2DA5A

Solution structure of the second homeobox domain of zinc fingers and homeoboxes protein 3 (triple homeobox 1 protein)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
b'GSSGSSGPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 3
publication title Solution structure of the second homeobox domain of Zinc fingers and homeoboxes protein 3 (Triple homeobox 1 protein)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da5A00
1FEXA 3MKLA 1R9TJ 3K2AA 2XGDA 3JRFA 4IEJA 2DMUA 1BW5A 2EZLA 3BQYA 2R5ZA 1MBFA 4RDUA 4A3LJ 3GTMJ 2COBA 1VNDA 3Q0UA 1G2HA 4BKXA 4XICA 1TWGJ 2FX0A 1AKHA 5F0CA 2ME0A 2R5ZB 2NVQJ 9ANTA 1XG1A 2HXOA 5C4JJ 1TWAJ 1JJ8C 4ABZA 5C3EJ 3JRDA 2NVTJ 3HBLA 1AKHB 4BY1J 4A69C 1A5JA 3JRCA 5M5XJ 1POGA 3I4NJ 5GPAA 4IHVA 2DMTA 1QVTA 1A6IA 3OSFA 2DJNA 3LOCA 4MO7A 2M9HA 4W97A 5EZHA 2DMPA 5FKNA 1UG2A 1ENHA 2DA2A 1IG7A 1MSEC 3C2BA 1TWFJ 4D5CA 2IBDA 2XSDC 1TWHJ 3HKZN 3SDGA 1AU7A 5EGOA 3RKQA 3ZQFA 2HYJA 2NVXJ 4A3CJ 4M3BA 1FTZA 3JR9A 2Y30A 1WI3A 3NAUA 5EGOB 5F04A 5DS9A 3BR5A 1ZQ3P 4FE7A 5E3OA 2M34A 3LSGA 3FK7A 1ETXA 5BNGA 1MBHA 3JRBA 4A3FJ 1Z0XA 1SFOJ 3IH4A 3A03A 3HDDA 2KT0A 4DZJA 4C3HJ 1U78A 1B8IA 1WGXA 3B6AA 1U9NA 1WCMJ 2ECCA 4GFBA 2VUMJ 1JTXA 1B8IB 2O7OA 3ZQCA 3G1OA 3GTJJ 4Y52J 2K9NA 2DMQA 1ETQA 5M3MJ 1JKRC 1JT0A 1TWCJ 3S1RJ 3MN2A 2O8KA 2L0KA 5EZGA 3HOWJ 3DCFA 2QCOA 5HODA 3HOZJ 1IGNA 1OCPA 3JRIA 4C3IJ 2JA5J 3GTOJ 3S17J 2K9QA 1HDPA 1ETOA 3ZQHA 5IPAA 1UMQA 2WB1N 5C4XJ 1HF0A 1T33A 3S1MJ 1IUFA 2E2HJ 2K9SA 2DA5A 3PM1A 4XIDA 2CQQA 2VPRA 2FJ1A 1IJWC 2Y0SN 5IP7J 2XB5A 1LE8A 2JA6J 4C2MJ 2EZKA 3A01A 2G0EA 4HNVA 2XPWA 1MSFC 3RQIA 2O9LA 4BXXJ 2LK2A 2WV1A 2CU7A 1LE8B 3FKIJ 1GT0C 2L7ZA 4D7NA 3A01B 1GVDA 2MSYA 1ZKGA 4UUSA 2LLKA 1OFCX 1BW6A 1ZK8A 4B4CA 3GTLJ 5IYDJ 1P7JA 4D5FA 4UUSB 1VF9A 3F0CA 3NARA 2OPTA 2R93J 4A3KJ 3HB9A 3LNQA 1XS9A 2DMNA 4I6ZA 3OOUA 4C3JJ 4B3AA 2JA8J 2DA6A 4D7MA 2E2JJ 3HOYJ 5IP6A 2JA7J 1OJLA 1UHSA 5IOZA 1ORKA 3IV5A 1NK3P 2H1KA 4MFDA 3Q3SA 1ETWA 2LR8A 3WHBA 4IHYA 1GUUA 2P81A 2GBYA 1VI0A 3BT9A 3D1NI 2ECBA 5E3NA 5FJ8J 2EH3A 4QTRA 2EBIA 3GBGA 1JT6A 2LTPA 2HI3A 2ID3A 2NS8A 3S1NJ 4L5EA 1IC8A 2HXIA 2EQRA 1E3OC 5GPCA 4QIWN 1IRZA 3DEWA 4XK4A 1JKPC 1TC3C 2M8GX 3UKGA 2X6OA 4M3FA 3H3VK 2X9DA 1APLC 2CRGA 2ZB9A 4LOCA 3W6VA 2FD5A 1W0UA 1JUSA 3O8GA 3Q0VA 3RZOJ 2M0CA 2DTZA 2E1OA 2OF7A 4DYQA 2H8RA 3CQZJ 4MIMA 4XRSG 1HDDC 2Y9YA 2JN6A 5M5WJ 3HM5A 2JMWA 3CMYA 5J1YA 1GDTA 1U8BA 1VFCA 2MG4A 1IDYA 1Y1VJ 1RESA 4G12A 3TP3A 3FIWA 5J1RA 3TEDA 4BY7J 5IYCJ 1JKOC 3BR0A 1K61A 3MVPA 1GV2A 4S0HB 1LFUP 1HOMA 1MH3A 3HOXJ 4MFEA 4A93J 1B72A 2XGEA 3O8HA 2NS7A 3QPSA 1WH5A 2XRLA 4I76A 1H8AC 1MNMC 1MH4A 1B72B 1GV5A 1SANA 2IEKA 3LSJA 5DTDA 3L1PA 4RBOA 3S1QJ 1JTYA 1BL0A 1CQTA 2RAEA 2DA3A 5E3MA 1BJZA 2TCTA 1HCRA 1RETA 2Y31A 5JLXA 4AC0A 4A3JJ 1F36A 4JX4A 1YRNA 2LP0A 4A3MJ 2VI6A 5F0FA 1QVUA 5FKLA 2M2EA 1H89C 1S7EA 1DU6A 2HOSA 2NOGA 1YRNB 2VKVA 1MBKA 1RR7A 5EYRA 4XRMA 3QQAA 4UUTA 4M3GA 3IH3A 2LY9A 4W1UA 5EG0A 3GTGJ 1ZR2A 3M3YJ 5JLWA 3BTIA 4X1EA 5J1UA 1HLVA 1IDZA 2LFBA 3LSRA 3BTCA 4DZPA 1W0TA 5EG0B 2B63J 2L7MP 2CUFA 1FIPA 4V2FA 3S2DJ 1WH7A 4EEFG 5IP9J 1MBJA 1RPWA 2DA4A 3BTJA 1JUPA 1X2MA 2LVSA 5K7FA 1OCTC 2CJJA 2L7FP 1FTTA 3BG9A 2YS9A 5F0HA 4FTHA 1D5YA 2YU9J 1Y1WJ 3BG3A 5EF6A 2HDDA 1RKTA 3E7LA 5M3FJ 2EZIA 4AUXA 1ZGWA 3Q0WA 4M3EA 1K83J 1QPIA 3BR6A 4CYCA 3BQZA 4DYRA 1P7IA 2JJ7A 3H0GJ 3ZOBA 4DYCA 5FLMJ 4CYCB 2FQ4A 2D5VA 2XGCA 3JRHA 1I50J 3QPLA 2KDZA 3BG5A 1X2NA 5F1JA 1FIAA 4A3IJ 1MBEA 1FJLA 2PMZN 3JRAA 1ZTRA 4JYKA 3SJMA 4A3BJ 1BA5A 1LFBA 2GM4A 1JGGA 3PO2J 2JK3A 4B1RA 3I4MJ 3BR1A 2E2IJ 1EF4A 2EZHA 2QF7A 4FE4A 4J19A 4A3EJ 1Q1VA 3JREA 1U9OA 3ZQLA 5EEAA 2VKEA 3HOUJ 2IAIA 3GTQJ 1ITYA 4M3DA 2YUSA 3HEFA 4IHWA 4A3DJ 5K7ZA 1PUFA 3IH2A 3FISA 2DA1A 1H88C 2AHQA 4M6VA 2DN0A 5F08A 1PUFB 3M4OJ 2K40A 2ID6A 4JX5A 3ZQGA 2XPVA 2DA7A 1NK2P 3HGGA 1JUMA 2TRTA 3HGYA 3SFIA 4IHXA 3HOVJ 3PO3J 1WPKA 2HQ5A 2ME6A 1ETYA 1X58A 5M5YJ 1I6HJ 3JRGA 3BR3A 2MGQA 5FLVA 1T56A 2CQXA 2LKXA 4Y7NJ 1DU0A 3CDLA 4JX6A 3S2HJ 1F43A 4V2GA 1ZR4A 3LSPA 2XPUA 4BBRJ 2GLOA 5IOYA 2AO9A 4MLOA 3TW6A 2JWTA 2X48A 5C44J 3K7AJ 1IV6A 1MBGA 4BBSJ 3G1LA 2L9RA 3CCYA 3S15J 4NDLA 2XB0X 3OSGA 2MW8A 1XC5A 4XRSA 2HOTA 1I3QJ 3TP0A 2Y2ZA 1RKWA 3BTLA 1NTCA 4QSHA 3VPRA 1JJ6C 3BR2A 1ETKA 3RZDJ 2CUEA 2E19A 3WHCA 5K7HA 5EDNA 1Z77A 1QRYA 3S14J 1JKQC 4A3GJ 2R7ZJ 5FKOA 2W48A 4JP0A 5FKKA 2I10A 2LD5A 3S16J 2R5YA 2R92J 2ELKA 4FCYA 2HOAA 4X6AJ 3G1MA 1AHDP 4FISA 3ZQIA 2R5YB 3TW7A 3FK6A 5FKMA 2N8GA 3A02A 5J3LA 3GTKJ 5F27A 3GTPJ 4AYBN 3OIOA 4DW6A 5IYBJ 5E3LA 3B6CA 1ETVA 2WAQN 5GP9A 2NVYJ 2Y9ZA 1O4XA 2R0QC
chains in the Genus database with same CATH superfamily
1MDMB 4WXCA 2GIZA 3MKLA 3CUQC 3PFYA 4YRVA 1G3TA 4EVIA 2LG4A 2QQAA 1STZA 4I02A 2HQNA 1MBFA 4G6TB 2M7BA 2COBA 4AU7A 4IQ4A 1AKHA 1USSA 3CCMI 2HVRA 3IAM2 5LHGA 2XF7A 1JJ8C 4KIFA 4ABZA 3S2WA 2NVTJ 3HBLA 1RZ4A 1T98A 1RRJA 4IKFA 3KLOA 3GFJA 4XKCA 2CS3A 1XGOA 2TDXA 3KP5A 1D8JA 4RGSA 4DGWB 2EV6A 4IHVA 4LK0F 2RVCA 2VOOA 1WJDA 2RC4A 3OYIA 4W97A 2DMPA 3J81K 4IRIA 1BOAA 5JVGF 1IG7A 4AVZA 1MSEC 3IHUA 5FROA 3JSOA 2XROA 2IBDA 2M5WA 4RAYA 1YTYA 3GW2A 4P9UA 3QPTA 2EFNA 1MMDA 1XSVA 3TOAA 3ZQFA 2WA0A 4IHTA 4HV6A 2KFDA 4M3BA 1BI1A 4M74A 2R7RA 2Y30A 2MC3A 2P7CB 5DS9A 1IAWA 1BJAA 4S04A 1ZQ3P 3H5RA 3FKJA 2HWVA 4ETSA 5E3OA 2A6TA 3I59A 3LSGA 1BBYA 1P2FA 1Z0XA 2E35A 3QP5A 1T6SA 3OMYA 3I9V2 5AIQA 2KT0A 5FRNA 1ULYA 2X4HA 1R23A 2ECCA 4HA8A 4QWQA 4HSRA 4C30A 1B8IB 4KN7X 3PNYA 4HYEA 2ZJRF 1WRJA 1QO0D 4BU2A 1B6AA 3MEXA 2BOLA 2DMQA 2YX7A 1FMWA 2L9SA 4BHCA 1IO2A 5M3MJ 5HS8A 1JKRC 2O8KA 3WE3A 3HOZJ 3LWFA 5DYMA 5D6FA 4HOBA 3JRIA 1X19A 3GTOJ 2W00A 1FLIA 3S17J 2K9QA 2F2EA 2LBFB 1HDPA 3P9IA 4MEYF 1R7JA 3OS0A 1Y6IA 1HF0A 1R4MB 3RTRA 1IUFA 3PIPF 1WJBA 1FOWA 1YX3A 2JVHA 2OU2A 1S6LA 2R7DA 1BI2A 1LDJA 1EA3A 1TZLA 2PMUA 2H8WA 2IGMA 5LHHA 2XF6A 2MD5A 5IP7J 2XB5A 3CC4I 1WFXA 2JA6J 3AG1H 3GEZA 2CG4A 3CF2A 1R71A 2CU7A 5F6FA 5E8IA 2LKSA 2MSYA 1TNSA 1ZKGA 2LLKA 2Z16A 1OFCX 2K7LA 3FXUA 3ERED 2HOEA 4RA2A 4C2TA 3PSFA 2WWYA 3AFHA 3NARA 2WADA 4MQ9F 1XTAA 2UUZA 3PJRA 1N75A 3LNQA 1YS7A 3CCLI 2XKOA 2FUG2 3WU2C 2DTRA 4I6ZA 2M45A 2MBFA 1LEAA 4L0YB 1TBXA 4XKWA 2OD5A 1G3YA 2JA8J 2DA6A 2FSWA 3OYFA 5IP6A 1OJLA 2PN6A 4XM3A 1ORKA 2QBYB 4MFDA 3HRMA 4BEHA 3Q3SA 5KCMA 3DEEA 1VI0A 2Z3YA 2O0YA 3D1NI 1ZHFA 3WTWC 4UY8I 3DPLC 4LG0A 3TDZC 4O6JA 5HLGA 3GBGA 4WXDA 3PSIA 4I0BA 2JPBA 2CW7A 1IC8A 1G59A 2HVSA 4QIWN 1IRZA 5LGTA 1Z91A 3DEWA 1TC3C 2QWWA 1YO5C 4BYYA 3OYNA 2EB7A 3UKGA 2L4AA 4IXAA 4M3FA 2CFOA 2X9DA 2EINH 3OYGA 4A5MA 4OIPF 1APLC 1FP2A 1KU3A 2FD5A 1W36D 5FLXK 1IXCA 3Q0VA 3RZOJ 4ZDPA 3DPTA 2RKHA 4HDUA 4B43A 4QLCU 1EV7A 4KMUX 1D5VA 1YIOA 2RNGA 3LSMA 5ICFA 3DBRB 1UELB 3KZYA 1ZG1A 4KDPA 2KKOA 2NS0A 1HDDC 2Y9YA 2B7EA 3DTKA 4LIVA 3HM5A 2V6CA 5B1BH 1U5TA 4DBRA 5IT3A 1W5TA 1WJ5A 4M9XA 4XSZF 1Z6RA 4NBQA 3ELKA 3SHFA 2GA2A 3TEDA 5E1ZB 1V4RA 3BR0A 1JKOC 4A12A 4OIRF 3MVPA 4YFXF 4OINF 2PJRA 1MH3A 3R0JA 3BOQA 3BZKA 5CVIA 2KIFA 3DU6A 1TW2A 1X1DA 2QENA 3OIQA 2LYCA 1VQ4I 2XKPA 3V7CA 3GO5A 4XLPF 5HDGA 1Z6TA 4LG3A 1V3FA 3WODF 1B1BA 4BQNA 1GV5A 1SANA 4XMYA 3VYSB 2M8EA 3SDBA 3JAMZ 2W84A 2LY2A 4RBOA 2JZYA 1OQYA 3KE2A 2JUCA 2TCTA 1ZELA 3FXJA 1RETA 2K4BA 3K4CA 5JLXA 2H6CA 4HNUA 4MTEA 4A3JJ 3S32A 1F36A 3K4KA 2K02A 3K4BA 5GAHJ 2BVMA 1YRNA 1R22A 1T8IA 5IT9Z 2XAQA 5KHDA 5F0FA 2YSRA 4N4OB 3ZP5A 4E7JA 2HOSA 1W36C 2R7UA 4BQQA 2OUMA 2M1BA 4M73A 3H1CA 5DD8A 3ZGKA 2QUFA 3KP3A 3NQOA 4U0WA 3VYUB 4HF2A 2EFWA 2DPUA 5D5VB 2H6BA 2L02A 1B59A 2P5VA 1FP1D 2R7TA 2LFBA 3LSRA 1W0TA 2DO7A 3ZMTA 5J47A 3S2DJ 1WH7A 4EEFG 2YX4A 4U7BA 2Z33A 3QYFA 1U0JA 3DBLB 1V54H 2G9WA 4LJZF 1D3YA 1RPWA 3GZ5A 5FD6A 5L3EA 4A0YA 1X2MA 3HRUA 5D5WB 4XR6A 2QLZA 2VN2A 3KEOA 3VDXA 2O03A 1D5YA 3BG3A 3HUGB 3H35A 1LFPA 1TQPA 2QQ8A 3E7LA 5M3FJ 2GWRA 4HV5A 3AKZA 4ZZLA 1QZZA 2K9LA 4M3EA 1S7AA 4LITA 1R49A 2EK5A 1Y0UA 1P9QC 1E3PA 3ZRGA 2LOOA 1P7IA 1HW1A 2E7XA 2OZUA 1T0FC 5FLMJ 1FYLA 1QPMA 4CYCB 1BM9A 2PMHA 2JSCA 1WKMA 1VQ7I 1BIBA 1SD5A 1SFEA 3HHGA 5CKTA 1I50J 3LSTA 1K6YA 5DUKA 1I39A 1D8KA 2A05A 2HDWA 2L5QA 5F1JA 1FIAA 1FJLA 1O3QA 1IRGA 4JYKA 1H9GA 3QOEA 5D8LB 4KFCA 1JI8A 2VIXA 2IJLA 2DJIA 4Y15A 2RV8A 1ZG5A 5CQEA 3BR1A 2I5UA 2PEXA 2Y69H 3OYAA 1WQ2A 2VE9A 4HF0A 5TRDA 3N97A 4J19A 1TTYA 1N25A 3OY9A 1EH6A 1EH8A 3CLOA 1Q1VA 2KMUA 3GVAA 1U9OA 3JREA 2PBIA 3KP2A 1A35A 3L2VA 3HOUJ 2A5YB 2IAIA 3OYJA 4M3DA 1ITYA 1UHMA 1D0XA 4PK4A 2GXGA 1KONA 5K7ZA 1PUFA 4ON0A 2DOAA 3FISA 5J40A 2DA1A 5L3CA 3A0HC 3IP4B 3OYKA 3OV8A 2AHQA 4RLFA 4M6VA 5F08A 3M8FA 3S93A 1C0WA 2P5LC 2ID6A 1MMGA 3EYIA 3ZQGA 2XPVA 2X0LA 1NK2P 3HGGA 4EJUA 4KUMA 5E8GA 1XPXA 3HGYA 4IHXA 1WPKA 1V55H 1T08B 1X58A 5M5YJ 