1XC5A

Solution structure of the smrt deacetylase activation domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
b'NGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear receptor corepressor 2
publication title Structural insights into the interaction and activation of histone deacetylase 3 by nuclear receptor corepressors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription corepressor
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xc5A01
2DMQA 5EEAA 3H0GJ 2EZLA 3JRBA 1FJLA 1O4XA 2I10A 3LSRA 2DA7A 2LK2A 3G1OA 3JRCA 2EQRA 1IG7A 3GTGJ 3GTQJ 2NVXJ 2JA8J 3TP3A 5IYBJ 4A3DJ 3GTMJ 3O8HA 1VI0A 1ZKGA 4D5CA 1ETXA 2X6OA 2PMZN 4JX5A 5JLXA 2VUMJ 5FKNA 1PUFB 2QCOA 3BR6A 3CDLA 5M5XJ 4C3JJ 2XPWA 4UUTA 1ETOA 4D5FA 1JJ6C 2XGDA 2DA4A 2COBA 1IJWC 2ZB9A 3BTLA 3HEFA 1VNDA 1WPKA 2VKVA 4GFBA 1T56A 3BQYA 3Q0UA 3TW6A 4B3AA 4XIDA 1NTCA 2HOTA 5C3EJ 2WB1N 1BW6A 2X9DA 3HOVJ 4IHWA 2LD5A 1EF4A 4BY1J 1BA5A 1TC3C 4BKXA 1WH5A 3HBLA 4D7MA 5EZHA 3JRIA 4I6ZA 3HOXJ 4MIMA 4BBRJ 3LSPA 2EZKA 2W48A 1Z77A 5FJ8J 1H8AC 2HI3A 4RBOA 4IEJA 5F08A 1H88C 9ANTA 5E3LA 3A03A 1QVUA 3ZQIA 4A3CJ 2P81A 3CCYA 2M9HA 3MKLA 1DU6A 1HF0A 5F27A 3K7AJ 4XICA 4AUXA 1ZGWA 1B8IA 2DMNA 5IOYA 3W6VA 1F36A 2DJNA 2YS9A 2E1OA 4FE7A 2NS7A 3OSFA 3OOUA 1XS9A 4A3LJ 3S2HJ 3Q0WA 5IPAA 1P7JA 3ZQHA 4DYCA 3GBGA 5FLMJ 3M4OJ 2WV1A 2LTPA 4MFDA 5C44J 1U9OA 4JX4A 4MLOA 4MFEA 5F1JA 4V2GA 1GVDA 2XB5A 1ZTRA 3BG9A 1MBFA 4IHXA 1X2MA 3S16J 2CRGA 2XGEA 4HNVA 5DS9A 1AU7A 2JJ7A 1FEXA 5K7HA 2L0KA 1SFOJ 1TWHJ 2ME6A 4EEFG 3OIOA 2VKEA 1VFCA 1B8IB 2FX0A 1XC5A 4X1EA 5EG0A 2MGQA 3BTIA 3A01A 3QQAA 5M5YJ 2GBYA 1A5JA 1ENHA 3S2DJ 2NVTJ 4V2FA 3MVPA 4BXXJ 2ECBA 4M3EA 3HOWJ 1CQTA 1P7IA 2EH3A 1LFUP 4D7NA 4Y7NJ 4A3BJ 2XSDC 3G1MA 1OCTC 1AKHA 3TP0A 1UG2A 5JLWA 1TWCJ 3BTJA 3LOCA 4C2MJ 5FKOA 5J3LA 1BL0A 1RPWA 3HGYA 2JA6J 2G0EA 1JKPC 1D5YA 1JUSA 3ZOBA 5E3NA 3K2AA 4BY7J 2M8GX 5EG0B 3B6AA 3A01B 2NOGA 2O9LA 2JA7J 1ETWA 2HYJA 1K83J 1ZQ3P 2E2HJ 1JGGA 5M3FJ 3ZQCA 5FKKA 1K61A 1MBJA 1E3OC 3CMYA 4A93J 2LKXA 1HDDC 3BR3A 2ECCA 3BR0A 1HOMA 4JX6A 1Z0XA 3MN2A 4A3JJ 1JKQC 3FK7A 1AKHB 1POGA 4M3GA 2Y0SN 2LP0A 4X6AJ 1MBHA 2IEKA 2LR8A 3HM5A 1Y1VJ 1RESA 2DA6A 2HXOA 4MO7A 4W97A 2MSYA 2FQ4A 1UMQA 4LOCA 3LNQA 1WI3A 4C3HJ 4A3EJ 3QPLA 2KT0A 4L5EA 5GPAA 4B4CA 2DMPA 2FD5A 5K7FA 3Q3SA 4FCYA 5F0HA 2M34A 1MSFC 2LLKA 4CYCA 1ZR4A 5J1RA 2H8RA 3BQZA 1HLVA 3NARA 1BJZA 2JWTA 4A3KJ 1UHSA 2LY9A 1IV6A 5EYRA 2R5YA 1QPIA 1MBKA 1ETQA 4A3GJ 3GTLJ 2R7ZJ 5FLVA 1W0TA 3PO3J 1OCPA 3G1LA 2H1KA 2ID6A 3RZOJ 1OJLA 2NVQJ 3S1QJ 1Y1WJ 1JUPA 4DW6A 2O8KA 2WAQN 5E3OA 3BT9A 1ZK8A 2B63J 2M2EA 2Y9ZA 1JKRC 3RKQA 4XK4A 2YUSA 3S1RJ 2E2IJ 3IH3A 3SDGA 2XGCA 1QRYA 2L7FP 1RR7A 3SJMA 1LE8A 3B6CA 2DN0A 1S7EA 1JUMA 3JRAA 1SANA 3PM1A 4CYCB 4FTHA 4QSHA 2IAIA 1GDTA 4XRSA 2L9RA 1NK3P 1MBEA 1TWAJ 1X58A 3WHCA 3HOYJ 2E2JJ 1IDZA 3GTKJ 2HOSA 2R5YB 4IHVA 3E7LA 1WGXA 2DMUA 3PO2J 3BR5A 4FE4A 3LSJA 5IP9J 3M3YJ 3BG5A 2KDZA 2HDDA 3Q0VA 3RZDJ 1MBGA 5F0CA 1JT0A 4A3MJ 3SFIA 1MH3A 2K9QA 1AHDP 2DA5A 1MH4A 2OPTA 2CQQA 2HXIA 4I76A 4M6VA 2Y2ZA 1LE8B 3S17J 2O7OA 5IP7J 1FTZA 1ETKA 2MW8A 4M3DA 2CUFA 1RKWA 1FIAA 1GV5A 5M3MJ 2XPUA 5HODA 1YRNA 1JTYA 4DZPA 3A02A 1W0UA 5IP6A 5IYCJ 2VPRA 1X2NA 4A3IJ 5J1UA 3DCFA 2NVYJ 4W1UA 1ORKA 5FKLA 1F43A 1WH7A 5GP9A 4AC0A 2R92J 2CJJA 5GPCA 4C3IJ 5BNGA 4DZJA 1VF9A 3L1PA 2AHQA 2L7MP 5C4XJ 1I3QJ 5EGOA 2XPVA 2HQ5A 5EF6A 2RAEA 2TRTA 1FIPA 3BR1A 2MG4A 4B1RA 4G12A 4M3BA 1JJ8C 4S0HB 3HDDA 3JR9A 3F0CA 3IV5A 3ZQFA 3FIWA 3ZQGA 2XRLA 5M5WJ 5F04A 4AYBN 1YRNB 3BG3A 1QVTA 4A3FJ 1DU0A 4FISA 2JA5J 2FJ1A 3HKZN 3S1MJ 1TWFJ 3D1NI 1ZR2A 4XRMA 2R0QC 2EZIA 3I4NJ 3VPRA 1HCRA 1U78A 3JRGA 2HOAA 3FISA 3FK6A 5IYDJ 4J19A 5EGOB 3GTJJ 2DMTA 4JP0A 4M3FA 3ZQLA 3DEWA 2JMWA 3LSGA 3C2BA 3TW7A 3WHBA 1XG1A 1ETVA 5J1YA 1JT6A 4UUSA 3TEDA 1IDYA 1GT0C 2ELKA 1WCMJ 2YU9J 2D5VA 2EZHA 5F0FA 3GTOJ 4A69C 2Y30A 3IH4A 4Y52J 3JRFA 1IRZA 3IH2A 1IGNA 1A6IA 1FTTA 2ID3A 2OF7A 3H3VK 2R93J 1IC8A 2X48A 5EZGA 1I50J 1RKTA 3BR2A 3FKIJ 2K40A 2GM4A 2DA1A 4XRSG 5K7ZA 1IUFA 4QIWN 2N8GA 2R5ZA 2DTZA 3O8GA 1APLC 2XB0X 1Q1VA 2Y31A 2Y9YA 3I4MJ 2E19A 3JREA 4UUSB 1G2HA 2JK3A 2QF7A 1LFBA 1H89C 1BW5A 1T33A 3CQZJ 1U8BA 3HOUJ 2DA2A 2JN6A 3HB9A 1NK2P 4DYRA 1JKOC 5E3MA 1B72A 4RDUA 2IBDA 1MNMC 2K9NA 5DTDA 4NDLA 1R9TJ 1JTXA 2CQXA 2M0CA 1RETA 4ABZA 3S1NJ 2VI6A 2K9SA 2NS8A 3OSGA 3RQIA 2GLOA 2L7ZA 2CUEA 2R5ZB 3S14J 3HOZJ 2LFBA 4DYQA 2ME0A 1OFCX 4BBSJ 1ETYA 4IHYA 3S15J 1I6HJ 2EBIA 2AO9A 3UKGA 3QPSA 3JRHA 1TWGJ 1PUFA 1MSEC 4JYKA 1GUUA 3JRDA 2TCTA 2LVSA 1ITYA 4QTRA 1GV2A 3NAUA 3HGGA 1U9NA 3BTCA 5IOZA 2DA3A 5C4JJ 1B72B 3GTPJ 2CU7A 1HDPA 5EDNA 5FKMA
chains in the Genus database with same CATH superfamily
2E7XA 4E70A 2I10A 3WTYC 2DA7A 2LK2A 3G1OA 3HRTA 3KP3A 3S3OA 5BPDA 3GTGJ 2KDOA 2FEZA 4CCLA 2KIQA 3TP3A 2H27A 1X4OA 1EKEA 1ZRDA 1VI0A 1TQMA 5HS8A 3WG7H 5FB2A 1LQ1A 1J2XA 1ETXA 2PMZN 3CCQI 2I5UA 2P0WA 4HV5A 2DFEA 4F91B 5JLXA 4J01A 2RN7A 5FKNA 3AG2H 3GFJA 4DBQA 5D8LB 3QPTA 5B66C 4C3JJ 2X1DA 2CW8A 3PFIA 1OYWA 2LOOA 4EM2A 4UUTA 2QBYA 1XX5A 2KFDA 4E7SA 1JJ6C 1FOKA 3DTIA 3CDHA 4B47A 1IJWC 2DK5A 3M1CA 1ZGAA 3X2QH 1VNDA 1Q1HA 2P7VB 3KLOA 1T56A 4H4KC 2VJIA 3Q0UA 4B3AA 1NTCA 2HOTA 1XSVA 4BQAA 5CQEA 5C3EJ 2IS2A 2W00A 2MC3A 1MNEA 1IXSB 2Q2EA 3MAJA 5DUKA 1TC3C 4RMNA 4BY1J 1BA5A 4PFPA 4KT6A 4LK1F 2VBYA 4U0VA 1XGNA 4OAZA 1YW7A 1BR4A 2WB1A 4QPQA 4ZYEA 5D5VB 1KU2A 1MJBA 1W1WE 2LMDA 4U88A 3V8LA 3VEPA 3H5RA 1DP7P 1QQIA 3KX2A 4HSRA 3LFKA 4LK0F 4G7HF 1ZGJA 1SVOA 2L9SA 3SZPA 3H9JA 4BACA 1UHMA 5KCMA 2LDUA 3PUBA 5ICGA 3KYDB 3K1MA 2DMNA 3CCUI 1R4NB 3GW2A 2YS9A 1WJEA 3CDIA 4FE7A 4PFOA 2NS7A 4LG0B 1XS9A 2CW0F 2RREA 3VB2A 1P7JA 5JVTA 1QHHD 5FLMJ 2X4HA 3H3ZA 2VXZA 2M87A 2PJRB 1U9OA 5ILUA 3CF2A 4KJZA 3LAPA 1UG0A 2BEOA 5F1JA 2L3DA 2NS0A 4B44A 1ZARA 2Z5UA 4LLLA 1S3JA 3VSLA 3S16J 3J7AO 1Z05A 2M7BA 2DPUA 2CG4A 1FEXA 3K69A 1DDNA 2L0KA 5FRMA 3OYHA 2VE9A 1LEAA 2CWEA 2E1MC 2VKEA 4RGSA 5TJJA 1W4MA 2PI0A 2VQGA 2M7AA 1XC5A 4UUVA 3HTUA 3GFLA 2MGQA 3BTIA 1GXQA 3HUGB 5DCFA 1BIAA 1PP7U 3S2DJ 3I55I 4V2FA 1SEUA 3CZ6A 4WX9A 4M3EA 1G4DA 2O6GE 3E5XA 1X3WB 4RAGA 1P7IA 2EILH 1MJ9A 4IRHA 3OY9A 1LFUP 4IRIA 2YPRA 3DLLF 3C3WA 2WV0A 4CSWA 2L5QA 2K3FA 1L0OC 3C1DA 3V4GA 5J3LA 3VYRB 2H8WA 5J40A 4MQ9F 2A5YB 4NC8A 4WXHA 3QYEA 2DYRH 2G0EA 3OL3A 1LUJB 1JXSA 3N97A 5FROA 1JUSA 2WAFA 5E3NA 3K2AA 1VQ5I 4BY7J 2OAZA 1BOAA 2P6TA 4IF4A 5LD2C 1X4PA 1HW5A 5EG0B 5A2QK 5ILVA 3M7GA 2BY2A 2VT2A 4KFCA 2WY8Q 5BS6A 2Z16A 3I4PA 3LSTA 3OYIA 3EUAA 1WJAA 1Z6RA 3F6OA 2E2HJ 2OC6A 1JGGA 2BBYA 3CCJI 5M3FJ 1K61A 2OBPA 5D5UB 3CMAI 1RRJA 3CMYA 3BP8A 3F8CA 3QU6A 1HDDC 1WJFA 2CQNA 3I64A 1MMGA 3BR0A 1R6RA 4A3JJ 4XLFA 4H0EA 4M3GA 2HVSA 5EEHA 1TNSA 4RB2C 5JVGF 1KQ8A 3C2HA 2A3SA 3LL7A 1VZ0A 2Z33A 2IEKA 3HM5A 1BN5A 2IGMA 3H36A 4M9XA 2ZFWA 1H9TA 1V5FA 3VDXA 2FQ4A 3WTWC 1ON1A 4C3HJ 4A3EJ 3QPLA 5AIPA 3MKZA 5LEKA 4JQFA 3KPHA 4IRGA 3A1YA 4UY8I 5F0HA 1MSFC 5HLTA 4CYCA 1ZR4A 3KYLA 1O3QA 1T0FC 3DV8A 3RJPA 2OQRA 3P9KA 2JWTA 3IP4B 3CESA 2L54A 5DV5A 4A3KJ 3CO6C 1BJAA 4EM0B 1MBKA 2UUZA 1L3LA 5FLVA 4ESFA 1W0TA 2WY7Q 3PO3J 3G1LA 3CMMA 2F4MB 2MABA 3S1QJ 5KVRA 1JUPA 2O8KA 4HF1A 4NHJA 4XQFA 2K9MA 2IGKA 2RKHA 5GTIC 1ZLKA 3FXJA 2M2EA 2V1DA 1V4RA 2Y9ZA 3DTEA 5D6EA 5ICEA 3HRSA 5DCMA 4LFUA 1MMSA 4FASD 4XL9A 1RUNA 3B6CA 2DN0A 1HSJA 2VXDA 1GDTA 2L9RA 3WHCA 3A4CA 1TQPA 2DJIA 1IDZA 4A0ZA 2XSJC 1N75A 4U0YA 1ZLJA 2V6CA 4PUSA 3DKXA 4CXFA 4O3MA 4E4HA 4ANJA 3E0JB 1XPXA 2ZJ2A 2KDZA 4NUBA 2BY1A 5L3CA 2RNJA 2L4MA 2R7TA 4HBLA 2R7WA 3FXKA 1YW9A 2HTJA 5ED4A 3VYUB 3SFIA 3IRQA 4EVIA 2F5CA 3GFIA 2VOPA 3BCBA 1NG7A 4E6KG 2Z9OA 2QSHX 2DA5A 3HOSA 2HVRA 2QA4I 3IC7A 1LE8B 3K9TA 1U2WA 3DXJF 2MW8A 5DD8A 1YI2I 4HG2A 2CUFA 2VONA 5CVJA 5AONA 1RKWA 1BC7C 1S7AA 1SFKA 4XMYA 2E5NA 3ZP5A 3QRFF 3OYMA 2W4SA 1JTYA 1P4WA 3E5UA 2HU9A 1RUOA 3A02A 5B1AH 4BYYA 3T5XA 4BJTA 3L9FA 3KIOA 4S05A 2VPRA 5DYMA 3R4KA 2MLKA 5J1UA 1Z67A 3BWGA 1E3PA 2DYSH 4EATA 1WH7A 4XLNF 4AC0A 5TISC 4M9ZA 2V9KA 2CJJA 2R92J 1YITI 4RGRA 5J4VA 5BNGA 3OS1A 2AHQA 4RS8A 2DO7A 5EGOA 2XRNA 5ILSA 1ODDA 2RAEA 1FNNA 2QQBA 3BR1A 2MG4A 2ZSHB 5E79C 4M3BA 3HDDA 3DP7A 3TO9A 2HFHA 3IRRA 4MEXF 2KLOA 1EA3A 3ZQGA 3NWSA 4HLXA 3F22A 5M5WJ 3OL4A 5F04A 3S8PA 4HQMA 4AYBN 2M8EA 2R3SA 3PL8A 2KMUA 4WCGA 2LSOA 2B0LA 3MZYA 4N0BA 2DQRA 3S1MJ 3R0JA 4MTEA 4CICA 3D1NI 4KIFA 2EZIA 2GOXB 1HCRA 1G3TA 1IV8A 2HOAA 4BS9A 4EJUA 2ZKZA 2A05A 4OWRB 4G6DA 4BNCA 1Y6IA 2KRFA 2HPIA 4JP0A 4G8XA 3F3XA 3W6KB 1OLTA 3GUDA 4B8XA 4E7ZA 2JMWA 3TW7A 3WHBA 5CJ9A 5D5XB 4WF2A 1PUEE 1Z3YA 3NQOA 1SMTA 5J1YA 1JT6A 4UUSA 3TEDA 2F6CA 1MMAA 4KMFA 1D0YA 2WWYA 2YU9J 2EJRA 5E1ZB 3RSNA 3PNVA 1HA8A 3QOPA 3HYIA 4A69C 4Y52J 3AKZA 1LJ9A 2DI3A 