1XC5A

Solution structure of the smrt deacetylase activation domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
NGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription corepressor
molecule keywords Nuclear receptor corepressor 2
publication title Structural insights into the interaction and activation of histone deacetylase 3 by nuclear receptor corepressors
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xc5A01
3B6CA 1NK3P 1HCRA 2RAEA 4BY1J 1F36A 2L7MP 3O8HA 1Q1VA 2HXOA 3W6VA 3FIWA 2ME0A 3GTMJ 5F27A 2EQRA 1PUFA 3HOYJ 2K9QA 3Q0WA 5E3OA 2IEKA 4UUSB 1B8IB 2MGQA 4FE7A 3VPRA 5FLVA 3BR1A 1NK2P 1IRZA 3OSFA 1CQTA 3S17J 2LY9A 3H0GJ 1ORKA 5J1RA 2KDZA 4IEJA 1FIPA 1UG2A 2XPUA 4B3AA 1K61A 3IH3A 1ZR4A 1A5JA 4HNVA 1AHDP 1RR7A 2XGDA 3HGYA 2NVXJ 2H8RA 3JRFA 2AO9A 5IOYA 2DJNA 2XGEA 1OCPA 3G1OA 1MNMC 1FEXA 3PO3J 5FKOA 2R7ZJ 3WHBA 2D5VA 3IV5A 4A3BJ 2EH3A 4FISA 3IH4A 4DYCA 1LE8A 2CQXA 2NVYJ 2GM4A 1LFUP 1MH3A 5JLWA 2EBIA 5DTDA 3HGGA 2DMTA 3A02A 1X58A 5EGOA 2CJJA 1POGA 1NTCA 5FJ8J 1B72A 1TWFJ 1GDTA 2H1KA 3LNQA 1OJLA 5IP6A 2ME6A 4V2GA 1HLVA 4DW6A 3C2BA 2JN6A 2NS7A 3TP0A 2Y9ZA 2JA5J 1HOMA 4D7MA 5IOZA 5M5YJ 2AHQA 3LSJA 1JUMA 1PUFB 3LSRA 2NS8A 4A3EJ 3TEDA 2Y31A 3BG3A 4M3GA 1H8AC 4B1RA 2PMZN 5IPAA 1I50J 2COBA 3BR3A 2B63J 3LSGA 3G1MA 2LFBA 5K7HA 1ETWA 2YUSA 1MBGA 1W0UA 3DCFA 3Q3SA 2DMQA 4QSHA 1LFBA 2E1OA 1T33A 1XG1A 1TC3C 2GLOA 2NVTJ 3BQZA 2MG4A 2QCOA 3G1LA 3BG9A 3S2DJ 4DZJA 2HOTA 3QPSA 3GTGJ 2MW8A 4A3JJ 4MFEA 5J1UA 5E3MA 4A93J 3A01A 4C3JJ 4DZPA 1AKHB 2VKEA 2GBYA 2Y9YA 3TW7A 4A3LJ 4JX6A 3CQZJ 1IC8A 2JA7J 2R5ZA 1GV5A 1JJ6C 5F08A 2VI6A 3RZDJ 4RDUA 1QVTA 1JGGA 4BBRJ 3I4MJ 2ECBA 2N8GA 2FX0A 2TRTA 1Z77A 3BR0A 5C44J 4CYCB 1P7IA 1ENHA 4A3MJ 1R9TJ 2WAQN 1WH7A 1JKPC 3JRAA 4AC0A 1BA5A 5C4JJ 1EF4A 4M3FA 1JKQC 4A3GJ 2VKVA 2XB0X 2ECCA 2DTZA 2M9HA 5C4XJ 1XC5A 2FJ1A 2JK3A 5M3FJ 2IBDA 3LOCA 4B4CA 2VUMJ 1UMQA 1RKTA 4DYRA 3FK6A 4A3IJ 1GUUA 3MVPA 3BTJA 3SFIA 2LVSA 5M3MJ 2O9LA 2DA2A 3HOVJ 2EZLA 3L1PA 3NARA 3QQAA 2FD5A 2WB1N 3HOWJ 2JJ7A 2TCTA 1YRNA 1FTZA 4MO7A 3OSGA 2R5YA 2FQ4A 5JLXA 5GPAA 3CCYA 2E2JJ 4MFDA 4D5FA 2DN0A 4XICA 2X9DA 3PM1A 4Y52J 4UUTA 3BTLA 1G2HA 3HB9A 4X1EA 2JA8J 2XRLA 5J3LA 4C2MJ 2XSDC 1JUSA 2XB5A 3ZQLA 1VI0A 3BT9A 5EG0A 2MSYA 2EZKA 5M5WJ 1WGXA 4L5EA 2XPWA 1HDPA 2E19A 3S1RJ 3PO2J 1TWCJ 4GFBA 3MN2A 1IJWC 2Y30A 3HDDA 2HYJA 1AU7A 4AUXA 2K40A 2CUEA 4QIWN 1MH4A 2QF7A 3FKIJ 5F04A 3HOXJ 2HXIA 2M34A 3S1MJ 1MBKA 1ZK8A 1BJZA 4DYQA 3BQYA 3S16J 4A3KJ 3S2HJ 2LR8A 3GTLJ 1O4XA 4BXXJ 1XS9A 4C3HJ 3JRDA 3M3YJ 1K83J 5K7ZA 3GTQJ 1A6IA 2LLKA 3S14J 5E3NA 2CU7A 4V2FA 1GT0C 1APLC 3A03A 3JRHA 2EZIA 2LD5A 1IDZA 4LOCA 3ZQHA 4W97A 3HM5A 1B8IA 4IHXA 1OFCX 3JRCA 1MBJA 1RETA 4Y7NJ 3HKZN 4I6ZA 2LK2A 3LSPA 1YRNB 1U78A 3K2AA 3S1QJ 2YS9A 5IYBJ 2R93J 2HOAA 1JKOC 1IV6A 3S1NJ 1RKWA 3JRIA 3HOZJ 4XIDA 1ZGWA 1JKRC 1H89C 5IP7J 1LE8B 2ELKA 1E3OC 2Y0SN 1ETKA 1BL0A 2EZHA 1RPWA 2L9RA 5EGOB 5M5XJ 5EG0B 1B72B 2JWTA 4M3BA 2DA4A 2ID3A 3NAUA 2HI3A 3K7AJ 1IUFA 3ZQCA 1ZKGA 1ZQ3P 1I6HJ 3JRBA 1ZR2A 3FISA 1ETVA 4JYKA 3BG5A 4XRSA 4FTHA 1FIAA 1WH5A 3BR6A 3HBLA 5EYRA 5BNGA 2G0EA 1VF9A 2O8KA 3Q0VA 3Q0UA 2HDDA 4X6AJ 2M0CA 2VPRA 3ZQGA 1SFOJ 1WCMJ 3CDLA 1TWGJ 4XK4A 1QVUA 1P7JA 2K9NA 3BTIA 4I76A 2M2EA 2L7ZA 3CMYA 4D7NA 1JUPA 1ZTRA 2ID6A 5EF6A 1JTYA 4IHWA 5F0FA 2M8GX 5EZHA 4M6VA 3B6AA 1Z0XA 4J19A 5DS9A 4A69C 1MBEA 2LP0A 3DEWA 2LKXA 2E2IJ 3A01B 1TWAJ 3I4NJ 5C3EJ 1DU6A 1ETOA 3ZQIA 1JTXA 3RQIA 3QPLA 1ETYA 1H88C 3GTOJ 1T56A 1FJLA 1GV2A 5FKLA 1ITYA 2L7FP 4FE4A 1JT0A 5E3LA 2P81A 1U9NA 4A3FJ 1SANA 2R5ZB 2KT0A 2NVQJ 1VFCA 3GTJJ 2DMPA 2X48A 3S15J 1D5YA 2OF7A 2DA6A 1VNDA 2E2HJ 3FK7A 1Y1WJ 4NDLA 4IHYA 2NOGA 2X6OA 2Y2ZA 3RZOJ 5IYDJ 1AKHA 1F43A 2DA5A 4XRMA 3SJMA 1OCTC 2K9SA 1DU0A 1MBFA 4W1UA 5FKNA 5F0CA 2OPTA 5GP9A 5K7FA 2R92J 1X2MA 2L0KA 2O7OA 1HF0A 4CYCA 5IYCJ 3JRGA 3TW6A 2R0QC 3RKQA 3H3VK 3M4OJ 1ETQA 3SDGA 1X2NA 1U8BA 5IP9J 4G12A 1S7EA 4QTRA 2XGCA 2LTPA 3MKLA 3BTCA 1BW5A 1I3QJ 1WI3A 4UUSA 4D5CA 2DA3A 1TWHJ 4A3DJ 3JREA 2WV1A 3IH2A 1QPIA 3BR5A 4M3DA 5GPCA 2R5YB 3F0CA 2I10A 2YU9J 3GTKJ 4S0HB 1GVDA 5F1JA 4RBOA 2HQ5A 5F0HA 5FLMJ 3OOUA 1FTTA 9ANTA 1RESA 5EDNA 4FCYA 4C3IJ 2JA6J 1WPKA 3O8GA 1QRYA 1IG7A 2DA7A 4MIMA 4XRSG 4AYBN 5J1YA 2CQQA 2XPVA 3TP3A 3ZOBA 4ABZA 2DA1A 1IDYA 4M3EA 2JMWA 1W0TA 1MBHA 4JP0A 4JX4A 2IAIA 3WHCA 1MSEC 3BR2A 2HOSA 3UKGA 1JJ8C 3ZQFA 1JT6A 2DMNA 3OIOA 2ZB9A 1Y1VJ 5EEAA 1HDDC 2CRGA 4MLOA 5HODA 2CUFA 4BBSJ 2DMUA 3D1NI 3HOUJ 4A3CJ 3GBGA 1BW6A 3HEFA 4JX5A 3JR9A 2W48A 4IHVA 3E7LA 5FKMA 5FKKA 1IGNA 4BY7J 1ETXA 1MSFC 1UHSA 5EZGA 4EEFG 1U9OA 3GTPJ 4BKXA
chains in the Genus database with same CATH superfamily
5CVRA 3SQNA 1NK3P 5D5UB 2L7MP 1AOYA 3HOTA 1D0YA 3DBRB 3L09A 2VE9A 5D8LB 2BW3B 5D4RA 5J8FA 3L2CA 2H27A 5JHUA 3CCEI 3W6VA 1VQ7I 5F27A 1PP7U 3HRSA 2K9QA 2DOAA 1SC7A 3KPHA 3VFZA 4IHSA 3HG9A 4CICA 2FEZA 2F4IA 1YFHA 2JSPA 2RQPA 2IGMA 1L3LA 2XAQA 1FIPA 3BZ6A 2MD0A 2X0LA 1K61A 2X6YA 3IH3A 2P6SA 5BPDA 1ZR4A 1S7OA 1UFMA 1AHDP 4NQWA 2F4MB 1KGSA 2VE8A 2H8RA 3JRFA 3L2RA 3BOQA 1MZBA 4G6TB 2PJRA 2DJNA 2XGEA 1OCPA 3T8RA 5HDNA 1XMKA 3GX4X 2IS4A 1SD6A 1UG0A 4XR6A 2EA4A 1TBXA 5FKOA 4DBRA 5IT9Z 3BDDA 2R7ZJ 1YS6A 3KZYA 3IV5A 2JQ7A 2M0MA 5HLHA 2W85A 2A69F 3DF8A 2O0YA 4FISA 4WF2A 2P4WA 2HPMA 4DYCA 3LAPA 2NVYJ 2GM4A 1TNSA 3K6GA 2L7KA 2XVCA 1MH3A 4A0XA 3CZ6A 2CQKA 4AYBA 2JZYA 3I59A 3W3CA 4N4NB 1POGA 2A5YB 2DW4A 1B72A 1IN7A 2VC0A 4ITVA 4HBLA 1HSTA 2GXBA 3BCAA 4V2GA 4CCOA 1T0FA 2H94A 3C2BA 3GWZA 4XKVA 2Y9ZA 1Z21A 1HOMA 3E1SA 5IOZA 5M5YJ 3J7ZI 2ZMEA 2E7XA 2IXSA 3OYJA 1PUFB 2Y31A 1ZH5A 1V54H 3ZMDA 3BG3A 4K2EA 3AG2H 1HKSA 3ZR8X 2AS5F 3AG1H 3I71A 3MKZA 4IKFA 2MFZA 4LIUA 1I50J 3MCZA 3BR3A 2W24A 2JVGA 3G1MA 1MNDA 3PNVA 1SFKA 5D5XB 2KMUA 3TDZC 1MBGA 2X1DA 3Q3SA 3D5SC 4QSHA 3OL3A 4II3A 1MMNA 1LVKA 1TC3C 3OL4A 1I1GA 3BWGA 1IW7F 4RAGA 4HV5A 3J81Z 4E7IA 2P6TA 2V9PA 2HOTA 4BE0A 1FMVA 3QPSA 1H9GA 3KP6A 3SEQA 3KLOA 2E35A 2OCCH 2FMYA 4MEXF 2BY1A 3FDYA 3QRFF 5CYVA 3NEUA 1OYYA 1AKHB 2V1DA 3TW7A 5ICEA 3AL0B 1I27A 4LG0A 3TO9A 5LRRA 2R5ZA 1EH8A 1HW2A 1GV5A 1EJ9A 4RDUA 1OLTA 4KITB 4LLNA 4IQ4A 3T5XA 4PDKA 2RDPA 1FZPB 1Z1DA 1RRJA 2KQRA 3QWLA 3IWZA 4OIPF 3BR0A 4AU7A 3WTWC 2ETHA 1Z3XA 5DCFA 2LY1A 2CYYA 5FB2A 3JRAA 2A68F 5F6FA 1CF7B 2PX9A 4M3FA 1E3HA 3BJOA 2AXLA 1SAUA 2XB0X 2DTZA 2EFWA 2M9HA 3R61A 1XC5A 1ZYRF 2OTLI 1A04A 1DPRA 3BJAA 2KFDA 2HTSA 3ABKH 3LOCA 1UMQA 3HSEA 3CP8A 1RKTA 1VQ4I 4EJTA 3FK6A 4MEYF 2X51A 5JVTA 1UCRA 3D5RC 3MVPA 2DI3A 2MLKA 1BI2A 3SFIA 5IT9K 2LVSA 2OU2A 4F3QA 2HKXA 1EH7A 3MZ8A 1STZA 2FNPA 3QQAA 3HUGA 3HOWJ 3ISPA 4IO9F 2TCTA 3EUAA 4BNCA 1IN6A 3HTSB 4D9JA 3HIFA 2XHKA 4EJVA 3OSGA 1BOBA 4XOTA 2ZSIB 1GXPA 1ODDA 3E0JB 3FBIB 1D1CA 2Y0MA 3M07A 1R5HA 3NWSA 1R6RA 1WI9A 2X9DA 3PM1A 2JPBA 4UUTA 4X1EA 2JA8J 4OIRF 3OYDA 1N78A 3LFUA 1B9MA 2LF8A 2X4HA 2FBIA 3ZQLA 5LEKA 1ZLJA 5DCMA 1SD4A 2HOEA 1UAAA 2JUGA 2MSYA 2EZKA 4M73A 4IVNA 3M8FA 2P7VB 3REOA 1WGXA 3QPHA 4JOMA 3D5LA 4JQFA 3FHNA 4WXHA 4RAYA 3PO2J 2NRAC 1TWCJ 1VQOI 2Z3YA 3E6CC 1YTYA 2HYJA 4L0ZB 4AUXA 2K40A 5LHIA 3WU1B 2QF7A 3FKIJ 1YE9A 5F04A 4L5IA 2BXZA 2HXIA 1MBKA 1P6RA 3LFKA 5FRMA 1BJZA 3IC7A 3K1MA 3K4CA 3F21A 3GTLJ 2EINH 4HQMA 1WSUA 3E6BA 3JRDA 1J75A 1MMAA 1HXDA 3CDIA 3AKZA 3J81K 2QA4I 1LB2A 2A61A 3GTQJ 1QZYA 1FOKA 2ZNZA 2BW3A 1Z91A 4KA4A 3S14J 2XV4S 3TMOA 4XKWA 1OCCH 1XDSA 2LBFB 1APLC 2QEXI 2M30A 2V7FA 5GAEJ 4W97A 4IHXA 1FY7A 3GFLA 2MBFA 1WRJA 3JRCA 1S9HA 1EV7A 1IO2A 4GRIA 4L5JA 2CW8A 4Y7NJ 1QHHD 2DLLA 4I6ZA 4XKBA 2R7WA 4KT5C 3K2AA 2A5WA 2YS9A 2P8TA 3JTHA 2DOFA 4EJWA 5DV5A 3E3VA 5FFZA 3ONQA 4XIDA 3I3LA 4PJLA 5D4SA 2FA5A 3GEZA 5IP7J 1T39A 1BC7C 1E3OC 1ETKA 2WB1A 3V8JA 5LGNA 2DXIA 3LQRA 1TW2A 1QZZA 4ENJA 3A0BC 2O03A 3I58A 1IRFA 5GAGJ 2Y69H 2NXNB 3E6DA 5E1WA 5K5QA 4F52A 3N4MA 2K5CA 2Z1DA 3BJ6A 2DT6A 2VJ4A 2KZVA 4LK0F 1R36A 1I6HJ 3GW2A 3F9KA 2UWMA 4BXFA 1ZR2A 3U1KA 2CS3A 3BG5A 4FTHA 3PNYA 3BR6A 5EYRA 2KIQA 3CC2I 5BNGA 2DCEA 3F8CA 4HPQA 4AIDA 1LVAA 2IW5A 2RNGA 2X85A 2FRHA 4RB0A 1F9NA 2L5QA 4NB5A 4G94A 3ZQGA 3CDLA 1QVUA 5HS7A 4WK8F 3ABMH 2K9NA 2P7CB 4PJ0C 4LK1F 2DOEA 1FP1D 2XKOA 4IRGA 5AIPA 4KDPA 1DGWY 5EF6A 3R4KA 4UVAA 2HQRA 2HKOA 5E17F 3B6AA 4LGWA 4IXAA 2DDAA 2P5VA 1UJ8A 2P0WA 3RSNA 5DS9A 3LSIA 4A69C 3PSIA 2ISZA 3RPUA 1KU9A 2X6WA 1YJ9I 2LKXA 3A01B 3G73A 1HBXG 2R7TA 4EV0A 3L00A 2KP6A 3N05A 5HDKA 1ZN2A 3QPLA 3FXRA 4R79A 1ITYA 1XSXA 2ELHA 5LBQA 3BLYA 5D6EA 5D5WB 4OMZA 2KT0A 2WAEA 4Q4ZF 4RGSA 3EQLF 2HZTA 3VYTB 4II2A 2OF7A 4KN4X 4U7DA 1N25A 4HF2A 3CDHA 3FXMA 2V6EA 3NWTA 1AKHA 1QPMA 2L3DA 5HOOA 3WE3A 4XRMA 3ZPLA 1OCTC 5ILSA 4ZJZA 1VQ9I 3MWMA 3DTIA 4IHTA 4PGGA 4ESJA 3DXJF 4Y33A 4CUGA 1J5YA 1B9NA 4YELA 1MKMA 