1JKRC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
b'GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*CP*AP*AP*GP*A)-3'
publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkrC00
4A3MJ 3OIOA 1Y1VJ 2NVYJ 5IP9J 4HNVA 4DYCA 1BJZA 1HLVA 1OCPA 3TW6A 1TWFJ 3GTLJ 1A6IA 3OOUA 2R5ZB 2LKXA 1LFBA 4D5CA 5K7ZA 4A3BJ 4IHWA 2JA7J 2B63J 4I76A 2Y9ZA 4Y52J 2CU7A 2E2JJ 1GUUA 3C2BA 4C3JJ 2XSDC 3JREA 1GVDA 1DU6A 5HODA 5E3OA 4IHVA 1XS9A 3TW7A 4JP0A 4A3DJ 5C44J 2CQQA 3S1QJ 5IYCJ 1OJLA 2XB0X 1XG1A 4X1EA 2KDZA 1DU0A 3Q3SA 4I6ZA 3M3YJ 4XICA 3BQYA 1LE8A 1R9TJ 2Y30A 5M3MJ 4W97A 5FKNA 5EF6A 5IOZA 1WH7A 3NAUA 2Y9YA 2R5YA 2IBDA 2M2EA 2E2IJ 1F36A 3CQZJ 3JRBA 2NS8A 3BTJA 3HOXJ 2XB5A 4C3HJ 1ZR4A 1T56A 1TC3C 2FX0A 2LTPA 1IV6A 2DMNA 1XC5A 3BTCA 1RKTA 1ZTRA 2ECCA 3GTKJ 3RKQA 1MH4A 1ORKA 2JA8J 2WB1N 2CUEA 2WAQN 3HOZJ 5C4JJ 3FIWA 2DA7A 4A3IJ 4M3EA 3BQZA 3BG5A 4MO7A 1POGA 1GV5A 1OFCX 4IEJA 3ZQFA 2XGCA 3JRHA 2QF7A 2X9DA 2ME6A 3A01B 1H89C 2LLKA 5E3NA 4MFDA 4C3IJ 1RR7A 5K7HA 1VI0A 1ZQ3P 1LE8B 4M3GA 3DCFA 3MKLA 2JK3A 3M4OJ 1H8AC 2R7ZJ 1X58A 2R5YB 2XGDA 4S0HB 2R5ZA 4J19A 2NVXJ 4BBSJ 3I4MJ 4D5FA 2ZB9A 1E3OC 3HBLA 4BXXJ 2DMTA 3FK6A 4M3FA 5F0FA 2R93J 4RDUA 2CJJA 2XRLA 2VPRA 3F0CA 3FK7A 4JX5A 4EEFG 1HCRA 2DA6A 5EGOA 2K9SA 5M3FJ 3JRGA 1O4XA 1NK3P 4B4CA 3HM5A 1VF9A 3L1PA 3HB9A 1MBJA 4M3DA 5M5YJ 1JKQC 3FKIJ 2LK2A 3MN2A 2R0QC 1U8BA 5F1JA 2FD5A 4M6VA 5C3EJ 1IRZA 5IP6A 1TWCJ 5FKKA 2N8GA 1UG2A 2R92J 1IG7A 2O8KA 3HDDA 5IOYA 5FLVA 4XK4A 2DMPA 4CYCB 2AHQA 4L5EA 2DA1A 1IC8A 1APLC 3HOVJ 2ECBA 5EDNA 3LSJA 5FJ8J 2CRGA 4D7MA 2P81A 4M3BA 3GTOJ 3RZDJ 4A3CJ 4A93J 1HDPA 2XPWA 3K2AA 3LOCA 2OF7A 1G2HA 3H0GJ 3BR0A 2DA4A 1X2MA 1VNDA 3BR6A 5IPAA 5EGOB 2EQRA 1HF0A 2XPVA 5FKOA 2GBYA 2X6OA 3GTGJ 1ETYA 2HOAA 1FJLA 1U9OA 2GLOA 3A01A 2DN0A 3IH3A 5J1UA 1GV2A 3SDGA 4DZJA 5GPCA 3GTQJ 1RESA 2L7FP 3IH2A 4A3EJ 1Q1VA 3GTMJ 1FIPA 2EZIA 3G1LA 4DZPA 1B8IA 1WPKA 1MBFA 1F43A 5GPAA 2IAIA 2VKEA 4Y7NJ 3S16J 1SANA 4C2MJ 4JX6A 4JYKA 2K9NA 1Z0XA 2M8GX 1JKRC 2XGEA 2E1OA 2HI3A 1MSEC 2O7OA 4B3AA 2HDDA 3CMYA 5DTDA 1P7IA 5EYRA 2MSYA 2X48A 1YRNA 1TWHJ 3JRCA 4JX4A 3QPLA 2VI6A 1UMQA 2YU9J 4QIWN 1FEXA 3HEFA 3HOUJ 3JR9A 2CUFA 4DYRA 1BW6A 1PUFB 1OCTC 1Y1WJ 5JLWA 1ETOA 1A5JA 3S17J 9ANTA 4V2FA 3CCYA 1MBHA 1ZK8A 3O8HA 1K83J 4MIMA 1FIAA 2HXIA 2LR8A 1Z77A 4BY1J 1B8IB 3LSGA 1ENHA 3WHCA 4FCYA 3PM1A 2DMQA 1WI3A 1S7EA 4XRMA 4DYQA 1UHSA 4CYCA 1ZR2A 5J1YA 3G1MA 2NOGA 3RQIA 5M5XJ 1ITYA 4BBRJ 5K7FA 2EZHA 4RBOA 2O9LA 4GFBA 3ZQGA 2D5VA 4A3LJ 5F04A 5F27A 3Q0WA 1NK2P 1BW5A 1YRNB 5IYBJ 3HOWJ 2YUSA 3MVPA 2LVSA 3HGGA 1JKOC 4BKXA 1HDDC 3HOYJ 4BY7J 1MSFC 1MH3A 5EG0A 3JRAA 4AC0A 4A3FJ 2L0KA 2OPTA 1RKWA 4XRSA 2ME0A 5EZGA 1MNMC 1U78A 1IJWC 3W6VA 3BR3A 2Y0SN 3B6AA 4FTHA 2HXOA 2TCTA 3S1RJ 3BG3A 2EH3A 4UUTA 1FTZA 3OSFA 1MBEA 1U9NA 1JT0A 2JN6A 4DW6A 1AHDP 4XIDA 5FKMA 1W0UA 5DS9A 2JJ7A 5J3LA 1LFUP 1JKPC 3OSGA 1GDTA 3SJMA 1EF4A 2CQXA 1RPWA 1TWAJ 1HOMA 5E3MA 4MFEA 2K40A 2M34A 1ETXA 4MLOA 4D7NA 3DEWA 2KT0A 1JUPA 3S15J 3BR5A 2MGQA 3B6CA 4FE7A 3BR1A 1P7JA 4A3KJ 1B72A 1BA5A 1JUSA 2L7ZA 5J1RA 4FE4A 1PUFA 1FTTA 5EG0B 2LP0A 2LFBA 3Q0UA 3E7LA 5BNGA 2JA6J 4QTRA 1SFOJ 1ETVA 5F0HA 2HQ5A 2M9HA 1JTXA 4A3JJ 1IDZA 2L7MP 3NARA 1D5YA 2NVTJ 3A02A 2NS7A 4B1RA 4IHXA 2DJNA 5E3LA 5C4XJ 2HOTA 2EZLA 4ABZA 3G1OA 3HGYA 4LOCA 2PMZN 4AUXA 1GT0C 1X2NA 3IV5A 2ID3A 5IYDJ 2K9QA 3ZQCA 4AYBN 2ELKA 1K61A 3CDLA 2YS9A 3WHBA 1JTYA 1H88C 2G0EA 4XRSG 3LSPA 1QVUA 1QPIA 2EBIA 1JT6A 2E2HJ 1TWGJ 3PO2J 1B72B 5JLXA 2DMUA 3S2DJ 5IP7J 2JMWA 1CQTA 3QQAA 1JGGA 3JRFA 1ETWA 4FISA 2LY9A 1AKHA 5M5WJ 3VPRA 3HKZN 2M0CA 5EEAA 2ID6A 2VKVA 1JJ8C 2QCOA 1BL0A 4QSHA 2W48A 1T33A 3JRIA 1WGXA 2TRTA 1I50J 3BR2A 3K7AJ 3H3VK 1ETKA 2FQ4A 3I4NJ 3S1NJ 1RETA 2WV1A 2JWTA 4A69C 3UKGA 2MW8A 2AO9A 2RAEA 3BTLA 2XPUA 4UUSA 2H1KA 2E19A 1ZKGA 1JUMA 3JRDA 3Q0VA 3GBGA 5F0CA 2EZKA 4NDLA 2Y2ZA 2Y31A 1JJ6C 2COBA 2H8RA 2FJ1A 5FKLA 3BG9A 4V2GA 4X6AJ 3TEDA 3TP3A 2VUMJ 3RZOJ 1IUFA 3A03A 2IEKA 2GM4A 3PO3J 2LD5A 1QRYA 1WH5A 2NVQJ 1ETQA 4IHYA 1I6HJ 1QVTA 2HOSA 3D1NI 1VFCA 1AKHB 1ZGWA 3BT9A 3GTPJ 4W1UA 1I3QJ 1W0TA 1AU7A 3QPSA 3GTJJ 1WCMJ 3ZQLA 5FLMJ 3S2HJ 3TP0A 3IH4A 2L9RA 1MBGA 2DA2A 2I10A 3FISA 2DTZA 4G12A 1MBKA 3O8GA 5GP9A 2HYJA 1NTCA 2JA5J 2DA5A 4UUSB 5F08A 3ZQIA 3S1MJ 4A3GJ 3LSRA 1IGNA 3S14J 3ZQHA 3BTIA 5EZHA 3SFIA 1IDYA 2MG4A 3ZOBA 2DA3A 3LNQA
chains in the Genus database with same CATH superfamily
5KK1A 2GXAA 3DF8A 4HNVA 2HS5A 2VPLA 3OYLA 1HLVA 2R4GA 2X85A 3TW6A 1A6IA 3ZGKA 4RM2A 2R5ZB 1HC8A 4CHUA 2OD5A 4D5CA 5K7ZA 2F6CA 3W3CA 2O03A 3CDIA 3OYIA 3D5LA 3RPUD 4EJTA 4Y52J 2E2JJ 2Y0MA 2VC0A 4NNJA 1R23A 2XSDC 3OYCA 3RSNA 1O3TA 2VQHA 3E3VA 1YHQI 3TW7A 4G8XA 2Z99A 2CQQA 2IGNA 1B9NA 5IYCJ 4G6QA 1STZA 2O0YA 2XB0X 1LDDA 2K02A 2A3SA 1DGRM 1U5TC 4X1EA 2F5VA 1YS7A 3VSKA 3HPGA 3Q3SA 5FROA 4BJTA 4UY8I 3M3YJ 2DDAA 1O3QA 3BPXA 1P9QC 2Y30A 4HW0A 4W97A 2PFBA 4CGZA 5L3EA 1W5CC 3I71A 5D4RA 2G7UA 2HWVA 3NAUA 2HYFA 2PEXA 2XHKA 1ZGJA 2BY3A 1FOYA 2M8EA 3PIPF 1UHMA 1QHGA 1R5HA 3QPTA 4LLLA 3K4BA 2QQ9A 3I59A 1NH3A 5E79C 3M1EA 1WRJA 5HNFA 5JFRA 1TC3C 1XMKA 2FX0A 4CDGA 1IV6A 2M5WA 3GFJA 3BTCA 3ML6A 1RKTA 5E8GA 2ECCA 2ZMEC 2WY8Q 4ON0A 3RKQA 2JA8J 2WAQN 2LC2A 3ZN0A 1SVLA 3OY9A 4KA4A 4K2EA 3KZIC 4A3IJ 2E1NA 3EYYA 2E7WA 3BG5A 1POGA 1K78B 3DQVC 1P4WA 2BE5F 1Z7UA 1GV5A 1OFCX 1SD7A 2NNYA 3ZQFA 2XAGA 2XGCA 3A0HC 1H0MA 2QF7A 2ME6A 3A01B 1D1CA 1MDMB 4OMYA 2DK5A 2DCEA 4S04A 3TDZC 5K7HA 3F8FA 5B1BH 3CCUI 1ZQ3P 2V1NA 2ZNYA 2LSOA 1YLFA 2XGXA 3J7ZI 2JK3A 3ELKA 2RNGA 5FRMA 1ODDA 4KIFA 2M4KA 3EQLF 3K9TA 5E20A 4MGRA 2R5ZA 2CQ7A 2M45A 4JOMA 2LMDA 4BE0A 2UV1A 2XV4S 4YIFA 1RC9A 4HOBA 2L9VA 3HSRA 5D5XB 1KU3A 2OCCH 3MKYB 2IRFG 3SDBA 3FK6A 3LSTA 2OA4A 4PUSA 1WKMA 3KZYA 1IUYA 2KMUA 2VPRA 4E7LA 2JPBA 4XLAA 5GTHC 5DCMB 1XMXA 3FK7A 2FMLA 1F9NA 4EEFG 4AD9A 2V1XA 5L3FA 1Y56A 4E7JA 3RTRA 1QNTA 1XGOA 4CA0A 2BYVE 3OR2C 2Q1ZB 2V79A 4U0VA 5KVRA 3OYEA 3L1PA 3FMQA 3HB9A 3KEOA 3SZTA 4RB1A 1KA8A 3DU5A 2R0QC 3SYTA 5C3EJ 3CCRI 5FB2A 1YI2I 5B3SH 1TWCJ 5FKKA 2N8GA 1GHCA 1KU9A 3RKWA 1VQLI 1TP4A 4KFCA 2VBWA 1E3HA 2HVSA 4EV0A 5FLVA 2W84A 2DPDA 3F22A 2DA1A 3FWEA 4M71A 2KIUA 1IC8A 3C3WA 1SVOA 1Q1HA 3BG6A 2LOOA 2AQFA 4F7ZA 2F4OB 1RNLA 5FJ8J 4D7MA 3S2WA 4M3BA 1W36C 1BI0A 3R0AA 1SEUA 3H0GJ 3BR0A 4BQOA 4C9YA 3HKZA 3K10A 3M07A 3JTHA 2EQRA 5E8IA 5H6RA 3WTYC 2XPVA 2X6OA 1FJLA 1FMVA 1U9OA 3A01A 3AG3H 3J80Z 5ICEA 4NQWB 1DDNA 1GV2A 4UVCA 1D1AA 5GPCA 1R71A 3PJRA 3PSIA 1Q1VA 3G1LA 1B8IA 3CCQI 2IAIA 1DUXC 1QA6A 1XPXA 4Y7NJ 1SANA 2RQQA 1V3FA 1Z0XA 4II2A 3WGIA 3FXMA 1PDNC 3P9IA 1S9HA 3CUQB 2E1OA 4HZFA 3KYLA 1J5YA 3G2BA 1IRXA 3K6GA 3CMYA 5A2QK 4WXDA 2IA2A 4C2UA 4MEYF 2EV5A 4JX4A 4N4NB 1K4TA 3QPLA 2VI6A 4RGUA 3AG1H 2B7EA 3L09A 1U8RA 2VASA 1VQ7I 4NC6A 3C1DA 4ANJA 1O57A 1BW6A 4OIRF 1PUFB 4OU0A 1ETOA 1A5JA 1N78A 2M4GA 5H20A 3VYRB 4HDVA 1XDSA 1ZK8A 3F23A 2FRHA 3FX3A 3CCEI 4MIMA 4KMFA 3FF5A 4P55A 5KAIC 1QBJA 4BY1J 3CJRB 1ENHA 3GZNB 1XGSA 4KDPA 1LVAA 2EFOA 3ZP5A 2DYRH 4CUGA 4FQGA 4XRMA 2EIJH 1A36A 3LL7A 3MZ8A 1Z6TA 1AA7A 1ZR2A 3CP2A 2VLAA 1P4XA 3JW4A 3VEPA 3BPVA 3AL0C 4HX4A 5M5XJ 3VSLA 3RPUA 1YTYA 2M1BA 2AXTC 4BBRJ 4RBOA 4GFBA 2DFFA 4L5IA 5F04A 2HGCA 4BNCA 3DTEA 3I3LA 3MEXA 4JK1X 4I7HA 2HQRA 2CGPA 1Y8RB 2EIKH 1JKOC 1LDKB 3HOYJ 2H6CA 2M87A 4ZTJA 1TBXA 4D0PA 2V4JC 4XRSA 2ME0A 2QSFX 1ZARA 2VXZA 3W6VA 3WE2A 5FLXZ 3TBIA 3R6SA 4CCKA 3WTXC 4UUTA 2X6WA 2IP2A 3V8JA 1AHDP 2K4BA 3HPHA 2PI0A 5J47A 1W0UA 2QKLB 2DXIA 3Q5FA 4H4KC 1FLIA 3HIFA 4E7IA 3I0TA 1G4DA 1ULYA 2PMHA 1K79A 4IOCF 1T39A 4AYBA 2CQXA 4M73A 4MLOA 2IGOA 4OAYA 1QPMA 4HEA2 3DEWA 3HL2A 3A1YA 4RAFA 1JUPA 3BR5A 1MJBA 3UNGC 2QSHX 3SEQA 2YSRA 4F91B 4V19K 2LF8A 3CTAA 4XLNF 1P7JA 2JQ7A 2LF7A 1KONA 3L2QA 4DIQA 4FE4A 1PUFA 2ELJA 4YFXF 1W4MA 1BC8C 5BNGA 4ITVA 3A4CA 4XBFA 3OR1C 1RR8C 1D8KA 3H9GA 1DP7P 3JTGA 4DBRA 3S3NA 4KN7X 3RCOA 3ZQQA 5D6EA 3EUAA 3BY6A 2HKXA 1H9TA 3CUOA 1KQ0A 2VJIA 4PSWA 1D5YA 3L7WA 5FD6A 3MKZA 2NVTJ 3DXJF 2BY1A 3KYCB 2YX7A 1DGWY 4Q48A 4B1RA 4EVIA 4IHXA 4XLFA 4XM3A 3BZKA 4PZJA 2QBYB 1BJAA 3LMMA 1XMAA 1S5LC 1T0FC 3R60A 1LJ9A 5GAGJ 1HKSA 1H88C 1QPIA 2E2HJ 2ZBKA 3TO9A 2R7OA 1SFXA 3PIOF 4PJLA 3S2DJ 2VT2A 1YE9A 1XGNA 1KQ8A 3ZMTA 2FEZA 3H5RA 4BUPA 3QQAA 3HKZN 3RKYA 4MNUA 4JBAA 3I56I 1Z1DA 2MD0A 2WV0A 2R7RA 2P0WA 2W48A 1BL0A 1IXCA 3CF2A 2TRTA 2L54A 5ICFA 4CZCA 2FQ3A 1O3RA 1FOWA 2K5CA 3ESWB 2MLKA 1RETA 2JWTA 3UKGA 2E71A 2LYCA 3E6BA 4EJOA 1HBXG 5DUIA 1YX3A 4UUSA 2H1KA 2ZXHA 2HKOA 5CVVA 1DQUA 4UVAA 2A61A 4XOTA 2LREA 3QYEA 5F0CA 3GF2A 1JJ6C 4NC7A 2COBA 3WG9A 1R22A 5DM7F 3BG9A 2VQCA 1FBSA 4ENJA 3GZ5A 3KE2A 3TP3A 3CESA 5E1XA 2VUMJ 2HTJA 2CG4A 3V42A 3OYJA 1FOKA 