1IGNA 1SFEA 3C18A 2H94A 4GDFA 1YG2A 3W2WA 1MKMA 2OF7A 4HZFA 3J7YJ 3L2RA 3AL0B 2ZXHA 2WC2A 4NB5A 1YX5A 1IC8A 2DFFA 2WA0A 2VBXA 2X48A 3I59A 2QSFX 1I50J 4IZZA 4XOPA 2GM4A 2EB7A 4ZZLA 1IUFA 4XSXF 3OIQA 2N8GA 4PSWA 3E6CC 4HRIA 3LSKA 3I71A 2XB0X 1MW7A 3H5NA 2BW3A 3H1CA 1XTAA 1J7KA 3K1NA 2CMPA 1B59A 4ZH4F 1H89C 2FBKA 1G3WA 3CQZJ 3OYDA 2QYOA 5CYVA 2JPBA 2V9VA 1JHFA 2VC1A 2R7VA 6PAXA 4BEHA 3LSMA 2XF6A 4XKWA 2F48A 5H6RA 3RDIA 1RETA 2IA2A 2VJ5A 1U5TA 1A04A 2OTLI 4NQWB 1V55H 2GLOA 1VQ7I 3S32A 1D1BA 4BQOA 1YLFA 2F5EA 4ENMA 1I6HJ 2LC2A 2EBIA 2X6YA 2C6YA 4I2OA 4IOCF 5BPIA 1ITYA 4CYDA 4N9IA 2CV0A 3HGGA 2DA3A 2GWRA 2CU7A 1FSHA 3GLLA 2ZXIA 3W3CA 3MFKA 1WZ2A 2FNAA 2DW4A 4L5JA 1YIOA 1JI8A 2EZLA 3JRBA 1FJLA 1OR7C 1WJDA 1OMIA 1V5GA 1O4XA 3LSRA 1WJ5A 1HXDA 2Z1DA 5FFZA 4EV0A 3JRCA 4BDYA 2DPDA 5B3SH 2NVXJ 3OYCA 2OA4A 4AM3A 1K79A 2EWNA 2ESHA 1Z7LA 4JBAA 2JA8J 4ENNA 1UFMA 3FMSA 2CV1A 3O8HA 4AIJA 1VQ8I 4M72A 1W36C 1Z3XA 4D5CA 3FHNA 3I54A 4MTDA 3WU1B 3WTUC 3CCMI 3CC7I 3CUQB 3O2PE 4ZDLA 2VUMJ 3DEEA 1PUFB 2QCOA 1HC8A 1LDDA 1YYVA 2PEXA 2UXXA 3F8MA 5M5XJ 2XKPA 3O6BB 2KIMA 4LGWA 2K9LA 1IN5A 1MD0A 2LYCA 3CLOA 1IN8A 4D5FA 3QAHA 3GFMA 5FFXA 1WJBA 1BR1A 3K4LA 1WPKA 2VKVA 3E97A 3EUHA 2F5VA 3BQYA 3HHHA 4M74A 3TW6A 4AVPA 4BXUA 4HNUA 4XIDA 3RPUD 3QP6A 2L9VA 4PCQA 1D0ZA 4PJ0C 3HOVJ 3W6JB 3LQRA 2LD5A 1EF4A 2RV8A 2V1NA 2CQ7A 2FOKA 1T39A 1DGRM 4I6ZA 4MIMA 1Z6TA 4K2EA 3S93A 2W48A 3WTVC 2AQEA 3RCOA 5FJ8J 2JZYA 2D2WA 4L9JA 4XSZF 4A6DA 1IRXA 3BG6A 5F08A 3SQNA 1WJCA 2XAJA 3JW4A 4TV7A 3OYFA 1OCRH 5JHFA 2JSPA 4EJWA 2FOWA 2P81A 4A5NA 1QA6A 5F27A 3K7AJ 1B8IA 4AUXA 1QZZA 2XIGA 3M1EA 5BMZA 1RIOH 4ZC3A 2YX7A 5IOYA 3DFGA 1F36A 3BLYA 5IT9Z 1S5LC 3K4KA 2STTA 1B9NA 4RM2A 4G7OF 1WFXA 2Z99A 3OSFA 3OOUA 3I5UA 4I99C 3S2HJ 2P5VA 3Q0WA 5HDGA 1R1UA 4E7JA 5GAHJ 3GBGA 4EJTA 3MEXA 3KFWX 3BROA 1WSUA 1H0MA 1O3SA 3ECOA 2V1XA 4MLOA 3A2KA 2BHZA 4V2GA 1GVDA 1VQLI 1ZTRA 1YJ9I 3FXUA 3GEZA 2CUJA 2QQ9A 3VOEA 5E18F 1EH7A 1AWCA 2F4IA 2M4GA 3PFYA 4IHXA 2K86A 4DNCA 4ZTFA 4RA2A 2CYYA 3OMYA 2L02A 1AU7A 1W7PA 2W82A 4Y13A 1R1TA 2KL4A 5CPRB 4EEFG 2L4AA 3OIOA 2HVQA 4I7HA 2K3PA 1HKTA 1SD5A 4Q5SF 1WQ2A 5H6QA 3FWEA 2FUG2 2OCCH 3H9GA 4X1EA 1ZREA 3A01A 3Q9VA 2HKXA 3OYJA 3WTZA 1HKQA 3I0TA 4BXXJ 1GVJA 3ZCOA 3MCZA 2MLGA 1FMVA 2BY3A 2M0MA 2EH3A 1O7LA 4OMZA 4A3BJ 3G1MA 4M6YA 3TP0A 1LDJA 4LLNA 3WU0A 1UG2A 4WXCA 5JLWA 1VQNI 1B1BA 4F55A 5FKOA 1BL0A 3LQQA 3F72A 1RPWA 2KJBA 3CCRI 4B48A 1JKPC 2XF7A 2EFQA 1MJAA 1QNTA 4XORA 4BQQA 4IQJA 3ZOBA 3K10A 1WWXA 1D0XA 1U0JA 1TLHB 3MZ8A 4UV8A 1USSA 5KNLA 5HLHA 2NOGA 4ZZDA 1ETWA 2XAHA 2GA2A 4IHSA 3BOQA 4AWXB 2ZXJA 3AG4H 3TL4X 4QWQA 1S9HA 3TQNA 1X1BA 1XCVA 1VTNC 4A93J 3EETA 1BBYA 1XGMA 3BY6A 1Z0XA 3MN2A 4UHTA 1SFUA 1JKQC 1AKHB 1K78B 1VQ6I 1S7OA 2VASA 4MEYF 2RQPA 2MD0A 1RZ4A 2LP0A 3ABKH 1K4SA 4GRIA 3M9AA 3ZQQA 2VN2A 2IGOA 3D5SC 3OR1C 4MO7A 4YFXF 4RAFA 2MSYA 3ELKA 4W97A 4EGZA 4AD9A 2O8XA 3J7ZI 1MMNA 2OCEA 3GO5A 5K7FA 1QBJA 2X6WA 1B4AA 2M34A 4M6XA 1Y8RB 2COMA 4KN4X 4KITB 3ZMSA 2H8RA 2DAOA 3BQZA 1YJWI 1HLVA 1BJZA 2R7SA 2P5KA 3S2WA 1IV6A 1SVMA 2M1BA 2R5YA 2HQNA 2IS1A 1ETQA 3Q5FA 4KT5C 3UR3C 3U2RA 2D1VA 2EIKH 4YG2F 4F52A 2RGVA 2H1KA 1FOWA 1KZHA 1UB9A 4B09A 4P9UA 1MDMA 4XLEA 3C2GA 4E7LA 1Y1WJ 1HBXG 3SYTA 2WAQN 1B6AA 4D0PA 1BIBA 2EK5A 2RNGA 3U1DA 1J09A 3PIOF 1ZK8A 2B63J 4R8HA 3V7CA 1A35A 2YUSA 1F5TA 4BUPA 2FRHA 3EQLF 5HNHA 4M71A 1D8KA 4OAYA 4G7ZF 4HF2A 3EDPA 3PUFA 1JUMA 3JRAA 1SANA 1Z9CA 3F8BA 3JAMZ 4QSHA 1NK3P 1MBEA 5DM7F 2J5OA 5FGMA 1D3YA 1W5CC 1R49A 2EA4A 4ESBA 3VWBA 1G59A 4PJMA 2BHYA 4L0YB 3K70C 2W25A 3BR5A 3M07A 3LSJA 3E1SA 3B73A 5F1RA 2A6TA 2LBFB 3K4JA 1X19A 3OYAA 4ESJA 1SD7A 2AQFA 4A3MJ 1T0FA 2OU2A 1OCZH 1MH3A 3KP7A 1QZYA 1UAAA 3RYRA 2K9QA 4O5VA 2KZVA 1AHDP 1FBSA 2CQQA 1FPQA 1TNTA 4M6VA 5LBQA 2Y2ZA 5LHHA 4LIVA 1UELB 2IGNA 3S17J 3I56I 3FXOA 5IP7J 3AL0C 4F3QA 3KZZA 5LGNA 2FE3A 2VJ4A 4M3DA 2Q8KA 1R00A 2QZ8A 3SZGA 3I59B 1FIAA 4RAYA 5LGUA 5HDKA 2CFXA 3OWTA 1O3RA 1UZCA 4OIQF 5DUIA 2W57A 4HX4A 2D45A 3WTSC 5GTHC 5DEQA 3IL2A 2DFHA 2FSWA 1F43A 4UNOA 2ZMEB 4C3IJ 2EFOA 1YJNI 4DZJA 5K1YA 3JCUC 1D1AA 2L7MP 3ASOH 1IN7A 4L5IA 3FXMA 1I3AA 2XPVA 2XAQA 3TMOA 4E7HA 3CP2A 5JFRA 3ZPLA 2GA1A 4UV9A 2EV6A 1JJ8C 2NYXA 2Z3YA 1ZG5A 3BZKA 1WHUA 2ICWG 3QYFA 3ZQFA 3RQ4A 5F64A 2XRLA 1XB4A 4P1WA 1CF7A 1YRNB 3BG3A 3PSFA 2X1CA 4A3FJ 4A12A 1QO0D 2CGPA 4FISA 4XM3A 3PJRA 1J5YA 3HKZN 3MQ0A 1VQMI 1LNWA 1D8JA 2V1UA 4AYBA 2P4WA 3ZMUA 1U78A 1Z7UA 2J5PA 2IJLA 3M8EA 4WWCA 4LB5A 1OYYA 4GYIA 3FK6A 3LFUA 3ZXSA 4GYGA 1HQCA 2OD5A 1YE9A 1E3HA 2A5WA 3DF8A 4MNUA 1YX3A 3DEWA 3OOPA 3C2BA 3L2WA 2JSCA 2W85A 1Y39A 4A0YA 1KU3A 3EUKL 4UB6C 1IDYA 1GT0C 2HEOA 2V6EA 2R7XA 2ESNA 2NAZA 4CCKA 2AXTC 4L9VA 3GTOJ 3GX4X 1C0WA 2BV6A 3JRFA 3LMMA 1FYLA 3IH2A 4XBFA 1IZ1A 1TQIA 5B1BH 3SHFA 3V8KA 1A6IA 3CUQC 5DDGA 2ZNYA 4Q4ZF 4JOMA 1R23A 4M9SA 4F7ZA 3GZ6A 3H3VK 2R93J 4G9YA 2XC7A 4S04A 4U7BA 4GXOA 2Q1ZB 4L9NA 2YR2A 2L9NA 2LY1A 1T08B 2DA1A 3R0AA 5K7ZA 3GWZA 4A2UA 4QIWN 5D5WB 2R5ZA 3U9GA 1APLC 1HW2A 1LVKA 4Y15A 2IA1A 2Y9YA 2ETHA 2E19A 1G2HA 3NEUA 4BHPA 3OYKA 1LFBA 2XKOA 4BQNA 2XHKA 5EJCA 2JTVA 2XUBA 3FX3A 1G8XA 4DYRA 1W7PD 2NOJB 2AXLA 4PGHA 3TO6A 5E3MA 3WTXC 2XROA 2EPFA 1B72A 2K9NA 3LA7A 5KAFC 3IKTA 2DQLA 2CQXA 1KYZA 2UV1A 3ZR8X 3MWMA 2K9SA 2NS8A 2O0YA 2HS5A 2FMYA 2L7ZA 4MHGA 4BL0B 3AAFA 2CUEA 2E5ZA 4CHUA 3F8FA 2M4KA 3HOZJ 2ME0A 1OFCX 3FBIB 2QWWA 4R79A 4BBSJ 1A6QA 3QPSA 3JRHA 1TWGJ 1MSEC 4JYKA 2QENA 1FZPB 2CSOA 3JRDA 5CVRA 1YTYA 1U6GA 2EIMH 3WTTC 5IOZA 3SDBA 3GTPJ 5K5RA 3D0SA 1QZEA 4Q48A 3RKXA 2R7FA 2QEXI 4IKFA 2O3FA 1U3EM 1UJ8A 2DMQA 5EEAA 3H0GJ 3J81Z 3DKWA 1J0RA 5J47A 2NNYA 2M45A 3GTQJ 4PJJA 4DBRA 4KA4A 2DCEA 2Y75A 3MKYB 4A3DJ 1ACIA 2PG4A 3GTMJ 1AA7A 4EJOA 1ZKGA 1X3UA 2B7EA 3H5AA 4HDVA 2X6OA 1X1PA 1WI9A 4L18B 3ZN0A 2ZJRF 4JX5A 2W1OA 4WXDA 1G6NA 2MH9A 4BJ5C 1DGWY 2VJJA 4FETA 1I6XA 3BDDA 2DT7B 1NHAA 3ZRGA 1O3TA 4KYWA 3K6GA 1K7AA 1ETOA 1N25A 4HQEA 3DLAA 2QSGX 2NRAC 2COBA 4OOIA 3E6BA 4C2TA 2ZB9A 4LG0A 4LG3A 3M8FA 2LH9A 2X9DA 2PJRA 1HW1A 1T2KA 2F5DA 1Y56A 4BKXA 3HBLA 3GZNB 3ASNH 5EZHA 3JRIA 3HOXJ 1X3ZB 4BBRJ 1IAWA 2V26A 3LSPA 5FO5A 2GZWA 1Z77A 4OIPF 1H8AC 3DTKA 4Y17A 4RBOA 1S72I 3H35A 1SMYF 1A31A 1H88C 3I58A 9ANTA 5E3LA 4BH9A 1AOYA 1DQUA 1OPCA 3IUOA 3ZQIA 1VQPI 1LFPA 3MKLA 3CCYA 1IO2A 2M9HA 1OR7A 4XICA 2VBZA 3GMEA 4IOAF 3KP5A 3OR2C 2QBYB 3W6VA 5KK1A 2LREA 3CUOA 2DJNA 2LY2A 3DBHB 2E1OA 4BU2A 3EYYA 3PSIA 3ZQ7A 1BR2A 4OIRF 3HUGA 5LRRA 2G7UA 3E3VA 3E6DA 5J8FA 4HAMA 4A3LJ 1JGSA 3P5JA 5IPAA 4HLYA 3ZQHA 3HPGA 4DYCA 5CVVA 3F23A 2LTPA 4MFDA 5C44J 1I5ZA 3N4MA 2Q2EB 3FBNB 1K6OA 5L3EA 2JA2A 3KP6A 2E1CA 2KP6A 3BG9A 4D9JA 2CV2A 5D4RA 2A68F 5FLXZ 5GAEJ 4KN7X 1X2MA 2CRGA 3BJ6A 4KMUX 4XRFA 2F4OB 2Y48A 1SFOJ 2NNNA 2VT3A 2ACJA 3HHGA 5EG0A 3TDZC 5J8CA 1IRFA 3CJQB 3QPHA 5M5YJ 2V79A 4EM1A 3L2QA 2NVTJ 1IUYA 4PK4A 2ECBA 2XGXA 5BQTA 1CQTA 3ZGKA 2VKDA 1GHCA 2VLAA 2KJCA 4GCVA 4D7NA 1BOBA 4Y7NJ 4RB1A 3JTHA 2VQCA 1PDNC 1FT9A 3KEQA 1TT5B 1FWZA 4ZYAA 2QUFA 1TWCJ 3LOCA 2DT6A 4C2MJ 5H20A 1FLIA 3HGYA 3L2VA 2OJED 2OQGA 4UVBA 2ELJA 3FMRA 2BXYA 1IN6A 3GF2A 5BOXA 5HNFA 1D5YA 3HRUA 4N9HA 2EFPA 2M8GX 3FMQA 2UWMA 1USTA 5LHGA 3CD6I 2VQHA 4FX0A 1I1SA 1P4AA 3PQJA 4BDZA 1VQOI 1FSEA 3RPQA 3V7SA 2O9LA 5CQGA 3RKWA 3LSHA 2LF8A 1HSTA 2GXAA 5IT9K 2FU4A 4E7IA 3ZQCA 4DOZA 2LKXA 2TDXA 3BR3A 2IA0A 3ISPA 3FK7A 3GLXA 3PNYA 4CCJA 1BI3A 2PMZA 4KNYA 2Y0SN 3SEZA 4EJVA 4ZYDA 1FYMA 1BM9A 2BVMA 4CH7A 1OCCH 1WKMA 1RESA 2DA6A 3G6EI 1SD6A 2H1LA 2EA2A 1P2FA 1WI3A 3TDUC 3DPLC 2KT0A 5FD5A 2LRDA 3W2AA 3K1PA 3HXLA 4F93B 2ZMEC 3D5LA 5TRDA 3S3MA 2LLKA 5HLIA 3V7RA 4LITA 2KRHA 2EV0A 2RC4A 3FZVA 2OTJI 2VPLA 4PZJA 3WGIA 2A6EF 2LY9A 5CVIA 5LEJA 5KAIC 5EYRA 2Y0MA 1LVAA 1R5HA 2E36A 3I53A 3GTLJ 2R7ZJ 1OCPA 1H9GA 2QVOA 3WODF 3RZOJ 3CCLI 1GLNA 1OJLA 2IRFG 2V7FA 4JK1X 4DW6A 2K4JA 1ZN2A 2ZXWH 5HLGA 1IRGA 1S8NA 4YFKF 3BT9A 3SZTA 3F9KA 5LLQA 4AU7A 3DKYA 1X1DA 1V54H 1JKRC 1NG6A 3RKQA 3VYSB 1SAUA 4OINF 2HOEA 5K5QA 3IH3A 3RYPA 1YQAA 3E6MA 3HSRA 2L7FP 1RR7A 3SJMA 1LE8A 4U0WA 3BPVA 4Z6YA 3GYHX 4YELA 1S7EA 3ABUA 3FHZA 1R5GA 2L7KA 3QODA 2PN6A 3HPHA 3VFZA 2DOFA 3PM1A 4CYCB 2IAIA 4HYEA 4XRSA 1TWAJ 1X58A 2PX9A 3HOYJ 2A6HF 2PMHA 3V42A 4C30A 2E2JJ 3NWTA 2HOSA 4RLFA 1WGXA 4XN0A 2MFZA 3EPZA 3ESWB 4FE4A 1TW3A 2JUGA 4RM3A 3M3YJ 3BG5A 1RNLA 3FKJA 4P5OA 2K7LA 4YRVA 3G3ZA 4XOTA 2MD5A 2HDDA 1ULYA 3RZDJ 2PQ8A 1MBGA 1ONVA 5F0CA 1JT0A 4ITVA 3H9QA 4HF0A 2MA3A 1KU9A 2UXNA 3ABLH 1MH4A 4KICA 4I76A 5DCMB 2X0LA 3TKYA 2HR3A 3G73A 2O7OA 2VKHA 4I01A 3PNTA 3KEOA 2QQ8A 1FTZA 3IHUA 4ETSA 2DT5A 2XASA 1GV5A 5M3MJ 1RI7A 1XD7A 1QGPA 3J80Z 4FQGA 1Z91A 1IF1A 4G6QA 4DZPA 5E17F 4F92B 2JQ7A 4LD5A 4ZJZA 4OMYA 