4FHTA 2R92J 5F0CA 5FLXZ 3SXYA 4B43A 2QSFX 4S04A 3T0YA 2GOXB 2L0KA 2VPLA 4RMNA 1X4OA 1R58A 5IYCJ 3JRGA 3TW6A 3ZMSA 3RKQA 2QM3A 5E8IA 1ETQA 4ENNA 1YX5A 1S7EA 2H6BA 3G6EI 1LDJA 1XCBA 4UUSA 1WI3A 3HYIA 1Y8RB 2O8XA 2QQBA 3BZKA 3MQ0A 3P5JA 3CP2A 5DUKA 1XGOA 4PZJA 4BHCA 1X1AA 2GAUA 2DA3A 2NS0A 2V9KA 3MZYA 1R4NB 3IH2A 3R0JA 3BR5A 5DM6F 2E60A 4XLCA 3F0CA 4XLNF 1P9QC 1RIOH 5TGTA 1IN8A 2BEOA 3QYFA 2HQ5A 4RBOA 1GHCA 4EJUA 1XSVA 4N9HA 4R1HA 3ZGKA 4FCYA 2STTA 4C3IJ 1QRYA 6PAXA 5J1YA 3JAMZ 3OYGA 2PG4A 3KEYA 1GXQA 2RGVA 5FD5A 4ABZA 1BBYA 4EM1A 4I2OA 4LJZF 2UUZA 1XX5A 1MJBA 2L54A 3WHCA 2JTVA 3K1NA 2HGCA 2IP2A 1JT6A 2KIFA 1BI3A 2CFOA 3AG3H 2LF7A 5HODA 1CGPA 4CGZA 3HSFA 3WG9A 3L2QA 1IZ1A 4A3CJ 3KP5A 3KP3A 3BPXA 3HEFA 3KX2A 4IHVA 3E7LA 3FWEA 3RKWA 1IGNA 2IGOA 4KN7X 2BV6A 2DO7A 2DT5A 1H9TA 1L0OC 4BKXA 3QP5A 4XRFA 1HCRA 4BHPA 1F36A 3S3MA 4PJNA 1Q1VA 2HXOA 3FIWA 2LRDA 1VQKI 1KQ0A 4Q47A 3TKYA 1SD7A 1FX7A 1U2WA 1JI8A 3HOYJ 5A2QZ 2M45A 3BZCA 2IA2A 4LLGF 1FOXA 3CUOA 3ECOA 3BR1A 2ADUA 4YG2F 3MKWB 2Q2EB 2KLOA 4XOPA 1ACIA 3DEUA 2M4KA 2LKPA 2MC3A 2R7SA 3S17J 4BQNA 4DOZA 3KLNA 2V1NA 2LBFA 3ABTA 4P9FA 3LAJA 2VC1A 1WJEA 2XPUA 4L0YB 4FX0A 3V4GA 3C2GA 1USSA 1A5JA 2XGDA 3JTGA 4XLEA 4CA0A 3I56I 3A1YA 4PSWA 4B3XA 1OYWA 2VASA 3KE2A 2QYOA 2VJJA 1Q1HA 2F5DA 4Z6YA 5TRDA 5FLXK 1WJFA 2EH3A 1JHFA 2FNAA 2M8EA 2E1CA 1G6NA 3GXOA 2CQXA 1S72I 1F4KA 4CZCA 5JLWA 3FXUA 2DFIA 4M9SA 1Y39A 1FBUA 2LOOA 1NTCA 3W6JB 3DKXA 4WXDA 2F5FA 1FMWA 1LEAA 3LNQA 2ELJA 4YFKF 2A6HF 1LNWA 4P9UA 5IP6A 1HLVA 2IS1A 4DW6A 4WCGA 2IA1A 2JN6A 5JHFA 4A0YA 4D7MA 5GADJ 2AHQA 3SZTA 1JUMA 4MQ9F 4F91B 2Q8KA 2BGCA 4A3EJ 2IS6A 1BC8C 5LEJA 4BEHB 2VB6A 2R7XA 2QENA 1TQPA 4NHJA 4HNUA 3IKVA 1VQPI 4PK4A 2V9VA 2COBA 2B63J 2HPIA 4ZH4F 4A5NA 4N0BA 2HS5A 2PJPA 3DLAA 2R4GA 2YUSA 5HNHA 4BE1A 4G7HF 1MMSA 1SFXA 3F6OA 1A35A 2X6XA 4G7OF 2KRCA 3VWBA 1FT9A 1LFBA 3GZ6A 1PJRA 3FF5A 4PFOA 4HSRA 3EYIA 2NVTJ 3BQZA 2MG4A 3G1LA 4KICA 3S2DJ 1EKEA 2VBZA 2O61A 2KZGA 4A3JJ 1G3SA 1W5CC 4M9XA 3I54A 5E3MA 4DIQA 3A01A 4C3JJ 4A93J 4YFNF 4XNFA 2LNBA 1QQIA 3DLLF 2QSHX 4OIOF 3IP4B 3OS0A 3DP7A 5B1BH 1W5SA 4M74A 4N4OB 3WGGA 2Y9YA 4YEJA 4DNCA 4A3LJ 2XAHA 3KP7A 3CCVI 4A2UA 3PJRA 3M8EA 5K5RA 1JJ6C 5F08A 2VI6A 5A2QK 1QVTA 1JGGA 4BBRJ 2E5NA 4D0PA 4RA2A 4RM3A 1V5GA 4CCNA 1P92A 2XF6A 2TRTA 1Z77A 1FYMA 1P7IA 3EUKL 3H0DA 3CMEI 3RYRA 2WAQN 3TL4X 3OMYA 5C4JJ 4U0WA 2O5RA 5C4XJ 1Z7LA 2A6TA 3IKTA 2JK3A 5M3FJ 1IUYA 2FF4A 3D0SA 1O3TA 4J00A 4HLYA 3CMMA 3CLOA 2VOPA 3DPLC 5CKTA 1MIJA 4CSWA 3E5QA 4RGXA 1GUUA 3ZP5A 2CUZA 1MDMB 5M3MJ 5CVJA 3FXQA 3WG7H 2DA2A 3X2QH 3SHFA 3E5XA 3VDXA 4EQQA 3H9GA 2HDWA 5L3FA 1W7PB 2FD5A 3CC4I 4BAYA 2NAZA 5J47A 1W1WE 1YRNA 2RV8A 2AQEA 2WBMA 4AIKA 1HKQA 2FOWA 2XASA 3J7YJ 2EA2A 3CCYA 3DKWA 4P55A 3K2ZA 1NH3A 4AIHA 3UR3C 3ZMUA 1D0XA 4Y52J 5DEQA 1ON2A 2FMLA 5LFAA 1G2HA 1MD0A 1RR8C 3J7AO 1R49A 2XRLA 1W4MA 4C2MJ 2XSDC 3ZMVA 2HVRA 2E7WA 2CGPA 2R7UA 3SZPA 2F2EA 1JUSA 1YJNI 3BT9A 2D1VA 2DBBA 5EG0A 1ZGAA 3UNGC 4EMSA 2CW7A 1WQ2A 2OJED 1D5VA 2F5EA 5KHDA 4C2TA 2BVLA 4XMYA 3ZN0A 4IZZA 1V5EA 3MN2A 2Y30A 4C30A 3HDDA 5D6FA 3W2AA 3DV8A 4IX7A 1TT5B 3OWTA 1Z7UA 1MH4A 2CWEA 2A05A 5E20A 3S1MJ 1O7FA 4DYQA 3PQKA 3S16J 4A3KJ 2I8DA 2LR8A 3ROUA 4BXXJ 1RI7A 4NNJA 1J0RA 1DDNA 3A0HC 4HOBA 4E7SA 2UZKA 4KISA 1KQ9A 1FC3A 2GA2A 4V2FA 3TDUC 1VQNI 3JRHA 2OC6A 1IDZA 2LD5A 4LOCA 1D1BA 2E5ZA 3HPGA 1X1CA 5D8KB 2RQQA 4I0AA 2Q2EA 1RETA 2G7UA 3GCMA 3HKZN 1Z9CA 3LSPA 3ZQ7A 1RUOA 4L9NA 3S1QJ 2V1XA 3HC7A 5IYBJ 2HOAA 1JKOC 3CF5F 4IL6C 4MTEA 4RB2C 3JRIA 2KKOA 1E3PA 4JBAA 3U21A 2QQ9A 3OYBA 1LE8B 2EIMH 2Y0SN 3RPUD 1LDDA 2K4BA 2W7NA 2OD5A 2D2WA 3I64A 3ZRGA 4HNTA 3H5NA 1VQMI 1X1BA 4HDVA 1RPWA 2L9NA 1R5GA 2QBYB 5M5XJ 2BZTA 1X19A 2OQRA 2UXNA 3NAUA 2HI3A 1IUFA 2HR3A 3ZQCA 1ZKGA 3GLXA 1Y6IA 2EWNA 1T98A 1BIBA 2LKSA 4I7HA 4XRSA 4RLQA 2GZWA 3O6BB 3E6MA 3LA3A 3OYAA 2G0EA 1VF9A 2O8KA 1A6QA 1SMTA 4ZYEA 2GA1A 1AWCA 1SFOJ 1WCMJ 1B6AA 1TWGJ 4BQQA 2EFPA 3LMMA 3WGHA 3S32A 2E36A 2OQGA 3BTIA 4LG3A 2ZSHB 4E7KA 2L7ZA 3CMYA 4A6EA 2ZFWA 1Y8QB 4CZZA 2MA3A 3F8NA 3TQNA 2M8GX 4M6VA 2F5CA 3K4JA 1R23A 2EFOA 3LSHA 5E8GA 2MYSA 4ZTJA 1S6LA 2F4OB 5ICFA 2ZXIA 3BY6A 1J7KA 2LP0A 2XAUA 3DEWA 2PFBA 4G7ZF 1HW1A 2PLYA 1X4PA 2P5KA 3FM3A 3I4NJ 2KJBA 1ETOA 2K85A 2OAZA 3EYYA 3OR2C 1H88C 1K78B 3GTOJ 4ZDOA 2O6GE 1FJLA 3LSKA 2G7HA 1F1ZA 2L7FP 3GF2A 3K4BA 4ESBA 1JT0A 2P81A 4A3FJ 1VQ5I 1SANA 4RM2A 2A3SA 2NVQJ 4UB6C 1G3YA 1WKMA 2DMPA 1OCOH 1NHAA 1ZELA 1D5YA 2PMHA 2KIMA 3CESA 2NOGA 2XC7A 1E0EA 2MC4A 2Q1ZB 2DA5A 4F7ZA 2KPMA 4M71A 3ZMZA 4Q48A 2JVHA 3HRTA 1FSHA 2I5UA 4DQ2A 2WY7Q 2DPDA 3FM5A 5GP9A 5TISC 3OS2A 2WAFA 1X2MA 5KAIC 1V5FA 4KUMA 3H5AA 4ENMA 5FD6A 4CH7A 3PUBA 3M4OJ 1XMAA 1X2NA 3C2HA 3HZJA 2EV0A 5LHHA 5IP9J 4G12A 3WTSC 2VQGA 4HX4A 2FUG2 4QTRA 2YX4A 2K4JA 3BTCA 1Z6RA 2E34A 1BI0A 2GXAA 3LA7A 3S93A 2R7FA 2ZO4A 1UHMA 4KT6A 4A3DJ 3ABLH 1W36C 2IJLA 3LQQA 3EPZA 1R5ID 4ZC3A 2ZJRF 5GPCA 3E97A 3CCRI 1UZCA 4Y4RA 3OYCA 2I10A 1ZREA 4E4HA 3PIOF 3OS1A 5DUIA 4M6YA 5F1JA 1MDMA 1FTTA 3HHHA 3AFHA 2JT1A 1BI1A 5EDNA 1JGSA 2F6CA 2JA6J 1WPKA 2DA7A 2XPVA 4XBFA 4G8XA 2XROA 4I99C 1PUEE 1KQ8A 4XQFA 4RAZA 4ZYGA 3HSRA 4M3EA 4BJ6C 2JMWA 1FYLA 3CCLI 1MBHA 4JP0A 4JX4A 2NVUB 3DU5A 4E7HA 1MSEC 1B59A 3BR2A 4E7ZA 2V79A 2HOSA 3Q5FA 2ZC2A 4I01A 3OIOA 3WTTC 4CCLA 1ONVA 2IPQX 4BDYA 1N77A 1S8NA 2RREA 2ZMEC 3LSTA 4YIRX 4HW0A 2OCEA 4L9VA 4HA8A 2CQ7A 2GIZA 1MW7A 5FKMA 2XAJA 2ZXHA 1X1DA 2OZ6A 2QKLB 4EEFG 2B7EA 3CCSI 2EILH 4J01A 1LFPA 4BJTA 4GDFA 3B6CA 2V4JC 4KNYA 2RAEA 4BY1J 2MH2A 4XN0A 1IXSB 2WY8Q 4RB3C 2EQRA 1PUFA 4PFPA 1TNTA 1TQIA 1B8IB 2MGQA 4FE7A 2MD5A 2BE5F 5FLVA 3BCBA 1MMGA 5E1ZB 2KJCA 2F48A 1NK2P 1IRZA 3CJQB 1XTAA 1UB9A 3OSFA 1CQTA 5JR3A 2WC2A 4ETSA 4OIQF 1ORKA 1ERDA 2H09A 3GUDA 4TV7A 5J1RA 1BR2A 4IEJA 4PJMA 3QP6A 3DBLB 5FFXA 3WTVC 3BG7A 3L2UA 2YR2A 4B3AA 2LYCA 4LMYA 1BIAA 2E1NA 1ZG5A 1ZRCA 2BXYA 1IRXA 4KJZA 3K1PA 4OU0A 5H6QA 2W00A 1RR7A 2EFQA 4Y13A 4IJAA 2MABA 3R60A 2FSWA 2AO9A 1T08B 5IOYA 4HV6A 1KU2A 4FETA 1PP8F 3G1OA 3U9GA 3RYPA 2MH9A 3J80K 1QA6A 5LGUA 4PJJA 3GZ5A 2D5VA 2CQNA 4A3BJ 3N97A 2KISA 5TJJA 3FMQA 3IH4A 2VN2A 5LGTA 1ZAOA 1LE8A 3W2VA 4ZYHA 3C1DA 4A6DA 4IRIA 3LSMA 3FZVA 1XD7A 2EBIA 5DTDA 3HGGA 1X58A 4NBQA 3CJRB 3GMEA 1FNNA 3K4MA 2QBYA 1SVOA 2ZNYA 3P9IA 4D1QA 2ZJPF 1GDTA 3HTUA 5HVQC 5ILUA 5D5VB 2H1KA 1LDKB 4U0YA 2VBXA 1IF1A 4E6KG 2HTJA 1KYZA 1CF7A 2M7BA 2NS7A 1VZ0A 2AXTC 3TP0A 4HAMA 4E7JA 2JA5J 1OR7C 2XDVA 4IF4A 1BN5A 2NS8A 5HNFA 2CV1A 4UUVA 1H8AC 3VODA 2PMZN 2QSGX 5IPAA 2DJIA 1XSDA 1U3EM 2M7AA 1IV8A 1KONA 2LY2A 4B44A 2LFBA 5K7HA 2ICWG 4BGDA 4AWXB 3BP8A 3WTXC 1W0UA 2DMQA 4ANJA 2E1OA 1T33A 5H2FC 2R7VA 3ML6A 2GLOA 1ZG1A 2GIVA 4ZZDA 2BBYA 4XLHA 2R7OA 3FXJA 4DZJA 5JVGF 1LKXA 2F5VA 1G3WA 2MW8A 4MFEA 4EM2A 5DDGA 5CQGA 1Z6TA 5AONA 4DZPA 4HG2A 1SEUA 4XSXF 2K9LA 2EK5A 4ZDPA 1K78A 3MKYB 3VYUB 4ESFA 2WWYA 1LQ1A 2L9SA 1RZ4A 2E71A 2IVMA 4JX6A 3CLQA 3CQZJ 1I39A 5LLQA 1HQCA 1BR4A 2K9MA 2JA7J 2M3AA 3GFMA 3L9FA 2QUFA 4G6QA 3JSOA 3H1CA 3RZDJ 4AM3A 3I59B 4U87A 4HF0A 3WTYC 1TTYA 2ECBA 2ZBKA 3CJTB 2M87A 5C44J 4CYCB 2VLAA 1B1BA 1R9TJ 2V6CA 1WH7A 4AC0A 1BA5A 5KAFC 3KYDB 2QVOA 3A4CA 2EFNA 1W36D 2LSOA 3ZN1A 2ECCA 2ZMEB 2JSCA 1FBSA 4EJOA 5J4YA 2H1LA 2QZ8A 2IBDA 3SFZA 4ENKA 2EIKH 1XPXA 2VUMJ 1FLIA 4DYRA 3KEQA 1IN5A 3CMAI 3M1EA 1DP7P 3HOVJ 2EZLA 3L1PA 3H3ZA 3NARA 2IGKA 1QBJA 4ZTFA 5HLGA 5B66C 2JJ7A 2P5LC 2ISYA 3DQVC 1FTZA 4EGYA 5HS9A 4HDUA 4LITA 4MO7A 5E18F 1D8JA 2QQ8A 1U6GA 2DQLA 3KP2A 4HEA2 3COAC 5JLXA 1O3QA 1OKRA 2E2JJ 3HRMA 2W82A 1TL8A 4HSTA 3DU6A 2DN0A 4XICA 2XSJC 3TO7A 3RKYA 3BTLA 2DK5A 4I0BA 4RS8A 1IN4A 3HB9A 4XSZF 5E79C 3QODA 3TGNA 4HF1A 5J3LA 2W25A 2OTJI 3F8FA 3M8JA 1N75A 5J4VA 1FOWA 3ZQQA 4HX7A 1ZGJA 3F22A 2ZJQF 3H9JA 2VL8A 5M5WJ 1C0WA 2K02A 4IRHA 5IY5H 4N9IA 2HQAA 2R7DA 3PUFA 3V7CA 1D1AA 3RI4A 3LL7A 2VKHA 4B47A 4BXUA 4GFBA 1IJWC 2PBIA 2DPUA 3G2BA 2CUEA 2XKPA 3KYLA 1HC8A 4QIWN 1R00A 1XGMA 5J40A 2A6EF 4DGWB 1YW7A 1B4AA 2CO5A 5F64A 1ZRFA 1K6OA 4CCKA 3S2HJ 3R0AA 4C3HJ 3M3YJ 1VTNC 1K83J 3B02A 1S29A 4UVCA 1T8IA 5K7ZA 2QKMB 2WAQA 1AA7A 5J8CA 3WTUC 5E3NA 2D1HA 2CU7A 2R7RA 3A03A 2EZIA 2M4GA 2WADA 1BOAA 3ZQHA 4B48A 2BY2A 1B8IA 4CDGA 1WJ5A 4KIBA 1DPUA 3RTRA 1YLFA 1RC9A 2OA4A 4KIFA 1KYWA 2LK2A 4RLFA 1YS7A 3QOEA 4RB1A 5KVRA 5DYMA 2XAGA 3K4NA 2WA0A 3DKYA 4EM0B 4EVIA 5HDGA 3SZGA 1MMDA 1TP4A 1WWXA 1ZGWA 1JKRC 3VYRB 3QPTA 1YJWI 1H89C 2ELKA 4ASNA 3CCUI 3KETA 1DP3A 2CH0A 4WWCA 1Z3YA 2EZHA 2KIUA 3KEOA 5JI6A 3IUOA 1YHQI 1R71A 3SDBA 5EGOB 1R1TA 5DCMB 1V4RA 2JWTA 2RNJA 4M3BA 3TOAA 3OY9A 3JCUC 4AD9A 1D0ZA 2DA4A 2ID3A 3OYMA 4FT8A 5ERIA 4F92B 4AVPA 4G6DA 1ZQ3P 1ZLKA 1WJCA 2G9WA 4B09A 4RAFA 2DFFA 1QHGA 3BC8A 3OYNA 