4L0YB

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 35
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l0yB00
3B02A 3LAJA 2P5VA 2P8TA 1FP1D 1Z6RA 2FSWA 4HBLA 1I1SA 5L3FA 2HS5A 2MH9A 3GFMA 3RI4A 4RGUA 3KETA 3I59B 4YFKF 1VTNC 2P5KA 1XB4A 2HTJA 2VT2A 4M9XA 3WTYC 4R8HA 2A3SA 2H09A 1TQMA 2C6YA 1U6GA 3WE3A 1HSTA 3ELKA 1MZBA 1IN5A 1QNTA 1I6XA 5BPIA 3LSTA 4HA8A 2F5FA 3GFJA 4LJZF 2R7DA 4R1HA 2W57A 4FHTA 2K7LA 2P7CB 1FX7A 3ZP5A 3ABTA 1QZYA 4HV5A 4FT8A 4HX7A 2A5YB 3EETA 2ZCWA 5D6FA 2XAHA 5HDKA 3HRSA 3H92A 4ON0A 4EM2A 1UHWA 1Z6TA 2ETHA 1HXDA 3W6KB 4BHPA 3BWGA 4N9IA 3FM5A 1QBJA 3L00A 2FMYA 2EB7A 4KN4X 5LBQA 5ED4A 1MKMA 1FLIA 1FZPB 4B8XA 3VODA 5JI6A 4HF2A 3H3ZA 4OIQF 1UB9A 1HKSA 5HS9A 3BY6A 1HBXG 1HQCA 1PP7U 1R1TA 2COMA 3T5XA 2PJPA 5FLXZ 4IJAA 5LEKA 5TJJA 1LDKB 2J5PA 3IKTA 2BYVE 1IN4A 4HX8A 5ILSA 1W5TA 4HAMA 3EQLF 2O61A 1GVJA 2FA5A 2VODA 2HQNA 5DYMA 3IL2A 2MC3A 3SFZA 2Y48A 5LGUA 2EV5A 4M74A 3CLOA 1JE8A 1L0OC 5ERIA 5HVQC 2FOKA 2IT0A 3EYIA 2QVOA 4Q47A 3FHZA 3DPTA 1T0FA 3WTZA 3J7AO 3HSEA 3IC7A 2LDUA 1JGSA 4WWCA 3WGGA 5L3CA 2DQLA 1T39A 1IN7A 2V1UA 3D5LA 4D0PA 1Z7UA 4GCVA 3Q5FA 2KIFA 1S7OA 1B9NA 2DLLA 3ZMTA 1ZRFA 4U7DA 2UXXA 1CF7A 1REPC 5KVRA 3WODF 1J2XA 5LGNA 2OA4A 2EWNA 2Z33A 3R0AA 4JK1X 4LLGF 2E7WA 1EH7A 1UFMA 2PMUA 2RDPA 5DUIA 1DDNA 3M1EA 5LHHA 2FF4A 2DPUA 2KJCA 1R23A 2Z9OA 1BC7C 4P55A 4KA4A 1CGPA 1BC8C 4OMZA 2XUBA 1TQIA 4UVAA 2WTEA 2STTA 5F64A 4G9YA 4DQ2A 3L2CA 3WTVC 4XBFA 1TLHB 3C7JA 2JZYA 1YYVA 3RJPA 1MDMB 5D8LB 3FXQA 2DU9A 3I58A 5K5RA 3W6JB 2FQ3A 1ZLJA 3V8KA 3MEXA 2K27A 3F8BA 3FMSA 1PP8F 1RI7A 1DPRA 1IUYA 2NYXA 4I7HA 1K6OA 4G7OF 2CSOA 1GXPA 3F22A 2L4MA 2IA2A 1J75A 1ZG5A 2R3SA 3FXRA 2LKPA 2HWVA 5ILVA 5HOOA 4RB0A 3JAMK 4M72A 2BBYA 3HSRA 4MHGA 1Q1HA 3D0SA 4Y15A 4OIOF 3V7SA 4ENKA 1XMKA 1P6RA 4YG2F 2RVCA 1CF7B 4PGHA 3ZPLA 4S05A 2JPBA 5EEGA 5D5WB 3E5UA 1Z91A 2D1VA 5IT9Z 3DQVC 4U7BA 1BI0A 1FP2A 4BNCA 5DEQA 2LSOA 2OQRA 1LNWA 3MQ0A 3KZYA 1OKRA 3ZN0A 3DF8A 1D3YA 3F72A 5LRRA 2NS0A 5BOXA 2XHKA 3ISPA 2BE5F 2KIUA 4Z2YA 2QQ9A 4KIFA 1XSXA 1P4AA 3IRRA 1T2KA 5E20A 2Y0MA 1XD7A 1OR7A 3JTGA 1ZG3A 1FOKA 4HQMA 2EJRA 2QQBA 2VT3A 4KNYA 4NQWA 4A0YA 5IT3A 3R0JA 4RGSA 4CZZA 3HRUA 1QPMA 1LQ1A 3WTWC 3DXJF 5LGTA 5DV5A 4HLYA 2DAOA 1MJ9A 2A6EF 1FSHA 1YO5C 2ELHA 4A0ZA 2VN2A 4HZFA 3DV8A 2BEOA 5KK1A 4U0YA 3VEPA 2DT5A 1QGPA 2VBZA 1H0MA 4LD5A 1FNNA 3GWZA 3K1PA 1IZ1A 1IAWA 3F8FA 3KP3A 2WC2A 2FBKA 3MZHA 4YIFA 1YQAA 2G7HA 4IVNA 4CDGA 3QU6A 1KU9A 2YU3A 4RAYA 4ENNA 3HYIA 3MAJA 3JTHA 4XLNF 4LB6B 3FXUA 2D45A 3E6DA 4KT5C 5L3GA 3IHUA 5D5XB 5BPDA 2JPCA 3FX3A 4BHCA 1D8KA 2EK5A 2HGCA 1OMIA 4M71A 3ULQB 1FYLA 4EQQA 1X3UA 5FFZA 2RQPA 3QAHA 5E17F 4I02A 1KQ8A 1KYZA 1H9GA 2RKHA 2EV0A 2O6GE 3F23A 2JSCA 4QWQA 4AIKA 3E6MA 1HW5A 1DUXC 4P9FA 3H3UA 2Z3YA 1BN5A 2XGXA 2EFNA 2PN6A 3I64A 4Y13A 2VC1A 3ML6A 5ICGA 4HDUA 3GZ6A 1IXCA 5ICCA 1U78A 5FLXK 2V9VA 3OOPA 2RV8A 3SZPA 4XRFA 2HEOA 5D4RA 1R58A 1XGOA 5LLQA 2ZNYA 4EM0B 3Q9SA 1LEAA 5H20A 1T38A 4LB5A 2DBBA 4RS8A 4IRGA 3TQNA 2E7XA 3LWFA 2FXAA 2HOEA 2P7VB 3TKYA 1KU3A 5ICFA 1BBYA 4QLCU 4LG0B 2ADUA 5TRDA 1DPUA 2CO5A 5HLGA 2PLYA 4CICA 3O2PE 4TV7A 3ZMDA 4R79A 2V79A 5K5OA 1P4WA 2Q0OA 4UUVA 2WWYA 4ESFA 2HFHA 4WXHA 1XGMA 2BGCA 4MEXF 4UXNA 2GA2A 2JRTA 2W25A 3QU3A 4IXAA 4G7ZF 4WCGA 3REOA 2OU2A 1OYYA 3KLOA 3I5UA 2JT1A 3KEOA 1ON2A 1UHMA 4G8XA 1BI3A 1WI9A 2VE8A 2A6HF 2IVMA 4EV0A 2B0LA 4I0BA 2VC0A 3F8CA 1W4MA 2VXZA 1FC3A 5D4SA 1W7PA 1JHHA 3EUHA 3RPQA 1FYMA 2EFQA 1IXSB 3C1DA 3TOBA 4M9ZA 3RKWA 5FFXA 2QLZA 5L3DA 1UCRA 2EFWA 1V4RA 1TNSA 3I0TA 5DD4A 4IHTA 4PDKA 1U3EM 1F4KA 2IW5A 3WE2A 3WGIA 1U5TC 2TDXA 3HHHA 1SD7A 3BP8A 2HQRA 4WX9A 1IRGA 3M7GA 4A5NA 2DPDA 1BOAA 2O03A 3BOQA 1R1VA 1O57A 1ONVA 3O3KA 4O5VA 1O3QA 3JW4A 3V4GA 2XKPA 5AONA 4I98B 1OPCA 2LF8A 3F8NA 3ROUA 4ZYEA 2NNYA 2ACJA 3HTSB 1BM9A 3VB2A 1J9IA 4XSXF 3RDIA 3P7NA 1ZHFA 5DCMA 1I27A 4LLLA 3WTTC 1U8RA 5E1ZB 2PBIA 1YTYA 4LLNA 1JHFA 5CVJA 2M87A 2CWEA 3JSPA 4BH9A 1J7KA 1XGNA 1BI1A 2DO7A 5IT9K 4NHJA 1WRJA 3I53A 3CUQC 1MD0A 5DUKA 1W7PB 1O7FA 4IRIA 3VFZA 4GYGA 2GIVA 4AD9A 1KYWA 1SMTA 1V3FA 1LDJA 5L3BA 4M73A 1S29A 1XCVA 3IWZA 2P6SA 1HKTA 1OYIA 2H6BA 1QZZA 3WTSC 4ZZLA 3SHFA 4ZYGA 4M6YA 3O6BB 4NB5A 1LDDA 2L3DA 2NRAC 2G9WA 5E8IA 2M1BA 4HX4A 4G6QA 1RZ4A 2DK8A 3BJAA 1I5ZA 3MFKA 3J81Z 2O3FA 2EFOA 4LFUA 4ETSA 1IRFA 3I54A 3DKWA 2VBXA 3HUGA 3GXOA 2UZKA 3GYHX 3LAPA 3QOPA 2IPQX 3GF2A 4L0ZB 1WSUA 1XDUA 1G3TA 1J5YA 1S7AA 2MBFA 3FM3A 1K78A 1GHCA 4WF2A 4KIBA 2ZBKA 4ZH4F 4U0WA 2ISZA 5F6FA 3GX4X 5FD5A 4UVCA 1HSJA 1B4AA 5JFRA 1TW3A 2AS5F 4JQFA 3ZQ7A 3ZMUA 1USTA 3AAFA 1SD5A 2ZNZA 1TNTA 4WXDA 4OU0A 1HW1A 1U5TA 1O3TA 4KUMA 4IF4A 3E5QA 1ULYA 1FPQA 3RIRA 2ZMEA 3T1BA 5BS6A 1XSDA 1IN6A 1Z05A 2F5EA 4AIJA 3EYYA 3GFIA 4IRHA 2FEZA 3E3VA 5CJ9A 3RKYA 4BHBA 2HYGD 1K7AA 5AIQA 2QBYA 2DQRA 3U2RA 3I71A 5J8FA 2HDCA 3M9AA 3E6BA 1ZARA 1SD4A 3R61A 2QUFA 1J0RA 5FD6A 2STWA 2VOPA 3VOEA 5FGMA 1DP7P 2VOOA 4HOBA 1NHAA 3M8FA 1T6SA 2ESNA 4UV8A 3OV8A 4P9UA 2IA0A 3KZZA 3CUQA 2F5CA 1YIOA 4OIPF 1XSVA 1G6NA 1S3JA 2HR3A 4CGZA 3HSFA 3G73A 4MQVA 1D8JA 2IJLA 3GUDA 5FB2A 3FWEA 3PFIA 2YX4A 4CO8A 2EFPA 3CO6C 3GLXA 1U2WA 4HYEA 2ZXJA 4OIRF 3GO5A 2M45A 3HTUA 5F1RA 2FE3A 3HOSA 3JSOA 4CHUA 2CQKA 1P92A 2OZUA 1EH8A 3GEZA 4PCQA 3MWMA 4LK1F 4RB2C 4JBAA 3RTRA 2MA3A 1QO0D 3QRFF 1YW8A 3F8MA 4AIHA 2YPRA 5EEHA 3WG9A 2ZMEB 4WK8F 3NEUA 1WQ2A 4L9JA 4Q48A 3B73A 2VBWA 3K2ZA 4RGRA 1R5GA 4L18B 1B9MA 1W7PD 1KA8A 1EH6A 1F9NA 3I4PA 4KMUX 1R1UA 5K5QA 1RUNA 2PQ8A 4KDPA 2Z99A 5DD8A 2AXLA 3SXYA 3TDZC 1Z1DA 1FBUA 5JVTA 4L0YB 3BROA 1WWXA 4MTDA 2OQGA 4N0BA 2ZFWA 2IRFG 4N9HA 4ENMA 1FT9A 3KP7A 4IPAA 2QQAA 3R60A 3DPLC 2FBIA 1HW2A 4EGZA 1R36A 1SAXA 2OBPA 3ABUA 3M8EA 3TOAA 3T0YA 3Q9VA 5HLHA 1B1BA 1YFHA 5CVUA 4S04A 2DW4A 3U1DA 3F21A 2KJBA 4XSZF 2Q2EA 2ZJ2A 3KLNA 3E6CC 3U9GA 4EJWA 4HLXA 2GXBA 4KYWA 5HDNA 2XAQA 1LVAA 2OAZA 3LA3A 2OZ6A 4A2UA 4RAZA 3EDPA 4L9VA 3CUOA 4AWXB 4G7HF 1XMAA 2GA1A 1B6AA 2E1CA 2CFXA 3BJ6A 2G7UA 4L9TA 3RYPA 2HKOA 4PZJA 2A61A 1SFEA 2PI0A 5D6EA 3RYRA 2M8EA 3J80Z 1J59A 2H94A 1YW7A 5E1XA 3QPTA 4FX4A 3K1MA 3V8JA 1L3LA 1TQPA 3FMRA 1RIOH 1IXRC 4A6EA 2UXNA 3G3ZA 1YS6A 3ZMSA 3KP6A 3KP4A 3IRQA 5J6XA 3CJNA 2ZKZA 1P4XA 3R6SA 3GW2A 1FSEA 2XIGA 3K9TA 4ZYHA 4U0VA 1YW9A 1G3YA 4L5IA 1TTYA 5DDGA 2XV4S 4KN7X 2Y75A 1TBXA 4KIGA 2IP2A 4L9NA 3FZVA 3QP5A 1XCBA 1LB2A 4BQAA 1FYKA 1ZAOA 3FF5A 1ZH5A 2V1DA 3J81K 2O8XA 5HS8A 4EJUA 3HRMA 2CYYA 2FMLA 3P9CA 3F6OA 4EJTA 4I0AA 2VONA 3LQRA 2XROA 4EGYA 3L7WA 1JXSA 1Z9CA 3IWFA 3TGNA 2F5DA 1ZLKA 4G94A 4XLPF 2GAUA 4EJOA 3WTXC 2OD5A 4Q5SF 1W5SA 1TW2A 2W85A 1KQ0A 2GWRA 4LGWA 2EA2A 3HHGA 3KE2A 3P9KA 3GVAA 2GQQA 3S2WA 1QQIA 3ECOA 2J5OA 1BIAA 1ODDA 1R00A 4BYYA 1STZA 2PMHA 4CYDA 4Y17A 2X0LA 1OYWA 1USSA 3K69A 3TO9A 2VE9A 5CLSA 1KU2A 3DFGA 1I1GA 2MD5A 1MDMA 1SFXA 2EV6A 2XAGA 3N4MA 3LQQA 2A68F 3E5XA 1T98A 4GXOA 2H27A 4HF1A 1ZGJA 6PAXA 5CVVA 2LNBA 4P96A 2L4AA 4HF0A 4GO1A 1SD6A 3R4KA 2HKXA 5E18F 1ZG1A 2CG4A 3LA7A 4AVPA 1IN8A 1FWZA 4H0EA 2W84A 2XKOA 3E97A 2Z5UA 1ZRDA 3WU0A 3WU1B 3WTUC 3NQOA 3DEUA 3ECHA 4I01A 1BI2A 2XAFA 4A6DA 3V8LA 2X4HA 3NRVA 2DK5A 1E2XA 2MLGA 4I09A 1LJ9A 2YSRA 2IA1A 4UHTA 2PFBA 3K0LA 2K86A 1FBSA 1K79A 2A69F 1BIBA 2XVCA 4YFXF 2JTVA 4KICA 2GZWA 2NAZA 3QPHA 1F5TA 1ZYRF 1YS7A 4RB1A 1O3RA 2O0YA 5CVIA 1O3SA 5DCFA 2V1XA 3DP7A 3T8TA 5LEJA 2K4BA 3PQKA 4ESJA 3PQJA 2Q8KA 3KFWX 2RN7A 1IF1A 3TDUC 4M9SA 5D5VB 4O3MA 2XRNA 4MEYF 2EA4A 2M5WA 4MTEA 3BDDA 3T8RA 3HRTA 4A12A 4BAYA 4MGRA 2MLKA 3BPXA 3HOTA 2FU4A 5D8KB 3C3WA 3ZMVA 2P5LC 2RNJA 2RGVA 4K2EA 5DCMB 4B09A 4I2OA 2YR2A 2D2WA 4U88A 3RKXA 2F2EA 2QWWA 2FNAA 1YG2A 5CVRA 1A04A 1GXQA 5A2QK 1KGSA 2QENA 5BMZA 2XASA 3CDHA 2KRFA 2WV0A 1G3SA 3HIFA 4PGGA 3COAC 1HKQA 2KKOA 4HV6A 1ZN2A 1ZRCA 2GXGA 2L54A 1AWCA 1EV7A 1MJAA 5H6RA 3LA2A 3V7RA 4EVIA 2H6CA 5HLIA 2W24A 4HW0A 3KP2A 3BPVA 5HS7A 1E17A 4KFCA 4KMFA 5E1WA 3CTAA 1ON1A 4ZZDA 2PEXA 3KP5A 4GYIA 2DTRA 1Y0UA 2HZTA 1K78B 5AIPA 2DFIA 1MGTA 1S8NA 4F7ZA 2E1NA 1RNLA 1O7LA 1RUOA 3ZMZA 5BQTA 1XN7A 3ERED 3SZTA 1WKMA 1YLFA 2CGPA 4M6XA 3J80K 5J8CA 1H9TA 5CYVA 4GGGA 4ENJA 1F1ZA 4LMYA 5E8GA 2YX7A 4L5JA 4A5MA 4CXFA 3L09A 4EJVA 5ICEA 4ASNA 5K1YA 1P2FA 2L01A 1PUEE 1R22A 4HQEA 5ILUA 3C18A 2LF7A 1U5TB 2FRHA 2MH2A 2D1HA 5H6QA 4A0XA 3BJOA 4EMSA 4O6JA 3L9FA 4WXCA 2M30A 4YFNF 2HYFA 4YIIA 3BZ6A 4LG0A 2NNNA 1C0WA 2ISYA 4IHSA 2L02A 2A07F 1XGSA 2KIMA 2QBYB 5D5UB 5A2QZ 4LK0F 3GZ5A 4FX0A 1KQ9A 3P9IA 2V6CA 2DI3A 5LHIA 5HDGA 2HTSA 4OMYA 4OOIA 3WGHA 5FO5A 3IKVA 3I59A 4P5OA 3TO7A 3JAMZ 3F6VA 4HDVA 4UV9A 5JHUA 2BV6A 4DNCA 1S6LA 2QM3A 3CUQB 4MQ9F 1BJAA 4OINF 1IW7F 2ESHA 3MCZA 4UVBA 3V7CA 3F3XA 1AOYA 3QP6A 3K1NA 3TO6A 3KCCA 2P6TA 1B59A 2QZ8A 2FNPA 4ZYDA 1XDSA 5LRSA 4E70A 1PDNC 1SFUA 1FBQA 3ZN1A 2RC4A 4RGXA 4BXUA 1G4DA 2ZO4A 1KU7A 2FBHA 2UWMA 3MZYA 2PG4A 2VBYA 4EM1A 1FY7A 1SMYF 3N97A 1MJBA 4Q4ZF 3FMQA 2P4WA 5LHGA 4RB3C 1D5VA 3KEQA 2CW0F 2K4JA 3CO7C 2K02A 1R5HA 3LFKA 2R7FA 1G3WA 1R7JA 5JR3A 5L3EA 3SQNA 4MNUA 3GFLA 2QYOA 1ZREA 1LEBA 4ESBA 3RPUA 1ZGAA 4G6DA 4UNOA 2XAJA
chains in the Genus database with same CATH superfamily
5CKTA 3G1OA 3I3LA 3B02A 3LAJA 3Q0VA 2WA0A 3S93A 4A3CJ 2P5VA 2P8TA 3CESA 4FCYA 1FP1D 1Z6RA 2FSWA 4HBLA 1I1SA 3D5RC 1BW6A 2A05A 2IAIA 3A03A 3NARA 1TWCJ 5L3FA 3ABMH 4RM2A 1I50J 1JT0A 1ETXA 2HS5A 2XAUA 2MH9A 3Q3SA 3GFMA 3RI4A 4OAZA 4RGUA 2PX9A 3KETA 2VUMJ 3I59B 4YFKF 1VTNC 4DW6A 2P5KA 1XB4A 3J7AY 2HTJA 2VT2A 2M9HA 5FKOA 4M9XA 3WTYC 3ONQA 2E36A 4R8HA 3MKZA 1E3HA 2A3SA 2H09A 2BW3B 2WADA 1TZLA 1TQMA 2C6YA 1U6GA 3WE3A 4X1EA 3K4JA 1XPXA 3ASOH 1FOYA 3GTMJ 2TRTA 2XGEA 1EJ9A 4NC6A 1HSTA 3ELKA 1MZBA 1SANA 1IN5A 1QNTA 3I4NJ 1I6XA 5HLTA 5BPIA 3LSTA 4HA8A 2F5FA 3GFJA 2UV1A 4LJZF 3VYUB 3JRBA 5C44J 2K3FA 2R7DA 2W57A 4R1HA 2LMDA 1ITYA 4FHTA 2K7LA 1JTXA 2GLOA 1D1BA 2EZKA 2P7CB 4F91B 1FX7A 3ZP5A 1B8IA 3ABTA 1QZYA 4HV5A 4FT8A 4IKFA 5E3NA 4GDFA 4HX7A 2A5YB 4PUSA 2LKSA 3EETA 4BXFA 4BACA 2Y0SN 2V4JC 2ZCWA 5D6FA 2KIQA 2XAHA 2LG4A 5HDKA 3HRSA 2KDZA 3S1RJ 4B44A 3H92A 2IGKA 4ON0A 4EM2A 1MMSA 1UHWA 1WGXA 1Z6TA 2ETHA 1HXDA 1RKWA 1SVMA 3W6KB 2M34A 3UR3C 4BHPA 3BWGA 4N9IA 2CW7A 3FM5A 3L00A 4YIRX 1QBJA 3OL4A 5J40A 4ZC3A 4CYCA 2FMYA 4IHXA 4CUGA 1ETQA 1IDZA 2EB7A 4KN4X 5LBQA 5ED4A 1MKMA 5IYCJ 2DMPA 1FLIA 1FZPB 2HXOA 1UG0A 3LMMA 1JGGA 4B8XA 3VODA 5JI6A 2VI6A 3H3ZA 4HF2A 4OIQF 3OYMA 1UB9A 2DMQA 4IX7A 3OWTA 1HKSA 5HS9A 3FXJA 2RNGA 1KONA 3DBHB 4DBQA 1OQYA 3BY6A 1HBXG 2JJ7A 1HQCA 1PP7U 1R1TA 2COMA 3T5XA 2PJPA 4L5EA 4DYRA 5FLXZ 3JRCA 3K70C 4OWRB 4IJAA 5LEKA 4XRSG 5TJJA 1GDTA 3CC4I 1LDKB 2J5PA 1GVDA 2LOOA 2ZMEC 3IKTA 2BYVE 1IN4A 4HX8A 4DYCA 5ILSA 3FBNB 2LD5A 1V5GA 1W5TA 4HAMA 3DPUA 3EQLF 2FQ4A 4PSXA 1YRNA 3X2QH 2O61A 1ZQ3P 4BY1J 1GVJA 2FA5A 2VODA 2HQNA 5DYMA 3DKXA 3IL2A 2E71A 2MC3A 3SFZA 2Y48A 4D7NA 1X1CA 2EILH 5IY5H 5LGUA 3BZCA 2KDOA 2ZJRF 1VI0A 2EV5A 3PIOF 1B72A 4M74A 3CLOA 3BR5A 4FE7A 4UUTA 1JE8A 1L0OC 3K10A 5ERIA 5F0CA 2XF5A 3W2WA 5HVQC 2KRCA 4W1UA 2FOKA 5TISC 2IT0A 3EYIA 2QVOA 4Q47A 3FHZA 3DPTA 3OYBA 2ECBA 4Y4RA 1T0FA 1WH5A 4P1WA 1OR7C 4XMYA 3WTZA 2Y0SA 2LBFB 3J7AO 3HSEA 3IC7A 2LDUA 1JGSA 4WWCA 3WGGA 1OLTA 5L3CA 3FXOA 2DQLA 3TEDA 1JKOC 2EINH 4MFDA 1B8IB 4BBSJ 1Y56A 1CQTA 1T39A 2CV0A 1IN7A 3F0CA 3HGYA 2V1UA 2KMUA 5GAGJ 2XF7A 3D5LA 2IEKA 4D0PA 1Z7UA 4GCVA 3Q5FA 2GOXB 2KIFA 1S7OA 1R4MB 1B9NA 2DLLA 3ZMTA 3BG5A 4M3GA 1ZRFA 4DZPA 4U7DA 3AKZA 2R7XA 2UXXA 4QTRA 4M3FA 1CF7A 1LFPA 1REPC 5KVRA 3WODF 3QYFA 3OS2A 1F43A 1J2XA 2KQRA 2VASA 2CMPA 5LGNA 2EBIA 1W5CC 2OA4A 5F0HA 2EWNA 5EYRA 2Z33A 2DA1A 3BTJA 3C2GA 5EG0A 3R0AA 2KP6A 3AG2H 4JK1X 4LLGF 4XKVA 2MSYA 2E7WA 1EH7A 2DA3A 1UFMA 