2MABA

Untangling the solution structure of c-terminal domain of aciniform spidroin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
PSFGLVLNSPNGLRSPQAKARINNLASALSTAVGRNGVDVNAFTSGLRATLSNLGDSGMSPNEAKVEVLLEALTAALQLLSSSTLGAVDTTSIGLTSNSVSKAVAQALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACINIFORM SPIDROIN
publication title Structure and function of C-terminal domain of aciniform spidroin
pubmed doi rcsb
source organism Nephila antipodiana
total genus 31
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mabA00
2M0MA 2KHMA 2MFZA 2MABA 2K3PA
chains in the Genus database with same CATH superfamily
5E79C 4I2OA 1WKMA 2MA3A 2NOJB 2FEZA 3MZYA 5F0HA 3S1NJ 1PVEA 2OZ6A 1KYWA 1QGPA 1R1TA 1FZPB 2OTLI 2DYRH 4KMFA 3VODA 3A03A 3HSRA 3ECOA 1JKRC 2V4JC 1OR7A 2VJIA 2CUJA 4EM1A 2CQQA 1E17A 4HNVA 3HUGA 1T08B 2K02A 3CMYA 4XLAA 1YYVA 1SFOJ 3BTLA 4HV5A 5DUKA 2Z2SB 3C18A 1ZN2A 2GIZA 3OYBA 2ZFWA 1F36A 4BBRJ 5IP6A 3ZXSA 2P4WA 3AG4H 3OYNA 3LSPA 4IHYA 2VOPA 5E18F 2HQNA 2NNNA 5FLXZ 1YO5C 3LMMA 5J4YA 2M0MA 2XIGA 4W97A 4M3GA 1X19A 1XD7A 3M3YJ 2BXYA 1MH3A 4DJAA 4ZYGA 3L2QA 2ETHA 2XRLA 3ASOH 4IXAA 2NVTJ 3C7JA 1T39A 2OZUA 3DLAA 2PLYA 3UR3C 1MSEC 2EK5A 2ZSHB 5HVQC 2BW3A 3F8MA 1QRYA 4LLGF 4AM3A 4RB2C 5FKMA 5B3SH 3FXRA 2W48A 3HOTA 2ZXHA 4E7JA 4L9VA 1IRFA 5EF6A 1S7OA 4B09A 3S2HJ 1J09A 1SVLA 2DT7B 1VQ5I 2L4AA 1ETWA 3NWTA 4PDKA 1B72B 4OIQF 1OR7C 4I01A 1OCOH 4A6DA 3CQZJ 2JQ7A 3CDLA 5KAFC 2JA7J 2G0EA 5HS7A 3Q5FA 1X1PA 3AG3H 3GTMJ 4BXUA 2X51A 1YIJI 1TLHB 4IQ4A 2XHKA 3EYIA 4L0YB 3F9KA 1QZYA 5GADJ 5FRMA 1T2KA 3AG2H 1OCCH 3WHBA 4E6KG 3BZKA 4A69C 4FQGA 2DW4A 1UG0A 5EEAA 3CF5F 5H6RA 3H5NA 4BS9A 1R5ID 4P5OA 3FMQA 4A3JJ 3M07A 1DPUA 4MNUA 1IXRC 5TRDA 3L2CA 5EDNA 4Y15A 5EZGA 1S3JA 1EKEA 4U0VA 3RCOA 1DGWY 2QSHX 4BE1A 1A31A 3JRGA 2WV1A 3FZVA 2DT6A 3TP0A 3J7AY 1DU6A 3BP8A 1R36A 1G3SA 2PMUA 3TOAA 4YFKF 2LKPA 5E20A 3ZCOA 1PP7U 3WGIA 4JX4A 3CMMA 2STWA 3HSEA 3KP6A 4UUTA 1STZA 1ETKA 3D0SA 3ESWB 4BHPA 1O4XA 3ASNH 1R49A 2X85A 5IOYA 1FOXA 5HLIA 2ISZA 2UXXA 1CF7B 1IRGA 1GVJA 4WF2A 2BBYA 4XKVA 3MEXA 3K1PA 2RVCA 2VE8A 1J7KA 4Y33A 5FRNA 5EG0A 4A0ZA 1CQTA 1XB4A 2M0CA 2ADUA 3RIRA 4DNCA 4ENMA 3MZHA 2IGMA 1FC3A 3Q0WA 1E0EA 1BOAA 1A04A 2CFOA 3DP7A 1L3LA 3HM5A 2PMZA 4M71A 2R5YA 1Q1HA 4G6TB 5GPAA 3PSFA 2LSOA 3DEUA 1U2WA 1BIBA 2G9WA 3I0TA 2WAQA 5LGUA 2IXSA 1Z3YA 2FD5A 3FWEA 4U88A 4BU2A 3LA2A 4GXOA 2R7VA 1AA7A 1FOWA 4U7BA 4Y52J 3MMYB 1WHUA 3BTCA 3GVAA 2R7TA 2H1KA 4UV9A 1LPQA 3FHNA 3IWZA 4BQNA 1QVUA 2EPFA 2M87A 3E5QA 3GZ6A 2GM4A 1FOKA 1NK3P 2JA8J 4FX4A 1PJRA 2Y0MA 3HG9A 3B73A 4BXXJ 2PMZN 2LP0A 1RKWA 3T8TA 4JBAA 2V1NA 1HKSA 2LMDA 3S3NA 2B63J 5F27A 1VI0A 3S8PA 5IYDJ 1F4KA 3DF8A 5M3FJ 2W24A 4BL0B 4LG0B 4EJWA 6PAXA 1KA8A 5FLMJ 1R4MB 4P9UA 2Z5UA 2QQAA 2WWYA 2DA6A 2HI3A 5BOXA 5GAEJ 2QKMB 2LNBA 2KQRA 3DKXA 3G1MA 3LAJA 4LLNA 1L0OC 2MYSA 1S72I 4IEJA 4LD5A 5CVVA 2DMTA 4CCOA 3GTKJ 3IH4A 1LUJB 1QZEA 1IW7F 5IPAA 1AHDP 4YEJA 2IEKA 3F22A 3M8FA 2R7WA 2CG4A 4L5IA 4H0EA 2XGCA 1CGPA 5CVUA 2VKEA 4RBOA 2RV8A 3K69A 4JOMA 2HYGD 4KMUX 4Y4RA 2YX7A 2CFXA 1JE8A 3V7CA 4HZFA 2LD5A 2MC4A 2WB1N 3I3LA 1IUYA 3HTSB 2LY2A 2XB5A 1RKTA 2L9RA 1I27A 3ZQLA 1WJBA 2LF7A 1SFUA 2O5RA 4FISA 3NARA 4KT5C 4HLYA 4ZJZA 1BI0A 5B1AH 3GTQJ 3LL7A 4PSXA 3CLQA 1W7PD 4EGZA 2Y0SA 3E6DA 4XIDA 1LFPA 2EJRA 2JSCA 1J9IA 5A2QZ 4N9HA 3G3ZA 2CW0F 4KN7X 3CO7C 1K78B 4BHBA 5HLHA 3EQLF 5K5QA 2DA3A 2VBXA 3GFIA 1FT9A 3PL8A 2O3FA 3WGGA 1RRJA 2UWMA 3UKGA 3KYCB 1UAAA 4M3BA 1X4PA 4Z2YA 3CCJI 2GIVA 2AXLA 2BGCA 2ISYA 4PK4A 4XLFA 4ON0A 2X1DA 4AYBN 1FBUA 5F64A 2R5ZA 1IN8A 4XNFA 1WI3A 2CW7A 4A3LJ 3H3ZA 1OQYA 2LC2A 4OWRB 4WCGA 2COMA 2E19A 1FEXA 4NQWB 3WGHA 2P81A 5E3MA 2ACJA 1IG7A 5F04A 2L5QA 4UB6C 2OQGA 4A2UA 1WJDA 2QQBA 4B3AA 2IP2A 3PNVA 2M2EA 2VPRA 3B6AA 1B8IA 2R7RA 3F8BA 2DOEA 2FBHA 2JUCA 1W5SA 4BJTA 1QQIA 3BCBA 3PIOF 2F6CA 3RQIA 3IHUA 4RAGA 1XSXA 2KFDA 1FSEA 2FQ3A 3M4OJ 3GF2A 5TJJA 1BL0A 1X3WB 4QPQA 4AIJA 3M7GA 5IP9J 4Y3OA 1Y1VJ 2XROA 2R7XA 2A05A 2FQ4A 1T38A 1EA3A 4S04A 4JP0A 3OWTA 3HPHA 3KEOA 1B1BA 3HXLA 1ITYA 3GUDA 4HOBA 3CCLI 4RGRA 1QHHD 1U0JA 2A3SA 5FFZA 3DKYA 2O6GE 3I55I 2JPCA 1BJAA 2TCTA 1B6AA 3JAMZ 2QZ8A 1IO2A 4XLHA 3PNTA 1E3HA 2QWWA 1TQPA 3TOBA 1XS9A 3C1DA 2EBIA 1LE8B 5D8KB 1ETOA 4FE4A 2IGNA 1Z1DA 1MBJA 2STTA 1MNEA 3NRVA 4MGRA 1LDJA 1HSTA 3LSRA 3FX3A 2LKSA 1FTTA 1I50J 3DBHB 3LA7A 1GV5A 4BAYA 1ORKA 4LIVA 3A2KA 1RNLA 4HF2A 2JK3A 1A36A 5D6EA 3S3MA 2DDBA 2V9KA 4YFXF 2QSGX 4XKBA 2MD0A 1TBXA 4DYQA 1WH7A 2Z1DA 2PX9A 2VT2A 3NEUA 4B1RA 4KIFA 3FXQA 1Z9CA 2CUZA 2B7EA 5K7ZA 3JREA 3T1BA 2FRHA 5B66C 3QODA 1TW2A 3JCUC 2ZKZA 3KEQA 1O3QA 5EGOB 1BR4A 1LEAA 4WXDA 4IQJA 2E1MC 2RREA 3QPTA 4YG2F 3V7RA 1I6HJ 1UJ8A 4A3FJ 1TQIA 1H8AC 4RGUA 2HZDA 2ZNYA 3HGYA 2VB6A 3EPZA 4HX7A 4MLOA 4BH9A 3HGGA 3W2WA 2QVOA 2L7MP 2XAFA 3RPUA 4IHTA 2H09A 4HYEA 5BNGA 2GOMA 2B0LA 2KJBA 3FISA 4U87A 2R93J 4HDUA 1KONA 3S3OA 1C0WA 3DU5A 2VKDA 1R00A 5DV5A 5D5WB 3CCUI 2CUEA 5LEKA 4M9XA 2Z99A 4KA4A 2F5FA 1H0MA 1HDPA 2YUSA 5CJ9A 1A6IA 1H9GA 1S9HA 2Y69H 2CMPA 2CQ7A 3JSOA 1SAUA 3BG3A 3REOA 2GZWA 2QGUA 4EMSA 2VXZA 4CZZA 3BC8A 2HDCA 2KP6A 1A35A 4D5CA 5J4VA 1FY7A 3C3WA 3PSIA 3CCSI 4LJZF 3HDDA 4AU7A 3OYHA 1G8XA 4G6DA 3TO6A 4QIWN 3F23A 4I0BA 1LJ9A 5L3DA 2EA4A 2MW8A 2ZJRF 5GTHC 1FJLA 2CQXA 1XC5A 1HW2A 1VQLI 4KYWA 2R7FA 3ZMDA 1WJ5A 3MQ0A 2FOKA 1I39A 3UNGC 4XSXF 2BV6A 2WTEA 3GLLA 1YE9A 3GZ5A 1ZG1A 2JZYA 2DN0A 1MSFC 5FROA 3WTYC 3E97A 3RPQA 1BBYA 5E8IA 3DLLF 4PJMA 1TWFJ 1BW6A 1R5GA 4HQMA 5CVJA 1V5GA 2AQEA 3WU2C 2K85A 1SEUA 5E1ZB 2HU9A 3MFKA 1QU3A 2PJPA 3TO9A 1I1SA 2D1VA 3F21A 2NOGA 3WODF 2HOEA 3H35A 3O3KA 4R8HA 4KIBA 4LK0F 1JT6A 3BT9A 3ELKA 3B6CA 1VZ0A 3I4PA 3LA3A 2E1NA 2BXZA 1ZRCA 3VYSB 3WTZA 4BNCA 4I7HA 3F3XA 5F1JA 5AONA 4KIGA 4KICA 1IN7A 4M74A 1HW5A 1GT0C 3CC7I 3JSPA 2ZJ2A 4LK1F 2PBIA 2LFBA 1W7PB 2WADA 3VB2A 2OD5A 2M5WA 3CJNA 4D1QA 2LY1A 3SEQA 3FM5A 1HKQA 2VJJA 2DPDA 2DK5A 3OIPA 4IHWA 2EZKA 3OYJA 2DA5A 1VQMI 5E1WA 3K70D 1MBKA 3KP4A 2P7CB 5HLTA 3U1DA 3BLYA 1ODDA 3JRAA 2NRAC 2LY9A 4D9JA 2E35A 4ZTFA 3FMRA 5FKOA 2Y2ZA 4ENNA 2E2HJ 5D8LB 3R6SA 4QLCU 2E71A 5FD5A 2PG4A 2JA6J 2K9QA 2NVUB 3H9JA 1ZQ3P 1RUOA 1MBEA 2XKOA 1Y8QB 2KRCA 2OAZA 3K0LA 1TT0A 1DDNA 1LDKB 4PGGA 5DS9A 4IOCF 2O9LA 2ESNA 4A3MJ 2IS6A 1TTYA 1SVOA 1LFBA 1WJFA 2Y48A 4M6YA 3ZN0A 2X0LA 4D5FA 1TWCJ 1Y1WJ 2DFFA 2XF7A 4A0XA 4CYCB 3O8HA 2PQ8A 3G1LA 3LSMA 5L3GA 2XSJC 4HV6A 2NYXA 3GX4X 4BACA 2XPVA 2D1HA 3NWSA 1Y6IA 2VC0A 1FNNA 1SMYF 1JGSA 3ZOBA 5IP7J 4F93B 3DPLC 3KIOA 4C2UA 1SC7A 4ZDOA 2C6YA 2QENA 2DQRA 1X1BA 3A1YA 2R0QC 3HOUJ 1FOYA 1E2XA 1U8RA 2XGXA 3LSGA 4PJNA 1G4DA 4LMYA 2HXIA 5M5YJ 4EQQA 2MGQA 3R0JA 4W1UA 1AKHA 2KRHA 3HRUA 5J8CA 2HKOA 5DCMB 4EVIA 2NS7A 4P96A 2CYYA 3CCYA 2BY0A 3AL0B 2V6EA 2A5WA 4KNYA 1WPKA 4CCLA 2HVRA 3CESA 1B4AA 3BQYA 2V79A 5FJ8J 3J80Z 4C3IJ 1GXQA 2QCOA 4KFCA 1FMWA 1VQNI 3JRDA 1H9TA 4ZYHA 1FP2A 1MMAA 2FX0A 3CO6C 4LG0A 2ME6A 4DGWB 3DU6A 1IJWC 4IRIA 5K7HA 2D45A 1AWCA 2LRDA 2IS1A 3CDIA 3MZ8A 5KNLA 4M3FA 4RAFA 5J1RA 4HA8A 3SHFA 3LSKA 3W2VA 2ZJPF 3C2GA 4XR6A 2F4MB 2CW8A 3K7AJ 5FO5A 3JRHA 3QAHA 1ZG5A 3K1MA 3D5SC 3QYBA 4CYDA 1YITI 3ZQFA 1YOVB 2YS9A 1K79A 1P9QC 1HLVA 1A6QA 4JX6A 1IXCA 2RNGA 4KJZA 3S14J 3M8JA 2XAQA 1ACIA 4E7HA 1P7IA 2B9SA 2VE9A 2GLOA 1BR1A 4TV7A 2P5VA 3CMAI 4NC7A 2XDVA 5BS6A 2DODA 4I09A 4YELA 1NH3A 1GXPA 2Z33A 4BE2A 5CQEA 3A4CA 4D0PA 3I59B 2H6BA 5DUIA 1ETVA 3EYYA 1LVKA 2HQAA 2KIUA 3HHHA 3J7YJ 3J7AO 1BOBA 5LGTA 1U5TA 2M7BA 