1OR7C 1ONVA 2LD5A 1QRYA 2XKOA 5BS6A 2EFWA 1TTYA 2LNBA 2UXNA 3IRQA 1Y6IA 2CFOA 2O5RA 3M8EA 4J01A 2K27A 2HOSA 3D1NI 2BOLA 3SZGA 3OYMA 1VQ5I 1USSA 2ZO4A 2W25A 3LWFA 5HS7A 4EJWA 1J75A 1I3QJ 4P1WA 4F3QA 1WCMJ 3LSIA 2P5KA 1BBYA 1W36D 1IN4A 1AOYA 2E60A 1SD6A 4UB8C 3CP8A 4G12A 1JXSA 2PX9A 3E5XA 2P7VB 3H5AA 2DFHA 3S1MJ 2PJRA 4A3GJ 2OV7A 3EETA 5GAHJ 1IGNA 3S14J 3ZQHA 1FYLA 2R7XA 5EZHA 1HQCA 4ASNA 3ZOBA 1XD7A 1F4KA 1YIJI 3IP4B 4RB3C 2OJED 3ECOA 2CMPA 4X0GA 2NVYJ 4KN4X 3L2VA 1G3YA 4DYCA 1V5EA 4KICA 1OCPA 1S7AA 5K5OA 2P4WA 4WCGA 3GW2A 2IXSA 3PSFA 4DNCA 5ICCA 2OC6A 1P92A 4FX0A 2WAQA 2B63J 2RN7A 4I76A 2Y9ZA 2O8XA 5J8FA 1GUUA 4UUVA 3MZYA 4CCJA 3C2BA 4C3JJ 1SAUA 3JREA 5DM6F 1R1TA 1SFUA 4IHVA 5E3OA 1XS9A 5KNLA 4JP0A 2IVMA 1U2WA 1YOVB 1B9MA 1LUJB 2P5VA 1KYZA 4GYIA 3H9JA 2CUZA 2AS5F 1L3LA 3CJTB 3NRVA 1MMSA 1X1DA 1MD0A 2PLYA 1D0XA 2KRFA 3ABKH 5B66C 1OKRA 3DKWA 3FXJA 1DU0A 3DLAA 1A04A 1OPCA 3GLXA 3WU2C 2OBPA 3HC7A 4XICA 4ENKA 1N77A 1LE8A 1R9TJ 5EEGA 2X1CA 2MH9A 1H9GA 2LKPA 4L18B 4B47A 2EV6A 5IOZA 1WH7A 2Y9YA 3HRMA 2W85A 2R5YA 3K70C 1OYYA 3PUBA 3WGGA 2M2EA 4CXFA 3W6JB 2HZTA 2E2IJ 3JRBA 5IY5H 2NS8A 4KYWA 3BTJA 2XB5A 2OQRA 1T56A 1ZR4A 1VQOI 2LTPA 5JVGF 2DMNA 3LA3A 1R49A 2LDUA 3GO5A 3HRTA 3F6OA 2VONA 1ZTRA 4B43A 1MH4A 1ORKA 1X19A 3BLYA 2CUEA 2DOFA 2ZXWH 3ZN1A 4IQJA 2UUZA 2EFQA 1U6GA 2HDWA 4GRIA 4LFUA 1FBQA 4N9IA 1BR1A 3G71I 5L3GA 1H89C 4AIHA 1TW3A 4TV7A 1XTAA 2KJBA 1R7JA 2I5UA 3Q9VA 1S7OA 3HUGA 4M3GA 5GAEJ 3DCFA 3SXYA 1W7PD 1WJCA 2IPQX 5GADJ 2JUCA 1V55H 2E34A 3BJAA 3CC4I 2XF7A 4OOIA 5DYMA 2HYGD 3I59B 2DT5A 3HBLA 3ABLH 3M7GA 2X0LA 4M6XA 4E70A 4BU2A 1KU2A 4M3FA 5F0FA 2QZ8A 1W5SA 3DPUA 2GWRA 5ILVA 4BHCA 2Y48A 3CMEI 1Z67A 3F0CA 2QQ8A 3S8PA 3MQ0A 4A0ZA 4O3MA 5CPRB 1D1BA 2KZVA 3BROA 2K9SA 3JRGA 1O4XA 5E18F 2GOMA 1BN5A 3PUFA 2XC7A 3J81Z 1MBJA 1JKQC 1R5GA 2VIXA 3FKIJ 2IW5A 4M74A 2LK2A 1X3UA 2FD5A 3VDXA 1IN6A 2Z9OA 5ICGA 4E6KG 3GXOA 1UCRA 1EH6A 1R6RA 1G8XA 2GIZA 2PMUA 5F6FA 2JA2A 5IOYA 3GWZA 4XK4A 4CYCB 3JAMZ 1UFMA 1LQ1A 1BI2A 3NEUA 3O3KA 1S72I 2BBYA 1Z91A 4FX4A 3FXLA 1Z6RA 5EDNA 4YEJA 1IRFA 3COAC 1OCCH 2UXXA 5B1AH 2MC3A 4PGHA 4EQQA 5JHUA 3RZDJ 4A3CJ 2DYSH 4A93J 2KISA 4IZZA 2VJ4A 4A5NA 3BR6A 1VNDA 1D5VA 2PG4A 1J2XA 4HAMA 3GTGJ 4ZDOA 4BHBA 3L2RA 3OIPA 3IH3A 5J1UA 3GTQJ 4QWQA 2L7FP 4A3EJ 2EZIA 1WWXA 1F43A 1MBFA 2VB6A 2VKHA 3H35A 2VKEA 5GPAA 4ENMA 2GXBA 1TW2A 1R58A 4HNUA 2K9NA 4GO1A 4JYKA 3FHZA 2V9VA 3ABUA 2M8GX 2ZC2A 1PP8F 2DPUA 2UZKA 2CH0A 4DOZA 1Z9CA 1ZRDA 2HI3A 1MSEC 2O7OA 4B3AA 4Y3OA 1DPUA 2QLZA 2LRDA 4HX8A 2MSYA 4GGGA 2A68F 1YRNA 3BC8A 1KQ9A 3JRCA 2ZJQF 2DT6A 3K4KA 2WAFA 2DOAA 4RGSA 2FBIA 4BDYA 3HEFA 4OAZA 1BC7C 3HOUJ 5CQEA 3H0DA 4U88A 1R1UA 3C2GA 2IGKA 2JVHA 1FP1D 2QVOA 2CV2A 5JI6A 4DYRA 2OUMA 4IHSA 1SD5A 4BEHA 4BAYA 4KJZA 1Y1WJ 1OCTC 2DQRA 3BZ6A 4R1HA 4HNTA 1S29A 4FT8A 2IS4A 3EYIA 2IGMA 4V2FA 3CCYA 1MBHA 4Y15A 5CVIA 1Y0UA 1OMIA 1MMAA 1FIAA 3QYFA 1ZG5A 1L0OC 3ASNH 1W7PB 2Z3YA 3K1PA 3MFKA 2VE8A 1B8IB 4PJNA 3LSGA 3OV8A 4Z2YA 1VQNI 3PM1A 2DMQA 3K4NA 1S7EA 3V7SA 4CSWA 4CYCA 2LKSA 3C2HA 2F5DA 3KYDB 2ZSIB 5J1YA 4YFNF 3RQIA 2F5FA 2ZJPF 2JRMA 1ITYA 1WVRA 1HSTA 2V26A 2DLLA 2P6TA 2EZHA 2O9LA 1X1CA 3EDPA 4A3LJ 3N97A 5LGUA 5IYBJ 4PFOA 2HNHA 3HGGA 1PP7U 3G73A 4XKBA 3OS0A 1SC7A 5HLIA 1HDDC 4BE2A 1MH3A 1R5ID 5EG0A 1USTA 3JRAA 3BJOA 3I9V2 1RKWA 1YJWI 1J09A 3IWZA 4I0BA 1IJWC 3ULQB 1N75A 1C0WA 2Y0SN 1MZBA 2Y69H 4FTHA 1TT5B 3BG3A 1VQ8I 3B02A 4GYGA 3CF5F 3OS1A 3FZVA 4XLHA 1XDUA 2M30A 2ZXJA 1JT0A 3F8CA 4MHGA 4XIDA 1B59A 4BS9A 5DS9A 2H94A 3DBHB 1LKXA 1OCRH 3OYKA 1BIBA 4XLCA 1WJFA 3SJMA 3MMYB 2E1MC 3HTUA 3KEYA 1FNNA 4MFEA 4Q5SF 2M34A 1ETXA 1XSDA 2WTEA 4UNOA 1TQPA 2VODA 2KT0A 2I8DA 2MGQA 1QO0D 2B9SA 2ZFUA 1HA8A 2F4IA 1B72A 1BA5A 3KFWX 2H8WA 5J1RA 3K70D 4CICA 4GXOA 2E1CA 3E7LA 4XNFA 2QM3A 4YELA 5HS8A 4HF0A 2HU9A 4QTRA 1SFOJ 3PFIA 3AG2H 1YYVA 1R4NB 4ZYHA 1OYWA 3KP3A 2M9HA 1W7PA 3HZJA 3TO7A 4B3XA 2HZDA 1BR4A 3KP4A 4EJUA 4E7ZA 4KIGA 1XX5A 1IDZA 1YIOA 3KLOA 3NARA 4ZDPA 4AU7A 4HX7A 3I53A 3A02A 4BYYA 3C18A 2LG4A 2DJNA 4AVZA 3HGYA 1GXQA 5LEKA 4AUXA 1SMYF 1A6QA 2QWWA 1IAWA 1OCOH 2BXZA 2O61A 4XLEA 3QODA 2Z1DA 1WJDA 2XRNA 3ZQCA 1MW7A 2DI3A 3C7JA 2F48A 3CDLA 3FM3A 1Z3YA 3WHBA 4A6DA 3B73A 4D9JA 2G0EA 5BPDA 2D45A 1CF7B 2NAZA 3FXKA 5CJ9A 1MGTA 3X2QH 1TQIA 4WXCA 3DKYA 4ENNA 2HPMA 2NOJB 1KGSA 3OL3A 3LAJA 3OYDA 3JRFA 1ETWA 2LY9A 4E4HA 1AKHA 2KQRA 4U7DA 4F52A 1K6YA 4DQ2A 2ID6A 4L9NA 4DBQA 4XMYA 1LDJA 1JJ8C 1YJ9I 2QCOA 4MQVA 4RAGA 4Y17A 2K86A 1T33A 3ZMVA 1E2XA 3K7AJ 1DPRA 1I6XA 1X1AA 1X1BA 1ETKA 4N4OB 2CFXA 5LLQA 2GA1A 4Y4RA 2FQ4A 1TZLA 3CCSI 2WV1A 4A69C 3S1NJ 3E6DA 2MW8A 1O7LA 2AO9A 3BTLA 3E5UA 3SQNA 3F21A 2RREA 1FBUA 5HDKA 5D5VB 2ISZA 4EMSA 2JZYA 4UV9A 3K4MA 4NDLA 1T0FA 2FJ1A 3WODF 3T8TA 4X6AJ 3TL4X 1IV8A 3WE3A 3TEDA 2R3SA 3KX2A 4XQFA 2W00A 4HLXA 3W2WA 1UHWA 4MQ9F 4BGDA 3ZMZA 4I99C 4EGZA 3D0SA 2EA2A 4RAYA 2H09A 2L2OA 4M9SA 2K4JA 2D2WA 1IN7A 1W1WE 5J4VA 1WH5A 2Z2SB 3ABTA 1FYKA 1I5ZA 1ETQA 3TOAA 3AKZA 2EV0A 1QVTA 4EJVA 2W1OA 3LSKA 1TL8A 3W2AA 4G7HF 1T38A 1ZLJA 2DK8A 3GTJJ 2LY1A 3ZQLA 4IRHA 3S2HJ 3TP0A 2L9RA 2I10A 4A0XA 3FISA 3RQ4A 1IRGA 3O8GA 2JA5J 1YW8A 1B1BA 1F1ZA 1FX7A 4UUSB 5LD2C 4BQQA 3ZQIA 3LSRA 3BTIA 4LLNA 2EWNA 3SFIA 1FMWA 4FASD 5LGNA 1G3WA 3N4MA 3P9KA 3F6VA 3A2KA 4A3MJ 1CF7A 3OIOA 1Y1VJ 3CDHA 5IP9J 3K0LA 1BJZA 3W6KB 2NNNA 1OR7A 3DBRB 1TWFJ 3GTLJ 1DP3A 2O3FA 4CCLA 2LKXA 1LFBA 1K6OA 2ETHA 1IXRC 2CU7A 1LEAA 3WTUC 2R7UA 2F5CA 4RAZA 3ZQ7A 1PJRA 1DU6A 2ADUA 3TKYA 4A3DJ 3OYAA 4LIVA 2VE9A 1VQMI 5C44J 3GUDA 4XOPA 2X51A 3S1QJ 1LFPA 1T98A 1OJLA 1XG1A 5JVTA 5LHHA 2VBYA 1D3YA 1ZYRF 2HTSA 2A5YB 2KJCA 3DP7A 3LSHA 3CMAI 3ERED 4XRFA 2KDZA 4I6ZA 2PJRB 3CJNA 4XN0A 3VWBA 2DDBA 5FKNA 5M3MJ 5EF6A 2BZTA 2FE3A 2L9SA 1V5FA 3ONQA 3KP6A 1BI1A 5L3DA 1BI3A 1TNTA 4YIRX 4A0YA 2V1DA 2Q2EB 3CQZJ 3CJQB 3SEZA 5AIQA 4IF4A 2GQQA 3M8JA 1XC5A 1NHAA 1EKEA 4L0YB 5EEHA 3HSEA 3GTKJ 4KT6A 5ILSA 4ZYDA 2FMYA 2OAZA 1P4AA 3CC2I 4ZZDA 2WB1N 4Y33A 2DJIA 2ZSHB 4RM3A 1IO2A 3MWMA 2M0MA 4MTDA 3FIWA 3TQNA 2DA7A 4KUMA 2EJRA 3DFGA 5DDGA 3VB2A 2W57A 2F4MB 2LLKA 5E3NA 3K4CA 4C3IJ 1X4OA 3CLQA 1QU3A 3HOTA 3A0BC 3HRSA 3LSMA 4LJZF 1LE8B 2W4SA 3LA7A 2Q0OA 1UAAA 3NWTA 4ZDLA 5IT3A 1H8AC 5AONA 2R7ZJ 1BOBA 3HRUA 4QLCU 3BOQA 2R5YB 2NVUB 3CUQC 4J19A 2ZFWA 3H9QA 3I54A 2NVXJ 3DTKA 2PQ8A 3KEQA 4LIUA 1MMNA 1E3OC 4BXXJ 1HW5A 3F9KA 4BJ5C 2DMTA 4NHJA 1QZZA 2EIMH 3BJ6A 1ZGAA 2R93J 4RDUA 2CJJA 1IZ1A 4EM2A 2L5QA 3CO6C 4HRIA 4JX5A 2UWMA 2DU9A 5F1RA 1HCRA 2F5EA 3E5QA 4R79A 2DA6A 4G7OF 5EGOA 1U3EM 2MYSA 2EILH 4E7HA 1B6AA 5K5RA 2MC4A 2CO5A 2FNAA 4B4CA 4CCNA 5E17F 1U5TB 3WGHA 1IXSB 4BL0B 4M3DA 5M5YJ 4M6YA 3MN2A 4HF1A 4ESBA 4Z6YA 5F1JA 1V4RA 1IRZA 1FC3A 5IP6A 1UG2A 2V7FA 3HUGB 5K5QA 1IG7A 4DJAA 1X3ZB 2O8KA 3E97A 3TO6A 3HDDA 2H1LA 2PMZA 2KPMA 2Q2EA 2ZJ2A 2VQLA 1R00A 4U0YA 1HW2A 3J80K 1ZLKA 5DCFA 1XSVA 2KHMA 1Z7LA 3QU3A 1KYWA 2ECBA 2RVCA 2YX4A 2ZMEB 2C6YA 2OTJI 3CMMA 3WG7H 4IQ4A 2E5ZA 5TISC 3MKWB 2KIQA 3KP7A 3P7NA 4PGGA 1G2HA 2K9LA 3T8RA 2VJJA 3S32A 3CC7I 3IKTA 1J0RA 3V4GA 5DD8A 1VQ4I 2QEXI 3ZRGA 2CQKA 4UVBA 2QUFA 1HF0A 1HXDA 4H0EA 5HOOA 2HOAA 1A35A 2GLOA 4CYDA 3I4PA 3F8BA 3CO7C 2DOEA 4RMNA 3SDGA 4DZJA 3T0YA 3V8KA 3U2RA 4ZC3A 2FU4A 2JSPA 3S16J 4JX6A 3QP6A 1JKRC 2XGEA 2DW4A 3OMYA 5BOXA 4OINF 4AIKA 1RIOH 5TGTA 2EFPA 3FM5A 3I64A 2VL8A 1E3PA 1WI9A 2WADA 4WX9A 2X48A 2IS1A 5FGMA 5TRDA 1UMQA 2YU9J 2CWEA 4QIWN 1S3JA 1FEXA 1EJ9A 4XL9A 3ZPLA 2IA0A 3ZMSA 4HQEA 2CUFA 2Y0SA 2OCEA 3L00A 2RNJA 5HLTA 1UG0A 2VN2A 3QRFF 3U1KA 3OYFA 5JLWA 1U5TA 2VXDA 3IHUA 3S17J 1U0JA 3OL4A 2L7KA 1LVKA 4AIJA 3FDYA 1WFXA 4B09A 1TT0A 2D1VA 3FHNA 3IL2A 1G3TA 2EPFA 1Z77A 2LR8A 2GOXB 3PL8A 3GFIA 1YFHA 1QHHD 3PFYA 4IRGA 4ZYGA 4O5VA 4EM1A 2V6CA 4DYQA 1UHSA 4C2TA 4KT5C 2PBIA 3ECHA 3S93A 3VOEA 2L02A 2AXLA 5K7FA 2VBZA 3DPLC 5FLXK 4BACA 2ZMEA 4E7KA 2A69F 2G7HA 5D8KB 1EV7A 3Q0WA 1PUEE 1HW1A 1HKTA 4OIOF 2CQNA 1YRNB 3SFZA 3GLLA 3HOWJ 5CVRA 3MVPA 4U87A 1KZHA 4RLQA 3TMOA 3QP5A 2W24A 1VTNC 2FOKA 4UXNA 5HNHA 1MSFC 4BXFA 1Z05A 1PYVA 4A3FJ 3EUHC 4HPQA 3HJEA 5BMZA 3DKXA 1B4AA 2MLGA 1MNMC 4BEHB 1ZH5A 3MCZA 4CO8A 3HTSB 1LNWA 2A5WA 1V54H 4HV5A 1I1GA 2TCTA 3S1RJ 2VC1A 3ISPA 2R7TA 3GMEA 2FXAA 1VQPI 2V6EA 5LEJA 2XF6A 3OSFA 1EH8A 3F8NA 1MBEA 2DFIA 2JN6A 4G94A 3L9FA 1CGPA 1M1EB 2JJ7A 1ZRCA 5L3BA 4CZZA 2FBHA 1JKPC 2FNPA 4NBQA 1EF4A 1SMTA 3AFHA 3KCCA 1X3WB 4ZH4F 1P6RA 1S6LA 1TWAJ 5TJJA 2XROA 3V7RA 5E3MA 1W5TA 2K40A 4IVNA 1T2KA 2KIMA 2P5LC 3ZCOA 2ZNZA 3RPQA 5F64A 4ZYAA 3S15J 3IKVA 2P7CB 2BEOA 2P6SA 2DFEA 3ABMH 3B6CA 3RJPA 1EA3A 4FE7A 3BR1A 3U21A 4J00A 2HEOA 3IWFA 1FWZA 3FBIB 4HQMA 4A6EA 1JUSA 1NG7A 1Y39A 2E36A 2LP0A 