2PMUA 3Q0WA 2RDPA 3DLLF 3KYCB 5DUIA 1DDNA 3M1EA 5LHHA 2FF4A 2DPUA 3MD2A 3SEZA 2KJCA 1R23A 2OTLI 2Z9OA 3ZQFA 3D5SC 2H1LA 1BC7C 4P55A 3PNTA 5EJCA 4KA4A 1CGPA 1VNDA 2VIXA 1BC8C 3A2KA 1WCMJ 4OMZA 2L2OA 3DBLB 5JVGF 2HYJA 2XUBA 1TQIA 2BY0A 4UVAA 2WTEA 1E3PA 2QSFX 2STTA 1FTZA 4W97A 2JK3A 3C2BA 5F64A 1RETA 4BQOA 2H8WA 4G9YA 4DQ2A 3L2CA 3WTVC 3CF5F 4XBFA 1TLHB 1BL0A 1ZTRA 3C7JA 3ZQQA 1EF4A 3PO3J 2JZYA 1JKQC 1YYVA 3I56I 1YRNB 1E0EA 4PSWA 4ZDOA 3RJPA 2DYSH 1MDMB 5D8LB 3FXQA 2DU9A 3I58A 5K5RA 5C3EJ 3W6JB 5HODA 2FQ3A 1ZLJA 3H35A 3V8KA 1T08B 3MEXA 2CUFA 2K27A 4UUSA 3OR2C 1D1AA 2F6CA 3F8BA 3FMSA 1PP8F 2LTPA 3RQ4A 1DP3A 1Z67A 4IO9F 1RI7A 3CCJI 1DPRA 2VQLA 1X19A 3CCMI 3PFYA 1IUYA 3CDIA 2BXZA 2NYXA 5TGTA 1WJ5A 4YRVA 5J1YA 1YITI 3HEFA 4I7HA 3IH3A 2LH9A 1K6OA 4G7OF 4C2TA 2R4GA 4BQQA 2CSOA 2E34A 2QEXI 2OPTA 1YJWI 2WBMA 1GXPA 1ZR4A 3L1PA 5DM7F 3F22A 3SDBA 2L4MA 2IA2A 1J75A 4XKWA 1ZG5A 1K61A 1FIPA 2R3SA 2IGNA 4RA2A 1JUMA 4B43A 3FXRA 1V54H 5M5XJ 2XC7A 2LKPA 1U9NA 1FJLA 2HWVA 5ILVA 1IRXA 2ZC2A 2VQCA 4RB0A 5HOOA 3HB9A 3JAMK 3JR9A 3FHNA 4B3XA 3ZGKA 1IRZA 4M72A 2M2EA 5GAHJ 1SC7A 5IP7J 3S16J 5CPRB 1OFCX 2BBYA 3HSRA 1H89C 3H0DA 1MMDA 1OCOH 4MHGA 1VQ7I 1Z0XA 1Q1HA 3D0SA 4Y15A 1QHHD 3CCVI 4OIOF 3H5NA 4E7SA 3V7SA 4ENKA 1HLVA 1XMKA 2X85A 1P6RA 4AVZA 4YG2F 2RVCA 1CF7B 1RC9A 3G2BA 4PGHA 3ZPLA 1FEXA 4S05A 4BE1A 1WJFA 2JPBA 5EEGA 5D5WB 3PNVA 1MMNA 3E5UA 2EPFA 3VSKA 1Z91A 2D1VA 5EG0B 5IT9Z 2VPRA 3DQVC 4U7BA 3CJRB 1ETYA 3C2HA 1IDYA 1BI0A 1QVTA 4MIMA 2JUCA 3CLQA 1FP2A 4BNCA 5DEQA 2LSOA 3ZQGA 2OQRA 1LNWA 3MQ0A 3KZYA 1OKRA 3ZN0A 4Y33A 3DF8A 3IH4A 1D3YA 4AYBN 3F72A 5LRRA 3CCLI 2NS0A 1POGA 3ESWB 3M8JA 5BOXA 2XHKA 3ISPA 2XRLA 2Y9YA 2L9NA 2VJIA 2VLAA 2BE5F 5GAEJ 4JYKA 4A3FJ 5DTDA 2KIUA 4Z2YA 3JRAA 2QQ9A 2O5RA 4KIFA 4BJ5C 1XSXA 1IV6A 2PJRB 3PL8A 3EPZA 1P4AA 3IRRA 1T2KA 2WY7Q 3MMYB 3RZDJ 5E20A 2Y0MA 3M3YJ 4NUBA 1XD7A 1OR7A 3DEWA 3JTGA 1ZG3A 2K3PA 1TC3C 2BHZA 1IC8A 2M4KA 4HQMA 3JRHA 2EJRA 3OL3A 2QQBA 2BY3A 2VT3A 4KNYA 4BUPA 2KLOA 4NQWA 4A0YA 5IT3A 1R6RA 3RPUD 3R0JA 2L5QA 2HDWA 4RGSA 4CZZA 3HRUA 1TWAJ 1QPMA 1LQ1A 3FXMA 5EZGA 3HPHA 3WTWC 3IH2A 1A35A 5FRNA 2PMZA 4CH7A 4CSWA 1DU0A 1IO2A 3DXJF 5LGTA 5DV5A 4HLYA 2HPIA 2DAOA 3IUOA 1MJ9A 5B3SH 2A6EF 3GTOJ 2E1MC 1FSHA 2MW8A 1YO5C 2ELHA 3HPGA 4BKXA 4A0ZA 3SEQA 2VN2A 2W1OA 1YE9A 1Y6IA 4HZFA 3DV8A 3OS1A 2CV1A 5B1BH 3S15J 2BEOA 5KK1A 4PJMA 4U0YA 3VEPA 1EKEA 2DT5A 1QGPA 2ID3A 2VBZA 3NWSA 3OYLA 1H0MA 5GTIC 1TWHJ 2CFOA 4M3BA 2X51A 4LD5A 1FNNA 5FLVA 3GWZA 5FRMA 3K1PA 1IZ1A 1IAWA 2JA8J 3KZIC 2OUMA 3LSMA 5F0FA 5KNLA 3F8FA 3KP3A 2WC2A 3WHBA 2FBKA 3MZHA 4D5FA 4YIFA 1YQAA 4HPQA 2G7HA 2KT0A 4IVNA 4CDGA 4C9YA 3QU6A 1KU9A 3BR3A 2YU3A 4A3JJ 4RAYA 4ENNA 1V5EA 2R5YA 3HYIA 4NC8A 4CCNA 3MAJA 3JTHA 2ZXHA 4XLNF 1A6QA 3AL0C 2A6TA 4LB6B 3FXUA 2D45A 3EUAA 3QYEA 1ETOA 3E6DA 2WAQN 4KT5C 2HVRA 3BZKA 2ZJQF 2NOGA 2DDAA 5L3GA 3IHUA 2XPUA 4XNFA 1QHGA 5D5XB 2QA4I 2NXNB 2IS6A 3H5RA 5BPDA 5KHDA 3K2AA 2JPCA 3JRGA 1I3QJ 3FX3A 1R49A 4BHCA 1D8KA 2EK5A 2HGCA 1ZELA 1U9OA 5J47A 2VJJA 1OMIA 4M71A 3ULQB 1FYLA 1VQ5I 4EQQA 1X3UA 5FFZA 2RQPA 3QAHA 5E17F 4I02A 1KQ8A 3BTLA 2ZXWH 4KITB 3CCQI 2CQXA 1KYZA 2M7AA 4D7MA 1H9GA 2RKHA 2IS2A 1Z77A 2EV0A 2ZFUA 3LSJA 2O6GE 3F23A 2JSCA 4QWQA 2I10A 4PFPA 4AIKA 3E6MA 3GTGJ 1HW5A 3VYRB 3J7ZI 2CQNA 2B63J 1DUXC 2V9PA 3K7AJ 4NQWB 4A93J 5FROA 4P9FA 2FUG2 3H3UA 2Z3YA 4A3LJ 1BN5A 2XGXA 4ITVA 2KFDA 2EFNA 2PN6A 2HOSA 2RREA 2WB1N 3I64A 4Y13A 2VC1A 2BHYA 3ML6A 5ICGA 1APLC 4HDUA 1VQ8I 3L2QA 3GZ6A 1IXCA 5ICCA 1U78A 2R7TA 5FLXK 2CQQA 2V9VA 1LFBA 3BG3A 3LL7A 3OOPA 3W3CA 2XGDA 4UY8I 4XONA 2RV8A 3SZPA 5DS9A 4XRFA 2HEOA 2LY9A 3GBGA 5D4RA 1R58A 1XGOA 5LLQA 4BE2A 1UELB 3A0BC 3M1CA 2NVYJ 2M3AA 2ZNYA 4EM0B 3Q9SA 1LEAA 5H20A 3UNGC 3QPSA 4A3KJ 4M6VA 4PJJA 3LFUA 3M07A 5K7HA 2R7VA 1T38A 4LB5A 1OCRH 1S7EA 2DBBA 4RS8A 3HBLA 1Q1VA 4IRGA 3TQNA 3IAS2 2E7XA 3LWFA 2FXAA 2HOEA 2P7VB 3TKYA 5EDNA 2JVGA 2QSHX 5IYDJ 3A02A 3ZR8X 3PNYA 1KU3A 2R7SA 5ICFA 4RBOA 1BBYA 1S72I 4QLCU 4LG0B 1A5JA 2ADUA 2LC2A 1N78A 2CUJA 3LSIA 4Z6YA 4HRIA 2VKHA 5TRDA 1DPUA 2CO5A 5HLGA 2PLYA 3HXLA 4CICA 3PUFA 4A3BJ 2WAQA 4DBRA 3O2PE 4TV7A 2IGOA 3ZMDA 4BDZA 4CA0A 3RQIA 4Y52J 4R79A 2V79A 5K5OA 1P4WA 2Q0OA 5M3FJ 4UUVA 3HOUJ 1SEUA 5C4XJ 3L2UA 2WWYA 4ESFA 2HFHA 4WXHA 1XGMA 2BGCA 4MEXF 2QKMB 2D5VA 4UXNA 2GA2A 2JRTA 2W25A 3QU3A 1R4NB 4IXAA 2HOTA 2EQRA 1A36A 4V2FA 5M5YJ 4G7ZF 2JA2A 4RMNA 4EATA 2W7NA 4WCGA 3REOA 2XDVA 2OU2A 1OYYA 3KLOA 3WU2C 1WZ2A 3FISA 4F3QA 3CP8A 3I5UA 2JT1A 3DU5A 3TL4X 2JA5J 2WY8Q 3KEOA 4AUXA 1ON2A 2CS3A 2LVSA 3GZNB 1UHMA 1FMVA 3KPHA 4G8XA 1BI3A 3DTEA 2WB1A 1WI9A 2VE8A 2A6HF 2IVMA 4XOTA 4EV0A 2B0LA 4I0BA 2VC0A 3F8CA 1YIJI 1W4MA 2OCCH 2VXZA 1P7IA 3S1QJ 1FC3A 1EA3A 5D4SA 1ETKA 1N25A 1W7PA 2VPLA 2JRMA 1JHHA 3OYDA 2O7OA 3EUHA 1VQOI 1RESA 3RPQA 2LK2A 3HC7A 1RR7A 1FYMA 2EFQA 1IXSB 3S3MA 3C1DA 4OAYA 3FKJA 3TOBA 4M9ZA 3RKWA 5FFXA 1XC5A 4QPQA 1ACIA 3S14J 1QVUA 1P7JA 1MNDA 4ZDLA 2R5ZA 1QZEA 2QLZA 5K7FA 5L3DA 1A31A 2X1EA 3Q0UA 1UCRA 2EFWA 1V4RA 1TNSA 3I0TA 5DD4A 3S2HJ 2R7ZJ 4IHTA 2NS8A 4PDKA 1U3EM 3TW7A 1F4KA 2IW5A 3GTQJ 2L7ZA 2H8RA 3WE2A 2HDDA 3WGIA 3CC7I 1U5TC 5DM6F 1NG7A 2Y69H 2TDXA 1X4OA 3HHHA 4IHVA 9ANTA 1SD7A 5KCMA 1O4XA 3BP8A 2HQRA 3LNQA 3ASNH 1ORKA 4WX9A 3M7GA 1W1WE 1IRGA 4CCJA 5H2FC 4A5NA 2DPDA 2HQAA 1BOAA 4C3HJ 2O03A 3KEYA 3BOQA 1R1VA 1O57A 3H5AA 4XRSA 4IEJA 2DJIA 1ONVA 2VB6A 3NAUA 3O3KA 5FJ8J 3CMAI 1MBFA 4O5VA 1O3QA 2COBA 3JW4A 3OSGA 3G4SI 3V4GA 4A3IJ 4BEHA 5EGOA 2XKPA 2K9LA 5B66C 5AONA 2MD0A 3OYJA 1IUFA 4I98B 2LYCA 1WJDA 1OPCA 2LF8A 1AA7A 3F8NA 3ROUA 4ZYEA 1QPIA 2NNYA 1HF0A 2ACJA 3HTSB 1BM9A 1YHQI 2M7BA 2B7EA 3VB2A 1J9IA 4XSXF 3RDIA 2DOFA 3P7NA 1ZHFA 5DCMA 1TP4A 1I27A 4LLLA 1KZHA 3WTTC 2CH0A 3ZQCA 1U8RA 5E1ZB 4B47A 2PBIA 1YTYA 4LLNA 1TT0A 3K6GA 1UG2A 3S1MJ 3K4KA 4J19A 1JHFA 5CVJA 4S0HB 2M87A 2CWEA 3JSPA 4BH9A 2F4MB 1J7KA 1XGNA 1BI1A 2DO7A 3AG1H 5IT9K 3A01A 4NHJA 2M4GA 4ZTJA 2Y9ZA 1MW7A 4HSRA 2EZIA 1WRJA 4BGDA 1I6HJ 1VFCA 3I53A 3BQYA 1MD0A 3CUQC 5DUKA 3D1NI 1GT0C 1W7PB 1O7FA 4IRIA 4LOCA 3VFZA 4GYGA 1UMQA 2GIVA 2OV7A 1S5LC 1X3WB 4AD9A 4IQ4A 1KYWA 1SMTA 1V3FA 1HCRA 1LDJA 2AHQA 5L3BA 4M73A 4BDYA 2V6EA 5LFAA 1IG7A 1S29A 1XCVA 3IWZA 5F1JA 2P6SA 5E3MA 1RR8C 3I55I 2EH3A 1HKTA 3K4LA 4MO7A 1OYIA 3PO2J 2H6BA 3H9GA 3DWLE 2K9QA 2XB5A 1QZZA 2VXDA 3WTSC 1K6YA 3H9JA 4ZZLA 4CYCB 1GUUA 3SHFA 4ZYGA 1G8XA 2HOAA 4M6YA 3O6BB 4NB5A 1E3OC 1LDDA 2L3DA 2NVQJ 2NRAC 1QRYA 2G9WA 4ZYAA 5E8IA 1DGWY 2AQFA 4H4KC 4A3GJ 2M1BA 3JRDA 4HX4A 4BE0A 4A3EJ 1UJ8A 4G6QA 1RZ4A 1X1AA 2R7OA 4F93B 2DK8A 4D9JA 3BJAA 1I5ZA 2AO9A 3VYTB 3MFKA 2IS4A 3J81Z 2O3FA 2EFOA 4LFUA 4ETSA 4HNUA 1IRFA 3I54A 3DKWA 2BZTA 2DCEA 2QF7A 2CJJA 2VBXA 3HUGA 3GXOA 2UZKA 2IGMA 3ZQLA 1JI8A 3GYHX 3LAPA 3QOPA 2V1NA 3DLAA 2W82A 2DMNA 2IPQX 3GF2A 4XN0A 4M3DA 4L0ZB 2WV1A 4C2MJ 1WSUA 1XDUA 2ICWG 3G6EI 1G3TA 4KT6A 1J5YA 1S7AA 2RQQA 2MBFA 2V7FA 2KL4A 3FM3A 1UHSA 1K78A 2WAEA 3QWLA 1VQ9I 1GHCA 2OJED 3IP4B 4WF2A 1MBHA 4KIBA 2JUGA 2ZBKA 1LFUP 2DXIA 4ANJA 5E3LA 4CZCA 1X1PA 4ZH4F 2NVTJ 4U0WA 1PYVA 2ISZA 3LSKA 2LR8A 5GPAA 4AM3A 5F6FA 1IV8A 1HDDC 1YX3A 1YX5A 3CMMA 1X4PA 3GX4X 5FD5A 4UVCA 2HVQA 1HSJA 1B4AA 4DYQA 2DYRH 2E35A 2IBDA 5M3MJ 3H3VK 1UAAA 1YOVB 4E7KA 1B72B 3LOCA 4NC7A 5JFRA 1TW3A 2AS5F 3U21A 1N75A 2ID6A 3DKYA 4JQFA 2ELKA 1XX5A 2AXTC 1Y0NA 2PMZN 4XOPA 3ZQ7A 1MNMC 2DA4A 3ZMUA 1TWGJ 1W36D 2DFEA 1USTA 3AAFA 1SD5A 2ZNZA 4I76A 1X2NA 1TNTA 4WXDA 2MG4A 3BT9A 2ECCA 4OU0A 1HW1A 1U5TA 1O3TA 4KUMA 4KJZA 4XM3A 2ZSHB 3OYKA 2DDBA 1U8BA 4IF4A 2HZDA 2L0KA 3E5QA 4JX5A 1ULYA 1FPQA 4LITA 2YUSA 3RIRA 4CCKA 3A4CA 2DT6A 2ZMEA 3T1BA 5EZHA 5BS6A 1XSDA 3MZ8A 1OCPA 1IN6A 1Z05A 4MLOA 3HKZA 1JTYA 2F5EA 2LP0A 4FTHA 4AIJA 3EYYA 3GFIA 2X48A 4IRHA 2FEZA 4HNTA 3L2RA 3FK7A 2EIJH 1MMAA 3E3VA 5CJ9A 4IHWA 3RKYA 4BHBA 2HYGD 2MABA 2BVLA 3CJTB 3KX2A 5AIQA 1JT6A 1K7AA 5IOZA 1WJBA 2QBYA 2DQRA 3U2RA 2CUEA 2L7KA 4Y7NJ 1X2MA 1S9HA 3F9KA 3I71A 3TMOA 5J8FA 2HDCA 1BOBA 3M9AA 3E6BA 1ZARA 1SD4A 3R61A 4B3AA 1D0ZA 2W48A 2QUFA 1J0RA 5FD6A 2STWA 2VOPA 3QQAA 2A5WA 3VOEA 1WJCA 5FGMA 4BL0B 1DP7P 5B5EC 4LIVA 2VOOA 3RZOJ 3BC8A 4HOBA 2EZLA 1NHAA 2L9RA 3M8FA 1T6SA 2ESNA 4UV8A 3OV8A 1HA8A 4P9UA 2IA0A 5J1RA 3KZZA 3DCFA 3CUQA 2F5CA 3V42A 1YIOA 4OIPF 3BR0A 1XSVA 4Y3OA 1G6NA 1DQUA 1S3JA 2KISA 2HR3A 5C4JJ 4UUSB 4CGZA 1X1BA 3HSFA 4XL9A 1VQNI 2WAFA 2DA5A 4RLQA 3K4MA 2DMTA 3G73A 4MQVA 1D8JA 2IJLA 2XSDC 3BQZA 3GUDA 4DZJA 5FB2A 3FWEA 3PFIA 2YX4A 2L7MP 1XS9A 4CO8A 3HJEA 2EFPA 2E5ZA 3CO6C 3GLXA 1MNEA 4C30A 2VKEA 1U2WA 5CQEA 5E3OA 4HYEA 2ZXJA 4OIRF 3GO5A 2M45A 2R0QC 3HTUA 4UB8C 5F1RA 2FE3A 4E4HA 3HOSA 3JSOA 2V9KA 1NTCA 3ZQIA 4CHUA 2X1CA 2CQKA 1P92A 3EUKL 3CCSI 1W0TA 2LY2A 2OZUA 3FBIB 1EH8A 1Y39A 3GEZA 4PCQA 4XLCA 3MWMA 4LK1F 4RB2C 4LIUA 4JBAA 3RTRA 1AKHA 2MA3A 1QO0D 1V55H 1H8AC 4G6TB 1HOMA 4DJAA 3IAM2 3QRFF 4E7HA 1YW8A 3F8MA 4AIHA 2YPRA 1ZR2A 4HG2A 1JJ6C 5EEHA 3WG9A 4IOCF 2ZMEB 4WK8F 2TCTA 3BG7A 3NEUA 1WQ2A 2L9SA 1Z21A 4L9JA 4ABZA 2QSGX 4Q48A 3B73A 2JVHA 3A1YA 2VBWA 3K2ZA 3CMYA 4RGRA 1R5GA 4L18B 2E2JJ 3GLLA 1B9MA 1W7PD 1KA8A 1EH6A 1F9NA 2BY2A 5JLXA 2HU9A 1Y8RB 3I4PA 3K4NA 4KMUX 1R1UA 5K5QA 1RUNA 3IV5A 2PQ8A 4KDPA 3S2DJ 3OIQA 2Z99A 2KZGA 5DD8A 3ZXSA 2AXLA 3SXYA 2N8GA 3TDZC 3RCOA 3JRFA 1ZGWA 1Z1DA 4AC0A 1FBUA 3SFIA 5JVTA 3BROA 4L0YB 1PJRA 1WWXA 4MTDA 2OQGA 4N0BA 1XMXA 2ZFWA 1SFOJ 2IRFG 5M5WJ 3BR6A 4N9HA 5EF6A 2R7WA 2GBYA 4UB6C 3E0JB 4ENMA 1FT9A 3KP7A 4BS9A 4JX6A 5KAFC 4IPAA 2MYSA 2QQAA 3R60A 4I6ZA 3DPLC 2FBIA 3H1CA 3ABLH 1HW2A 4EGZA 2X6XA 1R36A 2NOJB 2LRDA 4HNVA 1SAXA 2LKXA 2OBPA 1DGRM 2MC4A 3AG4H 3E7LA 3ABUA 3M8EA 3T0YA 3TOAA 3Q9VA 1MBGA 2M0CA 1B1BA 3A0HC 4PJLA 5HLHA 1YFHA 5CVUA 1HC8A 5FKNA 4S04A 2LREA 2Y2ZA 2DW4A 2XB0X 3U1DA 5GPCA 3F21A 4XKBA 2KJBA 4NDLA 2P0WA 4XSZF 2VQGA 4B1RA 1NK2P 2DN0A 1YJ9I 2Q2EA 2ZJ2A 3KLNA 3E6CC 3U9GA 4EJWA 1LKXA 2MGQA 4HLXA 2GXBA 4KYWA 1WPKA 1U0JA 4XICA 4E7LA 2BXYA 5HDNA 4BJTA 2XAQA 3ZCOA 4RM3A 4X6AJ 1LVAA 2ZJPF 3JREA 2OAZA 3LA3A 2ME6A 2OZ6A 4A2UA 4RAZA 1R5ID 3EDPA 4L9VA 3CUOA 4AWXB 2E60A 3OYCA 3E1SA 3MKLA 4G7HF 1XMAA 2GA1A 1B6AA 2E1CA 2CFXA 3BJ6A 2G7UA 3HOWJ 4FISA 4L9TA 3RYPA 2HKOA 4PZJA 3LSRA 2A61A 3BCAA 1SFEA 2PI0A 5D6EA 1VQ4I 3RYRA 2M8EA 3J80Z 1J59A 2H94A 1LUJB 1YW7A 3CQZJ 1R71A 5E1XA 3QPTA 1T0FC 3CF2A 2R5YB 3K1MA 3SJMA 4FX4A 1FTTA 3V8JA 1AHDP 3FKIJ 1L3LA 3MKYB 3BLYA 5IOYA 1TQPA 3MVPA 3FMRA 1F36A 1RIOH 3OSFA 1IXRC 3DU6A 4A6EA 2UXNA 3G3ZA 1YS6A 2KHMA 2W00A 2GXAA 3ZMSA 3KP6A 1ERDA 1D0YA 3KP4A 4E7JA 3IRQA 3CZ6A 4GRIA 5J6XA 3CJNA 2R93J 2ZKZA 1P4XA 3R6SA 3GW2A 1FSEA 1VQMI 2NVUB 3HOYJ 2XIGA 3K9TA 4ZYHA 5CQGA 1WJAA 4U0VA 3OYHA 3OR1C 1YW9A 1SFKA 2GIZA 5FKLA 3SZGA 1G3YA 4L5IA 3DBRB 1TTYA 5DDGA 2XV4S 2Z1DA 4KN7X 4JOMA 1BA5A 2Y75A 3DTIA 1TBXA 3UKGA 4KIGA 2IP2A 2O8KA 4L9NA 4FASD 4D1QA 3FZVA 3QP5A 2E2HJ 1XCBA 2L9VA 1LB2A 4BQAA 3AG3H 1FYKA 2R92J 1ZAOA 2DODA 3FF5A 4XORA 4J01A 1ZH5A 2V1DA 3G1MA 3J81K 2O8XA 1RRJA 5HS8A 4EJUA 2FX0A 3HRMA 3RKQA 2CYYA 2CV2A 2FMLA 4BBRJ 4DIQA 3P9CA 3J7YJ 2X9DA 1MBEA 2LBFA 2I8DA 3F6OA 4EJTA 3ABKH 2Q2EB 3W2VA 3TBIA 1VQ6I 4CCMA 1Z3YA 2Q1ZB 4I0AA 4RAFA 3JRIA 2VONA 1MBKA 4NNJA 4C3IJ 3LQRA 4DGWB 2XROA 2YS9A 4EGYA 3L7WA 1JXSA 1Z9CA 3IWFA 4BY7J 4XK4A 4XQFA 2IXSA 3TGNA 1QU3A 3K4BA 2X6WA 4XLHA 2F5DA 4V19K 1ZLKA 4G94A 4XLPF 2GAUA 3W2AA 2DA7A 2GM4A 2XGCA 4EJOA 3WTXC 2KPMA 2OD5A 3NWTA 4Q5SF 1V5FA 1W5SA 3BG9A 3G1LA 1SVLA 1TW2A 2W85A 2QKLB 1KQ0A 4D5CA 1K4SA 2GWRA 4LGWA 2EA2A 3HHGA 1GV2A 3TP3A 2VJ4A 3KE2A 1XTAA 4B4CA 4BQNA 3P9KA 1JKPC 4M3EA 4XLEA 3GVAA 3BTIA 2XF6A 2OF7A 4ZTFA 3PJRA 1WHUA 2GQQA 2NVXJ 3S2WA 2OTJI 1I3AA 1QQIA 3ECOA 2J5OA 1BIAA 