1XC5A

Solution structure of the smrt deacetylase activation domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
NGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear receptor corepressor 2
publication title Structural insights into the interaction and activation of histone deacetylase 3 by nuclear receptor corepressors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription corepressor
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xc5A01
1ETXA 4JP0A 1HOMA 3LSGA 5IP7J 1MH4A 2DMTA 5EYRA 2HI3A 4XRSA 1LFBA 2OPTA 1IG7A 4D5CA 2DA6A 5DS9A 2DA2A 2VI6A 3HGGA 2WAQN 4G12A 5FKLA 1ENHA 5FKKA 1S7EA 3JRDA 1K83J 1D5YA 2E2JJ 1TC3C 3BR5A 1QPIA 2L9RA 1P7IA 1T33A 5IPAA 4X6AJ 1HDDC 1ETWA 3S1MJ 1XG1A 1WI3A 2DMNA 1B72B 5IYCJ 1IRZA 2R93J 3HOUJ 2DA4A 2JN6A 3BR6A 4XRMA 4B1RA 2ECCA 2LD5A 5EZHA 3RZDJ 4IHYA 4A3LJ 3BTIA 3WHCA 1P7JA 2NS7A 3G1MA 5EG0B 4A3CJ 1JTXA 2E1OA 2E2HJ 1PUFA 1WH7A 1IDYA 1DU6A 5EGOB 5FKOA 3HKZN 1OFCX 3W6VA 3M3YJ 1WPKA 1UMQA 1AKHB 1B8IA 4MFEA 9ANTA 1IJWC 1EF4A 1ZTRA 2ECBA 3FIWA 2CUFA 1FEXA 3NAUA 3LOCA 3I4MJ 3HB9A 2LVSA 4UUTA 3MN2A 3OOUA 5EZGA 1VF9A 1ETYA 2Y0SN 1JT6A 1A5JA 2CRGA 2MW8A 3JRIA 3S2DJ 2I10A 1MNMC 1I6HJ 2DJNA 2R0QC 4JYKA 1R9TJ 1Y1VJ 3B6CA 1APLC 2E2IJ 1ZR2A 5FJ8J 2EZHA 2XB5A 2NVXJ 3IV5A 3CMYA 4JX5A 3A03A 3VPRA 2AO9A 3LNQA 5M3FJ 4DYRA 4AUXA 2X6OA 4LOCA 3O8GA 5E3OA 1LE8B 2DMQA 2N8GA 5M3MJ 3WHBA 4D7NA 3I4NJ 3GTKJ 2ID3A 3O8HA 5GP9A 1XS9A 1GUUA 2R5YB 5F0HA 1ETKA 2HQ5A 3PO2J 4QSHA 1HCRA 2YU9J 3S1QJ 2LK2A 4MFDA 2DMUA 2EZKA 2NVYJ 1ITYA 2JA7J 1U8BA 1XC5A 1ORKA 3BG3A 2CQQA 2O7OA 2PMZN 1RESA 3IH4A 1IGNA 2NS8A 3M4OJ 5F08A 5M5XJ 2ELKA 2XPWA 3K2AA 2K9SA 2K9NA 3BTCA 3HOXJ 2JMWA 3FISA 1MH3A 1POGA 3GTJJ 3GTOJ 1FIPA 2HDDA 2EH3A 2O8KA 1FTTA 4Y7NJ 4D7MA 4RBOA 2D5VA 4AYBN 3CDLA 1GVDA 1TWCJ 3A01B 5FLMJ 2EBIA 4UUSB 2EQRA 1VFCA 4XICA 4A3MJ 1UG2A 2LR8A 3IH3A 4A93J 2Y2ZA 2GLOA 1IUFA 5DTDA 2COBA 3GBGA 1TWHJ 5F1JA 3BTLA 4C3JJ 1JJ6C 2TRTA 3GTLJ 1U78A 5M5YJ 2HOAA 2CQXA 3Q0WA 1RR7A 3RQIA 3K7AJ 2L0KA 2NVTJ 3CQZJ 2R5ZB 3TW7A 2GBYA 2NOGA 3HOWJ 4DYQA 3OSGA 4EEFG 1U9OA 2M9HA 1MSFC 4BY7J 3FK6A 3DCFA 1IDZA 2M8GX 1UHSA 3GTPJ 3ZQLA 3JR9A 2YUSA 3TW6A 2LKXA 4DZPA 3S16J 4A3JJ 2X9DA 3A02A 1NK3P 2FQ4A 1Z0XA 3ZQHA 3Q0VA 3QPSA 5C4XJ 3HOYJ 4C3HJ 3D1NI 1Y1WJ 5HODA 2DA1A 1JGGA 3BT9A 3JRGA 2P81A 1MBHA 3F0CA 3Q3SA 4HNVA 3TP3A 5IOYA 3HOZJ 4MIMA 2LTPA 3S1NJ 1GV2A 1ZK8A 5FKNA 1BA5A 2WV1A 5K7ZA 3BR2A 3TP0A 5J1UA 2XPUA 1JJ8C 2ZB9A 3JRFA 4A3KJ 1Z77A 1RETA 2XPVA 5C44J 3JRBA 1W0TA 1Q1VA 5F04A 1OCTC 2JA6J 2G0EA 2XSDC 1I50J 2FJ1A 3BTJA 4B3AA 2MSYA 4M3EA 3FK7A 1A6IA 1HDPA 1PUFB 1MBKA 1WCMJ 3E7LA 4FTHA 3QQAA 4J19A 3S15J 2QCOA 2VKVA 4FE7A 1FIAA 1B8IB 4M3BA 1YRNA 1IV6A 2VPRA 3LSJA 2VUMJ 2H1KA 5IYDJ 5C3EJ 4A3EJ 4JX4A 2RAEA 3G1LA 2K40A 1JKOC 1TWAJ 1QVTA 2JWTA 4I76A 2LY9A 2K9QA 1ETQA 2ME0A 3C2BA 4A3BJ 5E3LA 3ZQFA 3ZQGA 5BNGA 2O9LA 4QTRA 2Y9ZA 2HOSA 5F0CA 5J1YA 1H8AC 2YS9A 2ME6A 1OJLA 3BG9A 5F0FA 1TWGJ 4V2FA 4FCYA 4BBSJ 2Y9YA 2JA5J 2KT0A 1X58A 1F43A 2EZLA 5GPCA 3L1PA 2DA5A 2R92J 2MG4A 3UKGA 2DMPA 4M3FA 4C2MJ 1WH5A 4D5FA 1BW6A 2CUEA 2Y30A 1WGXA 2LLKA 1B72A 1X2NA 4IHXA 4QIWN 4CYCB 1CQTA 1H88C 1G2HA 2JJ7A 2AHQA 3TEDA 1RKWA 2DA3A 5EG0A 5F27A 2X48A 1RPWA 3BR0A 3NARA 1ZKGA 2OF7A 4B4CA 5EGOA 3SJMA 2EZIA 2E19A 2M34A 3CCYA 1X2MA 4MLOA 1AU7A 4BY1J 5EF6A 4A3FJ 2LP0A 3H3VK 5IP9J 1AKHA 1JT0A 1ETOA 4RDUA 1ETVA 3ZOBA 4X1EA 3OSFA 2H8RA 4MO7A 4I6ZA 2XGDA 2WB1N 1SFOJ 5JLXA 4JX6A 1ZR4A 3LSPA 1FTZA 1HF0A 2HYJA 2W48A 5K7FA 2R7ZJ 3GTGJ 5E3NA 1QVUA 1QRYA 2TCTA 3JRAA 1MBEA 1VNDA 3ZQIA 4M3DA 1JKQC 2L7FP 2XRLA 1ZGWA 1LFUP 2B63J 4NDLA 2L7MP 1BW5A 2IAIA 1GDTA 4AC0A 1TWFJ 1DU0A 4W1UA 1I3QJ 4BXXJ 4XK4A 1AHDP 5EDNA 1JKRC 3GTMJ 2CJJA 2JK3A 4IHVA 1E3OC 3JRCA 5FLVA 3BR1A 3HEFA 2M2EA 5EEAA 3LSRA 3JREA 3Q0UA 4M6VA 1GT0C 1OCPA 1LE8A 1BJZA 1MBJA 4DZJA 4Y52J 5FKMA 2ID6A 1IC8A 2HOTA 1JUMA 1FJLA 4IEJA 3JRHA 4BKXA 1HLVA 3S14J 3DEWA 2R5YA 3S2HJ 1JTYA 4M3GA 3SDGA 3ZQCA 3BG5A 1BL0A 2XB0X 3FKIJ 3PM1A 5JLWA 4FISA 4DYCA 1U9NA 4XIDA 4A3GJ 1MBFA 4W97A 5IOZA 2MGQA 3GTQJ 5E3MA 3PO3J 1MSEC 2VKEA 1ZQ3P 1NK2P 2M0CA 4ABZA 1O4XA 1K61A 4A69C 1T56A 2HXIA 1JKPC 1W0UA 2IBDA 2JA8J 3OIOA 5M5WJ 3B6AA 4DW6A 3G1OA 2GM4A 1NTCA 4S0HB 5J3LA 3HGYA 4FE4A 4BBRJ 1SANA 3S17J 3BQYA 4GFBA 3SFIA 1JUPA 2NVQJ 4C3IJ 3A01A 5IP6A 3MKLA 4UUSA 2HXOA 1GV5A 3IH2A 2QF7A 2IEKA 2CU7A 5C4JJ 5K7HA 5J1RA 3RZOJ 2XGCA 3HBLA 2Y31A 4V2GA 4CYCA 3RKQA 1RKTA 2XGEA 5GPAA 5IYBJ 4XRSG 2FX0A 2KDZA 4IHWA 3QPLA 1YRNB 4A3DJ 4A3IJ 1JUSA 2R5ZA 1VI0A 3S1RJ 3H0GJ 3HM5A 3HOVJ 1H89C 3MVPA 2DN0A 2L7ZA 4L5EA 1MBGA 2DA7A 3HDDA 2DTZA 3BQZA 2FD5A 2LFBA 3BR3A 1F36A
chains in the Genus database with same CATH superfamily
2BY1A 1VQLI 3BPXA 2EFWA 4LB5A 1BBYA 3TO9A 2K7LA 1FX7A 1DQUA 2F5DA 3WU1B 3GX4X 3I58A 1LFBA 4II2A 2OPTA 3K6GA 4M73A 4D5CA 1N77A 5DS9A 2Q0OA 4CCNA 3HGGA 2QQ8A 2EJRA 2E1MC 5FKKA 3ABTA 4I02A 2CQNA 1S7EA 1XCBA 1D5YA 2CG4A 1RRJA 2C6YA 1TC3C 3BR5A 1X1DA 2BXZA 5GAEJ 2B0LA 3ROUA 2PQ8A 5CJ9A 3LSKA 4EVIA 3F23A 1HDDC 1ETWA 1E0EA 2BV6A 3W6KB 3ABLH 2LSOA 3CTAA 3DKXA 3HOUJ 5LRRA 1KONA 4B1RA 4XRMA 1VQ6I 3ZRGA 4RLQA 2F6CA 1V5GA 2V1XA 4KIBA 3TQNA 3WHCA 3MKWB 1P7JA 2EILH 2NS7A 3H9JA 4M9ZA 2F4OB 4BE0A 4Q5SF 4UY8I 3GMEA 1JTXA 1UFMA 3O3KA 1FSEA 2FSWA 4XN3A 4A0ZA 1IDYA 1QO0D 4HX4A 3LA2A 1G3WA 2O3FA 3W6VA 1YE9A 3K4NA 1R1TA 4KITB 3RYPA 1WSUA 3VYSB 5ICCA 1FT9A 4IXAA 4AM3A 3BZ6A 1S7AA 1TW3A 2H27A 3VB2A 2HQNA 4XLPF 2Z33A 3PFIA 3CC2I 2K3FA 3KEQA 5E1ZB 1FEXA 3LOCA 5FGMA 3D5SC 4C2TA 4M6YA 4QPOA 3IP4B 2A61A 1WJAA 3OOUA 3RYRA 5EZGA 5FRMA 2DO7A 2R4GA 1JT6A 5JHFA 1A5JA 1KA8A 1HW5A 2LF8A 1ZLJA 3KLNA 3D5LA 3OYAA 3JRIA 1BC7C 1LEBA 1G4DA 1MNMC 1I6HJ 3MCZA 1U0JA 1Y1VJ 4WX9A 1UG0A 4E7ZA 3ECOA 4EGZA 1A36A 2CV1A 4D1QA 1HKTA 1VQMI 3P9KA 1P4WA 2PFBA 3MZHA 5HDNA 3E6CC 2GWRA 5J47A 1S72I 4HLYA 1BR2A 4JX5A 4GDFA 4L5IA 1ZGAA 3RPQA 5M3FJ 4Q47A 3DTEA 4CCOA 4LB6B 1LE8B 2ZO4A 3FZVA 3BJAA 5FLXK 4I0AA 4XSXF 3I4NJ 3GTKJ 4B8XA 3S93A 5GP9A 1XS9A 4RAZA 4G7ZF 2R5YB 2XF6A 2HQ5A 1HCRA 1XMKA 2YU9J 2OBPA 3OYDA 3OS0A 3N97A 4MFDA 2RGVA 3M07A 2ZJRF 2ESHA 2Y0SA 3CO6C 3ZPLA 5BPDA 1B1BA 1V5FA 4ESJA 1XC5A 3K69A 1U8BA 1XSDA 2E1MB 2EFPA 2FNPA 3OY9A 2LNBA 1TBXA 4WXCA 3K4KA 1IGNA 4G8XA 2IPQX 3DFGA 2FF4A 5A2QZ 5F08A 1W5CC 3K2AA 3HXLA 4X0GA 5TGTA 1BN5A 3FISA 1OR7C 1ZRDA 1SAUA 3EUHC 3H9QA 5E1WA 4RBOA 4FETA 1TWCJ 2OQRA 4F91B 2EBIA 4UXNA 4UUSB 3H0DA 4A3MJ 4G6TB 3IH3A 5D5UB 4A93J 2Y2ZA 4F92B 1IUFA 3WGHA 1GLNA 4KICA 2H6BA 2TRTA 3GTLJ 2D1VA 1U78A 3CCVI 5M5YJ 1VQ4I 2HOAA 1FYMA 4I98B 2A3SA 2M5WA 1X3UA 4Y33A 3K7AJ 2F5EA 2R5ZB 3TW7A 4M74A 1BC8C 1DP7P 4DYQA 2WWYA 3R4KA 4EJUA 1T6SA 4II3A 4EEFG 3FK6A 3DCFA 4FT8A 2MYSA 1ZGJA 3GTPJ 3FXLA 2EIKH 1K4SA 5HLGA 2YUSA 1MMDA 2A68F 3FX3A 4U7BA 2VKHA 1U3EM 2Q2EB 2FBIA 4R8HA 3KYCB 5CLSA 4BXUA 3A02A 2FBKA 2DK5A 2FQ4A 2OZUA 3MZ8A 3NWSA 1FWZA 4XMYA 3KZZA 3HOYJ 3JAMZ 4C3HJ 4YRVA 4P9FA 3U9GA 5HODA 1OQYA 4H4KC 4S04A 3BT9A 3JRGA 2JRMA 1MBHA 1XD7A 2CO5A 2WAQA 3WTZA 3HOZJ 1BA5A 2MD5A 2STTA 2LY2A 2E1NA 3E1SA 3BR2A 4PJJA 3MQ0A 1SD6A 5D5VB 2XPUA 4HYEA 3JRFA 2W25A 3KYLA 2K4BA 3CUQA 3F21A 4XR6A 4EJWA 2W1OA 1MNDA 1X1PA 4IPAA 4O3MA 1UAAA 2JA6J 3FKJA 3J7ZI 2HVSA 3RDIA 2GIZA 1WHUA 3SZTA 4BQNA 1RIOH 1D8JA 2FJ1A 4BH9A 2GXAA 4JBAA 3FK7A 2P5VA 1UJ8A 1HDPA 1PUFB 4U0VA 2A6HF 1MBKA 3QQAA 3F9KA 1KU2A 3CCUI 1XMXA 5GAHJ 3S15J 1XGSA 4B43A 3OYLA 1FIAA 3N4MA 1IZ1A 2G7HA 1IV6A 3PSFA 3RSNA 3LSJA 1LQ1A 2VUMJ 3PFYA 4F7ZA 1KQ9A 2NNNA 2P0WA 2E5ZA 4YFXF 2V1UA 1E17A 1MMAA 4PSXA 2RAEA 4KN7X 3RPUD 4XNFA 2UV1A 5DCMA 1AWCA 2Z9OA 1TWAJ 5E1XA 3K1NA 2X0LA 4L5JA 5DDGA 2ME0A 3LL7A 4A3BJ 3ZQFA 1WQ2A 5BNGA 1NG6A 1PYVA 4IVNA 2RKHA 4XL9A 1HC8A 1HXDA 1YYVA 1JHHA 1OKRA 4Z2YA 1OPCA 1UHMA 1W7PB 1OJLA 3BG9A 3Q9VA 3M1EA 4JOMA 3DKYA 2NOJB 4FCYA 1X4OA 2V79A 3NEUA 2ZC2A 1D0YA 4AD9A 2LMDA 2XVCA 1XCVA 2JA5J 1WJBA 3GFLA 5GPCA 3L1PA 1IN7A 4ZYHA 2MBFA 3SEQA 1VQOI 1WH5A 2ADUA 4DQ2A 4CZZA 3MMYB 3OYBA 3BPVA 2RV8A 2Q1ZB 3SZGA 2LLKA 3QYBA 2P7CB 1X2NA 4QIWN 1EH7A 3JTHA 2FEZA 1H88C 2KRCA 1M1EB 2JJ7A 3VDXA 4ZZDA 3TEDA 1N78A 5EG0A 2QLZA 2W84A 3AFHA 3QYFA 1U5TB 1RPWA 2JZYA 2W24A 3NARA 2VBWA 3ERED 4EQQA 3S32A 1USTA 3SXYA 4NB5A 4XKWA 3H3VK 4MEXF 3LMMA 1J5YA 4BGDA 2QSGX 3PIOF 3OL3A 4AVZA 2XGDA 2WB1N 1SFOJ 1QQIA 5JLXA 4JX6A 2DJIA 3COAC 2OCEA 4LG3A 3RTRA 3CD6I 1FTZA 2EV6A 3FXMA 2L01A 2TCTA 3ESWB 1MBEA 3JRAA 3GW2A 4BE1A 2O03A 4M3DA 1YTYA 1D1BA 1EKEA 2GXGA 5L3DA 5E18F 4CXFA 1LFUP 1U8RA 2LF7A 4IQ4A 1GDTA 1DU0A 2KISA 3ULQB 1J2XA 4W1UA 2DYSH 2V1NA 2FE3A 4XK4A 4DBQA 2L02A 1AHDP 3L2UA 3QOEA 3OYCA 2VT3A 1CF7A 4ZZLA 3GYHX 2QKMB 1K78A 1E3OC 3EETA 4RB2C 2K85A 1TQPA 3HSEA 3AL0B 1R23A 4M6VA 4XSZF 4ZYEA 4HDUA 4B44A 1OCPA 1GT0C 