3CDHA

Crystal structure of the marr family transcriptional regulator spo1453 from silicibacter pomeroyi dss-3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
134
Chain Sequence
DTFVSGYLLYLLAASSEEASAQFHDHIRAQGLRVPEWRVLACLVDNDAMMITRLAKLSLMEQSRMTRIVDQMDARGLVTRVARVRVRLTDDGRALAESLVASARAHETRLLSALADTDAARIKGVLRTLLDVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structure of the MarR family transcriptional regulator SPO1453 from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
total genus 42
structure length 134
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cdhA00
3QU6A 5LHHA 3LWFA 5JI6A 1XDUA 5ERIA 2D45A 5L3FA 4ESJA 4HX4A 4RB2C 2ETHA 3F8MA 5K1YA 2R3SA 2DLLA 3GFJA 5CLSA 3K2ZA 2LF8A 2X4HA 4A12A 1WWXA 3P9KA 2YX7A 1KYZA 1FY7A 2Q2EA 2LNBA 1HSJA 1XGMA 1LDJA 2M1BA 4M72A 4CICA 4OIQF 4YFKF 5LEKA 4A6EA 1I1GA 3RDIA 2NNNA 4LD5A 4BHCA 5D4RA 2DQLA 4EQQA 3HRUA 1EH7A 2ZXJA 4ENKA 2VODA 4G6QA 1JHHA 1T0FA 1PUEE 1MGTA 1YO5C 2KIMA 3DPLC 1U2WA 2ESNA 3BY6A 2OU2A 4KN7X 2E7XA 2ZBKA 3FMRA 2A07F 3I53A 3M1EA 4GXOA 5JFRA 4RAYA 2PJPA 4Y17A 1U78A 2FSWA 4WXHA 2K86A 4M71A 3BOQA 5CVVA 2RDPA 1ZGAA 4EM2A 1MJBA 3F8NA 4NQWA 4WK8F 2C6YA 1P6RA 1LEAA 3HRMA 2L01A 2ZKZA 2MLGA 2DO7A 5K5OA 2M8EA 2PLYA 3DEUA 3E5XA 3DP7A 3F8BA 4MTDA 4A6DA 3IWZA 2DT5A 1G4DA 1IF1A 2H09A 2QUFA 5EEGA 3SQNA 5CVIA 5E8GA 1PP7U 4U0WA 2KKOA 3GFIA 1IRGA 2EFPA 2LSOA 3O3KA 3P9IA 1IN7A 3GLXA 3WTVC 3CO7C 2K4JA 2CO5A 1J7KA 4MTEA 1FZPB 5FGMA 2RVCA 2QQBA 2DQRA 4AIJA 2R7FA 4I02A 3WTXC 2CG4A 2F5DA 5D8KB 1FLIA 4NB5A 3NEUA 1O3SA 3WGHA 1O3RA 1ZG3A 3KETA 3MQ0A 4KICA 5DEQA 1EH8A 1W7PA 3V8JA 2M5WA 5DCFA 3F6VA 1Z6RA 4P9UA 3I5UA 4HW0A 3AAFA 4LJZF 2IP2A 4ENMA 2XAGA 1RUOA 1FBUA 5ILVA 2MH2A 3MZYA 5CJ9A 3C7JA 4RGXA 4UVBA 4DQ2A 2QYOA 2ACJA 3BZ6A 3LSTA 5D6EA 4A5MA 2HFHA 1W7PD 5FD6A 1U5TB 2IRFG 4U0VA 1YW9A 1G3SA 1U5TA 2PI0A 4BNCA 2O3FA 1STZA 2QENA 2A61A 4EJTA 2MH9A 4FHTA 2EV5A 5HS8A 3CUOA 1L0OC 3BJOA 2CW0F 2HZTA 1PDNC 2EFWA 2M87A 2P7CB 5CVUA 3BROA 3JW4A 4HLXA 4OMYA 1UHMA 2GAUA 3CO6C 3FMSA 2P8TA 2XKOA 3KLNA 4PGHA 4UVCA 5F64A 3SXYA 1OYYA 2FNPA 3BJ6A 2O61A 4IRGA 4MEYF 5FB2A 3QOPA 4M9SA 4CHUA 1BBYA 2L4MA 3PFIA 3R61A 1D8JA 4BH9A 1GVJA 1BC8C 2STWA 1FNNA 1HBXG 1EH6A 1YS7A 1SD6A 1FPQA 1BM9A 2PMUA 1FC3A 3M7GA 3O2PE 1ZN2A 1LB2A 4L0YB 3RJPA 2STTA 2RGVA 4UHTA 3LA3A 4MNUA 1HSTA 1TQPA 4EM0B 1KQ9A 4LB6B 2XHKA 2OQRA 3F21A 5ICGA 1IN4A 2JPCA 1SFEA 2Y0MA 4KA4A 5FD5A 3CJNA 1HQCA 4ZZLA 1WQ2A 2BBYA 2OBPA 2ISYA 4MQVA 3I59B 2V1XA 4KNYA 1FP1D 4M73A 3I59A 3D0SA 4UVAA 1FYKA 5IT9K 1TQIA 2XKPA 1MDMB 3WU1B 2QQAA 1MDMA 1ZARA 1KQ0A 2CYYA 1ZGJA 4M9ZA 1I6XA 4XBFA 1U3EM 3TGNA 3VFZA 4JBAA 3QPTA 2Y75A 2YR2A 1ZRFA 1ODDA 1W4MA 3LAPA 3F8CA 3IC7A 1B1BA 3WODF 2ISZA 2BEOA 4G6DA 3IKTA 2FMYA 4HDUA 1ON1A 2WWYA 1IN6A 2FQ3A 4DNCA 4OINF 5DDGA 4M74A 4OOIA 2V79A 1U5TC 4ESBA 1ZLKA 2VOPA 5E20A 1ZG1A 4OIPF 3GZ6A 4D0PA 2WV0A 3IWFA 1IAWA 4HAMA 1S29A 4HYEA 1G3WA 5DUIA 1R7JA 2HQNA 2NNYA 1KGSA 2XUBA 3J80Z 3KCCA 2M45A 2TDXA 2P4WA 2H6CA 5ICFA 1SD4A 5LRRA 2VC1A 1T39A 3U2RA 4UUVA 5E18F 5HDGA 1MD0A 1BI2A 3ZP5A 2DPDA 1QGPA 4EGZA 4G8XA 2HTJA 2K02A 4XLPF 1G6NA 1I5ZA 4Q4ZF 3ERED 3ZN1A 1REPC 1BI0A 4JK1X 5H20A 1T2KA 2XV4S 5E17F 1XN7A 1O7FA 3LQRA 3U1DA 4HQMA 1RNLA 4CZZA 2HS5A 1TBXA 2EV0A 3RKXA 4HV5A 3C1DA 3KEQA 1E2XA 1J2XA 1KA8A 1H9GA 3TDUC 5LHIA 2P5LC 5LGUA 2FBIA 2IJLA 2DBBA 2LF7A 5ICEA 3E5QA 4HV6A 2ZMEB 2ZJ2A 2OQGA 3J81Z 3GXOA 1B9MA 4GGGA 4F7ZA 4LLGF 2EJRA 4BXUA 5D6FA 4L0ZB 1TQMA 2LKPA 5BQTA 2NRAC 2KJBA 4PZJA 3K1NA 4AIHA 2DW4A 3V8LA 5DCMB 1XSVA 4ENNA 2RN7A 5ICCA 1IRFA 3ZPLA 2RC4A 4NHJA 1BI3A 1V4RA 3Q5FA 1QO0D 1F5TA 4U7BA 2QVOA 2RV8A 3KZYA 1U8RA 2FEZA 2L02A 1DUXC 1A04A 5J8FA 2CGPA 3G3ZA 2QWWA 3E6MA 5FFZA 1C0WA 1KU3A 3FZVA 4ETSA 5HLGA 3HSFA 5FFXA 5LGTA 4I7HA 1USSA 1R1VA 2XIGA 1KU7A 1MZBA 1TNTA 2ADUA 3FHZA 2WC2A 2HKOA 2VN2A 4WX9A 2L3DA 1ZH5A 2O8XA 5L3DA 3T8RA 4IF4A 2W25A 3HOTA 1Z05A 2V1DA 4I09A 2FA5A 3DPTA 3EYYA 1ON2A 2MBFA 1T6SA 2QLZA 2VBYA 3HRSA 2VT2A 5LEJA 3G73A 4TV7A 2ZO4A 3E6BA 4RS8A 3V7SA 1RUNA 3R6SA 1W5SA 3H92A 1I1SA 5AIPA 3CTAA 2EFNA 2P6TA 4XLNF 5D8LB 1TW2A 2YSRA 3WE3A 3J80K 3BDDA 4U7DA 3SZTA 1Z7UA 3M8EA 1XCVA 2UXNA 3IL2A 3QRFF 4KT5C 2FMLA 2AS5F 3FWEA 4I0BA 3OV8A 1B59A 2H94A 3RIRA 4ENJA 4ON0A 2J5OA 2AXLA 3GW2A 1K79A 2IW5A 2VXZA 4LK0F 4A5NA 3WTSC 2BYVE 1WI9A 1K7AA 2XVCA 1OKRA 1WKMA 2L4AA 5A2QZ 2A6EF 1K78B 1LJ9A 5KK1A 3MFKA 3E3VA 1K78A 2JSCA 3RTRA 5L3GA 1IN5A 1D8KA 3VOEA 1AWCA 2UZKA 2IT0A 3LAJA 2GWRA 3REOA 5J6XA 3T0YA 4ZZDA 2ZFWA 3V8KA 4WXDA 2V9VA 4XRFA 3JAMZ 2P7VB 4UV9A 3WGGA 2IA1A 3TO9A 5D5XB 5BMZA 1OMIA 5D5WB 4P9FA 3ZMSA 2LDUA 3JTHA 3D5LA 3MZHA 3RI4A 2D1HA 4RB3C 1RIOH 1OYWA 1XMKA 1DPUA 3HIFA 4N9IA 1S8NA 3FM3A 1SMTA 3HSRA 2NS0A 1YIOA 1Z91A 3E6CC 1L3LA 4UNOA 1BC7C 2XASA 2QQ9A 3EYIA 2Q0OA 3I0TA 3ABTA 2OAZA 2DAOA 3K69A 2FBHA 1TTYA 4IRHA 1DPRA 4M6XA 2V6CA 1G3YA 1XGOA 4QWQA 1FSEA 1QBJA 2V1UA 1FYLA 1UHWA 2OA4A 4N0BA 4EJVA 3M9AA 5BPDA 1FBSA 2PN6A 1B6AA 2KIFA 1TW3A 1ZLJA 4HBLA 3KP4A 2G9WA 1O3TA 2A69F 4ASNA 3GFLA 5HLHA 3ZN0A 1YS6A 1O57A 2QBYB 5HS9A 1F1ZA 2F5CA 2QBYA 5DYMA 1D5VA 2CFXA 3HUGA 3FX3A 1Z1DA 1G3TA 4FT8A 3WTYC 2K27A 1BIAA 3Q9SA 4QLCU 3RKWA 3QAHA 2FE3A 2QM3A 2HYFA 1R58A 3W6KB 4MQ9F 2GQQA 1E17A 3LA7A 3FXQA 3GF2A 4EJOA 1Y0UA 5JHUA 5LGNA 4AWXB 3F22A 4K2EA 4G9YA 4MGRA 4EVIA 2VBWA 1SFXA 3COAC 3TO7A 3KE2A 3HYIA 4HX8A 4L9JA 5AONA 4EJUA 2CSOA 2A5YB 5DUKA 2DK8A 4XSZF 3Q9VA 4Z2YA 5D5VB 5L3BA 3GUDA 2RKHA 2HQRA 1ZAOA 2XAJA 3I58A 2MLKA 1JXSA 4OIOF 4Q5SF 4EV0A 5HS7A 3I4PA 1AOYA 4G7ZF 3ML6A 4RAZA 2VE8A 4CYDA 5KVRA 1J5YA 2CWEA 4OMZA 4KMFA 2EK5A 5H6QA 1KYWA 3FM5A 3JAMK 1S7AA 2ESHA 1CGPA 3B73A 2FF4A 1ZYRF 2A3SA 4RB1A 4P55A 3EQLF 2EB7A 1KU2A 2OZ6A 4A0XA 3HTSB 3ISPA 2XAFA 1B9NA 5E1WA 2F5EA 2GXBA 3MCZA 4YIIA 3H3ZA 4G94A 2RQPA 3BP8A 3R4KA 4AIKA 2GA2A 4P96A 2ZNZA 1HXDA 4GYIA 1R5GA 1O3QA 4IXAA 3WTUC 1FBQA 3CUQC 3S2WA 5D5UB 1HKQA 4LFUA 4G7HF 4FX0A 4WF2A 4MHGA 2Q8KA 2UXXA 3V7RA 5CVJA 3P7NA 4CGZA 1RZ4A 4S04A 2PEXA 1YTYA 2JRTA 2K7LA 3KP6A 4LB5A 1USTA 3BPVA 4BQAA 1FX7A 2VBXA 4O3MA 3GZ5A 1DP7P 1CF7B 4U88A 3DF8A 3DKWA 1CF7A 3K9TA 3HHGA 2H27A 3ECOA 3SFZA 4HQEA 1YYVA 3ZMDA 3GFMA 3TQNA 5JR3A 3DXJF 1QZYA 1R1UA 3DV8A 5H6RA 1JGSA 3VEPA 3QU3A 1GXQA 2ZMEA 1X3UA 1F9NA 1WSUA 2A6HF 1FP2A 3R0AA 2FBKA 2EV6A 2IVMA 3U9GA 5BS6A 5L3CA 3I64A 3RPQA 1P4XA 4L18B 3F23A 2ZNYA 1WRJA 1BOAA 1SFUA 1SD5A 3BWGA 5DCMA 4HOBA 1B4AA 1BJAA 4RGSA 4L9VA 3B02A 1K6OA 3ZMUA 1QQIA 4IJAA 1FYMA 3SHFA 1R36A 4ZYDA 1QNTA 4AVPA 4A2UA 1YG2A 1RI7A 2XAQA 1J9IA 4KIBA 4PCQA 1XGSA 2HR3A 4PDKA 2DI3A 4BHPA 4I01A 4HLYA 1MKMA 1LQ1A 2MC3A 5DD4A 4YFXF 1TNSA 3R0JA 1YQAA 4IHTA 1XD7A 1IUYA 1OR7A 3TO6A 3L09A 3I54A 4BAYA 4YG2F 3WE2A 1PP8F 3WTTC 3HTUA 2Y48A 5FO5A 2Z9OA 3WGIA 1OPCA 4G7OF 5HVQC 1FOKA 4EGYA 2MA3A 4HA8A 5DD8A 1IZ1A 1LEBA 3EETA 4I98B 3TOAA 2WTEA 3HRTA 1D3YA 2NYXA 1T98A 5K5RA 4E70A 2HYGD 3GO5A 1ZG5A 2FRHA 3ZMTA 1XB4A 3EUHA 3GEZA 4LLNA 1MJ9A 2NAZA 5L3EA 3V7CA 1J0RA 4WCGA 1Q1HA 1P2FA 2Z3YA 4KN4X 1YW8A 1R00A 3KLOA 3L2CA 3ABUA 4EJWA 3ECHA 2GXGA 4FX4A 2EFOA 4B8XA 1LVAA 1HW2A 3DQVC 1IXRC 3ZMZA 5E1ZB 4UV8A 4HF0A 1JHFA 5FLXZ 1FWZA 2YPRA 2IA0A 2PMHA 2ZCWA 5BPIA 4LK1F 3KP2A 3NQOA 2MD5A 5CYVA 3WG9A 4KUMA 1GXPA 1ZHFA 4L5JA 4OIRF 5IT9Z 2JT1A 4LGWA 3F3XA 3GVAA 5IT3A 3IKVA 5ILUA 4R79A 4UXNA 2JZYA 1ZRDA 5HLIA 1IW7F 2EA2A 1W7PB 4GCVA 1J59A 3H3UA 2HKXA 3V4GA 3J81K 2JTVA 4BYYA 3KP5A 4BHBA 3P9CA 1LDKB 2F5FA 1NHAA 1IXCA 2O0YA 5JVTA 2IA2A 1V3FA 5E1XA 4GO1A 2P5VA 4IHSA 2COMA 3FXUA 2HEOA 4HF1A 2VT3A 3KEOA 3LA2A 4KMUX 3T1BA 2FU4A 4R1HA 3FF5A 5ED4A 4H0EA 3TOBA 2O6GE 4LMYA 4M6YA 3HOSA 2GZWA 3FXRA 4KDPA 1P4AA 2JPBA 4U0YA 1YFHA 3CUQB 4L5IA 4CDGA 3CLOA 1HKSA 1XSXA 3CUQA 3ZMVA 4O5VA 3TDZC 3T5XA 1H0MA 2YX4A 2RNJA 3GYHX 2X0LA 2XROA 2P6SA 5HOOA 3F8FA 3QP5A 3W6JB 3F6OA 3O6BB 5HDNA 1S3JA 3HHHA 3WTWC 2EFQA 1O7LA 1S7OA 4YIFA 2P5KA 4RGUA 5EEHA 4S05A 1EV7A 1H9TA 3L9FA 1P92A 1KQ8A 2HDCA 3ELKA 2W85A 2HOEA 3KP3A 5J8CA 1R23A 1FT9A 2XGXA 3QPHA 4GYGA 3MWMA 1VTNC 3BPXA 5F1RA 1BIBA 2D1VA 3RYPA 3ULQB 1XGNA 2G7UA 4HZFA 3GX4X 2H6BA 1R22A 2DFIA 1XMAA 4A0YA 1F4KA 2DU9A 4R8HA 2XRNA 3EDPA 4HX7A 1XDSA 5DV5A 4P5OA 3BJAA 4L9TA 3DFGA 4CO8A 1SAXA 5LHGA 4L9NA 4LLLA 3C3WA 1P4WA 4EMSA 3K0LA 1SD7A 4WXCA 4O6JA 4IVNA 2F2EA 3JSOA 2VC0A 4M9XA 2VOOA 2J5PA 4A0ZA 2Z5UA 4RGRA 1FSHA 4JQFA 2YU3A 3NRVA 2XAHA 4KYWA 1HW1A 4Q47A 2KRFA 5HDKA 3WU0A 2KJCA 3RYRA 3RKYA 4MEXF 1XCBA 5FLXK 5K5QA 2BV6A 3MAJA 3HSEA 5A2QK 2W84A 4ESFA 4HDVA 3SZPA 1SMYF 2B0LA 2BE5F 1J75A 4HF2A 2E7WA 4I2OA 1KU9A 4KIGA 3L7WA 1ULYA 2L54A 3CDHA 1TLHB 4ZYHA 2E1NA 3PQJA 4IPAA 3TKYA 1YLFA 3RPUA 1BI1A 3GWZA 4KIFA 1IXSB 1LDDA 5TJJA 2GA1A 2M30A 1UB9A 3R60A 1GHCA 4OU0A 3J7AO 1Z6TA 3E6DA 3JSPA 4AD9A 2E1CA 1U6GA 4WWCA 4LG0B 2K4BA 5TRDA 4CXFA 4LG0A 2DPUA 1UFMA 4ZYGA 2FXAA 1XSDA 3LFKA 1Z9CA 2BGCA 3C18A 3IRQA 3T8TA 3M8FA 5F6FA 1ZREA 3QP6A 1OYIA 3VB2A 5BOXA 3JTGA 1R1TA 4EM1A 3K1PA 2UWMA 1HW5A 2DK5A 2OZUA 5D4SA 5LBQA 2FNAA 1I27A 1LNWA 5AIQA 3KZZA 2VONA 2Z99A 1UCRA 3MEXA 2VE9A 3N4MA 3ZQ7A 2CQKA 5E8IA 1R5HA 4YFNF 4N9HA 1ZRCA 1YW7A 1QPMA 2PQ8A 1HKTA 3WTZA 3I71A 3N97A 2DTRA 3IRRA 1W5TA 4KFCA 3ROUA 2KIUA 4Q48A 4ZYEA 5CVRA 2PFBA 2Z33A 2HGCA 1BN5A 2W24A 2FOKA 3L00A 4PGGA 2G7HA 1IN8A 2ELHA 2GIVA 1S6LA 2PG4A 3OOPA 3PQKA 1QZZA 2D2WA 4I0AA 6PAXA 2HTSA 3LQQA 4XSXF 3FMQA 2W57A 4B09A 2EWNA 3KFWX 3IHUA 2IPQX 5LRSA 4Y15A 1JE8A 2EA4A 4IRIA 5LLQA 2OD5A 4Y13A 2HWVA 1ONVA 3F72A 3VODA 2PBIA 1T38A 2R7DA 5ILSA 3E97A 1MJAA 2VBZA 2O03A 2A68F 3K1MA 3E5UA 3KP7A 4RB0A 1DDNA 4ZH4F 2QZ8A
chains in the Genus database with same CATH superfamily
1S72I 3QU6A 5LHHA 3JRAA 3LWFA 1RR8C 5JI6A 1A6IA 1XDUA 1FOWA 5ERIA 1OQYA 5L3FA 2D45A 4ESJA 4HX4A 4RB2C 2ETHA 3IH2A 3F8MA 2R7VA 5K1YA 2R3SA 2K5CA 1QA6A 2DLLA 4Y4RA 3GFJA 5GAEJ 4QIWN 5CLSA 3OSFA 2Y69H 3K2ZA 1WJFA 2LF8A 2X4HA 4A12A 1WWXA 1MBKA 2Q2EB 3P9KA 3CMEI 3CCMI 2YX7A 3EPZA 1N25A 1UG2A 4YELA 1KYZA 1FY7A 2Q2EA 5EDNA 1GDTA 4GFBA 1LFBA 1ZK8A 3PFYA 2MABA 2LNBA 3FHNA 4C3JJ 4FTHA 1X1CA 2L9RA 3WG7H 1HSJA 1XGMA 1LDJA 1DGWY 2M1BA 3ZQHA 3BTJA 3A0BC 5TISC 1XG1A 3QPLA 2DA2A 4AYBN 3FIWA 3OYLA 1I3QJ 1U0JA 3Q0VA 2L0KA 4M72A 4CICA 5CKTA 1JT0A 3CC4I 4OIQF 4YFKF 1YX3A 5LEKA 4A6EA 1I1GA 3RDIA 2NNNA 2UUZA 4E7JA 4LD5A 4BHCA 2VJ4A 5D4RA 2DQLA 1A6QA 2XF6A 3HRUA 4EQQA 1EH7A 2ZXJA 4ENKA 2VODA 2KRCA 4G6QA 1JHHA 1T0FA 1PUEE 1MGTA 1XPXA 3TW7A 1YO5C 2KIMA 4DYCA 4HSTA 3SJMA 1FTTA 3DPLC 1U2WA 2DMTA 1ETYA 2ESNA 3BY6A 3MMYB 3FXKA 1G8XA 2OU2A 2X48A 1TT5B 1VQKI 4KN7X 3KYCB 2WADA 3IH3A 2E7XA 2ZBKA 1HCRA 3A1YA 1I6HJ 3FMRA 2A07F 3I53A 3DU5A 4BE2A 2JMWA 4IEJA 1R49A 3M1EA 3HC7A 4GXOA 5JFRA 3PL8A 4RAYA 4RM3A 1Z7LA 2PJPA 4Y17A 3RKQA 1U78A 2DOFA 2JUCA 2FSWA 4WXHA 4ITVA 3J7ZI 2K86A 1WGXA 5J1YA 4M71A 1OLTA 2RNGA 3BOQA 2E36A 4BE1A 2X85A 4NQWB 5CVVA 2RDPA 1ZGAA 4EM2A 1MJBA 3F8NA 4NQWA 4WK8F 1MSEC 1YJ9I 2C6YA 1P6RA 1LEAA 3HRMA 2EZHA 2L01A 2ZKZA 1WH7A 2MLGA 2DO7A 5K5OA 2M8EA 2WA0A 2PLYA 3FKJA 1JTYA 2K9NA 3PSIA 1XTAA 1ZTRA 1MMGA 3DEUA 3E5XA 3OYIA 3FDYA 3DP7A 4S0HB 1POGA 1X3WB 3F8BA 4MTDA 4Y52J 4A6DA 3IWZA 2DT5A 3CCYA 3PO3J 2BY3A 5KNLA 1G4DA 3DWLE 4H4KC 5CPRB 1IF1A 2H09A 2EPFA 2QUFA 5EEGA 3SQNA 4B3AA 3PM1A 4XLCA 3ZQIA 5CVIA 5E8GA 4C30A 1PP7U 2EIMH 4U0WA 2KKOA 4B4CA 1W5CC 3GFIA 2AQEA 1R4MB 3VYTB 1IRGA 1ZGWA 1W1WE 2EFPA 4A3MJ 2LSOA 1UAAA 4XKCA 1E0EA 3JRDA 1VQ5I 4C3IJ 3O3KA 4XR6A 3P9IA 4MFEA 2OC6A 1IN7A 2LY1A 3GLXA 4FETA 1EJ9A 3WTVC 3J7YJ 2WAQA 3CO7C 2K4JA 2MG4A 2CO5A 1J7KA 1LFPA 4MTEA 4A3FJ 1ZKGA 1FZPB 2KPMA 3GBGA 3BZCA 5FGMA 4XK4A 3Q0UA 1ZR4A 2RVCA 3ABLH 2QQBA 2DQRA 4D7NA 4AIJA 1JJ6C 2R7FA 4AUXA 4I02A 3WTXC 1ETVA 1OCZH 4BUPA 1IG7A 2CG4A 4A3CJ 2F5DA 5GTIC 2QEXI 1R4NB 5D8KB 1FLIA 4PSXA 