1JKRC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*CP*AP*AP*GP*A)-3'
publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkrC00
4C3IJ 4JYKA 2O7OA 2VUMJ 2LFBA 4D5CA 5IYCJ 1B72B 2GM4A 3S14J 4BBSJ 3RZDJ 1RKWA 1OCTC 4V2FA 5C3EJ 5EYRA 2KT0A 3FIWA 5EGOB 3JRGA 2XGCA 1TWGJ 5M3MJ 3IH4A 1JKOC 2R5ZA 3GTMJ 3TW7A 3ZOBA 3L1PA 2JN6A 1ORKA 1FIPA 5FKNA 3HOVJ 4A3IJ 1OFCX 3E7LA 3D1NI 2R5ZB 5FLVA 3A01A 3TW6A 2K9NA 1RKTA 3UKGA 1ETWA 2MW8A 3PO3J 5IYBJ 3A01B 4X1EA 4CYCB 3WHBA 4XRSG 2R93J 5C4JJ 1IV6A 1HCRA 4A3BJ 1X2MA 2FD5A 5FKMA 2Y0SN 3MKLA 4M3FA 1RETA 3Q0WA 4BKXA 2P81A 4DYQA 5GPAA 1W0UA 2LY9A 1MSFC 2R5YA 2HI3A 4QIWN 2EQRA 2FQ4A 1JKQC 1JJ6C 2TRTA 4MFDA 4S0HB 1APLC 1Z77A 2EH3A 4MFEA 1QRYA 2YUSA 2DA1A 3BQZA 1LFUP 3HBLA 1TWAJ 2LP0A 1G2HA 3LSPA 3CQZJ 3ZQFA 3HGYA 1K83J 2L9RA 2L7MP 3IH3A 4RBOA 2JA6J 5E3NA 3BG5A 1ETYA 1ETXA 3BQYA 1YRNA 3VPRA 3LSRA 2KDZA 1A5JA 5F0HA 1LE8B 1D5YA 4AYBN 1VFCA 3G1LA 1FEXA 5IP6A 5E3OA 1GV2A 1ZKGA 3OSGA 1YRNB 3JREA 4JX6A 2M8GX 3QQAA 4DW6A 4XRMA 2K9SA 3FK7A 5EEAA 1JUSA 3S1MJ 4NDLA 2K40A 2PMZN 2O8KA 1RPWA 2JA7J 2XB0X 2MGQA 1JKRC 3JRDA 3GTKJ 1NTCA 3BR1A 4M3GA 3SJMA 3F0CA 1JJ8C 2I10A 3JRBA 5HODA 1Y1VJ 2X9DA 1HOMA 2DMNA 2VI6A 2JA8J 3HOWJ 4C3HJ 2Y9ZA 2DA7A 1MBHA 4DYRA 1B8IB 2H8RA 1CQTA 5M3FJ 2GLOA 3DCFA 2OPTA 3LSGA 3S2DJ 1P7JA 2XPVA 4D5FA 3HOYJ 3JRCA 3NAUA 4RDUA 1VF9A 2ZB9A 1O4XA 2VPRA 3A02A 3ZQHA 4AUXA 5M5XJ 3HM5A 4UUSB 4A69C 1ZR2A 1GT0C 1VI0A 3JRHA 1B72A 1XC5A 2FJ1A 3DEWA 2JMWA 5EGOA 3S1QJ 1Q1VA 1WGXA 2E2HJ 3OOUA 1FIAA 1TC3C 1GVDA 5M5WJ 1UG2A 2DMQA 1ETVA 3H3VK 2Y9YA 1U78A 2YS9A 3BG9A 3OSFA 4XIDA 2O9LA 3FK6A 4L5EA 2HYJA 3I4MJ 4LOCA 1ZK8A 1BJZA 4M3BA 1POGA 3GTPJ 1JTXA 3BTJA 3CMYA 4IHWA 1IDZA 4W97A 1IDYA 2R0QC 1U8BA 3HB9A 2LKXA 3MVPA 4CYCA 3S2HJ 1RESA 2CJJA 2XGEA 3S17J 1SFOJ 3JRAA 2TCTA 2M0CA 1TWHJ 4B1RA 1NK3P 2DMTA 1JUPA 1JT0A 3G1OA 2EZLA 5K7FA 2EZIA 1H8AC 5F27A 3K7AJ 2N8GA 2VKEA 3GTJJ 2WAQN 2E2JJ 3TEDA 4Y52J 2XRLA 2M2EA 1R9TJ 1ENHA 4A3EJ 4D7NA 2CRGA 1MBEA 2CQQA 3MN2A 2EBIA 1FTZA 2XPWA 3PO2J 9ANTA 1PUFA 1SANA 3LNQA 5JLWA 4W1UA 1ETQA 2FX0A 3HKZN 2D5VA 3HEFA 1I6HJ 2ID3A 1HDPA 1PUFB 1LE8A 2HOAA 2MSYA 2CUFA 2VKVA 1ZQ3P 3SDGA 1UHSA 1ZGWA 1GV5A 2GBYA 2L0KA 5IP7J 5IPAA 1DU0A 5F0CA 3PM1A 1MBKA 1A6IA 4FE4A 2X6OA 3S1NJ 2LR8A 2OF7A 4AC0A 2G0EA 1JTYA 2ME0A 1IC8A 5M5YJ 3C2BA 2Y2ZA 2MG4A 1F36A 3BR6A 4EEFG 3RKQA 2YU9J 2LK2A 2JA5J 3BTIA 4B3AA 5DS9A 3K2AA 1QPIA 2XSDC 2ECCA 5FJ8J 2JJ7A 2HQ5A 5FKKA 4JP0A 1B8IA 1X58A 3BT9A 2E1OA 3H0GJ 3ZQIA 3ZQLA 5FLMJ 2CU7A 3HDDA 4A3GJ 1I3QJ 2EZHA 4J19A 2HDDA 4UUSA 3FKIJ 3LSJA 4JX5A 2DA2A 1QVTA 4BXXJ 5E3LA 2NVQJ 3HGGA 2HXIA 1IRZA 2RAEA 3B6CA 1IJWC 2WB1N 4MLOA 2B63J 2DTZA 3JR9A 3RZOJ 5EG0B 1K61A 4M6VA 2DMUA 3I4NJ 3S15J 4A3FJ 5C4XJ 4FCYA 3G1MA 1IG7A 1ZTRA 2HOSA 1MH4A 3S16J 1BA5A 3A03A 4FE7A 2WV1A 3BR2A 1T56A 3HOXJ 1AU7A 1LFBA 1NK2P 3JRFA 4A3JJ 2ME6A 1BW5A 3Q0VA 4A3MJ 1WH5A 4XK4A 1AKHA 2E19A 1QVUA 3M4OJ 4C2MJ 4A3DJ 1MBJA 2DA3A 1WI3A 3O8HA 4JX4A 3CDLA 5IOYA 2M9HA 1FJLA 5J3LA 1BL0A 3BR0A 4MO7A 1ETKA 5JLXA 2H1KA 2IAIA 1AKHB 3CCYA 1MH3A 2AO9A 1H88C 4BY7J 1IGNA 2XGDA 3QPSA 4FISA 2L7ZA 4B4CA 3GTQJ 2E2IJ 2DMPA 1P7IA 4BBRJ 2EZKA 1MBFA 3Q3SA 2DA6A 2QCOA 4IEJA 1DU6A 1TWCJ 4QSHA 2M34A 1ETOA 4MIMA 5EZHA 2QF7A 1UMQA 1WPKA 2DN0A 1EF4A 1X2NA 2ECBA 1JKPC 1TWFJ 2X48A 1Z0XA 3BR3A 5IYDJ 1JT6A 2K9QA 1MSEC 1IUFA 2AHQA 4I76A 2NVXJ 2LVSA 5F0FA 3W6VA 3NARA 1E3OC 3OIOA 1JUMA 1U9NA 2Y30A 2LD5A 1Y1WJ 3WHCA 3BTCA 2HOTA 4M3EA 1JGGA 5IP9J 1HF0A 2XPUA 2NS8A 4A3CJ 3LOCA 1T33A 1RR7A 4XRSA 3IV5A 5BNGA 2JK3A 3QPLA 5J1UA 2JWTA 2R5YB 2HXOA 3GTOJ 1VNDA 3M3YJ 5GPCA 1XS9A 1S7EA 5EDNA 3BR5A 1HDDC 1OCPA 4BY1J 3GTGJ 2XB5A 5C44J 3B6AA 5J1RA 5IOZA 5J1YA 3BG3A 5F08A 2ID6A 4QTRA 1XG1A 1W0TA 3ZQCA 5DTDA 1ITYA 4HNVA 1WH7A 4X6AJ 3TP3A 4XICA 1H89C 2NVTJ 1MBGA 4A3LJ 4DZPA 3O8GA 4G12A 3RQIA 4DZJA 5K7ZA 4C3JJ 5F04A 2CQXA 1FTTA 4I6ZA 1GDTA 5GP9A 4A93J 1U9OA 1ZR4A 4IHVA 1F43A 3GTLJ 2L7FP 1OJLA 5F1JA 1MNMC 2LLKA 3Q0UA 4M3DA 2COBA 4IHYA 2NVYJ 2Y31A 5E3MA 1I50J 1AHDP 4A3KJ 5EG0A 4ABZA 2IBDA 4IHXA 3HOZJ 3SFIA 4V2GA 2R92J 2R7ZJ 4DYCA 5K7HA 1GUUA 3HOUJ 2LTPA 2DA4A 1HLVA 2DA5A 2IEKA 3IH2A 2ELKA 3GBGA 4D7MA 3S1RJ 4UUTA 2NOGA 3BTLA 4FTHA 2DJNA 5EF6A 3JRIA 1BW6A 2NS7A 2CUEA 2W48A 3ZQGA 5EZGA 3TP0A 4GFBA 3FISA 4Y7NJ 1WCMJ 5FKLA 5FKOA
chains in the Genus database with same CATH superfamily
3GUDA 1B1BA 4C3IJ 4KIBA 4LJZF 2VUMJ 1XN7A 3GYHX 2LFBA 3FWEA 4O5VA 4D5CA 1E3PA 4D9JA 4K2EA 4ZDPA 3RSNA 1B72B 2GM4A 3S14J 1R4MB 1RKWA 4EGYA 3OMYA 1OCTC 2CQ7A 5EYRA 2KT0A 3WGHA 3CCMI 1FZPB 2L02A 3K10A 2P4WA 3L2UA 4NC8A 3CCEI 5DM7F 3EYYA 3ZOBA 1K78A 2C6YA 1HW1A 4L5IA 1NG6A 2DQRA 3BY6A 5DM6F 1MKMA 4P96A 1LDJA 2Z16A 2R5ZB 1R7JA 4B09A 3A01A 5FB2A 2E36A 3PFYA 2HOEA 1UCRA 3PO3J 2AXLA 5LGUA 5IYBJ 4CYCB 4RM3A 2Z3YA 1Z3YA 4XOTA 4IRGA 5FFZA 4A3BJ 2W1OA 1MMSA 2CMPA 2PFBA 1SMYF 3MKLA 3EUHA 5FKMA 4BHBA 1ZRDA 2DQLA 2EIJH 3ONQA 3H5AA 2LY9A 1YX3A 2IGNA 4G6DA 1VQNI 3LSHA 4A5NA 4XKWA 4WCGA 4S0HB 3GFMA 1K7AA 1KA8A 3I71A 3J80K 1QRYA 3ZQQA 2M7AA 4QLCU 2FF4A 5CYVA 3HBLA 1TWAJ 3CQZJ 3ZQFA 3OYDA 2ZSIB 4Q4ZF 2MLKA 2L7MP 4RBOA 4UVBA 1VQLI 4OWRB 3TMOA 2HWVA 1XSVA 3K70C 2E7WA 2B7EA 4Y15A 1ETYA 2CFOA 4AIKA 5L3FA 2E34A 4DNCA 3VPRA 4N0BA 5JI6A 2KDZA 3SXYA 4HW0A 3S3NA 4AYBN 3OYEA 2QGUA 4NQWB 1VFCA 3W2VA 2LMDA 1FBSA 3FXMA 4ZTFA 4CDGA 2HKOA 4CCNA 3OSGA 3JREA 3QQAA 5KAFC 3CP2A 2L2OA 2BXYA 4D0PA 1RI7A 3R6SA 1DPRA 1LVAA 2K40A 2PI0A 1ODDA 3TOAA 1RPWA 1QBJA 3G2BA 2XC7A 3BR1A 3G71I 3KP4A 2WTEA 4OOIA 2K9MA 4HOBA 5DYMA 2IA2A 1P92A 1SFUA 3NWTA 3T8RA 2VQGA 1Y1VJ 2DI3A 3RPUD 3TO6A 1O7FA 2DMNA 2VI6A 3HRTA 2J5PA 3OY9A 3P9KA 3MKYB 3F8MA 3IRRA 4JBAA 1IXRC 5LD2C 4DYRA 5L3EA 4AIHA 2STTA 3L2WA 3EYIA 1SD4A 2OV7A 1CQTA 5M3FJ 2M4GA 2E5ZA 4MQ9F 2XPVA 2L54A 2HNHA 2BGCA 4RDUA 2KRCA 2P6SA 1Y0NA 2ZXWH 3DP7A 3C3WA 5M5XJ 3OYAA 1ZR2A 1VI0A 2ZJQF 3HSFA 2FMLA 1OCRH 1OKRA 2WAFA 3F8BA 3DPLC 3D5RC 1WGXA 4BEHB 5BMZA 2Q8KA 3J81Z 2IS4A 1FIAA 1GVDA 1UG2A 2NNYA 4P1WA 3H3VK 2Y9YA 3ECHA 4XIDA 4XR6A 1ZAOA 2HYJA 2QBYA 4B47A 4L9TA 2IS2A 2K7LA 3VB2A 3H9QA 1POGA 4U7DA 1JTXA 4A12A 1T6SA 4W97A 1A35A 1WVRA 2YU3A 2LKXA 1Y8RB 2IGOA 2X51A 4HRIA 4PDKA 4QPOA 1PDNC 2LREA 3ZMUA 2KZGA 5LHHA 4BE0A 1N77A 2RDPA 1SFOJ 3VDXA 2M0CA 3HHHA 5LHGA 2DK5A 2PMZA 2FRHA 1NK3P 2DMTA 