3Q0UA 4L9JA 5EG0B 3S3MA 1GXPA 4WF2A 1WZ2A 2BV6A 3DV8A 1XB4A 4LLGF 4RLFA 1XGMA 1OYIA 4B44A 1RRJA 1SVMA 5JHFA 1ETVA 4LMYA 1FZPB 4I98B 4A3JJ 1D0ZA 2L7MP 1ACIA 2M3AA 2BW3A 1MMDA 4UV8A 5KHDA 1QZYA 3FKJA 2HFHA 1K4SA 3AL0B 2ZCWA 5E3LA 1XN7A 2DT7B 3L2CA 2OQGA 1YJNI 1K7AA 3G1OA 4EM0B 3MD2A 2CW8A 4F93B 1FPQA 1VQ6I 2PMZN 1IW7F 4GCVA 4MTEA 4LG0A 3IV5A 3OYNA 5IYDJ 2ZJRF 2K9QA 1XSXA 1IF1A 5DUKA 2K7LA 3WTTC 3DWLE 1I27A 1LPQA 3ZXSA 2STWA 4XRSG 3LSPA 1QVUA 1ZG3A 2EBIA 1JT6A 1MJAA 1YW9A 4WK8F 4BDZA 5EJCA 3PNTA 1TWGJ 3G4SI 1B72B 5JLXA 2XIGA 1RI7A 3OYGA 5IT9Z 2DMUA 4XORA 1V5GA 3HYIA 2V9PA 5IP7J 2RQPA 2R7DA 2FOWA 5KAFC 2FUG2 4FISA 3RIRA 4XONA 3VPRA 2M0CA 5EEAA 3GX4X 1BOAA 4EGYA 2RDPA 2A6TA 3V8LA 1P2FA 3BP8A 2GA2A 5CVJA 1PVEA 1WGXA 4MEXF 3H3VK 4NB5A 3L2UA 2PN6A 5LBQA 1WJ5A 2RAEA 2L4MA 3CZ6A 3SHFA 3GFMA 1ZKGA 4WXHA 2QSGX 3VYUB 5CVUA 2EZKA 2Y2ZA 2Y31A 1G6NA 2R7FA 2V9KA 4IL6C 5LFAA 3CCMI 2H8RA 3OIQA 2OU2A 1IN5A 3HHHA 4JQFA 1E17A 3MAJA 4V2GA 4EATA 4RB0A 3E0JB 3RZOJ 1IUFA 1SFKA 4GDFA 4AM3A 3ROUA 2IEKA 2CUJA 1T8IA 3UR3C 3VODA 3PO3J 3E1SA 2KRHA 2NVQJ 4D1QA 3OS2A 2MFZA 4IHYA 3EPZA 4ZTFA 4ZYEA 2L9NA 2YPRA 1AKHB 4LB5A 1F5TA 3BT9A 3GTPJ 3QOEA 1W0TA 3QPSA 3QYBA 2HQAA 1YO5C 5FLMJ 3IH4A 2COMA 2EFNA 1MBGA 2DA2A 4AVPA 2W7NA 3H36A 2DTZA 1MBKA 5GP9A 4I09A 1NTCA 4YIIA 2DA5A 4RGRA 2XSJC 5F08A 5FFZA 4L9TA 1ZG1A 1VQKI 1IDYA 2MG4A 4YRVA 2CW7A 4ZJZA 3LNQA 3DLLF 3FMSA 1YS6A 3NWSA 1HSJA 1I3AA 2LH9A 3OOUA 3I55I 4A2UA 2EA4A 2WB1A 3QAHA 4A3BJ 4IHWA 2JA7J 3O6BB 3AAFA 5E1ZB 4E7SA 4BQAA 2XAUA 3K4JA 4PJMA 2ACJA 3IAM2 2XDVA 1Y0NA 2M7BA 1GVDA 1QZEA 2VOOA 3L2WA 5HODA 5GTIC 2HVQA 5DEQA 4CCOA 4OIQF 3G6EI 2VOPA 2G9WA 1TLHB 2KZGA 1K78A 2B0LA 3GYHX 1OLTA 2P8TA 2A6HF 1XCBA 1ON1A 3D5SC 4KMUX 4KITB 1MDMA 2BY0A 1UELB 2H6BA 3ASOH 1ZN2A 1ZAOA 3BQYA 3OYBA 4PK4A 2MA3A 1FP2A 3IRRA 4IO9F 2QYOA 3GVAA 4S05A 3HSFA 3KP5A 3R0JA 2MBFA 5KCMA 2L01A 1MNEA 2IBDA 3BG7A 1NG6A 3OOPA 2BHZA 1F36A 4CCMA 3HOXJ 2KLOA 1OQYA 4C3HJ 2LY2A 4G6TB 2JSCA 3V7CA 1QGPA 3QPHA 3PNVA 5HS9A 6PAXA 3KZZA 1Z3XA 2KIFA 2RGVA 2X1EA 5DCMA 5LRRA 3OWTA 5LRSA 3T1BA 2A07F 4A12A 4ETSA 1D8JA 3ZMUA 3HOZJ 1FY7A 2X4HA 2QKMB 2A6EF 3PQKA 4PCQA 1ERDA 1I39A 5C4JJ 4II3A 2K3FA 4M3EA 3BQZA 2R7SA 4MO7A 5CQGA 2CS3A 4IEJA 2WBMA 3EUKL 3JRHA 2JVGA 4HDUA 2X9DA 3CD6I 2IS6A 2NYXA 4MFDA 5FFXA 3LFKA 5AIPA 4PFPA 1RR7A 2L3DA 1VI0A 3H3UA 4M9ZA 3MKLA 3M4OJ 4B48A 3P5JA 1LB2A 2BVMA 2IA1A 1X58A 2VKDA 4IOAF 2XGDA 4S0HB 5LHIA 2XVCA 3K2ZA 2M7AA 2NRAC 5J40A 4NUBA 4BBSJ 2YR2A 3I4MJ 4D5FA 2ZB9A 3J81K 1T08B 3QWLA 2QQAA 4HA8A 3FXQA 4I2OA 2XRLA 2HOEA 3J7AY 2ICWG 4B8XA 1ON2A 3M1CA 4HBLA 3E6MA 3JAMK 3KETA 4QPQA 5M3FJ 1A31A 2XAJA 1E0EA 4ZZLA 2X6YA 1JI8A 1NK3P 2GZWA 2CYYA 2F2EA 2FBKA 4XR6A 4NQWA 3HM5A 1VF9A 2RC4A 5ED4A 2FF4A 1WJBA 1G3SA 4IPAA 1JE8A 2ZXIA 1U8BA 2TDXA 1D0YA 4PSXA 2L4AA 1RZ4A 4M6VA 3BWGA 2R92J 5CLSA 2XAQA 4AWXB 4L5JA 3F8MA 2OZ6A 3CUQA 3FXOA 1Z21A 4BH9A 3F3XA 1FT9A 3GZ6A 2DMPA 4U0WA 3LA2A 4BE1A 2AHQA 4L5EA 2R7WA 2Z5UA 3DEEA 1APLC 3HOVJ 3GEZA 1J59A 1T6SA 3WTSC 3LSJA 2CRGA 2KL4A 2FSWA 2XKPA 4ESFA 3T5XA 4IX7A 2AQEA 2XAHA 3OYHA 2P81A 1VQ9I 3RDIA 1AWCA 3WTWC 3GTOJ 2Z16A 5FRNA 1HDPA 2DODA 4BQNA 2XPWA 3K2AA 3LOCA 1YQAA 1JHFA 2OF7A 3RI4A 4YFKF 2DA4A 1X2MA 5EGOB 5IPAA 4WWCA 1FSEA 5FKOA 2GBYA 4BXUA 1ETYA 3ZR8X 4I01A 2HQNA 3VYSB 2RV8A 4LK0F 2DN0A 4LG3A 1RESA 3VYTB 3IH2A 3GTMJ 4HSRA 1FIPA 4DZPA 1WPKA 1MMGA 2JRTA 3K1MA 1G59A 4N9HA 4XSXF 1ZELA 5K1YA 2Z33A 4NC8A 1TQMA 4C2MJ 1JGSA 3R4KA 4LGWA 3JCUC 5IT9K 4CH7A 2MABA 4XKVA 2LBFB 3VFZA 2EINH 2IS2A 3IC7A 2HPIA 4DGWB 2IJLA 1LEBA 2HDDA 2EB7A 3U9GA 5DTDA 4I02A 1P7IA 5EYRA 3BDDA 2QQBA 3K1NA 5HVQC 3J7YJ 1UZCA 1TWHJ 3LQRA 3DTIA 5DD4A 4HLYA 3BCBA 2JPCA 2CSOA 3H1CA 1REPC 3G3ZA 3JR9A 4RGXA 3TOBA 3ZMDA 1R1VA 1UJ8A 1YW7A 3DPTA 1X1PA 4HSTA 1XCVA 3HHGA 3WU0A 5D6FA 2EK5A 3KIOA 9ANTA 3O8HA 2DQLA 1K83J 3FXRA 1WHUA 1WSUA 2HXIA 4AIDA 4PJJA 3WHCA 3S3OA 3O2PE 4FCYA 2ESNA 2QA4I 1WI3A 3ERMA 5D5WB 2WAEA 2X1DA 5CKTA 3G1MA 2WWYA 2NOGA 3GFLA 3SZPA 1O7FA 5E1WA 4IKFA 4UB6C 4L9VA 5LHGA 1OISA 2RKHA 4O6JA 3ZQGA 2D5VA 1TNSA 5F27A 4QPOA 5CYVA 1NK2P 4IHTA 1BW5A 2YUSA 2BVLA 1OCZH 2LVSA 1HKQA 2VQGA 4BKXA 5H2FC 3F72A 2BGCA 4BY7J 4OMZA 4KISA 3QU6A 4G9YA 2L0KA 1MKMA 2OPTA 4AC0A 3I58A 3NQOA 1Y8QB 1ZRFA 3AG4H 5EZGA 1U78A 4IRIA 1SD4A 2MH2A 3JSOA 3KLNA 4HV6A 4XN3A 3BR3A 3B6AA 2HXOA 1QQIA 2EH3A 1BIAA 5H6QA 1FTZA 2WY7Q 1FSHA 1U9NA 3HG9A 2KDOA 4KIBA 4DW6A 1N25A 1JHHA 5HDNA 2E5NA 3N05A 5FKMA 1WQ2A 2CV0A 5L3CA 1MNDA 2LBFA 4IXAA 5J3LA 5HLHA 5HDGA 1LFUP 3OSGA 1GDTA 1T95A 2VT3A 3BZCA 4IJAA 2QBYA 3FXUA 1ZHFA 1EH7A 5BQTA 3JSPA 1RPWA 1HOMA 3CLOA 3J7AO 2BHYA 3RYPA 4D7NA 1WJEA 2R7QA 3D5RC 2PJPA 4C30A 3QOPA 1J7KA 3I5UA 3GCMA 5J4YA 1KU7A 4A3KJ 3EUHA 4R8HA 2L7ZA 2VBXA 1FTTA 3K69A 2LFBA 4PDKA 4P9FA 2JA6J 2H27A 3Q9SA 2ELHA 3H3ZA 5J6XA 2O6GE 2J5OA 2XAFA 4HF2A 5F0HA 5JR3A 2DBBA 1FYMA 2HQ5A 2VJ5A 3U1DA 3E6CC 1JTXA 1YITI 2IT0A 2DO7A 3TDUC 4A5MA 1RUOA 4UHTA 4LD5A 1GVJA 3WU1B 4G7ZF 2NS7A 1GLNA 4OWRB 5D8LB 5C4XJ 2HOTA 5FD5A 4P9UA 2EZLA 3DEUA 4ABZA 3H92A 2A05A 4LOCA 2Y75A 4Y13A 1UB9A 3WTZA 1GT0C 1X2NA 4XLPF 3RKXA 2ID3A 1MJ9A 2CW0F 3H5NA 4AYBN 4Q4ZF 2ELKA 2DAOA 4N0BA 1K61A 2V1UA 5HLGA 2YS9A 1YG2A 1JTYA 5J8CA 3WTVC 1SFEA 1BR2A 1WJAA 2YU3A 1X4PA 2E35A 3KPHA 1R4MB 3PO2J 2K9MA 4BHPA 4HG2A 2R7VA 5FO5A 4FHTA 2JMWA 2D1HA 1CQTA 1JGGA 3W2VA 2QGUA 4P96A 4U7BA 5A2QZ 4XKCA 5M5WJ 3CCJI 2VKVA 2GIVA 2BY2A 3HXLA 3PQJA 2HVRA 4QSHA 3FBNB 3JRIA 3FMRA 2KP6A 3BR2A 1I50J 4XSZF 2WC2A 4M9XA 2BW3B 2W82A 4Q47A 3LAPA 5B5EC 3I4NJ 2K85A 2KFDA 3MZHA 2XPUA 2E1MB 2XF5A 2ZKZA 4M72A 4F92B 2E19A 4YG2F 3JRDA 1JUMA 3GBGA 2K3PA 3Q0VA 2KRCA 1IN8A 3CCLI 3DBLB 4F55A 4XKWA 4LG0B 2OZUA 5FKLA 5DV5A 2MD5A 3M9AA 1SAXA 4PJ0C 4L0ZB 2JT1A 3IUOA 4RA2A 2DTRA 2J5PA 3CCVI 3A03A 3PNYA 4ESJA 3DU6A 4RS8A 2XASA 3P9CA 4G6DA 2NXNB 1I1SA 5D4SA 2FA5A 2GM4A 2GXGA 3K4LA 2WA0A 4FETA 1FOXA 4LB6B 5LGTA 5D5UB 2X6XA 4LITA 4HYEA 1I6HJ 3TGNA 2CV1A 4RB2C 3BCAA 1VFCA 2ISYA 3M8FA 1ZREA 1O3SA 1ZGWA 2HDCA 2GAUA 1YX5A 2QENA 4W1UA 3RYRA 1AU7A 2JUGA 1RUNA 3REOA 2Q8KA 3LQQA 3LFUA 5ILUA 2NS0A 2JTVA 3IAS2 1VZ0A 1MIJA 4KNYA 1R36A 3HOSA 1S8NA 3KP2A 2BXYA 2KKOA 5BPIA 3R61A 2ESHA 2HYJA 4I0AA 4BJ6C 2XUBA 1J9IA 2E7XA 2HR3A 2STTA 5ERIA 4OIPF 1BM9A 4LK1F 2DA3A 2OTLI 4P5OA
chains in the Genus database with same CATH topology
4A3MJ 3OIOA 1Y1VJ 2NVYJ 5IP9J 4HNVA 4DYCA 1BJZA 1HLVA 1OCPA 3TW6A 1TWFJ 3GTLJ 1A6IA 3OOUA 2R5ZB 2LKXA 1LFBA 4D5CA 5K7ZA 4A3BJ 4IHWA 2JA7J 2B63J 4I76A 2Y9ZA 4Y52J 2CU7A 2E2JJ 1GUUA 3C2BA 4C3JJ 2XSDC 3JREA 1GVDA 1DU6A 5HODA 5E3OA 4IHVA 1XS9A 3TW7A 4JP0A 4A3DJ 5C44J 2CQQA 3S1QJ 5IYCJ 1OJLA 2XB0X 1XG1A 4X1EA 2KDZA 1DU0A 3Q3SA 4I6ZA 3M3YJ 4XICA 3BQYA 1LE8A 1R9TJ 2Y30A 5M3MJ 4W97A 5FKNA 5EF6A 5IOZA 1WH7A 3NAUA 2Y9YA 2R5YA 2IBDA 2M2EA 2E2IJ 1F36A 3CQZJ 3JRBA 2NS8A 3BTJA 3HOXJ 2XB5A 4C3HJ 1ZR4A 1T56A 1TC3C 2FX0A 2LTPA 1IV6A 2DMNA 1XC5A 3BTCA 1RKTA 1ZTRA 2ECCA 3GTKJ 3RKQA 1MH4A 1ORKA 2JA8J 2WB1N 2CUEA 2WAQN 3HOZJ 5C4JJ 3FIWA 2DA7A 4A3IJ 4M3EA 3BQZA 3BG5A 4MO7A 1POGA 1GV5A 1OFCX 4IEJA 3ZQFA 2XGCA 3JRHA 2QF7A 2X9DA 2ME6A 3A01B 1H89C 2LLKA 5E3NA 4MFDA 4C3IJ 1RR7A 5K7HA 1VI0A 1ZQ3P 1LE8B 4M3GA 3DCFA 3MKLA 2JK3A 3M4OJ 1H8AC 2R7ZJ 1X58A 2R5YB 2XGDA 4S0HB 2R5ZA 4J19A 2NVXJ 4BBSJ 3I4MJ 4D5FA 2ZB9A 1E3OC 3HBLA 4BXXJ 2DMTA 3FK6A 4M3FA 5F0FA 2R93J 4RDUA 2CJJA 2XRLA 2VPRA 3F0CA 3FK7A 4JX5A 4EEFG 1HCRA 2DA6A 5EGOA 2K9SA 5M3FJ 3JRGA 1O4XA 1NK3P 4B4CA 3HM5A 1VF9A 3L1PA 3HB9A 1MBJA 4M3DA 5M5YJ 1JKQC 3FKIJ 2LK2A 3MN2A 2R0QC 1U8BA 5F1JA 2FD5A 4M6VA 5C3EJ 1IRZA 5IP6A 1TWCJ 5FKKA 2N8GA 1UG2A 2R92J 1IG7A 2O8KA 3HDDA 5IOYA 5FLVA 4XK4A 2DMPA 4CYCB 2AHQA 4L5EA 2DA1A 1IC8A 1APLC 3HOVJ 2ECBA 5EDNA 3LSJA 5FJ8J 2CRGA 4D7MA 2P81A 4M3BA 3GTOJ 3RZDJ 4A3CJ 4A93J 1HDPA 2XPWA 3K2AA 3LOCA 2OF7A 1G2HA 3H0GJ 3BR0A 2DA4A 1X2MA 1VNDA 3BR6A 5IPAA 5EGOB 2EQRA 1HF0A 2XPVA 5FKOA 2GBYA 2X6OA 3GTGJ 1ETYA 2HOAA 1FJLA 1U9OA 2GLOA 3A01A 2DN0A 3IH3A 5J1UA 1GV2A 3SDGA 4DZJA 5GPCA 3GTQJ 1RESA 2L7FP 3IH2A 4A3EJ 1Q1VA 3GTMJ 1FIPA 2EZIA 3G1LA 4DZPA 1B8IA 1WPKA 1MBFA 1F43A 5GPAA 2IAIA 2VKEA 4Y7NJ 3S16J 1SANA 4C2MJ 4JX6A 4JYKA 2K9NA 1Z0XA 2M8GX 1JKRC 2XGEA 2E1OA 2HI3A 1MSEC 2O7OA 4B3AA 2HDDA 3CMYA 5DTDA 1P7IA 5EYRA 2MSYA 2X48A 1YRNA 1TWHJ 3JRCA 4JX4A 3QPLA 2VI6A 1UMQA 2YU9J 4QIWN 1FEXA 3HEFA 3HOUJ 3JR9A 2CUFA 4DYRA 1BW6A 1PUFB 1OCTC 1Y1WJ 5JLWA 1ETOA 1A5JA 3S17J 9ANTA 4V2FA 3CCYA 1MBHA 1ZK8A 3O8HA 1K83J 4MIMA 1FIAA 2HXIA 2LR8A 1Z77A 4BY1J 1B8IB 3LSGA 1ENHA 3WHCA 4FCYA 3PM1A 2DMQA 1WI3A 1S7EA 4XRMA 4DYQA 1UHSA 4CYCA 1ZR2A 5J1YA 3G1MA 2NOGA 3RQIA 5M5XJ 1ITYA 4BBRJ 5K7FA 2EZHA 4RBOA 2O9LA 4GFBA 3ZQGA 2D5VA 4A3LJ 