4BE2A 3BR3A 5FLVA 4PGHA 4ESBA 3G3ZA 2WAQA 2DQLA 5L3FA 1X3WB 4F93B 4QPQA 1KYWA 3CDLA 2NAZA 4JX6A 3S2HJ 1ZR4A 1Y39A 1D1BA 5CLSA 2F4MB 5CVVA 4MLOA 2JWTA 4XLEA 4N0BA 3K7AJ 4BBSJ 3G1LA 4CUGA 2L9RA 3S15J 1Z67A 3KLNA 2CQ7A 2VOPA 2XVCA 2KIQA 2HOTA 3QOPA 2JRMA 1TL8A 1SD6A 3BTLA 2FXAA 4RM3A 3VPRA 3G2BA 2WAFA 3GX4X 1A6QA 1K79A 4XONA 3ML6A 4KIGA 5K7HA 1XMAA 1ZLJA 3O6BB 4NQWA 2ZXHA 4YELA 3D5SC 3S14J 1H9TA 2W1OA 1DQUA 2R7ZJ 2H94A 1QA6A 3AG2H 3GFLA 1KU2A 3OL4A 1HKTA 5FKKA 3L2CA 5E17F 3MD2A 3J80K 2J5OA 3PIOF 2R5YA 1GXPA 3KZIC 2ELKA 4FCYA 1ZRCA 5H2FC 3K4JA 3G1MA 1F9NA 4XKBA 1AHDP 1FBUA 3U1DA 3LAPA 1FBSA 1MKMA 4B47A 2VBXA 1W5CC 2VXDA 3TW7A 3FK6A 5FKMA 2IP2A 1PP8F 2QKMB 1YG2A 1TNTA 4ZYHA 1MDMA 3GTPJ 1FBQA 2V1DA 4KIBA 3OIOA 1O3TA 2KP6A 5IYBJ 2WAQN 1D1CA 4AIDA 2P6SA 2BVLA 4Q48A 2QM3A 4LLGF 4UB8C 3HDDA 1FEXA 5H20A 1P4XA 1IZ1A 4RGRA 2IVMA 3CDIA 4IOCF 4LGWA 2FMYA 3H3ZA 4AWXB 2EZLA 3DKWA 3FXMA 3CO6C 1IXRC 3CMMA 2O5RA 3KZZA 4CCMA 3GTMJ 2QEXI 3L2RA 1VNDA 4BL0B 1G2HA 5LBQA 1SMTA 3TO7A 2E71A 5F0CA 1I6XA 2GZWA 1XG1A 1XMXA 4P5OA 3FM3A 4RAFA 2EV5A 3RSNA 4BY1J 4PJ0C 1I3AA 1W7PB 3CO7C 3BDDA 2DI3A 2ESNA 1MMNA 5M5XJ 1POGA 1O57A 3I4NJ 3CMAI 2IGNA 3PQKA 2HKXA 2DMTA 4U0YA 1QVTA 4HSTA 1EKEA 4MHGA 4AVPA 2WB1A 4BJ5C 2DJNA 3OSFA 2HVQA 4E7IA 1YE9A 2F5DA 4Q4ZF 2BY1A 3IRQA 4WK8F 5FKNA 1XMKA 2VPLA 4WCGA 1NG6A 2V1UA 1OCCH 4CCLA 3C2BA 3LSIA 2M4GA 2X85A 3Q9VA 2E36A 5FRMA 3CP8A 3GLLA 4FETA 2XSDC 2Y0SA 4BQAA 3VYRB 3DEUA 4HZFA 3RKQA 1YIJI 2NYXA 3MMYB 4A3CJ 2BBYA 3QRFF 4NC6A 2KRFA 3JR9A 4HDVA 1A31A 4WX9A 5EGOB 3BR5A 5HLIA 1WJFA 1R1VA 3I53A 5DDGA 3JRBA 3JSPA 1WWXA 1MMAA 3OYBA 3LQRA 4A3FJ 2STWA 3IH4A 3A03A 1HA8A 1Z3XA 1S9HA 1DP3A 4N9HA 4DZJA 4C3HJ 3AG3H 1ONVA 5FFZA 1WGXA 1B8IA 1HKQA 3HRSA 1WCMJ 3C18A 1VQPI 1R1UA 2DXIA 5LFAA 3BWGA 2O7OA 2R7OA 4Z6YA 4UVBA 2VL8A 4L9TA 2K9NA 1QNTA 1XDSA 2XDVA 1YFHA 4UUVA 1YS6A 4GXOA 1SFUA 4YG2F 2HQRA 4OAZA 3QWLA 5K5QA 1WSUA 2CQKA 3H92A 2LBFA 2ELJA 3WGGA 3HOWJ 2GOXB 4CZZA 4EJOA 3F72A 1R5GA 4TV7A 2ZNYA 3B73A 5L3GA 3TQNA 1U5TC 3HC7A 4PFOA 2CW0F 3IKTA 3TO6A 3GF2A 4XLFA 1ETOA 3ZQHA 3ZN0A 2V4JC 2WB1N 5C4XJ 4IO9F 3MFKA 1BC8C 5ERIA 3KYLA 4XIDA 2KLOA 1O7LA 2X6YA 1SAUA 3IWFA 3OWTA 1YYVA 2CQQA 3BZCA 3BG7A 5HLTA 2ZJ2A 2Y0SN 1QU3A 2A5WA 3IC7A 4KNYA 2E1MC 4C2MJ 2EZKA 1QBJA 2DT5A 2P5KA 4EGZA 4GGGA 2YU3A 3W3CA 3FKIJ 5FFXA 1TW3A 4PUSA 1DGWY 3U2RA 3C3WA 3SZPA 1KU9A 3ZQ7A 4XNFA 4B4CA 3GTLJ 2X1DA 1P7JA 4CCOA 2E7WA 3WG7H 3DQVC 2OPTA 4A3KJ 4U7DA 2YPRA 2OBPA 1CF7B 2QBYA 5DM7F 4C3JJ 1FWZA 1KQ8A 3SYTA 4P1WA 2XRNA 4XORA 4B3AA 3MKWB 2JA7J 3MKZA 1UHSA 5KAFC 1NK3P 3VSKA 3ISPA 3WHBA 4IHYA 5LGNA 4HLYA 1GUUA 4BQOA 2GBYA 3BT9A 3ZPLA 3N05A 4C9YA 4CCKA 2FBIA 3MAJA 1Z7UA 2M30A 5JHFA 2HR3A 2EBIA 1DUXC 1WJAA 3CCSI 1JT6A 2LTPA 2OCEA 2ZXWH 2ID3A 4PDKA 3K9TA 3S1NJ 2DYSH 4L5EA 3WTXC 3K4LA 3CZ6A 5H6RA 1TT5B 2OQRA 2PX9A 4XK4A 2M8GX 2EV0A 1V5EA 4PZJA 3E97A 2CFXA 4I2OA 2JPCA 3RYPA 2ZSIB 3E5UA 3ESWB 1U6GA 4BNCA 3S3NA 2ZB9A 4RGUA 5CPRB 1AA7A 5E18F 3FXLA 4UVCA 3S8PA 4DBQA 3W6VA 1P6RA 2OAZA 1W0UA 2VT3A 4I7HA 4BACA 1WI9A 3KIOA 4QPOA 2E1OA 3ZCOA 3WU0A 1G6NA 5ICEA 3F23A 4YIIA 5HOOA 3A2KA 1S8NA 2FU4A 1QZYA 2R7XA 1IRXA 3RPUA 2ISYA 2LY1A 3K6GA 1SAXA 1LPQA 2JMWA 1UCRA 5J1YA 1GDTA 4WWCA 2P6TA 1IDYA 1Y1VJ 3DTEA 1KU7A 4ANJA 1Z3YA 3SZGA 5J1RA 2PLYA 5IYCJ 1SD4A 1IN7A 2LF7A 2UXXA 1TP4A 2Z9OA 2VQGA 5K1YA 1VQ5I 1HOMA 4YIRX 5F1RA 3EUHA 4C2UA 2A61A 2GQQA 3O8HA 3QPSA 2VBZA 4IRHA 2XRLA 3RCOA 4I76A 2EWNA 1J7KA 3TKYA 1H8AC 1B72B 2IEKA 2K9MA 3BJ6A 1T95A 1O3SA 2HTJA 3S1QJ 5CVRA 4XN3A 1CQTA 3CJQB 1RIOH 2DA3A 4X0GA 1BJZA 3WTUC 3OYEA 2RQQA 2F4IA 2OQGA 2BGCA 3E6MA 1WVRA 5EEGA 2LP0A 2VI6A 4AIHA 2D1HA 1R5HA 2F5CA 1H89C 4F7ZA 1NHAA 3E5XA 1FC3A 3QQAA 4IZZA 4N9IA 2H27A 1VZ0A 2LKPA 4BE1A 1REPC 4A0ZA 3F6VA 2Q1ZB 5JLWA 3QYBA 3A0BC 2L7MP 1FIPA 4HF1A 3GWZA 4E7ZA 1M1EB 3EUAA 5DEQA 1MBJA 1J59A 4BHPA 5TJJA 3HUGA 1HXDA 1KQ0A 2Z1DA 4JQFA 1ZGAA 5K7FA 1HW2A 2CJJA 1OCTC 1EH7A 1JGSA 1RI7A 3KP4A 2DYRH 3BG9A 5F0HA 2YU9J 1FTTA 1Y1WJ 4FT8A 4A2UA 1X4OA 2H1LA 3HZJA 4CCJA 2EZIA 3TO9A 4AUXA 5BQTA 4ZDLA 1ZGWA 1PJRA 1K83J 4MNUA 4BH9A 1QPIA 3GZ6A 4CYCA 1B4AA 3GUDA 3WG9A 1FOXA 4R1HA 3G73A 2VBYA 2VASA 3ZOBA 4DYCA 5HVQC 3E6CC 3U9GA 2MFZA 2D5VA 3FMSA 2AXLA 2XGCA 1R1TA 3JRHA 3QPLA 4CDGA 1AOYA 2VJ4A 2A07F 1X2NA 5HS9A 3HOSA 4CXFA 3KX2A 3JRAA 4DOZA 1TQIA 1PVEA 5A2QZ 3SJMA 4N4NB 3TGNA 1UB9A 5E20A 2GM4A 3QODA 4B1RA 3GLXA 1RUNA 1SVOA 2BW3B 3EDPA 2HZTA 2E2IJ 4UXNA 1QZEA 3LA7A 4P96A 5CQGA 3FXQA 2E1CA 4I09A 5D8KB 2V6EA 4BXUA 4A3EJ 2B0LA 2M87A 1J0RA 4M71A 3ONQA 3ZQLA 3HTSB 2FNAA 5EEAA 4G9YA 1VQ8I 2QSGX 2EA4A 1YOVB 1OKRA 2YUSA 1Q1HA 4A3DJ 4L0ZB 3F8FA 4GCVA 1B9MA 4YFKF 1YW9A 4O3MA 1E0EA 3L2UA 4L5JA 3CF5F 2FF4A 3I54A 3BCBA 1D1AA 5EEHA 2ZMEB 3KP6A 1MW7A 3H0DA 3H9GA 4G6DA 4I98B 4G8XA 2QSFX 3ZR8X 3FX3A 3HSEA 3F21A 2OCCH 3SFIA 3PO3J 2FRHA 2ME6A 4AYBA 2HZDA 5JR3A 4FASD 3JRGA 4XLCA 2CQXA 1TQMA 3T0YA 3T5XA 4DQ2A 4EV0A 1DU0A 1F43A 2XAFA 2X1CA 3LSPA 4BBRJ 4KN4X 2DT7B 1BR4A 1Z7LA 2PFBA 5ED4A 4RB3C 3FBNB 3FXOA 3CC2I 2ZO4A 4E7HA 5C44J 1IV6A 1MBGA 2IW5A 2CUJA 2DOEA 3Q5FA 1RNLA 1R5ID 2KHMA 4XRFA 5AONA 2ICWG 4KT5C 1SEUA 1I3QJ 3TP0A 3UR3C 2L9NA 1E17A 3H3UA 3I3LA 3BLYA 3RZDJ 2IS1A 2F5EA 2CUEA 4FHTA 3F8CA 4U87A 1FSHA 2E19A 2JTVA 1YQAA 1Z77A 5B5EC 1HBXG 1VQ6I 4NNJA 4A3GJ 4R8HA 1FT9A 3BY6A 3CCEI 1VQLI 2W48A 4Y33A 3HKZA 5CYVA 2EIKH 5EJCA 2LD5A 4R79A 2R92J 1BI3A 1G3WA 5GTIC 4XL9A 4BDYA 2HOAA 2R4GA 4X6AJ 3W2VA 3PNVA 1W4MA 2XV4S 5LLQA 2ZC2A 1IF1A 2V7FA 3IAS2 3ERMA 3I4PA 4JK1X 5LHIA 1HQCA 4XLNF 2N8GA 3DPUA 2CQNA 4XSXF 1ZARA 4AYBN 2QGUA 3BROA 4MGRA 2EIMH 1J5YA 4PSWA 2Y9ZA 2P4WA 3OS2A 4AM3A 3F8MA 5HS7A 1ZN2A 5GADJ 1VQOI 4HEA2 4B48A 2ZSHB 1IN8A 3LAJA 2BXZA 4PJLA 2GXAA 5DV5A 1R9TJ 3HSRA 3K2AA 3L00A 3JRFA 1X1PA 3VOEA 1UJ8A 4CYDA 2CUZA 3P9CA 3E3VA 4A3LJ 3I0TA 2YR2A 5ICGA 3BJOA 3AL0B 3PFIA 4HLXA 2GAUA 4BKXA 1TWGJ 2FX0A 4S05A 4XICA 3DKXA 2ME0A 2M7AA 2DDBA 2R5ZB 1W7PA 2ACJA 2HXOA 1BIAA 1L0OC 4XKVA 4RB2C 5DUIA 3K1NA 3JRDA 3E5QA 5CVJA 3RPUD 4A69C 2WC2A 1A5JA 1LVKA 3JRCA 1GVJA 3WTVC 3S3MA 1BOBA 3KFWX 3QYEA 3VYTB 3R60A 4BAYA 1N78A 3T1BA 1G4DA 1A6IA 1MIJA 4KT6A 2W57A 1AWCA 3K2ZA 2M9HA 5EZHA 3Q9SA 4F92B 4IF4A 3IUOA 1OR7A 4OMYA 2R7SA 1UG2A 1MNEA 2DA2A 1QHHD 4DJAA 4BS9A 5IY5H 3WTSC 2KRCA 2L4MA 3V7RA 3V8KA 3ECOA 2IXSA 2W7NA 2H09A 2DFFA 2W24A 1FMVA 3RJPA 4D5CA 1FPQA 2A6HF 3FMQA 3HKZN 2CV0A 3SDGA 1AU7A 5ILVA 2IS4A 5EGOA 2BYVE 2ESHA 2KPMA 2ZCWA 5DD4A 4HW0A 4OAYA 3W6KB 4UHTA 3WGHA 1IXSB 2HYJA 3FHNA 4EJTA 2NVUB 4O5VA 2VB6A 4E6KG 3K4MA 2JRTA 1IW7F 3VWBA 5F04A 4D9JA 1N77A 4FE7A 3PUFA 4CA0A 5GAGJ 3SZTA 2M34A 4L9JA 3FK7A 2DBBA 2JVGA 1DGRM 4G7ZF 5LEKA 2O61A 1S7OA 2ZNZA 4KITB 4BHBA 2ZXIA 2F6CA 3B6AA 1F5TA 1U9NA 4J00A 2G7UA 4I01A 2ZKZA 3COAC 2R7FA 3IKVA 3ZQCA 2EIJH 1CGPA 1X1BA 3GTJJ 4HBLA 1FNNA 2V9KA 3WTZA 2LRDA 2K27A 4BGDA 1L3LA 1OYYA 1J09A 1TWCJ 3MN2A 1KGSA 2L0KA 4ENMA 2HPMA 1HC8A 2QCOA 1OCPA 1SFXA 3BCAA 2JA5J 3NWTA 1WJCA 3B02A 1SC7A 3S1MJ 2FQ3A 2EFPA 1XCBA 2E2HJ 2DA5A 4K2EA 3WU1B 1VTNC 2GOMA 4PJMA 3EUHC 3LA2A 2LH9A 1P4AA 1SD7A 2E60A 2JA2A 3LL7A 3CCQI 2AXTC 2VPRA 3JAMK 3QAHA 3MQ0A 4CO8A 1IJWC 3DLAA 4XN0A 3CUQB 2BHYA 4KICA 4B8XA 3GFIA 2IA1A 4HNVA 2XPWA 1MSFC 3RQIA 2O9LA 5IT9K 2LK2A 3SFZA 1LE8B 1GT0C 3A01B 2L9VA 3J7ZI 1XSDA 1BW6A 1GHCA 4WF2A 1ZK8A 3JTHA 2I8DA 5IYDJ 2IRFG 3FMRA 2R7VA 4UUSB 3F0CA 4ZH4F 5D5UB 3QPHA 4XLHA 3HB9A 4F3QA 1XS9A 1OYIA 3CJTB 1KZHA 1UZCA 3ABLH 3OOUA 2R7WA 4L9VA 3CLQA 4OWRB 5FGMA 5LD2C 1S72I 2E2JJ 2BV6A 1I27A 2M0MA 5LGUA 3J81Z 4ZYGA 3IV5A 3OOPA 2H1KA 1IV8A 1I5ZA 1LJ9A 2LR8A 3BZ6A 1LQ1A 2ZJPF 5ILSA 3EETA 2ECBA 5FJ8J 2OZ6A 2RNJA 2EH3A 5HNHA 2DPDA 3E6DA 2XUBA 2EFQA 2MLGA 2ZBKA 5F64A 3M07A 1XCVA 2HI3A 4LLLA 3L2QA 2DFHA 2L3DA 2E5ZA 1YW8A 4ZC3A 2EQRA 1PYVA 5GPCA 4Z2YA 2VLAA 2DK5A 4ENNA 1B9NA 1Y56A 2VE8A 1D0ZA 2KIUA 5KK1A 5J8CA 3JTGA 2Y48A 2X6OA 3GYHX 4D0PA 1NG7A 4A6DA 5D4RA 2CRGA 3K4NA 1YJ9I 3VB2A 2O8XA 3M1CA 2ZFWA 1FX7A 4RMNA 1MJAA 1PUEE 2HEOA 2W4SA 3M7GA 1JUSA 3O8GA 2OF7A 5B1AH 3IL2A 4M72A 4PJJA 2OA4A 2CW8A 3LMMA 1ON2A 2H8RA 5D5XB 4LIUA 2FE3A 4NUBA 2ISZA 4MTDA 4L9NA 4FX0A 5M5WJ 5BPIA 3CMYA 1U8RA 5H6QA 2MA3A 3FXRA 3G4SI 1VFCA 4RAZA 2DAOA 3F6OA 5GAEJ 4G12A 5E1WA 3OYDA 3LQQA 1A36A 2KDOA 3FHZA 1K61A 1BC7C 4AIJA 1LFUP 3DP7A 5LRSA 3HOXJ 4MFEA 2MLKA 2DQRA 4A93J 1B72A 1ZRDA 2NS7A 3OYLA 1P92A 2MABA 2VKDA 3TDUC 2DCEA 1P4WA 2EJRA 5DM6F 4F52A 3KPHA 1MH4A 4F55A 2Q0OA 5LRRA 2CV2A 1JTYA 1BL0A 2RAEA 1HCRA 3FF5A 2CGPA 2PMZA 2MD0A 4AC0A 4Y3OA 3FXKA 3V8JA 4JX4A 4A3MJ 4KJZA 3GCMA 1BR1A 1QVUA 3J7AO 1FZPB 5TISC 5FO5A 2XGXA 4E7SA 4B3XA 1MBKA 2COMA 4XRMA 2XASA 3K1MA 3R4KA 4UUTA 2VJ5A 4RB1A 3CJNA 4M3GA 3IH3A 4BXFA 4MQVA 3CDHA 4HRIA 3HOTA 