2MABA

Untangling the solution structure of c-terminal domain of aciniform spidroin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
PSFGLVLNSPNGLRSPQAKARINNLASALSTAVGRNGVDVNAFTSGLRATLSNLGDSGMSPNEAKVEVLLEALTAALQLLSSSTLGAVDTTSIGLTSNSVSKAVAQALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of C-terminal domain of aciniform spidroin
pubmed doi rcsb
source organism Nephila antipodiana
molecule tags Structural protein
molecule keywords ACINIFORM SPIDROIN
total genus 31
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mabA00
2M0MA 2K3PA 2MABA 2KHMA 2MFZA
chains in the Genus database with same CATH superfamily
4DW6A 3OOPA 5B1BH 1A04A 1OMIA 2H6BA 3DEEA 1ZELA 3I5UA 5E3LA 2DN0A 4U7BA 2RNGA 3JREA 3IL2A 1J75A 1OCTC 4AVPA 3H35A 4AYBN 2O61A 1IN4A 2X6YA 3GFMA 4S04A 3G73A 4ZYAA 1WI3A 2GXGA 3CJTB 4FX0A 1F9NA 2DFHA 4PGGA 3QODA 3L09A 4CCKA 1G3YA 1DU6A 3B73A 2KKOA 1L0OC 4M3BA 4IHTA 1FLIA 5ILVA 2P5KA 2OQGA 2DU9A 4B43A 3BQYA 3JTGA 2H8WA 3MCZA 4ZJZA 1IN5A 3IKVA 4OINF 5JLWA 1Y8QB 5E18F 3OSGA 3L7WA 3ZCOA 2CV1A 3KYLA 1ZRCA 1BI3A 1WJCA 2DO7A 4KJZA 3FXLA 4EATA 4AM3A 2F5CA 1R1TA 1UG0A 2X1DA 3BCAA 3G71I 4G7HF 4IRHA 3ERMA 2KJCA 3E6BA 3CJNA 2VONA 4ZTJA 2XAJA 1JGSA 2A6EF 4XLFA 1CF7B 3LNQA 1GT0C 2CG4A 2Y31A 2V6EA 2DFEA 4L9TA 2GIVA 3PFIA 5F0FA 1YRNA 1G4DA 2EZLA 1LDKB 2JUCA 3KP5A 4GYIA 3S32A 2YU3A 1I3AA 1TZLA 4A3IJ 1PVEA 3H3ZA 1LFPA 3E5XA 4AIHA 3S2HJ 4KMUX 1ZG1A 2EV6A 1UHSA 4R1HA 2P6TA 1BR2A 1T6SA 1XGOA 2EFQA 2F6CA 3WGIA 1CQTA 2KIMA 3M1CA 1EF4A 3S1MJ 4FTHA 3HUGB 2AS5F 2JT1A 4YIIA 1N25A 2EWNA 1W36C 2DQLA 5FB2A 1R5HA 2DI3A 2ZXJA 2M0CA 1WKMA 2MA3A 4JX6A 2ID3A 2CUFA 1ZG3A 4UB6C 5C4JJ 3KLOA 2K85A 2Y9YA 2LG4A 4Y13A 2CH0A 3BY6A 4XN3A 2GM4A 3OYHA 3JW4A 4PZJA 4UV8A 3C18A 4V19K 2Y30A 3LWFA 2D5VA 1BA5A 5B66C 1PP8F 5TJJA 2JWTA 1KU2A 2GXAA 3K0LA 3GYHX 4OMZA 2ZNYA 4QTRA 1IXRC 3DKWA 1MBKA 1G2HA 3HPGA 2L01A 2CV0A 5HDKA 5GTIC 3ZMDA 3ZP5A 1HKTA 1U3EM 2KDZA 5K5QA 3BJ6A 4KIBA 3KCCA 1FP1D 1V5EA 2KDOA 2M4KA 4EJTA 3K4MA 5K7HA 1HDPA 4NUBA 1FOWA 3COAC 2PN6A 5ICFA 3I4NJ 3KLNA 1KYZA 1OISA 2W85A 4IHSA 3OR2C 1MH3A 1VF9A 1W5TA 2YX7A 4HF0A 2IVMA 2QA4I 3PO2J 1VZ0A 5E3MA 1O7FA 5J4VA 3NRVA 2QCOA 4BXXJ 2PJRB 1HW5A 3IP4B 3GLLA 5FKKA 4CCJA 5F0HA 5KAIC 3GZNB 2MH9A 4D7MA 3L2RA 5JVGF 5CJ9A 1ETOA 2V79A 4ZYEA 2A69F 5BS6A 3C1DA 2HKOA 4XRSA 3CZ6A 3PIOF 3MMYB 4NC6A 1FX7A 4C2UA 1XSVA 3ZN1A 1RIOH 3CESA 4HLXA 4HLYA 1KZHA 2RQQA 1ZH5A 3WTYC 1R23A 2MD0A 3NWTA 4IZZA 4YFKF 1LPQA 3K1NA 3W2VA 2LNBA 5BPIA 2M0MA 3TDUC 2IP2A 1SANA 3CCSI 3TP3A 3FBIB 3LSPA 3EYIA 2KP6A 4HX8A 2ZJPF 3AG2H 3WODF 3WU2C 3DPUA 2ECCA 2VKVA 3BR5A 3DXJF 2R5YA 3RIRA 4C2MJ 2HR3A 5E17F 3ABTA 1YS7A 2HYJA 5AIQA 2HOAA 4FHTA 3K1MA 3ML6A 4YIFA 1E2XA 4FETA 4XN0A 3GEZA 3RPQA 2IAIA 3EUHC 5KNLA 2XRNA 3DEUA 4XOTA 4Y15A 3HXLA 2RDPA 1OKRA 2PEXA 2WADA 1TNTA 1KQ0A 2FXAA 3RSNA 4WF2A 1JKRC 3HIFA 3WU1B 2NVTJ 1QZZA 2MFZA 2FX0A 2STWA 1JUSA 2Z1DA 3BJOA 3RQIA 1SVMA 2HTJA 2IEKA 3PQKA 5FROA 4CXFA 4KN4X 3G2BA 4RBOA 2EK5A 1NK2P 1ITYA 3ZN0A 2HPIA 3KPHA 3W6JB 3K4LA 3S1NJ 3BR6A 4UHTA 5ICCA 3PO3J 1KYWA 2PJPA 4IHVA 4C3HJ 2R7UA 4E7SA 3CCMI 5LBQA 2D2WA 3HEFA 4UB8C 3J7ZI 4AIDA 4M3DA 1IRGA 3IUOA 2ZJ2A 1JJ6C 4UUSB 2O9LA 4KA4A 1A6IA 3CTAA 1TW2A 2FBIA 2LDUA 2XC7A 2CV2A 3K10A 2VKEA 3C2HA 2KT0A 3OYEA 5J8FA 1Z3XA 4FX4A 2UXNA 3IH4A 4MTDA 2KZVA 2VLAA 4A3FJ 2R92J 1FP2A 3L00A 2LR8A 3QYEA 2DJIA 4A0YA 3VYSB 2ZFUA 6PAXA 3GVAA 5BMZA 1QRYA 1U9OA 2Y75A 2ACJA 2A61A 1ZRFA 3HRUA 3ZRGA 1JKPC 4D9JA 1X2MA 2HI3A 5GPAA 4EM1A 5EG0A 1QHHD 5D5VB 2Z2SB 3BZ6A 4DYCA 4QLCU 2EZIA 1VQ8I 1XB4A 1T39A 1WSUA 2WA0A 1MMSA 3FM5A 3A0BC 3A4CA 2K9MA 2Y0MA 1DGRM 3K2AA 2XVCA 1NG7A 3OY9A 3MD2A 3VEPA 4IHWA 4RLFA 1V5GA 1SFXA 1FMWA 3F8CA 5KVRA 3TKYA 3TO9A 1JE8A 3ZMTA 3DV8A 5D6FA 5F1RA 3PNTA 2IT0A 4HZFA 1V3FA 2EIMH 2FBHA 3BR2A 4G12A 3MZHA 1R4MB 1X4PA 2HZDA 5CVIA 5E1XA 4G94A 4XMYA 4Y4RA 3CMMA 2X85A 5ILUA 1S5LC 2A6HF 2W7NA 3HUGA 2MLGA 3ULQB 3MN2A 2IPQX 3OOUA 2VUMJ 1IUFA 3S14J 4BNCA 5CVJA 2E34A 4BKXA 1FYMA 3QRFF 1DGWY 4ENKA 2Q8KA 2I10A 3FIWA 3L2VA 4WCGA 3KP2A 1MNMC 1MDMA 2FBKA 4CICA 4H4KC 3JCUC 1EH7A 2XAGA 3EETA 1K78A 1RZ4A 3CF5F 5HLIA 3GX4X 1QO0D 2UUZA 3GO5A 1MMGA 3J7AO 5E3OA 1JKOC 3ROUA 2JA5J 2GZWA 5F04A 3ZQLA 1KQ8A 1H9TA 1YYVA 2A6TA 3LAJA 2ZMEB 3VB2A 3RZDJ 4CYCA 4KUMA 4PJ0C 2KISA 2JPBA 2L7MP 1SD4A 4D0PA 2CU7A 4BEHB 2B0LA 4B3AA 3I64A 3WTSC 5KAFC 4U0WA 3C2BA 5IY5H 2E1MB 2F5VA 2Z5UA 3A0HC 3Q3SA 3R4KA 4IPAA 4ETSA 1JUPA 1A31A 1PUFB 3HOZJ 4IRIA 2P81A 4ASNA 4P9UA 2JA8J 2VC1A 3CUOA 4IEJA 3GZ5A 3HRMA 4UUTA 3KX2A 4L5EA 5CLSA 3CP2A 2IW5A 2QEXI 4IF4A 3AKZA 4L9VA 4F7ZA 4AU7A 4M6YA 1JKQC 3WHBA 4BDZA 2K9NA 2M2EA 1I39A 1TBXA 3DFGA 5EEGA 1XS9A 2VE8A 1R4NB 5FLXZ 2XGDA 4ZH4F 3G4SI 3I0TA 1B4AA 3RKXA 5M5YJ 2CW7A 2HTSA 5TISC 3IH2A 2JUGA 2OV7A 3K9TA 4ON0A 3T8TA 3BTCA 4D5CA 2PI0A 1WI9A 3FKIJ 3QP6A 2LKXA 1QVTA 4L0YB 2QSGX 2A5YB 2M30A 2CYYA 5IT9K 1WCMJ 3K6GA 3J81K 1I3QJ 3RTRA 4IQJA 2MC3A 4P1WA 4LLLA 3F3XA 2C6YA 2B63J 1R00A 5F1JA 4XLPF 1WJ5A 4LK1F 2XPUA 3S93A 2CJJA 2CFXA 2FJ1A 2EFNA 1VQ9I 5CKTA 3M3YJ 1D1BA 4WXHA 3FDYA 2XAQA 4CCOA 1JT0A 1HOMA 3GLXA 1F1ZA 5HLGA 5KK1A 3R61A 1PDNC 4N4NB 4ZYHA 3H9QA 1JJ8C 3BDDA 2HDDA 1LJ9A 2EIJH 5DCMB 4XKVA 2XAHA 2X48A 3SDGA 1F36A 4WXCA 3UKGA 3OS1A 5FGMA 2HYFA 2VT3A 3DQVC 2D45A 3F8MA 3I56I 4UUVA 2GAUA 3N05A 3GTKJ 1R6RA 1HKQA 1O7LA 3G3ZA 3DTKA 3E7LA 4MHGA 3KZYA 2ZXIA 1WZ2A 4KN7X 3TMOA 2K3FA 2WAQN 4M9ZA 3HYIA 2M1BA 3M8FA 3F8BA 3H5AA 2WY8Q 3OR1C 3ECOA 2HU9A 1UHMA 2E1NA 2F5DA 4UVAA 2HPMA 3F9KA 3FM3A 3H0GJ 4RAYA 3W2AA 1HLVA 1R9TJ 4HBLA 5GAGJ 1BR1A 1TWHJ 1U5TB 5A2QK 4HX7A 1XMKA 3RPUA 2Y0SA 3HKZA 2XB0X 3OIQA 1FIPA 4EJVA 2IXSA 1X1AA 1J09A 3AG1H 1YI2I 1USTA 3ZR8X 2VJ5A 1G3SA 1OYIA 5D8LB 3LSRA 4JX4A 2UZKA 4E70A 1GVDA 2STTA 4R79A 3FISA 4MIMA 1D8JA 1EH6A 4B47A 3NARA 4W1UA 3V7RA 4KITB 4II2A 2R7SA 3GTGJ 1E0EA 5L3FA 4I0BA 3FXRA 1HCRA 4AC0A 4BJ6C 4J00A 2DOEA 3HOTA 1P6RA 2LOOA 2QWWA 4BE2A 2A05A 2ZXWH 2ZNZA 4LFUA 1T38A 3QPTA 2XSDC 1ZAOA 4Z6YA 4YELA 1VQPI 5HDNA 5AIPA 5A2QZ 1OYYA 3LA3A 2DPDA 4N9HA 1AOYA 2CUEA 3LQRA 3P7NA 1D0YA 1HW2A 2PJRA 3I59B 3JRAA 3CCEI 1NH3A 4ESFA 1ZREA 2O3FA 3L2WA 3QOPA 2LF8A 4IOCF 1FMVA 3IHUA 2OC6A 1TT5B 4L5IA 3S16J 1UFMA 4FQGA 5EGOB 2DCEA 3GFLA 3ZMSA 2DXIA 2CQKA 2DA3A 2L9NA 2M8EA 4I01A 1TW3A 5LHHA 2FNPA 2XF5A 1XCVA 1BOAA 1K79A 2VE9A 4DNCA 1BJZA 1W0UA 4EJWA 2P5LC 3KFWX 1R58A 1ONVA 2GIZA 2ELJA 1JHHA 3GXOA 5FRNA 5K7ZA 2KLOA 3MAJA 4KT6A 5HODA 3CD6I 4E7IA 2KIQA 3ZQGA 2YX4A 3I59A 1T8IA 3CCLI 2Y2ZA 2DT5A 5J3LA 5L3CA 1DP3A 4IQ4A 4HRIA 1X1DA 3DBHB 2LK2A 3JRIA 2LMDA 5B3SH 4BDYA 2VQCA 4HEA2 2R5ZB 3GMEA 5IOZA 2CFOA 4ZYDA 3A2KA 2VN2A 4A69C 5TRDA 3DU6A 3RKYA 4KICA 2DYRH 1EKEA 3O6BB 2XHKA 3V42A 2MD5A 3QYBA 1Z6RA 2M3AA 1RC9A 1F43A 1X2NA 4ZZLA 1KQ9A 3AG3H 2CQXA 4ZDPA 3M1EA 3L9FA 2AQFA 4GCVA 3PNVA 2IGOA 4IKFA 2E35A 1LQ1A 2EBIA 4AIJA 5D5UB 1TP4A 5J4YA 3LL7A 1B8IB 2FA5A 2FSWA 2VOPA 1E17A 2VBXA 2K02A 2CQQA 2EFPA 2V1UA 3E5QA 2BVLA 4HYEA 4X6AJ 2PMZN 3X2QH 2ISZA 2LYCA 2BEOA 3P5JA 3S1QJ 2H1KA 2R7VA 3Q9SA 2R7OA 3CO7C 1MBJA 1UELB 5GAHJ 2IA0A 5LGTA 1BI2A 3E97A 5GP9A 1H8AC 1XGNA 4HQMA 1MJBA 1TWCJ 3O8GA 5FO5A 1HBXG 3LSJA 3W6VA 2Q2EA 4OMYA 1X3UA 3FK6A 3M4OJ 3ISPA 1LVKA 1POGA 1VNDA 2VPRA 2BY1A 3WTXC 1DPRA 1NK3P 4IOAF 4DGWB 2L7KA 2CO5A 5FFXA 3CMYA 2GWRA 3DF8A 4LB5A 4XRSG 4BEHA 4A3KJ 3IAM2 2ZMEC 2Z3YA 3LAPA 1Z6TA 4A6DA 4BQQA 2R7RA 3BG7A 1P2FA 1SFUA 1S72I 4HNUA 1ZG5A 4U7DA 2OJED 3G1LA 1MBFA 2DA2A 2WB1N 3HBLA 3KIOA 2MC4A 