5J6XA

Crystal structure of the apo-zalpha of zebrafish pkz
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
MSAENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKRPVWDLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of a large winged Z-DNA-binding domain of Danio rerio protein kinase PKZ
pubmed doi rcsb
source organism Danio rerio
molecule tags Dna binding protein
molecule keywords Z-DNA binding protein kinase
total genus 21
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5j6xA00
3I0TA 5AIQA 2L4AA 4RB2C 3MWMA 2Q0OA 2ZMEB 2IW5A 2F5CA 2H09A 2BYVE 4OMZA 2XROA 5HLIA 4R79A 5BS6A 1XGMA 4I01A 5ERIA 1W7PB 2BBYA 4BNCA 1O7FA 2VE9A 1ODDA 5CLSA 4IXAA 1FZPB 2P7CB 5E17F 2XV4S 3QU3A 3U9GA 1FOKA 3R0AA 3DXJF 2ZFWA 2EV6A 4G6QA 3GEZA 5FD6A 5DD8A 2FRHA 3BPXA 2HZTA 2Y0MA 1KU3A 3DKWA 2EFNA 5EEGA 1SD4A 4FX0A 4M6XA 1BN5A 2JTVA 3LFKA 1J59A 3MZYA 1TTYA 3GZ5A 4ON0A 4LGWA 2Z33A 2P4WA 3I5UA 4BHPA 3FXUA 2NRAC 2XAQA 5CVIA 1HSJA 4EQQA 5HS8A 3TOBA 1J7KA 4HV5A 3JAMZ 3KP7A 4KUMA 4IF4A 1OPCA 2VBWA 4EGYA 2UWMA 2P7VB 2A07F 3NRVA 1MZBA 4G9YA 1R22A 1YS7A 2XIGA 3FM3A 4M9ZA 4YIIA 1G3SA 1EH7A 1SMYF 1WRJA 3F22A 2VXZA 1J75A 4ENJA 1XSVA 1UFMA 1PDNC 2RN7A 3HIFA 1W4MA 3KFWX 1BC8C 4HLYA 2B0LA 1O3SA 3DPTA 4KN4X 1G3WA 3L2CA 2ZNYA 3RJPA 4KNYA 4G94A 1KQ0A 5D8KB 1GXQA 3V8KA 2KIMA 1X3UA 1YLFA 3ZMVA 1TNSA 2GZWA 5H20A 2XHKA 2HOEA 2K02A 5BPIA 1IXCA 1HSTA 4UUVA 2O61A 1Z91A 3GYHX 4M6YA 1U5TB 3PFIA 4L0YB 2DPDA 1G6NA 1IN5A 1MDMB 3M8EA 2JRTA 4ASNA 4KFCA 2L02A 2XVCA 2F5FA 5JFRA 1TW2A 2PN6A 2YU3A 1IRGA 3BPVA 2W84A 4P9FA 4YIFA 1RUNA 1TLHB 3F3XA 4QLCU 2HTJA 1R5GA 4AVPA 3VEPA 2JZYA 2CWEA 3ABUA 2L54A 5D6EA 1MJBA 2FBKA 5ICCA 3E5XA 3K69A 1P92A 4BYYA 3MCZA 2F5DA 5D5XB 1XMAA 4GXOA 5DCFA 2NS0A 1IN8A 1WKMA 3FZVA 4OIQF 1B9NA 2IVMA 1J9IA 2CW0F 1HXDA 3R4KA 5ICGA 4IPAA 4ZYGA 4M74A 5A2QK 1V4RA 1PUEE 1B9MA 1YYVA 5AIPA 1V3FA 2MBFA 1LQ1A 2DQRA 3W6JB 3FMQA 4ESBA 2A6EF 2ISYA 4H0EA 5IT3A 4MQ9F 3RPQA 4L18B 4WWCA 2J5PA 3Q9VA 1C0WA 1XN7A 2DTRA 3R61A 1ZG1A 1FC3A 2FSWA 1KQ9A 4HLXA 4M73A 3GW2A 3QPTA 2L4MA 3M8FA 5F6FA 2VC0A 4OIOF 2VT3A 3WTXC 3H3ZA 1DPRA 3RKYA 2IA1A 4A12A 2DT5A 3GVAA 3P9CA 2CSOA 2VOOA 2FNPA 3ZN0A 4IRGA 5D5WB 4DQ2A 2IP2A 3LA3A 2ESNA 3C18A 2COMA 1K78A 3HRUA 2GA1A 2DLLA 2M5WA 1XCBA 4A0ZA 1W7PD 1ZYRF 2FE3A 3WG9A 2EV5A 2VBZA 3E5UA 1L0OC 3ML6A 3ISPA 2STTA 2DK8A 2HGCA 4KIFA 5KVRA 5IT9K 1BIBA 2P6SA 4O5VA 2E7WA 2A68F 5E1XA 1Q1HA 1XDSA 2STWA 3E5QA 5JR3A 4P55A 5BQTA 5H6RA 2A3SA 2VOPA 2VBYA 4KIGA 1W7PA 2IA2A 1TQIA 1WQ2A 2K7LA 5LHIA 3MFKA 2HYGD 4ZYEA 1UB9A 1XGOA 1MGTA 4L9VA 3O3KA 1SD6A 3SFZA 3GLXA 1HW1A 1U3EM 4KMFA 1PP7U 3TO9A 2AS5F 4N9IA 2PEXA 4HF2A 3ABTA 4CYDA 2IPQX 5DEQA 1ZHFA 4E70A 1S8NA 2OD5A 2WV0A 4ETSA 3J80Z 2V1DA 1SMTA 1TBXA 4A5NA 1WI9A 4PGGA 1HQCA 3EETA 3V7CA 2CFXA 3Q5FA 5LEKA 2G9WA 3TDUC 3IKTA 3F8CA 1IN6A 4EJWA 6PAXA 1NHAA 1D8KA 5HDKA 1XMKA 1HKQA 2YR2A 4HDUA 4WCGA 1T39A 1P4WA 2PQ8A 2FXAA 2ADUA 4I09A 5E8GA 1YG2A 4G7OF 2W85A 3TO6A 4CXFA 1ZGAA 4L0ZB 3QP5A 2R7FA 1JE8A 3U2RA 3SHFA 3IL2A 2EFWA 1KQ8A 2D1VA 3H92A 5L3GA 3T0YA 4HQMA 2FMYA 3RIRA 4KA4A 2D45A 4HF0A 2EK5A 4R8HA 3TQNA 1FBSA 2X0LA 1H9TA 3K1NA 1ZRCA 2VC1A 2LSOA 5HVQC 1B4AA 1O7LA 1BOAA 2VODA 3HSRA 3WGHA 3FMSA 5FLXZ 1PP8F 3F8BA 3GF2A 3T5XA 4HOBA 3WE2A 4LB5A 3PQJA 3KP4A 1AWCA 3LSTA 5AONA 2PLYA 3P9IA 4XSZF 3QOPA 5E1ZB 1R7JA 3IC7A 1R1UA 3F72A 1FX7A 4GYIA 3HUGA 1S3JA 4FX4A 2M45A 1IN4A 2E7XA 1ZG5A 2ZBKA 2Q8KA 3SQNA 5K5OA 2Y48A 1J0RA 2ELHA 4UVAA 2MC3A 4L5IA 3WE3A 2MLGA 3GFLA 3KP6A 4LK0F 3DEUA 2O3FA 3RKXA 4AIJA 2VE8A 4IHSA 4NQWA 3WTVC 5IT9Z 3HSFA 4I02A 1DP7P 4S04A 1H9GA 3N4MA 4NB5A 4M72A 5LRSA 4IHTA 4OMYA 3LQRA 1P4AA 2KRFA 2P5LC 2H6BA 1DDNA 2AXLA 5BMZA 3ERED 4EVIA 4KYWA 2P8TA 2Q2EA 4RGUA 5CYVA 3HTSB 3R60A 2R7DA 1I5ZA 5E20A 5D5UB 3I58A 5D8LB 3KE2A 4HA8A 5LGNA 2QUFA 3KLNA 4Q4ZF 4YFXF 3KCCA 3LAPA 4EM0B 3BDDA 2VONA 2H27A 2Z9OA 2HTSA 1LEBA 3CO7C 3H3UA 1YTYA 1KYWA 1RI7A 5H6QA 1KU2A 4LFUA 2QQAA 5E18F 4HX7A 4RAYA 3ZMSA 3GFIA 4BXUA 2JPCA 4MNUA 3FM5A 4A2UA 3J80K 1KU7A 1B59A 5JHUA 3V4GA 2RV8A 2PBIA 2F5EA 1QQIA 2LF7A 4PDKA 2XGXA 1O3RA 4U7BA 2OBPA 5DUIA 1G3YA 2LNBA 4OU0A 1LDDA 2K86A 1SFUA 2XKOA 4M9XA 4TV7A 2Z5UA 3MEXA 2FEZA 3LWFA 1LDJA 2EJRA 1ULYA 3C1DA 3HHHA 2UXNA 4XRFA 3LA2A 3U1DA 2JT1A 1YO5C 4ZZLA 1XSDA 3TO7A 3WGIA 1QO0D 4A5MA 1RNLA 2YX4A 2QM3A 2DW4A 3L09A 4KDPA 3K0LA 2IJLA 2W25A 3QAHA 4ENNA 4A6DA 2XAGA 2QBYB 1GVJA 2W24A 2HDCA 4UNOA 2EA4A 3K2ZA 3I71A 3EYYA 2M87A 4HAMA 1P6RA 3GXOA 3R6SA 2XKPA 1XDUA 1BIAA 2VT2A 1AOYA 1IRFA 2QZ8A 4AIHA 1D8JA 3WTUC 5DCMB 3ZQ7A 4RB1A 2HQNA 4EJOA 3DF8A 1IF1A 4Q48A 3IRRA 2OZ6A 2V9VA 4ENKA 2QYOA 2ESHA 3OV8A 1YFHA 1A04A 3RI4A 2VN2A 4EM1A 3E6CC 5HS7A 3CUOA 3DFGA 3L9FA 1SAXA 2QWWA 1D5VA 2CYYA 3F21A 3J7AO 2EFPA 3BJ6A 5FO5A 2JPBA 1FSHA 2DK5A 1I1SA 2RDPA 2ZXJA 2HS5A 3V7RA 1BI0A 1FBQA 1UCRA 1T98A 2EB7A 2ZO4A 3JAMK 3WTZA 1O57A 3TDZC 3K1MA 1O3QA 2F2EA 3WTYC 2M8EA 3EYIA 2HR3A 3N97A 3ULQB 3I64A 3F6VA 4B09A 1GHCA 1HKSA 5ILSA 1TQMA 3S2WA 4XBFA 3FX3A 1LNWA 2V1UA 1FSEA 3BOQA 1U6GA 4WXCA 4IVNA 2K4BA 2J5OA 2OQGA 3J81K 1W5SA 1ZLJA 5LGUA 4FT8A 2O6GE 4A0XA 2BGCA 4A6EA 4FHTA 4G8XA 1BI3A 2L01A 2Z99A 1U2WA 2KJBA 2PMUA 1EV7A 2IT0A 5DDGA 1QGPA 4GYGA 4AIKA 4YG2F 3HOSA 5FB2A 3CUQB 2OU2A 1FYKA 3WTTC 5DV5A 3FXQA 5D5VB 3O2PE 3L00A 2LF8A 5CVRA 2OZUA 5J8FA 2V79A 1JXSA 4U88A 4F7ZA 2YPRA 4B8XA 2MLKA 3HOTA 4WF2A 4HBLA 2PFBA 1D3YA 3OOPA 1L3LA 3LA7A 4LD5A 4AWXB 2FNAA 2HFHA 2FU4A 2M30A 2TDXA 3I4PA 2EV0A 4L9JA 2MD5A 4YFKF 1DUXC 2FQ3A 3D5LA 4R1HA 4EJUA 4JQFA 1IW7F 3B73A 3NQOA 2UXXA 4N9HA 3KEOA 3WU0A 1RUOA 1XCVA 1E17A 4ESFA 3FHZA 1F4KA 2W57A 3E6MA 4LG0A 4MTDA 1IN7A 4ZZDA 4RS8A 3RPUA 4M71A 3T8TA 3E6DA 5HLHA 1LB2A 4DNCA 4CGZA 3KP3A 3QPHA 4EJVA 2V6CA 3GX4X 1DPUA 3ZMZA 4EGZA 3V8JA 4ZYDA 2BE5F 3WTWC 3KETA 4UV9A 5BPDA 4LB6B 4Y17A 1JHHA 2OQRA 2G7UA 1R36A 1IAWA 5LHHA 3BROA 2YX7A 4L9TA 2DQLA 4WXDA 5LLQA 4EV0A 4NHJA 5CVJA 5A2QZ 1CF7B 1SFEA 2CQKA 3D0SA 3BJAA 3E3VA 1USTA 2EA2A 4RB0A 2L3DA 1Y0UA 4ESJA 3MAJA 3BWGA 3Q9SA 4HX8A 5DD4A 4EM2A 1YW8A 2M1BA 1IXRC 2VBXA 3ZMTA 1XB4A 3KP5A 3HHGA 3RYPA 1G3TA 1LEAA 3W6KB 3R0JA 2RQPA 3F8NA 1K79A 3ROUA 1KYZA 3I59A 4BHCA 1ZG3A 2QBYA 3J81Z 2HEOA 5K5RA 1HBXG 1F1ZA 2E1NA 1FBUA 4L5JA 5L3DA 1MJ9A 2BEOA 3JTGA 2A69F 1ZN2A 2CO5A 1J2XA 1LVAA 1J5YA 5DCMA 1FYMA 4U7DA 3GUDA 4UVBA 4WK8F 1RZ4A 3IWZA 3EQLF 2RNJA 4CO8A 2D2WA 4XLNF 3ELKA 4IRIA 2LDUA 2DFIA 1R1VA 1JGSA 2XUBA 3HRSA 1U8RA 1KGSA 5L3EA 4IRHA 2FA5A 2FMLA 2GIVA 2JSCA 1MD0A 1ONVA 1IZ1A 3K9TA 3WU1B 3JW4A 4MEXF 1B6AA 2ZJ2A 1R00A 1YQAA 1XSXA 4P9UA 1HW2A 5FFXA 3P7NA 1R58A 2RC4A 1ON1A 1ZARA 5JI6A 2ETHA 1T6SA 2QVOA 2R3SA 4XSXF 4G7ZF 1IUYA 2ISZA 1BJAA 4HW0A 4KICA 4Q5SF 3COAC 3SXYA 2K4JA 3K1PA 4RGSA 1XD7A 3RYRA 5FFZA 3TOAA 5F64A 4Z2YA 4CHUA 3FF5A 2RKHA 3NEUA 3CTAA 5HDNA 3AAFA 1FWZA 4CICA 1OYYA 3CUQC 4PGHA 2RGVA 4WX9A 2HYFA 3EUHA 1SD7A 1XGNA 1USSA 3QU6A 2GXBA 2K27A 1OYWA 4U0WA 3RTRA 3E6BA 3VFZA 3RKWA 1K7AA 3L7WA 1R5HA 2KIFA 1K6OA 4HF1A 2WWYA 1S7AA 3CUQA 4BH9A 2ZCWA 4IJAA 4L9NA 2FBHA 1ZREA 2OA4A 1F9NA 1FP1D 2XRNA 3M1EA 1LJ9A 4GCVA 5FGMA 2NNYA 3SZPA 3QP6A 1T0FA 1YIOA 4RGXA 2A6HF 2QQ9A 1I1GA 4QWQA 4MQVA 1SD5A 4GO1A 3T1BA 3CDHA 2O8XA 1UHWA 3M9AA 5TRDA 4BHBA 4KMUX 5LEJA 5ICFA 3FMRA 3GFMA 4HZFA 5JVTA 3G3ZA 2IA0A 4OIPF 4I7HA 1TNTA 4RGRA 1OR7A 4LMYA 4RB3C 4LG0B 4LJZF 2HWVA 5DYMA 2CG4A 1I6XA 2MH2A 1S29A 3B02A 2GQQA 2NYXA 5LBQA 2OAZA 3FWEA 1F5TA 2C6YA 1Z1DA 3JSPA 1ZRFA 2WC2A 5FD5A 2GWRA 3TGNA 1FNNA 1P2FA 3SZTA 5ED4A 3MZHA 1U78A 2GAUA 3M7GA 5K1YA 3BP8A 2D1HA 2ACJA 1T2KA 1T38A 4HDVA 2CGPA 3P9KA 4UHTA 1OYIA 5CJ9A 1JHFA 4I98B 4LLGF 4XLPF 3WODF 1UHMA 5TJJA 4A0YA 2KKOA 4P96A 1CF7A 2QLZA 4PCQA 4O6JA 3WTSC 1QZYA 4WXHA 3DQVC 2PG4A 5L3CA 1YS6A 1EH8A 2MH9A 4GGGA 1E2XA 1YW9A 4KN7X 4KIBA 2ZMEA 3O6BB 1Z9CA 2O03A 3VODA 3ZP5A 1MKMA 2KIUA 2P5VA 3HYIA 4BQAA 5CVVA 4ZH4F 3I59B 1HW5A 4HV6A 3BY6A 3BJOA 5ILVA 4UV8A 3KEQA 4P5OA 1I27A 4D0PA 3WGGA 5LGTA 1FP2A 2NNNA 3ECOA 1CGPA 2KJCA 1OKRA 1WSUA 2PI0A 3JTHA 2ZKZA 3MQ0A 1XGSA 2IRFG 4MGRA 1GXPA 3VOEA 3DPLC 5FLXK 3FXRA 2FBIA 2EFOA 1H0MA 3LAJA 3EDPA 4HYEA 3CLOA 4EMSA 3KZYA 2H94A 1ZRDA 5ILUA 1KU9A 4K2EA 3QRFF 1R1TA 4HX4A 4JK1X 4ENMA 2DI3A 3GO5A 3JSOA 1QNTA 5J8CA 4LLLA 2DO7A 1KA8A 4BAYA 2A61A 1W5TA 2QQBA 4UVCA 2V1XA 4UXNA 2GA2A 1R23A 2G7HA 3BZ6A 1BI1A 3ECHA 4KT5C 3F6OA 3KP2A 3GWZA 1O3TA 1SFXA 3IHUA 4MHGA 3KZZA 2P6TA 5E8IA 3G73A 3HRMA 4Y13A 2DPUA 5HS9A 4MEYF 1Z05A 2XAFA 2UZKA 3TKYA 1BBYA 2NAZA 4CDGA 5F1RA 3IWFA 4LLNA 2Z3YA 5D6FA 4N0BA 1B1BA 1VTNC 5HDGA 4Q47A 3C7JA 5LRRA 3ZMDA 5J6XA 3I54A 1LDKB 1FT9A 4EJTA 4I2OA 5BOXA 2YSRA 2HKOA 2MA3A 1Z7UA 3DP7A 1TQPA 1S6LA 2X4HA 1OMIA 2H6CA 3GFJA 5D4RA 1STZA 1U5TA 4G7HF 2FF4A 4S05A 1MDMA 5L3FA 3RDIA 4I0AA 4U0YA 4I0BA 2DU9A 2ZNZA 2FOKA 4YFNF 4G6DA 3HRTA 2P5KA 1Z6TA 4OINF 4M9SA 1Z6RA 3ZPLA 1U5TC 5K5QA 1P4XA 4LK1F 3HSEA 1FYLA 4OIRF 3DV8A 1ZH5A 5DUKA 1FLIA 3KLOA 2DAOA 1MJAA 1BI2A 3REOA 3V8LA 2EFQA 1WWXA 3ZMUA 1BC7C 2RVCA 1EH6A 3HTUA 4U0VA 4ZYHA 5HLGA 2QENA 4RAZA 3CJNA 3PQKA 2LKPA 1QZZA 5L3BA 4JBAA 1BM9A 5ICEA 2XASA 5HOOA 3GZ6A 2HKXA 1QBJA 1ZAOA 5LHGA 1FPQA 5EEHA 3F23A 1G4DA 4MTEA 4O3MA 2PJPA 3IKVA 4PZJA 1S7OA 2Y75A 1IXSB 2E1CA 1RIOH 3I53A 1FY7A 2PMHA 4HQEA 3F8FA 1REPC 3ZN1A 1ZLKA 2BV6A 3C3WA 4CZZA 3VB2A 2WTEA 1ON2A 2A5YB 1HKTA 3T8RA 4OOIA 3CO6C 5E1WA 2HQRA 1YW7A 1K78B 2EWNA 1TW3A 3LQQA 3E97A 5CVUA 3F8MA 2GXGA 5KK1A 1ZGJA 3V7SA 5D4SA 2XAHA 3IRQA 4Y15A 2XAJA 2O0YA 1QPMA 2DBBA 4AD9A
chains in the Genus database with same CATH superfamily
3I0TA 5AIQA 2L4AA 4RB2C 5C4JJ 2L7MP 3MWMA 2XPWA 2GBYA 3ZQGA 3U1KA 2Y69H 1KZHA 2Q0OA 4CYCB 3H9QA 4BE0A 2ZMEB 3FXKA 2IW5A 2F5CA 3CP2A 2H09A 3LSKA 3S1RJ 2R7UA 2BYVE 1LFUP 4OMZA 2XROA 3K4CA 5HLIA 4R79A 5EZHA 5BS6A 1UJ8A 3CDLA 1XGMA 3S2HJ 1VFCA 4I01A 5ERIA 1W7PB 3SFIA 3BTCA 3AG4H 2BBYA 4BNCA 1O7FA 3PSFA 3OY9A 3ONQA 2HQ5A 2BY3A 2VE9A 2HOSA 2FUG2 1ODDA 5CLSA 3CJQB 2KISA 1G59A 4IXAA 1WJ5A 1FZPB 2P7CB 4NC8A 2Y9YA 1X1CA 2DMQA 5E17F 2XV4S 3QU3A 3U9GA 1FOKA 3R0AA 3DXJF 5HNFA 2ZFWA 2EV6A 4QPQA 3OYNA 4G6QA 3GEZA 2EZIA 5FD6A 3HC7A 5H2FC 1JTXA 4G6TB 5DD8A 2DA3A 3D1NI 2FRHA 3BPXA 2F6CA 1B8IB 3SEZA 2HZTA 2Y0MA 1KU3A 4D9JA 4E7HA 2EZLA 2B7EA 2ZSIB 3DKWA 2EFNA 1R5ID 5EEGA 5J1UA 4KITB 1SD4A 2KMUA 4FX0A 1QRYA 4M6XA 1Y1VJ 5E3NA 2X51A 1BN5A 2JTVA 3H5AA 3LFKA 3KX2A 3MZYA 1J59A 1TWCJ 1TTYA 3GZ5A 4ON0A 4LGWA 2Z33A 2P4WA 2FOWA 3I5UA 2V4JC 4BHPA 2R7VA 3FXUA 1UAAA 4A3KJ 2NRAC 2XAQA 5CVIA 4NC6A 1VQ8I 1HSJA 4KT6A 4EQQA 3W2VA 2ID6A 5HS8A 3OYHA 5E3OA 3TOBA 1J7KA 4HV5A 1ETKA 3JAMZ 2D5VA 3KP7A 4KUMA 4IF4A 1OPCA 3DU6A 4J01A 2QKLB 2VBWA 4EGYA 3OYMA 2UWMA 2P7VB 1YHQI 3CCLI 2A07F 3S1QJ 3NRVA 3OYCA 1M1EB 3CCSI 3JRDA 1MZBA 4G9YA 1OCTC 1R22A 4BQQA 1VQ9I 1YS7A 2XIGA 2X1EA 1N78A 3FM3A 4M9ZA 4YIIA 3A01B 1G3SA 2DJIA 4A3MJ 3G6EI 1EH7A 1SMYF 1UG0A 1WRJA 2HOAA 3F22A 2VXZA 1J75A 4ENJA 3H5RA 1XSVA 2JQ7A 1UFMA 5DM7F 2FJ1A 1PDNC 1NG7A 2RN7A 1EF4A 3HIFA 3BG6A 1W4MA 3KFWX 4HLYA 1BR2A 1BC8C 1YX5A 2B0LA 1O3SA 3DPTA 4KN4X 1G3WA 3L2CA 2CJJA 5EDNA 3RSNA 2ZNYA 2K9MA 1ENHA 3RJPA 4KNYA 4XLAA 4F55A 4G94A 5C3EJ 1KQ0A 3HEFA 4G12A 5D8KB 2WADA 1GXQA 2X48A 2DTZA 2KRCA 2DYRH 3V8KA 2KIMA 1X3UA 4XICA 3MKZA 5DS9A 1ETXA 1OFCX 1YLFA 3ZMVA 2KP6A 1TNSA 2GZWA 3H36A 5H20A 2KFDA 1LKXA 4A3DJ 2UUZA 2R5ZA 3FHNA 5FKLA 2XHKA 2HOEA 2K02A 5BPIA 2Y2ZA 2NVXJ 1IXCA 2ELJA 5F08A 1HSTA 3SJMA 4UUVA 2QGUA 4FE7A 2O61A 2L0KA 3NARA 1Z91A 2OF7A 3GYHX 2E19A 4M6YA 2IS4A 1U5TB 3PFIA 3GTLJ 3HPHA 4HRIA 2LC2A 4I99C 2DPDA 4BE1A 4L0YB 3DTIA 1UELB 1G6NA 2TCTA 3OYBA 1IN5A 2L7ZA 1MDMB 1G2HA 3HL2A 2LFBA 3M8EA 2JRTA 4ASNA 2K9QA 2L02A 4KFCA 2XVCA 2NOJB 3DTEA 4DYCA 4C30A 4FQGA 2F5FA 1R49A 2I8DA 5JFRA 1JKRC 2L7KA 