1ZR2A 1GLNA 3CCRI 2D1VA 3BTIA 4X1EA 5J1UA 1IDZA 3BTCA 4DZPA 5EG0B 2B63J 2Q2EB 2CUFA 3BG6A 3T8RA 4NC8A 2LREA 2DA4A 3QU6A 2E5NA 4L18B 4WXHA 3G71I 2YS9A 1FOKA 3JW4A 2Z99A 5DCFA 1W7PD 2RQPA 1YJNI 2BZTA 3MKYB 2HDDA 1RKTA 1XN7A 1K4SA 3TOBA 4BJ6C 1RR8C 3OYMA 4D1QA 1OLTA 3CTAA 1IRFA 3BR6A 1V5GA 4UNOA 2JJ7A 5GTHC 1DPUA 1VQ9I 2IA2A 3ROUA 2X51A 1A04A 4EATA 2PI0A 1OMIA 2DK8A 1NH3A 5FLXZ 2K4JA 3C7JA 2DFIA 2MH2A 3HPHA 2UXNA 3RQ4A 2CV1A 2HGCA 1MBEA 1YX5A 2PMZN 3HIFA 2BW3A 3X2QH 4LK1F 4A3BJ 1MMSA 1BA5A 1HSJA 4MEXF 2AQEA 1LFBA 3OL3A 4EGYA 2OTLI 1JGGA 2JK3A 1U2WA 3ZQQA 3I4MJ 2E1NA 2QF7A 1G8XA 1I1GA 2VQLA 2FA5A 3FM5A 4IL6C 1R58A 2CWEA 1Z05A 2VKEA 3FZVA 1E3HA 1DPRA 1XD7A 4IHWA 4YFNF 1PDNC 4ESFA 1R00A 4BJTA 4ENJA 2IS2A 2K5CA 3IH2A 2ZMEA 3E0JB 4KMFA 4NB5A 1Z9CA 4ZYDA 3E6BA 2HYGD 1X3ZB 4RLQA 4EMSA 2DN0A 4LD5A 4GDFA 2K40A 3M4OJ 3HXLA 5CVUA 2DA7A 5DCMB 4HQEA 3LA3A 3CMEI 1XSXA 2QQBA 1JUMA 3LFKA 5KVRA 3HOVJ 1I6HJ 3BP8A 1ETYA 4RB0A 2HS5A 4Y4RA 2ZXJA 4P9FA 1OR7C 1YITI 3KYCB 4Y7NJ 3L9FA 4V2GA 1K78B 2GLOA 3HTUA 5IOYA 2BHZA 2AO9A 5JVTA 1HW5A 1X3UA 1BR2A 3TW6A 3S3OA 1SVLA 4Q5SF 3IRRA 4OIOF 4HAMA 1J2XA 1GXQA 3BPVA 3KP7A 3OR1C 1UHWA 3CCYA 3ECHA 2RREA 3PL8A 2BY2A 3I71A 2XB0X 3OSGA 1QGPA 5BPDA 2DDAA 2XSJC 3P7NA 1FYKA 4ITVA 4UVAA 2Y2ZA 1RKWA 1LDDA 4HX8A 4PJNA 3F22A 1NTCA 2PQ8A 4QSHA 1T38A 1JJ6C 1FY7A 3H5NA 2NRAC 3HSFA 3WHCA 5EDNA 2MH9A 3MWMA 1QRYA 2IA0A 3P9KA 2L54A 3HPGA 4UV8A 5FKOA 4JP0A 1HKSA 4RM2A 3T8TA 5BOXA 2HFHA 2O3FA 3KETA 2K3PA 3HJEA 1MJBA 1YW7A 3D5LA 1R36A 1ZRFA 3I5UA 3ZMDA 3ZXSA 2KZVA 1ACIA 2M4KA 2PG4A 3MZYA 3ZMZA 1K4TA 3ASNH 2DOFA 4ESJA 1TLHB 4RGXA 4HPQA 1Y0NA 2UWMA 3L2WA 5F27A 1MJ9A 2V1XA 4OOIA 2LNBA 3NWSA 4XLAA 5E3LA 3KCCA 3OS1A 2ELHA 5GP9A 4CHUA 3TL4X 1O4XA 2R0QC 4I0AA 4LMYA 2ZJQF 4XQFA 4U0VA 1DP7P 1ERDA 2XGDA 4IEJA 2DMUA 3SQNA 3CC7I 1BW5A 2V79A 3BQYA 4LFUA 2R5ZA 1O3RA 1MD0A 4RDUA 3CCUI 4G7HF 1ZAOA 2AQFA 3Q0UA 5J4YA 2IGOA 2Y0MA 2UZKA 3E1SA 1OCZH 4XOPA 4IX7A 2NVQJ 4JBAA 9ANTA 3K70D 5C4JJ 2BY3A 1G3SA 4GO1A 4NHJA 1TWAJ 3RKXA 5C3EJ 2CO5A 2XAGA 1AKHB 4XBFA 3W2AA 5GPAA 3VSLA 3DBHB 3LOCA 3PUBA 5L3BA 1X1AA 4MO7A 4M6XA 1ON1A 4IRGA 3FBIB 4H0EA 1ENHA 4Y17A 3NEUA 2JQ7A 2QZ8A 1TWFJ 4E7KA 2ADUA 2V1NA 1TWHJ 1UAAA 5HDKA 2O6GE 2XAJA 3LFUA 2XC7A 2DODA 3A1YA 2NVXJ 2ZFUA 1FTZA 1WI3A 3NAUA 3FDYA 3JCUC 2VJJA 3M1EA 1W5SA 2BE5F 3I58A 1ETXA 5BNGA 1MBHA 1SFOJ 1ODDA 1BN5A 3I59B 1U78A 3O3KA 3RI4A 3V7SA 2HPIA 5LEJA 2M3AA 3K69A 3RKWA 2DU9A 4EJWA 2EPFA 1MZBA 3BPXA 4GFBA 1JTXA 3ABUA 3HYIA 2XF5A 1Y8RB 5BMZA 2VUMJ 5HNFA 2VKHA 1UG0A 2RDPA 1BI0A 5L3DA 2EFOA 3G1OA 4Y52J 3K70C 1QQIA 3SEZA 3WTYC 4V19K 1K7AA 4Q47A 3DTIA 4CH7A 1EJ9A 1ETQA 1XDUA 2ETHA 1ZG3A 1JT0A 4AD9A 3O2PE 3ZMVA 5D4SA 3S1RJ 2HU9A 5EZGA 1KA8A 2OC6A 3I64A 3DCFA 4IJAA 3H9JA 5HODA 1IGNA 4U88A 3M8JA 4C3IJ 3J80Z 1ZGJA 3I56I 3L09A 3C1DA 5IPAA 1RC9A 1UMQA 1XX5A 1T33A 4LB5A 2IGKA 1I1SA 4H4KC 2K9SA 2Q8KA 3PM1A 3CUQA 2LDUA 2D2WA 2X6XA 2FJ1A 3DWLE 1LE8A 4GYIA 3VEPA 3A01A 2P7VB 2G0EA 5JI6A 2AS5F 5K5OA 2VONA 4BXXJ 2KIMA 2WV1A 5J4VA 2LC2A 5E79C 5FB2A 2MYSA 2L7ZA 4D7NA 2WV0A 1GVDA 4EM1A 1O7FA 2VC0A 4UUSA 2MC4A 1IUYA 4HG2A 3KEQA 3ASOH 3RKYA 4ZTFA 1R4NB 1S3JA 1SVMA 2FNPA 4D5FA 1VF9A 2W25A 4CZCA 2BY0A 3AAFA 2R93J 4EM0B 4EM2A 2WY7Q 2A3SA 1WHUA 2DMNA 3REOA 1IN5A 3BJAA 3V42A 1JXSA 4KYWA 2CSOA 2LF8A 2V9PA 2VXZA 1SFKA 2KISA 4D7MA 4EQQA 3HOYJ 4A6EA 3G6EI 5IOZA 1HSTA 2C6YA 4AIKA 1ETWA 1LB2A 2P81A 2VQCA 2VT2A 4PFPA 3MCZA 2HTSA 2Y75A 5E3NA 1PP7U 4BEHB 3V8LA 3VFZA 3DU5A 5ICCA 3D5RC 4QTRA 2CH0A 3ABMH 2KJCA 2NS8A 1WZ2A 2HXIA 2Z2SB 4LG0B 1E3OC 3LSKA 5AIPA 1JKPC 3CCJI 3H3VK 2CMPA 2R3SA 4RAGA 4ENKA 4M9ZA 3H36A 1KQ9A 4LOCA 4UB6C 5HLHA 2NNNA 2M0CA 2DTZA 4II3A 2G7HA 2OTJI 1OPCA 3FWEA 2KJBA 3L7WA 3UNGC 4DYQA 4Y13A 1LKXA 1D0YA 3RYRA 1T39A 5A2QK 5KAIC 2K3FA 4CICA 3CQZJ 4MIMA 4XRSG 4E70A 2JN6A 2QVOA 4A0XA 2PJPA 1U8BA 2NNYA 4PSXA 2MG4A 5B66C 3K1PA 1Z21A 3ULQB 1RESA 2NOJB 1J9IA 4OIQF 3CJRB 3TP3A 1E2XA 2L2OA 3FIWA 2HDCA 4BY7J 4ZYEA 1U5TB 1YI2I 1GV2A 4S0HB 2VODA 4DNCA 3DLLF 5TGTA 2XGEA 4II2A 1Z1DA 4OU0A 3M9AA 4YIFA 2PJRB 1ZREA 1UFMA 3K10A 3OR2C 1WH5A 3DXJF 4YEJA 3WTTC 1MNMC 4PGGA 3LSJA 5DTDA 3L1PA 2ZMEC 3QU3A 4E4HA 3CP2A 1VQKI 1S29A 1YLFA 2VQHA 3ZN1A 5E3MA 2FEZA 1F4KA 1FSEA 1OCRH 4PCQA 4NC7A 1ZH5A 2E1MB 2Y31A 3SEQA 1U3EM 2VBWA 5KNLA 3VODA 2FBKA 4JOMA 3KEYA 1MGTA 2X6WA 3OYHA 3C2GA 3ZMUA 2K85A 5FKLA 2L01A 3QP6A 5K5RA 2M2EA 2K86A 1S7EA 2LSOA 1DU6A 2NOGA 1YRNB 1ZLKA 2VKVA 2JT1A 1RR7A 5EYRA 2P8TA 2UV1A 2LY9A 4W1UA 3W2WA 3AG4H 2D45A 1JE8A 4HX4A 1QHGA 4IHSA 4F91B 5EG0A 2Q2EA 3GTGJ 3R6SA 3I55I 3P5JA 5J8FA 3M3YJ 1HLVA 4ZJZA 2W82A 1W1WE 2A69F 2WAEA 3OYCA 4V2FA 2A6EF 1FYMA 5IP9J 4I99C 4KISA 3F9KA 2J5PA 4E7LA 3ZMSA 1LDKB 3BTJA 3R61A 4IQJA 1JUPA 1Y8QB 2LVSA 1CF7A 2L7FP 4FTHA 3BC8A 1KYZA 2QYOA 5B3SH 5EF6A 4CCNA 1V5FA 2P0WA 3GXOA 5HDNA 3Q0WA 2HNHA 3PNTA 2X1EA 1FOYA 3BQZA 3IWZA 4DYRA 3LSHA 3NRVA 2DLLA 3H0GJ 4IVNA 4LB6B 1S5LC 2OJED 1DDNA 2VC1A 2FQ4A 3M8EA 1YJWI 4ZTJA 2WY8Q 4ASNA 2DT6A 2OV7A 3CESA 3EUKL 3KYDB 3RDIA 1H0MA 5FD5A 4IOAF 2KL4A 1J75A 3EPZA 2KDZA 3C2HA 3CUOA 3BG5A 1OCOH 3ABTA 1IN4A 4A3IJ 2F48A 3GMEA 4A5NA 1ZTRA 1IN6A 1JHFA 2B9SA 3CD6I 2XAUA 1YHQI 4IPAA 3DKYA 2JUGA 4RS8A 2JSPA 4M6YA 1RUOA 4HX7A 3PO2J 3GFMA 2E34A 2Z5UA 4ZZDA 4EJVA 2GXBA 1EF4A 6PAXA 2EZHA 4FE4A 4GYGA 4FQGA 3CCVI 5E1XA 4CGZA 1XGSA 2IS6A 1ZYRF 3SXYA 3TBIA 2R7QA 3WGIA 4B44A 2CYYA 2LMDA 5ILUA 3F8BA 3AL0C 3GTQJ 1TT0A 4G6QA 3HEFA 2KRHA 3W6JB 3DF8A 1F1ZA 5DCMA 1H88C 2STTA 4KA4A 3V4GA 1PUFB 2GIVA 3HHHA 2A68F 2W85A 3PQJA 3U21A 3RPQA 4G94A 4CSWA 4DIQA 5BS6A 4JX5A 3J7YJ 2DW4A 2FMLA 1R6RA 2QSHX 2RN7A 1SMYF 3R0AA 2F4OB 2BXYA 2DFEA 2RGVA 3OIPA 2TRTA 4UV9A 3MZ8A 1LEBA 2KZGA 2HQ5A 3N4MA 1OISA 2MGQA 2QQ9A 1K78A 1T56A 2GA1A 2HKOA 2LKXA 3HL2A 2FOWA 2QA4I 3HRTA 2XPUA 1LNWA 4BUPA 4M9SA 4L5IA 2HQAA 1X4PA 4HQMA 4B09A 2IPQX 1XGNA 1LVAA 1T2KA 1VQMI 2FOKA 2X48A 4GRIA 4XOTA 2V26A 3EYYA 4NDLA 4LLNA 1VQNI 5CJ9A 3WE2A 4ZYAA 2MW8A 1XC5A 3ABKH 4XRSA 2EILH 2XHKA 3HG9A 4FX4A 3A4CA 3GZNB 1MNDA 2V9VA 2QKLB 2VJIA 3BR2A 1ETKA 1USTA 3D0SA 4BDZA 2F5VA 2XIGA 3MZHA 3TMOA 2IT0A 3K0LA 2KQRA 1T0FA 2FBHA 5JFRA 1JKQC 3DFGA 2WBMA 2EA2A 4OMZA 5D6EA 4BE0A 3H9QA 1X1CA 4NQWB 1OYWA 3H5AA 2HYFA 1XGMA 1XB4A 2XAHA 2I10A 2BEOA 3S16J 3F8NA 1LUJB 4HNTA 5J6XA 3EQLF 2WTEA 4FISA 3U1KA 2L7KA 3ZQIA 4P55A 1WJEA 2R5YB 3DV8A 3J7AY 1JHHA 4ZDOA 3A02A 5J3LA 3GTKJ 3F3XA 3RIRA 2F5FA 4DW6A 4J01A 1K6OA 4G7OF 5JHUA 3B6CA 1ETVA 2NVYJ 2NXNB
chains in the Genus database with same CATH topology
1FEXA 3MKLA 1R9TJ 3K2AA 2XGDA 3JRFA 4IEJA 2DMUA 1BW5A 2EZLA 3BQYA 2R5ZA 1MBFA 4RDUA 4A3LJ 3GTMJ 2COBA 1VNDA 3Q0UA 1G2HA 4BKXA 4XICA 1TWGJ 2FX0A 1AKHA 5F0CA 2ME0A 2R5ZB 2NVQJ 9ANTA 1XG1A 2HXOA 5C4JJ 1TWAJ 1JJ8C 4ABZA 5C3EJ 3JRDA 2NVTJ 3HBLA 1AKHB 4BY1J 4A69C 1A5JA 3JRCA 5M5XJ 1POGA 3I4NJ 5GPAA 4IHVA 2DMTA 1QVTA 1A6IA 3OSFA 2DJNA 3LOCA 4MO7A 2M9HA 4W97A 5EZHA 2DMPA 5FKNA 1UG2A 1ENHA 2DA2A 1IG7A 1MSEC 3C2BA 1TWFJ 4D5CA 2IBDA 2XSDC 1TWHJ 3HKZN 3SDGA 1AU7A 5EGOA 3RKQA 3ZQFA 2HYJA 2NVXJ 4A3CJ 4M3BA 1FTZA 3JR9A 2Y30A 1WI3A 3NAUA 5EGOB 5F04A 5DS9A 3BR5A 1ZQ3P 4FE7A 5E3OA 2M34A 3LSGA 3FK7A 1ETXA 5BNGA 1MBHA 3JRBA 4A3FJ 1Z0XA 1SFOJ 3IH4A 3A03A 3HDDA 2KT0A 4DZJA 4C3HJ 1U78A 1B8IA 1WGXA 3B6AA 1U9NA 1WCMJ 2ECCA 4GFBA 2VUMJ 1JTXA 1B8IB 2O7OA 3ZQCA 3G1OA 3GTJJ 4Y52J 2K9NA 2DMQA 1ETQA 5M3MJ 1JKRC 1JT0A 1TWCJ 3S1RJ 3MN2A 2O8KA 2L0KA 5EZGA 3HOWJ 3DCFA 2QCOA 5HODA 3HOZJ 1IGNA 1OCPA 3JRIA 4C3IJ 2JA5J 3GTOJ 3S17J 2K9QA 1HDPA 1ETOA 3ZQHA 5IPAA 1UMQA 2WB1N 5C4XJ 1HF0A 1T33A 3S1MJ 1IUFA 2E2HJ 2K9SA 2DA5A 3PM1A 4XIDA 2CQQA 2VPRA 2FJ1A 1IJWC 2Y0SN 5IP7J 2XB5A 1LE8A 2JA6J 4C2MJ 2EZKA 3A01A 2G0EA 4HNVA 2XPWA 1MSFC 3RQIA 2O9LA 4BXXJ 2LK2A 2WV1A 2CU7A 1LE8B 3FKIJ 1GT0C 2L7ZA 4D7NA 3A01B 1GVDA 2MSYA 1ZKGA 4UUSA 2LLKA 1OFCX 1BW6A 1ZK8A 4B4CA 3GTLJ 5IYDJ 1P7JA 4D5FA 4UUSB 1VF9A 3F0CA 3NARA 2OPTA 2R93J 4A3KJ 3HB9A 3LNQA 1XS9A 2DMNA 4I6ZA 3OOUA 4C3JJ 4B3AA 2JA8J 2DA6A 4D7MA 2E2JJ 3HOYJ 5IP6A 2JA7J 1OJLA 1UHSA 5IOZA 1ORKA 3IV5A 1NK3P 2H1KA 4MFDA 3Q3SA 1ETWA 2LR8A 3WHBA 4IHYA 1GUUA 2P81A 2GBYA 1VI0A 3BT9A 3D1NI 2ECBA 5E3NA 5FJ8J 2EH3A 4QTRA 2EBIA 3GBGA 1JT6A 2LTPA 2HI3A 2ID3A 2NS8A 3S1NJ 4L5EA 1IC8A 2HXIA 2EQRA 1E3OC 5GPCA 4QIWN 1IRZA 3DEWA 4XK4A 1JKPC 1TC3C 2M8GX 3UKGA 2X6OA 4M3FA 3H3VK 2X9DA 1APLC 2CRGA 2ZB9A 4LOCA 3W6VA 2FD5A 1W0UA 1JUSA 3O8GA 3Q0VA 3RZOJ 2M0CA 2DTZA 2E1OA 2OF7A 4DYQA 2H8RA 3CQZJ 4MIMA 4XRSG 1HDDC 2Y9YA 2JN6A 5M5WJ 3HM5A 2JMWA 3CMYA 5J1YA 1GDTA 1U8BA 1VFCA 2MG4A 1IDYA 1Y1VJ 1RESA 4G12A 3TP3A 3FIWA 5J1RA 3TEDA 4BY7J 5IYCJ 1JKOC 3BR0A 1K61A 3MVPA 1GV2A 4S0HB 1LFUP 1HOMA 1MH3A 3HOXJ 4MFEA 4A93J 1B72A 2XGEA 3O8HA 2NS7A 