2LY2A 3FXOA 3DWLE 3BC8A 1ZN2A 2LF7A 2A68F 1K6YA 5GTHC 2KRCA 3ZQCA 5DUKA 4EM0B 1U6GA 2M34A 4MQ9F 3ONQA 1AA7A 2R7FA 3WE2A 1CGPA 5K7FA 1ENHA 1IV8A 2W24A 1G3TA 2IA2A 3CCRI 3FXQA 1IRZA 3CC7I 4OIRF 1WJEA 1BL0A 1TNSA 4W97A 2MBFA 3TW6A 3H5NA 2LP0A 3MQ0A 1A35A 1MD0A 2DMPA 3KEYA 3R6SA 2VJJA 4XBFA 1S6LA 1NHAA 3EUKL 3HGGA 5JLXA 3HM5A 2W1OA 2KFDA 4BHBA 1OCOH 4NQWB 3VSLA 4L18B 3CP8A 5IP6A 2GOXB 1ZR2A 4PGHA 1H89C 4A2UA 3S3MA 2QZ8A 2ID6A 3LSHA 1GUUA 1J2XA 2H27A 2JK3A 4P9FA 3DP7A 3EPZA 3RYPA 3JSOA 4UVCA 3VOEA 4RGUA 2K9LA 4RAGA 1F4KA 1EJ9A 2HVSA 2DA6A 3VWBA 5E1WA 3CMEI 3BR3A 1FC3A 3H5RA 2M8GX 4ANJA 2P0WA 3OYFA 4NNJA 2KHMA 2OAZA 2X6WA 1VI0A 2P5VA 3CC2I 1XPXA 3ZPLA 4PSWA 3WGHA 4XICA 1Q1HA 2HQAA 2E1OA 1YX3A 4KYWA 4EJUA 1MJ9A 5ERIA 4G6QA 1VQ7I 4QSHA 2F2EA 4HAMA 4N9IA 4KNYA 4FISA 3CMAI 2V6CA 4Q47A 2LKPA 1E3OC 4PJNA 3SHFA 3IKTA 2DPUA 1B6AA 2PG4A 2L7FP 2LVSA 2F4MB 4M9XA 4XIDA 2E19A 3BG9A 4XLAA 5J1UA 4DZPA 1VQ6I 1P4AA 3Q0WA 5FLMJ 1YIJI 2R7QA 1J59A 2RQPA 4EJOA 2DTZA 3EUAA 4XSXF 4MNUA 3TBIA 3HHGA 3QPLA 4YIRX 3Q0VA 4MGRA 4M3EA 4LG0B 5AONA 3DLAA 1S7EA 2XB5A 1YW7A 3ZGKA 1W36D 2NVYJ 2E7XA 2NNYA 5K1YA 3HJEA 2DQRA 2VJIA 3M07A 4IRGA 2LREA 2E7WA 1HQCA 1SFOJ 1T33A 2BY2A 4O6JA 4HX4A 3DPTA 1TLHB 4LG0A 2ZMEA 4ZYGA 2R7ZJ 1FTZA 4CUGA 4ENMA 4PUSA 1N77A 2FF4A 1IXSB 2VB6A 4OIOF 3KZZA 2L4AA 4UV9A 2JRTA 1W5CC 1ZQ3P 4BE1A 3S15J 4F92B 2L5QA 3WU0A 2NRAC 1NG6A 1T98A 3PUFA 3Q9VA 1R5GA 1YQAA 3BR0A 1IW7F 3GBGA 1IN7A 3R60A 4Y17A 3V8LA 1U8BA 1MDMB 2L0KA 3E0JB 4CH7A 5B1AH 1XMXA 4S0HB 2E2IJ 2V4JC 3U9GA 1IZ1A 5DCFA 2NS0A 3TP0A 3DKXA 4QWQA 3WTWC 2F5EA 4GRIA 1B8IA 1QVUA 5L3BA 2FD5A 1HF0A 1LKXA 3DBLB 4BQNA 3OYNA 1YLFA 2BBYA 2IJLA 5M3MJ 1AKHA 1MMDA 1MBEA 2DBBA 2FE3A 4RMNA 4KISA 3FX3A 3U21A 3J80K 1HSTA 2R5ZA 5M3FJ 3L2QA 5H2FC 4Y33A 1R49A 2AXTC 4NC7A 2XRLA 3F23A 3GFJA 3JR9A 3K4KA 1D8KA 4A3BJ 1M1EB 2L2OA 1RRJA 2TCTA 4Y7NJ 3J7AY 3GCMA 3M7GA 5HDGA 1DU0A 3KP3A 3JRBA 2X1EA 5E20A 3GTOJ 3ELKA 2R7WA 2VODA 1XD7A 3H3VK 1IAWA 2HFHA 3K2ZA 2QKMB 5CVRA 2MYSA 1ULYA 2VQLA 3BG5A 4BJTA 3RI4A 4M6XA 1VFCA 2DFIA 3K4CA 4N0BA 2ME0A 2XSJC 5F08A 1YW8A 5KHDA 5L3GA 4L9NA 5CYVA 2MABA 3HL2A 1BI0A 1DDNA 3PM1A 1I6XA 3B6AA 1HDDC 3UNGC 2VL8A 3F8NA 3H3UA 4RAZA 1ZYRF 1D3YA 3PSIA 4V2GA 3J80Z 2O8XA 4QPOA 1FBSA 3QQAA 4RM3A 1I1GA 3MVPA 4P96A 2LY9A 2CW8A 4BY1J 5LLQA 4AIKA 4TV7A 5F27A 3SEZA 4HNTA 2Z99A 5DS9A 1BC7C 1IF1A 3HOWJ 2GQQA 3CDHA 3TOBA 3BTIA 2XPVA 3L1PA 1I27A 1SAUA 1UB9A 3PL8A 3JRDA 1YHQI 2BV6A 4MTEA 1ZTRA 2IGMA 2AXLA 3PIPF 4A3MJ 4UNOA 3GTQJ 3U1KA 2RGVA 1BN5A 2HS5A 1J9IA 5IT3A 1UCRA 2Q2EB 3IWFA 1K83J 2NVUB 1SMYF 2ELKA 1W0TA 1HXDA 2R7XA 2MLKA 2VKHA 2E2JJ 2IS4A 2EB7A 2KMUA 4A3JJ 1QZYA 2HYGD 4DQ2A 2QUFA 3I53A 4XLNF 3L2CA 3WG7H 5DEQA 1HKSA 5HLHA 4JOMA 4EGZA 1OQYA 4FE4A 1SVLA 2F4OB 3OYLA 3OMYA 3TO6A 1TTYA 1XGMA 1QBJA 1ETVA 1ON1A 1P9QC 2L9RA 1HW1A 3HKZN 1IN8A 1FNNA 1AHDP 1Z7UA 3MZ8A 5JHUA 4E7ZA 1FSHA 3GW2A 5DYMA 2IS6A 1Y0UA 3RKQA 2FOWA 3BCBA 2ZJRF 4DYRA 1GV5A 3WTUC 1H0MA 1Z05A 1W7PA 1MJAA 3FMQA 2EFWA 4M74A 1UG2A 4JP0A 5F64A 2E71A 3W3CA 5EDNA 4JQFA 2CS3A 4E4HA 4HPQA 4G8XA 5EZHA 4O3MA 1D5VA 1RESA 5TGTA 2DMUA 2DA5A 1RUNA 1DUXC 1ZK8A 3FK7A 3GFIA 3VPRA 1P7IA 2OCCH 2V1DA 2R3SA 5HLTA 5BOXA 2ZBKA 5D6EA 1LUJB 4DBRA 2ME6A 4L9JA 5DCMA 5FLVA 1XDUA 3VYRB 5C3EJ 2R0QC 4F91B 2IBDA 2IS2A 3LSKA 5CQGA 2K27A 1W5SA 4LIVA 1ZKGA 3BTLA 2JSPA 1J0RA 4C3IJ 3RCOA 4HF2A 3W2WA 5EGOA 2OZ6A 4EEFG 3HOYJ 2HXIA 3QYFA 2VASA 2L4MA 2EIKH 3FXUA 2WC2A 1RKWA 2ESNA 4RAFA 3PSFA 1I50J 5LFAA 2EINH 1ETYA 3MEXA 3SFZA 4E6KG 1W7PD 5ILSA 4PJJA 2COMA 1Z67A 2BW3A 1T56A 3H1CA 1N78A 1GDTA 4NBQA 1JT6A 3R0AA 1Y39A 1FZPB 2QGUA 3OYIA 2GXBA 2FMLA 3GTPJ 1ON2A 3ASOH 1WH5A 3TDZC 4ABZA 2KJBA 1ACIA 2ZSIB 3JTHA 2GOMA 2QQ9A 5HVQC 2Z33A 1JUMA 5C44J 2COBA 2V1XA 3FHZA 5LRRA 1FOKA 1YTYA 2XF6A 3K7AJ 2NS8A 3A03A 2G7UA 3M9AA 2X6XA 1U5TC 2L9VA 4BGDA 2M4GA 3DBRB 3V8KA 4BBRJ 1Y6IA 3FMRA 4I76A 3WTTC 1VQMI 3S1RJ 2ZCWA 2TDXA 1MW7A 1ODDA 3F72A 2ZJQF 2DJNA 3CLQA 5L3EA 1J7KA 1SD5A 1IG7A 1D1AA 2E60A 2LFBA 1ZLKA 4M72A 4M9SA 1WQ2A 1YRNB 2EQRA 2PMHA 1YJNI 2YSRA 4HDUA 2WAFA 4ZTFA 2XKOA 1U2WA 2Y48A 2L9SA 3B6CA 1AWCA 2VI6A 2XROA 1D0ZA 3H9JA 4CYDA 2LTPA 4BQOA 5HNHA 3FWEA 1MIJA 5E79C 1Y8RB 4BAYA 5IP9J 4XNFA 3ZQFA 2CMPA 4RS8A 2XV4S 3T1BA 2PLYA 4DZJA 3BPVA 2ADUA 1Z0XA 1BC8C 2WV0A 3BR1A 2JVGA 2LY1A 3AL0B 1A5JA 3P9IA 2VC0A 4E7HA 3ZXSA 3IRRA 2IGKA 4BYYA 1IO2A 2E36A 2BYVE 3BPXA 3HGYA 2K4JA 2D1HA 2XKPA 3DCFA 1MMNA 1PJRA 1WJDA 3VYTB 4NB5A 4N4OB 4OWRB 1E3HA 1K78B 2CQ7A 1IV6A 1FOYA 2HQ5A 4I0AA 3C3WA 1BW6A 2ZO4A 2ETHA 5F0CA 2BHYA 2UV1A 1JTXA 1AU7A 3H92A 3DTEA 4CCLA 3SXYA 1U78A 5DDGA 3KETA 1RR8C 2XAFA 1G59A 1Y0NA 2Q1ZB 2HVRA 5LHIA 1USSA 2F5FA 4F55A 1ZGWA 3VODA 5DV5A 2JZYA 1LFUP 4KFCA 3V8JA 9ANTA 3DEWA 5FJ8J 4UVBA 4AYBA 1XCBA 1T0FA 4LGWA 2JSCA 3L2UA 1KA8A 4MEYF 3TOAA 1WPKA 1LEBA 4HG2A 4XR6A 3GUDA 2V26A 2QSFX 1FWZA 1GV2A 4A0XA 5LHGA 4K2EA 3A02A 1Q1VA 1STZA 4IVNA 1O4XA 2NXNB 3S8PA 1O3SA 4U88A 2WAEA 5BPDA 3HDDA 3MKZA 3PQJA 4XRMA 2DOAA 3NAUA 2YU9J 3IRQA 2A5WA 1PYVA 2NOJB 1OLTA 3PJRA 3LSTA 3I55I 1X3WB 4C9YA 1EA3A 2DT6A 3K1PA 3V7SA 2WB1A 1BW5A 1IDYA 1FYKA 4PSXA 1MH4A 4BXFA 4F3QA 2M45A 4CZCA 1SEUA 4Y3OA 2JMWA 2Y0SN 1WFXA 4BBSJ 3QPSA 4LG3A 5C4XJ 2HNHA 2XGEA 1WGXA 2WY7Q 3EDPA 2K5CA 2OD5A 4I02A 3J7YJ 1OCRH 5JVTA 4DIQA 1JI8A 3F8FA 1IRFA 3EUHA 2L3DA 3BWGA 1O3TA 5HS8A 2IRFG 2IA1A 4XRFA 4GXOA 1JHFA 2W4SA 3O2PE 5FD6A 3ZMZA 2DDAA 1W7PB 4Y52J 1BBYA 2JVHA 4BUPA 2DOFA 4G7ZF 1F5TA 1RPWA 1Z3YA 1VQ4I 1R22A 5CVUA 3ZQIA 1HC8A 1TT0A 4WX9A 3QP5A 3ERED 3OYAA 1W1WE 2JPCA 3PUBA 4P5OA 2QSHX 2M7AA 2FRHA 2DMQA 3K70D 4R8HA 3G6EI 3DLLF 1TWFJ 2O03A 2LH9A 4XLCA 4G9YA 1TL8A 3DPLC 2DMTA 3OYDA 4C30A 1XDSA 4FT8A 4ESJA 3BROA 2O0YA 2R5YB 4RGSA 2DA4A 4G6DA 5LGUA 1O3RA 1R36A 3CCVI 5HS7A 3KYCB 3CLOA 1X1CA 1QHGA 1MGTA 1P4WA 4RB0A 3CCJI 1U9NA 1YS6A 5E8GA 4A3EJ 3KZIC 4E7KA 3RPUD 3QU6A 2VT2A 4L0ZB 1EH8A 2EILH 3H0DA 4HQEA 5DM6F 2AHQA 5JFRA 1WJFA 2PBIA 4NHJA 2KIFA 2K9QA 2N8GA 1SFEA 3D0SA 3ZMUA 5B5EC 1PP7U 1OCPA 2E5NA 1RNLA 3JRGA 5DD4A 3SZGA 2K4BA 2EPFA 3T8RA 4O5VA 1QU3A 3ECHA 3IV5A 4M3GA 2K86A 1T0FC 3JAMZ 2DAOA 1IC8A 2BW3B 1MMAA 3QAHA 2H94A 2CGPA 5EEHA 2OTJI 5FLXK 3QOEA 1TWAJ 2FU4A 4RB3C 2QENA 2QM3A 1O3QA 4LB6B 3CUQC 3BJAA 5CVVA 1Y1VJ 1B9MA 2P4WA 1FSEA 1S7OA 5EG0B 2BVMA 4Q4ZF 3BG3A 3MKYB 4LMYA 1FY7A 1R71A 2OBPA 3LFKA 2OA4A 3BZCA 3IAS2 4RA2A 2IS1A 4U0VA 1SD7A 4OIQF 2CUZA 4MFDA 3J81Z 1QGPA 2PMZA 3F22A 3QPHA 2PQ8A 5FRMA 2RN7A 1PUEE 3OYKA 1I1SA 2ICWG 4IHYA 2DK5A 1XSXA 3QU3A 4ENNA 1QPIA 1BIAA 1VQOI 2R93J 2HXOA 1UJ8A 4BH9A 2JA2A 4EQQA 5IT9Z 2O5RA 4U0YA 4MQVA 2BXZA 2LC2A 5K5OA 1OPCA 1KGSA 1ETQA 1Z77A 4JYKA 3K4BA 1B59A 4A12A 3HOUJ 4A93J 3A1YA 3REOA 3CUQA 5EZGA 2DT7B 2Z16A 4I6ZA 2HWVA 3WGGA 4IHXA 3O8HA 5IPAA 3BQZA 2QLZA 5CPRB 3CF2A 4LIUA 2QYOA 2ZSHB 1ZRDA 2XASA 2V7FA 1VQKI 1S3JA 1SFKA 4Q48A 3S3NA 3TO7A 3RZOJ 2DW4A 4EGYA 1YIOA 4FCYA 1MBHA 1LB2A 2QBYA 2VPLA 4BJ5C 1U5TA 2XGXA 3EQLF 3S3OA 4HA8A 4A5MA 5DD8A 5IYDJ 2X51A 4KT5C 1TWGJ 1OR7A 2MGQA 2OF7A 2NYXA 2GBYA 1LFBA 3KEOA 3ABUA 3OYMA 2OCEA 3N97A 3CCYA 1G6NA 3GWZA 1TQPA 2H09A 2HQRA 1WJBA 3MZYA 4I09A 3RDIA 5D8KB 5LD2C 2VQHA 4CDGA 3U1DA 1K4SA 5IP7J 2V9KA 1MZBA 2O7OA 3IH3A 1X58A 3H9GA 2BE5F 5CQEA 4HSRA 2P8TA 2KRHA 1A36A 4FASD 3OYBA 2WBMA 3OS2A 2FUG2 1OR7C 3SQNA 5LEJA 4RB1A 1SAXA 1S8NA 2E1CA 2NS7A 1FJLA 5JR3A 3H36A 3OL4A 1B72A 1I5ZA 3HOXJ 4M71A 3HOSA 1LVAA 1WJAA 3BT9A 1LE8A 3FXKA 2TRTA 3S17J 2CQNA 2R7DA 4L5JA 2O6GE 1UAAA 