3J80K

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j80K00
2K02A 2DBBA 5DYMA 1GXPA 2KRFA 3KP6A 3K2ZA 3EQLF 3KEQA 4PZJA 2VT3A 4N0BA 2IRFG 1S7AA 1FYKA 5EEGA 1Q1HA 2W24A 2V1DA 5CVRA 1P4WA 1U78A 5BPDA 3WTVC 5K1YA 3MEXA 1MD0A 5KVRA 4LD5A 1T2KA 3QRFF 1LEBA 2RN7A 1U5TA 4UXNA 1ZARA 2COMA 4EVIA 1YS6A 3DEUA 2W85A 3LA3A 3CJNA 1SD7A 2P4WA 1T0FA 5E8GA 2DK8A 4IRHA 4H0EA 1SMYF 3BJOA 5LEKA 4YFKF 4Y17A 3SXYA 3I58A 2D1VA 1F1ZA 3FXUA 1W7PD 2NAZA 2UZKA 2M8EA 3ULQB 3WE2A 4G6QA 3DP7A 1FX7A 4HYEA 5DUKA 3AAFA 4P5OA 2DAOA 4RGUA 5ICFA 3E3VA 1FT9A 2ETHA 3KLOA 1ZGJA 1FBUA 2MLKA 5KK1A 4O6JA 3GEZA 4LLLA 1W5SA 1OYIA 5CVVA 1RI7A 4I2OA 2MH2A 2QQAA 2EV6A 3JAMK 1J7KA 1LB2A 4BHCA 1JHFA 1REPC 2A5YB 2RV8A 2XKPA 4P9UA 4CXFA 1BIAA 1I5ZA 3BJAA 3RKXA 4LG0A 2E7XA 3QU6A 4HW0A 3JW4A 3EUHA 2FMYA 4UVCA 4MEYF 1S7OA 2LF7A 5DV5A 1HW1A 5D4RA 1U6GA 1BN5A 4R79A 4EM2A 1EH6A 1B1BA 2MC3A 1MJAA 4L5IA 2J5OA 1XN7A 5LRRA 5BOXA 2A3SA 1IUYA 3IRQA 2UWMA 5LGTA 2NNNA 4AIJA 5HDKA 3B73A 4M72A 1P6RA 3D5LA 1O7LA 2KKOA 4WXHA 3FWEA 3MWMA 5D8LB 4BHPA 3IWZA 4HQMA 4LLGF 4A5MA 3L2CA 4L9VA 2EFPA 2KJBA 2QYOA 4MQVA 4WCGA 4HLYA 5DEQA 3LA7A 1D8JA 2QBYA 2HQNA 5CVIA 5LHIA 1BI0A 2DPUA 3T0YA 3NQOA 1D5VA 3BP8A 2OQRA 4I01A 2A07F 5FGMA 5EEHA 3V7CA 1YW8A 4EV0A 5D4SA 2FEZA 1R22A 3VOEA 4G7OF 3WODF 1XMKA 3IKVA 1ZREA 5JVTA 2EA4A 3RPQA 4CZZA 2XAFA 2EV5A 3DPTA 2YX4A 1USSA 4P55A 2H6CA 3KFWX 3CUOA 1BOAA 1ZLKA 2GWRA 2WV0A 1KYWA 5LRSA 2G9WA 2GIVA 2WWYA 2OU2A 3KCCA 5CJ9A 2EFQA 1LQ1A 2ZFWA 4ESBA 4UNOA 1GVJA 6PAXA 3GYHX 4XLNF 3WTXC 3M1EA 3CO7C 2W25A 1KU2A 2ZCWA 4M71A 1J9IA 2Y0MA 3K9TA 4RGXA 2HYGD 3SZTA 4A2UA 4OINF 3K69A 1H9GA 3GFMA 1B4AA 2Q2EA 3WTZA 2PEXA 1DP7P 1R5GA 2JTVA 3BROA 2R3SA 3MCZA 1T98A 5DCMB 3MZYA 2BEOA 3F23A 4PGHA 3M9AA 4XBFA 1TW2A 1SD4A 2P5VA 4L9TA 4R1HA 4KUMA 2QZ8A 5ICCA 2ZKZA 1O7FA 3ABUA 3WTTC 2V1XA 4WXCA 2EWNA 4G9YA 4L18B 3P9CA 1KGSA 1R23A 3SFZA 4EGZA 2NYXA 4DNCA 1MGTA 3F8NA 4KN7X 3I59A 4ENJA 4Y15A 3SZPA 2K4JA 5CVJA 4HLXA 3E6MA 2P6SA 3GXOA 1USTA 3FM5A 3WTUC 4EMSA 3MFKA 3FHZA 3I64A 3H92A 1XGSA 2P5KA 4LMYA 2D2WA 5FB2A 3O3KA 3S2WA 4YFXF 1T6SA 4KMUX 1I27A 1O3SA 5LLQA 4R8HA 3CO6C 5CVUA 1IN5A 1QZYA 3CLOA 3KETA 1E17A 1XDSA 1G3YA 2CWEA 1RIOH 4GCVA 2L3DA 1YLFA 4ENKA 1B9NA 4FHTA 4IJAA 2RVCA 2EV0A 4P9FA 1GXQA 4B8XA 3M8EA 3MZHA 4N9IA 5HLIA 2VODA 3R61A 3TQNA 2DU9A 1ZGAA 5L3BA 4RB2C 1F4KA 1XCVA 5L3EA 1BJAA 4GYIA 3U2RA 1C0WA 3N4MA 1YW7A 2H6BA 3ZMDA 4HOBA 1U3EM 2HS5A 4LK1F 2FQ3A 2OA4A 3P9IA 4I02A 5E20A 1B59A 4A6EA 3FMRA 4KN4X 4GO1A 5F1RA 4U7DA 2NRAC 3DV8A 3FMSA 1TQMA 3W6KB 2XASA 3MQ0A 3WTYC 3HTUA 2IP2A 3KP2A 3Q9SA 2V1UA 1HBXG 3L00A 1S29A 2RKHA 1QGPA 3FX3A 4RB3C 2FOKA 2VBXA 4XRFA 3BPVA 3HYIA 5DD4A 3ZPLA 1L3LA 4EJOA 3VB2A 2LSOA 2VBZA 3TO7A 2MBFA 1ONVA 1BI2A 3I71A 4M9XA 2FNPA 3KE2A 3NEUA 5H6RA 4M6YA 1KA8A 1IN7A 2QENA 4CYDA 4OMYA 3FM3A 1YYVA 2FRHA 3F6OA 4HAMA 4LGWA 4IF4A 5A2QZ 1MDMB 3JAMZ 2P7VB 3O2PE 1OMIA 3KEOA 2FNAA 2MD5A 5K5OA 1F5TA 4WXDA 3I54A 4MNUA 5L3DA 1TNSA 5FO5A 3ERED 2Y48A 5TJJA 1W7PB 2JRTA 2YR2A 3LFKA 1FSEA 1G3WA 2OQGA 3JSOA 3W6JB 1TTYA 3TGNA 1TW3A 3U1DA 2PLYA 4QLCU 1JHHA 2PMHA 4IRGA 4EJTA 4G6DA 2P5LC 3P7NA 3TDZC 3K0LA 1G3SA 1PDNC 5D8KB 5H6QA 5J8CA 3GF2A 2CG4A 5HS9A 2DFIA 1ULYA 1WRJA 3DF8A 3FMQA 4NB5A 2XROA 3BJ6A 1WWXA 3GFJA 2GQQA 4KIFA 3K1NA 4LLNA 4UV8A 3QP5A 4Q47A 3V8JA 2HTJA 4KMFA 4PDKA 4AVPA 3U9GA 1Z91A 3WGIA 1BIBA 2DT5A 1CF7B 4O5VA 1WSUA 4AIKA 4KICA 3VFZA 2NNYA 4E70A 1FYLA 4HDUA 1HXDA 3JTHA 2CYYA 2Z99A 1SFUA 1Y0UA 2FXAA 2RQPA 1R5HA 1FOKA 4G7HF 5J8FA 4ZYGA 2XUBA 3F22A 1LEAA 5ILVA 1ZAOA 4RAYA 2BYVE 4KIGA 2DW4A 3QPHA 3ZMZA 3JSPA 1ON1A 4ZYHA 2QWWA 1RZ4A 3F8FA 4UUVA 2XKOA 2GA2A 4IPAA 3CTAA 3IL2A 3HRTA 5TRDA 2IPQX 2RNJA 2X4HA 2FBIA 1A04A 1T38A 2HOEA 2VOOA 1B6AA 5A2QK 4NQWA 4UVBA 4HBLA 3C1DA 3EYIA 3TO9A 2DTRA 2IJLA 5F6FA 4PGGA 2DQLA 3RIRA 2M30A 1IXCA 4U0WA 4LJZF 3DXJF 2A6EF 5HS7A 4FT8A 3F8MA 3QP6A 1T39A 2VC0A 2XV4S 4RS8A 2EFNA 1P2FA 3IRRA 5DCMA 1IZ1A 1UHWA 3LSTA 1OR7A 2OD5A 1P4AA 4EM0B 3ZMTA 3ZMUA 4IHSA 3Q9VA 4QWQA 3V7RA 3IC7A 2JT1A 1YFHA 4BXUA 2RDPA 3GZ5A 3HSFA 1ZG1A 4A0ZA 1ON2A 1NHAA 4YIFA 1ZH5A 1UB9A 1QNTA 2CW0F 3HSRA 4EJUA 2A61A 4A5NA 1XB4A 5LEJA 1JE8A 5K5RA 1U5TB 3REOA 5FLXK 1ZRDA 4U0YA 1TLHB 2XHKA 4EM1A 4LB5A 1ODDA 3V8LA 2OZ6A 3F3XA 1GHCA 4NHJA 2ZO4A 1P4XA 2VBYA 3GZ6A 3TO6A 3LQQA 3ZP5A 2YSRA 1HKTA 4RB0A 2MH9A 1S3JA 1STZA 1WKMA 4EGYA 2EFOA 4FX4A 2HYFA 4OIPF 2HDCA 2FA5A 2BE5F 3V8KA 3R60A 1UHMA 2W57A 4MTDA 3RYRA 2KIUA 3GW2A 3WE3A 1DDNA 1BC8C 1SD6A 4G8XA 4U88A 4KDPA 1DPRA 3E5XA 4K2EA 2A68F 3PQKA 3J7AO 2OZUA 1F9NA 4FX0A 5ICGA 2PN6A 2ZJ2A 1VTNC 1JXSA 1R58A 3LWFA 5JHUA 1K6OA 1BBYA 4HF0A 3DPLC 5HOOA 2HTSA 5HLGA 1Z6TA 3GUDA 3WU1B 5K5QA 2XGXA 3E6CC 3WGHA 3BOQA 1BI3A 2GXBA 2F5EA 1PUEE 2XAQA 2BV6A 2JZYA 2DI3A 1XSXA 3QPTA 3RKYA 4IRIA 3FXQA 1XGMA 5E8IA 5BS6A 5CLSA 1XMAA 1YW9A 3ML6A 3ZMVA 2GAUA 2P8TA 3P9KA 4XSXF 3QU3A 3RKWA 4AWXB 3QAHA 3E6DA 1D8KA 2ISYA 1Z6RA 1SFXA 3HRMA 5DUIA 2A69F 2M45A 1IXRC 5D5XB 5DCFA 4RGSA 3HUGA 2VN2A 2FBKA 2K27A 4JQFA 1WI9A 1FPQA 2YU3A 3ISPA 4ESJA 1D3YA 1MKMA 1HSTA 1QO0D 1U8RA 3I4PA 1Z05A 3OV8A 1MDMA 3LAPA 4I0BA 5ILUA 3ROUA 3GO5A 1MJBA 3KZYA 3L09A 1IAWA 2ZXJA 4UHTA 1EH7A 3WU0A 5D6FA 1W5TA 3LQRA 3ZN0A 1KU9A 2FMLA 4HV6A 4HX7A 1FNNA 2VE9A 5DDGA 5ERIA 1S6LA 1PP7U 4A0XA 4D0PA 2XRNA 1QQIA 2XAHA 2B0LA 1L0OC 4ENMA 1XGOA 1RUOA 4OIRF 3R0JA 1CGPA 4EQQA 2WTEA 3N97A 4ESFA 1QZZA 1HKSA 2QQBA 5DD8A 2E1CA 2VT2A 2ZMEB 3CUQB 4ZYDA 4CDGA 3J81K 4I09A 4UVAA 4ZZDA 1BM9A 4MQ9F 1X3UA 1SAXA 1XD7A 1CF7A 3H3UA 2CSOA 1FWZA 3C7JA 1Z7UA 4S05A 3BDDA 4L5JA 4ON0A 2XIGA 1PP8F 2VXZA 5BPIA 2L54A 2ACJA 2P7CB 4Q48A 4BAYA 3F8CA 3BZ6A 3HHHA 1O3TA 2RC4A 4I7HA 5IT3A 4MGRA 1YQAA 2D45A 3QOPA 3DKWA 4IVNA 3EYYA 2ZNYA 3C3WA 1KU7A 1XDUA 2M87A 2ZBKA 1R1UA 3B02A 1J59A 2FBHA 3Q5FA 2UXXA 1IF1A 1MZBA 2L02A 3HSEA 4GYGA 1OKRA 2EK5A 3R6SA 4KNYA 3WTWC 3WGGA 2LKPA 5E1XA 4M9SA 1TBXA 5L3FA 1HW5A 3GFLA 2J5PA 3LA2A 5ICEA 3GWZA 3T5XA 2GZWA 5FFXA 1G3TA 2XVCA 3L9FA 1U2WA 3G3ZA 2G7HA 3KP3A 1LJ9A 3T8RA 4RB1A 5D5UB 1O57A 3M7GA 4S04A 2LDUA 1UCRA 3ZN1A 3J80K 1FSHA 2XAJA 2VOPA 2L4AA 2QQ9A 1J75A 3VEPA 4EJWA 2ISZA 2L01A 1HSJA 2BGCA 3OOPA 2M1BA 2OBPA 2Y75A 4RGRA 5HS8A 3HOTA 1EV7A 3H3ZA 2ADUA 5J6XA 1H9TA 3I0TA 4ETSA 2PBIA 2LNBA 2A6HF 2V9VA 5FLXZ 1HW2A 2HQRA 3V4GA 3KP4A 1TQIA 4A0YA 2WC2A 1DPUA 5BMZA 3GLXA 4MTEA 2QUFA 3F8BA 3RPUA 1IN8A 1P92A 2ESHA 1ZN2A 1KU3A 5D5VB 2PG4A 3DQVC 4I98B 2H94A 1IN6A 4HV5A 4WF2A 1J2XA 2PQ8A 3IKTA 3ZQ7A 4WWCA 4KT5C 4M6XA 4CGZA 5LGUA 3BY6A 2F5DA 3MAJA 5FD5A 1G6NA 4WX9A 1HQCA 4BYYA 3COAC 4F7ZA 1LDKB 1ZHFA 4HX4A 1V4RA 2STWA 1FLIA 2DO7A 2F5CA 1IRFA 4CICA 4ASNA 2KJCA 5JFRA 1BI1A 5IT9K 2PI0A 3ECOA 2AS5F 2HWVA 1K78B 2TDXA 2NS0A 3SHFA 2Z33A 2Z3YA 4WK8F 3KLNA 4B09A 1MJ9A 2L4MA 2ESNA 2EJRA 2HZTA 4KFCA 4LB6B 5HDNA 4U7BA 4M73A 3C18A 2HFHA 2O6GE 3RYPA 4IXAA 1KQ9A 1XSDA 2FE3A 1YG2A 5E18F 2KIMA 3BWGA 2D1HA 5AIPA 2K7LA 1Z1DA 3E97A 1YIOA 5HLHA 1ZRCA 1FP1D 5FD6A 1U5TC 2R7FA 5HVQC 3T1BA 3GX4X 1ZG5A 4ZZLA 1BC7C 5AONA 3E6BA 1IXSB 1AOYA 2E7WA 3VODA 4ENNA 2O3FA 1QBJA 5L3CA 2H27A 2FSWA 3D0SA 2VC1A 5F64A 2ZNZA 3SQNA 5LGNA 3IWFA 2W84A 3FXRA 3E5QA 3HOSA 4L9NA 2QVOA 5FFZA 3HIFA 1TNTA 1YS7A 4XSZF 1OYYA 2IT0A 2Q0OA 3RTRA 3RDIA 3GVAA 4LK0F 1J5YA 2FF4A 2CGPA 4HDVA 2C6YA 4AD9A 2PMUA 4XLPF 5JI6A 1S8NA 4BH9A 2YPRA 4EJVA 2ELHA 1IW7F 1IRGA 2MA3A 1E2XA 1K7AA 1WQ2A 1IN4A 4HA8A 1FYMA 2GXGA 1KQ0A 4YIIA 3JTGA 3I5UA 2F5FA 2STTA 2VONA 4BQAA 3FZVA 1R7JA 4Z2YA 5AIQA 4OIOF 2E1NA 1DUXC 3J81Z 2O8XA 2CQKA 3ELKA 2EFWA 1AWCA 2QLZA 4JBAA 3F21A 4DQ2A 2ZMEA 3CUQA 1JGSA 1H0MA 1FZPB 2Q8KA 1OPCA 4LG0B 3FF5A 2VE8A 1R1TA 1YTYA 3K1PA 4M74A 1FBSA 2O61A 3TDUC 1RNLA 4P96A 1G4DA 2P6TA 3CDHA 4HX8A 5ILSA 2R7DA 4HQEA 5CYVA 2K86A 3PQJA 4L0YB 2HGCA 3KZZA 3PFIA 5H20A 4KYWA 4LFUA 1ZLJA 3M8FA 3K1MA 3ZMSA 2LF8A 2YX7A 2Z5UA 4M9ZA 1KYZA 1O3QA 4HF2A 4YG2F 1LVAA 3TOBA 4HZFA 3LAJA 3HRSA 4YFNF 1W4MA 2KIFA 1K79A 2QBYB 1I1SA 4PCQA 4GXOA 2JPBA 5E1ZB 2AXLA 4U0VA 2Z9OA 5JR3A 1LNWA 5LBQA 2PFBA 2QM3A 5D6EA 1FC3A 1QPMA 1FY7A 3WG9A 4ZYEA 4GGGA 2M5WA 1W7PA 4UV9A 5LHHA 3F72A 3T8TA 4Y13A 2UXNA 4KA4A 2DQRA 2DK5A 3J80Z 4BHBA 2DPDA 4A12A 3R4KA 2H09A 3ABTA 4Q5SF 1R36A 5BQTA 2F2EA 2GA1A 3EDPA 5ED4A 3CUQC 4O3MA 3BPXA 4OOIA 1V3FA 2HKXA 2XAGA 4TV7A 1R00A 2PJPA 4RAZA 2HEOA 1EH8A 4OMZA 2VBWA 2OAZA 1HKQA 2IW5A 4A6DA 2X0LA 3G73A 4HF1A 4AIHA 3I53A 4OIQF 3HRUA 1TQPA 2EA2A 2IA0A 3KP7A 5E17F 1UFMA 1FBQA 1KQ8A 3O6BB 4G94A 4ZH4F 3HHGA 1XCBA 4G7ZF 2EB7A 3V7SA 4JK1X 4MEXF 3DFGA 3L7WA 1ZYRF 4KIBA 3EETA 4IHTA 5D5WB 3RI4A 2JPCA 2HKOA 3GFIA 3WTSC 2DLLA 1Z9CA 2O03A 1SD5A 5LHGA 2V79A 1SFEA 3R0AA 4N9HA 2BBYA 4BNCA 1I6XA 4CO8A 1ZRFA 5L3GA 1O3RA 3TOAA 4I0AA 4L9JA 1ZG3A 2IA2A 1I1GA 2O0YA 4MHGA 3NRVA 2RGVA 3E5UA 1FP2A 3I59B 1RUNA 3KP5A 3F6VA 1OYWA 5HDGA 1R1VA 3HTSB 1LDJA 3IHUA 1YO5C 5IT9Z 2HR3A 1J0RA 2K4BA 2V6CA 2IA1A 2CFXA 4Q4ZF 1XGNA 3TKYA 1B9MA 2FU4A 1K78A 2IVMA 1LDDA 2G7UA 3ECHA 4CHUA 2CO5A 1XSVA 2MLGA 1SMTA 5E1WA 2JSCA 4L0ZB 3RJPA 4OU0A
chains in the Genus database with same CATH superfamily
4BJTA 2K02A 2DBBA 1JKRC 2ECBA 2FX0A 3SFIA 5DYMA 1A6QA 1GXPA 2KRFA 5DTDA 3KP6A 3LNQA 3K2ZA 3EQLF 3KEQA 4RA2A 2O5RA 4XLFA 2XB5A 2L7ZA 4PZJA 2XGEA 2VT3A 3DEEA 4N0BA 1W0UA 2IRFG 1S7AA 5EDNA 1FYKA 3S1NJ 4M3BA 2VKHA 5EEGA 1Q1HA 4UUSB 5HLTA 1FOXA 3BQYA 5GTIC 1N25A 2W24A 4BEHA 2V1DA 4I99C 4JX6A 3FK6A 3OSGA 3S3MA 5CVRA 1LKXA 1P4WA 3VSLA 1U78A 1HLVA 3HGYA 3DTKA 5BPDA 3OYNA 5FKOA 3WTVC 5K1YA 3MEXA 1V5EA 1MD0A 3HPHA 5KVRA 4LD5A 1R5ID 3HPGA 1T2KA 2XB0X 1MSFC 4C2UA 3QRFF 1ETVA 1SVOA 1AKHB 5EJCA 2RN7A 1LEBA 2JWTA 1U5TA 4UXNA 2EBIA 1ZARA 2COMA 3HZJA 4PJNA 5FKNA 5FKLA 3QPSA 4C9YA 4EVIA 1YS6A 3LSIA 3ZR8X 3DEUA 1NK2P 2W85A 2HQAA 3SZGA 2NVYJ 1MMAA 3OYBA 3LA3A 3CJNA 1SD7A 2P4WA 1T0FA 5E8GA 1RKTA 2QKMB 2DK8A 2FD5A 4IRHA 4H0EA 1A36A 1SEUA 1SMYF 5FLMJ 3BJOA 1WGXA 4FE4A 4A93J 3ZCOA 4B48A 5LEKA 2E34A 4YFKF 4XORA 4Y17A 2R7VA 2ID3A 3SXYA 4XLHA 3I58A 2D1VA 1F1ZA 4UY8I 1G59A 3FXUA 1W7PD 1WJAA 2NAZA 2VUMJ 2R7TA 2UZKA 1X1DA 1JJ6C 1GV5A 2M8EA 4BS9A 3ULQB 3WE2A 4G6QA 2BZTA 3DP7A 1FX7A 2JVGA 4HYEA 5DUKA 3B6AA 2KHMA 4BUPA 2NVXJ 3AAFA 3GTLJ 2X51A 5IPAA 2W1OA 4FQGA 3NAUA 3CP2A 4P5OA 4Y52J 1FIAA 2DAOA 4RGUA 2WY8Q 5EZGA 5ICFA 3E3VA 4XKBA 1FT9A 2Y31A 1EF4A 2ETHA 3KLOA 1ZGJA 5TISC 1FBUA 4J19A 2BOLA 4E6KG 5C44J 2MLKA 1OQYA 5KK1A 4L5EA 4O6JA 3GEZA 4LLLA 3WU2C 1W5SA 1OYIA 5CVVA 1RI7A 4QTRA 3PO2J 3L2VA 4I2OA 2MH2A 2QQAA 2OJED 3L2UA 1X4OA 2EV6A 1JI8A 3JAMK 1QA6A 3CLQA 1J7KA 1LB2A 2HU9A 3IAS2 3CZ6A 4BHCA 4RLQA 1JHFA 1REPC 2A5YB 2NS8A 3OYDA 2GIZA 1LFBA 2E71A 2RV8A 3VYUB 3HXLA 2XKPA 2L9SA 2M3AA 2VL8A 3HM5A 4P9UA 4CXFA 3CCVI 1BIAA 1I5ZA 2COBA 2LRDA 3BJAA 3RKXA 3JREA 4LG0A 5GPAA 4XIDA 1R4MB 2E7XA 3QU6A 4HW0A 3G1MA 2R7QA 3JW4A 5EZHA 2R7WA 4RBOA 3HKZA 4DGWB 3BT9A 1UMQA 2BY3A 3EUHA 3IH4A 2FMYA 2LC2A 3QPLA 1WFXA 4UVCA 4MEYF 1S7OA 2XDVA 2L9NA 2LF7A 1NH3A 5DV5A 2M7AA 2L7KA 1QZEA 2P0WA 5GPCA 1HW1A 4II2A 4E7ZA 4W1UA 5D4RA 1U6GA 3RQIA 1WH7A 3S2HJ 1BN5A 4R79A 3LSPA 4QIWN 4EM2A 1EH6A 1B1BA 1JTYA 2MC3A 1MJAA 4J00A 4L5IA 5J4YA 2J5OA 1Z0XA 2L7MP 1XN7A 5LRRA 5BOXA 2A3SA 2E1MB 1IUYA 3IRQA 2UWMA 4F55A 5LGTA 2OC6A 1T0FC 2XGCA 2B63J 2NNNA 4AIJA 2IS2A 2E5ZA 2ICWG 2OF7A 5C3EJ 5HDKA 3HDDA 3B73A 4BKXA 2CU7A 4M72A 1B72B 3CDLA 1P6RA 4NC8A 3PJRA 3D5LA 4PK4A 1O7LA 3A01A 2VKDA 2KKOA 4ITVA 3WHBA 3HB9A 1X1PA 2KPMA 4XN0A 3VWBA 4WXHA 3FWEA 3S3NA 3M07A 3MWMA 2RQQA 1FIPA 3G1LA 3ZXSA 5D8LB 1OLTA 2ZB9A 4BHPA 4KISA 3ABKH 3IWZA 4HQMA 4LLGF 4A5MA 3L2CA 1D5YA 4L9VA 2EFPA 2KJBA 5HNHA 2QYOA 4MQVA 4WCGA 4HLYA 5DEQA 3LA7A 4XLAA 2BHZA 1D8JA 3JRDA 2HQNA 3L2QA 5CVIA 1A35A 