2DA5A

Solution structure of the second homeobox domain of zinc fingers and homeoboxes protein 3 (triple homeobox 1 protein)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GSSGSSGPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Zinc fingers and homeoboxes protein 3
publication title Solution structure of the second homeobox domain of Zinc fingers and homeoboxes protein 3 (Triple homeobox 1 protein)
rcsb
source organism Homo sapiens
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da5A00
3LSRA 1I6HJ 1TWAJ 5FLVA 3W6VA 1W0TA 2MW8A 1TC3C 3BTIA 2E2HJ 2L9RA 2CUFA 2DA6A 4FCYA 1U78A 1CQTA 4A93J 4M6VA 1VF9A 2AO9A 2HXOA 3HKZN 2HXIA 2K9QA 3ZQHA 2EZIA 2DA7A 2XGEA 1ETWA 1IGNA 2DA4A 4C2MJ 2XGDA 3H0GJ 3RZOJ 5GPCA 2ME0A 5IPAA 4QIWN 4XK4A 1QPIA 1MNMC 5EZHA 3HOZJ 4ABZA 2JK3A 1GV5A 5JLXA 1GVDA 1RKTA 4NDLA 3HDDA 2PMZN 5C4XJ 1OCPA 3ZQCA 2YS9A 2XSDC 4DZJA 2MSYA 2R7ZJ 1AHDP 1TWFJ 1MSFC 5E3NA 5F04A 2XGCA 3IH4A 2HOTA 3CQZJ 4BKXA 4C3HJ 1MBHA 2E1OA 2QCOA 2NS8A 4M3DA 2JA8J 4Y52J 3BTLA 2Y9YA 1B72A 4BXXJ 1G2HA 2XPVA 3BQYA 3JREA 3RZDJ 5F27A 1VFCA 4JX5A 4BBSJ 1MBGA 2R5ZA 4RDUA 3B6CA 5FKMA 4M3FA 1I3QJ 1QRYA 4DW6A 3I4MJ 1FTZA 5FKOA 2DMTA 1S7EA 5E3LA 4LOCA 2HI3A 1GUUA 1O4XA 1PUFB 1IV6A 3RQIA 4S0HB 2ECCA 2X6OA 3WHBA 3MN2A 1IDZA 2L7FP 1QVUA 1IC8A 4D5FA 3O8HA 2QF7A 4V2FA 1F43A 2Y2ZA 4C3JJ 2FQ4A 3TEDA 1WPKA 5DTDA 3JRFA 1HCRA 3JR9A 1NK2P 2FX0A 2L7ZA 1HDPA 3BG9A 2EQRA 5F0HA 1A6IA 3LSJA 2M34A 5M5YJ 3QPSA 1OFCX 1BJZA 1Z77A 3L1PA 1VNDA 2LK2A 3S17J 5GPAA 2NVYJ 2ID3A 1MH3A 3K7AJ 4G12A 4XRSG 2OF7A 1ITYA 2H8RA 1RPWA 1Y1WJ 3MVPA 3LSGA 1QVTA 3S1QJ 5J1RA 1K83J 2HOAA 5M3FJ 3D1NI 3ZQGA 3HGGA 2XB0X 5EF6A 1TWGJ 2D5VA 5IYBJ 3S16J 3HOXJ 1MH4A 1MBEA 4M3BA 3JRAA 4L5EA 1H89C 3BR0A 1ZQ3P 3MKLA 1ETYA 2IBDA 3ZQIA 1RESA 2M9HA 3LSPA 1SFOJ 2IAIA 2VPRA 3B6AA 3IH2A 5K7FA 1R9TJ 2KT0A 1BL0A 2DA5A 2Y0SN 5J3LA 4MFEA 4IHYA 1U8BA 1IRZA 3A03A 3HBLA 2OPTA 3S1NJ 1ETXA 3GTMJ 2CRGA 2JA5J 3ZQFA 5C3EJ 2NVQJ 3TW7A 3JRDA 3BR1A 1RETA 3RKQA 1FIPA 2ECBA 5JLWA 1F36A 3BQZA 1U9NA 1SANA 3TW6A 4XRMA 2RAEA 5EYRA 4FISA 3G1OA 1YRNB 3S1MJ 3JRHA 2ME6A 1MBKA 2LP0A 1JTYA 2N8GA 1X2NA 3O8GA 4HNVA 1ENHA 1LFUP 3M4OJ 3CDLA 2R0QC 4W1UA 5F0CA 3TP0A 2DMQA 3JRCA 2EZKA 2LY9A 2DA2A 4X6AJ 1HDDC 4A69C 2JJ7A 2W48A 1JKRC 3IV5A 5IP7J 4XICA 3OSGA 3S2HJ 3Q0WA 4AUXA 4EEFG 3WHCA 1HLVA 3SDGA 1EF4A 1ZR4A 1H88C 3BR6A 1UMQA 5IP6A 1FTTA 2E2IJ 3G1LA 1T56A 2E2JJ 4QSHA 1IUFA 1JUSA 1JGGA 1HOMA 5EGOB 2NS7A 1VI0A 1RR7A 2YUSA 3CMYA 4IEJA 2NVTJ 2ZB9A 1X2MA 3GTQJ 5E3OA 1A5JA 2HQ5A 2JA7J 3E7LA 1ZTRA 2JMWA 3SFIA 4Y7NJ 5EGOA 2LR8A 3FIWA 5EG0B 3FISA 5F1JA 4FE4A 5EZGA 3BG5A 3H3VK 1JT6A 3K2AA 1WI3A 4A3DJ 3Q0VA 2X9DA 1XC5A 2LVSA 1HF0A 2CUEA 4A3EJ 1POGA 5FKNA 1U9OA 2LD5A 3PO3J 5EG0A 1PUFA 3Q3SA 2R5YB 3DCFA 5FKKA 1JUPA 3A02A 2L0KA 1XS9A 3LOCA 2WB1N 1K61A 3I4NJ 3HGYA 2LLKA 2TCTA 1D5YA 1TWHJ 1FEXA 1NK3P 3FK7A 3HOUJ 1JT0A 3DEWA 1H8AC 5FKLA 3ZOBA 5FLMJ 4UUSB 4A3LJ 1UG2A 1MBJA 2ID6A 1IDYA 1BA5A 1WGXA 1B8IB 4FTHA 2COBA 4A3JJ 3S1RJ 1UHSA 3HB9A 1JJ6C 5IYDJ 4XIDA 4I6ZA 3S15J 1JKOC 4UUSA 4M3GA 4A3CJ 1BW6A 2XPUA 2CQQA 2FJ1A 3NARA 5BNGA 4J19A 4BY7J 1E3OC 4BBRJ 1AKHB 3GTOJ 2K40A 2VI6A 3HEFA 3BR3A 3PM1A 5EEAA 3ZQLA 4JP0A 1P7IA 2M8GX 1JJ8C 2DJNA 3GTPJ 2H1KA 1OCTC 3A01B 2DA1A 5FJ8J 2HYJA 4UUTA 2LFBA 3QPLA 2KDZA 3LNQA 2GM4A 1ZK8A 3JRBA 4I76A 5E3MA 1TWCJ 4MFDA 4B4CA 2Y30A 2HDDA 5GP9A 1LFBA 1W0UA 2WV1A 4A3KJ 1ORKA 4X1EA 4D7NA 1XG1A 4A3IJ 4A3GJ 1ETVA 1MBFA 1RKWA 1WCMJ 4V2GA 1WH7A 2JWTA 3JRIA 2LKXA 2JA6J 4DYQA 2XB5A 1IG7A 1Z0XA 1YRNA 1AU7A 3GTGJ 2FD5A 4DYRA 4XRSA 5K7ZA 2B63J 3HM5A 3HOYJ 4MLOA 4AYBN 4MIMA 5DS9A 1JKPC 4JX6A 1DU6A 5EDNA 3BR2A 3TP3A 4IHWA 3S14J 4W97A 2TRTA 3BTCA 1JTXA 1X58A 2GBYA 1APLC 1Q1VA 4B3AA 5IOYA 5HODA 1B72B 1DU0A 3GBGA 3HOVJ 2DN0A 4M3EA 2MG4A 2L7MP 2R5ZB 3F0CA 2EZLA 2VUMJ 2G0EA 1LE8B 4B1RA 2O7OA 9ANTA 2DTZA 3FK6A 1GV2A 4JYKA 2K9SA 4QTRA 5J1YA 3NAUA 2Y31A 2EBIA 5F0FA 4BY1J 3G1MA 1FIAA 1LE8A 2XRLA 3QQAA 4CYCB 1P7JA 1I50J 2WAQN 3Q0UA 5M5XJ 1ETQA 2E19A 1JUMA 3CCYA 1Y1VJ 3SJMA 2NOGA 2O9LA 4C3IJ 2CQXA 3IH3A 4A3MJ 3BG3A 2DMUA 5M5WJ 2R5YA 4CYCA 2DMPA 5IOZA 2AHQA 2IEKA 1OJLA 2VKVA 4D7MA 1ZGWA 1GT0C 4DYCA 2P81A 1MSEC 2GLOA 5C44J 4FE7A 4A3FJ 1NTCA 3C2BA 1FJLA 3VPRA 4AC0A 5IP9J 5M3MJ 2O8KA 3BT9A 3UKGA 3GTLJ 2YU9J 2EZHA 3GTKJ 1GDTA 3JRGA 1BW5A 2LTPA 4MO7A 2K9NA 2MGQA 2R92J 5F08A 2X48A 2R93J 2DA3A 2EH3A 3BTJA 1B8IA 2Y9ZA 2CJJA 3BR5A 3PO2J 2CU7A 1JKQC 4GFBA 2ELKA 1WH5A 1ETKA 3OOUA 2HOSA 5C4JJ 4IHXA 3GTJJ 2I10A 1ZKGA 2JN6A 1IJWC 4D5CA 1AKHA 2M2EA 3S2DJ 3M3YJ 1T33A 5IYCJ 5J1UA 4JX4A 2NVXJ 4DZPA 4A3BJ 2VKEA 3FKIJ 3HOWJ 5K7HA 3A01A 1ETOA 2M0CA 2XPWA 2DMNA 4RBOA 3OSFA 1ZR2A 4IHVA 3OIOA
chains in the Genus database with same CATH superfamily
3OS1A 2E1CA 3EYYA 2XASA 3ZXSA 3DTIA 3U1KA 5FLVA 3J7ZI 1TC3C 2DFEA 1X1AA 3BTIA 3WGHA 1ZN2A 1XB4A 2KL4A 2GIVA 4XLCA 3SZGA 2EZIA 2DA7A 1IGNA 2DA4A 2QKLB 4M6XA 2XGDA 3H0GJ 5IPAA 1YHQI 4IL6C 1KA8A 5L3FA 5EZHA 4IHTA 3HOZJ 4A0ZA 4ABZA 2JK3A 4L18B 5JLXA 5L3GA 2VB6A 1RKTA 3KP5A 3PUBA 2MLKA 4A2UA 4ENJA 4CO8A 1RRJA 5C4XJ 2A6HF 2DBBA 3F8FA 1R5ID 2R7ZJ 3BPXA 4U7DA 2PBIA 3S3OA 1TWFJ 1XMAA 3MCZA 3FHZA 2E5ZA 1MSFC 3CLQA 1GXQA 2BZTA 4MEYF 4P1WA 1O3QA 3A0HC 1IF1A 1FOXA 1O3SA 3HYIA 1HKSA 4OMZA 1W4MA 2MC3A 3GO5A 2CWEA 1U6GA 1NG6A 2Z3YA 4BXXJ 2DT5A 3JREA 5F27A 2XRNA 2Q8KA 1P4WA 3DV8A 2HZDA 3GEZA 1I1GA 1R00A 1O3TA 3E5UA 4RDUA 2JUGA 5HS7A 4M3FA 2ZFUA 2KJBA 4DW6A 1U8RA 2XF6A 2BHZA 2W85A 3ZMTA 5KAIC 4ZYGA 4O3MA 1F9NA 4HPQA 3K4CA 1O4XA 1XMKA 4CA0A 2HKXA 2E1NA 4UV9A 2WWYA 2XSJC 1QVUA 3ABMH 2ISZA 1I6XA 2KRFA 2Z1DA 3BZCA 2X6WA 3M9AA 3JAMK 3VSKA 2QF7A 2X6XA 2R7TA 3N97A 2HFHA 4LIVA 3WTUC 3AL0C 3ASNH 2WADA 2VBXA 4BS9A 1XGNA 1XN7A 2KMUA 2Y48A 2VL8A 3JRFA 3WTVC 2FX0A 5F0HA 2VIXA 3KX2A 3FXKA 3LSJA 1HBXG 5J4YA 5BOXA 4HF1A 1B59A 2IPQX 3RSNA 4HX4A 3TO7A 3SEQA 1Z3YA 3F21A 4A6DA 4KIGA 3KP2A 3DTEA 2ID3A 2LY2A 3F72A 3KP3A 4M71A 4HLXA 4XRSG 3OS2A 2TDXA 3OV8A 3BCBA 4E7JA 4OIPF 6PAXA 3LSGA 3N05A 2P0WA 5JVGF 3K10A 1IN7A 2HOAA 5M3FJ 4BHPA 2XB0X 1OQYA 1TWGJ 2CYYA 3F3XA 3HOXJ 1MH4A 1MBEA 2P7VB 2XKOA 2PJPA 4R8HA 3NWSA 1ZQ3P 5FLXK 1FP2A 1JI8A 2RV8A 2IGOA 1RESA 2M9HA 3HPGA 2H8WA 2O6GE 3B73A 2VPRA 4YG2F 2VE9A 2KIUA 2NXNB 2WY8Q 5D8LB 4OINF 5J3LA 1LB2A 3A03A 3WTSC 4C2UA 1IN8A 4HBLA 3DF8A 2A5WA 3ZQFA 1MD0A 2YX7A 4AM3A 3BG6A 3OYHA 3JRDA 4XL9A 2DJIA 3MQ0A 3F6OA 5JLWA 3T5XA 4DGWB 2YX4A 4KYWA 2DPDA 5H6QA 4BL0B 2QM3A 4XRMA 2RAEA 4KMUX 5TJJA 3S1MJ 1ZH5A 4I02A 3ZGKA 5B1BH 1MBKA 2GOXB 2HWVA 3H9JA 1JTYA 2O5RA 2R4GA 3KZIC 5B1AH 2R0QC 4W1UA 3TP0A 4AVPA 3JRCA 4BACA 4CHUA 2IGNA 2DA2A 4HAMA 4M6YA 2DFIA 1W36C 1HDDC 1EH6A 1ZYRF 4BEHA 1NHAA 3R4KA 5FLXZ 3S2HJ 3Q0WA 1R23A 3CO6C 1BOBA 1IRXA 2L2OA 4Q47A 2CUZA 1BR4A 1LDDA 3G1LA 2E2JJ 1IRGA 1HOMA 4KDPA 1XGSA 1Y56A 2CMPA 2NAZA 3IKVA 4RA2A 1YW9A 4EGYA 2ELHA 2LH9A 3AKZA 3LSMA 2PJRA 1VI0A 3JSOA 2YUSA 4IXAA 2HS5A 2ZB9A 1X2MA 3GTQJ 1A5JA 3GFIA 3SFIA 5KAFC 4A12A 3CUOA 2WAFA 3HPHA 3L7WA 5J4VA 3FIWA 3FISA 1SMTA 3JCUC 3LA7A 3GFMA 2KIQA 3K4NA 3BG5A 5DD8A 3MFKA 2DXIA 3KZZA 3GZ5A 1XC5A 4PCQA 3DPLC 5LFAA 1O7FA 2CUEA 2XAQA 3DU6A 3MMYB 3CTAA 3J80K 4RAZA 4RGSA 4CCMA 3DCFA 3A02A 4WK8F 2OZUA 2L0KA 2IS4A 2QA4I 3KIOA 1WJFA 2QGUA 2V79A 1SAUA 1VQ9I 2XAJA 4KICA 1TWHJ 1FEXA 4E6KG 3R0JA 3RPUD 2PQ8A 3LSIA 4B44A 3HG9A 3J7AY 5FLMJ 2UWMA 2WAQA 2LF8A 3G71I 1IDYA 5LGTA 1WGXA 1B8IB 4CGZA 3FHNA 2COBA 4LLNA 5DDGA 3S1RJ 1UHSA 1B4AA 5FFZA 1W7PD 2FOWA 3HB9A 5IYDJ 1SC7A 2FF4A 5H20A 4HQEA 2OCCH 4M3GA 4A3CJ 2XPUA 4HX8A 4J19A 3OYNA 2CW7A 4ETSA 2UXNA 4DJAA 3U1DA 1OYIA 3J80Z 4PGGA 4NB5A 3E6CC 1AOYA 1N75A 3BR3A 2RC4A 3TOBA 3ZQLA 1P7IA 4AIJA 4NC8A 3E3VA 2VODA 1OCTC 4MQ9F 2PG4A 2YU3A 3A01B 5D5VB 5JI6A 3RKYA 5ED4A 3QODA 1VQPI 2LFBA 3TKYA 2FXAA 2CW8A 2GM4A 1ZK8A 3ZN1A 3IRQA 1D0XA 4B4CA 3JTHA 4MQVA 2CV2A 1LFBA 3HOTA 5LEKA 2DQRA 3OYMA 2DI3A 4WXDA 1ORKA 4X1EA 2NRAC 5ILUA 1ETVA 1MBFA 2D2WA 4V2GA 1WH7A 3GFJA 1R1VA 3ZRGA 2XAUA 2LKXA 2JA6J 2QVOA 5D6EA 1KQ0A 1YRNA 1OR7A 5GAHJ 3HM5A 5GTHC 4XSXF 3HOYJ 3PFYA 5DS9A 2L01A 1T39A 2GIZA 1RIOH 3BR2A 1UHWA 3M8JA 3HUGB 3TP3A 4RB2C 3S14J 1X1DA 1MDMA 2M0MA 3M8FA 3GUDA 5E20A 2I5UA 2W1OA 4W97A 2BY1A 1G3YA 2G9WA 2TRTA 4ZDOA 2VQGA 2GBYA 2L7KA 2CV0A 4L0YB 3O3KA 1Q1VA 2V26A 5EJCA 2EK5A 1FMWA 2K4JA 5HODA 3CJRB 3BDDA 1A35A 3HOVJ 2MG4A 3M1CA 5FO5A 1Z05A 2P6SA 2RKHA 1J59A 3F0CA 2Q2EA 3TO6A 3TDUC 2L5QA 3PQKA 2G0EA 3VB2A 1I5ZA 2BXZA 2X1DA 4IF4A 9ANTA 2UUZA 4AIKA 2QENA 1GV2A 4JYKA 2G7UA 2Z16A 5GTIC 2K9SA 4G6QA 1YO5C 4OMYA 3PFIA 1IXCA 5J1YA 1KQ9A 1KQ8A 2W84A 3NAUA 2LC2A 1AWCA 1ZGJA 2OTLI 1LE8A 4O5VA 2OAZA 1S7OA 4CYCB 1P7JA 2DODA 1I50J 1IN5A 3Q0UA 5M5XJ 1MMAA 1K78A 2ZKZA 3TL4X 4E7SA 3QPHA 1L3LA 2O9LA 4XOTA 