4DIQA 2MC4A 1XTAA 5ILSA 4MGRA 1FX7A 5DV5A 1H8AC 4IVNA 4E7ZA 4RB1A 2X1CA 1W36C 2M45A 5F27A 3CJTB 2N8GA 3CCJI 3JTGA 1WQ2A 3H36A 2DOAA 4I0BA 1X3WB 2O6GE 2VIXA 4ZDOA 4IRIA 2H6CA 4YFXF 3RKYA 2EBIA 2XPWA 2HPIA 4XLEA 3G6EI 3WTSC 1PUFA 3ZP5A 2R3SA 3DU5A 3V8KA 5D5XB 4PGGA 3LNQA 5JLWA 2L4MA 5CLSA 1R71A 1E2XA 3VEPA 3HPHA 4M72A 1HDPA 2HOAA 2ZFUA 4YFKF 4EJOA 3KP3A 3ABMH 2WADA 1DUXC 3SDGA 1F5TA 1IRXA 1V55H 1UHSA 3NRVA 4EJVA 3FXRA 2KKOA 1YIOA 3J80Z 2QEXI 2P8TA 4FE4A 2X6OA 1IO2A 2EV0A 3WU2C 4ESFA 2ME0A 2RNGA 2XF5A 3C2BA 2F5DA 3LQRA 5HS7A 5M5YJ 1F36A 5CKTA 3WTWC 4F55A 4EEFG 2P5LC 2YU9J 1BR1A 1OQYA 3FXUA 2BY3A 4G7ZF 2JPCA 2DYRH 3BTIA 4B3AA 2OQRA 1OISA 5DS9A 1J59A 3K2AA 3VYUB 1XCBA 3CCUI 2XV4S 2XSDC 2PG4A 5B5EC 2WY7Q 1MMNA 2DT6A 3G4SI 4ZYGA 3BG6A 3IWFA 3K1MA 4XSXF 4IX7A 1X58A 4HZFA 2OBPA 1LJ9A 1STZA 2DFFA 5FLMJ 2CU7A 4A3GJ 2XIGA 1YQAA 5A2QK 5JR3A 2CV1A 3C2GA 2W00A 1RUNA 1I3QJ 3HRMA 4UUSA 2WY8Q 2WC2A 3GVAA 3ROUA 1RR8C 2QQBA 3ZMVA 5AIQA 3B6CA 1XX5A 5HNHA 2EFWA 2WB1N 2ISYA 3I59B 4HEA2 3RZOJ 2DTZA 4XNFA 1I1SA 1K61A 4MEYF 5LRSA 3OIQA 1Z05A 2K4BA 3S16J 2H8WA 5GAEJ 4FE7A 1QO0D 4QPQA 5EEGA 1T56A 3HOXJ 1WHUA 5K5QA 2HZDA 1WJ5A 1BW5A 3Q0VA 2M87A 2EA4A 3KX2A 4CSWA 4BGDA 4XK4A 5LFAA 1BM9A 1QVUA 1ULYA 2CW8A 4A3DJ 4P9UA 4JX4A 3CDLA 3E6MA 5CVRA 5J3LA 2BV6A 2EFQA 4MQVA 5DUIA 1BL0A 3HSRA 2Z99A 4HBLA 3HTSB 2H1KA 2IAIA 2X1DA 1SVMA 1V54H 3DTKA 3AAFA 2FOKA 3GMEA 3LL7A 4CO8A 3BG7A 1T0FA 4A0YA 3EQLF 1HQCA 4I01A 4EV0A 1X1BA 1DDNA 2JVGA 4BU2A 1FPQA 1LNWA 4N4NB 1MNDA 1P7IA 3OL3A 2EZKA 2Z9OA 2H1LA 2GZWA 1YG2A 2DA6A 1F1ZA 1P4XA 5CVUA 5BPDA 1DU6A 4QSHA 4MIMA 1Z9CA 2CH0A 2E1NA 1EF4A 1KQ9A 3MZHA 1TWFJ 3W3CA 3WTZA 3V7SA 4DBRA 1JT6A 2BYVE 1IUFA 4HQEA 2NVXJ 4UVAA 2LVSA 4KJZA 3W6VA 4KISA 1LPQA 3HRUA 2W25A 2HQRA 4U87A 3G73A 2L9VA 2LD5A 1MNEA 3BTCA 2GA2A 1JXSA 2NVUB 1QZEA 4G6QA 1YOVB 1QNTA 5IP9J 3D5LA 5CVIA 4HF1A 2RC4A 2XPUA 1I3AA 2NS8A 3LOCA 1T33A 1LEBA 1Y0UA 1IRGA 1WRJA 3CTAA 1SEUA 4XRSA 1T38A 1S9HA 2EJRA 5BNGA 1CGPA 2JK3A 1U5TB 5KNLA 1BI3A 3QPLA 4YIFA 3ERMA 1AA7A 1G6NA 2HXOA 3L2QA 2BVLA 4ETSA 5GPCA 5BS6A 3BCBA 3SQNA 4CZCA 3PIOF 4BY1J 2VL8A 1VQPI 3ELKA 3OV8A 3B6AA 1QPMA 1C0WA 5F08A 4J00A 1PJRA 2ID6A 4QTRA 1XG1A 1W0TA 3ZQCA 4GRIA 5DTDA 3U1DA 1WSUA 4GYGA 3U2RA 3KP5A 2IRFG 4G9YA 2IP2A 4DZPA 5FGMA 3AFHA 3RQIA 2A61A 1YI2I 2DT7B 1QGPA 1P4AA 2EINH 2DXIA 3MEXA 3RCOA 5F04A 2CQXA 4I6ZA 1IXCA 1GDTA 2RV8A 4A93J 4E7KA 3WTXC 1ZR4A 4AIDA 3F23A 4II3A 2ZCWA 3PUBA 2L7FP 1FMVA 3JCUC 2E1MC 3OYCA 1P4WA 1PVEA 2COBA 5D4SA 3DLAA 3TO7A 2DFEA 4L9JA 4RB0A 2M30A 4CCMA 1XGNA 1I27A 2NVYJ 3KE2A 4RB2C 1AHDP 5E1ZB 4A3KJ 4M73A 3AKZA 1XMXA 2IBDA 3IHUA 5CPRB 4ZYDA 3PL8A 4IHXA 4V2GA 4HSRA 4DYCA 2WAEA 4NNJA 4NC7A 4A0ZA 5DEQA 5HLTA 3DTIA 2JT1A 3DV8A 3HOUJ 2LTPA 1ZGJA 3F9KA 1EJ9A 1Z1DA 3B02A 2IEKA 2ELKA 1BIAA 4D7MA 4ZZLA 3FDYA 1FSHA 4UVCA 3VYTB 3ABLH 2Y0MA 5D4RA 2O3FA 2W48A 1OYIA 4RAYA 3REOA 1IN5A 1U2WA 2ZSHB 4R8HA 2CGPA 4FASD 2D1HA 2XDVA 2O7OA 2HFHA 2R7VA 3U21A 3WG7H 1YTYA 3BP8A 1KONA 3T8TA 4BBSJ 1BN5A 2A6TA 2E35A 1W1WE 3FXJA 2W24A 3JRGA 4KITB 2CYYA 5EGOB 4H0EA 3E5UA 2OQGA 1DGRM 2UV1A 3QYBA 1JKOC 5EJCA 1HW2A 2CV0A 3PQKA 3N97A 3LSKA 2R5ZA 2R7XA 2MH2A 3L1PA 1OLTA 2JN6A 2HVSA 2LBFA 1ORKA 1FIPA 4BH9A 3HOVJ 3RKXA 3Q9VA 4AYBA 2O61A 2R7DA 5J47A 5D5WB 5FLVA 4XN3A 3I9V2 3TW6A 5E1WA 1CF7B 4PCQA 2MW8A 4NB5A 2R7TA 3E6CC 3HUGB 5J4YA 1UELB 4HDUA 4XRSG 2R93J 5C4JJ 1L3LA 2DPDA 2DW4A 1IV6A 2CS3A 3CUQC 3VWBA 1PP8F 2Y0SN 4OAYA 1V5GA 5K5OA 4KT5C 3Q0WA 3MQ0A 4BKXA 5GPAA 2O5RA 1W0UA 1MSFC 2R5YA 1R1TA 4QIWN 2E1MB 4UY8I 2DYSH 5H2FC 1K6OA 3EUAA 4YG2F 1JE8A 1JKQC 2DAOA 1JJ6C 1YW9A 3TO9A 2DOFA 2ZMEA 4EMSA 1K4TA 2YUSA 3MAJA 5TISC 2W4SA 5HDGA 3WGGA 2NAZA 5IT3A 3PSFA 3KZYA 5HOOA 3OL4A 4XLAA 2COMA 2ZKZA 4CA0A 3IWZA 4J01A 1EH8A 1GLNA 2E60A 2ICWG 3BG5A 4C2TA 4MTEA 2VXZA 1HC8A 2KIMA 1LE8B 5J40A 5FLXK 2L4AA 1ZG3A 3U1KA 5HLIA 5E3OA 1HSJA 2BY0A 5D5VB 3HG9A 1OR7C 2CWEA 2E7XA 4XRMA 2K9SA 4M71A 3SDBA 4S04A 1Y56A 3E6DA 2D2WA 1JUSA 3D5SC 2HTSA 3ZR8X 2A3SA 1R5GA 2DBBA 4EM2A 1DQUA 2JA7J 2VT2A 2MGQA 4GGGA 5B3SH 1JKRC 3JRDA 1NTCA 2VJJA 1Q1HA 3FMQA 3SJMA 3F0CA 3QODA 4B43A 3X2QH 2FBIA 1USSA 3GZNB 3LA3A 4XLFA 1W5SA 1ZELA 2I5UA 1XGMA 2M5WA 1HKSA 5ICEA 4C3HJ 2GIZA 3DBHB 5GAGJ 2ZXJA 4G8XA 2DA7A 1E3HA 2HVQA 1J0RA 3SHFA 1T39A 2OTJI 2G7HA 3KP2A 3LAJA 3K1NA 3HOYJ 1MDMA 1VF9A 2ZB9A 1D8JA 2QLZA 3A02A 4LFUA 1FOYA 2IGKA 3LWFA 5ILVA 1VQ5I 2P5VA 2CV2A 3LA7A 2ZMEC 4BEHA 2VJIA 2QSFX 3CUQB 1FYKA 1XC5A 2QQAA 1I5ZA 2XUBA 5FD6A 2FJ1A 1WKMA 3DEWA 4RAFA 3LAPA 4FQGA 1Q1VA 2A6EF 6PAXA 2FXAA 3W6JB 1IN8A 4M74A 1W7PA 1VQMI 2P6TA 2CO5A 3NQOA 3CCVI 1FYMA 5DD4A 3OSFA 2F5VA 2O9LA 4E7JA 1MMAA 1W4MA 2A6HF 2QM3A 4N4OB 3SZTA 2DTRA 1LUJB 5D8KB 4CXFA 2K86A 3GTPJ 1IDZA 3CP8A 3S2WA 4IHWA 4Y17A 3GFIA 4OIPF 4I2OA 2KJCA 4XM3A 3CDIA 1ZN2A 2F48A 3K70D 2BY2A 3S17J 1A36A 3JRAA 2LNBA 4CCOA 4B1RA 2L9SA 3VSLA 1JUPA 3C18A 4AWXB 3G1OA 3RDIA 2CW0F 2PJPA 2OZUA 4KIFA 3V7CA 4E4HA 5K7FA 2K85A 1TBXA 3E3VA 4DOZA 1FC3A 3PNYA 1HSTA 1DP7P 2UXXA 4HSTA 1A31A 4I98B 4UB8C 4Y52J 1D0YA 2QZ8A 2XRLA 4XLNF 4M6XA 4EJWA 4GO1A 2RGVA 1ENHA 4D7NA 5ICCA 2W82A 4B44A 1FTZA 2ZJRF 2Q2EA 2FA5A 4OMYA 9ANTA 2BOLA 5KVRA 4C30A 3CO7C 2RKHA 1YS7A 3DQVC 1AWCA 1XD7A 2LKSA 3RIRA 3M07A 4BE2A 4CCLA 3HKZN 2R7UA 2D5VA 3CD6I 4MEXF 1FBQA 4U0YA 2MSYA 3H92A 2EIKH 2VKVA 4UNOA 1R6RA 3AG3H 4HG2A 2HGCA 3ZN1A 1VQ9I 3RPQA 1V5FA 2L0KA 5IP7J 4FT8A 2ADUA 2LRDA 3PM1A 1A6IA 4YELA 2LR8A 2OF7A 4U0VA 3TQNA 2VLAA 1G3WA 5J4VA 2G0EA 3E0JB 4ESJA 3K6GA 2XKPA 3KIOA 2MG4A 4C9YA 4GDFA 3BR6A 3F8FA 3IC7A 3ZMTA 3P5JA 3RPUA 3KFWX 4EQQA 4U7BA 4EM1A 1Z6TA 4XQFA 2JA5J 3K4NA 2AXTC 5H20A 1Z6RA 1PUEE 3F6VA 3F8NA 3K2ZA 3QP6A 5FLXZ 2JJ7A 3H35A 4I7HA 1B8IA 5DUKA 3OYIA 3A1YA 4I09A 3K4CA 2E1OA 2HZTA 2B0LA 3H0GJ 1D1BA 3ZQIA 1K79A 4KICA 4RGSA 2V1XA 3GFJA 4E7SA 2WA0A 3R60A 3IRQA 3EUHC 2KIQA 1MJAA 1FYLA 2DK8A 2PX9A 2L7KA 3A0HC 4JX5A 1V4RA 4PSXA 2H94A 3I59A 1BI1A 2VASA 4BXXJ 1HKTA 2WAQA 2HXIA 1B59A 1SFXA 4ENMA 2E5NA 4IHSA 3S8PA 2HVRA 2KRFA 2RVCA 4BQQA 1ERDA 2VBWA 2R7WA 1W36D 1IG7A 1FP2A 1J2XA 2WV0A 1SFKA 2MYSA 3LFKA 1MH4A 1BA5A 2CG4A 3A03A 2BVMA 3L00A 3TDZC 3BR2A 2F4IA 3IP4B 4XKVA 3W2AA 1MD0A 4A3JJ 4L0YB 3WU0A 5E17F 4PJMA 3BZCA 3J7ZI 4UUVA 1MBJA 1WI3A 3AL0C 1WI9A 4L9NA 4KN4X 2LSOA 2FOWA 