4NB5A 2OPTA 1OCPA 3NEUA 2M4KA 1O3SA 3WGHA 1O3RA 1ZG3A 3KETA 3MQ0A 4KICA 2X6WA 5DEQA 1EH8A 1Y0NA 1W7PA 3SZGA 2LFBA 5KHDA 3ZQLA 4BL0B 3V8JA 2M5WA 5DCFA 4XRSG 3F6VA 1DU6A 1Z6RA 3I5UA 4P9UA 2XF5A 4HW0A 3AAFA 1M1EB 1IV8A 4LJZF 5F0CA 2IP2A 4ENMA 3BG3A 5CQGA 2XAGA 1MSFC 1RUOA 4BS9A 1FBUA 5ILVA 2MH2A 3MZYA 5CJ9A 5DM7F 3C7JA 4RGXA 4UVBA 1Z67A 5KAFC 4DQ2A 4UB6C 2QYOA 5DS9A 2ACJA 3BZ6A 3LSTA 5D6EA 1XX5A 4A5MA 2HNHA 2HFHA 5J1RA 3IUOA 1W7PD 2CRGA 1HLVA 3K2AA 5FD6A 5FKKA 5JVGF 1U5TB 2IRFG 3BR6A 4U0VA 1YW9A 1G3SA 1U5TA 4BQNA 4F92B 3S1QJ 2PI0A 4BNCA 2NVQJ 3A4CA 2DODA 5IOYA 2AQFA 2O3FA 1STZA 2QENA 4LG3A 2A61A 4CH7A 2MH9A 4EJTA 4FHTA 3CJRB 2NS8A 2EV5A 4I76A 5HS8A 3CUOA 1L0OC 3BJOA 2CW0F 2X1DA 2HZTA 1PDNC 2EFWA 1YIJI 2X1CA 2JN6A 2M87A 3BG6A 2P7CB 2JRMA 5E3NA 5CVUA 3CC2I 1BOBA 4ANJA 2HOAA 3BROA 3RZOJ 4OAZA 4RMNA 4ZTFA 3JW4A 4HLXA 2EINH 2OF7A 1WCMJ 4OMYA 5EG0B 2Z2SB 1UHMA 2GAUA 4PFOA 3CO6C 2DJNA 5EG0A 1HC8A 3FMSA 2P8TA 2XKOA 3KLNA 4PGHA 2LLKA 4UVCA 4BXXJ 5F64A 3BLYA 3SXYA 1OYYA 2FNPA 1H8AC 3BJ6A 2O61A 4IRGA 4MEYF 5FB2A 2GXAA 3JRBA 3KYLA 2R7QA 1OFCX 2VUMJ 3QOPA 4M9SA 5J47A 1V5FA 4CHUA 1BBYA 3HPGA 2L4MA 3H9JA 3PFIA 3R61A 3FK6A 1D8JA 1K6YA 1QVUA 4BH9A 1GVJA 2VL8A 1TWGJ 1BC8C 3BR3A 3M1CA 1T8IA 2STWA 1FNNA 1HBXG 1GLNA 5FKOA 5J3LA 4RAFA 2H1LA 2F6CA 1EH6A 1YS7A 3C2BA 1TWFJ 1SD6A 2LREA 4RLFA 3K4NA 1FPQA 3M8JA 4IQ4A 1BM9A 2LR8A 2PMUA 1FC3A 3CP2A 3M7GA 3K70D 2DTZA 2OUMA 5FLMJ 3M3YJ 3O2PE 3JRFA 5IPAA 1ZN2A 3HJEA 1LB2A 4F52A 1V55H 4C2UA 4PK4A 4L0YB 4I99C 3RJPA 2STTA 2RGVA 3E0JB 4UHTA 5GPCA 3LA3A 2HVQA 4MNUA 1HSTA 1TQPA 3DU6A 4HSRA 4EM0B 1KQ9A 3L2WA 2DFFA 2Q1ZB 4FQGA 4LB6B 2XHKA 2OQRA 3F21A 5ICGA 1IN4A 2JPCA 1SFEA 4Y7NJ 2Y0MA 1W36D 1TZLA 1UG0A 4KA4A 5FD5A 3CJNA 4IHYA 4M3GA 1HQCA 4ZZLA 4RLQA 1WQ2A 3S15J 2BBYA 2E1MB 3OS2A 4XRMA 4JYKA 3RZDJ 1QZEA 4MFDA 4ZDOA 2OBPA 1R6RA 2ISYA 4MQVA 4BJ5C 3I59B 2MD0A 4XN3A 2V1XA 2JWTA 4KNYA 3PIOF 3CCLI 1FP1D 4M73A 3I59A 3CF5F 3D0SA 5IYCJ 2M9HA 3OYDA 3QYEA 4UVAA 1FYKA 2HZDA 2QF7A 5IT9K 1JUSA 3TMOA 2XKPA 1TQIA 2DT6A 3PO2J 2MSYA 1MDMB 4XICA 2V9PA 2XGDA 2QQAA 4D5FA 3WU1B 5F27A 1ZARA 1MDMA 3LFUA 4AM3A 2A5WA 2OJED 1KQ0A 2CYYA 1ZGJA 4L5EA 1I6XA 2DA3A 3BR0A 4JX6A 4M9ZA 3NAUA 4XBFA 2EZLA 1U3EM 3CQZJ 2AHQA 2W00A 2O8KA 1JTXA 4BBRJ 3TGNA 3VFZA 2E5ZA 4JBAA 3KIOA 3QPTA 2Y75A 2HXIA 2YR2A 2R5ZB 1ZRFA 2ZC2A 1ODDA 1W4MA 3LAPA 2R5ZA 2DJIA 3F8CA 1PVEA 3IC7A 4IHVA 3H0DA 3DBHB 1B1BA 1CQTA 3IV5A 4FE7A 3WODF 2ISZA 2LKSA 2BEOA 1FJLA 2DYRH 4G6DA 2WB1N 3IKTA 2FMYA 4M3BA 4HDUA 1ON1A 4CA0A 3HG9A 3S3OA 2WWYA 1IN6A 2FQ3A 4DNCA 4OINF 5DDGA 4M74A 4XNFA 2V7FA 4OOIA 4BE0A 3S1MJ 4X6AJ 2V79A 3RSNA 1U5TC 2HVRA 4NC6A 4ESBA 5F0HA 4XLEA 1ZLKA 2VOPA 5E20A 5CQEA 3ZR8X 1ZG1A 4OIPF 1UMQA 9ANTA 3K4MA 3ASNH 4XKBA 4D0PA 3GZ6A 2WV0A 3IWFA 2W82A 3ONQA 1IAWA 4BDZA 2WB1A 4HAMA 1WJDA 4E6KG 2VASA 1S29A 3FXJA 4HYEA 4M3DA 1JGGA 4JX5A 1G3WA 2PMZN 3ASOH 3SDGA 5DUIA 1GV5A 3OYNA 1R7JA 2HQNA 2NNYA 1KGSA 1WJBA 2G0EA 3HGGA 1B8IA 2XUBA 3L1PA 1ETXA 3J80Z 3KCCA 2M45A 2TDXA 2M0MA 2P4WA 5J1UA 1W0UA 2H6CA 2XB0X 5ICFA 1SD4A 4ZC3A 2K85A 2DYSH 4UUTA 5LRRA 2VC1A 1T39A 3G2BA 3U2RA 1MH3A 4UUVA 5E18F 5HDGA 3JREA 2F5VA 1MD0A 4G6TB 4YEJA 1BI2A 1Q1VA 2IAIA 2FQ4A 3ZP5A 3BTIA 3DTEA 2DPDA 2XPUA 4UB8C 2Y30A 1QGPA 4EGZA 4G8XA 5K7HA 2IGOA 2WAEA 5GPAA 3OWTA 2HTJA 3QOEA 2K02A 2ME6A 1LVKA 4XLPF 2BW3B 1JKQC 1G6NA 2PJRB 1I5ZA 3I55I 4M3FA 2BW3A 4Q4ZF 3K70C 3ERED 3ZN1A 5J40A 3OYGA 1REPC 2PJRA 1BI0A 4JK1X 1VQ7I 5H20A 3TEDA 1T2KA 2EIJH 2XV4S 4DW6A 5E17F 1XMXA 2ZXWH 3SFIA 1XN7A 1O7FA 3HPHA 3LQRA 1QVTA 3GCMA 3U1DA 4HQMA 1RNLA 2CQ7A 4CZZA 4D7MA 2HS5A 1TBXA 2EV0A 3RKXA 4U87A 2DXIA 4HV5A 3C1DA 1Z21A 4UY8I 3KEQA 1E2XA 2ZXHA 1J2XA 1KA8A 1H9GA 3FKIJ 3TDUC 2H8RA 5LHIA 2P5LC 1W36C 5LGUA 1OCRH 2FBIA 3H9GA 2IJLA 2A05A 2DBBA 4E7SA 3JRCA 2LF7A 5ICEA 1VQ9I 1LKXA 4AVZA 1IV6A 2GM4A 4LITA 2EBIA 3E5QA 4HV6A 1EF4A 2ZMEB 2NVUB 2ZJ2A 2BY2A 4MLOA 2OQGA 3J81Z 3CDLA 1B9MA 3GXOA 3MN2A 4GGGA 4F7ZA 3OYHA 4LLGF 2LD5A 2EJRA 4BXUA 5D6FA 4L0ZB 1TQMA 2LKPA 2KDOA 4DBRA 5BQTA 2NRAC 2X1EA 2IEKA 2KJBA 4PZJA 1X4PA 1X19A 3K1NA 4AIHA 1MMAA 1N77A 2E1MC 1ETOA 2DW4A 3V8LA 3W2AA 2Z1DA 4J00A 4PJNA 3OL4A 5DCMB 3H35A 4X1EA 1XSVA 4ENNA 4DGWB 2DDAA 2LH9A 2RN7A 2CV1A 4B1RA 1MNMC 3QPSA 5ICCA 1IRFA 2GOMA 3ZPLA 2RC4A 2GIZA 3B6AA 4NHJA 3D5SC 1BI3A 1V4RA 3Q5FA 4NC7A 1QO0D 1F5TA 4U7BA 2QVOA 2RV8A 2CH0A 2A6TA 3E1SA 1D0YA 3DBRB 4V2FA 3KZYA 1U8RA 2FEZA 3H5RA 2L02A 3CDIA 1DUXC 2F4OB 1A04A 5J8FA 2CGPA 3I3LA 2RREA 3F9KA 3G3ZA 2QWWA 3E6MA 2DMUA 5FFZA 2QA4I 1C0WA 1ITYA 2VJ5A 1FIPA 1KU3A 2K3PA 2DT7B 1Z77A 3O8GA 3SDBA 3GLLA 3KYDB 3FZVA 4ETSA 5HLGA 3HSFA 2CUZA 5FFXA 3WU2C 3RQIA 5LGTA 4I7HA 1USSA 1R1VA 4V2GA 2NVYJ 2XIGA 5FKMA 4A3IJ 1KU7A 1DGRM 1JKRC 2Z16A 1MZBA 1TNTA 3K4LA 4FASD 2ADUA 3FHZA 3CESA 2WC2A 2HKOA 3S1RJ 1MBFA 2VN2A 3AG2H 4XQFA 4WX9A 2L3DA 4FISA 1ZH5A 1TP4A 2O8XA 4NUBA 5L3DA 3T8RA 4IF4A 2R7UA 2W25A 2Y31A 2H8WA 4E7IA 3HOTA 2CV2A 1BR4A 1Z05A 2V1DA 3K4BA 1WFXA 2DA6A 4I09A 2E19A 4PJLA 2FA5A 3DPTA 4BJ6C 3EYYA 1ON2A 2MBFA 1T6SA 2QLZA 2E35A 4IX7A 3BC8A 1F43A 2VBYA 4BY1J 5EJCA 1LUJB 3HRSA 2VT2A 2HI3A 2BY0A 4A69C 5LEJA 3JRIA 2O5RA 4TV7A 3G73A 2ZO4A 3E6BA 4RS8A 3V7SA 3OR2C 3OL3A 2KT0A 1RUNA 3R6SA 2COBA 1W5SA 3H92A 2HPMA 1ENHA 4DIQA 1I1SA 2WAQN 5AIPA 3CTAA 2EFNA 2P6TA 3L2VA 3GZNB 4II2A 4XLNF 5D8LB 1TW2A 2NOJB 2YSRA 4XRSA 1JKOC 3WE3A 3J80K 3NWTA 5M5WJ 3BDDA 4U7DA 1WPKA 3S8PA 2XC7A 5HODA 5GTHC 3SZTA 4CCLA 1Z7UA 2E1OA 3M8EA 3G1MA 1XCVA 3DEWA 2DA4A 2UXNA 4E7ZA 3IL2A 1Y8RB 3QRFF 4KT5C 2XGCA 3CCSI 2QSFX 1K4TA 2FMLA 2AS5F 3LSKA 3BG5A 3FWEA 5J4YA 2KLOA 4I0BA 3OV8A 1B59A 2H94A 3RIRA 1XS9A 2FD5A 4ENJA 4ON0A 3GTKJ 3HOWJ 2B7EA 2KHMA 4EATA 2J5OA 2AXLA 1JI8A 3GW2A 3H9QA 1K79A 2IW5A 1MBHA 1RRJA 2VXZA 4II3A 4LK0F 4A5NA 3QYBA 4HRIA 2UV1A 3WTSC 2BYVE 3S32A 2R0QC 4F93B 1RR7A 1WI9A 3JRHA 1K7AA 1APLC 2XVCA 1OKRA 3TP3A 1WKMA 2L4AA 3VWBA 5A2QZ 3AFHA 2A6EF 1K78B 1LJ9A 3MD2A 4B44A 5KK1A 3MFKA 3VYRB 3E3VA 2BY1A 1Y1WJ 1K78A 2JSCA 3RTRA 1BL0A 5L3GA 1IN5A 1D8KA 1TWAJ 1NG7A 3ZOBA 2CV0A 5LD2C 1VQNI 1RC9A 3VOEA 4BQOA 3FBNB 4ZYAA 1D0ZA 2EIKH 2L7KA 3OYCA 3MKYB 3CMAI 2VKHA 1AWCA 3OS0A 2UZKA 2EZKA 2IT0A 3GTJJ 2DFEA 3S14J 3LAJA 2ZMEC 2GWRA 4XORA 3REOA 5J6XA 1D0XA 4YIRX 2CU7A 2KMUA 3T0YA 4ZZDA 1K61A 2ZFWA 4Y33A 3V8KA 4WXDA 5GAHJ 2V9VA 4XRFA 1DQUA 2P7VB 4UV9A 3WGGA 2IA1A 3JAMZ 5EEAA 3TO9A 5D5XB 5BMZA 1OMIA 3OR1C 4P9FA 5D5WB 2V26A 2LDUA 2N8GA 3JTHA 3D5LA 3ZMSA 1X58A 3MZHA 4XL9A 3I4NJ 3FXMA 1YI2I 3RI4A 2D1HA 3OIPA 4B47A 2LMDA 2OTLI 4RB3C 1RIOH 1OYWA 3H5NA 1XMKA 3TP0A 1DPUA 3HIFA 2L7MP 3DPUA 4N9IA 1S8NA 3BR1A 3FM3A 1SMTA 3HSRA 1FEXA 4P1WA 3P5JA 4PUSA 3I4MJ 1RKTA 2NS0A 2V1NA 4XOTA 3FXOA 1YIOA 2IS2A 3HOVJ 1Z91A 3E6CC 1L3LA 4BEHB 2CW7A 4UNOA 1BC7C 2XASA 4IO9F 2JUGA 2OCCH 3PNYA 4NNJA 4BEHA 4I6ZA 5C3EJ 1SC7A 4AU7A 2ELJA 1F36A 2QQ9A 2ID3A 3EYIA 2DCEA 2Q0OA 3I0TA 1BA5A 5K7ZA 1JUMA 3ABTA 2OAZA 1X3ZB 2DMNA 2DAOA 2DA1A 3K69A 1UHSA 2FBHA 1TTYA 2R4GA 4IRHA 5B1BH 1DPRA 4BQQA 4M6XA 4PSWA 3CCQI 5B1AH 3GTLJ 2V6CA 3CD6I 1G3YA 1XGOA 4QWQA 1FSEA 1MBEA 2KP6A 1QBJA 2V1UA 1FYLA 1UHWA 2CQNA 2WBMA 2W4SA 2CUJA 2OA4A 2QSHX 4N0BA 2XSJC 4EJVA 5IP6A 5FJ8J 2L7ZA 3M9AA 2W1OA 5BPDA 1FBSA 2PN6A 2KQRA 1B6AA 2KIFA 4A93J 3M4OJ 1IUFA 1J09A 1TW3A 2CQXA 1ZLJA 3QWLA 2XSDC 4HBLA 3SEQA 1NK2P 1T33A 3KP4A 1T08B 4EEFG 3PUFA 3LSIA 4BBSJ 2G9WA 3H5AA 1O3TA 1GT0C 1IGNA 2A69F 3JCUC 4ASNA 3GFLA 2NOGA 5HLHA 3ZN0A 3LL7A 2M7BA 1YS6A 1O57A 2QBYB 2DA7A 5HS9A 1VQMI 3E7LA 1F1ZA 3CCUI 2F5CA 2QBYA 5DYMA 1D5VA 3HUGB 2YU9J 2CFXA 2E2JJ 2Y0SA 5C44J 2JA6J 4BY7J 5IP7J 3HUGA 4D1QA 2XPWA 2KFDA 3DBLB 1MBJA 3FX3A 2Y9ZA 2BOLA 1Z1DA 1G3TA 4XMYA 2R7TA 5B3SH 4FT8A 1X1DA 4IKFA 1BJZA 3WTYC 2K27A 2L2OA 1AA7A 3BQZA 1BIAA 3Q9SA 4QLCU 1V5GA 1JT6A 3VSKA 3RKWA 3QAHA 3CMMA 4A3LJ 2FE3A 2QM3A 2HYFA 1R58A 2PX9A 3W6KB 1FMWA 4MQ9F 2GQQA 3W2VA 3MVPA 1E17A 1K83J 1R5ID 2QGUA 3LA7A 3FXQA 1ETWA 3GF2A 4B48A 2M7AA 1SFKA 3ERMA 4EJOA 3ZQFA 1Y0UA 4CZCA 5JHUA 2BXYA 1QU3A 1XC5A 4QPOA 5KCMA 4AC0A 4IQJA 2H1KA 1HOMA 5LGNA 1P7IA 1FOXA 4AWXB 3F22A 4K2EA 5FRMA 4G9YA 3H0GJ 3OYJA 4MGRA 2RAEA 2Y2ZA 4EVIA 2JA7J 2VBWA 1SFXA 2HYJA 2JK3A 3COAC 1U9OA 3TO7A 3HOXJ 3KE2A 3HYIA 4HX8A 3J7AY 5HNHA 3DTIA 4XM3A 4L9JA 5AONA 4FE4A 4EJUA 2CSOA 2A5YB 5DUKA 2IGKA 3CCJI 2DK8A 4HNVA 4XSZF 3HZJA 3Q9VA 4Z2YA 5D5VB 5L3BA 1YHQI 1VQ8I 2VJIA 3GUDA 2RKHA 1IDZA 2P0WA 2HQRA 1ZAOA 2XAJA 4NBQA 3I58A 2MLKA 4N4OB 4OIOF 1JXSA 1Y8QB 4Q5SF 2V6EA 2QKLB 2JSPA 4YRVA 4EV0A 5HS7A 3I4PA 1AOYA 3CJQB 4G7ZF 3IAS2 3ML6A 3GTPJ 4RAZA 2VE8A 3GTMJ 2VQCA 4XN0A 4IHXA 4CYDA 1D1BA 1S7EA 2O9LA 5KVRA 1J5YA 2CWEA 1YOVB 1BW5A 4OMZA 4KMFA 2EK5A 2VKEA 1WHUA 5H6QA 3C2HA 1ETKA 5FLVA 3HOYJ 3DLLF 2KZGA 2JA5J 2BZTA 4BXFA 1D1AA 2WAFA 1KYWA 2TCTA 3S16J 3FM5A 3BTLA 4E4HA 3JAMK 3KPHA 4D9JA 4C2TA 1HA8A 1S7AA 4DOZA 2ESHA 3BQYA 1CGPA 3B73A 2FF4A 1ZYRF 2A3SA 4RB1A 4P55A 4A3BJ 1IO2A 3OYFA 3EQLF 3K10A 2EB7A 3PNTA 2X51A 3BR5A 1MMNA 2VB6A 3OIOA 2IS1A 3BZKA 1KU2A 3CF2A 2OZ6A 4CCNA 4A0XA 3HTSB 3CC7I 2M2EA 1V54H 2L7FP 3ISPA 2XAFA 1YE9A 4D5CA 1B9NA 5E1WA 2F5EA 2KDZA 2R7SA 1JKPC 2GXBA 4G12A 1GV2A 3MCZA 4YIIA 1GVDA 4KISA 3H3ZA 4G94A 1S9HA 2RQPA 3BP8A 3R4KA 3OY9A 4AIKA 2GA2A 2E34A 3A02A 4P96A 2ZNZA 1HXDA 4XLHA 4GYIA 1VNDA 3S17J 3HKZA 2K9QA 1R5GA 4RAGA 1AHDP 1O3QA 4IXAA 3WTUC 2CUFA 1FBQA 4CUGA 4RA2A 1HDDC 3H3VK 3CUQC 3S2WA 1B72B 5D5UB 3ABMH 1SVLA 2HXOA 2HDWA 1B72A 3S2DJ 3LSJA 1HKQA 1VFCA 2QSGX 4LFUA 4G7HF 4XONA 2I5UA 3HL2A 4FX0A 2DN0A 4WF2A 5FKLA 4MHGA 2Q8KA 3ZQGA 2UXXA 3B6CA 3K6GA 1MNDA 3V7RA 3VYUB 1N75A 1E3PA 5CVJA 4X0GA 2X6YA 3P7NA 4CGZA 1RZ4A 3LSHA 4M6VA 1YJNI 4S04A 4DYQA 2PEXA 1YTYA 2JRTA 1V5EA 2K7LA 2WY7Q 3KP6A 2LP0A 4LB5A 2R93J 2XF7A 1USTA 3A03A 3BPVA 4BQAA 4CSWA 1FX7A 4AIDA 2VBXA 4O3MA 3GZ5A 2MC4A 3AG1H 1DP7P 1CF7B 2F4IA 4U88A 3DF8A 3DKWA 1CF7A 1TC3C 3K9TA 1FTZA 3HHGA 2ZJRF 2H27A 1X1AA 3ECOA 3GTGJ 2R7XA 3SFZA 4HQEA 1YYVA 2ZSHB 3ZMDA 4F55A 3GFMA 3TQNA 5JR3A 2R5YB 4XLFA 1X1BA 3DXJF 4F91B 1P7JA 5JLWA 1QZYA 1R1UA 3DV8A 5H6RA 2R5YA 5JHFA 1BW6A 5E79C 3RQ4A 4PJJA 1JGSA 2VQGA 3PNVA 2OCEA 2I10A 3K7AJ 3VEPA 3CJTB 1TT0A 2X6XA 5GAGJ 2EILH 5B5EC 3QU3A 1GXQA 2DOEA 2W7NA 3H1CA 5EGOB 2ZMEA 1X3UA 1F9NA 1WSUA 2A6HF 2NXNB 4BDYA 1FP2A 2I8DA 1AKHB 3R0AA 2FBKA 2EV6A 2IVMA 3U9GA 1QRYA 1AKHA 2VLAA 3LOCA 5BS6A 2EH3A 4XIDA 5L3CA 3I64A 3RPQA 1I3AA 4A3JJ 1P4XA 3LSPA 2X9DA 2VXDA 3ZQQA 2BHYA 2CUEA 2K9SA 4L18B 3F23A 2ZNYA 5M3MJ 1WRJA 3S3NA 1AU7A 1BOAA 1SFUA 1VQOI 4IOCF 4KJZA 1SD5A 5HNFA 5E3MA 1Z3XA 1P9QC 3W2WA 2W48A 4HNTA 3BWGA 5DCMA 1A35A 3HM5A 4HOBA 1B4AA 2CW8A 2IGMA 1BJAA 2M8GX 1U8BA 4RGSA 4L9VA 3X2QH 3QYFA 2JVGA 3B02A 3I9V2 1K6OA 2ME0A 4PFPA 3ZMUA 1QQIA 3BCAA 5HLTA 2M0CA 4JX4A 1MBGA 4IJAA 1FYMA 3SHFA 1R36A 4ZYDA 1QNTA 2XGEA 4AVPA 4A2UA 2JQ7A 1YG2A 3G71I 1RI7A 2XAQA 1J9IA 4KIBA 4PCQA 1XGSA 3HEFA 4QSHA 1UELB 2MW8A 3LNQA 2DDBA 4IL6C 2HR3A 3GMEA 3CZ6A 5IY5H 2LYCA 4PDKA 1TWHJ 2DI3A 4BHPA 3HB9A 4I01A 4LOCA 4HLYA 1MKMA 1LQ1A 3AG4H 3PJRA 2MC3A 3EUKL 3ZXSA 3FBIB 3OYEA 2FUG2 5DD4A 2VQLA 4YFXF 3L2UA 5EZGA 1TNSA 3R0JA 1YQAA 4J19A 1OJLA 4IHTA 1SEUA 1WJ5A 1XD7A 2RQQA 1IUYA 1OR7A 3TO6A 2HU9A 3I54A 3L09A 3UKGA 2KISA 4BAYA 4YG2F 4B43A 3WE2A 1PP8F 3WTTC 3HTUA 2GOXB 2Y48A 5FO5A 4M3EA 1YX5A 2Z9OA 2X6OA 3WGIA 3HXLA 3CCEI 1VQLI 1OPCA 4G7OF 5HVQC 1FOKA 1FOYA 3DEEA 4LIUA 2V4JC 4AYBA 2M3AA 3AL0C 2ZB9A 5IOZA 1Y6IA 2MA3A 4HA8A 5DD8A 4BJTA 2R7WA 4EGYA 3SYTA 1X2NA 1IZ1A 1LEBA 4E7KA 3EETA 4I98B 1MW7A 4BACA 3NARA 2ID6A 3S1NJ 3NWSA 3TOAA 2WTEA 3HRTA 4CCKA 3CP8A 2BVLA 1D3YA 2NYXA 1G2HA 1T98A 5K5RA 1WJEA 2ECCA 2LRDA 4E70A 1VQPI 3OSGA 3LSGA 2HYGD 3GO5A 4ABZA 1ZG5A 2FRHA 3ZMTA 4CYCB 1XB4A 3OYMA 3EUHA 4CYCA 3GEZA 5DTDA 1WVRA 4LLNA 2HQ5A 