2ETHA

Crystal structure of a marr-like transcriptional regulator (tm0816) from thermotoga maritima at 2.50 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
b'HMDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVEALSRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, putative, Mar family
publication title Crystal structure of Transcriptional regulator, putative, MAR family (tm0816) from Thermotoga maritima at 2.50 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ethA00
3EDPA 4EJOA 4KYWA 5AIQA 5E17F 4M71A 4R8HA 4FHTA 5H20A 2PLYA 4I09A 4YFXF 4KMFA 1XGOA 4AVPA 4WX9A 2XGXA 2XV4S 3VEPA 5FO5A 2QM3A 1D8KA 2VT2A 2FNPA 1WRJA 2NAZA 4OIPF 3GWZA 2CWEA 1FBSA 2EFWA 1IN5A 2IVMA 5HLGA 4CGZA 1ON1A 4KUMA 1HW2A 5D4SA 3TO6A 4OMYA 1T39A 3WTYC 3ZMZA 3QAHA 2HGCA 5BOXA 2RNJA 3W6KB 2VBWA 3GW2A 3FXRA 3HSEA 4RB1A 4FX0A 5D8KB 2F5DA 2P5KA 2WV0A 3ZN1A 3AAFA 3E6CC 3TO7A 3GEZA 3FMQA 4P9FA 2UXNA 1YS7A 2JTVA 1RIOH 3KP7A 1P4AA 3G73A 2EFNA 2OBPA 1Z7UA 5HOOA 4JK1X 4ENNA 5HLIA 4G8XA 2DI3A 1S8NA 5E1WA 3F3XA 3TOBA 1YIOA 4LGWA 4HF2A 2DQRA 2VOPA 3R6SA 4JQFA 4DQ2A 4LB5A 5DD4A 5DDGA 1NHAA 3HYIA 3KP4A 2CYYA 4U0YA 4GO1A 1SFUA 3R4KA 5HVQC 5ICCA 3CUQA 4HX8A 2RVCA 2COMA 4EQQA 3DQVC 4EJUA 2V6CA 1R36A 1LDJA 2YX4A 5D5XB 4A0ZA 1GXQA 1TQPA 2PMUA 2XAJA 3FX3A 1W7PA 5K5RA 4HDVA 2H94A 4BH9A 2WTEA 1QQIA 3MWMA 2OZ6A 1YLFA 3T5XA 3F6VA 2EFQA 5A2QZ 4A5NA 2DTRA 4FT8A 1SD4A 3V4GA 3ZN0A 2Z99A 2O03A 2GA1A 5ICEA 1I1GA 2MH2A 2E1NA 2D2WA 1ZYRF 1S7OA 3FHZA 1Z91A 4RGUA 5D5VB 4IHSA 4A12A 2D45A 2GXBA 2FOKA 3HRUA 2K27A 2UWMA 4RS8A 3FF5A 1XMKA 3NQOA 1V3FA 3IWZA 4CICA 5ILVA 2PQ8A 2W57A 4H0EA 2HTSA 1VTNC 3P9CA 1Q1HA 1FY7A 2QZ8A 2GA2A 1HBXG 4M6YA 2P5VA 3CTAA 3C3WA 2QQAA 3QU3A 1RNLA 1F5TA 4HF1A 4L18B 2E7WA 2XAHA 2O8XA 1YQAA 2L4AA 3TGNA 3IWFA 2HYGD 4ETSA 2R7FA 1J59A 1TQIA 2IA2A 3MQ0A 4PZJA 2A61A 4IVNA 2QQBA 1CGPA 2A6EF 1H9TA 3TQNA 3HOSA 1ODDA 4XLPF 2DK5A 4P9UA 5LBQA 3ZPLA 2EJRA 3F8FA 2KRFA 3VODA 5DUIA 2J5OA 2ZKZA 1XGNA 3KZZA 2EFOA 4HX7A 1DPRA 1P6RA 1B59A 5E18F 3JAMZ 5ILSA 2EWNA 5J6XA 2BEOA 4I98B 4OOIA 4G6DA 1R1UA 4OIRF 1U8RA 4KNYA 1XSDA 4I2OA 3BOQA 2XROA 2BBYA 2ISYA 5E20A 2GWRA 1YG2A 3QU6A 1E17A 1ZRFA 2XHKA 4EJVA 2R3SA 1O3TA 1DP7P 2FMLA 3K69A 1UCRA 2XKOA 3BJOA 3K1MA 4M9ZA 3KLNA 4LLLA 2FRHA 3B02A 3R61A 1R7JA 2KKOA 2DAOA 1G3TA 3T1BA 3WTTC 2NNNA 2OA4A 5D5UB 4HAMA 5JI6A 2GXGA 3I5UA 3GF2A 2JZYA 4KIFA 2YPRA 4KN4X 2D1HA 1QO0D 1Y0UA 1LB2A 2FU4A 4U7BA 3BJAA 5BS6A 5TRDA 3SXYA 2FNAA 2VC1A 2P8TA 2K4JA 2E1CA 3C1DA 2K02A 1SD5A 1BOAA 4ENMA 1MGTA 2M45A 4U7DA 2RKHA 1JE8A 4M9XA 3T8RA 3F72A 1J9IA 3C7JA 4UUVA 5H6RA 1XN7A 4UHTA 3KFWX 3I59B 3KP2A 3ML6A 4I0BA 5DV5A 3H3ZA 4QLCU 1IXSB 3V7CA 4BHBA 4RAZA 1LNWA 1MD0A 1OR7A 5E8GA 1CF7B 4ZYGA 1FSHA 3L9FA 5ERIA 4WXDA 3R60A 1HKQA 1IXCA 2ESHA 1R1VA 4RGSA 2W85A 1SAXA 1JGSA 3TKYA 2DFIA 3K9TA 1TQMA 2WWYA 3WU0A 1W4MA 3CLOA 4M74A 1A04A 1R58A 1HKSA 3E6MA 3IKVA 4AIKA 2IA0A 4MHGA 2RDPA 2HOEA 4A6EA 2K7LA 1O3SA 4HOBA 4HZFA 2FBKA 1MZBA 1J2XA 1LJ9A 3HRSA 3R0JA 3COAC 3GVAA 5BQTA 1G3SA 3ZQ7A 1ZG1A 1Z1DA 1XD7A 1ZGAA 1I5ZA 4E70A 4ZZLA 4S05A 3QPHA 1FC3A 3DEUA 1P4WA 3LQRA 1V4RA 3HSFA 5DD8A 1D8JA 3KE2A 4B8XA 3MAJA 4MEYF 2RN7A 3KP3A 3V7RA 2G9WA 1USSA 4CDGA 2HTJA 5JVTA 2P7CB 4WXCA 4IPAA 4Q47A 1U78A 2GQQA 5CJ9A 1K79A 2HWVA 3BDDA 4IJAA 2IA1A 5CLSA 4ENJA 5FD6A 3LSTA 1XDUA 3KEQA 4AWXB 5DEQA 5EEGA 2CQKA 2VOOA 1T0FA 2A6HF 1U5TB 1IUYA 2VE9A 2HKOA 5E8IA 2HYFA 1KU3A 3SZPA 3ERED 2V1XA 4RB0A 3VOEA 5IT9Z 5FFXA 3PQJA 2P6SA 4Q48A 4OIQF 1TW2A 2CSOA 5JHUA 3BZ6A 4Y17A 4M6XA 4Z2YA 4Q5SF 1WKMA 4ENKA 3ZP5A 1EH7A 4K2EA 1C0WA 1STZA 4IF4A 5FFZA 3IC7A 1R23A 1RZ4A 4UV9A 2VBYA 3BWGA 1L0OC 3V8JA 1KYZA 5J8FA 3KP5A 4KFCA 2FF4A 3IKTA 3QP5A 4L9TA 2VT3A 5A2QK 1U6GA 3RKYA 3HHGA 5E1ZB 3B73A 2A3SA 1BIAA 2R7DA 3JW4A 1XCVA 2Y48A 2F5FA 2ZJ2A 5F6FA 1W5SA 3FM5A 4LLGF 1BI2A 5LLQA 3WTZA 3BROA 2BGCA 2XAQA 2FXAA 1XGSA 5K5OA 1P92A 4GXOA 1KQ8A 3DPTA 1IN7A 3WODF 4OMZA 2XAFA 2PI0A 4BHPA 2VONA 3Q9VA 5CVRA 5L3GA 3K1NA 3OV8A 1K7AA 1BBYA 2CGPA 3CUQC 3MFKA 2YX7A 1DPUA 1IN6A 4PGHA 1EV7A 3P9KA 1YTYA 1PP8F 1BJAA 2VXZA 2EB7A 1TNSA 4HYEA 2ADUA 4LLNA 1FBQA 4BXUA 2CW0F 3P7NA 1IF1A 4HQEA 5CVIA 2BE5F 3DPLC 1HW1A 1ZARA 4CXFA 4UVBA 4WK8F 2FBHA 2UZKA 5ED4A 1FOKA 3FXUA 4GCVA 3I71A 2DQLA 4G7OF 5D4RA 1XSXA 4XSXF 4NB5A 1KU7A 2W84A 4RGRA 2WC2A 3E6DA 1BI1A 3W6JB 1TW3A 3PFIA 3JSPA 3Q5FA 1XDSA 3M8EA 5LEKA 3J80K 1T6SA 2F5EA 3FWEA 2W25A 5KK1A 4A6DA 1ZRCA 4UV8A 1QNTA 1U5TA 4LJZF 1ZREA 3JAMK 3CJNA 5ICGA 1KQ9A 3BJ6A 3RYPA 1FP2A 4BYYA 2QBYB 5DUKA 1UB9A 1LEAA 4EM1A 4ESJA 1BC7C 4BHCA 1G6NA 2C6YA 3WU1B 2G7HA 3LA7A 1DDNA 1REPC 3GLXA 4UVCA 5KVRA 1EH6A 2GAUA 5FB2A 2AXLA 1TLHB 5FD5A 3GX4X 1G4DA 1FT9A 3GFMA 2ZCWA 2XAGA 3K0LA 2L3DA 4RB2C 1D3YA 4MTEA 3O6BB 2PEXA 5L3EA 2YR2A 3ECHA 5J8CA 2O61A 3RTRA 3LAJA 4ESBA 1K6OA 2XVCA 1ULYA 2FE3A 3WGGA 5HS7A 3VB2A 5F1RA 1TBXA 4M73A 1HQCA 4ZYDA 2Z5UA 3RDIA 3DKWA 4L0ZB 1TNTA 3IL2A 4CYDA 1R22A 1FP1D 2DBBA 4G6QA 3J80Z 2ZXJA 2DW4A 2EK5A 1S29A 1WI9A 3QOPA 4GGGA 5ICFA 3REOA 1OYYA 3JTGA 3FM3A 3BP8A 4CZZA 1O3RA 1J75A 3ZMTA 3WGIA 3I4PA 3PQKA 5D6EA 3NRVA 3FMRA 2H6BA 3FMSA 2KJBA 1FNNA 1WQ2A 3IHUA 2KIMA 4HV6A 4XBFA 1BN5A 3RJPA 4EGYA 3ROUA 2LF7A 4ZYEA 3KCCA 4IRGA 4BQAA 1KQ0A 2D1VA 1OYIA 3P9IA 1F4KA 1SD6A 2DK8A 3ABUA 5FGMA 1I1SA 3GZ5A 4IXAA 5AIPA 4N9HA 3HOTA 1UHWA 2FEZA 4YG2F 3V7SA 3DV8A 1IN4A 2KJCA 1PDNC 4HA8A 1OPCA 2OAZA 4KICA 1FYMA 3GZ6A 4L9VA 3OOPA 5LHIA 2HDCA 1J5YA 4AIJA 3S2WA 1RUOA 4WWCA 3CDHA 4P96A 4UVAA 2MD5A 1JHFA 5D6FA 3RI4A 2E7XA 4CHUA 3D5LA 1B9MA 3ABTA 5LRSA 3CO6C 1O57A 2LSOA 5CYVA 1AWCA 1FLIA 1B6AA 1FWZA 4LFUA 3ZMUA 4M9SA 1P2FA 3F21A 2NRAC 4EV0A 1IXRC 3DP7A 4L9JA 2Y0MA 3LA2A 2MH9A 3ISPA 1FYKA 3J81Z 3DXJF 1MDMB 4HLYA 2MC3A 2G7UA 1ZH5A 3E5UA 1HSJA 4XRFA 3F8MA 5E1XA 1SMYF 4PDKA 5CVVA 2FBIA 3L2CA 2STTA 3CUOA 1FBUA 5L3FA 2W24A 1RI7A 3R0AA 1I6XA 1FZPB 2PG4A 2RQPA 1GVJA 3I53A 4A5MA 4BAYA 2YU3A 2VC0A 1T98A 5L3BA 3MZHA 2OD5A 5HS8A 3I54A 3SZTA 2DU9A 3WTXC 5IT9K 1IZ1A 3E3VA 4KT5C 4R79A 1W7PD 2HQNA 4N0BA 3U1DA 2TDXA 3QPTA 3T8TA 2ZNZA 5HDGA 2L54A 4OU0A 2OU2A 3RIRA 1SD7A 3V8KA 4Q4ZF 2O6GE 1SFXA 4WCGA 1R5HA 3K2ZA 1BI0A 4OINF 1R00A 2H09A 4RB3C 2KIFA 3WTWC 2QYOA 1UFMA 3MCZA 4O6JA 4NQWA 3HRMA 2A68F 2M5WA 3LWFA 3WE3A 3JSOA 5FLXK 2JPBA 4YFNF 2ZBKA 4I01A 1Z6TA 3ZMVA 3G3ZA 2M8EA 3DFGA 4G9YA 1FPQA 4HLXA 4B09A 1DUXC 3F8NA 1WWXA 1W7PB 4HF0A 4ESFA 2RV8A 5EEHA 2MA3A 3L09A 2IPQX 3DF8A 3M1EA 3CO7C 4EJWA 1LDKB 4XLNF 3N4MA 2PMHA 4Y13A 2EV0A 4R1HA 5DCMB 4GYIA 1BC8C 3LAPA 1BI3A 2XKPA 2Y75A 3F22A 2HQRA 3V8LA 4O5VA 5ILUA 2ESNA 5TJJA 3BPVA 4QWQA 3RKWA 3E97A 2AS5F 2H27A 1KA8A 3F6OA 1D5VA 1MJAA 3I59A 3KP6A 4FX4A 2LNBA 2CO5A 2JRTA 3HUGA 3IRQA 2HS5A 3H3UA 2VBXA 2IJLA 2ETHA 5DCFA 1MDMA 1CF7A 1YFHA 5LRRA 1ZLKA 3QP6A 2EV5A 3BPXA 2HZTA 3HSRA 1F9NA 1SFEA 3KLOA 5AONA 1XGMA 5FLXZ 2L01A 3HIFA 2F5CA 1IRFA 3MEXA 6PAXA 4L0YB 5K1YA 4BNCA 1KU9A 3EYYA 4JBAA 2MBFA 1Z9CA 1O7FA 3GUDA 1Z6RA 2X0LA 3WTUC 3GFIA 2LF8A 2M87A 4EJTA 4UNOA 3E5XA 4AIHA 1ON2A 3E5QA 3L7WA 4G7HF 4MTDA 1YS6A 2VE8A 1HXDA 1G3WA 1QPMA 3M9AA 1W5TA 2QLZA 1S3JA 1OYWA 2HFHA 5L3CA 1KU2A 2A07F 4XSZF 2RGVA 1Z05A 1JHHA 4L9NA 3TO9A 5D5WB 4I0AA 5CVUA 3SHFA 5JFRA 3GYHX 4EM2A 3I0TA 3TDZC 2L4MA 2O3FA 1ZG5A 1B4AA 2X4HA 2OQRA 1GHCA 2Z3YA 1HSTA 2PBIA 4RGXA 3NEUA 2DPUA 2QENA 1RUNA 3VFZA 4KN7X 1G3YA 4A0YA 2XIGA 1B1BA 4N9IA 4D0PA 2ACJA 1HKTA 1T38A 5D8LB 2QVOA 5LHGA 1U5TC 1J0RA 2NYXA 4MGRA 1K78B 3FXQA 2JSCA 3WTVC 3RPUA 5DCMA 1LQ1A 4ON0A 2HKXA 4YFKF 3I64A 1ZRDA 3F8BA 1KGSA 4LG0B 3N97A 1EH8A 2OZUA 5HLHA 1WSUA 3WE2A 2FA5A 2FMYA 4EGZA 2P6TA 1ZGJA 3LA3A 4LK0F 4AD9A 1FX7A 1MJBA 1QZZA 2P4WA 3HHHA 3F8CA 2ZFWA 5BMZA 3LQQA 1LVAA 3M8FA 1XCBA 2MLGA 5DYMA 2CG4A 1YW8A 2NNYA 1YW9A 2VBZA 1MJ9A 3H92A 1TTYA 3L00A 2IT0A 3D0SA 4IRIA 3F23A 5LEJA 2PFBA 1IRGA 2Z9OA 4LK1F 2PN6A 4NHJA 1U3EM 2V1UA 5IT3A 1O3QA 3ELKA 3J7AO 4ZZDA 3GFJA 1LDDA 4MNUA 4L5IA 2QQ9A 3FZVA 3EQLF 3EYIA 2J5PA 3WGHA 1QGPA 2EA2A 1JXSA 3RKXA 1QZYA 2GIVA 4LMYA 3KEOA 4G94A 4U88A 5L3DA 5HDNA 2ZO4A 4UXNA 4Y15A 2MLKA 2P7VB 1FYLA 3ZMDA 3ULQB 2OQGA 1AOYA 4RAYA 2GZWA 4HV5A 2ZMEB 2M30A 3RYRA 4A0XA 3EETA 4M72A 1MKMA 3J81K 4P5OA 4LB6B 4LD5A 4YIFA 2Z33A 2IRFG 1J7KA 2Q0OA 2PJPA 4EMSA 4EVIA 4HX4A 1L3LA 2BV6A 1S7AA 2K86A 3C18A 2JPCA 4DNCA 3RPQA 4HBLA 2A5YB 4G7ZF 4I7HA 2DPDA 2A69F 5BPDA 1B9NA 2H6CA 2B0LA 4KA4A 2HR3A 2K4BA 2Q2EA 1K78A 4U0WA 3QRFF 1FSEA 3T0YA 3MZYA 1UHMA 1IAWA 3GO5A 4KDPA 5LHHA 2DLLA 2EA4A 4O3MA 4LG0A 4TV7A 1IW7F 1PP7U 2NS0A 1ZHFA 2QBYA 1T2KA 3ZMSA 4L5JA 5F64A 1OKRA 2DO7A 3TDUC 4GYGA 4MQ9F 2BYVE 3BY6A 3O2PE 2FQ3A 2EFPA 4A2UA 2ELHA 1I27A 4I02A 1YYVA 1HW5A 2KIUA 1X3UA 5CVJA 1KYWA 4MEXF 4PCQA 1U2WA 4IHTA 1ZG3A 2IP2A 4KIGA 1XSVA 1XMAA 2V9VA 1BIBA 3TOAA 3GFLA 5JR3A 1ZAOA 4PGGA 3SFZA 4ZH4F 4WXHA 4HDUA 2O0YA 4KIBA 2XRNA 2F2EA 2QUFA 2CFXA 2LKPA 3O3KA 2YSRA 1P4XA 2JT1A 2XUBA 2LDUA 3ECOA 2L02A 1OMIA 1ONVA 5BPIA 1QBJA 1O7LA 5K5QA 3Q9SA 1H9GA 4IRHA 4MQVA 2Q8KA 4KMUX 2ISZA 1BM9A 4P55A 4WF2A 1F1ZA 5LGNA 4S04A 3WG9A 1USTA 2ZNYA 1XB4A 2STWA 3E6BA 2M1BA 2VODA 3K1PA 1R5GA 2DT5A 1E2XA 1LEBA 2FSWA 2IW5A 1S6LA 4CO8A 1GXPA 4F7ZA 3WTSC 2RC4A 2V79A 3IRRA 1SMTA 1IN8A 4OIOF 2ZMEA 3M7GA 3U9GA 3GXOA 3KZYA 3JTHA 3KETA 4HW0A 1YW7A 4U0VA 2XASA 1R1TA 3CUQB 1H0MA 2HEOA 4EM0B 2UXXA 5HS9A 5LGUA 3LFKA 5HDKA 3U2RA 5LGTA 2VN2A 1PUEE 1ZLJA 4YIIA 2EV6A 5H6QA 1ZN2A 4ASNA 2QWWA 4HQMA 3EUHA 1YO5C 2V1DA 3HTSB 3HRTA 3SQNA 3I58A 3HTUA 4ZYHA 2P5LC
chains in the Genus database with same CATH superfamily
2EZKA 3EDPA 3VYSB 4EJOA 1W36C 2KLOA 4KYWA 4EATA 3BTCA 2BW3A 2XF6A 5AIQA 1D0YA 3GTQJ 5E17F 4FQGA 4M71A 4FE4A 4R8HA 1RC9A 4FHTA 5H20A 1MBJA 3SEZA 3K4BA 3BG6A 2H1KA 3GTGJ 2LLKA 2PLYA 4I09A 1JJ8C 2E36A 4YFXF 2DA6A 4KMFA 1XGOA 2EPFA 1IO2A 4XM3A 4NUBA 4AVPA 4XICA 2LR8A 3D5RC 3HB9A 5B5EC 1EJ9A 4WX9A 2CU7A 2XGXA 2DYRH 2UUZA 2XV4S 3VEPA 2LTPA 1S72I 5FO5A 3V42A 3PIOF 3L2WA 4DZPA 2QM3A 4CCLA 1D8KA 2VT2A 3S1NJ 4XLHA 2FNPA 1WRJA 3U1KA 2M0MA 2KPMA 4Y4RA 2NAZA 5KAIC 4OIPF 3GWZA 2CWEA 4PFOA 3OY9A 1FBSA 5FLVA 3CCUI 2EFWA 3BTIA 1IN5A 2IVMA 1BR4A 5HLGA 2FJ1A 4CGZA 1ON1A 2V9KA 4KUMA 1HW2A 2Y31A 5D4SA 2NVTJ 3TO6A 1R4NB 4OMYA 1T39A 2ME0A 3H9QA 3WTYC 3ZMZA 1OCCH 3QAHA 2HGCA 1K4SA 1DGRM 4BDZA 4BDYA 2IS6A 5F1JA 1S9HA 5BOXA 2VIXA 2F4OB 2RNJA 1G2HA 2Y0SN 3W6KB 3KYDB 2VBWA 3GW2A 4JOMA 1WJAA 3FXRA 3A01B 1V54H 3W6VA 3FKJA 3HSEA 4RB1A 4FX0A 5D8KB 3LSJA 4OWRB 2F5DA 4A3MJ 2YU9J 2P5KA 2WV0A 3ZN1A 3AAFA 3E6CC 3TO7A 3GEZA 3FMQA 4P9FA 2UXNA 2GXAA 3QYFA 1YS7A 4PJ0C 1B8IA 2JTVA 3CCEI 1RIOH 3FXMA 3H36A 3KP7A 1P4AA 3RSNA 1X1DA 3G73A 2VKDA 3OYCA 2EFNA 2DA4A 2OBPA 2E2HJ 1Z7UA 3OL4A 3H0DA 2ZXWH 3FHNA 5HOOA 2OUMA 1UG2A 1X4OA 4ZDPA 4JK1X 4ENNA 2LG4A 5HLIA 2XPWA 4G8XA 2DI3A 1S8NA 5E1WA 2EQRA 2JK3A 3F3XA 3HG9A 3TBIA 3TOBA 4A3EJ 1O4XA 1YIOA 4LGWA 1EF4A 1W0UA 4BKXA 4HF2A 2V7FA 3TW7A 2DQRA 2VOPA 3BZCA 5CQEA 3K10A 3R6SA 5FKNA 5F04A 4JQFA 2DXIA 4DQ2A 5E79C 1Y8RB 2MYSA 2IAIA 5DD4A 4LB5A 5DDGA 1NHAA 3HYIA 3RCOA 3KP4A 1X1BA 1ACIA 2CYYA 1EKEA 2K9MA 2CMPA 4U0YA 3H9JA 2KFDA 4GO1A 2HXOA 1SFUA 3R4KA 5HVQC 5ICCA 3CUQA 4HX8A 2RVCA 3QWLA 4M6VA 3JRGA 2COMA 4EQQA 2ZB9A 3DQVC 4EJUA 2V6CA 2DFFA 1R36A 2JN6A 3OIOA 3LNQA 1LDJA 1T33A 1ZR4A 2YX4A 2MGQA 5D5XB 3AG1H 4A0ZA 1GXQA 1TQPA 2PMUA 2XAJA 3QODA 2DOAA 3FX3A 2VASA 3ZQIA 1W7PA 5K5RA 2DMPA 2CJJA 4HDVA 2MSYA 1UHSA 2H94A 3K4NA 4BH9A 4DYCA 3BC8A 3TP3A 3IUOA 2WTEA 1Y39A 1QQIA 5K7HA 3MWMA 2OZ6A 1YLFA 3T5XA 3OYKA 3F6VA 2EFQA 3JRDA 5IOZA 5A2QZ 3CJRB 4A5NA 2DTRA 4FT8A 1SD4A 3V4GA 3ZN0A 1D0XA 2A05A 2YUSA 2FQ4A 3BG9A 3VWBA 4UY8I 2Z99A 4ABZA 1TL8A 5E3NA 1LUJB 2O03A 2R7UA 3MKWB 2GA1A 4JX4A 2CV2A 3ZQFA 5ICEA 1I1GA 2MH2A 2E1NA 3KYLA 3BR5A 2D2WA 