3QPSA 1WH5A 2XRLA 4I76A 1H8AC 1MNMC 1MH4A 1B72B 1GV5A 1SANA 2IEKA 3LSJA 5DTDA 3L1PA 4RBOA 3S1QJ 1JTYA 1BL0A 1CQTA 2RAEA 2DA3A 5E3MA 1BJZA 2TCTA 1HCRA 1RETA 2Y31A 5JLXA 4AC0A 4A3JJ 1F36A 4JX4A 1YRNA 2LP0A 4A3MJ 2VI6A 5F0FA 1QVUA 5FKLA 2M2EA 1H89C 1S7EA 1DU6A 2HOSA 2NOGA 1YRNB 2VKVA 1MBKA 1RR7A 5EYRA 4XRMA 3QQAA 4UUTA 4M3GA 3IH3A 2LY9A 4W1UA 5EG0A 3GTGJ 1ZR2A 3M3YJ 5JLWA 3BTIA 4X1EA 5J1UA 1HLVA 1IDZA 2LFBA 3LSRA 3BTCA 4DZPA 1W0TA 5EG0B 2B63J 2L7MP 2CUFA 1FIPA 4V2FA 3S2DJ 1WH7A 4EEFG 5IP9J 1MBJA 1RPWA 2DA4A 3BTJA 1JUPA 1X2MA 2LVSA 5K7FA 1OCTC 2CJJA 2L7FP 1FTTA 3BG9A 2YS9A 5F0HA 4FTHA 1D5YA 2YU9J 1Y1WJ 3BG3A 5EF6A 2HDDA 1RKTA 3E7LA 5M3FJ 2EZIA 4AUXA 1ZGWA 3Q0WA 4M3EA 1K83J 1QPIA 3BR6A 4CYCA 3BQZA 4DYRA 1P7IA 2JJ7A 3H0GJ 3ZOBA 4DYCA 5FLMJ 4CYCB 2FQ4A 2D5VA 2XGCA 3JRHA 1I50J 3QPLA 2KDZA 3BG5A 1X2NA 5F1JA 1FIAA 4A3IJ 1MBEA 1FJLA 2PMZN 3JRAA 1ZTRA 4JYKA 3SJMA 4A3BJ 1BA5A 1LFBA 2GM4A 1JGGA 3PO2J 2JK3A 4B1RA 3I4MJ 3BR1A 2E2IJ 1EF4A 2EZHA 2QF7A 4FE4A 4J19A 4A3EJ 1Q1VA 3JREA 1U9OA 3ZQLA 5EEAA 2VKEA 3HOUJ 2IAIA 3GTQJ 1ITYA 4M3DA 2YUSA 3HEFA 4IHWA 4A3DJ 5K7ZA 1PUFA 3IH2A 3FISA 2DA1A 1H88C 2AHQA 4M6VA 2DN0A 5F08A 1PUFB 3M4OJ 2K40A 2ID6A 4JX5A 3ZQGA 2XPVA 2DA7A 1NK2P 3HGGA 1JUMA 2TRTA 3HGYA 3SFIA 4IHXA 3HOVJ 3PO3J 1WPKA 2HQ5A 2ME6A 1ETYA 1X58A 5M5YJ 1I6HJ 3JRGA 3BR3A 2MGQA 5FLVA 1T56A 2CQXA 2LKXA 4Y7NJ 1DU0A 3CDLA 4JX6A 3S2HJ 1F43A 4V2GA 1ZR4A 3LSPA 2XPUA 4BBRJ 2GLOA 5IOYA 2AO9A 4MLOA 3TW6A 2JWTA 2X48A 5C44J 3K7AJ 1IV6A 1MBGA 4BBSJ 3G1LA 2L9RA 3CCYA 3S15J 4NDLA 2XB0X 3OSGA 2MW8A 1XC5A 4XRSA 2HOTA 1I3QJ 3TP0A 2Y2ZA 1RKWA 3BTLA 1NTCA 4QSHA 3VPRA 1JJ6C 3BR2A 1ETKA 3RZDJ 2CUEA 2E19A 3WHCA 5K7HA 5EDNA 1Z77A 1QRYA 3S14J 1JKQC 4A3GJ 2R7ZJ 5FKOA 2W48A 4JP0A 5FKKA 2I10A 2LD5A 3S16J 2R5YA 2R92J 2ELKA 4FCYA 2HOAA 4X6AJ 3G1MA 1AHDP 4FISA 3ZQIA 2R5YB 3TW7A 3FK6A 5FKMA 2N8GA 3A02A 5J3LA 3GTKJ 5F27A 3GTPJ 4AYBN 3OIOA 4DW6A 5IYBJ 5E3LA 3B6CA 1ETVA 2WAQN 5GP9A 2NVYJ 2Y9ZA 1O4XA 2R0QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEX A;  3MKL A;  1R9T J;  3K2A A;  2XGD A;  3JRF A;  4IEJ A;  2DMU A;  1BW5 A;  2EZL A;  3BQY A;  2R5Z A;  1MBF A;  4RDU A;  4A3L J;  3GTM J;  2COB A;  1VND A;  3Q0U A;  1G2H A;  4BKX A;  4XIC A;  1TWG J;  2FX0 A;  1AKH A;  5F0C A;  2ME0 A;  2R5Z B;  2NVQ J;  9ANT A;  1XG1 A;  2HXO A;  5C4J J;  1TWA J;  1JJ8 C;  4ABZ A;  5C3E J;  3JRD A;  2NVT J;  3HBL A;  1AKH B;  4BY1 J;  4A69 C;  1A5J A;  3JRC A;  5M5X J;  1POG A;  3I4N J;  5GPA A;  4IHV A;  2DMT A;  1QVT A;  1A6I A;  3OSF A;  2DJN A;  3LOC A;  4MO7 A;  2M9H A;  4W97 A;  5EZH A;  2DMP A;  5FKN A;  1UG2 A;  1ENH A;  2DA2 A;  1IG7 A;  1MSE C;  3C2B A;  1TWF J;  4D5C A;  2IBD A;  2XSD C;  1TWH J;  3HKZ N;  3SDG A;  1AU7 A;  5EGO A;  3RKQ A;  3ZQF A;  2HYJ A;  2NVX J;  4A3C J;  4M3B A;  1FTZ A;  3JR9 A;  2Y30 A;  1WI3 A;  3NAU A;  5EGO B;  5F04 A;  5DS9 A;  3BR5 A;  1ZQ3 P;  4FE7 A;  5E3O A;  2M34 A;  3LSG A;  3FK7 A;  1ETX A;  5BNG A;  1MBH A;  3JRB A;  4A3F J;  1Z0X A;  1SFO J;  3IH4 A;  3A03 A;  3HDD A;  2KT0 A;  4DZJ A;  4C3H J;  1U78 A;  1B8I A;  1WGX A;  3B6A A;  1U9N A;  1WCM J;  2ECC A;  4GFB A;  2VUM J;  1JTX A;  1B8I B;  2O7O A;  3ZQC A;  3G1O A;  3GTJ J;  4Y52 J;  2K9N A;  2DMQ A;  1ETQ A;  5M3M J;  1JKR C;  1JT0 A;  1TWC J;  3S1R J;  3MN2 A;  2O8K A;  2L0K A;  5EZG A;  3HOW J;  3DCF A;  2QCO A;  5HOD A;  3HOZ J;  1IGN A;  1OCP A;  3JRI A;  4C3I J;  2JA5 J;  3GTO J;  3S17 J;  2K9Q A;  1HDP A;  1ETO A;  3ZQH A;  5IPA A;  1UMQ A;  2WB1 N;  5C4X J;  1HF0 A;  1T33 A;  3S1M J;  1IUF A;  2E2H J;  2K9S A;  2DA5 A;  3PM1 A;  4XID A;  2CQQ A;  2VPR A;  2FJ1 A;  1IJW C;  2Y0S N;  5IP7 J;  2XB5 A;  1LE8 A;  2JA6 J;  4C2M J;  2EZK A;  3A01 A;  2G0E A;  4HNV A;  2XPW A;  1MSF C;  3RQI A;  2O9L A;  4BXX J;  2LK2 A;  2WV1 A;  2CU7 A;  1LE8 B;  3FKI J;  1GT0 C;  2L7Z A;  4D7N A;  3A01 B;  1GVD A;  2MSY A;  1ZKG A;  4UUS A;  2LLK A;  1OFC X;  1BW6 A;  1ZK8 A;  4B4C A;  3GTL J;  5IYD J;  1P7J A;  4D5F A;  4UUS B;  1VF9 A;  3F0C A;  3NAR A;  2OPT A;  2R93 J;  4A3K J;  3HB9 A;  3LNQ A;  1XS9 A;  2DMN A;  4I6Z A;  3OOU A;  4C3J J;  4B3A A;  2JA8 J;  2DA6 A;  4D7M A;  2E2J J;  3HOY J;  5IP6 A;  2JA7 J;  1OJL A;  1UHS A;  5IOZ A;  1ORK A;  3IV5 A;  1NK3 P;  2H1K A;  4MFD A;  3Q3S A;  1ETW A;  2LR8 A;  3WHB A;  4IHY A;  1GUU A;  2P81 A;  2GBY A;  1VI0 A;  3BT9 A;  3D1N I;  2ECB A;  5E3N A;  5FJ8 J;  2EH3 A;  4QTR A;  2EBI A;  3GBG A;  1JT6 A;  2LTP A;  2HI3 A;  2ID3 A;  2NS8 A;  3S1N J;  4L5E A;  1IC8 A;  2HXI A;  2EQR A;  1E3O C;  5GPC A;  4QIW N;  1IRZ A;  3DEW A;  4XK4 A;  1JKP C;  1TC3 C;  2M8G X;  3UKG A;  2X6O A;  4M3F A;  3H3V K;  2X9D A;  1APL C;  2CRG A;  2ZB9 A;  4LOC A;  3W6V A;  2FD5 A;  1W0U A;  1JUS A;  3O8G A;  3Q0V A;  3RZO J;  2M0C A;  2DTZ A;  2E1O A;  2OF7 A;  4DYQ A;  2H8R A;  3CQZ J;  4MIM A;  4XRS G;  1HDD C;  2Y9Y A;  2JN6 A;  5M5W J;  3HM5 A;  2JMW A;  3CMY A;  5J1Y A;  1GDT A;  1U8B A;  1VFC A;  2MG4 A;  1IDY A;  1Y1V J;  1RES A;  4G12 A;  3TP3 A;  3FIW A;  5J1R A;  3TED A;  4BY7 J;  5IYC J;  1JKO C;  3BR0 A;  1K61 A;  3MVP A;  1GV2 A;  4S0H B;  1LFU P;  1HOM A;  1MH3 A;  3HOX J;  4MFE A;  4A93 J;  1B72 A;  2XGE A;  3O8H A;  2NS7 A;  3QPS A;  1WH5 A;  2XRL A;  4I76 A;  1H8A C;  1MNM C;  1MH4 A;  1B72 B;  1GV5 A;  1SAN A;  2IEK A;  3LSJ A;  5DTD A;  3L1P A;  4RBO A;  3S1Q J;  1JTY A;  1BL0 A;  1CQT A;  2RAE A;  2DA3 A;  5E3M A;  1BJZ A;  2TCT A;  1HCR A;  1RET A;  2Y31 A;  5JLX A;  4AC0 A;  4A3J J;  1F36 A;  4JX4 A;  1YRN A;  2LP0 A;  4A3M J;  2VI6 A;  5F0F A;  1QVU A;  5FKL A;  2M2E A;  1H89 C;  1S7E A;  1DU6 A;  2HOS A;  2NOG A;  1YRN B;  2VKV A;  1MBK A;  1RR7 A;  5EYR A;  4XRM A;  3QQA A;  4UUT A;  4M3G A;  3IH3 A;  2LY9 A;  4W1U A;  5EG0 A;  3GTG J;  1ZR2 A;  3M3Y J;  5JLW A;  3BTI A;  4X1E A;  5J1U A;  1HLV A;  1IDZ A;  2LFB A;  3LSR A;  3BTC A;  4DZP A;  1W0T A;  5EG0 B;  2B63 J;  2L7M P;  2CUF A;  1FIP A;  4V2F A;  3S2D J;  1WH7 A;  4EEF G;  5IP9 J;  1MBJ A;  1RPW A;  2DA4 A;  3BTJ A;  1JUP A;  1X2M A;  2LVS A;  5K7F A;  1OCT C;  2CJJ A;  2L7F P;  1FTT A;  3BG9 A;  2YS9 A;  5F0H A;  4FTH A;  1D5Y A;  2YU9 J;  1Y1W J;  3BG3 A;  5EF6 A;  2HDD A;  1RKT A;  3E7L A;  5M3F J;  2EZI A;  4AUX A;  1ZGW A;  3Q0W A;  4M3E A;  1K83 J;  1QPI A;  3BR6 A;  4CYC A;  3BQZ A;  4DYR A;  1P7I A;  2JJ7 A;  3H0G J;  3ZOB A;  4DYC A;  5FLM J;  4CYC B;  2FQ4 A;  2D5V A;  2XGC A;  3JRH A;  1I50 J;  3QPL A;  2KDZ A;  3BG5 A;  1X2N A;  5F1J A;  1FIA A;  4A3I J;  1MBE A;  1FJL A;  2PMZ N;  3JRA A;  1ZTR A;  4JYK A;  3SJM A;  4A3B J;  1BA5 A;  1LFB A;  2GM4 A;  1JGG A;  3PO2 J;  2JK3 A;  4B1R A;  3I4M J;  3BR1 A;  2E2I J;  1EF4 A;  2EZH A;  2QF7 A;  4FE4 A;  4J19 A;  4A3E J;  1Q1V A;  3JRE A;  1U9O A;  3ZQL A;  5EEA A;  2VKE A;  3HOU J;  2IAI A;  3GTQ J;  1ITY A;  4M3D A;  2YUS A;  3HEF A;  4IHW A;  4A3D J;  5K7Z A;  1PUF A;  3IH2 A;  3FIS A;  2DA1 A;  1H88 C;  2AHQ A;  4M6V A;  2DN0 A;  5F08 A;  1PUF B;  3M4O J;  2K40 A;  2ID6 A;  4JX5 A;  3ZQG A;  2XPV A;  2DA7 A;  1NK2 P;  3HGG A;  1JUM A;  2TRT A;  3HGY A;  3SFI A;  4IHX A;  3HOV J;  3PO3 J;  1WPK A;  2HQ5 A;  2ME6 A;  1ETY A;  1X58 A;  5M5Y J;  1I6H J;  3JRG A;  3BR3 A;  2MGQ A;  5FLV A;  1T56 A;  2CQX A;  2LKX A;  4Y7N J;  1DU0 A;  3CDL A;  4JX6 A;  3S2H J;  1F43 A;  4V2G A;  1ZR4 A;  3LSP A;  2XPU A;  4BBR J;  2GLO A;  5IOY A;  2AO9 A;  4MLO A;  3TW6 A;  2JWT A;  2X48 A;  5C44 J;  3K7A J;  1IV6 A;  1MBG A;  4BBS J;  3G1L A;  2L9R A;  3CCY A;  3S15 J;  4NDL A;  2XB0 X;  3OSG A;  2MW8 A;  1XC5 A;  4XRS A;  2HOT A;  1I3Q J;  3TP0 A;  2Y2Z A;  1RKW A;  3BTL A;  1NTC A;  4QSH A;  3VPR A;  1JJ6 C;  3BR2 A;  1ETK A;  3RZD J;  2CUE A;  2E19 A;  3WHC A;  5K7H A;  5EDN A;  1Z77 A;  1QRY A;  3S14 J;  1JKQ C;  4A3G J;  2R7Z J;  5FKO A;  2W48 A;  4JP0 A;  5FKK A;  2I10 A;  2LD5 A;  3S16 J;  2R5Y A;  2R92 J;  2ELK A;  4FCY A;  2HOA A;  4X6A J;  3G1M A;  1AHD P;  4FIS A;  3ZQI A;  2R5Y B;  3TW7 A;  3FK6 A;  5FKM A;  2N8G A;  3A02 A;  5J3L A;  3GTK J;  5F27 A;  3GTP J;  4AYB N;  3OIO A;  4DW6 A;  5IYB J;  5E3L A;  3B6C A;  1ETV A;  2WAQ N;  5GP9 A;  2NVY J;  2Y9Z A;  1O4X A;  2R0Q C; 
#chains in the Genus database with same CATH topology
