5J6XA

Crystal structure of the apo-zalpha of zebrafish pkz
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
MSAENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKRPVWDLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Z-DNA binding protein kinase
publication title Structural and functional studies of a large winged Z-DNA-binding domain of Danio rerio protein kinase PKZ
pubmed doi rcsb
source organism Danio rerio
total genus 21
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5j6xA00
3WGIA 1QNTA 2QBYA 1T39A 2FMYA 4PCQA 1F1ZA 4Z2YA 1LDDA 1ON2A 4GCVA 1P6RA 3NEUA 2JPBA 1HBXG 3LAJA 1T2KA 4L9NA 5FLXZ 2K4BA 4CGZA 4GGGA 5HVQC 1SD7A 1RUNA 3FF5A 1S3JA 3R60A 3J81Z 1FBUA 2XGXA 5EEHA 4HX7A 4RB2C 4AIJA 2W85A 3ROUA 1G3WA 4B09A 4LD5A 2PLYA 4OIPF 5DCMA 5DD4A 3QP5A 5CVUA 1W4MA 2W24A 1WWXA 3SHFA 1SD4A 5BPIA 2VC1A 1HXDA 5LHHA 2L4AA 5F64A 1Z1DA 3E5XA 1HW1A 5D6FA 3QU6A 1S29A 2P6TA 3TKYA 1O3SA 4IHSA 1Z91A 2EA4A 1LEAA 1IN4A 2PG4A 4EGZA 4H0EA 3G73A 4HX4A 2STTA 2XVCA 5FGMA 2HKOA 4OINF 3HHGA 2HKXA 2EJRA 4PDKA 1Y0UA 2HEOA 4M72A 4WX9A 1IAWA 5CYVA 2O8XA 2R7DA 2HTJA 2FOKA 2HQRA 3RTRA 2ZMEA 3R6SA 1JHHA 4YIIA 3ECHA 4M9SA 1TBXA 3IKTA 3DP7A 2PQ8A 2PMUA 5HS7A 2P6SA 2ZBKA 1PP8F 3IHUA 1G3SA 3WE2A 4WXHA 4O6JA 2RN7A 2K4JA 2KIUA 2WTEA 2ACJA 2FA5A 5D8LB 5E8IA 1TQMA 5ILSA 1GXPA 2XROA 1ZN2A 3WGHA 1K78B 3MFKA 3K1NA 4KMFA 1V3FA 2TDXA 2EV5A 3ZMVA 2IT0A 3HRMA 5D8KB 2MD5A 4P5OA 2H6BA 4LGWA 3RKXA 1BJAA 3S2WA 1X3UA 2HFHA 5L3FA 1QBJA 1KQ9A 5KK1A 5JI6A 2AS5F 3E6DA 4BHBA 5J8FA 3M7GA 3V4GA 5ERIA 2VOOA 3P9IA 2EWNA 4L0ZB 4UHTA 2ISZA 1AWCA 2XUBA 3ECOA 2CG4A 4KDPA 2VONA 1XMKA 4ZH4F 2EFOA 1UHMA 1W7PB 5LBQA 4Q48A 4G7OF 1FOKA 1ZRCA 2F5DA 1XN7A 4A0ZA 5D6EA 2QLZA 3DKWA 4IRHA 5FO5A 4AIHA 1W7PD 4HAMA 3GFMA 4P9FA 3BDDA 4K2EA 4KICA 3EETA 2KIMA 1WKMA 3RPUA 3SFZA 3FHZA 3KP5A 5AIPA 3LQRA 1IN8A 2DAOA 3F72A 4KIFA 1BOAA 3VEPA 2KIFA 3HOTA 1BI1A 4UVAA 4JK1X 4A5MA 3QP6A 1O3RA 3ZMDA 1SD6A 3K0LA 1I6XA 3WTUC 1TNSA 2VC0A 2Z3YA 2R7FA 2FBIA 3F8MA 1CGPA 3GYHX 4M9XA 1XGOA 1ZHFA 1P4XA 3QPHA 2CSOA 3Q9VA 2CW0F 2HYGD 2DI3A 2MA3A 1FX7A 3FZVA 4ESJA 4LFUA 4LK1F 2DPUA 2BV6A 1OYIA 2GAUA 5E18F 1YO5C 2OAZA 4EJTA 4UUVA 5ILUA 3IC7A 1FC3A 1FYKA 3HSEA 4ESBA 4PGGA 3E5QA 4Q5SF 4MTEA 2HTSA 3WTYC 1T38A 2XKPA 1T6SA 3I0TA 4ZYDA 2FSWA 1H9GA 5J6XA 1FYLA 5BMZA 2M5WA 4L9JA 4M9ZA 2GA1A 4UVBA 1HQCA 5LHIA 3CO6C 3F21A 2HR3A 4HV6A 4A2UA 2RQPA 1JXSA 2B0LA 1P92A 4M6XA 4ESFA 1QZYA 5ICCA 5AONA 4BNCA 1RIOH 1ZH5A 1FNNA 1YS6A 1ON1A 1USTA 2QBYB 1HKTA 1U3EM 3ZP5A 4XRFA 3MZYA 1P2FA 1H0MA 1FSHA 4A0XA 3DPTA 1S6LA 4CO8A 2DFIA 1DP7P 1S8NA 2ISYA 5TRDA 2M8EA 1BN5A 2BGCA 3TOBA 2BYVE 1E17A 2IPQX 2HGCA 2RC4A 1ONVA 4A6DA 2W57A 4OOIA 3BZ6A 4CDGA 1HSJA 2XAQA 3KCCA 4LLLA 4ENNA 3FMQA 4GYGA 2JTVA 4LK0F 4HQEA 4CXFA 2NS0A 3BJAA 4R79A 1ZARA 1QGPA 2K7LA 2WC2A 4RB3C 2XHKA 1NHAA 1J5YA 1EH8A 5FFZA 2L01A 4I98B 4M6YA 4HX8A 1IN7A 1U78A 1KU3A 4I02A 3W6KB 1T98A 5TJJA 3HUGA 5A2QZ 4A6EA 3LA3A 4EM2A 1TQIA 4HBLA 1G4DA 3WTTC 1DPUA 1FBQA 4QLCU 3OV8A 2CFXA 4BQAA 4IVNA 2O6GE 3L9FA 2OD5A 5ILVA 3KE2A 4G7ZF 2OBPA 2ZMEB 3TQNA 3GEZA 2YR2A 4LMYA 2A6HF 1MGTA 4S04A 3ZMUA 3V8JA 5HOOA 1J2XA 3GFJA 4HZFA 4OIOF 2ZNZA 1LQ1A 4I7HA 3W6JB 3TDZC 2LDUA 3J7AO 2QQ9A 2GA2A 4OIRF 1XSXA 2Z33A 3CJNA 1LDKB 5LRRA 2A68F 3TO6A 4IRIA 4RAYA 1MJBA 1R1TA 3WTZA 2QZ8A 3CO7C 4RGUA 3C18A 2ELHA 4LJZF 3BJOA 3DXJF 1Z7UA 3GX4X 1JE8A 1BIAA 2VODA 1H9TA 3EUHA 4G6QA 1XCVA 3WGGA 4NHJA 3RDIA 5JHUA 4KUMA 3K1PA 2GIVA 3TDUC 2V79A 5K5QA 1TW3A 4O5VA 1YYVA 1WQ2A 2G9WA 1WRJA 4FHTA 1O3TA 1YLFA 4KMUX 3F8CA 3KETA 2PBIA 3BOQA 4KT5C 4QWQA 2PJPA 4MQ9F 4JBAA 3L2CA 5DCFA 3O3KA 1LEBA 4LG0A 1R5HA 1L3LA 1IXSB 1MDMB 3DFGA 3JSOA 2D45A 5K5OA 1OYWA 4WF2A 4G94A 2P8TA 4UVCA 1IN5A 3PFIA 4ENKA 3QRFF 4CICA 3HIFA 1BM9A 3CLOA 2A5YB 4IXAA 2XASA 1KA8A 4MEYF 2FRHA 4XBFA 5BQTA 4I2OA 1IF1A 3VOEA 5JR3A 3WU1B 1BI3A 1YTYA 4MQVA 1S7OA 3MAJA 2XAGA 2NRAC 3D0SA 2VXZA 1B4AA 1I1GA 5E1WA 4P55A 5CVRA 1ODDA 2V6CA 1IZ1A 1BC8C 4MGRA 3VODA 3KP6A 5F1RA 1UCRA 2RVCA 4KA4A 4L9TA 4YIFA 3P7NA 4PZJA 1FBSA 4FX4A 3DQVC 1XCBA 3J80Z 2Y48A 3BROA 1YW9A 1U2WA 3I59B 3COAC 1QQIA 1MD0A 2EV6A 2A69F 2J5PA 1YW8A 1D3YA 3VB2A 4G9YA 2QYOA 4WCGA 4BAYA 1FSEA 2P5KA 3RKYA 1YIOA 3SQNA 2F5FA 3EYIA 2IW5A 2MC3A 5DV5A 1ZG3A 4EQQA 1SFUA 2QUFA 1CF7A 3O2PE 4MNUA 1LVAA 3ZPLA 1EH6A 1DUXC 1RNLA 1ZAOA 1B9NA 5EEGA 2VN2A 2ZKZA 2DQRA 3WTXC 2H09A 4KNYA 2MBFA 1B6AA 4UV9A 5CLSA 2VBYA 3V7RA 4P9UA 4AVPA 5DYMA 3GUDA 3O6BB 4PGHA 2DK5A 2RNJA 2Q2EA 3FXQA 5D5VB 2XV4S 5H6QA 3GZ6A 3IWFA 3KZYA 1IUYA 3CUQB 2PN6A 4EMSA 3M9AA 3JSPA 4R1HA 3JTGA 3V7CA 3LA2A 4L5IA 3ZN0A 4OMYA 4RB0A 4YFKF 4RS8A 4EM0B 1KYZA 3KP7A 3H3UA 1F9NA 6PAXA 1Z05A 1PUEE 2MH9A 1QPMA 5L3GA 1KQ8A 2Q0OA 4U0WA 2JZYA 4YFNF 2DK8A 4M73A 1FT9A 2DQLA 3KP3A 2HS5A 4UV8A 4TV7A 5HDNA 5DDGA 5D4RA 4BHPA 1XMAA 1OPCA 1XGSA 4ZYGA 4EJUA 4BYYA 2K86A 3R4KA 1UFMA 1BC7C 5JVTA 4CYDA 1U5TB 1HW5A 3T0YA 2E7WA 4S05A 5FB2A 5LHGA 4YFXF 1XGMA 3H3ZA 3ABUA 1QZZA 2DW4A 2YU3A 4HF2A 4N9IA 3DEUA 3HSRA 3F8NA 2ESHA 3TGNA 1K6OA 2HOEA 3I58A 3KLNA 5DEQA 3TOAA 1EV7A 1RI7A 3KEQA 5BOXA 5E1ZB 1U8RA 3U2RA 2A6EF 2ADUA 1F4KA 1FPQA 2A61A 2DO7A 2DTRA 3REOA 3KP2A 2VT3A 5L3CA 5JFRA 4G7HF 4Q47A 1ZRDA 1MJ9A 4U88A 3KLOA 4MEXF 1B1BA 3FXRA 2O61A 4AIKA 1HSTA 1U6GA 3HYIA 4O3MA 4ENJA 4EM1A 1G3YA 2O3FA 1IRFA 4ETSA 2DPDA 4HW0A 1FYMA 2XAHA 3L09A 2P7VB 3TO7A 2ETHA 1PDNC 3M1EA 2MLGA 4LG0B 4F7ZA 4AWXB 4I0BA 1QO0D 4GO1A 2YPRA 2UWMA 3SZPA 4G8XA 4KFCA 4N0BA 3QOPA 1R58A 3M8EA 3H92A 4I01A 5K1YA 1O3QA 2IP2A 2E1NA 3HHHA 1BIBA 4KN4X 1F5TA 2L3DA 2L4MA 3GW2A 4I0AA 3RYRA 1YQAA 2CQKA 5E17F 3DPLC 1W5TA 3V8KA 1C0WA 3BWGA 5DCMB 1O7FA 4CZZA 3OOPA 3ZN1A 3K2ZA 3IL2A 4IRGA 1K79A 1P4AA 1TTYA 3I64A 5FLXK 2KJCA 3P9CA 1LJ9A 4Q4ZF 2JRTA 4HLXA 5L3EA 4IJAA 1FZPB 3F8BA 1Q1HA 1B59A 5ED4A 4XLNF 2LF8A 5FD5A 4EVIA 2NAZA 1FP2A 1LB2A 2JPCA 3DV8A 1HKSA 3BJ6A 3RYPA 4EJWA 5DUIA 2OU2A 2FBKA 3LWFA 4LB6B 2DT5A 5AIQA 3Q5FA 1RUOA 5K5RA 2XIGA 5CVIA 2W25A 1V4RA 1KU9A 3KZZA 3B73A 5CJ9A 4OU0A 2P7CB 2Y0MA 1XSVA 4EV0A 3BPXA 3ABTA 1RZ4A 3B02A 3GF2A 3CUOA 4RAZA 3DF8A 1R1UA 5LEKA 1CF7B 1IXCA 3WE3A 3V8LA 2YSRA 2OQGA 2OZUA 3K69A 1ULYA 5H20A 4ASNA 2EB7A 1P4WA 3EDPA 3PQKA 2FEZA 4MTDA 2STWA 3T8RA 2NYXA 1MJAA 5H6RA 1K7AA 4EJOA 2V9VA 4L9VA 1DDNA 4I09A 3U1DA 3ERED 2JT1A 3E3VA 4UXNA 3RIRA 2QWWA 1KU2A 1R36A 4HDVA 3T5XA 3R0JA 3R0AA 1J59A 2F5CA 3VFZA 1FY7A 4AD9A 1DPRA 1WSUA 4RGSA 3CUQC 2ZFWA 2M87A 1R22A 2IA1A 3E5UA 2CWEA 2VBWA 1G6NA 2X4HA 1ZRFA 1GHCA 4HA8A 2XAJA 3N97A 3K1MA 4BH9A 5HDKA 1TLHB 3IRRA 1ZGJA 2L54A 3E6CC 2V1DA 3RJPA 4KIGA 1BI0A 3ZMSA 3WTSC 1XGNA 3TO9A 5FD6A 2FNPA 2Z99A 2IA2A 1OMIA 3GWZA 2ZCWA 1PP7U 1JGSA 4FT8A 2QQBA 1FP1D 2GXGA 5CVVA 2GWRA 4DQ2A 2QVOA 4U7BA 1U5TC 1W5SA 1Z9CA 5FFXA 5E20A 2X0LA 3T1BA 2UXXA 5LGUA 1YFHA 3BPVA 4HQMA 4BHCA 3CDHA 2UZKA 3RPQA 2PMHA 5E1XA 1R1VA 2RDPA 4LLNA 3D5LA 3FMSA 1J7KA 2EFQA 3HRUA 3F6OA 2OZ6A 3BP8A 4ZZLA 4U0VA 5LGTA 3F23A 5KVRA 1I5ZA 2VE9A 3KEOA 4ZYEA 2XAFA 2PI0A 3FM3A 3GXOA 4GYIA 1KU7A 2ZO4A 2XRNA 3WTVC 5D4SA 1Z6TA 3ULQB 2LNBA 2ZJ2A 4ENMA 1D5VA 4CHUA 2F2EA 2M45A 1MZBA 2YX4A 4E70A 1HKQA 2HWVA 4WXDA 5HLIA 1R5GA 1KGSA 1L0OC 3JAMK 1Z6RA 3I54A 1EH7A 2EV0A 3FWEA 3I53A 5F6FA 3GFLA 5DUKA 4M71A 4NB5A 3WODF 2WWYA 5DD8A 1SD5A 1E2XA 1T0FA 3ZMTA 5BPDA 2EK5A 2FQ3A 4FX0A 2CO5A 2ZNYA 5CVJA 2VT2A 4N9HA 3SXYA 1R7JA 1TW2A 2DLLA 3SZTA 2J5OA 3M8FA 2VE8A 2RKHA 4ZZDA 1AOYA 3C1DA 4D0PA 2D1HA 1R23A 3E97A 3P9KA 1ZG1A 1OKRA 2G7HA 2FNAA 4U7DA 2FE3A 2FXAA 3GO5A 2LSOA 5D5WB 2EFPA 3IWZA 2A07F 1XB4A 2H94A 2MH2A 2OQRA 1S7AA 4KN7X 3LQQA 3E6MA 3RI4A 2Q8KA 2KJBA 5ICGA 1MDMA 1UHWA 1SMTA 3U9GA 5HLHA 3E6BA 2O0YA 1J75A 2VOPA 3I71A 4MHGA 4EGYA 3GFIA 1GXQA 4IPAA 2P5VA 2RV8A 3F22A 3MZHA 4KYWA 2M30A 3ZMZA 4Y13A 2CGPA 3HOSA 1ZG5A 3N4MA 5A2QK 4A0YA 2LKPA 2IVMA 1YS7A 2XKOA 1O57A 1UB9A 3WG9A 2COMA 4GXOA 4HDUA 4P96A 5HDGA 2H6CA 3WTWC 3HRTA 3F8FA 1KQ0A 4A5NA 3K9TA 2VBZA 5HS9A 1ZGAA 3ISPA 5HS8A 4RGRA 1WI9A 2HYFA 1J9IA 2VBXA 5LRSA 4KIBA 3MQ0A 2KKOA 4DNCA 2E7XA 3EYYA 2NNNA 1YW7A 5LEJA 1SAXA 1A04A 2QQAA 1VTNC 4B8XA 3F6VA 1I1SA 2IA0A 2D2WA 2FBHA 3GZ5A 2QENA 1B9MA 5L3BA 2DBBA 4XLPF 3JTHA 2KRFA 4ZYHA 3FMRA 3ZQ7A 1OR7A 3I59A 3CTAA 3WU0A 1O7LA 4HF0A 4G6DA 2K27A 2V1XA 5IT9K 3JAMZ 2D1VA 4L18B 4WWCA 3Q9SA 1XSDA 2IRFG 3C7JA 1FLIA 3GLXA 1IN6A 1IW7F 1JHFA 1R00A 1TNTA 3LSTA 1ZREA 1K78A 3HTUA 2HQNA 4R8HA 4EJVA 1I27A 2LF7A 3FXUA 3ELKA 3GVAA 1ZYRF 3LA7A 4L0YB 3MEXA 4OMZA 2EFNA 2GXBA 2AXLA 5ICEA 3RKWA 5BS6A 3IRQA 2O03A 3KFWX 2IJLA 1XD7A 4YG2F 2JSCA 3CUQA 1ZLJA 3LAPA 3I4PA 4JQFA 4U0YA 5IT3A 2HZTA 1SMYF 2BBYA 1FWZA 2P5LC 3J81K 2C6YA 1W7PA 1STZA 2PEXA 3L7WA 5E8GA 4LB5A 3FM5A 1BBYA 5L3DA 3HTSB 4Y17A 2UXNA 4M74A 5LLQA 1LDJA 5D5XB 3T8TA 3JW4A 2EA2A 3QPTA 1XDSA 1ZLKA 3AAFA 1BI2A 4OIQF 2NNYA 4RGXA 4IF4A 2L02A 4LLGF 1U5TA 1HW2A 2ESNA 1YG2A 2GQQA 1XDUA 2FU4A 3J80K 1IRGA 1IXRC 4WXCA 3ML6A 3C3WA 4A12A 1LNWA 2MLKA 4UNOA 2DU9A 2F5EA 3KP4A 4IHTA 1TQPA 3IKVA 1SFEA 1GVJA 2QM3A 2FMLA 2P4WA 2ZXJA 3MCZA 4HOBA 1USSA 3QU3A 2OA4A 2GZWA 2RGVA 4ON0A 3I5UA 3EQLF 5ICFA 3PQJA 1D8JA 4HYEA 2R3SA 3F3XA 1OYYA 4Y15A 5IT9Z 3BY6A 2E1CA 5HLGA 3QAHA 3HRSA 5LGNA 1SFXA 2YX7A 4L5JA 4XSXF 5J8CA 4BXUA 3MWMA 1D8KA 4HLYA 2A3SA 2Z9OA 3V7SA 2H27A 3R61A 2BEOA 2HDCA 3L00A 1MKMA 3HSFA 5D5UB 3FX3A 4RB1A 1KYWA 2EFWA 2M1BA 4XSZF 2BE5F 4NQWA 2K02A 2Z5UA 4HF1A 4HV5A 3G3ZA 2FF4A 3NRVA 1G3TA 3NQOA 1REPC 3LFKA 2V1UA 2PFBA 2G7UA 4WK8F 2W84A 2CYYA 2Y75A 1J0RA 2WV0A
chains in the Genus database with same CATH superfamily
3WGIA 1QNTA 3CCLI 1RETA 4BE0A 2WV1A 1T39A 2QBYA 3A1YA 2FMYA 4D5FA 4D7NA 4PCQA 1VQ9I 1F1ZA 1QHHD 4Z2YA 5IPAA 5J4YA 1RR8C 1LDDA 2CQXA 3IAM2 1ON2A 4G12A 3HOWJ 4GCVA 1P6RA 3NEUA 2JPBA 4E7JA 2X51A 1HBXG 3LAJA 1T2KA 4L9NA 3QOEA 5FLXZ 2ICWG 2JA6J 2K4BA 4CGZA 4GGGA 5HVQC 1SD7A 3AG1H 3O8HA 1RUNA 3FF5A 4B47A 2R0QC 1S3JA 2VIXA 3R60A 3J81Z 4IQJA 2DA7A 1FBUA 2XGXA 3CF2A 5EEHA 4HX7A 4RB2C 4AIJA 2W85A 4DBRA 3ROUA 1G3WA 4B09A 1D1BA 4LD5A 3JCUC 4D7MA 3AG3H 4F91B 2XPVA 3OYCA 2PLYA 4OIPF 5DCMA 2WAFA 5DD4A 1PYVA 1X2NA 3QP5A 5CVUA 1TC3C 1W4MA 2W24A 4B1RA 3GTGJ 2LY1A 1WWXA 1Z21A 3SHFA 4CH7A 4QSHA 1SD4A 5BPIA 2VC1A 1HXDA 5LHHA 2L4AA 5F64A 1Z1DA 3E5XA 1HW1A 4I76A 2X9DA 5D6FA 3QU6A 1S29A 4DBQA 1X58A 2P6TA 4D1QA 3TKYA 5CPRB 1WGXA 1O3SA 2NVTJ 2Z1DA 4IHSA 1Z91A 2EA4A 2VKHA 1W5CC 1LEAA 1VFCA 1IN4A 1TP4A 2PG4A 4V19K 4EGZA 2VPLA 1E3HA 1HDPA 4H0EA 3ZXSA 3G73A 4HX4A 1BW5A 2STTA 2XVCA 3UNGC 2E35A 4BL0B 2X85A 5FGMA 4RLQA 2HKOA 4OINF 3HHGA 5KNLA 2HKXA 2EJRA 4PDKA 1Y0UA 2HEOA 4M72A 1U8BA 4WX9A 3GTOJ 2R92J 1IAWA 4E7IA 3EUHC 5CYVA 2O8XA 2R7DA 2OTLI 2HTJA 1RKTA 4DYCA 2FOKA 1V55H 1LFPA 4YEJA 2XGEA 2HQRA 4BS9A 3RTRA 2ZMEA 2UV1A 3R6SA 3UR3C 3H5AA 3OOUA 1JJ6C 1JHHA 1VZ0A 4YIIA 3MN2A 4XOPA 3ECHA 4M9SA 1TBXA 3IKTA 1ENHA 3DP7A 2PQ8A 3TW6A 3JR9A 2PMUA 2WB1A 5HS7A 1S7EA 2P6SA 5FKNA 2R5ZA 2ZBKA 1PP8F 3IHUA 3BR5A 1G3SA 1R9TJ 1Z3YA 3S14J 3WE2A 2CW7A 4WXHA 4O6JA 3Q0VA 4MIMA 1WJ5A 2RN7A 3DWLE 1VQ4I 1WJBA 2K4JA 2KIUA 2WTEA 4MO7A 1BW6A 3CF5F 2ACJA 2IXSA 3M1CA 2FA5A 5D8LB 5E8IA 1TQMA 5ILSA 3TW7A 4EEFG 4PUSA 1GXPA 2XROA 1ZN2A 1N75A 3WGHA 4HG2A 3MFKA 1K78B 3K1NA 3PSIA 4KMFA 1V3FA 2TDXA 4NC6A 3ZCOA 2Y0SA 2EV5A 3ZMVA 4DGWB 2CQ7A 2IT0A 3HRMA 5D8KB 1TWCJ 2MD5A 4P5OA 1TWGJ 2H6BA 4LGWA 3RKXA 1JGGA 1BJAA 3S2WA 1X3UA 2HFHA 5L3FA 1QBJA 1UMQA 4HSTA 4U87A 4F3QA 1KQ9A 5KK1A 5JI6A 2AS5F 1X1CA 1APLC 3E6DA 4BHBA 5E3OA 4XL9A 3LNQA 3BR0A 5EZGA 4IHWA 1XC5A 5J8FA 3O8GA 4GRIA 1NH3A 3LSMA 2X48A 3M7GA 2H8WA 3MD2A 3V4GA 5ERIA 2VOOA 5GP9A 3P9IA 1Z7LA 2EWNA 4L0ZB 3DCFA 2W00A 4UHTA 2ISZA 2X1CA 2DA5A 1AWCA 2A5WA 2XUBA 3WHCA 3ECOA 2CG4A 3S1MJ 4KDPA 3WHBA 1R49A 3MVPA 5F0FA 2VONA 1XMKA 