5J6XA

Crystal structure of the apo-zalpha of zebrafish pkz
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
MSAENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKRPVWDLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of a large winged Z-DNA-binding domain of Danio rerio protein kinase PKZ
pubmed doi rcsb
source organism Danio rerio
molecule tags Dna binding protein
molecule keywords Z-DNA binding protein kinase
total genus 21
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5j6xA00
1TW2A 5E1XA 1FP1D 1UHWA 4G6QA 4WX9A 5L3DA 4I2OA 5BS6A 1YQAA 2P7VB 4ON0A 4LJZF 5TRDA 3KP5A 3AAFA 3C18A 4M6XA 4AIKA 1MZBA 1IN6A 4M6YA 4BAYA 4A6DA 3TQNA 2EFNA 3OOPA 2K27A 2FNPA 4I09A 3J81Z 2EWNA 5CLSA 5LEKA 5F1RA 5ILSA 3J80K 2IT0A 1WSUA 4LB5A 3WE2A 3KEOA 3NEUA 1CF7A 2VBYA 1IUYA 3RYPA 1AOYA 3QP6A 2H6CA 4S04A 2YU3A 1YIOA 4K2EA 3FMSA 1O3QA 2BGCA 1FT9A 3V7RA 3LWFA 1R1VA 4G8XA 2ISYA 6PAXA 1R5GA 1OR7A 1BJAA 3I5UA 3TO7A 1OYWA 1HKQA 2FBKA 1MGTA 2FBIA 4CGZA 2EFPA 4UVAA 1HSTA 1HW5A 3BJ6A 2V1UA 4L0YB 2ZO4A 3T5XA 3LAJA 5LRRA 2BBYA 4HF2A 4LB6B 4P55A 2BYVE 2PBIA 3J7AO 1PDNC 2EV6A 4KYWA 2R3SA 2CWEA 1W7PA 2LKPA 1MDMB 2IA1A 1IRGA 3GZ6A 3PQJA 3N4MA 2ZXJA 2VBZA 3L00A 3B02A 1TQPA 4HDVA 4ZZLA 2MA3A 3FXRA 4PCQA 4E70A 2EV0A 1U8RA 2A6HF 3KE2A 2UZKA 1MJBA 2XUBA 4A6EA 3TOAA 1A04A 5HS9A 3PFIA 1EV7A 2YR2A 4JQFA 5L3EA 2F5FA 4EGZA 1R22A 3DV8A 2OZ6A 1Z1DA 4L9NA 5DCMA 3E5XA 2ZNYA 1G6NA 4IRGA 3ISPA 4G9YA 5HDKA 4CHUA 2J5OA 1QGPA 1FPQA 5LHHA 4CZZA 4R8HA 2ZBKA 2M5WA 3L09A 1RUNA 1FYKA 3DEUA 1LB2A 4GYIA 3M1EA 4KIGA 1I27A 1TQMA 5HDNA 1XCVA 2WTEA 1R7JA 2ISZA 5ICCA 4EMSA 1IZ1A 5DUKA 2FE3A 4NQWA 4KICA 4U7BA 5CVIA 1W5SA 2V1XA 4ASNA 3IKTA 5D6EA 2VONA 1D5VA 2LDUA 4KNYA 1J59A 2JRTA 1R1UA 1U5TA 4HX8A 3V8KA 3RKYA 3ZN1A 5DD4A 5AIQA 1F5TA 4RAZA 3COAC 4ENNA 2A68F 1EH8A 4LK0F 1FLIA 4HQEA 3DF8A 2Z9OA 3V7CA 3C7JA 3T1BA 2GWRA 2AXLA 2STWA 1ZREA 4RAYA 1G3WA 4UV8A 3SZPA 1U78A 3M9AA 3E3VA 2VN2A 3GVAA 5TJJA 1R36A 4HDUA 2O3FA 3ZMSA 3KFWX 2IP2A 2OZUA 1BC7C 2D2WA 4CDGA 4AWXB 1XSXA 3NRVA 2RGVA 2YPRA 2IA2A 5JI6A 2RV8A 3K0LA 4AVPA 4HZFA 2HR3A 4B8XA 1F4KA 2G7HA 1P4AA 3GFJA 4P96A 2ZMEA 3VOEA 1BIBA 1KU2A 3LQRA 2FEZA 2QYOA 2K02A 2K4JA 5DDGA 2HGCA 4RS8A 3VODA 3OV8A 3BPVA 1J2XA 2IA0A 2UWMA 1W7PB 4YFNF 4N0BA 1LDJA 2L4MA 2P5LC 4LG0B 5DV5A 5HOOA 1O3RA 2PI0A 3KEQA 3SZTA 3ECHA 1T2KA 3I59A 1WQ2A 3H92A 1MD0A 2Q2EA 2ZNZA 2FQ3A 4KA4A 3EQLF 3CLOA 4OINF 1ZGJA 1LDDA 3E5QA 3ERED 4MQVA 3JAMK 3G73A 4IRIA 4YFKF 1XSDA 5ICEA 3K2ZA 5HLHA 4LD5A 3C1DA 2F5DA 1EH7A 3KP3A 3ROUA 1IN7A 2NYXA 2ESHA 3DPTA 4N9HA 3DXJF 3CUQC 1QO0D 2JTVA 3ZQ7A 2HYGD 2H09A 3E97A 3RKXA 5FB2A 1J5YA 4RB0A 4BHCA 1U2WA 1REPC 1S8NA 3LAPA 1D8KA 2CQKA 4I98B 3J80Z 1U3EM 5CVJA 5E1WA 1LEBA 2EJRA 1XGMA 3WGHA 4KMFA 2DT5A 2PMHA 1B9MA 1SFXA 3ZP5A 3Q9SA 4HAMA 3IRQA 2QQBA 2GA2A 3JTHA 2XAFA 4XSXF 3CO6C 2ZMEB 1BIAA 3ML6A 3HUGA 2KRFA 3RDIA 3GFLA 1R1TA 1P6RA 3U1DA 4D0PA 4HA8A 4L0ZB 4UV9A 2QLZA 3GFIA 2FMYA 2G7UA 4MGRA 1IW7F 4WXHA 4BNCA 3BWGA 1TQIA 3FWEA 4EVIA 2CGPA 2L02A 1K79A 2EB7A 5E1ZB 2OQGA 5KK1A 2VXZA 4RB3C 1J9IA 3GYHX 2XROA 4M9ZA 4KFCA 5ILUA 1SD5A 1WWXA 1WKMA 4ZH4F 1YW9A 1RIOH 4XBFA 3BPXA 1KYWA 1K78A 4G94A 2Q8KA 4CYDA 3IHUA 3RIRA 2W25A 5IT3A 3Q9VA 3KZYA 3BY6A 2F2EA 2QQAA 3V7SA 2H27A 5FLXK 5BPDA 5L3CA 1KQ8A 5LGUA 3WTWC 1B59A 3IL2A 4GYGA 1ZLJA 3KP4A 1XN7A 1SD4A 4IPAA 4L9VA 4MNUA 5E8IA 2XVCA 5LEJA 3HHGA 4U7DA 4TV7A 2FMLA 1BOAA 2PMUA 5FLXZ 1ZG5A 2RVCA 2MC3A 4A12A 3GFMA 2NS0A 4U0VA 1KA8A 1BI3A 2ADUA 3MWMA 2P7CB 4IXAA 3WU1B 4RGUA 2OAZA 1QZYA 2DTRA 4ZYGA 1Q1HA 2EFQA 3M8EA 3IRRA 2VE9A 2JT1A 3TGNA 1ZRDA 1XDUA 2GZWA 3JSOA 1Z91A 1H0MA 1XCBA 4ENKA 1G3YA 3WTSC 4EJUA 3ABUA 3WU0A 1P92A 2B0LA 3IKVA 4EJOA 4Q4ZF 3FX3A 2H94A 4Q47A 1FBSA 1HKSA 4IVNA 4A2UA 1TW3A 5BMZA 2ZJ2A 4HW0A 2XV4S 2ZFWA 1IRFA 1OMIA 2NRAC 4EGYA 4MTEA 3LQQA 2F5CA 3DFGA 4PDKA 2KKOA 5JHUA 4G7HF 1TBXA 3HSFA 3MFKA 3LSTA 3TDZC 1LVAA 3LA3A 1PP8F 3ZMUA 3ZMDA 5BQTA 3EETA 4EM1A 2OA4A 2P6TA 1USSA 2ELHA 5CVRA 3WTVC 4GGGA 4ENMA 2KJCA 1K78B 1QNTA 2DQLA 5FGMA 4H0EA 2QVOA 4S05A 4FX4A 1QPMA 4M73A 5D5XB 3F22A 3BROA 3CDHA 2P5VA 3RYRA 4A0ZA 4Q5SF 1R5HA 5J8FA 4UNOA 1HXDA 3R61A 4OOIA 3ELKA 4EM2A 1BBYA 5LRSA 4HV6A 1IN4A 4HQMA 3FXQA 4A0YA 3ZMZA 3IC7A 2M1BA 5DCMB 5LHGA 1U5TB 3K1PA 3WODF 3CJNA 2XAQA 3ABTA 5ILVA 4JBAA 3GLXA 2E7WA 3F6VA 2HEOA 1GHCA 3C3WA 3HSRA 2COMA 1Z6RA 3KCCA 1IAWA 1T0FA 1ODDA 1JHHA 5J6XA 3M8FA 2MH2A 2E1NA 3T8TA 3TDUC 2JSCA 1HBXG 1D3YA 2IVMA 4RB2C 2CW0F 3WTTC 1Z6TA 3EYIA 3WGGA 4LG0A 5LGNA 4AD9A 5AIPA 3REOA 2JZYA 3VEPA 3JSPA 3L2CA 2NAZA 2YX7A 3E6DA 4M9XA 2RC4A 2QBYA 4ZYDA 3QAHA 5HLGA 4OIOF 2A69F 2P8TA 4IF4A 4MEXF 4XLPF 2PLYA 3RJPA 4M71A 3P9KA 1T38A 4M9SA 1BM9A 2QM3A 3HRMA 2DO7A 4WWCA 1X3UA 2AS5F 3R6SA 1R58A 2O8XA 1STZA 2RN7A 5D4SA 2OBPA 2FSWA 4BYYA 1F9NA 3JAMZ 4HBLA 4KN4X 2UXXA 4KIFA 1SFUA 2L4AA 4Y13A 4HOBA 5CYVA 2IRFG 1P2FA 3HHHA 3HTUA 4HV5A 3LFKA 2XAJA 3ZPLA 2V9VA 1UCRA 3F6OA 2V6CA 5D6FA 1K6OA 5K5QA 5F64A 5H6RA 1IN8A 5LHIA 1FBQA 4IHTA 3MQ0A 3ECOA 4GCVA 1FSEA 3P9IA 4U0WA 3FM3A 3ULQB 2A07F 3V8JA 2L01A 1DUXC 5A2QZ 4EM0B 3H3UA 4CICA 2O6GE 4HX4A 2D1HA 4UVCA 2GXGA 5HS8A 1LDKB 4G7ZF 1GXQA 4BH9A 2UXNA 1S6LA 3TO6A 1YW7A 3TO9A 5D8KB 2V79A 1ZGAA 4GO1A 1ZLKA 2DPDA 2ACJA 2BE5F 1Z05A 2HDCA 1SFEA 5L3FA 3I54A 5JR3A 3GF2A 5LBQA 4WK8F 1SD7A 2MBFA 3HRSA 4ENJA 1CF7B 1ZH5A 1XMKA 1LEAA 1USTA 2EA4A 4M74A 2Y0MA 2EFWA 4BXUA 4ESJA 1OKRA 2KJBA 1XGOA 2ZCWA 2GA1A 4B09A 2GQQA 4L9TA 3J81K 1VTNC 5A2QK 5CVUA 4HLXA 2OQRA 2E1CA 1RI7A 3E6BA 4G6DA 4Y17A 2FA5A 2QENA 3R0JA 1RUOA 2D1VA 4GXOA 3LA2A 2IJLA 2XKPA 4YIFA 3DPLC 1HW1A 3W6KB 5IT9Z 2WWYA 2W84A 3O3KA 3HOSA 4RGSA 2DBBA 5D5VB 5E17F 1TNTA 3GXOA 1ZG1A 1U5TC 1ZHFA 1FNNA 1ZRFA 5H20A 4EQQA 4KMUX 4BHPA 5FD5A 3EDPA 1YS6A 2A5YB 4CO8A 1JXSA 2Y75A 1D8JA 5LLQA 3I0TA 4WXDA 5K5OA 1FP2A 2VE8A 1TNSA 1WRJA 1YYVA 2FRHA 1TTYA 3I59B 3F3XA 1V3FA 1YLFA 1IF1A 1FSHA 2DI3A 5K1YA 1T39A 1L3LA 4DQ2A 3GEZA 3MZYA 1DPRA 2Z5UA 2MD5A 3WTZA 4FX0A 5BOXA 1OPCA 2PFBA 3K9TA 1FX7A 3EUHA 1Y0UA 1KU3A 4MQ9F 2HQRA 3E6MA 1B9NA 4HX7A 4O3MA 2GIVA 4RB1A 3IWFA 3F72A 1MJAA 3QU6A 2M87A 5CJ9A 1IXCA 1KGSA 1KU7A 3NQOA 5EEHA 1KQ9A 3SHFA 3KLOA 1JHFA 3RPUA 5E20A 3U9GA 1FWZA 2IW5A 1YG2A 1MJ9A 1SD6A 4XSZF 1JGSA 5DUIA 2LNBA 3ZMTA 2XGXA 2K7LA 1FBUA 3S2WA 3L7WA 3RPQA 4IHSA 1L0OC 4A5MA 4L9JA 2X4HA 3L9FA 1XB4A 1QBJA 4MHGA 2STTA 1ONVA 1J7KA 4F7ZA 2DK5A 2CFXA 2MLGA 1HQCA 4IJAA 1O3SA 1XD7A 3BOQA 4AIJA 1OYIA 2RQPA 1DPUA 3I58A 4PGHA 5FFZA 2OU2A 1HKTA 2FU4A 3FHZA 5IT9K 5DCFA 3D0SA 4LFUA 2HS5A 4ZYEA 1XMAA 2FOKA 4O6JA 2FBHA 3K69A 1ZN2A 1QQIA 4I0BA 3GWZA 3HSEA 3RTRA 4EJVA 3QOPA 4OIQF 3VB2A 3U2RA 4QWQA 2YX4A 1WI9A 3CTAA 5D5WB 5E8GA 2BEOA 2BV6A 3WGIA 4IRHA 1UFMA 2VOOA 1EH6A 4U88A 1LJ9A 1S7AA 4ESFA 2QWWA 5H6QA 2HTSA 1PP7U 5E18F 3MEXA 3JW4A 2VC1A 4UUVA 3FXUA 4OMZA 1GVJA 2PQ8A 1FZPB 1BI0A 3TOBA 5HDGA 1YW8A 2YSRA 1R23A 2LF8A 2HZTA 1G3SA 1BN5A 2WV0A 3EYYA 2KIMA 5D4RA 3QU3A 1I1SA 2XAHA 2R7FA 1S7OA 1P4XA 3CUQB 2O03A 4CXFA 2W24A 1XGSA 1RNLA 5EEGA 4LK1F 1FOKA 3R0AA 3I4PA 3JTGA 2QZ8A 4HF1A 3R60A 4N9IA 2CO5A 1QZZA 3BP8A 1BI2A 2PG4A 4A0XA 5ED4A 4Y15A 2XRNA 3QPTA 3HYIA 2DQRA 3BJAA 4UXNA 4DNCA 1FY7A 1HW2A 1O3TA 1AWCA 4Z2YA 1Z9CA 2HQNA 4R79A 2DAOA 2J5PA 5L3BA 1TLHB 3QPHA 3W6JB 5L3GA 2FF4A 1PUEE 2TDXA 1CGPA 2KIUA 5ERIA 2HFHA 4EV0A 5KVRA 5HVQC 3T8RA 2VC0A 3CUOA 2FXAA 1FC3A 3KP2A 1ZG3A 1JE8A 3FMRA 1SAXA 1J75A 3HTSB 3K1NA 2L3DA 2PN6A 4YIIA 2DU9A 2ESNA 3F23A 1UHMA 2NNNA 4FT8A 4PZJA 3TKYA 3KP7A 3F8FA 1RZ4A 3RKWA 3FMQA 4ETSA 2QUFA 1YTYA 2V1DA 2DFIA 5FFXA 2RKHA 1XGNA 5D5UB 4KDPA 4I7HA 2QBYB 4LGWA 2DLLA 1MDMA 3GW2A 2PEXA 4HF0A 2GXBA 2VBXA 3F8NA 4XRFA 2A61A 5HLIA 4HYEA 5JFRA 5F6FA 1BC8C 2XHKA 2LSOA 5HS7A 2FNAA 1KU9A 1B4AA 1ZRCA 1XDSA 3D5LA 4LLNA 4L18B 2OD5A 2HKXA 1O57A 2CSOA 1I1GA 2A3SA 1K7AA 5ICFA 2O61A 2F5EA 5JVTA 4ZZDA 3BZ6A 3I64A 4YFXF 4JK1X 2D45A 2VODA 3N97A 2LF7A 2JPBA 2ETHA 1T6SA 4OU0A 1E2XA 3E5UA 4R1HA 3GZ5A 1OYYA 2HWVA 1ULYA 3KETA 2W57A 2Y48A 3K1MA 3QP5A 3O2PE 4P5OA 1Z7UA 3CUQA 1SMYF 3P9CA 4O5VA 4KT5C 2RDPA 1IN5A 1ZAOA 2CG4A 3KLNA 3B73A 4I01A 1G3TA 4OIRF 2GAUA 5DYMA 3SXYA 3GO5A 3DQVC 2Z3YA 3WTXC 3ZMVA 4KUMA 1KQ0A 2EV5A 1YFHA 2HOEA 4LMYA 3HRUA 5K5RA 5LGTA 1W7PD 2XASA 2K4BA 3FM5A 2XAGA 4RGRA 3RI4A 4ZYHA 4MTDA 1B1BA 1W4MA 3E6CC 2O0YA 2XKOA 2ZKZA 3I71A 3I53A 1ON2A 3M7GA 4KN7X 3BDDA 3QRFF 1SMTA 1I6XA 3WTYC 4UVBA 1O7LA 4NHJA 1UB9A 3KZZA 3HRTA 1I5ZA 4A5NA 3HIFA 4L5IA 4UHTA 1YS7A 4I0AA 1ON1A 4ESBA 3G3ZA 1S29A 1ZARA 3MAJA 3HOTA 3R4KA 1ZYRF 4U0YA 2EA2A 3KP6A 3PQKA 2E7XA 2Q0OA 3VFZA 2KIFA 2L54A 5FO5A 1S3JA 2K86A 1T98A 3WE3A 1FYMA 3T0YA 1U6GA 2EFOA 1HSJA 1G4DA 1E17A 4WCGA 4HLYA 5DD8A 3O6BB 4Q48A 3DKWA 1FYLA 3F8BA 1P4WA 4WXCA 1IXSB 2R7DA 3GUDA 3F21A 5BPIA 4YG2F 2W85A 2DPUA 2DK8A 3V4GA 3BJOA 1DDNA 4LLGF 2VT3A 4PGGA 5CVVA 1R00A 1W5TA 1BI1A 2PJPA 2G9WA 2EK5A 4EJTA 2M8EA 4BHBA 4EJWA 2JPCA 4FHTA 3SQNA 1IXRC 3Q5FA 2VOPA 4RGXA 3V8LA 3F8CA 2HKOA 3WG9A 4I02A 4M72A 2HTJA 2WC2A 5AONA 4BQAA 2MH9A 3MZHA 3F8MA 1YO5C 3GX4X 2NNYA 2QQ9A 2Z33A 1V4RA 2XIGA 1KYZA 2H6BA 1H9TA 4MEYF 4OIPF 4KIBA 3FF5A 1LNWA 3IWZA 1GXPA 1B6AA 3LA7A 3P7NA 2C6YA 4OMYA 2VBWA 5D8LB 5ICGA 3FZVA 3MCZA 3H3ZA 1DP7P 4G7OF 3DP7A 5DEQA 2RNJA 2M45A 4WF2A 3ZN0A 1LQ1A 2HYFA 5FD6A 5J8CA 3WTUC 3SFZA 2DW4A 1NHAA 1C0WA 1H9GA 4P9UA 2VT2A 4L5JA 4XLNF 2CYYA 1F1ZA 2MLKA 1XSVA 2P5KA 3CO7C 4LLLA 4P9FA 2IPQX 4AIHA 2M30A 2A6EF 4QLCU 4NB5A 2Z99A 1O7FA 2X0LA 2P6SA 1MKMA 1J0RA 2P4WA
chains in the Genus database with same CATH superfamily
2JMWA 4FTHA 1TW2A 2VQGA 1H88C 5E1XA 3BR0A 1FP1D 4DBRA 4JYKA 1UHWA 5KAIC 4CCJA 2LR8A 1WH5A 2L9SA 4G6QA 4WX9A 1DP3A 1OCPA 1K4TA 2GOXB 1WZ2A 1T56A 4W1UA 1E3OC 3G1MA 1Z67A 5L3DA 4I2OA 5BS6A 5E3MA 1OJLA 3OL3A 2E2HJ 1YQAA 2P7VB 4ON0A 4C3IJ 2X6XA 2V9PA 4LJZF 5TRDA 1TL8A 2KMUA 1UG0A 2OCCH 1HF0A 4M3FA 3KP5A 3AAFA 3C18A 4A3KJ 2NOGA 3ZQHA 4M6XA 4AIKA 2B7EA 2CV2A 1MZBA 1A6QA 1IN6A 2R4GA 4M6YA 4BAYA 5JVGF 2BHZA 2DYRH 1A36A 1BA5A 4A6DA 3TQNA 5F1JA 2EFNA 3CMMA 3JRBA 3DBLB 1H89C 4XN0A 1FMWA 3OOPA 1IV8A 2K27A 2FNPA 4I09A 3J81Z 3QWLA 2EWNA 4C30A 5CLSA 2KDOA 5LEKA 5F1RA 5ILSA 2DYSH 2L7MP 4RDUA 3J80K 2IT0A 1WSUA 4LB5A 3WE2A 2FJ1A 3KEOA 4JX6A 4CUGA 2HVRA 2DOAA 2H1KA 3A01B 2FUG2 3NEUA 2DXIA 1CF7A 5TGTA 4RMNA 1JUMA 1MBHA 1UHSA 2M3AA 2VBYA 3TBIA 2CRGA 5J1UA 1U9NA 3RYPA 1W36D 1IUYA 1AOYA 2Y9YA 3QP6A 1QPIA 2DA6A 1RKWA 2H6CA 4S04A 2YU3A 2EZIA 5F04A 3AL0B 1YIOA 4K2EA 5FLMJ 3FMSA 2TCTA 1U8BA 1YRNA 1O3QA 2BGCA 1R49A 1FT9A 1G2HA 3V7RA 3LWFA 1R1VA 3OYAA 2AXTC 4G8XA 1FEXA 2ZB9A 2ISYA 3OYLA 2IS2A 6PAXA 4NC7A 3M07A 4AVZA 1TWGJ 1R5GA 1OR7A 2MYSA 4BBSJ 1BJAA 1U9OA 4DGWB 3I5UA 3CQZJ 1R71A 2LC2A 1X1AA 5JHFA 3JREA 3TO7A 2CQNA 1OYWA 3ZQFA 1X1PA 1HKQA 2FBKA 2LBFB 4ANJA 2WBMA 1ETQA 1MGTA 2FBIA 3A4CA 4M3EA 4CGZA 1LE8A 3DU6A 2EFPA 3OSFA 1YIJI 1V5FA 4UVAA 3S2DJ 1HSTA 2HI3A 1HW5A 3BJ6A 2CV0A 1JT0A 2V1UA 2ID6A 4L0YB 1ACIA 2O9LA 3ZQLA 1UAAA 2CUJA 2ZO4A 2HPIA 5CKTA 3T5XA 3NAUA 3LAJA 5LRRA 2BBYA 4HF2A 4LB6B 4P55A 2BYVE 2PBIA 3J7AO 3NARA 1PDNC 2EV6A 4KYWA 2R3SA 5HODA 2CWEA 1W7PA 2LKPA 1OCRH 1MDMB 3BR3A 2ZJPF 2IA1A 1IRGA 3GZ6A 5EGOA 3PQJA 2ZC2A 3A1YA 4JX4A 2XF7A 3N4MA 4II2A 2ZXJA 5HNFA 1UMQA 5GTIC 1TWAJ 2VBZA 2XAUA 3L00A 1D0XA 2CU7A 3B02A 3RQ4A 1TQPA 1RESA 4HDVA 2K9MA 4ZZLA 2MA3A 3FXRA 2LKXA 3K10A 3WG7H 2MC4A 4PCQA 3CCJI 2DFFA 3HGYA 4PJ0C 4E70A 2EV0A 2X9DA 1LFBA 2A6HF 4ABZA 1U8RA 2IGNA 3KE2A 2UZKA 1MJBA 2XUBA 1FTZA 4A6EA 3TOAA 1A04A 3IH3A 3UKGA 5HS9A 3PFIA 2CUFA 1EV7A 3QPSA 2YR2A 4JQFA 5L3EA 2F5FA 4EGZA 4AIDA 1R22A 3J7AY 2CJJA 1WJBA 3DV8A 2OZ6A 1Z1DA 3DTIA 1Y6IA 4L9NA 5DCMA 3E5XA 2ZNYA 4F3QA 1G6NA 4BQQA 4IRGA 3ISPA 2RAEA 4G9YA 4RLQA 2NVUB 5HDKA 4CHUA 