3CDHA

Crystal structure of the marr family transcriptional regulator spo1453 from silicibacter pomeroyi dss-3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
134
Chain Sequence
DTFVSGYLLYLLAASSEEASAQFHDHIRAQGLRVPEWRVLACLVDNDAMMITRLAKLSLMEQSRMTRIVDQMDARGLVTRVARVRVRLTDDGRALAESLVASARAHETRLLSALADTDAARIKGVLRTLLDVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structure of the MarR family transcriptional regulator SPO1453 from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
total genus 42
structure length 134
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cdhA00
2GA1A 3GUDA 3I58A 4CXFA 1ON2A 1WWXA 2RV8A 3SQNA 2JPBA 5D8LB 2QQ9A 4I7HA 2CFXA 3L2CA 1ZREA 3KCCA 1ZG3A 1RUOA 2IA2A 2OAZA 2QBYA 2L3DA 1HXDA 1P4XA 1Z7UA 5BPDA 4EGYA 1FP1D 2P6TA 3ECHA 3M8FA 3BDDA 4M71A 1ZRDA 3NRVA 2W85A 2Y0MA 4XRFA 3F6OA 1XCBA 2K86A 2G7UA 1B9MA 5A2QK 4PCQA 2LSOA 2VC0A 1R22A 4OIQF 2FOKA 2HWVA 3H3UA 4JBAA 2IPQX 3D5LA 4EMSA 5JR3A 1RNLA 1HSJA 1TBXA 4FX0A 1P4AA 1LJ9A 5KK1A 3QP5A 2QQAA 2QM3A 1REPC 3ELKA 2R7DA 5LBQA 1QNTA 3HHHA 4TV7A 1DUXC 3J81Z 2P4WA 1XMKA 1XGNA 1KYWA 2HR3A 2DPDA 5D4RA 1K7AA 5LRRA 2XAGA 3M8EA 5HLGA 3IWZA 2QQBA 3WE3A 5FB2A 4ZH4F 3FXQA 1FBSA 4KFCA 2OZUA 1Z1DA 4IVNA 3PFIA 2P7VB 1SD6A 3EYIA 5DCMA 3M1EA 2YSRA 5EEHA 2VC1A 2YPRA 4G9YA 1G3SA 4CGZA 2A3SA 3PQKA 3E5XA 4LG0A 2DQRA 2ACJA 1LDJA 4I0AA 1H0MA 1W5TA 1YW8A 3EDPA 1QQIA 1BI0A 2ESHA 3E3VA 1B9NA 4L18B 3QPHA 1UB9A 3I59A 1FNNA 2IVMA 2E7WA 4GYGA 4UUVA 4MNUA 4GYIA 4BYYA 4L0YB 5H6RA 1IXCA 1WRJA 2GZWA 4G94A 4ESFA 1E17A 3ZMSA 2PMUA 4CDGA 1EV7A 5E20A 3FF5A 5BPIA 3U1DA 4ZZLA 1LNWA 4N0BA 2HFHA 4L5IA 4LD5A 1IRGA 4M73A 4S04A 3GFJA 2Y75A 1F1ZA 1V3FA 4U7BA 2GXBA 1CGPA 4HV5A 4G7HF 4BHBA 2LNBA 3IL2A 1LEAA 4B09A 4Y15A 4NB5A 1HSTA 1R1TA 5FD6A 3E5QA 1FY7A 1KQ9A 4PDKA 4L9NA 4EGZA 5LEJA 3HSFA 2K4BA 3KLNA 4A0XA 5JFRA 1KYZA 5HLHA 2XKOA 2QVOA 3LA2A 2XKPA 2ISYA 4MHGA 3JSPA 1USTA 4WX9A 2FA5A 2UWMA 2Z3YA 3EETA 3FHZA 1K78B 3KP6A 3LAJA 4OU0A 3F23A 2HYFA 1OYWA 3MQ0A 4EM0B 3LQRA 2QENA 3MWMA 4D0PA 4FX4A 5F6FA 2CYYA 2FQ3A 1SFUA 2YU3A 1W7PD 1BIBA 2E7XA 1KGSA 3GW2A 3GFIA 3BROA 5CVIA 4Q5SF 3V4GA 3TOAA 2GXGA 1JGSA 1P6RA 1IN6A 3MAJA 2UXXA 3QRFF 3E6CC 3T5XA 1SD7A 3N97A 3WTYC 1WI9A 2CO5A 2OQGA 1ZHFA 3F21A 1J75A 2FE3A 2EFPA 3E6MA 1QZYA 3GX4X 4N9HA 2NRAC 2O6GE 4YIFA 2F5FA 3LA7A 4CO8A 2MBFA 3WTTC 2BBYA 1LEBA 5J8FA 3ERED 3OV8A 4ASNA 4DQ2A 4IRIA 1O7FA 3L09A 1CF7A 3GLXA 4RGUA 4P9FA 3HHGA 4Y17A 1O3RA 3CUQB 2Z5UA 1AWCA 2O03A 3MZHA 3IWFA 1R00A 1LQ1A 1HKSA 4RB2C 2DAOA 2DT5A 4HLYA 1YG2A 5KVRA 2P5VA 3C18A 2GAUA 3WTWC 1HW5A 3GVAA 1UFMA 1V4RA 3KZZA 5L3CA 3LA3A 5L3DA 1Z91A 3R61A 2EFOA 1KU9A 1G6NA 5DV5A 2MD5A 2HOEA 4I02A 4ZZDA 1MD0A 3HRSA 1R1VA 3FXUA 3FM3A 1BC7C 4OINF 5F1RA 1D8JA 3K0LA 1TW2A 1MJBA 1FBUA 5LGUA 1MJ9A 3ZN0A 1ZG1A 2A6HF 2JTVA 2CGPA 1FSHA 1W7PB 4M9SA 2H6CA 3G73A 2D1HA 3BOQA 2XROA 2HKXA 3U2RA 1QO0D 1D5VA 1B1BA 4R8HA 3DP7A 3KP2A 2QZ8A 2EA2A 1MGTA 5LRSA 3B02A 5HOOA 2L01A 3HOTA 1ZARA 2V1UA 3V7CA 2WC2A 4ESJA 3FMQA 4U0WA 2RC4A 1T39A 5DYMA 1J2XA 2HZTA 1D8KA 2O3FA 3ISPA 1U3EM 4HLXA 3I54A 2FNPA 3TDUC 3DEUA 3RPQA 2VOPA 1R58A 2IJLA 1ZH5A 1FYKA 3RJPA 4XLNF 1QZZA 2MH9A 2XIGA 5K5OA 2VE8A 2ZFWA 3J80Z 3LAPA 2A68F 2VN2A 1TTYA 3I5UA 4ENJA 1MDMB 3GFMA 3ZMVA 3REOA 5J8CA 2QUFA 3AAFA 4L9VA 3R0JA 5ILSA 5ICCA 4HF0A 4Y13A 3T1BA 2D45A 1IW7F 4UV8A 3NEUA 3KP5A 2DQLA 3ZN1A 2P8TA 1BI2A 1BIAA 2FBKA 1IN8A 4HDUA 3L9FA 3BPXA 3ZQ7A 1O57A 2H09A 4RGXA 1UHMA 1WQ2A 1I5ZA 4BH9A 4BXUA 1XSVA 4YFXF 2KKOA 3LFKA 1DP7P 2F5CA 4RAYA 2M45A 1J5YA 2NS0A 5CVJA 4DNCA 2DFIA 3FMRA 2P5LC 2GA2A 2GQQA 3VFZA 1U5TC 1DPUA 1JHHA 1ZLKA 4R1HA 2WWYA 4LB5A 2HS5A 4NHJA 4M72A 3DXJF 5D6FA 4ZYDA 2O8XA 2HQNA 4FHTA 2M87A 2V6CA 3T8TA 1LB2A 2V9VA 3F3XA 1VTNC 4AIJA 3WODF 2J5OA 4CYDA 4LK1F 3KP4A 1BC8C 3Q9SA 4A0ZA 3VEPA 3MFKA 5J6XA 2RN7A 2XASA 4HA8A 5E1WA 4EQQA 1W7PA 2HDCA 3GWZA 3EQLF 5ICFA 3KETA 1FX7A 2B0LA 3RTRA 4WCGA 1IF1A 1KQ8A 2ISZA 2RNJA 2XV4S 3K2ZA 1D3YA 1PDNC 1ZRCA 4RGRA 2Z99A 5ILVA 3CDHA 4HX7A 2EV0A 1TLHB 4BHCA 2A6EF 4G7OF 3V7SA 3DV8A 2DK8A 2V79A 3CLOA 2FEZA 3Q9VA 4G8XA 2FMLA 2KIMA 5D5WB 3ZMTA 3TO7A 2W57A 2EK5A 2M5WA 3TO6A 1NHAA 4MTEA 3ZMDA 3KEQA 5TRDA 1FC3A 2STWA 3R6SA 2BEOA 1RZ4A 4YFNF 3S2WA 2VBXA 5CVVA 3GO5A 3MCZA 6PAXA 3FMSA 4EM1A 1TW3A 1ZGAA 4HBLA 4JQFA 5E1ZB 1I1SA 4WF2A 2PMHA 4P55A 3ABTA 1FPQA 2MA3A 2L54A 3P9CA 1RUNA 2DBBA 2MC3A 4YFKF 3RYRA 3GF2A 3WU1B 1Z6RA 3K69A 1L0OC 1S3JA 2ZMEA 5HDGA 1EH6A 1U5TA 4LFUA 2KJCA 1IAWA 5ILUA 4HYEA 2FBHA 4HQEA 3LSTA 2ESNA 1I6XA 5BQTA 5FLXK 1DPRA 1S29A 2EJRA 3E97A 3JAMK 1J59A 2HQRA 5K1YA 3DQVC 1K79A 4FT8A 3HIFA 1UCRA 1XMAA 1QBJA 5CYVA 3LQQA 4IHSA 5JVTA 2NNYA 1FLIA 4A5NA 4HF2A 3OOPA 3I0TA 4LK0F 3WG9A 3GXOA 3C7JA 5AIQA 3WTVC 3KLOA 4LJZF 2X4HA 3MEXA 5DD4A 2P7CB 2GIVA 1F9NA 3F8FA 5L3GA 5K5RA 2F5DA 3COAC 1XDUA 4Q4ZF 2VXZA 1EH7A 1P2FA 1G3YA 3GZ5A 4A6EA 3WE2A 1ODDA 1FWZA 2BE5F 5BOXA 5DEQA 1UHWA 4LLLA 1R5GA 2QWWA 1P4WA 1PP8F 1HW1A 2EV5A 4U0VA 5E17F 2DW4A 2DPUA 2XUBA 5CVUA 3QP6A 2PG4A 2EFNA 5HS9A 1B6AA 5LGNA 3H92A 4U7DA 4RB0A 5FGMA 2ZJ2A 3WGHA 1SAXA 3KP3A 1J9IA 3QAHA 1EH8A 4XSXF 3TDZC 5AONA 3BWGA 1R5HA 5E18F 3IRQA 4ENMA 4IF4A 3BJAA 1YYVA 1XCVA 5D5XB 1XGSA 2K02A 4ON0A 3T8RA 4EJVA 2XVCA 4ENKA 1LVAA 2JZYA 4XLPF 3F8MA 1YS7A 1IN5A 5DUKA 2IP2A 3Q5FA 4EJUA 1F4KA 1GXPA 3TGNA 1ZGJA 3E5UA 2OA4A 4S05A 2KRFA 1SFXA 4HAMA 5D5UB 4Q48A 4BAYA 2JPCA 4KN4X 3K1MA 2XRNA 3RPUA 5IT9Z 5ICGA 1BM9A 1S7AA 2XAHA 1I27A 2VONA 1R23A 4RB1A 4KYWA 3G3ZA 3RI4A 3FZVA 3CUQC 3C3WA 2RQPA 5HLIA 3SHFA 3HTUA 4K2EA 1IXSB 1R1UA 2RGVA 3BY6A 4N9IA 2H27A 4A12A 3T0YA 3ROUA 2ELHA 3DFGA 3JSOA 1BN5A 4YIIA 2QBYB 2KJBA 1TQMA 1FYMA 3KP7A 2ETHA 1ULYA 1ON1A 5DDGA 4KA4A 4M9XA 1H9TA 2P5KA 4AIKA 5AIPA 1T2KA 4A2UA 2P6SA 2OZ6A 1ZN2A 3QU3A 2FU4A 4OOIA 4F7ZA 1YIOA 4AVPA 4P9UA 1I1GA 4ZYEA 3ZP5A 1K78A 3JTHA 4HV6A 3GFLA 4OMYA 1KA8A 3EUHA 4AD9A 4O6JA 4GO1A 4G6DA 4G6QA 1G4DA 3F8NA 5E8GA 3RYPA 2EFQA 3TO9A 2Z33A 2RDPA 1W5SA 2OD5A 2E1NA 2GWRA 5L3BA 2DO7A 1GVJA 3WTUC 5DCMB 4A5MA 3O6BB 5CLSA 4CHUA 4QLCU 4EJOA 1IN4A 2D1VA 2IA0A 4KDPA 1MJAA 1Z6TA 5ERIA 2FSWA 1QGPA 3KE2A 1STZA 1YO5C 4WXHA 4ESBA 4LG0B 1B4AA 2ZNYA 3FXRA 1H9GA 2PBIA 2LF8A 3BPVA 4MQVA 2YX4A 1SD5A 2K27A 4IRGA 2PLYA 4WXDA 2L4MA 2LF7A 3HRUA 3I59B 2Y48A 1TNTA 3CUQA 2COMA 1A04A 2HTJA 4UVAA 2VE9A 1O3SA 4RB3C 2KIFA 4EJWA 2EFWA 1PUEE 5ED4A 2F2EA 3SFZA 3IRRA 1R36A 1WKMA 3C1DA 2A69F 2XGXA 1Q1HA 3ABUA 1K6OA 3QU6A 1TQIA 4WXCA 3WTZA 1O7LA 3CJNA 2ZBKA 2V1XA 1S6LA 3JW4A 3O3KA 3U9GA 1OR7A 1KU7A 5E8IA 4UXNA 1XSXA 4HX8A 2VBWA 2W84A 5DD8A 3R4KA 4WWCA 5TJJA 2QLZA 2D2WA 2J5PA 3FM5A 5A2QZ 4L9TA 1SFEA 2PN6A 4JK1X 3KZYA 1O3TA 4UV9A 4R79A 4ZYGA 1C0WA 5FO5A 5JI6A 4GCVA 5LEKA 1XSDA 1YLFA 2AXLA 2EB7A 1G3TA 1SD4A 1ZRFA 4KICA 1BOAA 2K4JA 2BGCA 4EVIA 2FBIA 1U2WA 2WV0A 5H20A 1TQPA 3JTGA 2FNAA 2H6BA 4Q47A 1PP7U 1WSUA 4KUMA 2NAZA 3I53A 3V7RA 4IJAA 3VOEA 4L5JA 1OPCA 2IT0A 5D6EA 4BQAA 3DF8A 1QPMA 1RIOH 4XSZF 4KMFA 1YFHA 2CQKA 2CSOA 1GHCA 3P9IA 5K5QA 3I64A 2PJPA 1USSA 5JHUA 3J81K 1LDKB 4EM2A 4KMUX 1HBXG 4Z2YA 3K1NA 3WGGA 2AS5F 4PGHA 1OYIA 4P5OA 3HTSB 4PGGA 3H3ZA 4M6YA 5LLQA 3J7AO 5CVRA 1MDMA 3TKYA 2RVCA 2HGCA 2Z9OA 4IPAA 1T6SA 1ZYRF 1AOYA 2W24A 4UNOA 4XBFA 1HW2A 1J7KA 4P96A 2X0LA 4H0EA 1KU3A 1FBQA 2L02A 5FLXZ 3JAMZ 3EYYA 1CF7B 4BHPA 2IW5A 1SMTA 3ULQB 2H94A 4I09A 1TNSA 2FMYA 4ETSA 2CW0F 1JHFA 3W6JB 2BYVE 1Y0UA 3KFWX 5IT3A 2FF4A 2WTEA 2VT2A 5HS8A 1T98A 1XN7A 3CTAA 3TQNA 4UVBA 3DKWA 4EJTA 4UHTA 2M8EA 4HQMA 3ML6A 3TOBA 4CICA 4I01A 2ZCWA 3BZ6A 1J0RA 4HF1A 2EV6A 4HOBA 4KIFA 2OU2A 3R0AA 3R60A 3RKWA 4M6XA 4YG2F 3RIRA 5E1XA 5D8KB 2A07F 2ADUA 2JSCA 4G7ZF 1ZG5A 2ZO4A 5F64A 2XHKA 3MZYA 1FT9A 2PEXA 4NQWA 4U88A 2ZNZA 1YW9A 1BI1A 4MGRA 1U78A 2VOOA 1IXRC 1OKRA 1U8RA 2XAQA 4KT5C 1SMYF 4KN7X 2EA4A 4GGGA 2YX7A 2PFBA 4E70A 1HKQA 4UVCA 4RAZA 3SZTA 5DCFA 3GYHX 3L00A 4HZFA 3VB2A 3P7NA 1RI7A 4I2OA 2KIUA 4A6DA 5HVQC 3WTSC 3L7WA 4BNCA 3I4PA 1FYLA 3F72A 4CZZA 3DPTA 5LHIA 4A0YA 1Z9CA 3ZMUA 2W25A 3P9KA 2YR2A 2Q8KA 2DTRA 3HSRA 3ECOA 3IKTA 3HRMA 1F5TA 1IN7A 4QWQA 2UXNA 4OIRF 4OIOF 2VBYA 2MH2A 1B59A 3QPTA 3DPLC 3CUOA 5DUIA 2R3SA 2IRFG 5HDKA 3FX3A 3SXYA 2RKHA 2UZKA 2QYOA 3CO7C 2O0YA 2DLLA 2G9WA 3W6KB 2LKPA 4OIPF 2JRTA 4I98B 3V8JA 2ZKZA 3RKYA 2C6YA 2VT3A 3RKXA 1G3WA 1U6GA 4HDVA 1FP2A 1FSEA 1FOKA 2Q2EA 4WK8F 2FXAA 1JXSA 1YTYA 1L3LA 1FZPB 2LDUA 4KIGA 1YQAA 4LMYA 3O2PE 1S7OA 1XD7A 1BI3A 1YW7A 2TDXA 3IC7A 5LHHA 5FFZA 1T38A 2ZXJA 4U0YA 3M7GA 1HKTA 1P92A 3IKVA 4RS8A 1MKMA 3BJ6A 4PZJA 4AWXB 1BJAA 2VBZA 2DI3A 2STTA 3BP8A 2BV6A 2OBPA 3QOPA 3LWFA 3F22A 4O3MA 4KIBA 5IT9K 5BMZA 5D5VB 4LLNA 3VODA 2HYGD 2EWNA 4MEYF 3GEZA 5FFXA 2FRHA 3KEOA 5L3FA 3K1PA 4IXAA 3WGIA 3ZPLA 1YS6A 4ZYHA 3PQJA 1KU2A 3I71A 4LLGF 4M74A 2A61A 3D0SA 4LGWA 1OYYA 2HKOA 1IUYA 3HRTA 5FD5A 1MZBA 2Q0OA 1X3UA 4I0BA 3V8LA 3K9TA 5ICEA 1XB4A 4HW0A 3V8KA 1W4MA 3HSEA 1ZAOA 3IHUA 5H6QA 4MQ9F 2MLKA 3N4MA 3E6DA 2V1DA 1XGMA 4GXOA 3F6VA 5HS7A 1ZLJA 2DK5A 4LB6B 3WTXC 3CO6C 2E1CA 4IRHA 4ENNA 1HQCA 5L3EA 2R7FA 1IRFA 3F8CA 4EV0A 1XDSA 1XGOA 5EEGA 2M1BA 2G7HA 4HX4A 5LHGA 1ONVA 3FWEA 2XAJA 4AIHA 3ZMZA 1O3QA 3RDIA 4L0ZB 1DDNA 2NYXA 2CWEA 2M30A 2VODA 1Z05A 3HOSA 1JE8A 2DU9A 3SZPA 1R7JA 2CG4A 4O5VA 1OMIA 2L4AA 2HEOA 3BJOA 2JT1A 4KNYA 2PI0A 1IZ1A 3NQOA 3HUGA 2HTSA 3J80K 2K7LA 3WU0A 4L9JA 4RGSA 2O61A 2NNNA 3M9AA 3GZ6A 4MTDA 5LGTA 1BBYA 4M9ZA 5HDNA 2F5EA 3E6BA 3HYIA 2ZMEB 1LDDA 1U5TB 1E2XA 4B8XA 1KQ0A 2MLGA 2PQ8A 3F8BA 5D4SA 2XAFA 4IHTA 5CJ9A 4OMZA 1GXQA 1T0FA 2A5YB 1S8NA 3B73A 2IA1A 2OQRA 4MEXF 5BS6A
chains in the Genus database with same CATH superfamily
2GA1A 3GUDA 2KQRA 1ETVA 2JN6A 2DOEA 4ABZA 2R7SA 3I58A 1VQOI 4CXFA 1ON2A 1WWXA 2RV8A 1LKXA 3SQNA 2EZIA 3CCMI 2JPBA 5JLXA 2CUJA 3VSKA 5D8LB 2IBDA 3CCYA 2QQ9A 5FKKA 1GUUA 4JYKA 4I7HA 2CFXA 4XICA 3L2CA 1R9TJ 2NOGA 4MLOA 3KCCA 1ZREA 4IOAF 5IYDJ 1GVDA 1ZG3A 1RUOA 2IA2A 2OAZA 2W82A 2QBYA 3CJTB 2L3DA 1HXDA 1P4XA 1Z7UA 5BPDA 4EGYA 1FP1D 2K9SA 2P6TA 3ECHA 3PUBA 3M8FA 3BDDA 4M71A 1BA5A 1ZRDA 3NRVA 2BY0A 2W85A 4LOCA 2Y0MA 4XRFA 3ZRGA 3F6OA 4I6ZA 2QCOA 1NK2P 3DTEA 1XCBA 2K86A 5J4VA 2G7UA 1B9MA 2IEKA 5A2QK 1XTAA 4PCQA 2LSOA 2VC0A 3M8JA 3RPUD 4F91B 1R22A 3ZQLA 5M5WJ 1X1CA 2M9HA 3A4CA 4OIQF 2FOKA 2HWVA 3H3UA 4JBAA 4AYBA 2IPQX 4N4NB 3D5LA 4EMSA 5JR3A 2LBFB 1RNLA 1HSJA 5EZHA 3OWTA 3OY9A 3BCAA 1TBXA 2DT6A 2EH3A 2CUFA 4FX0A 5EYRA 1P4AA 3H0DA 4BE1A 1MBJA 4ITVA 1LJ9A 4A3BJ 1X3ZB 2E5NA 2M4KA 5KK1A 4XRSA 4DZPA 3QP5A 2QQAA 1Y8QB 1I39A 1JGGA 2LLKA 4II3A 2QM3A 2CH0A 1REPC 3ELKA 2R7DA 4JX6A 1QNTA 3HHHA 3DCFA 4TV7A 3SDBA 5LBQA 3CMAI 1DUXC 3J81Z 3PIOF 2P4WA 1XMKA 1XGNA 2DA6A 2NVYJ 3SEZA 3WG7H 1KYWA 1BR2A 4BJTA 1EF4A 5FKNA 2HR3A 2DPDA 4YRVA 4BY7J 5D4RA 1K7AA 5KAFC 5IP7J 5LRRA 5B1BH 2XAGA 3M8EA 3DBRB 2OCCH 5HLGA 1X1DA 3IWZA 1OCTC 2QQBA 3WE3A 3UNGC 2CFOA 4ZTFA 5FB2A 3LSMA 3FXQA 4ZH4F 1FBSA 4KFCA 2MW8A 2OZUA 3BC8A 4HG2A 1Z1DA 4IVNA 3PFIA 2P7VB 1SD6A 3EYIA 5DCMA 3M1EA 5FLVA 3AG2H 3HOZJ 2LR8A 2YSRA 5EEHA 2VC1A 4BE0A 2H1KA 2LG4A 4HNTA 2YPRA 2DXIA 1B8IB 4G9YA 1G3SA 4CGZA 4XN0A 2A3SA 2XB5A 1LFUP 3PQKA 1JKQC 1OCZH 3E5XA 4LG0A 2DQRA 1V54H 4Y4RA 2ACJA 2ZXHA 1LDJA 4I0AA 3CCEI 2R7TA 1H0MA 1W5TA 1YW8A 3EDPA 1QQIA 1BI0A 3CMYA 2ESHA 4BUPA 1E3PA 2MSYA 2W00A 3E3VA 4UB8C 1B9NA 3FK7A 2JVGA 4D1QA 3ABLH 4XONA 4L18B 1G2HA 3QPHA 1UB9A 3I59A 1FNNA 3F0CA 3ASNH 2IVMA 3BTLA 2E7WA 4GYGA 4UUVA 4XMYA 3CDIA 4MNUA 4GYIA 4A93J 4B4CA 2E19A 4BYYA 2X1EA 3G71I 1K4SA 4L0YB 5H6RA 1IUFA 1IXCA 1WRJA 2GZWA 2HOAA 4G94A 2CV0A 1QRYA 4ESFA 1RRJA 3K10A 1LE8B 5GPAA 4F92B 1E17A 3ZMSA 5LFAA 4E7JA 4A3IJ 2PMUA 3P5JA 4CDGA 1EV7A 1R49A 4RM3A 3BTIA 1QPIA 4XRMA 2LY2A 1FOXA 5E20A 5HODA 3IAS2 3FF5A 5BPIA 3U1DA 4ZZLA 4A3FJ 