2MABA

Untangling the solution structure of c-terminal domain of aciniform spidroin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
b'PSFGLVLNSPNGLRSPQAKARINNLASALSTAVGRNGVDVNAFTSGLRATLSNLGDSGMSPNEAKVEVLLEALTAALQLLSSSTLGAVDTTSIGLTSNSVSKAVAQALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACINIFORM SPIDROIN
publication title Structure and function of C-terminal domain of aciniform spidroin
pubmed doi rcsb
source organism Nephila antipodiana
molecule tags Structural protein
total genus 31
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mabA00
2K3PA 2MFZA 2M0MA 2MABA 2KHMA
chains in the Genus database with same CATH superfamily
4ETSA 3E6CC 1WCMJ 2L7KA 2K9NA 2EZKA 4ZH4F 2XPWA 4OOIA 1UAAA 3ZMTA 1VQNI 5K5QA 2EFQA 3S2DJ 2WBMA 3GWZA 2KJBA 1XTAA 2A6EF 3GEZA 2MH2A 5JLWA 4YIFA 3MQ0A 4A3FJ 1HCRA 3EPZA 2Q8KA 3G4SI 3S3OA 1EF4A 3KEYA 4I98B 1UELB 2BY2A 1SVOA 3QODA 5B1BH 3ASNH 5JVGF 3T1BA 2WAQA 3D0SA 3HGYA 1GT0C 4KJZA 3BG9A 3E3VA 5EGOB 2LY9A 3P5JA 3MN2A 2M5WA 2YSRA 4IHXA 1DP7P 2VBZA 4M9XA 2JK3A 2PJPA 4Q4ZF 1B8IB 4RB0A 2ME6A 2YU9J 3PQKA 5C4XJ 1UHWA 3IUOA 3TW6A 5GAEJ 4DOZA 3LSMA 1YS6A 4BUPA 5E3MA 1H9TA 4DW6A 1BL0A 2XF6A 2BY3A 3LNQA 2D5VA 1LKXA 1G59A 1LUJB 1Y8QB 2BW3B 2QBYA 3S1QJ 2M4KA 2KHMA 2ISZA 2W85A 2DAOA 4FE7A 2HZTA 2ELHA 5F04A 4U0WA 3HKZN 1EV7A 1TTYA 2FBHA 1JKRC 3A02A 1JHHA 1ITYA 3K4CA 3MCZA 4EMSA 2G9WA 4A3BJ 4UB6C 2P7VB 2XPVA 2AHQA 1JTXA 2L9SA 2PQ8A 3CUOA 2EV0A 3OYKA 4ZYEA 3H35A 5D6FA 4IF4A 2F6CA 4YFKF 1FLIA 4RGRA 4W1UA 5CVRA 1Z67A 5B3SH 1XSDA 1NH3A 3PFIA 3ZQCA 3Q5FA 2VJ5A 5ICFA 3KP2A 4HOBA 5L3EA 5LEJA 3BR3A 2PMHA 1N25A 1G2HA 2WY7Q 4RAZA 2Z33A 3F72A 5DCMB 1LVAA 2W25A 3H0GJ 1QGPA 3R6SA 1VFCA 3JW4A 5LGTA 2DT6A 1D8JA 1A6IA 4BL0B 2DTZA 5F0FA 3H3VK 5E1ZB 2EA4A 1MH3A 5FLVA 2ZC2A 2HYGD 2P0WA 1AOYA 4HX7A 2COBA 1J2XA 2CRGA 3CP2A 4CCKA 3BR1A 1A04A 1FBUA 2AS5F 5LBQA 2DMUA 4Y15A 5EJCA 2ME0A 3OOUA 1Z1DA 3BOQA 4ABZA 4BE0A 4RM3A 4ZYGA 4G94A 3CC4I 3U2RA 2Q0OA 4LLGF 4LOCA 1S9HA 3OL4A 3HOUJ 2M0MA 3VOEA 3EYIA 3W2VA 2KLOA 3OYHA 4RMNA 4Y4RA 3PUFA 1JGGA 4NC7A 3OWTA 3VYTB 2R7DA 2FA5A 2M3AA 3WTTC 4A0YA 5M5WJ 1F43A 2XRLA 2UWMA 1G6NA 1O57A 4M73A 5KAFC 2DA1A 2Y0SA 2KIMA 1B1BA 4CYDA 2ZFWA 1YIJI 4MTEA 4R8HA 3QPLA 2CQ7A 2FUG2 3CJTB 1RR7A 1OMIA 1IGNA 1OQYA 2ADUA 4OAYA 4XLAA 1K6YA 1X3UA 4BGDA 3CJNA 2BHYA 3TOBA 2FU4A 2FMLA 2JWTA 2BY0A 1SFXA 1W5CC 3M8JA 4L9NA 1IN8A 4N4NB 2A05A 2L4MA 4HF2A 2VL8A 1U5TA 3H5NA 4JP0A 4LG0B 2O61A 1D1BA 3NARA 1WRJA 3RTRA 3S2WA 2B9SA 4HAMA 2HYFA 4BU2A 4CH7A 4HLYA 1HSJA 1L0OC 1ZGAA 4UUTA 1FY7A 3BY6A 4B4CA 3BTCA 3M8FA 4OMYA 2FBIA 2KIFA 3KX2A 4Q48A 4XLNF 4FTHA 4NHJA 1SD4A 2KRHA 3OOPA 1SFUA 2MG4A 1POGA 1IN7A 4M6VA 2DMNA 5A2QZ 5HS8A 2IA0A 1FZPB 4O6JA 3QQAA 2MFZA 3EUKL 5BS6A 3N4MA 2VKEA 4JX5A 4FASD 3FDYA 2L54A 1OR7A 2DO7A 3ABKH 3IWZA 5KNLA 2EIMH 5FRNA 5K7ZA 2VONA 1I27A 5F0CA 1HKTA 3Q0VA 1T95A 4HSRA 5DDGA 3QRFF 4R79A 2GOXB 3CCRI 1I50J 2EFWA 3DKYA 1O3SA 2BYVE 2VXDA 3CJRB 4LLLA 3WU1B 2LC2A 3DTIA 3SZTA 2Y9YA 1RUOA 2O5RA 2M4GA 3LL7A 1ORKA 3ZQ7A 3GCMA 4EJWA 2VASA 1I1GA 3SFIA 1GVDA 1YJNI 2EBIA 1ENHA 2K9MA 1QZEA 1HLVA 4XNFA 5BQTA 4XRMA 5ICCA 2NS7A 3VPRA 4YIRX 5M3FJ 1RIOH 2VE8A 2E34A 1LVKA 2IGMA 2WWYA 2EFPA 2GBYA 4LIVA 4CA0A 3HRUA 4ZZLA 1L3LA 4M9ZA 3K4MA 3SEZA 2XAJA 1W36D 4E7KA 3U9GA 3LFUA 1YG2A 3IAM2 3KP4A 3RQIA 5E3OA 2VODA 3S3NA 2FSWA 3JRAA 2H1LA 1JKOC 2MGQA 2R92J 2OU2A 3K0LA 2AXTC 2ELKA 3GXOA 5CQGA 2JUGA 3EUHC 3K4LA 4UV8A 5DD4A 2AXLA 1F1ZA 1R7JA 2L5QA 2COMA 3C18A 3I64A 5FLXZ 2ID6A 4QLCU 3BQYA 2W7NA 2YX7A 3W2AA 3F3XA 4G7HF 1Y1WJ 2K85A 2RNGA 2LG4A 3K4NA 4ZYDA 3DPLC 2FOWA 4BXXJ 2RQQA 3DEWA 2DODA 3ZQFA 2BBYA 2R4GA 4Y33A 1JI8A 1IUFA 3CJQB 3J80K 2MYSA 3FKIJ 2LBFB 3WU2C 2M7AA 1LEAA 2IGKA 2L7ZA 3LSTA 5JHFA 2L0KA 1WSUA 2DLLA 1WI9A 4YFXF 3LAJA 3CCQI 2F5EA 3GTKJ 2E2JJ 4CHUA 3ZXSA 4YIIA 1JTYA 3GMEA 2OBPA 2ELJA 1IV6A 2LFBA 4RA2A 1RRJA 5LFAA 2L4AA 1TWHJ 1IRXA 1YO5C 1JKPC 4FCYA 2NYXA 2BV6A 2IJLA 4MHGA 3IV5A 3CCJI 3B02A 5IYBJ 4BHBA 3UKGA 1G3WA 3V8LA 3HOTA 1SEUA 2VPRA 3ZMUA 5E18F 5F08A 3K6GA 1DDNA 2ECBA 3SZGA 1LDJA 5FKMA 3HJEA 4HDVA 1F5TA 4KN4X 2W48A 3GTMJ 1FSEA 1TLHB 1CF7B 2DBBA 2W57A 2XGDA 3DQVC 1SVMA 4OIOF 3CDHA 3M1EA 4LB5A 2D1VA 4OIRF 2WV1A 3RPUD 5HOOA 2VJJA 3HG9A 4I02A 5EG0A 1R5GA 2R7ZJ 1HDPA 3TOAA 4BACA 2HOTA 3GLXA 4HSTA 3H9GA 1PUFA 3BWGA 2DYRH 1XMXA 2VBXA 3I4MJ 3K69A 4IHWA 1MIJA 1IW7F 3WHBA 3CUQC 4EJTA 3RJPA 1WPKA 2L7MP 1ZLJA 4ESJA 4HF1A 4DIQA 4H4KC 3BZKA 2E19A 4M9SA 4PJLA 3V42A 3K7AJ 5EZHA 3DU5A 4N9IA 2DJNA 3GUDA 1TW3A 3KEOA 1W7PB 4D5FA 1ETOA 2RNJA 4WXHA 2DT5A 1WZ2A 1X19A 3JTGA 1MH4A 2EINH 3HC7A 2DK5A 3RI4A 1DU0A 3CC7I 3FHNA 3TW7A 2XGXA 3B6CA 1DP3A 2D2WA 3GFLA 4L9JA 3GTQJ 1V54H 3I54A 3FHZA 3AG4H 2AQEA 1W5SA 3KP6A 2JT1A 4PJMA 1ETYA 4QIWN 4NB5A 2Y48A 2IP2A 2PMUA 4AM3A 5C4JJ 1RESA 4XLPF 4RGSA 3GTLJ 1LDKB 3DPUA 5ILVA 2QM3A 1G3TA 3HTSB 4Y3OA 2OTJI 1BN5A 1A31A 2CW8A 2VKVA 1NTCA 3U21A 1QVTA 1V55H 2NAZA 5CLSA 1AA7A 1EKEA 1XGOA 3ULQB 4HF0A 2GXGA 4WF2A 1A6QA 4MEYF 2RV8A 3KYDB 3PIOF 2VOPA 4KICA 4ANJA 3M4OJ 1X1DA 2N8GA 2O03A 3K2ZA 1KA8A 3LOCA 3E5QA 1WJCA 4L5EA 1J7KA 4C2TA 5HVQC 3N97A 2GIVA 4HLXA 3V4GA 2QENA 2KIQA 4F55A 1FIPA 1HXDA 2DQLA 3O8GA 2BVMA 1MSFC 2PG4A 4E7ZA 2JTVA 2OQRA 1K79A 1SMTA 2BZTA 3QYBA 2P6SA 3SFZA 4KN7X 4CYCA 3I55I 1FBQA 1SD7A 1JHFA 1TZLA 2E5ZA 1YITI 4DGWB 3E1SA 4XICA 2QKMB 5DS9A 1ZK8A 1YOVB 3RPQA 5LEKA 1R58A 4F91B 2OCCH 5ILSA 3FXUA 1B72B 2DOFA 1XX5A 4HRIA 2NNYA 2DDAA 2K02A 3K1NA 2K9LA 1Z0XA 3O2PE 2H8RA 2IXSA 3PNVA 2ZMEC 5J3LA 2DJIA 4XL9A 2P5LC 1KGSA 4RS8A 3H36A 4S0HB 2EK5A 1ETKA 1R1TA 3QP6A 2DDBA 3V7RA 2P81A 2DA6A 1FSHA 2WTEA 1XG1A 3T8RA 3IH4A 2W1OA 4XK4A 1JUMA 1QHGA 2G0EA 1XCBA 4PGGA 1LPQA 3KYLA 1CQTA 2PI0A 2EA2A 3OL3A 4M3BA 2WA0A 3IL2A 4HDUA 5ILUA 1S7AA 5LRRA 1DPRA 3F8MA 1IN4A 4DNCA 1FTZA 1OLTA 3V8JA 3HPHA 5IT9Z 3A01B 2F48A 2HEOA 3S32A 2HQNA 2F5FA 4I6ZA 1ZGWA 3WTWC 2DW4A 3HSFA 2F5VA 1RNLA 4KIFA 4UB8C 3CD6I 3RIRA 1KQ8A 3VSKA 4F93B 3DKWA 1J0RA 4MGRA 4E4HA 1HKSA 3V7CA 3TKYA 4KDPA 5CVIA 1FMWA 4I09A 1APLC 4IOCF 2IA1A 3R4KA 3L2CA 2ZNYA 1K61A 3JREA 2VQGA 1USSA 5CPRB 3GW2A 5H6RA 3DXJF 3LSRA 3I59B 2Z16A 1VQOI 3VSLA 2EFNA 3LSJA 4GDFA 1E2XA 3S3MA 1NG7A 1JUPA 5DD8A 2MLGA 4QWQA 4C2UA 3L00A 3JAMK 5BMZA 3DTKA 1BR1A 3E5UA 1ZARA 1ETVA 1V5GA 3SHFA 5F0HA 2R5YB 2IBDA 1VQMI 1FTTA 1D0ZA 4A5NA 3GF2A 3C2BA 4EQQA 1I6HJ 3H1CA 1JJ8C 5F64A 4XQFA 4XKVA 4D7NA 1K4TA 1FJLA 1A35A 2G7UA 5BPDA 2LTPA 3NEUA 4NC6A 1MMSA 5K5RA 1H8AC 3CCVI 2QVOA 1KU7A 3BTIA 2V1XA 3MKZA 2KZVA 3JRHA 1LEBA 4ZC3A 2HYJA 5IP7J 2EIKH 2TCTA 3I58A 4CSWA 1TNTA 1C0WA 1WHUA 2K9SA 2LOOA 3T5XA 3S1RJ 4XLHA 5J4YA 2E71A 2KIUA 3V8KA 3GZNB 4ZTJA 1YS7A 4BEHA 3A0BC 1J59A 1MMNA 2I10A 1HQCA 2E1MC 4IXAA 4W97A 5DUKA 3OYGA 2E1OA 2BVLA 3KFWX 2V9VA 3OIOA 2ISYA 4MO7A 3RKQA 2K86A 2NVXJ 1YW7A 1G3YA 3K2AA 5CVUA 1IRZA 3NWSA 2HTSA 5BOXA 2WV0A 1WVRA 2FNAA 5FLXK 2JSPA 4P5OA 1FP2A 5D4SA 4Q5SF 3WE3A 3ZN1A 1BI3A 2HXIA 2X6WA 3OYNA 2MC4A 3VDXA 3IRRA 1RETA 4NQWB 2IRFG 3M1CA 3AG1H 4IHYA 3QOEA 2F5CA 4KMUX 4C30A 4D7MA 5DUIA 1IRGA 2XF5A 3BT9A 1EH7A 1P6RA 1GVJA 2XAUA 3OYBA 1BJAA 1NHAA 2TDXA 4UUSA 2EH3A 3H9JA 1EA3A 3LFKA 1MJ9A 3HUGB 1XGSA 2R93J 2CO5A 4BYYA 2LY2A 3OYDA 2E7XA 2V7FA 2VXZA 2FOKA 3IH3A 2NVYJ 4ENJA 3DCFA 3H9QA 2QQAA 2CWEA 2KMUA 2QZ8A 2JA8J 2HOAA 1FC3A 2KKOA 2LKSA 2ZB9A 3HKZA 5J1UA 3CMMA 3ASOH 3VODA 5JR3A 2D1HA 1XSXA 3G6EI 4MQVA 1D1CA 2VIXA 2B63J 2R7RA 1XD7A 2EV5A 2F5DA 2IEKA 1Y56A 2M34A 4ENMA 2CW0F 3WU0A 2E2IJ 1OFCX 