5F04A 5F27A 3Q0WA 1NK2P 1BW5A 1YRNB 5IYBJ 3HOWJ 2YUSA 3MVPA 2LVSA 3HGGA 1JKOC 4BKXA 1HDDC 3HOYJ 4BY7J 1MSFC 1MH3A 5EG0A 3JRAA 4AC0A 4A3FJ 2L0KA 2OPTA 1RKWA 4XRSA 2ME0A 5EZGA 1MNMC 1U78A 1IJWC 3W6VA 3BR3A 2Y0SN 3B6AA 4FTHA 2HXOA 2TCTA 3S1RJ 3BG3A 2EH3A 4UUTA 1FTZA 3OSFA 1MBEA 1U9NA 1JT0A 2JN6A 4DW6A 1AHDP 4XIDA 5FKMA 1W0UA 5DS9A 2JJ7A 5J3LA 1LFUP 1JKPC 3OSGA 1GDTA 3SJMA 1EF4A 2CQXA 1RPWA 1TWAJ 1HOMA 5E3MA 4MFEA 2K40A 2M34A 1ETXA 4MLOA 4D7NA 3DEWA 2KT0A 1JUPA 3S15J 3BR5A 2MGQA 3B6CA 4FE7A 3BR1A 1P7JA 4A3KJ 1B72A 1BA5A 1JUSA 2L7ZA 5J1RA 4FE4A 1PUFA 1FTTA 5EG0B 2LP0A 2LFBA 3Q0UA 3E7LA 5BNGA 2JA6J 4QTRA 1SFOJ 1ETVA 5F0HA 2HQ5A 2M9HA 1JTXA 4A3JJ 1IDZA 2L7MP 3NARA 1D5YA 2NVTJ 3A02A 2NS7A 4B1RA 4IHXA 2DJNA 5E3LA 5C4XJ 2HOTA 2EZLA 4ABZA 3G1OA 3HGYA 4LOCA 2PMZN 4AUXA 1GT0C 1X2NA 3IV5A 2ID3A 5IYDJ 2K9QA 3ZQCA 4AYBN 2ELKA 1K61A 3CDLA 2YS9A 3WHBA 1JTYA 1H88C 2G0EA 4XRSG 3LSPA 1QVUA 1QPIA 2EBIA 1JT6A 2E2HJ 1TWGJ 3PO2J 1B72B 5JLXA 2DMUA 3S2DJ 5IP7J 2JMWA 1CQTA 3QQAA 1JGGA 3JRFA 1ETWA 4FISA 2LY9A 1AKHA 5M5WJ 3VPRA 3HKZN 2M0CA 5EEAA 2ID6A 2VKVA 1JJ8C 2QCOA 1BL0A 4QSHA 2W48A 1T33A 3JRIA 1WGXA 2TRTA 1I50J 3BR2A 3K7AJ 3H3VK 1ETKA 2FQ4A 3I4NJ 3S1NJ 1RETA 2WV1A 2JWTA 4A69C 3UKGA 2MW8A 2AO9A 2RAEA 3BTLA 2XPUA 4UUSA 2H1KA 2E19A 1ZKGA 1JUMA 3JRDA 3Q0VA 3GBGA 5F0CA 2EZKA 4NDLA 2Y2ZA 2Y31A 1JJ6C 2COBA 2H8RA 2FJ1A 5FKLA 3BG9A 4V2GA 4X6AJ 3TEDA 3TP3A 2VUMJ 3RZOJ 1IUFA 3A03A 2IEKA 2GM4A 3PO3J 2LD5A 1QRYA 1WH5A 2NVQJ 1ETQA 4IHYA 1I6HJ 1QVTA 2HOSA 3D1NI 1VFCA 1AKHB 1ZGWA 3BT9A 3GTPJ 4W1UA 1I3QJ 1W0TA 1AU7A 3QPSA 3GTJJ 1WCMJ 3ZQLA 5FLMJ 3S2HJ 3TP0A 3IH4A 2L9RA 1MBGA 2DA2A 2I10A 3FISA 2DTZA 4G12A 1MBKA 3O8GA 5GP9A 2HYJA 1NTCA 2JA5J 2DA5A 4UUSB 5F08A 3ZQIA 3S1MJ 4A3GJ 3LSRA 1IGNA 3S14J 3ZQHA 3BTIA 5EZHA 3SFIA 1IDYA 2MG4A 3ZOBA 2DA3A 3LNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M J;  3OIO A;  1Y1V J;  2NVY J;  5IP9 J;  4HNV A;  4DYC A;  1BJZ A;  1HLV A;  1OCP A;  3TW6 A;  1TWF J;  3GTL J;  1A6I A;  3OOU A;  2R5Z B;  2LKX A;  1LFB A;  4D5C A;  5K7Z A;  4A3B J;  4IHW A;  2JA7 J;  2B63 J;  4I76 A;  2Y9Z A;  4Y52 J;  2CU7 A;  2E2J J;  1GUU A;  3C2B A;  4C3J J;  2XSD C;  3JRE A;  1GVD A;  1DU6 A;  5HOD A;  5E3O A;  4IHV A;  1XS9 A;  3TW7 A;  4JP0 A;  4A3D J;  5C44 J;  2CQQ A;  3S1Q J;  5IYC J;  1OJL A;  2XB0 X;  1XG1 A;  4X1E A;  2KDZ A;  1DU0 A;  3Q3S A;  4I6Z A;  3M3Y J;  4XIC A;  3BQY A;  1LE8 A;  1R9T J;  2Y30 A;  5M3M J;  4W97 A;  5FKN A;  5EF6 A;  5IOZ A;  1WH7 A;  3NAU A;  2Y9Y A;  2R5Y A;  2IBD A;  2M2E A;  2E2I J;  1F36 A;  3CQZ J;  3JRB A;  2NS8 A;  3BTJ A;  3HOX J;  2XB5 A;  4C3H J;  1ZR4 A;  1T56 A;  1TC3 C;  2FX0 A;  2LTP A;  1IV6 A;  2DMN A;  1XC5 A;  3BTC A;  1RKT A;  1ZTR A;  2ECC A;  3GTK J;  3RKQ A;  1MH4 A;  1ORK A;  2JA8 J;  2WB1 N;  2CUE A;  2WAQ N;  3HOZ J;  5C4J J;  3FIW A;  2DA7 A;  4A3I J;  4M3E A;  3BQZ A;  3BG5 A;  4MO7 A;  1POG A;  1GV5 A;  1OFC X;  4IEJ A;  3ZQF A;  2XGC A;  3JRH A;  2QF7 A;  2X9D A;  2ME6 A;  3A01 B;  1H89 C;  2LLK A;  5E3N A;  4MFD A;  4C3I J;  1RR7 A;  5K7H A;  1VI0 A;  1ZQ3 P;  1LE8 B;  4M3G A;  3DCF A;  3MKL A;  2JK3 A;  3M4O J;  1H8A C;  2R7Z J;  1X58 A;  2R5Y B;  2XGD A;  4S0H B;  2R5Z A;  4J19 A;  2NVX J;  4BBS J;  3I4M J;  4D5F A;  2ZB9 A;  1E3O C;  3HBL A;  4BXX J;  2DMT A;  3FK6 A;  4M3F A;  5F0F A;  2R93 J;  4RDU A;  2CJJ A;  2XRL A;  2VPR A;  3F0C A;  3FK7 A;  4JX5 A;  4EEF G;  1HCR A;  2DA6 A;  5EGO A;  2K9S A;  5M3F J;  3JRG A;  1O4X A;  1NK3 P;  4B4C A;  3HM5 A;  1VF9 A;  3L1P A;  3HB9 A;  1MBJ A;  4M3D A;  5M5Y J;  1JKQ C;  3FKI J;  2LK2 A;  3MN2 A;  2R0Q C;  1U8B A;  5F1J A;  2FD5 A;  4M6V A;  5C3E J;  1IRZ A;  5IP6 A;  1TWC J;  5FKK A;  2N8G A;  1UG2 A;  2R92 J;  1IG7 A;  2O8K A;  3HDD A;  5IOY A;  5FLV A;  4XK4 A;  2DMP A;  4CYC B;  2AHQ A;  4L5E A;  2DA1 A;  1IC8 A;  1APL C;  3HOV J;  2ECB A;  5EDN A;  3LSJ A;  5FJ8 J;  2CRG A;  4D7M A;  2P81 A;  4M3B A;  3GTO J;  3RZD J;  4A3C J;  4A93 J;  1HDP A;  2XPW A;  3K2A A;  3LOC A;  2OF7 A;  1G2H A;  3H0G J;  3BR0 A;  2DA4 A;  1X2M A;  1VND A;  3BR6 A;  5IPA A;  5EGO B;  2EQR A;  1HF0 A;  2XPV A;  5FKO A;  2GBY A;  2X6O A;  3GTG J;  1ETY A;  2HOA A;  1FJL A;  1U9O A;  2GLO A;  3A01 A;  2DN0 A;  3IH3 A;  5J1U A;  1GV2 A;  3SDG A;  4DZJ A;  5GPC A;  3GTQ J;  1RES A;  2L7F P;  3IH2 A;  4A3E J;  1Q1V A;  3GTM J;  1FIP A;  2EZI A;  3G1L A;  4DZP A;  1B8I A;  1WPK A;  1MBF A;  1F43 A;  5GPA A;  2IAI A;  2VKE A;  4Y7N J;  3S16 J;  1SAN A;  4C2M J;  4JX6 A;  4JYK A;  2K9N A;  1Z0X A;  2M8G X;  1JKR C;  2XGE A;  2E1O A;  2HI3 A;  1MSE C;  2O7O A;  4B3A A;  2HDD A;  3CMY A;  5DTD A;  1P7I A;  5EYR A;  2MSY A;  2X48 A;  1YRN A;  1TWH J;  3JRC A;  4JX4 A;  3QPL A;  2VI6 A;  1UMQ A;  2YU9 J;  4QIW N;  1FEX A;  3HEF A;  3HOU J;  3JR9 A;  2CUF A;  4DYR A;  1BW6 A;  1PUF B;  1OCT C;  1Y1W J;  5JLW A;  1ETO A;  1A5J A;  3S17 J;  9ANT A;  4V2F A;  3CCY A;  1MBH A;  1ZK8 A;  3O8H A;  1K83 J;  4MIM A;  1FIA A;  2HXI A;  2LR8 A;  1Z77 A;  4BY1 J;  1B8I B;  3LSG A;  1ENH A;  3WHC A;  4FCY A;  3PM1 A;  2DMQ A;  1WI3 A;  1S7E A;  4XRM A;  4DYQ A;  1UHS A;  4CYC A;  1ZR2 A;  5J1Y A;  3G1M A;  2NOG A;  3RQI A;  5M5X J;  1ITY A;  4BBR J;  5K7F A;  2EZH A;  4RBO A;  2O9L A;  4GFB A;  3ZQG A;  2D5V A;  4A3L J;  5F04 A;  5F27 A;  3Q0W A;  1NK2 P;  1BW5 A;  1YRN B;  5IYB J;  3HOW J;  2YUS A;  3MVP A;  2LVS A;  3HGG A;  1JKO C;  4BKX A;  1HDD C;  3HOY J;  4BY7 J;  1MSF C;  1MH3 A;  5EG0 A;  3JRA A;  4AC0 A;  4A3F J;  2L0K A;  2OPT A;  1RKW A;  4XRS A;  2ME0 A;  5EZG A;  1MNM C;  1U78 A;  1IJW C;  3W6V A;  3BR3 A;  2Y0S N;  3B6A A;  4FTH A;  2HXO A;  2TCT A;  3S1R J;  3BG3 A;  2EH3 A;  4UUT A;  1FTZ A;  3OSF A;  1MBE A;  1U9N A;  1JT0 A;  2JN6 A;  4DW6 A;  1AHD P;  4XID A;  5FKM A;  1W0U A;  5DS9 A;  2JJ7 A;  5J3L A;  1LFU P;  1JKP C;  3OSG A;  1GDT A;  3SJM A;  1EF4 A;  2CQX A;  1RPW A;  1TWA J;  1HOM A;  5E3M A;  4MFE A;  2K40 A;  2M34 A;  1ETX A;  4MLO A;  4D7N A;  3DEW A;  2KT0 A;  1JUP A;  3S15 J;  3BR5 A;  2MGQ A;  3B6C A;  4FE7 A;  3BR1 A;  1P7J A;  4A3K J;  1B72 A;  1BA5 A;  1JUS A;  2L7Z A;  5J1R A;  4FE4 A;  1PUF A;  1FTT A;  5EG0 B;  2LP0 A;  2LFB A;  3Q0U A;  3E7L A;  5BNG A;  2JA6 J;  4QTR A;  1SFO J;  1ETV A;  5F0H A;  2HQ5 A;  2M9H A;  1JTX A;  4A3J J;  1IDZ A;  2L7M P;  3NAR A;  1D5Y A;  2NVT J;  3A02 A;  2NS7 A;  4B1R A;  4IHX A;  2DJN A;  5E3L A;  5C4X J;  2HOT A;  2EZL A;  4ABZ A;  3G1O A;  3HGY A;  4LOC A;  2PMZ N;  4AUX A;  1GT0 C;  1X2N A;  3IV5 A;  2ID3 A;  5IYD J;  2K9Q A;  3ZQC A;  4AYB N;  2ELK A;  1K61 A;  3CDL A;  2YS9 A;  3WHB A;  1JTY A;  1H88 C;  2G0E A;  4XRS G;  3LSP A;  1QVU A;  1QPI A;  2EBI A;  1JT6 A;  2E2H J;  1TWG J;  3PO2 J;  1B72 B;  5JLX A;  2DMU A;  3S2D J;  5IP7 J;  2JMW A;  1CQT A;  3QQA A;  1JGG A;  3JRF A;  1ETW A;  4FIS A;  2LY9 A;  1AKH A;  5M5W J;  3VPR A;  3HKZ N;  2M0C A;  5EEA A;  2ID6 A;  2VKV A;  1JJ8 C;  2QCO A;  1BL0 A;  4QSH A;  2W48 A;  1T33 A;  3JRI A;  1WGX A;  2TRT A;  1I50 J;  3BR2 A;  3K7A J;  3H3V K;  1ETK A;  2FQ4 A;  3I4N J;  3S1N J;  1RET A;  2WV1 A;  2JWT A;  4A69 C;  3UKG A;  2MW8 A;  2AO9 A;  2RAE A;  3BTL A;  2XPU A;  4UUS A;  2H1K A;  2E19 A;  1ZKG A;  1JUM A;  3JRD A;  3Q0V A;  3GBG A;  5F0C A;  2EZK A;  4NDL A;  2Y2Z A;  2Y31 A;  1JJ6 C;  2COB A;  2H8R A;  2FJ1 A;  5FKL A;  3BG9 A;  4V2G A;  4X6A J;  3TED A;  3TP3 A;  2VUM J;  3RZO J;  1IUF A;  3A03 A;  2IEK A;  2GM4 A;  3PO3 J;  2LD5 A;  1QRY A;  1WH5 A;  2NVQ J;  1ETQ A;  4IHY A;  1I6H J;  1QVT A;  2HOS A;  3D1N I;  1VFC A;  1AKH B;  1ZGW A;  3BT9 A;  3GTP J;  4W1U A;  1I3Q J;  1W0T A;  1AU7 A;  3QPS A;  3GTJ J;  1WCM J;  3ZQL A;  5FLM J;  3S2H J;  3TP0 A;  3IH4 A;  2L9R A;  1MBG A;  2DA2 A;  2I10 A;  3FIS A;  2DTZ A;  4G12 A;  1MBK A;  3O8G A;  5GP9 A;  2HYJ A;  1NTC A;  2JA5 J;  2DA5 A;  4UUS B;  5F08 A;  3ZQI A;  3S1M J;  4A3G J;  3LSR A;  1IGN A;  3S14 J;  3ZQH A;  3BTI A;  5EZH A;  3SFI A;  1IDY A;  2MG4 A;  3ZOB A;  2DA3 A;  3LNQ A; 
#chains in the Genus database with same CATH topology
