;  2R92 J;  4OIP F;  2VI6 A;  3V8L A;  3CMY A;  3LWF A;  3Q0U A;  4BQN A;  3LSH A;  2Y31 A;  3BCB A;  3RKW A;  2LR8 A;  1UG2 A;  3R60 A;  2P5K A;  2L9N A;  2MFZ A;  3W2W A;  1B9N A;  2DDA A;  4XIC A;  2HDD A;  2IS6 A;  3OOP A;  4RA2 A;  3LSM A;  2VXZ A;  3U9G A;  2AO9 A;  4HX7 A;  4UNO A;  2YPR A;  4O5V A;  5FKK A;  3E6D A;  3ZN0 A;  1ZG5 A;  4U7D A;  1FY7 A;  5EGO A;  1ZRF A;  1UAA A;  3A03 A;  4KN4 X;  1RUO A;  2JN6 A;  1FMV A;  3IH3 A;  3F8M A;  3RPQ A;  1R00 A;  1S8N A;  2MD5 A;  1BI3 A;  2LKS A;  3QAH A;  1FZP B;  4Y7N J;  2K3F A;  4I98 B;  1YJW I;  1MBH A;  2NVQ J;  1VQ6 I;  2PQ8 A;  1HDD C;  2ETH A;  5LHI A;  1FYL A;  4AYB N;  4U88 A;  1MDM B;  3ZMZ A;  4Q47 A;  1FEX A;  5DEQ A;  2M8E A;  3DTI A;  4PJM A;  3ZMD A;  3H9J A;  2JRM A;  3CCY A;  3D5R C;  1B72 A;  2OCC H;  1ZK8 A;  2GAU A;  3BOQ A;  5B5E C;  2CFO A;  5CQG A;  2DA2 A;  2RQQ A;  4NQW A;  3I71 A;  3DV8 A;  3MN2 A;  4DW6 A;  2IA0 A;  2E1O A;  4A2U A;  4KIB A;  4XNF A;  4RB0 A;  3FXM A;  4HNT A;  1UJ8 A;  1GDT A;  5IOZ A;  3FXQ A;  3MAJ A;  2M9H A;  5TIS C;  4EM2 A;  4D1Q A;  3HKZ A;  3BG7 A;  2NVY J;  2CQ7 A;  2M34 A;  3OL4 A;  1Z7L A;  2HYJ A;  2L7F P;  1U5T A;  3GX4 X;  2IS2 A;  4BYY A;  2DMN A;  1IW7 F;  1VTN C;  4A12 A;  3V8J A;  1W5C C;  4NBQ A;  1SAX A;  1UZC A;  4G9Y A;  4PJJ A;  4BUP A;  3J7A O;  4BXX J;  3RJP A;  2HQA A;  1QRY A;  1E3P A;  2QLZ A;  1GUU A;  2DT5 A;  4HF0 A;  4IHW A;  4L9T A;  4OMZ A;  1G6N A;  4ZDL A;  3J81 K;  2AS5 F;  3P9C A;  1BW6 A;  3CCR I;  4AC0 A;  1XCB A;  1MBG A;  1YQA A;  5E8I A;  5K7H A;  5D5U B;  2ISY A;  2Z16 A;  2QSH X;  4M73 A;  5DUK A;  2ME6 A;  4LIT A;  2XKO A;  3RKY A;  3S93 A;  1G3Y A;  4G6Q A;  5HOD A;  2UUZ A;  3PFI A;  1ZR2 A;  3VYU B;  4A5M A;  1Y8Q B;  3ABU A;  3DWL E;  3KEQ A;  3FIS A;  4UHT A;  2K86 A;  2FA5 A;  5E1X A;  3KIO A;  4V2F A;  3JRA A;  3TO9 A;  2AXT C;  4WXC A;  1RNL A;  2GQQ A;  1WI9 A;  2G9W A;  1J09 A;  1I6X A;  1VF9 A;  2NXN B;  4B48 A;  5K7F A;  1WI3 A;  1IV6 A;  1AKH A;  2KRC A;  1U0J A;  2LDU A;  3DKY A;  3GTO J;  3IHU A;  1KU9 A;  2Z3Y A;  3VSL A;  4RGU A;  5BNG A;  2LNB A;  4D7M A;  4DGW B;  1SC7 A;  3S32 A;  3JTG A;  2HR3 A;  4CCM A;  4XRF A;  3P7N A;  3CMA I;  2GOX B;  4B8X A;  4HV6 A;  3OYM A;  2PJR A;  3KEO A;  1BOA A;  4V2G A;  2XRN A;  3HUG A;  2HQR A;  3HOT A;  1V5G A;  3R0J A;  5IYB J;  1R71 A;  1S7E A;  4ENJ A;  1BL0 A;  5E20 A;  2JMW A;  2P6S A;  2PMZ A;  3H5R A;  3RZO J;  4HAM A;  4NHJ A;  2PG4 A;  3LNQ A;  1RIO H;  2EH3 A;  4WXD A;  1XMK A;  1D8K A;  1YRN A;  3LSJ A;  2AXL A;  2YS9 A;  4XM3 A;  1KU7 A;  4ZDP A;  4D5C A;  3HHG A;  1YFH A;  1ZHF A;  2DTZ A;  2EIM H;  3BPV A;  2X6X A;  1HW1 A;  3RSN A;  3A01 B;  1X1C A;  3C2B A;  4CZZ A;  2M2E A;  1LEA A;  3G71 I;  2MH9 A;  3HGG A;  2HPI A;  3JRC A;  1XSD A;  2TCT A;  2X6Y A;  2EFO A;  2YU3 A;  3CUQ A;  1VZ0 A;  1XMX A;  2MH2 A;  1HOM A;  1P4W A;  1B4A A;  1FT9 A;  2DFF A;  3IP4 B;  5DTD A;  4XRM A;  4MFE A;  4W1U A;  1OR7 C;  5K7Z A;  2GLO A;  1Y39 A;  3V4G A;  4S04 A;  4XON A;  2X6W A;  4L9N A;  5DCF A;  1DP7 P;  2H1L A;  3IH2 A;  3CCS I;  2IT0 A;  1V5F A;  3ZQQ A;  2IBD A;  5FGM A;  2OF7 A;  3T0Y A;  3KYD B;  4A3B J;  5IT9 Z;  2HTS A;  2HOS A;  4RAZ A;  1DPU A;  3SEZ A;  5FO5 A;  3EUA A;  4I0B A;  3EDP A;  3I3L A;  2VKD A;  2OUM A;  2MLK A;  1IN5 A;  2F5V A;  2CV0 A;  2F4M B;  2IA1 A;  2RNG A;  1BJA A;  2LC2 A;  4GCV A;  5DUI A;  4P1W A;  4HDU A;  1KON A;  2M30 A;  4X6A J;  2CGP A;  1SFO J;  1ODD A;  4NDL A;  3BR1 A;  2D5V A;  4G6D A;  2HI3 A;  2EIL H;  3M8E A;  3LSR A;  1K6O A;  4E7K A;  4LB6 B;  5C4X J;  3LFK A;  3MVP A;  2F5C A;  2CW0 F;  2EQR A;  4HDV A;  1SVM A;  5TJJ A;  4O6J A;  1Y0N A;  4M3E A;  2XHK A;  1HKT A;  2OAZ A;  4HQM A;  3UNG C;  3W6V A;  4C3I J;  3BQY A;  2V6E A;  1SD5 A;  4BAC A;  1ZTR A;  3ZPL A;  4C2U A;  2WC2 A;  1ETO A;  3H9G A;  1FBU A;  2F4O B;  2LP0 A;  1TWG J;  1Z21 A;  2RVC A;  4IF4 A;  4YIR X;  1A04 A;  1YHQ I;  4LG0 A;  1XPX A;  1WCM J;  5LEK A;  5ICE A;  2VLA A;  4OMY A;  4DOZ A;  3BR0 A;  1QVT A;  4KMU X;  3H3V K;  3WU1 B;  1IRF A;  4E7Z A;  3BC8 A;  4OAY A;  3MEX A;  2D45 A;  4XLC A;  5CQE A;  4BHB A;  3E0J B;  1Y1V J;  1Y1W J;  4I2O A;  4A3C J;  2XC7 A;  4LG0 B;  2VBX A;  5EYR A;  3A0B C;  2VON A;  5ILU A;  1VFC A;  1TL8 A;  1K78 A;  4HF1 A;  2CUE A;  2H1K A;  2OBP A;  2DA4 A;  1TQI A;  3U21 A;  3GYH X;  3S1M J;  4F91 B;  3GO5 A;  5H20 A;  1B1B A;  5FKO A;  1HQC A;  2W00 A;  1W4M A;  1X4O A;  