1LNWA 4N0BA 2HFHA 2HPIA 5IP6A 1MMGA 1UELB 4L5IA 4LD5A 2QGUA 1IRGA 4M73A 4N4OB 4S04A 1WJ5A 3TEDA 3GFJA 4BACA 4Y52J 2Y75A 1F1ZA 1V3FA 4U7BA 2GXBA 1CGPA 4HV5A 4XLHA 4BHBA 4G7HF 3EUKL 1XS9A 1B72A 1ZKGA 2LNBA 3IL2A 2VI6A 3G6EI 1LEAA 1IG7A 4B09A 3H5AA 4AVZA 4Y15A 4NB5A 3A0HC 1HSTA 1X2MA 3JR9A 1R1TA 3OYFA 5FD6A 1LUJB 2DMQA 3E5QA 3TBIA 1W0TA 1FY7A 1KQ9A 4PDKA 1YJ9I 1WH7A 4L9NA 3HOYJ 4EGZA 3GBGA 3KIOA 5LEJA 3HSFA 2K4BA 1ZR2A 2HNHA 3G1MA 3KLNA 4A0XA 1VQ7I 3PO3J 4HSTA 5JFRA 3DKXA 1KYZA 2EINH 5HLHA 2KDOA 2XKOA 3LSKA 5H2FC 3E7LA 2M0MA 4M6VA 2QVOA 1MBGA 3LA2A 2XKPA 4BL0B 5GAHJ 1MMDA 1X1PA 2ISYA 4MHGA 3JRHA 3JSPA 4L5EA 2LBFA 1TWAJ 1USTA 4WX9A 2FA5A 2LREA 4PJJA 2CRGA 2UWMA 2Z3YA 3EETA 4DYCA 3FHZA 4BQOA 3CZ6A 3K7AJ 3PL8A 5HNFA 4KT6A 1K78B 3KP6A 2LTPA 3LAJA 4OU0A 3FXOA 4OAYA 3F23A 2HYFA 3DKYA 1QHHD 3K70C 1OYWA 4XKCA 3W3CA 2RNGA 3MQ0A 5KCMA 2M7AA 1F43A 4EM0B 4FISA 3H36A 1MSEC 3LQRA 2QENA 3GTOJ 3MWMA 3S3OA 1ZGWA 4D0PA 4FX4A 1P7IA 4A3EJ 5F6FA 2CYYA 2FQ3A 3EUAA 1SFUA 2YU3A 1W7PD 4BEHA 1BIBA 2E7XA 3VWBA 4XRSG 5E79C 2DOFA 3M07A 1XMXA 5TGTA 1KGSA 2BXZA 3GW2A 3BROA 5B66C 3GFIA 2ZJPF 1EJ9A 3S2DJ 3K4MA 3G2BA 5CVIA 4Q5SF 4ZDLA 1MW7A 3CC4I 3JRAA 2R5YB 4C30A 3V4GA 2VQGA 3TOAA 2GXGA 3J7ZI 3AKZA 1JGSA 1ZELA 3QQAA 1P6RA 2VQCA 1IN6A 4RA2A 3MAJA 3HGYA 5M5XJ 2UXXA 1YOVB 5FJ8J 3QRFF 3E6CC 3T5XA 3DU5A 3SJMA 3OYDA 1SD7A 2WB1A 3N97A 1JJ8C 3WTYC 1UG0A 2BHZA 1WI9A 1DQUA 3I56I 2CO5A 2OQGA 1ZHFA 4UUSA 3F21A 2IXSA 2AHQA 1J75A 2NVQJ 2FE3A 2EFPA 2O8KA 1VQ4I 3E6MA 1MIJA 1QZYA 3GX4X 2XF5A 4N9HA 2NRAC 2O6GE 3CDLA 4YIFA 3ZOBA 3PO2J 2F5FA 1MSFC 3LA7A 4CO8A 1WHUA 2MBFA 3OIOA 3WTTC 2BBYA 1LEBA 5J8FA 1Z3XA 3ERED 2X6OA 1BR4A 4E7LA 3OV8A 4ASNA 4DQ2A 4IRIA 1O7FA 3L09A 1CF7A 3GLXA 4RGUA 4P9FA 3HHGA 2CQXA 5GTHC 5GTIC 4Y17A 1O3RA 3CUQB 3BR5A 2Z5UA 3BTJA 1AWCA 5J47A 2O03A 3MZHA 3IWFA 1R00A 1LQ1A 4QTRA 1HKSA 2P81A 4RB2C 2DAOA 2DT5A 4HLYA 1YG2A 2HVQA 5KVRA 2LD5A 2P5VA 3C18A 4JP0A 1E0EA 2AO9A 2GAUA 3ONQA 3WTWC 4FASD 1Y6IA 3ESWB 1HW5A 3GVAA 1ETKA 3B6AA 1V5EA 3RQ4A 1UFMA 1V4RA 3HOUJ 3KZZA 2Y30A 5L3CA 3S32A 2P0WA 3LA3A 2VKEA 4AU7A 1R6RA 2QA4I 5L3DA 2X6XA 2R7WA 2JWTA 3DWLE 1Z91A 1WH5A 3MKLA 1O4XA 3R61A 2EFOA 2HVSA 1ZQ3P 1SFKA 1KU9A 3I9V2 2NOJB 4QIWN 4FCYA 1G6NA 4Y33A 2A6TA 5DV5A 2M8GX 4C3HJ 2MD5A 2HOEA 5CQGA 4I02A 1T0FC 4RLFA 4ANJA 2X6YA 1FIPA 3PSIA 1MD0A 1ZK8A 4ZZDA 2VPRA 5C44J 3HRSA 1R1VA 3FXUA 1YRNA 4AIDA 4LIUA 2LYCA 3FM3A 3J7AY 2ELKA 1BC7C 2Y2ZA 4OINF 3JRCA 3PNVA 5F1RA 1D8JA 2IS6A 1R4MB 1ITYA 3M3YJ 3K0LA 5GAGJ 1TW2A 1MJBA 2XGCA 4HNVA 1YI2I 1FBUA 3L2WA 2GBYA 5LGUA 1MJ9A 2VLAA 2LK2A 3ZN0A 4AC0A 4F3QA 2Y9ZA 3K4LA 2GXAA 4C2UA 1ZG1A 2A6HF 2JTVA 1YX3A 2CGPA 5F0CA 3OS2A 3JCUC 4FE7A 1OFCX 3OYJA 1HOMA 1X19A 1FSHA 1W7PB 4M9SA 2H6CA 4PJ0C 3G73A 2D1HA 2ECCA 3BOQA 1JKRC 2HXOA 2XROA 1SC7A 4OAZA 3SEQA 4NC6A 1FOYA 5JLWA 2VKHA 1FEXA 2NVXJ 2HKXA 3U2RA 1FJLA 2DJIA 5J1RA 4E7HA 2LKXA 3I4MJ 1NG7A 4C3JJ 3HOXJ 1CQTA 1QO0D 4E7ZA 1D5VA 1B1BA 4R8HA 3HEFA 4DIQA 3CCLI 3DP7A 3KP2A 2VIXA 2QZ8A 2EA2A 1MGTA 5LRSA 3B02A 3TMOA 2L9VA 5HOOA 3JREA 2L01A 3S16J 3HOTA 1K83J 5K7HA 2NXNB 1ZARA 1K4TA 2V1UA 3V7CA 3HBLA 4B48A 2WC2A 2CW7A 5E3LA 4ESJA 2R7XA 3FMQA 4BQQA 4U0WA 1QZEA 2BOLA 2RC4A 3OYEA 1T39A 5DYMA 1QA6A 2X48A 1HCRA 2WAEA 1J2XA 2HZTA 1D8KA 2O3FA 3GTGJ 2CW8A 3ISPA 1V5FA 3TP0A 3K4JA 1U3EM 2BVLA 4HLXA 4ZJZA 3I54A 2RREA 1DP3A 2FNPA 3TDUC 2EZKA 3DEUA 3RPQA 2GIZA 3IUOA 2VOPA 2JA5J 1R58A 2IJLA 1ZH5A 1XG1A 3H1CA 3SFIA 1FYKA 2OUMA 1BR1A 1S72I 3RJPA 2R4GA 4XLNF 1YE9A 1WJDA 1QZZA 2MH9A 2E2HJ 2XIGA 2LY9A 2Y0SA 5K5OA 2VE8A 2ZFWA 3J80Z 2DDAA 2IS2A 3CJRB 3LAPA 3Q3SA 4D9JA 3L2RA 2A68F 2KZGA 2XF7A 3BG3A 1Z7LA 3DU6A 3K6GA 2VN2A 1BL0A 1VQNI 1TTYA 3I5UA 4ENJA 1MDMB 3GFMA 3ZMVA 2R7RA 1DGWY 3REOA 1FTZA 1KONA 5J8CA 2JRMA 2JQ7A 2W1OA 2DA3A 2QUFA 2WY8Q 3AAFA 4L9VA 3R0JA 5ILSA 5ICCA 4HF0A 1VQ8I 3HB9A 3S3NA 5F27A 2WY7Q 3ZGKA 4Y13A 4CCOA 3T1BA 3A01B 2D45A 1IW7F 4UV8A 3NEUA 3LSRA 3OL4A 5TISC 3HC7A 3KP5A 2DQLA 3ZN1A 3CCJI 2P8TA 1Y0NA 1BI2A 1QVUA 1BIAA 2FBKA 2K9NA 3CCVI 1VF9A 1IN8A 4RLQA 1GDTA 4HDUA 3L9FA 4ZTJA 3OYMA 3AL0B 3BPXA 1IDYA 4ZDPA 2R0QC 2DT7B 2Q1ZB 3ZQ7A 1SVLA 2QKMB 1O57A 2A05A 2H09A 1T08B 3FXJA 4RGXA 1UHMA 3PNYA 3M4OJ 1WQ2A 3LSIA 1I5ZA 4BH9A 3BG5A 4MFDA 2BY1A 1VI0A 4BXUA 1XSVA 4YFXF 3BR6A 1W36C 1AU7A 2KKOA 2VJ4A 3LFKA 4CYCA 1KZHA 2PMZA 3QPSA 4CCLA 4PJNA 1DP7P 2F5CA 3IH4A 4RAYA 1ERDA 2M45A 4V19K 1JT0A 3IV5A 1J5YA 2NS0A 3SDGA 4BS9A 3HG9A 5CVJA 4DNCA 2DFIA 3FMRA 2P5LC 3KYDB 2ZMEC 1BW5A 1MNDA 3OYGA 2GA2A 2GQQA 3VFZA 3OYNA 1U5TC 3LSPA 1JHHA 1DPUA 5E3NA 1TT5B 1VFCA 1ZLKA 5GP9A 1RKWA 4R1HA 2WWYA 4LB5A 2BW3B 2HS5A 4CZCA 4NHJA 4M72A 2BY2A 2K9LA 1PUFB 2V1NA 3S93A 2DA4A 3DXJF 3X2QH 2KPMA 5D6FA 2K9QA 4ZYDA 1IV6A 2O8XA 2HQNA 4FHTA 2HU9A 2M87A 2K85A 2V6CA 1ETWA 3T8TA 3OSFA 1LB2A 4KISA 4BGDA 2V9VA 3F3XA 1VTNC 4AIJA 5F0FA 4IHXA 3JRDA 3A03A 4F52A 3WODF 4PJMA 2J5OA 4CYDA 4LK1F 3KP4A 1ETXA 3L1PA 1BC8C 3Q9SA 1DGRM 3A0BC 4A0ZA 3VEPA 3MFKA 1I6HJ 5J6XA 2ID3A 4DOZA 2RN7A 2XASA 3KEYA 4HA8A 5E1WA 2HVRA 5FKOA 4EQQA 5FRMA 1VQ9I 1W7PA 3S2HJ 2HDCA 3PM1A 3GWZA 1WI3A 3EQLF 1UMQA 2HXIA 1BJZA 5ICFA 3TP3A 3KETA 1FX7A 2B0LA 1S9HA 3VPRA 4NQWB 3RTRA 4WCGA 4A3JJ 1IF1A 2QEXI 1KQ8A 2ISZA 1E3HA 2DTZA 2RNJA 3VYRB 2XV4S 3BQYA 1H89C 2L9NA 4XKBA 4A3MJ 1YHQI 3KPHA 3K2ZA 1D3YA 2NS7A 1PDNC 1ZRCA 2VQHA 4RGRA 4CCMA 2Z99A 5EG0B 5LD2C 3RCOA 2ECBA 2TCTA 5ILVA 3DTKA 2KL4A 3CDHA 5IY5H 2DMTA 2JK3A 3ZQCA 4H4KC 4HX7A 1RKTA 2OF7A 2MGQA 3S15J 2EV0A 3DEEA 2OTLI 2WV1A 1TLHB 4BHCA 2A6EF 4G7OF 3V7SA 1D0YA 4FTHA 4DBRA 3DV8A 2DK8A 2V79A 3CLOA 4BBSJ 2FEZA 3Q9VA 4G8XA 2FMLA 2KIMA 5F08A 1NK3P 1HDPA 5D5WB 3ZMTA 2R7ZJ 1Y39A 3DBHB 5CKTA 3TO7A 2W57A 1PVEA 2EK5A 2M5WA 3TO6A 1NHAA 1Z3YA 4MTEA 1SANA 4IOCF 4C2MJ 1H8AC 1OCCH 3ZMDA 4YIRX 4NBQA 3KEQA 1S5LC 5TRDA 4B3AA 1FC3A 4NC8A 2IGNA 3VSLA 1YJWI 1IRXA 2STWA 2OTJI 3R6SA 3CC7I 4DBQA 2BEOA 2ME6A 4BU2A 1RZ4A 2A5WA 4LIVA 2O7OA 3IP4B 4YFNF 3MMYB 3S2WA 2E71A 2VBXA 1WJBA 3DPUA 5CVVA 2E1OA 3GO5A 1LVKA 4QPQA 3MCZA 6PAXA 3FMSA 4HPQA 3VDXA 3MKZA 1TW3A 1ZGAA 4HBLA 4JQFA 5E1ZB 4EM1A 1I1SA 2KZVA 4II2A 4XLAA 3L2QA 2M3AA 4WF2A 2PMHA 1Y1WJ 1JTYA 4P55A 4V2FA 3ABTA 1FPQA 2MA3A 2L54A 3OS1A 2HQAA 3BG7A 3P9CA 2F4MB 1RUNA 2DBBA 2MC3A 4YFKF 2F5VA 3RYRA 4PK4A 3GF2A 4XM3A 3WU1B 1Z6RA 3RZOJ 2VL8A 3K69A 4C3IJ 2KRCA 1L0OC 1S3JA 1TWGJ 2ZMEA 5HDGA 1GV5A 2H8WA 1EH6A 5EGOB 1UAAA 1U5TA 5CPRB 2CMPA 1MBFA 5K7FA 2CUZA 3QYBA 4LFUA 4IZZA 2KJCA 1IAWA 4ZDOA 2LC2A 3H9GA 5ILUA 4HYEA 2XDVA 2FBHA 2VPLA 4HQEA 3LSTA 2VUMJ 2ZFUA 2Q2EB 4HRIA 2ESNA 1I6XA 1P7JA 5BQTA 5FLXK 2QQ8A 3HGGA 1DPRA 1S29A 2EJRA 3C2BA 3E97A 3JAMK 1J59A 3OMYA 2HQRA 3W2AA 2I10A 3LNQA 1A36A 3S8PA 3BCBA 5K1YA 2CUEA 3GMEA 3A1YA 4P1WA 3DQVC 3K2AA 5GADJ 1K79A 4FT8A 3HIFA 4PSWA 1UCRA 2EBIA 4AUXA 1XMAA 1QBJA 5CYVA 3LQQA 2VXDA 3IH3A 2I5UA 4IHSA 1FOWA 5JVTA 2NNYA 1FLIA 1J09A 4A5NA 4HF2A 3JRIA 2E5ZA 3OOPA 2FX0A 3I0TA 4LK0F 3MKWB 4RAGA 3ZR8X 3WG9A 3GXOA 3C7JA 5AIQA 3WTVC 1HA8A 1OJLA 3KLOA 2XSDC 4LJZF 2X4HA 3MEXA 1SEUA 5DD4A 1MNMC 2P7CB 1X1AA 3CC2I 2GIVA 1F9NA 4XLCA 3F8FA 4UUTA 5KHDA 5L3GA 3HOWJ 5K5RA 1Z77A 2QSGX 2AQEA 3JRFA 2F5DA 3COAC 2HDWA 5J1UA 2OV7A 3HZJA 1IRZA 3RSNA 1XDUA 3FISA 2VXZA 4Q4ZF 1EH7A 4GFBA 1P2FA 1XPXA 1W0UA 1G3YA 4A69C 3GZ5A 2F4IA 4A6EA 2MABA 3WE2A 1VQ6I 1ODDA 1FWZA 2R7OA 2FUG2 4ZC3A 1N25A 3AG4H 2DMPA 2DFFA 5FROA 1G59A 3ZQIA 2BE5F 5BOXA 2IAIA 5DEQA 1JJ6C 1UHWA 4LLLA 1R5GA 2QWWA 4BJ6C 3FBNB 4E6KG 2JA8J 1P4WA 2NVUB 4A3GJ 2L5QA 1PP8F 1ORKA 2HYJA 2BY3A 3LL7A 3H35A 4U87A 1D1CA 3BR3A 2ZJQF 1HW1A 1TZLA 2EV5A 3E0JB 4U0VA 2PJRB 5E17F 2DW4A 2M7BA 5IYCJ 1M1EB 3PIPF 2DPUA 2XUBA 5CVUA 1UZCA 4PFOA 3QP6A 4PFPA 2PG4A 2EFNA 4J19A 5HS9A 2XRLA 1B6AA 5LGNA 3H92A 4U7DA 4RB0A 3TL4X 5FGMA 2ZJ2A 1AKHB 3WGHA 1D1BA 1SAXA 3GTPJ 2R7VA 3EUHC 3K4CA 3KP3A 1J9IA 5JVGF 2FOWA 4RBOA 1IC8A 3QAHA 4HNUA 4UB6C 3HKZN 2M34A 1K6YA 1B8IA 2V9KA 4DJAA 1EH8A 4XSXF 3TDZC 2K3PA 5AONA 2VKVA 2DA2A 2DA7A 2R93J 1X1BA 3S1QJ 2I8DA 1W1WE 3BWGA 4QSHA 1R5HA 3ZQGA 2DA1A 2E60A 5E18F 3IRQA 4ENMA 4IX7A 4IF4A 4D5CA 3BJAA 1YYVA 2VJJA 1XCVA 5D5XB 1XGSA 1D5YA 2K02A 2QKLB 2WAQA 4ON0A 1HDDC 2GLOA 4B3XA 3HUGB 1YITI 2H1LA 2BHYA 2K5CA 3TW7A 1OCOH 2ELJA 3T8RA 4EJVA 2XVCA 4JX5A 4ENKA 2OPTA 4G12A 1LVAA 2JZYA 3OYIA 4XLPF 3F8MA 1MH4A 2CS3A 5C3EJ 3HPHA 1YS7A 4MFEA 1IN5A 3BLYA 1WZ2A 5DUKA 5KAIC 2XGEA 3VYUB 5BNGA 2E1MB 2IP2A 3Q5FA 4HEA2 1NTCA 4EJUA 1F4KA 2NVTJ 1GXPA 3TGNA 1ZGJA 1LE8A 3E5UA 2OA4A 4S05A 2KRFA 1SFXA 4D7NA 4HAMA 1A6IA 5D5UB 2L9SA 4Q48A 1TT0A 4BAYA 2JPCA 3FKIJ 3DEWA 4KN4X 4FETA 3K1MA 2V9PA 2XRNA 4OWRB 3RPUA 3U1KA 5IT9Z 5ICGA 4I76A 1BM9A 2COBA 1DU0A 3OR2C 1S7AA 2XAHA 1I27A 2DFHA 3A02A 1R23A 4GRIA 4RB1A 4M3GA 4KYWA 2VONA 3MKYB 3G3ZA 3RI4A 3FZVA 3CUQC 4XLEA 3C3WA 1U9NA 3QODA 2RQPA 5HLIA 2UV1A 2VQLA 3SHFA 2EIKH 3OYBA 3HTUA 4K2EA 1MMNA 1IXSB 1R1UA 4A3DJ 2LP0A 2RGVA 1VZ0A 3NWSA 3BY6A 5FRNA 2CQNA 4N9IA 2H27A 4A12A 3V42A 2VASA 3T0YA 2KISA 3ROUA 2ELHA 5E3OA 3DFGA 1WJAA 1RR8C 3JSOA 1BN5A 3FXKA 4YIIA 4IKFA 2EZHA 2QBYB 1VQMI 2JA2A 2XF6A 2KJBA 1TQMA 1FYMA 3KP7A 4BXXJ 1OR7C 1VQKI 2ETHA 3BR2A 4CCNA 1ULYA 3ERMA 1ETOA 1ON1A 5DDGA 4KA4A 2G0EA 3VYTB 4M9XA 3N05A 5HLTA 1H88C 2MG4A 3S1RJ 1H9TA 2R7UA 2P5KA 4AIKA 5AIPA 1OQYA 1T2KA 1IGNA 3CCQI 3PNTA 4A2UA 2P6SA 3EPZA 2OZ6A 1ZN2A 3BR0A 4M3DA 3NWTA 4E7KA 3OYCA 4C2TA 3QU3A 1JUPA 4BXFA 2FU4A 4CH7A 4OOIA 4F7ZA 1IV8A 1YIOA 1X4PA 2VJ5A 4AVPA 4P9UA 1I1GA 3OSGA 4XORA 4ZYEA 3ZP5A 1K78A 2ICWG 3JTHA 2K9MA 4HV6A 1SVMA 3GFLA 4OMYA 5IOZA 1KA8A 3EUHA 2Y0SN 4IQ4A 4AD9A 4Y7NJ 2GOXB 1XX5A 4YELA 4RM2A 2GM4A 3DBLB 3GZNB 4O6JA 4PJLA 4C9YA 2L0KA 2F48A 3CCRI 4GO1A 4G6DA 2KP6A 2XPVA 4G6QA 5FKMA 1VNDA 3CF5F 1Z0XA 4BKXA 3BT9A 1G4DA 2GOMA 3F8NA 5E8GA 3RYPA 4XKWA 1X3WB 2CJJA 5IP9J 2EFQA 3TO9A 3FBIB 1X4OA 2JMWA 2KMUA 2HZDA 2Z33A 3OOUA 1DU6A 3PUFA 2RDPA 4B47A 1W5SA 2OD5A 2E1NA 2R5YA 2GWRA 1WJCA 5L3BA 2DO7A 1GVJA 4XL9A 4D5FA 5GPCA 2M0CA 1ETQA 3M1CA 5JHFA 3WTUC 3H5RA 5DCMB 4EEFG 4A5MA 3O6BB 5CLSA 2Y69H 4CHUA 3CESA 4QLCU 4EJOA 2ZB9A 1IN4A 2D1VA 2IA0A 2HI3A 4KDPA 1MJAA 2KFDA 1Z6TA 5ERIA 2FSWA 1QGPA 3KE2A 2RQQA 4BY1J 2KRHA 1STZA 1YO5C 4WXHA 2BVMA 2K40A 3G1OA 4GDFA 3BR1A 4ESBA 4LG0B 1B4AA 2ZNYA 3CJQB 1H9GA 3FXRA 3IH2A 2PBIA 1T33A 2LF8A 3BPVA 4MQVA 2YX4A 5FLMJ 1SD5A 1ACIA 2QSFX 2WBMA 4G6TB 2K27A 4IRGA 2PLYA 1Y1VJ 3S1MJ 4WXDA 5FKLA 2L4MA 1MH3A 3I3LA 2LF7A 5J4YA 3HRUA 1GT0C 2BZTA 1AA7A 2K3FA 3I59B 2DJNA 3H9QA 3HXLA 2Y48A 4XQFA 1TNTA 2DA5A 3CUQA 2COMA 1D0XA 2NS8A 3Q0VA 5J3LA 1A04A 2HTJA 3ZQHA 4UVAA 3PSFA 2VE9A 1O3SA 4RB3C 3S3MA 2KIFA 4EJWA 2EFWA 1PUEE 1OLTA 5ED4A 4BBRJ 2JSPA 2F2EA 3SFZA 2LRDA 2LOOA 3IRRA 1R36A 2XB0X 4DW6A 4B1RA 3BG9A 4CUGA 1PYVA 1WKMA 3IAM2 5DM7F 3C1DA 1A6QA 2DN0A 2L7ZA 2A69F 1D1AA 2N8GA 2XGXA 1JKOC 1Q1HA 2YUSA 3ABUA 1K6OA 3QU6A 3H9JA 1TQIA 4WXCA 1G8XA 1O7LA 3WTZA 3CJNA 2ZBKA 1TC3C 2V1XA 1S6LA 3AL0C 1JTXA 1TWCJ 4FE4A 3JW4A 3O3KA 1OR7A 3U9GA 2DODA 2ZSIB 1KU7A 5E8IA 2LH9A 4AYBN 4UY8I 2DYRH 1EKEA 1TWFJ 1VQ5I 4UXNA 1XSXA 4HX8A 2VBWA 2W84A 3C2GA 3OYAA 5DD8A 4NNJA 3R4KA 4M3BA 4WWCA 5TJJA 2QLZA 2D2WA 2J5PA 3CP8A 3FM5A 4Z6YA 5A2QZ 1B72B 4L9TA 1SFEA 2PN6A 4JK1X 3KZYA 2YS9A 1O3TA 4UV9A 1WGXA 2R7QA 4R79A 4ZYGA 1C0WA 5FO5A 5IYBJ 2DOAA 5JI6A 4GCVA 5LEKA 1XSDA 4IQJA 1YLFA 2AXLA 1YIJI 3HM5A 2MFZA 2EB7A 2W48A 1EA3A 3UKGA 1G3TA 1SD4A 2R92J 1ZRFA 5DS9A 1XC5A 4KICA 4S0HB 1BOAA 3D5SC 4A3LJ 2K4JA 1WVRA 2BGCA 4EVIA 2FBIA 1U2WA 2WV0A 5H20A 3L2VA 1TQPA 1NG6A 3JTGA 2FNAA 2H6BA 4Q47A 1PP7U 2F6CA 5IOYA 1IJWC 1WSUA 4KITB 2LMDA 3S17J 4KUMA 2NAZA 3I53A 3S14J 3V7RA 4IJAA 3HOVJ 2V26A 2KT0A 4I99C 3VOEA 4L5JA 2ZXIA 1OPCA 3KYCB 4EATA 3CP2A 4E7SA 3BTCA 5J40A 1A31A 2IT0A 5D6EA 4BQAA 2JA7J 3DF8A 4CSWA 2TRTA 