2MABA

Untangling the solution structure of c-terminal domain of aciniform spidroin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
PSFGLVLNSPNGLRSPQAKARINNLASALSTAVGRNGVDVNAFTSGLRATLSNLGDSGMSPNEAKVEVLLEALTAALQLLSSSTLGAVDTTSIGLTSNSVSKAVAQALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACINIFORM SPIDROIN
publication title Structure and function of C-terminal domain of aciniform spidroin
pubmed doi rcsb
source organism Nephila antipodiana
molecule tags Structural protein
total genus 31
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mabA00
2KHMA 2MABA 2K3PA 2MFZA 2M0MA
chains in the Genus database with same CATH superfamily
4B4CA 1SMYF 3IAS2 4S05A 2L9VA 3X2QH 3GTMJ 2CS3A 2TRTA 2QENA 3LAJA 3ONQA 4YFXF 1TLHB 2KHMA 3CQZJ 3VDXA 4II2A 2IJLA 2L9SA 1IZ1A 3FM5A 3K10A 4S04A 2JSPA 1O3RA 2O0YA 2LH9A 1B8IA 2L5QA 3TO7A 2F5FA 4IO9F 3OIOA 4HA8A 4UUSA 3JRCA 5J4YA 1G3YA 1S8NA 4LIVA 5E1ZB 2EV0A 1REPC 2Z2SB 3V7RA 2MH9A 4BHPA 2XAGA 2VC1A 2YSRA 2YX4A 2ZCWA 2WB1N 4AD9A 3G2BA 1R5ID 4L5IA 3ZMUA 4D1QA 4MLOA 4PJMA 3DP7A 1T0FC 1ZG5A 5LD2C 4IHWA 3L1PA 2H09A 2IGMA 2WTEA 3M9AA 1O7LA 1D8KA 2LY2A 3LA7A 4E7SA 2CG4A 4F55A 5IOYA 3CMMA 1U9OA 4EJVA 3CCRI 3FXKA 2FOKA 2NVXJ 2FXAA 2VASA 1B1BA 4OAYA 5F0CA 2CV1A 3KZZA 4RB0A 2FX0A 3MVPA 2A68F 1ZGWA 2J5PA 2LY1A 2ID3A 2K9SA 1BL0A 3S2DJ 5A2QZ 4UUVA 2EV5A 3K4BA 1R9TJ 1ZLJA 2VODA 2ZSIB 4CH7A 2KLOA 4Z2YA 4CYCA 2BBYA 1BOAA 1ZK8A 2OBPA 4YFNF 1YX5A 4NHJA 2F4IA 1X3WB 2PFBA 5DM6F 3EQLF 2COMA 2JUGA 2V6CA 5L3FA 2UV1A 3OWTA 1IN7A 2CRGA 2VQHA 5JVTA 4I0BA 2H8RA 2HOEA 2MYSA 2HPIA 3M1EA 2QCOA 1ZG3A 1RESA 1IRXA 2VQCA 1Z9CA 2M7BA 3BTIA 1TNTA 5J1RA 2M4KA 4F52A 4QPOA 2XRNA 1A31A 5CQEA 3EUAA 1YS6A 3E6BA 4AU7A 4QSHA 3K4CA 3O2PE 5LHIA 1WJAA 4ASNA 1JTYA 1I1SA 1ZAOA 3AG2H 2MA3A 2ZC2A 4PFOA 3H36A 3AL0C 1SFUA 5HDGA 3TP3A 3HRUA 1J09A 2QQBA 4ZDOA 5C3EJ 3BZ6A 2M9HA 3ABUA 3WTZA 3D5RC 3LSPA 4OINF 4IRGA 4P9UA 3RKXA 3QP6A 1W4MA 2MG4A 2R7ZJ 2EA2A 2HDCA 5GTHC 1VQOI 5GAEJ 3CUQB 3BROA 1UHWA 2IA0A 2DOAA 3PQJA 1MBFA 3P5JA 4BQNA 4AVPA 3OOUA 3TDUC 4EVIA 2EBIA 2R5YB 2KISA 3FMRA 3MEXA 1YG2A 2WAQN 3DPLC 3QOEA 1I6HJ 3J81Z 2D45A 1SVMA 4UB6C 2ESNA 2A61A 1E17A 2H6CA 1IXCA 1RZ4A 3K7AJ 2QUFA 5F08A 4M3EA 4Q47A 1JHHA 2A6HF 1YOVB 2VPRA 5AIPA 2A69F 5GADJ 2GBYA 3R4KA 3OIPA 5JVGF 1BR4A 3HPHA 4II3A 2IEKA 5LGUA 2Y9YA 1W5TA 2NNYA 4CHUA 4G9YA 2WV1A 3FK7A 4MTEA 4LD5A 2CSOA 2QSGX 2VL8A 1IN8A 1JUSA 4NBQA 3N97A 1LEAA 2E5NA 3L00A 5FFZA 3LFKA 2HYFA 3KYDB 4A6EA 3T1BA 3WHBA 3HM5A 2O3FA 2HVQA 5TJJA 1QPMA 1U78A 4Q4ZF 5F27A 2LR8A 3BG7A 4EQQA 2LF7A 3V42A 3WGGA 3ERED 1XCBA 2M0CA 1AOYA 1FLIA 2JVGA 1NHAA 2CWEA 2F5CA 3DKYA 3GCMA 4XR6A 2HYGD 3K1NA 3ZCOA 2CQKA 3H1CA 4A6DA 3LSJA 3GWZA 4F92B 3PNVA 5AIQA 3RQIA 1F36A 4EM1A 3BJAA 2WC2A 1R71A 4Q48A 3SFZA 2M8EA 2XHKA 4HYEA 3Q9SA 3IKVA 1HOMA 4A3JJ 4Y3OA 3KZIC 4U0YA 4FETA 1LUJB 2QSHX 5BOXA 3MFKA 3BR0A 3CLOA 4N4OB 3J7ZI 2ZB9A 1Z6TA 2EZHA 4HPQA 3PL8A 1DU6A 1IRFA 5CKTA 1HLVA 4RGXA 1Z21A 4LLLA 4LK0F 1FBSA 3WTSC 5HLHA 2A6EF 1QHHD 3K9TA 2FOWA 3ZQQA 1X19A 2JA2A 3WE3A 1SFXA 1F9NA 2M4GA 4ESBA 1FZPB 2EA4A 3WE2A 3CCLI 2LVSA 3SXYA 1J0RA 1WVRA 2ETHA 4O6JA 1SD6A 2QZ8A 1BI0A 4L5JA 3MKZA 4HAMA 2CFXA 2CUZA 4KIFA 3RI4A 3QU6A 2BXYA 3G1OA 1OLTA 1XGSA 2RQPA 4XIDA 3H92A 4PDKA 3FDYA 4J01A 2IS4A 4GYGA 2ZJ2A 1FEXA 2FSWA 3ASOH 1AU7A 1MNEA 1RETA 4HNUA 3CJTB 3VEPA 3P9CA 3FBNB 5C4JJ 4CO8A 1I1GA 1RI7A 2FF4A 4A3FJ 4L0ZB 4LB5A 3A2KA 4IHTA 3F0CA 3R61A 5E3NA 2HKOA 2DFEA 2E1OA 5DCMA 3A01B 2STTA 4LG0B 2VKVA 1QNTA 3KLNA 3K70C 1YRNA 1SC7A 3K4LA 3KP4A 4A3CJ 2QM3A 2DDBA 3IHUA 4CCNA 1XS9A 1D1BA 2EPFA 3U1DA 1FT9A 2OC6A 3CTAA 3C2BA 3HG9A 3LSGA 2V1UA 4XLCA 3KE2A 2BW3B 5E3LA 2PBIA 2R7OA 3E3VA 3OYJA 3I0TA 3F8NA 3RPUD 4BJ6C 4R79A 1OYWA 2O8XA 1I50J 3E1SA 3CC2I 1Y0UA 5EG0B 4XKCA 3JRAA 2DYSH 2HNHA 3K0LA 4HRIA 5K1YA 1ZQ3P 1USSA 1HXDA 1YHQI 3K4MA 2XVCA 2AXLA 4UB8C 1QA6A 2NS0A 4B3AA 4KJZA 1VQ7I 5FKMA 2LNBA 3IH2A 4U7BA 1UG0A 4M9SA 1H8AC 4X6AJ 1QZZA 1BBYA 4GRIA 4BJTA 3DTIA 1MMSA 1GVJA 4RAGA 2RNGA 1DGRM 2L2OA 1KU9A 1P7IA 2QQAA 2V26A 1U5TB 2PMZN 3RPUA 2EK5A 4G6TB 2XPUA 1RNLA 4G94A 1LFBA 3W6VA 1G3SA 3SHFA 3ABKH 2X4HA 3DWLE 5EF6A 4WF2A 2P81A 4UVCA 1PJRA 1UMQA 2QYOA 3GLXA 4NQWA 5EGOB 4I6ZA 3TBIA 5LFAA 2ISZA 3WU0A 2HYJA 2DMNA 3G1MA 1UFMA 1LDKB 2XAUA 3SEQA 2FBHA 3BR2A 3ABMH 4RLFA 1K6YA 2VJIA 1SVLA 1T2KA 4KNYA 4I0AA 4YIRX 2P7VB 2XPVA 2GAUA 1DPRA 1MDMA 1BM9A 2VN2A 2DA7A 2RQQA 2D2WA 3BPVA 1BJZA 4RB3C 2OZUA 1N75A 2AHQA 2I5UA 1Z7UA 3TGNA 4KA4A 1OQYA 3I59A 3EYIA 2DOFA 3OS2A 2QGUA 2FRHA 4F93B 5IPAA 5F0HA 1UHMA 2IA2A 3WG9A 1Y0NA 5D4SA 3MKYB 5D8LB 4ESJA 3FXOA 3F8FA 4DNCA 4BBSJ 4OIRF 2V6EA 1TP4A 1WJFA 2DU9A 3LA2A 3GTPJ 5CVUA 2F5VA 2DO7A 4CA0A 1OMIA 2L7MP 3HHGA 5E79C 1T56A 3BCBA 1P4XA 4IHVA 2K27A 1BW5A 3HRSA 1N25A 2MD5A 4FE4A 1EKEA 5FROA 4UNOA 3FXMA 3MZ8A 3R60A 2R0QC 2JMWA 1ZRCA 3QWLA 3DPUA 4B47A 2V9VA 2ZNZA 4BY7J 3J80K 1WWXA 3MCZA 3DBLB 3HDDA 2MFZA 2L54A 4RS8A 2Y9ZA 4RGRA 3CCVI 1MGTA 1UHSA 3HUGB 3PO2J 1H9TA 4XONA 3I5UA 1PUEE 1V54H 1VI0A 1FP2A 5ILUA 3JRDA 4RBOA 1MMGA 5KVRA 3P9IA 1Z0XA 1XD7A 2B9SA 1HC8A 2K9MA 4M71A 3OV8A 2R7XA 1XGNA 4TV7A 2IPQX 2AQEA 3ZMTA 3O8GA 5E8GA 3CZ6A 3HSFA 5M5WJ 4EJUA 2COBA 2I10A 3BOQA 5HDKA 3T0YA 5F0FA 2NXNB 4RM3A 1IRGA 2CYYA 3HRMA 2XAJA 3EPZA 2DFFA 4Y7NJ 2Z16A 2E5ZA 3E5XA 4NDLA 5K7FA 2JK3A 3K69A 2KPMA 4MEXF 3VYSB 4KDPA 1ZGAA 3F6OA 5EJCA 1Y39A 4M73A 2WAEA 3PNTA 1L3LA 1USTA 2H8WA 2M0MA 5FKNA 2ISYA 4HSRA 3I56I 1FMWA 5LEJA 2XASA 3E0JB 3FM3A 1FOKA 4GDFA 3GZ6A 4A5MA 2R7TA 2ELKA 2FD5A 1HKSA 2ADUA 2D5VA 3F72A 2XB5A 5HS7A 3M1CA 3MKLA 3RQ4A 1K61A 4ESFA 4E7LA 2HI3A 4HF0A 1ZYRF 2NS7A 5FRMA 2BVMA 3LA3A 1B72B 1LFUP 4LFUA 2AS5F 3B6CA 1A5JA 3DPTA 1BW6A 4RB2C 4CGZA 4J19A 2GXBA 1TWGJ 3W2AA 1WHUA 4DYCA 4XBFA 2DJIA 4Y17A 3IWFA 5FLVA 5J47A 5C44J 1QVUA 1O7FA 1W0TA 1T0FA 2VLAA 4YFKF 1TBXA 4IX7A 3GW2A 3CJNA 5CJ9A 3S32A 1X1BA 2OPTA 3N05A 4KIBA 5FLMJ 1IG7A 4ZDPA 5CVVA 1WJDA 3ZOBA 4BHBA 2KZGA 5DTDA 3T5XA 4HNVA 1OYIA 3AG3H 3H5AA 1OCOH 3HB9A 3G71I 2ZFUA 3ML6A 1I6XA 4C2UA 2K9NA 2G7UA 1SFOJ 3ECHA 1ETVA 1U8BA 2ZJQF 3QPHA 2E1MC 4A3KJ 1JJ8C 2R92J 3OL4A 2QA4I 1VQNI 5LRRA 4HLYA 3L7WA 3HC7A 2BEOA 4UVAA 4ANJA 5FLXK 2DT6A 2G7HA 2HVRA 3WU1B 4BNCA 5TISC 3ISPA 5FFXA 2DW4A 2VIXA 2DPUA 2W1OA 3H3ZA 2ZFWA 3G3ZA 3QODA 1JT0A 1JJ6C 1RC9A 3LQRA 2VJ4A 3BP8A 5L3DA 4IOCF 4M3FA 2VT3A 1IN6A 3HGGA 2DI3A 3V7CA 2K3FA 2CH0A 3CCYA 2GWRA 5DUIA 2QBYB 3RDIA 3PUFA 2EV6A 5E3MA 1G8XA 5F1RA 2FEZA 2MC4A 4P96A 2PG4A 2JA8J 2UXXA 4ZDLA 2G0EA 4WXCA 2UXNA 4HV5A 1BIAA 3DTKA 1SAUA 5HOOA 4XKVA 3N4MA 4OIQF 4CCKA 5FKKA 3FK6A 4BQAA 5GP9A 1IC8A 3L09A 4H4KC 1LJ9A 4BGDA 3I4NJ 3J7AY 1ONVA 1Y1VJ 3CJRB 1WRJA 3Q3SA 4CICA 2GLOA 1OISA 3QAHA 4G12A 2ZSHB 4Y13A 3C2HA 1ETOA 4MFDA 3CMYA 5C4XJ 3ZN0A 3OYMA 3REOA 5ILSA 1MJBA 4AC0A 1D5VA 3PFYA 3Q0VA 4ENMA 5J3LA 3UNGC 2KJBA 3CCMI 2JSCA 4XSZF 3ZXSA 3PSFA 1FYMA 1D8JA 3K6GA 4C3HJ 4EEFG 2LD5A 3S2WA 5KHDA 1SD5A 2X6YA 2K9LA 1WJEA 2DT5A 2P8TA 1MSEC 4IHXA 4A3EJ 1XCVA 1YJNI 3ELKA 1IW7F 1AKHA 2L7FP 5B3SH 1S72I 2R7FA 5LLQA 3IKTA 2X1CA 2Z99A 3FISA 4RA2A 2R3SA 3DU5A 2B0LA 3C7JA 2H1LA 3G73A 1ZN2A 3TMOA 1YS7A 3CF2A 2RREA 1B9NA 4U0VA 3TOBA 1P4WA 2MC3A 3CCJI 5CQGA 3V7SA 1U8RA 5D5VB 3E5QA 3M07A 1S6LA 4CSWA 1SFKA 1Z1DA 4PJNA 1B4AA 4XLFA 4XRSG 3HPGA 2X85A 2LBFA 4HOBA 4HQMA 4IHSA 5H6RA 1W5CC 2NVTJ 2DA3A 2QQ9A 2JA5J 2EZKA 2ZMEB 3MZHA 4BY1J 2UWMA 2P7CB 3SDBA 4DYQA 2LC2A 1FOWA 3FZVA 3T8TA 2CUEA 2K3PA 2XPWA 1QO0D 4HX8A 1QRYA 2A5YB 1PUFB 