 1MDM B;  4WXC A;  2GIZ A;  3MKL A;  3CUQ C;  3PFY A;  4YRV A;  1G3T A;  4EVI A;  2LG4 A;  2QQA A;  1STZ A;  4I02 A;  2HQN A;  1MBF A;  4G6T B;  2M7B A;  2COB A;  4AU7 A;  4IQ4 A;  1AKH A;  1USS A;  3CCM I;  2HVR A;  3IAM 2;  5LHG A;  2XF7 A;  1JJ8 C;  4KIF A;  4ABZ A;  3S2W A;  2NVT J;  3HBL A;  1RZ4 A;  1T98 A;  1RRJ A;  4IKF A;  3KLO A;  3GFJ A;  4XKC A;  2CS3 A;  1XGO A;  2TDX A;  3KP5 A;  1D8J A;  4RGS A;  4DGW B;  2EV6 A;  4IHV A;  4LK0 F;  2RVC A;  2VOO A;  1WJD A;  2RC4 A;  3OYI A;  4W97 A;  2DMP A;  3J81 K;  4IRI A;  1BOA A;  5JVG F;  1IG7 A;  4AVZ A;  1MSE C;  3IHU A;  5FRO A;  3JSO A;  2XRO A;  2IBD A;  2M5W A;  4RAY A;  1YTY A;  3GW2 A;  4P9U A;  3QPT A;  2EFN A;  1MMD A;  1XSV A;  3TOA A;  3ZQF A;  2WA0 A;  4IHT A;  4HV6 A;  2KFD A;  4M3B A;  1BI1 A;  4M74 A;  2R7R A;  2Y30 A;  2MC3 A;  2P7C B;  5DS9 A;  1IAW A;  1BJA A;  4S04 A;  1ZQ3 P;  3H5R A;  3FKJ A;  2HWV A;  4ETS A;  5E3O A;  2A6T A;  3I59 A;  3LSG A;  1BBY A;  1P2F A;  1Z0X A;  2E35 A;  3QP5 A;  1T6S A;  3OMY A;  3I9V 2;  5AIQ A;  2KT0 A;  5FRN A;  1ULY A;  2X4H A;  1R23 A;  2ECC A;  4HA8 A;  4QWQ A;  4HSR A;  4C30 A;  1B8I B;  4KN7 X;  3PNY A;  4HYE A;  2ZJR F;  1WRJ A;  1QO0 D;  4BU2 A;  1B6A A;  3MEX A;  2BOL A;  2DMQ A;  2YX7 A;  1FMW A;  2L9S A;  4BHC A;  1IO2 A;  5M3M J;  5HS8 A;  1JKR C;  2O8K A;  3WE3 A;  3HOZ J;  3LWF A;  5DYM A;  5D6F A;  4HOB A;  3JRI A;  1X19 A;  3GTO J;  2W00 A;  1FLI A;  3S17 J;  2K9Q A;  2F2E A;  2LBF B;  1HDP A;  3P9I A;  4MEY F;  1R7J A;  3OS0 A;  1Y6I A;  1HF0 A;  1R4M B;  3RTR A;  1IUF A;  3PIP F;  1WJB A;  1FOW A;  1YX3 A;  2JVH A;  2OU2 A;  1S6L A;  2R7D A;  1BI2 A;  1LDJ A;  1EA3 A;  1TZL A;  2PMU A;  2H8W A;  2IGM A;  5LHH A;  2XF6 A;  2MD5 A;  5IP7 J;  2XB5 A;  3CC4 I;  1WFX A;  2JA6 J;  3AG1 H;  3GEZ A;  2CG4 A;  3CF2 A;  1R71 A;  2CU7 A;  5F6F A;  5E8I A;  2LKS A;  2MSY A;  1TNS A;  1ZKG A;  2LLK A;  2Z16 A;  1OFC X;  2K7L A;  3FXU A;  3ERE D;  2HOE A;  4RA2 A;  4C2T A;  3PSF A;  2WWY A;  3AFH A;  3NAR A;  2WAD A;  4MQ9 F;  1XTA A;  2UUZ A;  3PJR A;  1N75 A;  3LNQ A;  1YS7 A;  3CCL I;  2XKO A;  2FUG 2;  3WU2 C;  2DTR A;  4I6Z A;  2M45 A;  2MBF A;  1LEA A;  4L0Y B;  1TBX A;  4XKW A;  2OD5 A;  1G3Y A;  2JA8 J;  2DA6 A;  2FSW A;  3OYF A;  5IP6 A;  1OJL A;  2PN6 A;  4XM3 A;  1ORK A;  2QBY B;  4MFD A;  3HRM A;  4BEH A;  3Q3S A;  5KCM A;  3DEE A;  1VI0 A;  2Z3Y A;  2O0Y A;  3D1N I;  1ZHF A;  3WTW C;  4UY8 I;  3DPL C;  4LG0 A;  3TDZ C;  4O6J A;  5HLG A;  3GBG A;  4WXD A;  3PSI A;  4I0B A;  2JPB A;  2CW7 A;  1IC8 A;  1G59 A;  2HVS A;  4QIW N;  1IRZ A;  5LGT A;  1Z91 A;  3DEW A;  1TC3 C;  2QWW A;  1YO5 C;  4BYY A;  3OYN A;  2EB7 A;  3UKG A;  2L4A A;  4IXA A;  4M3F A;  2CFO A;  2X9D A;  2EIN H;  3OYG A;  4A5M A;  4OIP F;  1APL C;  1FP2 A;  1KU3 A;  2FD5 A;  1W36 D;  5FLX K;  1IXC A;  3Q0V A;  3RZO J;  4ZDP A;  3DPT A;  2RKH A;  4HDU A;  4B43 A;  4QLC U;  1EV7 A;  4KMU X;  1D5V A;  1YIO A;  2RNG A;  3LSM A;  5ICF A;  3DBR B;  1UEL B;  3KZY A;  1ZG1 A;  4KDP A;  2KKO A;  2NS0 A;  1HDD C;  2Y9Y A;  2B7E A;  3DTK A;  4LIV A;  3HM5 A;  2V6C A;  5B1B H;  1U5T A;  4DBR A;  5IT3 A;  1W5T A;  1WJ5 A;  4M9X A;  4XSZ F;  1Z6R A;  4NBQ A;  3ELK A;  3SHF A;  2GA2 A;  3TED A;  5E1Z B;  1V4R A;  3BR0 A;  1JKO C;  4A12 A;  4OIR F;  3MVP A;  4YFX F;  4OIN F;  2PJR A;  1MH3 A;  3R0J A;  3BOQ A;  3BZK A;  5CVI A;  2KIF A;  3DU6 A;  1TW2 A;  1X1D A;  2QEN A;  3OIQ A;  2LYC A;  1VQ4 I;  2XKP A;  3V7C A;  3GO5 A;  4XLP F;  5HDG A;  1Z6T A;  4LG3 A;  1V3F A;  3WOD F;  1B1B A;  4BQN A;  1GV5 A;  1SAN A;  4XMY A;  3VYS B;  2M8E A;  3SDB A;  3JAM Z;  2W84 A;  2LY2 A;  4RBO A;  2JZY A;  1OQY A;  3KE2 A;  2JUC A;  2TCT A;  1ZEL A;  3FXJ A;  1RET A;  2K4B A;  3K4C A;  5JLX A;  2H6C A;  4HNU A;  4MTE A;  4A3J J;  3S32 A;  1F36 A;  3K4K A;  2K02 A;  3K4B A;  5GAH J;  2BVM A;  1YRN A;  1R22 A;  1T8I A;  5IT9 Z;  2XAQ A;  5KHD A;  5F0F A;  2YSR A;  4N4O B;  3ZP5 A;  4E7J A;  2HOS A;  1W36 C;  2R7U A;  4BQQ A;  2OUM A;  2M1B A;  4M73 A;  3H1C A;  5DD8 A;  3ZGK A;  2QUF A;  3KP3 A;  3NQO A;  4U0W A;  3VYU B;  4HF2 A;  2EFW A;  2DPU A;  5D5V B;  2H6B A;  2L02 A;  1B59 A;  2P5V A;  1FP1 D;  2R7T A;  2LFB A;  3LSR A;  1W0T A;  2DO7 A;  3ZMT A;  5J47 A;  3S2D J;  1WH7 A;  4EEF G;  2YX4 A;  4U7B A;  2Z33 A;  3QYF A;  1U0J A;  3DBL B;  1V54 H;  2G9W A;  4LJZ F;  1D3Y A;  1RPW A;  3GZ5 A;  5FD6 A;  5L3E A;  4A0Y A;  1X2M A;  3HRU A;  5D5W B;  4XR6 A;  2QLZ A;  2VN2 A;  3KEO A;  3VDX A;  2O03 A;  1D5Y A;  3BG3 A;  3HUG B;  3H35 A;  1LFP A;  1TQP A;  2QQ8 A;  3E7L A;  5M3F J;  2GWR A;  4HV5 A;  3AKZ A;  4ZZL A;  1QZZ A;  2K9L A;  4M3E A;  1S7A A;  4LIT A;  1R49 A;  2EK5 A;  1Y0U A;  1P9Q C;  1E3P A;  3ZRG A;  2LOO A;  1P7I A;  1HW1 A;  2E7X A;  2OZU A;  1T0F C;  5FLM J;  1FYL A;  1QPM A;  4CYC B;  1BM9 A;  2PMH A;  2JSC A;  1WKM A;  1VQ7 I;  1BIB A;  1SD5 A;  1SFE A;  3HHG A;  5CKT A;  1I50 J;  3LST A;  1K6Y A;  5DUK A;  1I39 A;  1D8K A;  2A05 A;  2HDW A;  2L5Q A;  5F1J A;  1FIA A;  1FJL A;  1O3Q A;  1IRG A;  4JYK A;  1H9G A;  3QOE A;  5D8L B;  4KFC A;  1JI8 A;  2VIX A;  2IJL A;  2DJI A;  4Y15 A;  2RV8 A;  1ZG5 A;  5CQE A;  3BR1 A;  2I5U A;  2PEX A;  2Y69 H;  3OYA A;  1WQ2 A;  2VE9 A;  4HF0 A;  5TRD A;  3N97 A;  4J19 A;  1TTY A;  1N25 A;  3OY9 A;  1EH6 A;  1EH8 A;  3CLO A;  1Q1V A;  2KMU A;  3GVA A;  1U9O A;  3JRE A;  2PBI A;  3KP2 A;  1A35 A;  3L2V A;  3HOU J;  2A5Y B;  2IAI A;  3OYJ A;  4M3D A;  1ITY A;  1UHM A;  1D0X A;  4PK4 A;  2GXG A;  1KON A;  5K7Z A;  1PUF A;  4ON0 A;  2DOA A;  3FIS A;  5J40 A;  2DA1 A;  5L3C A;  3A0H C;  3IP4 B;  3OYK A;  3OV8 A;  2AHQ A;  4RLF A;  4M6V A;  5F08 A;  3M8F A;  3S93 A;  1C0W A;  2P5L C;  2ID6 A;  1MMG A;  3EYI A;  3ZQG A;  2XPV A;  2X0L A;  1NK2 P;  3HGG A;  4EJU A;  4KUM A;  5E8G A;  1XPX A;  3HGY A;  4IHX A;  1WPK A;  1V55 H;  1T08 B;  1X58 A;  5M5Y J;  4BE2 A;  3BR3 A;  5FLV A;  4PGH A;  4ESB A;  3G3Z A;  2WAQ A;  2DQL A;  5L3F A;  1X3W B;  4F93 B;  4QPQ A;  1KYW A;  3CDL A;  2NAZ A;  4JX6 A;  3S2H J;  1ZR4 A;  1Y39 A;  1D1B A;  5CLS A;  2F4M B;  5CVV A;  4MLO A;  2JWT A;  4XLE A;  4N0B A;  3K7A J;  4BBS J;  3G1L A;  4CUG A;  2L9R A;  3S15 J;  1Z67 A;  3KLN A;  2CQ7 A;  2VOP A;  2XVC A;  2KIQ A;  2HOT A;  3QOP A;  2JRM A;  1TL8 A;  1SD6 A;  3BTL A;  2FXA A;  4RM3 A;  3VPR A;  3G2B A;  2WAF A;  3GX4 X;  1A6Q A;  1K79 A;  4XON A;  3ML6 A;  4KIG A;  5K7H A;  1XMA A;  1ZLJ A;  3O6B B;  4NQW A;  2ZXH A;  4YEL A;  3D5S C;  3S14 J;  1H9T A;  2W1O A;  1DQU A;  2R7Z J;  2H94 A;  1QA6 A;  3AG2 H;  3GFL A;  1KU2 A;  3OL4 A;  1HKT A;  5FKK A;  3L2C A;  5E17 F;  3MD2 A;  3J80 K;  2J5O A;  3PIO F;  2R5Y A;  1GXP A;  3KZI C;  2ELK A;  4FCY A;  1ZRC A;  5H2F C;  3K4J A;  3G1M A;  1F9N A;  4XKB A;  1AHD P;  1FBU A;  3U1D A;  3LAP A;  1FBS A;  1MKM A;  4B47 A;  2VBX A;  1W5C C;  2VXD A;  3TW7 A;  3FK6 A;  5FKM A;  2IP2 A;  1PP8 F;  2QKM B;  1YG2 A;  1TNT A;  4ZYH A;  1MDM A;  3GTP J;  1FBQ A;  2V1D A;  4KIB A;  3OIO A;  1O3T A;  2KP6 A;  5IYB J;  2WAQ N;  1D1C A;  4AID A;  2P6S A;  2BVL A;  4Q48 A;  2QM3 A;  4LLG F;  4UB8 C;  3HDD A;  1FEX A;  5H20 A;  1P4X A;  1IZ1 A;  4RGR A;  2IVM A;  3CDI A;  4IOC F;  4LGW A;  2FMY A;  3H3Z A;  4AWX B;  2EZL A;  3DKW A;  3FXM A;  3CO6 C;  1IXR C;  3CMM A;  2O5R A;  3KZZ A;  4CCM A;  3GTM J;  2QEX I;  3L2R A;  1VND A;  4BL0 B;  1G2H A;  5LBQ A;  1SMT A;  3TO7 A;  2E71 A;  5F0C A;  1I6X A;  2GZW A;  1XG1 A;  1XMX A;  4P5O A;  3FM3 A;  4RAF A;  2EV5 A;  3RSN A;  4BY1 J;  4PJ0 C;  1I3A A;  1W7P B;  3CO7 C;  3BDD A;  2DI3 A;  2ESN A;  1MMN A;  5M5X J;  1POG A;  1O57 A;  3I4N J;  3CMA I;  2IGN A;  3PQK A;  2HKX A;  2DMT A;  4U0Y A;  1QVT A;  4HST A;  1EKE A;  4MHG A;  4AVP A;  2WB1 A;  4BJ5 C;  2DJN A;  3OSF A;  2HVQ A;  4E7I A;  1YE9 A;  2F5D A;  4Q4Z F;  2BY1 A;  3IRQ A;  4WK8 F;  5FKN A;  1XMK A;  2VPL A;  4WCG A;  1NG6 A;  2V1U A;  1OCC H;  4CCL A;  3C2B A;  3LSI A;  2M4G A;  2X85 A;  3Q9V A;  2E36 A;  5FRM A;  3CP8 A;  3GLL A;  4FET A;  2XSD C;  2Y0S A;  4BQA A;  3VYR B;  3DEU A;  4HZF A;  3RKQ A;  1YIJ I;  2NYX A;  3MMY B;  4A3C J;  2BBY A;  3QRF F;  4NC6 A;  2KRF A;  3JR9 A;  4HDV A;  1A31 A;  4WX9 A;  5EGO B;  3BR5 A;  5HLI A;  1WJF A;  1R1V A;  3I53 A;  5DDG A;  3JRB A;  3JSP A;  1WWX A;  1MMA A;  3OYB A;  3LQR A;  4A3F J;  2STW A;  3IH4 A;  3A03 A;  1HA8 A;  1Z3X A;  1S9H A;  1DP3 A;  4N9H A;  4DZJ A;  4C3H J;  3AG3 H;  1ONV A;  5FFZ A;  1WGX A;  1B8I A;  1HKQ A;  3HRS A;  1WCM J;  3C18 A;  1VQP I;  1R1U A;  2DXI A;  5LFA A;  3BWG A;  2O7O A;  2R7O A;  4Z6Y A;  4UVB A;  2VL8 A;  4L9T A;  2K9N A;  1QNT A;  1XDS A;  2XDV A;  1YFH A;  4UUV A;  1YS6 A;  4GXO A;  1SFU A;  4YG2 F;  2HQR A;  4OAZ A;  3QWL A;  5K5Q A;  1WSU A;  2CQK A;  3H92 A;  2LBF A;  2ELJ A;  3WGG A;  3HOW J;  2GOX B;  4CZZ A;  4EJO A;  3F72 A;  1R5G A;  