 5KK1 A;  2GXA A;  3DF8 A;  4HNV A;  2HS5 A;  2VPL A;  3OYL A;  1HLV A;  2R4G A;  2X85 A;  3TW6 A;  1A6I A;  3ZGK A;  4RM2 A;  2R5Z B;  1HC8 A;  4CHU A;  2OD5 A;  4D5C A;  5K7Z A;  2F6C A;  3W3C A;  2O03 A;  3CDI A;  3OYI A;  3D5L A;  3RPU D;  4EJT A;  4Y52 J;  2E2J J;  2Y0M A;  2VC0 A;  4NNJ A;  1R23 A;  2XSD C;  3OYC A;  3RSN A;  1O3T A;  2VQH A;  3E3V A;  1YHQ I;  3TW7 A;  4G8X A;  2Z99 A;  2CQQ A;  2IGN A;  1B9N A;  5IYC J;  4G6Q A;  1STZ A;  2O0Y A;  2XB0 X;  1LDD A;  2K02 A;  2A3S A;  1DGR M;  1U5T C;  4X1E A;  2F5V A;  1YS7 A;  3VSK A;  3HPG A;  3Q3S A;  5FRO A;  4BJT A;  4UY8 I;  3M3Y J;  2DDA A;  1O3Q A;  3BPX A;  1P9Q C;  2Y30 A;  4HW0 A;  4W97 A;  2PFB A;  4CGZ A;  5L3E A;  1W5C C;  3I71 A;  5D4R A;  2G7U A;  2HWV A;  3NAU A;  2HYF A;  2PEX A;  2XHK A;  1ZGJ A;  2BY3 A;  1FOY A;  2M8E A;  3PIP F;  1UHM A;  1QHG A;  1R5H A;  3QPT A;  4LLL A;  3K4B A;  2QQ9 A;  3I59 A;  1NH3 A;  5E79 C;  3M1E A;  1WRJ A;  5HNF A;  5JFR A;  1TC3 C;  1XMK A;  2FX0 A;  4CDG A;  1IV6 A;  2M5W A;  3GFJ A;  3BTC A;  3ML6 A;  1RKT A;  5E8G A;  2ECC A;  2ZME C;  2WY8 Q;  4ON0 A;  3RKQ A;  2JA8 J;  2WAQ N;  2LC2 A;  3ZN0 A;  1SVL A;  3OY9 A;  4KA4 A;  4K2E A;  3KZI C;  4A3I J;  2E1N A;  3EYY A;  2E7W A;  3BG5 A;  1POG A;  1K78 B;  3DQV C;  1P4W A;  2BE5 F;  1Z7U A;  1GV5 A;  1OFC X;  1SD7 A;  2NNY A;  3ZQF A;  2XAG A;  2XGC A;  3A0H C;  1H0M A;  2QF7 A;  2ME6 A;  3A01 B;  1D1C A;  1MDM B;  4OMY A;  2DK5 A;  2DCE A;  4S04 A;  3TDZ C;  5K7H A;  3F8F A;  5B1B H;  3CCU I;  1ZQ3 P;  2V1N A;  2ZNY A;  2LSO A;  1YLF A;  2XGX A;  3J7Z I;  2JK3 A;  3ELK A;  2RNG A;  5FRM A;  1ODD A;  4KIF A;  2M4K A;  3EQL F;  3K9T A;  5E20 A;  4MGR A;  2R5Z A;  2CQ7 A;  2M45 A;  4JOM A;  2LMD A;  4BE0 A;  2UV1 A;  2XV4 S;  4YIF A;  1RC9 A;  4HOB A;  2L9V A;  3HSR A;  5D5X B;  1KU3 A;  2OCC H;  3MKY B;  2IRF G;  3SDB A;  3FK6 A;  3LST A;  2OA4 A;  4PUS A;  1WKM A;  3KZY A;  1IUY A;  2KMU A;  2VPR A;  4E7L A;  2JPB A;  4XLA A;  5GTH C;  5DCM B;  1XMX A;  3FK7 A;  2FML A;  1F9N A;  4EEF G;  4AD9 A;  2V1X A;  5L3F A;  1Y56 A;  4E7J A;  3RTR A;  1QNT A;  1XGO A;  4CA0 A;  2BYV E;  3OR2 C;  2Q1Z B;  2V79 A;  4U0V A;  5KVR A;  3OYE A;  3L1P A;  3FMQ A;  3HB9 A;  3KEO A;  3SZT A;  4RB1 A;  1KA8 A;  3DU5 A;  2R0Q C;  3SYT A;  5C3E J;  3CCR I;  5FB2 A;  1YI2 I;  5B3S H;  1TWC J;  5FKK A;  2N8G A;  1GHC A;  1KU9 A;  3RKW A;  1VQL I;  1TP4 A;  4KFC A;  2VBW A;  1E3H A;  2HVS A;  4EV0 A;  5FLV A;  2W84 A;  2DPD A;  3F22 A;  2DA1 A;  3FWE A;  4M71 A;  2KIU A;  1IC8 A;  3C3W A;  1SVO A;  1Q1H A;  3BG6 A;  2LOO A;  2AQF A;  4F7Z A;  2F4O B;  1RNL A;  5FJ8 J;  4D7M A;  3S2W A;  4M3B A;  1W36 C;  1BI0 A;  3R0A A;  1SEU A;  3H0G J;  3BR0 A;  4BQO A;  4C9Y A;  3HKZ A;  3K10 A;  3M07 A;  3JTH A;  2EQR A;  5E8I A;  5H6R A;  3WTY C;  2XPV A;  2X6O A;  1FJL A;  1FMV A;  1U9O A;  3A01 A;  3AG3 H;  3J80 Z;  5ICE A;  4NQW B;  1DDN A;  1GV2 A;  4UVC A;  1D1A A;  5GPC A;  1R71 A;  3PJR A;  3PSI A;  1Q1V A;  3G1L A;  1B8I A;  3CCQ I;  2IAI A;  1DUX C;  1QA6 A;  1XPX A;  4Y7N J;  1SAN A;  2RQQ A;  1V3F A;  1Z0X A;  4II2 A;  3WGI A;  3FXM A;  1PDN C;  3P9I A;  1S9H A;  3CUQ B;  2E1O A;  4HZF A;  3KYL A;  1J5Y A;  3G2B A;  1IRX A;  3K6G A;  3CMY A;  5A2Q K;  4WXD A;  2IA2 A;  4C2U A;  4MEY F;  2EV5 A;  4JX4 A;  4N4N B;  1K4T A;  3QPL A;  2VI6 A;  4RGU A;  3AG1 H;  2B7E A;  3L09 A;  1U8R A;  2VAS A;  1VQ7 I;  4NC6 A;  3C1D A;  4ANJ A;  1O57 A;  1BW6 A;  4OIR F;  1PUF B;  4OU0 A;  1ETO A;  1A5J A;  1N78 A;  2M4G A;  5H20 A;  3VYR B;  4HDV A;  1XDS A;  1ZK8 A;  3F23 A;  2FRH A;  3FX3 A;  3CCE I;  4MIM A;  4KMF A;  3FF5 A;  4P55 A;  5KAI C;  1QBJ A;  4BY1 J;  3CJR B;  1ENH A;  3GZN B;  1XGS A;  4KDP A;  1LVA A;  2EFO A;  3ZP5 A;  2DYR H;  4CUG A;  4FQG A;  4XRM A;  2EIJ H;  1A36 A;  3LL7 A;  3MZ8 A;  1Z6T A;  1AA7 A;  1ZR2 A;  3CP2 A;  2VLA A;  1P4X A;  3JW4 A;  3VEP A;  3BPV A;  3AL0 C;  4HX4 A;  5M5X J;  3VSL A;  3RPU A;  1YTY A;  2M1B A;  2AXT C;  4BBR J;  4RBO A;  4GFB A;  2DFF A;  4L5I A;  5F04 A;  2HGC A;  4BNC A;  3DTE A;  3I3L A;  3MEX A;  4JK1 X;  4I7H A;  2HQR A;  2CGP A;  1Y8R B;  2EIK H;  1JKO C;  1LDK B;  3HOY J;  2H6C A;  2M87 A;  4ZTJ A;  1TBX A;  4D0P A;  2V4J C;  4XRS A;  2ME0 A;  2QSF X;  1ZAR A;  2VXZ A;  3W6V A;  3WE2 A;  5FLX Z;  3TBI A;  3R6S A;  4CCK A;  3WTX C;  4UUT A;  2X6W A;  2IP2 A;  3V8J A;  1AHD P;  2K4B A;  3HPH A;  2PI0 A;  5J47 A;  1W0U A;  2QKL B;  2DXI A;  3Q5F A;  4H4K C;  1FLI A;  3HIF A;  4E7I A;  3I0T A;  1G4D A;  1ULY A;  2PMH A;  1K79 A;  4IOC F;  1T39 A;  4AYB A;  2CQX A;  4M73 A;  4MLO A;  2IGO A;  4OAY A;  1QPM A;  4HEA 2;  3DEW A;  3HL2 A;  3A1Y A;  4RAF A;  1JUP A;  3BR5 A;  1MJB A;  3UNG C;  2QSH X;  3SEQ A;  2YSR A;  4F91 B;  4V19 K;  2LF8 A;  3CTA A;  4XLN F;  1P7J A;  2JQ7 A;  2LF7 A;  1KON A;  3L2Q A;  4DIQ A;  4FE4 A;  1PUF A;  2ELJ A;  4YFX F;  1W4M A;  1BC8 C;  5BNG A;  4ITV A;  3A4C A;  4XBF A;  3OR1 C;  1RR8 C;  1D8K A;  3H9G A;  1DP7 P;  3JTG A;  4DBR A;  3S3N A;  4KN7 X;  3RCO A;  3ZQQ A;  5D6E A;  3EUA A;  3BY6 A;  2HKX A;  1H9T A;  3CUO A;  1KQ0 A;  2VJI A;  4PSW A;  1D5Y A;  3L7W A;  5FD6 A;  3MKZ A;  2NVT J;  3DXJ F;  2BY1 A;  3KYC B;  2YX7 A;  1DGW Y;  4Q48 A;  4B1R A;  4EVI A;  4IHX A;  4XLF A;  4XM3 A;  3BZK A;  4PZJ A;  2QBY B;  1BJA A;  3LMM A;  1XMA A;  1S5L C;  1T0F C;  3R60 A;  1LJ9 A;  5GAG J;  1HKS A;  1H88 C;  1QPI A;  2E2H J;  2ZBK A;  3TO9 A;  2R7O A;  1SFX A;  3PIO F;  4PJL A;  3S2D J;  2VT2 A;  1YE9 A;  1XGN A;  1KQ8 A;  3ZMT A;  2FEZ A;  3H5R A;  4BUP A;  3QQA A;  3HKZ N;  3RKY A;  4MNU A;  4JBA A;  3I56 I;  1Z1D A;  2MD0 A;  2WV0 A;  2R7R A;  2P0W A;  2W48 A;  1BL0 A;  1IXC A;  3CF2 A;  2TRT A;  2L54 A;  5ICF A;  4CZC A;  2FQ3 A;  1O3R A;  1FOW A;  2K5C A;  3ESW B;  2MLK A;  1RET A;  2JWT A;  3UKG A;  2E71 A;  2LYC A;  3E6B A;  4EJO A;  1HBX G;  5DUI A;  1YX3 A;  4UUS A;  2H1K A;  2ZXH A;  2HKO A;  5CVV A;  1DQU A;  4UVA A;  2A61 A;  4XOT A;  2LRE A;  3QYE A;  5F0C A;  3GF2 A;  1JJ6 C;  4NC7 A;  2COB A;  3WG9 A;  1R22 A;  5DM7 F;  3BG9 A;  2VQC A;  1FBS A;  4ENJ A;  3GZ5 A;  3KE2 A;  3TP3 A;  3CES A;  5E1X A;  2VUM J;  2HTJ A;  2CG4 A;  3V42 A;  3OYJ A;  1FOK A;  1OR7 C;  1ONV A;  2LD5 A;  1QRY A;  2XKO A;  5BS6 A;  2EFW A;  1TTY A;  2LNB A;  2UXN A;  3IRQ A;  1Y6I A;  2CFO A;  2O5R A;  3M8E A;  4J01 A;  2K27 A;  2HOS A;  3D1N I;  2BOL A;  3SZG A;  3OYM A;  1VQ5 I;  1USS A;  2ZO4 A;  2W25 A;  3LWF A;  5HS7 A;  4EJW A;  1J75 A;  1I3Q J;  4P1W A;  4F3Q A;  1WCM J;  3LSI A;  2P5K A;  1BBY A;  1W36 D;  1IN4 A;  1AOY A;  2E60 A;  1SD6 A;  4UB8 C;  3CP8 A;  4G12 A;  1JXS A;  2PX9 A;  3E5X A;  2P7V B;  3H5A A;  2DFH A;  3S1M J;  2PJR A;  4A3G J;  2OV7 A;  3EET A;  5GAH J;  1IGN A;  3S14 J;  3ZQH A;  1FYL A;  2R7X A;  5EZH A;  1HQC A;  4ASN A;  3ZOB A;  1XD7 A;  1F4K A;  1YIJ I;  3IP4 B;  4RB3 C;  2OJE D;  3ECO A;  2CMP A;  4X0G A;  2NVY J;  4KN4 X;  3L2V A;  1G3Y A;  4DYC A;  1V5E A;  4KIC A;  1OCP A;  1S7A A;  5K5O A;  2P4W A;  4WCG A;  3GW2 A;  2IXS A;  3PSF A;  4DNC A;  5ICC A;  2OC6 A;  1P92 A;  4FX0 A;  2WAQ A;  2B63 J;  2RN7 A;  4I76 A;  2Y9Z A;  2O8X A;  5J8F A;  1GUU A;  4UUV A;  3MZY A;  4CCJ A;  3C2B A;  4C3J J;  1SAU A;  3JRE A;  5DM6 F;  1R1T A;  1SFU A;  4IHV A;  5E3O A;  1XS9 A;  5KNL A;  4JP0 A;  2IVM A;  1U2W A;  1YOV B;  1B9M A;  1LUJ B;  2P5V A;  1KYZ A;  4GYI A;  3H9J A;  2CUZ A;  2AS5 F;  1L3L A;  3CJT B;  3NRV A;  1MMS A;  1X1D A;  1MD0 A;  2PLY A;  1D0X A;  2KRF A;  3ABK H;  5B66 C;  1OKR A;  3DKW A;  3FXJ A;  1DU0 A;  3DLA A;  1A04 A;  1OPC A;  3GLX A;  3WU2 C;  2OBP A;  3HC7 A;  4XIC A;  4ENK A;  1N77 A;  1LE8 A;  1R9T J;  5EEG A;  2X1C A;  2MH9 A;  1H9G A;  2LKP A;  4L18 B;  4B47 A;  2EV6 A;  5IOZ A;  1WH7 A;  2Y9Y A;  3HRM A;  2W85 A;  2R5Y A;  3K70 C;  1OYY A;  3PUB A;  3WGG A;  2M2E A;  4CXF A;  3W6J B;  2HZT A;  2E2I J;  3JRB A;  5IY5 H;  2NS8 A;  4KYW A;  3BTJ A;  2XB5 A;  2OQR A;  1T56 A;  1ZR4 A;  1VQO I;  2LTP A;  5JVG F;  2DMN A;  3LA3 A;  1R49 A;  2LDU A;  3GO5 A;  3HRT A;  3F6O A;  2VON A;  1ZTR A;  4B43 A;  1MH4 A;  1ORK A;  1X19 A;  3BLY A;  2CUE A;  2DOF A;  2ZXW H;  3ZN1 A;  4IQJ A;  2UUZ A;  2EFQ A;  1U6G A;  2HDW A;  4GRI A;  4LFU A;  1FBQ A;  4N9I A;  1BR1 A;  3G71 I;  5L3G A;  1H89 C;  4AIH A;  1TW3 A;  4TV7 A;  1XTA A;  2KJB A;  1R7J A;  2I5U A;  3Q9V A;  1S7O A;  3HUG A;  4M3G A;  5GAE J;  3DCF A;  3SXY A;  1W7P D;  1WJC A;  2IPQ X;  5GAD J;  2JUC A;  1V55 H;  2E34 A;  3BJA A;  3CC4 I;  2XF7 A;  4OOI A;  5DYM A;  2HYG D;  3I59 B;  2DT5 A;  3HBL A;  3ABL H;  3M7G A;  2X0L A;  4M6X A;  4E70 A;  4BU2 A;  1KU2 A;  4M3F A;  5F0F A;  2QZ8 A;  1W5S A;  3DPU A;  2GWR A;  5ILV A;  4BHC A;  2Y48 A;  3CME I;  1Z67 A;  3F0C A;  2QQ8 A;  3S8P A;  3MQ0 A;  4A0Z A;  4O3M A;  5CPR B;  1D1B A;  2KZV A;  3BRO A;  2K9S A;  3JRG A;  1O4X A;  5E18 F;  2GOM A;  1BN5 A;  3PUF A;  2XC7 A;  3J81 Z;  1MBJ A;  1JKQ C;  1R5G