2DA5A

Solution structure of the second homeobox domain of zinc fingers and homeoboxes protein 3 (triple homeobox 1 protein)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GSSGSSGPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 3
publication title Solution structure of the second homeobox domain of Zinc fingers and homeoboxes protein 3 (Triple homeobox 1 protein)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da5A00
1TWHJ 3RZDJ 3I4MJ 3OSGA 5K7HA 3S2DJ 5EGOB 2FD5A 3JREA 1WPKA 3CDLA 2JA6J 2PMZN 5FKNA 4BY7J 3BR5A 4CYCB 2E2JJ 3S15J 2HOAA 2FJ1A 3LSPA 1QRYA 1GUUA 1LFUP 1AHDP 2HOTA 5EG0A 3DEWA 4JX6A 5IOYA 2YUSA 3A02A 1JT0A 1MBHA 2AO9A 2CQXA 4XICA 3PO2J 4MIMA 4D5FA 1T33A 2DA7A 1ETXA 3DCFA 5FJ8J 4QTRA 1ZR2A 4MO7A 1QVUA 3Q0UA 2EQRA 3RZOJ 2NS7A 3BTIA 4A3DJ 1FEXA 3GTJJ 2EZHA 5EF6A 1IRZA 2L9RA 1ZGWA 3O8GA 1IC8A 4V2FA 2DA2A 3S14J 3S1RJ 1JTYA 4M3FA 1WCMJ 3ZQHA 1FJLA 1K61A 4A3IJ 1Y1WJ 4A3LJ 5E3NA 5GPAA 3SFIA 2IEKA 3TW7A 5GPCA 1LFBA 5FLMJ 1DU0A 2R7ZJ 3K7AJ 1U78A 2DA6A 4C3JJ 2M2EA 2HQ5A 2P81A 3ZQFA 1SANA 5F0FA 3BTJA 3Q0WA 1AKHA 2IBDA 3E7LA 3G1LA 1OCPA 3IH2A 2G0EA 3ZQLA 1NK2P 1MBKA 1WH5A 2LP0A 1Z0XA 2WV1A 2CQQA 2DMPA 4M3DA 2JN6A 1X2MA 4DYRA 2VKEA 3TW6A 3GTPJ 3BR3A 2OF7A 2H1KA 3OIOA 4Y52J 3S1NJ 2DN0A 2XPUA 1JGGA 1D5YA 4A3KJ 2L7MP 3O8HA 5M5XJ 3RKQA 4V2GA 3Q3SA 1RETA 4GFBA 5EZGA 1FTTA 2R0QC 1Z77A 2LKXA 2EBIA 5C44J 2ELKA 2DMUA 2HYJA 1P7IA 2KT0A 1JT6A 3BQZA 3HOYJ 4A3MJ 2DJNA 1DU6A 1GV5A 1HDPA 4MFEA 4A3BJ 1MNMC 1BL0A 2YS9A 1GDTA 4JX4A 1AU7A 1JUMA 4XIDA 3BR1A 2GM4A 2HXIA 2JK3A 3C2BA 5M5YJ 1POGA 1W0UA 1CQTA 3GTGJ 2K9QA 1U9NA 2DMTA 3H0GJ 3S16J 4FE4A 5JLXA 1HCRA 1E3OC 4C3HJ 2LVSA 1A6IA 4HNVA 3F0CA 1RKTA 3LNQA 2NVXJ 5FKKA 2Y31A 5IP6A 5EG0B 4XRSA 4FCYA 3BG5A 1JKPC 5IYCJ 1UHSA 1W0TA 1JUPA 2NVYJ 4NDLA 1XC5A 3OOUA 5BNGA 5IPAA 2GBYA 1QPIA 2X48A 3JRAA 1LE8A 4EEFG 1RESA 2QF7A 2TCTA 1ITYA 2Y0SN 3ZQCA 2CRGA 3RQIA 4JP0A 1NK3P 4I76A 2JA5J 2EZIA 1B8IA 2QCOA 1TWGJ 4BBRJ 5IP7J 3D1NI 1WH7A 5F0HA 2XGCA 3PM1A 3WHCA 4QIWN 4BY1J 2ME6A 4BBSJ 1FTZA 1BW6A 3NAUA 2L7ZA 4RBOA 2JWTA 3IH4A 2E2IJ 5C4XJ 4A3CJ 1F43A 4L5EA 1AKHB 1ETQA 2MG4A 3VPRA 1BW5A 4UUSA 2NS8A 2O7OA 3WHBA 4A93J 2FQ4A 1ETVA 5IYDJ 1B72A 4W1UA 1ZKGA 5F08A 1WI3A 3A01A 3G1MA 1ETKA 1TWFJ 3QPSA 3S2HJ 3MN2A 2M34A 1YRNA 3S1QJ 2CUFA 1I50J 1U9OA 5M3MJ 2WAQN 1OJLA 3UKGA 2IAIA 2L0KA 3FKIJ 4IHVA 4DYQA 3G1OA 2K40A 3HOWJ 4XK4A 4A3FJ 1MBGA 5IP9J 3HB9A 3BR0A 2VUMJ 3JRFA 2HOSA 4FE7A 3LOCA 4AYBN 2Y30A 3BT9A 5IOZA 3NARA 1G2HA 2MSYA 3K2AA 1TC3C 2OPTA 3JRBA 3FISA 2XPVA 1RPWA 4IHXA 1VF9A 4MLOA 3TEDA 2X6OA 2CJJA 1F36A 4FISA 3HGGA 3LSGA 3GTQJ 2E19A 3LSJA 1X2NA 4XRMA 4A3JJ 3LSRA 1BJZA 3GTOJ 1MSEC 4BKXA 2TRTA 3HOUJ 5C4JJ 2EZLA 5DTDA 5F04A 4DZPA 2NVQJ 1LE8B 1A5JA 4I6ZA 1SFOJ 3MKLA 3CCYA 2LTPA 1ETOA 3BR6A 2HDDA 1GVDA 5M5WJ 2NOGA 4UUTA 3JRIA 2Y9ZA 1O4XA 1B8IB 2O9LA 4M6VA 2CUEA 2JJ7A 1Y1VJ 4X1EA 1MBJA 5FKOA 4IHYA 1HOMA 1ZQ3P 2N8GA 1IDYA 1ORKA 5FLVA 2R92J 4DZJA 1OFCX 3HKZN 5E3MA 1MH3A 1ETYA 2LFBA 2XGEA 1XS9A 1R9TJ 4S0HB 3I4NJ 1IUFA 1JJ6C 5E3OA 2ID6A 5F27A 4UUSB 1JUSA 4C2MJ 4LOCA 1QVTA 1JKOC 2YU9J 3ZOBA 5C3EJ 1B72B 5EDNA 2M8GX 1HLVA 1BA5A 3BTCA 2JMWA 3A01B 3JRDA 2DA3A 3OSFA 2E1OA 1JKQC 1FIPA 1YRNB 3IH3A 5J1YA 1JJ8C 2MGQA 4B1RA 1VFCA 1HF0A 3ZQIA 2ME0A 4IEJA 2R5YA 1APLC 3HOVJ 4C3IJ 3JR9A 1VI0A 4RDUA 1EF4A 2CU7A 3SDGA 1RKWA 4QSHA 1MSFC 5JLWA 4BXXJ 2COBA 5EYRA 4A3GJ 4FTHA 3QQAA 1TWCJ 4B4CA 3IV5A 4DW6A 2DA1A 1PUFA 5J1UA 3QPLA 4Y7NJ 2W48A 1IJWC 1T56A 2LR8A 1ENHA 5J3LA 3GTKJ 3H3VK 2LD5A 2D5VA 2K9SA 4AC0A 4MFDA 1IV6A 5EEAA 4JX5A 3CQZJ 3HBLA 1ETWA 4A3EJ 1IDZA 1ZTRA 2LK2A 3PO3J 4B3AA 1JTXA 4X6AJ 2NVTJ 2EH3A 2LY9A 2XRLA 2VI6A 4D5CA 3TP3A 1Q1VA 2I10A 3BQYA 3FIWA 2R5ZA 1MH4A 1S7EA 4D7NA 3HOXJ 1NTCA 2H8RA 5K7ZA 3FK6A 2O8KA 1GT0C 4M3EA 5FKMA 2DA4A 2DA5A 5HODA 4IHWA 2DMQA 5DS9A 5EGOA 3HGYA 3SJMA 3BG9A 1GV2A 1TWAJ 5F0CA 3BTLA 5GP9A 4M3GA 1K83J 2WB1N 3B6AA 3FK7A 2FX0A 1OCTC 3B6CA 3HEFA 5EZHA 3A03A 4CYCA 1H89C 2HI3A 2LLKA 2XSDC 2DTZA 2Y2ZA 3BR2A 1HDDC 2EZKA 3Q0VA 1U8BA 3JRHA 5F1JA 1WGXA 4ABZA 1JKRC 1UG2A 2L7FP 1VNDA 2VPRA 5K7FA 1ZK8A 5E3LA 1FIAA 2R93J 3HDDA 3S1MJ 4A69C 2JA7J 2KDZA 2RAEA 3JRCA 2ECCA 2E2HJ 4J19A 2XPWA 3JRGA 2R5YB 1MBEA 1I6HJ 1X58A 4AUXA 4G12A 1IGNA 1IG7A 2XGDA 2ID3A 1H88C 4XRSG 3BG3A 4DYCA 2JA8J 1PUFB 2ZB9A 3W6VA 3CMYA 2VKVA 3GBGA 2XB0X 3ZQGA 5J1RA 5M3FJ 5FKLA 1ZR4A 2GLOA 3M4OJ 3HOZJ 2X9DA 2DMNA 1P7JA 9ANTA 5IYBJ 3GTLJ 3MVPA 2M0CA 2B63J 4D7MA 2ECBA 1MBFA 2M9HA 2Y9YA 3TP0A 3L1PA 2MW8A 1H8AC 3S17J 2HXOA 3GTMJ 2XB5A 3M3YJ 3HM5A 2K9NA 2R5ZB 1I3QJ 1UMQA 4JYKA 1XG1A 4M3BA 2AHQA 4W97A 1RR7A
chains in the Genus database with same CATH superfamily
2JUGA 3BLYA 1TWHJ 5HNHA 2B7EA 5KNLA 3S2DJ 3IWZA 2DFEA 3T5XA 2RGVA 1Z7LA 3I55I 1XX5A 2XKOA 4L0ZB 4FETA 4CSWA 3JCUC 1WZ2A 2HZDA 4B09A 3HSRA 1AHDP 1YQAA 2O6GE 4L0YB 3DEWA 2EIMH 5IOYA 1JT0A 2P6TA 1MBHA 1RC9A 2AO9A 3NWSA 1PDNC 1MIJA 4RM3A 4CCNA 4HRIA 4MIMA 4BHCA 4D5FA 1T33A 4XOTA 3DCFA 1QVUA 3ELKA 3ABMH 3QAHA 4IKFA 1XPXA 2A6HF 1W7PD 3J7AY 2VBXA 2NS7A 1FEXA 3GTJJ 3I59B 1OCRH 2L9RA 4ZYAA 3O8GA 3W2VA 5EF6A 2ZJRF 4A6DA 1IC8A 3GEZA 2JA2A 1HBXG 4M3FA 4L9VA 2VASA 4OIOF 1ZHFA 3V8KA 3PIPF 3CF5F 1FJLA 5AONA 2DOEA 4M6YA 2KP6A 2M87A 3DBRB 1XD7A 2LBFA 3CMAI 2R7ZJ 1XMAA 3KYLA 3K7AJ 1YW8A 1QZYA 1ZYRF 3K69A 4XNFA 4C3JJ 1Y0NA 1W7PB 2KZVA 3GLLA 1SANA 3GO5A 5KVRA 3DBHB 1OCPA 1YX5A 2YU3A 3F6OA 1FNNA 3S3NA 5E18F 4GYGA 2CQQA 2XRNA 1ERDA 1HW1A 3E97A 3JAMZ 4XLHA 2EA4A 4M73A 5BPDA 4DYRA 4CGZA 3FXLA 3P9CA 3ABLH 3SYTA 1MMSA 1R58A 2OF7A 2H1KA 4Y52J 2PEXA 2XPUA 2DFFA 3KLOA 3LSMA 4BU2A 5DDGA 3G71I 3FXKA 3F23A 3CJNA 1R49A 2DXIA 1RETA 4KT6A 4XRFA 2KRFA 3DU5A 5C44J 2ADUA 2HYJA 2IGOA 4IQJA 2KT0A 3BQZA 1G4DA 1S7AA 1HDPA 2LRDA 2D2WA 3L2CA 4AWXB 3WU2C 3DPLC 4XIDA 3BR1A 2X1EA 3CLQA 2GM4A 3C2BA 1FZPB 1W0UA 4HG2A 1X4OA 3ULQB 3GTGJ 4ENMA 3S16J 2X0LA 4L5IA 4ETSA 4IX7A 1V5EA 2EV5A 3D5LA 4EVIA 1IF1A 3F0CA 1IN6A 2KRCA 4MQVA 3WTXC 4PSWA 2WTEA 1N77A 1VQ7I 3FHNA 3BG5A 3ZQ7A 2GXBA 1JKPC 4O5VA 3PIOF 3VDXA 4XLCA 1MD0A 2OD5A 2X1CA 4NDLA 3TO9A 3ROUA 4M74A 5J8FA 1HKTA 5IPAA 5D4SA 2Z16A 1QPIA 4TV7A 1SMTA 5E20A 3TMOA 1QA6A 2I5UA 3RPUD 4HF2A 3ZQCA 3TDZC 4M71A 3HHGA 1NK3P 3CCQI 2DDAA 2KHMA 3GUDA 5CVIA 2HS5A 3I53A 2IA0A 5J6XA 5K1YA 2LY2A 3DEEA 3K4NA 3FX3A 2GOXB 4IRHA 2RREA 4BBSJ 2ME6A 2PBIA 1R36A 3NQOA 1T0FC 3NAUA 2L7ZA 2P7CB 2DAOA 3H36A 3MKWB 3IH4A 3WTVC 4HQEA 4CHUA 1SVMA 4HQMA 4A3CJ 4ZYEA 1OISA 2QKLB 1ETQA 2E71A 4HF0A 5CQGA 4AM3A 2K86A 4LD5A 2ESNA 2Z99A 5F64A 1FBSA 2EA2A 3L2RA 2CW8A 3TGNA 2K27A 1BI3A 2QLZA 3ZRGA 3V7SA 4YEJA 5IYDJ 5FFXA 2F5DA 4KJZA 1Y8RB 2EFNA 4EM2A 1TWFJ 3R60A 4G8XA 2ETHA 5CVUA 4IRGA 1QZZA 2QM3A 2WAQN 2WAFA 3LA3A 4F92B 3PNTA 4IHVA 1R7JA 2BY0A 2IGMA 3HOWJ 2L9VA 4CA0A 1TNTA 2VLAA 3FXRA 2RQPA 3BP8A 3QYEA 4RB3C 1RNLA 5KAFC 3IP4B 3BR0A 4KIBA 4XN0A 3E5XA 2GA1A 2J5PA 2WV0A 4Q4ZF 2HOSA 4WWCA 4FE7A 2KFDA 3AG3H 5IOZA 3VYUB 3NARA 1G2HA 3BPXA 2MSYA 3BZ6A 3K2AA 4Y15A 1RZ4A 4XLEA 2R7SA 4RAFA 2OC6A 3ERMA 2XPVA 5K5QA 4IZZA 1B4AA 1G8XA 2CH0A 3TL4X 1U5TB 5LGNA 2F5FA 2F5CA 4IPAA 2QA4I 3OS1A 1T8IA 3WTYC 2KQRA 1WKMA 3M7GA 2E1MC 4FISA 4ENKA 2H94A 3LAJA 1LUJB 3GTQJ 2E19A 3LSJA 2RN7A 4A3JJ 3GTOJ 3LSRA 3AG4H 2MD0A 2FSWA 4A6EA 3WGIA 2R7XA 2KDOA 3E6MA 1O57A 4S05A 4HNUA 4PJNA 4BXUA 2G7HA 2F4IA 4DZPA 4G7ZF 3KP6A 2NVQJ 1XN7A 4A12A 3MKLA 3CCYA 1Z3YA 2LTPA 2DYRH 2DPUA 1GVDA 5M5WJ 2NOGA 4HLYA 2DPDA 1B8IB 3GFLA 2DT7B 4LK0F 2JJ7A 1AWCA 1PVEA 4X1EA 3VWBA 1FSHA 1R1UA 1S6LA 3IAS2 3CC7I 1G3WA 2VJIA 1RUNA 3R4KA 5AIPA 1MH3A 1ETYA 3A0BC 3X2QH 2ZMEA 4YIIA 1ON2A 3PFYA 1QZEA 1YOVB 1HSJA 4Y17A 2D1VA 4YRVA 1X1CA 1R9TJ 3I4NJ 1S7OA 1IUFA 4Q5SF 3I5UA 3H9GA 3HL2A 3ERED 2Y48A 4LOCA 1G3SA 2ZO4A 3OYAA 3DTEA 2YU9J 1S3JA 5C3EJ 2X6YA 2QQAA 5HDGA 4HBLA 4FT8A 1HLVA 4CICA 3OYMA 1JKQC 1Z6TA 5B1AH 3EUHA 3DTKA 3S8PA 2CW0F 3IH3A 5J1YA 4OU0A 4UV8A 4IF4A 3CCEI 1VFCA 3EETA 3F21A 1HF0A 1DP3A 1DP7P 3O2PE 4IEJA 5GAEJ 4XL9A 2UZKA 3ABTA 3LMMA 3SDGA 3OOPA 3H5AA 2H09A 2K4BA 1PYVA 4FTHA 5IT9Z 2COMA 3QQAA 2QWWA 2UV1A 3F8NA 4RAGA 2IVMA 1X1BA 2DA1A 3DF8A 2HVSA 1BOBA 2ZFUA 3QPLA 4XOPA 2QQBA 3WE2A 5GAGJ 2QZ8A 2Q1ZB 2W48A 3V7RA 1IJWC 4I99C 3WE3A 1WQ2A 2EJRA 3HRMA 4BQAA 2FUG2 2CUJA 2D5VA 1MJ9A 2EV0A 3BG6A 1O7LA 3RKWA 3JSOA 4U0VA 1WVRA 1VQ6I 2NOJB 1WJ5A 2EWNA 4AC0A 4MFDA 2R7TA 5DV5A 4KIGA 4G6TB 3WGHA 4EM1A 1I1GA 2MLGA 1K79A 1JTXA 2NYXA 2OAZA 3ZN1A 2QUFA 3ZP5A 4X6AJ 3FBNB 4I09A 5DEQA 4JBAA 2Q8KA 5HLGA 4BE1A 2I10A 4OINF 1D1CA 3DV8A 5HLIA 5ICCA 3HOXJ 4LIVA 3F8BA 5K7ZA 2O8KA 5DCMB 2R7WA 2BY1A 2LMDA 2DA4A 2DA5A 2K9LA 2DMQA 3P9IA 5DS9A 2R7OA 3KYCB 2R7VA 3WU0A 1GV2A 3TBIA 3CCRI 5F0CA 3KEYA 4M3GA 2WB1N 2BBYA 1BI1A 4PJJA 3HEFA 2OJED 2P4WA 