4ZH4F 2EFOA 1UHMA 3S3OA 1W7PB 2RREA 1SEUA 2E5NA 5LBQA 2E2HJ 2HQAA 4Q48A 5K7FA 4IHYA 1MW7A 4G7OF 1FOKA 1ZRCA 2DTZA 2F5DA 3S15J 3CESA 1XN7A 4A0ZA 3CMYA 1ETVA 3F9KA 3S2DJ 2GOMA 2XB0X 2LKSA 5D6EA 2QLZA 3DKWA 4IRHA 2FUG2 3RKQA 5FO5A 3LFUA 4AIHA 1W7PD 3LOCA 3Q0UA 4HAMA 3GFMA 4P9FA 1IUFA 3BDDA 1X1PA 2KHMA 3AFHA 4PSXA 4K2EA 4KICA 1GV2A 3EETA 1CQTA 3DBLB 2KIMA 4HPQA 4EATA 5EG0A 3A03A 1K61A 1WKMA 3RPUA 3L2WA 3S3NA 2MABA 2WAQA 3SFZA 1LFBA 3FHZA 3KP5A 5AIPA 2JJ7A 3LQRA 1IN8A 2DAOA 1LFUP 3F72A 4KIFA 1BOAA 3VEPA 2KIFA 2VJIA 4ZYAA 3HOTA 4IEJA 2BY0A 2MG4A 1BI1A 4UVAA 4JK1X 4A5MA 5J47A 3QP6A 1O3RA 3ZMDA 1SD6A 3K0LA 4PJ0C 1I6XA 3ABLH 2OPTA 5KAFC 3WTUC 1W36D 1TNSA 2VC0A 4PK4A 2Z3YA 2KIQA 2R7FA 2FBIA 2XDVA 4XLEA 2ZSIB 2BY2A 3F8MA 1CGPA 2K40A 3GYHX 4M9XA 1XGOA 1D0YA 1ZHFA 2FOWA 1P4XA 1D0ZA 4Z6YA 2DA2A 3PUFA 3QPHA 4PJLA 3W6VA 2CSOA 1WJFA 3Q9VA 2Q1ZB 2CW0F 1ACIA 2WB1N 4AYBA 1UJ8A 4NC8A 2HYGD 1WJDA 3HPGA 2DI3A 2MA3A 1FX7A 3FZVA 1DU6A 2CMPA 3CJRB 2KZGA 4ESJA 4LFUA 1IJWC 1VI0A 4LK1F 2DPUA 2BV6A 2IS1A 2LP0A 2ZSHB 1OYIA 3TP3A 1MNDA 2GAUA 5E18F 5EGOA 1YO5C 1TZLA 1WJEA 2R5YB 2OAZA 4EJTA 1RESA 1U9NA 1W1WE 5E3NA 4UUVA 5FRNA 5ILUA 3IC7A 3PIOF 1T33A 2XF7A 1DGWY 3S1QJ 1FC3A 1FYKA 3HSEA 4ESBA 2XC7A 5IOYA 4BU2A 2KQRA 3HM5A 2Y0SN 4PGGA 1UELB 4X6AJ 3E5QA 4Q5SF 4MTEA 2R7VA 1POGA 2HTSA 3WTYC 1T38A 2LG4A 2XKPA 2ZXWH 1T6SA 3I0TA 3OYHA 4ZYDA 2FSWA 2A05A 1H9GA 4CA0A 5J6XA 3M8JA 1G2HA 1FYLA 4XR6A 5BMZA 2VB6A 2M5WA 3H9QA 4L9JA 1NK2P 4UB8C 1MH3A 1PJRA 4M9ZA 2BY1A 2GA1A 4QPQA 2OCCH 4UVBA 1HQCA 5LHIA 3CO6C 5BNGA 3F21A 2HR3A 4HV6A 3HEFA 4A2UA 1MIJA 2M7AA 2RQPA 3E1SA 3ZQIA 1JXSA 2HDWA 2B0LA 1P92A 4M6XA 2M4GA 4ESFA 1QZYA 4BDZA 1SANA 5ICCA 3KZIC 1RR7A 5AONA 4A3GJ 2DXIA 1R6RA 4BNCA 1RIOH 1PUFB 1ZH5A 4DZJA 1FNNA 1YS6A 1ON1A 1USTA 3J7AY 2QBYB 1HKTA 1U3EM 3ZP5A 1RC9A 4XRFA 3MZYA 1P2FA 1H0MA 3H1CA 1FSHA 4A0XA 3DPTA 3OS2A 5M5WJ 1S6LA 4CO8A 1FMWA 2DFIA 3D5SC 1DP7P 1S8NA 3G1LA 4B4CA 2ISYA 5TRDA 3S1RJ 2M8EA 4FE4A 1BN5A 1A31A 2BGCA 4UUSA 3TOBA 1QHGA 2BYVE 2Z2SB 1E17A 2IPQX 2HGCA 2RC4A 1ONVA 3BG6A 4BGDA 2HOTA 3PM1A 2JUCA 1R71A 2R7UA 1I3AA 3HDDA 4A6DA 2W57A 4OOIA 1RRJA 3BZ6A 4CDGA 2ECBA 2EILH 1YHQI 1HSJA 3I55I 1XS9A 2WAQN 2XAQA 3KCCA 3NWTA 2JN6A 4LLLA 4ENNA 1MMSA 3FMQA 4GYGA 2JTVA 2L7KA 4LK0F 4CXFA 4HQEA 2NS0A 3BJAA 4R79A 1N77A 1Y1VJ 5EEAA 1ERDA 5M5XJ 1ZARA 5FLVA 1QGPA 3K10A 3K6GA 3HGGA 3JRCA 1VQ7I 1Z77A 4A3DJ 1OQYA 3JREA 2AQEA 2K7LA 1W0TA 2WC2A 4XKVA 4RB3C 2XHKA 1OLTA 1M1EB 2E60A 1NHAA 1J5YA 3OL3A 1EH8A 5FFZA 3OMYA 4A3KJ 5IYDJ 2L01A 4I98B 4M6YA 3IUOA 4HX8A 1IN7A 2L9NA 1U78A 3DBRB 1KU3A 4FISA 4I02A 4YIRX 3W6KB 1T98A 5GAHJ 3F0CA 2X6OA 5TJJA 3HUGA 5A2QZ 2L2OA 3OYGA 1JTYA 3MKWB 1DQUA 4A6EA 3PL8A 3LA3A 4EM2A 5C3EJ 1TQIA 4HBLA 4C3HJ 2R7SA 4Y33A 1G4DA 3SDBA 3WTTC 1DPUA 1FBQA 4QLCU 5JLWA 3BR1A 2K9MA 3OV8A 2O9LA 3H3VK 4BY1J 2JA5J 2DFFA 4AUXA 2CFXA 3LSKA 4BQAA 4IVNA 2FD5A 4AYBN 1MMNA 4HSRA 2O6GE 4M6VA 3DLLF 3L9FA 3OR1C 2WBMA 2F5VA 2OD5A 1D1AA 1X19A 1LVKA 1IGNA 5ILVA 3KE2A 4G7ZF 2DMNA 2OBPA 9ANTA 2LY2A 2ZMEB 3TQNA 3H9JA 3GEZA 3PUBA 2DMUA 2YR2A 3SZGA 4LMYA 2A6HF 2L7MP 2I5UA 1MGTA 2OF7A 5DM7F 3BLYA 3EUAA 4S04A 2BVMA 2JQ7A 3BG3A 3ZMUA 3V8JA 5HOOA 1V5FA 1WJCA 1J2XA 2R5ZB 3GFJA 3IH2A 4HZFA 4OIOF 1ZK8A 2ZNZA 1LQ1A 4I7HA 2E1MC 2E34A 1QA6A 3W6JB 3TDZC 2LDUA 3J7AO 3DU5A 2QQ9A 1ETWA 2GA2A 1XSXA 1MBEA 4OIRF 2Z33A 3CJNA 1LDKB 5LRRA 2A68F 3TO6A 4IRIA 4RAYA 1MJBA 1BL0A 1R1TA 2V6EA 2Y2ZA 1A36A 3WTZA 3OIPA 2TCTA 1WHUA 2QZ8A 3CO7C 4RGUA 1G59A 2KDZA 3C18A 2LD5A 3TMOA 1Y0NA 2ELHA 3BTCA 5E3MA 4LJZF 2DJNA 1ETKA 1G8XA 3TBIA 4C2MJ 3BJOA 3DXJF 5B66C 1GLNA 1Z7UA 1I50J 3GX4X 1JE8A 1BIAA 1BJZA 4GFBA 2VODA 1F43A 2ZXIA 1H9TA 3P5JA 3EUHA 4CYCB 2V26A 3VYUB 4G6QA 1XCVA 2X1DA 3WGGA 4NHJA 3QYBA 2RQQA 3RDIA 2WADA 4II3A 5JHUA 4KUMA 3K1PA 4B3XA 2GIVA 3HBLA 2V79A 3TDUC 5K5QA 1TW3A 4O5VA 5GAEJ 3ZQQA 4V2GA 3HKZN 1YYVA 1WQ2A 2G9WA 1E3PA 1WRJA 4OAZA 4FHTA 2DN0A 4G6TB 1O3TA 1YLFA 3OYAA 1IG7A 3RQ4A 4KMUX 1ZR2A 3F8CA 2IGKA 3KETA 4DW6A 2PBIA 1YOVB 3BOQA 4CCMA 4KT5C 4XKBA 1IO2A 4QWQA 2PJPA 2I10A 4MQ9F 1SC7A 1HDDC 1ETYA 3GCMA 2KDOA 4JBAA 2BOLA 3L2CA 5DCFA 2NVQJ 3O3KA 1LEBA 2R7OA 4JOMA 4LG0A 1R5HA 1L3LA 2K3PA 3DTEA 1IXSB 3VSLA 3DFGA 3JSOA 2D45A 1MDMB 5K5OA 4BDYA 1QRYA 1LE8A 1OYWA 4WF2A 5E3LA 4CCNA 2ME6A 3B6CA 4G94A 4IO9F 1JKQC 3W2VA 4ITVA 2P8TA 4UVCA 3A0HC 1IN5A 5C44J 3PFIA 1BR4A 4ENKA 3QRFF 1IRXA 4CICA 2LRDA 5LD2C 3HIFA 5EG0B 1BM9A 1ETOA 2DA1A 3CLOA 2R7XA 2A5YB 4IXAA 2XASA 1KA8A 2XF6A 2FRHA 4MEYF 4XBFA 3CD6I 5BQTA 4I2OA 3K4NA 4IQ4A 1IF1A 3VOEA 5JR3A 3WU1B 3I4MJ 1BI3A 3JRIA 1X1DA 1YTYA 4MQVA 3FBIB 1YIJI 3KYCB 2EZKA 3HOXJ 3ZRGA 3VSKA 1S7OA 2VJJA 2LOOA 3FBNB 1K83J 3MAJA 2XAGA 4X0GA 2HVSA 2MFZA 2NRAC 3RPUD 3D0SA 4FASD 4XKWA 4FQGA 4Y4RA 1RKWA 2YUSA 2VXZA 2VJ4A 2QCOA 1B4AA 3GTPJ 1I1GA 2MW8A 4P55A 2IGOA 5E1WA 4A3JJ 1KONA 5CVRA 1ODDA 2V6CA 1LUJB 1IZ1A 1BC8C 2CUZA 4XKCA 1OCOH 3RCOA 4MGRA 2HXIA 5F27A 3VODA 2VASA 3KP6A 4E7ZA 5DTDA 2W48A 5F1RA 1UCRA 3H0GJ 2RVCA 4KA4A 3H36A 4L9TA 3GTKJ 1RPWA 1IDYA 2NS7A 2IS2A 4NC7A 4YIFA 2O5RA 3P7NA 4PZJA 5F0HA 1FBSA 1YRNB 1TWFJ 4FX4A 3ERMA 1VQMI 3W3CA 1BA5A 3DQVC 1XCBA 2E1OA 4JYKA 3J80Z 3GTQJ 1R4MB 2Y48A 3BROA 5EGOB 3OYNA 4DOZA 4RBOA 2X1EA 1N78A 1YW9A 1AKHA 1XTAA 1U2WA 3EPZA 4BQQA 3K70C 2BHYA 1XG1A 3I59B 3COAC 1QQIA 4XLCA 1MD0A 1NTCA 2E2JJ 3VYTB 2EV6A 2A69F 2J5PA 3DEEA 1YW8A 1D3YA 3VB2A 3A0BC 4G9YA 3AL0C 2QYOA 4WCGA 1S9HA 4BAYA 4F52A 1FSEA 2P5KA 3RKYA 1YIOA 3SQNA 2F5FA 5DM6F 3EYIA 2IW5A 4MFDA 1MBHA 2MC3A 2O7OA 5DV5A 1ZG1A 2AQFA 1ZG3A 1JKRC 1J09A 4EQQA 1O4XA 1OJLA 5M3MJ 3BTLA 1SFUA 2QUFA 3KPHA 1CF7A 1T56A 3O2PE 3QQAA 5KCMA 4MNUA 1LVAA 3ZPLA 1EH6A 1DUXC 1RNLA 3G71I 1ZAOA 1B9NA 5TISC 4KT6A 5EEGA 2KPMA 1U0JA 3CDIA 2VN2A 2ZKZA 2R93J 1OISA 3K4JA 3L2UA 2HVRA 2DQRA 2XSDC 2IBDA 1A6IA 3WTXC 1I39A 2H09A 4KNYA 2CQNA 2MBFA 1B6AA 4UV9A 5FRMA 5CLSA 3CCJI 4BBSJ 2VBYA 2HVQA 3V7RA 2NS8A 4P9UA 1HCRA 4AVPA 5DYMA 3GUDA 3OS0A 3O6BB 4NDLA 3S3MA 4PGHA 1LKXA 4B3AA 2DK5A 1BOBA 5M5YJ 2RNJA 2Q2EA 3BT9A 3FXQA 5D5VB 2NXNB 2VQLA 3OYIA 2XV4S 2VKVA 5H6QA 3GZ6A 3QPLA 3IWFA 4UUSB 2M2EA 3OS1A 3KZYA 5EF6A 1IUYA 3CUQB 1JUSA 2PN6A 2ZJRF 4EMSA 3M9AA 3JSPA 4R1HA 3JTGA 2ZXHA 3V7CA 1PVEA 1MSFC 2BY3A 3LA2A 5B1BH 4L5IA 3N05A 3SYTA 3ZN0A 2WY8Q 4RB0A 3VPRA 4OMYA 4YFKF 4RS8A 4EM0B 5HNFA 1KYZA 3KP7A 2K9LA 3H3UA 1OCCH 1F9NA 4NNJA 1EJ9A 2DFHA 2GM4A 6PAXA 1Z05A 4E7HA 1PUEE 3CC2I 3C2GA 2MH9A 1QPMA 5L3GA 2QEXI 3PNTA 2JA8J 4A69C 3DKXA 2M9HA 1KQ8A 3DTIA 3K7AJ 2Q0OA 3OYMA 4U0WA 2JZYA 4YFNF 2DK8A 1NG7A 4A3LJ 2CRGA 1QVUA 4M73A 1FT9A 2WA0A 2DQLA 3CCVI 4W1UA 3ZQCA 2CJJA 3KP3A 1UAAA 2HS5A 4UV8A 1V54H 4TV7A 5HDNA 2NVUB 2M3AA 5DDGA 5D4RA 4BHPA 1TT0A 3ASOH 4PFOA 1XMAA 3GMEA 1MMDA 3PO3J 1OPCA 3L2RA 5F1JA 4ZTFA 3IAS2 1XGSA 4ZYGA 4EJUA 4BYYA 2K86A 3R4KA 1UFMA 1BC7C 5JVTA 4CYDA 2LVSA 1U5TB 1HW5A 3T0YA 2E7WA 4S05A 5FB2A 5LHGA 4I99C 2V1NA 4YFXF 1XGMA 2DW4A 3ABUA 1QZZA 3H3ZA 2YU3A 4A3EJ 2LREA 4HF2A 2QF7A 5IYBJ 4JX6A 2EINH 3DEUA 3HSRA 4N9IA 2R7QA 1A6QA 2DOAA 3FISA 3F8NA 4BXXJ 2ESHA 4XN0A 3OYBA 3TGNA 2HOSA 1K6OA 3OY9A 1JI8A 2HOEA 3I58A 5GAGJ 1QVTA 1B72A 3KLNA 5DEQA 3A02A 2EH3A 2VQCA 1EV7A 2W82A 3TOAA 1RI7A 3KEQA 3ZQGA 5JHFA 4E7LA 1JT0A 4B48A 5BOXA 5E1ZB 1U8RA 2B7EA 3DLAA 2WAEA 3U2RA 2A6EF 4ZJZA 2ADUA 1P9QC 1F4KA 2Y9ZA 1FPQA 3U21A 2A61A 2DO7A 2EIJH 4XRSG 2DTRA 2EQRA 3REOA 1FOXA 3KP2A 1MMAA 2VT3A 1JUPA 3E7LA 3OYDA 5L3CA 3RZDJ 3KYLA 3ABMH 2DODA 3M3YJ 5JFRA 4G7HF 2CS3A 4Q47A 1MSEC 1ZRDA 1MJ9A 3OYKA 4U88A 3KLOA 2GLOA 1X4PA 3HG9A 4XN3A 4MEXF 3FK6A 2M34A 1B1BA 3FXRA 3JRBA 5J1RA 3CP8A 1FOYA 2B63J 1VQLI 1T0FC 2YS9A 3DKYA 2O61A 1IC8A 4C2UA 5FKKA 4AIKA 3RZOJ 1HSTA 2TRTA 3KIOA 5JVGF 2CV1A 1U6GA 3HYIA 1VNDA 4O3MA 4ENJA 4EM1A 2PJRA 4LG3A 1G3YA 3BZCA 2O3FA 4DYRA 5M3FJ 4RDUA 2K3FA 5FKOA 1IRFA 4ETSA 2DPDA 4HW0A 3BG7A 3GLLA 4OWRB 1FYMA 2XAHA 3L09A 2P7VB 3TO7A 2BW3A 3B6AA 3HXLA 4NQWB 1YJNI 4XLHA 2ETHA 1A5JA 1IV8A 3PSFA 1PDNC 3M1EA 4C2TA 2MLGA 4LG0B 4F7ZA 4J00A 4AWXB 5FLMJ 3G2BA 2D5VA 4I0BA 4FETA 1QO0D 1LE8B 1TT5B 1MH4A 4GO1A 2G0EA 2YPRA 2UWMA 4BKXA 3HKZA 2L7FP 3SZPA 4G8XA 4KFCA 3E0JB 2FQ4A 3EUKL 4N0BA 3QOPA 2EZIA 1MNMC 1R58A 3M8EA 5FJ8J 4A3CJ 4X1EA 2DMTA 1X4OA 2Y30A 2MD0A 3OIQA 1YX5A 2MC4A 2CUJA 3H92A 4I01A 5K1YA 1O3QA 4LIUA 2IP2A 1IRZA 2E1NA 3HHHA 1BIBA 4KN4X 1OCRH 1VQNI 1WZ2A 1F5TA 2L3DA 2L4MA 2JA2A 3GW2A 4I0AA 5HODA 3RYRA 1I3QJ 3RSNA 1YQAA 2CQKA 2IS4A 3A01A 5HNHA 5E17F 3DPLC 5IP7J 2L5QA 2VPRA 1W5TA 2B9SA 2MSYA 3V8KA 2KZVA 1C0WA 3BWGA 3I4NJ 2Y69H 3JRHA 5DCMB 1O7FA 4CZZA 4Y7NJ 2DDBA 1Y56A 3BTIA 3OOPA 3ZN1A 3K2ZA 3IL2A 2XF5A 3PNVA 3H5NA 3W2WA 3W2AA 4IRGA 3CQZJ 3DBHB 4BE1A 1K79A 3FKIJ 1P4AA 2LY9A 2X6XA 1GT0C 4PJMA 1TTYA 4D5CA 3I64A 5FLXK 2KJCA 3P9CA 1LJ9A 4Q4ZF 2HNHA 3S1NJ 2QSGX 2JRTA 2F6CA 4HLXA 4F92B 5L3EA 4IJAA 1ZR4A 4XONA 3S93A 1ITYA 1FZPB 3ZQFA 3F8BA 1Q1HA 1B59A 5ED4A 4A93J 1Z0XA 3CCEI 3DU6A 2DJIA 3PO2J 4XLNF 3BQZA 1NK3P 2LF8A 3TEDA 4AIDA 5FD5A 4EVIA 2WY7Q 2NAZA 1FP2A 5IYCJ 3BZKA 3X2QH 1VQ6I 2LMDA 2JPCA 1LB2A 3DV8A 1HKSA 3BJ6A 3M4OJ 4CUGA 3RYPA 4EJWA 5DUIA 2DMPA 2OU2A 2W1OA 2FBKA 2ZC2A 3LWFA 3HOZJ 4LB6B 2DT5A 2RNGA 1AKHB 3ONQA 2DYSH 1Z67A 5AIQA 3OYLA 3Q5FA 1RUOA 5K5RA 4XLAA 2XIGA 2EZLA 5CVIA 4UB6C 4ZDOA 5F08A 2W25A 3S2HJ 4E7KA 1V4RA 1KU9A 4QPOA 3KZZA 3JRFA 2AO9A 3B73A 3ZGKA 2IS6A 5CJ9A 4OU0A 2P7CB 2UUZA 4IHVA 3MKLA 1IDZA 2LR8A 2Y0MA 4XLFA 1XSVA 2CH0A 1JKPC 1D5YA 1OR7C 1Q1VA 2LYCA 3J7ZI 3PIPF 3HOVJ 1X2MA 4EV0A 2NVXJ 3BPXA 3ABTA 1FTZA 4E4HA 3UKGA 4Y3OA 1RZ4A 2JUGA 3B02A 3D5RC 3GF2A 4D9JA 3CUOA 4RAZA 3HOUJ 3DF8A 1R1UA 5LEKA 1CF7B 1IXCA 3GTLJ 5CKTA 3WE3A 3V8LA 2YSRA 4RLFA 5CQGA 1QU3A 2LK2A 3IH4A 4LIVA 2OQGA 2V9KA 2OZUA 1ZQ3P 3K69A 4XK4A 1ULYA 2PX9A 3QYEA 5H20A 4ASNA 2EB7A 1P4WA 2L9RA 3EDPA 1KZHA 4F93B 1DGRM 3A2KA 1VF9A 3PQKA 2FEZA 4XM3A 4HNUA 4MTDA 2STWA 3T8RA 2M7BA 2NYXA 1MJAA 5H6RA 1K7AA 4EJOA 3BC8A 2V9VA 3BQYA 3HPHA 4L9VA 1DDNA 1WCMJ 4I09A 3U1DA 1K6YA 2ID6A 3ERED 2KRHA 2JT1A 2Q2EB 3E3VA 4UXNA 3MMYB 4ABZA 3RIRA 2VLAA 2KL4A 2QWWA 3V42A 1KU2A 3CCMI 1R36A 4HDVA 1Y8RB 2CUEA 1ORKA 3GTJJ 3OL4A 3T5XA 2ID3A 2KP6A 2EIMH 3R0JA 3R0AA 1JKOC 3FXJA 2IAIA 1J59A 2F5CA 3DTKA 3VFZA 3CC7I 1FY7A 2HQ5A 4RM3A 4AD9A 2XPWA 2IEKA 4P1WA 2DT6A 1DPRA 1TL8A 1WSUA 4RGSA 4XICA 3CUQC 2OUMA 3ZR8X 2ZFWA 1Y6IA 2M87A 2OC6A 4HRIA 2DA6A 4HEA2 4IKFA 2X6WA 2Z16A 1R22A 2IA1A 3E5UA 1FMVA 2CWEA 2VBWA 4J19A 1VQKI 4M3BA 3IV5A 1G6NA 2XSJC 2X4HA 1ZRFA 1GHCA 4HA8A 2XAJA 3N97A 3K1MA 3H0DA 4BH9A 5HDKA 1TLHB 3HOYJ 5IP9J 2VKEA 3DEWA 1QZEA 1WVRA 3IRRA 1ZGJA 3SEZA 4ZDLA 2VXDA 2L54A 5F04A 3E6CC 5J4VA 2DOFA 3BTJA 2V1DA 3RJPA 1P7IA 4KIGA 1BI0A 1QPIA 3ZMSA 3ESWB 3WTSC 1XGNA 1D0XA 3TO9A 5FD6A 4XOTA 2FNPA 2Z99A 2IA2A 1OMIA 1GDTA 3GWZA 2ZCWA 1PP7U 2EZHA 1JGSA 4FT8A 3RQIA 2QQBA 1K4SA 1XPXA 2OJED 2E36A 1FP1D 2DFEA 2GXGA 5CVVA 2GWRA 4RAFA 4ZTJA 3S16J 2EIKH 4DQ2A 1W36C 1E0EA 3VWBA 1MBGA 1SFKA 4S0HB 4RA2A 4HNVA 3SEQA 2QVOA 4U7BA 1U5TC 1FOWA 1W5SA 1WFXA 3LSIA 1Z9CA 1JT6A 3GZNB 5FFXA 2OTJI 5E20A 2X0LA 1GVDA 3T1BA 2UXXA 4CCJA 5LGUA 1VQOI 3CCSI 1YFHA 3BPVA 4ANJA 4HQMA 1B72B 4BHCA 3U1KA 3CDHA 2QKMB 2UZKA 3FXOA 3RPQA 4B43A 2PMHA 1YI2I 5E1XA 1VQPI 1R1VA 2RDPA 3L1PA 2DA4A 4LLNA 3D5LA 3FXMA 3FMSA 1J7KA 5LFAA 1UG0A 2EFQA 1YJWI 3HRUA 1LPQA 3CCRI 3F6OA 4FCYA 4N4NB 2OZ6A 2KRCA 3BP8A 4ZZLA 4U0VA 5LGTA 3OWTA 3F23A 4BQOA 3CZ6A 5EDNA 2VQHA 3NAUA 3OYJA 5KVRA 2F4MB 1I5ZA 3QYFA 4XIDA 2VE9A 4M3DA 1OCZH 3KEOA 3ZQHA 1H8AC 3Q0WA 2AHQA 1SVLA 2I8DA 4ZYEA 2XAFA 2ZJPF 3K2AA 1H89C 1X3ZB 2PMZA 2PI0A 1S5LC 1ETXA 3FM3A 3G1OA 3GXOA 3I3LA 4GYIA 1KU7A 2QQ8A 1Z3XA 1DU0A 4II2A 4YELA 4PSWA 4IZZA 2YU9J 2R4GA 2PJRB 2ZO4A 2QA4I 5E79C 2XRNA 3WTVC 5D4SA 4C9YA 1Z6TA 2M8GX 4BUPA 