2DA5A

Solution structure of the second homeobox domain of zinc fingers and homeoboxes protein 3 (triple homeobox 1 protein)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GSSGSSGPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 3
publication title Solution structure of the second homeobox domain of Zinc fingers and homeoboxes protein 3 (Triple homeobox 1 protein)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da5A00
3G1LA 1AHDP 5IP9J 3GTPJ 3WHCA 5M5XJ 5C44J 1S7EA 2R93J 2VPRA 4JP0A 4D7NA 5K7FA 4MFDA 3C2BA 2GBYA 2E2IJ 3M3YJ 5FKKA 5EG0B 3JRGA 5J1UA 3TW6A 1JTXA 2EH3A 5C4JJ 3JRAA 1ETVA 2RAEA 2O9LA 2E1OA 1D5YA 3GTQJ 3S1RJ 1DU0A 3RQIA 3H0GJ 4A3KJ 5EGOB 3JREA 1JGGA 4XRSG 1JJ8C 5IOYA 2HQ5A 2G0EA 3HOUJ 2HDDA 4IHWA 5F08A 3HKZN 4FTHA 1NK3P 1MBKA 5EYRA 4AYBN 4D5FA 1HLVA 4D7MA 1WCMJ 1T33A 1LE8B 3S16J 4XRMA 5IPAA 2DA1A 2L7FP 4IHYA 3IH3A 1NTCA 2X9DA 1VNDA 2QF7A 5E3OA 1RESA 2JA7J 2MW8A 3HOWJ 1B8IA 1UHSA 1MNMC 4G12A 2DA5A 1X58A 1MSEC 2K40A 2NVXJ 2XSDC 2VI6A 4DYQA 2E2JJ 3HOZJ 2VKEA 3JRDA 1ETQA 4AC0A 3JRCA 3OOUA 1JJ6C 3HGYA 2XGEA 1IRZA 4A3GJ 4LOCA 2P81A 1TWGJ 3GTLJ 3FK6A 5K7ZA 4EEFG 2JA5J 1BW5A 2LR8A 1FIPA 2L7ZA 2MSYA 2K9QA 2VKVA 5EZGA 2ELKA 2L0KA 3BQZA 1T56A 4MLOA 2HXIA 4AUXA 4RBOA 3IH2A 3IV5A 3DEWA 2XRLA 3DCFA 3LNQA 2WAQN 4MIMA 2CUEA 1WH5A 1F36A 3WHBA 3BQYA 4JYKA 4I6ZA 2TRTA 3B6AA 1OCPA 2ID3A 2YU9J 1HDPA 1JTYA 5FLMJ 2YS9A 1FJLA 4BKXA 1XG1A 2M2EA 2TCTA 1ZQ3P 2M8GX 4HNVA 5FJ8J 3GBGA 1RKTA 1BW6A 1LFUP 1QRYA 3NARA 4M6VA 5IYCJ 3FIWA 2R5ZA 5F04A 3G1MA 4S0HB 2XPVA 3OIOA 1GV5A 1IV6A 3M4OJ 2Y2ZA 1I50J 2FQ4A 3ZQCA 3HOYJ 2ZB9A 4ABZA 2ME0A 3BR2A 3QPSA 1Z0XA 3QQAA 3TEDA 2R92J 2O7OA 1JKOC 1FEXA 1IDYA 1B72A 2CU7A 4A93J 2M0CA 3A01A 2XPUA 1HF0A 3ZQGA 2JMWA 3S1MJ 3BTCA 1FIAA 1ZKGA 1GT0C 3BTLA 4FISA 3SJMA 5F27A 3TP3A 1ZK8A 2EZLA 1BJZA 3S2HJ 2JJ7A 1VFCA 1PUFA 1BL0A 4M3BA 4V2GA 2GLOA 2Y30A 3BTIA 1X2NA 4A3IJ 5FLVA 3S1NJ 1K61A 2LVSA 5E3NA 2ID6A 1UMQA 2DMQA 2K9SA 3FISA 1K83J 1YRNB 4W97A 1XC5A 1IG7A 1OCTC 4DZJA 1BA5A 2NVYJ 4M3GA 4BBSJ 1UG2A 1QVUA 3JRFA 4JX5A 4IHVA 4FCYA 3OSGA 3L1PA 5HODA 3O8GA 2XB5A 1ETWA 5FKNA 3BR1A 1SANA 5IYDJ 2FD5A 3CCYA 5F0FA 3HM5A 2B63J 2M34A 5FKOA 1VI0A 1W0TA 5K7HA 1MBFA 3JRIA 2I10A 4W1UA 4UUSA 2LK2A 2R5YA 2DA7A 1IJWC 2MG4A 1EF4A 2K9NA 3BR3A 3RZDJ 3S2DJ 1ZR4A 3S17J 2AO9A 3QPLA 3ZQFA 3JRHA 1JT6A 2LY9A 3JRBA 1ZGWA 1TWHJ 2AHQA 2HOAA 2NOGA 1ZR2A 1U78A 3PO2J 1OJLA 2DMPA 4XK4A 1R9TJ 3BR0A 1WGXA 4A69C 2R5ZB 1AKHA 2NVQJ 1RR7A 2EQRA 1MH3A 1RPWA 1P7JA 2EBIA 4DYRA 4A3LJ 2LLKA 4CYCB 9ANTA 3GTMJ 2CQQA 4A3CJ 4A3BJ 2CJJA 4FE4A 2OPTA 1IGNA 2HXOA 5EG0A 3UKGA 1GV2A 3A01B 3GTOJ 1HOMA 3K2AA 2DN0A 4A3DJ 1GDTA 1MSFC 4JX4A 2NS8A 1MBGA 1GUUA 2LTPA 2XPWA 1NK2P 3O8HA 3SFIA 2IBDA 4C3IJ 3TP0A 1H88C 1P7IA 3LSGA 3LOCA 1ZTRA 3ZQHA 1IC8A 3TW7A 5M5WJ 2CUFA 2EZKA 2X48A 2XGCA 2KDZA 2COBA 3GTJJ 3MN2A 2DJNA 1ETYA 2FX0A 1FTTA 1LFBA 1GVDA 3HGGA 2DMUA 5EDNA 3LSJA 1H89C 1IDZA 3BR6A 2CRGA 2M9HA 5J1RA 3FKIJ 1A6IA 3HDDA 3IH4A 4BBRJ 3I4MJ 2JWTA 4B1RA 1XS9A 4M3DA 1JKPC 5GP9A 3S14J 4QSHA 2DA4A 5C4XJ 2DMNA 2JA6J 1G2HA 4UUSB 4A3JJ 1Y1WJ 2Y9YA 4DZPA 2DA3A 1B8IB 1JKQC 3LSPA 3Q0UA 4DW6A 2Y0SN 2ECBA 1JUMA 1TWAJ 5DS9A 4JX6A 3BG3A 3FK7A 4XRSA 2R7ZJ 3BT9A 5M5YJ 1HCRA 4Y52J 2LP0A 1VF9A 2X6OA 3W6VA 3NAUA 3VPRA 2IAIA 3OSFA 3HBLA 4IEJA 2Y9ZA 1Q1VA 1W0UA 5JLXA 5FKLA 5F0HA 1ETOA 2H1KA 3D1NI 2JK3A 5JLWA 4BY7J 1WI3A 1TWCJ 1Z77A 3I4NJ 4BXXJ 2KT0A 3CQZJ 2FJ1A 2WB1N 1JUSA 1U9NA 1AU7A 2HOTA 4C2MJ 2DMTA 4B4CA 1ENHA 5E3MA 3JR9A 3HOVJ 5EZHA 3F0CA 3ZQIA 3A02A 1X2MA 3Q3SA 4UUTA 5F0CA 1H8AC 3ZQLA 4X1EA 4C3JJ 2E19A 2D5VA 3RKQA 2DA2A 5M3MJ 1ETKA 2Y31A 2GM4A 1ITYA 3MKLA 2XGDA 5IYBJ 2NS7A 1CQTA 2L7MP 1I3QJ 3A03A 3HOXJ 1IUFA 2JN6A 5IP6A 2YUSA 2HOSA 1SFOJ 3BR5A 3Q0WA 3G1OA 1JKRC 4QIWN 2EZHA 3Q0VA 5C3EJ 2VUMJ 1FTZA 4M3FA 2LKXA 1POGA 4B3AA 1I6HJ 3S15J 1MBEA 1B72B 3MVPA 3CMYA 1F43A 1ORKA 3ZOBA 3BG5A 1O4XA 2DA6A 5F1JA 4X6AJ 1DU6A 2ECCA 2IEKA 4I76A 1E3OC 3GTKJ 4RDUA 1YRNA 2DTZA 3CDLA 2MGQA 2WV1A 2XB0X 4FE7A 4DYCA 5EGOA 1PUFB 3BG9A 4MFEA 4M3EA 4NDLA 5M3FJ 1OFCX 2HI3A 1QVTA 3E7LA 4A3EJ 1WH7A 5FKMA 2W48A 3SDGA 4XIDA 4QTRA 3K7AJ 1MBHA 1LE8A 5GPCA 2H8RA 1U8BA 1APLC 2LFBA 1U9OA 2NVTJ 1WPKA 4J19A 3RZOJ 4XICA 1RETA 3BTJA 3B6CA 4IHXA 5IOZA 2LD5A 1HDDC 1MH4A 2N8GA 4Y7NJ 3S1QJ 1QPIA 3HEFA 5IP7J 3GTGJ 2EZIA 4A3FJ 5BNGA 4MO7A 5J3LA 4L5EA 3LSRA 2R5YB 5EEAA 5EF6A 3H3VK 2CQXA 5GPAA 2QCOA 2OF7A 2JA8J 1ETXA 1Y1VJ 2ME6A 2R0QC 4A3MJ 2O8KA 5DTDA 1A5JA 3PM1A 4C3HJ 1JUPA 1MBJA 4CYCA 4GFBA 5E3LA 3PO3J 2PMZN 4V2FA 1TWFJ 1AKHB 1RKWA 1TC3C 2L9RA 3HB9A 4D5CA 5J1YA 2HYJA 2E2HJ 4BY1J 1JT0A
chains in the Genus database with same CATH superfamily
1BIAA 2P5LC 3G1LA 2VODA 3WHCA 5M5XJ 2LY2A 3BG6A 5C44J 4Q48A 3I3LA 1O7LA 4D7NA 5K7FA 4RGRA 1O3RA 4CCKA 3C2BA 3KETA 4KUMA 2X1CA 4IXAA 1Y0NA 5AIQA 3BG7A 5J1UA 3JRGA 4LJZF 2EH3A 2W57A 4PFOA 4ZDLA 4ENNA 2QBYA 1Z6TA 2O9LA 3IHUA 3OR1C 3T0YA 1DUXC 2L9NA 4B8XA 1IXSB 2EV0A 4MEXF 1YS7A 1DU0A 2Y0SA 3H36A 3H0GJ 4A3KJ 2NRAC 4NQWA 3CLOA 2BVLA 2V9VA 1D5VA 4PGHA 4QPOA 2HQ5A 1PVEA 2CS3A 2KIMA 2XAUA 2IGMA 4F91B 2G9WA 3PQJA 1J9IA 1R49A 2R7VA 4DGWB 3J7ZI 4D5FA 1HXDA 3VSKA 1ZN2A 4D7MA 2M87A 2O5RA 2Z1DA 3KZIC 4XRMA 3VFZA 1YQAA 4HA8A 2ELHA 2HTSA 3KLNA 3GVAA 3HPHA 5E3OA 2AQEA 3IWZA 4UVBA 2VJ4A 1MNMC 3F6OA 1MSEC 2K40A 2F5CA 2VI6A 2MD0A 1SFKA 3N4MA 1MJAA 2XRNA 2M3AA 3Q9VA 2ELJA 1ETQA 3OOUA 1Y39A 2QKMB 1ZRDA 2R3SA 3D5LA 4ZC3A 3ZGKA 2E5NA 4LOCA 5E20A 3AG4H 3GLLA 2JA5J 4L5JA 2IJLA 4M9ZA 1Z3YA 4RAGA 3BQZA 2E7XA 1SD4A 1BJAA 2KRHA 4KMFA 4RB1A 3PJRA 3K6GA 3QYFA 3LNQA 2CUEA 5LHIA 1Y8RB 3WHBA 1UELB 3PIPF 3ELKA 3OYHA 4BE0A 4JYKA 3GXOA 3B6AA 2KZVA 1ZELA 5HDNA 2XUBA 5FLMJ 1J0RA 3CLQA 1XG1A 2M2EA 3I9V2 4XLNF 3RYRA 4IX7A 2M8GX 3SZGA 4TV7A 3KP6A 3R61A 3GO5A 1HSTA 4HYEA 1RKTA 1GHCA 4LIUA 3FM3A 1QRYA 5FRMA 2X85A 3FDYA 4RLQA 4M6VA 3NRVA 1HW5A 3CDIA 3PNYA 4NQWB 3ECHA 3TL4X 5B3SH 3M4OJ 2Y2ZA 3MEXA 1I50J 4QLCU 2LBFA 2QUFA 1HBXG 5FB2A 3DPUA 3TEDA 4P5OA 2O7OA 2PG4A 3TOBA 1R00A 1DDNA 5HLGA 2RN7A 2RQQA 1G8XA 1IDYA 1Z21A 2GQQA 3ASNH 2L5QA 3A01A 3OYKA 3ZQGA 4U7BA 5IT3A 3S1MJ 1ZKGA 3F6VA 1FYMA 1S72I 4HSRA 3BTLA 4FISA 1N25A 1I1GA 2PN6A 2VQCA 2W7NA 1WJDA 1LDKB 1FP1D 3E6MA 4A6EA 3TP3A 2GWRA 2X4HA 2DOFA 4OIQF 2E36A 2JJ7A 1PUFA 4M3BA 3KLOA 5GADJ 1T39A 2EK5A 1X2NA 3S1NJ 5CYVA 2P4WA 3W2VA 2ID6A 1D0XA 1I5ZA 2KIFA 1YRNB 3N05A 1K78A 1XDUA 2OQRA 4DZJA 4HG2A 1J2XA 1WJCA 5D6EA 1UG2A 2ISZA 2YX4A 2DI3A 3C18A 1SAXA 3WU2C 1I6XA 2PMZA 2ICWG 2VXZA 4XM3A 3JRFA 3CCEI 2IA0A 5BOXA 1ON1A 2ZMEC 4XBFA 3V7CA 5HODA 4U0YA 1KQ9A 1SC7A 5FKNA 1WJFA 1BR1A 1NH3A 5DD4A 2WY7Q 3CCYA 1FYLA 4EJVA 2B63J 3QWLA 3WU0A 4PJMA 4XKVA 4XONA 4KT5C 3CTAA 3OIPA 4OAZA 4W1UA 4D1QA 5FROA 1YX3A 2BY2A 4CCJA 5LHHA 1VQ8I 1EF4A 3BR3A 1HKQA 2DJIA 2H1LA 4KN7X 4OU0A 2V1UA 3R60A 2FSWA 1JT6A 1ZGWA 2GAUA 2HQNA 1TWHJ 2AHQA 2L3DA 1CGPA 3WGIA 3IWFA 4L9JA 1R9TJ 3JTGA 3KP5A 4A69C 4OINF 2FNAA 3HRSA 4XLPF 1UHWA 1RR7A 1RPWA 1JHHA 1P7JA 4Q4ZF 2EBIA 5TRDA 1B1BA 2LLKA 3D0SA 4MHGA 3RPUD 4CYCB 4WX9A 4JK1X 1D0ZA 1N77A 3HKZA 3GTMJ 2MYSA 5CVVA 1O3TA 2E34A 4I7HA 2CJJA 4XL9A 2OPTA 5L3CA 1VQLI 3K4NA 5JVTA 3M8EA 2V6CA 3LAPA 5EG0A 4WF2A 3A01B 2V7FA 1W7PA 2H09A 3CP2A 2DN0A 3S32A 1TT5B 4A3DJ 2ETHA 1GDTA 2QWWA 3I71A 2NS8A 3E0JB 2FUG2 3CDHA 5D5UB 2CUZA 3E6BA 3F8CA 3TP0A 3I56I 1LFPA 3LSGA 2NXNB 3OR2C 3ZQHA 3IC7A 4J00A 3CP8A 3RKWA 2DOEA 2DYRH 1OYYA 2QGUA 2W4SA 1TLHB 2BY1A 3M7GA 3BJAA 2CUFA 2FOKA 2V1XA 3MN2A 2FX0A 1K7AA 3SDBA 1FTTA 5ICEA 3BZKA 2V4JC 3IAS2 4ESFA 2DMUA 1XX5A 3ZPLA 2YU3A 2CQKA 2PX9A 3LA7A 1ZAOA 4IOAF 1ULYA 4HW0A 1XGSA 3J81K 4P1WA 4FASD 3KPHA 2VE9A 5LLQA 1R71A 1R1VA 3FKIJ 3HDDA 3GFIA 2WAEA 1LEBA 1MJBA 4XMYA 4M3DA 3FXRA 2P6SA 3MKZA 1JKPC 3S14J 4QSHA 1J59A 2DMNA 2JA6J 3EDPA 2RC4A 3RTRA 3CUOA 3DBLB 4A3JJ 5E8IA 1Y1WJ 4DZPA 2VT2A 3CCSI 2DA3A 5CPRB 1VQNI 3I0TA 3Q0UA 1MIJA 4KICA 2DFIA 5LFAA 4PJ0C 5CVUA 3ZMUA 3VODA 4JX6A 3BG3A 3LMMA 3BT9A 3NEUA 2RDPA 4HF2A 4Y52J 2JA2A 2VC0A 4U7DA 2CV2A 1XCBA 2BY0A 2IAIA 4G94A 1MMAA 1P9QC 2M1BA 5J4VA 1FSEA 5F0HA 3H0DA 2STWA 5EEGA 3KFWX 3QPTA 4KIBA 1GLNA 1FY7A 2XF6A 2JK3A 2EPFA 2LC2A 3I4NJ 3E3VA 2KT0A 3ZQQA 4CZZA 5HLIA 3CD6I 4QPQA 5E17F 4G6QA 4C2MJ 2DMTA 3MZYA 2XROA 1HA8A 3OYIA 3HOVJ 3ZQIA 2YPRA 1RIOH 4UUTA 2HDCA 3ZQLA 4I0BA 2PI0A 2IVMA 4R1HA 2DA2A 3PNVA 1EKEA 1I3AA 2WTEA 2VASA 4RGXA 4BH9A 1U5TA 1WFXA 2BV6A 3QU6A 4BHCA 3MKLA 3W3CA 2VBWA 2IRFG 2RQPA 4CDGA 3A0BC 4CO8A 1SEUA 2IS2A 5IYBJ 1P4WA 2NS7A 4B47A 1CQTA 1T0FC 2EFOA 3KP4A 2Y69H 3RQ4A 4YIRX 3HOXJ 1A36A 4ZDOA 4ZYHA 3CESA 1SFOJ 3Q0WA 4KMUX 1A6QA 4B44A 3S93A 2OCEA 5CVRA 3H5AA 2CSOA 1HW2A 1F5TA 3F8BA 4CCOA 1FNNA 4B3AA 2PMUA 1PUEE 3S15J 1B72B 1S6LA 5H6RA 3MVPA 3CO7C 