4TV7 A;  2ZNY A;  3B73 A;  5L3G A;  3TQN A;  1U5T C;  3HC7 A;  4PFO A;  2CW0 F;  3IKT A;  3TO6 A;  3GF2 A;  4XLF A;  1ETO A;  3ZQH A;  3ZN0 A;  2V4J C;  2WB1 N;  5C4X J;  4IO9 F;  3MFK A;  1BC8 C;  5ERI A;  3KYL A;  4XID A;  2KLO A;  1O7L A;  2X6Y A;  1SAU A;  3IWF A;  3OWT A;  1YYV A;  2CQQ A;  3BZC A;  3BG7 A;  5HLT A;  2ZJ2 A;  2Y0S N;  1QU3 A;  2A5W A;  3IC7 A;  4KNY A;  2E1M C;  4C2M J;  2EZK A;  1QBJ A;  2DT5 A;  2P5K A;  4EGZ A;  4GGG A;  2YU3 A;  3W3C A;  3FKI J;  5FFX A;  1TW3 A;  4PUS A;  1DGW Y;  3U2R A;  3C3W A;  3SZP A;  1KU9 A;  3ZQ7 A;  4XNF A;  4B4C A;  3GTL J;  2X1D A;  1P7J A;  4CCO A;  2E7W A;  3WG7 H;  3DQV C;  2OPT A;  4A3K J;  4U7D A;  2YPR A;  2OBP A;  1CF7 B;  2QBY A;  5DM7 F;  4C3J J;  1FWZ A;  1KQ8 A;  3SYT A;  4P1W A;  2XRN A;  4XOR A;  4B3A A;  3MKW B;  2JA7 J;  3MKZ A;  1UHS A;  5KAF C;  1NK3 P;  3VSK A;  3ISP A;  3WHB A;  4IHY A;  5LGN A;  4HLY A;  1GUU A;  4BQO A;  2GBY A;  3BT9 A;  3ZPL A;  3N05 A;  4C9Y A;  4CCK A;  2FBI A;  3MAJ A;  1Z7U A;  2M30 A;  5JHF A;  2HR3 A;  2EBI A;  1DUX C;  1WJA A;  3CCS I;  1JT6 A;  2LTP A;  2OCE A;  2ZXW H;  2ID3 A;  4PDK A;  3K9T A;  3S1N J;  2DYS H;  4L5E A;  3WTX C;  3K4L A;  3CZ6 A;  5H6R A;  1TT5 B;  2OQR A;  2PX9 A;  4XK4 A;  2M8G X;  2EV0 A;  1V5E A;  4PZJ A;  3E97 A;  2CFX A;  4I2O A;  2JPC A;  3RYP A;  2ZSI B;  3E5U A;  3ESW B;  1U6G A;  4BNC A;  3S3N A;  2ZB9 A;  4RGU A;  5CPR B;  1AA7 A;  5E18 F;  3FXL A;  4UVC A;  3S8P A;  4DBQ A;  3W6V A;  1P6R A;  2OAZ A;  1W0U A;  2VT3 A;  4I7H A;  4BAC A;  1WI9 A;  3KIO A;  4QPO A;  2E1O A;  3ZCO A;  3WU0 A;  1G6N A;  5ICE A;  3F23 A;  4YII A;  5HOO A;  3A2K A;  1S8N A;  2FU4 A;  1QZY A;  2R7X A;  1IRX A;  3RPU A;  2ISY A;  2LY1 A;  3K6G A;  1SAX A;  1LPQ A;  2JMW A;  1UCR A;  5J1Y A;  1GDT A;  4WWC A;  2P6T A;  1IDY A;  1Y1V J;  3DTE A;  1KU7 A;  4ANJ A;  1Z3Y A;  3SZG A;  5J1R A;  2PLY A;  5IYC J;  1SD4 A;  1IN7 A;  2LF7 A;  2UXX A;  1TP4 A;  2Z9O A;  2VQG A;  5K1Y A;  1VQ5 I;  1HOM A;  4YIR X;  5F1R A;  3EUH A;  4C2U A;  2A61 A;  2GQQ A;  3O8H A;  3QPS A;  2VBZ A;  4IRH A;  2XRL A;  3RCO A;  4I76 A;  2EWN A;  1J7K A;  3TKY A;  1H8A C;  1B72 B;  2IEK A;  2K9M A;  3BJ6 A;  1T95 A;  1O3S A;  2HTJ A;  3S1Q J;  5CVR A;  4XN3 A;  1CQT A;  3CJQ B;  1RIO H;  2DA3 A;  4X0G A;  1BJZ A;  3WTU C;  3OYE A;  2RQQ A;  2F4I A;  2OQG A;  2BGC A;  3E6M A;  1WVR A;  5EEG A;  2LP0 A;  2VI6 A;  4AIH A;  2D1H A;  1R5H A;  2F5C A;  1H89 C;  4F7Z A;  1NHA A;  3E5X A;  1FC3 A;  3QQA A;  4IZZ A;  4N9I A;  2H27 A;  1VZ0 A;  2LKP A;  4BE1 A;  1REP C;  4A0Z A;  3F6V A;  2Q1Z B;  5JLW A;  3QYB A;  3A0B C;  2L7M P;  1FIP A;  4HF1 A;  3GWZ A;  4E7Z A;  1M1E B;  3EUA A;  5DEQ A;  1MBJ A;  1J59 A;  4BHP A;  5TJJ A;  3HUG A;  1HXD A;  1KQ0 A;  2Z1D A;  4JQF A;  1ZGA A;  5K7F A;  1HW2 A;  2CJJ A;  1OCT C;  1EH7 A;  1JGS A;  1RI7 A;  3KP4 A;  2DYR H;  3BG9 A;  5F0H A;  2YU9 J;  1FTT A;  1Y1W J;  4FT8 A;  4A2U A;  1X4O A;  2H1L A;  3HZJ A;  4CCJ A;  2EZI A;  3TO9 A;  4AUX A;  5BQT A;  4ZDL A;  1ZGW A;  1PJR A;  1K83 J;  4MNU A;  4BH9 A;  1QPI A;  3GZ6 A;  4CYC A;  1B4A A;  3GUD A;  3WG9 A;  1FOX A;  4R1H A;  3G73 A;  2VBY A;  2VAS A;  3ZOB A;  4DYC A;  5HVQ C;  3E6C C;  3U9G A;  2MFZ A;  2D5V A;  3FMS A;  2AXL A;  2XGC A;  1R1T A;  3JRH A;  3QPL A;  4CDG A;  1AOY A;  2VJ4 A;  2A07 F;  1X2N A;  5HS9 A;  3HOS A;  4CXF A;  3KX2 A;  3JRA A;  4DOZ A;  1TQI A;  1PVE A;  5A2Q Z;  3SJM A;  4N4N B;  3TGN A;  1UB9 A;  5E20 A;  2GM4 A;  3QOD A;  4B1R A;  3GLX A;  1RUN A;  1SVO A;  2BW3 B;  3EDP A;  2HZT A;  2E2I J;  4UXN A;  1QZE A;  3LA7 A;  4P96 A;  5CQG A;  3FXQ A;  2E1C A;  4I09 A;  5D8K B;  2V6E A;  4BXU A;  4A3E J;  2B0L A;  2M87 A;  1J0R A;  4M71 A;  3ONQ A;  3ZQL A;  3HTS B;  2FNA A;  5EEA A;  4G9Y A;  1VQ8 I;  2QSG X;  2EA4 A;  1YOV B;  1OKR A;  2YUS A;  1Q1H A;  4A3D J;  4L0Z B;  3F8F A;  4GCV A;  1B9M A;  4YFK F;  1YW9 A;  4O3M A;  1E0E A;  3L2U A;  4L5J A;  3CF5 F;  2FF4 A;  3I54 A;  3BCB A;  1D1A A;  5EEH A;  2ZME B;  3KP6 A;  1MW7 A;  3H0D A;  3H9G A;  4G6D A;  4I98 B;  4G8X A;  2QSF X;  3ZR8 X;  3FX3 A;  3HSE A;  3F21 A;  2OCC H;  3SFI A;  3PO3 J;  2FRH A;  2ME6 A;  4AYB A;  2HZD A;  5JR3 A;  4FAS D;  3JRG A;  4XLC A;  2CQX A;  1TQM A;  3T0Y A;  3T5X A;  4DQ2 A;  4EV0 A;  1DU0 A;  1F43 A;  2XAF A;  2X1C A;  3LSP A;  4BBR J;  4KN4 X;  2DT7 B;  1BR4 A;  1Z7L A;  2PFB A;  5ED4 A;  4RB3 C;  3FBN B;  3FXO A;  3CC2 I;  2ZO4 A;  4E7H A;  5C44 J;  1IV6 A;  1MBG A;  2IW5 A;  2CUJ A;  2DOE A;  3Q5F A;  1RNL A;  1R5I D;  2KHM A;  4XRF A;  5AON A;  2ICW G;  4KT5 C;  1SEU A;  1I3Q J;  3TP0 A;  3UR3 C;  2L9N A;  1E17 A;  3H3U A;  3I3L A;  3BLY A;  3RZD J;  2IS1 A;  2F5E A;  2CUE A;  4FHT A;  3F8C A;  4U87 A;  1FSH A;  2E19 A;  2JTV A;  1YQA A;  1Z77 A;  5B5E C;  1HBX G;  1VQ6 I;  4NNJ A;  4A3G J;  4R8H A;  1FT9 A;  3BY6 A;  3CCE I;  1VQL I;  2W48 A;  4Y33 A;  3HKZ A;  5CYV A;  2EIK H;  5EJC A;  2LD5 A;  4R79 A;  2R92 J;  1BI3 A;  1G3W A;  5GTI C;  4XL9 A;  4BDY A;  2HOA A;  2R4G A;  4X6A J;  3W2V A;  3PNV A;  1W4M A;  2XV4 S;  5LLQ A;  2ZC2 A;  1IF1 A;  2V7F A;  3IAS 2;  3ERM A;  3I4P A;  4JK1 X;  5LHI A;  1HQC A;  4XLN F;  2N8G A;  3DPU A;  2CQN A;  4XSX F;  1ZAR A;  4AYB N;  2QGU A;  3BRO A;  4MGR A;  2EIM H;  1J5Y A;  4PSW A;  2Y9Z A;  2P4W A;  3OS2 A;  4AM3 A;  3F8M A;  5HS7 A;  1ZN2 A;  5GAD J;  1VQO I;  4HEA 2;  4B48 A;  2ZSH B;  1IN8 A;  3LAJ A;  2BXZ A;  4PJL A;  2GXA A;  5DV5 A;  1R9T J;  3HSR A;  3K2A A;  3L00 A;  3JRF A;  1X1P A;  3VOE A;  1UJ8 A;  4CYD A;  2CUZ A;  3P9C A;  3E3V A;  4A3L J;  3I0T A;  2YR2 A;  5ICG A;  3BJO A;  3AL0 B;  3PFI A;  4HLX A;  2GAU A;  4BKX A;  1TWG J;  2FX0 A;  4S05 A;  4XIC A;  3DKX A;  2ME0 A;  2M7A A;  2DDB A;  2R5Z B;  1W7P A;  2ACJ A;  2HXO A;  1BIA A;  1L0O C;  4XKV A;  4RB2 C;  5DUI A;  3K1N A;  3JRD A;  3E5Q A;  5CVJ A;  3RPU D;  4A69 C;  2WC2 A;  1A5J A;  1LVK A;  3JRC A;  1GVJ A;  3WTV C;  3S3M A;  1BOB A;  3KFW X;  3QYE A;  3VYT B;  3R60 A;  4BAY A;  1N78 A;  3T1B A;  1G4D A;  1A6I A;  1MIJ A;  4KT6 A;  2W57 A;  1AWC A;  3K2Z A;  2M9H A;  5EZH A;  3Q9S A;  4F92 B;  4IF4 A;  3IUO A;  1OR7 A;  4OMY A;  2R7S A;  1UG2 A;  1MNE A;  2DA2 A;  1QHH D;  4DJA A;  4BS9 A;  5IY5 H;  3WTS C;  2KRC A;  2L4M A;  3V7R A;  3V8K A;  3ECO A;  2IXS A;  2W7N A;  2H09 A;  2DFF A;  2W24 A;  1FMV A;  3RJP A;  4D5C A;  1FPQ A;  2A6H F;  3FMQ A;  3HKZ N;  2CV0 A;  3SDG A;  1AU7 A;  5ILV A;  2IS4 A;  5EGO A;  2BYV E;  2ESH A;  2KPM A;  2ZCW A;  5DD4 A;  4HW0 A;  4OAY A;  3W6K B;  4UHT A;  3WGH A;  1IXS B;  2HYJ A;  3FHN A;  4EJT A;  2NVU B;  4O5V A;  2VB6 A;  4E6K G;  3K4M A;  2JRT A;  1IW7 F;  3VWB A;  5F04 A;  4D9J A;  1N77 A;  4FE7 A;  3PUF A;  4CA0 A;  5GAG J;  3SZT A;  2M34 A;  4L9J A;  3FK7 A;  2DBB A;  2JVG A;  1DGR M;  4G7Z F;  5LEK A;  2O61 A;  1S7O A;  2ZNZ A;  4KIT B;  4BHB A;  2ZXI A;  2F6C A;  3B6A A;  1F5T A;  1U9N A;  4J00 A;  2G7U A;  4I01 A;  2ZKZ A;  3COA C;  2R7F A;  3IKV A;  3ZQC A;  2EIJ H;  1CGP A;  1X1B A;  3GTJ J;  4HBL A;  1FNN A;  2V9K A;  3WTZ A;  2LRD A;  2K27 A;  4BGD A;  1L3L A;  1OYY A;  1J09 A;  1TWC J;  3MN2 A;  1KGS A;  2L0K A;  4ENM A;  2HPM A;  1HC8 A;  2QCO A;  1OCP A;  1SFX A;  3BCA A;  2JA5 J;  3NWT A;  1WJC A;  3B02 A;  1SC7 A;  3S1M J;  2FQ3 A;  2EFP A;  1XCB A;  2E2H J;  2DA5 A;  4K2E A;  3WU1 B;  1VTN C;  2GOM A;  4PJM A;  3EUH C;  3LA2 A;  2LH9 A;  1P4A A;  1SD7 A;  2E60 A;  2JA2 A;  3LL7 A;  3CCQ I;  2AXT C;  2VPR A;  3JAM K;  3QAH A;  3MQ0 A;  4CO8 A;  1IJW C;  3DLA A;  4XN0 A;  3CUQ B;  2BHY A;  4KIC A;  4B8X A;  3GFI A;  2IA1 A;  4HNV A;  2XPW A;  1MSF C;  3RQI A;  2O9L A;  5IT9 K;  2LK2 A;  3SFZ A;  1LE8 B;  1GT0 C;  3A01 B;  2L9V A;  3J7Z I;  1XSD A;  1BW6 A;  1GHC A;  4WF2 A;  1ZK8 A;  3JTH A;  2I8D A;  5IYD J;  2IRF G;  3FMR A;  2R7V A;  4UUS B;  3F0C A;  4ZH4 F;  5D5U B;  3QPH A;  4XLH A;  3HB9 A;  4F3Q A;  1XS9 A;  1OYI A;  3CJT B;  1KZH A;  1UZC A;  3ABL H;  3OOU A;  2R7W A;  4L9V A;  3CLQ A;  4OWR B;  5FGM A;  5LD2 C;  1S72 I;  2E2J J;  2BV6 A;  1I27 A;  2M0M A;  5LGU A;  3J81 Z;  4ZYG A;  3IV5 A;  3OOP A;  2H1K A;  1IV8 A;  1I5Z A;  1LJ9 A;  2LR8 A;  3BZ6 A;  1LQ1 A;  2ZJP F;  5ILS A;  3EET A;  2ECB A;  5FJ8 J;  2OZ6 A;  2RNJ A;  2EH3 A;  5HNH A;  2DPD A;  3E6D A;  2XUB A;  2EFQ A;  2MLG A;  2ZBK A;  5F64 A;  3M07 A;  1XCV A;  2HI3 A;  4LLL A;  3L2Q A;  2DFH A;  2L3D A;  2E5Z A;  1YW8 A;  4ZC3 A;  2EQR A;  1PYV A;  5GPC A;  4Z2Y A;  2VLA A;  2DK5 A;  4ENN A;  1B9N A;  1Y56 A;  2VE8 