3J80K

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j80K00
2M8EA 4Y15A 3P9CA 2PMHA 3TKYA 1XGNA 3TDUC 5ILUA 2XAGA 1PP8F 1BIBA 3ELKA 1XB4A 1KQ9A 4ZH4F 3IWZA 4UUVA 3RI4A 2DBBA 2RC4A 3ML6A 1O3TA 2Q2EA 2X0LA 3KP5A 5L3FA 3ZQ7A 2EA4A 3GXOA 1OKRA 1MGTA 1ZYRF 2VC1A 1LEBA 4HAMA 2Z33A 1RUOA 4S05A 1QZZA 5E1ZB 2LSOA 3AAFA 2M1BA 3CDHA 2Z9OA 1W4MA 3DPTA 2HYGD 4D0PA 1FP1D 5BOXA 1T0FA 3C1DA 2M5WA 3RKXA 1HKTA 1T98A 2IP2A 4QLCU 1I1GA 1B4AA 4MEXF 5L3EA 3DF8A 2ZO4A 4M6YA 3K1NA 2A6EF 1CF7B 1QZYA 2Z3YA 1YTYA 2XHKA 2GWRA 1YS7A 2VC0A 4ESFA 2VN2A 3IKTA 2DPDA 1CGPA 2DI3A 2EV0A 1HW2A 1KQ0A 4BQAA 2QBYA 4Y17A 1MDMA 4LFUA 4RB2C 1KA8A 3I64A 3R0JA 3QOPA 2HYFA 1XMAA 2XROA 3J81K 1ZGJA 1BI2A 4ON0A 4L18B 3HSRA 4M9SA 2O03A 4R79A 2NRAC 4RGRA 1DP7P 1U78A 1IN5A 2MD5A 2Q8KA 3K0LA 3TQNA 5DV5A 1P4AA 3N97A 3ZN1A 4B09A 4KIFA 1S7OA 2K7LA 3GO5A 3ZMTA 3KLNA 5HS8A 4HV5A 3IWFA 2EFQA 3HOTA 5HLIA 1J5YA 1O3SA 4LGWA 1JHHA 1LEAA 3I71A 2F5CA 5D8LB 3VODA 3RKYA 3GZ6A 1CF7A 3L7WA 4G9YA 4A0YA 1LVAA 1U5TA 1C0WA 2GAUA 1TLHB 2B0LA 2FEZA 1U8RA 5J6XA 1LDDA 3PQJA 3QRFF 2V9VA 1ZG5A 3DV8A 4IJAA 3BDDA 2EFPA 1VTNC 2C6YA 3WE2A 2QUFA 4I2OA 4MTEA 4Q47A 4RB0A 2OZUA 1R36A 2HS5A 1ZARA 3KETA 2GXBA 3MEXA 4IHTA 2MLKA 5L3CA 1FSHA 4WK8F 1TBXA 4ASNA 2FBIA 3EQLF 2VOPA 1REPC 2MBFA 5JHUA 2X4HA 4I0AA 2CO5A 4EM2A 2XUBA 4ENMA 2ELHA 1T39A 1U5TB 2F5EA 4KT5C 3OV8A 3EYIA 1LJ9A 3U1DA 3E5XA 3M8FA 3W6KB 1BN5A 5K5RA 5LRRA 1FNNA 3CJNA 2W85A 2CSOA 3ABTA 3C18A 3TGNA 1AWCA 3F8FA 1L3LA 3DQVC 4HF2A 4MQVA 2KJBA 3HRMA 4L0ZB 4LLGF 2KRFA 4A6EA 1H9TA 1UHWA 4XSXF 4A5NA 2HTSA 3JW4A 4FHTA 1LNWA 1ZRCA 1NHAA 3O2PE 2P5VA 5LLQA 1T38A 3GEZA 2L54A 4CHUA 1KGSA 1IXSB 3M8EA 2K86A 3CTAA 4HZFA 4I02A 5ILSA 3MFKA 3R6SA 4M74A 3DP7A 1RIOH 2K4JA 4FX4A 5CYVA 4LMYA 3F8BA 3K69A 3CUQC 3LAPA 1KYZA 3NQOA 1B9NA 1SFXA 4ZYDA 1BJAA 4M6XA 2J5OA 5AONA 3O6BB 2V1UA 3GFLA 3LWFA 2TDXA 4JBAA 2P6TA 4PCQA 2PJPA 3MZYA 1TNSA 3GUDA 4Q48A 3T8RA 2V79A 3Q9SA 4FT8A 3GFIA 4JQFA 2A68F 2ZMEB 4KYWA 4TV7A 1HSTA 4PDKA 2ZCWA 3COAC 3H3UA 4OIQF 4P9UA 3RYRA 1LDKB 2AXLA 4BHCA 2HWVA 2JPBA 2FNPA 5E17F 2P4WA 5FO5A 2P7CB 3KLOA 3B02A 1Z9CA 1AOYA 4HBLA 4RGSA 2HOEA 1SFUA 2BEOA 2LNBA 1XSDA 3FXQA 4RS8A 4BAYA 5ERIA 5L3DA 2CGPA 3I53A 5HS7A 2NAZA 1D8KA 1ODDA 5CVUA 2HQRA 2H27A 5BQTA 5K1YA 2FMLA 2A69F 3W6JB 1XDUA 3BJOA 3HRSA 4WF2A 1R7JA 4G7HF 3F3XA 3BROA 1FWZA 3WTUC 3R0AA 3F8CA 3R4KA 4EJTA 4IPAA 1G3YA 5TJJA 4Q5SF 2VBZA 4U0WA 1FBUA 1J75A 4P55A 3P9IA 4IHSA 1YG2A 2P5LC 4NQWA 1K79A 4AIHA 2HEOA 1SD4A 3I58A 2GA2A 5LGUA 2KKOA 4ZYEA 4YIFA 5FD5A 1SMTA 4GXOA 5HDGA 1SD7A 2FNAA 1JXSA 2XRNA 3F23A 5LBQA 1U5TC 4M73A 2ZKZA 2COMA 1R22A 3LA3A 1P4WA 5H6RA 3E6DA 4DQ2A 1EV7A 2GIVA 4YIIA 2JTVA 1FY7A 3GW2A 2A6HF 5DCMB 1JHFA 5KVRA 5TRDA 4U7DA 3I5UA 1FSEA 2Z99A 5EEHA 3N4MA 1W7PA 1EH8A 2ZNZA 4GCVA 5DYMA 5HLHA 4LK0F 1TQPA 2HKXA 3FM3A 5H6QA 1J59A 3E5UA 3J80Z 1HBXG 4OMZA 1XDSA 1WWXA 2YSRA 4O6JA 3ROUA 4ENNA 1USSA 2W57A 5K5QA 3RTRA 4OIRF 3PFIA 4A5MA 3U9GA 5JVTA 2VONA 3FMQA 3KP3A 1Z91A 1Z6TA 5LHHA 3RPQA 3BPXA 3RYPA 3FM5A 4EJOA 4I0BA 1IN6A 3IRQA 3HIFA 1SD5A 4L9NA 3QU6A 3FX3A 3T0YA 2R7DA 1ZAOA 1RNLA 5DUKA 5CVJA 2FMYA 3EETA 2IVMA 1P4XA 1ZN2A 2DLLA 3DPLC 2IA0A 1S29A 2XASA 2IT0A 2EJRA 2XAQA 5ICCA 1R5GA 3GF2A 3WU0A 3WGHA 4UHTA 4EMSA 1B9MA 3TOBA 4KICA 3QPHA 2QYOA 2JSCA 2PBIA 5FD6A 3M7GA 5EEGA 2Z5UA 4U0YA 4RAYA 5FFZA 3WTZA 2VBWA 4IRGA 3KP4A 4GO1A 4MHGA 3GWZA 2F2EA 2RN7A 4L0YB 2L02A 3SFZA 3TO7A 2F5DA 1ZGAA 4EM1A 3L9FA 5AIQA 5AIPA 2L4AA 1XGOA 3ZN0A 1YLFA 2W84A 3I4PA 4HF0A 4ESBA 4YFNF 3EYYA 4CGZA 2NYXA 1DPRA 4CYDA 4BHBA 1IUYA 3F8NA 4L9TA 2K27A 3ULQB 4DNCA 3ZP5A 1DUXC 2RNJA 1E2XA 3MWMA 4I09A 4ETSA 5E1WA 1GHCA 5E8GA 3KZYA 2XAHA 2PI0A 2K02A 2MH9A 1BC8C 3TO6A 5D4RA 1Y0UA 5LHGA 3IKVA 1BI3A 3WTTC 3O3KA 3QAHA 4CO8A 4OIPF 1KYWA 2XGXA 2PN6A 3RJPA 4GGGA 3IC7A 3KFWX 3L09A 3F21A 1XD7A 1BBYA 3K9TA 5BS6A 2YR2A 1T6SA 4OINF 4A6DA 4Z2YA 1QQIA 1YYVA 5F64A 2VBYA 1WSUA 5CVRA 2VODA 3U2RA 4A12A 5DCMA 3RPUA 5JFRA 5D8KB 2MLGA 3WODF 2UWMA 2RDPA 3EDPA 1G3TA 1IW7F 5E1XA 1YIOA 1BC7C 1QBJA 4LG0B 1FC3A 2L01A 3L2CA 3FHZA 2O0YA 2L3DA 3HYIA 4ZZLA 4G6QA 2UXXA 1FBSA 3QP6A 1G3WA 2D1VA 1BIAA 2ZFWA 3LA7A 4WXCA 4LB5A 2K4BA 5HDNA 1Z1DA 3R60A 3MAJA 5HLGA 1MD0A 3ZPLA 4AWXB 1SAXA 2FSWA 2OU2A 3M1EA 4G94A 2QVOA 3LAJA 2HZTA 2EV5A 2Y75A 1IRGA 5DUIA 4UV8A 4NHJA 2DO7A 2QWWA 4KIGA 3REOA 1ON1A 1USTA 1U2WA 3V8LA 3KZZA 5LHIA 4M72A 2LDUA 4P5OA 4CDGA 2D2WA 3E6CC 2FE3A 4KNYA 4AVPA 2EV6A 2JPCA 3SHFA 2VE8A 1OPCA 2HDCA 1FZPB 3SZTA 1EH7A 4EQQA 2W24A 2OZ6A 2MC3A 4OIOF 2WV0A 2XIGA 3NRVA 4BH9A 4G7ZF 5D6FA 3BOQA 1ZHFA 1XN7A 4M9ZA 1EH6A 2QBYB 1XCVA 1FLIA 2W25A 1RZ4A 4P96A 1IN4A 3DEUA 2H6CA 3E5QA 4NB5A 3KEOA 3I59B 3IL2A 4I98B 3WE3A 3QPTA 1HQCA 1YQAA 3J7AO 2CG4A 2H94A 3T1BA 1WI9A 2ESNA 1UFMA 2M45A 2V6CA 3HSFA 3ZMVA 2PMUA 2E1NA 1OYIA 4I01A 1MJAA 2IJLA 2LKPA 1XGSA 2FF4A 2NNYA 2QENA 1F1ZA 1B1BA 2ESHA 2AS5F 2CWEA 1P6RA 2XKPA 2ACJA 1I5ZA 1BOAA 1O57A 2DPUA 2FU4A 2VOOA 2PFBA 2DT5A 1ZRDA 3HTUA 4L5IA 5HVQC 3KP7A 2EA2A 4HQMA 2YX7A 2BV6A 2ZJ2A 4P9FA 4I7HA 5CVIA 2VT2A 2DK5A 1E17A 3HTSB 2CFXA 1K7AA 3CO6C 1FBQA 3KCCA 1JGSA 4CZZA 4O5VA 1WKMA 5A2QZ 4ZYGA 5CLSA 1W5TA 2LF8A 3HUGA 1FYMA 5IT9K 2BGCA 1A04A 2XVCA 1K78B 4YG2F 2CW0F 2Y0MA 2IRFG 4LB6B 4LLLA 2JRTA 3J81Z 2BYVE 5FFXA 3TOAA 1FP2A 1D3YA 1TQIA 1WQ2A 3K2ZA 5D4SA 3V8JA 3F22A 4IRIA 4OOIA 2E1CA 1SFEA 1ZLJA 2UXNA 3FZVA 6PAXA 1IXCA 1R23A 1J9IA 4U88A 1S7AA 1YS6A 4XBFA 3F72A 3ERED 5F6FA 3BPVA 5H20A 1D5VA 2RKHA 1FOKA 2R7FA 2V1XA 2P8TA 4B8XA 4LG0A 2GQQA 1UHMA 1J0RA 5KK1A 3ECOA 1XSVA 3JSOA 4YFKF 1MZBA 4MEYF 1XMKA 3SZPA 3HRTA 2KIFA 1K78A 2OQGA 1K6OA 2A3SA 4EVIA 1OMIA 3VFZA 3I54A 1ZG1A 3SQNA 5D5XB 4EV0A 3JTGA 4KA4A 1V4RA 5ICFA 3MCZA 5FGMA 1HW1A 3CO7C 1PP7U 2CQKA 2XV4S 2YPRA 2JZYA 4OU0A 4L9VA 4HLXA 1B6AA 1R58A 3V7CA 3FWEA 2WC2A 1PDNC 4LJZF 3WTWC 3D0SA 5E20A 1L0OC 2VT3A 4HA8A 4F7ZA 4BXUA 2EB7A 3TO9A 2IPQX 1GXPA 3V7SA 3VB2A 1O7FA 4PZJA 4WCGA 1S8NA 4HDUA 2O61A 2Y48A 1PUEE 4A0ZA 4MGRA 4E70A 3GFJA 3DXJF 3ZMZA 1U6GA 2PLYA 4HYEA 4U7BA 2VXZA 1HW5A 4UXNA 4UV9A 3F8MA 3VEPA 4ESJA 2CYYA 4RGXA 5DD4A 1J2XA 1SMYF 2XKOA 2KJCA 3GVAA 3LSTA 3B73A 2MA3A 3J80K 3WG9A 4LD5A 1ZG3A 1SD6A 2FRHA 2EFOA 4GYGA 4Q4ZF 3WTXC 2DQRA 2OBPA 2A5YB 5F1RA 4KFCA 4O3MA 3ZMSA 4EGYA 3IHUA 2DW4A 2J5PA 1XCBA 3S2WA 3GZ5A 1YW7A 4OMYA 3SXYA 1DPUA 2IA2A 2KIUA 1S3JA 3ECHA 2DFIA 2XAJA 1XGMA 2FA5A 2QM3A 4M9XA 3OOPA 3HSEA 2HGCA 3FXRA 2HFHA 5L3GA 4RB1A 3HRUA 1O3QA 2DU9A 2WTEA 5D5VB 4IF4A 4A0XA 5DEQA 3MZHA 4Y13A 5D5UB 4BHPA 4XSZF 3Q5FA 3GYHX 2BBYA 3G73A 1D8JA 3QP5A 1ZREA 4N9HA 2FBKA 4WXDA 1F5TA 3RDIA 1HKQA 2FOKA 3KE2A 4KIBA 4XRFA 3GX4X 1FPQA 2Q0OA 2UZKA 4M71A 2JT1A 2HR3A 3F6VA 4N9IA 1J7KA 4RB3C 4WX9A 2LF7A 1BM9A 2ZXJA 3HHHA 1HSJA 2R3SA 2GA1A 3HHGA 4A2UA 3Q9VA 3MQ0A 5A2QK 1LQ1A 4N0BA 1QGPA 1MKMA 1ONVA 3LA2A 2STTA 1W5SA 1GXQA 3T5XA 2A07F 4R8HA 1KQ8A 1XSXA 3V7RA 4RAZA 1ULYA 4AIKA 3L00A 2ZBKA 3KP2A 5DD8A 2YU3A 1QO0D 5ICEA 1ZH5A 5JI6A 3F6OA 1TTYA 4AD9A 4KN4X 5ED4A 3BP8A 1KU9A 3GLXA 1G6NA 1W7PD 2P7VB 1IZ1A 4G7OF 2O6GE 3RKWA 1UB9A 4HOBA 5D5WB 1Q1HA 1F4KA 3E6BA 5IT3A 1OYWA 5CJ9A 4R1HA 2D1HA 3BWGA 3DFGA 4FX0A 1HKSA 1Z6RA 1OR7A 5K5OA 5D6EA 1KU3A 3BZ6A 2DK8A 4QWQA 5FLXK 2VBXA 2ETHA 4HX4A 2OD5A 2ISYA 4KMFA 3T8TA 5ICGA 3BJ6A 1R1VA 1BI0A 1R1TA 1TW3A 4EJUA 1WRJA 4BYYA 5CVVA 4JK1X 3H3ZA 2FQ3A 2RGVA 2MH2A 1MDMB 2STWA 3LFKA 4EM0B 2QQBA 3FMSA 2EK5A 3LQQA 5J8CA 1IN8A 3CLOA 1Z05A 3BJAA 4UVCA 3CUQB 4ENJA 3WGIA 1R5HA 2P5KA 5LGTA 4U0VA 1F9NA 5ILVA 1H9GA 1GVJA 1KU7A 2P6SA 2QLZA 1I27A 4MNUA 1G3SA 4HDVA 2YX4A 4CICA 2WWYA 4K2EA 4BNCA 1P2FA 3WTVC 3D5LA 5DDGA 4WWCA 4HX7A 2OQRA 4IXAA 5BPIA 5LGNA 4LK1F 1S6LA 2D45A 1U3EM 3EUHA 2G9WA 1IRFA 2RVCA 3RIRA 1O7LA 3FXUA 4RGUA 4HW0A 1W7PB 2FBHA 3CUOA 2DTRA 2DQLA 3JAMZ 5J8FA 3C7JA 4UNOA 5HS9A 2IW5A 3LQRA 2O8XA 2ZNYA 2ZMEA 3HOSA 2NNNA 1RUNA 1DDNA 4HX8A 3DKWA 3JAMK 2GZWA 4ZZDA 5LRSA 2EFNA 1Z7UA 4WXHA 1G4DA 4PGGA 1IAWA 2OAZA 5FB2A 1QPMA 3CUQA 1P92A 1B59A 3R61A 3P7NA 4MTDA 4XLNF 3K1PA 2H09A 5BMZA 4L5JA 3H92A 1YFHA 3KP6A 3TDZC 3ISPA 3G3ZA 4CXFA 4LLNA 4IRHA 4PGHA 1ZLKA 1LDJA 2G7UA 5LEKA 2ISZA 2FXAA 4KN7X 3I0TA 4EJVA 3QU3A 1T2KA 1UCRA 4GYIA 1IF1A 1BI1A 2DAOA 3V8KA 3JSPA 2BE5F 1MJBA 3GFMA 4YFXF 2VE9A 3M9AA 3ZMUA 1LB2A 1FYLA 2EFWA 4HF1A 2ADUA 4HQEA 2M87A 5E8IA 1I6XA 2HQNA 3WU1B 1R1UA 2HTJA 1HXDA 2OA4A 1IXRC 5IT9Z 3PQKA 1ZRFA 3FF5A 1TQMA 4EGZA 1V3FA 1YW8A 2RV8A 3P9KA 5DCFA 5FLXZ 2QQAA 3KEQA 3IRRA 2XAFA 1OYYA 3E3VA 2PG4A 3BY6A 4G6DA 1RI7A 2E7XA 3K1MA 1TW2A 2NS0A 4MQ9F 2HKOA 5L3BA 3E6MA 3WGGA 1FX7A 5JR3A 1FYKA 2H6BA 1TNTA 1R00A 1QNTA 5HOOA 2EWNA 3VOEA 1KU2A 3WTYC 4KUMA 2KIMA 3ZMDA 1I1SA 3E97A 2RQPA 3C3WA 3JTHA 2QQ9A 3NEUA 1X3UA 5LEJA 4UVAA 1H0MA 5BPDA 1JE8A 1YO5C 2QZ8A 2A61A 2IA1A 4UVBA 5E18F 4XLPF 4KMUX 2PEXA 1ON2A 4HV6A 1FT9A 1IN7A 2G7HA 1MJ9A 4AIJA 1YW9A 3I59A 2PQ8A 3FMRA 4EJWA 3ABUA 4H0EA 3V4GA 2V1DA 4HLYA 1STZA 2M30A 4ZYHA 4ENKA 1O3RA 4S04A 4IVNA 4L9JA 4KDPA 5HDKA 2GXGA 2F5FA 2E7WA 2O3FA 3WTSC 2L4MA 4G8XA
chains in the Genus database with same CATH superfamily
2M8EA 2QKMB 4Y15A 3P9CA 5EG0A 2PMHA 4J01A 3PNYA 2R7RA 3TKYA 3JRIA 1XGNA 3TDUC 4XRSA 5ILUA 2K9SA 2XAGA 1PP8F 1BIBA 2MW8A 3ELKA 1Y1WJ 1RRJA 2M2EA 1XB4A 1KQ9A 4ZH4F 4DYCA 3IWZA 3LSMA 1YIJI 2R5YA 3FBNB 4UUVA 3RI4A 1F36A 2DBBA 5FLMJ 2RC4A 3ML6A 1O3TA 2E71A 3BC8A 2Q2EA 2X0LA 3KP5A 5L3FA 3ZQ7A 2LKSA 2EA4A 2HDWA 2HXOA 4B44A 3GXOA 1OKRA 1MGTA 3D5RC 1ZYRF 2VC1A 1LEBA 3HXLA 4HAMA 3HGYA 5GAGJ 2Z33A 2K9LA 4BXFA 2A5WA 1RUOA 4S05A 1QZZA 5E1ZB 3MMYB 2LSOA 3AAFA 3BR1A 2M1BA 3CDHA 2Z9OA 1W4MA 3DPTA 4BJ5C 4MFEA 2HYGD 4D0PA 4ZYAA 2LC2A 1FP1D 2FD5A 3HKZA 4IOAF 4OWRB 2E1MC 1NK3P 3GMEA 5BOXA 2XDVA 1T0FA 3C1DA 1N75A 2P81A 3KEYA 2M5WA 3RKXA 1QHGA 1HKTA 1XMXA 1T98A 2IP2A 2VKHA 4QLCU 4A3IJ 1I1GA 3M4OJ 1B4AA 4MEXF 2XF5A 5L3EA 2K40A 1G2HA 3DF8A 2EBIA 1E0EA 4XR6A 1S72I 4DGWB 3IH4A 4F91B 4BQNA 1X19A 2ZO4A 2X6OA 3K1NA 4M6YA 2A6EF 1IDYA 3CMEI 1CF7B 1NG7A 1QZYA 2Z3YA 1PVEA 3RZDJ 2HOSA 2L7FP 1IC8A 1YTYA 1X2MA 2XHKA 4GRIA 2GWRA 2DA6A 2WBMA 1YS7A 1LKXA 2VC0A 3OSGA 4ESFA 2VN2A 3CC7I 3IKTA 4XNFA 2DPDA 2DDAA 1CGPA 2V9PA 2EIMH 1OCRH 3BLYA 4ZJZA 2DI3A 2EV0A 2LYCA 5IP6A 5J4VA 4CYCA 1HW2A 1KQ0A 4BQAA 4Y52J 2QBYA 2HOTA 4Y17A 1MDMA 4LFUA 4RB2C 4J00A 1Q1VA 1ETOA 3KZIC 1KA8A 4D1QA 3I64A 1N77A 1GV2A 3R0JA 1SFKA 3M8JA 1QA6A 3UKGA 4Z6YA 5IP7J 3BTCA 1NH3A 5KNLA 3QOPA 2X9DA 2HYFA 1XMAA 2XROA 3H5AA 3N05A 5E3NA 1ZGJA 4BL0B 2QKLB 3J81K 1BI2A 2LTPA 4ON0A 4L18B 1MIJA 5FKNA 3HSRA 2DA4A 2QGUA 4F93B 4MIMA 3RSNA 5IOYA 2VLAA 5CPRB 2R4GA 4M9SA 2O03A 1JGGA 9ANTA 3Q0WA 4R79A 2NRAC 4RGRA 1R49A 2X1EA 4ZTJA 1DP7P 1U78A 1OCPA 2VXDA 4AYBN 3ABMH 4E7JA 1IN5A 3VSKA 2MD5A 2Q8KA 3K0LA 3TQNA 5DV5A 1P4AA 3N97A 3ZN1A 2BVMA 4KIFA 4B09A 2HOAA 1S7OA 2K7LA 2LBFA 3GO5A 4UB8C 4DBRA 4HNVA 3ZMTA 3KLNA 5HS8A 4HV5A 3IWFA 2EFQA 2MFZA 1U8BA 1TWHJ 3GBGA 3HOTA 2DMNA 4Y4RA 5HLIA 1J5YA 1O3SA 2KPMA 1ZK8A 4LGWA 2LG4A 1JHHA 1LEAA 2F4OB 1LFPA 3I71A 2F5CA 5D8LB 5J47A 4XLFA 1X2NA 3BCBA 3VODA 5K7HA 3RKYA 3GZ6A 1CF7A 2JMWA 3L7WA 4G9YA 4A0YA 1VQOI 2LFBA 1LVAA 4BU2A 2X1DA 1U5TA 3HL2A 1VQ9I 1C0WA 2GAUA 2WAQN 1TLHB 2ZC2A 4BJ6C 4OAZA 2B0LA 2FEZA 1U8RA 3L2WA 3DBRB 5J6XA 4NDLA 1LDDA 2HNHA 1Z77A 2ME0A 3ZOBA 1Z67A 3PQJA 1NK2P 3QRFF 2V9VA 1ZG5A 2BW3A 3DV8A 4IJAA 3BDDA 3OYAA 3K4JA 2I10A 3IAS2 4XLEA 3M3YJ 2EFPA 3KX2A 1FTTA 1JTXA 1A5JA 2CJJA 4M3BA 2QQ8A 1VTNC 1VQPI 2C6YA 1E3HA 1WJCA 1Z3YA 2QUFA 3WE2A 2VPRA 4I2OA 1IJWC 1UELB 3OL3A 5JLWA 1BW6A 4MTEA 1MH3A 4Q47A 1ZR4A 2XSDC 4RB0A 2OZUA 3ZQLA 1R36A 3BG9A 2HS5A 1ZARA 3KETA 3CCMI 1BA5A 5IY5H 2GXBA 5GAHJ 3MEXA 3PO3J 1HOMA 4E7HA 4IKFA 4IHTA 3Q3SA 