3ULQB 2LNBA 3LSHA 2ZJ2A 4ENMA 3VYRB 2RAEA 1D5VA 1WH7A 2EPFA 4CHUA 2BW3B 2F2EA 2H1LA 1BR2A 2E1MB 4DJAA 2M45A 1SVMA 3G1MA 1MZBA 2QSFX 2YX4A 4E70A 4CZCA 3HC7A 1HKQA 2HWVA 4WXDA 2NVYJ 2ME0A 4IOCF 2HOAA 5HLIA 1R5GA 3OR2C 1SAUA 1KGSA 1B8IA 1L0OC 1WPKA 1T8IA 4ZDPA 3FKJA 3JAMK 1R4NB 2R7RA 2LH9A 3D1NI 1Z6RA 3HZJA 2O8KA 3I54A 1JTXA 1X1BA 4BXFA 1EH7A 5HLTA 2EV0A 1HC8A 3FWEA 2GXAA 3I53A 5F6FA 3GFLA 5DUKA 2FJ1A 4M71A 2GBYA 2BXZA 3S17J 2CFOA 3S32A 3G6EI 2DOEA 2VJ5A 4NB5A 1K4TA 2BXYA 2F4OB 4IHXA 1E3OC 2XPUA 3WODF 3OSFA 3ASNH 3CJTB 1GUUA 3VYSB 2WWYA 2IGMA 5DD8A 1SD5A 4IL6C 1E2XA 1T0FA 2V9PA 3HB9A 3ZMTA 3Q3SA 1HOMA 5BPDA 2EK5A 5GTHC 2FQ3A 3K4CA 3LMMA 4FX0A 1X3WB 2E2IJ 2E19A 2K9QA 2CO5A 3A01B 2ZNYA 3LSJA 5CVJA 2VT2A 4N9HA 1IV6A 3SXYA 1R7JA 1TW2A 3SJMA 2NOJB 2DLLA 4CYCA 3SZTA 1W0UA 3GBGA 4M3GA 2J5OA 3M8FA 5F0CA 4PJNA 2VE8A 2RKHA 2GIZA 4NBQA 4C3IJ 4ZZDA 1AOYA 1Y8QB 3C1DA 4BEHA 4XMYA 4D0PA 2LTPA 2D1HA 1R23A 3E97A 3P9KA 2A6TA 1OKRA 2G7HA 2W4SA 2FNAA 4PFPA 1GV5A 4U7DA 2FE3A 4IOAF 3FK7A 5GPCA 1P7JA 2FXAA 3GO5A 2L7ZA 2LSOA 2K85A 5B3SH 3DPUA 5D5WB 1YX3A 2EFPA 3IWZA 2LBFA 5J1YA 2A07F 2QKLB 1XB4A 5EZHA 4C30A 2H94A 1XX5A 3KYDB 1MBFA 1VQ8I 1TWHJ 2MH2A 2OQRA 4CCOA 1S7AA 4FE7A 4KN7X 4RAGA 2VQGA 3E6MA 3LQQA 2ZJQF 3RI4A 2LC2A 2Q8KA 3ZQLA 3HL2A 3HUGB 2HU9A 4DYQA 1AHDP 1SFOJ 2KJBA 5EYRA 5TGTA 5ICGA 2GOXB 1MDMA 1U9OA 1YITI 1JJ8C 1UHWA 1SMTA 3U9GA 5HLHA 2L9VA 3CMMA 3E6BA 2O0YA 4XNFA 4IX7A 1J75A 2VOPA 1DP3A 2E71A 3I71A 4MHGA 4EGYA 4L5EA 1X1AA 3GFIA 2DT7B 1GXQA 4IPAA 3WG7H 2P5VA 2V7FA 2CW8A 2RV8A 3F22A 3MZHA 4LITA 4KYWA 2M30A 3ZMZA 4Y13A 2CGPA 5C4XJ 3HOSA 3L2QA 3CLQA 3H5RA 1FIPA 1ZG5A 3N4MA 5A2QK 1NG6A 1FTTA 3CJQB 2CUFA 3BCAA 4A0YA 3BCBA 2LKPA 4GDFA 2IVMA 2ZMEC 2PMZN 1YS7A 4BJTA 2XKOA 1O57A 1UB9A 2MGQA 2COMA 3WG9A 1OFCX 4GXOA 4HDUA 2HXOA 2HDDA 4QIWN 1A35A 4P96A 5HDGA 2IGNA 2H6CA 3WTWC 3HRTA 4MFEA 2FX0A 3F8FA 1OCPA 1KQ0A 1Y39A 4A5NA 3K9TA 2VBZA 5HS9A 1ZGAA 2NOGA 1T95A 4NUBA 2DDAA 3ISPA 5HS8A 3CMAI 1EKEA 3PNYA 4RGRA 1WI9A 2JSPA 2HYFA 2F4IA 1J9IA 5KAIC 5FKLA 1MNEA 2VBXA 3KEYA 2QSHX 3QWLA 5LRSA 4KIBA 3MQ0A 2KKOA 2P0WA 3K4MA 2JVGA 2XB5A 5KHDA 1FJLA 2HZDA 4DNCA 2V4JC 4E7SA 2E7XA 5J40A 2JVHA 3EYYA 1YRNA 2NNNA 1YW7A 2CU7A 4DIQA 5LEJA 2OCEA 2ELJA 1D1CA 1EA3A 1SAXA 1A04A 2QQAA 1VTNC 4B8XA 3F6VA 1ZTRA 1I1SA 2Y9YA 2IA0A 2D2WA 2FBHA 3GZ5A 2QENA 1B9MA 1SVOA 1N25A 5L3BA 1UZCA 2DBBA 4UUTA 3IH3A 5EJCA 4XLPF 3JTHA 3AL0B 2JWTA 2KRFA 4ZYHA 3FMRA 3ZQ7A 4OAYA 1OR7A 3I59A 3K4KA 1V5GA 3CTAA 3WU0A 1I6HJ 1O7LA 4HF0A 4G6DA 3K70D 2K27A 2X6YA 3C2HA 2Y31A 1WJAA 2V1XA 3QODA 2XRLA 5IT9K 3JAMZ 1FEXA 2D1VA 1T08B 5C4JJ 3NARA 4L18B 4KISA 4WWCA 2BZTA 3Q9SA 1EF4A 5J3LA 3CCQI 5JLXA 2BVLA 1XSDA 5J1UA 2KISA 3PFYA 2IRFG 2P81A 2VUMJ 3C7JA 4W97A 1FLIA 4RM2A 3GLXA 1IN6A 1IW7F 1JHFA 1R00A 1TNTA 3QPSA 5IP6A 3LSTA 3JRDA 2E5ZA 1ZREA 3CDLA 2MYSA 1K78A 3BR6A 1HF0A 2HPIA 3LSGA 3BG9A 1ZGWA 3HTUA 2HQNA 4R8HA 4EJVA 1YJ9I 2LFBA 1I27A 2W7NA 3SDGA 2LF7A 3CCUI 4BJ6C 5B5EC 3L2VA 4BACA 3FXUA 1MBJA 1UHSA 3ELKA 3GVAA 1ZYRF 2AXTC 2ZB9A 3LA7A 4XRSA 2DMQA 3FHNA 2M0MA 4L0YB 2M0CA 3MEXA 3CCYA 4OMZA 2EFNA 2VKDA 2GXBA 3BG5A 5FROA 3I56I 4A3IJ 4C3JJ 3I9V2 4BJ5C 2AXLA 1OCTC 5GPAA 5ICEA 1TWAJ 4A3BJ 3RKWA 2L0KA 2H1KA 5BS6A 3IRQA 3PJRA 2JA7J 2O03A 3FDYA 3AKZA 2LLKA 3KFWX 1FIAA 1XD7A 2IJLA 2JSCA 2KLOA 3FXKA 4M3EA 3CUQA 1ZLJA 4YG2F 5CQEA 4AU7A 3LAPA 3I4PA 4JQFA 2JRMA 3OYEA 4U0YA 5IT3A 2HZTA 1SMYF 5B1AH 4UY8I 1AA7A 2BBYA 1FWZA 4CCLA 2P5LC 3J81K 2C6YA 1W7PA 1R5ID 1STZA 2PEXA 1MBKA 3ABKH 3BR2A 3CP2A 4N4OB 3L7WA 5E8GA 2H8RA 4LB5A 3FM5A 1BBYA 2DCEA 5L3DA 3HTSB 3K4BA 4Y17A 2HPMA 2UXNA 2KT0A 1XMXA 4BQNA 4M74A 5DS9A 3H35A 4XQFA 5LLQA 2OV7A 4E6KG 2COBA 2HYJA 1LDJA 5D5XB 3T8TA 3JW4A 1YE9A 3HJEA 3G4SI 4CCKA 3CC4I 2EA2A 4FTHA 3QPTA 2DA3A 4AC0A 2M4KA 3C2BA 1XDSA 1ZLKA 3HGYA 5FKMA 5IOZA 3AAFA 1BI2A 4ZC3A 4F55A 4OIQF 4B44A 2NNYA 3MKZA 4RGXA 2DYRH 3H9GA 4IF4A 2L02A 3J7YJ 2JMWA 4LOCA 4LLGF 3KX2A 1H88C 1HLVA 1U5TA 4XORA 1HW2A 2ESNA 1YG2A 2GQQA 1XDUA 2FU4A 3J80K 2XGCA 1IXRC 2QGUA 3K4LA 4WXCA 1IRGA 3AG2H 3ML6A 3BR3A 1S72I 3C3WA 4J01A 3S8PA 4A12A 2KMUA 2K9SA 3GTMJ 2R7ZJ 1HA8A 1LNWA 4KITB 4V2FA 3FXLA 4JX5A 2MLKA 1AU7A 4UNOA 3VDXA 3TP0A 1B8IB 2DU9A 3FIWA 5H2FC 4YRVA 2F5EA 2R7WA 4I6ZA 3KP4A 5GADJ 4IHTA 1TQPA 3IKVA 1WI3A 1SFEA 1BR1A 4RMNA 1GVJA 4JX4A 2QM3A 3OSGA 1UG2A 1VQ5I 2KFDA 1Y1WJ 2FMLA 2P4WA 2JK3A 2ZXJA 3NWSA 3OYFA 3MCZA 2F48A 4DZPA 3CMEI 4HOBA 2BHZA 4A3FJ 1USSA 3QU3A 2OA4A 2GZWA 2RGVA 3IP4B 4H4KC 3I5UA 4ON0A 4AVZA 4BBRJ 4QTRA 3EQLF 5ICFA 2VI6A 3M07A 3PQJA 2R5YA 1D8JA 4HYEA 4MLOA 2R3SA 5K7ZA 3F3XA 1OYYA 4Y15A 5IT9Z 3LSRA 3A4CA 3BY6A 4XRMA 3AG4H 3LSPA 3SFIA 1MMGA 2E1CA 2CQQA 4A3MJ 3MKYB 4HNTA 5HLGA 3QAHA 3HRSA 4CSWA 5LGNA 2LKXA 1SFXA 4BEHB 5GTIC 2YX7A 1JUMA 4L5JA 4XSXF 3WU2C 5J8CA 4BXUA 3MWMA 1D8KA 2ECCA 2HI3A 4HLYA 2R7TA 2K5CA 2A3SA 3JRGA 4Y52J 2ZFUA 2Z9OA 3LL7A 3V7SA 2H27A 3R61A 2BEOA 2HDCA 3ZOBA 3L00A 1MKMA 3HSFA 4M3FA 2N8GA 5D5UB 2LBFB 2CV2A 3FX3A 4RB1A 1KYWA 2EFWA 1V5EA 2M1BA 3JRAA 2EBIA 4XSZF 4BY7J 2XGDA 2BE5F 4AM3A 4NQWA 2K02A 3TL4X 2Z5UA 3OIOA 4HF1A 3MZ8A 4HV5A 4KJZA 3G3ZA 2VL8A 5IY5H 2FF4A 3NRVA 1G3TA 3NQOA 1REPC 1ZKGA 4BE2A 3LFKA 2V1UA 2ELKA 2PFBA 4JP0A 2G7UA 5K7HA 4WK8F 2W84A 2L9SA 2CYYA 1ETQA 1WH5A 2Y75A 1J0RA 4PJJA 1PUFA 2K9NA 2CV0A 2XAUA 1F36A 1ZELA 2WV0A
chains in the Genus database with same CATH topology
3WGIA 1QNTA 2QBYA 1T39A 2FMYA 4PCQA 1F1ZA 4Z2YA 1LDDA 1ON2A 4GCVA 1P6RA 3NEUA 2JPBA 1HBXG 3LAJA 1T2KA 4L9NA 5FLXZ 2K4BA 4CGZA 4GGGA 5HVQC 1SD7A 1RUNA 3FF5A 1S3JA 3R60A 3J81Z 1FBUA 2XGXA 5EEHA 4HX7A 4RB2C 4AIJA 2W85A 3ROUA 1G3WA 4B09A 4LD5A 2PLYA 4OIPF 5DCMA 5DD4A 3QP5A 5CVUA 1W4MA 2W24A 1WWXA 3SHFA 1SD4A 5BPIA 2VC1A 1HXDA 5LHHA 2L4AA 5F64A 1Z1DA 3E5XA 1HW1A 5D6FA 3QU6A 1S29A 2P6TA 3TKYA 1O3SA 4IHSA 1Z91A 2EA4A 1LEAA 1IN4A 2PG4A 4EGZA 4H0EA 3G73A 4HX4A 2STTA 2XVCA 5FGMA 2HKOA 4OINF 3HHGA 2HKXA 2EJRA 4PDKA 1Y0UA 2HEOA 4M72A 4WX9A 1IAWA 5CYVA 2O8XA 2R7DA 2HTJA 2FOKA 2HQRA 3RTRA 2ZMEA 3R6SA 1JHHA 4YIIA 3ECHA 4M9SA 1TBXA 3IKTA 3DP7A 2PQ8A 2PMUA 5HS7A 2P6SA 2ZBKA 1PP8F 3IHUA 1G3SA 3WE2A 4WXHA 4O6JA 2RN7A 2K4JA 2KIUA 2WTEA 2ACJA 2FA5A 5D8LB 5E8IA 1TQMA 5ILSA 1GXPA 2XROA 1ZN2A 3WGHA 1K78B 3MFKA 3K1NA 4KMFA 1V3FA 2TDXA 2EV5A 3ZMVA 2IT0A 3HRMA 5D8KB 2MD5A 4P5OA 2H6BA 4LGWA 3RKXA 1BJAA 3S2WA 1X3UA 2HFHA 5L3FA 1QBJA 1KQ9A 5KK1A 5JI6A 2AS5F 3E6DA 4BHBA 5J8FA 3M7GA 3V4GA 5ERIA 2VOOA 3P9IA 2EWNA 4L0ZB 4UHTA 2ISZA 1AWCA 2XUBA 3ECOA 2CG4A 4KDPA 2VONA 1XMKA 4ZH4F 2EFOA 1UHMA 1W7PB 5LBQA 4Q48A 4G7OF 1FOKA 1ZRCA 2F5DA 1XN7A 4A0ZA 5D6EA 2QLZA 3DKWA 4IRHA 5FO5A 4AIHA 1W7PD 4HAMA 3GFMA 4P9FA 3BDDA 4K2EA 4KICA 3EETA 2KIMA 1WKMA 3RPUA 3SFZA 3FHZA 3KP5A 5AIPA 3LQRA 1IN8A 2DAOA 3F72A 4KIFA 1BOAA 3VEPA 2KIFA 3HOTA 1BI1A 4UVAA 4JK1X 4A5MA 3QP6A 1O3RA 3ZMDA 1SD6A 3K0LA 1I6XA 3WTUC 1TNSA 2VC0A 2Z3YA 2R7FA 2FBIA 3F8MA 1CGPA 3GYHX 4M9XA 1XGOA 1ZHFA 1P4XA 3QPHA 2CSOA 3Q9VA 2CW0F 2HYGD 2DI3A 2MA3A 1FX7A 3FZVA 4ESJA 4LFUA 4LK1F 2DPUA 2BV6A 1OYIA 2GAUA 5E18F 1YO5C 2OAZA 4EJTA 4UUVA 5ILUA 3IC7A 1FC3A 1FYKA 3HSEA 4ESBA 4PGGA 3E5QA 4Q5SF 4MTEA 2HTSA 3WTYC 1T38A 2XKPA 1T6SA 3I0TA 4ZYDA 2FSWA 1H9GA 5J6XA 1FYLA 5BMZA 2M5WA 4L9JA 4M9ZA 2GA1A 4UVBA 1HQCA 5LHIA 3CO6C 3F21A 2HR3A 4HV6A 4A2UA 2RQPA 1JXSA 2B0LA 1P92A 4M6XA 4ESFA 1QZYA 5ICCA 5AONA 4BNCA 1RIOH 1ZH5A 1FNNA 1YS6A 1ON1A 1USTA 2QBYB 1HKTA 1U3EM 3ZP5A 4XRFA 3MZYA 1P2FA 1H0MA 1FSHA 4A0XA 3DPTA 1S6LA 4CO8A 2DFIA 1DP7P 1S8NA 2ISYA 5TRDA 2M8EA 1BN5A 2BGCA 3TOBA 2BYVE 1E17A 2IPQX 2HGCA 2RC4A 1ONVA 4A6DA 2W57A 4OOIA 3BZ6A 4CDGA 1HSJA 2XAQA 3KCCA 4LLLA 4ENNA 3FMQA 4GYGA 2JTVA 4LK0F 4HQEA 4CXFA 2NS0A 3BJAA 4R79A 1ZARA 1QGPA 2K7LA 2WC2A 4RB3C 2XHKA 1NHAA 1J5YA 1EH8A 5FFZA 2L01A 4I98B 4M6YA 4HX8A 1IN7A 1U78A 1KU3A 4I02A 3W6KB 1T98A 5TJJA 3HUGA 5A2QZ 4A6EA 3LA3A 4EM2A 1TQIA 4HBLA 1G4DA 3WTTC 1DPUA 1FBQA 4QLCU 3OV8A 2CFXA 4BQAA 4IVNA 2O6GE 3L9FA 2OD5A 5ILVA 3KE2A 4G7ZF 2OBPA 2ZMEB 3TQNA 3GEZA 2YR2A 4LMYA 2A6HF 1MGTA 4S04A 3ZMUA 3V8JA 5HOOA 1J2XA 3GFJA 4HZFA 4OIOF 2ZNZA 1LQ1A 4I7HA 3W6JB 3TDZC 2LDUA 3J7AO 2QQ9A 2GA2A 4OIRF 1XSXA 2Z33A 3CJNA 1LDKB 5LRRA 2A68F 3TO6A 4IRIA 4RAYA 1MJBA 1R1TA 3WTZA 2QZ8A 3CO7C 4RGUA 3C18A 2ELHA 4LJZF 3BJOA 3DXJF 1Z7UA 3GX4X 1JE8A 1BIAA 2VODA 1H9TA 3EUHA 4G6QA 1XCVA 3WGGA 4NHJA 3RDIA 5JHUA 4KUMA 3K1PA 2GIVA 3TDUC 2V79A 5K5QA 1TW3A 4O5VA 1YYVA 1WQ2A 2G9WA 1WRJA 4FHTA 1O3TA 1YLFA 4KMUX 3F8CA 3KETA 2PBIA 3BOQA 4KT5C 4QWQA 2PJPA 4MQ9F 4JBAA 3L2CA 5DCFA 3O3KA 1LEBA 4LG0A 1R5HA 1L3LA 1IXSB 1MDMB 3DFGA 3JSOA 2D45A 5K5OA 1OYWA 4WF2A 4G94A 2P8TA 4UVCA 1IN5A 3PFIA 4ENKA 3QRFF 4CICA 3HIFA 1BM9A 3CLOA 2A5YB 4IXAA 2XASA 1KA8A 4MEYF 2FRHA 4XBFA 5BQTA 4I2OA 1IF1A 3VOEA 5JR3A 3WU1B 1BI3A 1YTYA 4MQVA 1S7OA 3MAJA 2XAGA 2NRAC 3D0SA 2VXZA 1B4AA 1I1GA 5E1WA 4P55A 5CVRA 1ODDA 2V6CA 1IZ1A 1BC8C 4MGRA 3VODA 3KP6A 5F1RA 1UCRA 2RVCA 4KA4A 4L9TA 4YIFA 3P7NA 4PZJA 1FBSA 4FX4A 3DQVC 1XCBA 3J80Z 2Y48A 3BROA 1YW9A 1U2WA 3I59B 3COAC 1QQIA 1MD0A 2EV6A 2A69F 2J5PA 1YW8A 1D3YA 3VB2A 4G9YA 2QYOA 4WCGA 4BAYA 1FSEA 2P5KA 3RKYA 1YIOA 3SQNA 2F5FA 3EYIA 2IW5A 2MC3A 5DV5A 1ZG3A 4EQQA 1SFUA 2QUFA 1CF7A 3O2PE 4MNUA 1LVAA 3ZPLA 1EH6A 1DUXC 1RNLA 1ZAOA 1B9NA 5EEGA 2VN2A 2ZKZA 2DQRA 3WTXC 2H09A 4KNYA 2MBFA 1B6AA 4UV9A 5CLSA 2VBYA 3V7RA 4P9UA 4AVPA 5DYMA 3GUDA 3O6BB 4PGHA 2DK5A 2RNJA 2Q2EA 3FXQA 5D5VB 2XV4S 5H6QA 3GZ6A 3IWFA 3KZYA 1IUYA 3CUQB 2PN6A 4EMSA 3M9AA 3JSPA 4R1HA 3JTGA 3V7CA 3LA2A 4L5IA 3ZN0A 4OMYA 4RB0A 4YFKF 4RS8A 4EM0B 1KYZA 3KP7A 3H3UA 1F9NA 6PAXA 1Z05A 1PUEE 2MH9A 1QPMA 5L3GA 1KQ8A 2Q0OA 4U0WA 2JZYA 4YFNF 2DK8A 4M73A 1FT9A 2DQLA 3KP3A 2HS5A 4UV8A 4TV7A 5HDNA 5DDGA 5D4RA 4BHPA 1XMAA 1OPCA 1XGSA 4ZYGA 4EJUA 4BYYA 2K86A 3R4KA 1UFMA 1BC7C 5JVTA 4CYDA 1U5TB 1HW5A 3T0YA 2E7WA 4S05A 5FB2A 5LHGA 4YFXF 1XGMA 3H3ZA 3ABUA 1QZZA 2DW4A 2YU3A 4HF2A 4N9IA 3DEUA 3HSRA 3F8NA 2ESHA 3TGNA 1K6OA 2HOEA 3I58A 3KLNA 5DEQA 3TOAA 1EV7A 1RI7A 3KEQA 5BOXA 5E1ZB 1U8RA 3U2RA 2A6EF 2ADUA 1F4KA 1FPQA 2A61A 2DO7A 2DTRA 3REOA 3KP2A 2VT3A 5L3CA 5JFRA 4G7HF 4Q47A 1ZRDA 1MJ9A 4U88A 3KLOA 4MEXF 1B1BA 3FXRA 2O61A 4AIKA 1HSTA 1U6GA 3HYIA 4O3MA 4ENJA 4EM1A 1G3YA 2O3FA 1IRFA 4ETSA 2DPDA 4HW0A 1FYMA 2XAHA 3L09A 2P7VB 3TO7A 2ETHA 1PDNC 3M1EA 2MLGA 4LG0B 4F7ZA 4AWXB 4I0BA 1QO0D 4GO1A 2YPRA 2UWMA 3SZPA 4G8XA 4KFCA 4N0BA 3QOPA 1R58A 3M8EA 3H92A 4I01A 5K1YA 1O3QA 2IP2A 2E1NA 3HHHA 1BIBA 4KN4X 1F5TA 2L3DA 2L4MA 3GW2A 4I0AA 3RYRA 1YQAA 2CQKA 5E17F 3DPLC 1W5TA 3V8KA 1C0WA 3BWGA 5DCMB 1O7FA 4CZZA 3OOPA 3ZN1A 3K2ZA 3IL2A 4IRGA 1K79A 1P4AA 1TTYA 3I64A 5FLXK 2KJCA 3P9CA 1LJ9A 4Q4ZF 2JRTA 4HLXA 5L3EA 4IJAA 1FZPB 3F8BA 1Q1HA 1B59A 5ED4A 4XLNF 2LF8A 5FD5A 4EVIA 2NAZA 1FP2A 1LB2A 2JPCA 3DV8A 1HKSA 3BJ6A 3RYPA 4EJWA 5DUIA 2OU2A 2FBKA 3LWFA 4LB6B 2DT5A 5AIQA 3Q5FA 1RUOA 5K5RA 2XIGA 5CVIA 2W25A 1V4RA 1KU9A 3KZZA 3B73A 5CJ9A 4OU0A 2P7CB 2Y0MA 1XSVA 4EV0A 3BPXA 3ABTA 1RZ4A 3B02A 3GF2A 3CUOA 4RAZA 3DF8A 1R1UA 5LEKA 1CF7B 1IXCA 3WE3A 3V8LA 2YSRA 2OQGA 2OZUA 3K69A 1ULYA 5H20A 4ASNA 2EB7A 1P4WA 3EDPA 3PQKA 2FEZA 4MTDA 2STWA 3T8RA 2NYXA 1MJAA 5H6RA 1K7AA 4EJOA 2V9VA 4L9VA 1DDNA 4I09A 3U1DA 3ERED 2JT1A 3E3VA 4UXNA 3RIRA 2QWWA 1KU2A 1R36A 4HDVA 3T5XA 3R0JA 3R0AA 1J59A 2F5CA 3VFZA 1FY7A 4AD9A 1DPRA 1WSUA 4RGSA 3CUQC 2ZFWA 2M87A 1R22A 2IA1A 3E5UA 2CWEA 2VBWA 1G6NA 2X4HA 1ZRFA 1GHCA 4HA8A 2XAJA 3N97A 3K1MA 4BH9A 5HDKA 1TLHB 3IRRA 1ZGJA 2L54A 3E6CC 2V1DA 3RJPA 4KIGA 1BI0A 3ZMSA 3WTSC 1XGNA 3TO9A 5FD6A 2FNPA 2Z99A 2IA2A 1OMIA 3GWZA 2ZCWA 1PP7U 1JGSA 4FT8A 2QQBA 1FP1D 2GXGA 5CVVA 2GWRA 4DQ2A 2QVOA 4U7BA 1U5TC 1W5SA 1Z9CA 5FFXA 5E20A 2X0LA 3T1BA 2UXXA 5LGUA 1YFHA 3BPVA 4HQMA 4BHCA 