3CCYA 5LHIA 2QBYA 2GOXB 1BI0A 3CCMI 2DPUA 3T0YA 3NQOA 1R71A 3BP8A 2OQRA 4I01A 1D5VA 1W36D 2A07F 5FGMA 5EEHA 3V7CA 3D1NI 1YW8A 2E19A 5D4SA 4EV0A 4FISA 3S14J 3M3YJ 2FEZA 1R22A 4A3LJ 3VOEA 4G7OF 3WODF 1XMKA 3IKVA 5DM7F 1ZREA 5JVTA 2CW7A 2EA4A 3DWLE 3PNYA 4F92B 3HOZJ 3RPQA 2FOWA 4CZZA 2XAFA 2I10A 1ITYA 2EV5A 2KQRA 3DPTA 2YX4A 1USSA 2Z16A 4P55A 2H6CA 3H5RA 3KFWX 1MW7A 2LOOA 3CUOA 1BOAA 1ZLKA 2GWRA 2WV0A 1KYWA 1WCMJ 3LSRA 5LRSA 2G9WA 2V6EA 2GIVA 2WWYA 1UG0A 2OU2A 3A2KA 1YRNA 3KCCA 1H8AC 3BR3A 2PMZN 2EFQA 3M1CA 5CJ9A 1LQ1A 2ZFWA 4ESBA 4UNOA 1ZKGA 1GVJA 2HOAA 4AUXA 2IS1A 6PAXA 2PJRB 3GYHX 3EUHC 4XLNF 5JLWA 4J01A 3JRCA 3WTXC 3M1EA 2K9LA 2W25A 3CO7C 2HOSA 3LSJA 1KU2A 2ZCWA 4M71A 1J9IA 2Y0MA 3K9TA 2DJNA 4RGXA 2HYGD 3SZTA 4A2UA 3L2WA 2R5YA 4OINF 3K69A 1H9GA 1R49A 3GFMA 1B4AA 3IV5A 2NVTJ 2CUZA 2Q2EA 1DQUA 3I3LA 3OL4A 3WTZA 1UHSA 2PEXA 4E7KA 3BR5A 1DP7P 2EZLA 5E3OA 1R5GA 2JTVA 2M7BA 4B4CA 1JT6A 3BROA 2DFEA 2R3SA 3MCZA 3LOCA 1T98A 5DCMB 3MZYA 2YU9J 1VI0A 2BEOA 3F23A 2LG4A 3BTJA 4PGHA 1ZTRA 3M9AA 3IP4B 5J40A 4XBFA 1WJ5A 5HODA 2DT6A 1TW2A 3RPUD 1SD4A 2P5VA 4L9TA 3HOXJ 1BOBA 2DMTA 1BR4A 4R1HA 2WAEA 1N75A 2X6WA 1JKPC 4PFPA 1V55H 4KUMA 2QZ8A 5ICCA 2ZKZA 5EG0B 4NDLA 1O7FA 4H4KC 2OTLI 3ABUA 3PIPF 3WTTC 3SDGA 3BTCA 2V1XA 3HJEA 1YJNI 1GLNA 4WXCA 2JQ7A 2EWNA 4G9YA 4L18B 3P9CA 1KGSA 1R23A 3LFUA 2LP0A 4IOAF 2X9DA 4RLFA 3SFZA 4BJ6C 4EGZA 2NYXA 4OAYA 1Y1WJ 4DNCA 3OYCA 1MGTA 3BG7A 3F8NA 3J7ZI 3RSNA 4KN7X 3FXMA 4UB6C 3I59A 3S2DJ 4ENJA 4Y15A 1DU0A 2EZKA 3SZPA 3GTKJ 3CDIA 2K4JA 2DOAA 1J09A 5CVJA 4HLXA 4S0HB 1POGA 3E6MA 2P6SA 1FTTA 3ZGKA 3GXOA 1USTA 3FM5A 3WTUC 1YJ9I 4EMSA 3MFKA 3FHZA 3I64A 3G6EI 5KAIC 3QODA 3H92A 4RDUA 1XGSA 1HC8A 2P5KA 2Y69H 4LMYA 2JN6A 2DA5A 2D2WA 2JUGA 5FB2A 3O3KA 1S5LC 3HOYJ 3S1RJ 3S2WA 2X6XA 4YFXF 3MZ8A 1T6SA 2DJIA 4B3XA 1RESA 4B1RA 3CC7I 4KMUX 1I27A 2WBMA 3BTIA 1GUUA 1O3SA 1HCRA 5LLQA 3CJQB 1Z67A 3PIOF 4R8HA 3CO6C 1TP4A 1VZ0A 3MKYB 5CVUA 1IN5A 1QZYA 2E35A 2ID6A 3CLOA 3KETA 1E17A 2I8DA 4Z6YA 1XDSA 1G3YA 4FE7A 2CWEA 1RIOH 4GCVA 2CW8A 2OV7A 2L3DA 1YLFA 4ENKA 3FK7A 1B9NA 4FHTA 4IJAA 3CCQI 2RVCA 3CJTB 2EV0A 4P9FA 3Q0UA 1GXQA 4B8XA 3M8EA 3MZHA 4N9IA 3G2BA 1YI2I 2DA3A 5HLIA 4UUTA 3BG3A 2W4SA 2WAQN 2VODA 3R61A 3K70C 3TQNA 2DU9A 2LLKA 2CV1A 1ZGAA 5L3BA 2K3PA 4RB2C 5F0FA 1XCVA 1F4KA 1GDTA 2WY7Q 5L3EA 2KDZA 3GCMA 3OL3A 2GXAA 1BJAA 4GYIA 2VJIA 2WADA 3TP0A 3AG3H 1MBGA 4RMNA 3U2RA 1C0WA 3N4MA 4C3JJ 1YW7A 1RR7A 4UUSA 2BXZA 3HOVJ 3A0BC 2H6BA 4BBRJ 1OCCH 2D5VA 2XPVA 3ZMDA 4HOBA 2Y0SA 1U3EM 2JA8J 1XX5A 2HS5A 3K4CA 2BY2A 1MMNA 1S9HA 3BG6A 3O8GA 4LK1F 4XLCA 2FQ3A 2OA4A 2IGOA 4M3DA 4HNUA 1WJDA 5JHFA 2E2IJ 3P9IA 1MBJA 4AYBN 3S3OA 4I02A 4IZZA 5E20A 1B59A 2QQ8A 3HG9A 5F0CA 4A6EA 3FMRA 4KN4X 4F52A 1AKHA 4GO1A 3DEWA 5F1RA 4U7DA 2NRAC 3DV8A 3BCBA 3FMSA 1TQMA 3W6KB 1I3AA 5GAHJ 3CCSI 2L9VA 4P1WA 2XASA 1VF9A 3MQ0A 4BGDA 2NOGA 3VPRA 3WTYC 5F0HA 3GTJJ 3HTUA 2IP2A 1JUPA 3VDXA 5IYCJ 1VFCA 3KP2A 3Q9SA 4A3CJ 2A05A 3UR3C 2V1UA 2VQGA 1PUFB 1K6YA 4D1QA 1HBXG 3L00A 3AL0C 1W1WE 2MG4A 4HG2A 2QA4I 1S29A 2RKHA 1QGPA 2M34A 3FX3A 5K7HA 3A1YA 4RB3C 2HVSA 2FOKA 2WB1A 3ZOBA 2VBXA 4XRFA 3BPVA 3HYIA 5DD4A 4YELA 3ZPLA 2W82A 2KRCA 1L3LA 4EJOA 3VB2A 2LSOA 2VBZA 3TO7A 2MBFA 3FIWA 1ONVA 1BI2A 3HUGB 3I71A 4M9XA 3OYLA 5M3FJ 2FNPA 3KE2A 2VQCA 3NEUA 3CP8A 5H6RA 5F04A 4M6YA 1APLC 1KA8A 2ELKA 2Z1DA 1IN7A 2QENA 4CYDA 4OMYA 3FM3A 1YYVA 4XLEA 4CCMA 2FRHA 3ONQA 4DYCA 3F6OA 4HAMA 4LGWA 4IF4A 5A2QZ 4V2GA 1MDMB 3JAMZ 2CUJA 2P7VB 3O2PE 1OMIA 1CQTA 1VQ7I 1IJWC 1ENHA 3KEOA 2FNAA 2MD5A 2B7EA 5K5OA 4XKWA 4BACA 1F5TA 4WXDA 3I54A 4MNUA 5L3DA 3JCUC 1TNSA 5FO5A 3ERED 2Y48A 2JJ7A 2FJ1A 5TJJA 1W7PB 4CH7A 2JRTA 4HSTA 5FJ8J 2YR2A 4KT6A 3LFKA 2XPUA 4RM3A 1FSEA 4CSWA 1G3WA 2OQGA 3JSOA 4DBQA 3W6JB 3SEZA 1TTYA 2KL4A 3TGNA 1TW3A 1Z7LA 3U1DA 2PLYA 5FKKA 4QLCU 3CCUI 5GAEJ 1JHHA 2PMHA 1K83J 4ZDLA 4IRGA 3CMAI 2XGDA 3FKJA 3OYAA 5GADJ 3OYJA 4EJTA 2L7FP 4G6DA 2P5LC 3P7NA 3TDZC 1E0EA 2V7FA 3K0LA 1IGNA 2CV0A 1G3SA 1PDNC 5D8KB 5H6QA 4CCNA 5J8CA 3GF2A 2CG4A 5HS9A 1FOWA 1EKEA 1LE8B 2DFIA 1ULYA 3S17J 1WRJA 1X58A 3DF8A 2VB6A 2MABA 3FMQA 3QQAA 5FKMA 4NB5A 1YHQI 2AQEA 4JX4A 2ZSHB 2LY2A 3BJ6A 2XROA 1WWXA 1DGWY 3GFJA 2GQQA 4IOCF 4KIFA 3K1NA 1ZR2A 4LLNA 3IH2A 2LBFB 2VXDA 4UV8A 3QP5A 4Q47A 3V8JA 2HTJA 4KMFA 3AKZA 4PDKA 2ZJQF 2ELJA 4AVPA 2UV1A 3V42A 3U9GA 2DDBA 5E79C 2DOEA 2QGUA 1AU7A 1Z91A 3WGIA 1OCPA 1BIBA 1B72A 2DT5A 3WG7H 2DA4A 3MD2A 1A6IA 4N4NB 2VKEA 1CF7B 3BG5A 2R93J 5FRMA 3A03A 4O5VA 2R7RA 1WSUA 2BW3B 2G0EA 4A3KJ 2DOFA 4AIKA 4KICA 2ZXHA 3FDYA 2NVUB 3VFZA 2NNYA 4E70A 1FYLA 3L2RA 4HDUA 1TWAJ 3OWTA 1HXDA 2OPTA 4CCKA 3JTHA 2CYYA 2Z99A 1SFUA 1VQKI 3GTGJ 4BDYA 2QCOA 1Y0UA 2FXAA 2KT0A 4Y7NJ 2RQPA 1R5HA 1FOKA 2MFZA 2O8KA 4G7HF 1DGRM 4ZYGA 5J8FA 2XUBA 2DTZA 3F22A 1LEAA 5ILVA 2QSHX 4XNFA 3OIQA 1ZAOA 3SEQA 1ZR4A 2FUG2 3KPHA 3PNVA 2JMWA 4RAYA 2O9LA 3PSIA 3HC7A 2BYVE 4KIGA 2DW4A 3QPHA 1WJBA 3ZMZA 3JSPA 1ON1A 4ZYHA 2QWWA 1RZ4A 3F8FA 1X1BA 4UUVA 2XKOA 3Q0WA 3CMYA 2DA2A 2GA2A 1VQ6I 4IPAA 2MD0A 1MIJA 3CTAA 3KYCB 3IL2A 2HNHA 3HRTA 4AC0A 5TRDA 5J1RA 4GFBA 2IPQX 2EILH 5F1JA 2VJ5A 2F5VA 4IHWA 3FHNA 2RNJA 3C2HA 2MC4A 3LL7A 5EEAA 2X4HA 4V2FA 2FBIA 5J1YA 2DCEA 1A04A 2BXYA 2HQ5A 5IY5H 4IO9F 1T38A 1RPWA 2HOEA 2VOOA 1DP3A 1B6AA 3H9JA 3K4MA 4M3GA 3J7AY 3E7LA 1X2NA 4NQWA 4UVBA 5A2QK 4HBLA 4X0GA 3LSGA 3C1DA 3ESWB 4CCLA 3EYIA 3TO9A 2PJRA 2PX9A 2DTRA 2DFFA 2KZGA 1ETOA 1MBFA 2RAEA 4BBSJ 2LTPA 2IJLA 5F6FA 4AIDA 4PGGA 2DQLA 2IEKA 1K61A 3RIRA 3TMOA 2M30A 2EZIA 3DBHB 1IXCA 4U0WA 4LJZF 3DXJF 4E7SA 2B9SA 2A6EF 5HS7A 4FT8A 4HEA2 3F8MA 3QP6A 1T39A 2VC0A 1A5JA 2IS4A 1Y8RB 2XV4S 4RS8A 2EFNA 2E1MC 2HXIA 1TC3C 3KZIC 1P2FA 3IRRA 2R5ZB 2HDDA 3Q3SA 4YEJA 5J47A 1IC8A 2DFHA 5DCMA 3DCFA 1VQ8I 1BL0A 1RC9A 2M9HA 2BHYA 1YIJI 3JRHA 1IZ1A 1UHWA 2E1OA 5IP7J 3LSTA 1OR7A 1OJLA 2OD5A 4A3FJ 1P4AA 2VJJA 4EM0B 3ZMTA 3ZMUA 4IHSA 3Q9VA 4QWQA 3V7RA 3IC7A 2WA0A 3DTEA 4JX5A 2JT1A 2VASA 2M0CA 4BQQA 4BXUA 1YFHA 2P81A 5GTHC 1SFOJ 2RDPA 3GZ5A 5EG0A 3HSFA 1ZG1A 1LFPA 3FKIJ 4A0ZA 5E3NA 2LYCA 4HPQA 1H89C 1ON2A 1IV8A 1E3OC 1NHAA 4YIFA 1ZH5A 4IHYA 1UB9A 1QNTA 2I5UA 4CUGA 3SJMA 2CW0F 1HOMA 1D1AA 4D7NA 2Z2SB 2E60A 3HSRA 2M4GA 4EJUA 3KEYA 2A61A 4A5NA 3S93A 3RQ4A 3I4NJ 2OCEA 1XB4A 3I9V2 5B1BH 5LEJA 1JE8A 5K5RA 3K4NA 1U5TB 4II3A 1TL8A 3REOA 3TW6A 1VNDA 5FLXK 1ZRDA 4DZPA 4U0YA 1TLHB 1QU3A 2XHKA 4EM1A 3OS0A 1ODDA 4LB5A 3ZQQA 3V8LA 4BU2A 4XICA 2OZ6A 2V9PA 3F3XA 4U87A 1GHCA 4NHJA 2ZO4A 4FTHA 1WH5A 1P4XA 2VBYA 3GZ6A 2VPLA 1KONA 1RR8C 3D5SC 3TO6A 3LQQA 3ZP5A 2YSRA 4IQJA 4RB0A 3S32A 4FCYA 2K85A 1S3JA 2MH9A 1STZA 4UB8C 1HKTA 1WKMA 4M3FA 2GM4A 3TEDA 4EGYA 2EFOA 4FX4A 2HYFA 4OIPF 2HDCA 4DBRA 1IUFA 2FA5A 2KISA 1Z21A 1X3ZB 3GTQJ 2F4IA 2BE5F 1ERDA 3AFHA 2R0QC 2DYRH 5J3LA 1UELB 2JVHA 3V8KA 3R60A 2VI6A 3MVPA 1UHMA 4ABZA 2W57A 4F3QA 1SVLA 3LSMA 4MTDA 3RYRA 4MO7A 2KIUA 3GW2A 3WE3A 1DDNA 4XK4A 1BC8C 2WAFA 1SD6A 3H9QA 1BW5A 3K4JA 1OCRH 4G8XA 4U88A 4KDPA 1DPRA 3E5XA 3VYRB 4K2EA 2A68F 2XC7A 3PQKA 3J7AO 2OZUA 4HNVA 1F9NA 3OYEA 4FX0A 5ICGA 3K10A 2K5CA 4X1EA 3S16J 1SANA 4PJLA 2PN6A 1GT0C 4BE1A 2ZJ2A 1OR7C 5M5YJ 1VTNC 2NS7A 2CMPA 3W2VA 4BXFA 4A3BJ 1JXSA 2FQ4A 1R58A 2XF5A 3QYFA 3LWFA 5JHUA 4M3EA 3CCRI 1K6OA 1BBYA 4HF0A 3DPLC 5IP9J 5HOOA 1K4SA 2HTSA 3ABMH 2LH9A 3HOUJ 3CC2I 5HLGA 4IHVA 1Z6TA 3GUDA 3PO3J 3WU1B 5K5QA 2XGXA 3E6CC 1WJCA 2MW8A 3WGHA 3MN2A 1WJFA 3BOQA 2M2EA 1BI3A 1JGGA 4RAGA 2NXNB 2GXBA 2F5EA 1PUEE 2XAQA 2BV6A 2JZYA 2K3FA 1IO2A 3B6CA 2DI3A 3PL8A 1XSXA 1NG7A 1PYVA 3QPTA 3RKYA 4IRIA 3FXQA 3FXKA 1XGMA 5E8IA 5BS6A 4A3GJ 1X4PA 2LK2A 3CCLI 5CLSA 3LSHA 1XMAA 3EUKL 1YW9A 4BJ5C 3ML6A 2R92J 3ZMVA 2R7SA 2GAUA 2P8TA 2K9QA 4B3AA 3DLLF 5F27A 2DA1A 3P9KA 4XSXF 2ZFUA 3QU3A 3RKWA 4AWXB 3QAHA 2AO9A 3DKXA 3E6DA 1D8KA 2ISYA 1Z6RA 3A4CA 1SFXA 2R4GA 3HRMA 5IP6A 2A69F 5DUIA 2M45A 2R7UA 1V54H 2CUFA 2LY9A 1IXRC 1QVTA 1NG6A 5D5XB 5DCFA 2OCCH 4RGSA 4DOZA 1ZELA 3HUGA 2JRMA 2VN2A 2FBKA 2K27A 3DBRB 4JQFA 4A3JJ 1WI9A 1FPQA 2YU3A 3ISPA 3HOWJ 2RREA 3VYSB 3NWSA 4ESJA 1D3YA 2L9RA 1MKMA 3AG2H 2HI3A 1HSTA 1QO0D 1U8RA 1OCOH 3I4PA 1Z05A 3OV8A 2CH0A 5IOYA 1MDMA 3LAPA 2DT7B 1FEXA 4I0BA 5KAFC 3GTMJ 4BY1J 1WPKA 4Y33A 5ILUA 3ROUA 3GO5A 3LMMA 1VQMI 1MJBA 2LFBA 4NC6A 4XL9A 3KZYA 3L09A 4C3HJ 1IAWA 2KFDA 2F48A 2EIMH 2ZXJA 4UHTA 4D9JA 3JRFA 1EH7A 3ERMA 3TP3A 3WU0A 3MMYB 1GV2A 5D6FA 1W5TA 5JVGF 3LQRA 3ZN0A 1Y0NA 2L5QA 3BZCA 1KU9A 1SFKA 2FMLA 2H1LA 4HV6A 4ZTFA 2JA5J 4HX7A 5J1UA 2MYSA 4HSRA 5EF6A 2VLAA 2IGKA 4XRMA 5E3MA 1FNNA 4IKFA 4CYCB 3IAM2 4PSWA 5DDGA 5ERIA 2VE9A 4DW6A 1S6LA 1PP7U 4A0XA 4D0PA 5B3SH 2XRNA 4I6ZA 3IH3A 1QQIA 2LVSA 2XAHA 2B0LA 2KZVA 2R7XA 1L0OC 4ENMA 1XGOA 1RUOA 3H35A 4OIRF 3FBIB 4PUSA 3R0JA 1CGPA 2E2JJ 1LE8A 3X2QH 4EQQA 2WTEA 4LITA 1O4XA 1ORKA 3N97A 1JJ8C 1YX3A 1TWHJ 2DYSH 4LIUA 4W97A 4ESFA 3CJRB 1QZZA 1HKSA 3UNGC 4XRSA 5DS9A 1QHGA 3U1KA 3P5JA 3CCEI 2QQBA 5DD8A 2E1CA 5C4JJ 2VT2A 5FLVA 2LBFA 2ZMEB 3CUQB 5C4XJ 4ZYDA 3CC4I 3EUAA 4CDGA 3J81K 2ME0A 4I09A 4UVAA 5KHDA 4ZZDA 2R5YB 3HKZN 5DM6F 3HBLA 1NTCA 1BJZA 2Q2EB 2KLOA 1BM9A 4XOPA 3H0GJ 1X3WB 4E7HA 5EGOB 4RM2A 1T33A 4EATA 4MQ9F 2KRHA 1X3UA 4LIVA 3GMEA 4XMYA 4ZYAA 1SAXA 3PSFA 1XD7A 1CF7A 3H3UA 2OTJI 2HXOA 2BW3A 2CSOA 1XS9A 1EJ9A 1FWZA 3C7JA 3IUOA 1Z7UA 4S05A 4ZC3A 3BDDA 4L5JA 1VQ9I 4ON0A 3C2GA 4KITB 5M3MJ 4E7LA 3K2AA 2R7OA 4PJ0C 4F91B 2XIGA 1HF0A 2BY0A 4X6AJ 1PP8F 3AG4H 1F43A 3H1CA 3H5AA 2V26A 2VXZA 1D0YA 4E7IA 1Y6IA 4DZJA 3ZQFA 3ZQLA 1I50J 3BC8A 5BPIA 2L54A 4B43A 2ACJA 2P7CB 4Q48A 4BAYA 3F8CA 3BZ6A 3HHHA 1O3TA 2RC4A 1BR1A 1MH4A 4I7HA 5IT3A 1I3QJ 4MGRA 1YQAA 2D45A 3QOPA 3DKWA 4IVNA 3EYYA 1S72I 2ZNYA 4CA0A 3C3WA 1A31A 1IRXA 3ASNH 1ZGWA 1S7EA 3UKGA 1KU7A 3Q0VA 2BVMA 1XDUA 3N05A 2M87A 3K6GA 2XSJC 3QOEA 4QSHA 4ZTJA 2ZBKA 3AL0B 3K7AJ 1IDYA 1OISA 1R1UA 3CF2A 2E36A 3B02A 4GRIA 3TW7A 2FBHA 1J59A 3NARA 3Q5FA 1AHDP 1FTZA 1TWFJ 2UXXA 1IF1A 1MZBA 1Y56A 2LREA 2HYJA 2L02A 3HSEA 4GYGA 1OKRA 2EK5A 3R6SA 1LFUP 4KNYA 3WTWC 3WGGA 2LKPA 5E1XA 4M9SA 2RNGA 4G12A 1TBXA 2E5NA 4DYRA 2CQXA 5L3FA 1HW5A 3A02A 2PMZA 3GFLA 3K4LA 2J5PA 3LA2A 1JTXA 2HDWA 5ICEA 5KNLA 3BZKA 3GWZA 3T5XA 2ME6A 2GZWA 5FFXA 1G3TA 4XRSG 2XVCA 3L9FA 1U2WA 2VQLA 1VQPI 3G3ZA 2G7HA 1Z3YA 3KP3A 4XKVA 4BY7J 1LJ9A 2ZXIA 3T8RA 4RB1A 3S8PA 3W6VA 5D5UB 2O7OA 1O57A 3FXOA 3M7GA 2CRGA 4S04A 2LDUA 1UCRA 3ZN1A 3J80K 1FSHA 3K70D 2XAJA 2VOPA 1JUMA 2A6TA 2GLOA 2L4AA 2V1NA 2QQ9A 4XR6A 4XONA 1J75A 1RKWA 3VYTB 2R5ZA 1B8IB 3VEPA 4EJWA 2ISZA 2L01A 2IBDA 1HSJA 2BGCA 3OOPA 3FXLA 2M1BA 2OBPA 4D5FA 2Y75A 4MIMA 4RGRA 5HS8A 2QKLB 3HOTA 1EV7A 3H3ZA 4N4OB 2YUSA 4DYQA 1YITI 3NWTA 1JKOC 2ADUA 1ETYA 5J6XA 1H9TA 3I0TA 1Z77A 4ETSA 1W5CC 1UJ8A 1ZQ3P 2PBIA 2LNBA 5LFAA 1FOYA 2DA6A 4LOCA 3ZRGA 2A6HF 1D1BA 2V9VA 2M0MA 5FLXZ 1HW2A 1MMSA 1LUJB 2HQRA 3E1SA 2CQNA 3V4GA 3KP4A 1TQIA 4A0YA 2WC2A 1QRYA 1DPUA 2EQRA 2CV2A 2F4MB 1K4TA 2DMPA 5BMZA 1T08B 2DMUA 3GLXA 2X85A 4MTEA 4JOMA 2QUFA 3F8BA 3RPUA 5CPRB 2E2HJ 1IN8A 1P92A 1ZN2A 2ESHA 1KU3A 5D5VB 2PG4A 3DQVC 4I98B 1JT0A 2H94A 1WZ2A 1IN6A 3OSFA 4HV5A 4NNJA 4WF2A 5E3LA 4F93B 1J2XA 3HGGA 2PQ8A 3BTLA 3IKTA 1G2HA 3ZQIA 3ZQ7A 3CD6I 4WWCA 2L0KA 3A0HC 4KT5C 4M6XA 4CGZA 5LGUA 3BY6A 2F5DA 3MAJA 3CESA 1W36C 5FD5A 1G6NA 4HNTA 2EINH 4WX9A 1HQCA 4BYYA 1MNEA 2KP6A 3W2WA 3COAC 4F7ZA 1LDKB 1ZHFA 2EZHA 1YX5A 5HNFA 3S1QJ 1FMVA 3MKWB 2GOMA 1G8XA 4HX4A 1TT0A 1V4RA 1Y39A 3VSKA 2STWA 1FLIA 4V19K 2DN0A 2DO7A 3E0JB 2F5CA 4DJAA 2LKXA 1BR2A 3RCOA 4XN3A 3KYLA 1IRFA 4IHXA 4CICA 4ASNA 4A3DJ 1D1CA 2ZXWH 2KJCA 2QF7A 5JFRA 5LD2C 1BI1A 2X1EA 2ECCA 5IT9K 3CQZJ 2PI0A 2DA7A 5GP9A 3ECOA 2EIKH 2AS5F 3LSKA 2HWVA 1K78B 