2Y48A 5FD6A 3W3CA 4Y15A 1YQAA 2DAOA 4ZJZA 4KYWA 5FD5A 1BJAA 4KMUX 2DN0A 4B3XA 4IHYA 4FX4A 1IO2A 1G6NA 3H5RA 4IF4A 2R7QA 3NWTA 1FWZA 5K5QA 3CF5F 3IC7A 1BI1A 3TQNA 2H6BA 4OMZA 4GO1A 1K78A 4IQJA 1DP3A 1CGPA 1ZTRA 3HL2A 2HGCA 2P6TA 2HKXA 4PJ0C 3HBLA 1WKMA 4V2FA 4A0YA 1ACIA 4ZYEA 1CF7A 3V8LA 3RYPA 2HQNA 5H20A 2DMUA 5BPIA 1DGWY 3BR6A 1FY7A 4BEHA 3PUBA 3K70D 3MWMA 4GYIA 4HZFA 2M8GX 4UUTA 5A2QK 5K5RA 2JPBA 1HBXG 4PZJA 1H9GA 4L9NA 1ETQA 3FMQA 3H0GJ 1KZHA 4ZZDA 3DEWA 5F6FA 1LVAA 3GFIA 3CO7C 3VSKA 4HF2A 4JOMA 1E3PA 3LSTA 4PUSA 1S7EA 1S5LC 1E0EA 2YU3A 3PO3J 2KZVA 1R1UA 1ZRFA 1OCZH 2EH3A 3DTEA 2CV2A 4PJLA 1MIJA 2X6OA 1UZCA 1R1VA 1B8IB 1ORKA 1NG6A 2IVMA 3B6AA 3I9V2 1J75A 1TW3A 4S0HB 4GCVA 3V8JA 2E7XA 3QQAA 4E70A 4UUSB 3GFLA 1LKXA 4E4HA 3KP5A 3OYBA 1RKTA 4IRIA 2KRHA 2IW5A 4LK1F 2A5WA 3GVAA 5BS6A 1QZYA 4E7JA 1OPCA 4XN3A 3NWSA 4U87A 1SANA 5DD8A 5FO5A 3MQ0A 1XSXA 4LGWA 5D5UB 3H9GA 3A1YA 2CJJA 3DBHB 2LKPA 4FHTA 2Z5UA 3OYFA 3LSRA 2UUZA 3OOPA 4FISA 2C6YA 2OTLI 5JLWA 3C3WA 1S29A 2CGPA 3CDLA 4I02A 2VJJA 5DYMA 4MEYF 3KEYA 2E36A 4L0YB 2QVOA 5FKOA 1LVKA 3RKWA 2OD5A 5JHFA 4CDGA 4HBLA 4CYCB 2EFNA 1CQTA 1W36C 2IA1A 2XGCA 2ME0A 1KYWA 2ICWG 3HTUA 5J4VA 4JQFA 1JKRC 2BV6A 1T95A 1E3OC 2Y69H 1TW2A 3J81K 1FBUA 5ICCA 4NC6A 2IS2A 3D1NI 2W00A 4BS9A 1FBQA 5ICFA 3JR9A 2NAZA 4LOCA 5M5XJ 4A3GJ 1SD7A 3CUQC 4C2TA 1FTTA 4KITB 3BG5A 1R23A 1K7AA 1S9HA 5L3EA 2E7WA 4RGUA 1TNSA 2M87A 3RKYA 3S1QJ 1OCPA 1LDJA 2D1HA 4KT5C 2FU4A 5JR3A 1ON1A 1TTYA 4WCGA 3Q0UA 5J8CA 1FSHA 1JXSA 1QZEA 1B9MA 2F4OB 1LFPA 2HTJA 1KU7A 2X6WA 3HYIA 5L3GA 1T6SA 1A6IA 3JRIA 2QQ8A 4MQVA 1I3QJ 1YTYA 5LGNA 1RR8C 2X48A 1Y8QB 4HEA2 3GUDA 3IAM2 4M72A 2K40A 3LWFA 1LE8A 2JRMA 2RKHA 3TEDA 2KL4A 1MKMA 4AYBN 1MNDA 2H94A 4A69C 1OCCH 4HDUA 1WFXA 4YG2F 4EJOA 4AIDA 3K2ZA 2GOXB 2OUMA 3M8JA 3I4MJ 1FOXA 4BE0A 5IYBJ 3BTCA 5LBQA 2QKMB 4G6QA 1P6RA 1ETXA 4BDYA 4RAZA 4ZTFA 3DQVC 3SQNA 3PIOF 3IH4A 4OU0A 4N4NB 4X0GA 3U1KA 4MFEA 2MLKA 1TT5B 2XDVA 4G8XA 5CVIA 4DZJA 3GTLJ 1ODDA 5GAHJ 5H6QA 3GLLA 1HSJA 4L5EA 1SVOA 5M3FJ 4LMYA 1UB9A 2JRTA 3FXJA 4X1EA 1U6GA 4BKXA 5CVJA 4I98B 2M34A 4GXOA 1YJ9I 2GZWA 2XC7A 1Z77A 4LB6B 5IYCJ 5EDNA 1QHGA 3WODF 1TZLA 4AVZA 3ECOA 2A3SA 2F4MB 2PMHA 1NTCA 2OZ6A 2VC0A 3UKGA 3CC7I 3V8KA 2G9WA 2MBFA 3P9KA 4V2GA 2ACJA 4EV0A 1WCMJ 5B5EC 2V4JC 4BACA 1GV5A 1HQCA 2Z1DA 3KEQA 5DV5A 2Y30A 4PJJA 1TQIA 4M9XA 2CFOA 1XX5A 2MLGA 5FJ8J 1NH3A 2HQRA 3S1MJ 2DMQA 1WJ5A 3BTJA 3VFZA 2W4SA 2J5OA 4A93J 1POGA 2RAEA 2ECBA 3ASNH 3JRHA 3KEOA 1WGXA 1LQ1A 5FKLA 1BI3A 1ZELA 3HSRA 2K9QA 2VQGA 2LKSA 4I01A 3M8FA 1TWCJ 2X6XA 4IJAA 5TRDA 3S3OA 4ZYAA 4B1RA 3S1NJ 1HW5A 5BNGA 3HSEA 5DEQA 2HR3A 4P5OA 1IN4A 4FE7A 4M6XA 3F9KA 5H2FC 3KETA 2H27A 2NYXA 5LEKA 2Q0OA 3HOUJ 1GDTA 1K4TA 2P5KA 3EUHA 2XRLA 1M1EB 2LYCA 3BG3A 1VQ4I 3R6SA 1WPKA 2DOEA 3RYRA 2L3DA 1Z3XA 5E1WA 3TO9A 1RIOH 4A3DJ 3HUGA 4XORA 1Y8RB 3CDHA 2AQFA 2M30A 3TP0A 1V5EA 5HS8A 3BTLA 4B43A 3KX2A 3JRGA 2OQRA 1OYYA 1ZREA 2E19A 4M3BA 3TL4X 3WTUC 3FX3A 4N9IA 1TWFJ 4ON0A 3SZPA 2Q2EA 1B6AA 4RLQA 2FJ1A 1SFEA 2R4GA 4NNJA 1GXPA 4A12A 4IXAA 4XLPF 4KIGA 4EATA 4O5VA 1KYZA 4BAYA 1TQMA 3M3YJ 2L7KA 3GYHX 3I3LA 1UCRA 2XV4S 1RUNA 4IOAF 2HS5A 3SZGA 3LMMA 2W82A 2LP0A 1XSDA 3QRFF 2E2JJ 1IRZA 2P6SA 2W24A 4CCOA 2XAFA 1SAXA 3JW4A 3A0BC 5DCMB 3C18A 2IAIA 3HOWJ 2HU9A 1OFCX 3RSNA 2FBIA 3A02A 2JVHA 4MHGA 4DBRA 1IAWA 4E7HA 3H5NA 1U5TC 1TL8A 4GGGA 1V55H 1YRNB 3LSKA 3NQOA 2ESHA 4FASD 1X4PA 4U88A 4ZYHA 1BC7C 1FIAA 2R5ZA 3ZMZA 3Q9VA 1DDNA 3AFHA 5IT3A 3CDIA 1XTAA 3DU6A 5HDNA 4OMYA 3HOVJ 2QWWA 3HRTA 2KP6A 2BY2A 4C9YA 2TDXA 2VI6A 3FKJA 3AKZA 4ENKA 4XLEA 1EF4A 4JP0A 3FXLA 3IUOA 3ZQGA 5B1BH 2OF7A 3HKZA 3E6MA 1IDZA 2IS1A 1G4DA 2MABA 1A04A 2O61A 1UAAA 2V1XA 2VBZA 3CCUI 1OKRA 2X9DA 2GA2A 4YIFA 2N8GA 2EILH 4E7KA 4AM3A 1MBKA 1YYVA 1U2WA 4FT8A 3I71A 4UHTA 3GXOA 1X1PA 2EWNA 4QLCU 5D4RA 1VQ6I 4B48A 5IT9Z 5IOZA 1O3QA 2DXIA 1LDDA 1FNNA 2RC4A 2LF8A 3O8HA 5EZGA 1GV2A 1D3YA 2ID6A 3PSIA 1YW7A 3QU3A 1VNDA 2QLZA 3DFGA 3G6EI 4L9JA 3K4NA 3F23A 4OIOF 2PJRA 3ZQ7A 1G3TA 1P7JA 5D6FA 4BQOA 4OAZA 2HVSA 2GQQA 3I4PA 5E17F 2BY1A 2BZTA 4XLAA 2Y31A 3BR3A 5LGTA 5GPAA 3GBGA 5EEHA 4NQWB 2YU9J 4P55A 4XMYA 2E71A 1Z3YA 1Z05A 3CP2A 3F22A 1GVDA 3JSOA 4RM2A 3WGIA 2GXGA 4PGGA 3JTHA 4G6DA 2GIVA 2VE8A 2O03A 2DK8A 2QEXI 3IL2A 4YIIA 2M3AA 2KIFA 4IQ4A 4IL6C 1MDMB 3H0DA 1ZR2A 4Z6YA 1EH6A 3OYNA 3C1DA 3KCCA 2BOLA 1T38A 6PAXA 2OJED 2XAQA 3EUHC 1GT0C 1Z6RA 2HPMA 2XGXA 2KIQA 1D1AA 5K7ZA 1PDNC 2HOSA 1W7PD 4XKWA 1JE8A 1WH7A 3F8BA 4EGZA 3GTKJ 3E7LA 4XRMA 3I59B 1HSTA 1O4XA 3HTSB 5ILVA 3ULQB 5KAFC 3HEFA 2DDAA 5HS9A 4DOZA 4D9JA 4IRHA 4XK4A 4BYYA 1MMAA 4EM2A 3HOXJ 1ZG1A 4M74A 4UXNA 2HZTA 1D0ZA 2FQ3A 1J5YA 1YO5C 1NK2P 2V9PA 4PSWA 3RZOJ 2KKOA 1WSUA 1QQIA 3CCSI 1ETYA 4H0EA 3D5LA 3BQYA 3LSMA 2X0LA 2VOPA 2KIMA 3CD6I 2A05A 2P5VA 4B8XA 4LJZF 5JHUA 4CXFA 4WX9A 5E18F 1F1ZA 2VBXA 3VYUB 1W7PA 1F4KA 2DFIA 2LLKA 4M3DA 1V5FA 4XLNF 2FQ4A 2XUBA 3ERMA 1P4AA 3PNYA 2A6TA 2RGVA 2RV8A 1RRJA 2P4WA 2HDWA 1IGNA 2X1DA 3IWZA 1XSVA 2OV7A 1BOBA 1YE9A 4AIHA 5F1JA 3L2UA 5BMZA 1W0UA 3EYYA 4Y52J 3LL7A 3GTQJ 2E1CA 3CP8A 1R49A 2V7FA 2IXSA 2F6CA 1N77A 1J59A 2FUG2 2OA4A 3JAMZ 2QF7A 4ZYGA 2EINH 1OJLA 2LOOA 4UVBA 1D0YA 2PX9A 3QPSA 3TW6A 3VB2A 2DJNA 5HNHA 2K4JA 2OAZA 1FYKA 4AIJA 2IBDA 4EJWA 4G7OF 2LG4A 4HLXA 3GTGJ 2IS6A 9ANTA 4O3MA 4BDZA 2B63J 1JT6A 3BR5A 3EDPA 2OU2A 3LOCA 1FP1D 2CQQA 4QWQA 3GFMA 1JKQC 5F04A 4I99C 4XOTA 3CMAI 3CCQI 3H35A 2F5EA 3HZJA 1A36A 2L4MA 1JTXA 1OR7A 3MN2A 3ZQFA 3GF2A 4HNTA 1X1AA 2MH2A 1KQ8A 2E2IJ 3ZPLA 4CCLA 1P2FA 1K4SA 3AG4H 4CZZA 1W5SA 3W6JB 2JN6A 2L9NA 3DF8A 3JAMK 4BJ5C 2AO9A 2MGQA 2Y0SA 4G7HF 2L7ZA 3FMSA 1TQPA 2ELJA 2Z33A 1FPQA 1EH7A 2XKOA 1SMTA 2BHYA 1LPQA 4YELA 3Q5FA 3OSGA 4KFCA 4Y33A 3BQZA 4CCMA 3MZYA 4ZZLA 3B02A 5CVRA 1X2MA 4LLNA 3WG7H 2BVLA 4A3MJ 1QPIA 4A3IJ 3BJOA 5F64A 5E3OA 5ICGA 1W36D 3PIPF 4M6YA 1TWHJ 4ENJA 1FIPA 4AIKA 3H9QA 1TC3C 2L0KA 1W1WE 2YX7A 2M5WA 3CUOA 1ETKA 4NC8A 2CU7A 4RMNA 2VBWA 2R7VA 4PGHA 4WWCA 2Y2ZA 3GTOJ 2VE9A 5LRSA 3D0SA 1BA5A 4XICA 3ZP5A 2V9KA 4LIUA 3OYIA 2RN7A 4R1HA 1VFCA 3P7NA 4OIPF 2B7EA 3K1MA 3L2QA 4BL0B 2LTPA 3RPQA 1IDYA 1ERDA 2DCEA 2VB6A 3LSIA 1X4OA 2JWTA 2MW8A 3KLOA 3V4GA 1MMNA 5L3CA 3U2RA 4HG2A 4XOPA 2XIGA 3IRQA 5EYRA 5HLTA 1YFHA 2WB1A 3IRRA 2KT0A 3CLQA 2BY3A 2FMYA 2YUSA 3CUQA 3GFJA 4PCQA 1BR1A 4PK4A 3GEZA 3BWGA 4EJTA 3U9GA 4HX4A 3RIRA 2R5YA 3SEZA 3VPRA 3VYRB 4V19K 2GOMA 3CMEI 4WXHA 2LFBA 4YRVA 1FYLA 1VQ9I 4F7ZA 4UY8I 1EJ9A 4U0WA 1IJWC 1IF1A 2DTZA 4IZZA 2CW0F 3FBIB 3HOTA 4L9TA 2KDOA 3CC4I 3KP3A 1R00A 2ZXWH 3W2WA 3SJMA 1AHDP 2WAFA 2JZYA 3S14J 1VQPI 1ENHA 3BJ6A 3ZMVA 1XG1A 2CQ7A 1XDSA 3AL0B 2M7AA 4MIMA 1MH3A 5GAGJ 5HODA 2NOJB 4A0ZA 2L9RA 2KFDA 2HXIA 3O3KA 3PFIA 1XGMA 1QU3A 3U21A 5J1UA 4JX4A 1XDUA 2MSYA 4JX5A 3RZDJ 3OL3A 4ABZA 3J7AO 2JT1A 1KU2A 3VSLA 3COAC 3RCOA 3FHNA 2PN6A 2JPCA 2DA4A 4QPQA 2E35A 3R0AA 1KA8A 1R1TA 1HDDC 2R93J 3VODA 3BT9A 4HSTA 3FXQA 4QTRA 2E2HJ 2DBBA 2ZMEC 3OS0A 3SDGA 4P9FA 3FIWA 1A6QA 2EFQA 5DM7F 4FTHA 4U7DA 2CW8A 2K02A 1OR7C 4I2OA 4XNFA 5BQTA 4DQ2A 5B66C 2NVQJ 5CLSA 5IP7J 4LITA 3S3NA 2VOOA 4CCJA 1ETWA 1AKHB 2R7DA 3HOYJ 1XMKA 4RAYA 4BU2A 2OCCH 1VQ8I 2IRFG 5IY5H 2PQ8A 2E1NA 3HOSA 3E6CC 1JKPC 3A4CA 3TDZC 1P92A 1X3ZB 4OOIA 3VOEA 4CUGA 1XMXA 4MGRA 2V1DA 3E6DA 4JYKA 3OR1C 3WTYC 3OS1A 3OYLA 3ZQIA 4XRSA 4LG3A 4BE2A 5HNFA 3K2AA 1S3JA 1Y6IA 2NOGA 4XL9A 1YIOA 4NUBA 4J00A 4EM0B 4NB5A 2LBFB 3OY9A 1FMVA 3K1PA 3GTJJ 2W7NA 1X1CA 2WAQA 2PLYA 