1ZYRF 1S7OA 4JX5A 2CFOA 1VFCA 3AG2H 3FHZA 1Y8QB 1LE8A 1Z91A 4RGUA 5FKLA 5D5VB 2GM4A 4D5FA 4GDFA 3LSHA 4IHSA 4A12A 2D45A 2GXBA 3AFHA 2IGOA 1R4MB 2FOKA 3HRUA 2DTZA 2K27A 2UWMA 4ANJA 4RS8A 5E3LA 4A69C 5EYRA 3FF5A 2OCCH 2K40A 1XMKA 4IOCF 3NQOA 1V3FA 3IWZA 2CW8A 3D5SC 4XQFA 4CICA 5ILVA 3S3MA 1TWFJ 2HZDA 1DGWY 1WVRA 2PQ8A 2W57A 4H0EA 1A6IA 3GTKJ 2HTSA 4IHYA 1VTNC 3P9CA 1BA5A 1Q1HA 1FY7A 2QZ8A 1WJCA 2GA2A 2VB6A 1HBXG 5FLMJ 4M6YA 3S3OA 2HDDA 2Y69H 2P5VA 3CTAA 2CS3A 3C3WA 2QQAA 1E3PA 1JUPA 1ZK8A 3QU3A 1RNLA 3Q3SA 2R5YB 1F5TA 2HOTA 4HF1A 3ERMA 2XB5A 4LIVA 4L18B 3BG7A 4J19A 2E7WA 2XAHA 4I99C 4UB8C 2O8XA 1SFKA 1YQAA 2L4AA 2VKHA 3TGNA 3IWFA 2X6WA 4QPQA 2HYGD 4ETSA 2R7FA 1J59A 2CUEA 1TQIA 2L5QA 2KT0A 1YHQI 2IA2A 3MQ0A 4PZJA 5JVGF 2A61A 4IVNA 5J47A 2QQBA 3O8GA 1CGPA 4NBQA 3HXLA 2A6EF 1H9TA 4NC7A 1NTCA 3TQNA 3BG3A 3HOSA 1ODDA 2DMNA 4XLPF 2OF7A 1SVLA 2DK5A 2QQ8A 4XORA 4XLCA 4XL9A 4P9UA 5LBQA 3ZPLA 2EJRA 3F8FA 4CCMA 1FTZA 5HODA 2KRFA 3VODA 5DUIA 2J5OA 2ZKZA 1XGNA 1MMSA 3KZZA 1VQ9I 2EFOA 4HX7A 2VPRA 1DPRA 1P6RA 3HZJA 2R7ZJ 1B59A 5E18F 3K7AJ 4U87A 2Y30A 3JAMZ 5ILSA 2EWNA 4HRIA 5J6XA 2BEOA 3H0GJ 4ZJZA 4I98B 3ZOBA 4OOIA 1LFBA 1ETOA 4G6DA 2QSGX 1R1UA 4OIRF 5IOYA 1U8RA 4KNYA 3CMMA 1TT5B 1XSDA 2K9NA 1IRXA 2E5NA 2XB0X 4DBQA 4I2OA 3CJQB 3BOQA 2XROA 2BBYA 2ISYA 5E20A 2GWRA 4BJ6C 1YG2A 3QU6A 3NAUA 1E17A 3HOUJ 1ZRFA 2XHKA 2QGUA 4EJVA 2LVSA 2R3SA 1O3TA 3LSIA 2F4MB 4H4KC 1W36D 2X9DA 3ZQQA 1DP7P 2R7QA 3DU6A 1WCMJ 2FMLA 2E19A 2RQQA 3K69A 1A5JA 3K4KA 1OCTC 1UCRA 2XKOA 3BJOA 3RQ4A 3M1CA 3K1MA 1YRNA 4M9ZA 3OYIA 4DIQA 3KLNA 4LLLA 4E7SA 3K4JA 5C3EJ 2WBMA 1MMDA 2FRHA 3B02A 3R61A 3JRIA 4IO9F 1R7JA 2KKOA 1GV2A 3KX2A 2DAOA 3M4OJ 2CQQA 5J1YA 1G3TA 3T1BA 3WTTC 2NNNA 4XR6A 2OA4A 3PO2J 5D5UB 4HAMA 5JI6A 2GXGA 3I5UA 1Z21A 2JZYA 3GF2A 3S8PA 2DA2A 5FKOA 3L2VA 5CPRB 2XDVA 4KIFA 2YPRA 4KN4X 4BY7J 2O7OA 2LY2A 2D1HA 1QO0D 2FOWA 1Y0UA 1LB2A 4BS9A 2FU4A 2LD5A 4U7BA 1HF0A 3BJAA 3DBRB 5BS6A 2E71A 1EA3A 5TRDA 3S1QJ 3SXYA 2FNAA 2VC1A 3OR1C 3PNYA 2P8TA 3FXKA 2K4JA 4BQOA 3MN2A 1K61A 2E1CA 3C1DA 2M0CA 2K02A 1SD5A 1BOAA 4ENMA 1MGTA 2M45A 2F5VA 4P1WA 4U7DA 2JUGA 4XOPA 2RKHA 1JE8A 2W00A 4M9XA 2QKLB 3T8RA 1AU7A 3F72A 1J9IA 1IDYA 3ASOH 3C7JA 3HPGA 3LFUA 4UUVA 5H6RA 4YIRX 1XN7A 1B72B 4UHTA 1X19A 3KFWX 3OSGA 2R7OA 3I59B 1A36A 2LY9A 3KP2A 3ML6A 5J4YA 1OQYA 4I0BA 3B6AA 2GOMA 2HYJA 5DV5A 3H3ZA 3LSRA 3IH3A 1JUMA 4QLCU 1WPKA 1IXSB 3CMYA 4CYCA 2LOOA 1GDTA 2DA5A 2KDOA 3V7CA 5E3MA 4OAZA 4NNJA 2H8WA 3IAS2 4RAZA 4BHBA 1LNWA 1MD0A 1SAUA 1OR7A 3PJRA 5E8GA 1CF7B 4ZYGA 1FSHA 1BR1A 3FK7A 4AIDA 2VJ5A 3QPSA 3L9FA 5ERIA 4WXDA 3OS0A 1QVTA 3R60A 2Y9ZA 3OIQA 1HKQA 1IXCA 3VDXA 2ESHA 1R1VA 4RGSA 1RETA 2W85A 1SAXA 1JGSA 3TKYA 2DFIA 3K9TA 1TQMA 2WWYA 3H5NA 3WU0A 2L9NA 3OOUA 1VQMI 1W4MA 2CUFA 3CLOA 4F55A 1XPXA 4BJ5C 4FASD 4M74A 1A04A 1UAAA 1VQPI 1R58A 1HKSA 3E6MA 1VQLI 3IKVA 4AIKA 2M7AA 2IA0A 1FIAA 2DDBA 4MHGA 2RDPA 5M5YJ 2HOEA 2XC7A 2OJED 4A6EA 3SJMA 2K7LA 1O3SA 2F6CA 3CMEI 4HOBA 4HZFA 2FBKA 1MZBA 2DODA 1J2XA 1LJ9A 2WAFA 1YJWI 1N75A 3HRSA 4HPQA 3R0JA 4BACA 4L5EA 3CZ6A 3COAC 2ZMEC 1ERDA 4BQQA 3GVAA 5BQTA 3C2HA 4M3FA 1G3SA 3CCQI 4RM2A 2X1CA 3ZQ7A 2ZJPF 1ZG1A 5FRMA 9ANTA 3LL7A 1Z1DA 3G1OA 3KEYA 3AL0C 3K4CA 3M3YJ 1GVDA 1X1AA 1XD7A 3DTKA 5CKTA 1ZGAA 1I5ZA 4E70A 4ZZLA 1LKXA 1ETQA 1V5GA 4BUPA 3H3VK 4ZC3A 4W1UA 4S05A 4A3LJ 3QPHA 1FC3A 4F93B 2R7WA 4YELA 3RZDJ 2A6TA 3DEUA 1P4WA 1I6HJ 3RPUD 4AVZA 1H88C 3LQRA 1HDDC 1FTTA 3OYFA 1NH3A 5JLWA 4PSWA 2CV1A 1PYVA 1V4RA 4NDLA 2ZJQF 4JYKA 5J3LA 3S93A 4D9JA 2BVMA 2VL8A 1OCOH 3HSFA 3I4NJ 5DD8A 1D8JA 2Z1DA 2ECBA 3KE2A 2VQLA 1QZEA 3QQAA 4B8XA 4DGWB 3CCJI 2LKXA 3MAJA 4MEYF 4XKBA 3BQYA 2G0EA 2RN7A 3KP3A 3IV5A 3V7RA 2LH9A 2G9WA 1USSA 4Z6YA 4FTHA 4CDGA 1WH5A 2EIMH 1WJEA 1P9QC 2HTJA 3HPHA 3K4LA 4JP0A 4WXCA 5JVTA 5EGOB 4IPAA 2P7CB 4Q47A 5EJCA 1CQTA 1U78A 2KDZA 1DU6A 2GQQA 5CJ9A 1K79A 3JRCA 2HWVA 2M8GX 3GZNB 3BDDA 2IS1A 4IJAA 1KONA 5EEAA 3FBIB 2IA1A 2W82A 1BR2A 5CLSA 4BU2A 2WAQA 4ENJA 5FD6A 3LSTA 3OYHA 1VQOI 3S14J 1XDUA 3KEQA 4HSTA 4AWXB 3Q0UA 1ZQ3P 5DEQA 5EEGA 3ZCOA 3HM5A 2CQKA 4XRSA 3CD6I 4BGDA 1OLTA 2VOOA 1T0FA 3SDGA 1FOYA 2A6HF 3HL2A 1U5TB 1IUYA 2VE9A 2HKOA 5GP9A 1FOWA 1OFCX 5E8IA 5KCMA 2HYFA 1KU3A 3SZPA 3CC2I 2LRDA 3ERED 3FBNB 4F3QA 2V1XA 4RB0A 3VOEA 2PJRA 1Z77A 5IT9Z 5FFXA 3PQJA 2P6SA 4Q48A 3OYLA 4OIQF 1TW2A 2CSOA 5JHUA 4I76A 1FEXA 3TP0A 3BZ6A 3CC7I 4Y17A 1RRJA 4M6XA 2JJ7A 4Z2YA 2V4JC 4Q5SF 3BR0A 1WKMA 1VNDA 4ENKA 2LP0A 2Q1ZB 2PX9A 2M4KA 2XPUA 3FXLA 3ZP5A 1EH7A 2XAUA 5F0CA 3CCYA 3GBGA 4K2EA 1C0WA 1F36A 1W5CC 1STZA 4IF4A 5FFZA 3IC7A 1R23A 1RZ4A 4UV9A 1XC5A 2VBYA 3BWGA 1L0OC 3V8JA 1KYZA 1Y1WJ 3P5JA 4XKCA 2WY8Q 5J8FA 4FETA 1Y1VJ 1JKQC 3KP5A 2LFBA 4G12A 4KFCA 2FF4A 5EZHA 3IKTA 2H1LA 2DJIA 2AQEA 3QP5A 4L9TA 2BY0A 2VT3A 5A2QK 1U6GA 3RKYA 3E7LA 4D7NA 1Y56A 2DCEA 3IH2A 3CF5F 3HHGA 5E1ZB 2ZSIB 3IAM2 2E1MB 3B73A 2CRGA 2A3SA 4BEHA 1BIAA 2R7DA 2IBDA 3JW4A 3S2HJ 1XCVA 2Y48A 4I6ZA 4RBOA 2F5FA 2Z2SB 2ZJ2A 1K4TA 1ETWA 2B63J 5F6FA 2QSFX 1OCZH 1W5SA 3FM5A 4LLGF 3DWLE 1BI2A 2LY1A 5LLQA 4G6TB 2BY2A 4A93J 1BOBA 2HOSA 3WTZA 3BROA 2X1EA 3S17J 2BGCA 4XRSG 3HEFA 2XAQA 4B1RA 1YITI 3OYAA 2FXAA 1UMQA 2OPTA 2I8DA 4W97A 1XGSA 5K5OA 1P92A 4GXOA 2EH3A 5HNHA 1JKOC 2CQ7A 4ITVA 1KQ8A 3DPTA 1IN7A 3WODF 4DW6A 4OMZA 2XAFA 2PI0A 4BHPA 2VONA 1D1BA 3Q9VA 5CVRA 5L3GA 5H2FC 3K1NA 3BG5A 3OV8A 1BBYA 3FXOA 1K7AA 2KRCA 2V9PA 2CGPA 1X4PA 3CC4I 5KHDA 2MC4A 2E34A 3CUQC 4KJZA 1MNEA 1NK3P 3MFKA 2YX7A 1I39A 1DPUA 1R71A 3HOWJ 3DLLF 1IN6A 4PGHA 5FKKA 2R4GA 1EV7A 3P9KA 1YTYA 3S16J 4GFBA 1PP8F 4MIMA 2LBFB 1BJAA 2VXZA 1UELB 5EF6A 2EB7A 1TNSA 2LK2A 1QA6A 4HYEA 1Q1VA 2DDAA 2ADUA 2UV1A 4LLNA 1FBQA 4BXUA 3BR6A 4BJTA 2JQ7A 2CW0F 1WHUA 1WJDA 3P7NA 1IF1A 4HQEA 2EZIA 5CVIA 2BE5F 1MMGA 3DPLC 1HW1A 1ZARA 2IGNA 3UR3C 4BE0A 4CXFA 4UVBA 3FISA 4WK8F 2FBHA 1FOXA 4UB6C 2UZKA 5B66C 5ED4A 1FOKA 1FIPA 3FXUA 2HXIA 4GCVA 3DLAA 4A3KJ 3I71A 2OTLI 2DQLA 4XIDA 4G7OF 4X1EA 5D4RA 5EG0A 1XSXA 4HEA2 4XSXF 4NB5A 5EGOA 2V26A 5TISC 1KU7A 2Z16A 2W84A 4RGRA 2WC2A 3E6DA 1BI1A 3W6JB 5JHFA 3DBLB 5C44J 1ZTRA 1TW3A 1LFPA 3PFIA 1OCRH 2VJ4A 3JSPA 2CQNA 3Q5FA 3UNGC 2KHMA 4C9YA 1XDSA 4BY1J 1TWCJ 2Q2EB 3M8EA 3WHBA 2K5CA 3JRHA 2OC6A 5LEKA 3J80K 1T6SA 2F5EA 1GUUA 2W25A 1WGXA 2BVLA 2JVHA 3FWEA 5KK1A 4RAFA 1IV6A 4A6DA 1ZRCA 1IDZA 4UV8A 1BJZA 1QNTA 1A31A 1MBEA 1U5TA 4LJZF 3UKGA 3VYRB 3ZRGA 2HVQA 1ZREA 3JAMK 2KISA 3CJNA 2HU9A 1ORKA 5ICGA 1KQ9A 2L9VA 3BJ6A 3RYPA 1X3WB 1TZLA 1FP2A 1SC7A 4BYYA 2QBYB 5DUKA 1UB9A 1LEAA 3ZGKA 4LOCA 4EM1A 4ESJA 1BC7C 4BHCA 1G6NA 3ZQGA 3HDDA 2C6YA 3WU1B 3E0JB 2G7HA 3HOZJ 2KRHA 3BR1A 2DJNA 3LA7A 4M3GA 1N77A 2R7SA 1DDNA 1REPC 3SYTA 2FX0A 2R7RA 1QHGA 2XGCA 2HVSA 3GLXA 4UVCA 5KVRA 1HCRA 1EH6A 2GAUA 3CP8A 2AXLA 5GAEJ 5FB2A 2IS2A 1TLHB 5FD5A 4IZZA 5B1BH 3GX4X 1G8XA 1G4DA 1FT9A 3GFMA 2ZCWA 2Y9YA 2XAGA 3K0LA 3ESWB 1AKHB 2L3DA 5FROA 3CF2A 4RB2C 4CCOA 1D3YA 2IS4A 4MTEA 3PIPF 3O6BB 2EIJH 2PEXA 5L3EA 4E7IA 2YR2A 2GLOA 3ECHA 1JT6A 5J8CA 1LFUP 2O61A 3CDLA 3D1NI 3RTRA 3A01A 3LOCA 3LAJA 4ESBA 4IX7A 1K6OA 3HBLA 2E5ZA 2R92J 4V2FA 2XVCA 2ID3A 1ULYA 2K3PA 3X2QH 2FE3A 1JI8A 2PMZA 2VQCA 3OR2C 3WGGA 5HS7A 4QPOA 4LIUA 2NVQJ 3VB2A 5F1RA 1VZ0A 1TBXA 4S0HB 4M73A 1HQCA 2I5UA 1U9NA 3MVPA 3NWTA 4ZYDA 1NG6A 2Z5UA 1QHHD 1MBGA 3RDIA 5C4XJ 3DKWA 4L0ZB 4HNUA 3S32A 4BL0B 2BY1A 4CCKA 2EZLA 1TNTA 5K7FA 2XGEA 3IL2A 3G71I 2JA8J 4CYDA 1R22A 2CW7A 1FP1D 2DBBA 1RKWA 2GIZA 3A1YA 4G6QA 1MSEC 3OYBA 3J80Z 1YX5A 2ZXJA 2DW4A 4X6AJ 4CH7A 4XNFA 2EK5A 2ZJRF 1IRZA 3CCLI 1S29A 1WI9A 2IEKA 3QOPA 4GGGA 5ICFA 3REOA 1IC8A 1OYYA 3JTGA 3Q0WA 4C30A 3FM3A 3BP8A 4QTRA 4CZZA 1O3RA 1J75A 3W2WA 3ZMTA 1YI2I 1P7IA 3ZXSA 3WGIA 1TP4A 3I4PA 5J40A 3EPZA 3PQKA 5D6EA 3OMYA 3OSFA 2LYCA 4V19K 2KP6A 3CCVI 3NRVA 3FMRA 1PVEA 2H6BA 2X51A 3FMSA 4PJNA 3G6EI 2KJBA 1IUFA 1FNNA 1WQ2A 3IHUA 2KIMA 1RR7A 4HV6A 4XBFA 1BN5A 2L7MP 1PUFB 4PJMA 3RJPA 2LBFA 3A0HC 4XLFA 4EGYA 1SVOA 3ROUA 2LF7A 3K4MA 2JA2A 2M2EA 3KCCA 4ZYEA 2F48A 3GTLJ 4IRGA 4NQWB 1E3HA 3CDIA 2X1DA 4NC6A 3HGGA 3AG3H 4BQAA 1KQ0A 2D1VA 3PL8A 1PJRA 1ZR2A 1OYIA 3P9IA 4B47A 4CSWA 3BZKA 4D7MA 1X1PA 1F4KA 2AHQA 1SD6A 2DK8A 3ABUA 2P0WA 5FGMA 5K7ZA 2HPMA 2AQFA 2WAEA 1I1SA 3GZ5A 2QEXI 1MBKA 2JVGA 4IXAA 3CCSI 2K9QA 4FISA 5AIPA 1GT0C 3GCMA 1T8IA 2HDWA 4N9HA 1UHWA 4Y3OA 2K85A 2NVUB 3HOTA 2FEZA 4YG2F 1BW6A 5FKMA 4MFDA 3V7SA 3NARA 3DV8A 4RA2A 4ZYAA 2L9RA 1IN4A 2KJCA 1PDNC 4DZJA 4AU7A 2XSDC 3CQZJ 4HA8A 1OPCA 3GTPJ 2OAZA 3LSMA 4KICA 5F27A 1FYMA 3GZ6A 4L9VA 3OOPA 1T56A 5LHIA 2HDCA 1J5YA 3KYCB 1SEUA 4AIJA 1JGGA 4FCYA 3S2WA 2KMUA 1RUOA 3I56I 2VI6A 3HC7A 2E2JJ 4WWCA 4PJLA 2EBIA 3CDHA 4P96A 4UVAA 4PJJA 1IGNA 2MD5A 1I3QJ 2JWTA 1E0EA 1JHFA 2YS9A 2OTJI 1YE9A 3U21A 5D6FA 4IOAF 3RI4A 2K3FA 2E7XA 3W3CA 3D5LA 4CHUA 2P81A 3HKZA 3K2AA 1B9MA 1FMWA 2FUG2 3ABTA 5LRSA 2DOEA 2X6YA 1NG7A 4Y33A 1SANA 4FE7A 3CO6C 1O57A 2LSOA 1P7JA 5CYVA 3NWSA 1M1EB 2MW8A 1AWCA 1FLIA 4XKWA 4A3IJ 1B6AA 2OV7A 1FWZA 3QYEA 4LFUA 3BQZA 3ZMUA 4M9SA 1P2FA 3F21A 2NRAC 4NC8A 4EV0A 3SFIA 1IXRC 2E1OA 3DP7A 1OR7C 4L9JA 3SDBA 2Y0MA 4A3CJ 2R7XA 3HUGB 3LA2A 2MH9A 2ICWG 3ISPA 3HOXJ 4C3HJ 4A3DJ 3VSKA 1FYKA 2VQGA 3AKZA 3SEQA 5LFAA 3J81Z 1V5FA 3DXJF 1VQ6I 1MDMB 1UZCA 4HLYA 2H8RA 1DQUA 2MC3A 2G7UA 2BHYA 3BCBA 1ZH5A 2XF7A 3E5UA 1HSJA 4C3IJ 3S2DJ 3ABKH 3W2VA 2R5YA 4XRFA 5DS9A 3F8MA 3N05A 1JTXA 5E1XA 1MNMC 2HQAA 1R6RA 1SMYF 4PDKA 5CVVA 1R9TJ 2FBIA 3L2CA 2STTA 3CUOA 2M3AA 1FBUA 3OYDA 5L3FA 1D1AA 2W7NA 2W24A 3Q0VA 1RI7A 3JCUC 3KZIC 3H9GA 3R0AA 1DP3A 1I6XA 1FZPB 2JA7J 2VPLA 2PG4A 2RQPA 1GVJA 3I53A 1U9OA 4A5MA 2X85A 4BAYA 2YU3A 3MKZA 3GTOJ 2VC0A 2ZC2A 1ETXA 3H5AA 1RESA 4CCNA 2BZTA 1T98A 5L3BA 3MZHA 2OD5A 3OL3A 5HS8A 3I54A 1G59A 1RPWA 3SZTA 2DU9A 4IEJA 3WTXC 3QYBA 5IT9K 1IZ1A 3B6CA 2BXZA 3DU5A 1U0JA 2ECCA 1D0ZA 3DTIA 3E3VA 4KT5C 5DM6F 1VQ5I 4R79A 3A0BC 1W7PD 2HQNA 1GLNA 3OIPA 4N0BA 3U1DA 5F0HA 3OYMA 2TDXA 3QPTA 4UUSB 2DA3A 2ZNZA 5HDGA 3T8TA 2L54A 4OU0A 2BOLA 4AUXA 2OU2A 3RIRA 2DT6A 5LD2C 1SD7A 3S15J 3V8KA 4Q4ZF 2ELJA 3CESA 2O6GE 1SFXA 2N8GA 4WCGA 1R5HA 2GOXB 4N4NB 4DJAA 5KNLA 5IYDJ 3K2ZA 2HI3A 2K9SA 5J1RA 1OISA 3CCMI 1BI0A 1VQ8I 1W1WE 4OINF 1R00A 2H09A 4XONA 3PFYA 4E6KG 4RB3C 2KIFA 3WTWC 2QYOA 4A3GJ 1WJ5A 1UFMA 3H1CA 4M3DA 1YOVB 1DU0A 3MCZA 4O6JA 3LSGA 2W1OA 2I10A 4V2GA 5TGTA 4B48A 4NQWA 3HRMA 2A68F 2M5WA 4MFEA 3LWFA 1X3ZB 2HQ5A 3WE3A 3JSOA 5FLXK 2JPBA 3LSPA 4YFNF 1D5YA 2ZBKA 4I01A 4XKVA 1Z6TA 3PNTA 3ZMVA 5HLTA 3G3ZA 4E7ZA 2M8EA 2QKMB 2OCEA 1FMVA 3I3LA 3HGYA 1QRYA 3DFGA 3K70C 4J00A 1R49A 4G9YA 1FPQA 4HLXA 4B09A 1DUXC 2WAQN 3F8NA 5IP7J 1WWXA 1W7PB 4HF0A 4ESFA 2RV8A 1XTAA 3FKIJ 1YJNI 2R7VA 1T0FC 5EEHA 2MA3A 3G2BA 3L09A 2IPQX 1Z3XA 2TRTA 2BY3A 2DMUA 3DF8A 3M1EA 5J4VA 3CO7C 4EJWA 4AYBN 2ZXHA 1LDKB 4XLNF 3N4MA 1Z0XA 2PMHA 4Y13A 2EV0A 4R1HA 5DCMB 4GYIA 1BC8C 1VQ7I 1I50J 3LAPA 2XSJC 3JRAA 4AYBA 2DFHA 1BI3A 2QA4I 1GV5A 2BXYA 2XKPA 2Y75A 4LG3A 3JR9A 3F22A 2HQRA 5M3MJ 3OYEA 3V8LA 5IP9J 4O5VA 1UG0A 3VYTB 1JT0A 4XLAA 2O5RA 5ILUA 2ESNA 5TJJA 3BPVA 4QWQA 2ID6A 3PM1A 2NS7A 3RKWA 2CH0A 3E97A 2AS5F 2IGKA 1ENHA 2E2IJ 3S1MJ 1LE8B 2H27A 4HNVA 1KA8A 3MZ8A 3F6OA 2VKVA 2VJIA 5EDNA 1D5VA 4Y7NJ 3H5RA 2LKSA 3CLQA 4QIWN 1B72A 1MJAA 3ZQLA 1WFXA 4F92B 3I59A 3KP6A 2R5ZB 1JKRC 4FX4A 3M07A 2LNBA 2CO5A 1YIJI 1X2NA 2EILH 2JRTA 3HUGA 1IG7A 4C2UA 1TT0A 5FJ8J 3IRQA 2XGDA 2HS5A 2VJJA 4HNTA 3KIOA 2VUMJ 3E1SA 3H3UA 2VBXA 2IJLA 2ETHA 5DCFA 1MMAA 1MDMA 4X0GA 1CF7A 1YFHA 5LRRA 1ZLKA 3QP6A 2EV5A 3BPXA 3DEEA 2HZTA 1TC3C 3HSRA 1S7EA 2MD0A 1F9NA 1SFEA 2LC2A 3KLOA 1XGMA 5AONA 2DN0A 4C3JJ 5FLXZ 2L01A 3HIFA 2JRMA 3BCAA 2F5CA 1IRFA 3G1LA 3MEXA 5GPAA 6PAXA 1Y6IA 4XK4A 1WH7A 3RQIA 5GPCA 4RDUA 