2XC7A 1QPMA 1RIOH 4XSZF 2Z16A 5K7ZA 4KMFA 1YFHA 4CCJA 3WU2C 4BDZA 3NARA 2CQKA 3FXMA 5GAEJ 2CSOA 1GHCA 3P9IA 3SYTA 2QF7A 5K5QA 3B6CA 4RMNA 3I64A 2PJPA 4NDLA 1USSA 2LFBA 2XSJC 5JHUA 4JX4A 2MYSA 3J81K 2IGOA 1LDKB 4BEHB 4EM2A 4KMUX 3K70D 1IDZA 1HBXG 3H3VK 3Q0UA 4Z2YA 3K1NA 3WGGA 2AS5F 4PGHA 4RAFA 1OYIA 1T56A 4P5OA 3HTSB 2WADA 4PGGA 2V4JC 3ABMH 3H3ZA 4M6YA 5LLQA 2CQQA 3J7AO 1ZR4A 5CVRA 1TP4A 4DYQA 3CMEI 4A3KJ 2HQ5A 3A2KA 3MVPA 1MDMA 4BE2A 3TKYA 2RVCA 1A5JA 2HGCA 4IEJA 1FIAA 2Z9OA 4IPAA 1T6SA 1ZYRF 4LITA 1AOYA 3A01A 2W24A 4UUSB 4UNOA 9ANTA 1R5ID 4XBFA 1SAUA 2KIQA 1HW2A 1J7KA 1S7EA 4P96A 2X0LA 2ZSHB 4H0EA 1KU3A 5C4JJ 2BXYA 1FBQA 4XOTA 2AQFA 3RKQA 2L02A 3KX2A 5FLXZ 1UJ8A 3ZQQA 5J1YA 1GV2A 3JAMZ 3EYYA 1CF7B 4BHPA 4XK4A 2IW5A 3QWLA 1NH3A 1SMTA 3ULQB 1MMAA 2H94A 4I09A 3CQZJ 2OCEA 4IO9F 1TNSA 2X85A 1Z21A 1QVTA 2CQ7A 2F4OB 2FMYA 4ETSA 4AM3A 4Y3OA 4X0GA 2CW0F 2FJ1A 3LSHA 1JHFA 3W6JB 1LFPA 2BYVE 1R71A 1Y0UA 3KFWX 5IT3A 2FF4A 2VB6A 2WTEA 2VT2A 3HJEA 2O9LA 5HS8A 2EPFA 1T98A 1XN7A 1MBEA 2BW3A 3CTAA 3TQNA 4UVBA 4J00A 3DKWA 3G1LA 2L7MP 2LY1A 1PUFA 2CV1A 4EJTA 3HL2A 4UHTA 5B1AH 2M8EA 3GTQJ 2JUGA 2X6WA 4HQMA 5M3FJ 3DTIA 3ML6A 3TOBA 4CICA 4I01A 2ZCWA 1TL8A 3BZ6A 3JRBA 1J0RA 3J7YJ 4IHYA 1YRNB 3I55I 4F93B 3PJRA 4HF1A 2EV6A 1WFXA 3FHNA 3ZCOA 3I4NJ 4HOBA 4HSRA 4KIFA 2OU2A 5EEAA 3R0AA 1ZTRA 3R60A 3RKWA 3KZIC 4M6XA 2JA6J 2OJED 1UG2A 2H8RA 5C4XJ 3CCUI 4IHVA 4YG2F 3RIRA 3SZGA 5E1XA 5D8KB 1ETYA 3BQZA 2A07F 2IS4A 2IGKA 2ADUA 2JSCA 2Z2SB 4G7ZF 2CV2A 1ZG5A 3LFUA 4W1UA 3E1SA 2ZO4A 5F64A 1U8BA 2XHKA 3MZYA 1FT9A 2KHMA 3K4KA 1F36A 2O5RA 2PEXA 1I3QJ 4D7MA 3F9KA 1A35A 4NQWA 4U88A 2ZNZA 3OL3A 1BI1A 1YW9A 2ID6A 5EDNA 3TW6A 3JRGA 2LKSA 1RC9A 4MGRA 4V2GA 1U78A 2VOOA 1IXRC 1OKRA 1U8RA 2XAQA 2FD5A 4KT5C 1SMYF 2CU7A 2DFEA 4KN7X 3MN2A 2V7FA 5EG0A 2EA4A 2UUZA 3GTKJ 1SVOA 3G4SI 4GGGA 4CCKA 1UHSA 2YX7A 2PFBA 1N78A 4E70A 3AG3H 1HKQA 3Q0WA 2WAFA 4UVCA 4RAZA 3LOCA 3SZTA 2WB1N 5DCFA 3GYHX 1JUSA 3L00A 4HZFA 3VB2A 2DMUA 5B5EC 4X6AJ 3P7NA 3UR3C 1RI7A 1N77A 4I2OA 2KIUA 2D5VA 4A6DA 2MC4A 2DCEA 5HVQC 2IS1A 3WTSC 2R5ZB 3OYLA 2WAQN 2JVHA 3MZ8A 3L7WA 4BNCA 3I4PA 1FYLA 1BOBA 3F72A 1R4NB 4XKVA 4CZZA 4IL6C 3PFYA 3DPTA 3OYKA 3OS0A 3AG1H 5IPAA 5LHIA 5KNLA 1T8IA 1FTTA 4A0YA 1Z9CA 1LPQA 3C2HA 4NUBA 1QHGA 2W25A 3ZMUA 3P9KA 4E7IA 3DLLF 5EJCA 2AXTC 1T95A 2YR2A 2Q8KA 3ZQFA 2EQRA 2L2OA 2DTRA 3HSRA 3ECOA 3IKTA 4J01A 2HOSA 3HRMA 1F5TA 3OIPA 1IN7A 5F04A 4QWQA 1HF0A 2UXNA 4OIRF 4B44A 4OIOF 2VBYA 3W2VA 3GLLA 2MH2A 4W97A 1B59A 3QPTA 2XGDA 3DPLC 3CUOA 5DUIA 3WHBA 2R3SA 2IRFG 1POGA 5HDKA 3FX3A 3H5NA 3WHCA 3KYLA 3CCSI 2DDBA 5M3MJ 5M5YJ 2E2IJ 3SXYA 1OISA 2RKHA 4LG3A 4DGWB 2UZKA 2QYOA 3CO7C 2O0YA 2DLLA 2G9WA 4X1EA 1MMSA 3W6KB 3AFHA 4F55A 4XIDA 5EGOA 2LKPA 4OIPF 2JRTA 2E35A 2B63J 3GCMA 4I98B 1OCPA 3V8JA 2ZKZA 3RKYA 2C6YA 2VT3A 1MBHA 1Z67A 3RKXA 2KDZA 3BZCA 1G3WA 3HKZA 1U6GA 4JOMA 1FP2A 1FMWA 4HDVA 2B9SA 1FSEA 1FOKA 2Q2EA 1I3AA 4WK8F 2FXAA 1JXSA 5B3SH 1YTYA 1L3LA 1FZPB 1WJFA 2IGMA 2EIMH 2LDUA 4XR6A 5E3MA 4KIGA 1I50J 1V55H 2QSHX 1RR7A 1YQAA 2M2EA 4LMYA 3O2PE 4CYCB 1S7OA 1XD7A 4E4HA 1BI3A 1YW7A 2OC6A 1RPWA 2TDXA 1QU3A 3IC7A 2ZJRF 1MNEA 2V6EA 5HNHA 2YU9J 5LHHA 5FFZA 2L7FP 2E34A 1T38A 2ZXJA 4U0YA 3MD2A 1JT6A 3M7GA 4DYRA 5EF6A 2E1MC 1W36D 1P92A 3IKVA 1HKTA 2EZLA 4RS8A 1MKMA 3BJ6A 4PZJA 2Y9YA 1JI8A 4AWXB 1BJAA 2VBZA 2DI3A 2STTA 2Y31A 3BP8A 2BV6A 2E2JJ 2HDDA 2OBPA 1D0ZA 3QOPA 3ASOH 5F0HA 3K4BA 3LWFA 3F22A 3HDDA 3O8GA 1U9OA 4O3MA 3CLQA 4KIBA 3BG6A 4DZJA 5IT9K 5BMZA 5D5VB 2ME0A 4LLNA 2Z1DA 3VODA 3OIQA 2HYGD 2EWNA 4MEYF 3GEZA 5FFXA 2FRHA 3KEOA 5L3FA 1LFBA 3K1PA 1E3OC 4PUSA 4IXAA 3WGIA 4CA0A 3ZPLA 4BJ5C 1YS6A 2VJIA 4ZYHA 3PQJA 1KU2A 3I71A 1U0JA 4LLGF 4M74A 2WA0A 4XOPA 2A61A 3QPLA 1K61A 1WJEA 3D0SA 2XAUA 4LGWA 1VQLI 1OYYA 1FMVA 3OYHA 2HKOA 3K4NA 1IUYA 3HRTA 2JJ7A 5FD5A 1MZBA 2LVSA 2Q0OA 1X3UA 3W6VA 3CMMA 4I0BA 3V8LA 4B43A 3L2UA 3K9TA 3GTLJ 5CQEA 1TWHJ 3HPGA 3GTMJ 3NAUA 5ICEA 4QPOA 1XB4A 4HW0A 3CD6I 3V8KA 1W4MA 3HSEA 1ZAOA 2X51A 3O8HA 4M3FA 2X1CA 4MIMA 3IHUA 4FQGA 2L9RA 4MQ9F 2MLKA 5H6QA 3N4MA 3E6DA 2V1DA 1XGMA 2L7KA 4GXOA 4XN3A 3F6VA 5HS7A 1ZLJA 3FDYA 2DK5A 3QOEA 4LB6B 3WTXC 3CO6C 3RZDJ 2E1CA 2PJRA 4IRHA 4ENNA 1HQCA 2E36A 1JKPC 5L3EA 2R7FA 1WPKA 1YX5A 3S1NJ 1IRFA 3F8CA 1JUMA 4XNFA 4EV0A 1XDSA 1XGOA 2FQ4A 3D5RC 5EEGA 3W2WA 2M1BA 4RDUA 2G7HA 2XPWA 4HX4A 2R5ZA 5LHGA 2PX9A 1AKHA 1YJNI 1ONVA 3FWEA 2XAJA 2MD0A 4AIHA 1HLVA 3ZMZA 3QYEA 1O3QA 5DM6F 3BZKA 3RDIA 4L0ZB 4XLFA 3GTJJ 1DDNA 2NYXA 4BQNA 2CWEA 4IHWA 2M30A 2VODA 1Z05A 1RESA 2W4SA 3CF2A 3HOSA 1V5GA 2JUCA 2W7NA 1JE8A 3LMMA 2HOTA 1W5CC 2DU9A 3SZPA 1R7JA 2CG4A 4O5VA 4MO7A 4PSXA 3VYSB 1OMIA 1Y56A 2L4AA 2PMZN 2HEOA 3BJOA 2VKDA 2JT1A 4KNYA 1Y8RB 1N75A 3FXLA 4ZYAA 2PI0A 1IZ1A 3NQOA 2X9DA 3HUGA 1APLC 2HTSA 2XPUA 3QYFA 3J80K 2ZC2A 3ABKH 2K7LA 3WU0A 2DMNA 4L9JA 4RGSA 2O61A 3D1NI 2DYSH 2B7EA 2NNNA 3M9AA 3RQIA 3GZ6A 1RETA 2X1DA 4YEJA 5LGTA 1BBYA 4MTDA 4M9ZA 1WCMJ 3FKJA 4BDYA 1X2NA 2HPMA 3OR1C 2KLOA 5HDNA 2F5EA 3E6BA 3DLAA 3LSGA 3HYIA 2RAEA 2ZMEB 4A3CJ 1ENHA 3FK6A 1LDDA 1PJRA 4NC7A 1U5TB 5EZGA 1E2XA 4B8XA 1KQ0A 2MLGA 2PQ8A 3F8BA 3FIWA 3H0GJ 3LSJA 4KJZA 5D4SA 1AHDP 1X58A 4M3EA 1P9QC 1OCRH 2M4GA 5F1JA 2XAFA 3ZXSA 4IHTA 2ZXWH 2EIJH 5CJ9A 4OMZA 1GXQA 1T0FA 1MBKA 1Q1VA 5DTDA 1HC8A 2A5YB 1SFOJ 1GLNA 1VQPI 1IO2A 2EILH 1S8NA 3B73A 1BW6A 3U21A 2IA1A 2OQRA 4MEXF 5BS6A
chains in the Genus database with same CATH topology
2GA1A 3GUDA 3I58A 4CXFA 1ON2A 1WWXA 2RV8A 3SQNA 2JPBA 5D8LB 2QQ9A 4I7HA 2CFXA 3L2CA 1ZREA 3KCCA 1ZG3A 1RUOA 2IA2A 2OAZA 2QBYA 2L3DA 1HXDA 1P4XA 1Z7UA 5BPDA 4EGYA 1FP1D 2P6TA 3ECHA 3M8FA 3BDDA 4M71A 1ZRDA 3NRVA 2W85A 2Y0MA 4XRFA 3F6OA 1XCBA 2K86A 2G7UA 1B9MA 5A2QK 4PCQA 2LSOA 2VC0A 1R22A 4OIQF 2FOKA 2HWVA 3H3UA 4JBAA 2IPQX 3D5LA 4EMSA 5JR3A 1RNLA 1HSJA 1TBXA 4FX0A 1P4AA 1LJ9A 5KK1A 3QP5A 2QQAA 2QM3A 1REPC 3ELKA 2R7DA 5LBQA 1QNTA 3HHHA 4TV7A 1DUXC 3J81Z 2P4WA 1XMKA 1XGNA 1KYWA 2HR3A 2DPDA 5D4RA 1K7AA 5LRRA 2XAGA 3M8EA 5HLGA 3IWZA 2QQBA 3WE3A 5FB2A 4ZH4F 3FXQA 1FBSA 4KFCA 2OZUA 1Z1DA 4IVNA 3PFIA 2P7VB 1SD6A 3EYIA 5DCMA 3M1EA 2YSRA 5EEHA 2VC1A 2YPRA 4G9YA 1G3SA 4CGZA 2A3SA 3PQKA 3E5XA 4LG0A 2DQRA 2ACJA 1LDJA 4I0AA 1H0MA 1W5TA 1YW8A 3EDPA 1QQIA 1BI0A 2ESHA 3E3VA 1B9NA 4L18B 3QPHA 1UB9A 3I59A 1FNNA 2IVMA 2E7WA 4GYGA 4UUVA 4MNUA 4GYIA 4BYYA 4L0YB 5H6RA 1IXCA 1WRJA 2GZWA 4G94A 4ESFA 1E17A 3ZMSA 2PMUA 4CDGA 1EV7A 5E20A 3FF5A 5BPIA 3U1DA 4ZZLA 1LNWA 4N0BA 2HFHA 4L5IA 4LD5A 1IRGA 4M73A 4S04A 3GFJA 2Y75A 1F1ZA 1V3FA 4U7BA 2GXBA 1CGPA 4HV5A 4G7HF 4BHBA 2LNBA 3IL2A 1LEAA 4B09A 4Y15A 4NB5A 1HSTA 1R1TA 5FD6A 3E5QA 1FY7A 1KQ9A 4PDKA 4L9NA 4EGZA 5LEJA 3HSFA 2K4BA 3KLNA 4A0XA 5JFRA 1KYZA 5HLHA 2XKOA 2QVOA 3LA2A 2XKPA 2ISYA 4MHGA 3JSPA 1USTA 4WX9A 2FA5A 2UWMA 2Z3YA 3EETA 3FHZA 1K78B 3KP6A 3LAJA 4OU0A 3F23A 2HYFA 1OYWA 3MQ0A 4EM0B 3LQRA 2QENA 3MWMA 4D0PA 4FX4A 5F6FA 2CYYA 2FQ3A 1SFUA 2YU3A 1W7PD 1BIBA 2E7XA 1KGSA 3GW2A 3GFIA 3BROA 5CVIA 4Q5SF 3V4GA 3TOAA 2GXGA 1JGSA 1P6RA 1IN6A 3MAJA 2UXXA 3QRFF 3E6CC 3T5XA 1SD7A 3N97A 3WTYC 1WI9A 2CO5A 2OQGA 1ZHFA 3F21A 1J75A 2FE3A 2EFPA 3E6MA 1QZYA 3GX4X 4N9HA 2NRAC 2O6GE 4YIFA 2F5FA 3LA7A 4CO8A 2MBFA 3WTTC 2BBYA 1LEBA 5J8FA 3ERED 3OV8A 4ASNA 4DQ2A 4IRIA 1O7FA 3L09A 1CF7A 3GLXA 4RGUA 4P9FA 3HHGA 4Y17A 1O3RA 3CUQB 2Z5UA 1AWCA 2O03A 3MZHA 3IWFA 1R00A 1LQ1A 1HKSA 4RB2C 2DAOA 2DT5A 4HLYA 1YG2A 5KVRA 2P5VA 3C18A 2GAUA 3WTWC 1HW5A 3GVAA 1UFMA 1V4RA 3KZZA 5L3CA 3LA3A 5L3DA 1Z91A 3R61A 2EFOA 1KU9A 1G6NA 5DV5A 2MD5A 2HOEA 4I02A 4ZZDA 1MD0A 3HRSA 1R1VA 3FXUA 3FM3A 1BC7C 4OINF 5F1RA 1D8JA 3K0LA 1TW2A 1MJBA 1FBUA 5LGUA 1MJ9A 3ZN0A 1ZG1A 2A6HF 2JTVA 2CGPA 1FSHA 1W7PB 4M9SA 2H6CA 3G73A 2D1HA 3BOQA 2XROA 2HKXA 3U2RA 1QO0D 1D5VA 1B1BA 4R8HA 3DP7A 3KP2A 2QZ8A 2EA2A 1MGTA 5LRSA 3B02A 5HOOA 2L01A 3HOTA 1ZARA 2V1UA 3V7CA 2WC2A 4ESJA 3FMQA 4U0WA 2RC4A 1T39A 5DYMA 1J2XA 2HZTA 1D8KA 2O3FA 3ISPA 1U3EM 4HLXA 3I54A 2FNPA 3TDUC 3DEUA 3RPQA 2VOPA 1R58A 2IJLA 1ZH5A 1FYKA 3RJPA 4XLNF 1QZZA 2MH9A 2XIGA 5K5OA 2VE8A 2ZFWA 3J80Z 3LAPA 2A68F 2VN2A 1TTYA 3I5UA 4ENJA 1MDMB 3GFMA 3ZMVA 3REOA 5J8CA 2QUFA 3AAFA 4L9VA 3R0JA 5ILSA 5ICCA 4HF0A 4Y13A 3T1BA 2D45A 1IW7F 4UV8A 3NEUA 3KP5A 2DQLA 3ZN1A 2P8TA 1BI2A 1BIAA 2FBKA 1IN8A 4HDUA 3L9FA 3BPXA 3ZQ7A 1O57A 2H09A 4RGXA 1UHMA 1WQ2A 1I5ZA 4BH9A 4BXUA 1XSVA 4YFXF 2KKOA 3LFKA 1DP7P 2F5CA 4RAYA 2M45A 1J5YA 2NS0A 5CVJA 4DNCA 2DFIA 3FMRA 2P5LC 2GA2A 2GQQA 3VFZA 1U5TC 1DPUA 1JHHA 1ZLKA 4R1HA 2WWYA 4LB5A 2HS5A 4NHJA 4M72A 3DXJF 5D6FA 4ZYDA 2O8XA 2HQNA 4FHTA 2M87A 2V6CA 3T8TA 1LB2A 2V9VA 3F3XA 1VTNC 4AIJA 3WODF 2J5OA 4CYDA 4LK1F 3KP4A 1BC8C 3Q9SA 4A0ZA 3VEPA 3MFKA 5J6XA 2RN7A 2XASA 4HA8A 5E1WA 4EQQA 1W7PA 2HDCA 3GWZA 3EQLF 5ICFA 3KETA 1FX7A 2B0LA 3RTRA 4WCGA 1IF1A 1KQ8A 2ISZA 2RNJA 2XV4S 3K2ZA 1D3YA 1PDNC 1ZRCA 4RGRA 2Z99A 5ILVA 3CDHA 4HX7A 2EV0A 1TLHB 4BHCA 2A6EF 4G7OF 3V7SA 3DV8A 2DK8A 2V79A 3CLOA 2FEZA 3Q9VA 4G8XA 2FMLA 2KIMA 5D5WB 3ZMTA 3TO7A 2W57A 2EK5A 2M5WA 3TO6A 1NHAA 4MTEA 3ZMDA 3KEQA 5TRDA 1FC3A 2STWA 3R6SA 2BEOA 1RZ4A 4YFNF 3S2WA 2VBXA 5CVVA 3GO5A 3MCZA 6PAXA 3FMSA 4EM1A 1TW3A 1ZGAA 4HBLA 4JQFA 5E1ZB 1I1SA 4WF2A 2PMHA 4P55A 3ABTA 1FPQA 2MA3A 2L54A 3P9CA 1RUNA 2DBBA 2MC3A 4YFKF 3RYRA 3GF2A 3WU1B 1Z6RA 3K69A 1L0OC 1S3JA 2ZMEA 5HDGA 1EH6A 1U5TA 4LFUA 2KJCA 1IAWA 5ILUA 4HYEA 2FBHA 4HQEA 3LSTA 2ESNA 1I6XA 5BQTA 5FLXK 1DPRA 1S29A 2EJRA 3E97A 3JAMK 1J59A 2HQRA 5K1YA 3DQVC 1K79A 4FT8A 3HIFA 1UCRA 1XMAA 1QBJA 5CYVA 3LQQA 4IHSA 5JVTA 2NNYA 1FLIA 4A5NA 4HF2A 3OOPA 3I0TA 4LK0F 3WG9A 3GXOA 3C7JA 5AIQA 3WTVC 3KLOA 4LJZF 2X4HA 3MEXA 5DD4A 2P7CB 2GIVA 1F9NA 3F8FA 5L3GA 5K5RA 2F5DA 3COAC 1XDUA 4Q4ZF 2VXZA 1EH7A 1P2FA 1G3YA 3GZ5A 4A6EA 3WE2A 1ODDA 1FWZA 2BE5F 5BOXA 5DEQA 1UHWA 4LLLA 1R5GA 2QWWA 1P4WA 1PP8F 1HW1A 2EV5A 4U0VA 5E17F 2DW4A 2DPUA 2XUBA 5CVUA 3QP6A 2PG4A 2EFNA 5HS9A 1B6AA 5LGNA 3H92A 4U7DA 4RB0A 5FGMA 2ZJ2A 3WGHA 1SAXA 3KP3A 1J9IA 3QAHA 1EH8A 4XSXF 3TDZC 5AONA 3BWGA 1R5HA 5E18F 3IRQA 4ENMA 4IF4A 3BJAA 1YYVA 1XCVA 5D5XB 1XGSA 2K02A 4ON0A 3T8RA 4EJVA 2XVCA 4ENKA 1LVAA 2JZYA 4XLPF 3F8MA 1YS7A 1IN5A 5DUKA 2IP2A 3Q5FA 4EJUA 1F4KA 1GXPA 3TGNA 1ZGJA 3E5UA 2OA4A 4S05A 2KRFA 1SFXA 4HAMA 5D5UB 4Q48A 4BAYA 2JPCA 4KN4X 3K1MA 2XRNA 3RPUA 5IT9Z 5ICGA 1BM9A 1S7AA 2XAHA 1I27A 2VONA 1R23A 4RB1A 4KYWA 3G3ZA 3RI4A 3FZVA 3CUQC 3C3WA 2RQPA 5HLIA 3SHFA 3HTUA 4K2EA 1IXSB 1R1UA 2RGVA 3BY6A 4N9IA 2H27A 4A12A 3T0YA 3ROUA 2ELHA 3DFGA 3JSOA 1BN5A 4YIIA 2QBYB 2KJBA 1TQMA 1FYMA 3KP7A 2ETHA 1ULYA 1ON1A 5DDGA 4KA4A 4M9XA 1H9TA 2P5KA 4AIKA 5AIPA 1T2KA 4A2UA 2P6SA 2OZ6A 1ZN2A 3QU3A 2FU4A 4OOIA 4F7ZA 1YIOA 4AVPA 4P9UA 1I1GA 4ZYEA 3ZP5A 1K78A 3JTHA 4HV6A 3GFLA 4OMYA 1KA8A 3EUHA 4AD9A 4O6JA 4GO1A 4G6DA 4G6QA 1G4DA 3F8NA 5E8GA 3RYPA 2EFQA 3TO9A 2Z33A 2RDPA 1W5SA 2OD5A 2E1NA 2GWRA 5L3BA 2DO7A 1GVJA 3WTUC 5DCMB 4A5MA 3O6BB 5CLSA 4CHUA 4QLCU 4EJOA 1IN4A 2D1VA 2IA0A 4KDPA 1MJAA 1Z6TA 5ERIA 2FSWA 1QGPA 3KE2A 1STZA 1YO5C 4WXHA 4ESBA 4LG0B 1B4AA 2ZNYA 3FXRA 1H9GA 2PBIA 2LF8A 3BPVA 4MQVA 2YX4A 1SD5A 2K27A 4IRGA 2PLYA 4WXDA 2L4MA 2LF7A 3HRUA 3I59B 2Y48A 1TNTA 3CUQA 2COMA 1A04A 2HTJA 4UVAA 2VE9A 1O3SA 4RB3C 2KIFA 4EJWA 2EFWA 1PUEE 5ED4A 2F2EA 3SFZA 3IRRA 1R36A 1WKMA 3C1DA 2A69F 2XGXA 1Q1HA 3ABUA 1K6OA 3QU6A 1TQIA 4WXCA 3WTZA 1O7LA 3CJNA 2ZBKA 2V1XA 1S6LA 3JW4A 3O3KA 3U9GA 1OR7A 1KU7A 5E8IA 4UXNA 1XSXA 4HX8A 2VBWA 2W84A 5DD8A 3R4KA 4WWCA 5TJJA 2QLZA 2D2WA 2J5PA 3FM5A 5A2QZ 4L9TA 1SFEA 2PN6A 4JK1X 3KZYA 1O3TA 4UV9A 4R79A 4ZYGA 1C0WA 5FO5A 5JI6A 4GCVA 5LEKA 1XSDA 1YLFA 2AXLA 2EB7A 1G3TA 1SD4A 1ZRFA 4KICA 1BOAA 2K4JA 2BGCA 4EVIA 2FBIA 1U2WA 2WV0A 5H20A 1TQPA 3JTGA 2FNAA 2H6BA 4Q47A 1PP7U 