1FP1D 4PJLA 1DPUA 3H92A 5M5WJ 4KITB 2IXSA 1HKQA 1G3TA 5KK1A 1BC7C 4FT8A 1OJLA 2M3AA 3GCMA 5IT9K 1GT0C 2ISYA 3DKXA 2ZO4A 3H9QA 1YS6A 3R0AA 4E7HA 2HVSA 4KMFA 3H36A 4A5NA 3C2BA 2DFFA 3VPRA 3OR2C 3SFZA 5IP9J 3BT9A 2X4HA 1W36D 2QKMB 2OUMA 4M73A 3V42A 2LTPA 4MO7A 4EM2A 2X48A 2R93J 3GX4X 5IY5H 3LA2A 4Z6YA 4CCOA 1FMVA 1FBUA 1LQ1A 2ELKA 4KUMA 1U5TC 2E34A 1PDNC 4N4NB 1ETKA 3OOUA 2O8XA 4BQOA 1ZKGA 1IJWC 4D5CA 1AKHA 4G6DA 2K27A 3BLYA 2FE3A 2VQHA 3M3YJ 4NNJA 2A3SA 5ICEA 4WX9A 2UXXA 1R1TA 5IYCJ 2E71A 5J1UA 1YW8A 2FUG2 4JX4A 2QEXI 2NVXJ 3E5QA 1ETOA 2M0CA 4RAGA 4C30A 3IWFA 5IT9Z 4A93J 2R7QA 1I6HJ 3A2KA 4HG2A 2FSWA 4AIDA 3W6VA 2HU9A 2FMYA 1H0MA 2CFXA 4ZC3A 3DEEA 2BYVE 2V9PA 2CUFA 2DA6A 1U78A 2HXOA 2A07F 2HXIA 5JVTA 3FXQA 3KEYA 1Y0NA 3ZMSA 3RYPA 5LHGA 3KYCB 3QYBA 2VASA 1SFKA 2QSGX 3ABUA 4EM1A 3GZ6A 1LVKA 1TNSA 2Y0SA 3ISPA 4YIIA 1QPIA 4LIUA 2EINH 1S72I 1LJ9A 1LEAA 2HTJA 5LRRA 2KDOA 3GW2A 3ZN0A 1GV5A 2DK5A 3ZMUA 3EQLF 4HV6A 1XGMA 1LPQA 2QQBA 1XSVA 1OCPA 2R3SA 2YS9A 3FXMA 3MZ8A 2XSDC 2ZSIB 2PFBA 1IW7F 1X3UA 1X1BA 1QU3A 3W3CA 3EUKL 5E3NA 2XGCA 3ZPLA 3W2AA 2HOTA 2HOEA 4Y33A 4C3HJ 1QA6A 5ERIA 3H5AA 1PYVA 3WU0A 5HLHA 4M3DA 4RS8A 3DPTA 4Y52J 3BTLA 2Y9YA 3WE3A 3GMEA 1B72A 1P4AA 1G2HA 3OS0A 4IO9F 5F64A 3CCEI 1SFUA 4Y17A 2R5ZA 1HC8A 2WTEA 4ENKA 3L2QA 3C7JA 4XLAA 1QRYA 5HLGA 5DCMB 5FKOA 1SEUA 4KT6A 4B09A 1R22A 4S0HB 2ECCA 2CV1A 1OMIA 1YYVA 3MN2A 5CYVA 1IDZA 2L7FP 4FASD 2KZVA 1IC8A 2H6CA 4BJ5C 4D5FA 3O8HA 1PJRA 5DM7F 1Y39A 2Y2ZA 4C3JJ 3Q9SA 1YE9A 3TEDA 3D0SA 3KP4A 2CS3A 5H2FC 2EIKH 1HCRA 4J01A 1RUNA 1NK2P 1T08B 3BG9A 2E7XA 2EQRA 3K1NA 2CGPA 3JSPA 2BY0A 3LSHA 2XAHA 1ZRCA 4KN7X 1WRJA 1V3FA 1R6RA 2M30A 1E3PA 2NVYJ 3BJAA 3I59A 4G7HF 2OV7A 4YFKF 1MH3A 3K7AJ 3OOPA 4RAFA 1OCRH 1E2XA 3L00A 3T0YA 2H8RA 5A2QZ 1BJAA 1RPWA 4E7KA 3VWBA 2OC6A 1WWXA 2B0LA 5CPRB 2EIMH 4PFOA 1IXRC 4XN3A 1K83J 2W24A 3C2HA 4IJAA 1DP7P 4BH9A 4F3QA 1YX3A 4U87A 3OYFA 3D1NI 3ML6A 1WJBA 4E7LA 5ILSA 5HDKA 2XROA 4LFUA 3CCRI 2KKOA 1YFHA 4CH7A 1I1SA 4M3BA 2GWRA 2L3DA 3JRAA 3QU3A 4L5EA 3BR0A 2M1BA 5J47A 1K4TA 1S5LC 3MKLA 2RDPA 2IBDA 1RUOA 2IRFG 2P7CB 3ERMA 2XC7A 3CCQI 3C1DA 2IAIA 2O3FA 3IH2A 3MEXA 3J81K 1R9TJ 2KT0A 4DBRA 1BL0A 2DA5A 4L5IA 4P55A 5E1WA 1Y8RB 3OYLA 3OYJA 1J5YA 4MFEA 1IRZA 4G8XA 2VXDA 3HBLA 2OPTA 1MGTA 3CCLI 3NQOA 2CRGA 4RB3C 1QO0D 3DFGA 5C3EJ 2NVQJ 2XF5A 3BR1A 3I5UA 2IGMA 4V19K 3BP8A 1S9HA 3RKQA 1FIPA 1XMXA 2CG4A 2ECBA 2Z99A 3D5RC 3TDZC 4M9SA 5L3BA 4HF0A 1K6YA 5EYRA 4FISA 3G1OA 3P5JA 2ME6A 1UG0A 4DQ2A 2HVQA 3CUQB 3CDHA 1R7JA 3M07A 1ENHA 3M4OJ 4PUSA 5LHIA 2V1DA 3CDLA 2DMQA 3AG1H 2A5YB 2MD5A 2LY9A 1P92A 3P9IA 2JJ7A 5IP7J 2CW0F 4N4OB 3TQNA 4ZYEA 4NQWA 4YFXF 2QSHX 1V54H 2HKOA 3BCAA 1GLNA 4XKVA 1H88C 3J81Z 4RM2A 4L9NA 2HZTA 4QSHA 1Z67A 1IN4A 1JGGA 1TBXA 3SZTA 3Q5FA 3BC8A 2L4AA 4A5MA 3CMYA 3CJTB 2KRHA 1TQIA 4RGRA 3OYCA 3H35A 1W7PB 3IL2A 1Z7UA 2JA7J 4EJUA 2IA1A 3E7LA 2JMWA 3FF5A 3T8RA 1H9GA 4ZYHA 5EG0B 3BJOA 1SMYF 5EZGA 3CC7I 1FX7A 3K4LA 4L5JA 1JT6A 3K2AA 4KIFA 1P9QC 4A3DJ 3WTWC 4N9IA 4XMYA 1YG2A 2LVSA 2AS5F 3EUAA 2GXBA 1JHHA 5ICGA 1U9OA 2VC0A 3S3NA 3HOSA 2H6BA 3W6KB 1PUFA 4BDYA 2R5YB 4ENMA 3WU1B 5FKKA 3Q9VA 1YJNI 3CDIA 3EUHA 1DUXC 3S8PA 4D1QA 3W2VA 3NRVA 1XS9A 3TO9A 3W2WA 3I4NJ 3HHGA 3HGYA 5BPIA 2TCTA 2V7FA 4GYGA 2CQ7A 3WODF 1NK3P 3FXUA 4BAYA 2ETHA 4UB8C 4NUBA 2BVMA 2XV4S 2ZMEC 3DEWA 4F52A 4UUSB 3J7YJ 2DOFA 4A3LJ 2DOEA 3VYUB 2ID6A 5KCMA 4A3JJ 2FOKA 3QP6A 3AL0B 2NS0A 2HNHA 1YI2I 3JW4A 2MLGA 2MC4A 2LY1A 2OCEA 2VJIA 4L9TA 2MD0A 4QLCU 3R6SA 2MABA 3NARA 5FGMA 4BY7J 4F55A 1T6SA 3JAMZ 5DYMA 3PIOF 3GLXA 1BI1A 5B5EC 4JP0A 2M8GX 2ACJA 3K69A 2VOPA 2CQNA 1KU7A 2J5OA 3V4GA 2ZJQF 4XKCA 4ENNA 1FSHA 2QLZA 5J8CA 2DW4A 2HYJA 2DOAA 2VONA 1ZELA 2KHMA 3P9KA 3M8EA 4FHTA 3RKXA 3I56I 4I76A 1B6AA 4S05A 4IHSA 3FMQA 1WJAA 5E3MA 3P9CA 1VQ8I 1TWCJ 1S8NA 2Y30A 3N4MA 4OU0A 1J0RA 3GZNB 2WV1A 1E3HA 1Z21A 4M72A 1Q1HA 5ICCA 2BW3A 1TQPA 1YS7A 4BQQA 3PNYA 3GLLA 4D7NA 2OBPA 3DBHB 1Z3XA 4EM0B 5CJ9A 1R36A 4B47A 3ABLH 3DQVC 3FKJA 2R7OA 4DYQA 2VJ4A 3H9GA 4XR6A 1ZLKA 1IG7A 1Z0XA 2ZBKA 1T38A 3GTGJ 4DYRA 1BOAA 5HNFA 3DTKA 2QUFA 2R7RA 5K7ZA 1TTYA 3S93A 3IAM2 4AYBN 3L2RA 5IT3A 3VODA 3DPUA 4BHCA 3ZQQA 1P4XA 1QZYA 4L9VA 1YJWI 2YPRA 4LB5A 4KN4X 1YJ9I 4XNFA 4KT5C 4GDFA 1JTXA 1DGRM 5LHHA 3T8TA 2XHKA 3MWMA 1O57A 4S04A 4RGXA 1Z7LA 2GQQA 5D5WB 2EFQA 2EZLA 5L3EA 2HTSA 1U3EM 1VQ5I 1J75A 2O7OA 5LGUA 3FK6A 5K5QA 2LYCA 3L2CA 2EPFA 2K02A 1CGPA 2IS1A 3DBRB 4RB1A 2EBIA 5F0FA 3QRFF 1FIAA 2VKDA 5J6XA 3I58A 2V9KA 4BXUA 4LG3A 2LDUA 2WAQN 4ZZDA 1CF7B 2IA2A 2L9NA 1J7KA 5LBQA 4FETA 3H5NA 3E6DA 5D5UB 3CCYA 1Y1VJ 3HIFA 1KONA 4C3IJ 2FQ3A 5KVRA 3TGNA 4A3MJ 4U0YA 4U0VA 2E60A 1LKXA 2P4WA 1D5VA 1LVAA 1TT0A 3I9V2 3L2WA 4CYCA 2DMPA 3ELKA 1TW2A 5IOZA 2QSFX 1RR8C 1BBYA 2ZNZA 2X1EA 4D7MA 3I64A 4DYCA 5LGNA 5E8IA 1YIOA 2P81A 3HZJA 5BPDA 2LRDA 5CVVA 1F5TA 1MSEC 1N25A 4XOPA 2HEOA 1I39A 1USSA 4A3FJ 1VZ0A 2KIMA 1NTCA 1FWZA 1R1UA 1WJCA 4BE0A 1XTAA 1MJBA 3LAPA 2YU9J 3E1SA 2DT6A 2EZHA 2K3FA 4XONA 4DNCA 1A31A 2DQLA 1R4MB 3QU6A 2K9NA 2MGQA 2XAGA 1JHFA 5HLIA 3V7CA 1ACIA 4HSRA 2CJJA 2CU7A 2BHYA 1IXSB 2EA4A 1JKQC 1DGWY 1JXSA 2COMA 1V5GA 2V4JC 4CCKA 1SAXA 2V1XA 2YR2A 2CH0A 1E17A 3PJRA 5F6FA 4ASNA 4IX7A 4HYEA 2LSOA 4MNUA 2HOSA 3ECOA 3HSRA 2FRHA 2I10A 2JN6A 1OCOH 1ZAOA 4OAZA 5HLTA 3AFHA 3AAFA 1J09A 4LG0A 1T33A 2JQ7A 2W4SA 2DT7B 3K70D 4HNTA 4DZPA 2DTRA 3FKIJ 1FYKA 3UNGC 2B7EA 4PFPA 5K7HA 3SEZA 4IHVA 4FX4A 3CO7C 4U0WA 3LSRA 2FU4A 2IJLA 2MW8A 1FOKA 3KCCA 5DD4A 4CZCA 2R7SA 1VQ4I 5FB2A 1VQNI 2L9RA 2P5KA 4FCYA 4M6VA 1FSEA 1VF9A 2AO9A 3I53A 3HKZN 3ZQHA 1U2WA 2IT0A 4BNCA 2XGEA 3J7AO 1ETWA 4QPQA 2XDVA 4ITVA 1W5CC 3FXLA 2ME0A 2BEOA 2MFZA 1BM9A 4XK4A 4BEHB 1MNMC 4CDGA 2KJCA 3EETA 4PJNA 1BIAA 4EATA 3I0TA 3CCJI 2M7BA 4R79A 3M7GA 2ESNA 2A6EF 2AQEA 1SFEA 2PMZN 1TT5B 1SVLA 4DZJA 2MSYA 3OY9A 1AHDP 4HV5A 2PJRB 4PZJA 2Q0OA 3RYRA 1V4RA 1BR2A 1LEBA 3CQZJ 3QP5A 4BKXA 1MBHA 4LJZF 2E35A 2Y0MA 1D8KA 2E1OA 5E1XA 2QCOA 4B3XA 3FZVA 4ZJZA 3OIOA 2VBYA 4WCGA 3IAS2 2NS8A 2WA0A 4PJ0C 3ERED 5HS9A 3JTGA 1YX5A 3RZDJ 3OMYA 3RPQA 3EPZA 1MJ9A 4JX5A 4BBSJ 1MBGA 1XGOA 2CO5A 4E7ZA 4B48A 1P6RA 4JQFA 2DLLA 3I4MJ 2MA3A 4BDZA 1X3WB 1S7EA 4LOCA 2HI3A 2QBYA 1IV6A 3RQIA 2EFNA 1G8XA 2EWNA 2X6OA 3WHBA 4A0XA 1BW5A 3F8NA 3PUFA 3E0JB 3LQQA 4M74A 3LFKA 3S2WA 4V2FA 3CJQB 2W7NA 3H3ZA 4NBQA 1MW7A 1WPKA 3CESA 4JK1X 4HDUA 3ZCOA 2L7ZA 1HDPA 2W82A 2WC2A 5FRMA 2R7VA 1A6IA 1OCZH 2M34A 5M5YJ 3RIRA 5E17F 1OFCX 4JOMA 1BJZA 2JTVA 2L02A 2NYXA 1IAWA 4N0BA 2HYFA 4BQNA 4BU2A 3L1PA 1VNDA 3S17J 3M1EA 3V7RA 1MJAA 3BPVA 4XLFA 4XQFA 5FRNA 3FMRA 1ON1A 2ZJPF 3A1YA 2QQ8A 3MZHA 1X19A 2JPBA 4G12A 3VYSB 4DBQA 2OF7A 3LA3A 2LBFA 1EV7A 3PQJA 3KE2A 3FXJA 3SQNA 3OWTA 4EVIA 2I8DA 3HRSA 5J8FA 1BN5A 2E7WA 2H09A 3HGGA 2LNBA 2QWWA 5J40A 2D5VA 3S16J 3CZ6A 2X0LA 3WTYC 1KU9A 4XN0A 1OR7C 2OD5A 3QYFA 3BWGA 1YQAA 1UAAA 1HSTA 2ESHA 1HW5A 2HQNA 1ETYA 2EV6A 3KEOA 3QOEA 4LK0F 3ZQIA 5D4SA 3LSPA 2D1VA 3ZR8X 5EEGA 1E0EA 2LREA 4PJJA 1IO2A 3TOAA 2Y0SN 1P2FA 2HYGD 1OKRA 1ZG3A 1U8BA 1A6QA 3EYIA 1U5TB 2OQGA 4IRGA 4HSTA 4YEJA 3SZPA 3GTMJ 1T8IA 4BHBA 1VQ6I 3PNTA 4MHGA 2JPCA 4BYYA 4C9YA 1T0FA 2P5VA 3FDYA 1F36A 2OA4A 5FD6A 1SANA 2BXYA 1REPC 3K1MA 1YRNB 3L2VA 2N8GA 3ECHA 4Y4RA 3F23A 3O8GA 2F5DA 1TNTA 3CCVI 1LFUP 1LUJB 2EV5A 1WI9A 2K86A 4AD9A 2EZKA 1FZPB 4X6AJ 3QPTA 2VOOA 2KLOA 5CKTA 1JKRC 4XRFA 3QWLA 4G94A 2HVRA 3OSGA 3WHCA 4BQAA 3GYHX 1F4KA 3CMAI 4HDVA 1MMDA 1SD4A 2H1LA 2F4OB 3K9TA 5AIQA 1ZR4A 1S7AA 1UMQA 1FTTA 2E2IJ 4CCNA 3VOEA 2XAFA 2VJJA 1IUFA 1HW1A 1ZLJA 2ZXWH 3BG7A 4UVCA 5LRSA 2Q2EB 5EGOB 1UELB 3CC2I 1WVRA 2NS7A 2M7AA 2XUBA 2ZSHB 1MNEA 1J2XA 2Z2SB 1STZA 1OYWA 1O3RA 3GXOA 2NVTJ 2BY3A 2WV0A 2E1MC 4IZZA 2MH2A 3BROA 2HQ5A 3OYAA 3U2RA 5E18F 1ZTRA 4CXFA 3I55I 2EFPA 5F1JA 1YTYA 2W25A 4EMSA 1ZHFA 4ZYDA 2DO7A 4B8XA 1W5TA 4UVAA 2ICWG 1ODDA 3G73A 2X9DA 4DOZA 4J00A 4N9HA 1K78B 1HF0A 2O61A 3DLLF 2K9MA 3HSFA 5FFXA 1FYLA 5EG0A 4G7ZF 1ON2A 2IP2A 3Q3SA 2JT1A 3WG9A 3O6BB 5HS8A 1JUPA 3AG2H 4PGHA 1ZARA 2ZXJA 3FXOA 3LOCA 2WB1N 1K61A 1JE8A 4OIOF 2LLKA 2PMHA 1BC8C 2MBFA 4LLLA 5HNHA 5CLSA 4GRIA 5KNLA 4MGRA 1WSUA 1WFXA 2CQKA 1R5HA 3IRRA 1JT0A 4DIQA 1G4DA 1M1EB 5FKLA 3ZOBA 4IRHA 3ULQB 4ESBA 4IOAF 4HOBA 4BE2A 4FTHA 4G7OF 5DEQA 1FBQA 1X4PA 5E1ZB 2JVGA 4I6ZA 2L9SA 1UHMA 3S15J 1JKOC 5AIPA 4UUSA 2QZ8A 1BW6A 2CQQA 3I3LA 4EGZA 1LDJA 2OZ6A 4BBRJ 1AKHB 3KLNA 3GTOJ 2VBZA 2K40A 2ZC2A 3HEFA 4NC7A 1T2KA 2FBHA 3OYBA 4BGDA 4LLGF 1FBSA 3PM1A 4LITA 5EEAA 4KISA 1JJ8C 1BR1A 1B9MA 1KYZA 4I0AA 1IZ1A 3KZYA 2ZCWA 3E6MA 4HLYA 5ICFA 2ZJRF 2H1KA 2DA1A 1HSJA 2F5EA 3FX3A 1BI3A 2X6YA 2KIFA 4UUTA 5KHDA 3QPLA 3B02A 2R7UA 3JRBA 1D0YA 3HL2A 2P6TA 2RN7A 3KP6A 2HDDA 