1VF9A 1NH3A 1MJ9A 2MFZA 3LMMA 3PIPF 2NAZA 5L3EA 4ZTJA 2YUSA 4F3QA 3V7CA 1J0RA 3ESWB 4WCGA 1Q1HA 2WV1A 1SFOJ 1P2FA 3L2RA 4CCOA 2IGNA 3HDDA 2MGQA 2Z3YA 4KN4X 1YW8A 2IBDA 2BXZA 2K3FA 3OMYA 2DMQA 2KZVA 4JOMA 2V9KA 1R00A 1DP3A 2XPVA 4BKXA 5TGTA 3KLOA 1T56A 3L2CA 3ABUA 2VQHA 4EJWA 4RDUA 3ECHA 2GXGA 5E3OA 4FX4A 2JVHA 2EFOA 2F4MB 4B8XA 1LVAA 2LVSA 1HW2A 1IRZA 3DQVC 1IXRC 5EZHA 3ZMZA 5E1ZB 2O7OA 4UV8A 4HF0A 1JHFA 5FLXZ 1QPIA 1FWZA 3G1OA 2YPRA 3D1NI 2IA0A 2E2IJ 2LC2A 2PMHA 2ZCWA 5BPIA 4LK1F 3KP2A 2B9SA 3NQOA 2MD5A 5CYVA 3WG9A 4KUMA 1GXPA 1ZHFA 1RETA 1S5LC 4L5JA 4OIRF 3BG7A 5IT9Z 2KRHA 3ABKH 3MKLA 1WJAA 2JT1A 4A3KJ 2CJJA 4LGWA 3F3XA 3GVAA 1OCCH 4Y3OA 4E7LA 1MIJA 5IT3A 2E71A 3IKVA 5ILUA 1D1CA 1Z3YA 4MIMA 3H36A 2P81A 4R79A 3MKWB 2QCOA 4ZDPA 4UXNA 2JZYA 4GDFA 3KZIC 3BG9A 2HQAA 5B66C 1ZRDA 4MO7A 3CLQA 5HLIA 1IW7F 4NC8A 3WHBA 2EA2A 1W7PB 5C4XJ 1Z0XA 4GCVA 4DJAA 1J59A 3H3UA 2HKXA 2F48A 3V4GA 2DA5A 3J81K 2JTVA 4BYYA 2ECBA 3MZ8A 3KP5A 4KITB 4BHBA 1X1PA 4PJ0C 3P9CA 1LDKB 1U9NA 2F5FA 1NHAA 1ACIA 2K9LA 3UR3C 5M5YJ 3SEZA 1UJ8A 3OOUA 1IXCA 4V19K 2O0YA 3F0CA 3IP4B 5JVTA 1SAUA 5J4VA 2FJ1A 2IA2A 1V3FA 3VYSB 4N4NB 3S93A 5E1XA 4GO1A 1PYVA 2L9NA 2P5VA 1UZCA 1RESA 4IHSA 2HOSA 2COMA 3FXUA 2HEOA 4HF1A 4RBOA 1ZQ3P 2VT3A 3KEOA 3LA2A 4KMUX 3T1BA 2FU4A 4XKWA 5FROA 4R1HA 3FF5A 1RPWA 3OYKA 5ED4A 2CFOA 1IRXA 2ZFUA 4H0EA 3S2HJ 2M34A 3TOBA 5C4JJ 1I50J 2CMPA 4LMYA 4M6YA 2O6GE 3HOSA 2GZWA 3FXRA 2NVXJ 4KDPA 1P4AA 2JPBA 4U0YA 1YFHA 3CUQB 4L5IA 4CDGA 1RKWA 1SVMA 2AXTC 3CLOA 1HKSA 1XSXA 3CUQA 5F08A 3LSMA 1IC8A 3ZMVA 3FK7A 4O5VA 3TDZC 2D5VA 3T5XA 1X2MA 1H0MA 1VZ0A 2YX4A 2RNJA 1BR1A 3OIQA 3GYHX 4CCJA 3BCBA 2X0LA 3HBLA 4HPQA 2P6SA 4C3HJ 2XROA 1R9TJ 3ZGKA 5HOOA 3F8FA 3QP5A 5IYBJ 3W6JB 2Y0SN 3F6OA 3O6BB 3Q0WA 4XLAA 4QPQA 1S3JA 5HDNA 4CCMA 3HHHA 3WTWC 1DU0A 3IH4A 2EFQA 2OV7A 4DBQA 1O7LA 1S7OA 4YIFA 2P5KA 1OR7C 2TRTA 4PJMA 4RGUA 5EEHA 4S05A 1EV7A 1H9TA 3L9FA 2ZSIB 2K9MA 3U1KA 1P92A 3JR9A 1T0FC 2L9VA 1KQ8A 2HDCA 2QKMB 3ELKA 2W85A 2HOEA 3KP3A 5J8CA 2ZXIA 3D5RC 1R23A 4HNUA 1FT9A 2XGXA 3QPHA 4GYGA 4C9YA 3MWMA 5IYDJ 2R92J 1VTNC 3BPXA 5F1RA 4BU2A 1BIBA 1SANA 2VIXA 2D1VA 3RYPA 3ULQB 3KEYA 4E7HA 3AG3H 5EYRA 1A31A 1IDYA 1XGNA 1GUUA 2G7UA 2XB5A 4HZFA 3O8HA 4Z6YA 2XRLA 3GX4X 1VI0A 2H6BA 2KIQA 1R22A 3LSRA 2DFIA 1XMAA 4A0YA 1LPQA 1F4KA 2DU9A 4R8HA 2LKXA 2XRNA 3EDPA 4KT6A 1OCTC 1TWCJ 3K4JA 3BT9A 4HX7A 3G4SI 3L2QA 1XDSA 5DV5A 4P5OA 4QTRA 2LG4A 3BJAA 4L9TA 3DFGA 3EUHC 4CO8A 2ZJPF 1SAXA 5LHGA 3K4KA 4L9NA 4A3GJ 4LLLA 3C3WA 1P4WA 1WH5A 4GRIA 4EMSA 2BHZA 1E3HA 3K0LA 3RCOA 2LY2A 2LTPA 2E2HJ 1SD7A 4WXCA 4O6JA 4IVNA 2F2EA 3JSOA 2VJJA 3QQAA 3S3MA 2HPIA 2LBFB 2HOTA 3ZRGA 1W0TA 1ZR2A 2R7ZJ 2VC0A 1JUPA 1Y1VJ 2LBFA 4M9XA 2L5QA 3UNGC 2VOOA 4ZDLA 3HOZJ 1WJCA 3PUBA 2J5PA 3TBIA 1MH4A 5E3LA 4A0ZA 1ZELA 3BTCA 2Z5UA 4DZJA 3FISA 4RGRA 1MMSA 1T95A 1FSHA 4JQFA 4A3DJ 2YU3A 1OISA 1LE8B 3BR2A 3NRVA 2XAHA 3DLAA 4KYWA 1HW1A 5K7FA 1QHHD 2JJ7A 4HEA2 2KRFA 4Q47A 1LE8A 1TL8A 3HGYA 5F04A 5HDKA 3WU0A 2KJCA 3RYRA 2CS3A 3RKYA 5LFAA 4MEXF 1XCBA 5FLXK 1HF0A 3CMYA 1EA3A 2M4GA 1Y39A 5K5QA 2BV6A 3MAJA 3HSEA 5A2QK 1BR2A 4JP0A 2W84A 4ESFA 1JJ8C 2VKVA 2AO9A 4XKVA 3SZPA 4HDVA 3GTQJ 1SMYF 2B0LA 2BE5F 1J75A 4HF2A 2E7WA 2Y9YA 1YITI 5IP9J 3VDXA 4I2OA 2L9SA 1H89C 3IAM2 1VQ6I 1KU9A 2FX0A 4KIGA 3L7WA 1D5YA 2R7OA 3W3CA 3OYAA 5H2FC 1A5JA 2ICWG 1ULYA 2L54A 3CDHA 4BGDA 1TLHB 1X4OA 4ZYHA 4OAYA 2XAUA 2E1NA 3PQJA 5GP9A 4NDLA 4IPAA 3TKYA 1YLFA 2JA8J 2EZIA 3U21A 5BNGA 1LFUP 3HOUJ 3RPUA 1WI3A 1I39A 1BI1A 3AKZA 3GWZA 4KIFA 2LOOA 2GLOA 1IXSB 1LDDA 4DYRA 5TJJA 2GA1A 2M30A 3CCVI 1ERDA 4UUSB 3JRGA 1UB9A 1KONA 2VPLA 5GADJ 3DKXA 2FOWA 4A3EJ 3R60A 4UUSA 2E5NA 1YRNB 1GHCA 3HKZN 4J01A 1Y56A 4OU0A 3AL0B 1E3OC 5FKNA 1Z6TA 3J7AO 1VQ4I 3E6DA 4HG2A 1YRNA 3JSPA 4AD9A 2IS4A 2E1CA 1U6GA 2VI6A 2LK2A 4B3XA 4WWCA 4LG0B 1KZHA 2K4BA 3A0HC 3RPUD 5TRDA 1N78A 4CXFA 4LG0A 2DPUA 1UFMA 4IOAF 5JLXA 4ZYGA 2FXAA 1XSDA 3LFKA 1Z9CA 2BGCA 1IJWC 3C18A 3OS1A 3IRQA 3K4CA 3MKZA 3T8TA 3M8FA 5EF6A 1WZ2A 5F6FA 3PSFA 5F0FA 1FMVA 3QP6A 1OYIA 3ZQCA 1ZREA 3VB2A 5BOXA 3WHCA 3JTGA 1R1TA 2IXSA 2ELKA 4EM1A 3VPRA 1YJWI 3K1PA 2UWMA 2K40A 1ETQA 3DCFA 1HW5A 2DK5A 2OZUA 3TL4X 2NVTJ 2DFHA 2VKDA 2KL4A 5D4SA 5LBQA 3I56I 2FNAA 1I27A 1B8IB 1LNWA 1OCOH 4RM2A 5AIQA 5DM6F 3KZZA 2VONA 4FCYA 2Z99A 1UCRA 2MYSA 3MEXA 2VE9A 3N4MA 3ZQ7A 3A01B 2CQKA 5E8IA 3N05A 2XDVA 1R5HA 5M3FJ 4YFNF 1SVOA 1NTCA 3A01A 3CCRI 2DMPA 2E60A 2EQRA 4N9HA 1MNEA 1NG6A 1ZRCA 1YW7A 1QPMA 2PQ8A 1HKTA 3WTZA 2NS7A 3TW6A 5FRNA 3I71A 3N97A 2CQQA 1R71A 2DTRA 3IRRA 4XOPA 2HVSA 1W5TA 4KFCA 2PMZA 3G6EI 2HDDA 3ROUA 2KIUA 4Q48A 4W97A 3GTOJ 4ZYEA 5CVRA 2PFBA 1A36A 1K4SA 2Z33A 2JA2A 2WY8Q 2HGCA 1BN5A 2W24A 3A2KA 2YS9A 5KAIC 1NK3P 2FOKA 3L00A 4OWRB 3KX2A 4PGGA 4IHWA 2G7HA 2VPRA 3DKYA 3C2GA 5M5XJ 1IN8A 2B63J 2ELHA 2GIVA 1S6LA 2PG4A 3FXLA 3OOPA 3PQKA 4ZJZA 3W6VA 1O4XA 1QZZA 2D2WA 4I0AA 3M07A 2GBYA 3V42A 6PAXA 2HTSA 3LQQA 4XSXF 3FMQA 2W57A 4B09A 2EWNA 1PUFB 5F1JA 2R7RA 1ORKA 3KFWX 3IHUA 3Q3SA 1PUFA 2IPQX 5EGOA 3DTKA 2OTJI 5LRSA 1MMDA 4Y15A 1JE8A 2EA4A 4IRIA 1H88C 5LLQA 2OD5A 1G59A 2IS6A 4C2MJ 4W1UA 4Y13A 2LY9A 2HWVA 1ONVA 3QODA 3G1LA 3OYBA 1FIAA 3F72A 3VODA 2PBIA 1PJRA 2R7DA 1T38A 4IZZA 2DOAA 2ZJQF 5ILSA 3E97A 1MJAA 1QHGA 2VBZA 4LIVA 2O03A 2A68F 2QQ8A 3VSLA 3K1MA 3E5UA 3KP7A 4RB0A 4DZPA 3EUAA 1DDNA 3ZCOA 4ZH4F 1EKEA 2BVMA 1HDPA 2QZ8A
chains in the Genus database with same CATH topology
3QU6A 5LHHA 3LWFA 5JI6A 1XDUA 5ERIA 2D45A 5L3FA 4ESJA 4HX4A 4RB2C 2ETHA 3F8MA 5K1YA 2R3SA 2DLLA 3GFJA 5CLSA 3K2ZA 2LF8A 2X4HA 4A12A 1WWXA 3P9KA 2YX7A 1KYZA 1FY7A 2Q2EA 2LNBA 1HSJA 1XGMA 1LDJA 2M1BA 4M72A 4CICA 4OIQF 4YFKF 5LEKA 4A6EA 1I1GA 3RDIA 2NNNA 4LD5A 4BHCA 5D4RA 2DQLA 4EQQA 3HRUA 1EH7A 2ZXJA 4ENKA 2VODA 4G6QA 1JHHA 1T0FA 1PUEE 1MGTA 1YO5C 2KIMA 3DPLC 1U2WA 2ESNA 3BY6A 2OU2A 4KN7X 2E7XA 2ZBKA 3FMRA 2A07F 3I53A 3M1EA 4GXOA 5JFRA 4RAYA 2PJPA 4Y17A 1U78A 2FSWA 4WXHA 2K86A 4M71A 3BOQA 5CVVA 2RDPA 1ZGAA 4EM2A 1MJBA 3F8NA 4NQWA 4WK8F 2C6YA 1P6RA 1LEAA 3HRMA 2L01A 2ZKZA 2MLGA 2DO7A 5K5OA 2M8EA 2PLYA 3DEUA 3E5XA 3DP7A 3F8BA 4MTDA 4A6DA 3IWZA 2DT5A 1G4DA 1IF1A 2H09A 2QUFA 5EEGA 3SQNA 5CVIA 5E8GA 1PP7U 4U0WA 2KKOA 3GFIA 1IRGA 2EFPA 2LSOA 3O3KA 3P9IA 1IN7A 3GLXA 3WTVC 3CO7C 2K4JA 2CO5A 1J7KA 4MTEA 1FZPB 5FGMA 2RVCA 2QQBA 2DQRA 4AIJA 2R7FA 4I02A 3WTXC 2CG4A 2F5DA 5D8KB 1FLIA 4NB5A 3NEUA 1O3SA 3WGHA 1O3RA 1ZG3A 3KETA 3MQ0A 4KICA 5DEQA 1EH8A 1W7PA 3V8JA 2M5WA 5DCFA 3F6VA 1Z6RA 4P9UA 3I5UA 4HW0A 3AAFA 4LJZF 2IP2A 4ENMA 2XAGA 1RUOA 1FBUA 5ILVA 2MH2A 3MZYA 5CJ9A 3C7JA 4RGXA 4UVBA 4DQ2A 2QYOA 2ACJA 3BZ6A 3LSTA 5D6EA 4A5MA 2HFHA 1W7PD 5FD6A 1U5TB 2IRFG 4U0VA 1YW9A 1G3SA 1U5TA 2PI0A 4BNCA 2O3FA 1STZA 2QENA 2A61A 4EJTA 2MH9A 4FHTA 2EV5A 5HS8A 3CUOA 1L0OC 3BJOA 2CW0F 2HZTA 1PDNC 2EFWA 2M87A 2P7CB 5CVUA 3BROA 3JW4A 4HLXA 4OMYA 1UHMA 2GAUA 3CO6C 3FMSA 2P8TA 2XKOA 3KLNA 4PGHA 4UVCA 5F64A 3SXYA 1OYYA 2FNPA 3BJ6A 2O61A 4IRGA 4MEYF 5FB2A 3QOPA 4M9SA 4CHUA 1BBYA 2L4MA 3PFIA 3R61A 1D8JA 4BH9A 1GVJA 1BC8C 2STWA 1FNNA 1HBXG 1EH6A 1YS7A 1SD6A 1FPQA 1BM9A 2PMUA 1FC3A 3M7GA 3O2PE 1ZN2A 1LB2A 4L0YB 3RJPA 2STTA 2RGVA 4UHTA 3LA3A 4MNUA 1HSTA 1TQPA 4EM0B 1KQ9A 4LB6B 2XHKA 2OQRA 3F21A 5ICGA 1IN4A 2JPCA 1SFEA 2Y0MA 4KA4A 5FD5A 3CJNA 1HQCA 4ZZLA 1WQ2A 2BBYA 2OBPA 2ISYA 4MQVA 3I59B 2V1XA 4KNYA 1FP1D 4M73A 3I59A 3D0SA 4UVAA 1FYKA 5IT9K 1TQIA 2XKPA 1MDMB 3WU1B 2QQAA 1MDMA 1ZARA 1KQ0A 2CYYA 1ZGJA 4M9ZA 1I6XA 4XBFA 1U3EM 3TGNA 3VFZA 4JBAA 3QPTA 2Y75A 2YR2A 1ZRFA 1ODDA 1W4MA 3LAPA 3F8CA 3IC7A 1B1BA 3WODF 2ISZA 2BEOA 4G6DA 3IKTA 2FMYA 4HDUA 1ON1A 2WWYA 1IN6A 2FQ3A 4DNCA 4OINF 5DDGA 4M74A 4OOIA 2V79A 1U5TC 4ESBA 1ZLKA 2VOPA 5E20A 1ZG1A 4OIPF 3GZ6A 4D0PA 2WV0A 3IWFA 1IAWA 4HAMA 1S29A 4HYEA 1G3WA 5DUIA 1R7JA 2HQNA 2NNYA 1KGSA 2XUBA 3J80Z 3KCCA 2M45A 2TDXA 2P4WA 2H6CA 5ICFA 1SD4A 5LRRA 2VC1A 1T39A 3U2RA 4UUVA 5E18F 5HDGA 1MD0A 1BI2A 3ZP5A 2DPDA 1QGPA 4EGZA 4G8XA 2HTJA 2K02A 4XLPF 1G6NA 1I5ZA 4Q4ZF 3ERED 3ZN1A 1REPC 1BI0A 4JK1X 5H20A 1T2KA 2XV4S 5E17F 1XN7A 1O7FA 3LQRA 3U1DA 4HQMA 1RNLA 4CZZA 2HS5A 1TBXA 2EV0A 3RKXA 4HV5A 3C1DA 3KEQA 1E2XA 1J2XA 1KA8A 1H9GA 3TDUC 5LHIA 2P5LC 5LGUA 2FBIA 2IJLA 2DBBA 2LF7A 5ICEA 3E5QA 4HV6A 2ZMEB 2ZJ2A 2OQGA 3J81Z 3GXOA 1B9MA 4GGGA 4F7ZA 4LLGF 2EJRA 4BXUA 5D6FA 4L0ZB 1TQMA 2LKPA 5BQTA 2NRAC 2KJBA 4PZJA 3K1NA 4AIHA 2DW4A 3V8LA 5DCMB 1XSVA 4ENNA 2RN7A 5ICCA 1IRFA 3ZPLA 2RC4A 4NHJA 1BI3A 1V4RA 3Q5FA 1QO0D 1F5TA 4U7BA 2QVOA 2RV8A 3KZYA 1U8RA 2FEZA 2L02A 1DUXC 1A04A 5J8FA 2CGPA 3G3ZA 2QWWA 3E6MA 5FFZA 1C0WA 1KU3A 3FZVA 4ETSA 5HLGA 3HSFA 5FFXA 5LGTA 4I7HA 1USSA 1R1VA 2XIGA 1KU7A 1MZBA 1TNTA 2ADUA 3FHZA 2WC2A 2HKOA 2VN2A 4WX9A 2L3DA 1ZH5A 2O8XA 5L3DA 3T8RA 4IF4A 2W25A 3HOTA 1Z05A 2V1DA 4I09A 2FA5A 3DPTA 3EYYA 1ON2A 2MBFA 1T6SA 2QLZA 2VBYA 3HRSA 2VT2A 5LEJA 3G73A 4TV7A 2ZO4A 3E6BA 4RS8A 3V7SA 1RUNA 3R6SA 1W5SA 3H92A 1I1SA 5AIPA 3CTAA 2EFNA 2P6TA 4XLNF 5D8LB 1TW2A 2YSRA 3WE3A 3J80K 3BDDA 4U7DA 3SZTA 1Z7UA 3M8EA 1XCVA 2UXNA 3IL2A 3QRFF 4KT5C 2FMLA 2AS5F 3FWEA 4I0BA 3OV8A 1B59A 2H94A 3RIRA 4ENJA 4ON0A 2J5OA 2AXLA 3GW2A 1K79A 2IW5A 2VXZA 4LK0F 4A5NA 3WTSC 2BYVE 1WI9A 1K7AA 2XVCA 1OKRA 1WKMA 2L4AA 5A2QZ 2A6EF 1K78B 1LJ9A 5KK1A 3MFKA 3E3VA 1K78A 2JSCA 3RTRA 5L3GA 1IN5A 1D8KA 3VOEA 1AWCA 2UZKA 2IT0A 3LAJA 2GWRA 3REOA 5J6XA 3T0YA 4ZZDA 2ZFWA 3V8KA 4WXDA 2V9VA 4XRFA 3JAMZ 2P7VB 4UV9A 3WGGA 2IA1A 3TO9A 5D5XB 5BMZA 1OMIA 5D5WB 4P9FA 3ZMSA 2LDUA 3JTHA 3D5LA 3MZHA 3RI4A 2D1HA 4RB3C 1RIOH 1OYWA 1XMKA 1DPUA 3HIFA 4N9IA 1S8NA 3FM3A 1SMTA 3HSRA 2NS0A 1YIOA 1Z91A 3E6CC 1L3LA 4UNOA 1BC7C 2XASA 2QQ9A 3EYIA 2Q0OA 3I0TA 3ABTA 2OAZA 2DAOA 3K69A 2FBHA 1TTYA 4IRHA 1DPRA 4M6XA 2V6CA 1G3YA 1XGOA 4QWQA 1FSEA 1QBJA 2V1UA 1FYLA 1UHWA 2OA4A 4N0BA 4EJVA 3M9AA 5BPDA 1FBSA 2PN6A 1B6AA 2KIFA 1TW3A 1ZLJA 4HBLA 3KP4A 2G9WA 1O3TA 2A69F 4ASNA 3GFLA 5HLHA 3ZN0A 1YS6A 1O57A 2QBYB 5HS9A 1F1ZA 2F5CA 2QBYA 5DYMA 1D5VA 2CFXA 3HUGA 3FX3A 1Z1DA 1G3TA 4FT8A 3WTYC 2K27A 1BIAA 3Q9SA 4QLCU 3RKWA 3QAHA 2FE3A 2QM3A 2HYFA 1R58A 3W6KB 4MQ9F 2GQQA 1E17A 3LA7A 3FXQA 3GF2A 4EJOA 1Y0UA 5JHUA 5LGNA 4AWXB 3F22A 4K2EA 4G9YA 4MGRA 4EVIA 2VBWA 1SFXA 3COAC 3TO7A 3KE2A 3HYIA 4HX8A 4L9JA 5AONA 4EJUA 2CSOA 2A5YB 5DUKA 2DK8A 4XSZF 3Q9VA 4Z2YA 5D5VB 5L3BA 3GUDA 2RKHA 2HQRA 1ZAOA 2XAJA 3I58A 2MLKA 1JXSA 4OIOF 4Q5SF 4EV0A 5HS7A 3I4PA 1AOYA 4G7ZF 3ML6A 4RAZA 2VE8A 4CYDA 5KVRA 1J5YA 2CWEA 4OMZA 4KMFA 2EK5A 5H6QA 1KYWA 3FM5A 3JAMK 1S7AA 2ESHA 1CGPA 3B73A 2FF4A 1ZYRF 2A3SA 4RB1A 4P55A 3EQLF 2EB7A 1KU2A 2OZ6A 4A0XA 3HTSB 3ISPA 2XAFA 1B9NA 5E1WA 2F5EA 2GXBA 3MCZA 4YIIA 3H3ZA 4G94A 2RQPA 3BP8A 3R4KA 4AIKA 2GA2A 4P96A 2ZNZA 1HXDA 4GYIA 1R5GA 1O3QA 4IXAA 3WTUC 1FBQA 3CUQC 3S2WA 5D5UB 1HKQA 4LFUA 4G7HF 4FX0A 4WF2A 4MHGA 2Q8KA 2UXXA 3V7RA 5CVJA 3P7NA 4CGZA 1RZ4A 4S04A 2PEXA 1YTYA 2JRTA 2K7LA 3KP6A 4LB5A 1USTA 3BPVA 4BQAA 1FX7A 2VBXA 4O3MA 3GZ5A 1DP7P 1CF7B 4U88A 3DF8A 3DKWA 1CF7A 3K9TA 3HHGA 2H27A 3ECOA 3SFZA 4HQEA 1YYVA 3ZMDA 3GFMA 3TQNA 5JR3A 3DXJF 1QZYA 1R1UA 3DV8A 5H6RA 1JGSA 3VEPA 3QU3A 1GXQA 2ZMEA 1X3UA 1F9NA 1WSUA 2A6HF 1FP2A 3R0AA 2FBKA 2EV6A 2IVMA 3U9GA 5BS6A 5L3CA 3I64A 3RPQA 1P4XA 4L18B 3F23A 2ZNYA 1WRJA 1BOAA 1SFUA 1SD5A 3BWGA 5DCMA 4HOBA 1B4AA 1BJAA 4RGSA 4L9VA 3B02A 1K6OA 3ZMUA 1QQIA 4IJAA 1FYMA 3SHFA 1R36A 4ZYDA 1QNTA 4AVPA 4A2UA 1YG2A 1RI7A 2XAQA 1J9IA 4KIBA 4PCQA 1XGSA 2HR3A 4PDKA 2DI3A 4BHPA 4I01A 4HLYA 1MKMA 1LQ1A 2MC3A 5DD4A 4YFXF 1TNSA 3R0JA 1YQAA 4IHTA 1XD7A 1IUYA 1OR7A 3TO6A 3L09A 3I54A 4BAYA 4YG2F 3WE2A 1PP8F 3WTTC 3HTUA 2Y48A 5FO5A 2Z9OA 3WGIA 1OPCA 4G7OF 5HVQC 1FOKA 4EGYA 2MA3A 4HA8A 5DD8A 1IZ1A 1LEBA 3EETA 4I98B 3TOAA 2WTEA 3HRTA 