1QU3A 2E1NA 3DCFA 5FKLA 2XAGA 3OYEA 4CUGA 4OIOF 2HWVA 2M30A 2GXGA 4WK8F 1KA8A 4BGDA 1VF9A 3L1PA 2Y69H 4IPAA 1I3QJ 1O57A 3OS0A 2LF7A 2HQ5A 4KIBA 5EF6A 1IN4A 1SC7A 2TRTA 2HPMA 2PJPA 1ZG3A 1W5SA 5IY5H 5K5OA 1YFHA 2P7CB 2ZFUA 3WG9A 3F0CA 3JSPA 3G2BA 3L2CA 1F4KA 3VSKA 5E8GA 1R1VA 4BHBA 1MMDA 2XV4S 4DIQA 4LB6B 3JAMK 2E60A 2JA5J 3K4BA 2FJ1A 1VQ4I 2ADUA 1TWFJ 3CF5F 4ENJA 3PQKA 1FYKA 1ZR2A 4XRMA 2R0QC 5CVUA 3K0LA 5HS9A 2CUZA 5HOOA 3JRGA 3FISA 3ABMH 3UNGC 4XKVA 3HKZA 4CDGA 1U8RA 4QLCU 4UXNA 1LEBA 3P9IA 1BI1A 1SAXA 4XLPF 3TOBA 1NH3A 5EGOB 3GTJJ 3RKYA 3D5RC 2R7UA 4M3FA 3T0YA 3ZQLA 1E17A 2KHMA 3P7NA 4YIFA 4DQ2A 1PVEA 3L7WA 1O7FA 1YOVB 1G3YA 1ETVA 3W2VA 4PSXA 2ELKA 4R1HA 5FRNA 3L09A 2X1EA 2D5VA 4HNTA 3S3NA 2H09A 2HQRA 1SFXA 4B43A 1MNDA 4BJ6C 2X85A 1E0EA 3WGGA 1IRZA 1I39A 1KQ0A 1MIJA 2DU9A 1QHGA 2D1HA 2DDAA 1FTTA 1T95A 1IXCA 3QU3A 2JVGA 3BC8A 4CO8A 3AG3H 5EZGA 1W36D 1I1GA 1RKTA 3BR2A 3FKIJ 4NQWA 4II3A 1TBXA 2DDBA 1EV7A 2RDPA 2BE5F 1T38A 2E35A 4RB3C 3ABTA 4XRSG 3ERED 5KHDA 2DTZA 3O8GA 3TOAA 2K4BA 2Y31A 1E2XA 4ASNA 1XSXA 5LRSA 3JREA 4J00A 4UUSB 2IS4A 1VQ9I 2QF7A 3ZMTA 2JRTA 2DXIA 2IP2A 1T33A 3FXLA 1RR8C 3G71I 4I98B 2FMLA 3HOUJ 5IT3A 2DA2A 1ZH5A 1NK2P 1JKOC 3TBIA 4NNJA 5TGTA 1MNMC 2IBDA 2QKMB 4YFNF 2VOOA 3OV8A 4MGRA 1R9TJ 1ZELA 4A6EA 2QQAA 3K2ZA 4ZDOA 3ZMZA 5D8KB 3FXRA 5J6XA 3LWFA 4ABZA 2W84A 3BPXA 4HOBA 3SXYA 3ONQA 2X6XA 3S1NJ 2P5LC 4O6JA 3RTRA 2ZCWA 4CCNA 2K5CA 2OUMA 4HV6A 1V3FA 1Y0NA 4G94A 3BJOA 2R7QA 2HDWA 2JVHA 4ON0A 2VC0A 5LHIA 3DQVC 1ETYA 4IHYA 2BW3B 1PJRA 3CUQA 4EQQA 5GADJ 2AO9A 3UKGA 4AIDA 2EINH 2GAUA 5F6FA 5E20A 4HA8A 3OYNA 1PUFA 4FT8A 2HGCA 1GUUA 2FNPA 4HEA2 2LVSA 2Q0OA 3MMYB 1FP1D 3IWZA 4XR6A 2WBMA 1V5EA 1LPQA 3NAUA 3CCSI 1U9NA 2HYGD 4P96A 3KETA 4E7KA 3R60A 3TO7A 4BEHB 2ISZA 1T6SA 4P55A 1P92A 3CC2I 5FKMA 3I9V2 3K4NA 2DLLA 4Y33A 3HG9A 1U5TB 2R4GA 1IG7A 2ZJQF 2EQRA 3KLNA 5LFAA 3WE3A 5E1XA 1ZHFA 4XLHA 3MKWB 5IYBJ 3CJTB 3SEQA 3REOA 3J7AY 2K85A 2BXZA 1A36A 1HKSA 4ZTJA 3BG7A 3BR6A 2FBIA 3CDLA 4YEJA 2XPWA 4I0BA 1Z21A 1K4TA 4P9FA 5B5EC 4AVZA 1XDSA 2QLZA 3QOEA 4CCMA 2XGDA 1D1CA 2DA4A 3HC7A 1JE8A 3M8JA 3KZYA 2PLYA 3BTLA 1FMWA 4QPOA 3HEFA 5E1WA 1ZG1A 3E5QA 1J75A 2GXBA 4PJLA 4GFBA 4N4OB 2A69F 1BW6A 2WB1N 3ZMVA 4PGGA 4IHWA 1TTYA 3BZ6A 2DFIA 1S6LA 3DPTA 3H92A 4X0GA 1WH5A 3RPUA 4D7MA 4FHTA 2EZKA 2L01A 5ICFA 5HVQC 2HI3A 4IEJA 4IVNA 4PDKA 2AS5F 2FF4A 2GOMA 3OYGA 2ZJPF 3A03A 3BZCA 1QVUA 1YHQI 5A2QZ 4A3CJ 1DU6A 4ZDPA 3H0DA 1HF0A 5J4YA 1ZGWA 2V9PA 5JHUA 2W24A 3DU5A 2KRCA 3IKVA 1BI2A 5ERIA 2FBHA 5GAGJ 2DOAA 1CGPA 4NC7A 5D4SA 2HYFA 5EEGA 4BE0A 1YIJI 4KISA 3LSIA 3M4OJ 1N78A 1SD4A 2F5FA 2WV1A 4RGXA 4Z2YA 4A0XA 4JX4A 2R7OA 3DBLB 1X1AA 3J81K 3ERMA 2G9WA 4MFEA 2XB5A 4U7DA 3CCVI 1MBFA 2XF5A 4OU0A 2XGEA 4HNVA 2G7HA 2GIVA 3BCAA 5DS9A 3ZN1A 1R5ID 2JJ7A 3FM3A 3FF5A 5K7HA 4L0ZB 1TWHJ 2PMUA 2ME6A 3WU2C 1VFCA 1B8IB 1XGSA 2FX0A 1K6YA 1DPUA 1M1EB 2BVLA 2YX4A 3BJAA 2OZ6A 4IHTA 4CZCA 3QQAA 4LLGF 2GBYA 5L3GA 1ENHA 1A5JA 3ULQB 3TGNA 3MVPA 4FX4A 3L2UA 4U87A 4XKBA 5L3DA 3HOWJ 3CJNA 5CLSA 2JUCA 3OYLA 2CS3A 3HJEA 5D6FA 2NXNB 2XSDC 2CH0A 4G6TB 1AKHA 4D1QA 1OCTC 1K78A 1P4XA 1YW8A 3OS2A 4UVCA 3KCCA 3BTJA 1FY7A 2ZNZA 3HIFA 3CLQA 2NVUB 4IJAA 2JA6J 1B9MA 1R22A 1YS7A 4Y4RA 1W7PB 1P9QC 4IQ4A 1PP8F 4A5MA 2IPQX 1SVLA 2MBFA 3B6AA 3PIPF 3A01B 2EIJH 4HW0A 3K70D 2RQQA 3U21A 3HSFA 2JA7J 1VQKI 2HYJA 1K83J 1QPMA 1YO5C 1ZQ3P 4AIKA 3NRVA 4I02A 1J9IA 3RI4A 4XKCA 2MC4A 5FKKA 1FX7A 1MBJA 1E3OC 3T8TA 1HOMA 2ECCA 2EFNA 4HDUA 4JX6A 1XMXA 3KP2A 1EH6A 4BHCA 2CW7A 2ZO4A 3AG1H 1POGA 2O5RA 1W5TA 3B02A 4KIGA 4NBQA 4X6AJ 2F2EA 1LDKB 1MBHA 2LR8A 4MQVA 1Y1VJ 2HXOA 2KISA 2KIFA 4XN3A 2Z2SB 1UMQA 4LOCA 3LNQA 2Y0SA 5FLXK 3QP5A 3CO7C 3KYCB 4RGUA 4L5EA 5GPAA 4B4CA 2DMPA 4CCOA 2FD5A 3I3LA 1N77A 3Q3SA 4FCYA 3RIRA 5J1RA 2L2OA 3NARA 1R4MB 5CKTA 1UHSA 2JPCA 1KQ9A 3WGHA 1FOYA 3COAC 1QPIA 3L00A 2WTEA 3HL2A 4A3GJ 4C9YA 1STZA 2P6SA 3LA3A 1F9NA 2ID6A 1BI0A 3CMEI 2P8TA 4Q47A 1IW7F 2E1MB 2NVQJ 1P6RA 1KGSA 2LBFA 4IXAA 5E3OA 1XMAA 2KIUA 3MD2A 2VL8A 4LMYA 4XLCA 3VYTB 2VBWA 1OQYA 4XK4A 2W7NA 3S1RJ 1T8IA 2E2IJ 3SDGA 1QRYA 2PFBA 2XGCA 4GGGA 4XNFA 2X51A 4C2UA 2DBBA 1ZYRF 2CQKA 4FTHA 1ON2A 2ISYA 3KZIC 4I09A 1GXPA 3CJRB 4M73A 1ERDA 3GTKJ 2R5YB 4DJAA 3U1KA 4IHVA 3E7LA 4KDPA 2DMUA 3PO2J 3KEYA 2H6CA 5IP9J 1BC8C 1MDMB 2FA5A 3H3UA 2O61A 2ZMEA 1Z1DA 1KONA 3Q0VA 3Q9SA 4GO1A 4EMSA 3FXQA 2E7WA 3K4MA 2E34A 3V8JA 4LIUA 2ELHA 2KPMA 4CZZA 2RVCA 3HOTA 2OPTA 1LKXA 1TW2A 2HTSA 2FXAA 1R36A 2HXIA 5L3BA 1TZLA 3C7JA 1LB2A 2ZC2A 1XGOA 4NC6A 1MZBA 2QKLB 2DK8A 1ETKA 1R58A 1EJ9A 1FOXA 1XSDA 3A0HC 1G3SA 1OKRA 2XPUA 4ZYGA 1I27A 5HODA 1YRNA 4BAYA 2KQRA 3ECHA 1MGTA 3GXOA 1IXRC 2EV5A 3DWLE 2IT0A 2HZTA 1W0UA 2GQQA 5IP6A 5IYCJ 3FDYA 1X2NA 2BYVE 2H6BA 4N4NB 4BXFA 3JTGA 4A3IJ 3F8NA 4W1UA 2NVYJ 1ORKA 5GP9A 3LAJA 2I8DA 5GPCA 3LA2A 1XCBA 2EFWA 5L3FA 4AIHA 2MH2A 4V19K 2DOEA 5C4XJ 2OZUA 2A07F 3GZ5A 3KE2A 3DPUA 4Y3OA 2YSRA 1FIPA 1WRJA 3ROUA 2B9SA 3JSOA 1Y0UA 4B1RA 2JT1A 2QM3A 4G12A 3QWLA 3WE2A 4S0HB 4YIRX 3JR9A 1KYWA 5E8IA 3IV5A 3IWFA 3FIWA 3GCMA 3N05A 2IXSA 2BOLA 3G4SI 2E71A 2HKOA 5ICCA 1QVTA 5JR3A 1DU0A 1OYIA 4I0AA 3DBRB 4KUMA 4CA0A 2XAFA 3KP4A 4XLAA 3MZHA 1REPC 1DPRA 3I4NJ 3VPRA 5FD6A 3HZJA 1RC9A 3DU6A 2BZTA 3VODA 2MYSA 3IAM2 2QGUA 4UVAA 3AFHA 3R6SA 4J19A 5IYDJ 1YS6A 4LJZF 3IAS2 1D5VA 2DMTA 1R71A 3ML6A 4HSTA 4UB8C 1OCOH 3F6VA 2GIZA 1S29A 2IW5A 1XMKA 1KU7A 1WVRA 5DD4A 3LSGA 4YIIA 1R7JA 3HSEA 3QYBA 1XDUA 1XG1A 4PJNA 2A61A 2WADA 2XDVA 1U5TC 2R7RA 1UHWA 4L9TA 5HS7A 4BE1A 3ZMDA 2V4JC 1WCMJ 5JI6A 4HX7A 1FC3A 1CF7B 3T1BA 2DTRA 4ENKA 2K27A 2EZHA 5F0FA 2Y30A 3CP8A 3IH4A 4XONA 3J80K 5AIQA 2HDCA 2WAQA 1OISA 4RB0A 1DP3A 2HNHA 1FBQA 2VE8A 2K02A 2ID3A 3OIPA 5LGTA 3CTAA 2DODA 2LG4A 2O03A 4II2A 4HPQA 2K40A 1PYVA 2IVMA 1X1CA 4RLQA 2KKOA 2UZKA 2LKSA 2FQ3A 3FM5A 3GVAA 2CO5A 4IX7A 1F1ZA 1Q1VA 2HQAA 2VQLA 3I4MJ 3HRMA 2CFOA 4B3XA 2LKPA 3EYIA 2JK3A 3R61A 2PBIA 1BW5A 1TT0A 3F21A 1U8BA 1FP2A 3A0BC 3HB9A 2JN6A 3HTSB 2KZGA 2VODA 1UCRA 4RDUA 2M3AA 4EGYA 3K4CA 1ZAOA 5DTDA 4NDLA 4RAZA 1JTXA 3DEUA 1TL8A 2BGCA 2M0CA 3T8RA 2WAEA 3OYBA 1T98A 2STWA 2VI6A 3OSGA 1TP4A 3RQIA 4IO9F 1ZRFA 2VIXA 4ZYHA 3P9CA 2LNBA 2XAUA 5DM6F 2BY0A 3CCEI 2VB6A 1ZRCA 5HDNA 2R5ZB 1EH8A 2YU3A 4DGWB 1DUXC 3S14J 2LFBA 4DYQA 3EUHC 2IS6A 2M5WA 2XVCA 2HZDA 4IL6C 2OV7A 3SFZA 5H2FC 4CGZA 3S15J 4HX8A 2ZBKA 2ZSIB 2R7DA 3CC4I 2TCTA 1JHHA 2JRMA 4QTRA 1GV2A 3BTCA 5C4JJ 1B72B 1HDPA 1Y8QB 5EDNA 1J59A 4BE2A 1XN7A 3O3KA 1FBUA
chains in the Genus database with same CATH topology
2DMQA 5EEAA 3H0GJ 2EZLA 3JRBA 1FJLA 1O4XA 2I10A 3LSRA 2DA7A 2LK2A 3G1OA 3JRCA 2EQRA 1IG7A 3GTGJ 3GTQJ 2NVXJ 2JA8J 3TP3A 5IYBJ 4A3DJ 3GTMJ 3O8HA 1VI0A 1ZKGA 4D5CA 1ETXA 2X6OA 2PMZN 4JX5A 5JLXA 2VUMJ 5FKNA 1PUFB 2QCOA 3BR6A 3CDLA 5M5XJ 4C3JJ 2XPWA 4UUTA 1ETOA 4D5FA 1JJ6C 2XGDA 2DA4A 2COBA 1IJWC 2ZB9A 3BTLA 3HEFA 1VNDA 1WPKA 2VKVA 4GFBA 1T56A 3BQYA 3Q0UA 3TW6A 4B3AA 4XIDA 1NTCA 2HOTA 5C3EJ 2WB1N 1BW6A 2X9DA 3HOVJ 4IHWA 2LD5A 1EF4A 4BY1J 1BA5A 1TC3C 4BKXA 1WH5A 3HBLA 4D7MA 5EZHA 3JRIA 4I6ZA 3HOXJ 4MIMA 4BBRJ 3LSPA 2EZKA 2W48A 1Z77A 5FJ8J 1H8AC 2HI3A 4RBOA 4IEJA 5F08A 1H88C 9ANTA 5E3LA 3A03A 1QVUA 3ZQIA 4A3CJ 2P81A 3CCYA 2M9HA 3MKLA 1DU6A 1HF0A 5F27A 3K7AJ 4XICA 4AUXA 1ZGWA 1B8IA 2DMNA 5IOYA 3W6VA 1F36A 2DJNA 2YS9A 2E1OA 4FE7A 2NS7A 3OSFA 3OOUA 1XS9A 4A3LJ 3S2HJ 3Q0WA 5IPAA 1P7JA 3ZQHA 4DYCA 3GBGA 5FLMJ 3M4OJ 2WV1A 2LTPA 4MFDA 5C44J 1U9OA 4JX4A 4MLOA 4MFEA 5F1JA 4V2GA 1GVDA 2XB5A 1ZTRA 3BG9A 1MBFA 4IHXA 1X2MA 3S16J 2CRGA 2XGEA 4HNVA 5DS9A 1AU7A 2JJ7A 1FEXA 5K7HA 2L0KA 1SFOJ 1TWHJ 2ME6A 4EEFG 3OIOA 2VKEA 1VFCA 1B8IB 2FX0A 1XC5A 4X1EA 5EG0A 2MGQA 3BTIA 3A01A 3QQAA 5M5YJ 2GBYA 1A5JA 1ENHA 3S2DJ 2NVTJ 4V2FA 3MVPA 4BXXJ 2ECBA 4M3EA 3HOWJ 1CQTA 1P7IA 2EH3A 1LFUP 4D7NA 4Y7NJ 4A3BJ 2XSDC 3G1MA 1OCTC 1AKHA 3TP0A 1UG2A 5JLWA 1TWCJ 3BTJA 3LOCA 4C2MJ 5FKOA 5J3LA 1BL0A 1RPWA 3HGYA 2JA6J 2G0EA 1JKPC 1D5YA 1JUSA 3ZOBA 5E3NA 3K2AA 4BY7J 2M8GX 5EG0B 3B6AA 3A01B 2NOGA 2O9LA 2JA7J 1ETWA 2HYJA 1K83J 1ZQ3P 2E2HJ 1JGGA 5M3FJ 3ZQCA 5FKKA 1K61A 1MBJA 1E3OC 3CMYA 4A93J 2LKXA 1HDDC 3BR3A 2ECCA 3BR0A 1HOMA 4JX6A 1Z0XA 3MN2A 4A3JJ 1JKQC 3FK7A 1AKHB 1POGA 4M3GA 2Y0SN 2LP0A 4X6AJ 1MBHA 2IEKA 2LR8A 3HM5A 1Y1VJ 1RESA 2DA6A 2HXOA 4MO7A 4W97A 2MSYA 2FQ4A 1UMQA 4LOCA 3LNQA 1WI3A 4C3HJ 4A3EJ 3QPLA 2KT0A 4L5EA 5GPAA 4B4CA 2DMPA 2FD5A 5K7FA 3Q3SA 4FCYA 5F0HA 2M34A 1MSFC 2LLKA 4CYCA 1ZR4A 5J1RA 2H8RA 3BQZA 1HLVA 3NARA 1BJZA 2JWTA 4A3KJ 1UHSA 2LY9A 1IV6A 5EYRA 2R5YA 1QPIA 1MBKA 1ETQA 4A3GJ 3GTLJ 2R7ZJ 5FLVA 1W0TA 3PO3J 1OCPA 3G1LA 2H1KA 2ID6A 3RZOJ 1OJLA 2NVQJ 3S1QJ 1Y1WJ 1JUPA 4DW6A 2O8KA 2WAQN 5E3OA 3BT9A 1ZK8A 2B63J 2M2EA 