1JKPC 3J7ZI 2MLKA 3I3LA 2I8DA 4BQQA 4LIUA 2A05A 5L3CA 3OYHA 4E7ZA 2XF7A 1LE8B 1FSHA 3NAUA 1GVDA 2CRGA 2ZFUA 4J19A 1EA3A 1ETQA 1TBXA 4WK8F 4ASNA 2HXIA 2FBIA 3PIPF 3HKZN 4JX6A 1Z7LA 3EQLF 1EF4A 2VOPA 1X4PA 3TP0A 1REPC 3DCFA 2MBFA 2NS8A 5JHUA 5EGOB 2X4HA 4I0AA 2HU9A 2CV0A 4X1EA 2CO5A 3WG7H 5J1YA 4EM2A 2XUBA 4ENMA 2ELHA 1T39A 3BR5A 1U5TB 2F5EA 4KT5C 1TL8A 2Y30A 1FIAA 1PUFB 3OV8A 3BG7A 3EYIA 5EG0B 1LJ9A 4RLQA 3FDYA 3U1DA 3E5XA 3M8FA 1MBGA 2DCEA 4MO7A 3W6KB 1FEXA 1BJZA 1BN5A 5K5RA 4X6AJ 2LREA 1B8IA 5LRRA 2R5YB 3PNVA 1Z0XA 2DMUA 4BY1J 1MNDA 4IQ4A 1FNNA 3CJNA 1QZEA 2QSHX 2W85A 2CSOA 3ABTA 3RCOA 3C18A 3LSIA 3TGNA 1AWCA 3F8FA 1L3LA 3AKZA 2LOOA 3DQVC 4HF2A 1ETYA 4MQVA 1UAAA 2KJBA 3HRMA 4L0ZB 4LLGF 2DFHA 5K7ZA 2H8RA 2KRFA 2KQRA 4A6EA 2B9SA 1H9TA 3LMMA 1I50J 1UHWA 4XSXF 4A5NA 2IGOA 2VPLA 2PX9A 2HTSA 4LIVA 4ZDOA 3JW4A 4FHTA 1LNWA 1A36A 1ZRCA 1NHAA 2X51A 3O2PE 2P5VA 5LLQA 1T38A 3GEZA 1S9HA 2L54A 4CHUA 3PIOF 2F5VA 2M34A 2DYRH 4JOMA 1KGSA 3S16J 1IXSB 4A3GJ 3M8EA 2K86A 3CTAA 4HZFA 4I02A 3BG6A 3OYJA 5ILSA 3MFKA 2O9LA 3R6SA 4MFDA 3HPHA 4M74A 3DP7A 1RIOH 5IYDJ 2K4JA 4FX4A 1P7IA 5CYVA 4LMYA 2JK3A 1X4OA 1I3AA 3DBLB 3F8BA 1BOBA 3CUQC 3K69A 5F04A 3LAPA 4AM3A 3K4KA 1KYZA 3NQOA 3ZRGA 1B9NA 4BQOA 1SFXA 4CUGA 1BJAA 4ZYDA 4FETA 3DEEA 4M6XA 1OLTA 1MW7A 2IGMA 2J5OA 2EZKA 5E3LA 3DTEA 1W5CC 5AONA 4AU7A 3O6BB 4ITVA 2V1UA 3GFLA 3OR2C 1MBFA 3LWFA 3SDGA 2IS4A 2TDXA 4JBAA 2P6TA 4PCQA 2PJPA 3MZYA 3CJRB 3JRDA 1TNSA 3GUDA 1F43A 4Q48A 1QRYA 4E6KG 3SFIA 3T8RA 1WJ5A 2CFOA 4C3JJ 4BE1A 1R4NB 2V79A 3Q9SA 1ZTRA 1I39A 1VQ5I 4MLOA 4ZTFA 4FT8A 1XTAA 3GFIA 2NVXJ 4JQFA 2E60A 2L9NA 4XMYA 5GTIC 2A68F 2ZMEB 1FOYA 4KYWA 4NC7A 4TV7A 1MNMC 5C4JJ 1HSTA 4PDKA 2ZCWA 3COAC 3H3UA 2I5UA 4XONA 1D5YA 4OIQF 4P9UA 5IOZA 3RYRA 1LDKB 2AXLA 2YUSA 3OIQA 3UR3C 4BHCA 5J4YA 4YRVA 2HWVA 2K5CA 3EUHC 2JPBA 2CS3A 2FNPA 3FK7A 5E17F 2P4WA 1YJ9I 1VQ7I 5FO5A 2P7CB 2ZXHA 3KLOA 2VQLA 3B02A 1VNDA 3E1SA 1Z9CA 1AOYA 4F92B 4HBLA 4RGSA 2R7VA 2HOEA 4CSWA 1SFUA 2BEOA 2VASA 1TZLA 2BY1A 3S93A 3H35A 2M0MA 1VZ0A 2LNBA 1XSDA 2JQ7A 3FXQA 4RS8A 4BAYA 5ERIA 3HJEA 5L3DA 3CCVI 2CGPA 2LRDA 1MMGA 3I53A 5HS7A 2NAZA 1D8KA 3CCJI 4NNJA 1ODDA 5CVUA 3B6CA 3H5RA 2HQRA 2H27A 3BTLA 1UZCA 3JRAA 5BQTA 5K1YA 2FMLA 2A69F 2ZXWH 3W6JB 1XDUA 3FISA 3BJOA 2MGQA 3HRSA 4WF2A 1R7JA 4G7HF 5EYRA 2HQAA 2R7QA 3F3XA 3I4MJ 3BROA 4PJMA 1N25A 1FWZA 1MMAA 1RC9A 3PSIA 3EUKL 2R7TA 3WTUC 4G6TB 1BR1A 3MKWB 3S1NJ 3R0AA 4NUBA 4YELA 3F8CA 3J7AY 3R4KA 3A01B 3U1KA 4EJTA 3S1MJ 1A6QA 2NOGA 4RLFA 4IPAA 5B1BH 2VJIA 5J3LA 1G3YA 5TJJA 1EJ9A 4Q5SF 2VBZA 4U0WA 1S5LC 2LLKA 1FBUA 1J75A 3G6EI 4P55A 1RKWA 3P9IA 4IHSA 3CMYA 1YG2A 4CCLA 2P5LC 2Y0SA 4BGDA 4NQWA 3QWLA 3VYUB 4AIHA 1SD4A 4XIDA 1K79A 2HEOA 1HA8A 2K3PA 1U0JA 1UHSA 2ZMEC 3I58A 3JRHA 3HOXJ 2GA2A 2L9VA 2K3FA 3CP2A 2JN6A 5LGUA 2BHYA 2KKOA 4ZYEA 5FRMA 4YIFA 1LFBA 5FD5A 2L5QA 1SMTA 4GXOA 5HDGA 1SD7A 2FNAA 1JXSA 2XRNA 2CUFA 3F23A 3RQ4A 3BTIA 5LBQA 1U5TC 4M73A 2ZKZA 2DODA 2R5ZA 1JKRC 5H2FC 2COMA 1R22A 3LA3A 1P4WA 2MSYA 5H6RA 4RM3A 2DXIA 2AXTC 3E6DA 4DQ2A 1EV7A 2LKXA 4A3BJ 1W0TA 2GIVA 2JTVA 4YIIA 1FY7A 4CZCA 3H5NA 4C30A 3GW2A 2A6HF 1SC7A 5DCMB 1JHFA 5KVRA 2M0CA 4XORA 5TRDA 4U7DA 3I5UA 1FSEA 2Z99A 5EEHA 3N4MA 2KRHA 1W7PA 1EH8A 2ZNZA 3TP3A 4D7MA 1X1AA 4GCVA 3HOZJ 5DYMA 3CMMA 5HLHA 1D1CA 4LK0F 1TQPA 2HKXA 3FM3A 5H6QA 3TMOA 2DMQA 1J59A 4C2TA 1E3PA 3E5UA 3CESA 3J80Z 2ECBA 1IO2A 1JT6A 1HBXG 4A93J 1X1CA 4OMZA 2MYSA 1XDSA 1WWXA 2V26A 3VYRB 2YSRA 4O6JA 2DOEA 4PFOA 2CW8A 3HGGA 1B8IB 4NC8A 3I4NJ 1E3OC 2DA5A 4CH7A 3ROUA 3A03A 4ENNA 1USSA 1OQYA 2W57A 4LG3A 4RM2A 4OIRF 3PFIA 3RTRA 4A5MA 5K5QA 4C3IJ 3U9GA 2KDOA 3BR3A 5JVTA 2VONA 3FMQA 3KP3A 2LD5A 3QPLA 3K6GA 2JVHA 1Z91A 1Z6TA 5LHHA 3CCQI 3OIPA 3RPQA 3G1OA 3BPXA 3CF2A 4CCJA 2JWTA 3RYPA 5KAIC 4XRMA 5CQEA 4BACA 1W36D 2BVLA 3HOYJ 4HSRA 3ZQFA 2W7NA 2E2HJ 3FM5A 4EJOA 4I0BA 1IN6A 4N4NB 3QODA 4BE0A 2VQHA 4DJAA 3W2AA 3IRQA 4HNUA 2HI3A 3OYFA 1FMWA 3HIFA 1SD5A 2NXNB 4DZJA 1POGA 2E36A 3QU6A 4L9NA 3FX3A 2LR8A 2WA0A 3H9JA 3T0YA 2R7DA 2LMDA 5TISC 1ZAOA 3IH3A 1R5ID 1RNLA 5CVJA 5DUKA 3EETA 2FMYA 3KYCB 1O4XA 2IVMA 1P4XA 1ZN2A 4DW6A 2DLLA 3DPLC 2IA0A 1S29A 2NOJB 2R93J 1WI3A 2XASA 2IT0A 2EJRA 1RR8C 2XAQA 5ICCA 2ZSIB 1R5GA 3HM5A 3GF2A 1A31A 3WU0A 2LY2A 5IP9J 3WGHA 1ETVA 3NWSA 4UHTA 4D5CA 3CCYA 2OV7A 3S2DJ 2GBYA 4EMSA 1B9MA 3TOBA 4KICA 2XC7A 3A02A 3HC7A 3AFHA 1VQ6I 2XF6A 3QPHA 1DQUA 2QYOA 4IO9F 2JSCA 2PBIA 2YS9A 1N78A 5FD6A 3CCLI 3OY9A 1ORKA 3M7GA 5EEGA 2Z5UA 1NG6A 4U0YA 3BG5A 4RAYA 5FFZA 3WTZA 5B1AH 2DYSH 2VBWA 4IRGA 2VI6A 3KP4A 4GO1A 2RNGA 4MHGA 3OS1A 3GWZA 2F2EA 2RN7A 4L0YB 3S1RJ 2L02A 4KISA 3AG1H 3SFZA 3GTOJ 5C4XJ 3PL8A 3TO7A 2UUZA 3MD2A 1G59A 3BQZA 2BOLA 2F5DA 1ZGAA 4EM1A 4AIDA 3H9QA 3L9FA 3OS0A 2EQRA 3L2UA 5F08A 5AIQA 5AIPA 2L4AA 4XRSG 1XGOA 3OL4A 3ZN0A 1YLFA 2L7ZA 4AVZA 2W84A 3I4PA 4HF0A 4ESBA 4YFNF 2ME6A 3EYYA 4PJLA 4CGZA 3ZXSA 2OPTA 1DPRA 2NYXA 4CYDA 2Y9ZA 2W82A 4BHBA 1IUYA 3I55I 3K10A 1RESA 2K9MA 3F8NA 2ZB9A 2M4GA 4BEHB 3H36A 4L9TA 2K27A 3ULQB 4DNCA 3FIWA 3ZP5A 2JA7J 1YE9A 1DUXC 3OYCA 1ENHA 2RNJA 1FMVA 2HVRA 1IGNA 2KZGA 1E2XA 3MWMA 4I09A 3OYGA 4RMNA 4ZDPA 4ETSA 3PNTA 5E1WA 3OYLA 1VQNI 1GHCA 5E8GA 2R7UA 3KZYA 4U87A 1FIPA 2XAHA 3DWLE 3FXKA 2PI0A 3C2HA 3FBIB 2K02A 2MH9A 1BC8C 4UB6C 2OF7A 2PJRA 2IGNA 3TO6A 1ZKGA 5D4RA 1Y0UA 5LHGA 4XKCA 3IKVA 1BI3A 3WTTC 4H4KC 1GT0C 2Q1ZB 3O3KA 3QAHA 2CW7A 4CO8A 2FUG2 4OIPF 3K7AJ 1KYWA 2XGXA 2PN6A 3A0HC 3RJPA 4GGGA 2HYJA 3DBHB 2Z2SB 4D5FA 3S3NA 3OYIA 4IHWA 1FOXA 1A6IA 3IC7A 3KFWX 3L09A 3F21A 1XD7A 2V4JC 3OWTA 4BDYA 4II3A 1BBYA 1X1BA 2KZVA 3WHBA 3K9TA 3ASNH 5BS6A 5DM6F 2YR2A 3JREA 4A3DJ 5GAEJ 1T6SA 3DKXA 4OINF 4A6DA 2CV2A 4Z2YA 3W3CA 1QQIA 1YYVA 2CMPA 1UG2A 1MNEA 5F64A 2VBYA 1WSUA 1QHHD 5CVRA 2VODA 3U2RA 3KYDB 1ZQ3P 4A12A 1SFOJ 5DCMA 3RPUA 5JFRA 5D8KB 2MLGA 3WODF 2LP0A 2UWMA 3D5SC 5EZGA 4UUTA 1VQLI 2RDPA 3EDPA 1G3TA 3S15J 1IW7F 5E1XA 1YIOA 1BC7C 1QBJA 3VPRA 4LG0B 1FC3A 2L01A 5FKLA 2Q2EB 1H88C 3ZQGA 1AU7A 3L2CA 1OCCH 3FHZA 2CUZA 2R5ZB 2O0YA 2L3DA 2WADA 3HYIA 4M3EA 4ZZLA 2CUJA 2FOWA 2UXXA 3BTJA 4G6QA 3JRGA 1FBSA 3QP6A 4IZZA 1G3WA 2D1VA 1BIAA 2HVQA 2ZFWA 3LA7A 4WXCA 2K4BA 5HDNA 4LB5A 4Y3OA 1Z1DA 3EUAA 1MH4A 3R60A 4BEHA 2K9NA 1JI8A 3CDLA 3MAJA 2R7SA 2B7EA 5HLGA 1MD0A 1UJ8A 3ZPLA 4AWXB 3GTLJ 1SAXA 3OYNA 2FSWA 2OU2A 3M1EA 3HPGA 1WCMJ 4G94A 5CKTA 3W2VA 2QVOA 3LAJA 2HZTA 4V2GA 2EV5A 2RAEA 2Y75A 1AKHA 4B43A 4YIRX 4KJZA 1IRGA 2AQFA 4C9YA 1I6HJ 1K83J 2EILH 2JA6J 1ACIA 3SJMA 5DUIA 4UV8A 4NHJA 2DO7A 2L9SA 2QWWA 2K9QA 3DU6A 4KIGA 4UUSA 5EZHA 3REOA 1ON1A 2OCEA 1USTA 1K6YA 4L5EA 1U2WA 3V8LA 1XX5A 3KZZA 4M72A 5LHIA 3LNQA 2EZHA 1T33A 2ZJRF 2LDUA 4P5OA 2XGDA 4JYKA 4CDGA 2D2WA 3A2KA 1LFUP 3E6CC 4E7IA 2FE3A 4KNYA 4AVPA 2EV6A 1P7JA 1A35A 4A69C 2JPCA 3SHFA 2VE8A 1OPCA 2IAIA 4B3XA 2HDCA 1WZ2A 2V9KA 1FZPB 3SZTA 1EH7A 4EQQA 2WAQA 2R7XA 2DN0A 2W24A 2OZ6A 2H1KA 2NVUB 1BR2A 1W1WE 2MC3A 2JSPA 4OIOF 3HEFA 3OS2A 2WV0A 3JRFA 3GLLA 2JA2A 2XIGA 3NRVA 1IV8A 3BOQA 4BH9A 5D6FA 2XPUA 4G7ZF 2L7MP 1ZHFA 2BXZA 4D9JA 3S3OA 2DA7A 1XN7A 2EH3A 1EH6A 4M9ZA 3MN2A 4QPQA 1R9TJ 3TEDA 2RREA 3VSLA 5B3SH 3ERMA 5K7FA 4N4OB 2QBYB 4KT6A 1XCVA 1FLIA 2X48A 2W25A 1RZ4A 2DA3A 4P96A 1IN4A 2V1NA 3BZCA 3DEUA 3BCAA 2H6CA 3O8GA 5TGTA 3E5QA 4XM3A 4NB5A 4G12A 4B47A 5FLVA 2R92J 4A3JJ 3KEOA 3FK6A 3I59B 3IL2A 1MBEA 1HDPA 4I98B 5FROA 1Y8QB 2F4IA 4F3QA 4BDZA 2E2JJ 1VQ8I 2HZDA 4W1UA 3WE3A 3SEQA 3QPTA 1HQCA 1MSFC 2KL4A 3G2BA 5J40A 1YQAA 1QVUA 3J7AO 2CG4A 2H94A 3T1BA 1OJLA 4X0GA 2W1OA 3BZKA 3JRCA 1WI9A 3BT9A 2ESNA 1UFMA 2M45A 2VQGA 2V6CA 3HSFA 3IV5A 3ZMVA 1MBKA 2PMUA 2E1NA 1OYIA 4I01A 1MJAA 2W4SA 4M3FA 4XICA 2IJLA 2LKPA 1XGSA 2FF4A 1RETA 2BHZA 4Y7NJ 5F27A 2NNYA 4BUPA 2QENA 1F1ZA 1B1BA 2ESHA 2GIZA 2AS5F 2CWEA 3GTKJ 1P6RA 2XKPA 2ACJA 2M7AA 1I5ZA 2CH0A 1WHUA 4I99C 5DM7F 2NVQJ 5KAFC 1BOAA 1O57A 2DPUA 1T0FC 2FU4A 2VOOA 2PFBA 2DT5A 1ZRDA 2HQ5A 1WJEA 3HTUA 4L5IA 5HVQC 3KP7A 2EA2A 4HQMA 3W2WA 2YX7A 2BV6A 2ZJ2A 2WY7Q 4QTRA 4P9FA 2XB0X 3WHCA 4I7HA 1X3ZB 5CVIA 2ELKA 1RR7A 2VT2A 3LSKA 1VQ4I 2DK5A 4PSXA 2VB6A 3DTIA 1E17A 4HRIA 1V5FA 3IP4B 3HTSB 3PO2J 2CFXA 1K7AA 3CO6C 1FBQA 4A3LJ 2HPIA 3KCCA 1JGSA 2VKEA 4CZZA 4O5VA 3K70C 1P9QC 1R71A 5F0CA 2HVSA 5J1RA 1WKMA 5A2QZ 3QOEA 4ZYGA 2KDZA 5CLSA 1W5TA 2LF8A 3HUGA 1FYMA 5GPCA 5IT9K 2BGCA 1A04A 4RDUA 3VDXA 2XVCA 2FX0A 1K78B 4YG2F 2WAFA 4S0HB 2CW0F 2Y0MA 4IHXA 2IRFG 4LB6B 2ICWG 4LLLA 1SVMA 2JRTA 1H89C 3J81Z 2BYVE 4BS9A 3H0DA 1HCRA 2NVYJ 5FFXA 2NS7A 3E0JB 3TOAA 3HDDA 3CC4I 3QPSA 5C3EJ 1FP2A 2DTZA 3E7LA 4XN0A 2O7OA 3OOUA 3HOUJ 2JVGA 1IRZA 2GM4A 1D3YA 1TQIA 1YJNI 2KHMA 1WQ2A 2OCCH 3K2ZA 1W0UA 5D4SA 3V8JA 3TBIA 3F22A 4IRIA 4OOIA 2E1CA 2GOXB 1SFEA 1ZLJA 1OCTC 2UXNA 3DPUA 3HOWJ 3FZVA 6PAXA 1IXCA 1R23A 4II2A 1J9IA 4U88A 3TL4X 2DJIA 1S7AA 2BY0A 1YS6A 4M3DA 4XBFA 3F72A 3QYBA 3HG9A 2L9RA 3RQIA 3ERED 1TC3C 5F6FA 3BPVA 1V55H 5H20A 1KONA 1D5VA 1JKOC 2RKHA 1FOKA 2R7FA 2V1XA 2P8TA 4B8XA 3DKYA 3H9GA 4LG0A 3I56I 2JRMA 2GQQA 1UHMA 4QIWN 4PJNA 1J0RA 2RQQA 4EATA 5KK1A 3ECOA 1XSVA 3JSOA 4YFKF 4QPOA 1NTCA 2AO9A 3OYKA 1MZBA 4A3EJ 4MEYF 3AL0B 1SVOA 1XMKA 3SZPA 2N8GA 3KPHA 3HRTA 2KIFA 1FJLA 4NC6A 2DT6A 1K78A 1V5GA 3VYSB 5HODA 2OQGA 3CDIA 2A3SA 4EVIA 1OMIA 4HG2A 1K6OA 3VFZA 1VF9A 3I54A 1XS9A 4ZDLA 1ZG1A 3PM1A 2DDBA 3SQNA 5D5XB 4B3AA 4EV0A 3JTGA 3K4MA 1X58A 4KA4A 2XPWA 1D0XA 4M3GA 1V4RA 5ICFA 1MMSA 1MBJA 3MCZA 2E34A 2Y69H 1TWFJ 3ZCOA 5FGMA 1HW1A 3CO7C 2CQKA 2XV4S 2YPRA 1PP7U 2JZYA 2DOFA 4OU0A 3LSGA 4L9VA 4CYCB 4HLXA 2E5ZA 1B6AA 1R58A 3V7CA 3FWEA 2WC2A 2VKDA 2M9HA 4GFBA 4IL6C 1PDNC 4LJZF 4ABZA 4FE4A 1LPQA 4XN3A 2EZLA 3WTWC 2IXSA 3D0SA 5FKKA 2CU7A 1RKTA 1WJAA 5J1UA 1FTZA 2ZJPF 5E20A 1L0OC 4I76A 2KFDA 3MZ8A 5JLXA 2VT3A 4HA8A 3L2RA 3G1MA 4F7ZA 3TW7A 1TT5B 4BXUA 2VQCA 5HLTA 2KIQA 2EB7A 1IG7A 3TO9A 4E7LA 2PJRB 2IPQX 3AG3H 1GXPA 3V7SA 3VB2A 1O7FA 4PZJA 4WCGA 1S8NA 4PUSA 4HDUA 1FOWA 4C3HJ 2O61A 2Y48A 1PUEE 1UG0A 4A0ZA 4MGRA 3CJTB 2MABA 3AG2H 4E70A 2PMZA 2F4MB 2KRCA 2KT0A 3GFJA 2ZJQF 4B1RA 3RKQA 3DXJF 1X1DA 3ZMZA 1U6GA 2PLYA 4HYEA 4U7BA 2VXZA 1YOVB 1HW5A 5C44J 1K4SA 3KYLA 2ID3A 4UXNA 1WJFA 2LBFB 4UV9A 2LVSA 3BR6A 3F8MA 3S2HJ 3VEPA 4ESJA 2CYYA 4RGXA 3CLQA 5DD4A 2XRLA 1J2XA 1SMYF 2XKOA 2A6TA 2KJCA 3GVAA 1H8AC 3LSTA 1WFXA 5EDNA 1T8IA 1VQKI 3B73A 5E79C 2Y2ZA 3SYTA 2MA3A 3SZGA 4BBSJ 3J80K 1QU3A 3WG9A 2XGEA 4LD5A 3ZQHA 1SEUA 4BKXA 1AHDP 1DU6A 1ZG3A 1SD6A 2JA8J 1IDZA 2FRHA 3FKJA 2VJ5A 3ABKH 1Y8RB 2EFOA 4GYGA 4AC0A 4Q4ZF 1DP3A 3WTXC 2DQRA 3UNGC 4A3MJ 2VUMJ 3G71I 2X1CA 2OBPA 2A5YB 4E7SA 5F1RA 4KFCA 1U9OA 3LSJA 4O3MA 3ZMSA 2WV1A 5JHFA 5EJCA 4EGYA 3M07A 3IHUA 2DW4A 3CP8A 2J5PA 1XCBA 2L7KA 3S2WA 3GZ5A 1YW7A 2P0WA 3AG4H 3RPUD 4OMYA 3SXYA 3OIOA 3ONQA 4A3FJ 3K2AA 1DPUA 1WPKA 2O5RA 4F52A 2IA2A 4HPQA 2W48A 1X1PA 2KIUA 4ZC3A 1S3JA 2M3AA 3G4SI 1HC8A 1QVTA 3ECHA 2DFIA 3CCSI 2D5VA 5HNHA 2XAJA 1XGMA 2FA5A 2QM3A 4M9XA 2TRTA 4CCNA 3CMAI 3OOPA 3HSEA 2HGCA 3FXRA 2QCOA 2HFHA 5L3GA 4RB1A 3HUGB 1YJWI 3HRUA 1MSEC 1O3QA 2DU9A 2WTEA 5D5VB 4BE2A 1U9NA 2ZSHB 2X6XA 3K4NA 4IF4A 3IUOA 4A0XA 5DEQA 2E19A 3MZHA 3J7YJ 4Y13A 5D5UB 1PJRA 2Y31A 4BHPA 4XSZF 3Q5FA 2QF7A 3GYHX 2BBYA 3G73A 3QQAA 4RAFA 5B66C 1D8JA 4V2FA 3MKYB 5FJ8J 3QP5A 1ZREA 4JX5A 3Q0UA 2CV1A 3A4CA 5BNGA 4N9HA 2FBKA 5FRNA 1ETXA 3LSRA 4WXDA 5EGOA 2DMPA 1F5TA 3V42A 2OTLI 3RDIA 1Y1VJ 1HKQA 2FOKA 3FHNA 3CCRI 2H8WA 3K4CA 3KE2A 1WVRA 2L0KA 1D1BA 5DTDA 5F1JA 4HEA2 4KIBA 4XRFA 2OUMA 3GX4X 1FPQA 3S3MA 2Q0OA 1HF0A 2UZKA 4M71A 4W97A 2H1LA 2JT1A 1Z21A 2HR3A 3GTGJ 1R4MB 3F6VA 4N9IA 1J7KA 4RB3C 1TWCJ 4WX9A 3IH2A 2LF7A 1BM9A 1X3WB 4XLHA 2BZTA 3FXLA 2O8KA 2ZXJA 