1D3YA 2NYXA 1T98A 5K5RA 4E70A 2HYGD 3GO5A 1ZG5A 2FRHA 3ZMTA 1XB4A 3EUHA 3GEZA 4LLNA 1MJ9A 2NAZA 5L3EA 3V7CA 1J0RA 4WCGA 1Q1HA 1P2FA 2Z3YA 4KN4X 1YW8A 1R00A 3KLOA 3L2CA 3ABUA 4EJWA 3ECHA 2GXGA 4FX4A 2EFOA 4B8XA 1LVAA 1HW2A 3DQVC 1IXRC 3ZMZA 5E1ZB 4UV8A 4HF0A 1JHFA 5FLXZ 1FWZA 2YPRA 2IA0A 2PMHA 2ZCWA 5BPIA 4LK1F 3KP2A 3NQOA 2MD5A 5CYVA 3WG9A 4KUMA 1GXPA 1ZHFA 4L5JA 4OIRF 5IT9Z 2JT1A 4LGWA 3F3XA 3GVAA 5IT3A 3IKVA 5ILUA 4R79A 4UXNA 2JZYA 1ZRDA 5HLIA 1IW7F 2EA2A 1W7PB 4GCVA 1J59A 3H3UA 2HKXA 3V4GA 3J81K 2JTVA 4BYYA 3KP5A 4BHBA 3P9CA 1LDKB 2F5FA 1NHAA 1IXCA 2O0YA 5JVTA 2IA2A 1V3FA 5E1XA 4GO1A 2P5VA 4IHSA 2COMA 3FXUA 2HEOA 4HF1A 2VT3A 3KEOA 3LA2A 4KMUX 3T1BA 2FU4A 4R1HA 3FF5A 5ED4A 4H0EA 3TOBA 2O6GE 4LMYA 4M6YA 3HOSA 2GZWA 3FXRA 4KDPA 1P4AA 2JPBA 4U0YA 1YFHA 3CUQB 4L5IA 4CDGA 3CLOA 1HKSA 1XSXA 3CUQA 3ZMVA 4O5VA 3TDZC 3T5XA 1H0MA 2YX4A 2RNJA 3GYHX 2X0LA 2XROA 2P6SA 5HOOA 3F8FA 3QP5A 3W6JB 3F6OA 3O6BB 5HDNA 1S3JA 3HHHA 3WTWC 2EFQA 1O7LA 1S7OA 4YIFA 2P5KA 4RGUA 5EEHA 4S05A 1EV7A 1H9TA 3L9FA 1P92A 1KQ8A 2HDCA 3ELKA 2W85A 2HOEA 3KP3A 5J8CA 1R23A 1FT9A 2XGXA 3QPHA 4GYGA 3MWMA 1VTNC 3BPXA 5F1RA 1BIBA 2D1VA 3RYPA 3ULQB 1XGNA 2G7UA 4HZFA 3GX4X 2H6BA 1R22A 2DFIA 1XMAA 4A0YA 1F4KA 2DU9A 4R8HA 2XRNA 3EDPA 4HX7A 1XDSA 5DV5A 4P5OA 3BJAA 4L9TA 3DFGA 4CO8A 1SAXA 5LHGA 4L9NA 4LLLA 3C3WA 1P4WA 4EMSA 3K0LA 1SD7A 4WXCA 4O6JA 4IVNA 2F2EA 3JSOA 2VC0A 4M9XA 2VOOA 2J5PA 4A0ZA 2Z5UA 4RGRA 1FSHA 4JQFA 2YU3A 3NRVA 2XAHA 4KYWA 1HW1A 4Q47A 2KRFA 5HDKA 3WU0A 2KJCA 3RYRA 3RKYA 4MEXF 1XCBA 5FLXK 5K5QA 2BV6A 3MAJA 3HSEA 5A2QK 2W84A 4ESFA 4HDVA 3SZPA 1SMYF 2B0LA 2BE5F 1J75A 4HF2A 2E7WA 4I2OA 1KU9A 4KIGA 3L7WA 1ULYA 2L54A 3CDHA 1TLHB 4ZYHA 2E1NA 3PQJA 4IPAA 3TKYA 1YLFA 3RPUA 1BI1A 3GWZA 4KIFA 1IXSB 1LDDA 5TJJA 2GA1A 2M30A 1UB9A 3R60A 1GHCA 4OU0A 3J7AO 1Z6TA 3E6DA 3JSPA 4AD9A 2E1CA 1U6GA 4WWCA 4LG0B 2K4BA 5TRDA 4CXFA 4LG0A 2DPUA 1UFMA 4ZYGA 2FXAA 1XSDA 3LFKA 1Z9CA 2BGCA 3C18A 3IRQA 3T8TA 3M8FA 5F6FA 1ZREA 3QP6A 1OYIA 3VB2A 5BOXA 3JTGA 1R1TA 4EM1A 3K1PA 2UWMA 1HW5A 2DK5A 2OZUA 5D4SA 5LBQA 2FNAA 1I27A 1LNWA 5AIQA 3KZZA 2VONA 2Z99A 1UCRA 3MEXA 2VE9A 3N4MA 3ZQ7A 2CQKA 5E8IA 1R5HA 4YFNF 4N9HA 1ZRCA 1YW7A 1QPMA 2PQ8A 1HKTA 3WTZA 3I71A 3N97A 2DTRA 3IRRA 1W5TA 4KFCA 3ROUA 2KIUA 4Q48A 4ZYEA 5CVRA 2PFBA 2Z33A 2HGCA 1BN5A 2W24A 2FOKA 3L00A 4PGGA 2G7HA 1IN8A 2ELHA 2GIVA 1S6LA 2PG4A 3OOPA 3PQKA 1QZZA 2D2WA 4I0AA 6PAXA 2HTSA 3LQQA 4XSXF 3FMQA 2W57A 4B09A 2EWNA 3KFWX 3IHUA 2IPQX 5LRSA 4Y15A 1JE8A 2EA4A 4IRIA 5LLQA 2OD5A 4Y13A 2HWVA 1ONVA 3F72A 3VODA 2PBIA 1T38A 2R7DA 5ILSA 3E97A 1MJAA 2VBZA 2O03A 2A68F 3K1MA 3E5UA 3KP7A 4RB0A 1DDNA 4ZH4F 2QZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QU6 A;  5LHH A;  3LWF A;  5JI6 A;  1XDU A;  5ERI A;  2D45 A;  5L3F A;  4ESJ A;  4HX4 A;  4RB2 C;  2ETH A;  3F8M A;  5K1Y A;  2R3S A;  2DLL A;  3GFJ A;  5CLS A;  3K2Z A;  2LF8 A;  2X4H A;  4A12 A;  1WWX A;  3P9K A;  2YX7 A;  1KYZ A;  1FY7 A;  2Q2E A;  2LNB A;  1HSJ A;  1XGM A;  1LDJ A;  2M1B A;  4M72 A;  4CIC A;  4OIQ F;  4YFK F;  5LEK A;  4A6E A;  1I1G A;  3RDI A;  2NNN A;  4LD5 A;  4BHC A;  5D4R A;  2DQL A;  4EQQ A;  3HRU A;  1EH7 A;  2ZXJ A;  4ENK A;  2VOD A;  4G6Q A;  1JHH A;  1T0F A;  1PUE E;  1MGT A;  1YO5 C;  2KIM A;  3DPL C;  1U2W A;  2ESN A;  3BY6 A;  2OU2 A;  4KN7 X;  2E7X A;  2ZBK A;  3FMR A;  2A07 F;  3I53 A;  3M1E A;  4GXO A;  5JFR A;  4RAY A;  2PJP A;  4Y17 A;  1U78 A;  2FSW A;  4WXH A;  2K86 A;  4M71 A;  3BOQ A;  5CVV A;  2RDP A;  1ZGA A;  4EM2 A;  1MJB A;  3F8N A;  4NQW A;  4WK8 F;  2C6Y A;  1P6R A;  1LEA A;  3HRM A;  2L01 A;  2ZKZ A;  2MLG A;  2DO7 A;  5K5O A;  2M8E A;  2PLY A;  3DEU A;  3E5X A;  3DP7 A;  3F8B A;  4MTD A;  4A6D A;  3IWZ A;  2DT5 A;  1G4D A;  1IF1 A;  2H09 A;  2QUF A;  5EEG A;  3SQN A;  5CVI A;  5E8G A;  1PP7 U;  4U0W A;  2KKO A;  3GFI A;  1IRG A;  2EFP A;  2LSO A;  3O3K A;  3P9I A;  1IN7 A;  3GLX A;  3WTV C;  3CO7 C;  2K4J A;  2CO5 A;  1J7K A;  4MTE A;  1FZP B;  5FGM A;  2RVC A;  2QQB A;  2DQR A;  4AIJ A;  2R7F A;  4I02 A;  3WTX C;  2CG4 A;  2F5D A;  5D8K B;  1FLI A;  4NB5 A;  3NEU A;  1O3S A;  3WGH A;  1O3R A;  1ZG3 A;  3KET A;  3MQ0 A;  4KIC A;  5DEQ A;  1EH8 A;  1W7P A;  3V8J A;  2M5W A;  5DCF A;  3F6V A;  1Z6R A;  4P9U A;  3I5U A;  4HW0 A;  3AAF A;  4LJZ F;  2IP2 A;  4ENM A;  2XAG A;  1RUO A;  1FBU A;  5ILV A;  2MH2 A;  3MZY A;  5CJ9 A;  3C7J A;  4RGX A;  4UVB A;  4DQ2 A;  2QYO A;  2ACJ A;  3BZ6 A;  3LST A;  5D6E A;  4A5M A;  2HFH A;  1W7P D;  5FD6 A;  1U5T B;  2IRF G;  4U0V A;  1YW9 A;  1G3S A;  1U5T A;  2PI0 A;  4BNC A;  2O3F A;  1STZ A;  2QEN A;  2A61 A;  4EJT A;  2MH9 A;  4FHT A;  2EV5 A;  5HS8 A;  3CUO A;  1L0O C;  3BJO A;  2CW0 F;  2HZT A;  1PDN C;  2EFW A;  2M87 A;  2P7C B;  5CVU A;  3BRO A;  3JW4 A;  4HLX A;  4OMY A;  1UHM A;  2GAU A;  3CO6 C;  3FMS A;  2P8T A;  2XKO A;  3KLN A;  4PGH A;  4UVC A;  5F64 A;  3SXY A;  1OYY A;  2FNP A;  3BJ6 A;  2O61 A;  4IRG A;  4MEY F;  5FB2 A;  3QOP A;  4M9S A;  4CHU A;  1BBY A;  2L4M A;  3PFI A;  3R61 A;  1D8J A;  4BH9 A;  1GVJ A;  1BC8 C;  2STW A;  1FNN A;  1HBX G;  1EH6 A;  1YS7 A;  1SD6 A;  1FPQ A;  1BM9 A;  2PMU A;  1FC3 A;  3M7G A;  3O2P E;  1ZN2 A;  1LB2 A;  4L0Y B;  3RJP A;  2STT A;  2RGV A;  4UHT A;  3LA3 A;  4MNU A;  1HST A;  1TQP A;  4EM0 B;  1KQ9 A;  4LB6 B;  2XHK A;  2OQR A;  3F21 A;  5ICG A;  1IN4 A;  2JPC A;  1SFE A;  2Y0M A;  4KA4 A;  5FD5 A;  3CJN A;  1HQC A;  4ZZL A;  1WQ2 A;  2BBY A;  2OBP A;  2ISY A;  4MQV A;  3I59 B;  2V1X A;  4KNY A;  1FP1 D;  4M73 A;  3I59 A;  3D0S A;  4UVA A;  1FYK A;  5IT9 K;  1TQI A;  2XKP A;  1MDM B;  3WU1 B;  2QQA A;  1MDM A;  1ZAR A;  1KQ0 A;  2CYY A;  1ZGJ A;  4M9Z A;  1I6X A;  4XBF A;  1U3E M;  3TGN A;  3VFZ A;  4JBA A;  3QPT A;  2Y75 A;  2YR2 A;  1ZRF A;  1ODD A;  1W4M A;  3LAP A;  3F8C A;  3IC7 A;  1B1B A;  3WOD F;  2ISZ A;  2BEO A;  4G6D A;  3IKT A;  2FMY A;  4HDU A;  1ON1 A;  2WWY A;  1IN6 A;  2FQ3 A;  4DNC A;  4OIN F;  5DDG A;  4M74 A;  4OOI A;  2V79 A;  1U5T C;  4ESB A;  1ZLK A;  2VOP A;  5E20 A;  1ZG1 A;  4OIP F;  3GZ6 A;  4D0P A;  2WV0 A;  3IWF A;  1IAW A;  4HAM A;  1S29 A;  4HYE A;  1G3W A;  5DUI A;  1R7J A;  2HQN A;  2NNY A;  1KGS A;  2XUB A;  3J80 Z;  3KCC A;  2M45 A;  2TDX A;  2P4W A;  2H6C A;  5ICF A;  1SD4 A;  5LRR A;  2VC1 A;  1T39 A;  3U2R A;  4UUV A;  5E18 F;  5HDG A;  1MD0 A;  1BI2 A;  3ZP5 A;  2DPD A;  1QGP A;  4EGZ A;  4G8X A;  2HTJ A;  2K02 A;  4XLP F;  1G6N A;  1I5Z A;  4Q4Z F;  3ERE D;  3ZN1 A;  1REP C;  1BI0 A;  4JK1 X;  5H20 A;  1T2K A;  2XV4 S;  5E17 F;  1XN7 A;  1O7F A;  3LQR A;  3U1D A;  4HQM A;  1RNL A;  4CZZ A;  2HS5 A;  1TBX A;  2EV0 A;  3RKX A;  4HV5 A;  3C1D A;  3KEQ A;  1E2X A;  1J2X A;  1KA8 A;  1H9G A;  3TDU C;  5LHI A;  2P5L C;  5LGU A;  2FBI A;  2IJL A;  2DBB A;  2LF7 A;  5ICE A;  3E5Q A;  4HV6 A;  2ZME B;  2ZJ2 A;  2OQG A;  3J81 Z;  3GXO A;  1B9M A;  4GGG A;  4F7Z A;  4LLG F;  2EJR A;  4BXU A;  5D6F A;  4L0Z B;  1TQM A;  2LKP A;  5BQT A;  2NRA C;  2KJB A;  4PZJ A;  3K1N A;  4AIH A;  2DW4 A;  3V8L A;  5DCM B;  1XSV A;  4ENN A;  2RN7 A;  5ICC A;  1IRF A;  3ZPL A;  2RC4 A;  4NHJ A;  1BI3 A;  1V4R A;  3Q5F A;  1QO0 D;  1F5T A;  4U7B A;  2QVO A;  2RV8 A;  3KZY A;  1U8R A;  2FEZ A;  2L02 A;  1DUX C;  1A04 A;  5J8F A;  2CGP A;  3G3Z A;  2QWW A;  3E6M A;  5FFZ A;  1C0W A;  1KU3 A;  3FZV A;  4ETS A;  5HLG A;  3HSF A;  5FFX A;  5LGT A;  4I7H A;  1USS A;  1R1V A;  2XIG A;  1KU7 A;  1MZB A;  1TNT A;  2ADU A;  3FHZ A;  2WC2 A;  2HKO A;  2VN2 A;  4WX9 A;  2L3D A;  1ZH5 A;  2O8X A;  5L3D A;  3T8R A;  4IF4 A;  2W25 A;  3HOT A;  1Z05 A;  2V1D A;  4I09 A;  2FA5 A;  3DPT A;  3EYY A;  1ON2 A;  2MBF A;  1T6S A;  2QLZ A;  2VBY A;  3HRS A;  2VT2 A;  5LEJ A;  3G73 A;  4TV7 A;  2ZO4 A;  3E6B A;  4RS8 A;  3V7S A;  1RUN A;  3R6S A;  1W5S A;  3H92 A;  1I1S A;  5AIP A;  3CTA A;  2EFN A;  2P6T A;  4XLN F;  5D8L B;  1TW2 A;  2YSR A;  3WE3 A;  3J80 K;  3BDD A;  4U7D A;  3SZT A;  1Z7U A;  3M8E A;  1XCV A;  2UXN A;  3IL2 A;  3QRF F;  4KT5 C;  2FML A;  2AS5 F;  3FWE A;  4I0B A;  3OV8 A;  1B59 A;  2H94 A;  3RIR A;  4ENJ A;  4ON0 A;  2J5O A;  2AXL A;  3GW2 A;  1K79 A;  2IW5 A;  2VXZ A;  4LK0 F;  4A5N A;  3WTS C;  2BYV E;  1WI9 A;  1K7A A;  2XVC A;  1OKR A;  1WKM A;  2L4A A;  5A2Q Z;  2A6E F;  1K78 B;  1LJ9 A;  5KK1 A;  3MFK A;  3E3V A;  1K78 A;  2JSC A;  3RTR A;  5L3G A;  1IN5 A;  1D8K A;  3VOE A;  1AWC A;  2UZK A;  2IT0 A;  3LAJ A;  2GWR A;  3REO A;  5J6X A;  3T0Y A;  4ZZD A;  2ZFW A;  3V8K A;  4WXD A;  2V9V A;  4XRF A;  3JAM Z;  2P7V B;  4UV9 A;  3WGG A;  2IA1 A;  3TO9 A;  5D5X B;  5BMZ A;  1OMI A;  5D5W B;  4P9F A;  3ZMS A;  2LDU A;  3JTH A;  3D5L A;  3MZH A;  3RI4 A;  2D1H A;  4RB3 C;  1RIO H;  1OYW A;  1XMK A;  1DPU A;  3HIF A;  4N9I A;  1S8N A;  3FM3 A;  1SMT A;  3HSR A;  2NS0 A;  1YIO A;  1Z91 A;  3E6C C;  1L3L A;  4UNO A;  1BC7 C;  2XAS A;  2QQ9 A;  3EYI A;  2Q0O A;  3I0T A;  3ABT A;  2OAZ A;  2DAO A;  3K69 A;  2FBH A;  1TTY A;  4IRH A;  1DPR A;  4M6X A;  2V6C A;  1G3Y A;  1XGO A;  4QWQ A;  1FSE A;  1QBJ A;  2V1U A;  1FYL A;  1UHW A;  2OA4 A;  4N0B A;  4EJV A;  3M9A A;  5BPD A;  1FBS A;  2PN6 A;  1B6A A;  2KIF A;  1TW3 A;  1ZLJ A;  4HBL A;  3KP4 A;  2G9W A;  1O3T A;  2A69 F;  4ASN A;  3GFL A;  5HLH A;  3ZN0 A;  1YS6 A;  1O57 A;  2QBY B;  5HS9 A;  1F1Z A;  2F5C A;  2QBY A;  5DYM A;  1D5V A;  2CFX A;  3HUG A;  3FX3 A;  1Z1D A;  1G3T A;  4FT8 A;  3WTY C;  2K27 A;  1BIA A;  3Q9S A;  4QLC U;  3RKW A;  3QAH A;  2FE3 A;  2QM3 A;  2HYF A;  1R58 A;  3W6K B;  4MQ9 F;  2GQQ A;  1E17 A;  3LA7 A;  3FXQ A;  3GF2 A;  4EJO A;  1Y0U A;  5JHU A;  5LGN A;  4AWX B;  3F22 A;  4K2E A;  4G9Y A;  4MGR A;  4EVI A;  2VBW A;  1SFX A;  3COA C;  3TO7 A;  3KE2 A;  3HYI A;  4HX8 A;  4L9J A;  5AON A;  4EJU A;  2CSO A;  2A5Y B;  5DUK A;  2DK8 A;  4XSZ F;  3Q9V A;  4Z2Y A;  5D5V B;  5L3B A;  3GUD A;  2RKH A;  2HQR A;  1ZAO A;  2XAJ A;  3I58 A;  2MLK A;  1JXS A;  4OIO F;  4Q5S F;  4EV0 A;  5HS7 A;  3I4P A;  1AOY A;  4G7Z F;  3ML6 A;  4RAZ A;  2VE8 A;  4CYD A;  5KVR A;  1J5Y A;  2CWE A;  4OMZ A;  4KMF A;  2EK5 A;  5H6Q A;  1KYW A;  3FM5 A;  3JAM K;  1S7A A;  2ESH A;  1CGP A;  3B73 A;  2FF4 A;  1ZYR F;  2A3S A;  4RB1 A;  4P55 A;  3EQL F;  2EB7 A;  1KU2 A;  2OZ6 A;  4A0X A;  3HTS B;  3ISP A;  2XAF A;  1B9N A;  5E1W A;  2F5E A;  2GXB A;  3MCZ A;  4YII A;  3H3Z A;  4G94 A;  2RQP A;  3BP8 A;  3R4K A;  4AIK A;  2GA2 A;  4P96 A;  2ZNZ A;  1HXD A;  4GYI A;  1R5G A;  1O3Q A;  4IXA A;  3WTU C;  1FBQ A;  3CUQ C;  3S2W A;  5D5U B;  1HKQ A;  4LFU A;  4G7H F;  4FX0 A;  4WF2 A;  4MHG A;  2Q8K A;  2UXX A;  3V7R A;  5CVJ A;  3P7N A;  4CGZ A;  1RZ4 A;  4S04 A;  2PEX A;  1YTY A;  2JRT A;  2K7L A;  3KP6 A;  4LB5 A;  1UST A;  3BPV A;  4BQA A;  1FX7 A;  2VBX A;  4O3M A;  3GZ5 A;  1DP7 P;  1CF7 B;  4U88 A;  3DF8 A;  3DKW A;  1CF7 A;  3K9T A;  3HHG A;  2H27 A;  3ECO A;  3SFZ A;  4HQE A;  1YYV A;  3ZMD A;  3GFM A;  3TQN A;  5JR3 A;  3DXJ F;  1QZY A;  1R1U A;  3DV8 A;  5H6R A;  1JGS A;  3VEP A;  3QU3 A;  1GXQ A;  2ZME A;  1X3U A;  1F9N A;  1WSU A;  2A6H F;  1FP2 A;  3R0A A;  2FBK A;  2EV6 A;  2IVM A;  3U9G A;  5BS6 A;  5L3C A;  3I64 A;  3RPQ A;  1P4X A;  4L18 B;  3F23 A;  2ZNY A;  1WRJ A;  1BOA A;  1SFU A;  1SD5 A;  3BWG A;  5DCM A;  4HOB A;  1B4A A;  1BJA A;  4RGS A;  4L9V A;  3B02 A;  1K6O A;  3ZMU A;  1QQI A;  4IJA A;  1FYM A;  3SHF A;  1R36 A;  4ZYD A;  1QNT A;  4AVP A;  4A2U A;  1YG2 A;  1RI7 A;  2XAQ A;  1J9I A;  4KIB A;  4PCQ A;  1XGS A;  2HR3 A;  4PDK A;  2DI3 A;  4BHP A;  4I01 