4M9ZA 2Z9OA 3RIRA 2FQ3A 3FISA 3CCJI 4JYKA 1FIAA 1WH5A 1U5TC 1V3FA 3HOSA 2W57A 1I6XA 3MMYB 2CG4A 3Q0UA 2HDDA 4E70A 4X6AJ 2M0CA 2WTEA 2VPRA 3CC7I 4KFCA 1YI2I 3RCOA 3VB2A 4XK4A 1OMIA 2RKHA 1P7JA 1YOVB 4Y3OA 3GVAA 4KMFA 2M2EA 2UXXA 1JUPA 1ZTRA 5EJCA 1JTYA 1WJDA 2XGXA 1I3AA 4Z2YA 5F0FA 2L01A 2FOKA 1XCVA 5EZHA 4ZYDA 4IQJA 1YO5C 1RUNA 1SFEA 3U2RA 1Z0XA 4I98B 1H0MA 2DTRA 1JXSA 2HWVA 4UXNA 5IT3A 5LRSA 3G4SI 2E2IJ 1TWAJ 5K1YA 1EH6A 2IGNA 3I4PA 2YSRA 5C3EJ 1G59A 4HZFA 2HFHA 4XONA 1FYKA 2GXGA 1P4WA 3FXOA 1K6YA 1WJBA 2W1OA 4M72A 4OAYA 4OINF 1K7AA 1IXRC 1NG7A 1U9NA 3PNTA 1OCZH 3HKZA 3C3WA 2GOMA 1VFCA 3IRRA 2HZDA 2ESHA 3GTJJ 3ZMTA 4NC6A 5CQEA 3WU0A 2DA6A 2PEXA 2OV7A 3DTKA 3OYIA 3FK7A 4IHYA 1W7PD 2HYGD 3RZOJ 1Z67A 2VODA 4YIIA 3M9AA 2BVMA 3M1CA 3AAFA 2NOJB 4XN3A 2Y0SA 4H4KC 2QQAA 1DUXC 1E2XA 4G9YA 1MBFA 5K7FA 1VQ6I 1LJ9A 5GTHC 1X3UA 2O7OA 2XIGA 4CYCA 4QLCU 3P7NA 3H3UA 3H3VK 3OIPA 3SDGA 2LG4A 1QGPA 2BY3A 2K86A 4BL0B 2LTPA 2DK8A 2RC4A 4BACA 1BW5A 5KK1A 3KZZA 2X1CA 1X3ZB 1X1PA 1ZARA 4Y17A 3HHGA 1YIJI 4D5CA 1R1VA 2L02A 1TWHJ 3JREA 2WV1A 3KYCB 1QPIA 3QYBA 1MJAA 1MJ9A 2R5YB 3RPQA 3OV8A 2HNHA 5AIQA 5CPRB 4S0HB 3CUQC 5F0HA 3OOUA 5FLMJ 9ANTA 2HEOA 3P9KA 2NYXA 1XN7A 2Z16A 4MIMA 4AYBN 1LPQA 1YITI 4GYIA 3ZOBA 4BHBA 3GYHX 2BHYA 4UY8I 2ZFUA 2TDXA 3P9CA 1W0TA 1LUJB 4XLAA 1J9IA 2IAIA 5LHGA 4HLXA 3ZQFA 3G71I 4U7BA 4L9TA 2DMNA 3E5UA 1BJAA 3ULQB 1LEBA 2ZB9A 1I1SA 1O57A 1HDDC 2CRGA 1E17A 3VSLA 2CUFA 2CW0F 4BBSJ 2OBPA 4HQEA 3C18A 3GO5A 3D1NI 1WVRA 5F1RA 3HOUJ 1R7JA 4WX9A 1BW6A 3EUHC 3HL2A 2B0LA 3TO6A 4JX5A 3C7JA 3VOEA 2CMPA 4L18B 3QAHA 5EZGA 1REPC 1R4MB 3L2WA 1U9OA 3GTPJ 2YX7A 2VXDA 1SAXA 3FMRA 3O8HA 2HDCA 1IRGA 3F23A 1PYVA 2R3SA 2VQHA 3DEEA 2ME0A 3GTMJ 3DFGA 2Z5UA 3HXLA 1U0JA 3Q0WA 2VOOA 5E3OA 2IEKA 4UUSB 2E1MB 1T2KA 3CO6C 4BEHA 3KZIC 4BDZA 3VPRA 5CLSA 1O7LA 4XLPF 1U5TB 4OWRB 3OYKA 3GFIA 3L2VA 1KA8A 1SVMA 2D45A 2LY9A 3H0GJ 3I0TA 3FXLA 1OCRH 5FROA 2Z99A 3V8KA 3MZHA 1J59A 3HPHA 5JFRA 1UG2A 4BYYA 1OISA 3ABUA 2W84A 2Z2SB 4NUBA 4WXCA 4A12A 4HNVA 1OR7A 2O3FA 3HGYA 1TQMA 2NVXJ 2XAFA 5DM7F 3H35A 4RGUA 2DYSH 1HA8A 2NNYA 1MNMC 5EEHA 2IS2A 1FEXA 2VONA 3H92A 3FKJA 3Q9SA 3PO3J 3FMSA 4KMUX 4O6JA 3WHBA 5FGMA 3WTZA 1KU7A 1SVLA 3S3NA 3OYHA 3IL2A 2COMA 1LFUP 2K7LA 2XF7A 1JE8A 1X3WB 2DMTA 1ZRDA 3I9V2 3J80Z 1UHWA 3A02A 4FX4A 4U88A 5EGOA 2CJJA 5FO5A 5FJ8J 4V19K 1TWFJ 2CUJA 1QU3A 3WGIA 3F8MA 1OJLA 2ACJA 4FASD 1OQYA 3HJEA 2ME6A 5ED4A 3PQJA 4EATA 2ZXWH 2DAOA 2BHZA 2DFEA 1USTA 5BMZA 1JHHA 3LSJA 4CHUA 4OMYA 1TT0A 3LSRA 3TEDA 1EA3A 2VBYA 4UB8C 2XF5A 3CCQI 4M3GA 4QWQA 4B1RA 3LWFA 4YFXF 2YU3A 3I5UA 2IRFG 2QWWA 1P4XA 3W2WA 1M1EB 3EDPA 3LSGA 2FE3A 3R6SA 3V7RA 3CCMI 5HLIA 2L9VA 4A0ZA 1ETWA 2GWRA 2DU9A 4I02A 3RDIA 3DCFA 3O3KA 3K70C 2DFHA 1W7PA 1XG1A 2VXZA 3H5RA 2L4MA 3I55I 5H20A 2QCOA 1YIOA 2LDUA 3V42A 4AIJA 3BG9A 1T95A 2EV6A 4BH9A 5EEGA 3F72A 3GLLA 3GTGJ 3ERED 1FBQA 5J1UA 4PSXA 3VEPA 1FSEA 1A31A 3CTAA 1T0FC 2K3PA 4U0VA 2Y48A 4P5OA 5HS8A 1YW9A 2VKEA 2GBYA 3CUQB 5B5EC 1TLHB 4XL9A 2JUCA 3PFIA 1T38A 1IC8A 4ZZLA 4Y15A 5B1AH 2JRMA 4CO8A 4UNOA 2W4SA 4PGHA 3TOBA 1MGTA 1D8KA 2BOLA 3I4MJ 2N8GA 1MNEA 1XGNA 2FX0A 2J5PA 4MQVA 1ENHA 2ZJ2A 2VT3A 4A3MJ 3FBNB 4LB5A 1JKPC 1ULYA 1D3YA 3K9TA 4S05A 1Y0NA 1GLNA 3ASNH 3CF2A 2DYRH 3F6VA 1EF4A 1JKQC 1FPQA 5DD8A 2VJ5A 2LH9A 2VKVA 4A3GJ 2VT2A 1V55H 2IA0A 2FJ1A 3KIOA 5K5OA 3T1BA 4P1WA 2B9SA 2BYVE 2M1BA 1ZHFA 4B4CA 4QPQA 2ZXJA 3MAJA 4A3IJ 2OZUA 3Q9VA 2STWA 3BTJA 2A07F 1WHUA 2FBKA 2O9LA 3J7AY 3A2KA 4C9YA 1HSJA 3DBHB 1FWZA 3FXKA 2WB1N 3OOPA 2PMZA 4NC8A 3GFJA 5L3EA 2R5YA 2LMDA 2L4AA 4ON0A 2FQ4A 5GPAA 2Z33A 3PFYA 2PN6A 4MFDA 2VIXA 1G8XA 1P4AA 3M7GA 4D5FA 4X0GA 1R1UA 5KNLA 5L3CA 2OUMA 3V8LA 4HX8A 1RNLA 2XB5A 3QOPA 1VI0A 3KCCA 4UV9A 3ZXSA 3PL8A 1KZHA 1K4TA 3F3XA 3I53A 3TBIA 3ESWB 4L5EA 1SD5A 2XPWA 3S8PA 1HDPA 2E19A 3S1RJ 2RN7A 3OR1C 3FX3A 4F93B 2DQRA 3NQOA 2KL4A 2ZCWA 2HVSA 1AU7A 1HKTA 2PMUA 2WV0A 4MTDA 3HOXJ 2M34A 2K27A 1ZK8A 2EIJH 2JA2A 1S7AA 3IAM2 5L3BA 3BQYA 4LD5A 5CVIA 1TZLA 5BQTA 3BG6A 1O4XA 1ON1A 1J2XA 3MD2A 3BPVA 2KDOA 1XS9A 1XDUA 2R7QA 3H9QA 4E7LA 1A6IA 2LLKA 4KYWA 3DTEA 1QNTA 1GT0C 2V26A 5LD2C 4UV8A 3HM5A 1OFCX 4M6XA 2KRHA 4NQWB 3DWLE 1MBJA 3EETA 3G3ZA 1Y0UA 4BU2A 2DODA 3MFKA 1U5TA 1YRNB 2FXAA 1U78A 2QGUA 2PJRB 3DPTA 3ECHA 3HRUA 2R93J 2PI0A 4GO1A 4IPAA 1IV6A 4ZDLA 4XKCA 4OAZA 1RKWA 5H6RA 3S1NJ 3HOZJ 2EB7A 3WU2C 2KHMA 1Z05A 1BL0A 2KDZA 4LLLA 4UVBA 4L9JA 5E1XA 4YIFA 1IAWA 1FOYA 4GYGA 2L9RA 1PVEA 4BUPA 4BE2A 5EG0B 1QZEA 2EV5A 1ZG3A 1B72B 2LREA 3K10A 2EPFA 5L3DA 3ELKA 1U8RA 1YYVA 4UHTA 3K0LA 3K7AJ 4XORA 3W6KB 2VBWA 3ASOH 3ZCOA 4HRIA 5KCMA 3LA2A 3JRBA 3L7WA 3S3OA 2FBHA 4JK1X 1S5LC 2Q0OA 2RVCA 4BQAA 1ETVA 2M5WA 4QPOA 3IAS2 3HBLA 4LB6B 3AG4H 5BPIA 4AVZA 3K4KA 4NC7A 5CVUA 2QLZA 2XRNA 2K3FA 5HLTA 5CVVA 3FHZA 3Q0VA 1I5ZA 1K79A 2JRTA 3K70D 2DDBA 4RGRA 4B8XA 4IOAF 1GVJA 3OYFA 4LIVA 2NNNA 1VQLI 2HVQA 4CCMA 4I76A 4Q5SF 1OYIA 4D7NA 2GQQA 3CJNA 2ID6A 2Y75A 1J09A 3F8BA 3MEXA 1XGSA 3KFWX 1F5TA 1YW8A 4IHWA 2MLGA 4LFUA 3O2PE 2H6CA 2CFXA 2HQNA 4GCVA 4J19A 2KRFA 2H8WA 5ICCA 1TW3A 3QU3A 1G4DA 4BQOA 3VSKA 3QU6A 1OPCA 4MGRA 1VQ8I 1MBEA 1Y56A 3RJPA 4HYEA 1G3TA 1DU6A 3IRQA 3ZQIA 1NG6A 1JTXA 1QO0D 2DT7B 3RQIA 1ETYA 1KU3A 1T56A 1WZ2A 1GV2A 5FKLA 4BS9A 3V7SA 4CXFA 3WE2A 2UV1A 4FE4A 4CYDA 5E3LA 3OYEA 4LG0B 4H0EA 1A36A 5BOXA 2R5ZB 3RKXA 5FRNA 1R22A 3PSFA 3CO7C 5GTIC 4O3MA 2X48A 4I09A 1FP2A 3S15J 2ESNA 1VNDA 2E2HJ 1Y1WJ 4NDLA 2X6OA 2Y2ZA 5IYDJ 1F43A 3SJMA 2CV2A 3CUQA 1WFXA 2K9SA 2IT0A 2LC2A 1YX3A 1O3RA 2FU4A 4IOCF 1UELB 1SMYF 1W5TA 1DU0A 4BJ5C 2L2OA 4W1UA 5FKNA 2OPTA 2CV0A 3JW4A 2XUBA 5GAHJ 3KP4A 1BR1A 1HF0A 3GZNB 3ERMA 3SEZA 2R0QC 4XM3A 1XB4A 1YG2A 4ZYAA 4KIGA 1U8BA 3IWFA 1T6SA 4O5VA 4P96A 5BS6A 2XGCA 3U1DA 3MKLA 2VJIA 1I3QJ 3BROA 1SFUA 2HYFA 3PIPF 1IXCA 3OYLA 1P2FA 3EUHA 3VYSB 3HUGB 2VKDA 1XMXA 3NRVA 3H36A 4XLFA 3S2WA 4C2UA 4PUSA 5ILVA 4A5MA 3JAMK 4M3DA 4MNUA 3JSPA 5J6XA 5L3GA 1O3SA 1BM9A 2BY0A 2YU9J 3GTKJ 2PQ8A 1HW5A 1GVDA 1S3JA 2JPCA 1DQUA 3IHUA 3AL0C 2C6YA 1RESA 1PDNC 3O8GA 3K69A 3K4LA 4GXOA 3QYEA 1IG7A 4DBQA 4XRSG 2CQQA 2X1EA 3TP3A 2VQLA 4PCQA 2YPRA 4F55A 2J5OA 2DA1A 1IDYA 4DJAA 5B3SH 1WJAA 2CSOA 3CD6I 4EGZA 3WODF 4MHGA 4CCJA 3SYTA 4FQGA 3B73A 3UKGA 1JJ8C 2VQCA 2EJRA 1Y1VJ 2HU9A 5EEAA 4MLOA 2AQFA 3DPUA 5CJ9A 5DD4A 2E1MC 2DMUA 5ICGA 3GBGA 1YQAA 4GGGA 2V1UA 3JR9A 1K4SA 3T8TA 2W48A 4R8HA 1DGRM 2ZKZA 5FKKA 4BY7J 1ETXA 3RQ4A 1MSFC 1UHSA 4YRVA 4OOIA 3OIQA
chains in the Genus database with same CATH topology
3B6CA 1NK3P 1HCRA 2RAEA 4BY1J 1F36A 2L7MP 3O8HA 1Q1VA 2HXOA 3W6VA 3FIWA 2ME0A 3GTMJ 5F27A 2EQRA 1PUFA 3HOYJ 2K9QA 3Q0WA 5E3OA 2IEKA 4UUSB 1B8IB 2MGQA 4FE7A 3VPRA 5FLVA 3BR1A 1NK2P 1IRZA 3OSFA 1CQTA 3S17J 2LY9A 3H0GJ 1ORKA 5J1RA 2KDZA 4IEJA 1FIPA 1UG2A 2XPUA 4B3AA 1K61A 3IH3A 1ZR4A 1A5JA 4HNVA 1AHDP 1RR7A 2XGDA 3HGYA 2NVXJ 2H8RA 3JRFA 2AO9A 5IOYA 2DJNA 2XGEA 1OCPA 3G1OA 1MNMC 1FEXA 3PO3J 5FKOA 2R7ZJ 3WHBA 2D5VA 3IV5A 4A3BJ 2EH3A 4FISA 3IH4A 4DYCA 1LE8A 2CQXA 2NVYJ 2GM4A 1LFUP 1MH3A 5JLWA 2EBIA 5DTDA 3HGGA 2DMTA 3A02A 1X58A 5EGOA 2CJJA 1POGA 1NTCA 5FJ8J 1B72A 1TWFJ 1GDTA 2H1KA 3LNQA 1OJLA 5IP6A 2ME6A 4V2GA 1HLVA 4DW6A 3C2BA 2JN6A 2NS7A 3TP0A 2Y9ZA 2JA5J 1HOMA 4D7MA 5IOZA 5M5YJ 2AHQA 3LSJA 1JUMA 1PUFB 3LSRA 2NS8A 4A3EJ 3TEDA 2Y31A 3BG3A 4M3GA 1H8AC 4B1RA 2PMZN 5IPAA 1I50J 2COBA 3BR3A 2B63J 3LSGA 3G1MA 2LFBA 5K7HA 1ETWA 2YUSA 1MBGA 1W0UA 3DCFA 3Q3SA 2DMQA 4QSHA 1LFBA 2E1OA 1T33A 1XG1A 1TC3C 2GLOA 2NVTJ 3BQZA 2MG4A 2QCOA 3G1LA 3BG9A 3S2DJ 4DZJA 2HOTA 3QPSA 3GTGJ 2MW8A 4A3JJ 4MFEA 5J1UA 5E3MA 4A93J 3A01A 4C3JJ 4DZPA 1AKHB 2VKEA 2GBYA 2Y9YA 3TW7A 4A3LJ 4JX6A 3CQZJ 1IC8A 2JA7J 2R5ZA 1GV5A 1JJ6C 5F08A 2VI6A 3RZDJ 4RDUA 1QVTA 1JGGA 4BBRJ 3I4MJ 2ECBA 2N8GA 2FX0A 2TRTA 1Z77A 3BR0A 5C44J 4CYCB 1P7IA 1ENHA 4A3MJ 1R9TJ 2WAQN 1WH7A 1JKPC 3JRAA 4AC0A 1BA5A 5C4JJ 1EF4A 4M3FA 1JKQC 4A3GJ 2VKVA 2XB0X 2ECCA 2DTZA 2M9HA 5C4XJ 1XC5A 2FJ1A 2JK3A 5M3FJ 2IBDA 3LOCA 4B4CA 2VUMJ 1UMQA 1RKTA 4DYRA 3FK6A 4A3IJ 1GUUA 3MVPA 3BTJA 3SFIA 2LVSA 5M3MJ 2O9LA 2DA2A 3HOVJ 2EZLA 3L1PA 3NARA 3QQAA 2FD5A 2WB1N 3HOWJ 2JJ7A 2TCTA 1YRNA 1FTZA 4MO7A 3OSGA 2R5YA 2FQ4A 5JLXA 5GPAA 3CCYA 2E2JJ 4MFDA 4D5FA 2DN0A 4XICA 2X9DA 3PM1A 4Y52J 4UUTA 3BTLA 1G2HA 3HB9A 4X1EA 2JA8J 2XRLA 5J3LA 4C2MJ 2XSDC 1JUSA 2XB5A 3ZQLA 1VI0A 3BT9A 5EG0A 2MSYA 2EZKA 5M5WJ 1WGXA 4L5EA 2XPWA 1HDPA 2E19A 3S1RJ 3PO2J 1TWCJ 4GFBA 3MN2A 1IJWC 2Y30A 3HDDA 2HYJA 1AU7A 4AUXA 2K40A 2CUEA 4QIWN 1MH4A 2QF7A 3FKIJ 5F04A 3HOXJ 2HXIA 2M34A 3S1MJ 1MBKA 1ZK8A 1BJZA 4DYQA 3BQYA 3S16J 4A3KJ 3S2HJ 2LR8A 3GTLJ 1O4XA 4BXXJ 1XS9A 4C3HJ 3JRDA 3M3YJ 1K83J 5K7ZA 3GTQJ 1A6IA 2LLKA 3S14J 5E3NA 2CU7A 4V2FA 