2MABA

Untangling the solution structure of c-terminal domain of aciniform spidroin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
PSFGLVLNSPNGLRSPQAKARINNLASALSTAVGRNGVDVNAFTSGLRATLSNLGDSGMSPNEAKVEVLLEALTAALQLLSSSTLGAVDTTSIGLTSNSVSKAVAQALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACINIFORM SPIDROIN
publication title Structure and function of C-terminal domain of aciniform spidroin
pubmed doi rcsb
source organism Nephila antipodiana
molecule tags Structural protein
total genus 31
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mabA00
2KHMA 2M0MA 2MFZA 2MABA 2K3PA
chains in the Genus database with same CATH superfamily
2VJ4A 2NVTJ 3D1NI 2CO5A 4F52A 2EQRA 1K78A 1A6IA 2XHKA 2WADA 4ETSA 3RQIA 1B1BA 4I99C 3FWEA 4CCNA 2LSOA 2TCTA 4LOCA 3HOVJ 3S15J 4BXFA 2HWVA 1O57A 2QQAA 3OV8A 4OAZA 3WU2C 4BHCA 5ICGA 1Y0NA 3H0GJ 3OYBA 2E5NA 1W0TA 3CO7C 1USSA 4UVCA 3TW6A 4B09A 5GPCA 2EZLA 3AKZA 1PYVA 5F64A 3VSLA 4XORA 1HW1A 1VQ5I 3TQNA 4IO9F 3KZYA 1RNLA 2LY9A 3DU5A 3U1DA 3IKVA 4RLFA 5D5XB 3GF2A 5IP9J 4AIJA 2VUMJ 3OYNA 5HVQC 2JRTA 2ZXHA 2YU3A 5E20A 1F43A 5C44J 2M2EA 5FB2A 1D8JA 2ZXJA 3Q0UA 4ESBA 1X58A 4HX7A 2OZ6A 4A6DA 5FJ8J 1MDMA 4BBSJ 5CKTA 2O61A 4ZJZA 1B9NA 2LFBA 1Z1DA 3T0YA 4EEFG 2OCEA 2XKPA 1WH5A 1XSVA 3C2HA 1SFUA 4G9YA 5JLWA 2HOEA 1RETA 3QPLA 2UZKA 1LFPA 1OR7A 5ILUA 3RPQA 3T8RA 3OYGA 4N0BA 4BAYA 2HDCA 1JUPA 1SANA 2Z2SB 2Q2EB 3KCCA 2ID3A 4AWXB 2V6EA 1X1PA 1X3UA 1KQ0A 1ZG5A 4D9JA 3WGGA 4DBQA 3GYHX 4I01A 3LQRA 3LSGA 2VBZA 4NQWB 1W1WE 3TDUC 1DPRA 1NK3P 1U5TA 3J81Z 3OYCA 1KONA 1G2HA 3CLOA 4A0ZA 1PUEE 1T08B 4ZYGA 4UVAA 4GDFA 1O3TA 3IAS2 4W97A 3ZR8X 2WAFA 1ZG3A 2MFZA 4DIQA 3A0HC 3TKYA 2LKSA 3BJ6A 2VPRA 1YOVB 3JRCA 1I3AA 1OCRH 5D8LB 2IJLA 2NS0A 3FM5A 2EV5A 4G7HF 2FF4A 3ZQLA 2QYOA 5LHGA 2CUEA 1WCMJ 4JK1X 2PJPA 3ZP5A 1K79A 2HDWA 2O8XA 3LA3A 4ANJA 3CF5F 3Q9VA 3GFLA 3ZGKA 2JTVA 1JE8A 2BY3A 4ZYAA 1YX3A 2M5WA 4ZTJA 1BN5A 1U6GA 1ZR4A 3DP7A 2DMUA 4KT6A 2DT5A 2E5ZA 3BT9A 3BZKA 4E7HA 1QHHD 3OY9A 4YFNF 2JRMA 1XB4A 3CUQB 5AIPA 5GTHC 2FBHA 3SDBA 3K1MA 3LL7A 2PLYA 3BQZA 3LFKA 3RTRA 2H1LA 1LFBA 2I5UA 1JKPC 1Y8QB 1WJBA 3BCAA 1JXSA 4BJ5C 3VDXA 1P7JA 2IXSA 5EZHA 1MBGA 5CVRA 1GLNA 2F5FA 3ZQ7A 3HKZA 2VL8A 4YG2F 2DXIA 5IY5H 2X6WA 2DODA 4RB2C 2ZXIA 4HQMA 2MC4A 4IJAA 2L7KA 3COAC 2XF7A 4B47A 1FYLA 3HTUA 2X48A 5FLVA 1SFXA 4WXDA 1QHGA 3E7LA 2MSYA 3I55I 3QAHA 2ZXWH 4HBLA 2KDOA 3M1EA 2DBBA 5DD8A 2XROA 2QKMB 2ME0A 2VBYA 3ECOA 3F8BA 4EV0A 2D45A 4PK4A 2HKXA 3H1CA 4IVNA 5K7HA 3ZQQA 2MH2A 3I4MJ 1ZHFA 4N9HA 3B73A 4EJOA 1X1CA 3D0SA 3EUHC 2VKHA 4M3FA 2AO9A 1RRJA 2P0WA 4U88A 1UHWA 5F04A 1CF7B 4BEHA 1IW7F 3RKWA 4D0PA 1KQ8A 1RKTA 2HXIA 4OIRF 4Q47A 1OPCA 1A5JA 2L4MA 3LSJA 1VFCA 2PBIA 4Q48A 3VYRB 4JP0A 1H0MA 2ZMEC 1WSUA 1RUOA 2HGCA 4RGUA 1OISA 1QNTA 3F8FA 2UWMA 1P2FA 3JR9A 1FX7A 2K85A 3R60A 4M6VA 4GCVA 2M87A 2PJRB 3FDYA 2ISYA 3JW4A 3RI4A 1Y56A 2EB7A 4RB0A 1ACIA 2V9KA 1FYMA 2CS3A 4O5VA 1QRYA 2VN2A 1U0JA 4KT5C 3BROA 3O3KA 5KAIC 3JRBA 1O7FA 4BQOA 4KIBA 3H9QA 4FE7A 3GTLJ 4FX0A 4Q4ZF 2X1EA 3S16J 3PO2J 1OCOH 1JHHA 3FXJA 2DU9A 2VC1A 1WHUA 1QQIA 3BP8A 2EH3A 2LD5A 2VOOA 3N05A 2Q8KA 5L3GA 1MZBA 3JRHA 4KNYA 1JTYA 2Z99A 1T98A 3KYCB 3OYLA 2VKEA 1IXSB 5BQTA 1D0XA 1I3QJ 1ZGJA 4LFUA 5JHFA 1Z9CA 4HX4A 3ZQGA 2W7NA 1YQAA 3I9V2 1IN5A 3GVAA 3GTOJ 4EJVA 1ZKGA 2L7MP 3KZZA 2F5EA 3O8GA 3QPTA 1QPMA 5M5XJ 3KPHA 2ISZA 5BOXA 2EFOA 3MKLA 5F1RA 5HS8A 1O7LA 3MZHA 9ANTA 4HDVA 3RYRA 3BG3A 3HSRA 4C3JJ 3QU6A 1IGNA 5FGMA 2ESNA 1XDSA 1Y6IA 2KFDA 2HKOA 2R7ZJ 1KZHA 3H9GA 1OMIA 1ETQA 1X4PA 2DDBA 2LC2A 4A5NA 2KJCA 1A36A 4FTHA 3ZMTA 4E4HA 2WV0A 4RA2A 4A3KJ 1ZREA 2XPUA 2GXGA 1R36A 1OFCX 1XG1A 3QYEA 1A6QA 3I0TA 4BJTA 4RB1A 1XMAA 4FISA 5EG0A 1TC3C 1XCVA 2PI0A 1J59A 4DJAA 1LEAA 3JSPA 5HDKA 3HGYA 2XAGA 5BS6A 2YUSA 3QPSA 3TO7A 1SEUA 3NARA 2G9WA 5HLHA 1LNWA 1OR7C 2F4IA 3ZQIA 3ABLH 4Y3OA 4EM1A 2QLZA 4UNOA 1HOMA 2HYJA 1KYZA 2P4WA 3K9TA 1NHAA 5E1ZB 1OCCH 4HLYA 1ONVA 4QLCU 1LDDA 3LSMA 4M3EA 1VNDA 4OIPF 2O5RA 5HOOA 3ABKH 1U5TC 3CZ6A 2XPWA 2A6EF 2R7XA 5AONA 4I0AA 3LNQA 3L2VA 2R7TA 2HPIA 4D7NA 2JJ7A 2JWTA 2JUGA 1F5TA 3K4CA 3SHFA 1DP3A 2L4AA 2L01A 1IV8A 2Y30A 5LRSA 3G73A 5K1YA 1LUJB 3VWBA 4OINF 1FBSA 2L9NA 2EIMH 4CICA 3IRRA 4CCMA 1FSEA 4WXCA 4UY8I 2KMUA 3ZPLA 4MNUA 1ZGWA 1X19A 1RR7A 2GQQA 1MJAA 2LREA 2D2WA 2LY2A 2LYCA 3DPUA 5ICFA 4GYGA 3IP4B 4KA4A 4KN7X 4XRSG 2DI3A 4A0XA 2OUMA 2Q1ZB 4BXXJ 2HS5A 1G59A 2W25A 5JVGF 5K5QA 1R49A 1BI1A 1FOYA 4G6TB 2G7UA 2QQBA 4M9ZA 1PP7U 2NAZA 1QO0D 4BJ6C 5HLTA 1DP7P 3J7AO 4DYQA 4A2UA 1TP4A 3M4OJ 4AIDA 4BUPA 2ZFWA 4XQFA 2GOMA 4QPQA 2DA7A 4HSRA 4LGWA 5GADJ 2K3PA 3E5UA 3FZVA 2BY0A 1MBHA 2IEKA 1HSJA 1WI3A 2NOJB 1ORKA 4E6KG 3ZRGA 1T38A 2OC6A 2OF7A 3K70D 1T2KA 1U9NA 3BG6A 3G3ZA 3VYTB 3CMYA 4U7DA 2E2IJ 2DA1A 3HJEA 3ZMVA 1VQOI 1JJ8C 2HQAA 4F92B 3SQNA 2DT7B 2CQKA 1BM9A 2XC7A 1ZG1A 4M73A 3HUGB 1GUUA 2Z9OA 5IT9Z 5DUKA 3S93A 2IAIA 5LFAA 3REOA 2EPFA 3KEQA 4IRGA 3J80K 2R3SA 3V8LA 2PG4A 1HQCA 4FQGA 1TT5B 3PQKA 2GIZA 1FBQA 3DBHB 5FKNA 1F9NA 5A2QZ 2NS7A 2LR8A 3I59B 1VQLI 2L5QA 3BR5A 1H88C 4Y52J 1DQUA 3FIWA 1R7JA 1TQPA 3LA7A 1T6SA 4PJNA 2YX7A 3RKYA 2PMHA 3WTYC 3FKJA 3CJQB 5E8GA 4B1RA 1A04A 3BTLA 3U9GA 4BEHB 2QQ9A 4R1HA 3OIQA 4A3CJ 5IP7J 2Z1DA 4ZYDA 4LG3A 3SFZA 4C2MJ 4YFKF 1YITI 2CYYA 2QWWA 4HQEA 2MC3A 1W5TA 1FPQA 2H27A 4NQWA 1ZH5A 1IF1A 1TWHJ 4I2OA 2IPQX 2DYRH 1CQTA 2AQEA 5FFZA 1IUYA 4G6QA 4E7KA 3LA2A 5LHIA 2DFHA 2JK3A 3FMSA 4RGXA 5J1RA 5IP6A 3C2GA 3F22A 3BJAA 4XLCA 1SD6A 1TBXA 4WWCA 2HXOA 5J4VA 1WZ2A 2F5CA 1RZ4A 4WXHA 3RQ4A 2K86A 2EZHA 2XIGA 3HOTA 1JT0A 4NNJA 1NG6A 2W24A 5FROA 5CLSA 3KP5A 2A5WA 2DQLA 2W4SA 2P5KA 4BU2A 1ZRCA 4LD5A 4B4CA 4CCLA 3R61A 1V5GA 2MH9A 4LJZF 4IRHA 5FD5A 3C3WA 4JBAA 5FLMJ 5HDNA 2DJNA 1KU3A 1WJEA 2DFIA 2CFXA 3CUQA 3MZYA 5FKKA 3OSGA 3TOAA 2VT2A 4HRIA 3IKTA 1P92A 1Z05A 3HRMA 4FETA 2XGXA 2DMPA 4H4KC 2KLOA 2QSHX 5JR3A 1VZ0A 2YSRA 1F1ZA 2XB0X 1FJLA 5E17F 4G7ZF 1KU9A 3LSIA 4OIQF 4L18B 2I10A 5DM6F 3F6OA 2LVSA 2BZTA 2OTJI 1AU7A 2BOLA 3GW2A 1T33A 2H09A 3V7CA 4B3XA 3J81K 4BDZA 1P7IA 3ZMUA 1T0FA 1ZRFA 4KITB 2MLGA 1ON2A 2YR2A 1ZN2A 5J47A 4PCQA 5ED4A 5CVVA 2HOTA 3BJOA 1MMNA 2ELJA 2ZSIB 5E79C 2VKVA 3SYTA 2JA2A 2WAEA 2CQXA 1K4SA 3I64A 3ULQB 1UZCA 4PJLA 1RIOH 3SDGA 3M8JA 4NHJA 5J3LA 2L02A 2DK8A 2X6YA 3HPHA 2KHMA 1S7AA 4MLOA 5BPDA 1N75A 1I6HJ 4XOPA 1JKQC 3W6JB 5J8FA 3J7ZI 4G6DA 2V1UA 3RYPA 4X0GA 1USTA 3RJPA 4KIGA 1CF7A 4DZPA 1MMGA 2M30A 1ZAOA 3ERMA 2R7SA 4I98B 1YFHA 2BV6A 4BACA 4U87A 2L0KA 3BR0A 3FXUA 3VPRA 4CHUA 2IGMA 2H94A 5HODA 1BR4A 1EH6A 2P7CB 1S7OA 4GYIA 4CA0A 4XBFA 3DXJF 4PDKA 5JI6A 3K0LA 4U0WA 3WU1B 4PSXA 3P9IA 2OD5A 1U8BA 3K4NA 3WODF 1YYVA 4CZZA 1MBEA 1D0ZA 3M3YJ 1W5SA 2EBIA 3W6KB 3JRIA 3W2AA 3PFIA 2W00A 4EJUA 2JT1A 2IBDA 2P5VA 4IF4A 1R4NB 5KHDA 4ESJA 2E35A 4N4OB 1S72I 2YX4A 4EQQA 2KIUA 2EA4A 1IO2A 2ZCWA 3KYLA 4ZYHA 4ON0A 3HOXJ 3FBIB 4MGRA 3P5JA 4HDUA 3L2UA 2FJ1A 2HOAA 5D6EA 1Z3XA 1E2XA 1BI0A 2DOAA 1HKQA 2VIXA 2KRHA 2CQNA 2ZJQF 3CC7I 3F21A 1IRZA 2L9VA 1YJ9I 2PMZN 1IRGA 2CUZA 2WB1N 3M1CA 1B6AA 4CGZA 2L3DA 4XLNF 1WVRA 2QF7A 1W0UA 2K27A 2P81A 5KK1A 2H8WA 1B8IB 3V8KA 3DEWA 4A3LJ 3DTEA 1XDUA 2VQCA 1VQ4I 3E5XA 5JFRA 4BHPA 3F8MA 4M72A 1ZLKA 4AYBA 2ESHA 2A07F 2HNHA 2NVYJ 1D8KA 4A3DJ 2OA4A 2IS4A 5DEQA 2TRTA 3HHHA 4Y17A 1K7AA 2ICWG 3NWTA 1OQYA 3FMQA 2X85A 1LVAA 3GLLA 5D5UB 2LNBA 1SD4A 3C7JA 3S1RJ 4B8XA 2VONA 3LSTA 1ETWA 3WTVC 2ECBA 4BQAA 1YJNI 2JPBA 4FHTA 3K70C 4U0VA 5J1UA 4A6EA 3B6CA 4LLGF 