1VF9A 4BXUA 2XF5A 2EB7A 1APLC 1DU0A 2DFHA 3RJPA 1DQUA 4ITVA 5LHHA 1GXQA 3PQKA 2WV0A 2ZKZA 3OYAA 3QYEA 3NAUA 1Z7LA 4N9HA 1D1CA 4D5FA 1JGSA 1X1DA 2EIJH 5KK1A 4DGWB 3NARA 5IP9J 4CZCA 4BXXJ 2HQ5A 5JI6A 1R7JA 2FE3A 4C3JJ 5E20A 2BHZA 3FHZA 1UELB 2YR2A 4HV6A 2EJRA 1HW1A 1KONA 3BCAA 5TGTA 4D7NA 1SD4A 2MD0A 1X2NA 3I64A 5E1XA 1IV6A 1FSEA 2Q1ZB 3A01A 1K78B 2FNAA 2A07F 4LG0A 3SFIA 2VKEA 1G59A 3FWEA 3ZMDA 2VONA 2XROA 3G4SI 5GTIC 3DCFA 1V5GA 5GPCA 2O5RA 1CF7B 5ED4A 4L9VA 3ZRGA 3KYLA 5K5OA 2EIMH 3FKIJ 5FGMA 2BW3A 3ZMSA 4JBAA 2ZO4A 2R7RA 3NEUA 1RKWA 2LK2A 1R22A 2F2EA 3DXJF 3SYTA 3GZNB 4BEHB 3GZ5A 5ICEA 2XF6A 1L0OC 1DUXC 2KMUA 5EG0A 5M3MJ 2XB0X 2LDUA 1MD0A 5D5WB 4B09A 4ETSA 2O6GE 2JTVA 3NRVA 1YW9A 3IH3A 2WBMA 1Z91A 2HWVA 5K7HA 3WTTC 1FC3A 2ZBKA 1ZH5A 2UZKA 2XSDC 1O3TA 1KGSA 2DA5A 2LMDA 3KP2A 4XQFA 1I27A 4A2UA 1HKQA 2EZIA 2OQGA 4A0XA 1HCRA 2IT0A 2EFPA 2X1EA 4NC7A 3BPXA 4AYBA 1IN5A 4I09A 2O7OA 1U5TA 1D0XA 1P9QC 4ZC3A 1U0JA 2GM4A 3G1LA 3S17J 1WJBA 3MKWB 2W57A 3DEUA 5HLGA 4DW6A 1U3EM 2LY9A 4A5NA 2Y0MA 2DA1A 5AONA 5EGOA 3OYCA 3WHCA 4AUXA 1IUYA 2R7WA 3CJQB 3GO5A 2NVUB 5D8KB 4RDUA 1XN7A 2L01A 3H9JA 2JA7J 1S7AA 2ZJRF 1QBJA 4RGSA 3S3MA 2ZJPF 2EIKH 3ZQHA 1MBJA 1MBHA 5HLIA 4ZH4F 2R7UA 1ITYA 2K4BA 3EUKL 4BHCA 3FXRA 2HFHA 4M9ZA 3BG6A 2STWA 2XSJC 4MTDA 2DA6A 3BLYA 2F5DA 3ABLH 1C0WA 5ERIA 1QVTA 5LHGA 4DYRA 3M7GA 4OWRB 3ZN1A 5DCFA 2JJ7A 5L3BA 1I5ZA 3UR3C 3T8RA 4D7MA 2HOAA 3F8CA 3WU2C 2M45A 4ZTJA 2NVYJ 4BQQA 3OSFA 4KN7X 1TWAJ 4HF1A 2CQNA 1R4MB 1E3HA 2D1VA 2DA2A 1MSFC 2ZNYA 2VT2A 4UV9A 4RAFA 2HEOA 1Q1HA 4W97A 5IP6A 3L2VA 2HZDA 2E60A 1PP7U 3TKYA 2HDDA 4JK1X 3I55I 2W25A 3RKQA 3ESWB 1LNWA 1WZ2A 2DPDA 2PEXA 2IGKA 1OCTC 3JSPA 4MNUA 4C3IJ 2CMPA 5FRNA 2XAHA 1YJWI 1MH4A 4PSXA 3KPHA 3LFUA 2V1NA 1H88C 3L2WA 3ROUA 4YEJA 2CW7A 2R7SA 4XM3A 3I58A 3S16J 1G3WA 1UG2A 2CUJA 2W48A 1YIJI 2BXZA 2PMZA 1MJ9A 1R5HA 1LE8B 2LSOA 1T98A 2CV0A 3M8EA 3TO6A 1J2XA 2BY0A 1MMDA 4DZPA 2E34A 3LQQA 1MNMC 4BUPA 2NNNA 1LB2A 3OYKA 2JA6J 2IGNA 1R4NB 3GX4X 2DODA 5M5YJ 2P5LC 3ZQLA 3M4OJ 2XGDA 1MW7A 3C2GA 3BY6A 5BPDA 2DT7B 1WI3A 2WADA 3MMYB 1IXSB 4KUMA 3CESA 3DKWA 4IEJA 2JQ7A 4IPAA 1DP7P 2PJPA 1R5GA 2K5CA 1Q1VA 3OYEA 2LKXA 2GA1A 3E97A 3A03A 1I3AA 1WH5A 5DDGA 1Y1WJ 2RDPA 1HA8A 1BR2A 3KP6A 3OYDA 2I8DA 1YI2I 2HQAA 2EQRA 1MZBA 4L18B 1WQ2A 1ON2A 5KAIC 5E8IA 2EZLA 4QIWN 1J9IA 2IGOA 3HOZJ 4XSXF 1J7KA 2BE5F 1O3SA 1PYVA 2QSFX 3D5SC 4BE1A 2ZXIA 1F5TA 5JFRA 1V3FA 3GMEA 2W84A 1IV8A 3I54A 1BC8C 2P0WA 5D5XB 2KDZA 5CYVA 2DYRH 2JUCA 3BZCA 3QPLA 1RPWA 1B72A 3K4JA 4XKBA 4G7ZF 1JUPA 4Y4RA 3J80Z 3ZGKA 1XGOA 2K86A 1EA3A 2O9LA 3KZYA 3OYHA 2H1KA 2VQLA 2WWYA 1U9NA 2BGCA 4IKFA 3A0HC 1XB4A 1R6RA 4M3GA 2LRDA 2FBKA 4KN4X 3DV8A 1V4RA 2GIZA 2ELHA 4XLHA 5KCMA 4HW0A 1SEUA 2M2EA 4KT6A 2DQRA 1PVEA 2CQXA 3JCUC 1K6OA 5DD4A 4EGYA 4CYDA 4F91B 3QYFA 4FCYA 2FA5A 1VQKI 1MBGA 1X3UA 5KNLA 2O8KA 3W6KB 1H0MA 3HKZN 2WA0A 1BI2A 4I7HA 4Q5SF 3JTGA 3SZTA 1FOYA 4A3LJ 1MJAA 3OMYA 1K83J 2ECCA 3WGHA 2EFWA 3OIQA 1BN5A 2Y75A 5J40A 2DMPA 3S1RJ 3S15J 3J7YJ 3LNQA 1DPUA 3HIFA 4FX0A 2OTJI 3H3VK 3B73A 1GLNA 4W1UA 4E7IA 1FTZA 1ZLKA 2PI0A 2DLLA 4WXDA 3WTXC 3QYBA 3BZKA 2W85A 2Q2EB 1Y56A 1PP8F 4C2MJ 1YW8A 3TOAA 5J6XA 4BXFA 3CO6C 4E6KG 2WY8Q 1IXRC 3AG1H 3HJEA 4ENNA 2CO5A 5IT9K 2QBYA 2VXZA 3TW7A 3FF5A 2E1MB 3L2RA 3ZQCA 2BYVE 1I39A 2NS8A 3VWBA 1NK3P 4MO7A 1STZA 2RNJA 2EFOA 5CPRB 4E7ZA 5EEAA 1GUUA 4HX7A 1KQ0A 2KRFA 5FB2A 1RUOA 4KISA 2QKLB 3CCEI 1JI8A 3HHHA 2DQLA 4IVNA 1HF0A 1YX3A 1Z67A 1JGGA 2TCTA 4BH9A 4M6VA 3DEEA 4ZYDA 4XRFA 5DS9A 2OCEA 4RB1A 1VZ0A 1VQMI 4FQGA 2HXOA 3KFWX 4BBRJ 3VYTB 4UV8A 4P1WA 2KQRA 4KICA 4XN0A 2R5ZB 4F3QA 2GXAA 5FLXZ 3BR1A 3DLLF 3QPTA 1R58A 1EH8A 3PJRA 1JUMA 4C30A 2WY7Q 2HOTA 2AXTC 3PM1A 2YS9A 5J1YA 3Q0WA 2VPLA 1LEBA 5HVQC 4EMSA 1D5YA 3F3XA 2DK5A 4HDVA 2VBYA 3JREA 1F43A 2YPRA 1G2HA 1ZARA 2FMLA 2VXDA 1NG7A 3DBRB 2NRAC 1T39A 1ULYA 3KIOA 4N0BA 4DJAA 2X51A 3O6BB 4D5CA 2ME6A 3IP4B 5DUKA 2VKHA 3JRFA 1T8IA 1H89C 1K79A 3WTWC 2F48A 5IYDJ 3BC8A 3EETA 3QP5A 2PMUA 2PJRB 3DLAA 1KU3A 3KP7A 2KRCA 4DBQA 1JHFA 4AWXB 3HXLA 3WTVC 3I53A 2XKPA 2RVCA 3DKXA 1R36A 5JLXA 1IUFA 2ZMEA 2FNPA 3F21A 3H3UA 1XPXA 1ZGJA 1X58A 1HDPA 1GHCA 1JKOC 3BG9A 3AAFA 3F6VA 2XGEA 4WK8F 1FJLA 4A3BJ 2V79A 1RR7A 1AWCA 2VKDA 3OYGA 1T33A 4LLGF 4JX6A 3R0JA 1QGPA 1XC5A 1AA7A 5D6EA 2DMTA 2HTSA 3JRBA 1PUFA 4R8HA 1TT0A 2IP2A 4MQ9F 2KJCA 1B59A 3MAJA 1WI9A 3ABTA 1KQ9A 3HGYA 1ZR4A 3LSHA 3L2CA 2DTRA 2VJ5A 4B44A 1EV7A 1XMAA 5B1AH 3S93A 3S8PA 1VTNC 5J8FA 1O57A 4HQEA 3W2VA 1ZKGA 1YLFA 1UJ8A 5EZHA 3KYCB 3FXUA 2Y0SN 3MD2A 1E2XA 3F8MA 2Z9OA 2LREA 2XF7A 1HW2A 2ZXHA 1VQLI 3E5UA 1OCRH 2M1BA 1HKTA 1ZRDA 3K4KA 1N78A 3OR2C 1T08B 1A35A 2KIUA 4DIQA 1FX7A 4K2EA 1S7OA 3LAPA 1ZHFA 1YITI 4GFBA 2L02A 2CUFA 3S2HJ 1VQ5I 1MBEA 2K85A 3QOPA 3ZR8X 3IV5A 2K7LA 2Z3YA 2Q8KA 4D0PA 2L4AA 1W7PB 4PFPA 3RTRA 2VUMJ 4KMFA 3BDDA 1BIBA 3L9FA 4I76A 2ZXJA 1WJCA 5EEGA
chains in the Genus database with same CATH topology
3E0JB 2X6XA 3IAS2 3S3OA 4ZYAA 4DGWB 4CZCA 2CS3A 4P5OA 3ONQA 3F9KA 2R7TA 2KHMA 3VDXA 4II2A 2L9SA 3RQ4A 1UELB 3K10A 3M1CA 2JSPA 1KONA 3BCAA 2LYCA 4E7LA 2LH9A 5TGTA 2L5QA 5FRMA 1Z3XA 2BVMA 2MD0A 4XORA 2AQFA 2Q1ZB 1V5EA 3DPTA 4LIVA 1G59A 2Z2SB 3W2AA 4B43A 3KX2A 2DJIA 1V5GA 2O5RA 3TL4X 3G2BA 3ZRGA 3KYLA 2VLAA 4D1QA 4MLOA 4PJMA 2BW3A 1T0FC 4IX7A 2R7RA 5LD2C 3S32A 1X1BA 3N05A 3SYTA 4RLQA 2IGMA 4BEHB 4ZDPA 1WJDA 2R4GA 2LY2A 4NNJA 4E7SA 4F55A 3CMMA 2XF6A 3H5AA 2KMUA 2ZFUA 4EATA 4C2UA 2VASA 4OAYA 2L7KA 2CV1A 3I3LA 2E1MC 2WBMA 3OL4A 3SZGA 4XQFA 3LMMA 2W82A 2LY1A 3HC7A 4ANJA 3K4BA 2DT6A 2ZSIB 4CH7A 2HVRA 2KLOA 4CCOA 2X1EA 2HU9A 1YX5A 3RSNA 4NC7A 2JVHA 2F4IA 4AYBA 4DBRA 2VIXA 2W1OA 1D0XA 4E7HA 3H5NA 1P9QC 4ZC3A 1U0JA 3QODA 2JUGA 3LSKA 1WJBA 4FASD 3MKWB 1X4PA 2VJ4A 2UV1A 3OWTA 2VQHA 3AFHA 3DU6A 2MYSA 2HPIA 2KP6A 2VQCA 1IRXA 3FKJA 4C9YA 3AKZA 2M7BA 4XLEA 3OYCA 2M4KA 3CJQB 2R7WA 4F52A 4QPOA 3H9JA 5CQEA 3S3MA 3EUAA 3IUOA 2CH0A 4AU7A 3K4CA 1WJAA 1G8XA 3HKZA 2R7UA 2MC4A 2IS1A 3EUKL 2MABA 1UAAA 4ZDLA 5HOOA 3DTKA 1SAUA 3BG6A 4XKVA 2XSJC 4PFOA 4CCKA 3BLYA 4E7KA 3AL0C 1J09A 4ZDOA 4H4KC 4OWRB 4B48A 4BGDA 2DXIA 3J7AY 3D5RC 3CJRB 3PSIA 3UR3C 3K4NA 4ZTJA 2PJRA 4BQQA 2ZSHB 3C2HA 4BQOA 4OAZA 2HVSA 3OYMA 2DOAA 4XLAA 4BQNA 3OOUA 3PFYA 3L2VA 2HZDA 2E60A 3GBGA 4NQWB 3UNGC 4XMYA 3ZXSA 3DPLC 1Z3YA 3PSFA 3QOEA 3CP2A 3K6GA 4RM2A 5KHDA 2X6YA 2K9LA 1WJEA 2IGKA 2CMPA 5FRNA 3OIPA 2M3AA 4PSXA 4IQ4A 1BR4A 3LFUA 3HPHA 3H0DA 2V1NA 3OYNA 4II3A 2BOLA 3L2WA 4YEJA 3EUHC 2CW7A 2R7SA 4XM3A 2HPMA 1D1AA 2X1CA 2CUJA 4XKWA 2VL8A 3DU5A 2PMZA 2CV0A 2E5NA 3CF2A 3TMOA 2RREA 1MMDA 5CQGA 4BUPA 2HVQA 4DOZA 3OYKA 2IGNA 4D9JA 4CSWA 1SFKA 4PJNA 1MMAA 4XLFA 3BG7A 3HPGA 1MW7A 2X85A 2LBFA 3C2GA 1D0ZA 3V42A 4PSWA 2DT7B 3MMYB 2WADA 3CESA 2UWMA 2K5CA 3SDBA 3D5LA 2JVGA 3OYEA 3LSMA 3DKYA 4XR6A 3ZCOA 2LC2A 4F92B 2K3PA 3PNVA 3VYUB 1HA8A 1BR2A 3OYDA 2I8DA 1V5FA 2HQAA 3W3CA 3PNYA 2A6TA 4ZJZA 2HDWA 2X1DA 2IGOA 4Y3OA 2OV7A 1BOBA 1YE9A 1PYVA 3D5SC 4FETA 2ZXIA 4BE1A 3L2UA 4B3XA 3LL7A 3CP8A 2V7FA 2IXSA 2F6CA 3H5RA 1N77A 2R7QA 2P0WA 4N4OB 3NWTA 2FUG2 4HPQA 2LOOA 3PL8A 1D0YA 3K4JA 4XKBA 4IQJA 4Y4RA 5CKTA 5HNHA 3ZGKA 1DP3A 3HL2A 1EA3A 2LG4A 1Z21A 3OYHA 2VQLA 2IS6A 4IKFA 1QHHD 4BDZA 3ZQQA 1X19A 2JA2A 1R6RA 2M4GA 2LRDA 1DGWY 4BEHA 3PUBA 3K70D 4XOTA 4XLHA 5KCMA 3MKZA 3H35A 2CUZA 4KT6A 1OLTA 4HNTA 1X1AA 4F91B 3QYFA 4CCLA 3FDYA 4J01A 2IS4A 5KNLA 3VSKA 4JOMA 2L9NA 1MNEA 2WA0A 4HNUA 4PUSA 4BJ5C 1E0EA 