3CDHA 2UZKA 3RPQA 2PMHA 5E1XA 1R1VA 2RDPA 4LLNA 3D5LA 3FMSA 1J7KA 2EFQA 3HRUA 3F6OA 2OZ6A 3BP8A 4ZZLA 4U0VA 5LGTA 3F23A 5KVRA 1I5ZA 2VE9A 3KEOA 4ZYEA 2XAFA 2PI0A 3FM3A 3GXOA 4GYIA 1KU7A 2ZO4A 2XRNA 3WTVC 5D4SA 1Z6TA 3ULQB 2LNBA 2ZJ2A 4ENMA 1D5VA 4CHUA 2F2EA 2M45A 1MZBA 2YX4A 4E70A 1HKQA 2HWVA 4WXDA 5HLIA 1R5GA 1KGSA 1L0OC 3JAMK 1Z6RA 3I54A 1EH7A 2EV0A 3FWEA 3I53A 5F6FA 3GFLA 5DUKA 4M71A 4NB5A 3WODF 2WWYA 5DD8A 1SD5A 1E2XA 1T0FA 3ZMTA 5BPDA 2EK5A 2FQ3A 4FX0A 2CO5A 2ZNYA 5CVJA 2VT2A 4N9HA 3SXYA 1R7JA 1TW2A 2DLLA 3SZTA 2J5OA 3M8FA 2VE8A 2RKHA 4ZZDA 1AOYA 3C1DA 4D0PA 2D1HA 1R23A 3E97A 3P9KA 1ZG1A 1OKRA 2G7HA 2FNAA 4U7DA 2FE3A 2FXAA 3GO5A 2LSOA 5D5WB 2EFPA 3IWZA 2A07F 1XB4A 2H94A 2MH2A 2OQRA 1S7AA 4KN7X 3LQQA 3E6MA 3RI4A 2Q8KA 2KJBA 5ICGA 1MDMA 1UHWA 1SMTA 3U9GA 5HLHA 3E6BA 2O0YA 1J75A 2VOPA 3I71A 4MHGA 4EGYA 3GFIA 1GXQA 4IPAA 2P5VA 2RV8A 3F22A 3MZHA 4KYWA 2M30A 3ZMZA 4Y13A 2CGPA 3HOSA 1ZG5A 3N4MA 5A2QK 4A0YA 2LKPA 2IVMA 1YS7A 2XKOA 1O57A 1UB9A 3WG9A 2COMA 4GXOA 4HDUA 4P96A 5HDGA 2H6CA 3WTWC 3HRTA 3F8FA 1KQ0A 4A5NA 3K9TA 2VBZA 5HS9A 1ZGAA 3ISPA 5HS8A 4RGRA 1WI9A 2HYFA 1J9IA 2VBXA 5LRSA 4KIBA 3MQ0A 2KKOA 4DNCA 2E7XA 3EYYA 2NNNA 1YW7A 5LEJA 1SAXA 1A04A 2QQAA 1VTNC 4B8XA 3F6VA 1I1SA 2IA0A 2D2WA 2FBHA 3GZ5A 2QENA 1B9MA 5L3BA 2DBBA 4XLPF 3JTHA 2KRFA 4ZYHA 3FMRA 3ZQ7A 1OR7A 3I59A 3CTAA 3WU0A 1O7LA 4HF0A 4G6DA 2K27A 2V1XA 5IT9K 3JAMZ 2D1VA 4L18B 4WWCA 3Q9SA 1XSDA 2IRFG 3C7JA 1FLIA 3GLXA 1IN6A 1IW7F 1JHFA 1R00A 1TNTA 3LSTA 1ZREA 1K78A 3HTUA 2HQNA 4R8HA 4EJVA 1I27A 2LF7A 3FXUA 3ELKA 3GVAA 1ZYRF 3LA7A 4L0YB 3MEXA 4OMZA 2EFNA 2GXBA 2AXLA 5ICEA 3RKWA 5BS6A 3IRQA 2O03A 3KFWX 2IJLA 1XD7A 4YG2F 2JSCA 3CUQA 1ZLJA 3LAPA 3I4PA 4JQFA 4U0YA 5IT3A 2HZTA 1SMYF 2BBYA 1FWZA 2P5LC 3J81K 2C6YA 1W7PA 1STZA 2PEXA 3L7WA 5E8GA 4LB5A 3FM5A 1BBYA 5L3DA 3HTSB 4Y17A 2UXNA 4M74A 5LLQA 1LDJA 5D5XB 3T8TA 3JW4A 2EA2A 3QPTA 1XDSA 1ZLKA 3AAFA 1BI2A 4OIQF 2NNYA 4RGXA 4IF4A 2L02A 4LLGF 1U5TA 1HW2A 2ESNA 1YG2A 2GQQA 1XDUA 2FU4A 3J80K 1IRGA 1IXRC 4WXCA 3ML6A 3C3WA 4A12A 1LNWA 2MLKA 4UNOA 2DU9A 2F5EA 3KP4A 4IHTA 1TQPA 3IKVA 1SFEA 1GVJA 2QM3A 2FMLA 2P4WA 2ZXJA 3MCZA 4HOBA 1USSA 3QU3A 2OA4A 2GZWA 2RGVA 4ON0A 3I5UA 3EQLF 5ICFA 3PQJA 1D8JA 4HYEA 2R3SA 3F3XA 1OYYA 4Y15A 5IT9Z 3BY6A 2E1CA 5HLGA 3QAHA 3HRSA 5LGNA 1SFXA 2YX7A 4L5JA 4XSXF 5J8CA 4BXUA 3MWMA 1D8KA 4HLYA 2A3SA 2Z9OA 3V7SA 2H27A 3R61A 2BEOA 2HDCA 3L00A 1MKMA 3HSFA 5D5UB 3FX3A 4RB1A 1KYWA 2EFWA 2M1BA 4XSZF 2BE5F 4NQWA 2K02A 2Z5UA 4HF1A 4HV5A 3G3ZA 2FF4A 3NRVA 1G3TA 3NQOA 1REPC 3LFKA 2V1UA 2PFBA 2G7UA 4WK8F 2W84A 2CYYA 2Y75A 1J0RA 2WV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WGI A;  1QNT A;  2QBY A;  1T39 A;  2FMY A;  4PCQ A;  1F1Z A;  4Z2Y A;  1LDD A;  1ON2 A;  4GCV A;  1P6R A;  3NEU A;  2JPB A;  1HBX G;  3LAJ A;  1T2K A;  4L9N A;  5FLX Z;  2K4B A;  4CGZ A;  4GGG A;  5HVQ C;  1SD7 A;  1RUN A;  3FF5 A;  1S3J A;  3R60 A;  3J81 Z;  1FBU A;  2XGX A;  5EEH A;  4HX7 A;  4RB2 C;  4AIJ A;  2W85 A;  3ROU A;  1G3W A;  4B09 A;  4LD5 A;  2PLY A;  4OIP F;  5DCM A;  5DD4 A;  3QP5 A;  5CVU A;  1W4M A;  2W24 A;  1WWX A;  3SHF A;  1SD4 A;  5BPI A;  2VC1 A;  1HXD A;  5LHH A;  2L4A A;  5F64 A;  1Z1D A;  3E5X A;  1HW1 A;  5D6F A;  3QU6 A;  1S29 A;  2P6T A;  3TKY A;  1O3S A;  4IHS A;  1Z91 A;  2EA4 A;  1LEA A;  1IN4 A;  2PG4 A;  4EGZ A;  4H0E A;  3G73 A;  4HX4 A;  2STT A;  2XVC A;  5FGM A;  2HKO A;  4OIN F;  3HHG A;  2HKX A;  2EJR A;  4PDK A;  1Y0U A;  2HEO A;  4M72 A;  4WX9 A;  1IAW A;  5CYV A;  2O8X A;  2R7D A;  2HTJ A;  2FOK A;  2HQR A;  3RTR A;  2ZME A;  3R6S A;  1JHH A;  4YII A;  3ECH A;  4M9S A;  1TBX A;  3IKT A;  3DP7 A;  2PQ8 A;  2PMU A;  5HS7 A;  2P6S A;  2ZBK A;  1PP8 F;  3IHU A;  1G3S A;  3WE2 A;  4WXH A;  4O6J A;  2RN7 A;  2K4J A;  2KIU A;  2WTE A;  2ACJ A;  2FA5 A;  5D8L B;  5E8I A;  1TQM A;  5ILS A;  1GXP A;  2XRO A;  1ZN2 A;  3WGH A;  1K78 B;  3MFK A;  3K1N A;  4KMF A;  1V3F A;  2TDX A;  2EV5 A;  3ZMV A;  2IT0 A;  3HRM A;  5D8K B;  2MD5 A;  4P5O A;  2H6B A;  4LGW A;  3RKX A;  1BJA A;  3S2W A;  1X3U A;  2HFH A;  5L3F A;  1QBJ A;  1KQ9 A;  5KK1 A;  5JI6 A;  2AS5 F;  3E6D A;  4BHB A;  5J8F A;  3M7G A;  3V4G A;  5ERI A;  2VOO A;  3P9I A;  2EWN A;  4L0Z B;  4UHT A;  2ISZ A;  1AWC A;  2XUB A;  3ECO A;  2CG4 A;  4KDP A;  2VON A;  1XMK A;  4ZH4 F;  2EFO A;  1UHM A;  1W7P B;  5LBQ A;  4Q48 A;  4G7O F;  1FOK A;  1ZRC A;  2F5D A;  1XN7 A;  4A0Z A;  5D6E A;  2QLZ A;  3DKW A;  4IRH A;  5FO5 A;  4AIH A;  1W7P D;  4HAM A;  3GFM A;  4P9F A;  3BDD A;  4K2E A;  4KIC A;  3EET A;  2KIM A;  1WKM A;  3RPU A;  3SFZ A;  3FHZ A;  3KP5 A;  5AIP A;  3LQR A;  1IN8 A;  2DAO A;  3F72 A;  4KIF A;  1BOA A;  3VEP A;  2KIF A;  3HOT A;  1BI1 A;  4UVA A;  4JK1 X;  4A5M A;  3QP6 A;  1O3R A;  3ZMD A;  1SD6 A;  3K0L A;  1I6X A;  3WTU C;  1TNS A;  2VC0 A;  2Z3Y A;  2R7F A;  2FBI A;  3F8M A;  1CGP A;  3GYH X;  4M9X A;  1XGO A;  1ZHF A;  1P4X A;  3QPH A;  2CSO A;  3Q9V A;  2CW0 F;  2HYG D;  2DI3 A;  2MA3 A;  1FX7 A;  3FZV A;  4ESJ A;  4LFU A;  4LK1 F;  2DPU A;  2BV6 A;  1OYI A;  2GAU A;  5E18 F;  1YO5 C;  2OAZ A;  4EJT A;  4UUV A;  5ILU A;  3IC7 A;  1FC3 A;  1FYK A;  3HSE A;  4ESB A;  4PGG A;  3E5Q A;  4Q5S F;  4MTE A;  2HTS A;  3WTY C;  1T38 A;  2XKP A;  1T6S A;  3I0T A;  4ZYD A;  2FSW A;  1H9G A;  5J6X A;  1FYL A;  5BMZ A;  2M5W A;  4L9J A;  4M9Z A;  2GA1 A;  4UVB A;  1HQC A;  5LHI A;  3CO6 C;  3F21 A;  2HR3 A;  4HV6 A;  4A2U A;  2RQP A;  1JXS A;  2B0L A;  1P92 A;  4M6X A;  4ESF A;  1QZY A;  5ICC A;  5AON A;  4BNC A;  1RIO H;  1ZH5 A;  1FNN A;  1YS6 A;  1ON1 A;  1UST A;  2QBY B;  1HKT A;  1U3E M;  3ZP5 A;  4XRF A;  3MZY A;  1P2F A;  1H0M A;  1FSH A;  4A0X A;  3DPT A;  1S6L A;  4CO8 A;  2DFI A;  1DP7 P;  1S8N A;  2ISY A;  5TRD A;  2M8E A;  1BN5 A;  2BGC A;  3TOB A;  2BYV E;  1E17 A;  2IPQ X;  2HGC A;  2RC4 A;  1ONV A;  4A6D A;  2W57 A;  4OOI A;  3BZ6 A;  4CDG A;  1HSJ A;  2XAQ A;  3KCC A;  4LLL A;  4ENN A;  3FMQ A;  4GYG A;  2JTV A;  4LK0 F;  4HQE A;  4CXF A;  2NS0 A;  3BJA A;  4R79 A;  1ZAR A;  1QGP A;  2K7L A;  2WC2 A;  4RB3 C;  2XHK A;  1NHA A;  1J5Y A;  1EH8 A;  5FFZ A;  2L01 A;  4I98 B;  4M6Y A;  4HX8 A;  1IN7 A;  1U78 A;  1KU3 A;  4I02 A;  3W6K B;  1T98 A;  5TJJ A;  3HUG A;  5A2Q Z;  4A6E A;  3LA3 A;  4EM2 A;  1TQI A;  4HBL A;  1G4D A;  3WTT C;  1DPU A;  1FBQ A;  4QLC U;  3OV8 A;  2CFX A;  4BQA A;  4IVN A;  2O6G E;  3L9F A;  2OD5 A;  5ILV A;  3KE2 A;  4G7Z F;  2OBP A;  2ZME B;  3TQN A;  3GEZ A;  2YR2 A;  4LMY A;  2A6H F;  1MGT A;  4S04 A;  3ZMU A;  3V8J A;  5HOO A;  1J2X A;  3GFJ A;  4HZF A;  4OIO F;  2ZNZ A;  1LQ1 A;  4I7H A;  3W6J B;  3TDZ C;  2LDU A;  3J7A O;  2QQ9 A;  2GA2 A;  4OIR F;  1XSX A;  2Z33 A;  3CJN A;  1LDK B;  5LRR A;  2A68 F;  3TO6 A;  4IRI A;  4RAY A;  1MJB A;  1R1T A;  3WTZ A;  2QZ8 A;  3CO7 C;  4RGU A;  3C18 A;  2ELH A;  4LJZ F;  3BJO A;  3DXJ F;  1Z7U A;  3GX4 X;  1JE8 A;  1BIA A;  2VOD A;  1H9T A;  3EUH A;  4G6Q A;  1XCV A;  3WGG A;  4NHJ A;  3RDI A;  5JHU A;  4KUM A;  3K1P A;  2GIV A;  3TDU C;  2V79 A;  5K5Q A;  1TW3 A;  4O5V A;  1YYV A;  1WQ2 A;  2G9W A;  1WRJ A;  4FHT A;  1O3T A;  1YLF A;  4KMU X;  3F8C A;  3KET A;  2PBI A;  3BOQ A;  4KT5 C;  4QWQ A;  2PJP A;  4MQ9 F;  4JBA A;  3L2C A;  5DCF A;  3O3K A;  1LEB A;  4LG0 A;  1R5H A;  1L3L A;  1IXS B;  1MDM B;  3DFG A;  3JSO A;  2D45 A;  5K5O A;  1OYW A;  4WF2 A;  4G94 A;  2P8T A;  4UVC A;  1IN5 A;  3PFI A;  4ENK A;  3QRF F;  4CIC A;  3HIF A;  1BM9 A;  3CLO A;  2A5Y B;  4IXA A;  2XAS A;  1KA8 A;  4MEY F;  2FRH A;  4XBF A;  5BQT A;  4I2O A;  1IF1 A;  3VOE A;  5JR3 A;  3WU1 B;  1BI3 A;  1YTY A;  4MQV A;  1S7O A;  3MAJ A;  2XAG A;  2NRA C;  3D0S A;  2VXZ A;  1B4A A;  1I1G A;  5E1W A;  4P55 A;  5CVR A;  1ODD A;  2V6C A;  1IZ1 A;  1BC8 C;  4MGR A;  3VOD A;  3KP6 A;  5F1R A;  1UCR A;  2RVC A;  4KA4 A;  4L9T A;  4YIF A;  3P7N A;  4PZJ A;  1FBS A;  4FX4 A;  3DQV C;  1XCB A;  3J80 Z;  2Y48 A;  3BRO A;  1YW9 A;  1U2W A;  3I59 B;  3COA C;  1QQI A;  1MD0 A;  2EV6 A;  2A69 F;  2J5P A;  1YW8 A;  1D3Y A;  3VB2 A;  4G9Y A;  2QYO A;  4WCG A;  4BAY A;  1FSE A;  2P5K A;  3RKY A;  1YIO A;  3SQN A;  2F5F A;  3EYI A;  2IW5 A;  2MC3 A;  5DV5 A;  1ZG3 A;  4EQQ A;  1SFU A;  2QUF A;  1CF7 A;  3O2P E;  4MNU A;  1LVA A;  3ZPL A;  1EH6 A;  1DUX C;  1RNL A;  1ZAO A;  1B9N A;  5EEG A;  2VN2 A;  2ZKZ A;  2DQR A;  3WTX C;  2H09 A;  4KNY A;  2MBF A;  1B6A A;  4UV9 A;  5CLS A;  2VBY A;  3V7R A;  4P9U A;  4AVP A;  5DYM A;  3GUD A;  3O6B B;  4PGH A;  2DK5 A;  2RNJ A;  2Q2E A;  3FXQ A;  5D5V B;  2XV4 S;  5H6Q A;  3GZ6 A;  3IWF A;  3KZY A;  1IUY A;  3CUQ B;  2PN6 A;  4EMS A;  3M9A A;  3JSP A;  4R1H A;  3JTG A;  3V7C A;  3LA2 A;  4L5I A;  3ZN0 A;  4OMY A;  4RB0 A;  4YFK F;  4RS8 A;  4EM0 B;  1KYZ A;  3KP7 A;  3H3U A;  1F9N A;  6PAX A;  1Z05 A;  1PUE E;  2MH9 A;  1QPM A;  5L3G A;  1KQ8 A;  2Q0O A;  4U0W A;  2JZY A;  4YFN F;  2DK8 A;  4M73 A;  1FT9 A;  2DQL A;  3KP3 A;  2HS5 A;  4UV8 A;  4TV7 A;  5HDN A;  5DDG A;  5D4R A;  4BHP A;  1XMA A;  1OPC A;  1XGS A;  4ZYG A;  4EJU A;  4BYY A;  2K86 A;  3R4K A;  1UFM A;  1BC7 C;  5JVT A;  4CYD A;  1U5T B;  1HW5 A;  3T0Y A;  2E7W A;  4S05 A;  5FB2 A;  5LHG A;  4YFX F;  1XGM A;  3H3Z A;  3ABU A;  1QZZ A;  2DW4 A;  2YU3 A;  4HF2 A;  4N9I A;  3DEU A;  3HSR A;  3F8N A;  2ESH A;  3TGN A;  1K6O A;  2HOE A;  3I58 A;  3KLN A;  5DEQ A;  3TOA A;  1EV7 A;  1RI7 A;  3KEQ A;  5BOX A;  5E1Z B;  1U8R A;  3U2R A;  2A6E F;  2ADU A;  1F4K A;  1FPQ A;  2A61 A;  2DO7 A;  2DTR A;  3REO A;  3KP2 A;  2VT3 A;  5L3C A;  5JFR A;  4G7H F;  4Q47 A;  1ZRD A;  1MJ9 A;  4U88 A;  3KLO A;  4MEX F;  1B1B A;  3FXR A;  2O61 A;  4AIK A;  1HST A;  1U6G A;  3HYI A;  4O3M A;  4ENJ A;  4EM1 A;  1G3Y A;  2O3F A;  1IRF A;  4ETS A;  2DPD A;  4HW0 A;  1FYM A;  2XAH A;  3L09 A;  2P7V B;  3TO7 A;  2ETH A;  1PDN C;  3M1E A;  2MLG A;  4LG0 B;  4F7Z A;  4AWX B;  4I0B A;  1QO0 D;  4GO1 A;  2YPR A;  2UWM A;  3SZP A;  4G8X A;  4KFC A;  4N0B A;  3QOP A;  1R58 A;  3M8E A;  3H92 A;  4I01 A;  5K1Y A;  1O3Q A;  2IP2 A;  2E1N A;  3HHH A;  1BIB A;  4KN4 X;  1F5T A;  2L3D A;  2L4M A;  3GW2 A;  4I0A A;  3RYR A;  1YQA A;  2CQK A;  5E17 F;  3DPL C;  1W5T A;  3V8K A;  1C0W A;  3BWG A;  5DCM B;  1O7F A;  4CZZ A;  3OOP A;  3ZN1 A;  3K2Z A;  3IL2 A;  4IRG A;  1K79 A;  1P4A A;  1TTY A;  3I64 A;  5FLX K;  2KJC A;  3P9C A;  1LJ9 A;  4Q4Z F;  2JRT A;  4HLX A;  5L3E A;  4IJA A;  1FZP B;  3F8B A;  1Q1H A;  1B59 A;  5ED4 A;  4XLN F;  2LF8 A;  5FD5 A;  4EVI A;  2NAZ A;  1FP2 A;  1LB2 A;  2JPC A;  3DV8 A;  1HKS A;  3BJ6 A;  3RYP A;  4EJW A;  5DUI A;  2OU2 A;  2FBK A;  3LWF A;  4LB6 B;  2DT5 A;  5AIQ A;  3Q5F A;  1RUO A;  5K5R A;  2XIG A;  5CVI A;  2W25 A;  1V4R A;  1KU9 A;  3KZZ A;  3B73 A;  5CJ9 A;  4OU0 A;  2P7C B;  2Y0M A;  1XSV A;  4EV0 A;  3BPX A;  3ABT A;  1RZ4 A;  3B02 A;  3GF2 A;  3CUO A;  4RAZ A;  3DF8 A;  1R1U A;  5LEK A;  1CF7 B;  1IXC A;  3WE3 A;  3V8L A;  2YSR A;  2OQG A;  2OZU A;  3K69 A;  1ULY A;  5H20 A;  4ASN A;  2EB7 A;  1P4W A;  3EDP A;  3PQK A;  2FEZ A;  4MTD A;  2STW A;  3T8R A;  2NYX A;  1MJA A;  5H6R A;  1K7A A;  4EJO A;  2V9V A;  4L9V A;  1DDN A;  4I09 A;  3U1D A;  3ERE D;  2JT1 A;  3E3V A;  4UXN A;  3RIR A;  2QWW A;  1KU2 A;  1R36 A;  4HDV A;  3T5X A;  3R0J A;  3R0A A;  1J59 A;  2F5C A;  3VFZ A;  1FY7 A;  4AD9 A;  1DPR A;  1WSU A;  4RGS A;  3CUQ C;  2ZFW A;  2M87 A;  1R22 A;  2IA1 A;  3E5U A;  2CWE A;  2VBW A;  1G6N A;  2X4H A;  1ZRF A;  1GHC A;  4HA8 A;  2XAJ A;  3N97 A;  3K1M A;  4BH9 A;  