4L0YB

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l0yB00
2Z99A 5J8FA 3I4PA 4ENKA 3DP7A 2DPUA 4NQWA 1HSTA 1ODDA 1WWXA 3U9GA 4IHSA 2EFQA 4HDVA 2BYVE 2JSCA 3M9AA 1ZHFA 1XCVA 1K78B 3Q5FA 3EUHA 3EYIA 3L2CA 4DNCA 2E7WA 2QBYB 2LDUA 1QZYA 2KKOA 2H09A 5LHGA 4QWQA 3F72A 3E3VA 2PMUA 1J75A 3FXUA 1UFMA 1PP8F 2A07F 3E5XA 1MJAA 1LDKB 3SZPA 3V8KA 4EM1A 2A3SA 4ENNA 3E6BA 3RYPA 3GYHX 2D1HA 2NRAC 2JTVA 2RQPA 3T8TA 1P4AA 4CO8A 2E1NA 5FFZA 2GIVA 3F8BA 3TOAA 5K5RA 5J8CA 4IF4A 5F64A 2Q8KA 1OMIA 1GXPA 1T6SA 2H6BA 1T98A 4A0YA 1IAWA 3WTVC 1BI1A 1IXCA 2MH9A 1OYIA 1XGOA 1UHMA 1IW7F 3I0TA 2HTJA 1JE8A 2HS5A 5CVVA 5L3CA 4ZH4F 1YQAA 3MAJA 3I59B 3LQQA 5L3EA 4RAZA 1MJBA 2VT3A 3H3ZA 3MEXA 2FRHA 4B09A 2DLLA 2DK5A 4MNUA 4HF2A 4Y15A 1KQ0A 3KP4A 3GX4X 1A04A 2P5KA 3RYRA 3F3XA 3JTGA 4RGSA 1MKMA 3K69A 2UXXA 2QQ9A 1P6RA 4MQ9F 1BI2A 1FOKA 1H0MA 3ZP5A 1Z9CA 1O3TA 1FP1D 3V7RA 2XAGA 3F8NA 2EB7A 2HQRA 4M71A 4M6XA 2M45A 3FXRA 5HDKA 1KU3A 2ZNZA 1BOAA 2XAJA 4A12A 4OMZA 2YR2A 5LEKA 5LRSA 1JGSA 4LLGF 2HQNA 2OAZA 1RI7A 5H6QA 1W5TA 3B02A 4EVIA 4KIFA 2FQ3A 4GO1A 3WE2A 3PQJA 2V1UA 4N0BA 2CQKA 2RV8A 3RDIA 4HDUA 2H94A 1QBJA 1E17A 2RVCA 4D0PA 4UV8A 1F1ZA 2FU4A 1OPCA 5D8KB 2UXNA 2EFWA 4ENJA 1IXSB 1WKMA 4WK8F 3DF8A 3L9FA 1VTNC 5BQTA 4UUVA 2IVMA 5D5XB 3FMQA 5DCMA 4IHTA 4U7BA 1R5GA 1ZH5A 3QRFF 1BBYA 4LG0B 1Z6TA 4IRGA 1L3LA 2O03A 1O3SA 2W84A 1WQ2A 2FEZA 4G94A 4MHGA 4MEXF 1FNNA 3TDZC 2JT1A 3LAPA 4OIOF 3I64A 2K27A 5LGTA 2M8EA 2O61A 1R23A 3ABTA 3ZPLA 2XRNA 3G3ZA 2XAFA 4WWCA 5DUKA 3T1BA 3RPQA 4ZYGA 1K79A 1O57A 3QU3A 5LEJA 2KJBA 2FF4A 1RNLA 1K78A 1ZREA 1U5TB 2F5EA 4MEYF 3BDDA 1IN6A 2ISZA 1LB2A 3KEQA 1FWZA 3ZMZA 1D3YA 2DPDA 2QBYA 2A69F 3K1MA 3R4KA 2YPRA 4LFUA 1MGTA 4UV9A 1P92A 1S7AA 1LNWA 1GXQA 4BHPA 4PDKA 2ZMEB 3TGNA 1IRFA 4I0AA 4KFCA 3CJNA 4G9YA 2TDXA 2JPCA 4G6DA 1S29A 4NB5A 1KYZA 3R0AA 3FM3A 4U0YA 1BN5A 2EK5A 3WU0A 3V8LA 5CVJA 2FNAA 3ERED 4XSXF 1B9MA 1BIAA 3DPTA 1G3SA 2K4JA 1W7PD 4S05A 3KP6A 2ESNA 1TNSA 3WTYC 3T8RA 3BWGA 3ABUA 2CSOA 4UVBA 3HOSA 1G3WA 4N9IA 4ZYDA 1FBQA 2EV5A 1R1VA 3RJPA 2DTRA 1H9TA 2HOEA 3DXJF 2NNYA 1DPRA 3F8FA 3TKYA 2G7UA 1HW5A 4HX8A 3I53A 3FZVA 1G3YA 3I59A 4PGHA 1J9IA 4I09A 4NHJA 1ZGAA 3RKXA 2B0LA 2OZUA 1Z1DA 4HQEA 3NRVA 6PAXA 2ZKZA 1SAXA 1FPQA 3WTSC 2J5PA 4WX9A 5J6XA 1OYWA 1J59A 4OMYA 4HLYA 2LF8A 4R8HA 5BPDA 3O2PE 1PDNC 3CUOA 5H20A 3GF2A 4HBLA 1HW2A 3I71A 1E2XA 3KP5A 2LKPA 3TDUC 1LEAA 5L3GA 2FBIA 5L3FA 1X3UA 3TO7A 5IT9Z 3GXOA 1ON1A 1DPUA 2K86A 1HXDA 4K2EA 4WF2A 3WODF 2R7DA 1YFHA 2ZCWA 4I98B 3E6DA 2L4AA 4KICA 5LGNA 2VXZA 1KGSA 4L5IA 2Z3YA 4A6DA 4CDGA 3CLOA 4S04A 3GFJA 5E17F 3C3WA 3DQVC 3WTTC 3LQRA 1I1SA 1IXRC 2RKHA 3L09A 4HLXA 2PBIA 5E18F 3KP3A 3COAC 4CYDA 3WTWC 1WI9A 3GO5A 5E1XA 2O0YA 4ESBA 5ILUA 4U7DA 1KA8A 5HLHA 2R7FA 1GVJA 2HTSA 3F6OA 4CGZA 3V4GA 4LG0A 3DPLC 4L5JA 3P7NA 4JQFA 5HDGA 2MBFA 2BEOA 5IT9K 2MLGA 3ZMUA 3WGHA 4LLLA 5A2QZ 4HQMA 3P9KA 5DCMB 1FP2A 1UB9A 3EETA 3R6SA 4A5NA 3VB2A 1YLFA 3HYIA 1U5TA 4L18B 3M7GA 3RKWA 2IPQX 2KRFA 3K1NA 4IXAA 2DT5A 2VOPA 1XGNA 4M9XA 4QLCU 4GXOA 1I27A 2QM3A 2ZMEA 3CO7C 3JTHA 1Z05A 4HF0A 4Q47A 1KYWA 2L01A 3B73A 4CICA 3GW2A 3KLNA 3F22A 2ZNYA 3WTZA 1KU9A 4BH9A 3LSTA 4L0YB 4AD9A 1D8JA 1G4DA 4RGUA 2EA2A 4WXCA 2VBZA 3BOQA 4A5MA 2GXGA 1MD0A 3ZMSA 4KYWA 4IRHA 2CGPA 2EV6A 3CUQB 5FLXK 3K2ZA 2HEOA 2Y48A 4ZYEA 5JR3A 3HTSB 2LF7A 1ZGJA 1EH7A 1S8NA 2HGCA 3IC7A 2KJCA 5JI6A 1MJ9A 4HZFA 2MD5A 1IN4A 2QLZA 1BI3A 1PUEE 3HRTA 4LK0F 2XGXA 3HHHA 4G7OF 1BIBA 3E5UA 3N4MA 2AXLA 2FNPA 3KCCA 2IA2A 1YYVA 5ICGA 1HKQA 1XDUA 5ERIA 1SD7A 3ZN1A 1AWCA 4RB1A 1DP7P 2IW5A 3HRSA 1Z91A 2PI0A 3VOEA 5HS9A 1LDDA 1WSUA 1HKTA 4UXNA 4AIKA 3BJ6A 3E6CC 2M30A 1K7AA 4PGGA 4I2OA 1YW8A 4XLPF 4BNCA 2E7XA 3L00A 2GAUA 4LMYA 1R5HA 3J80Z 4PZJA 3HSEA 1J5YA 3U2RA 4YFKF 2OBPA 5H6RA 2NS0A 2W24A 4OINF 2A6HF 3HTUA 1FSEA 5HLIA 3NQOA 1R22A 2VBXA 4OU0A 2JZYA 1XSXA 3JSPA 1I6XA 4KMUX 2GZWA 1EH8A 3MZYA 1FSHA 2MLKA 4KMFA 4BAYA 1TLHB 2L3DA 1W7PB 2V1DA 1O7LA 3TO6A 3GZ6A 2QUFA 3KE2A 4IPAA 3DV8A 3IRRA 4IRIA 3JAMZ 3PQKA 3GLXA 1TQMA 4XBFA 3ZQ7A 2FA5A 5LHIA 2JRTA 2Q0OA 1ZRCA 5KK1A 2F2EA 5ED4A 5D4RA 2ISYA 2XIGA 1YO5C 1XD7A 1SFXA 2STWA 2HKXA 1B9NA 4A0ZA 2H6CA 1YG2A 3WE3A 3NEUA 4BHCA 2W85A 3F8MA 3J80K 4RAYA 2Z9OA 4KDPA 4U0WA 4YFXF 3FMRA 5DCFA 4EGYA 3M8EA 4ESJA 2P7VB 2CG4A 2IJLA 2LSOA 2COMA 1O7FA 1YS6A 1IF1A 2DBBA 4CXFA 3BROA 5D8LB 4BQAA 2VT2A 3QP6A 4KIBA 5DYMA 1XB4A 3T5XA 1HQCA 3QPHA 2HWVA 4YIFA 3IHUA 1H9GA 2PJPA 5D5UB 3JSOA 3JAMK 4WXHA 2XROA 2LNBA 5AONA 3MQ0A 3J81Z 3QP5A 1YW7A 2EFNA 3LWFA 3IKVA 3VODA 3J7AO 1ZLKA 3CUQA 4Z2YA 5FD6A 3I58A 1FY7A 1MZBA 2FSWA 2IT0A 2IA0A 2ETHA 4L9NA 5D4SA 5BMZA 4IJAA 2GWRA 2V79A 2NAZA 1LDJA 3GUDA 2MH2A 4DQ2A 3MZHA 4GGGA 2HYGD 1K6OA 1FZPB 2EV0A 2YX7A 3HUGA 3I54A 1F4KA 1FYLA 2DW4A 2M5WA 2ZBKA 2VN2A 4R79A 3H92A 2BGCA 3ULQB 3SXYA 2WWYA 3IRQA 5AIQA 1BI0A 4HV5A 2L02A 4LLNA 2AS5F 4LK1F 1P4WA 2P6SA 2PEXA 1U8RA 5JVTA 1NHAA 3BJOA 3C7JA 4EMSA 3KP2A 2H27A 4HOBA 3J81K 1F9NA 4HYEA 4GYIA 2Q2EA 3SQNA 3WG9A 2P5LC 4FX0A 1LVAA 2OD5A 4HA8A 4MQVA 4Y13A 1IRGA 5DV5A 5CYVA 4H0EA 2K02A 1SD6A 2PMHA 1W5SA 1SMYF 4I0BA 3TQNA 5IT3A 2BBYA 5LGUA 2Y75A 2V6CA 4PCQA 5FO5A 3KFWX 3VEPA 1BJAA 3WU1B 1U6GA 3DEUA 2J5OA 2FE3A 4YFNF 2VOOA 5HS7A 4N9HA 2GXBA 4EJWA 3LA2A 3FHZA 4A6EA 3ZMTA 2W57A 1QQIA 1W7PA 2Y0MA 1R36A 2QZ8A 4AIJA 2STTA 2KIUA 1PP7U 3O3KA 4I02A 4P9UA 2HKOA 2HFHA 2WTEA 3F6VA 1KU7A 2W25A 3OV8A 3TO9A 5D6FA 3BPXA 2F5FA 2HDCA 1T2KA 4ESFA 4OIPF 2FXAA 3DKWA 3HOTA 2GA2A 1U2WA 2HYFA 4KT5C 4UHTA 4G6QA 3EYYA 4UVCA 3HRUA 2YX4A 4YIIA 5DDGA 4L9VA 1ZG1A 3K9TA 2PQ8A 1RIOH 1QPMA 2DU9A 1J2XA 3SZTA 1XMAA 3WGGA 5FB2A 3KLOA 2K4BA 1R7JA 3ZN0A 4Q4ZF 2DQRA 3HHGA 3EDPA 2PN6A 2QYOA 2X4HA 3RIRA 1HKSA 1ULYA 1QZZA 5HDNA 2P8TA 3DFGA 3QPTA 4O5VA 4RGRA 1YIOA 1EH6A 5FGMA 1XCBA 2E1CA 2FMYA 3D0SA 2V9VA 4F7ZA 2PLYA 2YU3A 2C6YA 4P9FA 1S3JA 4P96A 2L4MA 3GEZA 3SFZA 1SD5A 1CGPA 4HF1A 5E20A 2QWWA 3OOPA 4KN4X 3HIFA 3W6JB 4AVPA 1Z7UA 2EJRA 1F5TA 4FHTA 4GYGA 2G7HA 4LD5A 1U5TC 1U3EM 1FYKA 5CVIA 1S6LA 5K1YA 1DDNA 1TQIA 4OIQF 1BC8C 3ECOA 1FYMA 4L9JA 4AWXB 3MWMA 2ZXJA 4EJVA 3ZMVA 1Z6RA 1ZAOA 5L3DA 4RB2C 2P6TA 3AAFA 2IP2A 1ONVA 5ILSA 1DUXC 1XN7A 2ZFWA 2HR3A 1FLIA 1D8KA 2G9WA 3HSRA 2QQAA 2MC3A 5A2QK 4IVNA 3E97A 4ENMA 4U0VA 2QQBA 3R61A 1BM9A 2UZKA 1MDMB 3BJAA 5CVRA 2VBWA 2VONA 1BC7C 2YSRA 3IWFA 4BXUA 5FFXA 5CLSA 1XGMA 1P4XA 4ZZDA 2O3FA 2OU2A 4A2UA 5K5OA 5LLQA 1QGPA 1HW1A 4M74A 3Q9SA 3F21A 2CWEA 1OKRA 1ZN2A 5JFRA 1P2FA 3GFLA 4ZZLA 2XVCA 2OQGA 1QO0D 4JBAA 4EV0A 1J0RA 1IZ1A 3FWEA 3K1PA 1FBSA 5D6EA 1EV7A 1V3FA 1T39A 4XRFA 4LJZF 1TBXA 3REOA 2Z5UA 1UCRA 1KU2A 2FBHA 1OYYA 2UWMA 4RB0A 2EFOA 2RC4A 1HBXG 1IN7A 1XMKA 4HV6A 4G7ZF 4JK1X 3I5UA 5ICFA 4KNYA 3WTUC 1ZLJA 5DD4A 4BHBA 3R60A 1O3QA 3GVAA 1V4RA 3V7SA 4Q5SF 1KQ9A 1L0OC 2BV6A 4MGRA 3P9IA 2VE9A 5K5QA 2XASA 1T38A 1R00A 2XAQA 1KQ8A 1LQ1A 2QVOA 3U1DA 5BPIA 2OZ6A 1LEBA 2VC1A 1IUYA 4WCGA 1TW2A 5D5WB 2O6GE 2WV0A 1ZARA 4E70A 3FMSA 3QAHA 2DQLA 1FBUA 3WTXC 3BPVA 1TTYA 3O6BB 4RS8A 3C1DA 3LFKA 3T0YA 4I01A 3Q9VA 3VFZA 1D5VA 3GWZA 1SMTA 2A68F 2RDPA 3CO6C 4EM0B 4B8XA 4ZYHA 5ILVA 2D2WA 1JHFA 5F1RA 2NNNA 2Z33A 3H3UA 3QOPA 2RN7A 2VE8A 4WXDA 3RTRA 2O8XA 2X0LA 1B59A 2PG4A 5DUIA 4Y17A 4GCVA 3IKTA 3TOBA 4O3MA 3LA7A 2HZTA 3G73A 3WGIA 4HW0A 1ON2A 1W4MA 3FM5A 4A0XA 1ZRDA 3LAJA 5LRRA 4G7HF 2IA1A 5KVRA 3BZ6A 1REPC 2VODA 2M1BA 4M9ZA 2EFPA 4EQQA 2A6EF 3SHFA 2DO7A 3F8CA 2VBYA 5L3BA 4BYYA 1FX7A 1UHWA 2CFXA 4P55A 4I7HA 5TRDA 1R1TA 1LJ9A 2ACJA 1S7OA 5E1ZB 5EEGA 4LB5A 4XLNF 5CVUA 2P5VA 2L54A 3ML6A 1MDMA 1WRJA 1YS7A 1FC3A 4Q48A 5EEHA 2IRFG 3MFKA 3GFIA 3F23A 1CF7B 1RUOA 3CUQC 2OA4A 4UNOA 4ASNA 1YW9A 3E5QA 2ADUA 2D45A 4ETSA 3HRMA 1JHHA 5BS6A 1FT9A 2BE5F 2FMLA 4HAMA 3E6MA 3W6KB 2F5DA 2XHKA 3MCZA 5E8GA 3ROUA 2CYYA 1TW3A 2ESHA 3FXQA 3KZYA 4RB3C 1R1UA 3D5LA 1B4AA 3BP8A 2XKPA 2XUBA 3GZ5A 3S2WA 5TJJA 3EQLF 1USTA 4EM2A 4LB6B 3V7CA 1USSA 3FF5A 5E8IA 4MTDA 1O3RA 2CW0F 4M9SA 1ZRFA 2D1VA 1IN8A 3P9CA 2A61A 1XGSA 3BY6A 4MTEA 5HS8A 2KIMA 2ZO4A 4P5OA 4EGZA 5DD8A 1OR7A 1G6NA 4YG2F 2PFBA 2KIFA 4TV7A 2XAHA 4HX4A 1TQPA 1XSDA 1TNTA 3IL2A 1QNTA 2F5CA 4CHUA 1ZG3A 2CO5A 2M87A 4AIHA 3R0JA 3LA3A 2DAOA 2MA3A 2NYXA 2ZJ2A 2P7CB 2DK8A 2DI3A 5ICEA 4L0ZB 5BOXA 3ELKA 1JXSA 3CDHA 3M8FA 4XSZF 2R3SA 1YTYA 4EJTA 3ECHA 1Q1HA 1U78A 1IN5A 4CZZA 3CTAA 1B6AA 5HVQC 4EJUA 3V8JA 3ZMDA 5AIPA 3RI4A 1RUNA 4KN7X 3K0LA 2A5YB 2FOKA 2XKOA 4M73A 3C18A 2WC2A 5JHUA 2JPBA 5FD5A 4EJOA 3L7WA 5DEQA 1SFEA 1GHCA 1T0FA 1B1BA 2P4WA 3IWZA 2OQRA 3N97A 3QU6A 4KUMA 2XV4S 4OOIA 4RGXA 2K7LA 3RPUA 1ZYRF 4O6JA 2DFIA 4FT8A 3FX3A 2GQQA 5F6FA 4LGWA 2EA4A 3GFMA 4M72A 2VC0A 2V1XA 3KETA 4G8XA 4HX7A 1SFUA 1J7KA 4L9TA 3M1EA 5CJ9A 1SD4A 5FLXZ 4R1HA 3KZZA 2FBKA 1RZ4A 4ON0A 5LBQA 1R58A 1XDSA 4FX4A 3RKYA 3HSFA 3KEOA 1Y0UA 5LHHA 2EWNA 3KP7A 1XSVA 1ZG5A 1I1GA 5D5VB 2RGVA 2GA1A 4OIRF 1G3TA 1C0WA 1I5ZA 2QENA 4M6YA 5HOOA 4KIGA 3ISPA 5ICCA 4U88A 1AOYA 5E1WA 5HLGA 4UVAA 3PFIA 2RNJA 3JW4A 1CF7A 1HSJA 1STZA 2ELHA 4KA4A
chains in the Genus database with same CATH superfamily
2Z99A 1V54H 5J8FA 1X2MA 3I4PA 4ENKA 4CUGA 3DP7A 2VXDA 2DPUA 1NG6A 4NQWA 1HSTA 1ODDA 1DU0A 1WWXA 3U9GA 4IHSA 2IGOA 3L2UA 1WH5A 1GLNA 2EFQA 4HDVA 2BYVE 2JSCA 3F0CA 3M9AA 3MD2A 2EH3A 1BJZA 1MSEC 1ZHFA 1XCVA 1K78B 1OCTC 3Q5FA 3EUHA 3BQYA 3PFYA 4YEJA 3EYIA 3L2CA 4DNCA 2E7WA 3IH3A 2W7NA 4UY8I 2QBYB 4GDFA 5EF6A 3NAUA 3OIPA 2LDUA 1U8BA 1QZYA 2KKOA 1ZR2A 2H09A 3HZJA 3J7AY 5LHGA 4QWQA 2R7SA 2BY2A 3PIPF 2DT6A 1VQPI 2G0EA 4OWRB 1W1WE 3E3VA 3F72A 3HGGA 4QPQA 1CQTA 3K10A 2PMUA 1J75A 3FXUA 2X6YA 3GTPJ 1UFMA 3PNYA 3K7AJ 1PP8F 2A07F 1W5CC 3SDGA 3E5XA 3IAS2 1MJAA 1LDKB 3H5RA 3SZPA 3V8KA 4EM1A 3HXLA 4A3CJ 2A3SA 4XOTA 4QSHA 4ENNA 3E6BA 3RYPA 1FOXA 1HF0A 3GYHX 1GUUA 2D1HA 5TISC 5E3NA 2NRAC 3VSKA 2JTVA 2RQPA 3T8TA 2EZLA 1P4AA 4CO8A 2E1NA 5IYDJ 5FFZA 3K4LA 3GLLA 2L7ZA 4IQ4A 5JLWA 4NC8A 2PMZA 2GIVA 3IP4B 4BDYA 4PJMA 4E7JA 3F8BA 3TOAA 1ETYA 5K5RA 5J8CA 1Y1WJ 2R5YB 4IF4A 5IYCJ 5F64A 3ZGKA 3LSPA 2Q8KA 2E2JJ 1OMIA 1Z7LA 1GXPA 1T6SA 2H6BA 1T98A 4A0YA 2W4SA 1ETWA 5GADJ 5K7HA 1BI1A 4II2A 3WTVC 1IXCA 2MH9A 1OYIA 2M8GX 2NVQJ 1XGOA 3LSHA 2F4OB 4HG2A 3BCAA 1B8IA 1UHMA 3S93A 2R7QA 1I6HJ 4XLCA 2ZSIB 1IW7F 2W48A 3I0TA 4NDLA 2DFFA 4C2UA 2HTJA 1APLC 3S2HJ 2DTZA 4XKWA 4BQOA 1JE8A 2EPFA 2HS5A 5CVVA 5L3CA 4QPOA 4ZH4F 3CCLI 2JUGA 4RM3A 1YQAA 3H9GA 3I59B 3MAJA 4A3DJ 3ZQHA 3LQQA 5L3EA 2DDAA 4RAZA 2KLOA 5EZGA 1MJBA 2VT3A 2L7FP 3H3ZA 4N4OB 3MEXA 3FXKA 4E7KA 2FRHA 4B09A 2DLLA 2Y0SA 2R5ZA 2DK5A 1GT0C 2ZJPF 4KJZA 4MNUA 4QIWN 4HF2A 3OL3A 1W36D 3G71I 4Y15A 3S14J 1KQ0A 3KP4A 3GX4X 1A04A 2P5KA 3RYRA 2JA7J 3F3XA 3FXMA 3DKYA 3JTGA 1VNDA 4RGSA 1MKMA 4BQNA 4DZPA 3K69A 2UXXA 4XN3A 5H2FC 3D5RC 2QQ9A 1P6RA 4MQ9F 4FASD 1Z3YA 1BI2A 1FOKA 1H0MA 3ZP5A 4B48A 4HEA2 1Z9CA 4E7HA 2M3AA 3KPHA 1FP1D 3CDIA 1O3TA 3V7RA 2M7AA 2XAGA 3F8NA 2EB7A 2B9SA 2I5UA 2HQRA 1Y1VJ 1ORKA 2W00A 4M71A 4M6XA 3LSKA 2M45A 3QPSA 3JCUC 4IX7A 4C2TA 3A03A 1DP3A 3FXRA 5HDKA 1YX5A 2YS9A 1KU3A 1WI3A 3GMEA 3VYSB 2ZNZA 1BOAA 4MFEA 4BJ6C 2XAJA 4A12A 4OMZA 2LOOA 2YR2A 2Y69H 3PSIA 5LEKA 5LRSA 2R7WA 2YU9J 2W82A 1JGSA 2Y30A 2HQNA 4LLGF 2OAZA 4Z6YA 1RI7A 5H6QA 1W5TA 3B02A 4EVIA 4KIFA 4BXXJ 4HNVA 4FISA 2FQ3A 1AKHB 4GO1A 3WE2A 3PQJA 2V1UA 2VKVA 4N0BA 2CQKA 2RV8A 5B3SH 1SFOJ 1W0TA 1I39A 3RDIA 4HDUA 5J1RA 2H94A 3BG7A 1QBJA 1E17A 4HNUA 1D0ZA 2BVLA 1R4NB 4J01A 2RVCA 2OCEA 4D0PA 4BL0B 4UV8A 1ETOA 3ZXSA 1F1ZA 4MLOA 1VQMI 2FU4A 5DM6F 4B47A 2HZDA 3HM5A 3K4MA 3FBIB 2E2IJ 3EUKL 1OPCA 5D8KB 5J1YA 2UXNA 2EFWA 4DW6A 4ENJA 3SZGA 5IOZA 3CCSI 1IXSB 1WKMA 4WK8F 2QF7A 3DF8A 3L9FA 1VTNC 5BQTA 4UUVA 2IVMA 