1GT0C 1APLC 3A03A 3JRHA 2EZIA 2LD5A 1IDZA 4LOCA 3ZQHA 4W97A 3HM5A 1B8IA 4IHXA 1OFCX 3JRCA 1MBJA 1RETA 4Y7NJ 3HKZN 4I6ZA 2LK2A 3LSPA 1YRNB 1U78A 3K2AA 3S1QJ 2YS9A 5IYBJ 2R93J 2HOAA 1JKOC 1IV6A 3S1NJ 1RKWA 3JRIA 3HOZJ 4XIDA 1ZGWA 1JKRC 1H89C 5IP7J 1LE8B 2ELKA 1E3OC 2Y0SN 1ETKA 1BL0A 2EZHA 1RPWA 2L9RA 5EGOB 5M5XJ 5EG0B 1B72B 2JWTA 4M3BA 2DA4A 2ID3A 3NAUA 2HI3A 3K7AJ 1IUFA 3ZQCA 1ZKGA 1ZQ3P 1I6HJ 3JRBA 1ZR2A 3FISA 1ETVA 4JYKA 3BG5A 4XRSA 4FTHA 1FIAA 1WH5A 3BR6A 3HBLA 5EYRA 5BNGA 2G0EA 1VF9A 2O8KA 3Q0VA 3Q0UA 2HDDA 4X6AJ 2M0CA 2VPRA 3ZQGA 1SFOJ 1WCMJ 3CDLA 1TWGJ 4XK4A 1QVUA 1P7JA 2K9NA 3BTIA 4I76A 2M2EA 2L7ZA 3CMYA 4D7NA 1JUPA 1ZTRA 2ID6A 5EF6A 1JTYA 4IHWA 5F0FA 2M8GX 5EZHA 4M6VA 3B6AA 1Z0XA 4J19A 5DS9A 4A69C 1MBEA 2LP0A 3DEWA 2LKXA 2E2IJ 3A01B 1TWAJ 3I4NJ 5C3EJ 1DU6A 1ETOA 3ZQIA 1JTXA 3RQIA 3QPLA 1ETYA 1H88C 3GTOJ 1T56A 1FJLA 1GV2A 5FKLA 1ITYA 2L7FP 4FE4A 1JT0A 5E3LA 2P81A 1U9NA 4A3FJ 1SANA 2R5ZB 2KT0A 2NVQJ 1VFCA 3GTJJ 2DMPA 2X48A 3S15J 1D5YA 2OF7A 2DA6A 1VNDA 2E2HJ 3FK7A 1Y1WJ 4NDLA 4IHYA 2NOGA 2X6OA 2Y2ZA 3RZOJ 5IYDJ 1AKHA 1F43A 2DA5A 4XRMA 3SJMA 1OCTC 2K9SA 1DU0A 1MBFA 4W1UA 5FKNA 5F0CA 2OPTA 5GP9A 5K7FA 2R92J 1X2MA 2L0KA 2O7OA 1HF0A 4CYCA 5IYCJ 3JRGA 3TW6A 2R0QC 3RKQA 3H3VK 3M4OJ 1ETQA 3SDGA 1X2NA 1U8BA 5IP9J 4G12A 1S7EA 4QTRA 2XGCA 2LTPA 3MKLA 3BTCA 1BW5A 1I3QJ 1WI3A 4UUSA 4D5CA 2DA3A 1TWHJ 4A3DJ 3JREA 2WV1A 3IH2A 1QPIA 3BR5A 4M3DA 5GPCA 2R5YB 3F0CA 2I10A 2YU9J 3GTKJ 4S0HB 1GVDA 5F1JA 4RBOA 2HQ5A 5F0HA 5FLMJ 3OOUA 1FTTA 9ANTA 1RESA 5EDNA 4FCYA 4C3IJ 2JA6J 1WPKA 3O8GA 1QRYA 1IG7A 2DA7A 4MIMA 4XRSG 4AYBN 5J1YA 2CQQA 2XPVA 3TP3A 3ZOBA 4ABZA 2DA1A 1IDYA 4M3EA 2JMWA 1W0TA 1MBHA 4JP0A 4JX4A 2IAIA 3WHCA 1MSEC 3BR2A 2HOSA 3UKGA 1JJ8C 3ZQFA 1JT6A 2DMNA 3OIOA 2ZB9A 1Y1VJ 5EEAA 1HDDC 2CRGA 4MLOA 5HODA 2CUFA 4BBSJ 2DMUA 3D1NI 3HOUJ 4A3CJ 3GBGA 1BW6A 3HEFA 4JX5A 3JR9A 2W48A 4IHVA 3E7LA 5FKMA 5FKKA 1IGNA 4BY7J 1ETXA 1MSFC 1UHSA 5EZGA 4EEFG 1U9OA 3GTPJ 4BKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6C A;  1NK3 P;  1HCR A;  2RAE A;  4BY1 J;  1F36 A;  2L7M P;  3O8H A;  1Q1V A;  2HXO A;  3W6V A;  3FIW A;  2ME0 A;  3GTM J;  5F27 A;  2EQR A;  1PUF A;  3HOY J;  2K9Q A;  3Q0W A;  5E3O A;  2IEK A;  4UUS B;  1B8I B;  2MGQ A;  4FE7 A;  3VPR A;  5FLV A;  3BR1 A;  1NK2 P;  1IRZ A;  3OSF A;  1CQT A;  3S17 J;  2LY9 A;  3H0G J;  1ORK A;  5J1R A;  2KDZ A;  4IEJ A;  1FIP A;  1UG2 A;  2XPU A;  4B3A A;  1K61 A;  3IH3 A;  1ZR4 A;  1A5J A;  4HNV A;  1AHD P;  1RR7 A;  2XGD A;  3HGY A;  2NVX J;  2H8R A;  3JRF A;  2AO9 A;  5IOY A;  2DJN A;  2XGE A;  1OCP A;  3G1O A;  1MNM C;  1FEX A;  3PO3 J;  5FKO A;  2R7Z J;  3WHB A;  2D5V A;  3IV5 A;  4A3B J;  2EH3 A;  4FIS A;  3IH4 A;  4DYC A;  1LE8 A;  2CQX A;  2NVY J;  2GM4 A;  1LFU P;  1MH3 A;  5JLW A;  2EBI A;  5DTD A;  3HGG A;  2DMT A;  3A02 A;  1X58 A;  5EGO A;  2CJJ A;  1POG A;  1NTC A;  5FJ8 J;  1B72 A;  1TWF J;  1GDT A;  2H1K A;  3LNQ A;  1OJL A;  5IP6 A;  2ME6 A;  4V2G A;  1HLV A;  4DW6 A;  3C2B A;  2JN6 A;  2NS7 A;  3TP0 A;  2Y9Z A;  2JA5 J;  1HOM A;  4D7M A;  5IOZ A;  5M5Y J;  2AHQ A;  3LSJ A;  1JUM A;  1PUF B;  3LSR A;  2NS8 A;  4A3E J;  3TED A;  2Y31 A;  3BG3 A;  4M3G A;  1H8A C;  4B1R A;  2PMZ N;  5IPA A;  1I50 J;  2COB A;  3BR3 A;  2B63 J;  3LSG A;  3G1M A;  2LFB A;  5K7H A;  1ETW A;  2YUS A;  1MBG A;  1W0U A;  3DCF A;  3Q3S A;  2DMQ A;  4QSH A;  1LFB A;  2E1O A;  1T33 A;  1XG1 A;  1TC3 C;  2GLO A;  2NVT J;  3BQZ A;  2MG4 A;  2QCO A;  3G1L A;  3BG9 A;  3S2D J;  4DZJ A;  2HOT A;  3QPS A;  3GTG J;  2MW8 A;  4A3J J;  4MFE A;  5J1U A;  5E3M A;  4A93 J;  3A01 A;  4C3J J;  4DZP A;  1AKH B;  2VKE A;  2GBY A;  2Y9Y A;  3TW7 A;  4A3L J;  4JX6 A;  3CQZ J;  1IC8 A;  2JA7 J;  2R5Z A;  1GV5 A;  1JJ6 C;  5F08 A;  2VI6 A;  3RZD J;  4RDU A;  1QVT A;  1JGG A;  4BBR J;  3I4M J;  2ECB A;  2N8G A;  2FX0 A;  2TRT A;  1Z77 A;  3BR0 A;  5C44 J;  4CYC B;  1P7I A;  1ENH A;  4A3M J;  1R9T J;  2WAQ N;  1WH7 A;  1JKP C;  3JRA A;  4AC0 A;  1BA5 A;  5C4J J;  1EF4 A;  4M3F A;  1JKQ C;  4A3G J;  2VKV A;  2XB0 X;  2ECC A;  2DTZ A;  2M9H A;  5C4X J;  1XC5 A;  2FJ1 A;  2JK3 A;  5M3F J;  2IBD A;  3LOC A;  4B4C A;  2VUM J;  1UMQ A;  1RKT A;  4DYR A;  3FK6 A;  4A3I J;  1GUU A;  3MVP A;  3BTJ A;  3SFI A;  2LVS A;  5M3M J;  2O9L A;  2DA2 A;  3HOV J;  2EZL A;  3L1P A;  3NAR A;  3QQA A;  2FD5 A;  2WB1 N;  3HOW J;  2JJ7 A;  2TCT A;  1YRN A;  1FTZ A;  4MO7 A;  3OSG A;  2R5Y A;  2FQ4 A;  5JLX A;  5GPA A;  3CCY A;  2E2J J;  4MFD A;  4D5F A;  2DN0 A;  4XIC A;  2X9D A;  3PM1 A;  4Y52 J;  4UUT A;  3BTL A;  1G2H A;  3HB9 A;  4X1E A;  2JA8 J;  2XRL A;  5J3L A;  4C2M J;  2XSD C;  1JUS A;  2XB5 A;  3ZQL A;  1VI0 A;  3BT9 A;  5EG0 A;  2MSY A;  2EZK A;  5M5W J;  1WGX A;  4L5E A;  2XPW A;  1HDP A;  2E19 A;  3S1R J;  3PO2 J;  1TWC J;  4GFB A;  3MN2 A;  1IJW C;  2Y30 A;  3HDD A;  2HYJ A;  1AU7 A;  4AUX A;  2K40 A;  2CUE A;  4QIW N;  1MH4 A;  2QF7 A;  3FKI J;  5F04 A;  3HOX J;  2HXI A;  2M34 A;  3S1M J;  1MBK A;  1ZK8 A;  1BJZ A;  4DYQ A;  3BQY A;  3S16 J;  4A3K J;  3S2H J;  2LR8 A;  3GTL J;  1O4X A;  4BXX J;  1XS9 A;  4C3H J;  3JRD A;  3M3Y J;  1K83 J;  5K7Z A;  3GTQ J;  1A6I A;  2LLK A;  3S14 J;  5E3N A;  2CU7 A;  4V2F A;  1GT0 C;  1APL C;  3A03 A;  3JRH A;  2EZI A;  2LD5 A;  1IDZ A;  4LOC A;  3ZQH A;  4W97 A;  3HM5 A;  1B8I A;  4IHX A;  1OFC X;  3JRC A;  1MBJ A;  1RET A;  4Y7N J;  3HKZ N;  4I6Z A;  2LK2 A;  3LSP A;  1YRN B;  1U78 A;  3K2A A;  3S1Q J;  2YS9 A;  5IYB J;  2R93 J;  2HOA A;  1JKO C;  1IV6 A;  3S1N J;  1RKW A;  3JRI A;  3HOZ J;  4XID A;  1ZGW A;  1JKR C;  1H89 C;  5IP7 J;  1LE8 B;  2ELK A;  1E3O C;  2Y0S N;  1ETK A;  1BL0 A;  2EZH A;  1RPW A;  2L9R A;  5EGO B;  5M5X J;  5EG0 B;  1B72 B;  2JWT A;  4M3B A;  2DA4 A;  2ID3 A;  3NAU A;  2HI3 A;  3K7A J;  1IUF A;  3ZQC A;  1ZKG A;  1ZQ3 P;  1I6H J;  3JRB A;  1ZR2 A;  3FIS A;  1ETV A;  4JYK A;  3BG5 A;  4XRS A;  4FTH A;  1FIA A;  1WH5 A;  3BR6 A;  3HBL A;  5EYR A;  5BNG A;  2G0E A;  1VF9 A;  2O8K A;  3Q0V A;  3Q0U A;  2HDD A;  4X6A J;  2M0C A;  2VPR A;  3ZQG A;  1SFO J;  1WCM J;  3CDL A;  1TWG J;  4XK4 A;  1QVU A;  1P7J A;  2K9N A;  3BTI A;  4I76 A;  2M2E A;  2L7Z A;  3CMY A;  4D7N A;  1JUP A;  1ZTR A;  2ID6 A;  5EF6 A;  1JTY A;  4IHW A;  5F0F A;  2M8G X;  5EZH A;  4M6V A;  3B6A A;  1Z0X A;  4J19 A;  5DS9 A;  4A69 C;  1MBE A;  2LP0 A;  3DEW A;  2LKX A;  2E2I J;  3A01 B;  1TWA J;  3I4N J;  5C3E J;  1DU6 A;  1ETO A;  3ZQI A;  1JTX A;  3RQI A;  3QPL A;  1ETY A;  1H88 C;  3GTO J;  1T56 A;  1FJL A;  1GV2 A;  5FKL A;  1ITY A;  2L7F P;  4FE4 A;  1JT0 A;  5E3L A;  2P81 A;  1U9N A;  4A3F J;  1SAN A;  2R5Z B;  2KT0 A;  2NVQ J;  1VFC A;  3GTJ J;  2DMP A;  2X48 A;  3S15 J;  1D5Y A;  2OF7 A;  2DA6 A;  1VND A;  2E2H J;  3FK7 A;  1Y1W J;  4NDL A;  4IHY A;  2NOG A;  2X6O A;  2Y2Z A;  3RZO J;  5IYD J;  1AKH A;  1F43 A;  2DA5 A;  4XRM A;  3SJM A;  1OCT C;  2K9S A;  1DU0 A;  1MBF A;  4W1U A;  5FKN A;  5F0C A;  2OPT A;  5GP9 A;  5K7F A;  2R92 J;  1X2M A;  2L0K A;  2O7O A;  1HF0 A;  4CYC A;  5IYC J;  3JRG A;  3TW6 A;  2R0Q C;  3RKQ A;  3H3V K;  3M4O J;  1ETQ A;  3SDG A;  1X2N A;  1U8B A;  5IP9 J;  4G12 A;  1S7E A;  4QTR A;  2XGC A;  2LTP A;  3MKL A;  3BTC A;  1BW5 A;  1I3Q J;  1WI3 A;  4UUS A;  4D5C A;  2DA3 A;  1TWH J;  4A3D J;  3JRE A;  2WV1 A;  3IH2 A;  1QPI A;  3BR5 A;  4M3D A;  5GPC A;  2R5Y B;  3F0C A;  2I10 A;  2YU9 J;  3GTK J;  4S0H B;  1GVD A;  5F1J A;  4RBO A;  2HQ5 A;  5F0H A;  5FLM J;  3OOU A;  1FTT A;  9ANT A;  1RES A;  5EDN A;  4FCY A;  4C3I J;  2JA6 J;  1WPK A;  3O8G A;  1QRY A;  1IG7 A;  2DA7 A;  4MIM A;  4XRS G;  4AYB N;  5J1Y A;  2CQQ A;  2XPV A;  3TP3 A;  3ZOB A;  4ABZ A;  2DA1 A;  1IDY A;  4M3E A;  2JMW A;  1W0T A;  1MBH A;  4JP0 A;  4JX4 A;  2IAI A;  3WHC A;  1MSE C;  3BR2 A;  2HOS A;  3UKG A;  1JJ8 C;  3ZQF A;  1JT6 A;  2DMN A;  3OIO A;  2ZB9 A;  1Y1V J;  5EEA A;  1HDD C;  2CRG A;  4MLO A;  5HOD A;  2CUF A;  4BBS J;  2DMU A;  3D1N I;  3HOU J;  4A3C J;  3GBG A;  1BW6 A;  3HEF A;  4JX5 A;  3JR9 A;  2W48 A;  4IHV A;  3E7L A;  5FKM A;  5FKK A;  1IGN A;  4BY7 J;  1ETX A;  1MSF C;  1UHS A;  5EZG A;  4EEF G;  1U9O A;  3GTP J;  4BKX A; 
#chains in the Genus database with same CATH topology