1K83J 1ODDA 1R00A 4PFOA 5F04A 4BYYA 2JN6A 5F08A 1MH4A 1STZA 2ME0A 2PMHA 3H36A 4CYDA 2X6OA 3K70D 4Y17A 2X0LA 2UUZA 3GTLJ 4E7ZA 1OYWA 1USSA 3K69A 1FOWA 3TO9A 1MIJA 2VE9A 5CLSA 1KU2A 3DFGA 1SAUA 2L7FP 2K9SA 2XPVA 3ZRGA 3S1NJ 4N4NB 1I1GA 2MD5A 2E1MB 4F92B 1MDMA 1SFXA 2EV6A 2XAGA 1Z7LA 3N4MA 3LQQA 2A68F 3GTKJ 3E5XA 1T98A 3SDGA 1H88C 4GXOA 1A6IA 2H27A 4HF1A 1WI3A 1ZGJA 2YU9J 4NBQA 6PAXA 5CVVA 2LNBA 2XSJC 4P96A 5IYBJ 3GCMA 2Z16A 2L4AA 3TP0A 4HF0A 4GO1A 1SD6A 4RDUA 3R4KA 2HKXA 5E18F 1ZG1A 3VWBA 1YI2I 1OJLA 2CG4A 3LA7A 4AVPA 1IN8A 3U1KA 4IL6C 1FWZA 4H0EA 2W84A 2XKOA 3E97A 1Y1VJ 3KYDB 3GTJJ 2Z5UA 1ZRDA 3WU0A 3WU1B 3WTUC 3NQOA 3DEUA 3ECHA 3KIOA 4CCOA 3HGGA 4I01A 4I99C 1BI2A 1MSEC 3PSFA 2XAFA 4A6DA 4GFBA 3AL0B 2ELJA 3V8LA 2R7UA 1LPQA 2R5ZB 2X4HA 3NRVA 2DK5A 4II3A 1YJNI 1E2XA 2MLGA 4I09A 1LJ9A 2YSRA 2DA6A 2K9MA 4XRMA 2IA1A 3FK6A 2CW8A 3OYFA 4UHTA 2PFBA 3VPRA 3K0LA 1NH3A 1T56A 2K86A 3CDLA 1FBSA 1K79A 2A69F 3HKZN 2KZVA 1BIBA 4FE4A 2XVCA 4YFXF 3M4OJ 2JTVA 4KICA 2GZWA 4A69C 2NAZA 5B1AH 3QPHA 1F5TA 1DU6A 1ZYRF 2AQEA 2EIMH 1YS7A 1ZK8A 4RB1A 1O3RA 2BY1A 2O0YA 1VF9A 5CVIA 4E6KG 1ENHA 1O3SA 5DCFA 2V1XA 3DP7A 5E79C 2F48A 3T8TA 5LEJA 1P9QC 2K4BA 3HG9A 2M8GX 3PQKA 4ESJA 1Y1WJ 3PQJA 2Y30A 3DTKA 2FJ1A 2Q8KA 3KFWX 2VJ5A 5FKKA 2QGUA 2RN7A 2Z2SB 3AFHA 5F27A 3N05A 4HEA2 3FDYA 1IF1A 3TDUC 4M9SA 3HL2A 4X0GA 3PUBA 4BEHB 5EGOB 2JMWA 1XG1A 5D5VB 4O3MA 2XRNA 5J3LA 3HOZJ 4MEYF 2EA4A 2M5WA 4MTEA 4IQJA 2BOLA 3BDDA 3T8RA 3OMYA 3HRTA 4A12A 4BAYA 4MGRA 2MFZA 2MLKA 3H9QA 2PJRA 3BPXA 3HOTA 2GOMA 2CQ7A 4V2GA 2BVMA 2FU4A 2OCEA 3CP2A 5D8KB 3C3WA 4HSTA 4A3DJ 3ZMVA 4YELA 2P5LC 2RNJA 5GTHC 2RGVA 2JQ7A 4K2EA 5DCMB 1ZKGA 4B09A 1TL8A 2XPWA 4I2OA 2LLKA 2YR2A 2D2WA 4U88A 1G59A 1R9TJ 3RKXA 2F2EA 4CCLA 2QWWA 4DOZA 2FNAA 1MSFC 1W36C 2VKDA 1YG2A 3A01B 5CVRA 2VQHA 1A04A 3PM1A 3BR2A 1I39A 1GXQA 4C2UA 1VQPI 1JUSA 1KGSA 5A2QK 2QENA 2ZB9A 5BMZA 1MH3A 5EEAA 2DJNA 2HXIA 1OCTC 2XASA 4B48A 2FD5A 3LSGA 3CDHA 1PUFA 2KRFA 2WV0A 3I4MJ 3BCBA 3HDDA 1G3SA 2ZXIA 3WG7H 3HIFA 1D0XA 1X1DA 4PGGA 4PJ0C 2G0EA 1BR2A 2E1OA 1SVOA 3CMEI 3COAC 1HKQA 2KKOA 4HV6A 2X1DA 2CRGA 3L2VA 1LVKA 1ZN2A 4AU7A 3OS0A 2X6YA 3OY9A 4F52A 4N4OB 1FOKA 1ZRCA 2R7QA 2GXGA 3VYSB 2L54A 4PJNA 3MKWB 5BNGA 3DEEA 4G12A 3QODA 5FLMJ 1EV7A 1BJZA 1FIAA 3L2WA 1AWCA 1MJAA 5H6RA 3LSPA 1WH7A 3S32A 3LA2A 3V7RA 3QPLA 2V26A 4EVIA 2H6CA 5HLIA 2W24A 5LD2C 1M1EB 4HW0A 3KP2A 3MN2A 3BPVA 5HS7A 3HUGB 1IGNA 1E17A 4KFCA 4XLAA 3BTCA 4KMFA 5E1WA 3RSNA 3CCUI 3HOVJ 4JP0A 1D1CA 3CTAA 3OYAA 1ON1A 1UZCA 1WFXA 2PEXA 3FXKA 4ZZDA 4XIDA 3KP5A 4GYIA 3CCRI 2DOEA 2DTRA 4LG3A 1Y0UA 2HZTA 1PVEA 2DOAA 2F4OB 1K78B 4QPOA 2M0MA 1BR1A 5AIPA 2CUZA 2O9LA 2QCOA 2DFIA 4IZZA 1WVRA 1MGTA 2HQ5A 1S8NA 4XR6A 4F7ZA 3VDXA 2E1NA 1RNLA 3OYNA 1O7LA 4AIDA 1RUOA 3ZMZA 5BQTA 2RAEA 1T95A 1XN7A 1BW5A 3ERED 3SZTA 1TWFJ 1WKMA 1YLFA 2CGPA 3CD6I 3BG6A 4XKCA 4M6XA 3CC2I 4MFEA 3J80K 5J8CA 1H9TA 2CU7A 5CYVA 2EZHA 4GGGA 3JCUC 4ENJA 1F1ZA 4LMYA 4A3MJ 5E8GA 2YX7A 4L5JA 3OYGA 2FOWA 2I5UA 4A5MA 3CCEI 2VL8A 4CXFA 3OIPA 2F4IA 3L09A 1QA6A 1W0UA 4EJVA 5ICEA 3FXLA 3BR1A 3HZJA 4BXXJ 4ASNA 5K1YA 1WJEA 1P2FA 5GP9A 2L01A 1RKTA 3SYTA 1PUEE 1ETWA 1R22A 3P5JA 3S8PA 4HQEA 1G2HA 5ILUA 3C18A 2DMUA 2LF7A 1U5TB 2FRHA 2MH2A 3QOEA 2IS1A 2D1HA 5H6QA 3FIWA 4A0XA 2K40A 1PUFB 2P81A 3BJOA 4EMSA 2HVSA 2K85A 1D5YA 4O6JA 3L9FA 4WXCA 5IPAA 4QSHA 2M30A 4ZDPA 3WHCA 5J1UA 3OOUA 4YFNF 2E5NA 1T33A 4PK4A 3S3OA 2HYFA 4BJ6C 4YIIA 4KISA 4FQGA 3BZ6A 3H0GJ 2F5VA 1X3ZB 1Y8QB 2HNHA 1GV5A 2JA7J 4LG0A 2NNNA 1C0WA 2ISYA 4IHSA 2L02A 2A07F 1XGSA 2EIKH 4XLFA 2KIMA 3EUHC 5IP6A 2QBYB 2JA6J 1LE8A 2R7RA 3B6AA 5D5UB 3PSIA 4XN3A 5A2QZ 4LK0F 2JWTA 4E7IA 3LSHA 3GZ5A 4FX0A 1KQ9A 3P9IA 2V6CA 2DI3A 5JHFA 3CCYA 1HDPA 5J4YA 5LHIA 5HDGA 5HNFA 3OIOA 4ZJZA 1ETVA 2DT7B 2HTSA 4OMYA 4OOIA 3WGHA 5FO5A 4EEFG 3PIPF 4AYBA 5FKMA 3IKVA 3OYEA 3B6CA 2B9SA 1MMGA 1FOXA 2HPMA 1T8IA 3I59A 4P5OA 3TO7A 3JAMZ 3F6VA 4HDVA 4UV9A 5JHUA 2Y31A 2BV6A 2K5CA 4DNCA 5J4VA 1S6LA 2OC6A 2QM3A 2VKVA 5IP9J 2JSPA 3CUQB 4BU2A 4MQ9F 1BJAA 2DA2A 2BW3A 4IOAF 4OINF 1IW7F 2ESHA 4YEJA 1FMWA 3GTPJ 3MCZA 4UVBA 3V7CA 3GMEA 3F3XA 1AOYA 3QP6A 4FETA 3ZOBA 3KYLA 3K1NA 3TO6A 2KRHA 3KCCA 2P6TA 4II2A 1B59A 2QZ8A 2FNPA 2ZSIB 1OISA 4ZYDA 1VZ0A 1XDSA 3K4CA 5LRSA 4C3JJ 2LY1A 4E70A 1PDNC 3S3NA 1SFUA 2E19A 1FBQA 4RAGA 4JX4A 3ZN1A 2RC4A 3I9V2 5GADJ 2DFFA 4RGXA 3S17J 4BXUA 3CJQB 3VSLA 1G4DA 1AU7A 2ZO4A 2DFHA 3OYIA 1KU7A 2FBHA 3ERMA 2UWMA 1GLNA 1BR4A 3MZYA 2H1KA 2PG4A 4F55A 1JKRC 2VBYA 4EM1A 2NS7A 1FY7A 1IJWC 3HOXJ 1VQLI 1NG6A 1AKHB 2HI3A 1SMYF 3N97A 1MJBA 1RPWA 1OCZH 4Q4ZF 4U87A 3FMQA 2P4WA 2LFBA 3W6VA 5LHGA 5JLWA 3HM5A 1TT5B 4RB3C 5K7ZA 1D5VA 1Z3XA 5HNHA 3KEQA 1X58A 2CW0F 3O8HA 2K4JA 3CO7C 1VQKI 2K02A 1R5HA 3LFKA 4J00A 4IHYA 1JJ8C 2K9NA 2QQ8A 3G71I 3ZQHA 3TW6A 5KAIC 1K4TA 2R7FA 3O8GA 1G3WA 1R7JA 5JR3A 5L3EA 3SQNA 1MBJA 2DTZA 2E2IJ 4MNUA 1LE8B 3GFLA 4RLFA 2QYOA 1ZREA 1LEBA 2W4SA 1N77A 1J09A 4ESBA 3RPUA 1ZGAA 4G6DA 4UNOA 1OCCH 4QIWN 1NK3P 1JUPA 2XAJA 3QYBA
chains in the Genus database with same CATH topology
3B02A 3LAJA 2P5VA 2P8TA 1FP1D 1Z6RA 2FSWA 4HBLA 1I1SA 5L3FA 2HS5A 2MH9A 3GFMA 3RI4A 4RGUA 3KETA 3I59B 4YFKF 1VTNC 2P5KA 1XB4A 2HTJA 2VT2A 4M9XA 3WTYC 4R8HA 2A3SA 2H09A 1TQMA 2C6YA 1U6GA 3WE3A 1HSTA 3ELKA 1MZBA 1IN5A 1QNTA 1I6XA 5BPIA 3LSTA 4HA8A 2F5FA 3GFJA 4LJZF 2R7DA 4R1HA 2W57A 4FHTA 2K7LA 2P7CB 1FX7A 3ZP5A 3ABTA 1QZYA 4HV5A 4FT8A 4HX7A 2A5YB 3EETA 2ZCWA 5D6FA 2XAHA 5HDKA 3HRSA 3H92A 4ON0A 4EM2A 1UHWA 1Z6TA 2ETHA 1HXDA 3W6KB 4BHPA 3BWGA 4N9IA 3FM5A 1QBJA 3L00A 2FMYA 2EB7A 4KN4X 5LBQA 5ED4A 1MKMA 1FLIA 1FZPB 4B8XA 3VODA 5JI6A 4HF2A 3H3ZA 4OIQF 1UB9A 1HKSA 5HS9A 3BY6A 1HBXG 1HQCA 1PP7U 1R1TA 2COMA 3T5XA 2PJPA 5FLXZ 4IJAA 5LEKA 5TJJA 1LDKB 2J5PA 3IKTA 2BYVE 1IN4A 4HX8A 5ILSA 1W5TA 4HAMA 3EQLF 2O61A 1GVJA 2FA5A 2VODA 2HQNA 5DYMA 3IL2A 2MC3A 3SFZA 2Y48A 5LGUA 2EV5A 4M74A 3CLOA 1JE8A 1L0OC 5ERIA 5HVQC 2FOKA 2IT0A 3EYIA 2QVOA 4Q47A 3FHZA 3DPTA 1T0FA 3WTZA 3J7AO 3HSEA 3IC7A 2LDUA 1JGSA 4WWCA 3WGGA 5L3CA 2DQLA 1T39A 1IN7A 2V1UA 3D5LA 4D0PA 1Z7UA 4GCVA 3Q5FA 2KIFA 1S7OA 1B9NA 2DLLA 3ZMTA 1ZRFA 4U7DA 2UXXA 1CF7A 1REPC 5KVRA 3WODF 1J2XA 5LGNA 2OA4A 2EWNA 2Z33A 3R0AA 4JK1X 4LLGF 2E7WA 1EH7A 1UFMA 2PMUA 2RDPA 5DUIA 1DDNA 3M1EA 5LHHA 2FF4A 2DPUA 2KJCA 1R23A 2Z9OA 1BC7C 4P55A 4KA4A 1CGPA 1BC8C 4OMZA 2XUBA 1TQIA 4UVAA 2WTEA 2STTA 5F64A 4G9YA 4DQ2A 3L2CA 3WTVC 4XBFA 1TLHB 3C7JA 2JZYA 1YYVA 3RJPA 1MDMB 5D8LB 3FXQA 2DU9A 3I58A 5K5RA 3W6JB 2FQ3A 1ZLJA 3V8KA 3MEXA 2K27A 3F8BA 3FMSA 1PP8F 1RI7A 1DPRA 1IUYA 2NYXA 4I7HA 1K6OA 4G7OF 2CSOA 1GXPA 3F22A 2L4MA 2IA2A 1J75A 1ZG5A 2R3SA 3FXRA 2LKPA 2HWVA 5ILVA 5HOOA 4RB0A 3JAMK 4M72A 2BBYA 3HSRA 4MHGA 1Q1HA 3D0SA 4Y15A 4OIOF 3V7SA 4ENKA 1XMKA 1P6RA 4YG2F 2RVCA 1CF7B 4PGHA 3ZPLA 4S05A 2JPBA 5EEGA 5D5WB 3E5UA 1Z91A 2D1VA 5IT9Z 3DQVC 4U7BA 1BI0A 1FP2A 4BNCA 5DEQA 2LSOA 2OQRA 1LNWA 3MQ0A 3KZYA 1OKRA 3ZN0A 3DF8A 1D3YA 3F72A 5LRRA 2NS0A 5BOXA 2XHKA 3ISPA 2BE5F 2KIUA 4Z2YA 2QQ9A 4KIFA 1XSXA 1P4AA 3IRRA 1T2KA 5E20A 2Y0MA 1XD7A 1OR7A 3JTGA 1ZG3A 1FOKA 4HQMA 2EJRA 2QQBA 2VT3A 4KNYA 4NQWA 4A0YA 5IT3A 3R0JA 4RGSA 4CZZA 3HRUA 1QPMA 1LQ1A 3WTWC 3DXJF 5LGTA 5DV5A 4HLYA 2DAOA 1MJ9A 2A6EF 1FSHA 1YO5C 2ELHA 4A0ZA 2VN2A 4HZFA 3DV8A 2BEOA 5KK1A 4U0YA 3VEPA 2DT5A 1QGPA 2VBZA 1H0MA 4LD5A 1FNNA 3GWZA 3K1PA 1IZ1A 1IAWA 3F8FA 3KP3A 2WC2A 2FBKA 3MZHA 4YIFA 1YQAA 2G7HA 4IVNA 4CDGA 3QU6A 1KU9A 2YU3A 4RAYA 4ENNA 3HYIA 3MAJA 3JTHA 4XLNF 4LB6B 3FXUA 2D45A 3E6DA 4KT5C 5L3GA 3IHUA 5D5XB 5BPDA 2JPCA 3FX3A 4BHCA 1D8KA 2EK5A 2HGCA 1OMIA 4M71A 3ULQB 1FYLA 4EQQA 1X3UA 5FFZA 2RQPA 3QAHA 5E17F 4I02A 1KQ8A 1KYZA 1H9GA 2RKHA 2EV0A 2O6GE 3F23A 2JSCA 4QWQA 4AIKA 3E6MA 1HW5A 1DUXC 4P9FA 3H3UA 2Z3YA 1BN5A 2XGXA 2EFNA 2PN6A 3I64A 4Y13A 2VC1A 3ML6A 5ICGA 4HDUA 3GZ6A 1IXCA 5ICCA 1U78A 5FLXK 2V9VA 3OOPA 2RV8A 3SZPA 4XRFA 2HEOA 5D4RA 1R58A 1XGOA 5LLQA 2ZNYA 4EM0B 3Q9SA 1LEAA 5H20A 1T38A 4LB5A 2DBBA 4RS8A 4IRGA 3TQNA 2E7XA 3LWFA 2FXAA 2HOEA 2P7VB 3TKYA 1KU3A 5ICFA 1BBYA 4QLCU 4LG0B 2ADUA 5TRDA 1DPUA 2CO5A 5HLGA 2PLYA 4CICA 3O2PE 4TV7A 3ZMDA 4R79A 2V79A 5K5OA 1P4WA 2Q0OA 4UUVA 2WWYA 4ESFA 2HFHA 4WXHA 1XGMA 2BGCA 4MEXF 4UXNA 2GA2A 2JRTA 2W25A 3QU3A 4IXAA 4G7ZF 4WCGA 3REOA 2OU2A 1OYYA 3KLOA 3I5UA 2JT1A 3KEOA 1ON2A 1UHMA 4G8XA 1BI3A 1WI9A 2VE8A 2A6HF 2IVMA 4EV0A 2B0LA 4I0BA 2VC0A 3F8CA 1W4MA 2VXZA 1FC3A 5D4SA 1W7PA 1JHHA 3EUHA 3RPQA 1FYMA 2EFQA 1IXSB 3C1DA 3TOBA 4M9ZA 3RKWA 5FFXA 2QLZA 5L3DA 1UCRA 2EFWA 1V4RA 1TNSA 3I0TA 5DD4A 4IHTA 4PDKA 1U3EM 1F4KA 2IW5A 3WE2A 3WGIA 1U5TC 2TDXA 3HHHA 1SD7A 3BP8A 2HQRA 4WX9A 1IRGA 3M7GA 4A5NA 2DPDA 1BOAA 2O03A 3BOQA 1R1VA 1O57A 1ONVA 3O3KA 4O5VA 1O3QA 3JW4A 3V4GA 2XKPA 5AONA 4I98B 1OPCA 2LF8A 3F8NA 3ROUA 4ZYEA 2NNYA 2ACJA 3HTSB 1BM9A 3VB2A 1J9IA 4XSXF 3RDIA 3P7NA 1ZHFA 5DCMA 1I27A 4LLLA 3WTTC 1U8RA 5E1ZB 2PBIA 1YTYA 4LLNA 1JHFA 5CVJA 2M87A 2CWEA 3JSPA 4BH9A 1J7KA 1XGNA 1BI1A 2DO7A 5IT9K 4NHJA 1WRJA 3I53A 3CUQC 1MD0A 5DUKA 1W7PB 1O7FA 4IRIA 3VFZA 4GYGA 2GIVA 4AD9A 1KYWA 1SMTA 1V3FA 1LDJA 5L3BA 4M73A 1S29A 1XCVA 3IWZA 2P6SA 1HKTA 1OYIA 2H6BA 1QZZA 3WTSC 4ZZLA 3SHFA 4ZYGA 4M6YA 3O6BB 4NB5A 1LDDA 2L3DA 2NRAC 2G9WA 5E8IA 2M1BA 4HX4A 4G6QA 1RZ4A 2DK8A 3BJAA 1I5ZA 3MFKA 3J81Z 2O3FA 2EFOA 4LFUA 4ETSA 1IRFA 3I54A 3DKWA 2VBXA 3HUGA 3GXOA 2UZKA 3GYHX 3LAPA 3QOPA 2IPQX 3GF2A 4L0ZB 1WSUA 1XDUA 1G3TA 1J5YA 1S7AA 2MBFA 3FM3A 1K78A 1GHCA 4WF2A 4KIBA 2ZBKA 4ZH4F 4U0WA 2ISZA 5F6FA 3GX4X 5FD5A 4UVCA 1HSJA 1B4AA 5JFRA 1TW3A 2AS5F 4JQFA 3ZQ7A 3ZMUA 1USTA 3AAFA 1SD5A 2ZNZA 1TNTA 4WXDA 4OU0A 1HW1A 1U5TA 1O3TA 4KUMA 4IF4A 3E5QA 1ULYA 1FPQA 3RIRA 2ZMEA 3T1BA 5BS6A 1XSDA 1IN6A 1Z05A 2F5EA 4AIJA 3EYYA 3GFIA 4IRHA 2FEZA 3E3VA 5CJ9A 3RKYA 4BHBA 2HYGD 1K7AA 5AIQA 2QBYA 2DQRA 3U2RA 3I71A 5J8FA 2HDCA 3M9AA 3E6BA 1ZARA 1SD4A 3R61A 2QUFA 1J0RA 5FD6A 2STWA 2VOPA 3VOEA 5FGMA 1DP7P 2VOOA 4HOBA 1NHAA 3M8FA 1T6SA 2ESNA 4UV8A 3OV8A 4P9UA 2IA0A 3KZZA 3CUQA 2F5CA 1YIOA 4OIPF 1XSVA 1G6NA 1S3JA 2HR3A 4CGZA 3HSFA 3G73A 4MQVA 1D8JA 2IJLA 3GUDA 5FB2A 3FWEA 3PFIA 2YX4A 4CO8A 2EFPA 3CO6C 3GLXA 1U2WA 4HYEA 2ZXJA 4OIRF 3GO5A 2M45A 3HTUA 5F1RA 2FE3A 3HOSA 3JSOA 4CHUA 2CQKA 1P92A 2OZUA 1EH8A 3GEZA 4PCQA 3MWMA 4LK1F 4RB2C 4JBAA 3RTRA 2MA3A 1QO0D 3QRFF 1YW8A 3F8MA 4AIHA 2YPRA 5EEHA 3WG9A 2ZMEB 4WK8F 3NEUA 1WQ2A 4L9JA 4Q48A 3B73A 2VBWA 3K2ZA 4RGRA 1R5GA 4L18B 1B9MA 1W7PD 1KA8A 1EH6A 1F9NA 3I4PA 4KMUX 1R1UA 5K5QA 1RUNA 2PQ8A 4KDPA 2Z99A 5DD8A 2AXLA 3SXYA 3TDZC 1Z1DA 1FBUA 5JVTA 4L0YB 3BROA 1WWXA 4MTDA 2OQGA 4N0BA 2ZFWA 2IRFG 4N9HA 4ENMA 1FT9A 3KP7A 4IPAA 2QQAA 3R60A 3DPLC 2FBIA 1HW2A 4EGZA 1R36A 1SAXA 2OBPA 3ABUA 3M8EA 3TOAA 3T0YA 3Q9VA 5HLHA 1B1BA 1YFHA 5CVUA 4S04A 2DW4A 3U1DA 3F21A 2KJBA 4XSZF 2Q2EA 2ZJ2A 3KLNA 3E6CC 3U9GA 4EJWA 4HLXA 2GXBA 4KYWA 5HDNA 2XAQA 1LVAA 2OAZA 3LA3A 2OZ6A 4A2UA 4RAZA 3EDPA 4L9VA 3CUOA 4AWXB 4G7HF 1XMAA 2GA1A 1B6AA 2E1CA 2CFXA 3BJ6A 2G7UA 4L9TA 3RYPA 2HKOA 4PZJA 2A61A 1SFEA 2PI0A 5D6EA 3RYRA 2M8EA 3J80Z 1J59A 2H94A 1YW7A 5E1XA 3QPTA 4FX4A 3K1MA 3V8JA 1L3LA 1TQPA 3FMRA 1RIOH 1IXRC 4A6EA 2UXNA 3G3ZA 1YS6A 3ZMSA 3KP6A 3KP4A 3IRQA 5J6XA 3CJNA 2ZKZA 1P4XA 3R6SA 3GW2A 1FSEA 2XIGA 3K9TA 4ZYHA 4U0VA 1YW9A 1G3YA 4L5IA 1TTYA 5DDGA 2XV4S 4KN7X 2Y75A 1TBXA 4KIGA 2IP2A 4L9NA 3FZVA 3QP5A 1XCBA 1LB2A 4BQAA 1FYKA 1ZAOA 3FF5A 1ZH5A 2V1DA 3J81K 2O8XA 5HS8A 4EJUA 3HRMA 2CYYA 2FMLA 3P9CA 3F6OA 4EJTA 4I0AA 2VONA 3LQRA 2XROA 4EGYA 3L7WA 1JXSA 1Z9CA 3IWFA 3TGNA 2F5DA 1ZLKA 4G94A 4XLPF 2GAUA 4EJOA 3WTXC 2OD5A 4Q5SF 1W5SA 1TW2A 2W85A 1KQ0A 2GWRA 4LGWA 2EA2A 3HHGA 3KE2A 3P9KA 3GVAA 2GQQA 