1XC5A

Solution structure of the smrt deacetylase activation domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
NGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear receptor corepressor 2
publication title Structural insights into the interaction and activation of histone deacetylase 3 by nuclear receptor corepressors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription corepressor
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xc5A01
1FEXA 1MBEA 1U9OA 3WHBA 3S1RJ 4A3KJ 3MKLA 2GM4A 2LP0A 3BR6A 3PO3J 3TW7A 1RPWA 1W0TA 3JRHA 4UUSB 3SDGA 1JTYA 4XRSG 1QVTA 2CUFA 3BTCA 2FD5A 4A3IJ 1JKQC 2ECCA 1S7EA 1U78A 5C4XJ 2CU7A 3FKIJ 4AUXA 5E3NA 4BXXJ 3OSFA 4G12A 2NS7A 1LFUP 5IYCJ 1ZKGA 4DZJA 1X2MA 4JX4A 4A69C 5IP6A 2R0QC 1Y1VJ 1CQTA 3GTQJ 1IJWC 1MSEC 5EYRA 2LVSA 3E7LA 2NVXJ 4JX6A 4DYQA 5EG0B 1EF4A 3BQZA 5IOZA 4M3FA 2FJ1A 2L7MP 3K2AA 2LD5A 2B63J 2M8GX 2O9LA 1IDYA 1ZQ3P 1B8IA 1YRNA 3A02A 4FISA 1B72A 3RQIA 1RR7A 3Q0UA 5EEAA 4FCYA 2YS9A 5HODA 2HOTA 4A93J 1FTTA 2JN6A 2WB1N 2CQXA 1IV6A 2R5ZA 1AKHA 4D5CA 4JYKA 3S14J 3G1OA 5FKMA 4BY1J 4M3BA 1O4XA 5GPAA 3DCFA 3BG9A 4D7NA 3MVPA 1JUSA 3BTJA 3BG5A 1K83J 2IAIA 4BY7J 2E19A 3CDLA 3S2HJ 4A3JJ 1HDDC 4FTHA 2JA5J 2M9HA 5K7FA 4D5FA 1Y1WJ 3GTKJ 2HI3A 3BT9A 1HDPA 4HNVA 1JKRC 2ELKA 1K61A 1WI3A 5M3MJ 5F08A 3ZQHA 5F0FA 3GBGA 1B8IB 2YU9J 1YRNB 2K9NA 1B72B 1IC8A 3K7AJ 5E3OA 4A3FJ 3OOUA 1PUFA 1BW5A 2R5ZB 1AKHB 1UG2A 2H8RA 5F0HA 2EZIA 1VNDA 1ORKA 3HOZJ 4RDUA 1X58A 3NAUA 1TWCJ 1JJ6C 5K7ZA 2E2JJ 3RZDJ 5J3LA 1GVDA 1SANA 2H1KA 3DEWA 1ETOA 4V2GA 2XGDA 1WPKA 3ZQGA 2DMQA 1JUPA 3HM5A 1XG1A 3BR5A 3SFIA 2ID6A 4V2FA 4M3DA 1VF9A 3ZQIA 1ETYA 3S1NJ 3A01A 3TEDA 3CMYA 2X48A 2HXOA 3Q0VA 5GP9A 1NK2P 1MSFC 1ZTRA 2WV1A 3QPLA 2ECBA 1F43A 3JRAA 1MBFA 4W97A 3S1QJ 5FKOA 1JTXA 1TC3C 2NVQJ 1PUFB 1T56A 2K9QA 3FK7A 3GTGJ 2TCTA 3HOVJ 3BR0A 2VPRA 1ZGWA 4C3HJ 1LE8A 4XK4A 4BBRJ 4B1RA 2XRLA 2MGQA 2LLKA 1I3QJ 1X2NA 4RBOA 1AHDP 2JJ7A 1MBKA 4X1EA 2CRGA 5M3FJ 5IP7J 1JGGA 5IYBJ 4A3DJ 3HGYA 3S2DJ 3I4MJ 5IPAA 2HOAA 4IHWA 5C4JJ 4FE4A 1TWAJ 2MW8A 2X6OA 2EZKA 3H0GJ 2FX0A 2Y30A 4CYCA 3A01B 1GT0C 2DTZA 3HB9A 4MFDA 3BR2A 1RKTA 5F27A 2JMWA 1AU7A 3OIOA 4Y52J 1P7IA 4AC0A 3GTPJ 2DA2A 4B4CA 5J1UA 3LNQA 2M2EA 3D1NI 1ETWA 4XIDA 3TP3A 4MO7A 1HCRA 1TWFJ 4A3CJ 1LE8B 4C3JJ 3BTLA 1F36A 2OF7A 2DMUA 5FKKA 3GTJJ 2MG4A 2X9DA 2Y2ZA 5IYDJ 4DYCA 3JR9A 2DA3A 3HBLA 1BJZA 3BR3A 2HXIA 2VI6A 1RKWA 2AO9A 1RETA 1H8AC 5F0CA 2OPTA 1ZK8A 5J1YA 4CYCB 4B3AA 5DS9A 1DU0A 9ANTA 3FISA 1FIAA 2GLOA 2HYJA 3RKQA 3IV5A 3TP0A 2AHQA 4JX5A 2L7FP 3FK6A 2CUEA 4ABZA 1TWHJ 2QF7A 2ZB9A 4QSHA 3BQYA 2EZLA 2LTPA 2LY9A 2XGEA 3JRFA 3Q3SA 3JRBA 4A3LJ 4A3BJ 2M34A 5C44J 3LSPA 2W48A 2XPWA 2L7ZA 4M3EA 4C2MJ 1OCTC 2FQ4A 2DMPA 2R93J 3IH2A 4IHVA 2L9RA 2YUSA 3QPSA 1H89C 1HLVA 2KT0A 4I6ZA 3GTMJ 2EBIA 5IP9J 2XGCA 1ETKA 3RZOJ 4MLOA 1NTCA 5DTDA 1GV2A 1ENHA 2LKXA 3BR1A 1JT6A 3ZQLA 1BW6A 4FE7A 2IEKA 4QIWN 2IBDA 2HOSA 1NK3P 5J1RA 3FIWA 4XRMA 2DA5A 3CQZJ 5F04A 3M3YJ 1I6HJ 3HGGA 2ME6A 2EZHA 3O8GA 1LFBA 2RAEA 2XB5A 3CCYA 3IH3A 4I76A 3OSGA 5EZHA 1ZR2A 2ID3A 5M5WJ 2PMZN 2DJNA 5E3MA 1WGXA 1U9NA 2E1OA 2LK2A 2Y9YA 3Q0WA 3B6CA 4A3GJ 4Y7NJ 2CJJA 3GTLJ 1R9TJ 5EF6A 4J19A 2E2HJ 3ZQCA 3GTOJ 3HOWJ 2O8KA 3S1MJ 3M4OJ 2Y9ZA 1IUFA 2K9SA 4BKXA 3LSRA 2MSYA 4A3EJ 5FLMJ 4M6VA 3JRIA 1WH7A 2WAQN 5GPCA 3HOYJ 4JP0A 2R5YA 5FJ8J 1BL0A 2JA8J 1MBHA 3S15J 1U8BA 4IHXA 3LOCA 5M5XJ 4C3IJ 1GV5A 5FKNA 1IG7A 2JK3A 2JWTA 1RESA 1TWGJ 2ME0A 1JKPC 4W1UA 2EH3A 4L5EA 4DW6A 2D5VA 2XPUA 1GUUA 3IH4A 1FTZA 3BG3A 2M0CA 3LSGA 1UMQA 1WCMJ 3PO2J 2NVYJ 2VKVA 5FLVA 1OFCX 3PM1A 3W6VA 3UKGA 3G1MA 3JRGA 1FJLA 2R7ZJ 1WH5A 3HOXJ 1MH4A 1MBJA 2R92J 2LFBA 1Z77A 1JT0A 4M3GA 1MBGA 3A03A 3ZQFA 2VUMJ 4XICA 5BNGA 4GFBA 1MNMC 1ITYA 2DA7A 2N8GA 2O7OA 1ETVA 1A5JA 2LR8A 2XSDC 1ETQA 2QCOA 2HDDA 2DA4A 2R5YB 1HOMA 3HKZN 1ZR4A 1ETXA 2VKEA 4EEFG 2JA7J 1IGNA 4IEJA 1BA5A 3G1LA 4BBSJ 1DU6A 1I50J 1QPIA 1IRZA 5JLWA 3JRCA 5EGOA 1SFOJ 2DA1A 5EZGA 1XC5A 2G0EA 1JKOC 2K40A 1GDTA 5M5YJ 1QVUA 1POGA 2XPVA 3F0CA 3JRDA 2NVTJ 2NS8A 3H3VK 4UUTA 4AYBN 1APLC 1OJLA 1T33A 3BTIA 5K7HA 1D5YA 3HEFA 4D7MA 2JA6J 1QRYA 2I10A 1A6IA 3SJMA 1E3OC 1W0UA 2DMNA 4DYRA 2DMTA 3I4NJ 2P81A 1IDZA 4DZPA 1Q1VA 3VPRA 3ZOBA 1G2HA 5IOYA 4UUSA 4MFEA 3HDDA 2KDZA 2CQQA 4IHYA 2TRTA 4LOCA 1MH3A 5EGOB 5C3EJ 3JREA 2HQ5A 3S16J 5F1JA 5JLXA 2EQRA 1JJ8C 2DA6A 1Z0XA 1VFCA 5FKLA 2COBA 2L0KA 1XS9A 2E2IJ 2Y0SN 1JUMA 1OCPA 4XRSA 4MIMA 4QTRA 2Y31A 3HOUJ 3TW6A 3WHCA 3LSJA 3NARA 3QQAA 1P7JA 3L1PA 4A3MJ 1HF0A 1VI0A 5EDNA 4NDLA 3O8HA 1FIPA 2GBYA 1H88C 2XB0X 3B6AA 3S17J 2NOGA 5E3LA 2DN0A 4X6AJ 4S0HB 3MN2A 1UHSA 3C2BA 5EG0A
chains in the Genus database with same CATH superfamily
2HWVA 5LRSA 3HC7A 4WXDA 4U0YA 3HRTA 3HZJA 5HNFA 4A3KJ 4DQ2A 2HTJA 1LFPA 1XSXA 2XKOA 3TDZC 3JRHA 4UUSB 4ETSA 1A04A 1JTYA 3KE2A 3VFZA 4CZZA 1D5VA 1QVTA 3BTCA 3QAHA 1MMGA 5ICFA 4IVNA 4G7HF 2DPUA 1OYIA 1T38A 2LBFB 1KGSA 5C4XJ 1OCOH 4BXXJ 4ZJZA 4RAGA 3DPUA 5IYCJ 2DDAA 4DZJA 1SFEA 4F52A 2O8XA 1RIOH 4CCLA 2H27A 3HUGB 5KK1A 2BY1A 1XGNA 1AWCA 4LLLA 4F93B 2BHYA 2LDUA 4IKFA 5L3EA 1CQTA 1IJWC 2E34A 5EYRA 1DP7P 3E7LA 3IWZA 5EG0B 2PEXA 1U5TC 1OKRA 3BQZA 1EH8A 1L3LA 2WB1A 5IOZA 2DCEA 2FJ1A 2LD5A 4MEXF 5AIQA 2Z2SB 1R6RA 4BU2A 2LKPA 3JAMZ 1FC3A 4M9XA 4I0BA 2IGOA 2X6WA 4BH9A 1NH3A 2YR2A 3EUHC 5ICCA 2VJ4A 4GXOA 1U6GA 2JN6A 4I7HA 2DU9A 3S2WA 2R5ZA 1HBXG 3AG2H 1ON2A 3MD2A 3P9KA 4ON0A 3R6SA 4BY1J 3K70D 1TNSA 4NC7A 1O4XA 2PN6A 5B5EC 2XRNA 3IUOA 5GPAA 1K4SA 4HA8A 1R36A 1FY7A 2E35A 2LH9A 4XN0A 1MJ9A 1G59A 2KMUA 3BLYA 2IAIA 3MZYA 4IXAA 1QZZA 4PJ0C 3CDLA 2OA4A 3H35A 4PGHA 4JK1X 4L18B 3SDBA 4CGZA 2VKDA 2WY8Q 2M9HA 3FBNB 4D5FA 3VEPA 2MD0A 5HS7A 4HLXA 1DPUA 4UVCA 4IRHA 2V4JC 5D6EA 4HNVA 4DJAA 1I6XA 3MKWB 2P5LC 5GAHJ 5BPDA 2V26A 3GZNB 5F08A 3ZQHA 1FP2A 1X4OA 1RNLA 3CJTB 5CQEA 1ZLJA 4U0VA 3K4KA 1T0FA 3R0AA 4Y33A 3MEXA 4KA4A 3Q9SA 4GDFA 5B1AH 4A3FJ 5TRDA 2ZSIB 3QWLA 3HPHA 5K5OA 1PUFA 2BY0A 3KEQA 2KIFA 3K4LA 4RDUA 3NAUA 2IW5A 3FZVA 4BXFA 3KZYA 5CKTA 2R4GA 3TMOA 5K7ZA 3V7SA 2VOPA 2BHZA 2LY2A 5J3LA 5GTIC 2ETHA 1NG7A 2KIUA 2P7VB 4V2GA 3TKYA 2L7KA 4IRIA 3ULQB 4AIKA 3ZQGA 3DBHB 1WJFA 1UFMA 1XG1A 3BR5A 1BOBA 1R7JA 2IVMA 4M3DA 1VF9A 2JUGA 1W7PD 3WTUC 2W7NA 3K10A 1XGOA 3P7NA 2KDOA 3CMYA 3BZ6A 1SVOA 2X48A 2ECBA 3I9V2 2LY1A 3ZMVA 1VQ4I 4W97A 2RGVA 4IQJA 5D4RA 1R23A 2QZ8A 2ZMEB 1T56A 4IHSA 4ESJA 3HSFA 3K4NA 3BR0A 2DQRA 2W57A 4UB8C 3ELKA 1LE8A 3ZGKA 3TGNA 4ESBA 1F1ZA 2Y75A 3I4PA 2PI0A 5L3BA 1MJAA 2XROA 2HGCA 1R00A 2B7EA 3GX4X 1ZGAA 3ZN1A 2DPDA 1EH7A 1IV8A 2CRGA 2KZVA 3BZCA 4CCMA 5IYBJ 1JGGA 1OR7A 3ZPLA 3CCSI 3KLOA 1KU3A 1SVMA 1MNEA 4WCGA 4PJNA 4Y17A 4E7HA 1WJ5A 4E7ZA 4BJ6C 2Y30A 3A01B 3IAS2 5LGTA 3BR2A 4RAYA 1OISA 2JMWA 1YJNI 3OIOA 4CDGA 3GTPJ 4I02A 1J75A 2PJRA 2QSGX 2M1BA 4XIDA 2NAZA 3KX2A 4YIFA 3CCRI 3TP3A 3KP3A 4ZZLA 4MQVA 1W7PB 1PUEE 1MMDA 4XLFA 2HR3A 1XSDA 3L09A 4KIBA 3J7AY 2OF7A 2DMUA 2HFHA 3RCOA 2AQEA 3LSMA 1W1WE 2MG4A 2X9DA 4KISA 3CJQB 2ZNZA 1VQLI 4AIDA 2HZDA 2HKOA 3DTIA 1BM9A 1FBUA 2M0MA 2M87A 2HXIA 1U5TB 2AO9A 3N97A 3ECHA 4XOPA 1O3SA 3LQQA 5F0CA 5E20A 2E60A 4I0AA 3WGIA 9ANTA 1FIAA 2GLOA 2HYJA 3RKYA 1VQ8I 3NWSA 3WTTC 2ZC2A 2IRFG 2ISZA 3HYIA 3ZMSA 3SYTA 1TWHJ 5ILUA 3BQYA 4HSRA 3OS2A 4A3BJ 2M5WA 3JRBA 2HQAA 1YIOA 2KRFA 3GF2A 5LGNA 5FGMA 4LIVA 2ZO4A 2L7ZA 3HOSA 2W1OA 3FBIB 3MKZA 4EJTA 2FQ4A 5KNLA 3QP5A 2FQ3A 1VQKI 4IHVA 6PAXA 3QPTA 4EGZA 3E5UA 3JCUC 4FX0A 1NTCA 2RC4A 1GV2A 4MLOA 1ENHA 2LKXA 1S7OA 3GXOA 3S93A 4BUPA 1JE8A 4NHJA 4ESFA 3ZQLA 1O57A 4QIWN 2R7XA 3HRUA 4OWRB 4OINF 1NK3P 4MTDA 5DCMB 4RB3C 4F3QA 4Z6YA 5DUIA 2UV1A 1QU3A 1MD0A 5F04A 1ZREA 3M3YJ 2CQKA 5K5RA 1BJAA 4E70A 2QENA 4KMFA 1V55H 1X1BA 3I58A 2XB5A 3CCYA 4I2OA 4UVAA 3W2AA 1K6OA 2ID3A 1S29A 3BJ6A 3PNTA 5F64A 4OIPF 3FWEA 1PYVA 2K5CA 4HDVA 3JSOA 2ZFUA 3WTWC 2EIMH 2DJNA 5LEJA 5E3MA 2M30A 3BJAA 1U9NA 2LK2A 2Y9YA 4KMUX 1BC7C 4A3GJ 3HSRA 4IF4A 4O3MA 5H2FC 5EF6A 1K79A 2WAQA 3ABTA 3KPHA 3NWTA 1BR1A 3KYLA 2C6YA 2J5OA 1K78A 2O6GE 2HYFA 4N9IA 1JI8A 4ITVA 3DU5A 5A2QZ 4EQQA 4FETA 4HQMA 1P9QC 4KUMA 3MCZA 2EILH 1FYLA 4U7BA 1IAWA 1W4MA 2L02A 3LA2A 3RI4A 2Z99A 1ZHFA 2R5YA 2QWWA 3E97A 2XAJA 2DT7B 3CCMI 2JA8J 2KKOA 3TDUC 2IA0A 1LUJB 2JK3A 2JWTA 1YFHA 1YX3A 3UR3C 5IY5H 4DW6A 2XPUA 1D1BA 3BG3A 3FXOA 3KYCB 2NVYJ 3O3KA 2FU4A 2P4WA 3W6VA 4H0EA 3UKGA 3N4MA 2L9VA 1YOVB 1OQYA 2CYYA 3L2VA 4XLEA 2RNJA 1QZYA 2M8EA 2HVQA 1MBJA 2R92J 1N75A 1Z77A 3HHGA 4M3GA 1JT0A 1P6RA 3CMEI 5BNGA 4HPQA 2W4SA 4J00A 3FDYA 4XKVA 3GFIA 3TL4X 3RYPA 4A0XA 2H94A 1GXPA 4II3A 1KYWA 1HW1A 4GO1A 4G9YA 1J5YA 2NS0A 4CCKA 4XOTA 4BEHA 1ETXA 3DKWA 3LMMA 2CW7A 2XUBA 1HKTA 3PJRA 2P5VA 3O6BB 2BVLA 4N0BA 4BBSJ 1XTAA 2VQCA 1FLIA 