3HHHA 1HSJA 2IBDA 2ID6A 2R3SA 2GA1A 3Q0VA 3OYDA 3HHGA 4XL9A 4A2UA 3D1NI 1ETKA 1M1EB 3Q9VA 3MQ0A 5A2QK 3GZNB 1JUSA 1LVKA 3H1CA 1LQ1A 4N0BA 4GDFA 1QGPA 2B63J 3S14J 1MKMA 1ZR2A 3JCUC 3PSFA 2LY9A 1AKHB 4FTHA 1ONVA 4XLCA 2R7OA 3LA2A 5GP9A 4RBOA 2STTA 1W5SA 4IOCF 3DEWA 1GXQA 2E1MB 3LFUA 3T5XA 2A07F 3A0BC 4R8HA 1KQ8A 2FJ1A 1XSXA 4XOPA 3V7RA 4BBRJ 4RAZA 1ULYA 3ABLH 2JUGA 2MC4A 4AIKA 1BW5A 2COBA 4CCOA 3C2GA 4B4CA 2OJED 3BQYA 3L00A 3IAM2 2EPFA 2YU9J 2V7FA 2ZBKA 2EIKH 3KP2A 2CUEA 3DU5A 2L2OA 5DD8A 2GXAA 2XAUA 1ITYA 1MMDA 2DT7B 2YU3A 1QO0D 1XC5A 2VJ4A 5ICEA 1OCZH 2XGCA 3CJQB 2DOAA 4A3CJ 4CA0A 1ZH5A 1XPXA 5JI6A 2JA5J 1GLNA 1R6RA 4UY8I 2IS1A 3F6OA 1TTYA 1YRNB 2KLOA 3F0CA 4AD9A 2E5NA 4KN4X 5ED4A 4E4HA 4DYRA 2DFEA 3BP8A 2QA4I 1KU9A 3B6AA 3GLXA 3GTQJ 5LD2C 4FASD 3FXJA 4IHVA 1G6NA 1W7PD 2P7VB 2DJNA 1IZ1A 4G7OF 2O6GE 3RKWA 1UB9A 4PJJA 4HOBA 2Y9YA 1V54H 5GPAA 5D5WB 1Q1HA 2LK2A 2LY1A 1F4KA 1I3QJ 3E6BA 5IT3A 2QSGX 1OYWA 5CJ9A 3S17J 4R1HA 5GADJ 2D1HA 3BWGA 1DGRM 3DFGA 2Y0SN 3HB9A 4F55A 4FX0A 1AA7A 1HKSA 3C2BA 1JJ8C 1Z6RA 1OR7A 5K5OA 1OFCX 1TWAJ 5D6EA 5KCMA 1KU3A 4JP0A 2EINH 3BZ6A 2DK8A 4QWQA 3LL7A 1JUPA 4Y33A 5FLXK 2VBXA 2ETHA 3OR1C 4HX4A 2OD5A 1Y56A 2CQQA 2ISYA 5EEAA 4KMFA 3GTPJ 3T8TA 4BJTA 5ICGA 3ZQCA 1T95A 3OMYA 3BJ6A 1R1VA 2W00A 1BI0A 5FKMA 3ZQIA 1R1TA 1TW3A 4EJUA 1LUJB 1WRJA 3GTJJ 3BR2A 4BYYA 5CVVA 4JK1X 3GCMA 3H3ZA 1D1AA 1IRXA 2FQ3A 2RGVA 2AQEA 3K4LA 3SEZA 1SANA 2MH2A 1MDMB 4FISA 2TCTA 3L1PA 2STWA 3F9KA 3LFKA 1ETWA 4EM0B 2QQBA 3FMSA 2EK5A 2E35A 3LQQA 5J8CA 1IN8A 3CLOA 5M5XJ 1Z05A 2JJ7A 4XOTA 3BJAA 4UVCA 3TW6A 4V19K 3CF5F 3CUQB 4ENJA 3WGIA 2VL8A 2ECCA 1R5HA 4PFPA 4DYQA 2P5KA 1DU0A 1D0YA 5LGTA 5JVGF 4U0VA 1F9NA 2QSFX 5ILVA 5IYCJ 4P1WA 4IHYA 3CD6I 1H9GA 4JX4A 2R0QC 1GVJA 2PMZN 2X85A 1KU7A 2M4KA 2P6SA 2QLZA 3LOCA 2F48A 1T56A 4NQWB 4CCKA 1I27A 4MNUA 1G3SA 4XQFA 1VQMI 3QYEA 1GDTA 5KHDA 4B48A 2VJJA 4HDVA 2KP6A 1ZELA 2YX4A 4CICA 5B5EC 5GTHC 4C2MJ 2WWYA 4K2EA 2G0EA 4BNCA 1P2FA 3WTVC 3D5LA 4XKWA 2Z16A 4HX7A 5DDGA 5E3MA 4WWCA 2OQRA 4IXAA 1TT0A 4I6ZA 3S1QJ 5BPIA 1WH5A 1BR4A 3WU2C 3RZOJ 4RAGA 2E2IJ 4AYBA 2XPVA 1XG1A 1SVLA 5LGNA 1VI0A 4LK1F 1S6LA 5FKOA 2AHQA 2WY8Q 2D45A 1U3EM 2XSJC 1Z3XA 3A01A 3VYTB 5M5YJ 4KITB 2UV1A 3EUHA 2G9WA 3H3VK 2DMTA 1IRFA 3CZ6A 2RVCA 3RIRA 3FXMA 1O7LA 3FXUA 4RGUA 4HSTA 4HW0A 4M6VA 1W7PB 2FBHA 3CUOA 2DTRA 4PJ0C 2DQLA 3JAMZ 3MKZA 5J8FA 3JRBA 4QSHA 5M3MJ 1WGXA 2IEKA 1IUFA 3C7JA 3FXOA 3PUFA 4UNOA 5HS9A 2IW5A 3LQRA 2O8XA 2JUCA 3I9V2 2ZNYA 2ZMEA 2IS6A 4HNTA 3HOSA 2NNNA 3S32A 2V6EA 3PJRA 1RUNA 1G8XA 1D0ZA 3BR0A 1DDNA 4HX8A 3DKWA 3JAMK 2GZWA 4ZZDA 1ZGWA 5LRSA 3CC2I 2EFNA 1WJBA 1JTYA 3P5JA 4PSWA 2CQNA 4E7KA 1ERDA 1Z7UA 4ANJA 2IGKA 1HDDC 4WXHA 3DTKA 1G4DA 4PGGA 1IAWA 5IPAA 2CQ7A 5IYBJ 2OAZA 5FB2A 2DA1A 3HBLA 1QPMA 3NARA 4EEFG 3ZQQA 3A1YA 2R7WA 3CUQA 1P92A 1B59A 3R61A 3ZGKA 2K85A 4FCYA 3P7NA 2M8GX 4MTDA 4XLNF 3OYBA 3K4BA 3K1PA 1VFCA 3S8PA 2H09A 3H0GJ 2GOMA 3W6VA 5BMZA 1YI2I 3PUBA 4L5JA 4XK4A 1TP4A 3H92A 2ZXIA 1YFHA 3KP6A 3TDZC 5F0FA 3ISPA 3G3ZA 5F0HA 4CXFA 4LLNA 4IRHA 4PGHA 1ZLKA 3JR9A 3BG3A 1LDJA 2G7UA 5LEKA 4DOZA 1GV5A 2DFFA 2ISZA 2FXAA 4KN7X 3I0TA 3ASOH 4EJVA 3QU3A 2E1OA 3DLLF 1IV6A 1T2KA 1APLC 3SDBA 1UCRA 5LFAA 4GYIA 1IF1A 3QYFA 1OCOH 1BI1A 2DAOA 3V8KA 3JSPA 2BE5F 1MJBA 1SAUA 3GFMA 4YFXF 2VE9A 3M9AA 3AL0C 3ZMUA 1LB2A 1FYLA 2EFWA 1HLVA 3OYMA 4HF1A 2ADUA 2LH9A 4HQEA 1S7EA 4LOCA 1RPWA 1OISA 1LE8A 3GTMJ 1JJ6C 2F6CA 1B72B 2M87A 1UMQA 3CQZJ 5E8IA 3O8HA 1I6XA 4A3KJ 1W36C 2IS2A 4RA2A 2HQNA 4BXXJ 4D7NA 3WU1B 1R1UA 2HTJA 2VKVA 1HXDA 2OA4A 1IXRC 1V5EA 5IT9Z 2KISA 1Y39A 3PQKA 1ZRFA 4IQJA 2KMUA 3PFYA 5M5WJ 3MVPA 3FF5A 3DLAA 1TQMA 1MBHA 1OR7C 1TWGJ 3K70D 4EGZA 1YX3A 1V3FA 1PUFA 1YW8A 2RV8A 3P9KA 5DCFA 5FLXZ 2QQAA 3KEQA 2BXYA 3IRRA 2M7BA 2XAFA 3KIOA 3FKIJ 4XKVA 1OYYA 2MD0A 3E3VA 2PG4A 1Y6IA 3BY6A 2BW3B 2BY2A 3G1LA 4G6DA 4IEJA 1RI7A 2E7XA 3K1MA 2QEXI 1JT0A 1TW2A 2NS0A 3L2QA 3L2VA 4MQ9F 5EF6A 4UUSB 1YX5A 5M3FJ 1K4TA 2HKOA 2Z1DA 5L3BA 1BL0A 3ZR8X 3E6MA 3WGGA 1FX7A 2HDDA 2WB1N 5JR3A 4LITA 1FYKA 3LSPA 2H6BA 2OC6A 2EZIA 1YITI 1YRNA 1TNTA 1R00A 1QNTA 5HOOA 2EWNA 1GUUA 3VOEA 1KU2A 4C2UA 3WTYC 2XB5A 1WH7A 2KIMA 4KUMA 1KZHA 3U21A 3ZMDA 1I1SA 3E97A 1T08B 2BY3A 2MG4A 2RQPA 3C3WA 4DBQA 3JTHA 2QQ9A 1PYVA 4AUXA 3MKLA 2CQXA 1WJDA 2ELJA 3NEUA 1X3UA 3HOVJ 5LEJA 4UVAA 1H0MA 5BPDA 1JE8A 1YO5C 2QZ8A 2A61A 2IA1A 3M1CA 3OYEA 2OTJI 1JKQC 4UVBA 1QPIA 5E18F 4XLPF 1JUMA 4DZPA 2EIJH 5CQGA 4XLAA 4KMUX 1MMNA 4YEJA 2PEXA 3HZJA 3VWBA 1ON2A 1YHQI 4HV6A 1CQTA 1FT9A 4FQGA 1Y0NA 2VIXA 1IN7A 2G7HA 1MJ9A 5DS9A 3ESWB 4AIJA 1K61A 4OAYA 3NWTA 5HNFA 4NBQA 1YW9A 2DA2A 3I59A 2PQ8A 4BY7J 1EKEA 3FMRA 4EJWA 3ABUA 4H0EA 1B72A 3V4GA 2WAEA 2WB1A 2X6WA 2GLOA 4DIQA 2V1DA 4CCMA 4HLYA 5E3OA 3OSFA 1STZA 2M30A 4XKBA 4ZYHA 4ENKA 1J09A 1O3RA 4S04A 4IVNA 4FE7A 4L9JA 4KDPA 3X2QH 4IX7A 4PK4A 2NVTJ 3CCUI 3LSHA 2X6YA 3EPZA 5HDKA 2R7ZJ 2HPMA 2GXGA 2F5FA 2E7WA 2O3FA 2FQ4A 3WTSC 1DGWY 2L4MA 4G8XA 3CCEI
chains in the Genus database with same CATH topology
2M8EA 4Y15A 3P9CA 2PMHA 3TKYA 1XGNA 3TDUC 5ILUA 2XAGA 1PP8F 1BIBA 3ELKA 1XB4A 1KQ9A 4ZH4F 3IWZA 4UUVA 3RI4A 2DBBA 2RC4A 3ML6A 1O3TA 2Q2EA 2X0LA 3KP5A 5L3FA 3ZQ7A 2EA4A 3GXOA 1OKRA 1MGTA 1ZYRF 2VC1A 1LEBA 4HAMA 2Z33A 1RUOA 4S05A 1QZZA 5E1ZB 2LSOA 3AAFA 2M1BA 3CDHA 2Z9OA 1W4MA 3DPTA 2HYGD 4D0PA 1FP1D 5BOXA 1T0FA 3C1DA 2M5WA 3RKXA 1HKTA 1T98A 2IP2A 4QLCU 1I1GA 1B4AA 4MEXF 5L3EA 3DF8A 2ZO4A 4M6YA 3K1NA 2A6EF 1CF7B 1QZYA 2Z3YA 1YTYA 2XHKA 2GWRA 1YS7A 2VC0A 4ESFA 2VN2A 3IKTA 2DPDA 1CGPA 2DI3A 2EV0A 1HW2A 1KQ0A 4BQAA 2QBYA 4Y17A 1MDMA 4LFUA 4RB2C 1KA8A 3I64A 3R0JA 3QOPA 2HYFA 1XMAA 2XROA 3J81K 1ZGJA 1BI2A 4ON0A 4L18B 3HSRA 4M9SA 2O03A 4R79A 2NRAC 4RGRA 1DP7P 1U78A 1IN5A 2MD5A 2Q8KA 3K0LA 3TQNA 5DV5A 1P4AA 3N97A 3ZN1A 4B09A 4KIFA 1S7OA 2K7LA 3GO5A 3ZMTA 3KLNA 5HS8A 4HV5A 3IWFA 2EFQA 3HOTA 5HLIA 1J5YA 1O3SA 4LGWA 1JHHA 1LEAA 3I71A 2F5CA 5D8LB 3VODA 3RKYA 3GZ6A 1CF7A 3L7WA 4G9YA 4A0YA 1LVAA 1U5TA 1C0WA 2GAUA 1TLHB 2B0LA 2FEZA 1U8RA 5J6XA 1LDDA 3PQJA 3QRFF 2V9VA 1ZG5A 3DV8A 4IJAA 3BDDA 2EFPA 1VTNC 2C6YA 3WE2A 2QUFA 4I2OA 4MTEA 4Q47A 4RB0A 2OZUA 1R36A 2HS5A 1ZARA 3KETA 2GXBA 3MEXA 4IHTA 2MLKA 5L3CA 1FSHA 4WK8F 1TBXA 4ASNA 2FBIA 3EQLF 2VOPA 1REPC 2MBFA 5JHUA 2X4HA 4I0AA 2CO5A 4EM2A 2XUBA 4ENMA 2ELHA 1T39A 1U5TB 2F5EA 4KT5C 3OV8A 3EYIA 1LJ9A 3U1DA 3E5XA 3M8FA 3W6KB 1BN5A 5K5RA 5LRRA 1FNNA 3CJNA 2W85A 2CSOA 3ABTA 3C18A 3TGNA 1AWCA 3F8FA 1L3LA 3DQVC 4HF2A 4MQVA 2KJBA 3HRMA 4L0ZB 4LLGF 2KRFA 4A6EA 1H9TA 1UHWA 4XSXF 4A5NA 2HTSA 3JW4A 4FHTA 1LNWA 1ZRCA 1NHAA 3O2PE 2P5VA 5LLQA 1T38A 3GEZA 2L54A 4CHUA 1KGSA 1IXSB 3M8EA 2K86A 3CTAA 4HZFA 4I02A 5ILSA 3MFKA 3R6SA 4M74A 3DP7A 1RIOH 2K4JA 4FX4A 5CYVA 4LMYA 3F8BA 3K69A 3CUQC 3LAPA 1KYZA 3NQOA 1B9NA 1SFXA 4ZYDA 1BJAA 4M6XA 2J5OA 5AONA 3O6BB 2V1UA 3GFLA 3LWFA 2TDXA 4JBAA 2P6TA 4PCQA 2PJPA 3MZYA 1TNSA 3GUDA 4Q48A 3T8RA 2V79A 3Q9SA 4FT8A 3GFIA 4JQFA 2A68F 2ZMEB 4KYWA 4TV7A 1HSTA 4PDKA 2ZCWA 3COAC 3H3UA 4OIQF 4P9UA 3RYRA 1LDKB 2AXLA 4BHCA 2HWVA 2JPBA 2FNPA 5E17F 2P4WA 5FO5A 2P7CB 3KLOA 3B02A 1Z9CA 1AOYA 4HBLA 4RGSA 2HOEA 1SFUA 2BEOA 2LNBA 1XSDA 3FXQA 4RS8A 4BAYA 5ERIA 5L3DA 2CGPA 3I53A 5HS7A 2NAZA 1D8KA 1ODDA 5CVUA 2HQRA 2H27A 5BQTA 5K1YA 2FMLA 2A69F 3W6JB 1XDUA 3BJOA 3HRSA 4WF2A 1R7JA 4G7HF 3F3XA 3BROA 1FWZA 3WTUC 3R0AA 3F8CA 3R4KA 4EJTA 4IPAA 1G3YA 5TJJA 4Q5SF 2VBZA 4U0WA 1FBUA 1J75A 4P55A 3P9IA 4IHSA 1YG2A 2P5LC 4NQWA 1K79A 4AIHA 2HEOA 1SD4A 3I58A 2GA2A 5LGUA 2KKOA 4ZYEA 4YIFA 5FD5A 1SMTA 4GXOA 5HDGA 1SD7A 2FNAA 1JXSA 2XRNA 3F23A 5LBQA 1U5TC 4M73A 2ZKZA 2COMA 1R22A 3LA3A 1P4WA 5H6RA 3E6DA 4DQ2A 1EV7A 2GIVA 4YIIA 2JTVA 1FY7A 3GW2A 2A6HF 5DCMB 1JHFA 5KVRA 5TRDA 4U7DA 3I5UA 1FSEA 2Z99A 5EEHA 3N4MA 1W7PA 1EH8A 2ZNZA 4GCVA 5DYMA 5HLHA 4LK0F 1TQPA 2HKXA 3FM3A 5H6QA 1J59A 3E5UA 3J80Z 1HBXG 4OMZA 1XDSA 1WWXA 2YSRA 4O6JA 3ROUA 4ENNA 1USSA 2W57A 5K5QA 3RTRA 4OIRF 3PFIA 4A5MA 3U9GA 5JVTA 2VONA 3FMQA 3KP3A 1Z91A 1Z6TA 5LHHA 3RPQA 3BPXA 3RYPA 3FM5A 4EJOA 4I0BA 1IN6A 3IRQA 3HIFA 1SD5A 4L9NA 3QU6A 3FX3A 3T0YA 2R7DA 1ZAOA 1RNLA 5DUKA 5CVJA 2FMYA 3EETA 2IVMA 1P4XA 1ZN2A 2DLLA 3DPLC 2IA0A 1S29A 2XASA 2IT0A 2EJRA 2XAQA 5ICCA 1R5GA 3GF2A 3WU0A 3WGHA 4UHTA 4EMSA 1B9MA 3TOBA 4KICA 3QPHA 2QYOA 2JSCA 2PBIA 5FD6A 3M7GA 5EEGA 2Z5UA 4U0YA 4RAYA 5FFZA 3WTZA 2VBWA 4IRGA 3KP4A 4GO1A 4MHGA 3GWZA 2F2EA 2RN7A 4L0YB 2L02A 3SFZA 3TO7A 2F5DA 1ZGAA 4EM1A 3L9FA 5AIQA 5AIPA 2L4AA 1XGOA 3ZN0A 1YLFA 2W84A 3I4PA 4HF0A 4ESBA 4YFNF 3EYYA 4CGZA 2NYXA 1DPRA 4CYDA 4BHBA 1IUYA 3F8NA 4L9TA 2K27A 3ULQB 4DNCA 3ZP5A 1DUXC 2RNJA 1E2XA 3MWMA 4I09A 4ETSA 5E1WA 1GHCA 5E8GA 3KZYA 2XAHA 2PI0A 2K02A 2MH9A 1BC8C 3TO6A 5D4RA 1Y0UA 5LHGA 3IKVA 1BI3A 3WTTC 3O3KA 3QAHA 4CO8A 4OIPF 1KYWA 2XGXA 2PN6A 3RJPA 4GGGA 3IC7A 3KFWX 3L09A 3F21A 1XD7A 1BBYA 3K9TA 5BS6A 2YR2A 1T6SA 4OINF 4A6DA 4Z2YA 1QQIA 1YYVA 5F64A 2VBYA 1WSUA 5CVRA 2VODA 3U2RA 4A12A 5DCMA 3RPUA 5JFRA 5D8KB 2MLGA 3WODF 2UWMA 2RDPA 3EDPA 1G3TA 1IW7F 5E1XA 1YIOA 1BC7C 1QBJA 4LG0B 1FC3A 2L01A 3L2CA 3FHZA 2O0YA 2L3DA 3HYIA 4ZZLA 4G6QA 2UXXA 1FBSA 3QP6A 1G3WA 2D1VA 1BIAA 2ZFWA 3LA7A 4WXCA 4LB5A 2K4BA 5HDNA 1Z1DA 3R60A 3MAJA 5HLGA 1MD0A 3ZPLA 4AWXB 1SAXA 2FSWA 2OU2A 3M1EA 4G94A 2QVOA 3LAJA 2HZTA 2EV5A 2Y75A 1IRGA 5DUIA 4UV8A 4NHJA 2DO7A 2QWWA 4KIGA 3REOA 1ON1A 1USTA 1U2WA 3V8LA 3KZZA 5LHIA 4M72A 2LDUA 4P5OA 4CDGA 2D2WA 3E6CC 2FE3A 4KNYA 4AVPA 2EV6A 2JPCA 3SHFA 2VE8A 1OPCA 2HDCA 1FZPB 3SZTA 1EH7A 4EQQA 2W24A 2OZ6A 2MC3A 4OIOF 2WV0A 2XIGA 3NRVA 4BH9A 4G7ZF 5D6FA 3BOQA 1ZHFA 1XN7A 4M9ZA 1EH6A 2QBYB 1XCVA 1FLIA 2W25A 1RZ4A 4P96A 1IN4A 3DEUA 2H6CA 3E5QA 4NB5A 3KEOA 3I59B 3IL2A 4I98B 3WE3A 3QPTA 1HQCA 1YQAA 3J7AO 2CG4A 2H94A 3T1BA 1WI9A 2ESNA 1UFMA 2M45A 2V6CA 3HSFA 3ZMVA 2PMUA 2E1NA 1OYIA 4I01A 1MJAA 2IJLA 2LKPA 1XGSA 2FF4A 2NNYA 2QENA 1F1ZA 1B1BA 2ESHA 2AS5F 2CWEA 1P6RA 2XKPA 2ACJA 1I5ZA 1BOAA 1O57A 2DPUA 2FU4A 2VOOA 2PFBA 2DT5A 1ZRDA 3HTUA 4L5IA 5HVQC 3KP7A 2EA2A 4HQMA 2YX7A 2BV6A 2ZJ2A 4P9FA 4I7HA 5CVIA 2VT2A 2DK5A 1E17A 3HTSB 2CFXA 1K7AA 3CO6C 1FBQA 3KCCA 1JGSA 4CZZA 4O5VA 1WKMA 5A2QZ 4ZYGA 5CLSA 1W5TA 2LF8A 3HUGA 1FYMA 5IT9K 2BGCA 1A04A 2XVCA 1K78B 4YG2F 2CW0F 2Y0MA 2IRFG 4LB6B 4LLLA 2JRTA 3J81Z 2BYVE 5FFXA 3TOAA 1FP2A 1D3YA 1TQIA 1WQ2A 3K2ZA 5D4SA 3V8JA 3F22A 4IRIA 4OOIA 2E1CA 1SFEA 1ZLJA 2UXNA 3FZVA 6PAXA 1IXCA 1R23A 1J9IA 4U88A 1S7AA 1YS6A 4XBFA 3F72A 3ERED 5F6FA 3BPVA 5H20A 1D5VA 2RKHA 1FOKA 2R7FA 2V1XA 2P8TA 4B8XA 4LG0A 2GQQA 1UHMA 1J0RA 5KK1A 3ECOA 1XSVA 3JSOA 4YFKF 1MZBA 4MEYF 1XMKA 3SZPA 3HRTA 2KIFA 1K78A 2OQGA 1K6OA 2A3SA 4EVIA 1OMIA 3VFZA 3I54A 1ZG1A 3SQNA 5D5XB 4EV0A 3JTGA 4KA4A 1V4RA 5ICFA 3MCZA 5FGMA 1HW1A 3CO7C 1PP7U 2CQKA 2XV4S 2YPRA 2JZYA 4OU0A 4L9VA 4HLXA 1B6AA 1R58A 3V7CA 3FWEA 2WC2A 1PDNC 4LJZF 3WTWC 3D0SA 5E20A 1L0OC 2VT3A 4HA8A 4F7ZA 4BXUA 2EB7A 3TO9A 2IPQX 1GXPA 3V7SA 3VB2A 1O7FA 4PZJA 4WCGA 1S8NA 4HDUA 2O61A 2Y48A 1PUEE 4A0ZA 4MGRA 4E70A 3GFJA 3DXJF 3ZMZA 1U6GA 2PLYA 4HYEA 4U7BA 2VXZA 1HW5A 4UXNA 4UV9A 3F8MA 3VEPA 4ESJA 2CYYA 4RGXA 5DD4A 1J2XA 1SMYF 2XKOA 2KJCA 3GVAA 3LSTA 3B73A 2MA3A 3J80K 3WG9A 4LD5A 1ZG3A 1SD6A 2FRHA 2EFOA 4GYGA 4Q4ZF 3WTXC 2DQRA 2OBPA 2A5YB 5F1RA 4KFCA 4O3MA 3ZMSA 4EGYA 3IHUA 2DW4A 2J5PA 1XCBA 3S2WA 3GZ5A 1YW7A 4OMYA 3SXYA 1DPUA 2IA2A 2KIUA 1S3JA 3ECHA 2DFIA 2XAJA 1XGMA 2FA5A 2QM3A 4M9XA 3OOPA 3HSEA 2HGCA 3FXRA 2HFHA 5L3GA 4RB1A 3HRUA 1O3QA 2DU9A 2WTEA 5D5VB 4IF4A 4A0XA 5DEQA 3MZHA 4Y13A 5D5UB 4BHPA 4XSZF 3Q5FA 3GYHX 2BBYA 3G73A 1D8JA 3QP5A 1ZREA 4N9HA 2FBKA 4WXDA 1F5TA 3RDIA 1HKQA 2FOKA 3KE2A 4KIBA 4XRFA 3GX4X 1FPQA 