1HKTA 1ULYA 2ZXHA 1W0UA 4BJTA 4RM3A 1G6NA 1MZBA 2GA1A 2ADUA 4P96A 3C18A 1Y0UA 2M45A 4XM3A 4A3IJ 4A3GJ 3FWEA 2DYSH 2JWTA 1MMNA 1HW2A 2R7WA 3HC7A 2M8EA 4Y3OA 2ZJ2A 4WXCA 5LLQA 3G2BA 1AU7A 2FD5A 4XRSA 2AXLA 1AA7A 2DCEA 2B63J 5CVIA 2ELJA 4MLOA 2VLAA 4MIMA 3WGGA 4JX6A 2CSOA 1DU6A 4QPOA 5JHFA 1C0WA 5ILVA 2XIGA 1Z1DA 3BTCA 1Z6RA 2UZKA 4MEXF 3NWTA 2X85A 4PJMA 3G6EI 1G3WA 3OR1C 1B72B 4OIQF 3PSFA 1YOVB 2IW5A 3GBGA 3K70C 1DU0A 3LQRA 1FNNA 2OQRA 4XLHA 2L7MP 4II2A 2R5ZB 3BZ6A 4D9JA 1RNLA 1VQLI 5GAEJ 2OTJI 4I2OA 4P9FA 2Q1ZB 3UR3C 4YRVA 4Q4ZF 4OOIA 2A68F 1FLIA 3I54A 4GCVA 4BJ6C 4XBFA 4IQJA 1LDKB 1BI0A 3K0LA 1NG7A 4HRIA 4QTRA 2J5PA 2Y31A 4XLNF 3G1MA 2RQPA 2Z5UA 2XRLA 4CUGA 3R60A 3PSIA 1ZREA 2AXTC 1T98A 1V5EA 1W1WE 1ETQA 2X51A 3GF2A 1JUMA 3IP4B 3SJMA 3L9FA 3REOA 2CQXA 2R7XA 3IH3A 5DUIA 2E5NA 3BG3A 5HDNA 2QQAA 2DMUA 1D1CA 4RAYA 1D3YA 5CVUA 2LMDA 3E5XA 4IKFA 4KNYA 1R4NB 1CF7A 2AHQA 4EJTA 2IEKA 4RLQA 2KRCA 2VKVA 5EEHA 4A6EA 3I59B 3LL7A 3V7SA 2L4MA 4BUPA 2Z9OA 1QGPA 3H5RA 4G6TB 4I7HA 3D5LA 2F5VA 4Y15A 4YIFA 3UKGA 3MZYA 4XORA 1QBJA 3OYEA 3GTLJ 3COAC 2EIJH 3LAJA 4D0PA 3GTKJ 2V6CA 3JRGA 1DPRA 3C3WA 4Q5SF 4LMYA 2DA3A 3RI4A 1B8IA 3PO2J 3BR5A 1LNWA 1UB9A 5B66C 4L0ZB 4FX0A 3MKWB 1FOWA 1SVOA 2KP6A 4X0GA 1WZ2A 2V1UA 1KU2A 4UB6C 1K7AA 3OYDA 2ZMEB 1RC9A 1L0OC 2XVCA 2IA0A 5D5XB 4MTDA 4ZH4F 2VXZA 4RB0A 2H94A 2M2EA 2P5LC 4RMNA 3I71A 4E4HA 3S2DJ 1SVMA 4LK1F 2GAUA 1DDNA 3HOWJ 1TZLA 4UNOA 1QZZA 2W57A 1WJEA 4KA4A 3A01A 4RBOA 2XPWA 4ZDPA 4LGWA 2KFDA 2BBYA 3CC4I 1SFXA 2WY7Q 3K4MA 3SDBA 2D1HA 1TWAJ 2P8TA 2Y75A 3HSEA 1W0TA 2IGKA 1YITI 4E70A 5D6FA 2JUCA 2E2HJ 4YELA 4YFNF 1N78A 3DKYA 1CQTA 2F6CA 3K4JA 2V1NA 3BZKA 3DLAA 2VT2A 1H9TA 2GZWA 1EJ9A 2VPLA 1I27A 3LWFA 3DU5A 4AU7A 4EJVA 2K9QA 2EB7A 3K1PA 5D4RA 3U21A 3RQ4A 1B1BA 4P5OA 4C2MJ 5L3DA 5E79C 4NHJA 3RZOJ 3WTZA 5GPCA 1A36A 4QIWN 3V8JA 2H27A 5K5RA 4NQWB 2WBMA 3PIPF 2EJRA 3X2QH 1GVDA 2O03A 5TRDA 2F48A 4NDLA 5CVRA 4WWCA 1XDUA 3HDDA 1QZEA 4A0YA 3ZQCA 1WJDA 2E36A 4GXOA 4GGGA 5K1YA 1D1AA 2FA5A 3QYEA 1QQIA 3HUGA 3S32A 3QAHA 3EUHC 2HQAA 2STTA 4M9XA 2MH9A 3IH4A 5F04A 3CMEI 2Z33A 4IQ4A 1S3JA 3HHHA 1B9NA 5GAGJ 4OIRF 3BJ6A 5K5OA 4I0BA 2JA8J 2KISA 3F8CA 2XPVA 3BQYA 3ZMZA 4ESJA 4ANJA 1VFCA 3K4BA 2VBWA 1MIJA 4AYBA 2AQFA 2ZFWA 3B6CA 5FKMA 2LG4A 1I3QJ 2M5WA 2VQCA 2PEXA 1FTZA 3ONQA 1Y8QB 2DMTA 5DV5A 1T95A 2K5CA 3OIPA 5E3LA 4AIHA 1GUUA 1PUFB 1PUEE 3KP7A 4IPAA 1G59A 3CMMA 2OU2A 5JR3A 4O6JA 1G3SA 3VDXA 4XLPF 1VQMI 3T1BA 1J9IA 3L09A 3PNVA 1QHGA 2BY2A 3A0BC 1F43A 2DYRH 2LOOA 2FQ4A 4LD5A 3SHFA 2QQ9A 5DTDA 1UZCA 2DU9A 3JR9A 3H3UA 3K4KA 3F6VA 5FROA 2W00A 3ZMDA 3OL4A 4IRIA 3QPSA 3MKZA 4F92B 1EH7A 4OAYA 1O7LA 1TW3A 2G7HA 1Z77A 2LK2A 5JFRA 3F8MA 5GPAA 3WE2A 3IWZA 2VN2A 5HDGA 2F4IA 3CP8A 1FC3A 1ITYA 2PX9A 4H4KC 4HNUA 1D1BA 3ABTA 1Y1WJ 3MVPA 2IS6A 3DWLE 2A6TA 1QVTA 3S1QJ 2F5CA 3DEUA 3U9GA 5J1RA 1MMSA 5HOOA 2EA2A 4CYDA 3OYGA 3ZQGA 3IC7A 3NEUA 3WTTC 5EF6A 5IYBJ 2MYSA 3K2ZA 4HF2A 2R7FA 1I3AA 1H89C 3I4PA 2DFHA 2BV6A 1R5GA 2DPUA 2X1CA 1WQ2A 3G3ZA 4E7IA 3LSTA 1IRFA 4UHTA 4HEA2 1Y6IA 1SFOJ 3RCOA 3GVAA 5K7FA 2ZXIA 3B6AA 4UXNA 5BS6A 2KZGA 2BW3B 1A04A 4LB6B 4IHYA 1HQCA 4UV8A 2HGCA 2F4MB 4JBAA 3S1NJ 1ETXA 2V9VA 4EJWA 2VC1A 2JA5J 2FEZA 2EV0A 2KPMA 3TBIA 3TW7A 2XGXA 4AVZA 1FPQA 1RETA 3BQZA 3RTRA 1U9NA 3ROUA 3TW6A 1Z91A 4XSZF 3JRHA 3S3MA 1U5TA 2LP0A 1X2NA 2FNAA 3OL3A 4HNVA 5TGTA 2L9VA 5F0CA 2IVMA 4F91B 2FMLA 3L2UA 1KU3A 2JRMA 2VT3A 2B9SA 3VYRB 3HJEA 2HQRA 3LMMA 5LEJA 3VFZA 3IUOA 2JSPA 2R7DA 2C6YA 4A69C 4B43A 1Z6TA 2W48A 5B3SH 2K4BA 3DP7A 4YIRX 3FM3A 4XICA 3IV5A 4ZTJA 3HXLA 2V6EA 5CVJA 4UVBA 5FD5A 3FMSA 4WXHA 3TMOA 3VSLA 2JVHA 4AUXA 4EEFG 3SDGA 3WU2C 1HLVA 1X1CA 5TISC 1ZGAA 1OLTA 1EF4A 2CUJA 3BR6A 5IP6A 1YIJI 3HRUA 1T56A 2DAOA 1QNTA 1VQ7I 1JUSA 3HKZA 1XX5A 1ONVA 3A4CA 3WG7H 4GO1A 1K6OA 1VQOI 4C2TA 2EFOA 3ZMVA 2RVCA 1RR7A 3MKYB 2STWA 4IVNA 4I99C 3CF2A 5CQEA 3KYLA 3F9KA 4IEJA 3PL8A 5E3OA 1PVEA 4CZZA 4CCLA 2VQLA 4ZYAA 2BVLA 3DXJF 1SD7A 3BOQA 4Y7NJ 5EGOA 4XLEA 2LR8A 2IS2A 2EILH 2JSCA 3G4SI 1EKEA 1MMGA 1QHHD 4FE4A 4Y13A 2PMZA 4F7ZA 3H3VK 2DDBA 1WI3A 3AG4H 4G9YA 3ASOH 3Q0VA 4EJOA 3WGIA 1DQUA 3CD6I 2NVUB 2K85A 4A3EJ 1POGA 5FKNA 5DCMA 4CICA 2LD5A 3PO3J 1WHUA 4NC6A 1TL8A 1PP8F 1WKMA 3F22A 5DM6F 2GOMA 4R1HA 3KYDB 2CFOA 2HDCA 2WAEA 1RZ4A 2JZYA 5BQTA 1UJ8A 1NH3A 1D5YA 4HZFA 1FY7A 2F2EA 3EDPA 5DUKA 4KFCA 2Y69H 3FK7A 3DBLB 3HOUJ 4Z2YA 3GFLA 3BY6A 2K9LA 2M87A 1H8AC 2GA2A 4U7BA 3KPHA 1UG2A 1SD5A 2XKPA 3HRMA 1WJ5A 1MBJA 3KFWX 1S29A 1PP7U 4BE1A 4CSWA 1BA5A 4L9JA 2HPIA 1YLFA 1Z9CA 5F1RA 1S6LA 2YSRA 1KYWA 4XIDA 1JJ6C 4HQMA 4ZDLA 3CLOA 5LD2C 1X4OA 3KLOA 2VE8A 3E6BA 1MKMA 4MTEA 5GADJ 1IV8A 2FJ1A 4TV7A 5BNGA 4FQGA 1E3OC 3OYIA 2UV1A 3MAJA 2VKHA 2VI6A 5E8GA 4LG0B 4AWXB 4PSXA 3R61A 1XCBA 2DJNA 4GYIA 3GTPJ 2BOLA 2O0YA 5BMZA 3SXYA 3RDIA 5FJ8J 3H0DA 4IOCF 1GVJA 2JRTA 1U0JA 2KDZA 3LNQA 1GXPA 1BIBA 3QOPA 4U88A 2A61A 4MFDA 3E97A 5AONA 5JHUA 3CP2A 3CCMI 5GP9A 2RNJA 4A3KJ 1EA3A 2FBKA 2HPMA 4PK4A 1VQKI 1SD6A 1OPCA 2A05A 3F8BA 3LSKA 1IUYA 1HA8A 1XG1A 2OJED 1RKWA 1WCMJ 1ERDA 3VEPA 3OIQA 4XKBA 3SYTA 3JRIA 1MDMB 3ESWB 1V5FA 1BI2A 1K79A 1XPXA 2XB5A 3OYKA 1ZRDA 1R71A 2K7LA 3CUQA 3FBIB 1F1ZA 1XSDA 3HTUA 1JKPC 3GWZA 4KJZA 4CCJA 2LF7A 4K2EA 2RREA 5EDNA 2A69F 3V8KA 3HTSB 4IHWA 4HW0A 4F93B 2QYOA 5L3CA 1FYMA 4BXFA 1XSXA 1X58A 2FBIA 1APLC 4B3AA 2BE5F 1D0ZA 5IOYA 3CCSI 3DKWA 5H6RA 4H0EA 1W5SA 2DN0A 3CF5F 4M3EA 3KEQA 3RPUA 2EFWA 3ZP5A 1GHCA 2VUMJ 2ZNYA 3IKTA 3HRTA 3ZQ7A 1LE8B 3CJNA 4B1RA 2DTZA 4RGUA 2RNGA 3FM5A 2NNNA 2LKSA 5DCFA 3MD2A 1W7PA 2QBYB 1X1PA 1EH8A 3ABKH 2VJ5A 3H1CA 3K6GA 5CQGA 1OYYA 4BY1J 1USTA 3CCUI 2F5FA 3QQAA 2PMUA 5A2QK 2PN6A 1XDSA 2RQQA 2FNPA 1TLHB 5D8KB 2E19A 4Q48A 2E1MB 3D5SC 2GXGA 2NOGA 3RKWA 1TP4A 1LFPA 2LKPA 4OWRB 1OISA 2HDWA 1RI7A 2KQRA 1ZG5A 1OCCH 2DDAA 2K3PA 2R5YA 2PI0A 4EV0A 1ZRFA 4RLFA 2NNYA 1ZGWA 3FXRA 2D45A 1DP3A 2HR3A 4II3A 1FOYA 4ZTFA 2DK8A 2GLOA 5C44J 4M9ZA 2PLYA 3AG3H 4FE7A 1X3ZB 1VTNC 1FJLA 5M3MJ 1XCVA 4AC0A 1N77A 1MNDA 4HA8A 3W6JB 1R58A 1V55H 2JA2A 2LBFB 2O8KA 2RGVA 2L54A 4ZZLA 2NOJB 1GDTA 3KETA 4WF2A 2R92J 5HVQC 2BGCA 1TQMA 5F08A 2EH3A 1T0FC 3BTJA 2Y9ZA 4I98B 1JGSA 2M4KA 1UFMA 4HX7A 3V8LA 4ON0A 1KZHA 1XD7A 4GFBA 4PDKA 2WB1A 1K4SA 4UY8I 2XF7A 4PSWA 1WH5A 4QWQA 1ZG1A 2GXAA 3RJPA 1HXDA 3O2PE 5C4JJ 3VYTB 1YW7A 4IHXA 3GTJJ 1KGSA 4XKWA 1R49A 4P9UA 1IN6A 3FBNB 3WTXC 4EQQA 1QPMA 1D8JA 4I01A 1UCRA 3P7NA 4A3BJ 2M4GA 2VKEA 3IHUA 3LFUA 2ZMEA 4I09A 3CUQC 4ESFA 4UUVA 3C2GA 3OSFA 2DMNA 1ZR2A 4KIBA 1FT9A
chains in the Genus database with same CATH topology
3LSRA 1I6HJ 1TWAJ 5FLVA 3W6VA 1W0TA 2MW8A 1TC3C 3BTIA 2E2HJ 2L9RA 2CUFA 2DA6A 4FCYA 1U78A 1CQTA 4A93J 4M6VA 1VF9A 2AO9A 2HXOA 3HKZN 2HXIA 2K9QA 3ZQHA 2EZIA 2DA7A 2XGEA 1ETWA 1IGNA 2DA4A 4C2MJ 2XGDA 3H0GJ 3RZOJ 5GPCA 2ME0A 5IPAA 4QIWN 4XK4A 1QPIA 1MNMC 5EZHA 3HOZJ 4ABZA 2JK3A 1GV5A 5JLXA 1GVDA 1RKTA 4NDLA 3HDDA 2PMZN 5C4XJ 1OCPA 3ZQCA 2YS9A 2XSDC 4DZJA 2MSYA 2R7ZJ 1AHDP 1TWFJ 1MSFC 5E3NA 5F04A 2XGCA 3IH4A 2HOTA 3CQZJ 4BKXA 4C3HJ 1MBHA 2E1OA 2QCOA 2NS8A 4M3DA 2JA8J 4Y52J 3BTLA 2Y9YA 1B72A 4BXXJ 1G2HA 2XPVA 3BQYA 3JREA 3RZDJ 5F27A 1VFCA 4JX5A 4BBSJ 1MBGA 2R5ZA 4RDUA 3B6CA 5FKMA 4M3FA 1I3QJ 1QRYA 4DW6A 3I4MJ 1FTZA 5FKOA 2DMTA 1S7EA 5E3LA 4LOCA 2HI3A 1GUUA 1O4XA 1PUFB 1IV6A 3RQIA 4S0HB 2ECCA 2X6OA 3WHBA 3MN2A 1IDZA 2L7FP 1QVUA 1IC8A 4D5FA 3O8HA 2QF7A 4V2FA 1F43A 2Y2ZA 4C3JJ 2FQ4A 3TEDA 1WPKA 5DTDA 3JRFA 1HCRA 3JR9A 1NK2P 2FX0A 2L7ZA 1HDPA 3BG9A 2EQRA 5F0HA 1A6IA 3LSJA 2M34A 5M5YJ 3QPSA 1OFCX 1BJZA 1Z77A 3L1PA 1VNDA 2LK2A 3S17J 5GPAA 2NVYJ 2ID3A 1MH3A 3K7AJ 4G12A 4XRSG 2OF7A 1ITYA 2H8RA 1RPWA 1Y1WJ 3MVPA 3LSGA 1QVTA 3S1QJ 5J1RA 1K83J 2HOAA 5M3FJ 3D1NI 3ZQGA 3HGGA 2XB0X 5EF6A 1TWGJ 2D5VA 5IYBJ 3S16J 3HOXJ 1MH4A 1MBEA 4M3BA 3JRAA 4L5EA 1H89C 3BR0A 1ZQ3P 3MKLA 1ETYA 2IBDA 3ZQIA 1RESA 2M9HA 3LSPA 1SFOJ 2IAIA 2VPRA 3B6AA 3IH2A 5K7FA 1R9TJ 2KT0A 1BL0A 2DA5A 2Y0SN 5J3LA 4MFEA 4IHYA 1U8BA 1IRZA 3A03A 3HBLA 2OPTA 3S1NJ 1ETXA 3GTMJ 2CRGA 2JA5J 3ZQFA 5C3EJ 2NVQJ 3TW7A 3JRDA 3BR1A 1RETA 3RKQA 1FIPA 2ECBA 5JLWA 1F36A 3BQZA 1U9NA 1SANA 3TW6A 4XRMA 2RAEA 5EYRA 4FISA 3G1OA 1YRNB 3S1MJ 3JRHA 2ME6A 1MBKA 2LP0A 1JTYA 2N8GA 1X2NA 3O8GA 4HNVA 1ENHA 1LFUP 3M4OJ 3CDLA 2R0QC 4W1UA 5F0CA 3TP0A 2DMQA 3JRCA 2EZKA 2LY9A 2DA2A 4X6AJ 1HDDC 4A69C 2JJ7A 2W48A 1JKRC 3IV5A 5IP7J 4XICA 3OSGA 3S2HJ 3Q0WA 4AUXA 4EEFG 3WHCA 1HLVA 3SDGA 1EF4A 1ZR4A 1H88C 3BR6A 1UMQA 5IP6A 1FTTA 2E2IJ 3G1LA 1T56A 2E2JJ 4QSHA 1IUFA 1JUSA 1JGGA 1HOMA 5EGOB 2NS7A 1VI0A 1RR7A 2YUSA 3CMYA 4IEJA 2NVTJ 2ZB9A 1X2MA 3GTQJ 5E3OA 1A5JA 2HQ5A 2JA7J 3E7LA 1ZTRA 2JMWA 3SFIA 4Y7NJ 5EGOA 2LR8A 3FIWA 5EG0B 3FISA 5F1JA 4FE4A 5EZGA 3BG5A 