4L0YB

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 35
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l0yB00
2EA2A 4NQWA 2DQRA 2FA5A 3FWEA 2VBZA 3C7JA 3IKTA 3DV8A 4MHGA 3L00A 3T5XA 2EV5A 3M8FA 4HQEA 1I1SA 1FPQA 4IRHA 3LAJA 4M73A 2NS0A 1VTNC 4KICA 2EB7A 2JZYA 2PI0A 4AIHA 1IXCA 3KP3A 1MDMB 2O3FA 2D45A 1KYZA 3ISPA 3J7AO 5FGMA 2FEZA 4ESBA 1K78A 3KEQA 3ZN1A 3U2RA 3GFIA 1ONVA 1KA8A 1B59A 5HS7A 2X4HA 4L18B 4UNOA 5LGNA 1O7LA 5FFXA 1JXSA 2EFNA 3PFIA 3M9AA 4FX0A 5ICCA 2XAHA 4U88A 4HX7A 4EJOA 2FXAA 1XMAA 2W84A 2ZBKA 3M7GA 1W7PD 4KIBA 2DAOA 2PMUA 2Z5UA 3EETA 1MDMA 2XROA 1L3LA 1XMKA 2IVMA 2F2EA 4G9YA 1T6SA 2JTVA 2A6EF 4KNYA 2L54A 3FF5A 1YQAA 3GZ6A 3F8NA 3FMQA 2DTRA 4LB6B 1BI0A 3R60A 3VFZA 2D1VA 1C0WA 2HGCA 2QYOA 4LGWA 4ZYDA 1RZ4A 3GEZA 2XV4S 2NRAC 2V79A 3CTAA 4UVCA 3U9GA 1ZG5A 5L3BA 3DP7A 2V9VA 3QP5A 3I59B 3P9CA 1U5TB 5FD5A 3EUHA 3JSPA 1MD0A 4KYWA 4MEYF 3ERED 3I4PA 5LRSA 4HF1A 1FYMA 2QENA 3T8RA 1U2WA 1P4AA 2LKPA 2QUFA 3GF2A 2JT1A 2A6HF 1E2XA 3K69A 3JTHA 2MA3A 4QLCU 4RGUA 4RB1A 4Y17A 1DPRA 4M71A 3K1PA 5D5UB 2RC4A 4MTDA 3TGNA 1S7OA 1LEBA 1W5SA 2L4MA 2D1HA 2RDPA 5KVRA 1OYYA 3PQKA 5TJJA 1DP7P 1IN8A 1H9GA 1XSDA 2FBKA 2EFOA 1RUNA 1D5VA 2KIMA 2WTEA 1J2XA 1T0FA 2O0YA 1G3SA 1Z9CA 2P6SA 2HTJA 1HXDA 3E97A 1UHMA 2O03A 2YPRA 2NYXA 4CXFA 2GQQA 4LK1F 2IP2A 3GO5A 5F1RA 3DQVC 3E6CC 4P9FA 1DUXC 1S29A 3KP7A 3ZMSA 3GYHX 4GXOA 2RN7A 1KYWA 1W7PB 2Q2EA 1NHAA 3F22A 3E5XA 4Y13A 3B02A 3V7CA 3J80Z 1B9MA 3L2CA 5IT9K 3FX3A 2QQBA 3SZPA 1TBXA 3H3UA 2RNJA 3TDUC 1U8RA 4O5VA 1X3UA 4WXDA 3KZYA 1CF7A 2L3DA 3D5LA 1MKMA 4I7HA 4LG0B 5L3EA 3IKVA 3ZMDA 4BHCA 1RUOA 1SFXA 1LEAA 3SQNA 4RB2C 3QAHA 2DQLA 5CVJA 3CUQC 1R5HA 1HQCA 2VT2A 3ZMTA 5ILSA 4OMYA 5BQTA 2P5VA 3V8KA 1YW7A 2FNPA 1HW5A 4I09A 3VODA 3ZMVA 3JAMZ 3R0AA 1D3YA 1ZAOA 3F8BA 5HLHA 3T0YA 2EV6A 1F5TA 4FX4A 2WV0A 4L5JA 1BI2A 1IXSB 1G6NA 1K6OA 2P5KA 2W24A 1QBJA 2P5LC 2NNYA 1XSXA 2Z33A 1G3WA 2O6GE 2F5FA 4YIFA 1PP7U 2FNAA 5D6EA 5HDKA 2QBYA 1B4AA 2CGPA 5AONA 3O2PE 3WGIA 1GHCA 4AIJA 3Q9VA 2EJRA 3HRUA 4YIIA 1XB4A 1FYKA 4HW0A 1FYLA 1YW8A 3ML6A 1BOAA 1XCVA 3EYYA 5LEKA 1EH7A 1G3TA 5D5WB 1JGSA 5LRRA 3P9KA 1T38A 1SFUA 2VOPA 2XKPA 2R7DA 3ZMUA 1EH6A 2IRFG 1MJAA 3FHZA 5CVUA 1V4RA 4ESFA 2CSOA 2LF8A 1QO0D 4QWQA 5E8GA 3WGHA 3CO6C 4Q48A 4ZYHA 3CUQA 4IHTA 4AIKA 3DPTA 3LA7A 5A2QK 4LMYA 2GAUA 2VC1A 1IN7A 2L4AA 3GFJA 2AXLA 4K2EA 3RIRA 2OU2A 3LQRA 1U3EM 4WXHA 3J81Z 4BAYA 2RKHA 3GUDA 4GYGA 3HUGA 3IRRA 1ZGJA 3GW2A 2FMLA 2QQAA 1KU3A 3WGGA 2QM3A 2GIVA 1MJBA 1F4KA 1K78B 1WI9A 2DFIA 4EGZA 3VEPA 4UVBA 1LQ1A 1YFHA 5LLQA 4BHBA 3TO6A 2PJPA 4HQMA 5E1XA 1BC8C 2FE3A 1XCBA 3LFKA 2STTA 1T2KA 1JHHA 5LHGA 4EM1A 3K9TA 2HKOA 3J80K 1FWZA 1S6LA 1JHFA 4XLNF 4KA4A 4UXNA 4BYYA 1LDKB 3HRMA 5CVIA 3DFGA 2R3SA 5BPIA 4R1HA 1OYIA 4CICA 4KDPA 3O6BB 4IHSA 3FMSA 2XGXA 2XRNA 4U7BA 1G3YA 4FT8A 3C3WA 1U78A 3EDPA 2H6CA 2ZKZA 4U0VA 1S7AA 4XBFA 2Y48A 2TDXA 1Z05A 4O6JA 4EGYA 4ENMA 2J5PA 1P2FA 3DEUA 1F1ZA 3F72A 4XLPF 5EEGA 1XDSA 2QZ8A 5BPDA 1UFMA 2DPDA 3KLOA 2Z3YA 1GXQA 2OD5A 4LB5A 2FQ3A 3MZYA 1FNNA 3QPTA 3ULQB 2XAJA 1J9IA 3RTRA 3EYIA 2ETHA 4A5NA 4G7HF 1HKTA 1H9TA 1HSJA 1ZLJA 1I5ZA 4D0PA 4ETSA 2XVCA 1UCRA 2EFPA 3ZPLA 4P55A 1OYWA 3WE2A 1ZRDA 2KIFA 2QWWA 1T98A 4A2UA 3RKXA 1R36A 3WTYC 3E6DA 3OV8A 1O3SA 3WTZA 1EH8A 2ZNYA 2M1BA 3IWFA 5DCMA 3BWGA 4KIGA 3WTUC 1LNWA 3WTSC 1L0OC 5L3FA 2HR3A 4S04A 2Q0OA 3QOPA 1O57A 5J8CA 1HW2A 1YS6A 1KQ8A 2DK8A 4GYIA 3KP5A 2JSCA 2IA2A 2ZMEB 4M72A 4ZZLA 2EV0A 3QPHA 1FLIA 1XGMA 4OIRF 3FMRA 5L3CA 3TQNA 4Q5SF 2O61A 2D2WA 3L9FA 2W85A 1CGPA 4L9NA 2XAQA 2DU9A 3I0TA 4NHJA 1TQMA 2VXZA 1Z7UA 5HLGA 3JSOA 3HYIA 2G7UA 1J0RA 4L0ZB 4OIPF 1OKRA 3HTUA 4KT5C 3GFLA 3LSTA 4G8XA 3WTWC 2OQRA 4G6DA 2Y0MA 3WODF 2P6TA 2MD5A 5J8FA 4G6QA 4PDKA 3LA3A 3HTSB 3HRTA 4CDGA 1KQ9A 2QLZA 2H27A 2Y75A 1BM9A 3HOTA 2MC3A 4WF2A 1QQIA 3V7SA 1R58A 3ABTA 3C1DA 1J7KA 4KMFA 5ICEA 2YSRA 3G73A 1STZA 3R61A 2FSWA 2G7HA 5BS6A 4RGXA 1BI1A 1Y0UA 4Q4ZF 1R23A 1P4XA 1YG2A 2IA1A 2CFXA 3BOQA 1WSUA 1GVJA 3IHUA 1ZRCA 1MZBA 2BV6A 4L9JA 4A5MA 4ENKA 1XD7A 1QZYA 4RAYA 1ZARA 3K1NA 2MBFA 1XDUA 4HX8A 4XSZF 1ZG3A 2A07F 1BC7C 4EM2A 5IT3A 1ULYA 1ZYRF 1U5TA 2DK5A 2NNNA 3CDHA 2FBIA 2STWA 1UB9A 3F6VA 2M8EA 1USTA 3TO9A 5K5OA 2PMHA 1SMYF 3Q5FA 3I53A 3BPXA 1BBYA 3BY6A 3FXUA 2VODA 3DPLC 2AS5F 2Z9OA 4NB5A 3FM5A 4M9SA 2DBBA 1ZN2A 4OIQF 1WKMA 4IRIA 1F9NA 5D6FA 4GCVA 2KRFA 3M1EA 2PBIA 4PGHA 3RKYA 2NAZA 3RJPA 1FBQA 2OQGA 2BYVE 2RV8A 1Z6TA 2K4BA 3RI4A 4F7ZA 5ILUA 1YS7A 1HBXG 3TDZC 2K27A 2DLLA 1AWCA 5ICGA 2PLYA 1QPMA 4CYDA 1QNTA 2QBYB 2PQ8A 1TLHB 4WX9A 1K7AA 1YIOA 3WU0A 3CUQB 2ISZA 2ESNA 4KMUX 2UZKA 3QU6A 1FBSA 3TOBA 4YG2F 1O3RA 2H94A 5LGTA 3ZMZA 4HDUA 2VBWA 1SD7A 2RQPA 3ECOA 5LHHA 4CZZA 4AWXB 2J5OA 3E3VA 3BJAA 2UWMA 1D8JA 1JE8A 3LA2A 4U7DA 5DCMB 3HSRA 4EQQA 3JAMK 5K5RA 5HS8A 2XASA 3V4GA 2HWVA 2EK5A 4I0AA 1R1UA 1A04A 2KKOA 1KQ0A 2H09A 1BN5A 2ZJ2A 5E17F 2BBYA 1S3JA 3LWFA 1LDJA 4Z2YA 3RPQA 4LLNA 4CO8A 2L01A 2K4JA 2QVOA 4YFNF 1J59A 1Z1DA 3CO7C 5DD8A 4HDVA 3QRFF 1XSVA 1OR7A 1FSEA 2CW0F 4ESJA 4L0YB 2IA0A 1FT9A 2QQ9A 2GZWA 4HYEA 4MEXF 3JW4A 4TV7A 4CHUA 1YLFA 3E5QA 4HOBA 4IPAA 4ZH4F 2XHKA 1IW7F 5CLSA 2HTSA 4BH9A 4WWCA 3GVAA 5ILVA 4GGGA 4ENNA 4FHTA 3GZ5A 1ODDA 4AD9A 2GXGA 1IXRC 1SFEA 2LF7A 4ENJA 5LBQA 1ZGAA 1DPUA 4PGGA 3F8FA 1LDDA 3J81K 1TTYA 2OZUA 3BJ6A 1KU9A 3E6MA 2ZO4A 2JPBA 1TNTA 3ROUA 4IF4A 1TQIA 4LG0A 2FBHA 1CF7B 4UUVA 1P92A 3CUOA 4ZYGA 4O3MA 2LSOA 3BJOA 5L3GA 2W25A 3V8JA 2Q8KA 1RI7A 1MGTA 4IXAA 2V1DA 1IN5A 2DO7A 1O3TA 5FFZA 3MEXA 4JK1X 1FBUA 1YYVA 4OINF 4MQ9F 4P5OA 1U5TC 3P9IA 2ACJA 3QP6A 1WQ2A 3RYPA 1HSTA 1BIBA 2CWEA 3GWZA 3KZZA 2F5EA 1G4DA 3MQ0A 4MQVA 4LLLA 4OU0A 4DNCA 5LEJA 5K5QA 2IT0A 2OA4A 5HVQC 5HS9A 1ZHFA 3LAPA 3WG9A 1ON2A 4L9TA 4BXUA 4EJVA 3NEUA 2OAZA 2HYFA 1HKSA 2JPCA 3GX4X 3E5UA 5AIPA 2BGCA 1SD6A 3E6BA 3V7RA 1V3FA 1P6RA 2F5DA 3PQJA 5D8LB 3L09A 3RDIA 3FXRA 4U0YA 2M45A 5JI6A 2WC2A 2K86A 4HA8A 3SFZA 3F3XA 4JQFA 5CVRA 2ZXJA 1R1VA 5LGUA 4RAZA 2M87A 4IJAA 3BZ6A 2ISYA 4E70A 1FP1D 4N9HA 2A3SA 2CG4A 1PDNC 3WE3A 2VE9A 3KCCA 3SZTA 5AIQA 3SHFA 3ZN0A 2BE5F 5H6RA 3HIFA 4UVAA 5E8IA 5EEHA 1ZLKA 4WCGA 2COMA 5IT9Z 1W4MA 5KK1A 4HLYA 2FRHA 2HS5A 1Q1HA 3I54A 5D8KB 5LHIA 1EV7A 4HV6A 3ELKA 3V8LA 3W6KB 3IL2A 3F23A 1W5TA 3KP2A 4N9IA 5HOOA 4LK0F 2VONA 5L3DA 2XUBA 1IF1A 3C18A 3F8CA 3REOA 4R79A 3WTTC 5DV5A 3TKYA 4EVIA 1QZZA 1PUEE 4RB3C 2C6YA 4I02A 3EQLF 1Z6RA 4A0XA 3VOEA 4LD5A 2EFWA 3COAC 2HFHA 3Q9SA 3QU3A 2LDUA 4P9UA 3FXQA 5ED4A 2FF4A 2GA1A 2DT5A 3F21A 5F6FA 4RS8A 2UXXA 4WK8F 2FU4A 4ZYEA 2EWNA 1B9NA 1TNSA 3MFKA 4U0WA 2HYGD 2PFBA 3MWMA 1FX7A 2X0LA 3I64A 4N0BA 4EM0B 3HSFA 2DI3A 1FC3A 3GXOA 1BJAA 3KP6A 2YX7A 2HOEA 3KETA 4XSXF 3H3ZA 5E1WA 4YFKF 4HF0A 2ELHA 3W6JB 3ECHA 2CYYA 2P7CB 1IZ1A 2VBXA 2G9WA 2A68F 3S2WA 1I6XA 4OIOF 2DPUA 2A5YB 1TQPA 3CLOA 1IRGA 3WTVC 4UV8A 3HSEA 1YTYA 4KUMA 4HLXA 1KGSA 5FLXK 5HDNA 4B8XA 4EV0A 3T8TA 3RPUA 2M30A 4RGSA 1YO5C 5FLXZ 2K7LA 2ZCWA 4HV5A 1ZREA 3VB2A 3IWZA 5FD6A 3KEOA 2E1CA 3NQOA 3U1DA 2A61A 5DEQA 5TRDA 4IVNA 4Q47A 2JRTA 4OMZA 2YX4A 4H0EA 1MJ9A 2ADUA 1ZG1A 1R5GA 4L5IA 4HBLA 1XGSA 2OZ6A 2HQRA 2IPQX 1E17A 3G3ZA 4IRGA 2K02A 1B6AA 1RIOH 2MH2A 4A6DA 2P4WA 1BI3A 2W57A 5BMZA 3MAJA 5JFRA 1ZH5A 3AAFA 5A2QZ 3R4KA 2VBYA 2OBPA 1HW1A 4I0BA 1R7JA 4XRFA 2KJBA 5E20A 4KIFA 3JTGA 3P7NA 3M8EA 4RB0A 2CO5A 2Z99A 2P7VB 1SD4A 4P96A 2KJCA 3L7WA 2DW4A 3DKWA 5K1YA 3TO7A 4A0ZA 3TOAA 2RGVA 3KE2A 1USSA 5DD4A 4M74A 3WU1B 2GA2A 4L9VA 4OOIA 3FZVA 1SD5A 2HKXA 2MH9A 4S05A 3KFWX 1LVAA 1DDNA 5FO5A 4BNCA 1ZRFA 4UV9A 4EJWA 3OOPA 3SXYA 4MNUA 5DYMA 3N97A 3MZHA 4G7ZF 3GFMA 1UHWA 1S8NA 2CQKA 4BHPA 1K79A 4I98B 2YR2A 4EJTA 2P8TA 1WWXA 3WTXC 2PG4A 4UHTA 2L02A 5ERIA 1KU2A 4M6YA 1O7FA 2MLGA 2ZNZA 2RVCA 4GO1A 3HRSA 3K0LA 4DQ2A 4YFXF 3ZQ7A 1B1BA 2V1XA 1REPC 4ASNA 5JHUA 4MGRA 4I01A 4R8HA 2FMYA 3H92A 2PEXA 1HKQA 5D5VB 4I2OA 1WRJA 2VC0A 4A0YA 3CJNA 4JBAA 1R22A 5D5XB 4M6XA 1LJ9A 5E18F 3F6OA 3K2ZA 1U6GA 4LLGF 4HZFA 4A12A 1IN6A 3R0JA 1T39A 4HF2A 5J6XA 1D8KA 3O3KA 3DXJF 1SAXA 2HQNA 1RNLA 2WWYA 3I59A 2IJLA 2B0LA 4KFCA 1OPCA 3F8MA 5CYVA 2GXBA 2FOKA 1XGOA 2HEOA 5DUKA 5DDGA 1PP8F 1SMTA 5H6QA 4B09A 5ICFA 2F5CA 3BP8A 1XN7A 1FOKA 4HAMA 5JVTA 1FZPB 1YW9A 5DCFA 4PCQA 5D4SA 5H20A 1BIAA 2HZTA 3RYRA 3DF8A 2VOOA 3N4MA 3D0SA 3BROA 1IUYA 1KU7A 4EMSA 4PZJA 1R1TA 4A6EA 2HDCA 4G7OF 2V1UA 3IC7A 3KLNA 3HHGA 2XAFA 3I58A 3R6SA 2O8XA 5JR3A 3K1MA 4G94A 4M9XA 2H6BA 1FY7A 3IRQA 2LNBA 1I1GA 4ON0A 2R7FA 2ZFWA 3KP4A 1FSHA 2KIUA 2XIGA 2XKOA 2A69F 1W7PA 4LJZF 4MTEA 5HLIA 1J5YA 1H0MA 3ZP5A 2VT3A 1Z91A 4BQAA 3BDDA 3T1BA 2ESHA 5HDGA 4ZZDA 1O3QA 2XAGA 4KN4X 3NRVA 3FM3A 2MLKA 1QGPA 2EFQA 1LB2A 1IRFA 4CGZA 1P4WA 2UXNA 1R00A 2GWRA 3ABUA 1IN4A 5E1ZB 4M9ZA 1TW2A 1XGNA 1GXPA 3BPVA 4WXCA 3I5UA 4EJUA 5DUIA 2ZMEA 4Y15A 1AOYA 4AVPA 3RKWA 1OMIA 2E1NA 2E7WA 2BEOA 2E7XA 5FB2A 2IW5A 1TW3A 2V6CA 1IAWA 5F64A 3MCZA 2VN2A 5D4RA 5BOXA 2YU3A 2PN6A 5CVVA 3B73A 1FP2A 3LQQA 5CJ9A 3I71A 4HX4A 4LFUA 6PAXA 1J75A 1ON1A 2EA4A 2VE8A 4RGRA 1I27A 3GLXA 4KN7X 3HOSA 2M5WA 3HHHA
chains in the Genus database with same CATH superfamily
2EA2A 3KZIC 4NQWA 2DQRA 2FA5A 2LH9A 3RZDJ 3FWEA 2VBZA 3C7JA 3IKTA 3DV8A 2H8RA 4MHGA 2KZGA 3L00A 3TW6A 4IQJA 3T5XA 2EV5A 5F27A 4BQQA 4W1UA 2BY1A 3M8FA 4HQEA 4F93B 3K4CA 1I1SA 1FPQA 2KL4A 1ORKA 4IRHA 2ECCA 3M8JA 5IOZA 3LAJA 5F0FA 4M73A 3OS1A 1U0JA 2NS0A 4YRVA 2R7ZJ 1VTNC 4KICA 3BG9A 3U1KA 5IOYA 2MSYA 2EB7A 2ZC2A 2JZYA 2PI0A 2JK3A 2KMUA 2CW7A 4AIHA 1IXCA 3KP3A 2W7NA 2LOOA 1MDMB 2M7BA 2O3FA 1KYZA 2OJED 3CP2A 3ISPA 3K4MA 3ZOBA 2D45A 1T95A 3J7AO 2OTLI 3G2BA 1SFKA 2DODA 5FGMA 3BQYA 2FEZA 3BG6A 1MNEA 2NOJB 2ZB9A 1W36C 4XR6A 5F08A 3H9JA 5C3EJ 4ESBA 1K78A 1MNMC 1JUMA 3KEQA 3ZN1A 3U2RA 3FKJA 3GFIA 1ONVA 3VYTB 1KA8A 9ANTA 2VIXA 3PNYA 1B59A 5HS7A 2X4HA 3BCBA 1PUFB 3RCOA 1WJ5A 4NC7A 4E6KG 4L18B 4UNOA 3CDIA 5LGNA 1O7LA 2YUSA 2DOFA 4XORA 3OYCA 3H5AA 5FFXA 1JXSA 1GUUA 1NK3P 1D1BA 1X58A 2EFNA 3MKZA 3PFIA 4V19K 3M9AA 4FX0A 5ICCA 3GMEA 4BE0A 4UUSB 2XAHA 4U88A 4HX7A 3LSGA 2BOLA 3NWTA 1MW7A 4EJOA 2FXAA 1XMAA 2LY2A 2W84A 2ZBKA 1W7PD 3M7GA 1VQLI 2DN0A 4KIBA 2DAOA 2PMUA 4P1WA 2GM4A 3I55I 2Z5UA 3EETA 1Z21A 1APLC 4AM3A 5C44J 4E7KA 3OYDA 1UAAA 3FXKA 1MDMA 2XROA 4Y3OA 1L3LA 1IV8A 1XMKA 1T56A 4NC6A 2IVMA 4J01A 2F2EA 4G9YA 1T6SA 1NK2P 5FROA 3OL4A 2JTVA 2A6EF 4KNYA 2L54A 3FF5A 2Z16A 1YQAA 3GZ6A 3F8NA 4CCMA 4D5CA 1TWFJ 3FMQA 2DTRA 2L9SA 4IOAF 3CLQA 4LB6B 3K4BA 1X1CA 2F6CA 2JVHA 1BI0A 4F3QA 2L7FP 2X48A 2NS8A 3R60A 3VFZA 2ZFUA 2GLOA 2JUCA 2D1VA 1YX5A 1ZK8A 3LSIA 4PJJA 2VI6A 3HGGA 4RAFA 1C0WA 1OCZH 2DDAA 1DGWY 2HGCA 2QYOA 4LGWA 4ZYDA 1VF9A 1RZ4A 3GEZA 2XV4S 3JCUC 1H88C 2V79A 2NRAC 3CTAA 4UVCA 3U9GA 1ZG5A 2KP6A 2QGUA 5L3BA 3DP7A 2V9VA 2BY2A 3BZCA 3QP5A 3I59B 1UHSA 3P9CA 4XRMA 5K7ZA 1U5TB 1JUPA 5FD5A 3K4JA 3EUHA 3JSPA 2M3AA 1MD0A 4KYWA 4MEYF 3ERED 3I4PA 4FCYA 5LRSA 4HF1A 1FYMA 2KIQA 2QENA 4BGDA 3T8RA 1U2WA 1P4AA 2LKPA 2QUFA 3GF2A 4LOCA 4DOZA 2JT1A 2A6HF 3HL2A 1E2XA 3K69A 3JTHA 3PFYA 5GTIC 1MIJA 4FQGA 1UELB 1JT0A 4ZDLA 2MA3A 4QLCU 1N75A 3O8HA 4BBRJ 3PJRA 1IRZA 4RGUA 4RB1A 4Y17A 1DPRA 4M71A 3K1PA 5D5UB 1VQOI 2RC4A 2GOXB 3TGNA 4MTDA 2IS6A 2HVRA 2I8DA 1S7OA 1LEBA 1W5SA 2WAQA 2L4MA 2D1HA 1OR7C 3OR2C 3VYUB 2RDPA 4OWRB 3JREA 2QSHX 5KVRA 1OYYA 3VSLA 3OYEA 3PQKA 5TJJA 4RDUA 3BR6A 3A0BC 4JP0A 5GTHC 1IG7A 3OYIA 3JRGA 1DP7P 1IN8A 4C3HJ 1H9GA 2B9SA 1XSDA 2FBKA 2VPLA 2XF5A 2EFOA 1WZ2A 2DA6A 2Y2ZA 3K4LA 1RUNA 2JUGA 3JRAA 1YJNI 2K9MA 1D5VA 2KIMA 2WTEA 3B6AA 1J2XA 1FIPA 2IGMA 2KFDA 1T0FA 2L2OA 2ECBA 2O0YA 1G3SA 2OC6A 1Z9CA 2P6SA 2HTJA 1HXDA 1VQ4I 3GTPJ 1MMNA 3E97A 3OR1C 1JTYA 3O8GA 