A;  4HLY A;  1MKM A;  1LQ1 A;  2MC3 A;  5DD4 A;  4YFX F;  1TNS A;  3R0J A;  1YQA A;  4IHT A;  1XD7 A;  1IUY A;  1OR7 A;  3TO6 A;  3L09 A;  3I54 A;  4BAY A;  4YG2 F;  3WE2 A;  1PP8 F;  3WTT C;  3HTU A;  2Y48 A;  5FO5 A;  2Z9O A;  3WGI A;  1OPC A;  4G7O F;  5HVQ C;  1FOK A;  4EGY A;  2MA3 A;  4HA8 A;  5DD8 A;  1IZ1 A;  1LEB A;  3EET A;  4I98 B;  3TOA A;  2WTE A;  3HRT A;  1D3Y A;  2NYX A;  1T98 A;  5K5R A;  4E70 A;  2HYG D;  3GO5 A;  1ZG5 A;  2FRH A;  3ZMT A;  1XB4 A;  3EUH A;  3GEZ A;  4LLN A;  1MJ9 A;  2NAZ A;  5L3E A;  3V7C A;  1J0R A;  4WCG A;  1Q1H A;  1P2F A;  2Z3Y A;  4KN4 X;  1YW8 A;  1R00 A;  3KLO A;  3L2C A;  3ABU A;  4EJW A;  3ECH A;  2GXG A;  4FX4 A;  2EFO A;  4B8X A;  1LVA A;  1HW2 A;  3DQV C;  1IXR C;  3ZMZ A;  5E1Z B;  4UV8 A;  4HF0 A;  1JHF A;  5FLX Z;  1FWZ A;  2YPR A;  2IA0 A;  2PMH A;  2ZCW A;  5BPI A;  4LK1 F;  3KP2 A;  3NQO A;  2MD5 A;  5CYV A;  3WG9 A;  4KUM A;  1GXP A;  1ZHF A;  4L5J A;  4OIR F;  5IT9 Z;  2JT1 A;  4LGW A;  3F3X A;  3GVA A;  5IT3 A;  3IKV A;  5ILU A;  4R79 A;  4UXN A;  2JZY A;  1ZRD A;  5HLI A;  1IW7 F;  2EA2 A;  1W7P B;  4GCV A;  1J59 A;  3H3U A;  2HKX A;  3V4G A;  3J81 K;  2JTV A;  4BYY A;  3KP5 A;  4BHB A;  3P9C A;  1LDK B;  2F5F A;  1NHA A;  1IXC A;  2O0Y A;  5JVT A;  2IA2 A;  1V3F A;  5E1X A;  4GO1 A;  2P5V A;  4IHS A;  2COM A;  3FXU A;  2HEO A;  4HF1 A;  2VT3 A;  3KEO A;  3LA2 A;  4KMU X;  3T1B A;  2FU4 A;  4R1H A;  3FF5 A;  5ED4 A;  4H0E A;  3TOB A;  2O6G E;  4LMY A;  4M6Y A;  3HOS A;  2GZW A;  3FXR A;  4KDP A;  1P4A A;  2JPB A;  4U0Y A;  1YFH A;  3CUQ B;  4L5I A;  4CDG A;  3CLO A;  1HKS A;  1XSX A;  3CUQ A;  3ZMV A;  4O5V A;  3TDZ C;  3T5X A;  1H0M A;  2YX4 A;  2RNJ A;  3GYH X;  2X0L A;  2XRO A;  2P6S A;  5HOO A;  3F8F A;  3QP5 A;  3W6J B;  3F6O A;  3O6B B;  5HDN A;  1S3J A;  3HHH A;  3WTW C;  2EFQ A;  1O7L A;  1S7O A;  4YIF A;  2P5K A;  4RGU A;  5EEH A;  4S05 A;  1EV7 A;  1H9T A;  3L9F A;  1P92 A;  1KQ8 A;  2HDC A;  3ELK A;  2W85 A;  2HOE A;  3KP3 A;  5J8C A;  1R23 A;  1FT9 A;  2XGX A;  3QPH A;  4GYG A;  3MWM A;  1VTN C;  3BPX A;  5F1R A;  1BIB A;  2D1V A;  3RYP A;  3ULQ B;  1XGN A;  2G7U A;  4HZF A;  3GX4 X;  2H6B A;  1R22 A;  2DFI A;  1XMA A;  4A0Y A;  1F4K A;  2DU9 A;  4R8H A;  2XRN A;  3EDP A;  4HX7 A;  1XDS A;  5DV5 A;  4P5O A;  3BJA A;  4L9T A;  3DFG A;  4CO8 A;  1SAX A;  5LHG A;  4L9N A;  4LLL A;  3C3W A;  1P4W A;  4EMS A;  3K0L A;  1SD7 A;  4WXC A;  4O6J A;  4IVN A;  2F2E A;  3JSO A;  2VC0 A;  4M9X A;  2VOO A;  2J5P A;  4A0Z A;  2Z5U A;  4RGR A;  1FSH A;  4JQF A;  2YU3 A;  3NRV A;  2XAH A;  4KYW A;  1HW1 A;  4Q47 A;  2KRF A;  5HDK A;  3WU0 A;  2KJC A;  3RYR A;  3RKY A;  4MEX F;  1XCB A;  5FLX K;  5K5Q A;  2BV6 A;  3MAJ A;  3HSE A;  5A2Q K;  2W84 A;  4ESF A;  4HDV A;  3SZP A;  1SMY F;  2B0L A;  2BE5 F;  1J75 A;  4HF2 A;  2E7W A;  4I2O A;  1KU9 A;  4KIG A;  3L7W A;  1ULY A;  2L54 A;  3CDH A;  1TLH B;  4ZYH A;  2E1N A;  3PQJ A;  4IPA A;  3TKY A;  1YLF A;  3RPU A;  1BI1 A;  3GWZ A;  4KIF A;  1IXS B;  1LDD A;  5TJJ A;  2GA1 A;  2M30 A;  1UB9 A;  3R60 A;  1GHC A;  4OU0 A;  3J7A O;  1Z6T A;  3E6D A;  3JSP A;  4AD9 A;  2E1C A;  1U6G A;  4WWC A;  4LG0 B;  2K4B A;  5TRD A;  4CXF A;  4LG0 A;  2DPU A;  1UFM A;  4ZYG A;  2FXA A;  1XSD A;  3LFK A;  1Z9C A;  2BGC A;  3C18 A;  3IRQ A;  3T8T A;  3M8F A;  5F6F A;  1ZRE A;  3QP6 A;  1OYI A;  3VB2 A;  5BOX A;  3JTG A;  1R1T A;  4EM1 A;  3K1P A;  2UWM A;  1HW5 A;  2DK5 A;  2OZU A;  5D4S A;  5LBQ A;  2FNA A;  1I27 A;  1LNW A;  5AIQ A;  3KZZ A;  2VON A;  2Z99 A;  1UCR A;  3MEX A;  2VE9 A;  3N4M A;  3ZQ7 A;  2CQK A;  5E8I A;  1R5H A;  4YFN F;  4N9H A;  1ZRC A;  1YW7 A;  1QPM A;  2PQ8 A;  1HKT A;  3WTZ A;  3I71 A;  3N97 A;  2DTR A;  3IRR A;  1W5T A;  4KFC A;  3ROU A;  2KIU A;  4Q48 A;  4ZYE A;  5CVR A;  2PFB A;  2Z33 A;  2HGC A;  1BN5 A;  2W24 A;  2FOK A;  3L00 A;  4PGG A;  2G7H A;  1IN8 A;  2ELH A;  2GIV A;  1S6L A;  2PG4 A;  3OOP A;  3PQK A;  1QZZ A;  2D2W A;  4I0A A;  6PAX A;  2HTS A;  3LQQ A;  4XSX F;  3FMQ A;  2W57 A;  4B09 A;  2EWN A;  3KFW X;  3IHU A;  2IPQ X;  5LRS A;  4Y15 A;  1JE8 A;  2EA4 A;  4IRI A;  5LLQ A;  2OD5 A;  4Y13 A;  2HWV A;  1ONV A;  3F72 A;  3VOD A;  2PBI A;  1T38 A;  2R7D A;  5ILS A;  3E97 A;  1MJA A;  2VBZ A;  2O03 A;  2A68 F;  3K1M A;  3E5U A;  3KP7 A;  4RB0 A;  1DDN A;  4ZH4 F;  2QZ8 A; 
#chains in the Genus database with same CATH topology
 1S72 I;  3QU6 A;  5LHH A;  3JRA A;  3LWF A;  1RR8 C;  5JI6 A;  1A6I A;  1XDU A;  1FOW A;  5ERI A;  1OQY A;  5L3F A;  2D45 A;  4ESJ A;  4HX4 A;  4RB2 C;  2ETH A;  3IH2 A;  3F8M A;  2R7V A;  5K1Y A;  2R3S A;  2K5C A;  1QA6 A;  2DLL A;  4Y4R A;  3GFJ A;  5GAE J;  4QIW N;  5CLS A;  3OSF A;  2Y69 H;  3K2Z A;  1WJF A;  2LF8 A;  2X4H A;  4A12 A;  1WWX A;  1MBK A;  2Q2E B;  3P9K A;  3CME I;  3CCM I;  2YX7 A;  3EPZ A;  1N25 A;  1UG2 A;  4YEL A;  1KYZ A;  1FY7 A;  2Q2E A;  5EDN A;  1GDT A;  4GFB A;  1LFB A;  1ZK8 A;  3PFY A;  2MAB A;  2LNB A;  3FHN A;  4C3J J;  4FTH A;  1X1C A;  2L9R A;  3WG7 H;  1HSJ A;  1XGM A;  1LDJ A;  1DGW Y;  2M1B A;  3ZQH A;  3BTJ A;  3A0B C;  5TIS C;  1XG1 A;  3QPL A;  2DA2 A;  4AYB N;  3FIW A;  3OYL A;  1I3Q J;  1U0J A;  3Q0V A;  2L0K A;  4M72 A;  4CIC A;  5CKT A;  1JT0 A;  3CC4 I;  4OIQ F;  4YFK F;  1YX3 A;  5LEK A;  4A6E A;  1I1G A;  3RDI A;  2NNN A;  2UUZ A;  4E7J A;  4LD5 A;  4BHC A;  2VJ4 A;  5D4R A;  2DQL A;  1A6Q A;  2XF6 A;  3HRU A;  4EQQ A;  1EH7 A;  2ZXJ A;  4ENK A;  2VOD A;  2KRC A;  4G6Q A;  1JHH A;  1T0F A;  1PUE E;  1MGT A;  1XPX A;  3TW7 A;  1YO5 C;  2KIM A;  4DYC A;  4HST A;  3SJM A;  1FTT A;  3DPL C;  1U2W A;  2DMT A;  1ETY A;  2ESN A;  3BY6 A;  3MMY B;  3FXK A;  1G8X A;  2OU2 A;  2X48 A;  1TT5 B;  1VQK I;  4KN7 X;  3KYC B;  2WAD A;  3IH3 A;  2E7X A;  2ZBK A;  1HCR A;  3A1Y A;  1I6H J;  3FMR A;  2A07 F;  3I53 A;  3DU5 A;  4BE2 A;  2JMW A;  4IEJ A;  1R49 A;  3M1E A;  3HC7 A;  4GXO A;  5JFR A;  3PL8 A;  4RAY A;  4RM3 A;  1Z7L A;  2PJP A;  4Y17 A;  3RKQ A;  1U78 A;  2DOF A;  2JUC A;  2FSW A;  4WXH A;  4ITV A;  3J7Z I;  2K86 A;  1WGX A;  5J1Y A;  4M71 A;  1OLT A;  2RNG A;  3BOQ A;  2E36 A;  4BE1 A;  2X85 A;  4NQW B;  5CVV A;  2RDP A;  1ZGA A;  4EM2 A;  1MJB A;  3F8N A;  4NQW A;  4WK8 F;  1MSE C;  1YJ9 I;  2C6Y A;  1P6R A;  1LEA A;  3HRM A;  2EZH A;  2L01 A;  2ZKZ A;  1WH7 A;  2MLG A;  2DO7 A;  5K5O A;  2M8E A;  2WA0 A;  2PLY A;  3FKJ A;  1JTY A;  2K9N A;  3PSI A;  1XTA A;  1ZTR A;  1MMG A;  3DEU A;  3E5X A;  3OYI A;  3FDY A;  3DP7 A;  4S0H B;  1POG A;  1X3W B;  3F8B A;  4MTD A;  4Y52 J;  4A6D A;  3IWZ A;  2DT5 A;  3CCY A;  3PO3 J;  2BY3 A;  5KNL A;  1G4D A;  3DWL E;  4H4K C;  5CPR B;  1IF1 A;  2H09 A;  2EPF A;  2QUF A;  5EEG A;  3SQN A;  4B3A A;  3PM1 A;  4XLC A;  3ZQI A;  5CVI A;  5E8G A;  4C30 A;  1PP7 U;  2EIM H;  4U0W A;  2KKO A;  4B4C A;  1W5C C;  3GFI A;  2AQE A;  1R4M B;  3VYT B;  1IRG A;  1ZGW A;  1W1W E;  2EFP A;  4A3M J;  2LSO A;  1UAA A;  4XKC A;  1E0E A;  3JRD A;  1VQ5 I;  4C3I J;  3O3K A;  4XR6 A;  3P9I A;  4MFE A;  2OC6 A;  1IN7 A;  2LY1 A;  3GLX A;  4FET A;  1EJ9 A;  3WTV C;  3J7Y J;  2WAQ A;  3CO7 C;  2K4J A;  2MG4 A;  2CO5 A;  1J7K A;  1LFP A;  4MTE A;  4A3F J;  1ZKG A;  1FZP B;  2KPM A;  3GBG A;  3BZC A;  5FGM A;  4XK4 A;  3Q0U A;  1ZR4 A;  2RVC A;  3ABL H;  2QQB A;  2DQR A;  4D7N A;  4AIJ A;  1JJ6 C;  2R7F A;  4AUX A;  4I02 A;  3WTX C;  1ETV A;  1OCZ H;  4BUP A;  1IG7 A;  2CG4 A;  4A3C J;  2F5D A;  5GTI C;  2QEX I;  1R4N B;  5D8K B;  1FLI A;  4PSX A;  4NB5 A;  2OPT A;  1OCP A;  3NEU A;  2M4K A;  1O3S A;  3WGH A;  1O3R A;  1ZG3 A;  3KET A;  3MQ0 A;  4KIC A;  2X6W A;  5DEQ A;  1EH8 A;  1Y0N A;  1W7P A;  3SZG A;  2LFB A;  5KHD A;  3ZQL A;  4BL0 B;  3V8J A;  2M5W A;  5DCF A;  4XRS G;  3F6V A;  1DU6 A;  1Z6R A;  3I5U A;  4P9U A;  2XF5 A;  4HW0 A;  3AAF A;  1M1E B;  1IV8 A;  4LJZ F;  5F0C A;  2IP2 A;  4ENM A;  3BG3 A;  5CQG A;  2XAG A;  1MSF C;  1RUO A;  4BS9 A;  1FBU A;  5ILV A;  2MH2 A;  3MZY A;  5CJ9 A;  5DM7 F;  3C7J A;  4RGX A;  4UVB A;  1Z67 A;  5KAF C;  4DQ2 A;  4UB6 C;  2QYO A;  5DS9 A;  2ACJ A;  3BZ6 A;  3LST A;  5D6E A;  1XX5 A;  4A5M A;  2HNH A;  2HFH A;  5J1R A;  3IUO A;  1W7P D;  2CRG A;  1HLV A;  3K2A A;  5FD6 A;  5FKK A;  5JVG F;  1U5T B;  2IRF G;  3BR6 A;  4U0V A;  1YW9 A;  1G3S A;  1U5T A;  4BQN A;  4F92 B;  3S1Q J;  2PI0 A;  4BNC A;  2NVQ J;  3A4C A;  2DOD A;  5IOY A;  2AQF A;  2O3F A;  1STZ A;  2QEN A;  4LG3 A;  2A61 A;  4CH7 A;  2MH9 A;  4EJT A;  4FHT A;  3CJR B;  2NS8 A;  2EV5 A;  4I76 A;  5HS8 A;  3CUO A;  1L0O C;  3BJO A;  2CW0 F;  2X1D A;  2HZT A;  1PDN C;  2EFW A;  1YIJ I;  2X1C A;  2JN6 A;  2M87 A;  3BG6 A;  2P7C B;  2JRM A;  5E3N A;  5CVU A;  3CC2 I;  1BOB A;  4ANJ A;  2HOA A;  3BRO A;  3RZO J;  4OAZ A;  4RMN A;  4ZTF A;  3JW4 A;  4HLX A;  2EIN H;  2OF7 A;  1WCM J;  4OMY A;  5EG0 B;  2Z2S B;  1UHM A;  2GAU A;  4PFO A;  3CO6 C;  2DJN A;  5EG0 A;  1HC8 A;  3FMS A;  2P8T A;  2XKO A;  3KLN A;  4PGH A;  2LLK A;  4UVC A;  4BXX J;  5F64 A;  3BLY A;  3SXY A;  1OYY A;  2FNP A;  1H8A C;  3BJ6 A;  2O61 A;  4IRG A;  4MEY F;  5FB2 A;  2GXA A;  3JRB A;  3KYL A;  2R7Q A;  1OFC X;  2VUM J;  3QOP A;  4M9S A;  5J47 A;  1V5F A;  4CHU A;  1BBY A;  3HPG A;  2L4M A;  3H9J A;  3PFI A;  3R61 A;  3FK6 A;  1D8J A;  1K6Y A;  1QVU A;  4BH9 A;  1GVJ A;  2VL8 A;  1TWG J;  1BC8 C;  3BR3 A;  3M1C A;  1T8I A;  2STW A;  1FNN A;  1HBX G;  1GLN A;  5FKO A;  5J3L A;  4RAF A;  2H1L A;  2F6C A;  1EH6 A;  1YS7 A;  3C2B A;  1TWF J;  1SD6 A;  2LRE A;  4RLF A;  3K4N A;  1FPQ A;  3M8J A;  4IQ4 A;  1BM9 A;  2LR8 A;  2PMU A;  1FC3 A;  3CP2 A;  3M7G A;  3K70 D;  2DTZ A;  2OUM A;  5FLM J;  3M3Y J;  3O2P E;  3JRF A;  5IPA A;  1ZN2 A;  3HJE A;  1LB2 A;  4F52 A;  1V55 H;  4C2U A;  4PK4 A;  4L0Y B;  4I99 C;  3RJP A;  2STT A;  2RGV A;  3E0J B;  4UHT A;  5GPC A;  3LA3 A;  2HVQ A;  4MNU A;  1HST A;  1TQP A;  3DU6 A;  4HSR A;  4EM0 B;  1KQ9 A;  3L2W A;  2DFF A;  2Q1Z B;  4FQG A;  4LB6 B;  2XHK A;  2OQR A;  3F21 A;  5ICG A;  1IN4 A;  2JPC A;  1SFE A;  4Y7N J;  2Y0M A;  1W36 D;  1TZL A;  1UG0 A;  4KA4 A;  5FD5 A;  3CJN A;  4IHY A;  4M3G A;  1HQC A;  4ZZL A;  4RLQ A;  1WQ2 A;  3S15 J;  2BBY A;  2E1M B;  3OS2 A;  4XRM A;  4JYK A;  3RZD J;  1QZE A;  4MFD A;  4ZDO A;  2OBP A;  1R6R A;  2ISY A;  4MQV A;  4BJ5 C;  3I59 B;  2MD0 A;  4XN3 A;  2V1X A;  2JWT A;  4KNY A;  3PIO F;  3CCL I;  1FP1 D;  4M73 A;  3I59 A;  3CF5 F;  3D0S A;  5IYC J;  2M9H A;  3OYD A;  3QYE A;  4UVA A;  1FYK A;  2HZD A;  2QF7 A;  5IT9 K;  1JUS A;  3TMO A;  2XKP A;  1TQI A;  2DT6 A;  3PO2 J;  2MSY A;  1MDM B;  4XIC A;  2V9P A;  2XGD A;  2QQA A;  4D5F A;  3WU1 B;  5F27 A;  1ZAR A;  1MDM A;  3LFU A;  4AM3 A;  2A5W A;  2OJE D;  1KQ0 A;  2CYY A;  1ZGJ A;  4L5E A;  1I6X A;  2DA3 A;  3BR0 A;  4JX6 A;  4M9Z A;  3NAU A;  4XBF A;  2EZL A;  1U3E M;  3CQZ J;  2AHQ A;  2W00 A;  2O8K A;  1JTX A;  4BBR J;  3TGN A;  3VFZ A;  2E5Z A;  4JBA A;  3KIO A;  3QPT A;  2Y75 A;  2HXI A;  2YR2 A;  2R5Z B;  1ZRF A;  2ZC2 A;  1ODD A;  1W4M A;  3LAP A;  2R5Z A;  2DJI A;  3F8C A;  1PVE A;  3IC7 A;  4IHV A;  3H0D A;  3DBH B;  1B1B A;  1CQT A;  3IV5 A;  4FE7 A;  3WOD F;  2ISZ A;  2LKS A;  2BEO A;  1FJL A;  2DYR H;  4G6D A;  2WB1 N;  3IKT A;  2FMY A;  4M3B A;  4HDU A;  1ON1 A;  4CA0 A;  3HG9 A;  3S3O A;  2WWY A;  1IN6 A;  2FQ3 A;  4DNC A;  4OIN F;  5DDG A;  4M74 A;  4XNF A;  2V7F A;  4OOI A;  4BE0 A;  3S1M J;  4X6A J;  2V79 A;  3RSN A;  1U5T C;  2HVR A;  4NC6 A;  4ESB A;  5F0H A;  4XLE A;  1ZLK A;  2VOP