2EA2 A;  2JWT A;  3AL0 C;  5D6F A;  1RPW A;  3BT9 A;  4UY8 I;  4MLO A;  1MD0 A;  3MMY B;  1ZLK A;  3IRR A;  3ERM A;  4L5E A;  2GXG A;  3TW6 A;  2JJ7 A;  2X51 A;  1F1Z A;  3CUQ C;  3KLN A;  2WAD A;  2NS8 A;  2H8W A;  4KIF A;  3SFZ A;  2HQ5 A;  1G2H A;  4CYC B;  4A3M J;  4BXU A;  3FIW A;  5KVR A;  2W57 A;  3BPX A;  4DYQ A;  2BHY A;  4KT5 C;  3BG3 A;  2CWE A;  3F3X A;  2CQQ A;  2ZKZ A;  3QOD A;  4LLL A;  3MWM A;  1ZYR F;  5KHD A;  2R0Q C;  2ESH A;  4WF2 A;  4H0E A;  1NG7 A;  1Q1V A;  2XAJ A;  5AIQ A;  3KP5 A;  5FB2 A;  1ETV A;  3I9V 2;  3I4M J;  2XPU A;  3HG9 A;  3GFM A;  5FLV A;  2R7Q A;  2CMP A;  5EZH A;  3VYS B;  1BIA A;  1MBK A;  2IEK A;  3S16 J;  1HKS A;  1X1B A;  2QVO A;  3I5U A;  4RS8 A;  5LGU A;  4S05 A;  4KFC A;  3HB9 A;  3F22 A;  1UHS A;  4N0B A;  4BAY A;  5B1A H;  1F9N A;  2IGO A;  2LFB A;  2DT6 A;  1LNW A;  3IAM 2;  3K4B A;  4IX7 A;  1QHG A;  1IN4 A;  2VJI A;  2V9K A;  2RKH A;  3K70 D;  5J1Y A;  2HNH A;  1IGN A;  3DTK A;  3RQI A;  2GWR A;  1FX7 A;  4ZJZ A;  1PDN C;  3L2W A;  1JHF A;  4J00 A;  1N77 A;  3E6C C;  5J1U A;  3GTK J;  2LF7 A;  1XS9 A;  1JTX A;  2KMU A;  2WAE A;  2DA3 A;  5DM7 F;  3NRV A;  3F0C A;  2FOK A;  3ABK H;  4IKF A;  4C3J J;  4YFK F;  1IUY A;  4HLX A;  1T08 B;  2Y2Z A;  1MDM A;  4DIQ A;  2JA8 J;  2DA6 A;  2CYY A;  4NUB A;  2CQN A;  3P5J A;  4B44 A;  1B59 A;  1D1C A;  1WPK A;  5F64 A;  1J59 A;  1VQK I;  3TL4 X;  4FAS D;  3IL2 A;  1W0T A;  2HS5 A;  4BQO A;  3S1Q J;  3OR2 C;  4GYG A;  2BY2 A;  2M5W A;  5IP7 J;  1X4P A;  1ZKG A;  4CYC A;  1LVA A;  3JSO A;  4FQG A;  2R7W A;  2MBF A;  3I53 A;  4A6E A;  3OYG A;  5BPI A;  4HYE A;  3L2R A;  1J9I A;  2LH9 A;  3RKQ A;  3GZ6 A;  4I6Z A;  2EK5 A;  3SFI A;  3DBL B;  4PGG A;  1BJZ A;  1HC8 A;  3QP6 A;  4WX9 A;  2IGM A;  2EPF A;  1LFP A;  2QBY B;  3R0A A;  1A31 A;  4ESJ A;  1Y56 A;  2OCE A;  1LDJ A;  1UEL B;  4XRS A;  3L2V A;  1ZRE A;  3ZQF A;  3HTS B;  4YII A;  2R7R A;  4HST A;  1MMS A;  1P4A A;  1WVR A;  5KK1 A;  2FUG 2;  1ZAR A;  3W2A A;  3GZ5 A;  1HLV A;  5FD5 A;  1TBX A;  1DUX C;  2ZME B;  3HKZ N;  3HJE A;  2KIQ A;  5ICF A;  5IPA A;  3DTE A;  3S3M A;  4BBS J;  3F9K A;  2LTP A;  2JUC A;  4KIC A;  3W3C A;  4EQQ A;  2ZCW A;  3LSP A;  1ETY A;  3CF5 F;  1WH5 A;  1GLN A;  4PJN A;  4YFN F;  2MYS A;  1WJA A;  1FBS A;  1ERD A;  2LVS A;  4JP0 A;  2ZFW A;  4OOI A;  4CUG A;  5A2Q K;  2VBW A;  1F36 A;  1T33 A;  3J80 Z;  1X3Z B;  3QU6 A;  2R5Z B;  3PO3 J;  2V9V A;  3C2G A;  4E7H A;  1LFB A;  4P96 A;  2IJL A;  1Z9C A;  3GTG J;  2DI3 A;  2ZSH B;  3K1N A;  1U5T C;  3V8K A;  4Y15 A;  1O7F A;  5IP9 J;  3JW4 A;  1ENH A;  2XSD C;  2E7X A;  2RQP A;  4AM3 A;  4HV5 A;  2K4B A;  1VQO I;  2ZB9 A;  3FXL A;  2COM A;  3CCV I;  3SHF A;  1FC3 A;  2R7Z J;  1SAU A;  4D7N A;  1K6Y A;  2XB5 A;  1YIT I;  2LLK A;  4L0Y B;  1R5H A;  3TP0 A;  4BJ5 C;  2P5V A;  1R5I D;  1KGS A;  2BW3 A;  3H0G J;  2J5P A;  5IOY A;  1SMY F;  4JOM A;  3BCA A;  5FFZ A;  3M8F A;  2RNJ A;  1P6R A;  3LA7 A;  2HPM A;  5E3M A;  4BE1 A;  4PDK A;  2KHM A;  2DMP A;  3K69 A;  3NAU A;  3JAM Z;  2M0M A;  3SDB A;  3D0S A;  2DFI A;  5L3D A;  2VE9 A;  1DU6 A;  3BJ6 A;  4ESB A;  4F3Q A;  2P7C B;  1IAW A;  3HEF A;  1K7A A;  1D5Y A;  5B3S H;  1CGP A;  2Y9Z A;  1REP C;  2CV2 A;  1LDK B;  4IHV A;  3PQJ A;  5LHG A;  1H0M A;  3WU2 C;  4NC7 A;  3E5Q A;  4GRI A;  5ICC A;  3GTQ J;  3M3Y J;  1G3T A;  1WGX A;  4EJV A;  2FF4 A;  2IXS A;  1T95 A;  1RZ4 A;  1TQM A;  4BHP A;  3K4C A;  2B9S A;  1YX3 A;  1H89 C;  2A5Y B;  3E5U A;  3GFJ A;  2MA3 A;  1YW7 A;  2W85 A;  2XPV A;  2M0C A;  1O7L A;  3HOV J;  2NNN A;  2XV4 S;  4HX8 A;  1EJ9 A;  5AON A;  2HXI A;  3P9K A;  4Y4R A;  3KET A;  5HLI A;  4XN0 A;  1SFK A;  3BR3 A;  2QZ8 A;  4BQQ A;  3BR2 A;  2FSW A;  1G59 A;  1AOY A;  3QQA A;  2IGK A;  1KYW A;  3HOS A;  3ZQH A;  4KIT B;  2DO7 A;  4MQ9 F;  3PNY A;  1OQY A;  2BHZ A;  2HFH A;  4EGZ A;  3SEQ A;  2HVQ A;  3MQ0 A;  3ZOB A;  1D0Z A;  3N4M A;  2DMU A;  3LAP A;  1Y0U A;  2PLY A;  3C18 A;  2R5Z A;  3HRM A;  2UXN A;  2GIV A;  3BQZ A;  3QPS A;  2XSJ C;  3ZQ7 A;  5JFR A;  3QPT A;  5CKT A;  5FLX K;  5EG0 B;  4NB5 A;  1WKM A;  3PJR A;  2V79 A;  1HW5 A;  2JK3 A;  2LRD A;  3S8P A;  1Z3X A;  4I02 A;  2FMY A;  3K4K A;  1OYY A;  3HIF A;  1MBJ A;  1AWC A;  2PJR B;  5LEJ A;  2WY8 Q;  4BBR J;  3V42 A;  4BY1 J;  1XGN A;  4M74 A;  2P6T A;  5E1Z B;  1R5G A;  3WTY C;  2K9Q A;  3DQV C;  1OFC X;  2X6O A;  4GGG A;  5LLQ A;  1VI0 A;  2I10 A;  1RKW A;  1JUM A;  5JHU A;  5HLG A;  