3CTAA 1KU2A 2X1CA 3JRCA 1AOYA 4ZZDA 4B8XA 1MNDA 5EGOA 2Q8KA 2XHKA 5B3SH 4PSXA 4EV0A 5EZGA 2CV1A 2FF4A 2XPVA 2XAUA 2IJLA 4P1WA 2GXBA 4HAMA 1FP1D 1XMXA 3I59B 2VXDA 2JSPA 3ZQQA 2CQ7A 1APLC 1OJLA 2TDXA 1D5YA 4KJZA 3HEFA 2V7FA 4OOIA 2V6EA 1VQ7I 3T1BA 4YEJA 1A6IA 5TJJA 2RN7A 1ZYRF 4IJAA 2DMNA 1MKMA 1QBJA 2CV0A 3CF2A 4DYRA 3VODA 2DMTA 4KYWA 3I4NJ 3CCVI 2B9SA 3GO5A 1QHGA 4UNOA 2Y0SA 5EJCA 3V42A 1O3TA 4NC6A 5J6XA 3HDDA 3CZ6A 2YPRA 3IKVA 3RDIA 3JREA 5E1WA 1A35A 5CVUA 4QPOA 2OUMA 3BP8A 2FA5A 2MC4A 4IQ4A 2COBA 3NRVA 1XS9A 1OCPA 2FXAA 3HOUJ 2Y31A 1WKMA 3WHCA 1PDNC 2GAUA 1DGWY 4ENKA 2M7AA 1MJBA 3NARA 4XONA 1LDDA 1HF0A 1X1AA 2K3PA 1FBSA 1U0JA 5EEHA 2K7LA 1H88C 3B6AA 2CV2A 2UUZA 1YS7A 2DDBA 3W3CA 2DN0A 2ZSHB 1D0XA 2RREA 3MN2A 4WX9A 2X1EA 3HRMA 1U9OA 3PFYA 1LJ9A 3LSKA 2EFNA 3RIRA 1V5EA 3K2ZA 2NNYA 2O5RA 3DFGA 3PO3J 3TW7A 4PZJA 1W0TA 1MGTA 1XD7A 4IZZA 4S05A 3L2QA 1B6AA 1E2XA 1ZRCA 2FD5A 4A3IJ 2EFOA 2CW8A 1CF7A 3PSIA 1S7EA 1U78A 3DEEA 4BE1A 4AWXB 2CFXA 2QQ8A 3OSFA 4ZTFA 5E18F 2NS7A 1LFUP 1EH6A 1ZKGA 2JT1A 4D0PA 5IT9K 4XM3A 4JX4A 1MMAA 1MDMB 4XKCA 1MZBA 2IGKA 3ABKH 4RA2A 2WBMA 3F6OA 1RZ4A 3GYHX 2OV7A 1MSEC 2HVRA 2NVXJ 4JX6A 4DYQA 5J4YA 1E17A 1TW2A 2ZJQF 1EF4A 2XIGA 1B59A 4M3FA 2L7MP 2VASA 4B43A 2B63J 1FT9A 3H5NA 3ZP5A 1B8IA 2JUCA 1YRNA 3DLLF 3JAMK 4L0ZB 1B72A 1RR7A 2ELJA 3S32A 5EEAA 4PDKA 4UXNA 1IF1A 2QUFA 2YS9A 2ACJA 2A5WA 3TO9A 3P9CA 1MW7A 1Z91A 2W85A 5GAGJ 1IV6A 4L9TA 1AKHA 5FKMA 3WE3A 4CCNA 3VYUB 4HLYA 3CMMA 3ZR8X 3SEQA 2E5ZA 1D1AA 2KJBA 2Q2EA 3HXLA 2DXIA 2LG4A 4D7NA 4KFCA 2JPCA 3B73A 5HVQC 3CUOA 5IT3A 1GHCA 4BY7J 4AYBA 2E19A 1I1SA 3S2HJ 1HKSA 3V7CA 3GFJA 4A3JJ 1HDDC 2JA5J 5K7FA 1Y1WJ 2HI3A 4RGRA 1HDPA 3FMQA 4HF1A 3L2UA 2DJIA 1BIBA 5LEKA 1YE9A 3S3NA 1R71A 5LBQA 5E3OA 2GIVA 3KP4A 2KIMA 1ZGJA 3VYSB 4ZDPA 4LD5A 2Z5UA 3IWFA 4F92B 1BW5A 4OIOF 1R1TA 1X4PA 3I56I 3OIPA 2H8RA 5F0HA 1R5HA 2DYSH 3K9TA 1X58A 1DDNA 1TWCJ 3M7GA 2E2JJ 1FX7A 2OBPA 3WTVC 4Q5SF 1GVDA 4L5JA 1SANA 3G3ZA 2ZMEC 4DBQA 2X51A 3L2CA 4A12A 1SD5A 3O2PE 2OQRA 1WPKA 3G73A 2M4KA 3M8FA 4E7KA 3E6MA 3BCBA 1WWXA 5D5XB 3T5XA 3MZ8A 2KIQA 4AIHA 3M8JA 3ZQIA 3S1NJ 3M1CA 4HV6A 3F9KA 1NK2P 1MSFC 1Q1HA 5FFZA 5HLGA 1G8XA 3K69A 3JRAA 4BJ5C 4N9HA 2EFQA 3E6DA 4A2UA 2MLGA 3U2RA 3MWMA 4HSTA 2CFOA 3H0DA 2NVQJ 2XAQA 2EV5A 2K9QA 2VIXA 1B4AA 4CCJA 2TCTA 1YIJI 2EWNA 3U9GA 1WSUA 1OPCA 1T08B 2ZFWA 1XDSA 2BBYA 3IRQA 2BZTA 1I3AA 3VYRB 1ZG3A 2LLKA 2VBYA 4OAZA 4CZCA 4BDZA 3OS1A 2F6CA 2JJ7A 4PUSA 3J81Z 2P5KA 1JHFA 4Q47A 3HGYA 3DKYA 4IHWA 2HOAA 2VQHA 1YJWI 4ZTJA 1TWAJ 1IN6A 1BI1A 1I5ZA 2UXXA 2KRHA 2KLOA 1UELB 2X6OA 4LFUA 2RV8A 5IT9Z 1ONVA 5HS9A 2EZKA 2MH9A 3QYBA 4KN4X 2A6HF 3HB9A 4MFDA 1W5CC 1RKTA 2X85A 1D8JA 5F27A 2DFFA 1AU7A 4JOMA 1Y8RB 4AC0A 1FOXA 2ICWG 4PJMA 3ERMA 2BVMA 3WU0A 4RM3A 2MLKA 1FPQA 2IGNA 1XX5A 4HG2A 3K4MA 3I0TA 4LK1F 3REOA 4FQGA 1J7KA 3LL7A 1SFKA 1Y6IA 3F8MA 2H8WA 2OCCH 2XKPA 2BYVE 5ILVA 3CCLI 3LFKA 2COMA 2QKLB 1VQNI 2KZGA 3LAJA 4DYCA 3JR9A 4YG2F 2IA2A 4G6DA 3F8BA 2MH2A 2K4BA 3DV8A 2GZWA 3AG3H 1YS6A 1RKWA 1S6LA 3G4SI 4RLFA 2M3AA 1RETA 3WU1B 1NHAA 4A5NA 3ESWB 5FO5A 4CYCB 3NQOA 3FISA 1YW7A 3RKQA 2BXZA 2AHQA 3A0BC 5KAFC 4ZC3A 4LGWA 3OY9A 2CUEA 2WC2A 2Y0MA 3HRSA 2G7UA 1BBYA 3PNYA 2OQGA 1R1VA 2EZLA 1XMKA 2PG4A 1S8NA 1S7AA 3LSPA 3QPHA 1H0MA 2W48A 3I71A 2K3FA 4M3EA 3L7WA 1XSVA 3E6CC 3ZCOA 2IS1A 4M73A 1U2WA 3EUAA 4S04A 5CPRB 3OL3A 2K85A 2KT0A 5IP9J 1VQMI 2VC0A 4HW0A 4NUBA 3A2KA 3CUQB 2VJ5A 4HEA2 1SFUA 1A31A 1Y56A 1IRXA 1LDKB 4BQAA 5DTDA 3MFKA 3ERED 5L3CA 1JT6A 4FE7A 1UAAA 1SC7A 4CCOA 4R79A 3PNVA 3BWGA 4F55A 5J1RA 2EB7A 3FIWA 4OMYA 4B48A 3VYTB 1N77A 4RGSA 3PQKA 1S3JA 2ME6A 1XN7A 1G3WA 5ERIA 1LFBA 2VONA 4F91B 1D0YA 5LHGA 2CW0F 2FBKA 1ZR2A 5M5WJ 5D5UB 2PMZN 1G3YA 1FYMA 2YX7A 2EA4A 4M6XA 2E36A 1DPRA 3T8TA 5FB2A 2E1OA 4BJTA 3Q0WA 5B66C 1J2XA 3HPGA 1MDMA 3ASNH 1R9TJ 1WQ2A 1FMVA 3EUKL 3GTOJ 3HOWJ 3S1MJ 3M4OJ 5EEGA 4NB5A 2Y9ZA 4BKXA 4CSWA 4N4OB 5A2QK 4CA0A 4A3EJ 4LB5A 2VL8A 3FM5A 4A0YA 3JRIA 3N05A 1WH7A 2F5VA 5D4SA 3FXQA 2KRCA 3HOYJ 4C30A 4KIFA 2LMDA 3S15J 1OMIA 3LOCA 5B1BH 1X1CA 3D5LA 1OCZH 3ZMZA 3K6GA 1JKPC 2V1NA 2EH3A 3K4JA 3KP2A 3U1DA 2A07F 1XGSA 2M0CA 4XR6A 4NQWB 1UMQA 1WCMJ 2DO7A 2QQAA 4CYDA 3CP2A 2OD5A 4D1QA 1OFCX 4YFNF 3ABMH 2P8TA 1XCVA 1TLHB 5H6RA 2V6CA 2R7WA 5FLXZ 3GZ6A 4NC8A 3CCJI 1RI7A 1Y39A 2LF8A 1WI9A 4PK4A 1WH5A 1WFXA 4HBLA 3FKJA 3HOXJ 2XDVA 3RPQA 3K4CA 4ASNA 1MBGA 3FXKA 3I5UA 3LA3A 2RNGA 2VUMJ 3K1NA 3KP6A 4LG0B 4GFBA 2GXGA 4HF0A 2F48A 2QVOA 1IRFA 2WTEA 1ETVA 4YELA 2LR8A 1ETQA 1W5TA 5TGTA 2DA4A 2JZYA 2IS6A 1PVEA 3CO7C 2XASA 1PJRA 2DLLA 2MFZA 3HKZN 3H5RA 1TZLA 5HDNA 5JHFA 1X3ZB 2VKEA 3TO6A 1FZPB 4EEFG 3FX3A 1B1BA 1T39A 2QQBA 1F9NA 3ZN0A 3R60A 2DBBA 2KHMA 2JTVA 3ML6A 4B47A 1I50J 2W25A 3E5XA 2QBYB 4U0WA 2ZJPF 2OZUA 1SFOJ 2GXAA 2EFWA 3DF8A 5M5YJ 4GGGA 4P96A 1Z05A 3DWLE 3F0CA 3JRDA 4XLHA 2NVTJ 2AXTC 2PBIA 3RSNA 3H36A 2R7UA 4ENNA 4AYBN 4I01A 3OYKA 2M45A 3IRRA 3H9QA 5BPIA 4D7MA 1IXRC 5CJ9A 4EM1A 3J7YJ 3QU6A 1T98A 3D0SA 1KZHA 2P81A 2CS3A 4A5MA 5J40A 4DZPA 3VPRA 3ZQ7A 3H1CA 2K9LA 4EVIA 4UUSA 4MFEA 3W2WA 4G7OF 1OYWA 1UB9A 2ZXJA 4IHYA 3K1PA 3H92A 3KLNA 2HQ5A 3RPUD 3OYJA 2EK5A 2DA6A 4BHCA 1Z0XA 4U87A 2LBFA 2L0KA 1NG6A 2E2IJ 1BI2A 4GYIA 4XRSA 1GVJA 4IHTA 3CCUI 2VJJA 3W6JB 3H5AA 3L2RA 1P7JA 1VI0A 3HUGA 4NDLA 3O8HA 4U88A 2MC3A 2HQRA 3CC4I 3S17J 3KEOA 4CH7A 1Z7UA 1UHSA 2LKSA 3C2BA 2LNBA 5EG0A 2HYGD 2CWEA 4C2UA 1H9TA 5JR3A 2WWYA 5DM6F 2EJRA 3BG7A 1IO2A 1P4WA 1YI2I 3MKLA 2FEZA 2GM4A 2E5NA 3P5JA 1USTA 2LP0A 3BR6A 3ZXSA 1ZG1A 1RPWA 4L9VA 4L9NA 3SDGA 4XRSG 2QKMB 4OIQF 2CUFA 2A3SA 3R61A 3T0YA 1JKQC 3SQNA 4G6TB 1KYZA 1LVKA 4CO8A 2FBHA 3MMYB 2ECCA 4RMNA 1RUOA 2EINH 2CU7A 4IRGA 3B02A 5E3NA 2P0WA 4G12A 4PGGA 3GUDA 1S9HA 2YSRA 1R22A 5IP6A 4CICA 2FNAA 1FOYA 4P5OA 3OYAA 3VB2A 5JI6A 2R0QC 1SD7A 5E79C 5D8LB 1OR7C 2BW3B 3CDHA 2LVSA 3DEUA 3SXYA 2AS5F 4JQFA 1HC8A 1HQCA 2WY7Q 3JTHA 4E7SA 4KITB 4RAZA 3EDPA 3OYEA 4UY8I 4G6QA 3KETA 1IDYA 4A6DA 2KJCA 2KISA 4EJVA 2QGUA 2V1XA 3A02A 4FISA 3A1YA 4LITA 5ILSA 3Q0UA 2PMHA 5FRNA 4M9SA 2R7FA 4PSWA 4UV9A 2HOTA 4A93J 1REPC 1FTTA 2WB1N 2CQXA 4AVZA 4BXUA 3H9JA 3KZIC 4D5CA 4JYKA 4O6JA 4HNTA 3G1OA 2X6YA 1BN5A 4M3BA 3J7AO 4JBAA 3QODA 3GFLA 5CLSA 2HTSA 3BG9A 3BG5A 3C1DA 3BTJA 2E7WA 3QOEA 2OC6A 3GW2A 4FTHA 4BL0B 2DOAA 1V3FA 2GOXB 4E7JA 3GTKJ 3BT9A 4BE2A 3OYHA 2HPIA 3LWFA 2ELKA 2UWMA 1K61A 5M3MJ 3LSIA 2R7DA 2YU9J 2K9NA 2FBIA 2PFBA 2DAOA 3K7AJ 3OOUA 1LEAA 2ZJ2A 2ZMEA 5DUKA 2R5ZB 1H9GA 1UG2A 4FX4A 2X1DA 5BS6A 1USSA 1ORKA 3HOZJ 2OTJI 2DFIA 5D8KB 3U21A 2UZKA 1Z3XA 2H1KA 3CLQA 3RQ4A 3DEWA 5CVIA 2QM3A 1D3YA 4DIQA 2A61A 3LAPA 1QPMA 4HF2A 2K4JA 2MYSA 3DP7A 4PJLA 4QLCU 2D1HA 3SFIA 3SZPA 2ID6A 4V2FA 2HDCA 1ETYA 2JRTA 2W24A 3A01A 3TEDA 5AIPA 4KT6A 5D5VB 2HXOA 5GP9A 2L4AA 1ZTRA 2WV1A 3QPLA 4AM3A 4BDYA 1OCCH 4AIJA 1VQPI 3ZMTA 1QZEA 1JTXA 4BNCA 1ULYA 1N78A 1PUFB 1R49A 1W7PA 3HHHA 2BOLA 4XSXF 3HOVJ 4C3HJ 4UV8A 1BR2A 4XK4A 2HPMA 4HYEA 5TISC 3FXUA 3BPVA 2XRLA 2WAEA 1BI0A 2DK5A 2MGQA 4B1RA 4BS9A 4CUGA 1WJEA 3DBLB 4RBOA 1AHDP 3J81K 1MBKA 2F4IA 3OIQA 3M9AA 4X1EA 2PJPA 2EPFA 3F3XA 4EM2A 1T95A 5M3FJ 1ACIA 3VDXA 3V8LA 2BY2A 2MA3A 3OV8A 3I4MJ 3CCEI 2K02A 5C4JJ 4FE4A 1W36C 4DBRA 5HNHA 2MW8A 1U5TA 2VT3A 2P6TA 2JVGA 2J5PA 5DYMA 1QGPA 1FMWA 2I8DA 2FX0A 2DTZA 3BY6A 5JVGF 5FRMA 2O61A 3F72A 2KFDA 3OYLA 4ZDOA 1K4TA 4NNJA 4Y52J 5KCMA 1P7IA 1S5LC 2GIZA 2X6XA 3ISPA 2DA2A 2CSOA 2HNHA 5JHUA 3EUHA 3D1NI 4ZYEA 1WZ2A 4XKBA 3OYGA 3EPZA 3LSTA 2V9KA 4XLNF 1LB2A 1TWFJ 4A3CJ 2XSJC 4WWCA 1LE8B 4C3JJ 1RR8C 1F36A 1XPXA 3TO7A 4OU0A 3COAC 4GYGA 5FD6A 4NBQA 1N25A 3EETA 5IYDJ 2ZCWA 4XQFA 4LB6B 3IAM2 3F8FA 2QQ9A 2VQGA 1BJZA 3BR3A 4R8HA 1FYKA 3CF5F 2CUJA 1IXCA 4H4KC 2VI6A 4HX7A 1AA7A 2L5QA 1ZK8A 2OZ6A 1X1DA 5DCMA 4JX5A 4E7IA 3CUQC 3V4GA 2L7FP 3FK6A 1D0ZA 2HZTA 3EYYA 3Q9VA 4ABZA 2ZB9A 1KU9A 4QSHA 2PJRB 3EYIA 4L9JA 2DK8A 2XGEA 3DXJF 4A3LJ 3Q3SA 4WK8F 2ZBKA 4AU7A 4DOZA 2WA0A 2IS4A 2L54A 2NRAC 2IXSA 2XPWA 4C2MJ 2VE8A 1O3QA 1OCTC 3OR2C 2QEXI 2B0LA 2F5EA 3CESA 2XV4S 2DMPA 3CJRB 4RAFA 3BC8A 2R93J 5DEQA 3QPSA 2YUSA 2FMLA 4QPQA 3GTMJ 2EBIA 5LFAA 2X4HA 3WG7H 3ECOA 3FXJA 2EA2A 3I64A 1VQ5I 2YX4A 2A69F 3V7RA 1RRJA 3BR1A 3ABUA 5AONA 1BW6A 2D2WA 2HOSA 2VOOA 2IBDA 4RB1A 1L0OC 4XBFA 1KONA 2JRMA 1XDUA 2ELHA 2PMUA 2DA5A 3HG9A 4E6KG 1IXSB 3CQZJ 2XC7A 3F23A 1KQ8A 1FOWA 1I6HJ 3HGGA 2XAGA 3OYFA 3GMEA 5KVRA 2EZHA 1IRGA 2OCEA 1W36D 2V1UA 5BQTA 2ZXHA 3OSGA 3D5SC 4LLNA 2L4MA 5E1XA 2VB6A 1YW9A 4FT8A 3KZZA 4EJWA 3F6VA 4X0GA 4XORA 2LSOA 4XNFA 1W5SA 1SAXA 4XKWA 2F4OB 1TT5B 2STWA 3C3WA 2A5YB 2ZJRF 1WGXA 1Z21A 3B6CA 3GTLJ 4P55A 2GWRA 1K6YA 1QQIA 1V5FA 4P9UA 4B09A 1MMNA 2E2HJ 3AFHA 4CHUA 4ZYDA 2XGXA 1R1UA 