2KDOA 4YFKF 1R4NB 4FHTA 3BOQA 2HOTA 2L4MA 3F8MA 1MZBA 2XHKA 2P7VB 2KJCA 1HLVA 3W2AA 3S2HJ 3OWTA 1SEUA 2MLGA 4PFPA 5DD4A 3BG5A 2IT0A 3FXJA 3QP6A 3PM1A 2CGPA 3DU6A 1X4PA 4DYCA 2LKPA 2NRAC 1MBFA 2EV0A 1XGNA 3ZP5A 1A04A 2A69F 2AQFA 3VYUB 1K6YA 1MSEC 3PO3J 1ZQ3P 4ABZA 4ZDLA 4A12A 1SFXA 2IP2A 5EEHA 4CCMA 2IBDA 3OIOA 2BOLA 5ILSA 3E6BA 3FWEA 3TOAA 4AVPA 1VTNC 1RZ4A 2BY3A 1NTCA 1ZG5A 1R5GA 1UCRA 1Z91A 2V1DA 5J3LA 4BBRJ 3S17J 2IS1A 1WWXA 3BQYA 3SFIA 5LEKA 4GFBA 2VBYA 3UR3C 4LLNA 2BHZA 2KZVA 2DPDA 1JUPA 4ESBA 5AIQA 2XASA 3A01A 1W1WE 5CYVA 2ZFUA 4RM2A 1SD4A 1K79A 2KRFA 2CU7A 5C4JJ 2R7OA 1TQMA 4RB0A 1ONVA 1G59A 3S3NA 1MW7A 1W4MA 3HBLA 1Y8RB 2Y31A 4V2GA 3T0YA 2VOPA 5GPAA 5IYBJ 3P7NA 4M72A 2FX0A 2KDZA 1Z3XA 5B3SH 1YRNB 1LDJA 2EA2A 1D0ZA 2O0YA 2Z99A 4OMYA 3QODA 1JUSA 2PBIA 5JVTA 1Y6IA 3HUGB 3PSIA 1TT0A 3T8TA 3HOVJ 3R6SA 2FMYA 1FNNA 2LY1A 3DBRB 2XF5A 1ERDA 1R4MB 2L7ZA 3TMOA 4L5EA 4I01A 4AIJA 5F1RA 4YEJA 2DTZA 2BE5F 2M1BA 1F36A 3IL2A 5BQTA 5H6QA 4JP0A 4PUSA 4BS9A 3LSGA 1GXPA 1E3HA 5AIPA 5IP7J 1IV8A 2DMTA 2OU2A 2H09A 1MD0A 3IUOA 3ZMTA 3DEUA 4LD5A 1QBJA 2V26A 2WAQN 4G12A 1MKMA 4LJZF 4GGGA 5LGNA 2HFHA 1PDNC 4DNCA 1K83J 3PIPF 3CLOA 2E2JJ 2ZJPF 5KHDA 4AIHA 1OMIA 1QPIA 4N4NB 5ICGA 3DPLC 2MFZA 5IPAA 3HZJA 4X6AJ 1FY7A 3S1MJ 3V7SA 1WI3A 4RGUA 3CJRB 3IAM2 3AG3H 1I39A 1SD7A 2I8DA 4ZDOA 1I6XA 1SMYF 2DA4A 2JN6A 4A3LJ 4A0XA 3RZDJ 2CS3A 2KKOA 4ZYGA 3TGNA 1E3PA 3ISPA 3I71A 1HBXG 3DTKA 3DKWA 4U0YA 4ENJA 2LBFA 1DPRA 2E2HJ 2KL4A 3HTUA 2HPMA 3KEOA 2IVMA 1YLFA 4ANJA 5FROA 1WPKA 2NVUB 1STZA 1AKHB 4Z6YA 1ZARA 4G6DA 1B8IA 3HSRA 4PDKA 4A5MA 2E60A 9ANTA 3AG1H 1IJWC 1EF4A 4XLAA 1ZRFA 2NYXA 1Z6RA 4DJAA 3NAUA 2JPCA 4F3QA 3HB9A 4UUTA 3DF8A 1QPMA 2V6CA 1R22A 1J0RA 2VN2A 3I4MJ 4G6QA 1BJAA 1IW7F 1VF9A 2EINH 3HTSB 3G6EI 3SZPA 2DQLA 3HOTA 3DPTA 2DT6A 5DV5A 2A07F 1AOYA 3IAS2 4CUGA 3B6CA 2PX9A 3WTXC 1RI7A 2E2IJ 1IRFA 4R79A 5LBQA 2DOEA 2E5NA 3GFMA 4IF4A 1D1AA 4B3XA 2NVXJ 4RS8A 1J75A 1O3QA 3ZQ7A 3CMYA 2X1EA 3A03A 2EFNA 4NQWB 5CVJA 4DYRA 3CMAI 3CJTB 3JCUC 3HKZA 1FSHA 1SFKA 4IL6C 4LOCA 2F5CA 4RB3C 4AIDA 2DMQA 2X1CA 1R49A 2H1LA 3DTIA 3FXOA 3CC4I 1HW1A 2EV5A 3O8HA 3K4LA 4E4HA 1VQ7I 2ESNA 4QWQA 4HPQA 5D6EA 1E2XA 3CCEI 5F0HA 1ETKA 4G94A 2EA4A 3PO2J 4HNUA 1XX5A 4QSHA 3S2WA 4RB1A 1LVAA 1WJEA 2LK2A 2EZKA 2NVYJ 4WCGA 4UB8C 4C2UA 1Z7LA 2VE9A 2ICWG 2DOFA 2O7OA 3H1CA 1ZG3A 4YIFA 2H8WA 1RESA 2QGUA 2VC0A 3LSTA 2DAOA 2ELKA 4MNUA 4J01A 2ETHA 4CSWA 3I59B 3CCQI 2K9SA 3KP4A 4HZFA 2VOOA 3CC7I 3W6JB 1D1CA 3HOXJ 2JMWA 3BROA 1MH3A 2VL8A 3K0LA 3OYEA 2HDCA 2HU9A 3GTJJ 3GTOJ 3GXOA 2EH3A 4I0BA 4AYBN 3CDLA 4HBLA 4BHCA 1ZREA 4AU7A 4HX7A 3CUQC 1VFCA 1IN6A 3V8KA 4E70A 2PI0A 2GLOA 1V5EA 3GBGA 2QBYA 1KU7A 1H9GA 1TWHJ 2CQ7A 4EGYA 2ZMEB 5F1JA 2JTVA 2X1DA 1JJ6C 1SAXA 4XLHA 5J40A 2AXLA 4HLXA 3VSLA 4KMFA 2DYRH 3RQIA 1QGPA 2L0KA 2NVTJ 4A2UA 1ZG1A 3ASOH 2GBYA 3HOWJ 3HRMA 3FBNB 2VODA 1MMSA 3LSHA 4IRHA 2NXNB 1GHCA 1MSFC 3VSKA 2KLOA 3DP7A 2VBZA 1O57A 2M8GX 3I3LA 3ZQLA 2RVCA 3OOPA 3JR9A 1OYWA 4A6EA 2BW3A 1QHHD 3E5QA 4P5OA 1FYLA 4L9VA 4BJ5C 3TW6A 1RR8C 2JQ7A 3S16J 3T8RA 1C0WA 2FOWA 2V7FA 4HRIA 3RKXA 5LRSA 1S9HA 4OWRB 5KNLA 1T0FC 1X1CA 2DA1A 2OC6A 2P81A 2IRFG 3TDZC 2E34A 3F0CA 2HKXA 3Q3SA 5J6XA 3HRTA 5ICEA 5IOYA 4MIMA 2LTPA 3GO5A 4Y4RA 1ZK8A 3WTYC 4XLNF 4L18B 3FXUA 3TP0A 3K4CA 5DYMA 3WGGA 4EM1A 1O7FA 3FXRA 3KPHA 3WU0A 2L54A 1JJ8C 3OIPA 3H3ZA 4A3KJ 1D3YA 2M8EA 1RETA 1S3JA 3WE2A 5C44J 1BIAA 1W0TA 4OIQF 1Q1VA 2F5VA 2RNGA 3BP8A 5F04A 1OCTC 4L9JA 2M4GA 3P9CA 1I50J 3GCMA 2EFQA 2QYOA 3DPUA 3ZR8X 3H9GA 2MSYA 4KIGA 1ON2A 2QVOA 4M3EA 4D0PA 3U1DA 4NC7A 3BJOA 3I56I 5BMZA 1I5ZA 1WCMJ 5FFZA 4QPQA 1BR4A 1IN8A 3EYYA 1XPXA 2BXYA 2QWWA 3FMRA 5CVVA 4M3BA 4RA2A 4HQEA 3S3MA 3GUDA 2JUCA 5CQGA 4P96A 2H1KA 5IYDJ 4KT6A 3WTVC 1T08B 5C3EJ 2HQAA 2V9VA 4QLCU 5FB2A 4UVCA 3A0HC 1F4KA 2K40A 2QUFA 4PZJA 5JHUA 3DXJF 3CCSI 4ASNA 3HL2A 2E7XA 1FBUA 4I76A 2LY9A 2JA2A 2K9QA 1ETQA 2DU9A 1X19A 3L2WA 1B59A 3FXQA 4P55A 5E3LA 4BQQA 2O9LA 2P5LC 1XMAA 4QTRA 2Y9ZA 5F0CA 2VKDA 3QAHA 4C9YA 1Y56A 3JSOA 1R5ID 2UWMA 3G2BA 2K4JA 3MWMA 4E7LA 1H8AC 1ZLKA 2KHMA 2VJIA 5F0FA 5D5XB 3V8LA 2ZXWH 3J7AO 4BBSJ 2YPRA 4ZJZA 2MC3A 2CFOA 2KT0A 4BEHB 2Z2SB 1X58A 2EZLA 4HF0A 3X2QH 2MG4A 2Y0MA 3UKGA 4HF1A 3U21A 2XRNA 3P9IA 4M3FA 5HLHA 1RUOA 1BW6A 3IWFA 3GZ6A 4BE2A 2BVMA 1OLTA 4S05A 3LAPA 5IT9Z 2DBBA 3WTUC 3VOEA 4E7IA 3OYHA 1WFXA 2W82A 1YFHA 4OIOF 1RKWA 4HQMA 1O3RA 5F27A 2LYCA 3BCBA 4KUMA 3EPZA 3SHFA 3OS1A 3L2CA 1BOBA 3SJMA 1Z3YA 2CV2A 2A5WA 2E19A 4MLOA 3BG7A 1MGTA 3ELKA 1YX5A 1BIBA 2E35A 3QOPA 5IP9J 2ZCWA 3WG7H 4RDUA 1FOYA 4L9TA 5KAIC 2WC2A 3KZYA 4X1EA 3ZOBA 3OSFA 1YJ9I 2KQRA 4EJVA 4LG0B 3I55I 2LH9A 1N25A 4CCLA 2K3PA 5BPIA 5L3EA 2CV0A 3LSPA 2D45A 1HF0A 5K7FA 3E5XA 3ZXSA 3C18A 1YITI 3ZQIA 3CCJI 3R0AA 2L7FP 1HSJA 3F8NA 1ZGWA 3OR1C 4YIRX 1K6OA 2K02A 1TT5B 3BG6A 2L9VA 4B47A 2KFDA 4G7HF 4FASD 1BW5A 3V7RA 4JQFA 4O6JA 2VE8A 1BI2A 1LNWA 3KETA 2W7NA 2XF7A 1T2KA 3I64A 4ENNA 3KEYA 3WG9A 5FLVA 5DM7F 5FD5A 2M2EA 3OYIA 3LSRA 1Z21A 2W85A 3Q0UA 2V6EA 4ENKA 1LE8A 3S8PA 1TZLA 2B7EA 4DZJA 4Y52J 1P4AA 2PG4A 1MJBA 4IEJA 2Q8KA 4CO8A 4BKXA 2KMUA 3S14J 2KIQA 3GF2A 2JSCA 3BY6A 2R5YA 2DCEA 3FHNA 1R00A 1JTYA 1YO5C 5J8FA 3IRQA 1BL0A 5LFAA 1HSTA 1R1UA 1J9IA 4ESFA 3BC8A 5JLWA 3J81Z 1KU9A 3L09A 4RM3A 1Y39A 4CHUA 1UZCA 2M87A 4D9JA 3LFKA 2E1CA 5HLIA 2M0CA 5J4YA 1O4XA 2KIUA 1F5TA 2ZXIA 2MC4A 5GTHC 4JK1X 1JE8A 3CJQB 3QU6A 1QHGA 1T56A 5LD2C 2M4KA 4DW6A 3G1OA 2WY8Q 2J5OA 4GYGA 2M0MA 4Q4ZF 4HSRA 4FE4A 1SANA 4M6XA 4IOAF 2OUMA 3OYNA 1MMNA 4XKVA 3MKZA 4UUSA 3GZNB 4PJ0C 4MTEA 1JI8A 1GV5A 3IH2A 3HRUA 2IEKA 1V3FA 2DXIA 5E8IA 2K5CA 1USSA 3AG4H 2PEXA 3LSMA 4L0YB 1YIOA 2XGCA 4HSTA 1IN4A 3RKQA 1OCCH 3O2PE 4WWCA 4XRSG 2WV0A 1UELB 3F72A 5HLTA 4RAYA 4IHWA 1FP1D 4A3DJ 2A05A 2R5ZA 3BDDA 4KA4A 2IA1A 1ZAOA 2KP6A 1KZHA 2F5FA 3HIFA 2R7VA 1LPQA 1H89C 5DUKA 4ITVA 3IWZA 3LQQA 2VONA 4ZTJA 4GO1A 3HDDA 1DPUA 3BR3A 3QWLA 3C3WA 2R7WA 2VQGA 2Q2EA 4XLEA 2MH9A 2Z5UA 3SEZA 2YX4A 4DIQA 2IA2A 3E6MA 3RKYA 4XRSA 1EH6A 1WZ2A 2JT1A 3QPTA 4BDYA 1IG7A 2EK5A 2DA6A 1IAWA 2DA2A 1JHFA 2UZKA 1ENHA 1YW7A 3L00A 4LITA 1O3TA 3CESA 2AS5F 1B9MA 3EQLF 2XV4S 4OAZA 1X1AA 1VQ8I 4HF2A 4ON0A 2X6WA 2H94A 3K1MA 4XKBA 4MTDA 1XN7A 2ZJQF 5A2QK 3LSIA 4E7KA 1B72B 5IYCJ 1IRZA 2VB6A 3HSFA 1BI0A 2R93J 1T39A 2I5UA 4IHYA 4LGWA 3NWTA 1I1GA 2WAFA 3BTIA 4BL0B 3G1MA 2L9NA 4UB6C 4PJNA 5H6RA 1YG2A 2EB7A 2K9MA 2DLLA 3EUKL 3GFJA 1WH7A 1PUFA 5EGOB 4LFUA 1OFCX 3OYJA 3TKYA 4FX4A 1LUJB 4ZTFA 2XAJA 3JTGA 4HW0A 5HS8A 2G7UA 2A5YB 2NS0A 2HKOA 3LQRA 4LMYA 5HVQC 3S3OA 1YX3A 1XDUA 2Z16A 1L3LA 1Y0UA 3KP2A 2CUFA 4XOTA 2VPLA 2DFIA 2FBHA 2LVSA 4OMZA 4CICA 3MN2A 3T5XA 1G3SA 1BOAA 3JW4A 4IRIA 2HZTA 2Y0SN 4ETSA 5JVGF 5FFXA 2OTLI 2DJNA 4M9XA 3SYTA 5HNHA 4JYKA 2R0QC 1R9TJ 1APLC 4I7HA 1ZELA 3DV8A 3VEPA 5FJ8J 1ZR2A 4HAMA 2XB5A 2RQPA 3KIOA 1W7PA 2IW5A 5LHGA 3IV5A 5JFRA 3ZQQA 2OZ6A 2OQGA 3Q5FA 3LA3A 5LGTA 3JAMK 3VPRA 3LNQA 1IN5A 4BDZA 5ILVA 4RAGA 2BZTA 1VQKI 4IZZA 2N8GA 3C2HA 5M3MJ 3WHBA 1P6RA 2XGXA 1XSXA 2JRTA 1IRXA 4MQVA 1GUUA 3E3VA 3LFUA 4PJMA 1WJCA 1YW8A 1B9NA 2CFXA 2CW7A 3QYEA 1ZRCA 4HOBA 1MDMB 3S1QJ 1LDKB 2COMA 1V54H 2RN7A 1O3SA 1U5TA 2JA7J 3VFZA 1ORKA 5CKTA 2R7XA 2CQQA 2XC7A 4IO9F 2XAUA 1QZYA 3WE3A 3IH4A 2O5RA 2CUZA 3CUOA 3M4OJ 2YU3A 4WXHA 5M5XJ 3EUAA 3RI4A 2Y48A 3W2VA 5LGUA 2QENA 3BTCA 2P6TA 2X85A 1O7LA 2ELJA 1POGA 4PJLA 4Y15A 5LEJA 1FIPA 4KN4X 2HDDA 2O8KA 2PJRB 5TRDA 2D5VA 1GXQA 4ZC3A 1UB9A 2A6TA 3VWBA 3DBHB 5FLMJ 2WBMA 1AA7A 3MD2A 2EQRA 2K86A 2RREA 1KQ0A 2QQBA 5DTDA 3F8BA 2ISZA 2COBA 1T8IA 2O6GE 2WAEA 3K70D 4PSWA 5DEQA 4C3JJ 2WADA 1F1ZA 2HDWA 1REPC 1JGSA 3V7CA 4BJTA 2P6SA 2OD5A 2CQXA 1RR7A 2HPIA 3CQZJ 3RJPA 4CDGA 2NOGA 1PP7U 3OSGA 3HJEA 2M7BA 3I5UA 1U6GA 1EJ9A 2HOEA 4B48A 4MEYF 1OYYA 4TV7A 1UHSA 2B9SA 2BY2A 2VJJA 1HW2A 2F48A 1PJRA 3K4BA 2DPUA 2L5QA 4MGRA 4DZPA 4A3JJ 1R36A 2X9DA 2X6YA 2P4WA 3EDPA 4XLCA 1WVRA 4A5NA 4E7HA 3D1NI 1Y1WJ 6PAXA 3CJNA 3I54A 4I09A 4AIKA 3OS2A 1K4TA 3W2WA 3ZMVA 1WI9A 1I3AA 2CWEA 2ZSIB 4HNVA 2BHYA 4XM3A 1S7OA 2H6CA 1U2WA 2EIJH 3TP3A 3S1NJ 5FKNA 5L3GA 1Z05A 4Y13A 1SVOA 4Q48A 1H9TA 3SQNA 1J09A 2ZB9A 1SMTA 2L4AA 2OAZA 1NH3A 2XPVA 4AWXB 2OTJI 1YOVB 2GIVA 2VQLA 3RKWA 3G73A 3ZMUA 2G0EA 1Y0NA 1J7KA 2BY0A 1IUYA 3V8JA 2XSDC 4PGGA 3IKTA 4CZCA 3ABKH 2R7FA 1S6LA 2HYFA 2M30A 2IGMA 1R71A 4FTHA 4XRFA 1OCRH 1YS7A 2QQ9A 3PL8A 4J19A 2FXAA 5J8CA 4FE7A 4DBRA 1YRNA 3WODF 5CVIA 2VPRA 2FNAA 5K5OA 5HS7A 4A6DA 1W5TA 3FBIB 3HUGA 1FOWA 3PUBA 3CO7C 3W3CA 5J4VA 4JX4A 2EIMH 5BOXA 2L9SA 3G1LA 2HZDA 3TO6A 4F55A 2XKPA 1JKOC 3BLYA 1QVTA 2JWTA 1R58A 3CDHA 2VQCA 3C2BA 4BYYA 3OYFA 3K70C 2HOSA 5K5QA 2VQHA 2FA5A 1GVJA 4OU0A 2KIMA 3TO7A 4HNTA 1XTAA 