1F43A 3U21A 5K1YA 1ORKA 3ZOBA 2QVOA 2DA6A 2CV0A 3HRUA 2HPIA 2VBXA 3P7NA 1QHHD 1QZYA 2QQ8A 5JVGF 1V4RA 1XSXA 2OBPA 1PP8F 2LNBA 1E3OC 3GTKJ 1DU6A 2P5KA 1FOWA 1R22A 2O61A 4IKFA 4BE2A 3DV8A 3F9KA 3L2RA 2FNPA 2V26A 3ZR8X 4N4NB 2KPMA 5FO5A 2LKPA 4LMYA 3NQOA 3IUOA 2KIUA 2FBIA 3BG9A 3QAHA 4MFEA 4M3EA 3NWSA 3T8RA 1SFXA 3EYYA 1QVTA 1W5CC 3W6JB 4KITB 3COAC 1WH7A 1GXQA 2H8WA 4QTRA 1K79A 3K7AJ 2H8RA 1U9OA 2NVTJ 1WPKA 4MTEA 5D5VB 2KLOA 4XICA 1RETA 1YFHA 1FWZA 3B6CA 3MD2A 3ABUA 3OS0A 4Y7NJ 3S1QJ 1QPIA 3TDUC 2X51A 4YFNF 1I1SA 3TMOA 1YG2A 3IP4B 3FMSA 3OYDA 2WAQA 4K2EA 4L5EA 3LSRA 5EEAA 5ILUA 5EF6A 3H3VK 1X1PA 3ZQ7A 5TISC 4BQAA 3MZ8A 1O57A 1Y1VJ 4BQQA 3MFKA 3CJRB 3BROA 4G8XA 4E7LA 3VSLA 1JUPA 4MEYF 1E2XA 2FBKA 3OS1A 5LD2C 3UNGC 1R4MB 2LG4A 4V2FA 3EQLF 1KONA 1AKHB 5J1YA 2AXLA 3CMAI 4FX0A 2EINH 2R7OA 1AHDP 1FC3A 3GTPJ 1Y8QB 2R7XA 3KP2A 4R8HA 2LSOA 3C7JA 1R6RA 2L01A 1S7EA 3PUBA 1SD5A 4WXCA 4JP0A 5BQTA 4M6YA 1U8RA 2E1NA 4YIFA 3VYUB 4AWXB 2EIJH 4XNFA 5FKKA 1FOYA 3S2WA 1JTXA 5C4JJ 2EB7A 3BY6A 4IF4A 3MZHA 2O03A 1ZGAA 1BI2A 3JRAA 2X1DA 3WGGA 2R7FA 3ASOH 3HUGB 2EFQA 1B9NA 4EGYA 2UWMA 2DT6A 5DCFA 4CHUA 2R7UA 4ZYAA 3JREA 3KZYA 4ESBA 1YIOA 2LF7A 1JGGA 3CUQA 3ZMDA 2HDDA 2M7AA 4CYDA 2HZTA 1U6GA 3GZNB 4AYBN 4KNYA 1HLVA 3HSEA 1ON2A 2WBMA 3S16J 5IPAA 2Z9OA 5HS9A 1WRJA 3IH3A 5JI6A 5HOOA 2X9DA 1HC8A 1WSUA 1LNWA 1S7OA 1RESA 3BJ6A 3PQKA 2HGCA 2V79A 3QP6A 5DV5A 5LRSA 1G4DA 4HLYA 4I2OA 3HOWJ 1B8IA 3JAMK 4RMNA 4IPAA 2MABA 3A4CA 2DTRA 4IQJA 2JA7J 2E2JJ 4OIPF 4CCLA 4LGWA 3U1KA 2JZYA 4BJ6C 2VKEA 4U88A 1B4AA 4AC0A 2DO7A 2IT0A 4LG3A 3CCUI 2ZNZA 1JJ6C 5HDGA 3HGYA 2BHYA 1K6OA 3LSMA 2ESHA 2X1EA 2DODA 2XGEA 5ICGA 1KQ8A 2VJJA 4A3GJ 2P81A 4N4OB 2JRTA 2GXBA 1L3LA 5K7ZA 2OTJI 1IW7F 1BW5A 2LR8A 5E8GA 2L7ZA 2HTJA 2MSYA 4AUXA 2L0KA 1T56A 1U0JA 1OR7C 1V3FA 3C2HA 3ERMA 3V7SA 1TP4A 4Z6YA 2FA5A 3HZJA 4KFCA 3IV5A 1H9GA 3DEWA 5GTIC 2FBHA 1KU3A 3ABMH 5GAHJ 2WAQN 2Q2EA 1XB4A 1WH5A 1F36A 4U0WA 2VJ5A 1OCPA 2EIKH 2YU9J 2DFHA 1JTYA 4OOIA 1FJLA 4BKXA 3LFKA 1RR8C 2TCTA 4AM3A 3GWZA 1FBQA 4Y3OA 3HOTA 1E3HA 4GGGA 4O5VA 3GBGA 1LEAA 1BW6A 4CXFA 1JI8A 5CJ9A 3CMMA 3FIWA 1XN7A 2IA2A 3G1MA 4C30A 4D9JA 2D2WA 2M7BA 4KT6A 2XPVA 3DTIA 3OYBA 4AIJA 1VQ6I 3O2PE 1IV6A 1VQKI 3I59A 1NG6A 2XHKA 2HVRA 3CUQB 2FQ4A 3ZQCA 1BC8C 3HOYJ 1LDJA 5D6FA 2TDXA 2ME0A 3BR2A 2W84A 4IRIA 1Z0XA 2H27A 3QQAA 4BDYA 4Q47A 1JKOC 4NNJA 2MH2A 1FEXA 1R5GA 4KA4A 1SMTA 4RGSA 2R4GA 2VQGA 4M6XA 4RB2C 4A6DA 5B66C 4ENKA 2M0CA 2XPUA 1HF0A 2JMWA 3Q5FA 3ABLH 2HYGD 1FZPB 2L4AA 1ZLJA 3TO9A 3SJMA 1IN5A 1W5SA 4N9IA 1MGTA 1HKSA 1MNDA 4M9SA 2VE8A 2CO5A 1B59A 1V54H 2EZLA 2Z2SB 2KQRA 4EJOA 3ZMZA 4KIFA 3IRRA 4G7ZF 2OZ6A 3FXOA 2Y30A 1P2FA 1XMKA 1K61A 4GDFA 1TZLA 2LVSA 2XAHA 2EWNA 2EFWA 1UAAA 2PFBA 2IS4A 1BBYA 2DMQA 4G6DA 2H6CA 2VONA 3FISA 2VB6A 2FU4A 2OUMA 4C9YA 4E6KG 1MJ9A 3FHZA 2OD5A 4BBSJ 3PFYA 2HKOA 1AA7A 2F2EA 2JT1A 5HNFA 1VQ4I 5GAEJ 4HZFA 1FBSA 1N78A 5IYDJ 2FD5A 3FXMA 1J09A 2O6GE 5FKOA 3C1DA 2ZNYA 4NC8A 2CH0A 5DEQA 3CCVI 1QZEA 2NOJB 5K7HA 3KZZA 4XOPA 2I10A 4UUSA 3QOEA 1IJWC 2E71A 2PJRA 4PSWA 3RZDJ 3S2DJ 1SMYF 4IQ4A 5K5QA 3E6CC 3I4PA 4I09A 1OPCA 3I64A 3CCMI 3HIFA 2LY9A 1G3TA 4ZYDA 1T95A 2WB1A 2KRCA 2HU9A 2NOGA 4XSXF 1QA6A 1OJLA 3CC7I 3QODA 5HS8A 5LGUA 1RC9A 4PFPA 1Z3XA 3K1MA 4M9XA 2LRDA 3FF5A 4NHJA 4LLNA 3I59B 4HQEA 1STZA 4B3XA 4DYRA 3HOSA 5KVRA 3HTUA 3HJEA 5L3GA 2BEOA 1DGWY 2CQQA 5DD8A 1YIJI 3RDIA 3VWBA 3KIOA 4BXFA 3HG9A 2MC4A 1ZLKA 2ESNA 3UKGA 3E5XA 3LWFA 4CICA 3WODF 2D1VA 4BUPA 5E79C 3TDZC 4B09A 2KJCA 1MD0A 1MSFC 4JX4A 1BN5A 3JSPA 1OLTA 3M1CA 4E70A 4DQ2A 4P96A 2XDVA 1OCOH 1HKTA 3SFIA 5DUKA 1P7IA 4KYWA 4ENMA 3OYAA 5FLXK 2K27A 1IC8A 2QBYB 3BWGA 4ASNA 1D1AA 1FT9A 2EZKA 2XGCA 3GFJA 4PGGA 3J80K 2KDZA 2R7SA 2Z33A 2COBA 3GTJJ 1K4SA 4EM1A 1YJWI 1GVDA 1MNEA 3HGGA 4L0ZB 5EDNA 2MD5A 1PYVA 1IAWA 4UXNA 3DTKA 3LSHA 4HF0A 4BJTA 2CRGA 3RJPA 2B7EA 2M9HA 1LQ1A 2HNHA 5D8LB 2JSPA 3OMYA 2KIQA 1A6IA 4BBRJ 3I4MJ 2G7UA 1F1ZA 4AIHA 1WJ5A 3RKYA 3F8NA 1G2HA 4ITVA 5DYMA 2K7LA 4UUSB 1FMWA 1IN8A 3BOQA 2Y9YA 1WKMA 4L5IA 3L2CA 1JKQC 3J7AO 3LSPA 4BAYA 2Y0SN 2V1NA 5AONA 2ECBA 2MFZA 1JUMA 5DS9A 2VPLA 2CW0F 3AFHA 4EJUA 5BPDA 2K5CA 3BCAA 5J8CA 4XRSA 4H4KC 3AKZA 1S8NA 3KP7A 3H3UA 5TGTA 5M5YJ 4BACA 4FX4A 1GVJA 2PQ8A 2X6OA 1X4OA 2NVUB 3NAUA 4WCGA 3VPRA 3EUHC 1V5EA 3OYFA 4IEJA 2A6HF 3K2ZA 4ZDPA 2UV1A 2H1KA 1Z6RA 3J7YJ 1Z77A 2OQGA 4AD9A 3MWMA 2ZXWH 2FJ1A 4OWRB 2WB1N 1JUSA 3AG1H 5KNLA 3OYEA 1Z9CA 1AU7A 2HOTA 5FRNA 2A6EF 2OC6A 2PJPA 2JQ7A 1T2KA 2FMYA 3F0CA 4DBQA 2UXXA 2HPMA 1X2MA 2A68F 4OIOF 2JTVA 3Q3SA 2Y75A 3ZXSA 1Z1DA 1Z7UA 3ABKH 5LEKA 3F22A 2M8EA 3F3XA 4XLAA 2C6YA 2AQFA 2Q1ZB 4JQFA 3PNTA 2VC1A 4BHPA 3KCCA 4UHTA 2YR2A 5K5OA 3CJQB 4BGDA 5CQGA 2L7MP 3ECOA 2QA4I 1EJ9A 1KYZA 2LBFB 1IUFA 2JN6A 2XGXA 5IP6A 2YUSA 1KU7A 3BR5A 1YYVA 2FF4A 3G1OA 4F92B 4QIWN 2J5OA 1XMAA 5C3EJ 4IHSA 1MBEA 2F48A 2QKLB 2RNGA 5LBQA 3CMYA 5KCMA 1W36C 3RKXA 1IN6A 2E35A 2FQ3A 4O3MA 4ESJA 5FGMA 1LUJB 4NC7A 2O8XA 3GUDA 4RDUA 4Y15A 5A2QK 2R7TA 1Y0UA 4CSWA 2MGQA 1IN7A 3SQNA 3GZ5A 2WV1A 4BNCA 4DYCA 5EGOA 2RGVA 1PUFB 4L9NA 4XOTA 3CMEI 4EM0B 3S3OA 3L2UA 3AAFA 1VQ5I 4LK1F 3R4KA 3E5UA 1K78B 3DBHB 1TNSA 4A3EJ 2PLYA 4HDVA 5FKMA 2V9KA 2P0WA 4GRIA 1J5YA 2CUJA 3OYMA 1R5HA 3HSRA 3W2WA 1APLC 1KGSA 3C2GA 5KHDA 2QENA 3RZOJ 4KIGA 1TQMA 2F4MB 2KMUA 2X6WA 4BJ5C 4IHXA 3SZPA 2VIXA 2RREA 4RB0A 5IOZA 5K5RA 1HDDC 2YSRA 2DK8A 1MH4A 2N8GA 2MLKA 3HEFA 1YI2I 2WA0A 1QPMA 2VKHA 1MW7A 4MO7A 3WTVC 1E17A 1X3WB 2CQXA 2JPBA 5GPAA 2JA8J 3K4MA 4A3MJ 2R0QC 4L9TA 4F55A 3RPQA 2M30A 1A5JA 3PM1A 3T8TA 1D8KA 3OWTA 5E3LA 3S8PA 3G2BA 2PMZN 1TC3C 3VEPA 1EH7A 4D5CA 3HB9A 2F4OB 3RYPA 2WADA 2GA1A 4X0GA 1JT0A 1W4MA 5D5XB 2XV4S 5D4SA 3E5QA 3IKTA 1OCZH 3HYIA 1W5TA 2B9SA 4XKCA 2XAQA 2R93J 5LRRA 1BR2A 2VPRA 4ON0A 4MFDA 1R4NB 3QU3A 1LJ9A 1USTA 4F7ZA 4KDPA 4G7OF 1IRXA 1XMXA 4Y17A 5EG0B 3MKYB 3QRFF 1W7PB 3D5RC 3ZMSA 1OMIA 3W6KB 4ANJA 3CJTB 1BC7C 1ETVA 1SD6A 2RAEA 3K1PA 3VB2A 2P8TA 1XGMA 2O3FA 4H0EA 1YS6A 1D5YA 4XLCA 4OMYA 3S1RJ 2DQRA 3SEQA 3RQIA 3PFIA 1BIBA 1QQIA 2CFXA 2I8DA 5EGOB 3ISPA 4A5NA 2G7HA 1JJ8C 3LQQA 3I53A 5IOYA 3GMEA 1R23A 2VLAA 1DP3A 3O6BB 5F08A 3HKZN 3ZN1A 4IHWA 1NK3P 4G9YA 4WXHA 2GOXB 1MBKA 4HOBA 4HV6A 1J7KA 5J4YA 3TQNA 1TW3A 3ZP5A 2JVHA 3M8JA 2L7FP 1NTCA 4PUSA 4HPQA 2XASA 3KX2A 1VNDA 4CCNA 4IOCF 1FYKA 4B43A 1P92A 1WJBA 2MW8A 1V5FA 3WTUC 1JXSA 1UHSA 4HQMA 4EATA 2M4KA 4G12A 4EVIA 1LB2A 1DQUA 4X6AJ 3LSIA 2YX7A 5AIPA 3RIRA 2XSDC 1D1CA 4DYQA 2NVXJ 3I5UA 3ROUA 5ED4A 1O3SA 2HVSA 3L2QA 1IUYA 5J47A 1V55H 2KL4A 1YHQI 2NNNA 5EJCA 4KISA 3LQRA 4BDZA 1IRZA 1KZHA 2BY3A 1Z91A 2L54A 2ACJA 1TWGJ 4KJZA 3GTLJ 2FE3A 3FK6A 1FIPA 1F4KA 3H5NA 2K9QA 1V5GA 2V1DA 2ELKA 3HRTA 3FM5A 4MLOA 2DPDA 2HXIA 2Z5UA 1EV7A 2ADUA 1ZG5A 2CQ7A 2ZBKA 3IH2A 2W82A 1X4PA 3B73A 1SD7A 4LK0F 3DCFA 1G3WA 4G7HF 1BI0A 3A1YA 3E6DA 1ZARA 1UHMA 2BBYA 2LREA 3BQYA 4I6ZA 2TRTA 2ID3A 1HDPA 4BYYA 3KE2A 3JSOA 3IKVA 4XR6A 2ZMEA 1RI7A 2GXGA 1ZG3A 1ZQ3P 2LY1A 1Y6IA 5DCMA 3J7AY 2JPCA 1X1BA 5FFZA 4EJWA 2GIZA 2VQLA 1LFUP 3G4SI 3NARA 4ZTJA 2IGKA 3GZ6A 4KN4X 2R5ZA 2A05A 2VOOA 2KDOA 1X3ZB 3OIOA 4HRIA 2CWEA 2OAZA 2F6CA 1GV5A 3TGNA 4DJAA 3FXLA 1RRJA 4IRHA 1U5TB 3I58A 3L2VA 1UB9A 2R92J 4BHBA 1TNTA 2JVGA 1ZH5A 1ONVA 1W1WE 3R6SA 2JUCA 1O7FA 1IZ1A 2DQLA 3EETA 3HL2A 4MQVA 3TBIA 4LB6B 4A93J 4PSXA 4BQOA 5ICFA 2KP6A 2EFNA 3GLXA 1J75A 1DPRA 1CF7A 2EILH 3L7WA 3WG7H 1BOAA 3WTTC 5FD5A 2D45A 4XKBA 1YOVB 1K4TA 3OYJA 3GX4X 4UUVA 4NB5A 1OKRA 1WWXA 1BJZA 4J01A 3S2HJ 4N0BA 1VFCA 2GIVA 3GW2A 3UR3C 4V2GA 1HW1A 1PDNC 2LMDA 5E3NA 3LSKA 2IXSA 4U87A 1UMQA 2K9SA 1K83J 4BU2A 3GFLA 1C0WA 1XC5A 1IG7A 1OCTC 3CF2A 3WE2A 3M9AA 3G3ZA 1QO0D 1QVUA 4YEJA 2CGPA 1K6YA 1KYWA 4JX5A 2MBFA 4A2UA 3N97A 5JHFA 3OSGA 3L1PA 5BPIA 2H94A 1ETWA 2LF8A 3BR1A 1XGOA 4IRGA 4IVNA 2L4MA 1S7AA 3O3KA 4MTDA 5F0FA 4DIQA 2Y48A 1VI0A 3BPVA 3RSNA 3DXJF 2R5YA 2LK2A 4DOZA 2MG4A 2K9NA 2ZMEB 1ZR4A 3RPUA 5F64A 3S17J 5B5EC 4HNUA 3ZQFA 2HVQA 1IV8A 1R1UA 2HOAA 4AVZA 5TJJA 5ILVA 1ZR2A 4IL6C 5DM7F 2IS1A 2R5ZB 1WGXA 1NHAA 2P6TA 3TO7A 4BEHA 3OV8A 2WV0A 3BC8A 1D8JA 1FP2A 3OYCA 1DP7P 1X19A 4M73A 4LIVA 1RUNA 4EM2A 4XQFA 2E5ZA 5HDKA 2ZC2A 2W1OA 1EH6A 2VOPA 3EPZA 4A3CJ 4A3BJ 1QHGA 4FE4A 1VQPI 2A69F 1WVRA 2HS5A 1S5LC 2KHMA 3K4KA 4NUBA 3AL0B 2OTLI 3WE3A 3ULQB 4LB5A 3KEOA 1BM9A 1HQCA 3DEUA 2L2OA 4U0VA 2CFOA 1MBGA 3TO6A 1WQ2A 1A04A 2MA3A 2XPWA 2ZCWA 3O8HA 3MMYB 2A07F 2LDUA 3LOCA 4LITA 4I01A 4ENJA 3H1CA 3J81Z 3TW7A 5ICCA 2LH9A 3WTWC 2X48A 3RCOA 3KP3A 1OQYA 1W7PD 2EJRA 1IO2A 4S04A 3T5XA 1LFBA 2XF5A 1YTYA 5LEJA 1MMGA 1R5ID 2JRMA 3LSJA 1BOBA 1IN4A 2DT7B 1WHUA 3BR6A 5L3FA 5J1RA 2QQ9A 2Z3YA 1EA3A 4B1RA 1XS9A 2AS5F 3H9QA 2RKHA 3SFZA 