2IPQX 3ZQCA 3J80Z 1IUFA 1ON1A 2K9SA 4BGDA 3LSRA 5KHDA 1IN7A 1ZH5A 4IO9F 1C0WA 4OMZA 2QSFX 2WAQN 4QWQA 2KPMA 4MEYF 3S8PA 1YQAA 5ICEA 1MBHA 1Y0UA 3AAFA 1U8BA 4IHXA 4C3IJ 1GV5A 1IG7A 2ESNA 1RESA 1TWGJ 2A6TA 1G6NA 2ME0A 2V1DA 1WVRA 4I99C 4W1UA 4BHBA 2VBWA 4L5EA 2D5VA 1X3UA 3WTZA 1GUUA 1Z7LA 3IH4A 1FTZA 3LSGA 2H6BA 2V9PA 1Z1DA 3WU2C 2FRHA 1KA8A 5FLVA 1V5GA 3CDIA 4MQ9F 2WADA 3PM1A 2CMPA 2DYRH 5FLXK 3MZHA 3FM3A 3IHUA 1YG2A 2Z9OA 4XLCA 3A0HC 4PCQA 3JRGA 3F21A 1FJLA 2RKHA 1ZN2A 3M1EA 5D6FA 3G2BA 5LLQA 1MH4A 1SVLA 4O5VA 1X3WB 1K78B 1XGMA 5LD2C 2LFBA 3GFMA 3LQRA 2ZNYA 3ZQFA 4HDUA 3I59A 1ZARA 3A4CA 1MNMC 1FNNA 2DA7A 2O7OA 1TNTA 3WTSC 1A5JA 3AL0C 1UZCA 2XSDC 2QCOA 2HDDA 2R5YB 1HOMA 4ENJA 3F8NA 1TP4A 5F1RA 3I53A 1SD6A 5E1ZB 2H6CA 2UXNA 2PX9A 3L2WA 2R7TA 1HSTA 2EIJH 3CC7I 2JA7J 3FHNA 4A6EA 1CGPA 3WTYC 2Z16A 1IGNA 4IEJA 1BA5A 2WV0A 2D1VA 4EJOA 1YTYA 2VN2A 2BV6A 3G1LA 2HDWA 2FE3A 3FMSA 1QPIA 2EIKH 4MGRA 1IRZA 3QOPA 1IZ1A 3E1SA 3E3VA 1G3TA 1IN8A 1YLFA 2OJED 2DA1A 4HQEA 1DUXC 1JKOC 2K40A 3SFZA 1GDTA 3PUFA 1Y0NA 1QVUA 2JPBA 2ZKZA 1TQMA 5HLIA 4BHPA 1PP8F 3H3ZA 3TQNA 1BOAA 5D5WB 4LG3A 2V9VA 5HOOA 2HKXA 1R5ID 3H3VK 1O7FA 2DT5A 3CP8A 1SEUA 3ROUA 2KL4A 1SMTA 3BTIA 5KAIC 5K7HA 4M6YA 4MHGA 2JA6J 3OMYA 1S72I 1QRYA 2I10A 5LGUA 1JXSA 4BEHB 3RKXA 2F4MB 1E3OC 3FMRA 3SHFA 1T2KA 3FXRA 1Z3YA 4KIGA 5DCFA 3RYRA 3OYCA 1Q1VA 3KYDB 2L2OA 1G2HA 4IOCF 4ENMA 2L01A 3AKZA 2TRTA 5C3EJ 5EGOB 5L3GA 1HKQA 4C2TA 3S16J 4I09A 1TBXA 5JLXA 1FSHA 4HX8A 3KIOA 1E3HA 1VFCA 2Y0SN 1JUMA 5GADJ 4U7DA 4MIMA 3TW6A 1EKEA 3OYNA 1B9MA 3NEUA 5E8IA 3L1PA 1BR4A 5CQGA 4A3MJ 3ABLH 2ADUA 4PJJA 1XB4A 4ZH4F 2HS5A 3JW4A 1IN4A 4IL6C 2NOGA 4EM0B 4XRFA 3W2VA 4S0HB 4XLPF 3OYBA 2MABA 1FEXA 2GA1A 3C18A 4M71A 2FSWA 2VJIA 1MBEA 3DTEA 3R0JA 2VXZA 3WHBA 1QHHD 3S1RJ 2BXYA 4ZYAA 3KEYA 3CD6I 2ISYA 3L00A 4UB6C 3KFWX 2WAFA 3BG6A 1FWZA 2NYXA 4HRIA 5BMZA 2VBXA 1VQ6I 1P4XA 1E0EA 3CO6C 2L3DA 4MTEA 1R58A 3SEZA 4KN7X 3OOPA 4HOBA 3FKIJ 4AUXA 5HS8A 3G6EI 3FXMA 5GTHC 2W84A 5CYVA 3GLLA 2CUZA 4DNCA 2QLZA 1X2MA 4A69C 3JTGA 5LRRA 4G8XA 3T8RA 1Y1VJ 1ERDA 4LMYA 3GTQJ 3K1MA 3KP7A 4KT5C 4XN3A 2CGPA 1JHHA 3ZMDA 4HNUA 2VBZA 2EFPA 1FBQA 3CCQI 3H3UA 3K2AA 4F7ZA 2M8GX 2O0YA 2R7RA 2H09A 2O9LA 3OYMA 1ZQ3P 3R4KA 2OTLI 5GAEJ 3H9GA 1KQ9A 2CH0A 4RGUA 3RQIA 2K86A 1O7LA 2M7BA 4EMSA 4FCYA 1UJ8A 3DPTA 3QU3A 5HODA 4B3XA 1UHMA 1U8RA 1CF7B 1X1PA 1M1EB 4IPAA 1LEBA 2O3FA 2R3SA 3HIFA 4LLGF 4ZDLA 3S14J 3MKYB 3C2GA 3I55I 4EGYA 1YHQI 4RB0A 2VE9A 3DCFA 1WJBA 3S3OA 4LIUA 5ED4A 3MVPA 1JUSA 1BC8C 2E1MC 1K83J 1WJAA 2H1LA 4Q4ZF 3AL0B 3M8EA 1UCRA 3PL8A 2DTRA 4Y3OA 4UHTA 3RJPA 5K5QA 3BDDA 1I1GA 1STZA 1DGRM 1JKRC 3BJOA 1WI3A 3G71I 2G7HA 1B8IB 1OLTA 3GBGA 5F0FA 1YRNB 1B72B 4BQQA 2A6EF 1J0RA 1IC8A 2LYCA 5HLHA 3I3LA 2K27A 2QYOA 4TV7A 1LPQA 1ZLKA 1DQUA 4ANJA 4WF2A 1AKHB 4M9ZA 4D9JA 2EZIA 1VNDA 2VKHA 3EQLF 1TTYA 2IGMA 2MD5A 1Z9CA 4FHTA 2Y48A 1JJ6C 4XMYA 1HA8A 1T0FC 2Q2EB 2DQLA 3RZDJ 2O03A 3HJEA 3KP5A 2JVHA 2IS2A 1ETOA 1SD4A 2BE5F 2FUG2 2XGDA 3IP4B 3HTUA 1EV7A 2OAZA 2DMQA 1JUPA 3HM5A 1YJ9I 3DBRB 3M07A 2XF6A 2F5DA 3DLAA 3ZRGA 1HXDA 2XVCA 1OCRH 1V4RA 3Q0VA 1F43A 5BOXA 2FMYA 2M4GA 1MBFA 3S1QJ 1RC9A 2KQRA 5FKOA 3V8JA 3VSKA 1TC3C 3MAJA 3WG9A 1WJDA 4B44A 5DD4A 3FK7A 2XAFA 3GTGJ 2ESHA 5FFXA 2QSHX 1UG0A 2VPRA 1ZGWA 4UUVA 3CMAI 3DU6A 3GCMA 5FROA 3OS0A 4BBRJ 5J4VA 1YW8A 2VQLA 3BOQA 1I3QJ 4CXFA 1X2NA 3GEZA 2E7XA 4KICA 2R7QA 1J09A 4AVPA 5H6QA 5IP7J 4A3DJ 3S2DJ 2I5UA 5IPAA 2KP6A 5L3FA 3PIPF 2F2EA 2Z1DA 3H0GJ 2Q0OA 3DKXA 4MNUA 4CYCA 4G7ZF 1GT0C 5ICGA 5J8FA 4YRVA 3K4BA 3KCCA 5CVJA 2FOKA 1G3SA 2Q1ZB 4J01A 4HX4A 3HTSB 4BAYA 3WTXC 4B4CA 5J1UA 3LNQA 2M2EA 1T6SA 1ETWA 2RQQA 4AD9A 5FD5A 4MO7A 1HCRA 2EV0A 2IA1A 1XCBA 2L9SA 1KU7A 3LA7A 5LHIA 3BTLA 1Y8QB 3HOTA 2AQFA 2E1NA 2LRDA 3PIOF 5FKKA 3GTJJ 4P9FA 1LQ1A 1P92A 4GCVA 3MQ0A 3L9FA 4ZYGA 3F22A 1SAUA 1F4KA 3VWBA 2Y2ZA 2HU9A 4KNYA 2Z3YA 2LC2A 2DA3A 3HSEA 3HBLA 3BZKA 2STTA 3CUQA 3U1KA 1E3PA 2Y69H 3J7ZI 2W82A 2JQ7A 4ZYHA 1U3EM 1H8AC 1LKXA 2OPTA 1G4DA 2G9WA 3RKWA 2DFHA 5J1YA 4B3AA 3E0JB 1I27A 5DS9A 2VLAA 3PUBA 1DU0A 4RS8A 4BACA 4A0ZA 3TOBA 3IV5A 2QA4I 5JFRA 3TP0A 1Z6TA 4Y15A 2JSCA 3DPLC 1JGSA 2GOMA 2QF7A 2NNNA 1EJ9A 2LTPA 3OYIA 2LY9A 3IL2A 3JRFA 2XF5A 1ZG5A 2PQ8A 1BIAA 2M34A 5C44J 2Z33A 2GA2A 3ASOH 1Z6RA 2W00A 5L3DA 4HZFA 5DM7F 3LFUA 1HSJA 2RDPA 1P4AA 4PFOA 3VSLA 1J9IA 2E1MB 1B9NA 3IH2A 2FOWA 2L9RA 1TW3A 1WHUA 1H89C 3VOEA 4I6ZA 1HLVA 3BPXA 2XGCA 4E4HA 4BYYA 4N4NB 1ETKA 3RZOJ 2JA2A 2X0LA 3TBIA 4EJUA 2HVSA 3QRFF 2CO5A 2IEKA 4IX7A 3W6KB 4FASD 4XRMA 3CLOA 4XL9A 3PSFA 1LNWA 2PMZA 4GRIA 1ZAOA 1A36A 4BE0A 3F8CA 2DW4A 3O8GA 5HDKA 5JVTA 2HEOA 2R7VA 2ZXIA 2RAEA 3FF5A 3IH3A 4I76A 4EATA 5EZHA 1UHWA 2RVCA 4RB2C 1EA3A 2DODA 2AXLA 2GQQA 3IKTA 2E1CA 3AG1H 3OWTA 3UNGC 1WRJA 3WGHA 4NQWA 2R7SA 4LK0F 4UVBA 1HW5A 1P2FA 5DDGA 2A68F 4Y7NJ 2CJJA 2CQNA 1IUYA 3X2QH 1KQ0A 4J19A 3BCAA 1VTNC 3J80K 2O8KA 5CVRA 1RUNA 2BGCA 2EV6A 3JSPA 2ZXWH 1YYVA 2MSYA 4LG0A 1ODDA 1XMAA 1FOKA 5FLMJ 3GLXA 4M6VA 3ONQA 5GPCA 1K7AA 4WXCA 1FSEA 4JP0A 1YX5A 3P9IA 3FXLA 5FJ8J 4M72A 2VODA 3GVAA 1BL0A 3C2HA 5M5XJ 5LHHA 3DQVC 5FKNA 3WGGA 1QO0D 3LSHA 4Y13A 4V19K 3DTKA 2HQNA 1IW7F 2BY3A 5H20A 2LF7A 1R4MB 3PO2J 2VKVA 4RLQA 3E6BA 4PFPA 2QBYA 4C9YA 1TQPA 1F5TA 4K2EA 3G1MA 4DGWB 1GXQA 1A6QA 3BROA 2R7ZJ 1D1CA 4OAYA 2NOJB 2P7CB 2VPLA 2DI3A 2BEOA 1QNTA 3CC2I 4L5IA 4E7LA 3HKZA 4WXHA 3A03A 1YITI 4XICA 3QP6A 2IT0A 1ITYA 2N8GA 2L9NA 3RTRA 4R1HA 1R5GA 4YIRX 5HLTA 3SZGA 1ZELA 2R7OA 2NVUB 2RQPA 2F5FA 1TL8A 1ZRDA 1GLNA 1ZR4A 2VC1A 2A05A 1T8IA 3OR1C 1V54H 1OYYA 4Y4RA 4IOAF 5E8GA 3I54A 1SFXA 3PFIA 4Z2YA 2DOEA 4YIIA 5E17F 2P6SA 1DU6A 2V79A 2YU3A 1Z67A 2DFEA 3ZMUA 3S3MA 2MBFA 5JLWA 2HOEA 1TQIA 4M74A 2LOOA 1WJCA 3D5RC 1XC5A 4II2A 3WODF 2G0EA 4LJZF 3E5QA 1HW2A 2XAHA 4HV5A 1POGA 3OL4A 2OU2A 4BQOA 3K0LA 5DD8A 3Q5FA 1D8KA 1QA6A 2NXNB 3C7JA 1VZ0A 2F5CA 2NS8A 2PLYA 4UUTA 3AG4H 4XSZF 2LREA 5CVVA 3GZ5A 1T33A 5F6FA 1LVAA 4RM2A 4Q48A 1LDJA 3FHZA 3OYDA 3GWZA 3SJMA 3K70C 1W0UA 4G94A 1VQ9I 1ZRFA 1SMYF 2IP2A 1PP7U 1IDZA 5K1YA 5HDGA 3ZOBA 3HL2A 4XLAA 5IOYA 1VQOI 3WE2A 2KDZA 2CQQA 3TOAA 4YFKF 1J59A 4KDPA 4LOCA 1MH3A 1R4NB 1TT0A 1BI3A 4I98B 5F1JA 3PQJA 2EQRA 5J47A 5J8CA 1JJ8C 4OIRF 5FKLA 4BQNA 1IN5A 1MMSA 4QTRA 2FNPA 4L0YB 3LSJA 3CJNA 3QYFA 1YO5C 2K9MA 3QQAA 1X19A 4YFXF 2DT6A 5DV5A 5EDNA 2E71A 3SZTA 2VT2A 3IC7A 4RGXA 2XF7A 1MIJA 1DP3A 3V8KA 1FIPA 3RPUA 2GBYA 2XB0X 3QYEA 1O3RA 1I39A 5E3LA 2BW3A 4X6AJ 2DOFA 2CG4A 2D45A
chains in the Genus database with same CATH topology
1FEXA 1MBEA 1U9OA 3WHBA 3S1RJ 4A3KJ 3MKLA 2GM4A 2LP0A 3BR6A 3PO3J 3TW7A 1RPWA 1W0TA 3JRHA 4UUSB 3SDGA 1JTYA 4XRSG 1QVTA 2CUFA 3BTCA 2FD5A 4A3IJ 1JKQC 2ECCA 1S7EA 1U78A 5C4XJ 2CU7A 3FKIJ 4AUXA 5E3NA 4BXXJ 3OSFA 4G12A 2NS7A 1LFUP 5IYCJ 1ZKGA 4DZJA 1X2MA 4JX4A 4A69C 5IP6A 2R0QC 1Y1VJ 1CQTA 3GTQJ 1IJWC 1MSEC 5EYRA 2LVSA 3E7LA 2NVXJ 4JX6A 4DYQA 5EG0B 1EF4A 3BQZA 5IOZA 4M3FA 2FJ1A 2L7MP 3K2AA 2LD5A 2B63J 2M8GX 2O9LA 1IDYA 1ZQ3P 1B8IA 1YRNA 3A02A 4FISA 1B72A 3RQIA 1RR7A 3Q0UA 5EEAA 4FCYA 2YS9A 5HODA 2HOTA 4A93J 1FTTA 2JN6A 2WB1N 2CQXA 1IV6A 2R5ZA 1AKHA 4D5CA 4JYKA 3S14J 3G1OA 5FKMA 4BY1J 4M3BA 1O4XA 5GPAA 3DCFA 3BG9A 4D7NA 3MVPA 1JUSA 3BTJA 3BG5A 1K83J 2IAIA 4BY7J 2E19A 3CDLA 3S2HJ 4A3JJ 1HDDC 4FTHA 2JA5J 2M9HA 5K7FA 4D5FA 1Y1WJ 3GTKJ 2HI3A 3BT9A 1HDPA 4HNVA 1JKRC 2ELKA 1K61A 1WI3A 5M3MJ 5F08A 3ZQHA 5F0FA 3GBGA 1B8IB 2YU9J 1YRNB 2K9NA 1B72B 1IC8A 3K7AJ 5E3OA 4A3FJ 3OOUA 1PUFA 1BW5A 2R5ZB 1AKHB 1UG2A 2H8RA 5F0HA 2EZIA 1VNDA 1ORKA 3HOZJ 4RDUA 1X58A 3NAUA 1TWCJ 1JJ6C 5K7ZA 2E2JJ 3RZDJ 5J3LA 1GVDA 1SANA 2H1KA 3DEWA 1ETOA 4V2GA 2XGDA 1WPKA 3ZQGA 2DMQA 1JUPA 3HM5A 1XG1A 3BR5A 3SFIA 2ID6A 4V2FA 4M3DA 1VF9A 3ZQIA 1ETYA 3S1NJ 3A01A 3TEDA 3CMYA 2X48A 2HXOA 3Q0VA 5GP9A 1NK2P 1MSFC 1ZTRA 2WV1A 3QPLA 2ECBA 1F43A 3JRAA 1MBFA 4W97A 3S1QJ 5FKOA 1JTXA 1TC3C 2NVQJ 1PUFB 1T56A 2K9QA 3FK7A 3GTGJ 2TCTA 3HOVJ 3BR0A 2VPRA 1ZGWA 4C3HJ 1LE8A 4XK4A 4BBRJ 4B1RA 2XRLA 2MGQA 2LLKA 1I3QJ 1X2NA 4RBOA 1AHDP 2JJ7A 1MBKA 4X1EA 2CRGA 5M3FJ 5IP7J 1JGGA 5IYBJ 4A3DJ 3HGYA 3S2DJ 3I4MJ 5IPAA 2HOAA 4IHWA 5C4JJ 4FE4A 1TWAJ 2MW8A 2X6OA 2EZKA 3H0GJ 2FX0A 2Y30A 4CYCA 3A01B 1GT0C 2DTZA 3HB9A 4MFDA 3BR2A 1RKTA 5F27A 2JMWA 1AU7A 3OIOA 4Y52J 1P7IA 4AC0A 3GTPJ 2DA2A 4B4CA 5J1UA 3LNQA 2M2EA 3D1NI 1ETWA 4XIDA 3TP3A 4MO7A 1HCRA 1TWFJ 4A3CJ 1LE8B 4C3JJ 3BTLA 1F36A 2OF7A 2DMUA 5FKKA 3GTJJ 2MG4A 2X9DA 2Y2ZA 5IYDJ 4DYCA 3JR9A 2DA3A 3HBLA 1BJZA 3BR3A 2HXIA 2VI6A 1RKWA 2AO9A 1RETA 1H8AC 5F0CA 2OPTA 1ZK8A 5J1YA 4CYCB 4B3AA 5DS9A 1DU0A 9ANTA 3FISA 1FIAA 2GLOA 2HYJA 3RKQA 3IV5A 3TP0A 2AHQA 4JX5A 2L7FP 3FK6A 2CUEA 4ABZA 1TWHJ 2QF7A 2ZB9A 4QSHA 3BQYA 