3KEQA 3AFHA 5IYBJ 5F6FA 3MKWB 2FQ3A 4I99C 3FBNB 3I58A 5HNFA 2JRMA 3TW7A 2JN6A 3IWZA 2OU2A 3HRSA 1YX5A 3BZKA 5EJCA 3F21A 1YOVB 2ZFWA 1X4OA 3JSPA 5ICGA 4XKBA 4I2OA 3S2DJ 3OIPA 2DA7A 1MBGA 2RV8A 4KIGA 4XQFA 4D7NA 2YS9A 4CSWA 3O3KA 2HOTA 2MH2A 1JGGA 2EZKA 3HTUA 1XN7A 3BOQA 4BU2A 2RAEA 4KIFA 5FKLA 2M9HA 1OFCX 1K7AA 1AKHB 4B09A 1OYWA 2ISYA 3JRHA 1J5YA 2HVQA 2NVQJ 2BXYA 1YJ9I 1Z1DA 2W00A 3LA7A 3E6CC 4BACA 4YRVA 3GTMJ 2YUSA 2HDCA 2OTLI 2GA2A 1UZCA 2X6OA 4RGXA 1QZEA 3EYYA 2DK8A 3ZMVA 4G7OF 4HW0A 1I6HJ 1MNDA 3SEQA 1FIAA 4C2TA 1XTAA 2BY3A 3KP4A 2H1LA 1BI1A 2KZGA 2EV0A 4HSTA 1LDDA 4XLEA 1FTTA 2G7HA 4XOPA 4RDUA 3CDLA 1LE8B 2BY0A 2BZTA 1B72B 1FT9A 1P7JA 2UWMA 3BP8A 2VKDA 2ZXHA 1YFHA 4OU0A 4B48A 1V5FA 1Z7LA 1ZR4A 4U87A 5H6QA 1YE9A 1CF7A 1DQUA 5H6RA 3CO6C 2K3PA 2W25A 4M3FA 2M87A 4PFPA 2P6SA 1FOXA 3SZTA 3T0YA 1R1VA 3ESWB 5D4RA 1S9HA 1ZGJA 1QPMA 1LNWA 2OUMA 2E5ZA 3KYDB 1UMQA 2VBWA 4H0EA 2ZKZA 4BHPA 5BQTA 2PMUA 3HG9A 3GZ6A 4V2FA 1D1CA 5FFZA 4AVZA 1YG2A 4ESBA 1H9GA 2LSOA 5J1RA 4S05A 1B9NA 3HRTA 3IC7A 3KP7A 4XORA 2RC4A 4I98B 2KPMA 4JBAA 5LGNA 3OWTA 1T2KA 3DU5A 4GYGA 3CC4I 5J6XA 1RI7A 3LSIA 3LSGA 1KU3A 2ECBA 2X1CA 2ZB9A 1KU9A 4XSZF 4G6TB 3G1MA 5H20A 3HB9A 1FEXA 3GF2A 2HQNA 2VIXA 3OYGA 1X1BA 4PCQA 1Z21A 2VQGA 4PDKA 1GVJA 2JA7J 3B02A 1X19A 2XDVA 3NQOA 1VTNC 5D4SA 4QIWN 2QKLB 2VXDA 2P7VB 5IOYA 1ZLJA 2QQBA 5KCMA 1L3LA 3RYRA 1FBQA 4B8XA 3CDIA 4LK0F 1RETA 1IDZA 2R7TA 2X0LA 2G0EA 5GPCA 3D5RC 2QQ8A 4BL0B 2DTRA 2I8DA 5BNGA 3HTSB 5J40A 4MFEA 4YEJA 2XIGA 3G1OA 1U8RA 4HF1A 2WTEA 3OSFA 3TEDA 3VSKA 2HGCA 2JQ7A 3ASNH 1G3WA 3DKYA 2FMYA 4IO9F 2BHZA 4EVIA 3JRFA 1XC5A 2X9DA 3V4GA 4CHUA 1RR7A 1BOBA 3HSRA 3I3LA 1FBUA 2G9WA 3DTIA 3P9KA 1GHCA 5LEKA 1MKMA 4XKWA 5L3DA 4A3LJ 3FF5A 4MEXF 3ABMH 3RQ4A 1EV7A 4OOIA 1KONA 1UHWA 1S7AA 2RNJA 1GXQA 4CZZA 2YPRA 2H6CA 2GLOA 3LOCA 2CUJA 4HV6A 5D5XB 1RKTA 4AUXA 1K6OA 5ED4A 3LQQA 2VOOA 4A3GJ 1HA8A 1Z91A 2KIUA 2E1MC 2A3SA 4PK4A 1XG1A 5GADJ 3PNYA 1WWXA 3D5LA 2O8KA 3M8JA 2CRGA 2YR2A 5IYCJ 2I5UA 4BHCA 1ETXA 3LMMA 4UXNA 2B7EA 4A0ZA 4UUSA 4RGRA 2NOGA 1E3PA 2K9SA 1S29A 2X4HA 4A5NA 5E3NA 1YJWI 3WHCA 4IXAA 2M7BA 4HV5A 1VQLI 2QQAA 2OPTA 4GFBA 3VDXA 4A3DJ 3NWSA 4HOBA 2BGCA 4BXUA 2K40A 3HHHA 2HZTA 3TL4X 4C3JJ 3F6OA 1O57A 2QVOA 2CSOA 3BG6A 3ZQ7A 1BM9A 2JA6J 2EH3A 3E3VA 1V4RA 3A01A 2V9VA 2BOLA 1JXSA 1A6QA 2QBYB 1SVOA 1BIBA 3KP6A 4BQAA 5J8CA 4PFOA 4EV0A 1U0JA 3E1SA 5DUIA 4A3CJ 3F0CA 1H88C 4LITA 1LEAA 1Y56A 3ZQQA 4EM2A 3A01B 2LBFA 2EZHA 4CCMA 4M73A 4E7JA 3LA2A 4B3XA 5JHFA 3TQNA 1QQIA 1JTYA 1GLNA 2XPWA 3WTVC 3AG4H 1P92A 5FD5A 1P4XA 5LRSA 1GXPA 4IL6C 3CUQB 2WAQA 3I4PA 3BLYA 3OL3A 2W84A 3VYUB 1ZGAA 2P7CB 2L7ZA 3C2GA 3CJRB 4GO1A 5HOOA 2H8RA 1R5ID 4X0GA 3ZQHA 2V9PA 1SC7A 3RKWA 2FNAA 3U2RA 3BTJA 5DTDA 3Q0UA 4EMSA 3E6MA 2M5WA 2L02A 4OAYA 3MWMA 4NC8A 4D1QA 2IGNA 3HC7A 4OAZA 3N4MA 2MSYA 4DBQA 3WE3A 4WXDA 1RUOA 2WWYA 2RVCA 1IXCA 2LKSA 1MSEC 5JI6A 2VBYA 5E1ZB 3Q5FA 5DM7F 5M5XJ 2F48A 2HOEA 2Y69H 4Q5SF 4HNVA 1ETWA 1IUYA 4B1RA 2E2HJ 4DJAA 4LOCA 1YO5C 4B44A 2HOSA 3HSFA 2MW8A 4XLHA 4OIPF 2MG4A 4NDLA 1R7JA 4YG2F 3M8EA 2F4IA 2LRDA 2D1VA 4B4CA 1WVRA 3CJQB 3OIOA 2K7LA 1SMTA 4DOZA 2JJ7A 2HEOA 2ESHA 1XMAA 5M5WJ 3RJPA 1IJWC 4BE0A 2V1NA 3CCUI 2NNNA 4LLNA 2Q0OA 2DODA 3HZJA 2VXZA 4AD9A 1WRJA 3JRCA 5EYRA 1IN6A 4I7HA 1TQIA 3P9CA 3SJMA 2DMNA 3D1NI 4ENJA 2W82A 2AQEA 2HKXA 3QWLA 3I9V2 2EA4A 4IJAA 4PJMA 1HSJA 3ZOBA 1VQNI 2A07F 2UXXA 5GAEJ 4RM2A 1QA6A 5HS9A 4BS9A 2L54A 3FZVA 4RLQA 1X1PA 4CGZA 3KE2A 3K4JA 1K61A 1T95A 4M6VA 4F93B 4YFXF 2FOKA 4ZC3A 2ELHA 1K4TA 3FKJA 2B9SA 2LBFB 4WK8F 3D5SC 3E5UA 4CA0A 1LDJA 1WHUA 4QPQA 1Z9CA 2GA1A 1R1UA 4P55A 4HDVA 1TQMA 3R0JA 1ERDA 2W57A 1IGNA 1QNTA 2OZUA 4E7LA 1V55H 1WH7A 5FKNA 4D5FA 2Y9ZA 1D5YA 1MSFC 4RB2C 3MFKA 1T08B 4LD5A 4GDFA 1FPQA 3NEUA 1NTCA 5K5RA 1PUFA 1SD6A 2DA1A 1G8XA 2EA2A 2Z9OA 3VFZA 1KU7A 2XGCA 2PX9A 4XM3A 1OCCH 4ZZDA 1OCZH 2KQRA 3E6DA 3OYJA 4GGGA 4KMFA 3T5XA 4Z2YA 5D5WB 1BJAA 1DPUA 3TGNA 2XAUA 2RKHA 4MO7A 3AL0C 1ZARA 2ZC2A 4JK1X 4DYQA 2FEZA 4CYCB 4XKCA 3W6KB 1YW9A 1D0XA 1ORKA 4XONA 3V7CA 5J47A 4UY8I 4XL9A 2LLKA 3GTLJ 1XX5A 4X1EA 2CWEA 4J19A 3GTJJ 3LSMA 4IX7A 3FMSA 4WWCA 1Y1WJ 4A6EA 5J1YA 2XF7A 3K4NA 2W48A 4LLGF 4MLOA 1W4MA 2AO9A 1V54H 2HDWA 4CO8A 3JAMK 1N75A 2EJRA 2PFBA 3FXJA 1APLC 3LFUA 2WV1A 4CCNA 4J01A 4XK4A 1REPC 4F52A 4ZDLA 2KL4A 2KRFA 3ABKH 3K69A 4ITVA 3CCQI 3C7JA 4KDPA 3I71A 1ETKA 1XSDA 4ZDOA 5FKOA 3S2WA 4PJLA 3HPHA 2RREA 1XGSA 3SFIA 2OQRA 4YFNF 1MNEA 1FYLA 3AAFA 3FXMA 3PFYA 1IRXA 2DLLA 3F6VA 3FHNA 2XUBA 4LJZF 3OV8A 3SYTA 5E8IA 5EF6A 4JX5A 3K70C 3HOVJ 2CW0F 3UR3C 1ZHFA 3WG9A 1DP7P 2NAZA 1C0WA 2EV5A 3I4MJ 2DDBA 4AWXB 3OYCA 3HSEA 3ABLH 2QF7A 4FE7A 2DYSH 2JTVA 1OJLA 2DFFA 2EFOA 5ICEA 1YITI 5EEAA 3I54A 3SZPA 3OS0A 3CQZJ 4II3A 1TC3C 1BR4A 3MKLA 4BY7J 4NQWA 3WTZA 1VQ5I 2J5PA 2LD5A 2R4GA 1B1BA 2J5OA 2FQ4A 5FKMA 1X3ZB 2VBZA 2VJ4A 2NVXJ 3SDBA
chains in the Genus database with same CATH topology
3DEEA 2HPMA 3F9KA 1ZELA 4U7BA 1YX5A 2RNGA 3W2AA 3H35A 2X6YA 4ZYAA 3W3CA 1X4OA 4JQFA 4XKBA 1BR1A 2CS3A 3OIPA 4E4HA 4HPQA 4XQFA 3QODA 4CSWA 5TGTA 2Y0SA 4CCKA 3HKZA 3OIQA 4BU2A 5HLTA 2IXSA 1X1AA 1J09A 4DBRA 4B43A 3ZR8X 2VJ5A 3VYRB 4F91B 4ZJZA 2HVQA 2IS2A 3LSKA 3ZCOA 2W00A 5CQGA 4R79A 3KYLA 4YRVA 4BACA 2CV1A 4B47A 4LIVA 2JSPA 1WJCA 4II2A 4KITB 2R7SA 3RCOA 4KJZA 1E0EA 1MNDA 3W2WA 4EATA 3SEQA 4C2TA 4BJ6C 3QYFA 1UG0A 2X1DA 2LOOA 3HOTA 3BCAA 4J00A 4BE2A 2VASA 4HSTA 4XLEA 4XOPA 4ZTJA 4XLFA 4YELA 3PSFA 5LFAA 2V6EA 4E6KG 2UWMA 4PJJA 2VKDA 2ZXHA 2BW3A 4B48A 1V5FA 1Z7LA 1N78A 4U87A 1YE9A 1LDKB 3S32A 1DQUA 1D0YA 1TZLA 3OYIA 2PJRA 1LFPA 2K3PA 4PFPA 3L2WA 1BR2A 1FMVA 2F6CA 2OC6A 2ZSIB 1S9HA 2GOMA 2DCEA 2OUMA 2DXIA 3M1CA 5HVQC 2E5ZA 2L9NA 3HUGB 2XF5A 2XF6A 1W36C 3HG9A 2X6XA 4BGDA 2M4GA 2ELJA 1D1CA 4AVZA 5FRNA 2KLOA 4KT6A 1Y6IA 4XORA 2LG4A 4E7IA 2CH0A 1MW7A 2KPMA 4XN3A 3OYHA 3OWTA 1D1AA 2E60A 1DP3A 3DU5A 4IQ4A 4HRIA 1X1DA 3LSIA 3LSGA 4BDYA 2VQCA 4HEA2 2X1CA 2CFOA 3A2KA 2WAFA 4ZTFA 3DU6A 4G6TB 2L9SA 3V42A 3HPGA 1D0ZA 3H9JA 3QYBA 2M3AA 2VIXA 4BQOA 5HNHA 3OYGA 1X1BA 4ZDPA 1Z21A 2VQGA 2AQFA 2KDOA 1V5EA 1X19A 2M4KA 2XDVA 4XNFA 3K4MA 2CMPA 3PNVA 2IGOA 4IKFA 2QKLB 4NUBA 2VXDA 5KCMA 3LL7A 2R7TA 3D5RC 3OR2C 2JVGA 2LY1A 4BL0B 2I8DA 3AL0B 2BVLA 4E7HA 3ZXSA 1VZ0A 2IGKA 4YEJA 2PJRB 3IP4B 2LYCA 4CCJA 3L2RA 1MMNA 1PJRA 1WJDA 3VYTB 2R7VA 4N4OB 4OWRB 2R7OA 3VSKA 1UELB 3DKYA 3CZ6A 3MMYB 2UV1A 4C2UA 3DTEA 3CESA 4CCLA 1BOBA 1LVKA 3I3LA 2RQQA 3DTIA 1G59A 4XKWA 2MD0A 3NWTA 2Q1ZB 4IZZA 4DGWB 2HVRA 2L7KA 3W2VA 3RQ4A 2M0MA 4BEHA 4F55A 3IAM2 1KONA 4BQQA 2R7RA 3BG7A 3FBIB 2CUJA 2KP6A 4HNUA 3DPUA 4AYBA 3L2UA 1HA8A 2E1MC 2MC4A 2LY2A 3DWLE 4PK4A 3BC8A 4HG2A 3PNYA 1K6YA 3D5LA 2KRCA 4XR6A 3M8JA 2V26A 4FETA 4XN0A 3LMMA 3EUHC 5KNLA 3ONQA 4XOTA 1AA7A 3HXLA 2WADA 3S8PA 2WAEA 3RSNA 1WJEA 2M7BA 3MKZA 2MFZA 2DOAA 2Z1DA 3H5NA 3VDXA 3NWSA 2A5WA 1PYVA 2NOJB 3KEYA 5FROA 1OLTA 3PJRA 2VJJA 4C9YA 3EUKL 1EA3A 2DT6A 3G2BA 2WB1A 2HPIA 3TL4X 3K4LA 2W1OA 4PSXA 4BXFA 4NQWB 3VSLA 4F3QA 3BG6A 3CP8A 2R7UA 4CZCA 4Y3OA 2GOXB 4E7SA 3IUOA 3S3MA 1WFXA 2BOLA 3LSHA 4LG3A 2HNHA 4PFOA 2WY7Q 3E1SA 1U0JA 2K5CA 3EPZA 4LITA 2XC7A 2CV2A 1Y56A 3ZQQA 3K10A 2K9LA 4DIQA 3C2HA 1JI8A 2LBFA 3OYEA 1Z3XA 2HVSA 3VWBA 2VLAA 2KZVA 4CCMA 4E7JA 4B3XA 3H5RA 3QYEA 2DJIA 5JHFA 3VYSB 4ANJA 2P0WA 2ZFUA 3OYFA 2W4SA 4NNJA 1GLNA 2KHMA 2X6WA 2WAQA 3BLYA 2JVHA 3OL3A 4PSWA 4BUPA 3VYUB 3ZRGA 4D9JA 3C2GA 1Z3YA 2HQAA 3CJRB 1QHHD 5HOOA 1YX3A 