4L0YB 5K1YA 1QPIA 4BNCA 2HVRA 3GTJJ 3OS2A 1KU9A 3EYYA 2Y0SA 4RM3A 4JBAA 2MBFA 2WV1A 4A3BJ 1D1CA 1BL0A 1Z9CA 3ABLH 1O7FA 1YX3A 3GUDA 1Z6RA 2X0LA 4RMNA 3WTUC 3GFIA 2LF8A 1ETYA 2M87A 2DMQA 1Y0NA 4EJTA 4UNOA 3E5XA 4PSXA 4ZDLA 4AIHA 1ON2A 3E5QA 3L7WA 4G7HF 4MTDA 1YS6A 2AXTC 2MG4A 1JKPC 5M3FJ 2VE8A 1HXDA 1G3WA 3W2AA 1QPMA 1KZHA 3M9AA 5HNFA 4ZDOA 3WU2C 1W5TA 5B1AH 2O9LA 2QLZA 1S3JA 1OYWA 2HFHA 3CCRI 4UUSA 2A5WA 2L7KA 5L3CA 3BR3A 4PK4A 4Y52J 1KU2A 2A07F 2B9SA 2COBA 4XSZF 5JLXA 2CUJA 4UUTA 2RGVA 1MIJA 5CQGA 1Z05A 2RREA 2HNHA 1JHHA 1UJ8A 4DYQA 4L9NA 2RAEA 3TO9A 1W0TA 5D5WB 1NK2P 4I0AA 5CVUA 4D5CA 3SHFA 2X6XA 3BTJA 5JFRA 3GYHX 4EM2A 3I0TA 3TDZC 2L4MA 2O3FA 3OYJA 2ZXIA 1B4AA 1ZG5A 4B3AA 2X4HA 2OQRA 1GHCA 2Z3YA 1H8AC 1XMXA 1MMNA 4LITA 3C2GA 1HSTA 4DYRA 2PBIA 4XN3A 4RGXA 2L7ZA 3NEUA 2DPUA 1ZKGA 2CQXA 2QENA 1HA8A 1RUNA 3VFZA 5FRNA 1BW5A 1A35A 1T95A 3A03A 3F9KA 2MFZA 3J7AY 4KN7X 1G3YA 2JMWA 1YRNB 2JA6J 5BNGA 2KZGA 4EEFG 4A0YA 2XIGA 1SVMA 2L9SA 1B1BA 4N9IA 4D0PA 4XMYA 4B4CA 2ACJA 3OWTA 1HKTA 1IJWC 1T38A 5D8LB 2QVOA 5LHGA 1U5TC 1J0RA 2NYXA 4YEJA 4MGRA 1K78B 3VPRA 1ZELA 3BT9A 5GTHC 3FXQA 2JSCA 2B7EA 3QOEA 3WTVC 4MO7A 3LMMA 4RLQA 1A6QA 3RPUA 1VQKI 5DCMA 1V55H 1LQ1A 3PO3J 1JTYA 4ON0A 1I3AA 2HKXA 4YFKF 3I64A 1ZRDA 2EIKH 1TWAJ 4QSHA 3F8BA 1KGSA 4LG0B 3N97A 1EH8A 1V5EA 3FK6A 2DFEA 2OZUA 1JUSA 2Y2ZA 2ME6A 5GAGJ 5HLHA 1WSUA 3WE2A 2FA5A 2FMYA 2DYSH 4EGZA 2P6TA 1ZGJA 3LA3A 1ITYA 1WI3A 4LK0F 4AD9A 1FX7A 1ETKA 3HJEA 3TW6A 3JRBA 5IP6A 1MJBA 2KZVA 2M4GA 1QZZA 2P4WA 3HHHA 3F8CA 2ZFWA 5BMZA 3IP4B 3LQQA 1LVAA 3M8FA 4DOZA 1XCBA 2MLGA 5DYMA 2R5ZA 2CG4A 2WB1N 1YW8A 4GRIA 3WG7H 3L2RA 2NNYA 1YW9A 2VBZA 1MJ9A 2X6OA 2JUCA 4KISA 4N4OB 3H92A 2LREA 1TTYA 3L00A 4KITB 3LSKA 2WB1A 2IT0A 2WADA 3D0SA 3ABMH 2PMZN 3HOYJ 4IRIA 3F23A 5LEJA 2E1MC 4CYCB 2PFBA 1IRGA 2Z9OA 1AHDP 4LK1F 2JSPA 2FD5A 1RKTA 4E7LA 2XF5A 2X48A 2PN6A 4NHJA 3ZQHA 1U3EM 2V1UA 2L7FP 5IT3A 1XS9A 1O3QA 3ELKA 3PUFA 3J7AO 4ZZDA 2DA7A 4XLEA 1N25A 3GFJA 4XN0A 2E60A 1LDDA 4ZTJA 4MNUA 1Z3YA 3BR2A 4L5IA 2QQ9A 3FZVA 3EQLF 1VQ4I 3EYIA 2AO9A 1LPQA 1X2MA 4BQNA 2J5PA 3WGHA 3A2KA 1QGPA 2EA2A 1JXSA 1QVUA 2ZSHB 3RKXA 2BHZA 3DBHB 3JRFA 1QZYA 3A02A 3WHCA 2RNGA 2GIVA 1FJLA 1K83J 1ETVA 4LMYA 3KEOA 4G94A 4U88A 1HOMA 4XOTA 5L3DA 5HDNA 2ZO4A 4UXNA 4Y15A 2E35A 2MLKA 1JJ6C 2P7VB 1FYLA 3ZMDA 1OCPA 3ULQB 3J7YJ 2OQGA 4C2TA 2M7BA 2NS8A 1AOYA 4RAYA 2GZWA 4HV5A 3M8JA 3MKLA 4E7KA 2ZMEB 2VXDA 2R7TA 1OJLA 1T08B 2M30A 3RYRA 4A0XA 3EETA 2DA1A 4M72A 1MKMA 3L2UA 1WJBA 3K70D 4IHWA 3J81K 1X58A 4P5OA 5IPAA 3AL0B 4LB6B 4LD5A 4YIFA 2Z33A 4CA0A 2IRFG 1J7KA 2NOGA 2Q0OA 3ZR8X 2PJPA 4RLFA 4IKFA 3MD2A 4II3A 4EMSA 2WA0A 4EVIA 4HX4A 2NOJB 1X1CA 3L2QA 3VSLA 2K9LA 1ZGWA 3PNVA 2BV6A 1L3LA 3IH4A 1S7AA 5M5XJ 2K86A 3C18A 2JPCA 3ASNH 2ZFUA 4DNCA 2QF7A 1AA7A 3RPQA 4HBLA 2A5YB 2CUZA 4I7HA 4G7ZF 2V1NA 3TMOA 4CUGA 4B43A 1RR8C 2DPDA 2A69F 5BPDA 1B9NA 1S5LC 2KL4A 3I4MJ 5M5WJ 4XRMA 3GLLA 4ZTFA 2H6CA 2B0LA 5DTDA 1U8BA 3I9V2 5DM7F 3OYGA 4KA4A 2HR3A 4B3XA 2K4BA 2L0KA 4KT6A 2Q2EA 1QU3A 3KPHA 3RZOJ 2JA5J 1K78A 3O8HA 2W4SA 4AC0A 5C4JJ 5J1UA 3BLYA 4U0WA 3HKZN 3QRFF 4CCJA 2VLAA 1FSEA 3T0YA 2HOAA 3MZYA 2IXSA 4CZCA 1UHMA 2BW3B 1IAWA 2CV0A 3GO5A 1MBHA 4KDPA 5LHHA 2DLLA 3PUBA 1HC8A 2EA4A 4O3MA 3FIWA 5IYCJ 4LG0A 4TV7A 1IW7F 4JX6A 1PP7U 2NS0A 1ZHFA 2QBYA 3G1MA 1T2KA 2WY7Q 3DTEA 1H89C 1XX5A 3ZMSA 1VF9A 4L5JA 5F64A 1HLVA 1OKRA 2DO7A 2XPVA 4BBRJ 1HDPA 2PJRB 3TDUC 3DEWA 4GYGA 4MQ9F 2BYVE 3BY6A 4E7JA 3O2PE 2FQ3A 4B44A 2EFPA 5EZGA 4A2UA 2ELHA 1I27A 4I02A 1VQNI 1YYVA 2L2OA 1HW5A 5KAFC 5GTIC 2KIUA 1X3UA 1MH4A 5CVJA 1KYWA 1APLC 4MEXF 4PCQA 2F4IA 1U2WA 4IHTA 1ZG3A 2IP2A 4KIGA 1F43A 1XSVA 1Z7LA 1AKHA 1XMAA 2V9VA 1BIBA 3TOAA 3GFLA 5JR3A 3QPLA 1VI0A 1ZAOA 4HSRA 3SZGA 5GADJ 4M3EA 2NVYJ 4PFPA 1J09A 4PGGA 4E7HA 3SFZA 2O0YA 4WXHA 4ZH4F 4HDUA 4KIBA 4D1QA 2XRNA 3FXJA 2F2EA 2QUFA 2CFXA 1E3OC 2R93J 1XG1A 2LKPA 4BBSJ 3O3KA 4J01A 2YSRA 1P4XA 2JT1A 1MW7A 2XUBA 2LDUA 3ECOA 2KIQA 3FDYA 2ELKA 3ONQA 2L02A 1OMIA 1ONVA 3DPUA 5BPIA 4OAYA 1QBJA 4BE2A 1O7LA 1TWGJ 3BTLA 4IHXA 3K6GA 1IV8A 2IGMA 4F91B 4AM3A 1MSFC 3EUAA 5IY5H 3I55I 5K5QA 3OS1A 3Q9SA 1H9GA 2EINH 4IRHA 4MQVA 2Q8KA 3J7ZI 4KMUX 2ISZA 1BM9A 4BEHB 5B3SH 4P55A 4II2A 5F0FA 4YRVA 4BE1A 1B8IB 4WF2A 1F1ZA 5LGNA 4S04A 4HG2A 2NVXJ 4IQ4A 2DOFA 3DKYA 2DT7B 3WG9A 3TEDA 2V6EA 1USTA 2ZNYA 1XB4A 3ZQCA 3E6BA 2STWA 2M1BA 3DKXA 2QSHX 2HPIA 2R0QC 2W48A 2VODA 1K6YA 4IQJA 3K1PA 1R5GA 2NXNB 2DT5A 3AG4H 2D5VA 1E2XA 3GTMJ 2XRLA 1LEBA 2O8KA 2FSWA 2IW5A 1S6LA 2QCOA 4CO8A 3MKYB 1TWHJ 4A3JJ 1GXPA 4F7ZA 3WTSC 2RC4A 4PUSA 5E3OA 2V79A 2TCTA 3C2BA 1YJ9I 3IRRA 1SMTA 1IN8A 2M34A 4OIOF 4MLOA 2ZMEA 1PUFA 3HOVJ 2M9HA 3M7GA 3U9GA 1MH3A 3GXOA 1Z67A 1MNDA 3CJTB 4BXFA 3KZYA 4DBRA 3JREA 3JTHA 3KETA 4HW0A 1YW7A 4IHVA 4BXXJ 3DCFA 4F52A 3CP2A 3CMAI 3VYUB 4U0VA 1WJFA 4A3FJ 2XASA 1R1TA 3G4SI 3CUQB 5IYBJ 1H0MA 2VKEA 3S1RJ 2HEOA 4EM0B 2UXXA 5HS9A 2GBYA 2EZHA 3OYNA 5LGUA 1R5ID 1LVKA 3LFKA 5HDKA 1N78A 3RKQA 3U2RA 5F08A 1WZ2A 3PSFA 5LGTA 2VN2A 1PUEE 3EUHC 1MBFA 1SFOJ 1ZLJA 2DMTA 4YIIA 3A4CA 2LMDA 1POGA 2EV6A 5H6QA 1ZN2A 2VQHA 4RAGA 4ASNA 2QWWA 4HQMA 3S3NA 3EUHA 5GAHJ 3L1PA 2V1DA 3F0CA 3GMEA 1YO5C 3HTSB 3HRTA 4IL6C 4M3BA 5EG0B 3PSIA 2MABA 3MMYB 3SQNA 4C2MJ 3I58A 3EUKL 2KQRA 3HTUA 3H35A 4ZYHA 3TL4X 4E4HA 2P5LC
chains in the Genus database with same CATH topology
3EDPA 4EJOA 4KYWA 5AIQA 5E17F 4M71A 4R8HA 4FHTA 5H20A 2PLYA 4I09A 4YFXF 4KMFA 1XGOA 4AVPA 4WX9A 2XGXA 2XV4S 3VEPA 5FO5A 2QM3A 1D8KA 2VT2A 2FNPA 1WRJA 2NAZA 4OIPF 3GWZA 2CWEA 1FBSA 2EFWA 1IN5A 2IVMA 5HLGA 4CGZA 1ON1A 4KUMA 1HW2A 5D4SA 3TO6A 4OMYA 1T39A 3WTYC 3ZMZA 3QAHA 2HGCA 5BOXA 2RNJA 3W6KB 2VBWA 3GW2A 3FXRA 3HSEA 4RB1A 4FX0A 5D8KB 2F5DA 2P5KA 2WV0A 3ZN1A 3AAFA 3E6CC 3TO7A 3GEZA 3FMQA 4P9FA 2UXNA 1YS7A 2JTVA 1RIOH 3KP7A 1P4AA 3G73A 2EFNA 2OBPA 1Z7UA 5HOOA 4JK1X 4ENNA 5HLIA 4G8XA 2DI3A 1S8NA 5E1WA 3F3XA 3TOBA 1YIOA 4LGWA 4HF2A 2DQRA 2VOPA 3R6SA 4JQFA 4DQ2A 4LB5A 5DD4A 5DDGA 1NHAA 3HYIA 3KP4A 2CYYA 4U0YA 4GO1A 1SFUA 3R4KA 5HVQC 5ICCA 3CUQA 4HX8A 2RVCA 2COMA 4EQQA 3DQVC 4EJUA 2V6CA 1R36A 1LDJA 2YX4A 5D5XB 4A0ZA 1GXQA 1TQPA 2PMUA 2XAJA 3FX3A 1W7PA 5K5RA 4HDVA 2H94A 4BH9A 2WTEA 1QQIA 3MWMA 2OZ6A 1YLFA 3T5XA 3F6VA 2EFQA 5A2QZ 4A5NA 2DTRA 4FT8A 1SD4A 3V4GA 3ZN0A 2Z99A 2O03A 2GA1A 5ICEA 1I1GA 2MH2A 2E1NA 2D2WA 1ZYRF 1S7OA 3FHZA 1Z91A 4RGUA 5D5VB 4IHSA 4A12A 2D45A 2GXBA 2FOKA 3HRUA 2K27A 2UWMA 4RS8A 3FF5A 1XMKA 3NQOA 1V3FA 3IWZA 4CICA 5ILVA 2PQ8A 2W57A 4H0EA 2HTSA 1VTNC 3P9CA 1Q1HA 1FY7A 2QZ8A 2GA2A 1HBXG 4M6YA 2P5VA 3CTAA 3C3WA 2QQAA 3QU3A 1RNLA 1F5TA 4HF1A 4L18B 2E7WA 2XAHA 2O8XA 1YQAA 2L4AA 3TGNA 3IWFA 2HYGD 4ETSA 2R7FA 1J59A 1TQIA 2IA2A 3MQ0A 4PZJA 2A61A 4IVNA 2QQBA 1CGPA 2A6EF 1H9TA 3TQNA 3HOSA 1ODDA 4XLPF 2DK5A 4P9UA 5LBQA 3ZPLA 2EJRA 3F8FA 2KRFA 3VODA 5DUIA 2J5OA 2ZKZA 1XGNA 3KZZA 2EFOA 4HX7A 1DPRA 1P6RA 1B59A 5E18F 3JAMZ 5ILSA 2EWNA 5J6XA 2BEOA 4I98B 4OOIA 4G6DA 1R1UA 4OIRF 1U8RA 4KNYA 1XSDA 4I2OA 3BOQA 2XROA 2BBYA 2ISYA 5E20A 2GWRA 1YG2A 3QU6A 1E17A 1ZRFA 2XHKA 4EJVA 2R3SA 1O3TA 1DP7P 2FMLA 3K69A 1UCRA 2XKOA 3BJOA 3K1MA 4M9ZA 3KLNA 4LLLA 2FRHA 3B02A 3R61A 1R7JA 2KKOA 2DAOA 1G3TA 3T1BA 3WTTC 2NNNA 2OA4A 5D5UB 4HAMA 5JI6A 2GXGA 3I5UA 3GF2A 2JZYA 4KIFA 2YPRA 4KN4X 2D1HA 1QO0D 1Y0UA 1LB2A 2FU4A 4U7BA 3BJAA 5BS6A 5TRDA 3SXYA 2FNAA 2VC1A 2P8TA 2K4JA 2E1CA 3C1DA 2K02A 1SD5A 1BOAA 4ENMA 1MGTA 2M45A 4U7DA 2RKHA 1JE8A 4M9XA 3T8RA 3F72A 1J9IA 3C7JA 4UUVA 5H6RA 1XN7A 4UHTA 3KFWX 3I59B 3KP2A 3ML6A 4I0BA 5DV5A 3H3ZA 4QLCU 1IXSB 3V7CA 4BHBA 4RAZA 1LNWA 1MD0A 1OR7A 5E8GA 1CF7B 4ZYGA 1FSHA 3L9FA 5ERIA 4WXDA 3R60A 1HKQA 1IXCA 2ESHA 1R1VA 4RGSA 2W85A 1SAXA 1JGSA 3TKYA 2DFIA 3K9TA 1TQMA 2WWYA 3WU0A 1W4MA 3CLOA 4M74A 1A04A 1R58A 1HKSA 3E6MA 3IKVA 4AIKA 2IA0A 4MHGA 2RDPA 2HOEA 4A6EA 2K7LA 1O3SA 4HOBA 4HZFA 2FBKA 1MZBA 1J2XA 1LJ9A 3HRSA 3R0JA 3COAC 3GVAA 5BQTA 1G3SA 3ZQ7A 1ZG1A 1Z1DA 1XD7A 1ZGAA 1I5ZA 4E70A 4ZZLA 4S05A 3QPHA 1FC3A 3DEUA 1P4WA 3LQRA 1V4RA 3HSFA 5DD8A 1D8JA 3KE2A 4B8XA 3MAJA 4MEYF 2RN7A 3KP3A 3V7RA 2G9WA 1USSA 4CDGA 2HTJA 5JVTA 2P7CB 4WXCA 4IPAA 4Q47A 1U78A 2GQQA 5CJ9A 1K79A 2HWVA 3BDDA 4IJAA 2IA1A 5CLSA 4ENJA 5FD6A 3LSTA 1XDUA 3KEQA 4AWXB 5DEQA 5EEGA 2CQKA 2VOOA 1T0FA 2A6HF 1U5TB 1IUYA 2VE9A 2HKOA 5E8IA 2HYFA 1KU3A 3SZPA 3ERED 2V1XA 4RB0A 3VOEA 5IT9Z 5FFXA 3PQJA 2P6SA 4Q48A 4OIQF 1TW2A 2CSOA 5JHUA 3BZ6A 4Y17A 4M6XA 4Z2YA 4Q5SF 1WKMA 4ENKA 3ZP5A 1EH7A 4K2EA 1C0WA 1STZA 4IF4A 5FFZA 3IC7A 1R23A 1RZ4A 4UV9A 2VBYA 3BWGA 1L0OC 3V8JA 1KYZA 5J8FA 3KP5A 4KFCA 2FF4A 3IKTA 3QP5A 4L9TA 2VT3A 5A2QK 1U6GA 3RKYA 3HHGA 5E1ZB 3B73A 2A3SA 1BIAA 2R7DA 3JW4A 1XCVA 2Y48A 2F5FA 2ZJ2A 5F6FA 1W5SA 3FM5A 4LLGF 1BI2A 5LLQA 3WTZA 3BROA 2BGCA 2XAQA 2FXAA 1XGSA 5K5OA 1P92A 4GXOA 1KQ8A 3DPTA 1IN7A 3WODF 4OMZA 2XAFA 2PI0A 4BHPA 2VONA 3Q9VA 5CVRA 5L3GA 3K1NA 3OV8A 1K7AA 1BBYA 2CGPA 3CUQC 3MFKA 2YX7A 1DPUA 1IN6A 4PGHA 1EV7A 3P9KA 1YTYA 1PP8F 1BJAA 2VXZA 2EB7A 1TNSA 4HYEA 2ADUA 4LLNA 1FBQA 4BXUA 2CW0F 3P7NA 1IF1A 4HQEA 5CVIA 2BE5F 3DPLC 1HW1A 1ZARA 4CXFA 4UVBA 4WK8F 2FBHA 2UZKA 5ED4A 1FOKA 3FXUA 4GCVA 3I71A 2DQLA 4G7OF 5D4RA 1XSXA 4XSXF 4NB5A 1KU7A 2W84A 4RGRA 2WC2A 3E6DA 1BI1A 3W6JB 1TW3A 3PFIA 3JSPA 3Q5FA 1XDSA 3M8EA 5LEKA 3J80K 1T6SA 2F5EA 3FWEA 2W25A 5KK1A 4A6DA 1ZRCA 4UV8A 1QNTA 1U5TA 4LJZF 1ZREA 3JAMK 3CJNA 5ICGA 1KQ9A 3BJ6A 3RYPA 1FP2A 4BYYA 2QBYB 5DUKA 1UB9A 1LEAA 4EM1A 4ESJA 1BC7C 4BHCA 1G6NA 2C6YA 3WU1B 2G7HA 3LA7A 1DDNA 1REPC 3GLXA 4UVCA 5KVRA 1EH6A 2GAUA 5FB2A 2AXLA 1TLHB 5FD5A 3GX4X 1G4DA 1FT9A 3GFMA 2ZCWA 2XAGA 3K0LA 2L3DA 4RB2C 1D3YA 4MTEA 3O6BB 2PEXA 5L3EA 2YR2A 3ECHA 5J8CA 2O61A 3RTRA 3LAJA 4ESBA 1K6OA 2XVCA 1ULYA 2FE3A 3WGGA 5HS7A 3VB2A 5F1RA 1TBXA 4M73A 1HQCA 4ZYDA 2Z5UA 3RDIA 3DKWA 4L0ZB 1TNTA 3IL2A 4CYDA 1R22A 1FP1D 2DBBA 4G6QA 3J80Z 2ZXJA 2DW4A 2EK5A 1S29A 1WI9A 3QOPA 4GGGA 5ICFA 3REOA 1OYYA 3JTGA 3FM3A 3BP8A 4CZZA 1O3RA 1J75A 3ZMTA 3WGIA 3I4PA 3PQKA 5D6EA 3NRVA 3FMRA 2H6BA 3FMSA 2KJBA 1FNNA 1WQ2A 3IHUA 2KIMA 4HV6A 4XBFA 1BN5A 3RJPA 4EGYA 3ROUA 2LF7A 4ZYEA 3KCCA 4IRGA 4BQAA 1KQ0A 2D1VA 1OYIA 3P9IA 1F4KA 1SD6A 2DK8A 3ABUA 5FGMA 1I1SA 3GZ5A 4IXAA 5AIPA 4N9HA 3HOTA 1UHWA 2FEZA 4YG2F 3V7SA 3DV8A 1IN4A 2KJCA 1PDNC 4HA8A 1OPCA 2OAZA 4KICA 1FYMA 3GZ6A 4L9VA 3OOPA 5LHIA 2HDCA 1J5YA 4AIJA 3S2WA 1RUOA 4WWCA 3CDHA 4P96A 4UVAA 2MD5A 1JHFA 5D6FA 3RI4A 2E7XA 4CHUA 3D5LA 1B9MA 3ABTA 5LRSA 3CO6C 1O57A 2LSOA 5CYVA 1AWCA 1FLIA 1B6AA 1FWZA 4LFUA 3ZMUA 4M9SA 1P2FA 3F21A 2NRAC 4EV0A 1IXRC 3DP7A 4L9JA 2Y0MA 3LA2A 2MH9A 3ISPA 1FYKA 3J81Z 3DXJF 1MDMB 4HLYA 2MC3A 2G7UA 1ZH5A 3E5UA 1HSJA 4XRFA 3F8MA 5E1XA 1SMYF 4PDKA 5CVVA 2FBIA 3L2CA 2STTA 3CUOA 1FBUA 5L3FA 2W24A 1RI7A 3R0AA 1I6XA 1FZPB 2PG4A 2RQPA 1GVJA 3I53A 4A5MA 4BAYA 2YU3A 2VC0A 1T98A 5L3BA 3MZHA 2OD5A 5HS8A 3I54A 3SZTA 2DU9A 3WTXC 5IT9K 1IZ1A 3E3VA 4KT5C 4R79A 1W7PD 2HQNA 4N0BA 3U1DA 2TDXA 3QPTA 3T8TA 2ZNZA 5HDGA 2L54A 4OU0A 2OU2A 3RIRA 1SD7A 3V8KA 4Q4ZF 2O6GE 1SFXA 4WCGA 1R5HA 3K2ZA 1BI0A 4OINF 1R00A 2H09A 4RB3C 2KIFA 3WTWC 2QYOA 1UFMA 3MCZA 4O6JA 4NQWA 3HRMA 2A68F 2M5WA 3LWFA 3WE3A 3JSOA 5FLXK 2JPBA 4YFNF 2ZBKA 4I01A 1Z6TA 3ZMVA 3G3ZA 2M8EA 3DFGA 4G9YA 1FPQA 4HLXA 4B09A 1DUXC 3F8NA 1WWXA 1W7PB 4HF0A 4ESFA 2RV8A 5EEHA 2MA3A 3L09A 2IPQX 3DF8A 3M1EA 3CO7C 4EJWA 1LDKB 4XLNF 3N4MA 2PMHA 4Y13A 2EV0A 4R1HA 5DCMB 4GYIA 1BC8C 3LAPA 1BI3A 2XKPA 2Y75A 3F22A 2HQRA 3V8LA 4O5VA 5ILUA 2ESNA 5TJJA 3BPVA 4QWQA 3RKWA 3E97A 2AS5F 2H27A 1KA8A 3F6OA 1D5VA 1MJAA 3I59A 3KP6A 4FX4A 2LNBA 2CO5A 2JRTA 3HUGA 3IRQA 2HS5A 3H3UA 2VBXA 2IJLA 2ETHA 5DCFA 1MDMA 1CF7A 1YFHA 5LRRA 1ZLKA 3QP6A 2EV5A 3BPXA 2HZTA 3HSRA 1F9NA 1SFEA 