3S2WA 1QQIA 3ECOA 2J5OA 1BIAA 1ODDA 1R00A 4BYYA 1STZA 2PMHA 4CYDA 4Y17A 2X0LA 1OYWA 1USSA 3K69A 3TO9A 2VE9A 5CLSA 1KU2A 3DFGA 1I1GA 2MD5A 1MDMA 1SFXA 2EV6A 2XAGA 3N4MA 3LQQA 2A68F 3E5XA 1T98A 4GXOA 2H27A 4HF1A 1ZGJA 6PAXA 5CVVA 2LNBA 4P96A 2L4AA 4HF0A 4GO1A 1SD6A 3R4KA 2HKXA 5E18F 1ZG1A 2CG4A 3LA7A 4AVPA 1IN8A 1FWZA 4H0EA 2W84A 2XKOA 3E97A 2Z5UA 1ZRDA 3WU0A 3WU1B 3WTUC 3NQOA 3DEUA 3ECHA 4I01A 1BI2A 2XAFA 4A6DA 3V8LA 2X4HA 3NRVA 2DK5A 1E2XA 2MLGA 4I09A 1LJ9A 2YSRA 2IA1A 4UHTA 2PFBA 3K0LA 2K86A 1FBSA 1K79A 2A69F 1BIBA 2XVCA 4YFXF 2JTVA 4KICA 2GZWA 2NAZA 3QPHA 1F5TA 1ZYRF 1YS7A 4RB1A 1O3RA 2O0YA 5CVIA 1O3SA 5DCFA 2V1XA 3DP7A 3T8TA 5LEJA 2K4BA 3PQKA 4ESJA 3PQJA 2Q8KA 3KFWX 2RN7A 1IF1A 3TDUC 4M9SA 5D5VB 4O3MA 2XRNA 4MEYF 2EA4A 2M5WA 4MTEA 3BDDA 3T8RA 3HRTA 4A12A 4BAYA 4MGRA 2MLKA 3BPXA 3HOTA 2FU4A 5D8KB 3C3WA 3ZMVA 2P5LC 2RNJA 2RGVA 4K2EA 5DCMB 4B09A 4I2OA 2YR2A 2D2WA 4U88A 3RKXA 2F2EA 2QWWA 2FNAA 1YG2A 5CVRA 1A04A 1GXQA 5A2QK 1KGSA 2QENA 5BMZA 2XASA 3CDHA 2KRFA 2WV0A 1G3SA 3HIFA 4PGGA 3COAC 1HKQA 2KKOA 4HV6A 1ZN2A 1ZRCA 2GXGA 2L54A 1AWCA 1EV7A 1MJAA 5H6RA 3LA2A 3V7RA 4EVIA 2H6CA 5HLIA 2W24A 4HW0A 3KP2A 3BPVA 5HS7A 1E17A 4KFCA 4KMFA 5E1WA 3CTAA 1ON1A 4ZZDA 2PEXA 3KP5A 4GYIA 2DTRA 1Y0UA 2HZTA 1K78B 5AIPA 2DFIA 1MGTA 1S8NA 4F7ZA 2E1NA 1RNLA 1O7LA 1RUOA 3ZMZA 5BQTA 1XN7A 3ERED 3SZTA 1WKMA 1YLFA 2CGPA 4M6XA 3J80K 5J8CA 1H9TA 5CYVA 4GGGA 4ENJA 1F1ZA 4LMYA 5E8GA 2YX7A 4L5JA 4A5MA 4CXFA 3L09A 4EJVA 5ICEA 4ASNA 5K1YA 1P2FA 2L01A 1PUEE 1R22A 4HQEA 5ILUA 3C18A 2LF7A 1U5TB 2FRHA 2MH2A 2D1HA 5H6QA 4A0XA 3BJOA 4EMSA 4O6JA 3L9FA 4WXCA 2M30A 4YFNF 2HYFA 4YIIA 3BZ6A 4LG0A 2NNNA 1C0WA 2ISYA 4IHSA 2L02A 2A07F 1XGSA 2KIMA 2QBYB 5D5UB 5A2QZ 4LK0F 3GZ5A 4FX0A 1KQ9A 3P9IA 2V6CA 2DI3A 5LHIA 5HDGA 2HTSA 4OMYA 4OOIA 3WGHA 5FO5A 3IKVA 3I59A 4P5OA 3TO7A 3JAMZ 3F6VA 4HDVA 4UV9A 5JHUA 2BV6A 4DNCA 1S6LA 2QM3A 3CUQB 4MQ9F 1BJAA 4OINF 1IW7F 2ESHA 3MCZA 4UVBA 3V7CA 3F3XA 1AOYA 3QP6A 3K1NA 3TO6A 3KCCA 2P6TA 1B59A 2QZ8A 2FNPA 4ZYDA 1XDSA 5LRSA 4E70A 1PDNC 1SFUA 1FBQA 3ZN1A 2RC4A 4RGXA 4BXUA 1G4DA 2ZO4A 1KU7A 2FBHA 2UWMA 3MZYA 2PG4A 2VBYA 4EM1A 1FY7A 1SMYF 3N97A 1MJBA 4Q4ZF 3FMQA 2P4WA 5LHGA 4RB3C 1D5VA 3KEQA 2CW0F 2K4JA 3CO7C 2K02A 1R5HA 3LFKA 2R7FA 1G3WA 1R7JA 5JR3A 5L3EA 3SQNA 4MNUA 3GFLA 2QYOA 1ZREA 1LEBA 4ESBA 3RPUA 1ZGAA 4G6DA 4UNOA 2XAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B02 A;  3LAJ A;  2P5V A;  2P8T A;  1FP1 D;  1Z6R A;  2FSW A;  4HBL A;  1I1S A;  5L3F A;  2HS5 A;  2MH9 A;  3GFM A;  3RI4 A;  4RGU A;  3KET A;  3I59 B;  4YFK F;  1VTN C;  2P5K A;  1XB4 A;  2HTJ A;  2VT2 A;  4M9X A;  3WTY C;  4R8H A;  2A3S A;  2H09 A;  1TQM A;  2C6Y A;  1U6G A;  3WE3 A;  1HST A;  3ELK A;  1MZB A;  1IN5 A;  1QNT A;  1I6X A;  5BPI A;  3LST A;  4HA8 A;  2F5F A;  3GFJ A;  4LJZ F;  2R7D A;  4R1H A;  2W57 A;  4FHT A;  2K7L A;  2P7C B;  1FX7 A;  3ZP5 A;  3ABT A;  1QZY A;  4HV5 A;  4FT8 A;  4HX7 A;  2A5Y B;  3EET A;  2ZCW A;  5D6F A;  2XAH A;  5HDK A;  3HRS A;  3H92 A;  4ON0 A;  4EM2 A;  1UHW A;  1Z6T A;  2ETH A;  1HXD A;  3W6K B;  4BHP A;  3BWG A;  4N9I A;  3FM5 A;  1QBJ A;  3L00 A;  2FMY A;  2EB7 A;  4KN4 X;  5LBQ A;  5ED4 A;  1MKM A;  1FLI A;  1FZP B;  4B8X A;  3VOD A;  5JI6 A;  4HF2 A;  3H3Z A;  4OIQ F;  1UB9 A;  1HKS A;  5HS9 A;  3BY6 A;  1HBX G;  1HQC A;  1PP7 U;  1R1T A;  2COM A;  3T5X A;  2PJP A;  5FLX Z;  4IJA A;  5LEK A;  5TJJ A;  1LDK B;  2J5P A;  3IKT A;  2BYV E;  1IN4 A;  4HX8 A;  5ILS A;  1W5T A;  4HAM A;  3EQL F;  2O61 A;  1GVJ A;  2FA5 A;  2VOD A;  2HQN A;  5DYM A;  3IL2 A;  2MC3 A;  3SFZ A;  2Y48 A;  5LGU A;  2EV5 A;  4M74 A;  3CLO A;  1JE8 A;  1L0O C;  5ERI A;  5HVQ C;  2FOK A;  2IT0 A;  3EYI A;  2QVO A;  4Q47 A;  3FHZ A;  3DPT A;  1T0F A;  3WTZ A;  3J7A O;  3HSE A;  3IC7 A;  2LDU A;  1JGS A;  4WWC A;  3WGG A;  5L3C A;  2DQL A;  1T39 A;  1IN7 A;  2V1U A;  3D5L A;  4D0P A;  1Z7U A;  4GCV A;  3Q5F A;  2KIF A;  1S7O A;  1B9N A;  2DLL A;  3ZMT A;  1ZRF A;  4U7D A;  2UXX A;  1CF7 A;  1REP C;  5KVR A;  3WOD F;  1J2X A;  5LGN A;  2OA4 A;  2EWN A;  2Z33 A;  3R0A A;  4JK1 X;  4LLG F;  2E7W A;  1EH7 A;  1UFM A;  2PMU A;  2RDP A;  5DUI A;  1DDN A;  3M1E A;  5LHH A;  2FF4 A;  2DPU A;  2KJC A;  1R23 A;  2Z9O A;  1BC7 C;  4P55 A;  4KA4 A;  1CGP A;  1BC8 C;  4OMZ A;  2XUB A;  1TQI A;  4UVA A;  2WTE A;  2STT A;  5F64 A;  4G9Y A;  4DQ2 A;  3L2C A;  3WTV C;  4XBF A;  1TLH B;  3C7J A;  2JZY A;  1YYV A;  3RJP A;  1MDM B;  5D8L B;  3FXQ A;  2DU9 A;  3I58 A;  5K5R A;  3W6J B;  2FQ3 A;  1ZLJ A;  3V8K A;  3MEX A;  2K27 A;  3F8B A;  3FMS A;  1PP8 F;  1RI7 A;  1DPR A;  1IUY A;  2NYX A;  4I7H A;  1K6O A;  4G7O F;  2CSO A;  1GXP A;  3F22 A;  2L4M A;  2IA2 A;  1J75 A;  1ZG5 A;  2R3S A;  3FXR A;  2LKP A;  2HWV A;  5ILV A;  5HOO A;  4RB0 A;  3JAM K;  4M72 A;  2BBY A;  3HSR A;  4MHG A;  1Q1H A;  3D0S A;  4Y15 A;  4OIO F;  3V7S A;  4ENK A;  1XMK A;  1P6R A;  4YG2 F;  2RVC A;  1CF7 B;  4PGH A;  3ZPL A;  4S05 A;  2JPB A;  5EEG A;  5D5W B;  3E5U A;  1Z91 A;  2D1V A;  5IT9 Z;  3DQV C;  4U7B A;  1BI0 A;  1FP2 A;  4BNC A;  5DEQ A;  2LSO A;  2OQR A;  1LNW A;  3MQ0 A;  3KZY A;  1OKR A;  3ZN0 A;  3DF8 A;  1D3Y A;  3F72 A;  5LRR A;  2NS0 A;  5BOX A;  2XHK A;  3ISP A;  2BE5 F;  2KIU A;  4Z2Y A;  2QQ9 A;  4KIF A;  1XSX A;  1P4A A;  3IRR A;  1T2K A;  5E20 A;  2Y0M A;  1XD7 A;  1OR7 A;  3JTG A;  1ZG3 A;  1FOK A;  4HQM A;  2EJR A;  2QQB A;  2VT3 A;  4KNY A;  4NQW A;  4A0Y A;  5IT3 A;  3R0J A;  4RGS A;  4CZZ A;  3HRU A;  1QPM A;  1LQ1 A;  3WTW C;  3DXJ F;  5LGT A;  5DV5 A;  4HLY A;  2DAO A;  1MJ9 A;  2A6E F;  1FSH A;  1YO5 C;  2ELH A;  4A0Z A;  2VN2 A;  4HZF A;  3DV8 A;  2BEO A;  5KK1 A;  4U0Y A;  3VEP A;  2DT5 A;  1QGP A;  2VBZ A;  1H0M A;  4LD5 A;  1FNN A;  3GWZ A;  3K1P A;  1IZ1 A;  1IAW A;  3F8F A;  3KP3 A;  2WC2 A;  2FBK A;  3MZH A;  4YIF A;  1YQA A;  2G7H A;  4IVN A;  4CDG A;  3QU6 A;  1KU9 A;  2YU3 A;  4RAY A;  4ENN A;  3HYI A;  3MAJ A;  3JTH A;  4XLN F;  4LB6 B;  3FXU A;  2D45 A;  3E6D A;  4KT5 C;  5L3G A;  3IHU A;  5D5X B;  5BPD A;  2JPC A;  3FX3 A;  4BHC A;  1D8K A;  2EK5 A;  2HGC A;  1OMI A;  4M71 A;  3ULQ B;  1FYL A;  4EQQ A;  1X3U A;  5FFZ A;  2RQP A;  3QAH A;  5E17 F;  4I02 A;  1KQ8 A;  1KYZ A;  1H9G A;  2RKH A;  2EV0 A;  2O6G E;  3F23 A;  2JSC A;  4QWQ A;  4AIK A;  3E6M A;  1HW5 A;  1DUX C;  4P9F A;  3H3U A;  2Z3Y A;  1BN5 A;  2XGX A;  2EFN A;  2PN6 A;  3I64 A;  4Y13 A;  2VC1 A;  3ML6 A;  5ICG A;  4HDU A;  3GZ6 A;  1IXC A;  5ICC A;  1U78 A;  5FLX K;  2V9V A;  3OOP A;  2RV8 A;  3SZP A;  4XRF A;  2HEO A;  5D4R A;  1R58 A;  1XGO A;  5LLQ A;  2ZNY A;  4EM0 B;  3Q9S A;  1LEA A;  5H20 A;  1T38 A;  4LB5 A;  2DBB A;  4RS8 A;  4IRG A;  3TQN A;  2E7X A;  3LWF A;  2FXA A;  2HOE A;  2P7V B;  3TKY A;  1KU3 A;  5ICF A;  1BBY A;  4QLC U;  4LG0 B;  2ADU A;  5TRD A;  1DPU A;  2CO5 A;  5HLG A;  2PLY A;  4CIC A;  3O2P E;  4TV7 A;  3ZMD A;  4R79 A;  2V79 A;  5K5O A;  1P4W A;  2Q0O A;  4UUV A;  2WWY A;  4ESF A;  2HFH A;  4WXH A;  1XGM A;  2BGC A;  4MEX F;  4UXN A;  2GA2 A;  2JRT A;  2W25 A;  3QU3 A;  4IXA A;  4G7Z F;  4WCG A;  3REO A;  2OU2 A;  1OYY A;  3KLO A;  3I5U A;  2JT1 A;  3KEO A;  1ON2 A;  1UHM A;  4G8X A;  1BI3 A;  1WI9 A;  2VE8 A;  2A6H F;  2IVM A;  4EV0 A;  2B0L A;  4I0B A;  2VC0 A;  3F8C A;  1W4M A;  2VXZ A;  1FC3 A;  5D4S A;  1W7P A;  1JHH A;  3EUH A;  3RPQ A;  1FYM A;  2EFQ A;  1IXS B;  3C1D A;  3TOB A;  4M9Z A;  3RKW A;  5FFX A;  2QLZ A;  5L3D A;  1UCR A;  2EFW A;  1V4R A;  1TNS A;  3I0T A;  5DD4 A;  4IHT A;  4PDK A;  1U3E M;  1F4K A;  2IW5 A;  3WE2 A;  3WGI A;  1U5T C;  2TDX A;  3HHH A;  1SD7 A;  3BP8 A;  2HQR A;  4WX9 A;  1IRG A;  3M7G A;  4A5N A;  2DPD A;  1BOA A;  2O03 A;  3BOQ A;  1R1V A;  1O57 A;  1ONV A;  3O3K A;  4O5V A;  1O3Q A;  3JW4 A;  3V4G A;  2XKP A;  5AON A;  4I98 B;  1OPC A;  2LF8 A;  3F8N A;  3ROU A;  4ZYE A;  2NNY A;  2ACJ A;  3HTS B;  1BM9 A;  3VB2 A;  1J9I A;  4XSX F;  3RDI A;  3P7N A;  1ZHF A;  5DCM A;  1I27 A;  4LLL A;  3WTT C;  1U8R A;  5E1Z B;  2PBI A;  1YTY A;  4LLN A;  1JHF A;  5CVJ A;  2M87 A;  2CWE A;  3JSP A;  4BH9 A;  1J7K A;  1XGN A;  1BI1 A;  2DO7 A;  5IT9 K;  4NHJ A;  1WRJ A;  3I53 A;  3CUQ C;  1MD0 A;  5DUK A;  1W7P B;  1O7F A;  4IRI A;  3VFZ A;  4GYG A;  2GIV A;  4AD9 A;  1KYW A;  1SMT A;  1V3F A;  1LDJ A;  5L3B A;  4M73 A;  1S29 A;  1XCV A;  3IWZ A;  2P6S A;  1HKT A;  1OYI A;  2H6B A;  1QZZ A;  3WTS C;  4ZZL A;  3SHF A;  4ZYG A;  4M6Y A;  3O6B B;  4NB5 A;  1LDD A;  2L3D A;  2NRA C;  2G9W A;  5E8I A;  2M1B A;  4HX4 A;  4G6Q A;  1RZ4 A;  2DK8 A;  3BJA A;  1I5Z A;  3MFK A;  3J81 Z;  2O3F A;  2EFO A;  4LFU A;  4ETS A;  1IRF A;  3I54 A;  3DKW A;  2VBX A;  3HUG A;  3GXO A;  2UZK A;  3GYH X;  3LAP A;  3QOP A;  2IPQ X;  3GF2 A;  4L0Z B;  1WSU A;  1XDU A;  1G3T A;  1J5Y A;  1S7A A;  2MBF A;  3FM3 A;  1K78 A;  1GHC A;  4WF2 A;  4KIB A;  2ZBK A;  4ZH4 F;  4U0W A;  2ISZ A;  5F6F A;  3GX4 X;  5FD5 A;  4UVC A;  1HSJ A;  1B4A A;  5JFR A;  1TW3 A;  2AS5 F;  4JQF A;  3ZQ7 A;  3ZMU A;  1UST A;  3AAF A;  1SD5 A;  2ZNZ A;  1TNT A;  4WXD A;  4OU0 A;  1HW1 A;  1U5T A;  1O3T A;  4KUM A;  4IF4 A;  3E5Q A;  1ULY A;  1FPQ A;  3RIR A;  2ZME A;  3T1B A;  5BS6 A;  1XSD A;  1IN6 A;  1Z05 A;  2F5E A;  4AIJ A;  3EYY A;  3GFI A;  4IRH A;  2FEZ A;  3E3V A;  5CJ9 A;  3RKY A;  4BHB A;  2HYG D;  1K7A A;  5AIQ A;  2QBY A;  2DQR A;  3U2R A;  3I71 A;  5J8F A;  2HDC A;  3M9A A;  3E6B A;  1ZAR A;  1SD4 A;  3R61 A;  2QUF A;  1J0R A;  5FD6 A;  2STW A;  2VOP A;  3VOE A;  5FGM A;  1DP7 P;  2VOO A;  4HOB A;  1NHA A;  3M8F A;  1T6S A;  2ESN A;  4UV8 A;  3OV8 A;  4P9U A;  2IA0 A;  3KZZ A;  3CUQ A;  2F5C A;  1YIO A;  4OIP F;  1XSV A;  1G6N A;  1S3J A;  2HR3 A;  4CGZ A;  3HSF A;  3G73 A;  4MQV A;  1D8J A;  2IJL A;  3GUD A;  5FB2 A;  3FWE A;  3PFI A;  2YX4 A;  4CO8 A;  2EFP A;  3CO6 C;  3GLX A;  1U2W A;  4HYE A;  2ZXJ A;  4OIR F;  3GO5 A;  2M45 A;  3HTU A;  5F1R A;  2FE3 A;  3HOS A;  3JSO A;  4CHU A;  2CQK A;  1P92 A;  2OZU A;  1EH8 A;  3GEZ A;  4PCQ A;  3MWM A;  4LK1 F;  4RB2 C;  4JBA A;  3RTR A;  2MA3 A;  1QO0 D;  3QRF F;  1YW8 A;  3F8M A;  4AIH A;  2YPR A;  5EEH A;  3WG9 A;  2ZME B;  4WK8 F;  3NEU A;  1WQ2 A;  4L9J A;  4Q48 A;  3B73 A;  2VBW A;  3K2Z A;  4RGR A;  1R5G A;  4L18 B;  1B9M A;  1W7P D;  1KA8 A;  1EH6 A;  1F9N A;  3I4P A;  4KMU X;  1R1U A;  5K5Q A;  1RUN A;  2PQ8 A;  4KDP A;  2Z99 A;  5DD8 A;  2AXL A;  3SXY A;  3TDZ C;  1Z1D A;  1FBU A;  5JVT A;  4L0Y B;  3BRO A;  1WWX A;  4MTD A;  2OQG A;  4N0B A;  2ZFW A;  2IRF G;  4N9H A;  4ENM A;  1FT9 A;  3KP7 A;  4IPA A;  2QQA A;  3R60 A;  3DPL C;  2FBI A;  1HW2 A;  4EGZ A;  1R36 A;  1SAX A;  2OBP A;  3ABU A;  3M8E A;  3TOA A;  3T0Y A;  3Q9V A;  5HLH A;  1B1B A;  1YFH A;  5CVU A;  4S04 A;  2DW4 A;  3U1D A;  3F21 A;  2KJB A;  4XSZ F;  2Q2E A;  2ZJ2 A;  3KLN A;  3E6C C;  3U9G A;  4EJW A;  4HLX A;  2GXB A;  4KYW A;  5HDN A;  2XAQ A;  1LVA A;  2OAZ A;  3LA3 A;  2OZ6 A;  4A2U A;  4RAZ A;  3EDP A;  4L9V A;  3CUO A;  4AWX B;  4G7H F;  1XMA A;  2GA1 A;  1B6A A;  2E1C A;  2CFX A;  3BJ6 A;  2G7U A;  4L9T A;  3RYP A;  2HKO A;  4PZJ A;  2A61 A;  1SFE A;  2PI0 A;  5D6E A;  3RYR A;  2M8E A;  3J80 Z;  1J59 A;  2H94 A;  1YW7 A;  5E1X A;  3QPT A;  4FX4 A;  3K1M A;  3V8J A;  1L3L A;  1TQP A;  3FMR A;  1RIO H;  1IXR C;  4A6E A;  2UXN A;  3G3Z A;  1YS6 A;  3ZMS A;  3KP6 A;  3KP4 A;  3IRQ A;  5J6X A;  3CJN A;  2ZKZ A;  1P4X A;  3R6S A;  3GW2 A;  1FSE A;  2XIG A;  3K9T A;  4ZYH A;  