3FBNB 2KZVA 2Y0SA 2CV2A 3DTEA 3A2KA 4PJLA 2ELJA 3OMYA 1NG6A 3I9V2 3OIQA 4YELA 1LKXA 4E4HA 4Y33A 4CCMA 3OYBA 3K70C 3K4LA 2BVLA 2KRHA 4CCNA 1GLNA 2A5WA 1D1BA 4E7IA 2OC6A 3HG9A 3LSGA 1W36D 4XLCA 4E7JA 2BW3B 3QYBA 4XN3A 3NWSA 2Q2EB 1Y56A 2R7OA 3H9QA 4U87A 3OYJA 4BXFA 3RPUD 4BJ6C 4R79A 4E6KG 2WY8Q 4NC8A 3H9GA 3E1SA 3A1YA 4RMNA 2R7VA 3OYFA 4XKCA 2UUZA 2VXZA 3L2RA 2E1MB 2HNHA 4HRIA 2V9KA 4LIUA 3OYIA 2VJJA 3VWBA 3K4MA 3KEYA 3L2QA 4BL0B 4KJZA 5CPRB 4E7ZA 1ERDA 2DCEA 2VB6A 1LVKA 3LSIA 4U7BA 5JHFA 1UG0A 1X4OA 4KISA 2QKLB 4GRIA 1MMNA 4BJTA 1JI8A 3DTIA 1YX3A 4HG2A 4XOPA 2RNGA 1W36C 1DGRM 3DEEA 4JQFA 2L2OA 1T95A 2V26A 1VZ0A 4G6TB 5HLTA 2WB1A 2IS2A 2W00A 4BS9A 4PK4A 1BR1A 3VYTB 4P1WA 2KQRA 4XN0A 3DWLE 4F3QA 4C2TA 4KITB 1PJRA 3PJRA 1S9HA 4C30A 3SEZA 3VYRB 2WY7Q 2GOMA 3TBIA 5LFAA 4YRVA 2VPLA 2XAUA 1LDKB 3SEQA 5HVQC 4IZZA 3FBIB 3HOTA 2KDOA 3W2WA 2WAFA 4RLFA 1K6YA 2VJIA 1LFPA 2VXDA 2X6WA 1NG7A 3AL0B 2M7AA 2RQQA 2NOJB 4DJAA 2X51A 4HEA2 3IP4B 2VKHA 3IAM2 3U21A 1N75A 1QU3A 3OL3A 3BC8A 2KL4A 1MNDA 3VSLA 3RCOA 3OS2A 1WFXA 3FHNA 2PJRB 3DLAA 4F93B 4DBQA 2KRCA 4QPQA 2GOXB 2OUMA 3HXLA 3M8JA 4BE0A 3DKXA 3MKYB 2QKMB 4HSTA 4BDYA 2V6EA 1WJFA 4ZTFA 3OS0A 3DQVC 2F5VA 2CW8A 4CA0A 4N4NB 4X0GA 1OR7C 3BCBA 2XDVA 4XNFA 2VKDA 3OYGA 1AA7A 4LITA 5FROA 1TT0A 3S3NA 4B47A 3DPUA 4CCJA 2MFZA 3LSHA 4BU2A 2VJ5A 4B44A 2XC7A 3HOSA 3HUGB 3A4CA 3S93A 1QHGA 3S8PA 1TZLA 4XONA 4AVZA 4CUGA 3W2VA 3OR1C 3OS1A 3OYLA 1MMGA 3MD2A 4LG3A 4BE2A 2V4JC 2LREA 2XF7A 5HNFA 4BACA 2Z1DA 2K9MA 1Y6IA 2ZXHA 2R7XA 4XL9A 2AQEA 4PJJA 4NUBA 4J00A 3CZ6A 2CFOA 3K4KA 1N78A 3OR2C 2LBFB 3OY9A 1FMVA 1WJ5A 2W4SA 4DIQA 2W7NA 1X1CA 2WAQA 4RM3A 2XF5A 3EPZA 2Z16A 2E5ZA 3ZR8X 1DQUA 4ITVA 3OYAA 2KPMA 3QYEA 3VYSB 1ZELA 4PFPA 3RTRA 1Z7LA 2WAEA 2VQGA 3PNTA 2M0MA 1D1CA 1X1DA 4HSRA 1WJCA 1FMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHM A;  2MAB A;  2K3P A;  2MFZ A;  2M0M A; 
#chains in the Genus database with same CATH topology
 4B4C A;  1SMY F;  3IAS 2;  4S05 A;  2L9V A;  3X2Q H;  3GTM J;  2CS3 A;  2TRT A;  2QEN A;  3LAJ A;  3ONQ A;  4YFX F;  1TLH B;  2KHM A;  3CQZ J;  3VDX A;  4II2 A;  2IJL A;  2L9S A;  1IZ1 A;  3FM5 A;  3K10 A;  4S04 A;  2JSP A;  1O3R A;  2O0Y A;  2LH9 A;  1B8I A;  2L5Q A;  3TO7 A;  2F5F A;  4IO9 F;  3OIO A;  4HA8 A;  4UUS A;  3JRC A;  5J4Y A;  1G3Y A;  1S8N A;  4LIV A;  5E1Z B;  2EV0 A;  1REP C;  2Z2S B;  3V7R A;  2MH9 A;  4BHP A;  2XAG A;  2VC1 A;  2YSR A;  2YX4 A;  2ZCW A;  2WB1 N;  4AD9 A;  3G2B A;  1R5I D;  4L5I A;  3ZMU A;  4D1Q A;  4MLO A;  4PJM A;  3DP7 A;  1T0F C;  1ZG5 A;  5LD2 C;  4IHW A;  3L1P A;  2H09 A;  2IGM A;  2WTE A;  3M9A A;  1O7L A;  1D8K A;  2LY2 A;  3LA7 A;  4E7S A;  2CG4 A;  4F55 A;  5IOY A;  3CMM A;  1U9O A;  4EJV A;  3CCR I;  3FXK A;  2FOK A;  2NVX J;  2FXA A;  2VAS A;  1B1B A;  4OAY A;  5F0C A;  2CV1 A;  3KZZ A;  4RB0 A;  2FX0 A;  3MVP A;  2A68 F;  1ZGW A;  2J5P A;  2LY1 A;  2ID3 A;  2K9S A;  1BL0 A;  3S2D J;  5A2Q Z;  4UUV A;  2EV5 A;  3K4B A;  1R9T J;  1ZLJ A;  2VOD A;  2ZSI B;  4CH7 A;  2KLO A;  4Z2Y A;  4CYC A;  2BBY A;  1BOA A;  1ZK8 A;  2OBP A;  4YFN F;  1YX5 A;  4NHJ A;  2F4I A;  1X3W B;  2PFB A;  5DM6 F;  3EQL F;  2COM A;  2JUG A;  2V6C A;  5L3F A;  2UV1 A;  3OWT A;  1IN7 A;  2CRG A;  2VQH A;  5JVT A;  4I0B A;  2H8R A;  2HOE A;  2MYS A;  2HPI A;  3M1E A;  2QCO A;  1ZG3 A;  1RES A;  1IRX A;  2VQC A;  1Z9C A;  2M7B A;  3BTI A;  1TNT A;  5J1R A;  2M4K A;  4F52 A;  4QPO A;  2XRN A;  1A31 A;  5CQE A;  3EUA A;  1YS6 A;  3E6B A;  4AU7 A;  4QSH A;  3K4C A;  3O2P E;  5LHI A;  1WJA A;  4ASN A;  1JTY A;  1I1S A;  1ZAO A;  3AG2 H;  2MA3 A;  2ZC2 A;  4PFO A;  3H36 A;  3AL0 C;  1SFU A;  5HDG A;  3TP3 A;  3HRU A;  1J09 A;  2QQB A;  4ZDO A;  5C3E J;  3BZ6 A;  2M9H A;  3ABU A;  3WTZ A;  3D5R C;  3LSP A;  4OIN F;  4IRG A;  4P9U A;  3RKX A;  3QP6 A;  1W4M A;  2MG4 A;  2R7Z J;  2EA2 A;  2HDC A;  5GTH C;  1VQO I;  5GAE J;  3CUQ B;  3BRO A;  1UHW A;  2IA0 A;  2DOA A;  3PQJ A;  1MBF A;  3P5J A;  4BQN A;  4AVP A;  3OOU A;  3TDU C;  4EVI A;  2EBI A;  2R5Y B;  2KIS A;  3FMR A;  3MEX A;  1YG2 A;  2WAQ N;  3DPL C;  3QOE A;  1I6H J;  3J81 Z;  2D45 A;  1SVM A;  4UB6 C;  2ESN A;  2A61 A;  1E17 A;  2H6C A;  1IXC A;  1RZ4 A;  3K7A J;  2QUF A;  5F08 A;  4M3E A;  4Q47 A;  1JHH A;  2A6H F;  1YOV B;  2VPR A;  5AIP A;  2A69 F;  5GAD J;  2GBY A;  3R4K A;  3OIP A;  5JVG F;  1BR4 A;  3HPH A;  4II3 A;  2IEK A;  5LGU A;  2Y9Y A;  1W5T A;  2NNY A;  4CHU A;  4G9Y A;  2WV1 A;  3FK7 A;  4MTE A;  4LD5 A;  2CSO A;  2QSG X;  2VL8 A;  1IN8 A;  1JUS A;  4NBQ A;  3N97 A;  1LEA A;  2E5N A;  3L00 A;  5FFZ A;  3LFK A;  2HYF A;  3KYD B;  4A6E A;  3T1B A;  3WHB A;  3HM5 A;  2O3F A;  2HVQ A;  5TJJ A;  1QPM A;  1U78 A;  4Q4Z F;  5F27 A;  2LR8 A;  3BG7 A;  4EQQ A;  2LF7 A;  3V42 A;  3WGG A;  3ERE D;  1XCB A;  2M0C A;  1AOY A;  1FLI A;  2JVG A;  1NHA A;  2CWE A;  2F5C A;  3DKY A;  3GCM A;  4XR6 A;  2HYG D;  3K1N A;  3ZCO A;  2CQK A;  3H1C A;  4A6D A;  3LSJ A;  3GWZ A;  4F92 B;  3PNV A;  5AIQ A;  3RQI A;  1F36 A;  4EM1 A;  3BJA A;  2WC2 A;  1R71 A;  4Q48 A;  3SFZ A;  2M8E A;  2XHK A;  4HYE A;  3Q9S A;  3IKV A;  1HOM A;  4A3J J;  4Y3O A;  3KZI C;  4U0Y A;  4FET A;  1LUJ B;  2QSH X;  5BOX A;  3MFK A;  3BR0 A;  3CLO A;  4N4O B;  3J7Z I;  2ZB9 A;  1Z6T A;  2EZH A;  4HPQ A;  3PL8 A;  1DU6 A;  1IRF A;  5CKT A;  1HLV A;  4RGX A;  1Z21 A;  4LLL A;  4LK0 F;  1FBS A;  3WTS C;  5HLH A;  2A6E F;  1QHH D;  3K9T A;  2FOW A;  3ZQQ A;  1X19 A;  2JA2 A;  3WE3 A;  1SFX A;  1F9N A;  2M4G A;  4ESB A;  1FZP B;  2EA4 A;  3WE2 A;  3CCL I;  2LVS A;  3SXY A;  1J0R A;  1WVR A;  2ETH A;  4O6J A;  1SD6 A;  2QZ8 A;  1BI0 A;  4L5J A;  3MKZ A;  4HAM A;  2CFX A;  2CUZ A;  4KIF A;  3RI4 A;  3QU6 A;  2BXY A;  3G1O A;  1OLT A;  1XGS A;  2RQP A;  4XID A;  3H92 A;  4PDK A;  3FDY A;  4J01 A;  2IS4 A;  4GYG A;  2ZJ2 A;  1FEX A;  2FSW A;  3ASO H;  1AU7 A;  1MNE A;  1RET A;  4HNU A;  3CJT B;  3VEP A;  3P9C A;  3FBN B;  5C4J J;  4CO8 A;  1I1G A;  1RI7 A;  2FF4 A;  4A3F J;  4L0Z B;  4LB5 A;  3A2K A;  4IHT A;  3F0C A;  3R61 A;  5E3N A;  2HKO A;  2DFE A;  2E1O A;  5DCM A;  3A01 B;  2STT A;  4LG0 B;  2VKV A;  1QNT A;  3KLN A;  3K70 C;  1YRN A;  1SC7 A;  3K4L A;  3KP4 A;  4A3C J;  2QM3 A;  2DDB A;  3IHU A;  4CCN A;  1XS9 A;  1D1B A;  2EPF A;  3U1D A;  1FT9 A;  2OC6 A;  3CTA A;  3C2B A;  3HG9 A;  3LSG A;  2V1U A;  4XLC A;  3KE2 A;  2BW3 B;  5E3L A;  2PBI A;  2R7O A;  3E3V A;  3OYJ A;  3I0T A;  3F8N A;  3RPU D;  4BJ6 C;  4R79 A;  1OYW A;  2O8X A;  1I50 J;  3E1S A;  3CC2 I;  1Y0U A;  5EG0 B;  4XKC A;  3JRA A;  2DYS H;  2HNH A;  3K0L A;  4HRI A;  5K1Y A;  1ZQ3 P;  1USS A;  1HXD A;  1YHQ I;  3K4M A;  2XVC A;  2AXL A;  4UB8 C;  1QA6 A;  2NS0 A;  4B3A A;  4KJZ A;  1VQ7 I;  5FKM A;  2LNB A;  3IH2 A;  4U7B A;  1UG0 A;  4M9S A;  1H8A C;  4X6A J;  1QZZ A;  1BBY A;  4GRI A;  4BJT A;  3DTI A;  1MMS A;  1GVJ A;  4RAG A;  2RNG A;  1DGR M;  2L2O A;  1KU9 A;  1P7I A;  2QQA A;  2V26 A;  1U5T B;  2PMZ N;  3RPU A;  2EK5 A;  4G6T B;  2XPU A;  1RNL A;  4G94 A;  1LFB A;  3W6V A;  1G3S A;  3SHF A;  3ABK H;  2X4H A;  3DWL E;  5EF6 A;  4WF2 A;  2P81 A;  4UVC A;  1PJR A;  1UMQ A;  2QYO A;  3GLX A;  4NQW A;  5EGO B;  4I6Z A;  3TBI A;  5LFA A;  2ISZ A;  3WU0 A;  2HYJ A;  2DMN A;  3G1M A;  1UFM A;  1LDK B;  2XAU A;  3SEQ A;  2FBH A;  3BR2 A;  3ABM H;  4RLF A;  1K6Y A;  2VJI