1I6XA 5D4RA 1IAWA 5C44J 2DCEA 4LGWA 2BY3A 2MSYA 4WX9A 2YU9J 1MMNA 2WC2A 1IGNA 1X1AA 4KN4X 1D1BA 2L9VA 2FOWA 4PZJA 5E3NA 1W4MA 3BG6A 1P92A 3HOVJ 2A68F 2CQKA 1K78A 1MMSA 1P7JA 1VQKI 2EQRA 4LLLA 4X0GA 1GHCA 4XLCA 1TNTA 3HEFA 4ZDLA 5IYCJ 2X1CA 2Y31A 3SZTA 3DPTA 4EV0A 2LLKA 1V55H 2L54A 3FMSA 4GDFA 2DA4A 3GXOA 2F4IA 4P1WA 3P9CA 2W7NA 2WY8Q 3BPXA 4BJ6C 1B9MA 2OUMA 3HPGA 4NNJA 2A07F 2YPRA 1ENHA 1ZG3A 3F8FA 3PJRA 2GXBA 3U1KA 2HQ5A 3K10A 5EJCA 3L1PA 4LITA 3LNQA 4A3GJ 1JUMA 3QPLA 3ZGKA 1W36D 1JI8A 1U5TC 1X1DA 3HYIA 5LGNA 1YS7A 3RYRA 5C4XJ 1WSUA 1MKMA 2KIMA 1EH6A 1HW1A 4NQWA 1OCPA 3S2DJ 2VODA 1UHWA 1ETXA 4ANJA 4OINF 1ZGJA 2DXIA 1EH7A 2DLLA 3CC2I 4PJ0C 1K6YA 1IDYA 3CCRI 4PJJA 4H4KC 3C2BA 2OF7A 2IBDA 4A5NA 4EJUA 3S1RJ 2CUFA 3MVPA 1R71A 3K9TA 4DW6A 1G3WA 4V2FA 2FF4A 1JGGA 5FLXK 4L5JA 1D5YA 3S1QJ 2ZSIB 1GUUA 3ZQIA 3OSFA 4I6ZA 3ABKH 2HKXA 2RN7A 4BBSJ 4BY7J 3OOPA 2K86A 1Y56A 2HYJA 3OYKA 4RB1A 1Z77A 3OL4A 3WG9A 3I53A 5JLXA 3K2AA 3LSHA 1JJ8C 2WY7Q 2CRGA 5FFXA 1VF9A 2EIMH 4G12A 4NC6A 1QO0D 2V26A 2FSWA 4C2MJ 2IA1A 3X2QH 1TL8A 2M4KA 1KGSA 4MIMA 3HJEA 1LE8A 4FX0A 2JA2A 3SQNA 1J2XA 2P8TA 3OIQA 1J59A 3K6GA 2DOFA 5CVIA 1YJ9I 2QEXI 5IT9Z 4DZJA 3JRBA 3WU1B 1ZH5A 1WH5A 1X2MA 3E5UA 5F08A 3TKYA 3ZQ7A 2LYCA 2GOXB 5GPCA 3HKZA 2VKHA 4PGHA 3A02A 1Y8RB 1SFXA 1P4AA 2FMLA 3L7WA 3KP2A 2BEOA 1IDZA 3QU3A 1FYKA 1JHHA 2DTZA 5E17F 4I0AA 1O7LA 4L0ZB 2COBA 1JT0A 4HX4A 4XOPA 2CV0A 3FXJA 2HPIA 5D4SA 4BGDA 2OTJI 4XLNF 2WB1A 2N8GA 5J6XA 3TW7A 5EGOA 3OYDA 3N4MA 4K2EA 2ZCWA 4M73A 2ZXIA 2PJRB 1U3EM 3JRIA 2GXGA 2Q2EB 2W84A 4I76A 3HKZN 4M6XA 3TQNA 4MEXF 2K3FA 3MKLA 1VNDA 2CU7A 2E60A 3GTJJ 2QA4I 4RLQA 2L2OA 2A69F 2OU2A 3K1NA 4A3EJ 3C2HA 1MDMB 2FNPA 3SZGA 2QBYB 1RESA 1PDNC 1KU2A 1A5JA 3W6VA 3BJAA 4EM2A 3K4JA 2KRFA 1VTNC 2WV0A 5ERIA 2XB0X 3K4KA 1BIAA 1XDSA 3HRSA 2KDOA 1T0FA 3H0DA 3VEPA 5KAIC 1MBHA 1FIAA 1KQ9A 1FTZA 1R23A 1BC8C 3KLOA 1ZRFA 1WFXA 5H2FC 4OAYA 3KZYA 4BDZA 2XV4S 3OYMA 4OIRF 4AYBA 1S6LA 3I4MJ 3QQAA 4D7NA 2HDWA 4UNOA 3DEWA 3BJOA 2W82A 4UY8I 1MZBA 2AXTC 5ICFA 1NG7A 1RETA 4JQFA 4OMZA 2IPQX 4CCJA 3GO5A 3EETA 4UVCA 2FXAA 3IAM2 1DGRM 3HB9A 1YLFA 1VQ4I 2BW3B 3OL3A 4IL6C 1WQ2A 1QVTA 4IZZA 3HOSA 4IHVA 4HG2A 1G3YA 3MKZA 2P6TA 4HF1A 2DBBA 1YJNI 3ML6A 4CCKA 2NVXJ 2A5YB 2K40A 3BCAA 3GYHX 2V9PA 3B02A 3DWLE 4MFEA 2UXNA 3O8GA 5HS9A 3ZN1A 3BR3A 1MNMC 3F0CA 1T98A 1BI1A 2IVMA 3VDXA 1YRNB 1T0FC 3H5RA 2EB7A 5GTIC 1LVAA 1POGA 3OYLA 2VC1A 1WJEA 2KJCA 5KVRA 1R1UA 3E3VA 5DCFA 3MKYB 2PMHA 3TEDA 1ZR2A 4ASNA 1W7PA 3LQQA 2BYVE 3OYAA 1H89C 2RDPA 2RQPA 1J0RA 1OCZH 3CJQB 3F6OA 3HTUA 1T8IA 4PUSA 3PO3J 3H1CA 4XLEA 1I3QJ 5K5OA 1KU9A 3MKWB 1Z7UA 4HNTA 2L9SA 2Y9ZA 1RI7A 3QPSA 3RZDJ 2R4GA 1MBFA 4HBLA 2H1LA 5HOOA 1F5TA 1YW7A 3DPUA 4IPAA 1JJ6C 1REPC 3ERED 4XRMA 1JHFA 4F91B 2XGDA 3MWMA 2HOAA 2Q8KA 1ETQA 5CYVA 3FXKA 4XICA 5LRSA 1DP7P 4C3JJ 2VPLA 3D5RC 2MC3A 1GDTA 2IRFG 2IAIA 5D5XB 2K9SA 2J5OA 2RQQA 1XSDA 1F9NA 3I5UA 1N75A 3G6EI 2HVQA 3QRFF 3BPVA 3PUBA 2DMNA 5A2QK 3ZMTA 1SANA 1XPXA 1LB2A 2EFNA 4I98B 4G8XA 4MEYF 4CYCA 1BA5A 3J81Z 2ECBA 5DDGA 3RKYA 4O5VA 4B48A 3FXLA 2KLOA 1FMVA 2AHQA 1W5CC 2Y75A 1VQOI 2FE3A 3LWFA 2JA5J 3EUHA 3R4KA 3DTIA 3KETA 4G7HF 5EZHA 2DK8A 2VBYA 1W1WE 2HPMA 3KZIC 2JTVA 2DO7A 3V4GA 5EYRA 3CC4I 3PO2J 3OS0A 2JWTA 2PFBA 3HOYJ 2VKVA 1N77A 4XBFA 4CSWA 5ICCA 3BROA 2W85A 2RAEA 4XRSA 4MTEA 1Z6TA 2WAFA 2HYFA 2EWNA 2L01A 2H8RA 1P6RA 4ESBA 1YI2I 1WVRA 3RTRA 2K9MA 1D5VA 1WZ2A 3L09A 3LSJA 1O3RA 2L7FP 3PNYA 1UCRA 5HS8A 3W3CA 4RDUA 3BZCA 5BPDA 3U21A 3QWLA 3FK7A 3Q0VA 2D2WA 2V6CA 1MMGA 4HSRA 5HDNA 1QBJA 4IOAF 3CZ6A 4CUGA 4IKFA 1LQ1A 4YRVA 4UUSB 3RSNA 3I54A 1OPCA 3VOEA 2X6OA 4P55A 4HX8A 1P4XA 1TQMA 3P9KA 2ZC2A 4HF0A 4QSHA 2DJNA 1P2FA 3H3UA 4FE7A 2YX4A 5JI6A 3HL2A 2EZLA 2X6YA 3ZRGA 1RIOH 3DEEA 3FBIB 4BKXA 4HNUA 4NC8A 2FA5A 2K9LA 2OCEA 1NK2P 3ECHA 3F8NA 5C4JJ 3CCQI 2M34A 2L0KA 3I4NJ 1IC8A 4ZYEA 2ZO4A 1D8KA 3JAMK 3HRTA 2HGCA 2QYOA 3WTXC 4HSTA 3AL0C 2E5ZA 1G6NA 2IS4A 3E5XA 1ZLJA 2HZTA 1M1EB 1WI9A 2TDXA 5FLVA 4E7LA 1KQ0A 3DQVC 3CUOA 1K83J 4GCVA 4WK8F 2P5KA 1IUFA 2DMQA 1BR2A 3T5XA 3EUKL 3VSKA 2JN6A 2E36A 3HOWJ 5LHGA 4G7OF 3QYEA 2LF8A 4BQQA 3ZQCA 2FJ1A 2P7VB 3IH3A 2DJIA 1OMIA 2MH2A 4UVBA 2P6SA 2PEXA 4RB0A 4XL9A 1PUFB 2MABA 1BN5A 1T33A 1B72A 3BZ6A 2QQ8A 5F6FA 2W25A 3ZP5A 2JMWA 5B1BH 4J19A 1R22A 4M72A 2CV2A 1USTA 2OCCH 1D8JA 2GAUA 2HQRA 3I56I 1LEBA 3U9GA 1HOMA 4LFUA 3JRFA 1LNWA 4A93J 3BDDA 4FT8A 3QPHA 3HZJA 1DUXC 2O8XA 2BHYA 1EH8A 2NVQJ 4OIPF 2IGOA 2M8EA 4V2GA 5KK1A 1G2HA 3SZPA 1ZTRA 3KYLA 4E7SA 2K4BA 1EF4A 4GYGA 1XGSA 3GTLJ 3ZR8X 3ZPLA 1XX5A 5GAHJ 4ITVA 2BVLA 3E6MA 4KT6A 3DKWA 4PFPA 2R7DA 2NAZA 1S29A 4FHTA 3BJ6A 3H9GA 2DTRA 2E7XA 3P9IA 2DMUA 3ROUA 5FGMA 4JX5A 1JKPC 1MBGA 2M9HA 2DFIA 4EJTA 3I71A 4KDPA 2ECCA 3OYIA 1UB9A 4PSWA 4GGGA 4E4HA 2VI6A 1RR7A 2F5VA 2X4HA 4UXNA 3OYGA 2L7ZA 3CMEI 1CF7A 3W2AA 5C3EJ 4AIKA 4EGYA 4AWXB 4ZZLA 1RZ4A 4GRIA 1SD6A 5E3LA 1TT5B 3MN2A 2OQRA 2I5UA 3BR2A 4A3BJ 4M9ZA 3TMOA 2V1UA 1XMKA 2CSOA 2E7WA 3G1OA 4KITB 5DTDA 3MAJA 1DU0A 2JT1A 2QUFA 4FTHA 1AOYA 5KCMA 3SDBA 4CGZA 5L3FA 1JUPA 3W6JB 4AVPA 3CUQB 2YSRA 3RYPA 3GMEA 4XRFA 3RJPA 2A6HF 1XMXA 3GBGA 4QWQA 4UV8A 5CVRA 1UHSA 2IA2A 1ETYA 3JR9A 1ERDA 5BQTA 1JXSA 2IA0A 3LAPA 3S32A 3QOPA 3GFLA 5D6FA 5F0CA 4BY1J 3KCCA 2KZGA 2XASA 4XN3A 3ABUA 3QP6A 4IHSA 2K9NA 3ULQB 1BW5A 3FXUA 2EFPA 5H20A 1MNDA 1QHGA 1YW8A 3OR1C 4XSZF 2ZBKA 1PUEE 2F2EA 4L5EA 3U2RA 1T6SA 2CJJA 3SYTA 3OYFA 1U78A 3QU6A 5J1UA 2A6TA 3R61A 1FBSA 2DQLA 4MO7A 5CPRB 2OV7A 2XPWA 2QSFX 2HEOA 2LH9A 2MLKA 1QZZA 2ID6A 1ZGWA 2FNAA 2XKPA 3VYUB 5KHDA 4HPQA 3A0BC 5J47A 3E6BA 3ZQGA 2FMYA 3T8RA 1IZ1A 2KPMA 3RKQA 4EM0B 3DTEA 4FCYA 4DIQA 3ZMVA 3CJRB 5FB2A 5K7FA 2PN6A 1VQ7I 3K70C 3HOZJ 2VIXA 2JPBA 1FYMA 4XORA 3MD2A 1D1CA 4CXFA 2F5CA 5LFAA 1T56A 4LOCA 1MDMA 1FX7A 2QBYA 1UG2A 1Z67A 2NNYA 2Y30A 4ENKA 1BM9A 2E1OA 1YQAA 4IHXA 1NHAA 3IAS2 2VLAA 1OYIA 1OJLA 3BWGA 1WCMJ 3IRRA 1YX5A 2HWVA 2KIFA 2XAUA 3VPRA 3OR2C 4F92B 2K5CA 2XC7A 2P5LC 1K4TA 1N25A 2ZMEB 3SFIA 3A01B 3L2UA 2KISA 3BTIA 3BQZA 4I99C 1OKRA 1V5FA 1F43A 1Z21A 1HCRA 3BR0A 5K5RA 3H3VK 5J1YA 2HDDA 1VQ6I 3M1CA 4ENJA 4ZTJA 5HDKA 1TWAJ 1N78A 1V54H 2X6WA 3V8LA 1WRJA 4N9IA 4ZC3A 1MGTA 4XK4A 2CV1A 4HLXA 5J8FA 1Z6RA 3PQJA 5LRRA 4EJVA 4BDYA 2L02A 4FETA 1VQ9I 1I1GA 1U9NA 4MTDA 3PUFA 3CCMI 1JTXA 1WJAA 2CQNA 2Z9OA 2HOTA 5FD6A 3J7ZI 1BC7C 3FHZA 2EV0A 2DI3A 4R79A 1XGMA 3J80K 3AKZA 2OC6A 3SXYA 4CHUA 2A6EF 2HTJA 2X9DA 3ABLH 4Q47A 1IV6A 3KP5A 4OAZA 2NS0A 3AFHA 4RM2A 3DCFA 1YRNA 1NG6A 3FIWA 2I10A 2DFHA 4L9NA 4E7KA 1T95A 2H8WA 3L2VA 2XGEA 4FASD 3IKTA 1XCVA 4MHGA 1K4SA 3COAC 2XF6A 3GW2A 1K61A 3HHGA 3OSGA 2EZIA 2CGPA 4BJ5C 2BY2A 3ZQQA 4G9YA 2VUMJ 4UB8C 9ANTA 2E1CA 1KYZA 3PM1A 4MFDA 1RPWA 4NDLA 1SD5A 1F1ZA 1R9TJ 4ZDPA 2LREA 3IH2A 1TZLA 3WTVC 5JVGF 1R1VA 2ESHA 3ZMUA 3AG1H 1IXSB 4N4OB 2LBFB 4RB3C 3GFMA 5JVTA 2HOSA 2VQCA 4ZH4F 2FBKA 2HVSA 3I58A 3QP5A 4NHJA 5JHUA 3CJTB 3TBIA 2EH3A 1GLNA 4BEHB 2H27A 4MQ9F 2EFWA 4ESFA 5TGTA 1YIOA 1Z7LA 2LKXA 4JYKA 3I64A 2JVGA 3OIOA 2EFQA 4G6QA 4OOIA 4P9FA 1X4OA 3K4CA 1FBQA 1IN5A 2DA2A 1D0YA 2R7OA 2CO5A 3PQKA 1ONVA 3GWZA 2IW5A 4L18B 3H92A 3LOCA 5E3OA 3JTGA 1VQ8I 1X2NA 2EILH 1IV8A 1W5TA 2DA7A 2W4SA 4AIDA 4D7MA 2K27A 2M30A 3RI4A 4RAYA 4DOZA 1EJ9A 2V1DA 4KUMA 3WE2A 4GYIA 2EZHA 2LR8A 1SD7A 4G7ZF 1FWZA 1MH4A 2CH0A 4WWCA 2V1XA 3TDZC 4Q5SF 1YS6A 4B3XA 2ELJA 1OYWA 2ZXJA 3CD6I 2G7HA 4BUPA 2DMPA 1O3TA 1YG2A 3TO7A 4F7ZA 3CF2A 3LFKA 4Y7NJ 3V8JA 2OJED 