2W84A 2XGXA 2WADA 4CYCA 3W6JB 1WJFA 2XSDC 5GTIC 2V1NA 2Y2ZA 2EZKA 2D45A 3JRHA 4KA4A 4LGWA 1WGXA 2L7KA 2L7FP 4RB1A 2VPRA 4Z6YA 5K7FA 1SFKA 1ZK8A 1FIAA 2P5KA 4LG0B 4E7IA 3KZIC 2JA7J 1UJ8A 3CJQB 1KQ9A 1J9IA 2R3SA 1BR4A 1X58A 2V1XA 1VQOI 5D6EA 4N9IA 5ICGA 3OYDA 2H6BA 1IG7A 3J80K 1MDMA 2ID3A 4UVBA 3KLNA 2KISA 2I8DA 3IAM2 4KMFA 2E5ZA 1QHGA 2W25A 2XB0X 4DGWB 1FOXA 4EGZA 2P0WA 5ICFA 5M3FJ 4LITA 5K5OA 1ZR4A 4P9FA 3LA7A 2IRFG 4M6XA 2VT3A 3PSFA 2X9DA 2PMUA 2DMNA 4ZZLA 2XDVA 1SD7A 4MHGA 4F52A 2CFOA 4V19K 2JT1A 3S3MA 3W2AA 3Q9SA 3K4MA 2M0CA 3LL7A 3Q5FA 4NC7A 1GHCA 2ECBA 3D5RC 1GXPA 3IL2A 5FRMA 2KZGA 2MW8A 5LRSA 3C2GA 3B02A 3K1MA 3FKJA 3K2ZA 2M1BA 1XSVA 2R7QA 2AXLA 5D5XB 2MA3A 1HW5A 1N25A 2OQRA 1RR7A 3GFMA 1UAAA 4O3MA 4NHJA 4I0AA 3MEXA 1EJ9A 5L3BA 3OSGA 1O3TA 1SFXA 3O3KA 2FD5A 3F8FA 4PCQA 3BY6A 2JRMA 2JA6J 3QODA 1FT9A 1ON1A 3TOBA 4OAZA 2JVHA 4M9SA 1V4RA 3BR5A 4IOAF 2E2JJ 2VE8A 3VYSB 4OIQF 4CH7A 2QENA 3VOEA 1LFUP 2PG4A 4IVNA 3HRSA 5F6FA 2CG4A 2YUSA 3WTSC 2LREA 4XKCA 3P9KA 4ENJA 4KICA 1YYVA 3ML6A 1A35A 2DTRA 2ZJ2A 3A2KA 1ETXA 3VODA 2DT5A 3GZNB 4HEA2 5JI6A 2MFZA 3CCSI 4A3DJ 3BTIA 4RGUA 5CYVA 2EZHA 2NRAC 3HSFA 4HX4A 3S14J 1I39A 1R5HA 1D3YA 2M7AA 2H27A 3LFUA 1IXCA 2EIJH 2HDCA 1WCMJ 3KFWX 5J4YA 3COAC 4BHPA 4A3IJ 1Y1WJ 2L9NA 2VB6A 1YX3A 2QQ8A 3SFIA 1Z7UA 5GPCA 1P6RA 1DU0A 1U78A 3IKVA 4HAMA 1KU7A 2M2EA 2HQ5A 3RI4A 3ZQFA 2YR2A 4UV9A 3BTJA 3Q0WA 1AKHA 2EFQA 3E7LA 3G1LA 3ZMTA 1USTA 4KISA 2DK5A 2LF7A 1YG2A 3U21A 1WH5A 2LP0A 4M3DA 4I0BA 3MKZA 1X2MA 4GDFA 2H1LA 4RS8A 3RTRA 2CYYA 1DGWY 2E5NA 3GTPJ 3OIOA 3ZMZA 2DN0A 3T1BA 1JGGA 1ZLKA 1D5YA 5EEHA 1Q1HA 4A3KJ 4XMYA 3ZMSA 5M5XJ 2VQGA 2STWA 4HV5A 1D5VA 2R0QC 1LNWA 2MLKA 1OMIA 2ELKA 2LOOA 2M8EA 3HUGB 2EPFA 4GXOA 5KCMA 3U1KA 3HOYJ 4A3MJ 4KN7X 1IN7A 1MNMC 2VJJA 1XDSA 2O5RA 2LDUA 2YPRA 1GDTA 4JX4A 3K1PA 5IT3A 2MC4A 3GXOA 3M9AA 3QPHA 2HOEA 1D8KA 3VYRB 2DQRA 2VQCA 1POGA 3HRUA 2DMTA 5JLXA 1I5ZA 1JHFA 5E8GA 1E3OC 1MKMA 4A0XA 2VE9A 2NVXJ 2VONA 5FKKA 3RYRA 4CCOA 2Y31A 3E6DA 4E7ZA 5EG0B 4CZCA 4BQQA 1YHQI 1TZLA 2E7XA 3GFIA 2CUZA 3E3VA 4LK1F 3JTGA 1DDNA 4IHSA 4LLNA 4PFPA 4E6KG 1W0TA 1JUPA 2NVYJ 4IJAA 1XC5A 3OOUA 3PJRA 2QBYB 2V6CA 1CF7A 3RYPA 2XF5A 2XUBA 2KIFA 2GBYA 5GAHJ 2DODA 4BJ6C 4LG0A 1SD6A 5LHIA 4F91B 3PQKA 2TCTA 3G6EI 1VQNI 2E60A 2FOWA 2Y0SN 1ITYA 3RQIA 1YS7A 4DIQA 4FHTA 4JP0A 4UXNA 1F1ZA 3AG1H 2QCOA 4BBRJ 2XF7A 1B6AA 5IP7J 5CVJA 2GA2A 5JFRA 3PM1A 4EJUA 2IGNA 2HPIA 4NNJA 5EJCA 4EJOA 2HEOA 3FDYA 2PLYA 4C9YA 4RBOA 3DWLE 1S5LC 4G6QA 4IL6C 3V7CA 3MZHA 1U8RA 5C4XJ 2DOFA 2CSOA 5CLSA 4L5EA 2MG4A 3N05A 1F4KA 2OTLI 2DCEA 4P96A 3CZ6A 3LWFA 2O7OA 5D8LB 3KZZA 4KYWA 4YIFA 2BVLA 3WHBA 4LIUA 1OLTA 4A93J 4F7ZA 1ETVA 3BJ6A 4FASD 4MEXF 4JK1X 1B72A 3SFZA 3CC4I 3I64A 3IRQA 1FP1D 1ZKGA 5JR3A 3A01A 4WK8F 1Y56A 2PJRB 3G1MA 1W5TA 3HRTA 1KYZA 1YW7A 3PNYA 2M34A 1YRNA 3S1QJ 2CUFA 1UELB 5H6QA 4XORA 5M3MJ 1VQMI 2W82A 1OJLA 3UKGA 2IAIA 4DYQA 2K40A 1WFXA 2QEXI 2L4MA 4AVZA 4PJMA 3KP5A 1JI8A 1MBGA 1I6XA 4O6JA 3LQQA 1SVOA 3Q9VA 5D5VB 1ZAOA 4RGXA 1ZARA 3WTWC 2HU9A 1BOAA 3GMEA 3MWMA 2ZMEC 5BOXA 2BW3B 2P5VA 2ZCWA 4L18B 3F9KA 1K7AA 4QPQA 3I56I 1B59A 4PJ0C 1FC3A 3FISA 3VSLA 2QYOA 2DU9A 2HZTA 4IHXA 2V6EA 3J7AO 2DT6A 1F36A 3HGGA 3LSGA 4KUMA 1ZELA 1BJZA 1O3RA 3DU6A 1VQ5I 1LEBA 1MSEC 4BKXA 2TRTA 2ESHA 3H5RA 2EZLA 1QHHD 1Y8QB 3EUHC 3F8CA 1HSTA 2Z5UA 3R0JA 3J7ZI 3DLLF 5F04A 3H1CA 3S3OA 1LE8B 4I6ZA 1MMGA 3E6BA 2KLOA 2CQNA 1LVKA 1ETOA 3BR6A 3FMQA 1KZHA 3JRIA 4NQWA 4XM3A 1BI2A 2EK5A 1Y1VJ 3MAJA 3QU6A 5FKOA 1HOMA 1D0YA 2N8GA 2RC4A 1IDYA 1N75A 3BCBA 5FLVA 3GW2A 5E3MA 3OYIA 1T08B 4RMNA 2A07F 4PSXA 3GF2A 5BS6A 4LJZF 3ASNH 5HDKA 2LFBA 2DLLA 5L3EA 2BZTA 3KIOA 2ZKZA 4HX8A 3EYYA 4OOIA 6PAXA 5HS9A 1XS9A 2DQLA 2K3PA 4XLPF 1JJ6C 1KQ8A 2VJ5A 1LFPA 4UUSB 1TW3A 3C2HA 3LA2A 1JKOC 2EFWA 4NUBA 3OL3A 3ZOBA 4RAZA 3RDIA 5FD5A 5E8IA 1R4NB 1BA5A 3CJTB 1X3UA 2Z2SB 3JRDA 5E17F 2A3SA 3DKXA 2KRHA 1YI2I 2JTVA 1JJ8C 2M4GA 3MFKA 4MGRA 5H6RA 5GADJ 3DPTA 3CLOA 4A5MA 3ZQIA 1K4TA 2XC7A 4PK4A 5L3CA 5JHUA 2P5LC 3CTAA 3EQLF 2CU7A 4EJVA 2K7LA 3QYFA 1RKWA 4QSHA 4BXXJ 1LB2A 5D4RA 1SFEA 3T8TA 3M8FA 4E70A 3JSPA 1SFUA 4BQOA 1T95A 1X4PA 3H0DA 4KDPA 1VQKI 5J3LA 2LR8A 3H3VK 2K9SA 1EH7A 3DLAA 4U88A 2L01A 3E6CC 1IV8A 3HJEA 1IV6A 2A68F 4JX5A 3CQZJ 1PUEE 1EA3A 1IDZA 1X19A 1ZTRA 2BHYA 2LK2A 4J00A 4I01A 2PMZA 2NVTJ 4I2OA 2LY9A 2AQEA 3TP3A 1ZREA 4RLFA 2R5ZA 3BQYA 3FIWA 3RIRA 1MH4A 2WC2A 4WF2A 5CKTA 3AKZA 3KP4A 1JHHA 1NTCA 2HKXA 1GT0C 1ONVA 2KKOA 3ZMDA 5FKMA 1V5FA 5HODA 2X6XA 1TNSA 3ECHA 4BDZA 1FMWA 3BG9A 4B44A 2WY7Q 1KU9A 2F5EA 1K78B 2V1UA 1K83J 3B6AA 3KPHA 2GOMA 4XLAA 1R71A 3A0HC 1OCTC 3EUKL 1IW7F 3QP5A 1EH8A 5L3DA 3A03A 3IUOA 2L9SA 2MYSA 1DPUA 4FX0A 4ZDPA 1YE9A 2E1MB 2DTZA 2DO7A 4B3XA 5HLHA 1HDDC 2UXNA 4KITB 2V9PA 4P9UA 3RQ4A 1ODDA 5HOOA 1FWZA 3R0AA 3OV8A 4XN3A 5FLXZ 3EYIA 2FBIA 2CQ7A 2CWEA 1JKRC 3AL0B 5J8CA 1VNDA 2Q0OA 4IQ4A 4E7JA 2EV6A 2R93J 2NAZA 1P4WA 2ACJA 3L2VA 2MH2A 4MQ9F 2E2HJ 3D5SC 3FZVA 4EJTA 2R5YB 1MBEA 5LGTA 2O03A 1XB4A 3I59A 3DXJF 2DJIA 3HOTA 5B5EC 1DGRM 4Q47A 4DYCA 1TQPA 5D5WB 2FMLA 4ENNA 5KHDA 2JA8J 1K6YA 1PUFB 2ZB9A 3BPVA 3W6VA 3CMYA 3GBGA 1Y6IA 4ZJZA 1ZG1A 3ZQGA 5A2QK 4GCVA 1TP4A 1P9QC 3L7WA 1AA7A 2GLOA 3BZKA 3M4OJ 1IN4A 3L2WA 1W7PA 2OQGA 3LQRA 1P7JA 2IGKA 4H0EA 1FYMA 2F4OB 9ANTA 3KETA 5K5RA 3M8JA 4ESBA 4I02A 4PJLA 5IYBJ 4EV0A 2RNJA 1ACIA 3I71A 2RV8A 2ICWG 2HVQA 4YIRX 4D7MA 4RB0A 1FLIA 1MBFA 2AXTC 2M9HA 2KJCA 2LF8A 3L1PA 1ZN2A 1R5ID 3TOAA 2HXOA 2XB5A 5LEKA 3HM5A 2K9NA 2V9KA 4R79A 4L9TA 4NBQA 3ESWB 1I3QJ 4JYKA 3C1DA 2OV7A 2HPMA 1XG1A 3VSKA 1WRJA 3K70D 1UHSA 1QO0D 1MJAA 1WJDA 4W97A 2VKHA 3RZDJ 4D9JA 5EGOB 3IRRA 4I7HA 3JREA 2IJLA 1W5CC 1H9TA 1WPKA 3CDLA 1HXDA 5F1RA 2M45A 2FNAA 1BIAA 2LH9A 1TQMA 1JE8A 3S15J 4YFXF 1W4MA 2M0MA 3N97A 1AOYA 2OA4A 2CV2A 2FJ1A 4MTDA 2VOPA 3MKYB 3GZ6A 4IRIA 3I4PA 1STZA 4LLGF 2L4AA 2HOTA 2LG4A 5D5UB 4YG2F 4BJTA 4BS9A 2HNHA 3GYHX 2KIMA 3A02A 1XMXA 4NB5A 3D0SA 1S8NA 3K6GA 2XAQA 4Y3OA 3L00A 1N78A 3ZR8X 1GXQA 2VC1A 2HDWA 4P1WA 3V4GA 3PO2J 4BQNA 3BCAA 3TO6A 1MMDA 1OYIA 3I9V2 2JPBA 5FJ8J 1LPQA 3GCMA 1FYLA 4MO7A 1TL8A 2M7BA 1V55H 2EQRA 4KNYA 3SZPA 3RZOJ 1YTYA 2ZSIB 2A6TA 4NC6A 1R1TA 2Z1DA 1YS6A 4OIRF 4CCKA 3CUQB 2DA2A 4YELA 1ZGWA 3S1RJ 2HQNA 2XVCA 3SHFA 1Z21A 3DTIA 1D0ZA 1JTYA 3OYCA 2XF6A 1S9HA 1Z6RA 3OYHA 1K61A 3OIPA 5E79C 2IP2A 4A3LJ 4EJWA 5E3NA 2IEKA 1LFBA 3WTZA 2Q2EB 5CVRA 1NHAA 4XKVA 1FYKA 1A6QA 2P81A 2RVCA 3RPUA 3T0YA 5F0FA 3J81K 3ZXSA 5LHHA 2IT0A 4UUVA 3IH2A 3REOA 3ZQLA 4M9ZA 1NK2P 2LKPA 1ZG3A 4BYYA 4GO1A 3NEUA 4PZJA 1BR1A 2K3FA 1BJAA 3CCUI 3ZCOA 2VKEA 4JQFA 4B48A 3G73A 3SEQA 4BJ5C 3S1NJ 2YX4A 2HGCA 2VQLA 4HX7A 1PP7U 4H4KC 3RKQA 1XGNA 1MNEA 3JTHA 3MCZA 5EZGA 2NNYA 4FX4A 1Z77A 3VFZA 3QWLA 2DMUA 2OTJI 4BGDA 5ED4A 1P7IA 4G6DA 1X1DA 1JT6A 2X85A 2DJNA 4IO9F 3L2UA 1DU6A 1UFMA 4MFEA 1G6NA 4A3BJ 1BL0A 3ZN0A 2YS9A 2CFXA 5JVGF 3WTTC 3OS0A 2CMPA 2RNGA 5LHGA 1XMKA 3K4JA 5LRRA 5FGMA 2XKPA 2HXIA 2W00A 1KGSA 2Y75A 1CQTA 2QSHX 2MC3A 1U9NA 5HDNA 2IS6A 4FE4A 2O3FA 1HCRA 4UY8I 4C3HJ 5TISC 4HNVA 1Z1DA 1U5TA 3LNQA 3CCVI 5L3GA 1NG6A 5E1XA 4FCYA 2K4JA 3H3ZA 1FOYA 2RKHA 4XBFA 4B43A 1FBUA 1P2FA 2FOKA 2KMUA 3WG9A 1B9MA 2XAJA 3W2WA 3CO6C 3KX2A 4C30A 2X48A 2XAHA 4EEFG 3V8LA 1RESA 2A5WA 3SZGA 3GWZA 5CQEA 5ERIA 1W5SA 4I76A 1B8IA 1TWGJ 4M9XA 3VEPA 1W36C 1OQYA 1USSA 1X3WB 2JSCA 3A4CA 2CV1A 5LEJA 1YFHA 1TLHB 4PGHA 5F0HA 2XGCA 2Z33A 2V79A 4M72A 2CS3A 5E1WA 2W57A 3OYBA 4BY1J 1FTZA 2HKOA 1BW6A 1EV7A 2LBFB 4R1HA 4RM2A 1I3AA 4U87A 1GLNA 1F43A 3ECOA 3CP2A 5HLTA 4CYDA 2RDPA 3VPRA 2CGPA 1SD4A 2NS8A 4CCMA 3P5JA 3BJOA 1BI0A 2FQ4A 5CJ9A 4LG3A 2NS0A 2M3AA 3RKXA 4W1UA 1ZRDA 2M30A 2PN6A 2IS1A 2EFOA 3OY9A 2K5CA 3QPSA 3S2HJ 3K9TA 2AQFA 2D1HA 1U9OA 2ZSHB 4U0YA 4EM0B 2IW5A 2L0KA 3HHHA 3KEQA 1UB9A 1YIOA 5IP9J 2BOLA 2L5QA 2VUMJ 4FQGA 3JRFA 4WX9A 1ZGJA 3LOCA 4AYBN 2ZXIA 1VQ4I 2Y30A 2BHZA 3BT9A 3GFJA 3WODF 1WJCA 4PUSA 1TC3C 2OPTA 5H2FC 4A0YA 2HVRA 3IWFA 2X6OA 2F48A 2BEOA 2WA0A 2BV6A 1RUOA 4BUPA 2KPMA 2EFPA 1X2NA 2QKMB 2QQ9A 4XRMA 1L0OC 1SAXA 3ZMUA 4YFKF 3MD2A 3K0LA 1A36A 2KIQA 2GAUA 1IRXA 5C4JJ 3DEUA 2XASA 2ZC2A 4RA2A 1XDUA 3AFHA 1VQ8I 4F55A 2LC2A 5J47A 2VKDA 2VBYA 2V4JC 3NWTA 2Y9ZA 1FOKA 2O9LA 3P7NA 2B9SA 4WXHA 2NXNB 4HLXA 5DCMA 1WJEA 3IC7A 4IHYA 3C7JA 2VL8A 2R92J 3OR2C 2W24A 2ZXWH 3CUQA 1IAWA 1IUYA 3HKZN 1O3QA 1H0MA 3TO7A 2E35A 5FO5A 3CCJI 2MD5A 3QOPA 2Z9OA 4MNUA 4P55A 5DCFA 1D1AA 2DW4A 1BC7C 3OIQA 2VJ4A 3LSTA 3QU3A 1HA8A 3K4CA 5E3OA 2FBKA 5F27A 1B1BA 2DDBA 1OR7A 2Q2EA 4RGRA 3KE2A 4BNCA 3OYGA 2JZYA 4MEYF 5EDNA 1LKXA 2MABA 4RB2C 4IXAA 3BTCA 2JMWA 3OSFA 2E1OA 5JHFA 1R00A 2LY1A 4AD9A 3I0TA 1LJ9A 1HKQA 2MGQA 3SQNA 1UHMA 3OR1C 3I54A 