2TDXA 3ZQGA 3ZQHA 2KMUA 2NS0A 2WAQA 3SHFA 1AA7A 2Z33A 2Z3YA 4WK8F 2TRTA 3WHCA 4AU7A 2XF7A 3KLNA 4B09A 3CMEI 3ABLH 2DXIA 1D0XA 1JUSA 1JKQC 1MJ9A 2L4MA 5K7ZA 1P7IA 2ESNA 2EJRA 5IYBJ 2HZTA 2V4JC 1UZCA 4KFCA 4LB6B 2ZSIB 4GDFA 5HDNA 4U7BA 3S1MJ 4M73A 3C18A 2HFHA 2O6GE 4PJMA 3RYPA 2BY1A 3DU5A 1HA8A 9ANTA 4D5CA 2HOTA 4IXAA 1KQ9A 1XSDA 2IGNA 2FE3A 1YG2A 5E18F 1PJRA 2KIMA 3BWGA 1ETWA 4AYBA 3GLLA 2D1HA 5AIPA 3JRIA 4BE2A 2K7LA 1Z1DA 1X2MA 1FMWA 1EA3A 3E97A 1YIOA 5HLHA 1ZRCA 3MKLA 1R9TJ 1X19A 1FP1D 3BLYA 5FD6A 2Y0SN 4BEHB 1U5TC 5B1AH 2M4KA 4BXXJ 1TWCJ 2R7FA 5HVQC 3T1BA 1TT5B 1XPXA 4FETA 3GX4X 1ZG5A 4ZZLA 1BC7C 2DMQA 5AONA 1RRJA 3W2AA 3E6BA 4PJJA 1IXSB 1AOYA 3OIPA 1I39A 2E7WA 3VODA 4ENNA 1BA5A 2O3FA 3EPZA 2JUCA 2Y30A 1QBJA 1SC7A 4CCJA 5L3CA 3W3CA 2H27A 4XM3A 3F0CA 1SAUA 2FSWA 2EH3A 3D0SA 1VQLI 2AQFA 2LY1A 3BR6A 2L2OA 2EIJH 2VC1A 3OYKA 5F64A 2ZNZA 2M8GX 1FJLA 4YIRX 2IGMA 1I6HJ 3SQNA 5LGNA 3IWFA 2W84A 3S15J 2VIXA 3FXRA 2K9MA 3E5QA 3HOSA 2JA2A 4L9NA 2QVOA 3RKQA 1Z3XA 5FFZA 2WB1N 3HIFA 3RZOJ 4C30A 1TNTA 1YS7A 2F4OB 4XSZF 1OYYA 2IT0A 2Q0OA 3RTRA 1RETA 3RDIA 3BQZA 3GVAA 4LK0F 1J5YA 2FF4A 2CGPA 2ZJRF 4HDVA 3TL4X 5B66C 2C6YA 4AD9A 4BDZA 2ZC2A 1PVEA 2PMUA 4XLPF 5JI6A 1S8NA 3BR0A 4BH9A 1IDZA 2YPRA 4EJVA 1IV6A 2ELHA 3OYGA 1IW7F 1IRGA 3KIOA 2MA3A 2AXTC 1MMGA 1E2XA 1K7AA 1WQ2A 1IN4A 4HA8A 2N8GA 1FYMA 2GXGA 2JA6J 1X1CA 1KQ0A 4I76A 4BL0B 4YIIA 3JTGA 2Y9ZA 1E3PA 4CYCA 3I5UA 2F5FA 2STTA 1VQ5I 2VONA 4A3MJ 1MSEC 4BQAA 3FZVA 1R7JA 1M1EB 2XPWA 4E4HA 1V5FA 4Z2YA 5AIQA 2X48A 4OIOF 3DU6A 3OY9A 1TWGJ 3QYEA 1WHUA 2MSYA 4XKCA 2E1NA 2K9SA 2V9KA 1DUXC 3J81Z 4NQWB 4CCOA 1OCZH 2O8XA 1BW6A 2CQKA 3DKYA 3ELKA 2EFWA 1AWCA 3KYDB 2QLZA 3HL2A 4JBAA 3G4SI 3SDBA 1R6RA 3F21A 5K7FA 2TCTA 1YJWI 4IL6C 3PFYA 3OYHA 4DQ2A 3M8JA 2JK3A 2ZMEA 3CUQA 1JGSA 1H0MA 1FZPB 1XG1A 2Q8KA 2ZJPF 2NVQJ 1OPCA 3I56I 4LG0B 3FF5A 1IRZA 2VE8A 1R1TA 3HEFA 1YTYA 2R7ZJ 2HVRA 3K1PA 1ZK8A 4M74A 1FBSA 2O61A 3TDUC 3ZQCA 3OOUA 5EGOA 2X6OA 2LMDA 4C2TA 3H3VK 5H2FC 4PFOA 3BR2A 1RNLA 1X1AA 3C2BA 4P96A 2NOJB 1G4DA 5B5EC 2P6TA 4MLOA 4CZCA 3CDHA 4HX8A 3H0DA 5ILSA 2R7DA 3CCJI 1U9NA 1PUFA 4HQEA 2W48A 5CKTA 5CYVA 3GTPJ 1QPIA 2K86A 3PQJA 4L0YB 2HGCA 2X1CA 2LD5A 5M5WJ 3KZZA 3PFIA 3M4OJ 1R4NB 2Y9YA 4BQNA 5H20A 4KYWA 1SVMA 4LFUA 1ZLJA 3H5NA 5CQGA 3M8FA 3DPUA 1OCTC 1DU6A 3K1MA 3I4MJ 3ZMSA 2OUMA 1QVUA 2LF8A 2YX7A 4IQ4A 4AM3A 4M6VA 1HDDC 3OIOA 3A01B 2CFOA 3RZDJ 2Z5UA 4M9ZA 1KYZA 1O3QA 2XF6A 4HF2A 3GZNB 4YG2F 4A69C 1LVAA 4NUBA 3JR9A 3TOBA 1H88C 4KJZA 3OYFA 4HZFA 4XOTA 3LAJA 2AHQA 3HRSA 1YE9A 1LPQA 5CQEA 1U0JA 2VPRA 4YFNF 3OYMA 1W4MA 2KIFA 1K79A 2QBYB 2CQ7A 2HZDA 1I1SA 4PCQA 1P9QC 4GXOA 4A3EJ 5JLXA 1LVKA 2JPBA 5E1ZB 4XQFA 2AXLA 4U0VA 2Z9OA 5BNGA 4JP0A 5JR3A 3QYBA 1LNWA 2CUEA 5LBQA 3BG9A 4B44A 1MNDA 1MH3A 2PFBA 2QM3A 3OMYA 2LR8A 5D6EA 1FC3A 4G6TB 2UUZA 2H1KA 1XC5A 4C3IJ 1QPMA 1FY7A 3WG9A 4ZYEA 4GGGA 1OFCX 2M5WA 1NK3P 1W7PA 4UV9A 5LHHA 3K4KA 1HDPA 2IAIA 3F72A 2YS9A 1TZLA 4MFEA 3T8TA 1D0ZA 4B47A 4MFDA 4OWRB 2XSDC 4Y13A 2H8RA 2UXNA 1WI3A 4KA4A 2Q1ZB 2DQRA 2DK5A 3FXJA 3FBNB 4BHBA 3J80Z 2DPDA 2VKVA 4ZDPA 4A12A 2JA7J 3R4KA 2H09A 3ABTA 3DTIA 4Q5SF 1XTAA 1R36A 2MGQA 1N78A 5BQTA 2LKSA 1P7JA 2F2EA 5IOZA 2GA1A 3EDPA 5ED4A 3JRGA 1VQ4I 1VQNI 3O8HA 2ZMEC 3CUQC 4O3MA 3BPXA 4OOIA 2VJ4A 1UAAA 1V3FA 2HKXA 1YRNB 1Y1VJ 2XAGA 4TV7A 1B8IA 1R00A 4YRVA 2CS3A 2BVLA 2QEXI 1T8IA 4IX7A 2PJPA 4RAZA 3PM1A 2HEOA 5EYRA 4C2MJ 2KIQA 3PUBA 1EH8A 4OMZA 4NC7A 2VBWA 1F36A 4QPQA 1MBKA 5KCMA 2OAZA 1HKQA 2IW5A 4A6DA 1ETKA 1ACIA 1U9OA 2X0LA 3G73A 4AIHA 3I53A 3JRAA 4HF1A 4OIQF 1GVDA 3HRUA 1TQPA 2EA2A 3CMMA 2IA0A 3OS1A 3KP7A 5E17F 1UFMA 1FBQA 3GBGA 3F9KA 3L1PA 1KQ8A 3OS2A 3O6BB 4G94A 4ZH4F 3HHGA 3OR2C 3DLAA 4ZDOA 1XCBA 1Y8QB 4G7ZF 4A3IJ 1T56A 2EB7A 3V7SA 4ZJZA 4JK1X 3AG1H 3SYTA 2IXSA 2WV1A 3DFGA 4LG3A 4MEXF 3L7WA 1ZYRF 4KIBA 3BR1A 2K9NA 2QSFX 3EETA 1U8BA 4IEJA 3H36A 4IHTA 5FROA 5D5WB 3RI4A 2F6CA 2JPCA 2X6YA 2HKOA 3GFIA 2DODA 4Y4RA 3WTSC 2DLLA 1Z9CA 2O03A 1SD5A 5LHGA 2V79A 1SFEA 3R0AA 4N9HA 2BBYA 4AVZA 1I6XA 4CO8A 4BNCA 2JSPA 5FRNA 4BE0A 1MBEA 1ZRFA 5L3GA 1O3RA 3TOAA 4I0AA 3FISA 1ZG3A 4L9JA 2A5WA 3GTOJ 2IA2A 2DDAA 1I1GA 1MBHA 2O0YA 4MHGA 4FASD 2QSGX 3NRVA 2RGVA 2XRLA 3E5UA 4DIQA 1FP2A 3MKZA 3I59B 1RUNA 3KP5A 4NBQA 3F6VA 1W0TA 3QWLA 1OYWA 3D5RC 5HDGA 1R1VA 1UG2A 3HTSB 1LDJA 1XMXA 5GAGJ 3IHUA 1MNMC 1YO5C 5IT9Z 2W7NA 1KZHA 4OAZA 2HR3A 2HPMA 1WJEA 3G1OA 3U21A 1J0RA 1QHHD 2K4BA 3BCAA 4JYKA 4E7JA 2V6CA 2IA1A 4ANJA 2CFXA 4Q4ZF 2EPFA 3ASOH 4HRIA 1WVRA 1XGNA 1E3HA 3TKYA 2HPIA 3DBLB 5J4VA 2K40A 1B9MA 3G71I 2CJJA 4PSXA 4D7MA 3K4BA 5M5XJ 2FU4A 2GBYA 4RAFA 3OR1C 1ETQA 3H9GA 1K78A 2IVMA 3JRBA 1MMDA 2DMNA 1LDDA 2G7UA 3ECHA 4CHUA 2CO5A 2X1DA 2Y2ZA 1XSVA 3PNTA 3CF5F 2CQQA 1IG7A 2KDOA 1N77A 1ETXA 2XAUA 1T95A 1V5GA 3PUFA 4BQOA 1VQOI 2W00A 5TGTA 2MLGA 1SMTA 4Y3OA 3KX2A 2HVQA 3I55I 5F08A 5E1WA 2IS6A 2VQHA 3OYIA 2JSCA 4QPOA 5IYDJ 2H8WA 1Q1VA 1YOVB 4L0ZB 3TBIA 3RJPA 4EEFG 4OU0A 3J7YJ
chains in the Genus database with same CATH topology
2K02A 2DBBA 5DYMA 1GXPA 2KRFA 3KP6A 3K2ZA 3EQLF 3KEQA 4PZJA 2VT3A 4N0BA 2IRFG 1S7AA 1FYKA 5EEGA 1Q1HA 2W24A 2V1DA 5CVRA 1P4WA 1U78A 5BPDA 3WTVC 5K1YA 3MEXA 1MD0A 5KVRA 4LD5A 1T2KA 3QRFF 1LEBA 2RN7A 1U5TA 4UXNA 1ZARA 2COMA 4EVIA 1YS6A 3DEUA 2W85A 3LA3A 3CJNA 1SD7A 2P4WA 1T0FA 5E8GA 2DK8A 4IRHA 4H0EA 1SMYF 3BJOA 5LEKA 4YFKF 4Y17A 3SXYA 3I58A 2D1VA 1F1ZA 3FXUA 1W7PD 2NAZA 2UZKA 2M8EA 3ULQB 3WE2A 4G6QA 3DP7A 1FX7A 4HYEA 5DUKA 3AAFA 4P5OA 2DAOA 4RGUA 5ICFA 3E3VA 1FT9A 2ETHA 3KLOA 1ZGJA 1FBUA 2MLKA 5KK1A 4O6JA 3GEZA 4LLLA 1W5SA 1OYIA 5CVVA 1RI7A 4I2OA 2MH2A 2QQAA 2EV6A 3JAMK 1J7KA 1LB2A 4BHCA 1JHFA 1REPC 2A5YB 2RV8A 2XKPA 4P9UA 4CXFA 1BIAA 1I5ZA 3BJAA 3RKXA 4LG0A 2E7XA 3QU6A 4HW0A 3JW4A 3EUHA 2FMYA 4UVCA 4MEYF 1S7OA 2LF7A 5DV5A 1HW1A 5D4RA 1U6GA 1BN5A 4R79A 4EM2A 1EH6A 1B1BA 2MC3A 1MJAA 4L5IA 2J5OA 1XN7A 5LRRA 5BOXA 2A3SA 1IUYA 3IRQA 2UWMA 5LGTA 2NNNA 4AIJA 5HDKA 3B73A 4M72A 1P6RA 3D5LA 1O7LA 2KKOA 4WXHA 3FWEA 3MWMA 5D8LB 4BHPA 3IWZA 4HQMA 4LLGF 4A5MA 3L2CA 4L9VA 2EFPA 2KJBA 2QYOA 4MQVA 4WCGA 4HLYA 5DEQA 3LA7A 1D8JA 2QBYA 2HQNA 5CVIA 5LHIA 1BI0A 2DPUA 3T0YA 3NQOA 1D5VA 3BP8A 2OQRA 4I01A 2A07F 5FGMA 5EEHA 3V7CA 1YW8A 4EV0A 5D4SA 2FEZA 1R22A 3VOEA 4G7OF 3WODF 1XMKA 3IKVA 1ZREA 5JVTA 2EA4A 3RPQA 4CZZA 2XAFA 2EV5A 3DPTA 2YX4A 1USSA 4P55A 2H6CA 3KFWX 3CUOA 1BOAA 1ZLKA 2GWRA 2WV0A 1KYWA 5LRSA 2G9WA 2GIVA 2WWYA 2OU2A 3KCCA 5CJ9A 2EFQA 1LQ1A 2ZFWA 4ESBA 4UNOA 1GVJA 6PAXA 3GYHX 4XLNF 3WTXC 3M1EA 3CO7C 2W25A 1KU2A 2ZCWA 4M71A 1J9IA 2Y0MA 3K9TA 4RGXA 2HYGD 3SZTA 4A2UA 4OINF 3K69A 1H9GA 3GFMA 1B4AA 2Q2EA 3WTZA 2PEXA 1DP7P 1R5GA 2JTVA 3BROA 2R3SA 3MCZA 1T98A 5DCMB 3MZYA 2BEOA 3F23A 4PGHA 3M9AA 4XBFA 1TW2A 1SD4A 2P5VA 4L9TA 4R1HA 4KUMA 2QZ8A 5ICCA 2ZKZA 1O7FA 3ABUA 3WTTC 2V1XA 4WXCA 2EWNA 4G9YA 4L18B 3P9CA 1KGSA 1R23A 3SFZA 4EGZA 2NYXA 4DNCA 1MGTA 3F8NA 4KN7X 3I59A 4ENJA 4Y15A 3SZPA 2K4JA 5CVJA 4HLXA 3E6MA 2P6SA 3GXOA 1USTA 3FM5A 3WTUC 4EMSA 3MFKA 3FHZA 3I64A 3H92A 1XGSA 2P5KA 4LMYA 2D2WA 5FB2A 3O3KA 3S2WA 4YFXF 1T6SA 4KMUX 1I27A 1O3SA 5LLQA 4R8HA 3CO6C 5CVUA 1IN5A 1QZYA 3CLOA 3KETA 1E17A 1XDSA 1G3YA 2CWEA 1RIOH 4GCVA 2L3DA 1YLFA 4ENKA 1B9NA 4FHTA 4IJAA 2RVCA 2EV0A 4P9FA 1GXQA 4B8XA 3M8EA 3MZHA 4N9IA 5HLIA 2VODA 3R61A 3TQNA 2DU9A 1ZGAA 5L3BA 4RB2C 1F4KA 1XCVA 5L3EA 1BJAA 4GYIA 3U2RA 1C0WA 3N4MA 1YW7A 2H6BA 3ZMDA 4HOBA 1U3EM 2HS5A 4LK1F 2FQ3A 2OA4A 3P9IA 4I02A 5E20A 1B59A 4A6EA 3FMRA 4KN4X 4GO1A 5F1RA 4U7DA 2NRAC 3DV8A 3FMSA 1TQMA 3W6KB 2XASA 3MQ0A 3WTYC 3HTUA 2IP2A 3KP2A 3Q9SA 2V1UA 1HBXG 3L00A 1S29A 2RKHA 1QGPA 3FX3A 4RB3C 2FOKA 2VBXA 4XRFA 3BPVA 3HYIA 5DD4A 3ZPLA 1L3LA 4EJOA 3VB2A 2LSOA 2VBZA 3TO7A 2MBFA 1ONVA 1BI2A 3I71A 4M9XA 2FNPA 3KE2A 3NEUA 5H6RA 4M6YA 1KA8A 1IN7A 2QENA 4CYDA 4OMYA 3FM3A 1YYVA 2FRHA 3F6OA 4HAMA 4LGWA 4IF4A 5A2QZ 1MDMB 3JAMZ 2P7VB 3O2PE 1OMIA 3KEOA 2FNAA 2MD5A 5K5OA 1F5TA 4WXDA 3I54A 4MNUA 5L3DA 1TNSA 5FO5A 3ERED 2Y48A 5TJJA 1W7PB 2JRTA 2YR2A 3LFKA 1FSEA 1G3WA 2OQGA 3JSOA 3W6JB 1TTYA 3TGNA 1TW3A 3U1DA 2PLYA 4QLCU 1JHHA 2PMHA 4IRGA 4EJTA 4G6DA 2P5LC 3P7NA 3TDZC 3K0LA 1G3SA 1PDNC 5D8KB 5H6QA 5J8CA 3GF2A 2CG4A 5HS9A 2DFIA 1ULYA 1WRJA 3DF8A 3FMQA 4NB5A 2XROA 3BJ6A 1WWXA 3GFJA 2GQQA 4KIFA 3K1NA 4LLNA 4UV8A 3QP5A 4Q47A 3V8JA 2HTJA 4KMFA 4PDKA 4AVPA 3U9GA 1Z91A 3WGIA 1BIBA 2DT5A 1CF7B 4O5VA 1WSUA 4AIKA 4KICA 3VFZA 2NNYA 4E70A 1FYLA 4HDUA 1HXDA 3JTHA 2CYYA 2Z99A 1SFUA 1Y0UA 2FXAA 2RQPA 1R5HA 1FOKA 4G7HF 5J8FA 4ZYGA 2XUBA 3F22A 1LEAA 5ILVA 1ZAOA 4RAYA 2BYVE 4KIGA 2DW4A 3QPHA 3ZMZA 3JSPA 1ON1A 4ZYHA 2QWWA 1RZ4A 3F8FA 4UUVA 2XKOA 2GA2A 4IPAA 3CTAA 3IL2A 3HRTA 5TRDA 2IPQX 2RNJA 2X4HA 2FBIA 1A04A 1T38A 2HOEA 2VOOA 1B6AA 5A2QK 4NQWA 4UVBA 4HBLA 3C1DA 3EYIA 3TO9A 2DTRA 2IJLA 5F6FA 4PGGA 2DQLA 3RIRA 2M30A 1IXCA 4U0WA 4LJZF 3DXJF 2A6EF 5HS7A 4FT8A 3F8MA 3QP6A 1T39A 2VC0A 2XV4S 4RS8A 2EFNA 1P2FA 3IRRA 5DCMA 1IZ1A 1UHWA 3LSTA 1OR7A 2OD5A 1P4AA 4EM0B 3ZMTA 3ZMUA 4IHSA 3Q9VA 4QWQA 3V7RA 3IC7A 2JT1A 1YFHA 4BXUA 2RDPA 3GZ5A 3HSFA 1ZG1A 4A0ZA 1ON2A 1NHAA 4YIFA 1ZH5A 1UB9A 1QNTA 2CW0F 3HSRA 4EJUA 2A61A 4A5NA 1XB4A 5LEJA 1JE8A 5K5RA 1U5TB 3REOA 5FLXK 1ZRDA 4U0YA 1TLHB 2XHKA 4EM1A 4LB5A 1ODDA 3V8LA 2OZ6A 3F3XA 1GHCA 4NHJA 2ZO4A 1P4XA 2VBYA 3GZ6A 3TO6A 3LQQA 3ZP5A 2YSRA 1HKTA 4RB0A 2MH9A 1S3JA 1STZA 1WKMA 4EGYA 2EFOA 4FX4A 2HYFA 4OIPF 2HDCA 2FA5A 2BE5F 3V8KA 3R60A 1UHMA 2W57A 4MTDA 3RYRA 2KIUA 3GW2A 3WE3A 1DDNA 1BC8C 1SD6A 4G8XA 4U88A 4KDPA 1DPRA 3E5XA 4K2EA 2A68F 3PQKA 3J7AO 2OZUA 1F9NA 4FX0A 5ICGA 2PN6A 2ZJ2A 1VTNC 1JXSA 1R58A 3LWFA 5JHUA 1K6OA 1BBYA 4HF0A 3DPLC 5HOOA 2HTSA 5HLGA 1Z6TA 3GUDA 3WU1B 5K5QA 2XGXA 3E6CC 3WGHA 3BOQA 1BI3A 2GXBA 2F5EA 1PUEE 2XAQA 2BV6A 2JZYA 2DI3A 1XSXA 3QPTA 3RKYA 4IRIA 3FXQA 1XGMA 5E8IA 5BS6A 5CLSA 1XMAA 1YW9A 3ML6A 3ZMVA 2GAUA 2P8TA 3P9KA 4XSXF 3QU3A 3RKWA 4AWXB 3QAHA 3E6DA 1D8KA 2ISYA 1Z6RA 1SFXA 3HRMA 5DUIA 2A69F 2M45A 1IXRC 5D5XB 5DCFA 4RGSA 3HUGA 2VN2A 2FBKA 2K27A 4JQFA 1WI9A 1FPQA 2YU3A 3ISPA 4ESJA 1D3YA 1MKMA 1HSTA 1QO0D 1U8RA 3I4PA 1Z05A 3OV8A 1MDMA 3LAPA 4I0BA 5ILUA 3ROUA 3GO5A 1MJBA 3KZYA 3L09A 1IAWA 2ZXJA 4UHTA 1EH7A 3WU0A 5D6FA 1W5TA 3LQRA 3ZN0A 1KU9A 2FMLA 4HV6A 4HX7A 1FNNA 2VE9A 5DDGA 5ERIA 1S6LA 1PP7U 4A0XA 4D0PA 2XRNA 1QQIA 2XAHA 2B0LA 1L0OC 4ENMA 1XGOA 1RUOA 4OIRF 3R0JA 1CGPA 4EQQA 2WTEA 3N97A 4ESFA 1QZZA 1HKSA 2QQBA 5DD8A 2E1CA 2VT2A 2ZMEB 3CUQB 4ZYDA 4CDGA 3J81K 4I09A 4UVAA 4ZZDA 1BM9A 4MQ9F 1X3UA 1SAXA 1XD7A 1CF7A 3H3UA 2CSOA 1FWZA 3C7JA 1Z7UA 4S05A 3BDDA 4L5JA 4ON0A 2XIGA 1PP8F 2VXZA 5BPIA 2L54A 2ACJA 2P7CB 4Q48A 4BAYA 3F8CA 3BZ6A 3HHHA 1O3TA 2RC4A 4I7HA 5IT3A 4MGRA 1YQAA 2D45A 3QOPA 3DKWA 4IVNA 3EYYA 2ZNYA 3C3WA 1KU7A 1XDUA 2M87A 2ZBKA 1R1UA 3B02A 1J59A 2FBHA 3Q5FA 2UXXA 1IF1A 1MZBA 2L02A 3HSEA 4GYGA 1OKRA 2EK5A 3R6SA 4KNYA 3WTWC 3WGGA 2LKPA 5E1XA 4M9SA 1TBXA 5L3FA 1HW5A 3GFLA 2J5PA 3LA2A 5ICEA 3GWZA 3T5XA 2GZWA 5FFXA 1G3TA 2XVCA 3L9FA 1U2WA 3G3ZA 2G7HA 3KP3A 1LJ9A 3T8RA 4RB1A 5D5UB 1O57A 3M7GA 4S04A 2LDUA 1UCRA 3ZN1A 3J80K 1FSHA 2XAJA 2VOPA 2L4AA 2QQ9A 1J75A 3VEPA 4EJWA 2ISZA 2L01A 1HSJA 2BGCA 3OOPA 2M1BA 2OBPA 2Y75A 4RGRA 5HS8A 3HOTA 1EV7A 3H3ZA 2ADUA 5J6XA 1H9TA 3I0TA 4ETSA 2PBIA 2LNBA 2A6HF 2V9VA 5FLXZ 1HW2A 2HQRA 3V4GA 3KP4A 1TQIA 4A0YA 2WC2A 1DPUA 5BMZA 3GLXA 4MTEA 2QUFA 3F8BA 3RPUA 1IN8A 1P92A 2ESHA 1ZN2A 1KU3A 5D5VB 2PG4A 3DQVC 4I98B 2H94A 1IN6A 4HV5A 4WF2A 1J2XA 2PQ8A 3IKTA 3ZQ7A 4WWCA 4KT5C 4M6XA 4CGZA 5LGUA 3BY6A 2F5DA 3MAJA 5FD5A 1G6NA 4WX9A 1HQCA 4BYYA 3COAC 4F7ZA 1LDKB 1ZHFA 4HX4A 1V4RA 2STWA 1FLIA 2DO7A 2F5CA 1IRFA 4CICA 4ASNA 