2LRDA 2XGDA 5D5XB 3UKGA 3AL0C 5FKOA 1LPQA 3FMQA 2R7RA 2COBA 5DCMA 2L2OA 4RLFA 4IHTA 2E5ZA 4U7BA 1R5GA 2ELJA 3DLAA 3PSFA 5GP9A 3S3MA 3TEDA 4KITB 3LSJA 1ZH5A 2MW8A 3QRFF 1BBYA 4BXFA 3A01A 3U21A 4LG0B 3GTMJ 1Y8RB 2BZTA 2KMUA 1Z6TA 4IRGA 1L3LA 2O03A 1O3SA 2W84A 1WQ2A 2FEZA 4G94A 4MHGA 4MEXF 1FNNA 3TDZC 5IP7J 2JT1A 3LAPA 2K3PA 4OIOF 2R7TA 3I64A 2JA2A 2K27A 3GZNB 2M8EA 5LGTA 3K2AA 4XORA 3CCVI 1H89C 2O61A 4RAFA 1R23A 3ABTA 3ZPLA 2XRNA 3G3ZA 2K9MA 2XAFA 4JX4A 4WWCA 5DUKA 3T1BA 3RPQA 4ZYGA 4HNTA 1K79A 3SEQA 1O57A 3QU3A 4ZYAA 2K3FA 5LEJA 2L9SA 2KJBA 2FF4A 1ZR4A 1RNLA 3MZ8A 1K78A 1ZREA 1U5TB 1LFPA 2F5EA 4MEYF 3BDDA 3CP2A 1IN6A 2RNGA 2ISZA 2CMPA 1IDZA 3OYHA 1LB2A 3KEQA 1FWZA 3ZMZA 1D3YA 3G1MA 2DPDA 2QBYA 2A69F 3B6AA 3K1MA 3R4KA 1EA3A 2YPRA 4MIMA 4LFUA 2CS3A 1MGTA 1O4XA 2Z2SB 4UV9A 1P92A 4DGWB 1S7AA 3QYBA 1LNWA 3LSRA 1IUFA 1GXQA 4BHPA 4PDKA 2ZMEB 2DA4A 2LK2A 3CLQA 5GTIC 1TWAJ 3TGNA 1IRFA 4I0AA 4KFCA 2B7EA 3CJNA 4G9YA 4NQWB 3JRDA 1T56A 2ZSHB 2TDXA 3BT9A 2JPCA 1X4PA 4G6DA 4C3HJ 4CCMA 1S29A 4NB5A 1XMXA 3I55I 1KYZA 4BY7J 1MH4A 3FM3A 3R0AA 4U0YA 3AFHA 1BN5A 2EK5A 3WU0A 3V8LA 5CVJA 2M7BA 2FNAA 3ERED 2X85A 3OYNA 4XSXF 1B9MA 4LITA 1BIAA 3ASNH 3DPTA 4JOMA 4ITVA 1G3SA 5HNHA 5J3LA 2K4JA 4JX6A 4BDZA 3ERMA 1W7PD 4S05A 1M1EB 1X2NA 3Q0WA 3KP6A 1H8AC 2ESNA 1TNSA 1VQ7I 2R5YA 4E4HA 3S32A 3WTYC 2KDOA 2UV1A 2XDVA 5M5WJ 3GCMA 3T8RA 3SFIA 3BWGA 3ABUA 2CSOA 4UVBA 3HOSA 1B72B 1G3WA 5GPCA 4N9IA 4ZYDA 1FBQA 2EV5A 4AVZA 1R1VA 2WY8Q 4PUSA 2WAFA 3RJPA 2DTRA 1H9TA 3PUBA 1E3PA 2HOEA 3DXJF 2QSHX 2NNYA 2H8RA 1DPRA 3F8FA 5LFAA 3TKYA 2G7UA 1R71A 1HW5A 3LNQA 4HX8A 3I53A 2ECCA 1G3YA 3FZVA 3I59A 4XQFA 4PGHA 1J9IA 4I09A 3BG9A 2OTJI 2CH0A 1ZGAA 4NHJA 1SFKA 2R7UA 3RKXA 3FXOA 2B0LA 3I3LA 2OZUA 2M4GA 2BXZA 1Z1DA 2DT7B 4HQEA 2BOLA 2CW7A 3BZKA 1YHQI 3NRVA 5FLMJ 6PAXA 2ZKZA 1SAXA 1FPQA 4BACA 3WTSC 1YJ9I 2KRCA 3ZQGA 2DA5A 2J5PA 3G2BA 4WX9A 2LMDA 5J6XA 1OYWA 1J59A 4OMYA 5EDNA 4HLYA 2LF8A 3RQIA 1U9OA 4R8HA 5BPDA 3G1LA 3BR1A 3O2PE 1YITI 1PDNC 4F52A 3M8JA 4BE2A 3ONQA 3CUOA 4H4KC 5H20A 4C30A 3A0BC 4AM3A 3GF2A 4HBLA 1HW2A 1E0EA 1LUJB 1HA8A 1SANA 2LTPA 1OR7C 3I71A 3CCEI 4PFPA 1E2XA 3KP5A 2IS4A 1S5LC 5B1BH 2LKPA 3TDUC 1LEAA 5L3GA 2VPLA 2EILH 2FBIA 3UR3C 2XC7A 2LKXA 5L3FA 1X3UA 3TO7A 3W3CA 3GXOA 1ON1A 2KDZA 2R5ZB 2K86A 5IT9Z 1HXDA 1DPUA 3H36A 4K2EA 4WF2A 3GTOJ 4FTHA 3WODF 2R7DA 1YFHA 3EUAA 2L9VA 1MMDA 2ZCWA 4I98B 3FK6A 2GBYA 1EJ9A 2ZC2A 5C4JJ 1R5ID 2FOWA 2LYCA 1FTZA 3S3NA 3E6DA 5F0FA 1AKHA 2L4AA 2H1LA 3ABKH 2V4JC 2CV0A 2EQRA 4KICA 3TBIA 5LGNA 3L2QA 2VXZA 2XGEA 1KGSA 4A3IJ 2XSJC 4IQJA 2LH9A 1W0UA 2CU7A 3ZOBA 4L5IA 2Z3YA 4AUXA 1UJ8A 4A6DA 2ZXWH 4CDGA 2MD0A 3CLOA 4KT6A 4S04A 3GFJA 3RSNA 5E17F 3C3WA 3DQVC 3WTTC 1E3OC 1KZHA 2X1CA 3WU2C 3LQRA 3L2RA 1X3ZB 2ZJRF 1YJWI 2VL8A 4CCOA 1I1SA 3KX2A 1IXRC 2RKHA 3BLYA 3L09A 4HLXA 2E5NA 2PBIA 3DTEA 3ZCOA 1BA5A 5E18F 4E7ZA 3KP3A 3COAC 4CYDA 2QEXI 1VQ6I 3WTWC 1WI9A 2F4IA 2ID3A 3GO5A 2KZVA 2X51A 3TW7A 3NWTA 1XS9A 3ZQCA 3JRCA 5E1XA 3S1QJ 2O0YA 4ESBA 2EBIA 5ILUA 4U7DA 1KA8A 5HLHA 4LIVA 3DKXA 2IBDA 2R7FA 1GVJA 2HTSA 3F6OA 3AG4H 4CGZA 4F3QA 4CZCA 3V4GA 4LG0A 3DPLC 1T0FC 4L5JA 4XKBA 3P7NA 4JQFA 2LREA 2MBFA 5HDGA 4ZTFA 2IAIA 1TL8A 4G6TB 1D5YA 1JKRC 2BEOA 4LOCA 5IT9K 3IAM2 3IUOA 3OYAA 3SEZA 4DYRA 2MLGA 2M34A 3ZMUA 3WGHA 2N8GA 4LLLA 4IEJA 5A2QZ 1IV8A 2E19A 2R93J 4HQMA 1K83J 3P9KA 2B63J 5DCMB 3S1NJ 1FP2A 2OPTA 1UB9A 3I56I 3KYLA 3HL2A 3EETA 3R6SA 4A5NA 4M3DA 4XLEA 3VB2A 1YLFA 3MMYB 3HYIA 1WJDA 3OYCA 1U5TA 4L18B 5KNLA 5FKLA 3M7GA 3CZ6A 3QOEA 1D0YA 4U87A 3RKWA 3LFUA 2IPQX 3AG2H 5B5EC 5EYRA 3OYEA 2KRFA 3K1NA 2AXTC 4IXAA 2DT5A 2VOPA 1X4OA 3LSMA 2H1KA 1XGNA 3HOYJ 3OYJA 2XPVA 4M9XA 4QLCU 2R7ZJ 1A36A 1QVUA 4HPQA 3BCBA 3HBLA 1MBHA 4GXOA 3S1RJ 1I27A 2QM3A 2L7KA 2ZMEA 3CO7C 1D1AA 3JTHA 1Z05A 4HF0A 4XR6A 4Q47A 1KYWA 2E1OA 2L01A 1JI8A 3B73A 1XG1A 3ZR8X 4CICA 3GW2A 5FJ8J 3KLNA 3F22A 2ZNYA 3WTZA 2NOGA 1HLVA 4NBQA 2A6TA 1OCOH 2DYSH 1KU9A 3NWSA 3OYBA 4BH9A 3HOWJ 3K70C 2HDDA 2ID6A 1ETKA 3OS1A 1K4TA 4F91B 3LSTA 4MO7A 3FIWA 2CUEA 1HCRA 4L0YB 4AD9A 1D8JA 1G4DA 4I99C 4RGUA 3O8GA 2EA2A 4WXCA 1QHHD 3S8PA 2VBZA 3BOQA 2RQQA 2DN0A 2GXGA 4A5MA 1MD0A 3ZMSA 2CRGA 2PJRB 4KYWA 4IRHA 2CGPA 4BKXA 1R9TJ 2EV6A 1B72A 3HPHA 3CUQB 2BY3A 5FLXK 3LMMA 2OF7A 2E60A 4PSWA 1K4SA 3HKZN 3K2ZA 2HEOA 2Y48A 3EUHC 3SYTA 1NK2P 1X1CA 4ZYEA 5JR3A 3HTSB 2LF7A 4RLQA 2V26A 3W2AA 1ZGJA 1EH7A 1S8NA 2HGCA 3IC7A 4UUTA 2KJCA 5E3MA 4RA2A 5JI6A 4BJ5C 1MJ9A 3H5NA 4HZFA 2MD5A 4UB6C 1IN4A 1UZCA 4D5FA 2QLZA 4XLAA 2OC6A 1BI3A 3QYEA 1PUEE 2FJ1A 1VI0A 2IXSA 3HRTA 4LK0F 5GAHJ 4BE0A 3FISA 2XGXA 3HHHA 3HUGB 2DDBA 4G7OF 3PUFA 1H88C 4IOCF 1BIBA 3E5UA 2LY2A 3N4MA 1MMGA 2AXLA 2CFOA 2DA1A 2R7XA 3OOUA 2FNPA 3S3OA 1XPXA 4IHYA 2VUMJ 3KCCA 2R0QC 4PSXA 2OUMA 2IA2A 1YYVA 2KHMA 3GTJJ 2LVSA 1TZLA 3WHCA 1EF4A 3RZDJ 5ICGA 1HKQA 1XDUA 3N05A 5CKTA 1E3HA 4A3MJ 3BC8A 5ERIA 1SD7A 2MG4A 3VWBA 3ZN1A 1IV6A 1AWCA 4RB1A 2XPUA 1WJAA 1DP7P 3HC7A 2IW5A 3CCRI 3HRSA 1Z91A 2PI0A 3VOEA 5HS9A 1LDDA 2HOAA 1WSUA 1HKTA 1OJLA 1UG2A 4UXNA 2ICWG 4AIKA 4B44A 1U0JA 3BJ6A 3E6CC 2M30A 1JJ6C 4A3EJ 4M6VA 2V1NA 1K7AA 4PGGA 4I2OA 4E7SA 2K40A 1N78A 3LOCA 1YW8A 4A69C 4XLPF 1AHDP 4CCJA 3D5SC 2Q2EB 1A35A 2JA5J 4BNCA 5KHDA 2E7XA 1MW7A 3L00A 2GAUA 2ME0A 2CV2A 2LP0A 4LMYA 4V19K 1VQ8I 1R5HA 3J80Z 3OS0A 4PZJA 1T95A 2BW3A 5FKMA 1FOWA 3HSEA 2ELKA 4PJLA 1RR7A 2F48A 4B1RA 1J5YA 3KIOA 3MVPA 3U2RA 4YFKF 2OBPA 1MH3A 5H6RA 2NS0A 2XAUA 3BTJA 2W24A 4NC6A 4OINF 4S0HB 2VKEA 2A6HF 1RKTA 3HTUA 1FSEA 5HLIA 3CMMA 2VJIA 3NQOA 4ZDOA 1Q1VA 1R22A 2VBXA 4OU0A 2JZYA 1XSXA 4BS9A 4IKFA 3JSPA 2IS1A 2KRHA 3ZRGA 1I6XA 4KMUX 2AO9A 2GZWA 4D7MA 2DXIA 1EH8A 3Q3SA 4CCLA 3MZYA 1FSHA 1S9HA 2MLKA 4KMFA 2XPWA 2F5VA 2M0CA 1V5FA 1TLHB 4BAYA 2L3DA 1W7PB 2V1DA 2JRMA 1O7LA 3TO6A 3GZ6A 3G1OA 2QUFA 3KE2A 1PJRA 1I3AA 4IPAA 3DV8A 3IRRA 1BL0A 4IRIA 1BR2A 3JAMZ 1N75A 3PQKA 3GLXA 2Z16A 1MMNA 1TQMA 3ASOH 3IH4A 4XBFA 3ZQ7A 2FA5A 5LHIA 2XRLA 5DTDA 2JRTA 2Q0OA 1ZRCA 1Y6IA 4A3JJ 5KK1A 2F2EA 5ED4A 3PNTA 3L1PA 1VQOI 5D4RA 2ISYA 3DLLF 2XIGA 3KZIC 1YO5C 1XD7A 2V7FA 2FUG2 2NVUB 1UMQA 1SFXA 2STWA 2HKXA 2NS8A 3CJQB 4F55A 3W2VA 2KISA 1MMSA 1B9NA 2X9DA 4A0ZA 4A3KJ 2H6CA 1YG2A 2P0WA 3WE3A 3HDDA 2LFBA 3H35A 3NEUA 2E1MB 1VQKI 4BHCA 2W85A 3F8MA 3J80K 2R4GA 4RAYA 2Z9OA 4KDPA 2BY0A 1DGRM 4U0WA 3DTKA 4YFXF 3FMRA 3DEWA 4RM2A 5DCFA 3M8EA 4EGYA 4ESJA 1HC8A 1SEUA 2VJ5A 2DYRH 1WGXA 2P7VB 3MN2A 2QA4I 1AA7A 1JKQC 2CG4A 2KL4A 2IJLA 2CV1A 4IHXA 2LSOA 2COMA 2X1EA 1O7FA 1YS6A 5J40A 1IF1A 2DBBA 4CXFA 1PVEA 3HOXJ 3BROA 5D8LB 3H0DA 4BQAA 3CMYA 2VT2A 2Y2ZA 3QP6A 4KIBA 5EGOB 1TWHJ 1XB4A 2EZKA 5DYMA 3T5XA 3ZQQA 1F43A 1WJBA 2HVQA 3W2WA 1HQCA 1W36C 4N4NB 4IL6C 3CCMI 3QPHA 5E3LA 3FXLA 2ZFUA 3DCFA 2HWVA 1LE8B 1FTTA 1WJCA 3C2BA 1D0XA 4PJNA 4YIFA 3IHUA 1H9GA 2PJPA 4B3AA 5J47A 5D5UB 5M3MJ 3JSOA 3JAMK 1R4MB 1BOBA 4AYBN 4WXHA 3DEEA 4JX5A 2XROA 2OTLI 2WA0A 2LNBA 2IS6A 3MKZA 5AONA 3MQ0A 2F6CA 5IYBJ 3J81Z 3QP5A 1YW7A 4BE1A 2VJJA 2EFNA 1S72I 4DBQA 4XN0A 1LFUP 3LWFA 3S17J 2PJRA 3IKVA 2HQAA 3VODA 1D1BA 3J7AO 4L5EA 1ZLKA 3CUQA 4Z2YA 5FD6A 3AKZA 1FEXA 3I58A 1FY7A 2JSPA 1QPIA 3CCJI 1MZBA 4HSTA 2FSWA 1YX3A 4C3JJ 2IT0A 1YOVB 4PK4A 2IA0A 2ETHA 4DZJA 2ZXIA 1A6IA 4L9NA 1MSFC 5D4SA 1LFBA 2DMUA 5BMZA 4IJAA 3G4SI 2GWRA 4IO9F 2V79A 2NAZA 1LDJA 3GUDA 1Y8QB 2MH2A 1K6YA 2Q1ZB 3DBRB 3FK7A 4PFOA 1YRNB 2GLOA 1U9NA 2IGNA 3HPGA 1X1AA 4DQ2A 3MZHA 2HXOA 4X6AJ 3CP8A 3RQ4A 4GGGA 2HYGD 4XONA 1MNDA 1K6OA 4FE7A 1FZPB 3L2WA 2NVTJ 2EV0A 2MC4A 2YX7A 3HUGA 3OYGA 3I54A 1ETQA 1F4KA 1FYLA 2DW4A 2M5WA 2CQXA 5FRMA 2ZBKA 2VN2A 4R79A 2HPIA 3H92A 2BGCA 3ULQB 4E7IA 3SXYA 2WWYA 2XGCA 2KQRA 1MBEA 3AG3H 3IRQA 5AIQA 1BI0A 4HV5A 1I3QJ 2L02A 4LLNA 2AS5F 4LK1F 3TL4X 1MMAA 1P4WA 1QZEA 2EZHA 1TT0A 2P6SA 2PEXA 5JVTA 1U8RA 1NHAA 3BJOA 2JN6A 3C7JA 2QKLB 4EMSA 2BXYA 3HGYA 5LD2C 2EINH 1DU6A 3KP2A 4PJ0C 4BY1J 1VFCA 4HOBA 2H27A 1ETXA 3J81K 1F9NA 4HYEA 3AG1H 5F08A 4XKVA 3GTKJ 3OMYA 4J00A 3BR6A 5C3EJ 1MBGA 2ZXHA 1DQUA 2DMTA 3IH2A 4GYIA 2CUZA 3OYIA 2Q2EA 3SQNA 3CC2I 4IHVA 2NOJB 1X3WB 2FX0A 3E7LA 1ZK8A 3WG9A 1P9QC 3HEFA 3SDBA 4BBSJ 4PJJA 2DA2A 2P5LC 5F0CA 4FX0A 1LVAA 3L2VA 1PUFB 2OD5A 1ERDA 1A5JA 4HA8A 4MQVA 4Y13A 1IRGA 5DV5A 2VI6A 5CYVA 4H0EA 2NVXJ 2DJNA 2K02A 1SD6A 2L9RA 2PMHA 1W5SA 1SMYF 4I0BA 3ABMH 3TQNA 5IT3A 2BBYA 5GAGJ 2D5VA 2W1OA 1IGNA 5LGUA 1RC9A 2MYSA 2Y75A 4W1UA 2V6CA 4PCQA 5FO5A 3TW6A 3KFWX 3VEPA 2M0MA 1BJAA 2ME6A 1U6GA 3WU1B 3PIOF 2E36A 3DEUA 2J5OA 4CYCA 1Y0NA 3OYKA 2FE3A 4YFNF 3X2QH 3KYCB 1BR1A 2VOOA 5HS7A 1RKWA 4N9HA 2ECBA 4A93J 2GXBA 4EJWA 3BTCA 3LA2A 3VYUB 1P7JA 3FHZA 1UG0A 4A6EA 3ZMTA 1RESA 2W57A 1QQIA 1W7PA 4CCNA 2Y0MA 1R36A 2BW3B 1QRYA 2X6XA 2QZ8A 3Q0UA 4DBRA 4AIJA 1SC7A 2STTA 2KIUA 5J4YA 3H9QA 1FMVA 3D1NI 2GOMA 1PP7U 3O3KA 1XC5A 4I02A 3QODA 2HKOA 2HFHA 4P9UA 2WTEA 3F6VA 3CESA 2W25A 2DOAA 3HB9A 3JRAA 1KU7A 3OV8A 3TO9A 5D6FA 1OQYA 3BPXA 4RAGA 4IZZA 2F5FA 4XRMA 3OSFA 2HDCA 1T2KA 4ESFA 4OIPF 1RR8C 2XF5A 1WJEA 2FXAA 3DKWA 4D1QA 3H9JA 3HOTA 3QQAA 2GA2A 1U2WA 2HNHA 2O8KA 2HYFA 4KT5C 2WAEA 2DMNA 4ANJA 4UHTA 4G6QA 3VYRB 3EYYA 4UVCA 1WHUA 1WJ5A 2YX4A 3HRUA 4YIIA 5DDGA 2E35A 4E6KG 4L9VA 5IOYA 1QU3A 1ZG1A 3K9TA 2PQ8A 1RIOH 1QPMA 2DU9A 1J2XA 3SZTA 4P1WA 2IS2A 1BR4A 1YI2I 4CCKA 1XMAA 3WGGA 5FB2A 3KLOA 1X1BA 2LY1A 2K4BA 3A1YA 1R7JA 1IO2A 3ZN0A 4Q4ZF 2DQRA 1UHSA 2RAEA 3HHGA 2NS7A 3EDPA 3FXJA 2PN6A 2QYOA 2X4HA 1UELB 3RIRA 1HKSA 2M4KA 3V42A 1ULYA 2OJED 3GTLJ 1QZZA 5EGOA 4DIQA 2HOTA 5HDNA 3AL0B 2P8TA 3DFGA 3QPTA 4O5VA 1X19A 4RGRA 1YIOA 2YUSA 1EH6A 5FGMA 1XCBA 1G59A 1LE8A 2E1CA 1OCCH 3PL8A 4XKCA 2FMYA 1IRZA 4XICA 2TRTA 2X6WA 5GPAA 1IAWA 3D0SA 2V9VA 4F7ZA 2PLYA 4X0GA 2YU3A 2C6YA 5JHFA 1OCZH 2WAQN 4P9FA 1S3JA 2CUJA 4P96A 2X48A 1QHGA 2L4MA 3GEZA 4YELA 3RZOJ 2OCCH 1GVDA 3SFZA 1XTAA 1SD5A 1CGPA 4HF1A 2JVGA 4B4CA 5E20A 2XB5A 2QWWA 5K7ZA 3OOPA 4KN4X 3HIFA 2LR8A 3W6JB 1JJ8C 4AVPA 1Z7UA 5K7FA 2EJRA 3JRGA 3LSGA 1F5TA 4FHTA 5B66C 5EJCA 3OR2C 4GYGA 2G7HA 4LD5A 1U5TC 1U3EM 3BZCA 1FYKA 4Y7NJ 5CVIA 4RDUA 1S6LA 2X6OA 3G6EI 3WG7H 3K4BA 5K1YA 4UUSB 1TQIA 1DDNA 4OIQF 3M07A 2O9LA 2MGQA 1BC8C 3ECOA 1FYMA 1DGWY 1R6RA 1ZKGA 1IDYA 1WVRA 4B3XA 1WCMJ 4L9JA 4AWXB 2GIZA 3MWMA 1YRNA 2ZXJA 2GM4A 4EJVA 1VQNI 2PX9A 3ZMVA 1Z6RA 1ZAOA 2NVYJ 5L3DA 3VPRA 4RB2C 2ZMEC 2P6TA 4F92B 3AAFA 2IP2A 1ONVA 5ILSA 3PM1A 3K4CA 3S15J 1DUXC 3BTLA 1XN7A 2ZFWA 2HR3A 5FKKA 1FLIA 1D8KA 2G9WA 2WB1N 3HSRA 2QCOA 3OR1C 2QQAA 4KISA 3BG5A 2MC3A 5A2QK 4IVNA 2QSFX 3E97A 4ENMA 4U0VA 2QQBA 5FKNA 3A4CA 3R61A 1GV2A 1VZ0A 1BM9A 5HLTA 1TP4A 1XX5A 2Y9ZA 2UZKA 4JP0A 4BEHB 3W6VA 1MDMB 2KT0A 2JWTA 3BJAA 4Y4RA 2VBWA 5CVRA 2VONA 5CQGA 1BC7C 4XK4A 2KPMA 1T8IA 1TWGJ 5F1JA 2YSRA 1TWFJ 2K9NA 2Y31A 3IWFA 2MSYA 4BXUA 5FFXA 5CLSA 1Y39A 1ETVA 4HSRA 3B6CA 4D7NA 3J7ZI 1XGMA 4I6ZA 1P4XA 3E1SA 4ZZDA 3TP3A 3E0JB 2LBFB 1NG7A 2O3FA 2OU2A 3JRIA 4AYBA 4A2UA 5K5OA 5LLQA 1GV5A 1T33A 1QGPA 2K85A 1HW1A 4M74A 1X58A 2L5QA 3Q9SA 2LLKA 3OWTA 3F21A 2CWEA 1OKRA 3BR5A 3CMEI 3A0HC 3S1MJ 1ZN2A 5JFRA 1YIJI 4XM3A 1P2FA 4A3GJ 4EATA 2BY1A 4FE4A 3GFLA 9ANTA 1TC3C 2IGKA 1PUFA 1RETA 2L7MP 4ZZLA 2XVCA 3TP0A 1MNMC 2OQGA 1QO0D 2UUZA 4JYKA 4NUBA 4JBAA 2HYJA 2CW8A 2JMWA 2MFZA 1J0RA 4EV0A 1IZ1A 2FQ4A 2HU9A 3FWEA 3K1PA 1FBSA 5D6EA 5EZHA 2V6EA 1EV7A 1ITYA 3FBNB 4LG3A 1V3FA 2P81A 1T39A 1AU7A 3BR3A 4XRFA 3U1KA 1NH3A 4LJZF 1MBJA 1TBXA 3REOA 1OLTA 2DODA 2Z5UA 1UCRA 2DOFA 1JT0A 1KU2A 2FBHA 5E79C 1OYYA 2UWMA 3MKLA 4RB0A 4XRSA 2EFOA 2RC4A 1HBXG 4EEFG 1IN7A 2I8DA 3JREA 1Z77A 1XMKA 4C2MJ 2DA6A 4HV6A 4OAZA 4G7ZF 4JK1X 3I5UA 1T08B 2R7VA 5ICFA 1JUPA 2QGUA 4KNYA 2HVSA 3GTGJ 4DYQA 3WTUC 2JQ7A 