3BC8A 2ME0A 1APLC 3HOVJ 3HC7A 3JR9A 1VI0A 2CQKA 4RDUA 3KYDB 2E1CA 3PL8A 3QP6A 1YJWI 2COBA 2R7FA 4XLNF 4A0ZA 3DQVC 4HNTA 1MJBA 1TWCJ 2MBFA 4PGGA 3IV5A 3FM3A 4ON0A 1F9NA 2FXAA 3FF5A 3RKYA 1R5GA 1M1EB 3DBLB 2AS5F 5H20A 3HPHA 4Y7NJ 1XCVA 3EUAA 3FXJA 3OMYA 1E17A 1GVJA 3HZJA 3ZMVA 1Z3XA 3FWEA 1WJAA 1VQPI 2PMHA 2BYVE 2GQQA 2FRHA 3A1YA 3AAFA 3ABKH 2Y0SA 4LMYA 4U7BA 1J0RA 3F72A 4B3AA 4CCJA 2W1OA 1P92A 3L2QA 1KA8A 2EH3A 2XRLA 4D5CA 2HFHA 2R4GA 3TKYA 1S7EA 4EATA 1P4XA 4QWQA 4D7NA 1BN5A 2G7UA 2K02A 1B9NA 2E34A 2O61A 2FE3A 2KIUA 4AVPA 4M3EA 4IHTA 4IHWA 2IA2A 3CJRB 4ANJA 3HGYA 1J09A 2ZMEB 1TBXA 3BTLA 4WXDA 4B8XA 4HDUA 1HQCA 3SEZA 2XSJC 4ZDOA 2HWVA 3KP7A 3WTUC 2W7NA 1HW2A 2VT2A 1ZG5A 2Z3YA 2HI3A 3HTUA 3JAMK 1OCZH 5JVTA 5D8KB 1QQIA 2BE5F 4XSZF 2LSOA 3LSHA 2DI3A 3NRVA 2BXZA 3F3XA 3Q0VA 1G3YA 1OYWA 2EIKH 2F2EA 1MMAA 3L09A 4II2A 5F1JA 1U8BA 4ABZA 3DKWA 2LYCA 1QGPA 4E7SA 5E3LA 2STTA 4PFOA 2QGUA 3S1MJ 1KONA 4JOMA 2PJPA 2RAEA 1D1BA 2ECCA 4II3A 5CVVA 3JRCA 5LFAA 4J19A 4AIKA 3JRGA 1LDJA 2P6SA 2IS4A 1X3ZB 4AUXA 2HTJA 4G12A 2VPLA 1IGNA 1Y0UA 3CF2A 3PFIA 2XGDA 3LAPA 3OYFA 4R8HA 3M1CA 3OYKA 5D6FA 2ISYA 2PQ8A 2LNBA 1TQIA 3KP2A 1H88C 4XRSG 1ZLJA 3BG3A 1R1VA 4G9YA 2FF4A 2VKVA 5ICEA 3F6VA 5J1RA 1S72I 4NC8A 1RI7A 1Z67A 5FKLA 2CV0A 3FXOA 2HR3A 3FHZA 1JGSA 4HV6A 4OIPF 3DP7A 4EMSA 2V26A 3M1EA 3CUOA 4UB6C 1D0XA 2UUZA 5AIQA 3LSIA 4C2UA 3W6KB 5DM6F 2VC0A 1V3FA 2Y9YA 3TP0A 1W1WE 3H3UA 5IY5H 3CO7C 3CD6I 4B47A 3S17J 1P4AA 3M3YJ 4ZC3A 2UXXA 2GXGA 3SZTA 2H8WA 2O0YA 2BVMA 2QSFX 2PFBA 2LKSA 2V7FA 3F8MA 2XROA 3HUGA 3CDIA 2E36A 1OKRA 2GIZA 4XKBA 3I4MJ 3BJAA 5K7HA 2VOOA 3VYTB 2ZBKA 3AG2H 2PI0A 5DD4A 3R61A 4K2EA 2WAEA 3TQNA 2HYFA 2PMZN 2K85A 3RCOA 5FKNA 3E1SA 3G3ZA 3FMRA 1SEUA 3CDHA 3CP8A 4BY7J 4CYCB 2HQRA 2M4KA 2HOAA 4EQQA 3LSPA 1QRYA 1J59A 1GUUA 4DBQA 2VQHA 5EG0A 2XAGA 3F22A 1V54H 3L9FA 4JX6A 2XAFA 3H9QA 1R4MB 3QPTA 3MZYA 2ZJQF 3CMEI 1VTNC 1SC7A 1KYWA 2CQXA 3H92A 4XICA 2B0LA 1SD5A 1LQ1A 2QBYA 2HTSA 3OYNA 2DA7A 2E7WA 2OZUA 4L9JA 4GGGA 4BAYA 4QTRA 1ZR2A 2DFIA 4CXFA 2JSPA 1FBQA 3Q0UA 5BMZA 2ZNZA 1O7FA 4PDKA 1IRZA 4KFCA 1YIJI 4V2FA 4CZZA 1MDMB 1I1SA 1C0WA 3SDBA 1OYYA 4RGSA 1VQLI 2XIGA 3WU1B 3ZQHA 2F6CA 2NNNA 1T6SA 3CMMA 4AU7A 1T39A 4N4NB 1F5TA 5GPAA 2L3DA 3TW7A 2MH9A 2WBMA 5FLMJ 2DA6A 3M8EA 1E2XA 3H9JA 2WAQA 1XGOA 1U5TC 3PUFA 5FD6A 2OCEA 1G3TA 1ULYA 2IBDA 2G0EA 5TRDA 2BXYA 3ZGKA 1MBKA 2IPQX 3HYIA 5DM7F 1U3EM 1U0JA 5FLXK 1Z0XA 2WV1A 4XONA 1L3LA 1G59A 2DMPA 2JN6A 2KL4A 3TW6A 3BR3A 4GRIA 3MZ8A 1A04A 3N4MA 2PJRA 5DYMA 3K1NA 2K9MA 2QVOA 2L7MP 3HIFA 2BGCA 1IO2A 3O8HA 3AL0C 3C18A 3Q3SA 4V2GA 4E7KA 1LEAA 2GWRA 2R7DA 1IRFA 1PP8F 4DJAA 4GFBA 4L5JA 1QNTA 1FTTA 3M07A 4I98B 4D0PA 4AIJA 2LKXA 2EBIA 1BC8C 4WCGA 4C2TA 2A69F 3O6BB 3GVAA 2P8TA 4DNCA 1RRJA 5FB2A 3ASOH 1GV5A 2ZNYA 3BWGA 5L3FA 3I58A 3BROA 1AU7A 4BEHB 1JUMA 4Y33A 4S04A 4E7LA 4CUGA 4OMYA 2ELJA 2JK3A 5M5YJ 4BXFA 2BW3A 3OWTA 2K9QA 2JQ7A 3ZPLA 3H0GJ 5DUKA 2LVSA 1ZRCA 1A6IA 4ESJA 2R7UA 1RKTA 3BZCA 1XSDA 1IRGA 3U1DA 5A2QZ 3IHUA 5IP6A 4XRSA 1KQ0A 2DK8A 2P7VB 1SVLA 5IYCJ 2Y0MA 3OYJA 4LLLA 3CCLI 2OZ6A 5J40A 2CW7A 4WXCA 1CGPA 1S29A 4UHTA 5BNGA 1YITI 4OAYA 1YJ9I 3LFKA 1YJNI 4J01A 3JRAA 3G4SI 1LE8A 1HC8A 2QF7A 1REPC 3LSKA 5IT9K 5HVQC 2CRGA 1DUXC 4ITVA 3FXUA 1A31A 1KU2A 2JA5J 2EZIA 2M5WA 2G9WA 4HA8A 3D1NI 4P5OA 1WH7A 4E4HA 3WHCA 1PJRA 1X1PA 4QIWN 5E1ZB 2J5OA 3H35A 4N9HA 1MNDA 3HOSA 4HDVA 1TW2A 2OBPA 5FROA 2JWTA 3V42A 4N0BA 2JUCA 2E2IJ 4LB5A 3PNVA 2JRTA 3C3WA 1AKHB 3CC2I 1IXSB 1BW5A 1SMYF 4UUSA 4U7DA 1Z91A 4DBRA 3K70C 4ZH4F 1BR2A 5F08A 2C6YA 1XTAA 1WI3A 3UR3C 2QSGX 1OCCH 1ETKA 3WG7H 3MN2A 4ZZDA 4N4OB 2DOAA 1BM9A 1I50J 4OMZA 4ZTJA 3G2BA 5DUIA 1FSEA 4IOCF 3FKIJ 4CDGA 3TDUC 1ZRFA 3G1OA 4U0WA 4XK4A 1HKSA 2WWYA 4ESFA 4A3FJ 1OPCA 3KZYA 2ZJPF 4Q48A 3U9GA 3E0JB 4HSTA 1XCBA 3HB9A 5ILUA 1MW7A 4D1QA 1YO5C 1FPQA 1WI9A 3QOEA 3CUQC 1YW9A 4UVAA 4BDYA 1UHWA 1UZCA 4F93B 4LFUA 1NG7A 4HYEA 2DBBA 1T0FA 4KMUX 3DPUA 4Z2YA 3JRBA 4YFNF 1MMNA 1RPWA 3H5NA 5B66C 4BHBA 3K4LA 1VF9A 3FXQA 2OCCH 4MLOA 3TEDA 3U2RA 1OR7C 2CJJA 2O8XA 1J2XA 1U6GA 4UNOA 4CCLA 4XQFA 4A5NA 5LBQA 1KU3A 3E5QA 3J81Z 5ILVA 1YLFA 3ZQQA 3ISPA 3HOUJ 2W4SA 1QBJA 1CF7B 4GYIA 1J75A 1IN8A 1MZBA 2WB1A 5DTDA 1A5JA 1TT5B 1SFOJ 1VZ0A 1ZH5A 4QLCU 2R7RA 4EGYA 2OUMA 1D8JA 2HDDA 1O4XA 2FEZA 4UUTA 3DKYA 4M6VA 2KJBA 1V5GA 2CUEA 1FOWA 2WY8Q 3J80Z 1MBJA 4ZYHA 4G7HF 1XGMA 2NVUB 1WSUA 2JPCA 1ZQ3P 1J7KA 3FBIB 2X4HA 1ORKA 1IZ1A 3S32A 4DZJA 1OFCX 3FXMA 3GLXA 2YX7A 4ZYGA 4BACA 4KT5C 5HS8A 1BBYA 2ZFWA 3EPZA 1QPMA 1WJBA 1T2KA 5B1BH 1K78A 1FP2A 4ZTFA 4BE0A 2XGEA 4S0HB 1E0EA 1Z05A 2ID6A 1R6RA 1JUSA 4C2MJ 3MQ0A 1QVTA 2ISZA 1W36D 1X1AA 2F5VA 2X1DA 3HSEA 4HZFA 2EB7A 5ILSA 4LB6B 5BQTA 1B72B 1Y39A 3E5UA 5DD8A 2M8GX 4KIFA 1I27A 3A01B 2A05A 2FU4A 3PQJA 2DA3A 4HPQA 4ZYDA 1FIPA 4HSRA 3RPQA 1K6OA 1YRNB 3GZ5A 3OS2A 1RR8C 5KAIC 4DQ2A 2RQQA 4B1RA 1XSXA 4RLQA 3ABUA 3DFGA 1IN5A 2R5YA 4C3IJ 4F3QA 1T38A 2L02A 4QPOA 3WGGA 1EF4A 3S93A 1O3SA 1MSFC 5JLWA 3HG9A 5EYRA 3R6SA 4OWRB 2DYSH 1VQ9I 3HTSB 4A3GJ 4B4CA 2IS2A 3K4BA 4DW6A 1PUFA 3OYLA 1XGSA 5J1UA 2E1NA 1FY7A 5LLQA 4DOZA 2EILH 1T98A 4HW0A 4AIDA 2GZWA 1T56A 3SXYA 1ENHA 3GTKJ 1TTYA 4BEHA 1E3PA 2LD5A 2A61A 4XR6A 3RJPA 1J5YA 5HS7A 2GIVA 4E7HA 1FMVA 1H9GA 4G94A 5EEGA 4ASNA 5EEAA 4UB8C 5GTHC 3V8JA 4Y13A 3JW4A 3HBLA 1ETWA 2EINH 4A3EJ 3VB2A 2ZXJA 1ZGAA 3QYBA 2FNPA 3PO3J 2FMYA 2FBHA 2X6WA 3T8RA 1MGTA 3KCCA 2VI6A 1Q1VA 2VBZA 3BG7A 4RAYA 3GX4X 4NQWB 1UCRA 3W3CA 1UG0A 2H8RA 3BDDA 3ONQA 3FK6A 1JXSA 2CO5A 1QU3A 3B73A 5FRNA 5TJJA 3CESA 5EGOA 3SJMA 2L54A 2ZXHA 3J7YJ 1TWAJ 1Z9CA 1OCOH 1LDKB 5GP9A 3FK7A 2FX0A 2V1DA 3B6CA 2OU2A 2VODA 4XSXF 5LGUA 2FA5A 5EZHA 2FQ3A 2A6EF 1H89C 3MMYB 2L2OA 5KK1A 2LLKA 3BOQA 4BL0B 2W85A 3BR2A 1U2WA 1RIOH 2XAUA 4G7OF 4UVCA 1UG2A 2XV4S 3EDPA 1LVAA 3HDDA 4A69C 3OL4A 4L9NA 2VXZA 2KDZA 1TT0A 4BH9A 5BPIA 3PSIA 2XPWA 4AYBA 5B3SH 1I6HJ 2VIXA 1BIBA 2BY3A 3OYEA 1EH6A 2A5YB 4MTEA 2VN2A 2HYGD 4AIHA 4X0GA 4ZDLA 4BE2A 3FM5A 4KN4X 3IKTA 2BY2A 1IXRC 3FMSA 2YSRA 3HPGA 3S2WA 5TGTA 2JVGA 1WHUA 5J4VA 1EKEA 2F4MB 2VXDA 3CCMI 3HOZJ 3K4KA 2XHKA 2IA1A 3HXLA 1R23A 4Y4RA 2DFHA 1E3HA 1SAUA 2VBWA 2Y69H 2PX9A 3GTLJ 3MVPA 1FX7A 3QRFF 3PUBA 1LDDA 5FFZA 3RSNA 2B63J 2UWMA 2H6CA 5LD2C 1DQUA 2GXAA 1R22A 5CPRB 1NH3A 4A2UA 1K4SA 1H8AC 4HF1A 3GTMJ 1WWXA 3K10A 2ELHA 2V9VA 3KEOA 4CO8A 4HOBA 2IXSA 2R5ZB 3UNGC 3I3LA 1UMQA 5HNFA 3HKZA 2TDXA 1DPRA 3KP3A 4XKWA 4M3BA 2AHQA 2X51A 2HQAA 4XLFA
chains in the Genus database with same CATH topology
1TWHJ 3RZDJ 3I4MJ 3OSGA 5K7HA 3S2DJ 5EGOB 2FD5A 3JREA 1WPKA 3CDLA 2JA6J 2PMZN 5FKNA 4BY7J 3BR5A 4CYCB 2E2JJ 3S15J 2HOAA 2FJ1A 3LSPA 1QRYA 1GUUA 1LFUP 1AHDP 2HOTA 5EG0A 3DEWA 4JX6A 5IOYA 2YUSA 3A02A 1JT0A 1MBHA 2AO9A 2CQXA 4XICA 3PO2J 4MIMA 4D5FA 1T33A 2DA7A 1ETXA 3DCFA 5FJ8J 4QTRA 1ZR2A 4MO7A 1QVUA 3Q0UA 2EQRA 3RZOJ 2NS7A 3BTIA 4A3DJ 1FEXA 3GTJJ 2EZHA 5EF6A 1IRZA 2L9RA 1ZGWA 3O8GA 1IC8A 4V2FA 2DA2A 3S14J 3S1RJ 1JTYA 4M3FA 1WCMJ 3ZQHA 1FJLA 1K61A 4A3IJ 1Y1WJ 4A3LJ 5E3NA 5GPAA 3SFIA 2IEKA 3TW7A 5GPCA 1LFBA 5FLMJ 1DU0A 2R7ZJ 3K7AJ 1U78A 2DA6A 4C3JJ 2M2EA 2HQ5A 2P81A 3ZQFA 1SANA 5F0FA 3BTJA 3Q0WA 1AKHA 2IBDA 3E7LA 3G1LA 1OCPA 3IH2A 2G0EA 3ZQLA 1NK2P 1MBKA 1WH5A 2LP0A 1Z0XA 2WV1A 2CQQA 2DMPA 4M3DA 2JN6A 1X2MA 4DYRA 2VKEA 3TW6A 3GTPJ 3BR3A 2OF7A 2H1KA 3OIOA 4Y52J 3S1NJ 2DN0A 2XPUA 1JGGA 1D5YA 4A3KJ 2L7MP 3O8HA 5M5XJ 3RKQA 4V2GA 3Q3SA 1RETA 4GFBA 5EZGA 1FTTA 2R0QC 1Z77A 2LKXA 2EBIA 5C44J 2ELKA 2DMUA 2HYJA 1P7IA 2KT0A 1JT6A 3BQZA 3HOYJ 4A3MJ 2DJNA 1DU6A 1GV5A 1HDPA 4MFEA 4A3BJ 1MNMC 1BL0A 2YS9A 1GDTA 4JX4A 1AU7A 1JUMA 4XIDA 3BR1A 2GM4A 2HXIA 2JK3A 3C2BA 5M5YJ 1POGA 1W0UA 1CQTA 3GTGJ 2K9QA 1U9NA 2DMTA 3H0GJ 3S16J 4FE4A 5JLXA 1HCRA 1E3OC 4C3HJ 2LVSA 1A6IA 4HNVA 3F0CA 1RKTA 3LNQA 2NVXJ 5FKKA 2Y31A 5IP6A 5EG0B 4XRSA 4FCYA 3BG5A 1JKPC 5IYCJ 1UHSA 1W0TA 1JUPA 2NVYJ 4NDLA 1XC5A 3OOUA 5BNGA 5IPAA 2GBYA 1QPIA 2X48A 3JRAA 1LE8A 4EEFG 1RESA 2QF7A 2TCTA 1ITYA 2Y0SN 3ZQCA 2CRGA 3RQIA 4JP0A 1NK3P 4I76A 2JA5J 2EZIA 1B8IA 2QCOA 1TWGJ 4BBRJ 5IP7J 3D1NI 1WH7A 5F0HA 2XGCA 3PM1A 3WHCA 4QIWN 4BY1J 2ME6A 4BBSJ 1FTZA 1BW6A 3NAUA 2L7ZA 4RBOA 2JWTA 3IH4A 2E2IJ 5C4XJ 4A3CJ 1F43A 4L5EA 1AKHB 1ETQA 2MG4A 3VPRA 1BW5A 4UUSA 2NS8A 2O7OA 3WHBA 4A93J 2FQ4A 1ETVA 5IYDJ 1B72A 4W1UA 1ZKGA 5F08A 1WI3A 3A01A 3G1MA 1ETKA 1TWFJ 3QPSA 3S2HJ 3MN2A 2M34A 1YRNA 3S1QJ 2CUFA 1I50J 1U9OA 5M3MJ 2WAQN 1OJLA 3UKGA 2IAIA 2L0KA 3FKIJ 4IHVA 4DYQA 3G1OA 2K40A 3HOWJ 4XK4A 4A3FJ 1MBGA 5IP9J 3HB9A 3BR0A 2VUMJ 3JRFA 2HOSA 4FE7A 3LOCA 4AYBN 2Y30A 3BT9A 5IOZA 3NARA 1G2HA 2MSYA 3K2AA 1TC3C 2OPTA 3JRBA 3FISA 2XPVA 1RPWA 4IHXA 1VF9A 4MLOA 3TEDA 2X6OA 2CJJA 1F36A 4FISA 