4QPOA 1UHMA 2LY9A 4HNVA 2O03A 2YPRA 4BXFA 4E7IA 2NYXA 2R7QA 2GQQA 4LK1F 1D1AA 4CXFA 2IP2A 5M3FJ 1ETWA 3LSHA 1X4PA 2JSPA 3A2KA 3OL3A 3GO5A 4ZJZA 2KPMA 5F1RA 3DQVC 4PJ0C 3E6CC 4P9FA 1DUXC 1S29A 3KP7A 3ZMSA 2R7UA 4BQNA 3QYEA 3GYHX 4GXOA 1Y39A 2TCTA 2CQQA 3F9KA 4MIMA 3WHCA 2VKHA 1QRYA 2RN7A 1KYWA 1W7PB 2Q2EA 3TEDA 1DQUA 1FMWA 1NHAA 3DPUA 3E5XA 3I9V2 4Y13A 4D1QA 3OYFA 3F22A 1LFUP 3HOZJ 2LP0A 3B02A 3V7CA 1E3HA 1OCPA 3J80Z 1YRNA 4C2UA 1IV6A 1Z3XA 1JKPC 1G2HA 1B9MA 3L2CA 3ZRGA 1T33A 5FRNA 5IT9K 3FX3A 1OISA 3NARA 2QQBA 5CKTA 3SZPA 3HOWJ 2PX9A 3CCQI 4XQFA 3MZ8A 1TBXA 3H3UA 4I76A 5B66C 3IV5A 1Y56A 1UG2A 5J1UA 3SFIA 2RNJA 3TDUC 1U8RA 4M3BA 5DS9A 1T08B 2ICWG 2M8GX 4O5VA 5IPAA 2RQQA 1X3UA 1XMXA 4WXDA 2CQXA 3KZYA 5EGOB 1QA6A 1CF7A 2L3DA 3D5LA 1MKMA 4I7HA 5GPAA 3MN2A 5L3EA 4LG0B 3IKVA 3OYHA 3WG7H 2WA0A 3ZMDA 2QF7A 4BHCA 1RUOA 2K9QA 1SFXA 2HXIA 1LEAA 2XPWA 5EJCA 3SQNA 4RB2C 4RM3A 3QAHA 3CJQB 3IH2A 2XB0X 1X3ZB 2P0WA 2DQLA 1DU6A 4UY8I 5CVJA 3CUQC 3DU5A 1R5HA 1HQCA 5FKOA 3G6EI 2VT2A 1WJDA 2M34A 3ZMTA 2CV0A 3GZNB 2F4MB 1A5JA 5ILSA 1BJZA 3UR3C 4OMYA 2X6XA 5BQTA 2P5VA 3V8KA 3ZQLA 1G8XA 1YW7A 1H8AC 2FNPA 1HW5A 4I09A 3VODA 3ZMVA 3JAMZ 3R0AA 1H89C 1E3PA 1D3YA 3BG3A 1ZAOA 3F8BA 3CMMA 4E7ZA 5HLHA 2FUG2 1N25A 3T0YA 2EV6A 3E0JB 1F5TA 4FX4A 2WV0A 4L5JA 1MBEA 4N4OB 1BI2A 1IXSB 1G6NA 3BR3A 1K6OA 2P5KA 2W24A 1QBJA 1Z3YA 4CCNA 5F0HA 2IS4A 1RESA 5E3LA 4X6AJ 2P5LC 2HOTA 2WB1A 2NNYA 1XSXA 2Z33A 2DA5A 3FHNA 1G3WA 3PNTA 4HRIA 1YI2I 2O6GE 4QIWN 4PK4A 1V55H 2DA2A 3ABKH 3SYTA 3VYSB 2F5FA 4YIFA 1D5YA 3L2RA 3FISA 3K2AA 2DA1A 4ABZA 2DMPA 1PP7U 2V9PA 2VLAA 2FNAA 5D6EA 2Q1ZB 3NAUA 4RBOA 1MNDA 3W6VA 5HDKA 2QBYA 1B4AA 3QPLA 5AONA 2CGPA 3KPHA 3O2PE 4LG3A 3WGIA 1GHCA 4AIJA 4DGWB 1ZELA 3Q9VA 1RKTA 2EJRA 3HRUA 4YIIA 1JI8A 1XB4A 2VKDA 3OYNA 1FYKA 4HW0A 2QKMB 1FYLA 3DTKA 1YW8A 3ML6A 1BOAA 2L9NA 2HQ5A 1VQ9I 1XCVA 3EYYA 2DA3A 1EH7A 5LEKA 5EEAA 1G3TA 5D5WB 1FIAA 2DMUA 2LREA 3H5RA 2LLKA 3QQAA 4A69C 5M5WJ 1FEXA 1WHUA 1JGSA 5LRRA 2O5RA 3BQZA 3P9KA 1DGRM 5EG0A 1WJAA 1SFUA 1WJCA 1T38A 2XKPA 3FIWA 2VOPA 2R7DA 1IDYA 3ZMUA 1EH6A 3E1SA 2IRFG 4AU7A 2LBFB 1MJAA 3FHZA 5CVUA 1V4RA 2ZXWH 1ZKGA 4YEJA 2EZIA 4ESFA 2WB1N 3OSGA 2CSOA 4Y33A 2VQLA 2LF8A 5FKNA 2ME6A 1QO0D 4D7MA 4QWQA 2VL8A 5E8GA 3WGHA 3CO6C 4JX5A 4KJZA 3W2AA 4Q48A 4ZYHA 3CUQA 4IHTA 3ZCOA 2JA7J 4AIKA 1S9HA 3DPTA 3LA7A 1X2NA 2EPFA 4PFOA 2R5YB 5A2QK 4LMYA 2GAUA 2VC1A 1IN7A 3K70D 2L4AA 3GFJA 2AXLA 4K2EA 3S3NA 5J47A 3RIRA 4GDFA 1GDTA 2OU2A 3LQRA 5EG0B 1U3EM 4WXHA 3J81Z 1SVLA 4BAYA 2R93J 2DMNA 2RKHA 2F4IA 1MMDA 1GV5A 1HCRA 3GUDA 4GYGA 3HUGA 1XG1A 2HPMA 2WAQN 3IRRA 1ZGJA 2LC2A 4KITB 3GW2A 1YIJI 3BG5A 5E3MA 2FMLA 3CCSI 2QQAA 1KU3A 3A01A 4IZZA 2F48A 3WGGA 2QM3A 2BXZA 3I56I 1KZHA 2ELKA 2GIVA 2XSJC 1MJBA 2R7SA 3DBRB 5F1JA 3B6CA 1Z67A 3A02A 1GLNA 3S1QJ 2XAUA 4XLHA 1F4KA 1K78B 1MMGA 1WI9A 1Y1VJ 2KRCA 2DFIA 1A6QA 4EGZA 3VEPA 4UVBA 1LQ1A 1YFHA 5LLQA 4BHBA 3TO6A 2PJPA 4HQMA 5LD2C 5E1XA 2BY0A 1BC8C 1A35A 3PO3J 1Y8RB 3Q3SA 2DYRH 5JLWA 2FE3A 1XCBA 4AIDA 1WJBA 3LFKA 2STTA 4ZDPA 1T2KA 2QSGX 2KRHA 3RQIA 5EGOA 1JHHA 4XM3A 5M3MJ 4NC8A 4U87A 4H4KC 1OJLA 4J19A 5LHGA 4EM1A 3K9TA 3K6GA 2COBA 2HKOA 5HLTA 1FWZA 1S6LA 3J80K 1JHFA 4XLNF 1YITI 1MMAA 4KA4A 4UXNA 3BR0A 3BR2A 1ETKA 4BJ6C 4BYYA 1BR1A 4C9YA 3K4NA 3A1YA 2R7OA 1LDKB 3S14J 2H1KA 3HRMA 1TZLA 1OLTA 2Z1DA 5KAIC 5CVIA 3DFGA 2R3SA 5BPIA 3CJTB 4R1HA 4F91B 2WADA 4IKFA 2CQ7A 1K4SA 1OYIA 4CICA 4KDPA 3O6BB 4AYBA 1TL8A 4IHSA 3FMSA 2XGXA 1XPXA 2XRNA 4CA0A 1BR2A 1IUFA 2PJRA 2K5CA 4U7BA 1G3YA 4ANJA 2NVQJ 4FT8A 3D5SC 3ZQQA 3C3WA 1XC5A 2EZLA 3EDPA 5HNFA 2H6CA 3LSPA 3G1LA 2ZKZA 3SDGA 4U0VA 3S1MJ 1S7AA 4XBFA 2FOWA 2Y48A 2CQNA 1R9TJ 2TDXA 1Z05A 4O6JA 4EGYA 4ENMA 1WJFA 4C2MJ 2J5PA 5LFAA 1XTAA 3FBNB 1P2FA 3DEUA 1K6YA 2L9RA 5B1BH 3WHBA 1F1ZA 3GTLJ 3F72A 4XLPF 5EEGA 1XDSA 2QZ8A 5BPDA 3E7LA 1UFMA 2DPDA 5KAFC 3KLOA 1IJWC 2Z3YA 1GXQA 2OD5A 2RNGA 4IHWA 2FQ3A 4LB5A 3MZYA 1FNNA 3QPTA 3CMYA 4ZC3A 3ULQB 2XAJA 1J9IA 5KNLA 3RTRA 3EYIA 2ETHA 4IOCF 4A5NA 4G7HF 1HKTA 4LIUA 1H9TA 1HSJA 1ZLJA 1I5ZA 2DJIA 4D0PA 4ETSA 3DCFA 4PFPA 3S3MA 2XVCA 1UCRA 3QPSA 4F52A 2EFPA 3ZPLA 1T0FC 2L5QA 4C3JJ 1ETYA 4P55A 1OYWA 1ETXA 3WE2A 1ZRDA 3H36A 3LSMA 1SVMA 2ZSIB 1Z0XA 2EH3A 2KIFA 3AG2H 2QWWA 4XKBA 1T98A 2NVYJ 4A2UA 3RKXA 1R36A 3DBLB 3Q0UA 2AQFA 3WTYC 1DP3A 3E6DA 3OV8A 3LSRA 1O3SA 3WTZA 1W0TA 1EH8A 2CW8A 4E7JA 2ZNYA 2M1BA 3IWFA 4MFDA 5BNGA 5DCMA 3BWGA 1VQ5I 4KIGA 3WTUC 3F0CA 1LNWA 3WTSC 2F4OB 3H9QA 4BE1A 2LR8A 4ZDOA 5EYRA 4DBRA 1LFPA 1L0OC 5L3FA 2HR3A 2VJIA 4S04A 4M3GA 3ASOH 2O9LA 2Q0OA 3QOPA 1O57A 2E1MC 5J8CA 3VSKA 1HW2A 3J7YJ 3HPGA 1JKOC 1YS6A 1A36A 1KQ8A 2DK8A 2W48A 3KP5A 2JSCA 2IA2A 4GYIA 2ZMEB 3CCJI 2DFHA 3AG1H 4M72A 4ZZLA 2EV0A 1RRJA 3QPHA 1FLIA 1XGMA 3OIOA 4OIRF 3FMRA 4C3IJ 5L3CA 1KONA 2GXAA 1QVTA 5EZHA 3TQNA 4Q5SF 4BBSJ 2O61A 1X4OA 2IEKA 2D2WA 1OCCH 3L9FA 2HQAA 2W85A 4OAYA 1VI0A 4L9NA 2XAQA 1CGPA 2DU9A 3I0TA 4IL6C 4NHJA 5M5XJ 5IP6A 1TQMA 4JX4A 3LNQA 3U21A 2VXZA 5F04A 2PMZA 1Z7UA 3LSKA 5HLGA 3JSOA 3HYIA 2W00A 3L2VA 2G7UA 1J0RA 4L0ZB 4OIPF 1OKRA 3H5NA 2X1DA 3HTUA 1M1EB 2DXIA 1BA5A 4KT5C 3GFLA 1Q1VA 2EZHA 2W4SA 3LSTA 4PSWA 4G8XA 3WTWC 2OQRA 3M07A 2L7KA 4G6DA 2Y0MA 4S0HB 3WODF 2P6TA 2MD5A 5J8FA 4HSTA 4PJNA 2UV1A 4G6QA 4PDKA 3LA3A 1VQPI 3ZQGA 3HTSB 1P7IA 1K83J 3HRTA 4BDZA 2V4JC 1Y6IA 5KCMA 4CDGA 1KQ9A 2QLZA 2H27A 2OCEA 4ZTJA 2Y75A 1BM9A 3HOTA 4AVZA 2MC3A 4WF2A 4XRSA 1QQIA 2V9KA 3V7SA 1R58A 4A3LJ 4DZJA 2X1EA 1LE8B 2EQRA 3GCMA 3TMOA 3ABTA 3C1DA 2YU9J 1J7KA 4G6TB 4IX7A 2IS1A 3HB9A 4KMFA 5ICEA 2JN6A 2YSRA 3G73A 1STZA 2ELJA 3HKZA 3R61A 4L5EA 2FSWA 2G7HA 4RGXA 5BS6A 2KQRA 1BI1A 1Y0UA 3CCMI 4Q4ZF 1R23A 3DWLE 2EINH 2Y9YA 3S1NJ 1P4XA 2R7XA 5J1RA 1YG2A 2IA1A 5KHDA 2CFXA 3BOQA 1HLVA 1WSUA 1GVJA 2QCOA 3IHUA 4AUXA 4A3CJ 3IP4B 1ZRCA 1MZBA 2BV6A 4L9JA 4A5MA 3KEYA 2E34A 1HF0A 4RMNA 5EZGA 3A01B 2VUMJ 3S2DJ 4ENKA 1T8IA 1OCOH 1XD7A 1QZYA 1YE9A 1JJ8C 4RAYA 1ZARA 3K1NA 2M2EA 2XSDC 2MBFA 1XDUA 3CCUI 3HOXJ 4HX8A 2CFOA 4XSZF 4V2FA 1LE8A 1ZG3A 2A07F 1BC7C 4EM2A 5IT3A 4XL9A 1VQNI 1ULYA 3AG4H 4XKCA 3PIPF 2JA6J 1ZYRF 1U5TA 2MABA 2Y9ZA 4A3IJ 2DK5A 2NNNA 4UUSA 3GBGA 3CDHA 2FBIA 2STWA 3C2HA 5GP9A 4J00A 2CV2A 1UB9A 2QEXI 2WBMA 3F6VA 1ETVA 3OS0A 2M8EA 1USTA 1LPQA 2KISA 2HVQA 3TO9A 2LD5A 5K5OA 5FLVA 2OV7A 2PMHA 3ZXSA 1SMYF 3TP0A 1WI3A 2MYSA 2MG4A 3Q5FA 3S2HJ 3I53A 4BQOA 2WAFA 3BPXA 3TP3A 1BBYA 3BY6A 1Y1WJ 3FXUA 4XICA 4A3JJ 2VODA 1TT0A 3DPLC 2BVLA 2OUMA 2AS5F 3HDDA 2Z9OA 4NB5A 3FM5A 1P9QC 3S8PA 4MFEA 1IGNA 4IHVA 3N05A 4M9SA 3H9GA 2DBBA 1WH7A 1ZN2A 4OIQF 1WKMA 4IRIA 4NQWB 1F9NA 2NOGA 5D6FA 4GCVA 2KRFA 1W1WE 2A05A 3M1EA 2PBIA 3FBIB 4PGHA 3RKYA 2NAZA 1RETA 3RJPA 1FBQA 1TWAJ 4MLOA 2OQGA 3CC2I 3KYLA 2BYVE 3BR5A 5FKLA 4BE2A 1W5CC 5M5YJ 2RV8A 1Z6TA 2K4BA 2E5NA 1NTCA 1POGA 3RI4A 4F7ZA 5ILUA 2Y30A 3CQZJ 1HOMA 1YS7A 1HBXG 3SEZA 3TDZC 2K27A 2DLLA 4BKXA 5E3NA 3BR1A 2Q2EB 4G12A 5GAGJ 1AWCA 5ICGA 3FDYA 5B1AH 3FXOA 2LKSA 2PLYA 2ZJQF 1QPMA 2CUEA 4CYDA 2VASA 3HGYA 1QNTA 2QBYB 2K85A 2PQ8A 4XLCA 3RSNA 2E60A 1TLHB 4WX9A 1K7AA 1YIOA 2E36A 1LKXA 3WU0A 4B44A 3CUQB 4CH7A 2ISZA 5HNHA 2ESNA 2M4GA 1GVDA 4KMUX 3QU6A 5IYCJ 1ETQA 2UZKA 1FBSA 5CQGA 3TOBA 4YG2F 1O3RA 2H94A 2Y69H 5LGTA 3ZMZA 3M3YJ 1HC8A 4HDUA 2VBWA 3HJEA 1SD7A 3AKZA 2R7VA 1VQ8I 1Y8QB 4BU2A 3CC4I 2RQPA 3ECOA 4XLFA 4E4HA 5LHHA 3W2VA 4AWXB 4CZZA 4A3MJ 4N4NB 2J5OA 3E3VA 3BJAA 2UWMA 1D8JA 2MGQA 4NUBA 1JE8A 3LA2A 1JUSA 4U7DA 5DCMB 3HSRA 4EQQA 3JAMK 2KZVA 3QYFA 5K5RA 2M0CA 3HOVJ 1K4TA 4B48A 2IGOA 2OTJI 2BXYA 2XRLA 3KYDB 1B72B 5HS8A 2CUZA 2H8WA 2XASA 3V4GA 2HWVA 2EK5A 4I0AA 2V6EA 1R1UA 5J1YA 1A04A 2B7EA 3LSJA 3FXJA 1R71A 5J40A 3RPUD 5K7HA 2KKOA 1MBFA 2XGDA 4LITA 1KQ0A 2H09A 1BN5A 2LRDA 2ZJ2A 4XN3A 5HODA 1N77A 5E17F 2BBYA 1S3JA 2GIZA 4IO9F 3LWFA 5F0CA 1LDJA 2V7FA 2DFEA 4Z2YA 3RPQA 4UB6C 2A6TA 4LLNA 4XOTA 4NBQA 1R6RA 2L01A 4CO8A 2K4JA 3CESA 2QVOA 5EDNA 4YFNF 1J59A 3S3OA 1I50J 1Z1DA 1JJ6C 3CO7C 1HDPA 5DD8A 4HDVA 3QRFF 1R4MB 1XSVA 1NH3A 1FJLA 3ZR8X 3ZGKA 1OR7A 2E19A 1FSEA 2CW0F 4HG2A 3OY9A 4ESJA 4L0YB 2IA0A 1FT9A 2QQ9A 2Y31A 2GZWA 4HYEA 1LVKA 4MEXF 3JW4A 4TV7A 4CHUA 4HEA2 1YLFA 3BT9A 3E5QA 4HOBA 4IPAA 4ZH4F 2XHKA 3DKYA 4DIQA 1IW7F 2WAEA 2F5VA 5CLSA 1U8BA 2ZJRF 2HTSA 2WY8Q 4FE4A 3CC7I 4BH9A 2CU7A 4WWCA 4B47A 3GVAA 1ENHA 1ITYA 5ILVA 2ID6A 4GGGA 2DCEA 4CUGA 2WV1A 2K40A 3J7ZI 3FKIJ 4LIVA 4ENNA 2VQCA 4FHTA 3GZ5A 3P5JA 1ODDA 3K10A 4AD9A 1SANA 2X51A 2E71A 3ABMH 2GXGA 1N78A 1A6IA 1IXRC 5E3OA 4A3KJ 4B4CA 1S7EA 1SFEA 2LF7A 3HPHA 4M6VA 4ENJA 3A0HC 5LBQA 1FTZA 3DEEA 2L0KA 1FOWA 1ACIA 3HOYJ 1ZGAA 1DPUA 4PGGA 3F8FA 1LDDA 4Y7NJ 3CJRB 3J81K 4QTRA 1TTYA 2OZUA 2O8KA 3BJ6A 1KU9A 3CCYA 1ERDA 3E6MA 1SC7A 1W0UA 3BG7A 2ZO4A 4I6ZA 2JPBA 1JKQC 1V5FA 1TNTA 3ROUA 4IF4A 5FKMA 1P7JA 2ME0A 1TQIA 4LG0A 4OAZA 2FBHA 1CF7B 4UUVA 1P92A 3OIQA 3S32A 1S5LC 2X6YA 3CUOA 4ZYGA 5B5EC 2LSOA 4O3MA 3D1NI 3GTKJ 3BJOA 5L3GA 2DOAA 4CYCB 2FJ1A 1WFXA 2W25A 3PUBA 3V8JA 5JHFA 2IBDA 2Q8KA 1RI7A 1Y0NA 1MGTA 4IXAA 3PM1A 2V1DA 1V5EA 2V1NA 4II2A 3IAS2 3TL4X 1IN5A 2DO7A 2JMWA 4RLFA 1FTTA 3HXLA 1O3TA 5FFZA 3MEXA 4JK1X 3BTLA 3OYLA 4CCOA 2Y0SA 3ERMA 1FBUA 1YYVA 4OINF 2R5YA 2NVTJ 2LTPA 5CPRB 4MQ9F 2VXDA 4P5OA 3QOEA 1U5TC 2XB5A 3P9IA 1YRNB 2ACJA 2VJ5A 3QP6A 2CH0A 2NVUB 1WQ2A 3RYPA 1HSTA 1BIBA 3C2BA 2CWEA 3PO2J 3BTCA 3GWZA 3KZZA 2F5EA 2W1OA 1G4DA 1I39A 3MQ0A 2LMDA 4M3FA 2DYSH 3PSIA 4MQVA 3VPRA 4LLLA 4OU0A 4DNCA 3S17J 5LEJA 5K5QA 2IT0A 3CDLA 3OOUA 2OA4A 1U78A 5HVQC 3PUFA 5HS9A 1ZHFA 3LAPA 1LUJB 3WG9A 1QPIA 1ON2A 4L9TA 1B8IA 4BXUA 2ZSHB 2NXNB 4EJVA 3K4KA 3NEUA 2OAZA 2HYFA 4F55A 1HKSA 2JPCA 3GX4X 3E5UA 5AIPA 2BGCA 3K70C 1U9NA 1Z7LA 2VPRA 5IYBJ 3IH4A 1V54H 1V5GA 1SD6A 3E6BA 1MBHA 3V7RA 2AO9A 4PUSA 1V3FA 3HKZN 3JRIA 1P6RA 3BTJA 2F5DA 3PQJA 5D8LB 3L09A 3RDIA 3JRFA 2OF7A 3FXRA 4U0YA 2M45A 3VDXA 5JI6A 2WC2A 3HEFA 3LMMA 4BS9A 2K86A 4HA8A 3AFHA 2K9SA 3SFZA 3F3XA 2HDDA 1MH4A 4JQFA 5CVRA 2ZXJA 1R1VA 5LGUA 4RAZA 3OS2A 1WCMJ 2M87A 4II3A 4IJAA 1NG6A 3BZ6A 2ISYA 2D5VA 3KX2A 4C2TA 4E70A 3GTGJ 1FP1D 2MC4A 4KT6A 1EA3A 4N9HA 1R5ID 2L9VA 2XDVA 2LFBA 4D9JA 2A3SA 2CG4A 1PDNC 3WE3A 4A3DJ 2IXSA 2E2IJ 3GTOJ 2VE9A 3KCCA 3SZTA 5AIQA 2LG4A 4HNUA 3SHFA 1WGXA 3ZN0A 2BE5F 3Q0VA 5H6RA 4GRIA 2BVMA 3HIFA 2JVGA 4UVAA 4FTHA 3G4SI 3G1MA 5E8IA 5EEHA 1VFCA 1EKEA 1ZLKA 2PJRB 4EATA 2EIMH 4KISA 4I99C 4WCGA 1EF4A 3OYKA 5J4YA 2COMA 5IT9Z 2LYCA 1W4MA 5KK1A 2HXOA 2FRHA 5TGTA 4HLYA 2HS5A 1Q1HA 1Z77A 3I54A 4BY7J 5D8KB 5LHIA 3JRBA 1E3OC 4V2GA 1GT0C 5CQEA 2JQ7A 1EV7A 4HV6A 1X2MA 3ELKA 4C30A 5FJ8J 3V8LA 3W6KB 1W5TA 3IL2A 1ZTRA 3KP2A 3F23A 1MSFC 2ZJPF 2EIKH 4N9IA 3G71I 5IYDJ 5HOOA 4LK0F 1MBGA 2XPUA 5J3LA 1IO2A 1EJ9A 2VONA 1RR7A 1OCRH 3H1CA 5L3DA 3JRCA 2XUBA 4B3AA 1TWHJ 1JT6A 3M4OJ 1IF1A 3C18A 3QWLA 2BHYA 2K3PA 3F8CA 4E7LA 2R5ZB 3REOA 4R79A 3WTTC 4A3GJ 5DV5A 3TKYA 4EVIA 2GBYA 3GLLA 3FXLA 3CF5F 1SVOA 3DBHB 1QZZA 2L7ZA 3MMYB 5FLMJ 5GAEJ 3CP8A 2AQEA 3PIOF 1AKHB 2AXTC 4RB3C 1PUEE 4B3XA 4Y52J 2C6YA 4I02A 3EQLF 1Z6RA 4AC0A 1X1DA 3FXMA 1HDDC 2JWTA 4A0XA 3VOEA 4LD5A 4HSRA 4CCKA 2EFWA 3COAC 2XGEA 2HFHA 3Q9SA 2BW3B 3QU3A 2LDUA 1OQYA 3FXQA 4P9UA 3CCEI 3DTIA 5ED4A 2FF4A 2GA1A 3A03A 2P81A 1IDZA 2DT5A 3UNGC 3F21A 2X85A 5F6FA 3L2UA 2JJ7A 4RS8A 3W3CA 1D0ZA 2UXXA 2VKVA 4WK8F 2FU4A 4ZYEA 3VWBA 2EWNA 2XF6A 1B9NA 1TNSA 3MFKA 4X0GA 1D1CA 2ID3A 2WY7Q 4U0WA 3GTMJ 2HYGD 2PFBA 3L2WA 4AYBN 5EF6A 3MWMA 4BEHB 4CZCA 1FX7A 1TWGJ 1TWCJ 5K7FA 2X0LA 3I64A 2LY1A 3Q0WA 1RR8C 4N0BA 4EM0B 4ZTFA 5JVGF 2IS2A 4RLQA 2A5WA 1MBKA 3HC7A 3HSFA 1F36A 2DI3A 1B72A 1FC3A 4M3DA 3GXOA 1BJAA 2E5ZA 2R0QC 5DM6F 3KP6A 2YX7A 3CCRI 1VNDA 4F92B 4DZPA 3W2WA 