2Q0OA 2UZKA 4M71A 2JT1A 2HR3A 3F6VA 4N9IA 1J7KA 4RB3C 4WX9A 2LF7A 1BM9A 2ZXJA 3HHHA 1HSJA 2R3SA 2GA1A 3HHGA 4A2UA 3Q9VA 3MQ0A 5A2QK 1LQ1A 4N0BA 1QGPA 1MKMA 1ONVA 3LA2A 2STTA 1W5SA 1GXQA 3T5XA 2A07F 4R8HA 1KQ8A 1XSXA 3V7RA 4RAZA 1ULYA 4AIKA 3L00A 2ZBKA 3KP2A 5DD8A 2YU3A 1QO0D 5ICEA 1ZH5A 5JI6A 3F6OA 1TTYA 4AD9A 4KN4X 5ED4A 3BP8A 1KU9A 3GLXA 1G6NA 1W7PD 2P7VB 1IZ1A 4G7OF 2O6GE 3RKWA 1UB9A 4HOBA 5D5WB 1Q1HA 1F4KA 3E6BA 5IT3A 1OYWA 5CJ9A 4R1HA 2D1HA 3BWGA 3DFGA 4FX0A 1HKSA 1Z6RA 1OR7A 5K5OA 5D6EA 1KU3A 3BZ6A 2DK8A 4QWQA 5FLXK 2VBXA 2ETHA 4HX4A 2OD5A 2ISYA 4KMFA 3T8TA 5ICGA 3BJ6A 1R1VA 1BI0A 1R1TA 1TW3A 4EJUA 1WRJA 4BYYA 5CVVA 4JK1X 3H3ZA 2FQ3A 2RGVA 2MH2A 1MDMB 2STWA 3LFKA 4EM0B 2QQBA 3FMSA 2EK5A 3LQQA 5J8CA 1IN8A 3CLOA 1Z05A 3BJAA 4UVCA 3CUQB 4ENJA 3WGIA 1R5HA 2P5KA 5LGTA 4U0VA 1F9NA 5ILVA 1H9GA 1GVJA 1KU7A 2P6SA 2QLZA 1I27A 4MNUA 1G3SA 4HDVA 2YX4A 4CICA 2WWYA 4K2EA 4BNCA 1P2FA 3WTVC 3D5LA 5DDGA 4WWCA 4HX7A 2OQRA 4IXAA 5BPIA 5LGNA 4LK1F 1S6LA 2D45A 1U3EM 3EUHA 2G9WA 1IRFA 2RVCA 3RIRA 1O7LA 3FXUA 4RGUA 4HW0A 1W7PB 2FBHA 3CUOA 2DTRA 2DQLA 3JAMZ 5J8FA 3C7JA 4UNOA 5HS9A 2IW5A 3LQRA 2O8XA 2ZNYA 2ZMEA 3HOSA 2NNNA 1RUNA 1DDNA 4HX8A 3DKWA 3JAMK 2GZWA 4ZZDA 5LRSA 2EFNA 1Z7UA 4WXHA 1G4DA 4PGGA 1IAWA 2OAZA 5FB2A 1QPMA 3CUQA 1P92A 1B59A 3R61A 3P7NA 4MTDA 4XLNF 3K1PA 2H09A 5BMZA 4L5JA 3H92A 1YFHA 3KP6A 3TDZC 3ISPA 3G3ZA 4CXFA 4LLNA 4IRHA 4PGHA 1ZLKA 1LDJA 2G7UA 5LEKA 2ISZA 2FXAA 4KN7X 3I0TA 4EJVA 3QU3A 1T2KA 1UCRA 4GYIA 1IF1A 1BI1A 2DAOA 3V8KA 3JSPA 2BE5F 1MJBA 3GFMA 4YFXF 2VE9A 3M9AA 3ZMUA 1LB2A 1FYLA 2EFWA 4HF1A 2ADUA 4HQEA 2M87A 5E8IA 1I6XA 2HQNA 3WU1B 1R1UA 2HTJA 1HXDA 2OA4A 1IXRC 5IT9Z 3PQKA 1ZRFA 3FF5A 1TQMA 4EGZA 1V3FA 1YW8A 2RV8A 3P9KA 5DCFA 5FLXZ 2QQAA 3KEQA 3IRRA 2XAFA 1OYYA 3E3VA 2PG4A 3BY6A 4G6DA 1RI7A 2E7XA 3K1MA 1TW2A 2NS0A 4MQ9F 2HKOA 5L3BA 3E6MA 3WGGA 1FX7A 5JR3A 1FYKA 2H6BA 1TNTA 1R00A 1QNTA 5HOOA 2EWNA 3VOEA 1KU2A 3WTYC 4KUMA 2KIMA 3ZMDA 1I1SA 3E97A 2RQPA 3C3WA 3JTHA 2QQ9A 3NEUA 1X3UA 5LEJA 4UVAA 1H0MA 5BPDA 1JE8A 1YO5C 2QZ8A 2A61A 2IA1A 4UVBA 5E18F 4XLPF 4KMUX 2PEXA 1ON2A 4HV6A 1FT9A 1IN7A 2G7HA 1MJ9A 4AIJA 1YW9A 3I59A 2PQ8A 3FMRA 4EJWA 3ABUA 4H0EA 3V4GA 2V1DA 4HLYA 1STZA 2M30A 4ZYHA 4ENKA 1O3RA 4S04A 4IVNA 4L9JA 4KDPA 5HDKA 2GXGA 2F5FA 2E7WA 2O3FA 3WTSC 2L4MA 4G8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8E A;  4Y15 A;  3P9C A;  2PMH A;  3TKY A;  1XGN A;  3TDU C;  5ILU A;  2XAG A;  1PP8 F;  1BIB A;  3ELK A;  1XB4 A;  1KQ9 A;  4ZH4 F;  3IWZ A;  4UUV A;  3RI4 A;  2DBB A;  2RC4 A;  3ML6 A;  1O3T A;  2Q2E A;  2X0L A;  3KP5 A;  5L3F A;  3ZQ7 A;  2EA4 A;  3GXO A;  1OKR A;  1MGT A;  1ZYR F;  2VC1 A;  1LEB A;  4HAM A;  2Z33 A;  1RUO A;  4S05 A;  1QZZ A;  5E1Z B;  2LSO A;  3AAF A;  2M1B A;  3CDH A;  2Z9O A;  1W4M A;  3DPT A;  2HYG D;  4D0P A;  1FP1 D;  5BOX A;  1T0F A;  3C1D A;  2M5W A;  3RKX A;  1HKT A;  1T98 A;  2IP2 A;  4QLC U;  1I1G A;  1B4A A;  4MEX F;  5L3E A;  3DF8 A;  2ZO4 A;  4M6Y A;  3K1N A;  2A6E F;  1CF7 B;  1QZY A;  2Z3Y A;  1YTY A;  2XHK A;  2GWR A;  1YS7 A;  2VC0 A;  4ESF A;  2VN2 A;  3IKT A;  2DPD A;  1CGP A;  2DI3 A;  2EV0 A;  1HW2 A;  1KQ0 A;  4BQA A;  2QBY A;  4Y17 A;  1MDM A;  4LFU A;  4RB2 C;  1KA8 A;  3I64 A;  3R0J A;  3QOP A;  2HYF A;  1XMA A;  2XRO A;  3J81 K;  1ZGJ A;  1BI2 A;  4ON0 A;  4L18 B;  3HSR A;  4M9S A;  2O03 A;  4R79 A;  2NRA C;  4RGR A;  1DP7 P;  1U78 A;  1IN5 A;  2MD5 A;  2Q8K A;  3K0L A;  3TQN A;  5DV5 A;  1P4A A;  3N97 A;  3ZN1 A;  4B09 A;  4KIF A;  1S7O A;  2K7L A;  3GO5 A;  3ZMT A;  3KLN A;  5HS8 A;  4HV5 A;  3IWF A;  2EFQ A;  3HOT A;  5HLI A;  1J5Y A;  1O3S A;  4LGW A;  1JHH A;  1LEA A;  3I71 A;  2F5C A;  5D8L B;  3VOD A;  3RKY A;  3GZ6 A;  1CF7 A;  3L7W A;  4G9Y A;  4A0Y A;  1LVA A;  1U5T A;  1C0W A;  2GAU A;  1TLH B;  2B0L A;  2FEZ A;  1U8R A;  5J6X A;  1LDD A;  3PQJ A;  3QRF F;  2V9V A;  1ZG5 A;  3DV8 A;  4IJA A;  3BDD A;  2EFP A;  1VTN C;  2C6Y A;  3WE2 A;  2QUF A;  4I2O A;  4MTE A;  4Q47 A;  4RB0 A;  2OZU A;  1R36 A;  2HS5 A;  1ZAR A;  3KET A;  2GXB A;  3MEX A;  4IHT A;  2MLK A;  5L3C A;  1FSH A;  4WK8 F;  1TBX A;  4ASN A;  2FBI A;  3EQL F;  2VOP A;  1REP C;  2MBF A;  5JHU A;  2X4H A;  4I0A A;  2CO5 A;  4EM2 A;  2XUB A;  4ENM A;  2ELH A;  1T39 A;  1U5T B;  2F5E A;  4KT5 C;  3OV8 A;  3EYI A;  1LJ9 A;  3U1D A;  3E5X A;  3M8F A;  3W6K B;  1BN5 A;  5K5R A;  5LRR A;  1FNN A;  3CJN A;  2W85 A;  2CSO A;  3ABT A;  3C18 A;  3TGN A;  1AWC A;  3F8F A;  1L3L A;  3DQV C;  4HF2 A;  4MQV A;  2KJB A;  3HRM A;  4L0Z B;  4LLG F;  2KRF A;  4A6E A;  1H9T A;  1UHW A;  4XSX F;  4A5N A;  2HTS A;  3JW4 A;  4FHT A;  1LNW A;  1ZRC A;  1NHA A;  3O2P E;  2P5V A;  5LLQ A;  1T38 A;  3GEZ A;  2L54 A;  4CHU A;  1KGS A;  1IXS B;  3M8E A;  2K86 A;  3CTA A;  4HZF A;  4I02 A;  5ILS A;  3MFK A;  3R6S A;  4M74 A;  3DP7 A;  1RIO H;  2K4J A;  4FX4 A;  5CYV A;  4LMY A;  3F8B A;  3K69 A;  3CUQ C;  3LAP A;  1KYZ A;  3NQO A;  1B9N A;  1SFX A;  4ZYD A;  1BJA A;  4M6X A;  2J5O A;  5AON A;  3O6B B;  2V1U A;  3GFL A;  3LWF A;  2TDX A;  4JBA A;  2P6T A;  4PCQ A;  2PJP A;  3MZY A;  1TNS A;  3GUD A;  4Q48 A;  3T8R A;  2V79 A;  3Q9S A;  4FT8 A;  3GFI A;  4JQF A;  2A68 F;  2ZME B;  4KYW A;  4TV7 A;  1HST A;  4PDK A;  2ZCW A;  3COA C;  3H3U A;  4OIQ F;  4P9U A;  3RYR A;  1LDK B;  2AXL A;  4BHC A;  2HWV A;  2JPB A;  2FNP A;  5E17 F;  2P4W A;  5FO5 A;  2P7C B;  3KLO A;  3B02 A;  1Z9C A;  1AOY A;  4HBL A;  4RGS A;  2HOE A;  1SFU A;  2BEO A;  2LNB A;  1XSD A;  3FXQ A;  4RS8 A;  4BAY A;  5ERI A;  5L3D A;  2CGP A;  3I53 A;  5HS7 A;  2NAZ A;  1D8K A;  1ODD A;  5CVU A;  2HQR A;  2H27 A;  5BQT A;  5K1Y A;  2FML A;  2A69 F;  3W6J B;  1XDU A;  3BJO A;  3HRS A;  4WF2 A;  1R7J A;  4G7H F;  3F3X A;  3BRO A;  1FWZ A;  3WTU C;  3R0A A;  3F8C A;  3R4K A;  4EJT A;  4IPA A;  1G3Y A;  5TJJ A;  4Q5S F;  2VBZ A;  4U0W A;  1FBU A;  1J75 A;  4P55 A;  3P9I A;  4IHS A;  1YG2 A;  2P5L C;  4NQW A;  1K79 A;  4AIH A;  2HEO A;  1SD4 A;  3I58 A;  2GA2 A;  5LGU A;  2KKO A;  4ZYE A;  4YIF A;  5FD5 A;  1SMT A;  4GXO A;  5HDG A;  1SD7 A;  2FNA A;  1JXS A;  2XRN A;  3F23 A;  5LBQ A;  1U5T C;  4M73 A;  2ZKZ A;  2COM A;  1R22 A;  3LA3 A;  1P4W A;  5H6R A;  3E6D A;  4DQ2 A;  1EV7 A;  2GIV A;  4YII A;  2JTV A;  1FY7 A;  3GW2 A;  2A6H F;  5DCM B;  1JHF A;  5KVR A;  5TRD A;  4U7D A;  3I5U A;  1FSE A;  2Z99 A;  5EEH A;  3N4M A;  1W7P A;  1EH8 A;  2ZNZ A;  4GCV A;  5DYM A;  5HLH A;  4LK0 F;  1TQP A;  2HKX A;  3FM3 A;  5H6Q A;  1J59 A;  3E5U A;  3J80 Z;  1HBX G;  4OMZ A;  1XDS A;  1WWX A;  2YSR A;  4O6J A;  3ROU A;  4ENN A;  1USS A;  2W57 A;  5K5Q A;  3RTR A;  4OIR F;  3PFI A;  4A5M A;  3U9G A;  5JVT A;  2VON A;  3FMQ A;  3KP3 A;  1Z91 A;  1Z6T A;  5LHH A;  3RPQ A;  3BPX A;  3RYP A;  3FM5 A;  4EJO A;  4I0B A;  1IN6 A;  3IRQ A;  3HIF A;  1SD5 A;  4L9N A;  3QU6 A;  3FX3 A;  3T0Y A;  2R7D A;  1ZAO A;  1RNL A;  5DUK A;  5CVJ A;  2FMY A;  3EET A;  2IVM A;  1P4X A;  1ZN2 A;  2DLL A;  3DPL C;  2IA0 A;  1S29 A;  2XAS A;  2IT0 A;  2EJR A;  2XAQ A;  5ICC A;  1R5G A;  3GF2 A;  3WU0 A;  3WGH A;  4UHT A;  4EMS A;  1B9M A;  3TOB A;  4KIC A;  3QPH A;  2QYO A;  2JSC A;  2PBI A;  5FD6 A;  3M7G A;  5EEG A;  2Z5U A;  4U0Y A;  4RAY A;  5FFZ A;  3WTZ A;  2VBW A;  4IRG A;  3KP4 A;  4GO1 A;  4MHG A;  3GWZ A;  2F2E A;  2RN7 A;  4L0Y B;  2L02 A;  3SFZ A;  3TO7 A;  2F5D A;  1ZGA A;  4EM1 A;  3L9F A;  5AIQ A;  5AIP A;  2L4A A;  1XGO A;  3ZN0 A;  1YLF A;  2W84 A;  3I4P A;  4HF0 A;  4ESB A;  4YFN F;  3EYY A;  4CGZ A;  2NYX A;  1DPR A;  4CYD A;  4BHB A;  1IUY A;  3F8N A;  4L9T A;  2K27 A;  3ULQ B;  4DNC A;  3ZP5 A;  1DUX C;  2RNJ A;  1E2X A;  3MWM A;  4I09 A;  4ETS A;  5E1W A;  1GHC A;  5E8G A;  3KZY A;  2XAH A;  2PI0 A;  2K02 A;  2MH9 A;  1BC8 C;  3TO6 A;  5D4R A;  1Y0U A;  5LHG A;  3IKV A;  1BI3 A;  3WTT C;  3O3K A;  3QAH A;  4CO8 A;  4OIP F;  1KYW A;  2XGX A;  2PN6 A;  3RJP A;  4GGG A;  3IC7 A;  3KFW X;  3L09 A;  3F21 A;  1XD7 A;  1BBY A;  3K9T A;  5BS6 A;  2YR2 A;  1T6S A;  4OIN F;  4A6D A;  4Z2Y A;  1QQI A;  1YYV A;  5F64 A;  2VBY A;  1WSU A;  5CVR A;  2VOD A;  3U2R A;  4A12 A;  5DCM A;  3RPU A;  5JFR A;  5D8K B;  2MLG A;  3WOD F;  2UWM A;  2RDP A;  3EDP A;  1G3T A;  1IW7 F;  5E1X A;  1YIO A;  1BC7 C;  1QBJ A;  4LG0 B;  1FC3 A;  2L01 A;  3L2C A;  3FHZ A;  2O0Y A;  2L3D A;  3HYI A;  4ZZL A;  4G6Q A;  2UXX A;  1FBS A;  3QP6 A;  1G3W A;  2D1V A;  1BIA A;  2ZFW A;  3LA7 A;  4WXC A;  4LB5 A;  2K4B A;  5HDN A;  1Z1D A;  3R60 A;  3MAJ A;  5HLG A;  1MD0 A;  3ZPL A;  4AWX B;  1SAX A;  2FSW A;  2OU2 A;  3M1E A;  4G94 A;  2QVO A;  3LAJ A;  2HZT A;  2EV5 A;  2Y75 A;  1IRG A;  5DUI A;  4UV8 A;  4NHJ A;  2DO7 A;  2QWW A;  4KIG A;  3REO A;  1ON1 A;  1UST A;  1U2W A;  3V8L A;  3KZZ A;  5LHI A;  4M72 A;  2LDU A;  4P5O A;  4CDG A;  2D2W A;  3E6C C;  2FE3 A;  4KNY A;  4AVP A;  2EV6 A;  2JPC A;  3SHF A;  2VE8 A;  1OPC A;  2HDC A;  1FZP B;  3SZT A;  1EH7 A;  4EQQ A;  2W24 A;  2OZ6 A;  2MC3 A;  4OIO F;  2WV0 A;  2XIG A;  3NRV A;  4BH9 A;  4G7Z F;  5D6F A;  3BOQ A;  1ZHF A;  1XN7 A;  4M9Z A;  1EH6 A;  2QBY B;  1XCV A;  1FLI A;  2W25 A;  1RZ4 A;  4P96 A;  1IN4 A;  3DEU A;  2H6C A;  3E5Q A;  4NB5 A;  3KEO A;  3I59 B;  3IL2 A;  4I98 B;  3WE3 A;  3QPT A;  1HQC A;  1YQA A;  3J7A O;  2CG4 A;  2H94 A;  3T1B A;  1WI9 A;  2ESN A;  1UFM A;  2M45 A;  2V6C A;  3HSF A;  3ZMV A;  2PMU A;  2E1N A;  1OYI A;  4I01 A;  1MJA A;  2IJL A;  2LKP A;  1XGS A;  2FF4 A;  2NNY A;  2QEN A;  1F1Z A;  1B1B A;  2ESH A;  2AS5 F;  2CWE A;  1P6R A;  2XKP A;  2ACJ A;  1I5Z A;  1BOA A;  1O57 A;  2DPU A;  2FU4 A;  2VOO A;  2PFB A;  2DT5 A;  1ZRD A;  3HTU A;  4L5I A;  5HVQ C;  3KP7 A;  2EA2 A;  4HQM A;  2YX7 A;  2BV6 A;  2ZJ2 A;  4P9F A;  4I7H A;  5CVI A;  2VT2 A;  2DK5 A;  1E17 A;  3HTS B;  2CFX A;  1K7A A;  3CO6 C;  1FBQ A;  3KCC A;  1JGS A;  4CZZ A;  4O5V A;  1WKM A;  5A2Q Z;  4ZYG A;  5CLS A;  1W5T A;  2LF8 A;  3HUG A;  1FYM A;  5IT9 K;  2BGC A;  1A04 A;  2XVC A;  1K78 B;  4YG2 F;  2CW0 F;  2Y0M A;  2IRF G;  4LB6 B;  4LLL A;  2JRT A;  3J81 Z;  2BYV E;  5FFX A;  3TOA A;  1FP2 A;  1D3Y A;  1TQI A;  1WQ2 A;  3K2Z A;  5D4S A;  3V8J A;  3F22 A;  4IRI A;  4OOI A;  2E1C A;  1SFE A;  1ZLJ A;  2UXN A;  3FZV A;  6PAX A;  1IXC A;  1R23 A;  1J9I A;  4U88 A;  1S7A A;  1YS6 A;  4XBF A;  3F72 A;  3ERE D;  5F6F A;  3BPV A;  5H20 A;  1D5V A;  2RKH A;  1FOK A;  2R7F A;  2V1X A;  2P8T A;  4B8X A;  4LG0 A;  2GQQ A;  1UHM A;  1J0R A;  5KK1 A;  3ECO A;  1XSV A;  3JSO A;  4YFK F;  1MZB A;  4MEY F;  1XMK A;  3SZP A;  3HRT A;  2KIF A;  1K78 A;  2OQG A;  1K6O A;  2A3S A;  4EVI A;  1OMI A;  3VFZ A;  3I54 A;  1ZG1 A;  3SQN A;  5D5X B;  4EV0 A;  3JTG A;  4KA4 A;  1V4R A;  5ICF A;  3MCZ A;  5FGM A;  1HW1 A;  3CO7 C;  1PP7 U;  2CQK A;  2XV4 S;  2YPR A;  2JZY A;  4OU0 A;  4L9V A;  4HLX A;  1B6A A;  1R58 A;  3V7C A;  3FWE A;  2WC2 A;  1PDN C;  4LJZ F;  3WTW C;  3D0S A;  5E20 A;  1L0O C;  2VT3 A;  4HA8 A;  4F7Z A;  4BXU A;  2EB7 A;  3TO9 A;  2IPQ X;  1GXP A;  3V7S A;  3VB2 A;  1O7F A;  4PZJ A;  4WCG A;  1S8N A;  4HDU A;  2O61 A;  2Y48 A;  1PUE E;  4A0Z A;  4MGR A;  4E70 A;  3GFJ A;  3DXJ F;  3ZMZ A;  1U6G A;  2PLY A;  4HYE A;  4U7B A;  2VXZ A;  1HW5 A;  4UXN A;  4UV9 A;  3F8M A;  3VEP A;  4ESJ A;  2CYY A;  4RGX A;  5DD4 A;  1J2X A;  1SMY F;  2XKO A;  2KJC A;  3GVA A;  3LST A;  3B73 A;  2MA3 A;  3J80 K;  3WG9 A;  4LD5 A;  1ZG3 A;  1SD6 A;  2FRH A;  2EFO A;  4GYG A;  4Q4Z F;  3WTX C;  