A;  2VIX A;  3FKI J;  2IW5 A;  4M74 A;  2LK2 A;  1X3U A;  2FD5 A;  3VDX A;  1IN6 A;  2Z9O A;  5ICG A;  4E6K G;  3GXO A;  1UCR A;  1EH6 A;  1R6R A;  1G8X A;  2GIZ A;  2PMU A;  5F6F A;  2JA2 A;  5IOY A;  3GWZ A;  4XK4 A;  4CYC B;  3JAM Z;  1UFM A;  1LQ1 A;  1BI2 A;  3NEU A;  3O3K A;  1S72 I;  2BBY A;  1Z91 A;  4FX4 A;  3FXL A;  1Z6R A;  5EDN A;  4YEJ A;  1IRF A;  3COA C;  1OCC H;  2UXX A;  5B1A H;  2MC3 A;  4PGH A;  4EQQ A;  5JHU A;  3RZD J;  4A3C J;  2DYS H;  4A93 J;  2KIS A;  4IZZ A;  2VJ4 A;  4A5N A;  3BR6 A;  1VND A;  1D5V A;  2PG4 A;  1J2X A;  4HAM A;  3GTG J;  4ZDO A;  4BHB A;  3L2R A;  3OIP A;  3IH3 A;  5J1U A;  3GTQ J;  4QWQ A;  2L7F P;  4A3E J;  2EZI A;  1WWX A;  1F43 A;  1MBF A;  2VB6 A;  2VKH A;  3H35 A;  2VKE A;  5GPA A;  4ENM A;  2GXB A;  1TW2 A;  1R58 A;  4HNU A;  2K9N A;  4GO1 A;  4JYK A;  3FHZ A;  2V9V A;  3ABU A;  2M8G X;  2ZC2 A;  1PP8 F;  2DPU A;  2UZK A;  2CH0 A;  4DOZ A;  1Z9C A;  1ZRD A;  2HI3 A;  1MSE C;  2O7O A;  4B3A A;  4Y3O A;  1DPU A;  2QLZ A;  2LRD A;  4HX8 A;  2MSY A;  4GGG A;  2A68 F;  1YRN A;  3BC8 A;  1KQ9 A;  3JRC A;  2ZJQ F;  2DT6 A;  3K4K A;  2WAF A;  2DOA A;  4RGS A;  2FBI A;  4BDY A;  3HEF A;  4OAZ A;  1BC7 C;  3HOU J;  5CQE A;  3H0D A;  4U88 A;  1R1U A;  3C2G A;  2IGK A;  2JVH A;  1FP1 D;  2QVO A;  2CV2 A;  5JI6 A;  4DYR A;  2OUM A;  4IHS A;  1SD5 A;  4BEH A;  4BAY A;  4KJZ A;  1Y1W J;  1OCT C;  2DQR A;  3BZ6 A;  4R1H A;  4HNT A;  1S29 A;  4FT8 A;  2IS4 A;  3EYI A;  2IGM A;  4V2F A;  3CCY A;  1MBH A;  4Y15 A;  5CVI A;  1Y0U A;  1OMI A;  1MMA A;  1FIA A;  3QYF A;  1ZG5 A;  1L0O C;  3ASN H;  1W7P B;  2Z3Y A;  3K1P A;  3MFK A;  2VE8 A;  1B8I B;  4PJN A;  3LSG A;  3OV8 A;  4Z2Y A;  1VQN I;  3PM1 A;  2DMQ A;  3K4N A;  1S7E A;  3V7S A;  4CSW A;  4CYC A;  2LKS A;  3C2H A;  2F5D A;  3KYD B;  2ZSI B;  5J1Y A;  4YFN F;  3RQI A;  2F5F A;  2ZJP F;  2JRM A;  1ITY A;  1WVR A;  1HST A;  2V26 A;  2DLL A;  2P6T A;  2EZH A;  2O9L A;  1X1C A;  3EDP A;  4A3L J;  3N97 A;  5LGU A;  5IYB J;  4PFO A;  2HNH A;  3HGG A;  1PP7 U;  3G73 A;  4XKB A;  3OS0 A;  1SC7 A;  5HLI A;  1HDD C;  4BE2 A;  1MH3 A;  1R5I D;  5EG0 A;  1UST A;  3JRA A;  3BJO A;  3I9V 2;  1RKW A;  1YJW I;  1J09 A;  3IWZ A;  4I0B A;  1IJW C;  3ULQ B;  1N75 A;  1C0W A;  2Y0S N;  1MZB A;  2Y69 H;  4FTH A;  1TT5 B;  3BG3 A;  1VQ8 I;  3B02 A;  4GYG A;  3CF5 F;  3OS1 A;  3FZV A;  4XLH A;  1XDU A;  2M30 A;  2ZXJ A;  1JT0 A;  3F8C A;  4MHG A;  4XID A;  1B59 A;  4BS9 A;  5DS9 A;  2H94 A;  3DBH B;  1LKX A;  1OCR H;  3OYK A;  1BIB A;  4XLC A;  1WJF A;  3SJM A;  3MMY B;  2E1M C;  3HTU A;  3KEY A;  1FNN A;  4MFE A;  4Q5S F;  2M34 A;  1ETX A;  1XSD A;  2WTE A;  4UNO A;  1TQP A;  2VOD A;  2KT0 A;  2I8D A;  2MGQ A;  1QO0 D;  2B9S A;  2ZFU A;  1HA8 A;  2F4I A;  1B72 A;  1BA5 A;  3KFW X;  2H8W A;  5J1R A;  3K70 D;  4CIC A;  4GXO A;  2E1C A;  3E7L A;  4XNF A;  2QM3 A;  4YEL A;  5HS8 A;  4HF0 A;  2HU9 A;  4QTR A;  1SFO J;  3PFI A;  3AG2 H;  1YYV A;  1R4N B;  4ZYH A;  1OYW A;  3KP3 A;  2M9H A;  1W7P A;  3HZJ A;  3TO7 A;  4B3X A;  2HZD A;  1BR4 A;  3KP4 A;  4EJU A;  4E7Z A;  4KIG A;  1XX5 A;  1IDZ A;  1YIO A;  3KLO A;  3NAR A;  4ZDP A;  4AU7 A;  4HX7 A;  3I53 A;  3A02 A;  4BYY A;  3C18 A;  2LG4 A;  2DJN A;  4AVZ A;  3HGY A;  1GXQ A;  5LEK A;  4AUX A;  1SMY F;  1A6Q A;  2QWW A;  1IAW A;  1OCO H;  2BXZ A;  2O61 A;  4XLE A;  3QOD A;  2Z1D A;  1WJD A;  2XRN A;  3ZQC A;  1MW7 A;  2DI3 A;  3C7J A;  2F48 A;  3CDL A;  3FM3 A;  1Z3Y A;  3WHB A;  4A6D A;  3B73 A;  4D9J A;  2G0E A;  5BPD A;  2D45 A;  1CF7 B;  2NAZ A;  3FXK A;  5CJ9 A;  1MGT A;  3X2Q H;  1TQI A;  4WXC A;  3DKY A;  4ENN A;  2HPM A;  2NOJ B;  1KGS A;  3OL3 A;  3LAJ A;  3OYD A;  3JRF A;  1ETW A;  2LY9 A;  4E4H A;  1AKH A;  2KQR A;  4U7D A;  4F52 A;  1K6Y A;  4DQ2 A;  2ID6 A;  4L9N A;  4DBQ A;  4XMY A;  1LDJ A;  1JJ8 C;  1YJ9 I;  2QCO A;  4MQV A;  4RAG A;  4Y17 A;  2K86 A;  1T33 A;  3ZMV A;  1E2X A;  3K7A J;  1DPR A;  1I6X A;  1X1A A;  1X1B A;  1ETK A;  4N4O B;  2CFX A;  5LLQ A;  2GA1 A;  4Y4R A;  2FQ4 A;  1TZL A;  3CCS I;  2WV1 A;  4A69 C;  3S1N J;  3E6D A;  2MW8 A;  1O7L A;  2AO9 A;  3BTL A;  3E5U A;  3SQN A;  3F21 A;  2RRE A;  1FBU A;  5HDK A;  5D5V B;  2ISZ A;  4EMS A;  2JZY A;  4UV9 A;  3K4M A;  4NDL A;  1T0F A;  2FJ1 A;  3WOD F;  3T8T A;  4X6A J;  3TL4 X;  1IV8 A;  3WE3 A;  3TED A;  2R3S A;  3KX2 A;  4XQF A;  2W00 A;  4HLX A;  3W2W A;  1UHW A;  4MQ9 F;  4BGD A;  3ZMZ A;  4I99 C;  4EGZ A;  3D0S A;  2EA2 A;  4RAY A;  2H09 A;  2L2O A;  4M9S A;  2K4J A;  2D2W A;  1IN7 A;  1W1W E;  5J4V A;  1WH5 A;  2Z2S B;  3ABT A;  1FYK A;  1I5Z A;  1ETQ A;  3TOA A;  3AKZ A;  2EV0 A;  1QVT A;  4EJV A;  2W1O A;  3LSK A;  1TL8 A;  3W2A A;  4G7H F;  1T38 A;  1ZLJ A;  2DK8 A;  3GTJ J;  2LY1 A;  3ZQL A;  4IRH A;  3S2H J;  3TP0 A;  2L9R A;  2I10 A;  4A0X A;  3FIS A;  3RQ4 A;  1IRG A;  3O8G A;  2JA5 J;  1YW8 A;  1B1B A;  1F1Z A;  1FX7 A;  4UUS B;  5LD2 C;  4BQQ A;  3ZQI A;  3LSR A;  3BTI A;  4LLN A;  2EWN A;  3SFI A;  1FMW A;  4FAS D;  5LGN A;  1G3W A;  3N4M A;  3P9K A;  3F6V A;  3A2K A;  4A3M J;  1CF7 A;  3OIO A;  1Y1V J;  3CDH A;  5IP9 J;  3K0L A;  1BJZ A;  3W6K B;  2NNN A;  1OR7 A;  3DBR B;  1TWF J;  3GTL J;  1DP3 A;  2O3F A;  4CCL A;  2LKX A;  1LFB A;  1K6O A;  2ETH A;  1IXR C;  2CU7 A;  1LEA A;  3WTU C;  2R7U A;  2F5C A;  4RAZ A;  3ZQ7 A;  1PJR A;  1DU6 A;  2ADU A;  3TKY A;  4A3D J;  3OYA A;  4LIV A;  2VE9 A;  1VQM I;  5C44 J;  3GUD A;  4XOP A;  2X51 A;  3S1Q J;  1LFP A;  1T98 A;  1OJL A;  1XG1 A;  5JVT A;  5LHH A;  2VBY A;  1D3Y A;  1ZYR F;  2HTS A;  2A5Y B;  2KJC A;  3DP7 A;  3LSH A;  3CMA I;  3ERE D;  4XRF A;  2KDZ A;  4I6Z A;  2PJR B;  3CJN A;  4XN0 A;  3VWB A;  2DDB A;  5FKN A;  5M3M J;  5EF6 A;  2BZT A;  2FE3 A;  2L9S A;  1V5F A;  3ONQ A;  3KP6 A;  1BI1 A;  5L3D A;  1BI3 A;  1TNT A;  4YIR X;  4A0Y A;  2V1D A;  2Q2E B;  3CQZ J;  3CJQ B;  3SEZ A;  5AIQ A;  4IF4 A;  2GQQ A;  3M8J A;  1XC5 A;  1NHA A;  1EKE A;  4L0Y B;  5EEH A;  3HSE A;  3GTK J;  4KT6 A;  5ILS A;  4ZYD A;  2FMY A;  2OAZ A;  1P4A A;  3CC2 I;  4ZZD A;  2WB1 N;  4Y33 A;  2DJI A;  2ZSH B;  4RM3 A;  1IO2 A;  3MWM A;  2M0M A;  4MTD A;  3FIW A;  3TQN A;  2DA7 A;  4KUM A;  2EJR A;  3DFG A;  5DDG A;  3VB2 A;  2W57 A;  2F4M B;  2LLK A;  5E3N A;  3K4C A;  4C3I J;  1X4O A;  3CLQ A;  1QU3 A;  3HOT A;  3A0B C;  3HRS A;  3LSM A;  4LJZ F;  1LE8 B;  2W4S A;  3LA7 A;  2Q0O A;  1UAA A;  3NWT A;  4ZDL A;  5IT3 A;  1H8A C;  5AON A;  2R7Z J;  1BOB A;  3HRU A;  4QLC U;  3BOQ A;  2R5Y B;  2NVU B;  3CUQ C;  4J19 A;  2ZFW A;  3H9Q A;  3I54 A;  2NVX J;  3DTK A;  2PQ8 A;  3KEQ A;  4LIU A;  1MMN A;  1E3O C;  4BXX J;  1HW5 A;  3F9K A;  4BJ5 C;  2DMT A;  4NHJ A;  1QZZ A;  2EIM H;  3BJ6 A;  1ZGA A;  2R93 J;  4RDU A;  2CJJ A;  1IZ1 A;  4EM2 A;  2L5Q A;  3CO6 C;  4HRI A;  4JX5 A;  2UWM A;  2DU9 A;  5F1R A;  1HCR A;  2F5E A;  3E5Q A;  4R79 A;  2DA6 A;  4G7O F;  5EGO A;  1U3E M;  2MYS A;  2EIL H;  4E7H A;  1B6A A;  5K5R A;  2MC4 A;  2CO5 A;  2FNA A;  4B4C A;  4CCN A;  5E17 F;  1U5T B;  3WGH A;  1IXS B;  4BL0 B;  4M3D A;  5M5Y J;  4M6Y A;  3MN2 A;  4HF1 A;  4ESB A;  4Z6Y A;  5F1J A;  1V4R A;  1IRZ A;  1FC3 A;  5IP6 A;  1UG2 A;  2V7F A;  3HUG B;  5K5Q A;  1IG7 A;  4DJA A;  1X3Z B;  2O8K A;  3E97 A;  3TO6 A;  3HDD A;  2H1L A;  2PMZ A;  2KPM A;  2Q2E A;  2ZJ2 A;  2VQL A;  1R00 A;  4U0Y A;  1HW2 A;  3J80 K;  1ZLK A;  5DCF A;  1XSV A;  2KHM A;  1Z7L A;  3QU3 A;  1KYW A;  2ECB A;  2RVC A;  2YX4 A;  2ZME B;  2C6Y A;  2OTJ I;  3CMM A;  3WG7 H;  4IQ4 A;  2E5Z A;  5TIS C;  3MKW B;  2KIQ A;  3KP7 A;  3P7N A;  4PGG A;  1G2H A;  2K9L A;  3T8R A;  2VJJ A;  3S32 A;  3CC7 I;  3IKT A;  1J0R A;  3V4G A;  5DD8 A;  1VQ4 I;  2QEX I;  3ZRG A;  2CQK A;  4UVB A;  2QUF A;  1HF0 A;  1HXD A;  4H0E A;  5HOO A;  2HOA A;  1A35 A;  2GLO A;  4CYD A;  3I4P A;  3F8B A;  3CO7 C;  2DOE A;  4RMN A;  3SDG A;  4DZJ A;  3T0Y A;  3V8K A;  3U2R A;  4ZC3 A;  2FU4 A;  2JSP A;  3S16 J;  4JX6 A;  3QP6 A;  1JKR C;  2XGE A;  2DW4 A;  3OMY A;  5BOX A;  4OIN F;  4AIK A;  1RIO H;  5TGT A;  2EFP A;  3FM5 A;  3I64 A;  2VL8 A;  1E3P A;  1WI9 A;  2WAD A;  4WX9 A;  2X48 A;  2IS1 A;  5FGM A;  5TRD A;  1UMQ A;  2YU9 J;  2CWE A;  4QIW N;  1S3J A;  1FEX A;  1EJ9 A;  4XL9 A;  3ZPL A;  2IA0 A;  3ZMS A;  4HQE A;  2CUF A;  2Y0S A;  2OCE A;  3L00 A;  2RNJ A;  5HLT A;  1UG0 A;  2VN2 A;  3QRF F;  3U1K A;  3OYF A;  5JLW A;  1U5T A;  2VXD A;  3IHU A;  3S17 J;  1U0J A;  3OL4 A;  2L7K A;  1LVK A;  4AIJ A;  3FDY A;  1WFX A;  4B09 A;  1TT0 A;  2D1V