3H3VK 1JT6A 3K2AA 1WI3A 4A3DJ 3Q0VA 2X9DA 1XC5A 2LVSA 1HF0A 2CUEA 4A3EJ 1POGA 5FKNA 1U9OA 2LD5A 3PO3J 5EG0A 1PUFA 3Q3SA 2R5YB 3DCFA 5FKKA 1JUPA 3A02A 2L0KA 1XS9A 3LOCA 2WB1N 1K61A 3I4NJ 3HGYA 2LLKA 2TCTA 1D5YA 1TWHJ 1FEXA 1NK3P 3FK7A 3HOUJ 1JT0A 3DEWA 1H8AC 5FKLA 3ZOBA 5FLMJ 4UUSB 4A3LJ 1UG2A 1MBJA 2ID6A 1IDYA 1BA5A 1WGXA 1B8IB 4FTHA 2COBA 4A3JJ 3S1RJ 1UHSA 3HB9A 1JJ6C 5IYDJ 4XIDA 4I6ZA 3S15J 1JKOC 4UUSA 4M3GA 4A3CJ 1BW6A 2XPUA 2CQQA 2FJ1A 3NARA 5BNGA 4J19A 4BY7J 1E3OC 4BBRJ 1AKHB 3GTOJ 2K40A 2VI6A 3HEFA 3BR3A 3PM1A 5EEAA 3ZQLA 4JP0A 1P7IA 2M8GX 1JJ8C 2DJNA 3GTPJ 2H1KA 1OCTC 3A01B 2DA1A 5FJ8J 2HYJA 4UUTA 2LFBA 3QPLA 2KDZA 3LNQA 2GM4A 1ZK8A 3JRBA 4I76A 5E3MA 1TWCJ 4MFDA 4B4CA 2Y30A 2HDDA 5GP9A 1LFBA 1W0UA 2WV1A 4A3KJ 1ORKA 4X1EA 4D7NA 1XG1A 4A3IJ 4A3GJ 1ETVA 1MBFA 1RKWA 1WCMJ 4V2GA 1WH7A 2JWTA 3JRIA 2LKXA 2JA6J 4DYQA 2XB5A 1IG7A 1Z0XA 1YRNA 1AU7A 3GTGJ 2FD5A 4DYRA 4XRSA 5K7ZA 2B63J 3HM5A 3HOYJ 4MLOA 4AYBN 4MIMA 5DS9A 1JKPC 4JX6A 1DU6A 5EDNA 3BR2A 3TP3A 4IHWA 3S14J 4W97A 2TRTA 3BTCA 1JTXA 1X58A 2GBYA 1APLC 1Q1VA 4B3AA 5IOYA 5HODA 1B72B 1DU0A 3GBGA 3HOVJ 2DN0A 4M3EA 2MG4A 2L7MP 2R5ZB 3F0CA 2EZLA 2VUMJ 2G0EA 1LE8B 4B1RA 2O7OA 9ANTA 2DTZA 3FK6A 1GV2A 4JYKA 2K9SA 4QTRA 5J1YA 3NAUA 2Y31A 2EBIA 5F0FA 4BY1J 3G1MA 1FIAA 1LE8A 2XRLA 3QQAA 4CYCB 1P7JA 1I50J 2WAQN 3Q0UA 5M5XJ 1ETQA 2E19A 1JUMA 3CCYA 1Y1VJ 3SJMA 2NOGA 2O9LA 4C3IJ 2CQXA 3IH3A 4A3MJ 3BG3A 2DMUA 5M5WJ 2R5YA 4CYCA 2DMPA 5IOZA 2AHQA 2IEKA 1OJLA 2VKVA 4D7MA 1ZGWA 1GT0C 4DYCA 2P81A 1MSEC 2GLOA 5C44J 4FE7A 4A3FJ 1NTCA 3C2BA 1FJLA 3VPRA 4AC0A 5IP9J 5M3MJ 2O8KA 3BT9A 3UKGA 3GTLJ 2YU9J 2EZHA 3GTKJ 1GDTA 3JRGA 1BW5A 2LTPA 4MO7A 2K9NA 2MGQA 2R92J 5F08A 2X48A 2R93J 2DA3A 2EH3A 3BTJA 1B8IA 2Y9ZA 2CJJA 3BR5A 3PO2J 2CU7A 1JKQC 4GFBA 2ELKA 1WH5A 1ETKA 3OOUA 2HOSA 5C4JJ 4IHXA 3GTJJ 2I10A 1ZKGA 2JN6A 1IJWC 4D5CA 1AKHA 2M2EA 3S2DJ 3M3YJ 1T33A 5IYCJ 5J1UA 4JX4A 2NVXJ 4DZPA 4A3BJ 2VKEA 3FKIJ 3HOWJ 5K7HA 3A01A 1ETOA 2M0CA 2XPWA 2DMNA 4RBOA 3OSFA 1ZR2A 4IHVA 3OIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSR A;  1I6H J;  1TWA J;  5FLV A;  3W6V A;  1W0T A;  2MW8 A;  1TC3 C;  3BTI A;  2E2H J;  2L9R A;  2CUF A;  2DA6 A;  4FCY A;  1U78 A;  1CQT A;  4A93 J;  4M6V A;  1VF9 A;  2AO9 A;  2HXO A;  3HKZ N;  2HXI A;  2K9Q A;  3ZQH A;  2EZI A;  2DA7 A;  2XGE A;  1ETW A;  1IGN A;  2DA4 A;  4C2M J;  2XGD A;  3H0G J;  3RZO J;  5GPC A;  2ME0 A;  5IPA A;  4QIW N;  4XK4 A;  1QPI A;  1MNM C;  5EZH A;  3HOZ J;  4ABZ A;  2JK3 A;  1GV5 A;  5JLX A;  1GVD A;  1RKT A;  4NDL A;  3HDD A;  2PMZ N;  5C4X J;  1OCP A;  3ZQC A;  2YS9 A;  2XSD C;  4DZJ A;  2MSY A;  2R7Z J;  1AHD P;  1TWF J;  1MSF C;  5E3N A;  5F04 A;  2XGC A;  3IH4 A;  2HOT A;  3CQZ J;  4BKX A;  4C3H J;  1MBH A;  2E1O A;  2QCO A;  2NS8 A;  4M3D A;  2JA8 J;  4Y52 J;  3BTL A;  2Y9Y A;  1B72 A;  4BXX J;  1G2H A;  2XPV A;  3BQY A;  3JRE A;  3RZD J;  5F27 A;  1VFC A;  4JX5 A;  4BBS J;  1MBG A;  2R5Z A;  4RDU A;  3B6C A;  5FKM A;  4M3F A;  1I3Q J;  1QRY A;  4DW6 A;  3I4M J;  1FTZ A;  5FKO A;  2DMT A;  1S7E A;  5E3L A;  4LOC A;  2HI3 A;  1GUU A;  1O4X A;  1PUF B;  1IV6 A;  3RQI A;  4S0H B;  2ECC A;  2X6O A;  3WHB A;  3MN2 A;  1IDZ A;  2L7F P;  1QVU A;  1IC8 A;  4D5F A;  3O8H A;  2QF7 A;  4V2F A;  1F43 A;  2Y2Z A;  4C3J J;  2FQ4 A;  3TED A;  1WPK A;  5DTD A;  3JRF A;  1HCR A;  3JR9 A;  1NK2 P;  2FX0 A;  2L7Z A;  1HDP A;  3BG9 A;  2EQR A;  5F0H A;  1A6I A;  3LSJ A;  2M34 A;  5M5Y J;  3QPS A;  1OFC X;  1BJZ A;  1Z77 A;  3L1P A;  1VND A;  2LK2 A;  3S17 J;  5GPA A;  2NVY J;  2ID3 A;  1MH3 A;  3K7A J;  4G12 A;  4XRS G;  2OF7 A;  1ITY A;  2H8R A;  1RPW A;  1Y1W J;  3MVP A;  3LSG A;  1QVT A;  3S1Q J;  5J1R A;  1K83 J;  2HOA A;  5M3F J;  3D1N I;  3ZQG A;  3HGG A;  2XB0 X;  5EF6 A;  1TWG J;  2D5V A;  5IYB J;  3S16 J;  3HOX J;  1MH4 A;  1MBE A;  4M3B A;  3JRA A;  4L5E A;  1H89 C;  3BR0 A;  1ZQ3 P;  3MKL A;  1ETY A;  2IBD A;  3ZQI A;  1RES A;  2M9H A;  3LSP A;  1SFO J;  2IAI A;  2VPR A;  3B6A A;  3IH2 A;  5K7F A;  1R9T J;  2KT0 A;  1BL0 A;  2DA5 A;  2Y0S N;  5J3L A;  4MFE A;  4IHY A;  1U8B A;  1IRZ A;  3A03 A;  3HBL A;  2OPT A;  3S1N J;  1ETX A;  3GTM J;  2CRG A;  2JA5 J;  3ZQF A;  5C3E J;  2NVQ J;  3TW7 A;  3JRD A;  3BR1 A;  1RET A;  3RKQ A;  1FIP A;  2ECB A;  5JLW A;  1F36 A;  3BQZ A;  1U9N A;  1SAN A;  3TW6 A;  4XRM A;  2RAE A;  5EYR A;  4FIS A;  3G1O A;  1YRN B;  3S1M J;  3JRH A;  2ME6 A;  1MBK A;  2LP0 A;  1JTY A;  2N8G A;  1X2N A;  3O8G A;  4HNV A;  1ENH A;  1LFU P;  3M4O J;  3CDL A;  2R0Q C;  4W1U A;  5F0C A;  3TP0 A;  2DMQ A;  3JRC A;  2EZK A;  2LY9 A;  2DA2 A;  4X6A J;  1HDD C;  4A69 C;  2JJ7 A;  2W48 A;  1JKR C;  3IV5 A;  5IP7 J;  4XIC A;  3OSG A;  3S2H J;  3Q0W A;  4AUX A;  4EEF G;  3WHC A;  1HLV A;  3SDG A;  1EF4 A;  1ZR4 A;  1H88 C;  3BR6 A;  1UMQ A;  5IP6 A;  1FTT A;  2E2I J;  3G1L A;  1T56 A;  2E2J J;  4QSH A;  1IUF A;  1JUS A;  1JGG A;  1HOM A;  5EGO B;  2NS7 A;  1VI0 A;  1RR7 A;  2YUS A;  3CMY A;  4IEJ A;  2NVT J;  2ZB9 A;  1X2M A;  3GTQ J;  5E3O A;  1A5J A;  2HQ5 A;  2JA7 J;  3E7L A;  1ZTR A;  2JMW A;  3SFI A;  4Y7N J;  5EGO A;  2LR8 A;  3FIW A;  5EG0 B;  3FIS A;  5F1J A;  4FE4 A;  5EZG A;  3BG5 A;  3H3V K;  1JT6 A;  3K2A A;  1WI3 A;  4A3D J;  3Q0V A;  2X9D A;  1XC5 A;  2LVS A;  1HF0 A;  2CUE A;  4A3E J;  1POG A;  5FKN A;  1U9O A;  2LD5 A;  3PO3 J;  5EG0 A;  1PUF A;  3Q3S A;  2R5Y B;  3DCF A;  5FKK A;  1JUP A;  3A02 A;  2L0K A;  1XS9 A;  3LOC A;  2WB1 N;  1K61 A;  3I4N J;  3HGY A;  2LLK A;  2TCT A;  1D5Y A;  1TWH J;  1FEX A;  1NK3 P;  3FK7 A;  3HOU J;  1JT0 A;  3DEW A;  1H8A C;  5FKL A;  3ZOB A;  5FLM J;  4UUS B;  4A3L J;  1UG2 A;  1MBJ A;  2ID6 A;  1IDY A;  1BA5 A;  1WGX A;  1B8I B;  4FTH A;  2COB A;  4A3J J;  3S1R J;  1UHS A;  3HB9 A;  1JJ6 C;  5IYD J;  4XID A;  4I6Z A;  3S15 J;  1JKO C;  4UUS A;  4M3G A;  4A3C J;  1BW6 A;  2XPU A;  2CQQ A;  2FJ1 A;  3NAR A;  5BNG A;  4J19 A;  4BY7 J;  1E3O C;  4BBR J;  1AKH B;  3GTO J;  2K40 A;  2VI6 A;  3HEF A;  3BR3 A;  3PM1 A;  5EEA A;  3ZQL A;  4JP0 A;  1P7I A;  2M8G X;  1JJ8 C;  2DJN A;  3GTP J;  2H1K A;  1OCT C;  3A01 B;  2DA1 A;  5FJ8 J;  2HYJ A;  4UUT A;  2LFB A;  3QPL A;  2KDZ A;  3LNQ A;  2GM4 A;  1ZK8 A;  3JRB A;  4I76 A;  5E3M A;  1TWC J;  4MFD A;  4B4C A;  2Y30 A;  2HDD A;  5GP9 A;  1LFB A;  1W0U A;  2WV1 A;  4A3K J;  1ORK A;  4X1E A;  4D7N A;  1XG1 A;  4A3I J;  4A3G J;  1ETV A;  1MBF A;  1RKW A;  1WCM J;  4V2G A;  1WH7 A;  2JWT A;  3JRI A;  2LKX A;  2JA6 J;  4DYQ A;  2XB5 A;  1IG7 A;  1Z0X A;  1YRN A;  1AU7 A;  3GTG J;  2FD5 A;  4DYR A;  4XRS A;  5K7Z A;  2B63 J;  3HM5 A;  3HOY J;  4MLO A;  4AYB N;  4MIM A;  5DS9 A;  1JKP C;  4JX6 A;  1DU6 A;  5EDN A;  3BR2 A;  3TP3 A;  4IHW A;  3S14 J;  4W97 A;  2TRT A;  3BTC A;  1JTX A;  1X58 A;  2GBY A;  1APL C;  1Q1V A;  4B3A A;  5IOY A;  5HOD A;  1B72 B;  1DU0 A;  3GBG A;  3HOV J;  2DN0 A;  4M3E A;  2MG4 A;  2L7M P;  2R5Z B;  3F0C A;  2EZL A;  2VUM J;  2G0E A;  1LE8 B;  4B1R A;  2O7O A;  9ANT A;  2DTZ A;  3FK6 A;  1GV2 A;  4JYK A;  2K9S A;  4QTR A;  5J1Y A;  3NAU A;  2Y31 A;  2EBI A;  5F0F A;  4BY1 J;  3G1M A;  1FIA A;  1LE8 A;  2XRL A;  3QQA A;  4CYC B;  1P7J A;  1I50 J;  2WAQ N;  3Q0U A;  5M5X J;  1ETQ A;  2E19 A;  1JUM A;  3CCY A;  1Y1V J;  3SJM A;  2NOG A;  2O9L A;  4C3I J;  2CQX A;  3IH3 A;  4A3M J;  3BG3 A;  2DMU A;  5M5W J;  2R5Y A;  4CYC A;  2DMP A;  5IOZ A;  2AHQ A;  2IEK A;  1OJL A;  2VKV A;  4D7M A;  1ZGW A;  1GT0 C;  4DYC A;  2P81 A;  1MSE C;  2GLO A;  5C44 J;  4FE7 A;  4A3F J;  1NTC A;  3C2B A;  1FJL A;  3VPR A;  4AC0 A;  5IP9 J;  5M3M J;  2O8K A;  3BT9 A;  3UKG A;  3GTL J;  2YU9 J;  2EZH A;  3GTK J;  1GDT A;  3JRG A;  1BW5 A;  2LTP A;  4MO7 A;  2K9N A;  2MGQ A;  2R92 J;  5F08 A;  2X48 A;  2R93 J;  2DA3 A;  2EH3 A;  3BTJ A;  1B8I A;  2Y9Z A;  2CJJ A;  3BR5 A;  3PO2 J;  2CU7 A;  1JKQ C;  4GFB A;  2ELK A;  1WH5 A;  1ETK A;  3OOU A;  2HOS A;  5C4J J;  4IHX A;  3GTJ J;  2I10 A;  1ZKG A;  2JN6 A;  1IJW C;  4D5C A;  1AKH A;  2M2E A;  3S2D J;  3M3Y J;  1T33 A;  5IYC J;  5J1U A;  4JX4 A;  2NVX J;  4DZP A;  4A3B J;  2VKE A;  3FKI J;  3HOW J;  5K7H A;  3A01 A;  1ETO A;  2M0C A;  2XPW A;  2DMN A;  4RBO A;  3OSF A;  1ZR2 A;  4IHV A;  3OIO A; 
#chains in the Genus database with same CATH topology