2VXZA 4UV8A 2DFHA 2YS9A 5AONA 2CUJA 4RGRA 1TWGJ 4V2FA 3L2QA 2PMUA 3HG9A 4EV0A 2Y9YA 2RQQA 3GWZA 1F43A 2DA5A 5CQEA 1Z67A 2FMLA 3RPUA 2DMPA 2KIFA 4LIVA 4C2MJ 2HYGD 1ACIA 3KX2A 4D5FA 2CUEA 3L2RA 2FUG2 2Y30A 2PN6A 2ZSHB 1WGXA 2CSOA 4BQOA 3JSPA 1H0MA 4P9UA 2M7AA 4GXOA 4L0ZB 1NHAA 4CYDA 4IHXA 1CQTA 3QU3A 4BJ6C 1G2HA 1EV7A 3I0TA 4RLFA 2AHQA 5JI6A 1LB2A 1RC9A 3UNGC 5D8LB 3DEEA 1YJNI 2LC2A 3BR0A 2DT5A 2P8TA 1ZKGA 5H2FC 1IXCA 3I53A 2M34A 3CCYA 2ZJ2A 4RGSA 1XDSA 4A3FJ 2LP0A 4HV6A 2PMZA 1AKHA 4HV5A 5TJJA 2HEOA 4BU2A 1JT0A 4NNJA 3CCRI 2H8RA 1JXSA 4I6ZA 4ZYDA 2QQAA 3CZ6A 2KPMA 3E5UA 2HYJA 3OV8A 3GTGJ 3QRFF 3F6VA 2FRHA 4KMUX 5IY5H 3RQ4A 2HVQA 2Z3YA 3GLLA 5GTIC 4YG2F 3KCCA 4EJOA 2XRLA 3G3ZA 2F4MB 1T38A 2W00A 4NDLA 1HKSA 1KU3A 2L7MP 1VQPI 3RCOA 1YJWI 2IAIA 2BGCA 4AC0A 1DDNA 1KGSA 3GFIA 5E79C 2W57A 5EDNA 1JKRC 2VXDA 4IHTA 4CGZA 5HS9A 4IHVA 3C7JA 3JRCA 3BR1A 1BI1A 4NQWA 3L2VA 3ZN0A 5EEAA 3C1DA 2M45A 3JREA 4BHPA 3DLLF 1A6QA 1W7PD 3IC7A 2DTRA 1BJZA 4DGWB 3KP3A 5FKMA 3HPHA 3U1KA 1IC8A 3EYIA 1IO2A 4EMSA 1FJLA 1SFUA 4PGHA 2WB1A 1XGOA 2LRDA 2XAHA 3PNVA 4ZDPA 3ZMZA 3HHGA 4M3GA 2GXBA 3SDGA 4CA0A 1YW9A 2R7UA 3FKIJ 5DCFA 1VQ5I 2CQKA 2ZXHA 4A3GJ 4XIDA 5KK1A 3G71I 2MGQA 3GTQJ 5E3MA 1YQAA 2E71A 1YI2I 2VKEA 2MABA 1FZPB 1NK2P 3U2RA 2QKLB 4ENMA 2IA0A 2XUBA 4A69C 4I2OA 1DP3A 5KAFC 3B73A 3K9TA 2HXIA 3R61A 1JKPC 1W0UA 2OCCH 2JA8J 2D2WA 5M5WJ 2QSFX 3B6AA 4XORA 3I59A 4KT5C 2GM4A 2FQ3A 5GAGJ 2FOKA 3CUQB 1LEAA 3VYTB 3F3XA 3M8EA 2BVLA 2YSRA 2MH2A 2NVQJ 3ONQA 3DLAA 4BHBA 2GA2A 1G6NA 4ZH4F 2UUZA 3G4SI 3CF5F 1MMGA 2O61A 2X6XA 2ZMEA 3Q9SA 4M71A 1RKTA 2XGEA 2NAZA 4RGXA 1X3WB 2CW8A 2ZXJA 3M7GA 3QPLA 1TTYA 4A3IJ 1VI0A 3MAJA 1BI3A 3S1RJ 3ABUA 5BS6A 3HM5A 4IKFA 2IS4A 4E7SA 1LDDA 3MVPA 3OYKA 1W36D 3H5AA 4RMNA 5DCMB 3FHZA 2DA7A 4GRIA 4L9NA 4LK0F 4KFCA 2FD5A 5E8GA 4B09A 2GOMA 1ETXA 2L2OA 3DQVC 1HOMA 3P5JA 4EJTA 4U88A 2QZ8A 1TNTA 3HRSA 1MH4A 4G9YA 1V4RA 5EYRA 2HI3A 2YX7A 2O8XA 3H92A 1EA3A 1PP8F 3IKVA 3R0JA 1P9QC 2BEOA 2VI6A 2ZFWA 3OL4A 3GZ5A 5FKLA 1A35A 4IQJA 1A31A 5IT3A 1FP2A 3JRDA 3ASNH 1Z7UA 1KYWA 2OA4A 3J80Z 2L9RA 1P7IA 1T33A 4O5VA 3ERMA 4XQFA 4CH7A 3TOBA 1XG1A 2VJ4A 2DMNA 1MJAA 2LD5A 3BR6A 4UV9A 3TDUC 2ECCA 5EZHA 5F64A 2AQEA 4IRGA 3KZIC 3ZCOA 1KQ8A 2LOOA 5EG0B 3PUFA 4A3CJ 2LREA 4E7JA 3D0SA 1TL8A 4V19K 1FOXA 2E1OA 1DU6A 2DK8A 5FKOA 3HKZN 3I9V2 5DM6F 2GQQA 3M3YJ 4IX7A 1UMQA 1U5TC 3QPHA 4ZYAA 5JR3A 3L9FA 2OV7A 1I27A 1TLHB 3OIQA 4MFEA 5H20A 2STWA 1B6AA 1ZTRA 2ECBA 4NC6A 3KP7A 3FIWA 1OCOH 3A1YA 4UHTA 1D8KA 1ETYA 5ED4A 1V55H 4RAFA 2CRGA 2VASA 2MW8A 4NHJA 5CPRB 2I10A 3S2DJ 1IRGA 4LK1F 4KNYA 1WJDA 3F8FA 2EPFA 2EZHA 4UUVA 4IOCF 2WY7Q 5FRNA 1SFEA 2Y69H 1CF7B 1QNTA 4BUPA 1UHWA 1K78B 2XROA 4CCJA 2DDBA 2AO9A 2DQRA 3RIRA 4AUXA 5DUIA 2X6OA 4BEHA 1W36C 1G8XA 1N75A 2VJ5A 3PNTA 3O8GA 5L3BA 5E3OA 1P4XA 4XKCA 4LIUA 2L7KA 4D7NA 2R7RA 2HQRA 4N0BA 1FYKA 4IHSA 2ID3A 2JSPA 5F6FA 4UNOA 3AL0C 4PCQA 1TW2A 1QZEA 1QZZA 4KISA 3M8FA 3KP6A 3A2KA 3M1CA 4BNCA 1R7JA 3NQOA 1T0FA 3T1BA 2DMUA 4WK8F 2L3DA 1ITYA 1SVLA 2PMHA 3F22A 2LG4A 1FMVA 3O6BB 3BG3A 3DBLB 2JUGA 3KYDB 2VBXA 2IGNA 2DODA 2PMZN 2UXXA 1Z6TA 3R60A 1I1SA 2HTSA 4J00A 2NS8A 3WGIA 1ZHFA 2IXSA 3ABMH 2XPWA 4A0YA 2YR2A 3ZGKA 2ZNYA 2RDPA 4LG0A 2K9NA 4M9SA 5LLQA 1ON1A 2D1HA 2K27A 3KE2A 3B02A 3BJ6A 3H3UA 1FTTA 4Y7NJ 5D4RA 4D7MA 1S29A 2ZKZA 4EM2A 1IXSB 1GVDA 1MNEA 3L7WA 1EH8A 4N9IA 3A01B 2DFEA 3D5RC 2E7WA 2HS5A 4XICA 1MIJA 1UG2A 4OIRF 3OMYA 2ZBKA 2LR8A 1T95A 2R7SA 4DOZA 2GZWA 1WJFA 2F2EA 4BAYA 4R1HA 3SFZA 1Z9CA 3BTLA 1SVMA 5D5WB 2HR3A 3Q0WA 3WTWC 3HOSA 1HQCA 5EEGA 3CLQA 2CH0A 5KCMA 2BYVE 3KFWX 4HDVA 1PVEA 3A4CA 1U9OA 5EJCA 2M9HA 3CMMA 4P1WA 4BY7J 2R7TA 4OOIA 1IDZA 2PLYA 2IJLA 4C30A 1W5SA 4BACA 1PUEE 1T98A 3CP8A 4XOPA 2LKXA 2HGCA 5L3CA 2VIXA 3DU5A 5K1YA 1NK3P 1F9NA 4YIIA 2DFFA 2K9LA 1Z0XA 3ZQHA 1LVKA 3F8CA 3Q0VA 3QPSA 5C4XJ 1LJ9A 2IGKA 4AYBA 1JGGA 1ZYRF 2XKOA 4LLLA 5IT9K 2HWVA 2VC1A 5ERIA 4HEA2 4N9HA 1GV2A 3PQJA 1OR7A 1ZN2A 3ML6A 2WV1A 5K7ZA 5CVUA 4N4OB 3EUHA 5J1UA 4U0WA 1Z77A 2RC4A 1G3TA 3VODA 2M3AA 1FMWA 2XIGA 2R3SA 5B1AH 3JRBA 4MHGA 5ICFA 5HDKA 5L3FA 1L0OC 1Z1DA 2UXNA 1K7AA 3VYRB 4G7OF 2JVGA 3FM5A 4HX8A 1DUXC 3J80K 4E6KG 2HTJA 3BTJA 4B3AA 2GOXB 3K2ZA 2LBFB 4NUBA 1WRJA 1A6IA 5FD6A 3HHHA 3CMEI 3E7LA 2PJPA 2HNHA 1YHQI 2ZNZA 2QCOA 2VKVA 4UVBA 1D0XA 4KDPA 4XN0A 4U7DA 1R1VA 1B8IB 1IXRC 2TDXA 2QA4I 3K4JA 4GYIA 5KVRA 4U87A 4I99C 1S5LC 3LWFA 2QM3A 4H0EA 4A3EJ 5D6FA 3J7YJ 3DWLE 3LA7A 3M9AA 3TL4X 1KYZA 3F6OA 2IGOA 2WA0A 5E20A 1QU3A 2EFOA 1DGRM 3FM3A 5CVRA 5HDGA 3K10A 3LAJA 5LHHA 3PQKA 2QSHX 1ODDA 2V9KA 1WKMA 3ZQGA 5J1YA 2OJED 3MEXA 3WTTC 2VLAA 1QA6A 2HVRA 1FPQA 2ME6A 5HOOA 3FDYA 2E36A 3J81K 1LKXA 2R92J 3N05A 2XAFA 3KLOA 5TISC 4XLFA 2DI3A 2ELHA 5D8KB 1VZ0A 1X3ZB 3GLXA 1OYIA 3WTSC 1VQ9I 2R7QA 2EWNA 3E97A 1B72A 2J5PA 3SDBA 3REOA 2Y75A 4PK4A 4F93B 3E0JB 4HG2A 4CYCB 2P5KA 4CCKA 2GA1A 1X1BA 1IF1A 2DA3A 4YFNF 1TQIA 3K4MA 3BCAA 2X48A 3FF5A 4FX0A 2V4JC 3MFKA 4HA8A 2OF7A 1B4AA 3AG2H 1OCZH 2LDUA 2XAGA 4B4CA 5EGOA 2EZIA 3M8JA 1Y8QB 1X2MA 1XB4A 3H36A 1AU7A 5EF6A 1YIJI 4BY1J 4WXDA 1WJ5A 1ETOA 4GCVA 1ETVA 5DD8A 5B66C 1MJ9A 4MO7A 1P2FA 1R6RA 3WU2C 4OINF 3MZYA 3ZMSA 1ZR4A 3PNYA 3A0BC 2W48A 2R7ZJ 3OR2C 3IRRA 1LFPA 4YELA 5E3NA 1QVUA 1SC7A 1QRYA 3J7AY 4NBQA 1J59A 3CDIA 1YS6A 2CW0F 1VNDA 3GEZA 1S8NA 3OYGA 3IHUA 1JKQC 4EATA 1HKQA 2JVHA 4UVAA 2B63J 1SD5A 2ISYA 3KP5A 3FMSA 2QBYB 1FBSA 4EM0B 4KIFA 4NC8A 5FLXZ 2V9PA 1TWFJ 4MQ9F 5HNFA 3TBIA 3MKYB 1CGPA 1TNSA 1I3QJ 4BXXJ 3CCLI 4XBFA 3FMQA 1VQNI 4OIPF 3GTMJ 2CJJA 2JK3A 2ZMEC 4LLGF 1G3YA 2AXTC 1BM9A 3HEFA 1ZH5A 1D5VA 1FOKA 5B1BH 4IJAA 5GADJ 2CMPA 3BZCA 3CCMI 1MBJA 2ID6A 4XONA 2BW3B 4F52A 4Y17A 1JUMA 3JRHA 2XSJC 2Z1DA 3DEWA 4BQAA 3H5NA 3E6DA 1XGMA 5B5EC 3K1PA 1ULYA 1FC3A 3ZQCA 2DDAA 2IS6A 2KJBA 1XSVA 2RNJA 2XB0X 4KJZA 1MDMA 4FISA 2CYYA 3ZMDA 3H5RA 1U9NA 1NG7A 3BWGA 2XDVA 4W97A 5IOZA 5E17F 2BBYA 2GAUA 2X51A 2MA3A 1K61A 2XAQA 3AKZA 3HYIA 3GVAA 3CF2A 4PFOA 1TP4A 2W4SA 3PJRA 2DW4A 1FBQA 3ECHA 2R7DA 3QP5A 2IS2A 4KYWA 2VT2A 4OAYA 4S0HB 3FXKA 3BZKA 3HPGA 3HGYA 2F4IA 2PJRA 3ZN1A 2LKSA 3OYMA 1FLIA 2KZGA 4FQGA 1Q1HA 4C3IJ 3H35A 1RNLA 5IP6A 3C2GA 3HC7A 3MKLA 5ILUA 5D4SA 2DOAA 3AAFA 2HXOA 1BR1A 2QF7A 1P92A 2G9WA 5K7HA 3CP2A 4Y3OA 5J1RA 2WTEA 2A6EF 2X4HA 5LHIA 3RZOJ 4CYCA 5FO5A 2DT7B 2NNYA 1DGWY 5K5RA 3NRVA 3H0GJ 2KRHA 1R5HA 4BXFA 2ACJA 2JPBA 2MLKA 1OISA 3V4GA 2DN0A 4K2EA 2MD0A 4WF2A 2QEXI 1HA8A 1RUNA 1MBGA 2FU4A 3V42A 3BQZA 3I4PA 2LFBA
chains in the Genus database with same CATH topology
1ETXA 4JP0A 1HOMA 3LSGA 5IP7J 1MH4A 2DMTA 5EYRA 2HI3A 4XRSA 1LFBA 2OPTA 1IG7A 4D5CA 2DA6A 5DS9A 2DA2A 2VI6A 3HGGA 2WAQN 4G12A 5FKLA 1ENHA 5FKKA 1S7EA 3JRDA 1K83J 1D5YA 2E2JJ 1TC3C 3BR5A 1QPIA 2L9RA 1P7IA 1T33A 5IPAA 4X6AJ 1HDDC 1ETWA 3S1MJ 1XG1A 1WI3A 2DMNA 1B72B 5IYCJ 1IRZA 2R93J 3HOUJ 2DA4A 2JN6A 3BR6A 4XRMA 4B1RA 2ECCA 2LD5A 5EZHA 3RZDJ 4IHYA 4A3LJ 3BTIA 3WHCA 1P7JA 2NS7A 3G1MA 5EG0B 4A3CJ 1JTXA 2E1OA 2E2HJ 1PUFA 1WH7A 1IDYA 1DU6A 5EGOB 5FKOA 3HKZN 1OFCX 3W6VA 3M3YJ 1WPKA 1UMQA 1AKHB 1B8IA 4MFEA 9ANTA 1IJWC 1EF4A 1ZTRA 2ECBA 3FIWA 2CUFA 1FEXA 3NAUA 3LOCA 3I4MJ 3HB9A 2LVSA 4UUTA 3MN2A 3OOUA 5EZGA 1VF9A 1ETYA 2Y0SN 1JT6A 1A5JA 2CRGA 2MW8A 3JRIA 3S2DJ 2I10A 1MNMC 1I6HJ 2DJNA 2R0QC 4JYKA 1R9TJ 1Y1VJ 3B6CA 1APLC 2E2IJ 1ZR2A 5FJ8J 2EZHA 2XB5A 2NVXJ 3IV5A 3CMYA 4JX5A 3A03A 3VPRA 2AO9A 3LNQA 5M3FJ 4DYRA 4AUXA 2X6OA 4LOCA 3O8GA 5E3OA 1LE8B 2DMQA 2N8GA 5M3MJ 3WHBA 4D7NA 3I4NJ 3GTKJ 2ID3A 3O8HA 5GP9A 1XS9A 1GUUA 2R5YB 5F0HA 1ETKA 2HQ5A 3PO2J 4QSHA 1HCRA 2YU9J 3S1QJ 2LK2A 4MFDA 2DMUA 2EZKA 2NVYJ 1ITYA 2JA7J 1U8BA 1XC5A 1ORKA 3BG3A 2CQQA 2O7OA 2PMZN 1RESA 3IH4A 1IGNA 2NS8A 3M4OJ 5F08A 5M5XJ 2ELKA 2XPWA 3K2AA 2K9SA 2K9NA 3BTCA 3HOXJ 2JMWA 3FISA 1MH3A 1POGA 3GTJJ 3GTOJ 1FIPA 2HDDA 2EH3A 2O8KA 1FTTA 4Y7NJ 4D7MA 4RBOA 2D5VA 4AYBN 3CDLA 1GVDA 1TWCJ 3A01B 5FLMJ 2EBIA 4UUSB 2EQRA 1VFCA 4XICA 4A3MJ 1UG2A 2LR8A 3IH3A 4A93J 2Y2ZA 2GLOA 1IUFA 5DTDA 2COBA 3GBGA 1TWHJ 5F1JA 3BTLA 4C3JJ 1JJ6C 2TRTA 3GTLJ 1U78A 5M5YJ 2HOAA 2CQXA 3Q0WA 1RR7A 3RQIA 3K7AJ 2L0KA 2NVTJ 3CQZJ 2R5ZB 3TW7A 2GBYA 2NOGA 3HOWJ 4DYQA 3OSGA 4EEFG 1U9OA 2M9HA 1MSFC 4BY7J 3FK6A 3DCFA 1IDZA 2M8GX 1UHSA 3GTPJ 3ZQLA 3JR9A 2YUSA 3TW6A 2LKXA 4DZPA 3S16J 4A3JJ 2X9DA 3A02A 1NK3P 2FQ4A 1Z0XA 3ZQHA 3Q0VA 3QPSA 5C4XJ 3HOYJ 4C3HJ 3D1NI 1Y1WJ 5HODA 2DA1A 1JGGA 3BT9A 3JRGA 2P81A 1MBHA 3F0CA 3Q3SA 4HNVA 3TP3A 5IOYA 3HOZJ 4MIMA 2LTPA 3S1NJ 1GV2A 1ZK8A 5FKNA 1BA5A 2WV1A 5K7ZA 3BR2A 3TP0A 5J1UA 2XPUA 1JJ8C 2ZB9A 3JRFA 4A3KJ 1Z77A 1RETA 2XPVA 5C44J 3JRBA 1W0TA 1Q1VA 5F04A 1OCTC 2JA6J 2G0EA 2XSDC 1I50J 2FJ1A 3BTJA 4B3AA 2MSYA 4M3EA 3FK7A 1A6IA 1HDPA 1PUFB 1MBKA 