2J5OA 4E7JA 1QGPA 3GTOJ 1FPQA 2LFBA 4P1WA 5LHHA 3P5JA 1YE9A 1IUFA 4CZZA 4R8HA 2M9HA 2ZBKA 2M5WA 5IYCJ 2E60A 4OWRB 3L09A 1RUNA 1FYKA 3DEUA 1X1BA 1V55H 3H9JA 4E7SA 4ZJZA 2M8GX 1LB2A 4GYIA 1NH3A 3M1EA 4KIGA 3GTGJ 1I27A 1TQMA 3LMMA 2X6YA 3HKZN 4XK4A 3HC7A 5HDNA 2KFDA 1XCVA 2LH9A 4RBOA 2WTEA 4IQ4A 4A3EJ 1R7JA 2ISZA 1ERDA 5ICCA 4EMSA 3S17J 2VPLA 3RSNA 1VF9A 2COBA 1VQOI 1R6RA 2HPMA 5EJCA 1IZ1A 5DUKA 4XICA 2FE3A 2M0CA 1Z0XA 4NQWA 3BZKA 4KICA 2ZJQF 4U7BA 4IEJA 5CVIA 5K7ZA 1W5SA 2V1XA 4ASNA 2Q2EB 3DEWA 3IKTA 5FROA 3DU5A 2VJ4A 1D1BA 3LSHA 3HM5A 3IP4B 2ZXHA 4DYCA 2R5YA 5IP9J 1UJ8A 4C2UA 5D6EA 4DIQA 1ZR2A 1MH3A 2VONA 3LNQA 1D5VA 1OFCX 1FIPA 3OIOA 2LDUA 4KNYA 1MNMC 3G71I 4QIWN 2JK3A 2HXOA 3S1QJ 5EF6A 1J59A 2JRTA 4V19K 2GM4A 1R1UA 1U5TA 3K4JA 4XRSG 4HX8A 2HOTA 3PFYA 1WJFA 3V8KA 3RKYA 3ZN1A 5DD4A 5AIQA 1F5TA 4RAZA 4HSTA 4X1EA 3WHCA 3COAC 4ENNA 4EEFG 2A68F 1EH8A 4LK0F 1FLIA 4HQEA 1WVRA 1GLNA 1FJLA 3DF8A 2Z9OA 3HOZJ 3V7CA 2JA6J 3C7JA 3AG4H 3OYKA 1JGGA 3T1BA 1WFXA 2GWRA 1TP4A 2AXLA 4RAFA 4XORA 2STWA 4UUSB 4CCOA 1SVOA 1ZREA 4CSWA 3HZJA 4RAYA 3RZOJ 1G3WA 2DOEA 4UV8A 2I10A 3SZPA 1U78A 2JRMA 3M9AA 3E3VA 2L7ZA 2CUZA 2VN2A 3GVAA 3GMEA 5TJJA 1R36A 3KIOA 4HDUA 2BY2A 2P0WA 2O3FA 3ZMSA 2KIQA 3KFWX 2IP2A 2OZUA 1YHQI 2JVHA 1BC7C 2D2WA 4CDGA 4AWXB 2KDZA 2IGOA 1XSXA 1W36C 3NRVA 1POGA 2RGVA 2YPRA 1SVLA 2IA2A 5JI6A 5KNLA 4E7IA 2RV8A 2ZSIB 1FIAA 3OYFA 3BTLA 1JKQC 2IXSA 4M3GA 4E6KG 2QSHX 3OYEA 3DTEA 2OC6A 3K0LA 2CMPA 4AVPA 1BW5A 4HZFA 2HR3A 4B8XA 1WI3A 2DDBA 1F4KA 4EATA 3CCUI 2G7HA 4UUSA 1P4AA 3GFJA 4P96A 3CESA 2ZMEA 1JUPA 3W6VA 3VOEA 1PYVA 2K3PA 4IHVA 2CW8A 1BIBA 3SDBA 1IDZA 1XX5A 1KU2A 3LQRA 2FEZA 2QYOA 2K02A 2K4JA 5DDGA 2HGCA 2OV7A 4RS8A 3OR1C 1QVUA 3CCVI 1X1DA 3KEYA 4ZDPA 3VODA 3OV8A 3HDDA 2E1MB 3BPVA 1YRNB 3E7LA 1P7IA 1J2XA 2M34A 5KCMA 2IA0A 5FRNA 2UWMA 4CCKA 2LG4A 1W7PB 4YFNF 4N0BA 1LDJA 2R7SA 2IS1A 2L4MA 3HEFA 2P5LC 4ZDLA 3RPUD 1JTXA 1Z7LA 2E35A 4NDLA 4IHWA 2QCOA 4LG0B 1BR2A 1XMXA 1FOYA 5DV5A 5HOOA 3L2WA 3G2BA 1O3RA 2PI0A 3KEQA 3SZTA 1MH4A 3ECHA 3GZNB 1T2KA 1G8XA 4UY8I 3I59A 4XRMA 1MNDA 1WQ2A 3H92A 1QU3A 5FKMA 3MD2A 3IUOA 1MD0A 2ZNZA 2Q2EA 3ESWB 2FQ3A 2F5VA 2XPWA 4KA4A 3EQLF 1XC5A 1B72A 3CLOA 4HNUA 4OINF 1ZGJA 1LDDA 3E5QA 3ERED 4MQVA 4FQGA 3JAMK 3G73A 4MIMA 2W82A 3S14J 3L2QA 3ABLH 4IRIA 4YFKF 3ABMH 1TWCJ 1XSDA 1NK3P 5ICEA 3K2ZA 3SJMA 3BTJA 5GAGJ 3HG9A 5HLHA 4LD5A 1VQ6I 3C1DA 2Q1ZB 2F5DA 1EH7A 2QKLB 2Z2SB 1X4PA 2DMTA 3FIWA 2Y69H 3KP3A 3BZCA 3CDIA 4CCNA 2IBDA 4L5EA 3ROUA 5M5YJ 3GTPJ 1IN7A 2NYXA 2VQHA 4ZDOA 2ESHA 3DPTA 4G12A 4N9HA 2X48A 3DXJF 3OYMA 3CUQC 1QO0D 2JTVA 3ZQ7A 2HYGD 4HG2A 4XLHA 2H09A 3E97A 3RKXA 4A69C 3OMYA 3A01A 3DTKA 5FB2A 1PVEA 2DMNA 3FK7A 1J5YA 4NBQA 3HUGB 4RB0A 4BHCA 4KITB 1U2WA 1REPC 3K4LA 1F36A 1S8NA 4M3BA 4AU7A 3LAPA 3EUHC 2MW8A 4OAZA 1D8KA 5GP9A 2CQKA 4I98B 3J80Z 5CPRB 1U3EM 3S93A 3LFUA 5CVJA 2EIKH 1ETOA 4BU2A 4D9JA 1OCOH 5E1WA 3H9QA 1LEBA 2EJRA 3CCMI 1XGMA 3QPLA 3WGHA 2DODA 1MSFC 1QRYA 5IOYA 2DT5A 4KMFA 2PMHA 1B9MA 1SFXA 3LSGA 3ZP5A 1RETA 3Q9SA 2HVSA 4HAMA 2BW3A 2QQBA 3IRQA 2GA2A 4XOTA 3JTHA 2XAFA 4XSXF 3MKLA 1VQ8I 3CO6C 4IZZA 2ZMEB 1S5LC 1BIAA 3ML6A 2YU9J 2DOFA 3HUGA 1IRXA 1Z21A 1SVMA 2MG4A 3BG7A 2KRFA 3RDIA 3GFLA 1YITI 2H1LA 2CFOA 3GTQJ 1R1TA 1P6RA 2BOLA 2LREA 3U1DA 4D0PA 1RR8C 4HA8A 4L0ZB 2KHMA 3Q0VA 4UV9A 2QLZA 2R5ZB 3GFIA 2FMYA 4A3FJ 2G7UA 2LLKA 4MGRA 1IW7F 4FETA 1GUUA 4WXHA 3BWGA 4BNCA 3TEDA 3A0HC 3A2KA 4B48A 1TQIA 1NG6A 5CQEA 1YJWI 3FWEA 4EVIA 4I6ZA 2CGPA 2L02A 1K79A 2EB7A 3MMYB 2OQGA 5E1ZB 3DBRB 5KK1A 2VXZA 4C2TA 4RB3C 5J4YA 4KT6A 2JA5J 4N4OB 1J9IA 4PFPA 2QEXI 4BBRJ 3GYHX 2XROA 4M9ZA 4KFCA 5B5EC 5E3NA 1NK2P 5ILUA 4CCMA 2PJRA 5F27A 1SD5A 1WWXA 1WKMA 2VUMJ 2KRHA 3PUBA 4YRVA 1RKTA 5IP7J 4BDZA 4ZH4F 1X58A 3G6EI 1YW9A 3FXLA 1RIOH 2V1NA 2F6CA 1ORKA 4XBFA 5IYBJ 4V2FA 3BPXA 2K5CA 1KYWA 1VFCA 1K78A 4G94A 1HA8A 3OYIA 2Q8KA 1TWHJ 3H0GJ 2OUMA 3FK6A 3SEZA 3IHUA 3RIRA 2W25A 3TL4X 2X6OA 2UUZA 4CYDA 3Q9VA 3KZYA 5IT3A 1YI2I 2B9SA 3BY6A 2F2EA 2QQAA 2ZFUA 3V7SA 3BR5A 2H27A 2VKVA 2O7OA 5FLXK 3ZGKA 5BPDA 5L3CA 4D5CA 1DU0A 5LGUA 3WTWC 1KQ8A 1YX5A 1B59A 1Y8RB 3IAM2 3NWTA 4CH7A 4GYGA 3IL2A 4J19A 4B47A 1X3ZB 1ZLJA 3KP4A 5IOZA 1XN7A 2IGKA 2MD0A 1SD4A 4IPAA 4L9VA 4MNUA 4RLFA 4IOCF 5E8IA 4C3HJ 2XVCA 1ZKGA 4HEA2 3HHGA 5LEJA 2OF7A 1JI8A 4U7DA 4M6VA 4ZTFA 4TV7A 3TP3A 2FMLA 1Z3XA 1BOAA 2PMUA 5FLXZ 4FISA 3HL2A 1ZG5A 2RVCA 3FXJA 3F0CA 2MC3A 4A12A 3GFMA 1BW6A 2NS0A 4U0VA 1PJRA 4IKFA 4ZTJA 1KA8A 1BI3A 4HSRA 4DOZA 3S3OA 2ADUA 4A93J 3MWMA 3ZCOA 2P7CB 4IXAA 1LVKA 3WU1B 4RGUA 1A35A 2OAZA 1DQUA 2VI6A 1QZYA 2DTRA 1I3AA 5EEAA 1ZQ3P 3NWSA 4ZYGA 1Q1HA 2EFQA 4XR6A 5HNHA 3PSFA 3M8EA 3IRRA 4PJJA 2GLOA 3I4NJ 2BXYA 1N25A 1X4OA 2VE9A 2JT1A 3TGNA 1ZRDA 2ID3A 2M7AA 1ENHA 1XDUA 2GZWA 3JSOA 1YOVB 1Z91A 1H0MA 2XGEA 3E0JB 1XCBA 1KONA 4ENKA 1G3YA 2XPUA 5E79C 3WTSC 4RAGA 3VWBA 1MMSA 3MN2A 4MLOA 4EJUA 1YJNI 3ABUA 3WU0A 1P92A 2B0LA 2PMZA 3A03A 4HPQA 3DLLF 3IKVA 2R7XA 4EJOA 2QA4I 3PIPF 1WJDA 4Q4ZF 4DJAA 3FX3A 2H94A 3KPHA 4Q47A 2HXIA 3DKYA 3HPHA 4IL6C 4Y33A 1FBSA 1HKSA 1WJEA 3CJQB 4IVNA 4A2UA 1TW3A 2AQEA 5GTHC 3PSIA 2JJ7A 5BMZA 1ZK8A 3OYHA 2M2EA 3ONQA 4PSWA 2ZJ2A 2X6WA 4HW0A 4AYBA 2XV4S 4BE1A 5TISC 4D1QA 2ZFWA 1IRFA 1OMIA 2NRAC 4PUSA 3IH4A 4XN3A 2NS7A 1BOBA 3K4NA 2Z16A 3OYBA 1MSEC 3C2HA 4EGYA 4MTEA 1XPXA 1WCMJ 3LQQA 4JOMA 2F5CA 2EZKA 2R7VA 1QVTA 3JRIA 3DFGA 4PDKA 2JWTA 2KKOA 5JHUA 1QHHD 1JT6A 2EINH 5FKOA 4G7HF 1TBXA 2KRCA 3ZR8X 3HSFA 4PJNA 3MFKA 3TP0A 1B8IB 3LSTA 3TDZC 2DA3A 1JTYA 4ITVA 1LVAA 3LA3A 3CF5F 3ZMUA 1Y1WJ 1PP8F 2E2JJ 3ZMDA 5BQTA 3DBHB 3EETA 2P6TA 2OA4A 4EM1A 1USSA 4XM3A 4GFBA 2ELHA 3OYGA 5CVRA 3WTVC 1E0EA 4J01A 4GGGA 4ENMA 2KJCA 1K78B 1QNTA 3ZRGA 2DQLA 3FXKA 5FGMA 3D5SC 4H0EA 2A5WA 2DA1A 2QVOA 4A3IJ 4LITA 4E4HA 4S05A 4X6AJ 3K2AA 2EZHA 3CJRB 4B1RA 4FX4A 1QPMA 4C9YA 4M73A 4NNJA 2ME6A 1XTAA 2WB1A 2HYJA 5BNGA 4HNVA 4AM3A 3DWLE 4LIUA 5D5XB 3CD6I 3F22A 3BROA 2I8DA 3CDHA 2P5VA 3RYRA 3BQYA 3GLLA 4F91B 4A0ZA 1IV6A 4Q5SF 4J00A 2HDDA 3CC7I 1R5HA 4IHYA 5J8FA 4UNOA 1HXDA 5J4VA 1B8IA 1AA7A 3R61A 4OOIA 3ELKA 4EM2A 2WB1N 1BBYA 4V2GA 2R7OA 5LRSA 5E3OA 4HV6A 1IN4A 3SFIA 1R4NB 1OQYA 4HQMA 3W2WA 3FXQA 2XRLA 1VQ4I 4A0YA 3ZMZA 5KAFC 3D1NI 3IC7A 2M1BA 5DCMB 5LHGA 1U5TB 3K1PA 2F48A 3VYTB 3RQIA 3WODF 3HPGA 1A5JA 3CJNA 3ERMA 4B44A 2XGDA 3VYUB 2E36A 3AG2H 2XAQA 3ABTA 5ILVA 4JBAA 2L7FP 3GLXA 2E7WA 3H35A 3F6VA 2HEOA 1GHCA 1GDTA 3DLAA 3C3WA 3HSRA 2COMA 2EZLA 3BR2A 4N4NB 2L7KA 1MBFA 3U1KA 1Z6RA 3KCCA 5IP6A 2HQ5A 1WH7A 1IAWA 3LSJA 1LE8B 1T0FA 3L2RA 1ODDA 1JHHA 5J6XA 3M8FA 1ETXA 3FKJA 3HOYJ 2MH2A 2E1NA 2AQFA 1AKHA 2VXDA 3T8TA 3TDUC 2JSCA 3KX2A 1G59A 1HBXG 2NVQJ 1D3YA 2IVMA 4RB2C 3J7YJ 4MFDA 3HB9A 2CW0F 3L2UA 3WTTC 1SC7A 3L2VA 1Z6TA 4RM2A 4XMYA 5B1BH 2PJRB 3EYIA 2HDWA 4UUTA 3WGGA 3I56I 4LG0A 5LGNA 2QKMB 2XB0X 3ZQQA 2NXNB 4AD9A 2R7UA 5AIPA 2X51A 2JZYA 3REOA 1D0ZA 3VEPA 3JSPA 3L2CA 1ZGWA 2JVGA 4BY1J 2NAZA 1OCZH 2BVLA 2YX7A 3E6DA 4M9XA 2RC4A 2QBYA 4ZYDA 3QAHA 4HNTA 5HLGA 4PK4A 4XOPA 4OIOF 2A69F 2P8TA 2HOSA 4IF4A 4MEXF 2R5YB 3OYJA 4XLPF 4II3A 3VPRA 2R7RA 2PLYA 1OCCH 1U0JA 3I4MJ 3RJPA 2H8WA 3HOUJ 4M71A 3JRHA 2V26A 3P9KA 1T38A 2D5VA 3BCAA 4M9SA 1CQTA 1BM9A 2QM3A 5FKLA 2ME0A 4BKXA 4UB6C 2GOMA 3HRMA 2DO7A 4B43A 2W4SA 4XKWA 2W48A 1WHUA 4WWCA 3KZIC 2V7FA 1X3UA 2AS5F 3R6SA 3ZQGA 1R58A 2O8XA 1STZA 2RN7A 5D4SA 2OBPA 2FSWA 4BYYA 1F9NA 4E7ZA 3W2AA 3JAMZ 1MBKA 4HBLA 3GTJJ 4KN4X 5K7FA 2JQ7A 2UXXA 4KIFA 1SFUA 2L4AA 3BR6A 4Y13A 4HOBA 5CYVA 2R7WA 1P7JA 4B4CA 2F4IA 2E1MC 3AKZA 2IRFG 1P2FA 3HHHA 3HTUA 4HV5A 3LFKA 2XAJA 3ZPLA 2V9VA 2DA4A 4A3GJ 1UCRA 3F6OA 2V6CA 3M1CA 4AUXA 3CMEI 5D6FA 3EUKL 1K6OA 1XG1A 5K5QA 1HCRA 5F64A 1ITYA 3DPUA 4XL9A 5H6RA 1IN8A 4RM3A 1FBQA 5LHIA 3OYDA 4IHTA 3MQ0A 3ECOA 2DFHA 2K9QA 4GCVA 1FSEA 3P9IA 4U0WA 3FM3A 3ULQB 1VZ0A 2A07F 1VQ5I 3MKWB 3V8JA 2K3FA 3DKXA 2L01A 3K4CA 1DUXC 4H4KC 2EIJH 3H3UA 2DMPA 4EM0B 5A2QZ 4CICA 2MGQA 3QYFA 1BR1A 2O6GE 4HX4A 2IGMA 2D1HA 2DA7A 4UVCA 2GXGA 5HS8A 1LDKB 1HC8A 4BE0A 4G7ZF 1GXQA 4BH9A 3I9V2 2UXNA 2ZSHB 1S6LA 3LSKA 4PJMA 1YW7A 3TO6A 4B3XA 2NVTJ 3TO9A 1I3QJ 2OTLI 5D8KB 4F93B 3OS1A 1H8AC 2JA8J 3PO2J 1MBEA 2V79A 1ZGAA 4GO1A 1ZLKA 4C2MJ 2DPDA 2HQAA 2ACJA 3CJTB 2ECBA 2BE5F 1Z05A 2HDCA 2L5QA 1SFEA 5L3FA 2L0KA 3I54A 1KZHA 5JR3A 1I6HJ 3GF2A 5LBQA 4WK8F 1SD7A 2TRTA 1AHDP 2MBFA 4D5FA 4QPOA 3HRSA 4XLFA 4ENJA 2DA2A 3S3NA 1CF7B 1XMKA 1ZH5A 1LEAA 1USTA 3H36A 3OYCA 1BL0A 3SEQA 4BEHA 2EA4A 4QSHA 1EA3A 4M74A 2Y0MA 2EFWA 2ZXIA 4PFOA 5M3FJ 4BXUA 4ESJA 1OKRA 2KJBA 3FBIB 1XGOA 2IS6A 2ZCWA 2Y30A 1T0FC 3FXMA 2GA1A 2Z1DA 1D1CA 1JKPC 4B09A 1E3PA 2R5ZA 3GTMJ 2GQQA 4L9TA 4F92B 3J81K 1VTNC 4A3CJ 1QHGA 3EPZA 3OS0A 5A2QK 5CVUA 3JRFA 1D5YA 4HLXA 2OQRA 1F43A 5M5WJ 2E1CA 1RI7A 3E6BA 4G6DA 4Y17A 2QSGX 2FA5A 3WHBA 1X19A 2KL4A 2QENA 3R0JA 1RUOA 2D1VA 2ECCA 4GXOA 3LA2A 2IJLA 3H1CA 2XKPA 1IJWC 1NG7A 2VQCA 2BW3B 4YIFA 4LIVA 1I39A 4A3BJ 3DPLC 3M4OJ 2VKDA 4JX5A 5J47A 2GIZA 1HW1A 2X1DA 3A0BC 2VQLA 1MW7A 3W6KB 1Y1VJ 2XF5A 3FXOA 3BR1A 2QQ8A 4MO7A 2W7NA 4RA2A 5IT9Z 4FE7A 3FKIJ 1NTCA 2WWYA 1XS9A 4NUBA 2KISA 2W84A 3O3KA 3HOSA 3SYTA 1S7EA 3HOWJ 3DCFA 4RGSA 2VJJA 2DBBA 1DGRM 5D5VB 5E17F 1TNTA 3GXOA 5IPAA 2K9NA 1U5TC 1ZG1A 1ZHFA 1ETWA 4YELA 5JLWA 1QA6A 5DTDA 1K6YA 1FNNA 1ZRFA 5H20A 4Y7NJ 1IC8A 4BS9A 4EQQA 4KMUX 5F0FA 4BHPA 3HOXJ 3JCUC 3S16J 1X1CA 5FD5A 2Y9ZA 3EDPA 2WAFA 3OR2C 1YS6A 5DS9A 1X3WB 2A5YB 4CO8A 1MIJA 1JXSA 2Y75A 1D8JA 2IEKA 3J7ZI 3H5RA 2VPRA 2KZGA 5LLQA 3I0TA 2ICWG 4WXDA 3TMOA 2L9NA 2M0MA 3BG3A 4NQWB 5K5OA 5JLXA 2R92J 1O4XA 1FP2A 2VE8A 1TNSA 1WRJA 2KLOA 2V4JC 1YYVA 2FRHA 1P9QC 4XQFA 1TTYA 3I59B 5EZGA 3F3XA 1V3FA 2G0EA 1IDYA 1VI0A 1J09A 2L9RA 3CLQA 1YLFA 4LG3A 1IF1A 1FSHA 4BJTA 2DI3A 3LOCA 5K1YA 1T39A 3LSRA 1L3LA 4DQ2A 3K70C 3GEZA 3MZYA 5FKKA 1DPRA 2Z5UA 4BE2A 3C2GA 1UELB 2MD5A 1VQKI 3WTZA 4FX0A 5BOXA 1OPCA 3B6CA 4GDFA 2PFBA 2LKSA 3K9TA 3EUHA 1FX7A 2E5NA 1Y0UA 1V54H 1KU3A 2AO9A 2JSPA 3KYCB 4MQ9F 2HQRA 3E6MA 5LFAA 1B9NA 1T8IA 3LSPA 4HX7A 1N78A 4O3MA 3QOEA 2GIVA 4RB1A 2WAQN 2WY7Q 3ZQCA 1WPKA 2GXAA 3IWFA 1JJ6C 4PSXA 3ASOH 5H2FC 1EF4A 3F72A 2XPVA 3S2HJ 4NC6A 1MJAA 1IGNA 3QU6A 3HBLA 3CMYA 2RREA 2M87A 5CJ9A 1IXCA 1ETVA 1KGSA 1KU7A 3LSIA 3NQOA 5EEHA 1KQ9A 3SHFA 3KLOA 3CF2A 1A31A 1JHFA 5GAEJ 3RPUA 5E20A 3U9GA 1FWZA 2VJ5A 2IW5A 1YG2A 1MJ9A 1SD6A 2KPMA 2O8KA 5J40A 2ZJRF 4XSZF 3PO3J 3BG5A 9ANTA 1JGSA 3W2VA 3CDLA 4A3DJ 1Q1VA 4CCLA 5DUIA 2LNBA 1WJ5A 5J3LA 3ZMTA 2XGXA 2IS4A 2DMQA 2K7LA 1M1EB 1FBUA 3S2WA 3Q0UA 3L7WA 4XRSA 3RCOA 2XSDC 3RPQA 3ZQIA 3IV5A 4IHSA 1L0OC 3O8GA 4A5MA 1ZTRA 4L9JA 2X4HA 3L9FA 4Y52J 1XB4A 5M3MJ 1QBJA 3AL0C 4MHGA 2STTA 1OR7C 1SFKA 1TT5B 1ONVA 2CQQA 4A3MJ 3H5AA 2MFZA 1J7KA 3VSLA 5EZHA 5B66C 4F7ZA 2DK5A 2CFXA 2MLGA 3ZXSA 1HQCA 2ZXWH 1Y0NA 4IJAA 1O3SA 1XD7A 3BOQA 3EUAA 4AIJA 4FE4A 1OYIA 2NVYJ 3AFHA 3G1LA 2RQPA 3RKQA 1DPUA 3I58A 3MKYB 4PGHA 5FFZA 4W97A 2XB5A 2DJNA 2OU2A 2UV1A 1HKTA 2FU4A 1GV2A 3HGGA 4MFEA 3FHZA 5IT9K 2KT0A 5DCFA 5C44J 4IX7A 4XONA 3D0SA 4LFUA 2DT6A 2HS5A 3VSKA 2BXZA 1IG7A 2XC7A 4IOAF 4ZYEA 1XMAA 2FOKA 4O6JA 2FBHA 2LD5A 3K69A 1ZN2A 3OIQA 2JN6A 4BGDA 3I55I 5IYDJ 1QQIA 4I0BA 3GWZA 5K7HA 3HSEA 3RTRA 4EJVA 3QOPA 1Y8QB 4OIQF 2EIMH 3PIOF 1PUFA 3VB2A 2EILH 1S72I 3U2RA 4QWQA 4DZPA 4F52A 3OS2A 2YX4A 3CCQI 1WI9A 3CTAA 5D5WB 4XNFA 5E8GA 2BEOA 1Z77A 1Y56A 2BV6A 3WGIA 1YJ9I 1RRJA 4IRHA 1TC3C 3ZOBA 1UFMA 2VOOA 1EH6A 1A6IA 1IO2A 2Y0SA 4U88A 4U87A 1LJ9A 1S7AA 1MMGA 2BHYA 2DMUA 3BT9A 4ESFA 2QWWA 5H6QA 2HTSA 4YIRX 1PP7U 5E18F 1TT0A 2H8RA 2YS9A 3KYDB 3MEXA 3JW4A 2VC1A 1ETKA 4DZJA 3MKZA 4UUVA 3FXUA 4OMZA 1GVJA 2PQ8A 1FZPB 3M8JA 3OWTA 1BI0A 3TOBA 1JJ8C 5HDGA 1YW8A 2YSRA 1R23A 2LF8A 