2ZFUA 2M45A 2DA4A 4E7JA 2VXDA 1L0OC 1T0FA 5HLHA 3E1SA 4XN3A 3H92A 1B8IB 2CG4A 2QQAA 4ZH4F 6PAXA 1T6SA 3FZVA 3ZN0A 1T08B 1XD7A 2F4IA 5EEHA 3DFGA 3LA3A 4M71A 1ZREA 4BL0B 4C2TA 4BQNA 3OYNA 2DOAA 3GCMA 1JHFA 3FK7A 3JCUC 4FQGA 4PCQA 2R7ZJ 2HFHA 1HCRA 4BEHB 4XORA 2LP0A 2PBIA 1X1CA 3LA2A 3SZTA 3W6VA 1FOXA 3OSFA 3DTEA 4HNTA 1YW7A 2DU9A 3QPHA 5HNHA 1G3SA 1S3JA 3U2RA 3SXYA 1ETOA 3ESWB 1ZYRF 4HV5A 3D1NI 1M1EB 4BY7J 4IZZA 3BLYA 4YRVA 5DM6F 2M5WA 3CQZJ 3ABTA 3GYHX 3A0HC 1U9NA 1TBXA 2Q0OA 3QP5A 5E3MA 2I5UA 2Q2EB 2P7VB 5HVQC 5EZHA 5CVJA 3A02A 1FX7A 1D0YA 2IS6A 2HQRA 1RNLA 2F5FA 2K02A 3KEQA 4C3JJ 1YJ9I 1KA8A 3EUAA 4PZJA 2FMLA 1X1DA 5B1BH 2NNYA 2IPQX 1U3EM 4Q5SF 1Q1HA 2BW3A 1ETKA 5KAFC 2IGNA 2Y31A 1IXRC 4Y13A 1JE8A 2J5PA 1YITI 3K4JA 3ERED 2EIMH 1FOKA 1OYWA 2RNJA 2E1MB 5FD6A 3WG9A 4M74A 1UFMA 5F6FA 1VQMI 1R7JA 3L00A 1NG7A 3FXJA 3A03A 4AU7A 5H20A 3H9JA 2A5WA 3IAM2 3SEZA 2LKSA 2HOSA 2DFEA 3BP8A 2RVCA 4A0ZA 2VUMJ 3CJNA 2F5DA 3P9CA 1FTZA 4M3FA 2LKXA 4UVAA 4XLEA 5ILSA 5D8KB 4UV8A 3CZ6A 3BG5A 1O4XA 2R7DA 5F1JA 1R36A 2ECCA 2IEKA 2HKXA 4I76A 5IT9Z 2X0LA 1YRNA 2DTZA 1QNTA 3PIOF 2XSJC 2K86A 2LYCA 4FE7A 4JBAA 4E7SA 3FWEA 3LAJA 1MZBA 3V8JA 2KJBA 4Z2YA 2BOLA 2WAFA 4NDLA 5M3FJ 2HI3A 4Y33A 1MDMA 3QYBA 1PJRA 4RM2A 3I55I 2OA4A 2W48A 4XIDA 3WTXC 1LE8A 3FXUA 1MBHA 1OCCH 5GPCA 3CCRI 2BHZA 2LFBA 2OZUA 1RUOA 3QOPA 3K9TA 1IRGA 1UZCA 2Y0MA 2PMHA 1VZ0A 3BTJA 4UVCA 1ZHFA 4L18B 2GOMA 4GYIA 3ZCOA 1LVKA 3H9GA 1I39A 2IW5A 1U5TC 4RAZA 5IP7J 2ZO4A 1LKXA 3HHGA 2EZIA 4F52A 3GTGJ 2OCCH 4FHTA 3HC7A 1X1AA 2HZDA 3JW4A 2W24A 5BNGA 3CC4I 5J3LA 2K9MA 1AOYA 2PJRB 2QCOA 1VQOI 3DBRB 3BZ6A 1LPQA 2O8KA 2DYSH 2CW8A 2OU2A 2BW3B 3RI4A 4C3HJ 2DDAA 2IP2A 4A5MA 1SFUA 4CYCA 3M8FA 4GFBA 3BDDA 5GAGJ 1H9TA 3OL3A 5L3DA 3PO3J 3FMQA 1TTYA 1TWFJ 2W25A 4CUGA 3A2KA 2HYJA 1DPUA 2E2HJ 1XTAA 2QYOA 5B1AH 2DFFA 3ZMTA 2Z16A 3OS2A 1T8IA 5IP9J 3OYLA 4Y4RA 4MGRA 3GEZA 2GBYA 1E3PA 4XN0A 2E2IJ 4IJAA 4P9UA 3FKJA 3OY9A 1EH8A 2VL8A 3BJOA 2XC7A 3M3YJ 1OR7A 1XSDA 1OCRH 2NYXA 2STTA 1W36D 3EUKL 3TW6A 1B6AA 4CGZA 4CA0A 5JHUA 2XIGA 3HPGA 2R7WA 4RAYA 4YG2F 1TQPA 2E1OA 5E1XA 4MNUA 3K4LA 3GTQJ 4NBQA 3FX3A 3CO6C 1TL8A 4RAFA 4I0AA 2X6YA 5CQEA 4XRSG 2V9PA 2G0EA 4EQQA 3HOUJ 4XLFA 4FTHA 1Z7LA 3HHHA 4LLLA 3HTSB 1F9NA 5EYRA 3JAMZ 3K70D 1MDMB 3F23A 2VJIA 2MLGA 1T33A 1WCMJ 3L09A 3CCLI 1LE8B 5BS6A 2DA1A 4IHYA 3TOAA 2MH9A 5BMZA 3K4CA 3FBNB 5JR3A 3DQVC 2QF7A 4E7KA 1Z05A 4PJNA 3DEEA 4HX8A 1P6RA 3EYIA 2A3SA 3P9KA 4I99C 3E97A 3WU1B 2DA5A 1BI1A 1X58A 2ISYA 3KYDB 3G6EI 4UY8I 2XKPA 2BYVE 2DAOA 3HOZJ 5F1RA 4GCVA 2H6BA 3JRDA 2EFPA 2W00A 3JRCA 1ACIA 1VTNC 4II3A 3AL0C 1SVLA 4HX7A 2VN2A 4WXDA 1X3UA 1JGSA 3GFMA 4YIIA 4EEFG 3BPXA 4ZZDA 5E1WA 5EZGA 2VKVA 2E60A 4RBOA 2OJED 2GZWA 3V7RA 5CKTA 3K70C 2XRLA 3HRMA 2GA2A 1Z67A 4MIMA 3K1NA 1LVAA 3CF5F 4RS8A 1T38A 2M4GA 1LDDA 4EJTA 4LLGF 2YS9A 2QQBA 3H3ZA 4S05A 3CUQC 3DLLF 4HNVA 5FJ8J 3V8LA 4RGUA 4B48A 1KU2A 2CMPA 3AG3H 4OMZA 5IYCJ 3JTHA 5F04A 2HOEA 3W2AA 4S0HB 1USSA 3OIQA 3OL4A 3ML6A 2L02A 1AWCA 2ZXIA 2L7KA 5GTHC 1TW2A 3HSFA 2ZB9A 4ABZA 2VKDA 4ZYEA 1BR4A 3QPSA 3FXQA 1A35A 4CZCA 5KK1A 2JUGA 3VYTB 2DCEA 2EA2A 1XGNA 4N9HA 3CCJI 3ZRGA 1B72A 2CU7A 3U1DA 2QM3A 1E0EA 1G59A 4WWCA 1XCVA 1YO5C 3BTCA 1FIAA 1GT0C 1VQ9I 1YE9A 3IRQA 2KZGA 5F27A 1SVMA 2ZJPF 2HEOA 2BVMA 3G73A 3DKWA 1QZZA 1ZK8A 3DKYA 3DU6A 3Q9SA 3R0AA 4FT8A 4DNCA 3DKXA 1BL0A 2QSHX 2FRHA 2GLOA 3BTIA 4XRFA 4A3IJ 1RZ4A 3SHFA 5FLVA 3F21A 3DPLC 4GYGA 4D0PA 5L3EA 4UNOA 2E7WA 3GF2A 3ONQA 4W97A 1MKMA 1QGPA 2DT5A 1IRFA 3DWLE 1ZGJA 1BA5A 2NVYJ 4M3GA 3S3NA 2HYFA 2A5YB 2A6TA 1G6NA 3BCBA 2ZKZA 3VYSB 1FPQA 3KYLA 2XF7A 4FCYA 2K4JA 4IHVA 3O8GA 2DW4A 2XB5A 4UV9A 1SANA 3CC2I 3HM5A 2LOOA 2M34A 4MQ9F 2XAGA 1W0TA 4RB3C 3X2QH 1MBFA 3JRIA 2KKOA 3F72A 1O3QA 2E1CA 2DA7A 2E1MC 4HDUA 5DUIA 4GXOA 1MMDA 3S3MA 3OYGA 2EV6A 4ZTFA 4RM3A 2AO9A 3QPLA 3VDXA 1N75A 2ZXJA 3JRHA 2CV1A 1WI9A 4RLFA 4DBRA 3JRBA 4BE1A 3DU5A 2JSCA 4E4HA 1U78A 3PO2J 2DMPA 2L9VA 4XK4A 1AKHA 3BR0A 2BXYA 2NVQJ 4O6JA 2EQRA 3MCZA 2QSFX 1SFEA 1MH3A 1SAUA 1UG0A 1T98A 1PP7U 4A3LJ 3OOPA 3PSIA 4F93B 9ANTA 2Q8KA 4C2UA 1MMSA 3WTYC 1S29A 1U2WA 3WTZA 3WTSC 1P4AA 4AYBA 2WC2A 1IGNA 4JOMA 2HXOA 5FLXZ 2DXIA 1GV2A 3GTOJ 1HOMA 2QLZA 2K85A 3K2AA 3EUHA 2GXAA 3J80Z 1GUUA 4M72A 4G6TB 2LTPA 3HUGA 2EV5A 5KAIC 3MQ0A 4CCMA 1NK2P 3K10A 4L0YB 2IBDA 1FLIA 4C3IJ 5JFRA 1H88C 3QYEA 2HWVA 1XSVA 2FEZA 4IO9F 1HSJA 1ZTRA 5M5WJ 1YJNI 4I02A 1B9MA 2DJNA 1ETYA 5IT9K 4A12A 1ZRCA 4P9FA 2XVCA 4LG0A 1ERDA 1IXCA 1WJEA 4F3QA 1H89C 1IDZA 2COMA 4YELA 3BZCA 1QBJA 2A61A 3D5SC 2K3FA 4XSZF 3MAJA 3IH4A 5E18F 2DBBA 1OISA 2JWTA 2IGOA 2EA4A 2ZFWA 4I98B 5GP9A 5LGNA 3PSFA 5C4XJ 1UJ8A 2DPUA 1FBUA 4OAYA 3H35A 3PL8A 2DLLA 4LFUA 1FMVA 3P5JA 4HAMA 1R58A 3PUFA 1YLFA 4CH7A 2BE5F 5CVIA 4DW6A 3VYRB 4A0YA 5HS7A 2OV7A 2O0YA 2F5VA 3DP7A 1WJAA 1TWAJ 2K3PA 2ZSHB 1MMNA 3AG2H 2NAZA 3LFUA 2ZSIB 4E7IA 2UUZA 3CCQI 3F8MA 4PJLA 1REPC 1VF9A 1TT0A 1GXPA 3REOA 1WZ2A 2NS0A 4EGZA 4ZYGA 3HBLA 2Y9ZA 1Q1VA 1W0UA 1R1TA 3P9IA 5FKLA 5JLXA 2V6EA 2VT3A 4LD5A 2CW7A 2VBZA 2ZXHA 3KEYA 2R7RA 4AVPA 5JLWA 1WI3A 1TWCJ 4BXXJ 4HLXA 4FETA 4HX4A 2KFDA 4XLHA 5J6XA 3MKWB 4WK8F 4E7HA 4OIRF 1ENHA 4B4CA 1S9HA 2DK5A 4EMSA 4HBLA 3JR9A 1YW9A 4PK4A 4NC6A 1D1BA 4R79A 1H0MA 1OYIA 3FMRA 4P55A 2X6XA 3K4BA 4E7ZA 5F0CA 3DLAA 1H8AC 4ETSA 4X1EA 5CLSA 1BI3A 3TKYA 2E19A 2D5VA 1FSHA 2HR3A 2ZJ2A 5DCMB 2UXNA 3RKQA 4YFXF 4ZZLA 3L9FA 5M3MJ 5J8FA 3L2WA 2GM4A 1ITYA 5ERIA 3V42A 2WWYA 2ZJQF 3K0LA 2P5VA 3WGHA 3VOEA 4LG0B 2XGDA 1XPXA 1IF1A 2CYYA 4V19K 2DDBA 2XKOA 1I3QJ 1ODDA 5L3BA 2K9LA 5LGTA 4HSTA 5D4RA 2RV8A 1JKRC 1G3YA 1YW8A 4AIDA 2L9SA 1ZRFA 3K69A 2EZHA 3Q0VA 5A2QZ 3LL7A 2IA1A 4AIKA 5DDGA 1I6HJ 1POGA 4QWQA 4UB6C 2PEXA 1P4XA 3NWTA 4UB8C 2XAFA 4L9VA 3KYCB 5D5WB 4YFKF 2VBYA 3C3WA 4XKWA 1CF7B 4BS9A 4HEA2 2FOWA 1XDSA 3V4GA 3B02A 4ZJZA 3U9GA 3R0JA 3I54A 3CDLA 2MC3A 3HXLA 2R7QA 2XB0X 2P7CB 4IHTA 5J40A 2BXZA 1YX5A 3SYTA 3IL2A 2B0LA 2HDWA 1SVOA 1OFCX 2AXTC 3DF8A 2QEXI 1ZG1A 3E7LA 5HLTA 3FXKA 2UZKA 3G71I 4PJJA 2WY8Q 3SDGA 3F8FA 2W85A 1DGRM 2XAJA 1U8BA 2FXAA 4J19A 1D3YA 4PDKA 4HF1A 3ZMVA 5H6QA 2K4BA 2LD5A 3V8KA 5FFXA 3FHNA 2ZJRF 5LHGA 2QSGX 2BZTA 1UCRA 3LSTA 4A3FJ 2KRFA 2VQHA 1QU3A 3H5RA 1Y56A 2R5YB 2BGCA 4RA2A 4GO1A 4II2A 2Z99A 2OF7A 1ETXA 3FBIB 4BXUA 2ME6A 1A31A 3M07A 2F5EA 2CQNA 2KISA 5DTDA 1VQ7I 5E1ZB 1MBJA 1KU9A 1TQIA 2M0MA 2HQAA 5IY5H 1I27A 1RKWA 3M1EA 2L9RA 1KQ0A 3T1BA 5H2FC 4EV0A 4BY1J 2QZ8A 3DPTA 2D1HA 4A0XA
chains in the Genus database with same CATH topology
3G1LA 1AHDP 5IP9J 3GTPJ 3WHCA 5M5XJ 5C44J 1S7EA 2R93J 2VPRA 4JP0A 4D7NA 5K7FA 4MFDA 3C2BA 2GBYA 2E2IJ 3M3YJ 5FKKA 5EG0B 3JRGA 5J1UA 3TW6A 1JTXA 2EH3A 5C4JJ 3JRAA 1ETVA 2RAEA 2O9LA 2E1OA 1D5YA 3GTQJ 3S1RJ 1DU0A 3RQIA 3H0GJ 4A3KJ 5EGOB 3JREA 1JGGA 4XRSG 1JJ8C 5IOYA 2HQ5A 2G0EA 3HOUJ 2HDDA 4IHWA 5F08A 3HKZN 4FTHA 1NK3P 1MBKA 5EYRA 4AYBN 4D5FA 1HLVA 4D7MA 1WCMJ 1T33A 1LE8B 3S16J 4XRMA 5IPAA 2DA1A 2L7FP 4IHYA 3IH3A 1NTCA 2X9DA 1VNDA 2QF7A 5E3OA 1RESA 2JA7J 2MW8A 3HOWJ 1B8IA 1UHSA 1MNMC 4G12A 2DA5A 1X58A 1MSEC 2K40A 2NVXJ 2XSDC 2VI6A 4DYQA 2E2JJ 3HOZJ 2VKEA 3JRDA 1ETQA 4AC0A 3JRCA 3OOUA 1JJ6C 3HGYA 2XGEA 1IRZA 4A3GJ 4LOCA 2P81A 1TWGJ 3GTLJ 3FK6A 5K7ZA 4EEFG 2JA5J 1BW5A 2LR8A 1FIPA 2L7ZA 2MSYA 2K9QA 2VKVA 5EZGA 2ELKA 2L0KA 3BQZA 1T56A 4MLOA 2HXIA 4AUXA 4RBOA 3IH2A 3IV5A 3DEWA 2XRLA 3DCFA 3LNQA 2WAQN 4MIMA 2CUEA 1WH5A 1F36A 3WHBA 3BQYA 4JYKA 4I6ZA 2TRTA 3B6AA 1OCPA 2ID3A 2YU9J 1HDPA 1JTYA 5FLMJ 2YS9A 1FJLA 4BKXA 1XG1A 2M2EA 2TCTA 1ZQ3P 2M8GX 4HNVA 5FJ8J 3GBGA 1RKTA 1BW6A 1LFUP 1QRYA 3NARA 4M6VA 5IYCJ 3FIWA 2R5ZA 5F04A 3G1MA 4S0HB 2XPVA 3OIOA 1GV5A 1IV6A 3M4OJ 2Y2ZA 1I50J 2FQ4A 3ZQCA 3HOYJ 2ZB9A 4ABZA 2ME0A 3BR2A 3QPSA 1Z0XA 3QQAA 3TEDA 2R92J 2O7OA 1JKOC 1FEXA 1IDYA 1B72A 2CU7A 4A93J 2M0CA 3A01A 2XPUA 1HF0A 3ZQGA 2JMWA 3S1MJ 3BTCA 1FIAA 1ZKGA 1GT0C 3BTLA 4FISA 3SJMA 5F27A 3TP3A 1ZK8A 2EZLA 1BJZA 3S2HJ 2JJ7A 1VFCA 1PUFA 1BL0A 4M3BA 4V2GA 2GLOA 2Y30A 3BTIA 1X2NA 4A3IJ 5FLVA 3S1NJ 1K61A 2LVSA 5E3NA 2ID6A 1UMQA 2DMQA 2K9SA 3FISA 1K83J 1YRNB 4W97A 1XC5A 1IG7A 1OCTC 4DZJA 1BA5A 2NVYJ 4M3GA 4BBSJ 1UG2A 1QVUA 3JRFA 4JX5A 4IHVA 4FCYA 3OSGA 3L1PA 5HODA 3O8GA 2XB5A 1ETWA 5FKNA 3BR1A 1SANA 5IYDJ 2FD5A 3CCYA 5F0FA 3HM5A 2B63J 2M34A 5FKOA 1VI0A 1W0TA 5K7HA 1MBFA 3JRIA 2I10A 4W1UA 4UUSA 2LK2A 2R5YA 2DA7A 1IJWC 2MG4A 1EF4A 2K9NA 3BR3A 3RZDJ 3S2DJ 1ZR4A 3S17J 2AO9A 3QPLA 3ZQFA 3JRHA 1JT6A 2LY9A 3JRBA 1ZGWA 1TWHJ 2AHQA 2HOAA 2NOGA 1ZR2A 1U78A 3PO2J 1OJLA 2DMPA 4XK4A 1R9TJ 3BR0A 1WGXA 4A69C 2R5ZB 1AKHA 2NVQJ 1RR7A 2EQRA 1MH3A 1RPWA 1P7JA 2EBIA 4DYRA 4A3LJ 2LLKA 4CYCB 9ANTA 3GTMJ 2CQQA 4A3CJ 4A3BJ 2CJJA 4FE4A 2OPTA 1IGNA 2HXOA 5EG0A 