3HGGA 3LSGA 3GTQJ 2E19A 3LSJA 1X2NA 4XRMA 4A3JJ 3LSRA 1BJZA 3GTOJ 1MSEC 4BKXA 2TRTA 3HOUJ 5C4JJ 2EZLA 5DTDA 5F04A 4DZPA 2NVQJ 1LE8B 1A5JA 4I6ZA 1SFOJ 3MKLA 3CCYA 2LTPA 1ETOA 3BR6A 2HDDA 1GVDA 5M5WJ 2NOGA 4UUTA 3JRIA 2Y9ZA 1O4XA 1B8IB 2O9LA 4M6VA 2CUEA 2JJ7A 1Y1VJ 4X1EA 1MBJA 5FKOA 4IHYA 1HOMA 1ZQ3P 2N8GA 1IDYA 1ORKA 5FLVA 2R92J 4DZJA 1OFCX 3HKZN 5E3MA 1MH3A 1ETYA 2LFBA 2XGEA 1XS9A 1R9TJ 4S0HB 3I4NJ 1IUFA 1JJ6C 5E3OA 2ID6A 5F27A 4UUSB 1JUSA 4C2MJ 4LOCA 1QVTA 1JKOC 2YU9J 3ZOBA 5C3EJ 1B72B 5EDNA 2M8GX 1HLVA 1BA5A 3BTCA 2JMWA 3A01B 3JRDA 2DA3A 3OSFA 2E1OA 1JKQC 1FIPA 1YRNB 3IH3A 5J1YA 1JJ8C 2MGQA 4B1RA 1VFCA 1HF0A 3ZQIA 2ME0A 4IEJA 2R5YA 1APLC 3HOVJ 4C3IJ 3JR9A 1VI0A 4RDUA 1EF4A 2CU7A 3SDGA 1RKWA 4QSHA 1MSFC 5JLWA 4BXXJ 2COBA 5EYRA 4A3GJ 4FTHA 3QQAA 1TWCJ 4B4CA 3IV5A 4DW6A 2DA1A 1PUFA 5J1UA 3QPLA 4Y7NJ 2W48A 1IJWC 1T56A 2LR8A 1ENHA 5J3LA 3GTKJ 3H3VK 2LD5A 2D5VA 2K9SA 4AC0A 4MFDA 1IV6A 5EEAA 4JX5A 3CQZJ 3HBLA 1ETWA 4A3EJ 1IDZA 1ZTRA 2LK2A 3PO3J 4B3AA 1JTXA 4X6AJ 2NVTJ 2EH3A 2LY9A 2XRLA 2VI6A 4D5CA 3TP3A 1Q1VA 2I10A 3BQYA 3FIWA 2R5ZA 1MH4A 1S7EA 4D7NA 3HOXJ 1NTCA 2H8RA 5K7ZA 3FK6A 2O8KA 1GT0C 4M3EA 5FKMA 2DA4A 2DA5A 5HODA 4IHWA 2DMQA 5DS9A 5EGOA 3HGYA 3SJMA 3BG9A 1GV2A 1TWAJ 5F0CA 3BTLA 5GP9A 4M3GA 1K83J 2WB1N 3B6AA 3FK7A 2FX0A 1OCTC 3B6CA 3HEFA 5EZHA 3A03A 4CYCA 1H89C 2HI3A 2LLKA 2XSDC 2DTZA 2Y2ZA 3BR2A 1HDDC 2EZKA 3Q0VA 1U8BA 3JRHA 5F1JA 1WGXA 4ABZA 1JKRC 1UG2A 2L7FP 1VNDA 2VPRA 5K7FA 1ZK8A 5E3LA 1FIAA 2R93J 3HDDA 3S1MJ 4A69C 2JA7J 2KDZA 2RAEA 3JRCA 2ECCA 2E2HJ 4J19A 2XPWA 3JRGA 2R5YB 1MBEA 1I6HJ 1X58A 4AUXA 4G12A 1IGNA 1IG7A 2XGDA 2ID3A 1H88C 4XRSG 3BG3A 4DYCA 2JA8J 1PUFB 2ZB9A 3W6VA 3CMYA 2VKVA 3GBGA 2XB0X 3ZQGA 5J1RA 5M3FJ 5FKLA 1ZR4A 2GLOA 3M4OJ 3HOZJ 2X9DA 2DMNA 1P7JA 9ANTA 5IYBJ 3GTLJ 3MVPA 2M0CA 2B63J 4D7MA 2ECBA 1MBFA 2M9HA 2Y9YA 3TP0A 3L1PA 2MW8A 1H8AC 3S17J 2HXOA 3GTMJ 2XB5A 3M3YJ 3HM5A 2K9NA 2R5ZB 1I3QJ 1UMQA 4JYKA 1XG1A 4M3BA 2AHQA 4W97A 1RR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH J;  3RZD J;  3I4M J;  3OSG A;  5K7H A;  3S2D J;  5EGO B;  2FD5 A;  3JRE A;  1WPK A;  3CDL A;  2JA6 J;  2PMZ N;  5FKN A;  4BY7 J;  3BR5 A;  4CYC B;  2E2J J;  3S15 J;  2HOA A;  2FJ1 A;  3LSP A;  1QRY A;  1GUU A;  1LFU P;  1AHD P;  2HOT A;  5EG0 A;  3DEW A;  4JX6 A;  5IOY A;  2YUS A;  3A02 A;  1JT0 A;  1MBH A;  2AO9 A;  2CQX A;  4XIC A;  3PO2 J;  4MIM A;  4D5F A;  1T33 A;  2DA7 A;  1ETX A;  3DCF A;  5FJ8 J;  4QTR A;  1ZR2 A;  4MO7 A;  1QVU A;  3Q0U A;  2EQR A;  3RZO J;  2NS7 A;  3BTI A;  4A3D J;  1FEX A;  3GTJ J;  2EZH A;  5EF6 A;  1IRZ A;  2L9R A;  1ZGW A;  3O8G A;  1IC8 A;  4V2F A;  2DA2 A;  3S14 J;  3S1R J;  1JTY A;  4M3F A;  1WCM J;  3ZQH A;  1FJL A;  1K61 A;  4A3I J;  1Y1W J;  4A3L J;  5E3N A;  5GPA A;  3SFI A;  2IEK A;  3TW7 A;  5GPC A;  1LFB A;  5FLM J;  1DU0 A;  2R7Z J;  3K7A J;  1U78 A;  2DA6 A;  4C3J J;  2M2E A;  2HQ5 A;  2P81 A;  3ZQF A;  1SAN A;  5F0F A;  3BTJ A;  3Q0W A;  1AKH A;  2IBD A;  3E7L A;  3G1L A;  1OCP A;  3IH2 A;  2G0E A;  3ZQL A;  1NK2 P;  1MBK A;  1WH5 A;  2LP0 A;  1Z0X A;  2WV1 A;  2CQQ A;  2DMP A;  4M3D A;  2JN6 A;  1X2M A;  4DYR A;  2VKE A;  3TW6 A;  3GTP J;  3BR3 A;  2OF7 A;  2H1K A;  3OIO A;  4Y52 J;  3S1N J;  2DN0 A;  2XPU A;  1JGG A;  1D5Y A;  4A3K J;  2L7M P;  3O8H A;  5M5X J;  3RKQ A;  4V2G A;  3Q3S A;  1RET A;  4GFB A;  5EZG A;  1FTT A;  2R0Q C;  1Z77 A;  2LKX A;  2EBI A;  5C44 J;  2ELK A;  2DMU A;  2HYJ A;  1P7I A;  2KT0 A;  1JT6 A;  3BQZ A;  3HOY J;  4A3M J;  2DJN A;  1DU6 A;  1GV5 A;  1HDP A;  4MFE A;  4A3B J;  1MNM C;  1BL0 A;  2YS9 A;  1GDT A;  4JX4 A;  1AU7 A;  1JUM A;  4XID A;  3BR1 A;  2GM4 A;  2HXI A;  2JK3 A;  3C2B A;  5M5Y J;  1POG A;  1W0U A;  1CQT A;  3GTG J;  2K9Q A;  1U9N A;  2DMT A;  3H0G J;  3S16 J;  4FE4 A;  5JLX A;  1HCR A;  1E3O C;  4C3H J;  2LVS A;  1A6I A;  4HNV A;  3F0C A;  1RKT A;  3LNQ A;  2NVX J;  5FKK A;  2Y31 A;  5IP6 A;  5EG0 B;  4XRS A;  4FCY A;  3BG5 A;  1JKP C;  5IYC J;  1UHS A;  1W0T A;  1JUP A;  2NVY J;  4NDL A;  1XC5 A;  3OOU A;  5BNG A;  5IPA A;  2GBY A;  1QPI A;  2X48 A;  3JRA A;  1LE8 A;  4EEF G;  1RES A;  2QF7 A;  2TCT A;  1ITY A;  2Y0S N;  3ZQC A;  2CRG A;  3RQI A;  4JP0 A;  1NK3 P;  4I76 A;  2JA5 J;  2EZI A;  1B8I A;  2QCO A;  1TWG J;  4BBR J;  5IP7 J;  3D1N I;  1WH7 A;  5F0H A;  2XGC A;  3PM1 A;  3WHC A;  4QIW N;  4BY1 J;  2ME6 A;  4BBS J;  1FTZ A;  1BW6 A;  3NAU A;  2L7Z A;  4RBO A;  2JWT A;  3IH4 A;  2E2I J;  5C4X J;  4A3C J;  1F43 A;  4L5E A;  1AKH B;  1ETQ A;  2MG4 A;  3VPR A;  1BW5 A;  4UUS A;  2NS8 A;  2O7O A;  3WHB A;  4A93 J;  2FQ4 A;  1ETV A;  5IYD J;  1B72 A;  4W1U A;  1ZKG A;  5F08 A;  1WI3 A;  3A01 A;  3G1M A;  1ETK A;  1TWF J;  3QPS A;  3S2H J;  3MN2 A;  2M34 A;  1YRN A;  3S1Q J;  2CUF A;  1I50 J;  1U9O A;  5M3M J;  2WAQ N;  1OJL A;  3UKG A;  2IAI A;  2L0K A;  3FKI J;  4IHV A;  4DYQ A;  3G1O A;  2K40 A;  3HOW J;  4XK4 A;  4A3F J;  1MBG A;  5IP9 J;  3HB9 A;  3BR0 A;  2VUM J;  3JRF A;  2HOS A;  4FE7 A;  3LOC A;  4AYB N;  2Y30 A;  3BT9 A;  5IOZ A;  3NAR A;  1G2H A;  2MSY A;  3K2A A;  1TC3 C;  2OPT A;  3JRB A;  3FIS A;  2XPV A;  1RPW A;  4IHX A;  1VF9 A;  4MLO A;  3TED A;  2X6O A;  2CJJ A;  1F36 A;  4FIS A;  3HGG A;  3LSG A;  3GTQ J;  2E19 A;  3LSJ A;  1X2N A;  4XRM A;  4A3J J;  3LSR A;  1BJZ A;  3GTO J;  1MSE C;  4BKX A;  2TRT A;  3HOU J;  5C4J J;  2EZL A;  5DTD A;  5F04 A;  4DZP A;  2NVQ J;  1LE8 B;  1A5J A;  4I6Z A;  1SFO J;  3MKL A;  3CCY A;  2LTP A;  1ETO A;  3BR6 A;  2HDD A;  1GVD A;  5M5W J;  2NOG A;  4UUT A;  3JRI A;  2Y9Z A;  1O4X A;  1B8I B;  2O9L A;  4M6V A;  2CUE A;  2JJ7 A;  1Y1V J;  4X1E A;  1MBJ A;  5FKO A;  4IHY A;  1HOM A;  1ZQ3 P;  2N8G A;  1IDY A;  1ORK A;  5FLV A;  2R92 J;  4DZJ A;  1OFC X;  3HKZ N;  5E3M A;  1MH3 A;  1ETY A;  2LFB A;  2XGE A;  1XS9 A;  1R9T J;  4S0H B;  3I4N J;  1IUF A;  1JJ6 C;  5E3O A;  2ID6 A;  5F27 A;  4UUS B;  1JUS A;  4C2M J;  4LOC A;  1QVT A;  1JKO C;  2YU9 J;  3ZOB A;  5C3E J;  1B72 B;  5EDN A;  2M8G X;  1HLV A;  1BA5 A;  3BTC A;  2JMW A;  3A01 B;  3JRD A;  2DA3 A;  3OSF A;  2E1O A;  1JKQ C;  1FIP A;  1YRN B;  3IH3 A;  5J1Y A;  1JJ8 C;  2MGQ A;  4B1R A;  1VFC A;  1HF0 A;  3ZQI A;  2ME0 A;  4IEJ A;  2R5Y A;  1APL C;  3HOV J;  4C3I J;  3JR9 A;  1VI0 A;  4RDU A;  1EF4 A;  2CU7 A;  3SDG A;  1RKW A;  4QSH A;  1MSF C;  5JLW A;  4BXX J;  2COB A;  5EYR A;  4A3G J;  4FTH A;  3QQA A;  1TWC J;  4B4C A;  3IV5 A;  4DW6 A;  2DA1 A;  1PUF A;  5J1U A;  3QPL A;  4Y7N J;  2W48 A;  1IJW C;  1T56 A;  2LR8 A;  1ENH A;  5J3L A;  3GTK J;  3H3V K;  2LD5 A;  2D5V A;  2K9S A;  4AC0 A;  4MFD A;  1IV6 A;  5EEA A;  4JX5 A;  3CQZ J;  3HBL A;  1ETW A;  4A3E J;  1IDZ A;  1ZTR A;  2LK2 A;  3PO3 J;  4B3A A;  1JTX A;  4X6A J;  2NVT J;  2EH3 A;  2LY9 A;  2XRL A;  2VI6 A;  4D5C A;  3TP3 A;  1Q1V A;  2I10 A;  3BQY A;  3FIW A;  2R5Z A;  1MH4 A;  1S7E A;  4D7N A;  3HOX J;  1NTC A;  2H8R A;  5K7Z A;  3FK6 A;  2O8K A;  1GT0 C;  4M3E A;  5FKM A;  2DA4 A;  2DA5 A;  5HOD A;  4IHW A;  2DMQ A;  5DS9 A;  5EGO A;  3HGY A;  3SJM A;  3BG9 A;  1GV2 A;  1TWA J;  5F0C A;  3BTL A;  5GP9 A;  4M3G A;  1K83 J;  2WB1 N;  3B6A A;  3FK7 A;  2FX0 A;  1OCT C;  3B6C A;  3HEF A;  5EZH A;  3A03 A;  4CYC A;  1H89 C;  2HI3 A;  2LLK A;  2XSD C;  2DTZ A;  2Y2Z A;  3BR2 A;  1HDD C;  2EZK A;  3Q0V A;  1U8B A;  3JRH A;  5F1J A;  1WGX A;  4ABZ A;  1JKR C;  1UG2 A;  2L7F P;  1VND A;  2VPR A;  5K7F A;  1ZK8 A;  5E3L A;  1FIA A;  2R93 J;  3HDD A;  3S1M J;  4A69 C;  2JA7 J;  2KDZ A;  2RAE A;  3JRC A;  2ECC A;  2E2H J;  4J19 A;  2XPW A;  3JRG A;  2R5Y B;  1MBE A;  1I6H J;  1X58 A;  4AUX A;  4G12 A;  1IGN A;  1IG7 A;  2XGD A;  2ID3 A;  1H88 C;  4XRS G;  3BG3 A;  4DYC A;  2JA8 J;  1PUF B;  2ZB9 A;  3W6V A;  3CMY A;  2VKV A;  3GBG A;  2XB0 X;  3ZQG A;  5J1R A;  5M3F J;  5FKL A;  1ZR4 A;  2GLO A;  3M4O J;  3HOZ J;  2X9D A;  2DMN A;  1P7J A;  9ANT A;  5IYB J;  3GTL J;  3MVP A;  2M0C A;  2B63 J;  4D7M A;  2ECB A;  1MBF A;  2M9H A;  2Y9Y A;  3TP0 A;  3L1P A;  2MW8 A;  1H8A C;  3S17 J;  2HXO A;  3GTM J;  2XB5 A;  3M3Y J;  3HM5 A;  2K9N A;  2R5Z B;  1I3Q J;  1UMQ A;  4JYK A;  1XG1 A;  4M3B A;  2AHQ A;  4W97 A;  1RR7 A; 
#chains in the Genus database with same CATH topology