3K70D 4JP0A 2HZTA 1G3SA 3X2QH 5KHDA 1BN5A 3AG3H 2WV0A 1BR4A 3EYYA 2KIMA 1V5EA 5D4RA 2JUCA 3QU3A 2GBYA 2K9SA 1FMVA 2NS8A 1I1SA 2XAHA 1PUFB 2E19A 2R7FA 1S7OA 2DTZA 1P4XA 1OLTA 2OPTA 3CUQB 4KISA 3PJRA 1E3HA 2DA5A 2EPFA 2O03A 4CXFA 2R7QA 2W24A 1XGSA 1RNLA 5EEGA 1ETYA 4LK1F 1FOKA 3R0AA 5FLVA 3BG6A 1W1WE 1HOMA 5DM7F 1GT0C 3I4PA 4ZC3A 3JTGA 2QZ8A 2CUEA 4HF1A 2QGUA 4CZCA 3R60A 4N9IA 2CO5A 3ASNH 1QZZA 3BP8A 3CP8A 1WGXA 2A6TA 1BI2A 4PJLA 2PG4A 4A0XA 2CQXA 5ED4A 2VKEA 4Y15A 2XRNA 4BXFA 4BDYA 1N77A 3QPTA 1APLC 3Q3SA 3HYIA 2BY3A 2DQRA 3BJAA 4UXNA 4DNCA 1FY7A 2DN0A 1HW2A 1VQ9I 2K85A 1O3TA 3C2BA 4Z2YA 4R79A 2HQNA 1Z9CA 1AWCA 3GTKJ 5GPAA 2DAOA 3OL4A 1Y39A 2R7TA 2HZDA 2J5PA 5L3BA 1TLHB 1TWFJ 2F4OB 3QPHA 1UG2A 1SEUA 5FKNA 4FASD 2LOOA 2DT7B 3W6JB 5L3GA 2FF4A 1PUEE 3BTIA 5B1AH 2TDXA 1CGPA 2KIUA 1R9TJ 2R7ZJ 1HDPA 2HFHA 5ERIA 4EV0A 5KVRA 5HVQC 3T8RA 3FHNA 2X85A 1LKXA 2JA2A 2VC0A 3CUOA 2FXAA 2BVMA 1FC3A 3KP2A 2HOAA 1ZG3A 1JE8A 3FMRA 3K4MA 5C4JJ 1SAXA 1J75A 3HTSB 3K1NA 2L3DA 2PN6A 3OIPA 2DU9A 3PNTA 4YIIA 3JRGA 2ESNA 5M5XJ 3F23A 1UHMA 2NNNA 3LL7A 4FT8A 4PZJA 3TKYA 3GCMA 3KP7A 3F8FA 1OISA 1VQ7I 1BJZA 1RZ4A 5F0CA 2L2OA 3FMQA 3RKWA 2FD5A 1ZR4A 1GVDA 3CC4I 4DYRA 2LY9A 4ETSA 2QUFA 1YTYA 2V1DA 1JKOC 3PNYA 2DFIA 3BQZA 2FOWA 4QTRA 5EDNA 3H0DA 3WU2C 2DFEA 5FFXA 2RKHA 1XGNA 2E5ZA 2F4MB 5D5UB 4IQJA 2FQ4A 2VL8A 4KDPA 2W1OA 2WV1A 4I7HA 2M4KA 3CCYA 1IRZA 1MNEA 2EBIA 2QBYB 3VYSB 2KQRA 1D1AA 2DLLA 4LGWA 4I99C 2QSFX 3GW2A 2PEXA 1MDMA 4HF0A 1W0TA 2GXBA 2VLAA 2VBXA 1FOWA 5EG0A 3F8NA 4XRFA 2A61A 2NOJB 2Y31A 5GADJ 5HLIA 4HYEA 5JFRA 3JRCA 1QZEA 5F6FA 1BC8C 2MABA 2XHKA 3PNVA 1OCTC 3N05A 2EQRA 2LSOA 5HS7A 2FNAA 2CH0A 3MVPA 3CCLI 1LPQA 1KU9A 1B4AA 1ZRCA 1XDSA 2LVSA 2XDVA 3D5LA 3HOVJ 4LLNA 4XKCA 1UZCA 4L18B 2OD5A 5GPCA 5DM6F 2E34A 2HKXA 1VQNI 1O57A 2VASA 2CSOA 1I1GA 1EKEA 2A3SA 3MZ8A 1K7AA 5ICFA 2O61A 1VQLI 3K6GA 3S15J 2F5EA 2HNHA 4ZZDA 5JVTA 1WJAA 1RC9A 2LYCA 2L9VA 4LOCA 4Y3OA 1AU7A 2OTJI 2CS3A 3BZ6A 4YEJA 2LY1A 3I64A 3K4BA 2E2IJ 3UNGC 4BJ5C 4YFXF 4JK1X 5J1RA 2D45A 2VODA 1ZELA 4E7HA 3N97A 4GRIA 3O8HA 4IO9F 1GV5A 2LF7A 2JPBA 2A05A 4X0GA 2BY0A 2ETHA 2P81A 1T6SA 2YUSA 4OU0A 4CYCB 4BEHB 4XIDA 3OSGA 2XSJC 1E2XA 3E5UA 2ELKA 3D5RC 4R1HA 3GZ5A 1SANA 1X2MA 4KJZA 5IY5H 2LTPA 1OYYA 3OYNA 2AHQA 2HWVA 1ULYA 3KETA 2JUGA 2W57A 2Y48A 3K1MA 3QP5A 3O2PE 4P5OA 1Z7UA 4A3JJ 2LY2A 5C4XJ 3CUQA 1SMYF 3P9CA 4XLEA 4O5VA 4ZYAA 4KT5C 1T08B 2RQQA 5E3LA 1V5GA 2RDPA 1IN5A 1ZAOA 1R4MB 2CG4A 3KLNA 3B73A 3VYRB 4I01A 1G3TA 4OIRF 2GAUA 3DEEA 2R93J 3GTLJ 3BTCA 2EH3A 5DYMA 2R0QC 3SXYA 3GO5A 3BG9A 5F0HA 3DQVC 2HVQA 2Z3YA 3WTXC 1T95A 3HJEA 1MMAA 3ZMVA 4KUMA 1KQ0A 4F55A 1VNDA 3L1PA 2EV5A 2RNGA 1YFHA 2E71A 2HOEA 3S1MJ 2VJIA 2E1OA 2JA7J 4LMYA 3HRUA 5K5RA 1HLVA 1LUJB 5LGTA 1W7PD 2LRDA 2XASA 2K4BA 4DW6A 1I50J 2X1EA 2XF6A 3FM5A 4D7NA 5C3EJ 2XAGA 4RGRA 2BZTA 3RI4A 3RZDJ 2B63J 3U21A 3H5NA 2LK2A 4ZYHA 4MTDA 1B1BA 1W4MA 4CA0A 3E6CC 2O0YA 1W0UA 1YX3A 2XKOA 2ZKZA 3CZ6A 3I71A 3I53A 1ON2A 5LD2C 3M7GA 4KN7X 3KYLA 3BDDA 3QRFF 1SMTA 2PX9A 1I6XA 4S0HB 3WTYC 4UVBA 1JUSA 2KZVA 1O7LA 2W00A 2ZMEC 2V9KA 4BACA 1TZLA 1FTTA 2NVXJ 3ABKH 2BY1A 2VIXA 4NHJA 2K40A 3CP2A 3CMAI 1UB9A 4AYBN 3KZZA 3IH2A 3HRTA 4UB8C 1I5ZA 2WAQA 2CW7A 4XKBA 3K4KA 2V6EA 4A5NA 2MSYA 3HIFA 3PM1A 2OCEA 4L5IA 1YS7A 4UHTA 4I0AA 1ON1A 4ESBA 3G3ZA 4DYQA 1S29A 1ZARA 2Y2ZA 3MAJA 2OJED 3HOTA 3R4KA 1ZYRF 3QYBA 4U0YA 2EA2A 2N8GA 3KP6A 3JR9A 3HKZA 3PQKA 3JRAA 2E7XA 2Q0OA 4AC0A 1JKRC 3VFZA 2Y0SN 2KIFA 2L54A 5FO5A 1S3JA 2K86A 1T98A 3BC8A 3WE3A 1FYMA 3T0YA 3B6AA 1U6GA 2EFOA 1HSJA 3SZGA 3FDYA 1G4DA 3FBNB 1WJCA 1E17A 2WA0A 3S32A 4WCGA 2DCEA 4HLYA 4IHXA 5DD8A 3A02A 3O6BB 4Q48A 5B3SH 2HU9A 3DKWA 1RR7A 4NC8A 4XLCA 4BUPA 3F8BA 1P4WA 4WXCA 1FYLA 1IXSB 1AKHB 2R7DA 3GUDA 3F21A 4E7KA 3F9KA 1R5ID 5BPIA 3PUFA 3QODA 3I3LA 4YG2F 1SAUA 3CCEI 3V42A 2W85A 2DPUA 1RPWA 2DK8A 2K9LA 2M4GA 3FISA 5F08A 1Z3YA 3BJOA 3V4GA 1DDNA 4LLGF 4G6TB 3G4SI 1VQPI 3M3YJ 3G1OA 2VT3A 4PGGA 1D0YA 5CVVA 3CCRI 3S3MA 2CV1A 1R00A 1W5TA 1B72B 1BI1A 2PJPA 4B3AA 2PMZN 2G9WA 4I76A 2EK5A 4EJTA 1MMNA 2LMDA 2M8EA 4BHBA 4EJWA 3QQAA 1MBGA 2JPCA 3LSMA 4FHTA 3SQNA 1IXRC 3W3CA 4Y4RA 3Q5FA 2VOPA 3PL8A 4RGXA 3V8LA 3F8CA 1VQMI 2HKOA 5FRMA 2LBFA 3WG9A 4HRIA 3QYEA 1DU6A 2VKHA 3K7AJ 4FCYA 2QF7A 4BQNA 5EGOB 1HDDC 4M3DA 4I02A 4M72A 2HTJA 2WC2A 5HLTA 3OY9A 3AG1H 4BY7J 2FX0A 4E7LA 5AONA 2M7BA 4BQAA 1T33A 2MH9A 3HXLA 5GAHJ 3MZHA 1X2NA 3F8MA 4BXXJ 1YO5C 1K4SA 3GX4X 2NNYA 1FOXA 2QQ9A 2Z33A 4CYCA 1V4RA 4QPQA 3S8PA 2XIGA 1KYZA 3E1SA 2X1CA 4BQOA 3H3VK 2H6BA 1H9TA 3CCSI 2LP0A 2I5UA 4MEYF 4OIPF 1K61A 5EG0B 4D7MA 2DDAA 4A3LJ 1SFOJ 5FJ8J 4KIBA 3FF5A 1LNWA 3IWZA 4BL0B 3OOUA 1B6AA 1GXPA 4OAYA 3Q0WA 3TW7A 5CQGA 4DBQA 2KP6A 3LA7A 3P7NA 2O5RA 2C6YA 4OMYA 2VBWA 1K83J 2XGCA 1LFPA 5J1YA 5EYRA 3H9GA 5D8LB 3GBGA 3IAS2 5ICGA 3SDGA 2DJIA 3FZVA 3MCZA 1S9HA 3H3ZA 3S1NJ 1DP7P 4G7OF 3DP7A 5DEQA 1MMDA 2RNJA 2M45A 4WF2A 3ZN0A 1LQ1A 2HYFA 5FD6A 4XLAA 5J8CA 1EJ9A 3TW6A 1MBJA 4Z6YA 2VB6A 4XKVA 4C3JJ 2ELJA 3WTUC 3SFZA 2DW4A 1DGWY 1NHAA 2WAEA 1C0WA 2CQ7A 2IAIA 1W5CC 1H9GA 4P9UA 2VT2A 4L5JA 4XLNF 1N75A 2CYYA 1F1ZA 3JRDA 2MLKA 1XSVA 3BLYA 3UR3C 2WADA 4BJ6C 2P5KA 3S1RJ 3VDXA 3CO7C 4LLLA 4P9FA 2IPQX 1LFUP 4AIHA 2M30A 2A6EF 3CC2I 4QLCU 4NB5A 3BCBA 2Z99A 1O7FA 2WY8Q 2X0LA 2P6SA 1MKMA 1J0RA 2P4WA
chains in the Genus database with same CATH topology
1TW2A 5E1XA 1FP1D 1UHWA 4G6QA 4WX9A 5L3DA 4I2OA 5BS6A 1YQAA 2P7VB 4ON0A 4LJZF 5TRDA 3KP5A 3AAFA 3C18A 4M6XA 4AIKA 1MZBA 1IN6A 4M6YA 4BAYA 4A6DA 3TQNA 2EFNA 3OOPA 2K27A 2FNPA 4I09A 3J81Z 2EWNA 5CLSA 5LEKA 5F1RA 5ILSA 3J80K 2IT0A 1WSUA 4LB5A 3WE2A 3KEOA 3NEUA 1CF7A 2VBYA 1IUYA 3RYPA 1AOYA 3QP6A 2H6CA 4S04A 2YU3A 1YIOA 4K2EA 3FMSA 1O3QA 2BGCA 1FT9A 3V7RA 3LWFA 1R1VA 4G8XA 2ISYA 6PAXA 1R5GA 1OR7A 1BJAA 3I5UA 3TO7A 1OYWA 1HKQA 2FBKA 1MGTA 2FBIA 4CGZA 2EFPA 4UVAA 1HSTA 1HW5A 3BJ6A 2V1UA 4L0YB 2ZO4A 3T5XA 3LAJA 5LRRA 2BBYA 4HF2A 4LB6B 4P55A 2BYVE 2PBIA 3J7AO 1PDNC 2EV6A 4KYWA 2R3SA 2CWEA 1W7PA 2LKPA 1MDMB 2IA1A 1IRGA 3GZ6A 3PQJA 3N4MA 2ZXJA 2VBZA 3L00A 3B02A 1TQPA 4HDVA 4ZZLA 2MA3A 3FXRA 4PCQA 4E70A 2EV0A 1U8RA 2A6HF 3KE2A 2UZKA 1MJBA 2XUBA 4A6EA 3TOAA 1A04A 5HS9A 3PFIA 1EV7A 2YR2A 4JQFA 5L3EA 2F5FA 4EGZA 1R22A 3DV8A 2OZ6A 1Z1DA 4L9NA 5DCMA 3E5XA 2ZNYA 1G6NA 4IRGA 3ISPA 4G9YA 5HDKA 4CHUA 2J5OA 1QGPA 1FPQA 5LHHA 4CZZA 4R8HA 2ZBKA 2M5WA 3L09A 1RUNA 1FYKA 3DEUA 1LB2A 4GYIA 3M1EA 4KIGA 1I27A 1TQMA 5HDNA 1XCVA 2WTEA 1R7JA 2ISZA 5ICCA 4EMSA 1IZ1A 5DUKA 2FE3A 4NQWA 4KICA 4U7BA 5CVIA 1W5SA 2V1XA 4ASNA 3IKTA 5D6EA 2VONA 1D5VA 2LDUA 4KNYA 1J59A 2JRTA 1R1UA 1U5TA 4HX8A 3V8KA 3RKYA 3ZN1A 5DD4A 5AIQA 1F5TA 4RAZA 3COAC 4ENNA 2A68F 1EH8A 4LK0F 1FLIA 4HQEA 3DF8A 2Z9OA 3V7CA 3C7JA 3T1BA 2GWRA 2AXLA 2STWA 1ZREA 4RAYA 1G3WA 4UV8A 3SZPA 1U78A 3M9AA 3E3VA 2VN2A 3GVAA 5TJJA 1R36A 4HDUA 2O3FA 3ZMSA 3KFWX 2IP2A 2OZUA 1BC7C 2D2WA 4CDGA 4AWXB 1XSXA 3NRVA 2RGVA 2YPRA 2IA2A 5JI6A 2RV8A 3K0LA 4AVPA 4HZFA 2HR3A 4B8XA 1F4KA 2G7HA 1P4AA 3GFJA 4P96A 2ZMEA 3VOEA 1BIBA 1KU2A 3LQRA 2FEZA 2QYOA 2K02A 2K4JA 5DDGA 2HGCA 4RS8A 3VODA 3OV8A 3BPVA 1J2XA 2IA0A 2UWMA 1W7PB 4YFNF 4N0BA 1LDJA 2L4MA 2P5LC 4LG0B 5DV5A 5HOOA 1O3RA 2PI0A 3KEQA 3SZTA 3ECHA 1T2KA 3I59A 1WQ2A 3H92A 1MD0A 2Q2EA 2ZNZA 2FQ3A 4KA4A 3EQLF 3CLOA 4OINF 1ZGJA 1LDDA 3E5QA 3ERED 4MQVA 3JAMK 3G73A 4IRIA 4YFKF 1XSDA 5ICEA 3K2ZA 5HLHA 4LD5A 3C1DA 2F5DA 1EH7A 3KP3A 3ROUA 1IN7A 2NYXA 2ESHA 3DPTA 4N9HA 3DXJF 3CUQC 1QO0D 2JTVA 3ZQ7A 2HYGD 2H09A 3E97A 3RKXA 5FB2A 1J5YA 4RB0A 4BHCA 1U2WA 1REPC 1S8NA 3LAPA 1D8KA 2CQKA 4I98B 3J80Z 1U3EM 5CVJA 5E1WA 1LEBA 2EJRA 1XGMA 3WGHA 4KMFA 2DT5A 2PMHA 1B9MA 1SFXA 3ZP5A 3Q9SA 4HAMA 3IRQA 2QQBA 2GA2A 3JTHA 2XAFA 4XSXF 3CO6C 2ZMEB 1BIAA 3ML6A 3HUGA 2KRFA 3RDIA 3GFLA 1R1TA 1P6RA 3U1DA 4D0PA 4HA8A 4L0ZB 4UV9A 2QLZA 3GFIA 2FMYA 2G7UA 4MGRA 1IW7F 4WXHA 4BNCA 3BWGA 1TQIA 3FWEA 4EVIA 2CGPA 2L02A 1K79A 2EB7A 5E1ZB 2OQGA 5KK1A 2VXZA 4RB3C 1J9IA 3GYHX 2XROA 4M9ZA 4KFCA 5ILUA 1SD5A 1WWXA 1WKMA 4ZH4F 1YW9A 1RIOH 4XBFA 3BPXA 1KYWA 1K78A 4G94A 2Q8KA 4CYDA 3IHUA 3RIRA 2W25A 5IT3A 3Q9VA 3KZYA 3BY6A 2F2EA 2QQAA 3V7SA 2H27A 5FLXK 5BPDA 5L3CA 1KQ8A 5LGUA 3WTWC 1B59A 3IL2A 4GYGA 1ZLJA 3KP4A 1XN7A 1SD4A 4IPAA 4L9VA 4MNUA 5E8IA 2XVCA 5LEJA 3HHGA 4U7DA 4TV7A 2FMLA 1BOAA 2PMUA 5FLXZ 1ZG5A 2RVCA 2MC3A 4A12A 3GFMA 2NS0A 4U0VA 1KA8A 1BI3A 2ADUA 3MWMA 2P7CB 4IXAA 3WU1B 4RGUA 2OAZA 1QZYA 2DTRA 4ZYGA 1Q1HA 2EFQA 3M8EA 3IRRA 2VE9A 2JT1A 3TGNA 1ZRDA 1XDUA 2GZWA 3JSOA 1Z91A 1H0MA 1XCBA 4ENKA 1G3YA 3WTSC 4EJUA 3ABUA 3WU0A 1P92A 2B0LA 3IKVA 4EJOA 4Q4ZF 3FX3A 2H94A 4Q47A 1FBSA 1HKSA 4IVNA 4A2UA 1TW3A 5BMZA 2ZJ2A 4HW0A 2XV4S 2ZFWA 1IRFA 1OMIA 2NRAC 4EGYA 4MTEA 3LQQA 2F5CA 3DFGA 4PDKA 2KKOA 5JHUA 4G7HF 1TBXA 3HSFA 3MFKA 3LSTA 3TDZC 1LVAA 3LA3A 1PP8F 3ZMUA 3ZMDA 5BQTA 3EETA 4EM1A 2OA4A 2P6TA 1USSA 2ELHA 5CVRA 3WTVC 4GGGA 4ENMA 2KJCA 1K78B 1QNTA 2DQLA 5FGMA 4H0EA 2QVOA 4S05A 4FX4A 1QPMA 4M73A 5D5XB 3F22A 3BROA 3CDHA 2P5VA 3RYRA 4A0ZA 4Q5SF 1R5HA 5J8FA 4UNOA 1HXDA 3R61A 4OOIA 3ELKA 4EM2A 1BBYA 5LRSA 4HV6A 1IN4A 4HQMA 3FXQA 4A0YA 3ZMZA 3IC7A 2M1BA 5DCMB 5LHGA 1U5TB 3K1PA 3WODF 3CJNA 2XAQA 3ABTA 5ILVA 4JBAA 3GLXA 2E7WA 3F6VA 2HEOA 1GHCA 3C3WA 3HSRA 2COMA 1Z6RA 3KCCA 1IAWA 1T0FA 1ODDA 1JHHA 5J6XA 3M8FA 2MH2A 2E1NA 3T8TA 3TDUC 2JSCA 1HBXG 1D3YA 2IVMA 4RB2C 2CW0F 3WTTC 1Z6TA 3EYIA 3WGGA 4LG0A 5LGNA 4AD9A 5AIPA 3REOA 2JZYA 3VEPA 3JSPA 3L2CA 2NAZA 2YX7A 3E6DA 4M9XA 2RC4A 2QBYA 4ZYDA 3QAHA 5HLGA 4OIOF 2A69F 2P8TA 4IF4A 4MEXF 4XLPF 2PLYA 3RJPA 4M71A 3P9KA 1T38A 4M9SA 1BM9A 2QM3A 3HRMA 2DO7A 4WWCA 1X3UA 2AS5F 3R6SA 1R58A 2O8XA 1STZA 2RN7A 5D4SA 2OBPA 2FSWA 4BYYA 1F9NA 3JAMZ 4HBLA 4KN4X 2UXXA 4KIFA 1SFUA 2L4AA 4Y13A 4HOBA 5CYVA 2IRFG 1P2FA 3HHHA 3HTUA 4HV5A 3LFKA 2XAJA 3ZPLA 2V9VA 1UCRA 3F6OA 2V6CA 5D6FA 1K6OA 5K5QA 5F64A 5H6RA 1IN8A 5LHIA 1FBQA 4IHTA 3MQ0A 3ECOA 4GCVA 1FSEA 3P9IA 4U0WA 3FM3A 3ULQB 2A07F 3V8JA 2L01A 1DUXC 5A2QZ 4EM0B 3H3UA 4CICA 2O6GE 4HX4A 2D1HA 4UVCA 2GXGA 5HS8A 1LDKB 4G7ZF 1GXQA 4BH9A 2UXNA 1S6LA 3TO6A 1YW7A 3TO9A 5D8KB 2V79A 1ZGAA 4GO1A 1ZLKA 2DPDA 2ACJA 2BE5F 1Z05A 2HDCA 1SFEA 5L3FA 3I54A 5JR3A 3GF2A 5LBQA 4WK8F 1SD7A 2MBFA 3HRSA 4ENJA 1CF7B 1ZH5A 1XMKA 1LEAA 1USTA 2EA4A 4M74A 2Y0MA 2EFWA 4BXUA 4ESJA 1OKRA 2KJBA 1XGOA 2ZCWA 2GA1A 4B09A 2GQQA 4L9TA 3J81K 1VTNC 5A2QK 5CVUA 4HLXA 2OQRA 2E1CA 1RI7A 3E6BA 4G6DA 4Y17A 2FA5A 2QENA 3R0JA 1RUOA 2D1VA 4GXOA 3LA2A 2IJLA 2XKPA 4YIFA 3DPLC 1HW1A 3W6KB 5IT9Z 2WWYA 2W84A 3O3KA 3HOSA 4RGSA 2DBBA 5D5VB 5E17F 1TNTA 3GXOA 1ZG1A 1U5TC 1ZHFA 1FNNA 1ZRFA 5H20A 4EQQA 4KMUX 4BHPA 5FD5A 3EDPA 1YS6A 2A5YB 4CO8A 1JXSA 2Y75A 1D8JA 5LLQA 3I0TA 4WXDA 5K5OA 1FP2A 2VE8A 1TNSA 1WRJA 1YYVA 2FRHA 1TTYA 3I59B 3F3XA 1V3FA 1YLFA 1IF1A 1FSHA 2DI3A 5K1YA 1T39A 1L3LA 4DQ2A 3GEZA 3MZYA 1DPRA 2Z5UA 2MD5A 3WTZA 4FX0A 5BOXA 1OPCA 2PFBA 3K9TA 1FX7A 3EUHA 1Y0UA 1KU3A 4MQ9F 2HQRA 3E6MA 1B9NA 4HX7A 4O3MA 2GIVA 4RB1A 3IWFA 3F72A 1MJAA 3QU6A 2M87A 5CJ9A 1IXCA 1KGSA 1KU7A 3NQOA 5EEHA 1KQ9A 3SHFA 3KLOA 1JHFA 3RPUA 5E20A 3U9GA 1FWZA 2IW5A 1YG2A 1MJ9A 1SD6A 4XSZF 1JGSA 5DUIA 2LNBA 3ZMTA 2XGXA 2K7LA 1FBUA 3S2WA 3L7WA 3RPQA 4IHSA 1L0OC 4A5MA 4L9JA 2X4HA 3L9FA 1XB4A 1QBJA 4MHGA 2STTA 1ONVA 1J7KA 4F7ZA 2DK5A 2CFXA 2MLGA 1HQCA 4IJAA 1O3SA 1XD7A 3BOQA 4AIJA 1OYIA 2RQPA 1DPUA 3I58A 4PGHA 5FFZA 2OU2A 1HKTA 2FU4A 3FHZA 5IT9K 5DCFA 3D0SA 4LFUA 2HS5A 4ZYEA 1XMAA 2FOKA 4O6JA 2FBHA 3K69A 1ZN2A 1QQIA 4I0BA 3GWZA 3HSEA 3RTRA 4EJVA 3QOPA 4OIQF 3VB2A 3U2RA 4QWQA 2YX4A 1WI9A 3CTAA 5D5WB 5E8GA 2BEOA 2BV6A 3WGIA 4IRHA 1UFMA 2VOOA 1EH6A 4U88A 1LJ9A 1S7AA 4ESFA 2QWWA 5H6QA 2HTSA 1PP7U 5E18F 3MEXA 3JW4A 2VC1A 4UUVA 