1WCMJ 3E7LA 4FTHA 3QQAA 4J19A 3S15J 2QCOA 2VKVA 4FE7A 1FIAA 1B8IB 4M3BA 1YRNA 1IV6A 2VPRA 3LSJA 2VUMJ 2H1KA 5IYDJ 5C3EJ 4A3EJ 4JX4A 2RAEA 3G1LA 2K40A 1JKOC 1TWAJ 1QVTA 2JWTA 4I76A 2LY9A 2K9QA 1ETQA 2ME0A 3C2BA 4A3BJ 5E3LA 3ZQFA 3ZQGA 5BNGA 2O9LA 4QTRA 2Y9ZA 2HOSA 5F0CA 5J1YA 1H8AC 2YS9A 2ME6A 1OJLA 3BG9A 5F0FA 1TWGJ 4V2FA 4FCYA 4BBSJ 2Y9YA 2JA5J 2KT0A 1X58A 1F43A 2EZLA 5GPCA 3L1PA 2DA5A 2R92J 2MG4A 3UKGA 2DMPA 4M3FA 4C2MJ 1WH5A 4D5FA 1BW6A 2CUEA 2Y30A 1WGXA 2LLKA 1B72A 1X2NA 4IHXA 4QIWN 4CYCB 1CQTA 1H88C 1G2HA 2JJ7A 2AHQA 3TEDA 1RKWA 2DA3A 5EG0A 5F27A 2X48A 1RPWA 3BR0A 3NARA 1ZKGA 2OF7A 4B4CA 5EGOA 3SJMA 2EZIA 2E19A 2M34A 3CCYA 1X2MA 4MLOA 1AU7A 4BY1J 5EF6A 4A3FJ 2LP0A 3H3VK 5IP9J 1AKHA 1JT0A 1ETOA 4RDUA 1ETVA 3ZOBA 4X1EA 3OSFA 2H8RA 4MO7A 4I6ZA 2XGDA 2WB1N 1SFOJ 5JLXA 4JX6A 1ZR4A 3LSPA 1FTZA 1HF0A 2HYJA 2W48A 5K7FA 2R7ZJ 3GTGJ 5E3NA 1QVUA 1QRYA 2TCTA 3JRAA 1MBEA 1VNDA 3ZQIA 4M3DA 1JKQC 2L7FP 2XRLA 1ZGWA 1LFUP 2B63J 4NDLA 2L7MP 1BW5A 2IAIA 1GDTA 4AC0A 1TWFJ 1DU0A 4W1UA 1I3QJ 4BXXJ 4XK4A 1AHDP 5EDNA 1JKRC 3GTMJ 2CJJA 2JK3A 4IHVA 1E3OC 3JRCA 5FLVA 3BR1A 3HEFA 2M2EA 5EEAA 3LSRA 3JREA 3Q0UA 4M6VA 1GT0C 1OCPA 1LE8A 1BJZA 1MBJA 4DZJA 4Y52J 5FKMA 2ID6A 1IC8A 2HOTA 1JUMA 1FJLA 4IEJA 3JRHA 4BKXA 1HLVA 3S14J 3DEWA 2R5YA 3S2HJ 1JTYA 4M3GA 3SDGA 3ZQCA 3BG5A 1BL0A 2XB0X 3FKIJ 3PM1A 5JLWA 4FISA 4DYCA 1U9NA 4XIDA 4A3GJ 1MBFA 4W97A 5IOZA 2MGQA 3GTQJ 5E3MA 3PO3J 1MSEC 2VKEA 1ZQ3P 1NK2P 2M0CA 4ABZA 1O4XA 1K61A 4A69C 1T56A 2HXIA 1JKPC 1W0UA 2IBDA 2JA8J 3OIOA 5M5WJ 3B6AA 4DW6A 3G1OA 2GM4A 1NTCA 4S0HB 5J3LA 3HGYA 4FE4A 4BBRJ 1SANA 3S17J 3BQYA 4GFBA 3SFIA 1JUPA 2NVQJ 4C3IJ 3A01A 5IP6A 3MKLA 4UUSA 2HXOA 1GV5A 3IH2A 2QF7A 2IEKA 2CU7A 5C4JJ 5K7HA 5J1RA 3RZOJ 2XGCA 3HBLA 2Y31A 4V2GA 4CYCA 3RKQA 1RKTA 2XGEA 5GPAA 5IYBJ 4XRSG 2FX0A 2KDZA 4IHWA 3QPLA 1YRNB 4A3DJ 4A3IJ 1JUSA 2R5ZA 1VI0A 3S1RJ 3H0GJ 3HM5A 3HOVJ 1H89C 3MVPA 2DN0A 2L7ZA 4L5EA 1MBGA 2DA7A 3HDDA 2DTZA 3BQZA 2FD5A 2LFBA 3BR3A 1F36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETX A;  4JP0 A;  1HOM A;  3LSG A;  5IP7 J;  1MH4 A;  2DMT A;  5EYR A;  2HI3 A;  4XRS A;  1LFB A;  2OPT A;  1IG7 A;  4D5C A;  2DA6 A;  5DS9 A;  2DA2 A;  2VI6 A;  3HGG A;  2WAQ N;  4G12 A;  5FKL A;  1ENH A;  5FKK A;  1S7E A;  3JRD A;  1K83 J;  1D5Y A;  2E2J J;  1TC3 C;  3BR5 A;  1QPI A;  2L9R A;  1P7I A;  1T33 A;  5IPA A;  4X6A J;  1HDD C;  1ETW A;  3S1M J;  1XG1 A;  1WI3 A;  2DMN A;  1B72 B;  5IYC J;  1IRZ A;  2R93 J;  3HOU J;  2DA4 A;  2JN6 A;  3BR6 A;  4XRM A;  4B1R A;  2ECC A;  2LD5 A;  5EZH A;  3RZD J;  4IHY A;  4A3L J;  3BTI A;  3WHC A;  1P7J A;  2NS7 A;  3G1M A;  5EG0 B;  4A3C J;  1JTX A;  2E1O A;  2E2H J;  1PUF A;  1WH7 A;  1IDY A;  1DU6 A;  5EGO B;  5FKO A;  3HKZ N;  1OFC X;  3W6V A;  3M3Y J;  1WPK A;  1UMQ A;  1AKH B;  1B8I A;  4MFE A;  9ANT A;  1IJW C;  1EF4 A;  1ZTR A;  2ECB A;  3FIW A;  2CUF A;  1FEX A;  3NAU A;  3LOC A;  3I4M J;  3HB9 A;  2LVS A;  4UUT A;  3MN2 A;  3OOU A;  5EZG A;  1VF9 A;  1ETY A;  2Y0S N;  1JT6 A;  1A5J A;  2CRG A;  2MW8 A;  3JRI A;  3S2D J;  2I10 A;  1MNM C;  1I6H J;  2DJN A;  2R0Q C;  4JYK A;  1R9T J;  1Y1V J;  3B6C A;  1APL C;  2E2I J;  1ZR2 A;  5FJ8 J;  2EZH A;  2XB5 A;  2NVX J;  3IV5 A;  3CMY A;  4JX5 A;  3A03 A;  3VPR A;  2AO9 A;  3LNQ A;  5M3F J;  4DYR A;  4AUX A;  2X6O A;  4LOC A;  3O8G A;  5E3O A;  1LE8 B;  2DMQ A;  2N8G A;  5M3M J;  3WHB A;  4D7N A;  3I4N J;  3GTK J;  2ID3 A;  3O8H A;  5GP9 A;  1XS9 A;  1GUU A;  2R5Y B;  5F0H A;  1ETK A;  2HQ5 A;  3PO2 J;  4QSH A;  1HCR A;  2YU9 J;  3S1Q J;  2LK2 A;  4MFD A;  2DMU A;  2EZK A;  2NVY J;  1ITY A;  2JA7 J;  1U8B A;  1XC5 A;  1ORK A;  3BG3 A;  2CQQ A;  2O7O A;  2PMZ N;  1RES A;  3IH4 A;  1IGN A;  2NS8 A;  3M4O J;  5F08 A;  5M5X J;  2ELK A;  2XPW A;  3K2A A;  2K9S A;  2K9N A;  3BTC A;  3HOX J;  2JMW A;  3FIS A;  1MH3 A;  1POG A;  3GTJ J;  3GTO J;  1FIP A;  2HDD A;  2EH3 A;  2O8K A;  1FTT A;  4Y7N J;  4D7M A;  4RBO A;  2D5V A;  4AYB N;  3CDL A;  1GVD A;  1TWC J;  3A01 B;  5FLM J;  2EBI A;  4UUS B;  2EQR A;  1VFC A;  4XIC A;  4A3M J;  1UG2 A;  2LR8 A;  3IH3 A;  4A93 J;  2Y2Z A;  2GLO A;  1IUF A;  5DTD A;  2COB A;  3GBG A;  1TWH J;  5F1J A;  3BTL A;  4C3J J;  1JJ6 C;  2TRT A;  3GTL J;  1U78 A;  5M5Y J;  2HOA A;  2CQX A;  3Q0W A;  1RR7 A;  3RQI A;  3K7A J;  2L0K A;  2NVT J;  3CQZ J;  2R5Z B;  3TW7 A;  2GBY A;  2NOG A;  3HOW J;  4DYQ A;  3OSG A;  4EEF G;  1U9O A;  2M9H A;  1MSF C;  4BY7 J;  3FK6 A;  3DCF A;  1IDZ A;  2M8G X;  1UHS A;  3GTP J;  3ZQL A;  3JR9 A;  2YUS A;  3TW6 A;  2LKX A;  4DZP A;  3S16 J;  4A3J J;  2X9D A;  3A02 A;  1NK3 P;  2FQ4 A;  1Z0X A;  3ZQH A;  3Q0V A;  3QPS A;  5C4X J;  3HOY J;  4C3H J;  3D1N I;  1Y1W J;  5HOD A;  2DA1 A;  1JGG A;  3BT9 A;  3JRG A;  2P81 A;  1MBH A;  3F0C A;  3Q3S A;  4HNV A;  3TP3 A;  5IOY A;  3HOZ J;  4MIM A;  2LTP A;  3S1N J;  1GV2 A;  1ZK8 A;  5FKN A;  1BA5 A;  2WV1 A;  5K7Z A;  3BR2 A;  3TP0 A;  5J1U A;  2XPU A;  1JJ8 C;  2ZB9 A;  3JRF A;  4A3K J;  1Z77 A;  1RET A;  2XPV A;  5C44 J;  3JRB A;  1W0T A;  1Q1V A;  5F04 A;  1OCT C;  2JA6 J;  2G0E A;  2XSD C;  1I50 J;  2FJ1 A;  3BTJ A;  4B3A A;  2MSY A;  4M3E A;  3FK7 A;  1A6I A;  1HDP A;  1PUF B;  1MBK A;  1WCM J;  3E7L A;  4FTH A;  3QQA A;  4J19 A;  3S15 J;  2QCO A;  2VKV A;  4FE7 A;  1FIA A;  1B8I B;  4M3B A;  1YRN A;  1IV6 A;  2VPR A;  3LSJ A;  2VUM J;  2H1K A;  5IYD J;  5C3E J;  4A3E J;  4JX4 A;  2RAE A;  3G1L A;  2K40 A;  1JKO C;  1TWA J;  1QVT A;  2JWT A;  4I76 A;  2LY9 A;  2K9Q A;  1ETQ A;  2ME0 A;  3C2B A;  4A3B J;  5E3L A;  3ZQF A;  3ZQG A;  5BNG A;  2O9L A;  4QTR A;  2Y9Z A;  2HOS A;  5F0C A;  5J1Y A;  1H8A C;  2YS9 A;  2ME6 A;  1OJL A;  3BG9 A;  5F0F A;  1TWG J;  4V2F A;  4FCY A;  4BBS J;  2Y9Y A;  2JA5 J;  2KT0 A;  1X58 A;  1F43 A;  2EZL A;  5GPC A;  3L1P A;  2DA5 A;  2R92 J;  2MG4 A;  3UKG A;  2DMP A;  4M3F A;  4C2M J;  1WH5 A;  4D5F A;  1BW6 A;  2CUE A;  2Y30 A;  1WGX A;  2LLK A;  1B72 A;  1X2N A;  4IHX A;  4QIW N;  4CYC B;  1CQT A;  1H88 C;  1G2H A;  2JJ7 A;  2AHQ A;  3TED A;  1RKW A;  2DA3 A;  5EG0 A;  5F27 A;  2X48 A;  1RPW A;  3BR0 A;  3NAR A;  1ZKG A;  2OF7 A;  4B4C A;  5EGO A;  3SJM A;  2EZI A;  2E19 A;  2M34 A;  3CCY A;  1X2M A;  4MLO A;  1AU7 A;  4BY1 J;  5EF6 A;  4A3F J;  2LP0 A;  3H3V K;  5IP9 J;  1AKH A;  1JT0 A;  1ETO A;  4RDU A;  1ETV A;  3ZOB A;  4X1E A;  3OSF A;  2H8R A;  4MO7 A;  4I6Z A;  2XGD A;  2WB1 N;  1SFO J;  5JLX A;  4JX6 A;  1ZR4 A;  3LSP A;  1FTZ A;  1HF0 A;  2HYJ A;  2W48 A;  5K7F A;  2R7Z J;  3GTG J;  5E3N A;  1QVU A;  1QRY A;  2TCT A;  3JRA A;  1MBE A;  1VND A;  3ZQI A;  4M3D A;  1JKQ C;  2L7F P;  2XRL A;  1ZGW A;  1LFU P;  2B63 J;  4NDL A;  2L7M P;  1BW5 A;  2IAI A;  1GDT A;  4AC0 A;  1TWF J;  1DU0 A;  4W1U A;  1I3Q J;  4BXX J;  4XK4 A;  1AHD P;  5EDN A;  1JKR C;  3GTM J;  2CJJ A;  2JK3 A;  4IHV A;  1E3O C;  3JRC A;  5FLV A;  3BR1 A;  3HEF A;  2M2E A;  5EEA A;  3LSR A;  3JRE A;  3Q0U A;  4M6V A;  1GT0 C;  1OCP A;  1LE8 A;  1BJZ A;  1MBJ A;  4DZJ A;  4Y52 J;  5FKM A;  2ID6 A;  1IC8 A;  2HOT A;  1JUM A;  1FJL A;  4IEJ A;  3JRH A;  4BKX A;  1HLV A;  3S14 J;  3DEW A;  2R5Y A;  3S2H J;  1JTY A;  4M3G A;  3SDG A;  3ZQC A;  3BG5 A;  1BL0 A;  2XB0 X;  3FKI J;  3PM1 A;  5JLW A;  4FIS A;  4DYC A;  1U9N A;  4XID A;  4A3G J;  1MBF A;  4W97 A;  5IOZ A;  2MGQ A;  3GTQ J;  5E3M A;  3PO3 J;  1MSE C;  2VKE A;  1ZQ3 P;  1NK2 P;  2M0C A;  4ABZ A;  1O4X A;  1K61 A;  4A69 C;  1T56 A;  2HXI A;  1JKP C;  1W0U A;  2IBD A;  2JA8 J;  3OIO A;  5M5W J;  3B6A A;  4DW6 A;  3G1O A;  2GM4 A;  1NTC A;  4S0H B;  5J3L A;  3HGY A;  4FE4 A;  4BBR J;  1SAN A;  3S17 J;  3BQY A;  4GFB A;  3SFI A;  1JUP A;  2NVQ J;  4C3I J;  3A01 A;  5IP6 A;  3MKL A;  4UUS A;  2HXO A;  1GV5 A;  3IH2 A;  2QF7 A;  2IEK A;  2CU7 A;  5C4J J;  5K7H A;  5J1R A;  3RZO J;  2XGC A;  3HBL A;  2Y31 A;  4V2G A;  4CYC A;  3RKQ A;  1RKT A;  2XGE A;  5GPA A;  5IYB J;  4XRS G;  2FX0 A;  2KDZ A;  4IHW A;  3QPL A;  1YRN B;  4A3D J;  4A3I J;  1JUS A;  2R5Z A;  1VI0 A;  3S1R J;  3H0G J;  3HM5 A;  3HOV J;  1H89 C;  3MVP A;  2DN0 A;  2L7Z A;  4L5E A;  1MBG A;  2DA7 A;  3HDD A;  2DTZ A;  3BQZ A;  2FD5 A;  2LFB A;  3BR3 A;  1F36 A; 
#chains in the Genus database with same CATH topology