A;  5E20 A;  5CQE A;  3ZR8 X;  1ZG1 A;  4OIP F;  1UMQ A;  9ANT A;  3K4M A;  3ASN H;  4XKB A;  4D0P A;  3GZ6 A;  2WV0 A;  3IWF A;  2W82 A;  3ONQ A;  1IAW A;  4BDZ A;  2WB1 A;  4HAM A;  1WJD A;  4E6K G;  2VAS A;  1S29 A;  3FXJ A;  4HYE A;  4M3D A;  1JGG A;  4JX5 A;  1G3W A;  2PMZ N;  3ASO H;  3SDG A;  5DUI A;  1GV5 A;  3OYN A;  1R7J A;  2HQN A;  2NNY A;  1KGS A;  1WJB A;  2G0E A;  3HGG A;  1B8I A;  2XUB A;  3L1P A;  1ETX A;  3J80 Z;  3KCC A;  2M45 A;  2TDX A;  2M0M A;  2P4W A;  5J1U A;  1W0U A;  2H6C A;  2XB0 X;  5ICF A;  1SD4 A;  4ZC3 A;  2K85 A;  2DYS H;  4UUT A;  5LRR A;  2VC1 A;  1T39 A;  3G2B A;  3U2R A;  1MH3 A;  4UUV A;  5E18 F;  5HDG A;  3JRE A;  2F5V A;  1MD0 A;  4G6T B;  4YEJ A;  1BI2 A;  1Q1V A;  2IAI A;  2FQ4 A;  3ZP5 A;  3BTI A;  3DTE A;  2DPD A;  2XPU A;  4UB8 C;  2Y30 A;  1QGP A;  4EGZ A;  4G8X A;  5K7H A;  2IGO A;  2WAE A;  5GPA A;  3OWT A;  2HTJ A;  3QOE A;  2K02 A;  2ME6 A;  1LVK A;  4XLP F;  2BW3 B;  1JKQ C;  1G6N A;  2PJR B;  1I5Z A;  3I55 I;  4M3F A;  2BW3 A;  4Q4Z F;  3K70 C;  3ERE D;  3ZN1 A;  5J40 A;  3OYG A;  1REP C;  2PJR A;  1BI0 A;  4JK1 X;  1VQ7 I;  5H20 A;  3TED A;  1T2K A;  2EIJ H;  2XV4 S;  4DW6 A;  5E17 F;  1XMX A;  2ZXW H;  3SFI A;  1XN7 A;  1O7F A;  3HPH A;  3LQR A;  1QVT A;  3GCM A;  3U1D A;  4HQM A;  1RNL A;  2CQ7 A;  4CZZ A;  4D7M A;  2HS5 A;  1TBX A;  2EV0 A;  3RKX A;  4U87 A;  2DXI A;  4HV5 A;  3C1D A;  1Z21 A;  4UY8 I;  3KEQ A;  1E2X A;  2ZXH A;  1J2X A;  1KA8 A;  1H9G A;  3FKI J;  3TDU C;  2H8R A;  5LHI A;  2P5L C;  1W36 C;  5LGU A;  1OCR H;  2FBI A;  3H9G A;  2IJL A;  2A05 A;  2DBB A;  4E7S A;  3JRC A;  2LF7 A;  5ICE A;  1VQ9 I;  1LKX A;  4AVZ A;  1IV6 A;  2GM4 A;  4LIT A;  2EBI A;  3E5Q A;  4HV6 A;  1EF4 A;  2ZME B;  2NVU B;  2ZJ2 A;  2BY2 A;  4MLO A;  2OQG A;  3J81 Z;  3CDL A;  1B9M A;  3GXO A;  3MN2 A;  4GGG A;  4F7Z A;  3OYH A;  4LLG F;  2LD5 A;  2EJR A;  4BXU A;  5D6F A;  4L0Z B;  1TQM A;  2LKP A;  2KDO A;  4DBR A;  5BQT A;  2NRA C;  2X1E A;  2IEK A;  2KJB A;  4PZJ A;  1X4P A;  1X19 A;  3K1N A;  4AIH A;  1MMA A;  1N77 A;  2E1M C;  1ETO A;  2DW4 A;  3V8L A;  3W2A A;  2Z1D A;  4J00 A;  4PJN A;  3OL4 A;  5DCM B;  3H35 A;  4X1E A;  1XSV A;  4ENN A;  4DGW B;  2DDA A;  2LH9 A;  2RN7 A;  2CV1 A;  4B1R A;  1MNM C;  3QPS A;  5ICC A;  1IRF A;  2GOM A;  3ZPL A;  2RC4 A;  2GIZ A;  3B6A A;  4NHJ A;  3D5S C;  1BI3 A;  1V4R A;  3Q5F A;  4NC7 A;  1QO0 D;  1F5T A;  4U7B A;  2QVO A;  2RV8 A;  2CH0 A;  2A6T A;  3E1S A;  1D0Y A;  3DBR B;  4V2F A;  3KZY A;  1U8R A;  2FEZ A;  3H5R A;  2L02 A;  3CDI A;  1DUX C;  2F4O B;  1A04 A;  5J8F A;  2CGP A;  3I3L A;  2RRE A;  3F9K A;  3G3Z A;  2QWW A;  3E6M A;  2DMU A;  5FFZ A;  2QA4 I;  1C0W A;  1ITY A;  2VJ5 A;  1FIP A;  1KU3 A;  2K3P A;  2DT7 B;  1Z77 A;  3O8G A;  3SDB A;  3GLL A;  3KYD B;  3FZV A;  4ETS A;  5HLG A;  3HSF A;  2CUZ A;  5FFX A;  3WU2 C;  3RQI A;  5LGT A;  4I7H A;  1USS A;  1R1V A;  4V2G A;  2NVY J;  2XIG A;  5FKM A;  4A3I J;  1KU7 A;  1DGR M;  1JKR C;  2Z16 A;  1MZB A;  1TNT A;  3K4L A;  4FAS D;  2ADU A;  3FHZ A;  3CES A;  2WC2 A;  2HKO A;  3S1R J;  1MBF A;  2VN2 A;  3AG2 H;  4XQF A;  4WX9 A;  2L3D A;  4FIS A;  1ZH5 A;  1TP4 A;  2O8X A;  4NUB A;  5L3D A;  3T8R A;  4IF4 A;  2R7U A;  2W25 A;  2Y31 A;  2H8W A;  4E7I A;  3HOT A;  2CV2 A;  1BR4 A;  1Z05 A;  2V1D A;  3K4B A;  1WFX A;  2DA6 A;  4I09 A;  2E19 A;  4PJL A;  2FA5 A;  3DPT A;  4BJ6 C;  3EYY A;  1ON2 A;  2MBF A;  1T6S A;  2QLZ A;  2E35 A;  4IX7 A;  3BC8 A;  1F43 A;  2VBY A;  4BY1 J;  5EJC A;  1LUJ B;  3HRS A;  2VT2 A;  2HI3 A;  2BY0 A;  4A69 C;  5LEJ A;  3JRI A;  2O5R A;  4TV7 A;  3G73 A;  2ZO4 A;  3E6B A;  4RS8 A;  3V7S A;  3OR2 C;  3OL3 A;  2KT0 A;  1RUN A;  3R6S A;  2COB A;  1W5S A;  3H92 A;  2HPM A;  1ENH A;  4DIQ A;  1I1S A;  2WAQ N;  5AIP A;  3CTA A;  2EFN A;  2P6T A;  3L2V A;  3GZN B;  4II2 A;  4XLN F;  5D8L B;  1TW2 A;  2NOJ B;  2YSR A;  4XRS A;  1JKO C;  3WE3 A;  3J80 K;  3NWT A;  5M5W J;  3BDD A;  4U7D A;  1WPK A;  3S8P A;  2XC7 A;  5HOD A;  5GTH C;  3SZT A;  4CCL A;  1Z7U A;  2E1O A;  3M8E A;  3G1M A;  1XCV A;  3DEW A;  2DA4 A;  2UXN A;  4E7Z A;  3IL2 A;  1Y8R B;  3QRF F;  4KT5 C;  2XGC A;  3CCS I;  2QSF X;  1K4T A;  2FML A;  2AS5 F;  3LSK A;  3BG5 A;  3FWE A;  5J4Y A;  2KLO A;  4I0B A;  3OV8 A;  1B59 A;  2H94 A;  3RIR A;  1XS9 A;  2FD5 A;  4ENJ A;  4ON0 A;  3GTK J;  3HOW J;  2B7E A;  2KHM A;  4EAT A;  2J5O A;  2AXL A;  1JI8 A;  3GW2 A;  3H9Q A;  1K79 A;  2IW5 A;  1MBH A;  1RRJ A;  2VXZ A;  4II3 A;  4LK0 F;  4A5N A;  3QYB A;  4HRI A;  2UV1 A;  3WTS C;  2BYV E;  3S32 A;  2R0Q C;  4F93 B;  1RR7 A;  1WI9 A;  3JRH A;  1K7A A;  1APL C;  2XVC A;  1OKR A;  3TP3 A;  1WKM A;  2L4A A;  3VWB A;  5A2Q Z;  3AFH A;  2A6E F;  1K78 B;  1LJ9 A;  3MD2 A;  4B44 A;  5KK1 A;  3MFK A;  3VYR B;  3E3V A;  2BY1 A;  1Y1W J;  1K78 A;  2JSC A;  3RTR A;  1BL0 A;  5L3G A;  1IN5 A;  1D8K A;  1TWA J;  1NG7 A;  3ZOB A;  2CV0 A;  5LD2 C;  1VQN I;  1RC9 A;  3VOE A;  4BQO A;  3FBN B;  4ZYA A;  1D0Z A;  2EIK H;  2L7K A;  3OYC A;  3MKY B;  3CMA I;  2VKH A;  1AWC A;  3OS0 A;  2UZK A;  2EZK A;  2IT0 A;  3GTJ J;  2DFE A;  3S14 J;  3LAJ A;  2ZME C;  2GWR A;  4XOR A;  3REO A;  5J6X A;  1D0X A;  4YIR X;  2CU7 A;  2KMU A;  3T0Y A;  4ZZD A;  1K61 A;  2ZFW A;  4Y33 A;  3V8K A;  4WXD A;  5GAH J;  2V9V A;  4XRF A;  1DQU A;  2P7V B;  4UV9 A;  3WGG A;  2IA1 A;  3JAM Z;  5EEA A;  3TO9 A;  5D5X B;  5BMZ A;  1OMI A;  3OR1 C;  4P9F A;  5D5W B;  2V26 A;  2LDU A;  2N8G A;  3JTH A;  3D5L A;  3ZMS A;  1X58 A;  3MZH A;  4XL9 A;  3I4N J;  3FXM A;  1YI2 I;  3RI4 A;  2D1H A;  3OIP A;  4B47 A;  2LMD A;  2OTL I;  4RB3 C;  1RIO H;  1OYW A;  3H5N A;  1XMK A;  3TP0 A;  1DPU A;  3HIF A;  2L7M P;  3DPU A;  4N9I A;  1S8N A;  3BR1 A;  3FM3 A;  1SMT A;  3HSR A;  1FEX A;  4P1W A;  3P5J A;  4PUS A;  3I4M J;  1RKT A;  2NS0 A;  2V1N A;  4XOT A;  3FXO A;  1YIO A;  2IS2 A;  3HOV J;  1Z91 A;  3E6C C;  1L3L A;  4BEH B;  2CW7 A;  4UNO A;  1BC7 C;  2XAS A;  4IO9 F;  2JUG A;  2OCC H;  3PNY A;  4NNJ A;  4BEH A;  4I6Z A;  5C3E J;  1SC7 A;  4AU7 A;  2ELJ A;  1F36 A;  2QQ9 A;  2ID3 A;  3EYI A;  2DCE A;  2Q0O A;  3I0T A;  1BA5 A;  5K7Z A;  1JUM A;  3ABT A;  2OAZ A;  1X3Z B;  2DMN A;  2DAO A;  2DA1 A;  3K69 A;  1UHS A;  2FBH A;  1TTY A;  2R4G A;  4IRH A;  5B1B H;  1DPR A;  4BQQ A;  4M6X A;  4PSW A;  3CCQ I;  5B1A H;  3GTL J;  2V6C A;  3CD6 I;  1G3Y A;  1XGO A;  4QWQ A;  1FSE A;  1MBE A;  2KP6 A;  1QBJ A;  2V1U A;  1FYL A;  1UHW A;  2CQN A;  2WBM A;  2W4S A;  2CUJ A;  2OA4 A;  2QSH X;  4N0B A;  2XSJ C;  4EJV A;  5IP6 A;  5FJ8 J;  2L7Z A;  3M9A A;  2W1O A;  5BPD A;  1FBS A;  2PN6 A;  2KQR A;  1B6A A;  2KIF A;  4A93 J;  3M4O J;  1IUF A;  1J09 A;  1TW3 A;  2CQX A;  1ZLJ A;  3QWL A;  2XSD C;  4HBL A;  3SEQ A;  1NK2 P;  1T33 A;  3KP4 A;  1T08 B;  4EEF G;  3PUF A;  3LSI A;  4BBS J;  2G9W A;  3H5A A;  1O3T A;  1GT0 C;  1IGN A;  2A69 F;  3JCU C;  4ASN A;  3GFL A;  2NOG A;  5HLH A;  3ZN0 A;  3LL7 A;  2M7B A;  1YS6 A;  1O57 A;  2QBY B;  2DA7 A;  5HS9 A;  1VQM I;  3E7L A;  1F1Z A;  3CCU I;  2F5C A;  2QBY A;  5DYM A;  1D5V A;  3HUG B;  2YU9 J;  2CFX A;  2E2J J;  2Y0S A;  5C44 J;  2JA6 J;  4BY7 J;  5IP7 J;  3HUG A;  4D1Q A;  2XPW A;  2KFD A;  3DBL B;  1MBJ A;  3FX3 A;  2Y9Z A;  2BOL A;  1Z1D A;  1G3T A;  4XMY A;  2R7T A;  5B3S H;  4FT8 A;  1X1D A;  4IKF A;  1BJZ A;  3WTY C;  2K27 A;  2L2O A;  1AA7 A;  3BQZ A;  1BIA A;  3Q9S A;  4QLC U;  1V5G A;  1JT6 A;  3VSK A;  3RKW A;  3QAH A;  3CMM A;  4A3L J;  2FE3 A;  2QM3 A;  2HYF A;  1R58 A;  2PX9 A;  3W6K B;  1FMW A;  4MQ9 F;  2GQQ A;  3W2V A;  3MVP A;  1E17 A;  1K83 J;  1R5I D;  2QGU A;  3LA7 A;  3FXQ A;  1ETW A;  3GF2 A;  4B48 A;  2M7A A;  1SFK A;  3ERM A;  4EJO A;  3ZQF A;  1Y0U A;  4CZC A;  5JHU A;  2BXY A;  1QU3 A;  1XC5 A;  4QPO A;  5KCM A;  4AC0 A;  4IQJ A;  2H1K A;  1HOM A;  5LGN A;  1P7I A;  1FOX A;  4AWX B;  3F22 A;  4K2E A;  5FRM A;  4G9Y A;  3H0G J;  3OYJ A;  4MGR A;  2RAE A;  2Y2Z A;  4EVI A;  2JA7 J;  2VBW A;  1SFX A;  2HYJ A;  2JK3 A;  3COA C;  1U9O A;  3TO7 A;  3HOX J;  3KE2 A;  3HYI A;  4HX8 A;  3J7A Y;  5HNH A;  3DTI A;  4XM3 A;  4L9J A;  5AON A;  4FE4 A;  4EJU A;  2CSO A;  2A5Y B;  5DUK A;  2IGK A;  3CCJ I;  2DK8 A;  4HNV A;  4XSZ F;  3HZJ A;  3Q9V A;  4Z2Y A;  5D5V B;  5L3B A;  1YHQ I;  1VQ8 I;  2VJI A;  3GUD A;  2RKH A;  1IDZ A;  2P0W A;  2HQR A;  1ZAO A;  2XAJ A;  4NBQ A;  3I58 A;  2MLK A;  4N4O B;  4OIO F;  1JXS A;  1Y8Q B;  4Q5S F;  2V6E A;  2QKL B;  2JSP A;  4YRV A;  4EV0 A;  5HS7 A;  3I4P A;  1AOY A;  3CJQ B;  4G7Z F;  3IAS 2;  3ML6 A;  3GTP J;  4RAZ A;  2VE8 A;  3GTM J;  2VQC A;  4XN0 A;  4IHX A;  4CYD A;  1D1B A;  1S7E A;  2O9L A;  5KVR A;  1J5Y A;  2CWE A;  1YOV B;  1BW5 A;  4OMZ A;  4KMF A;  2EK5 A;  2VKE A;  1WHU A;  5H6Q A;  3C2H A;  1ETK A;  5FLV A;  3HOY J;  3DLL F;  2KZG A;  2JA5 J;  2BZT A;  4BXF A;  1D1A A;  2WAF A;  1KYW A;  2TCT A;  3S16 J;  3FM5 A;  3BTL A;  4E4H A;  3JAM K;  3KPH A;  4D9J A;  4C2T A;  1HA8 A;  1S7A A;  4DOZ A;  2ESH A;  3BQY A;  1CGP A;  3B73 A;  2FF4 A;  1ZYR F;  2A3S A;  4RB1 A;  4P55 A;  4A3B J;  1IO2 A;  3OYF A;  3EQL F;  3K10 A;  2EB7 A;  3PNT A;  2X51 A;  3BR5 A;  1MMN A;  2VB6 A;  3OIO A;  2IS1 A;  3BZK A;  1KU2 A;  3CF2 A;  2OZ6 A;  4CCN A;  4A0X A;  3HTS B;  3CC7 I;  2M2E A;  1V54 H;  2L7F P;  3ISP A;  2XAF A;  1YE9 A;  4D5C A;  1B9N A;  5E1W A;  2F5E A;  2KDZ A;  2R7S A;  1JKP C;  2GXB A;  4G12 A;  1GV2 A;  3MCZ A;  4YII A;  1GVD A;  4KIS A;  3H3Z A;  4G94 A;  1S9H A;  2RQP A;  3BP8 A;  3R4K A;  3OY9 A;  4AIK A;  2GA2 A;  2E34 A;  3A02 A;  4P96 A;  2ZNZ A;  1HXD A;  4XLH A;  4GYI A;  1VND A;  3S17 J;  3HKZ A;  2K9Q A;  1R5G A;  4RAG A;  1AHD P;  1O3Q A;  4IXA A;  3WTU C;  2CUF A;  1FBQ A;  4CUG A;  4RA2 A;  1HDD C;  3H3V K;  3CUQ C;  3S2W A;  1B72 B;  5D5U B;  3ABM H;  1SVL A;  2HXO A;  2HDW A;  1B72 A;  3S2D J;  3LSJ A;  1HKQ A;  1VFC A;  2QSG X;  4LFU A;  4G7H F;  4XON A;  2I5U A;  3HL2 A;  4FX0 A;  2DN0 A;  4WF2 A;  5FKL A;  4MHG A;  2Q8K A;  3ZQG A;  2UXX A;  3B6C A;  3K6G A;  1MND A;  3V7R A;  3VYU B;  1N75 A;  1E3P A;  5CVJ A;  4X0G A;  2X6Y A;  3P7N A;  4CGZ A;  1RZ4 A;  3LSH A;  4M6V A;  1YJN I;  4S04 A;  4DYQ A;  2PEX A;  1YTY A;  2JRT A;  1V5E A;  2K7L A;  2WY7 Q;  3KP6 A;  2LP0 A;  4LB5 A;  2R93 J;  2XF7 A;  1UST A;  3A03 A;  3BPV A;  4BQA A;  4CSW A;  1FX7 A;  4AID A;  2VBX A;  4O3M A;  3GZ5 A;  2MC4 A;  3AG1 H;  1DP7 P;  1CF7 B;  2F4I A;  4U88 A;  3DF8 A;  3DKW A;  1CF7 A;  1TC3 C;  3K9T A;  1FTZ A;  3HHG A;  2ZJR F;  2H27 A;  1X1A A;  3ECO A;  3GTG J;  2R7X A;  3SFZ A;  4HQE A;  1YYV A;  2ZSH B;  3ZMD A;  4F55 A;  3GFM A;  3TQN A;  5JR3 A;  2R5Y B;  4XLF A;  1X1B A;  3DXJ F;  4F91 B;  1P7J A;  5JLW A;  1QZY A;  1R1U A;  3DV8 A;  5H6R A;  2R5Y A;  5JHF A;  1BW6 A;  5E79 C;  3RQ4 A;  4PJJ A;  1JGS A;  2VQG A;  3PNV A;  2OCE A;  2I10 A;  3K7A J;  3VEP A;  3CJT B;  1TT0 A;  2X6X A;  5GAG J;  2EIL H;  5B5E C;  3QU3 A;  1GXQ A;  2DOE A;  2W7N A;  3H1C A;  5EGO B;  2ZME A;  1X3U A;  1F9N A;  1WSU A;  2A6H F;  2NXN B;  4BDY A;  1FP2 A;  2I8D A;  1AKH B;  3R0A A;  2FBK A;  2EV6 A;  2IVM A;  3U9G A;  1QRY A;  1AKH A;  2VLA A;  3LOC A;  5BS6 A;  2EH3 A;  4XID A;  5L3C A;  3I64 A;  3RPQ A;  1I3A A;  4A3J J;  1P4X A;  3LSP A;  2X9D A;  2VXD A;  3ZQQ A;  2BHY A;  2CUE A;  2K9S A;  4L18 B;  3F23 A;  2ZNY A;  5M3M J;  1WRJ A;  3S3N A;  1AU7 A;  1BOA A;  1SFU A;  1VQO I;  4IOC F;  4KJZ A;  1SD5 A;  5HNF A;  5E3M A;  1Z3X A;  1P9Q C;  3W2W A;  