3FXUA 4OMZA 1GVJA 2PQ8A 1FZPB 1BI0A 3TOBA 5HDGA 1YW8A 2YSRA 1R23A 2LF8A 2HZTA 1G3SA 1BN5A 2WV0A 3EYYA 2KIMA 5D4RA 3QU3A 1I1SA 2XAHA 2R7FA 1S7OA 1P4XA 3CUQB 2O03A 4CXFA 2W24A 1XGSA 1RNLA 5EEGA 4LK1F 1FOKA 3R0AA 3I4PA 3JTGA 2QZ8A 4HF1A 3R60A 4N9IA 2CO5A 1QZZA 3BP8A 1BI2A 2PG4A 4A0XA 5ED4A 4Y15A 2XRNA 3QPTA 3HYIA 2DQRA 3BJAA 4UXNA 4DNCA 1FY7A 1HW2A 1O3TA 1AWCA 4Z2YA 1Z9CA 2HQNA 4R79A 2DAOA 2J5PA 5L3BA 1TLHB 3QPHA 3W6JB 5L3GA 2FF4A 1PUEE 2TDXA 1CGPA 2KIUA 5ERIA 2HFHA 4EV0A 5KVRA 5HVQC 3T8RA 2VC0A 3CUOA 2FXAA 1FC3A 3KP2A 1ZG3A 1JE8A 3FMRA 1SAXA 1J75A 3HTSB 3K1NA 2L3DA 2PN6A 4YIIA 2DU9A 2ESNA 3F23A 1UHMA 2NNNA 4FT8A 4PZJA 3TKYA 3KP7A 3F8FA 1RZ4A 3RKWA 3FMQA 4ETSA 2QUFA 1YTYA 2V1DA 2DFIA 5FFXA 2RKHA 1XGNA 5D5UB 4KDPA 4I7HA 2QBYB 4LGWA 2DLLA 1MDMA 3GW2A 2PEXA 4HF0A 2GXBA 2VBXA 3F8NA 4XRFA 2A61A 5HLIA 4HYEA 5JFRA 5F6FA 1BC8C 2XHKA 2LSOA 5HS7A 2FNAA 1KU9A 1B4AA 1ZRCA 1XDSA 3D5LA 4LLNA 4L18B 2OD5A 2HKXA 1O57A 2CSOA 1I1GA 2A3SA 1K7AA 5ICFA 2O61A 2F5EA 5JVTA 4ZZDA 3BZ6A 3I64A 4YFXF 4JK1X 2D45A 2VODA 3N97A 2LF7A 2JPBA 2ETHA 1T6SA 4OU0A 1E2XA 3E5UA 4R1HA 3GZ5A 1OYYA 2HWVA 1ULYA 3KETA 2W57A 2Y48A 3K1MA 3QP5A 3O2PE 4P5OA 1Z7UA 3CUQA 1SMYF 3P9CA 4O5VA 4KT5C 2RDPA 1IN5A 1ZAOA 2CG4A 3KLNA 3B73A 4I01A 1G3TA 4OIRF 2GAUA 5DYMA 3SXYA 3GO5A 3DQVC 2Z3YA 3WTXC 3ZMVA 4KUMA 1KQ0A 2EV5A 1YFHA 2HOEA 4LMYA 3HRUA 5K5RA 5LGTA 1W7PD 2XASA 2K4BA 3FM5A 2XAGA 4RGRA 3RI4A 4ZYHA 4MTDA 1B1BA 1W4MA 3E6CC 2O0YA 2XKOA 2ZKZA 3I71A 3I53A 1ON2A 3M7GA 4KN7X 3BDDA 3QRFF 1SMTA 1I6XA 3WTYC 4UVBA 1O7LA 4NHJA 1UB9A 3KZZA 3HRTA 1I5ZA 4A5NA 3HIFA 4L5IA 4UHTA 1YS7A 4I0AA 1ON1A 4ESBA 3G3ZA 1S29A 1ZARA 3MAJA 3HOTA 3R4KA 1ZYRF 4U0YA 2EA2A 3KP6A 3PQKA 2E7XA 2Q0OA 3VFZA 2KIFA 2L54A 5FO5A 1S3JA 2K86A 1T98A 3WE3A 1FYMA 3T0YA 1U6GA 2EFOA 1HSJA 1G4DA 1E17A 4WCGA 4HLYA 5DD8A 3O6BB 4Q48A 3DKWA 1FYLA 3F8BA 1P4WA 4WXCA 1IXSB 2R7DA 3GUDA 3F21A 5BPIA 4YG2F 2W85A 2DPUA 2DK8A 3V4GA 3BJOA 1DDNA 4LLGF 2VT3A 4PGGA 5CVVA 1R00A 1W5TA 1BI1A 2PJPA 2G9WA 2EK5A 4EJTA 2M8EA 4BHBA 4EJWA 2JPCA 4FHTA 3SQNA 1IXRC 3Q5FA 2VOPA 4RGXA 3V8LA 3F8CA 2HKOA 3WG9A 4I02A 4M72A 2HTJA 2WC2A 5AONA 4BQAA 2MH9A 3MZHA 3F8MA 1YO5C 3GX4X 2NNYA 2QQ9A 2Z33A 1V4RA 2XIGA 1KYZA 2H6BA 1H9TA 4MEYF 4OIPF 4KIBA 3FF5A 1LNWA 3IWZA 1GXPA 1B6AA 3LA7A 3P7NA 2C6YA 4OMYA 2VBWA 5D8LB 5ICGA 3FZVA 3MCZA 3H3ZA 1DP7P 4G7OF 3DP7A 5DEQA 2RNJA 2M45A 4WF2A 3ZN0A 1LQ1A 2HYFA 5FD6A 5J8CA 3WTUC 3SFZA 2DW4A 1NHAA 1C0WA 1H9GA 4P9UA 2VT2A 4L5JA 4XLNF 2CYYA 1F1ZA 2MLKA 1XSVA 2P5KA 3CO7C 4LLLA 4P9FA 2IPQX 4AIHA 2M30A 2A6EF 4QLCU 4NB5A 2Z99A 1O7FA 2X0LA 2P6SA 1MKMA 1J0RA 2P4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW2 A;  5E1X A;  1FP1 D;  1UHW A;  4G6Q A;  4WX9 A;  5L3D A;  4I2O A;  5BS6 A;  1YQA A;  2P7V B;  4ON0 A;  4LJZ F;  5TRD A;  3KP5 A;  3AAF A;  3C18 A;  4M6X A;  4AIK A;  1MZB A;  1IN6 A;  4M6Y A;  4BAY A;  4A6D A;  3TQN A;  2EFN A;  3OOP A;  2K27 A;  2FNP A;  4I09 A;  3J81 Z;  2EWN A;  5CLS A;  5LEK A;  5F1R A;  5ILS A;  3J80 K;  2IT0 A;  1WSU A;  4LB5 A;  3WE2 A;  3KEO A;  3NEU A;  1CF7 A;  2VBY A;  1IUY A;  3RYP A;  1AOY A;  3QP6 A;  2H6C A;  4S04 A;  2YU3 A;  1YIO A;  4K2E A;  3FMS A;  1O3Q A;  2BGC A;  1FT9 A;  3V7R A;  3LWF A;  1R1V A;  4G8X A;  2ISY A;  6PAX A;  1R5G A;  1OR7 A;  1BJA A;  3I5U A;  3TO7 A;  1OYW A;  1HKQ A;  2FBK A;  1MGT A;  2FBI A;  4CGZ A;  2EFP A;  4UVA A;  1HST A;  1HW5 A;  3BJ6 A;  2V1U A;  4L0Y B;  2ZO4 A;  3T5X A;  3LAJ A;  5LRR A;  2BBY A;  4HF2 A;  4LB6 B;  4P55 A;  2BYV E;  2PBI A;  3J7A O;  1PDN C;  2EV6 A;  4KYW A;  2R3S A;  2CWE A;  1W7P A;  2LKP A;  1MDM B;  2IA1 A;  1IRG A;  3GZ6 A;  3PQJ A;  3N4M A;  2ZXJ A;  2VBZ A;  3L00 A;  3B02 A;  1TQP A;  4HDV A;  4ZZL A;  2MA3 A;  3FXR A;  4PCQ A;  4E70 A;  2EV0 A;  1U8R A;  2A6H F;  3KE2 A;  2UZK A;  1MJB A;  2XUB A;  4A6E A;  3TOA A;  1A04 A;  5HS9 A;  3PFI A;  1EV7 A;  2YR2 A;  4JQF A;  5L3E A;  2F5F A;  4EGZ A;  1R22 A;  3DV8 A;  2OZ6 A;  1Z1D A;  4L9N A;  5DCM A;  3E5X A;  2ZNY A;  1G6N A;  4IRG A;  3ISP A;  4G9Y A;  5HDK A;  4CHU A;  2J5O A;  1QGP A;  1FPQ A;  5LHH A;  4CZZ A;  4R8H A;  2ZBK A;  2M5W A;  3L09 A;  1RUN A;  1FYK A;  3DEU A;  1LB2 A;  4GYI A;  3M1E A;  4KIG A;  1I27 A;  1TQM A;  5HDN A;  1XCV A;  2WTE A;  1R7J A;  2ISZ A;  5ICC A;  4EMS A;  1IZ1 A;  5DUK A;  2FE3 A;  4NQW A;  4KIC A;  4U7B A;  5CVI A;  1W5S A;  2V1X A;  4ASN A;  3IKT A;  5D6E A;  2VON A;  1D5V A;  2LDU A;  4KNY A;  1J59 A;  2JRT A;  1R1U A;  1U5T A;  4HX8 A;  3V8K A;  3RKY A;  3ZN1 A;  5DD4 A;  5AIQ A;  1F5T A;  4RAZ A;  3COA C;  4ENN A;  2A68 F;  1EH8 A;  4LK0 F;  1FLI A;  4HQE A;  3DF8 A;  2Z9O A;  3V7C A;  3C7J A;  3T1B A;  2GWR A;  2AXL A;  2STW A;  1ZRE A;  4RAY A;  1G3W A;  4UV8 A;  3SZP A;  1U78 A;  3M9A A;  3E3V A;  2VN2 A;  3GVA A;  5TJJ A;  1R36 A;  4HDU A;  2O3F A;  3ZMS A;  3KFW X;  2IP2 A;  2OZU A;  1BC7 C;  2D2W A;  4CDG A;  4AWX B;  1XSX A;  3NRV A;  2RGV A;  2YPR A;  2IA2 A;  5JI6 A;  2RV8 A;  3K0L A;  4AVP A;  4HZF A;  2HR3 A;  4B8X A;  1F4K A;  2G7H A;  1P4A A;  3GFJ A;  4P96 A;  2ZME A;  3VOE A;  1BIB A;  1KU2 A;  3LQR A;  2FEZ A;  2QYO A;  2K02 A;  2K4J A;  5DDG A;  2HGC A;  4RS8 A;  3VOD A;  3OV8 A;  3BPV A;  1J2X A;  2IA0 A;  2UWM A;  1W7P B;  4YFN F;  4N0B A;  1LDJ A;  2L4M A;  2P5L C;  4LG0 B;  5DV5 A;  5HOO A;  1O3R A;  2PI0 A;  3KEQ A;  3SZT A;  3ECH A;  1T2K A;  3I59 A;  1WQ2 A;  3H92 A;  1MD0 A;  2Q2E A;  2ZNZ A;  2FQ3 A;  4KA4 A;  3EQL F;  3CLO A;  4OIN F;  1ZGJ A;  1LDD A;  3E5Q A;  3ERE D;  4MQV A;  3JAM K;  3G73 A;  4IRI A;  4YFK F;  1XSD A;  5ICE A;  3K2Z A;  5HLH A;  4LD5 A;  3C1D A;  2F5D A;  1EH7 A;  3KP3 A;  3ROU A;  1IN7 A;  2NYX A;  2ESH A;  3DPT A;  4N9H A;  3DXJ F;  3CUQ C;  1QO0 D;  2JTV A;  3ZQ7 A;  2HYG D;  2H09 A;  3E97 A;  3RKX A;  5FB2 A;  1J5Y A;  4RB0 A;  4BHC A;  1U2W A;  1REP C;  1S8N A;  3LAP A;  1D8K A;  2CQK A;  4I98 B;  3J80 Z;  1U3E M;  5CVJ A;  5E1W A;  1LEB A;  2EJR A;  1XGM A;  3WGH A;  4KMF A;  2DT5 A;  2PMH A;  1B9M A;  1SFX A;  3ZP5 A;  3Q9S A;  4HAM A;  3IRQ A;  2QQB A;  2GA2 A;  3JTH A;  2XAF A;  4XSX F;  3CO6 C;  2ZME B;  1BIA A;  3ML6 A;  3HUG A;  2KRF A;  3RDI A;  3GFL A;  1R1T A;  1P6R A;  3U1D A;  4D0P A;  4HA8 A;  4L0Z B;  4UV9 A;  2QLZ A;  3GFI A;  2FMY A;  2G7U A;  4MGR A;  1IW7 F;  4WXH A;  4BNC A;  3BWG A;  1TQI A;  3FWE A;  4EVI A;  2CGP A;  2L02 A;  1K79 A;  2EB7 A;  5E1Z B;  2OQG A;  5KK1 A;  2VXZ A;  4RB3 C;  1J9I A;  3GYH X;  2XRO A;  4M9Z A;  4KFC A;  5ILU A;  1SD5 A;  1WWX A;  1WKM A;  4ZH4 F;  1YW9 A;  1RIO H;  4XBF A;  3BPX A;  1KYW A;  1K78 A;  4G94 A;  2Q8K A;  4CYD A;  3IHU A;  3RIR A;  2W25 A;  5IT3 A;  3Q9V A;  3KZY A;  3BY6 A;  2F2E A;  2QQA A;  3V7S A;  2H27 A;  5FLX K;  5BPD A;  5L3C A;  1KQ8 A;  5LGU A;  3WTW C;  1B59 A;  3IL2 A;  4GYG A;  1ZLJ A;  3KP4 A;  1XN7 A;  1SD4 A;  4IPA A;  4L9V A;  4MNU A;  5E8I A;  2XVC A;  5LEJ A;  3HHG A;  4U7D A;  4TV7 A;  2FML A;  1BOA A;  2PMU A;  5FLX Z;  1ZG5 A;  2RVC A;  2MC3 A;  4A12 A;  3GFM A;  2NS0 A;  4U0V A;  1KA8 A;  1BI3 A;  2ADU A;  3MWM A;  2P7C B;  4IXA A;  3WU1 B;  4RGU A;  2OAZ A;  1QZY A;  2DTR A;  4ZYG A;  1Q1H A;  2EFQ A;  3M8E A;  3IRR A;  2VE9 A;  2JT1 A;  3TGN A;  1ZRD A;  1XDU A;  2GZW A;  3JSO A;  1Z91 A;  1H0M A;  1XCB A;  4ENK A;  1G3Y A;  3WTS C;  4EJU A;  3ABU A;  3WU0 A;  1P92 A;  2B0L A;  3IKV A;  4EJO A;  4Q4Z F;  3FX3 A;  2H94 A;  4Q47 A;  1FBS A;  1HKS A;  4IVN A;  4A2U A;  1TW3 A;  5BMZ A;  2ZJ2 A;  4HW0 A;  2XV4 S;  2ZFW A;  1IRF A;  1OMI A;  2NRA C;  4EGY A;  4MTE A;  3LQQ A;  2F5C A;  3DFG A;  4PDK A;  2KKO A;  5JHU A;  4G7H F;  1TBX A;  3HSF A;  3MFK A;  3LST A;  3TDZ C;  1LVA A;  3LA3 A;  1PP8 F;  3ZMU A;  3ZMD A;  5BQT A;  3EET A;  4EM1 A;  2OA4 A;  2P6T A;  1USS A;  2ELH A;  5CVR A;  3WTV C;  4GGG A;  4ENM A;  2KJC A;  1K78 B;  1QNT A;  2DQL A;  5FGM A;  4H0E A;  2QVO A;  4S05 A;  4FX4 A;  1QPM A;  4M73 A;  5D5X B;  3F22 A;  3BRO A;  3CDH A;  2P5V A;  3RYR A;  4A0Z A;  4Q5S F;  1R5H A;  5J8F A;  4UNO A;  1HXD A;  3R61 A;  4OOI A;  3ELK A;  4EM2 A;  1BBY A;  5LRS A;  4HV6 A;  1IN4 A;  4HQM A;  3FXQ A;  4A0Y A;  3ZMZ A;  3IC7 A;  2M1B A;  5DCM B;  5LHG A;  1U5T B;  3K1P A;  3WOD F;  3CJN A;  2XAQ A;  3ABT A;  5ILV A;  4JBA A;  3GLX A;  2E7W A;  3F6V A;  2HEO A;  1GHC A;  3C3W A;  3HSR A;  2COM A;  1Z6R A;  3KCC A;  1IAW A;  1T0F A;  1ODD A;  1JHH A;  5J6X A;  3M8F A;  2MH2 A;  2E1N A;  3T8T A;  3TDU C;  2JSC A;  1HBX G;  1D3Y A;  2IVM A;  4RB2 C;  2CW0 F;  3WTT C;  1Z6T A;  3EYI A;  3WGG A;  4LG0 A;  5LGN A;  4AD9 A;  5AIP A;  3REO A;  2JZY A;  3VEP A;  3JSP A;  3L2C A;  2NAZ A;  2YX7 A;  3E6D A;  4M9X A;  2RC4 A;  2QBY A;  4ZYD A;  3QAH A;  5HLG A;  4OIO F;  2A69 F;  2P8T A;  4IF4 A;  4MEX F;  4XLP F;  2PLY A;  3RJP A;  4M71 A;  3P9K A;  1T38 A;  4M9S A;  1BM9 A;  2QM3 A;  3HRM A;  2DO7 A;  4WWC A;  1X3U A;  2AS5 F;  3R6S A;  1R58 A;  2O8X A;  1STZ A;  2RN7 A;  5D4S A;  2OBP A;  2FSW A;  4BYY A;  1F9N A;  3JAM Z;  4HBL A;  4KN4 X;  2UXX A;  4KIF A;  1SFU A;  2L4A A;  4Y13 A;  4HOB A;  5CYV A;  2IRF G;  1P2F A;  3HHH A;  3HTU A;  4HV5 A;  3LFK A;  2XAJ A;  3ZPL A;  2V9V A;  1UCR A;  3F6O A;  2V6C A;  5D6F A;  1K6O A;  5K5Q A;  5F64 A;  5H6R A;  1IN8 A;  5LHI A;  1FBQ A;  4IHT A;  3MQ0 A;  3ECO A;  4GCV A;  1FSE A;  3P9I A;  4U0W A;  3FM3 A;  3ULQ B;  2A07 F;  3V8J A;  2L01 A;  1DUX C;  5A2Q Z;  4EM0 B;  3H3U A;  4CIC A;  2O6G E;  4HX4 A;  2D1H A;  4UVC A;  2GXG A;  5HS8 A;  1LDK B;  4G7Z F;  1GXQ A;  4BH9 A;  2UXN A;  1S6L A;  3TO6 A;  1YW7 A;  3TO9 A;  5D8K B;  2V79 A;  1ZGA A;  4GO1 A;  1ZLK A;  2DPD A;  2ACJ A;  2BE5 F;  1Z05 A;  2HDC A;  1SFE A;  5L3F A;  3I54 A;  5JR3 A;  3GF2 A;  5LBQ A;  4WK8 F;  1SD7 A;  2MBF A;  3HRS A;  4ENJ A;  1CF7 B;  1ZH5 A;  1XMK A;  1LEA A;  1UST A;  2EA4 A;  4M74 A;  2Y0M A;  2EFW A;  4BXU A;  4ESJ A;  1OKR A;  2KJB A;  1XGO A;  2ZCW A;  2GA1 A;  4B09 A;  2GQQ A;  4L9T A;  3J81 K;  1VTN C;  5A2Q K;  5CVU A;  4HLX A;  2OQR A;  2E1C A;  1RI7 A;  3E6B A;  4G6D A;  4Y17 A;  2FA5 A;  2QEN A;  3R0J A;  1RUO A;  2D1V A;  4GXO A;  3LA2 A;  2IJL A;  2XKP A;  4YIF A;  3DPL C;  1HW1 A;  3W6K B;  5IT9 Z;  2WWY A;  2W84 A;  3O3K A;  3HOS A;  4RGS A;  2DBB A;  5D5V B;  5E17 F;  1TNT A;  3GXO A;  1ZG1 A;  1U5T C;  1ZHF A;  1FNN A;  1ZRF A;  5H20 A;  4EQQ A;  4KMU X;  4BHP A;  5FD5 A;  3EDP A;  1YS6 A;  2A5Y B;  4CO8 A;  1JXS A;  2Y75 A;  1D8J A;  5LLQ A;  3I0T A;  4WXD A;  5K5O A;  1FP2 A;  2VE8 A;  1TNS A;  1WRJ A;  1YYV A;  2FRH A;  1TTY A;  3I59 B;  3F3X A;  1V3F A;  1YLF A;  1IF1 A;  1FSH A;  2DI3 A;  5K1Y A;  1T39 A;  1L3L A;  4DQ2 A;  3GEZ A;  3MZY A;  1DPR A;  2Z5U A;  2MD5 A;  3WTZ A;  4FX0 A;  5BOX A;  1OPC A;  2PFB A;  3K9T A;  1FX7 A;  3EUH A;  1Y0U A;  1KU3 A;  4MQ9 F;  2HQR A;  3E6M A;  1B9N A;  4HX7 A;  4O3M A;  2GIV A;  4RB1 A;  3IWF A;  3F72 A;  1MJA A;  3QU6 A;  2M87 A;  5CJ9 A;  1IXC A;  1KGS A;  1KU7 A;  3NQO A;  5EEH A;  1KQ9 A;  3SHF A;  3KLO A;  1JHF A;  3RPU A;  5E20 A;  3U9G A;  1FWZ A;  2IW5 A;  1YG2 A;  1MJ9 A;  1SD6 A;  4XSZ F;  1JGS A;  5DUI A;  2LNB A;  3ZMT A;  2XGX A;  2K7L A;  1FBU A;  3S2W A;  3L7W A;  3RPQ A;  4IHS A;  1L0O C;  4A5M A;  4L9J A;  2X4H A;  3L9F A;  1XB4 A;  1QBJ A;  4MHG A;  2STT A;  1ONV A;  1J7K A;  4F7Z A;  2DK5 A;  2CFX A;  2MLG A;  1HQC A;  4IJA A;  1O3S A;  1XD7 A;  3BOQ A;  4AIJ A;  1OYI A;  2RQP A;  1DPU A;  3I58 A;  4PGH A;  5FFZ A;  2OU2 A;  1HKT A;  2FU4 A;  3FHZ A;  5IT9 K;  5DCF A;  3D0S A;  