1X1BA 2GAUA 1MJBA 4G8XA 4FE4A 3F9KA 4P96A 1FYKA 4Y7NJ 3IUOA 3ABTA 3Q0VA 1PVEA 2KRFA 1BBYA 5EYRA 2E2HJ 4EM0B 4HNUA 2GZWA 2X9DA 1QGPA 1VI0A 3S32A 5LLQA 1OJLA 4F3QA 3JRDA 1NTCA 1PDNC 4IHWA 1FP2A 2F5DA 4DW6A 3FXOA 2P6SA 4D5FA 1VQNI 2Y48A 2O6GE 4PJMA 2M8GX 1QZYA 4E70A 1FY7A 2YPRA 3OR1C 3PL8A 2D1HA 4Y4RA 4ESFA 1JT6A 2STTA 3V4GA 4O3MA 2LF7A 4PSWA 2OV7A 1YI2I 3L7WA 1ZARA 1FTTA 5DM7F 3ASNH 3L2CA 2GXBA 1MW7A 2HZDA 1ZLJA 3K4BA 4AYBN 4PGHA 4C3IJ 3BZ6A 1OYWA 3O2PE 2DMQA 1SVOA 3GFJA 2NVQJ 3WG7H 3KP3A 2QUFA 3LMMA 3WE2A 2NYXA 2Y0SA 5M5WJ 1U8RA 5E1WA 3PFYA 4CYDA 4UUTA 1VTNC 3U2RA 3OOUA 2YU9J 1JJ6C 3WE3A 2R93J 5E3LA 3BWGA 3Q5FA 3PJRA 1R00A 3GTQJ 3BTIA 1EF4A 2OBPA 2XPVA 2A3SA 3BOQA 4HA8A 3BPXA 3CUQC 4EGZA 1I39A 2K02A 2L9SA 2VJIA 3P7NA 2M7AA 2BVLA 3R4KA 4M3GA 5LHHA 4AD9A 1JKOC 3TOBA 5CQGA 3WTUC 3DLLF 2CG4A 3SXYA 3HSEA 4XM3A 3HOSA 3ERED 2P5LC 3G1MA 4BKXA 1DDNA 5F6FA 5LGUA 4JOMA 1E3OC 2M3AA 4A3JJ 2V26A 1SFKA 1O3SA 4ZDOA 2CUFA 2KIFA 3CP8A 2ZB9A 1E17A 1T0FC 1X3WB 3E3VA 4IOCF 2XASA 3S3MA 4XLFA 3HUGA 3G4SI 4BL0B 5LGTA 2J5PA 1R1VA 1D5VA 2Y0SN 2ZJ2A 1EH8A 2VJ5A 1PJRA 2XKOA 4IOAF 4CUGA 4RAGA 3HOYJ 2JA7J 4P1WA 2OAZA 1TQIA 3PUBA 4C30A 2NNYA 2VQHA 3E6DA 4LB6B 3JAMZ 3MCZA 3BZCA 4L9NA 3MD2A 2I8DA 3ZMDA 3DKYA 5J40A 1AWCA 4FCYA 3ASOH 3I59A 4ZDLA 3WHBA 2R5YB 3K4MA 3D5RC 4NBQA 2HEOA 3V8JA 3CDLA 4M6YA 4E7SA 2BGCA 1XGOA 2V9PA 4L9VA 4J01A 3TL4X 3ZQHA 1JHFA 2E1MB 1XS9A 2EJRA 3KFWX 2QKLB 4KFCA 2IGOA 2XSDC 4V2FA 1T8IA 4L0ZB 3HRUA 4Y13A 3H92A 2Y0MA 3IWZA 3HKZN 3V7RA 3GWZA 1STZA 2LTPA 1N78A 1D0YA 2W85A 2XRNA 3H36A 1LDJA 2CQ7A 1QU3A 4ZTFA 4DOZA 2EV0A 3I54A 4HLXA 3MFKA 2QA4I 4YIFA 2XSJC 1QZZA 2H6BA 3GO5A 3UKGA 2V4JC 5C4JJ 1ETYA 3TW7A 4QWQA 2CFOA 1ZYRF 4LLNA 3HB9A 2XDVA 4ZDPA 4C9YA 4L0YB 2Y2ZA 3BQYA 4BDYA 1SMYF 3WU0A 3LSHA 5IT3A 2KZGA 2MYSA 1FOKA 3PNYA 5FKLA 3FKIJ 1JUMA 2EFPA 3NAUA 3K4KA 3ONQA 2L9RA 3WHCA 4IRIA 5GTIC 4OMYA 2VQGA 3H3VK 2RKHA 4MQVA 2F5VA 5IT9K 2ZSHB 3UR3C 1ON1A 2HQ5A 2PQ8A 3L09A 3K1PA 4HOBA 2MW8A 5K7FA 3MKYB 4CO8A 2D1VA 3EYIA 2E7XA 1DU0A 3W2VA 2CW8A 3L9FA 4XOTA 3VODA 5A2QK 3LFUA 1WFXA 1BW5A 4I7HA 1GDTA 1YRNB 5HNFA 2UXNA 4IPAA 1O3RA 2Z5UA 3ABMH 3CCEI 4OMZA 5H6RA 2MD5A 2H6CA 3WTTC 2JSCA 4IQJA 3LAJA 1MNDA 3AL0B 1QVTA 3K6GA 2B63J 4XLAA 3HOWJ 3HHGA 2DTRA 1DUXC 4II2A 2MLKA 2QM3A 1V5EA 5B1BH 2EK5A 2HR3A 3AG2H 3CLQA 2ZC2A 4C3HJ 5KVRA 3JRAA 1D3YA 2IS1A 1BL0A 3CDIA 1FBUA 2E1CA 2JA5J 5DS9A 3S2WA 2YS9A 2Y9ZA 2EFQA 3QODA 2K40A 2DFEA 2LF8A 4LMYA 1YIJI 2XGEA 1DPUA 3IRQA 2R7UA 1R6RA 3IH2A 2VXDA 1GT0C 1IXCA 2HDDA 3PSFA 2VE9A 2ZJPF 3ZQFA 2V6CA 3NWSA 2XVCA 4HNVA 2RAEA 4IXAA 3CCMI 5ICEA 5F0CA 4EMSA 2HZTA 2RVCA 1T39A 2FSWA 2Y69H 3RCOA 1VQ6I 2ZO4A 3DV8A 4PUSA 5HS7A 3MVPA 1ZR2A 3C1DA 4L5EA 1AHDP 2STWA 5IYBJ 2CW0F 4D1QA 5EEAA 4C2UA 4UV9A 2KISA 2XAHA 4BHBA 1Q1VA 1Z7LA 3L1PA 1IJWC 5HLIA 4YEJA 2KZVA 3JREA 2G7HA 4Z2YA 1DGRM 2O3FA 3F8CA 5DTDA 1YW9A 1ZGAA 3QOEA 4E7ZA 2M0MA 3HL2A 4ZH4F 4II3A 4AC0A 4BXUA 3D5SC 3CCSI 3CQZJ 2Y75A 3HGGA 3ISPA 3OYHA 1TWGJ 3FHZA 3FXQA 5CJ9A 2EWNA 2LY1A 5BPIA 2CW7A 4XK4A 5FRNA 1W5CC 3I58A 3CP2A 4HX8A 4U0YA 4IHTA 1UELB 3ECHA 5M3FJ 3KLOA 3KP6A 1MBJA 2MA3A 3RSNA 2HQNA 1E0EA 1EV7A 2CV1A 3FBNB 4MFEA 5J6XA 2E2JJ 5EEGA 1LJ9A 3LOCA 1FC3A 1FLIA 2OJED 4IHXA 5CVJA 1Z0XA 2ZJRF 2HYGD 1FWZA 3PSIA 1G3YA 5M3MJ 1Z6TA 2K3FA 3DQVC 5CVIA 2FQ4A 2HVQA 3OYFA 2FD5A 3R6SA 2KP6A 3CTAA 1XPXA 1YHQI 2WV1A 1U2WA 3ABUA 1MMAA 5DUIA 1WKMA 2ID6A 4LLLA 4CXFA 3CMAI 2IP2A 2IA2A 1BOAA 3IAM2 4M3BA 1KU2A 3S8PA 2R5ZB 3TMOA 3OSFA 4IHYA 1MMDA 1MBFA 1B8IA 1B72A 2EA2A 4QTRA 5C4XJ 4X6AJ 3K2AA 1WH7A 5GAEJ 4BE0A 2HVRA 4BBRJ 1HCRA 3S17J 4IX7A 2KIMA 2BXZA 3E97A 4Z6YA 2H8RA 4LG0B 1V5FA 1HC8A 3SEZA 3GZ5A 2DMTA 4BY1J 4WK8F 4CZCA 2KT0A 2Z33A 3ZN0A 3JTGA 4Y15A 3HG9A 1XGNA 3OR2C 1BW6A 4HW0A 3GFIA 1UHSA 1X1DA 2K4JA 2BHZA 1IG7A 3A03A 2K7LA 3V7SA 1HDPA 3BR2A 5EEHA 5HLGA 3PIOF 4BNCA 3MWMA 2CWEA 3EETA 2ELKA 3H9JA 1BIAA 3I4PA 2X51A 4MIMA 3RDIA 3S2HJ 2FMYA 2AQFA 1N25A 2M34A 3A4CA 2FQ3A 3H0DA 2G0EA 3A0BC 3K2ZA 1P6RA 4F91B 4IEJA 2IRFG 2A61A 1L0OC 2CJJA 4W1UA 4U7BA 1R5ID 1I50J 1IC8A 3OS2A 4DZJA 3WTZA 1SMTA 1LDKB 2A05A 3I71A 2X6XA 2EILH 4JX4A 2HQRA 4YELA 3N97A 1HBXG 3JSOA 2VOPA 4F93B 1ETVA 1ZTRA 2QQ8A 2ZKZA 1AA7A 1UG2A 2KPMA 4A5MA 1K6OA 4PFPA 4EVIA 4IHVA 2FOWA 4UUSB 4KIFA 3EPZA 2VQLA 4OOIA 3KETA 3F8NA 3DTIA 5TISC 3HOUJ 3V42A 3LSRA 3GCMA 5TGTA 2K9LA 4MO7A 2ME6A 1FOXA 2DDAA 3DTKA 4RS8A 2L7FP 5EZGA 3CC4I 1MH3A 3GBGA 2M8EA 3BG5A 2DOFA 3KIOA 4YIRX 2BXYA 3Q9SA 4MFDA 1VQ8I 2OZUA 4DNCA 1U9OA 4J00A 3VOEA 5F0HA 1G4DA 1UJ8A 1S6LA 1ZQ3P 2PN6A 1OCTC 2RREA 4L9JA 1FT9A 1HXDA 2RQPA 4XNFA 1XSXA 2WWYA 4NC6A 3VYUB 4EATA 1BA5A 1MNEA 4M9SA 1X2MA 3MKWB 1FOWA 1UAAA 2WTEA 1SC7A 5D5WB 3U1KA 1Z21A 4RAFA 4EGYA 4ENJA 4I76A 4XICA 1K83J 5GAGJ 2BW3A 5EDNA 2IGNA 1H9GA 2VKDA 3KZIC 2OCCH 1LPQA 1MGTA 4I6ZA 3F6VA 4HZFA 1T95A 4D5CA 4KJZA 4MEYF 4AU7A 1YO5C 1BIBA 4V19K 4TV7A 1REPC 2V9VA 3IL2A 1UG0A 2CRGA 1BI2A 2R5YA 1HA8A 4C2TA 4XIDA 5HNHA 4MEXF 3MZ8A 4RGRA 2NNNA 2JSPA 4DYCA 1R23A 4A3BJ 2XGCA 2FXAA 3G1OA 3T1BA 4ENMA 2NOGA 4ABZA 2R7FA 3PUFA 3PO3J 5DV5A 5IYCJ 3QP6A 3M8EA 2WBMA 3CD6I 3LQQA 1YJWI 3WGIA 1JTXA 4PJJA 1KA8A 1WQ2A 2FNAA 1SFEA 2FU4A 1IRXA 2V1XA 3E0JB 1U78A 1M1EB 1IN8A 5D8KB 2RNJA 2XAUA 1OYYA 1TZLA 4P9UA 3HTSB 5FFXA 3AAFA 1BJZA 4S05A 1J5YA 3QP5A 1XMKA 3EUHA 3FXRA 3H3ZA 5FKMA 3VFZA 3JRFA 1Y1VJ 3DF8A 4ZZLA 1ITYA 2LKPA 3GTPJ 4KMUX 2DA4A 3BR1A 4MQ9F 4A3EJ 3TBIA 2EV6A 4B43A 3L00A 2BYVE 1SAUA 2MABA 3NQOA 2IA1A 4XONA 2VI6A 4IZZA 2HTJA 1SVMA 2V1NA 2M7BA 2HFHA 2KRCA 1UMQA 2A6HF 2PFBA 2IS2A 4RBOA 2FEZA 2M1BA 3EUAA 5K7ZA 2IGKA 1BI3A 2CMPA 3D5LA 4HNTA 4H0EA 4XKCA 3JAMK 1LKXA 1Z7UA 2O9LA 2JN6A 3KEYA 5TJJA 4BY7J 2Y9YA 2ZNZA 2DQRA 3OIPA 3T5XA 1YRNA 2R7RA 1KYWA 3FM3A 3S14J 2K4BA 1YLFA 2W84A 3DPTA 1S29A 1B72B 1WJCA 4DYRA 4KUMA 5FD6A 4GFBA 3K4LA 2BHYA 4XLPF 2C6YA 4Q5SF 2GA1A 5ICCA 1GXQA 3LAPA 2VT3A 1B9MA 4UB8C 2E1OA 1R1TA 1APLC 2O7OA 2DOEA 2CSOA 3CJNA 4MTDA 2RNGA 2FNPA 2ACJA 4KDPA 4XLEA 4HV6A 3H5RA 1LE8B 2LDUA 3S1NJ 2R7WA 4A3MJ 2Y31A 1TWFJ 3OL3A 3CCVI 3CMMA 5FKOA 1UB9A 4UVBA 3E6MA 1LQ1A 3KLNA 1MSEC 1D1BA 3G71I 2L2OA 5IOYA 1MD0A 3E6BA 3W3CA 4A0YA 4MHGA 1P4WA 3ROUA 3OMYA 3H35A 5B1AH 3F0CA 5E3MA 2E34A 2FBKA 2M4KA 5KCMA 5LGNA 3MQ0A 3P9CA 1RKWA 1U3EM 3TO9A 2O8KA 5F0FA 3KYDB 3RIRA 5L3EA 3HRTA 1CGPA 5HS9A 5BMZA 3CCYA 2M0CA 1EJ9A 1FTZA 1XSDA 1QBJA 1FEXA 5DCMA 4S04A 4KYWA 2O03A 2LBFA 3GMEA 4G7OF 2R7QA 5DDGA 1HKSA 3R0AA 1OKRA 2X1CA 4L5JA 1Y39A 1WI9A 1WJFA 4CCJA 3GTGJ 3GTKJ 2QBYB 4NB5A 3PIPF 2ELHA 2QCOA 5J8CA 2FX0A 1WJ5A 1S5LC 1DGWY 5F08A 3JRGA 2Z16A 2JA8J 2B7EA 2F4OB 2M4GA 3A1YA 4MTEA 5B5EC 1WRJA 2JUCA 3MN2A 2XF6A 5IPAA 4HF1A 1OCZH 2VBXA 1MKMA 4XN0A 4AVPA 4UUVA 5CPRB 4I02A 5GPAA 4WF2A 4CCKA 4F55A 2MBFA 2R4GA 3HIFA 1ZRDA 4RM3A 1FMVA 1IUFA 1G3WA 1HLVA 1AKHA 2GIVA 3GLXA 1WJAA 1F4KA 1W7PB 4QIWN 5L3CA 4Y33A 1WWXA 1YE9A 1LB2A 5DYMA 4J19A 3A01B 3DFGA 2Q0OA 3H3UA 2WY7Q 2FA5A 1AOYA 5B66C 2HYFA 1H89C 4XKBA 1Z91A 2IVMA 4XN3A 3PQJA 2VBWA 1G6NA 3H5AA 3ZCOA 5J1YA 3BCBA 4XMYA 1VQMI 2IS6A 1JGGA 1FP1D 1YG2A 2R5ZA 3CC2I 3EUKL 1J0RA 1XMXA 2GWRA 3GZ6A 1YS6A 1R9TJ 1TT0A 4M9XA 1XCBA 2KJBA 4GGGA 1IAWA 1R1UA 2BW3B 2L7ZA 1XN7A 2K9SA 2W82A 2PX9A 3QOPA 1ERDA 4BYYA 1SFOJ 5DD4A 5FLXZ 4LG0A 3S2DJ 1PUFB 5EJCA 2VE8A 1SD5A 5L3DA 3BLYA 3QPHA 4A3FJ 2E60A 2KQRA 3SZPA 4CYCB 3HOZJ 4XRSA 2W57A 2A69F 1LVKA 1TLHB 1GXPA 2K5CA 2EINH 4EJWA 2F6CA 3FF5A 5C3EJ 2E1MC 1O4XA 5L3FA 2IT0A 2H1KA 3FXKA 1HDDC 5JLXA 3EDPA 1Z6RA 3Q3SA 1TWCJ 3DLAA 3WGHA 2VASA 2E1NA 3E6CC 4IHSA 5H20A 3MMYB 3CCRI 2HTSA 4RLQA 3OS1A 2RDPA 3F23A 1D1CA 3KEOA 3RZDJ 3FHNA 1XX5A 2IA0A 2LG4A 3G1LA 3OYEA 1PP8F 1FIPA 2EIKH 3PNVA 2ZFUA 3OYJA 2F48A 2L54A 4A3IJ 3GTMJ 4JYKA 1NG7A 4E7JA 4KISA 1GV5A 3AG3H 3BR6A 3ELKA 3RKXA 3K1NA 4HF2A 4UV8A 3CF2A 1XGSA 4BGDA 1HW5A 2BE5F 2DAOA 3DPLC 2CUJA 2AS5F 1Z77A 4IQ4A 2UXXA 3W6VA 1B4AA 5LEJA 4LK1F 4FX4A 3IC7A 2E36A 2RV8A 3K4JA 1G3TA 1YIOA 2WY8Q 5LEKA 2LH9A 4JQFA 4UUSA 1RUNA 3O6BB 2ZMEB 2TDXA 3BDDA 2X6OA 1V55H 1ODDA 1X4OA 3BR3A 4RMNA 1ZK8A 4XRFA 4DQ2A 3L2QA 3ZN1A 3ZXSA 2QENA 4E7LA 2K9MA 4WX9A 4BE1A 2DPUA 2XAQA 2DN0A 4ZC3A 2D5VA 3C2BA 3BPVA 2KIQA 3HZJA 1OLTA 5EGOB 2XAFA 1R22A 1N77A 3S3NA 4P5OA 2BVMA 2LKXA 4YIIA 1IZ1A 3DBLB 1XGMA 2OU2A 2O0YA 2PMUA 4KMFA 3W2WA 2AHQA 5E18F 4XKWA 1HSTA 3AL0C 5FO5A 1MBKA 4HF0A 2COBA 4XSZF 2PEXA 1Y8RB 1K78B 3GXOA 3DEUA 1QPIA 3OYKA 4LB5A 4YFXF 1J09A 4LK0F 3BG9A 4NC7A 3OS0A 3CJTB 3M8FA 3RPUD 3JCUC 1YX5A 2DYSH 1HW2A 5D4SA 1Y1WJ 1TW2A 3DEEA 3KE2A 5F27A 4RB3C 1C0WA 3TDZC 4ZZDA 2HPMA 3OL4A 1XC5A 4FASD 1R5HA 4QSHA 2OQRA 3AG1H 5IYDJ 5K5RA 1WGXA 2W1OA 3HYIA 2LMDA 2V1DA 3F72A 5E1XA 2ECCA 1ZELA 3U21A 2XB5A 2DO7A 2A6TA 2XGDA 4GRIA 5D6FA 2EIJH 2DA6A 4IL6C 1H8AC 1XTAA 2OQGA 4EM2A 1MDMB 2FE3A 2JMWA 4ITVA 1L3LA 3DBRB 1TWAJ 1E3HA 4CCOA 4B48A 1J2XA 2QSFX 1I6XA 3FK6A 3LWFA 4WCGA 2JVGA 3I5UA 5CQEA 3AG4H 1HF0A 5CVUA 3H5NA 2UUZA 1V54H 3M07A 1POGA 3BG7A 4M3DA 4HSTA 5JVTA 2DLLA 2XAJA 1W36D 3NRVA 3AFHA 1TW3A 3RPUA 2R0QC 5EF6A 5DCMB 3K10A 2LBFB 4XL9A 3ZMSA 1IN4A 1MSFC 2CH0A 2AXLA 3FK7A 2CV0A 1G8XA 1SD7A 2K9QA 4L5IA 4HPQA 1X1AA 2FMLA 1RESA 2DTZA 3WTSC 3G2BA 2DJIA 4RGSA 1U5TB 3MAJA 4NUBA 2JPCA 1R71A 1BR1A 2BY1A 3MKZA 3EQLF 3GTJJ 1D5YA 4R79A 4A69C 4KICA 2XUBA 4I0BA 4N9IA 2CU7A 3ZMZA 3DWLE 3BY6A 2COMA 2E7WA 2EZIA 1S9HA 1VQPI 1QZEA 3SZGA 1IV6A 4CDGA 1FSHA 3M9AA 1T56A 3BTCA 3WTXC 1TTYA 4RAZA 3DU6A 1AKHB 4OIOF 2DMNA 1RR8C 5D5VB 2GOXB 4ENNA 1BC7C 3OWTA 2P6TA 2A68F 4EJTA 3KP2A 4LIVA 3E1SA 3IH4A 1NH3A 2RC4A 2HU9A 1EKEA 1I1SA 3SEQA 4IKFA 1GHCA 3R0JA 4RM2A 1BJAA 2F2EA 3TP0A 2MG4A 4LITA 1ETOA 1LFUP 1A35A 2M45A 2BBYA 3Q0WA 2X4HA 3OIOA 5K5OA 2M9HA 2WAQA 1BOBA 1RPWA 3DCFA 2IW5A 3FX3A 3QYBA 1V4RA 4OWRB 2Z3YA 2DA5A 1MJ9A 2J5OA 1K61A 3TEDA 1MH4A 5CYVA 1W4MA 2KDZA 4KN4X 3S1QJ 1IXRC 1E3PA 3HSFA 1KU7A 4BE2A 1IN6A 1MNMC 3CCLI 3HDDA 3LSPA 3GX4X 1EA3A 2QZ8A 1FZPB 4M74A 3CCUI 3HEFA 2NRAC 4XR6A 4YRVA 1S8NA 4V2GA 4UHTA 4LIUA 2V7FA 1GVJA 4D7MA 4DBRA 5DCFA 2GLOA 3KX2A 2DA2A 4GO1A 4M6XA 1OYIA 4P55A 3QRFF 2GA2A 4PJ0C 3L2WA 1Q1HA 4N4NB 3FISA 4GXOA 3VYSB 5F1JA 1LE8A 4XKVA 5GAHJ 4A3GJ 4AIHA 2ADUA 1KGSA 1V3FA 1IDYA 1IRFA 3A2KA 2VC0A 1A31A 1O3QA 3HPGA 4I09A 5D4RA 4XLHA 4PGGA 4OU0A 4BS9A 2FBIA 1P4XA 3K69A 2NVUB 3J7AY 3JTHA 2JVHA 2NXNB 1SAXA 2WAQN 2P8TA 3DKWA 4ZYEA 3CDHA 1D1AA 5TRDA 2EFNA 2N8GA 2LLKA 2RQQA 4HV5A 3B6AA 3OYDA 1W7PD 3HRSA 1BR2A 1GVDA 3BC8A 2JQ7A 3N4MA 1HKTA 3ZOBA 1Z67A 2R7VA 3QWLA 4RAYA 2V79A 2QGUA 3J7YJ 2Q2EA 4JX5A 3SJMA 3O8HA 4UXNA 2QVOA 3FMRA 1UCRA 4L9TA 3ESWB 2CV2A 2QEXI 1KQ9A 3GZNB 4AVZA 5H2FC 1H9TA 3BTJA 1FMWA 5BNGA 2QBYA 5KAFC 1TQMA 1XD7A 4PFOA 1J9IA 3QQAA 2CGPA 1R5GA 5GP9A 4UB6C 5HDGA 1EH7A 2GM4A 1ETXA 5IOZA 1S7EA 1B59A 2BY2A 3FXMA 2VXZA 4X1EA 1LEBA 1BC8C 4FT8A 1ETKA 3MEXA 3I56I 3DKXA 3QYFA 4F7ZA 2QSGX 3PNTA 3M7GA 2B9SA 4G94A 2DK5A 2LOOA 1TNSA 3L2RA 4A93J 4B44A 1Z3YA 1W7PA 2P7VB 3B02A 2E19A 3PM1A 2LP0A 2OTLI 1UHMA 4HG2A 2JA6J 1FIAA 2DA3A 2JZYA 2HOSA 1GV2A 3A01A 1I5ZA 1JUSA 3CCQI 2HVSA 6PAXA 1MMSA 2BEOA 2DW4A 2VPLA 4G12A 2XF5A 3EYYA 1DU6A 2FUG2 1X2NA 5LD2C 1OCPA 3VB2A 5M5YJ 4DGWB 2VB6A 3WTWC 4K2EA 4BQNA 4R8HA 1TNTA 2X0LA 4BQQA 2K9NA 5E8IA 4CSWA 3S3OA 2W48A 1WPKA 2ETHA 2GBYA 3HM5A 2MD0A 3HC7A 1TL8A 1YW8A 2FRHA 4QPOA 2F4MB 3SFIA 1YTYA 1JI8A 3IH3A 2A5YB 1J75A 4XSXF 3IHUA 4O6JA 2XV4S 4NDLA 5E3NA 3CO6C 5ILVA 4A12A 3S1MJ 5AIQA 1P4AA 3GUDA 3K7AJ 2EZKA 4AIKA 2ZBKA 2R7OA 1YW7A 1PUFA 1RC9A 4M71A 2KL4A 4S0HB 3X2QH 2RN7A 3CMEI 3WG9A 1Y0UA 3TGNA 1R58A 5J4YA 1G3SA 2CQQA 5EG0B 4CYCA 1NK2P 3I4NJ 1SVLA 2DPDA 2AXTC 3P9KA 4E7IA 5ERIA 3OYMA 3FXLA 3QU3A 3UNGC 4AM3A 1UFMA 2ZNYA 3RZOJ 3OYIA 5FRMA 3KP4A 1P9QC 3F3XA 1QVUA 3GEZA 3OOPA 1I1GA 5LBQA 4ASNA 1JGSA 2KKOA 3CJRB 4BH9A 3CCJI 3HXLA 2EFWA 5L3BA 4ENKA 4XRMA 1ENHA 1VF9A 3T8TA 2LRDA 2R92J 1IN7A 3HBLA 3E5QA 3CUOA 4AUXA 1RI7A 3IV5A 2NVXJ 4P9FA 2VODA 2VJJA 5H6QA 3KP7A 3I3LA 4OAYA 2R7DA 3OYAA 3G6EI 2DCEA 3C18A 4JX6A 3J80Z 2FOKA 1K4TA 1R4MB 1IDZA 5ILSA 5JHUA 3ML6A 1VQ9I 2PMZA 5B3SH 2WB1A 3RKQA 3A02A 3TO6A 2NS8A 2X1DA 5LRRA 2ZMEA 1MIJA 3VEPA 1W36C 2DT6A 4B3AA 2PJRA 4HYEA 3I53A 1K6YA 1FNNA 2HI3A 2VLAA 4HAMA 4CH7A 1WJDA 2WA0A 2B0LA 2OPTA 1F36A 2DFFA 4NC8A 2WC2A 3SZTA 3LSKA 2RGVA 1VQ7I 5FLXK 2XRLA 1VQKI 3CESA 4HEA2 3VSKA 1JKRC 3ZQCA 1X3ZB 3NEUA 5EGOA 2UV1A 1QA6A 2GXAA 3IWFA 5E3OA 2MGQA 1J7KA 1I27A 2LK2A 3GFMA 5KNLA 1YS7A 1ULYA 2E71A 1S3JA 3TP3A 4RDUA 4PZJA
chains in the Genus database with same CATH topology
3RCOA 3BLYA 4PUSA 2E60A 2KQRA 4XLCA 2VJ4A 4D1QA 4C2UA 4F52A 1LVKA 3RQ4A 2K5CA 2WADA 2F6CA 4CCNA 3HOTA 1Z7LA 2E1MC 4NNJA 2KZVA 1NG6A 4YEJA 4BXFA 3OYBA 1DGRM 4OAZA 5FROA 3HL2A 3QOEA 4E7ZA 2E5NA 2M0MA 2A5WA 2W4SA 4II3A 4BU2A 3DLAA 3D5SC 2VASA 3AKZA 1PYVA 3VSLA 3OYHA 4CCLA 4XORA 1V5GA 3MMYB 4RLQA 3OS1A 1D1CA 3DU5A 3FHNA 4RLFA 2LG4A 2LY1A 3OYEA 5FRNA 2CW7A 3PNVA 3OYNA 3CP2A 5HVQC 2ZFUA 2ZXHA 1WJEA 1UELB 3OYJA 1NG7A 4E7JA 4KISA 3RSNA 4HRIA 1E0EA 2CV1A 3FBNB 5CKTA 4ZJZA 3CF2A 4BGDA 4FETA 3DPLC 2CUJA 4IQ4A 4H4KC 2KLOA 1VZ0A 3C2HA 3PSIA 3DQVC 3LSIA 2HVQA 3OYFA 1LFPA 3K4JA 3OYGA 2KP6A 2BOLA 2WY8Q 2LH9A 4JQFA 2Z2SB 2Q2EB 4B3XA 4BDZA 2V6EA 1MMAA 4KITB 4D9JA 4DBQA 1X4OA 4RMNA 3LSGA 3L2QA 3IAM2 1MMNA 2ELJA 2ZSIB 3ZXSA 4NQWB 3S8PA 2K9MA 2JA2A 3SYTA 4E7LA 2WAEA 3TMOA 4BE1A 1MMDA 3OYCA 1KONA 4ZC3A 1OLTA 4PJLA 1N77A 4BE0A 3S3NA 2HVRA 4P5OA 2BVMA 3M8JA 2X6YA 3HPHA 3IAS2 2KHMA 3ZR8X 4IX7A 4MLOA 1N75A 2WAFA 4XOPA 3W2WA 2MFZA 4DIQA 1V5FA 4XKWA 4X0GA 3SEZA 1MMGA 3AL0C 2R7SA 3OYKA 4CZCA 4BACA 4U87A 1J09A 3HG9A 3OR2C 4NC7A 3OS0A 2IGMA 3RPUD 1YX5A 1X1DA 1BR4A 4CA0A 2HDWA 3DEEA 4ANJA 2HPMA 3OL4A 4FASD 3H9JA 3ZGKA 2X51A 4ZYAA 1YX3A 4PSXA 4ZTJA 2W1OA 2AQFA 3K4NA 4KT6A 2E5ZA 4E7HA 1D0ZA 1QHHD 3A4CA 3OY9A 3H0DA 1ZELA 3U21A 3W2AA 4F91B 2A6TA 4GRIA 3SDBA 2W00A 4U7BA 3LL7A 3RTRA 1WJBA 3BCAA 5KHDA 3OS2A 4N4OB 4ITVA 3VDXA 4BJ5C 1LDKB 2IXSA 2X6XA 1GLNA 4CCOA 3HKZA 4B48A 2VL8A 4YELA 3KYLA 2JVGA 5CQEA 2DXIA 4F93B 2X6WA 3FBIB 3H5NA 2UUZA 2ZXIA 3L2UA 1Z3XA 1AA7A 2KPMA 3BG7A 4HSTA 2MC4A 2DOAA 4PFPA 1W36D 2VIXA 2KRHA 3AFHA 2L7KA 2XF7A 3EPZA 4B47A 2VQLA 3K10A 3DTIA 2LBFB 4XL9A 1QHGA 2CH0A 3V42A 2CV0A 1G8XA 5TGTA 2CUZA 2K9LA 3M1CA 4HPQA 1X1AA 3DTKA 2KDOA 3G2BA 2DJIA 2QKMB 3GBGA 4NUBA 4PK4A 3DTEA 2VQCA 1BR1A 3MKZA 4R79A 3ZQQA 3DWLE 1X1CA 4AYBA 2HNHA 3EUHC 1S9HA 2VKHA 4J00A 2IS4A 2P0WA 3SZGA 3NWTA 4BEHA 2RREA 2X85A 3DU6A 4XNFA 2GOXB 3OWTA 3K70C 4LIVA 3E1SA 3VYRB 1X1BA 3VYUB 2HU9A 4EATA 1MNEA 3F9KA 3MKWB 1UAAA 3SEQA 3IUOA 4IKFA 1Z21A 4RM2A 2UWMA 4HNUA 4LITA 2PJRB 3FDYA 3S32A 2BW3A 4F3QA 1Y56A 2WAQA 2IGNA 2V9KA 1BOBA 2CS3A 2VKDA 3QYBA 4OWRB 1U0JA 1T95A 4PJMA 4BQOA 4KJZA 3PL8A 3H9QA 3OR1C 4Y4RA 4AU7A 4BE2A 2X1EA 4PSWA 2OV7A 1EA3A 1UG0A 3N05A 1HA8A 4C2TA 4XR6A 4YRVA 1MW7A 2HZDA 5HNHA 3K4BA 3OYLA 2JSPA 4LIUA 2V7FA 1D0XA 5JHFA 2W7NA 3I9V2 4DBRA 3KX2A 2WBMA 3LMMA 2Y0SA 4PJJA 3L2WA 4N4NB 3VYSB 3PFYA 4XKVA 1IRXA 3E0JB 3OOUA 3A2KA 2XAUA 1TZLA 3HPGA 3PJRA 1Y6IA 3H9GA 