2EZLA 2LTPA 2LY9A 2XGEA 3JRFA 3Q3SA 3JRBA 4A3LJ 4A3BJ 2M34A 5C44J 3LSPA 2W48A 2XPWA 2L7ZA 4M3EA 4C2MJ 1OCTC 2FQ4A 2DMPA 2R93J 3IH2A 4IHVA 2L9RA 2YUSA 3QPSA 1H89C 1HLVA 2KT0A 4I6ZA 3GTMJ 2EBIA 5IP9J 2XGCA 1ETKA 3RZOJ 4MLOA 1NTCA 5DTDA 1GV2A 1ENHA 2LKXA 3BR1A 1JT6A 3ZQLA 1BW6A 4FE7A 2IEKA 4QIWN 2IBDA 2HOSA 1NK3P 5J1RA 3FIWA 4XRMA 2DA5A 3CQZJ 5F04A 3M3YJ 1I6HJ 3HGGA 2ME6A 2EZHA 3O8GA 1LFBA 2RAEA 2XB5A 3CCYA 3IH3A 4I76A 3OSGA 5EZHA 1ZR2A 2ID3A 5M5WJ 2PMZN 2DJNA 5E3MA 1WGXA 1U9NA 2E1OA 2LK2A 2Y9YA 3Q0WA 3B6CA 4A3GJ 4Y7NJ 2CJJA 3GTLJ 1R9TJ 5EF6A 4J19A 2E2HJ 3ZQCA 3GTOJ 3HOWJ 2O8KA 3S1MJ 3M4OJ 2Y9ZA 1IUFA 2K9SA 4BKXA 3LSRA 2MSYA 4A3EJ 5FLMJ 4M6VA 3JRIA 1WH7A 2WAQN 5GPCA 3HOYJ 4JP0A 2R5YA 5FJ8J 1BL0A 2JA8J 1MBHA 3S15J 1U8BA 4IHXA 3LOCA 5M5XJ 4C3IJ 1GV5A 5FKNA 1IG7A 2JK3A 2JWTA 1RESA 1TWGJ 2ME0A 1JKPC 4W1UA 2EH3A 4L5EA 4DW6A 2D5VA 2XPUA 1GUUA 3IH4A 1FTZA 3BG3A 2M0CA 3LSGA 1UMQA 1WCMJ 3PO2J 2NVYJ 2VKVA 5FLVA 1OFCX 3PM1A 3W6VA 3UKGA 3G1MA 3JRGA 1FJLA 2R7ZJ 1WH5A 3HOXJ 1MH4A 1MBJA 2R92J 2LFBA 1Z77A 1JT0A 4M3GA 1MBGA 3A03A 3ZQFA 2VUMJ 4XICA 5BNGA 4GFBA 1MNMC 1ITYA 2DA7A 2N8GA 2O7OA 1ETVA 1A5JA 2LR8A 2XSDC 1ETQA 2QCOA 2HDDA 2DA4A 2R5YB 1HOMA 3HKZN 1ZR4A 1ETXA 2VKEA 4EEFG 2JA7J 1IGNA 4IEJA 1BA5A 3G1LA 4BBSJ 1DU6A 1I50J 1QPIA 1IRZA 5JLWA 3JRCA 5EGOA 1SFOJ 2DA1A 5EZGA 1XC5A 2G0EA 1JKOC 2K40A 1GDTA 5M5YJ 1QVUA 1POGA 2XPVA 3F0CA 3JRDA 2NVTJ 2NS8A 3H3VK 4UUTA 4AYBN 1APLC 1OJLA 1T33A 3BTIA 5K7HA 1D5YA 3HEFA 4D7MA 2JA6J 1QRYA 2I10A 1A6IA 3SJMA 1E3OC 1W0UA 2DMNA 4DYRA 2DMTA 3I4NJ 2P81A 1IDZA 4DZPA 1Q1VA 3VPRA 3ZOBA 1G2HA 5IOYA 4UUSA 4MFEA 3HDDA 2KDZA 2CQQA 4IHYA 2TRTA 4LOCA 1MH3A 5EGOB 5C3EJ 3JREA 2HQ5A 3S16J 5F1JA 5JLXA 2EQRA 1JJ8C 2DA6A 1Z0XA 1VFCA 5FKLA 2COBA 2L0KA 1XS9A 2E2IJ 2Y0SN 1JUMA 1OCPA 4XRSA 4MIMA 4QTRA 2Y31A 3HOUJ 3TW6A 3WHCA 3LSJA 3NARA 3QQAA 1P7JA 3L1PA 4A3MJ 1HF0A 1VI0A 5EDNA 4NDLA 3O8HA 1FIPA 2GBYA 1H88C 2XB0X 3B6AA 3S17J 2NOGA 5E3LA 2DN0A 4X6AJ 4S0HB 3MN2A 1UHSA 3C2BA 5EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEX A;  1MBE A;  1U9O A;  3WHB A;  3S1R J;  4A3K J;  3MKL A;  2GM4 A;  2LP0 A;  3BR6 A;  3PO3 J;  3TW7 A;  1RPW A;  1W0T A;  3JRH A;  4UUS B;  3SDG A;  1JTY A;  4XRS G;  1QVT A;  2CUF A;  3BTC A;  2FD5 A;  4A3I J;  1JKQ C;  2ECC A;  1S7E A;  1U78 A;  5C4X J;  2CU7 A;  3FKI J;  4AUX A;  5E3N A;  4BXX J;  3OSF A;  4G12 A;  2NS7 A;  1LFU P;  5IYC J;  1ZKG A;  4DZJ A;  1X2M A;  4JX4 A;  4A69 C;  5IP6 A;  2R0Q C;  1Y1V J;  1CQT A;  3GTQ J;  1IJW C;  1MSE C;  5EYR A;  2LVS A;  3E7L A;  2NVX J;  4JX6 A;  4DYQ A;  5EG0 B;  1EF4 A;  3BQZ A;  5IOZ A;  4M3F A;  2FJ1 A;  2L7M P;  3K2A A;  2LD5 A;  2B63 J;  2M8G X;  2O9L A;  1IDY A;  1ZQ3 P;  1B8I A;  1YRN A;  3A02 A;  4FIS A;  1B72 A;  3RQI A;  1RR7 A;  3Q0U A;  5EEA A;  4FCY A;  2YS9 A;  5HOD A;  2HOT A;  4A93 J;  1FTT A;  2JN6 A;  2WB1 N;  2CQX A;  1IV6 A;  2R5Z A;  1AKH A;  4D5C A;  4JYK A;  3S14 J;  3G1O A;  5FKM A;  4BY1 J;  4M3B A;  1O4X A;  5GPA A;  3DCF A;  3BG9 A;  4D7N A;  3MVP A;  1JUS A;  3BTJ A;  3BG5 A;  1K83 J;  2IAI A;  4BY7 J;  2E19 A;  3CDL A;  3S2H J;  4A3J J;  1HDD C;  4FTH A;  2JA5 J;  2M9H A;  5K7F A;  4D5F A;  1Y1W J;  3GTK J;  2HI3 A;  3BT9 A;  1HDP A;  4HNV A;  1JKR C;  2ELK A;  1K61 A;  1WI3 A;  5M3M J;  5F08 A;  3ZQH A;  5F0F A;  3GBG A;  1B8I B;  2YU9 J;  1YRN B;  2K9N A;  1B72 B;  1IC8 A;  3K7A J;  5E3O A;  4A3F J;  3OOU A;  1PUF A;  1BW5 A;  2R5Z B;  1AKH B;  1UG2 A;  2H8R A;  5F0H A;  2EZI A;  1VND A;  1ORK A;  3HOZ J;  4RDU A;  1X58 A;  3NAU A;  1TWC J;  1JJ6 C;  5K7Z A;  2E2J J;  3RZD J;  5J3L A;  1GVD A;  1SAN A;  2H1K A;  3DEW A;  1ETO A;  4V2G A;  2XGD A;  1WPK A;  3ZQG A;  2DMQ A;  1JUP A;  3HM5 A;  1XG1 A;  3BR5 A;  3SFI A;  2ID6 A;  4V2F A;  4M3D A;  1VF9 A;  3ZQI A;  1ETY A;  3S1N J;  3A01 A;  3TED A;  3CMY A;  2X48 A;  2HXO A;  3Q0V A;  5GP9 A;  1NK2 P;  1MSF C;  1ZTR A;  2WV1 A;  3QPL A;  2ECB A;  1F43 A;  3JRA A;  1MBF A;  4W97 A;  3S1Q J;  5FKO A;  1JTX A;  1TC3 C;  2NVQ J;  1PUF B;  1T56 A;  2K9Q A;  3FK7 A;  3GTG J;  2TCT A;  3HOV J;  3BR0 A;  2VPR A;  1ZGW A;  4C3H J;  1LE8 A;  4XK4 A;  4BBR J;  4B1R A;  2XRL A;  2MGQ A;  2LLK A;  1I3Q J;  1X2N A;  4RBO A;  1AHD P;  2JJ7 A;  1MBK A;  4X1E A;  2CRG A;  5M3F J;  5IP7 J;  1JGG A;  5IYB J;  4A3D J;  3HGY A;  3S2D J;  3I4M J;  5IPA A;  2HOA A;  4IHW A;  5C4J J;  4FE4 A;  1TWA J;  2MW8 A;  2X6O A;  2EZK A;  3H0G J;  2FX0 A;  2Y30 A;  4CYC A;  3A01 B;  1GT0 C;  2DTZ A;  3HB9 A;  4MFD A;  3BR2 A;  1RKT A;  5F27 A;  2JMW A;  1AU7 A;  3OIO A;  4Y52 J;  1P7I A;  4AC0 A;  3GTP J;  2DA2 A;  4B4C A;  5J1U A;  3LNQ A;  2M2E A;  3D1N I;  1ETW A;  4XID A;  3TP3 A;  4MO7 A;  1HCR A;  1TWF J;  4A3C J;  1LE8 B;  4C3J J;  3BTL A;  1F36 A;  2OF7 A;  2DMU A;  5FKK A;  3GTJ J;  2MG4 A;  2X9D A;  2Y2Z A;  5IYD J;  4DYC A;  3JR9 A;  2DA3 A;  3HBL A;  1BJZ A;  3BR3 A;  2HXI A;  2VI6 A;  1RKW A;  2AO9 A;  1RET A;  1H8A C;  5F0C A;  2OPT A;  1ZK8 A;  5J1Y A;  4CYC B;  4B3A A;  5DS9 A;  1DU0 A;  9ANT A;  3FIS A;  1FIA A;  2GLO A;  2HYJ A;  3RKQ A;  3IV5 A;  3TP0 A;  2AHQ A;  4JX5 A;  2L7F P;  3FK6 A;  2CUE A;  4ABZ A;  1TWH J;  2QF7 A;  2ZB9 A;  4QSH A;  3BQY A;  2EZL A;  2LTP A;  2LY9 A;  2XGE A;  3JRF A;  3Q3S A;  3JRB A;  4A3L J;  4A3B J;  2M34 A;  5C44 J;  3LSP A;  2W48 A;  2XPW A;  2L7Z A;  4M3E A;  4C2M J;  1OCT C;  2FQ4 A;  2DMP A;  2R93 J;  3IH2 A;  4IHV A;  2L9R A;  2YUS A;  3QPS A;  1H89 C;  1HLV A;  2KT0 A;  4I6Z A;  3GTM J;  2EBI A;  5IP9 J;  2XGC A;  1ETK A;  3RZO J;  4MLO A;  1NTC A;  5DTD A;  1GV2 A;  1ENH A;  2LKX A;  3BR1 A;  1JT6 A;  3ZQL A;  1BW6 A;  4FE7 A;  2IEK A;  4QIW N;  2IBD A;  2HOS A;  1NK3 P;  5J1R A;  3FIW A;  4XRM A;  2DA5 A;  3CQZ J;  5F04 A;  3M3Y J;  1I6H J;  3HGG A;  2ME6 A;  2EZH A;  3O8G A;  1LFB A;  2RAE A;  2XB5 A;  3CCY A;  3IH3 A;  4I76 A;  3OSG A;  5EZH A;  1ZR2 A;  2ID3 A;  5M5W J;  2PMZ N;  2DJN A;  5E3M A;  1WGX A;  1U9N A;  2E1O A;  2LK2 A;  2Y9Y A;  3Q0W A;  3B6C A;  4A3G J;  4Y7N J;  2CJJ A;  3GTL J;  1R9T J;  5EF6 A;  4J19 A;  2E2H J;  3ZQC A;  3GTO J;  3HOW J;  2O8K A;  3S1M J;  3M4O J;  2Y9Z A;  1IUF A;  2K9S A;  4BKX A;  3LSR A;  2MSY A;  4A3E J;  5FLM J;  4M6V A;  3JRI A;  1WH7 A;  2WAQ N;  5GPC A;  3HOY J;  4JP0 A;  2R5Y A;  5FJ8 J;  1BL0 A;  2JA8 J;  1MBH A;  3S15 J;  1U8B A;  4IHX A;  3LOC A;  5M5X J;  4C3I J;  1GV5 A;  5FKN A;  1IG7 A;  2JK3 A;  2JWT A;  1RES A;  1TWG J;  2ME0 A;  1JKP C;  4W1U A;  2EH3 A;  4L5E A;  4DW6 A;  2D5V A;  2XPU A;  1GUU A;  3IH4 A;  1FTZ A;  3BG3 A;  2M0C A;  3LSG A;  1UMQ A;  1WCM J;  3PO2 J;  2NVY J;  2VKV A;  5FLV A;  1OFC X;  3PM1 A;  3W6V A;  3UKG A;  3G1M A;  3JRG A;  1FJL A;  2R7Z J;  1WH5 A;  3HOX J;  1MH4 A;  1MBJ A;  2R92 J;  2LFB A;  1Z77 A;  1JT0 A;  4M3G A;  1MBG A;  3A03 A;  3ZQF A;  2VUM J;  4XIC A;  5BNG A;  4GFB A;  1MNM C;  1ITY A;  2DA7 A;  2N8G A;  2O7O A;  1ETV A;  1A5J A;  2LR8 A;  2XSD C;  1ETQ A;  2QCO A;  2HDD A;  2DA4 A;  2R5Y B;  1HOM A;  3HKZ N;  1ZR4 A;  1ETX A;  2VKE A;  4EEF G;  2JA7 J;  1IGN A;  4IEJ A;  1BA5 A;  3G1L A;  4BBS J;  1DU6 A;  1I50 J;  1QPI A;  1IRZ A;  5JLW A;  3JRC A;  5EGO A;  1SFO J;  2DA1 A;  5EZG A;  1XC5 A;  2G0E A;  1JKO C;  2K40 A;  1GDT A;  5M5Y J;  1QVU A;  1POG A;  2XPV A;  3F0C A;  3JRD A;  2NVT J;  2NS8 A;  3H3V K;  4UUT A;  4AYB N;  1APL C;  1OJL A;  1T33 A;  3BTI A;  5K7H A;  1D5Y A;  3HEF A;  4D7M A;  2JA6 J;  1QRY A;  2I10 A;  1A6I A;  3SJM A;  1E3O C;  1W0U A;  2DMN A;  4DYR A;  2DMT A;  3I4N J;  2P81 A;  1IDZ A;  4DZP A;  1Q1V A;  3VPR A;  3ZOB A;  1G2H A;  5IOY A;  4UUS A;  4MFE A;  3HDD A;  2KDZ A;  2CQQ A;  4IHY A;  2TRT A;  4LOC A;  1MH3 A;  5EGO B;  5C3E J;  3JRE A;  2HQ5 A;  3S16 J;  5F1J A;  5JLX A;  2EQR A;  1JJ8 C;  2DA6 A;  1Z0X A;  1VFC A;  5FKL A;  2COB A;  2L0K A;  1XS9 A;  2E2I J;  2Y0S N;  1JUM A;  1OCP A;  4XRS A;  4MIM A;  4QTR A;  2Y31 A;  3HOU J;  3TW6 A;  3WHC A;  3LSJ A;  3NAR A;  3QQA A;  1P7J A;  3L1P A;  4A3M J;  1HF0 A;  1VI0 A;  5EDN A;  4NDL A;  3O8H A;  1FIP A;  2GBY A;  1H88 C;  2XB0 X;  3B6A A;  3S17 J;  2NOG A;  5E3L A;  2DN0 A;  4X6A J;  4S0H B;  3MN2 A;  1UHS A;  3C2B A;  5EG0 A; 
#chains in the Genus database with same CATH topology