2DQR A;  2OBP A;  2A5Y B;  5F1R A;  4KFC A;  4O3M A;  3ZMS A;  4EGY A;  3IHU A;  2DW4 A;  2J5P A;  1XCB A;  3S2W A;  3GZ5 A;  1YW7 A;  4OMY A;  3SXY A;  1DPU A;  2IA2 A;  2KIU A;  1S3J A;  3ECH A;  2DFI A;  2XAJ A;  1XGM A;  2FA5 A;  2QM3 A;  4M9X A;  3OOP A;  3HSE A;  2HGC A;  3FXR A;  2HFH A;  5L3G A;  4RB1 A;  3HRU A;  1O3Q A;  2DU9 A;  2WTE A;  5D5V B;  4IF4 A;  4A0X A;  5DEQ A;  3MZH A;  4Y13 A;  5D5U B;  4BHP A;  4XSZ F;  3Q5F A;  3GYH X;  2BBY A;  3G73 A;  1D8J A;  3QP5 A;  1ZRE A;  4N9H A;  2FBK A;  4WXD A;  1F5T A;  3RDI A;  1HKQ A;  2FOK A;  3KE2 A;  4KIB A;  4XRF A;  3GX4 X;  1FPQ A;  2Q0O A;  2UZK A;  4M71 A;  2JT1 A;  2HR3 A;  3F6V A;  4N9I A;  1J7K A;  4RB3 C;  4WX9 A;  2LF7 A;  1BM9 A;  2ZXJ A;  3HHH A;  1HSJ A;  2R3S A;  2GA1 A;  3HHG A;  4A2U A;  3Q9V A;  3MQ0 A;  5A2Q K;  1LQ1 A;  4N0B A;  1QGP A;  1MKM A;  1ONV A;  3LA2 A;  2STT A;  1W5S A;  1GXQ A;  3T5X A;  2A07 F;  4R8H A;  1KQ8 A;  1XSX A;  3V7R A;  4RAZ A;  1ULY A;  4AIK A;  3L00 A;  2ZBK A;  3KP2 A;  5DD8 A;  2YU3 A;  1QO0 D;  5ICE A;  1ZH5 A;  5JI6 A;  3F6O A;  1TTY A;  4AD9 A;  4KN4 X;  5ED4 A;  3BP8 A;  1KU9 A;  3GLX A;  1G6N A;  1W7P D;  2P7V B;  1IZ1 A;  4G7O F;  2O6G E;  3RKW A;  1UB9 A;  4HOB A;  5D5W B;  1Q1H A;  1F4K A;  3E6B A;  5IT3 A;  1OYW A;  5CJ9 A;  4R1H A;  2D1H A;  3BWG A;  3DFG A;  4FX0 A;  1HKS A;  1Z6R A;  1OR7 A;  5K5O A;  5D6E A;  1KU3 A;  3BZ6 A;  2DK8 A;  4QWQ A;  5FLX K;  2VBX A;  2ETH A;  4HX4 A;  2OD5 A;  2ISY A;  4KMF A;  3T8T A;  5ICG A;  3BJ6 A;  1R1V A;  1BI0 A;  1R1T A;  1TW3 A;  4EJU A;  1WRJ A;  4BYY A;  5CVV A;  4JK1 X;  3H3Z A;  2FQ3 A;  2RGV A;  2MH2 A;  1MDM B;  2STW A;  3LFK A;  4EM0 B;  2QQB A;  3FMS A;  2EK5 A;  3LQQ A;  5J8C A;  1IN8 A;  3CLO A;  1Z05 A;  3BJA A;  4UVC A;  3CUQ B;  4ENJ A;  3WGI A;  1R5H A;  2P5K A;  5LGT A;  4U0V A;  1F9N A;  5ILV A;  1H9G A;  1GVJ A;  1KU7 A;  2P6S A;  2QLZ A;  1I27 A;  4MNU A;  1G3S A;  4HDV A;  2YX4 A;  4CIC A;  2WWY A;  4K2E A;  4BNC A;  1P2F A;  3WTV C;  3D5L A;  5DDG A;  4WWC A;  4HX7 A;  2OQR A;  4IXA A;  5BPI A;  5LGN A;  4LK1 F;  1S6L A;  2D45 A;  1U3E M;  3EUH A;  2G9W A;  1IRF A;  2RVC A;  3RIR A;  1O7L A;  3FXU A;  4RGU A;  4HW0 A;  1W7P B;  2FBH A;  3CUO A;  2DTR A;  2DQL A;  3JAM Z;  5J8F A;  3C7J A;  4UNO A;  5HS9 A;  2IW5 A;  3LQR A;  2O8X A;  2ZNY A;  2ZME A;  3HOS A;  2NNN A;  1RUN A;  1DDN A;  4HX8 A;  3DKW A;  3JAM K;  2GZW A;  4ZZD A;  5LRS A;  2EFN A;  1Z7U A;  4WXH A;  1G4D A;  4PGG A;  1IAW A;  2OAZ A;  5FB2 A;  1QPM A;  3CUQ A;  1P92 A;  1B59 A;  3R61 A;  3P7N A;  4MTD A;  4XLN F;  3K1P A;  2H09 A;  5BMZ A;  4L5J A;  3H92 A;  1YFH A;  3KP6 A;  3TDZ C;  3ISP A;  3G3Z A;  4CXF A;  4LLN A;  4IRH A;  4PGH A;  1ZLK A;  1LDJ A;  2G7U A;  5LEK A;  2ISZ A;  2FXA A;  4KN7 X;  3I0T A;  4EJV A;  3QU3 A;  1T2K A;  1UCR A;  4GYI A;  1IF1 A;  1BI1 A;  2DAO A;  3V8K A;  3JSP A;  2BE5 F;  1MJB A;  3GFM A;  4YFX F;  2VE9 A;  3M9A A;  3ZMU A;  1LB2 A;  1FYL A;  2EFW A;  4HF1 A;  2ADU A;  4HQE A;  2M87 A;  5E8I A;  1I6X A;  2HQN A;  3WU1 B;  1R1U A;  2HTJ A;  1HXD A;  2OA4 A;  1IXR C;  5IT9 Z;  3PQK A;  1ZRF A;  3FF5 A;  1TQM A;  4EGZ A;  1V3F A;  1YW8 A;  2RV8 A;  3P9K A;  5DCF A;  5FLX Z;  2QQA A;  3KEQ A;  3IRR A;  2XAF A;  1OYY A;  3E3V A;  2PG4 A;  3BY6 A;  4G6D A;  1RI7 A;  2E7X A;  3K1M A;  1TW2 A;  2NS0 A;  4MQ9 F;  2HKO A;  5L3B A;  3E6M A;  3WGG A;  1FX7 A;  5JR3 A;  1FYK A;  2H6B A;  1TNT A;  1R00 A;  1QNT A;  5HOO A;  2EWN A;  3VOE A;  1KU2 A;  3WTY C;  4KUM A;  2KIM A;  3ZMD A;  1I1S A;  3E97 A;  2RQP A;  3C3W A;  3JTH A;  2QQ9 A;  3NEU A;  1X3U A;  5LEJ A;  4UVA A;  1H0M A;  5BPD A;  1JE8 A;  1YO5 C;  2QZ8 A;  2A61 A;  2IA1 A;  4UVB A;  5E18 F;  4XLP F;  4KMU X;  2PEX A;  1ON2 A;  4HV6 A;  1FT9 A;  1IN7 A;  2G7H A;  1MJ9 A;  4AIJ A;  1YW9 A;  3I59 A;  2PQ8 A;  3FMR A;  4EJW A;  3ABU A;  4H0E A;  3V4G A;  2V1D A;  4HLY A;  1STZ A;  2M30 A;  4ZYH A;  4ENK A;  1O3R A;  4S04 A;  4IVN A;  4L9J A;  4KDP A;  5HDK A;  2GXG A;  2F5F A;  2E7W A;  2O3F A;  3WTS C;  2L4M A;  4G8X A; 
#chains in the Genus database with same CATH topology
 2M8E A;  2QKM B;  4Y15 A;  3P9C A;  5EG0 A;  2PMH A;  4J01 A;  3PNY A;  2R7R A;  3TKY A;  3JRI A;  1XGN A;  3TDU C;  4XRS A;  5ILU A;  2K9S A;  2XAG A;  1PP8 F;  1BIB A;  2MW8 A;  3ELK A;  1Y1W J;  1RRJ A;  2M2E A;  1XB4 A;  1KQ9 A;  4ZH4 F;  4DYC A;  3IWZ A;  3LSM A;  1YIJ I;  2R5Y A;  3FBN B;  4UUV A;  3RI4 A;  1F36 A;  2DBB A;  5FLM J;  2RC4 A;  3ML6 A;  1O3T A;  2E71 A;  3BC8 A;  2Q2E A;  2X0L A;  3KP5 A;  5L3F A;  3ZQ7 A;  2LKS A;  2EA4 A;  2HDW A;  2HXO A;  4B44 A;  3GXO A;  1OKR A;  1MGT A;  3D5R C;  1ZYR F;  2VC1 A;  1LEB A;  3HXL A;  4HAM A;  3HGY A;  5GAG J;  2Z33 A;  2K9L A;  4BXF A;  2A5W A;  1RUO A;  4S05 A;  1QZZ A;  5E1Z B;  3MMY B;  2LSO A;  3AAF A;  3BR1 A;  2M1B A;  3CDH A;  2Z9O A;  1W4M A;  3DPT A;  4BJ5 C;  4MFE A;  2HYG D;  4D0P A;  4ZYA A;  2LC2 A;  1FP1 D;  2FD5 A;  3HKZ A;  4IOA F;  4OWR B;  2E1M C;  1NK3 P;  3GME A;  5BOX A;  2XDV A;  1T0F A;  3C1D A;  1N75 A;  2P81 A;  3KEY A;  2M5W A;  3RKX A;  1QHG A;  1HKT A;  1XMX A;  1T98 A;  2IP2 A;  2VKH A;  4QLC U;  4A3I J;  1I1G A;  3M4O J;  1B4A A;  4MEX F;  2XF5 A;  5L3E A;  2K40 A;  1G2H A;  3DF8 A;  2EBI A;  1E0E A;  4XR6 A;  1S72 I;  4DGW B;  3IH4 A;  4F91 B;  4BQN A;  1X19 A;  2ZO4 A;  2X6O A;  3K1N A;  4M6Y A;  2A6E F;  1IDY A;  3CME I;  1CF7 B;  1NG7 A;  1QZY A;  2Z3Y A;  1PVE A;  3RZD J;  2HOS A;  2L7F P;  1IC8 A;  1YTY A;  1X2M A;  2XHK A;  4GRI A;  2GWR A;  2DA6 A;  2WBM A;  1YS7 A;  1LKX A;  2VC0 A;  3OSG A;  4ESF A;  2VN2 A;  3CC7 I;  3IKT A;  4XNF A;  2DPD A;  2DDA A;  1CGP A;  2V9P A;  2EIM H;  1OCR H;  3BLY A;  4ZJZ A;  2DI3 A;  2EV0 A;  2LYC A;  5IP6 A;  5J4V A;  4CYC A;  1HW2 A;  1KQ0 A;  4BQA A;  4Y52 J;  2QBY A;  2HOT A;  4Y17 A;  1MDM A;  4LFU A;  4RB2 C;  4J00 A;  1Q1V A;  1ETO A;  3KZI C;  1KA8 A;  4D1Q A;  3I64 A;  1N77 A;  1GV2 A;  3R0J A;  1SFK A;  3M8J A;  1QA6 A;  3UKG A;  4Z6Y A;  5IP7 J;  3BTC A;  1NH3 A;  5KNL A;  3QOP A;  2X9D A;  2HYF A;  1XMA A;  2XRO A;  3H5A A;  3N05 A;  5E3N A;  1ZGJ A;  4BL0 B;  2QKL B;  3J81 K;  1BI2 A;  2LTP A;  4ON0 A;  4L18 B;  1MIJ A;  5FKN A;  3HSR A;  2DA4 A;  2QGU A;  4F93 B;  4MIM A;  3RSN A;  5IOY A;  2VLA A;  5CPR B;  2R4G A;  4M9S A;  2O03 A;  1JGG A;  9ANT A;  3Q0W A;  4R79 A;  2NRA C;  4RGR A;  1R49 A;  2X1E A;  4ZTJ A;  1DP7 P;  1U78 A;  1OCP A;  2VXD A;  4AYB N;  3ABM H;  4E7J A;  1IN5 A;  3VSK A;  2MD5 A;  2Q8K A;  3K0L A;  3TQN A;  5DV5 A;  1P4A A;  3N97 A;  3ZN1 A;  2BVM A;  4KIF A;  4B09 A;  2HOA A;  1S7O A;  2K7L A;  2LBF A;  3GO5 A;  4UB8 C;  4DBR A;  4HNV A;  3ZMT A;  3KLN A;  5HS8 A;  4HV5 A;  3IWF A;  2EFQ A;  2MFZ A;  1U8B A;  1TWH J;  3GBG A;  3HOT A;  2DMN A;  4Y4R A;  5HLI A;  1J5Y A;  1O3S A;  2KPM A;  1ZK8 A;  4LGW A;  2LG4 A;  1JHH A;  1LEA A;  2F4O B;  1LFP A;  3I71 A;  2F5C A;  5D8L B;  5J47 A;  4XLF A;  1X2N A;  3BCB A;  3VOD A;  5K7H A;  3RKY A;  3GZ6 A;  1CF7 A;  2JMW A;  3L7W A;  4G9Y A;  4A0Y A;  1VQO I;  2LFB A;  1LVA A;  4BU2 A;  2X1D A;  1U5T A;  3HL2 A;  1VQ9 I;  1C0W A;  2GAU A;  2WAQ N;  1TLH B;  2ZC2 A;  4BJ6 C;  4OAZ A;  2B0L A;  2FEZ A;  1U8R A;  3L2W A;  3DBR B;  5J6X A;  4NDL A;  1LDD A;  2HNH A;  1Z77 A;  2ME0 A;  3ZOB A;  1Z67 A;  3PQJ A;  1NK2 P;  3QRF F;  2V9V A;  1ZG5 A;  2BW3 A;  3DV8 A;  4IJA A;  3BDD A;  3OYA A;  3K4J A;  2I10 A;  3IAS 2;  4XLE A;  3M3Y J;  2EFP A;  3KX2 A;  1FTT A;  1JTX A;  1A5J A;  2CJJ A;  4M3B A;  2QQ8 A;  1VTN C;  1VQP I;  2C6Y A;  1E3H A;  1WJC A;  1Z3Y A;  2QUF A;  3WE2 A;  2VPR A;  4I2O A;  1IJW C;  1UEL B;  3OL3 A;  5JLW A;  1BW6 A;  4MTE A;  1MH3 A;  4Q47 A;  1ZR4 A;  2XSD C;  4RB0 A;  2OZU A;  3ZQL A;  1R36 A;  3BG9 A;  2HS5 A;  1ZAR A;  3KET A;  3CCM I;  1BA5 A;  5IY5 H;  2GXB A;  5GAH J;  3MEX A;  3PO3 J;  1HOM A;  4E7H A;  4IKF A;  4IHT A;  3Q3S A;  1JKP C;  3J7Z I;  2MLK A;  3I3L A;  2I8D A;  4BQQ A;  4LIU A;  2A05 A;  5L3C A;  3OYH A;  4E7Z A;  2XF7 A;  1LE8 B;  1FSH A;  3NAU A;  1GVD A;  2CRG A;  2ZFU A;  4J19 A;  1EA3 A;  1ETQ A;  1TBX A;  4WK8 F;  4ASN A;  2HXI A;  2FBI A;  3PIP F;  3HKZ N;  4JX6 A;  1Z7L A;  3EQL F;  1EF4 A;  2VOP A;  1X4P A;  3TP0 A;  1REP C;  3DCF A;  2MBF A;  2NS8 A;  5JHU A;  5EGO B;  2X4H A;  4I0A A;  2HU9 A;  2CV0 A;  4X1E A;  2CO5 A;  3WG7 H;  5J1Y A;  4EM2 A;  2XUB A;  4ENM A;  2ELH A;  1T39 A;  3BR5 A;  1U5T B;  2F5E A;  4KT5 C;  1TL8 A;  2Y30 A;  1FIA A;  1PUF B;  3OV8 A;  3BG7 A;  3EYI A;  5EG0 B;  1LJ9 A;  4RLQ A;  3FDY A;  3U1D A;  3E5X A;  3M8F A;  1MBG A;  2DCE A;  4MO7 A;  3W6K B;  1FEX A;  1BJZ A;  1BN5 A;  5K5R A;  4X6A J;  2LRE A;  1B8I A;  5LRR A;  2R5Y B;  3PNV A;  1Z0X A;  2DMU A;  4BY1 J;  1MND A;  4IQ4 A;  1FNN A;  3CJN A;  1QZE A;  2QSH X;  2W85 A;  2CSO A;  3ABT A;  3RCO A;  3C18 A;  3LSI A;  3TGN A;  1AWC A;  3F8F A;  1L3L A;  3AKZ A;  2LOO A;  3DQV C;  4HF2 A;  1ETY A;  4MQV A;  1UAA A;  2KJB A;  3HRM A;  4L0Z B;  4LLG F;  2DFH A;  5K7Z A;  2H8R A;  2KRF A;  2KQR A;  4A6E A;  2B9S A;  1H9T A;  3LMM A;  1I50 J;  1UHW A;  4XSX F;  4A5N A;  2IGO A;  2VPL A;  2PX9 A;  2HTS A;  4LIV A;  4ZDO A;  3JW4 A;  4FHT A;  1LNW A;  1A36 A;  1ZRC A;  1NHA A;  2X51 A;  3O2P E;  2P5V A;  5LLQ A;  1T38 A;  3GEZ A;  1S9H A;  2L54 A;  4CHU A;  3PIO F;  2F5V A;  2M34 A;  2DYR H;  4JOM A;  1KGS A;  3S16 J;  1IXS B;  4A3G J;  3M8E A;  2K86 A;  3CTA A;  4HZF A;  4I02 A;  3BG6 A;  3OYJ A;  5ILS A;  3MFK A;  2O9L A;  3R6S A;  4MFD A;  3HPH A;  4M74 A;  3DP7 A;  1RIO H;  5IYD J;  2K4J A;  4FX4 A;  1P7I A;  5CYV A;  4LMY A;  2JK3 A;  1X4O A;  1I3A A;  3DBL B;  3F8B A;  1BOB A;  3CUQ C;  3K69 A;  5F04 A;  3LAP A;  4AM3 A;  3K4K A;  1KYZ A;  3NQO A;  3ZRG A;  1B9N A;  4BQO A;  1SFX A;  4CUG A;  1BJA A;  4ZYD A;  4FET A;  3DEE A;  4M6X A;  1OLT A;  1MW7 A;  2IGM A;  2J5O A;  2EZK A;  5E3L A;  3DTE A;  1W5C C;  5AON A;  4AU7 A;  3O6B B;  4ITV A;  2V1U A;  3GFL A;  3OR2 C;  1MBF A;  3LWF A;  3SDG A;  2IS4 A;  2TDX A;  4JBA A;  2P6T A;  4PCQ A;  2PJP A;  3MZY A;  3CJR B;  3JRD A;  1TNS A;  3GUD A;  1F43 A;  4Q48 A;  1QRY A;  4E6K G;  3SFI A;  3T8R A;  1WJ5 A;  2CFO A;  4C3J J;  4BE1 A;  1R4N B;  2V79 A;  3Q9S A;  1ZTR A;  1I39 A;  1VQ5 I;  4MLO A;  4ZTF A;  4FT8 A;  1XTA A;  3GFI A;  2NVX J;  4JQF A;  2E60 A;  2L9N A;  4XMY A;  5GTI C;  2A68 F;  2ZME B;  1FOY A;  4KYW A;  4NC7 A;  4TV7 A;  1MNM C;  5C4J J;  1HST A;  4PDK A;  2ZCW A;  3COA C;  3H3U A;  2I5U A;  4XON A;  1D5Y A;  4OIQ F;  4P9U A;  5IOZ A;  3RYR A;  1LDK B;  2AXL A;  2YUS A;  3OIQ A;  3UR3 C;  4BHC A;  5J4Y A;  4YRV A;  2HWV A;  2K5C A;  3EUH C;  2JPB A;  2CS3 A;  2FNP A;  3FK7 A;  5E17 F;  2P4W A;  1YJ9 I;  1VQ7 I;  5FO5 A;  2P7C B;  2ZXH A;  3KLO A;  2VQL A;  3B02 A;  1VND A;  3E1S A;  1Z9C A;  1AOY A;  4F92 B;  4HBL A;  4RGS A;  2R7V A;  2HOE A;  4CSW A;  1SFU A;  2BEO A;  2VAS A;  1TZL A;  2BY1 A;  3S93 A;  3H35 A;  2M0M A;  1VZ0 A;  2LNB A;  1XSD A;  2JQ7 A;  3FXQ A;  4RS8 A;  4BAY A;  5ERI A;  3HJE A;  5L3D A;  3CCV I;  2CGP A;  2LRD A;  1MMG A;  3I53 A;  5HS7 A;  2NAZ A;  1D8K A;  3CCJ I;  4NNJ A;  1ODD A;  5CVU A;  3B6C A;  3H5R A;  2HQR A;  2H27 A;  3BTL A;  1UZC A;  3JRA A;  5BQT A;  5K1Y A;  2FML A;  2A69 F;  2ZXW H;  3W6J B;  1XDU A;  3FIS A;  3BJO A;  2MGQ A;  3HRS A;  4WF2 A;  1R7J A;  4G7H F;  5EYR A;  2HQA A;  2R7Q A;  3F3X A;  3I4M