5HDK A;  1TLH B;  3IRR A;  1ZGJ A;  2L54 A;  3E6C C;  2V1D A;  3RJP A;  4KIG A;  1BI0 A;  3ZMS A;  3WTS C;  1XGN A;  3TO9 A;  5FD6 A;  2FNP A;  2Z99 A;  2IA2 A;  1OMI A;  3GWZ A;  2ZCW A;  1PP7 U;  1JGS A;  4FT8 A;  2QQB A;  1FP1 D;  2GXG A;  5CVV A;  2GWR A;  4DQ2 A;  2QVO A;  4U7B A;  1U5T C;  1W5S A;  1Z9C A;  5FFX A;  5E20 A;  2X0L A;  3T1B A;  2UXX A;  5LGU A;  1YFH A;  3BPV A;  4HQM A;  4BHC A;  3CDH A;  2UZK A;  3RPQ A;  2PMH A;  5E1X A;  1R1V A;  2RDP A;  4LLN A;  3D5L A;  3FMS A;  1J7K A;  2EFQ A;  3HRU A;  3F6O A;  2OZ6 A;  3BP8 A;  4ZZL A;  4U0V A;  5LGT A;  3F23 A;  5KVR A;  1I5Z A;  2VE9 A;  3KEO A;  4ZYE A;  2XAF A;  2PI0 A;  3FM3 A;  3GXO A;  4GYI A;  1KU7 A;  2ZO4 A;  2XRN A;  3WTV C;  5D4S A;  1Z6T A;  3ULQ B;  2LNB A;  2ZJ2 A;  4ENM A;  1D5V A;  4CHU A;  2F2E A;  2M45 A;  1MZB A;  2YX4 A;  4E70 A;  1HKQ A;  2HWV A;  4WXD A;  5HLI A;  1R5G A;  1KGS A;  1L0O C;  3JAM K;  1Z6R A;  3I54 A;  1EH7 A;  2EV0 A;  3FWE A;  3I53 A;  5F6F A;  3GFL A;  5DUK A;  4M71 A;  4NB5 A;  3WOD F;  2WWY A;  5DD8 A;  1SD5 A;  1E2X A;  1T0F A;  3ZMT A;  5BPD A;  2EK5 A;  2FQ3 A;  4FX0 A;  2CO5 A;  2ZNY A;  5CVJ A;  2VT2 A;  4N9H A;  3SXY A;  1R7J A;  1TW2 A;  2DLL A;  3SZT A;  2J5O A;  3M8F A;  2VE8 A;  2RKH A;  4ZZD A;  1AOY A;  3C1D A;  4D0P A;  2D1H A;  1R23 A;  3E97 A;  3P9K A;  1ZG1 A;  1OKR A;  2G7H A;  2FNA A;  4U7D A;  2FE3 A;  2FXA A;  3GO5 A;  2LSO A;  5D5W B;  2EFP A;  3IWZ A;  2A07 F;  1XB4 A;  2H94 A;  2MH2 A;  2OQR A;  1S7A A;  4KN7 X;  3LQQ A;  3E6M A;  3RI4 A;  2Q8K A;  2KJB A;  5ICG A;  1MDM A;  1UHW A;  1SMT A;  3U9G A;  5HLH A;  3E6B A;  2O0Y A;  1J75 A;  2VOP A;  3I71 A;  4MHG A;  4EGY A;  3GFI A;  1GXQ A;  4IPA A;  2P5V A;  2RV8 A;  3F22 A;  3MZH A;  4KYW A;  2M30 A;  3ZMZ A;  4Y13 A;  2CGP A;  3HOS A;  1ZG5 A;  3N4M A;  5A2Q K;  4A0Y A;  2LKP A;  2IVM A;  1YS7 A;  2XKO A;  1O57 A;  1UB9 A;  3WG9 A;  2COM A;  4GXO A;  4HDU A;  4P96 A;  5HDG A;  2H6C A;  3WTW C;  3HRT A;  3F8F A;  1KQ0 A;  4A5N A;  3K9T A;  2VBZ A;  5HS9 A;  1ZGA A;  3ISP A;  5HS8 A;  4RGR A;  1WI9 A;  2HYF A;  1J9I A;  2VBX A;  5LRS A;  4KIB A;  3MQ0 A;  2KKO A;  4DNC A;  2E7X A;  3EYY A;  2NNN A;  1YW7 A;  5LEJ A;  1SAX A;  1A04 A;  2QQA A;  1VTN C;  4B8X A;  3F6V A;  1I1S A;  2IA0 A;  2D2W A;  2FBH A;  3GZ5 A;  2QEN A;  1B9M A;  5L3B A;  2DBB A;  4XLP F;  3JTH A;  2KRF A;  4ZYH A;  3FMR A;  3ZQ7 A;  1OR7 A;  3I59 A;  3CTA A;  3WU0 A;  1O7L A;  4HF0 A;  4G6D A;  2K27 A;  2V1X A;  5IT9 K;  3JAM Z;  2D1V A;  4L18 B;  4WWC A;  3Q9S A;  1XSD A;  2IRF G;  3C7J A;  1FLI A;  3GLX A;  1IN6 A;  1IW7 F;  1JHF A;  1R00 A;  1TNT A;  3LST A;  1ZRE A;  1K78 A;  3HTU A;  2HQN A;  4R8H A;  4EJV A;  1I27 A;  2LF7 A;  3FXU A;  3ELK A;  3GVA A;  1ZYR F;  3LA7 A;  4L0Y B;  3MEX A;  4OMZ A;  2EFN A;  2GXB A;  2AXL A;  5ICE A;  3RKW A;  5BS6 A;  3IRQ A;  2O03 A;  3KFW X;  2IJL A;  1XD7 A;  4YG2 F;  2JSC A;  3CUQ A;  1ZLJ A;  3LAP A;  3I4P A;  4JQF A;  4U0Y A;  5IT3 A;  2HZT A;  1SMY F;  2BBY A;  1FWZ A;  2P5L C;  3J81 K;  2C6Y A;  1W7P A;  1STZ A;  2PEX A;  3L7W A;  5E8G A;  4LB5 A;  3FM5 A;  1BBY A;  5L3D A;  3HTS B;  4Y17 A;  2UXN A;  4M74 A;  5LLQ A;  1LDJ A;  5D5X B;  3T8T A;  3JW4 A;  2EA2 A;  3QPT A;  1XDS A;  1ZLK A;  3AAF A;  1BI2 A;  4OIQ F;  2NNY A;  4RGX A;  4IF4 A;  2L02 A;  4LLG F;  1U5T A;  1HW2 A;  2ESN A;  1YG2 A;  2GQQ A;  1XDU A;  2FU4 A;  3J80 K;  1IRG A;  1IXR C;  4WXC A;  3ML6 A;  3C3W A;  4A12 A;  1LNW A;  2MLK A;  4UNO A;  2DU9 A;  2F5E A;  3KP4 A;  4IHT A;  1TQP A;  3IKV A;  1SFE A;  1GVJ A;  2QM3 A;  2FML A;  2P4W A;  2ZXJ A;  3MCZ A;  4HOB A;  1USS A;  3QU3 A;  2OA4 A;  2GZW A;  2RGV A;  4ON0 A;  3I5U A;  3EQL F;  5ICF A;  3PQJ A;  1D8J A;  4HYE A;  2R3S A;  3F3X A;  1OYY A;  4Y15 A;  5IT9 Z;  3BY6 A;  2E1C A;  5HLG A;  3QAH A;  3HRS A;  5LGN A;  1SFX A;  2YX7 A;  4L5J A;  4XSX F;  5J8C A;  4BXU A;  3MWM A;  1D8K A;  4HLY A;  2A3S A;  2Z9O A;  3V7S A;  2H27 A;  3R61 A;  2BEO A;  2HDC A;  3L00 A;  1MKM A;  3HSF A;  5D5U B;  3FX3 A;  4RB1 A;  1KYW A;  2EFW A;  2M1B A;  4XSZ F;  2BE5 F;  4NQW A;  2K02 A;  2Z5U A;  4HF1 A;  4HV5 A;  3G3Z A;  2FF4 A;  3NRV A;  1G3T A;  3NQO A;  1REP C;  3LFK A;  2V1U A;  2PFB A;  2G7U A;  4WK8 F;  2W84 A;  2CYY A;  2Y75 A;  1J0R A;  2WV0 A; 
#chains in the Genus database with same CATH topology
 3WGI A;  1QNT A;  3CCL I;  1RET A;  4BE0 A;  2WV1 A;  1T39 A;  2QBY A;  3A1Y A;  2FMY A;  4D5F A;  4D7N A;  4PCQ A;  1VQ9 I;  1F1Z A;  1QHH D;  4Z2Y A;  5IPA A;  5J4Y A;  1RR8 C;  1LDD A;  2CQX A;  3IAM 2;  1ON2 A;  4G12 A;  3HOW J;  4GCV A;  1P6R A;  3NEU A;  2JPB A;  4E7J A;  2X51 A;  1HBX G;  3LAJ A;  1T2K A;  4L9N A;  3QOE A;  5FLX Z;  2ICW G;  2JA6 J;  2K4B A;  4CGZ A;  4GGG A;  5HVQ C;  1SD7 A;  3AG1 H;  3O8H A;  1RUN A;  3FF5 A;  4B47 A;  2R0Q C;  1S3J A;  2VIX A;  3R60 A;  3J81 Z;  4IQJ A;  2DA7 A;  1FBU A;  2XGX A;  3CF2 A;  5EEH A;  4HX7 A;  4RB2 C;  4AIJ A;  2W85 A;  4DBR A;  3ROU A;  1G3W A;  4B09 A;  1D1B A;  4LD5 A;  3JCU C;  4D7M A;  3AG3 H;  4F91 B;  2XPV A;  3OYC A;  2PLY A;  4OIP F;  5DCM A;  2WAF A;  5DD4 A;  1PYV A;  1X2N A;  3QP5 A;  5CVU A;  1TC3 C;  1W4M A;  2W24 A;  4B1R A;  3GTG J;  2LY1 A;  1WWX A;  1Z21 A;  3SHF A;  4CH7 A;  4QSH A;  1SD4 A;  5BPI A;  2VC1 A;  1HXD A;  5LHH A;  2L4A A;  5F64 A;  1Z1D A;  3E5X A;  1HW1 A;  4I76 A;  2X9D A;  5D6F A;  3QU6 A;  1S29 A;  4DBQ A;  1X58 A;  2P6T A;  4D1Q A;  3TKY A;  5CPR B;  1WGX A;  1O3S A;  2NVT J;  2Z1D A;  4IHS A;  1Z91 A;  2EA4 A;  2VKH A;  1W5C C;  1LEA A;  1VFC A;  1IN4 A;  1TP4 A;  2PG4 A;  4V19 K;  4EGZ A;  2VPL A;  1E3H A;  1HDP A;  4H0E A;  3ZXS A;  3G73 A;  4HX4 A;  1BW5 A;  2STT A;  2XVC A;  3UNG C;  2E35 A;  4BL0 B;  2X85 A;  5FGM A;  4RLQ A;  2HKO A;  4OIN F;  3HHG A;  5KNL A;  2HKX A;  2EJR A;  4PDK A;  1Y0U A;  2HEO A;  4M72 A;  1U8B A;  4WX9 A;  3GTO J;  2R92 J;  1IAW A;  4E7I A;  3EUH C;  5CYV A;  2O8X A;  2R7D A;  2OTL I;  2HTJ A;  1RKT A;  4DYC A;  2FOK A;  1V55 H;  1LFP A;  4YEJ A;  2XGE A;  2HQR A;  4BS9 A;  3RTR A;  2ZME A;  2UV1 A;  3R6S A;  3UR3 C;  3H5A A;  3OOU A;  1JJ6 C;  1JHH A;  1VZ0 A;  4YII A;  3MN2 A;  4XOP A;  3ECH A;  4M9S A;  1TBX A;  3IKT A;  1ENH A;  3DP7 A;  2PQ8 A;  3TW6 A;  3JR9 A;  2PMU A;  2WB1 A;  5HS7 A;  1S7E A;  2P6S A;  5FKN A;  2R5Z A;  2ZBK A;  1PP8 F;  3IHU A;  3BR5 A;  1G3S A;  1R9T J;  1Z3Y A;  3S14 J;  3WE2 A;  2CW7 A;  4WXH A;  4O6J A;  3Q0V A;  4MIM A;  1WJ5 A;  2RN7 A;  3DWL E;  1VQ4 I;  1WJB A;  2K4J A;  2KIU A;  2WTE A;  4MO7 A;  1BW6 A;  3CF5 F;  2ACJ A;  2IXS A;  3M1C A;  2FA5 A;  5D8L B;  5E8I A;  1TQM A;  5ILS A;  3TW7 A;  4EEF G;  4PUS A;  1GXP A;  2XRO A;  1ZN2 A;  1N75 A;  3WGH A;  4HG2 A;  3MFK A;  1K78 B;  3K1N A;  3PSI A;  4KMF A;  1V3F A;  2TDX A;  4NC6 A;  3ZCO A;  2Y0S A;  2EV5 A;  3ZMV A;  4DGW B;  2CQ7 A;  2IT0 A;  3HRM A;  5D8K B;  1TWC J;  2MD5 A;  4P5O A;  1TWG J;  2H6B A;  4LGW A;  3RKX A;  1JGG A;  1BJA A;  3S2W A;  1X3U A;  2HFH A;  5L3F A;  1QBJ A;  1UMQ A;  4HST A;  4U87 A;  4F3Q A;  1KQ9 A;  5KK1 A;  5JI6 A;  2AS5 F;  1X1C A;  1APL C;  3E6D A;  4BHB A;  5E3O A;  4XL9 A;  3LNQ A;  3BR0 A;  5EZG A;  4IHW A;  1XC5 A;  5J8F A;  3O8G A;  4GRI A;  1NH3 A;  3LSM A;  2X48 A;  3M7G A;  2H8W A;  3MD2 A;  3V4G A;  5ERI A;  2VOO A;  5GP9 A;  3P9I A;  1Z7L A;  2EWN A;  4L0Z B;  3DCF A;  2W00 A;  4UHT A;  2ISZ A;  2X1C A;  2DA5 A;  1AWC A;  2A5W A;  2XUB A;  3WHC A;  3ECO A;  2CG4 A;  3S1M J;  4KDP A;  3WHB A;  1R49 A;  3MVP A;  5F0F A;  2VON A;  1XMK A;  4ZH4 F;  2EFO A;  1UHM A;  3S3O A;  1W7P B;  2RRE A;  1SEU A;  2E5N A;  5LBQ A;  2E2H J;  2HQA A;  4Q48 A;  5K7F A;  4IHY A;  1MW7 A;  4G7O F;  1FOK A;  1ZRC A;  2DTZ A;  2F5D A;  3S15 J;  3CES A;  1XN7 A;  4A0Z A;  3CMY A;  1ETV A;  3F9K A;  3S2D J;  2GOM A;  2XB0 X;  2LKS A;  5D6E A;  2QLZ A;  3DKW A;  4IRH A;  2FUG 2;  3RKQ A;  5FO5 A;  3LFU A;  4AIH A;  1W7P D;  3LOC A;  3Q0U A;  4HAM A;  3GFM A;  4P9F A;  1IUF A;  3BDD A;  1X1P A;  2KHM A;  3AFH A;  4PSX A;  4K2E A;  4KIC A;  1GV2 A;  3EET A;  1CQT A;  3DBL B;  2KIM A;  4HPQ A;  4EAT A;  5EG0 A;  3A03 A;  1K61 A;  1WKM A;  3RPU A;  3L2W A;  3S3N A;  2MAB A;  2WAQ A;  3SFZ A;  1LFB A;  3FHZ A;  3KP5 A;  5AIP A;  2JJ7 A;  3LQR A;  1IN8 A;  2DAO A;  1LFU P;  3F72 A;  4KIF A;  1BOA A;  3VEP A;  2KIF A;  2VJI A;  4ZYA A;  3HOT A;  4IEJ A;  2BY0 A;  2MG4 A;  1BI1 A;  4UVA A;  4JK1 X;  4A5M A;  5J47 A;  3QP6 A;  1O3R A;  3ZMD A;  1SD6 A;  3K0L A;  4PJ0 C;  1I6X A;  3ABL H;  2OPT A;  5KAF C;  3WTU C;  1W36 D;  1TNS A;  2VC0 A;  4PK4 A;  2Z3Y A;  2KIQ A;  2R7F A;  2FBI A;  2XDV A;  4XLE A;  2ZSI B;  2BY2 A;  3F8M A;  1CGP A;  2K40 A;  3GYH X;  4M9X A;  1XGO A;  1D0Y A;  1ZHF A;  2FOW A;  1P4X A;  1D0Z A;  4Z6Y A;  2DA2 A;  3PUF A;  3QPH A;  4PJL A;  3W6V A;  2CSO A;  1WJF A;  3Q9V A;  2Q1Z B;  2CW0 F;  1ACI A;  2WB1 N;  4AYB A;  1UJ8 A;  4NC8 A;  2HYG D;  1WJD A;  3HPG A;  2DI3 A;  2MA3 A;  1FX7 A;  3FZV A;  1DU6 A;  2CMP A;  3CJR B;  2KZG A;  4ESJ A;  4LFU A;  1IJW C;  1VI0 A;  4LK1 F;  2DPU A;  2BV6 A;  2IS1 A;  2LP0 A;  2ZSH B;  1OYI A;  3TP3 A;  1MND A;  2GAU A;  5E18 F;  5EGO A;  1YO5 C;  1TZL A;  1WJE A;  2R5Y B;  2OAZ A;  4EJT A;  1RES A;  1U9N A;  1W1W E;  5E3N A;  4UUV A;  5FRN A;  5ILU A;  3IC7 A;  3PIO F;  1T33 A;  2XF7 A;  1DGW Y;  3S1Q J;  1FC3 A;  1FYK A;  3HSE A;  4ESB A;  2XC7 A;  5IOY A;  4BU2 A;  2KQR A;  3HM5 A;  2Y0S N;  4PGG A;  1UEL B;  4X6A J;  3E5Q A;  4Q5S F;  4MTE A;  2R7V A;  1POG A;  2HTS A;  3WTY C;  1T38 A;  2LG4 A;  2XKP A;  2ZXW H;  1T6S A;  3I0T A;  3OYH A;  4ZYD A;  2FSW A;  2A05 A;  1H9G A;  4CA0 A;  5J6X A;  3M8J A;  1G2H A;  1FYL A;  4XR6 A;  5BMZ A;  2VB6 A;  2M5W A;  3H9Q A;  4L9J A;  1NK2 P;  4UB8 C;  1MH3 A;  1PJR A;  4M9Z A;  2BY1 A;  2GA1 A;  4QPQ A;  2OCC H;  4UVB A;  1HQC A;  5LHI A;  3CO6 C;  5BNG A;  3F21 A;  2HR3 A;  4HV6 A;  3HEF A;  4A2U A;  1MIJ A;  2M7A A;  2RQP A;  3E1S A;  3ZQI A;  1JXS A;  2HDW A;  2B0L A;  1P92 A;  4M6X A;  2M4G A;  4ESF A;  1QZY A;  4BDZ A;  1SAN A;  5ICC A;  3KZI C;  1RR7 A;  5AON A;  4A3G J;  2DXI A;  1R6R A;  4BNC A;  1RIO H;  1PUF B;  1ZH5 A;  4DZJ A;  1FNN A;  1YS6 A;  1ON1 A;  1UST A;  3J7A Y;  2QBY B;  1HKT A;  1U3E M;  3ZP5 A;  1RC9 A;  4XRF A;  3MZY A;  1P2F A;  1H0M A;  3H1C A;  1FSH A;  4A0X A;  3DPT A;  3OS2 A;  5M5W J;  1S6L A;  4CO8 A;  1FMW A;  2DFI A;  3D5S C;  1DP7 P;  1S8N A;  3G1L A;  4B4C A;  2ISY A;  5TRD A;  3S1R J;  2M8E A;  4FE4 A;  1BN5 A;  1A31 A;  2BGC A;  4UUS A;  3TOB A;  1QHG A;  2BYV E;  2Z2S B;  1E17 A;  2IPQ X;  2HGC A;  2RC4 A;  1ONV A;  3BG6 A;  4BGD A;  2HOT A;  3PM1 A;  2JUC A;  1R71 A;  2R7U A;  1I3A A;  3HDD A;  4A6D A;  2W57 A;  4OOI A;  1RRJ A;  3BZ6 A;  4CDG A;  2ECB A;  2EIL H;  1YHQ I;  1HSJ A;  3I55 I;  1XS9 A;  2WAQ N;  2XAQ A;  3KCC A;  3NWT A;  2JN6 A;  4LLL A;  4ENN A;  1MMS A;  3FMQ A;  4GYG A;  2JTV A;  2L7K A;  4LK0 F;  4CXF A;  4HQE A;  2NS0 A;  3BJA A;  4R79 A;  1N77 A;  1Y1V J;  5EEA A;  1ERD A;  5M5X J;  1ZAR A;  5FLV A;  1QGP A;  3K10 A;  3K6G A;  3HGG A;  3JRC A;  1VQ7 I;  1Z77 A;  4A3D J;  1OQY A;  3JRE A;  2AQE A;  2K7L A;  1W0T A;  2WC2 A;  4XKV A;  4RB3 C;  2XHK A;  1OLT A;  1M1E B;  2E60 A;  1NHA A;  1J5Y A;  3OL3 A;  1EH8 A;  5FFZ A;  3OMY A;  4A3K J;  5IYD J;  2L01 A;  4I98 B;  4M6Y A;  3IUO A;  4HX8 A;  1IN7 A;  2L9N A;  1U78 A;  3DBR B;  1KU3 A;  4FIS A;  4I02 A;  4YIR X;  3W6K B;  1T98 A;  5GAH J;  