3KLOA 5AONA 1XGMA 5FLXZ 2L01A 3HIFA 2F5CA 1IRFA 3MEXA 6PAXA 4L0YB 5K1YA 4BNCA 1KU9A 3EYYA 4JBAA 2MBFA 1Z9CA 1O7FA 3GUDA 1Z6RA 2X0LA 3WTUC 3GFIA 2LF8A 2M87A 4EJTA 4UNOA 3E5XA 4AIHA 1ON2A 3E5QA 3L7WA 4G7HF 4MTDA 1YS6A 2VE8A 1HXDA 1G3WA 1QPMA 3M9AA 1W5TA 2QLZA 1S3JA 1OYWA 2HFHA 5L3CA 1KU2A 2A07F 4XSZF 2RGVA 1Z05A 1JHHA 4L9NA 3TO9A 5D5WB 4I0AA 5CVUA 3SHFA 5JFRA 3GYHX 4EM2A 3I0TA 3TDZC 2L4MA 2O3FA 1ZG5A 1B4AA 2X4HA 2OQRA 1GHCA 2Z3YA 1HSTA 2PBIA 4RGXA 3NEUA 2DPUA 2QENA 1RUNA 3VFZA 4KN7X 1G3YA 4A0YA 2XIGA 1B1BA 4N9IA 4D0PA 2ACJA 1HKTA 1T38A 5D8LB 2QVOA 5LHGA 1U5TC 1J0RA 2NYXA 4MGRA 1K78B 3FXQA 2JSCA 3WTVC 3RPUA 5DCMA 1LQ1A 4ON0A 2HKXA 4YFKF 3I64A 1ZRDA 3F8BA 1KGSA 4LG0B 3N97A 1EH8A 2OZUA 5HLHA 1WSUA 3WE2A 2FA5A 2FMYA 4EGZA 2P6TA 1ZGJA 3LA3A 4LK0F 4AD9A 1FX7A 1MJBA 1QZZA 2P4WA 3HHHA 3F8CA 2ZFWA 5BMZA 3LQQA 1LVAA 3M8FA 1XCBA 2MLGA 5DYMA 2CG4A 1YW8A 2NNYA 1YW9A 2VBZA 1MJ9A 3H92A 1TTYA 3L00A 2IT0A 3D0SA 4IRIA 3F23A 5LEJA 2PFBA 1IRGA 2Z9OA 4LK1F 2PN6A 4NHJA 1U3EM 2V1UA 5IT3A 1O3QA 3ELKA 3J7AO 4ZZDA 3GFJA 1LDDA 4MNUA 4L5IA 2QQ9A 3FZVA 3EQLF 3EYIA 2J5PA 3WGHA 1QGPA 2EA2A 1JXSA 3RKXA 1QZYA 2GIVA 4LMYA 3KEOA 4G94A 4U88A 5L3DA 5HDNA 2ZO4A 4UXNA 4Y15A 2MLKA 2P7VB 1FYLA 3ZMDA 3ULQB 2OQGA 1AOYA 4RAYA 2GZWA 4HV5A 2ZMEB 2M30A 3RYRA 4A0XA 3EETA 4M72A 1MKMA 3J81K 4P5OA 4LB6B 4LD5A 4YIFA 2Z33A 2IRFG 1J7KA 2Q0OA 2PJPA 4EMSA 4EVIA 4HX4A 1L3LA 2BV6A 1S7AA 2K86A 3C18A 2JPCA 4DNCA 3RPQA 4HBLA 2A5YB 4G7ZF 4I7HA 2DPDA 2A69F 5BPDA 1B9NA 2H6CA 2B0LA 4KA4A 2HR3A 2K4BA 2Q2EA 1K78A 4U0WA 3QRFF 1FSEA 3T0YA 3MZYA 1UHMA 1IAWA 3GO5A 4KDPA 5LHHA 2DLLA 2EA4A 4O3MA 4LG0A 4TV7A 1IW7F 1PP7U 2NS0A 1ZHFA 2QBYA 1T2KA 3ZMSA 4L5JA 5F64A 1OKRA 2DO7A 3TDUC 4GYGA 4MQ9F 2BYVE 3BY6A 3O2PE 2FQ3A 2EFPA 4A2UA 2ELHA 1I27A 4I02A 1YYVA 1HW5A 2KIUA 1X3UA 5CVJA 1KYWA 4MEXF 4PCQA 1U2WA 4IHTA 1ZG3A 2IP2A 4KIGA 1XSVA 1XMAA 2V9VA 1BIBA 3TOAA 3GFLA 5JR3A 1ZAOA 4PGGA 3SFZA 4ZH4F 4WXHA 4HDUA 2O0YA 4KIBA 2XRNA 2F2EA 2QUFA 2CFXA 2LKPA 3O3KA 2YSRA 1P4XA 2JT1A 2XUBA 2LDUA 3ECOA 2L02A 1OMIA 1ONVA 5BPIA 1QBJA 1O7LA 5K5QA 3Q9SA 1H9GA 4IRHA 4MQVA 2Q8KA 4KMUX 2ISZA 1BM9A 4P55A 4WF2A 1F1ZA 5LGNA 4S04A 3WG9A 1USTA 2ZNYA 1XB4A 2STWA 3E6BA 2M1BA 2VODA 3K1PA 1R5GA 2DT5A 1E2XA 1LEBA 2FSWA 2IW5A 1S6LA 4CO8A 1GXPA 4F7ZA 3WTSC 2RC4A 2V79A 3IRRA 1SMTA 1IN8A 4OIOF 2ZMEA 3M7GA 3U9GA 3GXOA 3KZYA 3JTHA 3KETA 4HW0A 1YW7A 4U0VA 2XASA 1R1TA 3CUQB 1H0MA 2HEOA 4EM0B 2UXXA 5HS9A 5LGUA 3LFKA 5HDKA 3U2RA 5LGTA 2VN2A 1PUEE 1ZLJA 4YIIA 2EV6A 5H6QA 1ZN2A 4ASNA 2QWWA 4HQMA 3EUHA 1YO5C 2V1DA 3HTSB 3HRTA 3SQNA 3I58A 3HTUA 4ZYHA 2P5LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDP A;  4EJO A;  4KYW A;  5AIQ A;  5E17 F;  4M71 A;  4R8H A;  4FHT A;  5H20 A;  2PLY A;  4I09 A;  4YFX F;  4KMF A;  1XGO A;  4AVP A;  4WX9 A;  2XGX A;  2XV4 S;  3VEP A;  5FO5 A;  2QM3 A;  1D8K A;  2VT2 A;  2FNP A;  1WRJ A;  2NAZ A;  4OIP F;  3GWZ A;  2CWE A;  1FBS A;  2EFW A;  1IN5 A;  2IVM A;  5HLG A;  4CGZ A;  1ON1 A;  4KUM A;  1HW2 A;  5D4S A;  3TO6 A;  4OMY A;  1T39 A;  3WTY C;  3ZMZ A;  3QAH A;  2HGC A;  5BOX A;  2RNJ A;  3W6K B;  2VBW A;  3GW2 A;  3FXR A;  3HSE A;  4RB1 A;  4FX0 A;  5D8K B;  2F5D A;  2P5K A;  2WV0 A;  3ZN1 A;  3AAF A;  3E6C C;  3TO7 A;  3GEZ A;  3FMQ A;  4P9F A;  2UXN A;  1YS7 A;  2JTV A;  1RIO H;  3KP7 A;  1P4A A;  3G73 A;  2EFN A;  2OBP A;  1Z7U A;  5HOO A;  4JK1 X;  4ENN A;  5HLI A;  4G8X A;  2DI3 A;  1S8N A;  5E1W A;  3F3X A;  3TOB A;  1YIO A;  4LGW A;  4HF2 A;  2DQR A;  2VOP A;  3R6S A;  4JQF A;  4DQ2 A;  4LB5 A;  5DD4 A;  5DDG A;  1NHA A;  3HYI A;  3KP4 A;  2CYY A;  4U0Y A;  4GO1 A;  1SFU A;  3R4K A;  5HVQ C;  5ICC A;  3CUQ A;  4HX8 A;  2RVC A;  2COM A;  4EQQ A;  3DQV C;  4EJU A;  2V6C A;  1R36 A;  1LDJ A;  2YX4 A;  5D5X B;  4A0Z A;  1GXQ A;  1TQP A;  2PMU A;  2XAJ A;  3FX3 A;  1W7P A;  5K5R A;  4HDV A;  2H94 A;  4BH9 A;  2WTE A;  1QQI A;  3MWM A;  2OZ6 A;  1YLF A;  3T5X A;  3F6V A;  2EFQ A;  5A2Q Z;  4A5N A;  2DTR A;  4FT8 A;  1SD4 A;  3V4G A;  3ZN0 A;  2Z99 A;  2O03 A;  2GA1 A;  5ICE A;  1I1G A;  2MH2 A;  2E1N A;  2D2W A;  1ZYR F;  1S7O A;  3FHZ A;  1Z91 A;  4RGU A;  5D5V B;  4IHS A;  4A12 A;  2D45 A;  2GXB A;  2FOK A;  3HRU A;  2K27 A;  2UWM A;  4RS8 A;  3FF5 A;  1XMK A;  3NQO A;  1V3F A;  3IWZ A;  4CIC A;  5ILV A;  2PQ8 A;  2W57 A;  4H0E A;  2HTS A;  1VTN C;  3P9C A;  1Q1H A;  1FY7 A;  2QZ8 A;  2GA2 A;  1HBX G;  4M6Y A;  2P5V A;  3CTA A;  3C3W A;  2QQA A;  3QU3 A;  1RNL A;  1F5T A;  4HF1 A;  4L18 B;  2E7W A;  2XAH A;  2O8X A;  1YQA A;  2L4A A;  3TGN A;  3IWF A;  2HYG D;  4ETS A;  2R7F A;  1J59 A;  1TQI A;  2IA2 A;  3MQ0 A;  4PZJ A;  2A61 A;  4IVN A;  2QQB A;  1CGP A;  2A6E F;  1H9T A;  3TQN A;  3HOS A;  1ODD A;  4XLP F;  2DK5 A;  4P9U A;  5LBQ A;  3ZPL A;  2EJR A;  3F8F A;  2KRF A;  3VOD A;  5DUI A;  2J5O A;  2ZKZ A;  1XGN A;  3KZZ A;  2EFO A;  4HX7 A;  1DPR A;  1P6R A;  1B59 A;  5E18 F;  3JAM Z;  5ILS A;  2EWN A;  5J6X A;  2BEO A;  4I98 B;  4OOI A;  4G6D A;  1R1U A;  4OIR F;  1U8R A;  4KNY A;  1XSD A;  4I2O A;  3BOQ A;  2XRO A;  2BBY A;  2ISY A;  5E20 A;  2GWR A;  1YG2 A;  3QU6 A;  1E17 A;  1ZRF A;  2XHK A;  4EJV A;  2R3S A;  1O3T A;  1DP7 P;  2FML A;  3K69 A;  1UCR A;  2XKO A;  3BJO A;  3K1M A;  4M9Z A;  3KLN A;  4LLL A;  2FRH A;  3B02 A;  3R61 A;  1R7J A;  2KKO A;  2DAO A;  1G3T A;  3T1B A;  3WTT C;  2NNN A;  2OA4 A;  5D5U B;  4HAM A;  5JI6 A;  2GXG A;  3I5U A;  3GF2 A;  2JZY A;  4KIF A;  2YPR A;  4KN4 X;  2D1H A;  1QO0 D;  1Y0U A;  1LB2 A;  2FU4 A;  4U7B A;  3BJA A;  5BS6 A;  5TRD A;  3SXY A;  2FNA A;  2VC1 A;  2P8T A;  2K4J A;  2E1C A;  3C1D A;  2K02 A;  1SD5 A;  1BOA A;  4ENM A;  1MGT A;  2M45 A;  4U7D A;  2RKH A;  1JE8 A;  4M9X A;  3T8R A;  3F72 A;  1J9I A;  3C7J A;  4UUV A;  5H6R A;  1XN7 A;  4UHT A;  3KFW X;  3I59 B;  3KP2 A;  3ML6 A;  4I0B A;  5DV5 A;  3H3Z A;  4QLC U;  1IXS B;  3V7C A;  4BHB A;  4RAZ A;  1LNW A;  1MD0 A;  1OR7 A;  5E8G A;  1CF7 B;  4ZYG A;  1FSH A;  3L9F A;  5ERI A;  4WXD A;  3R60 A;  1HKQ A;  1IXC A;  2ESH A;  1R1V A;  4RGS A;  2W85 A;  1SAX A;  1JGS A;  3TKY A;  2DFI A;  3K9T A;  1TQM A;  2WWY A;  3WU0 A;  1W4M A;  3CLO A;  4M74 A;  1A04 A;  1R58 A;  1HKS A;  3E6M A;  3IKV A;  4AIK A;  2IA0 A;  4MHG A;  2RDP A;  2HOE A;  4A6E A;  2K7L A;  1O3S A;  4HOB A;  4HZF A;  2FBK A;  1MZB A;  1J2X A;  1LJ9 A;  3HRS A;  3R0J A;  3COA C;  3GVA A;  5BQT A;  1G3S A;  3ZQ7 A;  1ZG1 A;  1Z1D A;  1XD7 A;  1ZGA A;  1I5Z A;  4E70 A;  4ZZL A;  4S05 A;  3QPH A;  1FC3 A;  3DEU A;  1P4W A;  3LQR A;  1V4R A;  3HSF A;  5DD8 A;  1D8J A;  3KE2 A;  4B8X A;  3MAJ A;  4MEY F;  2RN7 A;  3KP3 A;  3V7R A;  2G9W A;  1USS A;  4CDG A;  2HTJ A;  5JVT A;  2P7C B;  4WXC A;  4IPA A;  4Q47 A;  1U78 A;  2GQQ A;  5CJ9 A;  1K79 A;  2HWV A;  3BDD A;  4IJA A;  2IA1 A;  5CLS A;  4ENJ A;  5FD6 A;  3LST A;  1XDU A;  3KEQ A;  4AWX B;  5DEQ A;  5EEG A;  2CQK A;  2VOO A;  1T0F A;  2A6H F;  1U5T B;  1IUY A;  2VE9 A;  2HKO A;  5E8I A;  2HYF A;  1KU3 A;  3SZP A;  3ERE D;  2V1X A;  4RB0 A;  3VOE A;  5IT9 Z;  5FFX A;  3PQJ A;  2P6S A;  4Q48 A;  4OIQ F;  1TW2 A;  2CSO A;  5JHU A;  3BZ6 A;  4Y17 A;  4M6X A;  4Z2Y A;  4Q5S F;  1WKM A;  4ENK A;  3ZP5 A;  1EH7 A;  4K2E A;  1C0W A;  1STZ A;  4IF4 A;  5FFZ A;  3IC7 A;  1R23 A;  1RZ4 A;  4UV9 A;  2VBY A;  3BWG A;  1L0O C;  3V8J A;  1KYZ A;  5J8F A;  3KP5 A;  4KFC A;  2FF4 A;  3IKT A;  3QP5 A;  4L9T A;  2VT3 A;  5A2Q K;  1U6G A;  3RKY A;  3HHG A;  5E1Z B;  3B73 A;  2A3S A;  1BIA A;  2R7D A;  3JW4 A;  1XCV A;  2Y48 A;  2F5F A;  2ZJ2 A;  5F6F A;  1W5S A;  3FM5 A;  4LLG F;  1BI2 A;  5LLQ A;  3WTZ A;  3BRO A;  2BGC A;  2XAQ A;  2FXA A;  1XGS A;  5K5O A;  1P92 A;  4GXO A;  1KQ8 A;  3DPT A;  1IN7 A;  3WOD F;  4OMZ A;  2XAF A;  2PI0 A;  4BHP A;  2VON A;  3Q9V A;  5CVR A;  5L3G A;  3K1N A;  3OV8 A;  1K7A A;  1BBY A;  2CGP A;  3CUQ C;  3MFK A;  2YX7 A;  1DPU A;  1IN6 A;  4PGH A;  1EV7 A;  3P9K A;  1YTY A;  1PP8 F;  1BJA A;  2VXZ A;  2EB7 A;  1TNS A;  4HYE A;  2ADU A;  4LLN A;  1FBQ A;  4BXU A;  2CW0 F;  3P7N A;  1IF1 A;  4HQE A;  5CVI A;  2BE5 F;  3DPL C;  1HW1 A;  1ZAR A;  4CXF A;  4UVB A;  4WK8 F;  2FBH A;  2UZK A;  5ED4 A;  1FOK A;  3FXU A;  4GCV A;  3I71 A;  2DQL A;  4G7O F;  5D4R A;  1XSX A;  4XSX F;  4NB5 A;  1KU7 A;  2W84 A;  4RGR A;  2WC2 A;  3E6D A;  1BI1 A;  3W6J B;  1TW3 A;  3PFI A;  3JSP A;  3Q5F A;  1XDS A;  3M8E A;  5LEK A;  3J80 K;  1T6S A;  2F5E A;  3FWE A;  2W25 A;  5KK1 A;  4A6D A;  1ZRC A;  4UV8 A;  1QNT A;  1U5T A;  4LJZ F;  1ZRE A;  3JAM K;  3CJN A;  5ICG A;  1KQ9 A;  3BJ6 A;  3RYP A;  1FP2 A;  4BYY A;  2QBY B;  5DUK A;  1UB9 A;  1LEA A;  4EM1 A;  4ESJ A;  1BC7 C;  4BHC A;  1G6N A;  2C6Y A;  3WU1 B;  2G7H A;  3LA7 A;  1DDN A;  1REP C;  3GLX A;  4UVC A;  5KVR A;  1EH6 A;  2GAU A;  5FB2 A;  2AXL A;  1TLH B;  5FD5 A;  3GX4 X;  1G4D A;  1FT9 A;  3GFM A;  2ZCW A;  2XAG A;  3K0L A;  2L3D A;  4RB2 C;  1D3Y A;  4MTE A;  3O6B B;  2PEX A;  5L3E A;  2YR2 A;  3ECH A;  5J8C A;  2O61 A;  3RTR A;  3LAJ A;  4ESB A;  1K6O A;  2XVC A;  1ULY A;  2FE3 A;  3WGG A;  5HS7 A;  3VB2 A;  5F1R A;  1TBX A;  4M73 A;  1HQC A;  4ZYD A;  2Z5U A;  3RDI A;  3DKW A;  4L0Z B;  1TNT A;  3IL2 A;  4CYD A;  1R22 A;  1FP1 D;  2DBB A;  4G6Q A;  3J80 Z;  2ZXJ A;  2DW4 A;  2EK5 A;  1S29 A;  1WI9 A;  3QOP A;  4GGG A;  5ICF A;  3REO A;  1OYY A;  3JTG A;  3FM3 A;  3BP8 A;  4CZZ A;  1O3R A;  1J75 A;  3ZMT A;  3WGI A;  3I4P A;  3PQK A;  5D6E A;  3NRV A;  3FMR A;  2H6B A;  3FMS A;  2KJB A;  1FNN A;  1WQ2 A;  3IHU A;  2KIM A;  4HV6 A;  4XBF A;  1BN5 A;  3RJP A;  4EGY A;  3ROU A;  2LF7 A;  4ZYE A;  3KCC A;  4IRG A;  4BQA A;  1KQ0 A;  2D1V A;  1OYI A;  3P9I A;  1F4K A;  1SD6 A;  2DK8 A;  3ABU A;  5FGM A;  1I1S A;  3GZ5 A;  4IXA A;  5AIP A;  4N9H A;  3HOT A;  1UHW A;  2FEZ A;  4YG2 F;  3V7S A;  3DV8 A;  1IN4 A;  2KJC A;  1PDN C;  4HA8 A;  1OPC A;  2OAZ A;  4KIC A;  1FYM A;  3GZ6 A;  4L9V A;  3OOP A;  5LHI A;  2HDC A;  1J5Y A;  4AIJ A;  3S2W A;  1RUO A;  4WWC A;  3CDH A;  4P96 A;  4UVA A;  2MD5 A;  1JHF A;  5D6F A;  3RI4 A;  2E7X A;  4CHU A;  3D5L A;  1B9M A;  3ABT A;  5LRS A;  3CO6 C;  1O57 A;  2LSO A;  5CYV A;  1AWC A;  1FLI A;  1B6A A;  1FWZ A;  4LFU A;  3ZMU A;  4M9S A;  1P2F A;  3F21 A;  2NRA C;  4EV0 A;  1IXR C;  3DP7 A;  4L9J A;  2Y0M A;  3LA2 A;  2MH9 A;  3ISP A;  1FYK A;  3J81 Z;  3DXJ F;  1MDM B;  4HLY A;  2MC3 A;  2G7U A;  1ZH5 A;  3E5U A;  1HSJ A;  4XRF A;  3F8M A;  5E1X A;  1SMY F;  4PDK A;  5CVV A;  2FBI A;  3L2C A;  2STT A;  3CUO A;  1FBU A;  5L3F A;  2W24 A;  1RI7 A;  3R0A A;  1I6X A;  1FZP B;  2PG4 A;  2RQP A;  1GVJ A;  3I53 A;  4A5M A;  4BAY A;  2YU3 A;  2VC0 A;  1T98 A;  5L3B A;  3MZH A;  2OD5 A;  5HS8 A;  3I54 A;  3SZT A;  2DU9 A;  3WTX C;  5IT9 K;  1IZ1 A;  3E3V A;  4KT5 C;  4R79 A;  1W7P D;  2HQN A;  4N0B A;  3U1D A;  2TDX A;  3QPT A;  3T8T A;  2ZNZ A;  5HDG A;  2L54 A;  4OU0 A;  2OU2 A;  3RIR A;  1SD7 A;  3V8K A;  4Q4Z F;  2O6G E;  1SFX A;  4WCG A;  1R5H A;  3K2Z A;  1BI0 A;  4OIN F;  1R00 A;  2H09 A;  4RB3 C;  2KIF A;  3WTW C;  2QYO A;  1UFM A;  3MCZ A;  4O6J A;  4NQW A;  3HRM A;  2A68 F;  2M5W A;  3LWF A;  3WE3 A;  3JSO A;  5FLX K;  2JPB A;  4YFN F;  2ZBK A;  4I01 A;  1Z6T A;  3ZMV A;  3G3Z A;  2M8E A;  3DFG A;  4G9Y A;  1FPQ A;  4HLX A;  4B09 A;  1DUX C;  3F8N A;  1WWX A;  1W7P B;  4HF0 A;  4ESF A;  2RV8 A;  5EEH A;  2MA3 A;  3L09 A;  2IPQ X;  3DF8 A;  3M1E A;  3CO7 C;  4EJW A;  1LDK B;  4XLN F;  3N4M A;  2PMH A;  4Y13 A;  2EV0 A;  4R1H A;  5DCM B;  4GYI A;  1BC8 C;  3LAP