 2BY1 A;  1VQL I;  3BPX A;  2EFW A;  4LB5 A;  1BBY A;  3TO9 A;  2K7L A;  1FX7 A;  1DQU A;  2F5D A;  3WU1 B;  3GX4 X;  3I58 A;  1LFB A;  4II2 A;  2OPT A;  3K6G A;  4M73 A;  4D5C A;  1N77 A;  5DS9 A;  2Q0O A;  4CCN A;  3HGG A;  2QQ8 A;  2EJR A;  2E1M C;  5FKK A;  3ABT A;  4I02 A;  2CQN A;  1S7E A;  1XCB A;  1D5Y A;  2CG4 A;  1RRJ A;  2C6Y A;  1TC3 C;  3BR5 A;  1X1D A;  2BXZ A;  5GAE J;  2B0L A;  3ROU A;  2PQ8 A;  5CJ9 A;  3LSK A;  4EVI A;  3F23 A;  1HDD C;  1ETW A;  1E0E A;  2BV6 A;  3W6K B;  3ABL H;  2LSO A;  3CTA A;  3DKX A;  3HOU J;  5LRR A;  1KON A;  4B1R A;  4XRM A;  1VQ6 I;  3ZRG A;  4RLQ A;  2F6C A;  1V5G A;  2V1X A;  4KIB A;  3TQN A;  3WHC A;  3MKW B;  1P7J A;  2EIL H;  2NS7 A;  3H9J A;  4M9Z A;  2F4O B;  4BE0 A;  4Q5S F;  4UY8 I;  3GME A;  1JTX A;  1UFM A;  3O3K A;  1FSE A;  2FSW A;  4XN3 A;  4A0Z A;  1IDY A;  1QO0 D;  4HX4 A;  3LA2 A;  1G3W A;  2O3F A;  3W6V A;  1YE9 A;  3K4N A;  1R1T A;  4KIT B;  3RYP A;  1WSU A;  3VYS B;  5ICC A;  1FT9 A;  4IXA A;  4AM3 A;  3BZ6 A;  1S7A A;  1TW3 A;  2H27 A;  3VB2 A;  2HQN A;  4XLP F;  2Z33 A;  3PFI A;  3CC2 I;  2K3F A;  3KEQ A;  5E1Z B;  1FEX A;  3LOC A;  5FGM A;  3D5S C;  4C2T A;  4M6Y A;  4QPO A;  3IP4 B;  2A61 A;  1WJA A;  3OOU A;  3RYR A;  5EZG A;  5FRM A;  2DO7 A;  2R4G A;  1JT6 A;  5JHF A;  1A5J A;  1KA8 A;  1HW5 A;  2LF8 A;  1ZLJ A;  3KLN A;  3D5L A;  3OYA A;  3JRI A;  1BC7 C;  1LEB A;  1G4D A;  1MNM C;  1I6H J;  3MCZ A;  1U0J A;  1Y1V J;  4WX9 A;  1UG0 A;  4E7Z A;  3ECO A;  4EGZ A;  1A36 A;  2CV1 A;  4D1Q A;  1HKT A;  1VQM I;  3P9K A;  1P4W A;  2PFB A;  3MZH A;  5HDN A;  3E6C C;  2GWR A;  5J47 A;  1S72 I;  4HLY A;  1BR2 A;  4JX5 A;  4GDF A;  4L5I A;  1ZGA A;  3RPQ A;  5M3F J;  4Q47 A;  3DTE A;  4CCO A;  4LB6 B;  1LE8 B;  2ZO4 A;  3FZV A;  3BJA A;  5FLX K;  4I0A A;  4XSX F;  3I4N J;  3GTK J;  4B8X A;  3S93 A;  5GP9 A;  1XS9 A;  4RAZ A;  4G7Z F;  2R5Y B;  2XF6 A;  2HQ5 A;  1HCR A;  1XMK A;  2YU9 J;  2OBP A;  3OYD A;  3OS0 A;  3N97 A;  4MFD A;  2RGV A;  3M07 A;  2ZJR F;  2ESH A;  2Y0S A;  3CO6 C;  3ZPL A;  5BPD A;  1B1B A;  1V5F A;  4ESJ A;  1XC5 A;  3K69 A;  1U8B A;  1XSD A;  2E1M B;  2EFP A;  2FNP A;  3OY9 A;  2LNB A;  1TBX A;  4WXC A;  3K4K A;  1IGN A;  4G8X A;  2IPQ X;  3DFG A;  2FF4 A;  5A2Q Z;  5F08 A;  1W5C C;  3K2A A;  3HXL A;  4X0G A;  5TGT A;  1BN5 A;  3FIS A;  1OR7 C;  1ZRD A;  1SAU A;  3EUH C;  3H9Q A;  5E1W A;  4RBO A;  4FET A;  1TWC J;  2OQR A;  4F91 B;  2EBI A;  4UXN A;  4UUS B;  3H0D A;  4A3M J;  4G6T B;  3IH3 A;  5D5U B;  4A93 J;  2Y2Z A;  4F92 B;  1IUF A;  3WGH A;  1GLN A;  4KIC A;  2H6B A;  2TRT A;  3GTL J;  2D1V A;  1U78 A;  3CCV I;  5M5Y J;  1VQ4 I;  2HOA A;  1FYM A;  4I98 B;  2A3S A;  2M5W A;  1X3U A;  4Y33 A;  3K7A J;  2F5E A;  2R5Z B;  3TW7 A;  4M74 A;  1BC8 C;  1DP7 P;  4DYQ A;  2WWY A;  3R4K A;  4EJU A;  1T6S A;  4II3 A;  4EEF G;  3FK6 A;  3DCF A;  4FT8 A;  2MYS A;  1ZGJ A;  3GTP J;  3FXL A;  2EIK H;  1K4S A;  5HLG A;  2YUS A;  1MMD A;  2A68 F;  3FX3 A;  4U7B A;  2VKH A;  1U3E M;  2Q2E B;  2FBI A;  4R8H A;  3KYC B;  5CLS A;  4BXU A;  3A02 A;  2FBK A;  2DK5 A;  2FQ4 A;  2OZU A;  3MZ8 A;  3NWS A;  1FWZ A;  4XMY A;  3KZZ A;  3HOY J;  3JAM Z;  4C3H J;  4YRV A;  4P9F A;  3U9G A;  5HOD A;  1OQY A;  4H4K C;  4S04 A;  3BT9 A;  3JRG A;  2JRM A;  1MBH A;  1XD7 A;  2CO5 A;  2WAQ A;  3WTZ A;  3HOZ J;  1BA5 A;  2MD5 A;  2STT A;  2LY2 A;  2E1N A;  3E1S A;  3BR2 A;  4PJJ A;  3MQ0 A;  1SD6 A;  5D5V B;  2XPU A;  4HYE A;  3JRF A;  2W25 A;  3KYL A;  2K4B A;  3CUQ A;  3F21 A;  4XR6 A;  4EJW A;  2W1O A;  1MND A;  1X1P A;  4IPA A;  4O3M A;  1UAA A;  2JA6 J;  3FKJ A;  3J7Z I;  2HVS A;  3RDI A;  2GIZ A;  1WHU A;  3SZT A;  4BQN A;  1RIO H;  1D8J A;  2FJ1 A;  4BH9 A;  2GXA A;  4JBA A;  3FK7 A;  2P5V A;  1UJ8 A;  1HDP A;  1PUF B;  4U0V A;  2A6H F;  1MBK A;  3QQA A;  3F9K A;  1KU2 A;  3CCU I;  1XMX A;  5GAH J;  3S15 J;  1XGS A;  4B43 A;  3OYL A;  1FIA A;  3N4M A;  1IZ1 A;  2G7H A;  1IV6 A;  3PSF A;  3RSN A;  3LSJ A;  1LQ1 A;  2VUM J;  3PFY A;  4F7Z A;  1KQ9 A;  2NNN A;  2P0W A;  2E5Z A;  4YFX F;  2V1U A;  1E17 A;  1MMA A;  4PSX A;  2RAE A;  4KN7 X;  3RPU D;  4XNF A;  2UV1 A;  5DCM A;  1AWC A;  2Z9O A;  1TWA J;  5E1X A;  3K1N A;  2X0L A;  4L5J A;  5DDG A;  2ME0 A;  3LL7 A;  4A3B J;  3ZQF A;  1WQ2 A;  5BNG A;  1NG6 A;  1PYV A;  4IVN A;  2RKH A;  4XL9 A;  1HC8 A;  1HXD A;  1YYV A;  1JHH A;  1OKR A;  4Z2Y A;  1OPC A;  1UHM A;  1W7P B;  1OJL A;  3BG9 A;  3Q9V A;  3M1E A;  4JOM A;  3DKY A;  2NOJ B;  4FCY A;  1X4O A;  2V79 A;  3NEU A;  2ZC2 A;  1D0Y A;  4AD9 A;  2LMD A;  2XVC A;  1XCV A;  2JA5 J;  1WJB A;  3GFL A;  5GPC A;  3L1P A;  1IN7 A;  4ZYH A;  2MBF A;  3SEQ A;  1VQO I;  1WH5 A;  2ADU A;  4DQ2 A;  4CZZ A;  3MMY B;  3OYB A;  3BPV A;  2RV8 A;  2Q1Z B;  3SZG A;  2LLK A;  3QYB A;  2P7C B;  1X2N A;  4QIW N;  1EH7 A;  3JTH A;  2FEZ A;  1H88 C;  2KRC A;  1M1E B;  2JJ7 A;  3VDX A;  4ZZD A;  3TED A;  1N78 A;  5EG0 A;  2QLZ A;  2W84 A;  3AFH A;  3QYF A;  1U5T B;  1RPW A;  2JZY A;  2W24 A;  3NAR A;  2VBW A;  3ERE D;  4EQQ A;  3S32 A;  1UST A;  3SXY A;  4NB5 A;  4XKW A;  3H3V K;  4MEX F;  3LMM A;  1J5Y A;  4BGD A;  2QSG X;  3PIO F;  3OL3 A;  4AVZ A;  2XGD A;  2WB1 N;  1SFO J;  1QQI A;  5JLX A;  4JX6 A;  2DJI A;  3COA C;  2OCE A;  4LG3 A;  3RTR A;  3CD6 I;  1FTZ A;  2EV6 A;  3FXM A;  2L01 A;  2TCT A;  3ESW B;  1MBE A;  3JRA A;  3GW2 A;  4BE1 A;  2O03 A;  4M3D A;  1YTY A;  1D1B A;  1EKE A;  2GXG A;  5L3D A;  5E18 F;  4CXF A;  1LFU P;  1U8R A;  2LF7 A;  4IQ4 A;  1GDT A;  1DU0 A;  2KIS A;  3ULQ B;  1J2X A;  4W1U A;  2DYS H;  2V1N A;  2FE3 A;  4XK4 A;  4DBQ A;  2L02 A;  1AHD P;  3L2U A;  3QOE A;  3OYC A;  2VT3 A;  1CF7 A;  4ZZL A;  3GYH X;  2QKM B;  1K78 A;  1E3O C;  3EET A;  4RB2 C;  2K85 A;  1TQP A;  3HSE A;  3AL0 B;  1R23 A;  4M6V A;  4XSZ F;  4ZYE A;  4HDU A;  4B44 A;  1OCP A;  1GT0 C;  2KDO A;  4YFK F;  1R4N B;  4FHT A;  3BOQ A;  2HOT A;  2L4M A;  3F8M A;  1MZB A;  2XHK A;  2P7V B;  2KJC A;  1HLV A;  3W2A A;  3S2H J;  3OWT A;  1SEU A;  2MLG A;  4PFP A;  5DD4 A;  3BG5 A;  2IT0 A;  3FXJ A;  3QP6 A;  3PM1 A;  2CGP A;  3DU6 A;  1X4P A;  4DYC A;  2LKP A;  2NRA C;  1MBF A;  2EV0 A;  1XGN A;  3ZP5 A;  1A04 A;  2A69 F;  2AQF A;  3VYU B;  1K6Y A;  1MSE C;  3PO3 J;  1ZQ3 P;  4ABZ A;  4ZDL A;  4A12 A;  1SFX A;  2IP2 A;  5EEH A;  4CCM A;  2IBD A;  3OIO A;  2BOL A;  5ILS A;  3E6B A;  3FWE A;  3TOA A;  4AVP A;  1VTN C;  1RZ4 A;  2BY3 A;  1NTC A;  1ZG5 A;  1R5G A;  1UCR A;  1Z91 A;  2V1D A;  5J3L A;  4BBR J;  3S17 J;  2IS1 A;  1WWX A;  3BQY A;  3SFI A;  5LEK A;  4GFB A;  2VBY A;  3UR3 C;  4LLN A;  2BHZ A;  2KZV A;  2DPD A;  1JUP A;  4ESB A;  5AIQ A;  2XAS A;  3A01 A;  1W1W E;  5CYV A;  2ZFU A;  4RM2 A;  1SD4 A;  1K79 A;  2KRF A;  2CU7 A;  5C4J J;  2R7O A;  1TQM A;  4RB0 A;  1ONV A;  1G59 A;  3S3N A;  1MW7 A;  1W4M A;  3HBL A;  1Y8R B;  2Y31 A;  4V2G A;  3T0Y A;  2VOP A;  5GPA A;  5IYB J;  3P7N A;  4M72 A;  2FX0 A;  2KDZ A;  1Z3X A;  5B3S H;  1YRN B;  1LDJ A;  2EA2 A;  1D0Z A;  2O0Y A;  2Z99 A;  4OMY A;  3QOD A;  1JUS A;  2PBI A;  5JVT A;  1Y6I A;  3HUG B;  3PSI A;  1TT0 A;  3T8T A;  3HOV J;  3R6S A;  2FMY A;  1FNN A;  2LY1 A;  3DBR B;  2XF5 A;  1ERD A;  1R4M B;  2L7Z A;  3TMO A;  4L5E A;  4I01 A;  4AIJ A;  5F1R A;  4YEJ A;  2DTZ A;  2BE5 F;  2M1B A;  1F36 A;  3IL2 A;  5BQT A;  5H6Q A;  4JP0 A;  4PUS A;  4BS9 A;  3LSG A;  1GXP A;  1E3H A;  5AIP A;  5IP7 J;  1IV8 A;  2DMT A;  2OU2 A;  2H09 A;  1MD0 A;  3IUO A;  3ZMT A;  3DEU A;  4LD5 A;  1QBJ A;  2V26 A;  2WAQ N;  4G12 A;  1MKM A;  4LJZ F;  4GGG A;  5LGN A;  2HFH A;  1PDN C;  4DNC A;  1K83 J;  3PIP F;  3CLO A;  2E2J J;  2ZJP F;  5KHD A;  4AIH A;  1OMI A;  1QPI A;  4N4N B;  5ICG A;  3DPL C;  2MFZ A;  5IPA A;  3HZJ A;  4X6A J;  1FY7 A;  3S1M J;  3V7S A;  1WI3 A;  4RGU A;  3CJR B;  3IAM 2;  3AG3 H;  1I39 A;  1SD7 A;  2I8D A;  4ZDO A;  1I6X A;  1SMY F;  2DA4 A;  2JN6 A;  4A3L J;  4A0X A;  3RZD J;  2CS3 A;  2KKO A;  4ZYG A;  3TGN A;  1E3P A;  3ISP A;  3I71 A;  1HBX G;  3DTK A;  3DKW A;  4U0Y A;  4ENJ A;  2LBF A;  1DPR A;  2E2H J;  2KL4 A;  3HTU A;  2HPM A;  3KEO A;  2IVM A;  1YLF A;  4ANJ A;  5FRO A;  1WPK A;  2NVU B;  1STZ A;  1AKH B;  4Z6Y A;  1ZAR A;  4G6D A;  1B8I A;  3HSR A;  4PDK A;  4A5M A;  2E60 A;  9ANT A;  3AG1 H;  1IJW C;  1EF4 A;  4XLA A;  1ZRF A;  2NYX A;  1Z6R A;  4DJA A;  3NAU A;  2JPC A;  4F3Q A;  3HB9 A;  4UUT A;  3DF8 A;  1QPM A;  2V6C A;  1R22 A;  1J0R A;  2VN2 A;  3I4M J;  4G6Q A;  1BJA A;  1IW7 F;  1VF9 A;  2EIN H;  3HTS B;  3G6E I;  3SZP A;  2DQL A;  3HOT A;  3DPT A;  2DT6 A;  5DV5 A;  2A07 F;  1AOY A;  3IAS 2;  4CUG A;  3B6C A;  2PX9 A;  3WTX C;  1RI7 A;  2E2I J;  1IRF A;  4R79 A;  5LBQ A;  2DOE A;  2E5N A;  3GFM A;  4IF4 A;  1D1A A;  4B3X A;  2NVX J;  4RS8 A;  1J75 A;  1O3Q A;  3ZQ7 A;  3CMY A;  2X1E A;  3A03 A;  2EFN A;  4NQW B;  5CVJ A;  4DYR A;  