4LIUA 2EIKH 2M9HA 3F9KA 1ZLJA 5DD4A 1IJWC 4II3A 4BHBA 2DCEA 4C9YA 4YRVA 3R60A 1O3QA 3CCYA 2VQLA 1ZGWA 3GVAA 1V4RA 3V7SA 4Q5SF 1KQ9A 1L0OC 3OYLA 2VB6A 2BV6A 2DJIA 4MGRA 3P9IA 5DM7F 3RCOA 2WBMA 1WPKA 3CC7I 3H1CA 2VE9A 3M4OJ 5K5QA 2XASA 2O7OA 1T38A 1R00A 4XIDA 4CYCB 3BR0A 2XAQA 1KQ8A 2EIMH 2VKHA 1LQ1A 1G8XA 1PYVA 4D5CA 1A6QA 2QVOA 3U1DA 5BPIA 2KFDA 1JUSA 2OZ6A 2V9PA 1MNEA 2A5WA 3QPLA 2WV1A 2DMQA 3CJRB 4BQQA 1LEBA 1BW6A 2K9LA 3K4NA 1ACIA 2VC1A 1IUYA 3OIOA 1TW2A 4WCGA 5D5WB 2LY9A 3OSGA 2O6GE 2WV0A 1ZARA 4E70A 5M5XJ 3FMSA 3OS2A 3CCQI 3QAHA 2DQLA 3GBGA 3ZQIA 1FBUA 3BQZA 3WTXC 4GFBA 3BPVA 1TTYA 3O6BB 3J7YJ 4M3BA 4RS8A 1VQLI 3C1DA 3LFKA 3T0YA 2EIJH 4I01A 2MABA 1FIPA 1FOYA 3Q9VA 3VFZA 1D5VA 2CQ7A 2HDWA 3GWZA 2O5RA 1SMTA 2A68F 2E34A 1FJLA 2RDPA 3K4KA 4EM0B 3CO6C 4B8XA 4ZYHA 1JKPC 3ZQFA 5F0HA 4CSWA 3C2HA 2BHYA 2DFHA 3H3VK 1N25A 5ILVA 5DS9A 2D2WA 1JHFA 1OCPA 5F1RA 2GOXB 2NNNA 2Z33A 1LVKA 4D9JA 3P5JA 3H3UA 3QOPA 2RN7A 2VE8A 1UAAA 1EKEA 4Y33A 4WXDA 2LG4A 1WJFA 3RTRA 2O8XA 2X0LA 2WADA 1B59A 2PG4A 5DUIA 3A2KA 4Y17A 3HG9A 3O8HA 4V2FA 1K61A 3K6GA 4GCVA 2DFEA 3IKTA 3TOBA 4O3MA 2CQQA 3LA7A 2HZTA 3IV5A 4AC0A 3G73A 3WGIA 2BHZA 4HW0A 1ON2A 1W4MA 3FM5A 4A0XA 3ESWB 4A3LJ 1ZRDA 3S16J 4DOZA 3LAJA 5LRRA 4G7HF 1HOMA 2X1DA 3MKYB 5EG0A 3PNVA 2IA1A 2QQ8A 1X1DA 4J19A 4UUSA 1POGA 5IPAA 1X1PA 2HOSA 5KVRA 3BZ6A 1REPC 2VODA 2M1BA 4M9ZA 2EFPA 1ZELA 3OYDA 3OIQA 4EQQA 2A6EF 2VKDA 3SHFA 2DO7A 3CF2A 1YJNI 2ZB9A 3F8CA 2VBYA 1JGGA 4ZDPA 5L3BA 4BYYA 2PMZN 2K5CA 5J4VA 1FX7A 1UHWA 2CFXA 4P55A 4RBOA 2VQHA 4I7HA 4FQGA 2EZIA 1V5GA 1Z21A 2XSDC 2VLAA 5TRDA 2KP6A 2IGMA 2VQGA 5IP9J 4DYCA 1R1TA 5B1AH 2JUCA 3CDLA 3BR2A 4CA0A 4QTRA 1LJ9A 2ACJA 4IHWA 1S7OA 1ZTRA 5E1ZB 5EEGA 4F93B 5CQEA 2JJ7A 4LB5A 5KAIC 4XLNF 5CVUA 2P5VA 1Y56A 2L54A 3OL4A 3ML6A 4BEHA 1MDMA 1WRJA 1YS7A 3EPZA 2HVRA 3S2DJ 1FC3A 2LKSA 4Q48A 3MKWB 1A31A 3KEYA 5EEHA 4BUPA 3MFKA 2IRFG 3GTQJ 1JT6A 2K9SA 3GFIA 3F23A 1CF7B 1RRJA 3OY9A 1RUOA 3CUQC 2OA4A 4UNOA 1OISA 4ASNA 3I4NJ 3DBHB 5CPRB 1YW9A 3E5QA 3NARA 2LBFA 3JRHA 3JRFA 2WAQA 4XNFA 2Y0SN 1VF9A 2ADUA 2D45A 3CD6I 4ETSA 3HRMA 3Q0VA 4OAYA 1JHHA 5BS6A 1FT9A 5IY5H 4M3FA 2XF6A 2JVHA 1QVTA 1MBKA 2BE5F 4M3EA 2FMLA 1FMWA 1P7IA 2VASA 3E6MA 4HAMA 5KCMA 3OYFA 3BG6A 1Z67A 3W6KB 2F5DA 1VQ4I 4B43A 2XHKA 3MCZA 2R7OA 5GTHC 2BVMA 3CQZJ 5E8GA 2R92J 2AQEA 2FD5A 3ROUA 1IRXA 1TW3A 1YE9A 2CYYA 2ESHA 3FXQA 1OCRH 3KZYA 1R1UA 4RB3C 3JRBA 2RREA 3D5LA 1I50J 1B4AA 3LL7A 5GAEJ 4V2GA 1V5EA 1IC8A 4XMYA 3BP8A 4FCYA 2XKPA 3PO2J 2XUBA 3GZ5A 3S2WA 1WH7A 4BBRJ 2AQFA 5TJJA 3EQLF 1USTA 4XLFA 3CC4I 4Y3OA 4EM2A 1MIJA 3PO3J 4LB6B 3V7CA 1USSA 5JLXA 5FROA 3QWLA 3KYDB 4M3GA 5TGTA 2LC2A 4RMNA 3FF5A 2HQ5A 3LSIA 2JA6J 1J09A 5E8IA 2VQCA 2CUFA 4MTDA 1O3RA 1MBFA 3HOUJ 2CW0F 4M9SA 1ZRFA 2D1VA 1IN8A 5FRNA 3P9CA 2E2HJ 2A61A 3HOZJ 2H8WA 1R49A 3RPUD 1XGSA 3BY6A 3CJTB 3CMAI 1VQ5I 4MTEA 5HS8A 2I10A 2KIMA 2ZO4A 3FKIJ 4G12A 4P5OA 4EGZA 2WB1A 2LD5A 4XL9A 2HI3A 3ABLH 5DD8A 1OR7A 3DU6A 1G6NA 1JUMA 4A3BJ 4YG2F 2PFBA 2KIQA 3HKZA 2KIFA 4TV7A 4XOPA 1JKOC 2XAHA 1B8IB 4HX4A 1N77A 1TQPA 1WFXA 1XSDA 1TNTA 5F27A 1V55H 2OV7A 4MFDA 3IL2A 1KONA 1QNTA 2F5CA 4CHUA 3H5AA 3VYTB 3OYMA 1ZG3A 2CO5A 2M87A 4AIHA 3R0JA 3LA3A 2DAOA 2MA3A 5HODA 2NYXA 2VIXA 3RKQA 2AHQA 2F4MB 1S7EA 5EEAA 1JTXA 1JTYA 2ZJ2A 2P7CB 2DK8A 2DI3A 5ICEA 4L0ZB 4AU7A 1F36A 5BOXA 2A05A 2CJJA 3ELKA 1JXSA 3CDHA 4E7LA 4AIDA 2ZJQF 3M8FA 4ZDLA 4XSZF 2R3SA 4A3FJ 1YTYA 1SVMA 4EJTA 3ECHA 4CH7A 3VSLA 1Q1HA 1U78A 1IN5A 4CZZA 2GXAA 3HOVJ 3CTAA 1B6AA 1SVLA 4FETA 3K70D 4BJTA 5F04A 2DA7A 4NC7A 5HVQC 4EJUA 2V9KA 3V8JA 3ZMDA 5AIPA 5C4XJ 3RI4A 1RUNA 4KN7X 2Y9YA 2XF7A 4HRIA 1WZ2A 3K0LA 2A5YB 2FOKA 2XKOA 1IG7A 2HXIA 4GRIA 4M73A 3C2GA 4BU2A 3C18A 1FIAA 3WHBA 2WC2A 5JHUA 2JPBA 5FD5A 4EJOA 2CQNA 3L7WA 5DEQA 2KZGA 5C44J 3TMOA 2IEKA 4XLHA 1SFEA 2QKMB 1GHCA 2XB0X 3CF5F 1T0FA 1B1BA 2P4WA 3IWZA 2OQRA 2M2EA 2DMPA 4ABZA 3N97A 3QU6A 4KUMA 3JR9A 4W97A 5FLVA 2VPRA 1D1CA 2XV4S 3DU5A 4OOIA 4RGXA 2K7LA 3RPUA 3SJMA 1NK3P 5KAFC 2E1MC 1LKXA 1SVOA 1ZYRF 2JK3A 4O6JA 2DFIA 1HDDC 4FT8A 3K4JA 1QA6A 3FX3A 3QYFA 1HDPA 2GQQA 4YIRX 5BNGA 1ZQ3P 4NNJA 2K9QA 5F6FA 4LGWA 2HPMA 3I9V2 3A02A 1SAUA 2EA4A 3GFMA 3VDXA 2TCTA 2E71A 4M72A 2VC0A 4DJAA 2V1XA 3KETA 4G8XA 4ZTJA 3ZQLA 4HX7A 5IP6A 1SFUA 1TWCJ 1J7KA 3DBLB 2QSGX 4L9TA 5HNFA 1OFCX 3M1EA 3CCUI 2L9NA 1NTCA 4Y52J 1GDTA 4XRSG 4BGDA 5CJ9A 1SD4A 2Z1DA 5FLXZ 5E3OA 2DOEA 1G2HA 4R1HA 1RPWA 3KZZA 3PJRA 2FBKA 2NXNB 1RZ4A 3M1CA 3DPUA 4ON0A 5LBQA 1R58A 1XDSA 4FX4A 2L0KA 3RKYA 5M3FJ 1TT5B 3DTIA 3HSFA 1BW5A 3KEOA 1Y0UA 5LHHA 2EWNA 3KP7A 1XSVA 1ZG5A 1I1GA 5M5YJ 3H0GJ 4ZJZA 2WY7Q 5D5VB 2RGVA 2GA1A 2VJ4A 3FDYA 3HJEA 4OIRF 1G3TA 1Z0XA 3A01B 4I76A 1C0WA 4ZC3A 1I5ZA 5EG0B 2QENA 4M6YA 5JVGF 2JA8J 5HOOA 3BG3A 3FHNA 4KIGA 3ISPA 3I4MJ 1Z3XA 4X1EA 5ICCA 3BTIA 4U88A 3UNGC 1ENHA 3M3YJ 4UB8C 1AOYA 5E1WA 1VQ9I 5J1UA 3FKJA 4C3IJ 5HLGA 4IOAF 4UVAA 3PFIA 2DA3A 2RNJA 3JW4A 3DWLE 1CF7A 1HSJA 1STZA 2ELHA 4KA4A
chains in the Genus database with same CATH topology
2Z99A 5J8FA 3I4PA 4ENKA 3DP7A 2DPUA 4NQWA 1HSTA 1ODDA 1WWXA 3U9GA 4IHSA 2EFQA 4HDVA 2BYVE 2JSCA 3M9AA 1ZHFA 1XCVA 1K78B 3Q5FA 3EUHA 3EYIA 3L2CA 4DNCA 2E7WA 2QBYB 2LDUA 1QZYA 2KKOA 2H09A 5LHGA 4QWQA 3F72A 3E3VA 2PMUA 1J75A 3FXUA 1UFMA 1PP8F 2A07F 3E5XA 1MJAA 1LDKB 3SZPA 3V8KA 4EM1A 2A3SA 4ENNA 3E6BA 3RYPA 3GYHX 2D1HA 2NRAC 2JTVA 2RQPA 3T8TA 1P4AA 4CO8A 2E1NA 5FFZA 2GIVA 3F8BA 3TOAA 5K5RA 5J8CA 4IF4A 5F64A 2Q8KA 1OMIA 1GXPA 1T6SA 2H6BA 1T98A 4A0YA 1IAWA 3WTVC 1BI1A 1IXCA 2MH9A 1OYIA 1XGOA 1UHMA 1IW7F 3I0TA 2HTJA 1JE8A 2HS5A 5CVVA 5L3CA 4ZH4F 1YQAA 3MAJA 3I59B 3LQQA 5L3EA 4RAZA 1MJBA 2VT3A 3H3ZA 3MEXA 2FRHA 4B09A 2DLLA 2DK5A 4MNUA 4HF2A 4Y15A 1KQ0A 3KP4A 3GX4X 1A04A 2P5KA 3RYRA 3F3XA 3JTGA 4RGSA 1MKMA 3K69A 2UXXA 2QQ9A 1P6RA 4MQ9F 1BI2A 1FOKA 1H0MA 3ZP5A 1Z9CA 1O3TA 1FP1D 3V7RA 2XAGA 3F8NA 2EB7A 2HQRA 4M71A 4M6XA 2M45A 3FXRA 5HDKA 1KU3A 2ZNZA 1BOAA 2XAJA 4A12A 4OMZA 2YR2A 5LEKA 5LRSA 1JGSA 4LLGF 2HQNA 2OAZA 1RI7A 5H6QA 1W5TA 3B02A 4EVIA 4KIFA 2FQ3A 4GO1A 3WE2A 3PQJA 2V1UA 4N0BA 2CQKA 2RV8A 3RDIA 4HDUA 2H94A 1QBJA 1E17A 2RVCA 4D0PA 4UV8A 1F1ZA 2FU4A 1OPCA 5D8KB 2UXNA 2EFWA 4ENJA 1IXSB 1WKMA 4WK8F 3DF8A 3L9FA 1VTNC 5BQTA 4UUVA 2IVMA 5D5XB 3FMQA 5DCMA 4IHTA 4U7BA 1R5GA 1ZH5A 3QRFF 1BBYA 4LG0B 1Z6TA 4IRGA 1L3LA 2O03A 1O3SA 2W84A 1WQ2A 2FEZA 4G94A 4MHGA 4MEXF 1FNNA 3TDZC 2JT1A 3LAPA 4OIOF 3I64A 2K27A 5LGTA 2M8EA 2O61A 1R23A 3ABTA 3ZPLA 2XRNA 3G3ZA 2XAFA 4WWCA 5DUKA 3T1BA 3RPQA 4ZYGA 1K79A 1O57A 3QU3A 5LEJA 2KJBA 2FF4A 1RNLA 1K78A 1ZREA 1U5TB 2F5EA 4MEYF 3BDDA 1IN6A 2ISZA 1LB2A 3KEQA 1FWZA 3ZMZA 1D3YA 2DPDA 2QBYA 2A69F 3K1MA 3R4KA 2YPRA 4LFUA 1MGTA 4UV9A 1P92A 1S7AA 1LNWA 1GXQA 4BHPA 4PDKA 2ZMEB 3TGNA 1IRFA 4I0AA 4KFCA 3CJNA 4G9YA 2TDXA 2JPCA 4G6DA 1S29A 4NB5A 1KYZA 3R0AA 3FM3A 4U0YA 1BN5A 2EK5A 3WU0A 3V8LA 5CVJA 2FNAA 3ERED 4XSXF 1B9MA 1BIAA 3DPTA 1G3SA 2K4JA 1W7PD 4S05A 3KP6A 2ESNA 1TNSA 3WTYC 3T8RA 3BWGA 3ABUA 2CSOA 4UVBA 3HOSA 1G3WA 4N9IA 4ZYDA 1FBQA 2EV5A 1R1VA 3RJPA 2DTRA 1H9TA 2HOEA 3DXJF 2NNYA 1DPRA 3F8FA 3TKYA 2G7UA 1HW5A 4HX8A 3I53A 3FZVA 1G3YA 3I59A 4PGHA 1J9IA 4I09A 4NHJA 1ZGAA 3RKXA 2B0LA 2OZUA 1Z1DA 4HQEA 3NRVA 6PAXA 2ZKZA 1SAXA 1FPQA 3WTSC 2J5PA 4WX9A 5J6XA 1OYWA 1J59A 4OMYA 4HLYA 2LF8A 4R8HA 5BPDA 3O2PE 1PDNC 3CUOA 5H20A 3GF2A 4HBLA 1HW2A 3I71A 1E2XA 3KP5A 2LKPA 3TDUC 1LEAA 5L3GA 2FBIA 5L3FA 1X3UA 3TO7A 5IT9Z 3GXOA 1ON1A 1DPUA 2K86A 1HXDA 4K2EA 4WF2A 3WODF 2R7DA 1YFHA 2ZCWA 4I98B 3E6DA 2L4AA 4KICA 5LGNA 2VXZA 1KGSA 4L5IA 2Z3YA 4A6DA 4CDGA 3CLOA 4S04A 3GFJA 5E17F 3C3WA 3DQVC 3WTTC 3LQRA 1I1SA 1IXRC 2RKHA 3L09A 4HLXA 2PBIA 5E18F 3KP3A 3COAC 4CYDA 3WTWC 1WI9A 3GO5A 5E1XA 2O0YA 4ESBA 5ILUA 4U7DA 1KA8A 5HLHA 2R7FA 1GVJA 2HTSA 3F6OA 4CGZA 3V4GA 4LG0A 3DPLC 4L5JA 3P7NA 4JQFA 5HDGA 2MBFA 2BEOA 5IT9K 2MLGA 3ZMUA 3WGHA 4LLLA 5A2QZ 4HQMA 3P9KA 5DCMB 1FP2A 1UB9A 3EETA 3R6SA 4A5NA 3VB2A 1YLFA 3HYIA 1U5TA 4L18B 3M7GA 3RKWA 2IPQX 2KRFA 3K1NA 4IXAA 2DT5A 2VOPA 1XGNA 4M9XA 4QLCU 4GXOA 1I27A 2QM3A 2ZMEA 3CO7C 3JTHA 1Z05A 4HF0A 4Q47A 1KYWA 2L01A 3B73A 4CICA 3GW2A 3KLNA 3F22A 2ZNYA 3WTZA 1KU9A 4BH9A 3LSTA 4L0YB 4AD9A 1D8JA 1G4DA 4RGUA 2EA2A 4WXCA 2VBZA 3BOQA 4A5MA 2GXGA 1MD0A 3ZMSA 4KYWA 4IRHA 2CGPA 2EV6A 3CUQB 5FLXK 3K2ZA 2HEOA 2Y48A 4ZYEA 5JR3A 3HTSB 2LF7A 1ZGJA 1EH7A 1S8NA 2HGCA 3IC7A 2KJCA 5JI6A 1MJ9A 4HZFA 2MD5A 1IN4A 2QLZA 1BI3A 1PUEE 3HRTA 4LK0F 2XGXA 3HHHA 4G7OF 1BIBA 3E5UA 3N4MA 2AXLA 2FNPA 3KCCA 2IA2A 1YYVA 5ICGA 1HKQA 1XDUA 5ERIA 1SD7A 3ZN1A 1AWCA 4RB1A 1DP7P 2IW5A 3HRSA 1Z91A 2PI0A 3VOEA 5HS9A 1LDDA 1WSUA 1HKTA 4UXNA 4AIKA 3BJ6A 3E6CC 2M30A 1K7AA 4PGGA 4I2OA 1YW8A 4XLPF 4BNCA 2E7XA 3L00A 2GAUA 4LMYA 1R5HA 3J80Z 4PZJA 3HSEA 1J5YA 3U2RA 4YFKF 2OBPA 5H6RA 2NS0A 2W24A 4OINF 2A6HF 3HTUA 1FSEA 5HLIA 3NQOA 1R22A 2VBXA 4OU0A 2JZYA 1XSXA 3JSPA 1I6XA 4KMUX 2GZWA 1EH8A 3MZYA 1FSHA 2MLKA 4KMFA 4BAYA 1TLHB 2L3DA 1W7PB 2V1DA 1O7LA 3TO6A 3GZ6A 2QUFA 3KE2A 4IPAA 3DV8A 3IRRA 4IRIA 3JAMZ 3PQKA 3GLXA 1TQMA 4XBFA 3ZQ7A 2FA5A 5LHIA 2JRTA 2Q0OA 1ZRCA 5KK1A 2F2EA 5ED4A 5D4RA 2ISYA 2XIGA 1YO5C 1XD7A 1SFXA 2STWA 2HKXA 1B9NA 4A0ZA 2H6CA 1YG2A 3WE3A 3NEUA 4BHCA 2W85A 3F8MA 3J80K 4RAYA 2Z9OA 4KDPA 4U0WA 4YFXF 3FMRA 5DCFA 4EGYA 3M8EA 4ESJA 2P7VB 2CG4A 2IJLA 2LSOA 2COMA 1O7FA 1YS6A 1IF1A 2DBBA 4CXFA 3BROA 5D8LB 4BQAA 2VT2A 3QP6A 4KIBA 5DYMA 1XB4A 3T5XA 1HQCA 3QPHA 2HWVA 4YIFA 3IHUA 1H9GA 2PJPA 5D5UB 3JSOA 3JAMK 4WXHA 2XROA 2LNBA 5AONA 3MQ0A 3J81Z 3QP5A 1YW7A 2EFNA 3LWFA 3IKVA 3VODA 3J7AO 1ZLKA 3CUQA 4Z2YA 5FD6A 3I58A 1FY7A 1MZBA 2FSWA 2IT0A 2IA0A 2ETHA 4L9NA 5D4SA 5BMZA 4IJAA 2GWRA 2V79A 2NAZA 1LDJA 3GUDA 2MH2A 4DQ2A 3MZHA 4GGGA 2HYGD 1K6OA 1FZPB 2EV0A 2YX7A 3HUGA 3I54A 1F4KA 1FYLA 2DW4A 2M5WA 2ZBKA 2VN2A 4R79A 3H92A 2BGCA 3ULQB 3SXYA 2WWYA 3IRQA 5AIQA 1BI0A 4HV5A 2L02A 4LLNA 2AS5F 4LK1F 1P4WA 2P6SA 2PEXA 1U8RA 5JVTA 1NHAA 3BJOA 3C7JA 4EMSA 3KP2A 2H27A 4HOBA 3J81K 1F9NA 4HYEA 4GYIA 2Q2EA 3SQNA 3WG9A 2P5LC 4FX0A 1LVAA 2OD5A 4HA8A 4MQVA 4Y13A 1IRGA 5DV5A 5CYVA 4H0EA 2K02A 1SD6A 2PMHA 1W5SA 1SMYF 4I0BA 3TQNA 5IT3A 2BBYA 5LGUA 2Y75A 2V6CA 4PCQA 5FO5A 3KFWX 3VEPA 1BJAA 3WU1B 1U6GA 3DEUA 2J5OA 2FE3A 4YFNF 2VOOA 5HS7A 4N9HA 2GXBA 4EJWA 3LA2A 3FHZA 4A6EA 3ZMTA 2W57A 1QQIA 1W7PA 2Y0MA 1R36A 2QZ8A 4AIJA 2STTA 2KIUA 1PP7U 3O3KA 4I02A 4P9UA 2HKOA 2HFHA 2WTEA 3F6VA 1KU7A 2W25A 3OV8A 3TO9A 5D6FA 3BPXA 2F5FA 2HDCA 1T2KA 4ESFA 4OIPF 2FXAA 3DKWA 3HOTA 2GA2A 1U2WA 2HYFA 4KT5C 4UHTA 4G6QA 3EYYA 4UVCA 3HRUA 2YX4A 4YIIA 5DDGA 4L9VA 1ZG1A 3K9TA 2PQ8A 1RIOH 1QPMA 2DU9A 1J2XA 3SZTA 1XMAA 3WGGA 5FB2A 3KLOA 2K4BA 1R7JA 3ZN0A 4Q4ZF 2DQRA 3HHGA 3EDPA 2PN6A 2QYOA 2X4HA 3RIRA 1HKSA 1ULYA 1QZZA 5HDNA 2P8TA 3DFGA 3QPTA 4O5VA 4RGRA 1YIOA 1EH6A 5FGMA 1XCBA 2E1CA 2FMYA 3D0SA 2V9VA 4F7ZA 2PLYA 2YU3A 2C6YA 4P9FA 1S3JA 4P96A 2L4MA 3GEZA 3SFZA 1SD5A 1CGPA 4HF1A 5E20A 2QWWA 3OOPA 4KN4X 3HIFA 3W6JB 4AVPA 1Z7UA 2EJRA 1F5TA 4FHTA 4GYGA 2G7HA 4LD5A 1U5TC 1U3EM 1FYKA 5CVIA 1S6LA 5K1YA 1DDNA 1TQIA 4OIQF 1BC8C 3ECOA 1FYMA 4L9JA 4AWXB 3MWMA 2ZXJA 4EJVA 3ZMVA 1Z6RA 1ZAOA 5L3DA 4RB2C 2P6TA 3AAFA 2IP2A 1ONVA 5ILSA 1DUXC 1XN7A 2ZFWA 2HR3A 1FLIA 1D8KA 2G9WA 3HSRA 2QQAA 2MC3A 5A2QK 4IVNA 3E97A 4ENMA 4U0VA 2QQBA 3R61A 1BM9A 2UZKA 1MDMB 3BJAA 5CVRA 2VBWA 2VONA 1BC7C 2YSRA 3IWFA 4BXUA 5FFXA 5CLSA 1XGMA 1P4XA 4ZZDA 2O3FA 2OU2A 4A2UA 5K5OA 5LLQA 1QGPA 1HW1A 4M74A 3Q9SA 3F21A 2CWEA 1OKRA 1ZN2A 5JFRA 1P2FA 3GFLA 4ZZLA 2XVCA 2OQGA 1QO0D 4JBAA 4EV0A 1J0RA 1IZ1A 3FWEA 3K1PA 1FBSA 5D6EA 1EV7A 1V3FA 1T39A 4XRFA 4LJZF 1TBXA 3REOA 2Z5UA 1UCRA 1KU2A 2FBHA 1OYYA 2UWMA 