4L0YB

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
b'PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 35
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l0yB00
1ZRDA 2ESNA 2EV5A 1G3YA 3ML6A 4O3MA 1HQCA 3I64A 4MEYF 1F9NA 3GUDA 4XLPF 4FT8A 1SD5A 1YIOA 2HYFA 4ENKA 4EGZA 4G9YA 1ZAOA 2E1NA 1SD7A 2CFXA 3ABUA 3CLOA 5CVRA 4UVCA 4UXNA 1ZGAA 2PBIA 4P9UA 3VFZA 2VODA 3P9IA 5AIPA 3DPTA 4B09A 1W4MA 1OMIA 1KYWA 4HQMA 1SAXA 3MQ0A 3W6KB 4YFKF 5LGTA 3WGGA 4PGHA 2VT2A 4YFNF 5H20A 2W84A 3E97A 4N0BA 4UUVA 5HLIA 4IVNA 4RB0A 2PEXA 4AD9A 4Z2YA 2MBFA 3TGNA 4OIRF 2L4AA 3ECOA 3M8EA 3P9KA 4JQFA 3WE2A 2O0YA 2O8XA 3HIFA 3AAFA 1ZG5A 2PN6A 2LF8A 1BC7C 1PP8F 3BP8A 3TO9A 2ZXJA 3DFGA 3MZHA 1KU7A 2DW4A 3VOEA 3GFLA 3NEUA 3T5XA 2UXXA 3KLOA 1UHMA 2XAJA 1JHFA 1W7PB 3WTUC 3IWFA 1SFEA 5D8KB 1IF1A 5CYVA 2H6BA 5ILVA 3EYYA 5HDNA 4BAYA 1MGTA 3QPHA 4EJTA 1XGNA 2PJPA 4LG0A 4DQ2A 1RI7A 2Y0MA 3HUGA 1LVAA 3BPXA 2MLKA 2A69F 2HOEA 4G94A 4KFCA 2O61A 1KU9A 4NB5A 4A0XA 2DK8A 3KFWX 4HOBA 4UHTA 4L0ZB 2OZ6A 1ZRFA 2IT0A 2FMYA 3GYHX 2PMUA 4RS8A 4ENJA 2GAUA 3E6CC 1G3SA 2HKXA 1O3QA 1JE8A 3LAJA 4ZYDA 2OA4A 2K86A 3K2ZA 3WTTC 1RUOA 4WXHA 2F5CA 3GO5A 4I02A 3KZYA 1Z05A 5BOXA 4EV0A 1FBSA 5FFXA 5DDGA 1B59A 2XUBA 5HLHA 2YR2A 1FPQA 1QZYA 1YLFA 3FXQA 3WODF 2NNYA 5DV5A 3F8CA 5FLXK 4XSXF 4ZZDA 4KMFA 4U0WA 3K0LA 3HRTA 1K79A 4KN4X 2HQRA 5J6XA 3O6BB 3ZQ7A 2F5EA 3DP7A 3JTHA 5JHUA 2CQKA 1WI9A 2XASA 4LGWA 1RZ4A 3CDHA 6PAXA 3P9CA 1LB2A 5HS8A 4YIIA 2Z3YA 3TQNA 2W24A 3PQJA 2XV4S 1TQMA 1SMYF 1HSTA 1GXQA 4ZYGA 2FNAA 4M9ZA 1XMAA 5HS9A 1FP1D 1OYYA 5HS7A 2K02A 3ZMDA 5JFRA 3ISPA 2LF7A 1KQ8A 1LDDA 2R3SA 4P96A 1U5TA 3EDPA 3RKWA 1SFXA 2CGPA 2BV6A 1QO0D 3G3ZA 4HYEA 5J8FA 3IRQA 3FWEA 3BJAA 2YU3A 1BI1A 3ZPLA 1FOKA 3FXUA 2YPRA 2EV6A 1W7PA 4OINF 4XBFA 4I0AA 4WX9A 1FX7A 5TRDA 4Y13A 1Z6RA 3FMRA 2QYOA 2VE8A 3EUHA 4CICA 1UHWA 1FT9A 4A6EA 4HF2A 1R58A 1TBXA 3ERED 3Q9SA 2QVOA 3WU0A 1TW3A 5D6EA 4HF0A 3DKWA 2QLZA 3IL2A 2FBKA 1U2WA 5JVTA 3I58A 1MDMB 2P5KA 4LK1F 4IXAA 4EJOA 2GZWA 1KU3A 1WRJA 2QUFA 3IWZA 1LEBA 3JTGA 4CHUA 5CJ9A 1BIAA 3GVAA 5E17F 5D4SA 3FMQA 3QP5A 1AWCA 2ETHA 1WSUA 3ROUA 3MAJA 1BI3A 1IN5A 2DU9A 3R6SA 3KP7A 3LAPA 3RI4A 4RB3C 2L02A 2JPCA 1MJAA 3RKXA 3V7CA 3T1BA 1S8NA 4PDKA 4U0YA 5LBQA 4TV7A 2LDUA 1P92A 5HOOA 2QWWA 5LGNA 4NHJA 3IRRA 2K4BA 4HX7A 3R61A 5KK1A 1O7LA 3B73A 1CGPA 4LD5A 3BY6A 2V6CA 3LSTA 4U88A 2VBWA 3HSRA 3TDUC 2A5YB 4GGGA 5ICCA 1QGPA 3F72A 2UZKA 1J5YA 4DNCA 1S7OA 3LA7A 2WWYA 3I59B 4U7DA 1D3YA 4HZFA 5L3EA 3I71A 3TKYA 1PUEE 3FX3A 2XGXA 4YG2F 2HKOA 3RPQA 4BHCA 1IN7A 3QU3A 1IUYA 3D0SA 2OBPA 2MA3A 1TW2A 3LQQA 1EH7A 2ZNYA 3N4MA 2DPDA 3J7AO 2L4MA 3FMSA 4IF4A 2YSRA 1YYVA 2JPBA 4L9VA 5D6FA 1IXSB 1R00A 1U6GA 3RYRA 5LEKA 1W5TA 5K5OA 1IAWA 1QQIA 2OQGA 4HBLA 2HTSA 2M87A 5A2QZ 4R79A 3M9AA 1FSEA 1SD6A 4RGSA 3E6BA 2NS0A 2D45A 2KIMA 2P7CB 1MJ9A 1T6SA 3CO6C 3SZPA 3GXOA 2RDPA 4WWCA 5EEHA 1ZREA 1MDMA 3DPLC 3WGIA 2FRHA 3NRVA 5DD4A 3JAMZ 3BWGA 2JTVA 3B02A 1FYMA 3BJ6A 1BM9A 3KZZA 5H6QA 1TLHB 2ZCWA 1BJAA 1ZN2A 2EK5A 4B8XA 5D5WB 2LSOA 3KP2A 4ESJA 1B9MA 2STWA 3BZ6A 5D5UB 3FM5A 5F1RA 5E8GA 1YW9A 2XAGA 1BI2A 5LHIA 1ZARA 4QLCU 3BROA 3RYPA 4HLXA 3OV8A 5LEJA 1H9GA 4PCQA 3W6JB 1ULYA 1IN4A 5DUIA 4WK8F 2ZO4A 1QPMA 3KP5A 2FEZA 4A0YA 4F7ZA 1ZGJA 5HDGA 3FHZA 2PQ8A 1HKTA 2P5VA 4O5VA 2CO5A 2V9VA 2HYGD 4ESBA 4GYGA 2PFBA 2H09A 5L3GA 5ICEA 1KQ0A 5E8IA 3C7JA 4MGRA 2QQBA 2XVCA 1U5TC 5CVVA 4WCGA 1D8JA 3ZMUA 2P8TA 3I59A 1J75A 3WTSC 3GZ6A 3ABTA 3D5LA 1S7AA 4LB5A 2AS5F 4PZJA 1ZLJA 3J80Z 5LRSA 2WC2A 5E18F 4EJWA 1U5TB 5BPDA 1LEAA 1R5GA 3PFIA 2D2WA 4CYDA 2OZUA 3KCCA 2Z9OA 1FSHA 1K7AA 2CSOA 1KGSA 2M1BA 4PGGA 2P7VB 5DUKA 4I2OA 1O3SA 5LHGA 3M7GA 3JW4A 2M8EA 2GQQA 4KNYA 1U8RA 2E7WA 2M5WA 1U3EM 4LLNA 3KEQA 5HLGA 4KICA 4KA4A 2DI3A 3S2WA 4L9TA 2F5FA 1STZA 2AXLA 2HFHA 4GYIA 2VBXA 4EJVA 1W7PD 3QPTA 2IRFG 3GX4X 1QZZA 4Y17A 3KE2A 1FNNA 4A5NA 3KLNA 1J59A 2M45A 2CG4A 4IHTA 3V7RA 4WF2A 2XAQA 4KYWA 1IZ1A 3Q5FA 3HTSB 3REOA 3BOQA 3KEOA 1Z7UA 4AIHA 3DEUA 1B1BA 1IN8A 4Q47A 2EFWA 1XGSA 1USTA 1S6LA 5LHHA 3E5QA 1O7FA 3C18A 1WWXA 4EMSA 4LMYA 3KP4A 4IRHA 3E5XA 4OIOF 1ON1A 2HQNA 4KDPA 3LWFA 3WTXC 2QBYB 4M71A 2G9WA 2VOOA 2L3DA 1TNSA 3T8TA 4RGUA 1UB9A 4OOIA 1B6AA 2GIVA 2DT5A 2Q2EA 2W57A 1IRGA 4R8HA 2RQPA 2Y75A 1WQ2A 1G3WA 4MTDA 2B0LA 3DF8A 3E5UA 1L0OC 3TOBA 1IXRC 5FGMA 4A12A 4XLNF 4MQVA 3H3UA 2COMA 3MZYA 4EM0B 1W5SA 2KJBA 3COAC 4CGZA 1G4DA 2LNBA 4EGYA 2Z33A 1F1ZA 3CJNA 1O3RA 1T39A 1TQIA 1D8KA 5E20A 4ZYEA 3NQOA 2ZFWA 4AWXB 1DDNA 3CUQB 5F6FA 4MHGA 3GFMA 1T0FA 1R1VA 2ISYA 2VC0A 1ZHFA 4I7HA 1F5TA 1CF7B 4XSZF 3FZVA 2QZ8A 5K5QA 2K4JA 2ADUA 1KU2A 2TDXA 2ZBKA 4MQ9F 1ONVA 3V4GA 5A2QK 5L3DA 1HSJA 3F21A 3MCZA 4HF1A 4KIBA 4GCVA 1HW2A 2HTJA 4UNOA 1YG2A 2RC4A 4BNCA 4UVAA 3IC7A 4JBAA 3OOPA 2EWNA 5FO5A 1MJBA 3JAMK 2RGVA 3LA2A 4L5JA 1FP2A 2Y48A 2M30A 3VODA 1EV7A 4ESFA 4OIPF 4G8XA 2JT1A 3ZMVA 4I09A 2JRTA 2VC1A 1HKSA 2Z99A 1I27A 2RN7A 2GXBA 4M74A 3V8KA 1FLIA 1L3LA 2UXNA 2A3SA 5BS6A 1GXPA 2KRFA 1X3UA 3VEPA 3I53A 1S29A 1TTYA 3WE3A 5DCFA 5D4RA 3HSEA 4EQQA 3EYIA 3CO7C 4I0BA 4WXCA 3ZMZA 2OD5A 2XRNA 5IT9Z 5IT3A 1G3TA 4IRIA 1R5HA 5D5XB 2VONA 3DQVC 2EFQA 4EM2A 3I5UA 4UV9A 2QBYA 2V1XA 3R4KA 3RDIA 2GWRA 5AIQA 3J81Z 4M73A 1HBXG 4MNUA 3LQRA 3U1DA 3HYIA 2RKHA 2XIGA 4IPAA 1J2XA 5E1WA 1P4XA 2DQLA 1FBUA 5J8CA 3BPVA 4N9HA 3BJOA 2K27A 3F22A 2PG4A 2Z5UA 2UWMA 1IRFA 4ASNA 1V4RA 3PQKA 3QP6A 1HW5A 2NRAC 5BQTA 4MEXF 4BQAA 2RV8A 2KJCA 4ENMA 3J80K 4HAMA 5TJJA 2KKOA 3EQLF 1HXDA 2DTRA 4G6DA 4LJZF 4H0EA 4L9JA 1Z9CA 1A04A 1BBYA 3GZ5A 3HSFA 4Y15A 4G7OF 4RB2C 1JGSA 1XMKA 4MTEA 3TO6A 3L2CA 2A6HF 3CUQA 2JSCA 3FF5A 3HTUA 2V79A 3QU6A 5K1YA 4LB6B 1UFMA 1ZG3A 2ZJ2A 1KQ9A 1CF7A 2XROA 1GVJA 2VXZA 3RTRA 4LLLA 2H27A 4HQEA 1YO5C 1BOAA 3I0TA 1BN5A 2D1HA 3GW2A 2QQ9A 2OU2A 1I6XA 5CVUA 1XSVA 3HRMA 4AIKA 4ETSA 1R36A 1J0RA 4CZZA 2W85A 3I4PA 1DPRA 2ESHA 2F2EA 4L9NA 2FOKA 5ICGA 4OIQF 2CYYA 2OAZA 4HLYA 2IJLA 3WG9A 1O3TA 2P4WA 4NQWA 5CVJA 1DP7P 3T8RA 5ILUA 4N9IA 3FXRA 3DV8A 1B9NA 3V8LA 1J9IA 1JXSA 3L9FA 1Y0UA 4P55A 4QWQA 1FZPB 2FA5A 1I1SA 3WTZA 2MH9A 2A6EF 4O6JA 5DCMB 1BI0A 1XN7A 3GF2A 1Z6TA 4CO8A 1FY7A 2L54A 2WV0A 5AONA 4FX0A 2IW5A 3TO7A 4U7BA 3P7NA 2R7DA 2MD5A 1O57A 3F8FA 2DFIA 1YS6A 1HKQA 4XRFA 5L3FA 1H9TA 1YS7A 5FD5A 2P6SA 2MH2A 3ZMSA 3GFIA 3ELKA 2MLGA 2Q8KA 4HDUA 1IXCA 1OPCA 5KVRA 3K69A 2FSWA 2GXGA 2VOPA 4S05A 1D5VA 4AIJA 1FC3A 1TNTA 3GFJA 3JSOA 1J7KA 5ED4A 4FX4A 4AVPA 5LGUA 3C3WA 3IKVA 1ZYRF 4WXDA 4S04A 3O2PE 5H6RA 4RB1A 2HGCA 2ACJA 2DK5A 2OQRA 4YIFA 4HV5A 2PLYA 2G7HA 1I1GA 3HOTA 2P6TA 2E1CA 4KMUX 5CLSA 3LFKA 1IW7F 2H6CA 3K9TA 2QQAA 2FQ3A 3L00A 1K78B 1SD4A 3JSPA 3RKYA 2LKPA 4Q4ZF 3HRUA 3SXYA 4BXUA 2XKPA 3F6VA 3C1DA 3WU1B 3V8JA 2YX4A 5DD8A 2IA1A 1XGOA 3K1PA 2IP2A 3QAHA 3WTVC 3CUOA 3IHUA 1Q1HA 2ZMEA 1K6OA 4CDGA 1XDUA 4RAYA 2FXAA 2NYXA 2CWEA 1LQ1A 4GXOA 2EV0A 3K1MA 5ILSA 1DPUA 1QBJA 1EH6A 1XSXA 2QM3A 2KIUA 2STTA 2PMHA 2A68F 2BGCA 2IA0A 1QNTA 3IKTA 3R60A 4G7HF 5IT9K 5JR3A 3F8BA 2DAOA 1U78A 3J81K 1R23A 2EA2A 3Q9VA 1XCVA 2EFNA 1USSA 1F4KA 4ZH4F 2GA2A 5DCMA 2F5DA 2JZYA 1OYWA 4BHPA 5BPIA 2DPUA 2FE3A 4HA8A 4L5IA 1AOYA 1LNWA 4U0VA 4M9SA 4IHSA 1Z91A 4OMYA 3ZMTA 2V1DA 3RPUA 2Q0OA 4G7ZF 3VB2A 3HHHA 2G7UA 3FM3A 2R7FA 2HS5A 3L09A 4RGXA 4P9FA 4BHBA 4A5MA 4OU0A 2VN2A 3SQNA 4E70A 3F6OA 2RVCA 5E1ZB 4I98B 2EJRA 2WTEA 1XD7A 3M1EA 3F23A 1Z1DA 2BE5F 1YFHA 1E17A 3CUQC 2XAHA 4HX8A 2YX7A 4ENNA 5LRRA 1LJ9A 1YW7A 3LA3A 4A0ZA 1KA8A 4P5OA 5D5VB 2J5OA 4R1HA 2RNJA 5L3CA 1OKRA 5D8LB 1YQAA 4I01A 3GEZA 1YW8A 4KIGA 4M72A 1VTNC 1YTYA 1K78A 4BYYA 3BDDA 1P6RA 3O3KA 4HX4A 1XB4A 2A07F 1ZG1A 2VT3A 2ELHA 1E2XA 2VE9A 3ZN1A 2HR3A 3WTWC 1R7JA 1R1TA 1FBQA 5FD6A 3F8NA 4ON0A 1MD0A 1ON2A 3ULQB 5ERIA 1LDJA 3GWZA 5JI6A 3U9GA 5FFZA 1HW1A 1REPC 2NNNA 1PDNC 3V7SA 4YFXF 4A2UA 2BYVE 2O3FA 1WKMA 3QRFF 1SMTA 1FWZA 3GLXA 2EFOA 5DYMA 2O6GE 3ZN0A 3H3ZA 4IRGA 3L7WA 1G6NA 5K5RA 1ZLKA 4RGRA 2NAZA 1S3JA 2EFPA 1GHCA 4L0YB 3RIRA 1LDKB 3MFKA 2PI0A 5L3BA 4KIFA 1OR7A 2V1UA 3SZTA 5E1XA 3TDZC 3RJPA 3ECHA 3H92A 4HW0A 4G6QA 4CXFA 2J5PA 2KIFA 1R1UA 4M6XA 1OYIA 1T2KA 1I5ZA 1XCBA 3K1NA 1ZH5A 1UCRA 2A61A 3R0JA 1MZBA 3KP3A 2C6YA 3KETA 1B4AA 2FNPA 4L18B 5LLQA 1BC8C 3MWMA 4Q48A 4EJUA 2FF4A 1XDSA 4ZZLA 5F64A 3E3VA 2MC3A 5HDKA 3M8FA 3MEXA 3R0AA 2BEOA 2HDCA 4UV8A 3WGHA 3G73A 4A6DA 2FMLA 1MKMA 1XGMA 2XKOA 1TQPA 2X4HA 5FLXZ 4EVIA 1FYKA 2L01A 4ZYHA 1P2FA 4KT5C 5FB2A 3F3XA 4KUMA 2K7LA 4LFUA 1KYZA 2IA2A 2FU4A 5BMZA 2GA1A 2EA4A 4LK0F 3DXJF 3TOAA 4OMZA 1R22A 5DEQA 1FYLA 3QOPA 2IPQX 2EB7A 2XHKA 3T0YA 2IVMA 2D1VA 1C0WA 3EETA 2H94A 4BH9A 3WTYC 2VBYA 2P5LC 3ZP5A 1RNLA 3HHGA 2ZKZA 4HV6A 4M6YA 4IJAA 4UVBA 2HEOA 5HVQC 3N97A 2ZMEB 1ODDA 1XSDA 1RUNA 2HZTA 2DQRA 4K2EA 3U2RA 4M9XA 1IN6A 4D0PA 1PP7U 3HOSA 1RIOH 1EH8A 2HWVA 4RAZA 3I54A 4LG0B 1V3FA 3E6MA 3KP6A 4KN7X 1SFUA 1T38A 3SFZA 2FBIA 3SHFA 3HRSA 5EEGA 2O03A 2VBZA 4JK1X 1BIBA 2X0LA 2DLLA 1P4WA 2DBBA 1T98A 2CW0F 3CTAA 4GO1A 4Q5SF 5CVIA 3E6DA 2FBHA 1NHAA 2QENA 4EM1A 2DO7A 4LLGF 1H0MA 2XAFA 2E7XA 2ISZA 5ICFA 1DUXC 1ZRCA 4HDVA 2W25A 2BBYA 1JHHA 1P4AA 2ZNZA 3F8MA 4FHTA
chains in the Genus database with same CATH superfamily
1ZRDA 2CQQA 2ESNA 2EV5A 1G3YA 3ML6A 2V4JC 4O3MA 1HQCA 2E71A 2K9LA 3I64A 2DDAA 2EZLA 1F9NA 3GUDA 4MEYF 4XLPF 4FT8A 3BTJA 1SD5A 1YIOA 2HYFA 5EDNA 3W2AA 2JRMA 4ENKA 1X2MA 2F48A 4EGZA 1HDPA 4AUXA 3RPUD 4G9YA 1ZAOA 2E1NA 4J01A 1SD7A 2CFXA 3ABUA 3CLOA 3A0BC 5CVRA 4GFBA 4UVCA 3G71I 3S3MA 4UXNA 1PUFA 2MG4A 1ZGAA 2PBIA 4C3JJ 4P9UA 1P7IA 3VFZA 2VODA 3P9IA 3L2QA 5GAEJ 5AIPA 3DPTA 3LMMA 4B09A 1W4MA 1OMIA 1KYWA 5GADJ 4HQMA 1SAXA 3MQ0A 3W6KB 4YFKF 5LGTA 3Q0UA 3WGGA 2ZJQF 2DA2A 4PGHA 4XORA 1QHHD 5FKKA 2VT2A 4YFNF 3CCEI 2R5YB 1K61A 5H20A 2W84A 3E97A 4RM3A 4EATA 3SJMA 4N0BA 4UUVA 2A6TA 2F4IA 2OV7A 5HLIA 1UJ8A 2R93J 2B7EA 4IVNA 1FOYA 2NS8A 3B6CA 4XLAA 5F0CA 5J47A 2IGKA 4RB0A 4DJAA 1SFOJ 2MABA 2PEXA 3Q3SA 4AD9A 2HPIA 2IS4A 4MFEA 4Z2YA 3CQZJ 2MBFA 3TGNA 4OIRF 2HPMA 5E79C 3CCMI 1YX3A 2L4AA 3ECOA 3M8EA 3P9KA 2I5UA 4JQFA 2R7OA 1H8AC 4A3EJ 3WE2A 2O0YA 2O8XA 3HIFA 3AAFA 1ZG5A 2PN6A 2LF8A 1JTYA 1PP8F 1H89C 1BC7C 3BP8A 3TO9A 2ZXJA 3BR2A 3DFGA 3OYKA 3MZHA 1Y39A 1D0XA 2JMWA 2VIXA 2DW4A 1KU7A 3VOEA 2Q1ZB 3AG4H 3GFLA 3HGYA 4IHYA 3NEUA 3T5XA 2UXXA 2JQ7A 3KLOA 4IKFA 1UHMA 2XAJA 1HDDC 1JHFA 4UB8C 1W7PB 3E1SA 3WTUC 3E7LA 3IWFA 3AL0B 1IGNA 1SFEA 2BY0A 5DM6F 5D8KB 3O8GA 1IF1A 5CYVA 2BY1A 2H6BA 5ILVA 3EYYA 3OIQA 1FOWA 5HDNA 4BAYA 1MGTA 2EZKA 2MFZA 3QPHA 4BJ5C 5J4VA 4EJTA 1XGNA 2PJPA 1R5ID 2DT7B 3OIOA 4LG0A 4DQ2A 4D7NA 4FE7A 1EJ9A 1OR7C 1WGXA 2R7ZJ 1RI7A 2Y0MA 4C3HJ 1LPQA 5HNFA 2VPLA 4AYBN 3HUGA 1LVAA 2Y0SN 3VYUB 3ZGKA 4BE1A 3CCSI 3BPXA 2MLKA 2A69F 2HOEA 4G94A 4KFCA 2O61A 2HOTA 1WI3A 2P81A 3QPLA 1KU9A 4NB5A 2VB6A 1Y56A 3BCAA 2HVQA 2DK8A 4A0XA 3KFWX 3I56I 4HOBA 4UHTA 4AVZA 3BR5A 5HODA 4L0ZB 2LBFB 2OZ6A 4NC7A 5FKMA 2VQGA 1Z3YA 1ZRFA 2W1OA 3HOZJ 2DA3A 5FJ8J 2IT0A 4ZDOA 2FMYA 3GYHX 2PMUA 4RS8A 2XF7A 4ENJA 1X4OA 4XQFA 2GAUA 4XNFA 3E6CC 1VQ7I 1G3SA 2HKXA 1O3QA 4B1RA 5HNHA 4V19K 2ELJA 1JE8A 4XN0A 3LSMA 3LAJA 2ZXIA 4ZYDA 2OA4A 2DA4A 2K86A 3K2ZA 3WTTC 1RUOA 3PUBA 3BQZA 4WXHA 3IV5A 2F5CA 3GO5A 1MSFC 3L2RA 3PO2J 1JI8A 2KP6A 4I02A 3ASNH 2L7ZA 2K3FA 2E1MB 3TW6A 5K7ZA 3KZYA 1A35A 1A31A 1Z05A 5BOXA 3ZQHA 3BQYA 3QYFA 4EV0A 2R92J 2K9NA 1FBSA 5FFXA 1SAUA 1QA6A 5DDGA 1MBGA 2EILH 1FJLA 1B59A 2HYJA 2XUBA 5HLHA 3A02A 3S1RJ 2LC2A 2MSYA 2BY3A 2YR2A 4BKXA 1FPQA 1OLTA 1QZYA 3VDXA 2MD0A 5HLTA 2DJIA 4BQNA 1T95A 2F6CA 2CQXA 2ZXHA 3VSLA 3B6AA 1YLFA 4Y3OA 4C2TA 3FXQA 3MKLA 4BGDA 3WODF 2NNYA 5DV5A 3F8CA 3AG3H 3CJTB 4C3IJ 1H88C 4E7SA 3DU5A 5FLXK 2R7RA 