A;  3FHN A;  3IL2 A;  1G3T A;  2EPF A;  1Z77 A;  2LR8 A;  2GOX B;  3PL8 A;  3GFI A;  1YFH A;  1QHH D;  3PFY A;  4IRG A;  4ZYG A;  4O5V A;  4EM1 A;  2V6C A;  4DYQ A;  1UHS A;  4C2T A;  4KT5 C;  2PBI A;  3ECH A;  3S93 A;  3VOE A;  2L02 A;  2AXL A;  5K7F A;  2VBZ A;  3DPL C;  5FLX K;  4BAC A;  2ZME A;  4E7K A;  2A69 F;  2G7H A;  5D8K B;  1EV7 A;  3Q0W A;  1PUE E;  1HW1 A;  1HKT A;  4OIO F;  2CQN A;  1YRN B;  3SFZ A;  3GLL A;  3HOW J;  5CVR A;  3MVP A;  4U87 A;  1KZH A;  4RLQ A;  3TMO A;  3QP5 A;  2W24 A;  1VTN C;  2FOK A;  4UXN A;  5HNH A;  1MSF C;  4BXF A;  1Z05 A;  1PYV A;  4A3F J;  3EUH C;  4HPQ A;  3HJE A;  5BMZ A;  3DKX A;  1B4A A;  2MLG A;  1MNM C;  4BEH B;  1ZH5 A;  3MCZ A;  4CO8 A;  3HTS B;  1LNW A;  2A5W A;  1V54 H;  4HV5 A;  1I1G A;  2TCT A;  3S1R J;  2VC1 A;  3ISP A;  2R7T A;  3GME A;  2FXA A;  1VQP I;  2V6E A;  5LEJ A;  2XF6 A;  3OSF A;  1EH8 A;  3F8N A;  1MBE A;  2DFI A;  2JN6 A;  4G94 A;  3L9F A;  1CGP A;  1M1E B;  2JJ7 A;  1ZRC A;  5L3B A;  4CZZ A;  2FBH A;  1JKP C;  2FNP A;  4NBQ A;  1EF4 A;  1SMT A;  3AFH A;  3KCC A;  1X3W B;  4ZH4 F;  1P6R A;  1S6L A;  1TWA J;  5TJJ A;  2XRO A;  3V7R A;  5E3M A;  1W5T A;  2K40 A;  4IVN A;  1T2K A;  2KIM A;  2P5L C;  3ZCO A;  2ZNZ A;  3RPQ A;  5F64 A;  4ZYA A;  3S15 J;  3IKV A;  2P7C B;  2BEO A;  2P6S A;  2DFE A;  3ABM H;  3B6C A;  3RJP A;  1EA3 A;  4FE7 A;  3BR1 A;  3U21 A;  4J00 A;  2HEO A;  3IWF A;  1FWZ A;  3FBI B;  4HQM A;  4A6E A;  1JUS A;  1NG7 A;  1Y39 A;  2E36 A;  2LP0 A;  3Q0U A;  4L9J A;  5EG0 B;  3S3M A;  1GXP A;  4WF2 A;  1WZ2 A;  2BV6 A;  3DV8 A;  1XB4 A;  4LLG F;  4RLF A;  1XGM A;  1OYI A;  4B44 A;  1RRJ A;  1SVM A;  5JHF A;  1ETV A;  4LMY A;  1FZP B;  4I98 B;  4A3J J;  1D0Z A;  2L7M P;  1ACI A;  2M3A A;  2BW3 A;  1MMD A;  4UV8 A;  5KHD A;  1QZY A;  3FKJ A;  2HFH A;  1K4S A;  3AL0 B;  2ZCW A;  5E3L A;  1XN7 A;  2DT7 B;  3L2C A;  2OQG A;  1YJN I;  1K7A A;  3G1O A;  4EM0 B;  3MD2 A;  2CW8 A;  4F93 B;  1FPQ A;  1VQ6 I;  2PMZ N;  1IW7 F;  4GCV A;  4MTE A;  4LG0 A;  3IV5 A;  3OYN A;  5IYD J;  2ZJR F;  2K9Q A;  1XSX A;  1IF1 A;  5DUK A;  2K7L A;  3WTT C;  3DWL E;  1I27 A;  1LPQ A;  3ZXS A;  2STW A;  4XRS G;  3LSP A;  1QVU A;  1ZG3 A;  2EBI A;  1JT6 A;  1MJA A;  1YW9 A;  4WK8 F;  4BDZ A;  5EJC A;  3PNT A;  1TWG J;  3G4S I;  1B72 B;  5JLX A;  2XIG A;  1RI7 A;  3OYG A;  5IT9 Z;  2DMU A;  4XOR A;  1V5G A;  3HYI A;  2V9P A;  5IP7 J;  2RQP A;  2R7D A;  2FOW A;  5KAF C;  2FUG 2;  4FIS A;  3RIR A;  4XON A;  3VPR A;  2M0C A;  5EEA A;  3GX4 X;  1BOA A;  4EGY A;  2RDP A;  2A6T A;  3V8L A;  1P2F A;  3BP8 A;  2GA2 A;  5CVJ A;  1PVE A;  1WGX A;  4MEX F;  3H3V K;  4NB5 A;  3L2U A;  2PN6 A;  5LBQ A;  1WJ5 A;  2RAE A;  2L4M A;  3CZ6 A;  3SHF A;  3GFM A;  1ZKG A;  4WXH A;  2QSG X;  3VYU B;  5CVU A;  2EZK A;  2Y2Z A;  2Y31 A;  1G6N A;  2R7F A;  2V9K A;  4IL6 C;  5LFA A;  3CCM I;  2H8R A;  3OIQ A;  2OU2 A;  1IN5 A;  3HHH A;  4JQF A;  1E17 A;  3MAJ A;  4V2G A;  4EAT A;  4RB0 A;  3E0J B;  3RZO J;  1IUF A;  1SFK A;  4GDF A;  4AM3 A;  3ROU A;  2IEK A;  2CUJ A;  1T8I A;  3UR3 C;  3VOD A;  3PO3 J;  3E1S A;  2KRH A;  2NVQ J;  4D1Q A;  3OS2 A;  2MFZ A;  4IHY A;  3EPZ A;  4ZTF A;  4ZYE A;  2L9N A;  2YPR A;  1AKH B;  4LB5 A;  1F5T A;  3BT9 A;  3GTP J;  3QOE A;  1W0T A;  3QPS A;  3QYB A;  2HQA A;  1YO5 C;  5FLM J;  3IH4 A;  2COM A;  2EFN A;  1MBG A;  2DA2 A;  4AVP A;  2W7N A;  3H36 A;  2DTZ A;  1MBK A;  5GP9 A;  4I09 A;  1NTC A;  4YII A;  2DA5 A;  4RGR A;  2XSJ C;  5F08 A;  5FFZ A;  4L9T A;  1ZG1 A;  1VQK I;  1IDY A;  2MG4 A;  4YRV A;  2CW7 A;  4ZJZ A;  3LNQ A;  3DLL F;  3FMS A;  1YS6 A;  3NWS A;  1HSJ A;  1I3A A;  2LH9 A;  3OOU A;  3I55 I;  4A2U A;  2EA4 A;  2WB1 A;  3QAH A;  4A3B J;  4IHW A;  2JA7 J;  3O6B B;  3AAF A;  5E1Z B;  4E7S A;  4BQA A;  2XAU A;  3K4J A;  4PJM A;  2ACJ A;  3IAM 2;  2XDV A;  1Y0N A;  2M7B A;  1GVD A;  1QZE A;  2VOO A;  3L2W A;  5HOD A;  5GTI C;  2HVQ A;  5DEQ A;  4CCO A;  4OIQ F;  3G6E I;  2VOP A;  2G9W A;  1TLH B;  2KZG A;  1K78 A;  2B0L A;  3GYH X;  1OLT A;  2P8T A;  2A6H F;  1XCB A;  1ON1 A;  3D5S C;  4KMU X;  4KIT B;  1MDM A;  2BY0 A;  1UEL B;  2H6B A;  3ASO H;  1ZN2 A;  1ZAO A;  3BQY A;  3OYB A;  4PK4 A;  2MA3 A;  1FP2 A;  3IRR A;  4IO9 F;  2QYO A;  3GVA A;  4S05 A;  3HSF A;  3KP5 A;  3R0J A;  2MBF A;  5KCM A;  2L01 A;  1MNE A;  2IBD A;  3BG7 A;  1NG6 A;  3OOP A;  2BHZ A;  1F36 A;  4CCM A;  3HOX J;  2KLO A;  1OQY A;  4C3H J;  2LY2 A;  4G6T B;  2JSC A;  3V7C A;  1QGP A;  3QPH A;  3PNV A;  5HS9 A;  6PAX A;  3KZZ A;  1Z3X A;  2KIF A;  2RGV A;  2X1E A;  5DCM A;  5LRR A;  3OWT A;  5LRS A;  3T1B A;  2A07 F;  4A12 A;  4ETS A;  1D8J A;  3ZMU A;  3HOZ J;  1FY7 A;  2X4H A;  2QKM B;  2A6E F;  3PQK A;  4PCQ A;  1ERD A;  1I39 A;  5C4J J;  4II3 A;  2K3F A;  4M3E A;  3BQZ A;  2R7S A;  4MO7 A;  5CQG A;  2CS3 A;  4IEJ A;  2WBM A;  3EUK L;  3JRH A;  2JVG A;  4HDU A;  2X9D A;  3CD6 I;  2IS6 A;  2NYX A;  4MFD A;  5FFX A;  3LFK A;  5AIP A;  4PFP A;  1RR7 A;  2L3D A;  1VI0 A;  3H3U A;  4M9Z A;  3MKL A;  3M4O J;  4B48 A;  3P5J A;  1LB2 A;  2BVM A;  2IA1 A;  1X58 A;  2VKD A;  4IOA F;  2XGD A;  4S0H B;  5LHI A;  2XVC A;  3K2Z A;  2M7A A;  2NRA C;  5J40 A;  4NUB A;  4BBS J;  2YR2 A;  3I4M J;  4D5F A;  2ZB9 A;  3J81 K;  1T08 B;  3QWL A;  2QQA A;  4HA8 A;  3FXQ A;  4I2O A;  2XRL A;  2HOE A;  3J7A Y;  2ICW G;  4B8X A;  1ON2 A;  3M1C A;  4HBL A;  3E6M A;  3JAM K;  3KET A;  4QPQ A;  5M3F J;  1A31 A;  2XAJ A;  1E0E A;  4ZZL A;  2X6Y A;  1JI8 A;  1NK3 P;  2GZW A;  2CYY A;  2F2E A;  2FBK A;  4XR6 A;  4NQW A;  3HM5 A;  1VF9 A;  2RC4 A;  5ED4 A;  2FF4 A;  1WJB A;  1G3S A;  4IPA A;  1JE8 A;  2ZXI A;  1U8B A;  2TDX A;  1D0Y A;  4PSX A;  2L4A A;  1RZ4 A;  4M6V A;  3BWG A;  2R92 J;  5CLS A;  2XAQ A;  4AWX B;  4L5J A;  3F8M A;  2OZ6 A;  3CUQ A;  3FXO A;  1Z21 A;  4BH9 A;  3F3X A;  1FT9 A;  3GZ6 A;  2DMP A;  4U0W A;  3LA2 A;  4BE1 A;  2AHQ A;  4L5E A;  2R7W A;  2Z5U A;  3DEE A;  1APL C;  3HOV J;  3GEZ A;  1J59 A;  1T6S A;  3WTS C;  3LSJ A;  2CRG A;  2KL4 A;  2FSW A;  2XKP A;  4ESF A;  3T5X A;  4IX7 A;  2AQE A;  2XAH A;  3OYH A;  2P81 A;  1VQ9 I;  3RDI A;  1AWC A;  3WTW C;  3GTO J;  2Z16 A;  5FRN A;  1HDP A;  2DOD A;  4BQN A;  2XPW A;  3K2A A;  3LOC A;  1YQA A;  1JHF A;  2OF7 A;  3RI4 A;  4YFK F;  2DA4 A;  1X2M A;  5EGO B;  5IPA A;  4WWC A;  1FSE A;  5FKO A;  2GBY A;  4BXU A;  1ETY A;  3ZR8 X;  4I01 A;  2HQN A;  3VYS B;  2RV8 A;  4LK0 F;  2DN0 A;  4LG3 A;  1RES A;  3VYT B;  3IH2 A;  3GTM J;  4HSR A;  1FIP A;  4DZP A;  1WPK A;  1MMG A;  2JRT A;  3K1M A;  1G59 A;  4N9H A;  4XSX F;  1ZEL A;  5K1Y A;  2Z33 A;  4NC8 A;  1TQM A;  4C2M J;  1JGS A;  3R4K A;  4LGW A;  3JCU C;  5IT9 K;  4CH7 A;  2MAB A;  4XKV A;  2LBF B;  3VFZ A;  2EIN H;  2IS2 A;  3IC7 A;  2HPI A;  4DGW B;  2IJL A;  1LEB A;  2HDD A;  2EB7 A;  3U9G A;  5DTD A;  4I02 A;  1P7I A;  5EYR A;  3BDD A;  2QQB A;  3K1N A;  5HVQ C;  3J7Y J;  1UZC A;  1TWH J;  3LQR A;  3DTI A;  5DD4 A;  4HLY A;  3BCB A;  2JPC A;  2CSO A;  3H1C A;  1REP C;  3G3Z A;  3JR9 A;  4RGX A;  3TOB A;  3ZMD A;  1R1V A;  1UJ8 A;  1YW7 A;  3DPT A;  1X1P A;  4HST A;  1XCV A;  3HHG A;  3WU0 A;  5D6F A;  2EK5 A;  3KIO A;  9ANT A;  3O8H A;  2DQL A;  1K83 J;  3FXR A;  1WHU A;  1WSU A;  2HXI A;  4AID A;  4PJJ A;  3WHC A;  3S3O A;  3O2P E;  4FCY A;  2ESN A;  2QA4 I;  1WI3 A;  3ERM A;  5D5W B;  2WAE A;  2X1D A;  5CKT A;  3G1M A;  2WWY A;  2NOG A;  3GFL A;  3SZP A;  1O7F A;  5E1W A;  4IKF A;  4UB6 C;  4L9V A;  5LHG A;  1OIS A;  2RKH A;  4O6J A;  3ZQG A;  2D5V A;  1TNS A;  5F27 A;  4QPO A;  5CYV A;  1NK2 P;  4IHT A;  1BW5 A;  2YUS A;  2BVL A;  1OCZ H;  2LVS A;  1HKQ A;  2VQG A;  4BKX A;  5H2F C;  3F72 A;  2BGC A;  4BY7 J;  4OMZ A;  4KIS A;  3QU6 A;  4G9Y A;  2L0K A;  1MKM A;  2OPT A;  4AC0 A;  3I58 A;  3NQO A;  1Y8Q B;  1ZRF A;  3AG4 H;  5EZG A;  1U78 A;  4IRI A;  1SD4 A;  2MH2 A;  3JSO A;  3KLN A;  4HV6 A;  4XN3 A;  3BR3 A;  3B6A A;  2HXO A;  1QQI A;  2EH3 A;  1BIA A;  5H6Q A;  1FTZ A;  2WY7 Q;  1FSH A;  1U9N A;  3HG9 A;  2KDO A;  4KIB A;  4DW6 A;  1N25 A;  1JHH A;  5HDN A;  2E5N A;  3N05 A;  5FKM A;  1WQ2 A;  2CV0 A;  5L3C A;  1MND A;  2LBF A;  4IXA A;  5J3L A;  5HLH A;  5HDG A;  1LFU P;  3OSG A;  1GDT A;  1T95 A;  2VT3 A;  3BZC A;  4IJA A;  2QBY A;  3FXU A;  1ZHF A;  1EH7 A;  5BQT A;  3JSP A;  1RPW A;  1HOM A;  3CLO A;  3J7A O;  2BHY A;  3RYP A;  4D7N A;  1WJE A;  2R7Q A;  3D5R C;  2PJP A;  4C30 A;  3QOP A;  1J7K A;  3I5U A;  3GCM A;  5J4Y A;  1KU7 A;  4A3K J;  3EUH A;  4R8H