J;  3BRO A;  4PJM A;  1N25 A;  1FWZ A;  1MMA A;  1RC9 A;  3PSI A;  3EUK L;  2R7T A;  3WTU C;  4G6T B;  1BR1 A;  3MKW B;  3S1N J;  3R0A A;  4NUB A;  4YEL A;  3F8C A;  3J7A Y;  3R4K A;  3A01 B;  3U1K A;  4EJT A;  3S1M J;  1A6Q A;  2NOG A;  4RLF A;  4IPA A;  5B1B H;  2VJI A;  5J3L A;  1G3Y A;  5TJJ A;  1EJ9 A;  4Q5S F;  2VBZ A;  4U0W A;  1S5L C;  2LLK A;  1FBU A;  1J75 A;  3G6E I;  4P55 A;  1RKW A;  3P9I A;  4IHS A;  3CMY A;  1YG2 A;  4CCL A;  2P5L C;  2Y0S A;  4BGD A;  4NQW A;  3QWL A;  3VYU B;  4AIH A;  1SD4 A;  4XID A;  1K79 A;  2HEO A;  1HA8 A;  2K3P A;  1U0J A;  1UHS A;  2ZME C;  3I58 A;  3JRH A;  3HOX J;  2GA2 A;  2L9V A;  2K3F A;  3CP2 A;  2JN6 A;  5LGU A;  2BHY A;  2KKO A;  4ZYE A;  5FRM A;  4YIF A;  1LFB A;  5FD5 A;  2L5Q A;  1SMT A;  4GXO A;  5HDG A;  1SD7 A;  2FNA A;  1JXS A;  2XRN A;  2CUF A;  3F23 A;  3RQ4 A;  3BTI A;  5LBQ A;  1U5T C;  4M73 A;  2ZKZ A;  2DOD A;  2R5Z A;  1JKR C;  5H2F C;  2COM A;  1R22 A;  3LA3 A;  1P4W A;  2MSY A;  5H6R A;  4RM3 A;  2DXI A;  2AXT C;  3E6D A;  4DQ2 A;  1EV7 A;  2LKX A;  4A3B J;  1W0T A;  2GIV A;  2JTV A;  4YII A;  1FY7 A;  4CZC A;  3H5N A;  4C30 A;  3GW2 A;  2A6H F;  1SC7 A;  5DCM B;  1JHF A;  5KVR A;  2M0C A;  4XOR A;  5TRD A;  4U7D A;  3I5U A;  1FSE A;  2Z99 A;  5EEH A;  3N4M A;  2KRH A;  1W7P A;  1EH8 A;  2ZNZ A;  3TP3 A;  4D7M A;  1X1A A;  4GCV A;  3HOZ J;  5DYM A;  3CMM A;  5HLH A;  1D1C A;  4LK0 F;  1TQP A;  2HKX A;  3FM3 A;  5H6Q A;  3TMO A;  2DMQ A;  1J59 A;  4C2T A;  1E3P A;  3E5U A;  3CES A;  3J80 Z;  2ECB A;  1IO2 A;  1JT6 A;  1HBX G;  4A93 J;  1X1C A;  4OMZ A;  2MYS A;  1XDS A;  1WWX A;  2V26 A;  3VYR B;  2YSR A;  4O6J A;  2DOE A;  4PFO A;  2CW8 A;  3HGG A;  1B8I B;  4NC8 A;  3I4N J;  1E3O C;  2DA5 A;  4CH7 A;  3ROU A;  3A03 A;  4ENN A;  1USS A;  1OQY A;  2W57 A;  4LG3 A;  4RM2 A;  4OIR F;  3PFI A;  3RTR A;  4A5M A;  5K5Q A;  4C3I J;  3U9G A;  2KDO A;  3BR3 A;  5JVT A;  2VON A;  3FMQ A;  3KP3 A;  2LD5 A;  3QPL A;  3K6G A;  2JVH A;  1Z91 A;  1Z6T A;  5LHH A;  3CCQ I;  3OIP A;  3RPQ A;  3G1O A;  3BPX A;  3CF2 A;  4CCJ A;  2JWT A;  3RYP A;  5KAI C;  4XRM A;  5CQE A;  4BAC A;  1W36 D;  2BVL A;  3HOY J;  4HSR A;  3ZQF A;  2W7N A;  2E2H J;  3FM5 A;  4EJO A;  4I0B A;  1IN6 A;  4N4N B;  3QOD A;  4BE0 A;  2VQH A;  4DJA A;  3W2A A;  3IRQ A;  4HNU A;  2HI3 A;  3OYF A;  1FMW A;  3HIF A;  1SD5 A;  2NXN B;  4DZJ A;  1POG A;  2E36 A;  3QU6 A;  4L9N A;  3FX3 A;  2LR8 A;  2WA0 A;  3H9J A;  3T0Y A;  2R7D A;  2LMD A;  5TIS C;  1ZAO A;  3IH3 A;  1R5I D;  1RNL A;  5CVJ A;  5DUK A;  3EET A;  2FMY A;  3KYC B;  1O4X A;  2IVM A;  1P4X A;  1ZN2 A;  4DW6 A;  2DLL A;  3DPL C;  2IA0 A;  1S29 A;  2NOJ B;  2R93 J;  1WI3 A;  2XAS A;  2IT0 A;  2EJR A;  1RR8 C;  2XAQ A;  5ICC A;  2ZSI B;  1R5G A;  3HM5 A;  3GF2 A;  1A31 A;  3WU0 A;  2LY2 A;  5IP9 J;  3WGH A;  1ETV A;  3NWS A;  4UHT A;  4D5C A;  3CCY A;  2OV7 A;  3S2D J;  2GBY A;  4EMS A;  1B9M A;  3TOB A;  4KIC A;  2XC7 A;  3A02 A;  3HC7 A;  3AFH A;  1VQ6 I;  2XF6 A;  3QPH A;  1DQU A;  2QYO A;  4IO9 F;  2JSC A;  2PBI A;  2YS9 A;  1N78 A;  5FD6 A;  3CCL I;  3OY9 A;  1ORK A;  3M7G A;  5EEG A;  2Z5U A;  1NG6 A;  4U0Y A;  3BG5 A;  4RAY A;  5FFZ A;  3WTZ A;  5B1A H;  2DYS H;  2VBW A;  4IRG A;  2VI6 A;  3KP4 A;  4GO1 A;  2RNG A;  4MHG A;  3OS1 A;  3GWZ A;  2F2E A;  2RN7 A;  4L0Y B;  3S1R J;  2L02 A;  4KIS A;  3AG1 H;  3SFZ A;  3GTO J;  5C4X J;  3PL8 A;  3TO7 A;  2UUZ A;  3MD2 A;  1G59 A;  3BQZ A;  2BOL A;  2F5D A;  1ZGA A;  4EM1 A;  4AID A;  3H9Q A;  3L9F A;  3OS0 A;  2EQR A;  3L2U A;  5F08 A;  5AIQ A;  5AIP A;  2L4A A;  4XRS G;  1XGO A;  3OL4 A;  3ZN0 A;  1YLF A;  2L7Z A;  4AVZ A;  2W84 A;  3I4P A;  4HF0 A;  4ESB A;  4YFN F;  2ME6 A;  3EYY A;  4PJL A;  4CGZ A;  3ZXS A;  2OPT A;  1DPR A;  2NYX A;  4CYD A;  2Y9Z A;  2W82 A;  4BHB A;  1IUY A;  3I55 I;  3K10 A;  1RES A;  2K9M A;  3F8N A;  2ZB9 A;  2M4G A;  4BEH B;  3H36 A;  4L9T A;  2K27 A;  3ULQ B;  4DNC A;  3FIW A;  3ZP5 A;  2JA7 J;  1YE9 A;  1DUX C;  3OYC A;  1ENH A;  2RNJ A;  1FMV A;  2HVR A;  1IGN A;  2KZG A;  1E2X A;  3MWM A;  4I09 A;  3OYG A;  4RMN A;  4ZDP A;  4ETS A;  3PNT A;  5E1W A;  3OYL A;  1VQN I;  1GHC A;  5E8G A;  2R7U A;  3KZY A;  4U87 A;  1FIP A;  2XAH A;  3DWL E;  3FXK A;  2PI0 A;  3C2H A;  3FBI B;  2K02 A;  2MH9 A;  1BC8 C;  4UB6 C;  2OF7 A;  2PJR A;  2IGN A;  3TO6 A;  1ZKG A;  5D4R A;  1Y0U A;  5LHG A;  4XKC A;  3IKV A;  1BI3 A;  3WTT C;  4H4K C;  1GT0 C;  2Q1Z B;  3O3K A;  3QAH A;  2CW7 A;  4CO8 A;  2FUG 2;  4OIP F;  3K7A J;  1KYW A;  2XGX A;  2PN6 A;  3A0H C;  3RJP A;  4GGG A;  2HYJ A;  3DBH B;  2Z2S B;  4D5F A;  3S3N A;  3OYI A;  4IHW A;  1FOX A;  1A6I A;  3IC7 A;  3KFW X;  3L09 A;  3F21 A;  1XD7 A;  2V4J C;  3OWT A;  4BDY A;  4II3 A;  1BBY A;  1X1B A;  2KZV A;  3WHB A;  3K9T A;  3ASN H;  5BS6 A;  5DM6 F;  2YR2 A;  3JRE A;  4A3D J;  5GAE J;  1T6S A;  3DKX A;  4OIN F;  4A6D A;  2CV2 A;  4Z2Y A;  3W3C A;  1QQI A;  1YYV A;  2CMP A;  1UG2 A;  1MNE A;  5F64 A;  2VBY A;  1WSU A;  1QHH D;  5CVR A;  2VOD A;  3U2R A;  3KYD B;  1ZQ3 P;  4A12 A;  1SFO J;  5DCM A;  3RPU A;  5JFR A;  5D8K B;  2MLG A;  3WOD F;  2LP0 A;  2UWM A;  3D5S C;  5EZG A;  4UUT A;  1VQL I;  2RDP A;  3EDP A;  1G3T A;  3S15 J;  1IW7 F;  5E1X A;  1YIO A;  1BC7 C;  1QBJ A;  3VPR A;  4LG0 B;  1FC3 A;  2L01 A;  5FKL A;  2Q2E B;  1H88 C;  3ZQG A;  1AU7 A;  3L2C A;  1OCC H;  3FHZ A;  2CUZ A;  2R5Z B;  2O0Y A;  2L3D A;  2WAD A;  3HYI A;  4M3E A;  4ZZL A;  2CUJ A;  2FOW A;  2UXX A;  3BTJ A;  4G6Q A;  3JRG A;  1FBS A;  3QP6 A;  4IZZ A;  1G3W A;  2D1V A;  1BIA A;  2HVQ A;  2ZFW A;  3LA7 A;  4WXC A;  2K4B A;  5HDN A;  4LB5 A;  4Y3O A;  1Z1D A;  3EUA A;  1MH4 A;  3R60 A;  4BEH A;  2K9N A;  1JI8 A;  3CDL A;  3MAJ A;  2R7S A;  2B7E A;  5HLG A;  1MD0 A;  1UJ8 A;  3ZPL A;  4AWX B;  3GTL J;  1SAX A;  3OYN A;  2FSW A;  2OU2 A;  3M1E A;  3HPG A;  1WCM J;  4G94 A;  5CKT A;  3W2V A;  2QVO A;  3LAJ A;  2HZT A;  4V2G A;  2EV5 A;  2RAE A;  2Y75 A;  1AKH A;  4B43 A;  4YIR X;  4KJZ A;  1IRG A;  2AQF A;  4C9Y A;  1I6H J;  1K83 J;  2EIL H;  2JA6 J;  1ACI A;  3SJM A;  5DUI A;  4UV8 A;  4NHJ A;  2DO7 A;  2L9S A;  2QWW A;  2K9Q A;  3DU6 A;  4KIG A;  4UUS A;  5EZH A;  3REO A;  1ON1 A;  2OCE A;  1UST A;  1K6Y A;  4L5E A;  1U2W A;  3V8L A;  1XX5 A;  3KZZ A;  4M72 A;  5LHI A;  3LNQ A;  2EZH A;  1T33 A;  2ZJR F;  2LDU A;  4P5O A;  2XGD A;  4JYK A;  4CDG A;  2D2W A;  3A2K A;  1LFU P;  3E6C C;  4E7I A;  2FE3 A;  4KNY A;  4AVP A;  2EV6 A;  1P7J A;  1A35 A;  4A69 C;  2JPC A;  3SHF A;  2VE8 A;  1OPC A;  2IAI A;  4B3X A;  2HDC A;  1WZ2 A;  2V9K A;  1FZP B;  3SZT A;  1EH7 A;  4EQQ A;  2WAQ A;  2R7X A;  2DN0 A;  2W24 A;  2OZ6 A;  2H1K A;  2NVU B;  1BR2 A;  1W1W E;  2MC3 A;  2JSP A;  4OIO F;  3HEF A;  3OS2 A;  2WV0 A;  3JRF A;  3GLL A;  2JA2 A;  2XIG A;  3NRV A;  1IV8 A;  3BOQ A;  4BH9 A;  5D6F A;  2XPU A;  4G7Z F;  2L7M P;  1ZHF A;  2BXZ A;  4D9J A;  3S3O A;  2DA7 A;  1XN7 A;  2EH3 A;  1EH6 A;  4M9Z A;  3MN2 A;  4QPQ A;  1R9T J;  3TED A;  2RRE A;  3VSL A;  5B3S H;  3ERM A;  5K7F A;  4N4O B;  2QBY B;  4KT6 A;  1XCV A;  1FLI A;  2X48 A;  2W25 A;  1RZ4 A;  2DA3 A;  4P96 A;  1IN4 A;  2V1N A;  3BZC A;  3DEU A;  3BCA A;  2H6C A;  3O8G A;  5TGT A;  3E5Q A;  4XM3 A;  4NB5 A;  4G12 A;  4B47 A;  5FLV A;  2R92 J;  4A3J J;  3KEO A;  3FK6 A;  3I59 B;  3IL2 A;  1MBE A;  1HDP A;  4I98 B;  5FRO A;  1Y8Q B;  2F4I A;  4F3Q A;  4BDZ A;  2E2J J;  1VQ8 I;  2HZD A;  4W1U A;  3WE3 A;  3SEQ A;  3QPT A;  1HQC A;  1MSF C;  2KL4 A;  3G2B A;  5J40 A;  1YQA A;  1QVU A;  3J7A O;  2CG4 A;  2H94 A;  3T1B A;  1OJL A;  4X0G A;  2W1O A;  3BZK A;  3JRC A;  1WI9 A;  3BT9 A;  2ESN A;  1UFM A;  2M45 A;  2VQG A;  2V6C A;  3HSF A;  3IV5 A;  3ZMV A;  1MBK A;  2PMU A;  2E1N A;  1OYI A;  4I01 A;  1MJA A;  2W4S A;  4M3F A;  4XIC A;  2IJL A;  2LKP A;  1XGS A;  2FF4 A;  1RET A;  2BHZ A;  4Y7N J;  5F27 A;  2NNY A;  4BUP A;  2QEN A;  1F1Z A;  1B1B A;  2ESH A;  2GIZ A;  2AS5 F;  2CWE A;  3GTK J;  1P6R A;  2XKP A;  2ACJ A;  2M7A A;  1I5Z A;  2CH0 A;  1WHU A;  4I99 C;  5DM7 F;  2NVQ J;  5KAF C;  1BOA A;  1O57 A;  2DPU A;  1T0F C;  2FU4 A;  2VOO A;  2PFB A;  2DT5 A;  1ZRD A;  2HQ5 A;  1WJE A;  3HTU A;  4L5I A;  5HVQ C;  3KP7 A;  2EA2 A;  4HQM A;  3W2W A;  2YX7 A;  2BV6 A;  2ZJ2 A;  2WY7 Q;  4QTR A;  4P9F A;  2XB0 X;  3WHC A;  4I7H A;  1X3Z B;  5CVI A;  2ELK A;  1RR7 A;  2VT2 A;  3LSK A;  1VQ4 I;  2DK5 A;  4PSX A;  2VB6 A;  3DTI A;  1E17 A;  4HRI A;  1V5F A;  3IP4 B;  3HTS B;  3PO2 J;  2CFX A;  1K7A A;  3CO6 C;  1FBQ A;  4A3L J;  2HPI A;  3KCC A;  1JGS A;  2VKE A;  4CZZ A;  4O5V A;  3K70 C;  1P9Q C;  1R71 A;  5F0C A;  2HVS A;  5J1R A;  1WKM A;  5A2Q Z;  3QOE A;  4ZYG A;  2KDZ A;  5CLS A;  1W5T A;  2LF8 A;  3HUG A;  1FYM A;  5GPC A;  5IT9 K;  2BGC A;  1A04 A;  4RDU A;  3VDX A;  2XVC A;  2FX0 A;  1K78 B;  4YG2 F;  2WAF A;  4S0H B;  2CW0 F;  2Y0M A;  4IHX A;  2IRF G;  4LB6 B;  2ICW G;  4LLL A;  1SVM A;  2JRT A;  1H89 C;  3J81 Z;  2BYV E;  4BS9 A;  3H0D A;  1HCR A;  2NVY J;  5FFX A;  2NS7 A;  3E0J B;  3TOA A;  3HDD A;  3CC4 I;  3QPS A;  5C3E J;  1FP2 A;  2DTZ A;  3E7L A;  4XN0 A;  2O7O A;  3OOU A;  3HOU J;  2JVG A;  1IRZ A;  2GM4 A;  1D3Y A;  1TQI A;  1YJN I;  2KHM A;  1WQ2 A;  2OCC H;  3K2Z A;  1W0U A;  5D4S A;  3V8J A;  3TBI A;  3F22 A;  4IRI A;  4OOI A;  2E1C A;  2GOX B;  1SFE A;  1ZLJ A;  1OCT C;  2UXN A;  3DPU A;  3HOW J;  3FZV A;  6PAX A;  1IXC A;  1R23 A;  4II2 A;  1J9I A;  4U88 A;  3TL4 X;  2DJI A;  1S7A A;  2BY0 A;  1YS6 A;  4M3D A;  4XBF A;  3F72 A;  3QYB A;  3HG9 A;  2L9R A;  3RQI A;  3ERE D;  1TC3 C;  5F6F A;  3BPV A;  1V55 H;  5H20 A;  1KON A;  1D5V A;  1JKO C;  2RKH A;  1FOK A;  2R7F A;  2V1X A;  2P8T A;  4B8X A;  3DKY A;  3H9G A;  4LG0 A;  3I56 I;  2JRM A;  2GQQ A;  1UHM A;  4QIW N;  4PJN A;  1J0R A;  2RQQ A;  4EAT A;  5KK1 A;  3ECO A;  1XSV A;  3JSO A;  4YFK F;  4QPO A;  1NTC A;  2AO9 A;  3OYK A;  1MZB A;  4A3E J;  4MEY F;  3AL0 B;  1SVO A;  1XMK A;  3SZP A;  2N8G A;  3KPH A;  3HRT A;  2KIF A;  1FJL A;  4NC6 A;  2DT6 A;  1K78 A;  1V5G A;  3VYS B;  5HOD A;  2OQG A;  3CDI A;  2A3S A;  4EVI A;  1OMI A;  4HG2 A;  1K6O A;  3VFZ A;  1VF9 A;  3I54 A;  1XS9 A;  4ZDL A;  1ZG1 A;  3PM1 A;  2DDB A;  3SQN A;  5D5X B;  4B3A A;  4EV0 A;  3JTG A;  3K4M A;  1X58 A;  4KA4 A;  2XPW A;  1D0X A;  4M3G A;  1V4R A;  5ICF A;  1MMS A;  1MBJ A;  3MCZ A;  2E34 A;  2Y69 H;  1TWF J;  3ZCO A;  5FGM A;  1HW1 A;  3CO7 C;  2CQK A;  2XV4 S;  2YPR A;  1PP7 U;  2JZY A;  2DOF A;  4OU0 A;  3LSG A;  4L9V A;  4CYC B;  4HLX A;  2E5Z A;  1B6A A;  1R58 A;  3V7C A;  3FWE A;  2WC2 A;  2VKD A;  2M9H A;  4GFB A;  4IL6 C;  1PDN C;  4LJZ F;  4ABZ A;  4FE4 A;  1LPQ A;  4XN3 A;  2EZL A;  3WTW C;  2IXS A;  3D0S A;  5FKK A;  2CU7 A;  1RKT A;  1WJA A;  5J1U A;  1FTZ A;  2ZJP F;  5E20 A;  1L0O C;  4I76 A;  2KFD A;  3MZ8 A;  5JLX A;  2VT3 A;  4HA8 A;  3L2R A;  3G1M A;  4F7Z A;  3TW7 A;  1TT5 B;  4BXU A;  2VQC A;  5HLT A;  2KIQ A;  2EB7 A;  1IG7 A;  3TO9 A;  4E7L A;  2PJR B;  2IPQ X;  3AG3 H;  1GXP A;  3V7S A;  3VB2 A;  1O7F A;  4PZJ A;  4WCG A;  1S8N A;  4PUS A;  4HDU A;  1FOW A;  4C3H J;  2O61 A;  2Y48 A;  1PUE E;  1UG0 A;  4A0Z A;  4MGR A;  3CJT B;  2MAB A;  3AG2 H;  4E70 A;  2PMZ A;  2F4M B;  2KRC A;  2KT0 A;  3GFJ A;  2ZJQ F;  4B1R A;  3RKQ A;  3DXJ F;  1X1D A;  3ZMZ A;  1U6G A;  2PLY A;  4HYE A;  4U7B A;  2VXZ A;  1YOV B;  1HW5 A;  5C44 J;  1K4S A;  3KYL A;  2ID3 