A;  1D0Z A;  2KIU A;  5KK1 A;  5J8C A;  3JTG A;  2Y48 A;  2X6O A;  3GYH X;  4D0P A;  1NG7 A;  4A6D A;  5D4R A;  2CRG A;  3K4N A;  1YJ9 I;  3VB2 A;  2O8X A;  3M1C A;  2ZFW A;  1FX7 A;  4RMN A;  1MJA A;  1PUE E;  2HEO A;  2W4S A;  3M7G A;  1JUS A;  3O8G A;  2OF7 A;  5B1A H;  3IL2 A;  4M72 A;  4PJJ A;  2OA4 A;  2CW8 A;  3LMM A;  1ON2 A;  2H8R A;  5D5X B;  4LIU A;  2FE3 A;  4NUB A;  2ISZ A;  4MTD A;  4L9N A;  4FX0 A;  5M5W J;  5BPI A;  3CMY A;  1U8R A;  5H6Q A;  2MA3 A;  3FXR A;  3G4S I;  1VFC A;  4RAZ A;  2DAO A;  3F6O A;  5GAE J;  4G12 A;  5E1W A;  3OYD A;  3LQQ A;  1A36 A;  2KDO A;  3FHZ A;  1K61 A;  1BC7 C;  4AIJ A;  1LFU P;  3DP7 A;  5LRS A;  3HOX J;  4MFE A;  2MLK A;  2DQR A;  4A93 J;  1B72 A;  1ZRD A;  2NS7 A;  3OYL A;  1P92 A;  2MAB A;  2VKD A;  3TDU C;  2DCE A;  1P4W A;  2EJR A;  5DM6 F;  4F52 A;  3KPH A;  1MH4 A;  4F55 A;  2Q0O A;  5LRR A;  2CV2 A;  1JTY A;  1BL0 A;  2RAE A;  1HCR A;  3FF5 A;  2CGP A;  2PMZ A;  2MD0 A;  4AC0 A;  4Y3O A;  3FXK A;  3V8J A;  4JX4 A;  4A3M J;  4KJZ A;  3GCM A;  1BR1 A;  1QVU A;  3J7A O;  1FZP B;  5TIS C;  5FO5 A;  2XGX A;  4E7S A;  4B3X A;  1MBK A;  2COM A;  4XRM A;  2XAS A;  3K1M A;  3R4K A;  4UUT A;  2VJ5 A;  4RB1 A;  3CJN A;  4M3G A;  3IH3 A;  4BXF A;  4MQV A;  3CDH A;  4HRI A;  3HOT A;  1ZR2 A;  1GLN A;  3CCR I;  2D1V A;  3BTI A;  4X1E A;  5J1U A;  1IDZ A;  3BTC A;  4DZP A;  5EG0 B;  2B63 J;  2Q2E B;  2CUF A;  3BG6 A;  3T8R A;  4NC8 A;  2LRE A;  2DA4 A;  3QU6 A;  2E5N A;  4L18 B;  4WXH A;  3G71 I;  2YS9 A;  1FOK A;  3JW4 A;  2Z99 A;  5DCF A;  1W7P D;  2RQP A;  1YJN I;  2BZT A;  3MKY B;  2HDD A;  1RKT A;  1XN7 A;  1K4S A;  3TOB A;  4BJ6 C;  1RR8 C;  3OYM A;  4D1Q A;  1OLT A;  3CTA A;  1IRF A;  3BR6 A;  1V5G A;  4UNO A;  2JJ7 A;  5GTH C;  1DPU A;  1VQ9 I;  2IA2 A;  3ROU A;  2X51 A;  1A04 A;  4EAT A;  2PI0 A;  1OMI A;  2DK8 A;  1NH3 A;  5FLX Z;  2K4J A;  3C7J A;  2DFI A;  2MH2 A;  3HPH A;  2UXN A;  3RQ4 A;  2CV1 A;  2HGC A;  1MBE A;  1YX5 A;  2PMZ N;  3HIF A;  2BW3 A;  3X2Q H;  4LK1 F;  4A3B J;  1MMS A;  1BA5 A;  1HSJ A;  4MEX F;  2AQE A;  1LFB A;  3OL3 A;  4EGY A;  2OTL I;  1JGG A;  2JK3 A;  1U2W A;  3ZQQ A;  3I4M J;  2E1N A;  2QF7 A;  1G8X A;  1I1G A;  2VQL A;  2FA5 A;  3FM5 A;  4IL6 C;  1R58 A;  2CWE A;  1Z05 A;  2VKE A;  3FZV A;  1E3H A;  1DPR A;  1XD7 A;  4IHW A;  4YFN F;  1PDN C;  4ESF A;  1R00 A;  4BJT A;  4ENJ A;  2IS2 A;  2K5C A;  3IH2 A;  2ZME A;  3E0J B;  4KMF A;  4NB5 A;  1Z9C A;  4ZYD A;  3E6B A;  2HYG D;  1X3Z B;  4RLQ A;  4EMS A;  2DN0 A;  4LD5 A;  4GDF A;  2K40 A;  3M4O J;  3HXL A;  5CVU A;  2DA7 A;  5DCM B;  4HQE A;  3LA3 A;  3CME I;  1XSX A;  2QQB A;  1JUM A;  3LFK A;  5KVR A;  3HOV J;  1I6H J;  3BP8 A;  1ETY A;  4RB0 A;  2HS5 A;  4Y4R A;  2ZXJ A;  4P9F A;  1OR7 C;  1YIT I;  3KYC B;  4Y7N J;  3L9F A;  4V2G A;  1K78 B;  2GLO A;  3HTU A;  5IOY A;  2BHZ A;  2AO9 A;  5JVT A;  1HW5 A;  1X3U A;  1BR2 A;  3TW6 A;  3S3O A;  1SVL A;  4Q5S F;  3IRR A;  4OIO F;  4HAM A;  1J2X A;  1GXQ A;  3BPV A;  3KP7 A;  3OR1 C;  1UHW A;  3CCY A;  3ECH A;  2RRE A;  3PL8 A;  2BY2 A;  3I71 A;  2XB0 X;  3OSG A;  1QGP A;  5BPD A;  2DDA A;  2XSJ C;  3P7N A;  1FYK A;  4ITV A;  4UVA A;  2Y2Z A;  1RKW A;  1LDD A;  4HX8 A;  4PJN A;  3F22 A;  1NTC A;  2PQ8 A;  4QSH A;  1T38 A;  1JJ6 C;  1FY7 A;  3H5N A;  2NRA C;  3HSF A;  3WHC A;  5EDN A;  2MH9 A;  3MWM A;  1QRY A;  2IA0 A;  3P9K A;  2L54 A;  3HPG A;  4UV8 A;  5FKO A;  4JP0 A;  1HKS A;  4RM2 A;  3T8T A;  5BOX A;  2HFH A;  2O3F A;  3KET A;  2K3P A;  3HJE A;  1MJB A;  1YW7 A;  3D5L A;  1R36 A;  1ZRF A;  3I5U A;  3ZMD A;  3ZXS A;  2KZV A;  1ACI A;  2M4K A;  2PG4 A;  3MZY A;  3ZMZ A;  1K4T A;  3ASN H;  2DOF A;  4ESJ A;  1TLH B;  4RGX A;  4HPQ A;  1Y0N A;  2UWM A;  3L2W A;  5F27 A;  1MJ9 A;  2V1X A;  4OOI A;  2LNB A;  3NWS A;  4XLA A;  5E3L A;  3KCC A;  3OS1 A;  2ELH A;  5GP9 A;  4CHU A;  3TL4 X;  1O4X A;  2R0Q C;  4I0A A;  4LMY A;  2ZJQ F;  4XQF A;  4U0V A;  1DP7 P;  1ERD A;  2XGD A;  4IEJ A;  2DMU A;  3SQN A;  3CC7 I;  1BW5 A;  2V79 A;  3BQY A;  4LFU A;  2R5Z A;  1O3R A;  1MD0 A;  4RDU A;  3CCU I;  4G7H F;  1ZAO A;  2AQF A;  3Q0U A;  5J4Y A;  2IGO A;  2Y0M A;  2UZK A;  3E1S A;  1OCZ H;  4XOP A;  4IX7 A;  2NVQ J;  4JBA A;  9ANT A;  3K70 D;  5C4J J;  2BY3 A;  1G3S A;  4GO1 A;  4NHJ A;  1TWA J;  3RKX A;  5C3E J;  2CO5 A;  2XAG A;  1AKH B;  4XBF A;  3W2A A;  5GPA A;  3VSL A;  3DBH B;  3LOC A;  3PUB A;  5L3B A;  1X1A A;  4MO7 A;  4M6X A;  1ON1 A;  4IRG A;  3FBI B;  4H0E A;  1ENH A;  4Y17 A;  3NEU A;  2JQ7 A;  2QZ8 A;  1TWF J;  4E7K A;  2ADU A;  2V1N A;  1TWH J;  1UAA A;  5HDK A;  2O6G E;  2XAJ A;  3LFU A;  2XC7 A;  2DOD A;  3A1Y A;  2NVX J;  2ZFU A;  1FTZ A;  1WI3 A;  3NAU A;  3FDY A;  3JCU C;  2VJJ A;  3M1E A;  1W5S A;  2BE5 F;  3I58 A;  1ETX A;  5BNG A;  1MBH A;  1SFO J;  1ODD A;  1BN5 A;  3I59 B;  1U78 A;  3O3K A;  3RI4 A;  3V7S A;  2HPI A;  5LEJ A;  2M3A A;  3K69 A;  3RKW A;  2DU9 A;  4EJW A;  2EPF A;  1MZB A;  3BPX A;  4GFB A;  1JTX A;  3ABU A;  3HYI A;  2XF5 A;  1Y8R B;  5BMZ A;  2VUM J;  5HNF A;  2VKH A;  1UG0 A;  2RDP A;  1BI0 A;  5L3D A;  2EFO A;  3G1O A;  4Y52 J;  3K70 C;  1QQI A;  3SEZ A;  3WTY C;  4V19 K;  1K7A A;  4Q47 A;  3DTI A;  4CH7 A;  1EJ9 A;  1ETQ A;  1XDU A;  2ETH A;  1ZG3 A;  1JT0 A;  4AD9 A;  3O2P E;  3ZMV A;  5D4S A;  3S1R J;  2HU9 A;  5EZG A;  1KA8 A;  2OC6 A;  3I64 A;  3DCF A;  4IJA A;  3H9J A;  5HOD A;  1IGN A;  4U88 A;  3M8J A;  4C3I J;  3J80 Z;  1ZGJ A;  3I56 I;  3L09 A;  3C1D A;  5IPA A;  1RC9 A;  1UMQ A;  1XX5 A;  1T33 A;  4LB5 A;  2IGK A;  1I1S A;  4H4K C;  2K9S A;  2Q8K A;  3PM1 A;  3CUQ A;  2LDU A;  2D2W A;  2X6X A;  2FJ1 A;  3DWL E;  1LE8 A;  4GYI A;  3VEP A;  3A01 A;  2P7V B;  2G0E A;  5JI6 A;  2AS5 F;  5K5O A;  2VON A;  4BXX J;  2KIM A;  2WV1 A;  5J4V A;  2LC2 A;  5E79 C;  5FB2 A;  2MYS A;  2L7Z A;  4D7N A;  2WV0 A;  1GVD A;  4EM1 A;  1O7F A;  2VC0 A;  4UUS A;  2MC4 A;  1IUY A;  4HG2 A;  3KEQ A;  3ASO H;  3RKY A;  4ZTF A;  1R4N B;  1S3J A;  1SVM A;  2FNP A;  4D5F A;  1VF9 A;  2W25 A;  4CZC A;  2BY0 A;  3AAF A;  2R93 J;  4EM0 B;  4EM2 A;  2WY7 Q;  2A3S A;  1WHU A;  2DMN A;  3REO A;  1IN5 A;  3BJA A;  3V42 A;  1JXS A;  4KYW A;  2CSO A;  2LF8 A;  2V9P A;  2VXZ A;  1SFK A;  2KIS A;  4D7M A;  4EQQ A;  3HOY J;  4A6E A;  3G6E I;  5IOZ A;  1HST A;  2C6Y A;  4AIK A;  1ETW A;  1LB2 A;  2P81 A;  2VQC A;  2VT2 A;  4PFP A;  3MCZ A;  2HTS A;  2Y75 A;  5E3N A;  1PP7 U;  4BEH B;  3V8L A;  3VFZ A;  3DU5 A;  5ICC A;  3D5R C;  4QTR A;  2CH0 A;  3ABM H;  2KJC A;  2NS8 A;  1WZ2 A;  2HXI A;  2Z2S B;  4LG0 B;  1E3O C;  3LSK A;  5AIP A;  1JKP C;  3CCJ I;  3H3V K;  2CMP A;  2R3S A;  4RAG A;  4ENK A;  4M9Z A;  3H36 A;  1KQ9 A;  4LOC A;  4UB6 C;  5HLH A;  2NNN A;  2M0C A;  2DTZ A;  4II3 A;  2G7H A;  2OTJ I;  1OPC A;  3FWE A;  2KJB A;  3L7W A;  3UNG C;  4DYQ A;  4Y13 A;  1LKX A;  1D0Y A;  3RYR A;  1T39 A;  5A2Q K;  5KAI C;  2K3F A;  4CIC A;  3CQZ J;  4MIM A;  4XRS G;  4E70 A;  2JN6 A;  2QVO A;  4A0X A;  2PJP A;  1U8B A;  2NNY A;  4PSX A;  2MG4 A;  5B66 C;  3K1P A;  1Z21 A;  3ULQ B;  1RES A;  2NOJ B;  1J9I A;  4OIQ F;  3CJR B;  3TP3 A;  1E2X A;  2L2O A;  3FIW A;  2HDC A;  4BY7 J;  4ZYE A;  1U5T B;  1YI2 I;  1GV2 A;  4S0H B;  2VOD A;  4DNC A;  3DLL F;  5TGT A;  2XGE A;  4II2 A;  1Z1D A;  4OU0 A;  3M9A A;  4YIF A;  2PJR B;  1ZRE A;  1UFM A;  3K10 A;  3OR2 C;  1WH5 A;  3DXJ F;  4YEJ A;  3WTT C;  1MNM C;  4PGG A;  3LSJ A;  5DTD A;  3L1P A;  2ZME C;  3QU3 A;  4E4H A;  3CP2 A;  1VQK I;  1S29 A;  1YLF A;  2VQH A;  3ZN1 A;  5E3M A;  2FEZ A;  1F4K A;  1FSE A;  1OCR H;  4PCQ A;  4NC7 A;  1ZH5 A;  2E1M B;  2Y31 A;  3SEQ A;  1U3E M;  2VBW A;  5KNL A;  3VOD A;  2FBK A;  4JOM A;  3KEY A;  1MGT A;  2X6W A;  3OYH A;  3C2G A;  3ZMU A;  2K85 A;  5FKL A;  2L01 A;  3QP6 A;  5K5R A;  2M2E A;  2K86 A;  1S7E A;  2LSO A;  1DU6 A;  2NOG A;  1YRN B;  1ZLK A;  2VKV A;  2JT1 A;  1RR7 A;  5EYR A;  2P8T A;  2UV1 A;  2LY9 A;  4W1U A;  3W2W A;  3AG4 H;  2D45 A;  1JE8 A;  4HX4 A;  1QHG A;  4IHS A;  4F91 B;  5EG0 A;  2Q2E A;  3GTG J;  3R6S A;  3I55 I;  3P5J A;  5J8F A;  3M3Y J;  1HLV A;  4ZJZ A;  2W82 A;  1W1W E;  2A69 F;  2WAE A;  3OYC A;  4V2F A;  2A6E F;  1FYM A;  5IP9 J;  4I99 C;  4KIS A;  3F9K A;  2J5P A;  4E7L A;  3ZMS A;  1LDK B;  3BTJ A;  3R61 A;  4IQJ A;  1JUP A;  1Y8Q B;  2LVS A;  1CF7 A;  2L7F P;  4FTH A;  3BC8 A;  1KYZ A;  2QYO A;  5B3S H;  5EF6 A;  4CCN A;  1V5F A;  2P0W A;  3GXO A;  5HDN A;  3Q0W A;  2HNH A;  3PNT A;  2X1E A;  1FOY A;  3BQZ A;  3IWZ A;  4DYR A;  3LSH A;  3NRV A;  