A;  1BI3 A;  2XKP A;  2Y75 A;  3F22 A;  2HQR A;  3V8L A;  4O5V A;  5ILU A;  2ESN A;  5TJJ A;  3BPV A;  4QWQ A;  3RKW A;  3E97 A;  2AS5 F;  2H27 A;  1KA8 A;  3F6O A;  1D5V A;  1MJA A;  3I59 A;  3KP6 A;  4FX4 A;  2LNB A;  2CO5 A;  2JRT A;  3HUG A;  3IRQ A;  2HS5 A;  3H3U A;  2VBX A;  2IJL A;  2ETH A;  5DCF A;  1MDM A;  1CF7 A;  1YFH A;  5LRR A;  1ZLK A;  3QP6 A;  2EV5 A;  3BPX A;  2HZT A;  3HSR A;  1F9N A;  1SFE A;  3KLO A;  5AON A;  1XGM A;  5FLX Z;  2L01 A;  3HIF A;  2F5C A;  1IRF A;  3MEX A;  6PAX A;  4L0Y B;  5K1Y A;  4BNC A;  1KU9 A;  3EYY A;  4JBA A;  2MBF A;  1Z9C A;  1O7F A;  3GUD A;  1Z6R A;  2X0L A;  3WTU C;  3GFI A;  2LF8 A;  2M87 A;  4EJT A;  4UNO A;  3E5X A;  4AIH A;  1ON2 A;  3E5Q A;  3L7W A;  4G7H F;  4MTD A;  1YS6 A;  2VE8 A;  1HXD A;  1G3W A;  1QPM A;  3M9A A;  1W5T A;  2QLZ A;  1S3J A;  1OYW A;  2HFH A;  5L3C A;  1KU2 A;  2A07 F;  4XSZ F;  2RGV A;  1Z05 A;  1JHH A;  4L9N A;  3TO9 A;  5D5W B;  4I0A A;  5CVU A;  3SHF A;  5JFR A;  3GYH X;  4EM2 A;  3I0T A;  3TDZ C;  2L4M A;  2O3F A;  1ZG5 A;  1B4A A;  2X4H A;  2OQR A;  1GHC A;  2Z3Y A;  1HST A;  2PBI A;  4RGX A;  3NEU A;  2DPU A;  2QEN A;  1RUN A;  3VFZ A;  4KN7 X;  1G3Y A;  4A0Y A;  2XIG A;  1B1B A;  4N9I A;  4D0P A;  2ACJ A;  1HKT A;  1T38 A;  5D8L B;  2QVO A;  5LHG A;  1U5T C;  1J0R A;  2NYX A;  4MGR A;  1K78 B;  3FXQ A;  2JSC A;  3WTV C;  3RPU A;  5DCM A;  1LQ1 A;  4ON0 A;  2HKX A;  4YFK F;  3I64 A;  1ZRD A;  3F8B A;  1KGS A;  4LG0 B;  3N97 A;  1EH8 A;  2OZU A;  5HLH A;  1WSU A;  3WE2 A;  2FA5 A;  2FMY A;  4EGZ A;  2P6T A;  1ZGJ A;  3LA3 A;  4LK0 F;  4AD9 A;  1FX7 A;  1MJB A;  1QZZ A;  2P4W A;  3HHH A;  3F8C A;  2ZFW A;  5BMZ A;  3LQQ A;  1LVA A;  3M8F A;  1XCB A;  2MLG A;  5DYM A;  2CG4 A;  1YW8 A;  2NNY A;  1YW9 A;  2VBZ A;  1MJ9 A;  3H92 A;  1TTY A;  3L00 A;  2IT0 A;  3D0S A;  4IRI A;  3F23 A;  5LEJ A;  2PFB A;  1IRG A;  2Z9O A;  4LK1 F;  2PN6 A;  4NHJ A;  1U3E M;  2V1U A;  5IT3 A;  1O3Q A;  3ELK A;  3J7A O;  4ZZD A;  3GFJ A;  1LDD A;  4MNU A;  4L5I A;  2QQ9 A;  3FZV A;  3EQL F;  3EYI A;  2J5P A;  3WGH A;  1QGP A;  2EA2 A;  1JXS A;  3RKX A;  1QZY A;  2GIV A;  4LMY A;  3KEO A;  4G94 A;  4U88 A;  5L3D A;  5HDN A;  2ZO4 A;  4UXN A;  4Y15 A;  2MLK A;  2P7V B;  1FYL A;  3ZMD A;  3ULQ B;  2OQG A;  1AOY A;  4RAY A;  2GZW A;  4HV5 A;  2ZME B;  2M30 A;  3RYR A;  4A0X A;  3EET A;  4M72 A;  1MKM A;  3J81 K;  4P5O A;  4LB6 B;  4LD5 A;  4YIF A;  2Z33 A;  2IRF G;  1J7K A;  2Q0O A;  2PJP A;  4EMS A;  4EVI A;  4HX4 A;  1L3L A;  2BV6 A;  1S7A A;  2K86 A;  3C18 A;  2JPC A;  4DNC A;  3RPQ A;  4HBL A;  2A5Y B;  4G7Z F;  4I7H A;  2DPD A;  2A69 F;  5BPD A;  1B9N A;  2H6C A;  2B0L A;  4KA4 A;  2HR3 A;  2K4B A;  2Q2E A;  1K78 A;  4U0W A;  3QRF F;  1FSE A;  3T0Y A;  3MZY A;  1UHM A;  1IAW A;  3GO5 A;  4KDP A;  5LHH A;  2DLL A;  2EA4 A;  4O3M A;  4LG0 A;  4TV7 A;  1IW7 F;  1PP7 U;  2NS0 A;  1ZHF A;  2QBY A;  1T2K A;  3ZMS A;  4L5J A;  5F64 A;  1OKR A;  2DO7 A;  3TDU C;  4GYG A;  4MQ9 F;  2BYV E;  3BY6 A;  3O2P E;  2FQ3 A;  2EFP A;  4A2U A;  2ELH A;  1I27 A;  4I02 A;  1YYV A;  1HW5 A;  2KIU A;  1X3U A;  5CVJ A;  1KYW A;  4MEX F;  4PCQ A;  1U2W A;  4IHT A;  1ZG3 A;  2IP2 A;  4KIG A;  1XSV A;  1XMA A;  2V9V A;  1BIB A;  3TOA A;  3GFL A;  5JR3 A;  1ZAO A;  4PGG A;  3SFZ A;  4ZH4 F;  4WXH A;  4HDU A;  2O0Y A;  4KIB A;  2XRN A;  2F2E A;  2QUF A;  2CFX A;  2LKP A;  3O3K A;  2YSR A;  1P4X A;  2JT1 A;  2XUB A;  2LDU A;  3ECO A;  2L02 A;  1OMI A;  1ONV A;  5BPI A;  1QBJ A;  1O7L A;  5K5Q A;  3Q9S A;  1H9G A;  4IRH A;  4MQV A;  2Q8K A;  4KMU X;  2ISZ A;  1BM9 A;  4P55 A;  4WF2 A;  1F1Z A;  5LGN A;  4S04 A;  3WG9 A;  1UST A;  2ZNY A;  1XB4 A;  2STW A;  3E6B A;  2M1B A;  2VOD A;  3K1P A;  1R5G A;  2DT5 A;  1E2X A;  1LEB A;  2FSW A;  2IW5 A;  1S6L A;  4CO8 A;  1GXP A;  4F7Z A;  3WTS C;  2RC4 A;  2V79 A;  3IRR A;  1SMT A;  1IN8 A;  4OIO F;  2ZME A;  3M7G A;  3U9G A;  3GXO A;  3KZY A;  3JTH A;  3KET A;  4HW0 A;  1YW7 A;  4U0V A;  2XAS A;  1R1T A;  3CUQ B;  1H0M A;  2HEO A;  4EM0 B;  2UXX A;  5HS9 A;  5LGU A;  3LFK A;  5HDK A;  3U2R A;  5LGT A;  2VN2 A;  1PUE E;  1ZLJ A;  4YII A;  2EV6 A;  5H6Q A;  1ZN2 A;  4ASN A;  2QWW A;  4HQM A;  3EUH A;  1YO5 C;  2V1D A;  3HTS B;  3HRT A;  3SQN A;  3I58 A;  3HTU A;  4ZYH A;  2P5L C; 
#chains in the Genus database with same CATH topology
 2EZK A;  3EDP A;  3VYS B;  4EJO A;  1W36 C;  2KLO A;  4KYW A;  4EAT A;  3BTC A;  2BW3 A;  2XF6 A;  5AIQ A;  1D0Y A;  3GTQ J;  5E17 F;  4FQG A;  4M71 A;  4FE4 A;  4R8H A;  1RC9 A;  4FHT A;  5H20 A;  1MBJ A;  3SEZ A;  3K4B A;  3BG6 A;  2H1K A;  3GTG J;  2LLK A;  2PLY A;  4I09 A;  1JJ8 C;  2E36 A;  4YFX F;  2DA6 A;  4KMF A;  1XGO A;  2EPF A;  1IO2 A;  4XM3 A;  4NUB A;  4AVP A;  4XIC A;  2LR8 A;  3D5R C;  3HB9 A;  5B5E C;  1EJ9 A;  4WX9 A;  2CU7 A;  2XGX A;  2DYR H;  2UUZ A;  2XV4 S;  3VEP A;  2LTP A;  1S72 I;  5FO5 A;  3V42 A;  3PIO F;  3L2W A;  4DZP A;  2QM3 A;  4CCL A;  1D8K A;  2VT2 A;  3S1N J;  4XLH A;  2FNP A;  1WRJ A;  3U1K A;  2M0M A;  2KPM A;  4Y4R A;  2NAZ A;  5KAI C;  4OIP F;  3GWZ A;  2CWE A;  4PFO A;  3OY9 A;  1FBS A;  5FLV A;  3CCU I;  2EFW A;  3BTI A;  1IN5 A;  2IVM A;  1BR4 A;  5HLG A;  2FJ1 A;  4CGZ A;  1ON1 A;  2V9K A;  4KUM A;  1HW2 A;  2Y31 A;  5D4S A;  2NVT J;  3TO6 A;  1R4N B;  4OMY A;  1T39 A;  2ME0 A;  3H9Q A;  3WTY C;  3ZMZ A;  1OCC H;  3QAH A;  2HGC A;  1K4S A;  1DGR M;  4BDZ A;  4BDY A;  2IS6 A;  5F1J A;  1S9H A;  5BOX A;  2VIX A;  2F4O B;  2RNJ A;  1G2H A;  2Y0S N;  3W6K B;  3KYD B;  2VBW A;  3GW2 A;  4JOM A;  1WJA A;  3FXR A;  3A01 B;  1V54 H;  3W6V A;  3FKJ A;  3HSE A;  4RB1 A;  4FX0 A;  5D8K B;  3LSJ A;  4OWR B;  2F5D A;  4A3M J;  2YU9 J;  2P5K A;  2WV0 A;  3ZN1 A;  3AAF A;  3E6C C;  3TO7 A;  3GEZ A;  3FMQ A;  4P9F A;  2UXN A;  2GXA A;  3QYF A;  1YS7 A;  4PJ0 C;  1B8I A;  2JTV A;  3CCE I;  1RIO H;  3FXM A;  3H36 A;  3KP7 A;  1P4A A;  3RSN A;  1X1D A;  3G73 A;  2VKD A;  3OYC A;  2EFN A;  2DA4 A;  2OBP A;  2E2H J;  1Z7U A;  3OL4 A;  3H0D A;  2ZXW H;  3FHN A;  5HOO A;  2OUM A;  1UG2 A;  1X4O A;  4ZDP A;  4JK1 X;  4ENN A;  2LG4 A;  5HLI A;  2XPW A;  4G8X A;  2DI3 A;  1S8N A;  5E1W A;  2EQR A;  2JK3 A;  3F3X A;  3HG9 A;  3TBI A;  3TOB A;  4A3E J;  1O4X A;  1YIO A;  4LGW A;  1EF4 A;  1W0U A;  4BKX A;  4HF2 A;  2V7F A;  3TW7 A;  2DQR A;  2VOP A;  3BZC A;  5CQE A;  3K10 A;  3R6S A;  5FKN A;  5F04 A;  4JQF A;  2DXI A;  4DQ2 A;  5E79 C;  1Y8R B;  2MYS A;  2IAI A;  5DD4 A;  4LB5 A;  5DDG A;  1NHA A;  3HYI A;  3RCO A;  3KP4 A;  1X1B A;  1ACI A;  2CYY A;  1EKE A;  2K9M A;  2CMP A;  4U0Y A;  3H9J A;  2KFD A;  4GO1 A;  2HXO A;  1SFU A;  3R4K A;  5HVQ C;  5ICC A;  3CUQ A;  4HX8 A;  2RVC A;  3QWL A;  4M6V A;  3JRG A;  2COM A;  4EQQ A;  2ZB9 A;  3DQV C;  4EJU A;  2V6C A;  2DFF A;  1R36 A;  2JN6 A;  3OIO A;  3LNQ A;  1LDJ A;  1T33 A;  1ZR4 A;  2YX4 A;  2MGQ A;  5D5X B;  3AG1 H;  4A0Z A;  1GXQ A;  1TQP A;  2PMU A;  2XAJ A;  3QOD A;  2DOA A;  3FX3 A;  2VAS A;  3ZQI A;  1W7P A;  5K5R A;  2DMP A;  2CJJ A;  4HDV A;  2MSY A;  1UHS A;  2H94 A;  3K4N A;  4BH9 A;  4DYC A;  3BC8 A;  3TP3 A;  3IUO A;  2WTE A;  1Y39 A;  1QQI A;  5K7H A;  3MWM A;  2OZ6 A;  1YLF A;  3T5X A;  3OYK A;  3F6V A;  2EFQ A;  3JRD A;  5IOZ A;  5A2Q Z;  3CJR B;  4A5N A;  2DTR A;  4FT8 A;  1SD4 A;  3V4G A;  3ZN0 A;  1D0X A;  2A05 A;  2YUS A;  2FQ4 A;  3BG9 A;  3VWB A;  4UY8 I;  2Z99 A;  4ABZ A;  1TL8 A;  5E3N A;  1LUJ B;  2O03 A;  2R7U A;  3MKW B;  2GA1 A;  4JX4 A;  2CV2 A;  3ZQF A;  5ICE A;  1I1G A;  2MH2 A;  2E1N A;  3KYL A;  3BR5 A;  2D2W A;  1ZYR F;  1S7O A;  4JX5 A;  2CFO A;  1VFC A;  3AG2 H;  3FHZ A;  1Y8Q B;  1LE8 A;  1Z91 A;  4RGU A;  5FKL A;  5D5V B;  2GM4 A;  4D5F A;  4GDF A;  3LSH A;  4IHS A;  4A12 A;  2D45 A;  2GXB A;  3AFH A;  2IGO A;  1R4M B;  2FOK A;  3HRU A;  2DTZ A;  2K27 A;  2UWM A;  4ANJ A;  4RS8 A;  5E3L A;  4A69 C;  5EYR A;  3FF5 A;  2OCC H;  2K40 A;  1XMK A;  4IOC F;  3NQO A;  1V3F A;  3IWZ A;  2CW8 A;  3D5S C;  4XQF A;  4CIC A;  5ILV A;  3S3M A;  1TWF J;  2HZD A;  1DGW Y;  1WVR A;  2PQ8 A;  2W57 A;  4H0E A;  1A6I A;  3GTK J;  2HTS A;  4IHY A;  1VTN C;  3P9C A;  1BA5 A;  1Q1H A;  1FY7 A;  2QZ8 A;  1WJC A;  2GA2 A;  2VB6 A;  1HBX G;  5FLM J;  4M6Y A;  3S3O A;  2HDD A;  2Y69 H;  2P5V A;  3CTA A;  2CS3 A;  3C3W A;  2QQA A;  1E3P A;  1JUP A;  1ZK8 A;  3QU3 A;  1RNL A;  3Q3S A;  2R5Y B;  1F5T A;  2HOT A;  4HF1 A;  3ERM A;  2XB5 A;  4LIV A;  4L18 B;  3BG7 A;  4J19 A;  2E7W A;  2XAH A;  4I99 C;  4UB8 C;  2O8X A;  1SFK A;  1YQA A;  2L4A A;  2VKH A;  3TGN A;  3IWF A;  2X6W A;  4QPQ A;  2HYG D;  4ETS A;  2R7F A;  1J59 A;  2CUE A;  1TQI A;  2L5Q A;  2KT0 A;  1YHQ I;  2IA2 A;  3MQ0 A;  4PZJ A;  5JVG F;  2A61 A;  4IVN A;  5J47 A;  2QQB A;  3O8G A;  1CGP A;  4NBQ A;  3HXL A;  2A6E F;  1H9T A;  4NC7 A;  1NTC A;  3TQN A;  3BG3 A;  3HOS A;  1ODD A;  2DMN A;  4XLP F;  2OF7 A;  1SVL A;  2DK5 A;  2QQ8 A;  4XOR A;  4XLC A;  4XL9 A;  4P9U A;  5LBQ A;  3ZPL A;  2EJR A;  3F8F A;  4CCM A;  1FTZ A;  5HOD A;  2KRF A;  3VOD A;  5DUI A;  2J5O A;  2ZKZ A;  1XGN A;  1MMS A;  3KZZ A;  1VQ9 I;  2EFO A;  4HX7 A;  2VPR A;  1DPR A;  1P6R A;  3HZJ A;  2R7Z J;  1B59 A;  5E18 F;  3K7A J;  4U87 A;  2Y30 A;  3JAM Z;  5ILS A;  2EWN A;  4HRI A;  5J6X A;  2BEO A;  3H0G J;  4ZJZ A;  4I98 B;  3ZOB A;  4OOI A;  1LFB A;  1ETO A;  4G6D A;  2QSG X;  1R1U A;  4OIR F;  5IOY A;  1U8R A;  4KNY A;  3CMM A;  1TT5 B;  1XSD A;  2K9N A;  1IRX A;  2E5N A;  2XB0 X;  4DBQ A;  4I2O A;  3CJQ B;  3BOQ A;  2XRO A;  2BBY A;  2ISY A;  5E20 A;  2GWR A;  4BJ6 C;  1YG2 A;  3QU6 A;  3NAU A;  1E17 A;  3HOU J;  1ZRF A;  2XHK A;  2QGU A;  4EJV A;  2LVS A;  2R3S A;  1O3T A;  3LSI A;  2F4M B;  4H4K C;  1W36 D;  2X9D A;  3ZQQ A;  1DP7 P;  2R7Q A;  3DU6 A;  1WCM J;  2FML A;  2E19 A;  2RQQ A;  3K69 A;  1A5J A;  3K4K A;  1OCT C;  1UCR A;  2XKO A;  3BJO A;  3RQ4 A;  3M1C A;  3K1M A;  1YRN A;  4M9Z A;  3OYI A;  4DIQ A;  3KLN A;  4LLL A;  4E7S A;  3K4J A;  5C3E J;  2WBM A;  1MMD A;  2FRH A;  3B02 A;  3R61 A;  3JRI A;  4IO9 F;  1R7J A;  2KKO A;  1GV2 A;  3KX2 A;  2DAO A;  3M4O J;  2CQQ A;  5J1Y A;  1G3T A;  3T1B A;  3WTT C;  2NNN A;  4XR6 A;  2OA4 A;  3PO2 J;  5D5U B;  4HAM A;  5JI6 A;  2GXG A;  3I5U A;  1Z21 A;  2JZY A;  3GF2 A;  3S8P A;  2DA2 A;  5FKO A;  3L2V A;  5CPR B;  2XDV A;  4KIF A;  2YPR A;  4KN4 X;  4BY7 J;  2O7O A;  2LY2 A;  2D1H A;  1QO0 D;  2FOW A;  1Y0U A;  1LB2 A;  4BS9 A;  2FU4 A;  2LD5 A;  4U7B A;  1HF0 A;  3BJA A;  3DBR B;  5BS6 A;  2E71 A;  1EA3 A;  5TRD A;  3S1Q J;  3SXY A;  2FNA A;  2VC1 A;  3OR1 C;  3PNY A;  2P8T A;  3FXK A;  2K4J A;  4BQO A;  3MN2 A;  1K61 A;  2E1C A;  3C1D A;  2M0C A;  2K02 A;  1SD5 A;  1BOA A;  4ENM A;  1MGT A;  2M45 A;  2F5V A;  4P1W A;  4U7D A;  2JUG A;  4XOP A;  2RKH A;  1JE8 A;  2W00 A;  4M9X A;  2QKL B;  3T8R A;  1AU7 A;  3F72 A;  1J9I A;  1IDY A;  3ASO H;  3C7J A;  3HPG A;  3LFU A;  4UUV A;  5H6R A;  4YIR X;  1XN7 A;  1B72 B;  4UHT A;  1X19 A;  3KFW X;  3OSG A;  2R7O A;  3I59 B;  1A36 A;  2LY9 A;  3KP2 A;  3ML6 A;  5J4Y A;  1OQY A;  4I0B A;  3B6A A;  2GOM A;  2HYJ A;  5DV5 A;  3H3Z A;  3LSR A;  3IH3 A;  1JUM A;  4QLC U;  1WPK A;  1IXS B;  3CMY A;  4CYC A;  2LOO A;  1GDT A;  2DA5 A;  2KDO A;  3V7C A;  5E3M A;  4OAZ A;  4NNJ A;  2H8W A;  3IAS 2;  4RAZ A;  4BHB A;  1LNW A;  1MD0 A;  1SAU A;  1OR7 A;  3PJR A;  5E8G A;  1CF7 B;  4ZYG A;  1FSH A;  1BR1 A;  3FK7 A;  4AID A;  2VJ5 A;  3QPS A;  3L9F A;  5ERI A;  4WXD A;  3OS0 A;  1QVT