3BDD A;  1O57 A;  3S1N J;  5DM6 F;  1K4S A;  2NRA C;  4N4N B;  1QZY A;  4NC8 A;  4F7Z A;  3CTA A;  1X3U A;  2L0K A;  2XKP A;  2DK8 A;  2EZH A;  3HYI A;  4GYI A;  3WGG A;  5HOO A;  1RKT A;  1LB2 A;  1HDP A;  2HGC A;  3TDZ C;  2E60 A;  5F0F A;  1Y6I A;  4A3I J;  2EZI A;  2KT0 A;  5ILS A;  3WOD F;  4Y33 A;  3JR9 A;  2A3S A;  3GLL A;  5HLT A;  4B3X A;  3FHN A;  3QYE A;  1G3W A;  2V1N A;  1D0Y A;  1FOK A;  1WQ2 A;  4ABZ A;  3A0H C;  3IC7 A;  2VC1 A;  1U6G A;  1YOV B;  3HRU A;  4IHT A;  2DOE A;  4ZDO A;  2PFB A;  3K4J A;  2YX7 A;  2JT1 A;  4UV8 A;  2MC3 A;  5J8C A;  2VQC A;  1D5V A;  3ULQ B;  3CCM I;  1HBX G;  1ZR4 A;  5CVU A;  3TW7 A;  2VOD A;  2VJJ A;  5J1R A;  2N8G A;  5FLX Z;  1YE9 A;  5KAF C;  1JT0 A;  3CD6 I;  4FET A;  1TW3 A;  3TMO A;  2V4J C;  2ZME A;  1FOY A;  4U7B A;  2K9S A;  3Q3S A;  3OMY A;  2HOE A;  2HYG D;  2VL8 A;  2XDV A;  3BR6 A;  3AKZ A;  2A6E F;  4RAY A;  2L4A A;  2NNY A;  1FP2 A;  1AU7 A;  5F08 A;  2O5R A;  1K4T A;  4UB8 C;  2WAQ N;  5CVR A;  2IVM A;  4ENM A;  2R3S A;  4XLE A;  3GFI A;  4N9H A;  4TV7 A;  3ASO H;  3CDH A;  1YYV A;  2EZL A;  1TNT A;  2Y0S N;  4LOC A;  1XX5 A;  3G1M A;  4EJW A;  1TT0 A;  3B6A A;  2OD5 A;  5FRO A;  5JLX A;  2Y9Y A;  4EAT A;  1KA8 A;  2LMD A;  4I01 A;  1FPQ A;  2VKH A;  5M3F J;  4LMY A;  2YUS A;  1A35 A;  2Y0S A;  1NTC A;  1O3Q A;  2NVU B;  2RAE A;  3WHB A;  1MND A;  1I5Z A;  3DFG A;  1U3E M;  1YS7 A;  1Z6R A;  2HOA A;  2ICW G;  3GEZ A;  4UB6 C;  5E79 C;  1IC8 A;  5E3N A;  3OYF A;  3SQN A;  1R1V A;  2BXY A;  4MIM A;  3PUB A;  3DCF A;  4G8X A;  2O03 A;  4XMY A;  3U2R A;  2W82 A;  1P4X A;  1X2N A;  1I6H J;  2KZV A;  2LK2 A;  3H3U A;  2V9P A;  1R36 A;  3TGN A;  3HOX J;  4FE7 A;  2Z33 A;  4PUS A;  2QA4 I;  1UMQ A;  2M1B A;  3OS2 A;  3BG9 A;  2DFH A;  2X9D A;  2BVL A;  1WJF A;  4Q4Z F;  3S3O A;  3FHZ A;  2BW3 B;  3T8T A;  2KZG A;  4ZYD A;  1S9H A;  2DXI A;  4A0Y A;  4MFD A;  4IHY A;  1VQL I;  3ABM H;  4HQE A;  2F5F A;  1WJC A;  3IV5 A;  3ZRG A;  2OA4 A;  3M7G A;  4KT6 A;  3V7S A;  5CLS A;  2L9S A;  2W1O A;  1P7J A;  2DT7 B;  2GXA A;  2BEO A;  2OZU A;  1X1D A;  3ZN1 A;  3EYI A;  4AIJ A;  2M3A A;  4X0G A;  3F8C A;  2GA2 A;  1QVU A;  5F0H A;  2EWN A;  3HBL A;  1FBQ A;  2D1H A;  1BR1 A;  2ZXW H;  3KLO A;  1T38 A;  3CC4 I;  4RB3 C;  1R58 A;  4D9J A;  2O3F A;  2XAH A;  4OIN F;  1JT6 A;  4Z6Y A;  1XD7 A;  2Z1D A;  4MTD A;  1YRN B;  2JA5 J;  1FMW A;  2OTJ I;  2ZSI B;  2DAO A;  1F5T A;  1W5T A;  3C7J A;  2VPR A;  1UB9 A;  1BI0 A;  3QYF A;  4A3E J;  3TBI A;  1LDD A;  4FCY A;  3F23 A;  2BE5 F;  3WTZ A;  4EM1 A;  2JVG A;  2MLG A;  3CQZ J;  2EZK A;  1MJ9 A;  4UXN A;  4K2E A;  1GV5 A;  2HEO A;  4DYC A;  1NG6 A;  3ZQG A;  3WHC A;  4AD9 A;  2HKX A;  1YG2 A;  1P7I A;  1WJD A;  1XN7 A;  1BI1 A;  3ABL H;  1GHC A;  3FXU A;  2FRH A;  2P81 A;  4E6K G;  1MSF C;  1XTA A;  4I7H A;  3RQ4 A;  3OSG A;  3KZZ A;  3EET A;  1AA7 A;  1T8I A;  3U1D A;  5GAH J;  1FJL A;  2XGE A;  2UV1 A;  1IXR C;  1KYZ A;  4ENK A;  1E3O C;  2ZJ2 A;  2QKL B;  2J5O A;  3JSP A;  2KP6 A;  1U9O A;  1MMD A;  5LFA A;  3WG9 A;  3BTC A;  4LK0 F;  1KZH A;  4KMF A;  3NQO A;  3HHH A;  4BJ6 C;  1WJE A;  3B6C A;  1K79 A;  3V7C A;  1T39 A;  4KYW A;  3R61 A;  5KNL A;  5EEG A;  3O2P E;  5CJ9 A;  3T5X A;  3OYC A;  2R7S A;  4JBA A;  4AU7 A;  2Z2S B;  4M6V A;  2VOO A;  4G94 A;  3AG2 H;  4QLC U;  1YTY A;  3GWZ A;  1XSV A;  3DP7 A;  4RB2 C;  1GVD A;  1OMI A;  5H6Q A;  1HA8 A;  1FSE A;  2QQB A;  2IS1 A;  1MMA A;  5TRD A;  3VEP A;  3ZCO A;  4IVN A;  2K9L A;  2FNA A;  5CPR B;  5A2Q Z;  3G4S I;  2YSR A;  3FXJ A;  4HA8 A;  2KIU A;  4MGR A;  2ME0 A;  1GXP A;  4AYB A;  1DDN A;  4Z2Y A;  5K5R A;  3A02 A;  1OJL A;  2DJI A;  4Q48 A;  4HRI A;  1WZ2 A;  2H09 A;  2RRE A;  1YW8 A;  5KAI C;  4UVA A;  1J75 A;  2BVM A;  4FX4 A;  5M5X J;  3DKW A;  5B66 C;  4P9U A;  1IDY A;  3OIQ A;  4M9S A;  3KEY A;  2I5U A;  5F27 A;  3L2C A;  3OWT A;  1W36 D;  2E2I J;  2L7M P;  1ORK A;  2DU9 A;  5BMZ A;  1MJA A;  2E34 A;  3OS1 A;  2P7V B;  3MZY A;  1SFU A;  3PSF A;  2HZT A;  1LUJ B;  2WB1 N;  2XGX A;  3WE3 A;  3ZQI A;  1BC8 C;  1XGO A;  3FZV A;  2A6T A;  2LYC A;  3IWF A;  3MKL A;  2JPB A;  2PEX A;  3ZQL A;  1WHU A;  3RYR A;  1Z67 A;  3HPG A;  4XOR A;  1S7O A;  3K4M A;  1PP7 U;  2FOW A;  2MC4 A;  1QU3 A;  2R7X A;  1OYI A;  2JSP A;  5CVI A;  3A4C A;  2Z9O A;  4IRH A;  1JKP C;  5HS8 A;  1MH4 A;  1ZGA A;  3OYH A;  2CU7 A;  5H6R A;  2L4M A;  3CP2 A;  4ENN A;  1F4K A;  1R4N B;  4XN3 A;  1ETW A;  