A;  2L7Z A;  2VBX A;  1FTT A;  3K69 A;  2LFB A;  4PDK A;  4P9F A;  2JA6 J;  2H27 A;  3Q9S A;  2ELH A;  3H3Z A;  5J6X A;  2O6G E;  2J5O A;  2XAF A;  4HF2 A;  5F0H A;  5JR3 A;  2DBB A;  1FYM A;  2HQ5 A;  2VJ5 A;  3U1D A;  3E6C C;  1JTX A;  1YIT I;  2IT0 A;  2DO7 A;  3TDU C;  4A5M A;  1RUO A;  4UHT A;  4LD5 A;  1GVJ A;  3WU1 B;  4G7Z F;  2NS7 A;  1GLN A;  4OWR B;  5D8L B;  5C4X J;  2HOT A;  5FD5 A;  4P9U A;  2EZL A;  3DEU A;  4ABZ A;  3H92 A;  2A05 A;  4LOC A;  2Y75 A;  4Y13 A;  1UB9 A;  3WTZ A;  1GT0 C;  1X2N A;  4XLP F;  3RKX A;  2ID3 A;  1MJ9 A;  2CW0 F;  3H5N A;  4AYB N;  4Q4Z F;  2ELK A;  2DAO A;  4N0B A;  1K61 A;  2V1U A;  5HLG A;  2YS9 A;  1YG2 A;  1JTY A;  5J8C A;  3WTV C;  1SFE A;  1BR2 A;  1WJA A;  2YU3 A;  1X4P A;  2E35 A;  3KPH A;  1R4M B;  3PO2 J;  2K9M A;  4BHP A;  4HG2 A;  2R7V A;  5FO5 A;  4FHT A;  2JMW A;  2D1H A;  1CQT A;  1JGG A;  3W2V A;  2QGU A;  4P96 A;  4U7B A;  5A2Q Z;  4XKC A;  5M5W J;  3CCJ I;  2VKV A;  2GIV A;  2BY2 A;  3HXL A;  3PQJ A;  2HVR A;  4QSH A;  3FBN B;  3JRI A;  3FMR A;  2KP6 A;  3BR2 A;  1I50 J;  4XSZ F;  2WC2 A;  4M9X A;  2BW3 B;  2W82 A;  4Q47 A;  3LAP A;  5B5E C;  3I4N J;  2K85 A;  2KFD A;  3MZH A;  2XPU A;  2E1M B;  2XF5 A;  2ZKZ A;  4M72 A;  4F92 B;  2E19 A;  4YG2 F;  3JRD A;  1JUM A;  3GBG A;  2K3P A;  3Q0V A;  2KRC A;  1IN8 A;  3CCL I;  3DBL B;  4F55 A;  4XKW A;  4LG0 B;  2OZU A;  5FKL A;  5DV5 A;  2MD5 A;  3M9A A;  1SAX A;  4PJ0 C;  4L0Z B;  2JT1 A;  3IUO A;  4RA2 A;  2DTR A;  2J5P A;  3CCV I;  3A03 A;  3PNY A;  4ESJ A;  3DU6 A;  4RS8 A;  2XAS A;  3P9C A;  4G6D A;  2NXN B;  1I1S A;  5D4S A;  2FA5 A;  2GM4 A;  2GXG A;  3K4L A;  2WA0 A;  4FET A;  1FOX A;  4LB6 B;  5LGT A;  5D5U B;  2X6X A;  4LIT A;  4HYE A;  1I6H J;  3TGN A;  2CV1 A;  4RB2 C;  3BCA A;  1VFC A;  2ISY A;  3M8F A;  1ZRE A;  1O3S A;  1ZGW A;  2HDC A;  2GAU A;  1YX5 A;  2QEN A;  4W1U A;  3RYR A;  1AU7 A;  2JUG A;  1RUN A;  3REO A;  2Q8K A;  3LQQ A;  3LFU A;  5ILU A;  2NS0 A;  2JTV A;  3IAS 2;  1VZ0 A;  1MIJ A;  4KNY A;  1R36 A;  3HOS A;  1S8N A;  3KP2 A;  2BXY A;  2KKO A;  5BPI A;  3R61 A;  2ESH A;  2HYJ A;  4I0A A;  4BJ6 C;  2XUB A;  1J9I A;  2E7X A;  2HR3 A;  2STT A;  5ERI A;  4OIP F;  1BM9 A;  4LK1 F;  2DA3 A;  2OTL I;  4P5O A; 
#chains in the Genus database with same CATH homology
 4A3M J;  3OIO A;  1Y1V J;  2NVY J;  5IP9 J;  4HNV A;  4DYC A;  1BJZ A;  1HLV A;  1OCP A;  3TW6 A;  1TWF J;  3GTL J;  1A6I A;  3OOU A;  2R5Z B;  2LKX A;  1LFB A;  4D5C A;  5K7Z A;  4A3B J;  4IHW A;  2JA7 J;  2B63 J;  4I76 A;  2Y9Z A;  4Y52 J;  2CU7 A;  2E2J J;  1GUU A;  3C2B A;  4C3J J;  2XSD C;  3JRE A;  1GVD A;  1DU6 A;  5HOD A;  5E3O A;  4IHV A;  1XS9 A;  3TW7 A;  4JP0 A;  4A3D J;  5C44 J;  2CQQ A;  3S1Q J;  5IYC J;  1OJL A;  2XB0 X;  1XG1 A;  4X1E A;  2KDZ A;  1DU0 A;  3Q3S A;  4I6Z A;  3M3Y J;  4XIC A;  3BQY A;  1LE8 A;  1R9T J;  2Y30 A;  5M3M J;  4W97 A;  5FKN A;  5EF6 A;  5IOZ A;  1WH7 A;  3NAU A;  2Y9Y A;  2R5Y A;  2IBD A;  2M2E A;  2E2I J;  1F36 A;  3CQZ J;  3JRB A;  2NS8 A;  3BTJ A;  3HOX J;  2XB5 A;  4C3H J;  1ZR4 A;  1T56 A;  1TC3 C;  2FX0 A;  2LTP A;  1IV6 A;  2DMN A;  1XC5 A;  3BTC A;  1RKT A;  1ZTR A;  2ECC A;  3GTK J;  3RKQ A;  1MH4 A;  1ORK A;  2JA8 J;  2WB1 N;  2CUE A;  2WAQ N;  3HOZ J;  5C4J J;  3FIW A;  2DA7 A;  4A3I J;  4M3E A;  3BQZ A;  3BG5 A;  4MO7 A;  1POG A;  1GV5 A;  1OFC X;  4IEJ A;  3ZQF A;  2XGC A;  3JRH A;  2QF7 A;  2X9D A;  2ME6 A;  3A01 B;  1H89 C;  2LLK A;  5E3N A;  4MFD A;  4C3I J;  1RR7 A;  5K7H A;  1VI0 A;  1ZQ3 P;  1LE8 B;  4M3G A;  3DCF A;  3MKL A;  2JK3 A;  3M4O J;  1H8A C;  2R7Z J;  1X58 A;  2R5Y B;  2XGD A;  4S0H B;  2R5Z A;  4J19 A;  2NVX J;  4BBS J;  3I4M J;  4D5F A;  2ZB9 A;  1E3O C;  3HBL A;  4BXX J;  2DMT A;  3FK6 A;  4M3F A;  5F0F A;  2R93 J;  4RDU A;  2CJJ A;  2XRL A;  2VPR A;  3F0C A;  3FK7 A;  4JX5 A;  4EEF G;  1HCR A;  2DA6 A;  5EGO A;  2K9S A;  5M3F J;  3JRG A;  1O4X A;  1NK3 P;  4B4C A;  3HM5 A;  1VF9 A;  3L1P A;  3HB9 A;  1MBJ A;  4M3D A;  5M5Y J;  1JKQ C;  3FKI J;  2LK2 A;  3MN2 A;  2R0Q C;  1U8B A;  5F1J A;  2FD5 A;  4M6V A;  5C3E J;  1IRZ A;  5IP6 A;  1TWC J;  5FKK A;  2N8G A;  1UG2 A;  2R92 J;  1IG7 A;  2O8K A;  3HDD A;  5IOY A;  5FLV A;  4XK4 A;  2DMP A;  4CYC B;  2AHQ A;  4L5E A;  2DA1 A;  1IC8 A;  1APL C;  3HOV J;  2ECB A;  5EDN A;  3LSJ A;  5FJ8 J;  2CRG A;  4D7M A;  2P81 A;  4M3B A;  3GTO J;  3RZD J;  4A3C J;  4A93 J;  1HDP A;  2XPW A;  3K2A A;  3LOC A;  2OF7 A;  1G2H A;  3H0G J;  3BR0 A;  2DA4 A;  1X2M A;  1VND A;  3BR6 A;  5IPA A;  5EGO B;  2EQR A;  1HF0 A;  2XPV A;  5FKO A;  2GBY A;  2X6O A;  3GTG J;  1ETY A;  2HOA A;  1FJL A;  1U9O A;  2GLO A;  3A01 A;  2DN0 A;  3IH3 A;  5J1U A;  1GV2 A;  3SDG A;  4DZJ A;  5GPC A;  3GTQ J;  1RES A;  2L7F P;  3IH2 A;  4A3E J;  1Q1V A;  3GTM J;  1FIP A;  2EZI A;  3G1L A;  4DZP A;  1B8I A;  1WPK A;  1MBF A;  1F43 A;  5GPA A;  2IAI A;  2VKE A;  4Y7N J;  3S16 J;  1SAN A;  4C2M J;  4JX6 A;  4JYK A;  2K9N A;  1Z0X A;  2M8G X;  1JKR C;  2XGE A;  2E1O A;  2HI3 A;  1MSE C;  2O7O A;  4B3A A;  2HDD A;  3CMY A;  5DTD A;  1P7I A;  5EYR A;  2MSY A;  2X48 A;  1YRN A;  1TWH J;  3JRC A;  4JX4 A;  3QPL A;  2VI6 A;  1UMQ A;  2YU9 J;  4QIW N;  1FEX A;  3HEF A;  3HOU J;  3JR9 A;  2CUF A;  4DYR A;  1BW6 A;  1PUF B;  1OCT C;  1Y1W J;  5JLW A;  1ETO A;  1A5J A;  3S17 J;  9ANT A;  4V2F A;  3CCY A;  1MBH A;  1ZK8 A;  3O8H A;  1K83 J;  4MIM A;  1FIA A;  2HXI A;  2LR8 A;  1Z77 A;  4BY1 J;  1B8I B;  3LSG A;  1ENH A;  3WHC A;  4FCY A;  3PM1 A;  2DMQ A;  1WI3 A;  1S7E A;  4XRM A;  4DYQ A;  1UHS A;  4CYC A;  1ZR2 A;  5J1Y A;  3G1M A;  2NOG A;  3RQI A;  5M5X J;  1ITY A;  4BBR J;  5K7F A;  2EZH A;  4RBO A;  2O9L A;  4GFB A;  3ZQG A;  2D5V A;  4A3L J;  5F04 A;  5F27 A;  3Q0W A;  1NK2 P;  1BW5 A;  1YRN B;  5IYB J;  3HOW J;  2YUS A;  3MVP A;  2LVS A;  3HGG A;  1JKO C;  4BKX A;  1HDD C;  3HOY J;  4BY7 J;  1MSF C;  1MH3 A;  5EG0 A;  3JRA A;  4AC0 A;  4A3F J;  2L0K A;  2OPT A;  1RKW A;  4XRS A;  2ME0 A;  5EZG A;  1MNM C;  1U78 A;  1IJW C;  3W6V A;  3BR3 A;  2Y0S N;  3B6A A;  4FTH A;  2HXO A;  2TCT A;  3S1R J;  3BG3 A;  2EH3 A;  4UUT A;  1FTZ A;  3OSF A;  1MBE A;  1U9N A;  1JT0 A;  2JN6 A;  4DW6 A;  1AHD P;  4XID A;  5FKM A;  1W0U A;  5DS9 A;  2JJ7 A;  5J3L A;  1LFU P;  1JKP C;  3OSG A;  1GDT A;  3SJM A;  1EF4 A;  2CQX A;  1RPW A;  1TWA J;  1HOM A;  5E3M A;  4MFE A;  2K40 A;  2M34 A;  1ETX A;  4MLO A;  4D7N A;  3DEW A;  2KT0 A;  1JUP A;  3S15 J;  3BR5 A;  2MGQ A;  3B6C A;  4FE7 A;  3BR1 A;  1P7J A;  4A3K J;  1B72 A;  1BA5 A;  1JUS A;  2L7Z A;  5J1R A;  4FE4 A;  1PUF A;  1FTT A;  5EG0 B;  2LP0 A;  2LFB A;  3Q0U A;  3E7L A;  5BNG A;  2JA6 J;  4QTR A;  1SFO J;  1ETV A;  5F0H A;  2HQ5 A;  2M9H A;  1JTX A;  4A3J J;  1IDZ A;  2L7M P;  3NAR A;  1D5Y A;  2NVT J;  3A02 A;  2NS7 A;  4B1R A;  4IHX A;  2DJN A;  5E3L A;  5C4X J;  2HOT A;  2EZL A;  4ABZ A;  3G1O A;  3HGY A;  4LOC A;  2PMZ N;  4AUX A;  1GT0 C;  1X2N A;  3IV5 A;  2ID3 A;  5IYD J;  2K9Q A;  3ZQC A;  4AYB N;  2ELK A;  1K61 A;  3CDL A;  2YS9 A;  3WHB A;  1JTY A;  1H88 C;  2G0E A;  4XRS G;  3LSP A;  1QVU A;  1QPI A;  2EBI A;  1JT6 A;  2E2H J;  1TWG J;  3PO2 J;  1B72 B;  5JLX A;  2DMU A;  3S2D J;  5IP7 J;  2JMW A;  1CQT A;  3QQA A;  1JGG A;  3JRF A;  1ETW A;  4FIS A;  2LY9 A;  1AKH A;  5M5W J;  3VPR A;  3HKZ N;  2M0C A;  5EEA A;  2ID6 A;  2VKV A;  1JJ8 C;  2QCO A;  1BL0 A;  4QSH A;  2W48 A;  1T33 A;  3JRI A;  1WGX A;  2TRT A;  1I50 J;  3BR2 A;  3K7A J;  3H3V K;  1ETK A;  2FQ4 A;  3I4N J;  3S1N J;  1RET A;  2WV1 A;  2JWT A;  4A69 C;  3UKG A;  2MW8 A;  2AO9 A;  2RAE A;  3BTL A;  2XPU A;  4UUS A;  2H1K A;  2E19 A;  1ZKG A;  1JUM A;  3JRD A;  3Q0V A;  3GBG A;  5F0C A;  2EZK A;  4NDL A;  2Y2Z A;  2Y31 A;  1JJ6 C;  2COB A;  2H8R A;  2FJ1 A;  5FKL A;  3BG9 A;  4V2G A;  4X6A J;  3TED A;  3TP3 A;  2VUM J;  3RZO J;  1IUF A;  3A03 A;  2IEK A;  2GM4 A;  3PO3 J;  2LD5 A;  1QRY A;  1WH5 A;  2NVQ J;  1ETQ A;  4IHY A;  1I6H J;  1QVT A;  2HOS A;  3D1N I;  1VFC A;  1AKH B;  1ZGW A;  3BT9 A;  3GTP J;  4W1U A;  1I3Q J;  1W0T A;  1AU7 A;  3QPS A;  3GTJ J;  1WCM J;  3ZQL A;  5FLM J;  3S2H J;  3TP0 A;  3IH4 A;  2L9R A;  1MBG A;  2DA2 A;  2I10 A;  3FIS A;  2DTZ A;  4G12 A;  1MBK A;  3O8G A;  5GP9 A;  2HYJ A;  1NTC A;  2JA5 J;  2DA5 A;  4UUS B;  5F08 A;  3ZQI A;  3S1M J;  4A3G J;  3LSR A;  1IGN A;  3S14 J;  3ZQH A;  3BTI A;  5EZH A;  3SFI A;  1IDY A;  2MG4 A;  3ZOB A;  2DA3 A;  3LNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...