3UKGA 1GV2A 3A01B 3GTOJ 1HOMA 3K2AA 2DN0A 4A3DJ 1GDTA 1MSFC 4JX4A 2NS8A 1MBGA 1GUUA 2LTPA 2XPWA 1NK2P 3O8HA 3SFIA 2IBDA 4C3IJ 3TP0A 1H88C 1P7IA 3LSGA 3LOCA 1ZTRA 3ZQHA 1IC8A 3TW7A 5M5WJ 2CUFA 2EZKA 2X48A 2XGCA 2KDZA 2COBA 3GTJJ 3MN2A 2DJNA 1ETYA 2FX0A 1FTTA 1LFBA 1GVDA 3HGGA 2DMUA 5EDNA 3LSJA 1H89C 1IDZA 3BR6A 2CRGA 2M9HA 5J1RA 3FKIJ 1A6IA 3HDDA 3IH4A 4BBRJ 3I4MJ 2JWTA 4B1RA 1XS9A 4M3DA 1JKPC 5GP9A 3S14J 4QSHA 2DA4A 5C4XJ 2DMNA 2JA6J 1G2HA 4UUSB 4A3JJ 1Y1WJ 2Y9YA 4DZPA 2DA3A 1B8IB 1JKQC 3LSPA 3Q0UA 4DW6A 2Y0SN 2ECBA 1JUMA 1TWAJ 5DS9A 4JX6A 3BG3A 3FK7A 4XRSA 2R7ZJ 3BT9A 5M5YJ 1HCRA 4Y52J 2LP0A 1VF9A 2X6OA 3W6VA 3NAUA 3VPRA 2IAIA 3OSFA 3HBLA 4IEJA 2Y9ZA 1Q1VA 1W0UA 5JLXA 5FKLA 5F0HA 1ETOA 2H1KA 3D1NI 2JK3A 5JLWA 4BY7J 1WI3A 1TWCJ 1Z77A 3I4NJ 4BXXJ 2KT0A 3CQZJ 2FJ1A 2WB1N 1JUSA 1U9NA 1AU7A 2HOTA 4C2MJ 2DMTA 4B4CA 1ENHA 5E3MA 3JR9A 3HOVJ 5EZHA 3F0CA 3ZQIA 3A02A 1X2MA 3Q3SA 4UUTA 5F0CA 1H8AC 3ZQLA 4X1EA 4C3JJ 2E19A 2D5VA 3RKQA 2DA2A 5M3MJ 1ETKA 2Y31A 2GM4A 1ITYA 3MKLA 2XGDA 5IYBJ 2NS7A 1CQTA 2L7MP 1I3QJ 3A03A 3HOXJ 1IUFA 2JN6A 5IP6A 2YUSA 2HOSA 1SFOJ 3BR5A 3Q0WA 3G1OA 1JKRC 4QIWN 2EZHA 3Q0VA 5C3EJ 2VUMJ 1FTZA 4M3FA 2LKXA 1POGA 4B3AA 1I6HJ 3S15J 1MBEA 1B72B 3MVPA 3CMYA 1F43A 1ORKA 3ZOBA 3BG5A 1O4XA 2DA6A 5F1JA 4X6AJ 1DU6A 2ECCA 2IEKA 4I76A 1E3OC 3GTKJ 4RDUA 1YRNA 2DTZA 3CDLA 2MGQA 2WV1A 2XB0X 4FE7A 4DYCA 5EGOA 1PUFB 3BG9A 4MFEA 4M3EA 4NDLA 5M3FJ 1OFCX 2HI3A 1QVTA 3E7LA 4A3EJ 1WH7A 5FKMA 2W48A 3SDGA 4XIDA 4QTRA 3K7AJ 1MBHA 1LE8A 5GPCA 2H8RA 1U8BA 1APLC 2LFBA 1U9OA 2NVTJ 1WPKA 4J19A 3RZOJ 4XICA 1RETA 3BTJA 3B6CA 4IHXA 5IOZA 2LD5A 1HDDC 1MH4A 2N8GA 4Y7NJ 3S1QJ 1QPIA 3HEFA 5IP7J 3GTGJ 2EZIA 4A3FJ 5BNGA 4MO7A 5J3LA 4L5EA 3LSRA 2R5YB 5EEAA 5EF6A 3H3VK 2CQXA 5GPAA 2QCOA 2OF7A 2JA8J 1ETXA 1Y1VJ 2ME6A 2R0QC 4A3MJ 2O8KA 5DTDA 1A5JA 3PM1A 4C3HJ 1JUPA 1MBJA 4CYCA 4GFBA 5E3LA 3PO3J 2PMZN 4V2FA 1TWFJ 1AKHB 1RKWA 1TC3C 2L9RA 3HB9A 4D5CA 5J1YA 2HYJA 2E2HJ 4BY1J 1JT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1L A;  1AHD P;  5IP9 J;  3GTP J;  3WHC A;  5M5X J;  5C44 J;  1S7E A;  2R93 J;  2VPR A;  4JP0 A;  4D7N A;  5K7F A;  4MFD A;  3C2B A;  2GBY A;  2E2I J;  3M3Y J;  5FKK A;  5EG0 B;  3JRG A;  5J1U A;  3TW6 A;  1JTX A;  2EH3 A;  5C4J J;  3JRA A;  1ETV A;  2RAE A;  2O9L A;  2E1O A;  1D5Y A;  3GTQ J;  3S1R J;  1DU0 A;  3RQI A;  3H0G J;  4A3K J;  5EGO B;  3JRE A;  1JGG A;  4XRS G;  1JJ8 C;  5IOY A;  2HQ5 A;  2G0E A;  3HOU J;  2HDD A;  4IHW A;  5F08 A;  3HKZ N;  4FTH A;  1NK3 P;  1MBK A;  5EYR A;  4AYB N;  4D5F A;  1HLV A;  4D7M A;  1WCM J;  1T33 A;  1LE8 B;  3S16 J;  4XRM A;  5IPA A;  2DA1 A;  2L7F P;  4IHY A;  3IH3 A;  1NTC A;  2X9D A;  1VND A;  2QF7 A;  5E3O A;  1RES A;  2JA7 J;  2MW8 A;  3HOW J;  1B8I A;  1UHS A;  1MNM C;  4G12 A;  2DA5 A;  1X58 A;  1MSE C;  2K40 A;  2NVX J;  2XSD C;  2VI6 A;  4DYQ A;  2E2J J;  3HOZ J;  2VKE A;  3JRD A;  1ETQ A;  4AC0 A;  3JRC A;  3OOU A;  1JJ6 C;  3HGY A;  2XGE A;  1IRZ A;  4A3G J;  4LOC A;  2P81 A;  1TWG J;  3GTL J;  3FK6 A;  5K7Z A;  4EEF G;  2JA5 J;  1BW5 A;  2LR8 A;  1FIP A;  2L7Z A;  2MSY A;  2K9Q A;  2VKV A;  5EZG A;  2ELK A;  2L0K A;  3BQZ A;  1T56 A;  4MLO A;  2HXI A;  4AUX A;  4RBO A;  3IH2 A;  3IV5 A;  3DEW A;  2XRL A;  3DCF A;  3LNQ A;  2WAQ N;  4MIM A;  2CUE A;  1WH5 A;  1F36 A;  3WHB A;  3BQY A;  4JYK A;  4I6Z A;  2TRT A;  3B6A A;  1OCP A;  2ID3 A;  2YU9 J;  1HDP A;  1JTY A;  5FLM J;  2YS9 A;  1FJL A;  4BKX A;  1XG1 A;  2M2E A;  2TCT A;  1ZQ3 P;  2M8G X;  4HNV A;  5FJ8 J;  3GBG A;  1RKT A;  1BW6 A;  1LFU P;  1QRY A;  3NAR A;  4M6V A;  5IYC J;  3FIW A;  2R5Z A;  5F04 A;  3G1M A;  4S0H B;  2XPV A;  3OIO A;  1GV5 A;  1IV6 A;  3M4O J;  2Y2Z A;  1I50 J;  2FQ4 A;  3ZQC A;  3HOY J;  2ZB9 A;  4ABZ A;  2ME0 A;  3BR2 A;  3QPS A;  1Z0X A;  3QQA A;  3TED A;  2R92 J;  2O7O A;  1JKO C;  1FEX A;  1IDY A;  1B72 A;  2CU7 A;  4A93 J;  2M0C A;  3A01 A;  2XPU A;  1HF0 A;  3ZQG A;  2JMW A;  3S1M J;  3BTC A;  1FIA A;  1ZKG A;  1GT0 C;  3BTL A;  4FIS A;  3SJM A;  5F27 A;  3TP3 A;  1ZK8 A;  2EZL A;  1BJZ A;  3S2H J;  2JJ7 A;  1VFC A;  1PUF A;  1BL0 A;  4M3B A;  4V2G A;  2GLO A;  2Y30 A;  3BTI A;  1X2N A;  4A3I J;  5FLV A;  3S1N J;  1K61 A;  2LVS A;  5E3N A;  2ID6 A;  1UMQ A;  2DMQ A;  2K9S A;  3FIS A;  1K83 J;  1YRN B;  4W97 A;  1XC5 A;  1IG7 A;  1OCT C;  4DZJ A;  1BA5 A;  2NVY J;  4M3G A;  4BBS J;  1UG2 A;  1QVU A;  3JRF A;  4JX5 A;  4IHV A;  4FCY A;  3OSG A;  3L1P A;  5HOD A;  3O8G A;  2XB5 A;  1ETW A;  5FKN A;  3BR1 A;  1SAN A;  5IYD J;  2FD5 A;  3CCY A;  5F0F A;  3HM5 A;  2B63 J;  2M34 A;  5FKO A;  1VI0 A;  1W0T A;  5K7H A;  1MBF A;  3JRI A;  2I10 A;  4W1U A;  4UUS A;  2LK2 A;  2R5Y A;  2DA7 A;  1IJW C;  2MG4 A;  1EF4 A;  2K9N A;  3BR3 A;  3RZD J;  3S2D J;  1ZR4 A;  3S17 J;  2AO9 A;  3QPL A;  3ZQF A;  3JRH A;  1JT6 A;  2LY9 A;  3JRB A;  1ZGW A;  1TWH J;  2AHQ A;  2HOA A;  2NOG A;  1ZR2 A;  1U78 A;  3PO2 J;  1OJL A;  2DMP A;  4XK4 A;  1R9T J;  3BR0 A;  1WGX A;  4A69 C;  2R5Z B;  1AKH A;  2NVQ J;  1RR7 A;  2EQR A;  1MH3 A;  1RPW A;  1P7J A;  2EBI A;  4DYR A;  4A3L J;  2LLK A;  4CYC B;  9ANT A;  3GTM J;  2CQQ A;  4A3C J;  4A3B J;  2CJJ A;  4FE4 A;  2OPT A;  1IGN A;  2HXO A;  5EG0 A;  3UKG A;  1GV2 A;  3A01 B;  3GTO J;  1HOM A;  3K2A A;  2DN0 A;  4A3D J;  1GDT A;  1MSF C;  4JX4 A;  2NS8 A;  1MBG A;  1GUU A;  2LTP A;  2XPW A;  1NK2 P;  3O8H A;  3SFI A;  2IBD A;  4C3I J;  3TP0 A;  1H88 C;  1P7I A;  3LSG A;  3LOC A;  1ZTR A;  3ZQH A;  1IC8 A;  3TW7 A;  5M5W J;  2CUF A;  2EZK A;  2X48 A;  2XGC A;  2KDZ A;  2COB A;  3GTJ J;  3MN2 A;  2DJN A;  1ETY A;  2FX0 A;  1FTT A;  1LFB A;  1GVD A;  3HGG A;  2DMU A;  5EDN A;  3LSJ A;  1H89 C;  1IDZ A;  3BR6 A;  2CRG A;  2M9H A;  5J1R A;  3FKI J;  1A6I A;  3HDD A;  3IH4 A;  4BBR J;  3I4M J;  2JWT A;  4B1R A;  1XS9 A;  4M3D A;  1JKP C;  5GP9 A;  3S14 J;  4QSH A;  2DA4 A;  5C4X J;  2DMN A;  2JA6 J;  1G2H A;  4UUS B;  4A3J J;  1Y1W J;  2Y9Y A;  4DZP A;  2DA3 A;  1B8I B;  1JKQ C;  3LSP A;  3Q0U A;  4DW6 A;  2Y0S N;  2ECB A;  1JUM A;  1TWA J;  5DS9 A;  4JX6 A;  3BG3 A;  3FK7 A;  4XRS A;  2R7Z J;  3BT9 A;  5M5Y J;  1HCR A;  4Y52 J;  2LP0 A;  1VF9 A;  2X6O A;  3W6V A;  3NAU A;  3VPR A;  2IAI A;  3OSF A;  3HBL A;  4IEJ A;  2Y9Z A;  1Q1V A;  1W0U A;  5JLX A;  5FKL A;  5F0H A;  1ETO A;  2H1K A;  3D1N I;  2JK3 A;  5JLW A;  4BY7 J;  1WI3 A;  1TWC J;  1Z77 A;  3I4N J;  4BXX J;  2KT0 A;  3CQZ J;  2FJ1 A;  2WB1 N;  1JUS A;  1U9N A;  1AU7 A;  2HOT A;  4C2M J;  2DMT A;  4B4C A;  1ENH A;  5E3M A;  3JR9 A;  3HOV J;  5EZH A;  3F0C A;  3ZQI A;  3A02 A;  1X2M A;  3Q3S A;  4UUT A;  5F0C A;  1H8A C;  3ZQL A;  4X1E A;  4C3J J;  2E19 A;  2D5V A;  3RKQ A;  2DA2 A;  5M3M J;  1ETK A;  2Y31 A;  2GM4 A;  1ITY A;  3MKL A;  2XGD A;  5IYB J;  2NS7 A;  1CQT A;  2L7M P;  1I3Q J;  3A03 A;  3HOX J;  1IUF A;  2JN6 A;  5IP6 A;  2YUS A;  2HOS A;  1SFO J;  3BR5 A;  3Q0W A;  3G1O A;  1JKR C;  4QIW N;  2EZH A;  3Q0V A;  5C3E J;  2VUM J;  1FTZ A;  4M3F A;  2LKX A;  1POG A;  4B3A A;  1I6H J;  3S15 J;  1MBE A;  1B72 B;  3MVP A;  3CMY A;  1F43 A;  1ORK A;  3ZOB A;  3BG5 A;  1O4X A;  2DA6 A;  5F1J A;  4X6A J;  1DU6 A;  2ECC A;  2IEK A;  4I76 A;  1E3O C;  3GTK J;  4RDU A;  1YRN A;  2DTZ A;  3CDL A;  2MGQ A;  2WV1 A;  2XB0 X;  4FE7 A;  4DYC A;  5EGO A;  1PUF B;  3BG9 A;  4MFE A;  4M3E A;  4NDL A;  5M3F J;  1OFC X;  2HI3 A;  1QVT A;  3E7L A;  4A3E J;  1WH7 A;  5FKM A;  2W48 A;  3SDG A;  4XID A;  4QTR A;  3K7A J;  1MBH A;  1LE8 A;  5GPC A;  2H8R A;  1U8B A;  1APL C;  2LFB A;  1U9O A;  2NVT J;  1WPK A;  4J19 A;  3RZO J;  4XIC A;  1RET A;  3BTJ A;  3B6C A;  4IHX A;  5IOZ A;  2LD5 A;  1HDD C;  1MH4 A;  2N8G A;  4Y7N J;  3S1Q J;  1QPI A;  3HEF A;  5IP7 J;  3GTG J;  2EZI A;  4A3F J;  5BNG A;  4MO7 A;  5J3L A;  4L5E A;  3LSR A;  2R5Y B;  5EEA A;  5EF6 A;  3H3V K;  2CQX A;  5GPA A;  2QCO A;  2OF7 A;  2JA8 J;  1ETX A;  1Y1V J;  2ME6 A;  2R0Q C;  4A3M J;  2O8K A;  5DTD A;  1A5J A;  3PM1 A;  4C3H J;  1JUP A;  1MBJ A;  4CYC A;  4GFB A;  5E3L A;  3PO3 J;  2PMZ N;  4V2F A;  1TWF J;  1AKH B;  1RKW A;  1TC3 C;  2L9R A;  3HB9 A;  4D5C A;  5J1Y A;  2HYJ A;  2E2H J;  4BY1 J;  1JT0 A; 
#chains in the Genus database with same CATH topology