3M1E A;  4WK8 F;  1LEB A;  3JRB A;  3TED A;  1A6I A;  2PMZ N;  6PAX A;  5D8L B;  3S17 J;  2DOD A;  2JPC A;  1MJB A;  2QYO A;  3TDU C;  2ELK A;  3EUH C;  4M3F A;  4IRG A;  5CVV A;  2JA6 J;  1BBY A;  3KP7 A;  5JVT A;  3TO7 A;  3EPZ A;  1SMT A;  4BU2 A;  1W1W E;  2KRF A;  4RLF A;  3LSK A;  3E7L A;  3M1C A;  2FQ4 A;  4XOP A;  4EMS A;  3W6J B;  1X2M A;  1DGR M;  5J3L A;  2XVC A;  2ESN A;  3AG4 H;  3K4N A;  1WWX A;  1D0X A;  5K5Q A;  1QA6 A;  4BDY A;  2A05 A;  3FM3 A;  4BS9 A;  3CF2 A;  2G7H A;  1S5L C;  4RAG A;  3WE2 A;  4ZZD A;  4G12 A;  1R1T A;  2H6B A;  1U5T B;  5F6F A;  2HKO A;  1RES A;  5L3B A;  1VND A;  2G7U A;  4A0Z A;  1ZAO A;  4EV0 A;  1RI7 A;  3BP8 A;  4HLY A;  1YW9 A;  5IYD J;  3E5X A;  1T98 A;  4AIK A;  2Y30 A;  2NAZ A;  4NC6 A;  1IG7 A;  1FP1 D;  4RM3 A;  4L9V A;  3FXK A;  3R4K A;  3H36 A;  1WH7 A;  3HZJ A;  3H5N A;  1V3F A;  3K7A J;  5HDN A;  2XUB A;  3TOA A;  2NVX J;  4U0V A;  2VKE A;  2JZY A;  3OL3 A;  1W5S A;  1S72 I;  1X58 A;  3BR5 A;  4IQ4 A;  3OSF A;  5BQT A;  1Z77 A;  2GBY A;  2W24 A;  2XAF A;  4UVC A;  1AHD P;  1LQ1 A;  5HVQ C;  3TOB A;  2IP2 A;  4E7S A;  3GBG A;  2K27 A;  2OPT A;  1I1S A;  1TC3 C;  2K85 A;  5D6E A;  1YJ9 I;  3RIR A;  5IT3 A;  4UUT A;  1PUF B;  1R22 A;  1FOX A;  4BE2 A;  2F2E A;  4ZYG A;  1QPI A;  1JGG A;  2R7O A;  1TWH J;  2FBH A;  4ZZL A;  4HBL A;  3GZN B;  1MBF A;  1S6L A;  1RET A;  2FD5 A;  2KL4 A;  4V19 K;  2QEX I;  1WFX A;  3BG6 A;  2UXX A;  3KZI C;  5L3E A;  2ACJ A;  2QF7 A;  3FKJ A;  1HST A;  1ITY A;  1D1A A;  2DJN A;  4BY7 J;  2LBF A;  2X1D A;  2XB0 X;  1Z3Y A;  2LF8 A;  3JCU C;  5EEH A;  4A5N A;  4L5I A;  1JKR C;  4AVZ A;  4ETS A;  4J01 A;  3LAJ A;  4UV9 A;  4BXF A;  3VOE A;  2M7B A;  1UST A;  3GTM J;  3I56 I;  3JRF A;  4KNY A;  3T1B A;  3SXY A;  3QOP A;  4RB1 A;  3L2Q A;  2NOJ B;  2XF6 A;  5GAE J;  3A01 A;  4YRV A;  4RMN A;  3QPH A;  2OTL I;  1APL C;  3W6K B;  3REO A;  2BYV E;  4CYD A;  2OC6 A;  2QEN A;  1BW5 A;  2Y75 A;  3E6M A;  3OYE A;  2M7A A;  3KZY A;  4I0A A;  1CF7 B;  3EUH A;  3I58 A;  4MEY F;  1A5J A;  5J4V A;  3G2B A;  2VQG A;  5E3L A;  4KUM A;  3HOW J;  4LLG F;  2VT2 A;  5ILV A;  2DMT A;  3K0L A;  4YFX F;  3WU0 A;  3BTI A;  1RUN A;  1KQ9 A;  1QQI A;  1EH8 A;  2XAS A;  1PUF A;  1Z1D A;  1NH3 A;  4G7Z F;  4ESF A;  2A69 F;  3OS0 A;  1IRZ A;  3R6S A;  3T8R A;  2L02 A;  1U2W A;  2KJB A;  1Y8R B;  5LGT A;  3CZ6 A;  3FK6 A;  4BQA A;  2LY9 A;  3ECO A;  3CJR B;  2Z99 A;  1E17 A;  2XRL A;  3KFW X;  2CW7 A;  2LOO A;  5J4Y A;  3HSR A;  1FSH A;  5E3O A;  4FTH A;  3FBI B;  2R7T A;  1IDZ A;  2MSY A;  1IF1 A;  1IUF A;  1W7P A;  2ECB A;  2MW8 A;  4FX0 A;  3LQR A;  2K9N A;  1SD6 A;  2R7F A;  3F21 A;  1BM9 A;  1IN6 A;  2QUF A;  4P9F A;  5LHH A;  1LKX A;  1L3L A;  4RGX A;  5HS9 A;  1Q1H A;  3FX3 A;  3QU3 A;  1YS6 A;  3TKY A;  2RGV A;  1ZGJ A;  1HSJ A;  4JK1 X;  1A36 A;  2EIK H;  4HNV A;  1ZG1 A;  1XC5 A;  2H27 A;  3I4P A;  2O61 A;  4QPQ A;  2R93 J;  2L2O A;  2TRT A;  3EUK L;  3HM5 A;  1U78 A;  1S7A A;  2KIM A;  3HDD A;  1X3W B;  2JA2 A;  3E6B A;  3M8J A;  4DZJ A;  1FTT A;  4DBQ A;  4MNU A;  4H4K C;  1LE8 A;  1MMG A;  4ZC3 A;  2R4G A;  4DBR A;  4P5O A;  5DV5 A;  4N4O B;  1XMA A;  3L09 A;  4ZH4 F;  1ZGW A;  3K1M A;  1HKQ A;  1D1B A;  5DDG A;  5H2F C;  3LFU A;  3I0T A;  3RPU D;  1E0E A;  1J7K A;  4EJO A;  3HOU J;  4KN7 X;  2P8T A;  4IOC F;  4BEH A;  3PFY A;  4KA4 A;  1TT5 B;  5E18 F;  4L0Z B;  1GVJ A;  3K9T A;  2CJJ A;  3AG3 H;  2OU2 A;  3HUG B;  2CO5 A;  1JJ6 C;  3WTW C;  4PZJ A;  5GPC A;  2PBI A;  2PMH A;  2BXZ A;  4WCG A;  3DKX A;  4RGR A;  2EFQ A;  2IRF G;  1MBE A;  4L9J A;  1Z0X A;  2KLO A;  3S2D J;  5GAG J;  3LMM A;  4JX4 A;  1PYV A;  1SAN A;  4M3G A;  1PUE E;  2STT A;  4R8H A;  4LIU A;  2R7U A;  3GW2 A;  2L01 A;  2FX0 A;  1FOW A;  4XKC A;  4IZZ A;  2Q2E A;  4XSX F;  1F43 A;  1XDS A;  2OQR A;  3SDG A;  5L3G A;  4I76 A;  3O3K A;  2ZXJ A;  4HW0 A;  1I3A A;  4HF2 A;  2RN7 A;  2VIX A;  4HPQ A;  4OWR B;  2LSO A;  1P2F A;  3Q9S A;  2DYS H;  1VQN I;  1MNE A;  3RDI A;  4FHT A;  2WAF A;  3WG7 H;  3WTX C;  2EFP A;  2HDW A;  3QWL A;  4A6D A;  1G3S A;  3PNV A;  1JKQ C;  4KIG A;  4DYR A;  2DMQ A;  2LRE A;  1B9M A;  1MZB A;  2QSG X;  1RR8 C;  5IP6 A;  1JXS A;  1BN5 A;  4M3D A;  2HYF A;  2GZW A;  4HZF A;  4MHG A;  1QPM A;  4RDU A;  2R7D A;  2ZNZ A;  4IPA A;  3QPL A;  3J7A Y;  2CW8 A;  2M8G X;  1D8J A;  2C6Y A;  3BZC A;  2Q2E B;  4IOA F;  3CCQ I;  2M45 A;  4ZYE A;  5D4R A;  1TW2 A;  2L54 A;  3DU6 A;  