4XLHA 1X4PA 4BS9A 2LC2A 3J7AY 2JVHA 4E4HA 2L9SA 2VJIA 2M7AA 2BVLA 1D1AA 3QYEA 4BJTA 2RQQA 3TBIA 4B43A 5CQGA 3OYDA 1BR2A 3BC8A 1SAUA 4XM3A 2MABA 3HOSA 4DJAA 4XONA 2R7VA 4IZZA 2V1NA 2M7BA 2KRCA 2IS2A 4JOMA 1OR7C 2M3AA 3EUAA 2V26A 2CV2A 2F4IA 1SFKA 2IGKA 4ZDOA 4Y3OA 4AVZA 3CP8A 1FMWA 2CMPA 3D5LA 1T0FC 4HNTA 4XKCA 4PFOA 3S3MA 1LKXA 4XLFA 4BL0B 3KEYA 3LSMA 3OIPA 2VJ5A 2O5RA 1PJRA 5HOOA 4CUGA 3CZ6A 4P1WA 2VXZA 2R7RA 3PUBA 3DKXA 4C30A 2VQHA 3QYFA 3L2VA 2R7TA 2R7XA 2HPIA 3DPTA 3PNTA 2JUGA 2LOOA 3L2RA 3MD2A 2I8DA 3K4CA 3DKYA 1WJCA 1DP3A 4B44A 1Z3YA 4ZDLA 3K4LA 3VWBA 3K4MA 3D5RC 2L9NA 4HG2A 4CCMA 4E7SA 4J01A 2HVSA 3TL4X 2KMUA 1X19A 2E1MB 2VPLA 2XF5A 2FUG2 2QKLB 5LD2C 2LREA 2IGOA 2LY2A 2LYCA 2VB6A 3DPUA 4BQNA 4DGWB 4CSWA 2RNGA 4BQQA 3IP4B 4XLEA 3H5RA 3S3OA 2R7WA 3OL3A 1N78A 1D0YA 3CMMA 2OUMA 2Q1ZB 1QU3A 2MD0A 3HC7A 4DOZA 4ZTFA 1G59A 4QPOA 1D1BA 1JI8A 2L2OA 2XSJC 4G6TB 3W3CA 2V4JC 3OMYA 3H35A 4BJ6C 5HLTA 2CFOA 4BUPA 2M4KA 4XQFA 2GOMA 2XDVA 5KCMA 4QPQA 4HSRA 4ZDPA 4C9YA 4BDYA 3LSHA 2R7OA 2KL4A 2K3PA 2MYSA 3PNYA 2NOJB 3K4KA 4E6KG 3ONQA 3ZRGA 4E7IA 2OC6A 3OYMA 3UNGC 2VQGA 3K70D 3BG6A 3VYTB 2LBFA 3OYIA 2R7QA 2F5VA 2ZSHB 5FRMA 3UR3C 2HQAA 2X1CA 1P9QC 4F92B 3MKYB 2DT7B 1WJFA 4CCJA 3CJRB 3W2VA 2XC7A 1WJ5A 2CW8A 3HXLA 1DGWY 4XOTA 2Z16A 3HUGB 2M4GA 3A1YA 3S93A 2LRDA 2XF6A 3LFUA 1WFXA 5LFAA 4XN0A 5CPRB 5HNFA 4CCKA 4F55A 2R4GA 4RM3A 2VJJA 1FMVA 3I3LA 4OAYA 1WJAA 3OYAA 2DCEA 4IQJA 2L5QA 1MNDA 3AL0B 4Y33A 1DQUA 3K6GA 1YE9A 4XLAA 4PJNA 2PMZA 4II2A 3FKJA 3CJQB 2WB1A 2WY7Q 4BEHB 1V5EA 2X1DA 3OIQA 4XKBA 1W36C 2DT6A 4XN3A 2PJRA 1K6YA 2IS1A 2Z1DA 3H5AA 3ZCOA 2VLAA 3BCBA 4LG3A 4CH7A 1WJDA 2WA0A 4XMYA 2IS6A 4NC8A 3QODA 3LSKA 3EUKL 3CESA 4HEA2 3VSKA 2R7UA 1R6RA 2VXDA 1TT0A 2UV1A 2AQEA 3PSFA 4E7KA 2BW3B 3NWSA 2W82A 1ERDA 5KNLA 3C2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHM A;  2M0M A;  2MFZ A;  2MAB A;  2K3P A; 
#chains in the Genus database with same CATH topology
 2VJ4 A;  2NVT J;  3D1N I;  2CO5 A;  4F52 A;  2EQR A;  1K78 A;  1A6I A;  2XHK A;  2WAD A;  4ETS A;  3RQI A;  1B1B A;  4I99 C;  3FWE A;  4CCN A;  2LSO A;  2TCT A;  4LOC A;  3HOV J;  3S15 J;  4BXF A;  2HWV A;  1O57 A;  2QQA A;  3OV8 A;  4OAZ A;  3WU2 C;  4BHC A;  5ICG A;  1Y0N A;  3H0G J;  3OYB A;  2E5N A;  1W0T A;  3CO7 C;  1USS A;  4UVC A;  3TW6 A;  4B09 A;  5GPC A;  2EZL A;  3AKZ A;  1PYV A;  5F64 A;  3VSL A;  4XOR A;  1HW1 A;  1VQ5 I;  3TQN A;  4IO9 F;  3KZY A;  1RNL A;  2LY9 A;  3DU5 A;  3U1D A;  3IKV A;  4RLF A;  5D5X B;  3GF2 A;  5IP9 J;  4AIJ A;  2VUM J;  3OYN A;  5HVQ C;  2JRT A;  2ZXH A;  2YU3 A;  5E20 A;  1F43 A;  5C44 J;  2M2E A;  5FB2 A;  1D8J A;  2ZXJ A;  3Q0U A;  4ESB A;  1X58 A;  4HX7 A;  2OZ6 A;  4A6D A;  5FJ8 J;  1MDM A;  4BBS J;  5CKT A;  2O61 A;  4ZJZ A;  1B9N A;  2LFB A;  1Z1D A;  3T0Y A;  4EEF G;  2OCE A;  2XKP A;  1WH5 A;  1XSV A;  3C2H A;  1SFU A;  4G9Y A;  5JLW A;  2HOE A;  1RET A;  3QPL A;  2UZK A;  1LFP A;  1OR7 A;  5ILU A;  3RPQ A;  3T8R A;  3OYG A;  4N0B A;  4BAY A;  2HDC A;  1JUP A;  1SAN A;  2Z2S B;  2Q2E B;  3KCC A;  2ID3 A;  4AWX B;  2V6E A;  1X1P A;  1X3U A;  1KQ0 A;  1ZG5 A;  4D9J A;  3WGG A;  4DBQ A;  3GYH X;  4I01 A;  3LQR A;  3LSG A;  2VBZ A;  4NQW B;  1W1W E;  3TDU C;  1DPR A;  1NK3 P;  1U5T A;  3J81 Z;  3OYC A;  1KON A;  1G2H A;  3CLO A;  4A0Z A;  1PUE E;  1T08 B;  4ZYG A;  4UVA A;  4GDF A;  1O3T A;  3IAS 2;  4W97 A;  3ZR8 X;  2WAF A;  1ZG3 A;  2MFZ A;  4DIQ A;  3A0H C;  3TKY A;  2LKS A;  3BJ6 A;  2VPR A;  1YOV B;  3JRC A;  1I3A A;  1OCR H;  5D8L B;  2IJL A;  2NS0 A;  3FM5 A;  2EV5 A;  4G7H F;  2FF4 A;  3ZQL A;  2QYO A;  5LHG A;  2CUE A;  1WCM J;  4JK1 X;  2PJP A;  3ZP5 A;  1K79 A;  2HDW A;  2O8X A;  3LA3 A;  4ANJ A;  3CF5 F;  3Q9V A;  3GFL A;  3ZGK A;  2JTV A;  1JE8 A;  2BY3 A;  4ZYA A;  1YX3 A;  2M5W A;  4ZTJ A;  1BN5 A;  1U6G A;  1ZR4 A;  3DP7 A;  2DMU A;  4KT6 A;  2DT5 A;  2E5Z A;  3BT9 A;  3BZK A;  4E7H A;  1QHH D;  3OY9 A;  4YFN F;  2JRM A;  1XB4 A;  3CUQ B;  5AIP A;  5GTH C;  2FBH A;  3SDB A;  3K1M A;  3LL7 A;  2PLY A;  3BQZ A;  3LFK A;  3RTR A;  2H1L A;  1LFB A;  2I5U A;  1JKP C;  1Y8Q B;  1WJB A;  3BCA A;  1JXS A;  4BJ5 C;  3VDX A;  1P7J A;  2IXS A;  5EZH A;  1MBG A;  5CVR A;  1GLN A;  2F5F A;  3ZQ7 A;  3HKZ A;  2VL8 A;  4YG2 F;  2DXI A;  5IY5 H;  2X6W A;  2DOD A;  4RB2 C;  2ZXI A;  4HQM A;  2MC4 A;  4IJA A;  2L7K A;  3COA C;  2XF7 A;  4B47 A;  1FYL A;  3HTU A;  2X48 A;  5FLV A;  1SFX A;  4WXD A;  1QHG A;  3E7L A;  2MSY A;  3I55 I;  3QAH A;  2ZXW H;  4HBL A;  2KDO A;  3M1E A;  2DBB A;  5DD8 A;  2XRO A;  2QKM B;  2ME0 A;  2VBY A;  3ECO A;  3F8B A;  4EV0 A;  2D45 A;  4PK4 A;  2HKX A;  3H1C A;  4IVN A;  5K7H A;  3ZQQ A;  2MH2 A;  3I4M J;  1ZHF A;  4N9H A;  3B73 A;  4EJO A;  1X1C A;  3D0S A;  3EUH C;  2VKH A;  4M3F A;  2AO9 A;  1RRJ A;  2P0W A;  4U88 A;  1UHW A;  5F04 A;  1CF7 B;  4BEH A;  1IW7 F;  3RKW A;  4D0P A;  1KQ8 A;  1RKT A;  2HXI A;  4OIR F;  4Q47 A;  1OPC A;  1A5J A;  2L4M A;  3LSJ A;  1VFC A;  2PBI A;  4Q48 A;  3VYR B;  4JP0 A;  1H0M A;  2ZME C;  1WSU A;  1RUO A;  2HGC A;  4RGU A;  1OIS A;  1QNT A;  3F8F A;  2UWM A;  1P2F A;  3JR9 A;  1FX7 A;  2K85 A;  3R60 A;  4M6V A;  4GCV A;  2M87 A;  2PJR B;  3FDY A;  2ISY A;  3JW4 A;  3RI4 A;  1Y56 A;  2EB7 A;  4RB0 A;  1ACI A;  2V9K A;  1FYM A;  2CS3 A;  4O5V A;  1QRY A;  2VN2 A;  1U0J A;  4KT5 C;  3BRO A;  3O3K A;  5KAI C;  3JRB A;  1O7F A;  4BQO A;  4KIB A;  3H9Q A;  4FE7 A;  3GTL J;  4FX0 A;  4Q4Z F;  2X1E A;  3S16 J;  3PO2 J;  1OCO H;  1JHH A;  3FXJ A;  2DU9 A;  2VC1 A;  1WHU A;  1QQI A;  3BP8 A;  2EH3 A;  2LD5 A;  2VOO A;  3N05 A;  2Q8K A;  5L3G A;  1MZB A;  3JRH A;  4KNY A;  1JTY A;  2Z99 A;  1T98 A;  3KYC B;  3OYL A;  2VKE A;  1IXS B;  5BQT A;  1D0X A;  1I3Q J;  1ZGJ A;  4LFU A;  5JHF A;  1Z9C A;  4HX4 A;  3ZQG A;  2W7N A;  1YQA A;  3I9V 2;  1IN5 A;  3GVA A;  3GTO J;  4EJV A;  1ZKG A;  2L7M P;  3KZZ A;  2F5E A;  3O8G A;  3QPT A;  1QPM A;  5M5X J;  3KPH A;  2ISZ A;  5BOX A;  2EFO A;  3MKL A;  5F1R A;  5HS8 A;  1O7L A;  3MZH A;  9ANT A;  4HDV A;  3RYR A;  3BG3 A;  3HSR A;  4C3J J;  3QU6 A;  1IGN A;  5FGM A;  2ESN A;  1XDS A;  1Y6I A;  2KFD A;  2HKO A;  2R7Z J;  1KZH A;  3H9G A;  1OMI A;  1ETQ A;  1X4P A;  2DDB A;  2LC2 A;  4A5N A;  2KJC A;  1A36 A;  4FTH A;  3ZMT A;  4E4H A;  2WV0 A;  4RA2 A;  4A3K J;  1ZRE A;  2XPU A;  2GXG A;  1R36 A;  1OFC X;  1XG1 A;  3QYE A;  1A6Q A;  3I0T A;  4BJT A;  4RB1 A;  1XMA A;  4FIS A;  5EG0 A;  1TC3 C;  1XCV A;  2PI0 A;  1J59 A;  4DJA A;  1LEA A;  3JSP A;  5HDK A;  3HGY A;  2XAG A;  5BS6 A;  2YUS A;  3QPS A;  3TO7 A;  1SEU A;  3NAR A;  2G9W A;  5HLH A;  1LNW A;  1OR7 C;  2F4I A;  3ZQI A;  3ABL H;  4Y3O A;  4EM1 A;  2QLZ A;  4UNO A;  1HOM A;  2HYJ A;  1KYZ A;  2P4W A;  3K9T A;  1NHA A;  5E1Z B;  1OCC H;  4HLY A;  1ONV A;  4QLC U;  1LDD A;  3LSM A;  4M3E A;  1VND A;  4OIP F;  2O5R A;  5HOO A;  3ABK H;  1U5T C;  3CZ6 A;  2XPW A;  2A6E F;  2R7X A;  5AON A;  4I0A A;  3LNQ A;  3L2V A;  2R7T A;  2HPI A;  4D7N A;  2JJ7 A;  2JWT A;  2JUG A;  1F5T A;  3K4C A;  3SHF A;  1DP3 A;  2L4A A;  2L01 A;  1IV8 A;  2Y30 A;  5LRS A;  3G73 A;  5K1Y A;  1LUJ B;  3VWB A;  4OIN F;  1FBS A;  2L9N A;  2EIM H;  4CIC A;  3IRR A;  4CCM A;  1FSE A;  4WXC A;  4UY8 I;  2KMU A;  3ZPL A;  4MNU A;  1ZGW A;  1X19 A;  1RR7 A;  2GQQ A;  1MJA A;  2LRE A;  2D2W A;  2LY2 A;  2LYC