2ECCA 1TW2A 2PN6A 4PJJA 2YU3A 3LL7A 1IRGA 3OIQA 3BPVA 2CU7A 2W84A 5K7HA 4P9FA 1F43A 2M2EA 4YIFA 1X2MA 1WPKA 1RUNA 2PJRB 1TLHB 3F3XA 4QLCU 2CH0A 2HTJA 1R5GA 3DLAA 4AVPA 2GIZA 3VEPA 2HU9A 2H1KA 1BR1A 2JZYA 2CWEA 3ABUA 2ZJRF 1SFOJ 1MMAA 2L54A 5FRNA 2X1CA 1SEUA 5D6EA 1MJBA 2FBKA 2A05A 4D5FA 5ICCA 1TZLA 3E5XA 3K69A 2HNHA 3PIPF 1RPWA 1P92A 1WJEA 2IGKA 4BYYA 1ZQ3P 3MCZA 2F5DA 5D5XB 1XMAA 4GXOA 5DCFA 3DWLE 4PJ0C 2NS0A 2F4MB 3CCUI 2VKDA 5EG0B 1IN8A 3LSGA 3CP8A 1QA6A 1X1BA 1WKMA 3MVPA 2E34A 3FZVA 4ZC3A 4OIQF 2CUZA 1B9NA 2IVMA 1J9IA 1YOVB 2CQXA 2CW0F 1HXDA 4DBRA 1ZR2A 3SDGA 3R4KA 5ICGA 1LPQA 3BG3A 3G4SI 4IPAA 1AKHA 2WAFA 5GADJ 5J3LA 1D1AA 3ZQCA 3BG9A 4ZYGA 4M74A 5A2QK 1V4RA 2XB5A 1PUEE 1B9MA 1YYVA 3BC8A 3S14J 4IL6C 5AIPA 1V3FA 2MBFA 1LQ1A 2WAQA 4N4NB 2DN0A 5M5WJ 5F27A 2DQRA 3W6JB 2V26A 3FMQA 1P7JA 4ESBA 2A6EF 2ISYA 4H0EA 5IT3A 5EJCA 4MQ9F 3RPQA 4WWCA 4L18B 2J5PA 2ZXWH 2LG4A 4MO7A 2X1DA 4NBQA 3JREA 1MNMC 1PUFA 4ANJA 2BHYA 4CCLA 3Q9VA 2CQ7A 1C0WA 1XN7A 2DTRA 3R61A 1ZG1A 1FC3A 2FSWA 1R71A 2HI3A 1KQ9A 1WJCA 5FLMJ 2M0MA 4HLXA 4M73A 3GW2A 3CC2I 4JOMA 3QPTA 2L4MA 3M8FA 5F6FA 2VC0A 1YRNA 2Q2EB 3GLLA 2VT3A 4OIOF 3WTXC 3H3ZA 1DPRA 2CQQA 2E2HJ 3AKZA 3RKYA 2IA1A 4A12A 2DT5A 1JJ8C 2O7OA 3GVAA 3P9CA 1TWFJ 2CSOA 2VOOA 2FNPA 1OCPA 1X1PA 3HOXJ 2I5UA 1RR8C 3ZN0A 4IRGA 1A35A 5D5WB 4DQ2A 2IP2A 3LA3A 1Y0NA 3BR2A 3JRIA 2ESNA 4XORA 3C18A 2COMA 1K78A 2HVQA 3HRUA 5GP9A 4V2GA 2GA1A 2DLLA 2M5WA 1XCBA 5K7ZA 4A0ZA 2BVLA 2JA2A 4A3EJ 1W7PD 1ZYRF 2F48A 2FE3A 3O8HA 2R7SA 3WG9A 2XF6A 2LYCA 1Y1WJ 1GVDA 1GUUA 1WJFA 2EV5A 3G2BA 2VBZA 1PJRA 4BXXJ 3E5UA 2R7ZJ 1L0OC 3ML6A 3ISPA 4DBQA 3RZDJ 2DK8A 2STTA 1WJAA 3VSKA 2HGCA 2WB1A 2XB0X 4KIFA 5KVRA 5IT9K 4QTRA 1BIBA 3OL3A 2P6SA 1PVEA 2VKEA 4O5VA 5F0FA 4B48A 4CYCA 3ZQLA 2E7WA 2A68F 3QPSA 3S3OA 5E1XA 1Q1HA 1XDSA 1H8AC 2DFHA 2STWA 3CESA 2M3AA 3E5QA 4BACA 2E1MB 1KONA 3CLQA 5JR3A 5HLTA 1FJLA 3IV5A 2EIKH 1IJWC 4P55A 5BQTA 5H6RA 2A3SA 3FK7A 2VOPA 1S7EA 2VBYA 3BZCA 1A6IA 1IV6A 4KIGA 3HOYJ 1W7PA 2IA2A 1TQIA 3H3VK 1WQ2A 2K7LA 4B3AA 1MBHA 2DA4A 1P9QC 2CW7A 5LHIA 3MFKA 4A3FJ 2HYGD 3J7AY 4UY8I 1BL0A 3S8PA 2Y0SA 2M0CA 4JX5A 4ZYEA 1UB9A 1U9OA 5B1AH 1XGOA 1MGTA 4L9VA 3O3KA 1SD6A 3RCOA 2QKMB 3SFZA 3OYAA 2WY8Q 2AO9A 3GLXA 3ABMH 3K4LA 5IYCJ 1D5YA 3ZQIA 2NVUB 1HW1A 1K6YA 1JT0A 3Q0UA 3DTKA 1U3EM 2IGMA 4KMFA 1PP7U 3TO9A 1B8IA 2E36A 2AS5F 2WB1N 3OYJA 4N9IA 4I6ZA 2PEXA 4AUXA 4HF2A 2OJED 3ABTA 4CYDA 1Z3YA 2IPQX 5DEQA 1ZHFA 4E70A 4BGDA 1S9HA 1S8NA 2X6XA 4X6AJ 4IEJA 2OD5A 5M3FJ 2WV0A 4PUSA 4CA0A 4ETSA 1XC5A 2O5RA 3DBRB 2DOFA 3J80Z 3HG9A 3S15J 2V1DA 3ZGKA 3DBHB 2CV2A 1SMTA 1TBXA 2PMZA 4A5NA 1WI9A 2K5CA 4PGGA 5JLXA 3HKZA 1HQCA 3VDXA 1BW5A 2HDWA 4LIVA 3EETA 3GTGJ 3V7CA 2OCCH 1VQ4I 2CFXA 3Q5FA 2TRTA 5LEKA 2G9WA 3TDUC 3HOZJ 3F8CA 3IKTA 4V19K 5J4VA 2V9KA 3CC7I 1ZK8A 1IN6A 4EJWA 3DKYA 4W1UA 4Y52J 2LR8A 6PAXA 4CSWA 3CCJI 1IDZA 1NHAA 2ZFUA 4HSRA 4A3CJ 1D8KA 3LMMA 1ETYA 5HDKA 3A01A 1XMKA 4BQNA 1HKQA 2JJ7A 2YR2A 4HDUA 4WCGA 1T39A 3ERMA 1MBEA 2KIQA 1P4WA 2L9RA 1MW7A 4A69C 2PQ8A 2FXAA 3DCFA 1MMGA 2ADUA 4I09A 5E8GA 1YG2A 2QQ8A 4G7OF 4D7NA 2W85A 3A4CA 3QPLA 3TO6A 4CXFA 2ZB9A 1ZGAA 2CUEA 4L0ZB 3QP5A 2W00A 4BS9A 2R7FA 3SZGA 3I4MJ 1U9NA 1JKQC 1TWGJ 3QQAA 3X2QH 1JE8A 3U2RA 3SHFA 2AXTC 2NVTJ 3F9KA 3IL2A 2EFWA 2COBA 2V6EA 1KQ8A 2D1VA 3OS0A 3H92A 3TW6A 2PMZN 5CKTA 5L3GA 2R93J 3T0YA 4HQMA 3W2WA 2FMYA 3RIRA 4KA4A 4EATA 3IH3A 3JRGA 2D45A 1W1WE 4HF0A 2EK5A 2DFEA 2R5ZB 4R8HA 3TQNA 2XSJC 1FBSA 1TT5B 4FISA 3OIPA 3CDIA 1A5JA 2X0LA 3MMYB 2Y9ZA 1IO2A 1H9TA 3FXOA 3K1NA 1A31A 4GDFA 1ZRCA 2VC1A 2LSOA 2L7FP 2XGDA 5HVQC 1B4AA 1ZTRA 1O7LA 1BOAA 1QVTA 2R5YB 5FROA 2VODA 3S2DJ 1H88C 3HSRA 3IH2A 2K3FA 3MKLA 1GDTA 2F4OB 3WGHA 3FMSA 5FLXZ 3VWBA 2R7OA 2ZSHB 3CMYA 1PP8F 1NH3A 3F8BA 3GZNB 1EA3A 2V7FA 3GF2A 5IOYA 3T5XA 4HOBA 3WE2A 4LB5A 3PQJA 5FKNA 2M8GX 3KP4A 1YJ9I 1AWCA 4JP0A 1DU6A 3L2QA 3LSTA 5K7FA 5AONA 2PLYA 2H1LA 4BBSJ 4BDYA 2BHZA 3P9IA 3QOPA 4XSZF 1IDYA 2JN6A 2W82A 5E1ZB 1MBGA 1R7JA 3IC7A 1LVKA 4A3IJ 1I3AA 1R1UA 3F72A 1FX7A 2VL8A 4GYIA 5IYBJ 3HUGA 1S3JA 4MLOA 4BUPA 4ZDOA 2HPMA 4FX4A 3S3MA 3B6AA 2LY2A 1XTAA 2M45A 1IN4A 2E7XA 3GBGA 4B43A 2ZBKA 1ZG5A 2Q8KA 2Y31A 4ZTFA 3A1YA 3PO2J 3SQNA 5K5OA 2Y48A 1ZKGA 1J0RA 4NC7A 5DTDA 1V55H 2RNGA 3WG7H 3OYLA 2ELHA 3K70C 1QHGA 4UVAA 4MFDA 1W36D 2VQCA 4RA2A 2MC3A 1CQTA 1YE9A 4CCKA 2B63J 4L5IA 3WE3A 1RKTA 1S5LC 4RMNA 4N4OB 3VYTB 1U0JA 2VPLA 1POGA 1MH4A 2MLGA 3GFLA 3KP6A 4LK0F 3DEUA 1AKHB 2O3FA 3RKXA 4AIJA 2VE8A 3OR2C 3K4NA 4E7ZA 1Z67A 4XONA 4ZDPA 3CMMA 4NQWA 4IHSA 2NS8A 1V5EA 3WTVC 2M4GA 5IT9Z 2LH9A 1OCZH 3HSFA 4C2UA 4I02A 4YELA 3S3NA 1DP7P 4X1EA 4S04A 1H9GA 5GAGJ 3CCQI 3N4MA 3F0CA 3JRCA 3HB9A 1Z0XA 5EYRA 3BR6A 3WHBA 3H9GA 4DZPA 2IGOA 4NB5A 3DLLF 3ZQFA 4M72A 2VLAA 2CFOA 2EZHA 3P5JA 5LRSA 5JVGF 4IHTA 4OMYA 1PUFB 3LQRA 1P4AA 2KRFA 3LSJA 4UUSB 1XG1A 2H6BA 3VSLA 2P5LC 1DDNA 1ETOA 2AXLA 1W5CC 5M5YJ 5BMZA 1TC3C 3ERED 5FRMA 4LITA 4EVIA 1DP3A 4KYWA 1Y6IA 4PSXA 2P8TA 5EZGA 1SFKA 1YRNB 2Q2EA 4RGUA 5CYVA 3HTSB 3R60A 3CC4I 2R7DA 1I5ZA 3Q3SA 5E20A 3CZ6A 5D5UB 2KHMA 3JRFA 3I58A 3PNYA 5D8LB 3KE2A 4P1WA 2JA8J 4HA8A 4XN0A 5LGNA 2QUFA 2WAQN 3KLNA 3CCMI 4Q4ZF 2HXOA 4YFXF 3KCCA 4CCMA 3LAPA 2DODA 2X9DA 3BDDA 1UG2A 4EM0B 5IP9J 2VONA 1N75A 4C3IJ 1MMSA 2H27A 3IH4A 2Z9OA 2HTSA 2JA6J 1LEBA 3CO7C 3UNGC 4M3GA 3H3UA 2HPIA 3CD6I 1YTYA 1KYWA 1X19A 1RI7A 3OYFA 5H6QA 5GAHJ 2R7QA 3QWLA 4A3BJ 1KU2A 4LFUA 2QQAA 1HDPA 5FKKA 5E18F 4BKXA 2W1OA 2CV1A 4HX7A 4RAYA 3LSRA 5TGTA 1WH5A 3BZKA 3ZMSA 2Z1DA 3GFIA 2E60A 4BXUA 2JPCA 4XKWA 2WBMA 3FKJA 4MNUA 2LD5A 5EGOA 4M3EA 2R92J 3FM5A 1EJ9A 2DA7A 4NDLA 4A2UA 2XAUA 3J80K 1KU7A 1B59A 1X3ZB 2XRLA 4A3JJ 3FBNB 2R7XA 3QYEA 5JHUA 1OISA 4XKBA 4X0GA 4HNTA 1TWHJ 3V4GA 2RV8A 2PBIA 4B1RA 2F5EA 1QQIA 2LF7A 1NK2P 2ELKA 4PDKA 2XGXA 1O3RA 4U7BA 2W7NA 2OBPA 2Z2SB 5DUIA 3PJRA 1G3YA 2LNBA 4OU0A 4FE4A 1LDDA 2K86A 1SFUA 2XKOA 1Y8QB 4M9XA 3KYDB 4F93B 4TV7A 2Z5UA 1AU7A 3MEXA 2JWTA 2FEZA 3LWFA 1LDJA 3G1MA 2EJRA 1E3HA 2P81A 3DEWA 1ULYA 4BEHA 3HHHA 2FX0A 3C1DA 1ETWA 4XOTA 2UXNA 2WAEA 4XRFA 5J4YA 3GTKJ 1U8BA 1YJWI 3LA2A 1X2NA 3U1DA 2JT1A 3L2UA 1YO5C 3VYSB 4ZZLA 1TP4A 2DDAA 1XSDA 3TO7A 3WGIA 1QO0D 4A5MA 1VF9A 1RNLA 1TL8A 2YX4A 2QM3A 4ZJZA 2I10A 2DW4A 1YITI 3L09A 4KDPA 4MIMA 3K0LA 3WU2C 2IJLA 2W25A 3AL0C 3QAHA 4ENNA 4A6DA 2XAGA 1YX3A 3ZCOA 2A6TA 2QBYB 2VASA 1GVJA 2W24A 2HDCA 2HVRA 4UNOA 4IX7A 2EA4A 3K2ZA 1Q1VA 3BTIA 3I71A 3K4JA 2VJIA 1EKEA 2M87A 3EYYA 4HAMA 1P6RA 2IGNA 3GXOA 2XKPA 1XDUA 3R6SA 3TMOA 1BIAA 1MBKA 4ZYAA 2VT2A 1AOYA 1IRFA 2QZ8A 4AIHA 1MNEA 1LFBA 1D8JA 3WTUC 1D0YA 1D1CA 5DCMB 3ZQ7A 3H0GJ 4RB1A 2HQNA 3GMEA 4EJOA 4F3QA 4DJAA 1V54H 2MYSA 3CCRI 3JRBA 3DF8A 1IF1A 4Q48A 3IRRA 5KAIC 2OZ6A 4PJNA 2V9VA 4Y4RA 2DMPA 4ENKA 2QYOA 2ESHA 3OV8A 1YFHA 4A3LJ 1A04A 5GTHC 1E3OC 3RI4A 5M5XJ 1VQ6I 2VN2A 4EM1A 3GTJJ 3E6CC 5HS7A 3CUOA 3DFGA 3L9FA 3OOUA 4DGWB 4XNFA 3L2VA 1SAXA 2QWWA 1D5VA 2CYYA 2HOTA 1BR4A 2CQNA 3F21A 3J7AO 2HZDA 2EFPA 3BJ6A 3TP3A 5FO5A 5E3LA 2JPBA 1R6RA 2LY9A 1FSHA 5J47A 3OIOA 2DK5A 2KL4A 1I1SA 2RDPA 2ZXJA 2ZXIA 2HS5A 4ZTJA 1D0XA 4XR6A 1V5FA 1RRJA 2MC4A 3E0JB 3V7RA 1BI0A 1FBQA 1UCRA 1T98A 2EB7A 2ZO4A 4XLHA 4C3HJ 5BNGA 3JAMK 1SVMA 3WTZA 2M9HA 2MGQA 5FKOA 1O57A 2IEKA 3TDZC 5EF6A 3K1MA 2R5YA 1O3QA 2F2EA 3WTYC 4BL0B 3OR1C 3OWTA 2M8EA 2K3PA 3EYIA 2HR3A 3KPHA 2JUGA 3QOEA 3L1PA 3N97A 3ULQB 1VI0A 4B3XA 2OC6A 3I64A 2JA5J 2BZTA 3F6VA 4B09A 1GHCA 4CUGA 1HKSA 5ILSA 3ZQHA 1TQMA 3S2WA 4XBFA 3LSMA 4XLEA 3FX3A 1LNWA 2V1UA 4HPQA 3LSIA 1FSEA 3W2AA 3BOQA 2NVQJ 3H35A 1U6GA 2GM4A 3TP0A 4D1QA 4WXCA 3HUGB 4IVNA 2ZXHA 4JYKA 1A6QA 2K4BA 2J5OA 2OQGA 3J81K 4E7SA 2JSPA 2CUFA 2E1OA 1W5SA 1ZLJA 3TL4X 4PK4A 5LGUA 4FT8A 1IC8A 4AVZA 1W36C 2DMUA 2O6GE 4A0XA 2GOXB 1NG6A 4PFOA 3AG1H 2BGCA 2MG4A 3HOVJ 3BT9A 4UB6C 4A6EA 4FHTA 4G8XA 1BI3A 2L01A 3LOCA 2Z99A 1U2WA 3S32A 2KJBA 1SVLA 1JGGA 2PMUA 1EV7A 2IT0A 2K85A 2NS7A 3E1SA 3RQIA 1AHDP 5F1JA 5DDGA 4IHWA 1QGPA 4GYGA 4AIKA 1A36A 4YG2F 5B5EC 3Q0VA 3HOSA 4IQ4A 5B3SH 2E5NA 5FB2A 3CUQB 2OU2A 5LFAA 1FYKA 2XSDC 3WTTC 5DV5A 3FXQA 4NQWB 5D5VB 3O2PE 3L00A 3HZJA 1ETVA 2Q1ZB 2LF8A 5CVRA 2OZUA 4AYBA 3TEDA 3PO3J 5J8FA 4OWRB 1JTYA 2V79A 1JXSA 4U88A 4F7ZA 4RM2A 5IOZA 3EUKL 2VB6A 2YPRA 4B8XA 5J1YA 2MLKA 3AG2H 3HOTA 3FDYA 2N8GA 4WF2A 4HBLA 4HNVA 4GRIA 2PFBA 3GTQJ 4BDZA 5J40A 4UUSA 1D3YA 4HG2A 3OOPA 1L3LA 3LA7A 1ERDA 3HXLA 4II2A 4LD5A 1E3PA 3SDBA 4AWXB 3LSHA 3IAS2 2FNAA 2VJ5A 3QODA 2BW3B 2HFHA 3OS2A 1JJ6C 2FU4A 2M30A 2TDXA 2K9LA 1BW6A 1LFPA 3I4PA 2EV0A 4RLQA 2EBIA 3KYCB 4L9JA 2MD5A 2DT7B 4YFKF 1DUXC 2FQ3A 3D5LA 5CPRB 3DKXA 4R1HA 3L2RA 4EJUA 2H8RA 1P7IA 1FEXA 3HPGA 3CMAI 4JQFA 1IW7F 3B73A 3NQOA 3OSGA 2UXXA 4N9HA 1N77A 3I9V2 1HF0A 3KEOA 3M8JA 2B9SA 3WU0A 1X4OA 5HNHA 1X1AA 2E2IJ 1JUPA 1RUOA 1XCVA 1E17A 4ESFA 2DA6A 3FHZA 1F4KA 2W57A 3E6MA 3KEYA 4LG0A 4MTDA 5M3MJ 2QA4I 2NXNB 1IN7A 4ZZDA 3FK6A 4RS8A 3RPUA 4M71A 3T8TA 2JK3A 2HYJA 3MZ8A 3E6DA 1X1DA 2BXZA 5HLHA 5IPAA 3W6VA 3K2AA 1LB2A 4DNCA 1WI3A 4M3FA 4E4HA 4CGZA 3KP3A 2QSHX 1K83J 3QPHA 4EJVA 2OTJI 5GAEJ 2V6CA 3GX4X 2L9VA 1QPIA 2LY1A 1Y39A 1DPUA 2RREA 2O9LA 3K4KA 4BXFA 3ZMZA 3S1MJ 5EGOB 4EGZA 3HBLA 3V8JA 4ZYDA 2BE5F 3KIOA 3MKYB 3WTWC 3KETA 4UV9A 5BPDA 4LB6B 4Y17A 1JHHA 3BR0A 2Y0SN 3PFYA 2OQRA 1WZ2A 2G7UA 1Z77A 1VZ0A 1R36A 1IAWA 1IG7A 1HOMA 2XC7A 5LHHA 3W3CA 3BROA 2L5QA 2BVMA 2DQLA 2YX7A 4L9TA 4WXDA 5IP7J 2RQQA 5LLQA 4EV0A 2JMWA 4NHJA 5CVJA 2X6OA 5A2QZ 1CF7B 1SFEA 2CQKA 3CJRB 3D0SA 2ZMEC 4BE2A 3BJAA 3E3VA 2JVGA 1USTA 2EA2A 1WJDA 4RB0A 3H0DA 3J7YJ 2L3DA 3AL0B 1Y0UA 2NOGA 3K6GA 4M3DA 3M3YJ 1Z21A 3S93A 3BR5A 3DU5A 3MAJA 1JUSA 4BEHB 4ESJA 5B1BH 4DYQA 3BWGA 3Q9SA 4HX8A 1F36A 5DD4A 4EM2A 4E7JA 1YW8A 5F0CA 4FETA 3A2KA 2M1BA 1DU0A 1IXRC 2VBXA 2KT0A 4FCYA 3ZMTA 1XB4A 3KP5A 2VQGA 3HHGA 3RYPA 3HOWJ 3AFHA 1G3TA 4E7LA 1LEAA 1RC9A 2EILH 3PSIA 3W6KB 3R0JA 1FIAA 3HM5A 2RQPA 3F8NA 3I3LA 1NTCA 2VI6A 1K79A 4XIDA 3ROUA 4XK4A 2XGEA 1KYZA 3I59A 4JX6A 4BHCA 2OCEA 1ZG3A 4B47A 1Z7LA 2QBYA 3J81Z 1MBFA 3JCUC 2QSGX 2HEOA 5K5RA 1B72A 4RLFA 2CS3A 1HBXG 4S0HB 1F1ZA 2MSYA 2X6WA 1RR7A 1E0EA 2E1NA 1FBUA 5IP6A 2WA0A 3HGGA 4L5JA 5L3DA 3SYTA 1MJ9A 4ZDLA 2BEOA 2G0EA 3JTGA 1I50J 3ABKH 4B44A 2A69F 1ZN2A 2CO5A 1J2XA 1LVAA 1J5YA 3A0BC 4LIUA 2QSFX 5DCMA 4FTHA 2LKXA 4PJLA 1FYMA 4AM3A 4U7DA 2H8WA 3GUDA 4UVBA 3CF2A 1RZ4A 3IWZA 4WK8F 4MFEA 3EUAA 3EQLF 2RNJA 2L2OA 1MMDA 1OQYA 4CO8A 2D2WA 2MFZA 2CW8A 4XLNF 5EEAA 3ELKA 4XLFA 1I3QJ 4CZCA 4UUTA 4IRIA 2BY2A 3K10A 3EPZA 2LDUA 1ZELA 1VQNI 2DFIA 1R1VA 1JGSA 1HCRA 1WCMJ 2XUBA 3HRSA 3HKZN 1U8RA 1KGSA 5L3EA 1HC8A 4IRHA 2FA5A 3RQ4A 2FMLA 2OUMA 2GIVA 3FKIJ 2JSCA 2LVSA 5TISC 2L9NA 1MD0A 5E79C 1I6HJ 2M4KA 1QVUA 1ONVA 2EINH 1IZ1A 2ZJPF 3K9TA 3WU1B 3JW4A 4J00A 3PUBA 1PYVA 4MEXF 4IHYA 1XPXA 2RAEA 2ZJ2A 1B6AA 5KCMA 1R00A 1YQAA 1XSXA 2K9NA 4P9UA 1T33A 1HW2A 4NNJA 5FFXA 3P7NA 4DOZA 1R58A 1RKWA 2KPMA 3QYBA 1BJZA 3BR1A 2FD5A 3ASOH 2RC4A 1ON1A 2EPFA 1ZARA 4L5EA 3MD2A 5JLWA 4XLCA 1IRZA 4DZJA 5JI6A 3L2WA 2ETHA 2DJNA 1T6SA 2QVOA 2R3SA 4XSXF 1JKPC 1VQPI 4G7ZF 5IY5H 1TWAJ 2W48A 3G1OA 2ISZA 1IUYA 1BJAA 4HW0A 2V1NA 4KICA 4Q5SF 3COAC 3SXYA 2K4JA 3K1PA 3M4OJ 4RGSA 1LUJB 1XD7A 3SEQA 3ZR8X 3RYRA 5GTIC 2DA5A 3HOUJ 5FFZA 3IAM2 5F64A 3TOAA 4HEA2 4XRSG 2HQAA 4QSHA 1IGNA 4Z2YA 4XM3A 4CHUA 3FF5A 2RKHA 3NEUA 1VQ5I 2XF5A 3CTAA 5HDNA 3AAFA 1FWZA 3ABLH 3WHCA 1OYYA 3M07A 3CUQC 4CICA 5KNLA 4PGHA 2RGVA 4I76A 5CQGA 1WGXA 1Y8RB 4WX9A 2Z16A 1MMNA 1VQ7I 2LRDA 4E7KA 1NK3P 2HYFA 3EUHA 1SANA 1SD7A 3ZQQA 1XGNA 4OAZA 1MBJA 1USSA 3QU6A 2GXBA 2AQFA 3CCEI 2K27A 1R9TJ 2M7BA 2KDZA 1OYWA 2E2JJ 4U0WA 3RTRA 3E6BA 3VFZA 2DA1A 5KHDA 3RKWA 3I56I 1MIJA 1K7AA 2CMPA 1ITYA 3L7WA 2XPUA 