2IGNA 2EILH 2HOEA 2M9HA 3KETA 4XSXF 2VJJA 3H3ZA 5E1WA 4YFKF 4HF0A 2ELHA 3W6JB 3I4NJ 3ECHA 5E79C 1AHDP 2R7WA 2CYYA 2P7CB 1PVEA 1D0XA 1QHGA 1IZ1A 1QVUA 3H0DA 2VBXA 2G9WA 2A68F 1SAUA 3S2WA 1WJEA 2CMPA 5GPCA 1HA8A 4HPQA 1I6XA 4OIOF 2DPUA 2A5YB 1TQPA 2FX0A 3CLOA 4YELA 1IRGA 3WTVC 3WU2C 4UV8A 3HSEA 1YTYA 4KUMA 4HLXA 1KGSA 5TISC 5FLXK 2KHMA 5GAHJ 2QQ8A 5HDNA 3HG9A 4DW6A 4B8XA 4BEHA 4EV0A 3RPUA 3T8TA 3HZJA 3PSFA 3RQ4A 2M30A 4RGSA 1YO5C 3RZOJ 2LBFA 2R7TA 3G1OA 5FLXZ 3PL8A 1MSEC 2DFFA 3V42A 1XX5A 2LVSA 1MH3A 2K7LA 1IRXA 2ZCWA 4HV5A 1ZREA 1PYVA 3VB2A 2DTZA 3IWZA 4QSHA 3IH3A 5FD6A 1OFCX 1BW5A 3KEOA 2E1CA 3NQOA 3U1DA 1X3WB 2A61A 5DEQA 2QKLB 5TRDA 4IVNA 4RM2A 4Q47A 2DMQA 2JRTA 4OMZA 2YX4A 4Z6YA 4H0EA 2DOEA 3JR9A 2E1OA 1MJ9A 2HOAA 2QA4I 2ADUA 1ZG1A 2VB6A 4DYRA 1R5GA 2CRGA 4L5IA 1VQ7I 4HBLA 1XGSA 2X1CA 3VYRB 2OZ6A 2HQRA 1FOYA 2DA4A 1BW6A 3H0GJ 2IPQX 3SDBA 4FE7A 2B63J 1E17A 1QZEA 3G3ZA 2K3FA 4IRGA 1XS9A 1WPKA 2K02A 1B6AA 1RIOH 2X9DA 1AU7A 1U9OA 2MH2A 4A6DA 5C4JJ 2HOSA 2P4WA 1BI3A 2W57A 4CYCA 1E0EA 5BMZA 1OCTC 5C4XJ 1WVRA 1VQKI 3MAJA 5JFRA 4IHYA 1ZH5A 3EUHC 3AAFA 5A2QZ 3R4KA 5DM7F 2VBYA 3LOCA 2OBPA 4Y4RA 1HW1A 1WH5A 2X6OA 2V26A 1R7JA 4I0BA 4XRFA 3TW7A 3GTQJ 2KJBA 5E20A 2GOMA 4KIFA 3JTGA 2Z2SB 3S93A 3P7NA 3M8EA 4RB0A 1VQMI 2HNHA 2CO5A 4JYKA 2Z99A 2P7VB 4PJMA 4E7SA 3BZKA 2DT6A 3D5RC 1K61A 1SD4A 4DYCA 4P96A 2KJCA 4BJTA 3L7WA 2DW4A 3S16J 3DKWA 2XC7A 5K1YA 1O4XA 3TO7A 4A0ZA 1J09A 2HYJA 3TOAA 2RGVA 3KE2A 4A3EJ 2DJNA 1USSA 2HZDA 5DD4A 4M74A 3WU1B 2GA2A 2I5UA 4L9VA 4DJAA 1S72I 4OOIA 3RKQA 3A4CA 1IC8A 3FZVA 3QYBA 3EUAA 1QU3A 1YOVB 1SD5A 2HKXA 1AA7A 3HM5A 4UUTA 4JOMA 1SFOJ 2MH9A 3MD2A 1VQ6I 4S05A 4BJ5C 3IUOA 1TT5B 3HBLA 3KFWX 1R49A 3BTIA 1LVAA 1DDNA 5FO5A 4BNCA 1ZRFA 3CCVI 4UV9A 3HUGB 2KDOA 4EJWA 3OOPA 3SXYA 4MNUA 5DYMA 3N97A 3L1PA 3MZHA 5IY5H 4G7ZF 3ASNH 3GFMA 4UB8C 3H3VK 2XGCA 1UHWA 1S8NA 2CQKA 4BHPA 1K79A 1PUFA 4I98B 2YR2A 4EJTA 2BW3A 2P8TA 4XOPA 1WWXA 3WTXC 4XONA 2PG4A 2W82A 3C2GA 5IP9J 3BCAA 4UHTA 2L02A 5ERIA 1KU2A 3UKGA 1LFBA 3NWSA 4M6YA 4A3FJ 1O7FA 2MLGA 3ABLH 2ZNZA 2RVCA 4GO1A 3HRSA 2E35A 3K0LA 5GADJ 2X6WA 4DQ2A 4YFXF 2JRMA 2LKXA 3ZQ7A 3OMYA 1B1BA 1TP4A 2OPTA 1YJ9I 2V1XA 1YX3A 1MMSA 1REPC 4ASNA 2EIJH 2R7RA 5JHUA 2CS3A 2VJ4A 3KYCB 1W36D 4MGRA 4I01A 4MO7A 4R8HA 2OCCH 1B8IB 2FMYA 3H92A 2PEXA 1ZGWA 4FISA 4BUPA 2MFZA 5FKKA 1HKQA 2QSFX 5D5VB 4I2OA 2E1MB 3FK7A 1WRJA 4XLAA 2VC0A 4A0YA 3CJNA 4JBAA 1R22A 2H1LA 3ZQFA 5D5XB 3CMAI 1BL0A 1BOBA 1RC9A 2I10A 2KLOA 4M6XA 1LJ9A 3FK6A 4XMYA 5E18F 2VKEA 3EPZA 1FMVA 3F6OA 3K2ZA 1U6GA 4LLGF 4A3BJ 5FRMA 1UJ8A 4HZFA 1IN6A 3R0JA 4A12A 1T39A 4FETA 4HF2A 5J6XA 4GFBA 1D8KA 3O3KA 4NDLA 3DXJF 3ZQHA 4CCJA 2BHZA 2HQNA 2WWYA 1RNLA 1SEUA 1SAXA 2L7MP 3I59A 3CCLI 2IJLA 2B0LA 2R92J 2EBIA 4KFCA 1ZR2A 2CJJA 2HVSA 1CQTA 5JLXA 1OPCA 3F8MA 5CYVA 3OYBA 3DKXA 4BY1J 2UUZA 4RAGA 2GXBA 3I4MJ 2FOKA 1XGOA 4XK4A 4QPQA 3DEWA 2HEOA 5DUKA 2KDZA 5DDGA 1PP8F 4CSWA 1R4NB 1SMTA 5H6QA 4B09A 4A93J 3MKYB 5ICFA 2F5CA 2XF7A 3BP8A 1I3AA 3CZ6A 1XN7A 1FOKA 3GTJJ 4IQ4A 2CV1A 4HAMA 3MKWB 4PSXA 4X1EA 5JVTA 2E2HJ 3AL0C 2M7AA 1FZPB 1X1PA 1YW9A 2CUFA 5B3SH 1GV2A 5DCFA 4PCQA 5D4SA 5H20A 1BIAA 4XIDA 3SJMA 2HZTA 2IGKA 2DT7B 2FQ4A 3RYRA 2BZTA 3DF8A 2HPIA 2VOOA 3CD6I 2K9NA 2JA8J 1X1BA 3QODA 3N4MA 3D0SA 2DDBA 1MBJA 2RREA 3BROA 1IUYA 4XLEA 1KU7A 4EMSA 1X19A 3DLLF 3S15J 4PZJA 1R1TA 4A6EA 1AKHA 2HDCA 4G7OF 2V1UA 1A31A 3IC7A 3KLNA 3CMEI 3HHGA 4XN0A 1UZCA 2XAFA 4D7NA 3I58A 3R6SA 2O8XA 5JR3A 1UG0A 3KIOA 2E2JJ 5J4VA 2CUJA 1X1AA 4BL0B 2Y0SN 3K1MA 5IP7J 4G94A 2AHQA 3I3LA 4EEFG 4M9XA 4ZYAA 3TBIA 2H6BA 3M1CA 2R4GA 1JKRC 4BACA 4BDYA 3ZQCA 1FY7A 3IRQA 3LFUA 2LNBA 1I1GA 2HDWA 4ON0A 1G59A 3BLYA 2R7FA 2ZFWA 3CF2A 3KP4A 4E7HA 3DLAA 1FSHA 3DU6A 2KIUA 3OYJA 1YJWI 2XIGA 2XKOA 2A69F 2G0EA 2YS9A 1W7PA 3OWTA 4CCLA 3K7AJ 4LJZF 4MTEA 2VQHA 2HI3A 3L2QA 4XNFA 1I6HJ 3AG3H 2ZXIA 5HLIA 1J5YA 3ONQA 2MW8A 1H0MA 3H35A 1I3QJ 4M3EA 2JA2A 2ZMEC 2TRTA 3JRHA 3ZP5A 1JGGA 2VT3A 1Z91A 2JA5J 4BQAA 3BDDA 3T1BA 1ZQ3P 2ESHA 4ITVA 5HDGA 4ZZDA 3AL0B 3X2QH 1O3QA 1UMQA 2KT0A 1DU0A 1ETOA 2XAGA 4KN4X 3NRVA 3FM3A 2NVXJ 4FASD 2IAIA 2MLKA 1QGPA 4DBQA 2EFQA 1TC3C 3MKLA 1LB2A 4RA2A 2HU9A 1IRFA 4CGZA 2M0MA 1P4WA 2UXNA 4JX6A 4PJLA 2N8GA 3JRDA 2R5ZA 1R00A 2VQGA 2GWRA 3ABUA 5DTDA 3OYAA 4IHXA 1IN4A 5E1ZB 3OYGA 3EUKL 4M9ZA 1PJRA 1TW2A 1YHQI 1RPWA 2DMTA 1XGNA 4D5FA 1GXPA 3BPVA 3LL7A 4HNTA 1RKWA 2NS7A 2O7OA 3I5UA 4WXCA 4EJUA 4W97A 4BXXJ 2M4KA 5DUIA 2ZXHA 2K9LA 2ZMEA 4B43A 4Y15A 1AOYA 2EZKA 4AVPA 3RKWA 1OMIA 2FD5A 2PMZN 3SZGA 2E1NA 5H2FC 2E7WA 2BEOA 2E7XA 5FB2A 4DYQA 1NG7A 2IW5A 1F43A 1TW3A 2V6CA 1IAWA 1QHHD 3ESWB 5F64A 3MCZA 2VN2A 4B1RA 5D4RA 1D0YA 5BOXA 2YU3A 2PN6A 4XKWA 3HOUJ 5CVVA 1FOXA 3B73A 1FP2A 3LQQA 3J7AY 5CJ9A 3I71A 4XKVA 3DTEA 3ZQIA 2LK2A 4HX4A 4LFUA 6PAXA 4NNJA 3OSFA 3BC8A 1J75A 1ON1A 2DA7A 2EA4A 2VE8A 3OIPA 4RGRA 3IAM2 2XPVA 4XRSG 1I27A 1VZ0A 3OYMA 3GLXA 3PNVA 2RAEA 2MD0A 4IEJA 1BR4A 4KN7X 3HOSA 2M5WA 1JTXA 3HHHA 2BY3A 3MVPA 3SEQA 4YIRX 1ZR4A 3S1RJ
chains in the Genus database with same CATH topology
2EA2A 4NQWA 2DQRA 2FA5A 3FWEA 2VBZA 3C7JA 3IKTA 3DV8A 4MHGA 3L00A 3T5XA 2EV5A 3M8FA 4HQEA 1I1SA 1FPQA 4IRHA 3LAJA 4M73A 2NS0A 1VTNC 4KICA 2EB7A 2JZYA 2PI0A 4AIHA 1IXCA 3KP3A 1MDMB 2O3FA 2D45A 1KYZA 3ISPA 3J7AO 5FGMA 2FEZA 4ESBA 1K78A 3KEQA 3ZN1A 3U2RA 3GFIA 1ONVA 1KA8A 1B59A 5HS7A 2X4HA 4L18B 4UNOA 5LGNA 1O7LA 5FFXA 1JXSA 2EFNA 3PFIA 3M9AA 4FX0A 5ICCA 2XAHA 4U88A 4HX7A 4EJOA 2FXAA 1XMAA 2W84A 2ZBKA 3M7GA 1W7PD 4KIBA 2DAOA 2PMUA 2Z5UA 3EETA 1MDMA 2XROA 1L3LA 1XMKA 2IVMA 2F2EA 4G9YA 1T6SA 2JTVA 2A6EF 4KNYA 2L54A 3FF5A 1YQAA 3GZ6A 3F8NA 3FMQA 2DTRA 4LB6B 1BI0A 3R60A 3VFZA 2D1VA 1C0WA 2HGCA 2QYOA 4LGWA 4ZYDA 1RZ4A 3GEZA 2XV4S 2NRAC 2V79A 3CTAA 4UVCA 3U9GA 1ZG5A 5L3BA 3DP7A 2V9VA 3QP5A 3I59B 3P9CA 1U5TB 5FD5A 3EUHA 3JSPA 1MD0A 4KYWA 4MEYF 3ERED 3I4PA 5LRSA 4HF1A 1FYMA 2QENA 3T8RA 1U2WA 1P4AA 2LKPA 2QUFA 3GF2A 2JT1A 2A6HF 1E2XA 3K69A 3JTHA 2MA3A 4QLCU 4RGUA 4RB1A 4Y17A 1DPRA 4M71A 3K1PA 5D5UB 2RC4A 4MTDA 3TGNA 1S7OA 1LEBA 1W5SA 2L4MA 2D1HA 2RDPA 5KVRA 1OYYA 3PQKA 5TJJA 1DP7P 1IN8A 1H9GA 1XSDA 2FBKA 2EFOA 1RUNA 1D5VA 2KIMA 2WTEA 1J2XA 1T0FA 2O0YA 1G3SA 1Z9CA 2P6SA 2HTJA 1HXDA 3E97A 1UHMA 2O03A 2YPRA 2NYXA 4CXFA 2GQQA 4LK1F 2IP2A 3GO5A 5F1RA 3DQVC 3E6CC 4P9FA 1DUXC 1S29A 3KP7A 3ZMSA 3GYHX 4GXOA 2RN7A 1KYWA 1W7PB 2Q2EA 1NHAA 3F22A 3E5XA 4Y13A 3B02A 3V7CA 3J80Z 1B9MA 3L2CA 5IT9K 3FX3A 2QQBA 3SZPA 1TBXA 3H3UA 2RNJA 3TDUC 1U8RA 4O5VA 1X3UA 4WXDA 3KZYA 1CF7A 2L3DA 3D5LA 1MKMA 4I7HA 4LG0B 5L3EA 3IKVA 3ZMDA 4BHCA 1RUOA 1SFXA 1LEAA 3SQNA 4RB2C 3QAHA 2DQLA 5CVJA 3CUQC 1R5HA 1HQCA 2VT2A 3ZMTA 5ILSA 4OMYA 5BQTA 2P5VA 3V8KA 1YW7A 2FNPA 1HW5A 4I09A 3VODA 3ZMVA 3JAMZ 3R0AA 1D3YA 1ZAOA 3F8BA 5HLHA 3T0YA 2EV6A 1F5TA 4FX4A 2WV0A 4L5JA 1BI2A 1IXSB 1G6NA 1K6OA 2P5KA 2W24A 1QBJA 2P5LC 2NNYA 1XSXA 2Z33A 1G3WA 2O6GE 2F5FA 4YIFA 1PP7U 2FNAA 5D6EA 5HDKA 2QBYA 1B4AA 2CGPA 5AONA 3O2PE 3WGIA 1GHCA 4AIJA 3Q9VA 2EJRA 3HRUA 4YIIA 1XB4A 1FYKA 4HW0A 1FYLA 1YW8A 3ML6A 1BOAA 1XCVA 3EYYA 5LEKA 1EH7A 1G3TA 5D5WB 1JGSA 5LRRA 3P9KA 1T38A 1SFUA 2VOPA 2XKPA 2R7DA 3ZMUA 1EH6A 2IRFG 1MJAA 3FHZA 5CVUA 1V4RA 4ESFA 2CSOA 2LF8A 1QO0D 4QWQA 5E8GA 3WGHA 3CO6C 4Q48A 4ZYHA 3CUQA 4IHTA 4AIKA 3DPTA 3LA7A 5A2QK 4LMYA 2GAUA 2VC1A 1IN7A 2L4AA 3GFJA 2AXLA 4K2EA 3RIRA 2OU2A 3LQRA 1U3EM 4WXHA 3J81Z 4BAYA 2RKHA 3GUDA 4GYGA 3HUGA 3IRRA 1ZGJA 3GW2A 2FMLA 2QQAA 1KU3A 3WGGA 2QM3A 2GIVA 1MJBA 1F4KA 1K78B 1WI9A 2DFIA 4EGZA 3VEPA 4UVBA 1LQ1A 1YFHA 5LLQA 4BHBA 3TO6A 2PJPA 4HQMA 5E1XA 1BC8C 2FE3A 1XCBA 3LFKA 2STTA 1T2KA 1JHHA 5LHGA 4EM1A 3K9TA 2HKOA 3J80K 1FWZA 1S6LA 1JHFA 4XLNF 4KA4A 4UXNA 4BYYA 1LDKB 3HRMA 5CVIA 3DFGA 2R3SA 5BPIA 4R1HA 1OYIA 4CICA 4KDPA 3O6BB 4IHSA 3FMSA 2XGXA 2XRNA 4U7BA 1G3YA 4FT8A 3C3WA 1U78A 3EDPA 2H6CA 2ZKZA 4U0VA 1S7AA 4XBFA 2Y48A 2TDXA 1Z05A 4O6JA 4EGYA 4ENMA 2J5PA 1P2FA 3DEUA 1F1ZA 3F72A 4XLPF 5EEGA 1XDSA 2QZ8A 5BPDA 1UFMA 2DPDA 3KLOA 2Z3YA 1GXQA 2OD5A 4LB5A 2FQ3A 3MZYA 1FNNA 3QPTA 3ULQB 2XAJA 1J9IA 3RTRA 3EYIA 2ETHA 4A5NA 4G7HF 1HKTA 1H9TA 1HSJA 1ZLJA 1I5ZA 4D0PA 4ETSA 2XVCA 1UCRA 2EFPA 3ZPLA 4P55A 1OYWA 3WE2A 1ZRDA 2KIFA 2QWWA 1T98A 4A2UA 3RKXA 1R36A 3WTYC 3E6DA 3OV8A 1O3SA 3WTZA 1EH8A 2ZNYA 2M1BA 3IWFA 5DCMA 3BWGA 4KIGA 3WTUC 1LNWA 3WTSC 1L0OC 5L3FA 2HR3A 4S04A 2Q0OA 3QOPA 1O57A 5J8CA 1HW2A 1YS6A 1KQ8A 2DK8A 4GYIA 3KP5A 2JSCA 2IA2A 2ZMEB 4M72A 4ZZLA 2EV0A 3QPHA 1FLIA 1XGMA 4OIRF 3FMRA 5L3CA 3TQNA 4Q5SF 2O61A 2D2WA 3L9FA 2W85A 1CGPA 4L9NA 2XAQA 2DU9A 3I0TA 4NHJA 1TQMA 2VXZA 1Z7UA 5HLGA 3JSOA 3HYIA 2G7UA 1J0RA 4L0ZB 4OIPF 1OKRA 3HTUA 4KT5C 3GFLA 3LSTA 4G8XA 3WTWC 2OQRA 4G6DA 2Y0MA 3WODF 2P6TA 2MD5A 5J8FA 4G6QA 4PDKA 3LA3A 3HTSB 3HRTA 4CDGA 1KQ9A 2QLZA 2H27A 2Y75A 1BM9A 3HOTA 2MC3A 4WF2A 1QQIA 3V7SA 1R58A 3ABTA 3C1DA 1J7KA 4KMFA 5ICEA 2YSRA 3G73A 1STZA 3R61A 2FSWA 2G7HA 5BS6A 4RGXA 1BI1A 1Y0UA 4Q4ZF 1R23A 1P4XA 1YG2A 2IA1A 2CFXA 3BOQA 1WSUA 1GVJA 3IHUA 1ZRCA 1MZBA 2BV6A 4L9JA 4A5MA 4ENKA 1XD7A 1QZYA 4RAYA 1ZARA 3K1NA 2MBFA 1XDUA 4HX8A 4XSZF 1ZG3A 2A07F 1BC7C 4EM2A 5IT3A 1ULYA 1ZYRF 1U5TA 2DK5A 2NNNA 3CDHA 2FBIA 2STWA 1UB9A 3F6VA 2M8EA 1USTA 3TO9A 5K5OA 2PMHA 1SMYF 3Q5FA 3I53A 3BPXA 1BBYA 3BY6A 3FXUA 2VODA 3DPLC 2AS5F 2Z9OA 4NB5A 3FM5A 4M9SA 2DBBA 1ZN2A 4OIQF 1WKMA 4IRIA 1F9NA 5D6FA 4GCVA 2KRFA 3M1EA 2PBIA 4PGHA 3RKYA 2NAZA 3RJPA 1FBQA 2OQGA 2BYVE 2RV8A 1Z6TA 2K4BA 3RI4A 4F7ZA 5ILUA 1YS7A 1HBXG 3TDZC 2K27A 2DLLA 1AWCA 5ICGA 2PLYA 1QPMA 4CYDA 1QNTA 2QBYB 2PQ8A 1TLHB 4WX9A 1K7AA 1YIOA 3WU0A 3CUQB 2ISZA 2ESNA 4KMUX 2UZKA 3QU6A 1FBSA 3TOBA 4YG2F 1O3RA 2H94A 5LGTA 3ZMZA 4HDUA 2VBWA 1SD7A 2RQPA 3ECOA 5LHHA 4CZZA 4AWXB 2J5OA 3E3VA 3BJAA 2UWMA 1D8JA 1JE8A 3LA2A 4U7DA 5DCMB 3HSRA 4EQQA 3JAMK 5K5RA 5HS8A 2XASA 3V4GA 2HWVA 2EK5A 4I0AA 1R1UA 1A04A 2KKOA 1KQ0A 2H09A 1BN5A 2ZJ2A 5E17F 2BBYA 1S3JA 3LWFA 1LDJA 4Z2YA 3RPQA 4LLNA 4CO8A 2L01A 2K4JA 2QVOA 4YFNF 1J59A 1Z1DA 3CO7C 5DD8A 4HDVA 3QRFF 1XSVA 1OR7A 1FSEA 2CW0F 4ESJA 4L0YB 2IA0A 1FT9A 2QQ9A 2GZWA 4HYEA 4MEXF 3JW4A 4TV7A 4CHUA 1YLFA 3E5QA 4HOBA 4IPAA 4ZH4F 2XHKA 1IW7F 5CLSA 2HTSA 4BH9A 4WWCA 3GVAA 5ILVA 4GGGA 4ENNA 4FHTA 3GZ5A 1ODDA 4AD9A 2GXGA 1IXRC 1SFEA 2LF7A 4ENJA 5LBQA 1ZGAA 1DPUA 4PGGA 3F8FA 1LDDA 3J81K 1TTYA 2OZUA 3BJ6A 1KU9A 3E6MA 2ZO4A 2JPBA 1TNTA 3ROUA 4IF4A 1TQIA 4LG0A 2FBHA 1CF7B 4UUVA 1P92A 3CUOA 4ZYGA 4O3MA 2LSOA 3BJOA 5L3GA 2W25A 3V8JA 2Q8KA 1RI7A 1MGTA 4IXAA 2V1DA 1IN5A 2DO7A 1O3TA 5FFZA 3MEXA 4JK1X 1FBUA 1YYVA 4OINF 4MQ9F 4P5OA 1U5TC 3P9IA 2ACJA 3QP6A 1WQ2A 3RYPA 1HSTA 1BIBA 2CWEA 3GWZA 3KZZA 2F5EA 1G4DA 3MQ0A 4MQVA 4LLLA 4OU0A 4DNCA 5LEJA 5K5QA 2IT0A 2OA4A 5HVQC 5HS9A 1ZHFA 3LAPA 3WG9A 1ON2A 4L9TA 4BXUA 4EJVA 3NEUA 2OAZA 2HYFA 1HKSA 2JPCA 3GX4X 3E5UA 5AIPA 2BGCA 1SD6A 3E6BA 3V7RA 1V3FA 1P6RA 2F5DA 3PQJA 5D8LB 3L09A 3RDIA 3FXRA 4U0YA 2M45A 5JI6A 2WC2A 2K86A 4HA8A 3SFZA 3F3XA 4JQFA 5CVRA 2ZXJA 1R1VA 5LGUA 4RAZA 2M87A 4IJAA 3BZ6A 2ISYA 4E70A 1FP1D 4N9HA 2A3SA 2CG4A 1PDNC 3WE3A 2VE9A 3KCCA 3SZTA 5AIQA 3SHFA 3ZN0A 2BE5F 5H6RA 3HIFA 4UVAA 5E8IA 5EEHA 1ZLKA 4WCGA 2COMA 5IT9Z 1W4MA 5KK1A 4HLYA 2FRHA 2HS5A 1Q1HA 3I54A 5D8KB 5LHIA 1EV7A 4HV6A 3ELKA 3V8LA 3W6KB 3IL2A 3F23A 1W5TA 3KP2A 4N9IA 5HOOA 4LK0F 2VONA 5L3DA 2XUBA 1IF1A 3C18A 3F8CA 3REOA 4R79A 3WTTC 5DV5A 3TKYA 4EVIA 1QZZA 1PUEE 4RB3C 2C6YA 4I02A 3EQLF 1Z6RA 4A0XA 3VOEA 4LD5A 2EFWA 3COAC 2HFHA 3Q9SA 3QU3A 2LDUA 4P9UA 3FXQA 5ED4A 2FF4A 2GA1A 2DT5A 3F21A 5F6FA 4RS8A 2UXXA 4WK8F 2FU4A 4ZYEA 2EWNA 1B9NA 1TNSA 3MFKA 4U0WA 2HYGD 2PFBA 3MWMA 1FX7A 2X0LA 3I64A 4N0BA 4EM0B 3HSFA 2DI3A 1FC3A 