1WSUA 4KUMA 2NAZA 3I53A 3V7RA 4IJAA 3VOEA 4L5JA 1OPCA 2IT0A 5D6EA 4BQAA 3DF8A 1QPMA 1RIOH 4XSZF 4KMFA 1YFHA 2CQKA 2CSOA 1GHCA 3P9IA 5K5QA 3I64A 2PJPA 1USSA 5JHUA 3J81K 1LDKB 4EM2A 4KMUX 1HBXG 4Z2YA 3K1NA 3WGGA 2AS5F 4PGHA 1OYIA 4P5OA 3HTSB 4PGGA 3H3ZA 4M6YA 5LLQA 3J7AO 5CVRA 1MDMA 3TKYA 2RVCA 2HGCA 2Z9OA 4IPAA 1T6SA 1ZYRF 1AOYA 2W24A 4UNOA 4XBFA 1HW2A 1J7KA 4P96A 2X0LA 4H0EA 1KU3A 1FBQA 2L02A 5FLXZ 3JAMZ 3EYYA 1CF7B 4BHPA 2IW5A 1SMTA 3ULQB 2H94A 4I09A 1TNSA 2FMYA 4ETSA 2CW0F 1JHFA 3W6JB 2BYVE 1Y0UA 3KFWX 5IT3A 2FF4A 2WTEA 2VT2A 5HS8A 1T98A 1XN7A 3CTAA 3TQNA 4UVBA 3DKWA 4EJTA 4UHTA 2M8EA 4HQMA 3ML6A 3TOBA 4CICA 4I01A 2ZCWA 3BZ6A 1J0RA 4HF1A 2EV6A 4HOBA 4KIFA 2OU2A 3R0AA 3R60A 3RKWA 4M6XA 4YG2F 3RIRA 5E1XA 5D8KB 2A07F 2ADUA 2JSCA 4G7ZF 1ZG5A 2ZO4A 5F64A 2XHKA 3MZYA 1FT9A 2PEXA 4NQWA 4U88A 2ZNZA 1YW9A 1BI1A 4MGRA 1U78A 2VOOA 1IXRC 1OKRA 1U8RA 2XAQA 4KT5C 1SMYF 4KN7X 2EA4A 4GGGA 2YX7A 2PFBA 4E70A 1HKQA 4UVCA 4RAZA 3SZTA 5DCFA 3GYHX 3L00A 4HZFA 3VB2A 3P7NA 1RI7A 4I2OA 2KIUA 4A6DA 5HVQC 3WTSC 3L7WA 4BNCA 3I4PA 1FYLA 3F72A 4CZZA 3DPTA 5LHIA 4A0YA 1Z9CA 3ZMUA 2W25A 3P9KA 2YR2A 2Q8KA 2DTRA 3HSRA 3ECOA 3IKTA 3HRMA 1F5TA 1IN7A 4QWQA 2UXNA 4OIRF 4OIOF 2VBYA 2MH2A 1B59A 3QPTA 3DPLC 3CUOA 5DUIA 2R3SA 2IRFG 5HDKA 3FX3A 3SXYA 2RKHA 2UZKA 2QYOA 3CO7C 2O0YA 2DLLA 2G9WA 3W6KB 2LKPA 4OIPF 2JRTA 4I98B 3V8JA 2ZKZA 3RKYA 2C6YA 2VT3A 3RKXA 1G3WA 1U6GA 4HDVA 1FP2A 1FSEA 1FOKA 2Q2EA 4WK8F 2FXAA 1JXSA 1YTYA 1L3LA 1FZPB 2LDUA 4KIGA 1YQAA 4LMYA 3O2PE 1S7OA 1XD7A 1BI3A 1YW7A 2TDXA 3IC7A 5LHHA 5FFZA 1T38A 2ZXJA 4U0YA 3M7GA 1HKTA 1P92A 3IKVA 4RS8A 1MKMA 3BJ6A 4PZJA 4AWXB 1BJAA 2VBZA 2DI3A 2STTA 3BP8A 2BV6A 2OBPA 3QOPA 3LWFA 3F22A 4O3MA 4KIBA 5IT9K 5BMZA 5D5VB 4LLNA 3VODA 2HYGD 2EWNA 4MEYF 3GEZA 5FFXA 2FRHA 3KEOA 5L3FA 3K1PA 4IXAA 3WGIA 3ZPLA 1YS6A 4ZYHA 3PQJA 1KU2A 3I71A 4LLGF 4M74A 2A61A 3D0SA 4LGWA 1OYYA 2HKOA 1IUYA 3HRTA 5FD5A 1MZBA 2Q0OA 1X3UA 4I0BA 3V8LA 3K9TA 5ICEA 1XB4A 4HW0A 3V8KA 1W4MA 3HSEA 1ZAOA 3IHUA 5H6QA 4MQ9F 2MLKA 3N4MA 3E6DA 2V1DA 1XGMA 4GXOA 3F6VA 5HS7A 1ZLJA 2DK5A 4LB6B 3WTXC 3CO6C 2E1CA 4IRHA 4ENNA 1HQCA 5L3EA 2R7FA 1IRFA 3F8CA 4EV0A 1XDSA 1XGOA 5EEGA 2M1BA 2G7HA 4HX4A 5LHGA 1ONVA 3FWEA 2XAJA 4AIHA 3ZMZA 1O3QA 3RDIA 4L0ZB 1DDNA 2NYXA 2CWEA 2M30A 2VODA 1Z05A 3HOSA 1JE8A 2DU9A 3SZPA 1R7JA 2CG4A 4O5VA 1OMIA 2L4AA 2HEOA 3BJOA 2JT1A 4KNYA 2PI0A 1IZ1A 3NQOA 3HUGA 2HTSA 3J80K 2K7LA 3WU0A 4L9JA 4RGSA 2O61A 2NNNA 3M9AA 3GZ6A 4MTDA 5LGTA 1BBYA 4M9ZA 5HDNA 2F5EA 3E6BA 3HYIA 2ZMEB 1LDDA 1U5TB 1E2XA 4B8XA 1KQ0A 2MLGA 2PQ8A 3F8BA 5D4SA 2XAFA 4IHTA 5CJ9A 4OMZA 1GXQA 1T0FA 2A5YB 1S8NA 3B73A 2IA1A 2OQRA 4MEXF 5BS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA1 A;  3GUD A;  3I58 A;  4CXF A;  1ON2 A;  1WWX A;  2RV8 A;  3SQN A;  2JPB A;  5D8L B;  2QQ9 A;  4I7H A;  2CFX A;  3L2C A;  1ZRE A;  3KCC A;  1ZG3 A;  1RUO A;  2IA2 A;  2OAZ A;  2QBY A;  2L3D A;  1HXD A;  1P4X A;  1Z7U A;  5BPD A;  4EGY A;  1FP1 D;  2P6T A;  3ECH A;  3M8F A;  3BDD A;  4M71 A;  1ZRD A;  3NRV A;  2W85 A;  2Y0M A;  4XRF A;  3F6O A;  1XCB A;  2K86 A;  2G7U A;  1B9M A;  5A2Q K;  4PCQ A;  2LSO A;  2VC0 A;  1R22 A;  4OIQ F;  2FOK A;  2HWV A;  3H3U A;  4JBA A;  2IPQ X;  3D5L A;  4EMS A;  5JR3 A;  1RNL A;  1HSJ A;  1TBX A;  4FX0 A;  1P4A A;  1LJ9 A;  5KK1 A;  3QP5 A;  2QQA A;  2QM3 A;  1REP C;  3ELK A;  2R7D A;  5LBQ A;  1QNT A;  3HHH A;  4TV7 A;  1DUX C;  3J81 Z;  2P4W A;  1XMK A;  1XGN A;  1KYW A;  2HR3 A;  2DPD A;  5D4R A;  1K7A A;  5LRR A;  2XAG A;  3M8E A;  5HLG A;  3IWZ A;  2QQB A;  3WE3 A;  5FB2 A;  4ZH4 F;  3FXQ A;  1FBS A;  4KFC A;  2OZU A;  1Z1D A;  4IVN A;  3PFI A;  2P7V B;  1SD6 A;  3EYI A;  5DCM A;  3M1E A;  2YSR A;  5EEH A;  2VC1 A;  2YPR A;  4G9Y A;  1G3S A;  4CGZ A;  2A3S A;  3PQK A;  3E5X A;  4LG0 A;  2DQR A;  2ACJ A;  1LDJ A;  4I0A A;  1H0M A;  1W5T A;  1YW8 A;  3EDP A;  1QQI A;  1BI0 A;  2ESH A;  3E3V A;  1B9N A;  4L18 B;  3QPH A;  1UB9 A;  3I59 A;  1FNN A;  2IVM A;  2E7W A;  4GYG A;  4UUV A;  4MNU A;  4GYI A;  4BYY A;  4L0Y B;  5H6R A;  1IXC A;  1WRJ A;  2GZW A;  4G94 A;  4ESF A;  1E17 A;  3ZMS A;  2PMU A;  4CDG A;  1EV7 A;  5E20 A;  3FF5 A;  5BPI A;  3U1D A;  4ZZL A;  1LNW A;  4N0B A;  2HFH A;  4L5I A;  4LD5 A;  1IRG A;  4M73 A;  4S04 A;  3GFJ A;  2Y75 A;  1F1Z A;  1V3F A;  4U7B A;  2GXB A;  1CGP A;  4HV5 A;  4G7H F;  4BHB A;  2LNB A;  3IL2 A;  1LEA A;  4B09 A;  4Y15 A;  4NB5 A;  1HST A;  1R1T A;  5FD6 A;  3E5Q A;  1FY7 A;  1KQ9 A;  4PDK A;  4L9N A;  4EGZ A;  5LEJ A;  3HSF A;  2K4B A;  3KLN A;  4A0X A;  5JFR A;  1KYZ A;  5HLH A;  2XKO A;  2QVO A;  3LA2 A;  2XKP A;  2ISY A;  4MHG A;  3JSP A;  1UST A;  4WX9 A;  2FA5 A;  2UWM A;  2Z3Y A;  3EET A;  3FHZ A;  1K78 B;  3KP6 A;  3LAJ A;  4OU0 A;  3F23 A;  2HYF A;  1OYW A;  3MQ0 A;  4EM0 B;  3LQR A;  2QEN A;  3MWM A;  4D0P A;  4FX4 A;  5F6F A;  2CYY A;  2FQ3 A;  1SFU A;  2YU3 A;  1W7P D;  1BIB A;  2E7X A;  1KGS A;  3GW2 A;  3GFI A;  3BRO A;  5CVI A;  4Q5S F;  3V4G A;  3TOA A;  2GXG A;  1JGS A;  1P6R A;  1IN6 A;  3MAJ A;  2UXX A;  3QRF F;  3E6C C;  3T5X A;  1SD7 A;  3N97 A;  3WTY C;  1WI9 A;  2CO5 A;  2OQG A;  1ZHF A;  3F21 A;  1J75 A;  2FE3 A;  2EFP A;  3E6M A;  1QZY A;  3GX4 X;  4N9H A;  2NRA C;  2O6G E;  4YIF A;  2F5F A;  3LA7 A;  4CO8 A;  2MBF A;  3WTT C;  2BBY A;  1LEB A;  5J8F A;  3ERE D;  3OV8 A;  4ASN A;  4DQ2 A;  4IRI A;  1O7F A;  3L09 A;  1CF7 A;  3GLX A;  4RGU A;  4P9F A;  3HHG A;  4Y17 A;  1O3R A;  3CUQ B;  2Z5U A;  1AWC A;  2O03 A;  3MZH A;  3IWF A;  1R00 A;  1LQ1 A;  1HKS A;  4RB2 C;  2DAO A;  2DT5 A;  4HLY A;  1YG2 A;  5KVR A;  2P5V A;  3C18 A;  2GAU A;  3WTW C;  1HW5 A;  3GVA A;  1UFM A;  1V4R A;  3KZZ A;  5L3C A;  3LA3 A;  5L3D A;  1Z91 A;  3R61 A;  2EFO A;  1KU9 A;  1G6N A;  5DV5 A;  2MD5 A;  2HOE A;  4I02 A;  4ZZD A;  1MD0 A;  3HRS A;  1R1V A;  3FXU A;  3FM3 A;  1BC7 C;  4OIN F;  5F1R A;  1D8J A;  3K0L A;  1TW2 A;  1MJB A;  1FBU A;  5LGU A;  1MJ9 A;  3ZN0 A;  1ZG1 A;  2A6H F;  2JTV A;  2CGP A;  1FSH A;  1W7P B;  4M9S A;  2H6C A;  3G73 A;  2D1H A;  3BOQ A;  2XRO A;  2HKX A;  3U2R A;  1QO0 D;  1D5V A;  1B1B A;  4R8H A;  3DP7 A;  3KP2 A;  2QZ8 A;  2EA2 A;  1MGT A;  5LRS A;  3B02 A;  5HOO A;  2L01 A;  3HOT A;  1ZAR A;  2V1U A;  3V7C A;  2WC2 A;  4ESJ A;  3FMQ A;  4U0W A;  2RC4 A;  1T39 A;  5DYM A;  1J2X A;  2HZT A;  1D8K A;  2O3F A;  3ISP A;  1U3E M;  4HLX A;  3I54 A;  2FNP A;  3TDU C;  3DEU A;  3RPQ A;  2VOP A;  1R58 A;  2IJL A;  1ZH5 A;  1FYK A;  3RJP A;  4XLN F;  1QZZ A;  2MH9 A;  2XIG A;  5K5O A;  2VE8 A;  2ZFW A;  3J80 Z;  3LAP A;  2A68 F;  2VN2 A;  1TTY A;  3I5U A;  4ENJ A;  1MDM B;  3GFM A;  3ZMV A;  3REO A;  5J8C A;  2QUF A;  3AAF A;  4L9V A;  3R0J A;  5ILS A;  5ICC A;  4HF0 A;  4Y13 A;  3T1B A;  2D45 A;  1IW7 F;  4UV8 A;  3NEU A;  3KP5 A;  2DQL A;  3ZN1 A;  2P8T A;  1BI2 A;  1BIA A;  2FBK A;  1IN8 A;  4HDU A;  3L9F A;  3BPX A;  3ZQ7 A;  1O57 A;  2H09 A;  4RGX A;  1UHM A;  1WQ2 A;  1I5Z A;  4BH9 A;  4BXU A;  1XSV A;  4YFX F;  2KKO A;  3LFK A;  1DP7 P;  2F5C A;  4RAY A;  2M45 A;  1J5Y A;  2NS0 A;  5CVJ A;  4DNC A;  2DFI A;  3FMR A;  2P5L C;  2GA2 A;  2GQQ A;  3VFZ A;  1U5T C;  1DPU A;  1JHH A;  1ZLK A;  4R1H A;  2WWY A;  4LB5 A;  2HS5 A;  4NHJ A;  4M72 A;  3DXJ F;  5D6F A;  4ZYD A;  2O8X A;  2HQN A;  4FHT A;  2M87 A;  2V6C A;  3T8T A;  1LB2 A;  2V9V A;  3F3X A;  1VTN C;  4AIJ A;  3WOD F;  2J5O A;  4CYD A;  4LK1 F;  3KP4 A;  1BC8 C;  3Q9S A;  4A0Z A;  3VEP A;  3MFK A;  5J6X A;  2RN7 A;  2XAS A;  4HA8 A;  5E1W A;  4EQQ A;  1W7P A;  2HDC A;  3GWZ A;  3EQL F;  5ICF A;  3KET A;  1FX7 A;  2B0L A;  3RTR A;  4WCG A;  1IF1 A;  1KQ8 A;  2ISZ A;  2RNJ A;  2XV4 S;  3K2Z A;  1D3Y A;  1PDN C;  1ZRC A;  4RGR A;  2Z99 A;  5ILV A;  3CDH A;  4HX7 A;  2EV0 A;  1TLH B;  4BHC A;  2A6E F;  4G7O F;  3V7S A;  3DV8 A;  2DK8 A;  2V79 A;  3CLO A;  2FEZ A;  3Q9V A;  4G8X A;  2FML A;  2KIM A;  5D5W B;  3ZMT A;  3TO7 A;  2W57 A;  2EK5 A;  2M5W A;  3TO6 A;  1NHA A;  4MTE A;  3ZMD A;  3KEQ A;  5TRD A;  1FC3 A;  2STW A;  3R6S A;  2BEO A;  1RZ4 A;  4YFN F;  3S2W A;  2VBX A;  5CVV A;  3GO5 A;  3MCZ A;  6PAX A;  3FMS A;  4EM1 A;  1TW3 A;  1ZGA A;  4HBL A;  4JQF A;  5E1Z B;  1I1S A;  4WF2 A;  2PMH A;  4P55 A;  3ABT A;  1FPQ A;  2MA3 A;  2L54 A;  3P9C A;  1RUN A;  2DBB A;  2MC3 A;  4YFK F;  3RYR A;  3GF2 A;  3WU1 B;  1Z6R A;  3K69 A;  1L0O C;  1S3J A;  2ZME A;  5HDG A;  1EH6 A;  1U5T A;  4LFU A;  2KJC A;  1IAW A;  5ILU A;  4HYE A;  2FBH A;  4HQE A;  3LST A;  2ESN A;  1I6X A;  5BQT A;  5FLX K;  1DPR A;  1S29 A;  2EJR A;  3E97 A;  3JAM K;  1J59 A;  2HQR A;  5K1Y A;  3DQV C;  1K79 A;  4FT8 A;  3HIF A;  1UCR A;  1XMA A;  1QBJ A;  5CYV A;  3LQQ A;  4IHS A;  5JVT A;  2NNY A;  1FLI A;  4A5N A;  4HF2 A;  3OOP A;  3I0T A;  4LK0 F;  3WG9 A;  3GXO A;  3C7J A;  5AIQ A;  3WTV C;  3KLO A;  4LJZ F;  2X4H A;  3MEX A;  5DD4 A;  2P7C B;  2GIV A;  1F9N A;  3F8F A;  5L3G A;  5K5R A;  2F5D A;  3COA C;  1XDU A;  4Q4Z F;  2VXZ A;  1EH7 A;  1P2F A;  1G3Y A;  3GZ5 A;  4A6E A;  3WE2 A;  1ODD A;  1FWZ A;  2BE5 F;  5BOX A;  5DEQ A;  1UHW A;  4LLL A;  1R5G A;  2QWW A;  1P4W A;  1PP8 F;  1HW1 A;  2EV5 A;  4U0V A;  5E17 F;  2DW4 A;  2DPU A;  2XUB A;  5CVU A;  3QP6 A;  2PG4 A;  2EFN A;  5HS9 A;  1B6A A;  5LGN A;  3H92 A;  4U7D A;  4RB0 A;  5FGM A;  2ZJ2 A;  3WGH A;  1SAX A;  3KP3 A;  1J9I A;  3QAH A;  1EH8 A;  4XSX F;  3TDZ C;  5AON A;  3BWG A;  1R5H A;  5E18 F;  3IRQ A;  4ENM A;  4IF4 A;  3BJA A;  1YYV A;  1XCV A;  5D5X B;  1XGS A;  2K02 A;  4ON0 A;  3T8R A;  4EJV A;  2XVC A;  4ENK A;  1LVA A;  2JZY A;  4XLP F;  3F8M A;  1YS7 A;  1IN5 A;  5DUK A;  2IP2 A;  3Q5F A;  4EJU A;  1F4K A;  1GXP A;  3TGN A;  1ZGJ A;  3E5U A;  2OA4 A;  4S05 A;  2KRF A;  1SFX A;  4HAM A;  5D5U B;  4Q48 A;  4BAY A;  2JPC A;  4KN4 X;  3K1M A;  2XRN A;  3RPU A;  5IT9 Z;  5ICG A;  1BM9 A;  1S7A A;  2XAH A;  1I27 A;  2VON A;  1R23 A;  4RB1 A;  4KYW A;  3G3Z A;  3RI4 A;  3FZV A;  3CUQ C;  3C3W A;  2RQP A;  5HLI A;  3SHF A;  3HTU A;  4K2E A;  1IXS B;  1R1U A;  2RGV A;  3BY6 A;  4N9I A;  2H27 A;  4A12 A;  3T0Y A;  3ROU A;  2ELH A;  3DFG A;  3JSO A;  1BN5 A;  4YII A;  2QBY B;  2KJB A;  1TQM A;  1FYM A;  3KP7 A;  2ETH A;  1ULY A;  1ON1 A;  5DDG A;  4KA4 A;  4M9X A;  1H9T A;  2P5K A;  4AIK A;  5AIP A;  1T2K A;  4A2U A;  2P6S A;  2OZ6 A;  1ZN2 A;  3QU3 A;  2FU4 A;  4OOI A;  4F7Z A;  1YIO A;  4AVP A;  4P9U A;  1I1G A;  4ZYE A;  3ZP5 A;  1K78 A;  3JTH A;  4HV6 A;  3GFL A;  4OMY A;  1KA8 A;  3EUH A;  4AD9 A;  4O6J A;  4GO1 A;  4G6D A;  4G6Q A;  1G4D A;  3F8N A;  5E8G A;  3RYP A;  2EFQ A;  3TO9 A;  2Z33 A;  2RDP A;  1W5S A;  2OD5 A;  2E1N A;  2GWR A;  5L3B A;  2DO7 A;  1GVJ A;  3WTU C;  5DCM B;  4A5M A;  3O6B B;  5CLS A;  4CHU A;  4QLC U;  4EJO A;  1IN4 A;  2D1V A;  2IA0 A;  4KDP A;  1MJA A;  1Z6T A;  5ERI A;  2FSW A;  1QGP A;  3KE2 A;  1STZ A;  1YO5 C;  4WXH A;  4ESB A;  4LG0 B;  1B4A A;  2ZNY A;  3FXR A;  1H9G A;  2PBI A;  2LF8 A;  3BPV A;  4MQV A;  2YX4 A;  1SD5 A;  2K27 A;  4IRG A;  2PLY A;  4WXD A;  2L4M A;  2LF7 A;  3HRU A;  3I59 B;  2Y48 A;  1TNT A;  3CUQ A;  2COM A;  1A04 A;  2HTJ A;  4UVA A;  2VE9 A;  1O3S A;  4RB3 C;  2KIF A;  4EJW A;  2EFW A;  1PUE E;  5ED4 A;  2F2E A;  3SFZ A;  3IRR A;  1R36 A;  1WKM A;  3C1D A;  2A69 F;  2XGX A;  1Q1H A;  3ABU A;  1K6O A;  3QU6 A;  1TQI A;  4WXC A;  3WTZ A;  1O7L A;  3CJN A;  2ZBK A;  2V1X A;  1S6L A;  3JW4 A;  3O3K A;  3U9G A;  1OR7 A;  1KU7 A;  5E8I A;  4UXN A;  1XSX A;  4HX8 A;  2VBW A;  2W84 A;  5DD8 A;  3R4K A;  4WWC A;  5TJJ A;  2QLZ A;  2D2W A;  2J5P A;  3FM5 A;  5A2Q Z;  4L9T A;  1SFE A;  2PN6 A;  4JK1 X;  3KZY A;  1O3T A;  4UV9 A;  4R79 A;  4ZYG A;  1C0W A;  5FO5 A;  5JI6 A;  4GCV A;  5LEK A;  1XSD A;  1YLF A;  2AXL A;  2EB7 A;  1G3T A;  1SD4 A;  1ZRF A;  4KIC A;  1BOA A;  2K4J A;  2BGC A;  4EVI A;  2FBI A;  1U2W A;  2WV0 A;  5H20 A;  1TQP A;  3JTG A;  2FNA A;  2H6B A;  4Q47 A;  1PP7 U;  1WSU A;  4KUM A;  2NAZ A;  3I53 A;  3V7R A;  4IJA A;  3VOE A;  4L5J A;  1OPC A;  2IT0 A;  5D6E A;  4BQA A;  3DF8 A;  1QPM A;  1RIO H;  4XSZ F;  4KMF A;  1YFH A;  2CQK A;  2CSO A;  1GHC A;  3P9I A;  5K5Q A;  3I64 A;  2PJP A;  1USS A;  5JHU A;  3J81 K;  1LDK B;  4EM2 A;  4KMU X;  1HBX G;  4Z2Y A;  3K1N A;  3WGG A;  2AS5 F;  4PGH A;  1OYI A;  4P5O A;  3HTS B;  4PGG A;  3H3Z A;  4M6Y A;  5LLQ A;  3J7A O;  5CVR A;  1MDM A;  3TKY A;  2RVC A;  2HGC A;  2Z9O A;  4IPA A;  1T6S A;  1ZYR F;  1AOY A;  2W24 A;  4UNO A;  4XBF A;  1HW2 A;  1J7K A;  4P96 A;  2X0L A;  4H0E A;  1KU3 A;  1FBQ A;  2L02 A;  5FLX Z;  3JAM Z;  3EYY A;  1CF7 B;  4BHP A;  2IW5 A;  1SMT A;  3ULQ B;  2H94 A;  4I09 A;  1TNS A;  2FMY A;  4ETS A;  2CW0 F;  1JHF A;  3W6J B;  2BYV E;  1Y0U A;  3KFW X;  5IT3 A;  2FF4 A;  2WTE A;  2VT2 A;  5HS8 A;  1T98 A;  1XN7 A;  3CTA A;  3TQN A;  4UVB A;  3DKW A;  4EJT A;  4UHT A;  2M8E A;  4HQM A;  3ML6 A;  3TOB A;  4CIC A;  4I01 A;  2ZCW A;  3BZ6 A;  1J0R A;  4HF1 A;  2EV6 A;  4HOB A;  4KIF A;  2OU2 A;  3R0A A;  3R60 A;  3RKW A;  4M6X A;  4YG2 F;  3RIR A;  5E1X A;  5D8K B;  2A07 F;  2ADU A;  2JSC A;  4G7Z F;  1ZG5 A;  2ZO4 A;  5F64 A;  2XHK A;  3MZY A;  1FT9 A;  2PEX A;  4NQW A;  4U88 A;  2ZNZ A;  1YW9 A;  1BI1 A;  4MGR A;  1U78 A;  2VOO A;  1IXR C;  1OKR A;  1U8R A;  2XAQ A;  4KT5 C;  1SMY F;  4KN7 X;  2EA4 A;  4GGG A;  2YX7 A;  2PFB A;  4E70 A;  1HKQ A;  4UVC A;  4RAZ A;  3SZT A;  5DCF A;  3GYH X;  3L00 A;  4HZF A;  3VB2 A;  3P7N A;  1RI7 A;  4I2O A;  2KIU A;  4A6D A;  5HVQ C;  3WTS C;  3L7W A;  4BNC A;  3I4P A;  1FYL A;  3F72 A;  4CZZ A;  3DPT A;  5LHI A;  4A0Y A;  1Z9C A;  3ZMU A;  2W25 A;  3P9K A;  2YR2 A;  2Q8K A;  2DTR A;  3HSR A;  3ECO A;  3IKT A;  3HRM A;  1F5T A;  1IN7 A;  4QWQ A;  2UXN A;  4OIR F;  4OIO F;  2VBY A;  2MH2 A;  1B59 A;  3QPT A;  3DPL C;  3CUO A;  5DUI A;  2R3S A;  2IRF G;  5HDK A;  3FX3 A;  3SXY A;  2RKH A;  2UZK A;  2QYO A;  3CO7 C;  2O0Y A;  2DLL A;  2G9W A;  3W6K B;  2LKP A;  4OIP F;  2JRT A;  4I98 B;  3V8J A;  2ZKZ A;  3RKY A;  2C6Y A;  2VT3 A;  3RKX A;  1G3W A;  1U6G A;  4HDV A;  1FP2 A;  1FSE A;  1FOK A;  2Q2E A;  4WK8 F;  2FXA A;  1JXS A;  1YTY A;  1L3L A;  1FZP B;  2LDU A;  4KIG A;  1YQA A;  4LMY A;  3O2P E;  1S7O A;  1XD7 A;  1BI3 A;  1YW7 A;  2TDX A;  3IC7 A;  5LHH A;  5FFZ A;  1T38 A;  2ZXJ A;  4U0Y A;  3M7G A;  1HKT A;  1P92 A;  3IKV A;  4RS8 A;  1MKM A;  3BJ6 A;  4PZJ A;  4AWX B;  1BJA A;  2VBZ A;  2DI3 A;  2STT A;  3BP8 A;  2BV6 A;  2OBP A;  3QOP A;  3LWF A;  3F22 A;  4O3M A;  4KIB A;  5IT9 K;  5BMZ A;  5D5V B;  4LLN A;  3VOD A;  2HYG D;  2EWN A;  4MEY F;  3GEZ A;  5FFX A;  2FRH A;  3KEO A;  5L3F A;  3K1P A;  4IXA A;  3WGI A;  3ZPL A;  1YS6 A;  4ZYH A;  3PQJ A;  1KU2 A;  3I71 A;  4LLG F;  4M74 A;  2A61 A;  3D0S A;  4LGW A;  1OYY A;  2HKO A;  1IUY A;  3HRT A;  5FD5 A;  1MZB A;  2Q0O A;  1X3U A;  4I0B A;  3V8L A;  3K9T A;  5ICE A;  1XB4 A;  4HW0 A;  3V8K A;  1W4M A;  3HSE A;  1ZAO A;  3IHU A;  5H6Q A;  4MQ9 F;  2MLK A;  3N4M A;  3E6D A;  2V1D A;  1XGM A;  4GXO A;  3F6V A;  5HS7 A;  1ZLJ A;  2DK5 A;  4LB6 B;  3WTX C;  3CO6 C;  2E1C A;  4IRH A;  4ENN A;  1HQC A;  5L3E A;  2R7F A;  1IRF A;  3F8C A;  4EV0 A;  1XDS A;  1XGO A;  5EEG A;  2M1B A;  2G7H A;  4HX4 A;  5LHG A;  1ONV A;  3FWE A;  2XAJ A;  4AIH A;  3ZMZ A;  1O3Q A;  3RDI A;  4L0Z B;  1DDN A;  2NYX A;  2CWE A;  2M30 A;  2VOD A;  1Z05 A;  3HOS A;  1JE8 A;  2DU9 A;  3SZP A;  1R7J A;  2CG4 A;  4O5V A;  1OMI A;  2L4A A;  2HEO A;  3BJO A;  2JT1 A;  4KNY A;  2PI0 A;  1IZ1 A;  3NQO A;  3HUG A;  2HTS A;  3J80 K;  2K7L A;  3WU0 A;  4L9J A;  4RGS A;  2O61 A;  2NNN A;  3M9A A;  3GZ6 A;  4MTD A;  5LGT A;  1BBY A;  4M9Z A;  5HDN A;  2F5E A;  3E6B A;  3HYI A;  2ZME B;  1LDD A;  1U5T B;  1E2X A;  4B8X A;  1KQ0 A;  2MLG A;  2PQ8 A;  3F8B A;  5D4S A;  2XAF A;  4IHT A;  5CJ9 A;  4OMZ A;  1GXQ A;  1T0F A;  2A5Y B;  1S8N A;  3B73 A;  2IA1 A;  2OQR A;  4MEX F;  5BS6 A; 
#chains in the Genus database with same CATH topology
 2GA1 A;  3GUD A;  2KQR A;  1ETV A;  2JN6 A;  2DOE A;  4ABZ A;  2R7S A;  3I58 A;  1VQO I;  4CXF A;  1ON2 A;  1WWX A;  2RV8 A;  1LKX A;  3SQN A;  2EZI A;  3CCM I;  2JPB A;  5JLX A;  2CUJ A;  3VSK A;  5D8L B;  2IBD A;  3CCY A;  2QQ9 A;  5FKK A;  1GUU A;  4JYK A;  4I7H A;  2CFX A;  4XIC A;  3L2C A;  1R9T J;  2NOG A;  4MLO A;  3KCC A;  1ZRE A;  4IOA F;  5IYD J;  1GVD A;  1ZG3 A;  1RUO A;  2IA2 A;  2OAZ A;  2W82 A;  2QBY A;  3CJT B;  2L3D A;  1HXD A;  1P4X A;  1Z7U A;  5BPD A;  4EGY A;  1FP1 D;  2K9S A;  2P6T A;  3ECH A;  3PUB A;  3M8F A;  3BDD A;  4M71 A;  1BA5 A;  1ZRD A;  3NRV A;  2BY0 A;  2W85 A;  4LOC A;  2Y0M A;  4XRF A;  3ZRG A;  3F6O A;  4I6Z A;  2QCO A;  1NK2 P;  3DTE A;  1XCB A;  2K86 A;  5J4V A;  2G7U A;  1B9M A;  2IEK A;  5A2Q K;  1XTA A;  4PCQ A;  2LSO A;  2VC0 A;  3M8J A;  3RPU D;  4F91 B;  1R22 A;  3ZQL A;  5M5W J;  1X1C A;  2M9H A;  3A4C A;  4OIQ F;  2FOK A;  2HWV A;  3H3U A;  4JBA A;  4AYB A;  2IPQ X;  4N4N B;  3D5L A;  4EMS A;  5JR3 A;  2LBF B;  1RNL A;  1HSJ A;  5EZH A;  3OWT A;  3OY9 A;  3BCA A;  1TBX A;  2DT6 A;  2EH3 A;  2CUF A;  4FX0 A;  5EYR A;  1P4A A;  3H0D A;  4BE1 A;  1MBJ A;  4ITV A;  1LJ9 A;  4A3B J;  1X3Z B;  2E5N A;  2M4K A;  5KK1 A;  4XRS A;  4DZP A;  3QP5 A;  2QQA A;  1Y8Q B;  1I39 A;  1JGG A;  2LLK A;  4II3 A;  2QM3 A;  2CH0 A;  1REP C;  3ELK A;  2R7D A;  4JX6 A;  1QNT A;  3HHH A;  3DCF A;  4TV7 A;  3SDB A;  5LBQ A;  3CMA I;  1DUX C;  3J81 Z;  3PIO F;  2P4W A;  1XMK A;  1XGN A;  2DA6 A;  2NVY J;  3SEZ A;  3WG7 H;  1KYW A;  1BR2 A;  4BJT A;  1EF4 A;  5FKN A;  2HR3 A;  2DPD A;  4YRV A;  4BY7 J;  5D4R A;  1K7A A;  5KAF C;  5IP7 J;  5LRR A;  5B1B H;  2XAG A;  3M8E A;  3DBR B;  2OCC H;  5HLG A;  1X1D A;  3IWZ A;  1OCT C;  2QQB A;  3WE3 A;  3UNG C;  2CFO A;  4ZTF A;  5FB2 A;  3LSM A;  3FXQ A;  4ZH4 F;  1FBS A;  4KFC A;  2MW8 A;  2OZU A;  3BC8 A;  4HG2 A;  1Z1D A;  4IVN A;  3PFI A;  2P7V B;  1SD6 A;  3EYI A;  5DCM A;  3M1E A;  5FLV A;  3AG2 H;  3HOZ J;  2LR8 A;  2YSR A;  5EEH A;  2VC1 A;  4BE0 A;  2H1K A;  2LG4 A;  4HNT A;  2YPR A;  2DXI A;  1B8I B;  4G9Y A;  1G3S A;  4CGZ A;  4XN0 A;  2A3S A;  2XB5 A;  1LFU P;  3PQK A;  1JKQ C;  1OCZ H;  3E5X A;  4LG0 A;  2DQR A;  1V54 H;  4Y4R A;  2ACJ A;  2ZXH A;  1LDJ A;  4I0A A;  3CCE I;  2R7T A;  1H0M A;  1W5T A;  1YW8 A;  3EDP A;  1QQI A;  1BI0 A;  3CMY A;  2ESH A;  4BUP A;  1E3P A;  2MSY A;  2W00 A;  3E3V A;  4UB8 C;  1B9N A;  3FK7 A;  2JVG A;  4D1Q A;  3ABL H;  4XON A;  4L18 B;  1G2H A;  3QPH A;  1UB9 A;  3I59 A;  1FNN A;  3F0C A;  3ASN H;  2IVM A;  3BTL A;  2E7W A;  4GYG A;  4UUV A;  4XMY A;  3CDI A;  4MNU A;  4GYI A;  4A93 J;  4B4C A;  2E19 A;  4BYY A;  2X1E A;  3G71 I;  1K4S A;  4L0Y B;  5H6R A;  1IUF A;  1IXC A;  1WRJ A;  2GZW A;  2HOA A;  4G94 A;  2CV0 A;  1QRY A;  4ESF A;  1RRJ A;  3K10 A;  1LE8 B;  5GPA A;  4F92 B;  1E17 A;  3ZMS A;  5LFA A;  4E7J A;  4A3I J;  2PMU A;  3P5J A;  4CDG A;  1EV7 A;  1R49 A;  4RM3 A;  3BTI A;  1QPI A;  4XRM A;  2LY2 A;  1FOX A;  5E20 A;  5HOD A;  3IAS 2;  3FF5 A;  5BPI A;  3U1D A;  4ZZL A;  4A3F J;  1LNW A;  4N0B A;  2HFH A;  2HPI A;  5IP6 A;  1MMG A;  1UEL B;  4L5I A;  4LD5 A;  2QGU A;  1IRG A;  4M73 A;  4N4O B;  4S04 A;  1WJ5 A;  3TED A;  3GFJ A;  4BAC A;  4Y52 J;  2Y75 A;  1F1Z A;  1V3F A;  4U7B A;  2GXB A;  1CGP A;  4HV5 A;  4XLH A;  4BHB A;  4G7H F;  3EUK L;  1XS9 A;  1B72 A;  1ZKG A;  2LNB A;  3IL2 A;  2VI6 A;  3G6E I;  1LEA A;  1IG7 A;  4B09 A;  3H5A A;  4AVZ A;  4Y15 A;  4NB5 A;  3A0H C;  1HST A;  1X2M A;  3JR9 A;  1R1T A;  3OYF A;  5FD6 A;  1LUJ B;  2DMQ A;  3E5Q A;  3TBI A;  1W0T A;  1FY7 A;  1KQ9 A;  4PDK A;  1YJ9 I;  1WH7 A;  4L9N A;  3HOY J;  4EGZ A;  3GBG A;  3KIO A;  5LEJ A;  3HSF A;  2K4B A;  1ZR2 A;  2HNH A;  3G1M A;  3KLN A;  4A0X A;  1VQ7 I;  3PO3 J;  4HST A;  5JFR A;  3DKX A;  1KYZ A;  2EIN H;  5HLH A;  2KDO A;  2XKO A;  3LSK A;  5H2F C;  3E7L A;  2M0M A;  4M6V A;  2QVO A;  1MBG A;  3LA2 A;  2XKP A;  4BL0 B;  5GAH J;  1MMD A;  1X1P A;  2ISY A;  4MHG A;  3JRH A;  3JSP A;  4L5E A;  2LBF A;  1TWA J;  1UST A;  4WX9 A;  2FA5 A;  2LRE A;  4PJJ A;  2CRG A;  2UWM A;  2Z3Y A;  3EET A;  4DYC A;  3FHZ A;  4BQO A;  3CZ6 A;  3K7A J;  3PL8 A;  5HNF A;  4KT6 A;  1K78 B;  3KP6 A;  2LTP A;  3LAJ A;  4OU0 A;  3FXO A;  4OAY A;  3F23 A;  2HYF A;  3DKY A;  1QHH D;  3K70 C;  1OYW A;  4XKC A;  3W3C A;  2RNG A;  3MQ0 A;  5KCM A;  2M7A A;  1F43 A;  4EM0 B;  4FIS A;  3H36 A;  1MSE C;  3LQR A;  2QEN A;  3GTO J;  3MWM A;  3S3O A;  1ZGW A;  4D0P A;  4FX4 A;  1P7I A;  4A3E J;  5F6F A;  2CYY A;  2FQ3 A;  3EUA A;  1SFU A;  2YU3 A;  1W7P D;  4BEH A;  1BIB A;  2E7X A;  3VWB A;  4XRS G;  5E79 C;  2DOF A;  3M07 A;  1XMX A;  5TGT A;  1KGS A;  2BXZ A;  3GW2 A;  3BRO A;  5B66 C;  3GFI A;  2ZJP F;  1EJ9 A;  3S2D J;  3K4M A;  3G2B A;  5CVI A;  4Q5S F;  4ZDL A;  1MW7 A;  3CC4 I;  3JRA A;  2R5Y B;  4C30 A;  3V4G A;  2VQG A;  3TOA A;  2GXG A;  3J7Z I;  3AKZ A;  1JGS A;  1ZEL A;  3QQA A;  1P6R A;  2VQC A;  1IN6 A;  4RA2 A;  3MAJ A;  3HGY A;  5M5X J;  2UXX A;  1YOV B;  5FJ8 J;  3QRF F;  3E6C C;  3T5X A;  3DU5 A;  3SJM A;  3OYD A;  1SD7 A;  2WB1 A;  3N97 A;  1JJ8 C;  3WTY C;  1UG0 A;  2BHZ A;  1WI9 A;  1DQU A;  3I56 I;  2CO5 A;  2OQG A;  1ZHF A;  4UUS A;  3F21 A;  2IXS A;  2AHQ A;  1J75 A;  2NVQ J;  2FE3 A;  2EFP A;  2O8K A;  1VQ4 I;  3E6M A;  1MIJ A;  1QZY A;  3GX4 X;  2XF5 A;  4N9H A;  2NRA C;  2O6G E;  3CDL A;  4YIF A;  3ZOB A;  3PO2 J;  2F5F A;  1MSF C;  3LA7 A;  4CO8 A;  1WHU A;  2MBF A;  3OIO A;  3WTT C;  2BBY A;  1LEB A;  5J8F A;  1Z3X A;  3ERE D;  2X6O A;  1BR4 A;  4E7L A;  3OV8 A;  4ASN A;  4DQ2 A;  4IRI A;  1O7F A;  3L09 A;  1CF7 A;  3GLX A;  4RGU A;  4P9F A;  3HHG A;  2CQX A;  5GTH C;  5GTI C;  4Y17 A;  1O3R A;  3CUQ B;  3BR5 A;  2Z5U A;  3BTJ A;  1AWC A;  5J47 A;  2O03 A;  3MZH A;  3IWF A;  1R00 A;  1LQ1 A;  4QTR A;  1HKS A;  2P81 A;  4RB2 C;  2DAO A;  2DT5 A;  4HLY A;  1YG2 A;  2HVQ A;  5KVR A;  2LD5 A;  2P5V A;  3C18 A;  4JP0 A;  1E0E A;  2AO9 A;  2GAU A;  3ONQ A;  3WTW C;  4FAS D;  1Y6I A;  3ESW B;  1HW5 A;  3GVA A;  1ETK A;  3B6A A;  1V5E A;  3RQ4 A;  1UFM A;  1V4R A;  3HOU J;  3KZZ A;  2Y30 A;  5L3C A;  3S32 A;  2P0W A;  3LA3 A;  2VKE A;  4AU7 A;  1R6R A;  2QA4 I;  5L3D A;  2X6X A;  2R7W A;  2JWT A;  3DWL E;  1Z91 A;  1WH5 A;  3MKL A;  1O4X A;  3R61 A;  2EFO A;  2HVS A;  1ZQ3 P;  1SFK A;  1KU9 A;  3I9V 2;  2NOJ B;  4QIW N;  4FCY A;  1G6N A;  4Y33 A;  2A6T A;  5DV5 A;  2M8G X;  4C3H J;  2MD5 A;  2HOE A;  5CQG A;  4I02 A;  1T0F C;  4RLF A;  4ANJ A;  2X6Y A;  1FIP A;  3PSI A;  1MD0 A;  1ZK8 A;  4ZZD A;  2VPR A;  5C44 J;  3HRS A;  1R1V A;  3FXU A;  1YRN A;  4AID A;  4LIU A;  2LYC A;  3FM3 A;  3J7A Y;  2ELK A;  1BC7 C;  2Y2Z A;  4OIN F;  3JRC A;  3PNV A;  5F1R A;  1D8J A;  2IS6 A;  1R4M B;  1ITY A;  3M3Y J;  3K0L A;  5GAG J;  1TW2 A;  1MJB A;  2XGC A;  4HNV A;  1YI2 I;  1FBU A;  3L2W A;  2GBY A;  5LGU A;  1MJ9 A;  2VLA A;  2LK2 A;  3ZN0 A;  4AC0 A;  4F3Q A;  2Y9Z A;  3K4L A;  2GXA A;  4C2U A;  1ZG1 A;  2A6H F;  2JTV A;  1YX3 A;  2CGP A;  5F0C A;  3OS2 A;  3JCU