5KCM A;  5DCM B;  1OR7 A;  5JVG F;  4B47 A;  2VUM J;  1W7P D;  2IW5 A;  4QWQ A;  4E4H A;  4ZTF A;  2E1M C;  3JRI A;  1PJR A;  2LBF B;  3RI4 A;  2Y0M A;  5J8F A;  3H92 A;  4E7J A;  4U0W A;  5GAD J;  1IRG A;  2VT3 A;  5M5W J;  2IAI A;  2HWV A;  4JX5 A;  4B43 A;  3ELK A;  3DU5 A;  3LA3 A;  1GXQ A;  1ETQ A;  3PIO F;  3DEE A;  4DJA A;  4D0P A;  2LG4 A;  3RCO A;  1KU3 A;  5F1R A;  5F0C A;  1W0U A;  4CCL A;  2BV6 A;  1VQ9 I;  2E7W A;  3Q0V A;  3KX2 A;  1R23 A;  4DZP A;  1OCR H;  2EJR A;  5FJ8 J;  3MKZ A;  1HW2 A;  2CUF A;  4R79 A;  2WWY A;  1J5Y A;  4PSX A;  3A2K A;  4PCQ A;  3H0D A;  2ID6 A;  1G4D A;  1YX5 A;  4IHS A;  3FDY A;  3H3Z A;  4I99 C;  3ABT A;  2MGQ A;  2DPD A;  2X4H A;  1A6Q A;  1BOB A;  1FIA A;  2P5L C;  4A3G J;  3GUD A;  2HTJ A;  4R1H A;  1ZQ3 P;  2V26 A;  3CCU I;  4MO7 A;  1X1A A;  1M1E B;  2F48 A;  3BJA A;  1JUP A;  4IJA A;  2DOF A;  4M6Y A;  4ON0 A;  4XLN F;  3HRT A;  3ISP A;  5E17 F;  1WRJ A;  2DK5 A;  3KE2 A;  3PUF A;  3HOZ J;  2XAU A;  1R49 A;  4A3K J;  4LGW A;  3CJN A;  2VN2 A;  4JX6 A;  4UUV A;  3BTJ A;  3U1K A;  2A61 A;  4QPO A;  2XPW A;  3TQN A;  1V4R A;  3E97 A;  4GO1 A;  3BZK A;  3C2H A;  4IHX A;  1PP8 F;  4U87 A;  1DGW Y;  3DBR B;  4XK4 A;  3GTJ J;  5FFX A;  2P4W A;  4YEJ A;  2ADU A;  5IY5 H;  1N75 A;  1O3T A;  3CME I;  4CHU A;  2WAQ A;  3S1R J;  3H9Q A;  5B1B H;  2K5C A;  3OYJ A;  1YI2 I;  2VBY A;  4RLQ A;  4AIH A;  4UUS A;  2BOL A;  4P55 A;  2KIF A;  5F1J A;  3GFL A;  2DPU A;  1TTY A;  1T0F A;  2QSF X;  2HZD A;  4CA0 A;  2B0L A;  3K2A A;  5D5V B;  2V1X A;  2UZK A;  1OCT C;  3M9A A;  1SFE A;  2KRH A;  3HTU A;  3NWT A;  5EG0 A;  2M4K A;  2QKM B;  1FNN A;  2K02 A;  1R9T J;  2CUJ A;  2Q0O A;  2W84 A;  1E2X A;  1XGS A;  4PJ0 C;  2EFN A;  2VQL A;  2DA7 A;  3VYR B;  4EEF G;  2NVT J;  3FXO A;  4M9Z A;  4BGD A;  2FBK A;  1QNT A;  2NS7 A;  3LA2 A;  3J80 K;  3I55 I;  1VQM I;  4BDZ A;  2ZJP F;  3C3W A;  1IXS B;  1JE8 A;  4J19 A;  3N97 A;  5EGO B;  5JR3 A;  1IN7 A;  5EDN A;  1YJN I;  2L9R A;  1UCR A;  2LD5 A;  1LFU P;  5GTH C;  4L18 B;  4BJT A;  1Z7U A;  2OQG A;  1ULY A;  3S3N A;  4B4C A;  3CP8 A;  1VQ7 I;  3O8H A;  3CO6 C;  5LRR A;  4XOT A;  3IWZ A;  1GT0 C;  2G0E A;  1MSE C;  3K70 C;  2O9L A;  3BG5 A;  2BBY A;  4G6T B;  1FTZ A;  2E19 A;  4GFB A;  2PI0 A;  1BA5 A;  1I50 J;  4MQV A;  2EIJ H;  1SEU A;  4IEJ A;  4M71 A;  3JAM K;  2WBM A;  2CH0 A;  4D5F A;  1CQT A;  4LFU A;  1EH7 A;  1WSU A;  3EYY A;  4EVI A;  1OCP A;  2WV1 A;  5F04 A;  4CO8 A;  4N9I A;  1VQ5 I;  3UR3 C;  4QTR A;  2KDZ A;  1SFX A;  2OJE D;  2EV6 A;  1R6R A;  1X1P A;  3NEU A;  1OCO H;  3F8N A;  2KDO A;  4E7I A;  2DW4 A;  4RBO A;  2F5E A;  3S2W A;  4OAZ A;  1WJB A;  5HNF A;  2BGC A;  2IA2 A;  2CG4 A;  4EM0 B;  1V5E A;  4LG3 A;  4X1E A;  4JYK A;  5DD4 A;  4A3L J;  2K7L A;  5HS7 A;  2AQE A;  2H94 A;  5GP9 A;  4RM2 A;  1T2K A;  1JJ8 C;  1IJW C;  1T0F C;  4RGS A;  2XAG A;  2GXB A;  3RPU A;  4C2T A;  2WA0 A;  3LL7 A;  4C30 A;  4W97 A;  3BWG A;  2GIZ A;  3LST A;  1SD4 A;  2KFD A;  4HOB A;  3VOD A;  2VB6 A;  2QCO A;  1TP4 A;  3AG1 H;  3ROU A;  4IL6 C;  4M72 A;  1NK3 P;  1MGT A;  5BPD A;  3ESW B;  1J0R A;  2DFE A;  3K6G A;  2K9M A;  1OPC A;  1SVL A;  3AAF A;  1P92 A;  5AIP A;  3O8G A;  2DOA A;  1V55 H;  3I54 A;  3ZMS A;  2VBZ A;  3VWB A;  2E5Z A;  2B63 J;  4WXH A;  1YO5 C;  1NK2 P;  1HF0 A;  4ZTJ A;  1YLF A;  4GXO A;  4EGY A;  2KJC A;  3ASN H;  1UFM A;  4Y13 A;  2CQX A;  4CH7 A;  3AL0 B;  1QZZ A;  3OIP A;  5IYC J;  2W48 A;  4E7L A;  2WY7 Q;  4HEA 2;  2HXO A;  3B02 A;  1QO0 D;  2L9V A;  5HDG A;  5D5W B;  3OV8 A;  3G1O A;  4G7O F;  1MMN A;  3C1D A;  2A07 F;  3M07 A;  4C2M J;  2UWM A;  1NHA A;  3I4N J;  3B73 A;  3CMM A;  5LBQ A;  2E35 A;  5L3F A;  2O8X A;  1UHM A;  4II3 A;  1JI8 A;  1C0W A;  4S0H B;  3MFK A;  2DQR A;  3OIO A;  4IRI A;  3RYP A;  2CV1 A;  3DEW A;  2E1C A;  3VYT B;  3CO7 C;  2VC0 A;  2VOP A;  3CLQ A;  2V6C A;  1FLI A;  1BR4 A;  4CCO A;  1XGM A;  3SYT A;  3WTS C;  3FK7 A;  3S2H J;  5JI6 A;  5C44 J;  1VQ4 I;  1JUS A;  2EB7 A;  4IXA A;  2XIG A;  3N05 A;  3ZMV A;  3SZT A;  4CGZ A;  1W36 C;  3EQL F;  4DQ2 A;  2DA5 A;  5E1W A;  1QHH D;  1ZEL A;  1H9G A;  3LOC A;  3VSK A;  1DU0 A;  1N78 A;  4XBF A;  4F52 A;  4C3H J;  1Z05 A;  3D1N I;  3M4O J;  2P0W A;  4CCJ A;  2E71 A;  3DPT A;  2ZC2 A;  5ICG A;  4AUX A;  3VB2 A;  3LQQ A;  4F55 A;  3OYA A;  1O3R A;  2V1U A;  2Q1Z B;  4LLN A;  3WTT C;  4XLH A;  5K1Y A;  1Z6T A;  2MG4 A;  2ZO4 A;  3HSE A;  2X48 A;  1I27 A;  3JRH A;  4A3F J;  3CDI A;  2QQ9 A;  2ZJR F;  4Q5S F;  3FXR A;  2M4G A;  2PX9 A;  2DTR A;  3GXO A;  4PK4 A;  1LVK A;  4HSR A;  4KJZ A;  1R4M B;  3UKG A;  4XR6 A;  2NOG A;  2WTE A;  3BLY A;  1H9T A;  4MEX F;  2AHQ A; 