4RB0A 2EFOA 2RC4A 1HBXG 1IN7A 1XMKA 4HV6A 4G7ZF 4JK1X 3I5UA 5ICFA 4KNYA 3WTUC 1ZLJA 5DD4A 4BHBA 3R60A 1O3QA 3GVAA 1V4RA 3V7SA 4Q5SF 1KQ9A 1L0OC 2BV6A 4MGRA 3P9IA 2VE9A 5K5QA 2XASA 1T38A 1R00A 2XAQA 1KQ8A 1LQ1A 2QVOA 3U1DA 5BPIA 2OZ6A 1LEBA 2VC1A 1IUYA 4WCGA 1TW2A 5D5WB 2O6GE 2WV0A 1ZARA 4E70A 3FMSA 3QAHA 2DQLA 1FBUA 3WTXC 3BPVA 1TTYA 3O6BB 4RS8A 3C1DA 3LFKA 3T0YA 4I01A 3Q9VA 3VFZA 1D5VA 3GWZA 1SMTA 2A68F 2RDPA 3CO6C 4EM0B 4B8XA 4ZYHA 5ILVA 2D2WA 1JHFA 5F1RA 2NNNA 2Z33A 3H3UA 3QOPA 2RN7A 2VE8A 4WXDA 3RTRA 2O8XA 2X0LA 1B59A 2PG4A 5DUIA 4Y17A 4GCVA 3IKTA 3TOBA 4O3MA 3LA7A 2HZTA 3G73A 3WGIA 4HW0A 1ON2A 1W4MA 3FM5A 4A0XA 1ZRDA 3LAJA 5LRRA 4G7HF 2IA1A 5KVRA 3BZ6A 1REPC 2VODA 2M1BA 4M9ZA 2EFPA 4EQQA 2A6EF 3SHFA 2DO7A 3F8CA 2VBYA 5L3BA 4BYYA 1FX7A 1UHWA 2CFXA 4P55A 4I7HA 5TRDA 1R1TA 1LJ9A 2ACJA 1S7OA 5E1ZB 5EEGA 4LB5A 4XLNF 5CVUA 2P5VA 2L54A 3ML6A 1MDMA 1WRJA 1YS7A 1FC3A 4Q48A 5EEHA 2IRFG 3MFKA 3GFIA 3F23A 1CF7B 1RUOA 3CUQC 2OA4A 4UNOA 4ASNA 1YW9A 3E5QA 2ADUA 2D45A 4ETSA 3HRMA 1JHHA 5BS6A 1FT9A 2BE5F 2FMLA 4HAMA 3E6MA 3W6KB 2F5DA 2XHKA 3MCZA 5E8GA 3ROUA 2CYYA 1TW3A 2ESHA 3FXQA 3KZYA 4RB3C 1R1UA 3D5LA 1B4AA 3BP8A 2XKPA 2XUBA 3GZ5A 3S2WA 5TJJA 3EQLF 1USTA 4EM2A 4LB6B 3V7CA 1USSA 3FF5A 5E8IA 4MTDA 1O3RA 2CW0F 4M9SA 1ZRFA 2D1VA 1IN8A 3P9CA 2A61A 1XGSA 3BY6A 4MTEA 5HS8A 2KIMA 2ZO4A 4P5OA 4EGZA 5DD8A 1OR7A 1G6NA 4YG2F 2PFBA 2KIFA 4TV7A 2XAHA 4HX4A 1TQPA 1XSDA 1TNTA 3IL2A 1QNTA 2F5CA 4CHUA 1ZG3A 2CO5A 2M87A 4AIHA 3R0JA 3LA3A 2DAOA 2MA3A 2NYXA 2ZJ2A 2P7CB 2DK8A 2DI3A 5ICEA 4L0ZB 5BOXA 3ELKA 1JXSA 3CDHA 3M8FA 4XSZF 2R3SA 1YTYA 4EJTA 3ECHA 1Q1HA 1U78A 1IN5A 4CZZA 3CTAA 1B6AA 5HVQC 4EJUA 3V8JA 3ZMDA 5AIPA 3RI4A 1RUNA 4KN7X 3K0LA 2A5YB 2FOKA 2XKOA 4M73A 3C18A 2WC2A 5JHUA 2JPBA 5FD5A 4EJOA 3L7WA 5DEQA 1SFEA 1GHCA 1T0FA 1B1BA 2P4WA 3IWZA 2OQRA 3N97A 3QU6A 4KUMA 2XV4S 4OOIA 4RGXA 2K7LA 3RPUA 1ZYRF 4O6JA 2DFIA 4FT8A 3FX3A 2GQQA 5F6FA 4LGWA 2EA4A 3GFMA 4M72A 2VC0A 2V1XA 3KETA 4G8XA 4HX7A 1SFUA 1J7KA 4L9TA 3M1EA 5CJ9A 1SD4A 5FLXZ 4R1HA 3KZZA 2FBKA 1RZ4A 4ON0A 5LBQA 1R58A 1XDSA 4FX4A 3RKYA 3HSFA 3KEOA 1Y0UA 5LHHA 2EWNA 3KP7A 1XSVA 1ZG5A 1I1GA 5D5VB 2RGVA 2GA1A 4OIRF 1G3TA 1C0WA 1I5ZA 2QENA 4M6YA 5HOOA 4KIGA 3ISPA 5ICCA 4U88A 1AOYA 5E1WA 5HLGA 4UVAA 3PFIA 2RNJA 3JW4A 1CF7A 1HSJA 1STZA 2ELHA 4KA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z99 A;  5J8F A;  3I4P A;  4ENK A;  3DP7 A;  2DPU A;  4NQW A;  1HST A;  1ODD A;  1WWX A;  3U9G A;  4IHS A;  2EFQ A;  4HDV A;  2BYV E;  2JSC A;  3M9A A;  1ZHF A;  1XCV A;  1K78 B;  3Q5F A;  3EUH A;  3EYI A;  3L2C A;  4DNC A;  2E7W A;  2QBY B;  2LDU A;  1QZY A;  2KKO A;  2H09 A;  5LHG A;  4QWQ A;  3F72 A;  3E3V A;  2PMU A;  1J75 A;  3FXU A;  1UFM A;  1PP8 F;  2A07 F;  3E5X A;  1MJA A;  1LDK B;  3SZP A;  3V8K A;  4EM1 A;  2A3S A;  4ENN A;  3E6B A;  3RYP A;  3GYH X;  2D1H A;  2NRA C;  2JTV A;  2RQP A;  3T8T A;  1P4A A;  4CO8 A;  2E1N A;  5FFZ A;  2GIV A;  3F8B A;  3TOA A;  5K5R A;  5J8C A;  4IF4 A;  5F64 A;  2Q8K A;  1OMI A;  1GXP A;  1T6S A;  2H6B A;  1T98 A;  4A0Y A;  1IAW A;  3WTV C;  1BI1 A;  1IXC A;  2MH9 A;  1OYI A;  1XGO A;  1UHM A;  1IW7 F;  3I0T A;  2HTJ A;  1JE8 A;  2HS5 A;  5CVV A;  5L3C A;  4ZH4 F;  1YQA A;  3MAJ A;  3I59 B;  3LQQ A;  5L3E A;  4RAZ A;  1MJB A;  2VT3 A;  3H3Z A;  3MEX A;  2FRH A;  4B09 A;  2DLL A;  2DK5 A;  4MNU A;  4HF2 A;  4Y15 A;  1KQ0 A;  3KP4 A;  3GX4 X;  1A04 A;  2P5K A;  3RYR A;  3F3X A;  3JTG A;  4RGS A;  1MKM A;  3K69 A;  2UXX A;  2QQ9 A;  1P6R A;  4MQ9 F;  1BI2 A;  1FOK A;  1H0M A;  3ZP5 A;  1Z9C A;  1O3T A;  1FP1 D;  3V7R A;  2XAG A;  3F8N A;  2EB7 A;  2HQR A;  4M71 A;  4M6X A;  2M45 A;  3FXR A;  5HDK A;  1KU3 A;  2ZNZ A;  1BOA A;  2XAJ A;  4A12 A;  4OMZ A;  2YR2 A;  5LEK A;  5LRS A;  1JGS A;  4LLG F;  2HQN A;  2OAZ A;  1RI7 A;  5H6Q A;  1W5T A;  3B02 A;  4EVI A;  4KIF A;  2FQ3 A;  4GO1 A;  3WE2 A;  3PQJ A;  2V1U A;  4N0B A;  2CQK A;  2RV8 A;  3RDI A;  4HDU A;  2H94 A;  1QBJ A;  1E17 A;  2RVC A;  4D0P A;  4UV8 A;  1F1Z A;  2FU4 A;  1OPC A;  5D8K B;  2UXN A;  2EFW A;  4ENJ A;  1IXS B;  1WKM A;  4WK8 F;  3DF8 A;  3L9F A;  1VTN C;  5BQT A;  4UUV A;  2IVM A;  5D5X B;  3FMQ A;  5DCM A;  4IHT A;  4U7B A;  1R5G A;  1ZH5 A;  3QRF F;  1BBY A;  4LG0 B;  1Z6T A;  4IRG A;  1L3L A;  2O03 A;  1O3S A;  2W84 A;  1WQ2 A;  2FEZ A;  4G94 A;  4MHG A;  4MEX F;  1FNN A;  3TDZ C;  2JT1 A;  3LAP A;  4OIO F;  3I64 A;  2K27 A;  5LGT A;  2M8E A;  2O61 A;  1R23 A;  3ABT A;  3ZPL A;  2XRN A;  3G3Z A;  2XAF A;  4WWC A;  5DUK A;  3T1B A;  3RPQ A;  4ZYG A;  1K79 A;  1O57 A;  3QU3 A;  5LEJ A;  2KJB A;  2FF4 A;  1RNL A;  1K78 A;  1ZRE A;  1U5T B;  2F5E A;  4MEY F;  3BDD A;  1IN6 A;  2ISZ A;  1LB2 A;  3KEQ A;  1FWZ A;  3ZMZ A;  1D3Y A;  2DPD A;  2QBY A;  2A69 F;  3K1M A;  3R4K A;  2YPR A;  4LFU A;  1MGT A;  4UV9 A;  1P92 A;  1S7A A;  1LNW A;  1GXQ A;  4BHP A;  4PDK A;  2ZME B;  3TGN A;  1IRF A;  4I0A A;  4KFC A;  3CJN A;  4G9Y A;  2TDX A;  2JPC A;  4G6D A;  1S29 A;  4NB5 A;  1KYZ A;  3R0A A;  3FM3 A;  4U0Y A;  1BN5 A;  2EK5 A;  3WU0 A;  3V8L A;  5CVJ A;  2FNA A;  3ERE D;  4XSX F;  1B9M A;  1BIA A;  3DPT A;  1G3S A;  2K4J A;  1W7P D;  4S05 A;  3KP6 A;  2ESN A;  1TNS A;  3WTY C;  3T8R A;  3BWG A;  3ABU A;  2CSO A;  4UVB A;  3HOS A;  1G3W A;  4N9I A;  4ZYD A;  1FBQ A;  2EV5 A;  1R1V A;  3RJP A;  2DTR A;  1H9T A;  2HOE A;  3DXJ F;  2NNY A;  1DPR A;  3F8F A;  3TKY A;  2G7U A;  1HW5 A;  4HX8 A;  3I53 A;  3FZV A;  1G3Y A;  3I59 A;  4PGH A;  1J9I A;  4I09 A;  4NHJ A;  1ZGA A;  3RKX A;  2B0L A;  2OZU A;  1Z1D A;  4HQE A;  3NRV A;  6PAX A;  2ZKZ A;  1SAX A;  1FPQ A;  3WTS C;  2J5P A;  4WX9 A;  5J6X A;  1OYW A;  1J59 A;  4OMY A;  4HLY A;  2LF8 A;  4R8H A;  5BPD A;  3O2P E;  1PDN C;  3CUO A;  5H20 A;  3GF2 A;  4HBL A;  1HW2 A;  3I71 A;  1E2X A;  3KP5 A;  2LKP A;  3TDU C;  1LEA A;  5L3G A;  2FBI A;  5L3F A;  1X3U A;  3TO7 A;  5IT9 Z;  3GXO A;  1ON1 A;  1DPU A;  2K86 A;  1HXD A;  4K2E A;  4WF2 A;  3WOD F;  2R7D A;  1YFH A;  2ZCW A;  4I98 B;  3E6D A;  2L4A A;  4KIC A;  5LGN A;  2VXZ A;  1KGS A;  4L5I A;  2Z3Y A;  4A6D A;  4CDG A;  3CLO A;  4S04 A;  3GFJ A;  5E17 F;  3C3W A;  3DQV C;  3WTT C;  3LQR A;  1I1S A;  1IXR C;  2RKH A;  3L09 A;  4HLX A;  2PBI A;  5E18 F;  3KP3 A;  3COA C;  4CYD A;  3WTW C;  1WI9 A;  3GO5 A;  5E1X A;  2O0Y A;  4ESB A;  5ILU A;  4U7D A;  1KA8 A;  5HLH A;  2R7F A;  1GVJ A;  2HTS A;  3F6O A;  4CGZ A;  3V4G A;  4LG0 A;  3DPL C;  4L5J A;  3P7N A;  4JQF A;  5HDG A;  2MBF A;  2BEO A;  5IT9 K;  2MLG A;  3ZMU A;  3WGH A;  4LLL A;  5A2Q Z;  4HQM A;  3P9K A;  5DCM B;  1FP2 A;  1UB9 A;  3EET A;  3R6S A;  4A5N A;  3VB2 A;  1YLF A;  3HYI A;  1U5T A;  4L18 B;  3M7G A;  3RKW A;  2IPQ X;  2KRF A;  3K1N A;  4IXA A;  2DT5 A;  2VOP A;  1XGN A;  4M9X A;  4QLC U;  4GXO A;  1I27 A;  2QM3 A;  2ZME A;  3CO7 C;  3JTH A;  1Z05 A;  4HF0 A;  4Q47 A;  1KYW A;  2L01 A;  3B73 A;  4CIC A;  3GW2 A;  3KLN A;  3F22 A;  2ZNY A;  3WTZ A;  1KU9 A;  4BH9 A;  3LST A;  4L0Y B;  4AD9 A;  1D8J A;  1G4D A;  4RGU A;  2EA2 A;  4WXC A;  2VBZ A;  3BOQ A;  4A5M A;  2GXG A;  1MD0 A;  3ZMS A;  4KYW A;  4IRH A;  2CGP A;  2EV6 A;  3CUQ B;  5FLX K;  3K2Z A;  2HEO A;  2Y48 A;  4ZYE A;  5JR3 A;  3HTS B;  2LF7 A;  1ZGJ A;  1EH7 A;  1S8N A;  2HGC A;  3IC7 A;  2KJC A;  5JI6 A;  1MJ9 A;  4HZF A;  2MD5 A;  1IN4 A;  2QLZ A;  1BI3 A;  1PUE E;  3HRT A;  4LK0 F;  2XGX A;  3HHH A;  4G7O F;  1BIB A;  3E5U A;  3N4M A;  2AXL A;  2FNP A;  3KCC A;  2IA2 A;  1YYV A;  5ICG A;  1HKQ A;  1XDU A;  5ERI A;  1SD7 A;  3ZN1 A;  1AWC A;  4RB1 A;  1DP7 P;  2IW5 A;  3HRS A;  1Z91 A;  2PI0 A;  3VOE A;  5HS9 A;  1LDD A;  1WSU A;  1HKT A;  4UXN A;  4AIK A;  3BJ6 A;  3E6C C;  2M30 A;  1K7A A;  4PGG A;  4I2O A;  1YW8 A;  4XLP F;  4BNC A;  2E7X A;  3L00 A;  2GAU A;  4LMY A;  1R5H A;  3J80 Z;  4PZJ A;  3HSE A;  1J5Y A;  3U2R A;  4YFK F;  2OBP A;  5H6R A;  2NS0 A;  2W24 A;  4OIN F;  2A6H F;  3HTU A;  1FSE A;  5HLI A;  3NQO A;  1R22 A;  2VBX A;  4OU0 A;  2JZY A;  1XSX A;  3JSP A;  1I6X A;  4KMU X;  2GZW A;  1EH8 A;  3MZY A;  1FSH A;  2MLK A;  4KMF A;  4BAY A;  1TLH B;  2L3D A;  1W7P B;  2V1D A;  1O7L A;  3TO6 A;  3GZ6 A;  2QUF A;  3KE2 A;  4IPA A;  3DV8 A;  3IRR A;  4IRI A;  3JAM Z;  3PQK A;  3GLX A;  1TQM A;  4XBF A;  3ZQ7 A;  2FA5 A;  5LHI A;  2JRT A;  2Q0O A;  1ZRC A;  5KK1 A;  2F2E A;  5ED4 A;  5D4R A;  2ISY A;  2XIG A;  1YO5 C;  1XD7 A;  1SFX A;  2STW A;  2HKX A;  1B9N A;  4A0Z A;  2H6C A;  1YG2 A;  3WE3 A;  3NEU A;  4BHC A;  2W85 A;  3F8M A;  3J80 K;  4RAY A;  2Z9O A;  4KDP A;  4U0W A;  4YFX F;  3FMR A;  5DCF A;  4EGY A;  3M8E A;  4ESJ A;  2P7V B;  2CG4 A;  2IJL A;  2LSO A;  2COM A;  1O7F A;  1YS6 A;  1IF1 A;  2DBB A;  4CXF A;  3BRO A;  5D8L B;  4BQA A;  2VT2 A;  3QP6 A;  4KIB A;  5DYM A;  1XB4 A;  3T5X A;  1HQC A;  3QPH A;  2HWV A;  4YIF A;  3IHU A;  1H9G A;  2PJP A;  5D5U B;  3JSO A;  3JAM K;  4WXH A;  2XRO A;  2LNB A;  5AON A;  3MQ0 A;  3J81 Z;  3QP5 A;  1YW7 A;  2EFN A;  3LWF A;  3IKV A;  3VOD A;  3J7A O;  1ZLK A;  3CUQ A;  4Z2Y A;  5FD6 A;  3I58 A;  1FY7 A;  1MZB A;  2FSW A;  2IT0 A;  2IA0 A;  2ETH A;  4L9N A;  5D4S A;  5BMZ A;  4IJA A;  2GWR A;  2V79 A;  2NAZ A;  1LDJ A;  3GUD A;  2MH2 A;  4DQ2 A;  3MZH A;  4GGG A;  2HYG D;  1K6O A;  1FZP B;  2EV0 A;  2YX7 A;  3HUG A;  3I54 A;  1F4K A;  1FYL A;  2DW4 A;  2M5W A;  2ZBK A;  2VN2 A;  4R79 A;  3H92 A;  2BGC A;  3ULQ B;  3SXY A;  2WWY A;  3IRQ A;  5AIQ A;  1BI0 A;  4HV5 A;  2L02 A;  4LLN A;  2AS5 F;  4LK1 F;  1P4W A;  2P6S A;  2PEX A;  1U8R A;  5JVT A;  1NHA A;  3BJO A;  3C7J A;  4EMS A;  3KP2 A;  2H27 A;  4HOB A;  3J81 K;  1F9N A;  4HYE A;  4GYI A;  2Q2E A;  3SQN A;  3WG9 A;  2P5L C;  4FX0 A;  1LVA A;  2OD5 A;  4HA8 A;  4MQV A;  4Y13 A;  1IRG A;  5DV5 A;  5CYV A;  4H0E A;  2K02 A;  1SD6 A;  2PMH A;  1W5S A;  1SMY F;  4I0B A;  3TQN A;  5IT3 A;  2BBY A;  5LGU A;  2Y75 A;  2V6C A;  4PCQ A;  5FO5 A;  3KFW X;  3VEP A;  1BJA A;  3WU1 B;  1U6G A;  3DEU A;  2J5O A;  2FE3 A;  4YFN F;  2VOO A;  5HS7 A;  4N9H A;  2GXB A;  4EJW A;  3LA2 A;  3FHZ A;  4A6E A;  3ZMT A;  2W57 A;  1QQI A;  1W7P A;  2Y0M A;  1R36 A;  2QZ8 A;  4AIJ A;  2STT A;  2KIU A;  1PP7 U;  3O3K A;  4I02 A;  4P9U A;  2HKO A;  2HFH A;  2WTE A;  3F6V A;  1KU7 A;  2W25 A;  3OV8 A;  3TO9 A;  5D6F A;  3BPX A;  2F5F A;  2HDC A;  1T2K A;  4ESF A;  4OIP F;  2FXA A;  3DKW A;  3HOT A;  2GA2 A;  1U2W A;  2HYF A;  4KT5 C;  4UHT A;  4G6Q A;  3EYY A;  4UVC A;  3HRU A;  2YX4 A;  4YII A;  5DDG A;  4L9V A;  1ZG1 A;  3K9T A;  2PQ8 A;  1RIO H;  1QPM A;  2DU9 A;  1J2X A;  3SZT A;  1XMA A;  3WGG A;  5FB2 A;  3KLO A;  2K4B A;  1R7J A;  3ZN0 A;  4Q4Z F;  2DQR A;  3HHG A;  3EDP A;  2PN6 A;  2QYO A;  2X4H A;  3RIR A;  1HKS A;  1ULY A;  1QZZ A;  5HDN A;  2P8T A;  3DFG A;  3QPT A;  4O5V A;  4RGR A;  1YIO A;  1EH6 A;  5FGM A;  1XCB A;  2E1C A;  2FMY A;  3D0S A;  2V9V A;  4F7Z A;  2PLY A;  2YU3 A;  2C6Y A;  4P9F A;  1S3J A;  4P96 A;  2L4M A;  3GEZ A;  3SFZ A;  1SD5 A;  1CGP A;  4HF1 A;  5E20 A;  2QWW A;  3OOP A;  4KN4 X;  3HIF A;  3W6J B;  4AVP A;  1Z7U A;  2EJR A;  1F5T A;  4FHT A;  4GYG A;  2G7H A;  4LD5 A;  1U5T C;  1U3E M;  1FYK A;  5CVI A;  1S6L A;  5K1Y A;  1DDN A;  1TQI A;  4OIQ F;  1BC8 C;  3ECO A;  1FYM A;  4L9J A;  4AWX B;  3MWM A;  2ZXJ A;  4EJV A;  3ZMV A;  1Z6R A;  1ZAO A;  5L3D A;  4RB2 C;  2P6T A;  3AAF A;  2IP2 A;  1ONV A;  5ILS A;  1DUX C;  1XN7 A;  2ZFW A;  2HR3 A;  1FLI A;  1D8K A;  2G9W A;  