3CMA I;  3CJT B;  3JCU C;  3HKZ A;  1FSH A;  1SFK A;  4IL6 C;  4LOC A;  2F5C A;  4RB3 C;  4AID A;  2DMQ A;  2X1C A;  1R49 A;  2H1L A;  3DTI A;  3FXO A;  3CC4 I;  1HW1 A;  2EV5 A;  3O8H A;  3K4L A;  4E4H A;  1VQ7 I;  2ESN A;  4QWQ A;  4HPQ A;  5D6E A;  1E2X A;  3CCE I;  5F0H A;  1ETK A;  4G94 A;  2EA4 A;  3PO2 J;  4HNU A;  1XX5 A;  4QSH A;  3S2W A;  4RB1 A;  1LVA A;  1WJE A;  2LK2 A;  2EZK A;  2NVY J;  4WCG A;  4UB8 C;  4C2U A;  1Z7L A;  2VE9 A;  2ICW G;  2DOF A;  2O7O A;  3H1C A;  1ZG3 A;  4YIF A;  2H8W A;  1RES A;  2QGU A;  2VC0 A;  3LST A;  2DAO A;  2ELK A;  4MNU A;  4J01 A;  2ETH A;  4CSW A;  3I59 B;  3CCQ I;  2K9S A;  3KP4 A;  4HZF A;  2VOO A;  3CC7 I;  3W6J B;  1D1C A;  3HOX J;  2JMW A;  3BRO A;  1MH3 A;  2VL8 A;  3K0L A;  3OYE A;  2HDC A;  2HU9 A;  3GTJ J;  3GTO J;  3GXO A;  2EH3 A;  4I0B A;  4AYB N;  3CDL A;  4HBL A;  4BHC A;  1ZRE A;  4AU7 A;  4HX7 A;  3CUQ C;  1VFC A;  1IN6 A;  3V8K A;  4E70 A;  2PI0 A;  2GLO A;  1V5E A;  3GBG A;  2QBY A;  1KU7 A;  1H9G A;  1TWH J;  2CQ7 A;  4EGY A;  2ZME B;  5F1J A;  2JTV A;  2X1D A;  1JJ6 C;  1SAX A;  4XLH A;  5J40 A;  2AXL A;  4HLX A;  3VSL A;  4KMF A;  2DYR H;  3RQI A;  1QGP A;  2L0K A;  2NVT J;  4A2U A;  1ZG1 A;  3ASO H;  2GBY A;  3HOW J;  3HRM A;  3FBN B;  2VOD A;  1MMS A;  3LSH A;  4IRH A;  2NXN B;  1GHC A;  1MSF C;  3VSK A;  2KLO A;  3DP7 A;  2VBZ A;  1O57 A;  2M8G X;  3I3L A;  3ZQL A;  2RVC A;  3OOP A;  3JR9 A;  1OYW A;  4A6E A;  2BW3 A;  1QHH D;  3E5Q A;  4P5O A;  1FYL A;  4L9V A;  4BJ5 C;  3TW6 A;  1RR8 C;  2JQ7 A;  3S16 J;  3T8R A;  1C0W A;  2FOW A;  2V7F A;  4HRI A;  3RKX A;  5LRS A;  1S9H A;  4OWR B;  5KNL A;  1T0F C;  1X1C A;  2DA1 A;  2OC6 A;  2P81 A;  2IRF G;  3TDZ C;  2E34 A;  3F0C A;  2HKX A;  3Q3S A;  5J6X A;  3HRT A;  5ICE A;  5IOY A;  4MIM A;  2LTP A;  3GO5 A;  4Y4R A;  1ZK8 A;  3WTY C;  4XLN F;  4L18 B;  3FXU A;  3TP0 A;  3K4C A;  5DYM A;  3WGG A;  4EM1 A;  1O7F A;  3FXR A;  3KPH A;  3WU0 A;  2L54 A;  1JJ8 C;  3OIP A;  3H3Z A;  4A3K J;  1D3Y A;  2M8E A;  1RET A;  1S3J A;  3WE2 A;  5C44 J;  1BIA A;  1W0T A;  4OIQ F;  1Q1V A;  2F5V A;  2RNG A;  3BP8 A;  5F04 A;  1OCT C;  4L9J A;  2M4G A;  3P9C A;  1I50 J;  3GCM A;  2EFQ A;  2QYO A;  3DPU A;  3ZR8 X;  3H9G A;  2MSY A;  4KIG A;  1ON2 A;  2QVO A;  4M3E A;  4D0P A;  3U1D A;  4NC7 A;  3BJO A;  3I56 I;  5BMZ A;  1I5Z A;  1WCM J;  5FFZ A;  4QPQ A;  1BR4 A;  1IN8 A;  3EYY A;  1XPX A;  2BXY A;  2QWW A;  3FMR A;  5CVV A;  4M3B A;  4RA2 A;  4HQE A;  3S3M A;  3GUD A;  2JUC A;  5CQG A;  4P96 A;  2H1K A;  5IYD J;  4KT6 A;  3WTV C;  1T08 B;  5C3E J;  2HQA A;  2V9V A;  4QLC U;  5FB2 A;  4UVC A;  3A0H C;  1F4K A;  2K40 A;  2QUF A;  4PZJ A;  5JHU A;  3DXJ F;  3CCS I;  4ASN A;  3HL2 A;  2E7X A;  1FBU A;  4I76 A;  2LY9 A;  2JA2 A;  2K9Q A;  1ETQ A;  2DU9 A;  1X19 A;  3L2W A;  1B59 A;  3FXQ A;  4P55 A;  5E3L A;  4BQQ A;  2O9L A;  2P5L C;  1XMA A;  4QTR A;  2Y9Z A;  5F0C A;  2VKD A;  3QAH A;  4C9Y A;  1Y56 A;  3JSO A;  1R5I D;  2UWM A;  3G2B A;  2K4J A;  3MWM A;  4E7L A;  1H8A C;  1ZLK A;  2KHM A;  2VJI A;  5F0F A;  5D5X B;  3V8L A;  2ZXW H;  3J7A O;  4BBS J;  2YPR A;  4ZJZ A;  2MC3 A;  2CFO A;  2KT0 A;  4BEH B;  2Z2S B;  1X58 A;  2EZL A;  4HF0 A;  3X2Q H;  2MG4 A;  2Y0M A;  3UKG A;  4HF1 A;  3U21 A;  2XRN A;  3P9I A;  4M3F A;  5HLH A;  1RUO A;  1BW6 A;  3IWF A;  3GZ6 A;  4BE2 A;  2BVM A;  1OLT A;  4S05 A;  3LAP A;  5IT9 Z;  2DBB A;  3WTU C;  3VOE A;  4E7I A;  3OYH A;  1WFX A;  2W82 A;  1YFH A;  4OIO F;  1RKW A;  4HQM A;  1O3R A;  5F27 A;  2LYC A;  3BCB A;  4KUM A;  3EPZ A;  3SHF A;  3OS1 A;  3L2C A;  1BOB A;  3SJM A;  1Z3Y A;  2CV2 A;  2A5W A;  2E19 A;  4MLO A;  3BG7 A;  1MGT A;  3ELK A;  1YX5 A;  1BIB A;  2E35 A;  3QOP A;  5IP9 J;  2ZCW A;  3WG7 H;  4RDU A;  1FOY A;  4L9T A;  5KAI C;  2WC2 A;  3KZY A;  4X1E A;  3ZOB A;  3OSF A;  1YJ9 I;  2KQR A;  4EJV A;  4LG0 B;  3I55 I;  2LH9 A;  1N25 A;  4CCL A;  2K3P A;  5BPI A;  5L3E A;  2CV0 A;  3LSP A;  2D45 A;  1HF0 A;  5K7F A;  3E5X A;  3ZXS A;  3C18 A;  1YIT I;  3ZQI A;  3CCJ I;  3R0A A;  2L7F P;  1HSJ A;  3F8N A;  1ZGW A;  3OR1 C;  4YIR X;  1K6O A;  2K02 A;  1TT5 B;  3BG6 A;  2L9V A;  4B47 A;  2KFD A;  4G7H F;  4FAS D;  1BW5 A;  3V7R A;  4JQF A;  4O6J A;  2VE8 A;  1BI2 A;  1LNW A;  3KET A;  2W7N A;  2XF7 A;  1T2K A;  3I64 A;  4ENN A;  3KEY A;  3WG9 A;  5FLV A;  5DM7 F;  5FD5 A;  2M2E A;  3OYI A;  3LSR A;  1Z21 A;  2W85 A;  3Q0U A;  2V6E A;  4ENK A;  1LE8 A;  3S8P A;  1TZL A;  2B7E A;  4DZJ A;  4Y52 J;  1P4A A;  2PG4 A;  1MJB A;  4IEJ A;  2Q8K A;  4CO8 A;  4BKX A;  2KMU A;  3S14 J;  2KIQ A;  3GF2 A;  2JSC A;  3BY6 A;  2R5Y A;  2DCE A;  3FHN A;  1R00 A;  1JTY A;  1YO5 C;  5J8F A;  3IRQ A;  1BL0 A;  5LFA A;  1HST A;  1R1U A;  1J9I A;  4ESF A;  3BC8 A;  5JLW A;  3J81 Z;  1KU9 A;  3L09 A;  4RM3 A;  1Y39 A;  4CHU A;  1UZC A;  2M87 A;  4D9J A;  3LFK A;  2E1C A;  5HLI A;  2M0C A;  5J4Y A;  1O4X A;  2KIU A;  1F5T A;  2ZXI A;  2MC4 A;  5GTH C;  4JK1 X;  1JE8 A;  3CJQ B;  3QU6 A;  1QHG A;  1T56 A;  5LD2 C;  2M4K A;  4DW6 A;  3G1O A;  2WY8 Q;  2J5O A;  4GYG A;  2M0M A;  4Q4Z F;  4HSR A;  4FE4 A;  1SAN A;  4M6X A;  4IOA F;  2OUM A;  3OYN A;  1MMN A;  4XKV A;  3MKZ A;  4UUS A;  3GZN B;  4PJ0 C;  4MTE A;  1JI8 A;  1GV5 A;  3IH2 A;  3HRU A;  2IEK A;  1V3F A;  2DXI A;  5E8I A;  2K5C A;  1USS A;  3AG4 H;  2PEX A;  3LSM A;  4L0Y B;  1YIO A;  2XGC A;  4HST A;  1IN4 A;  3RKQ A;  1OCC H;  3O2P E;  4WWC A;  4XRS G;  2WV0 A;  1UEL B;  3F72 A;  5HLT A;  4RAY A;  4IHW A;  1FP1 D;  4A3D J;  2A05 A;  2R5Z A;  3BDD A;  4KA4 A;  2IA1 A;  1ZAO A;  2KP6 A;  1KZH A;  2F5F A;  3HIF A;  2R7V A;  1LPQ A;  1H89 C;  5DUK A;  4ITV A;  3IWZ A;  3LQQ A;  2VON A;  4ZTJ A;  4GO1 A;  3HDD A;  1DPU A;  3BR3 A;  3QWL A;  3C3W A;  2R7W A;  2VQG A;  2Q2E A;  4XLE A;  2MH9 A;  2Z5U A;  3SEZ A;  2YX4 A;  4DIQ A;  2IA2 A;  3E6M A;  3RKY A;  4XRS A;  1EH6 A;  1WZ2 A;  2JT1 A;  3QPT A;  4BDY A;  1IG7 A;  2EK5 A;  2DA6 A;  1IAW A;  2DA2 A;  1JHF A;  2UZK A;  1ENH A;  1YW7 A;  3L00 A;  4LIT A;  1O3T A;  3CES A;  2AS5 F;  1B9M A;  3EQL F;  2XV4 S;  4OAZ A;  1X1A A;  1VQ8 I;  4HF2 A;  4ON0 A;  2X6W A;  2H94 A;  3K1M A;  4XKB A;  4MTD A;  1XN7 A;  2ZJQ F;  5A2Q K;  3LSI A;  4E7K A;  1B72 B;  5IYC J;  1IRZ A;  2VB6 A;  3HSF A;  1BI0 A;  2R93 J;  1T39 A;  2I5U A;  4IHY A;  4LGW A;  3NWT A;  1I1G A;  2WAF A;  3BTI A;  4BL0 B;  3G1M A;  2L9N A;  4UB6 C;  4PJN A;  5H6R A;  1YG2 A;  2EB7 A;  2K9M A;  2DLL A;  3EUK L;  3GFJ A;  1WH7 A;  1PUF A;  5EGO B;  4LFU A;  1OFC X;  3OYJ A;  3TKY A;  4FX4 A;  1LUJ B;  4ZTF A;  2XAJ A;  3JTG A;  4HW0 A;  5HS8 A;  2G7U A;  2A5Y B;  2NS0 A;  2HKO A;  3LQR A;  4LMY A;  5HVQ C;  3S3O A;  1YX3 A;  1XDU A;  2Z16 A;  1L3L A;  1Y0U A;  3KP2 A;  2CUF A;  4XOT A;  2VPL A;  2DFI A;  2FBH A;  2LVS A;  4OMZ A;  4CIC A;  3MN2 A;  3T5X A;  1G3S A;  1BOA A;  3JW4 A;  4IRI A;  2HZT A;  2Y0S N;  4ETS A;  5JVG F;  5FFX A;  2OTL I;  2DJN A;  4M9X A;  3SYT A;  5HNH A;  4JYK A;  2R0Q C;  1R9T J;  1APL C;  4I7H A;  1ZEL A;  3DV8 A;  3VEP A;  5FJ8 J;  1ZR2 A;  4HAM A;  2XB5 A;  2RQP A;  3KIO A;  1W7P A;  2IW5 A;  5LHG A;  3IV5 A;  5JFR A;  3ZQQ A;  2OZ6 A;  2OQG A;  3Q5F A;  3LA3 A;  5LGT A;  3JAM K;  3VPR A;  3LNQ A;  1IN5 A;  4BDZ A;  5ILV A;  4RAG A;  2BZT A;  1VQK I;  4IZZ A;  2N8G A;  3C2H A;  5M3M J;  3WHB A;  1P6R A;  2XGX A;  1XSX A;  2JRT A;  1IRX A;  4MQV A;  1GUU A;  3E3V A;  3LFU A;  4PJM A;  1WJC A;  1YW8 A;  1B9N A;  2CFX A;  2CW7 A;  3QYE A;  1ZRC A;  4HOB A;  1MDM B;  3S1Q J;  1LDK B;  2COM A;  1V54 H;  2RN7 A;  1O3S A;  1U5T A;  2JA7 J;  3VFZ A;  1ORK A;  5CKT A;  2R7X A;  2CQQ A;  2XC7 A;  4IO9 F;  2XAU A;  1QZY A;  3WE3 A;  3IH4 A;  2O5R A;  2CUZ A;  3CUO A;  3M4O J;  2YU3 A;  4WXH A;  5M5X J;  3EUA A;  3RI4 A;  2Y48 A;  3W2V A;  5LGU A;  2QEN A;  3BTC A;  2P6T A;  2X85 A;  1O7L A;  2ELJ A;  1POG A;  4PJL A;  4Y15 A;  5LEJ A;  1FIP A;  4KN4 X;  2HDD A;  2O8K A;  2PJR B;  5TRD A;  2D5V A;  1GXQ A;  4ZC3 A;  1UB9 A;  2A6T A;  3VWB A;  3DBH B;  5FLM J;  2WBM A;  1AA7 A;  3MD2 A;  2EQR A;  2K86 A;  2RRE A;  1KQ0 A;  2QQB A;  5DTD A;  3F8B A;  2ISZ A;  2COB A;  1T8I A;  2O6G E;  2WAE A;  3K70 D;  4PSW A;  5DEQ A;  4C3J J;  2WAD A;  1F1Z A;  2HDW A;  1REP C;  1JGS A;  3V7C A;  4BJT A;  2P6S A;  2OD5 A;  2CQX A;  1RR7 A;  2HPI A;  3CQZ J;  3RJP A;  4CDG A;  2NOG A;  1PP7 U;  3OSG A;  3HJE A;  2M7B A;  3I5U A;  1U6G A;  1EJ9 A;  2HOE A;  4B48 A;  4MEY F;  1OYY A;  4TV7 A;  1UHS A;  2B9S A;  2BY2 A;  2VJJ A;  1HW2 A;  2F48 A;  1PJR A;  