2Y9ZA 1JKRC 3RKQA 4XK4A 2YUSA 3S1RJ 2E2IJ 3IH3A 3SDGA 2XGCA 1QRYA 2L7FP 1RR7A 3SJMA 1LE8A 3B6CA 2DN0A 1S7EA 1JUMA 3JRAA 1SANA 3PM1A 4CYCB 4FTHA 4QSHA 2IAIA 1GDTA 4XRSA 2L9RA 1NK3P 1MBEA 1TWAJ 1X58A 3WHCA 3HOYJ 2E2JJ 1IDZA 3GTKJ 2HOSA 2R5YB 4IHVA 3E7LA 1WGXA 2DMUA 3PO2J 3BR5A 4FE4A 3LSJA 5IP9J 3M3YJ 3BG5A 2KDZA 2HDDA 3Q0VA 3RZDJ 1MBGA 5F0CA 1JT0A 4A3MJ 3SFIA 1MH3A 2K9QA 1AHDP 2DA5A 1MH4A 2OPTA 2CQQA 2HXIA 4I76A 4M6VA 2Y2ZA 1LE8B 3S17J 2O7OA 5IP7J 1FTZA 1ETKA 2MW8A 4M3DA 2CUFA 1RKWA 1FIAA 1GV5A 5M3MJ 2XPUA 5HODA 1YRNA 1JTYA 4DZPA 3A02A 1W0UA 5IP6A 5IYCJ 2VPRA 1X2NA 4A3IJ 5J1UA 3DCFA 2NVYJ 4W1UA 1ORKA 5FKLA 1F43A 1WH7A 5GP9A 4AC0A 2R92J 2CJJA 5GPCA 4C3IJ 5BNGA 4DZJA 1VF9A 3L1PA 2AHQA 2L7MP 5C4XJ 1I3QJ 5EGOA 2XPVA 2HQ5A 5EF6A 2RAEA 2TRTA 1FIPA 3BR1A 2MG4A 4B1RA 4G12A 4M3BA 1JJ8C 4S0HB 3HDDA 3JR9A 3F0CA 3IV5A 3ZQFA 3FIWA 3ZQGA 2XRLA 5M5WJ 5F04A 4AYBN 1YRNB 3BG3A 1QVTA 4A3FJ 1DU0A 4FISA 2JA5J 2FJ1A 3HKZN 3S1MJ 1TWFJ 3D1NI 1ZR2A 4XRMA 2R0QC 2EZIA 3I4NJ 3VPRA 1HCRA 1U78A 3JRGA 2HOAA 3FISA 3FK6A 5IYDJ 4J19A 5EGOB 3GTJJ 2DMTA 4JP0A 4M3FA 3ZQLA 3DEWA 2JMWA 3LSGA 3C2BA 3TW7A 3WHBA 1XG1A 1ETVA 5J1YA 1JT6A 4UUSA 3TEDA 1IDYA 1GT0C 2ELKA 1WCMJ 2YU9J 2D5VA 2EZHA 5F0FA 3GTOJ 4A69C 2Y30A 3IH4A 4Y52J 3JRFA 1IRZA 3IH2A 1IGNA 1A6IA 1FTTA 2ID3A 2OF7A 3H3VK 2R93J 1IC8A 2X48A 5EZGA 1I50J 1RKTA 3BR2A 3FKIJ 2K40A 2GM4A 2DA1A 4XRSG 5K7ZA 1IUFA 4QIWN 2N8GA 2R5ZA 2DTZA 3O8GA 1APLC 2XB0X 1Q1VA 2Y31A 2Y9YA 3I4MJ 2E19A 3JREA 4UUSB 1G2HA 2JK3A 2QF7A 1LFBA 1H89C 1BW5A 1T33A 3CQZJ 1U8BA 3HOUJ 2DA2A 2JN6A 3HB9A 1NK2P 4DYRA 1JKOC 5E3MA 1B72A 4RDUA 2IBDA 1MNMC 2K9NA 5DTDA 4NDLA 1R9TJ 1JTXA 2CQXA 2M0CA 1RETA 4ABZA 3S1NJ 2VI6A 2K9SA 2NS8A 3OSGA 3RQIA 2GLOA 2L7ZA 2CUEA 2R5ZB 3S14J 3HOZJ 2LFBA 4DYQA 2ME0A 1OFCX 4BBSJ 1ETYA 4IHYA 3S15J 1I6HJ 2EBIA 2AO9A 3UKGA 3QPSA 3JRHA 1TWGJ 1PUFA 1MSEC 4JYKA 1GUUA 3JRDA 2TCTA 2LVSA 1ITYA 4QTRA 1GV2A 3NAUA 3HGGA 1U9NA 3BTCA 5IOZA 2DA3A 5C4JJ 1B72B 3GTPJ 2CU7A 1HDPA 5EDNA 5FKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMQ A;  5EEA A;  3H0G J;  2EZL A;  3JRB A;  1FJL A;  1O4X A;  2I10 A;  3LSR A;  2DA7 A;  2LK2 A;  3G1O A;  3JRC A;  2EQR A;  1IG7 A;  3GTG J;  3GTQ J;  2NVX J;  2JA8 J;  3TP3 A;  5IYB J;  4A3D J;  3GTM J;  3O8H A;  1VI0 A;  1ZKG A;  4D5C A;  1ETX A;  2X6O A;  2PMZ N;  4JX5 A;  5JLX A;  2VUM J;  5FKN A;  1PUF B;  2QCO A;  3BR6 A;  3CDL A;  5M5X J;  4C3J J;  2XPW A;  4UUT A;  1ETO A;  4D5F A;  1JJ6 C;  2XGD A;  2DA4 A;  2COB A;  1IJW C;  2ZB9 A;  3BTL A;  3HEF A;  1VND A;  1WPK A;  2VKV A;  4GFB A;  1T56 A;  3BQY A;  3Q0U A;  3TW6 A;  4B3A A;  4XID A;  1NTC A;  2HOT A;  5C3E J;  2WB1 N;  1BW6 A;  2X9D A;  3HOV J;  4IHW A;  2LD5 A;  1EF4 A;  4BY1 J;  1BA5 A;  1TC3 C;  4BKX A;  1WH5 A;  3HBL A;  4D7M A;  5EZH A;  3JRI A;  4I6Z A;  3HOX J;  4MIM A;  4BBR J;  3LSP A;  2EZK A;  2W48 A;  1Z77 A;  5FJ8 J;  1H8A C;  2HI3 A;  4RBO A;  4IEJ A;  5F08 A;  1H88 C;  9ANT A;  5E3L A;  3A03 A;  1QVU A;  3ZQI A;  4A3C J;  2P81 A;  3CCY A;  2M9H A;  3MKL A;  1DU6 A;  1HF0 A;  5F27 A;  3K7A J;  4XIC A;  4AUX A;  1ZGW A;  1B8I A;  2DMN A;  5IOY A;  3W6V A;  1F36 A;  2DJN A;  2YS9 A;  2E1O A;  4FE7 A;  2NS7 A;  3OSF A;  3OOU A;  1XS9 A;  4A3L J;  3S2H J;  3Q0W A;  5IPA A;  1P7J A;  3ZQH A;  4DYC A;  3GBG A;  5FLM J;  3M4O J;  2WV1 A;  2LTP A;  4MFD A;  5C44 J;  1U9O A;  4JX4 A;  4MLO A;  4MFE A;  5F1J A;  4V2G A;  1GVD A;  2XB5 A;  1ZTR A;  3BG9 A;  1MBF A;  4IHX A;  1X2M A;  3S16 J;  2CRG A;  2XGE A;  4HNV A;  5DS9 A;  1AU7 A;  2JJ7 A;  1FEX A;  5K7H A;  2L0K A;  1SFO J;  1TWH J;  2ME6 A;  4EEF G;  3OIO A;  2VKE A;  1VFC A;  1B8I B;  2FX0 A;  1XC5 A;  4X1E A;  5EG0 A;  2MGQ A;  3BTI A;  3A01 A;  3QQA A;  5M5Y J;  2GBY A;  1A5J A;  1ENH A;  3S2D J;  2NVT J;  4V2F A;  3MVP A;  4BXX J;  2ECB A;  4M3E A;  3HOW J;  1CQT A;  1P7I A;  2EH3 A;  1LFU P;  4D7N A;  4Y7N J;  4A3B J;  2XSD C;  3G1M A;  1OCT C;  1AKH A;  3TP0 A;  1UG2 A;  5JLW A;  1TWC J;  3BTJ A;  3LOC A;  4C2M J;  5FKO A;  5J3L A;  1BL0 A;  1RPW A;  3HGY A;  2JA6 J;  2G0E A;  1JKP C;  1D5Y A;  1JUS A;  3ZOB A;  5E3N A;  3K2A A;  4BY7 J;  2M8G X;  5EG0 B;  3B6A A;  3A01 B;  2NOG A;  2O9L A;  2JA7 J;  1ETW A;  2HYJ A;  1K83 J;  1ZQ3 P;  2E2H J;  1JGG A;  5M3F J;  3ZQC A;  5FKK A;  1K61 A;  1MBJ A;  1E3O C;  3CMY A;  4A93 J;  2LKX A;  1HDD C;  3BR3 A;  2ECC A;  3BR0 A;  1HOM A;  4JX6 A;  1Z0X A;  3MN2 A;  4A3J J;  1JKQ C;  3FK7 A;  1AKH B;  1POG A;  4M3G A;  2Y0S N;  2LP0 A;  4X6A J;  1MBH A;  2IEK A;  2LR8 A;  3HM5 A;  1Y1V J;  1RES A;  2DA6 A;  2HXO A;  4MO7 A;  4W97 A;  2MSY A;  2FQ4 A;  1UMQ A;  4LOC A;  3LNQ A;  1WI3 A;  4C3H J;  4A3E J;  3QPL A;  2KT0 A;  4L5E A;  5GPA A;  4B4C A;  2DMP A;  2FD5 A;  5K7F A;  3Q3S A;  4FCY A;  5F0H A;  2M34 A;  1MSF C;  2LLK A;  4CYC A;  1ZR4 A;  5J1R A;  2H8R A;  3BQZ A;  1HLV A;  3NAR A;  1BJZ A;  2JWT A;  4A3K J;  1UHS A;  2LY9 A;  1IV6 A;  5EYR A;  2R5Y A;  1QPI A;  1MBK A;  1ETQ A;  4A3G J;  3GTL J;  2R7Z J;  5FLV A;  1W0T A;  3PO3 J;  1OCP A;  3G1L A;  2H1K A;  2ID6 A;  3RZO J;  1OJL A;  2NVQ J;  3S1Q J;  1Y1W J;  1JUP A;  4DW6 A;  2O8K A;  2WAQ N;  5E3O A;  3BT9 A;  1ZK8 A;  2B63 J;  2M2E A;  2Y9Z A;  1JKR C;  3RKQ A;  4XK4 A;  2YUS A;  3S1R J;  2E2I J;  3IH3 A;  3SDG A;  2XGC A;  1QRY A;  2L7F P;  1RR7 A;  3SJM A;  1LE8 A;  3B6C A;  2DN0 A;  1S7E A;  1JUM A;  3JRA A;  1SAN A;  3PM1 A;  4CYC B;  4FTH A;  4QSH A;  2IAI A;  1GDT A;  4XRS A;  2L9R A;  1NK3 P;  1MBE A;  1TWA J;  1X58 A;  3WHC A;  3HOY J;  2E2J J;  1IDZ A;  3GTK J;  2HOS A;  2R5Y B;  4IHV A;  3E7L A;  1WGX A;  2DMU A;  3PO2 J;  3BR5 A;  4FE4 A;  3LSJ A;  5IP9 J;  3M3Y J;  3BG5 A;  2KDZ A;  2HDD A;  3Q0V A;  3RZD J;  1MBG A;  5F0C A;  1JT0 A;  4A3M J;  3SFI A;  1MH3 A;  2K9Q A;  1AHD P;  2DA5 A;  1MH4 A;  2OPT A;  2CQQ A;  2HXI A;  4I76 A;  4M6V A;  2Y2Z A;  1LE8 B;  3S17 J;  2O7O A;  5IP7 J;  1FTZ A;  1ETK A;  2MW8 A;  4M3D A;  2CUF A;  1RKW A;  1FIA A;  1GV5 A;  5M3M J;  2XPU A;  5HOD A;  1YRN A;  1JTY A;  4DZP A;  3A02 A;  1W0U A;  5IP6 A;  5IYC J;  2VPR A;  1X2N A;  4A3I J;  5J1U A;  3DCF A;  2NVY J;  4W1U A;  1ORK A;  5FKL A;  1F43 A;  1WH7 A;  5GP9 A;  4AC0 A;  2R92 J;  2CJJ A;  5GPC A;  4C3I J;  5BNG A;  4DZJ A;  1VF9 A;  3L1P A;  2AHQ A;  2L7M P;  5C4X J;  1I3Q J;  5EGO A;  2XPV A;  2HQ5 A;  5EF6 A;  2RAE A;  2TRT A;  1FIP A;  3BR1 A;  2MG4 A;  4B1R A;  4G12 A;  4M3B A;  1JJ8 C;  4S0H B;  3HDD A;  3JR9 A;  3F0C A;  3IV5 A;  3ZQF A;  3FIW A;  3ZQG A;  2XRL A;  5M5W J;  5F04 A;  4AYB N;  1YRN B;  3BG3 A;  1QVT A;  4A3F J;  1DU0 A;  4FIS A;  2JA5 J;  2FJ1 A;  3HKZ N;  3S1M J;  1TWF J;  3D1N I;  1ZR2 A;  4XRM A;  2R0Q C;  2EZI A;  3I4N J;  3VPR A;  1HCR A;  1U78 A;  3JRG A;  2HOA A;  3FIS A;  3FK6 A;  5IYD J;  4J19 A;  5EGO B;  3GTJ J;  2DMT A;  4JP0 A;  4M3F A;  3ZQL A;  3DEW A;  2JMW A;  3LSG A;  3C2B A;  3TW7 A;  3WHB A;  1XG1 A;  1ETV A;  5J1Y A;  1JT6 A;  4UUS A;  3TED A;  1IDY A;  1GT0 C;  2ELK A;  1WCM J;  2YU9 J;  2D5V A;  2EZH A;  5F0F A;  3GTO J;  4A69 C;  2Y30 A;  3IH4 A;  4Y52 J;  3JRF A;  1IRZ A;  3IH2 A;  1IGN A;  1A6I A;  1FTT A;  2ID3 A;  2OF7 A;  3H3V K;  2R93 J;  1IC8 A;  2X48 A;  5EZG A;  1I50 J;  1RKT A;  3BR2 A;  3FKI J;  2K40 A;  2GM4 A;  2DA1 A;  4XRS G;  5K7Z A;  1IUF A;  4QIW N;  2N8G A;  2R5Z A;  2DTZ A;  3O8G A;  1APL C;  2XB0 X;  1Q1V A;  2Y31 A;  2Y9Y A;  3I4M J;  2E19 A;  3JRE A;  4UUS B;  1G2H A;  2JK3 A;  2QF7 A;  1LFB A;  1H89 C;  1BW5 A;  1T33 A;  3CQZ J;  1U8B A;  3HOU J;  2DA2 A;  2JN6 A;  3HB9 A;  1NK2 P;  4DYR A;  1JKO C;  5E3M A;  1B72 A;  4RDU A;  2IBD A;  1MNM C;  2K9N A;  5DTD A;  4NDL A;  1R9T J;  1JTX A;  2CQX A;  2M0C A;  1RET A;  4ABZ A;  3S1N J;  2VI6 A;  2K9S A;  2NS8 A;  3OSG A;  3RQI A;  2GLO A;  2L7Z A;  2CUE A;  2R5Z B;  3S14 J;  3HOZ J;  2LFB A;  4DYQ A;  2ME0 A;  1OFC X;  4BBS J;  1ETY A;  4IHY A;  3S15 J;  1I6H J;  2EBI A;  2AO9 A;  3UKG A;  3QPS A;  3JRH A;  1TWG J;  1PUF A;  1MSE C;  4JYK A;  1GUU A;  3JRD A;  2TCT A;  2LVS A;  1ITY A;  4QTR A;  1GV2 A;  3NAU A;  3HGG A;  1U9N A;  3BTC A;  5IOZ A;  2DA3 A;  5C4J J;  1B72 B;  3GTP J;  2CU7 A;  1HDP A;  5EDN A;  5FKM A; 
#chains in the Genus database with same CATH topology