4AVZA 2HTSA 2VASA 3DFGA 3OS2A 2XAHA 4CCNA 2O0YA 1HXDA 4EEFG 5M5WJ 2DA1A 1R6RA 4XOTA 2BZTA 1XG1A 1AKHB 2MBFA 1WGXA 5HODA 1UMQA 2VQLA 3HRMA 4CA0A 2X48A 2L7KA 4IJAA 1PYVA 1WJCA 1ZELA 1X58A 1XTAA 4A3CJ 1Z91A 3L2RA 4F55A 1W36C 1XMAA 3FBNB 4A0YA 3W6KB 3FM3A 2M1BA 5J3LA 3KFWX 2WAQN 5LHHA 2V9VA 4UUSA 4A3DJ 4O3MA 1X1CA 3OS1A 3NAUA 2HFHA 3Q0UA 5HDGA 2HXOA 2KDZA 2DOAA 1DP3A 5AIQA 2VJ4A 2YR2A 3KE2A 5ILSA 1ZLKA 1TWHJ 3IC7A 2BVMA 2NS8A 5JHFA 4EJOA 2GBYA 3OYCA 2ZXWH 3F8CA 1BI3A 2M8GX 3AAFA 1SMTA 2IJLA 3DTKA 1FLIA 1ZREA 3S17J 1U6GA 2NXNB 5E8GA 1R7JA 2M4GA 1LDDA 4C9YA 3VYRB 3V42A 4ETSA 3HUGB 5GAGJ 5H6QA 4RM3A 3E0JB 4Q4ZF 1B9NA 2MFZA 2VQGA 3EUAA 2CS3A 4RLFA 2DYSH 2JVHA 2CWEA 1FP1D 5AIPA 3Q9VA 3H5AA 2W00A 3M8EA 2KMUA 2E34A 3BR5A 1YW9A 1IF1A 1U8BA 4A3KJ 4A12A 2JRTA 5JFRA 2OPTA 3S1MJ 3IKVA 1ON2A 4XKCA 4XM3A 5L3EA 2EV6A 1E3OC 3NQOA 5EEHA 1U5TB 4E7IA 5IT9K 4YIIA 1OFCX 2ICWG 3K4LA 4CCMA 4U0YA 1VQPI 3P5JA 3ONQA 3N97A 2UV1A 3OOUA 3JW4A 2VT3A 3PFIA 5ICGA 3FXOA 1O7FA 3DV8A 2BOLA 2GWRA 5B5EC 2Y9YA 2QM3A 4IVNA 4IRGA 2TRTA 5DEQA 3FXMA 1PUFA 4OU0A 2L9NA 3L9FA 5IY5H 3BY6A 4A6EA 3OV8A 4S05A 1Y39A 3CDHA 1DPRA 1YJWI 2DDAA 2RGVA 4B47A 3WE3A 2DFEA 4RAZA 3E7LA 3IP4B 2D5VA 4L9JA 2EIKH 2VQHA 2VN2A 2AO9A 4Q48A 2AS5F 5ILVA 4RGSA 1D0XA 3M9AA 3ABTA 3KLNA 3LFUA 1Y0NA 4C3HJ 2Y0SN 1MD0A 2I8DA 1HA8A 1SAXA 4CH7A 3GFJA 1Z3XA 3H9QA 1J5YA 3WU0A 4O6JA 2VOOA 1O3SA 2NVYJ 2ZFUA 2ME0A 3WHCA 5LLQA 4OMYA 3RDIA 2ZB9A 1GV2A 1HBXG 3RZOJ 5JLWA 4XRSG 1Y0UA 3K4BA 2DT5A 1ULYA 1JUSA 4ABZA 2UUZA 3R60A 2P0WA 5L3BA 5DD4A 1JTYA 1WWXA 1IRXA 3TL4X 1ZARA 1S7AA 3TGNA 5M3MJ 3CP2A 4I02A 4NBQA 3ISPA 3FF5A 2KKOA 3BG9A 4J00A 4A3IJ 1ZRDA 3ZMSA 2LVSA 2LG4A 2VBWA 4PJLA 3M1EA 1IN6A 1D0ZA 2JSPA 3L00A 4ZYDA 5D5UB 4CDGA 1HC8A 4RGXA 1XCBA 2WAEA 2XUBA 3DBRB 1OYYA 2GQQA 4EATA 4B4CA 1XN7A 2QKLB 1QNTA 4AUXA 3G71I 3FDYA 2E2IJ 1MJBA 1ZYRF 2E5NA 4C2TA 1SD4A 1R4NB 2KIQA 3EDPA 3GZNB 3V7SA 3D1NI 3CLOA 1MMDA 3S93A 1XDUA 2M7AA 2XVCA 5IOZA 5EG0B 1YFHA 2IT0A 1ZR4A 1TW3A 2EFOA 2A61A 5FKNA 2F5DA 4PFOA 1S5LC 4B8XA 4DQ2A 5DM6F 4BYYA 3CUQA 1GVDA 2MH9A 5F1RA 2EV5A 1AU7A 4BXFA 1O57A 2LOOA 3JRCA 4G94A 3S2WA 1MW7A 2R5YB 2MLGA 1TC3C 2JJ7A 3R0AA 3VSLA 1S8NA 4XKWA 3DXJF 4RMNA 2M45A 2MD5A 4M3EA 2O8KA 3F72A 2L3DA 3RPUD 4M6VA 2XRNA 5EEGA 2Q1ZB 2EA2A 4L9TA 4UUVA 1QPIA 2XF5A 1B59A 1R5HA 1S7EA 5DCMA 1SFKA 2KL4A 3OMYA 1FPQA 3RKXA 2R7SA 4J01A 2K4JA 2ID3A 1V4RA 3HIFA 4XLPF 3GEZA 3KEYA 3IRQA 4XN0A 5FKKA 4YFNF 1BJZA 4Y13A 1KQ8A 3A0HC 3FKJA 1OISA 4U0WA 4BE0A 4ZYAA 1EV7A 3FKIJ 4BQOA 5LBQA 4HRIA 3BG5A 2IS2A 2XAGA 3CUQC 3EUHC 4PCQA 1X3ZB 1UZCA 4BQAA 5J40A 2UZKA 3ABMH 4DYCA 2VBZA 3QYFA 1HKTA 4HEA2 2L4MA 4X1EA 3K2ZA 4XMYA 1FIPA 4IO9F 3BR1A 2KHMA 2O03A 2ELHA 4UVAA 4MQVA 4CO8A 1YTYA 3KYDB 2W57A 3HC7A 2VL8A 3KPHA 1UELB 3GCMA 5HNHA 3K4MA 4LG3A 3LSIA 4LB6B 1LFUP 4A5MA 1BI2A 2FUG2 5HNFA 2PI0A 5IYBJ 3G4SI 5CQGA 3GLXA 2RKHA 5CKTA 2J5PA 2LK2A 3IUOA 3I59A 3H36A 4WXHA 1XSVA 5JR3A 3KP7A 4N4NB 5IT3A 2R92J 3J81K 1ZK8A 1QPMA 1H88C 2Z3YA 5ED4A 2ZMEA 4U7DA 3A01A 3LSTA 1RC9A 3IWFA 3D5LA 2E2JJ 2G7UA 4E7ZA 4HQEA 1K6OA 3GTOJ 1FYLA 3WTWC 2OA4A 4AC0A 3E1SA 3WTTC 2QQ9A 2F48A 3E6CC 3RQ4A 2RC4A 1QA6A 3LQRA 3WG7H 2OBPA 4WXCA 3DBLB 1UHMA 3F6VA 4AD9A 3SEZA 3VFZA 2H94A 1IN4A 2DPUA 3SDGA 4DBQA 3K4NA 3L2WA 2HNHA 2MG4A 2XPUA 3CTAA 1I3AA 4X6AJ 3SFZA 4F52A 2QF7A 5D5VB 1ZHFA 4OIOF 2K3PA 5HLGA 3GTPJ 5LEJA 1E3PA 2O61A 3S16J 5LD2C 2W1OA 1HSJA 1HDDC 2VXDA 2BY1A 4IX7A 1K7AA 1G3TA 5ILUA 4R1HA 2DAOA 3KX2A 2X1EA 3N05A 1KZHA 3WTSC 3GTGJ 2GA2A 2K7LA 1D1AA 2R5ZB 1XGNA 4DZPA 4GFBA 2ZMEC 1HQCA 4QTRA 1SFEA 2HS5A 3G2BA 2EIJH 3JTHA 3OYEA 1USSA 1OCRH 4UHTA 3TW6A 1D3YA 4F3QA 1RR8C 4B44A 5CLSA 3V8KA 2EINH 2IGKA 4B43A 3KZZA 5FKLA 4AIHA 4IRHA 1MJ9A 3P7NA 3TDUC 1JKQC 2QLZA 2F4OB 2R7ZJ 2V7FA 3HOXJ 2M3AA 1B8IB 1Z05A 2GA1A 2R7QA 2HR3A 2BE5F 2FU4A 4IF4A 1W0TA 3QOEA 4C30A 4II2A 2Q0OA 4HAMA 1VFCA 5DD8A 2ZJQF 4CZCA 2LDUA 4JK1X 1TP4A 4Y17A 5TISC 5ICEA 1R58A 4II3A 2LBFA 5LHIA 4GO1A 3KP3A 4HDVA 3S15J 1YX3A 3HSFA 1Z0XA 3IV5A 1ZAOA 4ZZDA 5BPIA 5BMZA 1XGOA 3VWBA 1MIJA 4M9SA 4YIRX 3Q3SA 1G59A 3SJMA 3HBLA 4NUBA 4BEHA 1KU7A 1ON1A 2XAJA 4V19K 1J75A 1X3UA 3O2PE 1APLC 1IRZA 2XSDC 3Q9SA 1RUNA 1U9OA 1MJAA 3G73A 2LTPA 2RNJA 4RS8A 1ZGAA 3PFYA 5DM7F 4S0HB 2E1MB 2ZNZA 4ESJA 5E1XA 3BTJA 3VYTB 5F0FA 1DQUA 1I5ZA 2GXAA 3FK6A 1YHQI 1JKOC 2DU9A 2YU3A 5DYMA 2VONA 2BHZA 1ZKGA 2F5EA 4Z6YA 4YIFA 3CCEI 1SVMA 3T0YA 3ZQHA 3OY9A 3TP3A 4CICA 3O6BB 1OCTC 2WBMA 3BOQA 2KZVA 3ZMZA 4BHCA 3PIPF 4DYRA 2Z16A 3WTUC 4QPOA 5L3CA 4XONA 5K1YA 2O7OA 1FSHA 1NTCA 2ELKA 1LKXA 1W0UA 3H0GJ 4NB5A 1Q1VA 3ERMA 2H6CA 2JUGA 1TNSA 4LB5A 2FBIA 5GP9A 3MCZA 3CCVI 2WA0A 3BG7A 3RKWA 3BR6A 4N0BA 1TWGJ 1UFMA 2JRMA 2R3SA 1P4WA 5M5XJ 2KT0A 4HW0A 4XQFA 2AQFA 1KU3A 1HF0A 1OLTA 4KISA 2X6XA 4DBRA 2PJRA 3CP8A 4LIUA 3IL2A 2Q2EA 2R7UA 4E70A 1V5EA 4RA2A 3I9V2 4M3DA 1V3FA 2VJ5A 1PP8F
chains in the Genus database with same CATH topology
2R4GA 2NOJB 4DOZA 5HOOA 1WJ5A 3DPUA 3UNGC 4F91B 1YE9A 2CH0A 4B3XA 2ELJA 5FROA 4BUPA 2V4JC 3CF2A 4PJMA 2VJIA 2CUJA 2VPLA 4AVZA 1V5GA 2AQEA 2VASA 3D5RC 2HU9A 1QU3A 3OS2A 4CCNA 4XLAA 1R6RA 4XOTA 3H35A 2Z2SB 2RQQA 3OYBA 1VZ0A 2VQLA 1N75A 3VYSB 3ZXSA 4CA0A 2HVQA 2L7KA 1PYVA 1WJCA 3OYNA 1ZELA 3PUBA 3L2RA 4F55A 3LMMA 2M0MA 1W36C 3FBNB 1X19A 2WADA 4DJAA 3L2QA 4D1QA 2LY1A 3SEQA 4B48A 2KLOA 1FMVA 2VJJA 1X1CA 3OIPA 3OS1A 3DLAA 3OYJA 3UR3C 2DOAA 3DTIA 1DP3A 2VJ4A 2ZSHB 5HVQC 3K70D 2BW3A 5HLTA 3BLYA 2BVMA 2HPMA 4D9JA 5JHFA 4ZTFA 3OYCA 3OS0A 2ZXHA 3HOTA 4E7JA 1N77A 1J09A 3DTKA 2DT7B 3NWTA 2M4GA 4C9YA 4CSWA 3VYRB 3V42A 1OR7C 3H9JA 3HUGB 4RM3A 3E0JB 2VQGA 2MFZA 3EUAA 2KRCA 2CS3A 4RLFA 1TT0A 2WAFA 1LDKB 2X51A 2IS6A 4IQ4A 2JVHA 3RTRA 3F9KA 1WJFA 2W00A 2K9MA 2KMUA 3H5AA 5FRMA 4E6KG 3PNYA 3W3CA 1UG0A 3U21A 4HSRA 4XKCA 2XF7A 4XM3A 1MMGA 3H5NA 4BS9A 4P5OA 3CZ6A 4CUGA 4IKFA 3LSMA 4YRVA 4E7IA 3RSNA 2XSJC 3K4LA 4BACA 4CCMA 3NWSA 1Y6IA 3ONQA 2UV1A 3RCOA 3OOUA 1DGWY 4BE1A 4F93B 3DPLC 4C2UA 2DT6A 2BOLA 3J7AY 4ZDOA 3HL2A 2X6YA 1X1BA 3ZRGA 3A1YA 3DEEA 3ZCOA 3FBIB 3CMMA 2L9NA 3LSGA 4PJNA 4HNUA 4NC8A 2K9LA 2KRHA 4B47A 2X85A 3IP4B 2VQHA 3AL0B 2V6EA 2A5WA 4CCLA 2HVRA 1D0XA 3CESA 4HSTA 2E5ZA 3AL0C 2IS4A 4XKVA 3LFUA 2I8DA 4E7LA 1HA8A 3DQVC 4Y33A 4CH7A 5FRNA 1Z3XA 3H9QA 1FMWA 2ZFUA 2IGMA 1MMAA 1E0EA 4DGWB 1BR2A 3DU6A 3EUKL 3K4BA 3VSKA 2LRDA 2IS1A 2UUZA 2CFOA 2P0WA 5KNLA 3QYEA 2PMZA 4BQQA 3TL4X 1IRXA 4G6TB 3PSFA 3W2VA 2DJIA 3CP2A 3LSKA 3C2GA 4XR6A 2CW8A 2WAQA 2IXSA 4XL9A 2MABA 3D5SC 3QYBA 1Z3YA 4J00A 4BU2A 2CV2A 1P9QC 2R7VA 2LG4A 4PJLA 1AA7A 2RNGA 4KJZA 4U7BA 1D0ZA 2JSPA 3M8JA 4E7HA 2WAEA 3MMYB 1BR1A 4EATA 2R7TA 2QKLB 4NC7A 2XDVA 3FDYA 3FHNA 4YELA 4BQNA 4BE2A 2E5NA 4C2TA 5CQEA 3A4CA 1PJRA 3HG9A 1MMDA 3S93A 1LVKA 2HQAA 2M7AA 2IGOA 1BOBA 2V1NA 2M7BA 3KYLA 3S3NA 3S8PA 4PFOA 4E7SA 4BL0B 2DCEA 3ZR8X 4BXFA 2LOOA 1MMNA 4ITVA 1MW7A 2BVLA 2QKMB 4KT6A 1X1AA 2KQRA 1D1BA 3DKXA 3VSLA 4XKWA 4PFPA 2MYSA 4RMNA 3BG6A 3H9GA 4CCOA 3RPUD 4X0GA 2Q1ZB 4XLCA 4ZDLA 2X1CA 3OYIA 2XF5A 4PSWA 4YEJA 4E4HA 3OYGA 2F5VA 2R7WA 3DPTA 1SFKA 2KL4A 3W2AA 3OMYA 2R7SA 4P1WA 2F4IA 4J01A 2W7NA 4JOMA 2WY8Q 4BJ6C 4GRIA 2OUMA 3KEYA 4Y4RA 3HPGA 4NNJA 4XN0A 2MC4A 3I3LA 3TMOA 3PJRA 2LY2A 3FKJA 4KITB 3K10A 4LITA 4BE0A 5KCMA 1WJBA 3SDBA 3ZGKA 1W36D 2O5RA 4ZYAA 1JI8A 1X1DA 4BQOA 4ZJZA 4HRIA 3LL7A 4PSXA 2IS2A 3EUHC 2Y0SA 1LFPA 3GBGA 2DXIA 4ANJA 3QYFA 4HEA2 4XMYA 1K6YA 1ERDA 2KHMA 4PJJA 3S32A 4H4KC 3HC7A 2VL8A 1UELB 3PL8A 