 3OS1 A;  2E1C A;  3EYY A;  2XAS A;  3ZXS A;  3DTI A;  3U1K A;  5FLV A;  3J7Z I;  1TC3 C;  2DFE A;  1X1A A;  3BTI A;  3WGH A;  1ZN2 A;  1XB4 A;  2KL4 A;  2GIV A;  4XLC A;  3SZG A;  2EZI A;  2DA7 A;  1IGN A;  2DA4 A;  2QKL B;  4M6X A;  2XGD A;  3H0G J;  5IPA A;  1YHQ I;  4IL6 C;  1KA8 A;  5L3F A;  5EZH A;  4IHT A;  3HOZ J;  4A0Z A;  4ABZ A;  2JK3 A;  4L18 B;  5JLX A;  5L3G A;  2VB6 A;  1RKT A;  3KP5 A;  3PUB A;  2MLK A;  4A2U A;  4ENJ A;  4CO8 A;  1RRJ A;  5C4X J;  2A6H F;  2DBB A;  3F8F A;  1R5I D;  2R7Z J;  3BPX A;  4U7D A;  2PBI A;  3S3O A;  1TWF J;  1XMA A;  3MCZ A;  3FHZ A;  2E5Z A;  1MSF C;  3CLQ A;  1GXQ A;  2BZT A;  4MEY F;  4P1W A;  1O3Q A;  3A0H C;  1IF1 A;  1FOX A;  1O3S A;  3HYI A;  1HKS A;  4OMZ A;  1W4M A;  2MC3 A;  3GO5 A;  2CWE A;  1U6G A;  1NG6 A;  2Z3Y A;  4BXX J;  2DT5 A;  3JRE A;  5F27 A;  2XRN A;  2Q8K A;  1P4W A;  3DV8 A;  2HZD A;  3GEZ A;  1I1G A;  1R00 A;  1O3T A;  3E5U A;  4RDU A;  2JUG A;  5HS7 A;  4M3F A;  2ZFU A;  2KJB A;  4DW6 A;  1U8R A;  2XF6 A;  2BHZ A;  2W85 A;  3ZMT A;  5KAI C;  4ZYG A;  4O3M A;  1F9N A;  4HPQ A;  3K4C A;  1O4X A;  1XMK A;  4CA0 A;  2HKX A;  2E1N A;  4UV9 A;  2WWY A;  2XSJ C;  1QVU A;  3ABM H;  2ISZ A;  1I6X A;  2KRF A;  2Z1D A;  3BZC A;  2X6W A;  3M9A A;  3JAM K;  3VSK A;  2QF7 A;  2X6X A;  2R7T A;  3N97 A;  2HFH A;  4LIV A;  3WTU C;  3AL0 C;  3ASN H;  2WAD A;  2VBX A;  4BS9 A;  1XGN A;  1XN7 A;  2KMU A;  2Y48 A;  2VL8 A;  3JRF A;  3WTV C;  2FX0 A;  5F0H A;  2VIX A;  3KX2 A;  3FXK A;  3LSJ A;  1HBX G;  5J4Y A;  5BOX A;  4HF1 A;  1B59 A;  2IPQ X;  3RSN A;  4HX4 A;  3TO7 A;  3SEQ A;  1Z3Y A;  3F21 A;  4A6D A;  4KIG A;  3KP2 A;  3DTE A;  2ID3 A;  2LY2 A;  3F72 A;  3KP3 A;  4M71 A;  4HLX A;  4XRS G;  3OS2 A;  2TDX A;  3OV8 A;  3BCB A;  4E7J A;  4OIP F;  6PAX A;  3LSG A;  3N05 A;  2P0W A;  5JVG F;  3K10 A;  1IN7 A;  2HOA A;  5M3F J;  4BHP A;  2XB0 X;  1OQY A;  1TWG J;  2CYY A;  3F3X A;  3HOX J;  1MH4 A;  1MBE A;  2P7V B;  2XKO A;  2PJP A;  4R8H A;  3NWS A;  1ZQ3 P;  5FLX K;  1FP2 A;  1JI8 A;  2RV8 A;  2IGO A;  1RES A;  2M9H A;  3HPG A;  2H8W A;  2O6G E;  3B73 A;  2VPR A;  4YG2 F;  2VE9 A;  2KIU A;  2NXN B;  2WY8 Q;  5D8L B;  4OIN F;  5J3L A;  1LB2 A;  3A03 A;  3WTS C;  4C2U A;  1IN8 A;  4HBL A;  3DF8 A;  2A5W A;  3ZQF A;  1MD0 A;  2YX7 A;  4AM3 A;  3BG6 A;  3OYH A;  3JRD A;  4XL9 A;  2DJI A;  3MQ0 A;  3F6O A;  5JLW A;  3T5X A;  4DGW B;  2YX4 A;  4KYW A;  2DPD A;  5H6Q A;  4BL0 B;  2QM3 A;  4XRM A;  2RAE A;  4KMU X;  5TJJ A;  3S1M J;  1ZH5 A;  4I02 A;  3ZGK A;  5B1B H;  1MBK A;  2GOX B;  2HWV A;  3H9J A;  1JTY A;  2O5R A;  2R4G A;  3KZI C;  5B1A H;  2R0Q C;  4W1U A;  3TP0 A;  4AVP A;  3JRC A;  4BAC A;  4CHU A;  2IGN A;  2DA2 A;  4HAM A;  4M6Y A;  2DFI A;  1W36 C;  1HDD C;  1EH6 A;  1ZYR F;  4BEH A;  1NHA A;  3R4K A;  5FLX Z;  3S2H J;  3Q0W A;  1R23 A;  3CO6 C;  1BOB A;  1IRX A;  2L2O A;  4Q47 A;  2CUZ A;  1BR4 A;  1LDD A;  3G1L A;  2E2J J;  1IRG A;  1HOM A;  4KDP A;  1XGS A;  1Y56 A;  2CMP A;  2NAZ A;  3IKV A;  4RA2 A;  1YW9 A;  4EGY A;  2ELH A;  2LH9 A;  3AKZ A;  3LSM A;  2PJR A;  1VI0 A;  3JSO A;  2YUS A;  4IXA A;  2HS5 A;  2ZB9 A;  1X2M A;  3GTQ J;  1A5J A;  3GFI A;  3SFI A;  5KAF C;  4A12 A;  3CUO A;  2WAF A;  3HPH A;  3L7W A;  5J4V A;  3FIW A;  3FIS A;  1SMT A;  3JCU C;  3LA7 A;  3GFM A;  2KIQ A;  3K4N A;  3BG5 A;  5DD8 A;  3MFK A;  2DXI A;  3KZZ A;  3GZ5 A;  1XC5 A;  4PCQ A;  3DPL C;  5LFA A;  1O7F A;  2CUE A;  2XAQ A;  3DU6 A;  3MMY B;  3CTA A;  3J80 K;  4RAZ A;  4RGS A;  4CCM A;  3DCF A;  3A02 A;  4WK8 F;  2OZU A;  2L0K A;  2IS4 A;  2QA4 I;  3KIO A;  1WJF A;  2QGU A;  2V79 A;  1SAU A;  1VQ9 I;  2XAJ A;  4KIC A;  1TWH J;  1FEX A;  4E6K G;  3R0J A;  3RPU D;  2PQ8 A;  3LSI A;  4B44 A;  3HG9 A;  3J7A Y;  5FLM J;  2UWM A;  2WAQ A;  2LF8 A;  3G71 I;  1IDY A;  5LGT A;  1WGX A;  1B8I B;  4CGZ A;  3FHN A;  2COB A;  4LLN A;  5DDG A;  3S1R J;  1UHS A;  1B4A A;  5FFZ A;  1W7P D;  2FOW A;  3HB9 A;  5IYD J;  1SC7 A;  2FF4 A;  5H20 A;  4HQE A;  2OCC H;  4M3G A;  4A3C J;  2XPU A;  4HX8 A;  4J19 A;  3OYN A;  2CW7 A;  4ETS A;  2UXN A;  4DJA A;  3U1D A;  1OYI A;  3J80 Z;  4PGG A;  4NB5 A;  3E6C C;  1AOY A;  1N75 A;  3BR3 A;  2RC4 A;  3TOB A;  3ZQL A;  1P7I A;  4AIJ A;  4NC8 A;  3E3V A;  2VOD A;  1OCT C;  4MQ9 F;  2PG4 A;  2YU3 A;  3A01 B;  5D5V B;  5JI6 A;  3RKY A;  5ED4 A;  3QOD A;  1VQP I;  2LFB A;  3TKY A;  2FXA A;  2CW8 A;  2GM4 A;  1ZK8 A;  3ZN1 A;  3IRQ A;  1D0X A;  4B4C A;  3JTH A;  4MQV A;  2CV2 A;  1LFB A;  3HOT A;  5LEK A;  2DQR A;  3OYM A;  2DI3 A;  4WXD A;  1ORK A;  4X1E A;  2NRA C;  5ILU A;  1ETV A;  1MBF A;  2D2W A;  4V2G A;  1WH7 A;  3GFJ A;  1R1V A;  3ZRG A;  2XAU A;  2LKX A;  2JA6 J;  2QVO A;  5D6E A;  1KQ0 A;  1YRN A;  1OR7 A;  5GAH J;  3HM5 A;  5GTH C;  4XSX F;  3HOY J;  3PFY A;  5DS9 A;  2L01 A;  1T39 A;  2GIZ A;  1RIO H;  3BR2 A;  1UHW A;  3M8J A;  3HUG B;  3TP3 A;  4RB2 C;  3S14 J;  1X1D A;  1MDM A;  2M0M A;  3M8F A;  3GUD A;  5E20 A;  2I5U A;  2W1O A;  4W97 A;  2BY1 A;  1G3Y A;  2G9W A;  2TRT A;  4ZDO A;  2VQG A;  2GBY A;  2L7K A;  2CV0 A;  4L0Y B;  3O3K A;  1Q1V A;  2V26 A;  5EJC A;  2EK5 A;  1FMW A;  2K4J A;  5HOD A;  3CJR B;  3BDD A;  1A35 A;  3HOV J;  2MG4 A;  3M1C A;  5FO5 A;  1Z05 A;  2P6S A;  2RKH A;  1J59 A;  3F0C A;  2Q2E A;  3TO6 A;  3TDU C;  2L5Q A;  3PQK A;  2G0E A;  3VB2 A;  1I5Z A;  2BXZ A;  2X1D A;  4IF4 A;  9ANT A;  2UUZ A;  4AIK A;  2QEN A;  1GV2 A;  4JYK A;  2G7U A;  2Z16 A;  5GTI C;  2K9S A;  4G6Q A;  1YO5 C;  4OMY A;  3PFI A;  1IXC A;  5J1Y A;  1KQ9 A;  1KQ8 A;  2W84 A;  3NAU A;  2LC2 A;  1AWC A;  1ZGJ A;  2OTL I;  1LE8 A;  4O5V A;  2OAZ A;  1S7O A;  4CYC B;  1P7J A;  2DOD A;  1I50 J;  1IN5 A;  3Q0U A;  5M5X J;  1MMA A;  1K78 A;  2ZKZ A;  3TL4 X;  4E7S A;  3QPH A;  1L3L A;  2O9L A;  4XOT A;  1FP1 D;  4PJL A;  1DPU A;  3H92 A;  5M5W J;  4KIT B;  2IXS A;  1HKQ A;  1G3T A;  5KK1 A;  1BC7 C;  4FT8 A;  1OJL A;  2M3A A;  3GCM A;  5IT9 K;  1GT0 C;  2ISY A;  3DKX A;  2ZO4 A;  3H9Q A;  1YS6 A;  3R0A A;  4E7H A;  2HVS A;  4KMF A;  3H36 A;  4A5N A;  3C2B A;  2DFF A;  3VPR A;  3OR2 C;  3SFZ A;  5IP9 J;  3BT9 A;  2X4H A;  1W36 D;  2QKM B;  2OUM A;  4M73 A;  3V42 A;  2LTP A;  4MO7 A;  4EM2 A;  2X48 A;  2R93 J;  3GX4 X;  5IY5 H;  3LA2 A;  4Z6Y A;  4CCO A;  1FMV A;  1FBU A;  1LQ1 A;  2ELK A;  4KUM A;  1U5T C;  2E34 A;  1PDN C;  4N4N B;  1ETK A;  3OOU A;  2O8X A;  4BQO A;  1ZKG A;  1IJW C;  4D5C A;  1AKH A;  4G6D A;  2K27 A;  3BLY A;  2FE3 A;  2VQH A;  3M3Y J;  4NNJ A;  2A3S A;  5ICE A;  4WX9 A;  2UXX A;  1R1T A;  5IYC J;  2E71 A;  5J1U A;  1YW8 A;  2FUG 2;  4JX4 A;  2QEX I;  2NVX J;  3E5Q A;  1ETO A;  2M0C A;  4RAG A;  4C30 A;  3IWF A;  5IT9 Z;  4A93 J;  2R7Q A;  1I6H J;  3A2K A;  4HG2 A;  2FSW A;  4AID A;  3W6V A;  2HU9 A;  2FMY A;  1H0M A;  2CFX A;  4ZC3 A;  3DEE A;  2BYV E;  2V9P A;  2CUF A;  2DA6 A;  1U78 A;  2HXO A;  2A07 F;  2HXI A;  5JVT A;  3FXQ A;  3KEY A;  1Y0N A;  3ZMS A;  3RYP A;  5LHG A;  3KYC B;  3QYB A;  2VAS A;  1SFK A;  2QSG X;  3ABU A;  4EM1 A;  3GZ6 A;  1LVK A;  1TNS A;  2Y0S A;  3ISP A;  4YII A;  1QPI A;  4LIU A;  2EIN H;  1S72 I;  1LJ9 A;  1LEA A;  2HTJ A;  5LRR A;  2KDO A;  3GW2 A;  3ZN0 A;  1GV5 A;  2DK5 A;  3ZMU A;  3EQL F;  4HV6 A;  1XGM A;  1LPQ A;  2QQB A;  1XSV A;  1OCP A;  2R3S A;  2YS9 A;  3FXM A;  3MZ8 A;  2XSD C;  2ZSI B;  2PFB A;  1IW7 F;  1X3U A;  1X1B A;  1QU3 A;  3W3C A;  3EUK L;  5E3N A;  2XGC A;  3ZPL A;  3W2A A;  2HOT A;  2HOE A;  4Y33 A;  4C3H J;  1QA6 A;  5ERI A;  3H5A A;  1PYV A;  3WU0 A;  5HLH A;  4M3D A;  4RS8 A;  3DPT A;  4Y52 J;  3BTL A;  2Y9Y A;  3WE3 A;  3GME A;  1B72 A;  1P4A A;  1G2H A;  3OS0 A;  4IO9 F;  5F64 A;  3CCE I;  1SFU A;  4Y17 A;  2R5Z A;  1HC8 A;  2WTE A;  4ENK A;  3L2Q A;  3C7J A;  4XLA A;  1QRY A;  5HLG A;  5DCM B;  5FKO A;  1SEU A;  4KT6 A;  4B09 A;  1R22 A;  4S0H B;  2ECC A;  2CV1 A;  1OMI A;  1YYV A;  3MN2 A;  5CYV A;  1IDZ A;  2L7F P;  4FAS D;  2KZV A;  1IC8 A;  2H6C A;  4BJ5 C;  4D5F A;  3O8H A;  1PJR A;  5DM7 F;  1Y39 A;  2Y2Z A;  4C3J J;  3Q9S A;  1YE9 A;  3TED A;  3D0S A;  3KP4 A;  2CS3 A;  5H2F C;  2EIK H;  1HCR A;  4J01 A;  1RUN A;  1NK2 P;  1T08 B;  3BG9 A;  2E7X A;  2EQR A;  3K1N A;  2CGP A;  3JSP A;  2BY0 A;  3LSH A;  2XAH A;  1ZRC A;  4KN7 X;  1WRJ A;  1V3F A;  1R6R A;  2M30 A;  1E3P A;  2NVY J;  3BJA A;  3I59 A;  4G7H F;  2OV7 A;  4YFK F;  1MH3 A;  3K7A J;  3OOP A;  4RAF A;  1OCR H;  1E2X A;  3L00 A;  3T0Y A;  2H8R A;  5A2Q Z;  1BJA A;  1RPW A;  4E7K A;  3VWB A;  2OC6 A;  1WWX A;  2B0L A;  5CPR B;  2EIM H;  4PFO A;  1IXR C;  4XN3 A;  1K83 J;  2W24 A;  3C2H A;  4IJA A;  1DP7 P;  4BH9 A;  4F3Q A;  1YX3 A;  4U87 A;  3OYF A;  3D1N I;  3ML6 A;  1WJB A;  4E7L A;  5ILS A;  5HDK A;  2XRO A;  4LFU A;  3CCR I;  2KKO A;  1YFH A;  4CH7 A;  1I1S A;  4M3B A;  2GWR A;  2L3D A;  3JRA A;  3QU3 A;  4L5E