 2E7X A;  4E70 A;  2I10 A;  3WTY C;  2DA7 A;  2LK2 A;  3G1O A;  3HRT A;  3KP3 A;  3S3O A;  5BPD A;  3GTG J;  2KDO A;  2FEZ A;  4CCL A;  2KIQ A;  3TP3 A;  2H27 A;  1X4O A;  1EKE A;  1ZRD A;  1VI0 A;  1TQM A;  5HS8 A;  3WG7 H;  5FB2 A;  1LQ1 A;  1J2X A;  1ETX A;  2PMZ N;  3CCQ I;  2I5U A;  2P0W A;  4HV5 A;  2DFE A;  4F91 B;  5JLX A;  4J01 A;  2RN7 A;  5FKN A;  3AG2 H;  3GFJ A;  4DBQ A;  5D8L B;  3QPT A;  5B66 C;  4C3J J;  2X1D A;  2CW8 A;  3PFI A;  1OYW A;  2LOO A;  4EM2 A;  4UUT A;  2QBY A;  1XX5 A;  2KFD A;  4E7S A;  1JJ6 C;  1FOK A;  3DTI A;  3CDH A;  4B47 A;  1IJW C;  2DK5 A;  3M1C A;  1ZGA A;  3X2Q H;  1VND A;  1Q1H A;  2P7V B;  3KLO A;  1T56 A;  4H4K C;  2VJI A;  3Q0U A;  4B3A A;  1NTC A;  2HOT A;  1XSV A;  4BQA A;  5CQE A;  5C3E J;  2IS2 A;  2W00 A;  2MC3 A;  1MNE A;  1IXS B;  2Q2E A;  3MAJ A;  5DUK A;  1TC3 C;  4RMN A;  4BY1 J;  1BA5 A;  4PFP A;  4KT6 A;  4LK1 F;  2VBY A;  4U0V A;  1XGN A;  4OAZ A;  1YW7 A;  1BR4 A;  2WB1 A;  4QPQ A;  4ZYE A;  5D5V B;  1KU2 A;  1MJB A;  1W1W E;  2LMD A;  4U88 A;  3V8L A;  3VEP A;  3H5R A;  1DP7 P;  1QQI A;  3KX2 A;  4HSR A;  3LFK A;  4LK0 F;  4G7H F;  1ZGJ A;  1SVO A;  2L9S A;  3SZP A;  3H9J A;  4BAC A;  1UHM A;  5KCM A;  2LDU A;  3PUB A;  5ICG A;  3KYD B;  3K1M A;  2DMN A;  3CCU I;  1R4N B;  3GW2 A;  2YS9 A;  1WJE A;  3CDI A;  4FE7 A;  4PFO A;  2NS7 A;  4LG0 B;  1XS9 A;  2CW0 F;  2RRE A;  3VB2 A;  1P7J A;  5JVT A;  1QHH D;  5FLM J;  2X4H A;  3H3Z A;  2VXZ A;  2M87 A;  2PJR B;  1U9O A;  5ILU A;  3CF2 A;  4KJZ A;  3LAP A;  1UG0 A;  2BEO A;  5F1J A;  2L3D A;  2NS0 A;  4B44 A;  1ZAR A;  2Z5U A;  4LLL A;  1S3J A;  3VSL A;  3S16 J;  3J7A O;  1Z05 A;  2M7B A;  2DPU A;  2CG4 A;  1FEX A;  3K69 A;  1DDN A;  2L0K A;  5FRM A;  3OYH A;  2VE9 A;  1LEA A;  2CWE A;  2E1M C;  2VKE A;  4RGS A;  5TJJ A;  1W4M A;  2PI0 A;  2VQG A;  2M7A A;  1XC5 A;  4UUV A;  3HTU A;  3GFL A;  2MGQ A;  3BTI A;  1GXQ A;  3HUG B;  5DCF A;  1BIA A;  1PP7 U;  3S2D J;  3I55 I;  4V2F A;  1SEU A;  3CZ6 A;  4WX9 A;  4M3E A;  1G4D A;  2O6G E;  3E5X A;  1X3W B;  4RAG A;  1P7I A;  2EIL H;  1MJ9 A;  4IRH A;  3OY9 A;  1LFU P;  4IRI A;  2YPR A;  3DLL F;  3C3W A;  2WV0 A;  4CSW A;  2L5Q A;  2K3F A;  1L0O C;  3C1D A;  3V4G A;  5J3L A;  3VYR B;  2H8W A;  5J40 A;  4MQ9 F;  2A5Y B;  4NC8 A;  4WXH A;  3QYE A;  2DYR H;  2G0E A;  3OL3 A;  1LUJ B;  1JXS A;  3N97 A;  5FRO A;  1JUS A;  2WAF A;  5E3N A;  3K2A A;  1VQ5 I;  4BY7 J;  2OAZ A;  1BOA A;  2P6T A;  4IF4 A;  5LD2 C;  1X4P A;  1HW5 A;  5EG0 B;  5A2Q K;  5ILV A;  3M7G A;  2BY2 A;  2VT2 A;  4KFC A;  2WY8 Q;  5BS6 A;  2Z16 A;  3I4P A;  3LST A;  3OYI A;  3EUA A;  1WJA A;  1Z6R A;  3F6O A;  2E2H J;  2OC6 A;  1JGG A;  2BBY A;  3CCJ I;  5M3F J;  1K61 A;  2OBP A;  5D5U B;  3CMA I;  1RRJ A;  3CMY A;  3BP8 A;  3F8C A;  3QU6 A;  1HDD C;  1WJF A;  2CQN A;  3I64 A;  1MMG A;  3BR0 A;  1R6R A;  4A3J J;  4XLF A;  4H0E A;  4M3G A;  2HVS A;  5EEH A;  1TNS A;  4RB2 C;  5JVG F;  1KQ8 A;  3C2H A;  2A3S A;  3LL7 A;  1VZ0 A;  2Z33 A;  2IEK A;  3HM5 A;  1BN5 A;  2IGM A;  3H36 A;  4M9X A;  2ZFW A;  1H9T A;  1V5F A;  3VDX A;  2FQ4 A;  3WTW C;  1ON1 A;  4C3H J;  4A3E J;  3QPL A;  5AIP A;  3MKZ A;  5LEK A;  4JQF A;  3KPH A;  4IRG A;  3A1Y A;  4UY8 I;  5F0H A;  1MSF C;  5HLT A;  4CYC A;  1ZR4 A;  3KYL A;  1O3Q A;  1T0F C;  3DV8 A;  3RJP A;  2OQR A;  3P9K A;  2JWT A;  3IP4 B;  3CES A;  2L54 A;  5DV5 A;  4A3K J;  3CO6 C;  1BJA A;  4EM0 B;  1MBK A;  2UUZ A;  1L3L A;  5FLV A;  4ESF A;  1W0T A;  2WY7 Q;  3PO3 J;  3G1L A;  3CMM A;  2F4M B;  2MAB A;  3S1Q J;  5KVR A;  1JUP A;  2O8K A;  4HF1 A;  4NHJ A;  4XQF A;  2K9M A;  2IGK A;  2RKH A;  5GTI C;  1ZLK A;  3FXJ A;  2M2E A;  2V1D A;  1V4R A;  2Y9Z A;  3DTE A;  5D6E A;  5ICE A;  3HRS A;  5DCM A;  4LFU A;  1MMS A;  4FAS D;  4XL9 A;  1RUN A;  3B6C A;  2DN0 A;  1HSJ A;  2VXD A;  1GDT A;  2L9R A;  3WHC A;  3A4C A;  1TQP A;  2DJI A;  1IDZ A;  4A0Z A;  2XSJ C;  1N75 A;  4U0Y A;  1ZLJ A;  2V6C A;  4PUS A;  3DKX A;  4CXF A;  4O3M A;  4E4H A;  4ANJ A;  3E0J B;  1XPX A;  2ZJ2 A;  2KDZ A;  4NUB A;  2BY1 A;  5L3C A;  2RNJ A;  2L4M A;  2R7T A;  4HBL A;  2R7W A;  3FXK A;  1YW9 A;  2HTJ A;  5ED4 A;  3VYU B;  3SFI A;  3IRQ A;  4EVI A;  2F5C A;  3GFI A;  2VOP A;  3BCB A;  1NG7 A;  4E6K G;  2Z9O A;  2QSH X;  2DA5 A;  3HOS A;  2HVR A;  2QA4 I;  3IC7 A;  1LE8 B;  3K9T A;  1U2W A;  3DXJ F;  2MW8 A;  5DD8 A;  1YI2 I;  4HG2 A;  2CUF A;  2VON A;  5CVJ A;  5AON A;  1RKW A;  1BC7 C;  1S7A A;  1SFK A;  4XMY A;  2E5N A;  3ZP5 A;  3QRF F;  3OYM A;  2W4S A;  1JTY A;  1P4W A;  3E5U A;  2HU9 A;  1RUO A;  3A02 A;  5B1A H;  4BYY A;  3T5X A;  4BJT A;  3L9F A;  3KIO A;  4S05 A;  2VPR A;  5DYM A;  3R4K A;  2MLK A;  5J1U A;  1Z67 A;  3BWG A;  1E3P A;  2DYS H;  4EAT A;  1WH7 A;  4XLN F;  4AC0 A;  5TIS C;  4M9Z A;  2V9K A;  2CJJ A;  2R92 J;  1YIT I;  4RGR A;  5J4V A;  5BNG A;  3OS1 A;  2AHQ A;  4RS8 A;  2DO7 A;  5EGO A;  2XRN A;  5ILS A;  1ODD A;  2RAE A;  1FNN A;  2QQB A;  3BR1 A;  2MG4 A;  2ZSH B;  5E79 C;  4M3B A;  3HDD A;  3DP7 A;  3TO9 A;  2HFH A;  3IRR A;  4MEX F;  2KLO A;  1EA3 A;  3ZQG A;  3NWS A;  4HLX A;  3F22 A;  5M5W J;  3OL4 A;  5F04 A;  3S8P A;  4HQM A;  4AYB N;  2M8E A;  2R3S A;  3PL8 A;  2KMU A;  4WCG A;  2LSO A;  2B0L A;  3MZY A;  4N0B A;  2DQR A;  3S1M J;  3R0J A;  4MTE A;  4CIC A;  3D1N I;  4KIF A;  2EZI A;  2GOX B;  1HCR A;  1G3T A;  1IV8 A;  2HOA A;  4BS9 A;  4EJU A;  2ZKZ A;  2A05 A;  4OWR B;  4G6D A;  4BNC A;  1Y6I A;  2KRF A;  2HPI A;  4JP0 A;  4G8X A;  3F3X A;  3W6K B;  1OLT A;  3GUD A;  4B8X A;  4E7Z A;  2JMW A;  3TW7 A;  3WHB A;  5CJ9 A;  5D5X B;  4WF2 A;  1PUE E;  1Z3Y A;  3NQO A;  1SMT A;  5J1Y A;  1JT6 A;  4UUS A;  3TED A;  2F6C A;  1MMA A;  4KMF A;  1D0Y A;  2WWY A;  2YU9 J;  2EJR A;  5E1Z B;  3RSN A;  3PNV A;  1HA8 A;  3QOP A;  3HYI A;  4A69 C;  4Y52 J;  3AKZ A;  1LJ9 A;  2DI3 A;  1IGN A;  1SFE A;  3C18 A;  2H94 A;  4GDF A;  1YG2 A;  3W2W A;  1MKM A;  2OF7 A;  4HZF A;  3J7Y J;  3L2R A;  3AL0 B;  2ZXH A;  2WC2 A;  4NB5 A;  1YX5 A;  1IC8 A;  2DFF A;  2WA0 A;  2VBX A;  2X48 A;  3I59 A;  2QSF X;  1I50 J;  4IZZ A;  4XOP A;  2GM4 A;  2EB7 A;  4ZZL A;  1IUF A;  4XSX F;  3OIQ A;  2N8G A;  4PSW A;  3E6C C;  4HRI A;  3LSK A;  3I71 A;  2XB0 X;  1MW7 A;  3H5N A;  2BW3 A;  3H1C A;  1XTA A;  1J7K A;  3K1N A;  2CMP A;  1B59 A;  4ZH4 F;  1H89 C;  2FBK A;  1G3W A;  3CQZ J;  3OYD A;  2QYO A;  5CYV A;  2JPB A;  2V9V A;  1JHF A;  2VC1 A;  2R7V A;  6PAX A;  4BEH A;  3LSM A;  2XF6 A;  4XKW A;  2F48 A;  5H6R A;  3RDI A;  1RET A;  2IA2 A;  2VJ5 A;  1U5T A;  1A04 A;  2OTL I;  4NQW B;  1V55 H;  2GLO A;  1VQ7 I;  3S32 A;  1D1B A;  4BQO A;  1YLF A;  2F5E A;  4ENM A;  1I6H J;  2LC2 A;  2EBI A;  2X6Y A;  2C6Y A;  4I2O A;  4IOC F;  5BPI A;  1ITY A;  4CYD A;  4N9I A;  2CV0 A;  3HGG A;  2DA3 A;  2GWR A;  2CU7 A;  1FSH A;  3GLL A;  2ZXI A;  3W3C A;  3MFK A;  1WZ2 A;  2FNA A;  2DW4 A;  4L5J A;  1YIO A;  1JI8 A;  2EZL A;  3JRB A;  1FJL A;  1OR7 C;  1WJD A;  1OMI A;  1V5G A;  1O4X A;  3LSR A;  1WJ5 A;  1HXD A;  2Z1D A;  5FFZ A;  4EV0 A;  3JRC A;  4BDY A;  2DPD A;  5B3S H;  2NVX J;  3OYC A;  2OA4 A;  4AM3 A;  1K79 A;  2EWN A;  2ESH A;  1Z7L A;  4JBA A;  2JA8 J;  4ENN A;  1UFM A;  3FMS A;  2CV1 A;  3O8H A;  4AIJ A;  1VQ8 I;  4M72 A;  1W36 C;  1Z3X A;  4D5C A;  3FHN A;  3I54 A;  4MTD A;  3WU1 B;  3WTU C;  3CCM I;  3CC7 I;  3CUQ B;  3O2P E;  4ZDL A;  2VUM J;  3DEE A;  1PUF B;  2QCO A;  1HC8 A;  1LDD A;  1YYV A;  2PEX A;  2UXX A;  3F8M A;  5M5X J;  2XKP A;  3O6B B;  2KIM A;  4LGW A;  2K9L A;  1IN5 A;  1MD0 A;  2LYC A;  3CLO A;  1IN8 A;  4D5F A;  3QAH A;  3GFM A;  5FFX A;  1WJB A;  1BR1 A;  3K4L A;  1WPK A;  2VKV A;  3E97 A;  3EUH A;  2F5V A;  3BQY A;  3HHH A;  4M74 A;  3TW6 A;  4AVP A;  4BXU A;  4HNU A;  4XID A;  3RPU D;  3QP6 A;  2L9V A;  4PCQ A;  1D0Z A;  4PJ0 C;  3HOV J;  3W6J B;  3LQR A;  2LD5 A;  1EF4 A;  2RV8 A;  2V1N A;  2CQ7 A;  2FOK A;  1T39 A;  1DGR M;  4I6Z A;  4MIM A;  1Z6T A;  4K2E A;  3S93 A;  2W48 A;  3WTV C;  2AQE A;  3RCO A;  5FJ8 J;  2JZY A;  2D2W A;  4L9J A;  4XSZ F;  4A6D A;  1IRX A;  3BG6 A;  5F08 A;  3SQN A;  1WJC A;  2XAJ A;  3JW4 A;  4TV7 A;  3OYF A;  1OCR H;  5JHF A;  2JSP A;  4EJW A;  2FOW A;  2P81 A;  4A5N A;  1QA6 A;  5F27 A;  3K7A J;  1B8I A;  4AUX A;  1QZZ A;  2XIG A;  3M1E A;  5BMZ A;  1RIO H;  4ZC3 A;  2YX7 A;  5IOY A;  3DFG A;  1F36 A;  3BLY A;  5IT9 Z;  1S5L C;  3K4K A;  2STT A;  1B9N A;  4RM2 A;  4G7O F;  1WFX A;  2Z99 A;  3OSF A;  3OOU A;  3I5U A;  4I99 C;  3S2H J;  2P5V A;  3Q0W A;  5HDG A;  1R1U A;  4E7J A;  5GAH J;  3GBG A;  4EJT A;  3MEX A;  3KFW X;  3BRO A;  1WSU A;  1H0M A;  1O3S A;  3ECO A;  2V1X A;  4MLO A;  3A2K A;  2BHZ A;  4V2G A;  1GVD A;  1VQL I;  1ZTR A;  1YJ9 I;  3FXU A;  3GEZ A;  2CUJ A;  2QQ9 A;  3VOE A;  5E18 F;  1EH7 A;  1AWC A;  2F4I A;  2M4G A;  3PFY A;  4IHX A;  2K86 A;  4DNC A;  