4XN3A 5HNHA 3K4MA 4LG3A 2UWMA 3LSIA 5HNFA 2FUG2 1UAAA 1X4PA 5CQGA 2ZSIB 1MNDA 1QHGA 5CKTA 3OR1C 3IUOA 4XLFA 4PK4A 3SYTA 4N4NB 3OYFA 2A6TA 2X1DA 5CPRB 2OV7A 1Y56A 3OYKA 4XNFA 2LH9A 3OL4A 3LSHA 2CW7A 2WY7Q 3D5LA 2LC2A 4OWRB 3VYUB 5KHDA 4E7ZA 4HPQA 2V26A 4NQWB 2KPMA 3E1SA 2L5QA 3DTEA 4DIQA 3RQ4A 2M4KA 1WJDA 3CJRB 3PNVA 3SEZA 2JA2A 3K70C 3OIQA 2R7RA 2VIXA 3K6GA 4DBQA 3K4NA 3MD2A 2HNHA 4XORA 3L2WA 1D1CA 4BJTA 3BCBA 5LFAA 4F52A 2F6CA 2K3PA 2LYCA 4QPQA 2GOXB 2W1OA 5LD2C 2VXDA 4Y3OA 3IAS2 3HKZA 2VLAA 4IX7A 2VKHA 2R7XA 1YX5A 2XAUA 1EA3A 3KX2A 2X1EA 3N05A 3OR2C 2K5CA 4F92B 2XC7A 3OWTA 1D1AA 3HPHA 3HXLA 3L2UA 1QHHD 1U0JA 1V5FA 3DKYA 3G2BA 1Z21A 4XOPA 2CV0A 2HPIA 3OYEA 4F3QA 4BGDA 4B44A 2IGKA 2WB1A 3PNTA 4XLHA 4B43A 3OYDA 3M1CA 4ZTJA 2ZXIA 2PJRB 1N78A 2Q2EB 2X6WA 2IGNA 2V7FA 2M3AA 1MNEA 2R7QA 4ZC3A 2E60A 2CV1A 3QOEA 4RLQA 4BDYA 2L2OA 4FETA 4C30A 4II2A 3C2HA 3SZGA 4LIVA 4CZCA 3A2KA 1WJAA 4II3A 2LBFA 3S3MA 1YX3A 4R79A 2V9KA 3VWBA 3AKZA 2OC6A 1G59A 3K4JA 4NUBA 4BEHA 4XKBA 2MD0A 3K4KA 3H0DA 2KDOA 2Z1DA 4OAZA 3AFHA 4RM2A 1NG6A 4E7KA 1T95A 2CUZA 3L2VA 1WFXA 4FASD 4OAYA 3QODA 4BDZA 2XF6A 3OYMA 3PFYA 4AYBA 2E1MB 2HDWA 1BR4A 2W82A 4IQJA 2E1MC 2RREA 3VYTB 1DQUA 4BJ5C 1NG7A 3ZQQA 4JQFA 4CCJA 2HZDA 2VB6A 3EPZA 3OY9A 3IAM2 1DGRM 4MLOA 3W2WA 4ZDPA 2LREA 2WBMA 2BW3B 2KZVA 2GOMA 1TZLA 3OL3A 4U87A 4N4OB 2Z16A 2LBFB 1KONA 4QPOA 3HOSA 3DU5A 2VKDA 4HG2A 4IZZA 3S3OA 3MKZA 4XONA 2VQCA 2HVSA 4CCKA 3TBIA 1LKXA 1GLNA 4BEHB 3BCAA 3DWLE 1S9HA 2CMPA 2JUGA 5TGTA 1SAUA 1Z7LA 3VDXA 1T0FC 2JVGA 2VXZA 3H5RA 2WA0A 3BC8A 2KP6A 3BG7A 1X4OA 3K4CA 3PSIA 1D0YA 2R7OA 4AU7A 3OYHA 3OYLA 4XQFA 1G8XA 1WJEA 2AQFA 1OLTA 4KISA 3MKYB 2X6XA 4DBRA 2PJRA 3CP8A 4LIUA 3OYAA 2R7UA 3CJQB 1V5EA 2W4SA 4PUSA 3I9V2 4XLEA 3MKWB 4HNTA 2L9SA 2VJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0M A;  2KHM A;  2MFZ A;  2MAB A;  2K3P A; 
#chains in the Genus database with same CATH topology
 5E79 C;  4I2O A;  1WKM A;  2MA3 A;  2NOJ B;  2FEZ A;  3MZY A;  5F0H A;  3S1N J;  1PVE A;  2OZ6 A;  1KYW A;  1QGP A;  1R1T A;  1FZP B;  2OTL I;  2DYR H;  4KMF A;  3VOD A;  3A03 A;  3HSR A;  3ECO A;  1JKR C;  2V4J C;  1OR7 A;  2VJI A;  2CUJ A;  4EM1 A;  2CQQ A;  1E17 A;  4HNV A;  3HUG A;  1T08 B;  2K02 A;  3CMY A;  4XLA A;  1YYV A;  1SFO J;  3BTL A;  4HV5 A;  5DUK A;  2Z2S B;  3C18 A;  1ZN2 A;  2GIZ A;  3OYB A;  2ZFW A;  1F36 A;  4BBR J;  5IP6 A;  3ZXS A;  2P4W A;  3AG4 H;  3OYN A;  3LSP A;  4IHY A;  2VOP A;  5E18 F;  2HQN A;  2NNN A;  5FLX Z;  1YO5 C;  3LMM A;  5J4Y A;  2M0M A;  2XIG A;  4W97 A;  4M3G A;  1X19 A;  1XD7 A;  3M3Y J;  2BXY A;  1MH3 A;  4DJA A;  4ZYG A;  3L2Q A;  2ETH A;  2XRL A;  3ASO H;  4IXA A;  2NVT J;  3C7J A;  1T39 A;  2OZU A;  3DLA A;  2PLY A;  3UR3 C;  1MSE C;  2EK5 A;  2ZSH B;  5HVQ C;  2BW3 A;  3F8M A;  1QRY A;  4LLG F;  4AM3 A;  4RB2 C;  5FKM A;  5B3S H;  3FXR A;  2W48 A;  3HOT A;  2ZXH A;  4E7J A;  4L9V A;  1IRF A;  5EF6 A;  1S7O A;  4B09 A;  3S2H J;  1J09 A;  1SVL A;  2DT7 B;  1VQ5 I;  2L4A A;  1ETW A;  3NWT A;  4PDK A;  1B72 B;  4OIQ F;  1OR7 C;  4I01 A;  1OCO H;  4A6D A;  3CQZ J;  2JQ7 A;  3CDL A;  5KAF C;  2JA7 J;  2G0E A;  5HS7 A;  3Q5F A;  1X1P A;  3AG3 H;  3GTM J;  4BXU A;  2X51 A;  1YIJ I;  1TLH B;  4IQ4 A;  2XHK A;  3EYI A;  4L0Y B;  3F9K A;  1QZY A;  5GAD J;  5FRM A;  1T2K A;  3AG2 H;  1OCC H;  3WHB A;  4E6K G;  3BZK A;  4A69 C;  4FQG A;  2DW4 A;  1UG0 A;  5EEA A;  3CF5 F;  5H6R A;  3H5N A;  4BS9 A;  1R5I D;  4P5O A;  3FMQ A;  4A3J J;  3M07 A;  1DPU A;  4MNU A;  1IXR C;  5TRD A;  3L2C A;  5EDN A;  4Y15 A;  5EZG A;  1S3J A;  1EKE A;  4U0V A;  3RCO A;  1DGW Y;  2QSH X;  4BE1 A;  1A31 A;  3JRG A;  2WV1 A;  3FZV A;  2DT6 A;  3TP0 A;  3J7A Y;  1DU6 A;  3BP8 A;  1R36 A;  1G3S A;  2PMU A;  3TOA A;  4YFK F;  2LKP A;  5E20 A;  3ZCO A;  1PP7 U;  3WGI A;  4JX4 A;  3CMM A;  2STW A;  3HSE A;  3KP6 A;  4UUT A;  1STZ A;  1ETK A;  3D0S A;  3ESW B;  4BHP A;  1O4X A;  3ASN H;  1R49 A;  2X85 A;  5IOY A;  1FOX A;  5HLI A;  2ISZ A;  2UXX A;  1CF7 B;  1IRG A;  1GVJ A;  4WF2 A;  2BBY A;  4XKV A;  3MEX A;  3K1P A;  2RVC A;  2VE8 A;  1J7K A;  4Y33 A;  5FRN A;  5EG0 A;  4A0Z A;  1CQT A;  1XB4 A;  2M0C A;  2ADU A;  3RIR A;  4DNC A;  4ENM A;  3MZH A;  2IGM A;  1FC3 A;  3Q0W A;  1E0E A;  1BOA A;  1A04 A;  2CFO A;  3DP7 A;  1L3L A;  3HM5 A;  2PMZ A;  4M71 A;  2R5Y A;  1Q1H A;  4G6T B;  5GPA A;  3PSF A;  2LSO A;  3DEU A;  1U2W A;  1BIB A;  2G9W A;  3I0T A;  2WAQ A;  5LGU A;  2IXS A;  1Z3Y A;  2FD5 A;  3FWE A;  4U88 A;  4BU2 A;  3LA2 A;  4GXO A;  2R7V A;  1AA7 A;  1FOW A;  4U7B A;  4Y52 J;  3MMY B;  1WHU A;  3BTC A;  3GVA A;  2R7T A;  2H1K A;  4UV9 A;  1LPQ A;  3FHN A;  3IWZ A;  4BQN A;  1QVU A;  2EPF A;  2M87 A;  3E5Q A;  3GZ6 A;  2GM4 A;  1FOK A;  1NK3 P;  2JA8 J;  4FX4 A;  1PJR A;  2Y0M A;  3HG9 A;  3B73 A;  4BXX J;  2PMZ N;  2LP0 A;  1RKW A;  3T8T A;  4JBA A;  2V1N A;  1HKS A;  2LMD A;  3S3N A;  2B63 J;  5F27 A;  1VI0 A;  3S8P A;  5IYD J;  1F4K A;  3DF8 A;  5M3F J;  2W24 A;  4BL0 B;  4LG0 B;  4EJW A;  6PAX A;  1KA8 A;  5FLM J;  1R4M B;  4P9U A;  2Z5U A;  2QQA A;  2WWY A;  2DA6 A;  2HI3 A;  5BOX A;  5GAE J;  2QKM B;  2LNB A;  2KQR A;  3DKX A;  3G1M A;  3LAJ A;  4LLN A;  1L0O C;  2MYS A;  1S72 I;  4IEJ A;  4LD5 A;  5CVV A;  2DMT A;  4CCO A;  3GTK J;  3IH4 A;  1LUJ B;  1QZE A;  1IW7 F;  5IPA A;  1AHD P;  4YEJ A;  2IEK A;  3F22 A;  3M8F A;  2R7W A;  2CG4 A;  4L5I A;  4H0E A;  2XGC A;  1CGP A;  5CVU A;  2VKE A;  4RBO A;  2RV8 A;  3K69 A;  4JOM A;  2HYG D;  4KMU X;  4Y4R A;  2YX7 A;  2CFX A;  1JE8 A;  3V7C A;  4HZF A;  2LD5 A;  2MC4 A;  2WB1 N;  3I3L A;  1IUY A;  3HTS B;  2LY2 A;  2XB5 A;  1RKT A;  2L9R A;  1I27 A;  3ZQL A;  1WJB A;  2LF7 A;  1SFU A;  2O5R A;  4FIS A;  3NAR A;  4KT5 C;  4HLY A;  4ZJZ A;  1BI0 A;  5B1A H;  3GTQ J;  3LL7 A;  4PSX A;  3CLQ A;  1W7P D;  4EGZ A;  2Y0S A;  3E6D A;  4XID A;  1LFP A;  2EJR A;  2JSC A;  1J9I A;  5A2Q Z;  4N9H A;  3G3Z A;  2CW0 F;  4KN7 X;  3CO7 C;  1K78 B;  4BHB A;  5HLH A;  3EQL F;  5K5Q A;  2DA3 A;  2VBX A;  3GFI A;  1FT9 A;  3PL8 A;  2O3F A;  3WGG A;  1RRJ A;  2UWM A;  3UKG A;  3KYC B;  1UAA A;  4M3B A;  1X4P A;  4Z2Y A;  3CCJ I;  2GIV A;  2AXL A;  2BGC A;  2ISY A;  4PK4 A;  4XLF A;  4ON0 A;  2X1D A;  4AYB N;  1FBU A;  5F64 A;  2R5Z A;  1IN8 A;  4XNF A;  1WI3 A;  2CW7 A;  4A3L J;  3H3Z A;  1OQY A;  2LC2 A;  4OWR B;  4WCG A;  2COM A;  2E19 A;  1FEX A;  4NQW B;  3WGH A;  2P81 A;  5E3M A;  2ACJ A;  1IG7 A;  5F04 A;  2L5Q A;  4UB6 C;  2OQG A;  4A2U A;  1WJD A;  2QQB A;  4B3A A;  2IP2 A;  3PNV A;  2M2E A;  2VPR A;  3B6A A;  1B8I A;  2R7R A;  3F8B A;  2DOE A;  2FBH A;  2JUC A;  1W5S A;  4BJT A;  1QQI A;  3BCB A;  3PIO F;  2F6C A;  3RQI A;  3IHU A;  4RAG A;  1XSX A;  2KFD A;  1FSE A;  2FQ3 A;  3M4O J;  3GF2 A;  5TJJ A;  1BL0 A;  1X3W B;  4QPQ A;  4AIJ A;  3M7G A;  5IP9 J;  4Y3O A;  1Y1V J;  2XRO A;  2R7X A;  2A05 A;  2FQ4 A;  1T38 A;  1EA3 A;  4S04 A;  4JP0 A;  3OWT A;  3HPH A;  3KEO A;  1B1B A;  3HXL A;  1ITY A;  3GUD A;  4HOB A;  3CCL I;  4RGR A;  1QHH D;  1U0J A;  2A3S A;  5FFZ A;  3DKY A;  2O6G E;  3I55 I;  2JPC A;  1BJA A;  2TCT A;  1B6A A;  3JAM Z;  2QZ8 A;  1IO2 A;  4XLH A;  3PNT A;  1E3H A;  2QWW A;  1TQP A;  3TOB A;  1XS9 A;  3C1D A;  2EBI A;  1LE8 B;  5D8K B;  1ETO A;  4FE4 A;  2IGN A;  1Z1D A;  1MBJ A;  2STT A;  1MNE A;  3NRV A;  4MGR