A;  1SVL A;  1T2K A;  4KNY A;  4I0A A;  4YIR X;  2P7V B;  2XPV A;  2GAU A;  1DPR A;  1MDM A;  1BM9 A;  2VN2 A;  2DA7 A;  2RQQ A;  2D2W A;  3BPV A;  1BJZ A;  4RB3 C;  2OZU A;  1N75 A;  2AHQ A;  2I5U A;  1Z7U A;  3TGN A;  4KA4 A;  1OQY A;  3I59 A;  3EYI A;  2DOF A;  3OS2 A;  2QGU A;  2FRH A;  4F93 B;  5IPA A;  5F0H A;  1UHM A;  2IA2 A;  3WG9 A;  1Y0N A;  5D4S A;  3MKY B;  5D8L B;  4ESJ A;  3FXO A;  3F8F A;  4DNC A;  4BBS J;  4OIR F;  2V6E A;  1TP4 A;  1WJF A;  2DU9 A;  3LA2 A;  3GTP J;  5CVU A;  2F5V A;  2DO7 A;  4CA0 A;  1OMI A;  2L7M P;  3HHG A;  5E79 C;  1T56 A;  3BCB A;  1P4X A;  4IHV A;  2K27 A;  1BW5 A;  3HRS A;  1N25 A;  2MD5 A;  4FE4 A;  1EKE A;  5FRO A;  4UNO A;  3FXM A;  3MZ8 A;  3R60 A;  2R0Q C;  2JMW A;  1ZRC A;  3QWL A;  3DPU A;  4B47 A;  2V9V A;  2ZNZ A;  4BY7 J;  3J80 K;  1WWX A;  3MCZ A;  3DBL B;  3HDD A;  2MFZ A;  2L54 A;  4RS8 A;  2Y9Z A;  4RGR A;  3CCV I;  1MGT A;  1UHS A;  3HUG B;  3PO2 J;  1H9T A;  4XON A;  3I5U A;  1PUE E;  1V54 H;  1VI0 A;  1FP2 A;  5ILU A;  3JRD A;  4RBO A;  1MMG A;  5KVR A;  3P9I A;  1Z0X A;  1XD7 A;  2B9S A;  1HC8 A;  2K9M A;  4M71 A;  3OV8 A;  2R7X A;  1XGN A;  4TV7 A;  2IPQ X;  2AQE A;  3ZMT A;  3O8G A;  5E8G A;  3CZ6 A;  3HSF A;  5M5W J;  4EJU A;  2COB A;  2I10 A;  3BOQ A;  5HDK A;  3T0Y A;  5F0F A;  2NXN B;  4RM3 A;  1IRG A;  2CYY A;  3HRM A;  2XAJ A;  3EPZ A;  2DFF A;  4Y7N J;  2Z16 A;  2E5Z A;  3E5X A;  4NDL A;  5K7F A;  2JK3 A;  3K69 A;  2KPM A;  4MEX F;  3VYS B;  4KDP A;  1ZGA A;  3F6O A;  5EJC A;  1Y39 A;  4M73 A;  2WAE A;  3PNT A;  1L3L A;  1UST A;  2H8W A;  2M0M A;  5FKN A;  2ISY A;  4HSR A;  3I56 I;  1FMW A;  5LEJ A;  2XAS A;  3E0J B;  3FM3 A;  1FOK A;  4GDF A;  3GZ6 A;  4A5M A;  2R7T A;  2ELK A;  2FD5 A;  1HKS A;  2ADU A;  2D5V A;  3F72 A;  2XB5 A;  5HS7 A;  3M1C A;  3MKL A;  3RQ4 A;  1K61 A;  4ESF A;  4E7L A;  2HI3 A;  4HF0 A;  1ZYR F;  2NS7 A;  5FRM A;  2BVM A;  3LA3 A;  1B72 B;  1LFU P;  4LFU A;  2AS5 F;  3B6C A;  1A5J A;  3DPT A;  1BW6 A;  4RB2 C;  4CGZ A;  4J19 A;  2GXB A;  1TWG J;  3W2A A;  1WHU A;  4DYC A;  4XBF A;  2DJI A;  4Y17 A;  3IWF A;  5FLV A;  5J47 A;  5C44 J;  1QVU A;  1O7F A;  1W0T A;  1T0F A;  2VLA A;  4YFK F;  1TBX A;  4IX7 A;  3GW2 A;  3CJN A;  5CJ9 A;  3S32 A;  1X1B A;  2OPT A;  3N05 A;  4KIB A;  5FLM J;  1IG7 A;  4ZDP A;  5CVV A;  1WJD A;  3ZOB A;  4BHB A;  2KZG A;  5DTD A;  3T5X A;  4HNV A;  1OYI A;  3AG3 H;  3H5A A;  1OCO H;  3HB9 A;  3G71 I;  2ZFU A;  3ML6 A;  1I6X A;  4C2U A;  2K9N A;  2G7U A;  1SFO J;  3ECH A;  1ETV A;  1U8B A;  2ZJQ F;  3QPH A;  2E1M C;  4A3K J;  1JJ8 C;  2R92 J;  3OL4 A;  2QA4 I;  1VQN I;  5LRR A;  4HLY A;  3L7W A;  3HC7 A;  2BEO A;  4UVA A;  4ANJ A;  5FLX K;  2DT6 A;  2G7H A;  2HVR A;  3WU1 B;  4BNC A;  5TIS C;  3ISP A;  5FFX A;  2DW4 A;  2VIX A;  2DPU A;  2W1O A;  3H3Z A;  2ZFW A;  3G3Z A;  3QOD A;  1JT0 A;  1JJ6 C;  1RC9 A;  3LQR A;  2VJ4 A;  3BP8 A;  5L3D A;  4IOC F;  4M3F A;  2VT3 A;  1IN6 A;  3HGG A;  2DI3 A;  3V7C A;  2K3F A;  2CH0 A;  3CCY A;  2GWR A;  5DUI A;  2QBY B;  3RDI A;  3PUF A;  2EV6 A;  5E3M A;  1G8X A;  5F1R A;  2FEZ A;  2MC4 A;  4P96 A;  2PG4 A;  2JA8 J;  2UXX A;  4ZDL A;  2G0E A;  4WXC A;  2UXN A;  4HV5 A;  1BIA A;  3DTK A;  1SAU A;  5HOO A;  4XKV A;  3N4M A;  4OIQ F;  4CCK A;  5FKK A;  3FK6 A;  4BQA A;  5GP9 A;  1IC8 A;  3L09 A;  4H4K C;  1LJ9 A;  4BGD A;  3I4N J;  3J7A Y;  1ONV A;  1Y1V J;  3CJR B;  1WRJ A;  3Q3S A;  4CIC A;  2GLO A;  1OIS A;  3QAH A;  4G12 A;  2ZSH B;  4Y13 A;  3C2H A;  1ETO A;  4MFD A;  3CMY A;  5C4X J;  3ZN0 A;  3OYM A;  3REO A;  5ILS A;  1MJB A;  4AC0 A;  1D5V A;  3PFY A;  3Q0V A;  4ENM A;  5J3L A;  3UNG C;  2KJB A;  3CCM I;  2JSC A;  4XSZ F;  3ZXS A;  3PSF A;  1FYM A;  1D8J A;  3K6G A;  4C3H J;  4EEF G;  2LD5 A;  3S2W A;  5KHD A;  1SD5 A;  2X6Y A;  2K9L A;  1WJE A;  2DT5 A;  2P8T A;  1MSE C;  4IHX A;  4A3E J;  1XCV A;  1YJN I;  3ELK A;  1IW7 F;  1AKH A;  2L7F P;  5B3S H;  1S72 I;  2R7F A;  5LLQ A;  3IKT A;  2X1C A;  2Z99 A;  3FIS A;  4RA2 A;  2R3S A;  3DU5 A;  2B0L A;  3C7J A;  2H1L A;  3G73 A;  1ZN2 A;  3TMO A;  1YS7 A;  3CF2 A;  2RRE A;  1B9N A;  4U0V A;  3TOB A;  1P4W A;  2MC3 A;  3CCJ I;  5CQG A;  3V7S A;  1U8R A;  5D5V B;  3E5Q A;  3M07 A;  1S6L A;  4CSW A;  1SFK A;  1Z1D A;  4PJN A;  1B4A A;  4XLF A;  4XRS G;  3HPG A;  2X85 A;  2LBF A;  4HOB A;  4HQM A;  4IHS A;  5H6R A;  1W5C C;  2NVT J;  2DA3 A;  2QQ9 A;  2JA5 J;  2EZK A;  2ZME B;  3MZH A;  4BY1 J;  2UWM A;  2P7C B;  3SDB A;  4DYQ A;  2LC2 A;  1FOW A;  3FZV A;  3T8T A;  2CUE A;  2K3P A;  2XPW A;  1QO0 D;  4HX8 A;  1QRY A;  2A5Y B;  1PUF B;  2Y48 A;  5FD6 A;  3W3C A;  4Y15 A;  1YQA A;  2DAO A;  4ZJZ A;  4KYW A;  5FD5 A;  1BJA A;  4KMU X;  2DN0 A;  4B3X A;  4IHY A;  4FX4 A;  1IO2 A;  1G6N A;  3H5R A;  4IF4 A;  2R7Q A;  3NWT A;  1FWZ A;  5K5Q A;  3CF5 F;  3IC7 A;  1BI1 A;  3TQN A;  2H6B A;  4OMZ A;  4GO1 A;  1K78 A;  4IQJ A;  1DP3 A;  1CGP A;  1ZTR A;  3HL2 A;  2HGC A;  2P6T A;  2HKX A;  4PJ0 C;  3HBL A;  1WKM A;  4V2F A;  4A0Y A;  1ACI A;  4ZYE A;  1CF7 A;  3V8L A;  3RYP A;  2HQN A;  5H20 A;  2DMU A;  5BPI A;  1DGW Y;  3BR6 A;  1FY7 A;  4BEH A;  3PUB A;  3K70 D;  3MWM A;  4GYI A;  4HZF A;  2M8G X;  4UUT A;  5A2Q K;  5K5R A;  2JPB A;  1HBX G;  4PZJ A;  1H9G A;  4L9N A;  1ETQ A;  3FMQ A;  3H0G J;  1KZH A;  4ZZD A;  3DEW A;  5F6F A;  1LVA A;  3GFI A;  3CO7 C;  3VSK A;  4HF2 A;  4JOM A;  1E3P A;  3LST A;  4PUS A;  1S7E A;  1S5L C;  1E0E A;  2YU3 A;  3PO3 J;  2KZV A;  1R1U A;  1ZRF A;  1OCZ H;  2EH3 A;  3DTE A;  2CV2 A;  4PJL A;  1MIJ A;  2X6O A;  1UZC A;  1R1V A;  1B8I B;  1ORK A;  1NG6 A;  2IVM A;  3B6A A;  3I9V 2;  1J75 A;  1TW3 A;  4S0H B;  4GCV A;  3V8J A;  2E7X A;  3QQA A;  4E70 A;  4UUS B;  3GFL A;  1LKX A;  4E4H A;  3KP5 A;  3OYB A;  1RKT A;  4IRI A;  2KRH A;  2IW5 A;  4LK1 F;  2A5W A;  3GVA A;  5BS6 A;  1QZY A;  4E7J A;  1OPC A;  4XN3 A;  3NWS A;  4U87 A;  1SAN A;  5DD8 A;  5FO5 A;  3MQ0 A;  1XSX A;  4LGW A;  5D5U B;  3H9G A;  3A1Y A;  2CJJ A;  3DBH B;  2LKP A;  4FHT A;  2Z5U A;  3OYF A;  3LSR A;  2UUZ A;  3OOP A;  4FIS A;  2C6Y A;  2OTL I;  5JLW A;  3C3W A;  1S29 A;  2CGP A;  3CDL A;  4I02 A;  2VJJ A;  5DYM A;  4MEY F;  3KEY A;  2E36 A;  4L0Y B;  2QVO A;  5FKO A;  1LVK A;  3RKW A;  2OD5 A;  5JHF A;  4CDG A;  4HBL A;  4CYC B;  2EFN A;  1CQT A;  1W36 C;  2IA1 A;  2XGC A;  2ME0 A;  1KYW A;  2ICW G;  3HTU A;  5J4V A;  4JQF A;  1JKR C;  2BV6 A;  1T95 A;  1E3O C;  2Y69 H;  1TW2 A;  3J81 K;  1FBU A;  5ICC A;  4NC6 A;  2IS2 A;  3D1N I;  2W00 A;  4BS9 A;  1FBQ A;  5ICF A;  3JR9 A;  2NAZ A;  4LOC A;  5M5X J;  4A3G J;  1SD7 A;  3CUQ C;  4C2T A;  1FTT A;  4KIT B;  3BG5 A;  1R23 A;  1K7A A;  1S9H A;  5L3E A;  2E7W A;  4RGU A;  1TNS A;  2M87 A;  3RKY A;  3S1Q J;  1OCP A;  1LDJ A;  2D1H A;  4KT5 C;  2FU4 A;  5JR3 A;  1ON1 A;  1TTY A;  4WCG A;  3Q0U A;  5J8C A;  1FSH A;  1JXS A;  1QZE A;  1B9M A;  2F4O B;  1LFP A;  2HTJ A;  1KU7 A;  2X6W A;  3HYI A;  5L3G A;  1T6S A;  1A6I A;  3JRI A;  2QQ8 A;  4MQV A;  1I3Q J;  1YTY A;  5LGN A;  1RR8 C;  2X48 A;  1Y8Q B;  4HEA 2;  3GUD A;  3IAM 2;  4M72 A;  2K40 A;  3LWF A;  1LE8 A;  2JRM A;  2RKH A;  3TED A;  2KL4 A;  1MKM A;  4AYB N;  1MND A;  2H94 A;  4A69 C;  1OCC H;  4HDU A;  1WFX A;  4YG2 F;  4EJO A;  4AID A;  3K2Z A;  2GOX B;  2OUM A;  3M8J A;  3I4M J;  1FOX A;  4BE0 A;  5IYB