A;  4UXN A;  1WJF A;  2LBF B;  4UV9 A;  2LVS A;  3BR6 A;  3F8M A;  3S2H J;  3VEP A;  4ESJ A;  2CYY A;  4RGX A;  3CLQ A;  5DD4 A;  2XRL A;  1J2X A;  1SMY F;  2XKO A;  2A6T A;  2KJC A;  3GVA A;  1H8A C;  3LST A;  1WFX A;  5EDN A;  1T8I A;  1VQK I;  3B73 A;  5E79 C;  2Y2Z A;  3SYT A;  2MA3 A;  3SZG A;  4BBS J;  3J80 K;  1QU3 A;  3WG9 A;  2XGE A;  4LD5 A;  3ZQH A;  1SEU A;  4BKX A;  1AHD P;  1DU6 A;  1ZG3 A;  1SD6 A;  2JA8 J;  1IDZ A;  2FRH A;  3FKJ A;  2VJ5 A;  3ABK H;  1Y8R B;  2EFO A;  4GYG A;  4AC0 A;  4Q4Z F;  1DP3 A;  3WTX C;  2DQR A;  3UNG C;  4A3M J;  2VUM J;  3G71 I;  2X1C A;  2OBP A;  2A5Y B;  4E7S A;  5F1R A;  4KFC A;  1U9O A;  3LSJ A;  4O3M A;  3ZMS A;  2WV1 A;  5JHF A;  5EJC A;  4EGY A;  3M07 A;  3IHU A;  2DW4 A;  3CP8 A;  2J5P A;  1XCB A;  2L7K A;  3S2W A;  3GZ5 A;  1YW7 A;  2P0W A;  3AG4 H;  3RPU D;  4OMY A;  3SXY A;  3OIO A;  3ONQ A;  4A3F J;  3K2A A;  1DPU A;  1WPK A;  2O5R A;  4F52 A;  2IA2 A;  4HPQ A;  2W48 A;  1X1P A;  2KIU A;  4ZC3 A;  1S3J A;  2M3A A;  3G4S I;  1HC8 A;  1QVT A;  3ECH A;  2DFI A;  3CCS I;  2D5V A;  5HNH A;  2XAJ A;  1XGM A;  2FA5 A;  2QM3 A;  4M9X A;  2TRT A;  4CCN A;  3CMA I;  3OOP A;  3HSE A;  2HGC A;  3FXR A;  2QCO A;  2HFH A;  5L3G A;  4RB1 A;  3HUG B;  1YJW I;  3HRU A;  1MSE C;  1O3Q A;  2DU9 A;  2WTE A;  5D5V B;  4BE2 A;  1U9N A;  2ZSH B;  2X6X A;  3K4N A;  4IF4 A;  3IUO A;  4A0X A;  5DEQ A;  2E19 A;  3MZH A;  3J7Y J;  4Y13 A;  5D5U B;  1PJR A;  2Y31 A;  4BHP A;  4XSZ F;  3Q5F A;  2QF7 A;  3GYH X;  2BBY A;  3G73 A;  3QQA A;  4RAF A;  5B66 C;  1D8J A;  4V2F A;  3MKY B;  5FJ8 J;  3QP5 A;  1ZRE A;  4JX5 A;  3Q0U A;  2CV1 A;  3A4C A;  5BNG A;  4N9H A;  2FBK A;  5FRN A;  1ETX A;  3LSR A;  4WXD A;  5EGO A;  2DMP A;  1F5T A;  3V42 A;  2OTL I;  3RDI A;  1Y1V J;  1HKQ A;  2FOK A;  3FHN A;  3CCR I;  2H8W A;  3K4C A;  3KE2 A;  1WVR A;  2L0K A;  1D1B A;  5DTD A;  5F1J A;  4HEA 2;  4KIB A;  4XRF A;  2OUM A;  3GX4 X;  1FPQ A;  3S3M A;  2Q0O A;  1HF0 A;  2UZK A;  4M71 A;  4W97 A;  2H1L A;  2JT1 A;  1Z21 A;  2HR3 A;  3GTG J;  1R4M B;  3F6V A;  4N9I A;  1J7K A;  4RB3 C;  1TWC J;  4WX9 A;  3IH2 A;  2LF7 A;  1BM9 A;  1X3W B;  4XLH A;  2BZT A;  3FXL A;  2O8K A;  2ZXJ A;  3HHH A;  1HSJ A;  2IBD A;  2ID6 A;  2R3S A;  2GA1 A;  3Q0V A;  3OYD A;  3HHG A;  4XL9 A;  4A2U A;  3D1N I;  1ETK A;  1M1E B;  3Q9V A;  3MQ0 A;  5A2Q K;  3GZN B;  1JUS A;  1LVK A;  3H1C A;  1LQ1 A;  4N0B A;  4GDF A;  1QGP A;  2B63 J;  3S14 J;  1MKM A;  1ZR2 A;  3JCU C;  3PSF A;  2LY9 A;  1AKH B;  4FTH A;  1ONV A;  4XLC A;  2R7O A;  3LA2 A;  5GP9 A;  4RBO A;  2STT A;  1W5S A;  4IOC F;  3DEW A;  1GXQ A;  2E1M B;  3LFU A;  3T5X A;  2A07 F;  3A0B C;  4R8H A;  1KQ8 A;  2FJ1 A;  1XSX A;  4XOP A;  3V7R A;  4BBR J;  4RAZ A;  1ULY A;  3ABL H;  2JUG A;  2MC4 A;  4AIK A;  1BW5 A;  2COB A;  4CCO A;  3C2G A;  4B4C A;  2OJE D;  3BQY A;  3L00 A;  3IAM 2;  2EPF A;  2YU9 J;  2V7F A;  2ZBK A;  2EIK H;  3KP2 A;  2CUE A;  3DU5 A;  2L2O A;  5DD8 A;  2GXA A;  2XAU A;  1ITY A;  1MMD A;  2DT7 B;  2YU3 A;  1QO0 D;  1XC5 A;  2VJ4 A;  5ICE A;  1OCZ H;  2XGC A;  3CJQ B;  2DOA A;  4A3C J;  4CA0 A;  1ZH5 A;  1XPX A;  5JI6 A;  2JA5 J;  1GLN A;  1R6R A;  4UY8 I;  2IS1 A;  3F6O A;  1TTY A;  1YRN B;  2KLO A;  3F0C A;  4AD9 A;  2E5N A;  4KN4 X;  5ED4 A;  4E4H A;  4DYR A;  2DFE A;  3BP8 A;  2QA4 I;  1KU9 A;  3B6A A;  3GLX A;  3GTQ J;  5LD2 C;  4FAS D;  3FXJ A;  4IHV A;  1G6N A;  1W7P D;  2P7V B;  2DJN A;  1IZ1 A;  4G7O F;  2O6G E;  3RKW A;  1UB9 A;  4PJJ A;  4HOB A;  2Y9Y A;  1V54 H;  5GPA A;  5D5W B;  1Q1H A;  2LK2 A;  2LY1 A;  1F4K A;  1I3Q J;  3E6B A;  5IT3 A;  2QSG X;  1OYW A;  5CJ9 A;  3S17 J;  4R1H A;  5GAD J;  2D1H A;  3BWG A;  1DGR M;  3DFG A;  2Y0S N;  3HB9 A;  4F55 A;  4FX0 A;  1AA7 A;  1HKS A;  3C2B A;  1JJ8 C;  1Z6R A;  1OR7 A;  5K5O A;  1OFC X;  1TWA J;  5D6E A;  5KCM A;  1KU3 A;  4JP0 A;  2EIN H;  3BZ6 A;  2DK8 A;  4QWQ A;  3LL7 A;  1JUP A;  4Y33 A;  5FLX K;  2VBX A;  2ETH A;  3OR1 C;  4HX4 A;  2OD5 A;  1Y56 A;  2CQQ A;  2ISY A;  5EEA A;  4KMF A;  3GTP J;  3T8T A;  4BJT A;  5ICG A;  3ZQC A;  1T95 A;  3OMY A;  3BJ6 A;  1R1V A;  2W00 A;  1BI0 A;  5FKM A;  3ZQI A;  1R1T A;  1TW3 A;  4EJU A;  1LUJ B;  1WRJ A;  3GTJ J;  3BR2 A;  4BYY A;  5CVV A;  4JK1 X;  3GCM A;  3H3Z A;  1D1A A;  1IRX A;  2FQ3 A;  2RGV A;  2AQE A;  3K4L A;  3SEZ A;  1SAN A;  2MH2 A;  1MDM B;  4FIS A;  2TCT A;  3L1P A;  2STW A;  3F9K A;  3LFK A;  1ETW A;  4EM0 B;  2QQB A;  3FMS A;  2EK5 A;  2E35 A;  3LQQ A;  5J8C A;  1IN8 A;  3CLO A;  5M5X J;  1Z05 A;  2JJ7 A;  4XOT A;  3BJA A;  4UVC A;  3TW6 A;  4V19 K;  3CF5 F;  3CUQ B;  4ENJ A;  3WGI A;  2VL8 A;  2ECC A;  1R5H A;  4PFP A;  4DYQ A;  2P5K A;  1DU0 A;  1D0Y A;  5LGT A;  5JVG F;  4U0V A;  1F9N A;  2QSF X;  5ILV A;  5IYC J;  4P1W A;  4IHY A;  3CD6 I;  1H9G A;  4JX4 A;  2R0Q C;  1GVJ A;  2PMZ N;  2X85 A;  1KU7 A;  2M4K A;  2P6S A;  2QLZ A;  3LOC A;  2F48 A;  1T56 A;  4NQW B;  4CCK A;  1I27 A;  4MNU A;  1G3S A;  4XQF A;  1VQM I;  3QYE A;  1GDT A;  5KHD A;  4B48 A;  2VJJ A;  4HDV A;  2KP6 A;  1ZEL A;  2YX4 A;  4CIC A;  5B5E C;  5GTH C;  4C2M J;  2WWY A;  4K2E A;  2G0E A;  4BNC A;  1P2F A;  3WTV C;  3D5L A;  4XKW A;  2Z16 A;  4HX7 A;  5DDG A;  5E3M A;  4WWC A;  2OQR A;  4IXA A;  1TT0 A;  4I6Z A;  3S1Q J;  5BPI A;  1WH5 A;  1BR4 A;  3WU2 C;  3RZO J;  4RAG A;  2E2I J;  4AYB A;  2XPV A;  1XG1 A;  1SVL A;  5LGN A;  1VI0 A;  4LK1 F;  1S6L A;  5FKO A;  2AHQ A;  2WY8 Q;  2D45 A;  1U3E M;  2XSJ C;  1Z3X A;  3A01 A;  3VYT B;  5M5Y J;  4KIT B;  2UV1 A;  3EUH A;  2G9W A;  3H3V K;  2DMT A;  1IRF A;  3CZ6 A;  2RVC A;  3RIR A;  3FXM A;  1O7L A;  3FXU A;  4RGU A;  4HST A;  4HW0 A;  4M6V A;  1W7P B;  2FBH A;  3CUO A;  2DTR A;  4PJ0 C;  2DQL A;  3JAM Z;  3MKZ A;  5J8F A;  3JRB A;  4QSH A;  5M3M J;  1WGX A;  2IEK A;  1IUF A;  3C7J A;  3FXO A;  3PUF A;  4UNO A;  5HS9 A;  2IW5 A;  3LQR A;  2O8X A;  2JUC A;  3I9V 2;  2ZNY A;  2ZME A;  2IS6 A;  4HNT A;  3HOS A;  2NNN A;  3S32 A;  2V6E A;  3PJR A;  1RUN A;  1G8X A;  1D0Z A;  3BR0 A;  1DDN A;  4HX8 A;  3DKW A;  3JAM K;  2GZW A;  4ZZD A;  1ZGW A;  5LRS A;  3CC2 I;  2EFN A;  1WJB A;  1JTY A;  3P5J A;  4PSW A;  2CQN A;  4E7K A;  1ERD A;  1Z7U A;  4ANJ A;  2IGK A;  1HDD C;  4WXH A;  3DTK A;  1G4D A;  4PGG A;  1IAW A;  5IPA A;  2CQ7 A;  5IYB J;  2OAZ A;  5FB2 A;  2DA1 A;  3HBL A;  1QPM A;  3NAR A;  4EEF G;  3ZQQ A;  3A1Y A;  2R7W A;  3CUQ A;  1P92 A;  1B59 A;  3R61 A;  3ZGK A;  2K85 A;  4FCY A;  3P7N A;  2M8G X;  4MTD A;  4XLN F;  3OYB A;  3K4B A;  3K1P A;  1VFC A;  3S8P A;  2H09 A;  3H0G J;  2GOM A;  3W6V A;  5BMZ A;  1YI2 I;  3PUB A;  4L5J A;  4XK4 A;  1TP4 A;  3H92 A;  2ZXI A;  1YFH A;  3KP6 A;  3TDZ C;  5F0F A;  3ISP A;  3G3Z A;  5F0H A;  4CXF A;  4LLN A;  4IRH A;  4PGH A;  1ZLK A;  3JR9 A;  3BG3 A;  1LDJ A;  2G7U A;  5LEK A;  4DOZ A;  1GV5 A;  2DFF A;  2ISZ A;  2FXA A;  4KN7 X;  3I0T A;  3ASO H;  4EJV A;  3QU3 A;  2E1O A;  3DLL F;  1IV6 A;  1T2K A;  1APL C;  3SDB A;  1UCR A;  5LFA A;  4GYI A;  1IF1 A;  3QYF A;  1OCO H;  1BI1 A;  2DAO A;  3V8K A;  3JSP A;  2BE5 F;  1MJB A;  1SAU A;  3GFM A;  4YFX F;  2VE9 A;  3M9A A;  3AL0 C;  3ZMU A;  1LB2 A;  1FYL A;  2EFW A;  1HLV A;  3OYM A;  4HF1 A;  2ADU A;  2LH9 A;  4HQE A;  1S7E A;  4LOC A;  1RPW A;  1OIS A;  1LE8 A;  3GTM J;  1JJ6 C;  2F6C A;  1B72 B;  2M87 A;  1UMQ A;  3CQZ J;  5E8I A;  3O8H A;  1I6X A;  4A3K J;  1W36 C;  2IS2 A;  4RA2 A;  2HQN A;  4BXX J;  4D7N A;  3WU1 B;  1R1U A;  2HTJ A;  2VKV A;  1HXD A;  2OA4 A;  1IXR C;  1V5E A;  5IT9 Z;  2KIS A;  1Y39 A;  3PQK A;  1ZRF A;  4IQJ A;  2KMU A;  3PFY A;  5M5W J;  3MVP A;  3FF5 A;  3DLA A;  1TQM A;  1MBH A;  1OR7 C;  1TWG J;  3K70 D;  4EGZ A;  1YX3 A;  1V3F A;  1PUF A;  1YW8 A;  2RV8 A;  3P9K A;  5DCF A;  5FLX Z;  2QQA A;  3KEQ A;  2BXY A;  3IRR A;  2M7B A;  2XAF A;  3KIO A;  3FKI J;  4XKV A;  1OYY A;  2MD0 A;  3E3V A;  2PG4 A;  1Y6I A;  3BY6 A;  2BW3 B;  2BY2 A;  3G1L A;  4G6D A;  4IEJ A;  1RI7 A;  2E7X A;  3K1M A;  2QEX I;  1JT0 A;  1TW2 A;  2NS0 A;  3L2Q A;  3L2V A;  4MQ9 F;  5EF6 A;  4UUS B;  1YX5 A;  5M3F J;  1K4T A;  2HKO A;  2Z1D A;  5L3B A;  1BL0 A;  3ZR8 X;  3E6M A;  3WGG A;  1FX7 A;  2HDD A;  2WB1 N;  5JR3 A;  4LIT A;  1FYK A;  3LSP A;  2H6B A;  2OC6 A;  2EZI A;  1YIT I;  1YRN A;  1TNT A;  1R00 A;  1QNT A;  5HOO A;  2EWN A;  1GUU A;  3VOE A;  1KU2 A;  4C2U A;  3WTY C;  2XB5 A;  1WH7 A;  2KIM A;  4KUM A;  1KZH A;  3U21 A;  3ZMD A;  1I1S A;  3E97 A;  1T08 B;  2BY3 A;  2MG4 A;  2RQP A;  3C3W A;  4DBQ A;  3JTH A;  2QQ9 A;  1PYV A;  4AUX A;  3MKL A;  2CQX A;  1WJD A;  2ELJ A;  3NEU A;  1X3U A;  3HOV J;  5LEJ A;  4UVA A;  1H0M A;  5BPD A;  1JE8 A;  1YO5 C;  2QZ8 A;  2A61 A;  2IA1 A;  3M1C A;  3OYE A;  2OTJ I;  1JKQ C;  4UVB A;  1QPI A;  5E18 F;  4XLP F;  1JUM A;  4DZP A;  2EIJ H;  5CQG A;  4XLA A;  4KMU X;  1MMN A;  4YEJ A;  2PEX A;  3HZJ A;  3VWB A;  1ON2 A;  1YHQ I;  4HV6 A;  1CQT A;  1FT9 A;  4FQG A;  1Y0N A;  2VIX A;  1IN7 A;  2G7H A;  1MJ9 A;  5DS9 A;  3ESW B;  4AIJ A;  1K61 A;  4OAY A;  3NWT A;  5HNF A;  4NBQ A;  1YW9 A;  2DA2 A;  3I59 A;  2PQ8 A;  4BY7 J;  1EKE A;  3FMR A;  4EJW A;  3ABU A;  4H0E A;  1B72 A;  3V4G A;  2WAE A;  2WB1 A;  2X6W A;  2GLO A;  4DIQ A;  2V1D A;  4CCM A;  4HLY A;  5E3O A;  3OSF A;  1STZ A;  2M30 A;  4XKB A;  4ZYH A;  4ENK A;  1J09 A;  1O3R A;  4S04 A;  4IVN A;  4FE7 A;  4L9J A;  4KDP A;  3X2Q H;  4IX7 A;  4PK4 A;  2NVT J;  3CCU I;  3LSH A;  2X6Y A;  3EPZ A;  5HDK A;  2R7Z J;  2HPM A;  2GXG A;  2F5F A;  2E7W A;  2O3F A;  2FQ4 A;  3WTS C;  1DGW Y;  2L4M A;  4G8X A;  3CCE I; 
#chains in the Genus database with same CATH homology
 2M8E A;  4Y15 A;  3P9C A;  2PMH A;  3TKY A;  1XGN A;  3TDU C;  5ILU A;  2XAG A;  1PP8 F;  1BIB A;  3ELK A;  1XB4 A;  1KQ9 A;  4ZH4 F;  3IWZ A;  4UUV A;  3RI4 A;  2DBB A;  2RC4 A;  3ML6 A;  1O3T A;  2Q2E A;  2X0L A;  3KP5 A;  5L3F A;  3ZQ7 A;  2EA4 A;  3GXO A;  1OKR A;  1MGT A;  1ZYR F;  2VC1 A;  1LEB A;  4HAM A;  2Z33 A;  1RUO A;  4S05 A;  1QZZ A;  5E1Z B;  2LSO A;  3AAF A;  2M1B A;  3CDH A;  2Z9O A;  1W4M A;  3DPT A;  2HYG D;  4D0P A;  1FP1 D;  5BOX A;  1T0F A;  3C1D A;  2M5W A;  3RKX A;  1HKT A;  1T98 A;  2IP2 A;  4QLC U;  1I1G A;  1B4A A;  4MEX F;  5L3E A;  3DF8 A;  2ZO4 A;  4M6Y A;  3K1N A;  2A6E F;  1CF7 B;  1QZY A;  2Z3Y A;  1YTY A;  2XHK A;  2GWR A;  1YS7 A;  2VC0 A;  4ESF A;  2VN2 A;  3IKT A;  2DPD A;  1CGP A;  2DI3 A;  2EV0 A;  1HW2 A;  1KQ0 A;  4BQA A;  2QBY A;  4Y17 A;  1MDM A;  4LFU A;  4RB2 C;  1KA8 A;  3I64 A;  3R0J A;  3QOP A;  2HYF A;  1XMA A;  2XRO A;  3J81 K;  1ZGJ A;  1BI2 A;  4ON0 A;  4L18 B;  3HSR A;  4M9S A;  2O03 A;  4R79 A;  2NRA C;  4RGR A;  1DP7 P;  1U78 A;  1IN5 A;  2MD5 A;  2Q8K A;  3K0L A;  3TQN A;  5DV5 A;  1P4A A;  3N97 A;  3ZN1 A;  4B09 A;  4KIF A;  1S7O A;  2K7L A;  3GO5 A;  3ZMT A;  3KLN A;  5HS8 A;  4HV5 A;  3IWF A;  2EFQ A;  3HOT A;  5HLI A;  1J5Y A;  1O3S A;  4LGW A;  1JHH A;  1LEA A;  3I71 A;  2F5C A;  5D8L B;  3VOD A;  3RKY A;  3GZ6 A;  1CF7 A;  3L7W A;  4G9Y A;  4A0Y A;  1LVA A;  1U5T A;  1C0W A;  2GAU A;  1TLH B;  2B0L A;  2FEZ A;  1U8R A;  5J6X A;  1LDD A;  3PQJ A;  3QRF F;  2V9V A;  1ZG5 A;  3DV8 A;  4IJA A;  3BDD A;  2EFP A;  1VTN C;  2C6Y A;  3WE2 A;  2QUF A;  4I2O A;  4MTE A;  4Q47 A;  4RB0 A;  2OZU A;  1R36 A;  2HS5 A;  1ZAR A;  3KET A;  2GXB A;  3MEX A;  4IHT A;  2MLK A;  5L3C A;  1FSH A;  4WK8 F;  1TBX A;  4ASN A;  2FBI A;  3EQL