 2JUG A;  3BLY A;  1TWH J;  5HNH A;  2B7E A;  5KNL A;  3S2D J;  3IWZ A;  2DFE A;  3T5X A;  2RGV A;  1Z7L A;  3I55 I;  1XX5 A;  2XKO A;  4L0Z B;  4FET A;  4CSW A;  3JCU C;  1WZ2 A;  2HZD A;  4B09 A;  3HSR A;  1AHD P;  1YQA A;  2O6G E;  4L0Y B;  3DEW A;  2EIM H;  5IOY A;  1JT0 A;  2P6T A;  1MBH A;  1RC9 A;  2AO9 A;  3NWS A;  1PDN C;  1MIJ A;  4RM3 A;  4CCN A;  4HRI A;  4MIM A;  4BHC A;  4D5F A;  1T33 A;  4XOT A;  3DCF A;  1QVU A;  3ELK A;  3ABM H;  3QAH A;  4IKF A;  1XPX A;  2A6H F;  1W7P D;  3J7A Y;  2VBX A;  2NS7 A;  1FEX A;  3GTJ J;  3I59 B;  1OCR H;  2L9R A;  4ZYA A;  3O8G A;  3W2V A;  5EF6 A;  2ZJR F;  4A6D A;  1IC8 A;  3GEZ A;  2JA2 A;  1HBX G;  4M3F A;  4L9V A;  2VAS A;  4OIO F;  1ZHF A;  3V8K A;  3PIP F;  3CF5 F;  1FJL A;  5AON A;  2DOE A;  4M6Y A;  2KP6 A;  2M87 A;  3DBR B;  1XD7 A;  2LBF A;  3CMA I;  2R7Z J;  1XMA A;  3KYL A;  3K7A J;  1YW8 A;  1QZY A;  1ZYR F;  3K69 A;  4XNF A;  4C3J J;  1Y0N A;  1W7P B;  2KZV A;  3GLL A;  1SAN A;  3GO5 A;  5KVR A;  3DBH B;  1OCP A;  1YX5 A;  2YU3 A;  3F6O A;  1FNN A;  3S3N A;  5E18 F;  4GYG A;  2CQQ A;  2XRN A;  1ERD A;  1HW1 A;  3E97 A;  3JAM Z;  4XLH A;  2EA4 A;  4M73 A;  5BPD A;  4DYR A;  4CGZ A;  3FXL A;  3P9C A;  3ABL H;  3SYT A;  1MMS A;  1R58 A;  2OF7 A;  2H1K A;  4Y52 J;  2PEX A;  2XPU A;  2DFF A;  3KLO A;  3LSM A;  4BU2 A;  5DDG A;  3G71 I;  3FXK A;  3F23 A;  3CJN A;  1R49 A;  2DXI A;  1RET A;  4KT6 A;  4XRF A;  2KRF A;  3DU5 A;  5C44 J;  2ADU A;  2HYJ A;  2IGO A;  4IQJ A;  2KT0 A;  3BQZ A;  1G4D A;  1S7A A;  1HDP A;  2LRD A;  2D2W A;  3L2C A;  4AWX B;  3WU2 C;  3DPL C;  4XID A;  3BR1 A;  2X1E A;  3CLQ A;  2GM4 A;  3C2B A;  1FZP B;  1W0U A;  4HG2 A;  1X4O A;  3ULQ B;  3GTG J;  4ENM A;  3S16 J;  2X0L A;  4L5I A;  4ETS A;  4IX7 A;  1V5E A;  2EV5 A;  3D5L A;  4EVI A;  1IF1 A;  3F0C A;  1IN6 A;  2KRC A;  4MQV A;  3WTX C;  4PSW A;  2WTE A;  1N77 A;  1VQ7 I;  3FHN A;  3BG5 A;  3ZQ7 A;  2GXB A;  1JKP C;  4O5V A;  3PIO F;  3VDX A;  4XLC A;  1MD0 A;  2OD5 A;  2X1C A;  4NDL A;  3TO9 A;  3ROU A;  4M74 A;  5J8F A;  1HKT A;  5IPA A;  5D4S A;  2Z16 A;  1QPI A;  4TV7 A;  1SMT A;  5E20 A;  3TMO A;  1QA6 A;  2I5U A;  3RPU D;  4HF2 A;  3ZQC A;  3TDZ C;  4M71 A;  3HHG A;  1NK3 P;  3CCQ I;  2DDA A;  2KHM A;  3GUD A;  5CVI A;  2HS5 A;  3I53 A;  2IA0 A;  5J6X A;  5K1Y A;  2LY2 A;  3DEE A;  3K4N A;  3FX3 A;  2GOX B;  4IRH A;  2RRE A;  4BBS J;  2ME6 A;  2PBI A;  1R36 A;  3NQO A;  1T0F C;  3NAU A;  2L7Z A;  2P7C B;  2DAO A;  3H36 A;  3MKW B;  3IH4 A;  3WTV C;  4HQE A;  4CHU A;  1SVM A;  4HQM A;  4A3C J;  4ZYE A;  1OIS A;  2QKL B;  1ETQ A;  2E71 A;  4HF0 A;  5CQG A;  4AM3 A;  2K86 A;  4LD5 A;  2ESN A;  2Z99 A;  5F64 A;  1FBS A;  2EA2 A;  3L2R A;  2CW8 A;  3TGN A;  2K27 A;  1BI3 A;  2QLZ A;  3ZRG A;  3V7S A;  4YEJ A;  5IYD J;  5FFX A;  2F5D A;  4KJZ A;  1Y8R B;  2EFN A;  4EM2 A;  1TWF J;  3R60 A;  4G8X A;  2ETH A;  5CVU A;  4IRG A;  1QZZ A;  2QM3 A;  2WAQ N;  2WAF A;  3LA3 A;  4F92 B;  3PNT A;  4IHV A;  1R7J A;  2BY0 A;  2IGM A;  3HOW J;  2L9V A;  4CA0 A;  1TNT A;  2VLA A;  3FXR A;  2RQP A;  3BP8 A;  3QYE A;  4RB3 C;  1RNL A;  5KAF C;  3IP4 B;  3BR0 A;  4KIB A;  4XN0 A;  3E5X A;  2GA1 A;  2J5P A;  2WV0 A;  4Q4Z F;  2HOS A;  4WWC A;  4FE7 A;  2KFD A;  3AG3 H;  5IOZ A;  3VYU B;  3NAR A;  1G2H A;  3BPX A;  2MSY A;  3BZ6 A;  3K2A A;  4Y15 A;  1RZ4 A;  4XLE A;  2R7S A;  4RAF A;  2OC6 A;  3ERM A;  2XPV A;  5K5Q A;  4IZZ A;  1B4A A;  1G8X A;  2CH0 A;  3TL4 X;  1U5T B;  5LGN A;  2F5F A;  2F5C A;  4IPA A;  2QA4 I;  3OS1 A;  1T8I A;  3WTY C;  2KQR A;  1WKM A;  3M7G A;  2E1M C;  4FIS A;  4ENK A;  2H94 A;  3LAJ A;  1LUJ B;  3GTQ J;  2E19 A;  3LSJ A;  2RN7 A;  4A3J J;  3GTO J;  3LSR A;  3AG4 H;  2MD0 A;  2FSW A;  4A6E A;  3WGI A;  2R7X A;  2KDO A;  3E6M A;  1O57 A;  4S05 A;  4HNU A;  4PJN A;  4BXU A;  2G7H A;  2F4I A;  4DZP A;  4G7Z F;  3KP6 A;  2NVQ J;  1XN7 A;  4A12 A;  3MKL A;  3CCY A;  1Z3Y A;  2LTP A;  2DYR H;  2DPU A;  1GVD A;  5M5W J;  2NOG A;  4HLY A;  2DPD A;  1B8I B;  3GFL A;  2DT7 B;  4LK0 F;  2JJ7 A;  1AWC A;  1PVE A;  4X1E A;  3VWB A;  1FSH A;  1R1U A;  1S6L A;  3IAS 2;  3CC7 I;  1G3W A;  2VJI A;  1RUN A;  3R4K A;  5AIP A;  1MH3 A;  1ETY A;  3A0B C;  3X2Q H;  2ZME A;  4YII A;  1ON2 A;  3PFY A;  1QZE A;  1YOV B;  1HSJ A;  4Y17 A;  2D1V A;  4YRV A;  1X1C A;  1R9T J;  3I4N J;  1S7O A;  1IUF A;  4Q5S F;  3I5U A;  3H9G A;  3HL2 A;  3ERE D;  2Y48 A;  4LOC A;  1G3S A;  2ZO4 A;  3OYA A;  3DTE A;  2YU9 J;  1S3J A;  5C3E J;  2X6Y A;  2QQA A;  5HDG A;  4HBL A;  4FT8 A;  1HLV A;  4CIC A;  3OYM A;  1JKQ C;  1Z6T A;  5B1A H;  3EUH A;  3DTK A;  3S8P A;  2CW0 F;  3IH3 A;  5J1Y A;  4OU0 A;  4UV8 A;  4IF4 A;  3CCE I;  1VFC A;  3EET A;  3F21 A;  1HF0 A;  1DP3 A;  1DP7 P;  3O2P E;  4IEJ A;  5GAE J;  4XL9 A;  2UZK A;  3ABT A;  3LMM A;  3SDG A;  3OOP A;  3H5A A;  2H09 A;  2K4B A;  1PYV A;  4FTH A;  5IT9 Z;  2COM A;  3QQA A;  2QWW A;  2UV1 A;  3F8N A;  4RAG A;  2IVM A;  1X1B A;  2DA1 A;  3DF8 A;  2HVS A;  1BOB A;  2ZFU A;  3QPL A;  4XOP A;  2QQB A;  3WE2 A;  5GAG J;  2QZ8 A;  2Q1Z B;  2W48 A;  3V7R A;  1IJW C;  4I99 C;  3WE3 A;  1WQ2 A;  2EJR A;  3HRM A;  4BQA A;  2FUG 2;  2CUJ A;  2D5V A;  1MJ9 A;  2EV0 A;  3BG6 A;  1O7L A;  3RKW A;  3JSO A;  4U0V A;  1WVR A;  1VQ6 I;  2NOJ B;  1WJ5 A;  2EWN A;  4AC0 A;  4MFD A;  2R7T A;  5DV5 A;  4KIG A;  4G6T B;  3WGH A;  4EM1 A;  1I1G A;  2MLG A;  1K79 A;  1JTX A;  2NYX A;  2OAZ A;  3ZN1 A;  2QUF A;  3ZP5 A;  4X6A J;  3FBN B;  4I09 A;  5DEQ A;  4JBA A;  2Q8K A;  5HLG A;  4BE1 A;  2I10 A;  4OIN F;  1D1C A;  3DV8 A;  5HLI A;  5ICC A;  3HOX J;  4LIV A;  3F8B A;  5K7Z A;  2O8K A;  5DCM B;  2R7W A;  2BY1 A;  2LMD A;  2DA4 A;  2DA5 A;  2K9L A;  2DMQ A;  3P9I A;  5DS9 A;  2R7O A;  3KYC B;  2R7V A;  3WU0 A;  1GV2 A;  3TBI A;  3CCR I;  5F0C A;  3KEY A;  4M3G A;  2WB1 N;  2BBY A;  1BI1 A;  4PJJ A;  3HEF A;  2OJE D;  2P4W A;  2W84 A;  2XGX A;  2WAD A;  4CYC A;  3W6J B;  1WJF A;  2XSD C;  5GTI C;  2V1N A;  2Y2Z A;  2EZK A;  2D45 A;  3JRH A;  4KA4 A;  4LGW A;  1WGX A;  2L7K A;  2L7F P;  4RB1 A;  2VPR A;  4Z6Y A;  5K7F A;  1SFK A;  1ZK8 A;  1FIA A;  2P5K A;  4LG0 B;  4E7I A;  3KZI C;  2JA7 J;  1UJ8 A;  3CJQ B;  1KQ9 A;  1J9I A;  2R3S A;  1BR4 A;  1X58 A;  2V1X A;  1VQO I;  5D6E A;  4N9I A;  5ICG A;  3OYD A;  2H6B A;  1IG7 A;  3J80 K;  1MDM A;  2ID3 A;  4UVB A;  3KLN A;  2KIS A;  2I8D A;  3IAM 2;  4KMF A;  2E5Z A;  1QHG A;  2W25 A;  2XB0 X;  4DGW B;  1FOX A;  4EGZ A;  2P0W A;  5ICF A;  5M3F J;  4LIT A;  5K5O A;  1ZR4 A;  4P9F A;  3LA7 A;  2IRF G;  4M6X A;  2VT3 A;  3PSF A;  2X9D A;  2PMU A;  2DMN A;  4ZZL A;  2XDV A;  1SD7 A;  4MHG A;  4F52 A;  2CFO A;  4V19 K;  2JT1 A;  3S3M A;  3W2A A;  3Q9S A;  3K4M A;  2M0C A;  3LL7 A;  3Q5F A;  4NC7 A;  1GHC A;  2ECB A;  3D5R C;  1GXP A;  3IL2 A;  5FRM A;  2KZG A;  2MW8 A;  5LRS A;  3C2G A;  3B02 A;  3K1M A;  3FKJ A;  3K2Z A;  2M1B A;  1XSV A;  2R7Q A;  2AXL A;  5D5X B;  2MA3 A;  1HW5 A;  1N25 A;  2OQR A;  1RR7 A;  3GFM A;  1UAA A;  4O3M A;  4NHJ A;  4I0A A;  3MEX A;  1EJ9 A;  5L3B A;  3OSG A;  1O3T A;  1SFX A;  3O3K A;  2FD5 A;  3F8F A;  4PCQ A;  3BY6 A;  2JRM A;  2JA6 J;  3QOD A;  1FT9 A;  1ON1 A;  3TOB A;  4OAZ A;  2JVH A;  4M9S A;  1V4R A;  3BR5 A;  4IOA F;  2E2J J;  2VE8 A;  3VYS B;  4OIQ F;  4CH7 A;  2QEN A;  3VOE A;  1LFU P;  2PG4 A;  4IVN A;  3HRS A;  5F6F A;  2CG4 A;  2YUS A;  3WTS C;  2LRE A;  4XKC A;  3P9K A;  4ENJ A;  4KIC A;  1YYV A;  3ML6 A;  1A35 A;  2DTR A;  2ZJ2 A;  3A2K A;  1ETX A;  3VOD A;  2DT5 A;  3GZN B;  4HEA 2;  5JI6 A;  2MFZ A;  3CCS I;  4A3D J;  3BTI A;  4RGU A;  5CYV A;  2EZH A;  2NRA C;  3HSF A;  4HX4 A;  3S14 J;  1I39 A;  1R5H A;  1D3Y A;  2M7A A;  2H27 A;  3LFU A;  1IXC A;  2EIJ H;  2HDC A;  1WCM J;  3KFW X;  5J4Y A;  3COA C;  4BHP A;  4A3I J;  1Y1W J;  2L9N A;  2VB6 A;  1YX3 A;  2QQ8 A;  3SFI A;  1Z7U A;  5GPC A;  1P6R A;  1DU0 A;  1U78 A;  3IKV A;  4HAM A;  1KU7 A;  2M2E A;  2HQ5 A;  3RI4 A;  3ZQF A;  2YR2 A;  4UV9 A;  3BTJ A;  3Q0W A;  1AKH A;  2EFQ A;  3E7L A;  3G1L A;  3ZMT A;  1UST A;  4KIS A;  2DK5 A;  2LF7 A;  1YG2 A;  3U21 A;  1WH5 A;  2LP0 A;  4M3D A;  4I0B A;  3MKZ A;  1X2M A;  4GDF A;  2H1L A;  4RS8 A;  3RTR A;  2CYY A;  1DGW Y;  2E5N A;  3GTP J;  3OIO A;  3ZMZ A;  2DN0 A;  3T1B A;  1JGG A;  1ZLK A;  1D5Y A;  5EEH A;  1Q1H A;  4A3K J;  4XMY A;  3ZMS A;  5M5X J;  2VQG A;  2STW A;  4HV5 A;  1D5V A;  2R0Q C;  1LNW A;  2MLK A;  1OMI A;  2ELK A;  2LOO A;  2M8E A;  3HUG B;  2EPF A;  4GXO A;  5KCM A;  3U1K A;  3HOY J;  4A3M J;  4KN7 X;  1IN7 A;  1MNM C;  2VJJ A;  1XDS A;  2O5R A;  2LDU A;  2YPR A;  1GDT A;  4JX4 A;  3K1P A;  5IT3 A;  2MC4 A;  3GXO A;  3M9A A;  3QPH A;  2HOE A;  1D8K A;  3VYR B;  2DQR A;  2VQC A;  1POG A;  3HRU A;  2DMT A;  5JLX A;  1I5Z A;  1JHF A;  5E8G A;  1E3O C;  1MKM A;  4A0X A;  2VE9 A;  2NVX J;  2VON A;  5FKK A;  3RYR A;  4CCO