1ZH5A 2HS5A 6PAXA 1P4XA 1YW9A 3DBLB 2M0CA 3I3LA 4MQ9F 4ON0A 4BNCA 4RB2C 3GFMA 4U0YA 1KYWA 2DCEA 2E36A 4BS9A 4DBRA 1WH7A 2P7CB 2LREA 1YFHA 2V79A 5F6FA 4CCLA 3ZOBA 4RBOA 1RZ4A 3CUQB 4I2OA 2I8DA 4HQMA 4E7JA 2NNNA 3GBGA 4IO9F 3KYCB 1FNNA 3PO3J 1YTYA 3JSOA 2A68F 2ICWG 1H89C 3BDDA 4BJ6C 3ZQHA 2HTJA 2MD5A 1JKQC 4NC8A 2ZFUA 1K78B 1F4KA 4G9YA 5J40A 2Q2EA 2JN6A 3IP4B 3A4CA 5IY5H 1V4RA 4PZJA 1D5VA 3A2KA 2B7EA 2VI6A 1UHMA 2DTRA 4PCQA 4Y7NJ 1BW6A 2IS4A 5HDGA 1QZYA 1LFUP 4KYWA 2IS6A 4CCMA 1X1CA 1UB9A 3FXQA 4FE4A 1SAXA 3MEXA 1TQPA 2CS3A 1QZZA 1B9MA 2A6TA 3I4NJ 4V19K 3FKJA 3CLOA 1OCCH 4XKWA 4KNYA 4BH9A 2RC4A 4A3GJ 3QPSA 2HFHA 4IPAA 4UVCA 5DYMA 3VYUB 3DU6A 1YRNB 2HR3A 2L01A 3K4BA 3MWMA 1DU6A 1PYVA 2W4SA 1IJWC 4MIMA 1IUYA 2MSYA 1R1UA 2FBKA 2FNPA 4CICA 1J75A 5HNHA 1YX5A 1U5TC 2X0LA 2X6XA 4S04A 2GA2A 4HA8A 2GWRA 2LVSA 3WGHA 2ZCWA 3TO7A 4MEXF 4UUVA 1BOAA 2LLKA 3J81Z 2R7WA 4ZDOA 2F4OB 3UR3C 2QSGX 2GAUA 1AWCA 3P9IA 2GZWA 5EZGA 2PJRA 3LA3A 1P2FA 4RAYA 4A6EA 1IRFA 5DTDA 2ETHA 1YHQI 2Z9OA 2QLZA 5JHUA 2E1CA 3U1KA 3OYFA 3I56I 1PVEA 1QO0D 3RQ4A 2CUFA 2PBIA 2X1CA 4LG3A 1EH6A 4KIGA 2ZMEB 3GVAA 4YELA 4BAYA 4D1QA 2VQHA 3HHHA 1OR7C 2PLYA 5FRMA 2YS9A 3BG7A 1NK3P 1QQIA 3ESWB 1OISA 1CGPA 4L18B 3IKTA 4FX4A 1QVUA 3J7ZI 1QU3A 1DGRM 4I0AA 3G3ZA 1XCVA 4U0VA 1VQ7I 2OD5A 2KQRA 3HDDA 2CUZA 4RGUA 4KMFA 3F22A 4LJZF 1FIAA 1WJ5A 3KZIC 3QAHA 4JX6A 1U6GA 4XORA 2VBYA 2JA2A 4XLCA 4F52A 3CQZJ 2LH9A 3S15J 3BJAA 1X2MA 5LGNA 5JI6A 2DA5A 2EZHA 1W7PD 3H5RA 4HEA2 4B3XA 4C3IJ 3GZ5A 4PJJA 4B09A 1IG7A 4EVIA 2LD5A 1IDYA 4MTDA 3TEDA 3FWEA 1MW7A 2XVCA 3BPXA 2L02A 1JE8A 4BQAA 1YYVA 1FP1D 5J6XA 2XPUA 3CO7C 4LLNA 2DPUA 3DBHB 3MD2A 4XSXF 2RAEA 4XOTA 3J7AY 1AKHA 3FXMA 2OQGA 1ERDA 2KL4A 3IWFA 5IYCJ 5K7HA 1PUFB 2OTLI 3TDZC 2L7FP 1FMVA 3DF8A 1HW1A 1J5YA 1XN7A 5L3DA 4QTRA 2OV7A 5HODA 2NS8A 1R1VA 4HW0A 5FFZA 3G73A 1JGSA 2ESNA 3OYCA 1H88C 1J09A 1REPC 4U88A 3F23A 1QA6A 2K9QA 2Z2SB 2KRCA 3OYMA 1FYMA 1EH8A 3Q9VA 2HXOA 3VB2A 2DK8A 2H27A 3QYEA 3CCSI 2XC7A 5D8LB 4IJAA 4UXNA 3GTPJ 4DBQA 1HA8A 4D9JA 3WE2A 2DFHA 3G1MA 1OYWA 1IV8A 3ROUA 3QYFA 3NAUA 1ZR2A 1Q1VA 3GTJJ 3ZN0A 5GP9A 3ABMH 4D0PA 1HW5A 2OCEA 1VQPI 2ZXJA 3JRIA 2Z1DA 4PFOA 5CYVA 4IEJA 2PFBA 1G8XA 2OZ6A 3PUBA 4WX9A 3RPUA 1U3EM 3S16J 2B0LA 2CQQA 4DZJA 1R6RA 5K7FA 2JUCA 2HPMA 2GXAA 1MSEC 1LE8A 4IQJA 2IW5A 1KU2A 2J5OA 2E1MB 5JFRA 2D45A 3MKYB 1VTNC 1T98A 5HDNA 1S3JA 4E6KG 2R7VA 2OF7A 4CZZA 2ZXHA 5H20A 1GV2A 1TL8A 5M5XJ 3NRVA 3FXRA 5AIPA 4IOAF 3AG2H 3FXKA 1DUXC 1S29A 1V3FA 3OR2C 3FMSA 3PNYA 2Y31A 2DFFA 2QA4I 1B59A 5GTHC 4PK4A 3WTXC 1B4AA 1E17A 4B1RA 1ACIA 1N78A 3OS2A 2RQPA 4KFCA 2FQ3A 2UXXA 2GXBA 4L5IA 1Y0UA 5GAGJ 3CCLI 1T56A 1A36A 3SXYA 4CO8A 5LHGA 4Y52J 2R5ZA 3MAJA 5J8FA 4Y13A 2GM4A 2QBYB 1ZAOA 3F8NA 2EWNA 4L5JA 4L0YB 1TC3C 2IAIA 3TMOA 4A3IJ 3N05A 2ZNZA 2V6CA 1SFOJ 1R4MB 2CUJA 5FB2A 2ZXIA 1TWCJ 1T0FA 1ON2A 2QEXI 4UVBA 4LITA 1SAUA 2DI3A 2P4WA 4NBQA 1E0EA 4MNUA 4C9YA 2QQBA 3LSHA 4UHTA 4LK0F 1D0YA 3LMMA 4IHSA 5CKTA 2HVRA 4BY1J 4XKBA 3KETA 1ZRDA 2BEOA 2CJJA 1BW5A 2Z5UA 2H94A 3SDBA 2G7HA 1VQ8I 1BOBA 4M3GA 2V9KA 3KLNA 4ESBA 4G7ZF 2IPQX 1A5JA 4A69C 2QKLB 2XUBA 4IHTA 1MDMA 2OC6A 1U8BA 3IHUA 2KDOA 3HOWJ 3MFKA 5KHDA 5LD2C 1K4SA 2XROA 2A07F 3F8CA 3RZDJ 5LLQA 4FETA 3ABUA 2O6GE 3FIWA 3KIOA 4IRHA 4JOMA 4C3JJ 2NVQJ 3WODF 2DA2A 4XR6A 4BY7J 1ZGJA 2DOEA 2LKXA 1WI3A 3IKVA 3L2RA 2L9VA 2IS1A 1SC7A 1IC8A 1Y0NA 1KU9A 2Y69H 4FISA 4GYIA 1RPWA 1MD0A 1T33A 4BQQA 1WJEA 2R0QC 3W6VA 3OIQA 4CUGA 1GUUA 3CP8A 3PO2J 2R7XA 1Z9CA 1SVLA 3BG3A 3CMYA 2JJ7A 5FKOA 1YW8A 3OIPA 3W6JB 3CESA 4A3KJ 3RCOA 1TWAJ 5ICGA 2NOGA 4A3CJ 1K83J 5EGOA 1HC8A 1MMDA 1YX3A 2K5CA 3RSNA 1D5YA 2AO9A 3KEQA 2WY8Q 1I3AA 1GLNA 1B8IA 2HU9A 3E97A 2OAZA 2CUEA 5E79C 4RDUA 1UMQA 3M07A 2DMPA 2DFIA 2NOJB 3KP5A 2M7BA 4RAFA 4CDGA 1O7FA 2AQFA 3LA2A 2XRNA 4G6TB 4RAGA 2O8XA 1TT5B 4C2MJ 2FXAA 4M74A 2BW3A 5F27A 2DMTA 1Z77A 1UHSA 2A5WA 1ONVA 5H2FC 1QRYA 2QQ8A 1B6AA 3D1NI 5F1RA 3VYSB 2E60A 1U5TB 2HOSA 4IVNA 2O7OA 3DP7A 3GX4X 1Y39A 3C2HA 4II3A 4WK8F 2ZO4A 3GZ6A 4U87A 3JTHA 3MZYA 2V1NA 3ZCOA 3ECHA 2R7TA 2OJED 2HVSA 3JSPA 5ED4A 3IC7A 2XSJC 2ESHA 3OV8A 3KZYA 4EGYA 4HNVA 5IPAA 2DXIA 1W0UA 1PP7U 1YIOA 4AU7A 2CFXA 2VQCA 2DU9A 4RLFA 1AHDP 4PSWA 2MH9A 2EJRA 5HNFA 5M5YJ 3CZ6A 2H09A 5KCMA 3OR1C 5EYRA 3LSGA 5AONA 3PSIA 5F1JA 3Q0UA 4G8XA 2V6EA 2MD0A 4AC0A 1ZG3A 4I7HA 4YEJA 3WG7H 2V9PA 5DCMA 4B43A 3PL8A 2XB5A 4WXDA 4XLFA 4J01A 3HRSA 3NQOA 1F36A 5CQEA 5E3LA 4EM1A 4E7HA 2W84A 5D5UB 4MFDA 1FOXA 3TP3A 3ERED 3G1OA 4IZZA 2PN6A 4XM3A 4UNOA 4B48A 3I0TA 2ZJPF 1W0TA 1MBHA 4I76A 3DFGA 2ZJ2A 2W82A 1ZYRF 2CG4A 4ZJZA 2CW7A 5KAIC 1RC9A 1NG6A 3TL4X 3V7SA 2KDZA 1QBJA 5JLXA 1S7EA 2FMYA 5DM7F 1FPQA 5GAHJ 3GLLA 4GO1A 5HLIA 4CXFA 1XGNA 1WJFA 1HF0A 1SANA 1YE9A 4AVPA 1ZHFA 2R7OA 1XPXA 1MBEA 4HNUA 2QYOA 1ETWA 5E8GA 3ZP5A 3WG9A 3A1YA 5A2QK 3U1DA 4U7DA 2E1NA 2DOAA 2Y0MA 2E5NA 3F8FA 5GTIC 4GCVA 4P96A 2Y30A 2QWWA 2VC1A 3AKZA 2O3FA 4HX8A 3BR5A 2HKOA 5EDNA 3HXLA 4KITB 3BP8A 4AIKA 1MNEA 1U9NA 2R7QA 2WAEA 2ECCA 2CV0A 4UY8I 1T2KA 3LQQA 2RREA 5EF6A 3OSGA 4AIDA 1VQKI 4LG0A 2EILH 2KFDA 2XAQA 1VQ5I 1O3QA 3P7NA 3EETA 4CGZA 5AIQA 2MW8A 3GYHX 4DYCA 4H0EA 1XC5A 3M9AA 3BZCA 1VI0A 1X1PA 2VT3A 3S14J 1Z6TA 4RLQA 4EEFG 2XSDC 2YU3A 3HPGA 3ZGKA 4DZPA 2UZKA 4AUXA 2JA7J 1UZCA 4GFBA 2F4IA 3MZHA 1JXSA 4O5VA 3F8BA 1NK2P 2CYYA 2Y2ZA 5DCFA 3HB9A 2LYCA 3GTOJ 1XMAA 2DA7A 2HQAA 4EV0A 3O8HA 3VEPA 2A61A 5CJ9A 4A0ZA 4U7BA 1LJ9A 1X4OA 5C44J 3MMYB 1HBXG 3FX3A 3E5XA 4A2UA 1KQ9A 2HDWA 4JYKA 3CCEI 5GADJ 3BJOA 4FQGA 2O8KA 4XIDA 1X1AA 3E0JB 2ZXWH 4G6DA 1P4AA 1BIAA 1BR2A 2XAHA 3DLLF 1IZ1A 1Z7UA 3SQNA 2RKHA 3K4JA 4OINF 1YJWI 3J80Z 4AWXB 3TO9A 1D0XA 2DA4A 5EG0B 3SEQA 4LD5A 1SFKA 2CFOA 4P9FA 1PP8F 2ZSHB 5GPAA 2EPFA 1ZR4A 1I39A 3GO5A 5FKLA 1O4XA 1PJRA 4B3AA 1JUSA 3HGGA 3K70D 4X6AJ 4J00A 3L9FA 5IOZA 3L2QA 2MABA 4LGWA 2JMWA 1OCRH 4EATA 2XAGA 3VYRB 3MKLA 1TNSA 3FF5A 5FGMA 2NVUB 3H0DA 2JQ7A 1XDSA 3OMYA 1YQAA 2E2HJ 1RI7A 3LAPA 2XKPA 4AIJA 1OCPA 3BLYA 2EIJH 3ZQIA 1S6LA 1Q1HA 5TJJA 1MKMA 2BXYA 1IXCA 1Y6IA 1O3RA 1OCTC 3HRMA 5EEGA 2JA5J 3H3UA 3ABLH 1IAWA 1IO2A 2CU7A 4ZYAA 2R3SA 2HOEA 5ERIA 3PNTA 1VQ4I 3CCUI 3WGIA 2VPLA 4PFPA 2ZJRF 3RZOJ 2QUFA 2LMDA 3HEFA 3LSIA 2M30A 2HZDA 3X2QH 1ZTRA 1ULYA 2LBFA 1X3WB 2RGVA 3EUAA 4IRIA 3L2VA 1MZBA 4HBLA 5BNGA 3HL2A 4KISA 2EZLA 1WJDA 3C3WA 2HDCA 2XDVA 1BI0A 2X1EA 3JRDA 3DKXA 3ISPA 3RDIA 3HZJA 5E20A 4XMYA 1U9OA 4BJTA 4DQ2A 1D3YA 4ZYHA 1T6SA 3KLOA 1W1WE 2X9DA 4ZZDA 4M71A 2GQQA 2VT2A 2M8EA 4XKCA 4LK1F 3ONQA 3ZQLA 2IVMA 1OCZH 3I5UA 1LB2A 1FOKA 2MA3A 1WGXA 5FD6A 1I3QJ 3CF2A 2ID3A 2MBFA 3B6AA 4DYQA 2HKXA 2L3DA 1R5HA 1RUNA 2HVQA 1FX7A 5D5WB 2JVHA 2CQNA 4I01A 3S17J 4BJ5C 1Y8RB 3C2GA 4OAZA 1R9TJ 2FEZA 3EDPA 1CF7A 3KP3A 4CCNA 4CYCB 1MJBA 1P9QC 2R7FA 3WHCA 2L2OA 2NS0A 3W6KB 3K4KA 4GGGA 1BIBA 2WADA 4PDKA 3HTUA 1PDNC 2FE3A 2CQXA 2OUMA 2XF7A 3I71A 2WAQN 5KVRA 2ZSIB 1ZQ3P 3E7LA 2BGCA 3A0HC 2VOOA 3BR6A 3WTYC 2VC0A 3HOVJ 2LRDA 3M7GA 3ZQQA 2H6CA 4HYEA 2JSCA 4PJNA 3BPVA 2YR2A 2X51A 3COAC 2PEXA 5EEAA 4OU0A 1HDDC 5FD5A 3OY9A 3BR0A 5FROA 1DGWY 2VBWA 4G12A 4O3MA 3BTJA 1U0JA 2Y75A 5IP6A 2MLKA 5IP9J 1T39A 2HDDA 4KT5C 1RKTA 2PMZA 4RM2A 4QSHA 5IOYA 1XS9A 3R61A 1W7PA 1WJAA 1T38A 1TP4A 2Y9ZA 5HDKA 1R71A 3Q0WA 1W36C 2STWA 4HV5A 3BZ6A 3CTAA 2BXZA 4BKXA 4IQ4A 3E6MA 3ZMDA 3TBIA 4Q47A 2DT7B 3L2UA 3RYPA 1RKWA 2VUMJ 2M8GX 2JRMA 4XLEA 1BI1A 2QCOA 3OYIA 4BDYA 3REOA 2CQKA 4E7LA 4I99C 3IAS2 4MFEA 3JRFA 4KA4A 4XN3A 