4XSXF 4ZZDA 4CUGA 4KMFA 4Y52J 2CW7A 2A05A 4U0WA 3K0LA 3HRTA 3OYCA 1K79A 4KN4X 2HQRA 5J6XA 3O6BB 4S0HB 3ZQ7A 4ABZA 2F5EA 2EIJH 5F0FA 2JN6A 3DP7A 2XC7A 3JTHA 4D5FA 1ORKA 5JHUA 2CQKA 1WI9A 2XASA 2PMZN 4LGWA 1RZ4A 2UV1A 2R5YA 3CDHA 1X1AA 6PAXA 3P9CA 1LB2A 5HS8A 3RZOJ 4YIIA 2Z3YA 2K9MA 3TQNA 3D5RC 2W24A 3PQJA 1MMSA 2XV4S 3SEQA 1BA5A 3ZQGA 3HM5A 1RPWA 1TQMA 1SMYF 1HSTA 2XDVA 4CH7A 1GXQA 2CFOA 4ZYGA 2FNAA 4M3GA 4M9ZA 1XMAA 5HS9A 1FP1D 4V2GA 1OYYA 4BEHB 5HS7A 2K02A 2M7AA 3ZMDA 5JFRA 3ISPA 2LF7A 1KQ8A 1LDDA 2R3SA 4P96A 1U5TA 2QEXI 3EDPA 4U87A 1SFXA 3RKWA 2CGPA 3BG5A 2BV6A 1QO0D 3G3ZA 4HYEA 4V2FA 3FKIJ 5EZGA 5J8FA 3IRQA 3FWEA 3BJAA 3UNGC 1MMDA 2XF6A 3S93A 2YU3A 1BI1A 3ZPLA 1FOKA 3FXUA 3S3NA 4RM2A 2YPRA 2FD5A 3P5JA 2EV6A 4KISA 1MH3A 2JVGA 1D1CA 1W7PA 2E2IJ 4HG2A 1D0YA 5LFAA 4OINF 4XBFA 5CKTA 4I0AA 4WX9A 1FX7A 1IV6A 5TRDA 4Y13A 1Z6RA 2DODA 5F08A 3FMRA 2QYOA 1MSEC 2VE8A 3EUHA 3QODA 4CICA 1UHWA 4IQJA 2ZFUA 1FT9A 2LOOA 2KRHA 3WHBA 4I99C 4M3DA 4A6EA 3SDGA 4HF2A 1R58A 1WVRA 4BU2A 1TBXA 3ERED 2DJNA 3Q9SA 1MNMC 2QVOA 1IDYA 3WU0A 1TW3A 1U0JA 5D6EA 1HF0A 4HF0A 5GP9A 3GTPJ 3DKWA 1BOBA 2QLZA 1ZKGA 2LBFA 4F52A 3IL2A 2FBKA 1J09A 1U2WA 5M5XJ 5JVTA 3I58A 1ETYA 3GTMJ 3ZQQA 1MDMB 2P5KA 1B8IB 1V5FA 4LK1F 4IXAA 2D5VA 4EJOA 4C30A 4F92B 3TL4X 5EGOA 5FLVA 2BVLA 2GZWA 1DP3A 1KU3A 3BZCA 1IV8A 5K7HA 2OCCH 1WRJA 1JUPA 2QUFA 3IWZA 4II2A 5EYRA 1LEBA 2CUFA 3JTGA 4CHUA 4BXXJ 5CJ9A 1BIAA 2PJRB 3GVAA 5E17F 5D4SA 3FMQA 3HOXJ 3QP5A 1AWCA 2EIMH 2VJJA 4F91B 2L9SA 2ETHA 2AHQA 2H8RA 1YRNB 2HDWA 1WSUA 1IJWC 3MAJA 3ROUA 1BI3A 4A3JJ 1IN5A 2DU9A 3BTCA 4A3FJ 2EH3A 3R6SA 3D1NI 2EPFA 2R0QC 3KP7A 3LAPA 2XGCA 3RI4A 4RB3C 2L02A 3S2HJ 2JPCA 3W2VA 3PUFA 4LIVA 4CCJA 4L5EA 1MW7A 1MJAA 1R9TJ 3BR1A 3TEDA 3RKXA 3V7CA 1UAAA 3T1BA 2DT6A 1S8NA 3K4BA 4PDKA 4U0YA 2WAQN 4BL0B 2QSHX 5LBQA 4TV7A 2LDUA 3BCBA 1RKWA 3H5NA 3ERMA 3RCOA 4FQGA 5FRMA 3GTQJ 1P92A 5HOOA 2QWWA 5LGNA 4NHJA 2RREA 1S9HA 3IRRA 3A1YA 2K4BA 2E5NA 4HX7A 5J40A 3R61A 5KK1A 2MC4A 3OYMA 1O7LA 3B73A 1CGPA 3JREA 2ID3A 1F36A 4LD5A 3BY6A 2V6CA 3LSTA 1IRXA 4BQQA 4U88A 3OYDA 4E7KA 3BG7A 2VBWA 3HSRA 3BG3A 3TDUC 1Y1WJ 2A5YB 2VJ5A 3QYBA 4GGGA 2LREA 1Z67A 3JRHA 5ICCA 1QGPA 3F72A 2EZHA 2UZKA 1WHUA 1J5YA 1Z21A 1ZTRA 4DNCA 4KITB 1S7OA 2QKMB 2NS7A 3H5AA 4DBQA 1TC3C 3LA7A 1XPXA 2ZB9A 2WWYA 3I59B 4DZPA 1A5JA 1KONA 4U7DA 4IEJA 2DOAA 3I4MJ 1D3YA 4HZFA 3WG7H 5L3EA 1X1CA 3I71A 3TKYA 2R7UA 1PUEE 5F0HA 3OIPA 2KDOA 2HNHA 3FX3A 2XGXA 3H35A 2HKOA 3DEWA 4YG2F 3RPQA 4BY1J 2KPMA 4BHCA 1IN7A 3QU3A 3BLYA 1IUYA 3D0SA 2OBPA 2MA3A 1JKOC 1TW2A 3LQQA 1EH7A 2WA0A 3LSKA 2FQ4A 2ZNYA 3N4MA 3HXLA 2L9NA 4JX5A 2DPDA 2LYCA 1SC7A 3J7AO 2L4MA 3FMSA 2DMPA 1XTAA 2DMTA 2K85A 3L1PA 4NC6A 3X2QH 1VQOI 2L7FP 4IF4A 2YSRA 1YYVA 2JPBA 4L9VA 1UHSA 5D6FA 1IXSB 1R00A 1U6GA 3RYRA 5LEKA 1W5TA 4XRMA 2LK2A 2IEKA 5K5OA 3CJQB 4XK4A 1EKEA 3PNVA 1IAWA 1IUFA 5K7FA 1QQIA 2OQGA 4E4HA 4HBLA 2HTSA 2M87A 2XF5A 1JUSA 5A2QZ 4R79A 3M9AA 3SDBA 3K70C 1FSEA 1SD6A 4RGSA 3E6BA 1TWCJ 2NS0A 2R7XA 2D45A 2M0CA 2KIMA 1BJZA 1WFXA 2A5WA 2P7CB 1MJ9A 1T6SA 3CJRB 3CO6C 3SZPA 3GXOA 1E3OC 2RDPA 1FMVA 1WJ5A 4WWCA 5EEHA 3DLLF 1ZREA 2COBA 1ZGWA 1MDMA 3DPLC 3WGIA 2QCOA 3KEYA 2FRHA 3NRVA 5DD4A 3JAMZ 4BXFA 3HG9A 2R7QA 3BWGA 2JTVA 3BG9A 3QYEA 1TZLA 3B02A 1FYMA 4AU7A 3BJ6A 1BM9A 3M4OJ 2AO9A 2LY9A 3KZZA 3MN2A 3K4JA 1ETKA 5H6QA 1TLHB 2ZCWA 3HKZA 1BJAA 1P7JA 1SVLA 1ZN2A 5M3MJ 2EK5A 2KZGA 2IS1A 4A69C 4B8XA 5D5WB 2LSOA 2TCTA 3KP2A 4ESJA 1B9MA 2STWA 2OJED 3BZ6A 2HQ5A 5D5UB 4RMNA 3FM5A 5F1RA 5E8GA 3IAM2 4IHXA 1IO2A 1PJRA 4FETA 1YRNA 1YW9A 2XAGA 1BI2A 1B72A 1Y8RB 5LHIA 1ZARA 2B63J 3G1OA 1LUJB 4QLCU 1BR4A 3ABLH 2JUCA 3ZRGA 2G0EA 3K70D 2V9PA 3BROA 2YUSA 1MBFA 2LY2A 3RYPA 4HLXA 3I9V2 1WJDA 3U21A 3OV8A 5LEJA 1IDZA 1H9GA 1OCTC 4PCQA 4RLQA 2DYRH 3W6JB 1ULYA 5FKLA 1IN4A 4BY7J 5DUIA 4WK8F 4XKBA 1QRYA 2WAEA 2ZO4A 1QPMA 4XOPA 1U9OA 2JK3A 4A3IJ 3KP5A 5JLWA 1IC8A 2FEZA 4A0YA 4F7ZA 5GTIC 3BR6A 1UMQA 1ZGJA 3LSIA 2KHMA 4JX4A 5HDGA 4A3LJ 2LH9A 4PJNA 2PQ8A 3FHZA 1HKTA 4UUTA 2P5VA 2Q2EB 4NNJA 3CMMA 2CMPA 4O5VA 2CO5A 2FOWA 2V9VA 3IH4A 4A3KJ 5DM7F 2AXTC 2HYGD 1X3ZB 3HBLA 4ESBA 2DA6A 2ELKA 1SFKA 4GYGA 2PFBA 4PFPA 4B48A 2H09A 5L3GA 5ICEA 1KQ0A 1SVOA 5E8IA 3C7JA 1VQPI 5H2FC 2FUG2 2WB1N 4MGRA 1ITYA 2QQBA 2XVCA 2KFDA 1U5TC 5CVVA 2VASA 3CDIA 4E7ZA 2VKVA 4WCGA 5KCMA 5FRNA 1FIPA 1QPIA 2KDZA 1D8JA 3ZMUA 1AHDP 5J1YA 4OAZA 2P8TA 1WJBA 1RKTA 3I59A 3LFUA 4RBOA 2Y30A 3ZQCA 1J75A 3WTSC 1VQ8I 3GZ6A 4HEA2 3ABTA 3D5LA 1S5LC 1BW6A 2LY1A 5EEAA 1S7AA 5B5EC 4LB5A 2AS5F 1ERDA 4PZJA 1TT0A 3RQIA 1ZLJA 2JUGA 3J80Z 2QQ8A 1ETQA 2X51A 5LRSA 2WC2A 1T8IA 3G1MA 3AL0C 5E18F 1OCZH 1POGA 4EJWA 4CCOA 1U5TB 5BPDA 1LEAA 3OR1C 3PL8A 1R5GA 3PFIA 3OYLA 2D2WA 3DKYA 4NBQA 4CYDA 2OZUA 2M3AA 1VQ5I 3EUHC 3KCCA 2Z9OA 1FSHA 2RAEA 5FROA 2XSDC 3CC2I 5KAFC 2Y9ZA 1K7AA 4E7JA 2CSOA 3H36A 4XKVA 3OSFA 1YI2I 2M7BA 1KGSA 2M1BA 4MIMA 2F4MB 4B3XA 4PGGA 2P7VB 5DUKA 4GDFA 4ANJA 4I2OA 4XN3A 2VLAA 1O3SA 2CUJA 5LHGA 3M7GA 3KIOA 3JW4A 2V26A 3CP8A 1TT5B 2M8EA 5EF6A 5C4JJ 4X1EA 2GQQA 4KNYA 1U8RA 2E7WA 3AG1H 2KLOA 2M5WA 1OCOH 1U3EM 4LLNA 4B43A 3FXOA 2YU9J 3KEQA 1YOVB 5HLGA 1R4NB 4KICA 1F43A 1Y8QB 4KA4A 2DI3A 3S2WA 4RA2A 2R7WA 1N77A 4L9TA 2F5FA 1STZA 1X4PA 2DA7A 2AXLA 2HFHA 4GYIA 5B1BH 2VBXA 1HLVA 4EJVA 1W7PD 3QPTA 3O8HA 1ZR2A 3FXMA 2IRFG 2K3PA 3GX4X 3D5SC 1QZZA 4Y17A 3AKZA 1O4XA 2Y31A 3KE2A 1FNNA 4A5NA 3KLNA 4DYCA 2E1MC 1J59A 4F55A 2M45A 2CG4A 4IHTA 1T33A 3V7RA 3Q0WA 4WF2A 3M3YJ 2XAQA 4KYWA 1IZ1A 1SVMA 3Q5FA 3HTSB 3REOA 3BOQA 5EGOB 3KEOA 1Z7UA 4AIHA 1JKQC 4XLEA 3DEUA 1B1BA 4II3A 3MZ8A 1IN8A 1OFCX 3QPSA 4CCLA 4Q47A 3OYNA 2EFWA 4DYRA 1WJCA 1USTA 1XGSA 1E3HA 2ZSIB 1S6LA 3BTIA 2JJ7A 5LHHA 3OYBA 4XLHA 2HQAA 3RQ4A 4BQOA 3E5QA 3GLLA 1MNDA 4Z6YA 1NTCA 4CCKA 4F3QA 1O7FA 3C18A 1WWXA 4EMSA 4XICA 2Y69H 4LMYA 3KP4A 4A3GJ 2Y9YA 4W97A 4IRHA 3E5XA 2CV1A 2ZJPF 4OIOF 1ON1A 3GZNB 3OOUA 2HQNA 3G2BA 3LWFA 3S3OA 3WTXC 4KDPA 2QBYB 3PIOF 2MYSA 2P0WA 4M71A 2G9WA 2VOOA 1D1BA 2L3DA 1TNSA 1DGRM 3T8TA 4ZJZA 3MKWB 3OYHA 3FK7A 3ZQIA 3BZKA 2CJJA 4RGUA 1W0TA 3S1NJ 1UB9A 4OOIA 1TWHJ 1B6AA 2GIVA 2DT5A 3AG2H 2Q2EA 2W57A 5M5WJ 3H9GA 3TP0A 4QPOA 1MMAA 4HPQA 1IRGA 4R8HA 2CV0A 1LFBA 2DOEA 2RQPA 2Y75A 1WQ2A 1G3WA 2JVHA 2MGQA 4MTDA 3EPZA 3EUKL 4M6VA 2AQFA 2JWTA 2B0LA 2MW8A 4E6KG 3DF8A 2R7VA 3E5UA 1L0OC 2NVYJ 4UUSB 5M5YJ 3TOBA 2DA5A 2NOGA 3JRGA 1IXRC 1Y1VJ 2BW3B 5FGMA 1PVEA 4A12A 2EBIA 2L5QA 1OISA 4MQVA 5FKNA 3H3UA 2COMA 3MZYA 4XLNF 4EM0B 1ETWA 1W5SA 2XGDA 3DBLB 2KJBA 2KL4A 1R6RA 4HSTA 5CQEA 3FXKA 3A01B 5EZHA 3COAC 4CGZA 1G4DA 2LNBA 4JP0A 2KISA 3ZR8X 2UUZA 4EGYA 1R71A 1V5EA 5GPAA 2Z33A 1D5YA 1F1ZA 3CJNA 1O3RA 4BJTA 1T39A 3M1CA 2M34A 2JA2A 1TQIA 1D8KA 5E20A 3FXJA 1AKHA 1GVDA 3I4NJ 4ZYEA 3NQOA 1RR7A 4ZDLA 2ZFWA 2DXIA 4IL6C 2V7FA 2GM4A 2BXZA 4AWXB 1DDNA 3CC7I 4KT6A 3K10A 5E3LA 3CUQB 2DFEA 5F6FA 4MHGA 3GFMA 3VPRA 3LNQA 2DMUA 2XB5A 1APLC 1T0FA 1R1VA 2ISYA 4BUPA 2VC0A 3CMAI 1ZHFA 4I7HA 4ZTFA 1NK3P 4D9JA 4PFOA 3S17J 1F5TA 1A6IA 1CF7B 4XSZF 3H1CA 3FZVA 1MMGA 2QZ8A 5K5QA 2K4JA 2ADUA 1KU2A 2TDXA 2ZBKA 4MQ9F 1ONVA 4Y4RA 3V4GA 5A2QK 4UY8I 1D1AA 2E35A 2W82A 5L3DA 1HSJA 3F21A 5JVGF 3MCZA 2OTLI 4HF1A 4KIBA 4GCVA 1GV2A 1YJ9I 4BJ6C 4IQ4A 1HW2A 2HTJA 4UNOA 1YG2A 2RC4A 4BNCA 4UVAA 5GTHC 1DGWY 2KZVA 3IC7A 4JBAA 1MBEA 4JX6A 4BDYA 1BR2A 3OOPA 2EWNA 5FO5A 2L0KA 4I76A 3S1QJ 1MJBA 2JA6J 2EQRA 3JAMK 1JGGA 2RGVA 3C2GA 3LA2A 4L5JA 1FP2A 2QA4I 5C44J 2Y48A 2M30A 3VODA 1EV7A 4ESFA 4OIPF 4G8XA 3DBRB 2JT1A 3ZMVA 4PJ0C 4I09A 2VQHA 3DTIA 5F27A 3GTOJ 2JRTA 4C9YA 1D0ZA 2LRDA 3HZJA 1RETA 2VC1A 1V5GA 1HKSA 2Z99A 4HRIA 3ZQLA 5JHFA 1I27A 4E7LA 2RN7A 2GXBA 5C4XJ 3OSGA 4M74A 3V8KA 3A0HC 5B1AH 1LKXA 1FLIA 2L7KA 1I50J 2WB1A 2UXNA 3E0JB 1L3LA 2A3SA 2M4GA 5BS6A 4A3MJ 2KRFA 1GXPA 3HOVJ 1FEXA 1GUUA 1ETXA 3GCMA 3IH2A 1X3UA 3VEPA 3I53A 1S29A 1TTYA 3WE3A 5DCFA 4NQWB 3OR2C 3FDYA 5D4RA 4ZTJA 1JKPC 3HSEA 4EQQA 4ITVA 4XKCA 2OC6A 3EYIA 4DIQA 4XM3A 3CO7C 2Y2ZA 4GRIA 4I0BA 3ZQFA 4WXCA 3ZMZA 2OD5A 2XRNA 5IT9Z 5IT3A 4X0GA 1G3TA 4IRIA 5TISC 3PSIA 1R5HA 3CMEI 2HVSA 4DGWB 2Z16A 5D5XB 2NVXJ 3PIPF 3DQVC 2VONA 2EFQA 1TWGJ 2VJ4A 4EM2A 1EA3A 4Y33A 1B72B 3I5UA 4UV9A 2QBYA 2V1XA 3R4KA 3RDIA 3K4KA 4G6TB 4DBRA 2GWRA 5AIQA 3J81Z 1UG0A 1WJFA 4M73A 4IO9F 3GTJJ 2LR8A 3QOEA 1HBXG 4MNUA 2O8KA 1BW5A 1FOXA 3LQRA 3NWTA 3LSRA 5E3NA 5EJCA 2F4OB 1W5CC 3TBIA 3HYIA 2L9VA 3U1DA 2RKHA 4BDZA 2XIGA 4IPAA 2WADA 1J2XA 5E1WA 4LOCA 1P4XA 2DQLA 1FBUA 2RQQA 2BVMA 5J8CA 3I3LA 5LD2C 1KZHA 1JJ6C 3BPVA 4N9HA 4UUSA 3BJOA 2K27A 3F22A 2PG4A 2H8WA 2Z5UA 4RDUA 2BW3A 2UWMA 2B9SA 3JRCA 1IRFA 4ASNA 1V4RA 4BBSJ 3PQKA 3QP6A 1HW5A 2CV2A 1TWAJ 4CCMA 3OL3A 4AYBA 2NRAC 2Y0SA 3A01A 3F9KA 1YITI 3W6VA 5BQTA 2V1NA 1I3AA 1U8BA 4MEXF 1FTZA 4BQAA 5IYDJ 4FTHA 2RV8A 4Y7NJ 2KJCA 4ENMA 3J80K 1OCCH 2ECBA 4HAMA 5TJJA 2KKOA 4DOZA 2XAUA 3EQLF 2HOSA 1HXDA 2DTRA 4G6DA 4CZCA 4LJZF 4H0EA 2X6YA 4L9JA 3HB9A 1Z9CA 1MIJA 1A04A 1BBYA 3GZ5A 3HSFA 4Y15A 1MBKA 1I39A 4G7OF 4RB2C 4D5CA 1JGSA 1XMKA 3DPUA 3I55I 4MTEA 3TO6A 3L2CA 2A6HF 2KRCA 2XB0X 1T56A 1UG2A 4MO7A 2E2HJ 3JRBA 3CUQA 2JSCA 3GTLJ 3K4CA 1GT0C 3FF5A 1GLNA 2PX9A 5E3MA 3HTUA 3C2HA 2V79A 3QU6A 5K1YA 1Q1VA 5BNGA 4LB6B 1UFMA 1ZG3A 4NDLA 1FMWA 1X58A 2ZJ2A 1OQYA 5IP7J 1QVTA 1KQ9A 1CF7A 2XROA 4YEJA 1GVJA 1JTXA 2VXZA 1YX5A 1XMXA 4YIRX 4FISA 3CMYA 3RTRA 4LLLA 2H27A 1VQ4I 2E1OA 4B4CA 4HQEA 1YO5C 1BOAA 3FIWA 4PJLA 1N25A 3W3CA 4BE0A 3I0TA 1BN5A 1A6QA 2D1HA 2VJIA 3GW2A 2IGOA 3ZCOA 1DU0A 2QQ9A 2OU2A 1I6XA 5CVUA 1XSVA 3HRMA 4LITA 4AIKA 4ETSA 1R36A 2K40A 2M9HA 1J0RA 4CZZA 2CH0A 1WH5A 2M0MA 2W85A 3I4PA 1DPRA 2ESHA 2F5VA 1JKRC 4XLFA 2F2EA 1FTTA 4L9NA 2LTPA 2FOKA 3TP3A 5ICGA 3HPHA 5IPAA 4CSWA 2BHYA 3CF2A 2NVUB 2BY2A 3S8PA 3FXLA 4OIQF 2R7TA 3VWBA 2CYYA 1Z0XA 3BTLA 1YIJI 2OAZA 4JYKA 3KYDB 4HLYA 3OYAA 5J3LA 3J7ZI 2IJLA 3WG9A 2DN0A 1O3TA 3ASOH 2P4WA 1VZ0A 2E60A 3ABKH 4BBRJ 2PMZA 4NQWA 5CVJA 1DP7P 1M1EB 4M3FA 3T8RA 5ILUA 4N9IA 1ZR4A 3FXRA 4B47A 3DV8A 1K6YA 1B9NA 3CD6I 2CQ7A 1HCRA 3V8LA 2LFBA 1J9IA 1JXSA 1MMNA 3L9FA 3JR9A 1Y0UA 4P55A 3LSPA 4D7MA 3HC7A 3ESWB 2GOMA 2VKDA 4QWQA 5GPCA 1MNEA 3H9QA 1FZPB 1YJNI 2FA5A 1I1SA 1HA8A 3OYGA 3WTZA 2MH9A 2A6EF 2LVSA 3MKYB 4O6JA 5DCMB 5GAGJ 1BI0A 1XN7A 2EINH 3GF2A 4PK4A 1Z6TA 4CO8A 1FY7A 2RNGA 2L54A 2WV0A 5AONA 4FX0A 2N8GA 1GV5A 2IW5A 2W7NA 3TO7A 3DCFA 3K4MA 4U7BA 3H3VK 3P7NA 2R7DA 3M8JA 2MD5A 1O57A 3F8FA 2DFIA 3A2KA 1YS6A 1HKQA 4XRFA 3J7YJ 5L3FA 3K4LA 1H9TA 1BL0A 1YS7A 5FD5A 1Z77A 2P6SA 2MH2A 3GMEA 3ZMSA 3GFIA 3DU6A 3N05A 5GAHJ 4X6AJ 3ELKA 3S32A 2VUMJ 3CESA 4E7HA 2MLGA 2OF7A 2VI6A 3HGGA 2Q8KA 3QQAA 1X2NA 4HDUA 1IXCA 1OPCA 5KVRA 3K69A 1LE8B 2VXDA 2DFFA 2GBYA 1OCPA 4IZZA 2DOFA 2FSWA 2GXGA 3PJRA 2BXYA 3DKXA 4EEFG 2VOPA 4PSXA 1FIAA 2FJ1A 4S05A 4DW6A 4XKWA 3OS0A 1D5VA 4AIJA 1FC3A 4JOMA 4N4OB 1TNTA 3GFJA 3JSOA 1LFUP 1J7KA 5ED4A 2LP0A 4FE4A 4FX4A 2WY8Q 4AVPA 2OPTA 5LGUA 3C3WA 3IKVA 1ZYRF 4CYCB 4WXDA 1YJWI 1T0FC 4S04A 1VQ6I 2I10A 3O2PE 1OJLA 3AFHA 3LSHA 4FASD 2LMDA 3CCUI 5H6RA 4ZDPA 3KYCB 1JT0A 1AKHB 4RB1A 3WHCA 2HGCA 2ACJA 2VL8A 2DK5A 3BR3A 4KJZA 2OQRA 1ETOA 1MBHA 1G8XA 4YIFA 4HV5A 2PLYA 2G7HA 1I1GA 3HOTA 2P6TA 2E1CA 5C3EJ 1NG7A 3OS2A 4PJJA 4KMUX 5CLSA 3LFKA 1IW7F 1NK2P 2H6CA 2L7MP 3PNTA 3VYSB 3K9TA 3K2AA 2QQAA 2FQ3A 3HEFA 3L00A 4F93B 3M07A 3DLAA 2K5CA 4I6ZA 1GDTA 1X1DA 3RZDJ 1SD4A 1K78B 3JSPA 3RKYA 1R4MB 4J19A 1S7EA 2LKPA 1K4TA 4Q4ZF 3HRUA 3SXYA 4BXUA 4A3BJ 2QGUA 1LVKA 2XKPA 3F6VA 1AA7A 3OMYA 3C1DA 2NVTJ 3WU1B 3V8JA 4PSWA 3SEZA 2HVRA 2YX4A 3HOWJ 2K9QA 1WZ2A 5DD8A 2IA1A 1XGOA 1Y0NA 3JCUC 3LSJA 5B3SH 3K1PA 4IX7A 2IP2A 1EF4A 2WV1A 3QAHA 3WTVC 4J00A 2XPVA 3C2BA 3CUOA 