2DLL A;  3H0G J;  4IVN A;  4LB6 B;  1S5L C;  2OJE D;  1DDN A;  2VC1 A;  2FQ4 A;  3M8E A;  1YJW I;  4ZTJ A;  2WY8 Q;  4ASN A;  2DT6 A;  2OV7 A;  3CES A;  3EUK L;  3KYD B;  3RDI A;  1H0M A;  5FD5 A;  4IOA F;  2KL4 A;  1J75 A;  3EPZ A;  2KDZ A;  3C2H A;  3CUO A;  3BG5 A;  1OCO H;  3ABT A;  1IN4 A;  4A3I J;  2F48 A;  3GME A;  4A5N A;  1ZTR A;  1IN6 A;  1JHF A;  2B9S A;  3CD6 I;  2XAU A;  1YHQ I;  4IPA A;  3DKY A;  2JUG A;  4RS8 A;  2JSP A;  4M6Y A;  1RUO A;  4HX7 A;  3PO2 J;  3GFM A;  2E34 A;  2Z5U A;  4ZZD A;  4EJV A;  2GXB A;  1EF4 A;  6PAX A;  2EZH A;  4FE4 A;  4GYG A;  4FQG A;  3CCV I;  5E1X A;  4CGZ A;  1XGS A;  2IS6 A;  1ZYR F;  3SXY A;  3TBI A;  2R7Q A;  3WGI A;  4B44 A;  2CYY A;  2LMD A;  5ILU A;  3F8B A;  3AL0 C;  3GTQ J;  1TT0 A;  4G6Q A;  3HEF A;  2KRH A;  3W6J B;  3DF8 A;  1F1Z A;  5DCM A;  1H88 C;  2STT A;  4KA4 A;  3V4G A;  1PUF B;  2GIV A;  3HHH A;  2A68 F;  2W85 A;  3PQJ A;  3U21 A;  3RPQ A;  4G94 A;  4CSW A;  4DIQ A;  5BS6 A;  4JX5 A;  3J7Y J;  2DW4 A;  2FML A;  1R6R A;  2QSH X;  2RN7 A;  1SMY F;  3R0A A;  2F4O B;  2BXY A;  2DFE A;  2RGV A;  3OIP A;  2TRT A;  4UV9 A;  3MZ8 A;  1LEB A;  2KZG A;  2HQ5 A;  3N4M A;  1OIS A;  2MGQ A;  2QQ9 A;  1K78 A;  1T56 A;  2GA1 A;  2HKO A;  2LKX A;  3HL2 A;  2FOW A;  2QA4 I;  3HRT A;  2XPU A;  1LNW A;  4BUP A;  4M9S A;  4L5I A;  2HQA A;  1X4P A;  4HQM A;  4B09 A;  2IPQ X;  1XGN A;  1LVA A;  1T2K A;  1VQM I;  2FOK A;  2X48 A;  4GRI A;  4XOT A;  2V26 A;  3EYY A;  4NDL A;  4LLN A;  1VQN I;  5CJ9 A;  3WE2 A;  4ZYA A;  2MW8 A;  1XC5 A;  3ABK H;  4XRS A;  2EIL H;  2XHK A;  3HG9 A;  4FX4 A;  3A4C A;  3GZN B;  1MND A;  2V9V A;  2QKL B;  2VJI A;  3BR2 A;  1ETK A;  1UST A;  3D0S A;  4BDZ A;  2F5V A;  2XIG A;  3MZH A;  3TMO A;  2IT0 A;  3K0L A;  2KQR A;  1T0F A;  2FBH A;  5JFR A;  1JKQ C;  3DFG A;  2WBM A;  2EA2 A;  4OMZ A;  5D6E A;  4BE0 A;  3H9Q A;  1X1C A;  4NQW B;  1OYW A;  3H5A A;  2HYF A;  1XGM A;  1XB4 A;  2XAH A;  2I10 A;  2BEO A;  3S16 J;  3F8N A;  1LUJ B;  4HNT A;  5J6X A;  3EQL F;  2WTE A;  4FIS A;  3U1K A;  2L7K A;  3ZQI A;  4P55 A;  1WJE A;  2R5Y B;  3DV8 A;  3J7A Y;  1JHH A;  4ZDO A;  3A02 A;  5J3L A;  3GTK J;  3F3X A;  3RIR A;  2F5F A;  4DW6 A;  4J01 A;  1K6O A;  4G7O F;  5JHU A;  3B6C A;  1ETV A;  2NVY J;  2NXN B; 
#chains in the Genus database with same CATH homology
 1FEX A;  3MKL A;  1R9T J;  3K2A A;  2XGD A;  3JRF A;  4IEJ A;  2DMU A;  1BW5 A;  2EZL A;  3BQY A;  2R5Z A;  1MBF A;  4RDU A;  4A3L J;  3GTM J;  2COB A;  1VND A;  3Q0U A;  1G2H A;  4BKX A;  4XIC A;  1TWG J;  2FX0 A;  1AKH A;  5F0C A;  2ME0 A;  2R5Z B;  2NVQ J;  9ANT A;  1XG1 A;  2HXO A;  5C4J J;  1TWA J;  1JJ8 C;  4ABZ A;  5C3E J;  3JRD A;  2NVT J;  3HBL A;  1AKH B;  4BY1 J;  4A69 C;  1A5J A;  3JRC A;  5M5X J;  1POG A;  3I4N J;  5GPA A;  4IHV A;  2DMT A;  1QVT A;  1A6I A;  3OSF A;  2DJN A;  3LOC A;  4MO7 A;  2M9H A;  4W97 A;  5EZH A;  2DMP A;  5FKN A;  1UG2 A;  1ENH A;  2DA2 A;  1IG7 A;  1MSE C;  3C2B A;  1TWF J;  4D5C A;  2IBD A;  2XSD C;  1TWH J;  3HKZ N;  3SDG A;  1AU7 A;  5EGO A;  3RKQ A;  3ZQF A;  2HYJ A;  2NVX J;  4A3C J;  4M3B A;  1FTZ A;  3JR9 A;  2Y30 A;  1WI3 A;  3NAU A;  5EGO B;  5F04 A;  5DS9 A;  3BR5 A;  1ZQ3 P;  4FE7 A;  5E3O A;  2M34 A;  3LSG A;  3FK7 A;  1ETX A;  5BNG A;  1MBH A;  3JRB A;  4A3F J;  1Z0X A;  1SFO J;  3IH4 A;  3A03 A;  3HDD A;  2KT0 A;  4DZJ A;  4C3H J;  1U78 A;  1B8I A;  1WGX A;  3B6A A;  1U9N A;  1WCM J;  2ECC A;  4GFB A;  2VUM J;  1JTX A;  1B8I B;  2O7O A;  3ZQC A;  3G1O A;  3GTJ J;  4Y52 J;  2K9N A;  2DMQ A;  1ETQ A;  5M3M J;  1JKR C;  1JT0 A;  1TWC J;  3S1R J;  3MN2 A;  2O8K A;  2L0K A;  5EZG A;  3HOW J;  3DCF A;  2QCO A;  5HOD A;  3HOZ J;  1IGN A;  1OCP A;  3JRI A;  4C3I J;  2JA5 J;  3GTO J;  3S17 J;  2K9Q A;  1HDP A;  1ETO A;  3ZQH A;  5IPA A;  1UMQ A;  2WB1 N;  5C4X J;  1HF0 A;  1T33 A;  3S1M J;  1IUF A;  2E2H J;  2K9S A;  2DA5 A;  3PM1 A;  4XID A;  2CQQ A;  2VPR A;  2FJ1 A;  1IJW C;  2Y0S N;  5IP7 J;  2XB5 A;  1LE8 A;  2JA6 J;  4C2M J;  2EZK A;  3A01 A;  2G0E A;  4HNV A;  2XPW A;  1MSF C;  3RQI A;  2O9L A;  4BXX J;  2LK2 A;  2WV1 A;  2CU7 A;  1LE8 B;  3FKI J;  1GT0 C;  2L7Z A;  4D7N A;  3A01 B;  1GVD A;  2MSY A;  1ZKG A;  4UUS A;  2LLK A;  1OFC X;  1BW6 A;  1ZK8 A;  4B4C A;  3GTL J;  5IYD J;  1P7J A;  4D5F A;  4UUS B;  1VF9 A;  3F0C A;  3NAR A;  2OPT A;  2R93 J;  4A3K J;  3HB9 A;  3LNQ A;  1XS9 A;  2DMN A;  4I6Z A;  3OOU A;  4C3J J;  4B3A A;  2JA8 J;  2DA6 A;  4D7M A;  2E2J J;  3HOY J;  5IP6 A;  2JA7 J;  1OJL A;  1UHS A;  5IOZ A;  1ORK A;  3IV5 A;  1NK3 P;  2H1K A;  4MFD A;  3Q3S A;  1ETW A;  2LR8 A;  3WHB A;  4IHY A;  1GUU A;  2P81 A;  2GBY A;  1VI0 A;  3BT9 A;  3D1N I;  2ECB A;  5E3N A;  5FJ8 J;  2EH3 A;  4QTR A;  2EBI A;  3GBG A;  1JT6 A;  2LTP A;  2HI3 A;  2ID3 A;  2NS8 A;  3S1N J;  4L5E A;  1IC8 A;  2HXI A;  2EQR A;  1E3O C;  5GPC A;  4QIW N;  1IRZ A;  3DEW A;  4XK4 A;  1JKP C;  1TC3 C;  2M8G X;  3UKG A;  2X6O A;  4M3F A;  3H3V K;  2X9D A;  1APL C;  2CRG A;  2ZB9 A;  4LOC A;  3W6V A;  2FD5 A;  1W0U A;  1JUS A;  3O8G A;  3Q0V A;  3RZO J;  2M0C A;  2DTZ A;  2E1O A;  2OF7 A;  4DYQ A;  2H8R A;  3CQZ J;  4MIM A;  4XRS G;  1HDD C;  2Y9Y A;  2JN6 A;  5M5W J;  3HM5 A;  2JMW A;  3CMY A;  5J1Y A;  1GDT A;  1U8B A;  1VFC A;  2MG4 A;  1IDY A;  1Y1V J;  1RES A;  4G12 A;  3TP3 A;  3FIW A;  5J1R A;  3TED A;  4BY7 J;  5IYC J;  1JKO C;  3BR0 A;  1K61 A;  3MVP A;  1GV2 A;  4S0H B;  1LFU P;  1HOM A;  1MH3 A;  3HOX J;  4MFE A;  4A93 J;  1B72 A;  2XGE A;  3O8H A;  2NS7 A;  3QPS A;  1WH5 A;  2XRL A;  4I76 A;  1H8A C;  1MNM C;  1MH4 A;  1B72 B;  1GV5 A;  1SAN A;  2IEK A;  3LSJ A;  5DTD A;  3L1P A;  4RBO A;  3S1Q J;  1JTY A;  1BL0 A;  1CQT A;  2RAE A;  2DA3 A;  5E3M A;  1BJZ A;  2TCT A;  1HCR A;  1RET A;  2Y31 A;  5JLX A;  4AC0 A;  4A3J J;  1F36 A;  4JX4 A;  1YRN A;  2LP0 A;  4A3M J;  2VI6 A;  5F0F A;  1QVU A;  5FKL A;  2M2E A;  1H89 C;  1S7E A;  1DU6 A;  2HOS A;  2NOG A;  1YRN B;  2VKV A;  1MBK A;  1RR7 A;  5EYR A;  4XRM A;  3QQA A;  4UUT A;  4M3G A;  3IH3 A;  2LY9 A;  4W1U A;  5EG0 A;  3GTG J;  1ZR2 A;  3M3Y J;  5JLW A;  3BTI A;  4X1E A;  5J1U A;  1HLV A;  1IDZ A;  2LFB A;  3LSR A;  3BTC A;  4DZP A;  1W0T A;  5EG0 B;  2B63 J;  2L7M P;  2CUF A;  1FIP A;  4V2F A;  3S2D J;  1WH7 A;  4EEF G;  5IP9 J;  1MBJ A;  1RPW A;  2DA4 A;  3BTJ A;  1JUP A;  1X2M A;  2LVS A;  5K7F A;  1OCT C;  2CJJ A;  2L7F P;  1FTT A;  3BG9 A;  2YS9 A;  5F0H A;  4FTH A;  1D5Y A;  2YU9 J;  1Y1W J;  3BG3 A;  5EF6 A;  2HDD A;  1RKT A;  3E7L A;  5M3F J;  2EZI A;  4AUX A;  1ZGW A;  3Q0W A;  4M3E A;  1K83 J;  1QPI A;  3BR6 A;  4CYC A;  3BQZ A;  4DYR A;  1P7I A;  2JJ7 A;  3H0G J;  3ZOB A;  4DYC A;  5FLM J;  4CYC B;  2FQ4 A;  2D5V A;  2XGC A;  3JRH A;  1I50 J;  3QPL A;  2KDZ A;  3BG5 A;  1X2N A;  5F1J A;  1FIA A;  4A3I J;  1MBE A;  1FJL A;  2PMZ N;  3JRA A;  1ZTR A;  4JYK A;  3SJM A;  4A3B J;  1BA5 A;  1LFB A;  2GM4 A;  1JGG A;  3PO2 J;  2JK3 A;  4B1R A;  3I4M J;  3BR1 A;  2E2I J;  1EF4 A;  2EZH A;  2QF7 A;  4FE4 A;  4J19 A;  4A3E J;  1Q1V A;  3JRE A;  1U9O A;  3ZQL A;  5EEA A;  2VKE A;  3HOU J;  2IAI A;  3GTQ J;  1ITY A;  4M3D A;  2YUS A;  3HEF A;  4IHW A;  4A3D J;  5K7Z A;  1PUF A;  3IH2 A;  3FIS A;  2DA1 A;  1H88 C;  2AHQ A;  4M6V A;  2DN0 A;  5F08 A;  1PUF B;  3M4O J;  2K40 A;  2ID6 A;  4JX5 A;  3ZQG A;  2XPV A;  2DA7 A;  1NK2 P;  3HGG A;  1JUM A;  2TRT A;  3HGY A;  3SFI A;  4IHX A;  3HOV J;  3PO3 J;  1WPK A;  2HQ5 A;  2ME6 A;  1ETY A;  1X58 A;  5M5Y J;  1I6H J;  3JRG A;  3BR3 A;  2MGQ A;  5FLV A;  1T56 A;  2CQX A;  2LKX A;  4Y7N J;  1DU0 A;  3CDL A;  4JX6 A;  3S2H J;  1F43 A;  4V2G A;  1ZR4 A;  3LSP A;  2XPU A;  4BBR J;  2GLO A;  5IOY A;  2AO9 A;  4MLO A;  3TW6 A;  2JWT A;  2X48 A;  5C44 J;  3K7A J;  1IV6 A;  1MBG A;  4BBS J;  3G1L A;  2L9R A;  3CCY A;  3S15 J;  4NDL A;  2XB0 X;  3OSG A;  2MW8 A;  1XC5 A;  4XRS A;  2HOT A;  1I3Q J;  3TP0 A;  2Y2Z A;  1RKW A;  3BTL A;  1NTC A;  4QSH A;  3VPR A;  1JJ6 C;  3BR2 A;  1ETK A;  3RZD J;  2CUE A;  2E19 A;  3WHC A;  5K7H A;  5EDN A;  1Z77 A;  1QRY A;  3S14 J;  1JKQ C;  4A3G J;  2R7Z J;  5FKO A;  2W48 A;  4JP0 A;  5FKK A;  2I10 A;  2LD5 A;  3S16 J;  2R5Y A;  2R92 J;  2ELK A;  4FCY A;  2HOA A;  4X6A J;  3G1M A;  1AHD P;  4FIS A;  3ZQI A;  2R5Y B;  3TW7 A;  3FK6 A;  5FKM A;  2N8G A;  3A02 A;  5J3L A;  3GTK J;  5F27 A;  3GTP J;  4AYB N;  3OIO A;  4DW6 A;  5IYB J;  5E3L A;  3B6C A;  1ETV A;  2WAQ N;  5GP9 A;  2NVY J;  2Y9Z A;  1O4X A;  2R0Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...