1R5HA 3VYRB 4BY7J 2KIFA 1K6OA 2WWYA 4HF1A 5FKMA 1S7AA 4XRMA 1T95A 2DDBA 3HJEA 3CUQA 4BH9A 5B66C 2EH3A 2ZCWA 3MKWB 4IJAA 4L9NA 2FBHA 1ZREA 2OA4A 2K9SA 2Y30A 1F9NA 2YUSA 1FP1D 2GLOA 5IYDJ 2DYSH 4A93J 4IQJA 2XRNA 3OSFA 3M1EA 3TW7A 1LJ9A 4A3GJ 4GCVA 5FGMA 2NNYA 3SZPA 3QP6A 3B6CA 3S1NJ 1T0FA 1YIOA 2MABA 4RGXA 4XOPA 3H1CA 2LBFA 1N25A 3BQZA 2A6HF 3A0HC 2NVYJ 2QQ9A 3H9JA 2BW3A 4BJ6C 1VQOI 1I1GA 3LNQA 1ZGWA 4QWQA 1DGRM 4MQVA 1SD5A 3OYIA 4GO1A 3J7ZI 3T1BA 2ICWG 1HDDC 3CDHA 2O8XA 1UHWA 3M9AA 5TRDA 4BHBA 4KMUX 5LEJA 4C2MJ 3GTPJ 5ICFA 3FMRA 2W4SA 3S17J 3GFMA 1GV2A 3DEEA 3QYFA 4HZFA 5JVTA 3CCYA 4RAFA 3G3ZA 2IA0A 4OIPF 2BXYA 3BCAA 2XPVA 4I7HA 1TNTA 1D1BA 4RGRA 4J19A 9ANTA 3PNTA 4LOCA 1OR7A 2DFFA 4LMYA 4RB3C 4LG0B 1IUFA 4RAGA 2EIJH 3DPUA 3KYLA 4LJZF 2CRGA 1G8XA 2HWVA 1LE8A 1X58A 5DYMA 1SVOA 2DMNA 2CG4A 1I6XA 3LSPA 2MH2A 3OYEA 1S29A 3B02A 1OCRH 2GQQA 3G1LA 4M6VA 2NYXA 2CUJA 5LBQA 2OAZA 3FWEA 1F5TA 2VXDA 3BQYA 1QU3A 3OL4A 2C6YA 1Z1DA 3JSPA 1ZRFA 2EQRA 2MD0A 4ABZA 3IP4B 3CQZJ 1UMQA 2WC2A 4DIQA 2X85A 3ESWB 2GWRA 5FD5A 2K40A 2HDDA 1JI8A 4BY1J 4V2FA 1FNNA 3IUOA 1P2FA 3SZTA 3TGNA 5ED4A 3MZHA 1U78A 1OR7C 2GAUA 3M7GA 1WH7A 2M34A 3BP8A 5K1YA 2D1HA 4Y33A 2ACJA 2KZGA 1T2KA 1T38A 4HDVA 2CGPA 3P9KA 4UHTA 2YS9A 1OYIA 3A03A 1JHFA 3D5RC 5CJ9A 2EIMH 3I55I 4I98B 2YU9J 3ZXSA 3K70D 4LLGF 4XLPF 3WODF 1WHUA 3PNVA 1UHMA 5TJJA 4A0YA 2KKOA 4P96A 4W97A 1CF7A 1RETA 2QLZA 4PCQA 4O6JA 3WTSC 1QZYA 5C44J 4WXHA 3NWTA 3DQVC 2PG4A 5L3CA 2E1MC 3FIWA 2DT6A 1YS6A 1WVRA 2QF7A 2WV1A 1EH8A 5FLVA 2KLOA 4Y3OA 2MH9A 4GGGA 1E2XA 2LLKA 2GXAA 1YW9A 4KN7X 3C2HA 2WY7Q 3CCVI 3OYDA 3CF5F 3PUFA 3BCBA 2AQEA 2E35A 4B4CA 3K7AJ 4KIBA 1RESA 4YEJA 3BTLA 2ZMEA 3O6BB 1Z9CA 2O03A 3VODA 1XX5A 2CV0A 2P0WA 4QIWN 1ORKA 2DA2A 3ZP5A 4XKCA 3H5NA 1MKMA 2OTLI 1Y56A 2KIUA 3A02A 5KAFC 2A5WA 1I39A 2P5VA 3HYIA 5CQEA 2LMDA 3JR9A 2R7RA 1GV5A 2LREA 3UKGA 4BQAA 1VQKI 5CVVA 4ZH4F 3I59B 3VYUB 1HW5A 4HV6A 2L9SA 3BY6A 4XQFA 3CJTB 3BJOA 5ILVA 4UV8A 3K4MA 2XGCA 3G71I 2IAIA 3KEQA 4P5OA 2LOOA 2VQHA 1I27A 1UHSA 4D0PA 3WGGA 4CCOA 1B72B 5LGTA 1FP2A 2VJJA 1UZCA 2NNNA 1GLNA 3ECOA 1CGPA 4UB8C 2KJCA 3AG3H 1OKRA 1MH3A 3K4BA 1WSUA 3RZOJ 4IKFA 2ME0A 1TT0A 1O4XA 2PI0A 2BY0A 3JTHA 4F52A 2ZKZA 3MQ0A 1HA8A 1X4PA 5C4XJ 1XGSA 2IRFG 2DCEA 4MGRA 4BJ5C 1GXPA 3OS1A 2IS6A 1GT0C 2ECBA 2F5VA 5F0HA 3VOEA 3DPLC 4Z6YA 2MW8A 4E6KG 4II3A 3V42A 5FLXK 4ITVA 3FXRA 2FBIA 2EFOA 1H0MA 3M1CA 3BLYA 3LAJA 4DW6A 1K61A 4IHVA 3EDPA 1JKOC 3NWSA 1OJLA 1FTTA 4GFBA 4HYEA 3CLOA 4EMSA 2QEXI 1VQLI 2R4GA 3KZYA 2H94A 2GOMA 1ZRDA 5ILUA 1KU9A 4K2EA 4HSTA 4DYRA 3QRFF 1R1TA 4IHXA 2XDVA 4HX4A 4JK1X 3C2BA 4ENMA 2DI3A 3GO5A 3JSOA 5E3MA 1QNTA 5J8CA 4LLLA 2DO7A 1KA8A 1SAUA 3JRHA 2HXIA 2QCOA 2ZC2A 4JX4A 4BAYA 2A61A 4QPOA 2KDOA 2O8KA 4IZZA 1W5TA 3BTJA 4IO9F 4XMYA 2QQBA 4UVCA 1FOYA 2V1XA 4UXNA 2GA2A 1R23A 1D0ZA 2G7HA 4F92B 3BZ6A 1BI1A 3ECHA 4YIRX 4CH7A 4KT5C 1BOBA 3F6OA 1VNDA 2ME6A 3KP2A 1OCCH 3GWZA 3GCMA 3OYGA 1O3TA 1SFXA 3IHUA 4MHGA 3D5SC 3KZZA 4XL9A 3PM1A 2P6TA 4BBRJ 3PIOF 5E8IA 3FXMA 2HVSA 3G73A 4C2TA 3HRMA 4AU7A 4Y13A 2DPUA 3FXLA 5F04A 5HS9A 1K4TA 1ETQA 2VKVA 1Z05A 4MEYF 3RPUD 3OYKA 2XAFA 3CMEI 2UZKA 3TKYA 1BBYA 3S16J 2R7TA 2NAZA 1Z3XA 2LTPA 2E71A 4AYBN 4CDGA 4IOAF 5F1RA 3IWFA 4LLNA 2Z3YA 5D6FA 4N0BA 1B1BA 4IOCF 3N05A 1VTNC 5HDGA 4C3JJ 4Q47A 5GPCA 3C7JA 2DMTA 5LRRA 4FASD 3O8GA 3TBIA 3GTOJ 4PFPA 3ZMDA 2PX9A 2V9PA 2UV1A 4XRSA 5J6XA 3I54A 1LDKB 1FT9A 1HLVA 4EJTA 4I2OA 5BOXA 2YSRA 3PL8A 2DOEA 2HKOA 2MA3A 4BJTA 1Z7UA 4EEFG 3DP7A 1TQPA 4AC0A 3FXJA 1YIJI 1S6LA 2M7AA 1OMIA 2H6CA 2X4HA 3GTMJ 3KZIC 1QZEA 3GFJA 5D4RA 1STZA 1U5TA 2LP0A 4G7HF 1YJNI 2FF4A 2OV7A 4S05A 1OLTA 1MDMA 1T8IA 4RM3A 5L3FA 1JUMA 3RDIA 4I0AA 1ZR4A 1X3WB 4U0YA 4I0BA 1WFXA 5HODA 3EUHC 3UR3C 3BG7A 4C9YA 2DU9A 2ZNZA 2FOKA 3NAUA 4YFNF 4G6DA 1W0TA 3HRTA 3JRAA 2P5KA 1Z6TA 5J1RA 2JRMA 1AA7A 4OINF 4M9SA 1Z6RA 4PJMA 3ZPLA 3RKQA 1YI2I 2PJRA 5GPAA 3BG5A 1DQUA 1WJBA 2ID3A 1U5TC 5K5QA 1FOWA 1FTZA 1J09A 1P4XA 4LK1F 1W0UA 2KRHA 2IS2A 3HSEA 1SC7A 1FYLA 1R4MB 4OIRF 3DV8A 1ZH5A 2BY1A 3C2GA 2KZVA 4CCJA 5DUKA 2LBFB 5LD2C 1OCOH 3KLOA 1FLIA 3FISA 2DAOA 3BR3A 1MJAA 1BI2A 1FMVA 3REOA 3V8LA 3MN2A 3HGYA 2EFQA 1WWXA 3ZMUA 1BC7C 2RVCA 1EH6A 1QHHD 3HTUA 4M3BA 4U0VA 1FOXA 4ZYHA 2E5ZA 3ZOBA 5HLGA 2QENA 5EG0A 1MSFC 4KISA 4CCNA 1ACIA 1MSEC 4RAZA 4BQOA 4RBOA 3CJNA 3PQKA 2OPTA 2LKPA 2DXIA 4LG3A 2JVHA 1T0FC 3ASNH 3ZRGA 1JT6A 1QZZA 5L3BA 4JBAA 4Y7NJ 1BM9A 2FQ4A 2JUCA 2VJ4A 1H89C 5ICEA 2XASA 5HOOA 3GZ6A 2HKXA 1ZAOA 5LHGA 1QBJA 4U87A 1XMXA 2VPRA 2R0QC 4OAYA 4AIDA 1FPQA 3OMYA 5EEHA 4D5CA 3F23A 1G4DA 4MTEA 3U21A 2AHQA 2JA7J 2XF7A 1LE8B 4O3MA 5JHFA 2X6YA 2PJPA 4BU2A 5FJ8J 3DBLB 3IKVA 4PZJA 2DOAA 1FMWA 1S7OA 2Y75A 1IXSB 1RIOH 2E1CA 2F4IA 1T08B 3I53A 1APLC 1FY7A 2VUMJ 2PMHA 2ZJQF 4HQEA 3F8FA 3LFUA 4KJZA 5DM6F 1REPC 1DGWY 2IXSA 3ZN1A 1ZLKA 1R4NB 2BV6A 3C3WA 2IS1A 4CZZA 1XS9A 1FIPA 3VB2A 2WTEA 4HNUA 4RDUA 2VKHA 2VIXA 2KQRA 1ON2A 2A5YB 2VQLA 1HKTA 3T8RA 4NUBA 4OOIA 4PSWA 3CO6C 2LKSA 4F91B 5E1WA 2HQRA 2LK2A 1S72I 2R7WA 1YW7A 2EZKA 1K78B 4XN3A 2EWNA 4D7MA 1IRXA 3I4NJ 1TW3A 1IV8A 2IBDA 3LQQA 4E7IA 3HDDA 3E7LA 3E97A 5CVUA 4H4KC 1K4SA 1T56A 3F8MA 4XKVA 2GXGA 1BA5A 5KK1A 1ZGJA 1MNDA 3V7SA 1VQMI 5D4SA 2XAHA 4YRVA 3IRQA 4Y15A 2BOLA 2XAJA 3VPRA 2O0YA 1QPMA 3Q0WA 3FBIB 2DBBA 1V5GA 4AD9A
chains in the Genus database with same CATH topology
3I0TA 5AIQA 2L4AA 4RB2C 3MWMA 2Q0OA 2ZMEB 2IW5A 2F5CA 2H09A 2BYVE 4OMZA 2XROA 5HLIA 4R79A 5BS6A 1XGMA 4I01A 5ERIA 1W7PB 2BBYA 4BNCA 1O7FA 2VE9A 1ODDA 5CLSA 4IXAA 1FZPB 2P7CB 5E17F 2XV4S 3QU3A 3U9GA 1FOKA 3R0AA 3DXJF 2ZFWA 2EV6A 4G6QA 3GEZA 5FD6A 5DD8A 2FRHA 3BPXA 2HZTA 2Y0MA 1KU3A 3DKWA 2EFNA 5EEGA 1SD4A 4FX0A 4M6XA 1BN5A 2JTVA 3LFKA 1J59A 3MZYA 1TTYA 3GZ5A 4ON0A 4LGWA 2Z33A 2P4WA 3I5UA 4BHPA 3FXUA 2NRAC 2XAQA 5CVIA 1HSJA 4EQQA 5HS8A 3TOBA 1J7KA 4HV5A 3JAMZ 3KP7A 4KUMA 4IF4A 1OPCA 2VBWA 4EGYA 2UWMA 2P7VB 2A07F 3NRVA 1MZBA 4G9YA 1R22A 1YS7A 2XIGA 3FM3A 4M9ZA 4YIIA 1G3SA 1EH7A 1SMYF 1WRJA 3F22A 2VXZA 1J75A 4ENJA 1XSVA 1UFMA 1PDNC 2RN7A 3HIFA 1W4MA 3KFWX 1BC8C 4HLYA 2B0LA 1O3SA 3DPTA 4KN4X 1G3WA 3L2CA 2ZNYA 3RJPA 4KNYA 4G94A 1KQ0A 5D8KB 1GXQA 3V8KA 2KIMA 1X3UA 1YLFA 3ZMVA 1TNSA 2GZWA 5H20A 2XHKA 2HOEA 2K02A 5BPIA 1IXCA 1HSTA 4UUVA 2O61A 1Z91A 3GYHX 4M6YA 1U5TB 3PFIA 4L0YB 2DPDA 1G6NA 1IN5A 1MDMB 3M8EA 2JRTA 4ASNA 4KFCA 2L02A 2XVCA 2F5FA 5JFRA 1TW2A 2PN6A 2YU3A 1IRGA 3BPVA 2W84A 4P9FA 4YIFA 1RUNA 1TLHB 3F3XA 4QLCU 2HTJA 1R5GA 4AVPA 3VEPA 2JZYA 2CWEA 3ABUA 2L54A 5D6EA 1MJBA 2FBKA 5ICCA 3E5XA 3K69A 1P92A 4BYYA 3MCZA 2F5DA 5D5XB 1XMAA 4GXOA 5DCFA 2NS0A 1IN8A 1WKMA 3FZVA 4OIQF 1B9NA 2IVMA 1J9IA 2CW0F 1HXDA 3R4KA 5ICGA 4IPAA 4ZYGA 4M74A 5A2QK 1V4RA 1PUEE 1B9MA 1YYVA 5AIPA 1V3FA 2MBFA 1LQ1A 2DQRA 3W6JB 3FMQA 4ESBA 2A6EF 2ISYA 4H0EA 5IT3A 4MQ9F 3RPQA 4L18B 4WWCA 2J5PA 3Q9VA 1C0WA 1XN7A 2DTRA 3R61A 1ZG1A 1FC3A 2FSWA 1KQ9A 4HLXA 4M73A 3GW2A 3QPTA 2L4MA 3M8FA 5F6FA 2VC0A 4OIOF 2VT3A 3WTXC 3H3ZA 1DPRA 3RKYA 2IA1A 4A12A 2DT5A 3GVAA 3P9CA 2CSOA 2VOOA 2FNPA 3ZN0A 4IRGA 5D5WB 4DQ2A 2IP2A 3LA3A 2ESNA 3C18A 2COMA 1K78A 3HRUA 2GA1A 2DLLA 2M5WA 1XCBA 4A0ZA 1W7PD 1ZYRF 2FE3A 3WG9A 2EV5A 2VBZA 3E5UA 1L0OC 3ML6A 3ISPA 2STTA 2DK8A 2HGCA 4KIFA 5KVRA 5IT9K 1BIBA 2P6SA 4O5VA 2E7WA 2A68F 5E1XA 1Q1HA 1XDSA 2STWA 3E5QA 5JR3A 4P55A 5BQTA 5H6RA 2A3SA 2VOPA 2VBYA 4KIGA 1W7PA 2IA2A 1TQIA 1WQ2A 2K7LA 5LHIA 3MFKA 2HYGD 4ZYEA 1UB9A 1XGOA 1MGTA 4L9VA 3O3KA 1SD6A 3SFZA 3GLXA 1HW1A 1U3EM 4KMFA 1PP7U 3TO9A 2AS5F 4N9IA 2PEXA 4HF2A 3ABTA 4CYDA 2IPQX 5DEQA 1ZHFA 4E70A 1S8NA 2OD5A 2WV0A 4ETSA 3J80Z 2V1DA 1SMTA 1TBXA 4A5NA 1WI9A 4PGGA 1HQCA 3EETA 3V7CA 2CFXA 3Q5FA 5LEKA 2G9WA 3TDUC 3IKTA 3F8CA 1IN6A 4EJWA 6PAXA 1NHAA 1D8KA 5HDKA 1XMKA 1HKQA 2YR2A 4HDUA 4WCGA 1T39A 1P4WA 2PQ8A 2FXAA 2ADUA 4I09A 5E8GA 1YG2A 4G7OF 2W85A 3TO6A 4CXFA 1ZGAA 4L0ZB 3QP5A 2R7FA 1JE8A 3U2RA 3SHFA 3IL2A 2EFWA 1KQ8A 2D1VA 3H92A 5L3GA 3T0YA 4HQMA 2FMYA 3RIRA 4KA4A 2D45A 4HF0A 2EK5A 4R8HA 3TQNA 1FBSA 2X0LA 1H9TA 3K1NA 1ZRCA 2VC1A 2LSOA 5HVQC 1B4AA 1O7LA 1BOAA 2VODA 3HSRA 3WGHA 3FMSA 5FLXZ 1PP8F 3F8BA 3GF2A 3T5XA 4HOBA 3WE2A 4LB5A 3PQJA 3KP4A 1AWCA 3LSTA 5AONA 2PLYA 3P9IA 4XSZF 3QOPA 5E1ZB 1R7JA 3IC7A 1R1UA 3F72A 1FX7A 4GYIA 3HUGA 1S3JA 4FX4A 2M45A 1IN4A 2E7XA 1ZG5A 2ZBKA 2Q8KA 3SQNA 5K5OA 2Y48A 1J0RA 2ELHA 4UVAA 2MC3A 4L5IA 3WE3A 2MLGA 3GFLA 3KP6A 4LK0F 3DEUA 2O3FA 3RKXA 4AIJA 2VE8A 4IHSA 4NQWA 3WTVC 5IT9Z 3HSFA 4I02A 1DP7P 4S04A 1H9GA 3N4MA 4NB5A 4M72A 5LRSA 4IHTA 4OMYA 3LQRA 1P4AA 2KRFA 2P5LC 2H6BA 1DDNA 2AXLA 5BMZA 3ERED 4EVIA 4KYWA 2P8TA 2Q2EA 4RGUA 5CYVA 3HTSB 3R60A 2R7DA 1I5ZA 5E20A 5D5UB 3I58A 5D8LB 3KE2A 4HA8A 5LGNA 2QUFA 3KLNA 4Q4ZF 4YFXF 3KCCA 3LAPA 4EM0B 3BDDA 2VONA 2H27A 2Z9OA 2HTSA 1LEBA 3CO7C 3H3UA 1YTYA 1KYWA 1RI7A 5H6QA 1KU2A 4LFUA 2QQAA 5E18F 4HX7A 4RAYA 3ZMSA 3GFIA 4BXUA 2JPCA 4MNUA 3FM5A 4A2UA 3J80K 1KU7A 1B59A 5JHUA 3V4GA 2RV8A 2PBIA 2F5EA 1QQIA 2LF7A 4PDKA 2XGXA 1O3RA 4U7BA 2OBPA 5DUIA 1G3YA 2LNBA 4OU0A 1LDDA 2K86A 1SFUA 2XKOA 4M9XA 4TV7A 2Z5UA 3MEXA 2FEZA 3LWFA 1LDJA 2EJRA 1ULYA 3C1DA 3HHHA 2UXNA 4XRFA 3LA2A 3U1DA 2JT1A 1YO5C 4ZZLA 1XSDA 3TO7A 3WGIA 1QO0D 4A5MA 1RNLA 2YX4A 2QM3A 2DW4A 3L09A 4KDPA 3K0LA 2IJLA 2W25A 3QAHA 4ENNA 4A6DA 2XAGA 2QBYB 1GVJA 2W24A 2HDCA 4UNOA 2EA4A 3K2ZA 3I71A 3EYYA 2M87A 4HAMA 1P6RA 3GXOA 3R6SA 2XKPA 1XDUA 1BIAA 2VT2A 1AOYA 1IRFA 2QZ8A 4AIHA 1D8JA 3WTUC 5DCMB 3ZQ7A 4RB1A 2HQNA 4EJOA 3DF8A 1IF1A 4Q48A 3IRRA 2OZ6A 2V9VA 4ENKA 2QYOA 2ESHA 3OV8A 1YFHA 1A04A 3RI4A 2VN2A 4EM1A 3E6CC 5HS7A 3CUOA 3DFGA 3L9FA 1SAXA 2QWWA 1D5VA 2CYYA 3F21A 3J7AO 2EFPA 3BJ6A 5FO5A 2JPBA 1FSHA 2DK5A 1I1SA 2RDPA 2ZXJA 2HS5A 3V7RA 1BI0A 1FBQA 1UCRA 1T98A 2EB7A 2ZO4A 3JAMK 3WTZA 1O57A 3TDZC 3K1MA 1O3QA 2F2EA 3WTYC 2M8EA 3EYIA 2HR3A 3N97A 3ULQB 3I64A 3F6VA 4B09A 1GHCA 1HKSA 5ILSA 1TQMA 3S2WA 4XBFA 3FX3A 1LNWA 2V1UA 1FSEA 3BOQA 1U6GA 4WXCA 4IVNA 2K4BA 2J5OA 2OQGA 3J81K 1W5SA 1ZLJA 5LGUA 4FT8A 2O6GE 4A0XA 2BGCA 4A6EA 4FHTA 4G8XA 1BI3A 2L01A 2Z99A 1U2WA 2KJBA 2PMUA 1EV7A 2IT0A 5DDGA 1QGPA 4GYGA 4AIKA 4YG2F 3HOSA 5FB2A 3CUQB 2OU2A 1FYKA 3WTTC 5DV5A 3FXQA 5D5VB 3O2PE 3L00A 2LF8A 5CVRA 2OZUA 5J8FA 2V79A 1JXSA 4U88A 4F7ZA 2YPRA 4B8XA 2MLKA 3HOTA 4WF2A 4HBLA 2PFBA 1D3YA 3OOPA 1L3LA 3LA7A 4LD5A 4AWXB 2FNAA 2HFHA 2FU4A 2M30A 2TDXA 3I4PA 2EV0A 4L9JA 2MD5A 4YFKF 1DUXC 2FQ3A 3D5LA 4R1HA 4EJUA 4JQFA 1IW7F 3B73A 3NQOA 2UXXA 4N9HA 3KEOA 3WU0A 1RUOA 1XCVA 1E17A 4ESFA 3FHZA 1F4KA 2W57A 3E6MA 4LG0A 4MTDA 1IN7A 4ZZDA 4RS8A 3RPUA 4M71A 3T8TA 3E6DA 5HLHA 1LB2A 4DNCA 4CGZA 3KP3A 3QPHA 4EJVA 2V6CA 3GX4X 1DPUA 3ZMZA 4EGZA 3V8JA 4ZYDA 2BE5F 3WTWC 3KETA 4UV9A 5BPDA 4LB6B 4Y17A 1JHHA 2OQRA 2G7UA 1R36A 1IAWA 5LHHA 3BROA 2YX7A 4L9TA 2DQLA 4WXDA 5LLQA 4EV0A 4NHJA 5CVJA 5A2QZ 1CF7B 1SFEA 2CQKA 3D0SA 3BJAA 3E3VA 1USTA 2EA2A 4RB0A 2L3DA 1Y0UA 4ESJA 3MAJA 3BWGA 3Q9SA 4HX8A 5DD4A 4EM2A 1YW8A 2M1BA 1IXRC 2VBXA 3ZMTA 1XB4A 3KP5A 3HHGA 3RYPA 1G3TA 1LEAA 3W6KB 3R0JA 2RQPA 3F8NA 1K79A 3ROUA 1KYZA 3I59A 4BHCA 1ZG3A 2QBYA 3J81Z 2HEOA 5K5RA 1HBXG 1F1ZA 2E1NA 1FBUA 4L5JA 5L3DA 1MJ9A 2BEOA 3JTGA 2A69F 1ZN2A 2CO5A 1J2XA 1LVAA 1J5YA 5DCMA 1FYMA 4U7DA 3GUDA 4UVBA 4WK8F 1RZ4A 3IWZA 3EQLF 2RNJA 4CO8A 2D2WA 4XLNF 3ELKA 4IRIA 2LDUA 2DFIA 1R1VA 1JGSA 2XUBA 3HRSA 1U8RA 1KGSA 5L3EA 4IRHA 2FA5A 2FMLA 2GIVA 2JSCA 1MD0A 1ONVA 1IZ1A 3K9TA 3WU1B 3JW4A 4MEXF 1B6AA 2ZJ2A 1R00A 1YQAA 1XSXA 4P9UA 1HW2A 5FFXA 3P7NA 1R58A 2RC4A 1ON1A 1ZARA 5JI6A 2ETHA 1T6SA 2QVOA 2R3SA 4XSXF 4G7ZF 1IUYA 2ISZA 1BJAA 4HW0A 4KICA 4Q5SF 3COAC 3SXYA 2K4JA 3K1PA 4RGSA 1XD7A 3RYRA 5FFZA 3TOAA 5F64A 4Z2YA 4CHUA 3FF5A 2RKHA 3NEUA 3CTAA 5HDNA 3AAFA 1FWZA 