4U0V A;  1YW9 A;  1G3Y A;  4L5I A;  1TTY A;  5DDG A;  2XV4 S;  4KN7 X;  2Y75 A;  1TBX A;  4KIG A;  2IP2 A;  4L9N A;  3FZV A;  3QP5 A;  1XCB A;  1LB2 A;  4BQA A;  1FYK A;  1ZAO A;  3FF5 A;  1ZH5 A;  2V1D A;  3J81 K;  2O8X A;  5HS8 A;  4EJU A;  3HRM A;  2CYY A;  2FML A;  3P9C A;  3F6O A;  4EJT A;  4I0A A;  2VON A;  3LQR A;  2XRO A;  4EGY A;  3L7W A;  1JXS A;  1Z9C A;  3IWF A;  3TGN A;  2F5D A;  1ZLK A;  4G94 A;  4XLP F;  2GAU A;  4EJO A;  3WTX C;  2OD5 A;  4Q5S F;  1W5S A;  1TW2 A;  2W85 A;  1KQ0 A;  2GWR A;  4LGW A;  2EA2 A;  3HHG A;  3KE2 A;  3P9K A;  3GVA A;  2GQQ A;  3S2W A;  1QQI A;  3ECO A;  2J5O A;  1BIA A;  1ODD A;  1R00 A;  4BYY A;  1STZ A;  2PMH A;  4CYD A;  4Y17 A;  2X0L A;  1OYW A;  1USS A;  3K69 A;  3TO9 A;  2VE9 A;  5CLS A;  1KU2 A;  3DFG A;  1I1G A;  2MD5 A;  1MDM A;  1SFX A;  2EV6 A;  2XAG A;  3N4M A;  3LQQ A;  2A68 F;  3E5X A;  1T98 A;  4GXO A;  2H27 A;  4HF1 A;  1ZGJ A;  6PAX A;  5CVV A;  2LNB A;  4P96 A;  2L4A A;  4HF0 A;  4GO1 A;  1SD6 A;  3R4K A;  2HKX A;  5E18 F;  1ZG1 A;  2CG4 A;  3LA7 A;  4AVP A;  1IN8 A;  1FWZ A;  4H0E A;  2W84 A;  2XKO A;  3E97 A;  2Z5U A;  1ZRD A;  3WU0 A;  3WU1 B;  3WTU C;  3NQO A;  3DEU A;  3ECH A;  4I01 A;  1BI2 A;  2XAF A;  4A6D A;  3V8L A;  2X4H A;  3NRV A;  2DK5 A;  1E2X A;  2MLG A;  4I09 A;  1LJ9 A;  2YSR A;  2IA1 A;  4UHT A;  2PFB A;  3K0L A;  2K86 A;  1FBS A;  1K79 A;  2A69 F;  1BIB A;  2XVC A;  4YFX F;  2JTV A;  4KIC A;  2GZW A;  2NAZ A;  3QPH A;  1F5T A;  1ZYR F;  1YS7 A;  4RB1 A;  1O3R A;  2O0Y A;  5CVI A;  1O3S A;  5DCF A;  2V1X A;  3DP7 A;  3T8T A;  5LEJ A;  2K4B A;  3PQK A;  4ESJ A;  3PQJ A;  2Q8K A;  3KFW X;  2RN7 A;  1IF1 A;  3TDU C;  4M9S A;  5D5V B;  4O3M A;  2XRN A;  4MEY F;  2EA4 A;  2M5W A;  4MTE A;  3BDD A;  3T8R A;  3HRT A;  4A12 A;  4BAY A;  4MGR A;  2MLK A;  3BPX A;  3HOT A;  2FU4 A;  5D8K B;  3C3W A;  3ZMV A;  2P5L C;  2RNJ A;  2RGV A;  4K2E A;  5DCM B;  4B09 A;  4I2O A;  2YR2 A;  2D2W A;  4U88 A;  3RKX A;  2F2E A;  2QWW A;  2FNA A;  1YG2 A;  5CVR A;  1A04 A;  1GXQ A;  5A2Q K;  1KGS A;  2QEN A;  5BMZ A;  2XAS A;  3CDH A;  2KRF A;  2WV0 A;  1G3S A;  3HIF A;  4PGG A;  3COA C;  1HKQ A;  2KKO A;  4HV6 A;  1ZN2 A;  1ZRC A;  2GXG A;  2L54 A;  1AWC A;  1EV7 A;  1MJA A;  5H6R A;  3LA2 A;  3V7R A;  4EVI A;  2H6C A;  5HLI A;  2W24 A;  4HW0 A;  3KP2 A;  3BPV A;  5HS7 A;  1E17 A;  4KFC A;  4KMF A;  5E1W A;  3CTA A;  1ON1 A;  4ZZD A;  2PEX A;  3KP5 A;  4GYI A;  2DTR A;  1Y0U A;  2HZT A;  1K78 B;  5AIP A;  2DFI A;  1MGT A;  1S8N A;  4F7Z A;  2E1N A;  1RNL A;  1O7L A;  1RUO A;  3ZMZ A;  5BQT A;  1XN7 A;  3ERE D;  3SZT A;  1WKM A;  1YLF A;  2CGP A;  4M6X A;  3J80 K;  5J8C A;  1H9T A;  5CYV A;  4GGG A;  4ENJ A;  1F1Z A;  4LMY A;  5E8G A;  2YX7 A;  4L5J A;  4A5M A;  4CXF A;  3L09 A;  4EJV A;  5ICE A;  4ASN A;  5K1Y A;  1P2F A;  2L01 A;  1PUE E;  1R22 A;  4HQE A;  5ILU A;  3C18 A;  2LF7 A;  1U5T B;  2FRH A;  2MH2 A;  2D1H A;  5H6Q A;  4A0X A;  3BJO A;  4EMS A;  4O6J A;  3L9F A;  4WXC A;  2M30 A;  4YFN F;  2HYF A;  4YII A;  3BZ6 A;  4LG0 A;  2NNN A;  1C0W A;  2ISY A;  4IHS A;  2L02 A;  2A07 F;  1XGS A;  2KIM A;  2QBY B;  5D5U B;  5A2Q Z;  4LK0 F;  3GZ5 A;  4FX0 A;  1KQ9 A;  3P9I A;  2V6C A;  2DI3 A;  5LHI A;  5HDG A;  2HTS A;  4OMY A;  4OOI A;  3WGH A;  5FO5 A;  3IKV A;  3I59 A;  4P5O A;  3TO7 A;  3JAM Z;  3F6V A;  4HDV A;  4UV9 A;  5JHU A;  2BV6 A;  4DNC A;  1S6L A;  2QM3 A;  3CUQ B;  4MQ9 F;  1BJA A;  4OIN F;  1IW7 F;  2ESH A;  3MCZ A;  4UVB A;  3V7C A;  3F3X A;  1AOY A;  3QP6 A;  3K1N A;  3TO6 A;  3KCC A;  2P6T A;  1B59 A;  2QZ8 A;  2FNP A;  4ZYD A;  1XDS A;  5LRS A;  4E70 A;  1PDN C;  1SFU A;  1FBQ A;  3ZN1 A;  2RC4 A;  4RGX A;  4BXU A;  1G4D A;  2ZO4 A;  1KU7 A;  2FBH A;  2UWM A;  3MZY A;  2PG4 A;  2VBY A;  4EM1 A;  1FY7 A;  1SMY F;  3N97 A;  1MJB A;  4Q4Z F;  3FMQ A;  2P4W A;  5LHG A;  4RB3 C;  1D5V A;  3KEQ A;  2CW0 F;  2K4J A;  3CO7 C;  2K02 A;  1R5H A;  3LFK A;  2R7F A;  1G3W A;  1R7J A;  5JR3 A;  5L3E A;  3SQN A;  4MNU A;  3GFL A;  2QYO A;  1ZRE A;  1LEB A;  4ESB A;  3RPU A;  1ZGA A;  4G6D A;  4UNO A;  2XAJ A; 
#chains in the Genus database with same CATH topology
 5CKT A;  3G1O A;  3I3L A;  3B02 A;  3LAJ A;  3Q0V A;  2WA0 A;  3S93 A;  4A3C J;  2P5V A;  2P8T A;  3CES A;  4FCY A;  1FP1 D;  1Z6R A;  2FSW A;  4HBL A;  1I1S A;  3D5R C;  1BW6 A;  2A05 A;  2IAI A;  3A03 A;  3NAR A;  1TWC J;  5L3F A;  3ABM H;  4RM2 A;  1I50 J;  1JT0 A;  1ETX A;  2HS5 A;  2XAU A;  2MH9 A;  3Q3S A;  3GFM A;  3RI4 A;  4OAZ A;  4RGU A;  2PX9 A;  3KET A;  2VUM J;  3I59 B;  4YFK F;  1VTN C;  4DW6 A;  2P5K A;  1XB4 A;  3J7A Y;  2HTJ A;  2VT2 A;  2M9H A;  5FKO A;  4M9X A;  3WTY C;  3ONQ A;  2E36 A;  4R8H A;  3MKZ A;  1E3H A;  2A3S A;  2H09 A;  2BW3 B;  2WAD A;  1TZL A;  1TQM A;  2C6Y A;  1U6G A;  3WE3 A;  4X1E A;  3K4J A;  1XPX A;  3ASO H;  1FOY A;  3GTM J;  2TRT A;  2XGE A;  1EJ9 A;  4NC6 A;  1HST A;  3ELK A;  1MZB A;  1SAN A;  1IN5 A;  1QNT A;  3I4N J;  1I6X A;  5HLT A;  5BPI A;  3LST A;  4HA8 A;  2F5F A;  3GFJ A;  2UV1 A;  4LJZ F;  3VYU B;  3JRB A;  5C44 J;  2K3F A;  2R7D A;  2W57 A;  4R1H A;  2LMD A;  1ITY A;  4FHT A;  2K7L A;  1JTX A;  2GLO A;  1D1B A;  2EZK A;  2P7C B;  4F91 B;  1FX7 A;  3ZP5 A;  1B8I A;  3ABT A;  1QZY A;  4HV5 A;  4FT8 A;  4IKF A;  5E3N A;  4GDF A;  4HX7 A;  2A5Y B;  4PUS A;  2LKS A;  3EET A;  4BXF A;  4BAC A;  2Y0S N;  2V4J C;  2ZCW A;  5D6F A;  2KIQ A;  2XAH A;  2LG4 A;  5HDK A;  3HRS A;  2KDZ A;  3S1R J;  4B44 A;  3H92 A;  2IGK A;  4ON0 A;  4EM2 A;  1MMS A;  1UHW A;  1WGX A;  1Z6T A;  2ETH A;  1HXD A;  1RKW A;  1SVM A;  3W6K B;  2M34 A;  3UR3 C;  4BHP A;  3BWG A;  4N9I A;  2CW7 A;  3FM5 A;  3L00 A;  4YIR X;  1QBJ A;  3OL4 A;  5J40 A;  4ZC3 A;  4CYC A;  2FMY A;  4IHX A;  4CUG A;  1ETQ A;  1IDZ A;  2EB7 A;  4KN4 X;  5LBQ A;  5ED4 A;  1MKM A;  5IYC J;  2DMP A;  1FLI A;  1FZP B;  2HXO A;  1UG0 A;  3LMM A;  1JGG A;  4B8X A;  3VOD A;  5JI6 A;  2VI6 A;  3H3Z A;  4HF2 A;  4OIQ F;  3OYM A;  1UB9 A;  2DMQ A;  4IX7 A;  3OWT A;  1HKS A;  5HS9 A;  3FXJ A;  2RNG A;  1KON A;  3DBH B;  4DBQ A;  1OQY A;  3BY6 A;  1HBX G;  2JJ7 A;  1HQC A;  1PP7 U;  1R1T A;  2COM A;  3T5X A;  2PJP A;  4L5E A;  4DYR A;  5FLX Z;  3JRC A;  3K70 C;  4OWR B;  4IJA A;  5LEK A;  4XRS G;  5TJJ A;  1GDT A;  3CC4 I;  1LDK B;  2J5P A;  1GVD A;  2LOO A;  2ZME C;  3IKT A;  2BYV E;  1IN4 A;  4HX8 A;  4DYC A;  5ILS A;  3FBN B;  2LD5 A;  1V5G A;  1W5T A;  4HAM A;  3DPU A;  3EQL F;  2FQ4 A;  4PSX A;  1YRN A;  3X2Q H;  2O61 A;  1ZQ3 P;  4BY1 J;  1GVJ A;  2FA5 A;  2VOD A;  2HQN A;  5DYM A;  3DKX A;  3IL2 A;  2E71 A;  2MC3 A;  3SFZ A;  2Y48 A;  4D7N A;  1X1C A;  2EIL H;  5IY5 H;  5LGU A;  3BZC A;  2KDO A;  2ZJR F;  1VI0 A;  2EV5 A;  3PIO F;  1B72 A;  4M74 A;  3CLO A;  3BR5 A;  4FE7 A;  4UUT A;  1JE8 A;  1L0O C;  3K10 A;  5ERI A;  5F0C A;  2XF5 A;  3W2W A;  5HVQ C;  2KRC A;  4W1U A;  2FOK A;  5TIS C;  2IT0 A;  3EYI A;  2QVO A;  4Q47 A;  3FHZ A;  3DPT A;  3OYB A;  2ECB A;  4Y4R A;  1T0F A;  1WH5 A;  4P1W A;  1OR7 C;  4XMY A;  3WTZ A;  2Y0S A;  2LBF B;  3J7A O;  3HSE A;  3IC7 A;  2LDU A;  1JGS A;  4WWC A;  3WGG A;  1OLT A;  5L3C A;  3FXO A;  2DQL A;  3TED A;  1JKO C;  2EIN H;  4MFD A;  1B8I B;  4BBS J;  1Y56 A;  1CQT A;  1T39 A;  2CV0 A;  1IN7 A;  3F0C A;  3HGY A;  2V1U A;  2KMU A;  5GAG J;  2XF7 A;  3D5L A;  2IEK A;  4D0P A;  1Z7U A;  4GCV A;  3Q5F A;  2GOX B;  2KIF A;  1S7O A;  1R4M B;  1B9N A;  2DLL A;  3ZMT A;  3BG5 A;  4M3G A;  1ZRF A;  4DZP A;  4U7D A;  3AKZ A;  2R7X A;  2UXX A;  4QTR A;  4M3F A;  1CF7 A;  1LFP A;  1REP C;  5KVR A;  3WOD F;  3QYF A;  3OS2 A;  1F43 A;  1J2X A;  2KQR A;  2VAS A;  2CMP A;  5LGN A;  2EBI A;  1W5C C;  2OA4 A;  5F0H A;  2EWN A;  5EYR A;  2Z33 A;  2DA1 A;  3BTJ A;  3C2G A;  5EG0 A;  3R0A A;  2KP6 A;  3AG2 H;  4JK1 X;  4LLG F;  4XKV A;  2MSY A;  2E7W A;  1EH7 A;  2DA3 A;  1UFM A;  2PMU A;  3Q0W A;  2RDP A;  3DLL F;  3KYC B;  5DUI A;  1DDN A;  3M1E A;  5LHH A;  2FF4 A;  2DPU A;  3MD2 A;  3SEZ A;  2KJC A;  1R23 A;  2OTL I;  2Z9O A;  3ZQF A;  3D5S C;  2H1L A;  1BC7 C;  4P55 A;  3PNT A;  5EJC A;  4KA4 A;  1CGP A;  1VND A;  2VIX A;  1BC8 C;  3A2K A;  1WCM J;  4OMZ A;  2L2O A;  3DBL B;  5JVG F;  2HYJ A;  2XUB A;  1TQI A;  2BY0 A;  4UVA A;  2WTE A;  1E3P A;  2QSF X;  2STT A;  1FTZ A;  4W97 A;  2JK3 A;  3C2B A;  5F64 A;  1RET A;  4BQO A;  2H8W A;  4G9Y A;  4DQ2 A;  3L2C A;  3WTV C;  3CF5 F;  4XBF A;  1TLH B;  1BL0 A;  1ZTR A;  3C7J A;  3ZQQ A;  1EF4 A;  3PO3 J;  2JZY A;  1JKQ C;  1YYV A;  3I56 I;  1YRN B;  1E0E A;  4PSW A;  4ZDO A;  3RJP A;  2DYS H;  1MDM B;  5D8L B;  3FXQ A;  2DU9 A;  3I58 A;  5K5R A;  5C3E J;  3W6J B;  5HOD A;  2FQ3 A;  1ZLJ A;  3H35 A;  3V8K A;  1T08 B;  3MEX A;  2CUF A;  2K27 A;  4UUS A;  3OR2 C;  1D1A A;  2F6C A;  3F8B A;  3FMS A;  1PP8 F;  2LTP A;  3RQ4 A;  1DP3 A;  1Z67 A;  4IO9 F;  1RI7 A;  3CCJ I;  1DPR A;  2VQL A;  1X19 A;  3CCM I;  3PFY A;  1IUY A;  3CDI A;  2BXZ A;  2NYX A;  5TGT A;  1WJ5 A;  4YRV A;  5J1Y A;  1YIT I;  3HEF A;  4I7H A;  3IH3 A;  2LH9 A;  1K6O A;  4G7O F;  4C2T A;  2R4G A;  4BQQ A;  2CSO A;  2E34 A;  2QEX I;  2OPT A;  1YJW I;  2WBM A;  1GXP A;  1ZR4 A;  3L1P A;  5DM7 F;  3F22 A;  3SDB A;  2L4M A;  2IA2 A;  1J75 A;  4XKW A;  1ZG5 A;  1K61 A;  1FIP A;  2R3S A;  2IGN A;  4RA2 A;  1JUM A;  4B43 A;  3FXR A;  1V54 H;  5M5X J;  2XC7 A;  2LKP A;  1U9N A;  1FJL A;  2HWV A;  5ILV A;  1IRX A;  2ZC2 A;  2VQC A;  4RB0 A;  5HOO A;  3HB9 A;  3JAM K;  3JR9 A;  3FHN A;  4B3X A;  3ZGK A;  1IRZ A;  4M72 A;  2M2E A;  5GAH J;  1SC7 A;  5IP7 J;  3S16 J;  5CPR B;  1OFC X;  2BBY A;  3HSR A;  1H89 C;  3H0D A;  1MMD A;  1OCO H;  4MHG A;  1VQ7 I;  1Z0X A;  1Q1H A;  3D0S A;  4Y15 A;  1QHH D;  3CCV I;  4OIO F;  3H5N A;  4E7S A;  3V7S A;  4ENK A;  1HLV A;  1XMK A;  2X85 A;  1P6R A;  4AVZ A;  4YG2 F;  2RVC A;  1CF7 B;  1RC9 A;  3G2B A;  4PGH A;  3ZPL A;  1FEX A;  4S05 A;  4BE1 A;  1WJF A;  2JPB A;  5EEG A;  5D5W B;  3PNV A;  1MMN A;  3E5U A;  2EPF A;  3VSK A;  1Z91 A;  2D1V A;  5EG0 B;  5IT9 Z;  2VPR A;  3DQV C;  4U7B A;  3CJR B;  1ETY A;  3C2H A;  1IDY A;  1BI0 A;  1QVT A;  4MIM A;  2JUC A;  3CLQ A;  1FP2 A;  4BNC A;  5DEQ A;  2LSO A;  3ZQG A;  2OQR A;  1LNW A;  3MQ0 A;  3KZY A;  1OKR A;  3ZN0 A;  4Y33 A;  3DF8 A;  3IH4 A;  1D3Y A;  4AYB N;  3F72 A;  5LRR A;  3CCL I;  2NS0 A;  1POG A;  3ESW B;  3M8J A;  5BOX A;  2XHK A;  3ISP A;  2XRL A;  2Y9Y A;  2L9N A;  2VJI A;  2VLA A;  2BE5 F;  5GAE J;  4JYK A;  4A3F J;  5DTD A;  2KIU A;  4Z2Y A;  3JRA A;  2QQ9 A;  2O5R A;  4KIF A;  4BJ5 C;  1XSX A;  1IV6 A;  2PJR B;  3PL8 A;  3EPZ A;  1P4A A;  3IRR A;  1T2K A;  2WY7 Q;  3MMY B;  3RZD J;  5E20 A;  2Y0M A;  3M3Y J;  4NUB A;  1XD7 A;  1OR7 A;  3DEW A;  3JTG A;  1ZG3 A;  2K3P A;  1TC3 C;  2BHZ A;  1IC8 A;  2M4K A;  4HQM A;  3JRH A;  2EJR A;  3OL3 A;  2QQB A;  2BY3 A;  2VT3 A;  4KNY A;  4BUP A;  2KLO A;  4NQW A;  4A0Y A;  5IT3 A;  1R6R A;  3RPU D;  3R0J A;  2L5Q A;  2HDW A;  4RGS A;  4CZZ A;  3HRU A;  1TWA J;  1QPM A;  1LQ1 A;  3FXM A;  5EZG A;  3HPH A;  3WTW C;  3IH2 A;  1A35 A;  5FRN A;  2PMZ A;  4CH7 A;  4CSW A;  1DU0 A;  1IO2 A;  3DXJ F;  5LGT A;  5DV5 A;  4HLY A;  2HPI A;  2DAO A;  3IUO A;  1MJ9 A;  5B3S H;  2A6E F;  3GTO J;  2E1M C;  1FSH A;  2MW8 A;  1YO5 C;  2ELH A;  3HPG A;  4BKX A;  4A0Z A;  3SEQ A;  2VN2 A;  2W1O A;  1YE9 A;  1Y6I A;  4HZF A;  3DV8 A;  3OS1 A;  2CV1 A;  5B1B H;  3S15 J;  2BEO A;  5KK1 A;  