3DEEA 3BCAA 3FBNB 4BE2A 3BR2A 1WWXA 3BQZA 1MMAA 3WTUC 1BA5A 4A93J 3H3ZA 3LWFA 1E3PA 2X85A 4CZCA 1Z05A 5ICEA 1R36A 4M6YA 3BG6A 4WXCA 3CMAI 3RKWA 4A3MJ 2A6HF 3HYIA 3LQRA 2YPRA 1TW2A 2PMZN 2NVTJ 5J8CA 2ZBKA 4LMYA 1K6OA 2KT0A 1O7LA 5BPIA 4Z6YA 3HBLA 5J1YA 2DYSH 2M45A 4LFUA 1OCOH 4A6DA 1V5FA 3DPTA 3WTSC 1YJ9I 2CGPA 4GYGA 3TGNA 3RKXA 1YLFA 4BXFA 2IGNA 3T0YA 3M8EA 1S72I 2Q1ZB 5JVTA 2QSFX 5IT3A 5E17F 3L2WA 5IT9K 1P92A 2BE5F 5EEHA 3KCCA 3FM5A 2DN0A 5FJ8J 3FK6A 2KPMA 1JT0A 5E1WA 1S5LC 2K4JA 3AFHA 3HRTA 4PGHA 4JX4A 1UJ8A 1P4WA 2O0YA 2HNHA 1XGMA 1B72A 1WH5A 1VQ9I 3DV8A 4N4OB 3Q9SA 3ZR8X 5L3FA 2HGCA 1UG2A 3HOZJ 2LR8A 5H6QA 4GRIA 2VQLA 4I0BA 2JVGA 2JZYA 2RDPA 3FXOA 1G4DA 2E7WA 2CH0A 3TO6A 3CDIA 4XRSG 2QSHX 1GHCA 2JPCA 2LK2A 2NRAC 2K4BA 4OIPF 3FXLA 4NDLA 2JRTA 3D5RC 2V4JC 4NUBA 4BEHB 3S1MJ 2Y0SN 3T8TA 3DBRB 4DYRA 4ZTFA 4EM0B 1I6XA 1IN5A 3JAMZ 1R4NB 3LSKA 3I9V2 4B8XA 4RGXA 1EJ9A 3F6OA 5HS9A 3L09A 4EM2A 2EZIA 2V26A 3G71I 3MZ8A 2EFOA 2DPDA 1LFBA 5D5VB 1E3HA 2XAFA 5DV5A 3IH2A 3A01A 1ON1A 2VKHA 3K10A 2R7SA 2XGEA 2A5YB 2JA6J 1JT6A 1R5ID 3F9KA 3ECOA 4EGZA 2XGCA 1TT0A 2FD5A 2GOMA 4P9UA 1FWZA 2LY1A 3I4PA 1HSTA 4PSXA 3TP0A 4F3QA 4M6XA 3R60A 2Z99A 2EB7A 4UUSB 3MKWB 1N75A 1SFEA 2RN7A 1TQIA 3B73A 5D8KB 3QPHA 4EJUA 2X6YA 1LDDA 2UUZA 3AL0C 1B9NA 4GXOA 2FQ4A 3OYLA 1JJ6C 1IN6A 2DMQA 5HS7A 1X4PA 5TRDA 1IDZA 2KRFA 3I59A 1OYYA 1D1AA 3CCMI 4HPQA 1T0FC 1GXQA 2FX0A 1UFMA 1BI2A 4A3EJ 1H0MA 4BE1A 2GA1A 1VQ6I 3PM1A 2R5YA 4YG2F 3UNGC 3S8PA 4BBSJ 4ZDLA 3W3CA 2JPBA 2K27A 5TISC 1IXRC 1N77A 3JRBA 3CMEI 1FBSA 2XASA 1VZ0A 4F92B 3ZMVA 3K1PA 2P5KA 1AU7A 3EQLF 4AD9A 3D5LA 4X0GA 1K7AA 1ZLKA 3FZVA 4EJVA 1ZELA 1V5EA 5J1RA 1FYKA 1PUEE 4G6QA 4L9TA 4B47A 4A3JJ 3CDLA 4UV9A 2L9NA 4A3DJ 2KZGA 1ZREA 1XMKA 5LHHA 2QF7A 1U78A 2EV6A 1DPUA 3ELKA 3HSEA 1QNTA 2M87A 2RVCA 4TV7A 3W2WA 1ODDA 4ENKA 2UXNA 1MNMC 5B1AH 2FJ1A 2O9LA 3PSFA 4JBAA 2ZKZA 2CSOA 2QQ9A 1ZKGA 2Q2EB 5E3NA 5HLTA 3HOYJ 3EUHA 4MLOA 4AYBA 1Y1VJ 4A0XA 3S93A 1R22A 4M3EA 3SDGA 2GIZA 4IKFA 1S8NA 3CF5F 5HLHA 2HI3A 1STZA 1OPCA 1VF9A 4BXUA 1TBXA 3SJMA 1BC7C 3I53A 5HLGA 2YX4A 3FMRA 4NQWA 3SYTA 5LRSA 3WTVC 3G1LA 5D5XB 4P1WA 3WTZA 3ZRGA 3LA7A 3GTGJ 4FX0A 5K5OA 4XBFA 2P6TA 3ZPLA 1USTA 3ML6A 1Z6RA 5D6EA 4IX7A 4B44A 1W4MA 1WJBA 2TRTA 2YUSA 3ERMA 1MMGA 4A5MA 9ANTA 1LQ1A 1FOYA 1X2NA 3MVPA 3AG3H 2W24A 4JQFA 3F21A 1GV5A 1MNDA 1R23A 1X58A 1IF1A 3CCYA 3EYYA 4HX4A 2R7UA 2DA3A 4E70A 1TWFJ 3HUGA 4BDZA 3C7JA 2STTA 1BM9A 4AYBN 2WC2A 4LB6B 4E7IA 3Q3SA 2KISA 3FXJA 4P55A 1W5TA 4A3LJ 3QPTA 4IHVA 3K9TA 1E3OC 3R0JA 1T8IA 4BBRJ 3BC8A 3FBIB 1Z7LA 3H5AA 3HOSA 2XIGA 1SD5A 2X4HA 4S05A 2LKPA 2BOLA 3O6BB 1T08B 1I5ZA 5D4RA 1XSVA 2PJRB 4XRSA 4QPQA 1QPIA 4BQNA 2VJ4A 2H1KA 5GPCA 1DQUA 1LFPA 4ASNA 2LSOA 2FF4A 1ZN2A 4D5CA 4IRGA 2OPTA 3CLQA 3L7WA 1BJZA 5K1YA 4BHPA 1R00A 3RKYA 1VNDA 2XKOA 4RB3C 1F9NA 2HPIA 3BTLA 1OKRA 3CUQA 3GFIA 5TGTA 1H9GA 3OSFA 3KE2A 4X1EA 4JK1X 3S2HJ 4XONA 1SD6A 4RB1A 1G3SA 1QHHD 1R49A 2FRHA 2VN2A 3QP5A 4XRFA 2DQRA 1UG0A 1LNWA 3WGGA 1K78A 3E6DA 3QU3A 2P5VA 2E35A 1MBGA 3PJRA 3OYJA 2IT0A 3J81K 2HQ5A 1X1BA 2L9RA 3OS1A 1S7OA 4DJAA 2LF8A 3DEUA 4R1HA 3ZQGA 5LGUA 1ZG1A 1QPMA 3E6BA 4ITVA 2X1DA 1KZHA 1ETXA 1Z3YA 1BBYA 2WAFA 3PQJA 3L1PA 5FLMJ 1FT9A 1U2WA 2BY1A 3VFZA 1YI2I 2XHKA 2LF7A 1KYZA 2H8WA 2X6OA 5L3CA 2F4MB 3ZMZA 1O3TA 1XDUA 1AKHB 3SZPA 3HM5A 4V2FA 5L3GA 1YRNA 3P9KA 5B5EC 2K7LA 4F7ZA 4BQOA 4FHTA 5C3EJ 2ZJQF 1J9IA 4NNJA 2GLOA 1MJAA 3GFJA 2M9HA 4XSZF 2CV1A 3BCBA 4IL6C 4HG2A 2Z3YA 3JCUC 3K70C 3H92A 3LSPA 2VLAA 2IS2A 4HNTA 1TWGJ 3ZMSA 4WCGA 4HV6A 4XOPA 3D5SC 4G7OF 1IXSB 2X48A 3BG5A 1P7IA 3C1DA 2VB6A 2LDUA 3KZZA 3G2BA 1Z91A 1KONA 4A12A 4KT6A 5IYDJ 3IRQA 4Z2YA 5L3BA 1WFXA 3BROA 5J47A 4Y17A 3DWLE 4ZDPA 4E7SA 3KP7A 4KIBA 1XB4A 2A3SA 3P9CA 2IA2A 5E8IA 1FYLA 2OA4A 4EJOA 1HW2A 4N0BA 3OS0A 1FEXA 5DM6F 4PUSA 2ZMEA 3AAFA 2LP0A 5E1XA 4V2GA 3ABTA 4C3HJ 5B66C 4FT8A 3TQNA 5J4VA 3CC2I 1MGTA 5CVJA 4LIUA 3BJ6A 1LE8B 4YFNF 3A03A 4OMZA 3F0CA 3FMQA 1X3ZB 4J19A 2HQRA 3NWTA 1SMYF 3HHGA 3QU6A 4N9HA 2UV1A 1ZG5A 4M72A 2NXNB 3J7AO 2VJIA 3RYRA 2OZUA 4L0ZB 1MBJA 4M3DA 1MBKA 2KJCA 4ENNA 3DLAA 5FKKA 2K40A 4L9VA 2CMPA 4ESFA 5M3MJ 3OYEA 1GXPA 1M1EB 4BHCA 2VE9A 1ZRFA 2K3FA 3QWLA 1VQLI 1ZRCA 1BR4A 3KPHA 2HWVA 4XN0A 1GDTA 3PFYA 1TQMA 4M3FA 2P8TA 1UCRA 4HQEA 2M1BA 3JRGA 4OIQF 1FOWA 3PIPF 2VKDA 3FISA 4KUMA 2EQRA 5KK1A 2BHZA 1OYIA 2J5PA 1P7JA 2R5ZB 2WB1A 2PX9A 4PJ0C 3OYAA 2H6BA 3AL0B 1KU3A 4HZFA 2V1UA 3HSRA 2QGUA 3JRCA 3M3YJ 2ACJA 3F6VA 4AIHA 1Z3XA 3O3KA 4UVAA 2C6YA 1OJLA 2I5UA 4YRVA 1D8KA 3DTEA 3JR9A 2XV4S 5LHIA 1WKMA 1WQ2A 5FKNA 3S1NJ 3QOPA 2F2EA 4AVZA 2M2EA 1MBFA 5DEQA 1Z21A 2A69F 2KP6A 2K3PA 4K2EA 4CCOA 1HKQA 2CV2A 3VWBA 3TDUC 3R0AA 2XB0X 1MDMB 1KQ0A 1I1SA 2LNBA 4II2A 5FFXA 1BC8C 5FO5A 4QPOA 2WB1N 3HOXJ 2MC3A 3J7YJ 3FM3A 4OWRB 1HOMA 2DFEA 5CVVA 3CO6C 3FK7A 4WWCA 2W00A 4CCJA 1U8RA 1RR8C 2IGOA 3HIFA 3K1MA 2V1DA 1ETQA
chains in the Genus database with same CATH topology
2W1OA 1QHGA 2L7KA 1UAAA 3KYLA 3TMOA 3N05A 3OL3A 2WA0A 1V5FA 3DPTA 2CUJA 2WBMA 2ZXIA 1OLTA 4BXFA 4LITA 1SAUA 2IGNA 3HPHA 1E0EA 3EPZA 4C9YA 3S3OA 2Q1ZB 3KEYA 3LSHA 3L2WA 1UELB 3S32A 3QODA 1D0YA 3LMMA 5CKTA 2HVRA 2WAQA 2KPMA 4XKBA 3AFHA 3SDBA 4KJZA 2F5VA 1BOBA 2V9KA 2HNHA 2QKLB 3VSKA 2OC6A 4N4OB 3ZR8X 4F93B 2KDOA 4E4HA 4GRIA 2VQLA 2JVGA 1FMWA 5KHDA 5LD2C 2CH0A 3IUOA 4FETA 4DOZA 3LSMA 4JOMA 4BUPA 2VQGA 5CPRB 2XF6A 4XR6A 3D5RC 2V4JC 4NUBA 4BEHB 2Z16A 1LKXA 1G59A 3VSLA 3S3MA 2BW3B 3L2RA 1NG7A 4ZTFA 2IS1A 2M4KA 2KHMA 4C2UA 3LSKA 3I9V2 3DTKA 1BR1A 1V5GA 2V26A 1D0ZA 4BQQA 3K4CA 1WJEA 2R7XA 3OIQA 4CUGA 3CP8A 2VKHA 3K10A 4XQFA 4XKVA 2R7SA 3OIPA 2L9SA 3OYKA 3CESA 3H35A 3RCOA 2F6CA 3F9KA 1MMDA 1TT0A 1YX3A 2K5CA 2GOMA 3MKZA 2KZVA 3RSNA 2LY1A 4PSXA 2WY8Q 4ZC3A 1GLNA 4F3QA 2VJ5A 2HU9A 3MKWB 4CSWA 1N75A 2LOOA 2X6YA 2NOJB 2M7BA 2UUZA 3AL0C 2WY7Q 4XLHA 2AQFA 4G6TB 3OYLA 1X4PA 4ZTJA 4BEHA 1MMNA 2E1MC 3OYGA 2DT6A 1D1AA 2BW3A 2BVLA 4BL0B 4HPQA 1T0FC 2A5WA 4BE1A 3VYSB 3NWSA 2P0WA 2E60A 3CP2A 3UNGC 3S8PA 4CCKA 2JSPA 4P5OA 4ZDLA 3W3CA 1N77A 3C2HA 4II3A 2X6WA 3OOUA 4U87A 2MC4A 1VZ0A 4F92B 3OYNA 3VDXA 2V1NA 3ZCOA 2R7TA 2HVSA 4BE0A 4RM3A 4NQWB 3D5LA 4X0GA 2XSJC 1S9HA 1ZELA 3M1CA 1V5EA 3OL4A 3QOEA 2DXIA 2M0MA 4C30A 4AU7A 2VQCA 2XF5A 3W2VA 4RLFA 4B47A 2KLOA 3OYHA 2L9NA 4PSWA 2XAUA 4RMNA 3OYBA 4Y4RA 5HNFA 3CZ6A 4NC7A 3OWTA 3VYTB 5KCMA 3OR1C 3H9JA 2M3AA 3LSGA 3PSIA 1EA3A 3W2WA 2UWMA 2V6EA 2MD0A 3HUGB 4YEJA 2Y0SA 3PSFA 2LY2A 3OYDA 2V7FA 4B43A 2VXZA 3PL8A 4XLFA 4J01A 2FUG2 2Q2EB 3H9QA 5HLTA 4OAYA 4XLAA 4MLOA 5CQEA 1K6YA 2KMUA 4AYBA 4BGDA 4E7HA 3HKZA 3S93A 3CMMA 3M8JA 1D1CA 2VIXA 4N4NB 4IZZA 2VL8A 3H5NA 4XM3A 2R7RA 4IKFA 1D1BA 3RTRA 4B48A 4BU2A 4CH7A 1Y56A 2W82A 4ZJZA 2CW7A 3I3LA 3SYTA 1NG6A 3TL4X 4P1WA 2DCEA 3ZRGA 4BS9A 4DBRA 3KX2A 2LREA 2KRHA 4IX7A 4B44A 4CCLA 1WJBA 1MMGA 1WJFA 2I8DA 1YE9A 4E7JA 2R7OA 3GBGA 4JQFA 4HNUA 1MNDA 3A1YA 2MFZA 3EUKL 2DOAA 2E5NA 2R7UA 4FASD 3FDYA 4BDZA 5KNLA 5FRNA 4BJ6C 4E7IA 3AKZA 4NC8A 2ZFUA 1T95A 4HSRA 3HXLA 4R79A 4KITB 2GOXB 3IP4B 3A4CA 1MNEA 2R7QA 3DKYA 2VXDA 3BC8A 3CJRB 2WAEA 3FBIB 2CV0A 1Z7LA 2LC2A 3DTIA 3H5AA 3A2KA 3HOSA 2RREA 2O5RA 2M4GA 3LL7A 2BOLA 2IS4A 2VASA 2PJRB 4QPQA 2IS6A 4BQNA 4CCMA 2K9MA 1X1CA 4XNFA 2VJ4A 1DQUA 1LFPA 4RLQA 2CS3A 1LVKA 3HPGA 2IGMA 3ZGKA 4LIVA 4CA0A 2A6TA 3K4MA 3SEZA 1W36D 2F4IA 4E7KA 3FKJA 3LFUA 4XKWA 2HPIA 3IAM2 2LYCA 5TGTA 2HQAA 3S3NA 3VYUB 3DU6A 4XONA 4U7BA 1X4OA 3K4BA 1QHHD 1PYVA 