A;  1LDJ A;  1HST A;  3LSR A;  3FX3 A;  2LKS A;  1FTT A;  1I50 J;  3DBH B;  3LA7 A;  1GV5 A;  4BAY A;  1ORK A;  4LIV A;  3A2K A;  1RNL A;  4HF2 A;  2JK3 A;  1A36 A;  5D6E A;  3S3M A;  2DDB A;  2V9K A;  4YFX F;  2QSG X;  4XKB A;  2MD0 A;  1TBX A;  4DYQ A;  1WH7 A;  2Z1D A;  2PX9 A;  2VT2 A;  3NEU A;  4B1R A;  4KIF A;  3FXQ A;  1Z9C A;  2CUZ A;  2B7E A;  5K7Z A;  3JRE A;  3T1B A;  2FRH A;  5B66 C;  3QOD A;  1TW2 A;  3JCU C;  2ZKZ A;  3KEQ A;  1O3Q A;  5EGO B;  1BR4 A;  1LEA A;  4WXD A;  4IQJ A;  2E1M C;  2RRE A;  3QPT A;  4YG2 F;  3V7R A;  1I6H J;  1UJ8 A;  4A3F J;  1TQI A;  1H8A C;  4RGU A;  2HZD A;  2ZNY A;  3HGY A;  2VB6 A;  3EPZ A;  4HX7 A;  4MLO A;  4BH9 A;  3HGG A;  3W2W A;  2QVO A;  2L7M P;  2XAF A;  3RPU A;  4IHT A;  2H09 A;  4HYE A;  5BNG A;  2GOM A;  2B0L A;  2KJB A;  3FIS A;  4U87 A;  2R93 J;  4HDU A;  1KON A;  3S3O A;  1C0W A;  3DU5 A;  2VKD A;  1R00 A;  5DV5 A;  5D5W B;  3CCU I;  2CUE A;  5LEK A;  4M9X A;  2Z99 A;  4KA4 A;  2F5F A;  1H0M A;  1HDP A;  2YUS A;  5CJ9 A;  1A6I A;  1H9G A;  1S9H A;  2Y69 H;  2CMP A;  2CQ7 A;  3JSO A;  1SAU A;  3BG3 A;  3REO A;  2GZW A;  2QGU A;  4EMS A;  2VXZ A;  4CZZ A;  3BC8 A;  2HDC A;  2KP6 A;  1A35 A;  4D5C A;  5J4V A;  1FY7 A;  3C3W A;  3PSI A;  3CCS I;  4LJZ F;  3HDD A;  4AU7 A;  3OYH A;  1G8X A;  4G6D A;  3TO6 A;  4QIW N;  3F23 A;  4I0B A;  1LJ9 A;  5L3D A;  2EA4 A;  2MW8 A;  2ZJR F;  5GTH C;  1FJL A;  2CQX A;  1XC5 A;  1HW2 A;  1VQL I;  4KYW A;  2R7F A;  3ZMD A;  1WJ5 A;  3MQ0 A;  2FOK A;  1I39 A;  3UNG C;  4XSX F;  2BV6 A;  2WTE A;  3GLL A;  1YE9 A;  3GZ5 A;  1ZG1 A;  2JZY A;  2DN0 A;  1MSF C;  5FRO A;  3WTY C;  3E97 A;  3RPQ A;  1BBY A;  5E8I A;  3DLL F;  4PJM A;  1TWF J;  1BW6 A;  1R5G A;  4HQM A;  5CVJ A;  1V5G A;  2AQE A;  3WU2 C;  2K85 A;  1SEU A;  5E1Z B;  2HU9 A;  3MFK A;  1QU3 A;  2PJP A;  3TO9 A;  1I1S A;  2D1V A;  3F21 A;  2NOG A;  3WOD F;  2HOE A;  3H35 A;  3O3K A;  4R8H A;  4KIB A;  4LK0 F;  1JT6 A;  3BT9 A;  3ELK A;  3B6C A;  1VZ0 A;  3I4P A;  3LA3 A;  2E1N A;  2BXZ A;  1ZRC A;  3VYS B;  3WTZ A;  4BNC A;  4I7H A;  3F3X A;  5F1J A;  5AON A;  4KIG A;  4KIC A;  1IN7 A;  4M74 A;  1HW5 A;  1GT0 C;  3CC7 I;  3JSP A;  2ZJ2 A;  4LK1 F;  2PBI A;  2LFB A;  1W7P B;  2WAD A;  3VB2 A;  2OD5 A;  2M5W A;  3CJN A;  4D1Q A;  2LY1 A;  3SEQ A;  3FM5 A;  1HKQ A;  2VJJ A;  2DPD A;  2DK5 A;  3OIP A;  4IHW A;  2EZK A;  3OYJ A;  2DA5 A;  1VQM I;  5E1W A;  3K70 D;  1MBK A;  3KP4 A;  2P7C B;  5HLT A;  3U1D A;  3BLY A;  1ODD A;  3JRA A;  2NRA C;  2LY9 A;  4D9J A;  2E35 A;  4ZTF A;  3FMR A;  5FKO A;  2Y2Z A;  4ENN A;  2E2H J;  5D8L B;  3R6S A;  4QLC U;  2E71 A;  5FD5 A;  2PG4 A;  2JA6 J;  2K9Q A;  2NVU B;  3H9J A;  1ZQ3 P;  1RUO A;  1MBE A;  2XKO A;  1Y8Q B;  2KRC A;  2OAZ A;  3K0L A;  1TT0 A;  1DDN A;  1LDK B;  4PGG A;  5DS9 A;  4IOC F;  2O9L A;  2ESN A;  4A3M J;  2IS6 A;  1TTY A;  1SVO A;  1LFB A;  1WJF A;  2Y48 A;  4M6Y A;  3ZN0 A;  2X0L A;  4D5F A;  1TWC J;  1Y1W J;  2DFF A;  2XF7 A;  4A0X A;  4CYC B;  3O8H A;  2PQ8 A;  3G1L A;  3LSM A;  5L3G A;  2XSJ C;  4HV6 A;  2NYX A;  3GX4 X;  4BAC A;  2XPV A;  2D1H A;  3NWS A;  1Y6I A;  2VC0 A;  1FNN A;  1SMY F;  1JGS A;  3ZOB A;  5IP7 J;  4F93 B;  3DPL C;  3KIO A;  4C2U A;  1SC7 A;  4ZDO A;  2C6Y A;  2QEN A;  2DQR A;  1X1B A;  3A1Y A;  2R0Q C;  3HOU J;  1FOY A;  1E2X A;  1U8R A;  2XGX A;  3LSG A;  4PJN A;  1G4D A;  4LMY A;  2HXI A;  5M5Y J;  4EQQ A;  2MGQ A;  3R0J A;  4W1U A;  1AKH A;  2KRH A;  3HRU A;  5J8C A;  2HKO A;  5DCM B;  4EVI A;  2NS7 A;  4P96 A;  2CYY A;  3CCY A;  2BY0 A;  3AL0 B;  2V6E A;  2A5W A;  4KNY A;  1WPK A;  4CCL A;  2HVR A;  3CES A;  1B4A A;  3BQY A;  2V79 A;  5FJ8 J;  3J80 Z;  4C3I J;  1GXQ A;  2QCO A;  4KFC A;  1FMW A;  1VQN I;  3JRD A;  1H9T A;  4ZYH A;  1FP2 A;  1MMA A;  2FX0 A;  3CO6 C;  4LG0 A;  2ME6 A;  4DGW B;  3DU6 A;  1IJW C;  4IRI A;  5K7H A;  2D45 A;  1AWC A;  2LRD A;  2IS1 A;  3CDI A;  3MZ8 A;  5KNL A;  4M3F A;  4RAF A;  5J1R A;  4HA8 A;  3SHF A;  3LSK A;  3W2V A;  2ZJP F;  3C2G A;  4XR6 A;  2F4M B;  2CW8 A;  3K7A J;  5FO5 A;  3JRH A;  3QAH A;  1ZG5 A;  3K1M A;  3D5S C;  3QYB A;  4CYD A;  1YIT I;  3ZQF A;  1YOV B;  2YS9 A;  1K79 A;  1P9Q C;  1HLV A;  1A6Q A;  4JX6 A;  1IXC A;  2RNG A;  4KJZ A;  3S14 J;  3M8J A;  2XAQ A;  1ACI A;  4E7H A;  1P7I A;  2B9S A;  2VE9 A;  2GLO A;  1BR1 A;  4TV7 A;  2P5V A;  3CMA I;  4NC7 A;  2XDV A;  5BS6 A;  2DOD A;  4I09 A;  4YEL A;  1NH3 A;  1GXP A;  2Z33 A;  4BE2 A;  5CQE A;  3A4C A;  4D0P A;  3I59 B;  2H6B A;  5DUI A;  1ETV A;  3EYY A;  1LVK A;  2HQA A;  2KIU A;  3HHH A;  3J7Y J;  3J7A O;  1BOB A;  5LGT A;  1U5T A;  2M7B A;  1I6X A;  5D4R A;  1IAW A;  5C44 J;  2DCE A;  4LGW A;  2BY3 A;  2MSY A;  4WX9 A;  2YU9 J;  1MMN A;  2WC2 A;  1IGN A;  1X1A A;  4KN4 X;  1D1B A;  2L9V A;  2FOW A;  4PZJ A;  5E3N A;  1W4M A;  3BG6 A;  1P92 A;  3HOV J;  2A68 F;  2CQK A;  1K78 A;  1MMS A;  1P7J A;  1VQK I;  2EQR A;  4LLL A;  4X0G A;  1GHC A;  4XLC A;  1TNT A;  3HEF A;  4ZDL A;  5IYC J;  2X1C A;  2Y31 A;  3SZT A;  3DPT A;  4EV0 A;  2LLK A;  1V55 H;  2L54 A;  3FMS A;  4GDF A;  2DA4 A;  3GXO A;  2F4I A;  4P1W A;  3P9C A;  2W7N A;  2WY8 Q;  3BPX A;  4BJ6 C;  1B9M A;  2OUM A;  3HPG A;  4NNJ A;  2A07 F;  2YPR A;  1ENH A;  1ZG3 A;  3F8F A;  3PJR A;  2GXB A;  3U1K A;  2HQ5 A;  3K10 A;  5EJC A;  3L1P A;  4LIT A;  3LNQ A;  4A3G J;  1JUM A;  3QPL A;  3ZGK A;  1W36 D;  1JI8 A;  1U5T C;  1X1D A;  3HYI A;  5LGN A;  1YS7 A;  3RYR A;  5C4X J;  1WSU A;  1MKM A;  2KIM A;  1EH6 A;  1HW1 A;  4NQW A;  1OCP A;  3S2D J;  2VOD A;  1UHW A;  1ETX A;  4ANJ A;  4OIN F;  1ZGJ A;  2DXI A;  1EH7 A;  2DLL A;  3CC2 I;  4PJ0 C;  1K6Y A;  1IDY A;  3CCR I;  4PJJ A;  4H4K C;  3C2B A;  2OF7 A;  2IBD A;  4A5N A;  4EJU A;  3S1R J;  2CUF A;  3MVP A;  1R71 A;  3K9T A;  4DW6 A;  1G3W A;  4V2F A;  2FF4 A;  1JGG A;  5FLX K;  4L5J A;  1D5Y A;  3S1Q J;  2ZSI B;  1GUU A;  3ZQI A;  3OSF A;  4I6Z A;  3ABK H;  2HKX A;  2RN7 A;  4BBS J;  4BY7 J;  3OOP A;  2K86 A;  1Y56 A;  2HYJ A;  3OYK A;  4RB1 A;  1Z77 A;  3OL4 A;  3WG9 A;  3I53 A;  5JLX A;  3K2A A;  3LSH A;  1JJ8 C;  2WY7 Q;  2CRG A;  5FFX A;  1VF9 A;  2EIM H;  4G12 A;  4NC6 A;  1QO0 D;  2V26 A;  2FSW A;  4C2M J;  2IA1 A;  3X2Q H;  1TL8 A;  2M4K A;  1KGS A;  4MIM A;  3HJE A;  1LE8 A;  4FX0 A;  2JA2 A;  3SQN A;  1J2X A;  2P8T A;  3OIQ A;  1J59 A;  3K6G A;  2DOF A;  5CVI A;  1YJ9 I;  2QEX I;  5IT9 Z;  4DZJ A;  3JRB A;  3WU1 B;  1ZH5 A;  1WH5 A;  1X2M A;  3E5U A;  5F08 A;  3TKY A;  3ZQ7 A;  2LYC A;  2GOX B;  5GPC A;  3HKZ A;  2VKH A;  4PGH A;  3A02 A;  1Y8R B;  1SFX A;  1P4A A;  2FML A;  3L7W A;  3KP2 A;  2BEO A;  1IDZ A;  3QU3 A;  1FYK A;  1JHH A;  2DTZ A;  5E17 F;  4I0A A;  1O7L A;  4L0Z B;  2COB A;  1JT0 A;  4HX4 A;  4XOP A;  2CV0 A;  3FXJ A;  2HPI A;  5D4S A;  4BGD A;  2OTJ I;  4XLN F;  2WB1 A;  2N8G A;  5J6X A;  3TW7 A;  5EGO A;  3OYD A;  3N4M A;  4K2E A;  2ZCW A;  4M73 A;  2ZXI A;  2PJR B;  1U3E M;  3JRI A;  2GXG A;  2Q2E B;  2W84 A;  4I76 A;  3HKZ N;  4M6X A;  3TQN A;  4MEX F;  2K3F A;  3MKL A;  1VND A;  2CU7 A;  2E60 A;  3GTJ J;  2QA4 I;  4RLQ A;  2L2O A;  2A69 F;  2OU2 A;  3K1N A;  4A3E J;  3C2H A;  1MDM B;  2FNP A;  3SZG A;  2QBY B;  1RES A;  1PDN C;  1KU2 A;  1A5J A;  3W6V A;  3BJA A;  4EM2 A;  3K4J A;  2KRF A;  1VTN C;  2WV0 A;  5ERI A;  2XB0 X;  3K4K A;  1BIA