4CICA 1OYYA 3CUQC 4PGHA 2RGVA 4WX9A 2HYFA 3EUHA 1SD7A 1XGNA 1USSA 3QU6A 2GXBA 2K27A 1OYWA 4U0WA 3RTRA 3E6BA 3VFZA 3RKWA 1K7AA 3L7WA 1R5HA 2KIFA 1K6OA 4HF1A 2WWYA 1S7AA 3CUQA 4BH9A 2ZCWA 4IJAA 4L9NA 2FBHA 1ZREA 2OA4A 1F9NA 1FP1D 2XRNA 3M1EA 1LJ9A 4GCVA 5FGMA 2NNYA 3SZPA 3QP6A 1T0FA 1YIOA 4RGXA 2A6HF 2QQ9A 1I1GA 4QWQA 4MQVA 1SD5A 4GO1A 3T1BA 3CDHA 2O8XA 1UHWA 3M9AA 5TRDA 4BHBA 4KMUX 5LEJA 5ICFA 3FMRA 3GFMA 4HZFA 5JVTA 3G3ZA 2IA0A 4OIPF 4I7HA 1TNTA 4RGRA 1OR7A 4LMYA 4RB3C 4LG0B 4LJZF 2HWVA 5DYMA 2CG4A 1I6XA 2MH2A 1S29A 3B02A 2GQQA 2NYXA 5LBQA 2OAZA 3FWEA 1F5TA 2C6YA 1Z1DA 3JSPA 1ZRFA 2WC2A 5FD5A 2GWRA 3TGNA 1FNNA 1P2FA 3SZTA 5ED4A 3MZHA 1U78A 2GAUA 3M7GA 5K1YA 3BP8A 2D1HA 2ACJA 1T2KA 1T38A 4HDVA 2CGPA 3P9KA 4UHTA 1OYIA 5CJ9A 1JHFA 4I98B 4LLGF 4XLPF 3WODF 1UHMA 5TJJA 4A0YA 2KKOA 4P96A 1CF7A 2QLZA 4PCQA 4O6JA 3WTSC 1QZYA 4WXHA 3DQVC 2PG4A 5L3CA 1YS6A 1EH8A 2MH9A 4GGGA 1E2XA 1YW9A 4KN7X 4KIBA 2ZMEA 3O6BB 1Z9CA 2O03A 3VODA 3ZP5A 1MKMA 2KIUA 2P5VA 3HYIA 4BQAA 5CVVA 4ZH4F 3I59B 1HW5A 4HV6A 3BY6A 3BJOA 5ILVA 4UV8A 3KEQA 4P5OA 1I27A 4D0PA 3WGGA 5LGTA 1FP2A 2NNNA 3ECOA 1CGPA 2KJCA 1OKRA 1WSUA 2PI0A 3JTHA 2ZKZA 3MQ0A 1XGSA 2IRFG 4MGRA 1GXPA 3VOEA 3DPLC 5FLXK 3FXRA 2FBIA 2EFOA 1H0MA 3LAJA 3EDPA 4HYEA 3CLOA 4EMSA 3KZYA 2H94A 1ZRDA 5ILUA 1KU9A 4K2EA 3QRFF 1R1TA 4HX4A 4JK1X 4ENMA 2DI3A 3GO5A 3JSOA 1QNTA 5J8CA 4LLLA 2DO7A 1KA8A 4BAYA 2A61A 1W5TA 2QQBA 4UVCA 2V1XA 4UXNA 2GA2A 1R23A 2G7HA 3BZ6A 1BI1A 3ECHA 4KT5C 3F6OA 3KP2A 3GWZA 1O3TA 1SFXA 3IHUA 4MHGA 3KZZA 2P6TA 5E8IA 3G73A 3HRMA 4Y13A 2DPUA 5HS9A 4MEYF 1Z05A 2XAFA 2UZKA 3TKYA 1BBYA 2NAZA 4CDGA 5F1RA 3IWFA 4LLNA 2Z3YA 5D6FA 4N0BA 1B1BA 1VTNC 5HDGA 4Q47A 3C7JA 5LRRA 3ZMDA 5J6XA 3I54A 1LDKB 1FT9A 4EJTA 4I2OA 5BOXA 2YSRA 2HKOA 2MA3A 1Z7UA 3DP7A 1TQPA 1S6LA 2X4HA 1OMIA 2H6CA 3GFJA 5D4RA 1STZA 1U5TA 4G7HF 2FF4A 4S05A 1MDMA 5L3FA 3RDIA 4I0AA 4U0YA 4I0BA 2DU9A 2ZNZA 2FOKA 4YFNF 4G6DA 3HRTA 2P5KA 1Z6TA 4OINF 4M9SA 1Z6RA 3ZPLA 1U5TC 5K5QA 1P4XA 4LK1F 3HSEA 1FYLA 4OIRF 3DV8A 1ZH5A 5DUKA 1FLIA 3KLOA 2DAOA 1MJAA 1BI2A 3REOA 3V8LA 2EFQA 1WWXA 3ZMUA 1BC7C 2RVCA 1EH6A 3HTUA 4U0VA 4ZYHA 5HLGA 2QENA 4RAZA 3CJNA 3PQKA 2LKPA 1QZZA 5L3BA 4JBAA 1BM9A 5ICEA 2XASA 5HOOA 3GZ6A 2HKXA 1QBJA 1ZAOA 5LHGA 1FPQA 5EEHA 3F23A 1G4DA 4MTEA 4O3MA 2PJPA 3IKVA 4PZJA 1S7OA 2Y75A 1IXSB 2E1CA 1RIOH 3I53A 1FY7A 2PMHA 4HQEA 3F8FA 1REPC 3ZN1A 1ZLKA 2BV6A 3C3WA 4CZZA 3VB2A 2WTEA 1ON2A 2A5YB 1HKTA 3T8RA 4OOIA 3CO6C 5E1WA 2HQRA 1YW7A 1K78B 2EWNA 1TW3A 3LQQA 3E97A 5CVUA 3F8MA 2GXGA 5KK1A 1ZGJA 3V7SA 5D4SA 2XAHA 3IRQA 4Y15A 2XAJA 2O0YA 1QPMA 2DBBA 4AD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0T A;  5AIQ A;  2L4A A;  4RB2 C;  3MWM A;  2Q0O A;  2ZME B;  2IW5 A;  2F5C A;  2H09 A;  2BYV E;  4OMZ A;  2XRO A;  5HLI A;  4R79 A;  5BS6 A;  1XGM A;  4I01 A;  5ERI A;  1W7P B;  2BBY A;  4BNC A;  1O7F A;  2VE9 A;  1ODD A;  5CLS A;  4IXA A;  1FZP B;  2P7C B;  5E17 F;  2XV4 S;  3QU3 A;  3U9G A;  1FOK A;  3R0A A;  3DXJ F;  2ZFW A;  2EV6 A;  4G6Q A;  3GEZ A;  5FD6 A;  5DD8 A;  2FRH A;  3BPX A;  2HZT A;  2Y0M A;  1KU3 A;  3DKW A;  2EFN A;  5EEG A;  1SD4 A;  4FX0 A;  4M6X A;  1BN5 A;  2JTV A;  3LFK A;  1J59 A;  3MZY A;  1TTY A;  3GZ5 A;  4ON0 A;  4LGW A;  2Z33 A;  2P4W A;  3I5U A;  4BHP A;  3FXU A;  2NRA C;  2XAQ A;  5CVI A;  1HSJ A;  4EQQ A;  5HS8 A;  3TOB A;  1J7K A;  4HV5 A;  3JAM Z;  3KP7 A;  4KUM A;  4IF4 A;  1OPC A;  2VBW A;  4EGY A;  2UWM A;  2P7V B;  2A07 F;  3NRV A;  1MZB A;  4G9Y A;  1R22 A;  1YS7 A;  2XIG A;  3FM3 A;  4M9Z A;  4YII A;  1G3S A;  1EH7 A;  1SMY F;  1WRJ A;  3F22 A;  2VXZ A;  1J75 A;  4ENJ A;  1XSV A;  1UFM A;  1PDN C;  2RN7 A;  3HIF A;  1W4M A;  3KFW X;  1BC8 C;  4HLY A;  2B0L A;  1O3S A;  3DPT A;  4KN4 X;  1G3W A;  3L2C A;  2ZNY A;  3RJP A;  4KNY A;  4G94 A;  1KQ0 A;  5D8K B;  1GXQ A;  3V8K A;  2KIM A;  1X3U A;  1YLF A;  3ZMV A;  1TNS A;  2GZW A;  5H20 A;  2XHK A;  2HOE A;  2K02 A;  5BPI A;  1IXC A;  1HST A;  4UUV A;  2O61 A;  1Z91 A;  3GYH X;  4M6Y A;  1U5T B;  3PFI A;  4L0Y B;  2DPD A;  1G6N A;  1IN5 A;  1MDM B;  3M8E A;  2JRT A;  4ASN A;  4KFC A;  2L02 A;  2XVC A;  2F5F A;  5JFR A;  1TW2 A;  2PN6 A;  2YU3 A;  1IRG A;  3BPV A;  2W84 A;  4P9F A;  4YIF A;  1RUN A;  1TLH B;  3F3X A;  4QLC U;  2HTJ A;  1R5G A;  4AVP A;  3VEP A;  2JZY A;  2CWE A;  3ABU A;  2L54 A;  5D6E A;  1MJB A;  2FBK A;  5ICC A;  3E5X A;  3K69 A;  1P92 A;  4BYY A;  3MCZ A;  2F5D A;  5D5X B;  1XMA A;  4GXO A;  5DCF A;  2NS0 A;  1IN8 A;  1WKM A;  3FZV A;  4OIQ F;  1B9N A;  2IVM A;  1J9I A;  2CW0 F;  1HXD A;  3R4K A;  5ICG A;  4IPA A;  4ZYG A;  4M74 A;  5A2Q K;  1V4R A;  1PUE E;  1B9M A;  1YYV A;  5AIP A;  1V3F A;  2MBF A;  1LQ1 A;  2DQR A;  3W6J B;  3FMQ A;  4ESB A;  2A6E F;  2ISY A;  4H0E A;  5IT3 A;  4MQ9 F;  3RPQ A;  4L18 B;  4WWC A;  2J5P A;  3Q9V A;  1C0W A;  1XN7 A;  2DTR A;  3R61 A;  1ZG1 A;  1FC3 A;  2FSW A;  1KQ9 A;  4HLX A;  4M73 A;  3GW2 A;  3QPT A;  2L4M A;  3M8F A;  5F6F A;  2VC0 A;  4OIO F;  2VT3 A;  3WTX C;  3H3Z A;  1DPR A;  3RKY A;  2IA1 A;  4A12 A;  2DT5 A;  3GVA A;  3P9C A;  2CSO A;  2VOO A;  2FNP A;  3ZN0 A;  4IRG A;  5D5W B;  4DQ2 A;  2IP2 A;  3LA3 A;  2ESN A;  3C18 A;  2COM A;  1K78 A;  3HRU A;  2GA1 A;  2DLL A;  2M5W A;  1XCB A;  4A0Z A;  1W7P D;  1ZYR F;  2FE3 A;  3WG9 A;  2EV5 A;  2VBZ A;  3E5U A;  1L0O C;  3ML6 A;  3ISP A;  2STT A;  2DK8 A;  2HGC A;  4KIF A;  5KVR A;  5IT9 K;  1BIB A;  2P6S A;  4O5V A;  2E7W A;  2A68 F;  5E1X A;  1Q1H A;  1XDS A;  2STW A;  3E5Q A;  5JR3 A;  4P55 A;  5BQT A;  5H6R A;  2A3S A;  2VOP A;  2VBY A;  4KIG A;  1W7P A;  2IA2 A;  1TQI A;  1WQ2 A;  2K7L A;  5LHI A;  3MFK A;  2HYG D;  4ZYE A;  1UB9 A;  1XGO A;  1MGT A;  4L9V A;  3O3K A;  1SD6 A;  3SFZ A;  3GLX A;  1HW1 A;  1U3E M;  4KMF A;  1PP7 U;  3TO9 A;  2AS5 F;  4N9I A;  2PEX A;  4HF2 A;  3ABT A;  4CYD A;  2IPQ X;  5DEQ A;  1ZHF A;  4E70 A;  1S8N A;  2OD5 A;  2WV0 A;  4ETS A;  3J80 Z;  2V1D A;  1SMT A;  1TBX A;  4A5N A;  1WI9 A;  4PGG A;  1HQC A;  3EET A;  3V7C A;  2CFX A;  3Q5F A;  5LEK A;  2G9W A;  3TDU C;  3IKT A;  3F8C A;  1IN6 A;  4EJW A;  6PAX A;  1NHA A;  1D8K A;  5HDK A;  1XMK A;  1HKQ A;  2YR2 A;  4HDU A;  4WCG A;  1T39 A;  1P4W A;  2PQ8 A;  2FXA A;  2ADU A;  4I09 A;  5E8G A;  1YG2 A;  4G7O F;  2W85 A;  3TO6 A;  4CXF A;  1ZGA A;  4L0Z B;  3QP5 A;  2R7F A;  1JE8 A;  3U2R A;  3SHF A;  3IL2 A;  2EFW A;  1KQ8 A;  2D1V A;  3H92 A;  5L3G A;  3T0Y A;  4HQM A;  2FMY A;  3RIR A;  4KA4 A;  2D45 A;  4HF0 A;  2EK5 A;  4R8H A;  3TQN A;  1FBS A;  2X0L A;  1H9T A;  3K1N A;  1ZRC A;  2VC1 A;  2LSO A;  5HVQ C;  1B4A A;  1O7L A;  1BOA A;  2VOD A;  3HSR A;  3WGH A;  3FMS A;  5FLX Z;  1PP8 F;  3F8B A;  3GF2 A;  3T5X A;  4HOB A;  3WE2 A;  4LB5 A;  3PQJ A;  3KP4 A;  1AWC A;  3LST A;  5AON A;  2PLY A;  3P9I A;  4XSZ F;  3QOP A;  5E1Z B;  1R7J A;  3IC7 A;  1R1U A;  3F72 A;  1FX7 A;  4GYI A;  3HUG A;  1S3J A;  4FX4 A;  2M45 A;  1IN4 A;  2E7X A;  1ZG5 A;  2ZBK A;  2Q8K A;  3SQN A;  5K5O A;  2Y48 A;  1J0R A;  2ELH A;  4UVA A;  2MC3 A;  4L5I A;  3WE3 A;  2MLG A;  3GFL A;  3KP6 A;  4LK0 F;  3DEU A;  2O3F A;  3RKX A;  4AIJ A;  2VE8 A;  4IHS A;  4NQW A;  3WTV C;  5IT9 Z;  3HSF A;  4I02 A;  1DP7 P;  4S04 A;  1H9G A;  3N4M A;  4NB5 A;  4M72 A;  5LRS A;  4IHT A;  4OMY A;  3LQR A;  1P4A A;  2KRF A;  2P5L C;  2H6B A;  1DDN A;  2AXL A;  5BMZ A;  3ERE D;  4EVI A;  4KYW A;  2P8T A;  2Q2E A;  4RGU A;  5CYV A;  3HTS B;  3R60 A;  2R7D A;  1I5Z A;  5E20 A;  5D5U B;  3I58 A;  5D8L B;  3KE2 A;  4HA8 A;  5LGN A;  2QUF A;  3KLN A;  4Q4Z F;  4YFX F;  3KCC A;  3LAP A;  4EM0 B;  3BDD A;  2VON A;  2H27 A;  2Z9O A;  2HTS A;  1LEB A;  3CO7 C;  3H3U A;  1YTY A;  1KYW A;  1RI7 A;  5H6Q A;  1KU2 A;  4LFU A;  2QQA A;  5E18 F;  4HX7 A;  4RAY A;  3ZMS A;  3GFI A;  4BXU A;  2JPC A;  4MNU A;  3FM5 A;  4A2U A;  3J80 K;  1KU7 A;  1B59 A;  5JHU A;  3V4G A;  2RV8 A;  2PBI A;  2F5E A;  1QQI A;  2LF7 A;  4PDK A;  2XGX A;  1O3R A;  4U7B A;  2OBP A;  5DUI A;  1G3Y A;  2LNB A;  4OU0 A;  1LDD A;  2K86 A;  1SFU A;  2XKO A;  4M9X A;  4TV7 A;  2Z5U A;  3MEX A;  2FEZ A;  3LWF A;  1LDJ A;  2EJR A;  1ULY A;  3C1D A;  3HHH A;  2UXN A;  4XRF A;  3LA2 A;  3U1D A;  2JT1 A;  1YO5 C;  4ZZL A;  1XSD A;  3TO7 A;  3WGI A;  1QO0 D;  4A5M A;  1RNL A;  2YX4 A;  2QM3 A;  2DW4 A;  3L09 A;  4KDP A;  3K0L A;  2IJL A;  2W25 A;  3QAH A;  4ENN A;  4A6D A;  2XAG A;  2QBY B;  1GVJ A;  2W24 A;  2HDC A;  4UNO A;  2EA4 A;  3K2Z A;  3I71 A;  3EYY A;  2M87 A;  4HAM A;  1P6R A;  3GXO A;  3R6S A;  2XKP A;  1XDU A;  1BIA A;  2VT2 A;  1AOY A;  1IRF A;  2QZ8 A;  4AIH A;  1D8J A;  3WTU C;  5DCM B;  3ZQ7 A;  4RB1 A;  2HQN A;  4EJO A;  3DF8 A;  1IF1 A;  4Q48 A;  3IRR A;  2OZ6 A;  2V9V A;  4ENK A;  2QYO A;  2ESH A;  3OV8 A;  1YFH A;  1A04 A;  3RI4 A;  2VN2 A;  4EM1 A;  3E6C C;  5HS7 A;  3CUO A;  3DFG A;  3L9F A;  1SAX A;  2QWW A;  1D5V A;  2CYY A;  3F21 A;  3J7A O;  2EFP A;  3BJ6 A;  5FO5 A;  2JPB A;  1FSH A;  2DK5 A;  1I1S A;  2RDP A;  2ZXJ A;  2HS5 A;  3V7R A;  1BI0 A;  1FBQ A;  1UCR A;  1T98 A;  2EB7 A;  2ZO4 A;  3JAM K;  3WTZ A;  1O57 A;  3TDZ C;  3K1M A;  1O3Q A;  2F2E A;  3WTY C;  2M8E A;  3EYI A;  2HR3 A;  3N97 A;  3ULQ B;  3I64 A;  3F6V A;  4B09 A;  1GHC A;  1HKS A;  5ILS A;  1TQM A;  3S2W A;  4XBF A;  3FX3 A;  1LNW A;  2V1U A;  1FSE A;  3BOQ A;  1U6G A;  4WXC A;  4IVN A;  2K4B A;  2J5O A;  2OQG A;  3J81 K;  1W5S A;  1ZLJ A;  5LGU A;  4FT8 A;  2O6G E;  4A0X A;  2BGC A;  4A6E A;  4FHT A;  4G8X A;  1BI3 A;  2L01 A;  2Z99 A;  1U2W A;  2KJB A;  2PMU A;  1EV7 A;  2IT0 A;  5DDG A;  1QGP A;  4GYG A;  4AIK A;  4YG2 F;  3HOS A;  5FB2 A;  3CUQ B;  2OU2 A;  1FYK A;  3WTT C;  5DV5 A;  3FXQ A;  5D5V B;  3O2P E;  3L00 A;  2LF8 A;  5CVR A;  2OZU A;  5J8F A;  2V79 A;  1JXS A;  4U88 A;  4F7Z A;  2YPR A;  4B8X A;  2MLK A;  3HOT A;  4WF2 A;  4HBL A;  2PFB A;  1D3Y A;  3OOP A;  1L3L A;  3LA7 A;  4LD5 A;  4AWX B;  2FNA A;  2HFH A;  2FU4 A;  2M30 A;  2TDX A;  3I4P A;  2EV0 A;  4L9J A;  2MD5 A;  4YFK F;  1DUX C;  2FQ3 A;  3D5L A;  4R1H A;  4EJU A;  4JQF A;  1IW7 F;  3B73 A;  3NQO A;  2UXX A;  4N9H A;  3KEO A;  3WU0 A;  1RUO A;  1XCV A;  1E17 A;  4ESF A;  3FHZ A;  1F4K A;  2W57 A;  3E6M A;  4LG0 A;  4MTD A;  1IN7 A;  4ZZD A;  4RS8 A;  3RPU A;  4M71 A;  3T8T A;  3E6D A;  5HLH A;  1LB2 A;  4DNC A;  4CGZ A;  3KP3 A;  3QPH A;  4EJV A;  2V6C A;  3GX4 X;  1DPU A;  3ZMZ A;  4EGZ A;  3V8J A;  4ZYD A;  2BE5 F;  3WTW C;  3KET A;  4UV9 A;  5BPD A;  4LB6 B;  4Y17 A;  1JHH A;  2OQR A;  2G7U A;  1R36 A;  1IAW A;  5LHH A;  3BRO A;  2YX7 A;  4L9T A;  2DQL A;  4WXD A;  5LLQ A;  4EV0 A;  4NHJ A;  5CVJ A;  5A2Q Z;  1CF7 B;  1SFE A;  2CQK A;  3D0S A;  3BJA A;  3E3V A;  1UST A;  2EA2 A;  4RB0 A;  2L3D A;  1Y0U A;  4ESJ A;  3MAJ A;  3BWG A;  3Q9S A;  4HX8 A;  5DD4 A;  4EM2 A;  1YW8 A;  2M1B A;  1IXR C;  2VBX A;  3ZMT A;  1XB4 A;  3KP5 A;  3HHG A;  3RYP A;  1G3T A;  1LEA A;  3W6K B;  3R0J A;  2RQP A;  3F8N A;  1K79 A;  3ROU A;  1KYZ A;  3I59 A;  4BHC A;  1ZG3 A;  2QBY A;  3J81 Z;  2HEO A;  5K5R A;  1HBX G;  1F1Z A;  2E1N A;  1FBU A;  4L5J A;  5L3D A;  1MJ9 A;  2BEO A;  3JTG A;  2A69 F;  1ZN2 A;  2CO5 A;  1J2X A;  1LVA A;  1J5Y A;  5DCM A;  1FYM A;  4U7D A;  3GUD A;  4UVB A;  4WK8 F;  1RZ4 A;  3IWZ A;  3EQL F;  2RNJ A;  4CO8 A;  2D2W A;  4XLN F;  3ELK A;  4IRI A;  2LDU A;  2DFI A;  1R1V A;  1JGS A;  2XUB A;  3HRS A;  1U8R A;  1KGS A;  5L3E A;  4IRH A;  2FA5 A;  2FML A;  2GIV A;  2JSC A;  1MD0 A;  1ONV A;  1IZ1 A;  3K9T A;  3WU1 B;  3JW4 A;  4MEX F;  