3GXOA 1BJAA 3KP6A 2YX7A 2HOEA 3KETA 4XSXF 3H3ZA 5E1WA 4YFKF 4HF0A 2ELHA 3W6JB 3ECHA 2CYYA 2P7CB 1IZ1A 2VBXA 2G9WA 2A68F 3S2WA 1I6XA 4OIOF 2DPUA 2A5YB 1TQPA 3CLOA 1IRGA 3WTVC 4UV8A 3HSEA 1YTYA 4KUMA 4HLXA 1KGSA 5FLXK 5HDNA 4B8XA 4EV0A 3T8TA 3RPUA 2M30A 4RGSA 1YO5C 5FLXZ 2K7LA 2ZCWA 4HV5A 1ZREA 3VB2A 3IWZA 5FD6A 3KEOA 2E1CA 3NQOA 3U1DA 2A61A 5DEQA 5TRDA 4IVNA 4Q47A 2JRTA 4OMZA 2YX4A 4H0EA 1MJ9A 2ADUA 1ZG1A 1R5GA 4L5IA 4HBLA 1XGSA 2OZ6A 2HQRA 2IPQX 1E17A 3G3ZA 4IRGA 2K02A 1B6AA 1RIOH 2MH2A 4A6DA 2P4WA 1BI3A 2W57A 5BMZA 3MAJA 5JFRA 1ZH5A 3AAFA 5A2QZ 3R4KA 2VBYA 2OBPA 1HW1A 4I0BA 1R7JA 4XRFA 2KJBA 5E20A 4KIFA 3JTGA 3P7NA 3M8EA 4RB0A 2CO5A 2Z99A 2P7VB 1SD4A 4P96A 2KJCA 3L7WA 2DW4A 3DKWA 5K1YA 3TO7A 4A0ZA 3TOAA 2RGVA 3KE2A 1USSA 5DD4A 4M74A 3WU1B 2GA2A 4L9VA 4OOIA 3FZVA 1SD5A 2HKXA 2MH9A 4S05A 3KFWX 1LVAA 1DDNA 5FO5A 4BNCA 1ZRFA 4UV9A 4EJWA 3OOPA 3SXYA 4MNUA 5DYMA 3N97A 3MZHA 4G7ZF 3GFMA 1UHWA 1S8NA 2CQKA 4BHPA 1K79A 4I98B 2YR2A 4EJTA 2P8TA 1WWXA 3WTXC 2PG4A 4UHTA 2L02A 5ERIA 1KU2A 4M6YA 1O7FA 2MLGA 2ZNZA 2RVCA 4GO1A 3HRSA 3K0LA 4DQ2A 4YFXF 3ZQ7A 1B1BA 2V1XA 1REPC 4ASNA 5JHUA 4MGRA 4I01A 4R8HA 2FMYA 3H92A 2PEXA 1HKQA 5D5VB 4I2OA 1WRJA 2VC0A 4A0YA 3CJNA 4JBAA 1R22A 5D5XB 4M6XA 1LJ9A 5E18F 3F6OA 3K2ZA 1U6GA 4LLGF 4HZFA 4A12A 1IN6A 3R0JA 1T39A 4HF2A 5J6XA 1D8KA 3O3KA 3DXJF 1SAXA 2HQNA 1RNLA 2WWYA 3I59A 2IJLA 2B0LA 4KFCA 1OPCA 3F8MA 5CYVA 2GXBA 2FOKA 1XGOA 2HEOA 5DUKA 5DDGA 1PP8F 1SMTA 5H6QA 4B09A 5ICFA 2F5CA 3BP8A 1XN7A 1FOKA 4HAMA 5JVTA 1FZPB 1YW9A 5DCFA 4PCQA 5D4SA 5H20A 1BIAA 2HZTA 3RYRA 3DF8A 2VOOA 3N4MA 3D0SA 3BROA 1IUYA 1KU7A 4EMSA 4PZJA 1R1TA 4A6EA 2HDCA 4G7OF 2V1UA 3IC7A 3KLNA 3HHGA 2XAFA 3I58A 3R6SA 2O8XA 5JR3A 3K1MA 4G94A 4M9XA 2H6BA 1FY7A 3IRQA 2LNBA 1I1GA 4ON0A 2R7FA 2ZFWA 3KP4A 1FSHA 2KIUA 2XIGA 2XKOA 2A69F 1W7PA 4LJZF 4MTEA 5HLIA 1J5YA 1H0MA 3ZP5A 2VT3A 1Z91A 4BQAA 3BDDA 3T1BA 2ESHA 5HDGA 4ZZDA 1O3QA 2XAGA 4KN4X 3NRVA 3FM3A 2MLKA 1QGPA 2EFQA 1LB2A 1IRFA 4CGZA 1P4WA 2UXNA 1R00A 2GWRA 3ABUA 1IN4A 5E1ZB 4M9ZA 1TW2A 1XGNA 1GXPA 3BPVA 4WXCA 3I5UA 4EJUA 5DUIA 2ZMEA 4Y15A 1AOYA 4AVPA 3RKWA 1OMIA 2E1NA 2E7WA 2BEOA 2E7XA 5FB2A 2IW5A 1TW3A 2V6CA 1IAWA 5F64A 3MCZA 2VN2A 5D4RA 5BOXA 2YU3A 2PN6A 5CVVA 3B73A 1FP2A 3LQQA 5CJ9A 3I71A 4HX4A 4LFUA 6PAXA 1J75A 1ON1A 2EA4A 2VE8A 4RGRA 1I27A 3GLXA 4KN7X 3HOSA 2M5WA 3HHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA2 A;  4NQW A;  2DQR A;  2FA5 A;  3FWE A;  2VBZ A;  3C7J A;  3IKT A;  3DV8 A;  4MHG A;  3L00 A;  3T5X A;  2EV5 A;  3M8F A;  4HQE A;  1I1S A;  1FPQ A;  4IRH A;  3LAJ A;  4M73 A;  2NS0 A;  1VTN C;  4KIC A;  2EB7 A;  2JZY A;  2PI0 A;  4AIH A;  1IXC A;  3KP3 A;  1MDM B;  2O3F A;  2D45 A;  1KYZ A;  3ISP A;  3J7A O;  5FGM A;  2FEZ A;  4ESB A;  1K78 A;  3KEQ A;  3ZN1 A;  3U2R A;  3GFI A;  1ONV A;  1KA8 A;  1B59 A;  5HS7 A;  2X4H A;  4L18 B;  4UNO A;  5LGN A;  1O7L A;  5FFX A;  1JXS A;  2EFN A;  3PFI A;  3M9A A;  4FX0 A;  5ICC A;  2XAH A;  4U88 A;  4HX7 A;  4EJO A;  2FXA A;  1XMA A;  2W84 A;  2ZBK A;  3M7G A;  1W7P D;  4KIB A;  2DAO A;  2PMU A;  2Z5U A;  3EET A;  1MDM A;  2XRO A;  1L3L A;  1XMK A;  2IVM A;  2F2E A;  4G9Y A;  1T6S A;  2JTV A;  2A6E F;  4KNY A;  2L54 A;  3FF5 A;  1YQA A;  3GZ6 A;  3F8N A;  3FMQ A;  2DTR A;  4LB6 B;  1BI0 A;  3R60 A;  3VFZ A;  2D1V A;  1C0W A;  2HGC A;  2QYO A;  4LGW A;  4ZYD A;  1RZ4 A;  3GEZ A;  2XV4 S;  2NRA C;  2V79 A;  3CTA A;  4UVC A;  3U9G A;  1ZG5 A;  5L3B A;  3DP7 A;  2V9V A;  3QP5 A;  3I59 B;  3P9C A;  1U5T B;  5FD5 A;  3EUH A;  3JSP A;  1MD0 A;  4KYW A;  4MEY F;  3ERE D;  3I4P A;  5LRS A;  4HF1 A;  1FYM A;  2QEN A;  3T8R A;  1U2W A;  1P4A A;  2LKP A;  2QUF A;  3GF2 A;  2JT1 A;  2A6H F;  1E2X A;  3K69 A;  3JTH A;  2MA3 A;  4QLC U;  4RGU A;  4RB1 A;  4Y17 A;  1DPR A;  4M71 A;  3K1P A;  5D5U B;  2RC4 A;  4MTD A;  3TGN A;  1S7O A;  1LEB A;  1W5S A;  2L4M A;  2D1H A;  2RDP A;  5KVR A;  1OYY A;  3PQK A;  5TJJ A;  1DP7 P;  1IN8 A;  1H9G A;  1XSD A;  2FBK A;  2EFO A;  1RUN A;  1D5V A;  2KIM A;  2WTE A;  1J2X A;  1T0F A;  2O0Y A;  1G3S A;  1Z9C A;  2P6S A;  2HTJ A;  1HXD A;  3E97 A;  1UHM A;  2O03 A;  2YPR A;  2NYX A;  4CXF A;  2GQQ A;  4LK1 F;  2IP2 A;  3GO5 A;  5F1R A;  3DQV C;  3E6C C;  4P9F A;  1DUX C;  1S29 A;  3KP7 A;  3ZMS A;  3GYH X;  4GXO A;  2RN7 A;  1KYW A;  1W7P B;  2Q2E A;  1NHA A;  3F22 A;  3E5X A;  4Y13 A;  3B02 A;  3V7C A;  3J80 Z;  1B9M A;  3L2C A;  5IT9 K;  3FX3 A;  2QQB A;  3SZP A;  1TBX A;  3H3U A;  2RNJ A;  3TDU C;  1U8R A;  4O5V A;  1X3U A;  4WXD A;  3KZY A;  1CF7 A;  2L3D A;  3D5L A;  1MKM A;  4I7H A;  4LG0 B;  5L3E A;  3IKV A;  3ZMD A;  4BHC A;  1RUO A;  1SFX A;  1LEA A;  3SQN A;  4RB2 C;  3QAH A;  2DQL A;  5CVJ A;  3CUQ C;  1R5H A;  1HQC A;  2VT2 A;  3ZMT A;  5ILS A;  4OMY A;  5BQT A;  2P5V A;  3V8K A;  1YW7 A;  2FNP A;  1HW5 A;  4I09 A;  3VOD A;  3ZMV A;  3JAM Z;  3R0A A;  1D3Y A;  1ZAO A;  3F8B A;  5HLH A;  3T0Y A;  2EV6 A;  1F5T A;  4FX4 A;  2WV0 A;  4L5J A;  1BI2 A;  1IXS B;  1G6N A;  1K6O A;  2P5K A;  2W24 A;  1QBJ A;  2P5L C;  2NNY A;  1XSX A;  2Z33 A;  1G3W A;  2O6G E;  2F5F A;  4YIF A;  1PP7 U;  2FNA A;  5D6E A;  5HDK A;  2QBY A;  1B4A A;  2CGP A;  5AON A;  3O2P E;  3WGI A;  1GHC A;  4AIJ A;  3Q9V A;  2EJR A;  3HRU A;  4YII A;  1XB4 A;  1FYK A;  4HW0 A;  1FYL A;  1YW8 A;  3ML6 A;  1BOA A;  1XCV A;  3EYY A;  5LEK A;  1EH7 A;  1G3T A;  5D5W B;  1JGS A;  5LRR A;  3P9K A;  1T38 A;  1SFU A;  2VOP A;  2XKP A;  2R7D A;  3ZMU A;  1EH6 A;  2IRF G;  1MJA A;  3FHZ A;  5CVU A;  1V4R A;  4ESF A;  2CSO A;  2LF8 A;  1QO0 D;  4QWQ A;  5E8G A;  3WGH A;  3CO6 C;  4Q48 A;  4ZYH A;  3CUQ A;  4IHT A;  4AIK A;  3DPT A;  3LA7 A;  5A2Q K;  4LMY A;  2GAU A;  2VC1 A;  1IN7 A;  2L4A A;  3GFJ A;  2AXL A;  4K2E A;  3RIR A;  2OU2 A;  3LQR A;  1U3E M;  4WXH A;  3J81 Z;  4BAY A;  2RKH A;  3GUD A;  4GYG A;  3HUG A;  3IRR A;  1ZGJ A;  3GW2 A;  2FML A;  2QQA A;  1KU3 A;  3WGG A;  2QM3 A;  2GIV A;  1MJB A;  1F4K A;  1K78 B;  1WI9 A;  2DFI A;  4EGZ A;  3VEP A;  4UVB A;  1LQ1 A;  1YFH A;  5LLQ A;  4BHB A;  3TO6 A;  2PJP A;  4HQM A;  5E1X A;  1BC8 C;  2FE3 A;  1XCB A;  3LFK A;  2STT A;  1T2K A;  1JHH A;  5LHG A;  4EM1 A;  3K9T A;  2HKO A;  3J80 K;  1FWZ A;  1S6L A;  1JHF A;  4XLN F;  4KA4 A;  4UXN A;  4BYY A;  1LDK B;  3HRM A;  5CVI A;  3DFG A;  2R3S A;  5BPI A;  4R1H A;  1OYI A;  4CIC A;  4KDP A;  3O6B B;  4IHS A;  3FMS A;  2XGX A;  2XRN A;  4U7B A;  1G3Y A;  4FT8 A;  3C3W A;  1U78 A;  3EDP A;  2H6C A;  2ZKZ A;  4U0V A;  1S7A A;  4XBF A;  2Y48 A;  2TDX A;  1Z05 A;  4O6J A;  4EGY A;  4ENM A;  2J5P A;  1P2F A;  3DEU A;  1F1Z A;  3F72 A;  4XLP F;  5EEG A;  1XDS A;  2QZ8 A;  5BPD A;  1UFM A;  2DPD A;  3KLO A;  2Z3Y A;  1GXQ A;  2OD5 A;  4LB5 A;  2FQ3 A;  3MZY A;  1FNN A;  3QPT A;  3ULQ B;  2XAJ A;  1J9I A;  3RTR A;  3EYI A;  2ETH A;  4A5N A;  4G7H F;  1HKT A;  1H9T A;  1HSJ A;  1ZLJ A;  1I5Z A;  4D0P A;  4ETS A;  2XVC A;  1UCR A;  2EFP A;  3ZPL A;  4P55 A;  1OYW A;  3WE2 A;  1ZRD A;  2KIF A;  2QWW A;  1T98 A;  4A2U A;  3RKX A;  1R36 A;  3WTY C;  3E6D A;  3OV8 A;  1O3S A;  3WTZ A;  1EH8 A;  2ZNY A;  2M1B A;  3IWF A;  5DCM A;  3BWG A;  4KIG A;  3WTU C;  1LNW A;  3WTS C;  1L0O C;  5L3F A;  2HR3 A;  4S04 A;  2Q0O A;  3QOP A;  1O57 A;  5J8C A;  1HW2 A;  1YS6 A;  1KQ8 A;  2DK8 A;  4GYI A;  3KP5 A;  2JSC A;  2IA2 A;  2ZME B;  4M72 A;  4ZZL A;  2EV0 A;  3QPH A;  1FLI A;  1XGM A;  4OIR F;  3FMR A;  5L3C A;  3TQN A;  4Q5S F;  2O61 A;  2D2W A;  3L9F A;  2W85 A;  1CGP A;  4L9N A;  2XAQ A;  2DU9 A;  3I0T A;  4NHJ A;  1TQM A;  2VXZ A;  1Z7U A;  5HLG A;  3JSO A;  3HYI A;  2G7U A;  1J0R A;  4L0Z B;  4OIP F;  1OKR A;  3HTU A;  4KT5 C;  3GFL A;  3LST A;  4G8X A;  3WTW C;  2OQR A;  4G6D A;  2Y0M A;  3WOD F;  2P6T A;  2MD5 A;  5J8F A;  4G6Q A;  4PDK A;  3LA3 A;  3HTS B;  3HRT A;  4CDG A;  1KQ9 A;  2QLZ A;  2H27 A;  2Y75 A;  1BM9 A;  3HOT A;  2MC3 A;  4WF2 A;  1QQI A;  3V7S A;  1R58 A;  3ABT A;  3C1D A;  1J7K A;  4KMF A;  5ICE A;  2YSR A;  3G73 A;  1STZ A;  3R61 A;  2FSW A;  2G7H A;  5BS6 A;  4RGX A;  1BI1 A;  1Y0U A;  4Q4Z F;  1R23 A;  1P4X A;  1YG2 A;  2IA1 A;  2CFX A;  3BOQ A;  1WSU A;  1GVJ A;  3IHU A;  1ZRC A;  1MZB A;  2BV6 A;  4L9J A;  4A5M A;  4ENK A;  1XD7 A;  1QZY A;  4RAY A;  1ZAR A;  3K1N A;  2MBF A;  1XDU A;  4HX8 A;  4XSZ F;  1ZG3 A;  2A07 F;  1BC7 C;  4EM2 A;  5IT3 A;  1ULY A;  1ZYR F;  1U5T A;  2DK5 A;  2NNN A;  3CDH A;  2FBI A;  2STW A;  1UB9 A;  3F6V A;  2M8E A;  1UST A;  3TO9 A;  5K5O A;  2PMH A;  1SMY F;  3Q5F A;  3I53 A;  3BPX A;  1BBY A;  3BY6 A;  3FXU A;  2VOD A;  3DPL C;  2AS5 F;  2Z9O A;  4NB5 A;  3FM5 A;  4M9S A;  2DBB A;  1ZN2 A;  4OIQ F;  1WKM A;  4IRI A;  1F9N A;  5D6F A;  4GCV A;  2KRF A;  3M1E A;  2PBI A;  4PGH A;  3RKY A;  2NAZ A;  3RJP A;  1FBQ A;  2OQG A;  2BYV E;  2RV8 A;  1Z6T A;  2K4B A;  3RI4 A;  4F7Z A;  5ILU A;  1YS7 A;  1HBX G;  3TDZ C;  2K27 A;  2DLL A;  1AWC A;  5ICG A;  2PLY A;  1QPM A;  4CYD A;  1QNT A;  2QBY B;  2PQ8 A;  1TLH B;  4WX9 A;  1K7A A;  1YIO A;  3WU0 A;  3CUQ B;  2ISZ A;  2ESN A;  4KMU X;  2UZK A;  3QU6 A;  1FBS A;  3TOB A;  4YG2 F;  1O3R A;  2H94 A;  5LGT A;  3ZMZ A;  4HDU A;  2VBW A;  1SD7 A;  2RQP A;  3ECO A;  5LHH A;  4CZZ A;  4AWX B;  2J5O A;  3E3V A;  3BJA A;  2UWM A;  1D8J A;  1JE8 A;  3LA2 A;  4U7D A;  5DCM B;  3HSR A;  4EQQ A;  3JAM K;  5K5R A;  5HS8 A;  2XAS A;  3V4G A;  2HWV A;  2EK5 A;  4I0A A;  1R1U A;  1A04 A;  2KKO A;  1KQ0 A;  2H09 A;  1BN5 A;  2ZJ2 A;  5E17 F;  2BBY A;  1S3J A;  3LWF A;  1LDJ A;  4Z2Y A;  3RPQ A;  4LLN A;  4CO8 A;  2L01 A;  2K4J A;  2QVO A;  4YFN F;  1J59 A;  1Z1D A;  3CO7 C;  5DD8 A;  4HDV A;  3QRF F;  1XSV A;  1OR7 A;  1FSE A;  2CW0 F;  4ESJ A;  4L0Y B;  2IA0 A;  1FT9 A;  2QQ9 A;  2GZW A;  4HYE A;  4MEX F;  3JW4 A;  4TV7 A;  4CHU A;  1YLF A;  3E5Q A;  4HOB A;  4IPA A;  4ZH4 F;  2XHK A;  1IW7 F;  5CLS A;  2HTS A;  4BH9 A;  4WWC A;  3GVA A;  5ILV A;  4GGG A;  4ENN A;  4FHT A;  3GZ5 A;  1ODD A;  4AD9 A;  2GXG A;  1IXR C;  1SFE A;  2LF7 A;  4ENJ A;  5LBQ A;  1ZGA A;  1DPU A;  4PGG A;  3F8F A;  1LDD A;  3J81 K;  1TTY A;  2OZU A;  3BJ6 A;  1KU9 A;  3E6M A;  2ZO4 A;  2JPB A;  1TNT A;  3ROU A;  4IF4 A;  1TQI A;  4LG0 A;  2FBH A;  1CF7 B;  4UUV A;  1P92 A;  3CUO A;  4ZYG A;  4O3M A;  2LSO A;  3BJO A;  5L3G A;  2W25 A;  3V8J A;  2Q8K A;  1RI7 A;  1MGT A;  4IXA A;  2V1D A;  1IN5 A;  2DO7 A;  1O3T A;  5FFZ A;  3MEX A;  4JK1 X;  1FBU A;  1YYV A;  4OIN F;  4MQ9 F;  4P5O A;  1U5T C;  3P9I A;  2ACJ A;  3QP6 A;  1WQ2 A;  3RYP A;  1HST A;  1BIB A;  2CWE A;  3GWZ A;  3KZZ A;  2F5E A;  1G4D A;  3MQ0 A;  4MQV A;  4LLL A;  4OU0 A;  4DNC A;  5LEJ A;  5K5Q A;  2IT0 A;  2OA4 A;  5HVQ C;  5HS9 A;  1ZHF A;  3LAP A;  3WG9 A;  1ON2 A;  4L9T A;  4BXU A;  4EJV A;  3NEU A;  2OAZ A;  2HYF A;  1HKS A;  2JPC A;  3GX4 X;  3E5U A;  5AIP A;  2BGC A;  1SD6 A;  3E6B A;  3V7R A;  1V3F A;  1P6R A;  2F5D A;  3PQJ A;  5D8L B;  3L09 A;  3RDI A;  3FXR A;  4U0Y A;  2M45 A;  5JI6 A;  2WC2 A;  2K86 A;  4HA8 A;  3SFZ A;  3F3X A;  4JQF A;  5CVR A;  2ZXJ A;  1R1V A;  5LGU A;  4RAZ A;  2M87 A;  4IJA A;  3BZ6 A;  2ISY A;  4E70 A;  1FP1 D;  4N9H A;  2A3S A;  2CG4 A;  1PDN C;  3WE3 A;  2VE9 A;  3KCC A;  3SZT A;  5AIQ A;  3SHF A;  3ZN0 A;  2BE5 F;  5H6R A;  3HIF A;  4UVA A;  5E8I A;  5EEH A;  1ZLK A;  4WCG A;  2COM A;  5IT9 Z;  1W4M A;  5KK1 A;  4HLY A;  2FRH A;  2HS5 A;  1Q1H A;  3I54 A;  5D8K B;  5LHI A;  1EV7 A;  4HV6 A;  3ELK A;  3V8L A;  3W6K B;  3IL2 A;  3F23 A;  1W5T A;  3KP2 A;  4N9I A;  5HOO A;  4LK0 F;  2VON A;  5L3D A;  2XUB A;  1IF1 A;  3C18 A;  3F8C A;  3REO A;  4R79 A;  3WTT C;  5DV5 A;  3TKY A;  4EVI A;  1QZZ A;  1PUE E;  4RB3 C;  2C6Y A;  4I02 A;  3EQL F;  1Z6R A;  4A0X A;  3VOE A;  4LD5 A;  2EFW A;  3COA C;  2HFH A;  3Q9S A;  3QU3 A;  2LDU A;  4P9U A;  3FXQ A;  5ED4 A;  2FF4 A;  2GA1 A;  2DT5 A;  3F21 A;  5F6F A;  4RS8 A;  2UXX A;  4WK8 F;  2FU4 A;  4ZYE A;  2EWN A;  1B9N A;  1TNS A;  3MFK A;  4U0W A;  2HYG D;  2PFB A;  3MWM A;  1FX7 A;  2X0L A;  3I64 A;  4N0B A;  4EM0 B;  3HSF A;  2DI3 A;  1FC3 A;  3GXO A;  1BJA A;  3KP6 A;  2YX7 A;  2HOE A;  3KET A;  4XSX F;  3H3Z A;  5E1W A;  4YFK F;  4HF0 A;  2ELH A;  3W6J B;  3ECH A;  2CYY A;  2P7C B;  1IZ1 A;  2VBX A;  2G9W A;  2A68 F;  3S2W A;  1I6X A;  4OIO F;  2DPU A;  2A5Y B;  1TQP A;  3CLO A;  1IRG A;  3WTV C;  4UV8 A;  3HSE A;  1YTY A;  4KUM A;  4HLX A;  1KGS A;  5FLX K;  5HDN A;  4B8X A;  4EV0 A;  3T8T A;  3RPU A;  2M30 A;  4RGS A;  1YO5 C;  5FLX Z;  2K7L A;  2ZCW A;  4HV5 A;  1ZRE A;  3VB2 A;  3IWZ A;  5FD6 A;  3KEO A;  2E1C A;  3NQO A;  3U1D A;  2A61 A;  5DEQ A;  5TRD A;  4IVN A;  4Q47 A;  2JRT A;  4OMZ A;  2YX4 A;  4H0E A;  1MJ9 A;  2ADU A;  1ZG1 A;  1R5G A;  4L5I A;  4HBL A;  1XGS A;  2OZ6 A;  2HQR A;  2IPQ X;  1E17 A;  3G3Z A;  4IRG A;  2K02 A;  1B6A A;  1RIO H;  2MH2 A;  4A6D A;  2P4W A;  1BI3 A;  2W57 A;  5BMZ A;  3MAJ A;  5JFR A;  1ZH5 A;  3AAF A;  5A2Q Z;  3R4K A;  2VBY A;  2OBP A;  1HW1 A;  4I0B A;  1R7J A;  4XRF A;  2KJB A;  5E20 A;  4KIF A;  3JTG A;  3P7N A;  3M8E A;  4RB0 A;  2CO5 A;  2Z99 A;  2P7V B;  1SD4 A;  4P96 A;  2KJC A;  3L7W A;  2DW4 A;  3DKW A;  5K1Y A;  3TO7 A;  4A0Z A;  3TOA A;  2RGV A;  3KE2 A;  1USS A;  5DD4 A;  4M74 A;  3WU1 B;  2GA2 A;  4L9V A;  4OOI A;  3FZV A;  1SD5 A;  2HKX A;  2MH9 A;  4S05 A;  3KFW X;  1LVA A;  1DDN A;  5FO5 A;  4BNC A;  1ZRF A;  4UV9 A;  4EJW A;  3OOP A;  3SXY A;  4MNU A;  5DYM A;  3N97 A;  3MZH A;  4G7Z F;  3GFM A;  1UHW A;  1S8N A;  2CQK A;  4BHP A;  1K79 A;  4I98 B;  2YR2 A;  4EJT A;  2P8T A;  1WWX A;  3WTX C;  2PG4 A;  4UHT A;  2L02 A;  5ERI A;  1KU2 A;  4M6Y A;  1O7F A;  2MLG A;  2ZNZ A;  2RVC A;  4GO1 A;  3HRS A;  3K0L A;  4DQ2 A;  4YFX F;  3ZQ7 A;  1B1B A;  2V1X A;  1REP C;  4ASN A;  5JHU A;  4MGR A;  4I01 A;  4R8H A;  2FMY A;  3H92 A;  2PEX A;  1HKQ A;  5D5V B;  4I2O A;  1WRJ A;  2VC0 A;  4A0Y A;  3CJN A;  4JBA A;  1R22 A;  5D5X B;  4M6X A;  1LJ9 A;  5E18 F;  3F6O A;  3K2Z A;  1U6G A;  4LLG F;  4HZF A;  4A12 A;  1IN6 A;  3R0J A;  1T39 A;  4HF2 A;  5J6X A;  1D8K A;  3O3K A;  3DXJ F;  1SAX A;  2HQN A;  1RNL A;  2WWY A;  3I59 A;  2IJL A;  2B0L A;  4KFC A;  1OPC A;  3F8M A;  5CYV A;  2GXB A;  2FOK A;  1XGO A;  2HEO A;  5DUK A;  5DDG A;  1PP8 F;  1SMT A;  5H6Q A;  4B09 A;  5ICF A;  2F5C A;  3BP8 A;  1XN7 A;  1FOK A;  4HAM A;  5JVT A;  1FZP B;  1YW9 A;  5DCF A;  4PCQ A;  5D4S A;  5H20 A;  1BIA A;  2HZT A;  3RYR A;  3DF8 A;  2VOO A;  3N4M A;  3D0S A;  3BRO A;  1IUY A;  1KU7 A;  4EMS A;  4PZJ A;  1R1T A;  4A6E A;  2HDC A;  4G7O F;  2V1U A;  3IC7 A;  3KLN A;  3HHG A;  2XAF A;  3I58 A;  3R6S A;  2O8X A;  5JR3 A;  3K1M A;  4G94 A;  4M9X A;  2H6B A;  1FY7 A;  3IRQ A;  2LNB A;  1I1G A;  4ON0 A;  2R7F A;  2ZFW A;  3KP4 A;  1FSH A;  2KIU A;  2XIG A;  2XKO A;  2A69 F;  1W7P A;  4LJZ F;  4MTE A;  5HLI A;  1J5Y A;  1H0M A;  3ZP5 A;  2VT3 A;  1Z91 A;  4BQA A;  3BDD A;  3T1B A;  2ESH A;  5HDG A;  4ZZD A;  1O3Q A;  2XAG A;  4KN4 X;  3NRV A;  3FM3 A;  2MLK A;  1QGP A;  2EFQ A;  1LB2 A;  1IRF A;  4CGZ A;  1P4W A;  2UXN A;  1R00 A;  2GWR A;  3ABU A;  1IN4 A;  5E1Z B;  4M9Z A;  1TW2 A;  1XGN A;  1GXP A;  3BPV A;  4WXC A;  3I5U A;  4EJU A;  5DUI A;  2ZME A;  4Y15 A;  1AOY A;  4AVP A;  3RKW A;  1OMI A;  2E1N A;  2E7W A;  2BEO A;  2E7X A;  5FB2 A;  2IW5 A;  1TW3 A;  2V6C A;  1IAW A;  5F64 A;  3MCZ A;  2VN2 A;  5D4R A;  5BOX A;  2YU3 A;  2PN6 A;  5CVV A;  3B73 A;  1FP2 A;  3LQQ A;  5CJ9 A;  3I71 A;  4HX4 A;  4LFU A;  6PAX A;  1J75 A;  1ON1 A;  2EA4 A;  2VE8 A;  4RGR A;  1I27 A;  3GLX A;  4KN7 X;  3HOS A;  2M5W A;  3HHH A; 
#chains in the Genus database with same CATH topology
 2EA2 A;  3KZI C;  4NQW A;  2DQR A;  2FA5 A;  2LH9 A;  3RZD J;  3FWE A;  2VBZ A;  3C7J A;  3IKT A;  3DV8 A;  2H8R A;  4MHG A;  2KZG A;  3L00 A;  3TW6 A;  4IQJ A;  3T5X A;  2EV5 A;  5F27 A;  4BQQ A;  4W1U A;  2BY1 A;  3M8F A;  4HQE A;  4F93 B;  3K4C A;  1I1S A;  1FPQ A;  2KL4 A;  1ORK A;  4IRH A;  2ECC A;  3M8J A;  5IOZ A;  3LAJ A;  5F0F A;  4M73 A;  3OS1 A;  1U0J A;  2NS0 A;  4YRV A;  2R7Z J;  1VTN C;  4KIC A;  3BG9 A;  3U1K A;  5IOY A;  2MSY A;  2EB7 A;  2ZC2 A;  2JZY A;  2PI0 A;  2JK3 A;  2KMU A;  2CW7 A;  4AIH A;  1IXC A;  3KP3 A;  2W7N A;  2LOO A;  1MDM B;  2M7B A;  2O3F A;  1KYZ A;  2OJE D;  3CP2 A;  3ISP A;  3K4M A;  3ZOB A;  2D45 A;  1T95 A;  3J7A O;  2OTL I;  3G2B A;  1SFK A;  2DOD A;  5FGM A;  3BQY A;  2FEZ A;  3BG6 A;  1MNE A;  2NOJ B;  2ZB9 A;  1W36 C;  4XR6 A;  5F08 A;  3H9J A;  5C3E J;  4ESB A;  1K78 A;  1MNM C;  1JUM A;  3KEQ A;  3ZN1 A;  3U2R A;  3FKJ A;  3GFI A;  1ONV A;  3VYT B;  1KA8 A;  9ANT A;  2VIX A;  3PNY A;  1B59 A;  5HS7 A;  2X4H A;  3BCB A;  1PUF B;  3RCO A;  1WJ5 A;  4NC7 A;  4E6K G;  4L18 B;  4UNO A;  3CDI A;  5LGN A;  1O7L A;  2YUS A;  2DOF A;  4XOR A;  3OYC A;  3H5A A;  5FFX A;  1JXS A;  1GUU A;  1NK3 P;  1D1B A;  1X58 A;  2EFN A;  3MKZ A;  3PFI A;  4V19 K;  3M9A A;  4FX0 A;  5ICC A;  3GME A;  4BE0 A;  4UUS B;  2XAH A;  4U88 A;  4HX7 A;  3LSG A;  2BOL A;  3NWT A;  1MW7 A;  4EJO A;  2FXA A;  1XMA A;  2LY2 A;  2W84 A;  2ZBK A;  1W7P D;  3M7G A;  1VQL I;  2DN0 A;  4KIB A;  2DAO A;  2PMU A;  4P1W A;  2GM4 A;  3I55 I;  2Z5U A;  3EET A;  1Z21 A;  1APL C;  4AM3 A;  5C44 J;  4E7K A;  3OYD A;  1UAA A;  3FXK A;  1MDM A;  2XRO A;  4Y3O A;  1L3L A;  1IV8 A;  1XMK A;  1T56 A;  4NC6 A;  2IVM A;  4J01 A;  2F2E A;  4G9Y A;  1T6S A;  1NK2 P;  5FRO A;  3OL4 A;  2JTV A;  2A6E F;  4KNY A;  2L54 A;  3FF5 A;  2Z16 A;  1YQA A;  3GZ6 A;  3F8N A;  4CCM A;  4D5C A;  1TWF J;  3FMQ A;  2DTR A;  2L9S A;  4IOA F;  3CLQ A;  4LB6 B;  3K4B A;  1X1C A;  2F6C A;  2JVH A;  1BI0 A;  4F3Q A;  2L7F P;  2X48 A;  2NS8 A;  3R60 A;  3VFZ A;  2ZFU A;  2GLO A;  2JUC A;  2D1V A;  1YX5 A;  1ZK8 A;  3LSI A;  4PJJ A;  2VI6 A;  3HGG A;  4RAF A;  1C0W A;  1OCZ H;  2DDA A;  1DGW Y;  2HGC A;  2QYO A;  4LGW A;  4ZYD A;  1VF9 A;  1RZ4 A;  3GEZ A;  2XV4 S;  3JCU C;  1H88 C;  2V79 A;  2NRA C;  3CTA A;  4UVC A;  3U9G A;  1ZG5 A;  2KP6 A;  2QGU A;  5L3B A;  3DP7 A;  2V9V A;  2BY2 A;  3BZC A;  3QP5 A;  3I59 B;  1UHS A;  3P9C A;  4XRM A;  5K7Z A;  1U5T B;  1JUP A;  5FD5 A;  3K4J A;  3EUH A;  3JSP A;  2M3A A;  1MD0 A;  4KYW A;  4MEY F;  3ERE D;  3I4P A;  4FCY A;  5LRS A;  4HF1 A;  1FYM A;  2KIQ A;  2QEN A;  4BGD A;  3T8R A;  1U2W A;  1P4A A;  2LKP A;  2QUF A;  3GF2 A;  4LOC A;  4DOZ A;  2JT1 A;  2A6H F;  3HL2 A;  1E2X A;  3K69 A;  3JTH A;  3PFY A;  5GTI C;  1MIJ A;  4FQG A;  1UEL B;  1JT0 A;  4ZDL A;  2MA3 A;  4QLC U;  1N75 A;  3O8H A;  4BBR J;  3PJR A;  1IRZ A;  4RGU A;  4RB1 A;  4Y17 A;  1DPR A;  4M71 A;  3K1P A;  5D5U B;  1VQO I;  2RC4 A;  2GOX B;  3TGN A;  4MTD A;  2IS6 A;  2HVR A;  2I8D A;  1S7O A;  1LEB A;  1W5S A;  2WAQ A;  2L4M A;  2D1H A;  1OR7 C;  3OR2 C;  3VYU B;  2RDP A;  4OWR B;  3JRE A;  2QSH X;  5KVR A;  1OYY A;  3VSL A;  3OYE A;  3PQK A;  5TJJ A;  4RDU A;  3BR6 A;  3A0B C;  4JP0 A;  5GTH C;  1IG7 A;  3OYI A;  3JRG A;  1DP7 P;  1IN8 A;  4C3H J;  1H9G A;  2B9S A;  1XSD A;  2FBK A;  2VPL A;  2XF5 A;  2EFO A;  1WZ2 A;  2DA6 A;  2Y2Z A;  3K4L A;  1RUN A;  2JUG A;  3JRA A;  1YJN I;  2K9M A;  1D5V A;  2KIM A;  2WTE A;  3B6A A;  1J2X A;  1FIP A;  2IGM A;  2KFD A;  1T0F A;  2L2O A;  2ECB A;  2O0Y A;  1G3S A;  2OC6 A;  1Z9C A;  2P6S A;  2HTJ A;  1HXD A;  1VQ4 I;  3GTP J;  1MMN A;  3E97 A;  3OR1 C;  1JTY A;  3O8G A;  4QPO A;  1UHM A;  2LY9 A;  4HNV A;  2O03 A;  2YPR A;  4BXF A;  4E7I A;  2NYX A;  2R7Q A;  2GQQ A;  4LK1 F;  1D1A A;  4CXF A;  2IP2 A;  5M3F J;  1ETW A;  3LSH A;  1X4P A;  2JSP A;  3A2K A;  3OL3 A;  3GO5 A;  4ZJZ A;  2KPM A;  5F1R A;  3DQV C;  4PJ0 C;  3E6C C;  4P9F A;  1DUX C;  1S29 A;  3KP7 A;  3ZMS A;  2R7U A;  4BQN A;  3QYE A;  3GYH X;  4GXO A;  1Y39 A;  2TCT A;  2CQQ A;  3F9K A;  4MIM A;  3WHC A;  2VKH A;  1QRY A;  2RN7 A;  1KYW A;  1W7P B;  2Q2E A;  3TED A;  1DQU A;  1FMW A;  1NHA A;  3DPU A;  3E5X A;  3I9V 2;  4Y13 A;  4D1Q A;  3OYF A;  3F22 A;  1LFU P;  3HOZ J;  2LP0 A;  3B02 A;  3V7C A;  1E3H A;  1OCP A;  3J80 Z;  1YRN A;  4C2U A;  1IV6 A;  1Z3X A;  1JKP C;  1G2H A;  1B9M A;  3L2C A;  3ZRG A;  1T33 A;  5FRN A;  5IT9 K;  3FX3 A;  1OIS A;  3NAR A;  2QQB A;  5CKT A;  3SZP A;  3HOW J;  2PX9 A;  3CCQ I;  4XQF A;  3MZ8 A;  1TBX A;  3H3U A;  4I76 A;  5B66 C;  3IV5 A;  1Y56 A;  1UG2 A;  5J1U A;  3SFI A;  2RNJ A;  3TDU C;  1U8R A;  4M3B A;  5DS9 A;  1T08 B;  2ICW G;  2M8G X;  4O5V A;  5IPA A;  2RQQ A;  1X3U A;  1XMX A;  4WXD A;  2CQX A;  3KZY A;  5EGO B;  1QA6 A;  1CF7 A;  2L3D A;  3D5L A;  1MKM A;  4I7H A;  5GPA A;  3MN2 A;  5L3E A;  4LG0 B;  3IKV A;  3OYH A;  3WG7 H;  2WA0 A;  3ZMD A;  2QF7 A;  4BHC A;  1RUO A;  2K9Q A;  1SFX A;  2HXI A;  1LEA A;  2XPW A;  5EJC A;  3SQN A;  4RB2 C;  4RM3 A;  3QAH A;  3CJQ B;  3IH2 A;  2XB0 X;  1X3Z B;  2P0W A;  2DQL A;  1DU6 A;  4UY8 I;  5CVJ A;  3CUQ C;  3DU5 A;  1R5H A;  1HQC A;  5FKO A;  3G6E I;  2VT2 A;  1WJD A;  2M34 A;  3ZMT A;  2CV0 A;  3GZN B;  2F4M B;  1A5J A;  5ILS A;  1BJZ A;  3UR3 C;  4OMY A;  2X6X A;  5BQT A;  2P5V A;  3V8K A;  3ZQL A;  1G8X A;  1YW7 A;  1H8A C;  2FNP A;  1HW5 A;  4I09 A;  3VOD A;  3ZMV A;  3JAM Z;  3R0A A;  1H89 C;  1E3P A;  1D3Y A;  3BG3 A;  1ZAO A;  3F8B A;  3CMM A;  4E7Z A;  5HLH A;  2FUG 2;  1N25 A;  3T0Y A;  2EV6 A;  3E0J B;  1F5T A;  4FX4 A;  2WV0 A;  4L5J A;  1MBE A;  4N4O B;  1BI2 A;  1IXS B;  1G6N A;  3BR3 A;  1K6O A;  2P5K A;  2W24 A;  1QBJ A;  1Z3Y A;  4CCN A;  5F0H A;  2IS4 A;  1RES A;  5E3L A;  4X6A J;  2P5L C;  2HOT A;  2WB1 A;  2NNY A;  1XSX A;  2Z33 A;  2DA5 A;  3FHN A;  1G3W A;  3PNT A;  4HRI A;  1YI2 I;  2O6G E;  4QIW N;  4PK4 A;  1V55 H;  2DA2 A;  3ABK H;  3SYT A;  3VYS B;  2F5F A;  4YIF A;  1D5Y A;  3L2R A;  3FIS A;  3K2A A;  2DA1 A;  4ABZ A;  2DMP A;  1PP7 U;  2V9P A;  2VLA A;  2FNA A;  5D6E A;  2Q1Z B;  3NAU A;  4RBO A;  1MND A;  3W6V A;  5HDK A;  2QBY A;  1B4A A;  3QPL A;  5AON A;  2CGP A;  3KPH A;  3O2P E;  4LG3 A;  3WGI A;  1GHC A;  4AIJ A;  4DGW B;  1ZEL A;  3Q9V A;  1RKT A;  2EJR A;  3HRU A;  4YII A;  1JI8 A;  1XB4 A;  2VKD A;  3OYN A;  1FYK A;  4HW0 A;  2QKM B;  1FYL A;  3DTK A;  1YW8 A;  3ML6 A;  1BOA A;  2L9N A;  2HQ5 A;  1VQ9 I;  1XCV A;  3EYY A;  2DA3 A;  1EH7 A;  5LEK A;  5EEA A;  1G3T A;  5D5W B;  1FIA A;  2DMU A;  2LRE A;  3H5R A;  2LLK A;  3QQA A;  4A69 C;  5M5W J;  1FEX A;  1WHU A;  1JGS A;  5LRR A;  2O5R A;  3BQZ A;  3P9K A;  1DGR M;  5EG0 A;  1WJA A;  1SFU A;  1WJC A;  1T38 A;  2XKP A;  3FIW A;  2VOP A;  2R7D A;  1IDY A;  3ZMU A;  1EH6 A;  3E1S A;  2IRF G;  4AU7 A;  2LBF B;  1MJA A;  3FHZ A;  5CVU A;  1V4R A;  2ZXW H;  1ZKG A;  4YEJ A;  2EZI A;  4ESF A;  2WB1 N;  3OSG A;  2CSO A;  4Y33 A;  2VQL A;  2LF8 A;  5FKN A;  2ME6 A;  1QO0 D;  4D7M A;  4QWQ A;  2VL8 A;  5E8G A;  3WGH A;  3CO6 C;  4JX5 A;  4KJZ A;  3W2A A;  4Q48 A;  4ZYH A;  3CUQ A;  4IHT A;  3ZCO A;  2JA7 J;  4AIK A;  1S9H A;  3DPT A;  3LA7 A;  1X2N A;  2EPF A;  4PFO A;  