2W48 A;  4HNT A;  3BWG A;  5DCM A;  1A35 A;  3HM5 A;  4HOB A;  1B4A A;  2CW8 A;  2IGM A;  1BJA A;  2M8G X;  1U8B A;  4RGS A;  4L9V A;  3X2Q H;  3QYF A;  2JVG A;  3B02 A;  3I9V 2;  1K6O A;  2ME0 A;  4PFP A;  3ZMU A;  1QQI A;  3BCA A;  5HLT A;  2M0C A;  4JX4 A;  1MBG A;  4IJA A;  1FYM A;  3SHF A;  1R36 A;  4ZYD A;  1QNT A;  2XGE A;  4AVP A;  4A2U A;  2JQ7 A;  1YG2 A;  3G71 I;  1RI7 A;  2XAQ A;  1J9I A;  4KIB A;  4PCQ A;  1XGS A;  3HEF A;  4QSH A;  1UEL B;  2MW8 A;  3LNQ A;  2DDB A;  4IL6 C;  2HR3 A;  3GME A;  3CZ6 A;  5IY5 H;  2LYC A;  4PDK A;  1TWH J;  2DI3 A;  4BHP A;  3HB9 A;  4I01 A;  4LOC A;  4HLY A;  1MKM A;  1LQ1 A;  3AG4 H;  3PJR A;  2MC3 A;  3EUK L;  3ZXS A;  3FBI B;  3OYE A;  2FUG 2;  5DD4 A;  2VQL A;  4YFX F;  3L2U A;  5EZG A;  1TNS A;  3R0J A;  1YQA A;  4J19 A;  1OJL A;  4IHT A;  1SEU A;  1WJ5 A;  1XD7 A;  2RQQ A;  1IUY A;  1OR7 A;  3TO6 A;  2HU9 A;  3I54 A;  3L09 A;  3UKG A;  2KIS A;  4BAY A;  4YG2 F;  4B43 A;  3WE2 A;  1PP8 F;  3WTT C;  3HTU A;  2GOX B;  2Y48 A;  5FO5 A;  4M3E A;  1YX5 A;  2Z9O A;  2X6O A;  3WGI A;  3HXL A;  3CCE I;  1VQL I;  1OPC A;  4G7O F;  5HVQ C;  1FOK A;  1FOY A;  3DEE A;  4LIU A;  2V4J C;  4AYB A;  2M3A A;  3AL0 C;  2ZB9 A;  5IOZ A;  1Y6I A;  2MA3 A;  4HA8 A;  5DD8 A;  4BJT A;  2R7W A;  4EGY A;  3SYT A;  1X2N A;  1IZ1 A;  1LEB A;  4E7K A;  3EET A;  4I98 B;  1MW7 A;  4BAC A;  3NAR A;  2ID6 A;  3S1N J;  3NWS A;  3TOA A;  2WTE A;  3HRT A;  4CCK A;  3CP8 A;  2BVL A;  1D3Y A;  2NYX A;  1G2H A;  1T98 A;  5K5R A;  1WJE A;  2ECC A;  2LRD A;  4E70 A;  1VQP I;  3OSG A;  3LSG A;  2HYG D;  3GO5 A;  4ABZ A;  1ZG5 A;  2FRH A;  3ZMT A;  4CYC B;  1XB4 A;  3OYM A;  3EUH A;  4CYC A;  3GEZ A;  5DTD A;  1WVR A;  4LLN A;  2HQ5 A;  1VF9 A;  1NH3 A;  1MJ9 A;  2MFZ A;  3LMM A;  3PIP F;  2NAZ A;  5L3E A;  4ZTJ A;  2YUS A;  4F3Q A;  3V7C A;  1J0R A;  3ESW B;  4WCG A;  1Q1H A;  2WV1 A;  1SFO J;  1P2F A;  3L2R A;  4CCO A;  2IGN A;  3HDD A;  2MGQ A;  2Z3Y A;  4KN4 X;  1YW8 A;  2IBD A;  2BXZ A;  2K3F A;  3OMY A;  2DMQ A;  2KZV A;  4JOM A;  2V9K A;  1R00 A;  1DP3 A;  2XPV A;  4BKX A;  5TGT A;  3KLO A;  1T56 A;  3L2C A;  3ABU A;  2VQH A;  4EJW A;  4RDU A;  3ECH A;  2GXG A;  5E3O A;  4FX4 A;  2JVH A;  2EFO A;  2F4M B;  4B8X A;  1LVA A;  2LVS A;  1HW2 A;  1IRZ A;  3DQV C;  1IXR C;  5EZH A;  3ZMZ A;  5E1Z B;  2O7O A;  4UV8 A;  4HF0 A;  1JHF A;  5FLX Z;  1QPI A;  1FWZ A;  3G1O A;  2YPR A;  3D1N I;  2IA0 A;  2E2I J;  2LC2 A;  2PMH A;  2ZCW A;  5BPI A;  4LK1 F;  3KP2 A;  2B9S A;  3NQO A;  2MD5 A;  5CYV A;  3WG9 A;  4KUM A;  1GXP A;  1ZHF A;  1RET A;  1S5L C;  4L5J A;  4OIR F;  3BG7 A;  5IT9 Z;  2KRH A;  3ABK H;  3MKL A;  1WJA A;  2JT1 A;  4A3K J;  2CJJ A;  4LGW A;  3F3X A;  3GVA A;  1OCC H;  4Y3O A;  4E7L A;  1MIJ A;  5IT3 A;  2E71 A;  3IKV A;  5ILU A;  1D1C A;  1Z3Y A;  4MIM A;  3H36 A;  2P81 A;  4R79 A;  3MKW B;  2QCO A;  4ZDP A;  4UXN A;  2JZY A;  4GDF A;  3KZI C;  3BG9 A;  2HQA A;  5B66 C;  1ZRD A;  4MO7 A;  3CLQ A;  5HLI A;  1IW7 F;  4NC8 A;  3WHB A;  2EA2 A;  1W7P B;  5C4X J;  1Z0X A;  4GCV A;  4DJA A;  1J59 A;  3H3U A;  2HKX A;  2F48 A;  3V4G A;  2DA5 A;  3J81 K;  2JTV A;  4BYY A;  2ECB A;  3MZ8 A;  3KP5 A;  4KIT B;  4BHB A;  1X1P A;  4PJ0 C;  3P9C A;  1LDK B;  1U9N A;  2F5F A;  1NHA A;  1ACI A;  2K9L A;  3UR3 C;  5M5Y J;  3SEZ A;  1UJ8 A;  3OOU A;  1IXC A;  4V19 K;  2O0Y A;  3F0C A;  3IP4 B;  5JVT A;  1SAU A;  5J4V A;  2FJ1 A;  2IA2 A;  1V3F A;  3VYS B;  4N4N B;  3S93 A;  5E1X A;  4GO1 A;  1PYV A;  2L9N A;  2P5V A;  1UZC A;  1RES A;  4IHS A;  2HOS A;  2COM A;  3FXU A;  2HEO A;  4HF1 A;  4RBO A;  1ZQ3 P;  2VT3 A;  3KEO A;  3LA2 A;  4KMU X;  3T1B A;  2FU4 A;  4XKW A;  5FRO A;  4R1H A;  3FF5 A;  1RPW A;  3OYK A;  5ED4 A;  2CFO A;  1IRX A;  2ZFU A;  4H0E A;  3S2H J;  2M34 A;  3TOB A;  5C4J J;  1I50 J;  2CMP A;  4LMY A;  4M6Y A;  2O6G E;  3HOS A;  2GZW A;  3FXR A;  2NVX J;  4KDP A;  1P4A A;  2JPB A;  4U0Y A;  1YFH A;  3CUQ B;  4L5I A;  4CDG A;  1RKW A;  1SVM A;  2AXT C;  3CLO A;  1HKS A;  1XSX A;  3CUQ A;  5F08 A;  3LSM A;  1IC8 A;  3ZMV A;  3FK7 A;  4O5V A;  3TDZ C;  2D5V A;  3T5X A;  1X2M A;  1H0M A;  1VZ0 A;  2YX4 A;  2RNJ A;  1BR1 A;  3OIQ A;  3GYH X;  4CCJ A;  3BCB A;  2X0L A;  3HBL A;  4HPQ A;  2P6S A;  4C3H J;  2XRO A;  1R9T J;  3ZGK A;  5HOO A;  3F8F A;  3QP5 A;  5IYB J;  3W6J B;  2Y0S N;  3F6O A;  3O6B B;  3Q0W A;  4XLA A;  4QPQ A;  1S3J A;  5HDN A;  4CCM A;  3HHH A;  3WTW C;  1DU0 A;  3IH4 A;  2EFQ A;  2OV7 A;  4DBQ A;  1O7L A;  1S7O A;  4YIF A;  2P5K A;  1OR7 C;  2TRT A;  4PJM A;  4RGU A;  5EEH A;  4S05 A;  1EV7 A;  1H9T A;  3L9F A;  2ZSI B;  2K9M A;  3U1K A;  1P92 A;  3JR9 A;  1T0F C;  2L9V A;  1KQ8 A;  2HDC A;  2QKM B;  3ELK A;  2W85 A;  2HOE A;  3KP3 A;  5J8C A;  2ZXI A;  3D5R C;  1R23 A;  4HNU A;  1FT9 A;  2XGX A;  3QPH A;  4GYG A;  4C9Y A;  3MWM A;  5IYD J;  2R92 J;  1VTN C;  3BPX A;  5F1R A;  4BU2 A;  1BIB A;  1SAN A;  2VIX A;  2D1V A;  3RYP A;  3ULQ B;  3KEY A;  4E7H A;  3AG3 H;  5EYR A;  1A31 A;  1IDY A;  1XGN A;  1GUU A;  2G7U A;  2XB5 A;  4HZF A;  3O8H A;  4Z6Y A;  2XRL A;  3GX4 X;  1VI0 A;  2H6B A;  2KIQ A;  1R22 A;  3LSR A;  2DFI A;  1XMA A;  4A0Y A;  1LPQ A;  1F4K A;  2DU9 A;  4R8H A;  2LKX A;  2XRN A;  3EDP A;  4KT6 A;  1OCT C;  1TWC J;  3K4J A;  3BT9 A;  4HX7 A;  3G4S I;  3L2Q A;  1XDS A;  5DV5 A;  4P5O A;  4QTR A;  2LG4 A;  3BJA A;  4L9T A;  3DFG A;  3EUH C;  4CO8 A;  2ZJP F;  1SAX A;  5LHG A;  3K4K A;  4L9N A;  4A3G J;  4LLL A;  3C3W A;  1P4W A;  1WH5 A;  4GRI A;  4EMS A;  2BHZ A;  1E3H A;  3K0L A;  3RCO A;  2LY2 A;  2LTP A;  2E2H J;  1SD7 A;  4WXC A;  4O6J A;  4IVN A;  2F2E A;  3JSO A;  2VJJ A;  3QQA A;  3S3M A;  2HPI A;  2LBF B;  2HOT A;  3ZRG A;  1W0T A;  1ZR2 A;  2R7Z J;  2VC0 A;  1JUP A;  1Y1V J;  2LBF A;  4M9X A;  2L5Q A;  3UNG C;  2VOO A;  4ZDL A;  3HOZ J;  1WJC A;  3PUB A;  2J5P A;  3TBI A;  1MH4 A;  5E3L A;  4A0Z A;  1ZEL A;  3BTC A;  2Z5U A;  4DZJ A;  3FIS A;  4RGR A;  1MMS A;  1T95 A;  1FSH A;  4JQF A;  4A3D J;  2YU3 A;  1OIS A;  1LE8 B;  3BR2 A;  3NRV A;  2XAH A;  3DLA A;  4KYW A;  1HW1 A;  5K7F A;  1QHH D;  2JJ7 A;  4HEA 2;  2KRF A;  4Q47 A;  1LE8 A;  1TL8 A;  3HGY A;  5F04 A;  5HDK A;  3WU0 A;  2KJC A;  3RYR A;  2CS3 A;  3RKY A;  5LFA A;  4MEX F;  1XCB A;  5FLX K;  1HF0 A;  3CMY A;  1EA3 A;  2M4G A;  1Y39 A;  5K5Q A;  2BV6 A;  3MAJ A;  3HSE A;  5A2Q K;  1BR2 A;  4JP0 A;  2W84 A;  4ESF A;  1JJ8 C;  2VKV A;  2AO9 A;  4XKV A;  3SZP A;  4HDV A;  3GTQ J;  1SMY F;  2B0L A;  2BE5 F;  1J75 A;  4HF2 A;  2E7W A;  2Y9Y A;  1YIT I;  5IP9 J;  3VDX A;  4I2O A;  2L9S A;  1H89 C;  3IAM 2;  1VQ6 I;  1KU9 A;  2FX0 A;  4KIG A;  3L7W A;  1D5Y A;  2R7O A;  3W3C A;  3OYA A;  5H2F C;  1A5J A;  2ICW G;  1ULY A;  2L54 A;  3CDH A;  4BGD A;  1TLH B;  1X4O A;  4ZYH A;  4OAY A;  2XAU A;  2E1N A;  3PQJ A;  5GP9 A;  4NDL A;  4IPA A;  3TKY A;  1YLF A;  2JA8 J;  2EZI A;  3U21 A;  5BNG A;  1LFU P;  3HOU J;  3RPU A;  1WI3 A;  1I39 A;  1BI1 A;  3AKZ A;  3GWZ A;  4KIF A;  2LOO A;  2GLO A;  1IXS B;  1LDD A;  4DYR A;  5TJJ A;  2GA1 A;  2M30 A;  3CCV I;  1ERD A;  4UUS B;  3JRG A;  1UB9 A;  1KON A;  2VPL A;  5GAD J;  3DKX A;  2FOW A;  4A3E J;  3R60 A;  4UUS A;  2E5N A;  1YRN B;  1GHC A;  3HKZ N;  4J01 A;  1Y56 A;  4OU0 A;  3AL0 B;  1E3O C;  5FKN A;  1Z6T A;  3J7A O;  1VQ4 I;  3E6D A;  4HG2 A;  1YRN A;  3JSP A;  4AD9 A;  2IS4 A;  2E1C A;  1U6G A;  2VI6 A;  2LK2 A;  4B3X A;  4WWC A;  4LG0 B;  1KZH A;  2K4B A;  3A0H C;  3RPU D;  5TRD A;  1N78 A;  4CXF A;  4LG0 A;  2DPU A;  1UFM A;  4IOA F;  5JLX A;  4ZYG A;  2FXA A;  1XSD A;  3LFK A;  1Z9C A;  2BGC A;  1IJW C;  3C18 A;  3OS1 A;  3IRQ A;  3K4C A;  3MKZ A;  3T8T A;  3M8F A;  5EF6 A;  1WZ2 A;  5F6F A;  3PSF A;  5F0F A;  1FMV A;  3QP6 A;  1OYI A;  3ZQC A;  1ZRE A;  3VB2 A;  5BOX A;  3WHC A;  3JTG A;  1R1T A;  2IXS A;  2ELK A;  4EM1 A;  3VPR A;  1YJW I;  3K1P A;  2UWM A;  2K40 A;  1ETQ A;  3DCF A;  1HW5 A;  2DK5 A;  2OZU A;  3TL4 X;  2NVT J;  2DFH A;  2VKD A;  2KL4 A;  5D4S A;  5LBQ A;  3I56 I;  2FNA A;  1I27 A;  1B8I B;  1LNW A;  1OCO H;  4RM2 A;  5AIQ A;  5DM6 F;  3KZZ A;  2VON A;  4FCY A;  2Z99 A;  1UCR A;  2MYS A;  3MEX A;  2VE9 A;  3N4M A;  3ZQ7 A;  3A01 B;  2CQK A;  5E8I A;  3N05 A;  2XDV A;  1R5H A;  5M3F J;  4YFN F;  1SVO A;  1NTC A;  3A01 A;  3CCR I;  2DMP A;  2E60 A;  2EQR A;  4N9H A;  1MNE A;  1NG6 A;  1ZRC A;  1YW7 A;  1QPM A;  2PQ8 A;  1HKT A;  3WTZ A;  2NS7 A;  3TW6 A;  5FRN A;  3I71 A;  3N97 A;  2CQQ A;  1R71 A;  2DTR A;  3IRR A;  4XOP A;  2HVS A;  1W5T A;  4KFC A;  2PMZ A;  3G6E I;  2HDD A;  3ROU A;  2KIU A;  4Q48 A;  4W97 A;  3GTO J;  4ZYE A;  5CVR A;  2PFB A;  1A36 A;  1K4S A;  2Z33 A;  2JA2 A;  2WY8 Q;  2HGC A;  1BN5 A;  2W24 A;  3A2K A;  2YS9 A;  5KAI C;  1NK3 P;  2FOK A;  3L00 A;  4OWR B;  3KX2 A;  4PGG A;  4IHW A;  2G7H A;  2VPR A;  3DKY A;  3C2G A;  5M5X J;  1IN8 A;  2B63 J;  2ELH A;  2GIV A;  1S6L A;  2PG4 A;  3FXL A;  3OOP A;  3PQK A;  4ZJZ A;  3W6V A;  1O4X A;  1QZZ A;  2D2W A;  4I0A A;  3M07 A;  2GBY A;  3V42 A;  6PAX A;  2HTS A;  3LQQ A;  4XSX F;  3FMQ A;  2W57 A;  4B09 A;  2EWN A;  1PUF B;  5F1J A;  2R7R A;  1ORK A;  3KFW X;  3IHU A;  3Q3S A;  1PUF A;  2IPQ X;  5EGO A;  3DTK A;  2OTJ I;  5LRS A;  1MMD A;  4Y15 A;  1JE8 A;  2EA4 A;  4IRI A;  1H88 C;  5LLQ A;  2OD5 A;  1G59 A;  2IS6 A;  4C2M J;  4W1U A;  4Y13 A;  2LY9 A;  2HWV A;  1ONV A;  3QOD A;  3G1L A;  3OYB A;  1FIA A;  3F72 A;  3VOD A;  2PBI A;  1PJR A;  2R7D A;  1T38 A;  4IZZ A;  2DOA A;  2ZJQ F;  5ILS A;  3E97 A;  1MJA A;  1QHG A;  2VBZ A;  4LIV A;  2O03 A;  2A68 F;  2QQ8 A;  3VSL A;  3K1M A;  3E5U A;  3KP7 A;  4RB0 A;  4DZP A;  3EUA A;  1DDN A;  3ZCO A;  4ZH4 F;  1EKE A;  2BVM A;  1HDP A;  2QZ8 A; 
#chains in the Genus database with same CATH homology