3F0C A;  2X6O A;  5TJJ A;  3HUG A;  5A2Q Z;  2L2O A;  3OYG A;  1JTY A;  3MKW B;  1DQU A;  4A6E A;  3PL8 A;  3LA3 A;  4EM2 A;  5C3E J;  1TQI A;  4HBL A;  4C3H J;  2R7S A;  4Y33 A;  1G4D A;  3SDB A;  3WTT C;  1DPU A;  1FBQ A;  4QLC U;  5JLW A;  3BR1 A;  2K9M A;  3OV8 A;  2O9L A;  3H3V K;  4BY1 J;  2JA5 J;  2DFF A;  4AUX A;  2CFX A;  3LSK A;  4BQA A;  4IVN A;  2FD5 A;  4AYB N;  1MMN A;  4HSR A;  2O6G E;  4M6V A;  3DLL F;  3L9F A;  3OR1 C;  2WBM A;  2F5V A;  2OD5 A;  1D1A A;  1X19 A;  1LVK A;  1IGN A;  5ILV A;  3KE2 A;  4G7Z F;  2DMN A;  2OBP A;  9ANT A;  2LY2 A;  2ZME B;  3TQN A;  3H9J A;  3GEZ A;  3PUB A;  2DMU A;  2YR2 A;  3SZG A;  4LMY A;  2A6H F;  2L7M P;  2I5U A;  1MGT A;  2OF7 A;  5DM7 F;  3BLY A;  3EUA A;  4S04 A;  2BVM A;  2JQ7 A;  3BG3 A;  3ZMU A;  3V8J A;  5HOO A;  1V5F A;  1WJC A;  1J2X A;  2R5Z B;  3GFJ A;  3IH2 A;  4HZF A;  4OIO F;  1ZK8 A;  2ZNZ A;  1LQ1 A;  4I7H A;  2E1M C;  2E34 A;  1QA6 A;  3W6J B;  3TDZ C;  2LDU A;  3J7A O;  3DU5 A;  2QQ9 A;  1ETW A;  2GA2 A;  1XSX A;  1MBE A;  4OIR F;  2Z33 A;  3CJN A;  1LDK B;  5LRR A;  2A68 F;  3TO6 A;  4IRI A;  4RAY A;  1MJB A;  1BL0 A;  1R1T A;  2V6E A;  2Y2Z A;  1A36 A;  3WTZ A;  3OIP A;  2TCT A;  1WHU A;  2QZ8 A;  3CO7 C;  4RGU A;  1G59 A;  2KDZ A;  3C18 A;  2LD5 A;  3TMO A;  1Y0N A;  2ELH A;  3BTC A;  5E3M A;  4LJZ F;  2DJN A;  1ETK A;  1G8X A;  3TBI A;  4C2M J;  3BJO A;  3DXJ F;  5B66 C;  1GLN A;  1Z7U A;  1I50 J;  3GX4 X;  1JE8 A;  1BIA A;  1BJZ A;  4GFB A;  2VOD A;  1F43 A;  2ZXI A;  1H9T A;  3P5J A;  3EUH A;  4CYC B;  2V26 A;  3VYU B;  4G6Q A;  1XCV A;  2X1D A;  3WGG A;  4NHJ A;  3QYB A;  2RQQ A;  3RDI A;  2WAD A;  4II3 A;  5JHU A;  4KUM A;  3K1P A;  4B3X A;  2GIV A;  3HBL A;  2V79 A;  3TDU C;  5K5Q A;  1TW3 A;  4O5V A;  5GAE J;  3ZQQ A;  4V2G A;  3HKZ N;  1YYV A;  1WQ2 A;  2G9W A;  1E3P A;  1WRJ A;  4OAZ A;  4FHT A;  2DN0 A;  4G6T B;  1O3T A;  1YLF A;  3OYA A;  1IG7 A;  3RQ4 A;  4KMU X;  1ZR2 A;  3F8C A;  2IGK A;  3KET A;  4DW6 A;  2PBI A;  1YOV B;  3BOQ A;  4CCM A;  4KT5 C;  4XKB A;  1IO2 A;  4QWQ A;  2PJP A;  2I10 A;  4MQ9 F;  1SC7 A;  1HDD C;  1ETY A;  3GCM A;  2KDO A;  4JBA A;  2BOL A;  3L2C A;  5DCF A;  2NVQ J;  3O3K A;  1LEB A;  2R7O A;  4JOM A;  4LG0 A;  1R5H A;  1L3L A;  2K3P A;  3DTE A;  1IXS B;  3VSL A;  3DFG A;  3JSO A;  2D45 A;  1MDM B;  5K5O A;  4BDY A;  1QRY A;  1LE8 A;  1OYW A;  4WF2 A;  5E3L A;  4CCN A;  2ME6 A;  3B6C A;  4G94 A;  4IO9 F;  1JKQ C;  3W2V A;  4ITV A;  2P8T A;  4UVC A;  3A0H C;  1IN5 A;  5C44 J;  3PFI A;  1BR4 A;  4ENK A;  3QRF F;  1IRX A;  4CIC A;  2LRD A;  5LD2 C;  3HIF A;  5EG0 B;  1BM9 A;  1ETO A;  2DA1 A;  3CLO A;  2R7X A;  2A5Y B;  4IXA A;  2XAS A;  1KA8 A;  2XF6 A;  2FRH A;  4MEY F;  4XBF A;  3CD6 I;  5BQT A;  4I2O A;  3K4N A;  4IQ4 A;  1IF1 A;  3VOE A;  5JR3 A;  3WU1 B;  3I4M J;  1BI3 A;  3JRI A;  1X1D A;  1YTY A;  4MQV A;  3FBI B;  1YIJ I;  3KYC B;  2EZK A;  3HOX J;  3ZRG A;  3VSK A;  1S7O A;  2VJJ A;  2LOO A;  3FBN B;  1K83 J;  3MAJ A;  2XAG A;  4X0G A;  2HVS A;  2MFZ A;  2NRA C;  3RPU D;  3D0S A;  4FAS D;  4XKW A;  4FQG A;  4Y4R A;  1RKW A;  2YUS A;  2VXZ A;  2VJ4 A;  2QCO A;  1B4A A;  3GTP J;  1I1G A;  2MW8 A;  4P55 A;  2IGO A;  5E1W A;  4A3J J;  1KON A;  5CVR A;  1ODD A;  2V6C A;  1LUJ B;  1IZ1 A;  1BC8 C;  2CUZ A;  4XKC A;  1OCO H;  3RCO A;  4MGR A;  2HXI A;  5F27 A;  3VOD A;  2VAS A;  3KP6 A;  4E7Z A;  5DTD A;  2W48 A;  5F1R A;  1UCR A;  3H0G J;  2RVC A;  4KA4 A;  3H36 A;  4L9T A;  3GTK J;  1RPW A;  1IDY A;  2NS7 A;  2IS2 A;  4NC7 A;  4YIF A;  2O5R A;  3P7N A;  4PZJ A;  5F0H A;  1FBS A;  1YRN B;  1TWF J;  4FX4 A;  3ERM A;  1VQM I;  3W3C A;  1BA5 A;  3DQV C;  1XCB A;  2E1O A;  4JYK A;  3J80 Z;  3GTQ J;  1R4M B;  2Y48 A;  3BRO A;  5EGO B;  3OYN A;  4DOZ A;  4RBO A;  2X1E A;  1N78 A;  1YW9 A;  1AKH A;  1XTA A;  1U2W A;  3EPZ A;  4BQQ A;  3K70 C;  2BHY A;  1XG1 A;  3I59 B;  3COA C;  1QQI A;  4XLC A;  1MD0 A;  1NTC A;  2E2J J;  3VYT B;  2EV6 A;  2A69 F;  2J5P A;  3DEE A;  1YW8 A;  1D3Y A;  3VB2 A;  3A0B C;  4G9Y A;  3AL0 C;  2QYO A;  4WCG A;  1S9H A;  4BAY A;  4F52 A;  1FSE A;  2P5K A;  3RKY A;  1YIO A;  3SQN A;  2F5F A;  5DM6 F;  3EYI A;  2IW5 A;  4MFD A;  1MBH A;  2MC3 A;  2O7O A;  5DV5 A;  1ZG1 A;  2AQF A;  1ZG3 A;  1JKR C;  1J09 A;  4EQQ A;  1O4X A;  1OJL A;  5M3M J;  3BTL A;  1SFU A;  2QUF A;  3KPH A;  1CF7 A;  1T56 A;  3O2P E;  3QQA A;  5KCM A;  4MNU A;  1LVA A;  3ZPL A;  1EH6 A;  1DUX C;  1RNL A;  3G71 I;  1ZAO A;  1B9N A;  5TIS C;  4KT6 A;  5EEG A;  2KPM A;  1U0J A;  3CDI A;  2VN2 A;  2ZKZ A;  2R93 J;  1OIS A;  3K4J A;  3L2U A;  2HVR A;  2DQR A;  2XSD C;  2IBD A;  1A6I A;  3WTX C;  1I39 A;  2H09 A;  4KNY A;  2CQN A;  2MBF A;  1B6A A;  4UV9 A;  5FRM A;  5CLS A;  3CCJ I;  4BBS J;  2VBY A;  2HVQ A;  3V7R A;  2NS8 A;  4P9U A;  1HCR A;  4AVP A;  5DYM A;  3GUD A;  3OS0 A;  3O6B B;  4NDL A;  3S3M A;  4PGH A;  1LKX A;  4B3A A;  2DK5 A;  1BOB A;  5M5Y J;  2RNJ A;  2Q2E A;  3BT9 A;  3FXQ A;  5D5V B;  2NXN B;  2VQL A;  3OYI A;  2XV4 S;  2VKV A;  5H6Q A;  3GZ6 A;  3QPL A;  3IWF A;  4UUS B;  2M2E A;  3OS1 A;  3KZY A;  5EF6 A;  1IUY A;  3CUQ B;  1JUS A;  2PN6 A;  2ZJR F;  4EMS A;  3M9A A;  3JSP A;  4R1H A;  3JTG A;  2ZXH A;  3V7C A;  1PVE A;  1MSF C;  2BY3 A;  3LA2 A;  5B1B H;  4L5I A;  3N05 A;  3SYT A;  3ZN0 A;  2WY8 Q;  4RB0 A;  3VPR A;  4OMY A;  4YFK F;  4RS8 A;  4EM0 B;  5HNF A;  1KYZ A;  3KP7 A;  2K9L A;  3H3U A;  1OCC H;  1F9N A;  4NNJ A;  1EJ9 A;  2DFH A;  2GM4 A;  6PAX A;  1Z05 A;  4E7H A;  1PUE E;  3CC2 I;  3C2G A;  2MH9 A;  1QPM A;  5L3G A;  2QEX I;  3PNT A;  2JA8 J;  4A69 C;  3DKX A;  2M9H A;  1KQ8 A;  3DTI A;  3K7A J;  2Q0O A;  3OYM A;  4U0W A;  2JZY A;  4YFN F;  2DK8 A;  1NG7 A;  4A3L J;  2CRG A;  1QVU A;  4M73 A;  1FT9 A;  2WA0 A;  2DQL A;  3CCV I;  4W1U A;  3ZQC A;  2CJJ A;  3KP3 A;  1UAA A;  2HS5 A;  4UV8 A;  1V54 H;  4TV7 A;  5HDN A;  2NVU B;  2M3A A;  5DDG A;  5D4R A;  4BHP A;  1TT0 A;  3ASO H;  4PFO A;  1XMA A;  3GME A;  1MMD A;  3PO3 J;  1OPC A;  3L2R A;  5F1J A;  4ZTF A;  3IAS 2;  1XGS A;  4ZYG A;  4EJU A;  4BYY A;  2K86 A;  3R4K A;  1UFM A;  1BC7 C;  5JVT A;  4CYD A;  2LVS A;  1U5T B;  1HW5 A;  3T0Y A;  2E7W A;  4S05 A;  5FB2 A;  5LHG A;  4I99 C;  2V1N A;  4YFX F;  1XGM A;  2DW4 A;  3ABU A;  1QZZ A;  3H3Z A;  2YU3 A;  4A3E J;  2LRE A;  4HF2 A;  2QF7 A;  5IYB J;  4JX6 A;  2EIN H;  3DEU A;  3HSR A;  4N9I A;  2R7Q A;  1A6Q A;  2DOA A;  3FIS A;  3F8N A;  4BXX J;  2ESH A;  4XN0 A;  3OYB A;  3TGN A;  2HOS A;  1K6O A;  3OY9 A;  1JI8 A;  2HOE A;  3I58 A;  5GAG J;  1QVT A;  1B72 A;  3KLN A;  5DEQ A;  3A02 A;  2EH3 A;  2VQC A;  1EV7 A;  2W82 A;  3TOA A;  1RI7 A;  3KEQ A;  3ZQG A;  5JHF A;  4E7L A;  1JT0 A;  4B48 A;  5BOX A;  5E1Z B;  1U8R A;  2B7E A;  3DLA A;  2WAE A;  3U2R A;  2A6E F;  4ZJZ A;  2ADU A;  1P9Q C;  1F4K A;  2Y9Z A;  1FPQ A;  3U21 A;  2A61 A;  2DO7 A;  2EIJ H;  4XRS G;  2DTR A;  2EQR A;  3REO A;  1FOX A;  3KP2 A;  1MMA A;  2VT3 A;  1JUP A;  3E7L A;  3OYD A;  5L3C A;  3RZD J;  3KYL A;  3ABM H;  2DOD A;  3M3Y J;  5JFR A;  4G7H F;  2CS3 A;  4Q47 A;  1MSE C;  1ZRD A;  1MJ9 A;  3OYK A;  4U88 A;  3KLO A;  2GLO A;  1X4P A;  3HG9 A;  4XN3 A;  4MEX F;  3FK6 A;  2M34 A;  1B1B A;  3FXR A;  3JRB A;  5J1R A;  3CP8 A;  1FOY A;  2B63 J;  1VQL I;  1T0F C;  2YS9 A;  3DKY A;  2O61 A;  1IC8 A;  4C2U A;  5FKK A;  4AIK A;  3RZO J;  1HST A;  2TRT A;  3KIO A;  5JVG F;  2CV1 A;  1U6G A;  3HYI A;  1VND A;  4O3M A;  4ENJ A;  4EM1 A;  2PJR A;  4LG3 A;  1G3Y A;  3BZC A;  2O3F A;  4DYR A;  5M3F J;  4RDU A;  2K3F A;  5FKO A;  1IRF A;  4ETS A;  2DPD A;  4HW0 A;  3BG7 A;  3GLL A;  4OWR B;  1FYM A;  2XAH A;  3L09 A;  2P7V B;  3TO7 A;  2BW3 A;  3B6A A;  3HXL A;  4NQW B;  1YJN I;  4XLH A;  2ETH A;  1A5J A;  1IV8 A;  3PSF A;  1PDN C;  3M1E A;  4C2T A;  2MLG A;  4LG0 B;  4F7Z A;  4J00 A;  4AWX B;  5FLM J;  3G2B A;  2D5V A;  4I0B A;  4FET A;  1QO0 D;  1LE8 B;  1TT5 B;  1MH4 A;  4GO1 A;  2G0E A;  2YPR A;  2UWM A;  4BKX A;  3HKZ A;  2L7F P;  3SZP A;  4G8X A;  4KFC A;  3E0J B;  2FQ4 A;  3EUK L;  4N0B A;  3QOP A;  2EZI A;  1MNM C;  1R58 A;  3M8E A;  5FJ8 J;  4A3C J;  4X1E A;  2DMT A;  1X4O A;  2Y30 A;  2MD0 A;  3OIQ A;  1YX5 A;  2MC4 A;  2CUJ A;  3H92 A;  4I01 A;  5K1Y A;  1O3Q A;  4LIU A;  2IP2 A;  1IRZ A;  2E1N A;  3HHH A;  1BIB A;  4KN4 X;  1OCR H;  1VQN I;  1WZ2 A;  1F5T A;  2L3D A;  2L4M A;  2JA2 A;  3GW2 A;  4I0A A;  5HOD A;  3RYR A;  1I3Q J;  3RSN A;  1YQA A;  2CQK A;  2IS4 A;  3A01 A;  5HNH A;  5E17 F;  3DPL C;  5IP7 J;  2L5Q A;  2VPR A;  1W5T A;  2B9S A;  2MSY A;  3V8K A;  2KZV A;  1C0W A;  3BWG A;  3I4N J;  2Y69 H;  3JRH A;  5DCM B;  1O7F A;  4CZZ A;  4Y7N J;  2DDB A;  1Y56 A;  3BTI A;  3OOP A;  3ZN1 A;  3K2Z A;  3IL2 A;  2XF5 A;  3PNV A;  3H5N A;  3W2W A;  3W2A A;  4IRG A;  3CQZ J;  3DBH B;  4BE1 A;  1K79 A;  3FKI J;  1P4A A;  2LY9 A;  2X6X A;  1GT0 C;  4PJM A;  1TTY A;  4D5C A;  3I64 A;  5FLX K;  2KJC A;  3P9C A;  1LJ9 A;  4Q4Z F;  2HNH A;  3S1N J;  2QSG X;  2JRT A;  2F6C A;  4HLX A;  4F92 B;  5L3E A;  4IJA A;  1ZR4 A;  4XON A;  3S93 A;  1ITY A;  1FZP B;  3ZQF A;  3F8B A;  1Q1H A;  1B59 A;  5ED4 A;  4A93 J;  1Z0X A;  3CCE I;  3DU6 A;  2DJI A;  3PO2 J;  4XLN F;  3BQZ A;  1NK3 P;  2LF8 A;  3TED A;  4AID A;  5FD5 A;  4EVI A;  2WY7 Q;  2NAZ A;  1FP2 A;  5IYC J;  3BZK A;  3X2Q H;  1VQ6 I;  2LMD A;  2JPC A;  1LB2 A;  3DV8 A;  1HKS A;  3BJ6 A;  3M4O J;  4CUG A;  3RYP A;  4EJW A;  5DUI A;  2DMP A;  2OU2 A;  2W1O A;  2FBK A;  2ZC2 A;  3LWF A;  3HOZ J;  4LB6 B;  2DT5 A;  2RNG A;  1AKH B;  3ONQ A;  2DYS H;  1Z67 A;  5AIQ A;  3OYL A;  3Q5F A;  1RUO A;  5K5R A;  4XLA A;  2XIG A;  2EZL A;  5CVI A;  4UB6 C;  4ZDO A;  5F08 A;  2W25 A;  3S2H J;  4E7K A;  1V4R A;  1KU9 A;  4QPO A;  3KZZ A;  3JRF A;  2AO9 A;  3B73 A;  3ZGK A;  2IS6 A;  5CJ9 A;  4OU0 A;  2P7C B;  2UUZ A;  4IHV A;  3MKL A;  1IDZ A;  2LR8 A;  2Y0M A;  4XLF A;  1XSV A;  2CH0 A;  1JKP C;  1D5Y A;  1OR7 C;  1Q1V A;  2LYC A;  3J7Z I;  3PIP F;  3HOV J;  1X2M A;  4EV0 A;  2NVX J;  3BPX A;  3ABT A;  1FTZ A;  4E4H A;  3UKG A;  4Y3O A;  1RZ4 A;  2JUG A;  3B02 A;  3D5R C;  3GF2 A;  4D9J A;  3CUO A;  4RAZ A;  3HOU J;  3DF8 A;  1R1U A;  5LEK A;  1CF7 B;  1IXC A;  3GTL J;  5CKT A;  3WE3 A;  3V8L A;  2YSR A;  4RLF A;  5CQG A;  1QU3 A;  2LK2 A;  3IH4 A;  4LIV A;  2OQG A;  2V9K A;  2OZU A;  1ZQ3 P;  3K69 A;  4XK4 A;  1ULY A;  2PX9 A;  3QYE A;  5H20 A;  4ASN A;  2EB7 A;  1P4W A;  2L9R A;  3EDP A;  1KZH A;  4F93 B;  1DGR M;  3A2K A;  1VF9 A;  3PQK A;  2FEZ A;  4XM3 A;  4HNU A;  4MTD A;  2STW A;  3T8R A;  2M7B A;  2NYX A;  1MJA A;  5H6R A;  1K7A A;  4EJO A;  3BC8 A;  2V9V A;  3BQY A;  3HPH A;  4L9V A;  1DDN A;  1WCM J;  4I09 A;  3U1D A;  1K6Y A;  2ID6 A;  3ERE D;  2KRH A;  2JT1 A;  2Q2E B;  3E3V A;  4UXN A;  3MMY B;  4ABZ A;  3RIR A;  2VLA A;  2KL4 A;  2QWW A;  3V42 A;  1KU2 A;  3CCM I;  1R36 A;  4HDV A;  1Y8R B;  2CUE A;  1ORK A;  3GTJ J;  3OL4 A;  3T5X A;  2ID3 A;  2KP6 A;  2EIM H;  3R0J A;  3R0A A;  1JKO C;  3FXJ A;  2IAI A;  1J59 A;  2F5C A;  3DTK A;  3VFZ A;  3CC7 I;  1FY7 A;  2HQ5 A;  4RM3 A;  4AD9 A;  2XPW A;  2IEK A;  4P1W A;  2DT6 A;  1DPR A;  1TL8 A;  1WSU A;  4RGS A;  4XIC A;  3CUQ C;  2OUM A;  3ZR8 X;  2ZFW A;  1Y6I A;  2M87 A;  2OC6 A;  4HRI A;  2DA6 A;  4HEA 2;  4IKF A;  2X6W A;  2Z16 A;  1R22 A;  2IA1 A;  3E5U A;  1FMV A;  2CWE A;  2VBW A;  4J19 A;  1VQK I;  4M3B A;  3IV5 A;  1G6N A;  2XSJ C;  2X4H A;  1ZRF A;  1GHC A;  4HA8 A;  2XAJ A;  3N97 A;  