A;  2Y31 A;  3E6D A;  4E7Z A;  5EG0 B;  4CZC A;  4BQQ A;  1YHQ I;  1TZL A;  2E7X A;  3GFI A;  2CUZ A;  3E3V A;  4LK1 F;  3JTG A;  1DDN A;  4IHS A;  4LLN A;  4PFP A;  4E6K G;  1W0T A;  1JUP A;  2NVY J;  4IJA A;  1XC5 A;  3OOU A;  3PJR A;  2QBY B;  2V6C A;  1CF7 A;  3RYP A;  2XF5 A;  2XUB A;  2KIF A;  2GBY A;  5GAH J;  2DOD A;  4BJ6 C;  4LG0 A;  1SD6 A;  5LHI A;  4F91 B;  3PQK A;  2TCT A;  3G6E I;  1VQN I;  2E60 A;  2FOW A;  2Y0S N;  1ITY A;  3RQI A;  1YS7 A;  4DIQ A;  4FHT A;  4JP0 A;  4UXN A;  1F1Z A;  3AG1 H;  2QCO A;  4BBR J;  2XF7 A;  1B6A A;  5IP7 J;  5CVJ A;  2GA2 A;  5JFR A;  3PM1 A;  4EJU A;  2IGN A;  2HPI A;  4NNJ A;  5EJC A;  4EJO A;  2HEO A;  3FDY A;  2PLY A;  4C9Y A;  4RBO A;  3DWL E;  1S5L C;  4G6Q A;  4IL6 C;  3V7C A;  3MZH A;  1U8R A;  5C4X J;  2DOF A;  2CSO A;  5CLS A;  4L5E A;  2MG4 A;  3N05 A;  1F4K A;  2OTL I;  2DCE A;  4P96 A;  3CZ6 A;  3LWF A;  2O7O A;  5D8L B;  3KZZ A;  4KYW A;  4YIF A;  2BVL A;  3WHB A;  4LIU A;  1OLT A;  4A93 J;  4F7Z A;  1ETV A;  3BJ6 A;  4FAS D;  4MEX F;  4JK1 X;  1B72 A;  3SFZ A;  3CC4 I;  3I64 A;  3IRQ A;  1FP1 D;  1ZKG A;  5JR3 A;  3A01 A;  4WK8 F;  1Y56 A;  2PJR B;  3G1M A;  1W5T A;  3HRT A;  1KYZ A;  1YW7 A;  3PNY A;  2M34 A;  1YRN A;  3S1Q J;  2CUF A;  1UEL B;  5H6Q A;  4XOR A;  5M3M J;  1VQM I;  2W82 A;  1OJL A;  3UKG A;  2IAI A;  4DYQ A;  2K40 A;  1WFX A;  2QEX I;  2L4M A;  4AVZ A;  4PJM A;  3KP5 A;  1JI8 A;  1MBG A;  1I6X A;  4O6J A;  3LQQ A;  1SVO A;  3Q9V A;  5D5V B;  1ZAO A;  4RGX A;  1ZAR A;  3WTW C;  2HU9 A;  1BOA A;  3GME A;  3MWM A;  2ZME C;  5BOX A;  2BW3 B;  2P5V A;  2ZCW A;  4L18 B;  3F9K A;  1K7A A;  4QPQ A;  3I56 I;  1B59 A;  4PJ0 C;  1FC3 A;  3FIS A;  3VSL A;  2QYO A;  2DU9 A;  2HZT A;  4IHX A;  2V6E A;  3J7A O;  2DT6 A;  1F36 A;  3HGG A;  3LSG A;  4KUM A;  1ZEL A;  1BJZ A;  1O3R A;  3DU6 A;  1VQ5 I;  1LEB A;  1MSE C;  4BKX A;  2TRT A;  2ESH A;  3H5R A;  2EZL A;  1QHH D;  1Y8Q B;  3EUH C;  3F8C A;  1HST A;  2Z5U A;  3R0J A;  3J7Z I;  3DLL F;  5F04 A;  3H1C A;  3S3O A;  1LE8 B;  4I6Z A;  1MMG A;  3E6B A;  2KLO A;  2CQN A;  1LVK A;  1ETO A;  3BR6 A;  3FMQ A;  1KZH A;  3JRI A;  4NQW A;  4XM3 A;  1BI2 A;  2EK5 A;  1Y1V J;  3MAJ A;  3QU6 A;  5FKO A;  1HOM A;  1D0Y A;  2N8G A;  2RC4 A;  1IDY A;  1N75 A;  3BCB A;  5FLV A;  3GW2 A;  5E3M A;  3OYI A;  1T08 B;  4RMN A;  2A07 F;  4PSX A;  3GF2 A;  5BS6 A;  4LJZ F;  3ASN H;  5HDK A;  2LFB A;  2DLL A;  5L3E A;  2BZT A;  3KIO A;  2ZKZ A;  4HX8 A;  3EYY A;  4OOI A;  6PAX A;  5HS9 A;  1XS9 A;  2DQL A;  2K3P A;  4XLP F;  1JJ6 C;  1KQ8 A;  2VJ5 A;  1LFP A;  4UUS B;  1TW3 A;  3C2H A;  3LA2 A;  1JKO C;  2EFW A;  4NUB A;  3OL3 A;  3ZOB A;  4RAZ A;  3RDI A;  5FD5 A;  5E8I A;  1R4N B;  1BA5 A;  3CJT B;  1X3U A;  2Z2S B;  3JRD A;  5E17 F;  2A3S A;  3DKX A;  2KRH A;  1YI2 I;  2JTV A;  1JJ8 C;  2M4G A;  3MFK A;  4MGR A;  5H6R A;  5GAD J;  3DPT A;  3CLO A;  4A5M A;  3ZQI A;  1K4T A;  2XC7 A;  4PK4 A;  5L3C A;  5JHU A;  2P5L C;  3CTA A;  3EQL F;  2CU7 A;  4EJV A;  2K7L A;  3QYF A;  1RKW A;  4QSH A;  4BXX J;  1LB2 A;  5D4R A;  1SFE A;  3T8T A;  3M8F A;  4E70 A;  3JSP A;  1SFU A;  4BQO A;  1T95 A;  1X4P A;  3H0D A;  4KDP A;  1VQK I;  5J3L A;  2LR8 A;  3H3V K;  2K9S A;  1EH7 A;  3DLA A;  4U88 A;  2L01 A;  3E6C C;  1IV8 A;  3HJE A;  1IV6 A;  2A68 F;  4JX5 A;  3CQZ J;  1PUE E;  1EA3 A;  1IDZ A;  1X19 A;  1ZTR A;  2BHY A;  2LK2 A;  4J00 A;  4I01 A;  2PMZ A;  2NVT J;  4I2O A;  2LY9 A;  2AQE A;  3TP3 A;  1ZRE A;  4RLF A;  2R5Z A;  3BQY A;  3FIW A;  3RIR A;  1MH4 A;  2WC2 A;  4WF2 A;  5CKT A;  3AKZ A;  3KP4 A;  1JHH A;  1NTC A;  2HKX A;  1GT0 C;  1ONV A;  2KKO A;  3ZMD A;  5FKM A;  1V5F A;  5HOD A;  2X6X A;  1TNS A;  3ECH A;  4BDZ A;  1FMW A;  3BG9 A;  4B44 A;  2WY7 Q;  1KU9 A;  2F5E A;  1K78 B;  2V1U A;  1K83 J;  3B6A A;  3KPH A;  2GOM A;  4XLA A;  1R71 A;  3A0H C;  1OCT C;  3EUK L;  1IW7 F;  3QP5 A;  1EH8 A;  5L3D A;  3A03 A;  3IUO A;  2L9S A;  2MYS A;  1DPU A;  4FX0 A;  4ZDP A;  1YE9 A;  2E1M B;  2DTZ A;  2DO7 A;  4B3X A;  5HLH A;  1HDD C;  2UXN A;  4KIT B;  2V9P A;  4P9U A;  3RQ4 A;  1ODD A;  5HOO A;  1FWZ A;  3R0A A;  3OV8 A;  4XN3 A;  5FLX Z;  3EYI A;  2FBI A;  2CQ7 A;  2CWE A;  1JKR C;  3AL0 B;  5J8C A;  1VND A;  2Q0O A;  4IQ4 A;  4E7J A;  2EV6 A;  2R93 J;  2NAZ A;  1P4W A;  2ACJ A;  3L2V A;  2MH2 A;  4MQ9 F;  2E2H J;  3D5S C;  3FZV A;  4EJT A;  2R5Y B;  1MBE A;  5LGT A;  2O03 A;  1XB4 A;  3I59 A;  3DXJ F;  2DJI A;  3HOT A;  5B5E C;  1DGR M;  4Q47 A;  4DYC A;  1TQP A;  5D5W B;  2FML A;  4ENN A;  5KHD A;  2JA8 J;  1K6Y A;  1PUF B;  2ZB9 A;  3BPV A;  3W6V A;  3CMY A;  3GBG A;  1Y6I A;  4ZJZ A;  1ZG1 A;  3ZQG A;  5A2Q K;  4GCV A;  1TP4 A;  1P9Q C;  3L7W A;  1AA7 A;  2GLO A;  3BZK A;  3M4O J;  1IN4 A;  3L2W A;  1W7P A;  2OQG A;  3LQR A;  1P7J A;  2IGK A;  4H0E A;  1FYM A;  2F4O B;  9ANT A;  3KET A;  5K5R A;  3M8J A;  4ESB A;  4I02 A;  4PJL A;  5IYB J;  4EV0 A;  2RNJ A;  1ACI A;  3I71 A;  2RV8 A;  2ICW G;  2HVQ A;  4YIR X;  4D7M A;  4RB0 A;  1FLI A;  1MBF A;  2AXT C;  2M9H A;  2KJC A;  2LF8 A;  3L1P A;  1ZN2 A;  1R5I D;  3TOA A;  2HXO A;  2XB5 A;  5LEK A;  3HM5 A;  2K9N A;  2V9K A;  4R79 A;  4L9T A;  4NBQ A;  3ESW B;  1I3Q J;  4JYK A;  3C1D A;  2OV7 A;  2HPM A;  1XG1 A;  3VSK A;  1WRJ A;  3K70 D;  1UHS A;  1QO0 D;  1MJA A;  1WJD A;  4W97 A;  2VKH A;  3RZD J;  4D9J A;  5EGO B;  3IRR A;  4I7H A;  3JRE A;  2IJL A;  1W5C C;  1H9T A;  1WPK A;  3CDL A;  1HXD A;  5F1R A;  2M45 A;  2FNA A;  1BIA A;  2LH9 A;  1TQM A;  1JE8 A;  3S15 J;  4YFX F;  1W4M A;  2M0M A;  3N97 A;  1AOY A;  2OA4 A;  2CV2 A;  2FJ1 A;  4MTD A;  2VOP A;  3MKY B;  3GZ6 A;  4IRI A;  3I4P A;  1STZ A;  4LLG F;  2L4A A;  2HOT A;  2LG4 A;  5D5U B;  4YG2 F;  4BJT A;  4BS9 A;  2HNH A;  3GYH X;  2KIM A;  3A02 A;  1XMX A;  4NB5 A;  3D0S A;  1S8N A;  3K6G A;  2XAQ A;  4Y3O A;  3L00 A;  1N78 A;  3ZR8 X;  1GXQ A;  2VC1 A;  2HDW A;  4P1W A;  3V4G A;  3PO2 J;  4BQN A;  3BCA A;  3TO6 A;  1MMD A;  1OYI A;  3I9V 2;  2JPB A;  5FJ8 J;  1LPQ A;  3GCM A;  1FYL A;  4MO7 A;  1TL8 A;  2M7B A;  1V55 H;  2EQR A;  4KNY A;  3SZP A;  3RZO J;  1YTY A;  2ZSI B;  2A6T A;  4NC6 A;  1R1T A;  2Z1D A;  1YS6 A;  4OIR F;  4CCK A;  3CUQ B;  2DA2 A;  4YEL A;  1ZGW A;  3S1R J;  2HQN A;  2XVC A;  3SHF A;  1Z21 A;  3DTI A;  1D0Z A;  1JTY A;  3OYC A;  2XF6 A;  1S9H A;  1Z6R A;  3OYH A;  1K61 A;  3OIP A;  5E79 C;  2IP2 A;  4A3L J;  4EJW A;  5E3N A;  2IEK A;  1LFB A;  3WTZ A;  2Q2E B;  5CVR A;  1NHA A;  4XKV A;  1FYK A;  1A6Q A;  2P81 A;  2RVC A;  3RPU A;  3T0Y A;  5F0F A;  3J81 K;  3ZXS A;  5LHH A;  2IT0 A;  4UUV A;  3IH2 A;  3REO A;  3ZQL A;  4M9Z A;  1NK2 P;  2LKP A;  1ZG3 A;  4BYY A;  4GO1 A;  3NEU A;  4PZJ A;  1BR1 A;  2K3F A;  1BJA A;  3CCU I;  3ZCO A;  2VKE A;  4JQF A;  4B48 A;  3G73 A;  3SEQ A;  4BJ5 C;  3S1N J;  2YX4 A;  2HGC A;  2VQL A;  4HX7 A;  1PP7 U;  4H4K C;  3RKQ A;  1XGN A;  1MNE A;  3JTH A;  3MCZ A;  5EZG A;  2NNY A;  4FX4 A;  1Z77 A;  3VFZ A;  3QWL A;  2DMU A;  2OTJ I;  4BGD A;  5ED4 A;  1P7I A;  4G6D A;  1X1D A;  1JT6 A;  2X85 A;  2DJN A;  4IO9 F;  3L2U A;  1DU6 A;  1UFM A;  4MFE A;  1G6N A;  4A3B J;  1BL0 A;  3ZN0 A;  2YS9 A;  2CFX A;  5JVG F;  3WTT C;  3OS0 A;  2CMP A;  2RNG A;  5LHG A;  1XMK A;  3K4J A;  5LRR A;  5FGM A;  2XKP A;  2HXI A;  2W00 A;  1KGS A;  2Y75 A;  1CQT A;  2QSH X;  2MC3 A;  1U9N A;  5HDN A;  2IS6 A;  4FE4 A;  2O3F A;  1HCR A;  4UY8 I;  4C3H J;  5TIS C;  4HNV A;  1Z1D A;  1U5T A;  3LNQ A;  3CCV I;  5L3G A;  1NG6 A;  5E1X A;  4FCY A;  2K4J A;  3H3Z A;  1FOY A;  2RKH A;  4XBF A;  4B43 A;  1FBU A;  1P2F A;  2FOK A;  2KMU A;  3WG9 A;  1B9M A;  2XAJ A;  3W2W A;  3CO6 C;  3KX2 A;  4C30 A;  2X48 A;  2XAH A;  4EEF G;  3V8L A;  1RES A;  2A5W A;  3SZG A;  3GWZ A;  5CQE A;  5ERI A;  1W5S A;  4I76 A;  1B8I A;  1TWG J;  4M9X A;  3VEP A;  1W36 C;  1OQY A;  1USS A;  1X3W B;  2JSC A;  3A4C A;  2CV1 A;  5LEJ A;  1YFH A;  1TLH B;  4PGH A;  5F0H A;  2XGC A;  2Z33 A;  2V79 A;  4M72 A;  2CS3 A;  5E1W A;  2W57 A;  3OYB A;  4BY1 J;  1FTZ A;  2HKO A;  1BW6 A;  1EV7 A;  2LBF B;  4R1H A;  4RM2 A;  1I3A A;  4U87 A;  1GLN A;  1F43 A;  3ECO A;  3CP2 A;  5HLT A;  4CYD A;  2RDP A;  3VPR A;  2CGP A;  1SD4 A;  2NS8 A;  4CCM A;  3P5J A;  3BJO A;  1BI0 A;  2FQ4 A;  5CJ9 A;  4LG3 A;  2NS0 A;  2M3A A;  3RKX A;  4W1U A;  1ZRD A;  2M30 A;  2PN6 A;  2IS1 A;  2EFO A;  3OY9 A;  2K5C A;  3QPS A;  3S2H J;  3K9T A;  2AQF A;  2D1H A;  1U9O A;  2ZSH B;  4U0Y A;  4EM0 B;  2IW5 A;  2L0K A;  3HHH A;  3KEQ A;  1UB9 A;  1YIO A;  5IP9 J;  2BOL A;  