 5CVR A;  3SQN A;  1NK3 P;  5D5U B;  2L7M P;  1AOY A;  3HOT A;  1D0Y A;  3DBR B;  3L09 A;  2VE9 A;  5D8L B;  2BW3 B;  5D4R A;  5J8F A;  3L2C A;  2H27 A;  5JHU A;  3CCE I;  3W6V A;  1VQ7 I;  5F27 A;  1PP7 U;  3HRS A;  2K9Q A;  2DOA A;  1SC7 A;  3KPH A;  3VFZ A;  4IHS A;  3HG9 A;  4CIC A;  2FEZ A;  2F4I A;  1YFH A;  2JSP A;  2RQP A;  2IGM A;  1L3L A;  2XAQ A;  1FIP A;  3BZ6 A;  2MD0 A;  2X0L A;  1K61 A;  2X6Y A;  3IH3 A;  2P6S A;  5BPD A;  1ZR4 A;  1S7O A;  1UFM A;  1AHD P;  4NQW A;  2F4M B;  1KGS A;  2VE8 A;  2H8R A;  3JRF A;  3L2R A;  3BOQ A;  1MZB A;  4G6T B;  2PJR A;  2DJN A;  2XGE A;  1OCP A;  3T8R A;  5HDN A;  1XMK A;  3GX4 X;  2IS4 A;  1SD6 A;  1UG0 A;  4XR6 A;  2EA4 A;  1TBX A;  5FKO A;  4DBR A;  5IT9 Z;  3BDD A;  2R7Z J;  1YS6 A;  3KZY A;  3IV5 A;  2JQ7 A;  2M0M A;  5HLH A;  2W85 A;  2A69 F;  3DF8 A;  2O0Y A;  4FIS A;  4WF2 A;  2P4W A;  2HPM A;  4DYC A;  3LAP A;  2NVY J;  2GM4 A;  1TNS A;  3K6G A;  2L7K A;  2XVC A;  1MH3 A;  4A0X A;  3CZ6 A;  2CQK A;  4AYB A;  2JZY A;  3I59 A;  3W3C A;  4N4N B;  1POG A;  2A5Y B;  2DW4 A;  1B72 A;  1IN7 A;  2VC0 A;  4ITV A;  4HBL A;  1HST A;  2GXB A;  3BCA A;  4V2G A;  4CCO A;  1T0F A;  2H94 A;  3C2B A;  3GWZ A;  4XKV A;  2Y9Z A;  1Z21 A;  1HOM A;  3E1S A;  5IOZ A;  5M5Y J;  3J7Z I;  2ZME A;  2E7X A;  2IXS A;  3OYJ A;  1PUF B;  2Y31 A;  1ZH5 A;  1V54 H;  3ZMD A;  3BG3 A;  4K2E A;  3AG2 H;  1HKS A;  3ZR8 X;  2AS5 F;  3AG1 H;  3I71 A;  3MKZ A;  4IKF A;  2MFZ A;  4LIU A;  1I50 J;  3MCZ A;  3BR3 A;  2W24 A;  2JVG A;  3G1M A;  1MND A;  3PNV A;  1SFK A;  5D5X B;  2KMU A;  3TDZ C;  1MBG A;  2X1D A;  3Q3S A;  3D5S C;  4QSH A;  3OL3 A;  4II3 A;  1MMN A;  1LVK A;  1TC3 C;  3OL4 A;  1I1G A;  3BWG A;  1IW7 F;  4RAG A;  4HV5 A;  3J81 Z;  4E7I A;  2P6T A;  2V9P A;  2HOT A;  4BE0 A;  1FMV A;  3QPS A;  1H9G A;  3KP6 A;  3SEQ A;  3KLO A;  2E35 A;  2OCC H;  2FMY A;  4MEX F;  2BY1 A;  3FDY A;  3QRF F;  5CYV A;  3NEU A;  1OYY A;  1AKH B;  2V1D A;  3TW7 A;  5ICE A;  3AL0 B;  1I27 A;  4LG0 A;  3TO9 A;  5LRR A;  2R5Z A;  1EH8 A;  1HW2 A;  1GV5 A;  1EJ9 A;  4RDU A;  1OLT A;  4KIT B;  4LLN A;  4IQ4 A;  3T5X A;  4PDK A;  2RDP A;  1FZP B;  1Z1D A;  1RRJ A;  2KQR A;  3QWL A;  3IWZ A;  4OIP F;  3BR0 A;  4AU7 A;  3WTW C;  2ETH A;  1Z3X A;  5DCF A;  2LY1 A;  2CYY A;  5FB2 A;  3JRA A;  2A68 F;  5F6F A;  1CF7 B;  2PX9 A;  4M3F A;  1E3H A;  3BJO A;  2AXL A;  1SAU A;  2XB0 X;  2DTZ A;  2EFW A;  2M9H A;  3R61 A;  1XC5 A;  1ZYR F;  2OTL I;  1A04 A;  1DPR A;  3BJA A;  2KFD A;  2HTS A;  3ABK H;  3LOC A;  1UMQ A;  3HSE A;  3CP8 A;  1RKT A;  1VQ4 I;  4EJT A;  3FK6 A;  4MEY F;  2X51 A;  5JVT A;  1UCR A;  3D5R C;  3MVP A;  2DI3 A;  2MLK A;  1BI2 A;  3SFI A;  5IT9 K;  2LVS A;  2OU2 A;  4F3Q A;  2HKX A;  1EH7 A;  3MZ8 A;  1STZ A;  2FNP A;  3QQA A;  3HUG A;  3HOW J;  3ISP A;  4IO9 F;  2TCT A;  3EUA A;  4BNC A;  1IN6 A;  3HTS B;  4D9J A;  3HIF A;  2XHK A;  4EJV A;  3OSG A;  1BOB A;  4XOT A;  2ZSI B;  1GXP A;  1ODD A;  3E0J B;  3FBI B;  1D1C A;  2Y0M A;  3M07 A;  1R5H A;  3NWS A;  1R6R A;  1WI9 A;  2X9D A;  3PM1 A;  2JPB A;  4UUT A;  4X1E A;  2JA8 J;  4OIR F;  3OYD A;  1N78 A;  3LFU A;  1B9M A;  2LF8 A;  2X4H A;  2FBI A;  3ZQL A;  5LEK A;  1ZLJ A;  5DCM A;  1SD4 A;  2HOE A;  1UAA A;  2JUG A;  2MSY A;  2EZK A;  4M73 A;  4IVN A;  3M8F A;  2P7V B;  3REO A;  1WGX A;  3QPH A;  4JOM A;  3D5L A;  4JQF A;  3FHN A;  4WXH A;  4RAY A;  3PO2 J;  2NRA C;  1TWC J;  1VQO I;  2Z3Y A;  3E6C C;  1YTY A;  2HYJ A;  4L0Z B;  4AUX A;  2K40 A;  5LHI A;  3WU1 B;  2QF7 A;  3FKI J;  1YE9 A;  5F04 A;  4L5I A;  2BXZ A;  2HXI A;  1MBK A;  1P6R A;  3LFK A;  5FRM A;  1BJZ A;  3IC7 A;  3K1M A;  3K4C A;  3F21 A;  3GTL J;  2EIN H;  4HQM A;  1WSU A;  3E6B A;  3JRD A;  1J75 A;  1MMA A;  1HXD A;  3CDI A;  3AKZ A;  3J81 K;  2QA4 I;  1LB2 A;  2A61 A;  3GTQ J;  1QZY A;  1FOK A;  2ZNZ A;  2BW3 A;  1Z91 A;  4KA4 A;  3S14 J;  2XV4 S;  3TMO A;  4XKW A;  1OCC H;  1XDS A;  2LBF B;  1APL C;  2QEX I;  2M30 A;  2V7F A;  5GAE J;  4W97 A;  4IHX A;  1FY7 A;  3GFL A;  2MBF A;  1WRJ A;  3JRC A;  1S9H A;  1EV7 A;  1IO2 A;  4GRI A;  4L5J A;  2CW8 A;  4Y7N J;  1QHH D;  2DLL A;  4I6Z A;  4XKB A;  2R7W A;  4KT5 C;  3K2A A;  2A5W A;  2YS9 A;  2P8T A;  3JTH A;  2DOF A;  4EJW A;  5DV5 A;  3E3V A;  5FFZ A;  3ONQ A;  4XID A;  3I3L A;  4PJL A;  5D4S A;  2FA5 A;  3GEZ A;  5IP7 J;  1T39 A;  1BC7 C;  1E3O C;  1ETK A;  2WB1 A;  3V8J A;  5LGN A;  2DXI A;  3LQR A;  1TW2 A;  1QZZ A;  4ENJ A;  3A0B C;  2O03 A;  3I58 A;  1IRF A;  5GAG J;  2Y69 H;  2NXN B;  3E6D A;  5E1W A;  5K5Q A;  4F52 A;  3N4M A;  2K5C A;  2Z1D A;  3BJ6 A;  2DT6 A;  2VJ4 A;  2KZV A;  4LK0 F;  1R36 A;  1I6H J;  3GW2 A;  3F9K A;  2UWM A;  4BXF A;  1ZR2 A;  3U1K A;  2CS3 A;  3BG5 A;  4FTH A;  3PNY A;  3BR6 A;  5EYR A;  2KIQ A;  3CC2 I;  5BNG A;  2DCE A;  3F8C A;  4HPQ A;  4AID A;  1LVA A;  2IW5 A;  2RNG A;  2X85 A;  2FRH A;  4RB0 A;  1F9N A;  2L5Q A;  4NB5 A;  4G94 A;  3ZQG A;  3CDL A;  1QVU A;  5HS7 A;  4WK8 F;  3ABM H;  2K9N A;  2P7C B;  4PJ0 C;  4LK1 F;  2DOE A;  1FP1 D;  2XKO A;  4IRG A;  5AIP A;  4KDP A;  1DGW Y;  5EF6 A;  3R4K A;  4UVA A;  2HQR A;  2HKO A;  5E17 F;  3B6A A;  4LGW A;  4IXA A;  2DDA A;  2P5V A;  1UJ8 A;  2P0W A;  3RSN A;  5DS9 A;  3LSI A;  4A69 C;  3PSI A;  2ISZ A;  3RPU A;  1KU9 A;  2X6W A;  1YJ9 I;  2LKX A;  3A01 B;  3G73 A;  1HBX G;  2R7T A;  4EV0 A;  3L00 A;  2KP6 A;  3N05 A;  5HDK A;  1ZN2 A;  3QPL A;  3FXR A;  4R79 A;  1ITY A;  1XSX A;  2ELH A;  5LBQ A;  3BLY A;  5D6E A;  5D5W B;  4OMZ A;  2KT0 A;  2WAE A;  4Q4Z F;  4RGS A;  3EQL F;  2HZT A;  3VYT B;  4II2 A;  2OF7 A;  4KN4 X;  4U7D A;  1N25 A;  4HF2 A;  3CDH A;  3FXM A;  2V6E A;  3NWT A;  1AKH A;  1QPM A;  2L3D A;  5HOO A;  3WE3 A;  4XRM A;  3ZPL A;  1OCT C;  5ILS A;  4ZJZ A;  1VQ9 I;  3MWM A;  3DTI A;  4IHT A;  4PGG A;  4ESJ A;  3DXJ F;  4Y33 A;  4CUG A;  1J5Y A;  1B9N A;  4YEL A;  1MKM A;  4FHT A;  2R92 J;  5F0C A;  5FLX Z;  3SXY A;  4B43 A;  2QSF X;  4S04 A;  3T0Y A;  2GOX B;  2L0K A;  2VPL A;  4RMN A;  1X4O A;  1R58 A;  5IYC J;  3JRG A;  3TW6 A;  3ZMS A;  3RKQ A;  2QM3 A;  5E8I A;  1ETQ A;  4ENN A;  1YX5 A;  1S7E A;  2H6B A;  3G6E I;  1LDJ A;  1XCB A;  4UUS A;  1WI3 A;  3HYI A;  1Y8R B;  2O8X A;  2QQB A;  3BZK A;  3MQ0 A;  3P5J A;  3CP2 A;  5DUK A;  1XGO A;  4PZJ A;  4BHC A;  1X1A A;  2GAU A;  2DA3 A;  2NS0 A;  2V9K A;  3MZY A;  1R4N B;  3IH2 A;  3R0J A;  3BR5 A;  5DM6 F;  2E60 A;  4XLC A;  3F0C A;  4XLN F;  1P9Q C;  1RIO H;  5TGT A;  1IN8 A;  2BEO A;  3QYF A;  2HQ5 A;  4RBO A;  1GHC A;  4EJU A;  1XSV A;  4N9H A;  4R1H A;  3ZGK A;  4FCY A;  2STT A;  4C3I J;  1QRY A;  6PAX A;  5J1Y A;  3JAM Z;  3OYG A;  2PG4 A;  3KEY A;  1GXQ A;  2RGV A;  5FD5 A;  4ABZ A;  1BBY A;  4EM1 A;  4I2O A;  4LJZ F;  2UUZ A;  1XX5 A;  1MJB A;  2L54 A;  3WHC A;  2JTV A;  3K1N A;  2HGC A;  2IP2 A;  1JT6 A;  2KIF A;  1BI3 A;  2CFO A;  3AG3 H;  2LF7 A;  5HOD A;  1CGP A;  4CGZ A;  3HSF A;  3WG9 A;  3L2Q A;  1IZ1 A;  4A3C J;  3KP5 A;  3KP3 A;  3BPX A;  3HEF A;  3KX2 A;  4IHV A;  3E7L A;  3FWE A;  3RKW A;  1IGN A;  2IGO A;  4KN7 X;  2BV6 A;  2DO7 A;  2DT5 A;  1H9T A;  1L0O C;  4BKX A;  3QP5 A;  4XRF A;  1HCR A;  4BHP A;  1F36 A;  3S3M A;  4PJN A;  1Q1V A;  2HXO A;  3FIW A;  2LRD A;  1VQK I;  1KQ0 A;  4Q47 A;  3TKY A;  1SD7 A;  1FX7 A;  1U2W A;  1JI8 A;  3HOY J;  5A2Q Z;  2M45 A;  3BZC A;  2IA2 A;  4LLG F;  1FOX A;  3CUO A;  3ECO A;  3BR1 A;  2ADU A;  4YG2 F;  3MKW B;  2Q2E B;  2KLO A;  4XOP A;  1ACI A;  3DEU A;  2M4K A;  2LKP A;  2MC3 A;  2R7S A;  3S17 J;  4BQN A;  4DOZ A;  3KLN A;  2V1N A;  2LBF A;  3ABT A;  4P9F A;  3LAJ A;  2VC1 A;  1WJE A;  2XPU A;  4L0Y B;  4FX0 A;  3V4G A;  3C2G A;  1USS A;  1A5J A;  2XGD A;  3JTG A;  4XLE A;  4CA0 A;  3I56 I;  3A1Y A;  4PSW A;  4B3X A;  1OYW A;  2VAS A;  3KE2 A;  2QYO A;  2VJJ A;  1Q1H A;  2F5D A;  4Z6Y A;  5TRD A;  5FLX K;  1WJF A;  2EH3 A;  1JHF A;  2FNA A;  2M8E A;  2E1C A;  1G6N A;  3GXO A;  2CQX A;  1S72 I;  1F4K A;  4CZC A;  5JLW A;  3FXU A;  2DFI A;  4M9S A;  1Y39 A;  1FBU A;  2LOO A;  1NTC A;  3W6J B;  3DKX A;  4WXD A;  2F5F A;  1FMW A;  1LEA A;  3LNQ A;  2ELJ A;  4YFK F;  2A6H F;  1LNW A;  4P9U A;  5IP6 A;  1HLV A;  2IS1 A;  4DW6 A;  4WCG A;  2IA1 A;  2JN6 A;  5JHF A;  4A0Y A;  4D7M A;  5GAD J;  2AHQ A;  3SZT A;  1JUM A;  4MQ9 F;  4F91 B;  2Q8K A;  2BGC A;  4A3E J;  2IS6 A;  1BC8 C;  5LEJ A;  4BEH B;  2VB6 A;  2R7X A;  2QEN A;  1TQP A;  4NHJ A;  4HNU A;  3IKV A;  1VQP I;  4PK4 A;  2V9V A;  2COB A;  2B63 J;  2HPI A;  4ZH4 F;  4A5N A;  4N0B A;  2HS5 A;  2PJP A;  3DLA A;  2R4G A;  2YUS A;  5HNH A;  4BE1 A;  4G7H F;  1MMS A;  1SFX A;  3F6O A;  1A35 A;  2X6X A;  4G7O F;  2KRC A;  3VWB A;  1FT9 A;  1LFB A;  3GZ6 A;  1PJR A;  3FF5 A;  4PFO A;  4HSR A;  3EYI A;  2NVT J;  3BQZ A;  2MG4 A;  3G1L A;  4KIC A;  3S2D J;  1EKE A;  2VBZ A;  2O61 A;  2KZG A;  4A3J J;  1G3S A;  1W5C