C;  4FE7 A;  1OFC X;  3OYJ A;  1HOM A;  1X19 A;  1FSH A;  1W7P B;  4M9S A;  2H6C A;  4PJ0 C;  3G73 A;  2D1H A;  2ECC A;  3BOQ A;  1JKR C;  2HXO A;  2XRO A;  1SC7 A;  4OAZ A;  3SEQ A;  4NC6 A;  1FOY A;  5JLW A;  2VKH A;  1FEX A;  2NVX J;  2HKX A;  3U2R A;  1FJL A;  2DJI A;  5J1R A;  4E7H A;  2LKX A;  3I4M J;  1NG7 A;  4C3J J;  3HOX J;  1CQT A;  1QO0 D;  4E7Z A;  1D5V A;  1B1B A;  4R8H A;  3HEF A;  4DIQ A;  3CCL I;  3DP7 A;  3KP2 A;  2VIX A;  2QZ8 A;  2EA2 A;  1MGT A;  5LRS A;  3B02 A;  3TMO A;  2L9V A;  5HOO A;  3JRE A;  2L01 A;  3S16 J;  3HOT A;  1K83 J;  5K7H A;  2NXN B;  1ZAR A;  1K4T A;  2V1U A;  3V7C A;  3HBL A;  4B48 A;  2WC2 A;  2CW7 A;  5E3L A;  4ESJ A;  2R7X A;  3FMQ A;  4BQQ A;  4U0W A;  1QZE A;  2BOL A;  2RC4 A;  3OYE A;  1T39 A;  5DYM A;  1QA6 A;  2X48 A;  1HCR A;  2WAE A;  1J2X A;  2HZT A;  1D8K A;  2O3F A;  3GTG J;  2CW8 A;  3ISP A;  1V5F A;  3TP0 A;  3K4J A;  1U3E M;  2BVL A;  4HLX A;  4ZJZ A;  3I54 A;  2RRE A;  1DP3 A;  2FNP A;  3TDU C;  2EZK A;  3DEU A;  3RPQ A;  2GIZ A;  3IUO A;  2VOP A;  2JA5 J;  1R58 A;  2IJL A;  1ZH5 A;  1XG1 A;  3H1C A;  3SFI A;  1FYK A;  2OUM A;  1BR1 A;  1S72 I;  3RJP A;  2R4G A;  4XLN F;  1YE9 A;  1WJD A;  1QZZ A;  2MH9 A;  2E2H J;  2XIG A;  2LY9 A;  2Y0S A;  5K5O A;  2VE8 A;  2ZFW A;  3J80 Z;  2DDA A;  2IS2 A;  3CJR B;  3LAP A;  3Q3S A;  4D9J A;  3L2R A;  2A68 F;  2KZG A;  2XF7 A;  3BG3 A;  1Z7L A;  3DU6 A;  3K6G A;  2VN2 A;  1BL0 A;  1VQN I;  1TTY A;  3I5U A;  4ENJ A;  1MDM B;  3GFM A;  3ZMV A;  2R7R A;  1DGW Y;  3REO A;  1FTZ A;  1KON A;  5J8C A;  2JRM A;  2JQ7 A;  2W1O A;  2DA3 A;  2QUF A;  2WY8 Q;  3AAF A;  4L9V A;  3R0J A;  5ILS A;  5ICC A;  4HF0 A;  1VQ8 I;  3HB9 A;  3S3N A;  5F27 A;  2WY7 Q;  3ZGK A;  4Y13 A;  4CCO A;  3T1B A;  3A01 B;  2D45 A;  1IW7 F;  4UV8 A;  3NEU A;  3LSR A;  3OL4 A;  5TIS C;  3HC7 A;  3KP5 A;  2DQL A;  3ZN1 A;  3CCJ I;  2P8T A;  1Y0N A;  1BI2 A;  1QVU A;  1BIA A;  2FBK A;  2K9N A;  3CCV I;  1VF9 A;  1IN8 A;  4RLQ A;  1GDT A;  4HDU A;  3L9F A;  4ZTJ A;  3OYM A;  3AL0 B;  3BPX A;  1IDY A;  4ZDP A;  2R0Q C;  2DT7 B;  2Q1Z B;  3ZQ7 A;  1SVL A;  2QKM B;  1O57 A;  2A05 A;  2H09 A;  1T08 B;  3FXJ A;  4RGX A;  1UHM A;  3PNY A;  3M4O J;  1WQ2 A;  3LSI A;  1I5Z A;  4BH9 A;  3BG5 A;  4MFD A;  2BY1 A;  1VI0 A;  4BXU A;  1XSV A;  4YFX F;  3BR6 A;  1W36 C;  1AU7 A;  2KKO A;  2VJ4 A;  3LFK A;  4CYC A;  1KZH A;  2PMZ A;  3QPS A;  4CCL A;  4PJN A;  1DP7 P;  2F5C A;  3IH4 A;  4RAY A;  1ERD A;  2M45 A;  4V19 K;  1JT0 A;  3IV5 A;  1J5Y A;  2NS0 A;  3SDG A;  4BS9 A;  3HG9 A;  5CVJ A;  4DNC A;  2DFI A;  3FMR A;  2P5L C;  3KYD B;  2ZME C;  1BW5 A;  1MND A;  3OYG A;  2GA2 A;  2GQQ A;  3VFZ A;  3OYN A;  1U5T C;  3LSP A;  1JHH A;  1DPU A;  5E3N A;  1TT5 B;  1VFC A;  1ZLK A;  5GP9 A;  1RKW A;  4R1H A;  2WWY A;  4LB5 A;  2BW3 B;  2HS5 A;  4CZC A;  4NHJ A;  4M72 A;  2BY2 A;  2K9L A;  1PUF B;  2V1N A;  3S93 A;  2DA4 A;  3DXJ F;  3X2Q H;  2KPM A;  5D6F A;  2K9Q A;  4ZYD A;  1IV6 A;  2O8X A;  2HQN A;  4FHT A;  2HU9 A;  2M87 A;  2K85 A;  2V6C A;  1ETW A;  3T8T A;  3OSF A;  1LB2 A;  4KIS A;  4BGD A;  2V9V A;  3F3X A;  1VTN C;  4AIJ A;  5F0F A;  4IHX A;  3JRD A;  3A03 A;  4F52 A;  3WOD F;  4PJM A;  2J5O A;  4CYD A;  4LK1 F;  3KP4 A;  1ETX A;  3L1P A;  1BC8 C;  3Q9S A;  1DGR M;  3A0B C;  4A0Z A;  3VEP A;  3MFK A;  1I6H J;  5J6X A;  2ID3 A;  4DOZ A;  2RN7 A;  2XAS A;  3KEY A;  4HA8 A;  5E1W A;  2HVR A;  5FKO A;  4EQQ A;  5FRM A;  1VQ9 I;  1W7P A;  3S2H J;  2HDC A;  3PM1 A;  3GWZ A;  1WI3 A;  3EQL F;  1UMQ A;  2HXI A;  1BJZ A;  5ICF A;  3TP3 A;  3KET A;  1FX7 A;  2B0L A;  1S9H A;  3VPR A;  4NQW B;  3RTR A;  4WCG A;  4A3J J;  1IF1 A;  2QEX I;  1KQ8 A;  2ISZ A;  1E3H A;  2DTZ A;  2RNJ A;  3VYR B;  2XV4 S;  3BQY A;  1H89 C;  2L9N A;  4XKB A;  4A3M J;  1YHQ I;  3KPH A;  3K2Z A;  1D3Y A;  2NS7 A;  1PDN C;  1ZRC A;  2VQH A;  4RGR A;  4CCM A;  2Z99 A;  5EG0 B;  5LD2 C;  3RCO A;  2ECB A;  2TCT A;  5ILV A;  3DTK A;  2KL4 A;  3CDH A;  5IY5 H;  2DMT A;  2JK3 A;  3ZQC A;  4H4K C;  4HX7 A;  1RKT A;  2OF7 A;  2MGQ A;  3S15 J;  2EV0 A;  3DEE A;  2OTL I;  2WV1 A;  1TLH B;  4BHC A;  2A6E F;  4G7O F;  3V7S A;  1D0Y A;  4FTH A;  4DBR A;  3DV8 A;  2DK8 A;  2V79 A;  3CLO A;  4BBS J;  2FEZ A;  3Q9V A;  4G8X A;  2FML A;  2KIM A;  5F08 A;  1NK3 P;  1HDP A;  5D5W B;  3ZMT A;  2R7Z J;  1Y39 A;  3DBH B;  5CKT A;  3TO7 A;  2W57 A;  1PVE A;  2EK5 A;  2M5W A;  3TO6 A;  1NHA A;  1Z3Y A;  4MTE A;  1SAN A;  4IOC F;  4C2M J;  1H8A C;  1OCC H;  3ZMD A;  4YIR X;  4NBQ A;  3KEQ A;  1S5L C;  5TRD A;  4B3A A;  1FC3 A;  4NC8 A;  2IGN A;  3VSL A;  1YJW I;  1IRX A;  2STW A;  2OTJ I;  3R6S A;  3CC7 I;  4DBQ A;  2BEO A;  2ME6 A;  4BU2 A;  1RZ4 A;  2A5W A;  4LIV A;  2O7O A;  3IP4 B;  4YFN F;  3MMY B;  3S2W A;  2E71 A;  2VBX A;  1WJB A;  3DPU A;  5CVV A;  2E1O A;  3GO5 A;  1LVK A;  4QPQ A;  3MCZ A;  6PAX A;  3FMS A;  4HPQ A;  3VDX A;  3MKZ A;  1TW3 A;  1ZGA A;  4HBL A;  4JQF A;  5E1Z B;  4EM1 A;  1I1S A;  2KZV A;  4II2 A;  4XLA A;  3L2Q A;  2M3A A;  4WF2 A;  2PMH A;  1Y1W J;  1JTY A;  4P55 A;  4V2F A;  3ABT A;  1FPQ A;  2MA3 A;  2L54 A;  3OS1 A;  2HQA A;  3BG7 A;  3P9C A;  2F4M B;  1RUN A;  2DBB A;  2MC3 A;  4YFK F;  2F5V A;  3RYR A;  4PK4 A;  3GF2 A;  4XM3 A;  3WU1 B;  1Z6R A;  3RZO J;  2VL8 A;  3K69 A;  4C3I J;  2KRC A;  1L0O C;  1S3J A;  1TWG J;  2ZME A;  5HDG A;  1GV5 A;  2H8W A;  1EH6 A;  5EGO B;  1UAA A;  1U5T A;  5CPR B;  2CMP A;  1MBF A;  5K7F A;  2CUZ A;  3QYB A;  4LFU A;  4IZZ A;  2KJC A;  1IAW A;  4ZDO A;  2LC2 A;  3H9G A;  5ILU A;  4HYE A;  2XDV A;  2FBH A;  2VPL A;  4HQE A;  3LST A;  2VUM J;  2ZFU A;  2Q2E B;  4HRI A;  2ESN A;  1I6X A;  1P7J A;  5BQT A;  5FLX K;  2QQ8 A;  3HGG A;  1DPR A;  1S29 A;  2EJR A;  3C2B A;  3E97 A;  3JAM K;  1J59 A;  3OMY A;  2HQR A;  3W2A A;  2I10 A;  3LNQ A;  1A36 A;  3S8P A;  3BCB A;  5K1Y A;  2CUE A;  3GME A;  3A1Y A;  4P1W A;  3DQV C;  3K2A A;  5GAD J;  1K79 A;  4FT8 A;  3HIF A;  4PSW A;  1UCR A;  2EBI A;  4AUX A;  1XMA A;  1QBJ A;  5CYV A;  3LQQ A;  2VXD A;  3IH3 A;  2I5U A;  4IHS A;  1FOW A;  5JVT A;  2NNY A;  1FLI A;  1J09 A;  4A5N A;  4HF2 A;  3JRI A;  2E5Z A;  3OOP A;  2FX0 A;  3I0T A;  4LK0 F;  3MKW B;  4RAG A;  3ZR8 X;  3WG9 A;  3GXO A;  3C7J A;  5AIQ A;  3WTV C;  1HA8 A;  1OJL A;  3KLO A;  2XSD C;  4LJZ F;  2X4H A;  3MEX A;  1SEU A;  5DD4 A;  1MNM C;  2P7C B;  1X1A A;  3CC2 I;  2GIV A;  1F9N A;  4XLC A;  3F8F A;  4UUT A;  5KHD A;  5L3G A;  3HOW J;  5K5R A;  1Z77 A;  2QSG X;  2AQE A;  3JRF A;  2F5D A;  3COA C;  2HDW A;  5J1U A;  2OV7 A;  3HZJ A;  1IRZ A;  3RSN A;  1XDU A;  3FIS A;  2VXZ A;  4Q4Z F;  1EH7 A;  4GFB A;  1P2F A;  1XPX A;  1W0U A;  1G3Y A;  4A69 C;  3GZ5 A;  2F4I A;  4A6E A;  2MAB A;  3WE2 A;  1VQ6 I;  1ODD A;  1FWZ A;  2R7O A;  2FUG 2;  4ZC3 A;  1N25 A;  3AG4 H;  2DMP A;  2DFF A;  5FRO A;  1G59 A;  3ZQI A;  2BE5 F;  5BOX A;  2IAI A;  5DEQ A;  1JJ6 C;  1UHW A;  4LLL A;  1R5G A;  2QWW A;  4BJ6 C;  3FBN B;  4E6K G;  2JA8 J;  1P4W A;  2NVU B;  4A3G J;  2L5Q A;  1PP8 F;  1ORK A;  2HYJ A;  2BY3 A;  3LL7 A;  3H35 A;  4U87 A;  1D1C A;  3BR3 A;  2ZJQ F;  1HW1 A;  1TZL A;  2EV5 A;  3E0J B;  4U0V A;  2PJR B;  5E17 F;  2DW4 A;  2M7B A;  5IYC J;  1M1E B;  3PIP F;  2DPU A;  2XUB A;  5CVU A;  1UZC A;  4PFO A;  3QP6 A;  4PFP A;  2PG4 A;  2EFN A;  4J19 A;  5HS9 A;  2XRL A;  1B6A A;  5LGN A;  3H92 A;  4U7D A;  4RB0 A;  3TL4 X;  5FGM A;  2ZJ2 A;  1AKH B;  3WGH A;  1D1B A;  1SAX A;  3GTP J;  2R7V A;  3EUH C;  3K4C A;  3KP3 A;  1J9I A;  5JVG F;  2FOW A;  4RBO A;  1IC8 A;  3QAH A;  4HNU A;  4UB6 C;  3HKZ N;  2M34 A;  1K6Y A;  1B8I A;  2V9K A;  4DJA A;  1EH8 A;  4XSX F;  3TDZ C;  2K3P A;  5AON A;  2VKV A;  2DA2 A;  2DA7 A;  2R93 J;  1X1B A;  3S1Q J;  2I8D A;  1W1W E;  3BWG A;  4QSH A;  1R5H A;  3ZQG A;  2DA1 A;  2E60 A;  5E18 F;  3IRQ A;  4ENM A;  4IX7 A;  4IF4 A;  4D5C A;  3BJA A;  1YYV A;  2VJJ A;  1XCV A;  5D5X B;  1XGS A;  1D5Y A;  2K02 A;  2QKL B;  2WAQ A;  4ON0 A;  1HDD C;  2GLO A;  4B3X A;  3HUG B;  1YIT I;  2H1L A;  2BHY A;  2K5C A;  3TW7 A;  1OCO H;  2ELJ A;  3T8R A;  4EJV A;  2XVC A;  4JX5 A;  4ENK A;  2OPT A;  4G12 A;  1LVA A;  2JZY A;  3OYI A;  4XLP F;  3F8M A;  1MH4 A;  2CS3 A;  5C3E J;  3HPH A;  1YS7 A;  4MFE A;  1IN5 A;  3BLY A;  1WZ2 A;  5DUK A;  5KAI C;  2XGE A;  3VYU B;  5BNG A;  2E1M B;  2IP2 A;  3Q5F A;  4HEA 2;  1NTC A;  4EJU A;  1F4K A;  2NVT J;  1GXP A;  3TGN A;  1ZGJ A;  1LE8 A;  3E5U A;  2OA4 A;  4S05 A;  2KRF A;  1SFX A;  4D7N A;  4HAM A;  1A6I A;  5D5U B;  2L9S A;  4Q48 A;  1TT0 A;  4BAY A;  2JPC A;  3FKI J;  3DEW A;  4KN4 X;  4FET A;  3K1M A;  2V9P A;  2XRN A;  4OWR B;  3RPU A;  3U1K A;  5IT9 Z;  5ICG A;  4I76 A;  1BM9 A;  2COB A;  1DU0 A;  3OR2 C;  1S7A A;  2XAH A;  1I27 A;  2DFH A;  3A02 A;  1R23 A;  4GRI A;  4RB1 A;  4M3G A;  4KYW A;  2VON A;  3MKY B;  3G3Z A;  3RI4 A;  3FZV A;  3CUQ C;  4XLE A;  3C3W A;  1U9N A;  3QOD A;  2RQP A;  5HLI A;  2UV1 A;  2VQL A;  3SHF A;  2EIK H;  3OYB A;  3HTU A;  4K2E A;  1MMN A;  1IXS B;  1R1U A;  4A3D J;  2LP0 A;  2RGV A;  1VZ0 A;  3NWS A;  3BY6 A;  5FRN A;  2CQN A;  4N9I A;  2H27 A;  4A12 A;  3V42 A;  2VAS A;  3T0Y A;  2KIS A;  3ROU A;  2ELH A;  5E3O A;  3DFG A;  1WJA A;  1RR8 C;  3JSO A;  1BN5 A;  3FXK A;  4YII A;  4IKF A;  2EZH A;  2QBY B;  1VQM I;  2JA2 A;  2XF6 A;  2KJB A;  1TQM A;  1FYM A;  3KP7 A;  4BXX J;  1OR7 C;  1VQK I;  2ETH A;  3BR2 A;  4CCN A;  1ULY A;  3ERM A;  1ETO A;  1ON1 A;  5DDG A;  4KA4 A;  2G0E A;  3VYT B;  4M9X A;  3N05 A;  5HLT A;  1H88 C;  2MG4 A;  3S1R J;  1H9T A;  2R7U A;  2P5K A;  4AIK A;  5AIP A;  1OQY A;  1T2K A;  1IGN A;  3CCQ I;  3PNT A;  4A2U A;  2P6S A;  3EPZ A;  2OZ6 A;  1ZN2 A;  3BR0 A;  4M3D A;  3NWT A;  4E7K A;  3OYC A;  4C2T A;  3QU3 A;  1JUP A;  4BXF A;  2FU4 A;  4CH7 A;  4OOI A;  4F7Z A;  1IV8 A;  1YIO A;  1X4P A;  2VJ5 A;  4AVP A;  4P9U A;  1I1G A;  3OSG A;  4XOR A;  4ZYE A;  3ZP5 A;  1K78 A;  2ICW G;  3JTH A;  2K9M A;  4HV6 A;  1SVM A;  3GFL A;  4OMY A;  5IOZ A;  1KA8 A;  3EUH A;  2Y0S N;  4IQ4 A;  4AD9 A;  4Y7N J;  2GOX B;  1XX5 A;  4YEL A;  4RM2 A;  2GM4 A;  3DBL B;  3GZN B;  4O6J A;  4PJL A;  4C9Y A;  2L0K A;  2F48 A;  3CCR I;  4GO1 A;  4G6D A;  2KP6 A;  2XPV A;  4G6Q A;  5FKM A;  1VND A;  3CF5 F;  1Z0X A;  4BKX A;  3BT9 A;  1G4D A;  2GOM A;  3F8N A;  5E8G A;  3RYP A;  4XKW A;  1X3W B;  2CJJ A;  5IP9 J;  2EFQ A;  3TO9 A;  3FBI B;  1X4O A;  2JMW A;  2KMU A;  2HZD A;  2Z33 A;  3OOU A;  1DU6 A;  3PUF A;  2RDP A;  4B47 A;  1W5S A;  2OD5 A;  2E1N A;  2R5Y A;  2GWR A;  1WJC A;  5L3B A;  2DO7 A;  1GVJ A;  4XL9 A;  4D5F A;  5GPC A;  2M0C A;  1ETQ A;  3M1C A;  5JHF A;  3WTU C;  3H5R A;  5DCM B;  4EEF G;  4A5M A;  3O6B B;  5CLS A;  2Y69 H;  4CHU A;  3CES A;  4QLC U;  4EJO A;  2ZB9 A;  1IN4 A;  2D1V A;  2IA0 A;  2HI3 A;  4KDP A;  1MJA A;  2KFD A;  1Z6T A;  5ERI A;  2FSW A;  1QGP A;  3KE2 A;  2RQQ A;  4BY1 J;  2KRH A;  1STZ A;  1YO5 C;  4WXH A;  2BVM A;  2K40 A;  3G1O A;  4GDF A;  3BR1 A;  4ESB A;  4LG0 B;  1B4A A;  2ZNY A;  3CJQ B;  1H9G A;  3FXR A;  3IH2 A;  2PBI A;  1T33 A;  2LF8 A;  3BPV A;  4MQV A;  2YX4 A;  5FLM J;  1SD5 A;  1ACI A;  2QSF X;  2WBM A;  4G6T B;  2K27 A;  4IRG A;  2PLY A;  1Y1V J;  3S1M J;  4WXD A;  5FKL A;  2L4M A;  1MH3 A;  3I3L A;  2LF7 A;  5J4Y A;  3HRU A;  1GT0 C;  2BZT A;  1AA7 A;  2K3F A;  3I59 B;  2DJN A;  3H9Q A;  3HXL A;  2Y48 A;  4XQF A;  1TNT A;  2DA5 A;  3CUQ A;  2COM A;  1D0X A;  2NS8 A;  3Q0V A;  5J3L A;  1A04 A;  2HTJ A;  3ZQH A;  