2R5Y B;  5A2Q K;  4LMY A;  2GAU A;  2VC1 A;  1IN7 A;  3K70 D;  2L4A A;  3GFJ A;  2AXL A;  4K2E A;  3S3N A;  5J47 A;  3RIR A;  4GDF A;  1GDT A;  2OU2 A;  3LQR A;  5EG0 B;  1U3E M;  4WXH A;  3J81 Z;  1SVL A;  4BAY A;  2R93 J;  2DMN A;  2RKH A;  2F4I A;  1MMD A;  1GV5 A;  1HCR A;  3GUD A;  4GYG A;  3HUG A;  1XG1 A;  2HPM A;  2WAQ N;  3IRR A;  1ZGJ A;  2LC2 A;  4KIT B;  3GW2 A;  1YIJ I;  3BG5 A;  5E3M A;  2FML A;  3CCS I;  2QQA A;  1KU3 A;  3A01 A;  4IZZ A;  2F48 A;  3WGG A;  2QM3 A;  2BXZ A;  3I56 I;  1KZH A;  2ELK A;  2GIV A;  2XSJ C;  1MJB A;  2R7S A;  3DBR B;  5F1J A;  3B6C A;  1Z67 A;  3A02 A;  1GLN A;  3S1Q J;  2XAU A;  4XLH A;  1F4K A;  1K78 B;  1MMG A;  1WI9 A;  1Y1V J;  2KRC A;  2DFI A;  1A6Q A;  4EGZ A;  3VEP A;  4UVB A;  1LQ1 A;  1YFH A;  5LLQ A;  4BHB A;  3TO6 A;  2PJP A;  4HQM A;  5LD2 C;  5E1X A;  2BY0 A;  1BC8 C;  1A35 A;  3PO3 J;  1Y8R B;  3Q3S A;  2DYR H;  5JLW A;  2FE3 A;  1XCB A;  4AID A;  1WJB A;  3LFK A;  2STT A;  4ZDP A;  1T2K A;  2QSG X;  2KRH A;  3RQI A;  5EGO A;  1JHH A;  4XM3 A;  5M3M J;  4NC8 A;  4U87 A;  4H4K C;  1OJL A;  4J19 A;  5LHG A;  4EM1 A;  3K9T A;  3K6G A;  2COB A;  2HKO A;  5HLT A;  1FWZ A;  1S6L A;  3J80 K;  1JHF A;  4XLN F;  1YIT I;  1MMA A;  4KA4 A;  4UXN A;  3BR0 A;  3BR2 A;  1ETK A;  4BJ6 C;  4BYY A;  1BR1 A;  4C9Y A;  3K4N A;  3A1Y A;  2R7O A;  1LDK B;  3S14 J;  2H1K A;  3HRM A;  1TZL A;  1OLT A;  2Z1D A;  5KAI C;  5CVI A;  3DFG A;  2R3S A;  5BPI A;  3CJT B;  4R1H A;  4F91 B;  2WAD A;  4IKF A;  2CQ7 A;  1K4S A;  1OYI A;  4CIC A;  4KDP A;  3O6B B;  4AYB A;  1TL8 A;  4IHS A;  3FMS A;  2XGX A;  1XPX A;  2XRN A;  4CA0 A;  1BR2 A;  1IUF A;  2PJR A;  2K5C A;  4U7B A;  1G3Y A;  4ANJ A;  2NVQ J;  4FT8 A;  3D5S C;  3ZQQ A;  3C3W A;  1XC5 A;  2EZL A;  3EDP A;  5HNF A;  2H6C A;  3LSP A;  3G1L A;  2ZKZ A;  3SDG A;  4U0V A;  3S1M J;  1S7A A;  4XBF A;  2FOW A;  2Y48 A;  2CQN A;  1R9T J;  2TDX A;  1Z05 A;  4O6J A;  4EGY A;  4ENM A;  1WJF A;  4C2M J;  2J5P A;  5LFA A;  1XTA A;  3FBN B;  1P2F A;  3DEU A;  1K6Y A;  2L9R A;  5B1B H;  3WHB A;  1F1Z A;  3GTL J;  3F72 A;  4XLP F;  5EEG A;  1XDS A;  2QZ8 A;  5BPD A;  3E7L A;  1UFM A;  2DPD A;  5KAF C;  3KLO A;  1IJW C;  2Z3Y A;  1GXQ A;  2OD5 A;  2RNG A;  4IHW A;  2FQ3 A;  4LB5 A;  3MZY A;  1FNN A;  3QPT A;  3CMY A;  4ZC3 A;  3ULQ B;  2XAJ A;  1J9I A;  5KNL A;  3RTR A;  3EYI A;  2ETH A;  4IOC F;  4A5N A;  4G7H F;  1HKT A;  4LIU A;  1H9T A;  1HSJ A;  1ZLJ A;  1I5Z A;  2DJI A;  4D0P A;  4ETS A;  3DCF A;  4PFP A;  3S3M A;  2XVC A;  1UCR A;  3QPS A;  4F52 A;  2EFP A;  3ZPL A;  1T0F C;  2L5Q A;  4C3J J;  1ETY A;  4P55 A;  1OYW A;  1ETX A;  3WE2 A;  1ZRD A;  3H36 A;  3LSM A;  1SVM A;  2ZSI B;  1Z0X A;  2EH3 A;  2KIF A;  3AG2 H;  2QWW A;  4XKB A;  1T98 A;  2NVY J;  4A2U A;  3RKX A;  1R36 A;  3DBL B;  3Q0U A;  2AQF A;  3WTY C;  1DP3 A;  3E6D A;  3OV8 A;  3LSR A;  1O3S A;  3WTZ A;  1W0T A;  1EH8 A;  2CW8 A;  4E7J A;  2ZNY A;  2M1B A;  3IWF A;  4MFD A;  5BNG A;  5DCM A;  3BWG A;  1VQ5 I;  4KIG A;  3WTU C;  3F0C A;  1LNW A;  3WTS C;  2F4O B;  3H9Q A;  4BE1 A;  2LR8 A;  4ZDO A;  5EYR A;  4DBR A;  1LFP A;  1L0O C;  5L3F A;  2HR3 A;  2VJI A;  4S04 A;  4M3G A;  3ASO H;  2O9L A;  2Q0O A;  3QOP A;  1O57 A;  2E1M C;  5J8C A;  3VSK A;  1HW2 A;  3J7Y J;  3HPG A;  1JKO C;  1YS6 A;  1A36 A;  1KQ8 A;  2DK8 A;  2W48 A;  3KP5 A;  2JSC A;  2IA2 A;  4GYI A;  2ZME B;  3CCJ I;  2DFH A;  3AG1 H;  4M72 A;  4ZZL A;  2EV0 A;  1RRJ A;  3QPH A;  1FLI A;  1XGM A;  3OIO A;  4OIR F;  3FMR A;  4C3I J;  5L3C A;  1KON A;  2GXA A;  1QVT A;  5EZH A;  3TQN A;  4Q5S F;  4BBS J;  2O61 A;  1X4O A;  2IEK A;  2D2W A;  1OCC H;  3L9F A;  2HQA A;  2W85 A;  4OAY A;  1VI0 A;  4L9N A;  2XAQ A;  1CGP A;  2DU9 A;  3I0T A;  4IL6 C;  4NHJ A;  5M5X J;  5IP6 A;  1TQM A;  4JX4 A;  3LNQ A;  3U21 A;  2VXZ A;  5F04 A;  2PMZ A;  1Z7U A;  3LSK A;  5HLG A;  3JSO A;  3HYI A;  2W00 A;  3L2V A;  2G7U A;  1J0R A;  4L0Z B;  4OIP F;  1OKR A;  3H5N A;  2X1D A;  3HTU A;  1M1E B;  2DXI A;  1BA5 A;  4KT5 C;  3GFL A;  1Q1V A;  2EZH A;  2W4S A;  3LST A;  4PSW A;  4G8X A;  3WTW C;  2OQR A;  3M07 A;  2L7K A;  4G6D A;  2Y0M A;  4S0H B;  3WOD F;  2P6T A;  2MD5 A;  5J8F A;  4HST A;  4PJN A;  2UV1 A;  4G6Q A;  4PDK A;  3LA3 A;  1VQP I;  3ZQG A;  3HTS B;  1P7I A;  1K83 J;  3HRT A;  4BDZ A;  2V4J C;  1Y6I A;  5KCM A;  4CDG A;  1KQ9 A;  2QLZ A;  2H27 A;  2OCE A;  4ZTJ A;  2Y75 A;  1BM9 A;  3HOT A;  4AVZ A;  2MC3 A;  4WF2 A;  4XRS A;  1QQI A;  2V9K A;  3V7S A;  1R58 A;  4A3L J;  4DZJ A;  2X1E A;  1LE8 B;  2EQR A;  3GCM A;  3TMO A;  3ABT A;  3C1D A;  2YU9 J;  1J7K A;  4G6T B;  4IX7 A;  2IS1 A;  3HB9 A;  4KMF A;  5ICE A;  2JN6 A;  2YSR A;  3G73 A;  1STZ A;  2ELJ A;  3HKZ A;  3R61 A;  4L5E A;  2FSW A;  2G7H A;  4RGX A;  5BS6 A;  2KQR A;  1BI1 A;  1Y0U A;  3CCM I;  4Q4Z F;  1R23 A;  3DWL E;  2EIN H;  2Y9Y A;  3S1N J;  1P4X A;  2R7X A;  5J1R A;  1YG2 A;  2IA1 A;  5KHD A;  2CFX A;  3BOQ A;  1HLV A;  1WSU A;  1GVJ A;  2QCO A;  3IHU A;  4AUX A;  4A3C J;  3IP4 B;  1ZRC A;  1MZB A;  2BV6 A;  4L9J A;  4A5M A;  3KEY A;  2E34 A;  1HF0 A;  4RMN A;  5EZG A;  3A01 B;  2VUM J;  3S2D J;  4ENK A;  1T8I A;  1OCO H;  1XD7 A;  1QZY A;  1YE9 A;  1JJ8 C;  4RAY A;  1ZAR A;  3K1N A;  2M2E A;  2XSD C;  2MBF A;  1XDU A;  3CCU I;  3HOX J;  4HX8 A;  2CFO A;  4XSZ F;  4V2F A;  1LE8 A;  1ZG3 A;  2A07 F;  1BC7 C;  4EM2 A;  5IT3 A;  4XL9 A;  1VQN I;  1ULY A;  3AG4 H;  4XKC A;  3PIP F;  2JA6 J;  1ZYR F;  1U5T A;  2MAB A;  2Y9Z A;  4A3I J;  2DK5 A;  2NNN A;  4UUS A;  3GBG A;  3CDH A;  2FBI A;  2STW A;  3C2H A;  5GP9 A;  4J00 A;  2CV2 A;  1UB9 A;  2QEX I;  2WBM A;  3F6V A;  1ETV A;  3OS0 A;  2M8E A;  1UST A;  1LPQ A;  2KIS A;  2HVQ A;  3TO9 A;  2LD5 A;  5K5O A;  5FLV A;  2OV7 A;  2PMH A;  3ZXS A;  1SMY F;  3TP0 A;  1WI3 A;  2MYS A;  2MG4 A;  3Q5F A;  3S2H J;  3I53 A;  4BQO A;  2WAF A;  3BPX A;  3TP3 A;  1BBY A;  3BY6 A;  1Y1W J;  3FXU A;  4XIC A;  4A3J J;  2VOD A;  1TT0 A;  3DPL C;  2BVL A;  2OUM A;  2AS5 F;  3HDD A;  2Z9O A;  4NB5 A;  3FM5 A;  1P9Q C;  3S8P A;  4MFE A;  1IGN A;  4IHV A;  3N05 A;  4M9S A;  3H9G A;  2DBB A;  1WH7 A;  1ZN2 A;  4OIQ F;  1WKM A;  4IRI A;  4NQW B;  1F9N A;  2NOG A;  5D6F A;  4GCV A;  2KRF A;  1W1W E;  2A05 A;  3M1E A;  2PBI A;  3FBI B;  4PGH A;  3RKY A;  2NAZ A;  1RET A;  3RJP A;  1FBQ A;  1TWA J;  4MLO A;  2OQG A;  3CC2 I;  3KYL A;  2BYV E;  3BR5 A;  5FKL A;  4BE2 A;  1W5C C;  5M5Y J;  2RV8 A;  1Z6T A;  2K4B A;  2E5N A;  1NTC A;  1POG A;  3RI4 A;  4F7Z A;  5ILU A;  2Y30 A;  3CQZ J;  1HOM A;  1YS7 A;  1HBX G;  3SEZ A;  3TDZ C;  2K27 A;  2DLL A;  4BKX A;  5E3N A;  3BR1 A;  2Q2E B;  4G12 A;  5GAG J;  1AWC A;  5ICG A;  3FDY A;  5B1A H;  3FXO A;  2LKS A;  2PLY A;  2ZJQ F;  1QPM A;  2CUE A;  4CYD A;  2VAS A;  3HGY A;  1QNT A;  2QBY B;  2K85 A;  2PQ8 A;  4XLC A;  3RSN A;  2E60 A;  1TLH B;  4WX9 A;  1K7A A;  1YIO A;  2E36 A;  1LKX A;  3WU0 A;  4B44 A;  3CUQ B;  4CH7 A;  2ISZ A;  5HNH A;  2ESN A;  2M4G A;  1GVD A;  4KMU X;  3QU6 A;  5IYC J;  1ETQ A;  2UZK A;  1FBS A;  5CQG A;  3TOB A;  4YG2 F;  1O3R A;  2H94 A;  2Y69 H;  5LGT A;  3ZMZ A;  3M3Y J;  1HC8 A;  4HDU A;  2VBW A;  3HJE A;  1SD7 A;  3AKZ A;  2R7V A;  1VQ8 I;  1Y8Q B;  4BU2 A;  3CC4 I;  2RQP A;  3ECO A;  4XLF A;  4E4H A;  5LHH A;  3W2V A;  4AWX B;  4CZZ A;  4A3M J;  4N4N B;  2J5O A;  3E3V A;  3BJA A;  2UWM A;  1D8J A;  2MGQ A;  4NUB A;  1JE8 A;  3LA2 A;  1JUS A;  4U7D A;  5DCM B;  3HSR A;  4EQQ A;  3JAM K;  2KZV A;  3QYF A;  5K5R A;  2M0C A;  3HOV J;  1K4T A;  4B48 A;  2IGO A;  2OTJ I;  2BXY A;  2XRL A;  3KYD B;  1B72 B;  5HS8 A;  2CUZ A;  2H8W A;  2XAS A;  3V4G A;  2HWV A;  2EK5 A;  4I0A A;  2V6E A;  1R1U A;  5J1Y A;  1A04 A;  2B7E A;  3LSJ A;  3FXJ A;  1R71 A;  5J40 A;  3RPU D;  5K7H A;  2KKO A;  1MBF A;  2XGD A;  4LIT A;  1KQ0 A;  2H09 A;  1BN5 A;  2LRD A;  2ZJ2 A;  4XN3 A;  5HOD A;  1N77 A;  5E17 F;  2BBY A;  1S3J A;  2GIZ A;  4IO9 F;  3LWF A;  5F0C A;  1LDJ A;  2V7F A;  2DFE A;  4Z2Y A;  3RPQ A;  4UB6 C;  2A6T A;  4LLN A;  4XOT A;  4NBQ A;  1R6R A;  2L01 A;  4CO8 A;  2K4J A;  3CES A;  2QVO A;  5EDN A;  4YFN F;  1J59 A;  3S3O A;  1I50 J;  1Z1D A;  1JJ6 C;  3CO7 C;  1HDP A;  5DD8 A;  4HDV A;  3QRF F;  1R4M B;  1XSV A;  1NH3 A;  1FJL A;  3ZR8 X;  3ZGK A;  1OR7 A;  2E19 A;  1FSE A;  2CW0 F;  4HG2 A;  3OY9 A;  4ESJ A;  4L0Y B;  2IA0 A;  1FT9 A;  2QQ9 A;  2Y31 A;  2GZW A;  4HYE A;  1LVK A;  4MEX F;  3JW4 A;  4TV7 A;  4CHU A;  4HEA 2;  1YLF A;  3BT9 A;  3E5Q A;  4HOB A;  4IPA A;  4ZH4 F;  2XHK A;  3DKY A;  4DIQ A;  1IW7 F;  2WAE A;  2F5V A;  5CLS A;  1U8B A;  2ZJR F;  2HTS A;  2WY8 Q;  4FE4 A;  3CC7 I;  4BH9 A;  2CU7 A;  4WWC A;  4B47 A;  3GVA A;  1ENH A;  1ITY A;  5ILV A;  2ID6 A;  4GGG A;  2DCE A;  4CUG A;  2WV1 A;  2K40 A;  3J7Z I;  3FKI J;  4LIV A;  4ENN A;  2VQC A;  4FHT A;  3GZ5 A;  3P5J A;  1ODD A;  3K10 A;  4AD9 A;  1SAN A;  2X51 A;  2E71 A;  3ABM H;  2GXG A;  1N78 A;  1A6I A;  1IXR C;  5E3O A;  4A3K J;  4B4C A;  1S7E A;  1SFE A;  2LF7 A;  3HPH A;  4M6V A;  4ENJ A;  3A0H C;  5LBQ A;  1FTZ A;  3DEE A;  2L0K A;  1FOW A;  1ACI A;  3HOY J;  1ZGA A;  1DPU A;  4PGG A;  3F8F A;  1LDD A;  4Y7N J;  3CJR B;  3J81 K;  4QTR A;  1TTY A;  2OZU A;  2O8K A;  3BJ6 A;  1KU9 A;  3CCY A;  1ERD A;  3E6M A;  1SC7 A;  1W0U A;  3BG7 A;  2ZO4 A;  4I6Z A;  2JPB A;  1JKQ C;  1V5F A;  1TNT A;  3ROU A;  4IF4 A;  5FKM A;  1P7J A;  2ME0 A;  1TQI A;  4LG0 A;  4OAZ A;  2FBH A;  1CF7 B;  4UUV A;  1P92 A;  3OIQ A;  3S32 A;  1S5L C;  2X6Y A;  3CUO A;  4ZYG A;  5B5E C;  2LSO A;  4O3M A;  3D1N I;  3GTK J;  3BJO A;  5L3G A;  2DOA A;  4CYC B;  2FJ1 A;  1WFX A;  2W25 A;  3PUB A;  3V8J A;  5JHF A;  2IBD A;  2Q8K A;  1RI7 A;  1Y0N A;  1MGT A;  4IXA A;  3PM1 A;  2V1D A;  1V5E A;  2V1N A;  4II2 A;  3IAS 2;  3TL4 X;  1IN5 A;  2DO7 A;  2JMW A;  4RLF A;  1FTT A;  3HXL A;  1O3T A;  5FFZ A;  3MEX A;  4JK1 X;  3BTL A;  3OYL A;  4CCO A;  2Y0S A;  3ERM A;  1FBU A;  1YYV A;  4OIN F;  2R5Y A;  2NVT J;  2LTP A;  5CPR B;  4MQ9 F;  2VXD A;  4P5O A;  3QOE A;  1U5T C;  2XB5 A;  3P9I A;  1YRN B;  2ACJ A;  2VJ5 A;  3QP6 A;  2CH0 A;  2NVU B;  1WQ2 A;  3RYP A;  1HST A;  1BIB A;  3C2B A;  2CWE A;  3PO2 J;  3BTC A;  3GWZ A;  3KZZ A;  2F5E A;  2W1O A;  1G4D A;  1I39 A;  3MQ0 A;  2LMD A;  4M3F A;  2DYS H;  3PSI A;  4MQV A;  3VPR A;  4LLL A;  4OU0 A;  4DNC A;  3S17 J;  5LEJ A;  5K5Q A;  2IT0 A;  3CDL A;  3OOU A;  2OA4 A;  1U78 A;  5HVQ C;  3PUF A;  5HS9 A;  1ZHF A;  3LAP A;  1LUJ B;  3WG9 A;  1QPI A;  1ON2 A;  4L9T A;  1B8I A;  4BXU A;  2ZSH B;  2NXN B;  4EJV A;  3K4K A;  3NEU A;  2OAZ A;  2HYF A;  4F55 A;  1HKS A;  2JPC A;  3GX4 X;  3E5U A;  5AIP A;  2BGC A;  3K70 C;  1U9N A;  1Z7L A;  2VPR A;  5IYB J;  3IH4 A;  1V54 H;  1V5G A;  1SD6 A;  3E6B A;  1MBH A;  3V7R A;  2AO9 A;  4PUS A;  1V3F A;  3HKZ N;  3JRI A;  1P6R A;  3BTJ A;  2F5D A;  3PQJ A;  5D8L B;  3L09 A;  3RDI A;  3JRF A;  2OF7 A;  3FXR A;  4U0Y A;  2M45 A;  3VDX A;  5JI6 A;  2WC2 A;  3HEF A;  3LMM A;  4BS9 A;  2K86 A;  4HA8 A;  3AFH A;  2K9S A;  3SFZ A;  3F3X A;  2HDD A;  1MH4 A;  4JQF A;  5CVR A;  2ZXJ A;  1R1V A;  5LGU A;  4RAZ A;  3OS2 A;  1WCM J;  2M87 A;  4II3 A;  4IJA A;  1NG6 A;  3BZ6 A;  2ISY A;  2D5V A;  3KX2 A;  4C2T A;  4E70 A;  3GTG J;  1FP1 D;  2MC4 A;  4KT6 A;  1EA3 A;  4N9H A;  1R5I D;  2L9V A;  2XDV A;  2LFB A;  4D9J A;  2A3S A;  2CG4 A;  1PDN C;  3WE3 A;  4A3D J;  2IXS A;  2E2I J;  3GTO J;  2VE9 A;  