2KJCA 5JFRA 1BI1A 5IT9K 2PI0A 3ECOA 2AS5F 2HWVA 1K78B 2TDXA 2NS0A 3SHFA 2Z33A 2Z3YA 4WK8F 3KLNA 4B09A 1MJ9A 2L4MA 2ESNA 2EJRA 2HZTA 4KFCA 4LB6B 5HDNA 4U7BA 4M73A 3C18A 2HFHA 2O6GE 3RYPA 4IXAA 1KQ9A 1XSDA 2FE3A 1YG2A 5E18F 2KIMA 3BWGA 2D1HA 5AIPA 2K7LA 1Z1DA 3E97A 1YIOA 5HLHA 1ZRCA 1FP1D 5FD6A 1U5TC 2R7FA 5HVQC 3T1BA 3GX4X 1ZG5A 4ZZLA 1BC7C 5AONA 3E6BA 1IXSB 1AOYA 2E7WA 3VODA 4ENNA 2O3FA 1QBJA 5L3CA 2H27A 2FSWA 3D0SA 2VC1A 5F64A 2ZNZA 3SQNA 5LGNA 3IWFA 2W84A 3FXRA 3E5QA 3HOSA 4L9NA 2QVOA 5FFZA 3HIFA 1TNTA 1YS7A 4XSZF 1OYYA 2IT0A 2Q0OA 3RTRA 3RDIA 3GVAA 4LK0F 1J5YA 2FF4A 2CGPA 4HDVA 2C6YA 4AD9A 2PMUA 4XLPF 5JI6A 1S8NA 4BH9A 2YPRA 4EJVA 2ELHA 1IW7F 1IRGA 2MA3A 1E2XA 1K7AA 1WQ2A 1IN4A 4HA8A 1FYMA 2GXGA 1KQ0A 4YIIA 3JTGA 3I5UA 2F5FA 2STTA 2VONA 4BQAA 3FZVA 1R7JA 4Z2YA 5AIQA 4OIOF 2E1NA 1DUXC 3J81Z 2O8XA 2CQKA 3ELKA 2EFWA 1AWCA 2QLZA 4JBAA 3F21A 4DQ2A 2ZMEA 3CUQA 1JGSA 1H0MA 1FZPB 2Q8KA 1OPCA 4LG0B 3FF5A 2VE8A 1R1TA 1YTYA 3K1PA 4M74A 1FBSA 2O61A 3TDUC 1RNLA 4P96A 1G4DA 2P6TA 3CDHA 4HX8A 5ILSA 2R7DA 4HQEA 5CYVA 2K86A 3PQJA 4L0YB 2HGCA 3KZZA 3PFIA 5H20A 4KYWA 4LFUA 1ZLJA 3M8FA 3K1MA 3ZMSA 2LF8A 2YX7A 2Z5UA 4M9ZA 1KYZA 1O3QA 4HF2A 4YG2F 1LVAA 3TOBA 4HZFA 3LAJA 3HRSA 4YFNF 1W4MA 2KIFA 1K79A 2QBYB 1I1SA 4PCQA 4GXOA 2JPBA 5E1ZB 2AXLA 4U0VA 2Z9OA 5JR3A 1LNWA 5LBQA 2PFBA 2QM3A 5D6EA 1FC3A 1QPMA 1FY7A 3WG9A 4ZYEA 4GGGA 2M5WA 1W7PA 4UV9A 5LHHA 3F72A 3T8TA 4Y13A 2UXNA 4KA4A 2DQRA 2DK5A 3J80Z 4BHBA 2DPDA 4A12A 3R4KA 2H09A 3ABTA 4Q5SF 1R36A 5BQTA 2F2EA 2GA1A 3EDPA 5ED4A 3CUQC 4O3MA 3BPXA 4OOIA 1V3FA 2HKXA 2XAGA 4TV7A 1R00A 2PJPA 4RAZA 2HEOA 1EH8A 4OMZA 2VBWA 2OAZA 1HKQA 2IW5A 4A6DA 2X0LA 3G73A 4HF1A 4AIHA 3I53A 4OIQF 3HRUA 1TQPA 2EA2A 2IA0A 3KP7A 5E17F 1UFMA 1FBQA 1KQ8A 3O6BB 4G94A 4ZH4F 3HHGA 1XCBA 4G7ZF 2EB7A 3V7SA 4JK1X 4MEXF 3DFGA 3L7WA 1ZYRF 4KIBA 3EETA 4IHTA 5D5WB 3RI4A 2JPCA 2HKOA 3GFIA 3WTSC 2DLLA 1Z9CA 2O03A 1SD5A 5LHGA 2V79A 1SFEA 3R0AA 4N9HA 2BBYA 4BNCA 1I6XA 4CO8A 1ZRFA 5L3GA 1O3RA 3TOAA 4I0AA 4L9JA 1ZG3A 2IA2A 1I1GA 2O0YA 4MHGA 3NRVA 2RGVA 3E5UA 1FP2A 3I59B 1RUNA 3KP5A 3F6VA 1OYWA 5HDGA 1R1VA 3HTSB 1LDJA 3IHUA 1YO5C 5IT9Z 2HR3A 1J0RA 2K4BA 2V6CA 2IA1A 2CFXA 4Q4ZF 1XGNA 3TKYA 1B9MA 2FU4A 1K78A 2IVMA 1LDDA 2G7UA 3ECHA 4CHUA 2CO5A 1XSVA 2MLGA 1SMTA 5E1WA 2JSCA 4L0ZB 3RJPA 4OU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K02 A;  2DBB A;  5DYM A;  1GXP A;  2KRF A;  3KP6 A;  3K2Z A;  3EQL F;  3KEQ A;  4PZJ A;  2VT3 A;  4N0B A;  2IRF G;  1S7A A;  1FYK A;  5EEG A;  1Q1H A;  2W24 A;  2V1D A;  5CVR A;  1P4W A;  1U78 A;  5BPD A;  3WTV C;  5K1Y A;  3MEX A;  1MD0 A;  5KVR A;  4LD5 A;  1T2K A;  3QRF F;  1LEB A;  2RN7 A;  1U5T A;  4UXN A;  1ZAR A;  2COM A;  4EVI A;  1YS6 A;  3DEU A;  2W85 A;  3LA3 A;  3CJN A;  1SD7 A;  2P4W A;  1T0F A;  5E8G A;  2DK8 A;  4IRH A;  4H0E A;  1SMY F;  3BJO A;  5LEK A;  4YFK F;  4Y17 A;  3SXY A;  3I58 A;  2D1V A;  1F1Z A;  3FXU A;  1W7P D;  2NAZ A;  2UZK A;  2M8E A;  3ULQ B;  3WE2 A;  4G6Q A;  3DP7 A;  1FX7 A;  4HYE A;  5DUK A;  3AAF A;  4P5O A;  2DAO A;  4RGU A;  5ICF A;  3E3V A;  1FT9 A;  2ETH A;  3KLO A;  1ZGJ A;  1FBU A;  2MLK A;  5KK1 A;  4O6J A;  3GEZ A;  4LLL A;  1W5S A;  1OYI A;  5CVV A;  1RI7 A;  4I2O A;  2MH2 A;  2QQA A;  2EV6 A;  3JAM K;  1J7K A;  1LB2 A;  4BHC A;  1JHF A;  1REP C;  2A5Y B;  2RV8 A;  2XKP A;  4P9U A;  4CXF A;  1BIA A;  1I5Z A;  3BJA A;  3RKX A;  4LG0 A;  2E7X A;  3QU6 A;  4HW0 A;  3JW4 A;  3EUH A;  2FMY A;  4UVC A;  4MEY F;  1S7O A;  2LF7 A;  5DV5 A;  1HW1 A;  5D4R A;  1U6G A;  1BN5 A;  4R79 A;  4EM2 A;  1EH6 A;  1B1B A;  2MC3 A;  1MJA A;  4L5I A;  2J5O A;  1XN7 A;  5LRR A;  5BOX A;  2A3S A;  1IUY A;  3IRQ A;  2UWM A;  5LGT A;  2NNN A;  4AIJ A;  5HDK A;  3B73 A;  4M72 A;  1P6R A;  3D5L A;  1O7L A;  2KKO A;  4WXH A;  3FWE A;  3MWM A;  5D8L B;  4BHP A;  3IWZ A;  4HQM A;  4LLG F;  4A5M A;  3L2C A;  4L9V A;  2EFP A;  2KJB A;  2QYO A;  4MQV A;  4WCG A;  4HLY A;  5DEQ A;  3LA7 A;  1D8J A;  2QBY A;  2HQN A;  5CVI A;  5LHI A;  1BI0 A;  2DPU A;  3T0Y A;  3NQO A;  1D5V A;  3BP8 A;  2OQR A;  4I01 A;  2A07 F;  5FGM A;  5EEH A;  3V7C A;  1YW8 A;  4EV0 A;  5D4S A;  2FEZ A;  1R22 A;  3VOE A;  4G7O F;  3WOD F;  1XMK A;  3IKV A;  1ZRE A;  5JVT A;  2EA4 A;  3RPQ A;  4CZZ A;  2XAF A;  2EV5 A;  3DPT A;  2YX4 A;  1USS A;  4P55 A;  2H6C A;  3KFW X;  3CUO A;  1BOA A;  1ZLK A;  2GWR A;  2WV0 A;  1KYW A;  5LRS A;  2G9W A;  2GIV A;  2WWY A;  2OU2 A;  3KCC A;  5CJ9 A;  2EFQ A;  1LQ1 A;  2ZFW A;  4ESB A;  4UNO A;  1GVJ A;  6PAX A;  3GYH X;  4XLN F;  3WTX C;  3M1E A;  3CO7 C;  2W25 A;  1KU2 A;  2ZCW A;  4M71 A;  1J9I A;  2Y0M A;  3K9T A;  4RGX A;  2HYG D;  3SZT A;  4A2U A;  4OIN F;  3K69 A;  1H9G A;  3GFM A;  1B4A A;  2Q2E A;  3WTZ A;  2PEX A;  1DP7 P;  1R5G A;  2JTV A;  3BRO A;  2R3S A;  3MCZ A;  1T98 A;  5DCM B;  3MZY A;  2BEO A;  3F23 A;  4PGH A;  3M9A A;  4XBF A;  1TW2 A;  1SD4 A;  2P5V A;  4L9T A;  4R1H A;  4KUM A;  2QZ8 A;  5ICC A;  2ZKZ A;  1O7F A;  3ABU A;  3WTT C;  2V1X A;  4WXC A;  2EWN A;  4G9Y A;  4L18 B;  3P9C A;  1KGS A;  1R23 A;  3SFZ A;  4EGZ A;  2NYX A;  4DNC A;  1MGT A;  3F8N A;  4KN7 X;  3I59 A;  4ENJ A;  4Y15 A;  3SZP A;  2K4J A;  5CVJ A;  4HLX A;  3E6M A;  2P6S A;  3GXO A;  1UST A;  3FM5 A;  3WTU C;  4EMS A;  3MFK A;  3FHZ A;  3I64 A;  3H92 A;  1XGS A;  2P5K A;  4LMY A;  2D2W A;  5FB2 A;  3O3K A;  3S2W A;  4YFX F;  1T6S A;  4KMU X;  1I27 A;  1O3S A;  5LLQ A;  4R8H A;  3CO6 C;  5CVU A;  1IN5 A;  1QZY A;  3CLO A;  3KET A;  1E17 A;  1XDS A;  1G3Y A;  2CWE A;  1RIO H;  4GCV A;  2L3D A;  1YLF A;  4ENK A;  1B9N A;  4FHT A;  4IJA A;  2RVC A;  2EV0 A;  4P9F A;  1GXQ A;  4B8X A;  3M8E A;  3MZH A;  4N9I A;  5HLI A;  2VOD A;  3R61 A;  3TQN A;  2DU9 A;  1ZGA A;  5L3B A;  4RB2 C;  1F4K A;  1XCV A;  5L3E A;  1BJA A;  4GYI A;  3U2R A;  1C0W A;  3N4M A;  1YW7 A;  2H6B A;  3ZMD A;  4HOB A;  1U3E M;  2HS5 A;  4LK1 F;  2FQ3 A;  2OA4 A;  3P9I A;  4I02 A;  5E20 A;  1B59 A;  4A6E A;  3FMR A;  4KN4 X;  4GO1 A;  5F1R A;  4U7D A;  2NRA C;  3DV8 A;  3FMS A;  1TQM A;  3W6K B;  2XAS A;  3MQ0 A;  3WTY C;  3HTU A;  2IP2 A;  3KP2 A;  3Q9S A;  2V1U A;  1HBX G;  3L00 A;  1S29 A;  2RKH A;  1QGP A;  3FX3 A;  4RB3 C;  2FOK A;  2VBX A;  4XRF A;  3BPV A;  3HYI A;  5DD4 A;  3ZPL A;  1L3L A;  4EJO A;  3VB2 A;  2LSO A;  2VBZ A;  3TO7 A;  2MBF A;  1ONV A;  1BI2 A;  3I71 A;  4M9X A;  2FNP A;  3KE2 A;  3NEU A;  5H6R A;  4M6Y A;  1KA8 A;  1IN7 A;  2QEN A;  4CYD A;  4OMY A;  3FM3 A;  1YYV A;  2FRH A;  3F6O A;  4HAM A;  4LGW A;  4IF4 A;  5A2Q Z;  1MDM B;  3JAM Z;  2P7V B;  3O2P E;  1OMI A;  3KEO A;  2FNA A;  2MD5 A;  5K5O A;  1F5T A;  4WXD A;  3I54 A;  4MNU A;  5L3D A;  1TNS A;  5FO5 A;  3ERE D;  2Y48 A;  5TJJ A;  1W7P B;  2JRT A;  2YR2 A;  3LFK A;  1FSE A;  1G3W A;  2OQG A;  3JSO A;  3W6J B;  1TTY A;  3TGN A;  1TW3 A;  3U1D A;  2PLY A;  4QLC U;  1JHH A;  2PMH A;  4IRG A;  4EJT A;  4G6D A;  2P5L C;  3P7N A;  3TDZ C;  3K0L A;  1G3S A;  1PDN C;  5D8K B;  5H6Q A;  5J8C A;  3GF2 A;  2CG4 A;  5HS9 A;  2DFI A;  1ULY A;  1WRJ A;  3DF8 A;  3FMQ A;  4NB5 A;  2XRO A;  3BJ6 A;  1WWX A;  3GFJ A;  2GQQ A;  4KIF A;  3K1N A;  4LLN A;  4UV8 A;  3QP5 A;  4Q47 A;  3V8J A;  2HTJ A;  4KMF A;  4PDK A;  4AVP A;  3U9G A;  1Z91 A;  3WGI A;  1BIB A;  2DT5 A;  1CF7 B;  4O5V A;  1WSU A;  4AIK A;  4KIC A;  3VFZ A;  2NNY A;  4E70 A;  1FYL A;  4HDU A;  1HXD A;  3JTH A;  2CYY A;  2Z99 A;  1SFU A;  1Y0U A;  2FXA A;  2RQP A;  1R5H A;  1FOK A;  4G7H F;  5J8F A;  4ZYG A;  2XUB A;  3F22 A;  1LEA A;  5ILV A;  1ZAO A;  4RAY A;  2BYV E;  4KIG A;  2DW4 A;  3QPH A;  3ZMZ A;  3JSP A;  1ON1 A;  4ZYH A;  2QWW A;  1RZ4 A;  3F8F A;  4UUV A;  2XKO A;  2GA2 A;  4IPA A;  3CTA A;  3IL2 A;  3HRT A;  5TRD A;  2IPQ X;  2RNJ A;  2X4H A;  2FBI A;  1A04 A;  1T38 A;  2HOE A;  2VOO A;  1B6A A;  5A2Q K;  4NQW A;  4UVB A;  4HBL A;  3C1D A;  3EYI A;  3TO9 A;  2DTR A;  2IJL A;  5F6F A;  4PGG A;  2DQL A;  3RIR A;  2M30 A;  1IXC A;  4U0W A;  4LJZ F;  3DXJ F;  2A6E F;  5HS7 A;  4FT8 A;  3F8M A;  3QP6 A;  1T39 A;  2VC0 A;  2XV4 S;  4RS8 A;  2EFN A;  1P2F A;  3IRR A;  5DCM A;  1IZ1 A;  1UHW A;  3LST A;  1OR7 A;  2OD5 A;  1P4A A;  4EM0 B;  3ZMT A;  3ZMU A;  4IHS A;  3Q9V A;  4QWQ A;  3V7R A;  3IC7 A;  2JT1 A;  1YFH A;  4BXU A;  2RDP A;  3GZ5 A;  3HSF A;  1ZG1 A;  4A0Z A;  1ON2 A;  1NHA A;  4YIF A;  1ZH5 A;  1UB9 A;  1QNT A;  2CW0 F;  3HSR A;  4EJU A;  2A61 A;  4A5N A;  1XB4 A;  5LEJ A;  1JE8 A;  5K5R A;  1U5T B;  3REO A;  5FLX K;  1ZRD A;  4U0Y A;  1TLH B;  2XHK A;  4EM1 A;  4LB5 A;  1ODD A;  3V8L A;  2OZ6 A;  3F3X A;  1GHC A;  4NHJ A;  2ZO4 A;  1P4X A;  2VBY A;  3GZ6 A;  3TO6 A;  3LQQ A;  3ZP5 A;  2YSR A;  1HKT A;  4RB0 A;  2MH9 A;  1S3J A;  1STZ A;  1WKM A;  4EGY A;  2EFO A;  4FX4 A;  2HYF A;  4OIP F;  2HDC A;  2FA5 A;  2BE5 F;  3V8K A;  3R60 A;  1UHM A;  2W57 A;  4MTD A;  3RYR A;  2KIU A;  3GW2 A;  3WE3 A;  1DDN A;  1BC8 C;  1SD6 A;  4G8X A;  4U88 A;  4KDP A;  1DPR A;  3E5X A;  4K2E A;  2A68 F;  3PQK A;  3J7A O;  2OZU A;  1F9N A;  4FX0 A;  5ICG A;  2PN6 A;  2ZJ2 A;  1VTN C;  1JXS A;  1R58 A;  3LWF A;  5JHU A;  1K6O A;  1BBY A;  4HF0 A;  3DPL C;  5HOO A;  2HTS A;  5HLG A;  1Z6T A;  3GUD A;  3WU1 B;  5K5Q A;  2XGX A;  3E6C C;  3WGH A;  3BOQ A;  1BI3 A;  2GXB A;  2F5E A;  1PUE E;  2XAQ A;  2BV6 A;  2JZY A;  2DI3 A;  1XSX A;  3QPT A;  3RKY A;  4IRI A;  3FXQ A;  1XGM A;  5E8I A;  5BS6 A;  5CLS A;  1XMA A;  1YW9 A;  3ML6 A;  3ZMV A;  2GAU A;  2P8T A;  3P9K A;  4XSX F;  3QU3 A;  3RKW A;  4AWX B;  3QAH A;  3E6D A;  1D8K A;  2ISY A;  1Z6R A;  1SFX A;  3HRM A;  5DUI A;  2A69 F;  2M45 A;  1IXR C;  5D5X B;  5DCF A;  4RGS A;  3HUG A;  2VN2 A;  2FBK A;  2K27 A;  4JQF A;  1WI9 A;  1FPQ A;  2YU3 A;  3ISP A;  4ESJ A;  1D3Y A;  1MKM A;  1HST A;  1QO0 D;  1U8R A;  3I4P A;  1Z05 A;  3OV8 A;  1MDM A;  3LAP A;  4I0B A;  5ILU A;  3ROU A;  3GO5 A;  1MJB A;  3KZY A;  3L09 A;  1IAW A;  2ZXJ A;  4UHT A;  1EH7 A;  3WU0 A;  5D6F A;  1W5T A;  3LQR A;  3ZN0 A;  1KU9 A;  2FML A;  4HV6 A;  4HX7 A;  1FNN A;  2VE9 A;  5DDG A;  5ERI A;  1S6L A;  1PP7 U;  4A0X A;  4D0P A;  2XRN A;  1QQI A;  2XAH A;  2B0L A;  1L0O C;  4ENM A;  1XGO A;  1RUO A;  4OIR F;  3R0J A;  1CGP A;  4EQQ A;  2WTE A;  3N97 A;  4ESF A;  1QZZ A;  1HKS A;  2QQB A;  5DD8 A;  2E1C A;  2VT2 A;  2ZME B;  3CUQ B;  4ZYD A;  4CDG A;  3J81 K;  4I09 A;  4UVA A;  4ZZD A;  1BM9 A;  4MQ9 F;  1X3U A;  1SAX A;  1XD7 A;  1CF7 A;  3H3U A;  2CSO A;  1FWZ A;  3C7J A;  1Z7U A;  4S05 A;  3BDD A;  4L5J A;  4ON0 A;  2XIG A;  1PP8 F;  2VXZ A;  5BPI A;  2L54 A;  2ACJ A;  2P7C B;  4Q48 A;  4BAY A;  3F8C A;  3BZ6 A;  3HHH A;  1O3T A;  2RC4 A;  4I7H A;  5IT3 A;  4MGR A;  1YQA A;  2D45 A;  3QOP A;  3DKW A;  4IVN A;  3EYY A;  2ZNY A;  3C3W A;  1KU7 A;  1XDU A;  2M87 A;  2ZBK A;  1R1U A;  3B02 A;  1J59 A;  2FBH A;  3Q5F A;  2UXX A;  1IF1 A;  1MZB A;  2L02 A;  3HSE A;  4GYG A;  1OKR A;  2EK5 A;  3R6S A;  4KNY A;  3WTW C;  3WGG A;  2LKP A;  5E1X A;  4M9S A;  1TBX A;  5L3F A;  1HW5 A;  3GFL A;  2J5P A;  3LA2 A;  5ICE A;  3GWZ A;  3T5X A;  2GZW A;  5FFX A;  1G3T A;  2XVC A;  3L9F A;  1U2W A;  3G3Z A;  2G7H A;  3KP3 A;  1LJ9 A;  3T8R A;  4RB1 A;  5D5U B;  1O57 A;  3M7G A;  4S04 A;  2LDU A;  1UCR A;  3ZN1 A;  3J80 K;  1FSH A;  2XAJ A;  2VOP A;  2L4A A;  2QQ9 A;  1J75 A;  3VEP A;  4EJW A;  2ISZ A;  2L01 A;  1HSJ A;  2BGC A;  3OOP A;  2M1B A;  2OBP A;  2Y75 A;  4RGR A;  5HS8 A;  3HOT A;  1EV7 A;  3H3Z A;  