A;  3BR0 A;  2M1B A;  5J47 A;  1K4T A;  1S5L C;  3MKL A;  2RDP A;  2IBD A;  1RUO A;  2IRF G;  2P7C B;  3ERM A;  2XC7 A;  3CCQ I;  3C1D A;  2IAI A;  2O3F A;  3IH2 A;  3MEX A;  3J81 K;  1R9T J;  2KT0 A;  4DBR A;  1BL0 A;  2DA5 A;  4L5I A;  4P55 A;  5E1W A;  1Y8R B;  3OYL A;  3OYJ A;  1J5Y A;  4MFE A;  1IRZ A;  4G8X A;  2VXD A;  3HBL A;  2OPT A;  1MGT A;  3CCL I;  3NQO A;  2CRG A;  4RB3 C;  1QO0 D;  3DFG A;  5C3E J;  2NVQ J;  2XF5 A;  3BR1 A;  3I5U A;  2IGM A;  4V19 K;  3BP8 A;  1S9H A;  3RKQ A;  1FIP A;  1XMX A;  2CG4 A;  2ECB A;  2Z99 A;  3D5R C;  3TDZ C;  4M9S A;  5L3B A;  4HF0 A;  1K6Y A;  5EYR A;  4FIS A;  3G1O A;  3P5J A;  2ME6 A;  1UG0 A;  4DQ2 A;  2HVQ A;  3CUQ B;  3CDH A;  1R7J A;  3M07 A;  1ENH A;  3M4O J;  4PUS A;  5LHI A;  2V1D A;  3CDL A;  2DMQ A;  3AG1 H;  2A5Y B;  2MD5 A;  2LY9 A;  1P92 A;  3P9I A;  2JJ7 A;  5IP7 J;  2CW0 F;  4N4O B;  3TQN A;  4ZYE A;  4NQW A;  4YFX F;  2QSH X;  1V54 H;  2HKO A;  3BCA A;  1GLN A;  4XKV A;  1H88 C;  3J81 Z;  4RM2 A;  4L9N A;  2HZT A;  4QSH A;  1Z67 A;  1IN4 A;  1JGG A;  1TBX A;  3SZT A;  3Q5F A;  3BC8 A;  2L4A A;  4A5M A;  3CMY A;  3CJT B;  2KRH A;  1TQI A;  4RGR A;  3OYC A;  3H35 A;  1W7P B;  3IL2 A;  1Z7U A;  2JA7 J;  4EJU A;  2IA1 A;  3E7L A;  2JMW A;  3FF5 A;  3T8R A;  1H9G A;  4ZYH A;  5EG0 B;  3BJO A;  1SMY F;  5EZG A;  3CC7 I;  1FX7 A;  3K4L A;  4L5J A;  1JT6 A;  3K2A A;  4KIF A;  1P9Q C;  4A3D J;  3WTW C;  4N9I A;  4XMY A;  1YG2 A;  2LVS A;  2AS5 F;  3EUA A;  2GXB A;  1JHH A;  5ICG A;  1U9O A;  2VC0 A;  3S3N A;  3HOS A;  2H6B A;  3W6K B;  1PUF A;  4BDY A;  2R5Y B;  4ENM A;  3WU1 B;  5FKK A;  3Q9V A;  1YJN I;  3CDI A;  3EUH A;  1DUX C;  3S8P A;  4D1Q A;  3W2V A;  3NRV A;  1XS9 A;  3TO9 A;  3W2W A;  3I4N J;  3HHG A;  3HGY A;  5BPI A;  2TCT A;  2V7F A;  4GYG A;  2CQ7 A;  3WOD F;  1NK3 P;  3FXU A;  4BAY A;  2ETH A;  4UB8 C;  4NUB A;  2BVM A;  2XV4 S;  2ZME C;  3DEW A;  4F52 A;  4UUS B;  3J7Y J;  2DOF A;  4A3L J;  2DOE A;  3VYU B;  2ID6 A;  5KCM A;  4A3J J;  2FOK A;  3QP6 A;  3AL0 B;  2NS0 A;  2HNH A;  1YI2 I;  3JW4 A;  2MLG A;  2MC4 A;  2LY1 A;  2OCE A;  2VJI A;  4L9T A;  2MD0 A;  4QLC U;  3R6S A;  2MAB A;  3NAR A;  5FGM A;  4BY7 J;  4F55 A;  1T6S A;  3JAM Z;  5DYM A;  3PIO F;  3GLX A;  1BI1 A;  5B5E C;  4JP0 A;  2M8G X;  2ACJ A;  3K69 A;  2VOP A;  2CQN A;  1KU7 A;  2J5O A;  3V4G A;  2ZJQ F;  4XKC A;  4ENN A;  1FSH A;  2QLZ A;  5J8C A;  2DW4 A;  2HYJ A;  2DOA A;  2VON A;  1ZEL A;  2KHM A;  3P9K A;  3M8E A;  4FHT A;  3RKX A;  3I56 I;  4I76 A;  1B6A A;  4S05 A;  4IHS A;  3FMQ A;  1WJA A;  5E3M A;  3P9C A;  1VQ8 I;  1TWC J;  1S8N A;  2Y30 A;  3N4M A;  4OU0 A;  1J0R A;  3GZN B;  2WV1 A;  1E3H A;  1Z21 A;  4M72 A;  1Q1H A;  5ICC A;  2BW3 A;  1TQP A;  1YS7 A;  4BQQ A;  3PNY A;  3GLL A;  4D7N A;  2OBP A;  3DBH B;  1Z3X A;  4EM0 B;  5CJ9 A;  1R36 A;  4B47 A;  3ABL H;  3DQV C;  3FKJ A;  2R7O A;  4DYQ A;  2VJ4 A;  3H9G A;  4XR6 A;  1ZLK A;  1IG7 A;  1Z0X A;  2ZBK A;  1T38 A;  3GTG J;  4DYR A;  1BOA A;  5HNF A;  3DTK A;  2QUF A;  2R7R A;  5K7Z A;  1TTY A;  3S93 A;  3IAM 2;  4AYB N;  3L2R A;  5IT3 A;  3VOD A;  3DPU A;  4BHC A;  3ZQQ A;  1P4X A;  1QZY A;  4L9V A;  1YJW I;  2YPR A;  4LB5 A;  4KN4 X;  1YJ9 I;  4XNF A;  4KT5 C;  4GDF A;  1JTX A;  1DGR M;  5LHH A;  3T8T A;  2XHK A;  3MWM A;  1O57 A;  4S04 A;  4RGX A;  1Z7L A;  2GQQ A;  5D5W B;  2EFQ A;  2EZL A;  5L3E A;  2HTS A;  1U3E M;  1VQ5 I;  1J75 A;  2O7O A;  5LGU A;  3FK6 A;  5K5Q A;  2LYC A;  3L2C A;  2EPF A;  2K02 A;  1CGP A;  2IS1 A;  3DBR B;  4RB1 A;  2EBI A;  5F0F A;  3QRF F;  1FIA A;  2VKD A;  5J6X A;  3I58 A;  2V9K A;  4BXU A;  4LG3 A;  2LDU A;  2WAQ N;  4ZZD A;  1CF7 B;  2IA2 A;  2L9N A;  1J7K A;  5LBQ A;  4FET A;  3H5N A;  3E6D A;  5D5U B;  3CCY A;  1Y1V J;  3HIF A;  1KON A;  4C3I J;  2FQ3 A;  5KVR A;  3TGN A;  4A3M J;  4U0Y A;  4U0V A;  2E60 A;  1LKX A;  2P4W A;  1D5V A;  1LVA A;  1TT0 A;  3I9V 2;  3L2W A;  4CYC A;  2DMP A;  3ELK A;  1TW2 A;  5IOZ A;  2QSF X;  1RR8 C;  1BBY A;  2ZNZ A;  2X1E A;  4D7M A;  3I64 A;  4DYC A;  5LGN A;  5E8I A;  1YIO A;  2P81 A;  3HZJ A;  5BPD A;  2LRD A;  5CVV A;  1F5T A;  1MSE C;  1N25 A;  4XOP A;  2HEO A;  1I39 A;  1USS A;  4A3F J;  1VZ0 A;  2KIM A;  1NTC A;  1FWZ A;  1R1U A;  1WJC A;  4BE0 A;  1XTA A;  1MJB A;  3LAP A;  2YU9 J;  3E1S A;  2DT6 A;  2EZH A;  2K3F A;  4XON A;  4DNC A;  1A31 A;  2DQL A;  1R4M B;  3QU6 A;  2K9N A;  2MGQ A;  2XAG A;  1JHF A;  5HLI A;  3V7C A;  1ACI A;  4HSR A;  2CJJ A;  2CU7 A;  2BHY A;  1IXS B;  2EA4 A;  1JKQ C;  1DGW Y;  1JXS A;  2COM A;  1V5G A;  2V4J C;  4CCK A;  1SAX A;  2V1X A;  2YR2 A;  2CH0 A;  1E17 A;  3PJR A;  5F6F A;  4ASN A;  4IX7 A;  4HYE A;  2LSO A;  4MNU A;  2HOS A;  3ECO A;  3HSR A;  2FRH A;  2I10 A;  2JN6 A;  1OCO H;  1ZAO A;  4OAZ A;  5HLT A;  3AFH A;  3AAF A;  1J09 A;  4LG0 A;  1T33 A;  2JQ7 A;  2W4S A;  2DT7 B;  3K70 D;  4HNT A;  4DZP A;  2DTR A;  3FKI J;  1FYK A;  3UNG C;  2B7E A;  4PFP A;  5K7H A;  3SEZ A;  4IHV A;  4FX4 A;  3CO7 C;  4U0W A;  3LSR A;  2FU4 A;  2IJL A;  2MW8 A;  1FOK A;  3KCC A;  5DD4 A;  4CZC A;  2R7S A;  1VQ4 I;  5FB2 A;  1VQN I;  2L9R A;  2P5K A;  4FCY A;  4M6V A;  1FSE A;  1VF9 A;  2AO9 A;  3I53 A;  3HKZ N;  3ZQH A;  1U2W A;  2IT0 A;  4BNC A;  2XGE A;  3J7A O;  1ETW A;  4QPQ A;  2XDV A;  4ITV A;  1W5C C;  3FXL A;  2ME0 A;  2BEO A;  2MFZ A;  1BM9 A;  4XK4 A;  4BEH B;  1MNM C;  4CDG A;  2KJC A;  3EET A;  4PJN A;  1BIA A;  4EAT A;  3I0T A;  3CCJ I;  2M7B A;  4R79 A;  3M7G A;  2ESN A;  2A6E F;  2AQE A;  1SFE A;  2PMZ N;  1TT5 B;  1SVL A;  4DZJ A;  2MSY A;  3OY9 A;  1AHD P;  4HV5 A;  2PJR B;  4PZJ A;  2Q0O A;  3RYR A;  1V4R A;  1BR2 A;  1LEB A;  3CQZ J;  3QP5 A;  4BKX A;  1MBH A;  4LJZ F;  2E35 A;  2Y0M A;  1D8K A;  2E1O A;  5E1X A;  2QCO A;  4B3X A;  3FZV A;  4ZJZ A;  3OIO A;  2VBY A;  4WCG A;  3IAS 2;  2NS8 A;  2WA0 A;  4PJ0 C;  3ERE D;  5HS9 A;  3JTG A;  1YX5 A;  3RZD J;  3OMY A;  3RPQ A;  3EPZ A;  1MJ9 A;  4JX5 A;  4BBS J;  1MBG A;  1XGO A;  2CO5 A;  4E7Z A;  4B48 A;  1P6R A;  4JQF A;  2DLL A;  3I4M J;  2MA3 A;  4BDZ A;  1X3W B;  1S7E A;  4LOC A;  2HI3 A;  2QBY A;  1IV6 A;  3RQI A;  2EFN A;  1G8X A;  2EWN A;  2X6O A;  3WHB A;  4A0X A;  1BW5 A;  3F8N A;  3PUF A;  3E0J B;  3LQQ A;  4M74 A;  3LFK A;  3S2W A;  4V2F A;  3CJQ B;  2W7N A;  3H3Z A;  4NBQ A;  1MW7 A;  1WPK A;  3CES A;  4JK1 X;  4HDU A;  3ZCO A;  2L7Z A;  1HDP A;  2W82 A;  2WC2 A;  5FRM A;  2R7V A;  1A6I A;  1OCZ H;  2M34 A;  5M5Y J;  3RIR A;  5E17 F;  1OFC X;  4JOM A;  1BJZ A;  2JTV A;  2L02 A;  2NYX A;  1IAW A;  4N0B A;  2HYF A;  4BQN A;  4BU2 A;  3L1P A;  1VND A;  3S17 J;  3M1E A;  3V7R A;  1MJA A;  3BPV A;  4XLF A;  4XQF A;  5FRN A;  3FMR A;  1ON1 A;  2ZJP F;  3A1Y A;  2QQ8 A;  3MZH A;  1X19 A;  2JPB A;  4G12 A;  3VYS B;  4DBQ A;  2OF7 A;  3LA3 A;  2LBF A;  1EV7 A;  3PQJ A;  3KE2 A;  3FXJ A;  3SQN A;  3OWT A;  4EVI A;  2I8D A;  3HRS A;  5J8F A;  1BN5 A;  2E7W A;  2H09 A;  3HGG A;  2LNB A;  2QWW A;  5J40 A;  2D5V A;  3S16 J;  3CZ6 A;  2X0L A;  3WTY C;  1KU9 A;  4XN0 A;  1OR7 C;  2OD5 A;  3QYF A;  3BWG A;  1YQA A;  1UAA A;  1HST A;  2ESH A;  1HW5 A;  2HQN A;  1ETY A;  2EV6 A;  3KEO A;  3QOE A;  4LK0 F;  3ZQI A;  5D4S A;  3LSP A;  2D1V A;  3ZR8 X;  5EEG A;  1E0E A;  2LRE A;  4PJJ A;  1IO2 A;  3TOA A;  2Y0S N;  1P2F A;  2HYG D;  1OKR A;  1ZG3 A;  1U8B A;  1A6Q A;  3EYI A;  1U5T B;  2OQG A;  4IRG A;  4HST A;  4YEJ A;  3SZP A;  3GTM J;  1T8I A;  4BHB A;  1VQ6 I;  3PNT A;  4MHG A;  2JPC A;  4BYY A;  4C9Y A;  1T0F A;  2P5V A;  3FDY A;  1F36 A;  2OA4 A;  5FD6 A;  1SAN A;  2BXY A;  1REP C;  3K1M A;  1YRN B;  3L2V A;  2N8G A;  3ECH A;  4Y4R A;  3F23 A;  3O8G A;  2F5D A;  1TNT A;  3CCV I;  1LFU P;  1LUJ B;  2EV5 A;  1WI9 A;  2K86 A;  4AD9 A;  2EZK A;  1FZP B;  4X6A J;  3QPT A;  2VOO A;  2KLO A;  5CKT A;  1JKR C;  4XRF A;  3QWL A;  4G94 A;  2HVR A;  3OSG A;  3WHC A;  4BQA A;  3GYH X;  1F4K A;  3CMA I;  4HDV A;  1MMD A;  1SD4 A;  2H1L A;  2F4O B;  3K9T A;  5AIQ A;  1ZR4 A;  1S7A A;  1UMQ A;  1FTT A;  2E2I J;  4CCN A;  3VOE A;  2XAF A;  2VJJ A;  1IUF A;  1HW1 A;  1ZLJ A;  2ZXW H;  3BG7 A;  4UVC A;  5LRS A;  2Q2E B;  5EGO B;  1UEL B;  3CC2 I;  1WVR A;  2NS7 A;  2M7A A;  2XUB A;  2ZSH B;  1MNE A;  1J2X A;  2Z2S B;  1STZ A;  1OYW A;  1O3R A;  3GXO A;  2NVT J;  2BY3 A;  2WV0 A;  2E1M C;  4IZZ A;  2MH2 A;  3BRO A;  2HQ5 A;  3OYA A;  3U2R A;  5E18 F;  1ZTR A;  4CXF A;  3I55 I;  2EFP A;  5F1J A;  1YTY A;  2W25 A;  4EMS A;  1ZHF A;  4ZYD A;  2DO7 A;  4B8X A;  1W5T A;  4UVA A;  2ICW G;  1ODD A;  3G73 A;  