C;  4M9X A;  3I54 A;  5E3M A;  4DIQ A;  3A01 A;  4C3J J;  4A93 J;  4YFN F;  4XNF A;  2LNB A;  1QQI A;  3DLL F;  2QSH X;  4OIO F;  3IP4 B;  3OS0 A;  3DP7 A;  5B1B H;  1W5S A;  4M74 A;  4N4O B;  3WGG A;  2Y9Y A;  4YEJ A;  4DNC A;  4A3L J;  2XAH A;  3KP7 A;  3CCV I;  4A2U A;  3PJR A;  3M8E A;  5K5R A;  1JJ6 C;  5F08 A;  2VI6 A;  5A2Q K;  1QVT A;  1JGG A;  4BBR J;  2E5N A;  4D0P A;  4RA2 A;  4RM3 A;  1V5G A;  4CCN A;  1P92 A;  2XF6 A;  2TRT A;  1Z77 A;  1FYM A;  1P7I A;  3EUK L;  3H0D A;  3CME I;  3RYR A;  2WAQ N;  3TL4 X;  3OMY A;  5C4J J;  4U0W A;  2O5R A;  5C4X J;  1Z7L A;  2A6T A;  3IKT A;  2JK3 A;  5M3F J;  1IUY A;  2FF4 A;  3D0S A;  1O3T A;  4J00 A;  4HLY A;  3CMM A;  3CLO A;  2VOP A;  3DPL C;  5CKT A;  1MIJ A;  4CSW A;  3E5Q A;  4RGX A;  1GUU A;  3ZP5 A;  2CUZ A;  1MDM B;  5M3M J;  5CVJ A;  3FXQ A;  3WG7 H;  2DA2 A;  3X2Q H;  3SHF A;  3E5X A;  3VDX A;  4EQQ A;  3H9G A;  2HDW A;  5L3F A;  1W7P B;  2FD5 A;  3CC4 I;  4BAY A;  2NAZ A;  5J47 A;  1W1W E;  1YRN A;  2RV8 A;  2AQE A;  2WBM A;  4AIK A;  1HKQ A;  2FOW A;  2XAS A;  3J7Y J;  2EA2 A;  3CCY A;  3DKW A;  4P55 A;  3K2Z A;  1NH3 A;  4AIH A;  3UR3 C;  3ZMU A;  1D0X A;  4Y52 J;  5DEQ A;  1ON2 A;  2FML A;  5LFA A;  1G2H A;  1MD0 A;  1RR8 C;  3J7A O;  1R49 A;  2XRL A;  1W4M A;  4C2M J;  2XSD C;  3ZMV A;  2HVR A;  2E7W A;  2CGP A;  2R7U A;  3SZP A;  2F2E A;  1JUS A;  1YJN I;  3BT9 A;  2D1V A;  2DBB A;  5EG0 A;  1ZGA A;  3UNG C;  4EMS A;  2CW7 A;  1WQ2 A;  2OJE D;  1D5V A;  2F5E A;  5KHD A;  4C2T A;  2BVL A;  4XMY A;  3ZN0 A;  4IZZ A;  1V5E A;  3MN2 A;  2Y30 A;  4C30 A;  3HDD A;  5D6F A;  3W2A A;  3DV8 A;  4IX7 A;  1TT5 B;  3OWT A;  1Z7U A;  1MH4 A;  2CWE A;  2A05 A;  5E20 A;  3S1M J;  1O7F A;  4DYQ A;  3PQK A;  3S16 J;  4A3K J;  2I8D A;  2LR8 A;  3ROU A;  4BXX J;  1RI7 A;  4NNJ A;  1J0R A;  1DDN A;  3A0H C;  4HOB A;  4E7S A;  2UZK A;  4KIS A;  1KQ9 A;  1FC3 A;  2GA2 A;  4V2F A;  3TDU C;  1VQN I;  3JRH A;  2OC6 A;  1IDZ A;  2LD5 A;  4LOC A;  1D1B A;  2E5Z A;  3HPG A;  1X1C A;  5D8K B;  2RQQ A;  4I0A A;  2Q2E A;  1RET A;  2G7U A;  3GCM A;  3HKZ N;  1Z9C A;  3LSP A;  3ZQ7 A;  1RUO A;  4L9N A;  3S1Q J;  2V1X A;  3HC7 A;  5IYB J;  2HOA A;  1JKO C;  3CF5 F;  4IL6 C;  4MTE A;  4RB2 C;  3JRI A;  2KKO A;  1E3P A;  4JBA A;  3U21 A;  2QQ9 A;  3OYB A;  1LE8 B;  2EIM H;  2Y0S N;  3RPU D;  1LDD A;  2K4B A;  2W7N A;  2OD5 A;  2D2W A;  3I64 A;  3ZRG A;  4HNT A;  3H5N A;  1VQM I;  1X1B A;  4HDV A;  1RPW A;  2L9N A;  1R5G A;  2QBY B;  5M5X J;  2BZT A;  1X19 A;  2OQR A;  2UXN A;  3NAU A;  2HI3 A;  1IUF A;  2HR3 A;  3ZQC A;  1ZKG A;  3GLX A;  1Y6I A;  2EWN A;  1T98 A;  1BIB A;  2LKS A;  4I7H A;  4XRS A;  4RLQ A;  2GZW A;  3O6B B;  3E6M A;  3LA3 A;  3OYA A;  2G0E A;  1VF9 A;  2O8K A;  1A6Q A;  1SMT A;  4ZYE A;  2GA1 A;  1AWC A;  1SFO J;  1WCM J;  1B6A A;  1TWG J;  4BQQ A;  2EFP A;  3LMM A;  3WGH A;  3S32 A;  2E36 A;  2OQG A;  3BTI A;  4LG3 A;  2ZSH B;  4E7K A;  2L7Z A;  3CMY A;  4A6E A;  2ZFW A;  1Y8Q B;  4CZZ A;  2MA3 A;  3F8N A;  3TQN A;  2M8G X;  4M6V A;  2F5C A;  3K4J A;  1R23 A;  2EFO A;  3LSH A;  5E8G A;  2MYS A;  4ZTJ A;  1S6L A;  2F4O B;  5ICF A;  2ZXI A;  3BY6 A;  1J7K A;  2LP0 A;  2XAU A;  3DEW A;  2PFB A;  4G7Z F;  1HW1 A;  2PLY A;  1X4P A;  2P5K A;  3FM3 A;  3I4N J;  2KJB A;  1ETO A;  2K85 A;  2OAZ A;  3EYY A;  3OR2 C;  1H88 C;  1K78 B;  3GTO J;  4ZDO A;  2O6G E;  1FJL A;  3LSK A;  2G7H A;  1F1Z A;  2L7F P;  3GF2 A;  3K4B A;  4ESB A;  1JT0 A;  2P81 A;  4A3F J;  1VQ5 I;  1SAN A;  4RM2 A;  2A3S A;  2NVQ J;  4UB6 C;  1G3Y A;  1WKM A;  2DMP A;  1OCO H;  1NHA A;  1ZEL A;  1D5Y A;  2PMH A;  2KIM A;  3CES A;  2NOG A;  2XC7 A;  1E0E A;  2MC4 A;  2Q1Z B;  2DA5 A;  4F7Z A;  2KPM A;  4M71 A;  3ZMZ A;  4Q48 A;  2JVH A;  3HRT A;  1FSH A;  2I5U A;  4DQ2 A;  2WY7 Q;  2DPD A;  3FM5 A;  5GP9 A;  5TIS C;  3OS2 A;  2WAF A;  1X2M A;  5KAI C;  1V5F A;  4KUM A;  3H5A A;  4ENM A;  5FD6 A;  4CH7 A;  3PUB A;  3M4O J;  1XMA A;  1X2N A;  3C2H A;  3HZJ A;  2EV0 A;  5LHH A;  5IP9 J;  4G12 A;  3WTS C;  2VQG A;  4HX4 A;  2FUG 2;  4QTR A;  2YX4 A;  2K4J A;  3BTC A;  1Z6R A;  2E34 A;  1BI0 A;  2GXA A;  3LA7 A;  3S93 A;  2R7F A;  2ZO4 A;  1UHM A;  4KT6 A;  4A3D J;  3ABL H;  1W36 C;  2IJL A;  3LQQ A;  3EPZ A;  1R5I D;  4ZC3 A;  2ZJR F;  5GPC A;  3E97 A;  3CCR I;  1UZC A;  4Y4R A;  3OYC A;  2I10 A;  1ZRE A;  4E4H A;  3PIO F;  3OS1 A;  5DUI A;  4M6Y A;  5F1J A;  1MDM A;  1FTT A;  3HHH A;  3AFH A;  2JT1 A;  1BI1 A;  5EDN A;  1JGS A;  2F6C A;  2JA6 J;  1WPK A;  2DA7 A;  2XPV A;  4XBF A;  4G8X A;  2XRO A;  4I99 C;  1PUE E;  1KQ8 A;  4XQF A;  4RAZ A;  4ZYG A;  3HSR A;  4M3E A;  4BJ6 C;  2JMW A;  1FYL A;  3CCL I;  1MBH A;  4JP0 A;  4JX4 A;  2NVU B;  3DU5 A;  4E7H A;  1MSE C;  1B59 A;  3BR2 A;  4E7Z A;  2V79 A;  2HOS A;  3Q5F A;  2ZC2 A;  4I01 A;  3OIO A;  3WTT C;  4CCL A;  1ONV A;  2IPQ X;  4BDY A;  1N77 A;  1S8N A;  2RRE A;  2ZME C;  3LST A;  4YIR X;  4HW0 A;  2OCE A;  4L9V A;  4HA8 A;  2CQ7 A;  2GIZ A;  1MW7 A;  5FKM A;  2XAJ A;  2ZXH A;  1X1D A;  2OZ6 A;  2QKL B;  4EEF G;  2B7E A;  3CCS I;  2EIL H;  4J01 A;  1LFP A;  4BJT A;  4GDF A;  3B6C A;  2V4J C;  4KNY A;  2RAE A;  4BY1 J;  2MH2 A;  4XN0 A;  1IXS B;  2WY8 Q;  4RB3 C;  2EQR A;  1PUF A;  4PFP A;  1TNT A;  1TQI A;  1B8I B;  2MGQ A;  4FE7 A;  2MD5 A;  2BE5 F;  5FLV A;  3BCB A;  1MMG A;  5E1Z B;  2KJC A;  2F48 A;  1NK2 P;  1IRZ A;  3CJQ B;  1XTA A;  1UB9 A;  3OSF A;  1CQT A;  5JR3 A;  2WC2 A;  4ETS A;  4OIQ F;  1ORK A;  1ERD A;  2H09 A;  3GUD A;  4TV7 A;  5J1R A;  1BR2 A;  4IEJ A;  4PJM A;  3QP6 A;  3DBL B;  5FFX A;  3WTV C;  3BG7 A;  3L2U A;  2YR2 A;  4B3A A;  2LYC A;  4LMY A;  1BIA A;  2E1N A;  1ZG5 A;  1ZRC A;  2BXY A;  1IRX A;  4KJZ A;  3K1P A;  4OU0 A;  5H6Q A;  2W00 A;  1RR7 A;  2EFQ A;  4Y13 A;  4IJA A;  2MAB A;  3R60 A;  2FSW A;  2AO9 A;  1T08 B;  5IOY A;  4HV6 A;  1KU2 A;  4FET A;  1PP8 F;  3G1O A;  3U9G A;  3RYP A;  2MH9 A;  3J80 K;  1QA6 A;  5LGU A;  4PJJ A;  3GZ5 A;  2D5V A;  2CQN A;  4A3B J;  3N97 A;  2KIS A;  5TJJ A;  3FMQ A;  3IH4 A;  2VN2 A;  5LGT A;  1ZAO A;  1LE8 A;  3W2V A;  4ZYH A;  3C1D A;  4A6D A;  4IRI A;  3LSM A;  3FZV A;  1XD7 A;  2EBI A;  5DTD A;  3HGG A;  1X58 A;  4NBQ A;  3CJR B;  3GME A;  1FNN A;  3K4M A;  2QBY A;  1SVO A;  2ZNY A;  3P9I A;  4D1Q A;  2ZJP F;  1GDT A;  3HTU A;  5HVQ C;  5ILU A;  5D5V B;  2H1K A;  1LDK B;  4U0Y A;  2VBX A;  1IF1 A;  4E6K G;  2HTJ A;  1KYZ A;  1CF7 A;  2M7B A;  2NS7 A;  1VZ0 A;  2AXT C;  3TP0 A;  4HAM A;  4E7J A;  2JA5 J;  1OR7 C;  2XDV A;  4IF4 A;  1BN5 A;  2NS8 A;  5HNF A;  2CV1 A;  4UUV A;  1H8A C;  3VOD A;  2PMZ N;  2QSG X;  5IPA A;  2DJI A;  1XSD A;  1U3E M;  2M7A A;  1IV8 A;  1KON A;  2LY2 A;  4B44 A;  2LFB A;  5K7H A;  2ICW G;  4BGD A;  4AWX B;  3BP8 A;  3WTX C;  1W0U A;  2DMQ A;  4ANJ A;  2E1O A;  1T33 A;  5H2F C;  2R7V A;  3ML6 A;  2GLO A;  1ZG1 A;  2GIV A;  4ZZD A;  2BBY A;  4XLH A;  2R7O A;  3FXJ A;  4DZJ A;  5JVG F;  1LKX A;  2F5V A;  1G3W A;  2MW8 A;  4MFE A;  4EM2 A;  5DDG A;  5CQG A;  1Z6T A;  5AON A;  4DZP A;  4HG2 A;  1SEU A;  4XSX F;  2K9L A;  2EK5 A;  4ZDP A;  1K78 A;  3MKY B;  3VYU B;  4ESF A;  2WWY A;  1LQ1 A;  2L9S A;  1RZ4 A;  2E71 A;  2IVM A;  4JX6 A;  3CLQ A;  3CQZ J;  1I39 A;  5LLQ A;  1HQC A;  1BR4 A;  2K9M A;  2JA7 J;  2M3A A;  3GFM A;  3L9F A;  2QUF A;  4G6Q A;  3JSO A;  3H1C A;  3RZD J;  4AM3 A;  3I59 B;  4U87 A;  4HF0 A;  3WTY C;  1TTY A;  2ECB A;  2ZBK A;  3CJT B;  2M87 A;  5C44 J;  4CYC B;  2VLA A;  1B1B A;  1R9T J;  2V6C A;  1WH7 A;  4AC0 A;  1BA5 A;  5KAF C;  3KYD B;  2QVO A;  3A4C A;  2EFN A;  1W36 D;  2LSO A;  3ZN1 A;  2ECC A;  2ZME B;  2JSC A;  1FBS A;  4EJO A;  5J4Y A;  2H1L A;  2QZ8 A;  2IBD A;  3SFZ A;  4ENK A;  2EIK H;  1XPX A;  2VUM J;  1FLI A;  4DYR A;  3KEQ A;  1IN5 A;  3CMA I;  3M1E A;  1DP7 P;  3HOV J;  2EZL A;  3L1P A;  3H3Z A;  3NAR A;  2IGK A;  1QBJ A;  4ZTF A;  5HLG A;  5B66 C;  2JJ7 A;  2P5L C;  2ISY A;  3DQV C;  1FTZ A;  4EGY A;  5HS9 A;  4HDU A;  4LIT A;  4MO7 A;  5E18 F;  1D8J A;  2QQ8 A;  1U6G A;  2DQL A;  3KP2 A;  4HEA 2;  3COA C;  5JLX A;  1O3Q A;  1OKR A;  2E2J J;  3HRM A;  2W82 A;  1TL8 A;  4HST A;  3DU6 A;  2DN0 A;  4XIC A;  2XSJ C;  3TO7 A;  3RKY A;  3BTL A;  2DK5 A;  4I0B A;  4RS8 A;  1IN4 A;  3HB9 A;  4XSZ F;  5E79 C;  3QOD A;  3TGN A;  4HF1 A;  5J3L A;  2W25 A;  2OTJ I;  3F8F A;  3M8J A;  1N75 A;  5J4V A;  1FOW A;  3ZQQ A;  4HX7 A;  1ZGJ A;  3F22 A;  2ZJQ F;  3H9J A;  2VL8 A;  5M5W J;  1C0W A;  2K02 A;  4IRH A;  5IY5 H;  4N9I A;  2HQA A;  2R7D A;  3PUF A;  