A;  3DPU A;  5ICF A;  4GYG A;  3IP4 B;  4KA4 A;  4KN7 X;  4XRS G;  2DI3 A;  4A0X A;  2OUM A;  2Q1Z B;  4BXX J;  2HS5 A;  1G59 A;  2W25 A;  5JVG F;  5K5Q A;  1R49 A;  1BI1 A;  1FOY A;  4G6T B;  2G7U A;  2QQB A;  4M9Z A;  1PP7 U;  2NAZ A;  1QO0 D;  4BJ6 C;  5HLT A;  1DP7 P;  3J7A O;  4DYQ A;  4A2U A;  1TP4 A;  3M4O J;  4AID A;  4BUP A;  2ZFW A;  4XQF A;  2GOM A;  4QPQ A;  2DA7 A;  4HSR A;  4LGW A;  5GAD J;  2K3P A;  3E5U A;  3FZV A;  2BY0 A;  1MBH A;  2IEK A;  1HSJ A;  1WI3 A;  2NOJ B;  1ORK A;  4E6K G;  3ZRG A;  1T38 A;  2OC6 A;  2OF7 A;  3K70 D;  1T2K A;  1U9N A;  3BG6 A;  3G3Z A;  3VYT B;  3CMY A;  4U7D A;  2E2I J;  2DA1 A;  3HJE A;  3ZMV A;  1VQO I;  1JJ8 C;  2HQA A;  4F92 B;  3SQN A;  2DT7 B;  2CQK A;  1BM9 A;  2XC7 A;  1ZG1 A;  4M73 A;  3HUG B;  1GUU A;  2Z9O A;  5IT9 Z;  5DUK A;  3S93 A;  2IAI A;  5LFA A;  3REO A;  2EPF A;  3KEQ A;  4IRG A;  3J80 K;  2R3S A;  3V8L A;  2PG4 A;  1HQC A;  4FQG A;  1TT5 B;  3PQK A;  2GIZ A;  1FBQ A;  3DBH B;  5FKN A;  1F9N A;  5A2Q Z;  2NS7 A;  2LR8 A;  3I59 B;  1VQL I;  2L5Q A;  3BR5 A;  1H88 C;  4Y52 J;  1DQU A;  3FIW A;  1R7J A;  1TQP A;  3LA7 A;  1T6S A;  4PJN A;  2YX7 A;  3RKY A;  2PMH A;  3WTY C;  3FKJ A;  3CJQ B;  5E8G A;  4B1R A;  1A04 A;  3BTL A;  3U9G A;  4BEH B;  2QQ9 A;  4R1H A;  3OIQ A;  4A3C J;  5IP7 J;  2Z1D A;  4ZYD A;  4LG3 A;  3SFZ A;  4C2M J;  4YFK F;  1YIT I;  2CYY A;  2QWW A;  4HQE A;  2MC3 A;  1W5T A;  1FPQ A;  2H27 A;  4NQW A;  1ZH5 A;  1IF1 A;  1TWH J;  4I2O A;  2IPQ X;  2DYR H;  1CQT A;  2AQE A;  5FFZ A;  1IUY A;  4G6Q A;  4E7K A;  3LA2 A;  5LHI A;  2DFH A;  2JK3 A;  3FMS A;  4RGX A;  5J1R A;  5IP6 A;  3C2G A;  3F22 A;  3BJA A;  4XLC A;  1SD6 A;  1TBX A;  4WWC A;  2HXO A;  5J4V A;  1WZ2 A;  2F5C A;  1RZ4 A;  4WXH A;  3RQ4 A;  2K86 A;  2EZH A;  2XIG A;  3HOT A;  1JT0 A;  4NNJ A;  1NG6 A;  2W24 A;  5FRO A;  5CLS A;  3KP5 A;  2A5W A;  2DQL A;  2W4S A;  2P5K A;  4BU2 A;  1ZRC A;  4LD5 A;  4B4C A;  4CCL A;  3R61 A;  1V5G A;  2MH9 A;  4LJZ F;  4IRH A;  5FD5 A;  3C3W A;  4JBA A;  5FLM J;  5HDN A;  2DJN A;  1KU3 A;  1WJE A;  2DFI A;  2CFX A;  3CUQ A;  3MZY A;  5FKK A;  3OSG A;  3TOA A;  2VT2 A;  4HRI A;  3IKT A;  1P92 A;  1Z05 A;  3HRM A;  4FET A;  2XGX A;  2DMP A;  4H4K C;  2KLO A;  2QSH X;  5JR3 A;  1VZ0 A;  2YSR A;  1F1Z A;  2XB0 X;  1FJL A;  5E17 F;  4G7Z F;  1KU9 A;  3LSI A;  4OIQ F;  4L18 B;  2I10 A;  5DM6 F;  3F6O A;  2LVS A;  2BZT A;  2OTJ I;  1AU7 A;  2BOL A;  3GW2 A;  1T33 A;  2H09 A;  3V7C A;  4B3X A;  3J81 K;  4BDZ A;  1P7I A;  3ZMU A;  1T0F A;  1ZRF A;  4KIT B;  2MLG A;  1ON2 A;  2YR2 A;  1ZN2 A;  5J47 A;  4PCQ A;  5ED4 A;  5CVV A;  2HOT A;  3BJO A;  1MMN A;  2ELJ A;  2ZSI B;  5E79 C;  2VKV A;  3SYT A;  2JA2 A;  2WAE A;  2CQX A;  1K4S A;  3I64 A;  3ULQ B;  1UZC A;  4PJL A;  1RIO H;  3SDG A;  3M8J A;  4NHJ A;  5J3L A;  2L02 A;  2DK8 A;  2X6Y A;  3HPH A;  2KHM A;  1S7A A;  4MLO A;  5BPD A;  1N75 A;  1I6H J;  4XOP A;  1JKQ C;  3W6J B;  5J8F A;  3J7Z I;  4G6D A;  2V1U A;  3RYP A;  4X0G A;  1UST A;  3RJP A;  4KIG A;  1CF7 A;  4DZP A;  1MMG A;  2M30 A;  1ZAO A;  3ERM A;  2R7S A;  4I98 B;  1YFH A;  2BV6 A;  4BAC A;  4U87 A;  2L0K A;  3BR0 A;  3FXU A;  3VPR A;  4CHU A;  2IGM A;  2H94 A;  5HOD A;  1BR4 A;  1EH6 A;  2P7C B;  1S7O A;  4GYI A;  4CA0 A;  4XBF A;  3DXJ F;  4PDK A;  5JI6 A;  3K0L A;  4U0W A;  3WU1 B;  4PSX A;  3P9I A;  2OD5 A;  1U8B A;  3K4N A;  3WOD F;  1YYV A;  4CZZ A;  1MBE A;  1D0Z A;  3M3Y J;  1W5S A;  2EBI A;  3W6K B;  3JRI A;  3W2A A;  3PFI A;  2W00 A;  4EJU A;  2JT1 A;  2IBD A;  2P5V A;  4IF4 A;  1R4N B;  5KHD A;  4ESJ A;  2E35 A;  4N4O B;  1S72 I;  2YX4 A;  4EQQ A;  2KIU A;  2EA4 A;  1IO2 A;  2ZCW A;  3KYL A;  4ZYH A;  4ON0 A;  3HOX J;  3FBI B;  4MGR A;  3P5J A;  4HDU A;  3L2U A;  2FJ1 A;  2HOA A;  5D6E A;  1Z3X A;  1E2X A;  1BI0 A;  2DOA A;  1HKQ A;  2VIX A;  2KRH A;  2CQN A;  2ZJQ F;  3CC7 I;  3F21 A;  1IRZ A;  2L9V A;  1YJ9 I;  2PMZ N;  1IRG A;  2CUZ A;  2WB1 N;  3M1C A;  1B6A A;  4CGZ A;  2L3D A;  4XLN F;  1WVR A;  2QF7 A;  1W0U A;  2K27 A;  2P81 A;  5KK1 A;  2H8W A;  1B8I B;  3V8K A;  3DEW A;  4A3L J;  3DTE A;  1XDU A;  2VQC A;  1VQ4 I;  3E5X A;  5JFR A;  4BHP A;  3F8M A;  4M72 A;  1ZLK A;  4AYB A;  2ESH A;  2A07 F;  2HNH A;  2NVY J;  1D8K A;  4A3D J;  2OA4 A;  2IS4 A;  5DEQ A;  2TRT A;  3HHH A;  4Y17 A;  1K7A A;  2ICW G;  3NWT A;  1OQY A;  3FMQ A;  2X85 A;  1LVA A;  3GLL A;  5D5U B;  2LNB A;  1SD4 A;  3C7J A;  3S1R J;  4B8X A;  2VON A;  3LST A;  1ETW A;  3WTV C;  2ECB A;  4BQA A;  1YJN I;  2JPB A;  4FHT A;  3K70 C;  4U0V A;  5J1U A;  4A6E A;  3B6C A;  4LLG F;  1X1B A;  2GAU A;  1MJB A;  4G8X A;  4FE4 A;  3F9K A;  4P96 A;  1FYK A;  4Y7N J;  3IUO A;  3ABT A;  3Q0V A;  1PVE A;  2KRF A;  1BBY A;  5EYR A;  2E2H J;  4EM0 B;  4HNU A;  2GZW A;  2X9D A;  1QGP A;  1VI0 A;  3S32 A;  5LLQ A;  1OJL A;  4F3Q A;  3JRD A;  1NTC A;  1PDN C;  4IHW A;  1FP2 A;  2F5D A;  4DW6 A;  3FXO A;  2P6S A;  4D5F A;  1VQN I;  2Y48 A;  2O6G E;  4PJM A;  2M8G X;  1QZY A;  4E70 A;  1FY7 A;  2YPR A;  3OR1 C;  3PL8 A;  2D1H A;  4Y4R A;  4ESF A;  1JT6 A;  2STT A;  3V4G A;  4O3M A;  2LF7 A;  4PSW A;  2OV7 A;  1YI2 I;  3L7W A;  1ZAR A;  1FTT A;  5DM7 F;  3ASN H;  3L2C A;  2GXB A;  1MW7 A;  2HZD A;  1ZLJ A;  3K4B A;  4AYB N;  4PGH A;  4C3I J;  3BZ6 A;  1OYW A;  3O2P E;  2DMQ A;  1SVO A;  3GFJ A;  2NVQ J;  3WG7 H;  3KP3 A;  2QUF A;  3LMM A;  3WE2 A;  2NYX A;  2Y0S A;  5M5W J;  1U8R A;  5E1W A;  3PFY A;  4CYD A;  4UUT A;  1VTN C;  3U2R A;  3OOU A;  2YU9 J;  1JJ6 C;  3WE3 A;  2R93 J;  5E3L A;  3BWG A;  3Q5F A;  3PJR A;  1R00 A;  3GTQ J;  3BTI A;  1EF4 A;  2OBP A;  2XPV A;  2A3S A;  3BOQ A;  4HA8 A;  3BPX A;  3CUQ C;  4EGZ A;  1I39 A;  2K02 A;  2L9S A;  2VJI A;  3P7N A;  2M7A A;  2BVL A;  3R4K A;  4M3G A;  5LHH A;  4AD9 A;  1JKO C;  3TOB A;  5CQG A;  3WTU C;  3DLL F;  2CG4 A;  3SXY A;  3HSE A;  4XM3 A;  3HOS A;  3ERE D;  2P5L C;  3G1M A;  4BKX A;  1DDN A;  5F6F A;  5LGU A;  4JOM A;  1E3O C;  2M3A A;  4A3J J;  2V26 A;  1SFK A;  1O3S A;  4ZDO A;  2CUF A;  2KIF A;  3CP8 A;  2ZB9 A;  1E17 A;  1T0F C;  1X3W B;  3E3V A;  4IOC F;  2XAS A;  3S3M A;  4XLF A;  3HUG A;  3G4S I;  4BL0 B;  5LGT A;  2J5P A;  1R1V A;  1D5V A;  2Y0S N;  2ZJ2 A;  1EH8 A;  2VJ5 A;  1PJR A;  2XKO A;  4IOA F;  4CUG A;  4RAG A;  3HOY J;  2JA7 J;  4P1W A;  2OAZ A;  1TQI A;  3PUB A;  4C30 A;  2NNY A;  2VQH A;  3E6D A;  4LB6 B;  3JAM Z;  3MCZ A;  3BZC A;  4L9N A;  3MD2 A;  2I8D A;  3ZMD A;  3DKY A;  5J40 A;  1AWC A;  4FCY A;  3ASO H;  3I59 A;  4ZDL A;  3WHB A;  2R5Y B;  3K4M A;  3D5R C;  4NBQ A;  2HEO A;  3V8J A;  3CDL A;  4M6Y A;  4E7S A;  2BGC A;  1XGO A;  2V9P A;  4L9V A;  4J01 A;  3TL4 X;  3ZQH A;  1JHF A;  2E1M B;  1XS9 A;  2EJR A;  3KFW X;  2QKL B;  4KFC A;  2IGO A;  2XSD C;  4V2F A;  1T8I A;  4L0Z B;  3HRU A;  4Y13 A;  3H92 A;  2Y0M A;  3IWZ A;  3HKZ N;  3V7R A;  3GWZ A;  1STZ A;  2LTP A;  1N78 A;  1D0Y A;  2W85 A;  2XRN A;  3H36 A;  1LDJ A;  2CQ7 A;  1QU3 A;  4ZTF A;  4DOZ A;  2EV0 A;  3I54 A;  4HLX A;  3MFK A;  2QA4 I;  4YIF A;  2XSJ C;  1QZZ A;  2H6B A;  3GO5 A;  3UKG A;  2V4J C;  5C4J J;  1ETY A;  3TW7 A;  4QWQ A;  2CFO A;  1ZYR F;  4LLN A;  3HB9 A;  2XDV A;  4ZDP A;  4C9Y A;  4L0Y B;  2Y2Z A;  3BQY A;  4BDY A;  1SMY F;  3WU0 A;  3LSH A;  5IT3 A;  2KZG A;  2MYS A;  1FOK A;  3PNY A;  5FKL A;  3FKI