3K4B A;  2DPU A;  2L5Q A;  4MGR A;  4DZP A;  4A3J J;  1R36 A;  2X9D A;  2X6Y A;  2P4W A;  3EDP A;  4XLC A;  1WVR A;  4A5N A;  4E7H A;  3D1N I;  1Y1W J;  6PAX A;  3CJN A;  3I54 A;  4I09 A;  4AIK A;  3OS2 A;  1K4T A;  3W2W A;  3ZMV A;  1WI9 A;  1I3A A;  2CWE A;  2ZSI B;  4HNV A;  2BHY A;  4XM3 A;  1S7O A;  2H6C A;  1U2W A;  2EIJ H;  3TP3 A;  3S1N J;  5FKN A;  5L3G A;  1Z05 A;  4Y13 A;  1SVO A;  4Q48 A;  1H9T A;  3SQN A;  1J09 A;  2ZB9 A;  1SMT A;  2L4A A;  2OAZ A;  1NH3 A;  2XPV A;  4AWX B;  2OTJ I;  1YOV B;  2GIV A;  2VQL A;  3RKW A;  3G73 A;  3ZMU A;  2G0E A;  1Y0N A;  1J7K A;  2BY0 A;  1IUY A;  3V8J A;  2XSD C;  4PGG A;  3IKT A;  4CZC A;  3ABK H;  2R7F A;  1S6L A;  2HYF A;  2M30 A;  2IGM A;  1R71 A;  4FTH A;  4XRF A;  1OCR H;  1YS7 A;  2QQ9 A;  3PL8 A;  4J19 A;  2FXA A;  5J8C A;  4FE7 A;  4DBR A;  1YRN A;  3WOD F;  5CVI A;  2VPR A;  2FNA A;  5K5O A;  5HS7 A;  4A6D A;  1W5T A;  3FBI B;  3HUG A;  1FOW A;  3PUB A;  3CO7 C;  3W3C A;  5J4V A;  4JX4 A;  2EIM H;  5BOX A;  2L9S A;  3G1L A;  2HZD A;  3TO6 A;  4F55 A;  2XKP A;  1JKO C;  3BLY A;  1QVT A;  2JWT A;  1R58 A;  3CDH A;  2VQC A;  3C2B A;  4BYY A;  3OYF A;  3K70 C;  2HOS A;  5K5Q A;  2VQH A;  2FA5 A;  1GVJ A;  4OU0 A;  2KIM A;  3TO7 A;  4HNT A;  1XTA A;  2VXZ A;  4UV8 A;  2DFH A;  2YS9 A;  5AON A;  2CUJ A;  4RGR A;  1TWG J;  4V2F A;  3L2Q A;  2PMU A;  3HG9 A;  4EV0 A;  2Y9Y A;  2RQQ A;  3GWZ A;  1F43 A;  2DA5 A;  5CQE A;  1Z67 A;  2FML A;  3RPU A;  2DMP A;  2KIF A;  4LIV A;  4C2M J;  2HYG D;  1ACI A;  3KX2 A;  4D5F A;  2CUE A;  3L2R A;  2FUG 2;  2Y30 A;  2PN6 A;  2ZSH B;  1WGX A;  2CSO A;  4BQO A;  3JSP A;  1H0M A;  4P9U A;  2M7A A;  4GXO A;  4L0Z B;  1NHA A;  4CYD A;  4IHX A;  1CQT A;  3QU3 A;  4BJ6 C;  1G2H A;  1EV7 A;  3I0T A;  4RLF A;  2AHQ A;  5JI6 A;  1LB2 A;  1RC9 A;  3UNG C;  5D8L B;  3DEE A;  1YJN I;  2LC2 A;  3BR0 A;  2DT5 A;  2P8T A;  1ZKG A;  5H2F C;  1IXC A;  3I53 A;  2M34 A;  3CCY A;  2ZJ2 A;  4RGS A;  1XDS A;  4A3F J;  2LP0 A;  4HV6 A;  2PMZ A;  1AKH A;  4HV5 A;  5TJJ A;  2HEO A;  4BU2 A;  1JT0 A;  4NNJ A;  3CCR I;  2H8R A;  1JXS A;  4I6Z A;  4ZYD A;  2QQA A;  3CZ6 A;  2KPM A;  3E5U A;  2HYJ A;  3OV8 A;  3GTG J;  3QRF F;  3F6V A;  2FRH A;  4KMU X;  5IY5 H;  3RQ4 A;  2HVQ A;  2Z3Y A;  3GLL A;  5GTI C;  4YG2 F;  3KCC A;  4EJO A;  2XRL A;  3G3Z A;  2F4M B;  1T38 A;  2W00 A;  4NDL A;  1HKS A;  1KU3 A;  2L7M P;  1VQP I;  3RCO A;  1YJW I;  2IAI A;  2BGC A;  4AC0 A;  1DDN A;  1KGS A;  3GFI A;  5E79 C;  2W57 A;  5EDN A;  1JKR C;  2VXD A;  4IHT A;  4CGZ A;  5HS9 A;  4IHV A;  3C7J A;  3JRC A;  3BR1 A;  1BI1 A;  4NQW A;  3L2V A;  3ZN0 A;  5EEA A;  3C1D A;  2M45 A;  3JRE A;  4BHP A;  3DLL F;  1A6Q A;  1W7P D;  3IC7 A;  2DTR A;  1BJZ A;  4DGW B;  3KP3 A;  5FKM A;  3HPH A;  3U1K A;  1IC8 A;  3EYI A;  1IO2 A;  4EMS A;  1FJL A;  1SFU A;  4PGH A;  2WB1 A;  1XGO A;  2LRD A;  2XAH A;  3PNV A;  4ZDP A;  3ZMZ A;  3HHG A;  4M3G A;  2GXB A;  3SDG A;  4CA0 A;  1YW9 A;  2R7U A;  3FKI J;  5DCF A;  1VQ5 I;  2CQK A;  2ZXH A;  4A3G J;  4XID A;  5KK1 A;  3G71 I;  2MGQ A;  3GTQ J;  5E3M A;  1YQA A;  2E71 A;  1YI2 I;  2VKE A;  2MAB A;  1FZP B;  1NK2 P;  3U2R A;  2QKL B;  4ENM A;  2IA0 A;  2XUB A;  4A69 C;  4I2O A;  1DP3 A;  5KAF C;  3B73 A;  3K9T A;  2HXI A;  3R61 A;  1JKP C;  1W0U A;  2OCC H;  2JA8 J;  2D2W A;  5M5W J;  2QSF X;  3B6A A;  4XOR A;  3I59 A;  4KT5 C;  2GM4 A;  2FQ3 A;  5GAG J;  2FOK A;  3CUQ B;  1LEA A;  3VYT B;  3F3X A;  3M8E A;  2BVL A;  2YSR A;  2MH2 A;  2NVQ J;  3ONQ A;  3DLA A;  4BHB A;  2GA2 A;  1G6N A;  4ZH4 F;  2UUZ A;  3G4S I;  3CF5 F;  1MMG A;  2O61 A;  2X6X A;  2ZME A;  3Q9S A;  4M71 A;  1RKT A;  2XGE A;  2NAZ A;  4RGX A;  1X3W B;  2CW8 A;  2ZXJ A;  3M7G A;  3QPL A;  1TTY A;  4A3I J;  1VI0 A;  3MAJ A;  1BI3 A;  3S1R J;  3ABU A;  5BS6 A;  3HM5 A;  4IKF A;  2IS4 A;  4E7S A;  1LDD A;  3MVP A;  3OYK A;  1W36 D;  3H5A A;  4RMN A;  5DCM B;  3FHZ A;  2DA7 A;  4GRI A;  4L9N A;  4LK0 F;  4KFC A;  2FD5 A;  5E8G A;  4B09 A;  2GOM A;  1ETX A;  2L2O A;  3DQV C;  1HOM A;  3P5J A;  4EJT A;  4U88 A;  2QZ8 A;  1TNT A;  3HRS A;  1MH4 A;  4G9Y A;  1V4R A;  5EYR A;  2HI3 A;  2YX7 A;  2O8X A;  3H92 A;  1EA3 A;  1PP8 F;  3IKV A;  3R0J A;  1P9Q C;  2BEO A;  2VI6 A;  2ZFW A;  3OL4 A;  3GZ5 A;  5FKL A;  1A35 A;  4IQJ A;  1A31 A;  5IT3 A;  1FP2 A;  3JRD A;  3ASN H;  1Z7U A;  1KYW A;  2OA4 A;  3J80 Z;  2L9R A;  1P7I A;  1T33 A;  4O5V A;  3ERM A;  4XQF A;  4CH7 A;  3TOB A;  1XG1 A;  2VJ4 A;  2DMN A;  1MJA A;  2LD5 A;  3BR6 A;  4UV9 A;  3TDU C;  2ECC A;  5EZH A;  5F64 A;  2AQE A;  4IRG A;  3KZI C;  3ZCO A;  1KQ8 A;  2LOO A;  5EG0 B;  3PUF A;  4A3C J;  2LRE A;  4E7J A;  3D0S A;  1TL8 A;  4V19 K;  1FOX A;  2E1O A;  1DU6 A;  2DK8 A;  5FKO A;  3HKZ N;  3I9V 2;  5DM6 F;  2GQQ A;  3M3Y J;  4IX7 A;  1UMQ A;  1U5T C;  3QPH A;  4ZYA A;  5JR3 A;  3L9F A;  2OV7 A;  1I27 A;  1TLH B;  3OIQ A;  4MFE A;  5H20 A;  2STW A;  1B6A A;  1ZTR A;  2ECB A;  4NC6 A;  3KP7 A;  3FIW A;  1OCO H;  3A1Y A;  4UHT A;  1D8K A;  1ETY A;  5ED4 A;  1V55 H;  4RAF A;  2CRG A;  2VAS A;  2MW8 A;  4NHJ A;  5CPR B;  2I10 A;  3S2D J;  1IRG A;  4LK1 F;  4KNY A;  1WJD A;  3F8F A;  2EPF A;  2EZH A;  4UUV A;  4IOC F;  2WY7 Q;  5FRN A;  1SFE A;  2Y69 H;  1CF7 B;  1QNT A;  4BUP A;  1UHW A;  1K78 B;  2XRO A;  4CCJ A;  2DDB A;  2AO9 A;  2DQR A;  3RIR A;  4AUX A;  5DUI A;  2X6O A;  4BEH A;  1W36 C;  1G8X A;  1N75 A;  2VJ5 A;  3PNT A;  3O8G A;  5L3B A;  5E3O A;  1P4X A;  4XKC A;  4LIU A;  2L7K A;  4D7N A;  2R7R A;  2HQR A;  4N0B A;  1FYK A;  4IHS A;  2ID3 A;  2JSP A;  5F6F A;  4UNO A;  3AL0 C;  4PCQ A;  1TW2 A;  1QZE A;  1QZZ A;  4KIS A;  3M8F A;  3KP6 A;  3A2K A;  3M1C A;  4BNC A;  1R7J A;  3NQO A;  1T0F A;  3T1B A;  2DMU A;  4WK8 F;  2L3D A;  1ITY A;  1SVL A;  2PMH A;  3F22 A;  2LG4 A;  1FMV A;  3O6B B;  3BG3 A;  3DBL B;  2JUG A;  3KYD B;  2VBX A;  2IGN A;  2DOD A;  2PMZ N;  2UXX A;  1Z6T A;  3R60 A;  1I1S A;  2HTS A;  4J00 A;  2NS8 A;  3WGI A;  1ZHF A;  2IXS A;  3ABM H;  2XPW A;  4A0Y A;  2YR2 A;  3ZGK A;  2ZNY A;  2RDP A;  4LG0 A;  2K9N A;  4M9S A;  5LLQ A;  1ON1 A;  2D1H A;  2K27 A;  3KE2 A;  3B02 A;  3BJ6 A;  3H3U A;  1FTT A;  4Y7N J;  5D4R A;  4D7M A;  1S29 A;  2ZKZ A;  4EM2 A;  1IXS B;  1GVD A;  1MNE A;  3L7W A;  1EH8 A;  4N9I A;  3A01 B;  2DFE A;  3D5R C;  2E7W A;  2HS5 A;  4XIC A;  1MIJ A;  1UG2 A;  4OIR F;  3OMY A;  2ZBK A;  2LR8 A;  1T95 A;  2R7S A;  4DOZ A;  2GZW A;  1WJF A;  2F2E A;  4BAY A;  4R1H A;  3SFZ A;  1Z9C A;  3BTL A;  1SVM A;  5D5W B;  2HR3 A;  3Q0W A;  3WTW C;  3HOS A;  1HQC A;  5EEG A;  3CLQ A;  2CH0 A;  5KCM A;  2BYV E;  3KFW X;  4HDV A;  1PVE A;  3A4C A;  1U9O A;  5EJC A;  2M9H A;  3CMM A;  4P1W A;  4BY7 J;  2R7T A;  4OOI A;  1IDZ A;  2PLY A;  2IJL A;  4C30 A;  1W5S A;  4BAC A;  1PUE E;  1T98 A;  3CP8 A;  4XOP A;  2LKX A;  2HGC A;  5L3C A;  2VIX A;  3DU5 A;  5K1Y A;  1NK3 P;  1F9N A;  4YII A;  2DFF A;  2K9L A;  1Z0X A;  3ZQH A;  1LVK A;  3F8C A;  3Q0V A;  3QPS A;  5C4X J;  1LJ9 A;  2IGK A;  4AYB A;  1JGG A;  1ZYR F;  2XKO A;  4LLL A;  5IT9 K;  2HWV A;  2VC1 A;  5ERI A;  4HEA 2;  4N9H A;  1GV2 A;  3PQJ A;  1OR7 A;  1ZN2 A;  3ML6 A;  2WV1 A;  5K7Z A;  5CVU A;  4N4O B;  3EUH A;  5J1U A;  4U0W A;  1Z77 A;  2RC4 A;  1G3T A;  3VOD A;  2M3A A;  1FMW A;  2XIG A;  2R3S A;  5B1A H;  3JRB A;  4MHG A;  5ICF A;  5HDK A;  5L3F A;  1L0O C;  1Z1D A;  2UXN A;  1K7A A;  3VYR B;  4G7O F;  2JVG A;  3FM5 A;  4HX8 A;  1DUX C;  3J80 K;  4E6K G;  2HTJ A;  3BTJ A;  4B3A A;  2GOX B;  3K2Z A;  2LBF B;  4NUB A;  1WRJ A;  1A6I A;  5FD6 A;  3HHH A;  3CME I;  3E7L A;  2PJP A;  2HNH A;  1YHQ I;  2ZNZ A;  2QCO A;  2VKV A;  4UVB A;  1D0X A;  4KDP A;  4XN0 A;  4U7D A;  1R1V A;  1B8I B;  1IXR C;  2TDX A;  2QA4 I;  3K4J A;  4GYI A;  5KVR A;  4U87 A;  4I99 C;  1S5L C;  3LWF A;  2QM3 A;  4H0E A;  4A3E J;  5D6F A;  3J7Y J;  3DWL E;  3LA7 A;  3M9A A;  3TL4 X;  1KYZ A;  3F6O A;  2IGO A;  2WA0 A;  5E20 A;  1QU3 A;  2EFO A;  1DGR M;  3FM3 A;  5CVR A;  5HDG A;  3K10 A;  3LAJ A;  5LHH A;  3PQK A;  2QSH X;  1ODD A;  2V9K A;  1WKM A;  3ZQG A;  5J1Y A;  2OJE D;  3MEX A;  3WTT C;  2VLA A;  1QA6 A;  2HVR A;  1FPQ A;  2ME6 A;  5HOO A;  3FDY A;  2E36 A;  3J81 K;  1LKX A;  2R92 J;  3N05 A;  2XAF A;  3KLO A;  5TIS C;  4XLF A;  2DI3 A;  2ELH A;  5D8K B;  1VZ0 A;  1X3Z B;  3GLX A;  1OYI A;  3WTS C;  1VQ9 I;  2R7Q A;  2EWN A;  3E97 A;  1B72 A;  2J5P A;  3SDB A;  3REO A;  2Y75 A;  4PK4 A;  4F93 B;  3E0J B;  4HG2 A;  4CYC B;  2P5K A;  4CCK A;  2GA1 A;  1X1B A;  1IF1 A;  2DA3 A;  4YFN F;  