A;  3R60 A;  2Y9Z A;  3OIQ A;  1HKQ A;  1IXC A;  3VDX A;  2ESH A;  1R1V A;  4RGS A;  1RET A;  2W85 A;  1SAX A;  1JGS A;  3TKY A;  2DFI A;  3K9T A;  1TQM A;  2WWY A;  3H5N A;  3WU0 A;  2L9N A;  3OOU A;  1VQM I;  1W4M A;  2CUF A;  3CLO A;  4F55 A;  1XPX A;  4BJ5 C;  4FAS D;  4M74 A;  1A04 A;  1UAA A;  1VQP I;  1R58 A;  1HKS A;  3E6M A;  1VQL I;  3IKV A;  4AIK A;  2M7A A;  2IA0 A;  1FIA A;  2DDB A;  4MHG A;  2RDP A;  5M5Y J;  2HOE A;  2XC7 A;  2OJE D;  4A6E A;  3SJM A;  2K7L A;  1O3S A;  2F6C A;  3CME I;  4HOB A;  4HZF A;  2FBK A;  1MZB A;  2DOD A;  1J2X A;  1LJ9 A;  2WAF A;  1YJW I;  1N75 A;  3HRS A;  4HPQ A;  3R0J A;  4BAC A;  4L5E A;  3CZ6 A;  3COA C;  2ZME C;  1ERD A;  4BQQ A;  3GVA A;  5BQT A;  3C2H A;  4M3F A;  1G3S A;  3CCQ I;  4RM2 A;  2X1C A;  3ZQ7 A;  2ZJP F;  1ZG1 A;  5FRM A;  9ANT A;  3LL7 A;  1Z1D A;  3G1O A;  3KEY A;  3AL0 C;  3K4C A;  3M3Y J;  1GVD A;  1X1A A;  1XD7 A;  3DTK A;  5CKT A;  1ZGA A;  1I5Z A;  4E70 A;  4ZZL A;  1LKX A;  1ETQ A;  1V5G A;  4BUP A;  3H3V K;  4ZC3 A;  4W1U A;  4S05 A;  4A3L J;  3QPH A;  1FC3 A;  4F93 B;  2R7W A;  4YEL A;  3RZD J;  2A6T A;  3DEU A;  1P4W A;  1I6H J;  3RPU D;  4AVZ A;  1H88 C;  3LQR A;  1HDD C;  1FTT A;  3OYF A;  1NH3 A;  5JLW A;  4PSW A;  2CV1 A;  1PYV A;  1V4R A;  4NDL A;  2ZJQ F;  4JYK A;  5J3L A;  3S93 A;  4D9J A;  2BVM A;  2VL8 A;  1OCO H;  3HSF A;  3I4N J;  5DD8 A;  1D8J A;  2Z1D A;  2ECB A;  3KE2 A;  2VQL A;  1QZE A;  3QQA A;  4B8X A;  4DGW B;  3CCJ I;  2LKX A;  3MAJ A;  4MEY F;  4XKB A;  3BQY A;  2G0E A;  2RN7 A;  3KP3 A;  3IV5 A;  3V7R A;  2LH9 A;  2G9W A;  1USS A;  4Z6Y A;  4FTH A;  4CDG A;  1WH5 A;  2EIM H;  1WJE A;  1P9Q C;  2HTJ A;  3HPH A;  3K4L A;  4JP0 A;  4WXC A;  5JVT A;  5EGO B;  4IPA A;  2P7C B;  4Q47 A;  5EJC A;  1CQT A;  1U78 A;  2KDZ A;  1DU6 A;  2GQQ A;  5CJ9 A;  1K79 A;  3JRC A;  2HWV A;  2M8G X;  3GZN B;  3BDD A;  2IS1 A;  4IJA A;  1KON A;  5EEA A;  3FBI B;  2IA1 A;  2W82 A;  1BR2 A;  5CLS A;  4BU2 A;  2WAQ A;  4ENJ A;  5FD6 A;  3LST A;  3OYH A;  1VQO I;  3S14 J;  1XDU A;  3KEQ A;  4HST A;  4AWX B;  3Q0U A;  1ZQ3 P;  5DEQ A;  5EEG A;  3ZCO A;  3HM5 A;  2CQK A;  4XRS A;  3CD6 I;  4BGD A;  1OLT A;  2VOO A;  1T0F A;  3SDG A;  1FOY A;  2A6H F;  3HL2 A;  1U5T B;  1IUY A;  2VE9 A;  2HKO A;  5GP9 A;  1FOW A;  1OFC X;  5E8I A;  5KCM A;  2HYF A;  1KU3 A;  3SZP A;  3CC2 I;  2LRD A;  3ERE D;  3FBN B;  4F3Q A;  2V1X A;  4RB0 A;  3VOE A;  2PJR A;  1Z77 A;  5IT9 Z;  5FFX A;  3PQJ A;  2P6S A;  4Q48 A;  3OYL A;  4OIQ F;  1TW2 A;  2CSO A;  5JHU A;  4I76 A;  1FEX A;  3TP0 A;  3BZ6 A;  3CC7 I;  4Y17 A;  1RRJ A;  4M6X A;  2JJ7 A;  4Z2Y A;  2V4J C;  4Q5S F;  3BR0 A;  1WKM A;  1VND A;  4ENK A;  2LP0 A;  2Q1Z B;  2PX9 A;  2M4K A;  2XPU A;  3FXL A;  3ZP5 A;  1EH7 A;  2XAU A;  5F0C A;  3CCY A;  3GBG A;  4K2E A;  1C0W A;  1F36 A;  1W5C C;  1STZ A;  4IF4 A;  5FFZ A;  3IC7 A;  1R23 A;  1RZ4 A;  4UV9 A;  1XC5 A;  2VBY A;  3BWG A;  1L0O C;  3V8J A;  1KYZ A;  1Y1W J;  3P5J A;  4XKC A;  2WY8 Q;  5J8F A;  4FET A;  1Y1V J;  1JKQ C;  3KP5 A;  2LFB A;  4G12 A;  4KFC A;  2FF4 A;  5EZH A;  3IKT A;  2H1L A;  2DJI A;  2AQE A;  3QP5 A;  4L9T A;  2BY0 A;  2VT3 A;  5A2Q K;  1U6G A;  3RKY A;  3E7L A;  4D7N A;  1Y56 A;  2DCE A;  3IH2 A;  3CF5 F;  3HHG A;  5E1Z B;  2ZSI B;  3IAM 2;  2E1M B;  3B73 A;  2CRG A;  2A3S A;  4BEH A;  1BIA A;  2R7D A;  2IBD A;  3JW4 A;  3S2H J;  1XCV A;  2Y48 A;  4I6Z A;  4RBO A;  2F5F A;  2Z2S B;  2ZJ2 A;  1K4T A;  1ETW A;  2B63 J;  5F6F A;  2QSF X;  1OCZ H;  1W5S A;  3FM5 A;  4LLG F;  3DWL E;  1BI2 A;  2LY1 A;  5LLQ A;  4G6T B;  2BY2 A;  4A93 J;  1BOB A;  2HOS A;  3WTZ A;  3BRO A;  2X1E A;  3S17 J;  2BGC A;  4XRS G;  3HEF A;  2XAQ A;  4B1R A;  1YIT I;  3OYA A;  2FXA A;  1UMQ A;  2OPT A;  2I8D A;  4W97 A;  1XGS A;  5K5O A;  1P92 A;  4GXO A;  2EH3 A;  5HNH A;  1JKO C;  2CQ7 A;  4ITV A;  1KQ8 A;  3DPT A;  1IN7 A;  3WOD F;  4DW6 A;  4OMZ A;  2XAF A;  2PI0 A;  4BHP A;  2VON A;  1D1B A;  3Q9V A;  5CVR A;  5L3G A;  5H2F C;  3K1N A;  3BG5 A;  3OV8 A;  1BBY A;  3FXO A;  1K7A A;  2KRC A;  2V9P A;  2CGP A;  1X4P A;  3CC4 I;  5KHD A;  2MC4 A;  2E34 A;  3CUQ C;  4KJZ A;  1MNE A;  1NK3 P;  3MFK A;  2YX7 A;  1I39 A;  1DPU A;  1R71 A;  3HOW J;  3DLL F;  1IN6 A;  4PGH A;  5FKK A;  2R4G A;  1EV7 A;  3P9K A;  1YTY A;  3S16 J;  4GFB A;  1PP8 F;  4MIM A;  2LBF B;  1BJA A;  2VXZ A;  1UEL B;  5EF6 A;  2EB7 A;  1TNS A;  2LK2 A;  1QA6 A;  4HYE A;  1Q1V A;  2DDA A;  2ADU A;  2UV1 A;  4LLN A;  1FBQ A;  4BXU A;  3BR6 A;  4BJT A;  2JQ7 A;  2CW0 F;  1WHU A;  1WJD A;  3P7N A;  1IF1 A;  4HQE A;  2EZI A;  5CVI A;  2BE5 F;  1MMG A;  3DPL C;  1HW1 A;  1ZAR A;  2IGN A;  3UR3 C;  4BE0 A;  4CXF A;  4UVB A;  3FIS A;  4WK8 F;  2FBH A;  1FOX A;  4UB6 C;  2UZK A;  5B66 C;  5ED4 A;  1FOK A;  1FIP A;  3FXU A;  2HXI A;  4GCV A;  3DLA A;  4A3K J;  3I71 A;  2OTL I;  2DQL A;  4XID A;  4G7O F;  4X1E A;  5D4R A;  5EG0 A;  1XSX A;  4HEA 2;  4XSX F;  4NB5 A;  5EGO A;  2V26 A;  5TIS C;  1KU7 A;  2Z16 A;  2W84 A;  4RGR A;  2WC2 A;  3E6D A;  1BI1 A;  3W6J B;  5JHF A;  3DBL B;  5C44 J;  1ZTR A;  1TW3 A;  1LFP A;  3PFI A;  1OCR H;  2VJ4 A;  3JSP A;  2CQN A;  3Q5F A;  3UNG C;  2KHM A;  4C9Y A;  1XDS A;  4BY1 J;  1TWC J;  2Q2E B;  3M8E A;  3WHB A;  2K5C A;  3JRH A;  2OC6 A;  5LEK A;  3J80 K;  1T6S A;  2F5E A;  1GUU A;  2W25 A;  1WGX A;  2BVL A;  2JVH A;  3FWE A;  5KK1 A;  4RAF A;  1IV6 A;  4A6D A;  1ZRC A;  1IDZ A;  4UV8 A;  1BJZ A;  1QNT A;  1A31 A;  1MBE A;  1U5T A;  4LJZ F;  3UKG A;  3VYR B;  3ZRG A;  2HVQ A;  1ZRE A;  3JAM K;  2KIS A;  3CJN A;  2HU9 A;  1ORK A;  5ICG A;  1KQ9 A;  2L9V A;  3BJ6 A;  3RYP A;  1X3W B;  1TZL A;  1FP2 A;  1SC7 A;  4BYY A;  2QBY B;  5DUK A;  1UB9 A;  1LEA A;  3ZGK A;  4LOC A;  4EM1 A;  4ESJ A;  1BC7 C;  4BHC A;  1G6N A;  3ZQG A;  3HDD A;  2C6Y A;  3WU1 B;  3E0J B;  2G7H A;  3HOZ J;  2KRH A;  3BR1 A;  2DJN A;  3LA7 A;  4M3G A;  1N77 A;  2R7S A;  1DDN A;  1REP C;  3SYT A;  2FX0 A;  2R7R A;  1QHG A;  2XGC A;  2HVS A;  3GLX A;  4UVC A;  5KVR A;  1HCR A;  1EH6 A;  2GAU A;  3CP8 A;  2AXL A;  5GAE J;  5FB2 A;  2IS2 A;  1TLH B;  5FD5 A;  4IZZ A;  5B1B H;  3GX4 X;  1G8X A;  1G4D A;  1FT9 A;  3GFM A;  2ZCW A;  2Y9Y A;  2XAG A;  3K0L A;  3ESW B;  1AKH B;  2L3D A;  5FRO A;  3CF2 A;  4RB2 C;  4CCO A;  1D3Y A;  2IS4 A;  4MTE A;  3PIP F;  3O6B B;  2EIJ H;  2PEX A;  5L3E A;  4E7I A;  2YR2 A;  2GLO A;  3ECH A;  1JT6 A;  5J8C A;  1LFU P;  2O61 A;  3CDL A;  3D1N I;  3RTR A;  3A01 A;  3LOC A;  3LAJ A;  4ESB A;  4IX7 A;  1K6O A;  3HBL A;  2E5Z A;  2R92 J;  4V2F A;  2XVC A;  2ID3 A;  1ULY A;  2K3P A;  3X2Q H;  2FE3 A;  1JI8 A;  2PMZ A;  2VQC A;  3OR2 C;  3WGG A;  5HS7 A;  4QPO A;  4LIU A;  2NVQ J;  3VB2 A;  5F1R A;  1VZ0 A;  1TBX A;  4S0H B;  4M73 A;  1HQC A;  2I5U A;  1U9N A;  3MVP A;  3NWT A;  4ZYD A;  1NG6 A;  2Z5U A;  1QHH D;  1MBG A;  3RDI A;  5C4X J;  3DKW A;  4L0Z B;  4HNU A;  3S32 A;  4BL0 B;  2BY1 A;  4CCK A;  2EZL A;  1TNT A;  5K7F A;  2XGE A;  3IL2 A;  3G71 I;  2JA8 J;  4CYD A;  1R22 A;  2CW7 A;  1FP1 D;  2DBB A;  1RKW A;  2GIZ A;  3A1Y A;  4G6Q A;  1MSE C;  3OYB A;  3J80 Z;  1YX5 A;  2ZXJ A;  2DW4 A;  4X6A J;  4CH7 A;  4XNF A;  2EK5 A;  2ZJR F;  1IRZ A;  3CCL I;  1S29 A;  1WI9 A;  2IEK A;  3QOP A;  4GGG A;  5ICF A;  3REO A;  1IC8 A;  1OYY A;  3JTG A;  3Q0W A;  4C30 A;  3FM3 A;  3BP8 A;  4QTR A;  4CZZ A;  1O3R A;  1J75 A;  3W2W A;  3ZMT A;  1YI2 I;  1P7I A;  3ZXS A;  3WGI A;  1TP4 A;  3I4P A;  5J40 A;  3EPZ A;  3PQK A;  5D6E A;  3OMY A;  3OSF A;  2LYC A;  4V19 K;  2KP6 A;  3CCV I;  3NRV A;  3FMR A;  1PVE A;  2H6B A;  2X51 A;  3FMS A;  4PJN A;  3G6E I;  2KJB A;  1IUF A;  1FNN A;  1WQ2 A;  3IHU A;  2KIM A;  1RR7 A;  4HV6 A;  4XBF A;  1BN5 A;  2L7M P;  1PUF B;  4PJM A;  3RJP A;  2LBF A;  3A0H C;  4XLF A;  4EGY A;  1SVO A;  3ROU A;  2LF7 A;  3K4M A;  2JA2 A;  2M2E A;  3KCC A;  4ZYE A;  2F48 A;  3GTL J;  4IRG A;  4NQW B;  1E3H A;  3CDI A;  2X1D A;  4NC6 A;  3HGG A;  3AG3 H;  4BQA A;  1KQ0 A;  2D1V A;  3PL8 A;  1PJR A;  1ZR2 A;  1OYI A;  3P9I A;  4B47 A;  4CSW A;  3BZK A;  4D7M A;  1X1P A;  1F4K A;  2AHQ A;  1SD6 A;  2DK8 A;  3ABU A;  2P0W A;  5FGM A;  5K7Z A;  2HPM A;  2AQF A;  2WAE A;  1I1S A;  3GZ5 A;  2QEX I;  1MBK A;  2JVG A;  4IXA A;  3CCS I;  2K9Q A;  4FIS A;  5AIP A;  1GT0 C;  3GCM A;  1T8I A;  2HDW A;  4N9H A;  1UHW A;  4Y3O A;  2K85 A;  2NVU B;  3HOT A;  2FEZ A;  4YG2 F;  1BW6 A;  5FKM A;  4MFD A;  3V7S A;  3NAR A;  3DV8 A;  4RA2 A;  4ZYA A;  2L9R A;  1IN4 A;  2KJC A;  1PDN C;  4DZJ A;  4AU7 A;  2XSD C;  3CQZ J;  4HA8 A;  1OPC A;  3GTP J;  2OAZ A;  3LSM A;  4KIC A;  5F27 A;  1FYM A;  3GZ6 A;  4L9V A;  3OOP A;  1T56 A;  5LHI A;  2HDC A;  1J5Y A;  3KYC B;  1SEU A;  4AIJ A;  1JGG A;  4FCY A;  3S2W A;  2KMU A;  1RUO A;  3I56 I;  2VI6 A;  3HC7 A;  2E2J J;  4WWC A;  4PJL A;  2EBI A;  3CDH A;  4P96 A;  4UVA A;  4PJJ A;  1IGN A;  2MD5 A;  1I3Q J;  2JWT A;  1E0E A;  1JHF A;  2YS9 A;  2OTJ I;  1YE9 A;  3U21 A;  5D6F A;  4IOA F;  3RI4 A;  2K3F A;  2E7X A;  3W3C A;  3D5L A;  4CHU A;  2P81 A;  3HKZ A;  3K2A A;  1B9M A;  1FMW A;  2FUG 2;  3ABT A;  5LRS A;  2DOE A;  2X6Y A;  1NG7 A;  4Y33 A;  1SAN A;  4FE7 A;  3CO6 C;  1O57 A;  2LSO A;  1P7J A;  5CYV A;  3NWS A;  1M1E B;  2MW8 A;  1AWC A;  1FLI A;  4XKW A;  4A3I J;  1B6A A;  2OV7 A;  1FWZ A;  3QYE A;  4LFU A;  3BQZ A;  3ZMU A;  4M9S A;  1P2F A;  3F21 A;  2NRA C;  4NC8 A;  4EV0 A;  3SFI A;  1IXR C;  2E1O A;  3DP7 A;  1OR7 C;  4L9J A;  3SDB A;  2Y0M A;  4A3C J;  2R7X A;  3HUG B;  3LA2 A;  2MH9 A;  2ICW G;  3ISP A;  3HOX J;  4C3H J;  4A3D J;  3VSK A;  1FYK A;  2VQG A;  3AKZ A;  3SEQ A;  5LFA A;  3J81 Z;  1V5F A;  3DXJ F;  1VQ6 I;  1MDM B;  1UZC A;  4HLY A;  2H8R A;  1DQU A;  2MC3 A;  2G7U A;  2BHY A;  3BCB A;  1ZH5 A;  2XF7 A;  3E5U A;  1HSJ A;  4C3I J;  3S2D J;  3ABK H;  3W2V A;  2R5Y A;  4XRF A;  5DS9 A;  3F8M A;  3N05 A;  1JTX A;  5E1X A;  1MNM C;  2HQA A;  1R6R A;  1SMY F;  4PDK A;  5CVV A;  1R9T J;  2FBI A;  3L2C A;  2STT A;  3CUO A;  2M3A A;  1FBU A;  3OYD A;  5L3F A;  1D1A A;  2W7N A;  2W24 A;  3Q0V A;  1RI7 A;  3JCU C;  3KZI C;  3H9G A;  3R0A A;  1DP3 A;  1I6X A;  1FZP B;  2JA7 J;  2VPL A;  2PG4 A;  2RQP A;  1GVJ A;  3I53 A;  1U9O A;  4A5M A;  2X85 A;  4BAY A;  2YU3 A;  3MKZ A;  3GTO J;  2VC0 A;  2ZC2 A;  1ETX A;  3H5A A;  1RES A;  4CCN A;  2BZT A;  1T98 A;  5L3B A;  3MZH A;  2OD5 A;  3OL3 A;  5HS8 A;  3I54 A;  1G59 A;  1RPW A;  3SZT A;  2DU9 A;  4IEJ A;  3WTX C;  3QYB A;  5IT9 K;  1IZ1 A;  3B6C A;  2BXZ A;  3DU5 A;  1U0J A;  2ECC A;  1D0Z A;  3DTI A;  3E3V A;  4KT5 C;  5DM6 F;  1VQ5 I;  4R79 A;  3A0B C;  1W7P D;  2HQN A;  1GLN A;  3OIP A;  4N0B A;  3U1D A;  5F0H A;  3OYM A;  2TDX A;  3QPT A;  4UUS B;  2DA3 A;  2ZNZ A;  5HDG A;  3T8T A;  2L54 A;  4OU0 A;  2BOL A;  4AUX A;  2OU2 A;  3RIR A;  2DT6 A;  5LD2 C;  1SD7 A;  3S15 J;  3V8K A;  4Q4Z F;  2ELJ A;  3CES A;  2O6G E;  1SFX A;  2N8G A;  4WCG A;  1R5H A;  2GOX B;  4N4N B;  4DJA A;  5KNL A;  5IYD J;  3K2Z A;  2HI3 A;  2K9S A;  5J1R A;  1OIS A;  3CCM I;  1BI0 A;  1VQ8 I;  1W1W E;  4OIN F;  1R00 A;  2H09 A;  4XON A;  3PFY A;  4E6K G;  4RB3 C;  2KIF A;  3WTW C;  2QYO A;  4A3G J;  1WJ5 A;  1UFM A;  3H1C A;  4M3D A;  1YOV B;  1DU0 A;  3MCZ A;  4O6J A;  3LSG A;  2W1O A;  2I10 A;  4V2G A;  5TGT A;  4B48 A;  4NQW A;  3HRM A;  2A68 F;  2M5W A;  4MFE A;  3LWF A;  1X3Z B;  2HQ5 A;  3WE3 A;  3JSO A;  5FLX K;  2JPB A;  3LSP A;  4YFN F;  1D5Y A;  2ZBK A;  4I01 A;  4XKV A;  1Z6T