1TT0A 2Z2SB 4X0GA 2WA0A 3OYAA 3A4CA 2K9MA 3PUBA 1DGRM 4P5OA 4OAYA 1NG7A 2M7AA 4NC8A 4D1QA 3OY9A 3MD2A 2IGNA 3HC7A 4OAZA 3K70D 4PJNA 4RLFA 4DBQA 1V5GA 2LH9A 1FMWA 4XLCA 3DPLC 3OYDA 4C30A 4XLAA 3PNTA 2R7QA 3EUAA 4DJAA 1X1CA 1QHGA 2HZDA 1X4PA 3TBIA 4B44A 4XLHA 4XMYA 3DLAA 4Y4RA 3ZGKA 3CMMA 1W36D 2X85A 4E7KA 2F4IA 2LRDA 3RPUD 2W7NA 3CJQB 2VJIA 2LREA 4DOZA 3H0DA 1WJFA 3OOUA 3DPTA 4BE0A 4CUGA 2V1NA 2E5NA 4PUSA 1N77A 3SZGA 2VB6A 1DGWY 2VXZA 1QU3A 4BE1A 3L2VA 1T0FC 4F92B 2L5QA 1NG6A 2BW3B 1MMAA 4H4KC 3GBGA 2W82A 3QOEA 3E0JB 2AQEA 2UUZA 3I9V2 4CH7A 4PJMA 1MMGA 2V4JC 4RM2A 2A6TA 3DKXA 4BS9A 4RLQA 2BVMA 3MKYB 4GRIA 3K4JA 4BEHB 3IAS2 1T95A 2IS1A 1LKXA 4F93B 2E1MB 2F5VA 2CUZA 4BQNA 3OYNA 4ZC3A 2PMZA 5FRMA 3FKJA 2LBFB 1MMDA 3OYKA 3D5SC 4CA0A 4RMNA 4KISA 4QPQA 3U21A 1ERDA 3L2QA 3KX2A 4Y33A 4E7LA 2JA2A 4NC7A 3CP2A 3K4KA 2O5RA 3AKZA 2L2OA 3J7AY 4AU7A 2LC2A 1G8XA 2X1EA 4BDZA 2R7WA 3K4BA 4XM3A 3A1YA 3OYJA 2KQRA 2QKMB 4BJTA 2MYSA 2VQLA 2XAUA 3AL0C 2DT7B 2Z16A 4XKCA 3K4CA 5KHDA 2XSJC 1D0XA 4XONA 4XL9A 2CW7A 5CPRB 2MABA 3HL2A 3CF2A 4LIUA 2ZSHB 2JUGA 2OV7A 2V7FA 3UNGC 1SFKA 3LSMA 2VL8A 4IX7A 3S3NA 3PSIA 4QPOA 2VPLA 2XF7A 3K4NA 4BJ5C 4MLOA 4RM3A 2HDWA 2CW8A 3S3OA 1N75A 2X51A 3K6GA 3RTRA 3SEZA 3LFUA 4CCNA 4HNTA 4IQJA 4J01A 4P1WA 4F52A 4ZDLA 1WJ5A 3S93A 1SAUA 2KL4A 4ITVA 3OYMA 3PL8A 5CKTA 2IGMA 1D1BA 4ZDOA 3FDYA 2CV0A 4PJLA 4CCOA 3HPHA 1WJBA 2RREA 5LD2C 1MNEA 2VQHA 3PFYA 1IRXA 4N4NB 3H9QA 3FHNA 2Q2EB 2V9KA 3SYTA 3K70C 2R7XA 2VKHA 3UR3C 2IS4A 2KMUA 3H9GA 4XKVA 5CQEA 4HSRA 2KRHA 3OYCA 4FASD 3OS1A 3OYBA 2WBMA 3DQVC 4JOMA 3OS2A 2FUG2 1OR7C 3N05A 3OYLA 3OMYA 1R6RA 3OL4A 3OS0A 1P9QC 3DTKA 3HOSA 1WJAA 2ZXIA 4II3A 3TMOA 1BR4A 4E7ZA 2IS6A 1UAAA 2R4GA 3AFHA 3BCBA 2WY8Q 3H5AA 3MKWB 3OR1C 2VJ4A 3FBNB 3SDBA 5HNFA 2HU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0M A;  2K3P A;  2MAB A;  2KHM A;  2MFZ A; 
#chains in the Genus database with same CATH topology
 4DW6 A;  3OOP A;  5B1B H;  1A04 A;  1OMI A;  2H6B A;  3DEE A;  1ZEL A;  3I5U A;  5E3L A;  2DN0 A;  4U7B A;  2RNG A;  3JRE A;  3IL2 A;  1J75 A;  1OCT C;  4AVP A;  3H35 A;  4AYB N;  2O61 A;  1IN4 A;  2X6Y A;  3GFM A;  4S04 A;  3G73 A;  4ZYA A;  1WI3 A;  2GXG A;  3CJT B;  4FX0 A;  1F9N A;  2DFH A;  4PGG A;  3QOD A;  3L09 A;  4CCK A;  1G3Y A;  1DU6 A;  3B73 A;  2KKO A;  1L0O C;  4M3B A;  4IHT A;  1FLI A;  5ILV A;  2P5K A;  2OQG A;  2DU9 A;  4B43 A;  3BQY A;  3JTG A;  2H8W A;  3MCZ A;  4ZJZ A;  1IN5 A;  3IKV A;  4OIN F;  5JLW A;  1Y8Q B;  5E18 F;  3OSG A;  3L7W A;  3ZCO A;  2CV1 A;  3KYL A;  1ZRC A;  1BI3 A;  1WJC A;  2DO7 A;  4KJZ A;  3FXL A;  4EAT A;  4AM3 A;  2F5C A;  1R1T A;  1UG0 A;  2X1D A;  3BCA A;  3G71 I;  4G7H F;  4IRH A;  3ERM A;  2KJC A;  3E6B A;  3CJN A;  2VON A;  4ZTJ A;  2XAJ A;  1JGS A;  2A6E F;  4XLF A;  1CF7 B;  3LNQ A;  1GT0 C;  2CG4 A;  2Y31 A;  2V6E A;  2DFE A;  4L9T A;  2GIV A;  3PFI A;  5F0F A;  1YRN A;  1G4D A;  2EZL A;  1LDK B;  2JUC A;  3KP5 A;  4GYI A;  3S32 A;  2YU3 A;  1I3A A;  1TZL A;  4A3I J;  1PVE A;  3H3Z A;  1LFP A;  3E5X A;  4AIH A;  3S2H J;  4KMU X;  1ZG1 A;  2EV6 A;  1UHS A;  4R1H A;  2P6T A;  1BR2 A;  1T6S A;  1XGO A;  2EFQ A;  2F6C A;  3WGI A;  1CQT A;  2KIM A;  3M1C A;  1EF4 A;  3S1M J;  4FTH A;  3HUG B;  2AS5 F;  2JT1 A;  4YII A;  1N25 A;  2EWN A;  1W36 C;  2DQL A;  5FB2 A;  1R5H A;  2DI3 A;  2ZXJ A;  2M0C A;  1WKM A;  2MA3 A;  4JX6 A;  2ID3 A;  2CUF A;  1ZG3 A;  4UB6 C;  5C4J J;  3KLO A;  2K85 A;  2Y9Y A;  2LG4 A;  4Y13 A;  2CH0 A;  3BY6 A;  4XN3 A;  2GM4 A;  3OYH A;  3JW4 A;  4PZJ A;  4UV8 A;  3C18 A;  4V19 K;  2Y30 A;  3LWF A;  2D5V A;  1BA5 A;  5B66 C;  1PP8 F;  5TJJ A;  2JWT A;  1KU2 A;  2GXA A;  3K0L A;  3GYH X;  4OMZ A;  2ZNY A;  4QTR A;  1IXR C;  3DKW A;  1MBK A;  1G2H A;  3HPG A;  2L01 A;  2CV0 A;  5HDK A;  5GTI C;  3ZMD A;  3ZP5 A;  1HKT A;  1U3E M;  2KDZ A;  5K5Q A;  3BJ6 A;  4KIB A;  3KCC A;  1FP1 D;  1V5E A;  2KDO A;  2M4K A;  4EJT A;  3K4M A;  5K7H A;  1HDP A;  4NUB A;  1FOW A;  3COA C;  2PN6 A;  5ICF A;  3I4N J;  3KLN A;  1KYZ A;  1OIS A;  2W85 A;  4IHS A;  3OR2 C;  1MH3 A;  1VF9 A;  1W5T A;  2YX7 A;  4HF0 A;  2IVM A;  2QA4 I;  3PO2 J;  1VZ0 A;  5E3M A;  1O7F A;  5J4V A;  3NRV A;  2QCO A;  4BXX J;  2PJR B;  1HW5 A;  3IP4 B;  3GLL A;  5FKK A;  4CCJ A;  5F0H A;  5KAI C;  3GZN B;  2MH9 A;  4D7M A;  3L2R A;  5JVG F;  5CJ9 A;  1ETO A;  2V79 A;  4ZYE A;  2A69 F;  5BS6 A;  3C1D A;  2HKO A;  4XRS A;  3CZ6 A;  3PIO F;  3MMY B;  4NC6 A;  1FX7 A;  4C2U A;  1XSV A;  3ZN1 A;  1RIO H;  3CES A;  4HLX A;  4HLY A;  1KZH A;  2RQQ A;  1ZH5 A;  3WTY C;  1R23 A;  2MD0 A;  3NWT A;  4IZZ A;  4YFK F;  1LPQ A;  3K1N A;  3W2V A;  2LNB A;  5BPI A;  2M0M A;  3TDU C;  2IP2 A;  1SAN A;  3CCS I;  3TP3 A;  3FBI B;  3LSP A;  3EYI A;  2KP6 A;  4HX8 A;  2ZJP F;  3AG2 H;  3WOD F;  3WU2 C;  3DPU A;  2ECC A;  2VKV A;  3BR5 A;  3DXJ F;  2R5Y A;  3RIR A;  4C2M J;  2HR3 A;  5E17 F;  3ABT A;  1YS7 A;  2HYJ A;  5AIQ A;  2HOA A;  4FHT A;  3K1M A;  3ML6 A;  4YIF A;  1E2X A;  4FET A;  4XN0 A;  3GEZ A;  3RPQ A;  2IAI A;  3EUH C;  5KNL A;  2XRN A;  3DEU A;  4XOT A;  4Y15 A;  3HXL A;  2RDP A;  1OKR A;  2PEX A;  2WAD A;  1TNT A;  1KQ0 A;  2FXA A;  3RSN A;  4WF2 A;  1JKR C;  3HIF A;  3WU1 B;  2NVT J;  1QZZ A;  2MFZ A;  2FX0 A;  2STW A;  1JUS A;  2Z1D A;  3BJO A;  3RQI A;  1SVM A;  2HTJ A;  2IEK A;  3PQK A;  5FRO A;  4CXF A;  4KN4 X;  3G2B A;  4RBO A;  2EK5 A;  1NK2 P;  1ITY A;  3ZN0 A;  2HPI A;  3KPH A;  3W6J B;  3K4L A;  3S1N J;  3BR6 A;  4UHT A;  5ICC A;  3PO3 J;  1KYW A;  2PJP A;  4IHV A;  4C3H J;  2R7U A;  4E7S A;  3CCM I;  5LBQ A;  2D2W A;  3HEF A;  4UB8 C;  3J7Z I;  4AID A;  4M3D A;  1IRG A;  3IUO A;  2ZJ2 A;  1JJ6 C;  4UUS B;  2O9L A;  4KA4 A;  1A6I A;  3CTA A;  1TW2 A;  2FBI A;  2LDU A;  2XC7 A;  2CV2 A;  3K10 A;  2VKE A;  3C2H A;  2KT0 A;  3OYE A;  5J8F A;  1Z3X A;  4FX4 A;  2UXN A;  3IH4 A;  4MTD A;  2KZV A;  2VLA A;  4A3F J;  2R92 J;  1FP2 A;  3L00 A;  2LR8 A;  3QYE A;  2DJI A;  4A0Y A;  3VYS B;  2ZFU A;  6PAX A;  3GVA A;  5BMZ A;  1QRY A;  1U9O A;  2Y75 A;  2ACJ A;  2A61 A;  1ZRF A;  3HRU A;  3ZRG A;  1JKP C;  4D9J A;  1X2M A;  2HI3 A;  5GPA A;  4EM1 A;  5EG0 A;  1QHH D;  5D5V B;  2Z2S B;  3BZ6 A;  4DYC A;  4QLC U;  2EZI A;  1VQ8 I;  1XB4 A;  1T39 A;  1WSU A;  2WA0 A;  1MMS A;  3FM5 A;  3A0B C;  3A4C A;  2K9M A;  2Y0M A;  1DGR M;  3K2A A;  2XVC A;  1NG7 A;  3OY9 A;  3MD2 A;  3VEP A;  4IHW A;  4RLF A;  1V5G A;  1SFX A;  1FMW A;  3F8C A;  5KVR A;  3TKY A;  3TO9 A;  1JE8 A;  3ZMT A;  3DV8 A;  5D6F A;  5F1R A;  3PNT A;  2IT0 A;  4HZF A;  1V3F A;  2EIM H;  2FBH A;  3BR2 A;  4G12 A;  3MZH A;  1R4M B;  1X4P A;  2HZD A;  5CVI A;  5E1X A;  4G94 A;  4XMY A;  4Y4R A;  3CMM A;  2X85 A;  5ILU A;  1S5L C;  2A6H F;  2W7N A;  3HUG A;  2MLG A;  3ULQ B;  3MN2 A;  2IPQ X;  3OOU A;  2VUM J;  1IUF A;  3S14 J;  4BNC A;  5CVJ A;  2E34 A;  4BKX A;  1FYM A;  3QRF F;  1DGW Y;  4ENK A;  2Q8K A;  2I10 A;  3FIW A;  3L2V A;  4WCG A;  3KP2 A;  1MNM C;  1MDM A;  2FBK A;  4CIC A;  4H4K C;  3JCU C;  1EH7 A;  2XAG A;  3EET A;  1K78 A;  1RZ4 A;  3CF5 F;  5HLI A;  3GX4 X;  1QO0 D;  2UUZ A;  3GO5 A;  1MMG A;  3J7A O;  5E3O A;  1JKO C;  3ROU A;  2JA5 J;  2GZW A;  5F04 A;  3ZQL A;  1KQ8 A;  1H9T A;  1YYV A;  2A6T A;  3LAJ A;  2ZME B;  3VB2 A;  3RZD J;  4CYC A;  4KUM A;  4PJ0 C;  2KIS A;  2JPB A;  2L7M P;  