#chains in the Genus database with same CATH homology
 2E1N A;  3BJO A;  2QBY A;  1R1U A;  1ONV A;  2O6G E;  4O3M A;  3KCC A;  3F72 A;  5FD6 A;  5K5O A;  2XAQ A;  1QGP A;  2EA4 A;  3HSF A;  2JRT A;  4DNC A;  1U8R A;  3Q5F A;  3PQK A;  2FXA A;  3MCZ A;  4CDG A;  2WV0 A;  1I1G A;  2EV0 A;  4OIR F;  1TQP A;  2K4J A;  3TO6 A;  3FMR A;  1IXC A;  2YR2 A;  4BNC A;  4ASN A;  4B09 A;  3F8F A;  3WGI A;  3IKV A;  1FYK A;  1O3S A;  1CF7 A;  2CFX A;  2A68 F;  2LKP A;  3DPL C;  2DLL A;  1UHW A;  4XSZ F;  1K78 B;  3GF2 A;  4KDP A;  4A0X A;  3BY6 A;  3RKX A;  3BZ6 A;  1ZLJ A;  2XRO A;  4EJT A;  1XSX A;  5CVJ A;  2CQK A;  1EV7 A;  1J2X A;  4OU0 A;  4LB5 A;  1YIO A;  5D8K B;  2QWW A;  3GLX A;  2JSC A;  3SZP A;  3O6B B;  2DBB A;  4ZYH A;  1FWZ A;  3KP6 A;  3E3V A;  3FMS A;  2ELH A;  3WTU C;  1ZRD A;  1ZH5 A;  1BIB A;  1MKM A;  1ZN2 A;  2D2W A;  1R7J A;  4MTE A;  2PJP A;  2IPQ X;  2HDC A;  3WTV C;  4AWX B;  3FM5 A;  2NS0 A;  2GA1 A;  1XCV A;  1D3Y A;  1L0O C;  3F6V A;  4YG2 F;  4L5J A;  2DQL A;  4XLP F;  2L3D A;  3IKT A;  1TNS A;  4EJU A;  5IT9 K;  2EV5 A;  3Q9V A;  3IRQ A;  5DCM A;  2Q8K A;  3COA C;  2D1V A;  3ZMU A;  5J6X A;  2VE8 A;  3I59 B;  3WGH A;  2M87 A;  2EFW A;  2QQA A;  5L3C A;  3G3Z A;  2FQ3 A;  4E70 A;  3FF5 A;  3K1P A;  2FU4 A;  2YX4 A;  3CUQ B;  2F5D A;  3DXJ F;  4LD5 A;  2A6H F;  3ML6 A;  2FBI A;  2NYX A;  3ZP5 A;  3V7R A;  2TDX A;  1HXD A;  4LJZ F;  1S3J A;  3L7W A;  3KP3 A;  1LJ9 A;  1OKR A;  3F6O A;  3K2Z A;  1ZRC A;  3ECH A;  3MZH A;  2ZNY A;  5BS6 A;  5BOX A;  5HLH A;  4OIQ F;  4UVB A;  1FYM A;  1JHH A;  5DYM A;  4WWC A;  1ON1 A;  2H6C A;  3DEU A;  4JQF A;  2V1D A;  3FMQ A;  5E8G A;  1KQ8 A;  2OZ6 A;  3DF8 A;  4M6X A;  4HX4 A;  3ERE D;  2FE3 A;  1BC7 C;  2QM3 A;  4U0Y A;  2PMU A;  4PGH A;  1QBJ A;  2FEZ A;  5ERI A;  3JTH A;  2Y48 A;  2ZBK A;  1XDU A;  4BH9 A;  5D5X B;  3CLO A;  2JTV A;  1BI2 A;  5LRS A;  3KP4 A;  3QP5 A;  1IN8 A;  5HDK A;  4FT8 A;  3P9I A;  2CSO A;  3L00 A;  4G7H F;  1STZ A;  3VFZ A;  2RV8 A;  1OYW A;  5DD8 A;  2ISZ A;  2X0L A;  1T6S A;  3I64 A;  4M9X A;  2Z5U A;  4CIC A;  5D4S A;  1USS A;  1EH6 A;  3CUO A;  5CYV A;  1S29 A;  1TLH B;  3HRS A;  5ED4 A;  4BHC A;  3GVA A;  3ZMT A;  1SD7 A;  2FNP A;  3BRO A;  1DPR A;  3L9F A;  3G73 A;  4Y17 A;  3F8B A;  4YIF A;  4AVP A;  3J81 Z;  1KU2 A;  3KP2 A;  1Z91 A;  3I59 A;  4OIO F;  1ZG3 A;  4CXF A;  2FML A;  1B6A A;  3FWE A;  2RDP A;  5LGN A;  1JGS A;  4I09 A;  1ON2 A;  3QRF F;  3D5L A;  2W25 A;  4LK1 F;  2O0Y A;  2STW A;  1IZ1 A;  2PN6 A;  2HQN A;  1KQ0 A;  1XB4 A;  3RTR A;  2RC4 A;  2KKO A;  4OIP F;  3V8L A;  3LWF A;  3RKW A;  3R60 A;  2P5K A;  1B9N A;  3OOP A;  2VXZ A;  3U9G A;  4HX7 A;  4UNO A;  2YPR A;  4O5V A;  3E6D A;  3ZN0 A;  1ZG5 A;  4U7D A;  1FY7 A;  1ZRF A;  4KN4 X;  1RUO A;  3F8M A;  3RPQ A;  1R00 A;  1S8N A;  2MD5 A;  1BI3 A;  3QAH A;  1FZP B;  4I98 B;  2PQ8 A;  2ETH A;  5LHI A;  1FYL A;  4U88 A;  1MDM B;  3ZMZ A;  4Q47 A;  5DEQ A;  2M8E A;  3ZMD A;  2GAU A;  3BOQ A;  4NQW A;  3I71 A;  3DV8 A;  2IA0 A;  4A2U A;  4KIB A;  4RB0 A;  3FXQ A;  3MAJ A;  4EM2 A;  1U5T A;  3GX4 X;  4BYY A;  1IW7 F;  1VTN C;  4A12 A;  3V8J A;  1SAX A;  4G9Y A;  3J7A O;  3RJP A;  2QLZ A;  4HF0 A;  2DT5 A;  4L9T A;  4OMZ A;  1G6N A;  3J81 K;  2AS5 F;  3P9C A;  1XCB A;  1YQA A;  5E8I A;  5D5U B;  2ISY A;  4M73 A;  5DUK A;  2XKO A;  3RKY A;  1G3Y A;  4G6Q A;  3PFI A;  4A5M A;  3ABU A;  3KEQ A;  4UHT A;  2K86 A;  2FA5 A;  5E1X A;  3TO9 A;  4WXC A;  1RNL A;  2GQQ A;  1WI9 A;  2G9W A;  1I6X A;  2LDU A;  3IHU A;  1KU9 A;  2Z3Y A;  4RGU A;  2LNB A;  3JTG A;  2HR3 A;  4XRF A;  3P7N A;  4B8X A;  4HV6 A;  3KEO A;  1BOA A;  2XRN A;  3HUG A;  2HQR A;  3HOT A;  3R0J A;  4ENJ A;  5E20 A;  2P6S A;  4HAM A;  4NHJ A;  2PG4 A;  1RIO H;  4WXD A;  1XMK A;  1D8K A;  2AXL A;  1KU7 A;  3HHG A;  1YFH A;  1ZHF A;  3BPV A;  1HW1 A;  4CZZ A;  1LEA A;  2MH9 A;  1XSD A;  2EFO A;  2YU3 A;  3CUQ A;  2MH2 A;  1P4W A;  1B4A A;  1FT9 A;  3V4G A;  4S04 A;  4L9N A;  5DCF A;  1DP7 P;  2IT0 A;  5FGM A;  3T0Y A;  5IT9 Z;  2HTS A;  4RAZ A;  1DPU A;  5FO5 A;  4I0B A;  3EDP A;  2MLK A;  1IN5 A;  2IA1 A;  1BJA A;  4GCV A;  5DUI A;  4HDU A;  2M30 A;  2CGP A;  1ODD A;  4G6D A;  3M8E A;  1K6O A;  4LB6 B;  3LFK A;  2F5C