2ADU A;  5J6X A;  1H9T A;  3I0T A;  4ETS A;  2PBI A;  2LNB A;  2A6H F;  2V9V A;  5FLX Z;  1HW2 A;  2HQR A;  3V4G A;  3KP4 A;  1TQI A;  4A0Y A;  2WC2 A;  1DPU A;  5BMZ A;  3GLX A;  4MTE A;  2QUF A;  3F8B A;  3RPU A;  1IN8 A;  1P92 A;  2ESH A;  1ZN2 A;  1KU3 A;  5D5V B;  2PG4 A;  3DQV C;  4I98 B;  2H94 A;  1IN6 A;  4HV5 A;  4WF2 A;  1J2X A;  2PQ8 A;  3IKT A;  3ZQ7 A;  4WWC A;  4KT5 C;  4M6X A;  4CGZ A;  5LGU A;  3BY6 A;  2F5D A;  3MAJ A;  5FD5 A;  1G6N A;  4WX9 A;  1HQC A;  4BYY A;  3COA C;  4F7Z A;  1LDK B;  1ZHF A;  4HX4 A;  1V4R A;  2STW A;  1FLI A;  2DO7 A;  2F5C A;  1IRF A;  4CIC A;  4ASN A;  2KJC A;  5JFR A;  1BI1 A;  5IT9 K;  2PI0 A;  3ECO A;  2AS5 F;  2HWV A;  1K78 B;  2TDX A;  2NS0 A;  3SHF A;  2Z33 A;  2Z3Y A;  4WK8 F;  3KLN A;  4B09 A;  1MJ9 A;  2L4M A;  2ESN A;  2EJR A;  2HZT A;  4KFC A;  4LB6 B;  5HDN A;  4U7B A;  4M73 A;  3C18 A;  2HFH A;  2O6G E;  3RYP A;  4IXA A;  1KQ9 A;  1XSD A;  2FE3 A;  1YG2 A;  5E18 F;  2KIM A;  3BWG A;  2D1H A;  5AIP A;  2K7L A;  1Z1D A;  3E97 A;  1YIO A;  5HLH A;  1ZRC A;  1FP1 D;  5FD6 A;  1U5T C;  2R7F A;  5HVQ C;  3T1B A;  3GX4 X;  1ZG5 A;  4ZZL A;  1BC7 C;  5AON A;  3E6B A;  1IXS B;  1AOY A;  2E7W A;  3VOD A;  4ENN A;  2O3F A;  1QBJ A;  5L3C A;  2H27 A;  2FSW A;  3D0S A;  2VC1 A;  5F64 A;  2ZNZ A;  3SQN A;  5LGN A;  3IWF A;  2W84 A;  3FXR A;  3E5Q A;  3HOS A;  4L9N A;  2QVO A;  5FFZ A;  3HIF A;  1TNT A;  1YS7 A;  4XSZ F;  1OYY A;  2IT0 A;  2Q0O A;  3RTR A;  3RDI A;  3GVA A;  4LK0 F;  1J5Y A;  2FF4 A;  2CGP A;  4HDV A;  2C6Y A;  4AD9 A;  2PMU A;  4XLP F;  5JI6 A;  1S8N A;  4BH9 A;  2YPR A;  4EJV A;  2ELH A;  1IW7 F;  1IRG A;  2MA3 A;  1E2X A;  1K7A A;  1WQ2 A;  1IN4 A;  4HA8 A;  1FYM A;  2GXG A;  1KQ0 A;  4YII A;  3JTG A;  3I5U A;  2F5F A;  2STT A;  2VON A;  4BQA A;  3FZV A;  1R7J A;  4Z2Y A;  5AIQ A;  4OIO F;  2E1N A;  1DUX C;  3J81 Z;  2O8X A;  2CQK A;  3ELK A;  2EFW A;  1AWC A;  2QLZ A;  4JBA A;  3F21 A;  4DQ2 A;  2ZME A;  3CUQ A;  1JGS A;  1H0M A;  1FZP B;  2Q8K A;  1OPC A;  4LG0 B;  3FF5 A;  2VE8 A;  1R1T A;  1YTY A;  3K1P A;  4M74 A;  1FBS A;  2O61 A;  3TDU C;  1RNL A;  4P96 A;  1G4D A;  2P6T A;  3CDH A;  4HX8 A;  5ILS A;  2R7D A;  4HQE A;  5CYV A;  2K86 A;  3PQJ A;  4L0Y B;  2HGC A;  3KZZ A;  3PFI A;  5H20 A;  4KYW A;  4LFU A;  1ZLJ A;  3M8F A;  3K1M A;  3ZMS A;  2LF8 A;  2YX7 A;  2Z5U A;  4M9Z A;  1KYZ A;  1O3Q A;  4HF2 A;  4YG2 F;  1LVA A;  3TOB A;  4HZF A;  3LAJ A;  3HRS A;  4YFN F;  1W4M A;  2KIF A;  1K79 A;  2QBY B;  1I1S A;  4PCQ A;  4GXO A;  2JPB A;  5E1Z B;  2AXL A;  4U0V A;  2Z9O A;  5JR3 A;  1LNW A;  5LBQ A;  2PFB A;  2QM3 A;  5D6E A;  1FC3 A;  1QPM A;  1FY7 A;  3WG9 A;  4ZYE A;  4GGG A;  2M5W A;  1W7P A;  4UV9 A;  5LHH A;  3F72 A;  3T8T A;  4Y13 A;  2UXN A;  4KA4 A;  2DQR A;  2DK5 A;  3J80 Z;  4BHB A;  2DPD A;  4A12 A;  3R4K A;  2H09 A;  3ABT A;  4Q5S F;  1R36 A;  5BQT A;  2F2E A;  2GA1 A;  3EDP A;  5ED4 A;  3CUQ C;  4O3M A;  3BPX A;  4OOI A;  1V3F A;  2HKX A;  2XAG A;  4TV7 A;  1R00 A;  2PJP A;  4RAZ A;  2HEO A;  1EH8 A;  4OMZ A;  2VBW A;  2OAZ A;  1HKQ A;  2IW5 A;  4A6D A;  2X0L A;  3G73 A;  4HF1 A;  4AIH A;  3I53 A;  4OIQ F;  3HRU A;  1TQP A;  2EA2 A;  2IA0 A;  3KP7 A;  5E17 F;  1UFM A;  1FBQ A;  1KQ8 A;  3O6B B;  4G94 A;  4ZH4 F;  3HHG A;  1XCB A;  4G7Z F;  2EB7 A;  3V7S A;  4JK1 X;  4MEX F;  3DFG A;  3L7W A;  1ZYR F;  4KIB A;  3EET A;  4IHT A;  5D5W B;  3RI4 A;  2JPC A;  2HKO A;  3GFI A;  3WTS C;  2DLL A;  1Z9C A;  2O03 A;  1SD5 A;  5LHG A;  2V79 A;  1SFE A;  3R0A A;  4N9H A;  2BBY A;  4BNC A;  1I6X A;  4CO8 A;  1ZRF A;  5L3G A;  1O3R A;  3TOA A;  4I0A A;  4L9J A;  1ZG3 A;  2IA2 A;  1I1G A;  2O0Y A;  4MHG A;  3NRV A;  2RGV A;  3E5U A;  1FP2 A;  3I59 B;  1RUN A;  3KP5 A;  3F6V A;  1OYW A;  5HDG A;  1R1V A;  3HTS B;  1LDJ A;  3IHU A;  1YO5 C;  5IT9 Z;  2HR3 A;  1J0R A;  2K4B A;  2V6C A;  2IA1 A;  2CFX A;  4Q4Z F;  1XGN A;  3TKY A;  1B9M A;  2FU4 A;  1K78 A;  2IVM A;  1LDD A;  2G7U A;  3ECH A;  4CHU A;  2CO5 A;  1XSV A;  2MLG A;  1SMT A;  5E1W A;  2JSC A;  4L0Z B;  3RJP A;  4OU0 A; 
#chains in the Genus database with same CATH topology
 4BJT A;  2K02 A;  2DBB A;  1JKR C;  2ECB A;  2FX0 A;  3SFI A;  5DYM A;  1A6Q A;  1GXP A;  2KRF A;  5DTD A;  3KP6 A;  3LNQ A;  3K2Z A;  3EQL F;  3KEQ A;  4RA2 A;  2O5R A;  4XLF A;  2XB5 A;  2L7Z A;  4PZJ A;  2XGE A;  2VT3 A;  3DEE A;  4N0B A;  1W0U A;  2IRF G;  1S7A A;  5EDN A;  1FYK A;  3S1N J;  4M3B A;  2VKH A;  5EEG A;  1Q1H A;  4UUS B;  5HLT A;  1FOX A;  3BQY A;  5GTI C;  1N25 A;  2W24 A;  4BEH A;  2V1D A;  4I99 C;  4JX6 A;  3FK6 A;  3OSG A;  3S3M A;  5CVR A;  1LKX A;  1P4W A;  3VSL A;  1U78 A;  1HLV A;  3HGY A;  3DTK A;  5BPD A;  3OYN A;  5FKO A;  3WTV C;  5K1Y A;  3MEX A;  1V5E A;  1MD0 A;  3HPH A;  5KVR A;  4LD5 A;  1R5I D;  3HPG A;  1T2K A;  2XB0 X;  1MSF C;  4C2U A;  3QRF F;  1ETV A;  1SVO A;  1AKH B;  5EJC A;  2RN7 A;  1LEB A;  2JWT A;  1U5T A;  4UXN A;  2EBI A;  1ZAR A;  2COM A;  3HZJ A;  4PJN A;  5FKN A;  5FKL A;  3QPS A;  4C9Y A;  4EVI A;  1YS6 A;  3LSI A;  3ZR8 X;  3DEU A;  1NK2 P;  2W85 A;  2HQA A;  3SZG A;  2NVY J;  1MMA A;  3OYB A;  3LA3 A;  3CJN A;  1SD7 A;  2P4W A;  1T0F A;  5E8G A;  1RKT A;  2QKM B;  2DK8 A;  2FD5 A;  4IRH A;  4H0E A;  1A36 A;  1SEU A;  1SMY F;  5FLM J;  3BJO A;  1WGX A;  4FE4 A;  4A93 J;  3ZCO A;  4B48 A;  5LEK A;  2E34 A;  4YFK F;  4XOR A;  4Y17 A;  2R7V A;  2ID3 A;  3SXY A;  4XLH A;  3I58 A;  2D1V A;  1F1Z A;  4UY8 I;  1G59 A;  3FXU A;  1W7P D;  1WJA A;  2NAZ A;  2VUM J;  2R7T A;  2UZK A;  1X1D A;  1JJ6 C;  1GV5 A;  2M8E A;  4BS9 A;  3ULQ B;  3WE2 A;  4G6Q A;  2BZT A;  3DP7 A;  1FX7 A;  2JVG A;  4HYE A;  5DUK A;  3B6A A;  2KHM A;  4BUP A;  2NVX J;  3AAF A;  3GTL J;  2X51 A;  5IPA A;  2W1O A;  4FQG A;  3NAU A;  3CP2 A;  4P5O A;  4Y52 J;  1FIA A;  2DAO A;  4RGU A;  2WY8 Q;  5EZG A;  5ICF A;  3E3V A;  4XKB A;  1FT9 A;  2Y31 A;  1EF4 A;  2ETH A;  3KLO A;  1ZGJ A;  5TIS C;  1FBU A;  4J19 A;  2BOL A;  4E6K G;  5C44 J;  2MLK A;  1OQY A;  5KK1 A;  4L5E A;  4O6J A;  3GEZ A;  4LLL A;  3WU2 C;  1W5S A;  1OYI A;  5CVV A;  1RI7 A;  4QTR A;  3PO2 J;  3L2V A;  4I2O A;  2MH2 A;  2QQA A;  2OJE D;  3L2U A;  1X4O A;  2EV6 A;  1JI8 A;  3JAM K;  1QA6 A;  3CLQ A;  1J7K A;  1LB2 A;  2HU9 A;  3IAS 2;  3CZ6 A;  4BHC A;  4RLQ A;  1JHF A;  1REP C;  2A5Y B;  2NS8 A;  3OYD A;  2GIZ A;  1LFB A;  2E71 A;  2RV8 A;  3VYU B;  3HXL A;  2XKP A;  2L9S A;  2M3A A;  2VL8 A;  3HM5 A;  4P9U A;  4CXF A;  3CCV I;  1BIA A;  1I5Z A;  2COB A;  2LRD A;  3BJA A;  3RKX A;  3JRE A;  4LG0 A;  5GPA A;  4XID A;  1R4M B;  2E7X A;  3QU6 A;  4HW0 A;  3G1M A;  2R7Q A;  3JW4 A;  5EZH A;  2R7W A;  4RBO A;  3HKZ A;  4DGW B;  3BT9 A;  1UMQ A;  2BY3 A;  3EUH A;  3IH4 A;  2FMY A;  2LC2 A;  3QPL A;  1WFX A;  4UVC A;  4MEY F;  1S7O A;  2XDV A;  2L9N A;  2LF7 A;  1NH3 A;  5DV5 A;  2M7A A;  2L7K A;  1QZE A;  2P0W A;  5GPC A;  1HW1 A;  4II2 A;  4E7Z A;  4W1U A;  5D4R A;  1U6G A;  3RQI A;  1WH7 A;  3S2H J;  1BN5 A;  4R79 A;  3LSP A;  4QIW N;  4EM2 A;  1EH6 A;  1B1B A;  1JTY A;  2MC3 A;  1MJA A;  4J00 A;  4L5I A;  5J4Y A;  2J5O A;  1Z0X A;  2L7M P;  1XN7 A;  5LRR A;  5BOX A;  2A3S A;  2E1M B;  1IUY A;  3IRQ A;  2UWM A;  4F55 A;  5LGT A;  2OC6 A;  1T0F C;  2XGC A;  2B63 J;  2NNN A;  4AIJ A;  2IS2 A;  2E5Z A;  2ICW G;  2OF7 A;  5C3E J;  5HDK A;  3HDD A;  3B73 A;  4BKX A;  2CU7 A;  4M72 A;  1B72 B;  3CDL A;  1P6R A;  4NC8 A;  3PJR A;  3D5L A;  4PK4 A;  1O7L A;  3A01 A;  2VKD A;  2KKO A;  4ITV A;  3WHB A;  3HB9 A;  1X1P A;  2KPM A;  4XN0 A;  3VWB A;  4WXH A;  3FWE A;  3S3N A;  3M07 A;  3MWM A;  2RQQ A;  1FIP A;  3G1L A;  3ZXS A;  5D8L B;  1OLT A;  2ZB9 A;  4BHP A;  4KIS A;  3ABK H;  3IWZ A;  4HQM A;  4LLG F;  4A5M A;  3L2C A;  1D5Y A;  4L9V A;  2EFP A;  2KJB A;  5HNH A;  2QYO A;  4MQV A;  4WCG A;  4HLY A;  5DEQ A;  3LA7 A;  4XLA A;  2BHZ A;  1D8J A;  3JRD A;  2HQN A;  3L2Q A;  5CVI A;  1A35 A;  3CCY A;  5LHI A;  2QBY A;  2GOX B;  1BI0 A;  3CCM I;  2DPU A;  3T0Y A;  3NQO A;  1R71 A;  3BP8 A;  2OQR A;  4I01 A;  1D5V A;  1W36 D;  2A07 F;  5FGM A;  5EEH A;  3V7C A;  3D1N I;  1YW8 A;  2E19 A;  5D4S A;  4EV0 A;  4FIS A;  3S14 J;  3M3Y J;  2FEZ A;  1R22 A;  4A3L J;  3VOE A;  4G7O F;  3WOD F;  1XMK A;  3IKV A;  5DM7 F;  1ZRE A;  5JVT A;  2CW7 A;  2EA4 A;  3DWL E;  3PNY A;  4F92 B;  3HOZ J;  3RPQ A;  2FOW A;  4CZZ A;  2XAF A;  2I10 A;  1ITY A;  2EV5 A;  2KQR A;  3DPT A;  2YX4 A;  1USS A;  2Z16 A;  4P55 A;  2H6C A;  3H5R A;  3KFW X;  1MW7 A;  2LOO A;  3CUO A;  1BOA A;  1ZLK A;  2GWR A;  2WV0 A;  1KYW A;  1WCM J;  3LSR A;  5LRS A;  2G9W A;  2V6E A;  2GIV A;  2WWY A;  1UG0 A;  2OU2 A;  3A2K A;  1YRN A;  3KCC A;  1H8A C;  3BR3 A;  2PMZ N;  2EFQ A;  3M1C A;  5CJ9 A;  1LQ1 A;  2ZFW A;  4ESB A;  4UNO A;  1ZKG A;  1GVJ A;  2HOA A;  4AUX A;  2IS1 A;  6PAX A;  2PJR B;  3GYH X;  3EUH C;  4XLN F;  5JLW A;  4J01 A;  3JRC A;  3WTX C;  3M1E A;  2K9L A;  2W25 A;  3CO7 C;  2HOS A;  3LSJ A;  1KU2 A;  2ZCW A;  4M71 A;  1J9I A;  2Y0M A;  3K9T A;  2DJN A;  4RGX A;  2HYG D;  3SZT A;  4A2U A;  3L2W A;  2R5Y A;  4OIN F;  3K69 A;  1H9G A;  1R49 A;  3GFM A;  1B4A A;  3IV5 A;  2NVT J;  2CUZ A;  2Q2E A;  1DQU A;  3I3L A;  3OL4 A;  3WTZ A;  1UHS A;  2PEX A;  4E7K A;  3BR5 A;  1DP7 P;  2EZL A;  5E3O A;  1R5G A;  2JTV A;  2M7B A;  4B4C A;  1JT6 A;  3BRO A;  2DFE A;  2R3S A;  3MCZ A;  3LOC A;  1T98 A;  5DCM B;  3MZY A;  2YU9 J;  1VI0 A;  2BEO A;  3F23 A;  2LG4 A;  3BTJ A;  4PGH A;  1ZTR A;  3M9A A;  3IP4 B;  5J40 A;  4XBF A;  1WJ5 A;  5HOD A;  2DT6 A;  1TW2 A;  3RPU D;  1SD4 A;  2P5V A;  4L9T A;  3HOX J;  1BOB A;  2DMT A;  1BR4 A;  4R1H A;  2WAE A;  1N75 A;  2X6W A;  1JKP C;  4PFP A;  1V55 H;  4KUM A;  2QZ8 A;  5ICC A;  2ZKZ A;  5EG0 B;  4NDL A;  1O7F A;  4H4K C;  2OTL I;  3ABU A;  3PIP F;  3WTT C;  3SDG A;  3BTC A;  2V1X A;  3HJE A;  1YJN I;  1GLN A;  4WXC A;  2JQ7 A;  2EWN A;  4G9Y A;  4L18 B;  3P9C A;  1KGS A;  1R23 A;  3LFU A;  2LP0 A;  4IOA F;  2X9D A;  4RLF A;  3SFZ A;  4BJ6 C;  4EGZ A;  2NYX A;  4OAY A;  1Y1W J;  4DNC A;  3OYC A;  1MGT A;  3BG7 A;  3F8N A;  3J7Z I;  3RSN A;  4KN7 X;  3FXM A;  4UB6 C;  3I59 A;  3S2D J;  4ENJ A;  4Y15 A;  1DU0 A;  2EZK A;  3SZP A;  3GTK J;  3CDI A;  2K4J A;  2DOA A;  1J09 A;  5CVJ A;  4HLX A;  4S0H B;  1POG A;  3E6M A;  2P6S A;  1FTT A;  3ZGK A;  3GXO A;  1UST A;  3FM5 A;  3WTU C;  1YJ9 I;  4EMS A;  3MFK A;  3FHZ A;  3I64 A;  3G6E I;  5KAI C;  3QOD A;  3H92 A;  4RDU A;  1XGS A;  1HC8 A;  2P5K A;  2Y69 H;  4LMY A;  2JN6 A;  2DA5 A;  2D2W A;  2JUG A;  5FB2 A;  3O3K A;  1S5L C;  3HOY J;  3S1R J;  3S2W A;  2X6X A;  4YFX F;  3MZ8 A;  1T6S A;  2DJI A;  4B3X A;  1RES A;  4B1R A;  3CC7 I;  4KMU X;  1I27 A;  2WBM A;  3BTI A;  1GUU A;  1O3S A;  1HCR A;  5LLQ A;  3CJQ B;  1Z67 A;  3PIO F;  4R8H A;  3CO6 C;  1TP4 A;  1VZ0 A;  3MKY B;  5CVU A;  1IN5 A;  1QZY A;  2E35 A;  2ID6 A;  3CLO A;  3KET A;  1E17 A;  2I8D A;  4Z6Y A;  1XDS A;  1G3Y A;  4FE7 A;  2CWE A;  1RIO H;  4GCV A;  2CW8 A;  2OV7 A;  2L3D A;  1YLF A;  4ENK A;  3FK7 A;  1B9N A;  4FHT A;  4IJA A;  3CCQ I;  2RVC A;  3CJT B;  2EV0 A;  4P9F A;  3Q0U A;  1GXQ A;  4B8X A;  3M8E A;  3MZH A;  4N9I A;  3G2B A;  1YI2 I;  2DA3 A;  5HLI A;  4UUT A;  3BG3 A;  2W4S A;  2WAQ N;  2VOD A;  3R61 A;  3K70 C;  3TQN A;  2DU9 A;  2LLK A;  2CV1 A;  1ZGA A;  5L3B A;  2K3P A;  4RB2 C;  5F0F A;  1XCV A;  1F4K A;  1GDT A;  2WY7 Q;  5L3E A;  2KDZ A;  