J;  3BTC A;  5LBQ A;  2QKM B;  4G6Q A;  1P6R A;  1ETX A;  4BDY A;  4RAZ A;  4ZTF A;  3DQV C;  3SQN A;  3PIO F;  3IH4 A;  4OU0 A;  4N4N B;  4X0G A;  3U1K A;  4MFE A;  2MLK A;  1TT5 B;  2XDV A;  4G8X A;  5CVI A;  4DZJ A;  3GTL J;  1ODD A;  5GAH J;  5H6Q A;  3GLL A;  1HSJ A;  4L5E A;  1SVO A;  5M3F J;  4LMY A;  1UB9 A;  2JRT A;  3FXJ A;  4X1E A;  1U6G A;  4BKX A;  5CVJ A;  4I98 B;  2M34 A;  4GXO A;  1YJ9 I;  2GZW A;  2XC7 A;  1Z77 A;  4LB6 B;  5IYC J;  5EDN A;  1QHG A;  3WOD F;  1TZL A;  4AVZ A;  3ECO A;  2A3S A;  2F4M B;  2PMH A;  1NTC A;  2OZ6 A;  2VC0 A;  3UKG A;  3CC7 I;  3V8K A;  2G9W A;  2MBF A;  3P9K A;  4V2G A;  2ACJ A;  4EV0 A;  1WCM J;  5B5E C;  2V4J C;  4BAC A;  1GV5 A;  1HQC A;  2Z1D A;  3KEQ A;  5DV5 A;  2Y30 A;  4PJJ A;  1TQI A;  4M9X A;  2CFO A;  1XX5 A;  2MLG A;  5FJ8 J;  1NH3 A;  2HQR A;  3S1M J;  2DMQ A;  1WJ5 A;  3BTJ A;  3VFZ A;  2W4S A;  2J5O A;  4A93 J;  1POG A;  2RAE A;  2ECB A;  3ASN H;  3JRH A;  3KEO A;  1WGX A;  1LQ1 A;  5FKL A;  1BI3 A;  1ZEL A;  3HSR A;  2K9Q A;  2VQG A;  2LKS A;  4I01 A;  3M8F A;  1TWC J;  2X6X A;  4IJA A;  5TRD A;  3S3O A;  4ZYA A;  4B1R A;  3S1N J;  1HW5 A;  5BNG A;  3HSE A;  5DEQ A;  2HR3 A;  4P5O A;  1IN4 A;  4FE7 A;  4M6X A;  3F9K A;  5H2F C;  3KET A;  2H27 A;  2NYX A;  5LEK A;  2Q0O A;  3HOU J;  1GDT A;  1K4T A;  2P5K A;  3EUH A;  2XRL A;  1M1E B;  2LYC A;  3BG3 A;  1VQ4 I;  3R6S A;  1WPK A;  2DOE A;  3RYR A;  2L3D A;  1Z3X A;  5E1W A;  3TO9 A;  1RIO H;  4A3D J;  3HUG A;  4XOR A;  1Y8R B;  3CDH A;  2AQF A;  2M30 A;  3TP0 A;  1V5E A;  5HS8 A;  3BTL A;  4B43 A;  3KX2 A;  3JRG A;  2OQR A;  1OYY A;  1ZRE A;  2E19 A;  4M3B A;  3TL4 X;  3WTU C;  3FX3 A;  4N9I A;  1TWF J;  4ON0 A;  3SZP A;  2Q2E A;  1B6A A;  4RLQ A;  2FJ1 A;  1SFE A;  2R4G A;  4NNJ A;  1GXP A;  4A12 A;  4IXA A;  4XLP F;  4KIG A;  4EAT A;  4O5V A;  1KYZ A;  4BAY A;  1TQM A;  3M3Y J;  2L7K A;  3GYH X;  3I3L A;  1UCR A;  2XV4 S;  1RUN A;  4IOA F;  2HS5 A;  3SZG A;  3LMM A;  2W82 A;  2LP0 A;  1XSD A;  3QRF F;  2E2J J;  1IRZ A;  2P6S A;  2W24 A;  4CCO A;  2XAF A;  1SAX A;  3JW4 A;  3A0B C;  5DCM B;  3C18 A;  2IAI A;  3HOW J;  2HU9 A;  1OFC X;  3RSN A;  2FBI A;  3A02 A;  2JVH A;  4MHG A;  4DBR A;  1IAW A;  4E7H A;  3H5N A;  1U5T C;  1TL8 A;  4GGG A;  1V55 H;  1YRN B;  3LSK A;  3NQO A;  2ESH A;  4FAS D;  1X4P A;  4U88 A;  4ZYH A;  1BC7 C;  1FIA A;  2R5Z A;  3ZMZ A;  3Q9V A;  1DDN A;  3AFH A;  5IT3 A;  3CDI A;  1XTA A;  3DU6 A;  5HDN A;  4OMY A;  3HOV J;  2QWW A;  3HRT A;  2KP6 A;  2BY2 A;  4C9Y A;  2TDX A;  2VI6 A;  3FKJ A;  3AKZ A;  4ENK A;  4XLE A;  1EF4 A;  4JP0 A;  3FXL A;  3IUO A;  3ZQG A;  5B1B H;  2OF7 A;  3HKZ A;  3E6M A;  1IDZ A;  2IS1 A;  1G4D A;  2MAB A;  1A04 A;  2O61 A;  1UAA A;  2V1X A;  2VBZ A;  3CCU I;  1OKR A;  2X9D A;  2GA2 A;  4YIF A;  2N8G A;  2EIL H;  4E7K A;  4AM3 A;  1MBK A;  1YYV A;  1U2W A;  4FT8 A;  3I71 A;  4UHT A;  3GXO A;  1X1P A;  2EWN A;  4QLC U;  5D4R A;  1VQ6 I;  4B48 A;  5IT9 Z;  5IOZ A;  1O3Q A;  2DXI A;  1LDD A;  1FNN A;  2RC4 A;  2LF8 A;  3O8H A;  5EZG A;  1GV2 A;  1D3Y A;  2ID6 A;  3PSI A;  1YW7 A;  3QU3 A;  1VND A;  2QLZ A;  3DFG A;  3G6E I;  4L9J A;  3K4N A;  3F23 A;  4OIO F;  2PJR A;  3ZQ7 A;  1G3T A;  1P7J A;  5D6F A;  4BQO A;  4OAZ A;  2HVS A;  2GQQ A;  3I4P A;  5E17 F;  2BY1 A;  2BZT A;  4XLA A;  2Y31 A;  3BR3 A;  5LGT A;  5GPA A;  3GBG A;  5EEH A;  4NQW B;  2YU9 J;  4P55 A;  4XMY A;  2E71 A;  1Z3Y A;  1Z05 A;  3CP2 A;  3F22 A;  1GVD A;  3JSO A;  4RM2 A;  3WGI A;  2GXG A;  4PGG A;  3JTH A;  4G6D A;  2GIV A;  2VE8 A;  2O03 A;  2DK8 A;  2QEX I;  3IL2 A;  4YII A;  2M3A A;  2KIF A;  4IQ4 A;  4IL6 C;  1MDM B;  3H0D A;  1ZR2 A;  4Z6Y A;  1EH6 A;  3OYN A;  3C1D A;  3KCC A;  2BOL A;  1T38 A;  6PAX A;  2OJE D;  2XAQ A;  3EUH C;  1GT0 C;  1Z6R A;  2HPM A;  2XGX A;  2KIQ A;  1D1A A;  5K7Z A;  1PDN C;  2HOS A;  1W7P D;  4XKW A;  1JE8 A;  1WH7 A;  3F8B A;  4EGZ A;  3GTK J;  3E7L A;  4XRM A;  3I59 B;  1HST A;  1O4X A;  3HTS B;  5ILV A;  3ULQ B;  5KAF C;  3HEF A;  2DDA A;  5HS9 A;  4DOZ A;  4D9J A;  4IRH A;  4XK4 A;  4BYY A;  1MMA A;  4EM2 A;  3HOX J;  1ZG1 A;  4M74 A;  4UXN A;  2HZT A;  1D0Z A;  2FQ3 A;  1J5Y A;  1YO5 C;  1NK2 P;  2V9P A;  4PSW A;  3RZO J;  2KKO A;  1WSU A;  1QQI A;  3CCS I;  1ETY A;  4H0E A;  3D5L A;  3BQY A;  3LSM A;  2X0L A;  2VOP A;  2KIM A;  3CD6 I;  2A05 A;  2P5V A;  4B8X A;  4LJZ F;  5JHU A;  4CXF A;  4WX9 A;  5E18 F;  1F1Z A;  2VBX A;  3VYU B;  1W7P A;  1F4K A;  2DFI A;  2LLK A;  4M3D A;  1V5F A;  4XLN F;  2FQ4 A;  2XUB A;  3ERM A;  1P4A A;  3PNY A;  2A6T A;  2RGV A;  2RV8 A;  1RRJ A;  2P4W A;  2HDW A;  1IGN A;  2X1D A;  3IWZ A;  1XSV A;  2OV7 A;  1BOB A;  1YE9 A;  4AIH A;  5F1J A;  3L2U A;  5BMZ A;  1W0U A;  3EYY A;  4Y52 J;  3LL7 A;  3GTQ J;  2E1C A;  3CP8 A;  1R49 A;  2V7F A;  2IXS A;  2F6C A;  1N77 A;  1J59 A;  2FUG 2;  2OA4 A;  3JAM Z;  2QF7 A;  4ZYG A;  2EIN H;  1OJL A;  2LOO A;  4UVB A;  1D0Y A;  2PX9 A;  3QPS A;  3TW6 A;  3VB2 A;  2DJN A;  5HNH A;  2K4J A;  2OAZ A;  1FYK A;  4AIJ A;  2IBD A;  4EJW A;  4G7O F;  2LG4 A;  4HLX A;  3GTG J;  2IS6 A;  9ANT A;  4O3M A;  4BDZ A;  2B63 J;  1JT6 A;  3BR5 A;  3EDP A;  2OU2 A;  3LOC A;  1FP1 D;  2CQQ A;  4QWQ A;  3GFM A;  1JKQ C;  5F04 A;  4I99 C;  4XOT A;  3CMA I;  3CCQ I;  3H35 A;  2F5E A;  3HZJ A;  1A36 A;  2L4M A;  1JTX A;  1OR7 A;  3MN2 A;  3ZQF A;  3GF2 A;  4HNT A;  1X1A A;  2MH2 A;  1KQ8 A;  2E2I J;  3ZPL A;  4CCL A;  1P2F A;  1K4S A;  3AG4 H;  4CZZ A;  1W5S A;  3W6J B;  2JN6 A;  2L9N A;  3DF8 A;  3JAM K;  4BJ5 C;  2AO9 A;  2MGQ A;  2Y0S A;  4G7H F;  2L7Z A;  3FMS A;  1TQP A;  2ELJ A;  2Z33 A;  1FPQ A;  1EH7 A;  2XKO A;  1SMT A;  2BHY A;  1LPQ A;  4YEL A;  3Q5F A;  3OSG A;  4KFC A;  4Y33 A;  3BQZ A;  4CCM A;  3MZY A;  4ZZL A;  3B02 A;  5CVR A;  1X2M A;  4LLN A;  3WG7 H;  2BVL A;  4A3M J;  1QPI A;  4A3I J;  3BJO A;  5F64 A;  5E3O A;  5ICG A;  1W36 D;  3PIP F;  4M6Y A;  1TWH J;  4ENJ A;  1FIP A;  4AIK A;  3H9Q A;  1TC3 C;  2L0K A;  1W1W E;  2YX7 A;  2M5W A;  3CUO A;  1ETK A;  4NC8 A;  2CU7 A;  4RMN A;  2VBW A;  2R7V A;  4PGH A;  4WWC A;  2Y2Z A;  3GTO J;  2VE9 A;  5LRS A;  3D0S A;  1BA5 A;  4XIC A;  3ZP5 A;  2V9K A;  4LIU A;  3OYI A;  2RN7 A;  4R1H A;  1VFC A;  3P7N A;  4OIP F;  2B7E A;  3K1M A;  3L2Q A;  4BL0 B;  2LTP A;  3RPQ A;  1IDY A;  1ERD A;  2DCE A;  2VB6 A;  3LSI A;  1X4O A;  2JWT A;  2MW8 A;  3KLO A;  3V4G A;  1MMN A;  5L3C A;  3U2R A;  4HG2 A;  4XOP A;  2XIG A;  3IRQ A;  5EYR A;  5HLT A;  1YFH A;  2WB1 A;  3IRR A;  2KT0 A;  3CLQ A;  2BY3 A;  2FMY A;  2YUS A;  3CUQ A;  3GFJ A;  4PCQ A;  1BR1 A;  4PK4 A;  3GEZ A;  3BWG A;  4EJT A;  3U9G A;  4HX4 A;  3RIR A;  2R5Y A;  3SEZ A;  3VPR A;  3VYR B;  4V19 K;  2GOM A;  3CME I;  4WXH A;  2LFB A;  4YRV A;  1FYL A;  1VQ9 I;  4F7Z A;  4UY8 I;  1EJ9 A;  4U0W A;  1IJW C;  1IF1 A;  2DTZ A;  4IZZ A;  2CW0 F;  3FBI B;  3HOT A;  4L9T A;  2KDO A;  3CC4 I;  3KP3 A;  1R00 A;  2ZXW H;  3W2W A;  3SJM A;  1AHD P;  2WAF A;  2JZY A;  3S14 J;  1VQP I;  1ENH A;  3BJ6 A;  3ZMV A;  1XG1 A;  2CQ7 A;  1XDS A;  3AL0 B;  2M7A A;  4MIM A;  1MH3 A;  5GAG J;  5HOD A;  2NOJ B;  4A0Z A;  2L9R A;  2KFD A;  2HXI A;  3O3K A;  3PFI A;  1XGM A;  1QU3 A;  3U21 A;  5J1U A;  4JX4 A;  1XDU A;  2MSY A;  4JX5 A;  3RZD J;  3OL3 A;  4ABZ A;  3J7A O;  2JT1 A;  1KU2 A;  3VSL A;  3COA C;  