3IHUA 2IBDA 1PYVA 1Q1HA 3MKZA 1VQKI 2IS6A 2ZMEA 4ZC3A 2OTJI 1K6OA 2DFHA 2CS3A 1CQTA 3CCYA 4CDGA 1XDUA 4RAYA 2FXAA 4C2UA 4AM3A 2NYXA 2CWEA 2WAQA 1LQ1A 4GXOA 2EV0A 3K1MA 2QF7A 5ILSA 5DTDA 1DPUA 2NVQJ 1QBJA 2ZJRF 3S2DJ 4YRVA 2WAFA 3OS1A 1DQUA 1EH6A 1VQLI 1XSXA 2CQNA 2E34A 2DTZA 2QM3A 3V42A 2KIQA 4OWRB 2KIUA 5IY5H 2STTA 2PMHA 2A68F 2BGCA 3DBHB 4QSHA 4G12A 1YHQI 1VQ9I 2IA0A 1QNTA 3IKTA 2Z1DA 3R60A 1HOMA 2ME6A 4G7HF 5IT9K 5JR3A 3F8BA 2O5RA 1HC8A 2W00A 5J4YA 2DAOA 3KZIC 1U78A 3F0CA 3VYTB 3JRFA 3L2WA 3BG6A 1ZELA 2H1KA 1V54H 3FKJA 1TWFJ 2BZTA 3J81K 3PO3J 1R23A 1Z3XA 4LIUA 2EA2A 1WJAA 1MH4A 4XOTA 3Q9VA 1XCVA 2EFNA 5IOYA 1USSA 1F4KA 2DA1A 4ZH4F 2NXNB 2GA2A 4B44A 5DCMA 2F5DA 2GIZA 2JZYA 1OYWA 3CLQA 4BHPA 5BPIA 1SEUA 1QU3A 2X85A 2DPUA 3S1MJ 2FE3A 4HA8A 4L5IA 1AOYA 1LNWA 1G2HA 3LOCA 3IUOA 4U0VA 3FHNA 4M9SA 4IHVA 2YS9A 4C2MJ 4IHSA 4BE2A 1ETVA 1Z91A 4OMYA 3ZMTA 2V1DA 2X9DA 3VSKA 3HL2A 4FHTA 3RPUA 1NH3A 3NARA 1VF9A 2W4SA 2H1LA 2Q0OA 4G7ZF 3VB2A 2HI3A 4XONA 5CQGA 2X6OA 2X48A 3HHHA 2G7UA 3G6EI 3FM3A 5FKOA 2R7FA 2HS5A 3OYIA 1TL8A 3L09A 4RGXA 4P9FA 4ZYAA 3OWTA 3CCQI 4BHBA 4A5MA 4OU0A 1LE8A 2VN2A 3SQNA 4E70A 3F6OA 5IP6A 2RVCA 5E1ZB 2DDBA 4I98B 2EJRA 2WTEA 3GTKJ 1XD7A 1YE9A 3M1EA 1TP4A 3GBGA 4XRSG 3F23A 1Z1DA 2XSJC 3TW7A 2BE5F 2R5ZB 1YFHA 4XIDA 2X6WA 2EZIA 1E17A 3CUQC 2XAHA 4HX8A 1P9QC 2YX7A 5J1UA 3OYJA 3S16J 4CYCA 3UR3C 4ENNA 3FISA 5LRRA 3WU2C 1LJ9A 1JJ8C 4XLCA 1XG1A 4M3BA 3GTGJ 2X1DA 1ZQ3P 2L9RA 1RRJA 3ZOBA 1YW7A 3LA3A 3CZ6A 4A0ZA 1RESA 1KA8A 4P5OA 5D5VB 2J5OA 4XMYA 4R1HA 2RNJA 3PM1A 3JRIA 4LG3A 5L3CA 3HOUJ 1OKRA 5D8LB 3HKZN 1YQAA 3NWSA 4I01A 1X1BA 2IGNA 3GEZA 2BOLA 1YW8A 3Q0VA 4NUBA 4KIGA 4MFDA 5EG0B 4QTRA 1QHGA 2GXAA 3FK6A 4M72A 1VTNC 3EUAA 1YTYA 1VQNI 1MBJA 1K78A 2ICWG 4FCYA 4BYYA 2W48A 9ANTA 2JA8J 3BDDA 4PUSA 3DTEA 5IOZA 1P6RA 3K4NA 3O3KA 4HX4A 2KQRA 2R4GA 4HNTA 2LKXA 1XB4A 2A07F 5KHDA 1ZG1A 2VT3A 1K4SA 2ELHA 1E2XA 2VE9A 3ZN1A 2WY7Q 3G1LA 1UZCA 2HR3A 3K7AJ 2KMUA 3WTWC 1R7JA 2Z2SB 3FBIB 1R1TA 4XRSA 1V55H 1FBQA 1SANA 3KPHA 5FD6A 4BACA 3F8NA 2VKEA 2XGEA 4ON0A 1MD0A 1ON2A 1WH7A 3ULQB 1R49A 3H5RA 5ERIA 3VYRB 1LDJA 3GWZA 1RR8C 3CCLI 3CP2A 4XL9A 5JI6A 2ZXWH 4DZJA 3U9GA 2NOJB 5FFZA 2HU9A 1HW1A 1REPC 2NNNA 2XRLA 2CRGA 1PDNC 3V7SA 2E5ZA 1N75A 4YFXF 4A2UA 2BYVE 2O3FA 3SYTA 3CCJI 2CW8A 1WKMA 3QRFF 3HDDA 2FX0A 2HZDA 1SMTA 1FWZA 3GLXA 2EFOA 2VQCA 5DYMA 5B66C 2O6GE 2VPRA 1JT6A 2LLKA 2QSGX 1I6HJ 3ZN0A 2GLOA 3H3ZA 4IHWA 4IRGA 3L7WA 1G6NA 1X1PA 3H9JA 5K5RA 1ZLKA 4RGRA 2NAZA 1S3JA 3IAS2 4HSRA 2EFPA 2X1EA 2ID6A 1GHCA 5J1RA 4AC0A 4L0YB 3RIRA 1LDKB 3PSFA 3MFKA 2PI0A 5L3BA 4W1UA 3CCVI 4KIFA 1OR7A 1VI0A 2V1UA 2K9SA 3SZTA 5E1XA 3TDZC 3RJPA 3W2WA 3OYFA 4QIWN 3ECHA 3H92A 4HW0A 4CA0A 2TRTA 3ZXSA 1G59A 4G6QA 4RLFA 3JRDA 2DCEA 4CCNA 4CXFA 2J5PA 1RC9A 2KIFA 2ZC2A 4BS9A 5KNLA 3NAUA 1R1UA 4M6XA 1ZK8A 4UB6C 3PNYA 1XS9A 3ONQA 1Z7LA 1OYIA 3DTKA 1T2KA 3ABMH 1I5ZA 1XCBA 2X1CA 2DMNA 3K1NA 3A4CA 4H4KC 1ZH5A 5KAIC 2I8DA 3H0DA 3HJEA 1UCRA 3LSGA 3RKQA 1IRZA 4P1WA 2A61A 3LL7A 3R0JA 1MZBA 3OY9A 3S14J 3L2VA 4NC8A 3H0GJ 3UKGA 3KP3A 2C6YA 3KETA 3MD2A 1B4AA 3IP4B 1K83J 2FNPA 4L18B 5LLQA 1BC8C 2ME0A 3MWMA 4Q48A 4RAFA 1X3WB 3HPGA 4EJUA 2FF4A 2X6XA 1XDSA 2LKSA 4ZZLA 1WJEA 5F64A 3E3VA 3G4SI 2R5ZA 2MC3A 5HDKA 4D1QA 3M8FA 3MEXA 5IYCJ 3R0AA 2BEOA 4E7IA 1W1WE 5DS9A 2HDCA 1I3QJ 4UV8A 2IXSA 3WGHA 3G73A 4A6DA 2E2JJ 1N78A 1IG7A 2FMLA 1VFCA 1MKMA 2E19A 3CC4I 1VNDA 1XGMA 2HXOA 2XKOA 3OYEA 4OAYA 2O7OA 5IYBJ 2CUEA 1TQPA 1PUFB 2IAIA 2X4HA 2XPWA 3RSNA 2L2OA 5M3FJ 1W36C 5FLXZ 4EVIA 1FYKA 1QVUA 2L01A 2LG4A 1W0UA 4ZYHA 1E3PA 2V9KA 1P2FA 3IH3A 4KT5C 3F3XA 4KUMA 3OL4A 5FB2A 2K7LA 1U9NA 2VQLA 5F04A 1AU7A 3PFYA 4QPQA 4LFUA 2CU7A 4MLOA 1KYZA 2IA2A 2HDDA 4A3CJ 2FU4A 4HNUA 5EG0A 1X19A 2QKLB 1VQMI 4A3DJ 5BMZA 5FLMJ 2WBMA 2GA1A 2EA4A 4LK0F 2JA7J 3DXJF 3TOAA 4BEHA 1OCRH 1NG6A 4OMZA 1R22A 5DEQA 1FYLA 2ZMEC 2QSFX 3BC8A 2EIKH 3QOPA 2IPQX 2EB7A 5JLXA 2XHKA 1ACIA 1LFPA 4XR6A 1WCMJ 3T0YA 2HOAA 2M4KA 2IVMA 4AIDA 2D1VA 2BHZA 1S72I 2AQEA 1QZEA 2R7SA 4N4NB 2KT0A 1C0WA 3EETA 2O9LA 1BR1A 2H94A 4BH9A 3WTYC 2VBYA 3HOYJ 1ENHA 3KYLA 3DEEA 2P5LC 1JUMA 3ZP5A 4DYQA 1RNLA 1DU6A 3HHGA 3MVPA 2VKHA 2ZKZA 4HV6A 3TMOA 4M6YA 2E36A 4IJAA 2JA5J 4UVBA 2HEOA 5HVQC 5F1JA 3N97A 2ZMEB 1ODDA 1XSDA 1RUNA 2IS2A 2HZTA 2DQRA 4K2EA 5CPRB 4HNVA 3U2RA 1W36D 4M9XA 1IN6A 4D0PA 1PP7U 3SZGA 3HOSA 3CF5F 1EH8A 3K6GA 2HWVA 1RIOH 3S15J 4YELA 2M2EA 2HXIA 3FBNB 3CDLA 4RAZA 3CCRI 2DMQA 1WPKA 1Y6IA 3I54A 3JRAA 3A03A 4LG0B 2OCEA 1V3FA 3E6MA 3KP6A 4KN7X 2DYSH 4IOCF 1XX5A 3HUGB 2M8GX 1SFUA 1T38A 3KX2A 3BT9A 3SFZA 2FBIA 3SHFA 3BR0A 3HRSA 5EEGA 2LD5A 1E0EA 2O03A 2VBZA 4JK1X 1BIBA 1B8IA 2X0LA 2DLLA 1P4WA 2ECCA 1T08B 2JSPA 3QWLA 1XC5A 2DBBA 3U1KA 1T98A 4IOAF 5E3OA 2CW0F 3CTAA 4GO1A 3L2UA 2V6EA 2ZSHB 4Q5SF 5CVIA 3E6DA 2FBHA 5IP9J 1NHAA 2IGMA 4RAGA 2QENA 4EM1A 2PJRA 2XPUA 2DO7A 4LLGF 1H0MA 2XAFA 2E7XA 3SFIA 2ISZA 5ICFA 3MMYB 4B3AA 1A36A 1DUXC 1ZRCA 2GOXB 4PJMA 3DWLE 5TGTA 4HDVA 2OUMA 4M3EA 2W25A 2BBYA 1JHHA 1P4AA 1UELB 3J7AY 2ZNZA 3F8MA 2CUZA 4A93J
chains in the Genus database with same CATH topology
1ZRDA 2ESNA 2EV5A 1G3YA 3ML6A 4O3MA 1HQCA 3I64A 4MEYF 1F9NA 3GUDA 4XLPF 4FT8A 1SD5A 1YIOA 2HYFA 4ENKA 4EGZA 4G9YA 1ZAOA 2E1NA 1SD7A 2CFXA 3ABUA 3CLOA 5CVRA 4UVCA 4UXNA 1ZGAA 2PBIA 4P9UA 3VFZA 2VODA 3P9IA 5AIPA 3DPTA 4B09A 1W4MA 1OMIA 1KYWA 4HQMA 1SAXA 3MQ0A 3W6KB 4YFKF 5LGTA 3WGGA 4PGHA 2VT2A 4YFNF 5H20A 2W84A 3E97A 4N0BA 4UUVA 5HLIA 4IVNA 4RB0A 2PEXA 4AD9A 4Z2YA 2MBFA 3TGNA 4OIRF 2L4AA 3ECOA 3M8EA 3P9KA 4JQFA 3WE2A 2O0YA 2O8XA 3HIFA 3AAFA 1ZG5A 2PN6A 2LF8A 1BC7C 1PP8F 3BP8A 3TO9A 2ZXJA 3DFGA 3MZHA 1KU7A 2DW4A 3VOEA 3GFLA 3NEUA 3T5XA 2UXXA 3KLOA 1UHMA 2XAJA 1JHFA 1W7PB 3WTUC 3IWFA 1SFEA 5D8KB 1IF1A 5CYVA 2H6BA 5ILVA 3EYYA 5HDNA 4BAYA 1MGTA 3QPHA 4EJTA 1XGNA 2PJPA 4LG0A 4DQ2A 1RI7A 2Y0MA 3HUGA 1LVAA 3BPXA 2MLKA 2A69F 2HOEA 4G94A 4KFCA 2O61A 1KU9A 4NB5A 4A0XA 2DK8A 3KFWX 4HOBA 4UHTA 4L0ZB 2OZ6A 1ZRFA 2IT0A 2FMYA 3GYHX 2PMUA 4RS8A 4ENJA 2GAUA 3E6CC 1G3SA 2HKXA 1O3QA 1JE8A 3LAJA 4ZYDA 2OA4A 2K86A 3K2ZA 3WTTC 1RUOA 4WXHA 2F5CA 3GO5A 4I02A 3KZYA 1Z05A 5BOXA 4EV0A 1FBSA 5FFXA 5DDGA 1B59A 2XUBA 5HLHA 2YR2A 1FPQA 1QZYA 1YLFA 3FXQA 3WODF 2NNYA 5DV5A 3F8CA 5FLXK 4XSXF 4ZZDA 4KMFA 4U0WA 3K0LA 3HRTA 1K79A 4KN4X 2HQRA 5J6XA 3O6BB 3ZQ7A 2F5EA 3DP7A 3JTHA 5JHUA 2CQKA 1WI9A 2XASA 4LGWA 1RZ4A 3CDHA 6PAXA 3P9CA 1LB2A 5HS8A 4YIIA 2Z3YA 3TQNA 2W24A 3PQJA 2XV4S 1TQMA 1SMYF 1HSTA 1GXQA 4ZYGA 2FNAA 4M9ZA 1XMAA 5HS9A 1FP1D 1OYYA 5HS7A 2K02A 3ZMDA 5JFRA 3ISPA 2LF7A 1KQ8A 1LDDA 2R3SA 4P96A 1U5TA 3EDPA 3RKWA 1SFXA 2CGPA 2BV6A 1QO0D 3G3ZA 4HYEA 5J8FA 3IRQA 3FWEA 3BJAA 2YU3A 1BI1A 3ZPLA 1FOKA 3FXUA 2YPRA 2EV6A 1W7PA 4OINF 4XBFA 4I0AA 4WX9A 1FX7A 5TRDA 4Y13A 1Z6RA 3FMRA 2QYOA 2VE8A 3EUHA 4CICA 1UHWA 1FT9A 4A6EA 4HF2A 1R58A 1TBXA 3ERED 3Q9SA 2QVOA 3WU0A 1TW3A 5D6EA 4HF0A 3DKWA 2QLZA 3IL2A 2FBKA 1U2WA 5JVTA 3I58A 1MDMB 2P5KA 4LK1F 4IXAA 4EJOA 2GZWA 1KU3A 1WRJA 2QUFA 3IWZA 1LEBA 3JTGA 4CHUA 5CJ9A 1BIAA 3GVAA 5E17F 5D4SA 3FMQA 3QP5A 1AWCA 2ETHA 1WSUA 3ROUA 3MAJA 1BI3A 1IN5A 2DU9A 3R6SA 3KP7A 3LAPA 3RI4A 4RB3C 2L02A 2JPCA 1MJAA 3RKXA 3V7CA 3T1BA 1S8NA 4PDKA 4U0YA 5LBQA 4TV7A 2LDUA 1P92A 5HOOA 2QWWA 5LGNA 4NHJA 3IRRA 2K4BA 4HX7A 3R61A 5KK1A 1O7LA 3B73A 1CGPA 4LD5A 3BY6A 2V6CA 3LSTA 4U88A 2VBWA 3HSRA 3TDUC 2A5YB 4GGGA 5ICCA 1QGPA 3F72A 2UZKA 1J5YA 4DNCA 1S7OA 3LA7A 2WWYA 3I59B 4U7DA 1D3YA 4HZFA 5L3EA 3I71A 3TKYA 1PUEE 3FX3A 2XGXA 4YG2F 2HKOA 3RPQA 4BHCA 1IN7A 3QU3A 1IUYA 3D0SA 2OBPA 2MA3A 1TW2A 3LQQA 1EH7A 2ZNYA 3N4MA 2DPDA 3J7AO 2L4MA 3FMSA 4IF4A 2YSRA 1YYVA 2JPBA 4L9VA 5D6FA 1IXSB 1R00A 1U6GA 3RYRA 5LEKA 1W5TA 5K5OA 1IAWA 1QQIA 2OQGA 4HBLA 2HTSA 2M87A 5A2QZ 4R79A 3M9AA 1FSEA 1SD6A 4RGSA 3E6BA 2NS0A 2D45A 2KIMA 2P7CB 1MJ9A 1T6SA 3CO6C 3SZPA 3GXOA 2RDPA 4WWCA 5EEHA 1ZREA 1MDMA 3DPLC 3WGIA 2FRHA 3NRVA 5DD4A 3JAMZ 3BWGA 2JTVA 3B02A 1FYMA 3BJ6A 1BM9A 3KZZA 5H6QA 1TLHB 2ZCWA 1BJAA 1ZN2A 2EK5A 4B8XA 5D5WB 2LSOA 3KP2A 4ESJA 1B9MA 2STWA 3BZ6A 5D5UB 3FM5A 5F1RA 5E8GA 1YW9A 2XAGA 1BI2A 5LHIA 1ZARA 4QLCU 3BROA 3RYPA 4HLXA 3OV8A 5LEJA 1H9GA 4PCQA 3W6JB 1ULYA 1IN4A 5DUIA 4WK8F 2ZO4A 1QPMA 3KP5A 2FEZA 4A0YA 4F7ZA 1ZGJA 5HDGA 3FHZA 2PQ8A 1HKTA 2P5VA 4O5VA 2CO5A 2V9VA 2HYGD 4ESBA 4GYGA 2PFBA 2H09A 5L3GA 5ICEA 1KQ0A 5E8IA 3C7JA 4MGRA 2QQBA 2XVCA 1U5TC 5CVVA 4WCGA 1D8JA 3ZMUA 2P8TA 3I59A 1J75A 3WTSC 3GZ6A 3ABTA 3D5LA 1S7AA 4LB5A 2AS5F 4PZJA 1ZLJA 3J80Z 5LRSA 2WC2A 5E18F 4EJWA 1U5TB 5BPDA 1LEAA 1R5GA 3PFIA 2D2WA 4CYDA 2OZUA 3KCCA 2Z9OA 1FSHA 1K7AA 2CSOA 1KGSA 2M1BA 4PGGA 2P7VB 5DUKA 4I2OA 1O3SA 5LHGA 3M7GA 3JW4A 2M8EA 2GQQA 4KNYA 1U8RA 2E7WA 2M5WA 1U3EM 4LLNA 3KEQA 5HLGA 4KICA 4KA4A 2DI3A 3S2WA 4L9TA 2F5FA 1STZA 2AXLA 2HFHA 4GYIA 2VBXA 4EJVA 1W7PD 3QPTA 2IRFG 3GX4X 1QZZA 4Y17A 3KE2A 1FNNA 4A5NA 3KLNA 1J59A 2M45A 2CG4A 4IHTA 3V7RA 4WF2A 2XAQA 4KYWA 1IZ1A 3Q5FA 3HTSB 3REOA 3BOQA 3KEOA 1Z7UA 4AIHA 3DEUA 1B1BA 1IN8A 4Q47A 2EFWA 1XGSA 1USTA 1S6LA 5LHHA 3E5QA 1O7FA 3C18A 1WWXA 4EMSA 4LMYA 3KP4A 4IRHA 3E5XA 4OIOF 1ON1A 2HQNA 4KDPA 3LWFA 3WTXC 2QBYB 4M71A 2G9WA 2VOOA 2L3DA 1TNSA 3T8TA 4RGUA 1UB9A 4OOIA 1B6AA 2GIVA 2DT5A 2Q2EA 2W57A 1IRGA 4R8HA 2RQPA 2Y75A 1WQ2A 1G3WA 4MTDA 2B0LA 3DF8A 3E5UA 1L0OC 3TOBA 1IXRC 5FGMA 4A12A 4XLNF 4MQVA 3H3UA 2COMA 3MZYA 4EM0B 1W5SA 2KJBA 3COAC 4CGZA 1G4DA 2LNBA 4EGYA 2Z33A 1F1ZA 3CJNA 1O3RA 1T39A 1TQIA 1D8KA 5E20A 4ZYEA 3NQOA 2ZFWA 4AWXB 1DDNA 3CUQB 5F6FA 4MHGA 3GFMA 1T0FA 1R1VA 2ISYA 2VC0A 1ZHFA 4I7HA 1F5TA 1CF7B 4XSZF 3FZVA 2QZ8A 5K5QA 2K4JA 2ADUA 1KU2A 2TDXA 2ZBKA 4MQ9F 1ONVA 3V4GA 5A2QK 5L3DA 1HSJA 3F21A 3MCZA 4HF1A 4KIBA 4GCVA 1HW2A 2HTJA 4UNOA 1YG2A 2RC4A 4BNCA 4UVAA 3IC7A 4JBAA 3OOPA 2EWNA 5FO5A 1MJBA 3JAMK 2RGVA 3LA2A 4L5JA 1FP2A 2Y48A 2M30A 3VODA 1EV7A 4ESFA 4OIPF 4G8XA 2JT1A 3ZMVA 4I09A 2JRTA 2VC1A 1HKSA 2Z99A 1I27A 2RN7A 2GXBA 4M74A 3V8KA 1FLIA 1L3LA 2UXNA 2A3SA 5BS6A 1GXPA 2KRFA 1X3UA 3VEPA 3I53A 1S29A 1TTYA 3WE3A 5DCFA 5D4RA 3HSEA 4EQQA 3EYIA 3CO7C 4I0BA 4WXCA 3ZMZA 2OD5A 2XRNA 5IT9Z 5IT3A 1G3TA 4IRIA 1R5HA 5D5XB 2VONA 3DQVC 2EFQA 4EM2A 3I5UA 4UV9A 2QBYA 2V1XA 3R4KA 3RDIA 2GWRA 5AIQA 3J81Z 4M73A 1HBXG 4MNUA 3LQRA 3U1DA 3HYIA 2RKHA 2XIGA 4IPAA 1J2XA 5E1WA 1P4XA 2DQLA 1FBUA 5J8CA 3BPVA 4N9HA 3BJOA 2K27A 3F22A 2PG4A 2Z5UA 2UWMA 1IRFA 4ASNA 1V4RA 3PQKA 3QP6A 1HW5A 2NRAC 5BQTA 4MEXF 4BQAA 2RV8A 2KJCA 4ENMA 3J80K 4HAMA 5TJJA 2KKOA 3EQLF 1HXDA 2DTRA 4G6DA 4LJZF 4H0EA 4L9JA 1Z9CA 1A04A 1BBYA 3GZ5A 3HSFA 4Y15A 4G7OF 4RB2C 1JGSA 1XMKA 4MTEA 3TO6A 3L2CA 2A6HF 3CUQA 2JSCA 3FF5A 3HTUA 2V79A 3QU6A 5K1YA 4LB6B 1UFMA 1ZG3A 2ZJ2A 1KQ9A 1CF7A 2XROA 1GVJA 2VXZA 3RTRA 4LLLA 2H27A 4HQEA 1YO5C 1BOAA 3I0TA 1BN5A 2D1HA 3GW2A 2QQ9A 2OU2A 1I6XA 5CVUA 1XSVA 3HRMA 4AIKA 4ETSA 1R36A 1J0RA 4CZZA 2W85A 3I4PA 1DPRA 2ESHA 2F2EA 4L9NA 2FOKA 5ICGA 4OIQF 2CYYA 2OAZA 4HLYA 2IJLA 3WG9A 1O3TA 2P4WA 4NQWA 5CVJA 1DP7P 3T8RA 5ILUA 4N9IA 3FXRA 3DV8A 1B9NA 3V8LA 1J9IA 1JXSA 3L9FA 1Y0UA 4P55A 4QWQA 1FZPB 2FA5A 1I1SA 3WTZA 2MH9A 2A6EF 4O6JA 5DCMB 1BI0A 1XN7A 3GF2A 1Z6TA 4CO8A 1FY7A 2L54A 2WV0A 5AONA 4FX0A 2IW5A 3TO7A 4U7BA 3P7NA 2R7DA 2MD5A 1O57A 3F8FA 2DFIA 1YS6A 1HKQA 4XRFA 5L3FA 1H9TA 1YS7A 5FD5A 2P6SA 2MH2A 3ZMSA 3GFIA 3ELKA 2MLGA 2Q8KA 4HDUA 1IXCA 1OPCA 5KVRA 3K69A 2FSWA 2GXGA 2VOPA 4S05A 1D5VA 4AIJA 1FC3A 1TNTA 3GFJA 3JSOA 1J7KA 5ED4A 4FX4A 4AVPA 5LGUA 3C3WA 3IKVA 1ZYRF 4WXDA 4S04A 3O2PE 5H6RA 4RB1A 2HGCA 2ACJA 2DK5A 2OQRA 4YIFA 4HV5A 2PLYA 2G7HA 1I1GA 3HOTA 2P6TA 2E1CA 4KMUX 5CLSA 3LFKA 1IW7F 2H6CA 3K9TA 2QQAA 2FQ3A 3L00A 1K78B 1SD4A 3JSPA 3RKYA 2LKPA 4Q4ZF 