1B6A A;  2ZJ2 A;  1R00 A;  1YQA A;  1XSX A;  4P9U A;  1HW2 A;  5FFX A;  3P7N A;  1R58 A;  2RC4 A;  1ON1 A;  1ZAR A;  5JI6 A;  2ETH A;  1T6S A;  2QVO A;  2R3S A;  4XSX F;  4G7Z F;  1IUY A;  2ISZ A;  1BJA A;  4HW0 A;  4KIC A;  4Q5S F;  3COA C;  3SXY A;  2K4J A;  3K1P A;  4RGS A;  1XD7 A;  3RYR A;  5FFZ A;  3TOA A;  5F64 A;  4Z2Y A;  4CHU A;  3FF5 A;  2RKH A;  3NEU A;  3CTA A;  5HDN A;  3AAF A;  1FWZ A;  4CIC A;  1OYY A;  3CUQ C;  4PGH A;  2RGV A;  4WX9 A;  2HYF A;  3EUH A;  1SD7 A;  1XGN A;  1USS A;  3QU6 A;  2GXB A;  2K27 A;  1OYW A;  4U0W A;  3RTR A;  3E6B A;  3VFZ A;  3RKW A;  1K7A A;  3L7W A;  1R5H A;  2KIF A;  1K6O A;  4HF1 A;  2WWY A;  1S7A A;  3CUQ A;  4BH9 A;  2ZCW A;  4IJA A;  4L9N A;  2FBH A;  1ZRE A;  2OA4 A;  1F9N A;  1FP1 D;  2XRN A;  3M1E A;  1LJ9 A;  4GCV A;  5FGM A;  2NNY A;  3SZP A;  3QP6 A;  1T0F A;  1YIO A;  4RGX A;  2A6H F;  2QQ9 A;  1I1G A;  4QWQ A;  4MQV A;  1SD5 A;  4GO1 A;  3T1B A;  3CDH A;  2O8X A;  1UHW A;  3M9A A;  5TRD A;  4BHB A;  4KMU X;  5LEJ A;  5ICF A;  3FMR A;  3GFM A;  4HZF A;  5JVT A;  3G3Z A;  2IA0 A;  4OIP F;  4I7H A;  1TNT A;  4RGR A;  1OR7 A;  4LMY A;  4RB3 C;  4LG0 B;  4LJZ F;  2HWV A;  5DYM A;  2CG4 A;  1I6X A;  2MH2 A;  1S29 A;  3B02 A;  2GQQ A;  2NYX A;  5LBQ A;  2OAZ A;  3FWE A;  1F5T A;  2C6Y A;  1Z1D A;  3JSP A;  1ZRF A;  2WC2 A;  5FD5 A;  2GWR A;  3TGN A;  1FNN A;  1P2F A;  3SZT A;  5ED4 A;  3MZH A;  1U78 A;  2GAU A;  3M7G A;  5K1Y A;  3BP8 A;  2D1H A;  2ACJ A;  1T2K A;  1T38 A;  4HDV A;  2CGP A;  3P9K A;  4UHT A;  1OYI A;  5CJ9 A;  1JHF A;  4I98 B;  4LLG F;  4XLP F;  3WOD F;  1UHM A;  5TJJ A;  4A0Y A;  2KKO A;  4P96 A;  1CF7 A;  2QLZ A;  4PCQ A;  4O6J A;  3WTS C;  1QZY A;  4WXH A;  3DQV C;  2PG4 A;  5L3C A;  1YS6 A;  1EH8 A;  2MH9 A;  4GGG A;  1E2X A;  1YW9 A;  4KN7 X;  4KIB A;  2ZME A;  3O6B B;  1Z9C A;  2O03 A;  3VOD A;  3ZP5 A;  1MKM A;  2KIU A;  2P5V A;  3HYI A;  4BQA A;  5CVV A;  4ZH4 F;  3I59 B;  1HW5 A;  4HV6 A;  3BY6 A;  3BJO A;  5ILV A;  4UV8 A;  3KEQ A;  4P5O A;  1I27 A;  4D0P A;  3WGG A;  5LGT A;  1FP2 A;  2NNN A;  3ECO A;  1CGP A;  2KJC A;  1OKR A;  1WSU A;  2PI0 A;  3JTH A;  2ZKZ A;  3MQ0 A;  1XGS A;  2IRF G;  4MGR A;  1GXP A;  3VOE A;  3DPL C;  5FLX K;  3FXR A;  2FBI A;  2EFO A;  1H0M A;  3LAJ A;  3EDP A;  4HYE A;  3CLO A;  4EMS A;  3KZY A;  2H94 A;  1ZRD A;  5ILU A;  1KU9 A;  4K2E A;  3QRF F;  1R1T A;  4HX4 A;  4JK1 X;  4ENM A;  2DI3 A;  3GO5 A;  3JSO A;  1QNT A;  5J8C A;  4LLL A;  2DO7 A;  1KA8 A;  4BAY A;  2A61 A;  1W5T A;  2QQB A;  4UVC A;  2V1X A;  4UXN A;  2GA2 A;  1R23 A;  2G7H A;  3BZ6 A;  1BI1 A;  3ECH A;  4KT5 C;  3F6O A;  3KP2 A;  3GWZ A;  1O3T A;  1SFX A;  3IHU A;  4MHG A;  3KZZ A;  2P6T A;  5E8I A;  3G73 A;  3HRM A;  4Y13 A;  2DPU A;  5HS9 A;  4MEY F;  1Z05 A;  2XAF A;  2UZK A;  3TKY A;  1BBY A;  2NAZ A;  4CDG A;  5F1R A;  3IWF A;  4LLN A;  2Z3Y A;  5D6F A;  4N0B A;  1B1B A;  1VTN C;  5HDG A;  4Q47 A;  3C7J A;  5LRR A;  3ZMD A;  5J6X A;  3I54 A;  1LDK B;  1FT9 A;  4EJT A;  4I2O A;  5BOX A;  2YSR A;  2HKO A;  2MA3 A;  1Z7U A;  3DP7 A;  1TQP A;  1S6L A;  2X4H A;  1OMI A;  2H6C A;  3GFJ A;  5D4R A;  1STZ A;  1U5T A;  4G7H F;  2FF4 A;  4S05 A;  1MDM A;  5L3F A;  3RDI A;  4I0A A;  4U0Y A;  4I0B A;  2DU9 A;  2ZNZ A;  2FOK A;  4YFN F;  4G6D A;  3HRT A;  2P5K A;  1Z6T A;  4OIN F;  4M9S A;  1Z6R A;  3ZPL A;  1U5T C;  5K5Q A;  1P4X A;  4LK1 F;  3HSE A;  1FYL A;  4OIR F;  3DV8 A;  1ZH5 A;  5DUK A;  1FLI A;  3KLO A;  2DAO A;  1MJA A;  1BI2 A;  3REO A;  3V8L A;  2EFQ A;  1WWX A;  3ZMU A;  1BC7 C;  2RVC A;  1EH6 A;  3HTU A;  4U0V A;  4ZYH A;  5HLG A;  2QEN A;  4RAZ A;  3CJN A;  3PQK A;  2LKP A;  1QZZ A;  5L3B A;  4JBA A;  1BM9 A;  5ICE A;  2XAS A;  5HOO A;  3GZ6 A;  2HKX A;  1QBJ A;  1ZAO A;  5LHG A;  1FPQ A;  5EEH A;  3F23 A;  1G4D A;  4MTE A;  4O3M A;  2PJP A;  3IKV A;  4PZJ A;  1S7O A;  2Y75 A;  1IXS B;  2E1C A;  1RIO H;  3I53 A;  1FY7 A;  2PMH A;  4HQE A;  3F8F A;  1REP C;  3ZN1 A;  1ZLK A;  2BV6 A;  3C3W A;  4CZZ A;  3VB2 A;  2WTE A;  1ON2 A;  2A5Y B;  1HKT A;  3T8R A;  4OOI A;  3CO6 C;  5E1W A;  2HQR A;  1YW7 A;  1K78 B;  2EWN A;  1TW3 A;  3LQQ A;  3E97 A;  5CVU A;  3F8M A;  2GXG A;  5KK1 A;  1ZGJ A;  3V7S A;  5D4S A;  2XAH A;  3IRQ A;  4Y15 A;  2XAJ A;  2O0Y A;  1QPM A;  2DBB A;  4AD9 A; 
#chains in the Genus database with same CATH topology
 3I0T A;  5AIQ A;  2L4A A;  4RB2 C;  5C4J J;  2L7M P;  3MWM A;  2XPW A;  2GBY A;  3ZQG A;  3U1K A;  2Y69 H;  1KZH A;  2Q0O A;  4CYC B;  3H9Q A;  4BE0 A;  2ZME B;  3FXK A;  2IW5 A;  2F5C A;  3CP2 A;  2H09 A;  3LSK A;  3S1R J;  2R7U A;  2BYV E;  1LFU P;  4OMZ A;  2XRO A;  3K4C A;  5HLI A;  4R79 A;  5EZH A;  5BS6 A;  1UJ8 A;  3CDL A;  1XGM A;  3S2H J;  1VFC A;  4I01 A;  5ERI A;  1W7P B;  3SFI A;  3BTC A;  3AG4 H;  2BBY A;  4BNC A;  1O7F A;  3PSF A;  3OY9 A;  3ONQ A;  2HQ5 A;  2BY3 A;  2VE9 A;  2HOS A;  2FUG 2;  1ODD A;  5CLS A;  3CJQ B;  2KIS A;  1G59 A;  4IXA A;  1WJ5 A;  1FZP B;  2P7C B;  4NC8 A;  2Y9Y A;  1X1C A;  2DMQ A;  5E17 F;  2XV4 S;  3QU3 A;  3U9G A;  1FOK A;  3R0A A;  3DXJ F;  5HNF A;  2ZFW A;  2EV6 A;  4QPQ A;  3OYN A;  4G6Q A;  3GEZ A;  2EZI A;  5FD6 A;  3HC7 A;  5H2F C;  1JTX A;  4G6T B;  5DD8 A;  2DA3 A;  3D1N I;  2FRH A;  3BPX A;  2F6C A;  1B8I B;  3SEZ A;  2HZT A;  2Y0M A;  1KU3 A;  4D9J A;  4E7H A;  2EZL A;  2B7E A;  2ZSI B;  3DKW A;  2EFN A;  1R5I D;  5EEG A;  5J1U A;  4KIT B;  1SD4 A;  2KMU A;  4FX0 A;  1QRY A;  4M6X A;  1Y1V J;  5E3N A;  2X51 A;  1BN5 A;  2JTV A;  3H5A A;  3LFK A;  3KX2 A;  3MZY A;  1J59 A;  1TWC J;  1TTY A;  3GZ5 A;  4ON0 A;  4LGW A;  2Z33 A;  2P4W A;  2FOW A;  3I5U A;  2V4J C;  4BHP A;  2R7V A;  3FXU A;  1UAA A;  4A3K J;  2NRA C;  2XAQ A;  5CVI A;  4NC6 A;  1VQ8 I;  1HSJ A;  4KT6 A;  4EQQ A;  3W2V A;  2ID6 A;  5HS8 A;  3OYH A;  5E3O A;  3TOB A;  1J7K A;  4HV5 A;  1ETK A;  3JAM Z;  2D5V A;  3KP7 A;  4KUM A;  4IF4 A;  1OPC A;  3DU6 A;  4J01 A;  2QKL B;  2VBW A;  4EGY A;  3OYM A;  2UWM A;  2P7V B;  1YHQ I;  3CCL I;  2A07 F;  3S1Q J;  3NRV A;  3OYC A;  1M1E B;  3CCS I;  3JRD A;  1MZB A;  4G9Y A;  1OCT C;  1R22 A;  4BQQ A;  1VQ9 I;  1YS7 A;  2XIG A;  2X1E A;  1N78 A;  3FM3 A;  4M9Z A;  4YII A;  3A01 B;  1G3S A;  2DJI A;  4A3M J;  3G6E I;  1EH7 A;  1SMY F;  1UG0 A;  1WRJ A;  2HOA A;  3F22 A;  2VXZ A;  1J75 A;  4ENJ A;  3H5R A;  1XSV A;  2JQ7 A;  1UFM A;  5DM7 F;  2FJ1 A;  1PDN C;  1NG7 A;  2RN7 A;  1EF4 A;  3HIF A;  3BG6 A;  1W4M A;  3KFW X;  4HLY A;  1BR2 A;  1BC8 C;  1YX5 A;  2B0L A;  1O3S A;  3DPT A;  4KN4 X;  1G3W A;  3L2C A;  2CJJ A;  5EDN A;  3RSN A;  2ZNY A;  2K9M A;  1ENH A;  3RJP A;  4KNY A;  4XLA A;  4F55 A;  4G94 A;  5C3E J;  1KQ0 A;  3HEF A;  4G12 A;  5D8K B;  2WAD A;  1GXQ A;  2X48 A;  2DTZ A;  2KRC A;  2DYR H;  3V8K A;  2KIM A;  1X3U A;  4XIC A;  3MKZ A;  5DS9 A;  1ETX A;  1OFC X;  1YLF A;  3ZMV A;  2KP6 A;  1TNS A;  2GZW A;  3H36 A;  5H20 A;  2KFD A;  1LKX A;  4A3D J;  2UUZ A;  2R5Z A;  3FHN A;  5FKL A;  2XHK A;  2HOE A;  2K02 A;  5BPI A;  2Y2Z A;  2NVX J;  1IXC A;  2ELJ A;  5F08 A;  1HST A;  3SJM A;  4UUV A;  2QGU A;  4FE7 A;  2O61 A;  2L0K A;  3NAR A;  1Z91 A;  2OF7 A;  3GYH X;  2E19 A;  4M6Y A;  2IS4 A;  1U5T B;  3PFI A;  3GTL J;  3HPH A;  4HRI A;  2LC2 A;  4I99 C;  2DPD A;  4BE1 A;  4L0Y B;  3DTI A;  1UEL B;  1G6N A;  2TCT A;  3OYB A;  1IN5 A;  2L7Z A;  1MDM B;  1G2H A;  3HL2 A;  2LFB A;  3M8E A;  2JRT A;  4ASN A;  2K9Q A;  2L02 A;  4KFC A;  2XVC A;  2NOJ B;  3DTE A;  4DYC A;  4C30 A;  4FQG A;  2F5F A;  1R49 A;  2I8D A;  5JFR A;  1JKR C;  2L7K A;  2ECC A;  1TW2 A;  2PN6 A;  4PJJ A;  2YU3 A;  3LL7 A;  1IRG A;  3OIQ A;  3BPV A;  2CU7 A;  2W84 A;  5K7H A;  4P9F A;  1F43 A;  2M2E A;  4YIF A;  1X2M A;  1WPK A;  1RUN A;  2PJR B;  1TLH B;  3F3X A;  4QLC U;  2CH0 A;  2HTJ A;  1R5G A;  3DLA A;  4AVP A;  2GIZ A;  3VEP A;  2HU9 A;  2H1K A;  1BR1 A;  2JZY A;  2CWE A;  3ABU A;  2ZJR F;  1SFO J;  1MMA A;  2L54 A;  5FRN A;  2X1C A;  1SEU A;  5D6E A;  1MJB A;  2FBK A;  2A05 A;  4D5F A;  5ICC A;  1TZL A;  3E5X A;  3K69 A;  2HNH A;  3PIP F;  1RPW A;  1P92 A;  1WJE A;  2IGK A;  4BYY A;  1ZQ3 P;  3MCZ A;  2F5D A;  5D5X B;  1XMA A;  4GXO A;  5DCF A;  3DWL E;  4PJ0 C;  2NS0 A;  2F4M B;  3CCU I;  2VKD A;  5EG0 B;  1IN8 A;  3LSG A;  3CP8 A;  1QA6 A;  1X1B A;  1WKM A;  3MVP A;  2E34 A;  3FZV A;  4ZC3 A;  4OIQ F;  2CUZ A;  1B9N A;  2IVM A;  1J9I A;  1YOV B;  2CQX A;  2CW0 F;  1HXD A;  4DBR A;  1ZR2 A;  3SDG A;  3R4K A;  5ICG A;  1LPQ A;  3BG3 A;  3G4S I;  4IPA A;  1AKH A;  2WAF A;  5GAD J;  5J3L A;  1D1A A;  3ZQC A;  3BG9 A;  4ZYG A;  4M74 A;  5A2Q K;  1V4R A;  2XB5 A;  1PUE E;  1B9M A;  1YYV A;  3BC8 A;  3S14 J;  4IL6 C;  5AIP A;  1V3F A;  2MBF A;  1LQ1 A;  2WAQ A;  4N4N B;  2DN0 A;  5M5W J;  5F27 A;  2DQR A;  3W6J B;  2V26 A;  3FMQ A;  1P7J A;  4ESB A;  2A6E F;  2ISY A;  4H0E A;  5IT3 A;  5EJC A;  4MQ9 F;  3RPQ A;  4WWC A;  4L18 B;  2J5P A;  2ZXW H;  2LG4 A;  4MO7 A;  2X1D A;  4NBQ A;  3JRE A;  1MNM C;  1PUF A;  4ANJ A;  2BHY A;  4CCL A;  3Q9V A;  2CQ7 A;  1C0W A;  1XN7 A;  2DTR A;  3R61 A;  1ZG1 A;  1FC3 A;  2FSW A;  1R71 A;  2HI3 A;  1KQ9 A;  1WJC A;  5FLM J;  2M0M A;  4HLX A;  4M73 A;  3GW2 A;  3CC2 I;  4JOM A;  3QPT A;  2L4M A;  3M8F A;  5F6F A;  2VC0 A;  1YRN A;  2Q2E B;  3GLL A;  2VT3 A;  4OIO F;  3WTX C;  3H3Z A;  1DPR A;  2CQQ A;  2E2H J;  3AKZ A;  3RKY A;  2IA1 A;  4A12 A;  2DT5 A;  1JJ8 C;  2O7O A;  3GVA A;  3P9C A;  1TWF J;  2CSO A;  2VOO A;  2FNP A;  1OCP A;  1X1P A;  3HOX J;  2I5U A;  1RR8 C;  3ZN0 A;  4IRG A;  1A35 A;  5D5W B;  4DQ2 A;  2IP2 A;  3LA3 A;  1Y0N A;  3BR2 A;  3JRI A;  2ESN A;  4XOR A;  3C18 A;  2COM A;  1K78 A;  2HVQ A;  3HRU A;  5GP9 A;  4V2G A;  2GA1 A;  2DLL A;  2M5W A;  1XCB A;  5K7Z A;  4A0Z A;  2BVL A;  2JA2 A;  4A3E J;  1W7P D;  1ZYR F;  2F48 A;  2FE3 A;  3O8H A;  2R7S A;  3WG9 A;  2XF6 A;  2LYC A;  1Y1W J;  1GVD A;  1GUU A;  1WJF A;  2EV5 A;  3G2B A;  2VBZ A;  1PJR A;  4BXX J;  3E5U A;  2R7Z J;  1L0O C;  3ML6 A;  3ISP A;  4DBQ A;  3RZD J;  2DK8 A;  2STT A;  1WJA A;  3VSK A;  2HGC A;  2WB1 A;  2XB0 X;  4KIF A;  5KVR A;  5IT9 K;  4QTR A;  1BIB A;  3OL3 A;  2P6S A;  1PVE A;  2VKE A;  4O5V A;  5F0F A;  4B48 A;  4CYC A;  3ZQL A;  2E7W A;  2A68 F;  3QPS A;  3S3O A;  5E1X A;  1Q1H A;  1XDS A;  1H8A C;  2DFH A;  2STW A;  3CES A;  2M3A A;  3E5Q A;  4BAC A;  2E1M B;  1KON A;  3CLQ A;  5JR3 A;  5HLT A;  1FJL A;  3IV5 A;  2EIK H;  1IJW C;  4P55 A;  5BQT A;  5H6R A;  2A3S A;  3FK7 A;  2VOP A;  1S7E A;  2VBY A;  3BZC A;  1A6I A;  1IV6 A;  4KIG A;  3HOY J;  1W7P A;  2IA2 A;  1TQI A;  3H3V K;  1WQ2 A;  2K7L A;  4B3A A;  1MBH A;  2DA4 A;  1P9Q C;  2CW7 A;  5LHI A;  3MFK A;  4A3F J;  2HYG D;  3J7A Y;  4UY8 I;  1BL0 A;  3S8P A;  2Y0S A;  2M0C A;  4JX5 A;  4ZYE A;  1UB9 A;  1U9O A;  5B1A H;  1XGO A;  1MGT A;  4L9V A;  3O3K A;  1SD6 A;  3RCO A;  2QKM B;  3SFZ A;  3OYA A;  2WY8 Q;  2AO9 A;  3GLX A;  3ABM H;  3K4L A;  5IYC J;  1D5Y A;  3ZQI A;  2NVU B;  1HW1 A;  1K6Y A;  1JT0 A;  3Q0U A;  3DTK A;  1U3E M;  2IGM A;  4KMF A;  1PP7 U;  3TO9 A;  1B8I A;  2E36 A;  2AS5 F;  2WB1 N;  3OYJ A;  4N9I A;  4I6Z A;  2PEX A;  4AUX A;  4HF2 A;  2OJE D;  3ABT A;  4CYD A;  1Z3Y A;  2IPQ X;  5DEQ A;  1ZHF A;  4E70 A;  4BGD A;  1S9H A;  1S8N A;  2X6X A;  4X6A J;  4IEJ A;  2OD5 A;  5M3F J;  2WV0 A;  4PUS A;  4CA0 A;  4ETS A;  1XC5 A;  2O5R A;  3DBR B;  2DOF A;  3J80 Z;  3HG9 A;  3S15 J;  2V1D A;  3ZGK A;  3DBH B;  2CV2 A;  1SMT A;  1TBX A;  2PMZ A;  4A5N A;  