1S7AA 1I6XA 1BI2A 2P7VB 2AO9A 1H88C 1IGNA 3GF2A 3CO6C 3QPSA 1EA3A 2LY1A 4CYDA 2VE8A 3KETA 3DWLE 2L7ZA 1FNNA 2DMPA 3H9GA 1T98A 3V4GA 4L9VA 2E1CA 2DO7A 1G3TA 4BBRJ 4LMYA 2R7SA 2QCOA 5D8LB 1TWCJ 4PJLA 2YX7A 3RYPA 1ETOA 2CUJA 2QF7A 1WFXA 4E7HA 2ECBA 1JKPC 3V8JA 2NS0A 3BR3A 4LG0A 2LY2A 1SD6A 4FX0A 1SAUA 3K0LA 2VOPA 2VC0A 4I76A 2FE3A 3FHNA 5F0FA 2L01A 3NARA 4XLCA 2V79A 3P7NA 1UJ8A 2M7BA 3A0BC 5HLGA 1XCVA 3KPHA 3OYMA 2HOTA 4BJ6C 1ZGAA 2GQQA 1FP1D 2HPMA 1JGGA 1J7KA 2XAFA 3H9JA 2JVHA 1U5TA 2W57A 1U6GA 4A3CJ 1YFHA 4ANJA 2K27A 5J8CA 3D0SA 1RR7A 5FRMA 3CJNA 2V9KA 4B8XA 1NHAA 3DKYA 2JWTA 1XS9A 1SD7A 3BR5A 4LITA 3QWLA 1ZG1A 1MZBA 5J1YA 5IOZA 3KEYA 3H3UA 2FNAA 4OIOF 4KFCA 3WTUC 1ITYA 1FMWA 1YS6A 2XKOA 4X6AJ 4XICA 1H89C 4ENKA 2JRMA 3HYIA 1DP3A 4A3LJ 2RQPA 2UXNA 2VQHA 2W85A 3CCLI 4LB6B 3O8GA 2EV6A 4G12A 1G8XA 4LIUA 5K7ZA 2QSHX 2EFNA 4IL6C 1D8KA 2LDUA 3ZN0A 1BJAA 2HDWA 1FTTA 1U9OA 2DODA 3T0YA 2VOOA 1F43A 3ZXSA 2KRHA 3TOBA 2LLKA 1K4SA 1R00A 5HS9A 3AL0B 4E7LA 1GVJA 4F3QA 4O3MA 1QHHD 3C7JA 4GYIA 5J6XA 3H5RA 5F6FA 4RLQA 2Y31A 2D1VA 1SD5A 3HSEA 5EG0A 2FUG2 4ABZA 2IA1A 2R92J 2R7ZJ 4YFNF 1GUUA 3JTHA 4LK0F 1R1UA 1EKEA 1LDKB 1YO5C 2L9NA 3IUOA 1HLVA 1IW7F 3IH2A 3HHGA 4PUSA 2Y0SA 2NOGA 1R49A 1D1CA 2BW3B 5EF6A 3PJRA 1ZLJA 3JRIA 4A2UA 1FSEA 1ZYRF 2A69F 1SAXA 2ZO4A 3ZQGA 2IS1A 4XL9A 2FBHA 1TT0A 3FISA 1WCMJ 5FKLA 4GFBA 5FKOA 1OPCA 4JYKA 3DPUA 3HZJA 4PJ0C 5IYCJ 1YIJI 1G3YA 4E6KG 3RZDJ 1JI8A 2GOMA 2IVMA 3HXLA 2XROA 1O3RA 1ON1A 4V2FA 3FIWA 3OOPA 4CCJA 2XGCA 1TWGJ 4OU0A 4FETA 2HYGD 1B4AA 3ZPLA 4KUMA 3GTMJ 3COAC 5FKNA 5JVTA 2IW5A 2RQQA 1MJ9A 2QSGX 3D1NI 4PFPA 3FMSA 1X3ZB 2LH9A 3ESWB 4RB3C 2M1BA 2QBYB 3AG2H 4RGXA 2STWA 3PQJA 3E97A 4JQFA 4ASNA 1UFMA 3GZ6A 2QQ8A 1EV7A 1ETWA 4HNUA 2M8EA 2V1UA 5H6RA 1H0MA 1LVKA 4X1EA 1T95A 4B48A 1VQKI 1HCRA 1WJFA 3VOEA 3DF8A 3KZZA 3TKYA 3CF5F 2P81A 1N25A 3UR3C 2NNNA 3Q5FA 4BJTA 1XB4A 2HI3A 2MC3A 3MD2A 2EQRA 2FQ4A 4IF4A 3LSMA 2KL4A 1APLC 1VZ0A 3I64A 3KLNA 4M9ZA 4MFEA 3WGIA 4CHUA 4N9HA 5TGTA 4UXNA 1TW2A 3BOQA 3R0AA 3O2PE 3KP6A 1G2HA 4LG3A 3LSPA 5DCMA 2ISZA 5AONA 4KMUX 3K4LA 5E1XA 2JA6J 1JHFA 1S5LC 5LLQA 5E3NA 1A6QA 2EA2A 1ETXA 3HOSA 1IRFA 3WU1B 4G7HF 2FMYA 1A5JA 1BIBA 1RIOH 5F0HA 1D5YA 3F72A 3CC4I 2PLYA 1FEXA 5IP6A 4KIGA 1GV2A 1TW3A 2R7FA 1YRNB 1FT9A 4XKBA 3L2VA 1Y8QB 4YRVA 2M8GX 5JHFA 4KDPA 2HDCA 1T0FC 3FK7A 3J7YJ 4RM2A 5EEAA 3CCQI 3S1MJ 4NDLA 4OINF 2PMZN 4CGZA 5D5UB 2K4JA 1TT5B 1E17A 5KCMA 2O8KA 2KIUA 3OYGA 1W5TA 3RQ4A 3QU6A 4BJ5C 3GTKJ 2F2EA 5D6FA 4M3GA 3CF2A 2I10A 5FFXA 3JRBA 2BY1A 3M1CA 1TQPA 4TV7A 4AU7A 4CH7A 2X9DA 1FBUA 5JHUA 1YHQI 3HPGA 3LFUA 4HYEA 3OYLA 3F21A 2JA8J 3HOWJ 4Y3OA 4QWQA 1GXPA 2Q0OA 2IT0A 2KLOA 4F7ZA 2H8RA 5TJJA 4ZC3A 2OPTA 3S2DJ 5E20A 2Z33A 4D5FA 1VQ8I 3M7GA 2MH9A 1N78A 2AS5F 1Y39A 2XF7A 3ZQHA 4AUXA 1HW5A 4Y33A 3HM5A 4UUSB 2EPFA 1GT0C 3JRHA 1B72A 2Y48A 1TQIA 1HBXG 5E8GA 1WZ2A 2F4MB 1ZARA 3DBLB 3I3LA 4A6DA 5GTHC 1H9TA 4RLFA 3CCRI 2E2HJ 4OIQF 3K4JA 3J7AO 4PJNA 1TC3C 3JSOA 4E7IA 3Q9SA 4BAYA 4OIRF 3ERED 2TDXA 2E71A 2Z2SB 3LQQA 1F4KA 3BG9A 1S7OA 1KU9A 1RNLA 1QU3A 2VPLA 3CMAI 1ZK8A 1OCCH 1BJZA 3I58A 1Z21A 3CJQB 4M3BA 1TNSA 3BTJA 3HOTA 2R0QC 1IDYA 3VYSB 1U8BA 2ZNYA 3HB9A 4BYYA 4CYCA 3S2HJ 2EB7A 1ONVA 4M9XA 1RESA 4PJJA 4U88A 4LIVA 5CVJA 2CJJA 2XGEA 2PJRB 1TWHJ 1FOWA 3GCMA 3BWGA 3NWSA 2KPMA 2G9WA 3R0JA 1XMKA 2GOXB 1JT0A 3QPHA 3DXJF 5HVQC 4L18B 1KU2A 2JA2A 2GWRA 5IY5H 3ABKH 2VBYA 2NOJB 1R58A 2DOEA 1T08B 2HR3A 4L0ZB 3V42A 1B9NA 2V9VA 3GTJJ 2VKEA 4IQ4A 4Q5SF 4G6TB 4Y4RA 3TEDA 1IF1A 2KP6A 2M2EA 1R9TJ 3ZMZA 1LFPA 4A3EJ 2CRGA 2CQQA 3MN2A 1O3QA 1KQ0A 2Y69H 4IZZA 4XSZF 1U3EM 1SANA 2F6CA 3IKVA 1BC7C 2DDBA 4M9SA 2BZTA 4EATA 1ETQA 4DBQA 2JQ7A 1MMGA 4LLLA 3GWZA 4YIRX 2ID3A 3EPZA 5GTIC 2K3PA 4NQWA 1OYYA 1FOXA 2CUFA 1Z7LA 5H6QA 1TL8A 1ZQ3P 2QKLB 1UG0A 4HX4A 3DFGA 4UV8A 5GADJ 1ZGWA 4I02A 4ESBA 2H27A 2VJ4A 1GV5A 2YPRA 3PUFA 1FWZA 2V7FA 5IPAA 1DU0A 1RRJA 3E1SA 4BXUA 1WJDA 1YW8A 5HS8A 2HQAA 4XORA 1HA8A 3SZGA 3S1NJ 4U0WA 4RA2A 2OC6A 4AC0A 1I1GA 4IQJA 1IC8A 1BR2A 2X6XA 3K4MA 1R23A 3LMMA 1Z3XA 1XGOA 2G7UA 3WE3A 4DQ2A 2DFHA 3VSKA 3B73A 5FO5A 4A6EA 5BOXA 1BI0A 1KU3A 3ECOA 5FKKA 5E8IA 3LSTA 4JP0A 1KU7A 2FQ3A 3BT9A 2A5YB 2CW7A 5DCFA 4XRFA 4I99C 4KA4A 2Y75A 4AVPA 5FD5A 3QRFF 2HTJA 3MKWB 2K9LA 2H09A 3FKIJ 1AOYA 4HLYA 2BHZA 3PSIA 1V5EA 5CJ9A 2DA2A 5FRNA 2NVQJ 3R61A 2Z1DA 5JFRA 2ELJA 2RAEA 4D1QA 3CC2I 3T5XA 2O8XA 1TQMA 2VQCA 2FEZA 3E5QA 5E18F 2DMUA 2ETHA 3S15J 4A3FJ 5C4XJ 4FCYA 2IS6A 2ZJPF 1ZTRA 2HOSA 1KZHA 2YR2A 5IT9K 5BQTA 1X4PA 3U9GA 4NC6A 4HX8A 3MCZA 1J75A 1LFBA 1AU7A 4BQNA 1XSXA 1E0EA 1ZRFA 2E19A 3FBNB 1P6RA 4C2MJ 2DA3A 2QQ9A 4HPQA 1U8RA 2M9HA 1IAWA 1FJLA 2KISA 4Z6YA 4BDYA 3BR0A 1ETKA 1AKHB 1G4DA 2KHMA 4HX7A 4BY7J 3JAMZ 2DLLA 5ERIA 4YEJA 1H9GA 1ZHFA 4B4CA 3GTQJ 4JOMA 4RMNA 2A07F 1W7PD 2DDAA 1OYWA 3IKTA 3PNTA 2Q1ZB 5K5RA 1MBFA 3Q3SA 3SFZA 1XGSA 2M34A 5EZHA 3FM3A 1UMQA 2DN0A 1X2NA 2LBFB 5LGNA 2BHYA 2X48A 1Z0XA 2IJLA 2K9QA 3ASOH 1YYVA 2UWMA 2AHQA 1E3OC 3ZGKA 2LYCA 3OIOA 1JUMA 5LEKA 1QA6A 2ESNA 3GX4X 5E79C 4PK4A 1SMTA 4M3EA 1WWXA 3L2RA 4XONA 1Z67A 2F4OB 1HF0A 4GXOA 1LKXA 2MABA 1QHGA 5CQGA 1R4NB 2WB1A 2XGXA 3CLQA 3GO5A 5ED4A 3IV5A 1XSDA 3I55I 3BPVA 5L3CA 3MKZA 3QPTA 2F5FA 4R79A 1RZ4A 3MFKA 5J1UA 2R5YB 2YX4A 3GTOJ 1VNDA 3M3YJ 1WJAA 2ACJA 2X1EA 1ZH5A 1OCPA 3IAM2 3CCSI 3GTGJ 1KYWA 2ZMEB 5C44J 3DU6A 5J1RA 3RTRA 4KT6A 3L9FA 4P55A 2OJED 2PQ8A 4HNVA 1WH7A 5DDGA 3TP3A 2NVTJ 2VONA 2DT5A 2MFZA 1MBGA 2JSCA 3DLLF 1BR4A 4RGUA 4E70A 3PIPF 1KGSA 3RYRA 4C2UA 3KYCB 4DZJA 3GLXA 1ZG5A 1IZ1A 4CICA 4BDZA 1NG7A 1YJNI 1ZRCA 3KYDB 4CCKA 4LK1F 4IHVA 1OJLA 1UZCA 3CMEI 3WTYC 4HV5A 4XKCA 5HNFA 1MNMC 4G94A 4BS9A 3Q0UA 4M3DA 3H0DA 3FX3A 1HXDA 4IHYA 5LEJA 1T2KA 2CUZA 4EJUA 2R7RA 3GLLA 2XRNA 2V1NA 3DKWA 4ZZDA 3WODF 1YJWI 2VE9A 1O57A 2AQFA 2DFIA 3HOZJ 4HA8A 3SFIA 2X6YA 3P9IA 2HQNA 5K7HA 2MA3A 3BZKA 2EFOA 4HF2A 4LLNA 2BW3A 4DJAA 2A5WA 2DA4A 3LSIA 2YSRA 3ZQ7A 3S1RJ 4BACA 4UUTA 3BTLA 1D5VA 3IL2A 2DJNA 3I4PA 2ELHA 2XF6A 3EETA 1BW6A 2P7CB 3BROA 3ML6A 2LOOA 5EZGA 1KQ8A 5ICGA 2K9NA 1MDMB 1LDDA 2EIMH 3L7WA 3O6BB 3SZPA 1ACIA 1U0JA 3AG4H 5LHIA 4UB6C 2IGMA 2JRTA 4ZJZA 2VT3A 2K5CA 2LF7A 5KAIC 2XAUA 4ITVA 2BXZA 1WJBA 2O03A 5C3EJ 1L0OC 2R7OA 5M3MJ 3I5UA 1W5CC 5IT9Z 2RN7A 3IH4A 3KEOA 