4LFU A;  2HS5 A;  4ZYE A;  1XMA A;  2FOK A;  4O6J A;  2FBH A;  3K69 A;  1ZN2 A;  1QQI A;  4I0B A;  3GWZ A;  3HSE A;  3RTR A;  4EJV A;  3QOP A;  4OIQ F;  3VB2 A;  3U2R A;  4QWQ A;  2YX4 A;  1WI9 A;  3CTA A;  5D5W B;  5E8G A;  2BEO A;  2BV6 A;  3WGI A;  4IRH A;  1UFM A;  2VOO A;  1EH6 A;  4U88 A;  1LJ9 A;  1S7A A;  4ESF A;  2QWW A;  5H6Q A;  2HTS A;  1PP7 U;  5E18 F;  3MEX A;  3JW4 A;  2VC1 A;  4UUV A;  3FXU A;  4OMZ A;  1GVJ A;  2PQ8 A;  1FZP B;  1BI0 A;  3TOB A;  5HDG A;  1YW8 A;  2YSR A;  1R23 A;  2LF8 A;  2HZT A;  1G3S A;  1BN5 A;  2WV0 A;  3EYY A;  2KIM A;  5D4R A;  3QU3 A;  1I1S A;  2XAH A;  2R7F A;  1S7O A;  1P4X A;  3CUQ B;  2O03 A;  4CXF A;  2W24 A;  1XGS A;  1RNL A;  5EEG A;  4LK1 F;  1FOK A;  3R0A A;  3I4P A;  3JTG A;  2QZ8 A;  4HF1 A;  3R60 A;  4N9I A;  2CO5 A;  1QZZ A;  3BP8 A;  1BI2 A;  2PG4 A;  4A0X A;  5ED4 A;  4Y15 A;  2XRN A;  3QPT A;  3HYI A;  2DQR A;  3BJA A;  4UXN A;  4DNC A;  1FY7 A;  1HW2 A;  1O3T A;  1AWC A;  4Z2Y A;  1Z9C A;  2HQN A;  4R79 A;  2DAO A;  2J5P A;  5L3B A;  1TLH B;  3QPH A;  3W6J B;  5L3G A;  2FF4 A;  1PUE E;  2TDX A;  1CGP A;  2KIU A;  5ERI A;  2HFH A;  4EV0 A;  5KVR A;  5HVQ C;  3T8R A;  2VC0 A;  3CUO A;  2FXA A;  1FC3 A;  3KP2 A;  1ZG3 A;  1JE8 A;  3FMR A;  1SAX A;  1J75 A;  3HTS B;  3K1N A;  2L3D A;  2PN6 A;  4YII A;  2DU9 A;  2ESN A;  3F23 A;  1UHM A;  2NNN A;  4FT8 A;  4PZJ A;  3TKY A;  3KP7 A;  3F8F A;  1RZ4 A;  3RKW A;  3FMQ A;  4ETS A;  2QUF A;  1YTY A;  2V1D A;  2DFI A;  5FFX A;  2RKH A;  1XGN A;  5D5U B;  4KDP A;  4I7H A;  2QBY B;  4LGW A;  2DLL A;  1MDM A;  3GW2 A;  2PEX A;  4HF0 A;  2GXB A;  2VBX A;  3F8N A;  4XRF A;  2A61 A;  5HLI A;  4HYE A;  5JFR A;  5F6F A;  1BC8 C;  2XHK A;  2LSO A;  5HS7 A;  2FNA A;  1KU9 A;  1B4A A;  1ZRC A;  1XDS A;  3D5L A;  4LLN A;  4L18 B;  2OD5 A;  2HKX A;  1O57 A;  2CSO A;  1I1G A;  2A3S A;  1K7A A;  5ICF A;  2O61 A;  2F5E A;  5JVT A;  4ZZD A;  3BZ6 A;  3I64 A;  4YFX F;  4JK1 X;  2D45 A;  2VOD A;  3N97 A;  2LF7 A;  2JPB A;  2ETH A;  1T6S A;  4OU0 A;  1E2X A;  3E5U A;  4R1H A;  3GZ5 A;  1OYY A;  2HWV A;  1ULY A;  3KET A;  2W57 A;  2Y48 A;  3K1M A;  3QP5 A;  3O2P E;  4P5O A;  1Z7U A;  3CUQ A;  1SMY F;  3P9C A;  4O5V A;  4KT5 C;  2RDP A;  1IN5 A;  1ZAO A;  2CG4 A;  3KLN A;  3B73 A;  4I01 A;  1G3T A;  4OIR F;  2GAU A;  5DYM A;  3SXY A;  3GO5 A;  3DQV C;  2Z3Y A;  3WTX C;  3ZMV A;  4KUM A;  1KQ0 A;  2EV5 A;  1YFH A;  2HOE A;  4LMY A;  3HRU A;  5K5R A;  5LGT A;  1W7P D;  2XAS A;  2K4B A;  3FM5 A;  2XAG A;  4RGR A;  3RI4 A;  4ZYH A;  4MTD A;  1B1B A;  1W4M A;  3E6C C;  2O0Y A;  2XKO A;  2ZKZ A;  3I71 A;  3I53 A;  1ON2 A;  3M7G A;  4KN7 X;  3BDD A;  3QRF F;  1SMT A;  1I6X A;  3WTY C;  4UVB A;  1O7L A;  4NHJ A;  1UB9 A;  3KZZ A;  3HRT A;  1I5Z A;  4A5N A;  3HIF A;  4L5I A;  4UHT A;  1YS7 A;  4I0A A;  1ON1 A;  4ESB A;  3G3Z A;  1S29 A;  1ZAR A;  3MAJ A;  3HOT A;  3R4K A;  1ZYR F;  4U0Y A;  2EA2 A;  3KP6 A;  3PQK A;  2E7X A;  2Q0O A;  3VFZ A;  2KIF A;  2L54 A;  5FO5 A;  1S3J A;  2K86 A;  1T98 A;  3WE3 A;  1FYM A;  3T0Y A;  1U6G A;  2EFO A;  1HSJ A;  1G4D A;  1E17 A;  4WCG A;  4HLY A;  5DD8 A;  3O6B B;  4Q48 A;  3DKW A;  1FYL A;  3F8B A;  1P4W A;  4WXC A;  1IXS B;  2R7D A;  3GUD A;  3F21 A;  5BPI A;  4YG2 F;  2W85 A;  2DPU A;  2DK8 A;  3V4G A;  3BJO A;  1DDN A;  4LLG F;  2VT3 A;  4PGG A;  5CVV A;  1R00 A;  1W5T A;  1BI1 A;  2PJP A;  2G9W A;  2EK5 A;  4EJT A;  2M8E A;  4BHB A;  4EJW A;  2JPC A;  4FHT A;  3SQN A;  1IXR C;  3Q5F A;  2VOP A;  4RGX A;  3V8L A;  3F8C A;  2HKO A;  3WG9 A;  4I02 A;  4M72 A;  2HTJ A;  2WC2 A;  5AON A;  4BQA A;  2MH9 A;  3MZH A;  3F8M A;  1YO5 C;  3GX4 X;  2NNY A;  2QQ9 A;  2Z33 A;  1V4R A;  2XIG A;  1KYZ A;  2H6B A;  1H9T A;  4MEY F;  4OIP F;  4KIB A;  3FF5 A;  1LNW A;  3IWZ A;  1GXP A;  1B6A A;  3LA7 A;  3P7N A;  2C6Y A;  4OMY A;  2VBW A;  5D8L B;  5ICG A;  3FZV A;  3MCZ A;  3H3Z A;  1DP7 P;  4G7O F;  3DP7 A;  5DEQ A;  2RNJ A;  2M45 A;  4WF2 A;  3ZN0 A;  1LQ1 A;  2HYF A;  5FD6 A;  5J8C A;  3WTU C;  3SFZ A;  2DW4 A;  1NHA A;  1C0W A;  1H9G A;  4P9U A;  2VT2 A;  4L5J A;  4XLN F;  2CYY A;  1F1Z A;  2MLK A;  1XSV A;  2P5K A;  3CO7 C;  4LLL A;  4P9F A;  2IPQ X;  4AIH A;  2M30 A;  2A6E F;  4QLC U;  4NB5 A;  2Z99 A;  1O7F A;  2X0L A;  2P6S A;  1MKM A;  1J0R A;  2P4W A; 
#chains in the Genus database with same CATH topology
 2JMW A;  4FTH A;  1TW2 A;  2VQG A;  1H88 C;  5E1X A;  3BR0 A;  1FP1 D;  4DBR A;  4JYK A;  1UHW A;  5KAI C;  4CCJ A;  2LR8 A;  1WH5 A;  2L9S A;  4G6Q A;  4WX9 A;  1DP3 A;  1OCP A;  1K4T A;  2GOX B;  1WZ2 A;  1T56 A;  4W1U A;  1E3O C;  3G1M A;  1Z67 A;  5L3D A;  4I2O A;  5BS6 A;  5E3M A;  1OJL A;  3OL3 A;  2E2H J;  1YQA A;  2P7V B;  4ON0 A;  4C3I J;  2X6X A;  2V9P A;  4LJZ F;  5TRD A;  1TL8 A;  2KMU A;  1UG0 A;  2OCC H;  1HF0 A;  4M3F A;  3KP5 A;  3AAF A;  3C18 A;  4A3K J;  2NOG A;  3ZQH A;  4M6X A;  4AIK A;  2B7E A;  2CV2 A;  1MZB A;  1A6Q A;  1IN6 A;  2R4G A;  4M6Y A;  4BAY A;  5JVG F;  2BHZ A;  2DYR H;  1A36 A;  1BA5 A;  4A6D A;  3TQN A;  5F1J A;  2EFN A;  3CMM A;  3JRB A;  3DBL B;  1H89 C;  4XN0 A;  1FMW A;  3OOP A;  1IV8 A;  2K27 A;  2FNP A;  4I09 A;  3J81 Z;  3QWL A;  2EWN A;  4C30 A;  5CLS A;  2KDO A;  5LEK A;  5F1R A;  5ILS A;  2DYS H;  2L7M P;  4RDU A;  3J80 K;  2IT0 A;  1WSU A;  4LB5 A;  3WE2 A;  2FJ1 A;  3KEO A;  4JX6 A;  4CUG A;  2HVR A;  2DOA A;  2H1K A;  3A01 B;  2FUG 2;  3NEU A;  2DXI A;  1CF7 A;  5TGT A;  4RMN A;  1JUM A;  1MBH A;  1UHS A;  2M3A A;  2VBY A;  3TBI A;  2CRG A;  5J1U A;  1U9N A;  3RYP A;  1W36 D;  1IUY A;  1AOY A;  2Y9Y A;  3QP6 A;  1QPI A;  2DA6 A;  1RKW A;  2H6C A;  4S04 A;  2YU3 A;  2EZI A;  5F04 A;  3AL0 B;  1YIO A;  4K2E A;  5FLM J;  3FMS A;  2TCT A;  1U8B A;  1YRN A;  1O3Q A;  2BGC A;  1R49 A;  1FT9 A;  1G2H A;  3V7R A;  3LWF A;  1R1V A;  3OYA A;  2AXT C;  4G8X A;  1FEX A;  2ZB9 A;  2ISY A;  3OYL A;  2IS2 A;  6PAX A;  4NC7 A;  3M07 A;  4AVZ A;  1TWG J;  1R5G A;  1OR7 A;  2MYS A;  4BBS J;  1BJA A;  1U9O A;  4DGW B;  3I5U A;  3CQZ J;  1R71 A;  2LC2 A;  1X1A A;  5JHF A;  3JRE A;  3TO7 A;  2CQN A;  1OYW A;  3ZQF A;  1X1P A;  1HKQ A;  2FBK A;  2LBF B;  4ANJ A;  2WBM A;  1ETQ A;  1MGT A;  2FBI A;  3A4C A;  4M3E A;  4CGZ A;  1LE8 A;  3DU6 A;  2EFP A;  3OSF A;  1YIJ I;  1V5F A;  4UVA A;  3S2D J;  1HST A;  2HI3 A;  1HW5 A;  3BJ6 A;  2CV0 A;  1JT0 A;  2V1U A;  2ID6 A;  4L0Y B;  1ACI A;  2O9L A;  3ZQL A;  1UAA A;  2CUJ A;  2ZO4 A;  2HPI A;  5CKT A;  3T5X A;  3NAU A;  3LAJ A;  5LRR A;  2BBY A;  4HF2 A;  4LB6 B;  4P55 A;  2BYV E;  2PBI A;  3J7A O;  3NAR A;  1PDN C;  2EV6 A;  4KYW A;  2R3S A;  5HOD A;  2CWE A;  1W7P A;  2LKP A;  1OCR H;  1MDM B;  3BR3 A;  2ZJP F;  2IA1 A;  1IRG A;  3GZ6 A;  5EGO A;  3PQJ A;  2ZC2 A;  3A1Y A;  4JX4 A;  2XF7 A;  3N4M A;  4II2 A;  2ZXJ A;  5HNF A;  1UMQ A;  5GTI C;  1TWA J;  2VBZ A;  2XAU A;  3L00 A;  1D0X A;  2CU7 A;  3B02 A;  3RQ4 A;  1TQP A;  1RES A;  4HDV A;  2K9M A;  4ZZL A;  2MA3 A;  3FXR A;  2LKX A;  3K10 A;  3WG7 H;  2MC4 A;  4PCQ A;  3CCJ I;  2DFF A;  3HGY A;  4PJ0 C;  4E70 A;  2EV0 A;  2X9D A;  1LFB A;  2A6H F;  4ABZ A;  1U8R A;  2IGN A;  3KE2 A;  2UZK A;  1MJB A;  2XUB A;  1FTZ A;  4A6E A;  3TOA A;  1A04 A;  3IH3 A;  3UKG A;  5HS9 A;  3PFI A;  2CUF A;  1EV7 A;  3QPS A;  2YR2 A;  4JQF A;  5L3E A;  2F5F A;  4EGZ A;  4AID A;  1R22 A;  3J7A Y;  2CJJ A;  1WJB A;  3DV8 A;  2OZ6 A;  1Z1D A;  3DTI A;  1Y6I A;  4L9N A;  5DCM A;  3E5X A;  2ZNY A;  4F3Q A;  1G6N A;  4BQQ A;  4IRG A;  3ISP A;  2RAE A;  4G9Y A;  4RLQ A;  2NVU B;  5HDK A;  4CHU A;  2J5O A;  4E7J A;  1QGP A;  3GTO J;  1FPQ A;  2LFB A;  4P1W A;  5LHH A;  3P5J A;  1YE9 A;  1IUF A;  4CZZ A;  4R8H A;  2M9H A;  2ZBK A;  2M5W A;  5IYC J;  2E60 A;  4OWR B;  3L09 A;  1RUN A;  1FYK A;  3DEU A;  1X1B A;  1V55 H;  3H9J A;  4E7S A;  4ZJZ A;  2M8G X;  1LB2 A;  4GYI A;  1NH3 A;  3M1E A;  4KIG A;  3GTG J;  1I27 A;  1TQM A;  3LMM A;  2X6Y A;  3HKZ N;  4XK4 A;  3HC7 A;  5HDN A;  2KFD A;  1XCV A;  2LH9 A;  4RBO A;  2WTE A;  4IQ4 A;  4A3E J;  1R7J A;  2ISZ A;  1ERD A;  5ICC A;  4EMS A;  3S17 J;  2VPL A;  3RSN A;  1VF9 A;  2COB A;  1VQO I;  1R6R A;  2HPM A;  5EJC A;  1IZ1 A;  5DUK A;  4XIC A;  2FE3 A;  2M0C A;  1Z0X A;  4NQW A;  3BZK A;  4KIC A;  2ZJQ F;  4U7B A;  4IEJ A;  5CVI A;  5K7Z A;  1W5S A;  2V1X A;  4ASN A;  2Q2E B;  3DEW A;  3IKT A;  5FRO A;  3DU5 A;  2VJ4 A;  1D1B A;  3LSH A;  3HM5 A;  3IP4 B;  2ZXH A;  4DYC A;  2R5Y A;  5IP9 J;  1UJ8 A;  4C2U A;  5D6E A;  4DIQ A;  1ZR2 A;  1MH3 A;  2VON A;  3LNQ A;  1D5V A;  1OFC X;  1FIP A;  3OIO A;  2LDU A;  4KNY A;  1MNM C;  3G71 I;  4QIW N;  2JK3 A;  2HXO A;  3S1Q J;  5EF6 A;  1J59 A;  2JRT A;  4V19 K;  2GM4 A;  1R1U A;  1U5T A;  3K4J A;  4XRS G;  4HX8 A;  2HOT A;  3PFY A;  1WJF A;  3V8K A;  3RKY A;  3ZN1 A;  5DD4 A;  5AIQ A;  1F5T A;  4RAZ A;  4HST A;  4X1E A;  3WHC A;  3COA C;  4ENN A;  4EEF G;  2A68 F;  1EH8 A;  4LK0 F;  1FLI A;  4HQE A;  1WVR A;  1GLN A;  1FJL A;  3DF8 A;  2Z9O A;  3HOZ J;  3V7C A;  2JA6 J;  3C7J A;  3AG4 H;  3OYK A;  1JGG A;  3T1B A;  1WFX A;  2GWR A;  1TP4 A;  2AXL A;  4RAF A;  4XOR A;  2STW A;  4UUS B;  4CCO A;  1SVO A;  1ZRE A;  4CSW A;  3HZJ A;  4RAY A;  3RZO J;  1G3W A;  2DOE A;  4UV8 A;  2I10 A;  3SZP A;  1U78 A;  2JRM A;  3M9A A;  3E3V A;  2L7Z A;  2CUZ A;  2VN2 A;  3GVA A;  3GME A;  5TJJ A;  1R36 A;  3KIO A;  4HDU A;  2BY2 A;  2P0W A;  2O3F A;  3ZMS A;  2KIQ A;  3KFW X;  2IP2 A;  2OZU A;  1YHQ I;  2JVH A;  1BC7 C;  2D2W A;  4CDG A;  4AWX B;  2KDZ A;  2IGO A;  1XSX A;  1W36 C;  3NRV A;  1POG A;  2RGV A;  2YPR A;  1SVL A;  2IA2 A;  5JI6 A;  5KNL A;  4E7I A;  2RV8 A;  2ZSI B;  1FIA A;  3OYF A;  3BTL A;  1JKQ C;  2IXS A;  4M3G A;  4E6K G;  2QSH X;  3OYE A;  3DTE A;  2OC6 A;  3K0L A;  2CMP A;  4AVP A;  1BW5 A;  4HZF A;  2HR3 A;  4B8X A;  1WI3 A;  2DDB A;  1F4K A;  4EAT A;  3CCU I;  2G7H A;  4UUS A;  1P4A A;  3GFJ A;  4P96 A;  3CES A;  2ZME A;  1JUP A;  3W6V A;  3VOE A;  1PYV A;  2K3P A;  4IHV A;  2CW8 A;  1BIB A;  3SDB A;  1IDZ A;  1XX5 A;  1KU2 A;  3LQR A;  2FEZ A;  2QYO A;  2K02 A;  2K4J A;  5DDG A;  2HGC A;  2OV7 A;  4RS8 A;  3OR1 C;  1QVU A;  3CCV I;  1X1D A;  3KEY A;  4ZDP A;  3VOD A;  3OV8 A;  3HDD A;  2E1M B;  3BPV A;  1YRN B;  3E7L A;  1P7I A;  1J2X A;  2M34 A;  5KCM A;  2IA0 A;  5FRN A;  2UWM A;  4CCK A;  2LG4 A;  1W7P B;  4YFN F;  4N0B A;  1LDJ A;  2R7S A;  2IS1 A;  2L4M A;  3HEF A;  2P5L C;  4ZDL A;  3RPU D;  1JTX A;  1Z7L A;  2E35 A;  4NDL A;  4IHW A;  2QCO A;  4LG0 B;  1BR2 A;  1XMX A;  1FOY A;  5DV5 A;  5HOO A;  3L2W A;  3G2B A;  1O3R A;  2PI0 A;  3KEQ A;  3SZT A;  1MH4 A;  3ECH A;  3GZN B;  1T2K A;  1G8X A;  4UY8 I;  3I59 A;  4XRM A;  1MND A;  1WQ2 A;  3H92 A;  1QU3 A;  5FKM A;  3MD2 A;  3IUO A;  1MD0 A;  2ZNZ A;  2Q2E A;  3ESW B;  2FQ3 A;  2F5V A;  2XPW A;  4KA4 A;  3EQL F;  1XC5 A;  1B72 A;  3CLO A;  4HNU A;  4OIN F;  1ZGJ A;  1LDD A;  3E5Q A;  3ERE D;  4MQV A;  4FQG A;  3JAM K;  3G73 A;  4MIM A;  2W82 A;  3S14 J;  3L2Q A;  3ABL H;  4IRI A;  4YFK F;  3ABM H;  1TWC J;  1XSD A;  1NK3 P;  5ICE A;  3K2Z A;  3SJM A;  3BTJ A;  5GAG J;  3HG9 A;  5HLH A;  4LD5 A;  1VQ6 I;  3C1D A;  2Q1Z B;  2F5D A;  1EH7 A;  2QKL B;  2Z2S B;  1X4P A;  2DMT A;  3FIW A;  2Y69 H;  3KP3 A;  3BZC A;  3CDI A;  4CCN A;  2IBD A;  4L5E A;  3ROU A;  5M5Y J;  3GTP J;  1IN7 A;  2NYX A;  2VQH A;  4ZDO A;  2ESH A;  3DPT A;  4G12 A;  4N9H A;  2X48 A;  3DXJ F;  3OYM A;  3CUQ C;  1QO0 D;  2JTV A;  3ZQ7 A;  2HYG D;  4HG2 A;  4XLH A;  