2X9D A;  4DOZ A;  4J00 A;  4N9H A;  1K78 B;  1HF0 A;  2O61 A;  3DLL F;  2K9M A;  3HSF A;  5FFX A;  1FYL A;  5EG0 A;  4G7Z F;  1ON2 A;  2IP2 A;  3Q3S A;  2JT1 A;  3WG9 A;  3O6B B;  5HS8 A;  1JUP A;  3AG2 H;  4PGH A;  1ZAR A;  2ZXJ A;  3FXO A;  3LOC A;  2WB1 N;  1K61 A;  1JE8 A;  4OIO F;  2LLK A;  2PMH A;  1BC8 C;  2MBF A;  4LLL A;  5HNH A;  5CLS A;  4GRI A;  5KNL A;  4MGR A;  1WSU A;  1WFX A;  2CQK A;  1R5H A;  3IRR A;  1JT0 A;  4DIQ A;  1G4D A;  1M1E B;  5FKL A;  3ZOB A;  4IRH A;  3ULQ B;  4ESB A;  4IOA F;  4HOB A;  4BE2 A;  4FTH A;  4G7O F;  5DEQ A;  1FBQ A;  1X4P A;  5E1Z B;  2JVG A;  4I6Z A;  2L9S A;  1UHM A;  3S15 J;  1JKO C;  5AIP A;  4UUS A;  2QZ8 A;  1BW6 A;  2CQQ A;  3I3L A;  4EGZ A;  1LDJ A;  2OZ6 A;  4BBR J;  1AKH B;  3KLN A;  3GTO J;  2VBZ A;  2K40 A;  2ZC2 A;  3HEF A;  4NC7 A;  1T2K A;  2FBH A;  3OYB A;  4BGD A;  4LLG F;  1FBS A;  3PM1 A;  4LIT A;  5EEA A;  4KIS A;  1JJ8 C;  1BR1 A;  1B9M A;  1KYZ A;  4I0A A;  1IZ1 A;  3KZY A;  2ZCW A;  3E6M A;  4HLY A;  5ICF A;  2ZJR F;  2H1K A;  2DA1 A;  1HSJ A;  2F5E A;  3FX3 A;  1BI3 A;  2X6Y A;  2KIF A;  4UUT A;  5KHD A;  3QPL A;  3B02 A;  2R7U A;  3JRB A;  1D0Y A;  3HL2 A;  2P6T A;  2RN7 A;  3KP6 A;  2HDD A;  1HKT A;  1ULY A;  2ZXH A;  1W0U A;  4BJT A;  4RM3 A;  1G6N A;  1MZB A;  2GA1 A;  2ADU A;  4P96 A;  3C18 A;  1Y0U A;  2M45 A;  4XM3 A;  4A3I J;  4A3G J;  3FWE A;  2DYS H;  2JWT A;  1MMN A;  1HW2 A;  2R7W A;  3HC7 A;  2M8E A;  4Y3O A;  2ZJ2 A;  4WXC A;  5LLQ A;  3G2B A;  1AU7 A;  2FD5 A;  4XRS A;  2AXL A;  1AA7 A;  2DCE A;  2B63 J;  5CVI A;  2ELJ A;  4MLO A;  2VLA A;  4MIM A;  3WGG A;  4JX6 A;  2CSO A;  1DU6 A;  4QPO A;  5JHF A;  1C0W A;  5ILV A;  2XIG A;  1Z1D A;  3BTC A;  1Z6R A;  2UZK A;  4MEX F;  3NWT A;  2X85 A;  4PJM A;  3G6E I;  1G3W A;  3OR1 C;  1B72 B;  4OIQ F;  3PSF A;  1YOV B;  2IW5 A;  3GBG A;  3K70 C;  1DU0 A;  3LQR A;  1FNN A;  2OQR A;  4XLH A;  2L7M P;  4II2 A;  2R5Z B;  3BZ6 A;  4D9J A;  1RNL A;  1VQL I;  5GAE J;  2OTJ I;  4I2O A;  4P9F A;  2Q1Z B;  3UR3 C;  4YRV A;  4Q4Z F;  4OOI A;  2A68 F;  1FLI A;  3I54 A;  4GCV A;  4BJ6 C;  4XBF A;  4IQJ A;  1LDK B;  1BI0 A;  3K0L A;  1NG7 A;  4HRI A;  4QTR A;  2J5P A;  2Y31 A;  4XLN F;  3G1M A;  2RQP A;  2Z5U A;  2XRL A;  4CUG A;  3R60 A;  3PSI A;  1ZRE A;  2AXT C;  1T98 A;  1V5E A;  1W1W E;  1ETQ A;  2X51 A;  3GF2 A;  1JUM A;  3IP4 B;  3SJM A;  3L9F A;  3REO A;  2CQX A;  2R7X A;  3IH3 A;  5DUI A;  2E5N A;  3BG3 A;  5HDN A;  2QQA A;  2DMU A;  1D1C A;  4RAY A;  1D3Y A;  5CVU A;  2LMD A;  3E5X A;  4IKF A;  4KNY A;  1R4N B;  1CF7 A;  2AHQ A;  4EJT A;  2IEK A;  4RLQ A;  2KRC A;  2VKV A;  5EEH A;  4A6E A;  3I59 B;  3LL7 A;  3V7S A;  2L4M A;  4BUP A;  2Z9O A;  1QGP A;  3H5R A;  4G6T B;  4I7H A;  3D5L A;  2F5V A;  4Y15 A;  4YIF A;  3UKG A;  3MZY A;  4XOR A;  1QBJ A;  3OYE A;  3GTL J;  3COA C;  2EIJ H;  3LAJ A;  4D0P A;  3GTK J;  2V6C A;  3JRG A;  1DPR A;  3C3W A;  4Q5S F;  4LMY A;  2DA3 A;  3RI4 A;  1B8I A;  3PO2 J;  3BR5 A;  1LNW A;  1UB9 A;  5B66 C;  4L0Z B;  4FX0 A;  3MKW B;  1FOW A;  1SVO A;  2KP6 A;  4X0G A;  1WZ2 A;  2V1U A;  1KU2 A;  4UB6 C;  1K7A A;  3OYD A;  2ZME B;  1RC9 A;  1L0O C;  2XVC A;  2IA0 A;  5D5X B;  4MTD A;  4ZH4 F;  2VXZ A;  4RB0 A;  2H94 A;  2M2E A;  2P5L C;  4RMN A;  3I71 A;  4E4H A;  3S2D J;  1SVM A;  4LK1 F;  2GAU A;  1DDN A;  3HOW J;  1TZL A;  4UNO A;  1QZZ A;  2W57 A;  1WJE A;  4KA4 A;  3A01 A;  4RBO A;  2XPW A;  4ZDP A;  4LGW A;  2KFD A;  2BBY A;  3CC4 I;  1SFX A;  2WY7 Q;  3K4M A;  3SDB A;  2D1H A;  1TWA J;  2P8T A;  2Y75 A;  3HSE A;  1W0T A;  2IGK A;  1YIT I;  4E70 A;  5D6F A;  2JUC A;  2E2H J;  4YEL A;  4YFN F;  1N78 A;  3DKY A;  1CQT A;  2F6C A;  3K4J A;  2V1N A;  3BZK A;  3DLA A;  2VT2 A;  1H9T A;  2GZW A;  1EJ9 A;  2VPL A;  1I27 A;  3LWF A;  3DU5 A;  4AU7 A;  4EJV A;  2K9Q A;  2EB7 A;  3K1P A;  5D4R A;  3U21 A;  3RQ4 A;  1B1B A;  4P5O A;  4C2M J;  5L3D A;  5E79 C;  4NHJ A;  3RZO J;  3WTZ A;  5GPC A;  1A36 A;  4QIW N;  3V8J A;  2H27 A;  5K5R A;  4NQW B;  2WBM A;  3PIP F;  2EJR A;  3X2Q H;  1GVD A;  2O03 A;  5TRD A;  2F48 A;  4NDL A;  5CVR A;  4WWC A;  1XDU A;  3HDD A;  1QZE A;  4A0Y A;  3ZQC A;  1WJD A;  2E36 A;  4GXO A;  4GGG A;  5K1Y A;  1D1A A;  2FA5 A;  3QYE A;  1QQI A;  3HUG A;  3S32 A;  3QAH A;  3EUH C;  2HQA A;  2STT A;  4M9X A;  2MH9 A;  3IH4 A;  5F04 A;  3CME I;  2Z33 A;  4IQ4 A;  1S3J A;  3HHH A;  1B9N A;  5GAG J;  4OIR F;  3BJ6 A;  5K5O A;  4I0B A;  2JA8 J;  2KIS A;  3F8C A;  2XPV A;  3BQY A;  3ZMZ A;  4ESJ A;  4ANJ A;  1VFC A;  3K4B A;  2VBW A;  1MIJ A;  4AYB A;  2AQF A;  2ZFW A;  3B6C A;  5FKM A;  2LG4 A;  1I3Q J;  2M5W A;  2VQC A;  2PEX A;  1FTZ A;  3ONQ A;  1Y8Q B;  2DMT A;  5DV5 A;  1T95 A;  2K5C A;  3OIP A;  5E3L A;  4AIH A;  1GUU A;  1PUF B;  1PUE E;  3KP7 A;  4IPA A;  1G59 A;  3CMM A;  2OU2 A;  5JR3 A;  4O6J A;  1G3S A;  3VDX A;  4XLP F;  1VQM I;  3T1B A;  1J9I A;  3L09 A;  3PNV A;  1QHG A;  2BY2 A;  3A0B C;  1F43 A;  2DYR H;  2LOO A;  2FQ4 A;  4LD5 A;  3SHF A;  2QQ9 A;  5DTD A;  1UZC A;  2DU9 A;  3JR9 A;  3H3U A;  3K4K A;  3F6V A;  5FRO A;  2W00 A;  3ZMD A;  3OL4 A;  4IRI A;  3QPS A;  3MKZ A;  4F92 B;  1EH7 A;  4OAY A;  1O7L A;  1TW3 A;  2G7H A;  1Z77 A;  2LK2 A;  5JFR A;  3F8M A;  5GPA A;  3WE2 A;  3IWZ A;  2VN2 A;  5HDG A;  2F4I A;  3CP8 A;  1FC3 A;  1ITY A;  2PX9 A;  4H4K C;  4HNU A;  1D1B A;  3ABT A;  1Y1W J;  3MVP A;  2IS6 A;  3DWL E;  2A6T A;  1QVT A;  3S1Q J;  2F5C A;  3DEU A;  3U9G A;  5J1R A;  1MMS A;  5HOO A;  2EA2 A;  4CYD A;  3OYG A;  3ZQG A;  3IC7 A;  3NEU A;  3WTT C;  5EF6 A;  5IYB J;  2MYS A;  3K2Z A;  4HF2 A;  2R7F A;  1I3A A;  1H89 C;  3I4P A;  2DFH A;  2BV6 A;  1R5G A;  2DPU A;  2X1C A;  1WQ2 A;  3G3Z A;  4E7I A;  3LST A;  1IRF A;  4UHT A;  4HEA 2;  1Y6I A;  1SFO J;  3RCO A;  3GVA A;  5K7F A;  2ZXI A;  3B6A A;  4UXN A;  5BS6 A;  2KZG A;  2BW3 B;  1A04 A;  4LB6 B;  4IHY A;  1HQC A;  4UV8 A;  2HGC A;  2F4M B;  4JBA A;  3S1N J;  1ETX A;  2V9V A;  4EJW A;  2VC1 A;  2JA5 J;  2FEZ A;  2EV0 A;  2KPM A;  3TBI A;  3TW7 A;  2XGX A;  4AVZ A;  1FPQ A;  1RET A;  3BQZ A;  3RTR A;  1U9N A;  3ROU A;  3TW6 A;  1Z91 A;  4XSZ F;  3JRH A;  3S3M A;  1U5T A;  2LP0 A;  1X2N A;  2FNA A;  3OL3 A;  4HNV A;  5TGT A;  2L9V A;  5F0C A;  2IVM A;  4F91 B;  2FML A;  3L2U A;  1KU3 A;  2JRM A;  2VT3 A;  2B9S A;  3VYR B;  3HJE A;  2HQR A;  3LMM A;  5LEJ A;  3VFZ A;  3IUO A;  2JSP A;  2R7D A;  2C6Y A;  4A69 C;  4B43 A;  1Z6T A;  2W48 A;  5B3S H;  2K4B A;  3DP7 A;  4YIR X;  3FM3 A;  4XIC A;  3IV5 A;  4ZTJ A;  3HXL A;  2V6E A;  5CVJ A;  4UVB A;  5FD5 A;  3FMS A;  4WXH A;  3TMO A;  3VSL A;  2JVH A;  4AUX A;  4EEF G;  3SDG A;  3WU2 C;  1HLV A;  1X1C A;  5TIS C;  1ZGA A;  1OLT A;  1EF4 A;  2CUJ A;  3BR6 A;  5IP6 A;  1YIJ I;  3HRU A;  1T56 A;  2DAO A;  1QNT A;  1VQ7 I;  1JUS A;  3HKZ A;  1XX5 A;  1ONV A;  3A4C A;  3WG7 H;  4GO1 A;  1K6O A;  1VQO I;  4C2T A;  2EFO A;  3ZMV A;  2RVC A;  1RR7 A;  3MKY B;  2STW A;  4IVN A;  4I99 C;  3CF2 A;  5CQE A;  3KYL A;  3F9K A;  4IEJ A;  3PL8 A;  5E3O A;  1PVE A;  4CZZ A;  4CCL A;  2VQL A;  4ZYA A;  2BVL A;  3DXJ F;  1SD7 A;  3BOQ A;  4Y7N J;  5EGO A;  4XLE A;  2LR8 A;  2IS2 A;  2EIL H;  2JSC A;  3G4S I;  1EKE A;  1MMG A;  1QHH D;  4FE4 A;  4Y13 A;  2PMZ A;  4F7Z A;  3H3V K;  2DDB A;  1WI3 A;  3AG4 H;  4G9Y A;  3ASO H;  3Q0V A;  4EJO A;  3WGI A;  1DQU A;  3CD6 I;  2NVU B;  2K85 A;  4A3E J;  1POG A;  5FKN A;  5DCM A;  4CIC A;  2LD5 A;  3PO3 J;  1WHU A;  4NC6 A;  1TL8 A;  1PP8 F;  1WKM A;  3F22 A;  5DM6 F;  2GOM A;  4R1H A;  3KYD B;  2CFO A;  2HDC A;  2WAE A;  1RZ4 A;  2JZY A;  5BQT A;  1UJ8 A;  1NH3 A;  1D5Y A;  4HZF A;  1FY7 A;  2F2E A;  3EDP A;  5DUK A;  4KFC A;  2Y69 H;  3FK7 A;  3DBL B;  3HOU J;  4Z2Y A;  3GFL A;  3BY6 A;  2K9L A;  2M87 A;  1H8A C;  2GA2 A;  4U7B A;  3KPH A;  1UG2 A;  1SD5 A;  2XKP A;  3HRM A;  1WJ5 A;  1MBJ A;  3KFW X;  1S29 A;  1PP7 U;  4BE1 A;  4CSW A;  1BA5 A;  4L9J A;  2HPI A;  1YLF A;  1Z9C A;  5F1R A;  1S6L A;  2YSR A;  1KYW A;  4XID A;  1JJ6 C;  4HQM A;  4ZDL A;  3CLO A;  5LD2 C;  1X4O A;  3KLO A;  2VE8 A;  3E6B A;  1MKM A;  4MTE A;  5GAD J;  1IV8 A;  2FJ1 A;  4TV7 A;  5BNG A;  4FQG A;  1E3O C;  3OYI A;  2UV1 A;  3MAJ A;  2VKH A;  2VI6 A;  5E8G A;  4LG0 B;  4AWX B;  4PSX A;  3R61 A;  1XCB A;  2DJN A;  4GYI A;  3GTP J;  2BOL A;  2O0Y A;  5BMZ A;  3SXY A;  3RDI A;  5FJ8 J;  3H0D A;  4IOC F;  1GVJ A;  2JRT A;  1U0J A;  2KDZ A;  3LNQ A;  1GXP A;  1BIB A;  3QOP A;  4U88 A;  2A61 A;  4MFD A;  3E97 A;  5AON A;  5JHU A;  3CP2 A;  3CCM I;  5GP9 A;  