3GCM A;  3OL3 A;  2GXA A;  1BJA A;  4GYI A;  2VJI A;  2WAD A;  3TP0 A;  3AG3 H;  1MBG A;  4RMN A;  3U2R A;  1C0W A;  3N4M A;  4C3J J;  1YW7 A;  1RR7 A;  4UUS A;  2BXZ A;  3HOV J;  3A0B C;  2H6B A;  4BBR J;  1OCC H;  2D5V A;  2XPV A;  3ZMD A;  4HOB A;  2Y0S A;  1U3E M;  2JA8 J;  1XX5 A;  2HS5 A;  3K4C A;  2BY2 A;  1MMN A;  1S9H A;  3BG6 A;  3O8G A;  4LK1 F;  4XLC A;  2FQ3 A;  2OA4 A;  2IGO A;  4M3D A;  4HNU A;  1WJD A;  5JHF A;  2E2I J;  3P9I A;  1MBJ A;  4AYB N;  3S3O A;  4I02 A;  4IZZ A;  5E20 A;  1B59 A;  2QQ8 A;  3HG9 A;  5F0C A;  4A6E A;  3FMR A;  4KN4 X;  4F52 A;  1AKH A;  4GO1 A;  3DEW A;  5F1R A;  4U7D A;  2NRA C;  3DV8 A;  3BCB A;  3FMS A;  1TQM A;  3W6K B;  1I3A A;  5GAH J;  3CCS I;  2L9V A;  4P1W A;  2XAS A;  1VF9 A;  3MQ0 A;  4BGD A;  2NOG A;  3VPR A;  3WTY C;  5F0H A;  3GTJ J;  3HTU A;  2IP2 A;  1JUP A;  3VDX A;  5IYC J;  1VFC A;  3KP2 A;  3Q9S A;  4A3C J;  2A05 A;  3UR3 C;  2V1U A;  2VQG A;  1PUF B;  1K6Y A;  4D1Q A;  1HBX G;  3L00 A;  3AL0 C;  1W1W E;  2MG4 A;  4HG2 A;  2QA4 I;  1S29 A;  2RKH A;  1QGP A;  2M34 A;  3FX3 A;  5K7H A;  3A1Y A;  4RB3 C;  2HVS A;  2FOK A;  2WB1 A;  3ZOB A;  2VBX A;  4XRF A;  3BPV A;  3HYI A;  5DD4 A;  4YEL A;  3ZPL A;  2W82 A;  2KRC A;  1L3L A;  4EJO A;  3VB2 A;  2LSO A;  2VBZ A;  3TO7 A;  2MBF A;  3FIW A;  1ONV A;  1BI2 A;  3HUG B;  3I71 A;  4M9X A;  3OYL A;  5M3F J;  2FNP A;  3KE2 A;  2VQC A;  3NEU A;  3CP8 A;  5H6R A;  5F04 A;  4M6Y A;  1APL C;  1KA8 A;  2ELK A;  2Z1D A;  1IN7 A;  2QEN A;  4CYD A;  4OMY A;  3FM3 A;  1YYV A;  4XLE A;  4CCM A;  2FRH A;  3ONQ A;  4DYC A;  3F6O A;  4HAM A;  4LGW A;  4IF4 A;  5A2Q Z;  4V2G A;  1MDM B;  3JAM Z;  2CUJ A;  2P7V B;  3O2P E;  1OMI A;  1CQT A;  1VQ7 I;  1IJW C;  1ENH A;  3KEO A;  2FNA A;  2MD5 A;  2B7E A;  5K5O A;  4XKW A;  4BAC A;  1F5T A;  4WXD A;  3I54 A;  4MNU A;  5L3D A;  3JCU C;  1TNS A;  5FO5 A;  3ERE D;  2Y48 A;  2JJ7 A;  2FJ1 A;  5TJJ A;  1W7P B;  4CH7 A;  2JRT A;  4HST A;  5FJ8 J;  2YR2 A;  4KT6 A;  3LFK A;  2XPU A;  4RM3 A;  1FSE A;  4CSW A;  1G3W A;  2OQG A;  3JSO A;  4DBQ A;  3W6J B;  3SEZ A;  1TTY A;  2KL4 A;  3TGN A;  1TW3 A;  1Z7L A;  3U1D A;  2PLY A;  5FKK A;  4QLC U;  3CCU I;  5GAE J;  1JHH A;  2PMH A;  1K83 J;  4ZDL A;  4IRG A;  3CMA I;  2XGD A;  3FKJ A;  3OYA A;  5GAD J;  3OYJ A;  4EJT A;  2L7F P;  4G6D A;  2P5L C;  3P7N A;  3TDZ C;  1E0E A;  2V7F A;  3K0L A;  1IGN A;  2CV0 A;  1G3S A;  1PDN C;  5D8K B;  5H6Q A;  4CCN A;  5J8C A;  3GF2 A;  2CG4 A;  5HS9 A;  1FOW A;  1EKE A;  1LE8 B;  2DFI A;  1ULY A;  3S17 J;  1WRJ A;  1X58 A;  3DF8 A;  2VB6 A;  2MAB A;  3FMQ A;  3QQA A;  5FKM A;  4NB5 A;  1YHQ I;  2AQE A;  4JX4 A;  2ZSH B;  2LY2 A;  3BJ6 A;  2XRO A;  1WWX A;  1DGW Y;  3GFJ A;  2GQQ A;  4IOC F;  4KIF A;  3K1N A;  1ZR2 A;  4LLN A;  3IH2 A;  2LBF B;  2VXD A;  4UV8 A;  3QP5 A;  4Q47 A;  3V8J A;  2HTJ A;  4KMF A;  3AKZ A;  4PDK A;  2ZJQ F;  2ELJ A;  4AVP A;  2UV1 A;  3V42 A;  3U9G A;  2DDB A;  5E79 C;  2DOE A;  2QGU A;  1AU7 A;  1Z91 A;  3WGI A;  1OCP A;  1BIB A;  1B72 A;  2DT5 A;  3WG7 H;  2DA4 A;  3MD2 A;  1A6I A;  4N4N B;  2VKE A;  1CF7 B;  3BG5 A;  2R93 J;  5FRM A;  3A03 A;  4O5V A;  2R7R A;  1WSU A;  2BW3 B;  2G0E A;  4A3K J;  2DOF A;  4AIK A;  4KIC A;  2ZXH A;  3FDY A;  2NVU B;  3VFZ A;  2NNY A;  4E70 A;  1FYL A;  3L2R A;  4HDU A;  1TWA J;  3OWT A;  1HXD A;  2OPT A;  4CCK A;  3JTH A;  2CYY A;  2Z99 A;  1SFU A;  1VQK I;  3GTG J;  4BDY A;  2QCO A;  1Y0U A;  2FXA A;  2KT0 A;  4Y7N J;  2RQP A;  1R5H A;  1FOK A;  2MFZ A;  2O8K A;  4G7H F;  1DGR M;  4ZYG A;  5J8F A;  2XUB A;  2DTZ A;  3F22 A;  1LEA A;  5ILV A;  2QSH X;  4XNF A;  3OIQ A;  1ZAO A;  3SEQ A;  1ZR4 A;  2FUG 2;  3KPH A;  3PNV A;  2JMW A;  4RAY A;  2O9L A;  3PSI A;  3HC7 A;  2BYV E;  4KIG A;  2DW4 A;  3QPH A;  1WJB A;  3ZMZ A;  3JSP A;  1ON1 A;  4ZYH A;  2QWW A;  1RZ4 A;  3F8F A;  1X1B A;  4UUV A;  2XKO A;  3Q0W A;  3CMY A;  2DA2 A;  2GA2 A;  1VQ6 I;  4IPA A;  2MD0 A;  1MIJ A;  3CTA A;  3KYC B;  3IL2 A;  2HNH A;  3HRT A;  4AC0 A;  5TRD A;  5J1R A;  4GFB A;  2IPQ X;  2EIL H;  5F1J A;  2VJ5 A;  2F5V A;  4IHW A;  3FHN A;  2RNJ A;  3C2H A;  2MC4 A;  3LL7 A;  5EEA A;  2X4H A;  4V2F A;  2FBI A;  5J1Y A;  2DCE A;  1A04 A;  2BXY A;  2HQ5 A;  5IY5 H;  4IO9 F;  1T38 A;  1RPW A;  2HOE A;  2VOO A;  1DP3 A;  1B6A A;  3H9J A;  3K4M A;  4M3G A;  3J7A Y;  3E7L A;  1X2N A;  4NQW A;  4UVB A;  5A2Q K;  4HBL A;  4X0G A;  3LSG A;  3C1D A;  3ESW B;  4CCL A;  3EYI A;  3TO9 A;  2PJR A;  2PX9 A;  2DTR A;  2DFF A;  2KZG A;  1ETO A;  1MBF A;  2RAE A;  4BBS J;  2LTP A;  2IJL A;  5F6F A;  4AID A;  4PGG A;  2DQL A;  2IEK A;  1K61 A;  3RIR A;  3TMO A;  2M30 A;  2EZI A;  3DBH B;  1IXC A;  4U0W A;  4LJZ F;  3DXJ F;  4E7S A;  2B9S A;  2A6E F;  5HS7 A;  4FT8 A;  4HEA 2;  3F8M A;  3QP6 A;  1T39 A;  2VC0 A;  1A5J A;  2IS4 A;  1Y8R B;  2XV4 S;  4RS8 A;  2EFN A;  2E1M C;  2HXI A;  1TC3 C;  3KZI C;  1P2F A;  3IRR A;  2R5Z B;  2HDD A;  3Q3S A;  4YEJ A;  5J47 A;  1IC8 A;  2DFH A;  5DCM A;  3DCF A;  1VQ8 I;  1BL0 A;  1RC9 A;  2M9H A;  2BHY A;  1YIJ I;  3JRH A;  1IZ1 A;  1UHW A;  2E1O A;  5IP7 J;  3LST A;  1OR7 A;  1OJL A;  2OD5 A;  4A3F J;  1P4A A;  2VJJ A;  4EM0 B;  3ZMT A;  3ZMU A;  4IHS A;  3Q9V A;  4QWQ A;  3V7R A;  3IC7 A;  2WA0 A;  3DTE A;  4JX5 A;  2JT1 A;  2VAS A;  2M0C A;  4BQQ A;  4BXU A;  1YFH A;  2P81 A;  5GTH C;  1SFO J;  2RDP A;  3GZ5 A;  5EG0 A;  3HSF A;  1ZG1 A;  1LFP A;  3FKI J;  4A0Z A;  5E3N A;  2LYC A;  4HPQ A;  1H89 C;  1ON2 A;  1IV8 A;  1E3O C;  1NHA A;  4YIF A;  1ZH5 A;  4IHY A;  1UB9 A;  1QNT A;  2I5U A;  4CUG A;  3SJM A;  2CW0 F;  1HOM A;  1D1A A;  4D7N A;  2Z2S B;  2E60 A;  3HSR A;  2M4G A;  4EJU A;  3KEY A;  2A61 A;  4A5N A;  3S93 A;  3RQ4 A;  3I4N J;  2OCE A;  1XB4 A;  3I9V 2;  5B1B H;  5LEJ A;  1JE8 A;  5K5R A;  3K4N A;  1U5T B;  4II3 A;  1TL8 A;  3REO A;  3TW6 A;  1VND A;  5FLX K;  1ZRD A;  4DZP A;  4U0Y A;  1TLH B;  1QU3 A;  2XHK A;  4EM1 A;  3OS0 A;  1ODD A;  4LB5 A;  3ZQQ A;  3V8L A;  4BU2 A;  4XIC A;  2OZ6 A;  2V9P A;  3F3X A;  4U87 A;  1GHC A;  4NHJ A;  2ZO4 A;  4FTH A;  1WH5 A;  1P4X A;  2VBY A;  3GZ6 A;  2VPL A;  1KON A;  1RR8 C;  3D5S C;  3TO6 A;  3LQQ A;  3ZP5 A;  2YSR A;  4IQJ A;  4RB0 A;  3S32 A;  4FCY A;  2K85 A;  1S3J A;  2MH9 A;  1STZ A;  4UB8 C;  1HKT A;  1WKM A;  4M3F A;  2GM4 A;  3TED A;  4EGY A;  2EFO A;  4FX4 A;  2HYF A;  4OIP F;  2HDC A;  4DBR A;  1IUF A;  2FA5 A;  2KIS A;  1Z21 A;  1X3Z B;  3GTQ J;  2F4I A;  2BE5 F;  1ERD A;  3AFH A;  2R0Q C;  2DYR H;  5J3L A;  1UEL B;  2JVH A;  3V8K A;  3R60 A;  2VI6 A;  3MVP A;  1UHM A;  4ABZ A;  2W57 A;  4F3Q A;  1SVL A;  3LSM A;  4MTD A;  3RYR A;  4MO7 A;  2KIU A;  3GW2 A;  3WE3 A;  1DDN A;  4XK4 A;  1BC8 C;  2WAF A;  1SD6 A;  3H9Q A;  1BW5 A;  3K4J A;  1OCR H;  4G8X A;  4U88 A;  4KDP A;  1DPR A;  3E5X A;  3VYR B;  4K2E A;  2A68 F;  2XC7 A;  3PQK A;  3J7A O;  2OZU A;  4HNV A;  1F9N A;  3OYE A;  4FX0 A;  5ICG A;  3K10 A;  2K5C A;  4X1E A;  3S16 J;  1SAN A;  4PJL A;  2PN6 A;  1GT0 C;  4BE1 A;  2ZJ2 A;  1OR7 C;  5M5Y J;  1VTN C;  2NS7 A;  2CMP A;  3W2V A;  4BXF A;  4A3B J;  1JXS A;  2FQ4 A;  1R58 A;  2XF5 A;  3QYF A;  3LWF A;  5JHU A;  4M3E A;  3CCR I;  1K6O A;  1BBY A;  4HF0 A;  3DPL C;  5IP9 J;  5HOO A;  1K4S A;  2HTS A;  3ABM H;  2LH9 A;  3HOU J;  3CC2 I;  5HLG A;  4IHV A;  1Z6T A;  3GUD A;  3PO3 J;  3WU1 B;  5K5Q A;  2XGX A;  3E6C C;  1WJC A;  2MW8 A;  3WGH A;  3MN2 A;  1WJF A;  3BOQ A;  2M2E A;  1BI3 A;  1JGG A;  4RAG A;  2NXN B;  2GXB A;  2F5E A;  1PUE E;  2XAQ A;  2BV6 A;  2JZY A;  2K3F A;  1IO2 A;  3B6C A;  2DI3 A;  3PL8 A;  1XSX A;  1NG7 A;  1PYV A;  3QPT A;  3RKY A;  4IRI A;  3FXQ A;  3FXK A;  1XGM A;  5E8I A;  5BS6 A;  4A3G J;  1X4P A;  2LK2 A;  3CCL I;  5CLS A;  3LSH A;  1XMA A;  3EUK L;  1YW9 A;  4BJ5 C;  3ML6 A;  2R92 J;  3ZMV A;  2R7S A;  2GAU A;  2P8T A;  2K9Q A;  4B3A A;  3DLL F;  5F27 A;  2DA1 A;  3P9K A;  4XSX F;  2ZFU A;  3QU3 A;  3RKW A;  4AWX B;  3QAH A;  2AO9 A;  3DKX A;  3E6D A;  1D8K A;  2ISY A;  1Z6R A;  3A4C A;  1SFX A;  2R4G A;  3HRM A;  5IP6 A;  2A69 F;  5DUI A;  2M45 A;  2R7U A;  1V54 H;  2CUF A;  2LY9 A;  1IXR C;  1QVT A;  1NG6 A;  5D5X B;  5DCF A;  2OCC H;  4RGS A;  4DOZ A;  1ZEL A;  3HUG A;  2JRM A;  2VN2 A;  2FBK A;  2K27 A;  3DBR B;  4JQF A;  4A3J J;  1WI9 A;  1FPQ A;  2YU3 A;  3ISP A;  3HOW J;  2RRE A;  3VYS B;  3NWS A;  4ESJ A;  1D3Y A;  2L9R A;  1MKM A;  3AG2 H;  2HI3 A;  1HST A;  1QO0 D;  1U8R A;  1OCO H;  3I4P A;  1Z05 A;  3OV8 A;  2CH0 A;  5IOY A;  1MDM A;  3LAP A;  2DT7 B;  1FEX A;  4I0B A;  5KAF C;  3GTM J;  4BY1 J;  1WPK A;  4Y33 A;  5ILU A;  3ROU A;  3GO5 A;  3LMM A;  1VQM I;  1MJB A;  2LFB A;  4NC6 A;  4XL9 A;  3KZY A;  3L09 A;  4C3H J;  1IAW A;  2KFD A;  2F48 A;  2EIM H;  2ZXJ A;  4UHT A;  4D9J A;  3JRF A;  1EH7 A;  3ERM A;  3TP3 A;  3WU0 A;  3MMY B;  1GV2 A;  5D6F A;  1W5T A;  5JVG F;  3LQR A;  3ZN0 A;  1Y0N A;  2L5Q A;  3BZC A;  1KU9 A;  1SFK A;  2FML A;  2H1L A;  4HV6 A;  4ZTF A;  2JA5 J;  4HX7 A;  5J1U A;  2MYS A;  4HSR A;  5EF6 A;  2VLA A;  2IGK A;  4XRM A;  5E3M A;  1FNN A;  4IKF A;  4CYC B;  3IAM 2;  4PSW A;  5DDG A;  5ERI A;  2VE9 A;  4DW6 A;  1S6L A;  1PP7 U;  4A0X A;  4D0P A;  5B3S H;  2XRN A;  4I6Z A;  3IH3 A;  1QQI A;  2LVS A;  2XAH A;  2B0L A;  2KZV A;  2R7X A;  1L0O C;  4ENM A;  1XGO A;  1RUO A;  3H35 A;  4OIR F;  3FBI B;  4PUS A;  3R0J A;  1CGP A;  2E2J J;  1LE8 A;  3X2Q H;  4EQQ A;  2WTE A;  4LIT A;  1O4X A;  1ORK A;  3N97 A;  1JJ8 C;  1YX3 A;  1TWH J;  2DYS H;  4LIU A;  4W97 A;  4ESF A;  3CJR B;  1QZZ A;  1HKS A;  3UNG C;  4XRS A;  5DS9 A;  1QHG A;  3U1K A;  3P5J A;  3CCE I;  2QQB A;  5DD8 A;  2E1C A;  5C4J J;  2VT2 A;  5FLV A;  2LBF A;  2ZME B;  3CUQ B;  5C4X J;  4ZYD A;  3CC4 I;  3EUA A;  4CDG A;  3J81 K;  2ME0 A;  4I09 A;  4UVA A;  5KHD A;  4ZZD A;  2R5Y B;  3HKZ N;  5DM6 F;  3HBL A;  1NTC A;  1BJZ A;  2Q2E B;  2KLO A;  1BM9 A;  4XOP A;  3H0G J;  1X3W B;  4E7H A;  5EGO B;  4RM2 A;  1T33 A;  4EAT A;  4MQ9 F;  2KRH A;  1X3U A;  4LIV A;  3GME A;  4XMY A;  4ZYA A;  1SAX A;  3PSF A;  1XD7 A;  1CF7 A;  3H3U A;  2OTJ I;  2HXO A;  2BW3 A;  2CSO A;  1XS9 A;  1EJ9 A;  1FWZ A;  3C7J A;  3IUO A;  1Z7U A;  4S05 A;  4ZC3 A;  3BDD A;  4L5J A;  1VQ9 I;  4ON0 A;  3C2G A;  4KIT B;  5M3M J;  4E7L A;  3K2A A;  2R7O A;  4PJ0 C;  4F91 B;  2XIG A;  1HF0 A;  2BY0 A;  4X6A J;  1PP8 F;  3AG4 H;  1F43 A;  3H1C A;  3H5A A;  2V26 A;  2VXZ A;  1D0Y A;  4E7I A;  1Y6I A;  4DZJ A;  3ZQF A;  3ZQL A;  1I50 J;  3BC8 A;  5BPI A;  2L54 A;  4B43 A;  2ACJ A;  2P7C B;  4Q48 A;  4BAY A;  3F8C A;  3BZ6 A;  3HHH A;  1O3T A;  2RC4 A;  1BR1 A;  1MH4 A;  4I7H A;  5IT3 A;  1I3Q J;  4MGR A;  1YQA A;  2D45 A;  3QOP A;  3DKW A;  4IVN A;  3EYY A;  1S72 I;  2ZNY A;  4CA0 A;  3C3W A;  1A31 A;  1IRX A;  3ASN H;  1ZGW A;  1S7E A;  3UKG A;  1KU7 A;  3Q0V A;  2BVM A;  1XDU A;  3N05 A;  2M87 A;  3K6G A;  2XSJ C;  3QOE A;  4QSH A;  4ZTJ A;  2ZBK A;  3AL0 B;  3K7A J;  1IDY A;  1OIS A;  1R1U A;  3CF2 A;  2E36 A;  3B02 A;  4GRI A;  3TW7 A;  2FBH A;  1J59 A;  3NAR A;  3Q5F A;  1AHD P;  1FTZ A;  1TWF J;  2UXX A;  1IF1 A;  1MZB A;  1Y56 A;  2LRE A;  2HYJ A;  2L02 A;  3HSE A;  4GYG A;  1OKR A;  2EK5 A;  3R6S A;  1LFU P;  4KNY A;  3WTW C;  3WGG A;  2LKP A;  5E1X A;  4M9S A;  2RNG A;  4G12 A;  1TBX A;  2E5N A;  4DYR A;  2CQX A;  5L3F A;  1HW5 A;  3A02 A;  2PMZ A;  3GFL A;  3K4L A;  2J5P A;  3LA2 A;  1JTX A;  2HDW A;  5ICE A;  5KNL