 2HWV A;  5LRS A;  3HC7 A;  4WXD A;  4U0Y A;  3HRT A;  3HZJ A;  5HNF A;  4A3K J;  4DQ2 A;  2HTJ A;  1LFP A;  1XSX A;  2XKO A;  3TDZ C;  3JRH A;  4UUS B;  4ETS A;  1A04 A;  1JTY A;  3KE2 A;  3VFZ A;  4CZZ A;  1D5V A;  1QVT A;  3BTC A;  3QAH A;  1MMG A;  5ICF A;  4IVN A;  4G7H F;  2DPU A;  1OYI A;  1T38 A;  2LBF B;  1KGS A;  5C4X J;  1OCO H;  4BXX J;  4ZJZ A;  4RAG A;  3DPU A;  5IYC J;  2DDA A;  4DZJ A;  1SFE A;  4F52 A;  2O8X A;  1RIO H;  4CCL A;  2H27 A;  3HUG B;  5KK1 A;  2BY1 A;  1XGN A;  1AWC A;  4LLL A;  4F93 B;  2BHY A;  2LDU A;  4IKF A;  5L3E A;  1CQT A;  1IJW C;  2E34 A;  5EYR A;  1DP7 P;  3E7L A;  3IWZ A;  5EG0 B;  2PEX A;  1U5T C;  1OKR A;  3BQZ A;  1EH8 A;  1L3L A;  2WB1 A;  5IOZ A;  2DCE A;  2FJ1 A;  2LD5 A;  4MEX F;  5AIQ A;  2Z2S B;  1R6R A;  4BU2 A;  2LKP A;  3JAM Z;  1FC3 A;  4M9X A;  4I0B A;  2IGO A;  2X6W A;  4BH9 A;  1NH3 A;  2YR2 A;  3EUH C;  5ICC A;  2VJ4 A;  4GXO A;  1U6G A;  2JN6 A;  4I7H A;  2DU9 A;  3S2W A;  2R5Z A;  1HBX G;  3AG2 H;  1ON2 A;  3MD2 A;  3P9K A;  4ON0 A;  3R6S A;  4BY1 J;  3K70 D;  1TNS A;  4NC7 A;  1O4X A;  2PN6 A;  5B5E C;  2XRN A;  3IUO A;  5GPA A;  1K4S A;  4HA8 A;  1R36 A;  1FY7 A;  2E35 A;  2LH9 A;  4XN0 A;  1MJ9 A;  1G59 A;  2KMU A;  3BLY A;  2IAI A;  3MZY A;  4IXA A;  1QZZ A;  4PJ0 C;  3CDL A;  2OA4 A;  3H35 A;  4PGH A;  4JK1 X;  4L18 B;  3SDB A;  4CGZ A;  2VKD A;  2WY8 Q;  2M9H A;  3FBN B;  4D5F A;  3VEP A;  2MD0 A;  5HS7 A;  4HLX A;  1DPU A;  4UVC A;  4IRH A;  2V4J C;  5D6E A;  4HNV A;  4DJA A;  1I6X A;  3MKW B;  2P5L C;  5GAH J;  5BPD A;  2V26 A;  3GZN B;  5F08 A;  3ZQH A;  1FP2 A;  1X4O A;  1RNL A;  3CJT B;  5CQE A;  1ZLJ A;  4U0V A;  3K4K A;  1T0F A;  3R0A A;  4Y33 A;  3MEX A;  4KA4 A;  3Q9S A;  4GDF A;  5B1A H;  4A3F J;  5TRD A;  2ZSI B;  3QWL A;  3HPH A;  5K5O A;  1PUF A;  2BY0 A;  3KEQ A;  2KIF A;  3K4L A;  4RDU A;  3NAU A;  2IW5 A;  3FZV A;  4BXF A;  3KZY A;  5CKT A;  2R4G A;  3TMO A;  5K7Z A;  3V7S A;  2VOP A;  2BHZ A;  2LY2 A;  5J3L A;  5GTI C;  2ETH A;  1NG7 A;  2KIU A;  2P7V B;  4V2G A;  3TKY A;  2L7K A;  4IRI A;  3ULQ B;  4AIK A;  3ZQG A;  3DBH B;  1WJF A;  1UFM A;  1XG1 A;  3BR5 A;  1BOB A;  1R7J A;  2IVM A;  4M3D A;  1VF9 A;  2JUG A;  1W7P D;  3WTU C;  2W7N A;  3K10 A;  1XGO A;  3P7N A;  2KDO A;  3CMY A;  3BZ6 A;  1SVO A;  2X48 A;  2ECB A;  3I9V 2;  2LY1 A;  3ZMV A;  1VQ4 I;  4W97 A;  2RGV A;  4IQJ A;  5D4R A;  1R23 A;  2QZ8 A;  2ZME B;  1T56 A;  4IHS A;  4ESJ A;  3HSF A;  3K4N A;  3BR0 A;  2DQR A;  2W57 A;  4UB8 C;  3ELK A;  1LE8 A;  3ZGK A;  3TGN A;  4ESB A;  1F1Z A;  2Y75 A;  3I4P A;  2PI0 A;  5L3B A;  1MJA A;  2XRO A;  2HGC A;  1R00 A;  2B7E A;  3GX4 X;  1ZGA A;  3ZN1 A;  2DPD A;  1EH7 A;  1IV8 A;  2CRG A;  2KZV A;  3BZC A;  4CCM A;  5IYB J;  1JGG A;  1OR7 A;  3ZPL A;  3CCS I;  3KLO A;  1KU3 A;  1SVM A;  1MNE A;  4WCG A;  4PJN A;  4Y17 A;  4E7H A;  1WJ5 A;  4E7Z A;  4BJ6 C;  2Y30 A;  3A01 B;  3IAS 2;  5LGT A;  3BR2 A;  4RAY A;  1OIS A;  2JMW A;  1YJN I;  3OIO A;  4CDG A;  3GTP J;  4I02 A;  1J75 A;  2PJR A;  2QSG X;  2M1B A;  4XID A;  2NAZ A;  3KX2 A;  4YIF A;  3CCR I;  3TP3 A;  3KP3 A;  4ZZL A;  4MQV A;  1W7P B;  1PUE E;  1MMD A;  4XLF A;  2HR3 A;  1XSD A;  3L09 A;  4KIB A;  3J7A Y;  2OF7 A;  2DMU A;  2HFH A;  3RCO A;  2AQE A;  3LSM A;  1W1W E;  2MG4 A;  2X9D A;  4KIS A;  3CJQ B;  2ZNZ A;  1VQL I;  4AID A;  2HZD A;  2HKO A;  3DTI A;  1BM9 A;  1FBU A;  2M0M A;  2M87 A;  2HXI A;  1U5T B;  2AO9 A;  3N97 A;  3ECH A;  4XOP A;  1O3S A;  3LQQ A;  5F0C A;  5E20 A;  2E60 A;  4I0A A;  3WGI A;  9ANT A;  1FIA A;  2GLO A;  2HYJ A;  3RKY A;  1VQ8 I;  3NWS A;  3WTT C;  2ZC2 A;  2IRF G;  2ISZ A;  3HYI A;  3ZMS A;  3SYT A;  1TWH J;  5ILU A;  3BQY A;  4HSR A;  3OS2 A;  4A3B J;  2M5W A;  3JRB A;  2HQA A;  1YIO A;  2KRF A;  3GF2 A;  5LGN A;  5FGM A;  4LIV A;  2ZO4 A;  2L7Z A;  3HOS A;  2W1O A;  3FBI B;  3MKZ A;  4EJT A;  2FQ4 A;  5KNL A;  3QP5 A;  2FQ3 A;  1VQK I;  4IHV A;  6PAX A;  3QPT A;  4EGZ A;  3E5U A;  3JCU C;  4FX0 A;  1NTC A;  2RC4 A;  1GV2 A;  4MLO A;  1ENH A;  2LKX A;  1S7O A;  3GXO A;  3S93 A;  4BUP A;  1JE8 A;  4NHJ A;  4ESF A;  3ZQL A;  1O57 A;  4QIW N;  2R7X A;  3HRU A;  4OWR B;  4OIN F;  1NK3 P;  4MTD A;  5DCM B;  4RB3 C;  4F3Q A;  4Z6Y A;  5DUI A;  2UV1 A;  1QU3 A;  1MD0 A;  5F04 A;  1ZRE A;  3M3Y J;  2CQK A;  5K5R A;  1BJA A;  4E70 A;  2QEN A;  4KMF A;  1V55 H;  1X1B A;  3I58 A;  2XB5 A;  3CCY A;  4I2O A;  4UVA A;  3W2A A;  1K6O A;  2ID3 A;  1S29 A;  3BJ6 A;  3PNT A;  5F64 A;  4OIP F;  3FWE A;  1PYV A;  2K5C A;  4HDV A;  3JSO A;  2ZFU A;  3WTW C;  2EIM H;  2DJN A;  5LEJ A;  5E3M A;  2M30 A;  3BJA A;  1U9N A;  2LK2 A;  2Y9Y A;  4KMU X;  1BC7 C;  4A3G J;  3HSR A;  4IF4 A;  4O3M A;  5H2F C;  5EF6 A;  1K79 A;  2WAQ A;  3ABT A;  3KPH A;  3NWT A;  1BR1 A;  3KYL A;  2C6Y A;  2J5O A;  1K78 A;  2O6G E;  2HYF A;  4N9I A;  1JI8 A;  4ITV A;  3DU5 A;  5A2Q Z;  4EQQ A;  4FET A;  4HQM A;  1P9Q C;  4KUM A;  3MCZ A;  2EIL H;  1FYL A;  4U7B A;  1IAW A;  1W4M A;  2L02 A;  3LA2 A;  3RI4 A;  2Z99 A;  1ZHF A;  2R5Y A;  2QWW A;  3E97 A;  2XAJ A;  2DT7 B;  3CCM I;  2JA8 J;  2KKO A;  3TDU C;  2IA0 A;  1LUJ B;  2JK3 A;  2JWT A;  1YFH A;  1YX3 A;  3UR3 C;  5IY5 H;  4DW6 A;  2XPU A;  1D1B A;  3BG3 A;  3FXO A;  3KYC B;  2NVY J;  3O3K A;  2FU4 A;  2P4W A;  3W6V A;  4H0E A;  3UKG A;  3N4M A;  2L9V A;  1YOV B;  1OQY A;  2CYY A;  3L2V A;  4XLE A;  2RNJ A;  1QZY A;  2M8E A;  2HVQ A;  1MBJ A;  2R92 J;  1N75 A;  1Z77 A;  3HHG A;  4M3G A;  1JT0 A;  1P6R A;  3CME I;  5BNG A;  4HPQ A;  2W4S A;  4J00 A;  3FDY A;  4XKV A;  3GFI A;  3TL4 X;  3RYP A;  4A0X A;  2H94 A;  1GXP A;  4II3 A;  1KYW A;  1HW1 A;  4GO1 A;  4G9Y A;  1J5Y A;  2NS0 A;  4CCK A;  4XOT A;  4BEH A;  1ETX A;  3DKW A;  3LMM A;  2CW7 A;  2XUB A;  1HKT A;  3PJR A;  2P5V A;  3O6B B;  2BVL A;  4N0B A;  4BBS J;  1XTA A;  2VQC A;  1FLI A;  3CTA A;  1KU2 A;  2X1C A;  3JRC A;  1AOY A;  4ZZD A;  4B8X A;  1MND A;  5EGO A;  2Q8K A;  2XHK A;  5B3S H;  4PSX A;  4EV0 A;  5EZG A;  2CV1 A;  2FF4 A;  2XPV A;  2XAU A;  2IJL A;  4P1W A;  2GXB A;  4HAM A;  1FP1 D;  1XMX A;  3I59 B;  2VXD A;  2JSP A;  3ZQQ A;  2CQ7 A;  1APL C;  1OJL A;  2TDX A;  1D5Y A;  4KJZ A;  3HEF A;  2V7F A;  4OOI A;  2V6E A;  1VQ7 I;  3T1B A;  4YEJ A;  1A6I A;  5TJJ A;  2RN7 A;  1ZYR F;  4IJA A;  2DMN A;  1MKM A;  1QBJ A;  2CV0 A;  3CF2 A;  4DYR A;  3VOD A;  2DMT A;  4KYW A;  3I4N J;  3CCV I;  2B9S A;  3GO5 A;  1QHG A;  4UNO A;  2Y0S A;  5EJC A;  3V42 A;  1O3T A;  4NC6 A;  5J6X A;  3HDD A;  3CZ6 A;  2YPR A;  3IKV A;  3RDI A;  3JRE A;  5E1W A;  1A35 A;  5CVU A;  4QPO A;  2OUM A;  3BP8 A;  2FA5 A;  2MC4 A;  4IQ4 A;  2COB A;  3NRV A;  1XS9 A;  1OCP A;  2FXA A;  3HOU J;  2Y31 A;  1WKM A;  3WHC A;  1PDN C;  2GAU A;  1DGW Y;  4ENK A;  2M7A A;  1MJB A;  3NAR A;  4XON A;  1LDD A;  1HF0 A;  1X1A A;  2K3P A;  1FBS A;  1U0J A;  5EEH A;  2K7L A;  1H88 C;  3B6A A;  2CV2 A;  2UUZ A;  1YS7 A;  2DDB A;  3W3C A;  2DN0 A;  2ZSH B;  1D0X A;  2RRE A;  3MN2 A;  4WX9 A;  2X1E A;  3HRM A;  1U9O A;  3PFY A;  1LJ9 A;  3LSK A;  2EFN A;  3RIR A;  1V5E A;  3K2Z A;  2NNY A;  2O5R A;  3DFG A;  3PO3 J;  3TW7 A;  4PZJ A;  1W0T A;  1MGT A;  1XD7 A;  4IZZ A;  4S05 A;  3L2Q A;  1B6A A;  1E2X A;  1ZRC A;  2FD5 A;  4A3I J;  2EFO A;  2CW8 A;  1CF7 A;  3PSI A;  1S7E A;  1U78 A;  3DEE A;  4BE1 A;  4AWX B;  2CFX A;  2QQ8 A;  3OSF A;  4ZTF A;  5E18 F;  2NS7 A;  1LFU P;  1EH6 A;  1ZKG A;  2JT1 A;  4D0P A;  5IT9 K;  4XM3 A;  4JX4 A;  1MMA A;  1MDM B;  4XKC A;  1MZB A;  2IGK A;  3ABK H;  4RA2 A;  2WBM A;  3F6O A;  1RZ4 A;  3GYH X;  2OV7 A;  1MSE C;  2HVR A;  2NVX J;  4JX6 A;  4DYQ A;  5J4Y A;  1E17 A;  1TW2 A;  2ZJQ F;  1EF4 A;  2XIG A;  1B59 A;  4M3F A;  2L7M P;  2VAS A;  4B43 A;  2B63 J;  1FT9 A;  3H5N A;  3ZP5 A;  1B8I A;  2JUC A;  1YRN A;  3DLL F;  3JAM K;  4L0Z B;  1B72 A;  1RR7 A;  2ELJ A;  3S32 A;  5EEA A;  4PDK A;  4UXN A;  1IF1 A;  2QUF A;  2YS9 A;  2ACJ A;  2A5W A;  3TO9 A;  3P9C A;  1MW7 A;  1Z91 A;  2W85 A;  5GAG J;  1IV6 A;  4L9T A;  1AKH A;  5FKM A;  3WE3 A;  4CCN A;  3VYU B;  4HLY A;  3CMM A;  3ZR8 X;  3SEQ A;  2E5Z A;  1D1A A;  2KJB A;  2Q2E A;  3HXL A;  2DXI A;  2LG4 A;  4D7N A;  4KFC A;  2JPC A;  3B73 A;  5HVQ C;  3CUO A;  5IT3 A;  1GHC A;  4BY7 J;  4AYB A;  2E19 A;  1I1S A;  3S2H J;  1HKS A;  3V7C A;  3GFJ A;  4A3J J;  1HDD C;  2JA5 J;  5K7F A;  1Y1W J;  2HI3 A;  4RGR A;  1HDP A;  3FMQ A;  4HF1 A;  3L2U A;  2DJI A;  1BIB A;  5LEK A;  1YE9 A;  3S3N A;  1R71 A;  5LBQ A;  5E3O A;  2GIV A;  3KP4 A;  2KIM A;  1ZGJ A;  3VYS B;  4ZDP A;  4LD5 A;  2Z5U A;  3IWF A;  4F92 B;  1BW5 A;  4OIO F;  1R1T A;  1X4P A;  3I56 I;  3OIP A;  2H8R A;  5F0H A;  1R5H A;  2DYS H;  3K9T A;  1X58 A;  1DDN A;  1TWC J;  3M7G A;  2E2J J;  1FX7 A;  2OBP A;  3WTV C;  4Q5S F;  1GVD A;  4L5J A;  1SAN A;  3G3Z A;  2ZME C;  4DBQ A;  2X51 A;  3L2C A;  4A12 A;  