1TQI A;  3K4M A;  3BCA A;  2X48 A;  3FF5 A;  4FX0 A;  2V4J C;  3MFK A;  4HA8 A;  2OF7 A;  1B4A A;  3AG2 H;  1OCZ H;  2LDU A;  2XAG A;  4B4C A;  5EGO A;  2EZI A;  3M8J A;  1Y8Q B;  1X2M A;  1XB4 A;  3H36 A;  1AU7 A;  5EF6 A;  1YIJ I;  4BY1 J;  4WXD A;  1WJ5 A;  1ETO A;  4GCV A;  1ETV A;  5DD8 A;  5B66 C;  1MJ9 A;  4MO7 A;  1P2F A;  1R6R A;  3WU2 C;  4OIN F;  3MZY A;  3ZMS A;  1ZR4 A;  3PNY A;  3A0B C;  2W48 A;  2R7Z J;  3OR2 C;  3IRR A;  1LFP A;  4YEL A;  5E3N A;  1QVU A;  1SC7 A;  1QRY A;  3J7A Y;  4NBQ A;  1J59 A;  3CDI A;  1YS6 A;  2CW0 F;  1VND A;  3GEZ A;  1S8N A;  3OYG A;  3IHU A;  1JKQ C;  4EAT A;  1HKQ A;  2JVH A;  4UVA A;  2B63 J;  1SD5 A;  2ISY A;  3KP5 A;  3FMS A;  2QBY B;  1FBS A;  4EM0 B;  4KIF A;  4NC8 A;  5FLX Z;  2V9P A;  1TWF J;  4MQ9 F;  5HNF A;  3TBI A;  3MKY B;  1CGP A;  1TNS A;  1I3Q J;  4BXX J;  3CCL I;  4XBF A;  3FMQ A;  1VQN I;  4OIP F;  3GTM J;  2CJJ A;  2JK3 A;  2ZME C;  4LLG F;  1G3Y A;  2AXT C;  1BM9 A;  3HEF A;  1ZH5 A;  1D5V A;  1FOK A;  5B1B H;  4IJA A;  5GAD J;  2CMP A;  3BZC A;  3CCM I;  1MBJ A;  2ID6 A;  4XON A;  2BW3 B;  4F52 A;  4Y17 A;  1JUM A;  3JRH A;  2XSJ C;  2Z1D A;  3DEW A;  4BQA A;  3H5N A;  3E6D A;  1XGM A;  5B5E C;  3K1P A;  1ULY A;  1FC3 A;  3ZQC A;  2DDA A;  2IS6 A;  2KJB A;  1XSV A;  2RNJ A;  2XB0 X;  4KJZ A;  1MDM A;  4FIS A;  2CYY A;  3ZMD A;  3H5R A;  1U9N A;  1NG7 A;  3BWG A;  2XDV A;  4W97 A;  5IOZ A;  5E17 F;  2BBY A;  2GAU A;  2X51 A;  2MA3 A;  1K61 A;  2XAQ A;  3AKZ A;  3HYI A;  3GVA A;  3CF2 A;  4PFO A;  1TP4 A;  2W4S A;  3PJR A;  2DW4 A;  1FBQ A;  3ECH A;  2R7D A;  3QP5 A;  2IS2 A;  4KYW A;  2VT2 A;  4OAY A;  4S0H B;  3FXK A;  3BZK A;  3HPG A;  3HGY A;  2F4I A;  2PJR A;  3ZN1 A;  2LKS A;  3OYM A;  1FLI A;  2KZG A;  4FQG A;  1Q1H A;  4C3I J;  3H35 A;  1RNL A;  5IP6 A;  3C2G A;  3HC7 A;  3MKL A;  5ILU A;  5D4S A;  2DOA A;  3AAF A;  2HXO A;  1BR1 A;  2QF7 A;  1P92 A;  2G9W A;  5K7H A;  3CP2 A;  4Y3O A;  5J1R A;  2WTE A;  2A6E F;  2X4H A;  5LHI A;  3RZO J;  4CYC A;  5FO5 A;  2DT7 B;  2NNY A;  1DGW Y;  5K5R A;  3NRV A;  3H0G J;  2KRH A;  1R5H A;  4BXF A;  2ACJ A;  2JPB A;  2MLK A;  1OIS A;  3V4G A;  2DN0 A;  4K2E A;  2MD0 A;  4WF2 A;  2QEX I;  1HA8 A;  1RUN A;  1MBG A;  2FU4 A;  3V42 A;  3BQZ A;  3I4P A;  2LFB A; 
#chains in the Genus database with same CATH homology
 1ETX A;  4JP0 A;  1HOM A;  3LSG A;  5IP7 J;  1MH4 A;  2DMT A;  5EYR A;  2HI3 A;  4XRS A;  1LFB A;  2OPT A;  1IG7 A;  4D5C A;  2DA6 A;  5DS9 A;  2DA2 A;  2VI6 A;  3HGG A;  2WAQ N;  4G12 A;  5FKL A;  1ENH A;  5FKK A;  1S7E A;  3JRD A;  1K83 J;  1D5Y A;  2E2J J;  1TC3 C;  3BR5 A;  1QPI A;  2L9R A;  1P7I A;  1T33 A;  5IPA A;  4X6A J;  1HDD C;  1ETW A;  3S1M J;  1XG1 A;  1WI3 A;  2DMN A;  1B72 B;  5IYC J;  1IRZ A;  2R93 J;  3HOU J;  2DA4 A;  2JN6 A;  3BR6 A;  4XRM A;  4B1R A;  2ECC A;  2LD5 A;  5EZH A;  3RZD J;  4IHY A;  4A3L J;  3BTI A;  3WHC A;  1P7J A;  2NS7 A;  3G1M A;  5EG0 B;  4A3C J;  1JTX A;  2E1O A;  2E2H J;  1PUF A;  1WH7 A;  1IDY A;  1DU6 A;  5EGO B;  5FKO A;  3HKZ N;  1OFC X;  3W6V A;  3M3Y J;  1WPK A;  1UMQ A;  1AKH B;  1B8I A;  4MFE A;  9ANT A;  1IJW C;  1EF4 A;  1ZTR A;  2ECB A;  3FIW A;  2CUF A;  1FEX A;  3NAU A;  3LOC A;  3I4M J;  3HB9 A;  2LVS A;  4UUT A;  3MN2 A;  3OOU A;  5EZG A;  1VF9 A;  1ETY A;  2Y0S N;  1JT6 A;  1A5J A;  2CRG A;  2MW8 A;  3JRI A;  3S2D J;  2I10 A;  1MNM C;  1I6H J;  2DJN A;  2R0Q C;  4JYK A;  1R9T J;  1Y1V J;  3B6C A;  1APL C;  2E2I J;  1ZR2 A;  5FJ8 J;  2EZH A;  2XB5 A;  2NVX J;  3IV5 A;  3CMY A;  4JX5 A;  3A03 A;  3VPR A;  2AO9 A;  3LNQ A;  5M3F J;  4DYR A;  4AUX A;  2X6O A;  4LOC A;  3O8G A;  5E3O A;  1LE8 B;  2DMQ A;  2N8G A;  5M3M J;  3WHB A;  4D7N A;  3I4N J;  3GTK J;  2ID3 A;  3O8H A;  5GP9 A;  1XS9 A;  1GUU A;  2R5Y B;  5F0H A;  1ETK A;  2HQ5 A;  3PO2 J;  4QSH A;  1HCR A;  2YU9 J;  3S1Q J;  2LK2 A;  4MFD A;  2DMU A;  2EZK A;  2NVY J;  1ITY A;  2JA7 J;  1U8B A;  1XC5 A;  1ORK A;  3BG3 A;  2CQQ A;  2O7O A;  2PMZ N;  1RES A;  3IH4 A;  1IGN A;  2NS8 A;  3M4O J;  5F08 A;  5M5X J;  2ELK A;  2XPW A;  3K2A A;  2K9S A;  2K9N A;  3BTC A;  3HOX J;  2JMW A;  3FIS A;  1MH3 A;  1POG A;  3GTJ J;  3GTO J;  1FIP A;  2HDD A;  2EH3 A;  2O8K A;  1FTT A;  4Y7N J;  4D7M A;  4RBO A;  2D5V A;  4AYB N;  3CDL A;  1GVD A;  1TWC J;  3A01 B;  5FLM J;  2EBI A;  4UUS B;  2EQR A;  1VFC A;  4XIC A;  4A3M J;  1UG2 A;  2LR8 A;  3IH3 A;  4A93 J;  2Y2Z A;  2GLO A;  1IUF A;  5DTD A;  2COB A;  3GBG A;  1TWH J;  5F1J A;  3BTL A;  4C3J J;  1JJ6 C;  2TRT A;  3GTL J;  1U78 A;  5M5Y J;  2HOA A;  2CQX A;  3Q0W A;  1RR7 A;  3RQI A;  3K7A J;  2L0K A;  2NVT J;  3CQZ J;  2R5Z B;  3TW7 A;  2GBY A;  2NOG A;  3HOW J;  4DYQ A;  3OSG A;  4EEF G;  1U9O A;  2M9H A;  1MSF C;  4BY7 J;  3FK6 A;  3DCF A;  1IDZ A;  2M8G X;  1UHS A;  3GTP J;  3ZQL A;  3JR9 A;  2YUS A;  3TW6 A;  2LKX A;  4DZP A;  3S16 J;  4A3J J;  2X9D A;  3A02 A;  1NK3 P;  2FQ4 A;  1Z0X A;  3ZQH A;  3Q0V A;  3QPS A;  5C4X J;  3HOY J;  4C3H J;  3D1N I;  1Y1W J;  5HOD A;  2DA1 A;  1JGG A;  3BT9 A;  3JRG A;  2P81 A;  1MBH A;  3F0C A;  3Q3S A;  4HNV A;  3TP3 A;  5IOY A;  3HOZ J;  4MIM A;  2LTP A;  3S1N J;  1GV2 A;  1ZK8 A;  5FKN A;  1BA5 A;  2WV1 A;  5K7Z A;  3BR2 A;  3TP0 A;  5J1U A;  2XPU A;  1JJ8 C;  2ZB9 A;  3JRF A;  4A3K J;  1Z77 A;  1RET A;  2XPV A;  5C44 J;  3JRB A;  1W0T A;  1Q1V A;  5F04 A;  1OCT C;  2JA6 J;  2G0E A;  2XSD C;  1I50 J;  2FJ1 A;  3BTJ A;  4B3A A;  2MSY A;  4M3E A;  3FK7 A;  1A6I A;  1HDP A;  1PUF B;  1MBK A;  1WCM J;  3E7L A;  4FTH A;  3QQA A;  4J19 A;  3S15 J;  2QCO A;  2VKV A;  4FE7 A;  1FIA A;  1B8I B;  4M3B A;  1YRN A;  1IV6 A;  2VPR A;  3LSJ A;  2VUM J;  2H1K A;  5IYD J;  5C3E J;  4A3E J;  4JX4 A;  2RAE A;  3G1L A;  2K40 A;  1JKO C;  1TWA J;  1QVT A;  2JWT A;  4I76 A;  2LY9 A;  2K9Q A;  1ETQ A;  2ME0 A;  3C2B A;  4A3B J;  5E3L A;  3ZQF A;  3ZQG A;  5BNG A;  2O9L A;  4QTR A;  2Y9Z A;  2HOS A;  5F0C A;  5J1Y A;  1H8A C;  2YS9 A;  2ME6 A;  1OJL A;  3BG9 A;  5F0F A;  1TWG J;  4V2F A;  4FCY A;  4BBS J;  2Y9Y A;  2JA5 J;  2KT0 A;  1X58 A;  1F43 A;  2EZL A;  5GPC A;  3L1P A;  2DA5 A;  2R92 J;  2MG4 A;  3UKG A;  2DMP A;  4M3F A;  4C2M J;  1WH5 A;  4D5F A;  1BW6 A;  2CUE A;  2Y30 A;  1WGX A;  2LLK A;  1B72 A;  1X2N A;  4IHX A;  4QIW N;  4CYC B;  1CQT A;  1H88 C;  1G2H A;  2JJ7 A;  2AHQ A;  3TED A;  1RKW A;  2DA3 A;  5EG0 A;  5F27 A;  2X48 A;  1RPW A;  3BR0 A;  3NAR A;  1ZKG A;  2OF7 A;  4B4C A;  5EGO A;  3SJM A;  2EZI A;  2E19 A;  2M34 A;  3CCY A;  1X2M A;  4MLO A;  1AU7 A;  4BY1 J;  5EF6 A;  4A3F J;  2LP0 A;  3H3V K;  5IP9 J;  1AKH A;  1JT0 A;  1ETO A;  4RDU A;  1ETV A;  3ZOB A;  4X1E A;  3OSF A;  2H8R A;  4MO7 A;  4I6Z A;  2XGD A;  2WB1 N;  1SFO J;  5JLX A;  4JX6 A;  1ZR4 A;  3LSP A;  1FTZ A;  1HF0 A;  2HYJ A;  2W48 A;  5K7F A;  2R7Z J;  3GTG J;  5E3N A;  1QVU A;  1QRY A;  2TCT A;  3JRA A;  1MBE A;  1VND A;  3ZQI A;  4M3D A;  1JKQ C;  2L7F P;  2XRL A;  1ZGW A;  1LFU P;  2B63 J;  4NDL A;  2L7M P;  1BW5 A;  2IAI A;  1GDT A;  4AC0 A;  1TWF J;  1DU0 A;  4W1U A;  1I3Q J;  4BXX J;  4XK4 A;  1AHD P;  5EDN A;  1JKR C;  3GTM J;  2CJJ A;  2JK3 A;  4IHV A;  1E3O C;  3JRC A;  5FLV A;  3BR1 A;  3HEF A;  2M2E A;  5EEA A;  3LSR A;  3JRE A;  3Q0U A;  4M6V A;  1GT0 C;  1OCP A;  1LE8 A;  1BJZ A;  1MBJ A;  4DZJ A;  4Y52 J;  5FKM A;  2ID6 A;  1IC8 A;  2HOT A;  1JUM A;  1FJL A;  4IEJ A;  3JRH A;  4BKX A;  1HLV A;  3S14 J;  3DEW A;  2R5Y A;  3S2H J;  1JTY A;  4M3G A;  3SDG A;  3ZQC A;  3BG5 A;  1BL0 A;  2XB0 X;  3FKI J;  3PM1 A;  5JLW A;  4FIS A;  4DYC A;  1U9N A;  4XID A;  4A3G J;  1MBF A;  4W97 A;  5IOZ A;  2MGQ A;  3GTQ J;  5E3M A;  3PO3 J;  1MSE C;  2VKE A;  1ZQ3 P;  1NK2 P;  2M0C A;  4ABZ A;  1O4X A;  1K61 A;  4A69 C;  1T56 A;  2HXI A;  1JKP C;  1W0U A;  2IBD A;  2JA8 J;  3OIO A;  5M5W J;  3B6A A;  4DW6 A;  3G1O A;  2GM4 A;  1NTC A;  4S0H B;  5J3L A;  3HGY A;  4FE4 A;  4BBR J;  1SAN A;  3S17 J;  3BQY A;  4GFB A;  3SFI A;  1JUP A;  2NVQ J;  4C3I J;  3A01 A;  5IP6 A;  3MKL A;  4UUS A;  2HXO A;  1GV5 A;  3IH2 A;  2QF7 A;  2IEK A;  2CU7 A;  5C4J J;  5K7H A;  5J1R A;  3RZO J;  2XGC A;  3HBL A;  2Y31 A;  4V2G A;  4CYC A;  3RKQ A;  1RKT A;  2XGE A;  5GPA A;  5IYB J;  4XRS G;  2FX0 A;  2KDZ A;  4IHW A;  3QPL A;  1YRN B;  4A3D J;  4A3I J;  1JUS A;  2R5Z A;  1VI0 A;  3S1R J;  3H0G J;  3HM5 A;  3HOV J;  1H89 C;  3MVP A;  2DN0 A;  2L7Z A;  4L5E A;  1MBG A;  2DA7 A;  3HDD A;  2DTZ A;  3BQZ A;  2FD5 A;  2LFB A;  3BR3 A;  1F36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...