3HSR A;  2QQA A;  2MC3 A;  5A2Q K;  4IVN A;  3E97 A;  4ENM A;  4U0V A;  2QQB A;  3R61 A;  1BM9 A;  2UZK A;  1MDM B;  3BJA A;  5CVR A;  2VBW A;  2VON A;  1BC7 C;  2YSR A;  3IWF A;  4BXU A;  5FFX A;  5CLS A;  1XGM A;  1P4X A;  4ZZD A;  2O3F A;  2OU2 A;  4A2U A;  5K5O A;  5LLQ A;  1QGP A;  1HW1 A;  4M74 A;  3Q9S A;  3F21 A;  2CWE A;  1OKR A;  1ZN2 A;  5JFR A;  1P2F A;  3GFL A;  4ZZL A;  2XVC A;  2OQG A;  1QO0 D;  4JBA A;  4EV0 A;  1J0R A;  1IZ1 A;  3FWE A;  3K1P A;  1FBS A;  5D6E A;  1EV7 A;  1V3F A;  1T39 A;  4XRF A;  4LJZ F;  1TBX A;  3REO A;  2Z5U A;  1UCR A;  1KU2 A;  2FBH A;  1OYY A;  2UWM A;  4RB0 A;  2EFO A;  2RC4 A;  1HBX G;  1IN7 A;  1XMK A;  4HV6 A;  4G7Z F;  4JK1 X;  3I5U A;  5ICF A;  4KNY A;  3WTU C;  1ZLJ A;  5DD4 A;  4BHB A;  3R60 A;  1O3Q A;  3GVA A;  1V4R A;  3V7S A;  4Q5S F;  1KQ9 A;  1L0O C;  2BV6 A;  4MGR A;  3P9I A;  2VE9 A;  5K5Q A;  2XAS A;  1T38 A;  1R00 A;  2XAQ A;  1KQ8 A;  1LQ1 A;  2QVO A;  3U1D A;  5BPI A;  2OZ6 A;  1LEB A;  2VC1 A;  1IUY A;  4WCG A;  1TW2 A;  5D5W B;  2O6G E;  2WV0 A;  1ZAR A;  4E70 A;  3FMS A;  3QAH A;  2DQL A;  1FBU A;  3WTX C;  3BPV A;  1TTY A;  3O6B B;  4RS8 A;  3C1D A;  3LFK A;  3T0Y A;  4I01 A;  3Q9V A;  3VFZ A;  1D5V A;  3GWZ A;  1SMT A;  2A68 F;  2RDP A;  3CO6 C;  4EM0 B;  4B8X A;  4ZYH A;  5ILV A;  2D2W A;  1JHF A;  5F1R A;  2NNN A;  2Z33 A;  3H3U A;  3QOP A;  2RN7 A;  2VE8 A;  4WXD A;  3RTR A;  2O8X A;  2X0L A;  1B59 A;  2PG4 A;  5DUI A;  4Y17 A;  4GCV A;  3IKT A;  3TOB A;  4O3M A;  3LA7 A;  2HZT A;  3G73 A;  3WGI A;  4HW0 A;  1ON2 A;  1W4M A;  3FM5 A;  4A0X A;  1ZRD A;  3LAJ A;  5LRR A;  4G7H F;  2IA1 A;  5KVR A;  3BZ6 A;  1REP C;  2VOD A;  2M1B A;  4M9Z A;  2EFP A;  4EQQ A;  2A6E F;  3SHF A;  2DO7 A;  3F8C A;  2VBY A;  5L3B A;  4BYY A;  1FX7 A;  1UHW A;  2CFX A;  4P55 A;  4I7H A;  5TRD A;  1R1T A;  1LJ9 A;  2ACJ A;  1S7O A;  5E1Z B;  5EEG A;  4LB5 A;  4XLN F;  5CVU A;  2P5V A;  2L54 A;  3ML6 A;  1MDM A;  1WRJ A;  1YS7 A;  1FC3 A;  4Q48 A;  5EEH A;  2IRF G;  3MFK A;  3GFI A;  3F23 A;  1CF7 B;  1RUO A;  3CUQ C;  2OA4 A;  4UNO A;  4ASN A;  1YW9 A;  3E5Q A;  2ADU A;  2D45 A;  4ETS A;  3HRM A;  1JHH A;  5BS6 A;  1FT9 A;  2BE5 F;  2FML A;  4HAM A;  3E6M A;  3W6K B;  2F5D A;  2XHK A;  3MCZ A;  5E8G A;  3ROU A;  2CYY A;  1TW3 A;  2ESH A;  3FXQ A;  3KZY A;  4RB3 C;  1R1U A;  3D5L A;  1B4A A;  3BP8 A;  2XKP A;  2XUB A;  3GZ5 A;  3S2W A;  5TJJ A;  3EQL F;  1UST A;  4EM2 A;  4LB6 B;  3V7C A;  1USS A;  3FF5 A;  5E8I A;  4MTD A;  1O3R A;  2CW0 F;  4M9S A;  1ZRF A;  2D1V A;  1IN8 A;  3P9C A;  2A61 A;  1XGS A;  3BY6 A;  4MTE A;  5HS8 A;  2KIM A;  2ZO4 A;  4P5O A;  4EGZ A;  5DD8 A;  1OR7 A;  1G6N A;  4YG2 F;  2PFB A;  2KIF A;  4TV7 A;  2XAH A;  4HX4 A;  1TQP A;  1XSD A;  1TNT A;  3IL2 A;  1QNT A;  2F5C A;  4CHU A;  1ZG3 A;  2CO5 A;  2M87 A;  4AIH A;  3R0J A;  3LA3 A;  2DAO A;  2MA3 A;  2NYX A;  2ZJ2 A;  2P7C B;  2DK8 A;  2DI3 A;  5ICE A;  4L0Z B;  5BOX A;  3ELK A;  1JXS A;  3CDH A;  3M8F A;  4XSZ F;  2R3S A;  1YTY A;  4EJT A;  3ECH A;  1Q1H A;  1U78 A;  1IN5 A;  4CZZ A;  3CTA A;  1B6A A;  5HVQ C;  4EJU A;  3V8J A;  3ZMD A;  5AIP A;  3RI4 A;  1RUN A;  4KN7 X;  3K0L A;  2A5Y B;  2FOK A;  2XKO A;  4M73 A;  3C18 A;  2WC2 A;  5JHU A;  2JPB A;  5FD5 A;  4EJO A;  3L7W A;  5DEQ A;  1SFE A;  1GHC A;  1T0F A;  1B1B A;  2P4W A;  3IWZ A;  2OQR A;  3N97 A;  3QU6 A;  4KUM A;  2XV4 S;  4OOI A;  4RGX A;  2K7L A;  3RPU A;  1ZYR F;  4O6J A;  2DFI A;  4FT8 A;  3FX3 A;  2GQQ A;  5F6F A;  4LGW A;  2EA4 A;  3GFM A;  4M72 A;  2VC0 A;  2V1X A;  3KET A;  4G8X A;  4HX7 A;  1SFU A;  1J7K A;  4L9T A;  3M1E A;  5CJ9 A;  1SD4 A;  5FLX Z;  4R1H A;  3KZZ A;  2FBK A;  1RZ4 A;  4ON0 A;  5LBQ A;  1R58 A;  1XDS A;  4FX4 A;  3RKY A;  3HSF A;  3KEO A;  1Y0U A;  5LHH A;  2EWN A;  3KP7 A;  1XSV A;  1ZG5 A;  1I1G A;  5D5V B;  2RGV A;  2GA1 A;  4OIR F;  1G3T A;  1C0W A;  1I5Z A;  2QEN A;  4M6Y A;  5HOO A;  4KIG A;  3ISP A;  5ICC A;  4U88 A;  1AOY A;  5E1W A;  5HLG A;  4UVA A;  3PFI A;  2RNJ A;  3JW4 A;  1CF7 A;  1HSJ A;  1STZ A;  2ELH A;  4KA4 A; 
#chains in the Genus database with same CATH topology
 2Z99 A;  1V54 H;  5J8F A;  1X2M A;  3I4P A;  4ENK A;  4CUG A;  3DP7 A;  2VXD A;  2DPU A;  1NG6 A;  4NQW A;  1HST A;  1ODD A;  1DU0 A;  1WWX A;  3U9G A;  4IHS A;  2IGO A;  3L2U A;  1WH5 A;  1GLN A;  2EFQ A;  4HDV A;  2BYV E;  2JSC A;  3F0C A;  3M9A A;  3MD2 A;  2EH3 A;  1BJZ A;  1MSE C;  1ZHF A;  1XCV A;  1K78 B;  1OCT C;  3Q5F A;  3EUH A;  3BQY A;  3PFY A;  4YEJ A;  3EYI A;  3L2C A;  4DNC A;  2E7W A;  3IH3 A;  2W7N A;  4UY8 I;  2QBY B;  4GDF A;  5EF6 A;  3NAU A;  3OIP A;  2LDU A;  1U8B A;  1QZY A;  2KKO A;  1ZR2 A;  2H09 A;  3HZJ A;  3J7A Y;  5LHG A;  4QWQ A;  2R7S A;  2BY2 A;  3PIP F;  2DT6 A;  1VQP I;  2G0E A;  4OWR B;  1W1W E;  3E3V A;  3F72 A;  3HGG A;  4QPQ A;  1CQT A;  3K10 A;  2PMU A;  1J75 A;  3FXU A;  2X6Y A;  3GTP J;  1UFM A;  3PNY A;  3K7A J;  1PP8 F;  2A07 F;  1W5C C;  3SDG A;  3E5X A;  3IAS 2;  1MJA A;  1LDK B;  3H5R A;  3SZP A;  3V8K A;  4EM1 A;  3HXL A;  4A3C J;  2A3S A;  4XOT A;  4QSH A;  4ENN A;  3E6B A;  3RYP A;  1FOX A;  1HF0 A;  3GYH X;  1GUU A;  2D1H A;  5TIS C;  5E3N A;  2NRA C;  3VSK A;  2JTV A;  2RQP A;  3T8T A;  2EZL A;  1P4A A;  4CO8 A;  2E1N A;  5IYD J;  5FFZ A;  3K4L A;  3GLL A;  2L7Z A;  4IQ4 A;  5JLW A;  4NC8 A;  2PMZ A;  2GIV A;  3IP4 B;  4BDY A;  4PJM A;  4E7J A;  3F8B A;  3TOA A;  1ETY A;  5K5R A;  5J8C A;  1Y1W J;  2R5Y B;  4IF4 A;  5IYC J;  5F64 A;  3ZGK A;  3LSP A;  2Q8K A;  2E2J J;  1OMI A;  1Z7L A;  1GXP A;  1T6S A;  2H6B A;  1T98 A;  4A0Y A;  2W4S A;  1ETW A;  5GAD J;  5K7H A;  1BI1 A;  4II2 A;  3WTV C;  1IXC A;  2MH9 A;  1OYI A;  2M8G X;  2NVQ J;  1XGO A;  3LSH A;  2F4O B;  4HG2 A;  3BCA A;  1B8I A;  1UHM A;  3S93 A;  2R7Q A;  1I6H J;  4XLC A;  2ZSI B;  1IW7 F;  2W48 A;  3I0T A;  4NDL A;  2DFF A;  4C2U A;  2HTJ A;  1APL C;  3S2H J;  2DTZ A;  4XKW A;  4BQO A;  1JE8 A;  2EPF A;  2HS5 A;  5CVV A;  5L3C A;  4QPO A;  4ZH4 F;  3CCL I;  2JUG A;  4RM3 A;  1YQA A;  3H9G A;  3I59 B;  3MAJ A;  4A3D J;  3ZQH A;  3LQQ A;  5L3E A;  2DDA A;  4RAZ A;  2KLO A;  5EZG A;  1MJB A;  2VT3 A;  2L7F P;  3H3Z A;  4N4O B;  3MEX A;  3FXK A;  4E7K A;  2FRH A;  4B09 A;  2DLL A;  2Y0S A;  2R5Z A;  2DK5 A;  1GT0 C;  2ZJP F;  4KJZ A;  4MNU A;  4QIW N;  4HF2 A;  3OL3 A;  1W36 D;  3G71 I;  4Y15 A;  3S14 J;  1KQ0 A;  3KP4 A;  3GX4 X;  1A04 A;  2P5K A;  3RYR A;  2JA7 J;  3F3X A;  3FXM A;  3DKY A;  3JTG A;  1VND A;  4RGS A;  1MKM A;  4BQN A;  4DZP A;  3K69 A;  2UXX A;  4XN3 A;  5H2F C;  3D5R C;  2QQ9 A;  1P6R A;  4MQ9 F;  4FAS D;  1Z3Y A;  1BI2 A;  1FOK A;  1H0M A;  3ZP5 A;  4B48 A;  4HEA 2;  1Z9C A;  4E7H A;  2M3A A;  3KPH A;  1FP1 D;  3CDI A;  1O3T A;  3V7R A;  2M7A A;  2XAG A;  3F8N A;  2EB7 A;  2B9S A;  2I5U A;  2HQR A;  1Y1V J;  1ORK A;  2W00 A;  4M71 A;  4M6X A;  3LSK A;  2M45 A;  3QPS A;  3JCU C;  4IX7 A;  4C2T A;  3A03 A;  1DP3 A;  3FXR A;  5HDK A;  1YX5 A;  2YS9 A;  1KU3 A;  1WI3 A;  3GME A;  3VYS B;  2ZNZ A;  1BOA A;  4MFE A;  4BJ6 C;  2XAJ A;  4A12 A;  4OMZ A;  2LOO A;  2YR2 A;  2Y69 H;  3PSI A;  5LEK A;  5LRS A;  2R7W A;  2YU9 J;  2W82 A;  1JGS A;  2Y30 A;  2HQN A;  4LLG F;  2OAZ A;  4Z6Y A;  1RI7 A;  5H6Q A;  1W5T A;  3B02 A;  4EVI A;  4KIF A;  4BXX J;  4HNV A;  4FIS A;  2FQ3 A;  1AKH B;  4GO1 A;  3WE2 A;  3PQJ A;  2V1U A;  2VKV A;  4N0B A;  2CQK A;  2RV8 A;  5B3S H;  1SFO J;  1W0T A;  1I39 A;  3RDI A;  4HDU A;  5J1R A;  2H94 A;  3BG7 A;  1QBJ A;  1E17 A;  4HNU A;  1D0Z A;  2BVL A;  1R4N B;  4J01 A;  2RVC A;  2OCE A;  4D0P A;  4BL0 B;  4UV8 A;  1ETO A;  3ZXS A;  1F1Z A;  4MLO A;  1VQM I;  2FU4 A;  5DM6 F;  4B47 A;  2HZD A;  3HM5 A;  3K4M A;  3FBI B;  2E2I J;  3EUK L;  1OPC A;  5D8K B;  5J1Y A;  2UXN A;  2EFW A;  4DW6 A;  4ENJ A;  3SZG A;  5IOZ A;  3CCS I;  1IXS B;  1WKM A;  4WK8 F;  2QF7 A;  3DF8 A;  3L9F A;  1VTN C;  5BQT A;  4UUV A;  2IVM A;  2LRD A;  2XGD A;  5D5X B;  3UKG A;  3AL0 C;  5FKO A;  1LPQ A;  3FMQ A;  2R7R A;  2COB A;  5DCM A;  2L2O A;  4RLF A;  4IHT A;  2E5Z A;  4U7B A;  1R5G A;  2ELJ A;  3DLA A;  3PSF A;  5GP9 A;  3S3M A;  3TED A;  4KIT B;  3LSJ A;  1ZH5 A;  2MW8 A;  3QRF F;  1BBY A;  4BXF A;  3A01 A;  3U21 A;  4LG0 B;  3GTM J;  1Y8R B;  2BZT A;  2KMU A;  1Z6T A;  4IRG A;  1L3L A;  2O03 A;  1O3S A;  2W84 A;  1WQ2 A;  2FEZ A;  4G94 A;  4MHG A;  4MEX F;  1FNN A;  3TDZ C;  5IP7 J;  2JT1 A;  3LAP A;  2K3P A;  4OIO F;  2R7T A;  3I64 A;  2JA2 A;  2K27 A;  3GZN B;  2M8E A;  5LGT A;  3K2A A;  4XOR A;  3CCV I;  1H89 C;  2O61 A;  4RAF A;  1R23 A;  3ABT A;  3ZPL A;  2XRN A;  3G3Z A;  2K9M A;  2XAF A;  4JX4 A;  4WWC A;  5DUK A;  3T1B A;  3RPQ A;  4ZYG A;  4HNT A;  1K79 A;  3SEQ A;  1O57 A;  3QU3 A;  4ZYA A;  2K3F A;  5LEJ A;  2L9S A;  2KJB A;  2FF4 A;  1ZR4 A;  1RNL A;  3MZ8 A;  1K78 A;  1ZRE A;  1U5T B;  1LFP A;  2F5E A;  4MEY F;  3BDD A;  3CP2 A;  1IN6 A;  2RNG A;  2ISZ A;  2CMP A;  1IDZ A;  3OYH A;  1LB2 A;  3KEQ A;  1FWZ A;  3ZMZ A;  1D3Y A;  3G1M A;  2DPD A;  2QBY A;  2A69 F;  3B6A A;  3K1M A;  3R4K A;  1EA3 A;  2YPR A;  4MIM A;  4LFU A;  2CS3 A;  1MGT A;  1O4X A;  2Z2S B;  4UV9 A;  1P92 A;  4DGW B;  1S7A A;  3QYB A;  1LNW A;  3LSR A;  1IUF A;  1GXQ A;  4BHP A;  4PDK A;  2ZME B;  2DA4 A;  2LK2 A;  3CLQ A;  5GTI C;  1TWA J;  3TGN A;  1IRF A;  4I0A A;  4KFC A;  2B7E A;  3CJN A;  4G9Y A;  4NQW B;  3JRD A;  1T56 A;  2ZSH B;  2TDX A;  3BT9 A;  2JPC A;  1X4P A;  4G6D A;  4C3H J;  4CCM A;  1S29 A;  4NB5 A;  1XMX A;  3I55 I;  1KYZ A;  4BY7 J;  1MH4 A;  3FM3 A;  3R0A A;  4U0Y A;  3AFH A;  1BN5 A;  2EK5 A;  3WU0 A;  3V8L A;  5CVJ A;  2M7B A;  2FNA A;  3ERE D;  2X85 A;  3OYN A;  4XSX F;  1B9M A;  4LIT A;  1BIA A;  3ASN H;  3DPT A;  4JOM A;  4ITV A;  1G3S A;  5HNH A;  5J3L A;  2K4J A;  4JX6 A;  4BDZ A;  3ERM A;  1W7P D;  4S05 A;  1M1E B;  1X2N A;  3Q0W A;  3KP6 A;  1H8A C;  2ESN A;  1TNS A;  1VQ7 I;  2R5Y A;  4E4H A;  3S32 A;  3WTY C;  2KDO A;  2UV1 A;  2XDV A;  5M5W J;  3GCM A;  3T8R A;  3SFI A;  3BWG A;  3ABU A;  2CSO A;  4UVB A;  3HOS A;  1B72 B;  1G3W A;  5GPC A;  4N9I A;  4ZYD A;  1FBQ A;  2EV5 A;  4AVZ A;  1R1V A;  2WY8 Q;  4PUS A;  2WAF A;  3RJP A;  2DTR A;  1H9T A;  3PUB A;  1E3P A;  2HOE A;  3DXJ F;  2QSH X;  2NNY A;  2H8R A;  1DPR A;  3F8F A;  5LFA A;  3TKY A;  2G7U A;  1R71 A;  1HW5 A;  3LNQ A;  4HX8 A;  3I53 A;  2ECC A;  1G3Y A;  3FZV A;  3I59 A;  4XQF A;  4PGH A;  1J9I A;  4I09 A;  3BG9 A;  2OTJ I;  2CH0 A;  1ZGA A;  4NHJ A;  1SFK A;  2R7U A;  3RKX A;  3FXO A;  2B0L A;  3I3L A;  2OZU A;  2M4G A;  2BXZ A;  1Z1D A;  2DT7 B;  4HQE A;  2BOL A;  2CW7 A;  3BZK A;  1YHQ I;  3NRV A;  5FLM J;  6PAX A;  2ZKZ A;  1SAX A;  1FPQ A;  4BAC A;  3WTS C;  1YJ9 I;  2KRC A;  3ZQG A;  2DA5 A;  2J5P A;  3G2B A;  4WX9 A;  2LMD A;  5J6X A;  1OYW A;  1J59 A;  4OMY A;  5EDN A;  4HLY A;  2LF8 A;  3RQI A;  1U9O A;  4R8H A;  5BPD A;  3G1L A;  3BR1 A;  3O2P E;  1YIT I;  1PDN C;  4F52 A;  3M8J A;  4BE2 A;  3ONQ A;  3CUO A;  4H4K C;  5H20 A;  4C30 A;  3A0B C;  4AM3 A;  3GF2 A;  4HBL A;  1HW2 A;  1E0E A;  1LUJ B;  1HA8 A;  1SAN A;  2LTP A;  1OR7 C;  3I71 A;  3CCE I;  4PFP A;  1E2X A;  3KP5 A;  2IS4 A;  1S5L C;  5B1B H;  2LKP A;  3TDU C;  1LEA A;  5L3G A;  2VPL A;  2EIL H;  2FBI A;  3UR3 C;  2XC7 A;  2LKX A;  5L3F A;  1X3U A;  3TO7 A;  3W3C A;  3GXO A;  1ON1 A;  2KDZ A;  2R5Z B;  2K86 A;  5IT9 Z;  1HXD A;  1DPU A;  3H36 A;  4K2E A;  4WF2 A;  