3KCC A;  3SZT A;  5AIQ A;  2LG4 A;  4HNU A;  3SHF A;  1WGX A;  3ZN0 A;  2BE5 F;  3Q0V A;  5H6R A;  4GRI A;  2BVM A;  3HIF A;  2JVG A;  4UVA A;  4FTH A;  3G4S I;  3G1M A;  5E8I A;  5EEH A;  1VFC A;  1EKE A;  1ZLK A;  2PJR B;  4EAT A;  2EIM H;  4KIS A;  4I99 C;  4WCG A;  1EF4 A;  3OYK A;  5J4Y A;  2COM A;  5IT9 Z;  2LYC A;  1W4M A;  5KK1 A;  2HXO A;  2FRH A;  5TGT A;  4HLY A;  2HS5 A;  1Q1H A;  1Z77 A;  3I54 A;  4BY7 J;  5D8K B;  5LHI A;  3JRB A;  1E3O C;  4V2G A;  1GT0 C;  5CQE A;  2JQ7 A;  1EV7 A;  4HV6 A;  1X2M A;  3ELK A;  4C30 A;  5FJ8 J;  3V8L A;  3W6K B;  1W5T A;  3IL2 A;  1ZTR A;  3KP2 A;  3F23 A;  1MSF C;  2ZJP F;  2EIK H;  4N9I A;  3G71 I;  5IYD J;  5HOO A;  4LK0 F;  1MBG A;  2XPU A;  5J3L A;  1IO2 A;  1EJ9 A;  2VON A;  1RR7 A;  1OCR H;  3H1C A;  5L3D A;  3JRC A;  2XUB A;  4B3A A;  1TWH J;  1JT6 A;  3M4O J;  1IF1 A;  3C18 A;  3QWL A;  2BHY A;  2K3P A;  3F8C A;  4E7L A;  2R5Z B;  3REO A;  4R79 A;  3WTT C;  4A3G J;  5DV5 A;  3TKY A;  4EVI A;  2GBY A;  3GLL A;  3FXL A;  3CF5 F;  1SVO A;  3DBH B;  1QZZ A;  2L7Z A;  3MMY B;  5FLM J;  5GAE J;  3CP8 A;  2AQE A;  3PIO F;  1AKH B;  2AXT C;  4RB3 C;  1PUE E;  4B3X A;  4Y52 J;  2C6Y A;  4I02 A;  3EQL F;  1Z6R A;  4AC0 A;  1X1D A;  3FXM A;  1HDD C;  2JWT A;  4A0X A;  3VOE A;  4LD5 A;  4HSR A;  4CCK A;  2EFW A;  3COA C;  2XGE A;  2HFH A;  3Q9S A;  2BW3 B;  3QU3 A;  2LDU A;  1OQY A;  3FXQ A;  4P9U A;  3CCE I;  3DTI A;  5ED4 A;  2FF4 A;  2GA1 A;  3A03 A;  2P81 A;  1IDZ A;  2DT5 A;  3UNG C;  3F21 A;  2X85 A;  5F6F A;  3L2U A;  2JJ7 A;  4RS8 A;  3W3C A;  1D0Z A;  2UXX A;  2VKV A;  4WK8 F;  2FU4 A;  4ZYE A;  3VWB A;  2EWN A;  2XF6 A;  1B9N A;  1TNS A;  3MFK A;  4X0G A;  1D1C A;  2ID3 A;  2WY7 Q;  4U0W A;  3GTM J;  2HYG D;  2PFB A;  3L2W A;  4AYB N;  5EF6 A;  3MWM A;  4BEH B;  4CZC A;  1FX7 A;  1TWG J;  1TWC J;  5K7F A;  2X0L A;  3I64 A;  2LY1 A;  3Q0W A;  1RR8 C;  4N0B A;  4EM0 B;  4ZTF A;  5JVG F;  2IS2 A;  4RLQ A;  2A5W A;  1MBK A;  3HC7 A;  3HSF A;  1F36 A;  2DI3 A;  1B72 A;  1FC3 A;  4M3D A;  3GXO A;  1BJA A;  2E5Z A;  2R0Q C;  5DM6 F;  3KP6 A;  2YX7 A;  3CCR I;  1VND A;  4F92 B;  4DZP A;  3W2W A;  2IGN A;  2EIL H;  2HOE A;  2M9H A;  3KET A;  4XSX F;  2VJJ A;  3H3Z A;  5E1W A;  4YFK F;  4HF0 A;  2ELH A;  3W6J B;  3I4N J;  3ECH A;  5E79 C;  1AHD P;  2R7W A;  2CYY A;  2P7C B;  1PVE A;  1D0X A;  1QHG A;  1IZ1 A;  1QVU A;  3H0D A;  2VBX A;  2G9W A;  2A68 F;  1SAU A;  3S2W A;  1WJE A;  2CMP A;  5GPC A;  1HA8 A;  4HPQ A;  1I6X A;  4OIO F;  2DPU A;  2A5Y B;  1TQP A;  2FX0 A;  3CLO A;  4YEL A;  1IRG A;  3WTV C;  3WU2 C;  4UV8 A;  3HSE A;  1YTY A;  4KUM A;  4HLX A;  1KGS A;  5TIS C;  5FLX K;  2KHM A;  5GAH J;  2QQ8 A;  5HDN A;  3HG9 A;  4DW6 A;  4B8X A;  4BEH A;  4EV0 A;  3RPU A;  3T8T A;  3HZJ A;  3PSF A;  3RQ4 A;  2M30 A;  4RGS A;  1YO5 C;  3RZO J;  2LBF A;  2R7T A;  3G1O A;  5FLX Z;  3PL8 A;  1MSE C;  2DFF A;  3V42 A;  1XX5 A;  2LVS A;  1MH3 A;  2K7L A;  1IRX A;  2ZCW A;  4HV5 A;  1ZRE A;  1PYV A;  3VB2 A;  2DTZ A;  3IWZ A;  4QSH A;  3IH3 A;  5FD6 A;  1OFC X;  1BW5 A;  3KEO A;  2E1C A;  3NQO A;  3U1D A;  1X3W B;  2A61 A;  5DEQ A;  2QKL B;  5TRD A;  4IVN A;  4RM2 A;  4Q47 A;  2DMQ A;  2JRT A;  4OMZ A;  2YX4 A;  4Z6Y A;  4H0E A;  2DOE A;  3JR9 A;  2E1O A;  1MJ9 A;  2HOA A;  2QA4 I;  2ADU A;  1ZG1 A;  2VB6 A;  4DYR A;  1R5G A;  2CRG A;  4L5I A;  1VQ7 I;  4HBL A;  1XGS A;  2X1C A;  3VYR B;  2OZ6 A;  2HQR A;  1FOY A;  2DA4 A;  1BW6 A;  3H0G J;  2IPQ X;  3SDB A;  4FE7 A;  2B63 J;  1E17 A;  1QZE A;  3G3Z A;  2K3F A;  4IRG A;  1XS9 A;  1WPK A;  2K02 A;  1B6A A;  1RIO H;  2X9D A;  1AU7 A;  1U9O A;  2MH2 A;  4A6D A;  5C4J J;  2HOS A;  2P4W A;  1BI3 A;  2W57 A;  4CYC A;  1E0E A;  5BMZ A;  1OCT C;  5C4X J;  1WVR A;  1VQK I;  3MAJ A;  5JFR A;  4IHY A;  1ZH5 A;  3EUH C;  3AAF A;  5A2Q Z;  3R4K A;  5DM7 F;  2VBY A;  3LOC A;  2OBP A;  4Y4R A;  1HW1 A;  1WH5 A;  2X6O A;  2V26 A;  1R7J A;  4I0B A;  4XRF A;  3TW7 A;  3GTQ J;  2KJB A;  5E20 A;  2GOM A;  4KIF A;  3JTG A;  2Z2S B;  3S93 A;  3P7N A;  3M8E A;  4RB0 A;  1VQM I;  2HNH A;  2CO5 A;  4JYK A;  2Z99 A;  2P7V B;  4PJM A;  4E7S A;  3BZK A;  2DT6 A;  3D5R C;  1K61 A;  1SD4 A;  4DYC A;  4P96 A;  2KJC A;  4BJT A;  3L7W A;  2DW4 A;  3S16 J;  3DKW A;  2XC7 A;  5K1Y A;  1O4X A;  3TO7 A;  4A0Z A;  1J09 A;  2HYJ A;  3TOA A;  2RGV A;  3KE2 A;  4A3E J;  2DJN A;  1USS A;  2HZD A;  5DD4 A;  4M74 A;  3WU1 B;  2GA2 A;  2I5U A;  4L9V A;  4DJA A;  1S72 I;  4OOI A;  3RKQ A;  3A4C A;  1IC8 A;  3FZV A;  3QYB A;  3EUA A;  1QU3 A;  1YOV B;  1SD5 A;  2HKX A;  1AA7 A;  3HM5 A;  4UUT A;  4JOM A;  1SFO J;  2MH9 A;  3MD2 A;  1VQ6 I;  4S05 A;  4BJ5 C;  3IUO A;  1TT5 B;  3HBL A;  3KFW X;  1R49 A;  3BTI A;  1LVA A;  1DDN A;  5FO5 A;  4BNC A;  1ZRF A;  3CCV I;  4UV9 A;  3HUG B;  2KDO A;  4EJW A;  3OOP A;  3SXY A;  4MNU A;  5DYM A;  3N97 A;  3L1P A;  3MZH A;  5IY5 H;  4G7Z F;  3ASN H;  3GFM A;  4UB8 C;  3H3V K;  2XGC A;  1UHW A;  1S8N A;  2CQK A;  4BHP A;  1K79 A;  1PUF A;  4I98 B;  2YR2 A;  4EJT A;  2BW3 A;  2P8T A;  4XOP A;  1WWX A;  3WTX C;  4XON A;  2PG4 A;  2W82 A;  3C2G A;  5IP9 J;  3BCA A;  4UHT A;  2L02 A;  5ERI A;  1KU2 A;  3UKG A;  1LFB A;  3NWS A;  4M6Y A;  4A3F J;  1O7F A;  2MLG A;  3ABL H;  2ZNZ A;  2RVC A;  4GO1 A;  3HRS A;  2E35 A;  3K0L A;  5GAD J;  2X6W A;  4DQ2 A;  4YFX F;  2JRM A;  2LKX A;  3ZQ7 A;  3OMY A;  1B1B A;  1TP4 A;  2OPT A;  1YJ9 I;  2V1X A;  1YX3 A;  1MMS A;  1REP C;  4ASN A;  2EIJ H;  2R7R A;  5JHU A;  2CS3 A;  2VJ4 A;  3KYC B;  1W36 D;  4MGR A;  4I01 A;  4MO7 A;  4R8H A;  2OCC H;  1B8I B;  2FMY A;  3H92 A;  2PEX A;  1ZGW A;  4FIS A;  4BUP A;  2MFZ A;  5FKK A;  1HKQ A;  2QSF X;  5D5V B;  4I2O A;  2E1M B;  3FK7 A;  1WRJ A;  4XLA A;  2VC0 A;  4A0Y A;  3CJN A;  4JBA A;  1R22 A;  2H1L A;  3ZQF A;  5D5X B;  3CMA I;  1BL0 A;  1BOB A;  1RC9 A;  2I10 A;  2KLO A;  4M6X A;  1LJ9 A;  3FK6 A;  4XMY A;  5E18 F;  2VKE A;  3EPZ A;  1FMV A;  3F6O A;  3K2Z A;  1U6G A;  4LLG F;  4A3B J;  5FRM A;  1UJ8 A;  4HZF A;  1IN6 A;  3R0J A;  4A12 A;  1T39 A;  4FET A;  4HF2 A;  5J6X A;  4GFB A;  1D8K A;  3O3K A;  4NDL A;  3DXJ F;  3ZQH A;  4CCJ A;  2BHZ A;  2HQN A;  2WWY A;  1RNL A;  1SEU A;  1SAX A;  2L7M P;  3I59 A;  3CCL I;  2IJL A;  2B0L A;  2R92 J;  2EBI A;  4KFC A;  1ZR2 A;  2CJJ A;  2HVS A;  1CQT A;  5JLX A;  1OPC A;  3F8M A;  5CYV A;  3OYB A;  3DKX A;  4BY1 J;  2UUZ A;  4RAG A;  2GXB A;  3I4M J;  2FOK A;  1XGO A;  4XK4 A;  4QPQ A;  3DEW A;  2HEO A;  5DUK A;  2KDZ A;  5DDG A;  1PP8 F;  4CSW A;  1R4N B;  1SMT A;  5H6Q A;  4B09 A;  4A93 J;  3MKY B;  5ICF A;  2F5C A;  2XF7 A;  3BP8 A;  1I3A A;  3CZ6 A;  1XN7 A;  1FOK A;  3GTJ J;  4IQ4 A;  2CV1 A;  4HAM A;  3MKW B;  4PSX A;  4X1E A;  5JVT A;  2E2H J;  3AL0 C;  2M7A A;  1FZP B;  1X1P A;  1YW9 A;  2CUF A;  5B3S H;  1GV2 A;  5DCF A;  4PCQ A;  5D4S A;  5H20 A;  1BIA A;  4XID A;  3SJM A;  2HZT A;  2IGK A;  2DT7 B;  2FQ4 A;  3RYR A;  2BZT A;  3DF8 A;  2HPI A;  2VOO A;  3CD6 I;  2K9N A;  2JA8 J;  1X1B A;  3QOD A;  3N4M A;  3D0S A;  2DDB A;  1MBJ A;  2RRE A;  3BRO A;  1IUY A;  4XLE A;  1KU7 A;  4EMS A;  1X19 A;  3DLL F;  3S15 J;  4PZJ A;  1R1T A;  4A6E A;  1AKH A;  2HDC A;  4G7O F;  2V1U A;  1A31 A;  3IC7 A;  3KLN A;  3CME I;  3HHG A;  4XN0 A;  1UZC A;  2XAF A;  4D7N A;  3I58 A;  3R6S A;  2O8X A;  5JR3 A;  1UG0 A;  3KIO A;  2E2J J;  5J4V A;  2CUJ A;  1X1A A;  4BL0 B;  2Y0S N;  3K1M A;  5IP7 J;  4G94 A;  2AHQ A;  3I3L A;  4EEF G;  4M9X A;  4ZYA A;  3TBI A;  2H6B A;  3M1C A;  2R4G A;  1JKR C;  4BAC A;  4BDY A;  3ZQC A;  1FY7 A;  3IRQ A;  3LFU A;  2LNB A;  1I1G A;  2HDW A;  4ON0 A;  1G59 A;  3BLY A;  2R7F A;  2ZFW A;  3CF2 A;  3KP4 A;  4E7H A;  3DLA A;  1FSH A;  3DU6 A;  2KIU A;  3OYJ A;  1YJW I;  2XIG A;  2XKO A;  2A69 F;  2G0E A;  2YS9 A;  1W7P A;  3OWT A;  4CCL A;  3K7A J;  4LJZ F;  4MTE A;  2VQH A;  2HI3 A;  3L2Q A;  4XNF A;  1I6H J;  3AG3 H;  2ZXI A;  5HLI A;  1J5Y A;  3ONQ A;  2MW8 A;  1H0M A;  3H35 A;  1I3Q J;  4M3E A;  2JA2 A;  2ZME C;  2TRT A;  3JRH A;  3ZP5 A;  1JGG A;  2VT3 A;  1Z91 A;  2JA5 J;  4BQA A;  3BDD A;  3T1B A;  1ZQ3 P;  2ESH A;  4ITV A;  5HDG A;  4ZZD A;  3AL0 B;  3X2Q H;  1O3Q A;  1UMQ A;  2KT0 A;  1DU0 A;  1ETO A;  2XAG A;  4KN4 X;  3NRV A;  3FM3 A;  2NVX J;  4FAS D;  2IAI A;  2MLK A;  1QGP A;  4DBQ A;  2EFQ A;  1TC3 C;  3MKL A;  1LB2 A;  4RA2 A;  2HU9 A;  1IRF A;  4CGZ A;  2M0M A;  1P4W A;  2UXN A;  4JX6 A;  4PJL A;  2N8G A;  3JRD A;  2R5Z A;  1R00 A;  2VQG A;  2GWR A;  3ABU A;  5DTD A;  3OYA A;  4IHX A;  1IN4 A;  5E1Z B;  3OYG A;  3EUK L;  4M9Z A;  1PJR A;  1TW2 A;  1YHQ I;  1RPW A;  2DMT A;  1XGN A;  4D5F A;  1GXP A;  3BPV A;  3LL7 A;  4HNT A;  1RKW A;  2NS7 A;  2O7O A;  3I5U A;  4WXC A;  4EJU A;  4W97 A;  4BXX J;  2M4K A;  5DUI A;  2ZXH A;  2K9L A;  2ZME A;  4B43 A;  4Y15 A;  1AOY A;  2EZK A;  4AVP A;  3RKW A;  1OMI A;  2FD5 A;  2PMZ N;  3SZG A;  2E1N A;  5H2F C;  2E7W A;  2BEO A;  2E7X A;  5FB2 A;  4DYQ A;  1NG7 A;  2IW5 A;  1F43 A;  1TW3 A;  2V6C A;  1IAW A;  1QHH D;  3ESW B;  5F64 A;  3MCZ A;  2VN2 A;  4B1R A;  5D4R A;  1D0Y A;  5BOX A;  2YU3 A;  2PN6 A;  4XKW A;  3HOU J;  5CVV A;  1FOX A;  3B73 A;  1FP2 A;  3LQQ A;  3J7A Y;  5CJ9 A;  3I71 A;  4XKV A;  3DTE A;  3ZQI A;  2LK2 A;  4HX4 A;  4LFU A;  6PAX A;  4NNJ A;  3OSF A;  3BC8 A;  1J75 A;  1ON1 A;  2DA7 A;  2EA4 A;  2VE8 A;  3OIP A;  4RGR A;  3IAM 2;  2XPV A;  4XRS G;  1I27 A;  1VZ0 A;  3OYM A;  3GLX A;  3PNV A;  2RAE A;  2MD0 A;  4IEJ A;  1BR4 A;  4KN7 X;  3HOS A;  2M5W A;  1JTX A;  3HHH A;  2BY3 A;  3MVP A;  3SEQ A;  4YIR X;  1ZR4 A;  3S1R J; 
#chains in the Genus database with same CATH homology
 2EA2 A;  4NQW A;  2DQR A;  2FA5 A;  3FWE A;  2VBZ A;  3C7J A;  3IKT A;  3DV8 A;  4MHG A;  3L00 A;  3T5X A;  2EV5 A;  3M8F A;  4HQE A;  1I1S A;  1FPQ A;  4IRH A;  3LAJ A;  4M73 A;  2NS0 A;  1VTN C;  4KIC A;  2EB7 A;  2JZY A;  2PI0 A;  4AIH A;  1IXC A;  3KP3 A;  1MDM B;  2O3F A;  2D45 A;  1KYZ A;  3ISP A;  3J7A O;  5FGM A;  2FEZ A;  4ESB A;  1K78 A;  3KEQ A;  3ZN1 A;  3U2R A;  3GFI A;  1ONV A;  1KA8 A;  1B59 A;  5HS7 A;  2X4H A;  4L18 B;  4UNO A;  5LGN A;  1O7L A;  5FFX A;  1JXS A;  2EFN A;  3PFI A;  3M9A A;  4FX0 A;  5ICC A;  2XAH A;  4U88 A;  4HX7 A;  4EJO A;  2FXA A;  1XMA A;  2W84 A;  2ZBK A;  3M7G A;  1W7P D;  4KIB A;  2DAO A;  2PMU A;  2Z5U A;  3EET A;  1MDM A;  2XRO A;  1L3L A;  1XMK A;  2IVM A;  2F2E A;  4G9Y A;  1T6S A;  2JTV A;  2A6E F;  4KNY A;  2L54 A;  3FF5 A;  1YQA A;  3GZ6 A;  3F8N A;  3FMQ A;  2DTR A;  4LB6 B;  1BI0 A;  3R60 A;  3VFZ A;  2D1V A;  1C0W A;  2HGC A;  2QYO A;  4LGW A;  4ZYD A;  1RZ4 A;  3GEZ A;  2XV4 S;  2NRA C;  2V79 A;  3CTA A;  4UVC A;  3U9G A;  1ZG5 A;  5L3B A;  3DP7 A;  2V9V A;  3QP5 A;  3I59 B;  3P9C A;  1U5T B;  5FD5 A;  3EUH A;  3JSP A;  1MD0 A;  4KYW A;  4MEY F;  3ERE D;  3I4P A;  5LRS A;  4HF1 A;  1FYM A;  2QEN A;  3T8R A;  1U2W A;  1P4A A;  2LKP A;  2QUF A;  3GF2 A;  2JT1 A;  2A6H F;  1E2X A;  3K69 A;  3JTH A;  2MA3 A;  4QLC U;  4RGU A;  4RB1 A;  4Y17 A;  1DPR A;  4M71 A;  3K1P A;  5D5U B;  2RC4 A;  4MTD A;  3TGN A;  1S7O A;  1LEB A;  1W5S A;  2L4M A;  2D1H A;  2RDP A;  5KVR A;  1OYY A;  3PQK A;  5TJJ A;  1DP7 P;  1IN8 A;  1H9G A;  1XSD A;  2FBK A;  2EFO A;  1RUN A;  1D5V A;  2KIM A;  2WTE A;  1J2X A;  1T0F A;  2O0Y A;  1G3S A;  1Z9C A;  2P6S A;  2HTJ A;  1HXD A;  3E97 A;  1UHM A;  2O03 A;  2YPR A;  2NYX A;  4CXF A;  2GQQ A;  4LK1 