3V7C A;  1D1A A;  3RI4 A;  3LL7 A;  2VKH A;  4B47 A;  4BXU A;  4GFB A;  1IJW C;  2PBI A;  2DPU A;  3G2B A;  2CUE A;  2XKP A;  3KYL A;  1HC8 A;  4QIW N;  1R00 A;  1XGM A;  5J40 A;  2A6E F;  4DGW B;  1YW7 A;  1B4A A;  2CO5 A;  5F64 A;  1ZRF A;  1K6O A;  4CCK A;  3S2H J;  3R0A A;  4C3H J;  3M3Y J;  1VTN C;  1K83 J;  3B02 A;  1S29 A;  4UVC A;  1T8I A;  5K7Z A;  2QKM B;  2WAQ A;  1AA7 A;  5J8C A;  3WTU C;  5E3N A;  2D1H A;  2CU7 A;  2R7R A;  3A03 A;  2EZI A;  2M4G A;  2WAD A;  1BOA A;  3ZQH A;  4B48 A;  2BY2 A;  1B8I A;  4CDG A;  1WJ5 A;  4KIB A;  1DPU A;  3RTR A;  1YLF A;  1RC9 A;  2OA4 A;  4KIF A;  1KYW A;  2LK2 A;  4RLF A;  1YS7 A;  3QOE A;  4RB1 A;  5KVR A;  5DYM A;  2XAG A;  3K4N A;  2WA0 A;  3DKY A;  4EM0 B;  4EVI A;  5HDG A;  3SZG A;  1MMD A;  1TP4 A;  1WWX A;  1ZGW A;  1JKR C;  3VYR B;  3QPT A;  1YJW I;  1H89 C;  2ELK A;  4ASN A;  3CCU I;  3KET A;  1DP3 A;  2CH0 A;  4WWC A;  1Z3Y A;  2EZH A;  2KIU A;  3KEO A;  5JI6 A;  3IUO A;  1YHQ I;  1R71 A;  3SDB A;  5EGO B;  1R1T A;  5DCM B;  1V4R A;  2JWT A;  2RNJ A;  4M3B A;  3TOA A;  3OY9 A;  3JCU C;  4AD9 A;  1D0Z A;  2DA4 A;  2ID3 A;  3OYM A;  4FT8 A;  5ERI A;  4F92 B;  4AVP A;  4G6D A;  1ZQ3 P;  1ZLK A;  1WJC A;  2G9W A;  4B09 A;  4RAF A;  2DFF A;  1QHG A;  3BC8 A;  3OYN A;  4M9Z A;  2Z9O A;  3RIR A;  2FQ3 A;  3FIS A;  3CCJ I;  4JYK A;  1FIA A;  1WH5 A;  1U5T C;  1V3F A;  3HOS A;  2W57 A;  1I6X A;  3MMY B;  2CG4 A;  3Q0U A;  2HDD A;  4E70 A;  4X6A J;  2M0C A;  2WTE A;  2VPR A;  3CC7 I;  4KFC A;  1YI2 I;  3RCO A;  3VB2 A;  4XK4 A;  1OMI A;  2RKH A;  1P7J A;  1YOV B;  4Y3O A;  3GVA A;  4KMF A;  2M2E A;  2UXX A;  1JUP A;  1ZTR A;  5EJC A;  1JTY A;  1WJD A;  2XGX A;  1I3A A;  4Z2Y A;  5F0F A;  2L01 A;  2FOK A;  1XCV A;  5EZH A;  4ZYD A;  4IQJ A;  1YO5 C;  1RUN A;  1SFE A;  3U2R A;  1Z0X A;  4I98 B;  1H0M A;  2DTR A;  1JXS A;  2HWV A;  4UXN A;  5IT3 A;  5LRS A;  3G4S I;  2E2I J;  1TWA J;  5K1Y A;  1EH6 A;  2IGN A;  3I4P A;  2YSR A;  5C3E J;  1G59 A;  4HZF A;  2HFH A;  4XON A;  1FYK A;  2GXG A;  1P4W A;  3FXO A;  1K6Y A;  1WJB A;  2W1O A;  4M72 A;  4OAY A;  4OIN F;  1K7A A;  1IXR C;  1NG7 A;  1U9N A;  3PNT A;  1OCZ H;  3HKZ A;  3C3W A;  2GOM A;  1VFC A;  3IRR A;  2HZD A;  2ESH A;  3GTJ J;  3ZMT A;  4NC6 A;  5CQE A;  3WU0 A;  2DA6 A;  2PEX A;  2OV7 A;  3DTK A;  3OYI A;  3FK7 A;  4IHY A;  1W7P D;  2HYG D;  3RZO J;  1Z67 A;  2VOD A;  4YII A;  3M9A A;  2BVM A;  3M1C A;  3AAF A;  2NOJ B;  4XN3 A;  2Y0S A;  4H4K C;  2QQA A;  1DUX C;  1E2X A;  4G9Y A;  1MBF A;  5K7F A;  1VQ6 I;  1LJ9 A;  5GTH C;  1X3U A;  2O7O A;  2XIG A;  4CYC A;  4QLC U;  3P7N A;  3H3U A;  3H3V K;  3OIP A;  3SDG A;  2LG4 A;  1QGP A;  2BY3 A;  2K86 A;  4BL0 B;  2LTP A;  2DK8 A;  2RC4 A;  4BAC A;  1BW5 A;  5KK1 A;  3KZZ A;  2X1C A;  1X3Z B;  1X1P A;  1ZAR A;  4Y17 A;  3HHG A;  1YIJ I;  4D5C A;  1R1V A;  2L02 A;  1TWH J;  3JRE A;  2WV1 A;  3KYC B;  1QPI A;  3QYB A;  1MJA A;  1MJ9 A;  2R5Y B;  3RPQ A;  3OV8 A;  2HNH A;  5AIQ A;  5CPR B;  4S0H B;  3CUQ C;  5F0H A;  3OOU A;  5FLM J;  9ANT A;  2HEO A;  3P9K A;  2NYX A;  1XN7 A;  2Z16 A;  4MIM A;  4AYB N;  1LPQ A;  1YIT I;  4GYI A;  3ZOB A;  4BHB A;  3GYH X;  2BHY A;  4UY8 I;  2ZFU A;  2TDX A;  3P9C A;  1W0T A;  1LUJ B;  4XLA A;  1J9I A;  2IAI A;  5LHG A;  4HLX A;  3ZQF A;  3G71 I;  4U7B A;  4L9T A;  2DMN A;  3E5U A;  1BJA A;  3ULQ B;  1LEB A;  2ZB9 A;  1I1S A;  1O57 A;  1HDD C;  2CRG A;  1E17 A;  3VSL A;  2CUF A;  2CW0 F;  4BBS J;  2OBP A;  4HQE A;  3C18 A;  3GO5 A;  3D1N I;  1WVR A;  5F1R A;  3HOU J;  1R7J A;  4WX9 A;  1BW6 A;  3EUH C;  3HL2 A;  2B0L A;  3TO6 A;  4JX5 A;  3C7J A;  3VOE A;  2CMP A;  4L18 B;  3QAH A;  5EZG A;  1REP C;  1R4M B;  3L2W A;  1U9O A;  3GTP J;  2YX7 A;  2VXD A;  1SAX A;  3FMR A;  3O8H A;  2HDC A;  1IRG A;  3F23 A;  1PYV A;  2R3S A;  2VQH A;  3DEE A;  2ME0 A;  3GTM J;  3DFG A;  2Z5U A;  3HXL A;  1U0J A;  3Q0W A;  2VOO A;  5E3O A;  2IEK A;  4UUS B;  2E1M B;  1T2K A;  3CO6 C;  4BEH A;  3KZI C;  4BDZ A;  3VPR A;  5CLS A;  1O7L A;  4XLP F;  1U5T B;  4OWR B;  3OYK A;  3GFI A;  3L2V A;  1KA8 A;  1SVM A;  2D45 A;  2LY9 A;  3H0G J;  3I0T A;  3FXL A;  1OCR H;  5FRO A;  2Z99 A;  3V8K A;  3MZH A;  1J59 A;  3HPH A;  5JFR A;  1UG2 A;  4BYY A;  1OIS A;  3ABU A;  2W84 A;  2Z2S B;  4NUB A;  4WXC A;  4A12 A;  4HNV A;  1OR7 A;  2O3F A;  3HGY A;  1TQM A;  2NVX J;  2XAF A;  5DM7 F;  3H35 A;  4RGU A;  2DYS H;  1HA8 A;  2NNY A;  1MNM C;  5EEH A;  2IS2 A;  1FEX A;  2VON A;  3H92 A;  3FKJ A;  3Q9S A;  3PO3 J;  3FMS A;  4KMU X;  4O6J A;  3WHB A;  5FGM A;  3WTZ A;  1KU7 A;  1SVL A;  3S3N A;  3OYH A;  3IL2 A;  2COM A;  1LFU P;  2K7L A;  2XF7 A;  1JE8 A;  1X3W B;  2DMT A;  1ZRD A;  3I9V 2;  3J80 Z;  1UHW A;  3A02 A;  4FX4 A;  4U88 A;  5EGO A;  2CJJ A;  5FO5 A;  5FJ8 J;  4V19 K;  1TWF J;  2CUJ A;  1QU3 A;  3WGI A;  3F8M A;  1OJL A;  2ACJ A;  4FAS D;  1OQY A;  3HJE A;  2ME6 A;  5ED4 A;  3PQJ A;  4EAT A;  2ZXW H;  2DAO A;  2BHZ A;  2DFE A;  1UST A;  5BMZ A;  1JHH A;  3LSJ A;  4CHU A;  4OMY A;  1TT0 A;  3LSR A;  3TED A;  1EA3 A;  2VBY A;  4UB8 C;  2XF5 A;  3CCQ I;  4M3G A;  4QWQ A;  4B1R A;  3LWF A;  4YFX F;  2YU3 A;  3I5U A;  2IRF G;  2QWW A;  1P4X A;  3W2W A;  1M1E B;  3EDP A;  3LSG A;  2FE3 A;  3R6S A;  3V7R A;  3CCM I;  5HLI A;  2L9V A;  4A0Z A;  1ETW A;  2GWR A;  2DU9 A;  4I02 A;  3RDI A;  3DCF A;  3O3K A;  3K70 C;  2DFH A;  1W7P A;  1XG1 A;  2VXZ A;  3H5R A;  2L4M A;  3I55 I;  5H20 A;  2QCO A;  1YIO A;  2LDU A;  3V42 A;  4AIJ A;  3BG9 A;  1T95 A;  2EV6 A;  4BH9 A;  5EEG A;  3F72 A;  3GLL A;  3GTG J;  3ERE D;  1FBQ A;  5J1U A;  4PSX A;  3VEP A;  1FSE A;  1A31 A;  3CTA A;  1T0F C;  2K3P A;  4U0V A;  2Y48 A;  4P5O A;  5HS8 A;  1YW9 A;  2VKE A;  2GBY A;  3CUQ B;  5B5E C;  1TLH B;  4XL9 A;  2JUC A;  3PFI A;  1T38 A;  1IC8 A;  4ZZL A;  4Y15 A;  5B1A H;  2JRM A;  4CO8 A;  4UNO A;  2W4S A;  4PGH A;  3TOB A;  1MGT A;  1D8K A;  2BOL A;  3I4M J;  2N8G A;  1MNE A;  1XGN A;  2FX0 A;  2J5P A;  4MQV A;  1ENH A;  2ZJ2 A;  2VT3 A;  4A3M J;  3FBN B;  4LB5 A;  1JKP C;  1ULY A;  1D3Y A;  3K9T A;  4S05 A;  1Y0N A;  1GLN A;  3ASN H;  3CF2 A;  2DYR H;  3F6V A;  1EF4 A;  1JKQ C;  1FPQ A;  5DD8 A;  2VJ5 A;  2LH9 A;  2VKV A;  4A3G J;  2VT2 A;  1V55 H;  2IA0 A;  2FJ1 A;  3KIO A;  5K5O A;  3T1B A;  4P1W A;  2B9S A;  2BYV E;  2M1B A;  1ZHF A;  4B4C A;  4QPQ A;  2ZXJ A;  3MAJ A;  4A3I J;  2OZU A;  3Q9V A;  2STW A;  3BTJ A;  2A07 F;  1WHU A;  2FBK A;  2O9L A;  3J7A Y;  3A2K A;  4C9Y A;  1HSJ A;  3DBH B;  1FWZ A;  3FXK A;  2WB1 N;  3OOP A;  2PMZ A;  4NC8 A;  3GFJ A;  5L3E A;  2R5Y A;  2LMD A;  2L4A A;  4ON0 A;  2FQ4 A;  5GPA A;  2Z33 A;  3PFY A;  2PN6 A;  4MFD A;  2VIX A;  1G8X A;  1P4A A;  3M7G A;  4D5F A;  4X0G A;  1R1U A;  5KNL A;  5L3C A;  2OUM A;  3V8L A;  4HX8 A;  1RNL A;  2XB5 A;  3QOP A;  1VI0 A;  3KCC A;  4UV9 A;  3ZXS A;  3PL8 A;  1KZH A;  1K4T A;  3F3X A;  3I53 A;  3TBI A;  3ESW B;  4L5E A;  1SD5 A;  2XPW A;  3S8P A;  1HDP A;  2E19 A;  3S1R J;  2RN7 A;  3OR1 C;  3FX3 A;  4F93 B;  2DQR A;  3NQO A;  2KL4 A;  2ZCW A;  2HVS A;  1AU7 A;  1HKT A;  2PMU A;  2WV0 A;  4MTD A;  3HOX J;  2M34 A;  2K27 A;  1ZK8 A;  2EIJ H;  2JA2 A;  1S7A A;  3IAM 2;  5L3B A;  3BQY A;  4LD5 A;  5CVI A;  1TZL A;  5BQT A;  3BG6 A;  1O4X A;  1ON1 A;  1J2X A;  3MD2 A;  3BPV A;  2KDO A;  1XS9 A;  1XDU A;  2R7Q A;  3H9Q A;  4E7L A;  1A6I A;  2LLK A;  4KYW A;  3DTE A;  1QNT A;  1GT0 C;  2V26 A;  5LD2 C;  4UV8 A;  3HM5 A;  1OFC X;  4M6X A;  2KRH A;  4NQW B;  3DWL E;  1MBJ A;  3EET A;  3G3Z A;  1Y0U A;  4BU2 A;  2DOD A;  3MFK A;  1U5T A;  1YRN B;  2FXA A;  1U78 A;  2QGU A;  2PJR B;  3DPT A;  3ECH A;  3HRU A;  2R93 J;  2PI0 A;  4GO1 A;  4IPA A;  1IV6 A;  4ZDL A;  4XKC A;  4OAZ A;  1RKW A;  5H6R A;  3S1N J;  3HOZ J;  2EB7 A;  3WU2 C;  2KHM A;  1Z05 A;  1BL0 A;  2KDZ A;  4LLL A;  4UVB A;  4L9J A;  5E1X A;  4YIF A;  1IAW A;  1FOY A;  4GYG A;  2L9R A;  1PVE A;  4BUP A;  4BE2 A;  5EG0 B;  1QZE A;  2EV5 A;  1ZG3 A;  1B72 B;  2LRE A;  3K10 A;  2EPF A;  5L3D A;  3ELK A;  1U8R A;  1YYV A;  4UHT A;  3K0L A;  3K7A J;  4XOR A;  3W6K B;  2VBW A;  3ASO H;  3ZCO A;  4HRI A;  5KCM A;  3LA2 A;  3JRB A;  3L7W A;  3S3O A;  2FBH A;  4JK1 X;  1S5L C;  2Q0O A;  2RVC A;  4BQA A;  1ETV A;  2M5W A;  4QPO A;  3IAS 2;  3HBL A;  4LB6 B;  3AG4 H;  5BPI A;  4AVZ A;  3K4K A;  4NC7 A;  5CVU A;  2QLZ A;  2XRN A;  2K3F A;  5HLT A;  5CVV A;  3FHZ A;  3Q0V A;  1I5Z A;  1K79 A;  2JRT A;  3K70 D;  2DDB A;  4RGR A;  4B8X A;  4IOA F;  1GVJ A;  3OYF A;  4LIV A;  2NNN A;  1VQL I;  