4ZTF A;  4RA2 A;  2CYY A;  3OMY A;  2L02 A;  1AU7 A;  1W7P A;  2W82 A;  4Y13 A;  1R1T A;  2KL4 A;  5CPR B;  4EEF G;  2L4A A;  3OIO A;  2HVQ A;  4I7H A;  2K3P A;  1HKT A;  1SD5 A;  4Q5S F;  1WQ2 A;  5H6Q A;  3FWE A;  2FUG 2;  2OCC H;  3H9G A;  4X1E A;  1ZRE A;  3A01 A;  3Q9V A;  2HKX A;  3OYJ A;  3WTZ A;  1HKQ A;  3I0T A;  4BXX J;  1GVJ A;  3ZCO A;  3MCZ A;  2MLG A;  1FMV A;  2BY3 A;  2M0M A;  2EH3 A;  1O7L A;  4OMZ A;  4A3B J;  3G1M A;  4M6Y A;  3TP0 A;  1LDJ A;  4LLN A;  3WU0 A;  1UG2 A;  4WXC A;  5JLW A;  1VQN I;  1B1B A;  4F55 A;  5FKO A;  1BL0 A;  3LQQ A;  3F72 A;  1RPW A;  2KJB A;  3CCR I;  4B48 A;  1JKP C;  2XF7 A;  2EFQ A;  1MJA A;  1QNT A;  4XOR A;  4BQQ A;  4IQJ A;  3ZOB A;  3K10 A;  1WWX A;  1D0X A;  1U0J A;  1TLH B;  3MZ8 A;  4UV8 A;  1USS A;  5KNL A;  5HLH A;  2NOG A;  4ZZD A;  1ETW A;  2XAH A;  2GA2 A;  4IHS A;  3BOQ A;  4AWX B;  2ZXJ A;  3AG4 H;  3TL4 X;  4QWQ A;  1S9H A;  3TQN A;  1X1B A;  1XCV A;  1VTN C;  4A93 J;  3EET A;  1BBY A;  1XGM A;  3BY6 A;  1Z0X A;  3MN2 A;  4UHT A;  1SFU A;  1JKQ C;  1AKH B;  1K78 B;  1VQ6 I;  1S7O A;  2VAS A;  4MEY F;  2RQP A;  2MD0 A;  1RZ4 A;  2LP0 A;  3ABK H;  1K4S A;  4GRI A;  3M9A A;  3ZQQ A;  2VN2 A;  2IGO A;  3D5S C;  3OR1 C;  4MO7 A;  4YFX F;  4RAF A;  2MSY A;  3ELK A;  4W97 A;  4EGZ A;  4AD9 A;  2O8X A;  3J7Z I;  1MMN A;  2OCE A;  3GO5 A;  5K7F A;  1QBJ A;  2X6W A;  1B4A A;  2M34 A;  4M6X A;  1Y8R B;  2COM A;  4KN4 X;  4KIT B;  3ZMS A;  2H8R A;  2DAO A;  3BQZ A;  1YJW I;  1HLV A;  1BJZ A;  2R7S A;  2P5K A;  3S2W A;  1IV6 A;  1SVM A;  2M1B A;  2R5Y A;  2HQN A;  2IS1 A;  1ETQ A;  3Q5F A;  4KT5 C;  3UR3 C;  3U2R A;  2D1V A;  2EIK H;  4YG2 F;  4F52 A;  2RGV A;  2H1K A;  1FOW A;  1KZH A;  1UB9 A;  4B09 A;  4P9U A;  1MDM A;  4XLE A;  3C2G A;  4E7L A;  1Y1W J;  1HBX G;  3SYT A;  2WAQ N;  1B6A A;  4D0P A;  1BIB A;  2EK5 A;  2RNG A;  3U1D A;  1J09 A;  3PIO F;  1ZK8 A;  2B63 J;  4R8H A;  3V7C A;  1A35 A;  2YUS A;  1F5T A;  4BUP A;  2FRH A;  3EQL F;  5HNH A;  4M71 A;  1D8K A;  4OAY A;  4G7Z F;  4HF2 A;  3EDP A;  3PUF A;  1JUM A;  3JRA A;  1SAN A;  1Z9C A;  3F8B A;  3JAM Z;  4QSH A;  1NK3 P;  1MBE A;  5DM7 F;  2J5O A;  5FGM A;  1D3Y A;  1W5C C;  1R49 A;  2EA4 A;  4ESB A;  3VWB A;  1G59 A;  4PJM A;  2BHY A;  4L0Y B;  3K70 C;  2W25 A;  3BR5 A;  3M07 A;  3LSJ A;  3E1S A;  3B73 A;  5F1R A;  2A6T A;  2LBF B;  3K4J A;  1X19 A;  3OYA A;  4ESJ A;  1SD7 A;  2AQF A;  4A3M J;  1T0F A;  2OU2 A;  1OCZ H;  1MH3 A;  3KP7 A;  1QZY A;  1UAA A;  3RYR A;  2K9Q A;  4O5V A;  2KZV A;  1AHD P;  1FBS A;  2CQQ A;  1FPQ A;  1TNT A;  4M6V A;  5LBQ A;  2Y2Z A;  5LHH A;  4LIV A;  1UEL B;  2IGN A;  3S17 J;  3I56 I;  3FXO A;  5IP7 J;  3AL0 C;  4F3Q A;  3KZZ A;  5LGN A;  2FE3 A;  2VJ4 A;  4M3D A;  2Q8K A;  1R00 A;  2QZ8 A;  3SZG A;  3I59 B;  1FIA A;  4RAY A;  5LGU A;  5HDK A;  2CFX A;  3OWT A;  1O3R A;  1UZC A;  4OIQ F;  5DUI A;  2W57 A;  4HX4 A;  2D45 A;  3WTS C;  5GTH C;  5DEQ A;  3IL2 A;  2DFH A;  2FSW A;  1F43 A;  4UNO A;  2ZME B;  4C3I J;  2EFO A;  1YJN I;  4DZJ A;  5K1Y A;  3JCU C;  1D1A A;  2L7M P;  3ASO H;  1IN7 A;  4L5I A;  3FXM A;  1I3A A;  2XPV A;  2XAQ A;  3TMO A;  4E7H A;  3CP2 A;  5JFR A;  3ZPL A;  2GA1 A;  4UV9 A;  2EV6 A;  1JJ8 C;  2NYX A;  2Z3Y A;  1ZG5 A;  3BZK A;  1WHU A;  2ICW G;  3QYF A;  3ZQF A;  3RQ4 A;  5F64 A;  2XRL A;  1XB4 A;  4P1W A;  1CF7 A;  1YRN B;  3BG3 A;  3PSF A;  2X1C A;  4A3F J;  4A12 A;  1QO0 D;  2CGP A;  4FIS A;  4XM3 A;  3PJR A;  1J5Y A;  3HKZ N;  3MQ0 A;  1VQM I;  1LNW A;  1D8J A;  2V1U A;  4AYB A;  2P4W A;  3ZMU A;  1U78 A;  1Z7U A;  2J5P A;  2IJL A;  3M8E A;  4WWC A;  4LB5 A;  1OYY A;  4GYI A;  3FK6 A;  3LFU A;  3ZXS A;  4GYG A;  1HQC A;  2OD5 A;  1YE9 A;  1E3H A;  2A5W A;  3DF8 A;  4MNU A;  1YX3 A;  3DEW A;  3OOP A;  3C2B A;  3L2W A;  2JSC A;  2W85 A;  1Y39 A;  4A0Y A;  1KU3 A;  3EUK L;  4UB6 C;  1IDY A;  1GT0 C;  2HEO A;  2V6E A;  2R7X A;  2ESN A;  2NAZ A;  4CCK A;  2AXT C;  4L9V A;  3GTO J;  3GX4 X;  1C0W A;  2BV6 A;  3JRF A;  3LMM A;  1FYL A;  3IH2 A;  4XBF A;  1IZ1 A;  1TQI A;  5B1B H;  3SHF A;  3V8K A;  1A6I A;  3CUQ C;  5DDG A;  2ZNY A;  4Q4Z F;  4JOM A;  1R23 A;  4M9S A;  4F7Z A;  3GZ6 A;  3H3V K;  2R93 J;  4G9Y A;  2XC7 A;  4S04 A;  4U7B A;  4GXO A;  2Q1Z B;  4L9N A;  2YR2 A;  2L9N A;  2LY1 A;  1T08 B;  2DA1 A;  3R0A A;  5K7Z A;  3GWZ A;  4A2U A;  4QIW N;  5D5W B;  2R5Z A;  3U9G A;  1APL C;  1HW2 A;  1LVK A;  4Y15 A;  2IA1 A;  2Y9Y A;  2ETH A;  2E19 A;  1G2H A;  3NEU A;  4BHP A;  3OYK A;  1LFB A;  2XKO A;  4BQN A;  2XHK A;  5EJC A;  2JTV A;  2XUB A;  3FX3 A;  1G8X A;  4DYR A;  1W7P D;  2NOJ B;  2AXL A;  4PGH A;  3TO6 A;  5E3M A;  3WTX C;  2XRO A;  2EPF A;  1B72 A;  2K9N A;  3LA7 A;  5KAF C;  3IKT A;  2DQL A;  2CQX A;  1KYZ A;  2UV1 A;  3ZR8 X;  3MWM A;  2K9S A;  2NS8 A;  2O0Y A;  2HS5 A;  2FMY A;  2L7Z A;  4MHG A;  4BL0 B;  3AAF A;  2CUE A;  2E5Z A;  4CHU A;  3F8F A;  2M4K A;  3HOZ J;  2ME0 A;  1OFC X;  3FBI B;  2QWW A;  4R79 A;  4BBS J;  1A6Q A;  3QPS A;  3JRH A;  1TWG J;  1MSE C;  4JYK A;  2QEN A;  1FZP B;  2CSO A;  3JRD A;  5CVR A;  1YTY A;  1U6G A;  2EIM H;  3WTT C;  5IOZ A;  3SDB A;  3GTP J;  5K5R A;  3D0S A;  1QZE A;  4Q48 A;  3RKX A;  2R7F A;  2QEX I;  4IKF A;  2O3F A;  1U3E M;  1UJ8 A;  2DMQ A;  5EEA A;  3H0G J;  3J81 Z;  3DKW A;  1J0R A;  5J47 A;  2NNY A;  2M45 A;  3GTQ J;  4PJJ A;  4DBR A;  4KA4 A;  2DCE A;  2Y75 A;  3MKY B;  4A3D J;  1ACI A;  2PG4 A;  3GTM J;  1AA7 A;  4EJO A;  1ZKG A;  1X3U A;  2B7E A;  3H5A A;  4HDV A;  2X6O A;  1X1P A;  1WI9 A;  4L18 B;  3ZN0 A;  2ZJR F;  4JX5 A;  2W1O A;  4WXD A;  1G6N A;  2MH9 A;  4BJ5 C;  1DGW Y;  2VJJ A;  4FET A;  1I6X A;  3BDD A;  2DT7 B;  1NHA A;  3ZRG A;  1O3T A;  4KYW A;  3K6G A;  1K7A A;  1ETO A;  1N25 A;  4HQE A;  3DLA A;  2QSG X;  2NRA C;  2COB A;  4OOI A;  3E6B A;  4C2T A;  2ZB9 A;  4LG0 A;  4LG3 A;  3M8F A;  2LH9 A;  2X9D A;  2PJR A;  1HW1 A;  1T2K A;  2F5D A;  1Y56 A;  4BKX A;  3HBL A;  3GZN B;  3ASN H;  5EZH A;  3JRI A;  3HOX J;  1X3Z B;  4BBR J;  1IAW A;  2V26 A;  3LSP A;  5FO5 A;  2GZW A;  1Z77 A;  4OIP F;  1H8A C;  3DTK A;  4Y17 A;  4RBO A;  1S72 I;  3H35 A;  1SMY F;  1A31 A;  1H88 C;  3I58 A;  9ANT A;  5E3L A;  4BH9 A;  1AOY A;  1DQU A;  1OPC A;  3IUO A;  3ZQI A;  1VQP I;  1LFP A;  3MKL A;  3CCY A;  1IO2 A;  2M9H A;  1OR7 A;  4XIC A;  2VBZ A;  3GME A;  4IOA F;  3KP5 A;  3OR2 C;  2QBY B;  3W6V A;  5KK1 A;  2LRE A;  3CUO A;  2DJN A;  2LY2 A;  3DBH B;  2E1O A;  4BU2 A;  3EYY A;  3PSI A;  3ZQ7 A;  1BR2 A;  4OIR F;  3HUG A;  5LRR A;  2G7U A;  3E3V A;  3E6D A;  5J8F A;  4HAM A;  4A3L J;  1JGS A;  3P5J A;  5IPA A;  4HLY A;  3ZQH A;  3HPG A;  4DYC A;  5CVV A;  3F23 A;  2LTP A;  4MFD A;  5C44 J;  1I5Z A;  3N4M A;  2Q2E B;  3FBN B;  1K6O A;  5L3E A;  2JA2 A;  3KP6 A;  2E1C A;  2KP6 A;  3BG9 A;  4D9J A;  2CV2 A;  5D4R A;  2A68 F;  5FLX Z;  5GAE J;  4KN7 X;  1X2M A;  2CRG A;  3BJ6 A;  4KMU X;  4XRF A;  2F4O B;  2Y48 A;  1SFO J;  2NNN A;  2VT3 A;  2ACJ A;  3HHG A;  5EG0 A;  3TDZ C;  5J8C A;  1IRF A;  3CJQ B;  3QPH A;  5M5Y J;  2V79 A;  4EM1 A;  3L2Q A;  2NVT J;  1IUY A;  4PK4 A;  2ECB A;  2XGX A;  5BQT A;  1CQT A;  3ZGK A;  2VKD A;  1GHC A;  2VLA A;  2KJC A;  4GCV A;  4D7N A;  1BOB A;  4Y7N J;  4RB1 A;  3JTH A;  2VQC A;  1PDN C;  1FT9 A;  3KEQ A;  1TT5 B;  1FWZ A;  4ZYA A;  2QUF A;  1TWC J;  3LOC A;  2DT6 A;  4C2M J;  5H20 A;  1FLI A;  3HGY A;  3L2V A;  2OJE D;  2OQG A;  4UVB A;  2ELJ A;  3FMR A;  2BXY A;  1IN6 A;  3GF2 A;  5BOX A;  5HNF A;  1D5Y A;  3HRU A;  4N9H A;  2EFP A;  2M8G X;  3FMQ A;  2UWM A;  1UST A;  5LHG A;  3CD6 I;  2VQH A;  4FX0 A;  1I1S A;  1P4A A;  3PQJ A;  4BDZ A;  1VQO I;  1FSE A;  3RPQ A;  3V7S A;  2O9L A;  5CQG A;  3RKW A;  3LSH A;  2LF8 A;  1HST A;  2GXA A;  5IT9 K;  2FU4 A;  4E7I A;  3ZQC A;  4DOZ A;  2LKX A;  2TDX A;  3BR3 A;  2IA0 A;  3ISP A;  3FK7 A;  3GLX A;  3PNY A;  4CCJ A;  1BI3 A;  2PMZ A;  4KNY A;  2Y0S N;  3SEZ A;  4EJV A;  4ZYD A;  1FYM A;  1BM9 A;  2BVM A;  4CH7 A;  1OCC H;  1WKM A;  1RES A;  2DA6 A;  3G6E I;  1SD6 A;  2H1L A;  2EA2 A;  1P2F A;  1WI3 A;  3TDU C;  3DPL C;  2KT0 A;  5FD5 A;  2LRD A;  3W2A A;  3K1P A;  3HXL A;  4F93 B;  2ZME C;  3D5L A;  5TRD A;  3S3M A;  2LLK A;  5HLI A;  3V7R A;  4LIT A;  2KRH A;  2EV0 A;  2RC4 A;  3FZV A;  2OTJ I;  2VPL A;  4PZJ A;  3WGI A;  2A6E F;  2LY9 A;  5CVI A;  5LEJ A;  5KAI C;  5EYR A;  2Y0M A;  1LVA A;  1R5H A;  2E36 A;  3I53 A;  3GTL J;  2R7Z J;  1OCP A;  1H9G A;  2QVO A;  3WOD F;  3RZO J;  3CCL I;  1GLN A;  1OJL A;  2IRF G;  2V7F A;  4JK1 X;  