A;  1XDS A;  3HRS A;  2KDO A;  1T0F A;  3H0D A;  3VEP A;  5KAI C;  1MBH A;  1FIA A;  1KQ9 A;  1FTZ A;  1R23 A;  1BC8 C;  3KLO A;  1ZRF A;  1WFX A;  5H2F C;  4OAY A;  3KZY A;  4BDZ A;  2XV4 S;  3OYM A;  4OIR F;  4AYB A;  1S6L A;  3I4M J;  3QQA A;  4D7N A;  2HDW A;  4UNO A;  3DEW A;  3BJO A;  2W82 A;  4UY8 I;  1MZB A;  2AXT C;  5ICF A;  1NG7 A;  1RET A;  4JQF A;  4OMZ A;  2IPQ X;  4CCJ A;  3GO5 A;  3EET A;  4UVC A;  2FXA A;  3IAM 2;  1DGR M;  3HB9 A;  1YLF A;  1VQ4 I;  2BW3 B;  3OL3 A;  4IL6 C;  1WQ2 A;  1QVT A;  4IZZ A;  3HOS A;  4IHV A;  4HG2 A;  1G3Y A;  3MKZ A;  2P6T A;  4HF1 A;  2DBB A;  1YJN I;  3ML6 A;  4CCK A;  2NVX J;  2A5Y B;  2K40 A;  3BCA A;  3GYH X;  2V9P A;  3B02 A;  3DWL E;  4MFE A;  2UXN A;  3O8G A;  5HS9 A;  3ZN1 A;  3BR3 A;  1MNM C;  3F0C A;  1T98 A;  1BI1 A;  2IVM A;  3VDX A;  1YRN B;  1T0F C;  3H5R A;  2EB7 A;  5GTI C;  1LVA A;  1POG A;  3OYL A;  2VC1 A;  1WJE A;  2KJC A;  5KVR A;  1R1U A;  3E3V A;  5DCF A;  3MKY B;  2PMH A;  3TED A;  1ZR2 A;  4ASN A;  1W7P A;  3LQQ A;  2BYV E;  3OYA A;  1H89 C;  2RDP A;  2RQP A;  1J0R A;  1OCZ H;  3CJQ B;  3F6O A;  3HTU A;  1T8I A;  4PUS A;  3PO3 J;  3H1C A;  4XLE A;  1I3Q J;  5K5O A;  1KU9 A;  3MKW B;  1Z7U A;  4HNT A;  2L9S A;  2Y9Z A;  1RI7 A;  3QPS A;  3RZD J;  2R4G A;  1MBF A;  4HBL A;  2H1L A;  5HOO A;  1F5T A;  1YW7 A;  3DPU A;  4IPA A;  1JJ6 C;  1REP C;  3ERE D;  4XRM A;  1JHF A;  4F91 B;  2XGD A;  3MWM A;  2HOA A;  2Q8K A;  1ETQ A;  5CYV A;  3FXK A;  4XIC A;  5LRS A;  1DP7 P;  4C3J J;  2VPL A;  3D5R C;  2MC3 A;  1GDT A;  2IRF G;  2IAI A;  5D5X B;  2K9S A;  2J5O A;  2RQQ A;  1XSD A;  1F9N A;  3I5U A;  1N75 A;  3G6E I;  2HVQ A;  3QRF F;  3BPV A;  3PUB A;  2DMN A;  5A2Q K;  3ZMT A;  1SAN A;  1XPX A;  1LB2 A;  2EFN A;  4I98 B;  4G8X A;  4MEY F;  4CYC A;  1BA5 A;  3J81 Z;  2ECB A;  5DDG A;  3RKY A;  4O5V A;  4B48 A;  3FXL A;  2KLO A;  1FMV A;  2AHQ A;  1W5C C;  2Y75 A;  1VQO I;  2FE3 A;  3LWF A;  2JA5 J;  3EUH A;  3R4K A;  3DTI A;  3KET A;  4G7H F;  5EZH A;  2DK8 A;  2VBY A;  1W1W E;  2HPM A;  3KZI C;  2JTV A;  2DO7 A;  3V4G A;  5EYR A;  3CC4 I;  3PO2 J;  3OS0 A;  2JWT A;  2PFB A;  3HOY J;  2VKV A;  1N77 A;  4XBF A;  4CSW A;  5ICC A;  3BRO A;  2W85 A;  2RAE A;  4XRS A;  4MTE A;  1Z6T A;  2WAF A;  2HYF A;  2EWN A;  2L01 A;  2H8R A;  1P6R A;  4ESB A;  1YI2 I;  1WVR A;  3RTR A;  2K9M A;  1D5V A;  1WZ2 A;  3L09 A;  3LSJ A;  1O3R A;  2L7F P;  3PNY A;  1UCR A;  5HS8 A;  3W3C A;  4RDU A;  3BZC A;  5BPD A;  3U21 A;  3QWL A;  3FK7 A;  3Q0V A;  2D2W A;  2V6C A;  1MMG A;  4HSR A;  5HDN A;  1QBJ A;  4IOA F;  3CZ6 A;  4CUG A;  4IKF A;  1LQ1 A;  4YRV A;  4UUS B;  3RSN A;  3I54 A;  1OPC A;  3VOE A;  2X6O A;  4P55 A;  4HX8 A;  1P4X A;  1TQM A;  3P9K A;  2ZC2 A;  4HF0 A;  4QSH A;  2DJN A;  1P2F A;  3H3U A;  4FE7 A;  2YX4 A;  5JI6 A;  3HL2 A;  2EZL A;  2X6Y A;  3ZRG A;  1RIO H;  3DEE A;  3FBI B;  4BKX A;  4HNU A;  4NC8 A;  2FA5 A;  2K9L A;  2OCE A;  1NK2 P;  3ECH A;  3F8N A;  5C4J J;  3CCQ I;  2M34 A;  2L0K A;  3I4N J;  1IC8 A;  4ZYE A;  2ZO4 A;  1D8K A;  3JAM K;  3HRT A;  2HGC A;  2QYO A;  3WTX C;  4HST A;  3AL0 C;  2E5Z A;  1G6N A;  2IS4 A;  3E5X A;  1ZLJ A;  2HZT A;  1M1E B;  1WI9 A;  2TDX A;  5FLV A;  4E7L A;  1KQ0 A;  3DQV C;  3CUO A;  1K83 J;  4GCV A;  4WK8 F;  2P5K A;  1IUF A;  2DMQ A;  1BR2 A;  3T5X A;  3EUK L;  3VSK A;  2JN6 A;  2E36 A;  3HOW J;  5LHG A;  4G7O F;  3QYE A;  2LF8 A;  4BQQ A;  3ZQC A;  2FJ1 A;  2P7V B;  3IH3 A;  2DJI A;  1OMI A;  2MH2 A;  4UVB A;  2P6S A;  2PEX A;  4RB0 A;  4XL9 A;  1PUF B;  2MAB A;  1BN5 A;  1T33 A;  1B72 A;  3BZ6 A;  2QQ8 A;  5F6F A;  2W25 A;  3ZP5 A;  2JMW A;  5B1B H;  4J19 A;  1R22 A;  4M72 A;  2CV2 A;  1UST A;  2OCC H;  1D8J A;  2GAU A;  2HQR A;  3I56 I;  1LEB A;  3U9G A;  1HOM A;  4LFU A;  3JRF A;  1LNW A;  4A93 J;  3BDD A;  4FT8 A;  3QPH A;  3HZJ A;  1DUX C;  2O8X A;  2BHY A;  1EH8 A;  2NVQ J;  4OIP F;  2IGO A;  2M8E A;  4V2G A;  5KK1 A;  1G2H A;  3SZP A;  1ZTR A;  3KYL A;  4E7S A;  2K4B A;  1EF4 A;  4GYG A;  1XGS A;  3GTL J;  3ZR8 X;  3ZPL A;  1XX5 A;  5GAH J;  4ITV A;  2BVL A;  3E6M A;  4KT6 A;  3DKW A;  4PFP A;  2R7D A;  2NAZ A;  1S29 A;  4FHT A;  3BJ6 A;  3H9G A;  2DTR A;  2E7X A;  3P9I A;  2DMU A;  3ROU A;  5FGM A;  4JX5 A;  1JKP C;  1MBG A;  2M9H A;  2DFI A;  4EJT A;  3I71 A;  4KDP A;  2ECC A;  3OYI A;  1UB9 A;  4PSW A;  4GGG A;  4E4H A;  2VI6 A;  1RR7 A;  2F5V A;  2X4H A;  4UXN A;  3OYG A;  2L7Z A;  3CME I;  1CF7 A;  3W2A A;  5C3E J;  4AIK A;  4EGY A;  4AWX B;  4ZZL A;  1RZ4 A;  4GRI A;  1SD6 A;  5E3L A;  1TT5 B;  3MN2 A;  2OQR A;  2I5U A;  3BR2 A;  4A3B J;  4M9Z A;  3TMO A;  2V1U A;  1XMK A;  2CSO A;  2E7W A;  3G1O A;  4KIT B;  5DTD A;  3MAJ A;  1DU0 A;  2JT1 A;  2QUF A;  4FTH A;  1AOY A;  5KCM A;  3SDB A;  4CGZ A;  5L3F A;  1JUP A;  3W6J B;  4AVP A;  3CUQ B;  2YSR A;  3RYP A;  3GME A;  4XRF A;  3RJP A;  2A6H F;  1XMX A;  3GBG A;  4QWQ A;  4UV8 A;  5CVR A;  1UHS A;  2IA2 A;  1ETY A;  3JR9 A;  1ERD A;  5BQT A;  1JXS A;  2IA0 A;  3LAP A;  3S32 A;  3QOP A;  3GFL A;  5D6F A;  5F0C A;  4BY1 J;  3KCC A;  2KZG A;  2XAS A;  4XN3 A;  3ABU A;  3QP6 A;  4IHS A;  2K9N A;  3ULQ B;  1BW5 A;  3FXU A;  2EFP A;  5H20 A;  1MND A;  1QHG A;  1YW8 A;  3OR1 C;  4XSZ F;  2ZBK A;  1PUE E;  2F2E A;  4L5E A;  3U2R A;  1T6S A;  2CJJ A;  3SYT A;  3OYF A;  1U78 A;  3QU6 A;  5J1U A;  2A6T A;  3R61 A;  1FBS A;  2DQL A;  4MO7 A;  5CPR B;  2OV7 A;  2XPW A;  2QSF X;  2HEO A;  2LH9 A;  2MLK A;  1QZZ A;  2ID6 A;  1ZGW A;  2FNA A;  2XKP A;  3VYU B;  5KHD A;  4HPQ A;  3A0B C;  5J47 A;  3E6B A;  3ZQG A;  2FMY A;  3T8R A;  1IZ1 A;  2KPM A;  3RKQ A;  4EM0 B;  3DTE A;  4FCY A;  4DIQ A;  3ZMV A;  3CJR B;  5FB2 A;  5K7F A;  2PN6 A;  1VQ7 I;  3K70 C;  3HOZ J;  2VIX A;  2JPB A;  1FYM A;  4XOR A;  3MD2 A;  1D1C A;  4CXF A;  2F5C A;  5LFA A;  1T56 A;  4LOC A;  1MDM A;  1FX7 A;  2QBY A;  1UG2 A;  1Z67 A;  2NNY A;  2Y30 A;  4ENK A;  1BM9 A;  2E1O A;  1YQA A;  4IHX A;  1NHA A;  3IAS 2;  2VLA A;  1OYI A;  1OJL A;  3BWG A;  1WCM J;  3IRR A;  1YX5 A;  2HWV A;  2KIF A;  2XAU A;  3VPR A;  3OR2 C;  4F92 B;  2K5C A;  2XC7 A;  2P5L C;  1K4T A;  1N25 A;  2ZME B;  3SFI A;  3A01 B;  3L2U A;  2KIS A;  3BTI A;  3BQZ A;  4I99 C;  1OKR A;  1V5F A;  1F43 A;  1Z21 A;  1HCR A;  3BR0 A;  5K5R A;  3H3V K;  5J1Y A;  2HDD A;  1VQ6 I;  3M1C A;  4ENJ A;  4ZTJ A;  5HDK A;  1TWA J;  1N78 A;  1V54 H;  2X6W A;  3V8L A;  1WRJ A;  4N9I A;  4ZC3 A;  1MGT A;  4XK4 A;  2CV1 A;  4HLX A;  5J8F A;  1Z6R A;  3PQJ A;  5LRR A;  4EJV A;  4BDY A;  2L02 A;  4FET A;  1VQ9 I;  1I1G A;  1U9N A;  4MTD A;  3PUF A;  3CCM I;  1JTX A;  1WJA A;  2CQN A;  2Z9O A;  2HOT A;  5FD6 A;  3J7Z I;  1BC7 C;  3FHZ A;  2EV0 A;  2DI3 A;  4R79 A;  1XGM A;  3J80 K;  3AKZ A;  2OC6 A;  3SXY A;  4CHU A;  2A6E F;  2HTJ A;  2X9D A;  3ABL H;  4Q47 A;  1IV6 A;  3KP5 A;  4OAZ A;  2NS0 A;  3AFH A;  4RM2 A;  3DCF A;  1YRN A;  1NG6 A;  3FIW A;  2I10 A;  2DFH A;  4L9N A;  4E7K A;  1T95 A;  2H8W A;  3L2V A;  2XGE A;  4FAS D;  3IKT A;  1XCV A;  4MHG A;  1K4S A;  3COA C;  2XF6 A;  3GW2 A;  1K61 A;  3HHG A;  3OSG A;  2EZI A;  2CGP A;  4BJ5 C;  2BY2 A;  3ZQQ A;  4G9Y A;  2VUM J;  4UB8 C;  9ANT A;  2E1C A;  1KYZ A;  3PM1 A;  4MFD A;  1RPW A;  4NDL A;  1SD5 A;  1F1Z A;  1R9T J;  4ZDP A;  2LRE A;  3IH2 A;  1TZL A;  3WTV C;  5JVG F;  1R1V A;  