3MMYB 2JUGA 3EUHC 2W4SA 3K4LA 5CQGA 2L5QA 2HDWA 1UG0A 2W7NA 5HNHA 3W2AA 1X1AA 1YX5A 3E0JB 2RNGA 2LG4A 2X6XA 3K4NA 1BR2A 3PJRA 3OYJA 3DPLC 2R7WA 4ZDOA 2RQQA 3K4JA 3UR3C 1X1BA 3OS1A 2R4GA 4Y33A 4DJAA 1JI8A 3CJQB 1D0XA 2MYSA 2LBFB 3SEQA 2M7AA 1SFKA 2CFOA 2IGKA 2PJRA 5JHFA 2ZSHB 4ITVA 2X1DA 1PJRA 3K70D 1Z3YA 4J00A 2WAFA 3L2QA 2MABA 4EATA 3OYFA 3ZXSA 3VYRB 3H0DA 3RQ4A 2ELJA 3OMYA 2X1CA 4LG3A 4YELA 4D1QA 5LFAA 2VQHA 3BLYA 1OR7C 1IRXA 5FRMA 3BG7A 3HOTA 4BQOA 4NNJA 1Y6IA 3K6GA 3BCBA 2CV1A 1QU3A 4HG2A 1DGRM 3SZGA 3K70C 2VLAA 2IS2A 4ZYAA 4HNTA 2KQRA 2CUZA 3PNTA 3DQVC 4XOPA 3D5SC 2VPLA 4PFPA 1WJ5A 2VB6A 4XORA 2JA2A 3G2BA 4XLCA 4F52A 3LSIA 3RPUD 2LH9A 1KONA 2HZDA 2VJJA 3HG9A 4KT6A 5HOOA 2LBFA 3EUAA 1WFXA 3H5RA 4HEA2 3L2VA 4BACA 4B3XA 4HSTA 3H9GA 4PJJA 3HL2A 4KISA 3DWLE 1WJDA 4ZDPA 4E7SA 2XDVA 2X1EA 3DKXA 1MW7A 4XMYA 4BJTA 3OS0A 4DIQA 4H4KC 4PUSA 3MD2A 4XOTA 3J7AY 4PJLA 4XKCA 1ERDA 2KL4A 3V42A 3ONQA 3DU5A 4LIUA 1FMVA 3CF2A 2OV7A 1X19A 3HC7A 2HVQA 3OYCA 3FHNA 2JVHA 1J09A 1DP3A 3NWTA 4BJ5C 2UV1A 2Z2SB 2KRCA 3C2GA 4OAZA 3OYMA 2VJIA 2AQEA 4CCNA 1P9QC 4PJMA 2L2OA 3QYEA 3K4KA 2XC7A 2WADA 3DLAA 4DBQA 1LDKB 3OYEA 3DPUA 2CMPA 2OUMA 1HA8A 4D9JA 2XF7A 4Y3OA 2ZSIB 2CW8A 3U21A 3QYFA 1BR4A 1AA7A 4XN0A 2LRDA 3ZQQA 3PFYA 4PJNA 2X51A 4ANJA 2VKDA 1X1DA 2Z1DA 4PFOA 1WJCA 3OY9A 1G8XA 2WB1A 3PUBA 5FROA 1DGWY 3OYAA 4C2TA 5HVQC 1U0JA 3AL0B 2PMZA 4RM2A 1R6RA 2HPMA 1WJAA 4F55A 4IQJA 2BVMA 1W36C 2E1MB 1Z3XA 4IQ4A 4E7ZA 4YRVA 3DTEA 3TBIA 3MKYB 2DT7B 3QYBA 3L2UA 4E6KG 2R7VA 4XLEA 3OYIA 4BDYA 2ZXHA 1TZLA 2E5ZA 4DGWB 3E1SA 4AVZA 4E7LA 2QKMB 1Z21A 3IAS2 2KP6A 4F91B 2K3PA 4CCOA 3OR2C 4XN3A 2CV2A 3DEEA 3BCAA 3FBNB 3PNYA 4BE2A 3VWBA 4HRIA 1MMAA 2K9LA 4PK4A 4II2A 2IXSA 3PNVA 2X85A 4CZCA 2DJIA 4XL9A 1N78A 3OS2A 4QPOA 4OWRB 3BG6A 2W00A 4CCJA 2IGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3P A;  2MFZ A;  2M0M A;  2MAB A;  2KHM A; 
#chains in the Genus database with same CATH topology
 4ETS A;  3E6C C;  1WCM J;  2L7K A;  2K9N A;  2EZK A;  4ZH4 F;  2XPW A;  4OOI A;  1UAA A;  3ZMT A;  1VQN I;  5K5Q A;  2EFQ A;  3S2D J;  2WBM A;  3GWZ A;  2KJB A;  1XTA A;  2A6E F;  3GEZ A;  2MH2 A;  5JLW A;  4YIF A;  3MQ0 A;  4A3F J;  1HCR A;  3EPZ A;  2Q8K A;  3G4S I;  3S3O A;  1EF4 A;  3KEY A;  4I98 B;  1UEL B;  2BY2 A;  1SVO A;  3QOD A;  5B1B H;  3ASN H;  5JVG F;  3T1B A;  2WAQ A;  3D0S A;  3HGY A;  1GT0 C;  4KJZ A;  3BG9 A;  3E3V A;  5EGO B;  2LY9 A;  3P5J A;  3MN2 A;  2M5W A;  2YSR A;  4IHX A;  1DP7 P;  2VBZ A;  4M9X A;  2JK3 A;  2PJP A;  4Q4Z F;  1B8I B;  4RB0 A;  2ME6 A;  2YU9 J;  3PQK A;  5C4X J;  1UHW A;  3IUO A;  3TW6 A;  5GAE J;  4DOZ A;  3LSM A;  1YS6 A;  4BUP A;  5E3M A;  1H9T A;  4DW6 A;  1BL0 A;  2XF6 A;  2BY3 A;  3LNQ A;  2D5V A;  1LKX A;  1G59 A;  1LUJ B;  1Y8Q B;  2BW3 B;  2QBY A;  3S1Q J;  2M4K A;  2KHM A;  2ISZ A;  2W85 A;  2DAO A;  4FE7 A;  2HZT A;  2ELH A;  5F04 A;  4U0W A;  3HKZ N;  1EV7 A;  1TTY A;  2FBH A;  1JKR C;  3A02 A;  1JHH A;  1ITY A;  3K4C A;  3MCZ A;  4EMS A;  2G9W A;  4A3B J;  4UB6 C;  2P7V B;  2XPV A;  2AHQ A;  1JTX A;  2L9S A;  2PQ8 A;  3CUO A;  2EV0 A;  3OYK A;  4ZYE A;  3H35 A;  5D6F A;  4IF4 A;  2F6C A;  4YFK F;  1FLI A;  4RGR A;  4W1U A;  5CVR A;  1Z67 A;  5B3S H;  1XSD A;  1NH3 A;  3PFI A;  3ZQC A;  3Q5F A;  2VJ5 A;  5ICF A;  3KP2 A;  4HOB A;  5L3E A;  5LEJ A;  3BR3 A;  2PMH A;  1N25 A;  1G2H A;  2WY7 Q;  4RAZ A;  2Z33 A;  3F72 A;  5DCM B;  1LVA A;  2W25 A;  3H0G J;  1QGP A;  3R6S A;  1VFC A;  3JW4 A;  5LGT A;  2DT6 A;  1D8J A;  1A6I A;  4BL0 B;  2DTZ A;  5F0F A;  3H3V K;  5E1Z B;  2EA4 A;  1MH3 A;  5FLV A;  2ZC2 A;  2HYG D;  2P0W A;  1AOY A;  4HX7 A;  2COB A;  1J2X A;  2CRG A;  3CP2 A;  4CCK A;  3BR1 A;  1A04 A;  1FBU A;  2AS5 F;  5LBQ A;  2DMU A;  4Y15 A;  5EJC A;  2ME0 A;  3OOU A;  1Z1D A;  3BOQ A;  4ABZ A;  4BE0 A;  4RM3 A;  4ZYG A;  4G94 A;  3CC4 I;  3U2R A;  2Q0O A;  4LLG F;  4LOC A;  1S9H A;  3OL4 A;  3HOU J;  2M0M A;  3VOE A;  3EYI A;  3W2V A;  2KLO A;  3OYH A;  4RMN A;  4Y4R A;  3PUF A;  1JGG A;  4NC7 A;  3OWT A;  3VYT B;  2R7D A;  2FA5 A;  2M3A A;  3WTT C;  4A0Y A;  5M5W J;  1F43 A;  2XRL A;  2UWM A;  1G6N A;  1O57 A;  4M73 A;  5KAF C;  2DA1 A;  2Y0S A;  2KIM A;  1B1B A;  4CYD A;  2ZFW A;  1YIJ I;  4MTE A;  4R8H A;  3QPL A;  2CQ7 A;  2FUG 2;  3CJT B;  1RR7 A;  1OMI A;  1IGN A;  1OQY A;  2ADU A;  4OAY A;  4XLA A;  1K6Y A;  1X3U A;  4BGD A;  3CJN A;  2BHY A;  3TOB A;  2FU4 A;  2FML A;  2JWT A;  2BY0 A;  1SFX A;  1W5C C;  3M8J A;  4L9N A;  1IN8 A;  4N4N B;  2A05 A;  2L4M A;  4HF2 A;  2VL8 A;  1U5T A;  3H5N A;  4JP0 A;  4LG0 B;  2O61 A;  1D1B A;  3NAR A;  1WRJ A;  3RTR A;  3S2W A;  2B9S A;  4HAM A;  2HYF A;  4BU2 A;  4CH7 A;  4HLY A;  1HSJ A;  1L0O C;  1ZGA A;  4UUT A;  1FY7 A;  3BY6 A;  4B4C A;  3BTC A;  3M8F A;  4OMY A;  2FBI A;  2KIF A;  3KX2 A;  4Q48 A;  4XLN F;  4FTH A;  4NHJ A;  1SD4 A;  2KRH A;  3OOP A;  1SFU A;  2MG4 A;  1POG A;  1IN7 A;  4M6V A;  2DMN A;  5A2Q Z;  5HS8 A;  2IA0 A;  1FZP B;  4O6J A;  3QQA A;  2MFZ A;  3EUK L;  5BS6 A;  3N4M A;  2VKE A;  4JX5 A;  4FAS D;  3FDY A;  2L54 A;  1OR7 A;  2DO7 A;  3ABK H;  3IWZ A;  5KNL A;  2EIM H;  5FRN A;  5K7Z A;  2VON A;  1I27 A;  5F0C A;  1HKT A;  3Q0V A;  1T95 A;  4HSR A;  5DDG A;  3QRF F;  4R79 A;  2GOX B;  3CCR I;  1I50 J;  2EFW A;  3DKY A;  1O3S A;  2BYV E;  2VXD A;  3CJR B;  4LLL A;  3WU1 B;  2LC2 A;  3DTI A;  3SZT A;  2Y9Y A;  1RUO A;  2O5R A;  2M4G A;  3LL7 A;  1ORK A;  3ZQ7 A;  3GCM A;  4EJW A;  2VAS A;  1I1G A;  3SFI A;  1GVD A;  1YJN I;  2EBI A;  1ENH A;  2K9M A;  1QZE A;  1HLV A;  4XNF A;  5BQT A;  4XRM A;  5ICC A;  2NS7 A;  3VPR A;  4YIR X;  5M3F J;  1RIO H;  2VE8 A;  2E34 A;  1LVK A;  2IGM A;  2WWY A;  2EFP A;  2GBY A;  4LIV A;  4CA0 A;  3HRU A;  4ZZL A;  1L3L A;  4M9Z A;  3K4M A;  3SEZ A;  2XAJ A;  1W36 D;  4E7K A;  3U9G A;  3LFU A;  1YG2 A;  3IAM 2;  3KP4 A;  3RQI A;  5E3O A;  2VOD A;  3S3N A;  2FSW A;  3JRA A;  2H1L A;  1JKO C;  2MGQ A;  2R92 J;  2OU2 A;  3K0L A;  2AXT C;  2ELK A;  3GXO A;  5CQG A;  2JUG A;  3EUH C;  3K4L A;  4UV8 A;  5DD4 A;  2AXL A;  1F1Z A;  1R7J A;  2L5Q A;  2COM A;  3C18 A;  3I64 A;  5FLX Z;  2ID6 A;  4QLC U;  3BQY A;  2W7N A;  2YX7 A;  3W2A A;  3F3X A;  4G7H F;  1Y1W J;  2K85 A;  2RNG A;  2LG4 A;  3K4N A;  4ZYD A;  3DPL C;  2FOW A;  4BXX J;  2RQQ A;  3DEW A;  2DOD A;  3ZQF A;  2BBY A;  2R4G A;  4Y33 A;  1JI8 A;  1IUF A;  3CJQ B;  3J80 K;  2MYS A;  3FKI J;  2LBF B;  3WU2 C;  2M7A A;  1LEA A;  2IGK A;  2L7Z A;  3LST A;  5JHF A;  2L0K A;  1WSU A;  2DLL A;  1WI9 A;  4YFX F;  3LAJ A;  3CCQ I;  2F5E A;  3GTK J;  2E2J J;  4CHU A;  3ZXS A;  4YII A;  1JTY A;  3GME A;  2OBP A;  2ELJ A;  1IV6 A;  2LFB A;  4RA2 A;  1RRJ A;  5LFA A;  2L4A A;  1TWH J;  1IRX A;  1YO5 C;  1JKP C;  4FCY A;  2NYX A;  2BV6 A;  2IJL A;  4MHG A;  3IV5 A;  3CCJ I;  3B02 A;  5IYB J;  4BHB A;  3UKG A;  1G3W A;  3V8L A;  3HOT A;  1SEU A;  2VPR A;  3ZMU A;  5E18 F;  5F08 A;  3K6G A;  1DDN A;  2ECB A;  3SZG A;  1LDJ A;  5FKM A;  3HJE A;  4HDV A;  1F5T A;  4KN4 X;  2W48 A;  3GTM J;  1FSE A;  1TLH B;  1CF7 B;  2DBB A;  2W57 A;  2XGD A;  3DQV C;  1SVM A;  4OIO F;  3CDH A;  3M1E A;  4LB5 A;  2D1V A;  4OIR F;  2WV1 A;  3RPU D;  5HOO A;  2VJJ A;  3HG9 A;  4I02 A;  5EG0 A;  1R5G A;  2R7Z J;  1HDP A;  3TOA A;  4BAC A;  2HOT A;  3GLX A;  4HST A;  3H9G A;  1PUF A;  3BWG A;  2DYR