3K1M A;  3H0D A;  4BH9 A;  5HDK A;  1TLH B;  3HOY J;  5IP9 J;  2VKE A;  3DEW A;  1QZE A;  1WVR A;  3IRR A;  1ZGJ A;  3SEZ A;  4ZDL A;  2VXD A;  2L54 A;  5F04 A;  3E6C C;  5J4V A;  2DOF A;  3BTJ A;  2V1D A;  3RJP A;  1P7I A;  4KIG A;  1BI0 A;  1QPI A;  3ZMS A;  3ESW B;  3WTS C;  1XGN A;  1D0X A;  3TO9 A;  5FD6 A;  4XOT A;  2FNP A;  2Z99 A;  2IA2 A;  1OMI A;  1GDT A;  3GWZ A;  2ZCW A;  1PP7 U;  2EZH A;  1JGS A;  4FT8 A;  3RQI A;  2QQB A;  1K4S A;  1XPX A;  2OJE D;  2E36 A;  1FP1 D;  2DFE A;  2GXG A;  5CVV A;  2GWR A;  4RAF A;  4ZTJ A;  3S16 J;  2EIK H;  4DQ2 A;  1W36 C;  1E0E A;  3VWB A;  1MBG A;  1SFK A;  4S0H B;  4RA2 A;  4HNV A;  3SEQ A;  2QVO A;  4U7B A;  1U5T C;  1FOW A;  1W5S A;  1WFX A;  3LSI A;  1Z9C A;  1JT6 A;  3GZN B;  5FFX A;  2OTJ I;  5E20 A;  2X0L A;  1GVD A;  3T1B A;  2UXX A;  4CCJ A;  5LGU A;  1VQO I;  3CCS I;  1YFH A;  3BPV A;  4ANJ A;  4HQM A;  1B72 B;  4BHC A;  3U1K A;  3CDH A;  2QKM B;  2UZK A;  3FXO A;  3RPQ A;  4B43 A;  2PMH A;  1YI2 I;  5E1X A;  1VQP I;  1R1V A;  2RDP A;  3L1P A;  2DA4 A;  4LLN A;  3D5L A;  3FXM A;  3FMS A;  1J7K A;  5LFA A;  1UG0 A;  2EFQ A;  1YJW I;  3HRU A;  1LPQ A;  3CCR I;  3F6O A;  4FCY A;  4N4N B;  2OZ6 A;  2KRC A;  3BP8 A;  4ZZL A;  4U0V A;  5LGT A;  3OWT A;  3F23 A;  4BQO A;  3CZ6 A;  5EDN A;  2VQH A;  3NAU A;  3OYJ A;  5KVR A;  2F4M B;  1I5Z A;  3QYF A;  4XID A;  2VE9 A;  4M3D A;  1OCZ H;  3KEO A;  3ZQH A;  1H8A C;  3Q0W A;  2AHQ A;  1SVL A;  2I8D A;  4ZYE A;  2XAF A;  2ZJP F;  3K2A A;  1H89 C;  1X3Z B;  2PMZ A;  2PI0 A;  1S5L C;  1ETX A;  3FM3 A;  3G1O A;  3GXO A;  3I3L A;  4GYI A;  1KU7 A;  2QQ8 A;  1Z3X A;  1DU0 A;  4II2 A;  4YEL A;  4PSW A;  4IZZ A;  2YU9 J;  2R4G A;  2PJR B;  2ZO4 A;  2QA4 I;  5E79 C;  2XRN A;  3WTV C;  5D4S A;  4C9Y A;  1Z6T A;  2M8G X;  4BUP A;  3ULQ B;  2LNB A;  3LSH A;  2ZJ2 A;  4ENM A;  3VYR B;  2RAE A;  1D5V A;  1WH7 A;  2EPF A;  4CHU A;  2BW3 B;  2F2E A;  2H1L A;  1BR2 A;  2E1M B;  4DJA A;  2M45 A;  1SVM A;  3G1M A;  1MZB A;  2QSF X;  2YX4 A;  4E70 A;  4CZC A;  3HC7 A;  1HKQ A;  2HWV A;  4WXD A;  2NVY J;  2ME0 A;  4IOC F;  2HOA A;  5HLI A;  1R5G A;  3OR2 C;  1SAU A;  1KGS A;  1B8I A;  1L0O C;  1WPK A;  1T8I A;  4ZDP A;  3FKJ A;  3JAM K;  1R4N B;  2R7R A;  2LH9 A;  3D1N I;  1Z6R A;  3HZJ A;  2O8K A;  3I54 A;  1JTX A;  1X1B A;  4BXF A;  1EH7 A;  5HLT A;  2EV0 A;  1HC8 A;  3FWE A;  2GXA A;  3I53 A;  5F6F A;  3GFL A;  5DUK A;  2FJ1 A;  4M71 A;  2GBY A;  2BXZ A;  3S17 J;  2CFO A;  3S32 A;  3G6E I;  2DOE A;  2VJ5 A;  4NB5 A;  1K4T A;  2BXY A;  2F4O B;  4IHX A;  1E3O C;  2XPU A;  3WOD F;  3OSF A;  3ASN H;  3CJT B;  1GUU A;  3VYS B;  2WWY A;  2IGM A;  5DD8 A;  1SD5 A;  4IL6 C;  1E2X A;  1T0F A;  2V9P A;  3HB9 A;  3ZMT A;  3Q3S A;  1HOM A;  5BPD A;  2EK5 A;  5GTH C;  2FQ3 A;  3K4C A;  3LMM A;  4FX0 A;  1X3W B;  2E2I J;  2E19 A;  2K9Q A;  2CO5 A;  3A01 B;  2ZNY A;  3LSJ A;  5CVJ A;  2VT2 A;  4N9H A;  1IV6 A;  3SXY A;  1R7J A;  1TW2 A;  3SJM A;  2NOJ B;  2DLL A;  4CYC A;  3SZT A;  1W0U A;  3GBG A;  4M3G A;  2J5O A;  3M8F A;  5F0C A;  4PJN A;  2VE8 A;  2RKH A;  2GIZ A;  4NBQ A;  4C3I J;  4ZZD A;  1AOY A;  1Y8Q B;  3C1D A;  4BEH A;  4XMY A;  4D0P A;  2LTP A;  2D1H A;  1R23 A;  3E97 A;  3P9K A;  2A6T A;  1OKR A;  2G7H A;  2W4S A;  2FNA A;  4PFP A;  1GV5 A;  4U7D A;  2FE3 A;  4IOA F;  3FK7 A;  5GPC A;  1P7J A;  2FXA A;  3GO5 A;  2L7Z A;  2LSO A;  2K85 A;  5B3S H;  3DPU A;  5D5W B;  1YX3 A;  2EFP A;  3IWZ A;  2LBF A;  5J1Y A;  2A07 F;  2QKL B;  1XB4 A;  5EZH A;  4C30 A;  2H94 A;  1XX5 A;  3KYD B;  1MBF A;  1VQ8 I;  1TWH J;  2MH2 A;  2OQR A;  4CCO A;  1S7A A;  4FE7 A;  4KN7 X;  4RAG A;  2VQG A;  3E6M A;  3LQQ A;  2ZJQ F;  3RI4 A;  2LC2 A;  2Q8K A;  3ZQL A;  3HL2 A;  3HUG B;  2HU9 A;  4DYQ A;  1AHD P;  1SFO J;  2KJB A;  5EYR A;  5TGT A;  5ICG A;  2GOX B;  1MDM A;  1U9O A;  1YIT I;  1JJ8 C;  1UHW A;  1SMT A;  3U9G A;  5HLH A;  2L9V A;  3CMM A;  3E6B A;  2O0Y A;  4XNF A;  4IX7 A;  1J75 A;  2VOP A;  1DP3 A;  2E71 A;  3I71 A;  4MHG A;  4EGY A;  4L5E A;  1X1A A;  3GFI A;  2DT7 B;  1GXQ A;  4IPA A;  3WG7 H;  2P5V A;  2V7F A;  2CW8 A;  2RV8 A;  3F22 A;  3MZH A;  4LIT A;  4KYW A;  2M30 A;  3ZMZ A;  4Y13 A;  2CGP A;  5C4X J;  3HOS A;  3L2Q A;  3CLQ A;  3H5R A;  1FIP A;  1ZG5 A;  3N4M A;  5A2Q K;  1NG6 A;  1FTT A;  3CJQ B;  2CUF A;  3BCA A;  4A0Y A;  3BCB A;  2LKP A;  4GDF A;  2IVM A;  2ZME C;  2PMZ N;  1YS7 A;  4BJT A;  2XKO A;  1O57 A;  1UB9 A;  2MGQ A;  2COM A;  3WG9 A;  1OFC X;  4GXO A;  4HDU A;  2HXO A;  2HDD A;  4QIW N;  1A35 A;  4P96 A;  5HDG A;  2IGN A;  2H6C A;  3WTW C;  3HRT A;  4MFE A;  2FX0 A;  3F8F A;  1OCP A;  1KQ0 A;  1Y39 A;  4A5N A;  3K9T A;  2VBZ A;  5HS9 A;  1ZGA A;  2NOG A;  1T95 A;  4NUB A;  2DDA A;  3ISP A;  5HS8 A;  3CMA I;  1EKE A;  3PNY A;  4RGR A;  1WI9 A;  2JSP A;  2HYF A;  2F4I A;  1J9I A;  5KAI C;  5FKL A;  1MNE A;  2VBX A;  3KEY A;  2QSH X;  3QWL A;  5LRS A;  4KIB A;  3MQ0 A;  2KKO A;  2P0W A;  3K4M A;  2JVG A;  2XB5 A;  5KHD A;  1FJL A;  2HZD A;  4DNC A;  2V4J C;  4E7S A;  2E7X A;  5J40 A;  2JVH A;  3EYY A;  1YRN A;  2NNN A;  1YW7 A;  2CU7 A;  4DIQ A;  5LEJ A;  2OCE A;  2ELJ A;  1D1C A;  1EA3 A;  1SAX A;  1A04 A;  2QQA A;  1VTN C;  4B8X A;  3F6V A;  1ZTR A;  1I1S A;  2Y9Y A;  2IA0 A;  2D2W A;  2FBH A;  3GZ5 A;  2QEN A;  1B9M A;  1SVO A;  1N25 A;  5L3B A;  1UZC A;  2DBB A;  4UUT A;  3IH3 A;  5EJC A;  4XLP F;  3JTH A;  3AL0 B;  2JWT A;  2KRF A;  4ZYH A;  3FMR A;  3ZQ7 A;  4OAY A;  1OR7 A;  3I59 A;  3K4K A;  1V5G A;  3CTA A;  3WU0 A;  1I6H J;  1O7L A;  4HF0 A;  4G6D A;  3K70 D;  2K27 A;  2X6Y A;  3C2H A;  2Y31 A;  1WJA A;  2V1X A;  3QOD A;  2XRL A;  5IT9 K;  3JAM Z;  1FEX A;  2D1V A;  1T08 B;  5C4J J;  3NAR A;  4L18 B;  4KIS A;  4WWC A;  2BZT A;  3Q9S A;  1EF4 A;  5J3L A;  3CCQ I;  5JLX A;  2BVL A;  1XSD A;  5J1U A;  2KIS A;  3PFY A;  2IRF G;  2P81 A;  2VUM J;  3C7J A;  4W97 A;  1FLI A;  4RM2 A;  3GLX A;  1IN6 A;  1IW7 F;  1JHF A;  1R00 A;  1TNT A;  3QPS A;  5IP6 A;  3LST A;  3JRD A;  2E5Z A;  1ZRE A;  3CDL A;  2MYS A;  1K78 A;  3BR6 A;  1HF0 A;  2HPI A;  3LSG A;  3BG9 A;  1ZGW A;  3HTU A;  2HQN A;  4R8H A;  4EJV A;  1YJ9 I;  2LFB A;  1I27 A;  2W7N A;  3SDG A;  2LF7 A;  3CCU I;  4BJ6 C;  5B5E C;  3L2V A;  4BAC A;  3FXU A;  1MBJ A;  1UHS A;  3ELK A;  3GVA A;  1ZYR F;  2AXT C;  2ZB9 A;  3LA7 A;  4XRS A;  2DMQ A;  3FHN A;  2M0M A;  4L0Y B;  2M0C A;  3MEX A;  3CCY A;  4OMZ A;  2EFN A;  2VKD A;  2GXB A;  3BG5 A;  5FRO A;  3I56 I;  4A3I J;  4C3J J;  3I9V 2;  4BJ5 C;  2AXL A;  1OCT C;  5GPA A;  5ICE A;  1TWA J;  4A3B J;  3RKW A;  2L0K A;  2H1K A;  5BS6 A;  3IRQ A;  3PJR A;  2JA7 J;  2O03 A;  3FDY A;  3AKZ A;  2LLK A;  3KFW X;  1FIA A;  1XD7 A;  2IJL A;  2JSC A;  2KLO A;  3FXK A;  4M3E A;  3CUQ A;  1ZLJ A;  4YG2 F;  5CQE A;  4AU7 A;  3LAP A;  3I4P A;  4JQF A;  2JRM A;  3OYE A;  4U0Y A;  5IT3 A;  2HZT A;  1SMY F;  5B1A H;  4UY8 I;  1AA7 A;  2BBY A;  1FWZ A;  4CCL A;  2P5L C;  3J81 K;  2C6Y A;  1W7P A;  1R5I D;  1STZ A;  2PEX A;  1MBK A;  3ABK H;  3BR2 A;  3CP2 A;  4N4O B;  3L7W A;  5E8G A;  2H8R A;  4LB5 A;  3FM5 A;  1BBY A;  2DCE A;  5L3D A;  3HTS B;  3K4B A;  4Y17 A;  2HPM A;  2UXN A;  2KT0 A;  1XMX A;  4BQN A;  4M74 A;  5DS9 A;  3H35 A;  4XQF A;  5LLQ A;  2OV7 A;  4E6K G;  2COB A;  2HYJ A;  1LDJ A;  5D5X B;  3T8T A;  3JW4 A;  1YE9 A;  3HJE A;  3G4S I;  4CCK A;  3CC4 I;  2EA2 A;  4FTH A;  3QPT A;  2DA3 A;  4AC0 A;  2M4K A;  3C2B A;  1XDS A;  1ZLK A;  3HGY A;  5FKM A;  5IOZ A;  3AAF A;  1BI2 A;  4ZC3 A;  4F55 A;  4OIQ F;  4B44 A;  2NNY A;  3MKZ A;  4RGX A;  2DYR H;  3H9G A;  4IF4 A;  2L02 A;  3J7Y J;  2JMW A;  4LOC A;  4LLG F;  3KX2 A;  1H88 C;  1HLV A;  1U5T A;  4XOR A;  1HW2 A;  2ESN A;  1YG2 A;  2GQQ A;  1XDU A;  2FU4 A;  3J80 K;  2XGC A;  1IXR C;  2QGU A;  3K4L A;  4WXC A;  1IRG A;  3AG2 H;  3ML6 A;  3BR3 A;  1S72 I;  3C3W A;  4J01 A;  3S8P A;  4A12 A;  2KMU A;  2K9S A;  3GTM J;  2R7Z J;  1HA8 A;  1LNW A;  4KIT B;  4V2F A;  3FXL A;  4JX5 A;  2MLK A;  1AU7 A;  4UNO A;  3VDX A;  3TP0 A;  1B8I B;  2DU9 A;  3FIW A;  5H2F C;  4YRV A;  2F5E A;  2R7W A;  4I6Z A;  3KP4 A;  5GAD J;  4IHT A;  1TQP A;  3IKV A;  1WI3 A;  1SFE A;  1BR1 A;  4RMN A;  1GVJ A;  4JX4 A;  2QM3 A;  3OSG A;  1UG2 A;  1VQ5 I;  2KFD A;  1Y1W J;  2FML A;  2P4W A;  2JK3 A;  2ZXJ A;  3NWS A;  3OYF A;  3MCZ A;  2F48 A;  4DZP A;  3CME I;  4HOB A;  2BHZ A;  4A3F J;  1USS A;  3QU3 A;  2OA4 A;  2GZW A;  2RGV A;  3IP4 B;  4H4K C;  3I5U A;  4ON0 A;  4AVZ A;  4BBR J;  4QTR A;  3EQL F;  5ICF A;  2VI6 A;  3M07 A;  3PQJ A;  2R5Y A;  1D8J A;  4HYE A;  4MLO A;  2R3S A;  5K7Z A;  3F3X A;  1OYY A;  4Y15 A;  5IT9 Z;  3LSR A;  3A4C A;  3BY6 A;  4XRM A;  3AG4 H;  3LSP A;  3SFI A;  1MMG A;  2E1C A;  2CQQ A;  4A3M J;  3MKY B;  4HNT A;  5HLG A;  3QAH A;  3HRS A;  4CSW A;  5LGN A;  2LKX A;  1SFX A;  4BEH B;  5GTI C;  2YX7 A;  1JUM A;  4L5J A;  4XSX F;  3WU2 C;  5J8C A;  4BXU A;  3MWM A;  1D8K A;  2ECC A;  2HI3 A;  4HLY A;  2R7T A;  2K5C A;  2A3S A;  3JRG A;  4Y52 J;  2ZFU A;  2Z9O A;  3LL7 A;  3V7S A;  2H27 A;  3R61 A;  2BEO A;  2HDC A;  3ZOB A;  3L00 A;  1MKM A;  3HSF A;  4M3F A;  2N8G A;  5D5U B;  2LBF B;  2CV2 A;  3FX3 A;  4RB1 A;  1KYW A;  2EFW A;  1V5E A;  2M1B A;  3JRA A;  2EBI A;  4XSZ F;  4BY7 J;  2XGD A;  2BE5 F;  4AM3 A;  4NQW A;  2K02 A;  3TL4 X;  2Z5U A;  3OIO A;  4HF1 A;  3MZ8 A;  4HV5 A;  4KJZ A;  3G3Z A;  2VL8 A;  5IY5 H;  2FF4 A;  3NRV A;  1G3T A;  3NQO A;  1REP C;  1ZKG A;  4BE2 A;  3LFK A;  2V1U A;  2ELK A;  2PFB A;  4JP0 A;  2G7U A;  5K7H A;  4WK8 F;  2W84 A;  2L9S A;  2CYY A;  1ETQ A;  1WH5 A;  2Y75 A;  1J0R A;  4PJJ A;  1PUF A;  2K9N A;  2CV0 A;  2XAU A;  1F36 A;  1ZEL A;  2WV0 A; 
#chains in the Genus database with same CATH homology
 3WGI A;  1QNT A;  2QBY A;  1T39 A;  2FMY A;  4PCQ A;  1F1Z A;  4Z2Y A;  1LDD A;  1ON2 A;  4GCV A;  1P6R A;  3NEU A;  2JPB A;  1HBX G;  3LAJ A;  1T2K A;  4L9N A;  5FLX Z;  2K4B A;  4CGZ A;  4GGG A;  5HVQ C;  1SD7 A;  1RUN A;  3FF5 A;  1S3J A;  3R60 A;  3J81 Z;  1FBU A;  2XGX A;  5EEH A;  4HX7 A;  4RB2 C;  4AIJ A;  2W85 A;  3ROU A;  1G3W A;  4B09 A;  4LD5 A;  2PLY A;  4OIP F;  5DCM A;  5DD4 A;  3QP5 A;  5CVU A;  1W4M A;  2W24 A;  1WWX A;  3SHF A;  1SD4 A;  5BPI A;  2VC1 A;  1HXD A;  5LHH A;  2L4A A;  5F64 A;  1Z1D A;  3E5X A;  1HW1 A;  5D6F A;  3QU6 A;  1S29 A;  2P6T A;  3TKY A;  1O3S A;  4IHS A;  1Z91 A;  2EA4 A;  1LEA A;  1IN4 A;  2PG4 A;  4EGZ A;  4H0E A;  3G73 A;  4HX4 A;  2STT A;  2XVC A;  5FGM A;  2HKO A;  4OIN F;  3HHG A;  2HKX A;  2EJR A;  4PDK A;  1Y0U A;  2HEO A;  4M72 A;  4WX9 A;  1IAW A;  5CYV A;  2O8X A;  2R7D A;  2HTJ A;  2FOK A;  2HQR A;  3RTR A;  2ZME A;  3R6S A;  1JHH A;  4YII A;  3ECH A;  4M9S A;  1TBX A;  3IKT A;  3DP7 A;  2PQ8 A;  2PMU A;  5HS7 A;  2P6S A;  2ZBK A;  1PP8 F;  3IHU A;  1G3S A;  3WE2 A;  4WXH A;  4O6J A;  2RN7 A;  2K4J A;  2KIU A;  2WTE A;  2ACJ A;  2FA5 A;  5D8L B;  5E8I A;  1TQM A;  5ILS A;  1GXP A;  2XRO A;  1ZN2 A;  3WGH A;  1K78 B;  3MFK A;  3K1N A;  4KMF A;  1V3F A;  2TDX A;  2EV5 A;  3ZMV A;  2IT0 A;  3HRM A;  5D8K B;  2MD5 A;  4P5O A;  2H6B A;  4LGW A;  3RKX A;  1BJA A;  3S2W A;  1X3U A;  2HFH A;  5L3F A;  1QBJ A;  1KQ9 A;  5KK1 A;  5JI6 A;  2AS5 F;  3E6D A;  4BHB A;  5J8F A;  3M7G A;  3V4G A;  5ERI A;  2VOO A;  3P9I A;  2EWN A;  4L0Z B;  4UHT A;  2ISZ A;  1AWC A;  2XUB A;  3ECO A;  2CG4 A;  4KDP A;  2VON A;  1XMK A;  4ZH4 F;  2EFO A;  1UHM A;  1W7P B;  5LBQ A;  4Q48 A;  4G7O F;  1FOK