2H09 A;  3E97 A;  3RKX A;  4A69 C;  3OMY A;  3A01 A;  3DTK A;  5FB2 A;  1PVE A;  2DMN A;  3FK7 A;  1J5Y A;  4NBQ A;  3HUG B;  4RB0 A;  4BHC A;  4KIT B;  1U2W A;  1REP C;  3K4L A;  1F36 A;  1S8N A;  4M3B A;  4AU7 A;  3LAP A;  3EUH C;  2MW8 A;  4OAZ A;  1D8K A;  5GP9 A;  2CQK A;  4I98 B;  3J80 Z;  5CPR B;  1U3E M;  3S93 A;  3LFU A;  5CVJ A;  2EIK H;  1ETO A;  4BU2 A;  4D9J A;  1OCO H;  5E1W A;  3H9Q A;  1LEB A;  2EJR A;  3CCM I;  1XGM A;  3QPL A;  3WGH A;  2DOD A;  1MSF C;  1QRY A;  5IOY A;  2DT5 A;  4KMF A;  2PMH A;  1B9M A;  1SFX A;  3LSG A;  3ZP5 A;  1RET A;  3Q9S A;  2HVS A;  4HAM A;  2BW3 A;  2QQB A;  3IRQ A;  2GA2 A;  4XOT A;  3JTH A;  2XAF A;  4XSX F;  3MKL A;  1VQ8 I;  3CO6 C;  4IZZ A;  2ZME B;  1S5L C;  1BIA A;  3ML6 A;  2YU9 J;  2DOF A;  3HUG A;  1IRX A;  1Z21 A;  1SVM A;  2MG4 A;  3BG7 A;  2KRF A;  3RDI A;  3GFL A;  1YIT I;  2H1L A;  2CFO A;  3GTQ J;  1R1T A;  1P6R A;  2BOL A;  2LRE A;  3U1D A;  4D0P A;  1RR8 C;  4HA8 A;  4L0Z B;  2KHM A;  3Q0V A;  4UV9 A;  2QLZ A;  2R5Z B;  3GFI A;  2FMY A;  4A3F J;  2G7U A;  2LLK A;  4MGR A;  1IW7 F;  4FET A;  1GUU A;  4WXH A;  3BWG A;  4BNC A;  3TED A;  3A0H C;  3A2K A;  4B48 A;  1TQI A;  1NG6 A;  5CQE A;  1YJW I;  3FWE A;  4EVI A;  4I6Z A;  2CGP A;  2L02 A;  1K79 A;  2EB7 A;  3MMY B;  2OQG A;  5E1Z B;  3DBR B;  5KK1 A;  2VXZ A;  4C2T A;  4RB3 C;  5J4Y A;  4KT6 A;  2JA5 J;  4N4O B;  1J9I A;  4PFP A;  2QEX I;  4BBR J;  3GYH X;  2XRO A;  4M9Z A;  4KFC A;  5B5E C;  5E3N A;  1NK2 P;  5ILU A;  4CCM A;  2PJR A;  5F27 A;  1SD5 A;  1WWX A;  1WKM A;  2VUM J;  2KRH A;  3PUB A;  4YRV A;  1RKT A;  5IP7 J;  4BDZ A;  4ZH4 F;  1X58 A;  3G6E I;  1YW9 A;  3FXL A;  1RIO H;  2V1N A;  2F6C A;  1ORK A;  4XBF A;  5IYB J;  4V2F A;  3BPX A;  2K5C A;  1KYW A;  1VFC A;  1K78 A;  4G94 A;  1HA8 A;  3OYI A;  2Q8K A;  1TWH J;  3H0G J;  2OUM A;  3FK6 A;  3SEZ A;  3IHU A;  3RIR A;  2W25 A;  3TL4 X;  2X6O A;  2UUZ A;  4CYD A;  3Q9V A;  3KZY A;  5IT3 A;  1YI2 I;  2B9S A;  3BY6 A;  2F2E A;  2QQA A;  2ZFU A;  3V7S A;  3BR5 A;  2H27 A;  2VKV A;  2O7O A;  5FLX K;  3ZGK A;  5BPD A;  5L3C A;  4D5C A;  1DU0 A;  5LGU A;  3WTW C;  1KQ8 A;  1YX5 A;  1B59 A;  1Y8R B;  3IAM 2;  3NWT A;  4CH7 A;  4GYG A;  3IL2 A;  4J19 A;  4B47 A;  1X3Z B;  1ZLJ A;  3KP4 A;  5IOZ A;  1XN7 A;  2IGK A;  2MD0 A;  1SD4 A;  4IPA A;  4L9V A;  4MNU A;  4RLF A;  4IOC F;  5E8I A;  4C3H J;  2XVC A;  1ZKG A;  4HEA 2;  3HHG A;  5LEJ A;  2OF7 A;  1JI8 A;  4U7D A;  4M6V A;  4ZTF A;  4TV7 A;  3TP3 A;  2FML A;  1Z3X A;  1BOA A;  2PMU A;  5FLX Z;  4FIS A;  3HL2 A;  1ZG5 A;  2RVC A;  3FXJ A;  3F0C A;  2MC3 A;  4A12 A;  3GFM A;  1BW6 A;  2NS0 A;  4U0V A;  1PJR A;  4IKF A;  4ZTJ A;  1KA8 A;  1BI3 A;  4HSR A;  4DOZ A;  3S3O A;  2ADU A;  4A93 J;  3MWM A;  3ZCO A;  2P7C B;  4IXA A;  1LVK A;  3WU1 B;  4RGU A;  1A35 A;  2OAZ A;  1DQU A;  2VI6 A;  1QZY A;  2DTR A;  1I3A A;  5EEA A;  1ZQ3 P;  3NWS A;  4ZYG A;  1Q1H A;  2EFQ A;  4XR6 A;  5HNH A;  3PSF A;  3M8E A;  3IRR A;  4PJJ A;  2GLO A;  3I4N J;  2BXY A;  1N25 A;  1X4O A;  2VE9 A;  2JT1 A;  3TGN A;  1ZRD A;  2ID3 A;  2M7A A;  1ENH A;  1XDU A;  2GZW A;  3JSO A;  1YOV B;  1Z91 A;  1H0M A;  2XGE A;  3E0J B;  1XCB A;  1KON A;  4ENK A;  1G3Y A;  2XPU A;  5E79 C;  3WTS C;  4RAG A;  3VWB A;  1MMS A;  3MN2 A;  4MLO A;  4EJU A;  1YJN I;  3ABU A;  3WU0 A;  1P92 A;  2B0L A;  2PMZ A;  3A03 A;  4HPQ A;  3DLL F;  3IKV A;  2R7X A;  4EJO A;  2QA4 I;  3PIP F;  1WJD A;  4Q4Z F;  4DJA A;  3FX3 A;  2H94 A;  3KPH A;  4Q47 A;  2HXI A;  3DKY A;  3HPH A;  4IL6 C;  4Y33 A;  1FBS A;  1HKS A;  1WJE A;  3CJQ B;  4IVN A;  4A2U A;  1TW3 A;  2AQE A;  5GTH C;  3PSI A;  2JJ7 A;  5BMZ A;  1ZK8 A;  3OYH A;  2M2E A;  3ONQ A;  4PSW A;  2ZJ2 A;  2X6W A;  4HW0 A;  4AYB A;  2XV4 S;  4BE1 A;  5TIS C;  4D1Q A;  2ZFW A;  1IRF A;  1OMI A;  2NRA C;  4PUS A;  3IH4 A;  4XN3 A;  2NS7 A;  1BOB A;  3K4N A;  2Z16 A;  3OYB A;  1MSE C;  3C2H A;  4EGY A;  4MTE A;  1XPX A;  1WCM J;  3LQQ A;  4JOM A;  2F5C A;  2EZK A;  2R7V A;  1QVT A;  3JRI A;  3DFG A;  4PDK A;  2JWT A;  2KKO A;  5JHU A;  1QHH D;  1JT6 A;  2EIN H;  5FKO A;  4G7H F;  1TBX A;  2KRC A;  3ZR8 X;  3HSF A;  4PJN A;  3MFK A;  3TP0 A;  1B8I B;  3LST A;  3TDZ C;  2DA3 A;  1JTY A;  4ITV A;  1LVA A;  3LA3 A;  3CF5 F;  3ZMU A;  1Y1W J;  1PP8 F;  2E2J J;  3ZMD A;  5BQT A;  3DBH B;  3EET A;  2P6T A;  2OA4 A;  4EM1 A;  1USS A;  4XM3 A;  4GFB A;  2ELH A;  3OYG A;  5CVR A;  3WTV C;  1E0E A;  4J01 A;  4GGG A;  4ENM A;  2KJC A;  1K78 B;  1QNT A;  3ZRG A;  2DQL A;  3FXK A;  5FGM A;  3D5S C;  4H0E A;  2A5W A;  2DA1 A;  2QVO A;  4A3I J;  4LIT A;  4E4H A;  4S05 A;  4X6A J;  3K2A A;  2EZH A;  3CJR B;  4B1R A;  4FX4 A;  1QPM A;  4C9Y A;  4M73 A;  4NNJ A;  2ME6 A;  1XTA A;  2WB1 A;  2HYJ A;  5BNG A;  4HNV A;  4AM3 A;  3DWL E;  4LIU A;  5D5X B;  3CD6 I;  3F22 A;  3BRO A;  2I8D A;  3CDH A;  2P5V A;  3RYR A;  3BQY A;  3GLL A;  4F91 B;  4A0Z A;  1IV6 A;  4Q5S F;  4J00 A;  2HDD A;  3CC7 I;  1R5H A;  4IHY A;  5J8F A;  4UNO A;  1HXD A;  5J4V A;  1B8I A;  1AA7 A;  3R61 A;  4OOI A;  3ELK A;  4EM2 A;  2WB1 N;  1BBY A;  4V2G A;  2R7O A;  5LRS A;  5E3O A;  4HV6 A;  1IN4 A;  3SFI A;  1R4N B;  1OQY A;  4HQM A;  3W2W A;  3FXQ A;  2XRL A;  1VQ4 I;  4A0Y A;  3ZMZ A;  5KAF C;  3D1N I;  3IC7 A;  2M1B A;  5DCM B;  5LHG A;  1U5T B;  3K1P A;  2F48 A;  3VYT B;  3RQI A;  3WOD F;  3HPG A;  1A5J A;  3CJN A;  3ERM A;  4B44 A;  2XGD A;  3VYU B;  2E36 A;  3AG2 H;  2XAQ A;  3ABT A;  5ILV A;  4JBA A;  2L7F P;  3GLX A;  2E7W A;  3H35 A;  3F6V A;  2HEO A;  1GHC A;  1GDT A;  3DLA A;  3C3W A;  3HSR A;  2COM A;  2EZL A;  3BR2 A;  4N4N B;  2L7K A;  1MBF A;  3U1K A;  1Z6R A;  3KCC A;  5IP6 A;  2HQ5 A;  1WH7 A;  1IAW A;  3LSJ A;  1LE8 B;  1T0F A;  3L2R A;  1ODD A;  1JHH A;  5J6X A;  3M8F A;  1ETX A;  3FKJ A;  3HOY J;  2MH2 A;  2E1N A;  2AQF A;  1AKH A;  2VXD A;  3T8T A;  3TDU C;  2JSC A;  3KX2 A;  1G59 A;  1HBX G;  2NVQ J;  1D3Y A;  2IVM A;  4RB2 C;  3J7Y J;  4MFD A;  3HB9 A;  2CW0 F;  3L2U A;  3WTT C;  1SC7 A;  3L2V A;  1Z6T A;  4RM2 A;  4XMY A;  5B1B H;  2PJR B;  3EYI A;  2HDW A;  4UUT A;  3WGG A;  3I56 I;  4LG0 A;  5LGN A;  2QKM B;  2XB0 X;  3ZQQ A;  2NXN B;  4AD9 A;  2R7U A;  5AIP A;  2X51 A;  2JZY A;  3REO A;  1D0Z A;  3VEP A;  3JSP A;  3L2C A;  1ZGW A;  2JVG A;  4BY1 J;  2NAZ A;  1OCZ H;  2BVL A;  2YX7 A;  3E6D A;  4M9X A;  2RC4 A;  2QBY A;  4ZYD A;  3QAH A;  4HNT A;  5HLG A;  4PK4 A;  4XOP A;  4OIO F;  2A69 F;  2P8T A;  2HOS A;  4IF4 A;  4MEX F;  2R5Y B;  3OYJ A;  4XLP F;  4II3 A;  3VPR A;  2R7R A;  2PLY A;  1OCC H;  1U0J A;  3I4M J;  3RJP A;  2H8W A;  3HOU J;  4M71 A;  3JRH A;  2V26 A;  3P9K A;  1T38 A;  2D5V A;  3BCA A;  4M9S A;  1CQT A;  1BM9 A;  2QM3 A;  5FKL A;  2ME0 A;  4BKX A;  4UB6 C;  2GOM A;  3HRM A;  2DO7 A;  4B43 A;  2W4S A;  4XKW A;  2W48 A;  1WHU A;  4WWC A;  3KZI C;  2V7F A;  1X3U A;  2AS5 F;  3R6S A;  3ZQG A;  1R58 A;  2O8X A;  1STZ A;  2RN7 A;  5D4S A;  2OBP A;  2FSW A;  4BYY A;  1F9N A;  4E7Z A;  3W2A A;  3JAM Z;  1MBK A;  4HBL A;  3GTJ J;  4KN4 X;  5K7F A;  2JQ7 A;  2UXX A;  4KIF A;  1SFU A;  2L4A A;  3BR6 A;  4Y13 A;  4HOB A;  5CYV A;  2R7W A;  1P7J A;  4B4C A;  2F4I A;  2E1M C;  3AKZ A;  2IRF G;  1P2F A;  3HHH A;  3HTU A;  4HV5 A;  3LFK A;  2XAJ A;  3ZPL A;  2V9V A;  2DA4 A;  4A3G J;  1UCR A;  3F6O A;  2V6C A;  3M1C A;  4AUX A;  3CME I;  5D6F A;  3EUK L;  1K6O A;  1XG1 A;  5K5Q A;  1HCR A;  5F64 A;  1ITY A;  3DPU A;  4XL9 A;  5H6R A;  1IN8 A;  4RM3 A;  1FBQ A;  5LHI A;  3OYD A;  4IHT A;  3MQ0 A;  3ECO A;  2DFH A;  2K9Q A;  4GCV A;  1FSE A;  3P9I A;  4U0W A;  3FM3 A;  3ULQ B;  1VZ0 A;  2A07 F;  1VQ5 I;  3MKW B;  3V8J A;  2K3F A;  3DKX A;  2L01 A;  3K4C A;  1DUX C;  4H4K C;  2EIJ H;  3H3U A;  2DMP A;  4EM0 B;  5A2Q Z;  4CIC A;  2MGQ A;  3QYF A;  1BR1 A;  2O6G E;  4HX4 A;  2IGM A;  2D1H A;  2DA7 A;  4UVC A;  2GXG A;  5HS8 A;  1LDK B;  1HC8 A;  4BE0 A;  4G7Z F;  1GXQ A;  4BH9 A;  3I9V 2;  2UXN A;  2ZSH B;  1S6L A;  3LSK A;  4PJM A;  1YW7 A;  3TO6 A;  4B3X A;  2NVT J;  3TO9 A;  1I3Q J;  2OTL I;  5D8K B;  4F93 B;  3OS1 A;  1H8A C;  2JA8 J;  3PO2 J;  1MBE A;  2V79 A;  1ZGA A;  4GO1 A;  1ZLK A;  4C2M J;  2DPD A;  2HQA A;  2ACJ A;  3CJT B;  2ECB A;  2BE5 F;  1Z05 A;  2HDC A;  2L5Q A;  1SFE A;  5L3F A;  2L0K A;  3I54 A;  1KZH A;  5JR3 A;  1I6H J;  3GF2 A;  5LBQ A;  4WK8 F;  1SD7 A;  2TRT A;  1AHD P;  2MBF A;  4D5F A;  4QPO A;  3HRS A;  4XLF A;  4ENJ A;  2DA2 A;  3S3N A;  1CF7 B;  1XMK A;  1ZH5 A;  1LEA A;  1UST A;  3H36 A;  3OYC A;  1BL0 A;  3SEQ A;  4BEH A;  2EA4 A;  4QSH A;  1EA3 A;  4M74 A;  2Y0M A;  2EFW A;  2ZXI A;  4PFO A;  5M3F J;  4BXU A;  4ESJ A;  1OKR A;  2KJB A;  3FBI B;  1XGO A;  2IS6 A;  2ZCW A;  2Y30 A;  1T0F C;  3FXM A;  2GA1 A;  2Z1D A;  1D1C A;  1JKP C;  4B09 A;  1E3P A;  2R5Z A;  3GTM J;  2GQQ A;  4L9T A;  4F92 B;  3J81 K;  1VTN C;  4A3C J;  1QHG A;  3EPZ A;  3OS0 A;  5A2Q K;  5CVU A;  3JRF A;  1D5Y A;  4HLX A;  2OQR A;  1F43 A;  5M5W J;  2E1C A;  1RI7 A;  3E6B A;  4G6D A;  4Y17 A;  2QSG X;  2FA5 A;  3WHB A;  1X19 A;  2KL4 A;  2QEN A;  3R0J A;  1RUO A;  2D1V A;  2ECC A;  4GXO A;  3LA2 A;  2IJL A;  3H1C A;  2XKP A;  1IJW C;  1NG7 A;  2VQC A;  2BW3 B;  4YIF A;  4LIV A;  1I39 A;  4A3B J;  3DPL C;  3M4O J;  2VKD A;  4JX5 A;  5J47 A;  2GIZ A;  1HW1 A;  2X1D A;  3A0B C;  2VQL A;  1MW7 A;  3W6K B;  1Y1V J;  2XF5 A;  3FXO A;  3BR1 A;  2QQ8 A;  4MO7 A;  2W7N A;  4RA2 A;  5IT9 Z;  4FE7 A;  3FKI J;  1NTC A;  2WWY A;  1XS9 A;  4NUB A;  2KIS A;  2W84 A;  3O3K A;  3HOS A;  3SYT A;  1S7E A;  3HOW J;  3DCF A;  4RGS A;  2VJJ A;  2DBB A;  1DGR M;  5D5V B;  5E17 F;  1TNT A;  3GXO A;  5IPA A;  2K9N A;  1U5T C;  1ZG1 A;  1ZHF A;  1ETW A;  4YEL A;  5JLW A;  1QA6 A;  5DTD A;  1K6Y A;  1FNN A;  1ZRF A;  5H20 A;  4Y7N J;  1IC8 A;  4BS9 A;  4EQQ A;  4KMU X;  5F0F A;  4BHP A;  3HOX J;  3JCU C;  3S16 J;  1X1C A;  5FD5 A;  2Y9Z A;  3EDP A;  2WAF A;  3OR2 C;  1YS6 A;  5DS9 A;  1X3W B;  2A5Y B;  4CO8 A;  1MIJ A;  1JXS A;  2Y75 A;  1D8J A;  2IEK A;  3J7Z I;  3H5R A;  2VPR A;  2KZG A;  5LLQ A;  3I0T A;  2ICW G;  4WXD A;  3TMO A;  2L9N A;  2M0M A;  3BG3 A;  4NQW B;  5K5O A;  5JLX A;  2R92 J;  1O4X A;  1FP2 A;  2VE8 A;  1TNS A;  1WRJ A;  2KLO A;  2V4J C;  1YYV A;  2FRH A;  1P9Q C;  4XQF A;  1TTY A;  3I59 B;  5EZG A;  3F3X A;  1V3F A;  2G0E A;  1IDY A;  1VI0 A;  1J09 A;  2L9R A;  3CLQ A;  1YLF A;  4LG3 A;  1IF1 A;  1FSH A;  4BJT A;  2DI3 A;  3LOC A;  5K1Y A;  1T39 A;  3LSR A;  1L3L A;  4DQ2 A;  3K70 C;  3GEZ A;  3MZY A;  5FKK A;  1DPR A;  2Z5U A;  4BE2 A;  3C2G A;  1UEL B;  2MD5 A;  1VQK I;  3WTZ A;  4FX0 A;  5BOX A;  1OPC A;  3B6C A;  4GDF A;  2PFB A;  2LKS A;  3K9T A;  3EUH A;  1FX7 A;  2E5N A;  1Y0U A;  1V54 H;  1KU3 A;  2AO9 A;  2JSP A;  3KYC B;  4MQ9 F;  2HQR A;  3E6M A;  5LFA A;  1B9N A;  1T8I A;  3LSP A;  4HX7 A;  1N78 A;  4O3M A;  3QOE A;  2GIV A;  4RB1 A;  2WAQ N;  2WY7 Q;  3ZQC A;  1WPK A;  2GXA A;  3IWF A;  1JJ6 C;  4PSX A;  3ASO H;  5H2F C;  1EF4 A;  3F72 A;  2XPV A;  3S2H J;  4NC6 A;  1MJA A;  1IGN A;  3QU6 A;  3HBL A;  3CMY A;  2RRE A;  2M87 A;  5CJ9 A;  1IXC A;  1ETV A;  1KGS A;  1KU7 A;  3LSI A;  3NQO A;  5EEH A;  1KQ9 A;  3SHF A;  3KLO A;  3CF2 A;  1A31 A;  1JHF A;  5GAE J;  3RPU A;  5E20 A;  3U9G A;  1FWZ A;  2VJ5 A;  2IW5 A;  1YG2 A;  1MJ9 A;  1SD6 A;  2KPM A;  2O8K A;  5J40 A;  2ZJR F;  4XSZ F;  3PO3 J;  3BG5 A;  9ANT A;  1JGS A;  3W2V A;  3CDL A;  4A3D J;  1Q1V A;  4CCL A;  5DUI A;  2LNB A;  1WJ5 A;  