4PJM A;  4U0Y A;  3VEP A;  1EKE A;  2DT5 A;  1QGP A;  2ID3 A;  2VBZ A;  3NWS A;  3OYL A;  1H0M A;  5GTI C;  1TWH J;  2CFO A;  4M3B A;  2X51 A;  4LD5 A;  1FNN A;  5FLV A;  3GWZ A;  5FRM A;  3K1P A;  1IZ1 A;  1IAW A;  2JA8 J;  3KZI C;  2OUM A;  3LSM A;  5F0F A;  5KNL A;  3F8F A;  3KP3 A;  2WC2 A;  3WHB A;  2FBK A;  3MZH A;  4D5F A;  4YIF A;  1YQA A;  4HPQ A;  2G7H A;  2KT0 A;  4IVN A;  4CDG A;  4C9Y A;  3QU6 A;  1KU9 A;  3BR3 A;  2YU3 A;  4A3J J;  4RAY A;  4ENN A;  1V5E A;  2R5Y A;  3HYI A;  4NC8 A;  4CCN A;  3MAJ A;  3JTH A;  2ZXH A;  4XLN F;  1A6Q A;  3AL0 C;  2A6T A;  4LB6 B;  3FXU A;  2D45 A;  3EUA A;  3QYE A;  1ETO A;  3E6D A;  2WAQ N;  4KT5 C;  2HVR A;  3BZK A;  2ZJQ F;  2NOG A;  2DDA A;  5L3G A;  3IHU A;  2XPU A;  4XNF A;  1QHG A;  5D5X B;  2QA4 I;  2NXN B;  2IS6 A;  3H5R A;  5BPD A;  5KHD A;  3K2A A;  2JPC A;  3JRG A;  1I3Q J;  3FX3 A;  1R49 A;  4BHC A;  1D8K A;  2EK5 A;  2HGC A;  1ZEL A;  1U9O A;  5J47 A;  2VJJ A;  1OMI A;  4M71 A;  3ULQ B;  1FYL A;  1VQ5 I;  4EQQ A;  1X3U A;  5FFZ A;  2RQP A;  3QAH A;  5E17 F;  4I02 A;  1KQ8 A;  3BTL A;  2ZXW H;  4KIT B;  3CCQ I;  2CQX A;  1KYZ A;  2M7A A;  4D7M A;  1H9G A;  2RKH A;  2IS2 A;  1Z77 A;  2EV0 A;  2ZFU A;  3LSJ A;  2O6G E;  3F23 A;  2JSC A;  4QWQ A;  2I10 A;  4PFP A;  4AIK A;  3E6M A;  3GTG J;  1HW5 A;  3VYR B;  3J7Z I;  2CQN A;  2B63 J;  1DUX C;  2V9P A;  3K7A J;  4NQW B;  4A93 J;  5FRO A;  4P9F A;  2FUG 2;  3H3U A;  2Z3Y A;  4A3L J;  1BN5 A;  2XGX A;  4ITV A;  2KFD A;  2EFN A;  2PN6 A;  2HOS A;  2RRE A;  2WB1 N;  3I64 A;  4Y13 A;  2VC1 A;  2BHY A;  3ML6 A;  5ICG A;  1APL C;  4HDU A;  1VQ8 I;  3L2Q A;  3GZ6 A;  1IXC A;  5ICC A;  1U78 A;  2R7T A;  5FLX K;  2CQQ A;  2V9V A;  1LFB A;  3BG3 A;  3LL7 A;  3OOP A;  3W3C A;  2XGD A;  4UY8 I;  4XON A;  2RV8 A;  3SZP A;  5DS9 A;  4XRF A;  2HEO A;  2LY9 A;  3GBG A;  5D4R A;  1R58 A;  1XGO A;  5LLQ A;  4BE2 A;  1UEL B;  3A0B C;  3M1C A;  2NVY J;  2M3A A;  2ZNY A;  4EM0 B;  3Q9S A;  1LEA A;  5H20 A;  3UNG C;  3QPS A;  4A3K J;  4M6V A;  4PJJ A;  3LFU A;  3M07 A;  5K7H A;  2R7V A;  1T38 A;  4LB5 A;  1OCR H;  1S7E A;  2DBB A;  4RS8 A;  3HBL A;  1Q1V A;  4IRG A;  3TQN A;  3IAS 2;  2E7X A;  3LWF A;  2FXA A;  2HOE A;  2P7V B;  3TKY A;  5EDN A;  2JVG A;  2QSH X;  5IYD J;  3A02 A;  3ZR8 X;  3PNY A;  1KU3 A;  2R7S A;  5ICF A;  4RBO A;  1BBY A;  1S72 I;  4QLC U;  4LG0 B;  1A5J A;  2ADU A;  2LC2 A;  1N78 A;  2CUJ A;  3LSI A;  4Z6Y A;  4HRI A;  2VKH A;  5TRD A;  1DPU A;  2CO5 A;  5HLG A;  2PLY A;  3HXL A;  4CIC A;  3PUF A;  4A3B J;  2WAQ A;  4DBR A;  3O2P E;  4TV7 A;  2IGO A;  3ZMD A;  4BDZ A;  4CA0 A;  3RQI A;  4Y52 J;  4R79 A;  2V79 A;  5K5O A;  1P4W A;  2Q0O A;  5M3F J;  4UUV A;  3HOU J;  1SEU A;  5C4X J;  3L2U A;  2WWY A;  4ESF A;  2HFH A;  4WXH A;  1XGM A;  2BGC A;  4MEX F;  2QKM B;  2D5V A;  4UXN A;  2GA2 A;  2JRT A;  2W25 A;  3QU3 A;  1R4N B;  4IXA A;  2HOT A;  2EQR A;  1A36 A;  4V2F A;  5M5Y J;  4G7Z F;  2JA2 A;  4RMN A;  4EAT A;  2W7N A;  4WCG A;  3REO A;  2XDV A;  2OU2 A;  1OYY A;  3KLO A;  3WU2 C;  1WZ2 A;  3FIS A;  4F3Q A;  3CP8 A;  3I5U A;  2JT1 A;  3DU5 A;  3TL4 X;  2JA5 J;  2WY8 Q;  3KEO A;  4AUX A;  1ON2 A;  2CS3 A;  2LVS A;  3GZN B;  1UHM A;  1FMV A;  3KPH A;  4G8X A;  1BI3 A;  3DTE A;  2WB1 A;  1WI9 A;  2VE8 A;  2A6H F;  2IVM A;  4XOT A;  4EV0 A;  2B0L A;  4I0B A;  2VC0 A;  3F8C A;  1YIJ I;  1W4M A;  2OCC H;  2VXZ A;  1P7I A;  3S1Q J;  1FC3 A;  1EA3 A;  5D4S A;  1ETK A;  1N25 A;  1W7P A;  2VPL A;  2JRM A;  1JHH A;  3OYD A;  2O7O A;  3EUH A;  1VQO I;  1RES A;  3RPQ A;  2LK2 A;  3HC7 A;  1RR7 A;  1FYM A;  2EFQ A;  1IXS B;  3S3M A;  3C1D A;  4OAY A;  3FKJ A;  3TOB A;  4M9Z A;  3RKW A;  5FFX A;  1XC5 A;  4QPQ A;  1ACI A;  3S14 J;  1QVU A;  1P7J A;  1MND A;  4ZDL A;  2R5Z A;  1QZE A;  2QLZ A;  5K7F A;  5L3D A;  1A31 A;  2X1E A;  3Q0U A;  1UCR A;  2EFW A;  1V4R A;  1TNS A;  3I0T A;  5DD4 A;  3S2H J;  2R7Z J;  4IHT A;  2NS8 A;  4PDK A;  1U3E M;  3TW7 A;  1F4K A;  2IW5 A;  3GTQ J;  2L7Z A;  2H8R A;  3WE2 A;  2HDD A;  3WGI A;  3CC7 I;  1U5T C;  5DM6 F;  1NG7 A;  2Y69 H;  2TDX A;  1X4O A;  3HHH A;  4IHV A;  9ANT A;  1SD7 A;  5KCM A;  1O4X A;  3BP8 A;  2HQR A;  3LNQ A;  3ASN H;  1ORK A;  4WX9 A;  3M7G A;  1W1W E;  1IRG A;  4CCJ A;  5H2F C;  4A5N A;  2DPD A;  2HQA A;  1BOA A;  4C3H J;  2O03 A;  3KEY A;  3BOQ A;  1R1V A;  1O57 A;  3H5A A;  4XRS A;  4IEJ A;  2DJI A;  1ONV A;  2VB6 A;  3NAU A;  3O3K A;  5FJ8 J;  3CMA I;  1MBF A;  4O5V A;  1O3Q A;  2COB A;  3JW4 A;  3OSG A;  3G4S I;  3V4G A;  4A3I J;  4BEH A;  5EGO A;  2XKP A;  2K9L A;  5B66 C;  5AON A;  2MD0 A;  3OYJ A;  1IUF A;  4I98 B;  2LYC A;  1WJD A;  1OPC A;  2LF8 A;  1AA7 A;  3F8N A;  3ROU A;  4ZYE A;  1QPI A;  2NNY A;  1HF0 A;  2ACJ A;  3HTS B;  1BM9 A;  1YHQ I;  2M7B A;  2B7E A;  3VB2 A;  1J9I A;  4XSX F;  3RDI A;  2DOF A;  3P7N A;  1ZHF A;  5DCM A;  1TP4 A;  1I27 A;  4LLL A;  1KZH A;  3WTT C;  2CH0 A;  3ZQC A;  1U8R A;  5E1Z B;  4B47 A;  2PBI A;  1YTY A;  4LLN A;  1TT0 A;  3K6G A;  1UG2 A;  3S1M J;  3K4K A;  4J19 A;  1JHF A;  5CVJ A;  4S0H B;  2M87 A;  2CWE A;  3JSP A;  4BH9 A;  2F4M B;  1J7K A;  1XGN A;  1BI1 A;  2DO7 A;  3AG1 H;  5IT9 K;  3A01 A;  4NHJ A;  2M4G A;  4ZTJ A;  2Y9Z A;  1MW7 A;  4HSR A;  2EZI A;  1WRJ A;  4BGD A;  1I6H J;  1VFC A;  3I53 A;  3BQY A;  1MD0 A;  3CUQ C;  5DUK A;  3D1N I;  1GT0 C;  1W7P B;  1O7F A;  4IRI A;  4LOC A;  3VFZ A;  4GYG A;  1UMQ A;  2GIV A;  2OV7 A;  1S5L C;  1X3W B;  4AD9 A;  4IQ4 A;  1KYW A;  1SMT A;  1V3F A;  1HCR A;  1LDJ A;  2AHQ A;  5L3B A;  4M73 A;  4BDY A;  2V6E A;  5LFA A;  1IG7 A;  1S29 A;  1XCV A;  3IWZ A;  5F1J A;  2P6S A;  5E3M A;  1RR8 C;  3I55 I;  2EH3 A;  1HKT A;  3K4L A;  4MO7 A;  1OYI A;  3PO2 J;  2H6B A;  3H9G A;  3DWL E;  2K9Q A;  2XB5 A;  1QZZ A;  2VXD A;  3WTS C;  1K6Y A;  3H9J A;  4ZZL A;  4CYC B;  1GUU A;  3SHF A;  4ZYG A;  1G8X A;  2HOA A;  4M6Y A;  3O6B B;  4NB5 A;  1E3O C;  1LDD A;  2L3D A;  2NVQ J;  2NRA C;  1QRY A;  2G9W A;  4ZYA A;  5E8I A;  1DGW Y;  2AQF A;  4H4K C;  4A3G J;  2M1B A;  3JRD A;  4HX4 A;  4BE0 A;  4A3E J;  1UJ8 A;  4G6Q A;  1RZ4 A;  1X1A A;  2R7O A;  4F93 B;  2DK8 A;  4D9J A;  3BJA A;  1I5Z A;  2AO9 A;  3VYT B;  3MFK A;  2IS4 A;  3J81 Z;  2O3F A;  2EFO A;  4LFU A;  4ETS A;  4HNU A;  1IRF A;  3I54 A;  3DKW A;  2BZT A;  2DCE A;  2QF7 A;  2CJJ A;  2VBX A;  3HUG A;  3GXO A;  2UZK A;  2IGM A;  3ZQL A;  1JI8 A;  3GYH X;  3LAP A;  3QOP A;  2V1N A;  3DLA A;  2W82 A;  2DMN A;  2IPQ X;  3GF2 A;  4XN0 A;  4M3D A;  4L0Z B;  2WV1 A;  4C2M J;  1WSU A;  1XDU A;  2ICW G;  3G6E I;  1G3T A;  4KT6 A;  1J5Y A;  1S7A A;  2RQQ A;  2MBF A;  2V7F A;  2KL4 A;  3FM3 A;  1UHS A;  1K78 A;  2WAE A;  3QWL A;  1VQ9 I;  1GHC A;  2OJE D;  3IP4 B;  4WF2 A;  1MBH A;  4KIB A;  2JUG A;  2ZBK A;  1LFU P;  2DXI A;  4ANJ A;  5E3L A;  4CZC A;  1X1P A;  4ZH4 F;  2NVT J;  4U0W A;  1PYV A;  2ISZ A;  3LSK A;  2LR8 A;  5GPA A;  4AM3 A;  5F6F A;  1IV8 A;  1HDD C;  1YX3 A;  1YX5 A;  3CMM A;  1X4P A;  3GX4 X;  5FD5 A;  4UVC A;  2HVQ A;  1HSJ A;  1B4A A;  4DYQ A;  2DYR H;  2E35 A;  2IBD A;  5M3M J;  3H3V K;  1UAA A;  1YOV B;  4E7K A;  1B72 B;  3LOC A;  4NC7 A;  5JFR A;  1TW3 A;  2AS5 F;  3U21 A;  1N75 A;  2ID6 A;  3DKY A;  4JQF A;  2ELK A;  1XX5 A;  2AXT C;  1Y0N A;  2PMZ N;  4XOP A;  3ZQ7 A;  1MNM C;  2DA4 A;  3ZMU A;  1TWG J;  1W36 D;  2DFE A;  1UST A;  3AAF A;  1SD5 A;  2ZNZ A;  4I76 A;  1X2N A;  1TNT A;  4WXD A;  2MG4 A;  3BT9 A;  2ECC A;  4OU0 A;  1HW1 A;  1U5T A;  1O3T A;  4KUM A;  4KJZ A;  4XM3 A;  2ZSH B;  3OYK A;  2DDB A;  1U8B A;  4IF4 A;  2HZD A;  2L0K A;  3E5Q A;  4JX5 A;  1ULY A;  1FPQ A;  4LIT A;  2YUS A;  3RIR A;  4CCK A;  3A4C A;  2DT6 A;  2ZME A;  3T1B A;  5EZH A;  5BS6 A;  1XSD A;  3MZ8 A;  1OCP A;  1IN6 A;  1Z05 A;  4MLO A;  3HKZ A;  1JTY A;  2F5E A;  2LP0 A;  4FTH A;  4AIJ A;  3EYY A;  3GFI A;  2X48 A;  4IRH A;  2FEZ A;  4HNT A;  3L2R A;  3FK7 A;  2EIJ H;  1MMA A;  3E3V A;  5CJ9 A;  4IHW A;  3RKY A;  4BHB A;  2HYG D;  2MAB A;  2BVL A;  3CJT B;  3KX2 A;  5AIQ A;  1JT6 A;  1K7A A;  5IOZ A;  1WJB A;  2QBY A;  2DQR A;  3U2R A;  2CUE A;  2L7K A;  4Y7N J;  1X2M A;  1S9H A;  3F9K A;  3I71 A;  3TMO A;  5J8F A;  2HDC A;  1BOB A;  3M9A A;  3E6B A;  1ZAR A;  1SD4 A;  3R61 A;  4B3A A;  1D0Z A;  2W48 A;  2QUF A;  1J0R A;  5FD6 A;  2STW A;  2VOP A;  3QQA A;  2A5W A;  3VOE A;  1WJC A;  5FGM A;  4BL0 B;  1DP7 P;  5B5E C;  4LIV A;  2VOO A;  3RZO J;  3BC8 A;  4HOB A;  2EZL A;  1NHA A;  2L9R A;  3M8F A;  1T6S A;  2ESN A;  4UV8 A;  3OV8 A;  1HA8 A;  4P9U A;  2IA0 A;  5J1R A;  3KZZ A;  3DCF A;  3CUQ A;  2F5C A;  3V42 A;  1YIO A;  4OIP F;  3BR0 A;  1XSV A;  4Y3O A;  1G6N A;  1DQU A;  1S3J A;  2KIS A;  2HR3 A;  5C4J J;  4UUS B;  4CGZ A;  1X1B A;  3HSF A;  4XL9 A;  1VQN I;  2WAF A;  2DA5 A;  4RLQ A;  3K4M A;  2DMT A;  3G73 A;  4MQV A;  1D8J A;  2IJL A;  2XSD C;  3BQZ A;  3GUD A;  4DZJ A;  5FB2 A;  3FWE A;  3PFI A;  2YX4 A;  2L7M P;  1XS9 A;  4CO8 A;  3HJE A;  2EFP A;  2E5Z A;  3CO6 C;  3GLX A;  1MNE A;  4C30 A;  2VKE A;  1U2W A;  5CQE A;  5E3O A;  4HYE A;  2ZXJ A;  4OIR F;  3GO5 A;  2M45 A;  2R0Q C;  3HTU A;  4UB8 C;  5F1R A;  2FE3 A;  4E4H A;  3HOS A;  3JSO A;  2V9K A;  1NTC A;  3ZQI A;  4CHU A;  2X1C A;  2CQK A;  1P92 A;  3EUK L;  3CCS I;  1W0T A;  2LY2 A;  2OZU A;  3FBI B;  1EH8 A;  1Y39 A;  3GEZ A;  4PCQ A;  4XLC A;  3MWM A;  4LK1 F;  4RB2 C;  4LIU A;  4JBA A;  3RTR A;  1AKH A;  2MA3 A;  1QO0 D;  1V55 H;  1H8A C;  4G6T B;  1HOM A;  4DJA A;  3IAM 2;  3QRF F;  4E7H A;  1YW8 A;  3F8M A;  4AIH A;  2YPR A;  1ZR2 A;  4HG2 A;  1JJ6 C;  5EEH A;  3WG9 A;  4IOC F;  2ZME B;  4WK8 F;  2TCT A;  3BG7 A;  3NEU A;  1WQ2 A;  2L9S A;  1Z21 A;  4L9J A;  4ABZ A;  2QSG X;  4Q48 A;  3B73 A;  2JVH A;  3A1Y A;  2VBW A;  3K2Z A;  3CMY A;  4RGR A;  1R5G A;  4L18 B;  2E2J J;  3GLL A;  1B9M A;  1W7P D;  1KA8 A;  1EH6 A;  1F9N A;  2BY2 A;  5JLX A;  2HU9 A;  1Y8R B;  3I4P A;  3K4N A;  4KMU X;  1R1U A;  5K5Q A;  1RUN A;  3IV5 A;  2PQ8 A;  4KDP A;  3S2D J;  3OIQ A;  2Z99 A;  2KZG A;  5DD8 A;  3ZXS A;  2AXL A;  3SXY A;  2N8G A;  3TDZ C;  3RCO A;  3JRF A;  1ZGW A;  1Z1D A;  4AC0 A;  1FBU A;  3SFI A;  5JVT A;  3BRO A;  4L0Y B;  1PJR A;  1WWX A;  4MTD A;  2OQG A;  4N0B A;  1XMX A;  2ZFW A;  1SFO J;  2IRF G;  5M5W J;  3BR6 A;  4N9H A;  5EF6 A;  2R7W A;  2GBY A;  4UB6 C;  3E0J B;  4ENM A;  1FT9 A;  3KP7 A;  4BS9 A;  4JX6 A;  5KAF C;  4IPA A;  2MYS A;  2QQA A;  3R60 A;  4I6Z A;  3DPL C;  2FBI A;  3H1C A;  3ABL H;  1HW2 A;  4EGZ A;  2X6X A;  1R36 A;  2NOJ B;  2LRD A;  4HNV A;  1SAX A;  2LKX A;  2OBP A;  1DGR M;  2MC4 A;  3AG4 H;  3E7L A;  3ABU A;  3M8E A;  3T0Y A;  3TOA A;  3Q9V A;  1MBG A;  2M0C A;  1B1B A;  3A0H C;  4PJL A;  5HLH A;  1YFH A;  5CVU A;  1HC8 A;  5FKN A;  4S04 A;  2LRE A;  2Y2Z A;  2DW4 A;  2XB0 X;  3U1D A;  5GPC A;  3F21 A;  4XKB A;  2KJB A;  4NDL A;  2P0W A;  4XSZ F;  2VQG A;  4B1R A;  1NK2 P;  2DN0 A;  1YJ9 I;  2Q2E A;  2ZJ2 A;  3KLN A;  3E6C C;  3U9G A;  4EJW A;  1LKX A;  2MGQ A;  4HLX A;  2GXB A;  4KYW A;  1WPK A;  1U0J A;  4XIC A;  4E7L A;  2BXY A;  5HDN A;  4BJT A;  2XAQ A;  3ZCO A;  4RM3 A;  4X6A J;  1LVA A;  2ZJP F;  3JRE A;  2OAZ A;  3LA3 A;  2ME6 A;  2OZ6 A;  4A2U A;  4RAZ A;  1R5I D;  3EDP A;  4L9V A;  3CUO A;  4AWX B;  2E60 A;  3OYC A;  3E1S A;  3MKL A;  4G7H F;  1XMA A;  2GA1 A;  1B6A A;  2E1C A;  2CFX A;  3BJ6 A;  2G7U A;  3HOW J;  4FIS A;  4L9T A;  3RYP A;  2HKO A;  