A;  2CW0 F;  4HDV A;  5TJJ A;  4O6J A;  2XHK A;  1HKT A;  2OAZ A;  4HQM A;  1SD5 A;  3ZPL A;  2WC2 A;  1FBU A;  2RVC A;  4IF4 A;  1A04 A;  4LG0 A;  5LEK A;  5ICE A;  4OMY A;  4KMU X;  3WU1 B;  1IRF A;  3MEX A;  2D45 A;  4BHB A;  4I2O A;  4LG0 B;  2VBX A;  2VON A;  5ILU A;  1K78 A;  4HF1 A;  2OBP A;  1TQI A;  3GYH X;  3GO5 A;  5H20 A;  1B1B A;  1HQC A;  1W4M A;  2EA2 A;  5D6F A;  1MD0 A;  1ZLK A;  3IRR A;  2GXG A;  3CUQ C;  1F1Z A;  3KLN A;  4KIF A;  3SFZ A;  4BXU A;  5KVR A;  2W57 A;  3BPX A;  4KT5 C;  2CWE A;  3F3X A;  2ZKZ A;  4LLL A;  3MWM A;  1ZYR F;  2ESH A;  4WF2 A;  4H0E A;  2XAJ A;  5AIQ A;  3KP5 A;  5FB2 A;  3GFM A;  1BIA A;  1HKS A;  2QVO A;  3I5U A;  4RS8 A;  5LGU A;  4S05 A;  4KFC A;  3F22 A;  4N0B A;  4BAY A;  1F9N A;  1LNW A;  1IN4 A;  2RKH A;  2GWR A;  1FX7 A;  1PDN C;  1JHF A;  3E6C C;  2LF7 A;  3NRV A;  2FOK A;  1IUY A;  4YFK F;  4HLX A;  1MDM A;  2CYY A;  1B59 A;  5F64 A;  1J59 A;  3IL2 A;  2HS5 A;  4GYG A;  2M5W A;  3JSO A;  1LVA A;  2MBF A;  3I53 A;  4A6E A;  5BPI A;  4HYE A;  1J9I A;  3GZ6 A;  2EK5 A;  4PGG A;  3QP6 A;  4WX9 A;  2QBY B;  3R0A A;  4ESJ A;  1LDJ A;  1ZRE A;  3HTS B;  4YII A;  1P4A A;  5KK1 A;  1ZAR A;  3GZ5 A;  5FD5 A;  1TBX A;  1DUX C;  2ZME B;  5ICF A;  4KIC A;  4EQQ A;  2ZCW A;  4YFN F;  1FBS A;  4OOI A;  2ZFW A;  5A2Q K;  3J80 Z;  2VBW A;  3QU6 A;  2V9V A;  4P96 A;  2IJL A;  1Z9C A;  2DI3 A;  3K1N A;  1U5T C;  3V8K A;  4Y15 A;  1O7F A;  3JW4 A;  2E7X A;  2RQP A;  4HV5 A;  2K4B A;  2COM A;  3SHF A;  1FC3 A;  4L0Y B;  1R5H A;  2P5V A;  1KGS A;  2J5P A;  1SMY F;  5FFZ A;  3M8F A;  2RNJ A;  1P6R A;  3LA7 A;  4PDK A;  3K69 A;  3JAM Z;  3D0S A;  2DFI A;  5L3D A;  2VE9 A;  3BJ6 A;  4ESB A;  2P7C B;  1IAW A;  1K7A A;  1CGP A;  1REP C;  1LDK B;  3PQJ A;  5LHG A;  1H0M A;  3E5Q A;  5ICC A;  1G3T A;  4EJV A;  2FF4 A;  1RZ4 A;  1TQM A;  4BHP A;  2A5Y B;  3E5U A;  3GFJ A;  2MA3 A;  1YW7 A;  2W85 A;  1O7L A;  2NNN A;  2XV4 S;  4HX8 A;  5AON A;  3P9K A;  3KET A;  5HLI A;  2QZ8 A;  2FSW A;  1AOY A;  1KYW A;  3HOS A;  2DO7 A;  4MQ9 F;  2HFH A;  4EGZ A;  3MQ0 A;  3N4M A;  3LAP A;  1Y0U A;  2PLY A;  3C18 A;  3HRM A;  2UXN A;  2GIV A;  3ZQ7 A;  5JFR A;  3QPT A;  5FLX K;  4NB5 A;  1WKM A;  2V79 A;  1HW5 A;  4I02 A;  2FMY A;  1OYY A;  3HIF A;  1AWC A;  5LEJ A;  1XGN A;  4M74 A;  2P6T A;  5E1Z B;  1R5G A;  3WTY C;  3DQV C;  4GGG A;  5LLQ A;  5JHU A;  5HLG A;  3BDD A;  1O57 A;  2NRA C;  1QZY A;  4F7Z A;  3CTA A;  1X3U A;  2XKP A;  2DK8 A;  3HYI A;  3WGG A;  4GYI A;  5HOO A;  1LB2 A;  2HGC A;  3TDZ C;  5ILS A;  3WOD F;  2A3S A;  1G3W A;  1FOK A;  1WQ2 A;  3IC7 A;  2VC1 A;  1U6G A;  3HRU A;  4IHT A;  2PFB A;  2YX7 A;  2JT1 A;  4UV8 A;  2MC3 A;  5J8C A;  1D5V A;  3ULQ B;  1HBX G;  5CVU A;  2VOD A;  5FLX Z;  1TW3 A;  2ZME A;  4U7B A;  2HOE A;  2HYG D;  2A6E F;  4RAY A;  2L4A A;  2NNY A;  1FP2 A;  5CVR A;  2IVM A;  4ENM A;  2R3S A;  3GFI A;  4N9H A;  4TV7 A;  3CDH A;  1YYV A;  1TNT A;  4EJW A;  2OD5 A;  1KA8 A;  4I01 A;  1FPQ A;  4LMY A;  1O3Q A;  1U3E M;  1I5Z A;  3DFG A;  1YS7 A;  1Z6R A;  3GEZ A;  3SQN A;  1R1V A;  4G8X A;  2O03 A;  3U2R A;  1P4X A;  3H3U A;  1R36 A;  3TGN A;  2Z33 A;  2M1B A;  4Q4Z F;  3FHZ A;  3T8T A;  4ZYD A;  4A0Y A;  4HQE A;  2F5F A;  2OA4 A;  3M7G A;  3V7S A;  5CLS A;  2BEO A;  2OZU A;  3ZN1 A;  3EYI A;  4AIJ A;  3F8C A;  2GA2 A;  2EWN A;  1FBQ A;  2D1H A;  3KLO A;  1T38 A;  4RB3 C;  1R58 A;  2O3F A;  2XAH A;  4OIN F;  1XD7 A;  4MTD A;  2DAO A;  1F5T A;  1W5T A;  3C7J A;  1UB9 A;  1BI0 A;  1LDD A;  3F23 A;  2BE5 F;  3WTZ A;  4EM1 A;  2MLG A;  1MJ9 A;  4UXN A;  4K2E A;  2HEO A;  4AD9 A;  2HKX A;  1YG2 A;  1XN7 A;  1BI1 A;  1GHC A;  3FXU A;  2FRH A;  4I7H A;  3KZZ A;  3EET A;  3U1D A;  1IXR C;  1KYZ A;  4ENK A;  2ZJ2 A;  2J5O A;  3JSP A;  3WG9 A;  4LK0 F;  4KMF A;  3NQO A;  3HHH A;  1K79 A;  3V7C A;  1T39 A;  4KYW A;  3R61 A;  5EEG A;  3O2P E;  5CJ9 A;  3T5X A;  4JBA A;  2VOO A;  4G94 A;  4QLC U;  1YTY A;  3GWZ A;  1XSV A;  3DP7 A;  4RB2 C;  1OMI A;  5H6Q A;  1FSE A;  2QQB A;  5TRD A;  3VEP A;  4IVN A;  2FNA A;  5A2Q Z;  2YSR A;  4HA8 A;  2KIU A;  4MGR A;  1GXP A;  1DDN A;  4Z2Y A;  5K5R A;  4Q48 A;  2H09 A;  1YW8 A;  4UVA A;  1J75 A;  4FX4 A;  3DKW A;  4P9U A;  3L2C A;  4M9S A;  2DU9 A;  5BMZ A;  1MJA A;  2P7V B;  3MZY A;  1SFU A;  2HZT A;  2XGX A;  3WE3 A;  1BC8 C;  1XGO A;  3FZV A;  3IWF A;  2JPB A;  2PEX A;  3RYR A;  1S7O A;  1PP7 U;  1OYI A;  5CVI A;  2Z9O A;  4IRH A;  5HS8 A;  1ZGA