2RNJ A;  4A3K J;  1EA3 A;  2FBK A;  2HPM A;  4PK4 A;  1VQK I;  1SD6 A;  1OPC A;  2A05 A;  3F8B A;  3LSK A;  1IUY A;  1HA8 A;  1XG1 A;  2OJE D;  1RKW A;  1WCM J;  1ERD A;  3VEP A;  3OIQ A;  4XKB A;  3SYT A;  3JRI A;  1MDM B;  3ESW B;  1V5F A;  1BI2 A;  1K79 A;  1XPX A;  2XB5 A;  3OYK A;  1ZRD A;  1R71 A;  2K7L A;  3CUQ A;  3FBI B;  1F1Z A;  1XSD A;  3HTU A;  1JKP C;  3GWZ A;  4KJZ A;  4CCJ A;  2LF7 A;  4K2E A;  2RRE A;  5EDN A;  2A69 F;  3V8K A;  3HTS B;  4IHW A;  4HW0 A;  4F93 B;  2QYO A;  5L3C A;  1FYM A;  4BXF A;  1XSX A;  1X58 A;  2FBI A;  1APL C;  4B3A A;  2BE5 F;  1D0Z A;  5IOY A;  3CCS I;  3DKW A;  5H6R A;  4H0E A;  1W5S A;  2DN0 A;  3CF5 F;  4M3E A;  3KEQ A;  3RPU A;  2EFW A;  3ZP5 A;  1GHC A;  2VUM J;  2ZNY A;  3IKT A;  3HRT A;  3ZQ7 A;  1LE8 B;  3CJN A;  4B1R A;  2DTZ A;  4RGU A;  2RNG A;  3FM5 A;  2NNN A;  2LKS A;  5DCF A;  3MD2 A;  1W7P A;  2QBY B;  1X1P A;  1EH8 A;  3ABK H;  2VJ5 A;  3H1C A;  3K6G A;  5CQG A;  1OYY A;  4BY1 J;  1UST A;  3CCU I;  2F5F A;  3QQA A;  2PMU A;  5A2Q K;  2PN6 A;  1XDS A;  2RQQ A;  2FNP A;  1TLH B;  5D8K B;  2E19 A;  4Q48 A;  2E1M B;  3D5S C;  2GXG A;  2NOG A;  3RKW A;  1TP4 A;  1LFP A;  2LKP A;  4OWR B;  1OIS A;  2HDW A;  1RI7 A;  2KQR A;  1ZG5 A;  1OCC H;  2DDA A;  2K3P A;  2R5Y A;  2PI0 A;  4EV0 A;  1ZRF A;  4RLF A;  2NNY A;  1ZGW A;  3FXR A;  2D45 A;  1DP3 A;  2HR3 A;  4II3 A;  1FOY A;  4ZTF A;  2DK8 A;  2GLO A;  5C44 J;  4M9Z A;  2PLY A;  3AG3 H;  4FE7 A;  1X3Z B;  1VTN C;  1FJL A;  5M3M J;  1XCV A;  4AC0 A;  1N77 A;  1MND A;  4HA8 A;  3W6J B;  1R58 A;  1V55 H;  2JA2 A;  2LBF B;  2O8K A;  2RGV A;  2L54 A;  4ZZL A;  2NOJ B;  1GDT A;  3KET A;  4WF2 A;  2R92 J;  5HVQ C;  2BGC A;  1TQM A;  5F08 A;  2EH3 A;  1T0F C;  3BTJ A;  2Y9Z A;  4I98 B;  1JGS A;  2M4K A;  1UFM A;  4HX7 A;  3V8L A;  4ON0 A;  1KZH A;  1XD7 A;  4GFB A;  4PDK A;  2WB1 A;  1K4S A;  4UY8 I;  2XF7 A;  4PSW A;  1WH5 A;  4QWQ A;  1ZG1 A;  2GXA A;  3RJP A;  1HXD A;  3O2P E;  5C4J J;  3VYT B;  1YW7 A;  4IHX A;  3GTJ J;  1KGS A;  4XKW A;  1R49 A;  4P9U A;  1IN6 A;  3FBN B;  3WTX C;  4EQQ A;  1QPM A;  1D8J A;  4I01 A;  1UCR A;  3P7N A;  4A3B J;  2M4G A;  2VKE A;  3IHU A;  3LFU A;  2ZME A;  4I09 A;  3CUQ C;  4ESF A;  4UUV A;  3C2G A;  3OSF A;  2DMN A;  1ZR2 A;  4KIB A;  1FT9 A; 
#chains in the Genus database with same CATH homology
 3LSR A;  1I6H J;  1TWA J;  5FLV A;  3W6V A;  1W0T A;  2MW8 A;  1TC3 C;  3BTI A;  2E2H J;  2L9R A;  2CUF A;  2DA6 A;  4FCY A;  1U78 A;  1CQT A;  4A93 J;  4M6V A;  1VF9 A;  2AO9 A;  2HXO A;  3HKZ N;  2HXI A;  2K9Q A;  3ZQH A;  2EZI A;  2DA7 A;  2XGE A;  1ETW A;  1IGN A;  2DA4 A;  4C2M J;  2XGD A;  3H0G J;  3RZO J;  5GPC A;  2ME0 A;  5IPA A;  4QIW N;  4XK4 A;  1QPI A;  1MNM C;  5EZH A;  3HOZ J;  4ABZ A;  2JK3 A;  1GV5 A;  5JLX A;  1GVD A;  1RKT A;  4NDL A;  3HDD A;  2PMZ N;  5C4X J;  1OCP A;  3ZQC A;  2YS9 A;  2XSD C;  4DZJ A;  2MSY A;  2R7Z J;  1AHD P;  1TWF J;  1MSF C;  5E3N A;  5F04 A;  2XGC A;  3IH4 A;  2HOT A;  3CQZ J;  4BKX A;  4C3H J;  1MBH A;  2E1O A;  2QCO A;  2NS8 A;  4M3D A;  2JA8 J;  4Y52 J;  3BTL A;  2Y9Y A;  1B72 A;  4BXX J;  1G2H A;  2XPV A;  3BQY A;  3JRE A;  3RZD J;  5F27 A;  1VFC A;  4JX5 A;  4BBS J;  1MBG A;  2R5Z A;  4RDU A;  3B6C A;  5FKM A;  4M3F A;  1I3Q J;  1QRY A;  4DW6 A;  3I4M J;  1FTZ A;  5FKO A;  2DMT A;  1S7E A;  5E3L A;  4LOC A;  2HI3 A;  1GUU A;  1O4X A;  1PUF B;  1IV6 A;  3RQI A;  4S0H B;  2ECC A;  2X6O A;  3WHB A;  3MN2 A;  1IDZ A;  2L7F P;  1QVU A;  1IC8 A;  4D5F A;  3O8H A;  2QF7 A;  4V2F A;  1F43 A;  2Y2Z A;  4C3J J;  2FQ4 A;  3TED A;  1WPK A;  5DTD A;  3JRF A;  1HCR A;  3JR9 A;  1NK2 P;  2FX0 A;  2L7Z A;  1HDP A;  3BG9 A;  2EQR A;  5F0H A;  1A6I A;  3LSJ A;  2M34 A;  5M5Y J;  3QPS A;  1OFC X;  1BJZ A;  1Z77 A;  3L1P A;  1VND A;  2LK2 A;  3S17 J;  5GPA A;  2NVY J;  2ID3 A;  1MH3 A;  3K7A J;  4G12 A;  4XRS G;  2OF7 A;  1ITY A;  2H8R A;  1RPW A;  1Y1W J;  3MVP A;  3LSG A;  1QVT A;  3S1Q J;  5J1R A;  1K83 J;  2HOA A;  5M3F J;  3D1N I;  3ZQG A;  3HGG A;  2XB0 X;  5EF6 A;  1TWG J;  2D5V A;  5IYB J;  3S16 J;  3HOX J;  1MH4 A;  1MBE A;  4M3B A;  3JRA A;  4L5E A;  1H89 C;  3BR0 A;  1ZQ3 P;  3MKL A;  1ETY A;  2IBD A;  3ZQI A;  1RES A;  2M9H A;  3LSP A;  1SFO J;  2IAI A;  2VPR A;  3B6A A;  3IH2 A;  5K7F A;  1R9T J;  2KT0 A;  1BL0 A;  2DA5 A;  2Y0S N;  5J3L A;  4MFE A;  4IHY A;  1U8B A;  1IRZ A;  3A03 A;  3HBL A;  2OPT A;  3S1N J;  1ETX A;  3GTM J;  2CRG A;  2JA5 J;  3ZQF A;  5C3E J;  2NVQ J;  3TW7 A;  3JRD A;  3BR1 A;  1RET A;  3RKQ A;  1FIP A;  2ECB A;  5JLW A;  1F36 A;  3BQZ A;  1U9N A;  1SAN A;  3TW6 A;  4XRM A;  2RAE A;  5EYR A;  4FIS A;  3G1O A;  1YRN B;  3S1M J;  3JRH A;  2ME6 A;  1MBK A;  2LP0 A;  1JTY A;  2N8G A;  1X2N A;  3O8G A;  4HNV A;  1ENH A;  1LFU P;  3M4O J;  3CDL A;  2R0Q C;  4W1U A;  5F0C A;  3TP0 A;  2DMQ A;  3JRC A;  2EZK A;  2LY9 A;  2DA2 A;  4X6A J;  1HDD C;  4A69 C;  2JJ7 A;  2W48 A;  1JKR C;  3IV5 A;  5IP7 J;  4XIC A;  3OSG A;  3S2H J;  3Q0W A;  4AUX A;  4EEF G;  3WHC A;  1HLV A;  3SDG A;  1EF4 A;  1ZR4 A;  1H88 C;  3BR6 A;  1UMQ A;  5IP6 A;  1FTT A;  2E2I J;  3G1L A;  1T56 A;  2E2J J;  4QSH A;  1IUF A;  1JUS A;  1JGG A;  1HOM A;  5EGO B;  2NS7 A;  1VI0 A;  1RR7 A;  2YUS A;  3CMY A;  4IEJ A;  2NVT J;  2ZB9 A;  1X2M A;  3GTQ J;  5E3O A;  1A5J A;  2HQ5 A;  2JA7 J;  3E7L A;  1ZTR A;  2JMW A;  3SFI A;  4Y7N J;  5EGO A;  2LR8 A;  3FIW A;  5EG0 B;  3FIS A;  5F1J A;  4FE4 A;  5EZG A;  3BG5 A;  3H3V K;  1JT6 A;  3K2A A;  1WI3 A;  4A3D J;  3Q0V A;  2X9D A;  1XC5 A;  2LVS A;  1HF0 A;  2CUE A;  4A3E J;  1POG A;  5FKN A;  1U9O A;  2LD5 A;  3PO3 J;  5EG0 A;  1PUF A;  3Q3S A;  2R5Y B;  3DCF A;  5FKK A;  1JUP A;  3A02 A;  2L0K A;  1XS9 A;  3LOC A;  2WB1 N;  1K61 A;  3I4N J;  3HGY A;  2LLK A;  2TCT A;  1D5Y A;  1TWH J;  1FEX A;  1NK3 P;  3FK7 A;  3HOU J;  1JT0 A;  3DEW A;  1H8A C;  5FKL A;  3ZOB A;  5FLM J;  4UUS B;  4A3L J;  1UG2 A;  1MBJ A;  2ID6 A;  1IDY A;  1BA5 A;  1WGX A;  1B8I B;  4FTH A;  2COB A;  4A3J J;  3S1R J;  1UHS A;  3HB9 A;  1JJ6 C;  5IYD J;  4XID A;  4I6Z A;  3S15 J;  1JKO C;  4UUS A;  4M3G A;  4A3C J;  1BW6 A;  2XPU A;  2CQQ A;  2FJ1 A;  3NAR A;  5BNG A;  4J19 A;  4BY7 J;  1E3O C;  4BBR J;  1AKH B;  3GTO J;  2K40 A;  2VI6 A;  3HEF A;  3BR3 A;  3PM1 A;  5EEA A;  3ZQL A;  4JP0 A;  1P7I A;  2M8G X;  1JJ8 C;  2DJN A;  3GTP J;  2H1K A;  1OCT C;  3A01 B;  2DA1 A;  5FJ8 J;  2HYJ A;  4UUT A;  2LFB A;  3QPL A;  2KDZ A;  3LNQ A;  2GM4 A;  1ZK8 A;  3JRB A;  4I76 A;  5E3M A;  1TWC J;  4MFD A;  4B4C A;  2Y30 A;  2HDD A;  5GP9 A;  1LFB A;  1W0U A;  2WV1 A;  4A3K J;  1ORK A;  4X1E A;  4D7N A;  1XG1 A;  4A3I J;  4A3G J;  1ETV A;  1MBF A;  1RKW A;  1WCM J;  4V2G A;  1WH7 A;  2JWT A;  3JRI A;  2LKX A;  2JA6 J;  4DYQ A;  2XB5 A;  1IG7 A;  1Z0X A;  1YRN A;  1AU7 A;  3GTG J;  2FD5 A;  4DYR A;  4XRS A;  5K7Z A;  2B63 J;  3HM5 A;  3HOY J;  4MLO A;  4AYB N;  4MIM A;  5DS9 A;  1JKP C;  4JX6 A;  1DU6 A;  5EDN A;  3BR2 A;  3TP3 A;  4IHW A;  3S14 J;  4W97 A;  2TRT A;  3BTC A;  1JTX A;  1X58 A;  2GBY A;  1APL C;  1Q1V A;  4B3A A;  5IOY A;  5HOD A;  1B72 B;  1DU0 A;  3GBG A;  3HOV J;  2DN0 A;  4M3E A;  2MG4 A;  2L7M P;  2R5Z B;  3F0C A;  2EZL A;  2VUM J;  2G0E A;  1LE8 B;  4B1R A;  2O7O A;  9ANT A;  2DTZ A;  3FK6 A;  1GV2 A;  4JYK A;  2K9S A;  4QTR A;  5J1Y A;  3NAU A;  2Y31 A;  2EBI A;  5F0F A;  4BY1 J;  3G1M A;  1FIA A;  1LE8 A;  2XRL A;  3QQA A;  4CYC B;  1P7J A;  1I50 J;  2WAQ N;  3Q0U A;  5M5X J;  1ETQ A;  2E19 A;  1JUM A;  3CCY A;  1Y1V J;  3SJM A;  2NOG A;  2O9L A;  4C3I J;  2CQX A;  3IH3 A;  4A3M J;  3BG3 A;  2DMU A;  5M5W J;  2R5Y A;  4CYC A;  2DMP A;  5IOZ A;  2AHQ A;  2IEK A;  1OJL A;  2VKV A;  4D7M A;  1ZGW A;  1GT0 C;  4DYC A;  2P81 A;  1MSE C;  2GLO A;  5C44 J;  4FE7 A;  4A3F J;  1NTC A;  3C2B A;  1FJL A;  3VPR A;  4AC0 A;  5IP9 J;  5M3M J;  2O8K A;  3BT9 A;  3UKG A;  3GTL J;  2YU9 J;  2EZH A;  3GTK J;  1GDT A;  3JRG A;  1BW5 A;  2LTP A;  4MO7 A;  2K9N A;  2MGQ A;  2R92 J;  5F08 A;  2X48 A;  2R93 J;  2DA3 A;  2EH3 A;  3BTJ A;  1B8I A;  2Y9Z A;  2CJJ A;  3BR5 A;  3PO2 J;  2CU7 A;  1JKQ C;  4GFB A;  2ELK A;  1WH5 A;  1ETK A;  3OOU A;  2HOS A;  5C4J J;  4IHX A;  3GTJ J;  2I10 A;  1ZKG A;  2JN6 A;  1IJW C;  4D5C A;  1AKH A;  2M2E A;  3S2D J;  3M3Y J;  1T33 A;  5IYC J;  5J1U A;  4JX4 A;  2NVX J;  4DZP A;  4A3B J;  2VKE A;  3FKI J;  3HOW J;  5K7H A;  3A01 A;  1ETO A;  2M0C A;  2XPW A;  2DMN A;  4RBO A;  3OSF A;  1ZR2 A;  4IHV A;  3OIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...