1SD5 A;  3O2P E;  2OQR A;  1WPK A;  3G73 A;  2M4K A;  3M8F A;  4E7K A;  3E6M A;  3BCB A;  1WWX A;  5D5X B;  3T5X A;  3MZ8 A;  2KIQ A;  4AIH A;  3M8J A;  3ZQI A;  3S1N J;  3M1C A;  4HV6 A;  3F9K A;  1NK2 P;  1MSF C;  1Q1H A;  5FFZ A;  5HLG A;  1G8X A;  3K69 A;  3JRA A;  4BJ5 C;  4N9H A;  2EFQ A;  3E6D A;  4A2U A;  2MLG A;  3U2R A;  3MWM A;  4HST A;  2CFO A;  3H0D A;  2NVQ J;  2XAQ A;  2EV5 A;  2K9Q A;  2VIX A;  1B4A A;  4CCJ A;  2TCT A;  1YIJ I;  2EWN A;  3U9G A;  1WSU A;  1OPC A;  1T08 B;  2ZFW A;  1XDS A;  2BBY A;  3IRQ A;  2BZT A;  1I3A A;  3VYR B;  1ZG3 A;  2LLK A;  2VBY A;  4OAZ A;  4CZC A;  4BDZ A;  3OS1 A;  2F6C A;  2JJ7 A;  4PUS A;  3J81 Z;  2P5K A;  1JHF A;  4Q47 A;  3HGY A;  3DKY A;  4IHW A;  2HOA A;  2VQH A;  1YJW I;  4ZTJ A;  1TWA J;  1IN6 A;  1BI1 A;  1I5Z A;  2UXX A;  2KRH A;  2KLO A;  1UEL B;  2X6O A;  4LFU A;  2RV8 A;  5IT9 Z;  1ONV A;  5HS9 A;  2EZK A;  2MH9 A;  3QYB A;  4KN4 X;  2A6H F;  3HB9 A;  4MFD A;  1W5C C;  1RKT A;  2X85 A;  1D8J A;  5F27 A;  2DFF A;  1AU7 A;  4JOM A;  1Y8R B;  4AC0 A;  1FOX A;  2ICW G;  4PJM A;  3ERM A;  2BVM A;  3WU0 A;  4RM3 A;  2MLK A;  1FPQ A;  2IGN A;  1XX5 A;  4HG2 A;  3K4M A;  3I0T A;  4LK1 F;  3REO A;  4FQG A;  1J7K A;  3LL7 A;  1SFK A;  1Y6I A;  3F8M A;  2H8W A;  2OCC H;  2XKP A;  2BYV E;  5ILV A;  3CCL I;  3LFK A;  2COM A;  2QKL B;  1VQN I;  2KZG A;  3LAJ A;  4DYC A;  3JR9 A;  4YG2 F;  2IA2 A;  4G6D A;  3F8B A;  2MH2 A;  2K4B A;  3DV8 A;  2GZW A;  3AG3 H;  1YS6 A;  1RKW A;  1S6L A;  3G4S I;  4RLF A;  2M3A A;  1RET A;  3WU1 B;  1NHA A;  4A5N A;  3ESW B;  5FO5 A;  4CYC B;  3NQO A;  3FIS A;  1YW7 A;  3RKQ A;  2BXZ A;  2AHQ A;  3A0B C;  5KAF C;  4ZC3 A;  4LGW A;  3OY9 A;  2CUE A;  2WC2 A;  2Y0M A;  3HRS A;  2G7U A;  1BBY A;  3PNY A;  2OQG A;  1R1V A;  2EZL A;  1XMK A;  2PG4 A;  1S8N A;  1S7A A;  3LSP A;  3QPH A;  1H0M A;  2W48 A;  3I71 A;  2K3F A;  4M3E A;  3L7W A;  1XSV A;  3E6C C;  3ZCO A;  2IS1 A;  4M73 A;  1U2W A;  3EUA A;  4S04 A;  5CPR B;  3OL3 A;  2K85 A;  2KT0 A;  5IP9 J;  1VQM I;  2VC0 A;  4HW0 A;  4NUB A;  3A2K A;  3CUQ B;  2VJ5 A;  4HEA 2;  1SFU A;  1A31 A;  1Y56 A;  1IRX A;  1LDK B;  4BQA A;  5DTD A;  3MFK A;  3ERE D;  5L3C A;  1JT6 A;  4FE7 A;  1UAA A;  1SC7 A;  4CCO A;  4R79 A;  3PNV A;  3BWG A;  4F55 A;  5J1R A;  2EB7 A;  3FIW A;  4OMY A;  4B48 A;  3VYT B;  1N77 A;  4RGS A;  3PQK A;  1S3J A;  2ME6 A;  1XN7 A;  1G3W A;  5ERI A;  1LFB A;  2VON A;  4F91 B;  1D0Y A;  5LHG A;  2CW0 F;  2FBK A;  1ZR2 A;  5M5W J;  5D5U B;  2PMZ N;  1G3Y A;  1FYM A;  2YX7 A;  2EA4 A;  4M6X A;  2E36 A;  1DPR A;  3T8T A;  5FB2 A;  2E1O A;  4BJT A;  3Q0W A;  5B66 C;  1J2X A;  3HPG A;  1MDM A;  3ASN H;  1R9T J;  1WQ2 A;  1FMV A;  3EUK L;  3GTO J;  3HOW J;  3S1M J;  3M4O J;  5EEG A;  4NB5 A;  2Y9Z A;  4BKX A;  4CSW A;  4N4O B;  5A2Q K;  4CA0 A;  4A3E J;  4LB5 A;  2VL8 A;  3FM5 A;  4A0Y A;  3JRI A;  3N05 A;  1WH7 A;  2F5V A;  5D4S A;  3FXQ A;  2KRC A;  3HOY J;  4C30 A;  4KIF A;  2LMD A;  3S15 J;  1OMI A;  3LOC A;  5B1B H;  1X1C A;  3D5L A;  1OCZ H;  3ZMZ A;  3K6G A;  1JKP C;  2V1N A;  2EH3 A;  3K4J A;  3KP2 A;  3U1D A;  2A07 F;  1XGS A;  2M0C A;  4XR6 A;  4NQW B;  1UMQ A;  1WCM J;  2DO7 A;  2QQA A;  4CYD A;  3CP2 A;  2OD5 A;  4D1Q A;  1OFC X;  4YFN F;  3ABM H;  2P8T A;  1XCV A;  1TLH B;  5H6R A;  2V6C A;  2R7W A;  5FLX Z;  3GZ6 A;  4NC8 A;  3CCJ I;  1RI7 A;  1Y39 A;  2LF8 A;  1WI9 A;  4PK4 A;  1WH5 A;  1WFX A;  4HBL A;  3FKJ A;  3HOX J;  2XDV A;  3RPQ A;  3K4C A;  4ASN A;  1MBG A;  3FXK A;  3I5U A;  3LA3 A;  2RNG A;  2VUM J;  3K1N A;  3KP6 A;  4LG0 B;  4GFB A;  2GXG A;  4HF0 A;  2F48 A;  2QVO A;  1IRF A;  2WTE A;  1ETV A;  4YEL A;  2LR8 A;  1ETQ A;  1W5T A;  5TGT A;  2DA4 A;  2JZY A;  2IS6 A;  1PVE A;  3CO7 C;  2XAS A;  1PJR A;  2DLL A;  2MFZ A;  3HKZ N;  3H5R A;  1TZL A;  5HDN A;  5JHF A;  1X3Z B;  2VKE A;  3TO6 A;  1FZP B;  4EEF G;  3FX3 A;  1B1B A;  1T39 A;  2QQB A;  1F9N A;  3ZN0 A;  3R60 A;  2DBB A;  2KHM A;  2JTV A;  3ML6 A;  4B47 A;  1I50 J;  2W25 A;  3E5X A;  2QBY B;  4U0W A;  2ZJP F;  2OZU A;  1SFO J;  2GXA A;  2EFW A;  3DF8 A;  5M5Y J;  4GGG A;  4P96 A;  1Z05 A;  3DWL E;  3F0C A;  3JRD A;  4XLH A;  2NVT J;  2AXT C;  2PBI A;  3RSN A;  3H36 A;  2R7U A;  4ENN A;  4AYB N;  4I01 A;  3OYK A;  2M45 A;  3IRR A;  3H9Q A;  5BPI A;  4D7M A;  1IXR C;  5CJ9 A;  4EM1 A;  3J7Y J;  3QU6 A;  1T98 A;  3D0S A;  1KZH A;  2P81 A;  2CS3 A;  4A5M A;  5J40 A;  4DZP A;  3VPR A;  3ZQ7 A;  3H1C A;  2K9L A;  4EVI A;  4UUS A;  4MFE A;  3W2W A;  4G7O F;  1OYW A;  1UB9 A;  2ZXJ A;  4IHY A;  3K1P A;  3H92 A;  3KLN A;  2HQ5 A;  3RPU D;  3OYJ A;  2EK5 A;  2DA6 A;  4BHC A;  1Z0X A;  4U87 A;  2LBF A;  2L0K A;  1NG6 A;  2E2I J;  1BI2 A;  4GYI A;  4XRS A;  1GVJ A;  4IHT A;  3CCU I;  2VJJ A;  3W6J B;  3H5A A;  3L2R A;  1P7J A;  1VI0 A;  3HUG A;  4NDL A;  3O8H A;  4U88 A;  2MC3 A;  2HQR A;  3CC4 I;  3S17 J;  3KEO A;  4CH7 A;  1Z7U A;  1UHS A;  2LKS A;  3C2B A;  2LNB A;  5EG0 A;  2HYG D;  2CWE A;  4C2U A;  1H9T A;  5JR3 A;  2WWY A;  5DM6 F;  2EJR A;  3BG7 A;  1IO2 A;  1P4W A;  1YI2 I;  3MKL A;  2FEZ A;  2GM4 A;  2E5N A;  3P5J A;  1UST A;  2LP0 A;  3BR6 A;  3ZXS A;  1ZG1 A;  1RPW A;  4L9V A;  4L9N A;  3SDG A;  4XRS G;  2QKM B;  4OIQ F;  2CUF A;  2A3S A;  3R61 A;  3T0Y A;  1JKQ C;  3SQN A;  4G6T B;  1KYZ A;  1LVK A;  4CO8 A;  2FBH A;  3MMY B;  2ECC A;  4RMN A;  1RUO A;  2EIN H;  2CU7 A;  4IRG A;  3B02 A;  5E3N A;  2P0W A;  4G12 A;  4PGG A;  3GUD A;  1S9H A;  2YSR A;  1R22 A;  5IP6 A;  4CIC A;  2FNA A;  1FOY A;  4P5O A;  3OYA A;  3VB2 A;  5JI6 A;  2R0Q C;  1SD7 A;  5E79 C;  5D8L B;  1OR7 C;  2BW3 B;  3CDH A;  2LVS A;  3DEU A;  3SXY A;  2AS5 F;  4JQF A;  1HC8 A;  1HQC A;  2WY7 Q;  3JTH A;  4E7S A;  4KIT B;  4RAZ A;  3EDP A;  3OYE A;  4UY8 I;  4G6Q A;  3KET A;  1IDY A;  4A6D A;  2KJC A;  2KIS A;  4EJV A;  2QGU A;  2V1X A;  3A02 A;  4FIS A;  3A1Y A;  4LIT A;  5ILS A;  3Q0U A;  2PMH A;  5FRN A;  4M9S A;  2R7F A;  4PSW A;  4UV9 A;  2HOT A;  4A93 J;  1REP C;  1FTT A;  2WB1 N;  2CQX A;  4AVZ A;  4BXU A;  3H9J A;  3KZI C;  4D5C A;  4JYK A;  4O6J A;  4HNT A;  3G1O A;  2X6Y A;  1BN5 A;  4M3B A;  3J7A O;  4JBA A;  3QOD A;  3GFL A;  5CLS A;  2HTS A;  3BG9 A;  3BG5 A;  3C1D A;  3BTJ A;  2E7W A;  3QOE A;  2OC6 A;  3GW2 A;  4FTH A;  4BL0 B;  2DOA A;  1V3F A;  2GOX B;  4E7J A;  3GTK J;  3BT9 A;  4BE2 A;  3OYH A;  2HPI A;  3LWF A;  2ELK A;  2UWM A;  1K61 A;  5M3M J;  3LSI A;  2R7D A;  2YU9 J;  2K9N A;  2FBI A;  2PFB A;  2DAO A;  3K7A J;  3OOU A;  1LEA A;  2ZJ2 A;  2ZME A;  5DUK A;  2R5Z B;  1H9G A;  1UG2 A;  4FX4 A;  2X1D A;  5BS6 A;  1USS A;  1ORK A;  3HOZ J;  2OTJ I;  2DFI A;  5D8K B;  3U21 A;  2UZK A;  1Z3X A;  2H1K A;  3CLQ A;  3RQ4 A;  3DEW A;  5CVI A;  2QM3 A;  1D3Y A;  4DIQ A;  2A61 A;  3LAP A;  1QPM A;  4HF2 A;  2K4J A;  2MYS A;  3DP7 A;  4PJL A;  4QLC U;  2D1H A;  3SFI A;  3SZP A;  2ID6 A;  4V2F A;  2HDC A;  1ETY A;  2JRT A;  2W24 A;  3A01 A;  3TED A;  5AIP A;  4KT6 A;  5D5V B;  2HXO A;  5GP9 A;  2L4A A;  1ZTR A;  2WV1 A;  3QPL A;  4AM3 A;  4BDY A;  1OCC H;  4AIJ A;  1VQP I;  3ZMT A;  1QZE A;  1JTX A;  4BNC A;  1ULY A;  1N78 A;  1PUF B;  1R49 A;  1W7P A;  3HHH A;  2BOL A;  4XSX F;  3HOV J;  4C3H J;  4UV8 A;  1BR2 A;  4XK4 A;  2HPM A;  4HYE A;  5TIS C;  3FXU A;  3BPV A;  2XRL A;  2WAE A;  1BI0 A;  2DK5 A;  2MGQ A;  4B1R A;  4BS9 A;  4CUG A;  1WJE A;  3DBL B;  4RBO A;  1AHD P;  3J81 K;  1MBK A;  2F4I A;  3OIQ A;  3M9A A;  4X1E A;  2PJP A;  2EPF A;  3F3X A;  4EM2 A;  1T95 A;  5M3F J;  1ACI A;  3VDX A;  3V8L A;  2BY2 A;  2MA3 A;  3OV8 A;  3I4M J;  3CCE I;  2K02 A;  5C4J J;  4FE4 A;  1W36 C;  4DBR A;  5HNH A;  2MW8 A;  1U5T A;  2VT3 A;  2P6T A;  2JVG A;  2J5P A;  5DYM A;  1QGP A;  1FMW A;  2I8D A;  2FX0 A;  2DTZ A;  3BY6 A;  5JVG F;  5FRM A;  2O61 A;  3F72 A;  2KFD A;  3OYL A;  4ZDO A;  1K4T A;  4NNJ A;  4Y52 J;  5KCM A;  1P7I A;  1S5L C;  2GIZ A;  2X6X A;  3ISP A;  2DA2 A;  2CSO A;  2HNH A;  5JHU A;  3EUH A;  3D1N I;  4ZYE A;  1WZ2 A;  4XKB A;  3OYG A;  3EPZ A;  3LST A;  2V9K A;  4XLN F;  1LB2 A;  1TWF J;  4A3C J;  2XSJ C;  4WWC A;  1LE8 B;  4C3J J;  1RR8 C;  1F36 A;  1XPX A;  3TO7 A;  4OU0 A;  3COA C;  4GYG A;  5FD6 A;  4NBQ A;  1N25 A;  3EET A;  5IYD J;  2ZCW A;  4XQF A;  4LB6 B;  3IAM 2;  3F8F A;  2QQ9 A;  2VQG A;  1BJZ A;  3BR3 A;  4R8H A;  1FYK A;  3CF5 F;  2CUJ A;  1IXC A;  4H4K C;  2VI6 A;  4HX7 A;  1AA7 A;  2L5Q A;  1ZK8 A;  2OZ6 A;  1X1D A;  5DCM A;  4JX5 A;  4E7I A;  3CUQ C;  3V4G A;  2L7F P;  3FK6 A;  1D0Z A;  2HZT A;  3EYY A;  3Q9V A;  