4PZJ A;  3LSR A;  2A61 A;  3BCA A;  1SFE A;  2PI0 A;  5D6E A;  1VQ4 I;  3RYR A;  2M8E A;  3J80 Z;  1J59 A;  2H94 A;  1LUJ B;  1YW7 A;  3CQZ J;  1R71 A;  5E1X A;  3QPT A;  1T0F C;  3CF2 A;  2R5Y B;  3K1M A;  3SJM A;  4FX4 A;  1FTT A;  3V8J A;  1AHD P;  3FKI J;  1L3L A;  3MKY B;  3BLY A;  5IOY A;  1TQP A;  3MVP A;  3FMR A;  1F36 A;  1RIO H;  3OSF A;  1IXR C;  3DU6 A;  4A6E A;  2UXN A;  3G3Z A;  1YS6 A;  2KHM A;  2W00 A;  2GXA A;  3ZMS A;  3KP6 A;  1ERD A;  1D0Y A;  3KP4 A;  4E7J A;  3IRQ A;  3CZ6 A;  4GRI A;  5J6X A;  3CJN A;  2R93 J;  2ZKZ A;  1P4X A;  3R6S A;  3GW2 A;  1FSE A;  1VQM I;  2NVU B;  3HOY J;  2XIG A;  3K9T A;  4ZYH A;  5CQG A;  1WJA A;  4U0V A;  3OYH A;  3OR1 C;  1YW9 A;  1SFK A;  2GIZ A;  5FKL A;  3SZG A;  1G3Y A;  4L5I A;  3DBR B;  1TTY A;  5DDG A;  2XV4 S;  2Z1D A;  4KN7 X;  4JOM A;  1BA5 A;  2Y75 A;  3DTI A;  1TBX A;  3UKG A;  4KIG A;  2IP2 A;  2O8K A;  4L9N A;  4FAS D;  4D1Q A;  3FZV A;  3QP5 A;  2E2H J;  1XCB A;  2L9V A;  1LB2 A;  4BQA A;  3AG3 H;  1FYK A;  2R92 J;  1ZAO A;  2DOD A;  3FF5 A;  4XOR A;  4J01 A;  1ZH5 A;  2V1D A;  3G1M A;  3J81 K;  2O8X A;  1RRJ A;  5HS8 A;  4EJU A;  2FX0 A;  3HRM A;  3RKQ A;  2CYY A;  2CV2 A;  2FML A;  4BBR J;  4DIQ A;  3P9C A;  3J7Y J;  2X9D A;  1MBE A;  2LBF A;  2I8D A;  3F6O A;  4EJT A;  3ABK H;  2Q2E B;  3W2V A;  3TBI A;  1VQ6 I;  4CCM A;  1Z3Y A;  2Q1Z B;  4I0A A;  4RAF A;  3JRI A;  2VON A;  1MBK A;  4NNJ A;  4C3I J;  3LQR A;  4DGW B;  2XRO A;  2YS9 A;  4EGY A;  3L7W A;  1JXS A;  1Z9C A;  3IWF A;  4BY7 J;  4XK4 A;  4XQF A;  2IXS A;  3TGN A;  1QU3 A;  3K4B A;  2X6W A;  4XLH A;  2F5D A;  4V19 K;  1ZLK A;  4G94 A;  4XLP F;  2GAU A;  3W2A A;  2DA7 A;  2GM4 A;  2XGC A;  4EJO A;  3WTX C;  2KPM A;  2OD5 A;  3NWT A;  4Q5S F;  1V5F A;  1W5S A;  3BG9 A;  3G1L A;  1SVL A;  1TW2 A;  2W85 A;  2QKL B;  1KQ0 A;  4D5C A;  1K4S A;  2GWR A;  4LGW A;  2EA2 A;  3HHG A;  1GV2 A;  3TP3 A;  2VJ4 A;  3KE2 A;  1XTA A;  4B4C A;  4BQN A;  3P9K A;  1JKP C;  4M3E A;  4XLE A;  3GVA A;  3BTI A;  2XF6 A;  2OF7 A;  4ZTF A;  3PJR A;  1WHU A;  2GQQ A;  2NVX J;  3S2W A;  2OTJ I;  1I3A A;  1QQI A;  3ECO A;  2J5O A;  1BIA A;  1K83 J;  1ODD A;  1R00 A;  4PFO A;  5F04 A;  4BYY A;  2JN6 A;  5F08 A;  1MH4 A;  1STZ A;  2ME0 A;  2PMH A;  3H36 A;  4CYD A;  2X6O A;  3K70 D;  4Y17 A;  2X0L A;  2UUZ A;  3GTL J;  4E7Z A;  1OYW A;  1USS A;  3K69 A;  1FOW A;  3TO9 A;  1MIJ A;  2VE9 A;  5CLS A;  1KU2 A;  3DFG A;  1SAU A;  2L7F P;  2K9S A;  2XPV A;  3ZRG A;  3S1N J;  4N4N B;  1I1G A;  2MD5 A;  2E1M B;  4F92 B;  1MDM A;  1SFX A;  2EV6 A;  2XAG A;  1Z7L A;  3N4M A;  3LQQ A;  2A68 F;  3GTK J;  3E5X A;  1T98 A;  3SDG A;  1H88 C;  4GXO A;  1A6I A;  2H27 A;  4HF1 A;  1WI3 A;  1ZGJ A;  2YU9 J;  4NBQ A;  6PAX A;  5CVV A;  2LNB A;  2XSJ C;  4P96 A;  5IYB J;  3GCM A;  2Z16 A;  2L4A A;  3TP0 A;  4HF0 A;  4GO1 A;  1SD6 A;  4RDU A;  3R4K A;  2HKX A;  5E18 F;  1ZG1 A;  3VWB A;  1YI2 I;  1OJL A;  2CG4 A;  3LA7 A;  4AVP A;  1IN8 A;  3U1K A;  4IL6 C;  1FWZ A;  4H0E A;  2W84 A;  2XKO A;  3E97 A;  1Y1V J;  3KYD B;  3GTJ J;  2Z5U A;  1ZRD A;  3WU0 A;  3WU1 B;  3WTU C;  3NQO A;  3DEU A;  3ECH A;  3KIO A;  4CCO A;  3HGG A;  4I01 A;  4I99 C;  1BI2 A;  1MSE C;  3PSF A;  2XAF A;  4A6D A;  4GFB A;  3AL0 B;  2ELJ A;  3V8L A;  2R7U A;  1LPQ A;  2R5Z B;  2X4H A;  3NRV A;  2DK5 A;  4II3 A;  1YJN I;  1E2X A;  2MLG A;  4I09 A;  1LJ9 A;  2YSR A;  2DA6 A;  2K9M A;  4XRM A;  2IA1 A;  3FK6 A;  2CW8 A;  3OYF A;  4UHT A;  2PFB A;  3VPR A;  3K0L A;  1NH3 A;  1T56 A;  2K86 A;  3CDL A;  1FBS A;  1K79 A;  2A69 F;  3HKZ N;  2KZV A;  1BIB A;  4FE4 A;  2XVC A;  4YFX F;  3M4O J;  2JTV A;  4KIC A;  2GZW A;  4A69 C;  2NAZ A;  5B1A H;  3QPH A;  1F5T A;  1DU6 A;  1ZYR F;  2AQE A;  2EIM H;  1YS7 A;  1ZK8 A;  4RB1 A;  1O3R A;  2BY1 A;  2O0Y A;  1VF9 A;  5CVI A;  4E6K G;  1ENH A;  1O3S A;  5DCF A;  2V1X A;  3DP7 A;  5E79 C;  2F48 A;  3T8T A;  5LEJ A;  1P9Q C;  2K4B A;  3HG9 A;  2M8G X;  3PQK A;  4ESJ A;  1Y1W J;  3PQJ A;  2Y30 A;  3DTK A;  2FJ1 A;  2Q8K A;  3KFW X;  2VJ5 A;  5FKK A;  2QGU A;  2RN7 A;  2Z2S B;  3AFH A;  5F27 A;  3N05 A;  4HEA 2;  3FDY A;  1IF1 A;  3TDU C;  4M9S A;  3HL2 A;  4X0G A;  3PUB A;  4BEH B;  5EGO B;  2JMW A;  1XG1 A;  5D5V B;  4O3M A;  2XRN A;  5J3L A;  3HOZ J;  4MEY F;  2EA4 A;  2M5W A;  4MTE A;  4IQJ A;  2BOL A;  3BDD A;  3T8R A;  3OMY A;  3HRT A;  4A12 A;  4BAY A;  4MGR A;  2MFZ A;  2MLK A;  3H9Q A;  2PJR A;  3BPX A;  3HOT A;  2GOM A;  2CQ7 A;  4V2G A;  2BVM A;  2FU4 A;  2OCE A;  3CP2 A;  5D8K B;  3C3W A;  4HST A;  4A3D J;  3ZMV A;  4YEL A;  2P5L C;  2RNJ A;  5GTH C;  2RGV A;  2JQ7 A;  4K2E A;  5DCM B;  1ZKG A;  4B09 A;  1TL8 A;  2XPW A;  4I2O A;  2LLK A;  2YR2 A;  2D2W A;  4U88 A;  1G59 A;  1R9T J;  3RKX A;  2F2E A;  4CCL A;  2QWW A;  4DOZ A;  2FNA A;  1MSF C;  1W36 C;  2VKD A;  1YG2 A;  3A01 B;  5CVR A;  2VQH A;  1A04 A;  3PM1 A;  3BR2 A;  1I39 A;  1GXQ A;  4C2U A;  1VQP I;  1JUS A;  1KGS A;  5A2Q K;  2QEN A;  2ZB9 A;  5BMZ A;  1MH3 A;  5EEA A;  2DJN A;  2HXI A;  1OCT C;  2XAS A;  4B48 A;  2FD5 A;  3LSG A;  3CDH A;  1PUF A;  2KRF A;  2WV0 A;  3I4M J;  3BCB A;  3HDD A;  1G3S A;  2ZXI A;  3WG7 H;  3HIF A;  1D0X A;  1X1D A;  4PGG A;  4PJ0 C;  2G0E A;  1BR2 A;  2E1O A;  1SVO A;  3CME I;  3COA C;  1HKQ A;  2KKO A;  4HV6 A;  2X1D A;  2CRG A;  3L2V A;  1LVK A;  1ZN2 A;  4AU7 A;  3OS0 A;  2X6Y A;  3OY9 A;  4F52 A;  4N4O B;  1FOK A;  1ZRC A;  2R7Q A;  2GXG A;  3VYS B;  2L54 A;  4PJN A;  3MKW B;  5BNG A;  3DEE A;  4G12 A;  3QOD A;  5FLM J;  1EV7 A;  1BJZ A;  1FIA A;  3L2W A;  1AWC A;  1MJA A;  5H6R A;  3LSP A;  1WH7 A;  3S32 A;  3LA2 A;  3V7R A;  3QPL A;  2V26 A;  4EVI A;  2H6C A;  5HLI A;  2W24 A;  5LD2 C;  1M1E B;  4HW0 A;  3KP2 A;  3MN2 A;  3BPV A;  5HS7 A;  3HUG B;  1IGN A;  1E17 A;  4KFC A;  4XLA A;  3BTC A;  4KMF A;  5E1W A;  3RSN A;  3CCU I;  3HOV J;  4JP0 A;  1D1C A;  3CTA A;  3OYA A;  1ON1 A;  1UZC A;  1WFX A;  2PEX A;  3FXK A;  4ZZD A;  4XID A;  3KP5 A;  4GYI A;  3CCR I;  2DOE A;  2DTR A;  4LG3 A;  1Y0U A;  2HZT A;  1PVE A;  2DOA A;  2F4O B;  1K78 B;  4QPO A;  2M0M A;  1BR1 A;  5AIP A;  2CUZ A;  2O9L A;  2QCO A;  2DFI A;  4IZZ A;  1WVR A;  1MGT A;  2HQ5 A;  1S8N A;  4XR6 A;  4F7Z A;  3VDX A;  2E1N A;  1RNL A;  3OYN A;  1O7L A;  4AID A;  1RUO A;  3ZMZ A;  5BQT A;  2RAE A;  1T95 A;  1XN7 A;  1BW5 A;  3ERE D;  3SZT A;  1TWF J;  1WKM A;  1YLF A;  2CGP A;  3CD6 I;  3BG6 A;  4XKC A;  4M6X A;  3CC2 I;  4MFE A;  3J80 K;  5J8C A;  1H9T A;  2CU7 A;  5CYV A;  2EZH A;  4GGG A;  3JCU C;  4ENJ A;  1F1Z A;  4LMY A;  4A3M J;  5E8G A;  2YX7 A;  4L5J A;  3OYG A;  2FOW A;  2I5U A;  4A5M A;  3CCE I;  2VL8 A;  4CXF A;  3OIP A;  2F4I A;  3L09 A;  1QA6 A;  1W0U A;  4EJV A;  5ICE A;  3FXL A;  3BR1 A;  3HZJ A;  4BXX J;  4ASN A;  5K1Y A;  1WJE A;  1P2F A;  5GP9 A;  2L01 A;  1RKT A;  3SYT A;  1PUE E;  1ETW A;  1R22 A;  3P5J A;  3S8P A;  4HQE A;  1G2H A;  5ILU A;  3C18 A;  2DMU A;  2LF7 A;  1U5T B;  2FRH A;  2MH2 A;  3QOE A;  2IS1 A;  2D1H A;  5H6Q A;  3FIW A;  4A0X A;  2K40 A;  1PUF B;  2P81 A;  3BJO A;  4EMS A;  2HVS A;  2K85 A;  1D5Y A;  4O6J A;  3L9F A;  4WXC A;  5IPA A;  4QSH A;  2M30 A;  4ZDP A;  3WHC A;  5J1U A;  3OOU A;  4YFN F;  2E5N A;  1T33 A;  4PK4 A;  3S3O A;  2HYF A;  4BJ6 C;  4YII A;  4KIS A;  4FQG A;  3BZ6 A;  3H0G J;  2F5V A;  1X3Z B;  1Y8Q B;  2HNH A;  1GV5 A;  2JA7 J;  4LG0 A;  2NNN A;  1C0W A;  2ISY A;  4IHS A;  2L02 A;  2A07 F;  1XGS A;  2EIK H;  4XLF A;  2KIM A;  3EUH C;  5IP6 A;  2QBY B;  2JA6 J;  1LE8 A;  2R7R A;  3B6A A;  5D5U B;  3PSI A;  4XN3 A;  5A2Q Z;  4LK0 F;  2JWT A;  4E7I A;  3LSH A;  3GZ5 A;  4FX0 A;  1KQ9 A;  3P9I A;  2V6C A;  2DI3 A;  5JHF A;  3CCY A;  1HDP A;  5J4Y A;  5LHI A;  5HDG A;  5HNF A;  3OIO A;  4ZJZ A;  1ETV A;  2DT7 B;  2HTS A;  4OMY A;  4OOI A;  3WGH A;  5FO5 A;  4EEF G;  3PIP F;  4AYB A;  5FKM A;  3IKV A;  3OYE A;  3B6C A;  2B9S A;  1MMG A;  1FOX A;  2HPM A;  1T8I A;  3I59 A;  4P5O A;  3TO7 A;  3JAM Z;  3F6V A;  4HDV A;  4UV9 A;  5JHU A;  2Y31 A;  2BV6 A;  2K5C A;  4DNC A;  5J4V A;  1S6L A;  2OC6 A;  2QM3 A;  2VKV A;  5IP9 J;  2JSP A;  3CUQ B;  4BU2 A;  4MQ9 F;  1BJA A;  2DA2 A;  2BW3 A;  4IOA F;  4OIN F;  1IW7 F;  2ESH A;  4YEJ A;  1FMW A;  3GTP J;  3MCZ A;  4UVB A;  3V7C A;  3GME A;  3F3X A;  1AOY A;  3QP6 A;  4FET A;  3ZOB A;  3KYL A;  3K1N A;  3TO6 A;  2KRH A;  3KCC A;  2P6T A;  4II2 A;  1B59 A;  2QZ8 A;  2FNP A;  2ZSI B;  1OIS A;  4ZYD A;  1VZ0 A;  1XDS A;  3K4C A;  5LRS A;  4C3J J;  2LY1 A;  4E70 A;  1PDN C;  3S3N A;  1SFU A;  2E19 A;  1FBQ A;  4RAG A;  4JX4 A;  3ZN1 A;  2RC4 A;  3I9V 2;  5GAD J;  2DFF A;  4RGX A;  3S17 J;  4BXU A;  3CJQ B;  3VSL A;  1G4D A;  1AU7 A;  2ZO4 A;  2DFH A;  3OYI A;  1KU7 A;  2FBH A;  3ERM A;  2UWM A;  1GLN A;  1BR4 A;  3MZY A;  2H1K A;  2PG4 A;  4F55 A;  1JKR C;  2VBY A;  4EM1 A;  2NS7 A;  1FY7 A;  1IJW C;  3HOX J;  1VQL I;  1NG6 A;  1AKH B;  2HI3 A;  1SMY F;  3N97 A;  1MJB A;  1RPW A;  1OCZ H;  4Q4Z F;  4U87 A;  3FMQ A;  2P4W A;  2LFB A;  3W6V A;  5LHG A;  5JLW A;  3HM5 A;  1TT5 B;  4RB3 C;  5K7Z A;  1D5V A;  1Z3X A;  5HNH A;  3KEQ A;  1X58 A;  2CW0 F;  3O8H A;  2K4J A;  3CO7 C;  1VQK I;  2K02 A;  1R5H A;  3LFK A;  4J00 A;  4IHY A;  1JJ8 C;  2K9N A;  2QQ8 A;  3G71 I;  3ZQH A;  3TW6 A;  5KAI C;  1K4T A;  2R7F A;  3O8G A;  1G3W A;  1R7J A;  5JR3 A;  5L3E A;  3SQN A;  1MBJ A;  2DTZ A;  2E2I J;  4MNU A;  1LE8 B;  3GFL A;  4RLF A;  2QYO A;  1ZRE A;  1LEB A;  2W4S A;  1N77 A;  1J09 A;  4ESB A;  3RPU A;  1ZGA A;  4G6D A;  4UNO A;  1OCC H;  4QIW N;  1NK3 P;  1JUP A;  2XAJ A;  3QYB A; 
#chains in the Genus database with same CATH homology
 3B02 A;  3LAJ A;  2P5V A;  2P8T A;  1FP1 D;  1Z6R A;  2FSW A;  4HBL A;  1I1S A;  5L3F A;  2HS5 A;  2MH9 A;  3GFM A;  3RI4 A;  4RGU A;  3KET A;  3I59 B;  4YFK F;  1VTN C;  2P5K A;  1XB4 A;  2HTJ A;  2VT2 A;  4M9X A;  3WTY C;  4R8H A;  2A3S A;  2H09 A;  1TQM A;  2C6Y A;  1U6G A;  3WE3 A;  1HST A;  3ELK A;  1MZB A;  1IN5 A;  1QNT A;  1I6X A;  5BPI A;  3LST A;  4HA8 A;  2F5F A;  3GFJ A;  4LJZ F;  2R7D A;  4R1H A;  2W57 A;  4FHT A;  2K7L A;  2P7C B;  1FX7 A;  3ZP5 A;  3ABT A;  1QZY A;  4HV5 A;  4FT8 A;  4HX7 A;  2A5Y B;  3EET A;  2ZCW A;  5D6F A;  2XAH A;  5HDK A;  3HRS A;  3H92 A;  4ON0 A;  4EM2 A;  1UHW A;  1Z6T A;  2ETH A;  1HXD A;  3W6K B;  4BHP A;  3BWG A;  4N9I A;  3FM5 A;  1QBJ A;  3L00 A;  2FMY A;  2EB7 A;  4KN4 X;  5LBQ A;  5ED4 A;  1MKM A;  1FLI A;  1FZP B;  4B8X A;  3VOD A;  5JI6 A;  4HF2 A;  3H3Z A;  4OIQ F;  1UB9 A;  1HKS A;  5HS9 A;  3BY6 A;  1HBX G;  1HQC A;  1PP7 U;  1R1T A;  2COM A;  3T5X A;  2PJP A;  5FLX Z;  4IJA A;  5LEK A;  5TJJ A;  1LDK B;  2J5P A;  3IKT A;  2BYV E;  1IN4 A;  4HX8 A;  5ILS A;  1W5T A;  4HAM A;  3EQL F;  2O61 A;  1GVJ A;  2FA5 A;  2VOD A;  2HQN A;  5DYM A;  3IL2 A;  2MC3 A;  3SFZ A;  2Y48 A;  5LGU A;  2EV5 A;  4M74 A;  3CLO A;  1JE8 A;  1L0O C;  5ERI A;  5HVQ C;  2FOK A;  2IT0 A;  3EYI A;  2QVO A;  4Q47 A;  3FHZ A;  3DPT A;  1T0F A;  3WTZ A;  3J7A O;  3HSE A;  3IC7 A;  2LDU A;  1JGS A;  4WWC A;  3WGG A;  5L3C A;  2DQL A;  1T39 A;  1IN7 A;  2V1U A;  3D5L A;  4D0P A;  1Z7U A;  4GCV A;  3Q5F A;  2KIF A;  1S7O A;  1B9N A;  2DLL A;  3ZMT A;  1ZRF A;  4U7D A;  2UXX A;  1CF7 A;  1REP C;  5KVR A;  3WOD F;  1J2X A;  5LGN A;  2OA4 A;  2EWN A;  2Z33 A;  3R0A A;  4JK1 X;  4LLG F;  2E7W A;  1EH7 A;  1UFM A;  2PMU A;  2RDP A;  5DUI A;  1DDN A;  3M1E