1SD4 A;  4D0P A;  2CU7 A;  4BEH B;  2B0L A;  4B3A A;  3I64 A;  3WTS C;  5KAF C;  4U0W A;  3C2B A;  5IY5 H;  2E1M B;  2F5V A;  2Z5U A;  3A0H C;  3Q3S A;  3R4K A;  4IPA A;  4ETS A;  1JUP A;  1A31 A;  1PUF B;  3HOZ J;  4IRI A;  2P81 A;  4ASN A;  4P9U A;  2JA8 J;  2VC1 A;  3CUO A;  4IEJ A;  3GZ5 A;  3HRM A;  4UUT A;  3KX2 A;  4L5E A;  5CLS A;  3CP2 A;  2IW5 A;  2QEX I;  4IF4 A;  3AKZ A;  4L9V A;  4F7Z A;  4AU7 A;  4M6Y A;  1JKQ C;  3WHB A;  4BDZ A;  2K9N A;  2M2E A;  1I39 A;  1TBX A;  3DFG A;  5EEG A;  1XS9 A;  2VE8 A;  1R4N B;  5FLX Z;  2XGD A;  4ZH4 F;  3G4S I;  3I0T A;  1B4A A;  3RKX A;  5M5Y J;  2CW7 A;  2HTS A;  5TIS C;  3IH2 A;  2JUG A;  2OV7 A;  3K9T A;  4ON0 A;  3T8T A;  3BTC A;  4D5C A;  2PI0 A;  1WI9 A;  3FKI J;  3QP6 A;  2LKX A;  1QVT A;  4L0Y B;  2QSG X;  2A5Y B;  2M30 A;  2CYY A;  5IT9 K;  1WCM J;  3K6G A;  3J81 K;  1I3Q J;  3RTR A;  4IQJ A;  2MC3 A;  4P1W A;  4LLL A;  3F3X A;  2C6Y A;  2B63 J;  1R00 A;  5F1J A;  4XLP F;  1WJ5 A;  4LK1 F;  2XPU A;  3S93 A;  2CJJ A;  2CFX A;  2FJ1 A;  2EFN A;  1VQ9 I;  5CKT A;  3M3Y J;  1D1B A;  4WXH A;  3FDY A;  2XAQ A;  4CCO A;  1JT0 A;  1HOM A;  3GLX A;  1F1Z A;  5HLG A;  5KK1 A;  3R61 A;  1PDN C;  4N4N B;  4ZYH A;  3H9Q A;  1JJ8 C;  3BDD A;  2HDD A;  1LJ9 A;  2EIJ H;  5DCM B;  4XKV A;  2XAH A;  2X48 A;  3SDG A;  1F36 A;  4WXC A;  3UKG A;  3OS1 A;  5FGM A;  2HYF A;  2VT3 A;  3DQV C;  2D45 A;  3F8M A;  3I56 I;  4UUV A;  2GAU A;  3N05 A;  3GTK J;  1R6R A;  1HKQ A;  1O7L A;  3G3Z A;  3DTK A;  3E7L A;  4MHG A;  3KZY A;  2ZXI A;  1WZ2 A;  4KN7 X;  3TMO A;  2K3F A;  2WAQ N;  4M9Z A;  3HYI A;  2M1B A;  3M8F A;  3F8B A;  3H5A A;  2WY8 Q;  3OR1 C;  3ECO A;  2HU9 A;  1UHM A;  2E1N A;  2F5D A;  4UVA A;  2HPM A;  3F9K A;  3FM3 A;  3H0G J;  4RAY A;  3W2A A;  1HLV A;  1R9T J;  4HBL A;  5GAG J;  1BR1 A;  1TWH J;  1U5T B;  5A2Q K;  4HX7 A;  1XMK A;  3RPU A;  2Y0S A;  3HKZ A;  2XB0 X;  3OIQ A;  1FIP A;  4EJV A;  2IXS A;  1X1A A;  1J09 A;  3AG1 H;  1YI2 I;  1UST A;  3ZR8 X;  2VJ5 A;  1G3S A;  1OYI A;  5D8L B;  3LSR A;  4JX4 A;  2UZK A;  4E70 A;  1GVD A;  2STT A;  4R79 A;  3FIS A;  4MIM A;  1D8J A;  1EH6 A;  4B47 A;  3NAR A;  4W1U A;  3V7R A;  4KIT B;  4II2 A;  2R7S A;  3GTG J;  1E0E A;  5L3F A;  4I0B A;  3FXR A;  1HCR A;  4AC0 A;  4BJ6 C;  4J00 A;  2DOE A;  3HOT A;  1P6R A;  2LOO A;  2QWW A;  4BE2 A;  2A05 A;  2ZXW H;  2ZNZ A;  4LFU A;  1T38 A;  3QPT A;  2XSD C;  1ZAO A;  4Z6Y A;  4YEL A;  1VQP I;  5HDN A;  5AIP A;  5A2Q Z;  1OYY A;  3LA3 A;  2DPD A;  4N9H A;  1AOY A;  2CUE A;  3LQR A;  3P7N A;  1D0Y A;  1HW2 A;  2PJR A;  3I59 B;  3JRA A;  3CCE I;  1NH3 A;  4ESF A;  1ZRE A;  2O3F A;  3L2W A;  3QOP A;  2LF8 A;  4IOC F;  1FMV A;  3IHU A;  2OC6 A;  1TT5 B;  4L5I A;  3S16 J;  1UFM A;  4FQG A;  5EGO B;  2DCE A;  3GFL A;  3ZMS A;  2DXI A;  2CQK A;  2DA3 A;  2L9N A;  2M8E A;  4I01 A;  1TW3 A;  5LHH A;  2FNP A;  2XF5 A;  1XCV A;  1BOA A;  1K79 A;  2VE9 A;  4DNC A;  1BJZ A;  1W0U A;  4EJW A;  2P5L C;  3KFW X;  1R58 A;  1ONV A;  2GIZ A;  2ELJ A;  1JHH A;  3GXO A;  5FRN A;  5K7Z A;  2KLO A;  3MAJ A;  4KT6 A;  5HOD A;  3CD6 I;  4E7I A;  2KIQ A;  3ZQG A;  2YX4 A;  3I59 A;  1T8I A;  3CCL I;  2Y2Z A;  2DT5 A;  5J3L A;  5L3C A;  1DP3 A;  4IQ4 A;  4HRI A;  1X1D A;  3DBH B;  2LK2 A;  3JRI A;  2LMD A;  5B3S H;  4BDY A;  2VQC A;  4HEA 2;  2R5Z B;  3GME A;  5IOZ A;  2CFO A;  4ZYD A;  3A2K A;  2VN2 A;  4A69 C;  5TRD A;  3DU6 A;  3RKY A;  4KIC A;  2DYR H;  1EKE A;  3O6B B;  2XHK A;  3V42 A;  2MD5 A;  3QYB A;  1Z6R A;  2M3A A;  1RC9 A;  1F43 A;  1X2N A;  4ZZL A;  1KQ9 A;  3AG3 H;  2CQX A;  4ZDP A;  3M1E A;  3L9F A;  2AQF A;  4GCV A;  3PNV A;  2IGO A;  4IKF A;  2E35 A;  1LQ1 A;  2EBI A;  4AIJ A;  5D5U B;  1TP4 A;  5J4Y A;  3LL7 A;  1B8I B;  2FA5 A;  2FSW A;  2VOP A;  1E17 A;  2VBX A;  2K02 A;  2CQQ A;  2EFP A;  2V1U A;  3E5Q A;  2BVL A;  4HYE A;  4X6A J;  2PMZ N;  3X2Q H;  2ISZ A;  2LYC A;  2BEO A;  3P5J A;  3S1Q J;  2H1K A;  2R7V A;  3Q9S A;  2R7O A;  3CO7 C;  1MBJ A;  1UEL B;  5GAH J;  2IA0 A;  5LGT A;  1BI2 A;  3E97 A;  5GP9 A;  1H8A C;  1XGN A;  4HQM A;  1MJB A;  1TWC J;  3O8G A;  5FO5 A;  1HBX G;  3LSJ A;  3W6V A;  2Q2E A;  4OMY A;  1X3U A;  3FK6 A;  3M4O J;  3ISP A;  1LVK A;  1POG A;  1VND A;  2VPR A;  2BY1 A;  3WTX C;  1DPR A;  1NK3 P;  4IOA F;  4DGW B;  2L7K A;  2CO5 A;  5FFX A;  3CMY A;  2GWR A;  3DF8 A;  4LB5 A;  4XRS G;  4BEH A;  4A3K J;  3IAM 2;  2ZME C;  2Z3Y A;  3LAP A;  1Z6T A;  4A6D A;  4BQQ A;  2R7R A;  3BG7 A;  1P2F A;  1SFU A;  1S72 I;  4HNU A;  1ZG5 A;  4U7D A;  2OJE D;  3G1L A;  1MBF A;  2DA2 A;  2WB1 N;  3HBL A;  3KIO A;  2MC4 A;  2LY2 A;  3FXO A;  3DWL E;  3BC8 A;  1ZN2 A;  2LF7 A;  2A68 F;  1K6Y A;  5GTH C;  2KRC A;  3ZQC A;  5DUK A;  4EM0 B;  1U6G A;  2M34 A;  4MQ9 F;  3ONQ A;  1AA7 A;  2R7F A;  3WE2 A;  1CGP A;  5K7F A;  1ENH A;  1IV8 A;  2W24 A;  1G3T A;  2IA2 A;  3CCR I;  3FXQ A;  1IRZ A;  3CC7 I;  4OIR F;  1WJE A;  1BL0 A;  1TNS A;  4W97 A;  2MBF A;  3TW6 A;  3H5N A;  2LP0 A;  3MQ0 A;  1A35 A;  1MD0 A;  2DMP A;  3KEY A;  3R6S A;  2VJJ A;  4XBF A;  1S6L A;  1NHA A;  3EUK L;  3HGG A;  5JLX A;  3HM5 A;  2W1O A;  2KFD A;  4BHB A;  1OCO H;  4NQW B;  3VSL A;  4L18 B;  3CP8 A;  5IP6 A;  2GOX B;  1ZR2 A;  4PGH A;  1H89 C;  4A2U A;  3S3M A;  2QZ8 A;  2ID6 A;  3LSH A;  1GUU A;  1J2X A;  2H27 A;  2JK3 A;  4P9F A;  3DP7 A;  3EPZ A;  3RYP A;  3JSO A;  4UVC A;  3VOE A;  4RGU A;  2K9L A;  4RAG A;  1F4K A;  1EJ9 A;  2HVS A;  2DA6 A;  3VWB A;  5E1W A;  3CME I;  3BR3 A;  1FC3 A;  3H5R A;  2M8G X;  4ANJ A;  2P0W A;  3OYF A;  4NNJ A;  2KHM A;  2OAZ A;  2X6W A;  1VI0 A;  2P5V A;  3CC2 I;  1XPX A;  3ZPL A;  4PSW A;  3WGH A;  4XIC A;  1Q1H A;  2HQA A;  2E1O A;  1YX3 A;  4KYW A;  4EJU A;  1MJ9 A;  5ERI A;  4G6Q A;  1VQ7 I;  4QSH A;  2F2E A;  4HAM A;  4N9I A;  4KNY A;  4FIS A;  3CMA I;  2V6C A;  4Q47 A;  2LKP A;  1E3O C;  4PJN A;  3SHF A;  3IKT A;  2DPU A;  1B6A A;  2PG4 A;  2L7F P;  2LVS A;  2F4M B;  4M9X A;  4XID A;  2E19 A;  3BG9 A;  4XLA A;  5J1U A;  4DZP A;  1VQ6 I;  1P4A A;  3Q0W A;  5FLM J;  1YIJ I;  2R7Q A;  1J59 A;  2RQP A;  4EJO A;  2DTZ A;  3EUA A;  4XSX F;  4MNU A;  3TBI A;  3HHG A;  3QPL A;  4YIR X;  3Q0V A;  4MGR A;  4M3E A;  4LG0 B;  5AON A;  3DLA A;  1S7E A;  2XB5 A;  1YW7 A;  3ZGK A;  1W36 D;  2NVY J;  2E7X A;  2NNY A;  5K1Y A;  3HJE A;  2DQR A;  2VJI A;  3M07 A;  4IRG A;  2LRE A;  2E7W A;  1HQC A;  1SFO J;  1T33 A;  2BY2 A;  4O6J A;  4HX4 A;  3DPT A;  1TLH B;  4LG0 A;  2ZME A;  4ZYG A;  2R7Z J;  1FTZ A;  4CUG A;  4ENM A;  4PUS A;  1N77 A;  2FF4 A;  1IXS B;  2VB6 A;  4OIO F;  3KZZ A;  2L4A A;  4UV9 A;  2JRT A;  1W5C C;  1ZQ3 P;  4BE1 A;  3S15 J;  4F92 B;  2L5Q A;  3WU0 A;  2NRA C;  1NG6 A;  1T98 A;  3PUF A;  3Q9V A;  1R5G A;  1YQA A;  3BR0 A;  1IW7 F;  3GBG A;  1IN7 A;  3R60 A;  4Y17 A;  3V8L A;  1U8B A;  1MDM B;  2L0K A;  3E0J B;  4CH7 A;  5B1A H;  1XMX A;  4S0H B;  2E2I J;  2V4J C;  3U9G A;  1IZ1 A;  5DCF A;  2NS0 A;  3TP0 A;  3DKX A;  4QWQ A;  3WTW C;  2F5E A;  4GRI A;  1B8I A;  1QVU A;  5L3B A;  2FD5 A;  1HF0 A;  1LKX A;  3DBL B;  4BQN A;  3OYN A;  1YLF A;  2BBY A;  2IJL A;  5M3M J;  1AKH A;  1MMD A;  1MBE A;  2DBB A;  2FE3 A;  4RMN A;  4KIS A;  3FX3 A;  3U21 A;  3J80 K;  1HST A;  2R5Z A;  5M3F J;  3L2Q A;  5H2F C;  4Y33 A;  1R49 A;  2AXT C;  4NC7 A;  2XRL A;  3F23 A;  3GFJ A;  3JR9 A;  3K4K A;  1D8K A;  4A3B J;  1M1E B;  2L2O A;  1RRJ A;  2TCT A;  4Y7N J;  3J7A Y;  3GCM A;  3M7G A;  5HDG A;  1DU0 A;  3KP3 A;  3JRB A;  2X1E A;  5E20 A;  3GTO J;  3ELK A;  2R7W A;  2VOD A;  1XD7 A;  3H3V K;  1IAW A;  2HFH A;  3K2Z A;  2QKM B;  5CVR A;  2MYS A;  1ULY A;  2VQL A;  3BG5 A;  4BJT A;  3RI4 A;  4M6X A;  1VFC A;  2DFI A;  3K4C A;  4N0B A;  2ME0 A;  2XSJ C;  5F08 A;  1YW8 A;  5KHD A;  5L3G A;  4L9N A;  5CYV A;  2MAB A;  3HL2 A;  1BI0 A;  1DDN A;  3PM1 A;  1I6X A;  3B6A A;  1HDD C;  3UNG C;  2VL8 A;  3F8N A;  3H3U A;  4RAZ A;  1ZYR F;  1D3Y A;  3PSI A;  4V2G A;  3J80 Z;  2O8X A;  4QPO A;  1FBS A;  3QQA A;  4RM3 A;  1I1G A;  3MVP A;  4P96 A;  2LY9 A;  2CW8 A;  4BY1 J;  5LLQ A;  4AIK A;  4TV7 A;  5F27 A;  3SEZ A;  4HNT A;  2Z99 A;  5DS9 A;  1BC7 C;  1IF1 A;  3HOW J;  2GQQ A;  3CDH A;  3TOB A;  3BTI A;  2XPV A;  3L1P A;  1I27 A;  1SAU A;  1UB9 A;  3PL8 A;  3JRD A;  1YHQ I;  2BV6 A;  4MTE A;  1ZTR A;  2IGM A;  2AXL A;  3PIP F;  4A3M J;  4UNO A;  3GTQ J;  3U1K A;  2RGV A;  1BN5 A;  2HS5 A;  1J9I A;  5IT3 A;  1UCR A;  2Q2E B;  3IWF A;  1K83 J;  2NVU B;  1SMY F;  2ELK A;  1W0T A;  1HXD A;  2R7X A;  2MLK A;  2VKH A;  2E2J J;  2IS4 A;  2EB7 A;  2KMU A;  4A3J J;  1QZY A;  2HYG D;  4DQ2 A;  2QUF A;  3I53 A;  4XLN F;  3L2C A;  3WG7 H;  5DEQ A;  1HKS A;  5HLH A;  4JOM A;  4EGZ A;  1OQY A;  4FE4 A;  1SVL A;  2F4O B;  3OYL A;  3OMY A;  3TO6 A;  1TTY A;  1XGM A;  1QBJ A;  1ETV A;  1ON1 A;  1P9Q C;  2L9R A;  1HW1 A;  3HKZ N;  1IN8 A;  1FNN A;  1AHD P;  1Z7U A;  3MZ8 A;  5JHU A;  4E7Z A;  1FSH A;  3GW2 A;  5DYM A;  2IS6 A;  1Y0U A;  3RKQ A;  2FOW A;  3BCB A;  2ZJR F;  4DYR A;  1GV5 A;  3WTU C;  1H0M A;  1Z05 A;  1W7P A;  1MJA A;  3FMQ A;  2EFW A;  4M74 A;  1UG2 A;  4JP0 A;  5F64 A;  2E71 A;  3W3C A;  5EDN A;  4JQF A;  2CS3 A;  4E4H A;  4HPQ A;  4G8X A;  5EZH A;  4O3M A;  1D5V A;  1RES A;  5TGT A;  2DMU A;  2DA5 A;  1RUN A;  1DUX C;  1ZK8 A;  3FK7 A;  3GFI A;  3VPR A;  1P7I A;  2OCC H;  2V1D A;  2R3S A;  5HLT A;  5BOX A;  2ZBK A;  5D6E A;  1LUJ B;  4DBR A;  2ME6 A;  4L9J A;  5DCM A;  5FLV A;  1XDU A;  3VYR B;  5C3E J;  2R0Q C;  4F91 B;  2IBD A;  2IS2 A;  3LSK A;  5CQG A;  2K27 A;  1W5S A;  4LIV A;  1ZKG A;  3BTL A;  2JSP A;  1J0R A;  4C3I J;  3RCO A;  4HF2 A;  3W2W A;  5EGO A;  2OZ6 A;  4EEF G;  3HOY J;  2HXI A;  3QYF A;  2VAS A;  2L4M A;  2EIK H;  3FXU A;  2WC2 A;  1RKW A;  2ESN A;  4RAF A;  3PSF A;  1I50 J;  5LFA A;  2EIN H;  1ETY A;  3MEX A;  3SFZ A;  4E6K G;  1W7P D;  5ILS A;  4PJJ A;  2COM A;  1Z67 A;  2BW3 A;  1T56 A;  3H1C A;  1N78 A;  1GDT A;  4NBQ A;  1JT6 A;  3R0A A;  1Y39 A;  1FZP B;  2QGU A;  3OYI A;  2GXB A;  2FML A;  3GTP J;  1ON2 A;  3ASO H;  1WH5 A;  3TDZ C;  4ABZ A;  2KJB A;  1ACI A;  2ZSI B;  3JTH A;  2GOM A;  2QQ9 A;  5HVQ C;  2Z33 A;  1JUM A;  5C44 J;  2COB A;  2V1X A;  3FHZ A;  5LRR A;  1FOK A;  1YTY A;  2XF6 A;  3K7A J;  2NS8 A;  3A03 A;  2G7U A;  3M9A A;  2X6X A;  1U5T C;  2L9V A;  4BGD A;  2M4G A;  3DBR B;  3V8K A;  4BBR J;  1Y6I A;  3FMR A;  4I76 A;  3WTT C;  1VQM I;  3S1R J;  2ZCW A;  2TDX A;  1MW7 A;  1ODD A;  3F72 A;  2ZJQ F;  2DJN A;  3CLQ A;  5L3E A;  1J7K A;  1SD5 A;  1IG7 A;  1D1A A;  2E60 A;  2LFB A;  1ZLK A;  4M72 A;  4M9S A;  1WQ2 A;  1YRN B;  2EQR A;  2PMH A;  1YJN I;  2YSR A;  4HDU A;  2WAF A;  4ZTF A;  2XKO A;  1U2W A;  2Y48 A;  2L9S A;  3B6C A;  1AWC A;  2VI6 A;  2XRO A;  1D0Z A;  3H9J A;  4CYD A;  2LTP A;  4BQO A;  5HNH A;  3FWE A;  1MIJ A;  5E79 C;  1Y8R B;  4BAY A;  5IP9 J;  4XNF A;  3ZQF A;  2CMP A;  4RS8 A;  2XV4 S;  3T1B A;  2PLY A;  4DZJ A;  3BPV A;  2ADU A;  1Z0X A;  1BC8 C;  2WV0 A;  3BR1 A;  2JVG A;  2LY1 A;  3AL0 B;  1A5J A;  3P9I A;  2VC0 A;  4E7H A;  3ZXS A;  3IRR A;  2IGK A;  4BYY A;  1IO2 A;  2E36 A;  2BYV E;  3BPX A;  3HGY A;  2K4J A;  2D1H A;  2XKP A;  3DCF A;  1MMN A;  1PJR A;  1WJD A;  3VYT B;  4NB5 A;  4N4O B;  4OWR B;  1E3H A;  1K78 B;  2CQ7 A;  1IV6 A;  1FOY A;  2HQ5 A;  4I0A A;  3C3W A;  1BW6 A;  2ZO4 A;  2ETH A;  5F0C A;  2BHY A;  2UV1 A;  1JTX A;  1AU7 A;  3H92 A;  3DTE A;  4CCL A;  3SXY A;  1U78 A;  5DDG A;  3KET A;  1RR8 C;  2XAF A;  1G59 A;  1Y0N A;  2Q1Z B;  2HVR A;  5LHI A;  1USS A;  2F5F A;  4F55 A;  1ZGW A;  3VOD A;  5DV5 A;  2JZY A;  1LFU P;  4KFC A;  3V8J A;  9ANT A;  3DEW A;  5FJ8 J;  4UVB A;  4AYB A;  1XCB A;  1T0F A;  4LGW A;  2JSC A;  3L2U A;  1KA8 A;  4MEY F;  3TOA A;  1WPK A;  1LEB A;  4HG2 A;  4XR6 A;  3GUD A;  2V26 A;  2QSF X;  1FWZ A;  1GV2 A;  4A0X A;  5LHG A;  4K2E A;  3A02 A;  1Q1V A;  1STZ A;  4IVN A;  1O4X A;  2NXN B;  3S8P A;  1O3S A;  4U88 A;  2WAE A;  5BPD A;  3HDD A;  3MKZ A;  3PQJ A;  4XRM A;  2DOA A;  3NAU A;  2YU9 J;  3IRQ A;  2A5W A;  1PYV A;  2NOJ B;  1OLT A;  3PJR A;  3LST A;  3I55 I;  1X3W B;  4C9Y A;  1EA3 A;  2DT6 A;  3K1P A;  3V7S A;  2WB1 A;  1BW5 A;  1IDY A;  1FYK A;  4PSX A;  1MH4 A;  4BXF A;  4F3Q A;  2M45 A;  4CZC A;  1SEU A;  4Y3O A;  2JMW A;  2Y0S N;  1WFX A;  4BBS J;  3QPS A;  4LG3 A;  5C4X J;  2HNH A;  2XGE A;  1WGX A;  2WY7 Q;  3EDP A;  2K5C A;  2OD5 A;  4I02 A;  3J7Y J;  1OCR H;  5JVT A;  4DIQ A;  1JI8 A;  3F8F A;  1IRF A;  3EUH A;  2L3D A;  3BWG A;  1O3T A;  5HS8 A;  2IRF G;  2IA1 A;  4XRF A;  4GXO A;  1JHF A;  2W4S A;  3O2P E;  5FD6 A;  3ZMZ A;  2DDA A;  1W7P B;  4Y52 J;  1BBY A;  2JVH A;  4BUP A;  2DOF A;  4G7Z F;  1F5T A;  1RPW A;  1Z3Y A;  1VQ4 I;  1R22 A;  5CVU A;  3ZQI A;  1HC8 A;  1TT0 A;  4WX9 A;  3QP5 A;  3ERE D;  3OYA A;  1W1W E;  2JPC A;  3PUB A;  4P5O A;  2QSH X;  2M7A A;  2FRH A;  2DMQ A;  3K70 D;  4R8H A;  3G6E I;  3DLL F;  1TWF J;  2O03 A;  2LH9 A;  4XLC A;  4G9Y A;  1TL8 A;  3DPL C;  2DMT A;  3OYD A;  4C30 A;  1XDS A;  4FT8 A;  4ESJ A;  3BRO A;  2O0Y A;  2R5Y B;  4RGS A;  2DA4 A;  4G6D A;  5LGU A;  1O3R A;  1R36 A;  3CCV I;  5HS7 A;  3KYC B;  3CLO A;  1X1C A;  1QHG A;  1MGT A;  1P4W A;  4RB0 A;  3CCJ I;  1U9N A;  1YS6 A;  5E8G A;  4A3E J;  3KZI C;  4E7K A;  3RPU D;  3QU6 A;  2VT2 A;  4L0Z B;  1EH8 A;  2EIL H;  3H0D A;  4HQE A;  5DM6 F;  2AHQ A;  5JFR A;  1WJF A;  2PBI A;  4NHJ A;  2KIF A;  2K9Q A;  2N8G A;  1SFE A;  3D0S A;  3ZMU A;  5B5E C;  1PP7 U;  1OCP A;  2E5N A;  1RNL A;  3JRG A;  5DD4 A;  3SZG A;  2K4B A;  2EPF A;  3T8R A;  4O5V A;  1QU3 A;  3ECH A;  3IV5 A;  4M3G A;  2K86 A;  1T0F C;  3JAM Z;  2DAO A;  1IC8 A;  2BW3 B;  1MMA A;  3QAH A;  2H94 A;  2CGP A;  5EEH A;  2OTJ I;  5FLX K;  3QOE A;  1TWA J;  2FU4 A;  4RB3 C;  2QEN A;  2QM3 A;  1O3Q A;  4LB6 B;  3CUQ C;  3BJA A;  5CVV A;  1Y1V J;  1B9M A;  2P4W A;  1FSE A;  1S7O A;  5EG0 B;  2BVM A;  4Q4Z F;  3BG3 A;  3MKY B;  4LMY A;  1FY7 A;  1R71 A;  2OBP A;  3LFK A;  2OA4 A;  3BZC A;  3IAS 2;  4RA2 A;  2IS1 A;  4U0V A;  1SD7 A;  4OIQ F;  2CUZ A;  4MFD A;  3J81 Z;  1QGP A;  2PMZ A;  3F22 A;  3QPH A;  2PQ8 A;  5FRM A;  2RN7 A;  1PUE E;  3OYK A;  1I1S A;  2ICW G;  4IHY A;  2DK5 A;  1XSX A;  3QU3 A;  4ENN A;  1QPI A;  1BIA A;  1VQO I;  2R93 J;  2HXO A;  1UJ8 A;  4BH9 A;  2JA2 A;  4EQQ A;  5IT9 Z;  2O5R A;  4U0Y A;  4MQV A;  2BXZ A;  2LC2 A;  5K5O A;  1OPC A;  1KGS A;  1ETQ A;  1Z77 A;  4JYK A;  3K4B A;  1B59 A;  4A12 A;  3HOU J;  4A93 J;  3A1Y A;  3REO A;  3CUQ A;  5EZG A;  2DT7 B;  2Z16 A;  4I6Z A;  2HWV A;  3WGG A;  4IHX A;  3O8H A;  5IPA A;  3BQZ A;  2QLZ A;  5CPR B;  3CF2 A;  4LIU A;  2QYO A;  2ZSH B;  1ZRD A;  2XAS