3HRUA 3SXYA 4BXUA 2XKPA 3F6VA 3C1DA 3WU1B 3V8JA 2YX4A 5DD8A 2IA1A 1XGOA 3K1PA 2IP2A 3QAHA 3WTVC 3CUOA 3IHUA 1Q1HA 2ZMEA 1K6OA 4CDGA 1XDUA 4RAYA 2FXAA 2NYXA 2CWEA 1LQ1A 4GXOA 2EV0A 3K1MA 5ILSA 1DPUA 1QBJA 1EH6A 1XSXA 2QM3A 2KIUA 2STTA 2PMHA 2A68F 2BGCA 2IA0A 1QNTA 3IKTA 3R60A 4G7HF 5IT9K 5JR3A 3F8BA 2DAOA 1U78A 3J81K 1R23A 2EA2A 3Q9VA 1XCVA 2EFNA 1USSA 1F4KA 4ZH4F 2GA2A 5DCMA 2F5DA 2JZYA 1OYWA 4BHPA 5BPIA 2DPUA 2FE3A 4HA8A 4L5IA 1AOYA 1LNWA 4U0VA 4M9SA 4IHSA 1Z91A 4OMYA 3ZMTA 2V1DA 3RPUA 2Q0OA 4G7ZF 3VB2A 3HHHA 2G7UA 3FM3A 2R7FA 2HS5A 3L09A 4RGXA 4P9FA 4BHBA 4A5MA 4OU0A 2VN2A 3SQNA 4E70A 3F6OA 2RVCA 5E1ZB 4I98B 2EJRA 2WTEA 1XD7A 3M1EA 3F23A 1Z1DA 2BE5F 1YFHA 1E17A 3CUQC 2XAHA 4HX8A 2YX7A 4ENNA 5LRRA 1LJ9A 1YW7A 3LA3A 4A0ZA 1KA8A 4P5OA 5D5VB 2J5OA 4R1HA 2RNJA 5L3CA 1OKRA 5D8LB 1YQAA 4I01A 3GEZA 1YW8A 4KIGA 4M72A 1VTNC 1YTYA 1K78A 4BYYA 3BDDA 1P6RA 3O3KA 4HX4A 1XB4A 2A07F 1ZG1A 2VT3A 2ELHA 1E2XA 2VE9A 3ZN1A 2HR3A 3WTWC 1R7JA 1R1TA 1FBQA 5FD6A 3F8NA 4ON0A 1MD0A 1ON2A 3ULQB 5ERIA 1LDJA 3GWZA 5JI6A 3U9GA 5FFZA 1HW1A 1REPC 2NNNA 1PDNC 3V7SA 4YFXF 4A2UA 2BYVE 2O3FA 1WKMA 3QRFF 1SMTA 1FWZA 3GLXA 2EFOA 5DYMA 2O6GE 3ZN0A 3H3ZA 4IRGA 3L7WA 1G6NA 5K5RA 1ZLKA 4RGRA 2NAZA 1S3JA 2EFPA 1GHCA 4L0YB 3RIRA 1LDKB 3MFKA 2PI0A 5L3BA 4KIFA 1OR7A 2V1UA 3SZTA 5E1XA 3TDZC 3RJPA 3ECHA 3H92A 4HW0A 4G6QA 4CXFA 2J5PA 2KIFA 1R1UA 4M6XA 1OYIA 1T2KA 1I5ZA 1XCBA 3K1NA 1ZH5A 1UCRA 2A61A 3R0JA 1MZBA 3KP3A 2C6YA 3KETA 1B4AA 2FNPA 4L18B 5LLQA 1BC8C 3MWMA 4Q48A 4EJUA 2FF4A 1XDSA 4ZZLA 5F64A 3E3VA 2MC3A 5HDKA 3M8FA 3MEXA 3R0AA 2BEOA 2HDCA 4UV8A 3WGHA 3G73A 4A6DA 2FMLA 1MKMA 1XGMA 2XKOA 1TQPA 2X4HA 5FLXZ 4EVIA 1FYKA 2L01A 4ZYHA 1P2FA 4KT5C 5FB2A 3F3XA 4KUMA 2K7LA 4LFUA 1KYZA 2IA2A 2FU4A 5BMZA 2GA1A 2EA4A 4LK0F 3DXJF 3TOAA 4OMZA 1R22A 5DEQA 1FYLA 3QOPA 2IPQX 2EB7A 2XHKA 3T0YA 2IVMA 2D1VA 1C0WA 3EETA 2H94A 4BH9A 3WTYC 2VBYA 2P5LC 3ZP5A 1RNLA 3HHGA 2ZKZA 4HV6A 4M6YA 4IJAA 4UVBA 2HEOA 5HVQC 3N97A 2ZMEB 1ODDA 1XSDA 1RUNA 2HZTA 2DQRA 4K2EA 3U2RA 4M9XA 1IN6A 4D0PA 1PP7U 3HOSA 1RIOH 1EH8A 2HWVA 4RAZA 3I54A 4LG0B 1V3FA 3E6MA 3KP6A 4KN7X 1SFUA 1T38A 3SFZA 2FBIA 3SHFA 3HRSA 5EEGA 2O03A 2VBZA 4JK1X 1BIBA 2X0LA 2DLLA 1P4WA 2DBBA 1T98A 2CW0F 3CTAA 4GO1A 4Q5SF 5CVIA 3E6DA 2FBHA 1NHAA 2QENA 4EM1A 2DO7A 4LLGF 1H0MA 2XAFA 2E7XA 2ISZA 5ICFA 1DUXC 1ZRCA 4HDVA 2W25A 2BBYA 1JHHA 1P4AA 2ZNZA 3F8MA 4FHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRD A;  2ESN A;  2EV5 A;  1G3Y A;  3ML6 A;  4O3M A;  1HQC A;  3I64 A;  4MEY F;  1F9N A;  3GUD A;  4XLP F;  4FT8 A;  1SD5 A;  1YIO A;  2HYF A;  4ENK A;  4EGZ A;  4G9Y A;  1ZAO A;  2E1N A;  1SD7 A;  2CFX A;  3ABU A;  3CLO A;  5CVR A;  4UVC A;  4UXN A;  1ZGA A;  2PBI A;  4P9U A;  3VFZ A;  2VOD A;  3P9I A;  5AIP A;  3DPT A;  4B09 A;  1W4M A;  1OMI A;  1KYW A;  4HQM A;  1SAX A;  3MQ0 A;  3W6K B;  4YFK F;  5LGT A;  3WGG A;  4PGH A;  2VT2 A;  4YFN F;  5H20 A;  2W84 A;  3E97 A;  4N0B A;  4UUV A;  5HLI A;  4IVN A;  4RB0 A;  2PEX A;  4AD9 A;  4Z2Y A;  2MBF A;  3TGN A;  4OIR F;  2L4A A;  3ECO A;  3M8E A;  3P9K A;  4JQF A;  3WE2 A;  2O0Y A;  2O8X A;  3HIF A;  3AAF A;  1ZG5 A;  2PN6 A;  2LF8 A;  1BC7 C;  1PP8 F;  3BP8 A;  3TO9 A;  2ZXJ A;  3DFG A;  3MZH A;  1KU7 A;  2DW4 A;  3VOE A;  3GFL A;  3NEU A;  3T5X A;  2UXX A;  3KLO A;  1UHM A;  2XAJ A;  1JHF A;  1W7P B;  3WTU C;  3IWF A;  1SFE A;  5D8K B;  1IF1 A;  5CYV A;  2H6B A;  5ILV A;  3EYY A;  5HDN A;  4BAY A;  1MGT A;  3QPH A;  4EJT A;  1XGN A;  2PJP A;  4LG0 A;  4DQ2 A;  1RI7 A;  2Y0M A;  3HUG A;  1LVA A;  3BPX A;  2MLK A;  2A69 F;  2HOE A;  4G94 A;  4KFC A;  2O61 A;  1KU9 A;  4NB5 A;  4A0X A;  2DK8 A;  3KFW X;  4HOB A;  4UHT A;  4L0Z B;  2OZ6 A;  1ZRF A;  2IT0 A;  2FMY A;  3GYH X;  2PMU A;  4RS8 A;  4ENJ A;  2GAU A;  3E6C C;  1G3S A;  2HKX A;  1O3Q A;  1JE8 A;  3LAJ A;  4ZYD A;  2OA4 A;  2K86 A;  3K2Z A;  3WTT C;  1RUO A;  4WXH A;  2F5C A;  3GO5 A;  4I02 A;  3KZY A;  1Z05 A;  5BOX A;  4EV0 A;  1FBS A;  5FFX A;  5DDG A;  1B59 A;  2XUB A;  5HLH A;  2YR2 A;  1FPQ A;  1QZY A;  1YLF A;  3FXQ A;  3WOD F;  2NNY A;  5DV5 A;  3F8C A;  5FLX K;  4XSX F;  4ZZD A;  4KMF A;  4U0W A;  3K0L A;  3HRT A;  1K79 A;  4KN4 X;  2HQR A;  5J6X A;  3O6B B;  3ZQ7 A;  2F5E A;  3DP7 A;  3JTH A;  5JHU A;  2CQK A;  1WI9 A;  2XAS A;  4LGW A;  1RZ4 A;  3CDH A;  6PAX A;  3P9C A;  1LB2 A;  5HS8 A;  4YII A;  2Z3Y A;  3TQN A;  2W24 A;  3PQJ A;  2XV4 S;  1TQM A;  1SMY F;  1HST A;  1GXQ A;  4ZYG A;  2FNA A;  4M9Z A;  1XMA A;  5HS9 A;  1FP1 D;  1OYY A;  5HS7 A;  2K02 A;  3ZMD A;  5JFR A;  3ISP A;  2LF7 A;  1KQ8 A;  1LDD A;  2R3S A;  4P96 A;  1U5T A;  3EDP A;  3RKW A;  1SFX A;  2CGP A;  2BV6 A;  1QO0 D;  3G3Z A;  4HYE A;  5J8F A;  3IRQ A;  3FWE A;  3BJA A;  2YU3 A;  1BI1 A;  3ZPL A;  1FOK A;  3FXU A;  2YPR A;  2EV6 A;  1W7P A;  4OIN F;  4XBF A;  4I0A A;  4WX9 A;  1FX7 A;  5TRD A;  4Y13 A;  1Z6R A;  3FMR A;  2QYO A;  2VE8 A;  3EUH A;  4CIC A;  1UHW A;  1FT9 A;  4A6E A;  4HF2 A;  1R58 A;  1TBX A;  3ERE D;  3Q9S A;  2QVO A;  3WU0 A;  1TW3 A;  5D6E A;  4HF0 A;  3DKW A;  2QLZ A;  3IL2 A;  2FBK A;  1U2W A;  5JVT A;  3I58 A;  1MDM B;  2P5K A;  4LK1 F;  4IXA A;  4EJO A;  2GZW A;  1KU3 A;  1WRJ A;  2QUF A;  3IWZ A;  1LEB A;  3JTG A;  4CHU A;  5CJ9 A;  1BIA A;  3GVA A;  5E17 F;  5D4S A;  3FMQ A;  3QP5 A;  1AWC A;  2ETH A;  1WSU A;  3ROU A;  3MAJ A;  1BI3 A;  1IN5 A;  2DU9 A;  3R6S A;  3KP7 A;  3LAP A;  3RI4 A;  4RB3 C;  2L02 A;  2JPC A;  1MJA A;  3RKX A;  3V7C A;  3T1B A;  1S8N A;  4PDK A;  4U0Y A;  5LBQ A;  4TV7 A;  2LDU A;  1P92 A;  5HOO A;  2QWW A;  5LGN A;  4NHJ A;  3IRR A;  2K4B A;  4HX7 A;  3R61 A;  5KK1 A;  1O7L A;  3B73 A;  1CGP A;  4LD5 A;  3BY6 A;  2V6C A;  3LST A;  4U88 A;  2VBW A;  3HSR A;  3TDU C;  2A5Y B;  4GGG A;  5ICC A;  1QGP A;  3F72 A;  2UZK A;  1J5Y A;  4DNC A;  1S7O A;  3LA7 A;  2WWY A;  3I59 B;  4U7D A;  1D3Y A;  4HZF A;  5L3E A;  3I71 A;  3TKY A;  1PUE E;  3FX3 A;  2XGX A;  4YG2 F;  2HKO A;  3RPQ A;  4BHC A;  1IN7 A;  3QU3 A;  1IUY A;  3D0S A;  2OBP A;  2MA3 A;  1TW2 A;  3LQQ A;  1EH7 A;  2ZNY A;  3N4M A;  2DPD A;  3J7A O;  2L4M A;  3FMS A;  4IF4 A;  2YSR A;  1YYV A;  2JPB A;  4L9V A;  5D6F A;  1IXS B;  1R00 A;  1U6G A;  3RYR A;  5LEK A;  1W5T A;  5K5O A;  1IAW A;  1QQI A;  2OQG A;  4HBL A;  2HTS A;  2M87 A;  5A2Q Z;  4R79 A;  3M9A A;  1FSE A;  1SD6 A;  4RGS A;  3E6B A;  2NS0 A;  2D45 A;  2KIM A;  2P7C B;  1MJ9 A;  1T6S A;  3CO6 C;  3SZP A;  3GXO A;  2RDP A;  4WWC A;  5EEH A;  1ZRE A;  1MDM A;  3DPL C;  3WGI A;  2FRH A;  3NRV A;  5DD4 A;  3JAM Z;  3BWG A;  2JTV A;  3B02 A;  1FYM A;  3BJ6 A;  1BM9 A;  3KZZ A;  5H6Q A;  1TLH B;  2ZCW A;  1BJA A;  1ZN2 A;  2EK5 A;  4B8X A;  5D5W B;  2LSO A;  3KP2 A;  4ESJ A;  1B9M A;  2STW A;  3BZ6 A;  5D5U B;  3FM5 A;  5F1R A;  5E8G A;  1YW9 A;  2XAG A;  1BI2 A;  5LHI A;  1ZAR A;  4QLC U;  3BRO A;  3RYP A;  4HLX A;  3OV8 A;  5LEJ A;  1H9G A;  4PCQ A;  3W6J B;  1ULY A;  1IN4 A;  5DUI A;  4WK8 F;  2ZO4 A;  1QPM A;  3KP5 A;  2FEZ A;  4A0Y A;  4F7Z A;  1ZGJ A;  5HDG A;  3FHZ A;  2PQ8 A;  1HKT A;  2P5V A;  4O5V A;  2CO5 A;  2V9V A;  2HYG D;  4ESB A;  4GYG A;  2PFB A;  2H09 A;  5L3G A;  5ICE A;  1KQ0 A;  5E8I A;  3C7J A;  4MGR A;  2QQB A;  2XVC A;  1U5T C;  5CVV A;  4WCG A;  1D8J A;  3ZMU A;  2P8T A;  3I59 A;  1J75 A;  3WTS C;  3GZ6 A;  3ABT A;  3D5L A;  1S7A A;  4LB5 A;  2AS5 F;  4PZJ A;  1ZLJ A;  3J80 Z;  5LRS A;  2WC2 A;  5E18 F;  4EJW A;  1U5T B;  5BPD A;  1LEA A;  1R5G A;  3PFI A;  2D2W A;  4CYD A;  2OZU A;  3KCC A;  2Z9O A;  1FSH A;  1K7A A;  2CSO A;  1KGS A;  2M1B A;  4PGG A;  2P7V B;  5DUK A;  4I2O A;  1O3S A;  5LHG A;  3M7G A;  3JW4 A;  2M8E A;  2GQQ A;  4KNY A;  1U8R A;  2E7W A;  2M5W A;  1U3E M;  4LLN A;  3KEQ A;  5HLG A;  4KIC A;  4KA4 A;  2DI3 A;  3S2W A;  4L9T A;  2F5F A;  1STZ A;  2AXL A;  2HFH A;  4GYI A;  2VBX A;  4EJV A;  1W7P D;  3QPT A;  2IRF G;  3GX4 X;  1QZZ A;  4Y17 A;  3KE2 A;  1FNN A;  4A5N A;  3KLN A;  1J59 A;  2M45 A;  2CG4 A;  4IHT A;  3V7R A;  4WF2 A;  2XAQ A;  4KYW A;  1IZ1 A;  3Q5F A;  3HTS B;  3REO A;  3BOQ A;  3KEO A;  1Z7U A;  4AIH A;  3DEU A;  1B1B A;  1IN8 A;  4Q47 A;  2EFW A;  1XGS A;  1UST A;  1S6L A;  5LHH A;  3E5Q A;  1O7F A;  3C18 A;  1WWX A;  4EMS A;  4LMY A;  3KP4 A;  4IRH A;  3E5X A;  4OIO F;  1ON1 A;  2HQN A;  4KDP A;  3LWF A;  3WTX C;  2QBY B;  4M71 A;  2G9W A;  2VOO A;  2L3D A;  1TNS A;  3T8T A;  4RGU A;  1UB9 A;  4OOI A;  1B6A A;  2GIV A;  2DT5 A;  2Q2E A;  2W57 A;  1IRG A;  4R8H A;  2RQP A;  2Y75 A;  1WQ2 A;  1G3W A;  4MTD A;  2B0L A;  3DF8 A;  3E5U A;  1L0O C;  3TOB A;  1IXR C;  5FGM A;  4A12 A;  4XLN F;  4MQV A;  3H3U A;  2COM A;  3MZY A;  4EM0 B;  1W5S A;  2KJB A;  3COA C;  4CGZ A;  1G4D A;  2LNB A;  4EGY A;  2Z33 A;  1F1Z A;  3CJN A;  1O3R A;  1T39 A;  1TQI A;  1D8K A;  5E20 A;  4ZYE A;  3NQO A;  2ZFW A;  4AWX B;  1DDN A;  3CUQ B;  5F6F A;  4MHG A;  3GFM A;  1T0F A;  1R1V A;  2ISY A;  2VC0 A;  1ZHF A;  4I7H A;  1F5T A;  1CF7 B;  4XSZ F;  3FZV A;  2QZ8 A;  5K5Q A;  2K4J A;  2ADU A;  1KU2 A;  2TDX A;  2ZBK A;  4MQ9 F;  1ONV A;  3V4G A;  5A2Q K;  5L3D A;  1HSJ A;  3F21 A;  3MCZ A;  4HF1 A;  4KIB A;  4GCV A;  1HW2 A;  2HTJ A;  4UNO A;  1YG2 A;  2RC4 A;  4BNC A;  4UVA A;  3IC7 A;  4JBA A;  3OOP A;  2EWN A;  5FO5 A;  1MJB A;  3JAM K;  2RGV A;  3LA2 A;  4L5J A;  1FP2 A;  2Y48 A;  2M30 A;  3VOD A;  1EV7 A;  4ESF A;  4OIP F;  4G8X A;  2JT1 A;  3ZMV A;  4I09 A;  2JRT A;  2VC1 A;  1HKS A;  2Z99 A;  1I27 A;  2RN7 A;  2GXB A;  4M74 A;  3V8K A;  1FLI A;  1L3L A;  2UXN A;  2A3S A;  5BS6 A;  1GXP A;  2KRF A;  1X3U A;  3VEP A;  3I53 A;  1S29 A;  1TTY A;  3WE3 A;  5DCF A;  5D4R A;  3HSE A;  4EQQ A;  3EYI A;  3CO7 C;  4I0B A;  4WXC A;  3ZMZ A;  2OD5 A;  2XRN A;  5IT9 Z;  5IT3 A;  1G3T A;  4IRI A;  1R5H A;  5D5X B;  2VON A;  3DQV C;  2EFQ A;  4EM2 A;  3I5U A;  4UV9 A;  2QBY A;  2V1X A;  3R4K A;  3RDI A;  2GWR A;  5AIQ A;  3J81 Z;  4M73 A;  1HBX G;  4MNU A;  3LQR A;  3U1D A;  3HYI A;  2RKH A;  2XIG A;  4IPA A;  1J2X A;  5E1W A;  1P4X A;  2DQL A;  1FBU A;  5J8C A;  3BPV A;  4N9H A;  3BJO A;  2K27 A;  3F22 A;  2PG4 A;  2Z5U A;  2UWM A;  1IRF A;  4ASN A;  1V4R A;  3PQK A;  3QP6 A;  1HW5 A;  2NRA C;  5BQT A;  4MEX F;  4BQA A;  2RV8 A;  2KJC A;  4ENM A;  3J80 K;  4HAM A;  5TJJ A;  2KKO A;  3EQL F;  1HXD A;  2DTR A;  4G6D A;  4LJZ F;  4H0E A;  4L9J A;  1Z9C A;  1A04 A;  1BBY A;  3GZ5 A;  3HSF A;  4Y15 A;  4G7O F;  4RB2 C;  1JGS A;  1XMK A;  4MTE A;  3TO6 A;  3L2C A;  2A6H F;  3CUQ A;  2JSC A;  3FF5 A;  3HTU A;  2V79 A;  3QU6 A;  5K1Y A;  4LB6 B;  1UFM A;  1ZG3 A;  2ZJ2 A;  1KQ9 A;  1CF7 A;  2XRO A;  1GVJ A;  2VXZ A;  3RTR A;  4LLL A;  2H27 A;  4HQE A;  1YO5 C;  1BOA A;  3I0T A;  1BN5 A;  2D1H A;  3GW2 A;  2QQ9 A;  2OU2 A;  1I6X A;  5CVU A;  1XSV A;  3HRM A;  4AIK A;  4ETS A;  1R36 A;  1J0R A;  4CZZ A;  2W85 A;  3I4P A;  1DPR A;  2ESH A;  2F2E A;  4L9N A;  2FOK A;  5ICG A;  4OIQ F;  2CYY A;  2OAZ A;  4HLY A;  2IJL A;  3WG9 A;  1O3T A;  2P4W A;  4NQW A;  5CVJ A;  1DP7 P;  3T8R A;  5ILU A;  4N9I A;  3FXR A;  3DV8 A;  1B9N A;  3V8L A;  1J9I A;  1JXS A;  3L9F A;  1Y0U A;  4P55 A;  4QWQ A;  1FZP B;  2FA5 A;  1I1S A;  3WTZ A;  2MH9 A;  2A6E F;  4O6J A;  5DCM B;  1BI0 A;  1XN7 A;  3GF2 A;  1Z6T A;  4CO8 A;  1FY7 A;  2L54 A;  2WV0 A;  5AON A;  4FX0 A;  2IW5 A;  3TO7 A;  4U7B A;  3P7N A;  2R7D A;  2MD5 A;  1O57 A;  3F8F A;  2DFI A;  1YS6 A;  1HKQ A;  4XRF A;  5L3F A;  1H9T A;  1YS7 A;  5FD5 A;  2P6S A;  