H;  1XMX A;  2VBX A;  3I4M J;  3K69 A;  4IHW A;  1MIJ A;  1IW7 F;  3WHB A;  3CUQ C;  4EJT A;  3RJP A;  1WPK A;  2L7M P;  1ZLJ A;  4ESJ A;  4HF1 A;  4DIQ A;  4H4K C;  3BZK A;  2E19 A;  4M9S A;  4PJL A;  3V42 A;  3K7A J;  5EZH A;  3DU5 A;  4N9I A;  2DJN A;  3GUD A;  1TW3 A;  3KEO A;  1W7P B;  4D5F A;  1ETO A;  2RNJ A;  4WXH A;  2DT5 A;  1WZ2 A;  1X19 A;  3JTG A;  1MH4 A;  2EIN H;  3HC7 A;  2DK5 A;  3RI4 A;  1DU0 A;  3CC7 I;  3FHN A;  3TW7 A;  2XGX A;  3B6C A;  1DP3 A;  2D2W A;  3GFL A;  4L9J A;  3GTQ J;  1V54 H;  3I54 A;  3FHZ A;  3AG4 H;  2AQE A;  1W5S A;  3KP6 A;  2JT1 A;  4PJM A;  1ETY A;  4QIW N;  4NB5 A;  2Y48 A;  2IP2 A;  2PMU A;  4AM3 A;  5C4J J;  1RES A;  4XLP F;  4RGS A;  3GTL J;  1LDK B;  3DPU A;  5ILV A;  2QM3 A;  1G3T A;  3HTS B;  4Y3O A;  2OTJ I;  1BN5 A;  1A31 A;  2CW8 A;  2VKV A;  1NTC A;  3U21 A;  1QVT A;  1V55 H;  2NAZ A;  5CLS A;  1AA7 A;  1EKE A;  1XGO A;  3ULQ B;  4HF0 A;  2GXG A;  4WF2 A;  1A6Q A;  4MEY F;  2RV8 A;  3KYD B;  3PIO F;  2VOP A;  4KIC A;  4ANJ A;  3M4O J;  1X1D A;  2N8G A;  2O03 A;  3K2Z A;  1KA8 A;  3LOC A;  3E5Q A;  1WJC A;  4L5E A;  1J7K A;  4C2T A;  5HVQ C;  3N97 A;  2GIV A;  4HLX A;  3V4G A;  2QEN A;  2KIQ A;  4F55 A;  1FIP A;  1HXD A;  2DQL A;  3O8G A;  2BVM A;  1MSF C;  2PG4 A;  4E7Z A;  2JTV A;  2OQR A;  1K79 A;  1SMT A;  2BZT A;  3QYB A;  2P6S A;  3SFZ A;  4KN7 X;  4CYC A;  3I55 I;  1FBQ A;  1SD7 A;  1JHF A;  1TZL A;  2E5Z A;  1YIT I;  4DGW B;  3E1S A;  4XIC A;  2QKM B;  5DS9 A;  1ZK8 A;  1YOV B;  3RPQ A;  5LEK A;  1R58 A;  4F91 B;  2OCC H;  5ILS A;  3FXU A;  1B72 B;  2DOF A;  1XX5 A;  4HRI A;  2NNY A;  2DDA A;  2K02 A;  3K1N A;  2K9L A;  1Z0X A;  3O2P E;  2H8R A;  2IXS A;  3PNV A;  2ZME C;  5J3L A;  2DJI A;  4XL9 A;  2P5L C;  1KGS A;  4RS8 A;  3H36 A;  4S0H B;  2EK5 A;  1ETK A;  1R1T A;  3QP6 A;  2DDB A;  3V7R A;  2P81 A;  2DA6 A;  1FSH A;  2WTE A;  1XG1 A;  3T8R A;  3IH4 A;  2W1O A;  4XK4 A;  1JUM A;  1QHG A;  2G0E A;  1XCB A;  4PGG A;  1LPQ A;  3KYL A;  1CQT A;  2PI0 A;  2EA2 A;  3OL3 A;  4M3B A;  2WA0 A;  3IL2 A;  4HDU A;  5ILU A;  1S7A A;  5LRR A;  1DPR A;  3F8M A;  1IN4 A;  4DNC A;  1FTZ A;  1OLT A;  3V8J A;  3HPH A;  5IT9 Z;  3A01 B;  2F48 A;  2HEO A;  3S32 A;  2HQN A;  2F5F A;  4I6Z A;  1ZGW A;  3WTW C;  2DW4 A;  3HSF A;  2F5V A;  1RNL A;  4KIF A;  4UB8 C;  3CD6 I;  3RIR A;  1KQ8 A;  3VSK A;  4F93 B;  3DKW A;  1J0R A;  4MGR A;  4E4H A;  1HKS A;  3V7C A;  3TKY A;  4KDP A;  5CVI A;  1FMW A;  4I09 A;  1APL C;  4IOC F;  2IA1 A;  3R4K A;  3L2C A;  2ZNY A;  1K61 A;  3JRE A;  2VQG A;  1USS A;  5CPR B;  3GW2 A;  5H6R A;  3DXJ F;  3LSR A;  3I59 B;  2Z16 A;  1VQO I;  3VSL A;  2EFN A;  3LSJ A;  4GDF A;  1E2X A;  3S3M A;  1NG7 A;  1JUP A;  5DD8 A;  2MLG A;  4QWQ A;  4C2U A;  3L00 A;  3JAM K;  5BMZ A;  3DTK A;  1BR1 A;  3E5U A;  1ZAR A;  1ETV A;  1V5G A;  3SHF A;  5F0H A;  2R5Y B;  2IBD A;  1VQM I;  1FTT A;  1D0Z A;  4A5N A;  3GF2 A;  3C2B A;  4EQQ A;  1I6H J;  3H1C A;  1JJ8 C;  5F64 A;  4XQF A;  4XKV A;  4D7N A;  1K4T A;  1FJL A;  1A35 A;  2G7U A;  5BPD A;  2LTP A;  3NEU A;  4NC6 A;  1MMS A;  5K5R A;  1H8A C;  3CCV I;  2QVO A;  1KU7 A;  3BTI A;  2V1X A;  3MKZ A;  2KZV A;  3JRH A;  1LEB A;  4ZC3 A;  2HYJ A;  5IP7 J;  2EIK H;  2TCT A;  3I58 A;  4CSW A;  1TNT A;  1C0W A;  1WHU A;  2K9S A;  2LOO A;  3T5X A;  3S1R J;  4XLH A;  5J4Y A;  2E71 A;  2KIU A;  3V8K A;  3GZN B;  4ZTJ A;  1YS7 A;  4BEH A;  3A0B C;  1J59 A;  1MMN A;  2I10 A;  1HQC A;  2E1M C;  4IXA A;  4W97 A;  5DUK A;  3OYG A;  2E1O A;  2BVL A;  3KFW X;  2V9V A;  3OIO A;  2ISY A;  4MO7 A;  3RKQ A;  2K86 A;  2NVX J;  1YW7 A;  1G3Y A;  3K2A A;  5CVU A;  1IRZ A;  3NWS A;  2HTS A;  5BOX A;  2WV0 A;  1WVR A;  2FNA A;  5FLX K;  2JSP A;  4P5O A;  1FP2 A;  5D4S A;  4Q5S F;  3WE3 A;  3ZN1 A;  1BI3 A;  2HXI A;  2X6W A;  3OYN A;  2MC4 A;  3VDX A;  3IRR A;  1RET A;  4NQW B;  2IRF G;  3M1C A;  3AG1 H;  4IHY A;  3QOE A;  2F5C A;  4KMU X;  4C30 A;  4D7M A;  5DUI A;  1IRG A;  2XF5 A;  3BT9 A;  1EH7 A;  1P6R A;  1GVJ A;  2XAU A;  3OYB A;  1BJA A;  1NHA A;  2TDX A;  4UUS A;  2EH3 A;  3H9J A;  1EA3 A;  3LFK A;  1MJ9 A;  3HUG B;  1XGS A;  2R93 J;  2CO5 A;  4BYY A;  2LY2 A;  3OYD A;  2E7X A;  2V7F A;  2VXZ A;  2FOK A;  3IH3 A;  2NVY J;  4ENJ A;  3DCF A;  3H9Q A;  2QQA A;  2CWE A;  2KMU A;  2QZ8 A;  2JA8 J;  2HOA A;  1FC3 A;  2KKO A;  2LKS A;  2ZB9 A;  3HKZ A;  5J1U A;  3CMM A;  3ASO H;  3VOD A;  5JR3 A;  2D1H A;  1XSX A;  3G6E I;  4MQV A;  1D1C A;  2VIX A;  2B63 J;  2R7R A;  1XD7 A;  2EV5 A;  2F5D A;  2IEK A;  1Y56 A;  2M34 A;  4ENM A;  2CW0 F;  3WU0 A;  2E2I J;  1OFC X;  1ZH5 A;  2HS5 A;  6PAX A;  1P4X A;  1YW9 A;  3DBL B;  2M0C A;  3I3L A;  4MQ9 F;  4ON0 A;  4BNC A;  4RB2 C;  3GFM A;  4U0Y A;  1KYW A;  2DCE A;  2E36 A;  4BS9 A;  4DBR A;  1WH7 A;  2P7C B;  2LRE A;  1YFH A;  2V79 A;  5F6F A;  4CCL A;  3ZOB A;  4RBO A;  1RZ4 A;  3CUQ B;  4I2O A;  2I8D A;  4HQM A;  4E7J A;  2NNN A;  3GBG A;  4IO9 F;  3KYC B;  1FNN A;  3PO3 J;  1YTY A;  3JSO A;  2A68 F;  2ICW G;  1H89 C;  3BDD A;  4BJ6 C;  3ZQH A;  2HTJ A;  2MD5 A;  1JKQ C;  4NC8 A;  2ZFU A;  1K78 B;  1F4K A;  4G9Y A;  5J40 A;  2Q2E A;  2JN6 A;  3IP4 B;  3A4C A;  5IY5 H;  1V4R A;  4PZJ A;  1D5V A;  3A2K A;  2B7E A;  2VI6 A;  1UHM A;  2DTR A;  4PCQ A;  4Y7N J;  1BW6 A;  2IS4 A;  5HDG A;  1QZY A;  1LFU P;  4KYW A;  2IS6 A;  4CCM A;  1X1C A;  1UB9 A;  3FXQ A;  4FE4 A;  1SAX A;  3MEX A;  1TQP A;  2CS3 A;  1QZZ A;  1B9M A;  2A6T A;  3I4N J;  4V19 K;  3FKJ A;  3CLO A;  1OCC H;  4XKW A;  4KNY A;  4BH9 A;  2RC4 A;  4A3G J;  3QPS A;  2HFH A;  4IPA A;  4UVC A;  5DYM A;  3VYU B;  3DU6 A;  1YRN B;  2HR3 A;  2L01 A;  3K4B A;  3MWM A;  1DU6 A;  1PYV A;  2W4S A;  1IJW C;  4MIM A;  1IUY A;  2MSY A;  1R1U A;  2FBK A;  2FNP A;  4CIC A;  1J75 A;  5HNH A;  1YX5 A;  1U5T C;  2X0L A;  2X6X A;  4S04 A;  2GA2 A;  4HA8 A;  2GWR A;  2LVS A;  3WGH A;  2ZCW A;  3TO7 A;  4MEX F;  4UUV A;  1BOA A;  2LLK A;  3J81 Z;  2R7W A;  4ZDO A;  2F4O B;  3UR3 C;  2QSG X;  2GAU A;  1AWC A;  3P9I A;  2GZW A;  5EZG A;  2PJR A;  3LA3 A;  1P2F A;  4RAY A;  4A6E A;  1IRF A;  5DTD A;  2ETH A;  1YHQ I;  2Z9O A;  2QLZ A;  5JHU A;  2E1C A;  3U1K A;  3OYF A;  3I56 I;  1PVE A;  1QO0 D;  3RQ4 A;  2CUF A;  2PBI A;  2X1C A;  4LG3 A;  1EH6 A;  4KIG A;  2ZME B;  3GVA A;  4YEL A;  4BAY A;  4D1Q A;  2VQH A;  3HHH A;  1OR7 C;  2PLY A;  5FRM A;  2YS9 A;  3BG7 A;  1NK3 P;  1QQI A;  3ESW B;  1OIS A;  1CGP A;  4L18 B;  3IKT A;  4FX4 A;  1QVU A;  3J7Z I;  1QU3 A;  1DGR M;  4I0A A;  3G3Z A;  1XCV A;  4U0V A;  1VQ7 I;  2OD5 A;  2KQR A;  3HDD A;  2CUZ A;  4RGU A;  4KMF A;  3F22 A;  4LJZ F;  1FIA A;  1WJ5 A;  3KZI C;  3QAH A;  4JX6 A;  1U6G A;  4XOR A;  2VBY A;  2JA2 A;  4XLC A;  4F52 A;  3CQZ J;  2LH9 A;  3S15 J;  3BJA A;  1X2M A;  5LGN A;  5JI6 A;  2DA5 A;  2EZH A;  1W7P D;  3H5R A;  4HEA 2;  4B3X A;  4C3I J;  3GZ5 A;  4PJJ A;  4B09 A;  1IG7 A;  4EVI A;  2LD5 A;  1IDY A;  4MTD A;  3TED A;  3FWE A;  1MW7 A;  2XVC A;  3BPX A;  2L02 A;  1JE8 A;  4BQA A;  1YYV A;  1FP1 D;  5J6X A;  2XPU A;  3CO7 C;  4LLN A;  2DPU A;  3DBH B;  3MD2 A;  4XSX F;  2RAE A;  4XOT A;  3J7A Y;  1AKH A;  3FXM A;  2OQG A;  1ERD A;  2KL4 A;  3IWF A;  5IYC J;  5K7H A;  1PUF B;  2OTL I;  3TDZ C;  2L7F P;  1FMV A;  3DF8 A;  1HW1 A;  1J5Y A;  1XN7 A;  5L3D A;  4QTR A;  2OV7 A;  5HOD A;  