1WI9 A;  2K5C A;  4PGG A;  5JLX A;  3HKZ A;  1HQC A;  3VDX A;  1BW5 A;  2HDW A;  4LIV A;  3EET A;  3GTG J;  3V7C A;  2OCC H;  1VQ4 I;  2CFX A;  3Q5F A;  2TRT A;  5LEK A;  2G9W A;  3TDU C;  3HOZ J;  3F8C A;  3IKT A;  4V19 K;  5J4V A;  2V9K A;  3CC7 I;  1ZK8 A;  1IN6 A;  4EJW A;  3DKY A;  4W1U A;  4Y52 J;  2LR8 A;  6PAX A;  4CSW A;  3CCJ I;  1IDZ A;  1NHA A;  2ZFU A;  4HSR A;  4A3C J;  1D8K A;  3LMM A;  1ETY A;  5HDK A;  3A01 A;  1XMK A;  4BQN A;  1HKQ A;  2JJ7 A;  2YR2 A;  4HDU A;  4WCG A;  1T39 A;  3ERM A;  1MBE A;  2KIQ A;  1P4W A;  2L9R A;  1MW7 A;  4A69 C;  2PQ8 A;  2FXA A;  3DCF A;  1MMG A;  2ADU A;  4I09 A;  5E8G A;  1YG2 A;  2QQ8 A;  4G7O F;  4D7N A;  2W85 A;  3A4C A;  3QPL A;  3TO6 A;  4CXF A;  2ZB9 A;  1ZGA A;  2CUE A;  4L0Z B;  3QP5 A;  2W00 A;  4BS9 A;  2R7F A;  3SZG A;  3I4M J;  1U9N A;  1JKQ C;  1TWG J;  3QQA A;  3X2Q H;  1JE8 A;  3U2R A;  3SHF A;  2AXT C;  2NVT J;  3F9K A;  3IL2 A;  2EFW A;  2COB A;  2V6E A;  1KQ8 A;  2D1V A;  3OS0 A;  3H92 A;  3TW6 A;  2PMZ N;  5CKT A;  5L3G A;  2R93 J;  3T0Y A;  4HQM A;  3W2W A;  2FMY A;  3RIR A;  4KA4 A;  4EAT A;  3IH3 A;  3JRG A;  2D45 A;  1W1W E;  4HF0 A;  2EK5 A;  2DFE A;  2R5Z B;  4R8H A;  3TQN A;  2XSJ C;  1FBS A;  1TT5 B;  4FIS A;  3OIP A;  3CDI A;  1A5J A;  2X0L A;  3MMY B;  2Y9Z A;  1IO2 A;  1H9T A;  3FXO A;  3K1N A;  1A31 A;  4GDF A;  1ZRC A;  2VC1 A;  2LSO A;  2L7F P;  2XGD A;  5HVQ C;  1B4A A;  1ZTR A;  1O7L A;  1BOA A;  1QVT A;  2R5Y B;  5FRO A;  2VOD A;  3S2D J;  1H88 C;  3HSR A;  3IH2 A;  2K3F A;  3MKL A;  1GDT A;  2F4O B;  3WGH A;  3FMS A;  5FLX Z;  3VWB A;  2R7O A;  2ZSH B;  3CMY A;  1PP8 F;  1NH3 A;  3F8B A;  3GZN B;  1EA3 A;  2V7F A;  3GF2 A;  5IOY A;  3T5X A;  4HOB A;  3WE2 A;  4LB5 A;  3PQJ A;  5FKN A;  2M8G X;  3KP4 A;  1YJ9 I;  1AWC A;  4JP0 A;  1DU6 A;  3L2Q A;  3LST A;  5K7F A;  5AON A;  2PLY A;  2H1L A;  4BBS J;  4BDY A;  2BHZ A;  3P9I A;  3QOP A;  4XSZ F;  1IDY A;  2JN6 A;  2W82 A;  5E1Z B;  1MBG A;  1R7J A;  3IC7 A;  1LVK A;  4A3I J;  1I3A A;  1R1U A;  3F72 A;  1FX7 A;  2VL8 A;  4GYI A;  5IYB J;  3HUG A;  1S3J A;  4MLO A;  4BUP A;  4ZDO A;  2HPM A;  4FX4 A;  3S3M A;  3B6A A;  2LY2 A;  1XTA A;  2M45 A;  1IN4 A;  2E7X A;  3GBG A;  4B43 A;  2ZBK A;  1ZG5 A;  2Q8K A;  2Y31 A;  4ZTF A;  3A1Y A;  3PO2 J;  3SQN A;  5K5O A;  2Y48 A;  1ZKG A;  1J0R A;  4NC7 A;  5DTD A;  1V55 H;  2RNG A;  3WG7 H;  3OYL A;  2ELH A;  3K70 C;  1QHG A;  4UVA A;  4MFD A;  1W36 D;  2VQC A;  4RA2 A;  2MC3 A;  1CQT A;  1YE9 A;  4CCK A;  2B63 J;  4L5I A;  3WE3 A;  1RKT A;  1S5L C;  4RMN A;  4N4O B;  3VYT B;  1U0J A;  2VPL A;  1POG A;  1MH4 A;  2MLG A;  3GFL A;  3KP6 A;  4LK0 F;  3DEU A;  1AKH B;  2O3F A;  3RKX A;  4AIJ A;  2VE8 A;  3OR2 C;  3K4N A;  4E7Z A;  1Z67 A;  4XON A;  4ZDP A;  3CMM A;  4NQW A;  4IHS A;  2NS8 A;  1V5E A;  3WTV C;  2M4G A;  5IT9 Z;  2LH9 A;  1OCZ H;  3HSF A;  4C2U A;  4I02 A;  4YEL A;  3S3N A;  1DP7 P;  4X1E A;  4S04 A;  1H9G A;  5GAG J;  3CCQ I;  3N4M A;  3F0C A;  3JRC A;  3HB9 A;  1Z0X A;  5EYR A;  3BR6 A;  3WHB A;  3H9G A;  4DZP A;  2IGO A;  4NB5 A;  3DLL F;  3ZQF A;  4M72 A;  2VLA A;  2CFO A;  2EZH A;  3P5J A;  5LRS A;  5JVG F;  4IHT A;  4OMY A;  1PUF B;  3LQR A;  1P4A A;  2KRF A;  3LSJ A;  4UUS B;  1XG1 A;  2H6B A;  3VSL A;  2P5L C;  1DDN A;  1ETO A;  2AXL A;  1W5C C;  5M5Y J;  5BMZ A;  1TC3 C;  3ERE D;  5FRM A;  4LIT A;  4EVI A;  1DP3 A;  4KYW A;  1Y6I A;  4PSX A;  2P8T A;  5EZG A;  1SFK A;  1YRN B;  2Q2E A;  4RGU A;  5CYV A;  3HTS B;  3R60 A;  3CC4 I;  2R7D A;  1I5Z A;  3Q3S A;  5E20 A;  3CZ6 A;  5D5U B;  2KHM A;  3JRF A;  3I58 A;  3PNY A;  5D8L B;  3KE2 A;  4P1W A;  2JA8 J;  4HA8 A;  4XN0 A;  5LGN A;  2QUF A;  2WAQ N;  3KLN A;  3CCM I;  4Q4Z F;  2HXO A;  4YFX F;  3KCC A;  4CCM A;  3LAP A;  2DOD A;  2X9D A;  3BDD A;  1UG2 A;  4EM0 B;  5IP9 J;  2VON A;  1N75 A;  4C3I J;  1MMS A;  2H27 A;  3IH4 A;  2Z9O A;  2HTS A;  2JA6 J;  1LEB A;  3CO7 C;  3UNG C;  4M3G A;  3H3U A;  2HPI A;  3CD6 I;  1YTY A;  1KYW A;  1X19 A;  1RI7 A;  3OYF A;  5H6Q A;  5GAH J;  2R7Q A;  3QWL A;  4A3B J;  1KU2 A;  4LFU A;  2QQA A;  1HDP A;  5FKK A;  5E18 F;  4BKX A;  2W1O A;  2CV1 A;  4HX7 A;  4RAY A;  3LSR A;  5TGT A;  1WH5 A;  3BZK A;  3ZMS A;  2Z1D A;  3GFI A;  2E60 A;  4BXU A;  2JPC A;  4XKW A;  2WBM A;  3FKJ A;  4MNU A;  2LD5 A;  5EGO A;  4M3E A;  2R92 J;  3FM5 A;  1EJ9 A;  2DA7 A;  4NDL A;  4A2U A;  2XAU A;  3J80 K;  1KU7 A;  1B59 A;  1X3Z B;  2XRL A;  4A3J J;  3FBN B;  2R7X A;  3QYE A;  5JHU A;  1OIS A;  4XKB A;  4X0G A;  4HNT A;  1TWH J;  3V4G A;  2RV8 A;  2PBI A;  4B1R A;  2F5E A;  1QQI A;  2LF7 A;  1NK2 P;  2ELK A;  4PDK A;  2XGX A;  1O3R A;  4U7B A;  2W7N A;  2OBP A;  2Z2S B;  5DUI A;  3PJR A;  1G3Y A;  2LNB A;  4OU0 A;  4FE4 A;  1LDD A;  2K86 A;  1SFU A;  2XKO A;  1Y8Q B;  4M9X A;  3KYD B;  4F93 B;  4TV7 A;  2Z5U A;  1AU7 A;  3MEX A;  2JWT A;  2FEZ A;  3LWF A;  1LDJ A;  3G1M A;  2EJR A;  1E3H A;  2P81 A;  3DEW A;  1ULY A;  4BEH A;  3HHH A;  2FX0 A;  3C1D A;  1ETW A;  4XOT A;  2UXN A;  2WAE A;  4XRF A;  5J4Y A;  3GTK J;  1U8B A;  1YJW I;  3LA2 A;  1X2N A;  3U1D A;  2JT1 A;  3L2U A;  1YO5 C;  3VYS B;  4ZZL A;  1TP4 A;  2DDA A;  1XSD A;  3TO7 A;  3WGI A;  1QO0 D;  4A5M A;  1VF9 A;  1RNL A;  1TL8 A;  2YX4 A;  2QM3 A;  4ZJZ A;  2I10 A;  2DW4 A;  1YIT I;  3L09 A;  4KDP A;  4MIM A;  3K0L A;  3WU2 C;  2IJL A;  2W25 A;  3AL0 C;  3QAH A;  4ENN A;  4A6D A;  2XAG A;  1YX3 A;  3ZCO A;  2A6T A;  2QBY B;  2VAS A;  1GVJ A;  2W24 A;  2HDC A;  2HVR A;  4UNO A;  4IX7 A;  2EA4 A;  3K2Z A;  1Q1V A;  3BTI A;  3I71 A;  3K4J A;  2VJI A;  1EKE A;  2M87 A;  3EYY A;  4HAM A;  1P6R A;  2IGN A;  3GXO A;  2XKP A;  1XDU A;  3R6S A;  3TMO A;  1BIA A;  1MBK A;  4ZYA A;  2VT2 A;  1AOY A;  1IRF A;  2QZ8 A;  4AIH A;  1MNE A;  1LFB A;  1D8J A;  3WTU C;  1D0Y A;  1D1C A;  5DCM B;  3ZQ7 A;  3H0G J;  4RB1 A;  2HQN A;  3GME A;  4EJO A;  4F3Q A;  4DJA A;  1V54 H;  2MYS A;  3CCR I;  3JRB A;  3DF8 A;  1IF1 A;  4Q48 A;  3IRR A;  5KAI C;  2OZ6 A;  4PJN A;  2V9V A;  4Y4R A;  2DMP A;  4ENK A;  2QYO A;  2ESH A;  3OV8 A;  1YFH A;  4A3L J;  1A04 A;  5GTH C;  1E3O C;  3RI4 A;  5M5X J;  1VQ6 I;  2VN2 A;  4EM1 A;  3GTJ J;  3E6C C;  5HS7 A;  3CUO A;  3DFG A;  3L9F A;  3OOU A;  4DGW B;  4XNF A;  3L2V A;  1SAX A;  2QWW A;  1D5V A;  2CYY A;  2HOT A;  1BR4 A;  2CQN A;  3F21 A;  3J7A O;  2HZD A;  2EFP A;  3BJ6 A;  3TP3 A;  5FO5 A;  5E3L A;  2JPB A;  1R6R A;  2LY9 A;  1FSH A;  5J47 A;  3OIO A;  2DK5 A;  2KL4 A;  1I1S A;  2RDP A;  2ZXJ A;  2ZXI A;  2HS5 A;  4ZTJ A;  1D0X A;  4XR6 A;  1V5F A;  1RRJ A;  2MC4 A;  3E0J B;  3V7R A;  1BI0 A;  1FBQ A;  1UCR A;  1T98 A;  2EB7 A;  2ZO4 A;  4XLH A;  4C3H J;  5BNG A;  3JAM K;  1SVM A;  3WTZ A;  2M9H A;  2MGQ A;  5FKO A;  1O57 A;  2IEK A;  3TDZ C;  5EF6 A;  3K1M A;  2R5Y A;  1O3Q A;  2F2E A;  3WTY C;  4BL0 B;  3OR1 C;  3OWT A;  2M8E A;  2K3P A;  3EYI A;  2HR3 A;  3KPH A;  2JUG A;  3QOE A;  3L1P A;  3N97 A;  3ULQ B;  1VI0 A;  4B3X A;  2OC6 A;  3I64 A;  2JA5 J;  2BZT A;  3F6V A;  4B09 A;  1GHC A;  4CUG A;  1HKS A;  5ILS A;  3ZQH A;  1TQM A;  3S2W A;  4XBF A;  3LSM A;  4XLE A;  3FX3 A;  1LNW A;  2V1U A;  4HPQ A;  3LSI A;  1FSE A;  3W2A A;  3BOQ A;  2NVQ J;  3H35 A;  1U6G A;  2GM4 A;  3TP0 A;  4D1Q A;  4WXC A;  3HUG B;  4IVN A;  2ZXH A;  4JYK A;  1A6Q A;  2K4B A;  2J5O A;  2OQG A;  3J81 K;  4E7S A;  2JSP A;  2CUF A;  2E1O A;  1W5S A;  1ZLJ A;  3TL4 X;  4PK4 A;  5LGU A;  4FT8 A;  1IC8 A;  4AVZ A;  1W36 C;  2DMU A;  2O6G E;  4A0X A;  2GOX B;  1NG6 A;  4PFO A;  3AG1 H;  2BGC A;  2MG4 A;  3HOV J;  3BT9 A;  4UB6 C;  4A6E A;  4FHT A;  4G8X A;  1BI3 A;  2L01 A;  3LOC A;  2Z99 A;  1U2W A;  3S32 A;  2KJB A;  1SVL A;  1JGG A;  2PMU A;  1EV7 A;  2IT0 A;  2K85 A;  2NS7 A;  3E1S A;  3RQI A;  1AHD P;  5F1J A;  5DDG A;  4IHW A;  1QGP A;  4GYG A;  4AIK A;  1A36 A;  4YG2 F;  5B5E C;  3Q0V A;  3HOS A;  4IQ4 A;  5B3S H;  2E5N A;  5FB2 A;  3CUQ B;  2OU2 A;  5LFA A;  1FYK A;  2XSD C;  3WTT C;  5DV5 A;  3FXQ A;  4NQW B;  5D5V B;  3O2P E;  3L00 A;  3HZJ A;  1ETV A;  2Q1Z B;  2LF8 A;  5CVR A;  2OZU A;  4AYB A;  3TED A;  3PO3 J;  5J8F A;  4OWR B;  1JTY A;  2V79 A;  1JXS A;  4U88 A;  4F7Z A;  4RM2 A;  5IOZ A;  3EUK L;  2VB6 A;  2YPR A;  4B8X A;  5J1Y A;  2MLK A;  3AG2 H;  3HOT A;  3FDY A;  2N8G A;  4WF2 A;  4HBL A;  4HNV A;  4GRI A;  2PFB A;  3GTQ J;  4BDZ A;  5J40 A;  4UUS A;  1D3Y A;  4HG2 A;  3OOP A;  1L3L A;  3LA7 A;  1ERD A;  3HXL A;  4II2 A;  4LD5 A;  1E3P A;  3SDB A;  4AWX B;  3LSH A;  3IAS 2;  2FNA A;  2VJ5 A;  3QOD A;  2BW3 B;  2HFH A;  3OS2 A;  1JJ6 C;  2FU4 A;  2M30 A;  2TDX A;  2K9L A;  1BW6 A;  1LFP A;  3I4P A;  2EV0 A;  4RLQ A;  2EBI A;  3KYC B;  4L9J A;  2MD5 A;  2DT7 B;  4YFK F;  1DUX C;  2FQ3 A;  3D5L A;  5CPR B;  3DKX A;  4R1H A;  3L2R A;  4EJU A;  2H8R A;  1P7I A;  1FEX A;  3HPG A;  3CMA I;  4JQF A;  1IW7 F;  3B73 A;  3NQO A;  3OSG A;  2UXX A;  4N9H A;  1N77 A;  3I9V 2;  1HF0 A;  3KEO A;  3M8J A;  2B9S A;  3WU0 A;  1X4O A;  5HNH A;  1X1A A;  2E2I J;  1JUP A;  1RUO A;  1XCV A;  1E17 A;  4ESF A;  2DA6 A;  3FHZ A;  1F4K A;  2W57 A;  3E6M A;  3KEY A;  4LG0 A;  4MTD A;  5M3M J;  2QA4 I;  2NXN B;  1IN7 A;  4ZZD A;  3FK6 A;  4RS8 A;  3RPU A;  4M71 A;  3T8T A;  2JK3 A;  2HYJ A;  3MZ8 A;  3E6D A;  1X1D A;  2BXZ A;  5HLH A;  5IPA A;  3W6V A;  3K2A A;  1LB2 A;  4DNC A;  1WI3 A;  4M3F A;  4E4H A;  4CGZ A;  3KP3 A;  2QSH X;  1K83 J;  3QPH A;  4EJV A;  2OTJ I;  5GAE J;  2V6C A;  3GX4 X;  2L9V A;  1QPI A;  2LY1 A;  1Y39 A;  1DPU A;  2RRE A;  2O9L A;  3K4K A;  4BXF A;  3ZMZ A;  3S1M J;  5EGO B;  4EGZ A;  3HBL A;  3V8J A;  4ZYD A;  2BE5 F;  3KIO A;  3MKY B;  3WTW C;  3KET A;  4UV9 A;  5BPD A;  4LB6 B;  4Y17 A;  1JHH A;  3BR0 A;  2Y0S N;  3PFY A;  2OQR A;  1WZ2 A;  2G7U A;  1Z77 A;  1VZ0 A;  1R36 A;  1IAW A;  1IG7 A;  1HOM A;  2XC7 A;  5LHH A;  3W3C A;  3BRO A;  2L5Q A;  2BVM A;  2DQL A;  2YX7 A;  4L9T A;  4WXD A;  5IP7 J;  2RQQ A;  5LLQ A;  4EV0 A;  2JMW A;  4NHJ A;  5CVJ A;  2X6O A;  5A2Q Z;  1CF7 B;  1SFE A;  2CQK A;  3CJR B;  3D0S A;  2ZME C;  4BE2 A;  3BJA A;  3E3V A;  2JVG A;  1UST A;  2EA2 A;  1WJD A;  4RB0 A;  3H0D A;  3J7Y J;  2L3D A;  3AL0 B;  1Y0U A;  2NOG A;  3K6G A;  4M3D A;  3M3Y J;  1Z21 A;  3S93 A;  3BR5 A;  3DU5 A;  3MAJ A;  1JUS A;  4BEH B;  4ESJ A;  5B1B H;  4DYQ A;  3BWG A;  3Q9S A;  4HX8 A;  1F36 A;  5DD4 A;  4EM2 A;  4E7J A;  1YW8 A;  5F0C A;  4FET A;  3A2K A;  2M1B A;  1DU0 A;  1IXR C;  2VBX A;  2KT0 A;  4FCY A;  3ZMT A;  1XB4 A;  3KP5 A;  2VQG A;  3HHG A;  3RYP A;  3HOW J;  3AFH A;  1G3T A;  4E7L A;  1LEA A;  1RC9 A;  2EIL H;  3PSI A;  3W6K B;  3R0J A;  1FIA A;  3HM5 A;  2RQP A;  3F8N A;  3I3L A;  1NTC A;  2VI6 A;  1K79 A;  4XID A;  3ROU A;  4XK4 A;  2XGE A;  1KYZ A;  3I59 A;  4JX6 A;  4BHC A;  2OCE A;  1ZG3 A;  4B47 A;  1Z7L A;  2QBY A;  3J81 Z;  1MBF A;  3JCU C;  2QSG X;  2HEO A;  5K5R A;  1B72 A;  4RLF A;  2CS3 A;  1HBX G;  4S0H B;  1F1Z A;  2MSY A;  2X6W A;  1RR7 A;  1E0E A;  2E1N A;  1FBU A;  5IP6 A;  2WA0 A;  3HGG A;  4L5J A;  5L3D A;  3SYT A;  1MJ9 A;  4ZDL A;  2BEO A;  2G0E A;  3JTG A;  1I50 J;  3ABK H;  4B44 A;  2A69 F;  1ZN2 A;  2CO5 A;  1J2X A;  1LVA A;  1J5Y A;  3A0B C;  4LIU A;  2QSF X;  5DCM A;  4FTH A;  2LKX A;  4PJL A;  1FYM A;  4AM3 A;  4U7D A;  2H8W A;  3GUD A;  4UVB A;  3CF2 A;  1RZ4 A;  3IWZ A;  4WK8 F;  4MFE A;  3EUA A;  3EQL F;  2RNJ A;  2L2O A;  1MMD A;  1OQY A;  4CO8 A;  2D2W A;  2MFZ A;  2CW8 A;  4XLN F;  5EEA A;  3ELK A;  4XLF A;  