2MH2 A;  3ZMS A;  3GFI A;  3ELK A;  2MLG A;  2Q8K A;  4HDU A;  1IXC A;  1OPC A;  5KVR A;  3K69 A;  2FSW A;  2GXG A;  2VOP A;  4S05 A;  1D5V A;  4AIJ A;  1FC3 A;  1TNT A;  3GFJ A;  3JSO A;  1J7K A;  5ED4 A;  4FX4 A;  4AVP A;  5LGU A;  3C3W A;  3IKV A;  1ZYR F;  4WXD A;  4S04 A;  3O2P E;  5H6R A;  4RB1 A;  2HGC A;  2ACJ A;  2DK5 A;  2OQR A;  4YIF A;  4HV5 A;  2PLY A;  2G7H A;  1I1G A;  3HOT A;  2P6T A;  2E1C A;  4KMU X;  5CLS A;  3LFK A;  1IW7 F;  2H6C A;  3K9T A;  2QQA A;  2FQ3 A;  3L00 A;  1K78 B;  1SD4 A;  3JSP A;  3RKY A;  2LKP A;  4Q4Z F;  3HRU A;  3SXY A;  4BXU A;  2XKP A;  3F6V A;  3C1D A;  3WU1 B;  3V8J A;  2YX4 A;  5DD8 A;  2IA1 A;  1XGO A;  3K1P A;  2IP2 A;  3QAH A;  3WTV C;  3CUO A;  3IHU A;  1Q1H A;  2ZME A;  1K6O A;  4CDG A;  1XDU A;  4RAY A;  2FXA A;  2NYX A;  2CWE A;  1LQ1 A;  4GXO A;  2EV0 A;  3K1M A;  5ILS A;  1DPU A;  1QBJ A;  1EH6 A;  1XSX A;  2QM3 A;  2KIU A;  2STT A;  2PMH A;  2A68 F;  2BGC A;  2IA0 A;  1QNT A;  3IKT A;  3R60 A;  4G7H F;  5IT9 K;  5JR3 A;  3F8B A;  2DAO A;  1U78 A;  3J81 K;  1R23 A;  2EA2 A;  3Q9V A;  1XCV A;  2EFN A;  1USS A;  1F4K A;  4ZH4 F;  2GA2 A;  5DCM A;  2F5D A;  2JZY A;  1OYW A;  4BHP A;  5BPI A;  2DPU A;  2FE3 A;  4HA8 A;  4L5I A;  1AOY A;  1LNW A;  4U0V A;  4M9S A;  4IHS A;  1Z91 A;  4OMY A;  3ZMT A;  2V1D A;  3RPU A;  2Q0O A;  4G7Z F;  3VB2 A;  3HHH A;  2G7U A;  3FM3 A;  2R7F A;  2HS5 A;  3L09 A;  4RGX A;  4P9F A;  4BHB A;  4A5M A;  4OU0 A;  2VN2 A;  3SQN A;  4E70 A;  3F6O A;  2RVC A;  5E1Z B;  4I98 B;  2EJR A;  2WTE A;  1XD7 A;  3M1E A;  3F23 A;  1Z1D A;  2BE5 F;  1YFH A;  1E17 A;  3CUQ C;  2XAH A;  4HX8 A;  2YX7 A;  4ENN A;  5LRR A;  1LJ9 A;  1YW7 A;  3LA3 A;  4A0Z A;  1KA8 A;  4P5O A;  5D5V B;  2J5O A;  4R1H A;  2RNJ A;  5L3C A;  1OKR A;  5D8L B;  1YQA A;  4I01 A;  3GEZ A;  1YW8 A;  4KIG A;  4M72 A;  1VTN C;  1YTY A;  1K78 A;  4BYY A;  3BDD A;  1P6R A;  3O3K A;  4HX4 A;  1XB4 A;  2A07 F;  1ZG1 A;  2VT3 A;  2ELH A;  1E2X A;  2VE9 A;  3ZN1 A;  2HR3 A;  3WTW C;  1R7J A;  1R1T A;  1FBQ A;  5FD6 A;  3F8N A;  4ON0 A;  1MD0 A;  1ON2 A;  3ULQ B;  5ERI A;  1LDJ A;  3GWZ A;  5JI6 A;  3U9G A;  5FFZ A;  1HW1 A;  1REP C;  2NNN A;  1PDN C;  3V7S A;  4YFX F;  4A2U A;  2BYV E;  2O3F A;  1WKM A;  3QRF F;  1SMT A;  1FWZ A;  3GLX A;  2EFO A;  5DYM A;  2O6G E;  3ZN0 A;  3H3Z A;  4IRG A;  3L7W A;  1G6N A;  5K5R A;  1ZLK A;  4RGR A;  2NAZ A;  1S3J A;  2EFP A;  1GHC A;  4L0Y B;  3RIR A;  1LDK B;  3MFK A;  2PI0 A;  5L3B A;  4KIF A;  1OR7 A;  2V1U A;  3SZT A;  5E1X A;  3TDZ C;  3RJP A;  3ECH A;  3H92 A;  4HW0 A;  4G6Q A;  4CXF A;  2J5P A;  2KIF A;  1R1U A;  4M6X A;  1OYI A;  1T2K A;  1I5Z A;  1XCB A;  3K1N A;  1ZH5 A;  1UCR A;  2A61 A;  3R0J A;  1MZB A;  3KP3 A;  2C6Y A;  3KET A;  1B4A A;  2FNP A;  4L18 B;  5LLQ A;  1BC8 C;  3MWM A;  4Q48 A;  4EJU A;  2FF4 A;  1XDS A;  4ZZL A;  5F64 A;  3E3V A;  2MC3 A;  5HDK A;  3M8F A;  3MEX A;  3R0A A;  2BEO A;  2HDC A;  4UV8 A;  3WGH A;  3G73 A;  4A6D A;  2FML A;  1MKM A;  1XGM A;  2XKO A;  1TQP A;  2X4H A;  5FLX Z;  4EVI A;  1FYK A;  2L01 A;  4ZYH A;  1P2F A;  4KT5 C;  5FB2 A;  3F3X A;  4KUM A;  2K7L A;  4LFU A;  1KYZ A;  2IA2 A;  2FU4 A;  5BMZ A;  2GA1 A;  2EA4 A;  4LK0 F;  3DXJ F;  3TOA A;  4OMZ A;  1R22 A;  5DEQ A;  1FYL A;  3QOP A;  2IPQ X;  2EB7 A;  2XHK A;  3T0Y A;  2IVM A;  2D1V A;  1C0W A;  3EET A;  2H94 A;  4BH9 A;  3WTY C;  2VBY A;  2P5L C;  3ZP5 A;  1RNL A;  3HHG A;  2ZKZ A;  4HV6 A;  4M6Y A;  4IJA A;  4UVB A;  2HEO A;  5HVQ C;  3N97 A;  2ZME B;  1ODD A;  1XSD A;  1RUN A;  2HZT A;  2DQR A;  4K2E A;  3U2R A;  4M9X A;  1IN6 A;  4D0P A;  1PP7 U;  3HOS A;  1RIO H;  1EH8 A;  2HWV A;  4RAZ A;  3I54 A;  4LG0 B;  1V3F A;  3E6M A;  3KP6 A;  4KN7 X;  1SFU A;  1T38 A;  3SFZ A;  2FBI A;  3SHF A;  3HRS A;  5EEG A;  2O03 A;  2VBZ A;  4JK1 X;  1BIB A;  2X0L A;  2DLL A;  1P4W A;  2DBB A;  1T98 A;  2CW0 F;  3CTA A;  4GO1 A;  4Q5S F;  5CVI A;  3E6D A;  2FBH A;  1NHA A;  2QEN A;  4EM1 A;  2DO7 A;  4LLG F;  1H0M A;  2XAF A;  2E7X A;  2ISZ A;  5ICF A;  1DUX C;  1ZRC A;  4HDV A;  2W25 A;  2BBY A;  1JHH A;  1P4A A;  2ZNZ A;  3F8M A;  4FHT A; 
#chains in the Genus database with same CATH topology
 1ZRD A;  2CQQ A;  2ESN A;  2EV5 A;  1G3Y A;  3ML6 A;  2V4J C;  4O3M A;  1HQC A;  2E71 A;  2K9L A;  3I64 A;  2DDA A;  2EZL A;  1F9N A;  3GUD A;  4MEY F;  4XLP F;  4FT8 A;  3BTJ A;  1SD5 A;  1YIO A;  2HYF A;  5EDN A;  3W2A A;  2JRM A;  4ENK A;  1X2M A;  2F48 A;  4EGZ A;  1HDP A;  4AUX A;  3RPU D;  4G9Y A;  1ZAO A;  2E1N A;  4J01 A;  1SD7 A;  2CFX A;  3ABU A;  3CLO A;  3A0B C;  5CVR A;  4GFB A;  4UVC A;  3G71 I;  3S3M A;  4UXN A;  1PUF A;  2MG4 A;  1ZGA A;  2PBI A;  4C3J J;  4P9U A;  1P7I A;  3VFZ A;  2VOD A;  3P9I A;  3L2Q A;  5GAE J;  5AIP A;  3DPT A;  3LMM A;  4B09 A;  1W4M A;  1OMI A;  1KYW A;  5GAD J;  4HQM A;  1SAX A;  3MQ0 A;  3W6K B;  4YFK F;  5LGT A;  3Q0U A;  3WGG A;  2ZJQ F;  2DA2 A;  4PGH A;  4XOR A;  1QHH D;  5FKK A;  2VT2 A;  4YFN F;  3CCE I;  2R5Y B;  1K61 A;  5H20 A;  2W84 A;  3E97 A;  4RM3 A;  4EAT A;  3SJM A;  4N0B A;  4UUV A;  2A6T A;  2F4I A;  2OV7 A;  5HLI A;  1UJ8 A;  2R93 J;  2B7E A;  4IVN A;  1FOY A;  2NS8 A;  3B6C A;  4XLA A;  5F0C A;  5J47 A;  2IGK A;  4RB0 A;  4DJA A;  1SFO J;  2MAB A;  2PEX A;  3Q3S A;  4AD9 A;  2HPI A;  2IS4 A;  4MFE A;  4Z2Y A;  3CQZ J;  2MBF A;  3TGN A;  4OIR F;  2HPM A;  5E79 C;  3CCM I;  1YX3 A;  2L4A A;  3ECO A;  3M8E A;  3P9K A;  2I5U A;  4JQF A;  2R7O A;  1H8A C;  4A3E J;  3WE2 A;  2O0Y A;  2O8X A;  3HIF A;  3AAF A;  1ZG5 A;  2PN6 A;  2LF8 A;  1JTY A;  1PP8 F;  1H89 C;  1BC7 C;  3BP8 A;  3TO9 A;  2ZXJ A;  3BR2 A;  3DFG A;  3OYK A;  3MZH A;  1Y39 A;  1D0X A;  2JMW A;  2VIX A;  2DW4 A;  1KU7 A;  3VOE A;  2Q1Z B;  3AG4 H;  3GFL A;  3HGY A;  4IHY A;  3NEU A;  3T5X A;  2UXX A;  2JQ7 A;  3KLO A;  4IKF A;  1UHM A;  2XAJ A;  1HDD C;  1JHF A;  4UB8 C;  1W7P B;  3E1S A;  3WTU C;  3E7L A;  3IWF A;  3AL0 B;  1IGN A;  1SFE A;  2BY0 A;  5DM6 F;  5D8K B;  3O8G A;  1IF1 A;  5CYV A;  2BY1 A;  2H6B A;  5ILV A;  3EYY A;  3OIQ A;  1FOW A;  5HDN A;  4BAY A;  1MGT A;  2EZK A;  2MFZ A;  3QPH A;  4BJ5 C;  5J4V A;  4EJT A;  1XGN A;  2PJP A;  1R5I D;  2DT7 B;  3OIO A;  4LG0 A;  4DQ2 A;  4D7N A;  4FE7 A;  1EJ9 A;  1OR7 C;  1WGX A;  2R7Z J;  1RI7 A;  2Y0M A;  4C3H J;  1LPQ A;  5HNF A;  2VPL A;  4AYB N;  3HUG A;  1LVA A;  2Y0S N;  3VYU B;  3ZGK A;  4BE1 A;  3CCS I;  3BPX A;  2MLK A;  2A69 F;  2HOE A;  4G94 A;  4KFC A;  2O61 A;  2HOT A;  1WI3 A;  2P81 A;  3QPL A;  1KU9 A;  4NB5 A;  2VB6 A;  1Y56 A;  3BCA A;  2HVQ A;  2DK8 A;  4A0X A;  3KFW X;  3I56 I;  4HOB A;  4UHT A;  4AVZ A;  3BR5 A;  5HOD A;  4L0Z B;  2LBF B;  2OZ6 A;  4NC7 A;  5FKM A;  2VQG A;  1Z3Y A;  1ZRF A;  2W1O A;  3HOZ J;  2DA3 A;  5FJ8 J;  2IT0 A;  4ZDO A;  2FMY A;  3GYH X;  2PMU A;  4RS8 A;  2XF7 A;  4ENJ A;  1X4O A;  4XQF A;  2GAU A;  4XNF A;  3E6C C;  1VQ7 I;  1G3S A;  2HKX A;  1O3Q A;  4B1R A;  5HNH A;  4V19 K;  2ELJ A;  1JE8 A;  4XN0 A;  3LSM A;  3LAJ A;  2ZXI A;  4ZYD A;  2OA4 A;  2DA4 A;  2K86 A;  3K2Z A;  3WTT C;  1RUO A;  3PUB A;  3BQZ A;  4WXH A;  3IV5 A;  2F5C A;  3GO5 A;  1MSF C;  3L2R A;  3PO2 J;  1JI8 A;  2KP6 A;  4I02 A;  3ASN H;  2L7Z A;  2K3F A;  2E1M B;  3TW6 A;  5K7Z A;  3KZY A;  1A35 A;  1A31 A;  1Z05 A;  5BOX A;  3ZQH A;  3BQY A;  3QYF A;  4EV0 A;  2R92 J;  2K9N A;  1FBS A;  5FFX A;  1SAU A;  1QA6 A;  5DDG A;  1MBG A;  2EIL H;  1FJL A;  1B59 A;  2HYJ A;  2XUB A;  5HLH A;  3A02 A;  3S1R J;  2LC2 A;  2MSY A;  2BY3 A;  2YR2 A;  4BKX A;  1FPQ A;  1OLT A;  1QZY A;  3VDX A;  2MD0 A;  5HLT A;  2DJI A;  4BQN A;  1T95 A;  2F6C A;  2CQX A;  2ZXH A;  3VSL A;  3B6A A;  1YLF A;  4Y3O A;  4C2T A;  3FXQ A;  3MKL A;  4BGD A;  3WOD F;  2NNY A;  5DV5 A;  3F8C A;  3AG3 H;  3CJT B;  4C3I J;  1H88 C;  4E7S A;  3DU5 A;  5FLX K;  2R7R A;  4XSX F;  4ZZD A;  4CUG A;  4KMF A;  4Y52 J;  2CW7 A;  2A05 A;  4U0W A;  3K0L A;  3HRT A;  3OYC A;  1K79 A;  4KN4 X;  2HQR A;  5J6X A;  3O6B B;  4S0H B;  3ZQ7 A;  4ABZ A;  2F5E A;  2EIJ H;  5F0F A;  2JN6 A;  3DP7 A;  2XC7 A;  3JTH A;  4D5F A;  1ORK A;  5JHU A;  2CQK A;  1WI9 A;  2XAS A;  2PMZ N;  4LGW A;  1RZ4 A;  2UV1 A;  2R5Y A;  3CDH A;  1X1A A;  6PAX A;  3P9C A;  1LB2 A;  5HS8 A;  3RZO J;  4YII A;  2Z3Y A;  2K9M A;  3TQN A;  3D5R C;  2W24 A;  3PQJ A;  1MMS A;  2XV4 S;  3SEQ A;  1BA5 A;  3ZQG A;  3HM5 A;  1RPW A;  1TQM A;  1SMY F;  1HST A;  2XDV A;  4CH7 A;  1GXQ A;  2CFO A;  4ZYG A;  2FNA A;  4M3G A;  4M9Z A;  1XMA A;  5HS9 A;  1FP1 D;  4V2G A;  1OYY A;  4BEH B;  5HS7 A;  2K02 A;  2M7A A;  3ZMD A;  5JFR A;  3ISP A;  2LF7 A;  1KQ8 A;  1LDD A;  2R3S A;  4P96 A;  1U5T A;  2QEX I;  3EDP A;  4U87 A;  1SFX A;  3RKW A;  2CGP A;  3BG5 A;  2BV6 A;  1QO0 D;  3G3Z A;  4HYE A;  4V2F A;  3FKI J;  5EZG A;  5J8F A;  3IRQ A;  3FWE A;  3BJA A;  3UNG C;  1MMD A;  2XF6 A;  3S93 A;  2YU3 A;  1BI1 A;  3ZPL A;  1FOK A;  3FXU A;  3S3N A;  4RM2 A;  2YPR A;  2FD5 A;  3P5J A;  2EV6 A;  4KIS A;  1MH3 A;  2JVG A;  1D1C A;  1W7P A;  2E2I J;  4HG2 A;  1D0Y A;  5LFA A;  4OIN F;  4XBF A;  5CKT A;  4I0A A;  4WX9 A;  1FX7 A;  1IV6 A;  5TRD A;  4Y13 A;  1Z6R A;  2DOD A;  5F08 A;  3FMR A;  2QYO A;  1MSE C;  2VE8 A;  3EUH A;  3QOD A;  4CIC A;  1UHW A;  4IQJ A;  2ZFU A;  1FT9 A;  2LOO A;  2KRH A;  3WHB A;  4I99 C;  4M3D A;  4A6E A;  3SDG A;  4HF2 A;  1R58 A;  1WVR A;  4BU2 A;  1TBX A;  3ERE D;  2DJN A;  3Q9S A;  1MNM C;  2QVO A;  1IDY A;  3WU0 A;  1TW3 A;  1U0J A;  5D6E A;  1HF0 A;  4HF0 A;  5GP9 A;  3GTP J;  3DKW A;  1BOB A;  2QLZ A;  1ZKG A;  2LBF A;  4F52 A;  3IL2 A;  2FBK A;  1J09 A;  1U2W A;  5M5X J;  5JVT A;  3I58 A;  1ETY A;  3GTM J;  3ZQQ A;  1MDM B;  2P5K A;  1B8I B;  1V5F A;  4LK1 F;  4IXA A;  2D5V A;  4EJO A;  4C30 A;  4F92 B;  3TL4 X;  5EGO A;  5FLV A;  2BVL A;  2GZW A;  1DP3 A;  1KU3 A;  3BZC A;  1IV8 A;  5K7H A;  2OCC H;  1WRJ A;  1JUP A;  2QUF A;  3IWZ A;  4II2 A;  5EYR A;  1LEB A;  2CUF A;  3JTG A;  4CHU A;  4BXX J;  5CJ9 A;  1BIA A;  2PJR B;  3GVA A;  5E17 F;  5D4S A;  3FMQ A;  3HOX J;  3QP5 A;  1AWC A;  2EIM H;  2VJJ A;  4F91 B;  2L9S A;  2ETH A;  2AHQ A;  2H8R A;  1YRN B;  2HDW A;  1WSU A;  1IJW C;  3MAJ A;  3ROU A;  1BI3 A;  4A3J J;  1IN5 A;  2DU9 A;  3BTC A;  4A3F J;  2EH3 A;  3R6S A;  3D1N I;  2EPF A;  2R0Q C;  3KP7 A;  3LAP A;  2XGC A;  3RI4 A;  4RB3 C;  2L02 A;  3S2H J;  2JPC A;  3W2V A;  3PUF A;  4LIV A;  4CCJ A;  4L5E A;  1MW7 A;  1MJA A;  1R9T J;  3BR1 A;  3TED A;  3RKX A;  3V7C A;  1UAA A;  3T1B A;  2DT6 A;  1S8N A;  3K4B A;  4PDK A;  4U0Y A;  2WAQ N;  4BL0 B;  2QSH X;  5LBQ A;  4TV7 A;  2LDU A;  3BCB A;  1RKW A;  3H5N A;  3ERM A;  3RCO A;  4FQG A;  5FRM A;  3GTQ J;  1P92 A;  5HOO A;  2QWW A;  5LGN A;  4NHJ A;  2RRE A;  1S9H A;  3IRR A;  3A1Y A;  2K4B A;  2E5N A;  4HX7 A;  5J40 A;  3R61 A;  5KK1 A;  2MC4 A;  3OYM A;  1O7L A;  3B73 A;  1CGP A;  3JRE A;  2ID3 A;  1F36 A;  4LD5 A;  3BY6 A;  2V6C A;  3LST A;  1IRX A;  4BQQ A;  4U88 A;  3OYD A;  4E7K A;  3BG7 A;  2VBW A;  3HSR A;  3BG3 A;  3TDU C;  1Y1W J;  2A5Y B;  2VJ5 A;  3QYB A;  4GGG A;  2LRE A;  1Z67 A;  3JRH A;  5ICC A;  1QGP A;  3F72 A;  2EZH A;  2UZK A;  1WHU A;  1J5Y A;  1Z21 A;  1ZTR A;  4DNC A;  4KIT B;  1S7O A;  2QKM B;  2NS7 A;  3H5A A;  4DBQ A;  1TC3 C;  3LA7 A;  1XPX A;  2ZB9 A;  2WWY A;  3I59 B;  4DZP A;  1A5J A;  1KON A;  4U7D A;  4IEJ A;  2DOA A;  3I4M J;  1D3Y A;  4HZF A;  3WG7 H;  5L3E A;  1X1C A;  3I71 A;  3TKY A;  2R7U