F;  2IP2 A;  3GO5 A;  5F1R A;  3DQV C;  3E6C C;  4P9F A;  1DUX C;  1S29 A;  3KP7 A;  3ZMS A;  3GYH X;  4GXO A;  2RN7 A;  1KYW A;  1W7P B;  2Q2E A;  1NHA A;  3F22 A;  3E5X A;  4Y13 A;  3B02 A;  3V7C A;  3J80 Z;  1B9M A;  3L2C A;  5IT9 K;  3FX3 A;  2QQB A;  3SZP A;  1TBX A;  3H3U A;  2RNJ A;  3TDU C;  1U8R A;  4O5V A;  1X3U A;  4WXD A;  3KZY A;  1CF7 A;  2L3D A;  3D5L A;  1MKM A;  4I7H A;  4LG0 B;  5L3E A;  3IKV A;  3ZMD A;  4BHC A;  1RUO A;  1SFX A;  1LEA A;  3SQN A;  4RB2 C;  3QAH A;  2DQL A;  5CVJ A;  3CUQ C;  1R5H A;  1HQC A;  2VT2 A;  3ZMT A;  5ILS A;  4OMY A;  5BQT A;  2P5V A;  3V8K A;  1YW7 A;  2FNP A;  1HW5 A;  4I09 A;  3VOD A;  3ZMV A;  3JAM Z;  3R0A A;  1D3Y A;  1ZAO A;  3F8B A;  5HLH A;  3T0Y A;  2EV6 A;  1F5T A;  4FX4 A;  2WV0 A;  4L5J A;  1BI2 A;  1IXS B;  1G6N A;  1K6O A;  2P5K A;  2W24 A;  1QBJ A;  2P5L C;  2NNY A;  1XSX A;  2Z33 A;  1G3W A;  2O6G E;  2F5F A;  4YIF A;  1PP7 U;  2FNA A;  5D6E A;  5HDK A;  2QBY A;  1B4A A;  2CGP A;  5AON A;  3O2P E;  3WGI A;  1GHC A;  4AIJ A;  3Q9V A;  2EJR A;  3HRU A;  4YII A;  1XB4 A;  1FYK A;  4HW0 A;  1FYL A;  1YW8 A;  3ML6 A;  1BOA A;  1XCV A;  3EYY A;  5LEK A;  1EH7 A;  1G3T A;  5D5W B;  1JGS A;  5LRR A;  3P9K A;  1T38 A;  1SFU A;  2VOP A;  2XKP A;  2R7D A;  3ZMU A;  1EH6 A;  2IRF G;  1MJA A;  3FHZ A;  5CVU A;  1V4R A;  4ESF A;  2CSO A;  2LF8 A;  1QO0 D;  4QWQ A;  5E8G A;  3WGH A;  3CO6 C;  4Q48 A;  4ZYH A;  3CUQ A;  4IHT A;  4AIK A;  3DPT A;  3LA7 A;  5A2Q K;  4LMY A;  2GAU A;  2VC1 A;  1IN7 A;  2L4A A;  3GFJ A;  2AXL A;  4K2E A;  3RIR A;  2OU2 A;  3LQR A;  1U3E M;  4WXH A;  3J81 Z;  4BAY A;  2RKH A;  3GUD A;  4GYG A;  3HUG A;  3IRR A;  1ZGJ A;  3GW2 A;  2FML A;  2QQA A;  1KU3 A;  3WGG A;  2QM3 A;  2GIV A;  1MJB A;  1F4K A;  1K78 B;  1WI9 A;  2DFI A;  4EGZ A;  3VEP A;  4UVB A;  1LQ1 A;  1YFH A;  5LLQ A;  4BHB A;  3TO6 A;  2PJP A;  4HQM A;  5E1X A;  1BC8 C;  2FE3 A;  1XCB A;  3LFK A;  2STT A;  1T2K A;  1JHH A;  5LHG A;  4EM1 A;  3K9T A;  2HKO A;  3J80 K;  1FWZ A;  1S6L A;  1JHF A;  4XLN F;  4KA4 A;  4UXN A;  4BYY A;  1LDK B;  3HRM A;  5CVI A;  3DFG A;  2R3S A;  5BPI A;  4R1H A;  1OYI A;  4CIC A;  4KDP A;  3O6B B;  4IHS A;  3FMS A;  2XGX A;  2XRN A;  4U7B A;  1G3Y A;  4FT8 A;  3C3W A;  1U78 A;  3EDP A;  2H6C A;  2ZKZ A;  4U0V A;  1S7A A;  4XBF A;  2Y48 A;  2TDX A;  1Z05 A;  4O6J A;  4EGY A;  4ENM A;  2J5P A;  1P2F A;  3DEU A;  1F1Z A;  3F72 A;  4XLP F;  5EEG A;  1XDS A;  2QZ8 A;  5BPD A;  1UFM A;  2DPD A;  3KLO A;  2Z3Y A;  1GXQ A;  2OD5 A;  4LB5 A;  2FQ3 A;  3MZY A;  1FNN A;  3QPT A;  3ULQ B;  2XAJ A;  1J9I A;  3RTR A;  3EYI A;  2ETH A;  4A5N A;  4G7H F;  1HKT A;  1H9T A;  1HSJ A;  1ZLJ A;  1I5Z A;  4D0P A;  4ETS A;  2XVC A;  1UCR A;  2EFP A;  3ZPL A;  4P55 A;  1OYW A;  3WE2 A;  1ZRD A;  2KIF A;  2QWW A;  1T98 A;  4A2U A;  3RKX A;  1R36 A;  3WTY C;  3E6D A;  3OV8 A;  1O3S A;  3WTZ A;  1EH8 A;  2ZNY A;  2M1B A;  3IWF A;  5DCM A;  3BWG A;  4KIG A;  3WTU C;  1LNW A;  3WTS C;  1L0O C;  5L3F A;  2HR3 A;  4S04 A;  2Q0O A;  3QOP A;  1O57 A;  5J8C A;  1HW2 A;  1YS6 A;  1KQ8 A;  2DK8 A;  4GYI A;  3KP5 A;  2JSC A;  2IA2 A;  2ZME B;  4M72 A;  4ZZL A;  2EV0 A;  3QPH A;  1FLI A;  1XGM A;  4OIR F;  3FMR A;  5L3C A;  3TQN A;  4Q5S F;  2O61 A;  2D2W A;  3L9F A;  2W85 A;  1CGP A;  4L9N A;  2XAQ A;  2DU9 A;  3I0T A;  4NHJ A;  1TQM A;  2VXZ A;  1Z7U A;  5HLG A;  3JSO A;  3HYI A;  2G7U A;  1J0R A;  4L0Z B;  4OIP F;  1OKR A;  3HTU A;  4KT5 C;  3GFL A;  3LST A;  4G8X A;  3WTW C;  2OQR A;  4G6D A;  2Y0M A;  3WOD F;  2P6T A;  2MD5 A;  5J8F A;  4G6Q A;  4PDK A;  3LA3 A;  3HTS B;  3HRT A;  4CDG A;  1KQ9 A;  2QLZ A;  2H27 A;  2Y75 A;  1BM9 A;  3HOT A;  2MC3 A;  4WF2 A;  1QQI A;  3V7S A;  1R58 A;  3ABT A;  3C1D A;  1J7K A;  4KMF A;  5ICE A;  2YSR A;  3G73 A;  1STZ A;  3R61 A;  2FSW A;  2G7H A;  5BS6 A;  4RGX A;  1BI1 A;  1Y0U A;  4Q4Z F;  1R23 A;  1P4X A;  1YG2 A;  2IA1 A;  2CFX A;  3BOQ A;  1WSU A;  1GVJ A;  3IHU A;  1ZRC A;  1MZB A;  2BV6 A;  4L9J A;  4A5M A;  4ENK A;  1XD7 A;  1QZY A;  4RAY A;  1ZAR A;  3K1N A;  2MBF A;  1XDU A;  4HX8 A;  4XSZ F;  1ZG3 A;  2A07 F;  1BC7 C;  4EM2 A;  5IT3 A;  1ULY A;  1ZYR F;  1U5T A;  2DK5 A;  2NNN A;  3CDH A;  2FBI A;  2STW A;  1UB9 A;  3F6V A;  2M8E A;  1UST A;  3TO9 A;  5K5O A;  2PMH A;  1SMY F;  3Q5F A;  3I53 A;  3BPX A;  1BBY A;  3BY6 A;  3FXU A;  2VOD A;  3DPL C;  2AS5 F;  2Z9O A;  4NB5 A;  3FM5 A;  4M9S A;  2DBB A;  1ZN2 A;  4OIQ F;  1WKM A;  4IRI A;  1F9N A;  5D6F A;  4GCV A;  2KRF A;  3M1E A;  2PBI A;  4PGH A;  3RKY A;  2NAZ A;  3RJP A;  1FBQ A;  2OQG A;  2BYV E;  2RV8 A;  1Z6T A;  2K4B A;  3RI4 A;  4F7Z A;  5ILU A;  1YS7 A;  1HBX G;  3TDZ C;  2K27 A;  2DLL A;  1AWC A;  5ICG A;  2PLY A;  1QPM A;  4CYD A;  1QNT A;  2QBY B;  2PQ8 A;  1TLH B;  4WX9 A;  1K7A A;  1YIO A;  3WU0 A;  3CUQ B;  2ISZ A;  2ESN A;  4KMU X;  2UZK A;  3QU6 A;  1FBS A;  3TOB A;  4YG2 F;  1O3R A;  2H94 A;  5LGT A;  3ZMZ A;  4HDU A;  2VBW A;  1SD7 A;  2RQP A;  3ECO A;  5LHH A;  4CZZ A;  4AWX B;  2J5O A;  3E3V A;  3BJA A;  2UWM A;  1D8J A;  1JE8 A;  3LA2 A;  4U7D A;  5DCM B;  3HSR A;  4EQQ A;  3JAM K;  5K5R A;  5HS8 A;  2XAS A;  3V4G A;  2HWV A;  2EK5 A;  4I0A A;  1R1U A;  1A04 A;  2KKO A;  1KQ0 A;  2H09 A;  1BN5 A;  2ZJ2 A;  5E17 F;  2BBY A;  1S3J A;  3LWF A;  1LDJ A;  4Z2Y A;  3RPQ A;  4LLN A;  4CO8 A;  2L01 A;  2K4J A;  2QVO A;  4YFN F;  1J59 A;  1Z1D A;  3CO7 C;  5DD8 A;  4HDV A;  3QRF F;  1XSV A;  1OR7 A;  1FSE A;  2CW0 F;  4ESJ A;  4L0Y B;  2IA0 A;  1FT9 A;  2QQ9 A;  2GZW A;  4HYE A;  4MEX F;  3JW4 A;  4TV7 A;  4CHU A;  1YLF A;  3E5Q A;  4HOB A;  4IPA A;  4ZH4 F;  2XHK A;  1IW7 F;  5CLS A;  2HTS A;  4BH9 A;  4WWC A;  3GVA A;  5ILV A;  4GGG A;  4ENN A;  4FHT A;  3GZ5 A;  1ODD A;  4AD9 A;  2GXG A;  1IXR C;  1SFE A;  2LF7 A;  4ENJ A;  5LBQ A;  1ZGA A;  1DPU A;  4PGG A;  3F8F A;  1LDD A;  3J81 K;  1TTY A;  2OZU A;  3BJ6 A;  1KU9 A;  3E6M A;  2ZO4 A;  2JPB A;  1TNT A;  3ROU A;  4IF4 A;  1TQI A;  4LG0 A;  2FBH A;  1CF7 B;  4UUV A;  1P92 A;  3CUO A;  4ZYG A;  4O3M A;  2LSO A;  3BJO A;  5L3G A;  2W25 A;  3V8J A;  2Q8K A;  1RI7 A;  1MGT A;  4IXA A;  2V1D A;  1IN5 A;  2DO7 A;  1O3T A;  5FFZ A;  3MEX A;  4JK1 X;  1FBU A;  1YYV A;  4OIN F;  4MQ9 F;  4P5O A;  1U5T C;  3P9I A;  2ACJ A;  3QP6 A;  1WQ2 A;  3RYP A;  1HST A;  1BIB A;  2CWE A;  3GWZ A;  3KZZ A;  2F5E A;  1G4D A;  3MQ0 A;  4MQV A;  4LLL A;  4OU0 A;  4DNC A;  5LEJ A;  5K5Q A;  2IT0 A;  2OA4 A;  5HVQ C;  5HS9 A;  1ZHF A;  3LAP A;  3WG9 A;  1ON2 A;  4L9T A;  4BXU A;  4EJV A;  3NEU A;  2OAZ A;  2HYF A;  1HKS A;  2JPC A;  3GX4 X;  3E5U A;  5AIP A;  2BGC A;  1SD6 A;  3E6B A;  3V7R A;  1V3F A;  1P6R A;  2F5D A;  3PQJ A;  5D8L B;  3L09 A;  3RDI A;  3FXR A;  4U0Y A;  2M45 A;  5JI6 A;  2WC2 A;  2K86 A;  4HA8 A;  3SFZ A;  3F3X A;  4JQF A;  5CVR A;  2ZXJ A;  1R1V A;  5LGU A;  4RAZ A;  2M87 A;  4IJA A;  3BZ6 A;  2ISY A;  4E70 A;  1FP1 D;  4N9H A;  2A3S A;  2CG4 A;  1PDN C;  3WE3 A;  2VE9 A;  3KCC A;  3SZT A;  5AIQ A;  3SHF A;  3ZN0 A;  2BE5 F;  5H6R A;  3HIF A;  4UVA A;  5E8I A;  5EEH A;  1ZLK A;  4WCG A;  2COM A;  5IT9 Z;  1W4M A;  5KK1 A;  4HLY A;  2FRH A;  2HS5 A;  1Q1H A;  3I54 A;  5D8K B;  5LHI A;  1EV7 A;  4HV6 A;  3ELK A;  3V8L A;  3W6K B;  3IL2 A;  3F23 A;  1W5T A;  3KP2 A;  4N9I A;  5HOO A;  4LK0 F;  2VON A;  5L3D A;  2XUB A;  1IF1 A;  3C18 A;  3F8C A;  3REO A;  4R79 A;  3WTT C;  5DV5 A;  3TKY A;  4EVI A;  1QZZ A;  1PUE E;  4RB3 C;  2C6Y A;  4I02 A;  3EQL F;  1Z6R A;  4A0X A;  3VOE A;  4LD5 A;  2EFW A;  3COA C;  2HFH A;  3Q9S A;  3QU3 A;  2LDU A;  4P9U A;  3FXQ A;  5ED4 A;  2FF4 A;  2GA1 A;  2DT5 A;  3F21 A;  5F6F A;  4RS8 A;  2UXX A;  4WK8 F;  2FU4 A;  4ZYE A;  2EWN A;  1B9N A;  1TNS A;  3MFK A;  4U0W A;  2HYG D;  2PFB A;  3MWM A;  1FX7 A;  2X0L A;  3I64 A;  4N0B A;  4EM0 B;  3HSF A;  2DI3 A;  1FC3 A;  3GXO A;  1BJA A;  3KP6 A;  2YX7 A;  2HOE A;  3KET A;  4XSX F;  3H3Z A;  5E1W A;  4YFK F;  4HF0 A;  2ELH A;  3W6J B;  3ECH A;  2CYY A;  2P7C B;  1IZ1 A;  2VBX A;  2G9W A;  2A68 F;  3S2W A;  1I6X A;  4OIO F;  2DPU A;  2A5Y B;  1TQP A;  3CLO A;  1IRG A;  3WTV C;  4UV8 A;  3HSE A;  1YTY A;  4KUM A;  4HLX A;  1KGS A;  5FLX K;  5HDN A;  4B8X A;  4EV0 A;  3T8T A;  3RPU A;  2M30 A;  4RGS A;  1YO5 C;  5FLX Z;  2K7L A;  2ZCW A;  4HV5 A;  1ZRE A;  3VB2 A;  3IWZ A;  5FD6 A;  3KEO A;  2E1C A;  3NQO A;  3U1D A;  2A61 A;  5DEQ A;  5TRD A;  4IVN A;  4Q47 A;  2JRT A;  4OMZ A;  2YX4 A;  4H0E A;  1MJ9 A;  2ADU A;  1ZG1 A;  1R5G A;  4L5I A;  4HBL A;  1XGS A;  2OZ6 A;  2HQR A;  2IPQ X;  1E17 A;  3G3Z A;  4IRG A;  2K02 A;  1B6A A;  1RIO H;  2MH2 A;  4A6D A;  2P4W A;  1BI3 A;  2W57 A;  5BMZ A;  3MAJ A;  5JFR A;  1ZH5 A;  3AAF A;  5A2Q Z;  3R4K A;  2VBY A;  2OBP A;  1HW1 A;  4I0B A;  1R7J A;  4XRF A;  2KJB A;  5E20 A;  4KIF A;  3JTG A;  3P7N A;  3M8E A;  4RB0 A;  2CO5 A;  2Z99 A;  2P7V B;  1SD4 A;  4P96 A;  2KJC A;  3L7W A;  2DW4 A;  3DKW A;  5K1Y A;  3TO7 A;  4A0Z A;  3TOA A;  2RGV A;  3KE2 A;  1USS A;  5DD4 A;  4M74 A;  3WU1 B;  2GA2 A;  4L9V A;  4OOI A;  3FZV A;  1SD5 A;  2HKX A;  2MH9 A;  4S05 A;  3KFW X;  1LVA A;  1DDN A;  5FO5 A;  4BNC A;  1ZRF A;  4UV9 A;  4EJW A;  3OOP A;  3SXY A;  4MNU A;  5DYM A;  3N97 A;  3MZH A;  4G7Z F;  3GFM A;  1UHW A;  1S8N A;  2CQK A;  4BHP A;  1K79 A;  4I98 B;  2YR2 A;  4EJT A;  2P8T A;  1WWX A;  3WTX C;  2PG4 A;  4UHT A;  2L02 A;  5ERI A;  1KU2 A;  4M6Y A;  1O7F A;  2MLG A;  2ZNZ A;  2RVC A;  4GO1 A;  3HRS A;  3K0L A;  4DQ2 A;  4YFX F;  3ZQ7 A;  1B1B A;  2V1X A;  1REP C;  4ASN A;  5JHU A;  4MGR A;  4I01 A;  4R8H A;  2FMY A;  3H92 A;  2PEX A;  1HKQ A;  5D5V B;  4I2O A;  1WRJ A;  2VC0 A;  4A0Y A;  3CJN A;  4JBA A;  1R22 A;  5D5X B;  4M6X A;  1LJ9 A;  5E18 F;  3F6O A;  3K2Z A;  1U6G A;  4LLG F;  4HZF A;  4A12 A;  1IN6 A;  3R0J A;  1T39 A;  4HF2 A;  5J6X A;  1D8K A;  3O3K A;  3DXJ F;  1SAX A;  2HQN A;  1RNL A;  2WWY A;  3I59 A;  2IJL A;  2B0L A;  4KFC A;  1OPC A;  3F8M A;  5CYV A;  2GXB A;  2FOK A;  1XGO A;  2HEO A;  5DUK A;  5DDG A;  1PP8 F;  1SMT A;  5H6Q A;  4B09 A;  5ICF A;  2F5C A;  3BP8 A;  1XN7 A;  1FOK A;  4HAM A;  5JVT A;  1FZP B;  1YW9 A;  5DCF A;  4PCQ A;  5D4S A;  5H20 A;  1BIA A;  2HZT A;  3RYR A;  3DF8 A;  2VOO A;  3N4M A;  3D0S A;  3BRO A;  1IUY A;  1KU7 A;  4EMS A;  4PZJ A;  1R1T A;  4A6E A;  2HDC A;  4G7O F;  2V1U A;  3IC7 A;  3KLN A;  3HHG A;  2XAF A;  3I58 A;  3R6S A;  2O8X A;  5JR3 A;  3K1M A;  4G94 A;  4M9X A;  2H6B A;  1FY7 A;  3IRQ A;  2LNB A;  1I1G A;  4ON0 A;  2R7F A;  2ZFW A;  3KP4 A;  1FSH A;  2KIU A;  2XIG A;  2XKO A;  2A69 F;  1W7P A;  4LJZ F;  4MTE A;  5HLI A;  1J5Y A;  1H0M A;  3ZP5 A;  2VT3 A;  1Z91 A;  4BQA A;  3BDD A;  3T1B A;  2ESH A;  5HDG A;  4ZZD A;  1O3Q A;  2XAG A;  4KN4 X;  3NRV A;  3FM3 A;  2MLK A;  1QGP A;  2EFQ A;  1LB2 A;  1IRF A;  4CGZ A;  1P4W A;  2UXN A;  1R00 A;  2GWR A;  3ABU A;  1IN4 A;  5E1Z B;  4M9Z A;  1TW2 A;  1XGN A;  1GXP A;  3BPV A;  4WXC A;  3I5U A;  4EJU A;  5DUI A;  2ZME A;  4Y15 A;  1AOY A;  4AVP A;  3RKW A;  1OMI A;  2E1N A;  2E7W A;  2BEO A;  2E7X A;  5FB2 A;  2IW5 A;  1TW3 A;  2V6C A;  1IAW A;  5F64 A;  3MCZ A;  2VN2 A;  5D4R A;  5BOX A;  2YU3 A;  2PN6 A;  5CVV A;  3B73 A;  1FP2 A;  3LQQ A;  5CJ9 A;  3I71 A;  4HX4 A;  4LFU A;  6PAX A;  1J75 A;  1ON1 A;  2EA4 A;  2VE8 A;  4RGR A;  1I27 A;  3GLX A;  4KN7 X;  3HOS A;  2M5W A;  3HHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...