F;  2VOP A;  1REP C;  2MBF A;  5JHU A;  2X4H A;  4I0A A;  2CO5 A;  4EM2 A;  2XUB A;  4ENM A;  2ELH A;  1T39 A;  1U5T B;  2F5E A;  4KT5 C;  3OV8 A;  3EYI A;  1LJ9 A;  3U1D A;  3E5X A;  3M8F A;  3W6K B;  1BN5 A;  5K5R A;  5LRR A;  1FNN A;  3CJN A;  2W85 A;  2CSO A;  3ABT A;  3C18 A;  3TGN A;  1AWC A;  3F8F A;  1L3L A;  3DQV C;  4HF2 A;  4MQV A;  2KJB A;  3HRM A;  4L0Z B;  4LLG F;  2KRF A;  4A6E A;  1H9T A;  1UHW A;  4XSX F;  4A5N A;  2HTS A;  3JW4 A;  4FHT A;  1LNW A;  1ZRC A;  1NHA A;  3O2P E;  2P5V A;  5LLQ A;  1T38 A;  3GEZ A;  2L54 A;  4CHU A;  1KGS A;  1IXS B;  3M8E A;  2K86 A;  3CTA A;  4HZF A;  4I02 A;  5ILS A;  3MFK A;  3R6S A;  4M74 A;  3DP7 A;  1RIO H;  2K4J A;  4FX4 A;  5CYV A;  4LMY A;  3F8B A;  3K69 A;  3CUQ C;  3LAP A;  1KYZ A;  3NQO A;  1B9N A;  1SFX A;  4ZYD A;  1BJA A;  4M6X A;  2J5O A;  5AON A;  3O6B B;  2V1U A;  3GFL A;  3LWF A;  2TDX A;  4JBA A;  2P6T A;  4PCQ A;  2PJP A;  3MZY A;  1TNS A;  3GUD A;  4Q48 A;  3T8R A;  2V79 A;  3Q9S A;  4FT8 A;  3GFI A;  4JQF A;  2A68 F;  2ZME B;  4KYW A;  4TV7 A;  1HST A;  4PDK A;  2ZCW A;  3COA C;  3H3U A;  4OIQ F;  4P9U A;  3RYR A;  1LDK B;  2AXL A;  4BHC A;  2HWV A;  2JPB A;  2FNP A;  5E17 F;  2P4W A;  5FO5 A;  2P7C B;  3KLO A;  3B02 A;  1Z9C A;  1AOY A;  4HBL A;  4RGS A;  2HOE A;  1SFU A;  2BEO A;  2LNB A;  1XSD A;  3FXQ A;  4RS8 A;  4BAY A;  5ERI A;  5L3D A;  2CGP A;  3I53 A;  5HS7 A;  2NAZ A;  1D8K A;  1ODD A;  5CVU A;  2HQR A;  2H27 A;  5BQT A;  5K1Y A;  2FML A;  2A69 F;  3W6J B;  1XDU A;  3BJO A;  3HRS A;  4WF2 A;  1R7J A;  4G7H F;  3F3X A;  3BRO A;  1FWZ A;  3WTU C;  3R0A A;  3F8C A;  3R4K A;  4EJT A;  4IPA A;  1G3Y A;  5TJJ A;  4Q5S F;  2VBZ A;  4U0W A;  1FBU A;  1J75 A;  4P55 A;  3P9I A;  4IHS A;  1YG2 A;  2P5L C;  4NQW A;  1K79 A;  4AIH A;  2HEO A;  1SD4 A;  3I58 A;  2GA2 A;  5LGU A;  2KKO A;  4ZYE A;  4YIF A;  5FD5 A;  1SMT A;  4GXO A;  5HDG A;  1SD7 A;  2FNA A;  1JXS A;  2XRN A;  3F23 A;  5LBQ A;  1U5T C;  4M73 A;  2ZKZ A;  2COM A;  1R22 A;  3LA3 A;  1P4W A;  5H6R A;  3E6D A;  4DQ2 A;  1EV7 A;  2GIV A;  4YII A;  2JTV A;  1FY7 A;  3GW2 A;  2A6H F;  5DCM B;  1JHF A;  5KVR A;  5TRD A;  4U7D A;  3I5U A;  1FSE A;  2Z99 A;  5EEH A;  3N4M A;  1W7P A;  1EH8 A;  2ZNZ A;  4GCV A;  5DYM A;  5HLH A;  4LK0 F;  1TQP A;  2HKX A;  3FM3 A;  5H6Q A;  1J59 A;  3E5U A;  3J80 Z;  1HBX G;  4OMZ A;  1XDS A;  1WWX A;  2YSR A;  4O6J A;  3ROU A;  4ENN A;  1USS A;  2W57 A;  5K5Q A;  3RTR A;  4OIR F;  3PFI A;  4A5M A;  3U9G A;  5JVT A;  2VON A;  3FMQ A;  3KP3 A;  1Z91 A;  1Z6T A;  5LHH A;  3RPQ A;  3BPX A;  3RYP A;  3FM5 A;  4EJO A;  4I0B A;  1IN6 A;  3IRQ A;  3HIF A;  1SD5 A;  4L9N A;  3QU6 A;  3FX3 A;  3T0Y A;  2R7D A;  1ZAO A;  1RNL A;  5DUK A;  5CVJ A;  2FMY A;  3EET A;  2IVM A;  1P4X A;  1ZN2 A;  2DLL A;  3DPL C;  2IA0 A;  1S29 A;  2XAS A;  2IT0 A;  2EJR A;  2XAQ A;  5ICC A;  1R5G A;  3GF2 A;  3WU0 A;  3WGH A;  4UHT A;  4EMS A;  1B9M A;  3TOB A;  4KIC A;  3QPH A;  2QYO A;  2JSC A;  2PBI A;  5FD6 A;  3M7G A;  5EEG A;  2Z5U A;  4U0Y A;  4RAY A;  5FFZ A;  3WTZ A;  2VBW A;  4IRG A;  3KP4 A;  4GO1 A;  4MHG A;  3GWZ A;  2F2E A;  2RN7 A;  4L0Y B;  2L02 A;  3SFZ A;  3TO7 A;  2F5D A;  1ZGA A;  4EM1 A;  3L9F A;  5AIQ A;  5AIP A;  2L4A A;  1XGO A;  3ZN0 A;  1YLF A;  2W84 A;  3I4P A;  4HF0 A;  4ESB A;  4YFN F;  3EYY A;  4CGZ A;  2NYX A;  1DPR A;  4CYD A;  4BHB A;  1IUY A;  3F8N A;  4L9T A;  2K27 A;  3ULQ B;  4DNC A;  3ZP5 A;  1DUX C;  2RNJ A;  1E2X A;  3MWM A;  4I09 A;  4ETS A;  5E1W A;  1GHC A;  5E8G A;  3KZY A;  2XAH A;  2PI0 A;  2K02 A;  2MH9 A;  1BC8 C;  3TO6 A;  5D4R A;  1Y0U A;  5LHG A;  3IKV A;  1BI3 A;  3WTT C;  3O3K A;  3QAH A;  4CO8 A;  4OIP F;  1KYW A;  2XGX A;  2PN6 A;  3RJP A;  4GGG A;  3IC7 A;  3KFW X;  3L09 A;  3F21 A;  1XD7 A;  1BBY A;  3K9T A;  5BS6 A;  2YR2 A;  1T6S A;  4OIN F;  4A6D A;  4Z2Y A;  1QQI A;  1YYV A;  5F64 A;  2VBY A;  1WSU A;  5CVR A;  2VOD A;  3U2R A;  4A12 A;  5DCM A;  3RPU A;  5JFR A;  5D8K B;  2MLG A;  3WOD F;  2UWM A;  2RDP A;  3EDP A;  1G3T A;  1IW7 F;  5E1X A;  1YIO A;  1BC7 C;  1QBJ A;  4LG0 B;  1FC3 A;  2L01 A;  3L2C A;  3FHZ A;  2O0Y A;  2L3D A;  3HYI A;  4ZZL A;  4G6Q A;  2UXX A;  1FBS A;  3QP6 A;  1G3W A;  2D1V A;  1BIA A;  2ZFW A;  3LA7 A;  4WXC A;  4LB5 A;  2K4B A;  5HDN A;  1Z1D A;  3R60 A;  3MAJ A;  5HLG A;  1MD0 A;  3ZPL A;  4AWX B;  1SAX A;  2FSW A;  2OU2 A;  3M1E A;  4G94 A;  2QVO A;  3LAJ A;  2HZT A;  2EV5 A;  2Y75 A;  1IRG A;  5DUI A;  4UV8 A;  4NHJ A;  2DO7 A;  2QWW A;  4KIG A;  3REO A;  1ON1 A;  1UST A;  1U2W A;  3V8L A;  3KZZ A;  5LHI A;  4M72 A;  2LDU A;  4P5O A;  4CDG A;  2D2W A;  3E6C C;  2FE3 A;  4KNY A;  4AVP A;  2EV6 A;  2JPC A;  3SHF A;  2VE8 A;  1OPC A;  2HDC A;  1FZP B;  3SZT A;  1EH7 A;  4EQQ A;  2W24 A;  2OZ6 A;  2MC3 A;  4OIO F;  2WV0 A;  2XIG A;  3NRV A;  4BH9 A;  4G7Z F;  5D6F A;  3BOQ A;  1ZHF A;  1XN7 A;  4M9Z A;  1EH6 A;  2QBY B;  1XCV A;  1FLI A;  2W25 A;  1RZ4 A;  4P96 A;  1IN4 A;  3DEU A;  2H6C A;  3E5Q A;  4NB5 A;  3KEO A;  3I59 B;  3IL2 A;  4I98 B;  3WE3 A;  3QPT A;  1HQC A;  1YQA A;  3J7A O;  2CG4 A;  2H94 A;  3T1B A;  1WI9 A;  2ESN A;  1UFM A;  2M45 A;  2V6C A;  3HSF A;  3ZMV A;  2PMU A;  2E1N A;  1OYI A;  4I01 A;  1MJA A;  2IJL A;  2LKP A;  1XGS A;  2FF4 A;  2NNY A;  2QEN A;  1F1Z A;  1B1B A;  2ESH A;  2AS5 F;  2CWE A;  1P6R A;  2XKP A;  2ACJ A;  1I5Z A;  1BOA A;  1O57 A;  2DPU A;  2FU4 A;  2VOO A;  2PFB A;  2DT5 A;  1ZRD A;  3HTU A;  4L5I A;  5HVQ C;  3KP7 A;  2EA2 A;  4HQM A;  2YX7 A;  2BV6 A;  2ZJ2 A;  4P9F A;  4I7H A;  5CVI A;  2VT2 A;  2DK5 A;  1E17 A;  3HTS B;  2CFX A;  1K7A A;  3CO6 C;  1FBQ A;  3KCC A;  1JGS A;  4CZZ A;  4O5V A;  1WKM A;  5A2Q Z;  4ZYG A;  5CLS A;  1W5T A;  2LF8 A;  3HUG A;  1FYM A;  5IT9 K;  2BGC A;  1A04 A;  2XVC A;  1K78 B;  4YG2 F;  2CW0 F;  2Y0M A;  2IRF G;  4LB6 B;  4LLL A;  2JRT A;  3J81 Z;  2BYV E;  5FFX A;  3TOA A;  1FP2 A;  1D3Y A;  1TQI A;  1WQ2 A;  3K2Z A;  5D4S A;  3V8J A;  3F22 A;  4IRI A;  4OOI A;  2E1C A;  1SFE A;  1ZLJ A;  2UXN A;  3FZV A;  6PAX A;  1IXC A;  1R23 A;  1J9I A;  4U88 A;  1S7A A;  1YS6 A;  4XBF A;  3F72 A;  3ERE D;  5F6F A;  3BPV A;  5H20 A;  1D5V A;  2RKH A;  1FOK A;  2R7F A;  2V1X A;  2P8T A;  4B8X A;  4LG0 A;  2GQQ A;  1UHM A;  1J0R A;  5KK1 A;  3ECO A;  1XSV A;  3JSO A;  4YFK F;  1MZB A;  4MEY F;  1XMK A;  3SZP A;  3HRT A;  2KIF A;  1K78 A;  2OQG A;  1K6O A;  2A3S A;  4EVI A;  1OMI A;  3VFZ A;  3I54 A;  1ZG1 A;  3SQN A;  5D5X B;  4EV0 A;  3JTG A;  4KA4 A;  1V4R A;  5ICF A;  3MCZ A;  5FGM A;  1HW1 A;  3CO7 C;  1PP7 U;  2CQK A;  2XV4 S;  2YPR A;  2JZY A;  4OU0 A;  4L9V A;  4HLX A;  1B6A A;  1R58 A;  3V7C A;  3FWE A;  2WC2 A;  1PDN C;  4LJZ F;  3WTW C;  3D0S A;  5E20 A;  1L0O C;  2VT3 A;  4HA8 A;  4F7Z A;  4BXU A;  2EB7 A;  3TO9 A;  2IPQ X;  1GXP A;  3V7S A;  3VB2 A;  1O7F A;  4PZJ A;  4WCG A;  1S8N A;  4HDU A;  2O61 A;  2Y48 A;  1PUE E;  4A0Z A;  4MGR A;  4E70 A;  3GFJ A;  3DXJ F;  3ZMZ A;  1U6G A;  2PLY A;  4HYE A;  4U7B A;  2VXZ A;  1HW5 A;  4UXN A;  4UV9 A;  3F8M A;  3VEP A;  4ESJ A;  2CYY A;  4RGX A;  5DD4 A;  1J2X A;  1SMY F;  2XKO A;  2KJC A;  3GVA A;  3LST A;  3B73 A;  2MA3 A;  3J80 K;  3WG9 A;  4LD5 A;  1ZG3 A;  1SD6 A;  2FRH A;  2EFO A;  4GYG A;  4Q4Z F;  3WTX C;  2DQR A;  2OBP A;  2A5Y B;  5F1R A;  4KFC A;  4O3M A;  3ZMS A;  4EGY A;  3IHU A;  2DW4 A;  2J5P A;  1XCB A;  3S2W A;  3GZ5 A;  1YW7 A;  4OMY A;  3SXY A;  1DPU A;  2IA2 A;  2KIU A;  1S3J A;  3ECH A;  2DFI A;  2XAJ A;  1XGM A;  2FA5 A;  2QM3 A;  4M9X A;  3OOP A;  3HSE A;  2HGC A;  3FXR A;  2HFH A;  5L3G A;  4RB1 A;  3HRU A;  1O3Q A;  2DU9 A;  2WTE A;  5D5V B;  4IF4 A;  4A0X A;  5DEQ A;  3MZH A;  4Y13 A;  5D5U B;  4BHP A;  4XSZ F;  3Q5F A;  3GYH X;  2BBY A;  3G73 A;  1D8J A;  3QP5 A;  1ZRE A;  4N9H A;  2FBK A;  4WXD A;  1F5T A;  3RDI A;  1HKQ A;  2FOK A;  3KE2 A;  4KIB A;  4XRF A;  3GX4 X;  1FPQ A;  2Q0O A;  2UZK A;  4M71 A;  2JT1 A;  2HR3 A;  3F6V A;  4N9I A;  1J7K A;  4RB3 C;  4WX9 A;  2LF7 A;  1BM9 A;  2ZXJ A;  3HHH A;  1HSJ A;  2R3S A;  2GA1 A;  3HHG A;  4A2U A;  3Q9V A;  3MQ0 A;  5A2Q K;  1LQ1 A;  4N0B A;  1QGP A;  1MKM A;  1ONV A;  3LA2 A;  2STT A;  1W5S A;  1GXQ A;  3T5X A;  2A07 F;  4R8H A;  1KQ8 A;  1XSX A;  3V7R A;  4RAZ A;  1ULY A;  4AIK A;  3L00 A;  2ZBK A;  3KP2 A;  5DD8 A;  2YU3 A;  1QO0 D;  5ICE A;  1ZH5 A;  5JI6 A;  3F6O A;  1TTY A;  4AD9 A;  4KN4 X;  5ED4 A;  3BP8 A;  1KU9 A;  3GLX A;  1G6N A;  1W7P D;  2P7V B;  1IZ1 A;  4G7O F;  2O6G E;  3RKW A;  1UB9 A;  4HOB A;  5D5W B;  1Q1H A;  1F4K A;  3E6B A;  5IT3 A;  1OYW A;  5CJ9 A;  4R1H A;  2D1H A;  3BWG A;  3DFG A;  4FX0 A;  1HKS A;  1Z6R A;  1OR7 A;  5K5O A;  5D6E A;  1KU3 A;  3BZ6 A;  2DK8 A;  4QWQ A;  5FLX K;  2VBX A;  2ETH A;  4HX4 A;  2OD5 A;  2ISY A;  4KMF A;  3T8T A;  5ICG A;  3BJ6 A;  1R1V A;  1BI0 A;  1R1T A;  1TW3 A;  4EJU A;  1WRJ A;  4BYY A;  5CVV A;  4JK1 X;  3H3Z A;  2FQ3 A;  2RGV A;  2MH2 A;  1MDM B;  2STW A;  3LFK A;  4EM0 B;  2QQB A;  3FMS A;  2EK5 A;  3LQQ A;  5J8C A;  1IN8 A;  3CLO A;  1Z05 A;  3BJA A;  4UVC A;  3CUQ B;  4ENJ A;  3WGI A;  1R5H A;  2P5K A;  5LGT A;  4U0V A;  1F9N A;  5ILV A;  1H9G A;  1GVJ A;  1KU7 A;  2P6S A;  2QLZ A;  1I27 A;  4MNU A;  1G3S A;  4HDV A;  2YX4 A;  4CIC A;  2WWY A;  4K2E A;  4BNC A;  1P2F A;  3WTV C;  3D5L A;  5DDG A;  4WWC A;  4HX7 A;  2OQR A;  4IXA A;  5BPI A;  5LGN A;  4LK1 F;  1S6L A;  2D45 A;  1U3E M;  3EUH A;  2G9W A;  1IRF A;  2RVC A;  3RIR A;  1O7L A;  3FXU A;  4RGU A;  4HW0 A;  1W7P B;  2FBH A;  3CUO A;  2DTR A;  2DQL A;  3JAM Z;  5J8F A;  3C7J A;  4UNO A;  5HS9 A;  2IW5 A;  3LQR A;  2O8X A;  2ZNY A;  2ZME A;  3HOS A;  2NNN A;  1RUN A;  1DDN A;  4HX8 A;  3DKW A;  3JAM K;  2GZW A;  4ZZD A;  5LRS A;  2EFN A;  1Z7U A;  4WXH A;  1G4D A;  4PGG A;  1IAW A;  2OAZ A;  5FB2 A;  1QPM A;  3CUQ A;  1P92 A;  1B59 A;  3R61 A;  3P7N A;  4MTD A;  4XLN F;  3K1P A;  2H09 A;  5BMZ A;  4L5J A;  3H92 A;  1YFH A;  3KP6 A;  3TDZ C;  3ISP A;  3G3Z A;  4CXF A;  4LLN A;  4IRH A;  4PGH A;  1ZLK A;  1LDJ A;  2G7U A;  5LEK A;  2ISZ A;  2FXA A;  4KN7 X;  3I0T A;  4EJV A;  3QU3 A;  1T2K A;  1UCR A;  4GYI A;  1IF1 A;  1BI1 A;  2DAO A;  3V8K A;  3JSP A;  2BE5 F;  1MJB A;  3GFM A;  4YFX F;  2VE9 A;  3M9A A;  3ZMU A;  1LB2 A;  1FYL A;  2EFW A;  4HF1 A;  2ADU A;  4HQE A;  2M87 A;  5E8I A;  1I6X A;  2HQN A;  3WU1 B;  1R1U A;  2HTJ A;  1HXD A;  2OA4 A;  1IXR C;  5IT9 Z;  3PQK A;  1ZRF A;  3FF5 A;  1TQM A;  4EGZ A;  1V3F A;  1YW8 A;  2RV8 A;  3P9K A;  5DCF A;  5FLX Z;  2QQA A;  3KEQ A;  3IRR A;  2XAF A;  1OYY A;  3E3V A;  2PG4 A;  3BY6 A;  4G6D A;  1RI7 A;  2E7X A;  3K1M A;  1TW2 A;  2NS0 A;  4MQ9 F;  2HKO A;  5L3B A;  3E6M A;  3WGG A;  1FX7 A;  5JR3 A;  1FYK A;  2H6B A;  1TNT A;  1R00 A;  1QNT A;  5HOO A;  2EWN A;  3VOE A;  1KU2 A;  3WTY C;  4KUM A;  2KIM A;  3ZMD A;  1I1S A;  3E97 A;  2RQP A;  3C3W A;  3JTH A;  2QQ9 A;  3NEU A;  1X3U A;  5LEJ A;  4UVA A;  1H0M A;  5BPD A;  1JE8 A;  1YO5 C;  2QZ8 A;  2A61 A;  2IA1 A;  4UVB A;  5E18 F;  4XLP F;  4KMU X;  2PEX A;  1ON2 A;  4HV6 A;  1FT9 A;  1IN7 A;  2G7H A;  1MJ9 A;  4AIJ A;  1YW9 A;  3I59 A;  2PQ8 A;  3FMR A;  4EJW A;  3ABU A;  4H0E A;  3V4G A;  2V1D A;  4HLY A;  1STZ A;  2M30 A;  4ZYH A;  4ENK A;  1O3R A;  4S04 A;  4IVN A;  4L9J A;  4KDP A;  5HDK A;  2GXG A;  2F5F A;  2E7W A;  2O3F A;  3WTS C;  2L4M A;  4G8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...