2VBZA 4GCVA 1W7PB 4OMZA 4AM3A 2ZXIA 2GIVA 1X1DA 3TW7A 2HS5A 1LQ1A 2FU4A 2ZFWA 4WXDA 4A3IJ 1OFCX 3E7LA 4Z2YA 1B9MA 1BC8C 2P0WA 4BNCA 2X85A 3WE2A 2I8DA 2KFDA 4MTDA 3KP7A 2EK5A 4FHTA 3WTTC 1K78B 3FM5A 1YJ9I 1RKTA 1X19A 3UKGA 3PNVA 4WXCA 1QZYA 1MMDA 4NUBA 3H5NA 3A01B 5HDKA 1MJBA 3WHBA 2HEOA 2M4KA 5B66C 3MMYB 3KZIC 3E5XA 5L3DA 4XLPF 1X2MA 4IJAA 2FD5A 4M3FA 1RETA 1YW7A 4DYQA 4IRHA 4RAZA 4AIJA 3OS1A 3M8JA 1R1VA 1TP4A 2XAQA 2TRTA 4MFDA 4UHTA 1D1AA 4IOAF 1Z77A 2EH3A 2CFXA 2ZBKA 1IN4A 2DA1A 3OYFA 3BQZA 1LFUP 3TL4X 1LB2A 1DPUA 2LP0A 1BOAA 1O3TA 4YIIA 3HGYA 4EM0B 1YITI 1XMAA 1K83J 2Q2EB 2L9RA 3N05A 3IH3A 3OR2C 2J5OA 4MNUA 2GXGA 2LKPA 2PBIA 4V19K 5GAHJ 1DGWY 3DPTA 3ISPA 3BQYA 1YRNA 2ZNZA 3LSRA 3V7RA 2IPQX 1MIJA 4IO9F 4BL0B 1GHCA 3G1LA 2CQKA 1ZKGA 1J9IA 2Z5UA 3CC7I 4WK8F 4JX6A 4DW6A 1X1CA 1YLFA 2VN2A 4XBFA 3S3OA 2RNJA 4MHGA 3RI4A 3I54A 5LGTA 3DKXA 3BZ6A 3T1BA 3V8LA 4BE1A 3QP5A 1IV8A 2KIFA 2OUMA 2XB0X 2DPUA 1S72I 2XASA 3CESA 3E6BA 4LLGF 2K02A 2QKMB 1S6LA 1JJ8C 3QU3A 4ZYHA 1PP7U 3KCCA 5HODA 4A0XA 1HOMA 4F93B 5AIPA 1XPXA 5K1YA 4BUPA 2KZVA 2Y9ZA 1MBHA 1B8IB 4P9FA 1MW7A 3TBIA 1QQIA 2K3FA 1X1AA 3SEQA 2GLOA 3DCFA 1XDSA 3LSGA 1U5TC 2NYXA 2ESHA 2QUFA 1P7JA 4O6JA 2H6BA 3JRCA 5JVGF 3NAUA 3FXOA 1O4XA 2VPRA 3F3XA 5DD8A 1BBYA 3F6OA 1R5HA 4NBQA 2EWNA 4FX4A 3SEZA 3SYTA 4A69C 4F91B 2LG4A 1Z7UA 3PFIA 2UZKA 5TRDA 3FHZA 1A04A 2JMWA 5EGOA 2D45A 5L3BA 4BQAA 3S1QJ 1WJEA 2GXAA 3RJPA 3CLOA 3OS2A 2ZJ2A 4BHCA 1USTA 3OOUA 3CMMA 4WF2A 3HL2A 5M5WJ 2DMQA 1ETVA 3MWMA 2DU9A 2IXSA 3QAHA 1U78A 1NH3A 2YS9A 3FXLA 3QYFA 1BOBA 3FK6A 1SVLA 2X4HA 4L5EA 3I4MJ 4LOCA 2GAUA 1CF7A 2VKDA 2PJRA 3CMYA 3M8EA 3ABTA 3ZCOA 3I56I 3HUGA 3MVPA 2BE5F 3W2WA 1OCOH 3P9CA 4HAMA 3K4KA 2CSOA 1S3JA 3VYRB 2TCTA 2A05A 4ZYEA 2O0YA 3HIFA 4S05A 3K1PA 4L5JA 3FXKA 4G7OF 4PFOA 1FY7A 1TNTA 1MGTA 2EZLA 1P9QC 5BPIA 2EZIA 1G59A 2V6CA 1VQ6I 1F9NA 2XAHA 2HKXA 2MBFA 1Z91A 2WAQN 3K7AJ 4LD5A 2E2JJ 2OU2A 1UAAA 3QOPA 4RGRA 1D0ZA 3AG1H 1ZREA 4IXAA 4WXHA 1MBEA 4UV9A 2OZ6A 3ZMDA 1T8IA 3PO2J 2VBXA 4PZJA 5LRRA 3FKJA 3OYKA 1R36A 3NEUA 4LG0B 4A5MA 2XHKA 5B1BH 3W6KB 3OWTA 3O3KA 3OYHA 4W1UA 1XDUA 2FX0A 3M8FA 5ILUA 3HEFA 1R5ID 3BJ6A 1OCZH 2CQNA 1PUFB 1LE8A 1I6HJ 2ZC2A 3I0TA 2FNPA 2BEOA 2A68F 3H3ZA 2V1DA 3GZ5A 5CVVA 2GA1A 4B3XA 4KMFA 2GBYA 3IAS2 4XOPA 3UNGC 4BHPA 3FZVA 3EUKL 3DTEA 3BPXA 3HTUA 3FBIB 5HDNA 5F0CA 1MBKA 1SVOA 3BJAA 1I39A 1JHHA 3S93A 4ZTJA 2VQLA 2F5CA 1JTYA 4Q48A 4XMYA 2Y2ZA 2JUGA 2QYOA 3RKQA 3S3MA 1ON2A 1IN6A 2M0MA 2PMHA 4CUGA 5HLHA 2LK2A 2VODA 4Q47A 2FBKA 4HLXA 1D3YA 1QPIA 4RS8A 3ABUA 3GXOA 2ECCA 1TTYA 5FJ8J 2NXNB 2HQ5A 3S32A 3C1DA 3A2KA 4BQOA 2OA4A 4ENJA 2RREA 2QENA 2EFPA 2HU9A 3FXQA 1SC7A 3BC8A 3ZQLA 2JTVA 2B9SA 2OAZA 2LC2A 3HDDA 3GFLA 1O3SA 2F5EA 2V4JC 2KMUA 3BCAA 3JSPA 2EZHA 4J19A 2KDOA 4HV6A 2HDDA 2PN6A 3LSJA 2V9PA 1PYVA 3CUQA 1LEAA 2JUCA 2LF8A 1QVTA 5E3LA 5F1RA 3HGGA 2NRAC 3N4MA 1IRZA 1IJWC 3MZYA 1Y6IA 4MLOA 1ZLKA 4F52A 2B63J 3JR9A 3A4CA 5EG0B 4AVZA 3BDDA 5B1AH 2ZXHA 4M6VA 2QA4I 1M1EB 3OS0A 2EV5A 2DJIA 3I4NJ 2MD0A 3CDHA 3G1MA 4EGZA 5A2QZ 2JSPA 2XAGA 4DGWB 3JAMK 3J7AY 3HKZA 3RKWA 1REPC 2JZYA 3BLYA 2WV1A 3CJRB 3ASNH 3LA2A 5D6EA 5FROA 2M3AA 3WTVC 4BXFA 1NK2P 3JRFA 4IKFA 3BJOA 2ME6A 1S29A 4A3MJ 4ZYAA 1WH5A 2PMUA 1AKHA 1VQ4I 1RC9A 3M4OJ 2MLGA 3HRSA 4WWCA 3O8HA 2JPBA 5LBQA 5IOYA 3FMRA 2AQEA 4MO7A 5JLXA 2KJBA 1IN7A 2VKHA 3CCYA 1MH3A 4EVIA 1B6AA 1OR7A 4R1HA 2XGDA 1X1PA 1K6YA 1EH6A 3CUOA 1J09A 2VXDA 4FISA 2E2IJ 2L5QA 5F64A 5ICFA 5EEHA 2DCEA 2MD5A 3JW4A 4IEJA 4ENNA 1WPKA 3KEQA 4KYWA 3OIPA 2PEXA 4PSWA 5KK1A 1KYZA 2X6WA 1VQ7I 1FLIA 5J8FA 5IYDJ 4HF0A 1MSEC 2BBYA 2QWWA 4KNYA 2XAJA 1RUOA 3GEZA 2VC1A 2R7QA 4HQMA 4KN7X 3F22A 4HDVA 2KQRA 1U9NA 2Y30A 3M9AA 5CQEA 1Y1WJ 3ZRGA 2UUZA 3WHCA 3L2CA 2XSJC 3K69A 4JK1X 2EILH 2HYFA 2X0LA 2OCCH 4LB5A 2VB6A 2R4GA 2FSWA 3ZMSA 1QZZA 4PGHA 3R4KA 2W7NA 1D0XA 3DBRB 1X3UA 1IUYA 1SFEA 2P5KA 1S7EA 1VQOI 3C2HA 3DEUA 5EDNA 4ON0A 1HDDC 3K9TA 4X0GA 3QOEA 2XB5A 1V3FA 1TZLA 2WBMA 4Y13A 3BG3A 1UHWA 4ZDLA 2OCEA 4WX9A 4OAZA 1YE9A 4HNTA 1JGSA 4M6YA 5DCMB 3OR1C 1S8NA 3KLOA 4NHJA 3G3ZA 2IA0A 2L3DA 4LGWA 2OTLI 1GXQA 1YX5A 3OYJA 1P2FA 1G3SA 1IXSB 4N9IA 4C3JJ 3TGNA 4XLHA 5GP9A 3H1CA 1VTNC 3DEEA 1X4OA 3ULQB 4AD9A 3KYLA 2GXBA 3GTLJ 1J5YA 5KHDA 5F1JA 2W84A 4RAGA 1TLHB 3VODA 3I53A 4P5OA 3FF5A 4F92B 3M1EA 5E3MA 1I50J 2OD5A 3WG9A 1EH7A 4ZH4F 1FOKA 1HKQA 2WWYA 1O7LA 5L3GA 2V26A 1R22A 3OYBA 1N75A 2V6EA 3CZ6A 3K4BA 3OYNA 4IPAA 3J81K 4II2A 4H4KC 2DA5A 3TDUC 3GBGA 4I0AA 4XN0A 2XVCA 2VJ5A 1WJCA 4FTHA 3L09A 4IHTA 3MZ8A 3QYEA 1OMIA 4EJTA 1UB9A 4CZZA 4IOCF 2NS7A 3HC7A 2CUEA 3HJEA 3F8CA 3GW2A 3VFZA 3EDPA 3TP0A 2QVOA 4Y7NJ 1UHMA
chains in the Genus database with same CATH topology
4C3IJ 4JYKA 2O7OA 2VUMJ 2LFBA 4D5CA 5IYCJ 1B72B 2GM4A 3S14J 4BBSJ 3RZDJ 1RKWA 1OCTC 4V2FA 5C3EJ 5EYRA 2KT0A 3FIWA 5EGOB 3JRGA 2XGCA 1TWGJ 5M3MJ 3IH4A 1JKOC 2R5ZA 3GTMJ 3TW7A 3ZOBA 3L1PA 2JN6A 1ORKA 1FIPA 5FKNA 3HOVJ 4A3IJ 1OFCX 3E7LA 3D1NI 2R5ZB 5FLVA 3A01A 3TW6A 2K9NA 1RKTA 3UKGA 1ETWA 2MW8A 3PO3J 5IYBJ 3A01B 4X1EA 4CYCB 3WHBA 4XRSG 2R93J 5C4JJ 1IV6A 1HCRA 4A3BJ 1X2MA 2FD5A 5FKMA 2Y0SN 3MKLA 4M3FA 1RETA 3Q0WA 4BKXA 2P81A 4DYQA 5GPAA 1W0UA 2LY9A 1MSFC 2R5YA 2HI3A 4QIWN 2EQRA 2FQ4A 1JKQC 1JJ6C 2TRTA 4MFDA 4S0HB 1APLC 1Z77A 2EH3A 4MFEA 1QRYA 2YUSA 2DA1A 3BQZA 1LFUP 3HBLA 1TWAJ 2LP0A 1G2HA 3LSPA 3CQZJ 3ZQFA 3HGYA 1K83J 2L9RA 2L7MP 3IH3A 4RBOA 2JA6J 5E3NA 3BG5A 1ETYA 1ETXA 3BQYA 1YRNA 3VPRA 3LSRA 2KDZA 1A5JA 5F0HA 1LE8B 1D5YA 4AYBN 1VFCA 3G1LA 1FEXA 5IP6A 5E3OA 1GV2A 1ZKGA 3OSGA 1YRNB 3JREA 4JX6A 2M8GX 3QQAA 4DW6A 4XRMA 2K9SA 3FK7A 5EEAA 1JUSA 3S1MJ 4NDLA 2K40A 2PMZN 2O8KA 1RPWA 2JA7J 2XB0X 2MGQA 1JKRC 3JRDA 3GTKJ 1NTCA 3BR1A 4M3GA 3SJMA 3F0CA 1JJ8C 2I10A 3JRBA 5HODA 1Y1VJ 2X9DA 1HOMA 2DMNA 2VI6A 2JA8J 3HOWJ 4C3HJ 2Y9ZA 2DA7A 1MBHA 4DYRA 1B8IB 2H8RA 1CQTA 5M3FJ 2GLOA 3DCFA 2OPTA 3LSGA 3S2DJ 1P7JA 2XPVA 4D5FA 3HOYJ 3JRCA 3NAUA 4RDUA 1VF9A 2ZB9A 1O4XA 2VPRA 3A02A 3ZQHA 4AUXA 5M5XJ 3HM5A 4UUSB 4A69C 1ZR2A 1GT0C 1VI0A 3JRHA 1B72A 1XC5A 2FJ1A 3DEWA 2JMWA 5EGOA 3S1QJ 1Q1VA 1WGXA 2E2HJ 3OOUA 1FIAA 1TC3C 1GVDA 5M5WJ 1UG2A 2DMQA 1ETVA 3H3VK 2Y9YA 1U78A 2YS9A 3BG9A 3OSFA 4XIDA 2O9LA 3FK6A 4L5EA 2HYJA 3I4MJ 4LOCA 1ZK8A 1BJZA 4M3BA 1POGA 3GTPJ 1JTXA 3BTJA 