A;  5H6R A;  2L4M A;  4ENN A;  1F4K A;  3M1E A;  4WK8 F;  1LEB A;  6PAX A;  5D8L B;  2JPC A;  1MJB A;  2QYO A;  3TDU C;  4IRG A;  5CVV A;  1BBY A;  3KP7 A;  5JVT A;  3TO7 A;  1SMT A;  2KRF A;  4EMS A;  3W6J B;  2XVC A;  2ESN A;  1WWX A;  5K5Q A;  3FM3 A;  2G7H A;  3WE2 A;  4ZZD A;  1R1T A;  2H6B A;  1U5T B;  5F6F A;  2HKO A;  5L3B A;  2G7U A;  4A0Z A;  1ZAO A;  4EV0 A;  1RI7 A;  3BP8 A;  4HLY A;  1YW9 A;  3E5X A;  1T98 A;  4AIK A;  2NAZ A;  1FP1 D;  4L9V A;  3R4K A;  1V3F A;  5HDN A;  2XUB A;  3TOA A;  4U0V A;  2JZY A;  1W5S A;  5BQT A;  2W24 A;  2XAF A;  4UVC A;  1LQ1 A;  5HVQ C;  3TOB A;  2IP2 A;  2K27 A;  1I1S A;  5D6E A;  3RIR A;  5IT3 A;  1R22 A;  2F2E A;  4ZYG A;  4ZZL A;  2FBH A;  4HBL A;  1S6L A;  2ACJ A;  2UXX A;  5L3E A;  1HST A;  2LF8 A;  5EEH A;  4A5N A;  4L5I A;  4ETS A;  3LAJ A;  4UV9 A;  3VOE A;  1UST A;  4KNY A;  3T1B A;  3SXY A;  3QOP A;  4RB1 A;  3QPH A;  3W6K B;  3REO A;  2BYV E;  4CYD A;  2QEN A;  2Y75 A;  3E6M A;  3KZY A;  1CF7 B;  4I0A A;  3EUH A;  3I58 A;  4MEY F;  4KUM A;  4LLG F;  2VT2 A;  5ILV A;  3K0L A;  4YFX F;  3WU0 A;  1RUN A;  1KQ9 A;  1QQI A;  1EH8 A;  2XAS A;  1Z1D A;  4G7Z F;  4ESF A;  2A69 F;  3R6S A;  3T8R A;  2L02 A;  1U2W A;  2KJB A;  5LGT A;  4BQA A;  3ECO A;  2Z99 A;  1E17 A;  3KFW X;  1FSH A;  3HSR A;  1IF1 A;  1W7P A;  4FX0 A;  3LQR A;  1SD6 A;  2R7F A;  3F21 A;  1BM9 A;  1IN6 A;  2QUF A;  4P9F A;  5LHH A;  1L3L A;  4RGX A;  5HS9 A;  1Q1H A;  3FX3 A;  3QU3 A;  1YS6 A;  3TKY A;  2RGV A;  1ZGJ A;  1HSJ A;  4JK1 X;  1ZG1 A;  2H27 A;  3I4P A;  2O61 A;  1U78 A;  1S7A A;  2KIM A;  3E6B A;  4MNU A;  4P5O A;  5DV5 A;  1XMA A;  3L09 A;  4ZH4 F;  3K1M A;  1HKQ A;  5DDG A;  3I0T A;  1J7K A;  4EJO A;  4KN7 X;  2P8T A;  4KA4 A;  5E18 F;  4L0Z B;  1GVJ A;  3K9T A;  2OU2 A;  2CO5 A;  3WTW C;  4PZJ A;  2PBI A;  2PMH A;  4WCG A;  4RGR A;  2EFQ A;  2IRF G;  4L9J A;  1PUE E;  2STT A;  4R8H A;  3GW2 A;  2L01 A;  2Q2E A;  4XSX F;  1XDS A;  2OQR A;  5L3G A;  3O3K A;  2ZXJ A;  4HW0 A;  4HF2 A;  2RN7 A;  2LSO A;  1P2F A;  3Q9S A;  3RDI A;  4FHT A;  3WTX C;  2EFP A;  4A6D A;  1G3S A;  4KIG A;  1B9M A;  1MZB A;  1JXS A;  1BN5 A;  2HYF A;  2GZW A;  4HZF A;  4MHG A;  1QPM A;  2R7D A;  2ZNZ A;  4IPA A;  1D8J A;  2C6Y A;  2M45 A;  4ZYE A;  5D4R A;  1TW2 A;  2L54 A;  5DCM B;  1OR7 A;  1W7P D;  2IW5 A;  4QWQ A;  3RI4 A;  2Y0M A;  5J8F A;  3H92 A;  4U0W A;  1IRG A;  2VT3 A;  2HWV A;  3ELK A;  3LA3 A;  1GXQ A;  4D0P A;  1KU3 A;  5F1R A;  2BV6 A;  2E7W A;  1R23 A;  2EJR A;  1HW2 A;  4R79 A;  2WWY A;  1J5Y A;  4PCQ A;  1G4D A;  4IHS A;  3H3Z A;  3ABT A;  2DPD A;  2X4H A;  2P5L C;  3GUD A;  2HTJ A;  4R1H A;  3BJA A;  4IJA A;  4ON0 A;  4XLN F;  4M6Y A;  3HRT A;  3ISP A;  5E17 F;  1WRJ A;  2DK5 A;  3KE2 A;  4LGW A;  3CJN A;  2VN2 A;  4UUV A;  2A61 A;  3TQN A;  1V4R A;  3E97 A;  4GO1 A;  1PP8 F;  5FFX A;  2P4W A;  2ADU A;  1O3T A;  4CHU A;  2VBY A;  4AIH A;  4P55 A;  2KIF A;  3GFL A;  2DPU A;  1TTY A;  1T0F A;  2B0L A;  5D5V B;  2V1X A;  2UZK A;  3M9A A;  1SFE A;  3HTU A;  1FNN A;  2K02 A;  2Q0O A;  2W84 A;  1E2X A;  1XGS A;  2EFN A;  4M9Z A;  2FBK A;  1QNT A;  3J80 K;  3LA2 A;  3C3W A;  1JE8 A;  1IXS B;  3N97 A;  5JR3 A;  1IN7 A;  1UCR A;  4L18 B;  1Z7U A;  2OQG A;  1ULY A;  3CO6 C;  5LRR A;  3IWZ A;  2BBY A;  2PI0 A;  4MQV A;  4M71 A;  3JAM K;  4LFU A;  1EH7 A;  1WSU A;  3EYY A;  4EVI A;  4CO8 A;  4N9I A;  1SFX A;  2EV6 A;  3NEU A;  3F8N A;  2DW4 A;  2F5E A;  3S2W A;  2BGC A;  2IA2 A;  2CG4 A;  4EM0 B;  5DD4 A;  2K7L A;  5HS7 A;  2H94 A;  1T2K A;  4RGS A;  2XAG A;  2GXB A;  3RPU A;  3BWG A;  3LST A;  1SD4 A;  4HOB A;  3VOD A;  3ROU A;  4M72 A;  1MGT A;  5BPD A;  1J0R A;  1OPC A;  3AAF A;  1P92 A;  5AIP A;  3I54 A;  3ZMS A;  2VBZ A;  4WXH A;  1YO5 C;  1YLF A;  4GXO A;  4EGY A;  2KJC A;  1UFM A;  4Y13 A;  1QZZ A;  3B02 A;  1QO0 D;  5HDG A;  5D5W B;  3OV8 A;  4G7O F;  2A07 F;  3C1D A;  2UWM A;  1NHA A;  3B73 A;  5LBQ A;  5L3F A;  2O8X A;  1UHM A;  1C0W A;  3MFK A;  2DQR A;  4IRI A;  3RYP A;  2E1C A;  3CO7 C;  2VC0 A;  2VOP A;  1FLI A;  2V6C A;  1XGM A;  3WTS C;  5JI6 A;  2EB7 A;  4IXA A;  2XIG A;  3ZMV A;  3SZT A;  4CGZ A;  3EQL F;  4DQ2 A;  5E1W A;  1H9G A;  4XBF A;  1Z05 A;  3DPT A;  5ICG A;  3VB2 A;  3LQQ A;  1O3R A;  2V1U A;  4LLN A;  3WTT C;  5K1Y A;  1Z6T A;  2ZO4 A;  3HSE A;  1I27 A;  2QQ9 A;  4Q5S F;  3FXR A;  3GXO A;  2DTR A;  2WTE A;  1W7P B;  1H9T A;  4MEX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...