3GTO J;  4FTH A;  3WOD F;  2R7D A;  1YFH A;  3EUA A;  2L9V A;  1MMD A;  2ZCW A;  4I98 B;  3FK6 A;  2GBY A;  1EJ9 A;  2ZC2 A;  5C4J J;  1R5I D;  2FOW A;  2LYC A;  1FTZ A;  3S3N A;  3E6D A;  5F0F A;  1AKH A;  2L4A A;  2H1L A;  3ABK H;  2V4J C;  2CV0 A;  2EQR A;  4KIC A;  3TBI A;  5LGN A;  3L2Q A;  2VXZ A;  2XGE A;  1KGS A;  4A3I J;  2XSJ C;  4IQJ A;  2LH9 A;  1W0U A;  2CU7 A;  3ZOB A;  4L5I A;  2Z3Y A;  4AUX A;  1UJ8 A;  4A6D A;  2ZXW H;  4CDG A;  2MD0 A;  3CLO A;  4KT6 A;  4S04 A;  3GFJ A;  3RSN A;  5E17 F;  3C3W A;  3DQV C;  3WTT C;  1E3O C;  1KZH A;  2X1C A;  3WU2 C;  3LQR A;  3L2R A;  1X3Z B;  2ZJR F;  1YJW I;  2VL8 A;  4CCO A;  1I1S A;  3KX2 A;  1IXR C;  2RKH A;  3BLY A;  3L09 A;  4HLX A;  2E5N A;  2PBI A;  3DTE A;  3ZCO A;  1BA5 A;  5E18 F;  4E7Z A;  3KP3 A;  3COA C;  4CYD A;  2QEX I;  1VQ6 I;  3WTW C;  1WI9 A;  2F4I A;  2ID3 A;  3GO5 A;  2KZV A;  2X51 A;  3TW7 A;  3NWT A;  1XS9 A;  3ZQC A;  3JRC A;  5E1X A;  3S1Q J;  2O0Y A;  4ESB A;  2EBI A;  5ILU A;  4U7D A;  1KA8 A;  5HLH A;  4LIV A;  3DKX A;  2IBD A;  2R7F A;  1GVJ A;  2HTS A;  3F6O A;  3AG4 H;  4CGZ A;  4F3Q A;  4CZC A;  3V4G A;  4LG0 A;  3DPL C;  1T0F C;  4L5J A;  4XKB A;  3P7N A;  4JQF A;  2LRE A;  2MBF A;  5HDG A;  4ZTF A;  2IAI A;  1TL8 A;  4G6T B;  1D5Y A;  1JKR C;  2BEO A;  4LOC A;  5IT9 K;  3IAM 2;  3IUO A;  3OYA A;  3SEZ A;  4DYR A;  2MLG A;  2M34 A;  3ZMU A;  3WGH A;  2N8G A;  4LLL A;  4IEJ A;  5A2Q Z;  1IV8 A;  2E19 A;  2R93 J;  4HQM A;  1K83 J;  3P9K A;  2B63 J;  5DCM B;  3S1N J;  1FP2 A;  2OPT A;  1UB9 A;  3I56 I;  3KYL A;  3HL2 A;  3EET A;  3R6S A;  4A5N A;  4M3D A;  4XLE A;  3VB2 A;  1YLF A;  3MMY B;  3HYI A;  1WJD A;  3OYC A;  1U5T A;  4L18 B;  5KNL A;  5FKL A;  3M7G A;  3CZ6 A;  3QOE A;  1D0Y A;  4U87 A;  3RKW A;  3LFU A;  2IPQ X;  3AG2 H;  5B5E C;  5EYR A;  3OYE A;  2KRF A;  3K1N A;  2AXT C;  4IXA A;  2DT5 A;  2VOP A;  1X4O A;  3LSM A;  2H1K A;  1XGN A;  3HOY J;  3OYJ A;  2XPV A;  4M9X A;  4QLC U;  2R7Z J;  1A36 A;  1QVU A;  4HPQ A;  3BCB A;  3HBL A;  1MBH A;  4GXO A;  3S1R J;  1I27 A;  2QM3 A;  2L7K A;  2ZME A;  3CO7 C;  1D1A A;  3JTH A;  1Z05 A;  4HF0 A;  4XR6 A;  4Q47 A;  1KYW A;  2E1O A;  2L01 A;  1JI8 A;  3B73 A;  1XG1 A;  3ZR8 X;  4CIC A;  3GW2 A;  5FJ8 J;  3KLN A;  3F22 A;  2ZNY A;  3WTZ A;  2NOG A;  1HLV A;  4NBQ A;  2A6T A;  1OCO H;  2DYS H;  1KU9 A;  3NWS A;  3OYB A;  4BH9 A;  3HOW J;  3K70 C;  2HDD A;  2ID6 A;  1ETK A;  3OS1 A;  1K4T A;  4F91 B;  3LST A;  4MO7 A;  3FIW A;  2CUE A;  1HCR A;  4L0Y B;  4AD9 A;  1D8J A;  1G4D A;  4I99 C;  4RGU A;  3O8G A;  2EA2 A;  4WXC A;  1QHH D;  3S8P A;  2VBZ A;  3BOQ A;  2RQQ A;  2DN0 A;  2GXG A;  4A5M A;  1MD0 A;  3ZMS A;  2CRG A;  2PJR B;  4KYW A;  4IRH A;  2CGP A;  4BKX A;  1R9T J;  2EV6 A;  1B72 A;  3HPH A;  3CUQ B;  2BY3 A;  5FLX K;  3LMM A;  2OF7 A;  2E60 A;  4PSW A;  1K4S A;  3HKZ N;  3K2Z A;  2HEO A;  2Y48 A;  3EUH C;  3SYT A;  1NK2 P;  1X1C A;  4ZYE A;  5JR3 A;  3HTS B;  2LF7 A;  4RLQ A;  2V26 A;  3W2A A;  1ZGJ A;  1EH7 A;  1S8N A;  2HGC A;  3IC7 A;  4UUT A;  2KJC A;  5E3M A;  4RA2 A;  5JI6 A;  4BJ5 C;  1MJ9 A;  3H5N A;  4HZF A;  2MD5 A;  4UB6 C;  1IN4 A;  1UZC A;  4D5F A;  2QLZ A;  4XLA A;  2OC6 A;  1BI3 A;  3QYE A;  1PUE E;  2FJ1 A;  1VI0 A;  2IXS A;  3HRT A;  4LK0 F;  5GAH J;  4BE0 A;  3FIS A;  2XGX A;  3HHH A;  3HUG B;  2DDB A;  4G7O F;  3PUF A;  1H88 C;  4IOC F;  1BIB A;  3E5U A;  2LY2 A;  3N4M A;  1MMG A;  2AXL A;  2CFO A;  2DA1 A;  2R7X A;  3OOU A;  2FNP A;  3S3O A;  1XPX A;  4IHY A;  2VUM J;  3KCC A;  2R0Q C;  4PSX A;  2OUM A;  2IA2 A;  1YYV A;  2KHM A;  3GTJ J;  2LVS A;  1TZL A;  3WHC A;  1EF4 A;  3RZD J;  5ICG A;  1HKQ A;  1XDU A;  3N05 A;  5CKT A;  1E3H A;  4A3M J;  3BC8 A;  5ERI A;  1SD7 A;  2MG4 A;  3VWB A;  3ZN1 A;  1IV6 A;  1AWC A;  4RB1 A;  2XPU A;  1WJA A;  1DP7 P;  3HC7 A;  2IW5 A;  3CCR I;  3HRS A;  1Z91 A;  2PI0 A;  3VOE A;  5HS9 A;  1LDD A;  2HOA A;  1WSU A;  1HKT A;  1OJL A;  1UG2 A;  4UXN A;  2ICW G;  4AIK A;  4B44 A;  1U0J A;  3BJ6 A;  3E6C C;  2M30 A;  1JJ6 C;  4A3E J;  4M6V A;  2V1N A;  1K7A A;  4PGG A;  4I2O A;  4E7S A;  2K40 A;  1N78 A;  3LOC A;  1YW8 A;  4A69 C;  4XLP F;  1AHD P;  4CCJ A;  3D5S C;  2Q2E B;  1A35 A;  2JA5 J;  4BNC A;  5KHD A;  2E7X A;  1MW7 A;  3L00 A;  2GAU A;  2ME0 A;  2CV2 A;  2LP0 A;  4LMY A;  4V19 K;  1VQ8 I;  1R5H A;  3J80 Z;  3OS0 A;  4PZJ A;  1T95 A;  2BW3 A;  5FKM A;  1FOW A;  3HSE A;  2ELK A;  4PJL A;  1RR7 A;  2F48 A;  4B1R A;  1J5Y A;  3KIO A;  3MVP A;  3U2R A;  4YFK F;  2OBP A;  1MH3 A;  5H6R A;  2NS0 A;  2XAU A;  3BTJ A;  2W24 A;  4NC6 A;  4OIN F;  4S0H B;  2VKE A;  2A6H F;  1RKT A;  3HTU A;  1FSE A;  5HLI A;  3CMM A;  2VJI A;  3NQO A;  4ZDO A;  1Q1V A;  1R22 A;  2VBX A;  4OU0 A;  2JZY A;  1XSX A;  4BS9 A;  4IKF A;  3JSP A;  2IS1 A;  2KRH A;  3ZRG A;  1I6X A;  4KMU X;  2AO9 A;  2GZW A;  4D7M A;  2DXI A;  1EH8 A;  3Q3S A;  4CCL A;  3MZY A;  1FSH A;  1S9H A;  2MLK A;  4KMF A;  2XPW A;  2F5V A;  2M0C A;  1V5F A;  1TLH B;  4BAY A;  2L3D A;  1W7P B;  2V1D A;  2JRM A;  1O7L A;  3TO6 A;  3GZ6 A;  3G1O A;  2QUF A;  3KE2 A;  1PJR A;  1I3A A;  4IPA A;  3DV8 A;  3IRR A;  1BL0 A;  4IRI A;  1BR2 A;  3JAM Z;  1N75 A;  3PQK A;  3GLX A;  2Z16 A;  1MMN A;  1TQM A;  3ASO H;  3IH4 A;  4XBF A;  3ZQ7 A;  2FA5 A;  5LHI A;  2XRL A;  5DTD A;  2JRT A;  2Q0O A;  1ZRC A;  1Y6I A;  4A3J J;  5KK1 A;  2F2E A;  5ED4 A;  3PNT A;  3L1P A;  1VQO I;  5D4R A;  2ISY A;  3DLL F;  2XIG A;  3KZI C;  1YO5 C;  1XD7 A;  2V7F A;  2FUG 2;  2NVU B;  1UMQ A;  1SFX A;  2STW A;  2HKX A;  2NS8 A;  3CJQ B;  4F55 A;  3W2V A;  2KIS A;  1MMS A;  1B9N A;  2X9D A;  4A0Z A;  4A3K J;  2H6C A;  1YG2 A;  2P0W A;  3WE3 A;  3HDD A;  2LFB A;  3H35 A;  3NEU A;  2E1M B;  1VQK I;  4BHC A;  2W85 A;  3F8M A;  3J80 K;  2R4G A;  4RAY A;  2Z9O A;  4KDP A;  2BY0 A;  1DGR M;  4U0W A;  3DTK A;  4YFX F;  3FMR A;  3DEW A;  4RM2 A;  5DCF A;  3M8E A;  4EGY A;  4ESJ A;  1HC8 A;  1SEU A;  2VJ5 A;  2DYR H;  1WGX A;  2P7V B;  3MN2 A;  2QA4 I;  1AA7 A;  1JKQ C;  2CG4 A;  2KL4 A;  2IJL A;  2CV1 A;  4IHX A;  2LSO A;  2COM A;  2X1E A;  1O7F A;  1YS6 A;  5J40 A;  1IF1 A;  2DBB A;  4CXF A;  1PVE A;  3HOX J;  3BRO A;  5D8L B;  3H0D A;  4BQA A;  3CMY A;  2VT2 A;  2Y2Z A;  3QP6 A;  4KIB A;  5EGO B;  1TWH J;  1XB4 A;  2EZK A;  5DYM A;  3T5X A;  3ZQQ A;  1F43 A;  1WJB A;  2HVQ A;  3W2W A;  1HQC A;  1W36 C;  4N4N B;  4IL6 C;  3CCM I;  3QPH A;  5E3L A;  3FXL A;  2ZFU A;  3DCF A;  2HWV A;  1LE8 B;  1FTT A;  1WJC A;  3C2B A;  1D0X A;  4PJN A;  4YIF A;  3IHU A;  1H9G A;  2PJP A;  4B3A A;  5J47 A;  5D5U B;  5M3M J;  3JSO A;  3JAM K;  1R4M B;  1BOB A;  4AYB N;  4WXH A;  3DEE A;  4JX5 A;  2XRO A;  2OTL I;  2WA0 A;  2LNB A;  2IS6 A;  3MKZ A;  5AON A;  3MQ0 A;  2F6C A;  5IYB J;  3J81 Z;  3QP5 A;  1YW7 A;  4BE1 A;  2VJJ A;  2EFN A;  1S72 I;  4DBQ A;  4XN0 A;  1LFU P;  3LWF A;  3S17 J;  2PJR A;  3IKV A;  2HQA A;  3VOD A;  1D1B A;  3J7A O;  4L5E A;  1ZLK A;  3CUQ A;  4Z2Y A;  5FD6 A;  3AKZ A;  1FEX A;  3I58 A;  1FY7 A;  2JSP A;  1QPI A;  3CCJ I;  1MZB A;  4HST A;  2FSW A;  1YX3 A;  4C3J J;  2IT0 A;  1YOV B;  4PK4 A;  2IA0 A;  2ETH A;  4DZJ A;  2ZXI A;  1A6I A;  4L9N A;  1MSF C;  5D4S A;  1LFB A;  2DMU A;  5BMZ A;  4IJA A;  3G4S I;  2GWR A;  4IO9 F;  2V79 A;  2NAZ A;  1LDJ A;  3GUD A;  1Y8Q B;  2MH2 A;  1K6Y A;  2Q1Z B;  3DBR B;  3FK7 A;  4PFO A;  1YRN B;  2GLO A;  1U9N A;  2IGN A;  3HPG A;  1X1A A;  4DQ2 A;  3MZH A;  2HXO A;  4X6A J;  3CP8 A;  3RQ4 A;  4GGG A;  2HYG D;  4XON A;  1MND A;  1K6O A;  4FE7 A;  1FZP B;  3L2W A;  2NVT J;  2EV0 A;  2MC4 A;  2YX7 A;  3HUG A;  3OYG A;  3I54 A;  1ETQ A;  1F4K A;  1FYL A;  2DW4 A;  2M5W A;  2CQX A;  5FRM A;  2ZBK A;  2VN2 A;  4R79 A;  2HPI A;  3H92 A;  2BGC A;  3ULQ B;  4E7I A;  3SXY A;  2WWY A;  2XGC A;  2KQR A;  1MBE A;  3AG3 H;  3IRQ A;  5AIQ A;  1BI0 A;  4HV5 A;  1I3Q J;  2L02 A;  4LLN A;  2AS5 F;  4LK1 F;  3TL4 X;  1MMA A;  1P4W A;  1QZE A;  2EZH A;  1TT0 A;  2P6S A;  2PEX A;  5JVT A;  1U8R A;  1NHA A;  3BJO A;  2JN6 A;  3C7J A;  2QKL B;  4EMS A;  2BXY A;  3HGY A;  5LD2 C;  2EIN H;  1DU6 A;  3KP2 A;  4PJ0 C;  4BY1 J;  1VFC A;  4HOB A;  2H27 A;  1ETX A;  3J81 K;  1F9N A;  4HYE A;  3AG1 H;  5F08 A;  4XKV A;  3GTK J;  3OMY A;  4J00 A;  3BR6 A;  5C3E J;  1MBG A;  2ZXH A;  1DQU A;  2DMT A;  3IH2 A;  4GYI A;  2CUZ A;  3OYI A;  2Q2E A;  3SQN A;  3CC2 I;  4IHV A;  2NOJ B;  1X3W B;  2FX0 A;  3E7L A;  1ZK8 A;  3WG9 A;  1P9Q C;  3HEF A;  3SDB A;  4BBS J;  4PJJ A;  2DA2 A;  2P5L C;  5F0C A;  4FX0 A;  1LVA A;  3L2V A;  1PUF B;  2OD5 A;  1ERD A;  1A5J A;  4HA8 A;  4MQV A;  4Y13 A;  1IRG A;  5DV5 A;  2VI6 A;  5CYV A;  4H0E A;  2NVX J;  2DJN A;  2K02 A;  1SD6 A;  2L9R A;  2PMH A;  1W5S A;  1SMY F;  4I0B A;  3ABM H;  3TQN A;  5IT3 A;  2BBY A;  5GAG J;  2D5V A;  2W1O A;  1IGN A;  5LGU A;  1RC9 A;  2MYS A;  2Y75 A;  4W1U A;  2V6C A;  4PCQ A;  5FO5 A;  3TW6 A;  3KFW X;  3VEP A;  2M0M A;  1BJA A;  2ME6 A;  1U6G A;  3WU1 B;  3PIO F;  2E36 A;  3DEU A;  2J5O A;  4CYC A;  1Y0N A;  3OYK A;  2FE3 A;  4YFN F;  3X2Q H;  3KYC B;  1BR1 A;  2VOO A;  5HS7 A;  1RKW A;  4N9H A;  2ECB A;  4A93 J;  2GXB A;  4EJW A;  3BTC A;  3LA2 A;  3VYU B;  1P7J A;  3FHZ A;  1UG0 A;  4A6E A;  3ZMT A;  1RES A;  2W57 A;  1QQI A;  1W7P A;  4CCN A;  2Y0M A;  1R36 A;  2BW3 B;  1QRY A;  2X6X A;  2QZ8 A;  3Q0U A;  4DBR A;  4AIJ A;  1SC7 A;  2STT A;  2KIU A;  5J4Y A;  3H9Q A;  1FMV A;  3D1N I;  2GOM A;  1PP7 U;  3O3K A;  1XC5 A;  4I02 A;  3QOD A;  2HKO A;  2HFH A;  4P9U A;  2WTE A;  3F6V A;  3CES A;  2W25 A;  2DOA A;  3HB9 A;  3JRA A;  1KU7 A;  3OV8 A;  3TO9 A;  5D6F A;  1OQY A;  3BPX A;  4RAG A;  4IZZ A;  2F5F A;  4XRM A;  3OSF A;  2HDC A;  1T2K A;  4ESF A;  4OIP F;  1RR8 C;  2XF5 A;  1WJE A;  2FXA A;  3DKW A;  4D1Q A;  3H9J A;  3HOT A;  3QQA A;  2GA2 A;  1U2W A;  2HNH A;  2O8K A;  2HYF A;  4KT5 C;  2WAE A;  2DMN A;  4ANJ A;  4UHT A;  4G6Q A;  3VYR B;  3EYY A;  4UVC A;  1WHU A;  1WJ5 A;  2YX4 A;  3HRU A;  4YII A;  5DDG A;  2E35 A;  4E6K G;  4L9V A;  5IOY A;  1QU3 A;  1ZG1 A;  3K9T A;  2PQ8 A;  1RIO H;  1QPM A;  2DU9 A;  1J2X A;  3SZT A;  4P1W A;  2IS2 A;  1BR4 A;  1YI2 I;  4CCK A;  1XMA A;  3WGG A;  5FB2 A;  3KLO A;  1X1B A;  2LY1 A;  2K4B A;  3A1Y A;  1R7J A;  1IO2 A;  3ZN0 A;  4Q4Z F;  2DQR A;  1UHS A;  2RAE A;  3HHG A;  2NS7 A;  3EDP A;  3FXJ A;  2PN6 A;  2QYO A;  2X4H A;  1UEL B;  3RIR A;  1HKS A;  2M4K A;  3V42 A;  1ULY A;  2OJE D;  3GTL J;  1QZZ A;  5EGO A;  4DIQ A;  2HOT A;  5HDN A;  3AL0 B;  2P8T A;  3DFG A;  3QPT A;  4O5V A;  1X19 A;  4RGR A;  1YIO A;  2YUS A;  1EH6 A;  5FGM A;  1XCB A;  1G59 A;  1LE8 A;  2E1C A;  1OCC H;  3PL8 A;  4XKC A;  2FMY A;  1IRZ A;  4XIC A;  2TRT A;  2X6W A;  5GPA A;  1IAW A;  3D0S A;  2V9V A;  4F7Z A;  2PLY A;  4X0G A;  2YU3 A;  2C6Y A;  5JHF A;  1OCZ H;  2WAQ N;  4P9F A;  1S3J A;  2CUJ A;  4P96 A;  2X48 A;  1QHG A;  2L4M A;  3GEZ A;  4YEL A;  3RZO J;  2OCC H;  1GVD A;  3SFZ A;  1XTA A;  1SD5 A;  1CGP A;  4HF1 A;  2JVG A;  4B4C A;  5E20 A;  2XB5 A;  2QWW A;  5K7Z A;  3OOP A;  4KN4 X;  3HIF A;  2LR8 A;  3W6J B;  1JJ8 C;  4AVP A;  1Z7U A;  5K7F A;  2EJR A;  3JRG A;  3LSG A;  1F5T A;  4FHT A;  5B66 C;  5EJC A;  3OR2 C;  4GYG A;  2G7H A;  4LD5 A;  1U5T C;  1U3E M;  3BZC A;  1FYK A;  4Y7N J;  5CVI A;  4RDU A;  1S6L A;  2X6O A;  3G6E I;  3WG7 H;  3K4B A;  5K1Y A;  4UUS B;  1TQI A;  1DDN A;  4OIQ F;  3M07 A;  2O9L A;  2MGQ A;  1BC8 