J;  1JUM A;  2EFP A;  3NAU A;  3K4K A;  3ONQ A;  2L9R A;  3WHC A;  4IRI A;  5GTI C;  4OMY A;  2VQG A;  3H3V K;  2RKH A;  4MQV A;  2F5V A;  5IT9 K;  2ZSH B;  3UR3 C;  1ON1 A;  2HQ5 A;  2PQ8 A;  3L09 A;  3K1P A;  4HOB A;  2MW8 A;  5K7F A;  3MKY B;  4CO8 A;  2D1V A;  3EYI A;  2E7X A;  1DU0 A;  3W2V A;  2CW8 A;  3L9F A;  4XOT A;  3VOD A;  5A2Q K;  3LFU A;  1WFX A;  1BW5 A;  4I7H A;  1GDT A;  1YRN B;  5HNF A;  2UXN A;  4IPA A;  1O3R A;  2Z5U A;  3ABM H;  3CCE I;  4OMZ A;  5H6R A;  2MD5 A;  2H6C A;  3WTT C;  2JSC A;  4IQJ A;  3LAJ A;  1MND A;  3AL0 B;  1QVT A;  3K6G A;  2B63 J;  4XLA A;  3HOW J;  3HHG A;  2DTR A;  1DUX C;  4II2 A;  2MLK A;  2QM3 A;  1V5E A;  5B1B H;  2EK5 A;  2HR3 A;  3AG2 H;  3CLQ A;  2ZC2 A;  4C3H J;  5KVR A;  3JRA A;  1D3Y A;  2IS1 A;  1BL0 A;  3CDI A;  1FBU A;  2E1C A;  2JA5 J;  5DS9 A;  3S2W A;  2YS9 A;  2Y9Z A;  2EFQ A;  3QOD A;  2K40 A;  2DFE A;  2LF8 A;  4LMY A;  1YIJ I;  2XGE A;  1DPU A;  3IRQ A;  2R7U A;  1R6R A;  3IH2 A;  2VXD A;  1GT0 C;  1IXC A;  2HDD A;  3PSF A;  2VE9 A;  2ZJP F;  3ZQF A;  2V6C A;  3NWS A;  2XVC A;  4HNV A;  2RAE A;  4IXA A;  3CCM I;  5ICE A;  5F0C A;  4EMS A;  2HZT A;  2RVC A;  1T39 A;  2FSW A;  2Y69 H;  3RCO A;  1VQ6 I;  2ZO4 A;  3DV8 A;  4PUS A;  5HS7 A;  3MVP A;  1ZR2 A;  3C1D A;  4L5E A;  1AHD P;  2STW A;  5IYB J;  2CW0 F;  4D1Q A;  5EEA A;  4C2U A;  4UV9 A;  2KIS A;  2XAH A;  4BHB A;  1Q1V A;  1Z7L A;  3L1P A;  1IJW C;  5HLI A;  4YEJ A;  2KZV A;  3JRE A;  2G7H A;  4Z2Y A;  1DGR M;  2O3F A;  3F8C A;  5DTD A;  1YW9 A;  1ZGA A;  3QOE A;  4E7Z A;  2M0M A;  3HL2 A;  4ZH4 F;  4II3 A;  4AC0 A;  4BXU A;  3D5S C;  3CCS I;  3CQZ J;  2Y75 A;  3HGG A;  3ISP A;  3OYH A;  1TWG J;  3FHZ A;  3FXQ A;  5CJ9 A;  2EWN A;  2LY1 A;  5BPI A;  2CW7 A;  4XK4 A;  5FRN A;  1W5C C;  3I58 A;  3CP2 A;  4HX8 A;  4U0Y A;  4IHT A;  1UEL B;  3ECH A;  5M3F J;  3KLO A;  3KP6 A;  1MBJ A;  2MA3 A;  3RSN A;  2HQN A;  1E0E A;  1EV7 A;  2CV1 A;  3FBN B;  4MFE A;  5J6X A;  2E2J J;  5EEG A;  1LJ9 A;  3LOC A;  1FC3 A;  1FLI A;  2OJE D;  4IHX A;  5CVJ A;  1Z0X A;  2ZJR F;  2HYG D;  1FWZ A;  3PSI A;  1G3Y A;  5M3M J;  1Z6T A;  2K3F A;  3DQV C;  5CVI A;  2FQ4 A;  2HVQ A;  3OYF A;  2FD5 A;  3R6S A;  2KP6 A;  3CTA A;  1XPX A;  1YHQ I;  2WV1 A;  1U2W A;  3ABU A;  1MMA A;  5DUI A;  1WKM A;  2ID6 A;  4LLL A;  4CXF A;  3CMA I;  2IP2 A;  2IA2 A;  1BOA A;  3IAM 2;  4M3B A;  1KU2 A;  3S8P A;  2R5Z B;  3TMO A;  3OSF A;  4IHY A;  1MMD A;  1MBF A;  1B8I A;  1B72 A;  2EA2 A;  4QTR A;  5C4X J;  4X6A J;  3K2A A;  1WH7 A;  5GAE J;  4BE0 A;  2HVR A;  4BBR J;  1HCR A;  3S17 J;  4IX7 A;  2KIM A;  2BXZ A;  3E97 A;  4Z6Y A;  2H8R A;  4LG0 B;  1V5F A;  1HC8 A;  3SEZ A;  3GZ5 A;  2DMT A;  4BY1 J;  4WK8 F;  4CZC A;  2KT0 A;  2Z33 A;  3ZN0 A;  3JTG A;  4Y15 A;  3HG9 A;  1XGN A;  3OR2 C;  1BW6 A;  4HW0 A;  3GFI A;  1UHS A;  1X1D A;  2K4J A;  2BHZ A;  1IG7 A;  3A03 A;  2K7L A;  3V7S A;  1HDP A;  3BR2 A;  5EEH A;  5HLG A;  3PIO F;  4BNC A;  3MWM A;  2CWE A;  3EET A;  2ELK A;  3H9J A;  1BIA A;  3I4P A;  2X51 A;  4MIM A;  3RDI A;  3S2H J;  2FMY A;  2AQF A;  1N25 A;  2M34 A;  3A4C A;  2FQ3 A;  3H0D A;  2G0E A;  3A0B C;  3K2Z A;  1P6R A;  4F91 B;  4IEJ A;  2IRF G;  2A61 A;  1L0O C;  2CJJ A;  4W1U A;  4U7B A;  1R5I D;  1I50 J;  1IC8 A;  3OS2 A;  4DZJ A;  3WTZ A;  1SMT A;  1LDK B;  2A05 A;  3I71 A;  2X6X A;  2EIL H;  4JX4 A;  2HQR A;  4YEL A;  3N97 A;  1HBX G;  3JSO A;  2VOP A;  4F93 B;  1ETV A;  1ZTR A;  2QQ8 A;  2ZKZ A;  1AA7 A;  1UG2 A;  2KPM A;  4A5M A;  1K6O A;  4PFP A;  4EVI A;  4IHV A;  2FOW A;  4UUS B;  4KIF A;  3EPZ A;  2VQL A;  4OOI A;  3KET A;  3F8N A;  3DTI A;  5TIS C;  3HOU J;  3V42 A;  3LSR A;  3GCM A;  5TGT A;  2K9L A;  4MO7 A;  2ME6 A;  1FOX A;  2DDA A;  3DTK A;  4RS8 A;  2L7F P;  5EZG A;  3CC4 I;  1MH3 A;  3GBG A;  2M8E A;  3BG5 A;  2DOF A;  3KIO A;  4YIR X;  2BXY A;  3Q9S A;  4MFD A;  1VQ8 I;  2OZU A;  4DNC A;  1U9O A;  4J00 A;  3VOE A;  5F0H A;  1G4D A;  1UJ8 A;  1S6L A;  1ZQ3 P;  2PN6 A;  1OCT C;  2RRE A;  4L9J A;  1FT9 A;  1HXD A;  2RQP A;  4XNF A;  1XSX A;  2WWY A;  4NC6 A;  3VYU B;  4EAT A;  1BA5 A;  1MNE A;  4M9S A;  1X2M A;  3MKW B;  1FOW A;  1UAA A;  2WTE A;  1SC7 A;  5D5W B;  3U1K A;  1Z21 A;  4RAF A;  4EGY A;  4ENJ A;  4I76 A;  4XIC A;  1K83 J;  5GAG J;  2BW3 A;  5EDN A;  2IGN A;  1H9G A;  2VKD A;  3KZI C;  2OCC H;  1LPQ A;  1MGT A;  4I6Z A;  3F6V A;  4HZF A;  1T95 A;  4D5C A;  4KJZ A;  4MEY F;  4AU7 A;  1YO5 C;  1BIB A;  4V19 K;  4TV7 A;  1REP C;  2V9V A;  3IL2 A;  1UG0 A;  2CRG A;  1BI2 A;  2R5Y A;  1HA8 A;  4C2T A;  4XID A;  5HNH A;  4MEX F;  3MZ8 A;  4RGR A;  2NNN A;  2JSP A;  4DYC A;  1R23 A;  4A3B J;  2XGC A;  2FXA A;  3G1O A;  3T1B A;  4ENM A;  2NOG A;  4ABZ A;  2R7F A;  3PUF A;  3PO3 J;  5DV5 A;  5IYC J;  3QP6 A;  3M8E A;  2WBM A;  3CD6 I;  3LQQ A;  1YJW I;  3WGI A;  1JTX A;  4PJJ A;  1KA8 A;  1WQ2 A;  2FNA A;  1SFE A;  2FU4 A;  1IRX A;  2V1X A;  3E0J B;  1U78 A;  1M1E B;  1IN8 A;  5D8K B;  2RNJ A;  2XAU A;  1OYY A;  1TZL A;  4P9U A;  3HTS B;  5FFX A;  3AAF A;  1BJZ A;  4S05 A;  1J5Y A;  3QP5 A;  1XMK A;  3EUH A;  3FXR A;  3H3Z A;  5FKM A;  3VFZ A;  3JRF A;  1Y1V J;  3DF8 A;  4ZZL A;  1ITY A;  2LKP A;  3GTP J;  4KMU X;  2DA4 A;  3BR1 A;  4MQ9 F;  4A3E J;  3TBI A;  2EV6 A;  4B43 A;  3L00 A;  2BYV E;  1SAU A;  2MAB A;  3NQO A;  2IA1 A;  4XON A;  2VI6 A;  4IZZ A;  2HTJ A;  1SVM A;  2V1N A;  2M7B A;  2HFH A;  2KRC A;  1UMQ A;  2A6H F;  2PFB A;  2IS2 A;  4RBO A;  2FEZ A;  2M1B A;  3EUA A;  5K7Z A;  2IGK A;  1BI3 A;  2CMP A;  3D5L A;  4HNT A;  4H0E A;  4XKC A;  3JAM K;  1LKX A;  1Z7U A;  2O9L A;  2JN6 A;  3KEY A;  5TJJ A;  4BY7 J;  2Y9Y A;  2ZNZ A;  2DQR A;  3OIP A;  3T5X A;  1YRN A;  2R7R A;  1KYW A;  3FM3 A;  3S14 J;  2K4B A;  1YLF A;  2W84 A;  3DPT A;  1S29 A;  1B72 B;  1WJC A;  4DYR A;  4KUM A;  5FD6 A;  4GFB A;  3K4L A;  2BHY A;  4XLP F;  2C6Y A;  4Q5S F;  2GA1 A;  5ICC A;  1GXQ A;  3LAP A;  2VT3 A;  1B9M A;  4UB8 C;  2E1O A;  1R1T A;  1APL C;  2O7O A;  2DOE A;  2CSO A;  3CJN A;  4MTD A;  2RNG A;  2FNP A;  2ACJ A;  4KDP A;  4XLE A;  4HV6 A;  3H5R A;  1LE8 B;  2LDU A;  3S1N J;  2R7W A;  4A3M J;  2Y31 A;  1TWF J;  3OL3 A;  3CCV I;  3CMM A;  5FKO A;  1UB9 A;  4UVB A;  3E6M A;  1LQ1 A;  3KLN A;  1MSE C;  1D1B A;  3G71 I;  2L2O A;  5IOY A;  1MD0 A;  3E6B A;  3W3C A;  4A0Y A;  4MHG A;  1P4W A;  3ROU A;  3OMY A;  3H35 A;  5B1A H;  3F0C A;  5E3M A;  2E34 A;  2FBK A;  2M4K A;  5KCM A;  5LGN A;  3MQ0 A;  3P9C A;  1RKW A;  1U3E M;  3TO9 A;  2O8K A;  5F0F A;  3KYD B;  3RIR A;  5L3E A;  3HRT A;  1CGP A;  5HS9 A;  5BMZ A;  3CCY A;  2M0C A;  1EJ9 A;  1FTZ A;  1XSD A;  1QBJ A;  1FEX A;  5DCM A;  4S04 A;  4KYW A;  2O03 A;  2LBF A;  3GME A;  4G7O F;  2R7Q A;  5DDG A;  1HKS A;  3R0A A;  1OKR A;  2X1C A;  4L5J A;  1Y39 A;  1WI9 A;  1WJF A;  4CCJ A;  3GTG J;  3GTK J;  2QBY B;  4NB5 A;  3PIP F;  2ELH A;  2QCO A;  5J8C A;  2FX0 A;  1WJ5 A;  1S5L C;  1DGW Y;  5F08 A;  3JRG A;  2Z16 A;  2JA8 J;  2B7E A;  2F4O B;  2M4G A;  3A1Y A;  4MTE A;  5B5E C;  1WRJ A;  2JUC A;  3MN2 A;  2XF6 A;  5IPA A;  4HF1 A;  1OCZ H;  2VBX A;  1MKM A;  4XN0 A;  4AVP A;  4UUV A;  5CPR B;  4I02 A;  5GPA A;  4WF2 A;  4CCK A;  4F55 A;  2MBF A;  2R4G A;  3HIF A;  1ZRD A;  4RM3 A;  1FMV A;  1IUF A;  1G3W A;  1HLV A;  1AKH A;  2GIV A;  3GLX A;  1WJA A;  