A;  1PUE E;  5F0H A;  3OIP A;  2KDO A;  2HNH A;  3FX3 A;  2XGX A;  3H35 A;  2HKO A;  3DEW A;  4YG2 F;  3RPQ A;  4BY1 J;  2KPM A;  4BHC A;  1IN7 A;  3QU3 A;  3BLY A;  1IUY A;  3D0S A;  2OBP A;  2MA3 A;  1JKO C;  1TW2 A;  3LQQ A;  1EH7 A;  2WA0 A;  3LSK A;  2FQ4 A;  2ZNY A;  3N4M A;  3HXL A;  2L9N A;  4JX5 A;  2DPD A;  2LYC A;  1SC7 A;  3J7A O;  2L4M A;  3FMS A;  2DMP A;  1XTA A;  2DMT A;  2K85 A;  3L1P A;  4NC6 A;  3X2Q H;  1VQO I;  2L7F P;  4IF4 A;  2YSR A;  1YYV A;  2JPB A;  4L9V A;  1UHS A;  5D6F A;  1IXS B;  1R00 A;  1U6G A;  3RYR A;  5LEK A;  1W5T A;  4XRM A;  2LK2 A;  2IEK A;  5K5O A;  3CJQ B;  4XK4 A;  1EKE A;  3PNV A;  1IAW A;  1IUF A;  5K7F A;  1QQI A;  2OQG A;  4E4H A;  4HBL A;  2HTS A;  2M87 A;  2XF5 A;  1JUS A;  5A2Q Z;  4R79 A;  3M9A A;  3SDB A;  3K70 C;  1FSE A;  1SD6 A;  4RGS A;  3E6B A;  1TWC J;  2NS0 A;  2R7X A;  2D45 A;  2M0C A;  2KIM A;  1BJZ A;  1WFX A;  2A5W A;  2P7C B;  1MJ9 A;  1T6S A;  3CJR B;  3CO6 C;  3SZP A;  3GXO A;  1E3O C;  2RDP A;  1FMV A;  1WJ5 A;  4WWC A;  5EEH A;  3DLL F;  1ZRE A;  2COB A;  1ZGW A;  1MDM A;  3DPL C;  3WGI A;  2QCO A;  3KEY A;  2FRH A;  3NRV A;  5DD4 A;  3JAM Z;  4BXF A;  3HG9 A;  2R7Q A;  3BWG A;  2JTV A;  3BG9 A;  3QYE A;  1TZL A;  3B02 A;  1FYM A;  4AU7 A;  3BJ6 A;  1BM9 A;  3M4O J;  2AO9 A;  2LY9 A;  3KZZ A;  3MN2 A;  3K4J A;  1ETK A;  5H6Q A;  1TLH B;  2ZCW A;  3HKZ A;  1BJA A;  1P7J A;  1SVL A;  1ZN2 A;  5M3M J;  2EK5 A;  2KZG A;  2IS1 A;  4A69 C;  4B8X A;  5D5W B;  2LSO A;  2TCT A;  3KP2 A;  4ESJ A;  1B9M A;  2STW A;  2OJE D;  3BZ6 A;  2HQ5 A;  5D5U B;  4RMN A;  3FM5 A;  5F1R A;  5E8G A;  3IAM 2;  4IHX A;  1IO2 A;  1PJR A;  4FET A;  1YRN A;  1YW9 A;  2XAG A;  1BI2 A;  1B72 A;  1Y8R B;  5LHI A;  1ZAR A;  2B63 J;  3G1O A;  1LUJ B;  4QLC U;  1BR4 A;  3ABL H;  2JUC A;  3ZRG A;  2G0E A;  3K70 D;  2V9P A;  3BRO A;  2YUS A;  1MBF A;  2LY2 A;  3RYP A;  4HLX A;  3I9V 2;  1WJD A;  3U21 A;  3OV8 A;  5LEJ A;  1IDZ A;  1H9G A;  1OCT C;  4PCQ A;  4RLQ A;  2DYR H;  3W6J B;  1ULY A;  5FKL A;  1IN4 A;  4BY7 J;  5DUI A;  4WK8 F;  4XKB A;  1QRY A;  2WAE A;  2ZO4 A;  1QPM A;  4XOP A;  1U9O A;  2JK3 A;  4A3I J;  3KP5 A;  5JLW A;  1IC8 A;  2FEZ A;  4A0Y A;  4F7Z A;  5GTI C;  3BR6 A;  1UMQ A;  1ZGJ A;  3LSI A;  2KHM A;  4JX4 A;  5HDG A;  4A3L J;  2LH9 A;  4PJN A;  2PQ8 A;  3FHZ A;  1HKT A;  4UUT A;  2P5V A;  2Q2E B;  4NNJ A;  3CMM A;  2CMP A;  4O5V A;  2CO5 A;  2FOW A;  2V9V A;  3IH4 A;  4A3K J;  5DM7 F;  2AXT C;  2HYG D;  1X3Z B;  3HBL A;  4ESB A;  2DA6 A;  2ELK A;  1SFK A;  4GYG A;  2PFB A;  4PFP A;  4B48 A;  2H09 A;  5L3G A;  5ICE A;  1KQ0 A;  1SVO A;  5E8I A;  3C7J A;  1VQP I;  5H2F C;  2FUG 2;  2WB1 N;  4MGR A;  1ITY A;  2QQB A;  2XVC A;  2KFD A;  1U5T C;  5CVV A;  2VAS A;  3CDI A;  4E7Z A;  2VKV A;  4WCG A;  5KCM A;  5FRN A;  1FIP A;  1QPI A;  2KDZ A;  1D8J A;  3ZMU A;  1AHD P;  5J1Y A;  4OAZ A;  2P8T A;  1WJB A;  1RKT A;  3I59 A;  3LFU A;  4RBO A;  2Y30 A;  3ZQC A;  1J75 A;  3WTS C;  1VQ8 I;  3GZ6 A;  4HEA 2;  3ABT A;  3D5L A;  1S5L C;  1BW6 A;  2LY1 A;  5EEA A;  1S7A A;  5B5E C;  4LB5 A;  2AS5 F;  1ERD A;  4PZJ A;  1TT0 A;  3RQI A;  1ZLJ A;  2JUG A;  3J80 Z;  2QQ8 A;  1ETQ A;  2X51 A;  5LRS A;  2WC2 A;  1T8I A;  3G1M A;  3AL0 C;  5E18 F;  1OCZ H;  1POG A;  4EJW A;  4CCO A;  1U5T B;  5BPD A;  1LEA A;  3OR1 C;  3PL8 A;  1R5G A;  3PFI A;  3OYL A;  2D2W A;  3DKY A;  4NBQ A;  4CYD A;  2OZU A;  2M3A A;  1VQ5 I;  3EUH C;  3KCC A;  2Z9O A;  1FSH A;  2RAE A;  5FRO A;  2XSD C;  3CC2 I;  5KAF C;  2Y9Z A;  1K7A A;  4E7J A;  2CSO A;  3H36 A;  4XKV A;  3OSF A;  1YI2 I;  2M7B A;  1KGS A;  2M1B A;  4MIM A;  2F4M B;  4B3X A;  4PGG A;  2P7V B;  5DUK A;  4GDF A;  4ANJ A;  4I2O A;  4XN3 A;  2VLA A;  1O3S A;  2CUJ A;  5LHG A;  3M7G A;  3KIO A;  3JW4 A;  2V26 A;  3CP8 A;  1TT5 B;  2M8E A;  5EF6 A;  5C4J J;  4X1E A;  2GQQ A;  4KNY A;  1U8R A;  2E7W A;  3AG1 H;  2KLO A;  2M5W A;  1OCO H;  1U3E M;  4LLN A;  4B43 A;  3FXO A;  2YU9 J;  3KEQ A;  1YOV B;  5HLG A;  1R4N B;  4KIC A;  1F43 A;  1Y8Q B;  4KA4 A;  2DI3 A;  3S2W A;  4RA2 A;  2R7W A;  1N77 A;  4L9T A;  2F5F A;  1STZ A;  1X4P A;  2DA7 A;  2AXL A;  2HFH A;  4GYI A;  5B1B H;  2VBX A;  1HLV A;  4EJV A;  1W7P D;  3QPT A;  3O8H A;  1ZR2 A;  3FXM A;  2IRF G;  2K3P A;  3GX4 X;  3D5S C;  1QZZ A;  4Y17 A;  3AKZ A;  1O4X A;  2Y31 A;  3KE2 A;  1FNN A;  4A5N A;  3KLN A;  4DYC A;  2E1M C;  1J59 A;  4F55 A;  2M45 A;  2CG4 A;  4IHT A;  1T33 A;  3V7R A;  3Q0W A;  4WF2 A;  3M3Y J;  2XAQ A;  4KYW A;  1IZ1 A;  1SVM A;  3Q5F A;  3HTS B;  3REO A;  3BOQ A;  5EGO B;  3KEO A;  1Z7U A;  4AIH A;  1JKQ C;  4XLE A;  3DEU A;  1B1B A;  4II3 A;  3MZ8 A;  1IN8 A;  1OFC X;  3QPS A;  4CCL A;  4Q47 A;  3OYN A;  2EFW A;  4DYR A;  1WJC A;  1UST A;  1XGS A;  1E3H A;  2ZSI B;  1S6L A;  3BTI A;  2JJ7 A;  5LHH A;  3OYB A;  4XLH A;  2HQA A;  3RQ4 A;  4BQO A;  3E5Q A;  3GLL A;  1MND A;  4Z6Y A;  1NTC A;  4CCK A;  4F3Q A;  1O7F A;  3C18 A;  1WWX A;  4EMS A;  4XIC A;  2Y69 H;  4LMY A;  3KP4 A;  4A3G J;  2Y9Y A;  4W97 A;  4IRH A;  3E5X A;  2CV1 A;  2ZJP F;  4OIO F;  1ON1 A;  3GZN B;  3OOU A;  2HQN A;  3G2B A;  3LWF A;  3S3O A;  3WTX C;  4KDP A;  2QBY B;  3PIO F;  2MYS A;  2P0W A;  4M71 A;  2G9W A;  2VOO A;  1D1B A;  2L3D A;  1TNS A;  1DGR M;  3T8T A;  4ZJZ A;  3MKW B;  3OYH A;  3FK7 A;  3ZQI A;  3BZK A;  2CJJ A;  4RGU A;  1W0T A;  3S1N J;  1UB9 A;  4OOI A;  1TWH J;  1B6A A;  2GIV A;  2DT5 A;  3AG2 H;  2Q2E A;  2W57 A;  5M5W J;  3H9G A;  3TP0 A;  4QPO A;  1MMA A;  4HPQ A;  1IRG A;  4R8H A;  2CV0 A;  1LFB A;  2DOE A;  2RQP A;  2Y75 A;  1WQ2 A;  1G3W A;  2JVH A;  2MGQ A;  4MTD A;  3EPZ A;  3EUK L;  4M6V A;  2AQF A;  2JWT A;  2B0L A;  2MW8 A;  4E6K G;  3DF8 A;  2R7V A;  3E5U A;  1L0O C;  2NVY J;  4UUS B;  5M5Y J;  3TOB A;  2DA5 A;  2NOG A;  3JRG A;  1IXR C;  1Y1V J;  2BW3 B;  5FGM A;  1PVE A;  4A12 A;  2EBI A;  2L5Q A;  1OIS A;  4MQV A;  5FKN A;  3H3U A;  2COM A;  3MZY A;  4XLN F;  4EM0 B;  1ETW A;  1W5S A;  2XGD A;  3DBL B;  2KJB A;  2KL4 A;  1R6R A;  4HST A;  5CQE A;  3FXK A;  3A01 B;  5EZH A;  3COA C;  4CGZ A;  1G4D A;  2LNB A;  4JP0 A;  2KIS A;  3ZR8 X;  2UUZ A;  4EGY A;  1R71 A;  1V5E A;  5GPA A;  2Z33 A;  1D5Y A;  1F1Z A;  3CJN A;  1O3R A;  4BJT A;  1T39 A;  3M1C A;  2M34 A;  2JA2 A;  1TQI A;  1D8K A;  5E20 A;  3FXJ A;  1AKH A;  1GVD A;  3I4N J;  4ZYE A;  3NQO A;  1RR7 A;  4ZDL A;  2ZFW A;  2DXI A;  4IL6 C;  2V7F A;  2GM4 A;  2BXZ A;  4AWX B;  1DDN A;  3CC7 I;  4KT6 A;  3K10 A;  5E3L A;  3CUQ B;  2DFE A;  5F6F A;  4MHG A;  3GFM A;  3VPR A;  3LNQ A;  2DMU A;  2XB5 A;  1APL C;  1T0F A;  1R1V A;  2ISY A;  4BUP A;  2VC0 A;  3CMA I;  1ZHF A;  4I7H A;  4ZTF A;  1NK3 P;  4D9J A;  4PFO A;  3S17 J;  1F5T A;  1A6I A;  1CF7 B;  4XSZ F;  3H1C A;  3FZV A;  1MMG A;  2QZ8 A;  5K5Q A;  2K4J A;  2ADU A;  1KU2 A;  2TDX A;  2ZBK A;  4MQ9 F;  1ONV A;  4Y4R A;  3V4G A;  5A2Q K;  4UY8 I;  1D1A A;  2E35 A;  2W82 A;  5L3D A;  1HSJ A;  3F21 A;  5JVG F;  3MCZ A;  2OTL I;  4HF1 A;  4KIB A;  4GCV A;  1GV2 A;  1YJ9 I;  4BJ6 C;  4IQ4 A;  1HW2 A;  2HTJ A;  4UNO A;  1YG2 A;  2RC4 A;  4BNC A;  4UVA A;  5GTH C;  1DGW Y;  2KZV A;  3IC7 A;  4JBA A;  1MBE A;  4JX6 A;  4BDY A;  1BR2 A;  3OOP A;  2EWN A;  5FO5 A;  2L0K A;  4I76 A;  3S1Q J;  1MJB A;  2JA6 J;  2EQR A;  3JAM K;  1JGG A;  2RGV A;  3C2G A;  3LA2 A;  4L5J A;  1FP2 A;  2QA4 I;  5C44 J;  2Y48 A;  2M30 A;  3VOD A;  1EV7 A;  4ESF A;  4OIP F;  4G8X A;  3DBR B;  2JT1 A;  3ZMV A;  4PJ0 C;  4I09 A;  2VQH A;  3DTI A;  5F27 A;  3GTO J;  2JRT A;  4C9Y A;  1D0Z A;  2LRD A;  3HZJ A;  1RET A;  2VC1 A;  1V5G A;  1HKS A;  2Z99 A;  4HRI A;  3ZQL A;  5JHF A;  1I27 A;  4E7L A;  2RN7 A;  2GXB A;  5C4X J;  3OSG A;  4M74 A;  3V8K A;  3A0H C;  5B1A H;  1LKX A;  1FLI A;  2L7K A;  1I50 J;  2WB1 A;  2UXN A;  3E0J B;  1L3L A;  2A3S A;  2M4G A;  5BS6 A;  4A3M J;  2KRF A;  1GXP A;  3HOV J;  1FEX A;  1GUU A;  1ETX A;  3GCM A;  3IH2 A;  1X3U A;  3VEP A;  3I53 A;  1S29 A;  1TTY A;  3WE3 A;  5DCF A;  4NQW B;  3OR2 C;  3FDY A;  5D4R A;  4ZTJ A;  1JKP C;  3HSE A;  4EQQ A;  4ITV A;  4XKC A;  2OC6 A;  3EYI A;  4DIQ A;  4XM3 A;  3CO7 C;  2Y2Z A;  4GRI A;  4I0B A;  3ZQF A;  4WXC A;  3ZMZ A;  2OD5 A;  2XRN A;  5IT9 Z;  5IT3 A;  4X0G A;  1G3T A;  4IRI A;  5TIS C;  3PSI A;  1R5H A;  3CME I;  2HVS A;  4DGW B;  2Z16 A;  5D5X B;  2NVX J;  3PIP F;  3DQV C;  2VON A;  2EFQ A;  1TWG J;  2VJ4 A;  4EM2 A;  1EA3 A;  4Y33 A;  1B72 B;  3I5U A;  4UV9 A;  2QBY A;  2V1X A;  3R4K A;  3RDI A;  3K4K A;  4G6T B;  4DBR A;  2GWR A;  5AIQ A;  3J81 Z;  1UG0 A;  1WJF A;  4M73 A;  4IO9 F;  3GTJ J;  2LR8 A;  3QOE A;  1HBX G;  4MNU A;  2O8K A;  1BW5 A;  1FOX A;  3LQR A;  3NWT A;  3LSR A;  5E3N A;  5EJC A;  2F4O B;  1W5C C;  3TBI A;  3HYI A;  2L9V A;  3U1D A;  2RKH A;  4BDZ A;  2XIG A;  4IPA A;  2WAD A;  1J2X A;  5E1W A;  4LOC A;  1P4X A;  2DQL A;  1FBU A;  2RQQ A;  2BVM A;  5J8C A;  3I3L A;  5LD2 C;  1KZH A;  1JJ6 C;  3BPV A;  4N9H A;  4UUS A;  3BJO A;  2K27 A;  3F22 A;  2PG4 A;  2H8W A;  2Z5U A;  4RDU A;  2BW3 A;  2UWM A;  2B9S A;  3JRC A;  1IRF A;  4ASN A;  1V4R A;  4BBS J;  3PQK A;  3QP6 A;  1HW5 A;  2CV2 A;  1TWA J;  4CCM A;  3OL3 A;  4AYB A;  2NRA C;  2Y0S A;  3A01 A;  3F9K A;  1YIT I;  3W6V A;  5BQT A;  2V1N A;  1I3A A;  1U8B A;  4MEX F;  1FTZ A;  4BQA A;  5IYD J;  4FTH A;  2RV8 A;  4Y7N J;  2KJC A;  4ENM A;  3J80 K;  1OCC H;  2ECB A;  4HAM A;  5TJJ A;  2KKO A;  4DOZ A;  2XAU A;  3EQL F;  2HOS A;  1HXD A;  2DTR A;  4G6D A;  4CZC A;  4LJZ F;  4H0E A;  2X6Y A;  4L9J A;  3HB9 A;  1Z9C A;  1MIJ A;  1A04 A;  1BBY A;  3GZ5 A;  3HSF A;  4Y15 A;  1MBK A;  1I39 A;  4G7O F;  4RB2 C;  4D5C A;  1JGS A;  1XMK A;  3DPU A;  3I55 I;  4MTE A;  3TO6 A;  3L2C A;  2A6H F;  2KRC A;  2XB0 X;  1T56 A;  1UG2 A;  4MO7 A;  2E2H J;  3JRB A;  3CUQ A;  2JSC A;  3GTL J;  3K4C A;  1GT0 C;  3FF5 A;  1GLN A;  2PX9 A;  5E3M A;  3HTU A;  3C2H A;  2V79 A;  3QU6 A;  5K1Y A;  1Q1V A;  5BNG A;  4LB6 B;  1UFM A;  1ZG3 A;  4NDL A;  1FMW A;  1X58 A;  2ZJ2 A;  1OQY A;  5IP7 J;  1QVT A;  1KQ9 A;  1CF7 A;  2XRO A;  4YEJ A;  1GVJ A;  1JTX A;  2VXZ A;  1YX5 A;  1XMX A;  4YIR X;  4FIS A;  3CMY A;  3RTR A;  4LLL A;  2H27 A;  1VQ4 I;  2E1O A;  4B4C A;  4HQE A;  1YO5 C;  1BOA A;  3FIW A;  4PJL A;  1N25 A;  3W3C A;  4BE0 A;  3I0T A;  1BN5 A;  1A6Q A;  2D1H A;  2VJI A;  3GW2 A;  2IGO A;  3ZCO A;  1DU0 A;  2QQ9 A;  2OU2 A;  1I6X A;  5CVU A;  1XSV A;  3HRM A;  4LIT A;  4AIK A;  4ETS A;  1R36 A;  2K40 A;  2M9H A;  1J0R A;  4CZZ A;  2CH0 A;  1WH5 A;  2M0M A;  2W85 A;  3I4P A;  1DPR A;  2ESH A;  2F5V A;  1JKR C;  4XLF A;  2F2E A;  1FTT A;  4L9N A;  2LTP A;  2FOK A;  3TP3 A;  5ICG A;  3HPH A;  5IPA A;  4CSW A;  2BHY A;  3CF2 A;  2NVU B;  2BY2 A;  3S8P A;  3FXL A;  4OIQ F;  2R7T A;  3VWB A;  2CYY A;  1Z0X A;  3BTL A;  1YIJ I;  2OAZ A;  4JYK A;  3KYD B;  4HLY A;  3OYA A;  5J3L A;  3J7Z I;  2IJL A;  3WG9 A;  2DN0 A;  1O3T A;  3ASO H;  2P4W A;  1VZ0 A;  2E60 A;  3ABK H;  4BBR J;  2PMZ A;  4NQW A;  5CVJ A;  1DP7 P;  1M1E B;  4M3F A;  3T8R A;  5ILU A;  4N9I A;  1ZR4 A;  3FXR A;  4B47 A;  3DV8 A;  1K6Y A;  1B9N A;  3CD6 I;  2CQ7 A;  1HCR A;  3V8L A;  2LFB A;  1J9I A;  1JXS A;  1MMN A;  3L9F A;  3JR9 A;  1Y0U A;  4P55 A;  3LSP A;  4D7M A;  3HC7 A;  3ESW B;  2GOM A;  2VKD A;  4QWQ A;  5GPC A;  1MNE A;  3H9Q A;  1FZP B;  1YJN I;  2FA5 A;  1I1S A;  1HA8 A;  3OYG A;  3WTZ A;  2MH9 A;  2A6E F;  2LVS A;  3MKY B;  4O6J A;  