C;  3ECO A;  1FYM A;  1DGW Y;  1R6R A;  1ZKG A;  1IDY A;  1WVR A;  4B3X A;  1WCM J;  4L9J A;  4AWX B;  2GIZ A;  3MWM A;  1YRN A;  2ZXJ A;  2GM4 A;  4EJV A;  1VQN I;  2PX9 A;  3ZMV A;  1Z6R A;  1ZAO A;  2NVY J;  5L3D A;  3VPR A;  4RB2 C;  2ZME C;  2P6T A;  4F92 B;  3AAF A;  2IP2 A;  1ONV A;  5ILS A;  3PM1 A;  3K4C A;  3S15 J;  1DUX C;  3BTL A;  1XN7 A;  2ZFW A;  2HR3 A;  5FKK A;  1FLI A;  1D8K A;  2G9W A;  2WB1 N;  3HSR A;  2QCO A;  3OR1 C;  2QQA A;  4KIS A;  3BG5 A;  2MC3 A;  5A2Q K;  4IVN A;  2QSF X;  3E97 A;  4ENM A;  4U0V A;  2QQB A;  5FKN A;  3A4C A;  3R61 A;  1GV2 A;  1VZ0 A;  1BM9 A;  5HLT A;  1TP4 A;  1XX5 A;  2Y9Z A;  2UZK A;  4JP0 A;  4BEH B;  3W6V A;  1MDM B;  2KT0 A;  2JWT A;  3BJA A;  4Y4R A;  2VBW A;  5CVR A;  2VON A;  5CQG A;  1BC7 C;  4XK4 A;  2KPM A;  1T8I A;  1TWG J;  5F1J A;  2YSR A;  1TWF J;  2K9N A;  2Y31 A;  3IWF A;  2MSY A;  4BXU A;  5FFX A;  5CLS A;  1Y39 A;  1ETV A;  4HSR A;  3B6C A;  4D7N A;  3J7Z I;  1XGM A;  4I6Z A;  1P4X A;  3E1S A;  4ZZD A;  3TP3 A;  3E0J B;  2LBF B;  1NG7 A;  2O3F A;  2OU2 A;  3JRI A;  4AYB A;  4A2U A;  5K5O A;  5LLQ A;  1GV5 A;  1T33 A;  1QGP A;  2K85 A;  1HW1 A;  4M74 A;  1X58 A;  2L5Q A;  3Q9S A;  2LLK A;  3OWT A;  3F21 A;  2CWE A;  1OKR A;  3BR5 A;  3CME I;  3A0H C;  3S1M J;  1ZN2 A;  5JFR A;  1YIJ I;  4XM3 A;  1P2F A;  4A3G J;  4EAT A;  2BY1 A;  4FE4 A;  3GFL A;  9ANT A;  1TC3 C;  2IGK A;  1PUF A;  1RET A;  2L7M P;  4ZZL A;  2XVC A;  3TP0 A;  1MNM C;  2OQG A;  1QO0 D;  2UUZ A;  4JYK A;  4NUB A;  4JBA A;  2HYJ A;  2CW8 A;  2JMW A;  2MFZ A;  1J0R A;  4EV0 A;  1IZ1 A;  2FQ4 A;  2HU9 A;  3FWE A;  3K1P A;  1FBS A;  5D6E A;  5EZH A;  2V6E A;  1EV7 A;  1ITY A;  3FBN B;  4LG3 A;  1V3F A;  2P81 A;  1T39 A;  1AU7 A;  3BR3 A;  4XRF A;  3U1K A;  1NH3 A;  4LJZ F;  1MBJ A;  1TBX A;  3REO A;  1OLT A;  2DOD A;  2Z5U A;  1UCR A;  2DOF A;  1JT0 A;  1KU2 A;  2FBH A;  5E79 C;  1OYY A;  2UWM A;  3MKL A;  4RB0 A;  4XRS A;  2EFO A;  2RC4 A;  1HBX G;  4EEF G;  1IN7 A;  2I8D A;  3JRE A;  1Z77 A;  1XMK A;  4C2M J;  2DA6 A;  4HV6 A;  4OAZ A;  4G7Z F;  4JK1 X;  3I5U A;  1T08 B;  2R7V A;  5ICF A;  1JUP A;  2QGU A;  4KNY A;  2HVS A;  3GTG J;  4DYQ A;  3WTU C;  2JQ7 A;  4LIU A;  2EIK H;  2M9H A;  3F9K A;  1ZLJ A;  5DD4 A;  1IJW C;  4II3 A;  4BHB A;  2DCE A;  4C9Y A;  4YRV A;  3R60 A;  1O3Q A;  3CCY A;  2VQL A;  1ZGW A;  3GVA A;  1V4R A;  3V7S A;  4Q5S F;  1KQ9 A;  1L0O C;  3OYL A;  2VB6 A;  2BV6 A;  2DJI A;  4MGR A;  3P9I A;  5DM7 F;  3RCO A;  2WBM A;  1WPK A;  3CC7 I;  3H1C A;  2VE9 A;  3M4O J;  5K5Q A;  2XAS A;  2O7O A;  1T38 A;  1R00 A;  4XID A;  4CYC B;  3BR0 A;  2XAQ A;  1KQ8 A;  2EIM H;  2VKH A;  1LQ1 A;  1G8X A;  1PYV A;  4D5C A;  1A6Q A;  2QVO A;  3U1D A;  5BPI A;  2KFD A;  1JUS A;  2OZ6 A;  2V9P A;  1MNE A;  2A5W A;  3QPL A;  2WV1 A;  2DMQ A;  3CJR B;  4BQQ A;  1LEB A;  1BW6 A;  2K9L A;  3K4N A;  1ACI A;  2VC1 A;  1IUY A;  3OIO A;  1TW2 A;  4WCG A;  5D5W B;  2LY9 A;  3OSG A;  2O6G E;  2WV0 A;  1ZAR A;  4E70 A;  5M5X J;  3FMS A;  3OS2 A;  3CCQ I;  3QAH A;  2DQL A;  3GBG A;  3ZQI A;  1FBU A;  3BQZ A;  3WTX C;  4GFB A;  3BPV A;  1TTY A;  3O6B B;  3J7Y J;  4M3B A;  4RS8 A;  1VQL I;  3C1D A;  3LFK A;  3T0Y A;  2EIJ H;  4I01 A;  2MAB A;  1FIP A;  1FOY A;  3Q9V A;  3VFZ A;  1D5V A;  2CQ7 A;  2HDW A;  3GWZ A;  2O5R A;  1SMT A;  2A68 F;  2E34 A;  1FJL A;  2RDP A;  3K4K A;  4EM0 B;  3CO6 C;  4B8X A;  4ZYH A;  1JKP C;  3ZQF A;  5F0H A;  4CSW A;  3C2H A;  2BHY A;  2DFH A;  3H3V K;  1N25 A;  5ILV A;  5DS9 A;  2D2W A;  1JHF A;  1OCP A;  5F1R A;  2GOX B;  2NNN A;  2Z33 A;  1LVK A;  4D9J A;  3P5J A;  3H3U A;  3QOP A;  2RN7 A;  2VE8 A;  1UAA A;  1EKE A;  4Y33 A;  4WXD A;  2LG4 A;  1WJF A;  3RTR A;  2O8X A;  2X0L A;  2WAD A;  1B59 A;  2PG4 A;  5DUI A;  3A2K A;  4Y17 A;  3HG9 A;  3O8H A;  4V2F A;  1K61 A;  3K6G A;  4GCV A;  2DFE A;  3IKT A;  3TOB A;  4O3M A;  2CQQ A;  3LA7 A;  2HZT A;  3IV5 A;  4AC0 A;  3G73 A;  3WGI A;  2BHZ A;  4HW0 A;  1ON2 A;  1W4M A;  3FM5 A;  4A0X A;  3ESW B;  4A3L J;  1ZRD A;  3S16 J;  4DOZ A;  3LAJ A;  5LRR A;  4G7H F;  1HOM A;  2X1D A;  3MKY B;  5EG0 A;  3PNV A;  2IA1 A;  2QQ8 A;  1X1D A;  4J19 A;  4UUS A;  1POG A;  5IPA A;  1X1P A;  2HOS A;  5KVR A;  3BZ6 A;  1REP C;  2VOD A;  2M1B A;  4M9Z A;  2EFP A;  1ZEL A;  3OYD A;  3OIQ A;  4EQQ A;  2A6E F;  2VKD A;  3SHF A;  2DO7 A;  3CF2 A;  1YJN I;  2ZB9 A;  3F8C A;  2VBY A;  1JGG A;  4ZDP A;  5L3B A;  4BYY A;  2PMZ N;  2K5C A;  5J4V A;  1FX7 A;  1UHW A;  2CFX A;  4P55 A;  4RBO A;  2VQH A;  4I7H A;  4FQG A;  2EZI A;  1V5G A;  1Z21 A;  2XSD C;  2VLA A;  5TRD A;  2KP6 A;  2IGM A;  2VQG A;  5IP9 J;  4DYC A;  1R1T A;  5B1A H;  2JUC A;  3CDL A;  3BR2 A;  4CA0 A;  4QTR A;  1LJ9 A;  2ACJ A;  4IHW A;  1S7O A;  1ZTR A;  5E1Z B;  5EEG A;  4F93 B;  5CQE A;  2JJ7 A;  4LB5 A;  5KAI C;  4XLN F;  5CVU A;  2P5V A;  1Y56 A;  2L54 A;  3OL4 A;  3ML6 A;  4BEH A;  1MDM A;  1WRJ A;  1YS7 A;  3EPZ A;  2HVR A;  3S2D J;  1FC3 A;  2LKS A;  4Q48 A;  3MKW B;  1A31 A;  3KEY A;  5EEH A;  4BUP A;  3MFK A;  2IRF G;  3GTQ J;  1JT6 A;  2K9S A;  3GFI A;  3F23 A;  1CF7 B;  1RRJ A;  3OY9 A;  1RUO A;  3CUQ C;  2OA4 A;  4UNO A;  1OIS A;  4ASN A;  3I4N J;  3DBH B;  5CPR B;  1YW9 A;  3E5Q A;  3NAR A;  2LBF A;  3JRH A;  3JRF A;  2WAQ A;  4XNF A;  2Y0S N;  1VF9 A;  2ADU A;  2D45 A;  3CD6 I;  4ETS A;  3HRM A;  3Q0V A;  4OAY A;  1JHH A;  5BS6 A;  1FT9 A;  5IY5 H;  4M3F A;  2XF6 A;  2JVH A;  1QVT A;  1MBK A;  2BE5 F;  4M3E A;  2FML A;  1FMW A;  1P7I A;  2VAS A;  3E6M A;  4HAM A;  5KCM A;  3OYF A;  3BG6 A;  1Z67 A;  3W6K B;  2F5D A;  1VQ4 I;  4B43 A;  2XHK A;  3MCZ A;  2R7O A;  5GTH C;  2BVM A;  3CQZ J;  5E8G A;  2R92 J;  2AQE A;  2FD5 A;  3ROU A;  1IRX A;  1TW3 A;  1YE9 A;  2CYY A;  2ESH A;  3FXQ A;  1OCR H;  3KZY A;  1R1U A;  4RB3 C;  3JRB A;  2RRE A;  3D5L A;  1I50 J;  1B4A A;  3LL7 A;  5GAE J;  4V2G A;  1V5E A;  1IC8 A;  4XMY A;  3BP8 A;  4FCY A;  2XKP A;  3PO2 J;  2XUB A;  3GZ5 A;  3S2W A;  1WH7 A;  4BBR J;  2AQF A;  5TJJ A;  3EQL F;  1UST A;  4XLF A;  3CC4 I;  4Y3O A;  4EM2 A;  1MIJ A;  3PO3 J;  4LB6 B;  3V7C A;  1USS A;  5JLX A;  5FRO A;  3QWL A;  3KYD B;  4M3G A;  5TGT A;  2LC2 A;  4RMN A;  3FF5 A;  2HQ5 A;  3LSI A;  2JA6 J;  1J09 A;  5E8I A;  2VQC A;  2CUF A;  4MTD A;  1O3R A;  1MBF A;  3HOU J;  2CW0 F;  4M9S A;  1ZRF A;  2D1V A;  1IN8 A;  5FRN A;  3P9C A;  2E2H J;  2A61 A;  3HOZ J;  2H8W A;  1R49 A;  3RPU D;  1XGS A;  3BY6 A;  3CJT B;  3CMA I;  1VQ5 I;  4MTE A;  5HS8 A;  2I10 A;  2KIM A;  2ZO4 A;  3FKI J;  4G12 A;  4P5O A;  4EGZ A;  2WB1 A;  2LD5 A;  4XL9 A;  2HI3 A;  3ABL H;  5DD8 A;  1OR7 A;  3DU6 A;  1G6N A;  1JUM A;  4A3B J;  4YG2 F;  2PFB A;  2KIQ A;  3HKZ A;  2KIF A;  4TV7 A;  4XOP A;  1JKO C;  2XAH A;  1B8I B;  4HX4 A;  1N77 A;  1TQP A;  1WFX A;  1XSD A;  1TNT A;  5F27 A;  1V55 H;  2OV7 A;  4MFD A;  3IL2 A;  1KON A;  1QNT A;  2F5C A;  4CHU A;  3H5A A;  3VYT B;  3OYM A;  1ZG3 A;  2CO5 A;  2M87 A;  4AIH A;  3R0J A;  3LA3 A;  2DAO A;  2MA3 A;  5HOD A;  2NYX A;  2VIX A;  3RKQ A;  2AHQ A;  2F4M B;  1S7E A;  5EEA A;  1JTX A;  1JTY A;  2ZJ2 A;  2P7C B;  2DK8 A;  2DI3 A;  5ICE A;  4L0Z B;  4AU7 A;  1F36 A;  5BOX A;  2A05 A;  2CJJ A;  3ELK A;  1JXS A;  3CDH A;  4E7L A;  4AID A;  2ZJQ F;  3M8F A;  4ZDL A;  4XSZ F;  2R3S A;  4A3F J;  1YTY A;  1SVM A;  4EJT A;  3ECH A;  4CH7 A;  3VSL A;  1Q1H A;  1U78 A;  1IN5 A;  4CZZ A;  2GXA A;  3HOV J;  3CTA A;  1B6A A;  1SVL A;  4FET A;  3K70 D;  4BJT A;  5F04 A;  2DA7 A;  4NC7 A;  5HVQ C;  4EJU A;  2V9K A;  3V8J A;  3ZMD A;  5AIP A;  5C4X J;  3RI4 A;  1RUN A;  4KN7 X;  2Y9Y A;  2XF7 A;  4HRI A;  1WZ2 A;  3K0L A;  2A5Y B;  2FOK A;  2XKO A;  1IG7 A;  2HXI A;  4GRI A;  4M73 A;  3C2G A;  4BU2 A;  3C18 A;  1FIA A;  3WHB A;  2WC2 A;  5JHU A;  2JPB A;  5FD5 A;  4EJO A;  2CQN A;  3L7W A;  5DEQ A;  2KZG A;  5C44 J;  3TMO A;  2IEK A;  4XLH A;  1SFE A;  2QKM B;  1GHC A;  2XB0 X;  3CF5 F;  1T0F A;  1B1B A;  2P4W A;  3IWZ A;  2OQR A;  2M2E A;  2DMP A;  4ABZ A;  3N97 A;  3QU6 A;  4KUM A;  3JR9 A;  4W97 A;  5FLV A;  2VPR A;  1D1C A;  2XV4 S;  3DU5 A;  4OOI A;  4RGX A;  2K7L A;  3RPU A;  3SJM A;  1NK3 P;  5KAF C;  2E1M C;  1LKX A;  1SVO A;  1ZYR F;  2JK3 A;  4O6J A;  2DFI A;  1HDD C;  4FT8 A;  3K4J A;  1QA6 A;  3FX3 A;  3QYF A;  1HDP A;  2GQQ A;  4YIR X;  5BNG A;  1ZQ3 P;  4NNJ A;  2K9Q A;  5F6F A;  4LGW A;  2HPM A;  3I9V 2;  3A02 A;  1SAU A;  2EA4 A;  3GFM A;  3VDX A;  2TCT A;  2E71 A;  4M72 A;  2VC0 A;  4DJA A;  2V1X A;  3KET A;  4G8X A;  4ZTJ A;  3ZQL A;  4HX7 A;  5IP6 A;  1SFU A;  1TWC J;  1J7K A;  3DBL B;  2QSG X;  4L9T A;  5HNF A;  1OFC X;  3M1E A;  3CCU I;  2L9N A;  1NTC A;  4Y52 J;  1GDT A;  4XRS G;  4BGD A;  5CJ9 A;  1SD4 A;  2Z1D A;  5FLX Z;  5E3O A;  2DOE A;  1G2H A;  4R1H A;  1RPW A;  3KZZ A;  3PJR A;  2FBK A;  2NXN B;  1RZ4 A;  3M1C A;  3DPU A;  4ON0 A;  5LBQ A;  1R58 A;  1XDS A;  4FX4 A;  2L0K A;  3RKY A;  5M3F J;  1TT5 B;  3DTI A;  3HSF A;  1BW5 A;  3KEO A;  1Y0U A;  5LHH A;  2EWN A;  3KP7 A;  1XSV A;  1ZG5 A;  1I1G A;  5M5Y J;  3H0G J;  4ZJZ A;  2WY7 Q;  5D5V B;  2RGV A;  2GA1 A;  2VJ4 A;  3FDY A;  3HJE A;  4OIR F;  1G3T A;  1Z0X A;  3A01 B;  4I76 A;  1C0W A;  4ZC3 A;  1I5Z A;  5EG0 B;  2QEN A;  4M6Y A;  5JVG F;  2JA8 J;  5HOO A;  3BG3 A;  3FHN A;  4KIG A;  3ISP A;  3I4M J;  1Z3X A;  4X1E A;  5ICC A;  3BTI A;  4U88 A;  3UNG C;  1ENH A;  3M3Y J;  4UB8 C;  1AOY A;  5E1W A;  1VQ9 I;  5J1U A;  3FKJ A;  4C3I J;  5HLG A;  4IOA F;  4UVA A;  3PFI A;  2DA3 A;  2RNJ A;  3JW4 A;  3DWL E;  1CF7 A;  1HSJ A;  1STZ A;  2ELH A;  4KA4 A; 
#chains in the Genus database with same CATH homology
 2Z99 A;  5J8F A;  3I4P A;  4ENK A;  3DP7 A;  2DPU A;  4NQW A;  1HST A;  1ODD A;  1WWX A;  3U9G A;  4IHS A;  2EFQ A;  4HDV A;  2BYV E;  2JSC A;  3M9A A;  1ZHF A;  1XCV A;  1K78 B;  3Q5F A;  3EUH A;  3EYI A;  3L2C A;  4DNC A;  2E7W A;  2QBY B;  2LDU A;  1QZY A;  2KKO A;  2H09 A;  5LHG A;  4QWQ A;  3F72 A;  3E3V A;  2PMU A;  1J75 A;  3FXU A;  1UFM A;  1PP8 F;  2A07 F;  3E5X A;  1MJA A;  1LDK B;  3SZP A;  3V8K A;  4EM1 A;  2A3S A;  4ENN A;  3E6B A;  3RYP A;  3GYH X;  2D1H A;  2NRA C;  2JTV A;  2RQP A;  3T8T A;  1P4A A;  4CO8 A;  2E1N A;  5FFZ A;  2GIV A;  3F8B A;  3TOA A;  5K5R A;  5J8C A;  4IF4 A;  5F64 A;  2Q8K A;  1OMI A;  1GXP A;  1T6S A;  2H6B A;  1T98 A;  4A0Y A;  1IAW A;  3WTV C;  1BI1 A;  1IXC A;  2MH9 A;  1OYI A;  1XGO A;  1UHM A;  1IW7 F;  3I0T A;  2HTJ A;  1JE8 A;  2HS5 A;  5CVV A;  5L3C A;  4ZH4 F;  1YQA A;  3MAJ A;  3I59 B;  3LQQ A;  5L3E A;  4RAZ A;  1MJB A;  2VT3 A;  3H3Z A;  3MEX A;  2FRH A;  4B09 A;  2DLL A;  2DK5 A;  4MNU A;  4HF2 A;  4Y15 A;  1KQ0 A;  3KP4 A;  3GX4 X;  1A04 A;  2P5K A;  3RYR A;  3F3X A;  3JTG A;  4RGS A;  1MKM A;  3K69 A;  2UXX A;  2QQ9 A;  1P6R A;  4MQ9 F;  1BI2 A;  1FOK A;  1H0M A;  3ZP5 A;  1Z9C A;  1O3T A;  1FP1 D;  3V7R A;  2XAG A;  3F8N A;  2EB7 A;  2HQR A;  4M71 A;  4M6X A;  2M45 A;  3FXR A;  5HDK A;  1KU3 A;  2ZNZ A;  1BOA A;  2XAJ A;  4A12 A;  4OMZ A;  2YR2 A;  5LEK A;  5LRS A;  1JGS A;  4LLG F;  2HQN A;  2OAZ A;  1RI7 A;  5H6Q A;  1W5T A;  3B02 A;  4EVI A;  4KIF A;  2FQ3 A;  4GO1 A;  3WE2 A;  3PQJ A;  2V1U A;  4N0B A;  2CQK A;  2RV8 A;  3RDI A;  4HDU A;  2H94 A;  1QBJ A;  1E17 A;  2RVC A;  4D0P A;  4UV8 A;  1F1Z A;  2FU4 A;  1OPC A;  5D8K B;  2UXN A;  2EFW A;  4ENJ A;  1IXS B;  1WKM A;  4WK8 F;  3DF8 A;  3L9F A;  1VTN C;  5BQT A;  4UUV