1I3Q J;  4CZC A;  4UUT A;  4IRI A;  2BY2 A;  3K10 A;  3EPZ A;  2LDU A;  1ZEL A;  1VQN I;  2DFI A;  1R1V A;  1JGS A;  1HCR A;  1WCM J;  2XUB A;  3HRS A;  3HKZ N;  1U8R A;  1KGS A;  5L3E A;  1HC8 A;  4IRH A;  2FA5 A;  3RQ4 A;  2FML A;  2OUM A;  2GIV A;  3FKI J;  2JSC A;  2LVS A;  5TIS C;  2L9N A;  1MD0 A;  5E79 C;  1I6H J;  2M4K A;  1QVU A;  1ONV A;  2EIN H;  1IZ1 A;  2ZJP F;  3K9T A;  3WU1 B;  3JW4 A;  4J00 A;  3PUB A;  1PYV A;  4MEX F;  4IHY A;  1XPX A;  2RAE A;  2ZJ2 A;  1B6A A;  5KCM A;  1R00 A;  1YQA A;  1XSX A;  2K9N A;  4P9U A;  1T33 A;  1HW2 A;  4NNJ A;  5FFX A;  3P7N A;  4DOZ A;  1R58 A;  1RKW A;  2KPM A;  3QYB A;  1BJZ A;  3BR1 A;  2FD5 A;  3ASO H;  2RC4 A;  1ON1 A;  2EPF A;  1ZAR A;  4L5E A;  3MD2 A;  5JLW A;  4XLC A;  1IRZ A;  4DZJ A;  5JI6 A;  3L2W A;  2ETH A;  2DJN A;  1T6S A;  2QVO A;  2R3S A;  4XSX F;  1JKP C;  1VQP I;  4G7Z F;  5IY5 H;  1TWA J;  2W48 A;  3G1O A;  2ISZ A;  1IUY A;  1BJA A;  4HW0 A;  2V1N A;  4KIC A;  4Q5S F;  3COA C;  3SXY A;  2K4J A;  3K1P A;  3M4O J;  4RGS A;  1LUJ B;  1XD7 A;  3SEQ A;  3ZR8 X;  3RYR A;  5GTI C;  2DA5 A;  3HOU J;  5FFZ A;  3IAM 2;  5F64 A;  3TOA A;  4HEA 2;  4XRS G;  2HQA A;  4QSH A;  1IGN A;  4Z2Y A;  4XM3 A;  4CHU A;  3FF5 A;  2RKH A;  3NEU A;  1VQ5 I;  2XF5 A;  3CTA A;  5HDN A;  3AAF A;  1FWZ A;  3ABL H;  3WHC A;  1OYY A;  3M07 A;  3CUQ C;  4CIC A;  5KNL A;  4PGH A;  2RGV A;  4I76 A;  5CQG A;  1WGX A;  1Y8R B;  4WX9 A;  2Z16 A;  1MMN A;  1VQ7 I;  2LRD A;  4E7K A;  1NK3 P;  2HYF A;  3EUH A;  1SAN A;  1SD7 A;  3ZQQ A;  1XGN A;  4OAZ A;  1MBJ A;  1USS A;  3QU6 A;  2GXB A;  2AQF A;  3CCE I;  2K27 A;  1R9T J;  2M7B A;  2KDZ A;  1OYW A;  2E2J J;  4U0W A;  3RTR A;  3E6B A;  3VFZ A;  2DA1 A;  5KHD A;  3RKW A;  3I56 I;  1MIJ A;  1K7A A;  2CMP A;  1ITY A;  3L7W A;  2XPU A;  1R5H A;  3VYR B;  4BY7 J;  2KIF A;  1K6O A;  2WWY A;  4HF1 A;  5FKM A;  1S7A A;  4XRM A;  1T95 A;  2DDB A;  3HJE A;  3CUQ A;  4BH9 A;  5B66 C;  2EH3 A;  2ZCW A;  3MKW B;  4IJA A;  4L9N A;  2FBH A;  1ZRE A;  2OA4 A;  2K9S A;  2Y30 A;  1F9N A;  2YUS A;  1FP1 D;  2GLO A;  5IYD J;  2DYS H;  4A93 J;  4IQJ A;  2XRN A;  3OSF A;  3M1E A;  3TW7 A;  1LJ9 A;  4A3G J;  4GCV A;  5FGM A;  2NNY A;  3SZP A;  3QP6 A;  3B6C A;  3S1N J;  1T0F A;  1YIO A;  2MAB A;  4RGX A;  4XOP A;  3H1C A;  2LBF A;  1N25 A;  3BQZ A;  2A6H F;  3A0H C;  2NVY J;  2QQ9 A;  3H9J A;  2BW3 A;  4BJ6 C;  1VQO I;  1I1G A;  3LNQ A;  1ZGW A;  4QWQ A;  1DGR M;  4MQV A;  1SD5 A;  3OYI A;  4GO1 A;  3J7Z I;  3T1B A;  2ICW G;  1HDD C;  3CDH A;  2O8X A;  1UHW A;  3M9A A;  5TRD A;  4BHB A;  4KMU X;  5LEJ A;  4C2M J;  3GTP J;  5ICF A;  3FMR A;  2W4S A;  3S17 J;  3GFM A;  1GV2 A;  3DEE A;  3QYF A;  4HZF A;  5JVT A;  3CCY A;  4RAF A;  3G3Z A;  2IA0 A;  4OIP F;  2BXY A;  3BCA A;  2XPV A;  4I7H A;  1TNT A;  1D1B A;  4RGR A;  4J19 A;  9ANT A;  3PNT A;  4LOC A;  1OR7 A;  2DFF A;  4LMY A;  4RB3 C;  4LG0 B;  1IUF A;  4RAG A;  2EIJ H;  3DPU A;  3KYL A;  4LJZ F;  2CRG A;  1G8X A;  2HWV A;  1LE8 A;  1X58 A;  5DYM A;  1SVO A;  2DMN A;  2CG4 A;  1I6X A;  3LSP A;  2MH2 A;  3OYE A;  1S29 A;  3B02 A;  1OCR H;  2GQQ A;  3G1L A;  4M6V A;  2NYX A;  2CUJ A;  5LBQ A;  2OAZ A;  3FWE A;  1F5T A;  2VXD A;  3BQY A;  1QU3 A;  3OL4 A;  2C6Y A;  1Z1D A;  3JSP A;  1ZRF A;  2EQR A;  2MD0 A;  4ABZ A;  3IP4 B;  3CQZ J;  1UMQ A;  2WC2 A;  4DIQ A;  2X85 A;  3ESW B;  2GWR A;  5FD5 A;  2K40 A;  2HDD A;  1JI8 A;  4BY1 J;  4V2F A;  1FNN A;  3IUO A;  1P2F A;  3SZT A;  3TGN A;  5ED4 A;  3MZH A;  1U78 A;  1OR7 C;  2GAU A;  3M7G A;  1WH7 A;  2M34 A;  3BP8 A;  5K1Y A;  2D1H A;  4Y33 A;  2ACJ A;  2KZG A;  1T2K A;  1T38 A;  4HDV A;  2CGP A;  3P9K A;  4UHT A;  2YS9 A;  1OYI A;  3A03 A;  1JHF A;  3D5R C;  5CJ9 A;  2EIM H;  3I55 I;  4I98 B;  2YU9 J;  3ZXS A;  3K70 D;  4LLG F;  4XLP F;  3WOD F;  1WHU A;  3PNV A;  1UHM A;  5TJJ A;  4A0Y A;  2KKO A;  4P96 A;  4W97 A;  1CF7 A;  1RET A;  2QLZ A;  4PCQ A;  4O6J A;  3WTS C;  1QZY A;  5C44 J;  4WXH A;  3NWT A;  3DQV C;  2PG4 A;  5L3C A;  2E1M C;  3FIW A;  2DT6 A;  1YS6 A;  1WVR A;  2QF7 A;  2WV1 A;  1EH8 A;  5FLV A;  2KLO A;  4Y3O A;  2MH9 A;  4GGG A;  1E2X A;  2LLK A;  2GXA A;  1YW9 A;  4KN7 X;  3C2H A;  2WY7 Q;  3CCV I;  3OYD A;  3CF5 F;  3PUF A;  3BCB A;  2AQE A;  2E35 A;  4B4C A;  3K7A J;  4KIB A;  1RES A;  4YEJ A;  3BTL A;  2ZME A;  3O6B B;  1Z9C A;  2O03 A;  3VOD A;  1XX5 A;  2CV0 A;  2P0W A;  4QIW N;  1ORK A;  2DA2 A;  3ZP5 A;  4XKC A;  3H5N A;  1MKM A;  2OTL I;  1Y56 A;  2KIU A;  3A02 A;  5KAF C;  2A5W A;  1I39 A;  2P5V A;  3HYI A;  5CQE A;  2LMD A;  3JR9 A;  2R7R A;  1GV5 A;  2LRE A;  3UKG A;  4BQA A;  1VQK I;  5CVV A;  4ZH4 F;  3I59 B;  3VYU B;  1HW5 A;  4HV6 A;  2L9S A;  3BY6 A;  4XQF A;  3CJT B;  3BJO A;  5ILV A;  4UV8 A;  3K4M A;  2XGC A;  3G71 I;  2IAI A;  3KEQ A;  4P5O A;  2LOO A;  2VQH A;  1I27 A;  1UHS A;  4D0P A;  3WGG A;  4CCO A;  1B72 B;  5LGT A;  1FP2 A;  2VJJ A;  1UZC A;  2NNN A;  1GLN A;  3ECO A;  1CGP A;  4UB8 C;  2KJC A;  3AG3 H;  1OKR A;  1MH3 A;  3K4B A;  1WSU A;  3RZO J;  4IKF A;  2ME0 A;  1TT0 A;  1O4X A;  2PI0 A;  2BY0 A;  3JTH A;  4F52 A;  2ZKZ A;  3MQ0 A;  1HA8 A;  1X4P A;  5C4X J;  1XGS A;  2IRF G;  2DCE A;  4MGR A;  4BJ5 C;  1GXP A;  3OS1 A;  2IS6 A;  1GT0 C;  2ECB A;  2F5V A;  5F0H A;  3VOE A;  3DPL C;  4Z6Y A;  2MW8 A;  4E6K G;  4II3 A;  3V42 A;  5FLX K;  4ITV A;  3FXR A;  2FBI A;  2EFO A;  1H0M A;  3M1C A;  3BLY A;  3LAJ A;  4DW6 A;  1K61 A;  4IHV A;  3EDP A;  1JKO C;  3NWS A;  1OJL A;  1FTT A;  4GFB A;  4HYE A;  3CLO A;  4EMS A;  2QEX I;  1VQL I;  2R4G A;  3KZY A;  2H94 A;  2GOM A;  1ZRD A;  5ILU A;  1KU9 A;  4K2E A;  4HST A;  4DYR A;  3QRF F;  1R1T A;  4IHX A;  2XDV A;  4HX4 A;  4JK1 X;  3C2B A;  4ENM A;  2DI3 A;  3GO5 A;  3JSO A;  5E3M A;  1QNT A;  5J8C A;  4LLL A;  2DO7 A;  1KA8 A;  1SAU A;  3JRH A;  2HXI A;  2QCO A;  2ZC2 A;  4JX4 A;  4BAY A;  2A61 A;  4QPO A;  2KDO A;  2O8K A;  4IZZ A;  1W5T A;  3BTJ A;  4IO9 F;  4XMY A;  2QQB A;  4UVC A;  1FOY A;  2V1X A;  4UXN A;  2GA2 A;  1R23 A;  1D0Z A;  2G7H A;  4F92 B;  3BZ6 A;  1BI1 A;  3ECH A;  4YIR X;  4CH7 A;  4KT5 C;  1BOB A;  3F6O A;  1VND A;  2ME6 A;  3KP2 A;  1OCC H;  3GWZ A;  3GCM A;  3OYG A;  1O3T A;  1SFX A;  3IHU A;  4MHG A;  3D5S C;  3KZZ A;  4XL9 A;  3PM1 A;  2P6T A;  4BBR J;  3PIO F;  5E8I A;  3FXM A;  2HVS A;  3G73 A;  4C2T A;  3HRM A;  4AU7 A;  4Y13 A;  2DPU A;  3FXL A;  5F04 A;  5HS9 A;  1K4T A;  1ETQ A;  2VKV A;  1Z05 A;  4MEY F;  3RPU D;  3OYK A;  2XAF A;  3CME I;  2UZK A;  3TKY A;  1BBY A;  3S16 J;  2R7T A;  2NAZ A;  1Z3X A;  2LTP A;  2E71 A;  4AYB N;  4CDG A;  4IOA F;  5F1R A;  3IWF A;  4LLN A;  2Z3Y A;  5D6F A;  4N0B A;  1B1B A;  4IOC F;  3N05 A;  1VTN C;  5HDG A;  4C3J J;  4Q47 A;  5GPC A;  3C7J A;  2DMT A;  5LRR A;  4FAS D;  3O8G A;  3TBI A;  3GTO J;  4PFP A;  3ZMD A;  2PX9 A;  2V9P A;  2UV1 A;  4XRS A;  5J6X A;  3I54 A;  1LDK B;  1FT9 A;  1HLV A;  4EJT A;  4I2O A;  5BOX A;  2YSR A;  3PL8 A;  2DOE A;  2HKO A;  2MA3 A;  4BJT A;  1Z7U A;  4EEF G;  3DP7 A;  1TQP A;  4AC0 A;  3FXJ A;  1YIJ I;  1S6L A;  2M7A A;  1OMI A;  2H6C A;  2X4H A;  3GTM J;  3KZI C;  1QZE A;  3GFJ A;  5D4R A;  1STZ A;  1U5T A;  2LP0 A;  4G7H F;  1YJN I;  2FF4 A;  2OV7 A;  4S05 A;  1OLT A;  1MDM A;  1T8I A;  4RM3 A;  5L3F A;  1JUM A;  3RDI A;  4I0A A;  1ZR4 A;  1X3W B;  4U0Y A;  4I0B A;  1WFX A;  5HOD A;  3EUH C;  3UR3 C;  3BG7 A;  4C9Y A;  2DU9 A;  2ZNZ A;  2FOK A;  3NAU A;  4YFN F;  4G6D A;  1W0T A;  3HRT A;  3JRA A;  2P5K A;  1Z6T A;  5J1R A;  2JRM A;  1AA7 A;  4OIN F;  4M9S A;  1Z6R A;  4PJM A;  3ZPL A;  3RKQ A;  1YI2 I;  2PJR A;  5GPA A;  3BG5 A;  1DQU A;  1WJB A;  2ID3 A;  1U5T C;  5K5Q A;  1FOW A;  1FTZ A;  1J09 A;  1P4X A;  4LK1 F;  1W0U A;  2KRH A;  2IS2 A;  3HSE A;  1SC7 A;  1FYL A;  1R4M B;  4OIR F;  3DV8 A;  1ZH5 A;  2BY1 A;  3C2G A;  2KZV A;  4CCJ A;  5DUK A;  2LBF B;  5LD2 C;  1OCO H;  3KLO A;  1FLI A;  3FIS A;  2DAO A;  3BR3 A;  1MJA A;  1BI2 A;  1FMV A;  3REO A;  3V8L A;  3MN2 A;  3HGY A;  2EFQ A;  1WWX A;  3ZMU A;  1BC7 C;  2RVC A;  1EH6 A;  1QHH D;  3HTU A;  4M3B A;  4U0V A;  1FOX A;  4ZYH A;  2E5Z A;  3ZOB A;  5HLG A;  2QEN A;  5EG0 A;  1MSF C;  4KIS A;  4CCN A;  1ACI A;  1MSE C;  4RAZ A;  4BQO A;  4RBO A;  3CJN A;  3PQK A;  2OPT A;  2LKP A;  2DXI A;  4LG3 A;  2JVH A;  1T0F C;  3ASN H;  3ZRG A;  1JT6 A;  1QZZ A;  5L3B A;  4JBA A;  4Y7N J;  1BM9 A;  2FQ4 A;  2JUC A;  2VJ4 A;  1H89 C;  5ICE A;  2XAS A;  5HOO A;  3GZ6 A;  2HKX A;  1ZAO A;  5LHG A;  1QBJ A;  4U87 A;  1XMX A;  2VPR A;  2R0Q C;  4OAY A;  4AID A;  1FPQ A;  3OMY A;  5EEH A;  4D5C A;  3F23 A;  1G4D A;  4MTE A;  3U21 A;  2AHQ A;  2JA7 J;  2XF7 A;  1LE8 B;  4O3M A;  5JHF A;  2X6Y A;  2PJP A;  4BU2 A;  5FJ8 J;  3DBL B;  3IKV A;  4PZJ A;  2DOA A;  1FMW A;  1S7O A;  2Y75 A;  1IXS B;  1RIO H;  2E1C A;  2F4I A;  1T08 B;  3I53 A;  1APL C;  1FY7 A;  2VUM J;  2PMH A;  2ZJQ F;  4HQE A;  3F8F A;  3LFU A;  4KJZ A;  5DM6 F;  1REP C;  1DGW Y;  2IXS A;  3ZN1 A;  1ZLK A;  1R4N B;  2BV6 A;  3C3W A;  2IS1 A;  4CZZ A;  1XS9 A;  1FIP A;  3VB2 A;  2WTE A;  4HNU A;  4RDU A;  2VKH A;  2VIX A;  2KQR A;  1ON2 A;  2A5Y B;  2VQL A;  1HKT A;  3T8R A;  4NUB A;  4OOI A;  4PSW A;  3CO6 C;  2LKS A;  4F91 B;  5E1W A;  2HQR A;  2LK2 A;  1S72 I;  2R7W A;  1YW7 A;  2EZK A;  1K78 B;  4XN3 A;  2EWN A;  4D7M A;  1IRX A;  3I4N J;  1TW3 A;  1IV8 A;  2IBD A;  3LQQ A;  4E7I A;  3HDD A;  3E7L A;  3E97 A;  5CVU A;  4H4K C;  1K4S A;  1T56 A;  3F8M A;  4XKV A;  2GXG A;  1BA5 A;  5KK1 A;  1ZGJ A;  1MND A;  3V7S A;  1VQM I;  5D4S A;  2XAH A;  4YRV A;  3IRQ A;  4Y15 A;  2BOL A;  2XAJ A;  3VPR A;  2O0Y A;  1QPM A;  3Q0W A;  3FBI B;  2DBB A;  1V5G A;  4AD9 A; 
#chains in the Genus database with same CATH homology
 3I0T A;  5AIQ A;  2L4A A;  4RB2 C;  3MWM A;  2Q0O A;  2ZME B;  2IW5 A;  2F5C A;  2H09 A;  2BYV E;  4OMZ A;  2XRO A;  5HLI A;  4R79 A;  5BS6 A;  1XGM A;  4I01 A;  5ERI A;  1W7P B;  2BBY A;  4BNC A;  1O7F A;  2VE9 A;  1ODD A;  5CLS A;  4IXA A;  1FZP B;  2P7C B;  5E17 F;  2XV4 S;  3QU3 A;  3U9G A;  1FOK A;  3R0A A;  3DXJ F;  2ZFW A;  2EV6 A;  4G6Q A;  3GEZ A;  5FD6 A;  5DD8 A;  2FRH A;  3BPX A;  2HZT A;  2Y0M A;  1KU3 A;  3DKW A;  2EFN A;  5EEG A;  1SD4 A;  4FX0 A;  4M6X A;  1BN5 A;  2JTV A;  3LFK A;  1J59 A;  3MZY A;  1TTY A;  3GZ5 A;  4ON0 A;  4LGW A;  2Z33 A;  2P4W A;  3I5U A;  4BHP A;  3FXU A;  2NRA C;  2XAQ A;  5CVI A;  1HSJ A;  4EQQ A;  5HS8 A;  3TOB A;  1J7K A;  4HV5 A;  3JAM Z;  3KP7 A;  4KUM A;  4IF4 A;  1OPC A;  2VBW A;  4EGY A;  2UWM A;  2P7V B;  2A07 F;  3NRV A;  1MZB A;  4G9Y A;  1R22 A;  1YS7 A;  2XIG A;  3FM3 A;  4M9Z A;  4YII A;  1G3S A;  1EH7 A;  1SMY F;  1WRJ A;  3F22 A;  2VXZ A;  1J75 A;  4ENJ A;  1XSV A;  1UFM A;  1PDN C;  2RN7 A;  3HIF A;  1W4M A;  3KFW X;  1BC8 C;  4HLY A;  2B0L A;  1O3S A;  3DPT A;  4KN4 X;  1G3W A;  3L2C A;  2ZNY A;  3RJP A;  4KNY A;  4G94 A;  1KQ0 A;  5D8K B;  1GXQ A;  3V8K A;  2KIM A;  1X3U A;  1YLF A;  3ZMV A;  1TNS A;  2GZW A;  5H20 A;  2XHK A;  2HOE A;  2K02 A;  5BPI A;  1IXC A;  1HST A;  4UUV A;  2O61 A;  1Z91 A;  3GYH X;  4M6Y A;  1U5T B;  3PFI A;  4L0Y B;  2DPD A;  1G6N A;  1IN5 A;  1MDM B;  3M8E A;  2JRT A;  4ASN A;  4KFC A;  2L02 A;  2XVC A;  2F5F A;  5JFR A;  1TW2 A;  2PN6 A;  2YU3 A;  1IRG A;  3BPV A;  2W84 A;  4P9F A;  4YIF A;  1RUN A;  1TLH B;  3F3X A;  4QLC U;  2HTJ A;  1R5G A;  4AVP A;  3VEP A;  2JZY A;  2CWE A;  3ABU A;  2L54 A;  5D6E A;  1MJB A;  2FBK A;  5ICC A;  3E5X