2L5Q A;  2VUM J;  4FQG A;  3JRF A;  4WX9 A;  1ZGJ A;  3LOC A;  4AYB N;  2ZXI A;  1VQ4 I;  2Y30 A;  2BHZ A;  3BT9 A;  3GFJ A;  3WOD F;  1WJC A;  4PUS A;  1TC3 C;  2OPT A;  5H2F C;  4A0Y A;  2HVR A;  3IWF A;  2X6O A;  2F48 A;  2BEO A;  2WA0 A;  2BV6 A;  1RUO A;  4BUP A;  2KPM A;  2EFP A;  1X2N A;  2QKM B;  2QQ9 A;  4XRM A;  1L0O C;  1SAX A;  3ZMU A;  4YFK F;  3MD2 A;  3K0L A;  1A36 A;  2KIQ A;  2GAU A;  1IRX A;  5C4J J;  3DEU A;  2XAS A;  2ZC2 A;  4RA2 A;  1XDU A;  3AFH A;  1VQ8 I;  4F55 A;  2LC2 A;  5J47 A;  2VKD A;  2VBY A;  2V4J C;  3NWT A;  2Y9Z A;  1FOK A;  2O9L A;  3P7N A;  2B9S A;  4WXH A;  2NXN B;  4HLX A;  5DCM A;  1WJE A;  3IC7 A;  4IHY A;  3C7J A;  2VL8 A;  2R92 J;  3OR2 C;  2W24 A;  2ZXW H;  3CUQ A;  1IAW A;  1IUY A;  3HKZ N;  1O3Q A;  1H0M A;  3TO7 A;  2E35 A;  5FO5 A;  3CCJ I;  2MD5 A;  3QOP A;  2Z9O A;  4MNU A;  4P55 A;  5DCF A;  1D1A A;  2DW4 A;  1BC7 C;  3OIQ A;  2VJ4 A;  3LST A;  3QU3 A;  1HA8 A;  3K4C A;  5E3O A;  2FBK A;  5F27 A;  1B1B A;  2DDB A;  1OR7 A;  2Q2E A;  4RGR A;  3KE2 A;  4BNC A;  3OYG A;  2JZY A;  4MEY F;  5EDN A;  1LKX A;  2MAB A;  4RB2 C;  4IXA A;  3BTC A;  2JMW A;  3OSF A;  2E1O A;  5JHF A;  1R00 A;  2LY1 A;  4AD9 A;  3I0T A;  1LJ9 A;  1HKQ A;  2MGQ A;  3SQN A;  1UHM A;  3OR1 C;  3I54 A;  3BC8 A;  2ME0 A;  1APL C;  3HOV J;  3HC7 A;  3JR9 A;  1VI0 A;  2CQK A;  4RDU A;  3KYD B;  2E1C A;  3PL8 A;  3QP6 A;  1YJW I;  2COB A;  2R7F A;  4XLN F;  4A0Z A;  3DQV C;  4HNT A;  1MJB A;  1TWC J;  2MBF A;  4PGG A;  3IV5 A;  3FM3 A;  4ON0 A;  1F9N A;  2FXA A;  3FF5 A;  3RKY A;  1R5G A;  1M1E B;  3DBL B;  2AS5 F;  5H20 A;  3HPH A;  4Y7N J;  1XCV A;  3EUA A;  3FXJ A;  3OMY A;  1E17 A;  1GVJ A;  3HZJ A;  3ZMV A;  1Z3X A;  3FWE A;  1WJA A;  1VQP I;  2PMH A;  2BYV E;  2GQQ A;  2FRH A;  3A1Y A;  3AAF A;  3ABK H;  2Y0S A;  4LMY A;  4U7B A;  1J0R A;  3F72 A;  4B3A A;  4CCJ A;  2W1O A;  1P92 A;  3L2Q A;  1KA8 A;  2EH3 A;  2XRL A;  4D5C A;  2HFH A;  2R4G A;  3TKY A;  1S7E A;  4EAT A;  1P4X A;  4QWQ A;  4D7N A;  1BN5 A;  2G7U A;  2K02 A;  1B9N A;  2E34 A;  2O61 A;  2FE3 A;  2KIU A;  4AVP A;  4M3E A;  4IHT A;  4IHW A;  2IA2 A;  3CJR B;  4ANJ A;  3HGY A;  1J09 A;  2ZME B;  1TBX A;  3BTL A;  4WXD A;  4B8X A;  4HDU A;  1HQC A;  3SEZ A;  2XSJ C;  4ZDO A;  2HWV A;  3KP7 A;  3WTU C;  2W7N A;  1HW2 A;  2VT2 A;  1ZG5 A;  2Z3Y A;  2HI3 A;  3HTU A;  3JAM K;  1OCZ H;  5JVT A;  5D8K B;  1QQI A;  2BE5 F;  4XSZ F;  2LSO A;  3LSH A;  2DI3 A;  3NRV A;  2BXZ A;  3F3X A;  3Q0V A;  1G3Y A;  1OYW A;  2EIK H;  2F2E A;  1MMA A;  3L09 A;  4II2 A;  5F1J A;  1U8B A;  4ABZ A;  3DKW A;  2LYC A;  1QGP A;  4E7S A;  5E3L A;  2STT A;  4PFO A;  2QGU A;  3S1M J;  1KON A;  4JOM A;  2PJP A;  2RAE A;  1D1B A;  2ECC A;  4II3 A;  5CVV A;  3JRC A;  5LFA A;  4J19 A;  4AIK A;  3JRG A;  1LDJ A;  2P6S A;  2IS4 A;  1X3Z B;  4AUX A;  2HTJ A;  4G12 A;  2VPL A;  1IGN A;  1Y0U A;  3CF2 A;  3PFI A;  2XGD A;  3LAP A;  3OYF A;  4R8H A;  3M1C A;  3OYK A;  5D6F A;  2ISY A;  2PQ8 A;  2LNB A;  1TQI A;  3KP2 A;  1H88 C;  4XRS G;  1ZLJ A;  3BG3 A;  1R1V A;  4G9Y A;  2FF4 A;  2VKV A;  5ICE A;  3F6V A;  5J1R A;  1S72 I;  4NC8 A;  1RI7 A;  1Z67 A;  5FKL A;  2CV0 A;  3FXO A;  2HR3 A;  3FHZ A;  1JGS A;  4HV6 A;  4OIP F;  3DP7 A;  4EMS A;  2V26 A;  3M1E A;  3CUO A;  4UB6 C;  1D0X A;  2UUZ A;  5AIQ A;  3LSI A;  4C2U A;  3W6K B;  5DM6 F;  2VC0 A;  1V3F A;  2Y9Y A;  3TP0 A;  1W1W E;  3H3U A;  5IY5 H;  3CO7 C;  3CD6 I;  4B47 A;  3S17 J;  1P4A A;  3M3Y J;  4ZC3 A;  2UXX A;  2GXG A;  3SZT A;  2H8W A;  2O0Y A;  2BVM A;  2QSF X;  2PFB A;  2LKS A;  2V7F A;  3F8M A;  2XRO A;  3HUG A;  3CDI A;  2E36 A;  1OKR A;  2GIZ A;  4XKB A;  3I4M J;  3BJA A;  5K7H A;  2VOO A;  3VYT B;  2ZBK A;  3AG2 H;  2PI0 A;  5DD4 A;  3R61 A;  4K2E A;  2WAE A;  3TQN A;  2HYF A;  2PMZ N;  2K85 A;  3RCO A;  5FKN A;  3E1S A;  3G3Z A;  3FMR A;  1SEU A;  3CDH A;  3CP8 A;  4BY7 J;  4CYC B;  2HQR A;  2M4K A;  2HOA A;  4EQQ A;  3LSP A;  1QRY A;  1J59 A;  1GUU A;  4DBQ A;  2VQH A;  5EG0 A;  2XAG A;  3F22 A;  1V54 H;  3L9F A;  4JX6 A;  2XAF A;  3H9Q A;  1R4M B;  3QPT A;  3MZY A;  2ZJQ F;  3CME I;  1VTN C;  1SC7 A;  1KYW A;  2CQX A;  3H92 A;  4XIC A;  2B0L A;  1SD5 A;  1LQ1 A;  2QBY A;  2HTS A;  3OYN A;  2DA7 A;  2E7W A;  2OZU A;  4L9J A;  4GGG A;  4BAY A;  4QTR A;  1ZR2 A;  2DFI A;  4CXF A;  2JSP A;  1FBQ A;  3Q0U A;  5BMZ A;  2ZNZ A;  1O7F A;  4PDK A;  1IRZ A;  4KFC A;  1YIJ I;  4V2F A;  4CZZ A;  1MDM B;  1I1S A;  1C0W A;  3SDB A;  1OYY A;  4RGS A;  1VQL I;  2XIG A;  3WU1 B;  3ZQH A;  2F6C A;  2NNN A;  1T6S A;  3CMM A;  4AU7 A;  1T39 A;  4N4N B;  1F5T A;  5GPA A;  2L3D A;  3TW7 A;  2MH9 A;  2WBM A;  5FLM J;  2DA6 A;  3M8E A;  1E2X A;  3H9J A;  2WAQ A;  1XGO A;  1U5T C;  3PUF A;  5FD6 A;  2OCE A;  1G3T A;  1ULY A;  2IBD A;  2G0E A;  5TRD A;  2BXY A;  3ZGK A;  1MBK A;  2IPQ X;  3HYI A;  5DM7 F;  1U3E M;  1U0J A;  5FLX K;  1Z0X A;  2WV1 A;  4XON A;  1L3L A;  1G59 A;  2DMP A;  2JN6 A;  2KL4 A;  3TW6 A;  3BR3 A;  4GRI A;  3MZ8 A;  1A04 A;  3N4M A;  2PJR A;  5DYM A;  3K1N A;  2K9M A;  2QVO A;  2L7M P;  3HIF A;  2BGC A;  1IO2 A;  3O8H A;  3AL0 C;  3C18 A;  3Q3S A;  4V2G A;  4E7K A;  1LEA A;  2GWR A;  2R7D A;  1IRF A;  1PP8 F;  4DJA A;  4GFB A;  4L5J A;  1QNT A;  1FTT A;  3M07 A;  4I98 B;  4D0P A;  4AIJ A;  2LKX A;  2EBI A;  1BC8 C;  4WCG A;  4C2T A;  2A69 F;  3O6B B;  3GVA A;  2P8T A;  4DNC A;  1RRJ A;  5FB2 A;  3ASO H;  1GV5 A;  2ZNY A;  3BWG A;  5L3F A;  3I58 A;  3BRO A;  1AU7 A;  4BEH B;  1JUM A;  4Y33 A;  4S04 A;  4E7L A;  4CUG A;  4OMY A;  2ELJ A;  2JK3 A;  5M5Y J;  4BXF A;  2BW3 A;  3OWT A;  2K9Q A;  2JQ7 A;  3ZPL A;  3H0G J;  5DUK A;  2LVS A;  1ZRC A;  1A6I A;  4ESJ A;  2R7U A;  1RKT A;  3BZC A;  1XSD A;  1IRG A;  3U1D A;  5A2Q Z;  3IHU A;  5IP6 A;  4XRS A;  1KQ0 A;  2DK8 A;  2P7V B;  1SVL A;  5IYC J;  2Y0M A;  3OYJ A;  4LLL A;  3CCL I;  2OZ6 A;  5J40 A;  2CW7 A;  4WXC A;  1CGP A;  1S29 A;  4UHT A;  5BNG A;  1YIT I;  4OAY A;  1YJ9 I;  3LFK A;  1YJN I;  4J01 A;  3JRA A;  3G4S I;  1LE8 A;  1HC8 A;  2QF7 A;  1REP C;  3LSK A;  5IT9 K;  5HVQ C;  2CRG A;  1DUX C;  4ITV A;  3FXU A;  1A31 A;  1KU2 A;  2JA5 J;  2EZI A;  2M5W A;  2G9W A;  4HA8 A;  3D1N I;  4P5O A;  1WH7 A;  4E4H A;  3WHC A;  1PJR A;  1X1P A;  4QIW N;  5E1Z B;  2J5O A;  3H35 A;  4N9H A;  1MND A;  3HOS A;  4HDV A;  1TW2 A;  2OBP A;  5FRO A;  2JWT A;  3V42 A;  4N0B A;  2JUC A;  2E2I J;  4LB5 A;  3PNV A;  2JRT A;  3C3W A;  1AKH B;  3CC2 I;  1IXS B;  1BW5 A;  1SMY F;  4UUS A;  4U7D A;  1Z91 A;  4DBR A;  3K70 C;  4ZH4 F;  1BR2 A;  5F08 A;  2C6Y A;  1XTA A;  1WI3 A;  3UR3 C;  2QSG X;  1OCC H;  1ETK A;  3WG7 H;  3MN2 A;  4ZZD A;  4N4O B;  2DOA A;  1BM9 A;  1I50 J;  4OMZ A;  4ZTJ A;  3G2B A;  5DUI A;  1FSE A;  4IOC F;  3FKI J;  4CDG A;  3TDU C;  1ZRF A;  3G1O A;  4U0W A;  4XK4 A;  1HKS A;  2WWY A;  4ESF A;  4A3F J;  1OPC A;  3KZY A;  2ZJP F;  4Q48 A;  3U9G A;  3E0J B;  4HST A;  1XCB A;  3HB9 A;  5ILU A;  1MW7 A;  4D1Q A;  1YO5 C;  1FPQ A;  1WI9 A;  3QOE A;  3CUQ C;  1YW9 A;  4UVA A;  4BDY A;  1UHW A;  1UZC A;  4F93 B;  4LFU A;  1NG7 A;  4HYE A;  2DBB A;  1T0F A;  4KMU X;  3DPU A;  4Z2Y A;  3JRB A;  4YFN F;  1MMN A;  1RPW A;  3H5N A;  5B66 C;  4BHB A;  3K4L A;  1VF9 A;  3FXQ A;  2OCC H;  4MLO A;  3TED A;  3U2R A;  1OR7 C;  2CJJ A;  2O8X A;  1J2X A;  1U6G A;  4UNO A;  4CCL A;  4XQF A;  4A5N A;  5LBQ A;  1KU3 A;  3E5Q A;  3J81 Z;  5ILV A;  1YLF A;  3ZQQ A;  3ISP A;  3HOU J;  2W4S A;  1QBJ A;  1CF7 B;  4GYI A;  1J75 A;  1IN8 A;  1MZB A;  2WB1 A;  5DTD A;  1A5J A;  1TT5 B;  1SFO J;  1VZ0 A;  1ZH5 A;  4QLC U;  2R7R A;  4EGY A;  2OUM A;  1D8J A;  2HDD A;  1O4X A;  2FEZ A;  4UUT A;  3DKY A;  4M6V A;  2KJB A;  1V5G A;  2CUE A;  1FOW A;  2WY8 Q;  3J80 Z;  1MBJ A;  4ZYH A;  4G7H F;  1XGM A;  2NVU B;  1WSU A;  2JPC A;  1ZQ3 P;  1J7K A;  3FBI B;  2X4H A;  1ORK A;  1IZ1 A;  3S32 A;  4DZJ A;  1OFC X;  3FXM A;  3GLX A;  2YX7 A;  4ZYG A;  4BAC A;  4KT5 C;  5HS8 A;  1BBY A;  2ZFW A;  3EPZ A;  1QPM A;  1WJB A;  1T2K A;  5B1B H;  1K78 A;  1FP2 A;  4ZTF A;  4BE0 A;  2XGE A;  4S0H B;  1E0E A;  1Z05 A;  2ID6 A;  1R6R A;  1JUS A;  4C2M J;  3MQ0 A;  1QVT A;  2ISZ A;  1W36 D;  1X1A A;  2F5V A;  2X1D A;  3HSE A;  4HZF A;  2EB7 A;  5ILS A;  4LB6 B;  5BQT A;  1B72 B;  1Y39 A;  3E5U A;  5DD8 A;  2M8G X;  4KIF A;  1I27 A;  3A01 B;  2A05 A;  2FU4 A;  3PQJ A;  2DA3 A;  4HPQ A;  4ZYD A;  1FIP A;  4HSR A;  3RPQ A;  1K6O A;  1YRN B;  3GZ5 A;  3OS2 A;  1RR8 C;  5KAI C;  4DQ2 A;  2RQQ A;  4B1R A;  1XSX A;  4RLQ A;  