A;  5LHH A;  2FF4 A;  2DPU A;  2KJC A;  1R23 A;  2Z9O A;  1BC7 C;  4P55 A;  4KA4 A;  1CGP A;  1BC8 C;  4OMZ A;  2XUB A;  1TQI A;  4UVA A;  2WTE A;  2STT A;  5F64 A;  4G9Y A;  4DQ2 A;  3L2C A;  3WTV C;  4XBF A;  1TLH B;  3C7J A;  2JZY A;  1YYV A;  3RJP A;  1MDM B;  5D8L B;  3FXQ A;  2DU9 A;  3I58 A;  5K5R A;  3W6J B;  2FQ3 A;  1ZLJ A;  3V8K A;  3MEX A;  2K27 A;  3F8B A;  3FMS A;  1PP8 F;  1RI7 A;  1DPR A;  1IUY A;  2NYX A;  4I7H A;  1K6O A;  4G7O F;  2CSO A;  1GXP A;  3F22 A;  2L4M A;  2IA2 A;  1J75 A;  1ZG5 A;  2R3S A;  3FXR A;  2LKP A;  2HWV A;  5ILV A;  5HOO A;  4RB0 A;  3JAM K;  4M72 A;  2BBY A;  3HSR A;  4MHG A;  1Q1H A;  3D0S A;  4Y15 A;  4OIO F;  3V7S A;  4ENK A;  1XMK A;  1P6R A;  4YG2 F;  2RVC A;  1CF7 B;  4PGH A;  3ZPL A;  4S05 A;  2JPB A;  5EEG A;  5D5W B;  3E5U A;  1Z91 A;  2D1V A;  5IT9 Z;  3DQV C;  4U7B A;  1BI0 A;  1FP2 A;  4BNC A;  5DEQ A;  2LSO A;  2OQR A;  1LNW A;  3MQ0 A;  3KZY A;  1OKR A;  3ZN0 A;  3DF8 A;  1D3Y A;  3F72 A;  5LRR A;  2NS0 A;  5BOX A;  2XHK A;  3ISP A;  2BE5 F;  2KIU A;  4Z2Y A;  2QQ9 A;  4KIF A;  1XSX A;  1P4A A;  3IRR A;  1T2K A;  5E20 A;  2Y0M A;  1XD7 A;  1OR7 A;  3JTG A;  1ZG3 A;  1FOK A;  4HQM A;  2EJR A;  2QQB A;  2VT3 A;  4KNY A;  4NQW A;  4A0Y A;  5IT3 A;  3R0J A;  4RGS A;  4CZZ A;  3HRU A;  1QPM A;  1LQ1 A;  3WTW C;  3DXJ F;  5LGT A;  5DV5 A;  4HLY A;  2DAO A;  1MJ9 A;  2A6E F;  1FSH A;  1YO5 C;  2ELH A;  4A0Z A;  2VN2 A;  4HZF A;  3DV8 A;  2BEO A;  5KK1 A;  4U0Y A;  3VEP A;  2DT5 A;  1QGP A;  2VBZ A;  1H0M A;  4LD5 A;  1FNN A;  3GWZ A;  3K1P A;  1IZ1 A;  1IAW A;  3F8F A;  3KP3 A;  2WC2 A;  2FBK A;  3MZH A;  4YIF A;  1YQA A;  2G7H A;  4IVN A;  4CDG A;  3QU6 A;  1KU9 A;  2YU3 A;  4RAY A;  4ENN A;  3HYI A;  3MAJ A;  3JTH A;  4XLN F;  4LB6 B;  3FXU A;  2D45 A;  3E6D A;  4KT5 C;  5L3G A;  3IHU A;  5D5X B;  5BPD A;  2JPC A;  3FX3 A;  4BHC A;  1D8K A;  2EK5 A;  2HGC A;  1OMI A;  4M71 A;  3ULQ B;  1FYL A;  4EQQ A;  1X3U A;  5FFZ A;  2RQP A;  3QAH A;  5E17 F;  4I02 A;  1KQ8 A;  1KYZ A;  1H9G A;  2RKH A;  2EV0 A;  2O6G E;  3F23 A;  2JSC A;  4QWQ A;  4AIK A;  3E6M A;  1HW5 A;  1DUX C;  4P9F A;  3H3U A;  2Z3Y A;  1BN5 A;  2XGX A;  2EFN A;  2PN6 A;  3I64 A;  4Y13 A;  2VC1 A;  3ML6 A;  5ICG A;  4HDU A;  3GZ6 A;  1IXC A;  5ICC A;  1U78 A;  5FLX K;  2V9V A;  3OOP A;  2RV8 A;  3SZP A;  4XRF A;  2HEO A;  5D4R A;  1R58 A;  1XGO A;  5LLQ A;  2ZNY A;  4EM0 B;  3Q9S A;  1LEA A;  5H20 A;  1T38 A;  4LB5 A;  2DBB A;  4RS8 A;  4IRG A;  3TQN A;  2E7X A;  3LWF A;  2FXA A;  2HOE A;  2P7V B;  3TKY A;  1KU3 A;  5ICF A;  1BBY A;  4QLC U;  4LG0 B;  2ADU A;  5TRD A;  1DPU A;  2CO5 A;  5HLG A;  2PLY A;  4CIC A;  3O2P E;  4TV7 A;  3ZMD A;  4R79 A;  2V79 A;  5K5O A;  1P4W A;  2Q0O A;  4UUV A;  2WWY A;  4ESF A;  2HFH A;  4WXH A;  1XGM A;  2BGC A;  4MEX F;  4UXN A;  2GA2 A;  2JRT A;  2W25 A;  3QU3 A;  4IXA A;  4G7Z F;  4WCG A;  3REO A;  2OU2 A;  1OYY A;  3KLO A;  3I5U A;  2JT1 A;  3KEO A;  1ON2 A;  1UHM A;  4G8X A;  1BI3 A;  1WI9 A;  2VE8 A;  2A6H F;  2IVM A;  4EV0 A;  2B0L A;  4I0B A;  2VC0 A;  3F8C A;  1W4M A;  2VXZ A;  1FC3 A;  5D4S A;  1W7P A;  1JHH A;  3EUH A;  3RPQ A;  1FYM A;  2EFQ A;  1IXS B;  3C1D A;  3TOB A;  4M9Z A;  3RKW A;  5FFX A;  2QLZ A;  5L3D A;  1UCR A;  2EFW A;  1V4R A;  1TNS A;  3I0T A;  5DD4 A;  4IHT A;  4PDK A;  1U3E M;  1F4K A;  2IW5 A;  3WE2 A;  3WGI A;  1U5T C;  2TDX A;  3HHH A;  1SD7 A;  3BP8 A;  2HQR A;  4WX9 A;  1IRG A;  3M7G A;  4A5N A;  2DPD A;  1BOA A;  2O03 A;  3BOQ A;  1R1V A;  1O57 A;  1ONV A;  3O3K A;  4O5V A;  1O3Q A;  3JW4 A;  3V4G A;  2XKP A;  5AON A;  4I98 B;  1OPC A;  2LF8 A;  3F8N A;  3ROU A;  4ZYE A;  2NNY A;  2ACJ A;  3HTS B;  1BM9 A;  3VB2 A;  1J9I A;  4XSX F;  3RDI A;  3P7N A;  1ZHF A;  5DCM A;  1I27 A;  4LLL A;  3WTT C;  1U8R A;  5E1Z B;  2PBI A;  1YTY A;  4LLN A;  1JHF A;  5CVJ A;  2M87 A;  2CWE A;  3JSP A;  4BH9 A;  1J7K A;  1XGN A;  1BI1 A;  2DO7 A;  5IT9 K;  4NHJ A;  1WRJ A;  3I53 A;  3CUQ C;  1MD0 A;  5DUK A;  1W7P B;  1O7F A;  4IRI A;  3VFZ A;  4GYG A;  2GIV A;  4AD9 A;  1KYW A;  1SMT A;  1V3F A;  1LDJ A;  5L3B A;  4M73 A;  1S29 A;  1XCV A;  3IWZ A;  2P6S A;  1HKT A;  1OYI A;  2H6B A;  1QZZ A;  3WTS C;  4ZZL A;  3SHF A;  4ZYG A;  4M6Y A;  3O6B B;  4NB5 A;  1LDD A;  2L3D A;  2NRA C;  2G9W A;  5E8I A;  2M1B A;  4HX4 A;  4G6Q A;  1RZ4 A;  2DK8 A;  3BJA A;  1I5Z A;  3MFK A;  3J81 Z;  2O3F A;  2EFO A;  4LFU A;  4ETS A;  1IRF A;  3I54 A;  3DKW A;  2VBX A;  3HUG A;  3GXO A;  2UZK A;  3GYH X;  3LAP A;  3QOP A;  2IPQ X;  3GF2 A;  4L0Z B;  1WSU A;  1XDU A;  1G3T A;  1J5Y A;  1S7A A;  2MBF A;  3FM3 A;  1K78 A;  1GHC A;  4WF2 A;  4KIB A;  2ZBK A;  4ZH4 F;  4U0W A;  2ISZ A;  5F6F A;  3GX4 X;  5FD5 A;  4UVC A;  1HSJ A;  1B4A A;  5JFR A;  1TW3 A;  2AS5 F;  4JQF A;  3ZQ7 A;  3ZMU A;  1UST A;  3AAF A;  1SD5 A;  2ZNZ A;  1TNT A;  4WXD A;  4OU0 A;  1HW1 A;  1U5T A;  1O3T A;  4KUM A;  4IF4 A;  3E5Q A;  1ULY A;  1FPQ A;  3RIR A;  2ZME A;  3T1B A;  5BS6 A;  1XSD A;  1IN6 A;  1Z05 A;  2F5E A;  4AIJ A;  3EYY A;  3GFI A;  4IRH A;  2FEZ A;  3E3V A;  5CJ9 A;  3RKY A;  4BHB A;  2HYG D;  1K7A A;  5AIQ A;  2QBY A;  2DQR A;  3U2R A;  3I71 A;  5J8F A;  2HDC A;  3M9A A;  3E6B A;  1ZAR A;  1SD4 A;  3R61 A;  2QUF A;  1J0R A;  5FD6 A;  2STW A;  2VOP A;  3VOE A;  5FGM A;  1DP7 P;  2VOO A;  4HOB A;  1NHA A;  3M8F A;  1T6S A;  2ESN A;  4UV8 A;  3OV8 A;  4P9U A;  2IA0 A;  3KZZ A;  3CUQ A;  2F5C A;  1YIO A;  4OIP F;  1XSV A;  1G6N A;  1S3J A;  2HR3 A;  4CGZ A;  3HSF A;  3G73 A;  4MQV A;  1D8J A;  2IJL A;  3GUD A;  5FB2 A;  3FWE A;  3PFI A;  2YX4 A;  4CO8 A;  2EFP A;  3CO6 C;  3GLX A;  1U2W A;  4HYE A;  2ZXJ A;  4OIR F;  3GO5 A;  2M45 A;  3HTU A;  5F1R A;  2FE3 A;  3HOS A;  3JSO A;  4CHU A;  2CQK A;  1P92 A;  2OZU A;  1EH8 A;  3GEZ A;  4PCQ A;  3MWM A;  4LK1 F;  4RB2 C;  4JBA A;  3RTR A;  2MA3 A;  1QO0 D;  3QRF F;  1YW8 A;  3F8M A;  4AIH A;  2YPR A;  5EEH A;  3WG9 A;  2ZME B;  4WK8 F;  3NEU A;  1WQ2 A;  4L9J A;  4Q48 A;  3B73 A;  2VBW A;  3K2Z A;  4RGR A;  1R5G A;  4L18 B;  1B9M A;  1W7P D;  1KA8 A;  1EH6 A;  1F9N A;  3I4P A;  4KMU X;  1R1U A;  5K5Q A;  1RUN A;  2PQ8 A;  4KDP A;  2Z99 A;  5DD8 A;  2AXL A;  3SXY A;  3TDZ C;  1Z1D A;  1FBU A;  5JVT A;  4L0Y B;  3BRO A;  1WWX A;  4MTD A;  2OQG A;  4N0B A;  2ZFW A;  2IRF G;  4N9H A;  4ENM A;  1FT9 A;  3KP7 A;  4IPA A;  2QQA A;  3R60 A;  3DPL C;  2FBI A;  1HW2 A;  4EGZ A;  1R36 A;  1SAX A;  2OBP A;  3ABU A;  3M8E A;  3TOA A;  3T0Y A;  3Q9V A;  5HLH A;  1B1B A;  1YFH A;  5CVU A;  4S04 A;  2DW4 A;  3U1D A;  3F21 A;  2KJB A;  4XSZ F;  2Q2E A;  2ZJ2 A;  3KLN A;  3E6C C;  3U9G A;  4EJW A;  4HLX A;  2GXB A;  4KYW A;  5HDN A;  2XAQ A;  1LVA A;  2OAZ A;  3LA3 A;  2OZ6 A;  4A2U A;  4RAZ A;  3EDP A;  4L9V A;  3CUO A;  4AWX B;  4G7H F;  1XMA A;  2GA1 A;  1B6A A;  2E1C A;  2CFX A;  3BJ6 A;  2G7U A;  4L9T A;  3RYP A;  2HKO A;  4PZJ A;  2A61 A;  1SFE A;  2PI0 A;  5D6E A;  3RYR A;  2M8E A;  3J80 Z;  1J59 A;  2H94 A;  1YW7 A;  5E1X A;  3QPT A;  4FX4 A;  3K1M A;  3V8J A;  1L3L A;  1TQP A;  3FMR A;  1RIO H;  1IXR C;  4A6E A;  2UXN A;  3G3Z A;  1YS6 A;  3ZMS A;  3KP6 A;  3KP4 A;  3IRQ A;  5J6X A;  3CJN A;  2ZKZ A;  1P4X A;  3R6S A;  3GW2 A;  1FSE A;  2XIG A;  3K9T A;  4ZYH A;  4U0V A;  1YW9 A;  1G3Y A;  4L5I A;  1TTY A;  5DDG A;  2XV4 S;  4KN7 X;  2Y75 A;  1TBX A;  4KIG A;  2IP2 A;  4L9N A;  3FZV A;  3QP5 A;  1XCB A;  1LB2 A;  4BQA A;  1FYK A;  1ZAO A;  3FF5 A;  1ZH5 A;  2V1D A;  3J81 K;  2O8X A;  5HS8 A;  4EJU A;  3HRM A;  2CYY A;  2FML A;  3P9C A;  3F6O A;  4EJT A;  4I0A A;  2VON A;  3LQR A;  2XRO A;  4EGY A;  3L7W A;  1JXS A;  1Z9C A;  3IWF A;  3TGN A;  2F5D A;  1ZLK A;  4G94 A;  4XLP F;  2GAU A;  4EJO A;  3WTX C;  2OD5 A;  4Q5S F;  1W5S A;  1TW2 A;  2W85 A;  1KQ0 A;  2GWR A;  4LGW A;  2EA2 A;  3HHG A;  3KE2 A;  3P9K A;  3GVA A;  2GQQ A;  3S2W A;  1QQI A;  3ECO A;  2J5O A;  1BIA A;  1ODD A;  1R00 A;  4BYY A;  1STZ A;  2PMH A;  4CYD A;  4Y17 A;  2X0L A;  1OYW A;  1USS A;  3K69 A;  3TO9 A;  2VE9 A;  5CLS A;  1KU2 A;  3DFG A;  1I1G A;  2MD5 A;  1MDM A;  1SFX A;  2EV6 A;  2XAG A;  3N4M A;  3LQQ A;  2A68 F;  3E5X A;  1T98 A;  4GXO A;  2H27 A;  4HF1 A;  1ZGJ A;  6PAX A;  5CVV A;  2LNB A;  4P96 A;  2L4A A;  4HF0 A;  4GO1 A;  1SD6 A;  3R4K A;  2HKX A;  5E18 F;  1ZG1 A;  2CG4 A;  3LA7 A;  4AVP A;  1IN8 A;  1FWZ A;  4H0E A;  2W84 A;  2XKO A;  3E97 A;  2Z5U A;  1ZRD A;  3WU0 A;  3WU1 B;  3WTU C;  3NQO A;  3DEU A;  3ECH A;  4I01 A;  1BI2 A;  2XAF A;  4A6D A;  3V8L A;  2X4H A;  3NRV A;  2DK5 A;  1E2X A;  2MLG A;  4I09 A;  1LJ9 A;  2YSR A;  2IA1 A;  4UHT A;  2PFB A;  3K0L A;  2K86 A;  1FBS A;  1K79 A;  2A69 F;  1BIB A;  2XVC A;  4YFX F;  2JTV A;  4KIC A;  2GZW A;  2NAZ A;  3QPH A;  1F5T A;  1ZYR F;  1YS7 A;  4RB1 A;  1O3R A;  2O0Y A;  5CVI A;  1O3S A;  5DCF A;  2V1X A;  3DP7 A;  3T8T A;  5LEJ A;  2K4B A;  3PQK A;  4ESJ A;  3PQJ A;  2Q8K A;  3KFW X;  2RN7 A;  1IF1 A;  3TDU C;  4M9S A;  5D5V B;  4O3M A;  2XRN A;  4MEY F;  2EA4 A;  2M5W A;  4MTE A;  3BDD A;  3T8R A;  3HRT A;  4A12 A;  4BAY A;  4MGR A;  2MLK A;  3BPX A;  3HOT A;  2FU4 A;  5D8K B;  3C3W A;  3ZMV A;  2P5L C;  2RNJ A;  2RGV A;  4K2E A;  5DCM B;  4B09 A;  4I2O A;  2YR2 A;  2D2W A;  4U88 A;  3RKX A;  2F2E A;  2QWW A;  2FNA A;  1YG2 A;  5CVR A;  1A04 A;  1GXQ A;  5A2Q K;  1KGS A;  2QEN A;  5BMZ A;  2XAS A;  3CDH A;  2KRF A;  2WV0 A;  1G3S A;  3HIF A;  4PGG A;  3COA C;  1HKQ A;  2KKO A;  4HV6 A;  1ZN2 A;  1ZRC A;  2GXG A;  2L54 A;  1AWC A;  1EV7 A;  1MJA A;  5H6R A;  3LA2 A;  3V7R A;  4EVI A;  2H6C A;  5HLI A;  2W24 A;  4HW0 A;  3KP2 A;  3BPV A;  5HS7 A;  1E17 A;  4KFC A;  4KMF A;  5E1W A;  3CTA A;  1ON1 A;  4ZZD A;  2PEX A;  3KP5 A;  4GYI A;  2DTR A;  1Y0U A;  2HZT A;  1K78 B;  5AIP A;  2DFI A;  1MGT A;  1S8N A;  4F7Z A;  2E1N A;  1RNL A;  1O7L A;  1RUO A;  3ZMZ A;  5BQT A;  1XN7 A;  3ERE D;  3SZT A;  1WKM A;  1YLF A;  2CGP A;  4M6X A;  3J80 K;  5J8C A;  1H9T A;  5CYV A;  4GGG A;  4ENJ A;  1F1Z A;  4LMY A;  5E8G A;  2YX7 A;  4L5J A;  4A5M A;  4CXF A;  3L09 A;  4EJV A;  5ICE A;  4ASN A;  5K1Y A;  1P2F A;  2L01 A;  1PUE E;  1R22 A;  4HQE A;  5ILU A;  3C18 A;  2LF7 A;  1U5T B;  2FRH A;  2MH2 A;  2D1H A;  5H6Q A;  4A0X A;  3BJO A;  4EMS A;  4O6J A;  3L9F A;  4WXC A;  2M30 A;  4YFN F;  2HYF A;  4YII A;  3BZ6 A;  4LG0 A;  2NNN A;  1C0W A;  2ISY A;  4IHS A;  2L02 A;  2A07 F;  1XGS A;  2KIM A;  2QBY B;  5D5U B;  5A2Q Z;  4LK0 F;  3GZ5 A;  4FX0 A;  1KQ9 A;  3P9I A;  2V6C A;  2DI3 A;  5LHI A;  5HDG A;  2HTS A;  4OMY A;  4OOI A;  3WGH A;  5FO5 A;  3IKV A;  3I59 A;  4P5O A;  3TO7 A;  3JAM Z;  3F6V A;  4HDV A;  4UV9 A;  5JHU A;  2BV6 A;  4DNC A;  1S6L A;  2QM3 A;  3CUQ B;  4MQ9 F;  1BJA A;  4OIN F;  1IW7 F;  2ESH A;  3MCZ A;  4UVB A;  3V7C A;  3F3X A;  1AOY A;  3QP6 A;  3K1N A;  3TO6 A;  3KCC A;  2P6T A;  1B59 A;  2QZ8 A;  2FNP A;  4ZYD A;  1XDS A;  5LRS A;  4E70 A;  1PDN C;  1SFU A;  1FBQ A;  3ZN1 A;  2RC4 A;  4RGX A;  4BXU A;  1G4D A;  2ZO4 A;  1KU7 A;  2FBH A;  2UWM A;  3MZY A;  2PG4 A;  2VBY A;  4EM1 A;  1FY7 A;  1SMY F;  3N97 A;  1MJB A;  4Q4Z F;  3FMQ A;  2P4W A;  5LHG A;  4RB3 C;  1D5V A;  3KEQ A;  2CW0 F;  2K4J A;  3CO7 C;  2K02 A;  1R5H A;  3LFK A;  2R7F A;  1G3W A;  1R7J A;  5JR3 A;  5L3E A;  3SQN A;  4MNU A;  3GFL A;  2QYO A;  1ZRE A;  1LEB A;  4ESB A;  3RPU A;  1ZGA A;  4G6D A;  4UNO A;  2XAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...