 3QU6 A;  5LHH A;  3LWF A;  5JI6 A;  1XDU A;  5ERI A;  2D45 A;  5L3F A;  4ESJ A;  4HX4 A;  4RB2 C;  2ETH A;  3F8M A;  5K1Y A;  2R3S A;  2DLL A;  3GFJ A;  5CLS A;  3K2Z A;  2LF8 A;  2X4H A;  4A12 A;  1WWX A;  3P9K A;  2YX7 A;  1KYZ A;  1FY7 A;  2Q2E A;  2LNB A;  1HSJ A;  1XGM A;  1LDJ A;  2M1B A;  4M72 A;  4CIC A;  4OIQ F;  4YFK F;  5LEK A;  4A6E A;  1I1G A;  3RDI A;  2NNN A;  4LD5 A;  4BHC A;  5D4R A;  2DQL A;  4EQQ A;  3HRU A;  1EH7 A;  2ZXJ A;  4ENK A;  2VOD A;  4G6Q A;  1JHH A;  1T0F A;  1PUE E;  1MGT A;  1YO5 C;  2KIM A;  3DPL C;  1U2W A;  2ESN A;  3BY6 A;  2OU2 A;  4KN7 X;  2E7X A;  2ZBK A;  3FMR A;  2A07 F;  3I53 A;  3M1E A;  4GXO A;  5JFR A;  4RAY A;  2PJP A;  4Y17 A;  1U78 A;  2FSW A;  4WXH A;  2K86 A;  4M71 A;  3BOQ A;  5CVV A;  2RDP A;  1ZGA A;  4EM2 A;  1MJB A;  3F8N A;  4NQW A;  4WK8 F;  2C6Y A;  1P6R A;  1LEA A;  3HRM A;  2L01 A;  2ZKZ A;  2MLG A;  2DO7 A;  5K5O A;  2M8E A;  2PLY A;  3DEU A;  3E5X A;  3DP7 A;  3F8B A;  4MTD A;  4A6D A;  3IWZ A;  2DT5 A;  1G4D A;  1IF1 A;  2H09 A;  2QUF A;  5EEG A;  3SQN A;  5CVI A;  5E8G A;  1PP7 U;  4U0W A;  2KKO A;  3GFI A;  1IRG A;  2EFP A;  2LSO A;  3O3K A;  3P9I A;  1IN7 A;  3GLX A;  3WTV C;  3CO7 C;  2K4J A;  2CO5 A;  1J7K A;  4MTE A;  1FZP B;  5FGM A;  2RVC A;  2QQB A;  2DQR A;  4AIJ A;  2R7F A;  4I02 A;  3WTX C;  2CG4 A;  2F5D A;  5D8K B;  1FLI A;  4NB5 A;  3NEU A;  1O3S A;  3WGH A;  1O3R A;  1ZG3 A;  3KET A;  3MQ0 A;  4KIC A;  5DEQ A;  1EH8 A;  1W7P A;  3V8J A;  2M5W A;  5DCF A;  3F6V A;  1Z6R A;  4P9U A;  3I5U A;  4HW0 A;  3AAF A;  4LJZ F;  2IP2 A;  4ENM A;  2XAG A;  1RUO A;  1FBU A;  5ILV A;  2MH2 A;  3MZY A;  5CJ9 A;  3C7J A;  4RGX A;  4UVB A;  4DQ2 A;  2QYO A;  2ACJ A;  3BZ6 A;  3LST A;  5D6E A;  4A5M A;  2HFH A;  1W7P D;  5FD6 A;  1U5T B;  2IRF G;  4U0V A;  1YW9 A;  1G3S A;  1U5T A;  2PI0 A;  4BNC A;  2O3F A;  1STZ A;  2QEN A;  2A61 A;  4EJT A;  2MH9 A;  4FHT A;  2EV5 A;  5HS8 A;  3CUO A;  1L0O C;  3BJO A;  2CW0 F;  2HZT A;  1PDN C;  2EFW A;  2M87 A;  2P7C B;  5CVU A;  3BRO A;  3JW4 A;  4HLX A;  4OMY A;  1UHM A;  2GAU A;  3CO6 C;  3FMS A;  2P8T A;  2XKO A;  3KLN A;  4PGH A;  4UVC A;  5F64 A;  3SXY A;  1OYY A;  2FNP A;  3BJ6 A;  2O61 A;  4IRG A;  4MEY F;  5FB2 A;  3QOP A;  4M9S A;  4CHU A;  1BBY A;  2L4M A;  3PFI A;  3R61 A;  1D8J A;  4BH9 A;  1GVJ A;  1BC8 C;  2STW A;  1FNN A;  1HBX G;  1EH6 A;  1YS7 A;  1SD6 A;  1FPQ A;  1BM9 A;  2PMU A;  1FC3 A;  3M7G A;  3O2P E;  1ZN2 A;  1LB2 A;  4L0Y B;  3RJP A;  2STT A;  2RGV A;  4UHT A;  3LA3 A;  4MNU A;  1HST A;  1TQP A;  4EM0 B;  1KQ9 A;  4LB6 B;  2XHK A;  2OQR A;  3F21 A;  5ICG A;  1IN4 A;  2JPC A;  1SFE A;  2Y0M A;  4KA4 A;  5FD5 A;  3CJN A;  1HQC A;  4ZZL A;  1WQ2 A;  2BBY A;  2OBP A;  2ISY A;  4MQV A;  3I59 B;  2V1X A;  4KNY A;  1FP1 D;  4M73 A;  3I59 A;  3D0S A;  4UVA A;  1FYK A;  5IT9 K;  1TQI A;  2XKP A;  1MDM B;  3WU1 B;  2QQA A;  1MDM A;  1ZAR A;  1KQ0 A;  2CYY A;  1ZGJ A;  4M9Z A;  1I6X A;  4XBF A;  1U3E M;  3TGN A;  3VFZ A;  4JBA A;  3QPT A;  2Y75 A;  2YR2 A;  1ZRF A;  1ODD A;  1W4M A;  3LAP A;  3F8C A;  3IC7 A;  1B1B A;  3WOD F;  2ISZ A;  2BEO A;  4G6D A;  3IKT A;  2FMY A;  4HDU A;  1ON1 A;  2WWY A;  1IN6 A;  2FQ3 A;  4DNC A;  4OIN F;  5DDG A;  4M74 A;  4OOI A;  2V79 A;  1U5T C;  4ESB A;  1ZLK A;  2VOP A;  5E20 A;  1ZG1 A;  4OIP F;  3GZ6 A;  4D0P A;  2WV0 A;  3IWF A;  1IAW A;  4HAM A;  1S29 A;  4HYE A;  1G3W A;  5DUI A;  1R7J A;  2HQN A;  2NNY A;  1KGS A;  2XUB A;  3J80 Z;  3KCC A;  2M45 A;  2TDX A;  2P4W A;  2H6C A;  5ICF A;  1SD4 A;  5LRR A;  2VC1 A;  1T39 A;  3U2R A;  4UUV A;  5E18 F;  5HDG A;  1MD0 A;  1BI2 A;  3ZP5 A;  2DPD A;  1QGP A;  4EGZ A;  4G8X A;  2HTJ A;  2K02 A;  4XLP F;  1G6N A;  1I5Z A;  4Q4Z F;  3ERE D;  3ZN1 A;  1REP C;  1BI0 A;  4JK1 X;  5H20 A;  1T2K A;  2XV4 S;  5E17 F;  1XN7 A;  1O7F A;  3LQR A;  3U1D A;  4HQM A;  1RNL A;  4CZZ A;  2HS5 A;  1TBX A;  2EV0 A;  3RKX A;  4HV5 A;  3C1D A;  3KEQ A;  1E2X A;  1J2X A;  1KA8 A;  1H9G A;  3TDU C;  5LHI A;  2P5L C;  5LGU A;  2FBI A;  2IJL A;  2DBB A;  2LF7 A;  5ICE A;  3E5Q A;  4HV6 A;  2ZME B;  2ZJ2 A;  2OQG A;  3J81 Z;  3GXO A;  1B9M A;  4GGG A;  4F7Z A;  4LLG F;  2EJR A;  4BXU A;  5D6F A;  4L0Z B;  1TQM A;  2LKP A;  5BQT A;  2NRA C;  2KJB A;  4PZJ A;  3K1N A;  4AIH A;  2DW4 A;  3V8L A;  5DCM B;  1XSV A;  4ENN A;  2RN7 A;  5ICC A;  1IRF A;  3ZPL A;  2RC4 A;  4NHJ A;  1BI3 A;  1V4R A;  3Q5F A;  1QO0 D;  1F5T A;  4U7B A;  2QVO A;  2RV8 A;  3KZY A;  1U8R A;  2FEZ A;  2L02 A;  1DUX C;  1A04 A;  5J8F A;  2CGP A;  3G3Z A;  2QWW A;  3E6M A;  5FFZ A;  1C0W A;  1KU3 A;  3FZV A;  4ETS A;  5HLG A;  3HSF A;  5FFX A;  5LGT A;  4I7H A;  1USS A;  1R1V A;  2XIG A;  1KU7 A;  1MZB A;  1TNT A;  2ADU A;  3FHZ A;  2WC2 A;  2HKO A;  2VN2 A;  4WX9 A;  2L3D A;  1ZH5 A;  2O8X A;  5L3D A;  3T8R A;  4IF4 A;  2W25 A;  3HOT A;  1Z05 A;  2V1D A;  4I09 A;  2FA5 A;  3DPT A;  3EYY A;  1ON2 A;  2MBF A;  1T6S A;  2QLZ A;  2VBY A;  3HRS A;  2VT2 A;  5LEJ A;  3G73 A;  4TV7 A;  2ZO4 A;  3E6B A;  4RS8 A;  3V7S A;  1RUN A;  3R6S A;  1W5S A;  3H92 A;  1I1S A;  5AIP A;  3CTA A;  2EFN A;  2P6T A;  4XLN F;  5D8L B;  1TW2 A;  2YSR A;  3WE3 A;  3J80 K;  3BDD A;  4U7D A;  3SZT A;  1Z7U A;  3M8E A;  1XCV A;  2UXN A;  3IL2 A;  3QRF F;  4KT5 C;  2FML A;  2AS5 F;  3FWE A;  4I0B A;  3OV8 A;  1B59 A;  2H94 A;  3RIR A;  4ENJ A;  4ON0 A;  2J5O A;  2AXL A;  3GW2 A;  1K79 A;  2IW5 A;  2VXZ A;  4LK0 F;  4A5N A;  3WTS C;  2BYV E;  1WI9 A;  1K7A A;  2XVC A;  1OKR A;  1WKM A;  2L4A A;  5A2Q Z;  2A6E F;  1K78 B;  1LJ9 A;  5KK1 A;  3MFK A;  3E3V A;  1K78 A;  2JSC A;  3RTR A;  5L3G A;  1IN5 A;  1D8K A;  3VOE A;  1AWC A;  2UZK A;  2IT0 A;  3LAJ A;  2GWR A;  3REO A;  5J6X A;  3T0Y A;  4ZZD A;  2ZFW A;  3V8K A;  4WXD A;  2V9V A;  4XRF A;  3JAM Z;  2P7V B;  4UV9 A;  3WGG A;  2IA1 A;  3TO9 A;  5D5X B;  5BMZ A;  1OMI A;  5D5W B;  4P9F A;  3ZMS A;  2LDU A;  3JTH A;  3D5L A;  3MZH A;  3RI4 A;  2D1H A;  4RB3 C;  1RIO H;  1OYW A;  1XMK A;  1DPU A;  3HIF A;  4N9I A;  1S8N A;  3FM3 A;  1SMT A;  3HSR A;  2NS0 A;  1YIO A;  1Z91 A;  3E6C C;  1L3L A;  4UNO A;  1BC7 C;  2XAS A;  2QQ9 A;  3EYI A;  2Q0O A;  3I0T A;  3ABT A;  2OAZ A;  2DAO A;  3K69 A;  2FBH A;  1TTY A;  4IRH A;  1DPR A;  4M6X A;  2V6C A;  1G3Y A;  1XGO A;  4QWQ A;  1FSE A;  1QBJ A;  2V1U A;  1FYL A;  1UHW A;  2OA4 A;  4N0B A;  4EJV A;  3M9A A;  5BPD A;  1FBS A;  2PN6 A;  1B6A A;  2KIF A;  1TW3 A;  1ZLJ A;  4HBL A;  3KP4 A;  2G9W A;  1O3T A;  2A69 F;  4ASN A;  3GFL A;  5HLH A;  3ZN0 A;  1YS6 A;  1O57 A;  2QBY B;  5HS9 A;  1F1Z A;  2F5C A;  2QBY A;  5DYM A;  1D5V A;  2CFX A;  3HUG A;  3FX3 A;  1Z1D A;  1G3T A;  4FT8 A;  3WTY C;  2K27 A;  1BIA A;  3Q9S A;  4QLC U;  3RKW A;  3QAH A;  2FE3 A;  2QM3 A;  2HYF A;  1R58 A;  3W6K B;  4MQ9 F;  2GQQ A;  1E17 A;  3LA7 A;  3FXQ A;  3GF2 A;  4EJO A;  1Y0U A;  5JHU A;  5LGN A;  4AWX B;  3F22 A;  4K2E A;  4G9Y A;  4MGR A;  4EVI A;  2VBW A;  1SFX A;  3COA C;  3TO7 A;  3KE2 A;  3HYI A;  4HX8 A;  4L9J A;  5AON A;  4EJU A;  2CSO A;  2A5Y B;  5DUK A;  2DK8 A;  4XSZ F;  3Q9V A;  4Z2Y A;  5D5V B;  5L3B A;  3GUD A;  2RKH A;  2HQR A;  1ZAO A;  2XAJ A;  3I58 A;  2MLK A;  1JXS A;  4OIO F;  4Q5S F;  4EV0 A;  5HS7 A;  3I4P A;  1AOY A;  4G7Z F;  3ML6 A;  4RAZ A;  2VE8 A;  4CYD A;  5KVR A;  1J5Y A;  2CWE A;  4OMZ A;  4KMF A;  2EK5 A;  5H6Q A;  1KYW A;  3FM5 A;  3JAM K;  1S7A A;  2ESH A;  1CGP A;  3B73 A;  2FF4 A;  1ZYR F;  2A3S A;  4RB1 A;  4P55 A;  3EQL F;  2EB7 A;  1KU2 A;  2OZ6 A;  4A0X A;  3HTS B;  3ISP A;  2XAF A;  1B9N A;  5E1W A;  2F5E A;  2GXB A;  3MCZ A;  4YII A;  3H3Z A;  4G94 A;  2RQP A;  3BP8 A;  3R4K A;  4AIK A;  2GA2 A;  4P96 A;  2ZNZ A;  1HXD A;  4GYI A;  1R5G A;  1O3Q A;  4IXA A;  3WTU C;  1FBQ A;  3CUQ C;  3S2W A;  5D5U B;  1HKQ A;  4LFU A;  4G7H F;  4FX0 A;  4WF2 A;  4MHG A;  2Q8K A;  2UXX A;  3V7R A;  5CVJ A;  3P7N A;  4CGZ A;  1RZ4 A;  4S04 A;  2PEX A;  1YTY A;  2JRT A;  2K7L A;  3KP6 A;  4LB5 A;  1UST A;  3BPV A;  4BQA A;  1FX7 A;  2VBX A;  4O3M A;  3GZ5 A;  1DP7 P;  1CF7 B;  4U88 A;  3DF8 A;  3DKW A;  1CF7 A;  3K9T A;  3HHG A;  2H27 A;  3ECO A;  3SFZ A;  4HQE A;  1YYV A;  3ZMD A;  3GFM A;  3TQN A;  5JR3 A;  3DXJ F;  1QZY A;  1R1U A;  3DV8 A;  5H6R A;  1JGS A;  3VEP A;  3QU3 A;  1GXQ A;  2ZME A;  1X3U A;  1F9N A;  1WSU A;  2A6H F;  1FP2 A;  3R0A A;  2FBK A;  2EV6 A;  2IVM A;  3U9G A;  5BS6 A;  5L3C A;  3I64 A;  3RPQ A;  1P4X A;  4L18 B;  3F23 A;  2ZNY A;  1WRJ A;  1BOA A;  1SFU A;  1SD5 A;  3BWG A;  5DCM A;  4HOB A;  1B4A A;  1BJA A;  4RGS A;  4L9V A;  3B02 A;  1K6O A;  3ZMU A;  1QQI A;  4IJA A;  1FYM A;  3SHF A;  1R36 A;  4ZYD A;  1QNT A;  4AVP A;  4A2U A;  1YG2 A;  1RI7 A;  2XAQ A;  1J9I A;  4KIB A;  4PCQ A;  1XGS A;  2HR3 A;  4PDK A;  2DI3 A;  4BHP A;  4I01 A;  4HLY A;  1MKM A;  1LQ1 A;  2MC3 A;  5DD4 A;  4YFX F;  1TNS A;  3R0J A;  1YQA A;  4IHT A;  1XD7 A;  1IUY A;  1OR7 A;  3TO6 A;  3L09 A;  3I54 A;  4BAY A;  4YG2 F;  3WE2 A;  1PP8 F;  3WTT C;  3HTU A;  2Y48 A;  5FO5 A;  2Z9O A;  3WGI A;  1OPC A;  4G7O F;  5HVQ C;  1FOK A;  4EGY A;  2MA3 A;  4HA8 A;  5DD8 A;  1IZ1 A;  1LEB A;  3EET A;  4I98 B;  3TOA A;  2WTE A;  3HRT A;  1D3Y A;  2NYX A;  1T98 A;  5K5R A;  4E70 A;  2HYG D;  3GO5 A;  1ZG5 A;  2FRH A;  3ZMT A;  1XB4 A;  3EUH A;  3GEZ A;  4LLN A;  1MJ9 A;  2NAZ A;  5L3E A;  3V7C A;  1J0R A;  4WCG A;  1Q1H A;  1P2F A;  2Z3Y A;  4KN4 X;  1YW8 A;  1R00 A;  3KLO A;  3L2C A;  3ABU A;  4EJW A;  3ECH A;  2GXG A;  4FX4 A;  2EFO A;  4B8X A;  1LVA A;  1HW2 A;  3DQV C;  1IXR C;  3ZMZ A;  5E1Z B;  4UV8 A;  4HF0 A;  1JHF A;  5FLX Z;  1FWZ A;  2YPR A;  2IA0 A;  2PMH A;  2ZCW A;  5BPI A;  4LK1 F;  3KP2 A;  3NQO A;  2MD5 A;  5CYV A;  3WG9 A;  4KUM A;  1GXP A;  1ZHF A;  4L5J A;  4OIR F;  5IT9 Z;  2JT1 A;  4LGW A;  3F3X A;  3GVA A;  5IT3 A;  3IKV A;  5ILU A;  4R79 A;  4UXN A;  2JZY A;  1ZRD A;  5HLI A;  1IW7 F;  2EA2 A;  1W7P B;  4GCV A;  1J59 A;  3H3U A;  2HKX A;  3V4G A;  3J81 K;  2JTV A;  4BYY A;  3KP5 A;  4BHB A;  3P9C A;  1LDK B;  2F5F A;  1NHA A;  1IXC A;  2O0Y A;  5JVT A;  2IA2 A;  1V3F A;  5E1X A;  4GO1 A;  2P5V A;  4IHS A;  2COM A;  3FXU A;  2HEO A;  4HF1 A;  2VT3 A;  3KEO A;  3LA2 A;  4KMU X;  3T1B A;  2FU4 A;  4R1H A;  3FF5 A;  5ED4 A;  4H0E A;  3TOB A;  2O6G E;  4LMY A;  4M6Y A;  3HOS A;  2GZW A;  3FXR A;  4KDP A;  1P4A A;  2JPB A;  4U0Y A;  1YFH A;  3CUQ B;  4L5I A;  4CDG A;  3CLO A;  1HKS A;  1XSX A;  3CUQ A;  3ZMV A;  4O5V A;  3TDZ C;  3T5X A;  1H0M A;  2YX4 A;  2RNJ A;  3GYH X;  2X0L A;  2XRO A;  2P6S A;  5HOO A;  3F8F A;  3QP5 A;  3W6J B;  3F6O A;  3O6B B;  5HDN A;  1S3J A;  3HHH A;  3WTW C;  2EFQ A;  1O7L A;  1S7O A;  4YIF A;  2P5K A;  4RGU A;  5EEH A;  4S05 A;  1EV7 A;  1H9T A;  3L9F A;  1P92 A;  1KQ8 A;  2HDC A;  3ELK A;  2W85 A;  2HOE A;  3KP3 A;  5J8C A;  1R23 A;  1FT9 A;  2XGX A;  3QPH A;  4GYG A;  3MWM A;  1VTN C;  3BPX A;  5F1R A;  1BIB A;  2D1V A;  3RYP A;  3ULQ B;  1XGN A;  2G7U A;  4HZF A;  3GX4 X;  2H6B A;  1R22 A;  2DFI A;  1XMA A;  4A0Y A;  1F4K A;  2DU9 A;  4R8H A;  2XRN A;  3EDP A;  4HX7 A;  1XDS A;  5DV5 A;  4P5O A;  3BJA A;  4L9T A;  3DFG A;  4CO8 A;  1SAX A;  5LHG A;  4L9N A;  4LLL A;  3C3W A;  1P4W A;  4EMS A;  3K0L A;  1SD7 A;  4WXC A;  4O6J A;  4IVN A;  2F2E A;  3JSO A;  2VC0 A;  4M9X A;  2VOO A;  2J5P A;  4A0Z A;  2Z5U A;  4RGR A;  1FSH A;  4JQF A;  2YU3 A;  3NRV A;  2XAH A;  4KYW A;  1HW1 A;  4Q47 A;  2KRF A;  5HDK A;  3WU0 A;  2KJC A;  3RYR A;  3RKY A;  4MEX F;  1XCB A;  5FLX K;  5K5Q A;  2BV6 A;  3MAJ A;  3HSE A;  5A2Q K;  2W84 A;  4ESF A;  4HDV A;  3SZP A;  1SMY F;  2B0L A;  2BE5 F;  1J75 A;  4HF2 A;  2E7W A;  4I2O A;  1KU9 A;  4KIG A;  3L7W A;  1ULY A;  2L54 A;  3CDH A;  1TLH B;  4ZYH A;  2E1N A;  3PQJ A;  4IPA A;  3TKY A;  1YLF A;  3RPU A;  1BI1 A;  3GWZ A;  4KIF A;  1IXS B;  1LDD A;  5TJJ A;  2GA1 A;  2M30 A;  1UB9 A;  3R60 A;  1GHC A;  4OU0 A;  3J7A O;  1Z6T A;  3E6D A;  3JSP A;  4AD9 A;  2E1C A;  1U6G A;  4WWC A;  4LG0 B;  2K4B A;  5TRD A;  4CXF A;  4LG0 A;  2DPU A;  1UFM A;  4ZYG A;  2FXA A;  1XSD A;  3LFK A;  1Z9C A;  2BGC A;  3C18 A;  3IRQ A;  3T8T A;  3M8F A;  5F6F A;  1ZRE A;  3QP6 A;  1OYI A;  3VB2 A;  5BOX A;  3JTG A;  1R1T A;  4EM1 A;  3K1P A;  2UWM A;  1HW5 A;  2DK5 A;  2OZU A;  5D4S A;  5LBQ A;  2FNA A;  1I27 A;  1LNW A;  5AIQ A;  3KZZ A;  2VON A;  2Z99 A;  1UCR A;  3MEX A;  2VE9 A;  3N4M A;  3ZQ7 A;  2CQK A;  5E8I A;  1R5H A;  4YFN F;  4N9H A;  1ZRC A;  1YW7 A;  1QPM A;  2PQ8 A;  1HKT A;  3WTZ A;  3I71 A;  3N97 A;  2DTR A;  3IRR A;  1W5T A;  4KFC A;  3ROU A;  2KIU A;  4Q48 A;  4ZYE A;  5CVR A;  2PFB A;  2Z33 A;  2HGC A;  1BN5 A;  2W24 A;  2FOK A;  3L00 A;  4PGG A;  2G7H A;  1IN8 A;  2ELH A;  2GIV A;  1S6L A;  2PG4 A;  3OOP A;  3PQK A;  1QZZ A;  2D2W A;  4I0A A;  6PAX A;  2HTS A;  3LQQ A;  4XSX F;  3FMQ A;  2W57 A;  4B09 A;  2EWN A;  3KFW X;  3IHU A;  2IPQ X;  5LRS A;  4Y15 A;  1JE8 A;  2EA4 A;  4IRI A;  5LLQ A;  2OD5 A;  4Y13 A;  2HWV A;  1ONV A;  3F72 A;  3VOD A;  2PBI A;  1T38 A;  2R7D A;  5ILS A;  3E97 A;  1MJA A;  2VBZ A;  2O03 A;  2A68 F;  3K1M A;  3E5U A;  3KP7 A;  4RB0 A;  1DDN A;  4ZH4 F;  2QZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...