2ESH A;  3ZMU A;  3AG1 H;  1IXS B;  4N4O B;  2LBF B;  4RB3 C;  3GFM A;  5JVT A;  2HOS A;  2VQC A;  4ZH4 F;  2FBK A;  2HVS A;  3I58 A;  3QP5 A;  4NHJ A;  5JHU A;  3CJT B;  3TBI A;  2EH3 A;  1GLN A;  4BEH B;  2H27 A;  4MQ9 F;  2EFW A;  4ESF A;  5TGT A;  1YIO A;  1Z7L A;  2LKX A;  4JYK A;  3I64 A;  2JVG A;  3OIO A;  2EFQ A;  4G6Q A;  4OOI A;  4P9F A;  1X4O A;  3K4C A;  1FBQ A;  1IN5 A;  2DA2 A;  1D0Y A;  2R7O A;  2CO5 A;  3PQK A;  1ONV A;  3GWZ A;  2IW5 A;  4L18 B;  3H92 A;  3LOC A;  5E3O A;  3JTG A;  1VQ8 I;  1X2N A;  2EIL H;  1IV8 A;  1W5T A;  2DA7 A;  2W4S A;  4AID A;  4D7M A;  2K27 A;  2M30 A;  3RI4 A;  4RAY A;  4DOZ A;  1EJ9 A;  2V1D A;  4KUM A;  3WE2 A;  4GYI A;  2EZH A;  2LR8 A;  1SD7 A;  4G7Z F;  1FWZ A;  1MH4 A;  2CH0 A;  4WWC A;  2V1X A;  3TDZ C;  4Q5S F;  1YS6 A;  4B3X A;  2ELJ A;  1OYW A;  2ZXJ A;  3CD6 I;  2G7H A;  4BUP A;  2DMP A;  1O3T A;  1YG2 A;  3TO7 A;  4F7Z A;  3CF2 A;  3LFK A;  4Y7N J;  3V8J A;  2OJE D;  4AVZ A;  2HTS A;  2VAS A;  3DFG A;  3OS2 A;  2XAH A;  4CCN A;  2O0Y A;  1HXD A;  4EEF G;  5M5W J;  2DA1 A;  1R6R A;  4XOT A;  2BZT A;  1XG1 A;  1AKH B;  2MBF A;  1WGX A;  5HOD A;  1UMQ A;  2VQL A;  3HRM A;  4CA0 A;  2X48 A;  2L7K A;  4IJA A;  1PYV A;  1WJC A;  1ZEL A;  1X58 A;  1XTA A;  4A3C J;  1Z91 A;  3L2R A;  4F55 A;  1W36 C;  1XMA A;  3FBN B;  4A0Y A;  3W6K B;  3FM3 A;  2M1B A;  5J3L A;  3KFW X;  2WAQ N;  5LHH A;  2V9V A;  4UUS A;  4A3D J;  4O3M A;  1X1C A;  3OS1 A;  3NAU A;  2HFH A;  3Q0U A;  5HDG A;  2HXO A;  2KDZ A;  2DOA A;  1DP3 A;  5AIQ A;  2VJ4 A;  2YR2 A;  3KE2 A;  5ILS A;  1ZLK A;  1TWH J;  3IC7 A;  2BVM A;  2NS8 A;  5JHF A;  4EJO A;  2GBY A;  3OYC A;  2ZXW H;  3F8C A;  1BI3 A;  2M8G X;  3AAF A;  1SMT A;  2IJL A;  3DTK A;  1FLI A;  1ZRE A;  3S17 J;  1U6G A;  2NXN B;  5E8G A;  1R7J A;  2M4G A;  1LDD A;  4C9Y A;  3VYR B;  3V42 A;  4ETS A;  3HUG B;  5GAG J;  5H6Q A;  4RM3 A;  3E0J B;  4Q4Z F;  1B9N A;  2MFZ A;  2VQG A;  3EUA A;  2CS3 A;  4RLF A;  2DYS H;  2JVH A;  2CWE A;  1FP1 D;  5AIP A;  3Q9V A;  3H5A A;  2W00 A;  3M8E A;  2KMU A;  2E34 A;  3BR5 A;  1YW9 A;  1IF1 A;  1U8B A;  4A3K J;  4A12 A;  2JRT A;  5JFR A;  2OPT A;  3S1M J;  3IKV A;  1ON2 A;  4XKC A;  4XM3 A;  5L3E A;  2EV6 A;  1E3O C;  3NQO A;  5EEH A;  1U5T B;  4E7I A;  5IT9 K;  4YII A;  1OFC X;  2ICW G;  3K4L A;  4CCM A;  4U0Y A;  1VQP I;  3P5J A;  3ONQ A;  3N97 A;  2UV1 A;  3OOU A;  3JW4 A;  2VT3 A;  3PFI A;  5ICG A;  3FXO A;  1O7F A;  3DV8 A;  2BOL A;  2GWR A;  5B5E C;  2Y9Y A;  2QM3 A;  4IVN A;  4IRG A;  2TRT A;  5DEQ A;  3FXM A;  1PUF A;  4OU0 A;  2L9N A;  3L9F A;  5IY5 H;  3BY6 A;  4A6E A;  3OV8 A;  4S05 A;  1Y39 A;  3CDH A;  1DPR A;  1YJW I;  2DDA A;  2RGV A;  4B47 A;  3WE3 A;  2DFE A;  4RAZ A;  3E7L A;  3IP4 B;  2D5V A;  4L9J A;  2EIK H;  2VQH A;  2VN2 A;  2AO9 A;  4Q48 A;  2AS5 F;  5ILV A;  4RGS A;  1D0X A;  3M9A A;  3ABT A;  3KLN A;  3LFU A;  1Y0N A;  4C3H J;  2Y0S N;  1MD0 A;  2I8D A;  1HA8 A;  1SAX A;  4CH7 A;  3GFJ A;  1Z3X A;  3H9Q A;  1J5Y A;  3WU0 A;  4O6J A;  2VOO A;  1O3S A;  2NVY J;  2ZFU A;  2ME0 A;  3WHC A;  5LLQ A;  4OMY A;  3RDI A;  2ZB9 A;  1GV2 A;  1HBX G;  3RZO J;  5JLW A;  4XRS G;  1Y0U A;  3K4B A;  2DT5 A;  1ULY A;  1JUS A;  4ABZ A;  2UUZ A;  3R60 A;  2P0W A;  5L3B A;  5DD4 A;  1JTY A;  1WWX A;  1IRX A;  3TL4 X;  1ZAR A;  1S7A A;  3TGN A;  5M3M J;  3CP2 A;  4I02 A;  4NBQ A;  3ISP A;  3FF5 A;  2KKO A;  3BG9 A;  4J00 A;  4A3I J;  1ZRD A;  3ZMS A;  2LVS A;  2LG4 A;  2VBW A;  4PJL A;  3M1E A;  1IN6 A;  1D0Z A;  2JSP A;  3L00 A;  4ZYD A;  5D5U B;  4CDG A;  1HC8 A;  4RGX A;  1XCB A;  2WAE A;  2XUB A;  3DBR B;  1OYY A;  2GQQ A;  4EAT A;  4B4C A;  1XN7 A;  2QKL B;  1QNT A;  4AUX A;  3G71 I;  3FDY A;  2E2I J;  1MJB A;  1ZYR F;  2E5N A;  4C2T A;  1SD4 A;  1R4N B;  2KIQ A;  3EDP A;  3GZN B;  3V7S A;  3D1N I;  3CLO A;  1MMD A;  3S93 A;  1XDU A;  2M7A A;  2XVC A;  5IOZ A;  5EG0 B;  1YFH A;  2IT0 A;  1ZR4 A;  1TW3 A;  2EFO A;  2A61 A;  5FKN A;  2F5D A;  4PFO A;  1S5L C;  4B8X A;  4DQ2 A;  5DM6 F;  4BYY A;  3CUQ A;  1GVD A;  2MH9 A;  5F1R A;  2EV5 A;  1AU7 A;  4BXF A;  1O57 A;  2LOO A;  3JRC A;  4G94 A;  3S2W A;  1MW7 A;  2R5Y B;  2MLG A;  1TC3 C;  2JJ7 A;  3R0A A;  3VSL A;  1S8N A;  4XKW A;  3DXJ F;  4RMN A;  2M45 A;  2MD5 A;  4M3E A;  2O8K A;  3F72 A;  2L3D A;  3RPU D;  4M6V A;  2XRN A;  5EEG A;  2Q1Z B;  2EA2 A;  4L9T A;  4UUV A;  1QPI A;  2XF5 A;  1B59 A;  1R5H A;  1S7E A;  5DCM A;  1SFK A;  2KL4 A;  3OMY A;  1FPQ A;  3RKX A;  2R7S A;  4J01 A;  2K4J A;  2ID3 A;  1V4R A;  3HIF A;  4XLP F;  3GEZ A;  3KEY A;  3IRQ A;  4XN0 A;  5FKK A;  4YFN F;  1BJZ A;  4Y13 A;  1KQ8 A;  3A0H C;  3FKJ A;  1OIS A;  4U0W A;  4BE0 A;  4ZYA A;  1EV7 A;  3FKI J;  4BQO A;  5LBQ A;  4HRI A;  3BG5 A;  2IS2 A;  2XAG A;  3CUQ C;  3EUH C;  4PCQ A;  1X3Z B;  1UZC A;  4BQA A;  5J40 A;  2UZK A;  3ABM H;  4DYC A;  2VBZ A;  3QYF A;  1HKT A;  4HEA 2;  2L4M A;  4X1E A;  3K2Z A;  4XMY A;  1FIP A;  4IO9 F;  3BR1 A;  2KHM A;  2O03 A;  2ELH A;  4UVA A;  4MQV A;  4CO8 A;  1YTY A;  3KYD B;  2W57 A;  3HC7 A;  2VL8 A;  3KPH A;  1UEL B;  3GCM A;  5HNH A;  3K4M A;  4LG3 A;  3LSI A;  4LB6 B;  1LFU P;  4A5M A;  1BI2 A;  2FUG 2;  5HNF A;  2PI0 A;  5IYB J;  3G4S I;  5CQG A;  3GLX A;  2RKH A;  5CKT A;  2J5P A;  2LK2 A;  3IUO A;  3I59 A;  3H36 A;  4WXH A;  1XSV A;  5JR3 A;  3KP7 A;  4N4N B;  5IT3 A;  2R92 J;  3J81 K;  1ZK8 A;  1QPM A;  1H88 C;  2Z3Y A;  5ED4 A;  2ZME A;  4U7D A;  3A01 A;  3LST A;  1RC9 A;  3IWF A;  3D5L A;  2E2J J;  2G7U A;  4E7Z A;  4HQE A;  1K6O A;  3GTO J;  1FYL A;  3WTW C;  2OA4 A;  4AC0 A;  3E1S A;  3WTT C;  2QQ9 A;  2F48 A;  3E6C C;  3RQ4 A;  2RC4 A;  1QA6 A;  3LQR A;  3WG7 H;  2OBP A;  4WXC A;  3DBL B;  1UHM A;  3F6V A;  4AD9 A;  3SEZ A;  3VFZ A;  2H94 A;  1IN4 A;  2DPU A;  3SDG A;  4DBQ A;  3K4N A;  3L2W A;  2HNH A;  2MG4 A;  2XPU A;  3CTA A;  1I3A A;  4X6A J;  3SFZ A;  4F52 A;  2QF7 A;  5D5V B;  1ZHF A;  4OIO F;  2K3P A;  5HLG A;  3GTP J;  5LEJ A;  1E3P A;  2O61 A;  3S16 J;  5LD2 C;  2W1O A;  1HSJ A;  1HDD C;  2VXD A;  2BY1 A;  4IX7 A;  1K7A A;  1G3T A;  5ILU A;  4R1H A;  2DAO A;  3KX2 A;  2X1E A;  3N05 A;  1KZH A;  3WTS C;  3GTG J;  2GA2 A;  2K7L A;  1D1A A;  2R5Z B;  1XGN A;  4DZP A;  4GFB A;  2ZME C;  1HQC A;  4QTR A;  1SFE A;  2HS5 A;  3G2B A;  2EIJ H;  3JTH A;  3OYE A;  1USS A;  1OCR H;  4UHT A;  3TW6 A;  1D3Y A;  4F3Q A;  1RR8 C;  4B44 A;  5CLS A;  3V8K A;  2EIN H;  2IGK A;  4B43 A;  3KZZ A;  5FKL A;  4AIH A;  4IRH A;  1MJ9 A;  3P7N A;  3TDU C;  1JKQ C;  2QLZ A;  2F4O B;  2R7Z J;  2V7F A;  3HOX J;  2M3A A;  1B8I B;  1Z05 A;  2GA1 A;  2R7Q A;  2HR3 A;  2BE5 F;  2FU4 A;  4IF4 A;  1W0T A;  3QOE A;  4C30 A;  4II2 A;  2Q0O A;  4HAM A;  1VFC A;  5DD8 A;  2ZJQ F;  4CZC A;  2LDU A;  4JK1 X;  1TP4 A;  4Y17 A;  5TIS C;  5ICE A;  1R58 A;  4II3 A;  2LBF A;  5LHI A;  4GO1 A;  3KP3 A;  4HDV A;  3S15 J;  1YX3 A;  3HSF A;  1Z0X A;  3IV5 A;  1ZAO A;  4ZZD A;  5BPI A;  5BMZ A;  1XGO A;  3VWB A;  1MIJ A;  4M9S A;  4YIR X;  3Q3S A;  1G59 A;  3SJM A;  3HBL A;  4NUB A;  4BEH A;  1KU7 A;  1ON1 A;  2XAJ A;  4V19 K;  1J75 A;  1X3U A;  3O2P E;  1APL C;  1IRZ A;  2XSD C;  3Q9S A;  1RUN A;  1U9O A;  1MJA A;  3G73 A;  2LTP A;  2RNJ A;  4RS8 A;  1ZGA A;  3PFY A;  5DM7 F;  4S0H B;  2E1M B;  2ZNZ A;  4ESJ A;  5E1X A;  3BTJ A;  3VYT B;  5F0F A;  1DQU A;  1I5Z A;  2GXA A;  3FK6 A;  1YHQ I;  1JKO C;  2DU9 A;  2YU3 A;  5DYM A;  2VON A;  2BHZ A;  1ZKG A;  2F5E A;  4Z6Y A;  4YIF A;  3CCE I;  1SVM A;  3T0Y A;  3ZQH A;  3OY9 A;  3TP3 A;  4CIC A;  3O6B B;  1OCT C;  2WBM A;  3BOQ A;  2KZV A;  3ZMZ A;  4BHC A;  3PIP F;  4DYR A;  2Z16 A;  3WTU C;  4QPO A;  5L3C A;  4XON A;  5K1Y A;  2O7O A;  1FSH A;  1NTC A;  2ELK A;  1LKX A;  1W0U A;  3H0G J;  4NB5 A;  1Q1V A;  3ERM A;  2H6C A;  2JUG A;  1TNS A;  4LB5 A;  2FBI A;  5GP9 A;  3MCZ A;  3CCV I;  2WA0 A;  3BG7 A;  3RKW A;  3BR6 A;  4N0B A;  1TWG J;  1UFM A;  2JRM A;  2R3S A;  1P4W A;  5M5X J;  2KT0 A;  4HW0 A;  4XQF A;  2AQF A;  1KU3 A;  1HF0 A;  1OLT A;  4KIS A;  2X6X A;  4DBR A;  2PJR A;  3CP8 A;  4LIU A;  3IL2 A;  2Q2E A;  2R7U A;  4E70 A;  1V5E A;  4RA2 A;  3I9V 2;  4M3D A;  1V3F A;  2VJ5 A;  1PP8 F; 