2NS8 A;  1R1V A;  4HW0 A;  5FFZ A;  3G73 A;  1JGS A;  2ESN A;  3OYC A;  1H88 C;  1J09 A;  1REP C;  4U88 A;  3F23 A;  1QA6 A;  2K9Q A;  2Z2S B;  2KRC A;  3OYM A;  1FYM A;  1EH8 A;  3Q9V A;  2HXO A;  3VB2 A;  2DK8 A;  2H27 A;  3QYE A;  3CCS I;  2XC7 A;  5D8L B;  4IJA A;  4UXN A;  3GTP J;  4DBQ A;  1HA8 A;  4D9J A;  3WE2 A;  2DFH A;  3G1M A;  1OYW A;  1IV8 A;  3ROU A;  3QYF A;  3NAU A;  1ZR2 A;  1Q1V A;  3GTJ J;  3ZN0 A;  5GP9 A;  3ABM H;  4D0P A;  1HW5 A;  2OCE A;  1VQP I;  2ZXJ A;  3JRI A;  2Z1D A;  4PFO A;  5CYV A;  4IEJ A;  2PFB A;  1G8X A;  2OZ6 A;  3PUB A;  4WX9 A;  3RPU A;  1U3E M;  3S16 J;  2B0L A;  2CQQ A;  4DZJ A;  1R6R A;  5K7F A;  2JUC A;  2HPM A;  2GXA A;  1MSE C;  1LE8 A;  4IQJ A;  2IW5 A;  1KU2 A;  2J5O A;  2E1M B;  5JFR A;  2D45 A;  3MKY B;  1VTN C;  1T98 A;  5HDN A;  1S3J A;  4E6K G;  2R7V A;  2OF7 A;  4CZZ A;  2ZXH A;  5H20 A;  1GV2 A;  1TL8 A;  5M5X J;  3NRV A;  3FXR A;  5AIP A;  4IOA F;  3AG2 H;  3FXK A;  1DUX C;  1S29 A;  1V3F A;  3OR2 C;  3FMS A;  3PNY A;  2Y31 A;  2DFF A;  2QA4 I;  1B59 A;  5GTH C;  4PK4 A;  3WTX C;  1B4A A;  1E17 A;  4B1R A;  1ACI A;  1N78 A;  3OS2 A;  2RQP A;  4KFC A;  2FQ3 A;  2UXX A;  2GXB A;  4L5I A;  1Y0U A;  5GAG J;  3CCL I;  1T56 A;  1A36 A;  3SXY A;  4CO8 A;  5LHG A;  4Y52 J;  2R5Z A;  3MAJ A;  5J8F A;  4Y13 A;  2GM4 A;  2QBY B;  1ZAO A;  3F8N A;  2EWN A;  4L5J A;  4L0Y B;  1TC3 C;  2IAI A;  3TMO A;  4A3I J;  3N05 A;  2ZNZ A;  2V6C A;  1SFO J;  1R4M B;  2CUJ A;  5FB2 A;  2ZXI A;  1TWC J;  1T0F A;  1ON2 A;  2QEX I;  4UVB A;  4LIT A;  1SAU A;  2DI3 A;  2P4W A;  4NBQ A;  1E0E A;  4MNU A;  4C9Y A;  2QQB A;  3LSH A;  4UHT A;  4LK0 F;  1D0Y A;  3LMM A;  4IHS A;  5CKT A;  2HVR A;  4BY1 J;  4XKB A;  3KET A;  1ZRD A;  2BEO A;  2CJJ A;  1BW5 A;  2Z5U A;  2H94 A;  3SDB A;  2G7H A;  1VQ8 I;  1BOB A;  4M3G A;  2V9K A;  3KLN A;  4ESB A;  4G7Z F;  2IPQ X;  1A5J A;  4A69 C;  2QKL B;  2XUB A;  4IHT A;  1MDM A;  2OC6 A;  1U8B A;  3IHU A;  2KDO A;  3HOW J;  3MFK A;  5KHD A;  5LD2 C;  1K4S A;  2XRO A;  2A07 F;  3F8C A;  3RZD J;  5LLQ A;  4FET A;  3ABU A;  2O6G E;  3FIW A;  3KIO A;  4IRH A;  4JOM A;  4C3J J;  2NVQ J;  3WOD F;  2DA2 A;  4XR6 A;  4BY7 J;  1ZGJ A;  2DOE A;  2LKX A;  1WI3 A;  3IKV A;  3L2R A;  2L9V A;  2IS1 A;  1SC7 A;  1IC8 A;  1Y0N A;  1KU9 A;  2Y69 H;  4FIS A;  4GYI A;  1RPW A;  1MD0 A;  1T33 A;  4BQQ A;  1WJE A;  2R0Q C;  3W6V A;  3OIQ A;  4CUG A;  1GUU A;  3CP8 A;  3PO2 J;  2R7X A;  1Z9C A;  1SVL A;  3BG3 A;  3CMY A;  2JJ7 A;  5FKO A;  1YW8 A;  3OIP A;  3W6J B;  3CES A;  4A3K J;  3RCO A;  1TWA J;  5ICG A;  2NOG A;  4A3C J;  1K83 J;  5EGO A;  1HC8 A;  1MMD A;  1YX3 A;  2K5C A;  3RSN A;  1D5Y A;  2AO9 A;  3KEQ A;  2WY8 Q;  1I3A A;  1GLN A;  1B8I A;  2HU9 A;  3E97 A;  2OAZ A;  2CUE A;  5E79 C;  4RDU A;  1UMQ A;  3M07 A;  2DMP A;  2DFI A;  2NOJ B;  3KP5 A;  2M7B A;  4RAF A;  4CDG A;  1O7F A;  2AQF A;  3LA2 A;  2XRN A;  4G6T B;  4RAG A;  2O8X A;  1TT5 B;  4C2M J;  2FXA A;  4M74 A;  2BW3 A;  5F27 A;  2DMT A;  1Z77 A;  1UHS A;  2A5W A;  1ONV A;  5H2F C;  1QRY A;  2QQ8 A;  1B6A A;  3D1N I;  5F1R A;  3VYS B;  2E60 A;  1U5T B;  2HOS A;  4IVN A;  2O7O A;  3DP7 A;  3GX4 X;  1Y39 A;  3C2H A;  4II3 A;  4WK8 F;  2ZO4 A;  3GZ6 A;  4U87 A;  3JTH A;  3MZY A;  2V1N A;  3ZCO A;  3ECH A;  2R7T A;  2OJE D;  2HVS A;  3JSP A;  5ED4 A;  3IC7 A;  2XSJ C;  2ESH A;  3OV8 A;  3KZY A;  4EGY A;  4HNV A;  5IPA A;  2DXI A;  1W0U A;  1PP7 U;  1YIO A;  4AU7 A;  2CFX A;  2VQC A;  2DU9 A;  4RLF A;  1AHD P;  4PSW A;  2MH9 A;  2EJR A;  5HNF A;  5M5Y J;  3CZ6 A;  2H09 A;  5KCM A;  3OR1 C;  5EYR A;  3LSG A;  5AON A;  3PSI A;  5F1J A;  3Q0U A;  4G8X A;  2V6E A;  2MD0 A;  4AC0 A;  1ZG3 A;  4I7H A;  4YEJ A;  3WG7 H;  2V9P A;  5DCM A;  4B43 A;  3PL8 A;  2XB5 A;  4WXD A;  4XLF A;  4J01 A;  3HRS A;  3NQO A;  1F36 A;  5CQE A;  5E3L A;  4EM1 A;  4E7H A;  2W84 A;  5D5U B;  4MFD A;  1FOX A;  3TP3 A;  3ERE D;  3G1O A;  4IZZ A;  2PN6 A;  4XM3 A;  4UNO A;  4B48 A;  3I0T A;  2ZJP F;  1W0T A;  1MBH A;  4I76 A;  3DFG A;  2ZJ2 A;  2W82 A;  1ZYR F;  2CG4 A;  4ZJZ A;  2CW7 A;  5KAI C;  1RC9 A;  1NG6 A;  3TL4 X;  3V7S A;  2KDZ A;  1QBJ A;  5JLX A;  1S7E A;  2FMY A;  5DM7 F;  1FPQ A;  5GAH J;  3GLL A;  4GO1 A;  5HLI A;  4CXF A;  1XGN A;  1WJF A;  1HF0 A;  1SAN A;  1YE9 A;  4AVP A;  1ZHF A;  2R7O A;  1XPX A;  1MBE A;  4HNU A;  2QYO A;  1ETW A;  5E8G A;  3ZP5 A;  3WG9 A;  3A1Y A;  5A2Q K;  3U1D A;  4U7D A;  2E1N A;  2DOA A;  2Y0M A;  2E5N A;  3F8F A;  5GTI C;  4GCV A;  4P96 A;  2Y30 A;  2QWW A;  2VC1 A;  3AKZ A;  2O3F A;  4HX8 A;  3BR5 A;  2HKO A;  5EDN A;  3HXL A;  4KIT B;  3BP8 A;  4AIK A;  1MNE A;  1U9N A;  2R7Q A;  2WAE A;  2ECC A;  2CV0 A;  4UY8 I;  1T2K A;  3LQQ A;  2RRE A;  5EF6 A;  3OSG A;  4AID A;  1VQK I;  4LG0 A;  2EIL H;  2KFD A;  2XAQ A;  1VQ5 I;  1O3Q A;  3P7N A;  3EET A;  4CGZ A;  5AIQ A;  2MW8 A;  3GYH X;  4DYC A;  4H0E A;  1XC5 A;  3M9A A;  3BZC A;  1VI0 A;  1X1P A;  2VT3 A;  3S14 J;  1Z6T A;  4RLQ A;  4EEF G;  2XSD C;  2YU3 A;  3HPG A;  3ZGK A;  4DZP A;  2UZK A;  4AUX A;  2JA7 J;  1UZC A;  4GFB A;  2F4I A;  3MZH A;  1JXS A;  4O5V A;  3F8B A;  1NK2 P;  2CYY A;  2Y2Z A;  5DCF A;  3HB9 A;  2LYC A;  3GTO J;  1XMA A;  2DA7 A;  2HQA A;  4EV0 A;  3O8H A;  3VEP A;  2A61 A;  5CJ9 A;  4A0Z A;  4U7B A;  1LJ9 A;  1X4O A;  5C44 J;  3MMY B;  1HBX G;  3FX3 A;  3E5X A;  4A2U A;  1KQ9 A;  2HDW A;  4JYK A;  3CCE I;  5GAD J;  3BJO A;  4FQG A;  2O8K A;  4XID A;  1X1A A;  3E0J B;  2ZXW H;  4G6D A;  1P4A A;  1BIA A;  1BR2 A;  2XAH A;  3DLL F;  1IZ1 A;  1Z7U A;  3SQN A;  2RKH A;  3K4J A;  4OIN F;  1YJW I;  3J80 Z;  4AWX B;  3TO9 A;  1D0X A;  2DA4 A;  5EG0 B;  3SEQ A;  4LD5 A;  1SFK A;  2CFO A;  4P9F A;  1PP8 F;  2ZSH B;  5GPA A;  2EPF A;  1ZR4 A;  1I39 A;  3GO5 A;  5FKL A;  1O4X A;  1PJR A;  4B3A A;  1JUS A;  3HGG A;  3K70 D;  4X6A J;  4J00 A;  3L9F A;  5IOZ A;  3L2Q A;  2MAB A;  4LGW A;  2JMW A;  1OCR H;  4EAT A;  2XAG A;  3VYR B;  3MKL A;  1TNS A;  3FF5 A;  5FGM A;  2NVU B;  3H0D A;  2JQ7 A;  1XDS A;  3OMY A;  1YQA A;  2E2H J;  1RI7 A;  3LAP A;  2XKP A;  4AIJ A;  1OCP A;  3BLY A;  2EIJ H;  3ZQI A;  1S6L A;  1Q1H A;  5TJJ A;  1MKM A;  2BXY A;  1IXC A;  1Y6I A;  1O3R A;  1OCT C;  3HRM A;  5EEG A;  2JA5 J;  3H3U A;  3ABL H;  1IAW A;  1IO2 A;  2CU7 A;  4ZYA A;  2R3S A;  2HOE A;  5ERI A;  3PNT A;  1VQ4 I;  3CCU I;  3WGI A;  2VPL A;  4PFP A;  2ZJR F;  3RZO J;  2QUF A;  2LMD A;  3HEF A;  3LSI A;  2M30 A;  2HZD A;  3X2Q H;  1ZTR A;  1ULY A;  2LBF A;  1X3W B;  2RGV A;  3EUA A;  4IRI A;  3L2V A;  1MZB A;  4HBL A;  5BNG A;  3HL2 A;  4KIS A;  2EZL A;  1WJD A;  3C3W A;  2HDC A;  2XDV A;  1BI0 A;  2X1E A;  3JRD A;  3DKX A;  3ISP A;  3RDI A;  3HZJ A;  5E20 A;  4XMY A;  1U9O A;  4BJT A;  4DQ2 A;  1D3Y A;  4ZYH A;  1T6S A;  3KLO A;  1W1W E;  2X9D A;  4ZZD A;  4M71 A;  2GQQ A;  2VT2 A;  2M8E A;  4XKC A;  4LK1 F;  3ONQ A;  3ZQL A;  2IVM A;  1OCZ H;  3I5U A;  1LB2 A;  1FOK A;  2MA3 A;  1WGX A;  5FD6 A;  1I3Q J;  3CF2 A;  2ID3 A;  2MBF A;  3B6A A;  4DYQ A;  2HKX A;  2L3D A;  1R5H A;  1RUN A;  2HVQ A;  1FX7 A;  5D5W B;  2JVH A;  2CQN A;  4I01 A;  3S17 J;  4BJ5 C;  1Y8R B;  3C2G A;  4OAZ A;  1R9T J;  2FEZ A;  3EDP A;  1CF7 A;  3KP3 A;  4CCN A;  4CYC B;  1MJB A;  1P9Q C;  2R7F A;  3WHC A;  2L2O A;  2NS0 A;  3W6K B;  3K4K A;  4GGG A;  1BIB A;  2WAD A;  