A;  1ZRC A;  2F5D A;  1XN7 A;  4A0Z A;  5D6E A;  2QLZ A;  3DKW A;  4IRH A;  5FO5 A;  4AIH A;  1W7P D;  4HAM A;  3GFM A;  4P9F A;  3BDD A;  4K2E A;  4KIC A;  3EET A;  2KIM A;  1WKM A;  3RPU A;  3SFZ A;  3FHZ A;  3KP5 A;  5AIP A;  3LQR A;  1IN8 A;  2DAO A;  3F72 A;  4KIF A;  1BOA A;  3VEP A;  2KIF A;  3HOT A;  1BI1 A;  4UVA A;  4JK1 X;  4A5M A;  3QP6 A;  1O3R A;  3ZMD A;  1SD6 A;  3K0L A;  1I6X A;  3WTU C;  1TNS A;  2VC0 A;  2Z3Y A;  2R7F A;  2FBI A;  3F8M A;  1CGP A;  3GYH X;  4M9X A;  1XGO A;  1ZHF A;  1P4X A;  3QPH A;  2CSO A;  3Q9V A;  2CW0 F;  2HYG D;  2DI3 A;  2MA3 A;  1FX7 A;  3FZV A;  4ESJ A;  4LFU A;  4LK1 F;  2DPU A;  2BV6 A;  1OYI A;  2GAU A;  5E18 F;  1YO5 C;  2OAZ A;  4EJT A;  4UUV A;  5ILU A;  3IC7 A;  1FC3 A;  1FYK A;  3HSE A;  4ESB A;  4PGG A;  3E5Q A;  4Q5S F;  4MTE A;  2HTS A;  3WTY C;  1T38 A;  2XKP A;  1T6S A;  3I0T A;  4ZYD A;  2FSW A;  1H9G A;  5J6X A;  1FYL A;  5BMZ A;  2M5W A;  4L9J A;  4M9Z A;  2GA1 A;  4UVB A;  1HQC A;  5LHI A;  3CO6 C;  3F21 A;  2HR3 A;  4HV6 A;  4A2U A;  2RQP A;  1JXS A;  2B0L A;  1P92 A;  4M6X A;  4ESF A;  1QZY A;  5ICC A;  5AON A;  4BNC A;  1RIO H;  1ZH5 A;  1FNN A;  1YS6 A;  1ON1 A;  1UST A;  2QBY B;  1HKT A;  1U3E M;  3ZP5 A;  4XRF A;  3MZY A;  1P2F A;  1H0M A;  1FSH A;  4A0X A;  3DPT A;  1S6L A;  4CO8 A;  2DFI A;  1DP7 P;  1S8N A;  2ISY A;  5TRD A;  2M8E A;  1BN5 A;  2BGC A;  3TOB A;  2BYV E;  1E17 A;  2IPQ X;  2HGC A;  2RC4 A;  1ONV A;  4A6D A;  2W57 A;  4OOI A;  3BZ6 A;  4CDG A;  1HSJ A;  2XAQ A;  3KCC A;  4LLL A;  4ENN A;  3FMQ A;  4GYG A;  2JTV A;  4LK0 F;  4HQE A;  4CXF A;  2NS0 A;  3BJA A;  4R79 A;  1ZAR A;  1QGP A;  2K7L A;  2WC2 A;  4RB3 C;  2XHK A;  1NHA A;  1J5Y A;  1EH8 A;  5FFZ A;  2L01 A;  4I98 B;  4M6Y A;  4HX8 A;  1IN7 A;  1U78 A;  1KU3 A;  4I02 A;  3W6K B;  1T98 A;  5TJJ A;  3HUG A;  5A2Q Z;  4A6E A;  3LA3 A;  4EM2 A;  1TQI A;  4HBL A;  1G4D A;  3WTT C;  1DPU A;  1FBQ A;  4QLC U;  3OV8 A;  2CFX A;  4BQA A;  4IVN A;  2O6G E;  3L9F A;  2OD5 A;  5ILV A;  3KE2 A;  4G7Z F;  2OBP A;  2ZME B;  3TQN A;  3GEZ A;  2YR2 A;  4LMY A;  2A6H F;  1MGT A;  4S04 A;  3ZMU A;  3V8J A;  5HOO A;  1J2X A;  3GFJ A;  4HZF A;  4OIO F;  2ZNZ A;  1LQ1 A;  4I7H A;  3W6J B;  3TDZ C;  2LDU A;  3J7A O;  2QQ9 A;  2GA2 A;  4OIR F;  1XSX A;  2Z33 A;  3CJN A;  1LDK B;  5LRR A;  2A68 F;  3TO6 A;  4IRI A;  4RAY A;  1MJB A;  1R1T A;  3WTZ A;  2QZ8 A;  3CO7 C;  4RGU A;  3C18 A;  2ELH A;  4LJZ F;  3BJO A;  3DXJ F;  1Z7U A;  3GX4 X;  1JE8 A;  1BIA A;  2VOD A;  1H9T A;  3EUH A;  4G6Q A;  1XCV A;  3WGG A;  4NHJ A;  3RDI A;  5JHU A;  4KUM A;  3K1P A;  2GIV A;  3TDU C;  2V79 A;  5K5Q A;  1TW3 A;  4O5V A;  1YYV A;  1WQ2 A;  2G9W A;  1WRJ A;  4FHT A;  1O3T A;  1YLF A;  4KMU X;  3F8C A;  3KET A;  2PBI A;  3BOQ A;  4KT5 C;  4QWQ A;  2PJP A;  4MQ9 F;  4JBA A;  3L2C A;  5DCF A;  3O3K A;  1LEB A;  4LG0 A;  1R5H A;  1L3L A;  1IXS B;  1MDM B;  3DFG A;  3JSO A;  2D45 A;  5K5O A;  1OYW A;  4WF2 A;  4G94 A;  2P8T A;  4UVC A;  1IN5 A;  3PFI A;  4ENK A;  3QRF F;  4CIC A;  3HIF A;  1BM9 A;  3CLO A;  2A5Y B;  4IXA A;  2XAS A;  1KA8 A;  4MEY F;  2FRH A;  4XBF A;  5BQT A;  4I2O A;  1IF1 A;  3VOE A;  5JR3 A;  3WU1 B;  1BI3 A;  1YTY A;  4MQV A;  1S7O A;  3MAJ A;  2XAG A;  2NRA C;  3D0S A;  2VXZ A;  1B4A A;  1I1G A;  5E1W A;  4P55 A;  5CVR A;  1ODD A;  2V6C A;  1IZ1 A;  1BC8 C;  4MGR A;  3VOD A;  3KP6 A;  5F1R A;  1UCR A;  2RVC A;  4KA4 A;  4L9T A;  4YIF A;  3P7N A;  4PZJ A;  1FBS A;  4FX4 A;  3DQV C;  1XCB A;  3J80 Z;  2Y48 A;  3BRO A;  1YW9 A;  1U2W A;  3I59 B;  3COA C;  1QQI A;  1MD0 A;  2EV6 A;  2A69 F;  2J5P A;  1YW8 A;  1D3Y A;  3VB2 A;  4G9Y A;  2QYO A;  4WCG A;  4BAY A;  1FSE A;  2P5K A;  3RKY A;  1YIO A;  3SQN A;  2F5F A;  3EYI A;  2IW5 A;  2MC3 A;  5DV5 A;  1ZG3 A;  4EQQ A;  1SFU A;  2QUF A;  1CF7 A;  3O2P E;  4MNU A;  1LVA A;  3ZPL A;  1EH6 A;  1DUX C;  1RNL A;  1ZAO A;  1B9N A;  5EEG A;  2VN2 A;  2ZKZ A;  2DQR A;  3WTX C;  2H09 A;  4KNY A;  2MBF A;  1B6A A;  4UV9 A;  5CLS A;  2VBY A;  3V7R A;  4P9U A;  4AVP A;  5DYM A;  3GUD A;  3O6B B;  4PGH A;  2DK5 A;  2RNJ A;  2Q2E A;  3FXQ A;  5D5V B;  2XV4 S;  5H6Q A;  3GZ6 A;  3IWF A;  3KZY A;  1IUY A;  3CUQ B;  2PN6 A;  4EMS A;  3M9A A;  3JSP A;  4R1H A;  3JTG A;  3V7C A;  3LA2 A;  4L5I A;  3ZN0 A;  4OMY A;  4RB0 A;  4YFK F;  4RS8 A;  4EM0 B;  1KYZ A;  3KP7 A;  3H3U A;  1F9N A;  6PAX A;  1Z05 A;  1PUE E;  2MH9 A;  1QPM A;  5L3G A;  1KQ8 A;  2Q0O A;  4U0W A;  2JZY A;  4YFN F;  2DK8 A;  4M73 A;  1FT9 A;  2DQL A;  3KP3 A;  2HS5 A;  4UV8 A;  4TV7 A;  5HDN A;  5DDG A;  5D4R A;  4BHP A;  1XMA A;  1OPC A;  1XGS A;  4ZYG A;  4EJU A;  4BYY A;  2K86 A;  3R4K A;  1UFM A;  1BC7 C;  5JVT A;  4CYD A;  1U5T B;  1HW5 A;  3T0Y A;  2E7W A;  4S05 A;  5FB2 A;  5LHG A;  4YFX F;  1XGM A;  3H3Z A;  3ABU A;  1QZZ A;  2DW4 A;  2YU3 A;  4HF2 A;  4N9I A;  3DEU A;  3HSR A;  3F8N A;  2ESH A;  3TGN A;  1K6O A;  2HOE A;  3I58 A;  3KLN A;  5DEQ A;  3TOA A;  1EV7 A;  1RI7 A;  3KEQ A;  5BOX A;  5E1Z B;  1U8R A;  3U2R A;  2A6E F;  2ADU A;  1F4K A;  1FPQ A;  2A61 A;  2DO7 A;  2DTR A;  3REO A;  3KP2 A;  2VT3 A;  5L3C A;  5JFR A;  4G7H F;  4Q47 A;  1ZRD A;  1MJ9 A;  4U88 A;  3KLO A;  4MEX F;  1B1B A;  3FXR A;  2O61 A;  4AIK A;  1HST A;  1U6G A;  3HYI A;  4O3M A;  4ENJ A;  4EM1 A;  1G3Y A;  2O3F A;  1IRF A;  4ETS A;  2DPD A;  4HW0 A;  1FYM A;  2XAH A;  3L09 A;  2P7V B;  3TO7 A;  2ETH A;  1PDN C;  3M1E A;  2MLG A;  4LG0 B;  4F7Z A;  4AWX B;  4I0B A;  1QO0 D;  4GO1 A;  2YPR A;  2UWM A;  3SZP A;  4G8X A;  4KFC A;  4N0B A;  3QOP A;  1R58 A;  3M8E A;  3H92 A;  4I01 A;  5K1Y A;  1O3Q A;  2IP2 A;  2E1N A;  3HHH A;  1BIB A;  4KN4 X;  1F5T A;  2L3D A;  2L4M A;  3GW2 A;  4I0A A;  3RYR A;  1YQA A;  2CQK A;  5E17 F;  3DPL C;  1W5T A;  3V8K A;  1C0W A;  3BWG A;  5DCM B;  1O7F A;  4CZZ A;  3OOP A;  3ZN1 A;  3K2Z A;  3IL2 A;  4IRG A;  1K79 A;  1P4A A;  1TTY A;  3I64 A;  5FLX K;  2KJC A;  3P9C A;  1LJ9 A;  4Q4Z F;  2JRT A;  4HLX A;  5L3E A;  4IJA A;  1FZP B;  3F8B A;  1Q1H A;  1B59 A;  5ED4 A;  4XLN F;  2LF8 A;  5FD5 A;  4EVI A;  2NAZ A;  1FP2 A;  1LB2 A;  2JPC A;  3DV8 A;  1HKS A;  3BJ6 A;  3RYP A;  4EJW A;  5DUI A;  2OU2 A;  2FBK A;  3LWF A;  4LB6 B;  2DT5 A;  5AIQ A;  3Q5F A;  1RUO A;  5K5R A;  2XIG A;  5CVI A;  2W25 A;  1V4R A;  1KU9 A;  3KZZ A;  3B73 A;  5CJ9 A;  4OU0 A;  2P7C B;  2Y0M A;  1XSV A;  4EV0 A;  3BPX A;  3ABT A;  1RZ4 A;  3B02 A;  3GF2 A;  3CUO A;  4RAZ A;  3DF8 A;  1R1U A;  5LEK A;  1CF7 B;  1IXC A;  3WE3 A;  3V8L A;  2YSR A;  2OQG A;  2OZU A;  3K69 A;  1ULY A;  5H20 A;  4ASN A;  2EB7 A;  1P4W A;  3EDP A;  3PQK A;  2FEZ A;  4MTD A;  2STW A;  3T8R A;  2NYX A;  1MJA A;  5H6R A;  1K7A A;  4EJO A;  2V9V A;  4L9V A;  1DDN A;  4I09 A;  3U1D A;  3ERE D;  2JT1 A;  3E3V A;  4UXN A;  3RIR A;  2QWW A;  1KU2 A;  1R36 A;  4HDV A;  3T5X A;  3R0J A;  3R0A A;  1J59 A;  2F5C A;  3VFZ A;  1FY7 A;  4AD9 A;  1DPR A;  1WSU A;  4RGS A;  3CUQ C;  2ZFW A;  2M87 A;  1R22 A;  2IA1 A;  3E5U A;  2CWE A;  2VBW A;  1G6N A;  2X4H A;  1ZRF A;  1GHC A;  4HA8 A;  2XAJ A;  3N97 A;  3K1M A;  4BH9 A;  5HDK A;  1TLH B;  3IRR A;  1ZGJ A;  2L54 A;  3E6C C;  2V1D A;  3RJP A;  4KIG A;  1BI0 A;  3ZMS A;  3WTS C;  1XGN A;  3TO9 A;  5FD6 A;  2FNP A;  2Z99 A;  2IA2 A;  1OMI A;  3GWZ A;  2ZCW A;  1PP7 U;  1JGS A;  4FT8 A;  2QQB A;  1FP1 D;  2GXG A;  5CVV A;  2GWR A;  4DQ2 A;  2QVO A;  4U7B A;  1U5T C;  1W5S A;  1Z9C A;  5FFX A;  5E20 A;  2X0L A;  3T1B A;  2UXX A;  5LGU A;  1YFH A;  3BPV A;  4HQM A;  4BHC A;  3CDH A;  2UZK A;  3RPQ A;  2PMH A;  5E1X A;  1R1V A;  2RDP A;  4LLN A;  3D5L A;  3FMS A;  1J7K A;  2EFQ A;  3HRU A;  3F6O A;  2OZ6 A;  3BP8 A;  4ZZL A;  4U0V A;  5LGT A;  3F23 A;  5KVR A;  1I5Z A;  2VE9 A;  3KEO A;  4ZYE A;  2XAF A;  2PI0 A;  3FM3 A;  3GXO A;  4GYI A;  1KU7 A;  2ZO4 A;  2XRN A;  3WTV C;  5D4S A;  1Z6T A;  3ULQ B;  2LNB A;  2ZJ2 A;  4ENM A;  1D5V A;  4CHU A;  2F2E A;  2M45 A;  1MZB A;  2YX4 A;  4E70 A;  1HKQ A;  2HWV A;  4WXD A;  5HLI A;  1R5G A;  1KGS A;  1L0O C;  3JAM K;  1Z6R A;  3I54 A;  1EH7 A;  2EV0 A;  3FWE A;  3I53 A;  5F6F A;  3GFL A;  5DUK A;  4M71 A;  4NB5 A;  3WOD F;  2WWY A;  5DD8 A;  1SD5 A;  1E2X A;  1T0F A;  3ZMT A;  5BPD A;  2EK5 A;  2FQ3 A;  4FX0 A;  2CO5 A;  2ZNY A;  5CVJ A;  2VT2 A;  4N9H A;  3SXY A;  1R7J A;  1TW2 A;  2DLL A;  3SZT A;  2J5O A;  3M8F A;  2VE8 A;  2RKH A;  4ZZD A;  1AOY A;  3C1D A;  4D0P A;  2D1H A;  1R23 A;  3E97 A;  3P9K A;  1ZG1 A;  1OKR A;  2G7H A;  2FNA A;  4U7D A;  2FE3 A;  2FXA A;  3GO5 A;  2LSO A;  5D5W B;  2EFP A;  3IWZ A;  2A07 F;  1XB4 A;  2H94 A;  2MH2 A;  2OQR A;  1S7A A;  4KN7 X;  3LQQ A;  3E6M A;  3RI4 A;  2Q8K A;  2KJB A;  5ICG A;  1MDM A;  1UHW A;  1SMT A;  3U9G A;  5HLH A;  3E6B A;  2O0Y A;  1J75 A;  2VOP A;  3I71 A;  4MHG A;  4EGY A;  3GFI A;  1GXQ A;  4IPA A;  2P5V A;  2RV8 A;  3F22 A;  3MZH A;  4KYW A;  2M30 A;  3ZMZ A;  4Y13 A;  2CGP A;  3HOS A;  1ZG5 A;  3N4M A;  5A2Q K;  4A0Y A;  2LKP A;  2IVM A;  1YS7 A;  2XKO A;  1O57 A;  1UB9 A;  3WG9 A;  2COM A;  4GXO A;  4HDU A;  4P96 A;  5HDG A;  2H6C A;  3WTW C;  3HRT A;  3F8F A;  1KQ0 A;  4A5N A;  3K9T A;  2VBZ A;  5HS9 A;  1ZGA A;  3ISP A;  5HS8 A;  4RGR A;  1WI9 A;  2HYF A;  1J9I A;  2VBX A;  5LRS A;  4KIB A;  3MQ0 A;  2KKO A;  4DNC A;  2E7X A;  3EYY A;  2NNN A;  1YW7 A;  5LEJ A;  1SAX A;  1A04 A;  2QQA A;  1VTN C;  4B8X A;  3F6V A;  1I1S A;  2IA0 A;  2D2W A;  2FBH A;  3GZ5 A;  2QEN A;  1B9M A;  5L3B A;  2DBB A;  4XLP F;  3JTH A;  2KRF A;  4ZYH A;  3FMR A;  3ZQ7 A;  1OR7 A;  3I59 A;  3CTA A;  3WU0 A;  1O7L A;  4HF0 A;  4G6D A;  2K27 A;  2V1X A;  5IT9 K;  3JAM Z;  2D1V A;  4L18 B;  4WWC A;  3Q9S A;  1XSD A;  2IRF G;  3C7J A;  1FLI A;  3GLX A;  1IN6 A;  1IW7 F;  1JHF A;  1R00 A;  1TNT A;  3LST A;  1ZRE A;  1K78 A;  3HTU A;  2HQN A;  4R8H A;  4EJV A;  1I27 A;  2LF7 A;  3FXU A;  3ELK A;  3GVA A;  1ZYR F;  3LA7 A;  4L0Y B;  3MEX A;  4OMZ A;  2EFN A;  2GXB A;  2AXL A;  5ICE A;  3RKW A;  5BS6 A;  3IRQ A;  2O03 A;  3KFW X;  2IJL A;  1XD7 A;  4YG2 F;  2JSC A;  3CUQ A;  1ZLJ A;  3LAP A;  3I4P A;  4JQF A;  4U0Y A;  5IT3 A;  2HZT A;  1SMY F;  2BBY A;  1FWZ A;  2P5L C;  3J81 K;  2C6Y A;  1W7P A;  1STZ A;  2PEX A;  3L7W A;  5E8G A;  4LB5 A;  3FM5 A;  1BBY A;  5L3D A;  3HTS B;  4Y17 A;  2UXN A;  4M74 A;  5LLQ A;  1LDJ A;  5D5X B;  3T8T A;  3JW4 A;  2EA2 A;  3QPT A;  1XDS A;  1ZLK A;  3AAF A;  1BI2 A;  4OIQ F;  2NNY A;  4RGX A;  4IF4 A;  2L02 A;  4LLG F;  1U5T A;  1HW2 A;  2ESN A;  1YG2 A;  2GQQ A;  1XDU A;  2FU4 A;  3J80 K;  1IRG A;  1IXR C;  4WXC A;  3ML6 A;  3C3W A;  4A12 A;  1LNW A;  2MLK A;  4UNO A;  2DU9 A;  2F5E A;  3KP4 A;  4IHT A;  1TQP A;  3IKV A;  1SFE A;  1GVJ A;  2QM3 A;  2FML A;  2P4W A;  2ZXJ A;  3MCZ A;  4HOB A;  1USS A;  3QU3 A;  2OA4 A;  2GZW A;  2RGV A;  4ON0 A;  3I5U A;  3EQL F;  5ICF A;  3PQJ A;  1D8J A;  4HYE A;  2R3S A;  3F3X A;  1OYY A;  4Y15 A;  5IT9 Z;  3BY6 A;  2E1C A;  5HLG A;  3QAH A;  3HRS A;  5LGN A;  1SFX A;  2YX7 A;  4L5J A;  4XSX F;  5J8C A;  4BXU A;  3MWM A;  1D8K A;  4HLY A;  2A3S A;  2Z9O A;  3V7S A;  2H27 A;  3R61 A;  2BEO A;  2HDC A;  3L00 A;  1MKM A;  3HSF A;  5D5U B;  3FX3 A;  4RB1 A;  1KYW A;  2EFW A;  2M1B A;  4XSZ F;  2BE5 F;  4NQW A;  2K02 A;  2Z5U A;  4HF1 A;  4HV5 A;  3G3Z A;  2FF4 A;  3NRV A;  1G3T A;  3NQO A;  1REP C;  3LFK A;  2V1U A;  2PFB A;  2G7U A;  4WK8 F;  2W84 A;  2CYY A;  2Y75 A;  1J0R A;  2WV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...