5J3L A;  3ZMT A;  2XGX A;  2IS4 A;  2DMQ A;  2K7L A;  1M1E B;  1FBU A;  3S2W A;  3Q0U A;  3L7W A;  4XRS A;  3RCO A;  2XSD C;  3RPQ A;  3ZQI A;  3IV5 A;  4IHS A;  1L0O C;  3O8G A;  4A5M A;  1ZTR A;  4L9J A;  2X4H A;  3L9F A;  4Y52 J;  1XB4 A;  5M3M J;  1QBJ A;  3AL0 C;  4MHG A;  2STT A;  1OR7 C;  1SFK A;  1TT5 B;  1ONV A;  2CQQ A;  4A3M J;  3H5A A;  2MFZ A;  1J7K A;  3VSL A;  5EZH A;  5B66 C;  4F7Z A;  2DK5 A;  2CFX A;  2MLG A;  3ZXS A;  1HQC A;  2ZXW H;  1Y0N A;  4IJA A;  1O3S A;  1XD7 A;  3BOQ A;  3EUA A;  4AIJ A;  4FE4 A;  1OYI A;  2NVY J;  3AFH A;  3G1L A;  2RQP A;  3RKQ A;  1DPU A;  3I58 A;  3MKY B;  4PGH A;  5FFZ A;  4W97 A;  2XB5 A;  2DJN A;  2OU2 A;  2UV1 A;  1HKT A;  2FU4 A;  1GV2 A;  3HGG A;  4MFE A;  3FHZ A;  5IT9 K;  2KT0 A;  5DCF A;  5C44 J;  4IX7 A;  4XON A;  3D0S A;  4LFU A;  2DT6 A;  2HS5 A;  3VSK A;  2BXZ A;  1IG7 A;  2XC7 A;  4IOA F;  4ZYE A;  1XMA A;  2FOK A;  4O6J A;  2FBH A;  2LD5 A;  3K69 A;  1ZN2 A;  3OIQ A;  2JN6 A;  4BGD A;  3I55 I;  5IYD J;  1QQI A;  4I0B A;  3GWZ A;  5K7H A;  3HSE A;  3RTR A;  4EJV A;  3QOP A;  1Y8Q B;  4OIQ F;  2EIM H;  3PIO F;  1PUF A;  3VB2 A;  2EIL H;  1S72 I;  3U2R A;  4QWQ A;  4DZP A;  4F52 A;  3OS2 A;  2YX4 A;  3CCQ I;  1WI9 A;  3CTA A;  5D5W B;  4XNF A;  5E8G A;  2BEO A;  1Z77 A;  1Y56 A;  2BV6 A;  3WGI A;  1YJ9 I;  1RRJ A;  4IRH A;  1TC3 C;  3ZOB A;  1UFM A;  2VOO A;  1EH6 A;  1A6I A;  1IO2 A;  2Y0S A;  4U88 A;  4U87 A;  1LJ9 A;  1S7A A;  1MMG A;  2BHY A;  2DMU A;  3BT9 A;  4ESF A;  2QWW A;  5H6Q A;  2HTS A;  4YIR X;  1PP7 U;  5E18 F;  1TT0 A;  2H8R A;  2YS9 A;  3KYD B;  3MEX A;  3JW4 A;  2VC1 A;  1ETK A;  4DZJ A;  3MKZ A;  4UUV A;  3FXU A;  4OMZ A;  1GVJ A;  2PQ8 A;  1FZP B;  3M8J A;  3OWT A;  1BI0 A;  3TOB A;  1JJ8 C;  5HDG A;  1YW8 A;  2YSR A;  1R23 A;  2LF8 A;  3K70 D;  4JP0 A;  2HZT A;  1G3S A;  3X2Q H;  5KHD A;  1BN5 A;  3AG3 H;  2WV0 A;  1BR4 A;  3EYY A;  2KIM A;  1V5E A;  5D4R A;  2JUC A;  3QU3 A;  2GBY A;  2K9S A;  1FMV A;  2NS8 A;  1I1S A;  2XAH A;  1PUF B;  2E19 A;  2R7F A;  1S7O A;  2DTZ A;  1P4X A;  1OLT A;  2OPT A;  3CUQ B;  4KIS A;  3PJR A;  1E3H A;  2DA5 A;  2EPF A;  2O03 A;  4CXF A;  2R7Q A;  2W24 A;  1XGS A;  1RNL A;  5EEG A;  1ETY A;  4LK1 F;  1FOK A;  3R0A A;  5FLV A;  3BG6 A;  1W1W E;  1HOM A;  5DM7 F;  1GT0 C;  3I4P A;  4ZC3 A;  3JTG A;  2QZ8 A;  2CUE A;  4HF1 A;  2QGU A;  4CZC A;  3R60 A;  4N9I A;  2CO5 A;  3ASN H;  1QZZ A;  3BP8 A;  3CP8 A;  1WGX A;  2A6T A;  1BI2 A;  4PJL A;  2PG4 A;  4A0X A;  2CQX A;  5ED4 A;  2VKE A;  4Y15 A;  2XRN A;  4BXF A;  4BDY A;  1N77 A;  3QPT A;  1APL C;  3Q3S A;  3HYI A;  2BY3 A;  2DQR A;  3BJA A;  4UXN A;  4DNC A;  1FY7 A;  2DN0 A;  1HW2 A;  1VQ9 I;  2K85 A;  1O3T A;  3C2B A;  4Z2Y A;  4R79 A;  2HQN A;  1Z9C A;  1AWC A;  3GTK J;  5GPA A;  2DAO A;  3OL4 A;  1Y39 A;  2R7T A;  2HZD A;  2J5P A;  5L3B A;  1TLH B;  1TWF J;  2F4O B;  3QPH A;  1UG2 A;  1SEU A;  5FKN A;  4FAS D;  2LOO A;  2DT7 B;  3W6J B;  5L3G A;  2FF4 A;  1PUE E;  3BTI A;  5B1A H;  2TDX A;  1CGP A;  2KIU A;  1R9T J;  2R7Z J;  1HDP A;  2HFH A;  5ERI A;  4EV0 A;  5KVR A;  5HVQ C;  3T8R A;  3FHN A;  2X85 A;  1LKX A;  2JA2 A;  2VC0 A;  3CUO A;  2FXA A;  2BVM A;  1FC3 A;  3KP2 A;  2HOA A;  1ZG3 A;  1JE8 A;  3FMR A;  3K4M A;  5C4J J;  1SAX A;  1J75 A;  3HTS B;  3K1N A;  2L3D A;  2PN6 A;  3OIP A;  2DU9 A;  3PNT A;  4YII A;  3JRG A;  2ESN A;  5M5X J;  3F23 A;  1UHM A;  2NNN A;  3LL7 A;  4FT8 A;  4PZJ A;  3TKY A;  3GCM A;  3KP7 A;  3F8F A;  1OIS A;  1VQ7 I;  1BJZ A;  1RZ4 A;  5F0C A;  2L2O A;  3FMQ A;  3RKW A;  2FD5 A;  1ZR4 A;  1GVD A;  3CC4 I;  4DYR A;  2LY9 A;  4ETS A;  2QUF A;  1YTY A;  2V1D A;  1JKO C;  3PNY A;  2DFI A;  3BQZ A;  2FOW A;  4QTR A;  5EDN A;  3H0D A;  3WU2 C;  2DFE A;  5FFX A;  2RKH A;  1XGN A;  2E5Z A;  2F4M B;  5D5U B;  4IQJ A;  2FQ4 A;  2VL8 A;  4KDP A;  2W1O A;  2WV1 A;  4I7H A;  2M4K A;  3CCY A;  1IRZ A;  1MNE A;  2EBI A;  2QBY B;  3VYS B;  2KQR A;  1D1A A;  2DLL A;  4LGW A;  4I99 C;  2QSF X;  3GW2 A;  2PEX A;  1MDM A;  4HF0 A;  1W0T A;  2GXB A;  2VLA A;  2VBX A;  1FOW A;  5EG0 A;  3F8N A;  4XRF A;  2A61 A;  2NOJ B;  2Y31 A;  5GAD J;  5HLI A;  4HYE A;  5JFR A;  3JRC A;  1QZE A;  5F6F A;  1BC8 C;  2MAB A;  2XHK A;  3PNV A;  1OCT C;  3N05 A;  2EQR A;  2LSO A;  5HS7 A;  2FNA A;  2CH0 A;  3MVP A;  3CCL I;  1LPQ A;  1KU9 A;  1B4A A;  1ZRC A;  1XDS A;  2LVS A;  2XDV A;  3D5L A;  3HOV J;  4LLN A;  4XKC A;  1UZC A;  4L18 B;  2OD5 A;  5GPC A;  5DM6 F;  2E34 A;  2HKX A;  1VQN I;  1O57 A;  2VAS A;  2CSO A;  1I1G A;  1EKE A;  2A3S A;  3MZ8 A;  1K7A A;  5ICF A;  2O61 A;  1VQL I;  3K6G A;  3S15 J;  2F5E A;  2HNH A;  4ZZD A;  5JVT A;  1WJA A;  1RC9 A;  2LYC A;  2L9V A;  4LOC A;  4Y3O A;  1AU7 A;  2OTJ I;  2CS3 A;  3BZ6 A;  4YEJ A;  2LY1 A;  3I64 A;  3K4B A;  2E2I J;  3UNG C;  4BJ5 C;  4YFX F;  4JK1 X;  5J1R A;  2D45 A;  2VOD A;  1ZEL A;  4E7H A;  3N97 A;  4GRI A;  3O8H A;  4IO9 F;  1GV5 A;  2LF7 A;  2JPB A;  2A05 A;  4X0G A;  2BY0 A;  2ETH A;  2P81 A;  1T6S A;  2YUS A;  4OU0 A;  4CYC B;  4BEH B;  4XID A;  3OSG A;  2XSJ C;  1E2X A;  3E5U A;  2ELK A;  3D5R C;  4R1H A;  3GZ5 A;  1SAN A;  1X2M A;  4KJZ A;  5IY5 H;  2LTP A;  1OYY A;  3OYN A;  2AHQ A;  2HWV A;  1ULY A;  3KET A;  2JUG A;  2W57 A;  2Y48 A;  3K1M A;  3QP5 A;  3O2P E;  4P5O A;  1Z7U A;  4A3J J;  2LY2 A;  5C4X J;  3CUQ A;  1SMY F;  3P9C A;  4XLE A;  4O5V A;  4ZYA A;  4KT5 C;  1T08 B;  2RQQ A;  5E3L A;  1V5G A;  2RDP A;  1IN5 A;  1ZAO A;  1R4M B;  2CG4 A;  3KLN A;  3B73 A;  3VYR B;  4I01 A;  1G3T A;  4OIR F;  2GAU A;  3DEE A;  2R93 J;  3GTL J;  3BTC A;  2EH3 A;  5DYM A;  2R0Q C;  3SXY A;  3GO5 A;  3BG9 A;  5F0H A;  3DQV C;  2HVQ A;  2Z3Y A;  3WTX C;  1T95 A;  3HJE A;  1MMA A;  3ZMV A;  4KUM A;  1KQ0 A;  4F55 A;  1VND A;  3L1P A;  2EV5 A;  2RNG A;  1YFH A;  2E71 A;  2HOE A;  3S1M J;  2VJI A;  2E1O A;  2JA7 J;  4LMY A;  3HRU A;  5K5R A;  1HLV A;  1LUJ B;  5LGT A;  1W7P D;  2LRD A;  2XAS A;  2K4B A;  4DW6 A;  1I50 J;  2X1E A;  2XF6 A;  3FM5 A;  4D7N A;  5C3E J;  2XAG A;  4RGR A;  2BZT A;  3RI4 A;  3RZD J;  2B63 J;  3U21 A;  3H5N A;  2LK2 A;  4ZYH A;  4MTD A;  1B1B A;  1W4M A;  4CA0 A;  3E6C C;  2O0Y A;  1W0U A;  1YX3 A;  2XKO A;  2ZKZ A;  3CZ6 A;  3I71 A;  3I53 A;  1ON2 A;  5LD2 C;  3M7G A;  4KN7 X;  3KYL A;  3BDD A;  3QRF F;  1SMT A;  2PX9 A;  1I6X A;  4S0H B;  3WTY C;  4UVB A;  1JUS A;  2KZV A;  1O7L A;  2W00 A;  2ZME C;  2V9K A;  4BAC A;  1TZL A;  1FTT A;  2NVX J;  3ABK H;  2BY1 A;  2VIX A;  4NHJ A;  2K40 A;  3CP2 A;  3CMA I;  1UB9 A;  4AYB N;  3KZZ A;  3IH2 A;  3HRT A;  4UB8 C;  1I5Z A;  2WAQ A;  2CW7 A;  4XKB A;  3K4K A;  2V6E A;  4A5N A;  2MSY A;  3HIF A;  3PM1 A;  2OCE A;  4L5I A;  1YS7 A;  4UHT A;  4I0A A;  1ON1 A;  4ESB A;  3G3Z A;  4DYQ A;  1S29 A;  1ZAR A;  2Y2Z A;  3MAJ A;  2OJE D;  3HOT A;  3R4K A;  1ZYR F;  3QYB A;  4U0Y A;  2EA2 A;  2N8G A;  3KP6 A;  3JR9 A;  3HKZ A;  3PQK A;  3JRA A;  2E7X A;  2Q0O A;  4AC0 A;  1JKR C;  3VFZ A;  2Y0S N;  2KIF A;  2L54 A;  5FO5 A;  1S3J A;  2K86 A;  1T98 A;  3BC8 A;  3WE3 A;  1FYM A;  3T0Y A;  3B6A A;  1U6G A;  2EFO A;  1HSJ A;  3SZG A;  3FDY A;  1G4D A;  3FBN B;  1WJC A;  1E17 A;  2WA0 A;  3S32 A;  4WCG A;  2DCE A;  4HLY A;  4IHX A;  5DD8 A;  3A02 A;  3O6B B;  4Q48 A;  5B3S H;  2HU9 A;  3DKW A;  1RR7 A;  4NC8 A;  4XLC A;  4BUP A;  3F8B A;  1P4W A;  4WXC A;  1FYL A;  1IXS B;  1AKH B;  2R7D A;  3GUD A;  3F21 A;  4E7K A;  3F9K A;  1R5I D;  5BPI A;  3PUF A;  3QOD A;  3I3L A;  4YG2 F;  1SAU A;  3CCE I;  3V42 A;  2W85 A;  2DPU A;  1RPW A;  2DK8 A;  2K9L A;  2M4G A;  3FIS A;  5F08 A;  1Z3Y A;  3BJO A;  3V4G A;  1DDN A;  4LLG F;  4G6T B;  3G4S I;  1VQP I;  3M3Y J;  3G1O A;  2VT3 A;  4PGG A;  1D0Y A;  5CVV A;  3CCR I;  3S3M A;  2CV1 A;  1R00 A;  1W5T A;  1B72 B;  1BI1 A;  2PJP A;  4B3A A;  2PMZ N;  2G9W A;  4I76 A;  2EK5 A;  4EJT A;  1MMN A;  2LMD A;  2M8E A;  4BHB A;  4EJW A;  3QQA A;  1MBG A;  2JPC A;  3LSM A;  4FHT A;  3SQN A;  1IXR C;  3W3C A;  4Y4R A;  3Q5F A;  2VOP A;  3PL8 A;  4RGX A;  3V8L A;  3F8C A;  1VQM I;  2HKO A;  5FRM A;  2LBF A;  3WG9 A;  4HRI A;  3QYE A;  1DU6 A;  2VKH A;  3K7A J;  4FCY A;  2QF7 A;  4BQN A;  5EGO B;  1HDD C;  4M3D A;  4I02 A;  4M72 A;  2HTJ A;  2WC2 A;  5HLT A;  3OY9 A;  3AG1 H;  4BY7 J;  2FX0 A;  4E7L A;  5AON A;  2M7B A;  4BQA A;  1T33 A;  2MH9 A;  3HXL A;  5GAH J;  3MZH A;  1X2N A;  3F8M A;  4BXX J;  1YO5 C;  1K4S A;  3GX4 X;  2NNY A;  1FOX A;  2QQ9 A;  2Z33 A;  4CYC A;  1V4R A;  4QPQ A;  3S8P A;  2XIG A;  1KYZ A;  3E1S A;  2X1C A;  4BQO A;  3H3V K;  2H6B A;  1H9T A;  3CCS I;  2LP0 A;  2I5U A;  4MEY F;  4OIP F;  1K61 A;  5EG0 B;  4D7M A;  2DDA A;  4A3L J;  1SFO J;  5FJ8 J;  4KIB A;  3FF5 A;  1LNW A;  3IWZ A;  4BL0 B;  3OOU A;  1B6A A;  1GXP A;  4OAY A;  3Q0W A;  3TW7 A;  5CQG A;  4DBQ A;  2KP6 A;  3LA7 A;  3P7N A;  2O5R A;  2C6Y A;  4OMY A;  2VBW A;  1K83 J;  2XGC A;  1LFP A;  5J1Y A;  5EYR A;  3H9G A;  5D8L B;  3GBG A;  3IAS 2;  5ICG A;  3SDG A;  2DJI A;  3FZV A;  3MCZ A;  1S9H A;  3H3Z A;  3S1N J;  1DP7 P;  4G7O F;  3DP7 A;  5DEQ A;  1MMD A;  2RNJ A;  2M45 A;  4WF2 A;  3ZN0 A;  1LQ1 A;  2HYF A;  5FD6 A;  4XLA A;  5J8C A;  1EJ9 A;  3TW6 A;  1MBJ A;  4Z6Y A;  2VB6 A;  4XKV A;  4C3J J;  2ELJ A;  3WTU C;  3SFZ A;  2DW4 A;  1DGW Y;  1NHA A;  2WAE A;  1C0W A;  2CQ7 A;  2IAI A;  1W5C C;  1H9G A;  4P9U A;  2VT2 A;  4L5J A;  4XLN F;  1N75 A;  2CYY A;  1F1Z A;  3JRD A;  2MLK A;  1XSV A;  3BLY A;  3UR3 C;  2WAD A;  4BJ6 C;  2P5K A;  3S1R J;  3VDX A;  3CO7 C;  4LLL A;  4P9F A;  2IPQ X;  1LFU P;  4AIH A;  2M30 A;  2A6E F;  3CC2 I;  4QLC U;  4NB5 A;  3BCB A;  2Z99 A;  1O7F A;  2WY8 Q;  2X0L A;  2P6S A;  1MKM A;  1J0R A;  2P4W A; 
#chains in the Genus database with same CATH homology
 1TW2 A;  5E1X A;  1FP1 D;  1UHW A;  4G6Q A;  4WX9 A;  5L3D A;  4I2O A;  5BS6 A;  1YQA A;  2P7V B;  4ON0 A;  4LJZ F;  5TRD A;  3KP5 A;  3AAF A;  3C18 A;  4M6X A;  4AIK A;  1MZB A;  1IN6 A;  4M6Y A;  4BAY A;  4A6D A;  3TQN A;  2EFN A;  3OOP A;  2K27 A;  2FNP A;  4I09 A;  3J81 Z;  2EWN A;  5CLS A;  5LEK A;  5F1R A;  5ILS A;  3J80 K;  2IT0 A;  1WSU A;  4LB5 A;  3WE2 A;  3KEO A;  3NEU A;  1CF7 A;  2VBY A;  1IUY A;  3RYP A;  1AOY A;  3QP6 A;  2H6C A;  4S04 A;  2YU3 A;  1YIO A;  4K2E A;  3FMS A;  1O3Q A;  2BGC A;  1FT9 A;  3V7R A;  3LWF A;  1R1V A;  4G8X A;  2ISY A;  6PAX A;  1R5G A;  1OR7 A;  1BJA A;  3I5U A;  3TO7 A;  1OYW A;  1HKQ A;  2FBK A;  1MGT A;  2FBI A;  4CGZ A;  2EFP A;  4UVA A;  1HST A;  1HW5 A;  3BJ6 A;  2V1U A;  4L0Y B;  2ZO4 A;  3T5X A;  3LAJ A;  5LRR A;  2BBY A;  4HF2 A;  4LB6 B;  4P55 A;  2BYV E;  2PBI A;  3J7A O;  1PDN C;  2EV6 A;  4KYW A;  2R3S A;  2CWE A;  1W7P A;  2LKP A;  1MDM B;  2IA1 A;  1IRG A;  3GZ6 A;  3PQJ A;  3N4M A;  2ZXJ A;  2VBZ A;  3L00 A;  3B02 A;  1TQP A;  4HDV A;  4ZZL A;  2MA3 A;  3FXR A;  4PCQ A;  4E70 A;  2EV0 A;  1U8R A;  2A6H F;  3KE2 A;  2UZK A;  1MJB A;  2XUB A;  4A6E A;  3TOA A;  1A04 A;  5HS9 A;  3PFI A;  1EV7 A;  2YR2 A;  4JQF A;  5L3E A;  2F5F A;  4EGZ A;  1R22 A;  3DV8 A;  2OZ6 A;  1Z1D A;  4L9N A;  5DCM A;  3E5X A;  2ZNY A;  1G6N A;  4IRG A;  3ISP A;  4G9Y A;  5HDK A;  4CHU A;  2J5O A;  1QGP A;  1FPQ A;  5LHH A;  4CZZ A;  4R8H A;  2ZBK A;  2M5W A;  3L09 A;  1RUN A;  1FYK A;  3DEU A;  1LB2 A;  4GYI A;  3M1E A;  4KIG A;  1I27 A;  1TQM A;  5HDN A;  1XCV A;  2WTE A;  1R7J A;  2ISZ A;  5ICC A;  4EMS A;  1IZ1 A;  5DUK A;  2FE3 A;  4NQW A;  4KIC A;  4U7B A;  5CVI A;  1W5S A;  2V1X A;  4ASN