A;  3PNT A;  3ZMV A;  5HLT A;  3G3Z A;  4E7Z A;  2M8E A;  2QKM B;  2OCE A;  1FMV A;  3I3L A;  3HGY A;  1QRY A;  3DFG A;  3K70 C;  4J00 A;  1R49 A;  4G9Y A;  1FPQ A;  4HLX A;  4B09 A;  1DUX C;  2WAQ N;  3F8N A;  5IP7 J;  1WWX A;  1W7P B;  4HF0 A;  4ESF A;  2RV8 A;  1XTA A;  3FKI J;  1YJN I;  2R7V A;  1T0F C;  5EEH A;  2MA3 A;  3G2B A;  3L09 A;  2IPQ X;  1Z3X A;  2TRT A;  2BY3 A;  2DMU A;  3DF8 A;  3M1E A;  5J4V A;  3CO7 C;  4EJW A;  4AYB N;  2ZXH A;  1LDK B;  4XLN F;  3N4M A;  1Z0X A;  2PMH A;  4Y13 A;  2EV0 A;  4R1H A;  5DCM B;  4GYI A;  1BC8 C;  1VQ7 I;  1I50 J;  3LAP A;  2XSJ C;  3JRA A;  4AYB A;  2DFH A;  1BI3 A;  2QA4 I;  1GV5 A;  2BXY A;  2XKP A;  2Y75 A;  4LG3 A;  3JR9 A;  3F22 A;  2HQR A;  5M3M J;  3OYE A;  3V8L A;  5IP9 J;  4O5V A;  1UG0 A;  3VYT B;  1JT0 A;  4XLA A;  2O5R A;  5ILU A;  2ESN A;  5TJJ A;  3BPV A;  4QWQ A;  2ID6 A;  3PM1 A;  2NS7 A;  3RKW A;  2CH0 A;  3E97 A;  2AS5 F;  2IGK A;  1ENH A;  2E2I J;  3S1M J;  1LE8 B;  2H27 A;  4HNV A;  1KA8 A;  3MZ8 A;  3F6O A;  2VKV A;  2VJI A;  5EDN A;  1D5V A;  4Y7N J;  3H5R A;  2LKS A;  3CLQ A;  4QIW N;  1B72 A;  1MJA A;  3ZQL A;  1WFX A;  4F92 B;  3I59 A;  3KP6 A;  2R5Z B;  1JKR C;  4FX4 A;  3M07 A;  2LNB A;  2CO5 A;  1YIJ I;  1X2N A;  2EIL H;  2JRT A;  3HUG A;  1IG7 A;  4C2U A;  1TT0 A;  5FJ8 J;  3IRQ A;  2XGD A;  2HS5 A;  2VJJ A;  4HNT A;  3KIO A;  2VUM J;  3E1S A;  3H3U A;  2VBX A;  2IJL A;  2ETH A;  5DCF A;  1MMA A;  1MDM A;  4X0G A;  1CF7 A;  1YFH A;  5LRR A;  1ZLK A;  3QP6 A;  2EV5 A;  3BPX A;  3DEE A;  2HZT A;  1TC3 C;  3HSR A;  1S7E A;  2MD0 A;  1F9N A;  1SFE A;  2LC2 A;  3KLO A;  1XGM A;  5AON A;  2DN0 A;  4C3J J;  5FLX Z;  2L01 A;  3HIF A;  2JRM A;  3BCA A;  2F5C A;  1IRF A;  3G1L A;  3MEX A;  5GPA A;  6PAX A;  1Y6I A;  4XK4 A;  1WH7 A;  3RQI A;  5GPC A;  4RDU A;  4L0Y B;  5K1Y A;  1QPI A;  4BNC A;  2HVR A;  3GTJ J;  3OS2 A;  1KU9 A;  3EYY A;  2Y0S A;  4RM3 A;  4JBA A;  2MBF A;  2WV1 A;  4A3B J;  1D1C A;  1BL0 A;  1Z9C A;  3ABL H;  1O7F A;  1YX3 A;  3GUD A;  1Z6R A;  2X0L A;  4RMN A;  3WTU C;  3GFI A;  2LF8 A;  1ETY A;  2M87 A;  2DMQ A;  1Y0N A;  4EJT A;  4UNO A;  3E5X A;  4PSX A;  4ZDL A;  4AIH A;  1ON2 A;  3E5Q A;  3L7W A;  4G7H F;  4MTD A;  1YS6 A;  2AXT C;  2MG4 A;  1JKP C;  5M3F J;  2VE8 A;  1HXD A;  1G3W A;  3W2A A;  1QPM A;  1KZH A;  3M9A A;  5HNF A;  4ZDO A;  3WU2 C;  1W5T A;  5B1A H;  2O9L A;  2QLZ A;  1S3J A;  1OYW A;  2HFH A;  3CCR I;  4UUS A;  2A5W A;  2L7K A;  5L3C A;  3BR3 A;  4PK4 A;  4Y52 J;  1KU2 A;  2A07 F;  2B9S A;  2COB A;  4XSZ F;  5JLX A;  2CUJ A;  4UUT A;  2RGV A;  1MIJ A;  5CQG A;  1Z05 A;  2RRE A;  2HNH A;  1JHH A;  1UJ8 A;  4DYQ A;  4L9N A;  2RAE A;  3TO9 A;  1W0T A;  5D5W B;  1NK2 P;  4I0A A;  5CVU A;  4D5C A;  3SHF A;  2X6X A;  3BTJ A;  5JFR A;  3GYH X;  4EM2 A;  3I0T A;  3TDZ C;  2L4M A;  2O3F A;  3OYJ A;  2ZXI A;  1B4A A;  1ZG5 A;  4B3A A;  2X4H A;  2OQR A;  1GHC A;  2Z3Y A;  1H8A C;  1XMX A;  1MMN A;  4LIT A;  3C2G A;  1HST A;  4DYR A;  2PBI A;  4XN3 A;  4RGX A;  2L7Z A;  3NEU A;  2DPU A;  1ZKG A;  2CQX A;  2QEN A;  1HA8 A;  1RUN A;  3VFZ A;  5FRN A;  1BW5 A;  1A35 A;  1T95 A;  3A03 A;  3F9K A;  2MFZ A;  3J7A Y;  4KN7 X;  1G3Y A;  2JMW A;  1YRN B;  2JA6 J;  5BNG A;  2KZG A;  4EEF G;  4A0Y A;  2XIG A;  1SVM A;  2L9S A;  1B1B A;  4N9I A;  4D0P A;  4XMY A;  4B4C A;  2ACJ A;  3OWT A;  1HKT A;  1IJW C;  1T38 A;  5D8L B;  2QVO A;  5LHG A;  1U5T C;  1J0R A;  2NYX A;  4YEJ A;  4MGR A;  1K78 B;  3VPR A;  1ZEL A;  3BT9 A;  5GTH C;  3FXQ A;  2JSC A;  2B7E A;  3QOE A;  3WTV C;  4MO7 A;  3LMM A;  4RLQ A;  1A6Q A;  3RPU A;  1VQK I;  5DCM A;  1V55 H;  1LQ1 A;  3PO3 J;  1JTY A;  4ON0 A;  1I3A A;  2HKX A;  4YFK F;  3I64 A;  1ZRD A;  2EIK H;  1TWA J;  4QSH A;  3F8B A;  1KGS A;  4LG0 B;  3N97 A;  1EH8 A;  1V5E A;  3FK6 A;  2DFE A;  2OZU A;  1JUS A;  2Y2Z A;  2ME6 A;  5GAG J;  5HLH A;  1WSU A;  3WE2 A;  2FA5 A;  2FMY A;  2DYS H;  4EGZ A;  2P6T A;  1ZGJ A;  3LA3 A;  1ITY A;  1WI3 A;  4LK0 F;  4AD9 A;  1FX7 A;  1ETK A;  3HJE A;  3TW6 A;  3JRB A;  5IP6 A;  1MJB A;  2KZV A;  2M4G A;  1QZZ A;  2P4W A;  3HHH A;  3F8C A;  2ZFW A;  5BMZ A;  3IP4 B;  3LQQ A;  1LVA A;  3M8F A;  4DOZ A;  1XCB A;  2MLG A;  5DYM A;  2R5Z A;  2CG4 A;  2WB1 N;  1YW8 A;  4GRI A;  3WG7 H;  3L2R A;  2NNY A;  1YW9 A;  2VBZ A;  1MJ9 A;  2X6O A;  2JUC A;  4KIS A;  4N4O B;  3H92 A;  2LRE A;  1TTY A;  3L00 A;  4KIT B;  3LSK A;  2WB1 A;  2IT0 A;  2WAD A;  3D0S A;  3ABM H;  2PMZ N;  3HOY J;  4IRI A;  3F23 A;  5LEJ A;  2E1M C;  4CYC B;  2PFB A;  1IRG A;  2Z9O A;  1AHD P;  4LK1 F;  2JSP A;  2FD5 A;  1RKT A;  4E7L A;  2XF5 A;  2X48 A;  2PN6 A;  4NHJ A;  3ZQH A;  1U3E M;  2V1U A;  2L7F P;  5IT3 A;  1XS9 A;  1O3Q A;  3ELK A;  3PUF A;  3J7A O;  4ZZD A;  2DA7 A;  4XLE A;  1N25 A;  3GFJ A;  4XN0 A;  2E60 A;  1LDD A;  4ZTJ A;  4MNU A;  1Z3Y A;  3BR2 A;  4L5I A;  2QQ9 A;  3FZV A;  3EQL F;  1VQ4 I;  3EYI A;  2AO9 A;  1LPQ A;  1X2M A;  4BQN A;  2J5P A;  3WGH A;  3A2K A;  1QGP A;  2EA2 A;  1JXS A;  1QVU A;  2ZSH B;  3RKX A;  2BHZ A;  3DBH B;  3JRF A;  1QZY A;  3A02 A;  3WHC A;  2RNG A;  2GIV A;  1FJL A;  1K83 J;  1ETV A;  4LMY A;  3KEO A;  4G94 A;  4U88 A;  1HOM A;  4XOT A;  5L3D A;  5HDN A;  2ZO4 A;  4UXN A;  4Y15 A;  2E35 A;  2MLK A;  1JJ6 C;  2P7V B;  1FYL A;  3ZMD A;  1OCP A;  3ULQ B;  3J7Y J;  2OQG A;  4C2T A;  2M7B A;  2NS8 A;  1AOY A;  4RAY A;  2GZW A;  4HV5 A;  3M8J A;  3MKL A;  4E7K A;  2ZME B;  2VXD A;  2R7T A;  1OJL A;  1T08 B;  2M30 A;  3RYR A;  4A0X A;  3EET A;  2DA1 A;  4M72 A;  1MKM A;  3L2U A;  1WJB A;  3K70 D;  4IHW A;  3J81 K;  1X58 A;  4P5O A;  5IPA A;  3AL0 B;  4LB6 B;  4LD5 A;  4YIF A;  2Z33 A;  4CA0 A;  2IRF G;  1J7K A;  2NOG A;  2Q0O A;  3ZR8 X;  2PJP A;  4RLF A;  4IKF A;  3MD2 A;  4II3 A;  4EMS A;  2WA0 A;  4EVI A;  4HX4 A;  2NOJ B;  1X1C A;  3L2Q A;  3VSL A;  2K9L A;  1ZGW A;  3PNV A;  2BV6 A;  1L3L A;  3IH4 A;  1S7A A;  5M5X J;  2K86 A;  3C18 A;  2JPC A;  3ASN H;  2ZFU A;  4DNC A;  2QF7 A;  1AA7 A;  3RPQ A;  4HBL A;  2A5Y B;  2CUZ A;  4I7H A;  4G7Z F;  2V1N A;  3TMO A;  4CUG A;  4B43 A;  1RR8 C;  2DPD A;  2A69 F;  5BPD A;  1B9N A;  1S5L C;  2KL4 A;  3I4M J;  5M5W J;  4XRM A;  3GLL A;  4ZTF A;  2H6C A;  2B0L A;  5DTD A;  1U8B A;  3I9V 2;  5DM7 F;  3OYG A;  4KA4 A;  2HR3 A;  4B3X A;  2K4B A;  2L0K A;  4KT6 A;  2Q2E A;  1QU3 A;  3KPH A;  3RZO J;  2JA5 J;  1K78 A;  3O8H A;  2W4S A;  4AC0 A;  5C4J J;  5J1U A;  3BLY A;  4U0W A;  3HKZ N;  3QRF F;  4CCJ A;  2VLA A;  1FSE A;  3T0Y A;  2HOA A;  3MZY A;  2IXS A;  4CZC A;  1UHM A;  2BW3 B;  1IAW A;  2CV0 A;  3GO5 A;  1MBH A;  4KDP A;  5LHH A;  2DLL A;  3PUB A;  1HC8 A;  2EA4 A;  4O3M A;  3FIW A;  5IYC J;  4LG0 A;  4TV7 A;  1IW7 F;  4JX6 A;  1PP7 U;  2NS0 A;  1ZHF A;  2QBY A;  3G1M A;  1T2K A;  2WY7 Q;  3DTE A;  1H89 C;  1XX5 A;  3ZMS A;  1VF9 A;  4L5J A;  5F64 A;  1HLV A;  1OKR A;  2DO7 A;  2XPV A;  4BBR J;  1HDP A;  2PJR B;  3TDU C;  3DEW A;  4GYG A;  4MQ9 F;  2BYV E;  3BY6 A;  4E7J A;  3O2P E;  2FQ3 A;  4B44 A;  2EFP A;  5EZG A;  4A2U A;  2ELH A;  1I27 A;  4I02 A;  1VQN I;  1YYV A;  2L2O A;  1HW5 A;  5KAF C;  5GTI C;  2KIU A;  1X3U A;  1MH4 A;  5CVJ A;  1KYW A;  1APL C;  4MEX F;  4PCQ A;  2F4I A;  1U2W A;  4IHT A;  1ZG3 A;  2IP2 A;  4KIG A;  1F43 A;  1XSV A;  1Z7L A;  1AKH A;  1XMA A;  2V9V A;  1BIB A;  3TOA A;  3GFL A;  5JR3 A;  3QPL A;  1VI0 A;  1ZAO A;  4HSR A;  3SZG A;  5GAD J;  4M3E A;  2NVY J;  4PFP A;  1J09 A;  4PGG A;  4E7H A;  3SFZ A;  2O0Y A;  4WXH A;  4ZH4 F;  4HDU A;  4KIB A;  4D1Q A;  2XRN A;  3FXJ A;  2F2E A;  2QUF A;  2CFX A;  1E3O C;  2R93 J;  1XG1 A;  2LKP A;  4BBS J;  3O3K A;  4J01 A;  2YSR A;  1P4X A;  2JT1 A;  1MW7 A;  2XUB A;  2LDU A;  3ECO A;  2KIQ A;  3FDY A;  2ELK A;  3ONQ A;  2L02 A;  1OMI A;  1ONV A;  3DPU A;  5BPI A;  4OAY A;  1QBJ A;  4BE2 A;  1O7L A;  1TWG J;  3BTL A;  4IHX A;  3K6G A;  1IV8 A;  2IGM A;  4F91 B;  4AM3 A;  1MSF C;  3EUA A;  5IY5 H;  3I55 I;  5K5Q A;  3OS1 A;  3Q9S A;  1H9G A;  2EIN H;  4IRH A;  4MQV A;  2Q8K A;  3J7Z I;  4KMU X;  2ISZ A;  1BM9 A;  4BEH B;  5B3S H;  4P55 A;  4II2 A;  5F0F A;  4YRV A;  4BE1 A;  1B8I B;  4WF2 A;  1F1Z A;  5LGN A;  4S04 A;  4HG2 A;  2NVX J;  4IQ4 A;  2DOF A;  3DKY A;  2DT7 B;  3WG9 A;  3TED A;  2V6E A;  1UST A;  2ZNY A;  1XB4 A;  3ZQC A;  3E6B A;  2STW A;  2M1B A;  3DKX A;  2QSH X;  2HPI A;  2R0Q C;  2W48 A;  2VOD A;  1K6Y A;  4IQJ A;  3K1P A;  1R5G A;  2NXN B;  2DT5 A;  3AG4 H;  2D5V A;  1E2X A;  3GTM J;  2XRL A;  1LEB A;  2O8K A;  2FSW A;  2IW5 A;  1S6L A;  2QCO A;  4CO8 A;  3MKY B;  1TWH J;  4A3J J;  1GXP A;  4F7Z A;  3WTS C;  2RC4 A;  4PUS A;  5E3O A;  2V79 A;  2TCT A;  3C2B A;  1YJ9 I;  3IRR A;  1SMT A;  1IN8 A;  2M34 A;  4OIO F;  4MLO A;  2ZME A;  1PUF A;  3HOV J;  2M9H A;  3M7G A;  3U9G A;  1MH3 A;  3GXO A;  1Z67 A;  1MND A;  3CJT B;  4BXF A;  3KZY A;  4DBR A;  3JRE A;  3JTH A;  3KET A;  4HW0 A;  1YW7 A;  4IHV A;  4BXX J;  3DCF A;  4F52 A;  3CP2 A;  3CMA I;  3VYU B;  4U0V A;  1WJF A;  4A3F J;  2XAS A;  1R1T A;  3G4S I;  3CUQ B;  5IYB J;  1H0M A;  2VKE A;  3S1R J;  2HEO A;  4EM0 B;  2UXX A;  5HS9 A;  2GBY A;  2EZH A;  3OYN A;  5LGU A;  1R5I D;  1LVK A;  3LFK A;  5HDK A;  1N78 A;  3RKQ A;  3U2R A;  5F08 A;  1WZ2 A;  3PSF A;  5LGT A;  2VN2 A;  1PUE E;  3EUH C;  1MBF A;  1SFO J;  1ZLJ A;  2DMT A;  4YII A;  3A4C A;  2LMD A;  1POG A;  2EV6 A;  5H6Q A;  1ZN2 A;  2VQH A;  4RAG A;  4ASN A;  2QWW A;  4HQM A;  3S3N A;  3EUH A;  5GAH J;  3L1P A;  2V1D A;  3F0C A;  3GME A;  1YO5 C;  3HTS B;  3HRT A;  4IL6 C;  4M3B A;  5EG0 B;  3PSI A;  2MAB A;  3MMY B;  3SQN A;  4C2M J;  3I58 A;  3EUK L;  2KQR A;  3HTU A;  3H35 A;  4ZYH A;  3TL4 X;  4E4H A;  2P5L C; 
#chains in the Genus database with same CATH homology
 3EDP A;  4EJO A;  4KYW A;  5AIQ A;  5E17 F;  4M71 A;  4R8H A;  4FHT A;  5H20 A;  2PLY A;  4I09 A;  4YFX F;  4KMF A;  1XGO A;  4AVP A;  4WX9 A;  2XGX A;  2XV4 S;  3VEP A;  5FO5 A;  2QM3 A;  1D8K A;  2VT2 A;  2FNP A;  1WRJ A;  2NAZ A;  4OIP F;  3GWZ A;  2CWE A;  1FBS A;  2EFW A;  1IN5 A;  2IVM A;  5HLG A;  4CGZ A;  1ON1 A;  4KUM A;  1HW2 A;  5D4S A;  3TO6 A;  4OMY A;  1T39 A;  3WTY C;  3ZMZ A;  3QAH A;  2HGC A;  5BOX A;  2RNJ A;  3W6K B;  2VBW A;  3GW2 A;  3FXR A;  3HSE A;  4RB1 A;  4FX0 A;  5D8K B;  2F5D A;  2P5K A;  2WV0 A;  3ZN1 A;  3AAF A;  3E6C C;  3TO7 A;  3GEZ A;  3FMQ A;  4P9F A;  2UXN A;  1YS7 A;  2JTV A;  1RIO H;  3KP7 A;  1P4A A;  3G73 A;  2EFN A;  2OBP A;  1Z7U A;  5HOO A;  4JK1 X;  4ENN A;  5HLI A;  4G8X A;  2DI3 A;  1S8N A;  5E1W A;  3F3X A;  3TOB A;  1YIO A;  4LGW A;  4HF2 A;  2DQR A;  2VOP A;  3R6S A;  4JQF A;  4DQ2 A;  4LB5 A;  5DD4 A;  5DDG A;  1NHA A;  3HYI A;  3KP4 A;  2CYY A;  4U0Y A;  4GO1 A;  1SFU A;  3R4K A;  5HVQ C;  5ICC A;  3CUQ A;  4HX8 A;  2RVC A;  2COM A;  4EQQ A;  3DQV C;  4EJU A;  2V6C A;  1R36 A;  1LDJ A;  2YX4 A;  5D5X B;  4A0Z A;  1GXQ A;  1TQP A;  2PMU A;  2XAJ A;  3FX3 A;  1W7P A;  5K5R A;  4HDV A;  2H94 A;  4BH9 A;  2WTE A;  1QQI A;  3MWM A;  2OZ6 A;  1YLF A;  3T5X A;  3F6V A;  2EFQ A;  5A2Q Z;  4A5N A;  2DTR A;  4FT8 A;  1SD4 A;  3V4G A;  3ZN0 A;  2Z99 A;  2O03 A;  2GA1 A;  5ICE A;  1I1G A;  2MH2 A;  2E1N A;  2D2W A;  1ZYR F;  1S7O A;  3FHZ A;  1Z91 A;  4RGU A;  5D5V B;  4IHS A;  4A12 A;  2D45 A;  2GXB A;  2FOK A;  3HRU A;  2K27 A;  2UWM A;  4RS8 A;  3FF5 A;  1XMK A;  3NQO A;  1V3F A;  3IWZ A;  4CIC A;  5ILV A;  2PQ8 A;  2W57 A;  4H0E A;  2HTS A;  1VTN C;  3P9C A;  1Q1H A;  1FY7 A;  2QZ8 