3CMYA 4IHWA 1IDZA 4W97A 1IDYA 2R0QC 1U8BA 3HB9A 2LKXA 3MVPA 4CYCA 3S2HJ 1RESA 2CJJA 2XGEA 3S17J 1SFOJ 3JRAA 2TCTA 2M0CA 1TWHJ 4B1RA 1NK3P 2DMTA 1JUPA 1JT0A 3G1OA 2EZLA 5K7FA 2EZIA 1H8AC 5F27A 3K7AJ 2N8GA 2VKEA 3GTJJ 2WAQN 2E2JJ 3TEDA 4Y52J 2XRLA 2M2EA 1R9TJ 1ENHA 4A3EJ 4D7NA 2CRGA 1MBEA 2CQQA 3MN2A 2EBIA 1FTZA 2XPWA 3PO2J 9ANTA 1PUFA 1SANA 3LNQA 5JLWA 4W1UA 1ETQA 2FX0A 3HKZN 2D5VA 3HEFA 1I6HJ 2ID3A 1HDPA 1PUFB 1LE8A 2HOAA 2MSYA 2CUFA 2VKVA 1ZQ3P 3SDGA 1UHSA 1ZGWA 1GV5A 2GBYA 2L0KA 5IP7J 5IPAA 1DU0A 5F0CA 3PM1A 1MBKA 1A6IA 4FE4A 2X6OA 3S1NJ 2LR8A 2OF7A 4AC0A 2G0EA 1JTYA 2ME0A 1IC8A 5M5YJ 3C2BA 2Y2ZA 2MG4A 1F36A 3BR6A 4EEFG 3RKQA 2YU9J 2LK2A 2JA5J 3BTIA 4B3AA 5DS9A 3K2AA 1QPIA 2XSDC 2ECCA 5FJ8J 2JJ7A 2HQ5A 5FKKA 4JP0A 1B8IA 1X58A 3BT9A 2E1OA 3H0GJ 3ZQIA 3ZQLA 5FLMJ 2CU7A 3HDDA 4A3GJ 1I3QJ 2EZHA 4J19A 2HDDA 4UUSA 3FKIJ 3LSJA 4JX5A 2DA2A 1QVTA 4BXXJ 5E3LA 2NVQJ 3HGGA 2HXIA 1IRZA 2RAEA 3B6CA 1IJWC 2WB1N 4MLOA 2B63J 2DTZA 3JR9A 3RZOJ 5EG0B 1K61A 4M6VA 2DMUA 3I4NJ 3S15J 4A3FJ 5C4XJ 4FCYA 3G1MA 1IG7A 1ZTRA 2HOSA 1MH4A 3S16J 1BA5A 3A03A 4FE7A 2WV1A 3BR2A 1T56A 3HOXJ 1AU7A 1LFBA 1NK2P 3JRFA 4A3JJ 2ME6A 1BW5A 3Q0VA 4A3MJ 1WH5A 4XK4A 1AKHA 2E19A 1QVUA 3M4OJ 4C2MJ 4A3DJ 1MBJA 2DA3A 1WI3A 3O8HA 4JX4A 3CDLA 5IOYA 2M9HA 1FJLA 5J3LA 1BL0A 3BR0A 4MO7A 1ETKA 5JLXA 2H1KA 2IAIA 1AKHB 3CCYA 1MH3A 2AO9A 1H88C 4BY7J 1IGNA 2XGDA 3QPSA 4FISA 2L7ZA 4B4CA 3GTQJ 2E2IJ 2DMPA 1P7IA 4BBRJ 2EZKA 1MBFA 3Q3SA 2DA6A 2QCOA 4IEJA 1DU6A 1TWCJ 4QSHA 2M34A 1ETOA 4MIMA 5EZHA 2QF7A 1UMQA 1WPKA 2DN0A 1EF4A 1X2NA 2ECBA 1JKPC 1TWFJ 2X48A 1Z0XA 3BR3A 5IYDJ 1JT6A 2K9QA 1MSEC 1IUFA 2AHQA 4I76A 2NVXJ 2LVSA 5F0FA 3W6VA 3NARA 1E3OC 3OIOA 1JUMA 1U9NA 2Y30A 2LD5A 1Y1WJ 3WHCA 3BTCA 2HOTA 4M3EA 1JGGA 5IP9J 1HF0A 2XPUA 2NS8A 4A3CJ 3LOCA 1T33A 1RR7A 4XRSA 3IV5A 5BNGA 2JK3A 3QPLA 5J1UA 2JWTA 2R5YB 2HXOA 3GTOJ 1VNDA 3M3YJ 5GPCA 1XS9A 1S7EA 5EDNA 3BR5A 1HDDC 1OCPA 4BY1J 3GTGJ 2XB5A 5C44J 3B6AA 5J1RA 5IOZA 5J1YA 3BG3A 5F08A 2ID6A 4QTRA 1XG1A 1W0TA 3ZQCA 5DTDA 1ITYA 4HNVA 1WH7A 4X6AJ 3TP3A 4XICA 1H89C 2NVTJ 1MBGA 4A3LJ 4DZPA 3O8GA 4G12A 3RQIA 4DZJA 5K7ZA 4C3JJ 5F04A 2CQXA 1FTTA 4I6ZA 1GDTA 5GP9A 4A93J 1U9OA 1ZR4A 4IHVA 1F43A 3GTLJ 2L7FP 1OJLA 5F1JA 1MNMC 2LLKA 3Q0UA 4M3DA 2COBA 4IHYA 2NVYJ 2Y31A 5E3MA 1I50J 1AHDP 4A3KJ 5EG0A 4ABZA 2IBDA 4IHXA 3HOZJ 3SFIA 4V2GA 2R92J 2R7ZJ 4DYCA 5K7HA 1GUUA 3HOUJ 2LTPA 2DA4A 1HLVA 2DA5A 2IEKA 3IH2A 2ELKA 3GBGA 4D7MA 3S1RJ 4UUTA 2NOGA 3BTLA 4FTHA 2DJNA 5EF6A 3JRIA 1BW6A 2NS7A 2CUEA 2W48A 3ZQGA 5EZGA 3TP0A 4GFBA 3FISA 4Y7NJ 1WCMJ 5FKLA 5FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I J;  4JYK A;  2O7O A;  2VUM J;  2LFB A;  4D5C A;  5IYC J;  1B72 B;  2GM4 A;  3S14 J;  4BBS J;  3RZD J;  1RKW A;  1OCT C;  4V2F A;  5C3E J;  5EYR A;  2KT0 A;  3FIW A;  5EGO B;  3JRG A;  2XGC A;  1TWG J;  5M3M J;  3IH4 A;  1JKO C;  2R5Z A;  3GTM J;  3TW7 A;  3ZOB A;  3L1P A;  2JN6 A;  1ORK A;  1FIP A;  5FKN A;  3HOV J;  4A3I J;  1OFC X;  3E7L A;  3D1N I;  2R5Z B;  5FLV A;  3A01 A;  3TW6 A;  2K9N A;  1RKT A;  3UKG A;  1ETW A;  2MW8 A;  3PO3 J;  5IYB J;  3A01 B;  4X1E A;  4CYC B;  3WHB A;  4XRS G;  2R93 J;  5C4J J;  1IV6 A;  1HCR A;  4A3B J;  1X2M A;  2FD5 A;  5FKM A;  2Y0S N;  3MKL A;  4M3F A;  1RET A;  3Q0W A;  4BKX A;  2P81 A;  4DYQ A;  5GPA A;  1W0U A;  2LY9 A;  1MSF C;  2R5Y A;  2HI3 A;  4QIW N;  2EQR A;  2FQ4 A;  1JKQ C;  1JJ6 C;  2TRT A;  4MFD A;  4S0H B;  1APL C;  1Z77 A;  2EH3 A;  4MFE A;  1QRY A;  2YUS A;  2DA1 A;  3BQZ A;  1LFU P;  3HBL A;  1TWA J;  2LP0 A;  1G2H A;  3LSP A;  3CQZ J;  3ZQF A;  3HGY A;  1K83 J;  2L9R A;  2L7M P;  3IH3 A;  4RBO A;  2JA6 J;  5E3N A;  3BG5 A;  1ETY A;  1ETX A;  3BQY A;  1YRN A;  3VPR A;  3LSR A;  2KDZ A;  1A5J A;  5F0H A;  1LE8 B;  1D5Y A;  4AYB N;  1VFC A;  3G1L A;  1FEX A;  5IP6 A;  5E3O A;  1GV2 A;  1ZKG A;  3OSG A;  1YRN B;  3JRE A;  4JX6 A;  2M8G X;  3QQA A;  4DW6 A;  4XRM A;  2K9S A;  3FK7 A;  5EEA A;  1JUS A;  3S1M J;  4NDL A;  2K40 A;  2PMZ N;  2O8K A;  1RPW A;  2JA7 J;  2XB0 X;  2MGQ A;  1JKR C;  3JRD A;  3GTK J;  1NTC A;  3BR1 A;  4M3G A;  3SJM A;  3F0C A;  1JJ8 C;  2I10 A;  3JRB A;  5HOD A;  1Y1V J;  2X9D A;  1HOM A;  2DMN A;  2VI6 A;  2JA8 J;  3HOW J;  4C3H J;  2Y9Z A;  2DA7 A;  1MBH A;  4DYR A;  1B8I B;  2H8R A;  1CQT A;  5M3F J;  2GLO A;  3DCF A;  2OPT A;  3LSG A;  3S2D J;  1P7J A;  2XPV A;  4D5F A;  3HOY J;  3JRC A;  3NAU A;  4RDU A;  1VF9 A;  2ZB9 A;  1O4X A;  2VPR A;  3A02 A;  3ZQH A;  4AUX A;  5M5X J;  3HM5 A;  4UUS B;  4A69 C;  1ZR2 A;  1GT0 C;  1VI0 A;  3JRH A;  1B72 A;  1XC5 A;  2FJ1 A;  3DEW A;  2JMW A;  5EGO A;  3S1Q J;  1Q1V A;  1WGX A;  2E2H J;  3OOU A;  1FIA A;  1TC3 C;  1GVD A;  5M5W J;  1UG2 A;  2DMQ A;  1ETV A;  3H3V K;  2Y9Y A;  1U78 A;  2YS9 A;  3BG9 A;  3OSF A;  4XID A;  2O9L A;  3FK6 A;  4L5E A;  2HYJ A;  3I4M J;  4LOC A;  1ZK8 A;  1BJZ A;  4M3B A;  1POG A;  3GTP J;  1JTX A;  3BTJ A;  3CMY A;  4IHW A;  1IDZ A;  4W97 A;  1IDY A;  2R0Q C;  1U8B A;  3HB9 A;  2LKX A;  3MVP A;  4CYC A;  3S2H J;  1RES A;  2CJJ A;  2XGE A;  3S17 J;  1SFO J;  3JRA A;  2TCT A;  2M0C A;  1TWH J;  4B1R A;  1NK3 P;  2DMT A;  1JUP A;  1JT0 A;  3G1O A;  2EZL A;  5K7F A;  2EZI A;  1H8A C;  5F27 A;  3K7A J;  2N8G A;  2VKE A;  3GTJ J;  2WAQ N;  2E2J J;  3TED A;  4Y52 J;  2XRL A;  2M2E A;  1R9T J;  1ENH A;  4A3E J;  4D7N A;  2CRG A;  1MBE A;  2CQQ A;  3MN2 A;  2EBI A;  1FTZ A;  2XPW A;  3PO2 J;  9ANT A;  1PUF A;  1SAN A;  3LNQ A;  5JLW A;  4W1U A;  1ETQ A;  2FX0 A;  3HKZ N;  2D5V A;  3HEF A;  1I6H J;  2ID3 A;  1HDP A;  1PUF B;  1LE8 A;  2HOA A;  2MSY A;  2CUF A;  2VKV A;  1ZQ3 P;  3SDG A;  1UHS A;  1ZGW A;  1GV5 A;  2GBY A;  2L0K A;  5IP7 J;  5IPA A;  1DU0 A;  5F0C A;  3PM1 A;  1MBK A;  1A6I A;  4FE4 A;  2X6O A;  3S1N J;  2LR8 A;  2OF7 A;  4AC0 A;  2G0E A;  1JTY A;  2ME0 A;  1IC8 A;  5M5Y J;  3C2B A;  2Y2Z A;  2MG4 A;  1F36 A;  3BR6 A;  4EEF G;  3RKQ A;  2YU9 J;  2LK2 A;  2JA5 J;  3BTI A;  4B3A A;  5DS9 A;  3K2A A;  1QPI A;  2XSD C;  2ECC A;  5FJ8 J;  2JJ7 A;  2HQ5 A;  5FKK A;  4JP0 A;  1B8I A;  1X58 A;  3BT9 A;  2E1O A;  3H0G J;  3ZQI A;  3ZQL A;  5FLM J;  2CU7 A;  3HDD A;  4A3G J;  1I3Q J;  2EZH A;  4J19 A;  2HDD A;  