4PDK A;  3HTU A;  1PDN C;  2FE3 A;  2CQX A;  2OUM A;  2XF7 A;  3I71 A;  2WAQ N;  5KVR A;  2ZSI B;  1ZQ3 P;  3E7L A;  2BGC A;  3A0H C;  2VOO A;  3BR6 A;  3WTY C;  2VC0 A;  3HOV J;  2LRD A;  3M7G A;  3ZQQ A;  2H6C A;  4HYE A;  2JSC A;  4PJN A;  3BPV A;  2YR2 A;  2X51 A;  3COA C;  2PEX A;  5EEA A;  4OU0 A;  1HDD C;  5FD5 A;  3OY9 A;  3BR0 A;  5FRO A;  1DGW Y;  2VBW A;  4G12 A;  4O3M A;  3BTJ A;  1U0J A;  2Y75 A;  5IP6 A;  2MLK A;  5IP9 J;  1T39 A;  2HDD A;  4KT5 C;  1RKT A;  2PMZ A;  4RM2 A;  4QSH A;  5IOY A;  1XS9 A;  3R61 A;  1W7P A;  1WJA A;  1T38 A;  1TP4 A;  2Y9Z A;  5HDK A;  1R71 A;  3Q0W A;  1W36 C;  2STW A;  4HV5 A;  3BZ6 A;  3CTA A;  2BXZ A;  4BKX A;  4IQ4 A;  3E6M A;  3ZMD A;  3TBI A;  4Q47 A;  2DT7 B;  3L2U A;  3RYP A;  1RKW A;  2VUM J;  2M8G X;  2JRM A;  4XLE A;  1BI1 A;  2QCO A;  3OYI A;  4BDY A;  3REO A;  2CQK A;  4E7L A;  4I99 C;  3IAS 2;  4MFE A;  3JRF A;  4KA4 A;  4XN3 A;  3DEE A;  3BCA A;  3FBN B;  4BE2 A;  3BR2 A;  1WWX A;  3BQZ A;  1MMA A;  3WTU C;  1BA5 A;  4A93 J;  3H3Z A;  3LWF A;  1E3P A;  2X85 A;  4CZC A;  1Z05 A;  5ICE A;  1R36 A;  4M6Y A;  3BG6 A;  4WXC A;  3CMA I;  3RKW A;  4A3M J;  2A6H F;  3HYI A;  3LQR A;  2YPR A;  1TW2 A;  2PMZ N;  2NVT J;  5J8C A;  2ZBK A;  4LMY A;  1K6O A;  2KT0 A;  1O7L A;  5BPI A;  4Z6Y A;  3HBL A;  5J1Y A;  2DYS H;  2M45 A;  4LFU A;  1OCO H;  4A6D A;  1V5F A;  3DPT A;  3WTS C;  1YJ9 I;  2CGP A;  4GYG A;  3TGN A;  3RKX A;  1YLF A;  4BXF A;  2IGN A;  3T0Y A;  3M8E A;  1S72 I;  2Q1Z B;  5JVT A;  2QSF X;  5IT3 A;  5E17 F;  3L2W A;  5IT9 K;  1P92 A;  2BE5 F;  5EEH A;  3KCC A;  3FM5 A;  2DN0 A;  5FJ8 J;  3FK6 A;  2KPM A;  1JT0 A;  5E1W A;  1S5L C;  2K4J A;  3AFH A;  3HRT A;  4PGH A;  4JX4 A;  1UJ8 A;  1P4W A;  2O0Y A;  2HNH A;  1XGM A;  1B72 A;  1WH5 A;  1VQ9 I;  3DV8 A;  4N4O B;  3Q9S A;  3ZR8 X;  5L3F A;  2HGC A;  1UG2 A;  3HOZ J;  2LR8 A;  5H6Q A;  4GRI A;  2VQL A;  4I0B A;  2JVG A;  2JZY A;  2RDP A;  3FXO A;  1G4D A;  2E7W A;  2CH0 A;  3TO6 A;  3CDI A;  4XRS G;  2QSH X;  1GHC A;  2JPC A;  2LK2 A;  2NRA C;  2K4B A;  4OIP F;  3FXL A;  4NDL A;  2JRT A;  3D5R C;  2V4J C;  4NUB A;  4BEH B;  3S1M J;  2Y0S N;  3T8T A;  3DBR B;  4DYR A;  4ZTF A;  4EM0 B;  1I6X A;  1IN5 A;  3JAM Z;  1R4N B;  3LSK A;  3I9V 2;  4B8X A;  4RGX A;  1EJ9 A;  3F6O A;  5HS9 A;  3L09 A;  4EM2 A;  2EZI A;  2V26 A;  3G71 I;  3MZ8 A;  2EFO A;  2DPD A;  1LFB A;  5D5V B;  1E3H A;  2XAF A;  5DV5 A;  3IH2 A;  3A01 A;  1ON1 A;  2VKH A;  3K10 A;  2R7S A;  2XGE A;  2A5Y B;  2JA6 J;  1JT6 A;  1R5I D;  3F9K A;  3ECO A;  4EGZ A;  2XGC A;  1TT0 A;  2FD5 A;  2GOM A;  4P9U A;  1FWZ A;  2LY1 A;  3I4P A;  1HST A;  4PSX A;  3TP0 A;  4F3Q A;  4M6X A;  3R60 A;  2Z99 A;  2EB7 A;  4UUS B;  3MKW B;  1N75 A;  1SFE A;  2RN7 A;  1TQI A;  3B73 A;  5D8K B;  3QPH A;  4EJU A;  2X6Y A;  1LDD A;  2UUZ A;  3AL0 C;  1B9N A;  4GXO A;  2FQ4 A;  3OYL A;  1JJ6 C;  1IN6 A;  2DMQ A;  5HS7 A;  1X4P A;  5TRD A;  1IDZ A;  2KRF A;  3I59 A;  1OYY A;  1D1A A;  3CCM I;  4HPQ A;  1T0F C;  1GXQ A;  2FX0 A;  1UFM A;  1BI2 A;  4A3E J;  1H0M A;  4BE1 A;  2GA1 A;  1VQ6 I;  3PM1 A;  2R5Y A;  4YG2 F;  3UNG C;  3S8P A;  4BBS J;  4ZDL A;  3W3C A;  2JPB A;  2K27 A;  5TIS C;  1IXR C;  1N77 A;  3JRB A;  3CME I;  1FBS A;  2XAS A;  1VZ0 A;  4F92 B;  3ZMV A;  3K1P A;  2P5K A;  1AU7 A;  3EQL F;  4AD9 A;  3D5L A;  4X0G A;  1K7A A;  1ZLK A;  3FZV A;  4EJV A;  1ZEL A;  1V5E A;  5J1R A;  1FYK A;  1PUE E;  4G6Q A;  4L9T A;  4B47 A;  4A3J J;  3CDL A;  4UV9 A;  2L9N A;  4A3D J;  2KZG A;  1ZRE A;  1XMK A;  5LHH A;  2QF7 A;  1U78 A;  2EV6 A;  1DPU A;  3ELK A;  3HSE A;  1QNT A;  2M87 A;  2RVC A;  4TV7 A;  3W2W A;  1ODD A;  4ENK A;  2UXN A;  1MNM C;  5B1A H;  2FJ1 A;  2O9L A;  3PSF A;  4JBA A;  2ZKZ A;  2CSO A;  2QQ9 A;  1ZKG A;  2Q2E B;  5E3N A;  5HLT A;  3HOY J;  3EUH A;  4MLO A;  4AYB A;  1Y1V J;  4A0X A;  3S93 A;  1R22 A;  4M3E A;  3SDG A;  2GIZ A;  4IKF A;  1S8N A;  3CF5 F;  5HLH A;  2HI3 A;  1STZ A;  1OPC A;  1VF9 A;  4BXU A;  1TBX A;  3SJM A;  1BC7 C;  3I53 A;  5HLG A;  2YX4 A;  3FMR A;  4NQW A;  3SYT A;  5LRS A;  3WTV C;  3G1L A;  5D5X B;  4P1W A;  3WTZ A;  3ZRG A;  3LA7 A;  3GTG J;  4FX0 A;  5K5O A;  4XBF A;  2P6T A;  3ZPL A;  1UST A;  3ML6 A;  1Z6R A;  5D6E A;  4IX7 A;  4B44 A;  1W4M A;  1WJB A;  2TRT A;  2YUS A;  3ERM A;  1MMG A;  4A5M A;  9ANT A;  1LQ1 A;  1FOY A;  1X2N A;  3MVP A;  3AG3 H;  2W24 A;  4JQF A;  3F21 A;  1GV5 A;  1MND A;  1R23 A;  1X58 A;  1IF1 A;  3CCY A;  3EYY A;  4HX4 A;  2R7U A;  2DA3 A;  4E70 A;  1TWF J;  3HUG A;  4BDZ A;  3C7J A;  2STT A;  1BM9 A;  4AYB N;  2WC2 A;  4LB6 B;  4E7I A;  3Q3S A;  2KIS A;  3FXJ A;  4P55 A;  1W5T A;  4A3L J;  3QPT A;  4IHV A;  3K9T A;  1E3O C;  3R0J A;  1T8I A;  4BBR J;  3BC8 A;  3FBI B;  1Z7L A;  3H5A A;  3HOS A;  2XIG A;  1SD5 A;  2X4H A;  4S05 A;  2LKP A;  2BOL A;  3O6B B;  1T08 B;  1I5Z A;  5D4R A;  1XSV A;  2PJR B;  4XRS A;  4QPQ A;  1QPI A;  4BQN A;  2VJ4 A;  2H1K A;  5GPC A;  1DQU A;  1LFP A;  4ASN A;  2LSO A;  2FF4 A;  1ZN2 A;  4D5C A;  4IRG A;  2OPT A;  3CLQ A;  3L7W A;  1BJZ A;  5K1Y A;  4BHP A;  1R00 A;  3RKY A;  1VND A;  2XKO A;  4RB3 C;  1F9N A;  2HPI A;  3BTL A;  1OKR A;  3CUQ A;  3GFI A;  5TGT A;  1H9G A;  3OSF A;  3KE2 A;  4X1E A;  4JK1 X;  3S2H J;  4XON A;  1SD6 A;  4RB1 A;  1G3S A;  1QHH D;  1R49 A;  2FRH A;  2VN2 A;  3QP5 A;  4XRF A;  2DQR A;  1UG0 A;  1LNW A;  3WGG A;  1K78 A;  3E6D A;  3QU3 A;  2P5V A;  2E35 A;  1MBG A;  3PJR A;  3OYJ A;  2IT0 A;  3J81 K;  2HQ5 A;  1X1B A;  2L9R A;  3OS1 A;  1S7O A;  4DJA A;  2LF8 A;  3DEU A;  4R1H A;  3ZQG A;  5LGU A;  1ZG1 A;  1QPM A;  3E6B A;  4ITV A;  2X1D A;  1KZH A;  1ETX A;  1Z3Y A;  1BBY A;  2WAF A;  3PQJ A;  3L1P A;  5FLM J;  1FT9 A;  1U2W A;  2BY1 A;  3VFZ A;  1YI2 I;  2XHK A;  2LF7 A;  1KYZ A;  2H8W A;  2X6O A;  5L3C A;  2F4M B;  3ZMZ A;  1O3T A;  1XDU A;  1AKH B;  3SZP A;  3HM5 A;  4V2F A;  5L3G A;  1YRN A;  3P9K A;  5B5E C;  2K7L A;  4F7Z A;  4BQO A;  4FHT A;  5C3E J;  2ZJQ F;  1J9I A;  4NNJ A;  2GLO A;  1MJA A;  3GFJ A;  2M9H A;  4XSZ F;  2CV1 A;  3BCB A;  4IL6 C;  4HG2 A;  2Z3Y A;  3JCU C;  3K70 C;  3H92 A;  3LSP A;  2VLA A;  2IS2 A;  4HNT A;  1TWG J;  3ZMS A;  4WCG A;  4HV6 A;  4XOP A;  3D5S C;  4G7O F;  1IXS B;  2X48 A;  3BG5 A;  1P7I A;  3C1D A;  2VB6 A;  2LDU A;  3KZZ A;  3G2B A;  1Z91 A;  1KON A;  4A12 A;  4KT6 A;  5IYD J;  3IRQ A;  4Z2Y A;  5L3B A;  1WFX A;  3BRO A;  5J47 A;  4Y17 A;  3DWL E;  4ZDP A;  4E7S A;  3KP7 A;  4KIB A;  1XB4 A;  2A3S A;  3P9C A;  2IA2 A;  5E8I A;  1FYL A;  2OA4 A;  4EJO A;  1HW2 A;  4N0B A;  3OS0 A;  1FEX A;  5DM6 F;  4PUS A;  2ZME A;  3AAF A;  2LP0 A;  5E1X A;  4V2G A;  3ABT A;  4C3H J;  5B66 C;  4FT8 A;  3TQN A;  5J4V A;  3CC2 I;  1MGT A;  5CVJ A;  4LIU A;  3BJ6 A;  1LE8 B;  4YFN F;  3A03 A;  4OMZ A;  3F0C A;  3FMQ A;  1X3Z B;  4J19 A;  2HQR A;  3NWT A;  1SMY F;  3HHG A;  3QU6 A;  4N9H A;  2UV1 A;  1ZG5 A;  4M72 A;  2NXN B;  3J7A O;  2VJI A;  3RYR A;  2OZU A;  4L0Z B;  1MBJ A;  4M3D A;  1MBK A;  2KJC A;  4ENN A;  3DLA A;  5FKK A;  2K40 A;  4L9V A;  2CMP A;  4ESF A;  5M3M J;  3OYE A;  1GXP A;  1M1E B;  4BHC A;  2VE9 A;  1ZRF A;  2K3F A;  3QWL A;  1VQL I;  1ZRC A;  1BR4 A;  3KPH A;  2HWV A;  4XN0 A;  1GDT A;  3PFY A;  1TQM A;  4M3F A;  2P8T A;  1UCR A;  4HQE A;  2M1B A;  3JRG A;  4OIQ F;  1FOW A;  3PIP F;  2VKD A;  3FIS A;  4KUM A;  2EQR A;  5KK1 A;  2BHZ A;  1OYI A;  2J5P A;  1P7J A;  2R5Z B;  2WB1 A;  2PX9 A;  4PJ0 C;  3OYA A;  2H6B A;  3AL0 B;  1KU3 A;  4HZF A;  2V1U A;  3HSR A;  2QGU A;  3JRC A;  3M3Y J;  2ACJ A;  3F6V A;  4AIH A;  1Z3X A;  3O3K A;  4UVA A;  2C6Y A;  1OJL A;  2I5U A;  4YRV A;  1D8K A;  3DTE A;  3JR9 A;  2XV4 S;  5LHI A;  1WKM A;  1WQ2 A;  5FKN A;  3S1N J;  3QOP A;  2F2E A;  4AVZ A;  2M2E A;  1MBF A;  5DEQ A;  1Z21 A;  2A69 F;  2KP6 A;  2K3P A;  4K2E A;  4CCO A;  1HKQ A;  2CV2 A;  3VWB A;  3TDU C;  3R0A A;  2XB0 X;  1MDM B;  1KQ0 A;  1I1S A;  2LNB A;  4II2 A;  5FFX A;  1BC8 C;  5FO5 A;  4QPO A;  2WB1 N;  3HOX J;  2MC3 A;  3J7Y J;  3FM3 A;  4OWR B;  1HOM A;  2DFE A;  5CVV A;  3CO6 C;  3FK7 A;  4WWC A;  2W00 A;  4CCJ A;  1U8R A;  1RR8 C;  2IGO A;  3HIF A;  3K1M A;  2V1D A;  1ETQ A; 