 1BIA A;  2P5L C;  3G1L A;  2VOD A;  3WHC A;  5M5X J;  2LY2 A;  3BG6 A;  5C44 J;  4Q48 A;  3I3L A;  1O7L A;  4D7N A;  5K7F A;  4RGR A;  1O3R A;  4CCK A;  3C2B A;  3KET A;  4KUM A;  2X1C A;  4IXA A;  1Y0N A;  5AIQ A;  3BG7 A;  5J1U A;  3JRG A;  4LJZ F;  2EH3 A;  2W57 A;  4PFO A;  4ZDL A;  4ENN A;  2QBY A;  1Z6T A;  2O9L A;  3IHU A;  3OR1 C;  3T0Y A;  1DUX C;  2L9N A;  4B8X A;  1IXS B;  2EV0 A;  4MEX F;  1YS7 A;  1DU0 A;  2Y0S A;  3H36 A;  3H0G J;  4A3K J;  2NRA C;  4NQW A;  3CLO A;  2BVL A;  2V9V A;  1D5V A;  4PGH A;  4QPO A;  2HQ5 A;  1PVE A;  2CS3 A;  2KIM A;  2XAU A;  2IGM A;  4F91 B;  2G9W A;  3PQJ A;  1J9I A;  1R49 A;  2R7V A;  4DGW B;  3J7Z I;  4D5F A;  1HXD A;  3VSK A;  1ZN2 A;  4D7M A;  2M87 A;  2O5R A;  2Z1D A;  3KZI C;  4XRM A;  3VFZ A;  1YQA A;  4HA8 A;  2ELH A;  2HTS A;  3KLN A;  3GVA A;  3HPH A;  5E3O A;  2AQE A;  3IWZ A;  4UVB A;  2VJ4 A;  1MNM C;  3F6O A;  1MSE C;  2K40 A;  2F5C A;  2VI6 A;  2MD0 A;  1SFK A;  3N4M A;  1MJA A;  2XRN A;  2M3A A;  3Q9V A;  2ELJ A;  1ETQ A;  3OOU A;  1Y39 A;  2QKM B;  1ZRD A;  2R3S A;  3D5L A;  4ZC3 A;  3ZGK A;  2E5N A;  4LOC A;  5E20 A;  3AG4 H;  3GLL A;  2JA5 J;  4L5J A;  2IJL A;  4M9Z A;  1Z3Y A;  4RAG A;  3BQZ A;  2E7X A;  1SD4 A;  1BJA A;  2KRH A;  4KMF A;  4RB1 A;  3PJR A;  3K6G A;  3QYF A;  3LNQ A;  2CUE A;  5LHI A;  1Y8R B;  3WHB A;  1UEL B;  3PIP F;  3ELK A;  3OYH A;  4BE0 A;  4JYK A;  3GXO A;  3B6A A;  2KZV A;  1ZEL A;  5HDN A;  2XUB A;  5FLM J;  1J0R A;  3CLQ A;  1XG1 A;  2M2E A;  3I9V 2;  4XLN F;  3RYR A;  4IX7 A;  2M8G X;  3SZG A;  4TV7 A;  3KP6 A;  3R61 A;  3GO5 A;  1HST A;  4HYE A;  1RKT A;  1GHC A;  4LIU A;  3FM3 A;  1QRY A;  5FRM A;  2X85 A;  3FDY A;  4RLQ A;  4M6V A;  3NRV A;  1HW5 A;  3CDI A;  3PNY A;  4NQW B;  3ECH A;  3TL4 X;  5B3S H;  3M4O J;  2Y2Z A;  3MEX A;  1I50 J;  4QLC U;  2LBF A;  2QUF A;  1HBX G;  5FB2 A;  3DPU A;  3TED A;  4P5O A;  2O7O A;  2PG4 A;  3TOB A;  1R00 A;  1DDN A;  5HLG A;  2RN7 A;  2RQQ A;  1G8X A;  1IDY A;  1Z21 A;  2GQQ A;  3ASN H;  2L5Q A;  3A01 A;  3OYK A;  3ZQG A;  4U7B A;  5IT3 A;  3S1M J;  1ZKG A;  3F6V A;  1FYM A;  1S72 I;  4HSR A;  3BTL A;  4FIS A;  1N25 A;  1I1G A;  2PN6 A;  2VQC A;  2W7N A;  1WJD A;  1LDK B;  1FP1 D;  3E6M A;  4A6E A;  3TP3 A;  2GWR A;  2X4H A;  2DOF A;  4OIQ F;  2E36 A;  2JJ7 A;  1PUF A;  4M3B A;  3KLO A;  5GAD J;  1T39 A;  2EK5 A;  1X2N A;  3S1N J;  5CYV A;  2P4W A;  3W2V A;  2ID6 A;  1D0X A;  1I5Z A;  2KIF A;  1YRN B;  3N05 A;  1K78 A;  1XDU A;  2OQR A;  4DZJ A;  4HG2 A;  1J2X A;  1WJC A;  5D6E A;  1UG2 A;  2ISZ A;  2YX4 A;  2DI3 A;  3C18 A;  1SAX A;  3WU2 C;  1I6X A;  2PMZ A;  2ICW G;  2VXZ A;  4XM3 A;  3JRF A;  3CCE I;  2IA0 A;  5BOX A;  1ON1 A;  2ZME C;  4XBF A;  3V7C A;  5HOD A;  4U0Y A;  1KQ9 A;  1SC7 A;  5FKN A;  1WJF A;  1BR1 A;  1NH3 A;  5DD4 A;  2WY7 Q;  3CCY A;  1FYL A;  4EJV A;  2B63 J;  3QWL A;  3WU0 A;  4PJM A;  4XKV A;  4XON A;  4KT5 C;  3CTA A;  3OIP A;  4OAZ A;  4W1U A;  4D1Q A;  5FRO A;  1YX3 A;  2BY2 A;  4CCJ A;  5LHH A;  1VQ8 I;  1EF4 A;  3BR3 A;  1HKQ A;  2DJI A;  2H1L A;  4KN7 X;  4OU0 A;  2V1U A;  3R60 A;  2FSW A;  1JT6 A;  1ZGW A;  2GAU A;  2HQN A;  1TWH J;  2AHQ A;  2L3D A;  1CGP A;  3WGI A;  3IWF A;  4L9J A;  1R9T J;  3JTG A;  3KP5 A;  4A69 C;  4OIN F;  2FNA A;  3HRS A;  4XLP F;  1UHW A;  1RR7 A;  1RPW A;  1JHH A;  1P7J A;  4Q4Z F;  2EBI A;  5TRD A;  1B1B A;  2LLK A;  3D0S A;  4MHG A;  3RPU D;  4CYC B;  4WX9 A;  4JK1 X;  1D0Z A;  1N77 A;  3HKZ A;  3GTM J;  2MYS A;  5CVV A;  1O3T A;  2E34 A;  4I7H A;  2CJJ A;  4XL9 A;  2OPT A;  5L3C A;  1VQL I;  3K4N A;  5JVT A;  3M8E A;  2V6C A;  3LAP A;  5EG0 A;  4WF2 A;  3A01 B;  2V7F A;  1W7P A;  2H09 A;  3CP2 A;  2DN0 A;  3S32 A;  1TT5 B;  4A3D J;  2ETH A;  1GDT A;  2QWW A;  3I71 A;  2NS8 A;  3E0J B;  2FUG 2;  3CDH A;  5D5U B;  2CUZ A;  3E6B A;  3F8C A;  3TP0 A;  3I56 I;  1LFP A;  3LSG A;  2NXN B;  3OR2 C;  3ZQH A;  3IC7 A;  4J00 A;  3CP8 A;  3RKW A;  2DOE A;  2DYR H;  1OYY A;  2QGU A;  2W4S A;  1TLH B;  2BY1 A;  3M7G A;  3BJA A;  2CUF A;  2FOK A;  2V1X A;  3MN2 A;  2FX0 A;  1K7A A;  3SDB A;  1FTT A;  5ICE A;  3BZK A;  2V4J C;  3IAS 2;  4ESF A;  2DMU A;  1XX5 A;  3ZPL A;  2YU3 A;  2CQK A;  2PX9 A;  3LA7 A;  1ZAO A;  4IOA F;  1ULY A;  4HW0 A;  1XGS A;  3J81 K;  4P1W A;  4FAS D;  3KPH A;  2VE9 A;  5LLQ A;  1R71 A;  1R1V A;  3FKI J;  3HDD A;  3GFI A;  2WAE A;  1LEB A;  1MJB A;  4XMY A;  4M3D A;  3FXR A;  2P6S A;  3MKZ A;  1JKP C;  3S14 J;  4QSH A;  1J59 A;  2DMN A;  2JA6 J;  3EDP A;  2RC4 A;  3RTR A;  3CUO A;  3DBL B;  4A3J J;  5E8I A;  1Y1W J;  4DZP A;  2VT2 A;  3CCS I;  2DA3 A;  5CPR B;  1VQN I;  3I0T A;  3Q0U A;  1MIJ A;  4KIC A;  2DFI A;  5LFA A;  4PJ0 C;  5CVU A;  3ZMU A;  3VOD A;  4JX6 A;  3BG3 A;  3LMM A;  3BT9 A;  3NEU A;  2RDP A;  4HF2 A;  4Y52 J;  2JA2 A;  2VC0 A;  4U7D A;  2CV2 A;  1XCB A;  2BY0 A;  2IAI A;  4G94 A;  1MMA A;  1P9Q C;  2M1B A;  5J4V A;  1FSE A;  5F0H A;  3H0D A;  2STW A;  5EEG A;  3KFW X;  3QPT A;  4KIB A;  1GLN A;  1FY7 A;  2XF6 A;  2JK3 A;  2EPF A;  2LC2 A;  3I4N J;  3E3V A;  2KT0 A;  3ZQQ A;  4CZZ A;  5HLI A;  3CD6 I;  4QPQ A;  5E17 F;  4G6Q A;  4C2M J;  2DMT A;  3MZY A;  2XRO A;  1HA8 A;  3OYI A;  3HOV J;  3ZQI A;  2YPR A;  1RIO H;  4UUT A;  2HDC A;  3ZQL A;  4I0B A;  2PI0 A;  2IVM A;  4R1H A;  2DA2 A;  3PNV A;  1EKE A;  1I3A A;  2WTE A;  2VAS A;  4RGX A;  4BH9 A;  1U5T A;  1WFX A;  2BV6 A;  3QU6 A;  4BHC A;  3MKL A;  3W3C A;  2VBW A;  2IRF G;  2RQP A;  4CDG A;  3A0B C;  4CO8 A;  1SEU A;  2IS2 A;  5IYB J;  1P4W A;  2NS7 A;  4B47 A;  1CQT A;  1T0F C;  2EFO A;  3KP4 A;  2Y69 H;  3RQ4 A;  4YIR X;  3HOX J;  1A36 A;  4ZDO A;  4ZYH A;  3CES A;  1SFO J;  3Q0W A;  4KMU X;  1A6Q A;  4B44 A;  3S93 A;  2OCE A;  5CVR A;  3H5A A;  2CSO A;  1HW2 A;  1F5T A;  3F8B A;  4CCO A;  1FNN A;  4B3A A;  2PMU A;  1PUE E;  3S15 J;  1B72 B;  1S6L A;  5H6R A;  3MVP A;  3CO7 C;  1F43 A;  3U21 A;  5K1Y A;  1ORK A;  3ZOB A;  2QVO A;  2DA6 A;  2CV0 A;  3HRU A;  2HPI A;  2VBX A;  3P7N A;  1QHH D;  1QZY A;  2QQ8 A;  5JVG F;  1V4R A;  1XSX A;  2OBP A;  1PP8 F;  2LNB A;  1E3O C;  3GTK J;  1DU6 A;  2P5K A;  1FOW A;  1R22 A;  2O61 A;  4IKF A;  4BE2 A;  3DV8 A;  3F9K A;  3L2R A;  2FNP A;  2V26 A;  3ZR8 X;  4N4N B;  2KPM A;  5FO5 A;  2LKP A;  4LMY A;  3NQO A;  3IUO A;  2KIU A;  2FBI A;  3BG9 A;  3QAH A;  4MFE A;  4M3E A;  3NWS A;  3T8R A;  1SFX A;  3EYY A;  1QVT A;  1W5C C;  3W6J B;  4KIT B;  3COA C;  1WH7 A;  1GXQ A;  2H8W A;  4QTR A;  1K79 A;  3K7A J;  2H8R A;  1U9O A;  2NVT J;  1WPK A;  4MTE A;  5D5V B;  2KLO A;  4XIC A;  1RET A;  1YFH A;  1FWZ A;  3B6C A;  3MD2 A;  3ABU A;  3OS0 A;  4Y7N J;  3S1Q J;  1QPI A;  3TDU C;  2X51 A;  4YFN F;  1I1S A;  3TMO A;  1YG2 A;  3IP4 B;  3FMS A;  3OYD A;  2WAQ A;  4K2E A;  4L5E A;  3LSR A;  5EEA A;  5ILU A;  5EF6 A;  3H3V K;  1X1P A;  3ZQ7 A;  5TIS C;  4BQA A;  3MZ8 A;  1O57 A;  1Y1V J;  4BQQ A;  3MFK A;  3CJR B;  3BRO A;  4G8X A;  4E7L A;  3VSL A;  1JUP A;  4MEY F;  1E2X A;  2FBK A;  3OS1 A;  5LD2 C;  3UNG C;  1R4M B;  2LG4 A;  4V2F A;  3EQL F;  1KON A;  1AKH B;  5J1Y A;  2AXL A;  3CMA I;  4FX0 A;  2EIN H;  2R7O A;  1AHD P;  1FC3 A;  3GTP J;  1Y8Q B;  2R7X A;  3KP2 A;  4R8H A;  2LSO A;  3C7J A;  1R6R A;  2L01 A;  1S7E A;  3PUB A;  1SD5 A;  4WXC A;  4JP0 A;  5BQT A;  4M6Y A;  1U8R A;  2E1N A;  4YIF A;  3VYU B;  4AWX B;  2EIJ H;  4XNF A;  5FKK A;  1FOY A;  3S2W A;  1JTX A;  5C4J J;  2EB7 A;  3BY6 A;  4IF4 A;  3MZH A;  2O03 A;  1ZGA A;  1BI2 A;  3JRA A;  2X1D A;  3WGG A;  2R7F A;  3ASO H;  3HUG B;  2EFQ A;  1B9N A;  4EGY A;  2UWM A;  2DT6 A;  5DCF A;  4CHU A;  2R7U A;  4ZYA A;  3JRE A;  3KZY A;  4ESB A;  1YIO A;  2LF7 A;  1JGG A;  3CUQ A;  3ZMD A;  2HDD A;  2M7A A;  4CYD A;  2HZT A;  1U6G A;  3GZN B;  4AYB N;  4KNY A;  1HLV A;  3HSE A;  1ON2 A;  2WBM A;  3S16 J;  5IPA A;  2Z9O A;  5HS9 A;  1WRJ A;  3IH3 A;  5JI6 A;  5HOO A;  2X9D A;  1HC8 A;  1WSU A;  1LNW A;  1S7O A;  1RES A;  3BJ6 A;  3PQK A;  2HGC A;  2V79 A;  3QP6 A;  5DV5 A;  5LRS A;  1G4D A;  4HLY A;  4I2O A;  3HOW J;  1B8I A;  3JAM K;  4RMN A;  4IPA A;  2MAB A;  3A4C A;  2DTR A;  4IQJ A;  2JA7 J;  2E2J J;  4OIP F;  4CCL A;  4LGW A;  3U1K A;  2JZY A;  4BJ6 C;  2VKE A;  4U88 A;  1B4A A;  4AC0 A;  2DO7 A;  2IT0 A;  4LG3 A;  3CCU I;  2ZNZ A;  1JJ6 C;  5HDG A;  3HGY A;  2BHY A;  1K6O A;  3LSM A;  2ESH A;  2X1E A;  2DOD A;  2XGE A;  5ICG A;  1KQ8 A;  2VJJ A;  4A3G J;  2P81 A;  4N4O B;  2JRT A;  2GXB A;  1L3L A;  5K7Z A;  2OTJ I;  1IW7 F;  1BW5 A;  2LR8 A;  5E8G A;  2L7Z A;  2HTJ A;  2MSY A;  4AUX A;  2L0K A;  1T56 A;  1U0J A;  1OR7 C;  1V3F A;  3C2H A;  3ERM A;  3V7S A;  1TP4 A;  4Z6Y A;  2FA5 A;  3HZJ A;  4KFC A;  3IV5 A;  1H9G A;  3DEW A;  5GTI C;  2FBH A;  1KU3 A;  3ABM H;  5GAH J;  2WAQ N;  2Q2E A;  1XB4 A;  1WH5 A;  1F36 A;  4U0W A;  2VJ5 A;  1OCP A;  2EIK H;  2YU9 J;  2DFH A;  1JTY A;  4OOI