4UVA A;  3PSF A;  2VE9 A;  1O3S A;  4RB3 C;  3S3M A;  2KIF A;  4EJW A;  2EFW A;  1PUE E;  1OLT A;  5ED4 A;  4BBR J;  2JSP A;  2F2E A;  3SFZ A;  2LRD A;  2LOO A;  3IRR A;  1R36 A;  2XB0 X;  4DW6 A;  4B1R A;  3BG9 A;  4CUG A;  1PYV A;  1WKM A;  3IAM 2;  5DM7 F;  3C1D A;  1A6Q A;  2DN0 A;  2L7Z A;  2A69 F;  1D1A A;  2N8G A;  2XGX A;  1JKO C;  1Q1H A;  2YUS A;  3ABU A;  1K6O A;  3QU6 A;  3H9J A;  1TQI A;  4WXC A;  1G8X A;  1O7L A;  3WTZ A;  3CJN A;  2ZBK A;  1TC3 C;  2V1X A;  1S6L A;  3AL0 C;  1JTX A;  1TWC J;  4FE4 A;  3JW4 A;  3O3K A;  1OR7 A;  3U9G A;  2DOD A;  2ZSI B;  1KU7 A;  5E8I A;  2LH9 A;  4AYB N;  4UY8 I;  2DYR H;  1EKE A;  1TWF J;  1VQ5 I;  4UXN A;  1XSX A;  4HX8 A;  2VBW A;  2W84 A;  3C2G A;  3OYA A;  5DD8 A;  4NNJ A;  3R4K A;  4M3B A;  4WWC A;  5TJJ A;  2QLZ A;  2D2W A;  2J5P A;  3CP8 A;  3FM5 A;  4Z6Y A;  5A2Q Z;  1B72 B;  4L9T A;  1SFE A;  2PN6 A;  4JK1 X;  3KZY A;  2YS9 A;  1O3T A;  4UV9 A;  1WGX A;  2R7Q A;  4R79 A;  4ZYG A;  1C0W A;  5FO5 A;  5IYB J;  2DOA A;  5JI6 A;  4GCV A;  5LEK A;  1XSD A;  4IQJ A;  1YLF A;  2AXL A;  1YIJ I;  3HM5 A;  2MFZ A;  2EB7 A;  2W48 A;  1EA3 A;  3UKG A;  1G3T A;  1SD4 A;  2R92 J;  1ZRF A;  5DS9 A;  1XC5 A;  4KIC A;  4S0H B;  1BOA A;  3D5S C;  4A3L J;  2K4J A;  1WVR A;  2BGC A;  4EVI A;  2FBI A;  1U2W A;  2WV0 A;  5H20 A;  3L2V A;  1TQP A;  1NG6 A;  3JTG A;  2FNA A;  2H6B A;  4Q47 A;  1PP7 U;  2F6C A;  5IOY A;  1IJW C;  1WSU A;  4KIT B;  2LMD A;  3S17 J;  4KUM A;  2NAZ A;  3I53 A;  3S14 J;  3V7R A;  4IJA A;  3HOV J;  2V26 A;  2KT0 A;  4I99 C;  3VOE A;  4L5J A;  2ZXI A;  1OPC A;  3KYC B;  4EAT A;  3CP2 A;  4E7S A;  3BTC A;  5J40 A;  1A31 A;  2IT0 A;  5D6E A;  4BQA A;  2JA7 J;  3DF8 A;  4CSW A;  2TRT A;  2XC7 A;  1QPM A;  1RIO H;  4XSZ F;  2Z16 A;  5K7Z A;  4KMF A;  1YFH A;  4CCJ A;  3WU2 C;  4BDZ A;  3NAR A;  2CQK A;  3FXM A;  5GAE J;  2CSO A;  1GHC A;  3P9I A;  3SYT A;  2QF7 A;  5K5Q A;  3B6C A;  4RMN A;  3I64 A;  2PJP A;  4NDL A;  1USS A;  2LFB A;  2XSJ C;  5JHU A;  4JX4 A;  2MYS A;  3J81 K;  2IGO A;  1LDK B;  4BEH B;  4EM2 A;  4KMU X;  3K70 D;  1IDZ A;  1HBX G;  3H3V K;  3Q0U A;  4Z2Y A;  3K1N A;  3WGG A;  2AS5 F;  4PGH A;  4RAF A;  1OYI A;  1T56 A;  4P5O A;  3HTS B;  2WAD A;  4PGG A;  2V4J C;  3ABM H;  3H3Z A;  4M6Y A;  5LLQ A;  2CQQ A;  3J7A O;  1ZR4 A;  5CVR A;  1TP4 A;  4DYQ A;  3CME I;  4A3K J;  2HQ5 A;  3A2K A;  3MVP A;  1MDM A;  4BE2 A;  3TKY A;  2RVC A;  1A5J A;  2HGC A;  4IEJ A;  1FIA A;  2Z9O A;  4IPA A;  1T6S A;  1ZYR F;  4LIT A;  1AOY A;  3A01 A;  2W24 A;  4UUS B;  4UNO A;  9ANT A;  1R5I D;  4XBF A;  1SAU A;  2KIQ A;  1HW2 A;  1J7K A;  1S7E A;  4P96 A;  2X0L A;  2ZSH B;  4H0E A;  1KU3 A;  5C4J J;  2BXY A;  1FBQ A;  4XOT A;  2AQF A;  3RKQ A;  2L02 A;  3KX2 A;  5FLX Z;  1UJ8 A;  3ZQQ A;  5J1Y A;  1GV2 A;  3JAM Z;  3EYY A;  1CF7 B;  4BHP A;  4XK4 A;  2IW5 A;  3QWL A;  1NH3 A;  1SMT A;  3ULQ B;  1MMA A;  2H94 A;  4I09 A;  3CQZ J;  2OCE A;  4IO9 F;  1TNS A;  2X85 A;  1Z21 A;  1QVT A;  2CQ7 A;  2F4O B;  2FMY A;  4ETS A;  4AM3 A;  4Y3O A;  4X0G A;  2CW0 F;  2FJ1 A;  3LSH A;  1JHF A;  3W6J B;  1LFP A;  2BYV E;  1R71 A;  1Y0U A;  3KFW X;  5IT3 A;  2FF4 A;  2VB6 A;  2WTE A;  2VT2 A;  3HJE A;  2O9L A;  5HS8 A;  2EPF A;  1T98 A;  1XN7 A;  1MBE A;  2BW3 A;  3CTA A;  3TQN A;  4UVB A;  4J00 A;  3DKW A;  3G1L A;  2L7M P;  2LY1 A;  1PUF A;  2CV1 A;  4EJT A;  3HL2 A;  4UHT A;  5B1A H;  2M8E A;  3GTQ J;  2JUG A;  2X6W A;  4HQM A;  5M3F J;  3DTI A;  3ML6 A;  3TOB A;  4CIC A;  4I01 A;  2ZCW A;  1TL8 A;  3BZ6 A;  3JRB A;  1J0R A;  3J7Y J;  4IHY A;  1YRN B;  3I55 I;  4F93 B;  3PJR A;  4HF1 A;  2EV6 A;  1WFX A;  3FHN A;  3ZCO A;  3I4N J;  4HOB A;  4HSR A;  4KIF A;  2OU2 A;  5EEA A;  3R0A A;  1ZTR A;  3R60 A;  3RKW A;  3KZI C;  4M6X A;  2JA6 J;  2OJE D;  1UG2 A;  2H8R A;  5C4X J;  3CCU I;  4IHV A;  4YG2 F;  3RIR A;  3SZG A;  5E1X A;  5D8K B;  1ETY A;  3BQZ A;  2A07 F;  2IS4 A;  2IGK A;  2ADU A;  2JSC A;  2Z2S B;  4G7Z F;  2CV2 A;  1ZG5 A;  3LFU A;  4W1U A;  3E1S A;  2ZO4 A;  5F64 A;  1U8B A;  2XHK A;  3MZY A;  1FT9 A;  2KHM A;  3K4K A;  1F36 A;  2O5R A;  2PEX A;  1I3Q J;  4D7M A;  3F9K A;  1A35 A;  4NQW A;  4U88 A;  2ZNZ A;  3OL3 A;  1BI1 A;  1YW9 A;  2ID6 A;  5EDN A;  3TW6 A;  3JRG A;  2LKS A;  1RC9 A;  4MGR A;  4V2G A;  1U78 A;  2VOO A;  1IXR C;  1OKR A;  1U8R A;  2XAQ A;  2FD5 A;  4KT5 C;  1SMY F;  2CU7 A;  2DFE A;  4KN7 X;  3MN2 A;  2V7F A;  5EG0 A;  2EA4 A;  2UUZ A;  3GTK J;  1SVO A;  3G4S I;  4GGG A;  4CCK A;  1UHS A;  2YX7 A;  2PFB A;  1N78 A;  4E70 A;  3AG3 H;  1HKQ A;  3Q0W A;  2WAF A;  4UVC A;  4RAZ A;  3LOC A;  3SZT A;  2WB1 N;  5DCF A;  3GYH X;  1JUS A;  3L00 A;  4HZF A;  3VB2 A;  2DMU A;  5B5E C;  4X6A J;  3P7N A;  3UR3 C;  1RI7 A;  1N77 A;  4I2O A;  2KIU A;  2D5V A;  4A6D A;  2MC4 A;  2DCE A;  5HVQ C;  2IS1 A;  3WTS C;  2R5Z B;  3OYL A;  2WAQ N;  2JVH A;  3MZ8 A;  3L7W A;  4BNC A;  3I4P A;  1FYL A;  1BOB A;  3F72 A;  1R4N B;  4XKV A;  4CZZ A;  4IL6 C;  3PFY A;  3DPT A;  3OYK A;  3OS0 A;  3AG1 H;  5IPA A;  5LHI A;  5KNL A;  1T8I A;  1FTT A;  4A0Y A;  1Z9C A;  1LPQ A;  3C2H A;  4NUB A;  1QHG A;  2W25 A;  3ZMU A;  3P9K A;  4E7I A;  3DLL F;  5EJC A;  2AXT C;  1T95 A;  2YR2 A;  2Q8K A;  3ZQF A;  2EQR A;  2L2O A;  2DTR A;  3HSR A;  3ECO A;  3IKT A;  4J01 A;  2HOS A;  3HRM A;  1F5T A;  3OIP A;  1IN7 A;  5F04 A;  4QWQ A;  1HF0 A;  2UXN A;  4OIR F;  4B44 A;  4OIO F;  2VBY A;  3W2V A;  3GLL A;  2MH2 A;  4W97 A;  1B59 A;  3QPT A;  2XGD A;  3DPL C;  3CUO A;  5DUI A;  3WHB A;  2R3S A;  2IRF G;  1POG A;  5HDK A;  3FX3 A;  3H5N A;  3WHC A;  3KYL A;  3CCS I;  2DDB A;  5M3M J;  5M5Y J;  2E2I J;  3SXY A;  1OIS A;  2RKH A;  4LG3 A;  4DGW B;  2UZK A;  2QYO A;  3CO7 C;  2O0Y A;  2DLL A;  2G9W A;  4X1E A;  1MMS A;  3W6K B;  3AFH A;  4F55 A;  4XID A;  5EGO A;  2LKP A;  4OIP F;  2JRT A;  2E35 A;  2B63 J;  3GCM A;  4I98 B;  1OCP A;  3V8J A;  2ZKZ A;  3RKY A;  2C6Y A;  2VT3 A;  1MBH A;  1Z67 A;  3RKX A;  2KDZ A;  3BZC A;  1G3W A;  3HKZ A;  1U6G A;  4JOM A;  1FP2 A;  1FMW A;  4HDV A;  2B9S A;  1FSE A;  1FOK A;  2Q2E A;  1I3A A;  4WK8 F;  2FXA A;  1JXS A;  5B3S H;  1YTY A;  1L3L A;  1FZP B;  1WJF A;  2IGM A;  2EIM H;  2LDU A;  4XR6 A;  5E3M A;  4KIG A;  1I50 J;  1V55 H;  2QSH X;  1RR7 A;  1YQA A;  2M2E A;  4LMY A;  3O2P E;  4CYC B;  1S7O A;  1XD7 A;  4E4H A;  1BI3 A;  1YW7 A;  2OC6 A;  1RPW A;  2TDX A;  1QU3 A;  3IC7 A;  2ZJR F;  1MNE A;  2V6E A;  5HNH A;  2YU9 J;  5LHH A;  5FFZ A;  2L7F P;  2E34 A;  1T38 A;  2ZXJ A;  4U0Y A;  3MD2 A;  1JT6 A;  3M7G A;  4DYR A;  5EF6 A;  2E1M C;  1W36 D;  1P92 A;  3IKV A;  1HKT A;  2EZL A;  4RS8 A;  1MKM A;  3BJ6 A;  4PZJ A;  2Y9Y A;  1JI8 A;  4AWX B;  1BJA A;  2VBZ A;  2DI3 A;  2STT A;  2Y31 A;  3BP8 A;  2BV6 A;  2E2J J;  2HDD A;  2OBP A;  1D0Z A;  3QOP A;  3ASO H;  5F0H A;  3K4B A;  3LWF A;  3F22 A;  3HDD A;  3O8G A;  1U9O A;  4O3M A;  3CLQ A;  4KIB A;  3BG6 A;  4DZJ A;  5IT9 K;  5BMZ A;  5D5V B;  2ME0 A;  4LLN A;  2Z1D A;  3VOD A;  3OIQ A;  2HYG D;  2EWN A;  4MEY F;  3GEZ A;  5FFX A;  2FRH A;  3KEO A;  5L3F A;  1LFB A;  3K1P A;  1E3O C;  4PUS A;  4IXA A;  3WGI A;  4CA0 A;  3ZPL A;  4BJ5 C;  1YS6 A;  2VJI A;  4ZYH A;  3PQJ A;  1KU2 A;  3I71 A;  1U0J A;  4LLG F;  4M74 A;  2WA0 A;  4XOP A;  2A61 A;  3QPL A;  1K61 A;  1WJE A;  3D0S A;  2XAU A;  4LGW A;  1VQL I;  1OYY A;  1FMV A;  3OYH A;  2HKO A;  3K4N A;  1IUY A;  3HRT A;  2JJ7 A;  5FD5 A;  1MZB A;  2LVS A;  2Q0O A;  1X3U A;  3W6V A;  3CMM A;  4I0B A;  3V8L A;  4B43 A;  3L2U A;  3K9T A;  3GTL J;  5CQE A;  1TWH J;  3HPG A;  3GTM J;  3NAU A;  5ICE A;  4QPO A;  1XB4 A;  4HW0 A;  3CD6 I;  3V8K A;  1W4M A;  3HSE A;  1ZAO A;  2X51 A;  3O8H A;  4M3F A;  2X1C A;  4MIM A;  3IHU A;  4FQG A;  2L9R A;  4MQ9 F;  2MLK A;  5H6Q A;  3N4M A;  3E6D A;  2V1D A;  1XGM A;  2L7K A;  4GXO A;  4XN3 A;  3F6V A;  5HS7 A;  1ZLJ A;  3FDY A;  2DK5 A;  3QOE A;  4LB6 B;  3WTX C;  3CO6 C;  3RZD J;  2E1C A;  2PJR A;  4IRH A;  4ENN A;  1HQC A;  2E36 A;  1JKP C;  5L3E A;  2R7F A;  1WPK A;  1YX5 A;  3S1N J;  1IRF A;  3F8C A;  1JUM A;  4XNF A;  4EV0 A;  1XDS A;  1XGO A;  2FQ4 A;  3D5R C;  5EEG A;  3W2W A;  2M1B A;  4RDU A;  2G7H A;  2XPW A;  4HX4 A;  2R5Z A;  5LHG A;  2PX9 A;  1AKH A;  1YJN I;  1ONV A;  3FWE A;  2XAJ A;  2MD0 A;  4AIH A;  1HLV A;  3ZMZ A;  3QYE A;  1O3Q A;  5DM6 F;  3BZK A;  3RDI A;  4L0Z B;  4XLF A;  3GTJ J;  1DDN A;  2NYX A;  4BQN A;  2CWE A;  4IHW A;  2M30 A;  2VOD A;  1Z05 A;  1RES A;  2W4S A;  3CF2 A;  3HOS A;  1V5G A;  2JUC A;  2W7N A;  1JE8 A;  3LMM A;  2HOT A;  1W5C C;  2DU9 A;  3SZP A;  1R7J A;  2CG4 A;  4O5V A;  4MO7 A;  4PSX A;  3VYS B;  1OMI A;  1Y56 A;  2L4A A;  2PMZ N;  2HEO A;  3BJO A;  2VKD A;  2JT1 A;  4KNY A;  1Y8R B;  1N75 A;  3FXL A;  4ZYA A;  2PI0 A;  1IZ1 A;  3NQO A;  2X9D A;  3HUG A;  1APL C;  2HTS A;  2XPU A;  3QYF A;  3J80 K;  2ZC2 A;  3ABK H;  2K7L A;  3WU0 A;  2DMN A;  4L9J A;  4RGS A;  2O61 A;  3D1N I;  2DYS H;  2B7E A;  2NNN A;  3M9A A;  3RQI A;  3GZ6 A;  1RET A;  2X1D A;  4YEJ A;  5LGT A;  1BBY A;  4MTD A;  4M9Z A;  1WCM J;  3FKJ A;  4BDY A;  1X2N A;  2HPM A;  3OR1 C;  2KLO A;  5HDN A;  2F5E A;  3E6B A;  3DLA A;  3LSG A;  3HYI A;  2RAE A;  2ZME B;  4A3C J;  1ENH A;  3FK6 A;  1LDD A;  1PJR A;  4NC7 A;  1U5T B;  5EZG A;  1E2X A;  4B8X A;  1KQ0 A;  2MLG A;  2PQ8 A;  3F8B A;  3FIW A;  3H0G J;  3LSJ A;  4KJZ A;  5D4S A;  1AHD P;  1X58 A;  4M3E A;  1P9Q C;  1OCR H;  2M4G A;  5F1J A;  2XAF A;  3ZXS A;  4IHT A;  2ZXW H;  2EIJ H;  5CJ9 A;  4OMZ A;  1GXQ A;  1T0F A;  1MBK A;  1Q1V A;  5DTD A;  1HC8 A;  2A5Y B;  1SFO J;  1GLN A;  1VQP I;  1IO2 A;  2EIL H;  1S8N A;  3B73 A;  1BW6 A;  3U21 A;  2IA1 A;  2OQR A;  4MEX F;  5BS6 A; 
#chains in the Genus database with same CATH homology