1F4K A;  1W7P B;  4QIW N;  5L3C A;  4Y33 A;  1WWX A;  1YE9 A;  1LB2 A;  5DYM A;  4J19 A;  3A01 B;  3DFG A;  2Q0O A;  3H3U A;  2WY7 Q;  2FA5 A;  1AOY A;  5B66 C;  2HYF A;  1H89 C;  4XKB A;  1Z91 A;  2IVM A;  4XN3 A;  3PQJ A;  2VBW A;  1G6N A;  3H5A A;  3ZCO A;  5J1Y A;  3BCB A;  4XMY A;  1VQM I;  2IS6 A;  1JGG A;  1FP1 D;  1YG2 A;  2R5Z A;  3CC2 I;  3EUK L;  1J0R A;  1XMX A;  2GWR A;  3GZ6 A;  1YS6 A;  1R9T J;  1TT0 A;  4M9X A;  1XCB A;  2KJB A;  4GGG A;  1IAW A;  1R1U A;  2BW3 B;  2L7Z A;  1XN7 A;  2K9S A;  2W82 A;  2PX9 A;  3QOP A;  1ERD A;  4BYY A;  1SFO J;  5DD4 A;  5FLX Z;  4LG0 A;  3S2D J;  1PUF B;  5EJC A;  2VE8 A;  1SD5 A;  5L3D A;  3BLY A;  3QPH A;  4A3F J;  2E60 A;  2KQR A;  3SZP A;  4CYC B;  3HOZ J;  4XRS A;  2W57 A;  2A69 F;  1LVK A;  1TLH B;  1GXP A;  2K5C A;  2EIN H;  4EJW A;  2F6C A;  3FF5 A;  5C3E J;  2E1M C;  1O4X A;  5L3F A;  2IT0 A;  2H1K A;  3FXK A;  1HDD C;  5JLX A;  3EDP A;  1Z6R A;  3Q3S A;  1TWC J;  3DLA A;  3WGH A;  2VAS A;  2E1N A;  3E6C C;  4IHS A;  5H20 A;  3MMY B;  3CCR I;  2HTS A;  4RLQ A;  3OS1 A;  2RDP A;  3F23 A;  1D1C A;  3KEO A;  3RZD J;  3FHN A;  1XX5 A;  2IA0 A;  2LG4 A;  3G1L A;  3OYE A;  1PP8 F;  1FIP A;  2EIK H;  3PNV A;  2ZFU A;  3OYJ A;  2F48 A;  2L54 A;  4A3I J;  3GTM J;  4JYK A;  1NG7 A;  4E7J A;  4KIS A;  1GV5 A;  3AG3 H;  3BR6 A;  3ELK A;  3RKX A;  3K1N A;  4HF2 A;  4UV8 A;  3CF2 A;  1XGS A;  4BGD A;  1HW5 A;  2BE5 F;  2DAO A;  3DPL C;  2CUJ A;  2AS5 F;  1Z77 A;  4IQ4 A;  2UXX A;  3W6V A;  1B4A A;  5LEJ A;  4LK1 F;  4FX4 A;  3IC7 A;  2E36 A;  2RV8 A;  3K4J A;  1G3T A;  1YIO A;  2WY8 Q;  5LEK A;  2LH9 A;  4JQF A;  4UUS A;  1RUN A;  3O6B B;  2ZME B;  2TDX A;  3BDD A;  2X6O A;  1V55 H;  1ODD A;  1X4O A;  3BR3 A;  4RMN A;  1ZK8 A;  4XRF A;  4DQ2 A;  3L2Q A;  3ZN1 A;  3ZXS A;  2QEN A;  4E7L A;  2K9M A;  4WX9 A;  4BE1 A;  2DPU A;  2XAQ A;  2DN0 A;  4ZC3 A;  2D5V A;  3C2B A;  3BPV A;  2KIQ A;  3HZJ A;  1OLT A;  5EGO B;  2XAF A;  1R22 A;  1N77 A;  3S3N A;  4P5O A;  2BVM A;  2LKX A;  4YII A;  1IZ1 A;  3DBL B;  1XGM A;  2OU2 A;  2O0Y A;  2PMU A;  4KMF A;  3W2W A;  2AHQ A;  5E18 F;  4XKW A;  1HST A;  3AL0 C;  5FO5 A;  1MBK A;  4HF0 A;  2COB A;  4XSZ F;  2PEX A;  1Y8R B;  1K78 B;  3GXO A;  3DEU A;  1QPI A;  3OYK A;  4LB5 A;  4YFX F;  1J09 A;  4LK0 F;  3BG9 A;  4NC7 A;  3OS0 A;  3CJT B;  3M8F A;  3RPU D;  3JCU C;  1YX5 A;  2DYS H;  1HW2 A;  5D4S A;  1Y1W J;  1TW2 A;  3DEE A;  3KE2 A;  5F27 A;  4RB3 C;  1C0W A;  3TDZ C;  4ZZD A;  2HPM A;  3OL4 A;  1XC5 A;  4FAS D;  1R5H A;  4QSH A;  2OQR A;  3AG1 H;  5IYD J;  5K5R A;  1WGX A;  2W1O A;  3HYI A;  2LMD A;  2V1D A;  3F72 A;  5E1X A;  2ECC A;  1ZEL A;  3U21 A;  2XB5 A;  2DO7 A;  2A6T A;  2XGD A;  4GRI A;  5D6F A;  2EIJ H;  2DA6 A;  4IL6 C;  1H8A C;  1XTA A;  2OQG A;  4EM2 A;  1MDM B;  2FE3 A;  2JMW A;  4ITV A;  1L3L A;  3DBR B;  1TWA J;  1E3H A;  4CCO A;  4B48 A;  1J2X A;  2QSF X;  1I6X A;  3FK6 A;  3LWF A;  4WCG A;  2JVG A;  3I5U A;  5CQE A;  3AG4 H;  1HF0 A;  5CVU A;  3H5N A;  2UUZ A;  1V54 H;  3M07 A;  1POG A;  3BG7 A;  4M3D A;  4HST A;  5JVT A;  2DLL A;  2XAJ A;  1W36 D;  3NRV A;  3AFH A;  1TW3 A;  3RPU A;  2R0Q C;  5EF6 A;  5DCM B;  3K10 A;  2LBF B;  4XL9 A;  3ZMS A;  1IN4 A;  1MSF C;  2CH0 A;  2AXL A;  3FK7 A;  2CV0 A;  1G8X A;  1SD7 A;  2K9Q A;  4L5I A;  4HPQ A;  1X1A A;  2FML A;  1RES A;  2DTZ A;  3WTS C;  3G2B A;  2DJI A;  4RGS A;  1U5T B;  3MAJ A;  4NUB A;  2JPC A;  1R71 A;  1BR1 A;  2BY1 A;  3MKZ A;  3EQL F;  3GTJ J;  1D5Y A;  4R79 A;  4A69 C;  4KIC A;  2XUB A;  4I0B A;  4N9I A;  2CU7 A;  3ZMZ A;  3DWL E;  3BY6 A;  2COM A;  2E7W A;  2EZI A;  1S9H A;  1VQP I;  1QZE A;  3SZG A;  1IV6 A;  4CDG A;  1FSH A;  3M9A A;  1T56 A;  3BTC A;  3WTX C;  1TTY A;  4RAZ A;  3DU6 A;  1AKH B;  4OIO F;  2DMN A;  1RR8 C;  5D5V B;  2GOX B;  4ENN A;  1BC7 C;  3OWT A;  2P6T A;  2A68 F;  4EJT A;  3KP2 A;  4LIV A;  3E1S A;  3IH4 A;  1NH3 A;  2RC4 A;  2HU9 A;  1EKE A;  1I1S A;  3SEQ A;  4IKF A;  1GHC A;  3R0J A;  4RM2 A;  1BJA A;  2F2E A;  3TP0 A;  2MG4 A;  4LIT A;  1ETO A;  1LFU P;  1A35 A;  2M45 A;  2BBY A;  3Q0W A;  2X4H A;  3OIO A;  5K5O A;  2M9H A;  2WAQ A;  1BOB A;  1RPW A;  3DCF A;  2IW5 A;  3FX3 A;  3QYB A;  1V4R A;  4OWR B;  2Z3Y A;  2DA5 A;  1MJ9 A;  2J5O A;  1K61 A;  3TED A;  1MH4 A;  5CYV A;  1W4M A;  2KDZ A;  4KN4 X;  3S1Q J;  1IXR C;  1E3P A;  3HSF A;  1KU7 A;  4BE2 A;  1IN6 A;  1MNM C;  3CCL I;  3HDD A;  3LSP A;  3GX4 X;  1EA3 A;  2QZ8 A;  1FZP B;  4M74 A;  3CCU I;  3HEF A;  2NRA C;  4XR6 A;  4YRV A;  1S8N A;  4V2G A;  4UHT A;  4LIU A;  2V7F A;  1GVJ A;  4D7M A;  4DBR A;  5DCF A;  2GLO A;  3KX2 A;  2DA2 A;  4GO1 A;  4M6X A;  1OYI A;  4P55 A;  3QRF F;  2GA2 A;  4PJ0 C;  3L2W A;  1Q1H A;  4N4N B;  3FIS A;  4GXO A;  3VYS B;  5F1J A;  1LE8 A;  4XKV A;  5GAH J;  4A3G J;  4AIH A;  2ADU A;  1KGS A;  1V3F A;  1IDY A;  1IRF A;  3A2K A;  2VC0 A;  1A31 A;  1O3Q A;  3HPG A;  4I09 A;  5D4R A;  4XLH A;  4PGG A;  4OU0 A;  4BS9 A;  2FBI A;  1P4X A;  3K69 A;  2NVU B;  3J7A Y;  3JTH A;  2JVH A;  2NXN B;  1SAX A;  2WAQ N;  2P8T A;  3DKW A;  4ZYE A;  3CDH A;  1D1A A;  5TRD A;  2EFN A;  2N8G A;  2LLK A;  2RQQ A;  4HV5 A;  3B6A A;  3OYD A;  1W7P D;  3HRS A;  1BR2 A;  1GVD A;  3BC8 A;  2JQ7 A;  3N4M A;  1HKT A;  3ZOB A;  1Z67 A;  2R7V A;  3QWL A;  4RAY A;  2V79 A;  2QGU A;  3J7Y J;  2Q2E A;  4JX5 A;  3SJM A;  3O8H A;  4UXN A;  2QVO A;  3FMR A;  1UCR A;  4L9T A;  3ESW B;  2CV2 A;  2QEX I;  1KQ9 A;  3GZN B;  4AVZ A;  5H2F C;  1H9T A;  3BTJ A;  1FMW A;  5BNG A;  2QBY A;  5KAF C;  1TQM A;  1XD7 A;  4PFO A;  1J9I A;  3QQA A;  2CGP A;  1R5G A;  5GP9 A;  4UB6 C;  5HDG A;  1EH7 A;  2GM4 A;  1ETX A;  5IOZ A;  1S7E A;  1B59 A;  2BY2 A;  3FXM A;  2VXZ A;  4X1E A;  1LEB A;  1BC8 C;  4FT8 A;  1ETK A;  3MEX A;  3I56 I;  3DKX A;  3QYF A;  4F7Z A;  2QSG X;  3PNT A;  3M7G A;  2B9S A;  4G94 A;  2DK5 A;  2LOO A;  1TNS A;  3L2R A;  4A93 J;  4B44 A;  1Z3Y A;  1W7P A;  2P7V B;  3B02 A;  2E19 A;  3PM1 A;  2LP0 A;  2OTL I;  1UHM A;  4HG2 A;  2JA6 J;  1FIA A;  2DA3 A;  2JZY A;  2HOS A;  1GV2 A;  3A01 A;  1I5Z A;  1JUS A;  3CCQ I;  2HVS A;  6PAX A;  1MMS A;  2BEO A;  2DW4 A;  2VPL A;  4G12 A;  2XF5 A;  3EYY A;  1DU6 A;  2FUG 2;  1X2N A;  5LD2 C;  1OCP A;  3VB2 A;  5M5Y J;  4DGW B;  2VB6 A;  3WTW C;  4K2E A;  4BQN A;  4R8H A;  1TNT A;  2X0L A;  4BQQ A;  2K9N A;  5E8I A;  4CSW A;  3S3O A;  2W48 A;  1WPK A;  2ETH A;  2GBY A;  3HM5 A;  2MD0 A;  3HC7 A;  1TL8 A;  1YW8 A;  2FRH A;  4QPO A;  2F4M B;  3SFI A;  1YTY A;  1JI8 A;  3IH3 A;  2A5Y B;  1J75 A;  4XSX F;  3IHU A;  4O6J A;  2XV4 S;  4NDL A;  5E3N A;  3CO6 C;  5ILV A;  4A12 A;  3S1M J;  5AIQ A;  1P4A A;  3GUD A;  3K7A J;  2EZK A;  4AIK A;  2ZBK A;  2R7O A;  1YW7 A;  1PUF A;  1RC9 A;  4M71 A;  2KL4 A;  4S0H B;  3X2Q H;  2RN7 A;  3CME I;  3WG9 A;  1Y0U A;  3TGN A;  1R58 A;  5J4Y A;  1G3S A;  2CQQ A;  5EG0 B;  4CYC A;  1NK2 P;  3I4N J;  1SVL A;  2DPD A;  2AXT C;  3P9K A;  4E7I A;  5ERI A;  3OYM A;  3FXL A;  3QU3 A;  3UNG C;  4AM3 A;  1UFM A;  2ZNY A;  3RZO J;  3OYI A;  5FRM A;  3KP4 A;  1P9Q C;  3F3X A;  1QVU A;  3GEZ A;  3OOP A;  1I1G A;  5LBQ A;  4ASN A;  1JGS A;  2KKO A;  3CJR B;  4BH9 A;  3CCJ I;  3HXL A;  2EFW A;  5L3B A;  4ENK A;  4XRM A;  1ENH A;  1VF9 A;  3T8T A;  2LRD A;  2R92 J;  1IN7 A;  3HBL A;  3E5Q A;  3CUO A;  4AUX A;  1RI7 A;  3IV5 A;  2NVX J;  4P9F A;  2VOD A;  2VJJ A;  5H6Q A;  3KP7 A;  3I3L A;  4OAY A;  2R7D A;  3OYA A;  3G6E I;  2DCE A;  3C18 A;  4JX6 A;  3J80 Z;  2FOK A;  1K4T A;  1R4M B;  1IDZ A;  5ILS A;  5JHU A;  3ML6 A;  1VQ9 I;  2PMZ A;  5B3S H;  2WB1 A;  3RKQ A;  3A02 A;  3TO6 A;  2NS8 A;  2X1D A;  5LRR A;  2ZME A;  1MIJ A;  3VEP A;  1W36 C;  2DT6 A;  4B3A A;  2PJR A;  4HYE A;  3I53 A;  1K6Y A;  1FNN A;  2HI3 A;  2VLA A;  4HAM A;  4CH7 A;  1WJD A;  2WA0 A;  2B0L A;  2OPT A;  1F36 A;  2DFF A;  4NC8 A;  2WC2 A;  3SZT A;  3LSK A;  2RGV A;  1VQ7 I;  5FLX K;  2XRL A;  1VQK I;  3CES A;  4HEA 2;  3VSK A;  1JKR C;  3ZQC A;  1X3Z B;  3NEU A;  5EGO A;  2UV1 A;  1QA6 A;  2GXA A;  3IWF A;  5E3O A;  2MGQ A;  1J7K A;  1I27 A;  2LK2 A;  3GFM A;  5KNL A;  1YS7 A;  1ULY A;  2E71 A;  1S3J A;  3TP3 A;  4RDU A;  4PZJ A; 