5DCM B;  5GAG J;  1BI0 A;  1XN7 A;  2EIN H;  3GF2 A;  4PK4 A;  1Z6T A;  4CO8 A;  1FY7 A;  2RNG A;  2L54 A;  2WV0 A;  5AON A;  4FX0 A;  2N8G A;  1GV5 A;  2IW5 A;  2W7N A;  3TO7 A;  3DCF A;  3K4M A;  4U7B A;  3H3V K;  3P7N A;  2R7D A;  3M8J A;  2MD5 A;  1O57 A;  3F8F A;  2DFI A;  3A2K A;  1YS6 A;  1HKQ A;  4XRF A;  3J7Y J;  5L3F A;  3K4L A;  1H9T A;  1BL0 A;  1YS7 A;  5FD5 A;  1Z77 A;  2P6S A;  2MH2 A;  3GME A;  3ZMS A;  3GFI A;  3DU6 A;  3N05 A;  5GAH J;  4X6A J;  3ELK A;  3S32 A;  2VUM J;  3CES A;  4E7H A;  2MLG A;  2OF7 A;  2VI6 A;  3HGG A;  2Q8K A;  3QQA A;  1X2N A;  4HDU A;  1IXC A;  1OPC A;  5KVR A;  3K69 A;  1LE8 B;  2VXD A;  2DFF A;  2GBY A;  1OCP A;  4IZZ A;  2DOF A;  2FSW A;  2GXG A;  3PJR A;  2BXY A;  3DKX A;  4EEF G;  2VOP A;  4PSX A;  1FIA A;  2FJ1 A;  4S05 A;  4DW6 A;  4XKW A;  3OS0 A;  1D5V A;  4AIJ A;  1FC3 A;  4JOM A;  4N4O B;  1TNT A;  3GFJ A;  3JSO A;  1LFU P;  1J7K A;  5ED4 A;  2LP0 A;  4FE4 A;  4FX4 A;  2WY8 Q;  4AVP A;  2OPT A;  5LGU A;  3C3W A;  3IKV A;  1ZYR F;  4CYC B;  4WXD A;  1YJW I;  1T0F C;  4S04 A;  1VQ6 I;  2I10 A;  3O2P E;  1OJL A;  3AFH A;  3LSH A;  4FAS D;  2LMD A;  3CCU I;  5H6R A;  4ZDP A;  3KYC B;  1JT0 A;  1AKH B;  4RB1 A;  3WHC A;  2HGC A;  2ACJ A;  2VL8 A;  2DK5 A;  3BR3 A;  4KJZ A;  2OQR A;  1ETO A;  1MBH A;  1G8X A;  4YIF A;  4HV5 A;  2PLY A;  2G7H A;  1I1G A;  3HOT A;  2P6T A;  2E1C A;  5C3E J;  1NG7 A;  3OS2 A;  4PJJ A;  4KMU X;  5CLS A;  3LFK A;  1IW7 F;  1NK2 P;  2H6C A;  2L7M P;  3PNT A;  3VYS B;  3K9T A;  3K2A A;  2QQA A;  2FQ3 A;  3HEF A;  3L00 A;  4F93 B;  3M07 A;  3DLA A;  2K5C A;  4I6Z A;  1GDT A;  1X1D A;  3RZD J;  1SD4 A;  1K78 B;  3JSP A;  3RKY A;  1R4M B;  4J19 A;  1S7E A;  2LKP A;  1K4T A;  4Q4Z F;  3HRU A;  3SXY A;  4BXU A;  4A3B J;  2QGU A;  1LVK A;  2XKP A;  3F6V A;  1AA7 A;  3OMY A;  3C1D A;  2NVT J;  3WU1 B;  3V8J A;  4PSW A;  3SEZ A;  2HVR A;  2YX4 A;  3HOW J;  2K9Q A;  1WZ2 A;  5DD8 A;  2IA1 A;  1XGO A;  1Y0N A;  3JCU C;  3LSJ A;  5B3S H;  3K1P A;  4IX7 A;  2IP2 A;  1EF4 A;  2WV1 A;  3QAH A;  3WTV C;  4J00 A;  2XPV A;  3C2B A;  3CUO A;  3IHU A;  2IBD A;  1PYV A;  1Q1H A;  3MKZ A;  1VQK I;  2IS6 A;  2ZME A;  4ZC3 A;  2OTJ I;  1K6O A;  2DFH A;  2CS3 A;  1CQT A;  3CCY A;  4CDG A;  1XDU A;  4RAY A;  2FXA A;  4C2U A;  4AM3 A;  2NYX A;  2CWE A;  2WAQ A;  1LQ1 A;  4GXO A;  2EV0 A;  3K1M A;  2QF7 A;  5ILS A;  5DTD A;  1DPU A;  2NVQ J;  1QBJ A;  2ZJR F;  3S2D J;  4YRV A;  2WAF A;  3OS1 A;  1DQU A;  1EH6 A;  1VQL I;  1XSX A;  2CQN A;  2E34 A;  2DTZ A;  2QM3 A;  3V42 A;  2KIQ A;  4OWR B;  2KIU A;  5IY5 H;  2STT A;  2PMH A;  2A68 F;  2BGC A;  3DBH B;  4QSH A;  4G12 A;  1YHQ I;  1VQ9 I;  2IA0 A;  1QNT A;  3IKT A;  2Z1D A;  3R60 A;  1HOM A;  2ME6 A;  4G7H F;  5IT9 K;  5JR3 A;  3F8B A;  2O5R A;  1HC8 A;  2W00 A;  5J4Y A;  2DAO A;  3KZI C;  1U78 A;  3F0C A;  3VYT B;  3JRF A;  3L2W A;  3BG6 A;  1ZEL A;  2H1K A;  1V54 H;  3FKJ A;  1TWF J;  2BZT A;  3J81 K;  3PO3 J;  1R23 A;  1Z3X A;  4LIU A;  2EA2 A;  1WJA A;  1MH4 A;  4XOT A;  3Q9V A;  1XCV A;  2EFN A;  5IOY A;  1USS A;  1F4K A;  2DA1 A;  4ZH4 F;  2NXN B;  2GA2 A;  4B44 A;  5DCM A;  2F5D A;  2GIZ A;  2JZY A;  1OYW A;  3CLQ A;  4BHP A;  5BPI A;  1SEU A;  1QU3 A;  2X85 A;  2DPU A;  3S1M J;  2FE3 A;  4HA8 A;  4L5I A;  1AOY A;  1LNW A;  1G2H A;  3LOC A;  3IUO A;  4U0V A;  3FHN A;  4M9S A;  4IHV A;  2YS9 A;  4C2M J;  4IHS A;  4BE2 A;  1ETV A;  1Z91 A;  4OMY A;  3ZMT A;  2V1D A;  2X9D A;  3VSK A;  3HL2 A;  4FHT A;  3RPU A;  1NH3 A;  3NAR A;  1VF9 A;  2W4S A;  2H1L A;  2Q0O A;  4G7Z F;  3VB2 A;  2HI3 A;  4XON A;  5CQG A;  2X6O A;  2X48 A;  3HHH A;  2G7U A;  3G6E I;  3FM3 A;  5FKO A;  2R7F A;  2HS5 A;  3OYI A;  1TL8 A;  3L09 A;  4RGX A;  4P9F A;  4ZYA A;  3OWT A;  3CCQ I;  4BHB A;  4A5M A;  4OU0 A;  1LE8 A;  2VN2 A;  3SQN A;  4E70 A;  3F6O A;  5IP6 A;  2RVC A;  5E1Z B;  2DDB A;  4I98 B;  2EJR A;  2WTE A;  3GTK J;  1XD7 A;  1YE9 A;  3M1E A;  1TP4 A;  3GBG A;  4XRS G;  3F23 A;  1Z1D A;  2XSJ C;  3TW7 A;  2BE5 F;  2R5Z B;  1YFH A;  4XID A;  2X6W A;  2EZI A;  1E17 A;  3CUQ C;  2XAH A;  4HX8 A;  1P9Q C;  2YX7 A;  5J1U A;  3OYJ A;  3S16 J;  4CYC A;  3UR3 C;  4ENN A;  3FIS A;  5LRR A;  3WU2 C;  1LJ9 A;  1JJ8 C;  4XLC A;  1XG1 A;  4M3B A;  3GTG J;  2X1D A;  1ZQ3 P;  2L9R A;  1RRJ A;  3ZOB A;  1YW7 A;  3LA3 A;  3CZ6 A;  4A0Z A;  1RES A;  1KA8 A;  4P5O A;  5D5V B;  2J5O A;  4XMY A;  4R1H A;  2RNJ A;  3PM1 A;  3JRI A;  4LG3 A;  5L3C A;  3HOU J;  1OKR A;  5D8L B;  3HKZ N;  1YQA A;  3NWS A;  4I01 A;  1X1B A;  2IGN A;  3GEZ A;  2BOL A;  1YW8 A;  3Q0V A;  4NUB A;  4KIG A;  4MFD A;  5EG0 B;  4QTR A;  1QHG A;  2GXA A;  3FK6 A;  4M72 A;  1VTN C;  3EUA A;  1YTY A;  1VQN I;  1MBJ A;  1K78 A;  2ICW G;  4FCY A;  4BYY A;  2W48 A;  9ANT A;  2JA8 J;  3BDD A;  4PUS A;  3DTE A;  5IOZ A;  1P6R A;  3K4N A;  3O3K A;  4HX4 A;  2KQR A;  2R4G A;  4HNT A;  2LKX A;  1XB4 A;  2A07 F;  5KHD A;  1ZG1 A;  2VT3 A;  1K4S A;  2ELH A;  1E2X A;  2VE9 A;  3ZN1 A;  2WY7 Q;  3G1L A;  1UZC A;  2HR3 A;  3K7A J;  2KMU A;  3WTW C;  1R7J A;  2Z2S B;  3FBI B;  1R1T A;  4XRS A;  1V55 H;  1FBQ A;  1SAN A;  3KPH A;  5FD6 A;  4BAC A;  3F8N A;  2VKE A;  2XGE A;  4ON0 A;  1MD0 A;  1ON2 A;  1WH7 A;  3ULQ B;  1R49 A;  3H5R A;  5ERI A;  3VYR B;  1LDJ A;  3GWZ A;  1RR8 C;  3CCL I;  3CP2 A;  4XL9 A;  5JI6 A;  2ZXW H;  4DZJ A;  3U9G A;  2NOJ B;  5FFZ A;  2HU9 A;  1HW1 A;  1REP C;  2NNN A;  2XRL A;  2CRG A;  1PDN C;  3V7S A;  2E5Z A;  1N75 A;  4YFX F;  4A2U A;  2BYV E;  2O3F A;  3SYT A;  3CCJ I;  2CW8 A;  1WKM A;  3QRF F;  3HDD A;  2FX0 A;  2HZD A;  1SMT A;  1FWZ A;  3GLX A;  2EFO A;  2VQC A;  5DYM A;  5B66 C;  2O6G E;  2VPR A;  1JT6 A;  2LLK A;  2QSG X;  1I6H J;  3ZN0 A;  2GLO A;  3H3Z A;  4IHW A;  4IRG A;  3L7W A;  1G6N A;  1X1P A;  3H9J A;  5K5R A;  1ZLK A;  4RGR A;  2NAZ A;  1S3J A;  3IAS 2;  4HSR A;  2EFP A;  2X1E A;  2ID6 A;  1GHC A;  5J1R A;  4AC0 A;  4L0Y B;  3RIR A;  1LDK B;  3PSF A;  3MFK A;  2PI0 A;  5L3B A;  4W1U A;  3CCV I;  4KIF A;  1OR7 A;  1VI0 A;  2V1U A;  2K9S A;  3SZT A;  5E1X A;  3TDZ C;  3RJP A;  3W2W A;  3OYF A;  4QIW N;  3ECH A;  3H92 A;  4HW0 A;  4CA0 A;  2TRT A;  3ZXS A;  1G59 A;  4G6Q A;  4RLF A;  3JRD A;  2DCE A;  4CCN A;  4CXF A;  2J5P A;  1RC9 A;  2KIF A;  2ZC2 A;  4BS9 A;  5KNL A;  3NAU A;  1R1U A;  4M6X A;  1ZK8 A;  4UB6 C;  3PNY A;  1XS9 A;  3ONQ A;  1Z7L A;  1OYI A;  3DTK A;  1T2K A;  3ABM H;  1I5Z A;  1XCB A;  2X1C A;  2DMN A;  3K1N A;  3A4C A;  4H4K C;  1ZH5 A;  5KAI C;  2I8D A;  3H0D A;  3HJE A;  1UCR A;  3LSG A;  3RKQ A;  1IRZ A;  4P1W A;  2A61 A;  3LL7 A;  3R0J A;  1MZB A;  3OY9 A;  3S14 J;  3L2V A;  4NC8 A;  3H0G J;  3UKG A;  3KP3 A;  2C6Y A;  3KET A;  3MD2 A;  1B4A A;  3IP4 B;  1K83 J;  2FNP A;  4L18 B;  5LLQ A;  1BC8 C;  2ME0 A;  3MWM A;  4Q48 A;  4RAF A;  1X3W B;  3HPG A;  4EJU A;  2FF4 A;  2X6X A;  1XDS A;  2LKS A;  4ZZL A;  1WJE A;  5F64 A;  3E3V A;  3G4S I;  2R5Z A;  2MC3 A;  5HDK A;  4D1Q A;  3M8F A;  3MEX A;  5IYC J;  3R0A A;  2BEO A;  4E7I A;  1W1W E;  5DS9 A;  2HDC A;  1I3Q J;  4UV8 A;  2IXS A;  3WGH A;  3G73 A;  4A6D A;  2E2J J;  1N78 A;  1IG7 A;  2FML A;  1VFC A;  1MKM A;  2E19 A;  3CC4 I;  1VND A;  1XGM A;  2HXO A;  2XKO A;  3OYE A;  4OAY A;  2O7O A;  5IYB J;  2CUE A;  1TQP A;  1PUF B;  2IAI A;  2X4H A;  2XPW A;  3RSN A;  2L2O A;  5M3F J;  1W36 C;  5FLX Z;  4EVI A;  1FYK A;  1QVU A;  2L01 A;  2LG4 A;  1W0U A;  4ZYH A;  1E3P A;  2V9K A;  1P2F A;  3IH3 A;  4KT5 C;  3F3X A;  4KUM A;  3OL4 A;  5FB2 A;  2K7L A;  1U9N A;  2VQL A;  5F04 A;  1AU7 A;  3PFY A;  4QPQ A;  4LFU A;  2CU7 A;  4MLO A;  1KYZ A;  2IA2 A;  2HDD A;  4A3C J;  2FU4 A;  4HNU A;  5EG0 A;  1X19 A;  2QKL B;  1VQM I;  4A3D J;  5BMZ A;  5FLM J;  2WBM A;  2GA1 A;  2EA4 A;  4LK0 F;  2JA7 J;  3DXJ F;  3TOA A;  4BEH A;  1OCR H;  1NG6 A;  4OMZ A;  1R22 A;  5DEQ A;  1FYL A;  2ZME C;  2QSF X;  3BC8 A;  2EIK H;  3QOP A;  2IPQ X;  2EB7 A;  5JLX A;  2XHK A;  1ACI A;  1LFP A;  4XR6 A;  1WCM J;  3T0Y A;  2HOA A;  2M4K A;  2IVM A;  4AID A;  2D1V A;  2BHZ A;  1S72 I;  2AQE A;  1QZE A;  2R7S A;  4N4N B;  2KT0 A;  1C0W A;  3EET A;  2O9L A;  1BR1 A;  2H94 A;  4BH9 A;  3WTY C;  2VBY A;  3HOY J;  1ENH A;  3KYL A;  3DEE A;  2P5L C;  1JUM A;  3ZP5 A;  4DYQ A;  1RNL A;  1DU6 A;  3HHG A;  3MVP A;  2VKH A;  2ZKZ A;  4HV6 A;  3TMO A;  4M6Y A;  2E36 A;  4IJA A;  2JA5 J;  4UVB A;  2HEO A;  5HVQ C;  5F1J A;  3N97 A;  2ZME B;  1ODD A;  1XSD A;  1RUN A;  2IS2 A;  2HZT A;  2DQR A;  4K2E A;  5CPR B;  4HNV A;  3U2R A;  1W36 D;  4M9X A;  1IN6 A;  4D0P A;  1PP7 U;  3SZG A;  3HOS A;  3CF5 F;  1EH8 A;  3K6G A;  2HWV A;  1RIO H;  3S15 J;  4YEL A;  2M2E A;  2HXI A;  3FBN B;  3CDL A;  4RAZ A;  3CCR I;  2DMQ A;  1WPK A;  1Y6I A;  3I54 A;  3JRA A;  3A03 A;  4LG0 B;  2OCE A;  1V3F A;  3E6M A;  3KP6 A;  4KN7 X;  2DYS H;  4IOC F;  1XX5 A;  3HUG B;  2M8G X;  1SFU A;  1T38 A;  3KX2 A;  3BT9 A;  3SFZ A;  2FBI A;  3SHF A;  3BR0 A;  3HRS A;  5EEG A;  2LD5 A;  1E0E A;  2O03 A;  2VBZ A;  4JK1 X;  1BIB A;  1B8I A;  2X0L A;  2DLL A;  1P4W A;  2ECC A;  1T08 B;  2JSP A;  3QWL A;  1XC5 A;  2DBB A;  3U1K A;  1T98 A;  4IOA F;  5E3O A;  2CW0 F;  3CTA A;  4GO1 A;  3L2U A;  2V6E A;  2ZSH B;  4Q5S F;  5CVI A;  3E6D A;  2FBH A;  5IP9 J;  1NHA A;  2IGM A;  4RAG A;  2QEN A;  4EM1 A;  2PJR A;  2XPU A;  2DO7 A;  4LLG F;  1H0M A;  2XAF A;  2E7X A;  3SFI A;  2ISZ A;  5ICF A;  3MMY B;  4B3A A;  1A36 A;  1DUX C;  1ZRC A;  2GOX B;  4PJM A;  3DWL E;  5TGT A;  4HDV A;  2OUM A;  4M3E A;  2W25 A;  2BBY A;  1JHH A;  1P4A A;  1UEL B;  3J7A Y;  2ZNZ A;  3F8M A;  2CUZ A;  4A93 J; 
#chains in the Genus database with same CATH homology
 1ZRD A;  2ESN A;  2EV5 A;  1G3Y A;  3ML6 A;  4O3M A;  1HQC A;  3I64 A;  4MEY F;  1F9N A;  3GUD A;  4XLP F;  4FT8 A;  1SD5 A;  1YIO A;  2HYF A;  4ENK A;  4EGZ A;  4G9Y A;  1ZAO A;  2E1N A;  1SD7 A;  2CFX A;  3ABU A;  3CLO A;  5CVR A;  4UVC A;  4UXN A;  1ZGA A;  2PBI A;  4P9U A;  3VFZ A;  2VOD A;  3P9I A;  5AIP A;  3DPT A;  4B09 A;  1W4M A;  1OMI A;  1KYW A;  4HQM A;  1SAX A;  3MQ0 A;  3W6K B;  4YFK F;  5LGT A;  3WGG A;  4PGH A;  2VT2 A;  4YFN F;  5H20 A;  2W84 A;  3E97 A;  4N0B A;  4UUV A;  5HLI A;  4IVN A;  4RB0 A;  2PEX A;  4AD9 A;  4Z2Y A;  2MBF A;  3TGN A;  4OIR F;  2L4A A;  3ECO A;  3M8E A;  3P9K A;  4JQF A;  3WE2 A;  2O0Y A;  2O8X A;  3HIF A;  3AAF A;  1ZG5 A;  2PN6 A;  2LF8 A;  1BC7 C;  1PP8 F;  3BP8 A;  3TO9 A;  2ZXJ A;  3DFG A;  3MZH A;  1KU7 A;  2DW4 A;  3VOE A;  3GFL A;  3NEU A;  3T5X A;  2UXX A;  3KLO A;  1UHM A;  2XAJ A;  1JHF A;  1W7P B;  3WTU C;  3IWF A;  1SFE A;  5D8K B;  1IF1 A;  5CYV A;  2H6B A;  5ILV A;  3EYY A;  5HDN A;  4BAY A;  1MGT A;  3QPH A;  4EJT A;  1XGN A;  2PJP A;  4LG0 A;  4DQ2 A;  1RI7 A;  2Y0M A;  3HUG A;  1LVA A;  3BPX A;  2MLK A;  2A69 F;  2HOE A;  4G94 A;  4KFC A;  2O61 A;  1KU9 A;  4NB5 A;  4A0X A;  2DK8 A;  3KFW X;  4HOB A;  4UHT A;  4L0Z B;  2OZ6 A;  1ZRF A;  2IT0 A;  2FMY A;  3GYH X;  2PMU A;  4RS8 A;  4ENJ A;  2GAU A;  3E6C C;  1G3S A;  2HKX A;  1O3Q A;  1JE8 A;  3LAJ A;  4ZYD A;  2OA4 A;  2K86 A;  3K2Z A;  3WTT C;  1RUO A;  4WXH A;  2F5C A;  3GO5 A;  4I02 A;  3KZY A;  1Z05 A;  5BOX A;  4EV0 A;  1FBS A;  5FFX A;  5DDG A;  1B59 A;  2XUB A;  5HLH A;  2YR2 A;  1FPQ A;  1QZY A;  1YLF A;  3FXQ A;  3WOD F;  2NNY A;  5DV5 A;  3F8C A;  5FLX K;  4XSX F;  4ZZD A;  4KMF A;  4U0W A;  3K0L A;  3HRT A;  1K79 A;  4KN4 X;  2HQR A;  5J6X A;  