A;  1FJL A;  4BKX A;  3LFK A;  1RR8 C;  2TCT A;  4AM3 A;  3GWZ A;  1FBQ A;  4Y3O A;  3HOT A;  1E3H A;  4GGG A;  4O5V A;  3GBG A;  1LEA A;  1BW6 A;  4CXF A;  1JI8 A;  5CJ9 A;  3CMM A;  3FIW A;  1XN7 A;  2IA2 A;  3G1M A;  4C30 A;  4D9J A;  2D2W A;  2M7B A;  4KT6 A;  2XPV A;  3DTI A;  3OYB A;  4AIJ A;  1VQ6 I;  3O2P E;  1IV6 A;  1VQK I;  3I59 A;  1NG6 A;  2XHK A;  2HVR A;  3CUQ B;  2FQ4 A;  3ZQC A;  1BC8 C;  3HOY J;  1LDJ A;  5D6F A;  2TDX A;  2ME0 A;  3BR2 A;  2W84 A;  4IRI A;  1Z0X A;  2H27 A;  3QQA A;  4BDY A;  4Q47 A;  1JKO C;  4NNJ A;  2MH2 A;  1FEX A;  1R5G A;  4KA4 A;  1SMT A;  4RGS A;  2R4G A;  2VQG A;  4M6X A;  4RB2 C;  4A6D A;  5B66 C;  4ENK A;  2M0C A;  2XPU A;  1HF0 A;  2JMW A;  3Q5F A;  3ABL H;  2HYG D;  1FZP B;  2L4A A;  1ZLJ A;  3TO9 A;  3SJM A;  1IN5 A;  1W5S A;  4N9I A;  1MGT A;  1HKS A;  1MND A;  4M9S A;  2VE8 A;  2CO5 A;  1B59 A;  1V54 H;  2EZL A;  2Z2S B;  2KQR A;  4EJO A;  3ZMZ A;  4KIF A;  3IRR A;  4G7Z F;  2OZ6 A;  3FXO A;  2Y30 A;  1P2F A;  1XMK A;  1K61 A;  4GDF A;  1TZL A;  2LVS A;  2XAH A;  2EWN A;  2EFW A;  1UAA A;  2PFB A;  2IS4 A;  1BBY A;  2DMQ A;  4G6D A;  2H6C A;  2VON A;  3FIS A;  2VB6 A;  2FU4 A;  2OUM A;  4C9Y A;  4E6K G;  1MJ9 A;  3FHZ A;  2OD5 A;  4BBS J;  3PFY A;  2HKO A;  1AA7 A;  2F2E A;  2JT1 A;  5HNF A;  1VQ4 I;  5GAE J;  4HZF A;  1FBS A;  1N78 A;  5IYD J;  2FD5 A;  3FXM A;  1J09 A;  2O6G E;  5FKO A;  3C1D A;  2ZNY A;  4NC8 A;  2CH0 A;  5DEQ A;  3CCV I;  1QZE A;  2NOJ B;  5K7H A;  3KZZ A;  4XOP A;  2I10 A;  4UUS A;  3QOE A;  1IJW C;  2E71 A;  2PJR A;  4PSW A;  3RZD J;  3S2D J;  1SMY F;  4IQ4 A;  5K5Q A;  3E6C C;  3I4P A;  4I09 A;  1OPC A;  3I64 A;  3CCM I;  3HIF A;  2LY9 A;  1G3T A;  4ZYD A;  1T95 A;  2WB1 A;  2KRC A;  2HU9 A;  2NOG A;  4XSX F;  1QA6 A;  1OJL A;  3CC7 I;  3QOD A;  5HS8 A;  5LGU A;  1RC9 A;  4PFP A;  1Z3X A;  3K1M A;  4M9X A;  2LRD A;  3FF5 A;  4NHJ A;  4LLN A;  3I59 B;  4HQE A;  1STZ A;  4B3X A;  4DYR A;  3HOS A;  5KVR A;  3HTU A;  3HJE A;  5L3G A;  2BEO A;  1DGW Y;  2CQQ A;  5DD8 A;  1YIJ I;  3RDI A;  3VWB A;  3KIO A;  4BXF A;  3HG9 A;  2MC4 A;  1ZLK A;  2ESN A;  3UKG A;  3E5X A;  3LWF A;  4CIC A;  3WOD F;  2D1V A;  4BUP A;  5E79 C;  3TDZ C;  4B09 A;  2KJC A;  1MD0 A;  1MSF C;  4JX4 A;  1BN5 A;  3JSP A;  1OLT A;  3M1C A;  4E70 A;  4DQ2 A;  4P96 A;  2XDV A;  1OCO H;  1HKT A;  3SFI A;  5DUK A;  1P7I A;  4KYW A;  4ENM A;  3OYA A;  5FLX K;  2K27 A;  1IC8 A;  2QBY B;  3BWG A;  4ASN A;  1D1A A;  1FT9 A;  2EZK A;  2XGC A;  3GFJ A;  4PGG A;  3J80 K;  2KDZ A;  2R7S A;  2Z33 A;  2COB A;  3GTJ J;  1K4S A;  4EM1 A;  1YJW I;  1GVD A;  1MNE A;  3HGG A;  4L0Z B;  5EDN A;  2MD5 A;  1PYV A;  1IAW A;  4UXN A;  3DTK A;  3LSH A;  4HF0 A;  4BJT A;  2CRG A;  3RJP A;  2B7E A;  2M9H A;  1LQ1 A;  2HNH A;  5D8L B;  2JSP A;  3OMY A;  2KIQ A;  1A6I A;  4BBR J;  3I4M J;  2G7U A;  1F1Z A;  4AIH A;  1WJ5 A;  3RKY A;  3F8N A;  1G2H A;  4ITV A;  5DYM A;  2K7L A;  4UUS B;  1FMW A;  1IN8 A;  3BOQ A;  2Y9Y A;  1WKM A;  4L5I A;  3L2C A;  1JKQ C;  3J7A O;  3LSP A;  4BAY A;  2Y0S N;  2V1N A;  5AON A;  2ECB A;  2MFZ A;  1JUM A;  5DS9 A;  2VPL A;  2CW0 F;  3AFH A;  4EJU A;  5BPD A;  2K5C A;  3BCA A;  5J8C A;  4XRS A;  4H4K C;  3AKZ A;  1S8N A;  3KP7 A;  3H3U A;  5TGT A;  5M5Y J;  4BAC A;  4FX4 A;  1GVJ A;  2PQ8 A;  2X6O A;  1X4O A;  2NVU B;  3NAU A;  4WCG A;  3VPR A;  3EUH C;  1V5E A;  3OYF A;  4IEJ A;  2A6H F;  3K2Z A;  4ZDP A;  2UV1 A;  2H1K A;  1Z6R A;  3J7Y J;  1Z77 A;  2OQG A;  4AD9 A;  3MWM A;  2ZXW H;  2FJ1 A;  4OWR B;  2WB1 N;  1JUS A;  3AG1 H;  5KNL A;  3OYE A;  1Z9C A;  1AU7 A;  2HOT A;  5FRN A;  2A6E F;  2OC6 A;  2PJP A;  2JQ7 A;  1T2K A;  2FMY A;  3F0C A;  4DBQ A;  2UXX A;  2HPM A;  1X2M A;  2A68 F;  4OIO F;  2JTV A;  3Q3S A;  2Y75 A;  3ZXS A;  1Z1D A;  1Z7U A;  3ABK H;  5LEK A;  3F22 A;  2M8E A;  3F3X A;  4XLA A;  2C6Y A;  2AQF A;  2Q1Z B;  4JQF A;  3PNT A;  2VC1 A;  4BHP A;  3KCC A;  4UHT A;  2YR2 A;  5K5O A;  3CJQ B;  4BGD A;  5CQG A;  2L7M P;  3ECO A;  2QA4 I;  1EJ9 A;  1KYZ A;  2LBF B;  1IUF A;  2JN6 A;  2XGX A;  5IP6 A;  2YUS A;  1KU7 A;  3BR5 A;  1YYV A;  2FF4 A;  3G1O A;  4F92 B;  4QIW N;  2J5O A;  1XMA A;  5C3E J;  4IHS A;  1MBE A;  2F48 A;  2QKL B;  2RNG A;  5LBQ A;  3CMY A;  5KCM A;  1W36 C;  3RKX A;  1IN6 A;  2E35 A;  2FQ3 A;  4O3M A;  4ESJ A;  5FGM A;  1LUJ B;  4NC7 A;  2O8X A;  3GUD A;  4RDU A;  4Y15 A;  5A2Q K;  2R7T A;  1Y0U A;  4CSW A;  2MGQ A;  1IN7 A;  3SQN A;  3GZ5 A;  2WV1 A;  4BNC A;  4DYC A;  5EGO A;  2RGV A;  1PUF B;  4L9N A;  4XOT A;  3CME I;  4EM0 B;  3S3O A;  3L2U A;  3AAF A;  1VQ5 I;  4LK1 F;  3R4K A;  3E5U A;  1K78 B;  3DBH B;  1TNS A;  4A3E J;  2PLY A;  4HDV A;  5FKM A;  2V9K A;  2P0W A;  4GRI A;  1J5Y A;  2CUJ A;  3OYM A;  1R5H A;  3HSR A;  3W2W A;  1APL C;  1KGS A;  3C2G A;  5KHD A;  2QEN A;  3RZO J;  4KIG A;  1TQM A;  2F4M B;  2KMU A;  2X6W A;  4BJ5 C;  4IHX A;  3SZP A;  2VIX A;  2RRE A;  4RB0 A;  5IOZ A;  5K5R A;  1HDD C;  2YSR A;  2DK8 A;  1MH4 A;  2N8G A;  2MLK A;  3HEF A;  1YI2 I;  2WA0 A;  1QPM A;  2VKH A;  1MW7 A;  4MO7 A;  3WTV C;  1E17 A;  1X3W B;  2CQX A;  2JPB A;  5GPA A;  2JA8 J;  3K4M A;  4A3M J;  2R0Q C;  4L9T A;  4F55 A;  3RPQ A;  2M30 A;  1A5J A;  3PM1 A;  3T8T A;  1D8K A;  3OWT A;  5E3L A;  3S8P A;  3G2B A;  2PMZ N;  1TC3 C;  3VEP A;  1EH7 A;  4D5C A;  3HB9 A;  2F4O B;  3RYP A;  2WAD A;  2GA1 A;  4X0G A;  1JT0 A;  1W4M A;  5D5X B;  2XV4 S;  5D4S A;  3E5Q A;  3IKT A;  1OCZ H;  3HYI A;  1W5T A;  2B9S A;  4XKC A;  2XAQ A;  2R93 J;  5LRR A;  1BR2 A;  2VPR A;  4ON0 A;  4MFD A;  1R4N B;  3QU3 A;  1LJ9 A;  1UST A;  4F7Z A;  4KDP A;  4G7O F;  1IRX A;  1XMX A;  4Y17 A;  5EG0 B;  3MKY B;  3QRF F;  1W7P B;  3D5R C;  3ZMS A;  1OMI A;  3W6K B;  4ANJ A;  3CJT B;  1BC7 C;  1ETV A;  1SD6 A;  2RAE A;  3K1P A;  3VB2 A;  2P8T A;  1XGM A;  2O3F A;  4H0E A;  1YS6 A;  1D5Y A;  4XLC A;  4OMY A;  3S1R J;  2DQR A;  3SEQ A;  3RQI A;  3PFI A;  1BIB A;  1QQI A;  2CFX A;  2I8D A;  5EGO B;  3ISP A;  4A5N A;  2G7H A;  1JJ8 C;  3LQQ A;  3I53 A;  5IOY A;  3GME A;  1R23 A;  2VLA A;  1DP3 A;  3O6B B;  5F08 A;  3HKZ N;  3ZN1 A;  4IHW A;  1NK3 P;  4G9Y A;  4WXH A;  2GOX B;  1MBK A;  4HOB A;  4HV6 A;  1J7K A;  5J4Y A;  3TQN A;  1TW3 A;  3ZP5 A;  2JVH A;  3M8J A;  2L7F P;  1NTC A;  4PUS A;  4HPQ A;  2XAS A;  3KX2 A;  1VND A;  4CCN A;  4IOC F;  1FYK A;  4B43 A;  1P92 A;  1WJB A;  2MW8 A;  1V5F A;  3WTU C;  1JXS A;  1UHS A;  4HQM A;  4EAT A;  2M4K A;  4G12 A;  4EVI A;  1LB2 A;  1DQU A;  4X6A J;  3LSI A;  2YX7 A;  5AIP A;  3RIR A;  2XSD C;  1D1C A;  4DYQ A;  2NVX J;  3I5U A;  3ROU A;  5ED4 A;  1O3S A;  2HVS A;  3L2Q A;  1IUY A;  5J47 A;  1V55 H;  2KL4 A;  1YHQ I;  2NNN A;  5EJC A;  4KIS A;  3LQR A;  4BDZ A;  1IRZ A;  1KZH A;  2BY3 A;  1Z91 A;  2L54 A;  2ACJ A;  1TWG J;  4KJZ A;  3GTL J;  2FE3 A;  3FK6 A;  1FIP A;  1F4K A;  3H5N A;  2K9Q A;  1V5G A;  2V1D A;  2ELK A;  3HRT A;  3FM5 A;  4MLO A;  2DPD A;  2HXI A;  2Z5U A;  1EV7 A;  2ADU A;  1ZG5 A;  2CQ7 A;  2ZBK A;  3IH2 A;  2W82 A;  1X4P A;  3B73 A;  1SD7 A;  4LK0 F;  3DCF A;  1G3W A;  4G7H F;  1BI0 A;  3A1Y A;  3E6D A;  1ZAR A;  1UHM A;  2BBY A;  2LRE A;  3BQY A;  4I6Z A;  2TRT A;  2ID3 A;  1HDP A;  4BYY A;  3KE2 A;  3JSO A;  3IKV A;  4XR6 A;  2ZME A;  1RI7 A;  2GXG A;  1ZG3 A;  1ZQ3 P;  2LY1 A;  1Y6I A;  5DCM A;  3J7A Y;  2JPC A;  1X1B A;  5FFZ A;  4EJW A;  2GIZ A;  2VQL A;  1LFU P;  3G4S I;  3NAR A;  4ZTJ A;  2IGK A;  3GZ6 A;  4KN4 X;  2R5Z A;  2A05 A;  2VOO A;  2KDO A;  1X3Z B;  3OIO A;  4HRI A;  2CWE A;  2OAZ A;  2F6C A;  1GV5 A;  3TGN A;  4DJA A;  3FXL A;  1RRJ A;  4IRH A;  1U5T B;  3I58 A;  3L2V A;  1UB9 A;  2R92 J;  4BHB A;  1TNT A;  2JVG A;  1ZH5 A;  1ONV A;  1W1W E;  3R6S A;  2JUC A;  1O7F A;  1IZ1 A;  2DQL A;  3EET A;  3HL2 A;  4MQV A;  3TBI A;  4LB6 B;  4A93 J;  4PSX A;  4BQO A;  5ICF A;  2KP6 A;  2EFN A;  3GLX A;  1J75 A;  1DPR A;  1CF7 A;  2EIL H;  3L7W A;  3WG7 H;  1BOA A;  3WTT C;  5FD5 A;  2D45 A;  4XKB A;  1YOV B;  1K4T A;  3OYJ A;  3GX4 X;  4UUV A;  4NB5 A;  1OKR A;  1WWX A;  1BJZ A;  4J01 A;  3S2H J;  4N0B A;  1VFC A;  2GIV A;  3GW2 A;  3UR3 C;  4V2G A;  1HW1 A;  1PDN C;  2LMD A;  5E3N A;  3LSK A;  2IXS A;  4U87 A;  1UMQ A;  2K9S A;  1K83 J;  4BU2 A;  3GFL A;  1C0W A;  1XC5 A;  1IG7 A;  1OCT C;  3CF2 A;  3WE2 A;  3M9A A;  3G3Z A;  1QO0 D;  1QVU A;  4YEJ A;  2CGP A;  1K6Y A;  1KYW A;  4JX5 A;  2MBF A;  4A2U A;  3N97 A;  5JHF A;  3OSG A;  3L1P A;  5BPI A;  2H94 A;  1ETW A;  2LF8 A;  3BR1 A;  1XGO A;  4IRG A;  4IVN A;  2L4M A;  