3ABU A;  3DFG A;  1IN5 A;  2R5Y A;  4C3I J;  4F3Q A;  1T38 A;  2L02 A;  4QPO A;  3WGG A;  1EF4 A;  3S93 A;  1O3S A;  1MSF C;  5JLW A;  3HG9 A;  5EYR A;  3R6S A;  4OWR B;  2DYS H;  1VQ9 I;  3HTS B;  4A3G J;  4B4C A;  2IS2 A;  3K4B A;  4DW6 A;  1PUF A;  3OYL A;  1XGS A;  5J1U A;  2E1N A;  1FY7 A;  5LLQ A;  4DOZ A;  2EIL H;  1T98 A;  4HW0 A;  4AID A;  2GZW A;  1T56 A;  3SXY A;  1ENH A;  3GTK J;  1TTY A;  4BEH A;  1E3P A;  2LD5 A;  2A61 A;  4XR6 A;  3RJP A;  1J5Y A;  5HS7 A;  2GIV A;  4E7H A;  1FMV A;  1H9G A;  4G94 A;  5EEG A;  4ASN A;  5EEA A;  4UB8 C;  5GTH C;  3V8J A;  4Y13 A;  3JW4 A;  3HBL A;  1ETW A;  2EIN H;  4A3E J;  3VB2 A;  2ZXJ A;  1ZGA A;  3QYB A;  2FNP A;  3PO3 J;  2FMY A;  2FBH A;  2X6W A;  3T8R A;  1MGT A;  3KCC A;  2VI6 A;  1Q1V A;  2VBZ A;  3BG7 A;  4RAY A;  3GX4 X;  4NQW B;  1UCR A;  3W3C A;  1UG0 A;  2H8R A;  3BDD A;  3ONQ A;  3FK6 A;  1JXS A;  2CO5 A;  1QU3 A;  3B73 A;  5FRN A;  5TJJ A;  3CES A;  5EGO A;  3SJM A;  2L54 A;  2ZXH A;  3J7Y J;  1TWA J;  1Z9C A;  1OCO H;  1LDK B;  5GP9 A;  3FK7 A;  2FX0 A;  2V1D A;  3B6C A;  2OU2 A;  2VOD A;  4XSX F;  5LGU A;  2FA5 A;  5EZH A;  2FQ3 A;  2A6E F;  1H89 C;  3MMY B;  2L2O A;  5KK1 A;  2LLK A;  3BOQ A;  4BL0 B;  2W85 A;  3BR2 A;  1U2W A;  1RIO H;  2XAU A;  4G7O F;  4UVC A;  1UG2 A;  2XV4 S;  3EDP A;  1LVA A;  3HDD A;  4A69 C;  3OL4 A;  4L9N A;  2VXZ A;  2KDZ A;  1TT0 A;  4BH9 A;  5BPI A;  3PSI A;  2XPW A;  4AYB A;  5B3S H;  1I6H J;  2VIX A;  1BIB A;  2BY3 A;  3OYE A;  1EH6 A;  2A5Y B;  4MTE A;  2VN2 A;  2HYG D;  4AIH A;  4X0G A;  4ZDL A;  4BE2 A;  3FM5 A;  4KN4 X;  3IKT A;  2BY2 A;  1IXR C;  3FMS A;  2YSR A;  3HPG A;  3S2W A;  5TGT A;  2JVG A;  1WHU A;  5J4V A;  1EKE A;  2F4M B;  2VXD A;  3CCM I;  3HOZ J;  3K4K A;  2XHK A;  2IA1 A;  3HXL A;  1R23 A;  4Y4R A;  2DFH A;  1E3H A;  1SAU A;  2VBW A;  2Y69 H;  2PX9 A;  3GTL J;  3MVP A;  1FX7 A;  3QRF F;  3PUB A;  1LDD A;  5FFZ A;  3RSN A;  2B63 J;  2UWM A;  2H6C A;  5LD2 C;  1DQU A;  2GXA A;  1R22 A;  5CPR B;  1NH3 A;  4A2U A;  1K4S A;  1H8A C;  4HF1 A;  3GTM J;  1WWX A;  3K10 A;  2ELH A;  2V9V A;  3KEO A;  4CO8 A;  4HOB A;  2IXS A;  2R5Z B;  3UNG C;  3I3L A;  1UMQ A;  5HNF A;  3HKZ A;  2TDX A;  1DPR A;  3KP3 A;  4XKW A;  4M3B A;  2AHQ A;  2X51 A;  2HQA A;  4XLF A; 
#chains in the Genus database with same CATH homology
 1TWH J;  3RZD J;  3I4M J;  3OSG A;  5K7H A;  3S2D J;  5EGO B;  2FD5 A;  3JRE A;  1WPK A;  3CDL A;  2JA6 J;  2PMZ N;  5FKN A;  4BY7 J;  3BR5 A;  4CYC B;  2E2J J;  3S15 J;  2HOA A;  2FJ1 A;  3LSP A;  1QRY A;  1GUU A;  1LFU P;  1AHD P;  2HOT A;  5EG0 A;  3DEW A;  4JX6 A;  5IOY A;  2YUS A;  3A02 A;  1JT0 A;  1MBH A;  2AO9 A;  2CQX A;  4XIC A;  3PO2 J;  4MIM A;  4D5F A;  1T33 A;  2DA7 A;  1ETX A;  3DCF A;  5FJ8 J;  4QTR A;  1ZR2 A;  4MO7 A;  1QVU A;  3Q0U A;  2EQR A;  3RZO J;  2NS7 A;  3BTI A;  4A3D J;  1FEX A;  3GTJ J;  2EZH A;  5EF6 A;  1IRZ A;  2L9R A;  1ZGW A;  3O8G A;  1IC8 A;  4V2F A;  2DA2 A;  3S14 J;  3S1R J;  1JTY A;  4M3F A;  1WCM J;  3ZQH A;  1FJL A;  1K61 A;  4A3I J;  1Y1W J;  4A3L J;  5E3N A;  5GPA A;  3SFI A;  2IEK A;  3TW7 A;  5GPC A;  1LFB A;  5FLM J;  1DU0 A;  2R7Z J;  3K7A J;  1U78 A;  2DA6 A;  4C3J J;  2M2E A;  2HQ5 A;  2P81 A;  3ZQF A;  1SAN A;  5F0F A;  3BTJ A;  3Q0W A;  1AKH A;  2IBD A;  3E7L A;  3G1L A;  1OCP A;  3IH2 A;  2G0E A;  3ZQL A;  1NK2 P;  1MBK A;  1WH5 A;  2LP0 A;  1Z0X A;  2WV1 A;  2CQQ A;  2DMP A;  4M3D A;  2JN6 A;  1X2M A;  4DYR A;  2VKE A;  3TW6 A;  3GTP J;  3BR3 A;  2OF7 A;  2H1K A;  3OIO A;  4Y52 J;  3S1N J;  2DN0 A;  2XPU A;  1JGG A;  1D5Y A;  4A3K J;  2L7M P;  3O8H A;  5M5X J;  3RKQ A;  4V2G A;  3Q3S A;  1RET A;  4GFB A;  5EZG A;  1FTT A;  2R0Q C;  1Z77 A;  2LKX A;  2EBI A;  5C44 J;  2ELK A;  2DMU A;  2HYJ A;  1P7I A;  2KT0 A;  1JT6 A;  3BQZ A;  3HOY J;  4A3M J;  2DJN A;  1DU6 A;  1GV5 A;  1HDP A;  4MFE A;  4A3B J;  1MNM C;  1BL0 A;  2YS9 A;  1GDT A;  4JX4 A;  1AU7 A;  1JUM A;  4XID A;  3BR1 A;  2GM4 A;  2HXI A;  2JK3 A;  3C2B A;  5M5Y J;  1POG A;  1W0U A;  1CQT A;  3GTG J;  2K9Q A;  1U9N A;  2DMT A;  3H0G J;  3S16 J;  4FE4 A;  5JLX A;  1HCR A;  1E3O C;  4C3H J;  2LVS A;  1A6I A;  4HNV A;  3F0C A;  1RKT A;  3LNQ A;  2NVX J;  5FKK A;  2Y31 A;  5IP6 A;  5EG0 B;  4XRS A;  4FCY A;  3BG5 A;  1JKP C;  5IYC J;  1UHS A;  1W0T A;  1JUP A;  2NVY J;  4NDL A;  1XC5 A;  3OOU A;  5BNG A;  5IPA A;  2GBY A;  1QPI A;  2X48 A;  3JRA A;  1LE8 A;  4EEF G;  1RES A;  2QF7 A;  2TCT A;  1ITY A;  2Y0S N;  3ZQC A;  2CRG A;  3RQI A;  4JP0 A;  1NK3 P;  4I76 A;  2JA5 J;  2EZI A;  1B8I A;  2QCO A;  1TWG J;  4BBR J;  5IP7 J;  3D1N I;  1WH7 A;  5F0H A;  2XGC A;  3PM1 A;  3WHC A;  4QIW N;  4BY1 J;  2ME6 A;  4BBS J;  1FTZ A;  1BW6 A;  3NAU A;  2L7Z A;  4RBO A;  2JWT A;  3IH4 A;  2E2I J;  5C4X J;  4A3C J;  1F43 A;  4L5E A;  1AKH B;  1ETQ A;  2MG4 A;  3VPR A;  1BW5 A;  4UUS A;  2NS8 A;  2O7O A;  3WHB A;  4A93 J;  2FQ4 A;  1ETV A;  5IYD J;  1B72 A;  4W1U A;  1ZKG A;  5F08 A;  1WI3 A;  3A01 A;  3G1M A;  1ETK A;  1TWF J;  3QPS A;  3S2H J;  3MN2 A;  2M34 A;  1YRN A;  3S1Q J;  2CUF A;  1I50 J;  1U9O A;  5M3M J;  2WAQ N;  1OJL A;  3UKG A;  2IAI A;  2L0K A;  3FKI J;  4IHV A;  4DYQ A;  3G1O A;  2K40 A;  3HOW J;  4XK4 A;  4A3F J;  1MBG A;  5IP9 J;  3HB9 A;  3BR0 A;  2VUM J;  3JRF A;  2HOS A;  4FE7 A;  3LOC A;  4AYB N;  2Y30 A;  3BT9 A;  5IOZ A;  3NAR A;  1G2H A;  2MSY A;  3K2A A;  1TC3 C;  2OPT A;  3JRB A;  3FIS A;  2XPV A;  1RPW A;  4IHX A;  1VF9 A;  4MLO A;  3TED A;  2X6O A;  2CJJ A;  1F36 A;  4FIS A;  3HGG A;  3LSG A;  3GTQ J;  2E19 A;  3LSJ A;  1X2N A;  4XRM A;  4A3J J;  3LSR A;  1BJZ A;  3GTO J;  1MSE C;  4BKX A;  2TRT A;  3HOU J;  5C4J J;  2EZL A;  5DTD A;  5F04 A;  4DZP A;  2NVQ J;  1LE8 B;  1A5J A;  4I6Z A;  1SFO J;  3MKL A;  3CCY A;  2LTP A;  1ETO A;  3BR6 A;  2HDD A;  1GVD A;  5M5W J;  2NOG A;  4UUT A;  3JRI A;  2Y9Z A;  1O4X A;  1B8I B;  2O9L A;  4M6V A;  2CUE A;  2JJ7 A;  1Y1V J;  4X1E A;  1MBJ A;  5FKO A;  4IHY A;  1HOM A;  1ZQ3 P;  2N8G A;  1IDY A;  1ORK A;  5FLV A;  2R92 J;  4DZJ A;  1OFC X;  3HKZ N;  5E3M A;  1MH3 A;  1ETY A;  2LFB A;  2XGE A;  1XS9 A;  1R9T J;  4S0H B;  3I4N J;  1IUF A;  1JJ6 C;  5E3O A;  2ID6 A;  5F27 A;  4UUS B;  1JUS A;  4C2M J;  4LOC A;  1QVT A;  1JKO C;  2YU9 J;  3ZOB A;  5C3E J;  1B72 B;  5EDN A;  2M8G X;  1HLV A;  1BA5 A;  3BTC A;  2JMW A;  3A01 B;  3JRD A;  2DA3 A;  3OSF A;  2E1O A;  1JKQ C;  1FIP A;  1YRN B;  3IH3 A;  5J1Y A;  1JJ8 C;  2MGQ A;  4B1R A;  1VFC A;  1HF0 A;  3ZQI A;  2ME0 A;  4IEJ A;  2R5Y A;  1APL C;  3HOV J;  4C3I J;  3JR9 A;  1VI0 A;  4RDU A;  1EF4 A;  2CU7 A;  3SDG A;  1RKW A;  4QSH A;  1MSF C;  5JLW A;  4BXX J;  2COB A;  5EYR A;  4A3G J;  4FTH A;  3QQA A;  1TWC J;  4B4C A;  3IV5 A;  4DW6 A;  2DA1 A;  1PUF A;  5J1U A;  3QPL A;  4Y7N J;  2W48 A;  1IJW C;  1T56 A;  2LR8 A;  1ENH A;  5J3L A;  3GTK J;  3H3V K;  2LD5 A;  2D5V A;  2K9S A;  4AC0 A;  4MFD A;  1IV6 A;  5EEA A;  4JX5 A;  3CQZ J;  3HBL A;  1ETW A;  4A3E J;  1IDZ A;  1ZTR A;  2LK2 A;  3PO3 J;  4B3A A;  1JTX A;  4X6A J;  2NVT J;  2EH3 A;  2LY9 A;  2XRL A;  2VI6 A;  4D5C A;  3TP3 A;  1Q1V A;  2I10 A;  3BQY A;  3FIW A;  2R5Z A;  1MH4 A;  1S7E A;  4D7N A;  3HOX J;  1NTC A;  2H8R A;  5K7Z A;  3FK6 A;  2O8K A;  1GT0 C;  4M3E A;  5FKM A;  2DA4 A;  2DA5 A;  5HOD A;  4IHW A;  2DMQ A;  5DS9 A;  5EGO A;  3HGY A;  3SJM A;  3BG9 A;  1GV2 A;  1TWA J;  5F0C A;  3BTL A;  5GP9 A;  4M3G A;  1K83 J;  2WB1 N;  3B6A A;  3FK7 A;  2FX0 A;  1OCT C;  3B6C A;  3HEF A;  5EZH A;  3A03 A;  4CYC A;  1H89 C;  2HI3 A;  2LLK A;  2XSD C;  2DTZ A;  2Y2Z A;  3BR2 A;  1HDD C;  2EZK A;  3Q0V A;  1U8B A;  3JRH A;  5F1J A;  1WGX A;  4ABZ A;  1JKR C;  1UG2 A;  2L7F P;  1VND A;  2VPR A;  5K7F A;  1ZK8 A;  5E3L A;  1FIA A;  2R93 J;  3HDD A;  3S1M J;  4A69 C;  2JA7 J;  2KDZ A;  2RAE A;  3JRC A;  2ECC A;  2E2H J;  4J19 A;  2XPW A;  3JRG A;  2R5Y B;  1MBE A;  1I6H J;  1X58 A;  4AUX A;  4G12 A;  1IGN A;  1IG7 A;  2XGD A;  2ID3 A;  1H88 C;  4XRS G;  3BG3 A;  4DYC A;  2JA8 J;  1PUF B;  2ZB9 A;  3W6V A;  3CMY A;  2VKV A;  3GBG A;  2XB0 X;  3ZQG A;  5J1R A;  5M3F J;  5FKL A;  1ZR4 A;  2GLO A;  3M4O J;  3HOZ J;  2X9D A;  2DMN A;  1P7J A;  9ANT A;  5IYB J;  3GTL J;  3MVP A;  2M0C A;  2B63 J;  4D7M A;  2ECB A;  1MBF A;  2M9H A;  2Y9Y A;  3TP0 A;  3L1P A;  2MW8 A;  1H8A C;  3S17 J;  2HXO A;  3GTM J;  2XB5 A;  3M3Y J;  3HM5 A;  2K9N A;  2R5Z B;  1I3Q J;  1UMQ A;  4JYK A;  1XG1 A;  4M3B A;  2AHQ A;  4W97 A;  1RR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...