A;  3BZK A;  3GWZ A;  3T5X A;  2ME6 A;  2GZW A;  5FFX A;  1G3T A;  4XRS G;  2XVC A;  3L9F A;  1U2W A;  2VQL A;  1VQP I;  3G3Z A;  2G7H A;  1Z3Y A;  3KP3 A;  4XKV A;  4BY7 J;  1LJ9 A;  2ZXI A;  3T8R A;  4RB1 A;  3S8P A;  3W6V A;  5D5U B;  2O7O A;  1O57 A;  3FXO A;  3M7G A;  2CRG A;  4S04 A;  2LDU A;  1UCR A;  3ZN1 A;  3J80 K;  1FSH A;  3K70 D;  2XAJ A;  2VOP A;  1JUM A;  2A6T A;  2GLO A;  2L4A A;  2V1N A;  2QQ9 A;  4XR6 A;  4XON A;  1J75 A;  1RKW A;  3VYT B;  2R5Z A;  1B8I B;  3VEP A;  4EJW A;  2ISZ A;  2L01 A;  2IBD A;  1HSJ A;  2BGC A;  3OOP A;  3FXL A;  2M1B A;  2OBP A;  4D5F A;  2Y75 A;  4MIM A;  4RGR A;  5HS8 A;  2QKL B;  3HOT A;  1EV7 A;  3H3Z A;  4N4O B;  2YUS A;  4DYQ A;  1YIT I;  3NWT A;  1JKO C;  2ADU A;  1ETY A;  5J6X A;  1H9T A;  3I0T A;  1Z77 A;  4ETS A;  1W5C C;  1UJ8 A;  1ZQ3 P;  2PBI A;  2LNB A;  5LFA A;  1FOY A;  2DA6 A;  4LOC A;  3ZRG A;  2A6H F;  1D1B A;  2V9V A;  2M0M A;  5FLX Z;  1HW2 A;  1MMS A;  1LUJ B;  2HQR A;  3E1S A;  2CQN A;  3V4G A;  3KP4 A;  1TQI A;  4A0Y A;  2WC2 A;  1QRY A;  1DPU A;  2EQR A;  2CV2 A;  2F4M B;  1K4T A;  2DMP A;  5BMZ A;  1T08 B;  2DMU A;  3GLX A;  2X85 A;  4MTE A;  4JOM A;  2QUF A;  3F8B A;  3RPU A;  5CPR B;  2E2H J;  1IN8 A;  1P92 A;  1ZN2 A;  2ESH A;  1KU3 A;  5D5V B;  2PG4 A;  3DQV C;  4I98 B;  1JT0 A;  2H94 A;  1WZ2 A;  1IN6 A;  3OSF A;  4HV5 A;  4NNJ A;  4WF2 A;  5E3L A;  4F93 B;  1J2X A;  3HGG A;  2PQ8 A;  3BTL A;  3IKT A;  1G2H A;  3ZQI A;  3ZQ7 A;  3CD6 I;  4WWC A;  2L0K A;  3A0H C;  4KT5 C;  4M6X A;  4CGZ A;  5LGU A;  3BY6 A;  2F5D A;  3MAJ A;  3CES A;  1W36 C;  5FD5 A;  1G6N A;  4HNT A;  2EIN H;  4WX9 A;  1HQC A;  4BYY A;  1MNE A;  2KP6 A;  3W2W A;  3COA C;  4F7Z A;  1LDK B;  1ZHF A;  2EZH A;  1YX5 A;  5HNF A;  3S1Q J;  1FMV A;  3MKW B;  2GOM A;  1G8X A;  4HX4 A;  1TT0 A;  1V4R A;  1Y39 A;  3VSK A;  2STW A;  1FLI A;  4V19 K;  2DN0 A;  2DO7 A;  3E0J B;  2F5C A;  4DJA A;  2LKX A;  1BR2 A;  3RCO A;  4XN3 A;  3KYL A;  1IRF A;  4IHX A;  4CIC A;  4ASN A;  4A3D J;  1D1C A;  2ZXW H;  2KJC A;  2QF7 A;  5JFR A;  5LD2 C;  1BI1 A;  2X1E A;  2ECC A;  5IT9 K;  3CQZ J;  2PI0 A;  2DA7 A;  5GP9 A;  3ECO A;  2EIK H;  2AS5 F;  3LSK A;  2HWV A;  1K78 B;  2TDX A;  3ZQG A;  3ZQH A;  2KMU A;  2NS0 A;  2WAQ A;  3SHF A;  1AA7 A;  2Z33 A;  2Z3Y A;  4WK8 F;  2TRT A;  3WHC A;  4AU7 A;  2XF7 A;  3KLN A;  4B09 A;  3CME I;  3ABL H;  2DXI A;  1D0X A;  1JUS A;  1JKQ C;  1MJ9 A;  2L4M A;  5K7Z A;  1P7I A;  2ESN A;  2EJR A;  5IYB J;  2HZT A;  2V4J C;  1UZC A;  4KFC A;  4LB6 B;  2ZSI B;  4GDF A;  5HDN A;  4U7B A;  3S1M J;  4M73 A;  3C18 A;  2HFH A;  2O6G E;  4PJM A;  3RYP A;  2BY1 A;  3DU5 A;  1HA8 A;  9ANT A;  4D5C A;  2HOT A;  4IXA A;  1KQ9 A;  1XSD A;  2IGN A;  2FE3 A;  1YG2 A;  5E18 F;  1PJR A;  2KIM A;  3BWG A;  1ETW A;  4AYB A;  3GLL A;  2D1H A;  5AIP A;  3JRI A;  4BE2 A;  2K7L A;  1Z1D A;  1X2M A;  1FMW A;  1EA3 A;  3E97 A;  1YIO A;  5HLH A;  1ZRC A;  3MKL A;  1R9T J;  1X19 A;  1FP1 D;  3BLY A;  5FD6 A;  2Y0S N;  4BEH B;  1U5T C;  5B1A H;  2M4K A;  4BXX J;  1TWC J;  2R7F A;  5HVQ C;  3T1B A;  1TT5 B;  1XPX A;  4FET A;  3GX4 X;  1ZG5 A;  4ZZL A;  1BC7 C;  2DMQ A;  5AON A;  1RRJ A;  3W2A A;  3E6B A;  4PJJ A;  1IXS B;  1AOY A;  3OIP A;  1I39 A;  2E7W A;  3VOD A;  4ENN A;  1BA5 A;  2O3F A;  3EPZ A;  2JUC A;  2Y30 A;  1QBJ A;  1SC7 A;  4CCJ A;  5L3C A;  3W3C A;  2H27 A;  4XM3 A;  3F0C A;  1SAU A;  2FSW A;  2EH3 A;  3D0S A;  1VQL I;  2AQF A;  2LY1 A;  3BR6 A;  2L2O A;  2EIJ H;  2VC1 A;  3OYK A;  5F64 A;  2ZNZ A;  2M8G X;  1FJL A;  4YIR X;  2IGM A;  1I6H J;  3SQN A;  5LGN A;  3IWF A;  2W84 A;  3S15 J;  2VIX A;  3FXR A;  2K9M A;  3E5Q A;  3HOS A;  2JA2 A;  4L9N A;  2QVO A;  3RKQ A;  1Z3X A;  5FFZ A;  2WB1 N;  3HIF A;  3RZO J;  4C30 A;  1TNT A;  1YS7 A;  2F4O B;  4XSZ F;  1OYY A;  2IT0 A;  2Q0O A;  3RTR A;  1RET A;  3RDI A;  3BQZ A;  3GVA A;  4LK0 F;  1J5Y A;  2FF4 A;  2CGP A;  2ZJR F;  4HDV A;  3TL4 X;  5B66 C;  2C6Y A;  4AD9 A;  4BDZ A;  2ZC2 A;  1PVE A;  2PMU A;  4XLP F;  5JI6 A;  1S8N A;  3BR0 A;  4BH9 A;  1IDZ A;  2YPR A;  4EJV A;  1IV6 A;  2ELH A;  3OYG A;  1IW7 F;  1IRG A;  3KIO A;  2MA3 A;  2AXT C;  1MMG A;  1E2X A;  1K7A A;  1WQ2 A;  1IN4 A;  4HA8 A;  2N8G A;  1FYM A;  2GXG A;  2JA6 J;  1X1C A;  1KQ0 A;  4I76 A;  4BL0 B;  4YII A;  3JTG A;  2Y9Z A;  1E3P A;  4CYC A;  3I5U A;  2F5F A;  2STT A;  1VQ5 I;  2VON A;  4A3M J;  1MSE C;  4BQA A;  3FZV A;  1R7J A;  1M1E B;  2XPW A;  4E4H A;  1V5F A;  4Z2Y A;  5AIQ A;  2X48 A;  4OIO F;  3DU6 A;  3OY9 A;  1TWG J;  3QYE A;  1WHU A;  2MSY A;  4XKC A;  2E1N A;  2K9S A;  2V9K A;  1DUX C;  3J81 Z;  4NQW B;  4CCO A;  1OCZ H;  2O8X A;  1BW6 A;  2CQK A;  3DKY A;  3ELK A;  2EFW A;  1AWC A;  3KYD B;  2QLZ A;  3HL2 A;  4JBA A;  3G4S I;  3SDB A;  1R6R A;  3F21 A;  5K7F A;  2TCT A;  1YJW I;  4IL6 C;  3PFY A;  3OYH A;  4DQ2 A;  3M8J A;  2JK3 A;  2ZME A;  3CUQ A;  1JGS A;  1H0M A;  1FZP B;  1XG1 A;  2Q8K A;  2ZJP F;  2NVQ J;  1OPC A;  3I56 I;  4LG0 B;  3FF5 A;  1IRZ A;  2VE8 A;  1R1T A;  3HEF A;  1YTY A;  2R7Z J;  2HVR A;  3K1P A;  1ZK8 A;  4M74 A;  1FBS A;  2O61 A;  3TDU C;  3ZQC A;  3OOU A;  5EGO A;  2X6O A;  2LMD A;  4C2T A;  3H3V K;  5H2F C;  4PFO A;  3BR2 A;  1RNL A;  1X1A A;  3C2B A;  4P96 A;  2NOJ B;  1G4D A;  5B5E C;  2P6T A;  4MLO A;  4CZC A;  3CDH A;  4HX8 A;  3H0D A;  5ILS A;  2R7D A;  3CCJ I;  1U9N A;  1PUF A;  4HQE A;  2W48 A;  5CKT A;  5CYV A;  3GTP J;  1QPI A;  2K86 A;  3PQJ A;  4L0Y B;  2HGC A;  2X1C A;  2LD5 A;  5M5W J;  3KZZ A;  3PFI A;  3M4O J;  1R4N B;  2Y9Y A;  4BQN A;  5H20 A;  4KYW A;  1SVM A;  4LFU A;  1ZLJ A;  3H5N A;  5CQG A;  3M8F A;  3DPU A;  1OCT C;  1DU6 A;  3K1M A;  3I4M J;  3ZMS A;  2OUM A;  1QVU A;  2LF8 A;  2YX7 A;  4IQ4 A;  4AM3 A;  4M6V A;  1HDD C;  3OIO A;  3A01 B;  2CFO A;  3RZD J;  2Z5U A;  4M9Z A;  1KYZ A;  1O3Q A;  2XF6 A;  4HF2 A;  3GZN B;  4YG2 F;  4A69 C;  1LVA A;  4NUB A;  3JR9 A;  3TOB A;  1H88 C;  4KJZ A;  3OYF A;  4HZF A;  4XOT A;  3LAJ A;  2AHQ A;  3HRS A;  1YE9 A;  1LPQ A;  5CQE A;  1U0J A;  2VPR A;  4YFN F;  3OYM A;  1W4M A;  2KIF A;  1K79 A;  2QBY B;  2CQ7 A;  2HZD A;  1I1S A;  4PCQ A;  1P9Q C;  4GXO A;  4A3E J;  5JLX A;  1LVK A;  2JPB A;  5E1Z B;  4XQF A;  2AXL A;  4U0V A;  2Z9O A;  5BNG A;  4JP0 A;  5JR3 A;  3QYB A;  1LNW A;  2CUE A;  5LBQ A;  3BG9 A;  4B44 A;  1MND A;  1MH3 A;  2PFB A;  2QM3 A;  3OMY A;  2LR8 A;  5D6E A;  1FC3 A;  4G6T B;  2UUZ A;  2H1K A;  1XC5 A;  4C3I J;  1QPM A;  1FY7 A;  3WG9 A;  4ZYE A;  4GGG A;  1OFC X;  2M5W A;  1NK3 P;  1W7P A;  4UV9 A;  5LHH A;  3K4K A;  1HDP A;  2IAI A;  3F72 A;  2YS9 A;  1TZL A;  4MFE A;  3T8T A;  1D0Z A;  4B47 A;  4MFD A;  4OWR B;  2XSD C;  4Y13 A;  2H8R A;  2UXN A;  1WI3 A;  4KA4 A;  2Q1Z B;  2DQR A;  2DK5 A;  3FXJ A;  3FBN B;  4BHB A;  3J80 Z;  2DPD A;  2VKV A;  4ZDP A;  4A12 A;  2JA7 J;  3R4K A;  2H09 A;  3ABT A;  3DTI A;  4Q5S F;  1XTA A;  1R36 A;  2MGQ A;  1N78 A;  5BQT A;  2LKS A;  1P7J A;  2F2E A;  5IOZ A;  2GA1 A;  3EDP A;  5ED4 A;  3JRG A;  1VQ4 I;  1VQN I;  3O8H A;  2ZME C;  3CUQ C;  4O3M A;  3BPX A;  4OOI A;  2VJ4 A;  1UAA A;  1V3F A;  2HKX A;  1YRN B;  1Y1V J;  2XAG A;  4TV7 A;  1B8I A;  1R00 A;  4YRV A;  2CS3 A;  2BVL A;  2QEX I;  1T8I A;  4IX7 A;  2PJP A;  4RAZ A;  3PM1 A;  2HEO A;  5EYR A;  4C2M J;  2KIQ A;  3PUB A;  1EH8 A;  4OMZ A;  4NC7 A;  2VBW A;  1F36 A;  4QPQ A;  1MBK A;  5KCM A;  2OAZ A;  1HKQ A;  2IW5 A;  4A6D A;  1ETK A;  1ACI A;  1U9O A;  2X0L A;  3G73 A;  4AIH A;  3I53 A;  3JRA A;  4HF1 A;  4OIQ F;  1GVD A;  3HRU A;  1TQP A;  2EA2 A;  3CMM A;  2IA0 A;  3OS1 A;  3KP7 A;  5E17 F;  1UFM A;  1FBQ A;  3GBG A;  3F9K A;  3L1P A;  1KQ8 A;  3OS2 A;  3O6B B;  4G94 A;  4ZH4 F;  3HHG A;  3OR2 C;  3DLA A;  4ZDO A;  1XCB A;  1Y8Q B;  4G7Z F;  4A3I J;  1T56 A;  2EB7 A;  3V7S A;  4ZJZ A;  4JK1 X;  3AG1 H;  3SYT A;  2IXS A;  2WV1 A;  3DFG A;  4LG3 A;  4MEX F;  3L7W A;  1ZYR F;  4KIB A;  3BR1 A;  2K9N A;  2QSF X;  3EET A;  1U8B A;  4IEJ A;  3H36 A;  4IHT A;  5FRO A;  5D5W B;  3RI4 A;  2F6C A;  2JPC A;  2X6Y A;  2HKO A;  3GFI A;  2DOD A;  4Y4R A;  3WTS C;  2DLL A;  1Z9C A;  2O03 A;  1SD5 A;  5LHG A;  2V79 A;  1SFE A;  3R0A A;  4N9H A;  2BBY A;  4AVZ A;  1I6X A;  4CO8 A;  4BNC A;  2JSP A;  5FRN A;  4BE0 A;  1MBE A;  1ZRF A;  5L3G A;  1O3R A;  3TOA A;  4I0A A;  3FIS A;  1ZG3 A;  4L9J A;  2A5W A;  3GTO J;  2IA2 A;  2DDA A;  1I1G A;  1MBH A;  2O0Y A;  4MHG A;  4FAS D;  2QSG X;  3NRV A;  2RGV A;  2XRL A;  3E5U A;  4DIQ A;  1FP2 A;  3MKZ A;  3I59 B;  1RUN A;  3KP5 A;  4NBQ A;  3F6V A;  1W0T A;  3QWL A;  1OYW A;  3D5R C;  5HDG A;  1R1V A;  1UG2 A;  3HTS B;  1LDJ A;  1XMX A;  5GAG J;  3IHU A;  1MNM C;  1YO5 C;  5IT9 Z;  2W7N A;  1KZH A;  4OAZ A;  2HR3 A;  2HPM A;  1WJE A;  3G1O A;  3U21 A;  1J0R A;  1QHH D;  2K4B A;  3BCA A;  4JYK A;  4E7J A;  2V6C A;  2IA1 A;  4ANJ A;  2CFX A;  4Q4Z F;  2EPF A;  3ASO H;  4HRI A;  1WVR A;  1XGN A;  1E3H A;  3TKY A;  2HPI A;  3DBL B;  5J4V A;  2K40 A;  1B9M A;  3G71 I;  2CJJ A;  4PSX A;  4D7M A;  3K4B A;  5M5X J;  2FU4 A;  2GBY A;  4RAF A;  3OR1 C;  1ETQ A;  3H9G A;  1K78 A;  2IVM A;  3JRB A;  1MMD A;  2DMN A;  1LDD A;  2G7U A;  3ECH A;  4CHU A;  2CO5 A;  2X1D A;  2Y2Z A;  1XSV A;  3PNT A;  3CF5 F;  2CQQ A;  1IG7 A;  2KDO A;  1N77 A;  1ETX A;  2XAU A;  1T95 A;  1V5G A;  3PUF A;  4BQO A;  1VQO I;  2W00 A;  5TGT A;  2MLG A;  1SMT A;  4Y3O A;  3KX2 A;  2HVQ A;  3I55 I;  5F08 A;  5E1W A;  2IS6 A;  2VQH A;  3OYI A;  2JSC A;  4QPO A;  5IYD J;  2H8W A;  1Q1V A;  1YOV B;  4L0Z B;  3TBI A;  3RJP A;  4EEF G;  4OU0 A;  3J7Y J; 
#chains in the Genus database with same CATH homology
 2K02 A;  2DBB A;  5DYM A;  1GXP A;  2KRF A;  3KP6 A;  3K2Z A;  3EQL F;  3KEQ A;  4PZJ A;  2VT3 A;  4N0B A;  2IRF G;  1S7A A;  1FYK A;  5EEG A;  1Q1H A;  2W24 A;  2V1D A;  5CVR A;  1P4W A;  1U78 A;  5BPD A;  3WTV C;  5K1Y A;  3MEX A;  1MD0 A;  5KVR A;  4LD5 A;  1T2K A;  3QRF F;  1LEB A;  2RN7 A;  1U5T A;  4UXN A;  1ZAR A;  2COM A;  4EVI A;  1YS6 A;  3DEU A;  2W85 A;  3LA3 A;  3CJN A;  1SD7 A;  2P4W A;  1T0F A;  5E8G A;  2DK8 A;  4IRH A;  4H0E A;  1SMY F;  3BJO A;  5LEK A;  4YFK F;  4Y17 A;  3SXY A;  3I58 A;  2D1V A;  1F1Z A;  3FXU A;  1W7P D;  2NAZ A;  2UZK A;  2M8E A;  3ULQ B;  3WE2 A;  4G6Q A;  3DP7 A;  1FX7 A;  4HYE A;  5DUK A;  3AAF A;  4P5O A;  2DAO A;  4RGU A;  5ICF A;  3E3V A;  1FT9 A;  2ETH A;  3KLO A;  1ZGJ A;  1FBU A;  2MLK A;  5KK1 A;  4O6J A;  3GEZ A;  4LLL A;  1W5S A;  1OYI A;  5CVV A;  1RI7 A;  4I2O A;  2MH2 A;  2QQA A;  2EV6 A;  3JAM K;  1J7K A;  1LB2 A;  4BHC A;  1JHF A;  1REP C;  2A5Y B;  2RV8 A;  2XKP A;  4P9U A;  4CXF A;  1BIA A;  1I5Z A;  3BJA A;  3RKX A;  4LG0 A;  2E7X A;  3QU6 A;  4HW0 A;  3JW4 A;  3EUH A;  2FMY A;  4UVC A;  4MEY F;  1S7O A;  2LF7 A;  5DV5 A;  1HW1 A;  5D4R A;  1U6G A;  1BN5 A;  4R79 A;  4EM2 A;  1EH6 A;  1B1B A;  2MC3 A;  1MJA A;  4L5I A;  2J5O A;  1XN7 A;  5LRR A;  5BOX A;  2A3S A;  1IUY A;  3IRQ A;  2UWM A;  5LGT A;  2NNN A;  4AIJ A;  5HDK A;  3B73 A;  4M72 A;  1P6R A;  3D5L A;  1O7L A;  2KKO A;  4WXH A;  3FWE A;  3MWM A;  5D8L B;  4BHP A;  3IWZ A;  4HQM A;  4LLG F;  4A5M A;  3L2C A;  4L9V A;  2EFP A;  2KJB A;  2QYO A;  4MQV A;  4WCG A;  4HLY A;  5DEQ A;  3LA7 A;  1D8J A;  2QBY A;  2HQN A;  5CVI A;  5LHI A;  1BI0 A;  2DPU A;  3T0Y A;  3NQO A;  1D5V A;  3BP8 A;  2OQR A;  4I01 A;  2A07 F;  5FGM A;  5EEH A;  3V7C A;  1YW8 A;  4EV0 A;  5D4S