1S7A A;  3O3K A;  4MTD A;  5F0F A;  4DIQ A;  2Y48 A;  1VI0 A;  3BPV A;  3RSN A;  3DXJ F;  2R5Y A;  2LK2 A;  4DOZ A;  2MG4 A;  2K9N A;  2ZME B;  1ZR4 A;  3RPU A;  5F64 A;  3S17 J;  5B5E C;  4HNU A;  3ZQF A;  2HVQ A;  1IV8 A;  1R1U A;  2HOA A;  4AVZ A;  5TJJ A;  5ILV A;  1ZR2 A;  4IL6 C;  5DM7 F;  2IS1 A;  2R5Z B;  1WGX A;  1NHA A;  2P6T A;  3TO7 A;  4BEH A;  3OV8 A;  2WV0 A;  3BC8 A;  1D8J A;  1FP2 A;  3OYC A;  1DP7 P;  1X19 A;  4M73 A;  4LIV A;  1RUN A;  4EM2 A;  4XQF A;  2E5Z A;  5HDK A;  2ZC2 A;  2W1O A;  1EH6 A;  2VOP A;  3EPZ A;  4A3C J;  4A3B J;  1QHG A;  4FE4 A;  1VQP I;  2A69 F;  1WVR A;  2HS5 A;  1S5L C;  2KHM A;  3K4K A;  4NUB A;  3AL0 B;  2OTL I;  3WE3 A;  3ULQ B;  4LB5 A;  3KEO A;  1BM9 A;  1HQC A;  3DEU A;  2L2O A;  4U0V A;  2CFO A;  1MBG A;  3TO6 A;  1WQ2 A;  1A04 A;  2MA3 A;  2XPW A;  2ZCW A;  3O8H A;  3MMY B;  2A07 F;  2LDU A;  3LOC A;  4LIT A;  4I01 A;  4ENJ A;  3H1C A;  3J81 Z;  3TW7 A;  5ICC A;  2LH9 A;  3WTW C;  2X48 A;  3RCO A;  3KP3 A;  1OQY A;  1W7P D;  2EJR A;  1IO2 A;  4S04 A;  3T5X A;  1LFB A;  2XF5 A;  1YTY A;  5LEJ A;  1MMG A;  1R5I D;  2JRM A;  3LSJ A;  1BOB A;  1IN4 A;  2DT7 B;  1WHU A;  3BR6 A;  5L3F A;  5J1R A;  2QQ9 A;  2Z3Y A;  1EA3 A;  4B1R A;  1XS9 A;  2AS5 F;  3H9Q A;  2RKH A;  3SFZ A;  2ZFU A;  2M45 A;  2DA4 A;  4E7J A;  2VXD A;  1L0O C;  1T0F A;  5HLH A;  3E1S A;  4XN3 A;  3H92 A;  1B8I B;  2CG4 A;  2QQA A;  4ZH4 F;  6PAX A;  1T6S A;  3FZV A;  3ZN0 A;  1T08 B;  1XD7 A;  2F4I A;  5EEH A;  3DFG A;  3LA3 A;  4M71 A;  1ZRE A;  4BL0 B;  4C2T A;  4BQN A;  3OYN A;  2DOA A;  3GCM A;  1JHF A;  3FK7 A;  3JCU C;  4FQG A;  4PCQ A;  2R7Z J;  2HFH A;  1HCR A;  4BEH B;  4XOR A;  2LP0 A;  2PBI A;  1X1C A;  3LA2 A;  3SZT A;  3W6V A;  1FOX A;  3OSF A;  3DTE A;  4HNT A;  1YW7 A;  2DU9 A;  3QPH A;  5HNH A;  1G3S A;  1S3J A;  3U2R A;  3SXY A;  1ETO A;  3ESW B;  1ZYR F;  4HV5 A;  3D1N I;  1M1E B;  4BY7 J;  4IZZ A;  3BLY A;  4YRV A;  5DM6 F;  2M5W A;  3CQZ J;  3ABT A;  3GYH X;  3A0H C;  1U9N A;  1TBX A;  2Q0O A;  3QP5 A;  5E3M A;  2I5U A;  2Q2E B;  2P7V B;  5HVQ C;  5EZH A;  5CVJ A;  3A02 A;  1FX7 A;  1D0Y A;  2IS6 A;  2HQR A;  1RNL A;  2F5F A;  2K02 A;  3KEQ A;  4C3J J;  1YJ9 I;  1KA8 A;  3EUA A;  4PZJ A;  2FML A;  1X1D A;  5B1B H;  2NNY A;  2IPQ X;  1U3E M;  4Q5S F;  1Q1H A;  2BW3 A;  1ETK A;  5KAF C;  2IGN A;  2Y31 A;  1IXR C;  4Y13 A;  1JE8 A;  2J5P A;  1YIT I;  3K4J A;  3ERE D;  2EIM H;  1FOK A;  1OYW A;  2RNJ A;  2E1M B;  5FD6 A;  3WG9 A;  4M74 A;  1UFM A;  5F6F A;  1VQM I;  1R7J A;  3L00 A;  1NG7 A;  3FXJ A;  3A03 A;  4AU7 A;  5H20 A;  3H9J A;  2A5W A;  3IAM 2;  3SEZ A;  2LKS A;  2HOS A;  2DFE A;  3BP8 A;  2RVC A;  4A0Z A;  2VUM J;  3CJN A;  2F5D A;  3P9C A;  1FTZ A;  4M3F A;  2LKX A;  4UVA A;  4XLE A;  5ILS A;  5D8K B;  4UV8 A;  3CZ6 A;  3BG5 A;  1O4X A;  2R7D A;  5F1J A;  1R36 A;  2ECC A;  2IEK A;  2HKX A;  4I76 A;  5IT9 Z;  2X0L A;  1YRN A;  2DTZ A;  1QNT A;  3PIO F;  2XSJ C;  2K86 A;  2LYC A;  4FE7 A;  4JBA A;  4E7S A;  3FWE A;  3LAJ A;  1MZB A;  3V8J A;  2KJB A;  4Z2Y A;  2BOL A;  2WAF A;  4NDL A;  5M3F J;  2HI3 A;  4Y33 A;  1MDM A;  3QYB A;  1PJR A;  4RM2 A;  3I55 I;  2OA4 A;  2W48 A;  4XID A;  3WTX C;  1LE8 A;  3FXU A;  1MBH A;  1OCC H;  5GPC A;  3CCR I;  2BHZ A;  2LFB A;  2OZU A;  1RUO A;  3QOP A;  3K9T A;  1IRG A;  1UZC A;  2Y0M A;  2PMH A;  1VZ0 A;  3BTJ A;  4UVC A;  1ZHF A;  4L18 B;  2GOM A;  4GYI A;  3ZCO A;  1LVK A;  3H9G A;  1I39 A;  2IW5 A;  1U5T C;  4RAZ A;  5IP7 J;  2ZO4 A;  1LKX A;  3HHG A;  2EZI A;  4F52 A;  3GTG J;  2OCC H;  4FHT A;  3HC7 A;  1X1A A;  2HZD A;  3JW4 A;  2W24 A;  5BNG A;  3CC4 I;  5J3L A;  2K9M A;  1AOY A;  2PJR B;  2QCO A;  1VQO I;  3DBR B;  3BZ6 A;  1LPQ A;  2O8K A;  2DYS H;  2CW8 A;  2OU2 A;  2BW3 B;  3RI4 A;  4C3H J;  2DDA A;  2IP2 A;  4A5M A;  1SFU A;  4CYC A;  3M8F A;  4GFB A;  3BDD A;  5GAG J;  1H9T A;  3OL3 A;  5L3D A;  3PO3 J;  3FMQ A;  1TTY A;  1TWF J;  2W25 A;  4CUG A;  3A2K A;  2HYJ A;  1DPU A;  2E2H J;  1XTA A;  2QYO A;  5B1A H;  2DFF A;  3ZMT A;  2Z16 A;  3OS2 A;  1T8I A;  5IP9 J;  3OYL A;  4Y4R A;  4MGR A;  3GEZ A;  2GBY A;  1E3P A;  4XN0 A;  2E2I J;  4IJA A;  4P9U A;  3FKJ A;  3OY9 A;  1EH8 A;  2VL8 A;  3BJO A;  2XC7 A;  3M3Y J;  1OR7 A;  1XSD A;  1OCR H;  2NYX A;  2STT A;  1W36 D;  3EUK L;  3TW6 A;  1B6A A;  4CGZ A;  4CA0 A;  5JHU A;  2XIG A;  3HPG A;  2R7W A;  4RAY A;  4YG2 F;  1TQP A;  2E1O A;  5E1X A;  4MNU A;  3K4L A;  3GTQ J;  4NBQ A;  3FX3 A;  3CO6 C;  1TL8 A;  4RAF A;  4I0A A;  2X6Y A;  5CQE A;  4XRS G;  2V9P A;  2G0E A;  4EQQ A;  3HOU J;  4XLF A;  4FTH A;  1Z7L A;  3HHH A;  4LLL A;  3HTS B;  1F9N A;  5EYR A;  3JAM Z;  3K70 D;  1MDM B;  3F23 A;  2VJI A;  2MLG A;  1T33 A;  1WCM J;  3L09 A;  3CCL I;  1LE8 B;  5BS6 A;  2DA1 A;  4IHY A;  3TOA A;  2MH9 A;  5BMZ A;  3K4C A;  3FBN B;  5JR3 A;  3DQV C;  2QF7 A;  4E7K A;  1Z05 A;  4PJN A;  3DEE A;  4HX8 A;  1P6R A;  3EYI A;  2A3S A;  3P9K A;  4I99 C;  3E97 A;  3WU1 B;  2DA5 A;  1BI1 A;  1X58 A;  2ISY A;  3KYD B;  3G6E I;  4UY8 I;  2XKP A;  2BYV E;  2DAO A;  3HOZ J;  5F1R A;  4GCV A;  2H6B A;  3JRD A;  2EFP A;  2W00 A;  3JRC A;  1ACI A;  1VTN C;  4II3 A;  3AL0 C;  1SVL A;  4HX7 A;  2VN2 A;  4WXD A;  1X3U A;  1JGS A;  3GFM A;  4YII A;  4EEF G;  3BPX A;  4ZZD A;  5E1W A;  5EZG A;  2VKV A;  2E60 A;  4RBO A;  2OJE D;  2GZW A;  3V7R A;  5CKT A;  3K70 C;  2XRL A;  3HRM A;  2GA2 A;  1Z67 A;  4MIM A;  3K1N A;  1LVA A;  3CF5 F;  4RS8 A;  1T38 A;  2M4G A;  1LDD A;  4EJT A;  4LLG F;  2YS9 A;  2QQB A;  3H3Z A;  4S05 A;  3CUQ C;  3DLL F;  4HNV A;  5FJ8 J;  3V8L A;  4RGU A;  4B48 A;  1KU2 A;  2CMP A;  3AG3 H;  4OMZ A;  5IYC J;  3JTH A;  5F04 A;  2HOE A;  3W2A A;  4S0H B;  1USS A;  3OIQ A;  3OL4 A;  3ML6 A;  2L02 A;  1AWC A;  2ZXI A;  2L7K A;  5GTH C;  1TW2 A;  3HSF A;  2ZB9 A;  4ABZ A;  2VKD A;  4ZYE A;  1BR4 A;  3QPS A;  3FXQ A;  1A35 A;  4CZC A;  5KK1 A;  2JUG A;  3VYT B;  2DCE A;  2EA2 A;  1XGN A;  4N9H A;  3CCJ I;  3ZRG A;  1B72 A;  2CU7 A;  3U1D A;  2QM3 A;  1E0E A;  1G59 A;  4WWC A;  1XCV A;  1YO5 C;  3BTC A;  1FIA A;  1GT0 C;  1VQ9 I;  1YE9 A;  3IRQ A;  2KZG A;  5F27 A;  1SVM A;  2ZJP F;  2HEO A;  2BVM A;  3G73 A;  3DKW A;  1QZZ A;  1ZK8 A;  3DKY A;  3DU6 A;  3Q9S A;  3R0A A;  4FT8 A;  4DNC A;  3DKX A;  1BL0 A;  2QSH X;  2FRH A;  2GLO A;  3BTI A;  4XRF A;  4A3I J;  1RZ4 A;  3SHF A;  5FLV A;  3F21 A;  3DPL C;  4GYG A;  4D0P A;  5L3E A;  4UNO A;  2E7W A;  3GF2 A;  3ONQ A;  4W97 A;  1MKM A;  1QGP A;  2DT5 A;  1IRF A;  3DWL E;  1ZGJ A;  1BA5 A;  2NVY J;  4M3G A;  3S3N A;  2HYF A;  2A5Y B;  2A6T A;  1G6N A;  3BCB A;  2ZKZ A;  3VYS B;  1FPQ A;  3KYL A;  2XF7 A;  4FCY A;  2K4J A;  4IHV A;  3O8G A;  2DW4 A;  2XB5 A;  4UV9 A;  1SAN A;  3CC2 I;  3HM5 A;  2LOO A;  2M34 A;  4MQ9 F;  2XAG A;  1W0T A;  4RB3 C;  3X2Q H;  1MBF A;  3JRI A;  2KKO A;  3F72 A;  1O3Q A;  2E1C A;  2DA7 A;  2E1M C;  4HDU A;  5DUI A;  4GXO A;  1MMD A;  3S3M A;  3OYG A;  2EV6 A;  4ZTF A;  4RM3 A;  2AO9 A;  3QPL A;  3VDX A;  1N75 A;  2ZXJ A;  3JRH A;  2CV1 A;  1WI9 A;  4RLF A;  4DBR A;  3JRB A;  4BE1 A;  3DU5 A;  2JSC A;  4E4H A;  1U78 A;  3PO2 J;  2DMP A;  2L9V A;  4XK4 A;  1AKH A;  3BR0 A;  2BXY A;  2NVQ J;  4O6J A;  2EQR A;  3MCZ A;  2QSF X;  1SFE A;  1MH3 A;  1SAU A;  1UG0 A;  1T98 A;  1PP7 U;  4A3L J;  3OOP A;  3PSI A;  4F93 B;  9ANT A;  2Q8K A;  4C2U A;  1MMS A;  3WTY C;  1S29 A;  1U2W A;  3WTZ A;  3WTS C;  1P4A A;  4AYB A;  2WC2 A;  1IGN A;  4JOM A;  2HXO A;  5FLX Z;  2DXI A;  1GV2 A;  3GTO J;  1HOM A;  2QLZ A;  2K85 A;  3K2A A;  3EUH A;  2GXA A;  3J80 Z;  1GUU A;  4M72 A;  4G6T B;  2LTP A;  3HUG A;  2EV5 A;  5KAI C;  3MQ0 A;  4CCM A;  1NK2 P;  3K10 A;  4L0Y B;  2IBD A;  1FLI A;  4C3I J;  5JFR A;  1H88 C;  3QYE A;  2HWV A;  1XSV A;  2FEZ A;  4IO9 F;  1HSJ A;  1ZTR A;  5M5W J;  1YJN I;  4I02 A;  1B9M A;  2DJN A;  1ETY A;  5IT9 K;  4A12 A;  1ZRC A;  4P9F A;  2XVC A;  4LG0 A;  1ERD A;  1IXC A;  1WJE A;  4F3Q A;  1H89 C;  1IDZ A;  2COM A;  4YEL A;  3BZC A;  1QBJ A;  2A61 A;  3D5S C;  2K3F A;  4XSZ F;  3MAJ A;  3IH4 A;  5E18 F;  2DBB A;  1OIS A;  2JWT A;  2IGO A;  2EA4 A;  2ZFW A;  4I98 B;  5GP9 A;  5LGN A;  3PSF A;  5C4X J;  1UJ8 A;  2DPU A;  1FBU A;  4OAY A;  3H35 A;  3PL8 A;  2DLL A;  4LFU A;  1FMV A;  3P5J A;  4HAM A;  1R58 A;  3PUF A;  1YLF A;  4CH7 A;  2BE5 F;  5CVI A;  4DW6 A;  3VYR B;  4A0Y A;  5HS7 A;  2OV7 A;  2O0Y A;  2F5V A;  3DP7 A;  1WJA A;  1TWA J;  2K3P A;  2ZSH B;  1MMN A;  3AG2 H;  2NAZ A;  3LFU A;  2ZSI B;  4E7I A;  2UUZ A;  3CCQ I;  