A;  2V7F A;  1VQK I;  1S3J A;  1SFK A;  4Q48 A;  3S3N A;  3TO7 A;  3RZO J;  2DW4 A;  4EGY A;  1YIO A;  4FCY A;  1MBH A;  1LB2 A;  2QBY A;  2VPL A;  4BJ5 C;  1U5T A;  2XGX A;  3EQL F;  3S3O A;  4HA8 A;  4A5M A;  5DD8 A;  5IYD J;  2X51 A;  4KT5 C;  1TWG J;  1OR7 A;  2MGQ A;  2OF7 A;  2NYX A;  2GBY A;  1LFB A;  3KEO A;  3ABU A;  3OYM A;  2OCE A;  3N97 A;  3CCY A;  1G6N A;  3GWZ A;  1TQP A;  2H09 A;  2HQR A;  1WJB A;  3MZY A;  4I09 A;  3RDI A;  5D8K B;  5LD2 C;  2VQH A;  4CDG A;  3U1D A;  1K4S A;  5IP7 J;  2V9K A;  1MZB A;  2O7O A;  3IH3 A;  1X58 A;  3H9G A;  2BE5 F;  5CQE A;  4HSR A;  2P8T A;  2KRH A;  1A36 A;  4FAS D;  3OYB A;  2WBM A;  3OS2 A;  2FUG 2;  1OR7 C;  3SQN A;  5LEJ A;  4RB1 A;  1SAX A;  1S8N A;  2E1C A;  2NS7 A;  1FJL A;  5JR3 A;  3H36 A;  3OL4 A;  1B72 A;  1I5Z A;  3HOX J;  4M71 A;  3HOS A;  1LVA A;  1WJA A;  3BT9 A;  1LE8 A;  3FXK A;  2TRT A;  3S17 J;  2CQN A;  2R7D A;  4L5J A;  2O6G E;  1UAA A;  3KEQ A;  3AFH A;  5IYB J;  5F6F A;  3MKW B;  2FQ3 A;  4I99 C;  3FBN B;  3I58 A;  5HNF A;  2JRM A;  3TW7 A;  2JN6 A;  3IWZ A;  2OU2 A;  3HRS A;  1YX5 A;  3BZK A;  5EJC A;  3F21 A;  1YOV B;  2ZFW A;  1X4O A;  3JSP A;  5ICG A;  4XKB A;  4I2O A;  3S2D J;  3OIP A;  2DA7 A;  1MBG A;  2RV8 A;  4KIG A;  4XQF A;  4D7N A;  2YS9 A;  4CSW A;  3O3K A;  2HOT A;  2MH2 A;  1JGG A;  2EZK A;  3HTU A;  1XN7 A;  3BOQ A;  4BU2 A;  2RAE A;  4KIF A;  5FKL A;  2M9H A;  1OFC X;  1K7A A;  1AKH B;  4B09 A;  1OYW A;  2ISY A;  3JRH A;  1J5Y A;  2HVQ A;  2NVQ J;  2BXY A;  1YJ9 I;  1Z1D A;  2W00 A;  3LA7 A;  3E6C C;  4BAC A;  4YRV A;  3GTM J;  2YUS A;  2HDC A;  2OTL I;  2GA2 A;  1UZC A;  2X6O A;  4RGX A;  1QZE A;  3EYY A;  2DK8 A;  3ZMV A;  4G7O F;  4HW0 A;  1I6H J;  1MND A;  3SEQ A;  1FIA A;  4C2T A;  1XTA A;  2BY3 A;  3KP4 A;  2H1L A;  1BI1 A;  2KZG A;  2EV0 A;  4HST A;  1LDD A;  4XLE A;  1FTT A;  2G7H A;  4XOP A;  4RDU A;  3CDL A;  1LE8 B;  2BY0 A;  2BZT A;  1B72 B;  1FT9 A;  1P7J A;  2UWM A;  3BP8 A;  2VKD A;  2ZXH A;  1YFH A;  4OU0 A;  4B48 A;  1V5F A;  1Z7L A;  1ZR4 A;  4U87 A;  5H6Q A;  1YE9 A;  1CF7 A;  1DQU A;  5H6R A;  3CO6 C;  2K3P A;  2W25 A;  4M3F A;  2M87 A;  4PFP A;  2P6S A;  1FOX A;  3SZT A;  3T0Y A;  1R1V A;  3ESW B;  5D4R A;  1S9H A;  1ZGJ A;  1QPM A;  1LNW A;  2OUM A;  2E5Z A;  3KYD B;  1UMQ A;  2VBW A;  4H0E A;  2ZKZ A;  4BHP A;  5BQT A;  2PMU A;  3HG9 A;  3GZ6 A;  4V2F A;  1D1C A;  5FFZ A;  4AVZ A;  1YG2 A;  4ESB A;  1H9G A;  2LSO A;  5J1R A;  4S05 A;  1B9N A;  3HRT A;  3IC7 A;  3KP7 A;  4XOR A;  2RC4 A;  4I98 B;  2KPM A;  4JBA A;  5LGN A;  3OWT A;  1T2K A;  3DU5 A;  4GYG A;  3CC4 I;  5J6X A;  1RI7 A;  3LSI A;  3LSG A;  1KU3 A;  2ECB A;  2X1C A;  2ZB9 A;  1KU9 A;  4XSZ F;  4G6T B;  3G1M A;  5H20 A;  3HB9 A;  1FEX A;  3GF2 A;  2HQN A;  2VIX A;  3OYG A;  1X1B A;  4PCQ A;  1Z21 A;  2VQG A;  4PDK A;  1GVJ A;  2JA7 J;  3B02 A;  1X19 A;  2XDV A;  3NQO A;  1VTN C;  5D4S A;  4QIW N;  2QKL B;  2VXD A;  2P7V B;  5IOY A;  1ZLJ A;  2QQB A;  5KCM A;  1L3L A;  3RYR A;  1FBQ A;  4B8X A;  3CDI A;  4LK0 F;  1RET A;  1IDZ A;  2R7T A;  2X0L A;  2G0E A;  5GPC A;  3D5R C;  2QQ8 A;  4BL0 B;  2DTR A;  2I8D A;  5BNG A;  3HTS B;  5J40 A;  4MFE A;  4YEJ A;  2XIG A;  3G1O A;  1U8R A;  4HF1 A;  2WTE A;  3OSF A;  3TED A;  3VSK A;  2HGC A;  2JQ7 A;  3ASN H;  1G3W A;  3DKY A;  2FMY A;  4IO9 F;  2BHZ A;  4EVI A;  3JRF A;  1XC5 A;  2X9D A;  3V4G A;  4CHU A;  1RR7 A;  1BOB A;  3HSR A;  3I3L A;  1FBU A;  2G9W A;  3DTI A;  3P9K A;  1GHC A;  5LEK A;  1MKM A;  4XKW A;  5L3D A;  4A3L J;  3FF5 A;  4MEX F;  3ABM H;  3RQ4 A;  1EV7 A;  4OOI A;  1KON A;  1UHW A;  1S7A A;  2RNJ A;  1GXQ A;  4CZZ A;  2YPR A;  2H6C A;  2GLO A;  3LOC A;  2CUJ A;  4HV6 A;  5D5X B;  1RKT A;  4AUX A;  1K6O A;  5ED4 A;  3LQQ A;  2VOO A;  4A3G J;  1HA8 A;  1Z91 A;  2KIU A;  2E1M C;  2A3S A;  4PK4 A;  1XG1 A;  5GAD J;  3PNY A;  1WWX A;  3D5L A;  2O8K A;  3M8J A;  2CRG A;  2YR2 A;  5IYC J;  2I5U A;  4BHC A;  1ETX A;  3LMM A;  4UXN A;  2B7E A;  4A0Z A;  4UUS A;  4RGR A;  2NOG A;  1E3P A;  2K9S A;  1S29 A;  2X4H A;  4A5N A;  5E3N A;  1YJW I;  3WHC A;  4IXA A;  2M7B A;  4HV5 A;  1VQL I;  2QQA A;  2OPT A;  4GFB A;  3VDX A;  4A3D J;  3NWS A;  4HOB A;  2BGC A;  4BXU A;  2K40 A;  3HHH A;  2HZT A;  3TL4 X;  4C3J J;  3F6O A;  1O57 A;  2QVO A;  2CSO A;  3BG6 A;  3ZQ7 A;  1BM9 A;  2JA6 J;  2EH3 A;  3E3V A;  1V4R A;  3A01 A;  2V9V A;  2BOL A;  1JXS A;  1A6Q A;  2QBY B;  1SVO A;  1BIB A;  3KP6 A;  4BQA A;  5J8C A;  4PFO A;  4EV0 A;  1U0J A;  3E1S A;  5DUI A;  4A3C J;  3F0C A;  1H88 C;  4LIT A;  1LEA A;  1Y56 A;  3ZQQ A;  4EM2 A;  3A01 B;  2LBF A;  2EZH A;  4CCM A;  4M73 A;  4E7J A;  3LA2 A;  4B3X A;  5JHF A;  3TQN A;  1QQI A;  1JTY A;  1GLN A;  2XPW A;  3WTV C;  3AG4 H;  1P92 A;  5FD5 A;  1P4X A;  5LRS A;  1GXP A;  4IL6 C;  3CUQ B;  2WAQ A;  3I4P A;  3BLY A;  3OL3 A;  2W84 A;  3VYU B;  1ZGA A;  2P7C B;  2L7Z A;  3C2G A;  3CJR B;  4GO1 A;  5HOO A;  2H8R A;  1R5I D;  4X0G A;  3ZQH A;  2V9P A;  1SC7 A;  3RKW A;  2FNA A;  3U2R A;  3BTJ A;  5DTD A;  3Q0U A;  4EMS A;  3E6M A;  2M5W A;  2L02 A;  4OAY A;  3MWM A;  4NC8 A;  4D1Q A;  2IGN A;  3HC7 A;  4OAZ A;  3N4M A;  2MSY A;  4DBQ A;  3WE3 A;  4WXD A;  1RUO A;  2WWY A;  2RVC A;  1IXC A;  2LKS A;  1MSE C;  5JI6 A;  2VBY A;  5E1Z B;  3Q5F A;  5DM7 F;  5M5X J;  2F48 A;  2HOE A;  2Y69 H;  4Q5S F;  4HNV A;  1ETW A;  1IUY A;  4B1R A;  2E2H J;  4DJA A;  4LOC A;  1YO5 C;  4B44 A;  2HOS A;  3HSF A;  2MW8 A;  4XLH A;  4OIP F;  2MG4 A;  4NDL A;  1R7J A;  4YG2 F;  3M8E A;  2F4I A;  2LRD A;  2D1V A;  4B4C A;  1WVR A;  3CJQ B;  3OIO A;  2K7L A;  1SMT A;  4DOZ A;  2JJ7 A;  2HEO A;  2ESH A;  1XMA A;  5M5W J;  3RJP A;  1IJW C;  4BE0 A;  2V1N A;  3CCU I;  2NNN A;  4LLN A;  2Q0O A;  2DOD A;  3HZJ A;  2VXZ A;  4AD9 A;  1WRJ A;  3JRC A;  5EYR A;  1IN6 A;  4I7H A;  1TQI A;  3P9C A;  3SJM A;  2DMN A;  3D1N I;  4ENJ A;  2W82 A;  2AQE A;  2HKX A;  3QWL A;  3I9V 2;  2EA4 A;  4IJA A;  4PJM A;  1HSJ A;  3ZOB A;  1VQN I;  2A07 F;  2UXX A;  5GAE J;  4RM2 A;  1QA6 A;  5HS9 A;  4BS9 A;  2L54 A;  3FZV A;  4RLQ A;  1X1P A;  4CGZ A;  3KE2 A;  3K4J A;  1K61 A;  1T95 A;  4M6V A;  4F93 B;  4YFX F;  2FOK A;  4ZC3 A;  2ELH A;  1K4T A;  3FKJ A;  2B9S A;  2LBF B;  4WK8 F;  3D5S C;  3E5U A;  4CA0 A;  1LDJ A;  1WHU A;  4QPQ A;  1Z9C A;  2GA1 A;  1R1U A;  4P55 A;  4HDV A;  1TQM A;  3R0J A;  1ERD A;  2W57 A;  1IGN A;  1QNT A;  2OZU A;  4E7L A;  1V55 H;  1WH7 A;  5FKN A;  4D5F A;  2Y9Z A;  1D5Y A;  1MSF C;  4RB2 C;  3MFK A;  1T08 B;  4LD5 A;  4GDF A;  1FPQ A;  3NEU A;  1NTC A;  5K5R A;  1PUF A;  1SD6 A;  2DA1 A;  1G8X A;  2EA2 A;  2Z9O A;  3VFZ A;  1KU7 A;  2XGC A;  2PX9 A;  4XM3 A;  1OCC H;  4ZZD A;  1OCZ H;  2KQR A;  3E6D A;  3OYJ A;  4GGG A;  4KMF A;  3T5X A;  4Z2Y A;  5D5W B;  1BJA A;  1DPU A;  3TGN A;  2XAU A;  2RKH A;  4MO7 A;  3AL0 C;  1ZAR A;  2ZC2 A;  4JK1 X;  4DYQ A;  2FEZ A;  4CYC B;  4XKC A;  3W6K B;  1YW9 A;  1D0X A;  1ORK A;  4XON A;  3V7C A;  5J47 A;  4UY8 I;  4XL9 A;  2LLK A;  3GTL J;  1XX5 A;  4X1E A;  2CWE A;  4J19 A;  3GTJ J;  3LSM A;  4IX7 A;  3FMS A;  4WWC A;  1Y1W J;  4A6E A;  5J1Y A;  2XF7 A;  3K4N A;  2W48 A;  4LLG F;  4MLO A;  1W4M A;  2AO9 A;  1V54 H;  2HDW A;  4CO8 A;  3JAM K;  1N75 A;  2EJR A;  2PFB A;  3FXJ A;  1APL C;  3LFU A;  2WV1 A;  4CCN A;  4J01 A;  4XK4 A;  1REP C;  4F52 A;  4ZDL A;  2KL4 A;  2KRF A;  3ABK H;  3K69 A;  4ITV A;  3CCQ I;  3C7J A;  4KDP A;  3I71 A;  1ETK A;  1XSD A;  4ZDO A;  5FKO A;  3S2W A;  4PJL A;  3HPH A;  2RRE A;  1XGS A;  3SFI A;  2OQR A;  4YFN F;  1MNE A;  1FYL A;  3AAF A;  3FXM A;  3PFY A;  1IRX A;  2DLL A;  3F6V A;  3FHN A;  2XUB A;  4LJZ F;  3OV8 A;  3SYT A;  5E8I A;  5EF6 A;  4JX5 A;  3K70 C;  3HOV J;  2CW0 F;  3UR3 C;  1ZHF A;  3WG9 A;  1DP7 P;  2NAZ A;  1C0W A;  2EV5 A;  3I4M J;  2DDB A;  4AWX B;  3OYC A;  3HSE A;  3ABL H;  2QF7 A;  4FE7 A;  2DYS H;  2JTV A;  1OJL A;  2DFF A;  2EFO A;  5ICE A;  1YIT I;  5EEA A;  3I54 A;  3SZP A;  3OS0 A;  3CQZ J;  4II3 A;  1TC3 C;  1BR4 A;  3MKL A;  4BY7 J;  4NQW A;  3WTZ A;  1VQ5 I;  2J5P A;  2LD5 A;  2R4G A;  1B1B A;  2J5O A;  2FQ4 A;  5FKM A;  1X3Z B;  2VBZ A;  2VJ4 A;  2NVX J;  3SDB A; 