A;  3IKT A;  5D6E A;  2VON A;  1D5V A;  2LDU A;  4KNY A;  1J59 A;  2JRT A;  1R1U A;  1U5T A;  4HX8 A;  3V8K A;  3RKY A;  3ZN1 A;  5DD4 A;  5AIQ A;  1F5T A;  4RAZ A;  3COA C;  4ENN A;  2A68 F;  1EH8 A;  4LK0 F;  1FLI A;  4HQE A;  3DF8 A;  2Z9O A;  3V7C A;  3C7J A;  3T1B A;  2GWR A;  2AXL A;  2STW A;  1ZRE A;  4RAY A;  1G3W A;  4UV8 A;  3SZP A;  1U78 A;  3M9A A;  3E3V A;  2VN2 A;  3GVA A;  5TJJ A;  1R36 A;  4HDU A;  2O3F A;  3ZMS A;  3KFW X;  2IP2 A;  2OZU A;  1BC7 C;  2D2W A;  4CDG A;  4AWX B;  1XSX A;  3NRV A;  2RGV A;  2YPR A;  2IA2 A;  5JI6 A;  2RV8 A;  3K0L A;  4AVP A;  4HZF A;  2HR3 A;  4B8X A;  1F4K A;  2G7H A;  1P4A A;  3GFJ A;  4P96 A;  2ZME A;  3VOE A;  1BIB A;  1KU2 A;  3LQR A;  2FEZ A;  2QYO A;  2K02 A;  2K4J A;  5DDG A;  2HGC A;  4RS8 A;  3VOD A;  3OV8 A;  3BPV A;  1J2X A;  2IA0 A;  2UWM A;  1W7P B;  4YFN F;  4N0B A;  1LDJ A;  2L4M A;  2P5L C;  4LG0 B;  5DV5 A;  5HOO A;  1O3R A;  2PI0 A;  3KEQ A;  3SZT A;  3ECH A;  1T2K A;  3I59 A;  1WQ2 A;  3H92 A;  1MD0 A;  2Q2E A;  2ZNZ A;  2FQ3 A;  4KA4 A;  3EQL F;  3CLO A;  4OIN F;  1ZGJ A;  1LDD A;  3E5Q A;  3ERE D;  4MQV A;  3JAM K;  3G73 A;  4IRI A;  4YFK F;  1XSD A;  5ICE A;  3K2Z A;  5HLH A;  4LD5 A;  3C1D A;  2F5D A;  1EH7 A;  3KP3 A;  3ROU A;  1IN7 A;  2NYX A;  2ESH A;  3DPT A;  4N9H A;  3DXJ F;  3CUQ C;  1QO0 D;  2JTV A;  3ZQ7 A;  2HYG D;  2H09 A;  3E97 A;  3RKX A;  5FB2 A;  1J5Y A;  4RB0 A;  4BHC A;  1U2W A;  1REP C;  1S8N A;  3LAP A;  1D8K A;  2CQK A;  4I98 B;  3J80 Z;  1U3E M;  5CVJ A;  5E1W A;  1LEB A;  2EJR A;  1XGM A;  3WGH A;  4KMF A;  2DT5 A;  2PMH A;  1B9M A;  1SFX A;  3ZP5 A;  3Q9S A;  4HAM A;  3IRQ A;  2QQB A;  2GA2 A;  3JTH A;  2XAF A;  4XSX F;  3CO6 C;  2ZME B;  1BIA A;  3ML6 A;  3HUG A;  2KRF A;  3RDI A;  3GFL A;  1R1T A;  1P6R A;  3U1D A;  4D0P A;  4HA8 A;  4L0Z B;  4UV9 A;  2QLZ A;  3GFI A;  2FMY A;  2G7U A;  4MGR A;  1IW7 F;  4WXH A;  4BNC A;  3BWG A;  1TQI A;  3FWE A;  4EVI A;  2CGP A;  2L02 A;  1K79 A;  2EB7 A;  5E1Z B;  2OQG A;  5KK1 A;  2VXZ A;  4RB3 C;  1J9I A;  3GYH X;  2XRO A;  4M9Z A;  4KFC A;  5ILU A;  1SD5 A;  1WWX A;  1WKM A;  4ZH4 F;  1YW9 A;  1RIO H;  4XBF A;  3BPX A;  1KYW A;  1K78 A;  4G94 A;  2Q8K A;  4CYD A;  3IHU A;  3RIR A;  2W25 A;  5IT3 A;  3Q9V A;  3KZY A;  3BY6 A;  2F2E A;  2QQA A;  3V7S A;  2H27 A;  5FLX K;  5BPD A;  5L3C A;  1KQ8 A;  5LGU A;  3WTW C;  1B59 A;  3IL2 A;  4GYG A;  1ZLJ A;  3KP4 A;  1XN7 A;  1SD4 A;  4IPA A;  4L9V A;  4MNU A;  5E8I A;  2XVC A;  5LEJ A;  3HHG A;  4U7D A;  4TV7 A;  2FML A;  1BOA A;  2PMU A;  5FLX Z;  1ZG5 A;  2RVC A;  2MC3 A;  4A12 A;  3GFM A;  2NS0 A;  4U0V A;  1KA8 A;  1BI3 A;  2ADU A;  3MWM A;  2P7C B;  4IXA A;  3WU1 B;  4RGU A;  2OAZ A;  1QZY A;  2DTR A;  4ZYG A;  1Q1H A;  2EFQ A;  3M8E A;  3IRR A;  2VE9 A;  2JT1 A;  3TGN A;  1ZRD A;  1XDU A;  2GZW A;  3JSO A;  1Z91 A;  1H0M A;  1XCB A;  4ENK A;  1G3Y A;  3WTS C;  4EJU A;  3ABU A;  3WU0 A;  1P92 A;  2B0L A;  3IKV A;  4EJO A;  4Q4Z F;  3FX3 A;  2H94 A;  4Q47 A;  1FBS A;  1HKS A;  4IVN A;  4A2U A;  1TW3 A;  5BMZ A;  2ZJ2 A;  4HW0 A;  2XV4 S;  2ZFW A;  1IRF A;  1OMI A;  2NRA C;  4EGY A;  4MTE A;  3LQQ A;  2F5C A;  3DFG A;  4PDK A;  2KKO A;  5JHU A;  4G7H F;  1TBX A;  3HSF A;  3MFK A;  3LST A;  3TDZ C;  1LVA A;  3LA3 A;  1PP8 F;  3ZMU A;  3ZMD A;  5BQT A;  3EET A;  4EM1 A;  2OA4 A;  2P6T A;  1USS A;  2ELH A;  5CVR A;  3WTV C;  4GGG A;  4ENM A;  2KJC A;  1K78 B;  1QNT A;  2DQL A;  5FGM A;  4H0E A;  2QVO A;  4S05 A;  4FX4 A;  1QPM A;  4M73 A;  5D5X B;  3F22 A;  3BRO A;  3CDH A;  2P5V A;  3RYR A;  4A0Z A;  4Q5S F;  1R5H A;  5J8F A;  4UNO A;  1HXD A;  3R61 A;  4OOI A;  3ELK A;  4EM2 A;  1BBY A;  5LRS A;  4HV6 A;  1IN4 A;  4HQM A;  3FXQ A;  4A0Y A;  3ZMZ A;  3IC7 A;  2M1B A;  5DCM B;  5LHG A;  1U5T B;  3K1P A;  3WOD F;  3CJN A;  2XAQ A;  3ABT A;  5ILV A;  4JBA A;  3GLX A;  2E7W A;  3F6V A;  2HEO A;  1GHC A;  3C3W A;  3HSR A;  2COM A;  1Z6R A;  3KCC A;  1IAW A;  1T0F A;  1ODD A;  1JHH A;  5J6X A;  3M8F A;  2MH2 A;  2E1N A;  3T8T A;  3TDU C;  2JSC A;  1HBX G;  1D3Y A;  2IVM A;  4RB2 C;  2CW0 F;  3WTT C;  1Z6T A;  3EYI A;  3WGG A;  4LG0 A;  5LGN A;  4AD9 A;  5AIP A;  3REO A;  2JZY A;  3VEP A;  3JSP A;  3L2C A;  2NAZ A;  2YX7 A;  3E6D A;  4M9X A;  2RC4 A;  2QBY A;  4ZYD A;  3QAH A;  5HLG A;  4OIO F;  2A69 F;  2P8T A;  4IF4 A;  4MEX F;  4XLP F;  2PLY A;  3RJP A;  4M71 A;  3P9K A;  1T38 A;  4M9S A;  1BM9 A;  2QM3 A;  3HRM A;  2DO7 A;  4WWC A;  1X3U A;  2AS5 F;  3R6S A;  1R58 A;  2O8X A;  1STZ A;  2RN7 A;  5D4S A;  2OBP A;  2FSW A;  4BYY A;  1F9N A;  3JAM Z;  4HBL A;  4KN4 X;  2UXX A;  4KIF A;  1SFU A;  2L4A A;  4Y13 A;  4HOB A;  5CYV A;  2IRF G;  1P2F A;  3HHH A;  3HTU A;  4HV5 A;  3LFK A;  2XAJ A;  3ZPL A;  2V9V A;  1UCR A;  3F6O A;  2V6C A;  5D6F A;  1K6O A;  5K5Q A;  5F64 A;  5H6R A;  1IN8 A;  5LHI A;  1FBQ A;  4IHT A;  3MQ0 A;  3ECO A;  4GCV A;  1FSE A;  3P9I A;  4U0W A;  3FM3 A;  3ULQ B;  2A07 F;  3V8J A;  2L01 A;  1DUX C;  5A2Q Z;  4EM0 B;  3H3U A;  4CIC A;  2O6G E;  4HX4 A;  2D1H A;  4UVC A;  2GXG A;  5HS8 A;  1LDK B;  4G7Z F;  1GXQ A;  4BH9 A;  2UXN A;  1S6L A;  3TO6 A;  1YW7 A;  3TO9 A;  5D8K B;  2V79 A;  1ZGA A;  4GO1 A;  1ZLK A;  2DPD A;  2ACJ A;  2BE5 F;  1Z05 A;  2HDC A;  1SFE A;  5L3F A;  3I54 A;  5JR3 A;  3GF2 A;  5LBQ A;  4WK8 F;  1SD7 A;  2MBF A;  3HRS A;  4ENJ A;  1CF7 B;  1ZH5 A;  1XMK A;  1LEA A;  1UST A;  2EA4 A;  4M74 A;  2Y0M A;  2EFW A;  4BXU A;  4ESJ A;  1OKR A;  2KJB A;  1XGO A;  2ZCW A;  2GA1 A;  4B09 A;  2GQQ A;  4L9T A;  3J81 K;  1VTN C;  5A2Q K;  5CVU A;  4HLX A;  2OQR A;  2E1C A;  1RI7 A;  3E6B A;  4G6D A;  4Y17 A;  2FA5 A;  2QEN A;  3R0J A;  1RUO A;  2D1V A;  4GXO A;  3LA2 A;  2IJL A;  2XKP A;  4YIF A;  3DPL C;  1HW1 A;  3W6K B;  5IT9 Z;  2WWY A;  2W84 A;  3O3K A;  3HOS A;  4RGS A;  2DBB A;  5D5V B;  5E17 F;  1TNT A;  3GXO A;  1ZG1 A;  1U5T C;  1ZHF A;  1FNN A;  1ZRF A;  5H20 A;  4EQQ A;  4KMU X;  4BHP A;  5FD5 A;  3EDP A;  1YS6 A;  2A5Y B;  4CO8 A;  1JXS A;  2Y75 A;  1D8J A;  5LLQ A;  3I0T A;  4WXD A;  5K5O A;  1FP2 A;  2VE8 A;  1TNS A;  1WRJ A;  1YYV A;  2FRH A;  1TTY A;  3I59 B;  3F3X A;  1V3F A;  1YLF A;  1IF1 A;  1FSH A;  2DI3 A;  5K1Y A;  1T39 A;  1L3L A;  4DQ2 A;  3GEZ A;  3MZY A;  1DPR A;  2Z5U A;  2MD5 A;  3WTZ A;  4FX0 A;  5BOX A;  1OPC A;  2PFB A;  3K9T A;  1FX7 A;  3EUH A;  1Y0U A;  1KU3 A;  4MQ9 F;  2HQR A;  3E6M A;  1B9N A;  4HX7 A;  4O3M A;  2GIV A;  4RB1 A;  3IWF A;  3F72 A;  1MJA A;  3QU6 A;  2M87 A;  5CJ9 A;  1IXC A;  1KGS A;  1KU7 A;  3NQO A;  5EEH A;  1KQ9 A;  3SHF A;  3KLO A;  1JHF A;  3RPU A;  5E20 A;  3U9G A;  1FWZ A;  2IW5 A;  1YG2 A;  1MJ9 A;  1SD6 A;  4XSZ F;  1JGS A;  5DUI A;  2LNB A;  3ZMT A;  2XGX A;  2K7L A;  1FBU A;  3S2W A;  3L7W A;  3RPQ A;  4IHS A;  1L0O C;  4A5M A;  4L9J A;  2X4H A;  3L9F A;  1XB4 A;  1QBJ A;  4MHG A;  2STT A;  1ONV A;  1J7K A;  4F7Z A;  2DK5 A;  2CFX A;  2MLG A;  1HQC A;  4IJA A;  1O3S A;  1XD7 A;  3BOQ A;  4AIJ A;  1OYI A;  2RQP A;  1DPU A;  3I58 A;  4PGH A;  5FFZ A;  2OU2 A;  1HKT A;  2FU4 A;  3FHZ A;  5IT9 K;  5DCF A;  3D0S A;  4LFU A;  2HS5 A;  4ZYE A;  1XMA A;  2FOK A;  4O6J A;  2FBH A;  3K69 A;  1ZN2 A;  1QQI A;  4I0B A;  3GWZ A;  3HSE A;  3RTR A;  4EJV A;  3QOP A;  4OIQ F;  3VB2 A;  3U2R A;  4QWQ A;  2YX4 A;  1WI9 A;  3CTA A;  5D5W B;  5E8G A;  2BEO A;  2BV6 A;  3WGI A;  4IRH A;  1UFM A;  2VOO A;  1EH6 A;  4U88 A;  1LJ9 A;  1S7A A;  4ESF A;  2QWW A;  5H6Q A;  2HTS A;  1PP7 U;  5E18 F;  3MEX A;  3JW4 A;  2VC1 A;  4UUV A;  3FXU A;  4OMZ A;  1GVJ A;  2PQ8 A;  1FZP B;  1BI0 A;  3TOB A;  5HDG A;  1YW8 A;  2YSR A;  1R23 A;  2LF8 A;  2HZT A;  1G3S A;  1BN5 A;  2WV0 A;  3EYY A;  2KIM A;  5D4R A;  3QU3 A;  1I1S A;  2XAH A;  2R7F A;  1S7O A;  1P4X A;  3CUQ B;  2O03 A;  4CXF A;  2W24 A;  1XGS A;  1RNL A;  5EEG A;  4LK1 F;  1FOK A;  3R0A A;  3I4P A;  3JTG A;  2QZ8 A;  4HF1 A;  3R60 A;  4N9I A;  2CO5 A;  1QZZ A;  3BP8 A;  1BI2 A;  2PG4 A;  4A0X A;  5ED4 A;  4Y15 A;  2XRN A;  3QPT A;  3HYI A;  2DQR A;  3BJA A;  4UXN A;  4DNC A;  1FY7 A;  1HW2 A;  1O3T A;  1AWC A;  4Z2Y A;  1Z9C A;  2HQN A;  4R79 A;  2DAO A;  2J5P A;  5L3B A;  1TLH B;  3QPH A;  3W6J B;  5L3G A;  2FF4 A;  1PUE E;  2TDX A;  1CGP A;  2KIU A;  5ERI A;  2HFH A;  4EV0 A;  5KVR A;  5HVQ C;  3T8R A;  2VC0 A;  3CUO A;  2FXA A;  1FC3 A;  3KP2 A;  1ZG3 A;  1JE8 A;  3FMR A;  1SAX A;  1J75 A;  3HTS B;  3K1N A;  2L3D A;  2PN6 A;  4YII A;  2DU9 A;  2ESN A;  3F23 A;  1UHM A;  2NNN A;  4FT8 A;  4PZJ A;  3TKY A;  3KP7 A;  3F8F A;  1RZ4 A;  3RKW A;  3FMQ A;  4ETS A;  2QUF A;  1YTY A;  2V1D A;  2DFI A;  5FFX A;  2RKH A;  1XGN A;  5D5U B;  4KDP A;  4I7H A;  2QBY B;  4LGW A;  2DLL A;  1MDM A;  3GW2 A;  2PEX A;  4HF0 A;  2GXB A;  2VBX A;  3F8N A;  4XRF A;  2A61 A;  5HLI A;  4HYE A;  5JFR A;  5F6F A;  1BC8 C;  2XHK A;  2LSO A;  5HS7 A;  2FNA A;  1KU9 A;  1B4A A;  1ZRC A;  1XDS A;  3D5L A;  4LLN A;  4L18 B;  2OD5 A;  2HKX A;  1O57 A;  2CSO A;  1I1G A;  2A3S A;  1K7A A;  5ICF A;  2O61 A;  2F5E A;  5JVT A;  4ZZD A;  3BZ6 A;  3I64 A;  4YFX F;  4JK1 X;  2D45 A;  2VOD A;  3N97 A;  2LF7 A;  2JPB A;  2ETH A;  1T6S A;  4OU0 A;  1E2X A;  3E5U A;  4R1H A;  3GZ5 A;  1OYY A;  2HWV A;  1ULY A;  3KET A;  2W57 A;  2Y48 A;  3K1M A;  3QP5 A;  3O2P E;  4P5O A;  1Z7U A;  3CUQ A;  1SMY F;  3P9C A;  4O5V A;  4KT5 C;  2RDP A;  1IN5 A;  1ZAO A;  2CG4 A;  3KLN A;  3B73 A;  4I01 A;  1G3T A;  4OIR F;  2GAU A;  5DYM A;  3SXY A;  3GO5 A;  3DQV C;  2Z3Y A;  3WTX C;  3ZMV A;  4KUM A;  1KQ0 A;  2EV5 A;  1YFH A;  2HOE A;  4LMY A;  3HRU A;  5K5R A;  5LGT A;  1W7P D;  2XAS A;  2K4B A;  3FM5 A;  2XAG A;  4RGR A;  3RI4 A;  4ZYH A;  4MTD A;  1B1B A;  1W4M A;  3E6C C;  2O0Y A;  2XKO A;  2ZKZ A;  3I71 A;  3I53 A;  1ON2 A;  3M7G A;  4KN7 X;  3BDD A;  3QRF F;  1SMT A;  1I6X A;  3WTY C;  4UVB A;  1O7L A;  4NHJ A;  1UB9 A;  3KZZ A;  3HRT A;  1I5Z A;  4A5N A;  3HIF A;  4L5I A;  4UHT A;  1YS7 A;  4I0A A;  1ON1 A;  4ESB A;  3G3Z A;  1S29 A;  1ZAR A;  3MAJ A;  3HOT A;  3R4K A;  1ZYR F;  4U0Y A;  2EA2 A;  3KP6 A;  3PQK A;  2E7X A;  2Q0O A;  3VFZ A;  2KIF A;  2L54 A;  5FO5 A;  1S3J A;  2K86 A;  1T98 A;  3WE3 A;  1FYM A;  3T0Y A;  1U6G A;  2EFO A;  1HSJ A;  1G4D A;  1E17 A;  4WCG A;  4HLY A;  5DD8 A;  3O6B B;  4Q48 A;  3DKW A;  1FYL A;  3F8B A;  1P4W A;  4WXC A;  1IXS B;  2R7D A;  3GUD A;  3F21 A;  5BPI A;  4YG2 F;  2W85 A;  2DPU A;  2DK8 A;  3V4G A;  3BJO A;  1DDN A;  4LLG F;  2VT3 A;  4PGG A;  5CVV A;  1R00 A;  1W5T A;  1BI1 A;  2PJP A;  2G9W A;  2EK5 A;  4EJT A;  2M8E A;  4BHB A;  4EJW A;  2JPC A;  4FHT A;  3SQN A;  1IXR C;  3Q5F A;  2VOP A;  4RGX A;  3V8L A;  3F8C A;  2HKO A;  3WG9 A;  4I02 A;  4M72 A;  2HTJ A;  2WC2 A;  5AON A;  4BQA A;  2MH9 A;  3MZH A;  3F8M A;  1YO5 C;  3GX4 X;  2NNY A;  2QQ9 A;  2Z33 A;  1V4R A;  2XIG A;  1KYZ A;  2H6B A;  1H9T A;  4MEY F;  4OIP F;  4KIB A;  3FF5 A;  1LNW A;  3IWZ A;  1GXP A;  1B6A A;  3LA7 A;  3P7N A;  2C6Y A;  4OMY A;  2VBW A;  5D8L B;  5ICG A;  3FZV A;  3MCZ A;  3H3Z A;  1DP7 P;  4G7O F;  3DP7 A;  5DEQ A;  2RNJ A;  2M45 A;  4WF2 A;  3ZN0 A;  1LQ1 A;  2HYF A;  5FD6 A;  5J8C A;  3WTU C;  3SFZ A;  2DW4 A;  1NHA A;  1C0W A;  1H9G A;  4P9U A;  2VT2 A;  4L5J A;  4XLN F;  2CYY A;  1F1Z A;  2MLK A;  1XSV A;  2P5K A;  3CO7 C;  4LLL A;  4P9F A;  2IPQ X;  4AIH A;  2M30 A;  2A6E F;  4QLC U;  4NB5 A;  2Z99 A;  1O7F A;  2X0L A;  2P6S A;  1MKM A;  1J0R A;  2P4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...