A;  2FEZ A;  1R22 A;  3VOE A;  4G7O F;  3WOD F;  1XMK A;  3IKV A;  1ZRE A;  5JVT A;  2EA4 A;  3RPQ A;  4CZZ A;  2XAF A;  2EV5 A;  3DPT A;  2YX4 A;  1USS A;  4P55 A;  2H6C A;  3KFW X;  3CUO A;  1BOA A;  1ZLK A;  2GWR A;  2WV0 A;  1KYW A;  5LRS A;  2G9W A;  2GIV A;  2WWY A;  2OU2 A;  3KCC A;  5CJ9 A;  2EFQ A;  1LQ1 A;  2ZFW A;  4ESB A;  4UNO A;  1GVJ A;  6PAX A;  3GYH X;  4XLN F;  3WTX C;  3M1E A;  3CO7 C;  2W25 A;  1KU2 A;  2ZCW A;  4M71 A;  1J9I A;  2Y0M A;  3K9T A;  4RGX A;  2HYG D;  3SZT A;  4A2U A;  4OIN F;  3K69 A;  1H9G A;  3GFM A;  1B4A A;  2Q2E A;  3WTZ A;  2PEX A;  1DP7 P;  1R5G A;  2JTV A;  3BRO A;  2R3S A;  3MCZ A;  1T98 A;  5DCM B;  3MZY A;  2BEO A;  3F23 A;  4PGH A;  3M9A A;  4XBF A;  1TW2 A;  1SD4 A;  2P5V A;  4L9T A;  4R1H A;  4KUM A;  2QZ8 A;  5ICC A;  2ZKZ A;  1O7F A;  3ABU A;  3WTT C;  2V1X A;  4WXC A;  2EWN A;  4G9Y A;  4L18 B;  3P9C A;  1KGS A;  1R23 A;  3SFZ A;  4EGZ A;  2NYX A;  4DNC A;  1MGT A;  3F8N A;  4KN7 X;  3I59 A;  4ENJ A;  4Y15 A;  3SZP A;  2K4J A;  5CVJ A;  4HLX A;  3E6M A;  2P6S A;  3GXO A;  1UST A;  3FM5 A;  3WTU C;  4EMS A;  3MFK A;  3FHZ A;  3I64 A;  3H92 A;  1XGS A;  2P5K A;  4LMY A;  2D2W A;  5FB2 A;  3O3K A;  3S2W A;  4YFX F;  1T6S A;  4KMU X;  1I27 A;  1O3S A;  5LLQ A;  4R8H A;  3CO6 C;  5CVU A;  1IN5 A;  1QZY A;  3CLO A;  3KET A;  1E17 A;  1XDS A;  1G3Y A;  2CWE A;  1RIO H;  4GCV A;  2L3D A;  1YLF A;  4ENK A;  1B9N A;  4FHT A;  4IJA A;  2RVC A;  2EV0 A;  4P9F A;  1GXQ A;  4B8X A;  3M8E A;  3MZH A;  4N9I A;  5HLI A;  2VOD A;  3R61 A;  3TQN A;  2DU9 A;  1ZGA A;  5L3B A;  4RB2 C;  1F4K A;  1XCV A;  5L3E A;  1BJA A;  4GYI A;  3U2R A;  1C0W A;  3N4M A;  1YW7 A;  2H6B A;  3ZMD A;  4HOB A;  1U3E M;  2HS5 A;  4LK1 F;  2FQ3 A;  2OA4 A;  3P9I A;  4I02 A;  5E20 A;  1B59 A;  4A6E A;  3FMR A;  4KN4 X;  4GO1 A;  5F1R A;  4U7D A;  2NRA C;  3DV8 A;  3FMS A;  1TQM A;  3W6K B;  2XAS A;  3MQ0 A;  3WTY C;  3HTU A;  2IP2 A;  3KP2 A;  3Q9S A;  2V1U A;  1HBX G;  3L00 A;  1S29 A;  2RKH A;  1QGP A;  3FX3 A;  4RB3 C;  2FOK A;  2VBX A;  4XRF A;  3BPV A;  3HYI A;  5DD4 A;  3ZPL A;  1L3L A;  4EJO A;  3VB2 A;  2LSO A;  2VBZ A;  3TO7 A;  2MBF A;  1ONV A;  1BI2 A;  3I71 A;  4M9X A;  2FNP A;  3KE2 A;  3NEU A;  5H6R A;  4M6Y A;  1KA8 A;  1IN7 A;  2QEN A;  4CYD A;  4OMY A;  3FM3 A;  1YYV A;  2FRH A;  3F6O A;  4HAM A;  4LGW A;  4IF4 A;  5A2Q Z;  1MDM B;  3JAM Z;  2P7V B;  3O2P E;  1OMI A;  3KEO A;  2FNA A;  2MD5 A;  5K5O A;  1F5T A;  4WXD A;  3I54 A;  4MNU A;  5L3D A;  1TNS A;  5FO5 A;  3ERE D;  2Y48 A;  5TJJ A;  1W7P B;  2JRT A;  2YR2 A;  3LFK A;  1FSE A;  1G3W A;  2OQG A;  3JSO A;  3W6J B;  1TTY A;  3TGN A;  1TW3 A;  3U1D A;  2PLY A;  4QLC U;  1JHH A;  2PMH A;  4IRG A;  4EJT A;  4G6D A;  2P5L C;  3P7N A;  3TDZ C;  3K0L A;  1G3S A;  1PDN C;  5D8K B;  5H6Q A;  5J8C A;  3GF2 A;  2CG4 A;  5HS9 A;  2DFI A;  1ULY A;  1WRJ A;  3DF8 A;  3FMQ A;  4NB5 A;  2XRO A;  3BJ6 A;  1WWX A;  3GFJ A;  2GQQ A;  4KIF A;  3K1N A;  4LLN A;  4UV8 A;  3QP5 A;  4Q47 A;  3V8J A;  2HTJ A;  4KMF A;  4PDK A;  4AVP A;  3U9G A;  1Z91 A;  3WGI A;  1BIB A;  2DT5 A;  1CF7 B;  4O5V A;  1WSU A;  4AIK A;  4KIC A;  3VFZ A;  2NNY A;  4E70 A;  1FYL A;  4HDU A;  1HXD A;  3JTH A;  2CYY A;  2Z99 A;  1SFU A;  1Y0U A;  2FXA A;  2RQP A;  1R5H A;  1FOK A;  4G7H F;  5J8F A;  4ZYG A;  2XUB A;  3F22 A;  1LEA A;  5ILV A;  1ZAO A;  4RAY A;  2BYV E;  4KIG A;  2DW4 A;  3QPH A;  3ZMZ A;  3JSP A;  1ON1 A;  4ZYH A;  2QWW A;  1RZ4 A;  3F8F A;  4UUV A;  2XKO A;  2GA2 A;  4IPA A;  3CTA A;  3IL2 A;  3HRT A;  5TRD A;  2IPQ X;  2RNJ A;  2X4H A;  2FBI A;  1A04 A;  1T38 A;  2HOE A;  2VOO A;  1B6A A;  5A2Q K;  4NQW A;  4UVB A;  4HBL A;  3C1D A;  3EYI A;  3TO9 A;  2DTR A;  2IJL A;  5F6F A;  4PGG A;  2DQL A;  3RIR A;  2M30 A;  1IXC A;  4U0W A;  4LJZ F;  3DXJ F;  2A6E F;  5HS7 A;  4FT8 A;  3F8M A;  3QP6 A;  1T39 A;  2VC0 A;  2XV4 S;  4RS8 A;  2EFN A;  1P2F A;  3IRR A;  5DCM A;  1IZ1 A;  1UHW A;  3LST A;  1OR7 A;  2OD5 A;  1P4A A;  4EM0 B;  3ZMT A;  3ZMU A;  4IHS A;  3Q9V A;  4QWQ A;  3V7R A;  3IC7 A;  2JT1 A;  1YFH A;  4BXU A;  2RDP A;  3GZ5 A;  3HSF A;  1ZG1 A;  4A0Z A;  1ON2 A;  1NHA A;  4YIF A;  1ZH5 A;  1UB9 A;  1QNT A;  2CW0 F;  3HSR A;  4EJU A;  2A61 A;  4A5N A;  1XB4 A;  5LEJ A;  1JE8 A;  5K5R A;  1U5T B;  3REO A;  5FLX K;  1ZRD A;  4U0Y A;  1TLH B;  2XHK A;  4EM1 A;  4LB5 A;  1ODD A;  3V8L A;  2OZ6 A;  3F3X A;  1GHC A;  4NHJ A;  2ZO4 A;  1P4X A;  2VBY A;  3GZ6 A;  3TO6 A;  3LQQ A;  3ZP5 A;  2YSR A;  1HKT A;  4RB0 A;  2MH9 A;  1S3J A;  1STZ A;  1WKM A;  4EGY A;  2EFO A;  4FX4 A;  2HYF A;  4OIP F;  2HDC A;  2FA5 A;  2BE5 F;  3V8K A;  3R60 A;  1UHM A;  2W57 A;  4MTD A;  3RYR A;  2KIU A;  3GW2 A;  3WE3 A;  1DDN A;  1BC8 C;  1SD6 A;  4G8X A;  4U88 A;  4KDP A;  1DPR A;  3E5X A;  4K2E A;  2A68 F;  3PQK A;  3J7A O;  2OZU A;  1F9N A;  4FX0 A;  5ICG A;  2PN6 A;  2ZJ2 A;  1VTN C;  1JXS A;  1R58 A;  3LWF A;  5JHU A;  1K6O A;  1BBY A;  4HF0 A;  3DPL C;  5HOO A;  2HTS A;  5HLG A;  1Z6T A;  3GUD A;  3WU1 B;  5K5Q A;  2XGX A;  3E6C C;  3WGH A;  3BOQ A;  1BI3 A;  2GXB A;  2F5E A;  1PUE E;  2XAQ A;  2BV6 A;  2JZY A;  2DI3 A;  1XSX A;  3QPT A;  3RKY A;  4IRI A;  3FXQ A;  1XGM A;  5E8I A;  5BS6 A;  5CLS A;  1XMA A;  1YW9 A;  3ML6 A;  3ZMV A;  2GAU A;  2P8T A;  3P9K A;  4XSX F;  3QU3 A;  3RKW A;  4AWX B;  3QAH A;  3E6D A;  1D8K A;  2ISY A;  1Z6R A;  1SFX A;  3HRM A;  5DUI A;  2A69 F;  2M45 A;  1IXR C;  5D5X B;  5DCF A;  4RGS A;  3HUG A;  2VN2 A;  2FBK A;  2K27 A;  4JQF A;  1WI9 A;  1FPQ A;  2YU3 A;  3ISP A;  4ESJ A;  1D3Y A;  1MKM A;  1HST A;  1QO0 D;  1U8R A;  3I4P A;  1Z05 A;  3OV8 A;  1MDM A;  3LAP A;  4I0B A;  5ILU A;  3ROU A;  3GO5 A;  1MJB A;  3KZY A;  3L09 A;  1IAW A;  2ZXJ A;  4UHT A;  1EH7 A;  3WU0 A;  5D6F A;  1W5T A;  3LQR A;  3ZN0 A;  1KU9 A;  2FML A;  4HV6 A;  4HX7 A;  1FNN A;  2VE9 A;  5DDG A;  5ERI A;  1S6L A;  1PP7 U;  4A0X A;  4D0P A;  2XRN A;  1QQI A;  2XAH A;  2B0L A;  1L0O C;  4ENM A;  1XGO A;  1RUO A;  4OIR F;  3R0J A;  1CGP A;  4EQQ A;  2WTE A;  3N97 A;  4ESF A;  1QZZ A;  1HKS A;  2QQB A;  5DD8 A;  2E1C A;  2VT2 A;  2ZME B;  3CUQ B;  4ZYD A;  4CDG A;  3J81 K;  4I09 A;  4UVA A;  4ZZD A;  1BM9 A;  4MQ9 F;  1X3U A;  1SAX A;  1XD7 A;  1CF7 A;  3H3U A;  2CSO A;  1FWZ A;  3C7J A;  1Z7U A;  4S05 A;  3BDD A;  4L5J A;  4ON0 A;  2XIG A;  1PP8 F;  2VXZ A;  5BPI A;  2L54 A;  2ACJ A;  2P7C B;  4Q48 A;  4BAY A;  3F8C A;  3BZ6 A;  3HHH A;  1O3T A;  2RC4 A;  4I7H A;  5IT3 A;  4MGR A;  1YQA A;  2D45 A;  3QOP A;  3DKW A;  4IVN A;  3EYY A;  2ZNY A;  3C3W A;  1KU7 A;  1XDU A;  2M87 A;  2ZBK A;  1R1U A;  3B02 A;  1J59 A;  2FBH A;  3Q5F A;  2UXX A;  1IF1 A;  1MZB A;  2L02 A;  3HSE A;  4GYG A;  1OKR A;  2EK5 A;  3R6S A;  4KNY A;  3WTW C;  3WGG A;  2LKP A;  5E1X A;  4M9S A;  1TBX A;  5L3F A;  1HW5 A;  3GFL A;  2J5P A;  3LA2 A;  5ICE A;  3GWZ A;  3T5X A;  2GZW A;  5FFX A;  1G3T A;  2XVC A;  3L9F A;  1U2W A;  3G3Z A;  2G7H A;  3KP3 A;  1LJ9 A;  3T8R A;  4RB1 A;  5D5U B;  1O57 A;  3M7G A;  4S04 A;  2LDU A;  1UCR A;  3ZN1 A;  3J80 K;  1FSH A;  2XAJ A;  2VOP A;  2L4A A;  2QQ9 A;  1J75 A;  3VEP A;  4EJW A;  2ISZ A;  2L01 A;  1HSJ A;  2BGC A;  3OOP A;  2M1B A;  2OBP A;  2Y75 A;  4RGR A;  5HS8 A;  3HOT A;  1EV7 A;  3H3Z A;  2ADU A;  5J6X A;  1H9T A;  3I0T A;  4ETS A;  2PBI A;  2LNB A;  2A6H F;  2V9V A;  5FLX Z;  1HW2 A;  2HQR A;  3V4G A;  3KP4 A;  1TQI A;  4A0Y A;  2WC2 A;  1DPU A;  5BMZ A;  3GLX A;  4MTE A;  2QUF A;  3F8B A;  3RPU A;  1IN8 A;  1P92 A;  2ESH A;  1ZN2 A;  1KU3 A;  5D5V B;  2PG4 A;  3DQV C;  4I98 B;  2H94 A;  1IN6 A;  4HV5 A;  4WF2 A;  1J2X A;  2PQ8 A;  3IKT A;  3ZQ7 A;  4WWC A;  4KT5 C;  4M6X A;  4CGZ A;  5LGU A;  3BY6 A;  2F5D A;  3MAJ A;  5FD5 A;  1G6N A;  4WX9 A;  1HQC A;  4BYY A;  3COA C;  4F7Z A;  1LDK B;  1ZHF A;  4HX4 A;  1V4R A;  2STW A;  1FLI A;  2DO7 A;  2F5C A;  1IRF A;  4CIC A;  4ASN A;  2KJC A;  5JFR A;  1BI1 A;  5IT9 K;  2PI0 A;  3ECO A;  2AS5 F;  2HWV A;  1K78 B;  2TDX A;  2NS0 A;  3SHF A;  2Z33 A;  2Z3Y A;  4WK8 F;  3KLN A;  4B09 A;  1MJ9 A;  2L4M A;  2ESN A;  2EJR A;  2HZT A;  4KFC A;  4LB6 B;  5HDN A;  4U7B A;  4M73 A;  3C18 A;  2HFH A;  2O6G E;  3RYP A;  4IXA A;  1KQ9 A;  1XSD A;  2FE3 A;  1YG2 A;  5E18 F;  2KIM A;  3BWG A;  2D1H A;  5AIP A;  2K7L A;  1Z1D A;  3E97 A;  1YIO A;  5HLH A;  1ZRC A;  1FP1 D;  5FD6 A;  1U5T C;  2R7F A;  5HVQ C;  3T1B A;  3GX4 X;  1ZG5 A;  4ZZL A;  1BC7 C;  5AON A;  3E6B A;  1IXS B;  1AOY A;  2E7W A;  3VOD A;  4ENN A;  2O3F A;  1QBJ A;  5L3C A;  2H27 A;  2FSW A;  3D0S A;  2VC1 A;  5F64 A;  2ZNZ A;  3SQN A;  5LGN A;  3IWF A;  2W84 A;  3FXR A;  3E5Q A;  3HOS A;  4L9N A;  2QVO A;  5FFZ A;  3HIF A;  1TNT A;  1YS7 A;  4XSZ F;  1OYY A;  2IT0 A;  2Q0O A;  3RTR A;  3RDI A;  3GVA A;  4LK0 F;  1J5Y A;  2FF4 A;  2CGP A;  4HDV A;  2C6Y A;  4AD9 A;  2PMU A;  4XLP F;  5JI6 A;  1S8N A;  4BH9 A;  2YPR A;  4EJV A;  2ELH A;  1IW7 F;  1IRG A;  2MA3 A;  1E2X A;  1K7A A;  1WQ2 A;  1IN4 A;  4HA8 A;  1FYM A;  2GXG A;  1KQ0 A;  4YII A;  3JTG A;  3I5U A;  2F5F A;  2STT A;  2VON A;  4BQA A;  3FZV A;  1R7J A;  4Z2Y A;  5AIQ A;  4OIO F;  2E1N A;  1DUX C;  3J81 Z;  2O8X A;  2CQK A;  3ELK A;  2EFW A;  1AWC A;  2QLZ A;  4JBA A;  3F21 A;  4DQ2 A;  2ZME A;  3CUQ A;  1JGS A;  1H0M A;  1FZP B;  2Q8K A;  1OPC A;  4LG0 B;  3FF5 A;  2VE8 A;  1R1T A;  1YTY A;  3K1P A;  4M74 A;  1FBS A;  2O61 A;  3TDU C;  1RNL A;  4P96 A;  1G4D A;  2P6T A;  3CDH A;  4HX8 A;  5ILS A;  2R7D A;  4HQE A;  5CYV A;  2K86 A;  3PQJ A;  4L0Y B;  2HGC A;  3KZZ A;  3PFI A;  5H20 A;  4KYW A;  4LFU A;  1ZLJ A;  3M8F A;  3K1M A;  3ZMS A;  2LF8 A;  2YX7 A;  2Z5U A;  4M9Z A;  1KYZ A;  1O3Q A;  4HF2 A;  4YG2 F;  1LVA A;  3TOB A;  4HZF A;  3LAJ A;  3HRS A;  4YFN F;  1W4M A;  2KIF A;  1K79 A;  2QBY B;  1I1S A;  4PCQ A;  4GXO A;  2JPB A;  5E1Z B;  2AXL A;  4U0V A;  2Z9O A;  5JR3 A;  1LNW A;  5LBQ A;  2PFB A;  2QM3 A;  5D6E A;  1FC3 A;  1QPM A;  1FY7 A;  3WG9 A;  4ZYE A;  4GGG A;  2M5W A;  1W7P A;  4UV9 A;  5LHH A;  3F72 A;  3T8T A;  4Y13 A;  2UXN A;  4KA4 A;  2DQR A;  2DK5 A;  3J80 Z;  4BHB A;  2DPD A;  4A12 A;  3R4K A;  2H09 A;  3ABT A;  4Q5S F;  1R36 A;  5BQT A;  2F2E A;  2GA1 A;  3EDP A;  5ED4 A;  3CUQ C;  4O3M A;  3BPX A;  4OOI A;  1V3F A;  2HKX A;  2XAG A;  4TV7 A;  1R00 A;  2PJP A;  4RAZ A;  2HEO A;  1EH8 A;  4OMZ A;  2VBW A;  2OAZ A;  1HKQ A;  2IW5 A;  4A6D A;  2X0L A;  3G73 A;  4HF1 A;  4AIH A;  3I53 A;  4OIQ F;  3HRU A;  1TQP A;  2EA2 A;  2IA0 A;  3KP7 A;  5E17 F;  1UFM A;  1FBQ A;  1KQ8 A;  3O6B B;  4G94 A;  4ZH4 F;  3HHG A;  1XCB A;  4G7Z F;  2EB7 A;  3V7S A;  4JK1 X;  4MEX F;  3DFG A;  3L7W A;  1ZYR F;  4KIB A;  3EET A;  4IHT A;  5D5W B;  3RI4 A;  2JPC A;  2HKO A;  3GFI A;  3WTS C;  2DLL A;  1Z9C A;  2O03 A;  1SD5 A;  5LHG A;  2V79 A;  1SFE A;  3R0A A;  4N9H A;  2BBY A;  4BNC A;  1I6X A;  4CO8 A;  1ZRF A;  5L3G A;  1O3R A;  3TOA A;  4I0A A;  4L9J A;  1ZG3 A;  2IA2 A;  1I1G A;  2O0Y A;  4MHG A;  3NRV A;  2RGV A;  3E5U A;  1FP2 A;  3I59 B;  1RUN A;  3KP5 A;  3F6V A;  1OYW A;  5HDG A;  1R1V A;  3HTS B;  1LDJ A;  3IHU A;  1YO5 C;  5IT9 Z;  2HR3 A;  1J0R A;  2K4B A;  2V6C A;  2IA1 A;  2CFX A;  4Q4Z F;  1XGN A;  3TKY A;  1B9M A;  2FU4 A;  1K78 A;  2IVM A;  1LDD A;  2G7U A;  3ECH A;  4CHU A;  2CO5 A;  1XSV A;  2MLG A;  1SMT A;  5E1W A;  2JSC A;  4L0Z B;  3RJP A;  4OU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...