4ABZ A;  2ZB9 A;  1KU9 A;  4QSH A;  2PJR B;  3EYI A;  4L9J A;  2DK8 A;  2XGE A;  3DXJ F;  4A3L J;  3Q3S A;  4WK8 F;  2ZBK A;  4AU7 A;  4DOZ A;  2WA0 A;  2IS4 A;  2L54 A;  2NRA C;  2IXS A;  2XPW A;  4C2M J;  2VE8 A;  1O3Q A;  1OCT C;  3OR2 C;  2QEX I;  2B0L A;  2F5E A;  3CES A;  2XV4 S;  2DMP A;  3CJR B;  4RAF A;  3BC8 A;  2R93 J;  5DEQ A;  3QPS A;  2YUS A;  2FML A;  4QPQ A;  3GTM J;  2EBI A;  5LFA A;  2X4H A;  3WG7 H;  3ECO A;  3FXJ A;  2EA2 A;  3I64 A;  1VQ5 I;  2YX4 A;  2A69 F;  3V7R A;  1RRJ A;  3BR1 A;  3ABU A;  5AON A;  1BW6 A;  2D2W A;  2HOS A;  2VOO A;  2IBD A;  4RB1 A;  1L0O C;  4XBF A;  1KON A;  2JRM A;  1XDU A;  2ELH A;  2PMU A;  2DA5 A;  3HG9 A;  4E6K G;  1IXS B;  3CQZ J;  2XC7 A;  3F23 A;  1KQ8 A;  1FOW A;  1I6H J;  3HGG A;  2XAG A;  3OYF A;  3GME A;  5KVR A;  2EZH A;  1IRG A;  2OCE A;  1W36 D;  2V1U A;  5BQT A;  2ZXH A;  3OSG A;  3D5S C;  4LLN A;  2L4M A;  5E1X A;  2VB6 A;  1YW9 A;  4FT8 A;  3KZZ A;  4EJW A;  3F6V A;  4X0G A;  4XOR A;  2LSO A;  4XNF A;  1W5S A;  1SAX A;  4XKW A;  2F4O B;  1TT5 B;  2STW A;  3C3W A;  2A5Y B;  2ZJR F;  1WGX A;  1Z21 A;  3B6C A;  3GTL J;  4P55 A;  2GWR A;  1K6Y A;  1QQI A;  1V5F A;  4P9U A;  4B09 A;  1MMN A;  2E2H J;  3AFH A;  4CHU A;  4ZYD A;  2XGX A;  1R1U A;  2IPQ X;  3ZQC A;  3J80 Z;  1IUF A;  1ON1 A;  2K9S A;  4BGD A;  3LSR A;  5KHD A;  1IN7 A;  1ZH5 A;  4IO9 F;  1C0W A;  4OMZ A;  2QSF X;  2WAQ N;  4QWQ A;  2KPM A;  4MEY F;  3S8P A;  1YQA A;  5ICE A;  1MBH A;  1Y0U A;  3AAF A;  1U8B A;  4IHX A;  4C3I J;  1GV5 A;  1IG7 A;  2ESN A;  1RES A;  1TWG J;  2A6T A;  1G6N A;  2ME0 A;  2V1D A;  1WVR A;  4I99 C;  4W1U A;  4BHB A;  2VBW A;  4L5E A;  2D5V A;  1X3U A;  3WTZ A;  1GUU A;  1Z7L A;  3IH4 A;  1FTZ A;  3LSG A;  2H6B A;  2V9P A;  1Z1D A;  3WU2 C;  2FRH A;  1KA8 A;  5FLV A;  1V5G A;  3CDI A;  4MQ9 F;  2WAD A;  3PM1 A;  2CMP A;  2DYR H;  5FLX K;  3MZH A;  3FM3 A;  3IHU A;  1YG2 A;  2Z9O A;  4XLC A;  3A0H C;  4PCQ A;  3JRG A;  3F21 A;  1FJL A;  2RKH A;  1ZN2 A;  3M1E A;  5D6F A;  3G2B A;  5LLQ A;  1MH4 A;  1SVL A;  4O5V A;  1X3W B;  1K78 B;  1XGM A;  5LD2 C;  2LFB A;  3GFM A;  3LQR A;  2ZNY A;  3ZQF A;  4HDU A;  3I59 A;  1ZAR A;  3A4C A;  1MNM C;  1FNN A;  2DA7 A;  2O7O A;  1TNT A;  3WTS C;  1A5J A;  3AL0 C;  1UZC A;  2XSD C;  2QCO A;  2HDD A;  2R5Y B;  1HOM A;  4ENJ A;  3F8N A;  1TP4 A;  5F1R A;  3I53 A;  1SD6 A;  5E1Z B;  2H6C A;  2UXN A;  2PX9 A;  3L2W A;  2R7T A;  1HST A;  2EIJ H;  3CC7 I;  2JA7 J;  3FHN A;  4A6E A;  1CGP A;  3WTY C;  2Z16 A;  1IGN A;  4IEJ A;  1BA5 A;  2WV0 A;  2D1V A;  4EJO A;  1YTY A;  2VN2 A;  2BV6 A;  3G1L A;  2HDW A;  2FE3 A;  3FMS A;  1QPI A;  2EIK H;  4MGR A;  1IRZ A;  3QOP A;  1IZ1 A;  3E1S A;  3E3V A;  1G3T A;  1IN8 A;  1YLF A;  2OJE D;  2DA1 A;  4HQE A;  1DUX C;  1JKO C;  2K40 A;  3SFZ A;  1GDT A;  3PUF A;  1Y0N A;  1QVU A;  2JPB A;  2ZKZ A;  1TQM A;  5HLI A;  4BHP A;  1PP8 F;  3H3Z A;  3TQN A;  1BOA A;  5D5W B;  4LG3 A;  2V9V A;  5HOO A;  2HKX A;  1R5I D;  3H3V K;  1O7F A;  2DT5 A;  3CP8 A;  1SEU A;  3ROU A;  2KL4 A;  1SMT A;  3BTI A;  5KAI C;  5K7H A;  4M6Y A;  4MHG A;  2JA6 J;  3OMY A;  1S72 I;  1QRY A;  2I10 A;  5LGU A;  1JXS A;  4BEH B;  3RKX A;  2F4M B;  1E3O C;  3FMR A;  3SHF A;  1T2K A;  3FXR A;  1Z3Y A;  4KIG A;  5DCF A;  3RYR A;  3OYC A;  1Q1V A;  3KYD B;  2L2O A;  1G2H A;  4IOC F;  4ENM A;  2L01 A;  3AKZ A;  2TRT A;  5C3E J;  5EGO B;  5L3G A;  1HKQ A;  4C2T A;  3S16 J;  4I09 A;  1TBX A;  5JLX A;  1FSH A;  4HX8 A;  3KIO A;  1E3H A;  1VFC A;  2Y0S N;  1JUM A;  5GAD J;  4U7D A;  4MIM A;  3TW6 A;  1EKE A;  3OYN A;  1B9M A;  3NEU A;  5E8I A;  3L1P A;  1BR4 A;  5CQG A;  4A3M J;  3ABL H;  2ADU A;  4PJJ A;  1XB4 A;  4ZH4 F;  2HS5 A;  3JW4 A;  1IN4 A;  4IL6 C;  2NOG A;  4EM0 B;  4XRF A;  3W2V A;  4S0H B;  4XLP F;  3OYB A;  2MAB A;  1FEX A;  2GA1 A;  3C18 A;  4M71 A;  2FSW A;  2VJI A;  1MBE A;  3DTE A;  3R0J A;  2VXZ A;  3WHB A;  1QHH D;  3S1R J;  2BXY A;  4ZYA A;  3KEY A;  3CD6 I;  2ISY A;  3L00 A;  4UB6 C;  3KFW X;  2WAF A;  3BG6 A;  1FWZ A;  2NYX A;  4HRI A;  5BMZ A;  2VBX A;  1VQ6 I;  1P4X A;  1E0E A;  3CO6 C;  2L3D A;  4MTE A;  1R58 A;  3SEZ A;  4KN7 X;  3OOP A;  4HOB A;  3FKI J;  4AUX A;  5HS8 A;  3G6E I;  3FXM A;  5GTH C;  2W84 A;  5CYV A;  3GLL A;  2CUZ A;  4DNC A;  2QLZ A;  1X2M A;  4A69 C;  3JTG A;  5LRR A;  4G8X A;  3T8R A;  1Y1V J;  1ERD A;  4LMY A;  3GTQ J;  3K1M A;  3KP7 A;  4KT5 C;  4XN3 A;  2CGP A;  1JHH A;  3ZMD A;  4HNU A;  2VBZ A;  2EFP A;  1FBQ A;  3CCQ I;  3H3U A;  3K2A A;  4F7Z A;  2M8G X;  2O0Y A;  2R7R A;  2H09 A;  2O9L A;  3OYM A;  1ZQ3 P;  3R4K A;  2OTL I;  5GAE J;  3H9G A;  1KQ9 A;  2CH0 A;  4RGU A;  3RQI A;  2K86 A;  1O7L A;  2M7B A;  4EMS A;  4FCY A;  1UJ8 A;  3DPT A;  3QU3 A;  5HOD A;  4B3X A;  1UHM A;  1U8R A;  1CF7 B;  1X1P A;  1M1E B;  4IPA A;  1LEB A;  2O3F A;  2R3S A;  3HIF A;  4LLG F;  4ZDL A;  3S14 J;  3MKY B;  3C2G A;  3I55 I;  4EGY A;  1YHQ I;  4RB0 A;  2VE9 A;  3DCF A;  1WJB A;  3S3O A;  4LIU A;  5ED4 A;  3MVP A;  1JUS A;  1BC8 C;  2E1M C;  1K83 J;  1WJA A;  2H1L A;  4Q4Z F;  3AL0 B;  3M8E A;  1UCR A;  3PL8 A;  2DTR A;  4Y3O A;  4UHT A;  3RJP A;  5K5Q A;  3BDD A;  1I1G A;  1STZ A;  1DGR M;  1JKR C;  3BJO A;  1WI3 A;  3G71 I;  2G7H A;  1B8I B;  1OLT A;  3GBG A;  5F0F A;  1YRN B;  1B72 B;  4BQQ A;  2A6E F;  1J0R A;  1IC8 A;  2LYC A;  5HLH A;  3I3L A;  2K27 A;  2QYO A;  4TV7 A;  1LPQ A;  1ZLK A;  1DQU A;  4ANJ A;  4WF2 A;  1AKH B;  4M9Z A;  4D9J A;  2EZI A;  1VND A;  2VKH A;  3EQL F;  1TTY A;  2IGM A;  2MD5 A;  1Z9C A;  4FHT A;  2Y48 A;  1JJ6 C;  4XMY A;  1HA8 A;  1T0F C;  2Q2E B;  2DQL A;  3RZD J;  2O03 A;  3HJE A;  3KP5 A;  2JVH A;  2IS2 A;  1ETO A;  1SD4 A;  2BE5 F;  2FUG 2;  2XGD A;  3IP4 B;  3HTU A;  1EV7 A;  2OAZ A;  2DMQ A;  1JUP A;  3HM5 A;  1YJ9 I;  3DBR B;  3M07 A;  2XF6 A;  2F5D A;  3DLA A;  3ZRG A;  1HXD A;  2XVC A;  1OCR H;  1V4R A;  3Q0V A;  1F43 A;  5BOX A;  2FMY A;  2M4G A;  1MBF A;  3S1Q J;  1RC9 A;  2KQR A;  5FKO A;  3V8J A;  3VSK A;  1TC3 C;  3MAJ A;  3WG9 A;  1WJD A;  4B44 A;  5DD4 A;  3FK7 A;  2XAF A;  3GTG J;  2ESH A;  5FFX A;  2QSH X;  1UG0 A;  2VPR A;  1ZGW A;  4UUV A;  3CMA I;  3DU6 A;  3GCM A;  5FRO A;  3OS0 A;  4BBR J;  5J4V A;  1YW8 A;  2VQL A;  3BOQ A;  1I3Q J;  4CXF A;  1X2N A;  3GEZ A;  2E7X A;  4KIC A;  2R7Q A;  1J09 A;  4AVP A;  5H6Q A;  5IP7 J;  4A3D J;  3S2D J;  2I5U A;  5IPA A;  2KP6 A;  5L3F A;  3PIP F;  2F2E A;  2Z1D A;  3H0G J;  2Q0O A;  3DKX A;  4MNU A;  4CYC A;  4G7Z F;  1GT0 C;  5ICG A;  5J8F A;  4YRV A;  3K4B A;  3KCC A;  5CVJ A;  2FOK A;  1G3S A;  2Q1Z B;  4J01 A;  4HX4 A;  3HTS B;  4BAY A;  3WTX C;  4B4C A;  5J1U A;  3LNQ A;  2M2E A;  1T6S A;  1ETW A;  2RQQ A;  4AD9 A;  5FD5 A;  4MO7 A;  1HCR A;  2EV0 A;  2IA1 A;  1XCB A;  2L9S A;  1KU7 A;  3LA7 A;  5LHI A;  3BTL A;  1Y8Q B;  3HOT A;  2AQF A;  2E1N A;  2LRD A;  3PIO F;  5FKK A;  3GTJ J;  4P9F A;  1LQ1 A;  1P92 A;  4GCV A;  3MQ0 A;  3L9F A;  4ZYG A;  3F22 A;  1SAU A;  1F4K A;  3VWB A;  2Y2Z A;  2HU9 A;  4KNY A;  2Z3Y A;  2LC2 A;  2DA3 A;  3HSE A;  3HBL A;  3BZK A;  2STT A;  3CUQ A;  3U1K A;  1E3P A;  2Y69 H;  3J7Z I;  2W82 A;  2JQ7 A;  4ZYH A;  1U3E M;  1H8A C;  1LKX A;  2OPT A;  1G4D A;  2G9W A;  3RKW A;  2DFH A;  5J1Y A;  4B3A A;  3E0J B;  1I27 A;  5DS9 A;  2VLA A;  3PUB A;  1DU0 A;  4RS8 A;  4BAC A;  4A0Z A;  3TOB A;  3IV5 A;  2QA4 I;  5JFR A;  3TP0 A;  1Z6T A;  4Y15 A;  2JSC A;  3DPL C;  1JGS A;  2GOM A;  2QF7 A;  2NNN A;  1EJ9 A;  2LTP A;  3OYI A;  2LY9 A;  3IL2 A;  3JRF A;  2XF5 A;  1ZG5 A;  2PQ8 A;  1BIA A;  2M34 A;  5C44 J;  2Z33 A;  2GA2 A;  3ASO H;  1Z6R A;  2W00 A;  5L3D A;  4HZF A;  5DM7 F;  3LFU A;  1HSJ A;  2RDP A;  1P4A A;  4PFO A;  3VSL A;  1J9I A;  2E1M B;  1B9N A;  3IH2 A;  2FOW A;  2L9R A;  1TW3 A;  1WHU A;  1H89 C;  3VOE A;  4I6Z A;  1HLV A;  3BPX A;  2XGC A;  4E4H A;  4BYY A;  4N4N B;  1ETK A;  3RZO J;  2JA2 A;  2X0L A;  3TBI A;  4EJU A;  2HVS A;  3QRF F;  2CO5 A;  2IEK A;  4IX7 A;  3W6K B;  4FAS D;  4XRM A;  3CLO A;  4XL9 A;  3PSF A;  1LNW A;  2PMZ A;  4GRI A;  1ZAO A;  1A36 A;  4BE0 A;  3F8C A;  2DW4 A;  3O8G A;  5HDK A;  5JVT A;  2HEO A;  2R7V A;  2ZXI A;  2RAE A;  3FF5 A;  3IH3 A;  4I76 A;  4EAT A;  5EZH A;  1UHW A;  2RVC A;  4RB2 C;  1EA3 A;  2DOD A;  2AXL A;  2GQQ A;  3IKT A;  2E1C A;  3AG1 H;  3OWT A;  3UNG C;  1WRJ A;  3WGH A;  4NQW A;  2R7S A;  4LK0 F;  4UVB A;  1HW5 A;  1P2F A;  5DDG A;  2A68 F;  4Y7N J;  2CJJ A;  2CQN A;  1IUY A;  3X2Q H;  1KQ0 A;  4J19 A;  3BCA A;  1VTN C;  3J80 K;  2O8K A;  5CVR