3F8M A;  4PJL A;  1REP C;  1VF9 A;  1TT0 A;  1GXP A;  3REO A;  1WZ2 A;  2NS0 A;  4EGZ A;  4ZYG A;  3HBL A;  2Y9Z A;  1Q1V A;  1W0U A;  1R1T A;  3P9I A;  5FKL A;  5JLX A;  2V6E A;  2VT3 A;  4LD5 A;  2CW7 A;  2VBZ A;  2ZXH A;  3KEY A;  2R7R A;  4AVP A;  5JLW A;  1WI3 A;  1TWC J;  4BXX J;  4HLX A;  4FET A;  4HX4 A;  2KFD A;  4XLH A;  5J6X A;  3MKW B;  4WK8 F;  4E7H A;  4OIR F;  1ENH A;  4B4C A;  1S9H A;  2DK5 A;  4EMS A;  4HBL A;  3JR9 A;  1YW9 A;  4PK4 A;  4NC6 A;  1D1B A;  4R79 A;  1H0M A;  1OYI A;  3FMR A;  4P55 A;  2X6X A;  3K4B A;  4E7Z A;  5F0C A;  3DLA A;  1H8A C;  4ETS A;  4X1E A;  5CLS A;  1BI3 A;  3TKY A;  2E19 A;  2D5V A;  1FSH A;  2HR3 A;  2ZJ2 A;  5DCM B;  2UXN A;  3RKQ A;  4YFX F;  4ZZL A;  3L9F A;  5M3M J;  5J8F A;  3L2W A;  2GM4 A;  1ITY A;  5ERI A;  3V42 A;  2WWY A;  2ZJQ F;  3K0L A;  2P5V A;  3WGH A;  3VOE A;  4LG0 B;  2XGD A;  1XPX A;  1IF1 A;  2CYY A;  4V19 K;  2DDB A;  2XKO A;  1I3Q J;  1ODD A;  5L3B A;  2K9L A;  5LGT A;  4HST A;  5D4R A;  2RV8 A;  1JKR C;  1G3Y A;  1YW8 A;  4AID A;  2L9S A;  1ZRF A;  3K69 A;  2EZH A;  3Q0V A;  5A2Q Z;  3LL7 A;  2IA1 A;  4AIK A;  5DDG A;  1I6H J;  1POG A;  4QWQ A;  4UB6 C;  2PEX A;  1P4X A;  3NWT A;  4UB8 C;  2XAF A;  4L9V A;  3KYC B;  5D5W B;  4YFK F;  2VBY A;  3C3W A;  4XKW A;  1CF7 B;  4BS9 A;  4HEA 2;  2FOW A;  1XDS A;  3V4G A;  3B02 A;  4ZJZ A;  3U9G A;  3R0J A;  3I54 A;  3CDL A;  2MC3 A;  3HXL A;  2R7Q A;  2XB0 X;  2P7C B;  4IHT A;  5J40 A;  2BXZ A;  1YX5 A;  3SYT A;  3IL2 A;  2B0L A;  2HDW A;  1SVO A;  1OFC X;  2AXT C;  3DF8 A;  2QEX I;  1ZG1 A;  3E7L A;  5HLT A;  3FXK A;  2UZK A;  3G71 I;  4PJJ A;  2WY8 Q;  3SDG A;  3F8F A;  2W85 A;  1DGR M;  2XAJ A;  1U8B A;  2FXA A;  4J19 A;  1D3Y A;  4PDK A;  4HF1 A;  3ZMV A;  5H6Q A;  2K4B A;  2LD5 A;  3V8K A;  5FFX A;  3FHN A;  2ZJR F;  5LHG A;  2QSG X;  2BZT A;  1UCR A;  3LST A;  4A3F J;  2KRF A;  2VQH A;  1QU3 A;  3H5R A;  1Y56 A;  2R5Y B;  2BGC A;  4RA2 A;  4GO1 A;  4II2 A;  2Z99 A;  2OF7 A;  1ETX A;  3FBI B;  4BXU A;  2ME6 A;  1A31 A;  3M07 A;  2F5E A;  2CQN A;  2KIS A;  5DTD A;  1VQ7 I;  5E1Z B;  1MBJ A;  1KU9 A;  1TQI A;  2M0M A;  2HQA A;  5IY5 H;  1I27 A;  1RKW A;  3M1E A;  2L9R A;  1KQ0 A;  3T1B A;  5H2F C;  4EV0 A;  4BY1 J;  2QZ8 A;  3DPT A;  2D1H A;  4A0X A; 
#chains in the Genus database with same CATH homology
 3G1L A;  1AHD P;  5IP9 J;  3GTP J;  3WHC A;  5M5X J;  5C44 J;  1S7E A;  2R93 J;  2VPR A;  4JP0 A;  4D7N A;  5K7F A;  4MFD A;  3C2B A;  2GBY A;  2E2I J;  3M3Y J;  5FKK A;  5EG0 B;  3JRG A;  5J1U A;  3TW6 A;  1JTX A;  2EH3 A;  5C4J J;  3JRA A;  1ETV A;  2RAE A;  2O9L A;  2E1O A;  1D5Y A;  3GTQ J;  3S1R J;  1DU0 A;  3RQI A;  3H0G J;  4A3K J;  5EGO B;  3JRE A;  1JGG A;  4XRS G;  1JJ8 C;  5IOY A;  2HQ5 A;  2G0E A;  3HOU J;  2HDD A;  4IHW A;  5F08 A;  3HKZ N;  4FTH A;  1NK3 P;  1MBK A;  5EYR A;  4AYB N;  4D5F A;  1HLV A;  4D7M A;  1WCM J;  1T33 A;  1LE8 B;  3S16 J;  4XRM A;  5IPA A;  2DA1 A;  2L7F P;  4IHY A;  3IH3 A;  1NTC A;  2X9D A;  1VND A;  2QF7 A;  5E3O A;  1RES A;  2JA7 J;  2MW8 A;  3HOW J;  1B8I A;  1UHS A;  1MNM C;  4G12 A;  2DA5 A;  1X58 A;  1MSE C;  2K40 A;  2NVX J;  2XSD C;  2VI6 A;  4DYQ A;  2E2J J;  3HOZ J;  2VKE A;  3JRD A;  1ETQ A;  4AC0 A;  3JRC A;  3OOU A;  1JJ6 C;  3HGY A;  2XGE A;  1IRZ A;  4A3G J;  4LOC A;  2P81 A;  1TWG J;  3GTL J;  3FK6 A;  5K7Z A;  4EEF G;  2JA5 J;  1BW5 A;  2LR8 A;  1FIP A;  2L7Z A;  2MSY A;  2K9Q A;  2VKV A;  5EZG A;  2ELK A;  2L0K A;  3BQZ A;  1T56 A;  4MLO A;  2HXI A;  4AUX A;  4RBO A;  3IH2 A;  3IV5 A;  3DEW A;  2XRL A;  3DCF A;  3LNQ A;  2WAQ N;  4MIM A;  2CUE A;  1WH5 A;  1F36 A;  3WHB A;  3BQY A;  4JYK A;  4I6Z A;  2TRT A;  3B6A A;  1OCP A;  2ID3 A;  2YU9 J;  1HDP A;  1JTY A;  5FLM J;  2YS9 A;  1FJL A;  4BKX A;  1XG1 A;  2M2E A;  2TCT A;  1ZQ3 P;  2M8G X;  4HNV A;  5FJ8 J;  3GBG A;  1RKT A;  1BW6 A;  1LFU P;  1QRY A;  3NAR A;  4M6V A;  5IYC J;  3FIW A;  2R5Z A;  5F04 A;  3G1M A;  4S0H B;  2XPV A;  3OIO A;  1GV5 A;  1IV6 A;  3M4O J;  2Y2Z A;  1I50 J;  2FQ4 A;  3ZQC A;  3HOY J;  2ZB9 A;  4ABZ A;  2ME0 A;  3BR2 A;  3QPS A;  1Z0X A;  3QQA A;  3TED A;  2R92 J;  2O7O A;  1JKO C;  1FEX A;  1IDY A;  1B72 A;  2CU7 A;  4A93 J;  2M0C A;  3A01 A;  2XPU A;  1HF0 A;  3ZQG A;  2JMW A;  3S1M J;  3BTC A;  1FIA A;  1ZKG A;  1GT0 C;  3BTL A;  4FIS A;  3SJM A;  5F27 A;  3TP3 A;  1ZK8 A;  2EZL A;  1BJZ A;  3S2H J;  2JJ7 A;  1VFC A;  1PUF A;  1BL0 A;  4M3B A;  4V2G A;  2GLO A;  2Y30 A;  3BTI A;  1X2N A;  4A3I J;  5FLV A;  3S1N J;  1K61 A;  2LVS A;  5E3N A;  2ID6 A;  1UMQ A;  2DMQ A;  2K9S A;  3FIS A;  1K83 J;  1YRN B;  4W97 A;  1XC5 A;  1IG7 A;  1OCT C;  4DZJ A;  1BA5 A;  2NVY J;  4M3G A;  4BBS J;  1UG2 A;  1QVU A;  3JRF A;  4JX5 A;  4IHV A;  4FCY A;  3OSG A;  3L1P A;  5HOD A;  3O8G A;  2XB5 A;  1ETW A;  5FKN A;  3BR1 A;  1SAN A;  5IYD J;  2FD5 A;  3CCY A;  5F0F A;  3HM5 A;  2B63 J;  2M34 A;  5FKO A;  1VI0 A;  1W0T A;  5K7H A;  1MBF A;  3JRI A;  2I10 A;  4W1U A;  4UUS A;  2LK2 A;  2R5Y A;  2DA7 A;  1IJW C;  2MG4 A;  1EF4 A;  2K9N A;  3BR3 A;  3RZD J;  3S2D J;  1ZR4 A;  3S17 J;  2AO9 A;  3QPL A;  3ZQF A;  3JRH A;  1JT6 A;  2LY9 A;  3JRB A;  1ZGW A;  1TWH J;  2AHQ A;  2HOA A;  2NOG A;  1ZR2 A;  1U78 A;  3PO2 J;  1OJL A;  2DMP A;  4XK4 A;  1R9T J;  3BR0 A;  1WGX A;  4A69 C;  2R5Z B;  1AKH A;  2NVQ J;  1RR7 A;  2EQR A;  1MH3 A;  1RPW A;  1P7J A;  2EBI A;  4DYR A;  4A3L J;  2LLK A;  4CYC B;  9ANT A;  3GTM J;  2CQQ A;  4A3C J;  4A3B J;  2CJJ A;  4FE4 A;  2OPT A;  1IGN A;  2HXO A;  5EG0 A;  3UKG A;  1GV2 A;  3A01 B;  3GTO J;  1HOM A;  3K2A A;  2DN0 A;  4A3D J;  1GDT A;  1MSF C;  4JX4 A;  2NS8 A;  1MBG A;  1GUU A;  2LTP A;  2XPW A;  1NK2 P;  3O8H A;  3SFI A;  2IBD A;  4C3I J;  3TP0 A;  1H88 C;  1P7I A;  3LSG A;  3LOC A;  1ZTR A;  3ZQH A;  1IC8 A;  3TW7 A;  5M5W J;  2CUF A;  2EZK A;  2X48 A;  2XGC A;  2KDZ A;  2COB A;  3GTJ J;  3MN2 A;  2DJN A;  1ETY A;  2FX0 A;  1FTT A;  1LFB A;  1GVD A;  3HGG A;  2DMU A;  5EDN A;  3LSJ A;  1H89 C;  1IDZ A;  3BR6 A;  2CRG A;  2M9H A;  5J1R A;  3FKI J;  1A6I A;  3HDD A;  3IH4 A;  4BBR J;  3I4M J;  2JWT A;  4B1R A;  1XS9 A;  4M3D A;  1JKP C;  5GP9 A;  3S14 J;  4QSH A;  2DA4 A;  5C4X J;  2DMN A;  2JA6 J;  1G2H A;  4UUS B;  4A3J J;  1Y1W J;  2Y9Y A;  4DZP A;  2DA3 A;  1B8I B;  1JKQ C;  3LSP A;  3Q0U A;  4DW6 A;  2Y0S N;  2ECB A;  1JUM A;  1TWA J;  5DS9 A;  4JX6 A;  3BG3 A;  3FK7 A;  4XRS A;  2R7Z J;  3BT9 A;  5M5Y J;  1HCR A;  4Y52 J;  2LP0 A;  1VF9 A;  2X6O A;  3W6V A;  3NAU A;  3VPR A;  2IAI A;  3OSF A;  3HBL A;  4IEJ A;  2Y9Z A;  1Q1V A;  1W0U A;  5JLX A;  5FKL A;  5F0H A;  1ETO A;  2H1K A;  3D1N I;  2JK3 A;  5JLW A;  4BY7 J;  1WI3 A;  1TWC J;  1Z77 A;  3I4N J;  4BXX J;  2KT0 A;  3CQZ J;  2FJ1 A;  2WB1 N;  1JUS A;  1U9N A;  1AU7 A;  2HOT A;  4C2M J;  2DMT A;  4B4C A;  1ENH A;  5E3M A;  3JR9 A;  3HOV J;  5EZH A;  3F0C A;  3ZQI A;  3A02 A;  1X2M A;  3Q3S A;  4UUT A;  5F0C A;  1H8A C;  3ZQL A;  4X1E A;  4C3J J;  2E19 A;  2D5V A;  3RKQ A;  2DA2 A;  5M3M J;  1ETK A;  2Y31 A;  2GM4 A;  1ITY A;  3MKL A;  2XGD A;  5IYB J;  2NS7 A;  1CQT A;  2L7M P;  1I3Q J;  3A03 A;  3HOX J;  1IUF A;  2JN6 A;  5IP6 A;  2YUS A;  2HOS A;  1SFO J;  3BR5 A;  3Q0W A;  3G1O A;  1JKR C;  4QIW N;  2EZH A;  3Q0V A;  5C3E J;  2VUM J;  1FTZ A;  4M3F A;  2LKX A;  1POG A;  4B3A A;  1I6H J;  3S15 J;  1MBE A;  1B72 B;  3MVP A;  3CMY A;  1F43 A;  1ORK A;  3ZOB A;  3BG5 A;  1O4X A;  2DA6 A;  5F1J A;  4X6A J;  1DU6 A;  2ECC A;  2IEK A;  4I76 A;  1E3O C;  3GTK J;  4RDU A;  1YRN A;  2DTZ A;  3CDL A;  2MGQ A;  2WV1 A;  2XB0 X;  4FE7 A;  4DYC A;  5EGO A;  1PUF B;  3BG9 A;  4MFE A;  4M3E A;  4NDL A;  5M3F J;  1OFC X;  2HI3 A;  1QVT A;  3E7L A;  4A3E J;  1WH7 A;  5FKM A;  2W48 A;  3SDG A;  4XID A;  4QTR A;  3K7A J;  1MBH A;  1LE8 A;  5GPC A;  2H8R A;  1U8B A;  1APL C;  2LFB A;  1U9O A;  2NVT J;  1WPK A;  4J19 A;  3RZO J;  4XIC A;  1RET A;  3BTJ A;  3B6C A;  4IHX A;  5IOZ A;  2LD5 A;  1HDD C;  1MH4 A;  2N8G A;  4Y7N J;  3S1Q J;  1QPI A;  3HEF A;  5IP7 J;  3GTG J;  2EZI A;  4A3F J;  5BNG A;  4MO7 A;  5J3L A;  4L5E A;  3LSR A;  2R5Y B;  5EEA A;  5EF6 A;  3H3V K;  2CQX A;  5GPA A;  2QCO A;  2OF7 A;  2JA8 J;  1ETX A;  1Y1V J;  2ME6 A;  2R0Q C;  4A3M J;  2O8K A;  5DTD A;  1A5J A;  3PM1 A;  4C3H J;  1JUP A;  1MBJ A;  4CYC A;  4GFB A;  5E3L A;  3PO3 J;  2PMZ N;  4V2F A;  1TWF J;  1AKH B;  1RKW A;  1TC3 C;  2L9R A;  3HB9 A;  4D5C A;  5J1Y A;  2HYJ A;  2E2H J;  4BY1 J;  1JT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...