4UUS A;  3FKI J;  3LSJ A;  4JX5 A;  2DA2 A;  1QVT A;  4BXX J;  5E3L A;  2NVQ J;  3HGG A;  2HXI A;  1IRZ A;  2RAE A;  3B6C A;  1IJW C;  2WB1 N;  4MLO A;  2B63 J;  2DTZ A;  3JR9 A;  3RZO J;  5EG0 B;  1K61 A;  4M6V A;  2DMU A;  3I4N J;  3S15 J;  4A3F J;  5C4X J;  4FCY A;  3G1M A;  1IG7 A;  1ZTR A;  2HOS A;  1MH4 A;  3S16 J;  1BA5 A;  3A03 A;  4FE7 A;  2WV1 A;  3BR2 A;  1T56 A;  3HOX J;  1AU7 A;  1LFB A;  1NK2 P;  3JRF A;  4A3J J;  2ME6 A;  1BW5 A;  3Q0V A;  4A3M J;  1WH5 A;  4XK4 A;  1AKH A;  2E19 A;  1QVU A;  3M4O J;  4C2M J;  4A3D J;  1MBJ A;  2DA3 A;  1WI3 A;  3O8H A;  4JX4 A;  3CDL A;  5IOY A;  2M9H A;  1FJL A;  5J3L A;  1BL0 A;  3BR0 A;  4MO7 A;  1ETK A;  5JLX A;  2H1K A;  2IAI A;  1AKH B;  3CCY A;  1MH3 A;  2AO9 A;  1H88 C;  4BY7 J;  1IGN A;  2XGD A;  3QPS A;  4FIS A;  2L7Z A;  4B4C A;  3GTQ J;  2E2I J;  2DMP A;  1P7I A;  4BBR J;  2EZK A;  1MBF A;  3Q3S A;  2DA6 A;  2QCO A;  4IEJ A;  1DU6 A;  1TWC J;  4QSH A;  2M34 A;  1ETO A;  4MIM A;  5EZH A;  2QF7 A;  1UMQ A;  1WPK A;  2DN0 A;  1EF4 A;  1X2N A;  2ECB A;  1JKP C;  1TWF J;  2X48 A;  1Z0X A;  3BR3 A;  5IYD J;  1JT6 A;  2K9Q A;  1MSE C;  1IUF A;  2AHQ A;  4I76 A;  2NVX J;  2LVS A;  5F0F A;  3W6V A;  3NAR A;  1E3O C;  3OIO A;  1JUM A;  1U9N A;  2Y30 A;  2LD5 A;  1Y1W J;  3WHC A;  3BTC A;  2HOT A;  4M3E A;  1JGG A;  5IP9 J;  1HF0 A;  2XPU A;  2NS8 A;  4A3C J;  3LOC A;  1T33 A;  1RR7 A;  4XRS A;  3IV5 A;  5BNG A;  2JK3 A;  3QPL A;  5J1U A;  2JWT A;  2R5Y B;  2HXO A;  3GTO J;  1VND A;  3M3Y J;  5GPC A;  1XS9 A;  1S7E A;  5EDN A;  3BR5 A;  1HDD C;  1OCP A;  4BY1 J;  3GTG J;  2XB5 A;  5C44 J;  3B6A A;  5J1R A;  5IOZ A;  5J1Y A;  3BG3 A;  5F08 A;  2ID6 A;  4QTR A;  1XG1 A;  1W0T A;  3ZQC A;  5DTD A;  1ITY A;  4HNV A;  1WH7 A;  4X6A J;  3TP3 A;  4XIC A;  1H89 C;  2NVT J;  1MBG A;  4A3L J;  4DZP A;  3O8G A;  4G12 A;  3RQI A;  4DZJ A;  5K7Z A;  4C3J J;  5F04 A;  2CQX A;  1FTT A;  4I6Z A;  1GDT A;  5GP9 A;  4A93 J;  1U9O A;  1ZR4 A;  4IHV A;  1F43 A;  3GTL J;  2L7F P;  1OJL A;  5F1J A;  1MNM C;  2LLK A;  3Q0U A;  4M3D A;  2COB A;  4IHY A;  2NVY J;  2Y31 A;  5E3M A;  1I50 J;  1AHD P;  4A3K J;  5EG0 A;  4ABZ A;  2IBD A;  4IHX A;  3HOZ J;  3SFI A;  4V2G A;  2R92 J;  2R7Z J;  4DYC A;  5K7H A;  1GUU A;  3HOU J;  2LTP A;  2DA4 A;  1HLV A;  2DA5 A;  2IEK A;  3IH2 A;  2ELK A;  3GBG A;  4D7M A;  3S1R J;  4UUT A;  2NOG A;  3BTL A;  4FTH A;  2DJN A;  5EF6 A;  3JRI A;  1BW6 A;  2NS7 A;  2CUE A;  2W48 A;  3ZQG A;  5EZG A;  3TP0 A;  4GFB A;  3FIS A;  4Y7N J;  1WCM J;  5FKL A;  5FKO A; 
#chains in the Genus database with same CATH topology
 3GUD A;  1B1B A;  4C3I J;  4KIB A;  4LJZ F;  2VUM J;  1XN7 A;  3GYH X;  2LFB A;  3FWE A;  4O5V A;  4D5C A;  1E3P A;  4D9J A;  4K2E A;  4ZDP A;  3RSN A;  1B72 B;  2GM4 A;  3S14 J;  1R4M B;  1RKW A;  4EGY A;  3OMY A;  1OCT C;  2CQ7 A;  5EYR A;  2KT0 A;  3WGH A;  3CCM I;  1FZP B;  2L02 A;  3K10 A;  2P4W A;  3L2U A;  4NC8 A;  3CCE I;  5DM7 F;  3EYY A;  3ZOB A;  1K78 A;  2C6Y A;  1HW1 A;  4L5I A;  1NG6 A;  2DQR A;  3BY6 A;  5DM6 F;  1MKM A;  4P96 A;  1LDJ A;  2Z16 A;  2R5Z B;  1R7J A;  4B09 A;  3A01 A;  5FB2 A;  2E36 A;  3PFY A;  2HOE A;  1UCR A;  3PO3 J;  2AXL A;  5LGU A;  5IYB J;  4CYC B;  4RM3 A;  2Z3Y A;  1Z3Y A;  4XOT A;  4IRG A;  5FFZ A;  4A3B J;  2W1O A;  1MMS A;  2CMP A;  2PFB A;  1SMY F;  3MKL A;  3EUH A;  5FKM A;  4BHB A;  1ZRD A;  2DQL A;  2EIJ H;  3ONQ A;  3H5A A;  2LY9 A;  1YX3 A;  2IGN A;  4G6D A;  1VQN I;  3LSH A;  4A5N A;  4XKW A;  4WCG A;  4S0H B;  3GFM A;  1K7A A;  1KA8 A;  3I71 A;  3J80 K;  1QRY A;  3ZQQ A;  2M7A A;  4QLC U;  2FF4 A;  5CYV A;  3HBL A;  1TWA J;  3CQZ J;  3ZQF A;  3OYD A;  2ZSI B;  4Q4Z F;  2MLK A;  2L7M P;  4RBO A;  4UVB A;  1VQL I;  4OWR B;  3TMO A;  2HWV A;  1XSV A;  3K70 C;  2E7W A;  2B7E A;  4Y15 A;  1ETY A;  2CFO A;  4AIK A;  5L3F A;  2E34 A;  4DNC A;  3VPR A;  4N0B A;  5JI6 A;  2KDZ A;  3SXY A;  4HW0 A;  3S3N A;  4AYB N;  3OYE A;  2QGU A;  4NQW B;  1VFC A;  3W2V A;  2LMD A;  1FBS A;  3FXM A;  4ZTF A;  4CDG A;  2HKO A;  4CCN A;  3OSG A;  3JRE A;  3QQA A;  5KAF C;  3CP2 A;  2L2O A;  2BXY A;  4D0P A;  1RI7 A;  3R6S A;  1DPR A;  1LVA A;  2K40 A;  2PI0 A;  1ODD A;  3TOA A;  1RPW A;  1QBJ A;  3G2B A;  2XC7 A;  3BR1 A;  3G71 I;  3KP4 A;  2WTE A;  4OOI A;  2K9M A;  4HOB A;  5DYM A;  2IA2 A;  1P92 A;  1SFU A;  3NWT A;  3T8R A;  2VQG A;  1Y1V J;  2DI3 A;  3RPU D;  3TO6 A;  1O7F A;  2DMN A;  2VI6 A;  3HRT A;  2J5P A;  3OY9 A;  3P9K A;  3MKY B;  3F8M A;  3IRR A;  4JBA A;  1IXR C;  5LD2 C;  4DYR A;  5L3E A;  4AIH A;  2STT A;  3L2W A;  3EYI A;  1SD4 A;  2OV7 A;  1CQT A;  5M3F J;  2M4G A;  2E5Z A;  4MQ9 F;  2XPV A;  2L54 A;  2HNH A;  2BGC A;  4RDU A;  2KRC A;  2P6S A;  1Y0N A;  2ZXW H;  3DP7 A;  3C3W A;  5M5X J;  3OYA A;  1ZR2 A;  1VI0 A;  2ZJQ F;  3HSF A;  2FML A;  1OCR H;  1OKR A;  2WAF A;  3F8B A;  3DPL C;  3D5R C;  1WGX A;  4BEH B;  5BMZ A;  2Q8K A;  3J81 Z;  2IS4 A;  1FIA A;  1GVD A;  1UG2 A;  2NNY A;  4P1W A;  3H3V K;  2Y9Y A;  3ECH A;  4XID A;  4XR6 A;  1ZAO A;  2HYJ A;  2QBY A;  4B47 A;  4L9T A;  2IS2 A;  2K7L A;  3VB2 A;  3H9Q A;  1POG A;  4U7D A;  1JTX A;  4A12 A;  1T6S A;  4W97 A;  1A35 A;  1WVR A;  2YU3 A;  2LKX A;  1Y8R B;  2IGO A;  2X51 A;  4HRI A;  4PDK A;  4QPO A;  1PDN C;  2LRE A;  3ZMU A;  2KZG A;  5LHH A;  4BE0 A;  1N77 A;  2RDP A;  1SFO J;  3VDX A;  2M0C A;  3HHH A;  5LHG A;  2DK5 A;  2PMZ A;  2FRH A;  1NK3 P;  2DMT A;  4DIQ A;  2MC4 A;  1XTA A;  5ILS A;  4MGR A;  1FX7 A;  5DV5 A;  1H8A C;  4IVN A;  4E7Z A;  4RB1 A;  2X1C A;  1W36 C;  2M45 A;  5F27 A;  3CJT B;  2N8G A;  3CCJ I;  3JTG A;  1WQ2 A;  3H36 A;  2DOA A;  4I0B A;  1X3W B;  2O6G E;  2VIX A;  4ZDO A;  4IRI A;  2H6C A;  4YFX F;  3RKY A;  2EBI A;  2XPW A;  2HPI A;  4XLE A;  3G6E I;  3WTS C;  1PUF A;  3ZP5 A;  2R3S A;  3DU5 A;  3V8K A;  5D5X B;  4PGG A;  3LNQ A;  5JLW A;  2L4M A;  5CLS A;  1R71 A;  1E2X A;  3VEP A;  3HPH A;  4M72 A;  1HDP A;  2HOA A;  2ZFU A;  4YFK F;  4EJO A;  3KP3 A;  3ABM H;  2WAD A;  1DUX C;  3SDG A;  1F5T A;  1IRX A;  1V55 H;  1UHS A;  3NRV A;  4EJV A;  3FXR A;  2KKO A;  1YIO A;  3J80 Z;  2QEX I;  2P8T A;  4FE4 A;  2X6O A;  1IO2 