#chains in the Genus database with same CATH homology
 2R4G A;  2NOJ B;  4DOZ A;  5HOO A;  1WJ5 A;  3DPU A;  3UNG C;  4F91 B;  1YE9 A;  2CH0 A;  4B3X A;  2ELJ A;  5FRO A;  4BUP A;  2V4J C;  3CF2 A;  4PJM A;  2VJI A;  2CUJ A;  2VPL A;  4AVZ A;  1V5G A;  2AQE A;  2VAS A;  3D5R C;  2HU9 A;  1QU3 A;  3OS2 A;  4CCN A;  4XLA A;  1R6R A;  4XOT A;  3H35 A;  2Z2S B;  2RQQ A;  3OYB A;  1VZ0 A;  2VQL A;  1N75 A;  3VYS B;  3ZXS A;  4CA0 A;  2HVQ A;  2L7K A;  1PYV A;  1WJC A;  3OYN A;  1ZEL A;  3PUB A;  3L2R A;  4F55 A;  3LMM A;  2M0M A;  1W36 C;  3FBN B;  1X19 A;  2WAD A;  4DJA A;  3L2Q A;  4D1Q A;  2LY1 A;  3SEQ A;  4B48 A;  2KLO A;  1FMV A;  2VJJ A;  1X1C A;  3OIP A;  3OS1 A;  3DLA A;  3OYJ A;  3UR3 C;  2DOA A;  3DTI A;  1DP3 A;  2VJ4 A;  2ZSH B;  5HVQ C;  3K70 D;  2BW3 A;  5HLT A;  3BLY A;  2BVM A;  2HPM A;  4D9J A;  5JHF A;  4ZTF A;  3OYC A;  3OS0 A;  2ZXH A;  3HOT A;  4E7J A;  1N77 A;  1J09 A;  3DTK A;  2DT7 B;  3NWT A;  2M4G A;  4C9Y A;  4CSW A;  3VYR B;  3V42 A;  1OR7 C;  3H9J A;  3HUG B;  4RM3 A;  3E0J B;  2VQG A;  2MFZ A;  3EUA A;  2KRC A;  2CS3 A;  4RLF A;  1TT0 A;  2WAF A;  1LDK B;  2X51 A;  2IS6 A;  4IQ4 A;  2JVH A;  3RTR A;  3F9K A;  1WJF A;  2W00 A;  2K9M A;  2KMU A;  3H5A A;  5FRM A;  4E6K G;  3PNY A;  3W3C A;  1UG0 A;  3U21 A;  4HSR A;  4XKC A;  2XF7 A;  4XM3 A;  1MMG A;  3H5N A;  4BS9 A;  4P5O A;  3CZ6 A;  4CUG A;  4IKF A;  3LSM A;  4YRV A;  4E7I A;  3RSN A;  2XSJ C;  3K4L A;  4BAC A;  4CCM A;  3NWS A;  1Y6I A;  3ONQ A;  2UV1 A;  3RCO A;  3OOU A;  1DGW Y;  4BE1 A;  4F93 B;  3DPL C;  4C2U A;  2DT6 A;  2BOL A;  3J7A Y;  4ZDO A;  3HL2 A;  2X6Y A;  1X1B A;  3ZRG A;  3A1Y A;  3DEE A;  3ZCO A;  3FBI B;  3CMM A;  2L9N A;  3LSG A;  4PJN A;  4HNU A;  4NC8 A;  2K9L A;  2KRH A;  4B47 A;  2X85 A;  3IP4 B;  2VQH A;  3AL0 B;  2V6E A;  2A5W A;  4CCL A;  2HVR A;  1D0X A;  3CES A;  4HST A;  2E5Z A;  3AL0 C;  2IS4 A;  4XKV A;  3LFU A;  2I8D A;  4E7L A;  1HA8 A;  3DQV C;  4Y33 A;  4CH7 A;  5FRN A;  1Z3X A;  3H9Q A;  1FMW A;  2ZFU A;  2IGM A;  1MMA A;  1E0E A;  4DGW B;  1BR2 A;  3DU6 A;  3EUK L;  3K4B A;  3VSK A;  2LRD A;  2IS1 A;  2UUZ A;  2CFO A;  2P0W A;  5KNL A;  3QYE A;  2PMZ A;  4BQQ A;  3TL4 X;  1IRX A;  4G6T B;  3PSF A;  3W2V A;  2DJI A;  3CP2 A;  3LSK A;  3C2G A;  4XR6 A;  2CW8 A;  2WAQ A;  2IXS A;  4XL9 A;  2MAB A;  3D5S C;  3QYB A;  1Z3Y A;  4J00 A;  4BU2 A;  2CV2 A;  1P9Q C;  2R7V A;  2LG4 A;  4PJL A;  1AA7 A;  2RNG A;  4KJZ A;  4U7B A;  1D0Z A;  2JSP A;  3M8J A;  4E7H A;  2WAE A;  3MMY B;  1BR1 A;  4EAT A;  2R7T A;  2QKL B;  4NC7 A;  2XDV A;  3FDY A;  3FHN A;  4YEL A;  4BQN A;  4BE2 A;  2E5N A;  4C2T A;  5CQE A;  3A4C A;  1PJR A;  3HG9 A;  1MMD A;  3S93 A;  1LVK A;  2HQA A;  2M7A A;  2IGO A;  1BOB A;  2V1N A;  2M7B A;  3KYL A;  3S3N A;  3S8P A;  4PFO A;  4E7S A;  4BL0 B;  2DCE A;  3ZR8 X;  4BXF A;  2LOO A;  1MMN A;  4ITV A;  1MW7 A;  2BVL A;  2QKM B;  4KT6 A;  1X1A A;  2KQR A;  1D1B A;  3DKX A;  3VSL A;  4XKW A;  4PFP A;  2MYS A;  4RMN A;  3BG6 A;  3H9G A;  4CCO A;  3RPU D;  4X0G A;  2Q1Z B;  4XLC A;  4ZDL A;  2X1C A;  3OYI A;  2XF5 A;  4PSW A;  4YEJ A;  4E4H A;  3OYG A;  2F5V A;  2R7W A;  3DPT A;  1SFK A;  2KL4 A;  3W2A A;  3OMY A;  2R7S A;  4P1W A;  2F4I A;  4J01 A;  2W7N A;  4JOM A;  2WY8 Q;  4BJ6 C;  4GRI A;  2OUM A;  3KEY A;  4Y4R A;  3HPG A;  4NNJ A;  4XN0 A;  2MC4 A;  3I3L A;  3TMO A;  3PJR A;  2LY2 A;  3FKJ A;  4KIT B;  3K10 A;  4LIT A;  4BE0 A;  5KCM A;  1WJB A;  3SDB A;  3ZGK A;  1W36 D;  2O5R A;  4ZYA A;  1JI8 A;  1X1D A;  4BQO A;  4ZJZ A;  4HRI A;  3LL7 A;  4PSX A;  2IS2 A;  3EUH C;  2Y0S A;  1LFP A;  3GBG A;  2DXI A;  4ANJ A;  3QYF A;  4HEA 2;  4XMY A;  1K6Y A;  1ERD A;  2KHM A;  4PJJ A;  3S32 A;  4H4K C;  3HC7 A;  2VL8 A;  1UEL B;  3PL8 A;  4XN3 A;  5HNH A;  3K4M A;  4LG3 A;  2UWM A;  3LSI A;  5HNF A;  2FUG 2;  1UAA A;  1X4P A;  5CQG A;  2ZSI B;  1MND A;  1QHG A;  5CKT A;  3OR1 C;  3IUO A;  4XLF A;  4PK4 A;  3SYT A;  4N4N B;  3OYF A;  2A6T A;  2X1D A;  5CPR B;  2OV7 A;  1Y56 A;  3OYK A;  4XNF A;  2LH9 A;  3OL4 A;  3LSH A;  2CW7 A;  2WY7 Q;  3D5L A;  2LC2 A;  4OWR B;  3VYU B;  5KHD A;  4E7Z A;  4HPQ A;  2V26 A;  4NQW B;  2KPM A;  3E1S A;  2L5Q A;  3DTE A;  4DIQ A;  3RQ4 A;  2M4K A;  1WJD A;  3CJR B;  3PNV A;  3SEZ A;  2JA2 A;  3K70 C;  3OIQ A;  2R7R A;  2VIX A;  3K6G A;  4DBQ A;  3K4N A;  3MD2 A;  2HNH A;  4XOR A;  3L2W A;  1D1C A;  4BJT A;  3BCB A;  5LFA A;  4F52 A;  2F6C A;  2K3P A;  2LYC A;  4QPQ A;  2GOX B;  2W1O A;  5LD2 C;  2VXD A;  4Y3O A;  3IAS 2;  3HKZ A;  2VLA A;  4IX7 A;  2VKH A;  2R7X A;  1YX5 A;  2XAU A;  1EA3 A;  3KX2 A;  2X1E A;  3N05 A;  3OR2 C;  2K5C A;  4F92 B;  2XC7 A;  3OWT A;  1D1A A;  3HPH A;  3HXL A;  3L2U A;  1QHH D;  1U0J A;  1V5F A;  3DKY A;  3G2B A;  1Z21 A;  4XOP A;  2CV0 A;  2HPI A;  3OYE A;  4F3Q A;  4BGD A;  4B44 A;  2IGK A;  2WB1 A;  3PNT A;  4XLH A;  4B43 A;  3OYD A;  3M1C A;  4ZTJ A;  2ZXI A;  2PJR B;  1N78 A;  2Q2E B;  2X6W A;  2IGN A;  2V7F A;  2M3A A;  1MNE A;  2R7Q A;  4ZC3 A;  2E60 A;  2CV1 A;  3QOE A;  4RLQ A;  4BDY A;  2L2O A;  4FET A;  4C30 A;  4II2 A;  3C2H A;  3SZG A;  4LIV A;  4CZC A;  3A2K A;  1WJA A;  4II3 A;  2LBF A;  3S3M A;  1YX3 A;  4R79 A;  2V9K A;  3VWB A;  3AKZ A;  2OC6 A;  1G59 A;  3K4J A;  4NUB A;  4BEH A;  4XKB A;  2MD0 A;  3K4K A;  3H0D A;  2KDO A;  2Z1D A;  4OAZ A;  3AFH A;  4RM2 A;  1NG6 A;  4E7K A;  1T95 A;  2CUZ A;  3L2V A;  1WFX A;  4FAS D;  4OAY A;  3QOD A;  4BDZ A;  2XF6 A;  3OYM A;  3PFY A;  4AYB A;  2E1M B;  2HDW A;  1BR4 A;  2W82 A;  4IQJ A;  2E1M C;  2RRE A;  3VYT B;  1DQU A;  4BJ5 C;  1NG7 A;  3ZQQ A;  4JQF A;  4CCJ A;  2HZD A;  2VB6 A;  3EPZ A;  3OY9 A;  3IAM 2;  1DGR M;  4MLO A;  3W2W A;  4ZDP A;  2LRE A;  2WBM A;  2BW3 B;  2KZV A;  2GOM A;  1TZL A;  3OL3 A;  4U87 A;  4N4O B;  2Z16 A;  2LBF B;  1KON A;  4QPO A;  3HOS A;  3DU5 A;  2VKD A;  4HG2 A;  4IZZ A;  3S3O A;  3MKZ A;  4XON A;  2VQC A;  2HVS A;  4CCK A;  3TBI A;  1LKX A;  1GLN A;  4BEH B;  3BCA A;  3DWL E;  1S9H A;  2CMP A;  2JUG A;  5TGT A;  1SAU A;  1Z7L A;  3VDX A;  1T0F C;  2JVG A;  2VXZ A;  3H5R A;  2WA0 A;  3BC8 A;  2KP6 A;  3BG7 A;  1X4O A;  3K4C A;  3PSI A;  1D0Y A;  2R7O A;  4AU7 A;  3OYH A;  3OYL A;  4XQF A;  1G8X A;  1WJE A;  2AQF A;  1OLT A;  4KIS A;  3MKY B;  2X6X A;  4DBR A;  2PJR A;  3CP8 A;  4LIU A;  3OYA A;  2R7U A;  3CJQ B;  1V5E A;  2W4S A;  4PUS A;  3I9V 2;  4XLE A;  3MKW B;  4HNT A;  2L9S A;  2VJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...