A;  2IVM A;  5D5X B;  3FMQ A;  5DCM A;  4IHT A;  4U7B A;  1R5G A;  1ZH5 A;  3QRF F;  1BBY A;  4LG0 B;  1Z6T A;  4IRG A;  1L3L A;  2O03 A;  1O3S A;  2W84 A;  1WQ2 A;  2FEZ A;  4G94 A;  4MHG A;  4MEX F;  1FNN A;  3TDZ C;  2JT1 A;  3LAP A;  4OIO F;  3I64 A;  2K27 A;  5LGT A;  2M8E A;  2O61 A;  1R23 A;  3ABT A;  3ZPL A;  2XRN A;  3G3Z A;  2XAF A;  4WWC A;  5DUK A;  3T1B A;  3RPQ A;  4ZYG A;  1K79 A;  1O57 A;  3QU3 A;  5LEJ A;  2KJB A;  2FF4 A;  1RNL A;  1K78 A;  1ZRE A;  1U5T B;  2F5E A;  4MEY F;  3BDD A;  1IN6 A;  2ISZ A;  1LB2 A;  3KEQ A;  1FWZ A;  3ZMZ A;  1D3Y A;  2DPD A;  2QBY A;  2A69 F;  3K1M A;  3R4K A;  2YPR A;  4LFU A;  1MGT A;  4UV9 A;  1P92 A;  1S7A A;  1LNW A;  1GXQ A;  4BHP A;  4PDK A;  2ZME B;  3TGN A;  1IRF A;  4I0A A;  4KFC A;  3CJN A;  4G9Y A;  2TDX A;  2JPC A;  4G6D A;  1S29 A;  4NB5 A;  1KYZ A;  3R0A A;  3FM3 A;  4U0Y A;  1BN5 A;  2EK5 A;  3WU0 A;  3V8L A;  5CVJ A;  2FNA A;  3ERE D;  4XSX F;  1B9M A;  1BIA A;  3DPT A;  1G3S A;  2K4J A;  1W7P D;  4S05 A;  3KP6 A;  2ESN A;  1TNS A;  3WTY C;  3T8R A;  3BWG A;  3ABU A;  2CSO A;  4UVB A;  3HOS A;  1G3W A;  4N9I A;  4ZYD A;  1FBQ A;  2EV5 A;  1R1V A;  3RJP A;  2DTR A;  1H9T A;  2HOE A;  3DXJ F;  2NNY A;  1DPR A;  3F8F A;  3TKY A;  2G7U A;  1HW5 A;  4HX8 A;  3I53 A;  3FZV A;  1G3Y A;  3I59 A;  4PGH A;  1J9I A;  4I09 A;  4NHJ A;  1ZGA A;  3RKX A;  2B0L A;  2OZU A;  1Z1D A;  4HQE A;  3NRV A;  6PAX A;  2ZKZ A;  1SAX A;  1FPQ A;  3WTS C;  2J5P A;  4WX9 A;  5J6X A;  1OYW A;  1J59 A;  4OMY A;  4HLY A;  2LF8 A;  4R8H A;  5BPD A;  3O2P E;  1PDN C;  3CUO A;  5H20 A;  3GF2 A;  4HBL A;  1HW2 A;  3I71 A;  1E2X A;  3KP5 A;  2LKP A;  3TDU C;  1LEA A;  5L3G A;  2FBI A;  5L3F A;  1X3U A;  3TO7 A;  5IT9 Z;  3GXO A;  1ON1 A;  1DPU A;  2K86 A;  1HXD A;  4K2E A;  4WF2 A;  3WOD F;  2R7D A;  1YFH A;  2ZCW A;  4I98 B;  3E6D A;  2L4A A;  4KIC A;  5LGN A;  2VXZ A;  1KGS A;  4L5I A;  2Z3Y A;  4A6D A;  4CDG A;  3CLO A;  4S04 A;  3GFJ A;  5E17 F;  3C3W A;  3DQV C;  3WTT C;  3LQR A;  1I1S A;  1IXR C;  2RKH A;  3L09 A;  4HLX A;  2PBI A;  5E18 F;  3KP3 A;  3COA C;  4CYD A;  3WTW C;  1WI9 A;  3GO5 A;  5E1X A;  2O0Y A;  4ESB A;  5ILU A;  4U7D A;  1KA8 A;  5HLH A;  2R7F A;  1GVJ A;  2HTS A;  3F6O A;  4CGZ A;  3V4G A;  4LG0 A;  3DPL C;  4L5J A;  3P7N A;  4JQF A;  5HDG A;  2MBF A;  2BEO A;  5IT9 K;  2MLG A;  3ZMU A;  3WGH A;  4LLL A;  5A2Q Z;  4HQM A;  3P9K A;  5DCM B;  1FP2 A;  1UB9 A;  3EET A;  3R6S A;  4A5N A;  3VB2 A;  1YLF A;  3HYI A;  1U5T A;  4L18 B;  3M7G A;  3RKW A;  2IPQ X;  2KRF A;  3K1N A;  4IXA A;  2DT5 A;  2VOP A;  1XGN A;  4M9X A;  4QLC U;  4GXO A;  1I27 A;  2QM3 A;  2ZME A;  3CO7 C;  3JTH A;  1Z05 A;  4HF0 A;  4Q47 A;  1KYW A;  2L01 A;  3B73 A;  4CIC A;  3GW2 A;  3KLN A;  3F22 A;  2ZNY A;  3WTZ A;  1KU9 A;  4BH9 A;  3LST A;  4L0Y B;  4AD9 A;  1D8J A;  1G4D A;  4RGU A;  2EA2 A;  4WXC A;  2VBZ A;  3BOQ A;  4A5M A;  2GXG A;  1MD0 A;  3ZMS A;  4KYW A;  4IRH A;  2CGP A;  2EV6 A;  3CUQ B;  5FLX K;  3K2Z A;  2HEO A;  2Y48 A;  4ZYE A;  5JR3 A;  3HTS B;  2LF7 A;  1ZGJ A;  1EH7 A;  1S8N A;  2HGC A;  3IC7 A;  2KJC A;  5JI6 A;  1MJ9 A;  4HZF A;  2MD5 A;  1IN4 A;  2QLZ A;  1BI3 A;  1PUE E;  3HRT A;  4LK0 F;  2XGX A;  3HHH A;  4G7O F;  1BIB A;  3E5U A;  3N4M A;  2AXL A;  2FNP A;  3KCC A;  2IA2 A;  1YYV A;  5ICG A;  1HKQ A;  1XDU A;  5ERI A;  1SD7 A;  3ZN1 A;  1AWC A;  4RB1 A;  1DP7 P;  2IW5 A;  3HRS A;  1Z91 A;  2PI0 A;  3VOE A;  5HS9 A;  1LDD A;  1WSU A;  1HKT A;  4UXN A;  4AIK A;  3BJ6 A;  3E6C C;  2M30 A;  1K7A A;  4PGG A;  4I2O A;  1YW8 A;  4XLP F;  4BNC A;  2E7X A;  3L00 A;  2GAU A;  4LMY A;  1R5H A;  3J80 Z;  4PZJ A;  3HSE A;  1J5Y A;  3U2R A;  4YFK F;  2OBP A;  5H6R A;  2NS0 A;  2W24 A;  4OIN F;  2A6H F;  3HTU A;  1FSE A;  5HLI A;  3NQO A;  1R22 A;  2VBX A;  4OU0 A;  2JZY A;  1XSX A;  3JSP A;  1I6X A;  4KMU X;  2GZW A;  1EH8 A;  3MZY A;  1FSH A;  2MLK A;  4KMF A;  4BAY A;  1TLH B;  2L3D A;  1W7P B;  2V1D A;  1O7L A;  3TO6 A;  3GZ6 A;  2QUF A;  3KE2 A;  4IPA A;  3DV8 A;  3IRR A;  4IRI A;  3JAM Z;  3PQK A;  3GLX A;  1TQM A;  4XBF A;  3ZQ7 A;  2FA5 A;  5LHI A;  2JRT A;  2Q0O A;  1ZRC A;  5KK1 A;  2F2E A;  5ED4 A;  5D4R A;  2ISY A;  2XIG A;  1YO5 C;  1XD7 A;  1SFX A;  2STW A;  2HKX A;  1B9N A;  4A0Z A;  2H6C A;  1YG2 A;  3WE3 A;  3NEU A;  4BHC A;  2W85 A;  3F8M A;  3J80 K;  4RAY A;  2Z9O A;  4KDP A;  4U0W A;  4YFX F;  3FMR A;  5DCF A;  4EGY A;  3M8E A;  4ESJ A;  2P7V B;  2CG4 A;  2IJL A;  2LSO A;  2COM A;  1O7F A;  1YS6 A;  1IF1 A;  2DBB A;  4CXF A;  3BRO A;  5D8L B;  4BQA A;  2VT2 A;  3QP6 A;  4KIB A;  5DYM A;  1XB4 A;  3T5X A;  1HQC A;  3QPH A;  2HWV A;  4YIF A;  3IHU A;  1H9G A;  2PJP A;  5D5U B;  3JSO A;  3JAM K;  4WXH A;  2XRO A;  2LNB A;  5AON A;  3MQ0 A;  3J81 Z;  3QP5 A;  1YW7 A;  2EFN A;  3LWF A;  3IKV A;  3VOD A;  3J7A O;  1ZLK A;  3CUQ A;  4Z2Y A;  5FD6 A;  3I58 A;  1FY7 A;  1MZB A;  2FSW A;  2IT0 A;  2IA0 A;  2ETH A;  4L9N A;  5D4S A;  5BMZ A;  4IJA A;  2GWR A;  2V79 A;  2NAZ A;  1LDJ A;  3GUD A;  2MH2 A;  4DQ2 A;  3MZH A;  4GGG A;  2HYG D;  1K6O A;  1FZP B;  2EV0 A;  2YX7 A;  3HUG A;  3I54 A;  1F4K A;  1FYL A;  2DW4 A;  2M5W A;  2ZBK A;  2VN2 A;  4R79 A;  3H92 A;  2BGC A;  3ULQ B;  3SXY A;  2WWY A;  3IRQ A;  5AIQ A;  1BI0 A;  4HV5 A;  2L02 A;  4LLN A;  2AS5 F;  4LK1 F;  1P4W A;  2P6S A;  2PEX A;  1U8R A;  5JVT A;  1NHA A;  3BJO A;  3C7J A;  4EMS A;  3KP2 A;  2H27 A;  4HOB A;  3J81 K;  1F9N A;  4HYE A;  4GYI A;  2Q2E A;  3SQN A;  3WG9 A;  2P5L C;  4FX0 A;  1LVA A;  2OD5 A;  4HA8 A;  4MQV A;  4Y13 A;  1IRG A;  5DV5 A;  5CYV A;  4H0E A;  2K02 A;  1SD6 A;  2PMH A;  1W5S A;  1SMY F;  4I0B A;  3TQN A;  5IT3 A;  2BBY A;  5LGU A;  2Y75 A;  2V6C A;  4PCQ A;  5FO5 A;  3KFW X;  3VEP A;  1BJA A;  3WU1 B;  1U6G A;  3DEU A;  2J5O A;  2FE3 A;  4YFN F;  2VOO A;  5HS7 A;  4N9H A;  2GXB A;  4EJW A;  3LA2 A;  3FHZ A;  4A6E A;  3ZMT A;  2W57 A;  1QQI A;  1W7P A;  2Y0M A;  1R36 A;  2QZ8 A;  4AIJ A;  2STT A;  2KIU A;  1PP7 U;  3O3K A;  4I02 A;  4P9U A;  2HKO A;  2HFH A;  2WTE A;  3F6V A;  1KU7 A;  2W25 A;  3OV8 A;  3TO9 A;  5D6F A;  3BPX A;  2F5F A;  2HDC A;  1T2K A;  4ESF A;  4OIP F;  2FXA A;  3DKW A;  3HOT A;  2GA2 A;  1U2W A;  2HYF A;  4KT5 C;  4UHT A;  4G6Q A;  3EYY A;  4UVC A;  3HRU A;  2YX4 A;  4YII A;  5DDG A;  4L9V A;  1ZG1 A;  3K9T A;  2PQ8 A;  1RIO H;  1QPM A;  2DU9 A;  1J2X A;  3SZT A;  1XMA A;  3WGG A;  5FB2 A;  3KLO A;  2K4B A;  1R7J A;  3ZN0 A;  4Q4Z F;  2DQR A;  3HHG A;  3EDP A;  2PN6 A;  2QYO A;  2X4H A;  3RIR A;  1HKS A;  1ULY A;  1QZZ A;  5HDN A;  2P8T A;  3DFG A;  3QPT A;  4O5V A;  4RGR A;  1YIO A;  1EH6 A;  5FGM A;  1XCB A;  2E1C A;  2FMY A;  3D0S A;  2V9V A;  4F7Z A;  2PLY A;  2YU3 A;  2C6Y A;  4P9F A;  1S3J A;  4P96 A;  2L4M A;  3GEZ A;  3SFZ A;  1SD5 A;  1CGP A;  4HF1 A;  5E20 A;  2QWW A;  3OOP A;  4KN4 X;  3HIF A;  3W6J B;  4AVP A;  1Z7U A;  2EJR A;  1F5T A;  4FHT A;  4GYG A;  2G7H A;  4LD5 A;  1U5T C;  1U3E M;  1FYK A;  5CVI A;  1S6L A;  5K1Y A;  1DDN A;  1TQI A;  4OIQ F;  1BC8 C;  3ECO A;  1FYM A;  4L9J A;  4AWX B;  3MWM A;  2ZXJ A;  4EJV A;  3ZMV A;  1Z6R A;  1ZAO A;  5L3D A;  4RB2 C;  2P6T A;  3AAF A;  2IP2 A;  1ONV A;  5ILS A;  1DUX C;  1XN7 A;  2ZFW A;  2HR3 A;  1FLI A;  1D8K A;  2G9W A;  3HSR A;  2QQA A;  2MC3 A;  5A2Q K;  4IVN A;  3E97 A;  4ENM A;  4U0V A;  2QQB A;  3R61 A;  1BM9 A;  2UZK A;  1MDM B;  3BJA A;  5CVR A;  2VBW A;  2VON A;  1BC7 C;  2YSR A;  3IWF A;  4BXU A;  5FFX A;  5CLS A;  1XGM A;  1P4X A;  4ZZD A;  2O3F A;  2OU2 A;  4A2U A;  5K5O A;  5LLQ A;  1QGP A;  1HW1 A;  4M74 A;  3Q9S A;  3F21 A;  2CWE A;  1OKR A;  1ZN2 A;  5JFR A;  1P2F A;  3GFL A;  4ZZL A;  2XVC A;  2OQG A;  1QO0 D;  4JBA A;  4EV0 A;  1J0R A;  1IZ1 A;  3FWE A;  3K1P A;  1FBS A;  5D6E A;  1EV7 A;  1V3F A;  1T39 A;  4XRF A;  4LJZ F;  1TBX A;  3REO A;  2Z5U A;  1UCR A;  1KU2 A;  2FBH A;  1OYY A;  2UWM A;  4RB0 A;  2EFO A;  2RC4 A;  1HBX G;  1IN7 A;  1XMK A;  4HV6 A;  4G7Z F;  4JK1 X;  3I5U A;  5ICF A;  4KNY A;  3WTU C;  1ZLJ A;  5DD4 A;  4BHB A;  3R60 A;  1O3Q A;  3GVA A;  1V4R A;  3V7S A;  4Q5S F;  1KQ9 A;  1L0O C;  2BV6 A;  4MGR A;  3P9I A;  2VE9 A;  5K5Q A;  2XAS A;  1T38 A;  1R00 A;  2XAQ A;  1KQ8 A;  1LQ1 A;  2QVO A;  3U1D A;  5BPI A;  2OZ6 A;  1LEB A;  2VC1 A;  1IUY A;  4WCG A;  1TW2 A;  5D5W B;  2O6G E;  2WV0 A;  1ZAR A;  4E70 A;  3FMS A;  3QAH A;  2DQL A;  1FBU A;  3WTX C;  3BPV A;  1TTY A;  3O6B B;  4RS8 A;  3C1D A;  3LFK A;  3T0Y A;  4I01 A;  3Q9V A;  3VFZ A;  1D5V A;  3GWZ A;  1SMT A;  2A68 F;  2RDP A;  3CO6 C;  4EM0 B;  4B8X A;  4ZYH A;  5ILV A;  2D2W A;  1JHF A;  5F1R A;  2NNN A;  2Z33 A;  3H3U A;  3QOP A;  2RN7 A;  2VE8 A;  4WXD A;  3RTR A;  2O8X A;  2X0L A;  1B59 A;  2PG4 A;  5DUI A;  4Y17 A;  4GCV A;  3IKT A;  3TOB A;  4O3M A;  3LA7 A;  2HZT A;  3G73 A;  3WGI A;  4HW0 A;  1ON2 A;  1W4M A;  3FM5 A;  4A0X A;  1ZRD A;  3LAJ A;  5LRR A;  4G7H F;  2IA1 A;  5KVR A;  3BZ6 A;  1REP C;  2VOD A;  2M1B A;  4M9Z A;  2EFP A;  4EQQ A;  2A6E F;  3SHF A;  2DO7 A;  3F8C A;  2VBY A;  5L3B A;  4BYY A;  1FX7 A;  1UHW A;  2CFX A;  4P55 A;  4I7H A;  5TRD A;  1R1T A;  1LJ9 A;  2ACJ A;  1S7O A;  5E1Z B;  5EEG A;  4LB5 A;  4XLN F;  5CVU A;  2P5V A;  2L54 A;  3ML6 A;  1MDM A;  1WRJ A;  1YS7 A;  1FC3 A;  4Q48 A;  5EEH A;  2IRF G;  3MFK A;  3GFI A;  3F23 A;  1CF7 B;  1RUO A;  3CUQ C;  2OA4 A;  4UNO A;  4ASN A;  1YW9 A;  3E5Q A;  2ADU A;  2D45 A;  4ETS A;  3HRM A;  1JHH A;  5BS6 A;  1FT9 A;  2BE5 F;  2FML A;  4HAM A;  3E6M A;  3W6K B;  2F5D A;  2XHK A;  3MCZ A;  5E8G A;  3ROU A;  2CYY A;  1TW3 A;  2ESH A;  3FXQ A;  3KZY A;  4RB3 C;  1R1U A;  3D5L A;  1B4A A;  3BP8 A;  2XKP A;  2XUB A;  3GZ5 A;  3S2W A;  5TJJ A;  3EQL F;  1UST A;  4EM2 A;  4LB6 B;  3V7C A;  1USS A;  3FF5 A;  5E8I A;  4MTD A;  1O3R A;  2CW0 F;  4M9S A;  1ZRF A;  2D1V A;  1IN8 A;  3P9C A;  2A61 A;  1XGS A;  3BY6 A;  4MTE A;  5HS8 A;  2KIM A;  2ZO4 A;  4P5O A;  4EGZ A;  5DD8 A;  1OR7 A;  1G6N A;  4YG2 F;  2PFB A;  2KIF A;  4TV7 A;  2XAH A;  4HX4 A;  1TQP A;  1XSD A;  1TNT A;  3IL2 A;  1QNT A;  2F5C A;  4CHU A;  1ZG3 A;  2CO5 A;  2M87 A;  4AIH A;  3R0J A;  3LA3 A;  2DAO A;  2MA3 A;  2NYX A;  2ZJ2 A;  2P7C B;  2DK8 A;  2DI3 A;  5ICE A;  4L0Z B;  5BOX A;  3ELK A;  1JXS A;  3CDH A;  3M8F A;  4XSZ F;  2R3S A;  1YTY A;  4EJT A;  3ECH A;  1Q1H A;  1U78 A;  1IN5 A;  4CZZ A;  3CTA A;  1B6A A;  5HVQ C;  4EJU A;  3V8J A;  3ZMD A;  5AIP A;  3RI4 A;  1RUN A;  4KN7 X;  3K0L A;  2A5Y B;  2FOK A;  2XKO A;  4M73 A;  3C18 A;  2WC2 A;  5JHU A;  2JPB A;  5FD5 A;  4EJO A;  3L7W A;  5DEQ A;  1SFE A;  1GHC A;  1T0F A;  1B1B A;  2P4W A;  3IWZ A;  2OQR A;  3N97 A;  3QU6 A;  4KUM A;  2XV4 S;  4OOI A;  4RGX A;  2K7L A;  3RPU A;  1ZYR F;  4O6J A;  2DFI A;  4FT8 A;  3FX3 A;  2GQQ A;  5F6F A;  4LGW A;  2EA4 A;  3GFM A;  4M72 A;  2VC0 A;  2V1X A;  3KET A;  4G8X A;  4HX7 A;  1SFU A;  1J7K A;  4L9T A;  3M1E A;  5CJ9 A;  1SD4 A;  5FLX Z;  4R1H A;  3KZZ A;  2FBK A;  1RZ4 A;  4ON0 A;  5LBQ A;  1R58 A;  1XDS A;  4FX4 A;  3RKY A;  3HSF A;  3KEO A;  1Y0U A;  5LHH A;  2EWN A;  3KP7 A;  1XSV A;  1ZG5 A;  1I1G A;  5D5V B;  2RGV A;  2GA1 A;  4OIR F;  1G3T A;  1C0W A;  1I5Z A;  2QEN A;  4M6Y A;  5HOO A;  4KIG A;  3ISP A;  5ICC A;  4U88 A;  1AOY A;  5E1W A;  5HLG A;  4UVA A;  3PFI A;  2RNJ A;  3JW4 A;  1CF7 A;  1HSJ A;  1STZ A;  2ELH A;  4KA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...