A;  2EV0 A;  3WU2 C;  4ESF A;  2ME0 A;  2RNG A;  2XF5 A;  3C2B A;  2F5D A;  3LQR A;  5HS7 A;  5M5Y J;  1F36 A;  5CKT A;  3WTW C;  4F55 A;  4EEF G;  2P5L C;  2YU9 J;  1BR1 A;  1OQY A;  3FXU A;  2BY3 A;  4G7Z F;  2JPC A;  2DYR H;  3BTI A;  4B3A A;  2OQR A;  1OIS A;  5DS9 A;  1J59 A;  3K2A A;  3VYU B;  1XCB A;  3CCU I;  2XV4 S;  2XSD C;  2PG4 A;  5B5E C;  2WY7 Q;  1MMN A;  2DT6 A;  3G4S I;  4ZYG A;  3BG6 A;  3IWF A;  3K1M A;  4XSX F;  4IX7 A;  1X58 A;  4HZF A;  2OBP A;  1LJ9 A;  1STZ A;  2DFF A;  5FLM J;  2CU7 A;  4A3G J;  2XIG A;  1YQA A;  5A2Q K;  5JR3 A;  2CV1 A;  3C2G A;  2W00 A;  1RUN A;  1I3Q J;  3HRM A;  4UUS A;  2WY8 Q;  2WC2 A;  3GVA A;  3ROU A;  1RR8 C;  2QQB A;  3ZMV A;  5AIQ A;  3B6C A;  1XX5 A;  5HNH A;  2EFW A;  2WB1 N;  2ISY A;  3I59 B;  4HEA 2;  3RZO J;  2DTZ A;  4XNF A;  1I1S A;  1K61 A;  4MEY F;  5LRS A;  3OIQ A;  1Z05 A;  2K4B A;  3S16 J;  2H8W A;  5GAE J;  4FE7 A;  1QO0 D;  4QPQ A;  5EEG A;  1T56 A;  3HOX J;  1WHU A;  5K5Q A;  2HZD A;  1WJ5 A;  1BW5 A;  3Q0V A;  2M87 A;  2EA4 A;  3KX2 A;  4CSW A;  4BGD A;  4XK4 A;  5LFA A;  1BM9 A;  1QVU A;  1ULY A;  2CW8 A;  4A3D J;  4P9U A;  4JX4 A;  3CDL A;  3E6M A;  5CVR A;  5J3L A;  2BV6 A;  2EFQ A;  4MQV A;  5DUI A;  1BL0 A;  3HSR A;  2Z99 A;  4HBL A;  3HTS B;  2H1K A;  2IAI A;  2X1D A;  1SVM A;  1V54 H;  3DTK A;  3AAF A;  2FOK A;  3GME A;  3LL7 A;  4CO8 A;  3BG7 A;  1T0F A;  4A0Y A;  3EQL F;  1HQC A;  4I01 A;  4EV0 A;  1X1B A;  1DDN A;  2JVG A;  4BU2 A;  1FPQ A;  1LNW A;  4N4N B;  1MND A;  1P7I A;  3OL3 A;  2EZK A;  2Z9O A;  2H1L A;  2GZW A;  1YG2 A;  2DA6 A;  1F1Z A;  1P4X A;  5CVU A;  5BPD A;  1DU6 A;  4QSH A;  4MIM A;  1Z9C A;  2CH0 A;  2E1N A;  1EF4 A;  1KQ9 A;  3MZH A;  1TWF J;  3W3C A;  3WTZ A;  3V7S A;  4DBR A;  1JT6 A;  2BYV E;  1IUF A;  4HQE A;  2NVX J;  4UVA A;  2LVS A;  4KJZ A;  3W6V A;  4KIS A;  1LPQ A;  3HRU A;  2W25 A;  2HQR A;  4U87 A;  3G73 A;  2L9V A;  2LD5 A;  1MNE A;  3BTC A;  2GA2 A;  1JXS A;  2NVU B;  1QZE A;  4G6Q A;  1YOV B;  1QNT A;  5IP9 J;  3D5L A;  5CVI A;  4HF1 A;  2RC4 A;  2XPU A;  1I3A A;  2NS8 A;  3LOC A;  1T33 A;  1LEB A;  1Y0U A;  1IRG A;  1WRJ A;  3CTA A;  1SEU A;  4XRS A;  1T38 A;  1S9H A;  2EJR A;  5BNG A;  1CGP A;  2JK3 A;  1U5T B;  5KNL A;  1BI3 A;  3QPL A;  4YIF A;  3ERM A;  1AA7 A;  1G6N A;  2HXO A;  3L2Q A;  2BVL A;  4ETS A;  5GPC A;  5BS6 A;  3BCB A;  3SQN A;  4CZC A;  3PIO F;  4BY1 J;  2VL8 A;  1VQP I;  3ELK A;  3OV8 A;  3B6A A;  1QPM A;  1C0W A;  5F08 A;  4J00 A;  1PJR A;  2ID6 A;  4QTR A;  1XG1 A;  1W0T A;  3ZQC A;  4GRI A;  5DTD A;  3U1D A;  1WSU A;  4GYG A;  3U2R A;  3KP5 A;  2IRF G;  4G9Y A;  2IP2 A;  4DZP A;  5FGM A;  3AFH A;  3RQI A;  2A61 A;  1YI2 I;  2DT7 B;  1QGP A;  1P4A A;  2EIN H;  2DXI A;  3MEX A;  3RCO A;  5F04 A;  2CQX A;  4I6Z A;  1IXC A;  1GDT A;  2RV8 A;  4A93 J;  4E7K A;  3WTX C;  1ZR4 A;  4AID A;  3F23 A;  4II3 A;  2ZCW A;  3PUB A;  2L7F P;  1FMV A;  3JCU C;  2E1M C;  3OYC A;  1P4W A;  1PVE A;  2COB A;  5D4S A;  3DLA A;  3TO7 A;  2DFE A;  4L9J A;  4RB0 A;  2M30 A;  4CCM A;  1XGN A;  1I27 A;  2NVY J;  3KE2 A;  4RB2 C;  1AHD P;  5E1Z B;  4A3K J;  4M73 A;  3AKZ A;  1XMX A;  2IBD A;  3IHU A;  5CPR B;  4ZYD A;  3PL8 A;  4IHX A;  4V2G A;  4HSR A;  4DYC A;  2WAE A;  4NNJ A;  4NC7 A;  4A0Z A;  5DEQ A;  5HLT A;  3DTI A;  2JT1 A;  3DV8 A;  3HOU J;  2LTP A;  1ZGJ A;  3F9K A;  1EJ9 A;  1Z1D A;  3B02 A;  2IEK A;  2ELK A;  1BIA A;  4D7M A;  4ZZL A;  3FDY A;  1FSH A;  4UVC A;  3VYT B;  3ABL H;  2Y0M A;  5D4R A;  2O3F A;  2W48 A;  1OYI A;  4RAY A;  3REO A;  1IN5 A;  1U2W A;  2ZSH B;  4R8H A;  2CGP A;  4FAS D;  2D1H A;  2XDV A;  2O7O A;  2HFH A;  2R7V A;  3U21 A;  3WG7 H;  1YTY A;  3BP8 A;  1KON A;  3T8T A;  4BBS J;  1BN5 A;  2A6T A;  2E35 A;  1W1W E;  3FXJ A;  2W24 A;  3JRG A;  4KIT B;  2CYY A;  5EGO B;  4H0E A;  3E5U A;  2OQG A;  1DGR M;  2UV1 A;  3QYB A;  1JKO C;  5EJC A;  1HW2 A;  2CV0 A;  3PQK A;  3N97 A;  3LSK A;  2R5Z A;  2R7X A;  2MH2 A;  3L1P A;  1OLT A;  2JN6 A;  2HVS A;  2LBF A;  1ORK A;  1FIP A;  4BH9 A;  3HOV J;  3RKX A;  3Q9V A;  4AYB A;  2O61 A;  2R7D A;  5J47 A;  5D5W B;  5FLV A;  4XN3 A;  3I9V 2;  3TW6 A;  5E1W A;  1CF7 B;  4PCQ A;  2MW8 A;  4NB5 A;  2R7T A;  3E6C C;  3HUG B;  5J4Y A;  1UEL B;  4HDU A;  4XRS G;  2R93 J;  5C4J J;  1L3L A;  2DPD A;  2DW4 A;  1IV6 A;  2CS3 A;  3CUQ C;  3VWB A;  1PP8 F;  2Y0S N;  4OAY A;  1V5G A;  5K5O A;  4KT5 C;  3Q0W A;  3MQ0 A;  4BKX A;  5GPA A;  2O5R A;  1W0U A;  1MSF C;  2R5Y A;  1R1T A;  4QIW N;  2E1M B;  4UY8 I;  2DYS H;  5H2F C;  1K6O A;  3EUA A;  4YG2 F;  1JE8 A;  1JKQ C;  2DAO A;  1JJ6 C;  1YW9 A;  3TO9 A;  2DOF A;  2ZME A;  4EMS A;  1K4T A;  2YUS A;  3MAJ A;  5TIS C;  2W4S A;  5HDG A;  3WGG A;  2NAZ A;  5IT3 A;  3PSF A;  3KZY A;  5HOO A;  3OL4 A;  4XLA A;  2COM A;  2ZKZ A;  4CA0 A;  3IWZ A;  4J01 A;  1EH8 A;  1GLN A;  2E60 A;  2ICW G;  3BG5 A;  4C2T A;  4MTE A;  2VXZ A;  1HC8 A;  2KIM A;  1LE8 B;  5J40 A;  5FLX K;  2L4A A;  1ZG3 A;  3U1K A;  5HLI A;  5E3O A;  1HSJ A;  2BY0 A;  5D5V B;  3HG9 A;  1OR7 C;  2CWE A;  2E7X A;  4XRM A;  2K9S A;  4M71 A;  3SDB A;  4S04 A;  1Y56 A;  3E6D A;  2D2W A;  1JUS A;  3D5S C;  2HTS A;  3ZR8 X;  2A3S A;  1R5G A;  2DBB A;  4EM2 A;  1DQU A;  2JA7 J;  2VT2 A;  2MGQ A;  4GGG A;  5B3S H;  1JKR C;  3JRD A;  1NTC A;  2VJJ A;  1Q1H A;  3FMQ A;  3SJM A;  3F0C A;  3QOD A;  4B43 A;  3X2Q H;  2FBI A;  1USS A;  3GZN B;  3LA3 A;  4XLF A;  1W5S A;  1ZEL A;  2I5U A;  1XGM A;  2M5W A;  1HKS A;  5ICE A;  4C3H J;  2GIZ A;  3DBH B;  5GAG J;  2ZXJ A;  4G8X A;  2DA7 A;  1E3H A;  2HVQ A;  1J0R A;  3SHF A;  1T39 A;  2OTJ I;  2G7H A;  3KP2 A;  3LAJ A;  3K1N A;  3HOY J;  1MDM A;  1VF9 A;  2ZB9 A;  1D8J A;  2QLZ A;  3A02 A;  4LFU A;  1FOY A;  2IGK A;  3LWF A;  5ILV A;  1VQ5 I;  2P5V A;  2CV2 A;  3LA7 A;  2ZME C;  4BEH A;  2VJI A;  2QSF X;  3CUQ B;  1FYK A;  1XC5 A;  2QQA A;  1I5Z A;  2XUB A;  5FD6 A;  2FJ1 A;  1WKM A;  3DEW A;  4RAF A;  3LAP A;  4FQG A;  1Q1V A;  2A6E F;  6PAX A;  2FXA A;  3W6J B;  1IN8 A;  4M74 A;  1W7P A;  1VQM I;  2P6T A;  2CO5 A;  3NQO A;  3CCV I;  1FYM A;  5DD4 A;  3OSF A;  2F5V A;  2O9L A;  4E7J A;  1MMA A;  1W4M A;  2A6H