A;  1RUN A;  2BGC A;  2EV6 A;  3JSP A;  2ZXW H;  1YYV A;  2MSY A;  4LG0 A;  1ODD A;  1XMA A;  1FOK A;  5FLM J;  3GLX A;  4M6V A;  3ONQ A;  5GPC A;  1K7A A;  4WXC A;  1FSE A;  4JP0 A;  1YX5 A;  3P9I A;  3FXL A;  5FJ8 J;  4M72 A;  2VOD A;  3GVA A;  1BL0 A;  3C2H A;  5M5X J;  5LHH A;  3DQV C;  5FKN A;  3WGG A;  1QO0 D;  3LSH A;  4Y13 A;  4V19 K;  3DTK A;  2HQN A;  1IW7 F;  2BY3 A;  5H20 A;  2LF7 A;  1R4M B;  3PO2 J;  2VKV A;  4RLQ A;  3E6B A;  4PFP A;  2QBY A;  4C9Y A;  1TQP A;  1F5T A;  4K2E A;  3G1M A;  4DGW B;  1GXQ A;  1A6Q A;  3BRO A;  2R7Z J;  1D1C A;  4OAY A;  2NOJ B;  2P7C B;  2VPL A;  2DI3 A;  2BEO A;  1QNT A;  3CC2 I;  4L5I A;  4E7L A;  3HKZ A;  4WXH A;  3A03 A;  1YIT I;  4XIC A;  3QP6 A;  2IT0 A;  1ITY A;  2N8G A;  2L9N A;  3RTR A;  4R1H A;  1R5G A;  4YIR X;  5HLT A;  3SZG A;  1ZEL A;  2R7O A;  2NVU B;  2RQP A;  2F5F A;  1TL8 A;  1ZRD A;  1GLN A;  1ZR4 A;  2VC1 A;  2A05 A;  1T8I A;  3OR1 C;  1V54 H;  1OYY A;  4Y4R A;  4IOA F;  5E8G A;  3I54 A;  1SFX A;  3PFI A;  4Z2Y A;  2DOE A;  4YII A;  5E17 F;  2P6S A;  1DU6 A;  2V79 A;  2YU3 A;  1Z67 A;  2DFE A;  3ZMU A;  3S3M A;  2MBF A;  5JLW A;  2HOE A;  1TQI A;  4M74 A;  2LOO A;  1WJC A;  3D5R C;  1XC5 A;  4II2 A;  3WOD F;  2G0E A;  4LJZ F;  3E5Q A;  1HW2 A;  2XAH A;  4HV5 A;  1POG A;  3OL4 A;  2OU2 A;  4BQO A;  3K0L A;  5DD8 A;  3Q5F A;  1D8K A;  1QA6 A;  2NXN B;  3C7J A;  1VZ0 A;  2F5C A;  2NS8 A;  2PLY A;  4UUT A;  3AG4 H;  4XSZ F;  2LRE A;  5CVV A;  3GZ5 A;  1T33 A;  5F6F A;  1LVA A;  4RM2 A;  4Q48 A;  1LDJ A;  3FHZ A;  3OYD A;  3GWZ A;  3SJM A;  3K70 C;  1W0U A;  4G94 A;  1VQ9 I;  1ZRF A;  1SMY F;  2IP2 A;  1PP7 U;  1IDZ A;  5K1Y A;  5HDG A;  3ZOB A;  3HL2 A;  4XLA A;  5IOY A;  1VQO I;  3WE2 A;  2KDZ A;  2CQQ A;  3TOA A;  4YFK F;  1J59 A;  4KDP A;  4LOC A;  1MH3 A;  1R4N B;  1TT0 A;  1BI3 A;  4I98 B;  5F1J A;  3PQJ A;  2EQR A;  5J47 A;  5J8C A;  1JJ8 C;  4OIR F;  5FKL A;  4BQN A;  1IN5 A;  1MMS A;  4QTR A;  2FNP A;  4L0Y B;  3LSJ A;  3CJN A;  3QYF A;  1YO5 C;  2K9M A;  3QQA A;  1X19 A;  4YFX F;  2DT6 A;  5DV5 A;  5EDN A;  2E71 A;  3SZT A;  2VT2 A;  3IC7 A;  4RGX A;  2XF7 A;  1MIJ A;  1DP3 A;  3V8K A;  1FIP A;  3RPU A;  2GBY A;  2XB0 X;  3QYE A;  1O3R A;  1I39 A;  5E3L A;  2BW3 A;  4X6A J;  2DOF A;  2CG4 A;  2D45 A; 
#chains in the Genus database with same CATH homology
 1FEX A;  1MBE A;  1U9O A;  3WHB A;  3S1R J;  4A3K J;  3MKL A;  2GM4 A;  2LP0 A;  3BR6 A;  3PO3 J;  3TW7 A;  1RPW A;  1W0T A;  3JRH A;  4UUS B;  3SDG A;  1JTY A;  4XRS G;  1QVT A;  2CUF A;  3BTC A;  2FD5 A;  4A3I J;  1JKQ C;  2ECC A;  1S7E A;  1U78 A;  5C4X J;  2CU7 A;  3FKI J;  4AUX A;  5E3N A;  4BXX J;  3OSF A;  4G12 A;  2NS7 A;  1LFU P;  5IYC J;  1ZKG A;  4DZJ A;  1X2M A;  4JX4 A;  4A69 C;  5IP6 A;  2R0Q C;  1Y1V J;  1CQT A;  3GTQ J;  1IJW C;  1MSE C;  5EYR A;  2LVS A;  3E7L A;  2NVX J;  4JX6 A;  4DYQ A;  5EG0 B;  1EF4 A;  3BQZ A;  5IOZ A;  4M3F A;  2FJ1 A;  2L7M P;  3K2A A;  2LD5 A;  2B63 J;  2M8G X;  2O9L A;  1IDY A;  1ZQ3 P;  1B8I A;  1YRN A;  3A02 A;  4FIS A;  1B72 A;  3RQI A;  1RR7 A;  3Q0U A;  5EEA A;  4FCY A;  2YS9 A;  5HOD A;  2HOT A;  4A93 J;  1FTT A;  2JN6 A;  2WB1 N;  2CQX A;  1IV6 A;  2R5Z A;  1AKH A;  4D5C A;  4JYK A;  3S14 J;  3G1O A;  5FKM A;  4BY1 J;  4M3B A;  1O4X A;  5GPA A;  3DCF A;  3BG9 A;  4D7N A;  3MVP A;  1JUS A;  3BTJ A;  3BG5 A;  1K83 J;  2IAI A;  4BY7 J;  2E19 A;  3CDL A;  3S2H J;  4A3J J;  1HDD C;  4FTH A;  2JA5 J;  2M9H A;  5K7F A;  4D5F A;  1Y1W J;  3GTK J;  2HI3 A;  3BT9 A;  1HDP A;  4HNV A;  1JKR C;  2ELK A;  1K61 A;  1WI3 A;  5M3M J;  5F08 A;  3ZQH A;  5F0F A;  3GBG A;  1B8I B;  2YU9 J;  1YRN B;  2K9N A;  1B72 B;  1IC8 A;  3K7A J;  5E3O A;  4A3F J;  3OOU A;  1PUF A;  1BW5 A;  2R5Z B;  1AKH B;  1UG2 A;  2H8R A;  5F0H A;  2EZI A;  1VND A;  1ORK A;  3HOZ J;  4RDU A;  1X58 A;  3NAU A;  1TWC J;  1JJ6 C;  5K7Z A;  2E2J J;  3RZD J;  5J3L A;  1GVD A;  1SAN A;  2H1K A;  3DEW A;  1ETO A;  4V2G A;  2XGD A;  1WPK A;  3ZQG A;  2DMQ A;  1JUP A;  3HM5 A;  1XG1 A;  3BR5 A;  3SFI A;  2ID6 A;  4V2F A;  4M3D A;  1VF9 A;  3ZQI A;  1ETY A;  3S1N J;  3A01 A;  3TED A;  3CMY A;  2X48 A;  2HXO A;  3Q0V A;  5GP9 A;  1NK2 P;  1MSF C;  1ZTR A;  2WV1 A;  3QPL A;  2ECB A;  1F43 A;  3JRA A;  1MBF A;  4W97 A;  3S1Q J;  5FKO A;  1JTX A;  1TC3 C;  2NVQ J;  1PUF B;  1T56 A;  2K9Q A;  3FK7 A;  3GTG J;  2TCT A;  3HOV J;  3BR0 A;  2VPR A;  1ZGW A;  4C3H J;  1LE8 A;  4XK4 A;  4BBR J;  4B1R A;  2XRL A;  2MGQ A;  2LLK A;  1I3Q J;  1X2N A;  4RBO A;  1AHD P;  2JJ7 A;  1MBK A;  4X1E A;  2CRG A;  5M3F J;  5IP7 J;  1JGG A;  5IYB J;  4A3D J;  3HGY A;  3S2D J;  3I4M J;  5IPA A;  2HOA A;  4IHW A;  5C4J J;  4FE4 A;  1TWA J;  2MW8 A;  2X6O A;  2EZK A;  3H0G J;  2FX0 A;  2Y30 A;  4CYC A;  3A01 B;  1GT0 C;  2DTZ A;  3HB9 A;  4MFD A;  3BR2 A;  1RKT A;  5F27 A;  2JMW A;  1AU7 A;  3OIO A;  4Y52 J;  1P7I A;  4AC0 A;  3GTP J;  2DA2 A;  4B4C A;  5J1U A;  3LNQ A;  2M2E A;  3D1N I;  1ETW A;  4XID A;  3TP3 A;  4MO7 A;  1HCR A;  1TWF J;  4A3C J;  1LE8 B;  4C3J J;  3BTL A;  1F36 A;  2OF7 A;  2DMU A;  5FKK A;  3GTJ J;  2MG4 A;  2X9D A;  2Y2Z A;  5IYD J;  4DYC A;  3JR9 A;  2DA3 A;  3HBL A;  1BJZ A;  3BR3 A;  2HXI A;  2VI6 A;  1RKW A;  2AO9 A;  1RET A;  1H8A C;  5F0C A;  2OPT A;  1ZK8 A;  5J1Y A;  4CYC B;  4B3A A;  5DS9 A;  1DU0 A;  9ANT A;  3FIS A;  1FIA A;  2GLO A;  2HYJ A;  3RKQ A;  3IV5 A;  3TP0 A;  2AHQ A;  4JX5 A;  2L7F P;  3FK6 A;  2CUE A;  4ABZ A;  1TWH J;  2QF7 A;  2ZB9 A;  4QSH A;  3BQY A;  2EZL A;  2LTP A;  2LY9 A;  2XGE A;  3JRF A;  3Q3S A;  3JRB A;  4A3L J;  4A3B J;  2M34 A;  5C44 J;  3LSP A;  2W48 A;  2XPW A;  2L7Z A;  4M3E A;  4C2M J;  1OCT C;  2FQ4 A;  2DMP A;  2R93 J;  3IH2 A;  4IHV A;  2L9R A;  2YUS A;  3QPS A;  1H89 C;  1HLV A;  2KT0 A;  4I6Z A;  3GTM J;  2EBI A;  5IP9 J;  2XGC A;  1ETK A;  3RZO J;  4MLO A;  1NTC A;  5DTD A;  1GV2 A;  1ENH A;  2LKX A;  3BR1 A;  1JT6 A;  3ZQL A;  1BW6 A;  4FE7 A;  2IEK A;  4QIW N;  2IBD A;  2HOS A;  1NK3 P;  5J1R A;  3FIW A;  4XRM A;  2DA5 A;  3CQZ J;  5F04 A;  3M3Y J;  1I6H J;  3HGG A;  2ME6 A;  2EZH A;  3O8G A;  1LFB A;  2RAE A;  2XB5 A;  3CCY A;  3IH3 A;  4I76 A;  3OSG A;  5EZH A;  1ZR2 A;  2ID3 A;  5M5W J;  2PMZ N;  2DJN A;  5E3M A;  1WGX A;  1U9N A;  2E1O A;  2LK2 A;  2Y9Y A;  3Q0W A;  3B6C A;  4A3G J;  4Y7N J;  2CJJ A;  3GTL J;  1R9T J;  5EF6 A;  4J19 A;  2E2H J;  3ZQC A;  3GTO J;  3HOW J;  2O8K A;  3S1M J;  3M4O J;  2Y9Z A;  1IUF A;  2K9S A;  4BKX A;  3LSR A;  2MSY A;  4A3E J;  5FLM J;  4M6V A;  3JRI A;  1WH7 A;  2WAQ N;  5GPC A;  3HOY J;  4JP0 A;  2R5Y A;  5FJ8 J;  1BL0 A;  2JA8 J;  1MBH A;  3S15 J;  1U8B A;  4IHX A;  3LOC A;  5M5X J;  4C3I J;  1GV5 A;  5FKN A;  1IG7 A;  2JK3 A;  2JWT A;  1RES A;  1TWG J;  2ME0 A;  1JKP C;  4W1U A;  2EH3 A;  4L5E A;  4DW6 A;  2D5V A;  2XPU A;  1GUU A;  3IH4 A;  1FTZ A;  3BG3 A;  2M0C A;  3LSG A;  1UMQ A;  1WCM J;  3PO2 J;  2NVY J;  2VKV A;  5FLV A;  1OFC X;  3PM1 A;  3W6V A;  3UKG A;  3G1M A;  3JRG A;  1FJL A;  2R7Z J;  1WH5 A;  3HOX J;  1MH4 A;  1MBJ A;  2R92 J;  2LFB A;  1Z77 A;  1JT0 A;  4M3G A;  1MBG A;  3A03 A;  3ZQF A;  2VUM J;  4XIC A;  5BNG A;  4GFB A;  1MNM C;  1ITY A;  2DA7 A;  2N8G A;  2O7O A;  1ETV A;  1A5J A;  2LR8 A;  2XSD C;  1ETQ A;  2QCO A;  2HDD A;  2DA4 A;  2R5Y B;  1HOM A;  3HKZ N;  1ZR4 A;  1ETX A;  2VKE A;  4EEF G;  2JA7 J;  1IGN A;  4IEJ A;  1BA5 A;  3G1L A;  4BBS J;  1DU6 A;  1I50 J;  1QPI A;  1IRZ A;  5JLW A;  3JRC A;  5EGO A;  1SFO J;  2DA1 A;  5EZG A;  1XC5 A;  2G0E A;  1JKO C;  2K40 A;  1GDT A;  5M5Y J;  1QVU A;  1POG A;  2XPV A;  3F0C A;  3JRD A;  2NVT J;  2NS8 A;  3H3V K;  4UUT A;  4AYB N;  1APL C;  1OJL A;  1T33 A;  3BTI A;  5K7H A;  1D5Y A;  3HEF A;  4D7M A;  2JA6 J;  1QRY A;  2I10 A;  1A6I A;  3SJM A;  1E3O C;  1W0U A;  2DMN A;  4DYR A;  2DMT A;  3I4N J;  2P81 A;  1IDZ A;  4DZP A;  1Q1V A;  3VPR A;  3ZOB A;  1G2H A;  5IOY A;  4UUS A;  4MFE A;  3HDD A;  2KDZ A;  2CQQ A;  4IHY A;  2TRT A;  4LOC A;  1MH3 A;  5EGO B;  5C3E J;  3JRE A;  2HQ5 A;  3S16 J;  5F1J A;  5JLX A;  2EQR A;  1JJ8 C;  2DA6 A;  1Z0X A;  1VFC A;  5FKL A;  2COB A;  2L0K A;  1XS9 A;  2E2I J;  2Y0S N;  1JUM A;  1OCP A;  4XRS A;  4MIM A;  4QTR A;  2Y31 A;  3HOU J;  3TW6 A;  3WHC A;  3LSJ A;  3NAR A;  3QQA A;  1P7J A;  3L1P A;  4A3M J;  1HF0 A;  1VI0 A;  5EDN A;  4NDL A;  3O8H A;  1FIP A;  2GBY A;  1H88 C;  2XB0 X;  3B6A A;  3S17 J;  2NOG A;  5E3L A;  2DN0 A;  4X6A J;  4S0H B;  3MN2 A;  1UHS A;  3C2B A;  5EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...