3RCO A;  3FHN A;  2PN6 A;  2JPC A;  2DA4 A;  4QPQ A;  2E35 A;  3R0A A;  1KA8 A;  1R1T A;  1HDD C;  2R93 J;  3VOD A;  3BT9 A;  4HST A;  3FXQ A;  4QTR A;  2E2H J;  2DBB A;  2ZME C;  3OS0 A;  3SDG A;  4P9F A;  3FIW A;  1A6Q A;  2EFQ A;  5DM7 F;  4FTH A;  4U7D A;  2CW8 A;  2K02 A;  1OR7 C;  4I2O A;  4XNF A;  5BQT A;  4DQ2 A;  5B66 C;  2NVQ J;  5CLS A;  5IP7 J;  4LIT A;  3S3N A;  2VOO A;  4CCJ A;  1ETW A;  1AKH B;  2R7D A;  3HOY J;  1XMK A;  4RAY A;  4BU2 A;  2OCC H;  1VQ8 I;  2IRF G;  5IY5 H;  2PQ8 A;  2E1N A;  3HOS A;  3E6C C;  1JKP C;  3A4C A;  3TDZ C;  1P92 A;  1X3Z B;  4OOI A;  3VOE A;  4CUG A;  1XMX A;  4MGR A;  2V1D A;  3E6D A;  4JYK A;  3OR1 C;  3WTY C;  3OS1 A;  3OYL A;  3ZQI A;  4XRS A;  4LG3 A;  4BE2 A;  5HNF A;  3K2A A;  1S3J A;  1Y6I A;  2NOG A;  4XL9 A;  1YIO A;  4NUB A;  4J00 A;  4EM0 B;  4NB5 A;  2LBF B;  3OY9 A;  1FMV A;  3K1P A;  3GTJ J;  2W7N A;  1X1C A;  2WAQ A;  2PLY A;  1VF9 A;  4BXU A;  2XF5 A;  2EB7 A;  1APL C;  1DU0 A;  2DFH A;  3RJP A;  1DQU A;  4ITV A;  5LHH A;  1GXQ A;  3PQK A;  2WV0 A;  2ZKZ A;  3OYA A;  3QYE A;  3NAU A;  1Z7L A;  4N9H A;  1D1C A;  4D5F A;  1JGS A;  1X1D A;  2EIJ H;  5KK1 A;  4DGW B;  3NAR A;  5IP9 J;  4CZC A;  4BXX J;  2HQ5 A;  5JI6 A;  1R7J A;  2FE3 A;  4C3J J;  5E20 A;  2BHZ A;  3FHZ A;  1UEL B;  2YR2 A;  4HV6 A;  2EJR A;  1HW1 A;  1KON A;  3BCA A;  5TGT A;  4D7N A;  1SD4 A;  2MD0 A;  1X2N A;  3I64 A;  5E1X A;  1IV6 A;  1FSE A;  2Q1Z B;  3A01 A;  1K78 B;  2FNA A;  2A07 F;  4LG0 A;  3SFI A;  2VKE A;  1G59 A;  3FWE A;  3ZMD A;  2VON A;  2XRO A;  3G4S I;  5GTI C;  3DCF A;  1V5G A;  5GPC A;  2O5R A;  1CF7 B;  5ED4 A;  4L9V A;  3ZRG A;  3KYL A;  5K5O A;  2EIM H;  3FKI J;  5FGM A;  2BW3 A;  3ZMS A;  4JBA A;  2ZO4 A;  2R7R A;  3NEU A;  1RKW A;  2LK2 A;  1R22 A;  2F2E A;  3DXJ F;  3SYT A;  3GZN B;  4BEH B;  3GZ5 A;  5ICE A;  2XF6 A;  1L0O C;  1DUX C;  2KMU A;  5EG0 A;  5M3M J;  2XB0 X;  2LDU A;  1MD0 A;  5D5W B;  4B09 A;  4ETS A;  2O6G E;  2JTV A;  3NRV A;  1YW9 A;  3IH3 A;  2WBM A;  1Z91 A;  2HWV A;  5K7H A;  3WTT C;  1FC3 A;  2ZBK A;  1ZH5 A;  2UZK A;  2XSD C;  1O3T A;  1KGS A;  2DA5 A;  2LMD A;  3KP2 A;  4XQF A;  1I27 A;  4A2U A;  1HKQ A;  2EZI A;  2OQG A;  4A0X A;  1HCR A;  2IT0 A;  2EFP A;  2X1E A;  4NC7 A;  3BPX A;  4AYB A;  1IN5 A;  4I09 A;  2O7O A;  1U5T A;  1D0X A;  1P9Q C;  4ZC3 A;  1U0J A;  2GM4 A;  3G1L A;  3S17 J;  1WJB A;  3MKW B;  2W57 A;  3DEU A;  5HLG A;  4DW6 A;  1U3E M;  2LY9 A;  4A5N A;  2Y0M A;  2DA1 A;  5AON A;  5EGO A;  3OYC A;  3WHC A;  4AUX A;  1IUY A;  2R7W A;  3CJQ B;  3GO5 A;  2NVU B;  5D8K B;  4RDU A;  1XN7 A;  2L01 A;  3H9J A;  2JA7 J;  1S7A A;  2ZJR F;  1QBJ A;  4RGS A;  3S3M A;  2ZJP F;  2EIK H;  3ZQH A;  1MBJ A;  1MBH A;  5HLI A;  4ZH4 F;  2R7U A;  1ITY A;  2K4B A;  3EUK L;  4BHC A;  3FXR A;  2HFH A;  4M9Z A;  3BG6 A;  2STW A;  2XSJ C;  4MTD A;  2DA6 A;  3BLY A;  2F5D A;  3ABL H;  1C0W A;  5ERI A;  1QVT A;  5LHG A;  4DYR A;  3M7G A;  4OWR B;  3ZN1 A;  5DCF A;  2JJ7 A;  5L3B A;  1I5Z A;  3UR3 C;  3T8R A;  4D7M A;  2HOA A;  3F8C A;  3WU2 C;  2M45 A;  4ZTJ A;  2NVY J;  4BQQ A;  3OSF A;  4KN7 X;  1TWA J;  4HF1 A;  2CQN A;  1R4M B;  1E3H A;  2D1V A;  2DA2 A;  1MSF C;  2ZNY A;  2VT2 A;  4UV9 A;  4RAF A;  2HEO A;  1Q1H A;  4W97 A;  5IP6 A;  3L2V A;  2HZD A;  2E60 A;  1PP7 U;  3TKY A;  2HDD A;  4JK1 X;  3I55 I;  2W25 A;  3RKQ A;  3ESW B;  1LNW A;  1WZ2 A;  2DPD A;  2PEX A;  2IGK A;  1OCT C;  3JSP A;  4MNU A;  4C3I J;  2CMP A;  5FRN A;  2XAH A;  1YJW I;  1MH4 A;  4PSX A;  3KPH A;  3LFU A;  2V1N A;  1H88 C;  3L2W A;  3ROU A;  4YEJ A;  2CW7 A;  2R7S A;  4XM3 A;  3I58 A;  3S16 J;  1G3W A;  1UG2 A;  2CUJ A;  2W48 A;  1YIJ I;  2BXZ A;  2PMZ A;  1MJ9 A;  1R5H A;  1LE8 B;  2LSO A;  1T98 A;  2CV0 A;  3M8E A;  3TO6 A;  1J2X A;  2BY0 A;  1MMD A;  4DZP A;  2E34 A;  3LQQ A;  1MNM C;  4BUP A;  2NNN A;  1LB2 A;  3OYK A;  2JA6 J;  2IGN A;  1R4N B;  3GX4 X;  2DOD A;  5M5Y J;  2P5L C;  3ZQL A;  3M4O J;  2XGD A;  1MW7 A;  3C2G A;  3BY6 A;  5BPD A;  2DT7 B;  1WI3 A;  2WAD A;  3MMY B;  1IXS B;  4KUM A;  3CES A;  3DKW A;  4IEJ A;  2JQ7 A;  4IPA A;  1DP7 P;  2PJP A;  1R5G A;  2K5C A;  1Q1V A;  3OYE A;  2LKX A;  2GA1 A;  3E97 A;  3A03 A;  1I3A A;  1WH5 A;  5DDG A;  1Y1W J;  2RDP A;  1HA8 A;  1BR2 A;  3KP6 A;  3OYD A;  2I8D A;  1YI2 I;  2HQA A;  2EQR A;  1MZB A;  4L18 B;  1WQ2 A;  1ON2 A;  5KAI C;  5E8I A;  2EZL A;  4QIW N;  1J9I A;  2IGO A;  3HOZ J;  4XSX F;  1J7K A;  2BE5 F;  1O3S A;  1PYV A;  2QSF X;  3D5S C;  4BE1 A;  2ZXI A;  1F5T A;  5JFR A;  1V3F A;  3GME A;  2W84 A;  1IV8 A;  3I54 A;  1BC8 C;  2P0W A;  5D5X B;  2KDZ A;  5CYV A;  2DYR H;  2JUC A;  3BZC A;  3QPL A;  1RPW A;  1B72 A;  3K4J A;  4XKB A;  4G7Z F;  1JUP A;  4Y4R A;  3J80 Z;  3ZGK A;  1XGO A;  2K86 A;  1EA3 A;  2O9L A;  3KZY A;  3OYH A;  2H1K A;  2VQL A;  2WWY A;  1U9N A;  2BGC A;  4IKF A;  3A0H C;  1XB4 A;  1R6R A;  4M3G A;  2LRD A;  2FBK A;  4KN4 X;  3DV8 A;  1V4R A;  2GIZ A;  2ELH A;  4XLH A;  5KCM A;  4HW0 A;  1SEU A;  2M2E A;  4KT6 A;  2DQR A;  1PVE A;  2CQX A;  3JCU C;  1K6O A;  5DD4 A;  4EGY A;  4CYD A;  4F91 B;  3QYF A;  4FCY A;  2FA5 A;  1VQK I;  1MBG A;  1X3U A;  5KNL A;  2O8K A;  3W6K B;  1H0M A;  3HKZ N;  2WA0 A;  1BI2 A;  4I7H A;  4Q5S F;  3JTG A;  3SZT A;  1FOY A;  4A3L J;  1MJA A;  3OMY A;  1K83 J;  2ECC A;  3WGH A;  2EFW A;  3OIQ A;  1BN5 A;  2Y75 A;  5J40 A;  2DMP A;  3S1R J;  3S15 J;  3J7Y J;  3LNQ A;  1DPU A;  3HIF A;  4FX0 A;  2OTJ I;  3H3V K;  3B73 A;  1GLN A;  4W1U A;  4E7I A;  1FTZ A;  1ZLK A;  2PI0 A;  2DLL A;  4WXD A;  3WTX C;  3QYB A;  3BZK A;  2W85 A;  2Q2E B;  1Y56 A;  1PP8 F;  4C2M J;  1YW8 A;  3TOA A;  5J6X A;  4BXF A;  3CO6 C;  4E6K G;  2WY8 Q;  1IXR C;  3AG1 H;  3HJE A;  4ENN A;  2CO5 A;  5IT9 K;  2QBY A;  2VXZ A;  3TW7 A;  3FF5 A;  2E1M B;  3L2R A;  3ZQC A;  2BYV E;  1I39 A;  2NS8 A;  3VWB A;  1NK3 P;  4MO7 A;  1STZ A;  2RNJ A;  2EFO A;  5CPR B;  4E7Z A;  5EEA A;  1GUU A;  4HX7 A;  1KQ0 A;  2KRF A;  5FB2 A;  1RUO A;  4KIS A;  2QKL B;  3CCE I;  1JI8 A;  3HHH A;  2DQL A;  4IVN A;  1HF0 A;  1YX3 A;  1Z67 A;  1JGG A;  2TCT A;  4BH9 A;  4M6V A;  3DEE A;  4ZYD A;  4XRF A;  5DS9 A;  2OCE A;  4RB1 A;  1VZ0 A;  1VQM I;  4FQG A;  2HXO A;  3KFW X;  4BBR J;  3VYT B;  4UV8 A;  4P1W A;  2KQR A;  4KIC A;  4XN0 A;  2R5Z B;  4F3Q A;  2GXA A;  5FLX Z;  3BR1 A;  3DLL F;  3QPT A;  1R58 A;  1EH8 A;  3PJR A;  1JUM A;  4C30 A;  2WY7 Q;  2HOT A;  2AXT C;  3PM1 A;  2YS9 A;  5J1Y A;  3Q0W A;  2VPL A;  1LEB A;  5HVQ C;  4EMS A;  1D5Y A;  3F3X A;  2DK5 A;  4HDV A;  2VBY A;  3JRE A;  1F43 A;  2YPR A;  1G2H A;  1ZAR A;  2FML A;  2VXD A;  1NG7 A;  3DBR B;  2NRA C;  1T39 A;  1ULY A;  3KIO A;  4N0B A;  4DJA A;  2X51 A;  3O6B B;  4D5C A;  2ME6 A;  3IP4 B;  5DUK A;  2VKH A;  3JRF A;  1T8I A;  1H89 C;  1K79 A;  3WTW C;  2F48 A;  5IYD J;  3BC8 A;  3EET A;  3QP5 A;  2PMU A;  2PJR B;  3DLA A;  1KU3 A;  3KP7 A;  2KRC A;  4DBQ A;  1JHF A;  4AWX B;  3HXL A;  3WTV C;  3I53 A;  2XKP A;  2RVC A;  3DKX A;  1R36 A;  5JLX A;  1IUF A;  2ZME A;  2FNP A;  3F21 A;  3H3U A;  1XPX A;  1ZGJ A;  1X58 A;  1HDP A;  1GHC A;  1JKO C;  3BG9 A;  3AAF A;  3F6V A;  2XGE A;  4WK8 F;  1FJL A;  4A3B J;  2V79 A;  1RR7 A;  1AWC A;  2VKD A;  3OYG A;  1T33 A;  4LLG F;  4JX6 A;  3R0J A;  1QGP A;  1XC5 A;  1AA7 A;  5D6E A;  2DMT A;  2HTS A;  3JRB A;  1PUF A;  4R8H A;  1TT0 A;  2IP2 A;  4MQ9 F;  2KJC A;  1B59 A;  3MAJ A;  1WI9 A;  3ABT A;  1KQ9 A;  3HGY A;  1ZR4 A;  3LSH A;  3L2C A;  2DTR A;  2VJ5 A;  4B44 A;  1EV7 A;  1XMA A;  5B1A H;  3S93 A;  3S8P A;  1VTN C;  5J8F A;  1O57 A;  4HQE A;  3W2V A;  1ZKG A;  1YLF A;  1UJ8 A;  5EZH A;  3KYC B;  3FXU A;  2Y0S N;  3MD2 A;  1E2X A;  3F8M A;  2Z9O A;  2LRE A;  2XF7 A;  1HW2 A;  2ZXH A;  1VQL I;  3E5U A;  1OCR H;  2M1B A;  1HKT A;  1ZRD A;  3K4K A;  1N78 A;  3OR2 C;  1T08 B;  1A35 A;  2KIU A;  4DIQ A;  1FX7 A;  4K2E A;  1S7O A;  3LAP A;  1ZHF A;  1YIT I;  4GFB A;  2L02 A;  2CUF A;  3S2H J;  1VQ5 I;  1MBE A;  2K85 A;  3QOP A;  3ZR8 X;  3IV5 A;  2K7L A;  2Z3Y A;  2Q8K A;  4D0P A;  2L4A A;  1W7P B;  4PFP A;  3RTR A;  2VUM J;  4KMF A;  3BDD A;  1BIB A;  3L9F A;  4I76 A;  2ZXJ A;  1WJC A;  5EEG A; 