A;  2GA2 A;  1HBX G;  4M6Y A;  2P5V A;  3CTA A;  3C3W A;  2QQA A;  3QU3 A;  1RNL A;  1F5T A;  4HF1 A;  4L18 B;  2E7W A;  2XAH A;  2O8X A;  1YQA A;  2L4A A;  3TGN A;  3IWF A;  2HYG D;  4ETS A;  2R7F A;  1J59 A;  1TQI A;  2IA2 A;  3MQ0 A;  4PZJ A;  2A61 A;  4IVN A;  2QQB A;  1CGP A;  2A6E F;  1H9T A;  3TQN A;  3HOS A;  1ODD A;  4XLP F;  2DK5 A;  4P9U A;  5LBQ A;  3ZPL A;  2EJR A;  3F8F A;  2KRF A;  3VOD A;  5DUI A;  2J5O A;  2ZKZ A;  1XGN A;  3KZZ A;  2EFO A;  4HX7 A;  1DPR A;  1P6R A;  1B59 A;  5E18 F;  3JAM Z;  5ILS A;  2EWN A;  5J6X A;  2BEO A;  4I98 B;  4OOI A;  4G6D A;  1R1U A;  4OIR F;  1U8R A;  4KNY A;  1XSD A;  4I2O A;  3BOQ A;  2XRO A;  2BBY A;  2ISY A;  5E20 A;  2GWR A;  1YG2 A;  3QU6 A;  1E17 A;  1ZRF A;  2XHK A;  4EJV A;  2R3S A;  1O3T A;  1DP7 P;  2FML A;  3K69 A;  1UCR A;  2XKO A;  3BJO A;  3K1M A;  4M9Z A;  3KLN A;  4LLL A;  2FRH A;  3B02 A;  3R61 A;  1R7J A;  2KKO A;  2DAO A;  1G3T A;  3T1B A;  3WTT C;  2NNN A;  2OA4 A;  5D5U B;  4HAM A;  5JI6 A;  2GXG A;  3I5U A;  3GF2 A;  2JZY A;  4KIF A;  2YPR A;  4KN4 X;  2D1H A;  1QO0 D;  1Y0U A;  1LB2 A;  2FU4 A;  4U7B A;  3BJA A;  5BS6 A;  5TRD A;  3SXY A;  2FNA A;  2VC1 A;  2P8T A;  2K4J A;  2E1C A;  3C1D A;  2K02 A;  1SD5 A;  1BOA A;  4ENM A;  1MGT A;  2M45 A;  4U7D A;  2RKH A;  1JE8 A;  4M9X A;  3T8R A;  3F72 A;  1J9I A;  3C7J A;  4UUV A;  5H6R A;  1XN7 A;  4UHT A;  3KFW X;  3I59 B;  3KP2 A;  3ML6 A;  4I0B A;  5DV5 A;  3H3Z A;  4QLC U;  1IXS B;  3V7C A;  4BHB A;  4RAZ A;  1LNW A;  1MD0 A;  1OR7 A;  5E8G A;  1CF7 B;  4ZYG A;  1FSH A;  3L9F A;  5ERI A;  4WXD A;  3R60 A;  1HKQ A;  1IXC A;  2ESH A;  1R1V A;  4RGS A;  2W85 A;  1SAX A;  1JGS A;  3TKY A;  2DFI A;  3K9T A;  1TQM A;  2WWY A;  3WU0 A;  1W4M A;  3CLO A;  4M74 A;  1A04 A;  1R58 A;  1HKS A;  3E6M A;  3IKV A;  4AIK A;  2IA0 A;  4MHG A;  2RDP A;  2HOE A;  4A6E A;  2K7L A;  1O3S A;  4HOB A;  4HZF A;  2FBK A;  1MZB A;  1J2X A;  1LJ9 A;  3HRS A;  3R0J A;  3COA C;  3GVA A;  5BQT A;  1G3S A;  3ZQ7 A;  1ZG1 A;  1Z1D A;  1XD7 A;  1ZGA A;  1I5Z A;  4E70 A;  4ZZL A;  4S05 A;  3QPH A;  1FC3 A;  3DEU A;  1P4W A;  3LQR A;  1V4R A;  3HSF A;  5DD8 A;  1D8J A;  3KE2 A;  4B8X A;  3MAJ A;  4MEY F;  2RN7 A;  3KP3 A;  3V7R A;  2G9W A;  1USS A;  4CDG A;  2HTJ A;  5JVT A;  2P7C B;  4WXC A;  4IPA A;  4Q47 A;  1U78 A;  2GQQ A;  5CJ9 A;  1K79 A;  2HWV A;  3BDD A;  4IJA A;  2IA1 A;  5CLS A;  4ENJ A;  5FD6 A;  3LST A;  1XDU A;  3KEQ A;  4AWX B;  5DEQ A;  5EEG A;  2CQK A;  2VOO A;  1T0F A;  2A6H F;  1U5T B;  1IUY A;  2VE9 A;  2HKO A;  5E8I A;  2HYF A;  1KU3 A;  3SZP A;  3ERE D;  2V1X A;  4RB0 A;  3VOE A;  5IT9 Z;  5FFX A;  3PQJ A;  2P6S A;  4Q48 A;  4OIQ F;  1TW2 A;  2CSO A;  5JHU A;  3BZ6 A;  4Y17 A;  4M6X A;  4Z2Y A;  4Q5S F;  1WKM A;  4ENK A;  3ZP5 A;  1EH7 A;  4K2E A;  1C0W A;  1STZ A;  4IF4 A;  5FFZ A;  3IC7 A;  1R23 A;  1RZ4 A;  4UV9 A;  2VBY A;  3BWG A;  1L0O C;  3V8J A;  1KYZ A;  5J8F A;  3KP5 A;  4KFC A;  2FF4 A;  3IKT A;  3QP5 A;  4L9T A;  2VT3 A;  5A2Q K;  1U6G A;  3RKY A;  3HHG A;  5E1Z B;  3B73 A;  2A3S A;  1BIA A;  2R7D A;  3JW4 A;  1XCV A;  2Y48 A;  2F5F A;  2ZJ2 A;  5F6F A;  1W5S A;  3FM5 A;  4LLG F;  1BI2 A;  5LLQ A;  3WTZ A;  3BRO A;  2BGC A;  2XAQ A;  2FXA A;  1XGS A;  5K5O A;  1P92 A;  4GXO A;  1KQ8 A;  3DPT A;  1IN7 A;  3WOD F;  4OMZ A;  2XAF A;  2PI0 A;  4BHP A;  2VON A;  3Q9V A;  5CVR A;  5L3G A;  3K1N A;  3OV8 A;  1K7A A;  1BBY A;  2CGP A;  3CUQ C;  3MFK A;  2YX7 A;  1DPU A;  1IN6 A;  4PGH A;  1EV7 A;  3P9K A;  1YTY A;  1PP8 F;  1BJA A;  2VXZ A;  2EB7 A;  1TNS A;  4HYE A;  2ADU A;  4LLN A;  1FBQ A;  4BXU A;  2CW0 F;  3P7N A;  1IF1 A;  4HQE A;  5CVI A;  2BE5 F;  3DPL C;  1HW1 A;  1ZAR A;  4CXF A;  4UVB A;  4WK8 F;  2FBH A;  2UZK A;  5ED4 A;  1FOK A;  3FXU A;  4GCV A;  3I71 A;  2DQL A;  4G7O F;  5D4R A;  1XSX A;  4XSX F;  4NB5 A;  1KU7 A;  2W84 A;  4RGR A;  2WC2 A;  3E6D A;  1BI1 A;  3W6J B;  1TW3 A;  3PFI A;  3JSP A;  3Q5F A;  1XDS A;  3M8E A;  5LEK A;  3J80 K;  1T6S A;  2F5E A;  3FWE A;  2W25 A;  5KK1 A;  4A6D A;  1ZRC A;  4UV8 A;  1QNT A;  1U5T A;  4LJZ F;  1ZRE A;  3JAM K;  3CJN A;  5ICG A;  1KQ9 A;  3BJ6 A;  3RYP A;  1FP2 A;  4BYY A;  2QBY B;  5DUK A;  1UB9 A;  1LEA A;  4EM1 A;  4ESJ A;  1BC7 C;  4BHC A;  1G6N A;  2C6Y A;  3WU1 B;  2G7H A;  3LA7 A;  1DDN A;  1REP C;  3GLX A;  4UVC A;  5KVR A;  1EH6 A;  2GAU A;  5FB2 A;  2AXL A;  1TLH B;  5FD5 A;  3GX4 X;  1G4D A;  1FT9 A;  3GFM A;  2ZCW A;  2XAG A;  3K0L A;  2L3D A;  4RB2 C;  1D3Y A;  4MTE A;  3O6B B;  2PEX A;  5L3E A;  2YR2 A;  3ECH A;  5J8C A;  2O61 A;  3RTR A;  3LAJ A;  4ESB A;  1K6O A;  2XVC A;  1ULY A;  2FE3 A;  3WGG A;  5HS7 A;  3VB2 A;  5F1R A;  1TBX A;  4M73 A;  1HQC A;  4ZYD A;  2Z5U A;  3RDI A;  3DKW A;  4L0Z B;  1TNT A;  3IL2 A;  4CYD A;  1R22 A;  1FP1 D;  2DBB A;  4G6Q A;  3J80 Z;  2ZXJ A;  2DW4 A;  2EK5 A;  1S29 A;  1WI9 A;  3QOP A;  4GGG A;  5ICF A;  3REO A;  1OYY A;  3JTG A;  3FM3 A;  3BP8 A;  4CZZ A;  1O3R A;  1J75 A;  3ZMT A;  3WGI A;  3I4P A;  3PQK A;  5D6E A;  3NRV A;  3FMR A;  2H6B A;  3FMS A;  2KJB A;  1FNN A;  1WQ2 A;  3IHU A;  2KIM A;  4HV6 A;  4XBF A;  1BN5 A;  3RJP A;  4EGY A;  3ROU A;  2LF7 A;  4ZYE A;  3KCC A;  4IRG A;  4BQA A;  1KQ0 A;  2D1V A;  1OYI A;  3P9I A;  1F4K A;  1SD6 A;  2DK8 A;  3ABU A;  5FGM A;  1I1S A;  3GZ5 A;  4IXA A;  5AIP A;  4N9H A;  3HOT A;  1UHW A;  2FEZ A;  4YG2 F;  3V7S A;  3DV8 A;  1IN4 A;  2KJC A;  1PDN C;  4HA8 A;  1OPC A;  2OAZ A;  4KIC A;  1FYM A;  3GZ6 A;  4L9V A;  3OOP A;  5LHI A;  2HDC A;  1J5Y A;  4AIJ A;  3S2W A;  1RUO A;  4WWC A;  3CDH A;  4P96 A;  4UVA A;  2MD5 A;  1JHF A;  5D6F A;  3RI4 A;  2E7X A;  4CHU A;  3D5L A;  1B9M A;  3ABT A;  5LRS A;  3CO6 C;  1O57 A;  2LSO A;  5CYV A;  1AWC A;  1FLI A;  1B6A A;  1FWZ A;  4LFU A;  3ZMU A;  4M9S A;  1P2F A;  3F21 A;  2NRA C;  4EV0 A;  1IXR C;  3DP7 A;  4L9J A;  2Y0M A;  3LA2 A;  2MH9 A;  3ISP A;  1FYK A;  3J81 Z;  3DXJ F;  1MDM B;  4HLY A;  2MC3 A;  2G7U A;  1ZH5 A;  3E5U A;  1HSJ A;  4XRF A;  3F8M A;  5E1X A;  1SMY F;  4PDK A;  5CVV A;  2FBI A;  3L2C A;  2STT A;  3CUO A;  1FBU A;  5L3F A;  2W24 A;  1RI7 A;  3R0A A;  1I6X A;  1FZP B;  2PG4 A;  2RQP A;  1GVJ A;  3I53 A;  4A5M A;  4BAY A;  2YU3 A;  2VC0 A;  1T98 A;  5L3B A;  3MZH A;  2OD5 A;  5HS8 A;  3I54 A;  3SZT A;  2DU9 A;  3WTX C;  5IT9 K;  1IZ1 A;  3E3V A;  4KT5 C;  4R79 A;  1W7P D;  2HQN A;  4N0B A;  3U1D A;  2TDX A;  3QPT A;  3T8T A;  2ZNZ A;  5HDG A;  2L54 A;  4OU0 A;  2OU2 A;  3RIR A;  1SD7 A;  3V8K A;  4Q4Z F;  2O6G E;  1SFX A;  4WCG A;  1R5H A;  3K2Z A;  1BI0 A;  4OIN F;  1R00 A;  2H09 A;  4RB3 C;  2KIF A;  3WTW C;  2QYO A;  1UFM A;  3MCZ A;  4O6J A;  4NQW A;  3HRM A;  2A68 F;  2M5W A;  3LWF A;  3WE3 A;  3JSO A;  5FLX K;  2JPB A;  4YFN F;  2ZBK A;  4I01 A;  1Z6T A;  3ZMV A;  3G3Z A;  2M8E A;  3DFG A;  4G9Y A;  1FPQ A;  4HLX A;  4B09 A;  1DUX C;  3F8N A;  1WWX A;  1W7P B;  4HF0 A;  4ESF A;  2RV8 A;  5EEH A;  2MA3 A;  3L09 A;  2IPQ X;  3DF8 A;  3M1E A;  3CO7 C;  4EJW A;  1LDK B;  4XLN F;  3N4M A;  2PMH A;  4Y13 A;  2EV0 A;  4R1H A;  5DCM B;  4GYI A;  1BC8 C;  3LAP A;  1BI3 A;  2XKP A;  2Y75 A;  3F22 A;  2HQR A;  3V8L A;  4O5V A;  5ILU A;  2ESN A;  5TJJ A;  3BPV A;  4QWQ A;  3RKW A;  3E97 A;  2AS5 F;  2H27 A;  1KA8 A;  3F6O A;  1D5V A;  1MJA A;  3I59 A;  3KP6 A;  4FX4 A;  2LNB A;  2CO5 A;  2JRT A;  3HUG A;  3IRQ A;  2HS5 A;  3H3U A;  2VBX A;  2IJL A;  2ETH A;  5DCF A;  1MDM A;  1CF7 A;  1YFH A;  5LRR A;  1ZLK A;  3QP6 A;  2EV5 A;  3BPX A;  2HZT A;  3HSR A;  1F9N A;  1SFE A;  3KLO A;  5AON A;  1XGM A;  5FLX Z;  2L01 A;  3HIF A;  2F5C A;  1IRF A;  3MEX A;  6PAX A;  4L0Y B;  5K1Y A;  4BNC A;  1KU9 A;  3EYY A;  4JBA A;  2MBF A;  1Z9C A;  1O7F A;  3GUD A;  1Z6R A;  2X0L A;  3WTU C;  3GFI A;  2LF8 A;  2M87 A;  4EJT A;  4UNO A;  3E5X A;  4AIH A;  1ON2 A;  3E5Q A;  3L7W A;  4G7H F;  4MTD A;  1YS6 A;  2VE8 A;  1HXD A;  1G3W A;  1QPM A;  3M9A A;  1W5T A;  2QLZ A;  1S3J A;  1OYW A;  2HFH A;  5L3C A;  1KU2 A;  2A07 F;  4XSZ F;  2RGV A;  1Z05 A;  1JHH A;  4L9N A;  3TO9 A;  5D5W B;  4I0A A;  5CVU A;  3SHF A;  5JFR A;  3GYH X;  4EM2 A;  3I0T A;  3TDZ C;  2L4M A;  2O3F A;  1ZG5 A;  1B4A A;  2X4H A;  2OQR A;  1GHC A;  2Z3Y A;  1HST A;  2PBI A;  4RGX A;  3NEU A;  2DPU A;  2QEN A;  1RUN A;  3VFZ A;  4KN7 X;  1G3Y A;  4A0Y A;  2XIG A;  1B1B A;  4N9I A;  4D0P A;  2ACJ A;  1HKT A;  1T38 A;  5D8L B;  2QVO A;  5LHG A;  1U5T C;  1J0R A;  2NYX A;  4MGR A;  1K78 B;  3FXQ A;  2JSC A;  3WTV C;  3RPU A;  5DCM A;  1LQ1 A;  4ON0 A;  2HKX A;  4YFK F;  3I64 A;  1ZRD A;  3F8B A;  1KGS A;  4LG0 B;  3N97 A;  1EH8 A;  2OZU A;  5HLH A;  1WSU A;  3WE2 A;  2FA5 A;  2FMY A;  4EGZ A;  2P6T A;  1ZGJ A;  3LA3 A;  4LK0 F;  4AD9 A;  1FX7 A;  1MJB A;  1QZZ A;  2P4W A;  3HHH A;  3F8C A;  2ZFW A;  5BMZ A;  3LQQ A;  1LVA A;  3M8F A;  1XCB A;  2MLG A;  5DYM A;  2CG4 A;  1YW8 A;  2NNY A;  1YW9 A;  2VBZ A;  1MJ9 A;  3H92 A;  1TTY A;  3L00 A;  2IT0 A;  3D0S A;  4IRI A;  3F23 A;  5LEJ A;  2PFB A;  1IRG A;  2Z9O A;  4LK1 F;  2PN6 A;  4NHJ A;  1U3E M;  2V1U A;  5IT3 A;  1O3Q A;  3ELK A;  3J7A O;  4ZZD A;  3GFJ A;  1LDD A;  4MNU A;  4L5I A;  2QQ9 A;  3FZV A;  3EQL F;  3EYI A;  2J5P A;  3WGH A;  1QGP A;  2EA2 A;  1JXS A;  3RKX A;  1QZY A;  2GIV A;  4LMY A;  3KEO A;  4G94 A;  4U88 A;  5L3D A;  5HDN A;  2ZO4 A;  4UXN A;  4Y15 A;  2MLK A;  2P7V B;  1FYL A;  3ZMD A;  3ULQ B;  2OQG A;  1AOY A;  4RAY A;  2GZW A;  4HV5 A;  2ZME B;  2M30 A;  3RYR A;  4A0X A;  3EET A;  4M72 A;  1MKM A;  3J81 K;  4P5O A;  4LB6 B;  4LD5 A;  4YIF A;  2Z33 A;  2IRF G;  1J7K A;  2Q0O A;  2PJP A;  4EMS A;  4EVI A;  4HX4 A;  1L3L A;  2BV6 A;  1S7A A;  2K86 A;  3C18 A;  2JPC A;  4DNC A;  3RPQ A;  4HBL A;  2A5Y B;  4G7Z F;  4I7H A;  2DPD A;  2A69 F;  5BPD A;  1B9N A;  2H6C A;  2B0L A;  4KA4 A;  2HR3 A;  2K4B A;  2Q2E A;  1K78 A;  4U0W A;  3QRF F;  1FSE A;  3T0Y A;  3MZY A;  1UHM A;  1IAW A;  3GO5 A;  4KDP A;  5LHH A;  2DLL A;  2EA4 A;  4O3M A;  4LG0 A;  4TV7 A;  1IW7 F;  1PP7 U;  2NS0 A;  1ZHF A;  2QBY A;  1T2K A;  3ZMS A;  4L5J A;  5F64 A;  1OKR A;  2DO7 A;  3TDU C;  4GYG A;  4MQ9 F;  2BYV E;  3BY6 A;  3O2P E;  2FQ3 A;  2EFP A;  4A2U A;  2ELH A;  1I27 A;  4I02 A;  1YYV A;  1HW5 A;  2KIU A;  1X3U A;  5CVJ A;  1KYW A;  4MEX F;  4PCQ A;  1U2W A;  4IHT A;  1ZG3 A;  2IP2 A;  4KIG A;  1XSV A;  1XMA A;  2V9V A;  1BIB A;  3TOA A;  3GFL A;  5JR3 A;  1ZAO A;  4PGG A;  3SFZ A;  4ZH4 F;  4WXH A;  4HDU A;  2O0Y A;  4KIB A;  2XRN A;  2F2E A;  2QUF A;  2CFX A;  2LKP A;  3O3K A;  2YSR A;  1P4X A;  2JT1 A;  2XUB A;  2LDU A;  3ECO A;  2L02 A;  1OMI A;  1ONV A;  5BPI A;  1QBJ A;  1O7L A;  5K5Q A;  3Q9S A;  1H9G A;  4IRH A;  4MQV A;  2Q8K A;  4KMU X;  2ISZ A;  1BM9 A;  4P55 A;  4WF2 A;  1F1Z A;  5LGN A;  4S04 A;  3WG9 A;  1UST A;  2ZNY A;  1XB4 A;  2STW A;  3E6B A;  2M1B A;  2VOD A;  3K1P A;  1R5G A;  2DT5 A;  1E2X A;  1LEB A;  2FSW A;  2IW5 A;  1S6L A;  4CO8 A;  1GXP A;  4F7Z A;  3WTS C;  2RC4 A;  2V79 A;  3IRR A;  1SMT A;  1IN8 A;  4OIO F;  2ZME A;  3M7G A;  3U9G A;  3GXO A;  3KZY A;  3JTH A;  3KET A;  4HW0 A;  1YW7 A;  4U0V A;  2XAS A;  1R1T A;  3CUQ B;  1H0M A;  2HEO A;  4EM0 B;  2UXX A;  5HS9 A;  5LGU A;  3LFK A;  5HDK A;  3U2R A;  5LGT A;  2VN2 A;  1PUE E;  1ZLJ A;  4YII A;  2EV6 A;  5H6Q A;  1ZN2 A;  4ASN A;  2QWW A;  4HQM A;  3EUH A;  1YO5 C;  2V1D A;  3HTS B;  3HRT A;  3SQN A;  3I58 A;  3HTU A;  4ZYH A;  2P5L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...