3O6B B;  3ZQ7 A;  2F5E A;  3DP7 A;  3JTH A;  5JHU A;  2CQK A;  1WI9 A;  2XAS A;  4LGW A;  1RZ4 A;  3CDH A;  6PAX A;  3P9C A;  1LB2 A;  5HS8 A;  4YII A;  2Z3Y A;  3TQN A;  2W24 A;  3PQJ A;  2XV4 S;  1TQM A;  1SMY F;  1HST A;  1GXQ A;  4ZYG A;  2FNA A;  4M9Z A;  1XMA A;  5HS9 A;  1FP1 D;  1OYY A;  5HS7 A;  2K02 A;  3ZMD A;  5JFR A;  3ISP A;  2LF7 A;  1KQ8 A;  1LDD A;  2R3S A;  4P96 A;  1U5T A;  3EDP A;  3RKW A;  1SFX A;  2CGP A;  2BV6 A;  1QO0 D;  3G3Z A;  4HYE A;  5J8F A;  3IRQ A;  3FWE A;  3BJA A;  2YU3 A;  1BI1 A;  3ZPL A;  1FOK A;  3FXU A;  2YPR A;  2EV6 A;  1W7P A;  4OIN F;  4XBF A;  4I0A A;  4WX9 A;  1FX7 A;  5TRD A;  4Y13 A;  1Z6R A;  3FMR A;  2QYO A;  2VE8 A;  3EUH A;  4CIC A;  1UHW A;  1FT9 A;  4A6E A;  4HF2 A;  1R58 A;  1TBX A;  3ERE D;  3Q9S A;  2QVO A;  3WU0 A;  1TW3 A;  5D6E A;  4HF0 A;  3DKW A;  2QLZ A;  3IL2 A;  2FBK A;  1U2W A;  5JVT A;  3I58 A;  1MDM B;  2P5K A;  4LK1 F;  4IXA A;  4EJO A;  2GZW A;  1KU3 A;  1WRJ A;  2QUF A;  3IWZ A;  1LEB A;  3JTG A;  4CHU A;  5CJ9 A;  1BIA A;  3GVA A;  5E17 F;  5D4S A;  3FMQ A;  3QP5 A;  1AWC A;  2ETH A;  1WSU A;  3ROU A;  3MAJ A;  1BI3 A;  1IN5 A;  2DU9 A;  3R6S A;  3KP7 A;  3LAP A;  3RI4 A;  4RB3 C;  2L02 A;  2JPC A;  1MJA A;  3RKX A;  3V7C A;  3T1B A;  1S8N A;  4PDK A;  4U0Y A;  5LBQ A;  4TV7 A;  2LDU A;  1P92 A;  5HOO A;  2QWW A;  5LGN A;  4NHJ A;  3IRR A;  2K4B A;  4HX7 A;  3R61 A;  5KK1 A;  1O7L A;  3B73 A;  1CGP A;  4LD5 A;  3BY6 A;  2V6C A;  3LST A;  4U88 A;  2VBW A;  3HSR A;  3TDU C;  2A5Y B;  4GGG A;  5ICC A;  1QGP A;  3F72 A;  2UZK A;  1J5Y A;  4DNC A;  1S7O A;  3LA7 A;  2WWY A;  3I59 B;  4U7D A;  1D3Y A;  4HZF A;  5L3E A;  3I71 A;  3TKY A;  1PUE E;  3FX3 A;  2XGX A;  4YG2 F;  2HKO A;  3RPQ A;  4BHC A;  1IN7 A;  3QU3 A;  1IUY A;  3D0S A;  2OBP A;  2MA3 A;  1TW2 A;  3LQQ A;  1EH7 A;  2ZNY A;  3N4M A;  2DPD A;  3J7A O;  2L4M A;  3FMS A;  4IF4 A;  2YSR A;  1YYV A;  2JPB A;  4L9V A;  5D6F A;  1IXS B;  1R00 A;  1U6G A;  3RYR A;  5LEK A;  1W5T A;  5K5O A;  1IAW A;  1QQI A;  2OQG A;  4HBL A;  2HTS A;  2M87 A;  5A2Q Z;  4R79 A;  3M9A A;  1FSE A;  1SD6 A;  4RGS A;  3E6B A;  2NS0 A;  2D45 A;  2KIM A;  2P7C B;  1MJ9 A;  1T6S A;  3CO6 C;  3SZP A;  3GXO A;  2RDP A;  4WWC A;  5EEH A;  1ZRE A;  1MDM A;  3DPL C;  3WGI A;  2FRH A;  3NRV A;  5DD4 A;  3JAM Z;  3BWG A;  2JTV A;  3B02 A;  1FYM A;  3BJ6 A;  1BM9 A;  3KZZ A;  5H6Q A;  1TLH B;  2ZCW A;  1BJA A;  1ZN2 A;  2EK5 A;  4B8X A;  5D5W B;  2LSO A;  3KP2 A;  4ESJ A;  1B9M A;  2STW A;  3BZ6 A;  5D5U B;  3FM5 A;  5F1R A;  5E8G A;  1YW9 A;  2XAG A;  1BI2 A;  5LHI A;  1ZAR A;  4QLC U;  3BRO A;  3RYP A;  4HLX A;  3OV8 A;  5LEJ A;  1H9G A;  4PCQ A;  3W6J B;  1ULY A;  1IN4 A;  5DUI A;  4WK8 F;  2ZO4 A;  1QPM A;  3KP5 A;  2FEZ A;  4A0Y A;  4F7Z A;  1ZGJ A;  5HDG A;  3FHZ A;  2PQ8 A;  1HKT A;  2P5V A;  4O5V A;  2CO5 A;  2V9V A;  2HYG D;  4ESB A;  4GYG A;  2PFB A;  2H09 A;  5L3G A;  5ICE A;  1KQ0 A;  5E8I A;  3C7J A;  4MGR A;  2QQB A;  2XVC A;  1U5T C;  5CVV A;  4WCG A;  1D8J A;  3ZMU A;  2P8T A;  3I59 A;  1J75 A;  3WTS C;  3GZ6 A;  3ABT A;  3D5L A;  1S7A A;  4LB5 A;  2AS5 F;  4PZJ A;  1ZLJ A;  3J80 Z;  5LRS A;  2WC2 A;  5E18 F;  4EJW A;  1U5T B;  5BPD A;  1LEA A;  1R5G A;  3PFI A;  2D2W A;  4CYD A;  2OZU A;  3KCC A;  2Z9O A;  1FSH A;  1K7A A;  2CSO A;  1KGS A;  2M1B A;  4PGG A;  2P7V B;  5DUK A;  4I2O A;  1O3S A;  5LHG A;  3M7G A;  3JW4 A;  2M8E A;  2GQQ A;  4KNY A;  1U8R A;  2E7W A;  2M5W A;  1U3E M;  4LLN A;  3KEQ A;  5HLG A;  4KIC A;  4KA4 A;  2DI3 A;  3S2W A;  4L9T A;  2F5F A;  1STZ A;  2AXL A;  2HFH A;  4GYI A;  2VBX A;  4EJV A;  1W7P D;  3QPT A;  2IRF G;  3GX4 X;  1QZZ A;  4Y17 A;  3KE2 A;  1FNN A;  4A5N A;  3KLN A;  1J59 A;  2M45 A;  2CG4 A;  4IHT A;  3V7R A;  4WF2 A;  2XAQ A;  4KYW A;  1IZ1 A;  3Q5F A;  3HTS B;  3REO A;  3BOQ A;  3KEO A;  1Z7U A;  4AIH A;  3DEU A;  1B1B A;  1IN8 A;  4Q47 A;  2EFW A;  1XGS A;  1UST A;  1S6L A;  5LHH A;  3E5Q A;  1O7F A;  3C18 A;  1WWX A;  4EMS A;  4LMY A;  3KP4 A;  4IRH A;  3E5X A;  4OIO F;  1ON1 A;  2HQN A;  4KDP A;  3LWF A;  3WTX C;  2QBY B;  4M71 A;  2G9W A;  2VOO A;  2L3D A;  1TNS A;  3T8T A;  4RGU A;  1UB9 A;  4OOI A;  1B6A A;  2GIV A;  2DT5 A;  2Q2E A;  2W57 A;  1IRG A;  4R8H A;  2RQP A;  2Y75 A;  1WQ2 A;  1G3W A;  4MTD A;  2B0L A;  3DF8 A;  3E5U A;  1L0O C;  3TOB A;  1IXR C;  5FGM A;  4A12 A;  4XLN F;  4MQV A;  3H3U A;  2COM A;  3MZY A;  4EM0 B;  1W5S A;  2KJB A;  3COA C;  4CGZ A;  1G4D A;  2LNB A;  4EGY A;  2Z33 A;  1F1Z A;  3CJN A;  1O3R A;  1T39 A;  1TQI A;  1D8K A;  5E20 A;  4ZYE A;  3NQO A;  2ZFW A;  4AWX B;  1DDN A;  3CUQ B;  5F6F A;  4MHG A;  3GFM A;  1T0F A;  1R1V A;  2ISY A;  2VC0 A;  1ZHF A;  4I7H A;  1F5T A;  1CF7 B;  4XSZ F;  3FZV A;  2QZ8 A;  5K5Q A;  2K4J A;  2ADU A;  1KU2 A;  2TDX A;  2ZBK A;  4MQ9 F;  1ONV A;  3V4G A;  5A2Q K;  5L3D A;  1HSJ A;  3F21 A;  3MCZ A;  4HF1 A;  4KIB A;  4GCV A;  1HW2 A;  2HTJ A;  4UNO A;  1YG2 A;  2RC4 A;  4BNC A;  4UVA A;  3IC7 A;  4JBA A;  3OOP A;  2EWN A;  5FO5 A;  1MJB A;  3JAM K;  2RGV A;  3LA2 A;  4L5J A;  1FP2 A;  2Y48 A;  2M30 A;  3VOD A;  1EV7 A;  4ESF A;  4OIP F;  4G8X A;  2JT1 A;  3ZMV A;  4I09 A;  2JRT A;  2VC1 A;  1HKS A;  2Z99 A;  1I27 A;  2RN7 A;  2GXB A;  4M74 A;  3V8K A;  1FLI A;  1L3L A;  2UXN A;  2A3S A;  5BS6 A;  1GXP A;  2KRF A;  1X3U A;  3VEP A;  3I53 A;  1S29 A;  1TTY A;  3WE3 A;  5DCF A;  5D4R A;  3HSE A;  4EQQ A;  3EYI A;  3CO7 C;  4I0B A;  4WXC A;  3ZMZ A;  2OD5 A;  2XRN A;  5IT9 Z;  5IT3 A;  1G3T A;  4IRI A;  1R5H A;  5D5X B;  2VON A;  3DQV C;  2EFQ A;  4EM2 A;  3I5U A;  4UV9 A;  2QBY A;  2V1X A;  3R4K A;  3RDI A;  2GWR A;  5AIQ A;  3J81 Z;  4M73 A;  1HBX G;  4MNU A;  3LQR A;  3U1D A;  3HYI A;  2RKH A;  2XIG A;  4IPA A;  1J2X A;  5E1W A;  1P4X A;  2DQL A;  1FBU A;  5J8C A;  3BPV A;  4N9H A;  3BJO A;  2K27 A;  3F22 A;  2PG4 A;  2Z5U A;  2UWM A;  1IRF A;  4ASN A;  1V4R A;  3PQK A;  3QP6 A;  1HW5 A;  2NRA C;  5BQT A;  4MEX F;  4BQA A;  2RV8 A;  2KJC A;  4ENM A;  3J80 K;  4HAM A;  5TJJ A;  2KKO A;  3EQL F;  1HXD A;  2DTR A;  4G6D A;  4LJZ F;  4H0E A;  4L9J A;  1Z9C A;  1A04 A;  1BBY A;  3GZ5 A;  3HSF A;  4Y15 A;  4G7O F;  4RB2 C;  1JGS A;  1XMK A;  4MTE A;  3TO6 A;  3L2C A;  2A6H F;  3CUQ A;  2JSC A;  3FF5 A;  3HTU A;  2V79 A;  3QU6 A;  5K1Y A;  4LB6 B;  1UFM A;  1ZG3 A;  2ZJ2 A;  1KQ9 A;  1CF7 A;  2XRO A;  1GVJ A;  2VXZ A;  3RTR A;  4LLL A;  2H27 A;  4HQE A;  1YO5 C;  1BOA A;  3I0T A;  1BN5 A;  2D1H A;  3GW2 A;  2QQ9 A;  2OU2 A;  1I6X A;  5CVU A;  1XSV A;  3HRM A;  4AIK A;  4ETS A;  1R36 A;  1J0R A;  4CZZ A;  2W85 A;  3I4P A;  1DPR A;  2ESH A;  2F2E A;  4L9N A;  2FOK A;  5ICG A;  4OIQ F;  2CYY A;  2OAZ A;  4HLY A;  2IJL A;  3WG9 A;  1O3T A;  2P4W A;  4NQW A;  5CVJ A;  1DP7 P;  3T8R A;  5ILU A;  4N9I A;  3FXR A;  3DV8 A;  1B9N A;  3V8L A;  1J9I A;  1JXS A;  3L9F A;  1Y0U A;  4P55 A;  4QWQ A;  1FZP B;  2FA5 A;  1I1S A;  3WTZ A;  2MH9 A;  2A6E F;  4O6J A;  5DCM B;  1BI0 A;  1XN7 A;  3GF2 A;  1Z6T A;  4CO8 A;  1FY7 A;  2L54 A;  2WV0 A;  5AON A;  4FX0 A;  2IW5 A;  3TO7 A;  4U7B A;  3P7N A;  2R7D A;  2MD5 A;  1O57 A;  3F8F A;  2DFI A;  1YS6 A;  1HKQ A;  4XRF A;  5L3F A;  1H9T A;  1YS7 A;  5FD5 A;  2P6S A;  2MH2 A;  3ZMS A;  3GFI A;  3ELK A;  2MLG A;  2Q8K A;  4HDU A;  1IXC A;  1OPC A;  5KVR A;  3K69 A;  2FSW A;  2GXG A;  2VOP A;  4S05 A;  1D5V A;  4AIJ A;  1FC3 A;  1TNT A;  3GFJ A;  3JSO A;  1J7K A;  5ED4 A;  4FX4 A;  4AVP A;  5LGU A;  3C3W A;  3IKV A;  1ZYR F;  4WXD A;  4S04 A;  3O2P E;  5H6R A;  4RB1 A;  2HGC A;  2ACJ A;  2DK5 A;  2OQR A;  4YIF A;  4HV5 A;  2PLY A;  2G7H A;  1I1G A;  3HOT A;  2P6T A;  2E1C A;  4KMU X;  5CLS A;  3LFK A;  1IW7 F;  2H6C A;  3K9T A;  2QQA A;  2FQ3 A;  3L00 A;  1K78 B;  1SD4 A;  3JSP A;  3RKY A;  2LKP A;  4Q4Z F;  3HRU A;  3SXY A;  4BXU A;  2XKP A;  3F6V A;  3C1D A;  3WU1 B;  3V8J A;  2YX4 A;  5DD8 A;  2IA1 A;  1XGO A;  3K1P A;  2IP2 A;  3QAH A;  3WTV C;  3CUO A;  3IHU A;  1Q1H A;  2ZME A;  1K6O A;  4CDG A;  1XDU A;  4RAY A;  2FXA A;  2NYX A;  2CWE A;  1LQ1 A;  4GXO A;  2EV0 A;  3K1M A;  5ILS A;  1DPU A;  1QBJ A;  1EH6 A;  1XSX A;  2QM3 A;  2KIU A;  2STT A;  2PMH A;  2A68 F;  2BGC A;  2IA0 A;  1QNT A;  3IKT A;  3R60 A;  4G7H F;  5IT9 K;  5JR3 A;  3F8B A;  2DAO A;  1U78 A;  3J81 K;  1R23 A;  2EA2 A;  3Q9V A;  1XCV A;  2EFN A;  1USS A;  1F4K A;  4ZH4 F;  2GA2 A;  5DCM A;  2F5D A;  2JZY A;  1OYW A;  4BHP A;  5BPI A;  2DPU A;  2FE3 A;  4HA8 A;  4L5I A;  1AOY A;  1LNW A;  4U0V A;  4M9S A;  4IHS A;  1Z91 A;  4OMY A;  3ZMT A;  2V1D A;  3RPU A;  2Q0O A;  4G7Z F;  3VB2 A;  3HHH A;  2G7U A;  3FM3 A;  2R7F A;  2HS5 A;  3L09 A;  4RGX A;  4P9F A;  4BHB A;  4A5M A;  4OU0 A;  2VN2 A;  3SQN A;  4E70 A;  3F6O A;  2RVC A;  5E1Z B;  4I98 B;  2EJR A;  2WTE A;  1XD7 A;  3M1E A;  3F23 A;  1Z1D A;  2BE5 F;  1YFH A;  1E17 A;  3CUQ C;  2XAH A;  4HX8 A;  2YX7 A;  4ENN A;  5LRR A;  1LJ9 A;  1YW7 A;  3LA3 A;  4A0Z A;  1KA8 A;  4P5O A;  5D5V B;  2J5O A;  4R1H A;  2RNJ A;  5L3C A;  1OKR A;  5D8L B;  1YQA A;  4I01 A;  3GEZ A;  1YW8 A;  4KIG A;  4M72 A;  1VTN C;  1YTY A;  1K78 A;  4BYY A;  3BDD A;  1P6R A;  3O3K A;  4HX4 A;  1XB4 A;  2A07 F;  1ZG1 A;  2VT3 A;  2ELH A;  1E2X A;  2VE9 A;  3ZN1 A;  2HR3 A;  3WTW C;  1R7J A;  1R1T A;  1FBQ A;  5FD6 A;  3F8N A;  4ON0 A;  1MD0 A;  1ON2 A;  3ULQ B;  5ERI A;  1LDJ A;  3GWZ A;  5JI6 A;  3U9G A;  5FFZ A;  1HW1 A;  1REP C;  2NNN A;  1PDN C;  3V7S A;  4YFX F;  4A2U A;  2BYV E;  2O3F A;  1WKM A;  3QRF F;  1SMT A;  1FWZ A;  3GLX A;  2EFO A;  5DYM A;  2O6G E;  3ZN0 A;  3H3Z A;  4IRG A;  3L7W A;  1G6N A;  5K5R A;  1ZLK A;  4RGR A;  2NAZ A;  1S3J A;  2EFP A;  1GHC A;  4L0Y B;  3RIR A;  1LDK B;  3MFK A;  2PI0 A;  5L3B A;  4KIF A;  1OR7 A;  2V1U A;  3SZT A;  5E1X A;  3TDZ C;  3RJP A;  3ECH A;  3H92 A;  4HW0 A;  4G6Q A;  4CXF A;  2J5P A;  2KIF A;  1R1U A;  4M6X A;  1OYI A;  1T2K A;  1I5Z A;  1XCB A;  3K1N A;  1ZH5 A;  1UCR A;  2A61 A;  3R0J A;  1MZB A;  3KP3 A;  2C6Y A;  3KET A;  1B4A A;  2FNP A;  4L18 B;  5LLQ A;  1BC8 C;  3MWM A;  4Q48 A;  4EJU A;  2FF4 A;  1XDS A;  4ZZL A;  5F64 A;  3E3V A;  2MC3 A;  5HDK A;  3M8F A;  3MEX A;  3R0A A;  2BEO A;  2HDC A;  4UV8 A;  3WGH A;  3G73 A;  4A6D A;  2FML A;  1MKM A;  1XGM A;  2XKO A;  1TQP A;  2X4H A;  5FLX Z;  4EVI A;  1FYK A;  2L01 A;  4ZYH A;  1P2F A;  4KT5 C;  5FB2 A;  3F3X A;  4KUM A;  2K7L A;  4LFU A;  1KYZ A;  2IA2 A;  2FU4 A;  5BMZ A;  2GA1 A;  2EA4 A;  4LK0 F;  3DXJ F;  3TOA A;  4OMZ A;  1R22 A;  5DEQ A;  1FYL A;  3QOP A;  2IPQ X;  2EB7 A;  2XHK A;  3T0Y A;  2IVM A;  2D1V A;  1C0W A;  3EET A;  2H94 A;  4BH9 A;  3WTY C;  2VBY A;  2P5L C;  3ZP5 A;  1RNL A;  3HHG A;  2ZKZ A;  4HV6 A;  4M6Y A;  4IJA A;  4UVB A;  2HEO A;  5HVQ C;  3N97 A;  2ZME B;  1ODD A;  1XSD A;  1RUN A;  2HZT A;  2DQR A;  4K2E A;  3U2R A;  4M9X A;  1IN6 A;  4D0P A;  1PP7 U;  3HOS A;  1RIO H;  1EH8 A;  2HWV A;  4RAZ A;  3I54 A;  4LG0 B;  1V3F A;  3E6M A;  3KP6 A;  4KN7 X;  1SFU A;  1T38 A;  3SFZ A;  2FBI A;  3SHF A;  3HRS A;  5EEG A;  2O03 A;  2VBZ A;  4JK1 X;  1BIB A;  2X0L A;  2DLL A;  1P4W A;  2DBB A;  1T98 A;  2CW0 F;  3CTA A;  4GO1 A;  4Q5S F;  5CVI A;  3E6D A;  2FBH A;  1NHA A;  2QEN A;  4EM1 A;  2DO7 A;  4LLG F;  1H0M A;  2XAF A;  2E7X A;  2ISZ A;  5ICF A;  1DUX C;  1ZRC A;  4HDV A;  2W25 A;  2BBY A;  1JHH A;  1P4A A;  2ZNZ A;  3F8M A;  4FHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...