#chains in the Genus database with same CATH homology
 2W1O A;  1QHG A;  2L7K A;  1UAA A;  3KYL A;  3TMO A;  3N05 A;  3OL3 A;  2WA0 A;  1V5F A;  3DPT A;  2CUJ A;  2WBM A;  2ZXI A;  1OLT A;  4BXF A;  4LIT A;  1SAU A;  2IGN A;  3HPH A;  1E0E A;  3EPZ A;  4C9Y A;  3S3O A;  2Q1Z B;  3KEY A;  3LSH A;  3L2W A;  1UEL B;  3S32 A;  3QOD A;  1D0Y A;  3LMM A;  5CKT A;  2HVR A;  2WAQ A;  2KPM A;  4XKB A;  3AFH A;  3SDB A;  4KJZ A;  2F5V A;  1BOB A;  2V9K A;  2HNH A;  2QKL B;  3VSK A;  2OC6 A;  4N4O B;  3ZR8 X;  4F93 B;  2KDO A;  4E4H A;  4GRI A;  2VQL A;  2JVG A;  1FMW A;  5KHD A;  5LD2 C;  2CH0 A;  3IUO A;  4FET A;  4DOZ A;  3LSM A;  4JOM A;  4BUP A;  2VQG A;  5CPR B;  2XF6 A;  4XR6 A;  3D5R C;  2V4J C;  4NUB A;  4BEH B;  2Z16 A;  1LKX A;  1G59 A;  3VSL A;  3S3M A;  2BW3 B;  3L2R A;  1NG7 A;  4ZTF A;  2IS1 A;  2M4K A;  2KHM A;  4C2U A;  3LSK A;  3I9V 2;  3DTK A;  1BR1 A;  1V5G A;  2V26 A;  1D0Z A;  4BQQ A;  3K4C A;  1WJE A;  2R7X A;  3OIQ A;  4CUG A;  3CP8 A;  2VKH A;  3K10 A;  4XQF A;  4XKV A;  2R7S A;  3OIP A;  2L9S A;  3OYK A;  3CES A;  3H35 A;  3RCO A;  2F6C A;  3F9K A;  1MMD A;  1TT0 A;  1YX3 A;  2K5C A;  2GOM A;  3MKZ A;  2KZV A;  3RSN A;  2LY1 A;  4PSX A;  2WY8 Q;  4ZC3 A;  1GLN A;  4F3Q A;  2VJ5 A;  2HU9 A;  3MKW B;  4CSW A;  1N75 A;  2LOO A;  2X6Y A;  2NOJ B;  2M7B A;  2UUZ A;  3AL0 C;  2WY7 Q;  4XLH A;  2AQF A;  4G6T B;  3OYL A;  1X4P A;  4ZTJ A;  4BEH A;  1MMN A;  2E1M C;  3OYG A;  2DT6 A;  1D1A A;  2BW3 A;  2BVL A;  4BL0 B;  4HPQ A;  1T0F C;  2A5W A;  4BE1 A;  3VYS B;  3NWS A;  2P0W A;  2E60 A;  3CP2 A;  3UNG C;  3S8P A;  4CCK A;  2JSP A;  4P5O A;  4ZDL A;  3W3C A;  1N77 A;  3C2H A;  4II3 A;  2X6W A;  3OOU A;  4U87 A;  2MC4 A;  1VZ0 A;  4F92 B;  3OYN A;  3VDX A;  2V1N A;  3ZCO A;  2R7T A;  2HVS A;  4BE0 A;  4RM3 A;  4NQW B;  3D5L A;  4X0G A;  2XSJ C;  1S9H A;  1ZEL A;  3M1C A;  1V5E A;  3OL4 A;  3QOE A;  2DXI A;  2M0M A;  4C30 A;  4AU7 A;  2VQC A;  2XF5 A;  3W2V A;  4RLF A;  4B47 A;  2KLO A;  3OYH A;  2L9N A;  4PSW A;  2XAU A;  4RMN A;  3OYB A;  4Y4R A;  5HNF A;  3CZ6 A;  4NC7 A;  3OWT A;  3VYT B;  5KCM A;  3OR1 C;  3H9J A;  2M3A A;  3LSG A;  3PSI A;  1EA3 A;  3W2W A;  2UWM A;  2V6E A;  2MD0 A;  3HUG B;  4YEJ A;  2Y0S A;  3PSF A;  2LY2 A;  3OYD A;  2V7F A;  4B43 A;  2VXZ A;  3PL8 A;  4XLF A;  4J01 A;  2FUG 2;  2Q2E B;  3H9Q A;  5HLT A;  4OAY A;  4XLA A;  4MLO A;  5CQE A;  1K6Y A;  2KMU A;  4AYB A;  4BGD A;  4E7H A;  3HKZ A;  3S93 A;  3CMM A;  3M8J A;  1D1C A;  2VIX A;  4N4N B;  4IZZ A;  2VL8 A;  3H5N A;  4XM3 A;  2R7R A;  4IKF A;  1D1B A;  3RTR A;  4B48 A;  4BU2 A;  4CH7 A;  1Y56 A;  2W82 A;  4ZJZ A;  2CW7 A;  3I3L A;  3SYT A;  1NG6 A;  3TL4 X;  4P1W A;  2DCE A;  3ZRG A;  4BS9 A;  4DBR A;  3KX2 A;  2LRE A;  2KRH A;  4IX7 A;  4B44 A;  4CCL A;  1WJB A;  1MMG A;  1WJF A;  2I8D A;  1YE9 A;  4E7J A;  2R7O A;  3GBG A;  4JQF A;  4HNU A;  1MND A;  3A1Y A;  2MFZ A;  3EUK L;  2DOA A;  2E5N A;  2R7U A;  4FAS D;  3FDY A;  4BDZ A;  5KNL A;  5FRN A;  4BJ6 C;  4E7I A;  3AKZ A;  4NC8 A;  2ZFU A;  1T95 A;  4HSR A;  3HXL A;  4R79 A;  4KIT B;  2GOX B;  3IP4 B;  3A4C A;  1MNE A;  2R7Q A;  3DKY A;  2VXD A;  3BC8 A;  3CJR B;  2WAE A;  3FBI B;  2CV0 A;  1Z7L A;  2LC2 A;  3DTI A;  3H5A A;  3A2K A;  3HOS A;  2RRE A;  2O5R A;  2M4G A;  3LL7 A;  2BOL A;  2IS4 A;  2VAS A;  2PJR B;  4QPQ A;  2IS6 A;  4BQN A;  4CCM A;  2K9M A;  1X1C A;  4XNF A;  2VJ4 A;  1DQU A;  1LFP A;  4RLQ A;  2CS3 A;  1LVK A;  3HPG A;  2IGM A;  3ZGK A;  4LIV A;  4CA0 A;  2A6T A;  3K4M A;  3SEZ A;  1W36 D;  2F4I A;  4E7K A;  3FKJ A;  3LFU A;  4XKW A;  2HPI A;  3IAM 2;  2LYC A;  5TGT A;  2HQA A;  3S3N A;  3VYU B;  3DU6 A;  4XON A;  4U7B A;  1X4O A;  3K4B A;  1QHH D;  1PYV A;  3MMY B;  2JUG A;  3EUH C;  2W4S A;  3K4L A;  5CQG A;  2L5Q A;  2HDW A;  1UG0 A;  2W7N A;  5HNH A;  3W2A A;  1X1A A;  1YX5 A;  3E0J B;  2RNG A;  2LG4 A;  2X6X A;  3K4N A;  1BR2 A;  3PJR A;  3OYJ A;  3DPL C;  2R7W A;  4ZDO A;  2RQQ A;  3K4J A;  3UR3 C;  1X1B A;  3OS1 A;  2R4G A;  4Y33 A;  4DJA A;  1JI8 A;  3CJQ B;  1D0X A;  2MYS A;  2LBF B;  3SEQ A;  2M7A A;  1SFK A;  2CFO A;  2IGK A;  2PJR A;  5JHF A;  2ZSH B;  4ITV A;  2X1D A;  1PJR A;  3K70 D;  1Z3Y A;  4J00 A;  2WAF A;  3L2Q A;  2MAB A;  4EAT A;  3OYF A;  3ZXS A;  3VYR B;  3H0D A;  3RQ4 A;  2ELJ A;  3OMY A;  2X1C A;  4LG3 A;  4YEL A;  4D1Q A;  5LFA A;  2VQH A;  3BLY A;  1OR7 C;  1IRX A;  5FRM A;  3BG7 A;  3HOT A;  4BQO A;  4NNJ A;  1Y6I A;  3K6G A;  3BCB A;  2CV1 A;  1QU3 A;  4HG2 A;  1DGR M;  3SZG A;  3K70 C;  2VLA A;  2IS2 A;  4ZYA A;  4HNT A;  2KQR A;  2CUZ A;  3PNT A;  3DQV C;  4XOP A;  3D5S C;  2VPL A;  4PFP A;  1WJ5 A;  2VB6 A;  4XOR A;  2JA2 A;  3G2B A;  4XLC A;  4F52 A;  3LSI A;  3RPU D;  2LH9 A;  1KON A;  2HZD A;  2VJJ A;  3HG9 A;  4KT6 A;  5HOO A;  2LBF A;  3EUA A;  1WFX A;  3H5R A;  4HEA 2;  3L2V A;  4BAC A;  4B3X A;  4HST A;  3H9G A;  4PJJ A;  3HL2 A;  4KIS A;  3DWL E;  1WJD A;  4ZDP A;  4E7S A;  2XDV A;  2X1E A;  3DKX A;  1MW7 A;  4XMY A;  4BJT A;  3OS0 A;  4DIQ A;  4H4K C;  4PUS A;  3MD2 A;  4XOT A;  3J7A Y;  4PJL A;  4XKC A;  1ERD A;  2KL4 A;  3V42 A;  3ONQ A;  3DU5 A;  4LIU A;  1FMV A;  3CF2 A;  2OV7 A;  1X19 A;  3HC7 A;  2HVQ A;  3OYC A;  3FHN A;  2JVH A;  1J09 A;  1DP3 A;  3NWT A;  4BJ5 C;  2UV1 A;  2Z2S B;  2KRC A;  3C2G A;  4OAZ A;  3OYM A;  2VJI A;  2AQE A;  4CCN A;  1P9Q C;  4PJM A;  2L2O A;  3QYE A;  3K4K A;  2XC7 A;  2WAD A;  3DLA A;  4DBQ A;  1LDK B;  3OYE A;  3DPU A;  2CMP A;  2OUM A;  1HA8 A;  4D9J A;  2XF7 A;  4Y3O A;  2ZSI B;  2CW8 A;  3U21 A;  3QYF A;  1BR4 A;  1AA7 A;  4XN0 A;  2LRD A;  3ZQQ A;  3PFY A;  4PJN A;  2X51 A;  4ANJ A;  2VKD A;  1X1D A;  2Z1D A;  4PFO A;  1WJC A;  3OY9 A;  1G8X A;  2WB1 A;  3PUB A;  5FRO A;  1DGW Y;  3OYA A;  4C2T A;  5HVQ C;  1U0J A;  3AL0 B;  2PMZ A;  4RM2 A;  1R6R A;  2HPM A;  1WJA A;  4F55 A;  4IQJ A;  2BVM A;  1W36 C;  2E1M B;  1Z3X A;  4IQ4 A;  4E7Z A;  4YRV A;  3DTE A;  3TBI A;  3MKY B;  2DT7 B;  3QYB A;  3L2U A;  4E6K G;  2R7V A;  4XLE A;  3OYI A;  4BDY A;  2ZXH A;  1TZL A;  2E5Z A;  4DGW B;  3E1S A;  4AVZ A;  4E7L A;  2QKM B;  1Z21 A;  3IAS 2;  2KP6 A;  4F91 B;  2K3P A;  4CCO A;  3OR2 C;  4XN3 A;  2CV2 A;  3DEE A;  3BCA A;  3FBN B;  3PNY A;  4BE2 A;  3VWB A;  4HRI A;  1MMA A;  2K9L A;  4PK4 A;  4II2 A;  2IXS A;  3PNV A;  2X85 A;  4CZC A;  2DJI A;  4XL9 A;  1N78 A;  3OS2 A;  4QPO A;  4OWR B;  3BG6 A;  2W00 A;  4CCJ A;  2IGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...