4DW6 A;  2K4J A;  1ZN2 A;  2ZXW H;  5HLG A;  1IRG A;  1S8N A;  4YFK F;  3BT9 A;  3SZT A;  3F9K A;  5LLQ A;  4AU7 A;  3DKY A;  1X1D A;  1V54 H;  1JKR C;  1NG6 A;  3RKQ A;  3VYS B;  1SAU A;  4OIN F;  2HOE A;  5K5Q A;  3IH3 A;  3RYP A;  1YQA A;  3E6M A;  3HSR A;  2L7F P;  1RR7 A;  3SJM A;  1LE8 A;  4U0W A;  3BPV A;  4Z6Y A;  3GYH X;  4YEL A;  1S7E A;  3ABU A;  3FHZ A;  1R5G A;  2L7K A;  3QOD A;  2PN6 A;  3HPH A;  3VFZ A;  2DOF A;  3PM1 A;  4CYC B;  2IAI A;  4HYE A;  4XRS A;  1TWA J;  1X58 A;  2PX9 A;  3HOY J;  2A6H F;  2PMH A;  3V42 A;  4C30 A;  2E2J J;  3NWT A;  2HOS A;  4RLF A;  1WGX A;  4XN0 A;  2MFZ A;  3EPZ A;  3ESW B;  4FE4 A;  1TW3 A;  2JUG A;  4RM3 A;  3M3Y J;  3BG5 A;  1RNL A;  3FKJ A;  4P5O A;  2K7L A;  4YRV A;  3G3Z A;  4XOT A;  2MD5 A;  2HDD A;  1ULY A;  3RZD J;  2PQ8 A;  1MBG A;  1ONV A;  5F0C A;  1JT0 A;  4ITV A;  3H9Q A;  4HF0 A;  2MA3 A;  1KU9 A;  2UXN A;  3ABL H;  1MH4 A;  4KIC A;  4I76 A;  5DCM B;  2X0L A;  3TKY A;  2HR3 A;  3G73 A;  2O7O A;  2VKH A;  4I01 A;  3PNT A;  3KEO A;  2QQ8 A;  1FTZ A;  3IHU A;  4ETS A;  2DT5 A;  2XAS A;  1GV5 A;  5M3M J;  1RI7 A;  1XD7 A;  1QGP A;  3J80 Z;  4FQG A;  1Z91 A;  1IF1 A;  4G6Q A;  4DZP A;  5E17 F;  4F92 B;  2JQ7 A;  4LD5 A;  4ZJZ A;  4OMY A;  1QU3 A;  2E1N A;  3DCF A;  5FKL A;  2XAG A;  3OYE A;  4CUG A;  4OIO F;  2HWV A;  2M30 A;  2GXG A;  4WK8 F;  1KA8 A;  4BGD A;  1VF9 A;  3L1P A;  2Y69 H;  4IPA A;  1I3Q J;  1O57 A;  3OS0 A;  2LF7 A;  2HQ5 A;  4KIB A;  5EF6 A;  1IN4 A;  1SC7 A;  2TRT A;  2HPM A;  2PJP A;  1ZG3 A;  1W5S A;  5IY5 H;  5K5O A;  1YFH A;  2P7C B;  2ZFU A;  3WG9 A;  3F0C A;  3JSP A;  3G2B A;  3L2C A;  1F4K A;  3VSK A;  5E8G A;  1R1V A;  4BHB A;  1MMD A;  2XV4 S;  4DIQ A;  4LB6 B;  3JAM K;  2E60 A;  2JA5 J;  3K4B A;  2FJ1 A;  1VQ4 I;  2ADU A;  1TWF J;  3CF5 F;  4ENJ A;  3PQK A;  1FYK A;  1ZR2 A;  4XRM A;  2R0Q C;  5CVU A;  3K0L A;  5HS9 A;  2CUZ A;  5HOO A;  3JRG A;  3FIS A;  3ABM H;  3UNG C;  4XKV A;  3HKZ A;  4CDG A;  1U8R A;  4QLC U;  4UXN A;  1LEB A;  3P9I A;  1BI1 A;  1SAX A;  4XLP F;  3TOB A;  1NH3 A;  5EGO B;  3GTJ J;  3RKY A;  3D5R C;  2R7U A;  4M3F A;  3T0Y A;  3ZQL A;  1E17 A;  2KHM A;  3P7N A;  4YIF A;  4DQ2 A;  1PVE A;  3L7W A;  1O7F A;  1YOV B;  1G3Y A;  1ETV A;  3W2V A;  4PSX A;  2ELK A;  4R1H A;  5FRN A;  3L09 A;  2X1E A;  2D5V A;  4HNT A;  3S3N A;  2H09 A;  2HQR A;  1SFX A;  4B43 A;  1MND A;  4BJ6 C;  2X85 A;  1E0E A;  3WGG A;  1IRZ A;  1I39 A;  1KQ0 A;  1MIJ A;  2DU9 A;  1QHG A;  2D1H A;  2DDA A;  1FTT A;  1T95 A;  1IXC A;  3QU3 A;  2JVG A;  3BC8 A;  4CO8 A;  3AG3 H;  5EZG A;  1W36 D;  1I1G A;  1RKT A;  3BR2 A;  3FKI J;  4NQW A;  4II3 A;  1TBX A;  2DDB A;  1EV7 A;  2RDP A;  2BE5 F;  1T38 A;  2E35 A;  4RB3 C;  3ABT A;  4XRS G;  3ERE D;  5KHD A;  2DTZ A;  3O8G A;  3TOA A;  2K4B A;  2Y31 A;  1E2X A;  4ASN A;  1XSX A;  5LRS A;  3JRE A;  4J00 A;  4UUS B;  2IS4 A;  1VQ9 I;  2QF7 A;  3ZMT A;  2JRT A;  2DXI A;  2IP2 A;  1T33 A;  3FXL A;  1RR8 C;  3G71 I;  4I98 B;  2FML A;  3HOU J;  5IT3 A;  2DA2 A;  1ZH5 A;  1NK2 P;  1JKO C;  3TBI A;  4NNJ A;  5TGT A;  1MNM C;  2IBD A;  2QKM B;  4YFN F;  2VOO A;  3OV8 A;  4MGR A;  1R9T J;  1ZEL A;  4A6E A;  2QQA A;  3K2Z A;  4ZDO A;  3ZMZ A;  5D8K B;  3FXR A;  5J6X A;  3LWF A;  4ABZ A;  2W84 A;  3BPX A;  4HOB A;  3SXY A;  3ONQ A;  2X6X A;  3S1N J;  2P5L C;  4O6J A;  3RTR A;  2ZCW A;  4CCN A;  2K5C A;  2OUM A;  4HV6 A;  1V3F A;  1Y0N A;  4G94 A;  3BJO A;  2R7Q A;  2HDW A;  2JVH A;  4ON0 A;  2VC0 A;  5LHI A;  3DQV C;  1ETY A;  4IHY A;  2BW3 B;  1PJR A;  3CUQ A;  4EQQ A;  5GAD J;  2AO9 A;  3UKG A;  4AID A;  2EIN H;  2GAU A;  5F6F A;  5E20 A;  4HA8 A;  3OYN A;  1PUF A;  4FT8 A;  2HGC A;  1GUU A;  2FNP A;  4HEA 2;  2LVS A;  2Q0O A;  3MMY B;  1FP1 D;  3IWZ A;  4XR6 A;  2WBM A;  1V5E A;  1LPQ A;  3NAU A;  3CCS I;  1U9N A;  2HYG D;  4P96 A;  3KET A;  4E7K A;  3R60 A;  3TO7 A;  4BEH B;  2ISZ A;  1T6S A;  4P55 A;  1P92 A;  3CC2 I;  5FKM A;  3I9V 2;  3K4N A;  2DLL A;  4Y33 A;  3HG9 A;  1U5T B;  2R4G A;  1IG7 A;  2ZJQ F;  2EQR A;  3KLN A;  5LFA A;  3WE3 A;  5E1X A;  1ZHF A;  4XLH A;  3MKW B;  5IYB J;  3CJT B;  3SEQ A;  3REO A;  3J7A Y;  2K85 A;  2BXZ A;  1A36 A;  1HKS A;  4ZTJ A;  3BG7 A;  3BR6 A;  2FBI A;  3CDL A;  4YEJ A;  2XPW A;  4I0B A;  1Z21 A;  1K4T A;  4P9F A;  5B5E C;  4AVZ A;  1XDS A;  2QLZ A;  3QOE A;  4CCM A;  2XGD A;  1D1C A;  2DA4 A;  3HC7 A;  1JE8 A;  3M8J A;  3KZY A;  2PLY A;  3BTL A;  1FMW A;  4QPO A;  3HEF A;  5E1W A;  1ZG1 A;  3E5Q A;  1J75 A;  2GXB A;  4PJL A;  4GFB A;  4N4O B;  2A69 F;  1BW6 A;  2WB1 N;  3ZMV A;  4PGG A;  4IHW A;  1TTY A;  3BZ6 A;  2DFI A;  1S6L A;  3DPT A;  3H92 A;  4X0G A;  1WH5 A;  3RPU A;  4D7M A;  4FHT A;  2EZK A;  2L01 A;  5ICF A;  5HVQ C;  2HI3 A;  4IEJ A;  4IVN A;  4PDK A;  2AS5 F;  2FF4 A;  2GOM A;  3OYG A;  2ZJP F;  3A03 A;  3BZC A;  1QVU A;  1YHQ I;  5A2Q Z;  4A3C J;  1DU6 A;  4ZDP A;  3H0D A;  1HF0 A;  5J4Y A;  1ZGW A;  2V9P A;  5JHU A;  2W24 A;  3DU5 A;  2KRC A;  3IKV A;  1BI2 A;  5ERI A;  2FBH A;  5GAG J;  2DOA A;  1CGP A;  4NC7 A;  5D4S A;  2HYF A;  5EEG A;  4BE0 A;  1YIJ I;  4KIS A;  3LSI A;  3M4O J;  1N78 A;  1SD4 A;  2F5F A;  2WV1 A;  4RGX A;  4Z2Y A;  4A0X A;  4JX4 A;  2R7O A;  3DBL B;  1X1A A;  3J81 K;  3ERM A;  2G9W A;  4MFE A;  2XB5 A;  4U7D A;  3CCV I;  1MBF A;  2XF5 A;  4OU0 A;  2XGE A;  4HNV A;  2G7H A;  2GIV A;  3BCA A;  5DS9 A;  3ZN1 A;  1R5I D;  2JJ7 A;  3FM3 A;  3FF5 A;  5K7H A;  4L0Z B;  1TWH J;  2PMU A;  2ME6 A;  3WU2 C;  1VFC A;  1B8I B;  1XGS A;  2FX0 A;  1K6Y A;  1DPU A;  1M1E B;  2BVL A;  2YX4 A;  3BJA A;  2OZ6 A;  4IHT A;  4CZC A;  3QQA A;  4LLG F;  2GBY A;  5L3G A;  1ENH A;  1A5J A;  3ULQ B;  3TGN A;  3MVP A;  4FX4 A;  3L2U A;  4U87 A;  4XKB A;  5L3D A;  3HOW J;  3CJN A;  5CLS A;  2JUC A;  3OYL A;  2CS3 A;  3HJE A;  5D6F A;  2NXN B;  2XSD C;  2CH0 A;  4G6T B;  1AKH A;  4D1Q A;  1OCT C;  1K78 A;  1P4X A;  1YW8 A;  3OS2 A;  4UVC A;  3KCC A;  3BTJ A;  1FY7 A;  2ZNZ A;  3HIF A;  3CLQ A;  2NVU B;  4IJA A;  2JA6 J;  1B9M A;  1R22 A;  1YS7 A;  4Y4R A;  1W7P B;  1P9Q C;  4IQ4 A;  1PP8 F;  4A5M A;  2IPQ X;  1SVL A;  2MBF A;  3B6A A;  3PIP F;  3A01 B;  2EIJ H;  4HW0 A;  3K70 D;  2RQQ A;  3U21 A;  3HSF A;  2JA7 J;  1VQK I;  2HYJ A;  1K83 J;  1QPM A;  1YO5 C;  1ZQ3 P;  4AIK A;  3NRV A;  4I02 A;  1J9I A;  3RI4 A;  4XKC A;  2MC4 A;  5FKK A;  1FX7 A;  1MBJ A;  1E3O C;  3T8T A;  1HOM A;  2ECC A;  2EFN A;  4HDU A;  4JX6 A;  1XMX A;  3KP2 A;  1EH6 A;  4BHC A;  2CW7 A;  2ZO4 A;  3AG1 H;  1POG A;  2O5R A;  1W5T A;  3B02 A;  4KIG A;  4NBQ A;  4X6A J;  2F2E A;  1LDK B;  1MBH A;  2LR8 A;  4MQV A;  1Y1V J;  2HXO A;  2KIS A;  2KIF A;  4XN3 A;  2Z2S B;  1UMQ A;  4LOC A;  3LNQ A;  2Y0S A;  5FLX K;  3QP5 A;  3CO7 C;  3KYC B;  4RGU A;  4L5E A;  5GPA A;  4B4C A;  2DMP A;  4CCO A;  2FD5 A;  3I3L A;  1N77 A;  3Q3S A;  4FCY A;  3RIR A;  5J1R A;  2L2O A;  3NAR A;  1R4M B;  5CKT A;  1UHS A;  2JPC A;  1KQ9 A;  3WGH A;  1FOY A;  3COA C;  1QPI A;  3L00 A;  2WTE A;  3HL2 A;  4A3G J;  4C9Y A;  1STZ A;  2P6S A;  3LA3 A;  1F9N A;  2ID6 A;  1BI0 A;  3CME I;  2P8T A;  4Q47 A;  1IW7 F;  2E1M B;  2NVQ J;  1P6R A;  1KGS A;  2LBF A;  4IXA A;  5E3O A;  1XMA A;  2KIU A;  3MD2 A;  2VL8 A;  4LMY A;  4XLC A;  3VYT B;  2VBW A;  1OQY A;  4XK4 A;  2W7N A;  3S1R J;  1T8I A;  2E2I J;  3SDG A;  1QRY A;  2PFB A;  2XGC A;  4GGG A;  4XNF A;  2X51 A;  4C2U A;  2DBB A;  1ZYR F;  2CQK A;  4FTH A;  1ON2 A;  2ISY A;  3KZI C;  4I09 A;  1GXP A;  3CJR B;  4M73 A;  1ERD A;  3GTK J;  2R5Y B;  4DJA A;  3U1K A;  4IHV A;  3E7L A;  4KDP A;  2DMU A;  3PO2 J;  3KEY A;  2H6C A;  5IP9 J;  1BC8 C;  1MDM B;  2FA5 A;  3H3U A;  2O61 A;  2ZME A;  1Z1D A;  1KON A;  3Q0V A;  3Q9S A;  4GO1 A;  4EMS A;  3FXQ A;  2E7W A;  3K4M A;  2E34 A;  3V8J A;  4LIU A;  2ELH A;  2KPM A;  4CZZ A;  2RVC A;  3HOT A;  2OPT A;  1LKX A;  1TW2 A;  2HTS A;  2FXA A;  1R36 A;  2HXI A;  5L3B A;  1TZL A;  3C7J A;  1LB2 A;  2ZC2 A;  1XGO A;  4NC6 A;  1MZB A;  2QKL B;  2DK8 A;  1ETK A;  1R58 A;  1EJ9 A;  1FOX A;  1XSD A;  3A0H C;  1G3S A;  1OKR A;  2XPU A;  4ZYG A;  1I27 A;  5HOD A;  1YRN A;  4BAY A;  2KQR A;  3ECH A;  1MGT A;  3GXO A;  1IXR C;  2EV5 A;  3DWL E;  2IT0 A;  2HZT A;  1W0U A;  2GQQ A;  5IP6 A;  5IYC J;  3FDY A;  1X2N A;  2BYV E;  2H6B A;  4N4N B;  4BXF A;  3JTG A;  4A3I J;  3F8N A;  4W1U A;  2NVY J;  1ORK A;  5GP9 A;  3LAJ A;  2I8D A;  5GPC A;  3LA2 A;  1XCB A;  2EFW A;  5L3F A;  4AIH A;  2MH2 A;  4V19 K;  2DOE A;  5C4X J;  2OZU A;  2A07 F;  3GZ5 A;  3KE2 A;  3DPU A;  