 2GA1 A;  3GUD A;  3I58 A;  4CXF A;  1ON2 A;  1WWX A;  2RV8 A;  3SQN A;  2JPB A;  5D8L B;  2QQ9 A;  4I7H A;  2CFX A;  3L2C A;  1ZRE A;  3KCC A;  1ZG3 A;  1RUO A;  2IA2 A;  2OAZ A;  2QBY A;  2L3D A;  1HXD A;  1P4X A;  1Z7U A;  5BPD A;  4EGY A;  1FP1 D;  2P6T A;  3ECH A;  3M8F A;  3BDD A;  4M71 A;  1ZRD A;  3NRV A;  2W85 A;  2Y0M A;  4XRF A;  3F6O A;  1XCB A;  2K86 A;  2G7U A;  1B9M A;  5A2Q K;  4PCQ A;  2LSO A;  2VC0 A;  1R22 A;  4OIQ F;  2FOK A;  2HWV A;  3H3U A;  4JBA A;  2IPQ X;  3D5L A;  4EMS A;  5JR3 A;  1RNL A;  1HSJ A;  1TBX A;  4FX0 A;  1P4A A;  1LJ9 A;  5KK1 A;  3QP5 A;  2QQA A;  2QM3 A;  1REP C;  3ELK A;  2R7D A;  5LBQ A;  1QNT A;  3HHH A;  4TV7 A;  1DUX C;  3J81 Z;  2P4W A;  1XMK A;  1XGN A;  1KYW A;  2HR3 A;  2DPD A;  5D4R A;  1K7A A;  5LRR A;  2XAG A;  3M8E A;  5HLG A;  3IWZ A;  2QQB A;  3WE3 A;  5FB2 A;  4ZH4 F;  3FXQ A;  1FBS A;  4KFC A;  2OZU A;  1Z1D A;  4IVN A;  3PFI A;  2P7V B;  1SD6 A;  3EYI A;  5DCM A;  3M1E A;  2YSR A;  5EEH A;  2VC1 A;  2YPR A;  4G9Y A;  1G3S A;  4CGZ A;  2A3S A;  3PQK A;  3E5X A;  4LG0 A;  2DQR A;  2ACJ A;  1LDJ A;  4I0A A;  1H0M A;  1W5T A;  1YW8 A;  3EDP A;  1QQI A;  1BI0 A;  2ESH A;  3E3V A;  1B9N A;  4L18 B;  3QPH A;  1UB9 A;  3I59 A;  1FNN A;  2IVM A;  2E7W A;  4GYG A;  4UUV A;  4MNU A;  4GYI A;  4BYY A;  4L0Y B;  5H6R A;  1IXC A;  1WRJ A;  2GZW A;  4G94 A;  4ESF A;  1E17 A;  3ZMS A;  2PMU A;  4CDG A;  1EV7 A;  5E20 A;  3FF5 A;  5BPI A;  3U1D A;  4ZZL A;  1LNW A;  4N0B A;  2HFH A;  4L5I A;  4LD5 A;  1IRG A;  4M73 A;  4S04 A;  3GFJ A;  2Y75 A;  1F1Z A;  1V3F A;  4U7B A;  2GXB A;  1CGP A;  4HV5 A;  4G7H F;  4BHB A;  2LNB A;  3IL2 A;  1LEA A;  4B09 A;  4Y15 A;  4NB5 A;  1HST A;  1R1T A;  5FD6 A;  3E5Q A;  1FY7 A;  1KQ9 A;  4PDK A;  4L9N A;  4EGZ A;  5LEJ A;  3HSF A;  2K4B A;  3KLN A;  4A0X A;  5JFR A;  1KYZ A;  5HLH A;  2XKO A;  2QVO A;  3LA2 A;  2XKP A;  2ISY A;  4MHG A;  3JSP A;  1UST A;  4WX9 A;  2FA5 A;  2UWM A;  2Z3Y A;  3EET A;  3FHZ A;  1K78 B;  3KP6 A;  3LAJ A;  4OU0 A;  3F23 A;  2HYF A;  1OYW A;  3MQ0 A;  4EM0 B;  3LQR A;  2QEN A;  3MWM A;  4D0P A;  4FX4 A;  5F6F A;  2CYY A;  2FQ3 A;  1SFU A;  2YU3 A;  1W7P D;  1BIB A;  2E7X A;  1KGS A;  3GW2 A;  3GFI A;  3BRO A;  5CVI A;  4Q5S F;  3V4G A;  3TOA A;  2GXG A;  1JGS A;  1P6R A;  1IN6 A;  3MAJ A;  2UXX A;  3QRF F;  3E6C C;  3T5X A;  1SD7 A;  3N97 A;  3WTY C;  1WI9 A;  2CO5 A;  2OQG A;  1ZHF A;  3F21 A;  1J75 A;  2FE3 A;  2EFP A;  3E6M A;  1QZY A;  3GX4 X;  4N9H A;  2NRA C;  2O6G E;  4YIF A;  2F5F A;  3LA7 A;  4CO8 A;  2MBF A;  3WTT C;  2BBY A;  1LEB A;  5J8F A;  3ERE D;  3OV8 A;  4ASN A;  4DQ2 A;  4IRI A;  1O7F A;  3L09 A;  1CF7 A;  3GLX A;  4RGU A;  4P9F A;  3HHG A;  4Y17 A;  1O3R A;  3CUQ B;  2Z5U A;  1AWC A;  2O03 A;  3MZH A;  3IWF A;  1R00 A;  1LQ1 A;  1HKS A;  4RB2 C;  2DAO A;  2DT5 A;  4HLY A;  1YG2 A;  5KVR A;  2P5V A;  3C18 A;  2GAU A;  3WTW C;  1HW5 A;  3GVA A;  1UFM A;  1V4R A;  3KZZ A;  5L3C A;  3LA3 A;  5L3D A;  1Z91 A;  3R61 A;  2EFO A;  1KU9 A;  1G6N A;  5DV5 A;  2MD5 A;  2HOE A;  4I02 A;  4ZZD A;  1MD0 A;  3HRS A;  1R1V A;  3FXU A;  3FM3 A;  1BC7 C;  4OIN F;  5F1R A;  1D8J A;  3K0L A;  1TW2 A;  1MJB A;  1FBU A;  5LGU A;  1MJ9 A;  3ZN0 A;  1ZG1 A;  2A6H F;  2JTV A;  2CGP A;  1FSH A;  1W7P B;  4M9S A;  2H6C A;  3G73 A;  2D1H A;  3BOQ A;  2XRO A;  2HKX A;  3U2R A;  1QO0 D;  1D5V A;  1B1B A;  4R8H A;  3DP7 A;  3KP2 A;  2QZ8 A;  2EA2 A;  1MGT A;  5LRS A;  3B02 A;  5HOO A;  2L01 A;  3HOT A;  1ZAR A;  2V1U A;  3V7C A;  2WC2 A;  4ESJ A;  3FMQ A;  4U0W A;  2RC4 A;  1T39 A;  5DYM A;  1J2X A;  2HZT A;  1D8K A;  2O3F A;  3ISP A;  1U3E M;  4HLX A;  3I54 A;  2FNP A;  3TDU C;  3DEU A;  3RPQ A;  2VOP A;  1R58 A;  2IJL A;  1ZH5 A;  1FYK A;  3RJP A;  4XLN F;  1QZZ A;  2MH9 A;  2XIG A;  5K5O A;  2VE8 A;  2ZFW A;  3J80 Z;  3LAP A;  2A68 F;  2VN2 A;  1TTY A;  3I5U A;  4ENJ A;  1MDM B;  3GFM A;  3ZMV A;  3REO A;  5J8C A;  2QUF A;  3AAF A;  4L9V A;  3R0J A;  5ILS A;  5ICC A;  4HF0 A;  4Y13 A;  3T1B A;  2D45 A;  1IW7 F;  4UV8 A;  3NEU A;  3KP5 A;  2DQL A;  3ZN1 A;  2P8T A;  1BI2 A;  1BIA A;  2FBK A;  1IN8 A;  4HDU A;  3L9F A;  3BPX A;  3ZQ7 A;  1O57 A;  2H09 A;  4RGX A;  1UHM A;  1WQ2 A;  1I5Z A;  4BH9 A;  4BXU A;  1XSV A;  4YFX F;  2KKO A;  3LFK A;  1DP7 P;  2F5C A;  4RAY A;  2M45 A;  1J5Y A;  2NS0 A;  5CVJ A;  4DNC A;  2DFI A;  3FMR A;  2P5L C;  2GA2 A;  2GQQ A;  3VFZ A;  1U5T C;  1DPU A;  1JHH A;  1ZLK A;  4R1H A;  2WWY A;  4LB5 A;  2HS5 A;  4NHJ A;  4M72 A;  3DXJ F;  5D6F A;  4ZYD A;  2O8X A;  2HQN A;  4FHT A;  2M87 A;  2V6C A;  3T8T A;  1LB2 A;  2V9V A;  3F3X A;  1VTN C;  4AIJ A;  3WOD F;  2J5O A;  4CYD A;  4LK1 F;  3KP4 A;  1BC8 C;  3Q9S A;  4A0Z A;  3VEP A;  3MFK A;  5J6X A;  2RN7 A;  2XAS A;  4HA8 A;  5E1W A;  4EQQ A;  1W7P A;  2HDC A;  3GWZ A;  3EQL F;  5ICF A;  3KET A;  1FX7 A;  2B0L A;  3RTR A;  4WCG A;  1IF1 A;  1KQ8 A;  2ISZ A;  2RNJ A;  2XV4 S;  3K2Z A;  1D3Y A;  1PDN C;  1ZRC A;  4RGR A;  2Z99 A;  5ILV A;  3CDH A;  4HX7 A;  2EV0 A;  1TLH B;  4BHC A;  2A6E F;  4G7O F;  3V7S A;  3DV8 A;  2DK8 A;  2V79 A;  3CLO A;  2FEZ A;  3Q9V A;  4G8X A;  2FML A;  2KIM A;  5D5W B;  3ZMT A;  3TO7 A;  2W57 A;  2EK5 A;  2M5W A;  3TO6 A;  1NHA A;  4MTE A;  3ZMD A;  3KEQ A;  5TRD A;  1FC3 A;  2STW A;  3R6S A;  2BEO A;  1RZ4 A;  4YFN F;  3S2W A;  2VBX A;  5CVV A;  3GO5 A;  3MCZ A;  6PAX A;  3FMS A;  4EM1 A;  1TW3 A;  1ZGA A;  4HBL A;  4JQF A;  5E1Z B;  1I1S A;  4WF2 A;  2PMH A;  4P55 A;  3ABT A;  1FPQ A;  2MA3 A;  2L54 A;  3P9C A;  1RUN A;  2DBB A;  2MC3 A;  4YFK F;  3RYR A;  3GF2 A;  3WU1 B;  1Z6R A;  3K69 A;  1L0O C;  1S3J A;  2ZME A;  5HDG A;  1EH6 A;  1U5T A;  4LFU A;  2KJC A;  1IAW A;  5ILU A;  4HYE A;  2FBH A;  4HQE A;  3LST A;  2ESN A;  1I6X A;  5BQT A;  5FLX K;  1DPR A;  1S29 A;  2EJR A;  3E97 A;  3JAM K;  1J59 A;  2HQR A;  5K1Y A;  3DQV C;  1K79 A;  4FT8 A;  3HIF A;  1UCR A;  1XMA A;  1QBJ A;  5CYV A;  3LQQ A;  4IHS A;  5JVT A;  2NNY A;  1FLI A;  4A5N A;  4HF2 A;  3OOP A;  3I0T A;  4LK0 F;  3WG9 A;  3GXO A;  3C7J A;  5AIQ A;  3WTV C;  3KLO A;  4LJZ F;  2X4H A;  3MEX A;  5DD4 A;  2P7C B;  2GIV A;  1F9N A;  3F8F A;  5L3G A;  5K5R A;  2F5D A;  3COA C;  1XDU A;  4Q4Z F;  2VXZ A;  1EH7 A;  1P2F A;  1G3Y A;  3GZ5 A;  4A6E A;  3WE2 A;  1ODD A;  1FWZ A;  2BE5 F;  5BOX A;  5DEQ A;  1UHW A;  4LLL A;  1R5G A;  2QWW A;  1P4W A;  1PP8 F;  1HW1 A;  2EV5 A;  4U0V A;  5E17 F;  2DW4 A;  2DPU A;  2XUB A;  5CVU A;  3QP6 A;  2PG4 A;  2EFN A;  5HS9 A;  1B6A A;  5LGN A;  3H92 A;  4U7D A;  4RB0 A;  5FGM A;  2ZJ2 A;  3WGH A;  1SAX A;  3KP3 A;  1J9I A;  3QAH A;  1EH8 A;  4XSX F;  3TDZ C;  5AON A;  3BWG A;  1R5H A;  5E18 F;  3IRQ A;  4ENM A;  4IF4 A;  3BJA A;  1YYV A;  1XCV A;  5D5X B;  1XGS A;  2K02 A;  4ON0 A;  3T8R A;  4EJV A;  2XVC A;  4ENK A;  1LVA A;  2JZY A;  4XLP F;  3F8M A;  1YS7 A;  1IN5 A;  5DUK A;  2IP2 A;  3Q5F A;  4EJU A;  1F4K A;  1GXP A;  3TGN A;  1ZGJ A;  3E5U A;  2OA4 A;  4S05 A;  2KRF A;  1SFX A;  4HAM A;  5D5U B;  4Q48 A;  4BAY A;  2JPC A;  4KN4 X;  3K1M A;  2XRN A;  3RPU A;  5IT9 Z;  5ICG A;  1BM9 A;  1S7A A;  2XAH A;  1I27 A;  2VON A;  1R23 A;  4RB1 A;  4KYW A;  3G3Z A;  3RI4 A;  3FZV A;  3CUQ C;  3C3W A;  2RQP A;  5HLI A;  3SHF A;  3HTU A;  4K2E A;  1IXS B;  1R1U A;  2RGV A;  3BY6 A;  4N9I A;  2H27 A;  4A12 A;  3T0Y A;  3ROU A;  2ELH A;  3DFG A;  3JSO A;  1BN5 A;  4YII A;  2QBY B;  2KJB A;  1TQM A;  1FYM A;  3KP7 A;  2ETH A;  1ULY A;  1ON1 A;  5DDG A;  4KA4 A;  4M9X A;  1H9T A;  2P5K A;  4AIK A;  5AIP A;  1T2K A;  4A2U A;  2P6S A;  2OZ6 A;  1ZN2 A;  3QU3 A;  2FU4 A;  4OOI A;  4F7Z A;  1YIO A;  4AVP A;  4P9U A;  1I1G A;  4ZYE A;  3ZP5 A;  1K78 A;  3JTH A;  4HV6 A;  3GFL A;  4OMY A;  1KA8 A;  3EUH A;  4AD9 A;  4O6J A;  4GO1 A;  4G6D A;  4G6Q A;  1G4D A;  3F8N A;  5E8G A;  3RYP A;  2EFQ A;  3TO9 A;  2Z33 A;  2RDP A;  1W5S A;  2OD5 A;  2E1N A;  2GWR A;  5L3B A;  2DO7 A;  1GVJ A;  3WTU C;  5DCM B;  4A5M A;  3O6B B;  5CLS A;  4CHU A;  4QLC U;  4EJO A;  1IN4 A;  2D1V A;  2IA0 A;  4KDP A;  1MJA A;  1Z6T A;  5ERI A;  2FSW A;  1QGP A;  3KE2 A;  1STZ A;  1YO5 C;  4WXH A;  4ESB A;  4LG0 B;  1B4A A;  2ZNY A;  3FXR A;  1H9G A;  2PBI A;  2LF8 A;  3BPV A;  4MQV A;  2YX4 A;  1SD5 A;  2K27 A;  4IRG A;  2PLY A;  4WXD A;  2L4M A;  2LF7 A;  3HRU A;  3I59 B;  2Y48 A;  1TNT A;  3CUQ A;  2COM A;  1A04 A;  2HTJ A;  4UVA A;  2VE9 A;  1O3S A;  4RB3 C;  2KIF A;  4EJW A;  2EFW A;  1PUE E;  5ED4 A;  2F2E A;  3SFZ A;  3IRR A;  1R36 A;  1WKM A;  3C1D A;  2A69 F;  2XGX A;  1Q1H A;  3ABU A;  1K6O A;  3QU6 A;  1TQI A;  4WXC A;  3WTZ A;  1O7L A;  3CJN A;  2ZBK A;  2V1X A;  1S6L A;  3JW4 A;  3O3K A;  3U9G A;  1OR7 A;  1KU7 A;  5E8I A;  4UXN A;  1XSX A;  4HX8 A;  2VBW A;  2W84 A;  5DD8 A;  3R4K A;  4WWC A;  5TJJ A;  2QLZ A;  2D2W A;  2J5P A;  3FM5 A;  5A2Q Z;  4L9T A;  1SFE A;  2PN6 A;  4JK1 X;  3KZY A;  1O3T A;  4UV9 A;  4R79 A;  4ZYG A;  1C0W A;  5FO5 A;  5JI6 A;  4GCV A;  5LEK A;  1XSD A;  1YLF A;  2AXL A;  2EB7 A;  1G3T A;  1SD4 A;  1ZRF A;  4KIC A;  1BOA A;  2K4J A;  2BGC A;  4EVI A;  2FBI A;  1U2W A;  2WV0 A;  5H20 A;  1TQP A;  3JTG A;  2FNA A;  2H6B A;  4Q47 A;  1PP7 U;  1WSU A;  4KUM A;  2NAZ A;  3I53 A;  3V7R A;  4IJA A;  3VOE A;  4L5J A;  1OPC A;  2IT0 A;  5D6E A;  4BQA A;  3DF8 A;  1QPM A;  1RIO H;  4XSZ F;  4KMF A;  1YFH A;  2CQK A;  2CSO A;  1GHC A;  3P9I A;  5K5Q A;  3I64 A;  2PJP A;  1USS A;  5JHU A;  3J81 K;  1LDK B;  4EM2 A;  4KMU X;  1HBX G;  4Z2Y A;  3K1N A;  3WGG A;  2AS5 F;  4PGH A;  1OYI A;  4P5O A;  3HTS B;  4PGG A;  3H3Z A;  4M6Y A;  5LLQ A;  3J7A O;  5CVR A;  1MDM A;  3TKY A;  2RVC A;  2HGC A;  2Z9O A;  4IPA A;  1T6S A;  1ZYR F;  1AOY A;  2W24 A;  4UNO A;  4XBF A;  1HW2 A;  1J7K A;  4P96 A;  2X0L A;  4H0E A;  1KU3 A;  1FBQ A;  2L02 A;  5FLX Z;  3JAM Z;  3EYY A;  1CF7 B;  4BHP A;  2IW5 A;  1SMT A;  3ULQ B;  2H94 A;  4I09 A;  1TNS A;  2FMY A;  4ETS A;  2CW0 F;  1JHF A;  3W6J B;  2BYV E;  1Y0U A;  3KFW X;  5IT3 A;  2FF4 A;  2WTE A;  2VT2 A;  5HS8 A;  1T98 A;  1XN7 A;  3CTA A;  3TQN A;  4UVB A;  3DKW A;  4EJT A;  4UHT A;  2M8E A;  4HQM A;  3ML6 A;  3TOB A;  4CIC A;  4I01 A;  2ZCW A;  3BZ6 A;  1J0R A;  4HF1 A;  2EV6 A;  4HOB A;  4KIF A;  2OU2 A;  3R0A A;  3R60 A;  3RKW A;  4M6X A;  4YG2 F;  3RIR A;  5E1X A;  5D8K B;  2A07 F;  2ADU A;  2JSC A;  4G7Z F;  1ZG5 A;  2ZO4 A;  5F64 A;  2XHK A;  3MZY A;  1FT9 A;  2PEX A;  4NQW A;  4U88 A;  2ZNZ A;  1YW9 A;  1BI1 A;  4MGR A;  1U78 A;  2VOO A;  1IXR C;  1OKR A;  1U8R A;  2XAQ A;  4KT5 C;  1SMY F;  4KN7 X;  2EA4 A;  4GGG A;  2YX7 A;  2PFB A;  4E70 A;  1HKQ A;  4UVC A;  4RAZ A;  3SZT A;  5DCF A;  3GYH X;  3L00 A;  4HZF A;  3VB2 A;  3P7N A;  1RI7 A;  4I2O A;  2KIU A;  4A6D A;  5HVQ C;  3WTS C;  3L7W A;  4BNC A;  3I4P A;  1FYL A;  3F72 A;  4CZZ A;  3DPT A;  5LHI A;  4A0Y A;  1Z9C A;  3ZMU A;  2W25 A;  3P9K A;  2YR2 A;  2Q8K A;  2DTR A;  3HSR A;  3ECO A;  3IKT A;  3HRM A;  1F5T A;  1IN7 A;  4QWQ A;  2UXN A;  4OIR F;  4OIO F;  2VBY A;  2MH2 A;  1B59 A;  3QPT A;  3DPL C;  3CUO A;  5DUI A;  2R3S A;  2IRF G;  5HDK A;  3FX3 A;  3SXY A;  2RKH A;  2UZK A;  2QYO A;  3CO7 C;  2O0Y A;  2DLL A;  2G9W A;  3W6K B;  2LKP A;  4OIP F;  2JRT A;  4I98 B;  3V8J A;  2ZKZ A;  3RKY A;  2C6Y A;  2VT3 A;  3RKX A;  1G3W A;  1U6G A;  4HDV A;  1FP2 A;  1FSE A;  1FOK A;  2Q2E A;  4WK8 F;  2FXA A;  1JXS A;  1YTY A;  1L3L A;  1FZP B;  2LDU A;  4KIG A;  1YQA A;  4LMY A;  3O2P E;  1S7O A;  1XD7 A;  1BI3 A;  1YW7 A;  2TDX A;  3IC7 A;  5LHH A;  5FFZ A;  1T38 A;  2ZXJ A;  4U0Y A;  3M7G A;  1HKT A;  1P92 A;  3IKV A;  4RS8 A;  1MKM A;  3BJ6 A;  4PZJ A;  4AWX B;  1BJA A;  2VBZ A;  2DI3 A;  2STT A;  3BP8 A;  2BV6 A;  2OBP A;  3QOP A;  3LWF A;  3F22 A;  4O3M A;  4KIB A;  5IT9 K;  5BMZ A;  5D5V B;  4LLN A;  3VOD A;  2HYG D;  2EWN A;  4MEY F;  3GEZ A;  5FFX A;  2FRH A;  3KEO A;  5L3F A;  3K1P A;  4IXA A;  3WGI A;  3ZPL A;  1YS6 A;  4ZYH A;  3PQJ A;  1KU2 A;  3I71 A;  4LLG F;  4M74 A;  2A61 A;  3D0S A;  4LGW A;  1OYY A;  2HKO A;  1IUY A;  3HRT A;  5FD5 A;  1MZB A;  2Q0O A;  1X3U A;  4I0B A;  3V8L A;  3K9T A;  5ICE A;  1XB4 A;  4HW0 A;  3V8K A;  1W4M A;  3HSE A;  1ZAO A;  3IHU A;  5H6Q A;  4MQ9 F;  2MLK A;  3N4M A;  3E6D A;  2V1D A;  1XGM A;  4GXO A;  3F6V A;  5HS7 A;  1ZLJ A;  2DK5 A;  4LB6 B;  3WTX C;  3CO6 C;  2E1C A;  4IRH A;  4ENN A;  1HQC A;  5L3E A;  2R7F A;  1IRF A;  3F8C A;  4EV0 A;  1XDS A;  1XGO A;  5EEG A;  2M1B A;  2G7H A;  4HX4 A;  5LHG A;  1ONV A;  3FWE A;  2XAJ A;  4AIH A;  3ZMZ A;  1O3Q A;  3RDI A;  4L0Z B;  1DDN A;  2NYX A;  2CWE A;  2M30 A;  2VOD A;  1Z05 A;  3HOS A;  1JE8 A;  2DU9 A;  3SZP A;  1R7J A;  2CG4 A;  4O5V A;  1OMI A;  2L4A A;  2HEO A;  3BJO A;  2JT1 A;  4KNY A;  2PI0 A;  1IZ1 A;  3NQO A;  3HUG A;  2HTS A;  3J80 K;  2K7L A;  3WU0 A;  4L9J A;  4RGS A;  2O61 A;  2NNN A;  3M9A A;  3GZ6 A;  4MTD A;  5LGT A;  1BBY A;  4M9Z A;  5HDN A;  2F5E A;  3E6B A;  3HYI A;  2ZME B;  1LDD A;  1U5T B;  1E2X A;  4B8X A;  1KQ0 A;  2MLG A;  2PQ8 A;  3F8B A;  5D4S A;  2XAF A;  4IHT A;  5CJ9 A;  4OMZ A;  1GXQ A;  1T0F A;  2A5Y B;  1S8N A;  3B73 A;  2IA1 A;  2OQR A;  4MEX F;  5BS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...