#chains in the Genus database with same CATH homology
 3RCO A;  3BLY A;  4PUS A;  2E60 A;  2KQR A;  4XLC A;  2VJ4 A;  4D1Q A;  4C2U A;  4F52 A;  1LVK A;  3RQ4 A;  2K5C A;  2WAD A;  2F6C A;  4CCN A;  3HOT A;  1Z7L A;  2E1M C;  4NNJ A;  2KZV A;  1NG6 A;  4YEJ A;  4BXF A;  3OYB A;  1DGR M;  4OAZ A;  5FRO A;  3HL2 A;  3QOE A;  4E7Z A;  2E5N A;  2M0M A;  2A5W A;  2W4S A;  4II3 A;  4BU2 A;  3DLA A;  3D5S C;  2VAS A;  3AKZ A;  1PYV A;  3VSL A;  3OYH A;  4CCL A;  4XOR A;  1V5G A;  3MMY B;  4RLQ A;  3OS1 A;  1D1C A;  3DU5 A;  3FHN A;  4RLF A;  2LG4 A;  2LY1 A;  3OYE A;  5FRN A;  2CW7 A;  3PNV A;  3OYN A;  3CP2 A;  5HVQ C;  2ZFU A;  2ZXH A;  1WJE A;  1UEL B;  3OYJ A;  1NG7 A;  4E7J A;  4KIS A;  3RSN A;  4HRI A;  1E0E A;  2CV1 A;  3FBN B;  5CKT A;  4ZJZ A;  3CF2 A;  4BGD A;  4FET A;  3DPL C;  2CUJ A;  4IQ4 A;  4H4K C;  2KLO A;  1VZ0 A;  3C2H A;  3PSI A;  3DQV C;  3LSI A;  2HVQ A;  3OYF A;  1LFP A;  3K4J A;  3OYG A;  2KP6 A;  2BOL A;  2WY8 Q;  2LH9 A;  4JQF A;  2Z2S B;  2Q2E B;  4B3X A;  4BDZ A;  2V6E A;  1MMA A;  4KIT B;  4D9J A;  4DBQ A;  1X4O A;  4RMN A;  3LSG A;  3L2Q A;  3IAM 2;  1MMN A;  2ELJ A;  2ZSI B;  3ZXS A;  4NQW B;  3S8P A;  2K9M A;  2JA2 A;  3SYT A;  4E7L A;  2WAE A;  3TMO A;  4BE1 A;  1MMD A;  3OYC A;  1KON A;  4ZC3 A;  1OLT A;  4PJL A;  1N77 A;  4BE0 A;  3S3N A;  2HVR A;  4P5O A;  2BVM A;  3M8J A;  2X6Y A;  3HPH A;  3IAS 2;  2KHM A;  3ZR8 X;  4IX7 A;  4MLO A;  1N75 A;  2WAF A;  4XOP A;  3W2W A;  2MFZ A;  4DIQ A;  1V5F A;  4XKW A;  4X0G A;  3SEZ A;  1MMG A;  3AL0 C;  2R7S A;  3OYK A;  4CZC A;  4BAC A;  4U87 A;  1J09 A;  3HG9 A;  3OR2 C;  4NC7 A;  3OS0 A;  2IGM A;  3RPU D;  1YX5 A;  1X1D A;  1BR4 A;  4CA0 A;  2HDW A;  3DEE A;  4ANJ A;  2HPM A;  3OL4 A;  4FAS D;  3H9J A;  3ZGK A;  2X51 A;  4ZYA A;  1YX3 A;  4PSX A;  4ZTJ A;  2W1O A;  2AQF A;  3K4N A;  4KT6 A;  2E5Z A;  4E7H A;  1D0Z A;  1QHH D;  3A4C A;  3OY9 A;  3H0D A;  1ZEL A;  3U21 A;  3W2A A;  4F91 B;  2A6T A;  4GRI A;  3SDB A;  2W00 A;  4U7B A;  3LL7 A;  3RTR A;  1WJB A;  3BCA A;  5KHD A;  3OS2 A;  4N4O B;  4ITV A;  3VDX A;  4BJ5 C;  1LDK B;  2IXS A;  2X6X A;  1GLN A;  4CCO A;  3HKZ A;  4B48 A;  2VL8 A;  4YEL A;  3KYL A;  2JVG A;  5CQE A;  2DXI A;  4F93 B;  2X6W A;  3FBI B;  3H5N A;  2UUZ A;  2ZXI A;  3L2U A;  1Z3X A;  1AA7 A;  2KPM A;  3BG7 A;  4HST A;  2MC4 A;  2DOA A;  4PFP A;  1W36 D;  2VIX A;  2KRH A;  3AFH A;  2L7K A;  2XF7 A;  3EPZ A;  4B47 A;  2VQL A;  3K10 A;  3DTI A;  2LBF B;  4XL9 A;  1QHG A;  2CH0 A;  3V42 A;  2CV0 A;  1G8X A;  5TGT A;  2CUZ A;  2K9L A;  3M1C A;  4HPQ A;  1X1A A;  3DTK A;  2KDO A;  3G2B A;  2DJI A;  2QKM B;  3GBG A;  4NUB A;  4PK4 A;  3DTE A;  2VQC A;  1BR1 A;  3MKZ A;  4R79 A;  3ZQQ A;  3DWL E;  1X1C A;  4AYB A;  2HNH A;  3EUH C;  1S9H A;  2VKH A;  4J00 A;  2IS4 A;  2P0W A;  3SZG A;  3NWT A;  4BEH A;  2RRE A;  2X85 A;  3DU6 A;  4XNF A;  2GOX B;  3OWT A;  3K70 C;  4LIV A;  3E1S A;  3VYR B;  1X1B A;  3VYU B;  2HU9 A;  4EAT A;  1MNE A;  3F9K A;  3MKW B;  1UAA A;  3SEQ A;  3IUO A;  4IKF A;  1Z21 A;  4RM2 A;  2UWM A;  4HNU A;  4LIT A;  2PJR B;  3FDY A;  3S32 A;  2BW3 A;  4F3Q A;  1Y56 A;  2WAQ A;  2IGN A;  2V9K A;  1BOB A;  2CS3 A;  2VKD A;  3QYB A;  4OWR B;  1U0J A;  1T95 A;  4PJM A;  4BQO A;  4KJZ A;  3PL8 A;  3H9Q A;  3OR1 C;  4Y4R A;  4AU7 A;  4BE2 A;  2X1E A;  4PSW A;  2OV7 A;  1EA3 A;  1UG0 A;  3N05 A;  1HA8 A;  4C2T A;  4XR6 A;  4YRV A;  1MW7 A;  2HZD A;  5HNH A;  3K4B A;  3OYL A;  2JSP A;  4LIU A;  2V7F A;  1D0X A;  5JHF A;  2W7N A;  3I9V 2;  4DBR A;  3KX2 A;  2WBM A;  3LMM A;  2Y0S A;  4PJJ A;  3L2W A;  4N4N B;  3VYS B;  3PFY A;  4XKV A;  1IRX A;  3E0J B;  3OOU A;  3A2K A;  2XAU A;  1TZL A;  3HPG A;  3PJR A;  1Y6I A;  3H9G A;  4XLH A;  1X4P A;  4BS9 A;  2LC2 A;  3J7A Y;  2JVH A;  4E4H A;  2L9S A;  2VJI A;  2M7A A;  2BVL A;  1D1A A;  3QYE A;  4BJT A;  2RQQ A;  3TBI A;  4B43 A;  5CQG A;  3OYD A;  1BR2 A;  3BC8 A;  1SAU A;  4XM3 A;  2MAB A;  3HOS A;  4DJA A;  4XON A;  2R7V A;  4IZZ A;  2V1N A;  2M7B A;  2KRC A;  2IS2 A;  4JOM A;  1OR7 C;  2M3A A;  3EUA A;  2V26 A;  2CV2 A;  2F4I A;  1SFK A;  2IGK A;  4ZDO A;  4Y3O A;  4AVZ A;  3CP8 A;  1FMW A;  2CMP A;  3D5L A;  1T0F C;  4HNT A;  4XKC A;  4PFO A;  3S3M A;  1LKX A;  4XLF A;  4BL0 B;  3KEY A;  3LSM A;  3OIP A;  2VJ5 A;  2O5R A;  1PJR A;  5HOO A;  4CUG A;  3CZ6 A;  4P1W A;  2VXZ A;  2R7R A;  3PUB A;  3DKX A;  4C30 A;  2VQH A;  3QYF A;  3L2V A;  2R7T A;  2R7X A;  2HPI A;  3DPT A;  3PNT A;  2JUG A;  2LOO A;  3L2R A;  3MD2 A;  2I8D A;  3K4C A;  3DKY A;  1WJC A;  1DP3 A;  4B44 A;  1Z3Y A;  4ZDL A;  3K4L A;  3VWB A;  3K4M A;  3D5R C;  2L9N A;  4HG2 A;  4CCM A;  4E7S A;  4J01 A;  2HVS A;  3TL4 X;  2KMU A;  1X19 A;  2E1M B;  2VPL A;  2XF5 A;  2FUG 2;  2QKL B;  5LD2 C;  2LRE A;  2IGO A;  2LY2 A;  2LYC A;  2VB6 A;  3DPU A;  4BQN A;  4DGW B;  4CSW A;  2RNG A;  4BQQ A;  3IP4 B;  4XLE A;  3H5R A;  3S3O A;  2R7W A;  3OL3 A;  1N78 A;  1D0Y A;  3CMM A;  2OUM A;  2Q1Z B;  1QU3 A;  2MD0 A;  3HC7 A;  4DOZ A;  4ZTF A;  1G59 A;  4QPO A;  1D1B A;  1JI8 A;  2L2O A;  2XSJ C;  4G6T B;  3W3C A;  2V4J C;  3OMY A;  3H35 A;  4BJ6 C;  5HLT A;  2CFO A;  4BUP A;  2M4K A;  4XQF A;  2GOM A;  2XDV A;  5KCM A;  4QPQ A;  4HSR A;  4ZDP A;  4C9Y A;  4BDY A;  3LSH A;  2R7O A;  2KL4 A;  2K3P A;  2MYS A;  3PNY A;  2NOJ B;  3K4K A;  4E6K G;  3ONQ A;  3ZRG A;  4E7I A;  2OC6 A;  3OYM A;  3UNG C;  2VQG A;  3K70 D;  3BG6 A;  3VYT B;  2LBF A;  3OYI A;  2R7Q A;  2F5V A;  2ZSH B;  5FRM A;  3UR3 C;  2HQA A;  2X1C A;  1P9Q C;  4F92 B;  3MKY B;  2DT7 B;  1WJF A;  4CCJ A;  3CJR B;  3W2V A;  2XC7 A;  1WJ5 A;  2CW8 A;  3HXL A;  1DGW Y;  4XOT A;  2Z16 A;  3HUG B;  2M4G A;  3A1Y A;  3S93 A;  2LRD A;  2XF6 A;  3LFU A;  1WFX A;  5LFA A;  4XN0 A;  5CPR B;  5HNF A;  4CCK A;  4F55 A;  2R4G A;  4RM3 A;  2VJJ A;  1FMV A;  3I3L A;  4OAY A;  1WJA A;  3OYA A;  2DCE A;  4IQJ A;  2L5Q A;  1MND A;  3AL0 B;  4Y33 A;  1DQU A;  3K6G A;  1YE9 A;  4XLA A;  4PJN A;  2PMZ A;  4II2 A;  3FKJ A;  3CJQ B;  2WB1 A;  2WY7 Q;  4BEH B;  1V5E A;  2X1D A;  3OIQ A;  4XKB A;  1W36 C;  2DT6 A;  4XN3 A;  2PJR A;  1K6Y A;  2IS1 A;  2Z1D A;  3H5A A;  3ZCO A;  2VLA A;  3BCB A;  4LG3 A;  4CH7 A;  1WJD A;  2WA0 A;  4XMY A;  2IS6 A;  4NC8 A;  3QOD A;  3LSK A;  3EUK L;  3CES A;  4HEA 2;  3VSK A;  2R7U A;  1R6R A;  2VXD A;  1TT0 A;  2UV1 A;  2AQE A;  3PSF A;  4E7K A;  2BW3 B;  3NWS A;  2W82 A;  1ERD A;  5KNL A;  3C2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...