4Y3O A;  2YSR A;  1FIP A;  1WRJ A;  3ROU A;  2B9S A;  3JSO A;  1Y0U A;  4B1R A;  2JT1 A;  2QM3 A;  4G12 A;  3QWL A;  3WE2 A;  4S0H B;  4YIR X;  3JR9 A;  1KYW A;  5E8I A;  3IV5 A;  3IWF A;  3FIW A;  3GCM A;  3N05 A;  2IXS A;  2BOL A;  3G4S I;  2E71 A;  2HKO A;  5ICC A;  1QVT A;  5JR3 A;  1DU0 A;  1OYI A;  4I0A A;  3DBR B;  4KUM A;  4CA0 A;  2XAF A;  3KP4 A;  4XLA A;  3MZH A;  1REP C;  1DPR A;  3I4N J;  3VPR A;  5FD6 A;  3HZJ A;  1RC9 A;  3DU6 A;  2BZT A;  3VOD A;  2MYS A;  3IAM 2;  2QGU A;  4UVA A;  3AFH A;  3R6S A;  4J19 A;  5IYD J;  1YS6 A;  4LJZ F;  3IAS 2;  1D5V A;  2DMT A;  1R71 A;  3ML6 A;  4HST A;  4UB8 C;  1OCO H;  3F6V A;  2GIZ A;  1S29 A;  2IW5 A;  1XMK A;  1KU7 A;  1WVR A;  5DD4 A;  3LSG A;  4YII A;  1R7J A;  3HSE A;  3QYB A;  1XDU A;  1XG1 A;  4PJN A;  2A61 A;  2WAD A;  2XDV A;  1U5T C;  2R7R A;  1UHW A;  4L9T A;  5HS7 A;  4BE1 A;  3ZMD A;  2V4J C;  1WCM J;  5JI6 A;  4HX7 A;  1FC3 A;  1CF7 B;  3T1B A;  2DTR A;  4ENK A;  2K27 A;  2EZH A;  5F0F A;  2Y30 A;  3CP8 A;  3IH4 A;  4XON A;  3J80 K;  5AIQ A;  2HDC A;  2WAQ A;  1OIS A;  4RB0 A;  1DP3 A;  2HNH A;  1FBQ A;  2VE8 A;  2K02 A;  2ID3 A;  3OIP A;  5LGT A;  3CTA A;  2DOD A;  2LG4 A;  2O03 A;  4II2 A;  4HPQ A;  2K40 A;  1PYV A;  2IVM A;  1X1C A;  4RLQ A;  2KKO A;  2UZK A;  2LKS A;  2FQ3 A;  3FM5 A;  3GVA A;  2CO5 A;  4IX7 A;  1F1Z A;  1Q1V A;  2HQA A;  2VQL A;  3I4M J;  3HRM A;  2CFO A;  4B3X A;  2LKP A;  3EYI A;  2JK3 A;  3R61 A;  2PBI A;  1BW5 A;  1TT0 A;  3F21 A;  1U8B A;  1FP2 A;  3A0B C;  3HB9 A;  2JN6 A;  3HTS B;  2KZG A;  2VOD A;  1UCR A;  4RDU A;  2M3A A;  4EGY A;  3K4C A;  1ZAO A;  5DTD A;  4NDL A;  4RAZ A;  1JTX A;  3DEU A;  1TL8 A;  2BGC A;  2M0C A;  3T8R A;  2WAE A;  3OYB A;  1T98 A;  2STW A;  2VI6 A;  3OSG A;  1TP4 A;  3RQI A;  4IO9 F;  1ZRF A;  2VIX A;  4ZYH A;  3P9C A;  2LNB A;  2XAU A;  5DM6 F;  2BY0 A;  3CCE I;  2VB6 A;  1ZRC A;  5HDN A;  2R5Z B;  1EH8 A;  2YU3 A;  4DGW B;  1DUX C;  3S14 J;  2LFB A;  4DYQ A;  3EUH C;  2IS6 A;  2M5W A;  2XVC A;  2HZD A;  4IL6 C;  2OV7 A;  3SFZ A;  5H2F C;  4CGZ A;  3S15 J;  4HX8 A;  2ZBK A;  2ZSI B;  2R7D A;  3CC4 I;  2TCT A;  1JHH A;  2JRM A;  4QTR A;  1GV2 A;  3BTC A;  5C4J J;  1B72 B;  1HDP A;  1Y8Q B;  5EDN A;  1J59 A;  4BE2 A;  1XN7 A;  3O3K A;  1FBU A; 
#chains in the Genus database with same CATH homology
 2DMQ A;  5EEA A;  3H0G J;  2EZL A;  3JRB A;  1FJL A;  1O4X A;  2I10 A;  3LSR A;  2DA7 A;  2LK2 A;  3G1O A;  3JRC A;  2EQR A;  1IG7 A;  3GTG J;  3GTQ J;  2NVX J;  2JA8 J;  3TP3 A;  5IYB J;  4A3D J;  3GTM J;  3O8H A;  1VI0 A;  1ZKG A;  4D5C A;  1ETX A;  2X6O A;  2PMZ N;  4JX5 A;  5JLX A;  2VUM J;  5FKN A;  1PUF B;  2QCO A;  3BR6 A;  3CDL A;  5M5X J;  4C3J J;  2XPW A;  4UUT A;  1ETO A;  4D5F A;  1JJ6 C;  2XGD A;  2DA4 A;  2COB A;  1IJW C;  2ZB9 A;  3BTL A;  3HEF A;  1VND A;  1WPK A;  2VKV A;  4GFB A;  1T56 A;  3BQY A;  3Q0U A;  3TW6 A;  4B3A A;  4XID A;  1NTC A;  2HOT A;  5C3E J;  2WB1 N;  1BW6 A;  2X9D A;  3HOV J;  4IHW A;  2LD5 A;  1EF4 A;  4BY1 J;  1BA5 A;  1TC3 C;  4BKX A;  1WH5 A;  3HBL A;  4D7M A;  5EZH A;  3JRI A;  4I6Z A;  3HOX J;  4MIM A;  4BBR J;  3LSP A;  2EZK A;  2W48 A;  1Z77 A;  5FJ8 J;  1H8A C;  2HI3 A;  4RBO A;  4IEJ A;  5F08 A;  1H88 C;  9ANT A;  5E3L A;  3A03 A;  1QVU A;  3ZQI A;  4A3C J;  2P81 A;  3CCY A;  2M9H A;  3MKL A;  1DU6 A;  1HF0 A;  5F27 A;  3K7A J;  4XIC A;  4AUX A;  1ZGW A;  1B8I A;  2DMN A;  5IOY A;  3W6V A;  1F36 A;  2DJN A;  2YS9 A;  2E1O A;  4FE7 A;  2NS7 A;  3OSF A;  3OOU A;  1XS9 A;  4A3L J;  3S2H J;  3Q0W A;  5IPA A;  1P7J A;  3ZQH A;  4DYC A;  3GBG A;  5FLM J;  3M4O J;  2WV1 A;  2LTP A;  4MFD A;  5C44 J;  1U9O A;  4JX4 A;  4MLO A;  4MFE A;  5F1J A;  4V2G A;  1GVD A;  2XB5 A;  1ZTR A;  3BG9 A;  1MBF A;  4IHX A;  1X2M A;  3S16 J;  2CRG A;  2XGE A;  4HNV A;  5DS9 A;  1AU7 A;  2JJ7 A;  1FEX A;  5K7H A;  2L0K A;  1SFO J;  1TWH J;  2ME6 A;  4EEF G;  3OIO A;  2VKE A;  1VFC A;  1B8I B;  2FX0 A;  1XC5 A;  4X1E A;  5EG0 A;  2MGQ A;  3BTI A;  3A01 A;  3QQA A;  5M5Y J;  2GBY A;  1A5J A;  1ENH A;  3S2D J;  2NVT J;  4V2F A;  3MVP A;  4BXX J;  2ECB A;  4M3E A;  3HOW J;  1CQT A;  1P7I A;  2EH3 A;  1LFU P;  4D7N A;  4Y7N J;  4A3B J;  2XSD C;  3G1M A;  1OCT C;  1AKH A;  3TP0 A;  1UG2 A;  5JLW A;  1TWC J;  3BTJ A;  3LOC A;  4C2M J;  5FKO A;  5J3L A;  1BL0 A;  1RPW A;  3HGY A;  2JA6 J;  2G0E A;  1JKP C;  1D5Y A;  1JUS A;  3ZOB A;  5E3N A;  3K2A A;  4BY7 J;  2M8G X;  5EG0 B;  3B6A A;  3A01 B;  2NOG A;  2O9L A;  2JA7 J;  1ETW A;  2HYJ A;  1K83 J;  1ZQ3 P;  2E2H J;  1JGG A;  5M3F J;  3ZQC A;  5FKK A;  1K61 A;  1MBJ A;  1E3O C;  3CMY A;  4A93 J;  2LKX A;  1HDD C;  3BR3 A;  2ECC A;  3BR0 A;  1HOM A;  4JX6 A;  1Z0X A;  3MN2 A;  4A3J J;  1JKQ C;  3FK7 A;  1AKH B;  1POG A;  4M3G A;  2Y0S N;  2LP0 A;  4X6A J;  1MBH A;  2IEK A;  2LR8 A;  3HM5 A;  1Y1V J;  1RES A;  2DA6 A;  2HXO A;  4MO7 A;  4W97 A;  2MSY A;  2FQ4 A;  1UMQ A;  4LOC A;  3LNQ A;  1WI3 A;  4C3H J;  4A3E J;  3QPL A;  2KT0 A;  4L5E A;  5GPA A;  4B4C A;  2DMP A;  2FD5 A;  5K7F A;  3Q3S A;  4FCY A;  5F0H A;  2M34 A;  1MSF C;  2LLK A;  4CYC A;  1ZR4 A;  5J1R A;  2H8R A;  3BQZ A;  1HLV A;  3NAR A;  1BJZ A;  2JWT A;  4A3K J;  1UHS A;  2LY9 A;  1IV6 A;  5EYR A;  2R5Y A;  1QPI A;  1MBK A;  1ETQ A;  4A3G J;  3GTL J;  2R7Z J;  5FLV A;  1W0T A;  3PO3 J;  1OCP A;  3G1L A;  2H1K A;  2ID6 A;  3RZO J;  1OJL A;  2NVQ J;  3S1Q J;  1Y1W J;  1JUP A;  4DW6 A;  2O8K A;  2WAQ N;  5E3O A;  3BT9 A;  1ZK8 A;  2B63 J;  2M2E A;  2Y9Z A;  1JKR C;  3RKQ A;  4XK4 A;  2YUS A;  3S1R J;  2E2I J;  3IH3 A;  3SDG A;  2XGC A;  1QRY A;  2L7F P;  1RR7 A;  3SJM A;  1LE8 A;  3B6C A;  2DN0 A;  1S7E A;  1JUM A;  3JRA A;  1SAN A;  3PM1 A;  4CYC B;  4FTH A;  4QSH A;  2IAI A;  1GDT A;  4XRS A;  2L9R A;  1NK3 P;  1MBE A;  1TWA J;  1X58 A;  3WHC A;  3HOY J;  2E2J J;  1IDZ A;  3GTK J;  2HOS A;  2R5Y B;  4IHV A;  3E7L A;  1WGX A;  2DMU A;  3PO2 J;  3BR5 A;  4FE4 A;  3LSJ A;  5IP9 J;  3M3Y J;  3BG5 A;  2KDZ A;  2HDD A;  3Q0V A;  3RZD J;  1MBG A;  5F0C A;  1JT0 A;  4A3M J;  3SFI A;  1MH3 A;  2K9Q A;  1AHD P;  2DA5 A;  1MH4 A;  2OPT A;  2CQQ A;  2HXI A;  4I76 A;  4M6V A;  2Y2Z A;  1LE8 B;  3S17 J;  2O7O A;  5IP7 J;  1FTZ A;  1ETK A;  2MW8 A;  4M3D A;  2CUF A;  1RKW A;  1FIA A;  1GV5 A;  5M3M J;  2XPU A;  5HOD A;  1YRN A;  1JTY A;  4DZP A;  3A02 A;  1W0U A;  5IP6 A;  5IYC J;  2VPR A;  1X2N A;  4A3I J;  5J1U A;  3DCF A;  2NVY J;  4W1U A;  1ORK A;  5FKL A;  1F43 A;  1WH7 A;  5GP9 A;  4AC0 A;  2R92 J;  2CJJ A;  5GPC A;  4C3I J;  5BNG A;  4DZJ A;  1VF9 A;  3L1P A;  2AHQ A;  2L7M P;  5C4X J;  1I3Q J;  5EGO A;  2XPV A;  2HQ5 A;  5EF6 A;  2RAE A;  2TRT A;  1FIP A;  3BR1 A;  2MG4 A;  4B1R A;  4G12 A;  4M3B A;  1JJ8 C;  4S0H B;  3HDD A;  3JR9 A;  3F0C A;  3IV5 A;  3ZQF A;  3FIW A;  3ZQG A;  2XRL A;  5M5W J;  5F04 A;  4AYB N;  1YRN B;  3BG3 A;  1QVT A;  4A3F J;  1DU0 A;  4FIS A;  2JA5 J;  2FJ1 A;  3HKZ N;  3S1M J;  1TWF J;  3D1N I;  1ZR2 A;  4XRM A;  2R0Q C;  2EZI A;  3I4N J;  3VPR A;  1HCR A;  1U78 A;  3JRG A;  2HOA A;  3FIS A;  3FK6 A;  5IYD J;  4J19 A;  5EGO B;  3GTJ J;  2DMT A;  4JP0 A;  4M3F A;  3ZQL A;  3DEW A;  2JMW A;  3LSG A;  3C2B A;  3TW7 A;  3WHB A;  1XG1 A;  1ETV A;  5J1Y A;  1JT6 A;  4UUS A;  3TED A;  1IDY A;  1GT0 C;  2ELK A;  1WCM J;  2YU9 J;  2D5V A;  2EZH A;  5F0F A;  3GTO J;  4A69 C;  2Y30 A;  3IH4 A;  4Y52 J;  3JRF A;  1IRZ A;  3IH2 A;  1IGN A;  1A6I A;  1FTT A;  2ID3 A;  2OF7 A;  3H3V K;  2R93 J;  1IC8 A;  2X48 A;  5EZG A;  1I50 J;  1RKT A;  3BR2 A;  3FKI J;  2K40 A;  2GM4 A;  2DA1 A;  4XRS G;  5K7Z A;  1IUF A;  4QIW N;  2N8G A;  2R5Z A;  2DTZ A;  3O8G A;  1APL C;  2XB0 X;  1Q1V A;  2Y31 A;  2Y9Y A;  3I4M J;  2E19 A;  3JRE A;  4UUS B;  1G2H A;  2JK3 A;  2QF7 A;  1LFB A;  1H89 C;  1BW5 A;  1T33 A;  3CQZ J;  1U8B A;  3HOU J;  2DA2 A;  2JN6 A;  3HB9 A;  1NK2 P;  4DYR A;  1JKO C;  5E3M A;  1B72 A;  4RDU A;  2IBD A;  1MNM C;  2K9N A;  5DTD A;  4NDL A;  1R9T J;  1JTX A;  2CQX A;  2M0C A;  1RET A;  4ABZ A;  3S1N J;  2VI6 A;  2K9S A;  2NS8 A;  3OSG A;  3RQI A;  2GLO A;  2L7Z A;  2CUE A;  2R5Z B;  3S14 J;  3HOZ J;  2LFB A;  4DYQ A;  2ME0 A;  1OFC X;  4BBS J;  1ETY A;  4IHY A;  3S15 J;  1I6H J;  2EBI A;  2AO9 A;  3UKG A;  3QPS A;  3JRH A;  1TWG J;  1PUF A;  1MSE C;  4JYK A;  1GUU A;  3JRD A;  2TCT A;  2LVS A;  1ITY A;  4QTR A;  1GV2 A;  3NAU A;  3HGG A;  1U9N A;  3BTC A;  5IOZ A;  2DA3 A;  5C4J J;  1B72 B;  3GTP J;  2CU7 A;  1HDP A;  5EDN A;  5FKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...