#chains in the Genus database with same CATH homology
 3E0J B;  2X6X A;  3IAS 2;  3S3O A;  4ZYA A;  4DGW B;  4CZC A;  2CS3 A;  4P5O A;  3ONQ A;  3F9K A;  2R7T A;  2KHM A;  3VDX A;  4II2 A;  2L9S A;  3RQ4 A;  1UEL B;  3K10 A;  3M1C A;  2JSP A;  1KON A;  3BCA A;  2LYC A;  4E7L A;  2LH9 A;  5TGT A;  2L5Q A;  5FRM A;  1Z3X A;  2BVM A;  2MD0 A;  4XOR A;  2AQF A;  2Q1Z B;  1V5E A;  3DPT A;  4LIV A;  1G59 A;  2Z2S B;  3W2A A;  4B43 A;  3KX2 A;  2DJI A;  1V5G A;  2O5R A;  3TL4 X;  3G2B A;  3ZRG A;  3KYL A;  2VLA A;  4D1Q A;  4MLO A;  4PJM A;  2BW3 A;  1T0F C;  4IX7 A;  2R7R A;  5LD2 C;  3S32 A;  1X1B A;  3N05 A;  3SYT A;  4RLQ A;  2IGM A;  4BEH B;  4ZDP A;  1WJD A;  2R4G A;  2LY2 A;  4NNJ A;  4E7S A;  4F55 A;  3CMM A;  2XF6 A;  3H5A A;  2KMU A;  2ZFU A;  4EAT A;  4C2U A;  2VAS A;  4OAY A;  2L7K A;  2CV1 A;  3I3L A;  2E1M C;  2WBM A;  3OL4 A;  3SZG A;  4XQF A;  3LMM A;  2W82 A;  2LY1 A;  3HC7 A;  4ANJ A;  3K4B A;  2DT6 A;  2ZSI B;  4CH7 A;  2HVR A;  2KLO A;  4CCO A;  2X1E A;  2HU9 A;  1YX5 A;  3RSN A;  4NC7 A;  2JVH A;  2F4I A;  4AYB A;  4DBR A;  2VIX A;  2W1O A;  1D0X A;  4E7H A;  3H5N A;  1P9Q C;  4ZC3 A;  1U0J A;  3QOD A;  2JUG A;  3LSK A;  1WJB A;  4FAS D;  3MKW B;  1X4P A;  2VJ4 A;  2UV1 A;  3OWT A;  2VQH A;  3AFH A;  3DU6 A;  2MYS A;  2HPI A;  2KP6 A;  2VQC A;  1IRX A;  3FKJ A;  4C9Y A;  3AKZ A;  2M7B A;  4XLE A;  3OYC A;  2M4K A;  3CJQ B;  2R7W A;  4F52 A;  4QPO A;  3H9J A;  5CQE A;  3S3M A;  3EUA A;  3IUO A;  2CH0 A;  4AU7 A;  3K4C A;  1WJA A;  1G8X A;  3HKZ A;  2R7U A;  2MC4 A;  2IS1 A;  3EUK L;  2MAB A;  1UAA A;  4ZDL A;  5HOO A;  3DTK A;  1SAU A;  3BG6 A;  4XKV A;  2XSJ C;  4PFO A;  4CCK A;  3BLY A;  4E7K A;  3AL0 C;  1J09 A;  4ZDO A;  4H4K C;  4OWR B;  4B48 A;  4BGD A;  2DXI A;  3J7A Y;  3D5R C;  3CJR B;  3PSI A;  3UR3 C;  3K4N A;  4ZTJ A;  2PJR A;  4BQQ A;  2ZSH B;  3C2H A;  4BQO A;  4OAZ A;  2HVS A;  3OYM A;  2DOA A;  4XLA A;  4BQN A;  3OOU A;  3PFY A;  3L2V A;  2HZD A;  2E60 A;  3GBG A;  4NQW B;  3UNG C;  4XMY A;  3ZXS A;  3DPL C;  1Z3Y A;  3PSF A;  3QOE A;  3CP2 A;  3K6G A;  4RM2 A;  5KHD A;  2X6Y A;  2K9L A;  1WJE A;  2IGK A;  2CMP A;  5FRN A;  3OIP A;  2M3A A;  4PSX A;  4IQ4 A;  1BR4 A;  3LFU A;  3HPH A;  3H0D A;  2V1N A;  3OYN A;  4II3 A;  2BOL A;  3L2W A;  4YEJ A;  3EUH C;  2CW7 A;  2R7S A;  4XM3 A;  2HPM A;  1D1A A;  2X1C A;  2CUJ A;  4XKW A;  2VL8 A;  3DU5 A;  2PMZ A;  2CV0 A;  2E5N A;  3CF2 A;  3TMO A;  2RRE A;  1MMD A;  5CQG A;  4BUP A;  2HVQ A;  4DOZ A;  3OYK A;  2IGN A;  4D9J A;  4CSW A;  1SFK A;  4PJN A;  1MMA A;  4XLF A;  3BG7 A;  3HPG A;  1MW7 A;  2X85 A;  2LBF A;  3C2G A;  1D0Z A;  3V42 A;  4PSW A;  2DT7 B;  3MMY B;  2WAD A;  3CES A;  2UWM A;  2K5C A;  3SDB A;  3D5L A;  2JVG A;  3OYE A;  3LSM A;  3DKY A;  4XR6 A;  3ZCO A;  2LC2 A;  4F92 B;  2K3P A;  3PNV A;  3VYU B;  1HA8 A;  1BR2 A;  3OYD A;  2I8D A;  1V5F A;  2HQA A;  3W3C A;  3PNY A;  2A6T A;  4ZJZ A;  2HDW A;  2X1D A;  2IGO A;  4Y3O A;  2OV7 A;  1BOB A;  1YE9 A;  1PYV A;  3D5S C;  4FET A;  2ZXI A;  4BE1 A;  3L2U A;  4B3X A;  3LL7 A;  3CP8 A;  2V7F A;  2IXS A;  2F6C A;  3H5R A;  1N77 A;  2R7Q A;  2P0W A;  4N4O B;  3NWT A;  2FUG 2;  4HPQ A;  2LOO A;  3PL8 A;  1D0Y A;  3K4J A;  4XKB A;  4IQJ A;  4Y4R A;  5CKT A;  5HNH A;  3ZGK A;  1DP3 A;  3HL2 A;  1EA3 A;  2LG4 A;  1Z21 A;  3OYH A;  2VQL A;  2IS6 A;  4IKF A;  1QHH D;  4BDZ A;  3ZQQ A;  1X19 A;  2JA2 A;  1R6R A;  2M4G A;  2LRD A;  1DGW Y;  4BEH A;  3PUB A;  3K70 D;  4XOT A;  4XLH A;  5KCM A;  3MKZ A;  3H35 A;  2CUZ A;  4KT6 A;  1OLT A;  4HNT A;  1X1A A;  4F91 B;  3QYF A;  4CCL A;  3FDY A;  4J01 A;  2IS4 A;  5KNL A;  3VSK A;  4JOM A;  2L9N A;  1MNE A;  2WA0 A;  4HNU A;  4PUS A;  4BJ5 C;  1E0E A;  3FBN B;  2KZV A;  2Y0S A;  2CV2 A;  3DTE A;  3A2K A;  4PJL A;  2ELJ A;  3OMY A;  1NG6 A;  3I9V 2;  3OIQ A;  4YEL A;  1LKX A;  4E4H A;  4Y33 A;  4CCM A;  3OYB A;  3K70 C;  3K4L A;  2BVL A;  2KRH A;  4CCN A;  1GLN A;  2A5W A;  1D1B A;  4E7I A;  2OC6 A;  3HG9 A;  3LSG A;  1W36 D;  4XLC A;  4E7J A;  2BW3 B;  3QYB A;  4XN3 A;  3NWS A;  2Q2E B;  1Y56 A;  2R7O A;  3H9Q A;  4U87 A;  3OYJ A;  4BXF A;  3RPU D;  4BJ6 C;  4R79 A;  4E6K G;  2WY8 Q;  4NC8 A;  3H9G A;  3E1S A;  3A1Y A;  4RMN A;  2R7V A;  3OYF A;  4XKC A;  2UUZ A;  2VXZ A;  3L2R A;  2E1M B;  2HNH A;  4HRI A;  2V9K A;  4LIU A;  3OYI A;  2VJJ A;  3VWB A;  3K4M A;  3KEY A;  3L2Q A;  4BL0 B;  4KJZ A;  5CPR B;  4E7Z A;  1ERD A;  2DCE A;  2VB6 A;  1LVK A;  3LSI A;  4U7B A;  5JHF A;  1UG0 A;  1X4O A;  4KIS A;  2QKL B;  4GRI A;  1MMN A;  4BJT A;  1JI8 A;  3DTI A;  1YX3 A;  4HG2 A;  4XOP A;  2RNG A;  1W36 C;  1DGR M;  3DEE A;  4JQF A;  2L2O A;  1T95 A;  2V26 A;  1VZ0 A;  4G6T B;  5HLT A;  2WB1 A;  2IS2 A;  2W00 A;  4BS9 A;  4PK4 A;  1BR1 A;  3VYT B;  4P1W A;  2KQR A;  4XN0 A;  3DWL E;  4F3Q A;  4C2T A;  4KIT B;  1PJR A;  3PJR A;  1S9H A;  4C30 A;  3SEZ A;  3VYR B;  2WY7 Q;  2GOM A;  3TBI A;  5LFA A;  4YRV A;  2VPL A;  2XAU A;  1LDK B;  3SEQ A;  5HVQ C;  4IZZ A;  3FBI B;  3HOT A;  2KDO A;  3W2W A;  2WAF A;  4RLF A;  1K6Y A;  2VJI A;  1LFP A;  2VXD A;  2X6W A;  1NG7 A;  3AL0 B;  2M7A A;  2RQQ A;  2NOJ B;  4DJA A;  2X51 A;  4HEA 2;  3IP4 B;  2VKH A;  3IAM 2;  3U21 A;  1N75 A;  1QU3 A;  3OL3 A;  3BC8 A;  2KL4 A;  1MND A;  3VSL A;  3RCO A;  3OS2 A;  1WFX A;  3FHN A;  2PJR B;  3DLA A;  4F93 B;  4DBQ A;  2KRC A;  4QPQ A;  2GOX B;  2OUM A;  3HXL A;  3M8J A;  4BE0 A;  3DKX A;  3MKY B;  2QKM B;  4HST A;  4BDY A;  2V6E A;  1WJF A;  4ZTF A;  3OS0 A;  3DQV C;  2F5V A;  2CW8 A;  4CA0 A;  4N4N B;  4X0G A;  1OR7 C;  3BCB A;  2XDV A;  4XNF A;  2VKD A;  3OYG A;  1AA7 A;  4LIT A;  5FRO A;  1TT0 A;  3S3N A;  4B47 A;  3DPU A;  4CCJ A;  2MFZ A;  3LSH A;  4BU2 A;  2VJ5 A;  4B44 A;  2XC7 A;  3HOS A;  3HUG B;  3A4C A;  3S93 A;  1QHG A;  3S8P A;  1TZL A;  4XON A;  4AVZ A;  4CUG A;  3W2V A;  3OR1 C;  3OS1 A;  3OYL A;  1MMG A;  3MD2 A;  4LG3 A;  4BE2 A;  2V4J C;  2LRE A;  2XF7 A;  5HNF A;  4BAC A;  2Z1D A;  2K9M A;  1Y6I A;  2ZXH A;  2R7X A;  4XL9 A;  2AQE A;  4PJJ A;  4NUB A;  4J00 A;  3CZ6 A;  2CFO A;  3K4K A;  1N78 A;  3OR2 C;  2LBF B;  3OY9 A;  1FMV A;  1WJ5 A;  2W4S A;  4DIQ A;  2W7N A;  1X1C A;  2WAQ A;  4RM3 A;  2XF5 A;  3EPZ A;  2Z16 A;  2E5Z A;  3ZR8 X;  1DQU A;  4ITV A;  3OYA A;  2KPM A;  3QYE A;  3VYS B;  1ZEL A;  4PFP A;  3RTR A;  1Z7L A;  2WAE A;  2VQG A;  3PNT A;  2M0M A;  1D1C A;  1X1D A;  4HSR A;  1WJC A;  1FMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...