#chains in the Genus database with same CATH homology
 3DEE A;  2HPM A;  3F9K A;  1ZEL A;  4U7B A;  1YX5 A;  2RNG A;  3W2A A;  3H35 A;  2X6Y A;  4ZYA A;  3W3C A;  1X4O A;  4JQF A;  4XKB A;  1BR1 A;  2CS3 A;  3OIP A;  4E4H A;  4HPQ A;  4XQF A;  3QOD A;  4CSW A;  5TGT A;  2Y0S A;  4CCK A;  3HKZ A;  3OIQ A;  4BU2 A;  5HLT A;  2IXS A;  1X1A A;  1J09 A;  4DBR A;  4B43 A;  3ZR8 X;  2VJ5 A;  3VYR B;  4F91 B;  4ZJZ A;  2HVQ A;  2IS2 A;  3LSK A;  3ZCO A;  2W00 A;  5CQG A;  4R79 A;  3KYL A;  4YRV A;  4BAC A;  2CV1 A;  4B47 A;  4LIV A;  2JSP A;  1WJC A;  4II2 A;  4KIT B;  2R7S A;  3RCO A;  4KJZ A;  1E0E A;  1MND A;  3W2W A;  4EAT A;  3SEQ A;  4C2T A;  4BJ6 C;  3QYF A;  1UG0 A;  2X1D A;  2LOO A;  3HOT A;  3BCA A;  4J00 A;  4BE2 A;  2VAS A;  4HST A;  4XLE A;  4XOP A;  4ZTJ A;  4XLF A;  4YEL A;  3PSF A;  5LFA A;  2V6E A;  4E6K G;  2UWM A;  4PJJ A;  2VKD A;  2ZXH A;  2BW3 A;  4B48 A;  1V5F A;  1Z7L A;  1N78 A;  4U87 A;  1YE9 A;  1LDK B;  3S32 A;  1DQU A;  1D0Y A;  1TZL A;  3OYI A;  2PJR A;  1LFP A;  2K3P A;  4PFP A;  3L2W A;  1BR2 A;  1FMV A;  2F6C A;  2OC6 A;  2ZSI B;  1S9H A;  2GOM A;  2DCE A;  2OUM A;  2DXI A;  3M1C A;  5HVQ C;  2E5Z A;  2L9N A;  3HUG B;  2XF5 A;  2XF6 A;  1W36 C;  3HG9 A;  2X6X A;  4BGD A;  2M4G A;  2ELJ A;  1D1C A;  4AVZ A;  5FRN A;  2KLO A;  4KT6 A;  1Y6I A;  4XOR A;  2LG4 A;  4E7I A;  2CH0 A;  1MW7 A;  2KPM A;  4XN3 A;  3OYH A;  3OWT A;  1D1A A;  2E60 A;  1DP3 A;  3DU5 A;  4IQ4 A;  4HRI A;  1X1D A;  3LSI A;  3LSG A;  4BDY A;  2VQC A;  4HEA 2;  2X1C A;  2CFO A;  3A2K A;  2WAF A;  4ZTF A;  3DU6 A;  4G6T B;  2L9S A;  3V42 A;  3HPG A;  1D0Z A;  3H9J A;  3QYB A;  2M3A A;  2VIX A;  4BQO A;  5HNH A;  3OYG A;  1X1B A;  4ZDP A;  1Z21 A;  2VQG A;  2AQF A;  2KDO A;  1V5E A;  1X19 A;  2M4K A;  2XDV A;  4XNF A;  3K4M A;  2CMP A;  3PNV A;  2IGO A;  4IKF A;  2QKL B;  4NUB A;  2VXD A;  5KCM A;  3LL7 A;  2R7T A;  3D5R C;  3OR2 C;  2JVG A;  2LY1 A;  4BL0 B;  2I8D A;  3AL0 B;  2BVL A;  4E7H A;  3ZXS A;  1VZ0 A;  2IGK A;  4YEJ A;  2PJR B;  3IP4 B;  2LYC A;  4CCJ A;  3L2R A;  1MMN A;  1PJR A;  1WJD A;  3VYT B;  2R7V A;  4N4O B;  4OWR B;  2R7O A;  3VSK A;  1UEL B;  3DKY A;  3CZ6 A;  3MMY B;  2UV1 A;  4C2U A;  3DTE A;  3CES A;  4CCL A;  1BOB A;  1LVK A;  3I3L A;  2RQQ A;  3DTI A;  1G59 A;  4XKW A;  2MD0 A;  3NWT A;  2Q1Z B;  4IZZ A;  4DGW B;  2HVR A;  2L7K A;  3W2V A;  3RQ4 A;  2M0M A;  4BEH A;  4F55 A;  3IAM 2;  1KON A;  4BQQ A;  2R7R A;  3BG7 A;  3FBI B;  2CUJ A;  2KP6 A;  4HNU A;  3DPU A;  4AYB A;  3L2U A;  1HA8 A;  2E1M C;  2MC4 A;  2LY2 A;  3DWL E;  4PK4 A;  3BC8 A;  4HG2 A;  3PNY A;  1K6Y A;  3D5L A;  2KRC A;  4XR6 A;  3M8J A;  2V26 A;  4FET A;  4XN0 A;  3LMM A;  3EUH C;  5KNL A;  3ONQ A;  4XOT A;  1AA7 A;  3HXL A;  2WAD A;  3S8P A;  2WAE A;  3RSN A;  1WJE A;  2M7B A;  3MKZ A;  2MFZ A;  2DOA A;  2Z1D A;  3H5N A;  3VDX A;  3NWS A;  2A5W A;  1PYV A;  2NOJ B;  3KEY A;  5FRO A;  1OLT A;  3PJR A;  2VJJ A;  4C9Y A;  3EUK L;  1EA3 A;  2DT6 A;  3G2B A;  2WB1 A;  2HPI A;  3TL4 X;  3K4L A;  2W1O A;  4PSX A;  4BXF A;  4NQW B;  3VSL A;  4F3Q A;  3BG6 A;  3CP8 A;  2R7U A;  4CZC A;  4Y3O A;  2GOX B;  4E7S A;  3IUO A;  3S3M A;  1WFX A;  2BOL A;  3LSH A;  4LG3 A;  2HNH A;  4PFO A;  2WY7 Q;  3E1S A;  1U0J A;  2K5C A;  3EPZ A;  4LIT A;  2XC7 A;  2CV2 A;  1Y56 A;  3ZQQ A;  3K10 A;  2K9L A;  4DIQ A;  3C2H A;  1JI8 A;  2LBF A;  3OYE A;  1Z3X A;  2HVS A;  3VWB A;  2VLA A;  2KZV A;  4CCM A;  4E7J A;  4B3X A;  3H5R A;  3QYE A;  2DJI A;  5JHF A;  3VYS B;  4ANJ A;  2P0W A;  2ZFU A;  3OYF A;  2W4S A;  4NNJ A;  1GLN A;  2KHM A;  2X6W A;  2WAQ A;  3BLY A;  2JVH A;  3OL3 A;  4PSW A;  4BUP A;  3VYU B;  3ZRG A;  4D9J A;  3C2G A;  1Z3Y A;  2HQA A;  3CJR B;  1QHH D;  5HOO A;  1YX3 A;  1TT0 A;  2Z2S B;  4X0G A;  2WA0 A;  3OYA A;  3A4C A;  2K9M A;  3PUB A;  1DGR M;  4P5O A;  4OAY A;  1NG7 A;  2M7A A;  4NC8 A;  4D1Q A;  3OY9 A;  3MD2 A;  2IGN A;  3HC7 A;  4OAZ A;  3K70 D;  4PJN A;  4RLF A;  4DBQ A;  1V5G A;  2LH9 A;  1FMW A;  4XLC A;  3DPL C;  3OYD A;  4C30 A;  4XLA A;  3PNT A;  2R7Q A;  3EUA A;  4DJA A;  1X1C A;  1QHG A;  2HZD A;  1X4P A;  3TBI A;  4B44 A;  4XLH A;  4XMY A;  3DLA A;  4Y4R A;  3ZGK A;  3CMM A;  1W36 D;  2X85 A;  4E7K A;  2F4I A;  2LRD A;  3RPU D;  2W7N A;  3CJQ B;  2VJI A;  2LRE A;  4DOZ A;  3H0D A;  1WJF A;  3OOU A;  3DPT A;  4BE0 A;  4CUG A;  2V1N A;  2E5N A;  4PUS A;  1N77 A;  3SZG A;  2VB6 A;  1DGW Y;  2VXZ A;  1QU3 A;  4BE1 A;  3L2V A;  1T0F C;  4F92 B;  2L5Q A;  1NG6 A;  2BW3 B;  1MMA A;  4H4K C;  3GBG A;  2W82 A;  3QOE A;  3E0J B;  2AQE A;  2UUZ A;  3I9V 2;  4CH7 A;  4PJM A;  1MMG A;  2V4J C;  4RM2 A;  2A6T A;  3DKX A;  4BS9 A;  4RLQ A;  2BVM A;  3MKY B;  4GRI A;  3K4J A;  4BEH B;  3IAS 2;  1T95 A;  2IS1 A;  1LKX A;  4F93 B;  2E1M B;  2F5V A;  2CUZ A;  4BQN A;  3OYN A;  4ZC3 A;  2PMZ A;  5FRM A;  3FKJ A;  2LBF B;  1MMD A;  3OYK A;  3D5S C;  4CA0 A;  4RMN A;  4KIS A;  4QPQ A;  3U21 A;  1ERD A;  3L2Q A;  3KX2 A;  4Y33 A;  4E7L A;  2JA2 A;  4NC7 A;  3CP2 A;  3K4K A;  2O5R A;  3AKZ A;  2L2O A;  3J7A Y;  4AU7 A;  2LC2 A;  1G8X A;  2X1E A;  4BDZ A;  2R7W A;  3K4B A;  4XM3 A;  3A1Y A;  3OYJ A;  2KQR A;  2QKM B;  4BJT A;  2MYS A;  2VQL A;  2XAU A;  3AL0 C;  2DT7 B;  2Z16 A;  4XKC A;  3K4C A;  5KHD A;  2XSJ C;  1D0X A;  4XON A;  4XL9 A;  2CW7 A;  5CPR B;  2MAB A;  3HL2 A;  3CF2 A;  4LIU A;  2ZSH B;  2JUG A;  2OV7 A;  2V7F A;  3UNG C;  1SFK A;  3LSM A;  2VL8 A;  4IX7 A;  3S3N A;  3PSI A;  4QPO A;  2VPL A;  2XF7 A;  3K4N A;  4BJ5 C;  4MLO A;  4RM3 A;  2HDW A;  2CW8 A;  3S3O A;  1N75 A;  2X51 A;  3K6G A;  3RTR A;  3SEZ A;  3LFU A;  4CCN A;  4HNT A;  4IQJ A;  4J01 A;  4P1W A;  4F52 A;  4ZDL A;  1WJ5 A;  3S93 A;  1SAU A;  2KL4 A;  4ITV A;  3OYM A;  3PL8 A;  5CKT A;  2IGM A;  1D1B A;  4ZDO A;  3FDY A;  2CV0 A;  4PJL A;  4CCO A;  3HPH A;  1WJB A;  2RRE A;  5LD2 C;  1MNE A;  2VQH A;  3PFY A;  1IRX A;  4N4N B;  3H9Q A;  3FHN A;  2Q2E B;  2V9K A;  3SYT A;  3K70 C;  2R7X A;  2VKH A;  3UR3 C;  2IS4 A;  2KMU A;  3H9G A;  4XKV A;  5CQE A;  4HSR A;  2KRH A;  3OYC A;  4FAS D;  3OS1 A;  3OYB A;  2WBM A;  3DQV C;  4JOM A;  3OS2 A;  2FUG 2;  1OR7 C;  3N05 A;  3OYL A;  3OMY A;  1R6R A;  3OL4 A;  3OS0 A;  1P9Q C;  3DTK A;  3HOS A;  1WJA A;  2ZXI A;  4II3 A;  3TMO A;  1BR4 A;  4E7Z A;  2IS6 A;  1UAA A;  2R4G A;  3AFH A;  3BCB A;  2WY8 Q;  3H5A A;  3MKW B;  3OR1 C;  2VJ4 A;  3FBN B;  3SDB A;  5HNF A;  2HU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...