2HVQ A;  4CCM A;  4I76 A;  4Q5S F;  1OYI A;  4D7N A;  2GQQ A;  3CJN A;  2ID6 A;  2Y75 A;  1J09 A;  3F8B A;  3MEX A;  1XGS A;  3KFW X;  1F5T A;  1YW8 A;  4IHW A;  2MLG A;  4LFU A;  3O2P E;  2H6C A;  2CFX A;  2HQN A;  4GCV A;  4J19 A;  2KRF A;  2H8W A;  5ICC A;  1TW3 A;  3QU3 A;  1G4D A;  4BQO A;  3VSK A;  3QU6 A;  1OPC A;  4MGR A;  1VQ8 I;  1MBE A;  1Y56 A;  3RJP A;  4HYE A;  1G3T A;  1DU6 A;  3IRQ A;  3ZQI A;  1NG6 A;  1JTX A;  1QO0 D;  2DT7 B;  3RQI A;  1ETY A;  1KU3 A;  1T56 A;  1WZ2 A;  1GV2 A;  5FKL A;  4BS9 A;  3V7S A;  4CXF A;  3WE2 A;  2UV1 A;  4FE4 A;  4CYD A;  5E3L A;  3OYE A;  4LG0 B;  4H0E A;  1A36 A;  5BOX A;  2R5Z B;  3RKX A;  5FRN A;  1R22 A;  3PSF A;  3CO7 C;  5GTI C;  4O3M A;  2X48 A;  4I09 A;  1FP2 A;  3S15 J;  2ESN A;  1VND A;  2E2H J;  1Y1W J;  4NDL A;  2X6O A;  2Y2Z A;  5IYD J;  1F43 A;  3SJM A;  2CV2 A;  3CUQ A;  1WFX A;  2K9S A;  2IT0 A;  2LC2 A;  1YX3 A;  1O3R A;  2FU4 A;  4IOC F;  1UEL B;  1SMY F;  1W5T A;  1DU0 A;  4BJ5 C;  2L2O A;  4W1U A;  5FKN A;  2OPT A;  2CV0 A;  3JW4 A;  2XUB A;  5GAH J;  3KP4 A;  1BR1 A;  1HF0 A;  3GZN B;  3ERM A;  3SEZ A;  2R0Q C;  4XM3 A;  1XB4 A;  1YG2 A;  4ZYA A;  4KIG A;  1U8B A;  3IWF A;  1T6S A;  4O5V A;  4P96 A;  5BS6 A;  2XGC A;  3U1D A;  3MKL A;  2VJI A;  1I3Q J;  3BRO A;  1SFU A;  2HYF A;  3PIP F;  1IXC A;  3OYL A;  1P2F A;  3EUH A;  3VYS B;  3HUG B;  2VKD A;  1XMX A;  3NRV A;  3H36 A;  4XLF A;  3S2W A;  4C2U A;  4PUS A;  5ILV A;  4A5M A;  3JAM K;  4M3D A;  4MNU A;  3JSP A;  5J6X A;  5L3G A;  1O3S A;  1BM9 A;  2BY0 A;  2YU9 J;  3GTK J;  2PQ8 A;  1HW5 A;  1GVD A;  1S3J A;  2JPC A;  1DQU A;  3IHU A;  3AL0 C;  2C6Y A;  1RES A;  1PDN C;  3O8G A;  3K69 A;  3K4L A;  4GXO A;  3QYE A;  1IG7 A;  4DBQ A;  4XRS G;  2CQQ A;  2X1E A;  3TP3 A;  2VQL A;  4PCQ A;  2YPR A;  4F55 A;  2J5O A;  2DA1 A;  1IDY A;  4DJA A;  5B3S H;  1WJA A;  2CSO A;  3CD6 I;  4EGZ A;  3WOD F;  4MHG A;  4CCJ A;  3SYT A;  4FQG A;  3B73 A;  3UKG A;  1JJ8 C;  2VQC A;  2EJR A;  1Y1V J;  2HU9 A;  5EEA A;  4MLO A;  2AQF A;  3DPU A;  5CJ9 A;  5DD4 A;  2E1M C;  2DMU A;  5ICG A;  3GBG A;  1YQA A;  4GGG A;  2V1U A;  3JR9 A;  1K4S A;  3T8T A;  2W48 A;  4R8H A;  1DGR M;  2ZKZ A;  5FKK A;  4BY7 J;  1ETX A;  3RQ4 A;  1MSF C;  1UHS A;  4YRV A;  4OOI A;  3OIQ A; 
#chains in the Genus database with same CATH homology
 3B6C A;  1NK3 P;  1HCR A;  2RAE A;  4BY1 J;  1F36 A;  2L7M P;  3O8H A;  1Q1V A;  2HXO A;  3W6V A;  3FIW A;  2ME0 A;  3GTM J;  5F27 A;  2EQR A;  1PUF A;  3HOY J;  2K9Q A;  3Q0W A;  5E3O A;  2IEK A;  4UUS B;  1B8I B;  2MGQ A;  4FE7 A;  3VPR A;  5FLV A;  3BR1 A;  1NK2 P;  1IRZ A;  3OSF A;  1CQT A;  3S17 J;  2LY9 A;  3H0G J;  1ORK A;  5J1R A;  2KDZ A;  4IEJ A;  1FIP A;  1UG2 A;  2XPU A;  4B3A A;  1K61 A;  3IH3 A;  1ZR4 A;  1A5J A;  4HNV A;  1AHD P;  1RR7 A;  2XGD A;  3HGY A;  2NVX J;  2H8R A;  3JRF A;  2AO9 A;  5IOY A;  2DJN A;  2XGE A;  1OCP A;  3G1O A;  1MNM C;  1FEX A;  3PO3 J;  5FKO A;  2R7Z J;  3WHB A;  2D5V A;  3IV5 A;  4A3B J;  2EH3 A;  4FIS A;  3IH4 A;  4DYC A;  1LE8 A;  2CQX A;  2NVY J;  2GM4 A;  1LFU P;  1MH3 A;  5JLW A;  2EBI A;  5DTD A;  3HGG A;  2DMT A;  3A02 A;  1X58 A;  5EGO A;  2CJJ A;  1POG A;  1NTC A;  5FJ8 J;  1B72 A;  1TWF J;  1GDT A;  2H1K A;  3LNQ A;  1OJL A;  5IP6 A;  2ME6 A;  4V2G A;  1HLV A;  4DW6 A;  3C2B A;  2JN6 A;  2NS7 A;  3TP0 A;  2Y9Z A;  2JA5 J;  1HOM A;  4D7M A;  5IOZ A;  5M5Y J;  2AHQ A;  3LSJ A;  1JUM A;  1PUF B;  3LSR A;  2NS8 A;  4A3E J;  3TED A;  2Y31 A;  3BG3 A;  4M3G A;  1H8A C;  4B1R A;  2PMZ N;  5IPA A;  1I50 J;  2COB A;  3BR3 A;  2B63 J;  3LSG A;  3G1M A;  2LFB A;  5K7H A;  1ETW A;  2YUS A;  1MBG A;  1W0U A;  3DCF A;  3Q3S A;  2DMQ A;  4QSH A;  1LFB A;  2E1O A;  1T33 A;  1XG1 A;  1TC3 C;  2GLO A;  2NVT J;  3BQZ A;  2MG4 A;  2QCO A;  3G1L A;  3BG9 A;  3S2D J;  4DZJ A;  2HOT A;  3QPS A;  3GTG J;  2MW8 A;  4A3J J;  4MFE A;  5J1U A;  5E3M A;  4A93 J;  3A01 A;  4C3J J;  4DZP A;  1AKH B;  2VKE A;  2GBY A;  2Y9Y A;  3TW7 A;  4A3L J;  4JX6 A;  3CQZ J;  1IC8 A;  2JA7 J;  2R5Z A;  1GV5 A;  1JJ6 C;  5F08 A;  2VI6 A;  3RZD J;  4RDU A;  1QVT A;  1JGG A;  4BBR J;  3I4M J;  2ECB A;  2N8G A;  2FX0 A;  2TRT A;  1Z77 A;  3BR0 A;  5C44 J;  4CYC B;  1P7I A;  1ENH A;  4A3M J;  1R9T J;  2WAQ N;  1WH7 A;  1JKP C;  3JRA A;  4AC0 A;  1BA5 A;  5C4J J;  1EF4 A;  4M3F A;  1JKQ C;  4A3G J;  2VKV A;  2XB0 X;  2ECC A;  2DTZ A;  2M9H A;  5C4X J;  1XC5 A;  2FJ1 A;  2JK3 A;  5M3F J;  2IBD A;  3LOC A;  4B4C A;  2VUM J;  1UMQ A;  1RKT A;  4DYR A;  3FK6 A;  4A3I J;  1GUU A;  3MVP A;  3BTJ A;  3SFI A;  2LVS A;  5M3M J;  2O9L A;  2DA2 A;  3HOV J;  2EZL A;  3L1P A;  3NAR A;  3QQA A;  2FD5 A;  2WB1 N;  3HOW J;  2JJ7 A;  2TCT A;  1YRN A;  1FTZ A;  4MO7 A;  3OSG A;  2R5Y A;  2FQ4 A;  5JLX A;  5GPA A;  3CCY A;  2E2J J;  4MFD A;  4D5F A;  2DN0 A;  4XIC A;  2X9D A;  3PM1 A;  4Y52 J;  4UUT A;  3BTL A;  1G2H A;  3HB9 A;  4X1E A;  2JA8 J;  2XRL A;  5J3L A;  4C2M J;  2XSD C;  1JUS A;  2XB5 A;  3ZQL A;  1VI0 A;  3BT9 A;  5EG0 A;  2MSY A;  2EZK A;  5M5W J;  1WGX A;  4L5E A;  2XPW A;  1HDP A;  2E19 A;  3S1R J;  3PO2 J;  1TWC J;  4GFB A;  3MN2 A;  1IJW C;  2Y30 A;  3HDD A;  2HYJ A;  1AU7 A;  4AUX A;  2K40 A;  2CUE A;  4QIW N;  1MH4 A;  2QF7 A;  3FKI J;  5F04 A;  3HOX J;  2HXI A;  2M34 A;  3S1M J;  1MBK A;  1ZK8 A;  1BJZ A;  4DYQ A;  3BQY A;  3S16 J;  4A3K J;  3S2H J;  2LR8 A;  3GTL J;  1O4X A;  4BXX J;  1XS9 A;  4C3H J;  3JRD A;  3M3Y J;  1K83 J;  5K7Z A;  3GTQ J;  1A6I A;  2LLK A;  3S14 J;  5E3N A;  2CU7 A;  4V2F A;  1GT0 C;  1APL C;  3A03 A;  3JRH A;  2EZI A;  2LD5 A;  1IDZ A;  4LOC A;  3ZQH A;  4W97 A;  3HM5 A;  1B8I A;  4IHX A;  1OFC X;  3JRC A;  1MBJ A;  1RET A;  4Y7N J;  3HKZ N;  4I6Z A;  2LK2 A;  3LSP A;  1YRN B;  1U78 A;  3K2A A;  3S1Q J;  2YS9 A;  5IYB J;  2R93 J;  2HOA A;  1JKO C;  1IV6 A;  3S1N J;  1RKW A;  3JRI A;  3HOZ J;  4XID A;  1ZGW A;  1JKR C;  1H89 C;  5IP7 J;  1LE8 B;  2ELK A;  1E3O C;  2Y0S N;  1ETK A;  1BL0 A;  2EZH A;  1RPW A;  2L9R A;  5EGO B;  5M5X J;  5EG0 B;  1B72 B;  2JWT A;  4M3B A;  2DA4 A;  2ID3 A;  3NAU A;  2HI3 A;  3K7A J;  1IUF A;  3ZQC A;  1ZKG A;  1ZQ3 P;  1I6H J;  3JRB A;  1ZR2 A;  3FIS A;  1ETV A;  4JYK A;  3BG5 A;  4XRS A;  4FTH A;  1FIA A;  1WH5 A;  3BR6 A;  3HBL A;  5EYR A;  5BNG A;  2G0E A;  1VF9 A;  2O8K A;  3Q0V A;  3Q0U A;  2HDD A;  4X6A J;  2M0C A;  2VPR A;  3ZQG A;  1SFO J;  1WCM J;  3CDL A;  1TWG J;  4XK4 A;  1QVU A;  1P7J A;  2K9N A;  3BTI A;  4I76 A;  2M2E A;  2L7Z A;  3CMY A;  4D7N A;  1JUP A;  1ZTR A;  2ID6 A;  5EF6 A;  1JTY A;  4IHW A;  5F0F A;  2M8G X;  5EZH A;  4M6V A;  3B6A A;  1Z0X A;  4J19 A;  5DS9 A;  4A69 C;  1MBE A;  2LP0 A;  3DEW A;  2LKX A;  2E2I J;  3A01 B;  1TWA J;  3I4N J;  5C3E J;  1DU6 A;  1ETO A;  3ZQI A;  1JTX A;  3RQI A;  3QPL A;  1ETY A;  1H88 C;  3GTO J;  1T56 A;  1FJL A;  1GV2 A;  5FKL A;  1ITY A;  2L7F P;  4FE4 A;  1JT0 A;  5E3L A;  2P81 A;  1U9N A;  4A3F J;  1SAN A;  2R5Z B;  2KT0 A;  2NVQ J;  1VFC A;  3GTJ J;  2DMP A;  2X48 A;  3S15 J;  1D5Y A;  2OF7 A;  2DA6 A;  1VND A;  2E2H J;  3FK7 A;  1Y1W J;  4NDL A;  4IHY A;  2NOG A;  2X6O A;  2Y2Z A;  3RZO J;  5IYD J;  1AKH A;  1F43 A;  2DA5 A;  4XRM A;  3SJM A;  1OCT C;  2K9S A;  1DU0 A;  1MBF A;  4W1U A;  5FKN A;  5F0C A;  2OPT A;  5GP9 A;  5K7F A;  2R92 J;  1X2M A;  2L0K A;  2O7O A;  1HF0 A;  4CYC A;  5IYC J;  3JRG A;  3TW6 A;  2R0Q C;  3RKQ A;  3H3V K;  3M4O J;  1ETQ A;  3SDG A;  1X2N A;  1U8B A;  5IP9 J;  4G12 A;  1S7E A;  4QTR A;  2XGC A;  2LTP A;  3MKL A;  3BTC A;  1BW5 A;  1I3Q J;  1WI3 A;  4UUS A;  4D5C A;  2DA3 A;  1TWH J;  4A3D J;  3JRE A;  2WV1 A;  3IH2 A;  1QPI A;  3BR5 A;  4M3D A;  5GPC A;  2R5Y B;  3F0C A;  2I10 A;  2YU9 J;  3GTK J;  4S0H B;  1GVD A;  5F1J A;  4RBO A;  2HQ5 A;  5F0H A;  5FLM J;  3OOU A;  1FTT A;  9ANT A;  1RES A;  5EDN A;  4FCY A;  4C3I J;  2JA6 J;  1WPK A;  3O8G A;  1QRY A;  1IG7 A;  2DA7 A;  4MIM A;  4XRS G;  4AYB N;  5J1Y A;  2CQQ A;  2XPV A;  3TP3 A;  3ZOB A;  4ABZ A;  2DA1 A;  1IDY A;  4M3E A;  2JMW A;  1W0T A;  1MBH A;  4JP0 A;  4JX4 A;  2IAI A;  3WHC A;  1MSE C;  3BR2 A;  2HOS A;  3UKG A;  1JJ8 C;  3ZQF A;  1JT6 A;  2DMN A;  3OIO A;  2ZB9 A;  1Y1V J;  5EEA A;  1HDD C;  2CRG A;  4MLO A;  5HOD A;  2CUF A;  4BBS J;  2DMU A;  3D1N I;  3HOU J;  4A3C J;  3GBG A;  1BW6 A;  3HEF A;  4JX5 A;  3JR9 A;  2W48 A;  4IHV A;  3E7L A;  5FKM A;  5FKK A;  1IGN A;  4BY7 J;  1ETX A;  1MSF C;  1UHS A;  5EZG A;  4EEF G;  1U9O A;  3GTP J;  4BKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...