A;  3K69 A;  1P92 A;  4BYY A;  3MCZ A;  2F5D A;  5D5X B;  1XMA A;  4GXO A;  5DCF A;  2NS0 A;  1IN8 A;  1WKM A;  3FZV A;  4OIQ F;  1B9N A;  2IVM A;  1J9I A;  2CW0 F;  1HXD A;  3R4K A;  5ICG A;  4IPA A;  4ZYG A;  4M74 A;  5A2Q K;  1V4R A;  1PUE E;  1B9M A;  1YYV A;  5AIP A;  1V3F A;  2MBF A;  1LQ1 A;  2DQR A;  3W6J B;  3FMQ A;  4ESB A;  2A6E F;  2ISY A;  4H0E A;  5IT3 A;  4MQ9 F;  3RPQ A;  4L18 B;  4WWC A;  2J5P A;  3Q9V A;  1C0W A;  1XN7 A;  2DTR A;  3R61 A;  1ZG1 A;  1FC3 A;  2FSW A;  1KQ9 A;  4HLX A;  4M73 A;  3GW2 A;  3QPT A;  2L4M A;  3M8F A;  5F6F A;  2VC0 A;  4OIO F;  2VT3 A;  3WTX C;  3H3Z A;  1DPR A;  3RKY A;  2IA1 A;  4A12 A;  2DT5 A;  3GVA A;  3P9C A;  2CSO A;  2VOO A;  2FNP A;  3ZN0 A;  4IRG A;  5D5W B;  4DQ2 A;  2IP2 A;  3LA3 A;  2ESN A;  3C18 A;  2COM A;  1K78 A;  3HRU A;  2GA1 A;  2DLL A;  2M5W A;  1XCB A;  4A0Z A;  1W7P D;  1ZYR F;  2FE3 A;  3WG9 A;  2EV5 A;  2VBZ A;  3E5U A;  1L0O C;  3ML6 A;  3ISP A;  2STT A;  2DK8 A;  2HGC A;  4KIF A;  5KVR A;  5IT9 K;  1BIB A;  2P6S A;  4O5V A;  2E7W A;  2A68 F;  5E1X A;  1Q1H A;  1XDS A;  2STW A;  3E5Q A;  5JR3 A;  4P55 A;  5BQT A;  5H6R A;  2A3S A;  2VOP A;  2VBY A;  4KIG A;  1W7P A;  2IA2 A;  1TQI A;  1WQ2 A;  2K7L A;  5LHI A;  3MFK A;  2HYG D;  4ZYE A;  1UB9 A;  1XGO A;  1MGT A;  4L9V A;  3O3K A;  1SD6 A;  3SFZ A;  3GLX A;  1HW1 A;  1U3E M;  4KMF A;  1PP7 U;  3TO9 A;  2AS5 F;  4N9I A;  2PEX A;  4HF2 A;  3ABT A;  4CYD A;  2IPQ X;  5DEQ A;  1ZHF A;  4E70 A;  1S8N A;  2OD5 A;  2WV0 A;  4ETS A;  3J80 Z;  2V1D A;  1SMT A;  1TBX A;  4A5N A;  1WI9 A;  4PGG A;  1HQC A;  3EET A;  3V7C A;  2CFX A;  3Q5F A;  5LEK A;  2G9W A;  3TDU C;  3IKT A;  3F8C A;  1IN6 A;  4EJW A;  6PAX A;  1NHA A;  1D8K A;  5HDK A;  1XMK A;  1HKQ A;  2YR2 A;  4HDU A;  4WCG A;  1T39 A;  1P4W A;  2PQ8 A;  2FXA A;  2ADU A;  4I09 A;  5E8G A;  1YG2 A;  4G7O F;  2W85 A;  3TO6 A;  4CXF A;  1ZGA A;  4L0Z B;  3QP5 A;  2R7F A;  1JE8 A;  3U2R A;  3SHF A;  3IL2 A;  2EFW A;  1KQ8 A;  2D1V A;  3H92 A;  5L3G A;  3T0Y A;  4HQM A;  2FMY A;  3RIR A;  4KA4 A;  2D45 A;  4HF0 A;  2EK5 A;  4R8H A;  3TQN A;  1FBS A;  2X0L A;  1H9T A;  3K1N A;  1ZRC A;  2VC1 A;  2LSO A;  5HVQ C;  1B4A A;  1O7L A;  1BOA A;  2VOD A;  3HSR A;  3WGH A;  3FMS A;  5FLX Z;  1PP8 F;  3F8B A;  3GF2 A;  3T5X A;  4HOB A;  3WE2 A;  4LB5 A;  3PQJ A;  3KP4 A;  1AWC A;  3LST A;  5AON A;  2PLY A;  3P9I A;  4XSZ F;  3QOP A;  5E1Z B;  1R7J A;  3IC7 A;  1R1U A;  3F72 A;  1FX7 A;  4GYI A;  3HUG A;  1S3J A;  4FX4 A;  2M45 A;  1IN4 A;  2E7X A;  1ZG5 A;  2ZBK A;  2Q8K A;  3SQN A;  5K5O A;  2Y48 A;  1J0R A;  2ELH A;  4UVA A;  2MC3 A;  4L5I A;  3WE3 A;  2MLG A;  3GFL A;  3KP6 A;  4LK0 F;  3DEU A;  2O3F A;  3RKX A;  4AIJ A;  2VE8 A;  4IHS A;  4NQW A;  3WTV C;  5IT9 Z;  3HSF A;  4I02 A;  1DP7 P;  4S04 A;  1H9G A;  3N4M A;  4NB5 A;  4M72 A;  5LRS A;  4IHT A;  4OMY A;  3LQR A;  1P4A A;  2KRF A;  2P5L C;  2H6B A;  1DDN A;  2AXL A;  5BMZ A;  3ERE D;  4EVI A;  4KYW A;  2P8T A;  2Q2E A;  4RGU A;  5CYV A;  3HTS B;  3R60 A;  2R7D A;  1I5Z A;  5E20 A;  5D5U B;  3I58 A;  5D8L B;  3KE2 A;  4HA8 A;  5LGN A;  2QUF A;  3KLN A;  4Q4Z F;  4YFX F;  3KCC A;  3LAP A;  4EM0 B;  3BDD A;  2VON A;  2H27 A;  2Z9O A;  2HTS A;  1LEB A;  3CO7 C;  3H3U A;  1YTY A;  1KYW A;  1RI7 A;  5H6Q A;  1KU2 A;  4LFU A;  2QQA A;  5E18 F;  4HX7 A;  4RAY A;  3ZMS A;  3GFI A;  4BXU A;  2JPC A;  4MNU A;  3FM5 A;  4A2U A;  3J80 K;  1KU7 A;  1B59 A;  5JHU A;  3V4G A;  2RV8 A;  2PBI A;  2F5E A;  1QQI A;  2LF7 A;  4PDK A;  2XGX A;  1O3R A;  4U7B A;  2OBP A;  5DUI A;  1G3Y A;  2LNB A;  4OU0 A;  1LDD A;  2K86 A;  1SFU A;  2XKO A;  4M9X A;  4TV7 A;  2Z5U A;  3MEX A;  2FEZ A;  3LWF A;  1LDJ A;  2EJR A;  1ULY A;  3C1D A;  3HHH A;  2UXN A;  4XRF A;  3LA2 A;  3U1D A;  2JT1 A;  1YO5 C;  4ZZL A;  1XSD A;  3TO7 A;  3WGI A;  1QO0 D;  4A5M A;  1RNL A;  2YX4 A;  2QM3 A;  2DW4 A;  3L09 A;  4KDP A;  3K0L A;  2IJL A;  2W25 A;  3QAH A;  4ENN A;  4A6D A;  2XAG A;  2QBY B;  1GVJ A;  2W24 A;  2HDC A;  4UNO A;  2EA4 A;  3K2Z A;  3I71 A;  3EYY A;  2M87 A;  4HAM A;  1P6R A;  3GXO A;  3R6S A;  2XKP A;  1XDU A;  1BIA A;  2VT2 A;  1AOY A;  1IRF A;  2QZ8 A;  4AIH A;  1D8J A;  3WTU C;  5DCM B;  3ZQ7 A;  4RB1 A;  2HQN A;  4EJO A;  3DF8 A;  1IF1 A;  4Q48 A;  3IRR A;  2OZ6 A;  2V9V A;  4ENK A;  2QYO A;  2ESH A;  3OV8 A;  1YFH A;  1A04 A;  3RI4 A;  2VN2 A;  4EM1 A;  3E6C C;  5HS7 A;  3CUO A;  3DFG A;  3L9F A;  1SAX A;  2QWW A;  1D5V A;  2CYY A;  3F21 A;  3J7A O;  2EFP A;  3BJ6 A;  5FO5 A;  2JPB A;  1FSH A;  2DK5 A;  1I1S A;  2RDP A;  2ZXJ A;  2HS5 A;  3V7R A;  1BI0 A;  1FBQ A;  1UCR A;  1T98 A;  2EB7 A;  2ZO4 A;  3JAM K;  3WTZ A;  1O57 A;  3TDZ C;  3K1M A;  1O3Q A;  2F2E A;  3WTY C;  2M8E A;  3EYI A;  2HR3 A;  3N97 A;  3ULQ B;  3I64 A;  3F6V A;  4B09 A;  1GHC A;  1HKS A;  5ILS A;  1TQM A;  3S2W A;  4XBF A;  3FX3 A;  1LNW A;  2V1U A;  1FSE A;  3BOQ A;  1U6G A;  4WXC A;  4IVN A;  2K4B A;  2J5O A;  2OQG A;  3J81 K;  1W5S A;  1ZLJ A;  5LGU A;  4FT8 A;  2O6G E;  4A0X A;  2BGC A;  4A6E A;  4FHT A;  4G8X A;  1BI3 A;  2L01 A;  2Z99 A;  1U2W A;  2KJB A;  2PMU A;  1EV7 A;  2IT0 A;  5DDG A;  1QGP A;  4GYG A;  4AIK A;  4YG2 F;  3HOS A;  5FB2 A;  3CUQ B;  2OU2 A;  1FYK A;  3WTT C;  5DV5 A;  3FXQ A;  5D5V B;  3O2P E;  3L00 A;  2LF8 A;  5CVR A;  2OZU A;  5J8F A;  2V79 A;  1JXS A;  4U88 A;  4F7Z A;  2YPR A;  4B8X A;  2MLK A;  3HOT A;  4WF2 A;  4HBL A;  2PFB A;  1D3Y A;  3OOP A;  1L3L A;  3LA7 A;  4LD5 A;  4AWX B;  2FNA A;  2HFH A;  2FU4 A;  2M30 A;  2TDX A;  3I4P A;  2EV0 A;  4L9J A;  2MD5 A;  4YFK F;  1DUX C;  2FQ3 A;  3D5L A;  4R1H A;  4EJU A;  4JQF A;  1IW7 F;  3B73 A;  3NQO A;  2UXX A;  4N9H A;  3KEO A;  3WU0 A;  1RUO A;  1XCV A;  1E17 A;  4ESF A;  3FHZ A;  1F4K A;  2W57 A;  3E6M A;  4LG0 A;  4MTD A;  1IN7 A;  4ZZD A;  4RS8 A;  3RPU A;  4M71 A;  3T8T A;  3E6D A;  5HLH A;  1LB2 A;  4DNC A;  4CGZ A;  3KP3 A;  3QPH A;  4EJV A;  2V6C A;  3GX4 X;  1DPU A;  3ZMZ A;  4EGZ A;  3V8J A;  4ZYD A;  2BE5 F;  3WTW C;  3KET A;  4UV9 A;  5BPD A;  4LB6 B;  4Y17 A;  1JHH A;  2OQR A;  2G7U A;  1R36 A;  1IAW A;  5LHH A;  3BRO A;  2YX7 A;  4L9T A;  2DQL A;  4WXD A;  5LLQ A;  4EV0 A;  4NHJ A;  5CVJ A;  5A2Q Z;  1CF7 B;  1SFE A;  2CQK A;  3D0S A;  3BJA A;  3E3V A;  1UST A;  2EA2 A;  4RB0 A;  2L3D A;  1Y0U A;  4ESJ A;  3MAJ A;  3BWG A;  3Q9S A;  4HX8 A;  5DD4 A;  4EM2 A;  1YW8 A;  2M1B A;  1IXR C;  2VBX A;  3ZMT A;  1XB4 A;  3KP5 A;  3HHG A;  3RYP A;  1G3T A;  1LEA A;  3W6K B;  3R0J A;  2RQP A;  3F8N A;  1K79 A;  3ROU A;  1KYZ A;  3I59 A;  4BHC A;  1ZG3 A;  2QBY A;  3J81 Z;  2HEO A;  5K5R A;  1HBX G;  1F1Z A;  2E1N A;  1FBU A;  4L5J A;  5L3D A;  1MJ9 A;  2BEO A;  3JTG A;  2A69 F;  1ZN2 A;  2CO5 A;  1J2X A;  1LVA A;  1J5Y A;  5DCM A;  1FYM A;  4U7D A;  3GUD A;  4UVB A;  4WK8 F;  1RZ4 A;  3IWZ A;  3EQL F;  2RNJ A;  4CO8 A;  2D2W A;  4XLN F;  3ELK A;  4IRI A;  2LDU A;  2DFI A;  1R1V A;  1JGS A;  2XUB A;  3HRS A;  1U8R A;  1KGS A;  5L3E A;  4IRH A;  2FA5 A;  2FML A;  2GIV A;  2JSC A;  1MD0 A;  1ONV A;  1IZ1 A;  3K9T A;  3WU1 B;  3JW4 A;  4MEX F;  1B6A A;  2ZJ2 A;  1R00 A;  1YQA A;  1XSX A;  4P9U A;  1HW2 A;  5FFX A;  3P7N A;  1R58 A;  2RC4 A;  1ON1 A;  1ZAR A;  5JI6 A;  2ETH A;  1T6S A;  2QVO A;  2R3S A;  4XSX F;  4G7Z F;  1IUY A;  2ISZ A;  1BJA A;  4HW0 A;  4KIC A;  4Q5S F;  3COA C;  3SXY A;  2K4J A;  3K1P A;  4RGS A;  1XD7 A;  3RYR A;  5FFZ A;  3TOA A;  5F64 A;  4Z2Y A;  4CHU A;  3FF5 A;  2RKH A;  3NEU A;  3CTA A;  5HDN A;  3AAF A;  1FWZ A;  4CIC A;  1OYY A;  3CUQ C;  4PGH A;  2RGV A;  4WX9 A;  2HYF A;  3EUH A;  1SD7 A;  1XGN A;  1USS A;  3QU6 A;  2GXB A;  2K27 A;  1OYW A;  4U0W A;  3RTR A;  3E6B A;  3VFZ A;  3RKW A;  1K7A A;  3L7W A;  1R5H A;  2KIF A;  1K6O A;  4HF1 A;  2WWY A;  1S7A A;  3CUQ A;  4BH9 A;  2ZCW A;  4IJA A;  4L9N A;  2FBH A;  1ZRE A;  2OA4 A;  1F9N A;  1FP1 D;  2XRN A;  3M1E A;  1LJ9 A;  4GCV A;  5FGM A;  2NNY A;  3SZP A;  3QP6 A;  1T0F A;  1YIO A;  4RGX A;  2A6H F;  2QQ9 A;  1I1G A;  4QWQ A;  4MQV A;  1SD5 A;  4GO1 A;  3T1B A;  3CDH A;  2O8X A;  1UHW A;  3M9A A;  5TRD A;  4BHB A;  4KMU X;  5LEJ A;  5ICF A;  3FMR A;  3GFM A;  4HZF A;  5JVT A;  3G3Z A;  2IA0 A;  4OIP F;  4I7H A;  1TNT A;  4RGR A;  1OR7 A;  4LMY A;  4RB3 C;  4LG0 B;  4LJZ F;  2HWV A;  5DYM A;  2CG4 A;  1I6X A;  2MH2 A;  1S29 A;  3B02 A;  2GQQ A;  2NYX A;  5LBQ A;  2OAZ A;  3FWE A;  1F5T A;  2C6Y A;  1Z1D A;  3JSP A;  1ZRF A;  2WC2 A;  5FD5 A;  2GWR A;  3TGN A;  1FNN A;  1P2F A;  3SZT A;  5ED4 A;  3MZH A;  1U78 A;  2GAU A;  3M7G A;  5K1Y A;  3BP8 A;  2D1H A;  2ACJ A;  1T2K A;  1T38 A;  4HDV A;  2CGP A;  3P9K A;  4UHT A;  1OYI A;  5CJ9 A;  1JHF A;  4I98 B;  4LLG F;  4XLP F;  3WOD F;  1UHM A;  5TJJ A;  4A0Y A;  2KKO A;  4P96 A;  1CF7 A;  2QLZ A;  4PCQ A;  4O6J A;  3WTS C;  1QZY A;  4WXH A;  3DQV C;  2PG4 A;  5L3C A;  1YS6 A;  1EH8 A;  2MH9 A;  4GGG A;  1E2X A;  1YW9 A;  4KN7 X;  4KIB A;  2ZME A;  3O6B B;  1Z9C A;  2O03 A;  3VOD A;  3ZP5 A;  1MKM A;  2KIU A;  2P5V A;  3HYI A;  4BQA A;  5CVV A;  4ZH4 F;  3I59 B;  1HW5 A;  4HV6 A;  3BY6 A;  3BJO A;  5ILV A;  4UV8 A;  3KEQ A;  4P5O A;  1I27 A;  4D0P A;  3WGG A;  5LGT A;  1FP2 A;  2NNN A;  3ECO A;  1CGP A;  2KJC A;  1OKR A;  1WSU A;  2PI0 A;  3JTH A;  2ZKZ A;  3MQ0 A;  1XGS A;  2IRF G;  4MGR A;  1GXP A;  3VOE A;  3DPL C;  5FLX K;  3FXR A;  2FBI A;  2EFO A;  1H0M A;  3LAJ A;  3EDP A;  4HYE A;  3CLO A;  4EMS A;  3KZY A;  2H94 A;  1ZRD A;  5ILU A;  1KU9 A;  4K2E A;  3QRF F;  1R1T A;  4HX4 A;  4JK1 X;  4ENM A;  2DI3 A;  3GO5 A;  3JSO A;  1QNT A;  5J8C A;  4LLL A;  2DO7 A;  1KA8 A;  4BAY A;  2A61 A;  1W5T A;  2QQB A;  4UVC A;  2V1X A;  4UXN A;  2GA2 A;  1R23 A;  2G7H A;  3BZ6 A;  1BI1 A;  3ECH A;  4KT5 C;  3F6O A;  3KP2 A;  3GWZ A;  1O3T A;  1SFX A;  3IHU A;  4MHG A;  3KZZ A;  2P6T A;  5E8I A;  3G73 A;  3HRM A;  4Y13 A;  2DPU A;  5HS9 A;  4MEY F;  1Z05 A;  2XAF A;  2UZK A;  3TKY A;  1BBY A;  2NAZ A;  4CDG A;  5F1R A;  3IWF A;  4LLN A;  2Z3Y A;  5D6F A;  4N0B A;  1B1B A;  1VTN C;  5HDG A;  4Q47 A;  3C7J A;  5LRR A;  3ZMD A;  5J6X A;  3I54 A;  1LDK B;  1FT9 A;  4EJT A;  4I2O A;  5BOX A;  2YSR A;  2HKO A;  2MA3 A;  1Z7U A;  3DP7 A;  1TQP A;  1S6L A;  2X4H A;  1OMI A;  2H6C A;  3GFJ A;  5D4R A;  1STZ A;  1U5T A;  4G7H F;  2FF4 A;  4S05 A;  1MDM A;  5L3F A;  3RDI A;  4I0A A;  4U0Y A;  4I0B A;  2DU9 A;  2ZNZ A;  2FOK A;  4YFN F;  4G6D A;  3HRT A;  2P5K A;  1Z6T A;  4OIN F;  4M9S A;  1Z6R A;  3ZPL A;  1U5T C;  5K5Q A;  1P4X A;  4LK1 F;  3HSE A;  1FYL A;  4OIR F;  3DV8 A;  1ZH5 A;  5DUK A;  1FLI A;  3KLO A;  2DAO A;  1MJA A;  1BI2 A;  3REO A;  3V8L A;  2EFQ A;  1WWX A;  3ZMU A;  1BC7 C;  2RVC A;  1EH6 A;  3HTU A;  4U0V A;  4ZYH A;  5HLG A;  2QEN A;  4RAZ A;  3CJN A;  3PQK A;  2LKP A;  1QZZ A;  5L3B A;  4JBA A;  1BM9 A;  5ICE A;  2XAS A;  5HOO A;  3GZ6 A;  2HKX A;  1QBJ A;  1ZAO A;  5LHG A;  1FPQ A;  5EEH A;  3F23 A;  1G4D A;  4MTE A;  4O3M A;  2PJP A;  3IKV A;  4PZJ A;  1S7O A;  2Y75 A;  1IXS B;  2E1C A;  1RIO H;  3I53 A;  1FY7 A;  2PMH A;  4HQE A;  3F8F A;  1REP C;  3ZN1 A;  1ZLK A;  2BV6 A;  3C3W A;  4CZZ A;  3VB2 A;  2WTE A;  1ON2 A;  2A5Y B;  1HKT A;  3T8R A;  4OOI A;  3CO6 C;  5E1W A;  2HQR A;  1YW7 A;  1K78 B;  2EWN A;  1TW3 A;  3LQQ A;  3E97 A;  5CVU A;  3F8M A;  2GXG A;  5KK1 A;  1ZGJ A;  3V7S A;  5D4S A;  2XAH A;  3IRQ A;  4Y15 A;  2XAJ A;  2O0Y A;  1QPM A;  2DBB A;  4AD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...