F;  2QM3 A;  4N4O B;  3SZT A;  2DTR A;  1LUJ B;  5D8K B;  4CXF A;  2K86 A;  3GTP J;  1IDZ A;  3CP8 A;  3S2W A;  4IHW A;  4Y17 A;  3GFI A;  4OIP F;  4I2O A;  2KJC A;  4XM3 A;  3CDI A;  1ZN2 A;  2F48 A;  3K70 D;  2BY2 A;  3S17 J;  1A36 A;  3JRA A;  2LNB A;  4CCO A;  4B1R A;  2L9S A;  3VSL A;  1JUP A;  3C18 A;  4AWX B;  3G1O A;  3RDI A;  2CW0 F;  2PJP A;  2OZU A;  4KIF A;  3V7C A;  4E4H A;  5K7F A;  2K85 A;  1TBX A;  3E3V A;  4DOZ A;  1FC3 A;  3PNY A;  1HST A;  1DP7 P;  2UXX A;  4HST A;  1A31 A;  4I98 B;  4UB8 C;  4Y52 J;  1D0Y A;  2QZ8 A;  2XRL A;  4XLN F;  4M6X A;  4EJW A;  4GO1 A;  2RGV A;  1ENH A;  4D7N A;  5ICC A;  2W82 A;  4B44 A;  1FTZ A;  2ZJR F;  2Q2E A;  2FA5 A;  4OMY A;  9ANT A;  2BOL A;  5KVR A;  4C30 A;  3CO7 C;  2RKH A;  1YS7 A;  3DQV C;  1AWC A;  1XD7 A;  2LKS A;  3RIR A;  3M07 A;  4BE2 A;  4CCL A;  3HKZ N;  2R7U A;  2D5V A;  3CD6 I;  4MEX F;  1FBQ A;  4U0Y A;  2MSY A;  3H92 A;  2EIK H;  2VKV A;  4UNO A;  1R6R A;  3AG3 H;  4HG2 A;  2HGC A;  3ZN1 A;  1VQ9 I;  3RPQ A;  1V5F A;  2L0K A;  5IP7 J;  4FT8 A;  2ADU A;  2LRD A;  3PM1 A;  1A6I A;  4YEL A;  2LR8 A;  2OF7 A;  4U0V A;  3TQN A;  2VLA A;  1G3W A;  5J4V A;  2G0E A;  3E0J B;  4ESJ A;  3K6G A;  2XKP A;  3KIO A;  2MG4 A;  4C9Y A;  4GDF A;  3BR6 A;  3F8F A;  3IC7 A;  3ZMT A;  3P5J A;  3RPU A;  3KFW X;  4EQQ A;  4U7B A;  4EM1 A;  1Z6T A;  4XQF A;  2JA5 J;  3K4N A;  2AXT C;  5H20 A;  1Z6R A;  1PUE E;  3F6V A;  3F8N A;  3K2Z A;  3QP6 A;  5FLX Z;  2JJ7 A;  3H35 A;  4I7H A;  1B8I A;  5DUK A;  3OYI A;  3A1Y A;  4I09 A;  3K4C A;  2E1O A;  2HZT A;  2B0L A;  3H0G J;  1D1B A;  3ZQI A;  1K79 A;  4KIC A;  4RGS A;  2V1X A;  3GFJ A;  4E7S A;  2WA0 A;  3R60 A;  3IRQ A;  3EUH C;  2KIQ A;  1MJA A;  1FYL A;  2DK8 A;  2PX9 A;  2L7K A;  3A0H C;  4JX5 A;  1V4R A;  4PSX A;  2H94 A;  3I59 A;  1BI1 A;  2VAS A;  4BXX J;  1HKT A;  2WAQ A;  2HXI A;  1B59 A;  1SFX A;  4ENM A;  2E5N A;  4IHS A;  3S8P A;  2HVR A;  2KRF A;  2RVC A;  4BQQ A;  1ERD A;  2VBW A;  2R7W A;  1W36 D;  1IG7 A;  1FP2 A;  1J2X A;  2WV0 A;  1SFK A;  2MYS A;  3LFK A;  1MH4 A;  1BA5 A;  2CG4 A;  3A03 A;  2BVM A;  3L00 A;  3TDZ C;  3BR2 A;  2F4I A;  3IP4 B;  4XKV A;  3W2A A;  1MD0 A;  4A3J J;  4L0Y B;  3WU0 A;  5E17 F;  4PJM A;  3BZC A;  3J7Z I;  4UUV A;  1MBJ A;  1WI3 A;  3AL0 C;  1WI9 A;  4L9N A;  4KN4 X;  2LSO A;  2FOW A;  1S7A A;  1I6X A;  1BI2 A;  2P7V B;  2AO9 A;  1H88 C;  1IGN A;  3GF2 A;  3CO6 C;  3QPS A;  1EA3 A;  2LY1 A;  4CYD A;  2VE8 A;  3KET A;  3DWL E;  2L7Z A;  1FNN A;  2DMP A;  3H9G A;  1T98 A;  3V4G A;  4L9V A;  2E1C A;  2DO7 A;  1G3T A;  4BBR J;  4LMY A;  2R7S A;  2QCO A;  5D8L B;  1TWC J;  4PJL A;  2YX7 A;  3RYP A;  1ETO A;  2CUJ A;  2QF7 A;  1WFX A;  4E7H A;  2ECB A;  1JKP C;  3V8J A;  2NS0 A;  3BR3 A;  4LG0 A;  2LY2 A;  1SD6 A;  4FX0 A;  1SAU A;  3K0L A;  2VOP A;  2VC0 A;  4I76 A;  2FE3 A;  3FHN A;  5F0F A;  2L01 A;  3NAR A;  4XLC A;  2V79 A;  3P7N A;  1UJ8 A;  2M7B A;  3A0B C;  5HLG A;  1XCV A;  3KPH A;  3OYM A;  2HOT A;  4BJ6 C;  1ZGA A;  2GQQ A;  1FP1 D;  2HPM A;  1JGG A;  1J7K A;  2XAF A;  3H9J A;  2JVH A;  1U5T A;  2W57 A;  1U6G A;  4A3C J;  1YFH A;  4ANJ A;  2K27 A;  5J8C A;  3D0S A;  1RR7 A;  5FRM A;  3CJN A;  2V9K A;  4B8X A;  1NHA A;  3DKY A;  2JWT A;  1XS9 A;  1SD7 A;  3BR5 A;  4LIT A;  3QWL A;  1ZG1 A;  1MZB A;  5J1Y A;  5IOZ A;  3KEY A;  3H3U A;  2FNA A;  4OIO F;  4KFC A;  3WTU C;  1ITY A;  1FMW A;  1YS6 A;  2XKO A;  4X6A J;  4XIC A;  1H89 C;  4ENK A;  2JRM A;  3HYI A;  1DP3 A;  4A3L J;  2RQP A;  2UXN A;  2VQH A;  2W85 A;  3CCL I;  4LB6 B;  3O8G A;  2EV6 A;  4G12 A;  1G8X A;  4LIU A;  5K7Z A;  2QSH X;  2EFN A;  4IL6 C;  1D8K A;  2LDU A;  3ZN0 A;  1BJA A;  2HDW A;  1FTT A;  1U9O A;  2DOD A;  3T0Y A;  2VOO A;  1F43 A;  3ZXS A;  2KRH A;  3TOB A;  2LLK A;  1K4S A;  1R00 A;  5HS9 A;  3AL0 B;  4E7L A;  1GVJ A;  4F3Q A;  4O3M A;  1QHH D;  3C7J A;  4GYI A;  5J6X A;  3H5R A;  5F6F A;  4RLQ A;  2Y31 A;  2D1V A;  1SD5 A;  3HSE A;  5EG0 A;  2FUG 2;  4ABZ A;  2IA1 A;  2R92 J;  2R7Z J;  4YFN F;  1GUU A;  3JTH A;  4LK0 F;  1R1U A;  1EKE A;  1LDK B;  1YO5 C;  2L9N A;  3IUO A;  1HLV A;  1IW7 F;  3IH2 A;  3HHG A;  4PUS A;  2Y0S A;  2NOG A;  1R49 A;  1D1C A;  2BW3 B;  5EF6 A;  3PJR A;  1ZLJ A;  3JRI A;  4A2U A;  1FSE A;  1ZYR F;  2A69 F;  1SAX A;  2ZO4 A;  3ZQG A;  2IS1 A;  4XL9 A;  2FBH A;  1TT0 A;  3FIS A;  1WCM J;  5FKL A;  4GFB A;  5FKO A;  1OPC A;  4JYK A;  3DPU A;  3HZJ A;  4PJ0 C;  5IYC J;  1YIJ I;  1G3Y A;  4E6K G;  3RZD J;  1JI8 A;  2GOM A;  2IVM A;  3HXL A;  2XRO A;  1O3R A;  1ON1 A;  4V2F A;  3FIW A;  3OOP A;  4CCJ A;  2XGC A;  1TWG J;  4OU0 A;  4FET A;  2HYG D;  1B4A A;  3ZPL A;  4KUM A;  3GTM J;  3COA C;  5FKN A;  5JVT A;  2IW5 A;  2RQQ A;  1MJ9 A;  2QSG X;  3D1N I;  4PFP A;  3FMS A;  1X3Z B;  2LH9 A;  3ESW B;  4RB3 C;  2M1B A;  2QBY B;  3AG2 H;  4RGX A;  2STW A;  3PQJ A;  3E97 A;  4JQF A;  4ASN A;  1UFM A;  3GZ6 A;  2QQ8 A;  1EV7 A;  1ETW A;  4HNU A;  2M8E A;  2V1U A;  5H6R A;  1H0M A;  1LVK A;  4X1E A;  1T95 A;  4B48 A;  1VQK I;  1HCR A;  1WJF A;  3VOE A;  3DF8 A;  3KZZ A;  3TKY A;  3CF5 F;  2P81 A;  1N25 A;  3UR3 C;  2NNN A;  3Q5F A;  4BJT A;  1XB4 A;  2HI3 A;  2MC3 A;  3MD2 A;  2EQR A;  2FQ4 A;  4IF4 A;  3LSM A;  2KL4 A;  1APL C;  1VZ0 A;  3I64 A;  3KLN A;  4M9Z A;  4MFE A;  3WGI A;  4CHU A;  4N9H A;  5TGT A;  4UXN A;  1TW2 A;  3BOQ A;  3R0A A;  3O2P E;  3KP6 A;  1G2H A;  4LG3 A;  3LSP A;  5DCM A;  2ISZ A;  5AON A;  4KMU X;  3K4L A;  5E1X A;  2JA6 J;  1JHF A;  1S5L C;  5LLQ A;  5E3N A;  1A6Q A;  2EA2 A;  1ETX A;  3HOS A;  1IRF A;  3WU1 B;  4G7H F;  2FMY A;  1A5J A;  1BIB A;  1RIO H;  5F0H A;  1D5Y A;  3F72 A;  3CC4 I;  2PLY A;  1FEX A;  5IP6 A;  4KIG A;  1GV2 A;  1TW3 A;  2R7F A;  1YRN B;  1FT9 A;  4XKB A;  3L2V A;  1Y8Q B;  4YRV A;  2M8G X;  5JHF A;  4KDP A;  2HDC A;  1T0F C;  3FK7 A;  3J7Y J;  4RM2 A;  5EEA A;  3CCQ I;  3S1M J;  4NDL A;  4OIN F;  2PMZ N;  4CGZ A;  5D5U B;  2K4J A;  1TT5 B;  1E17 A;  5KCM A;  2O8K A;  2KIU A;  3OYG A;  1W5T A;  3RQ4 A;  3QU6 A;  4BJ5 C;  3GTK J;  2F2E A;  5D6F A;  4M3G A;  3CF2 A;  2I10 A;  5FFX A;  3JRB A;  2BY1 A;  3M1C A;  1TQP A;  4TV7 A;  4AU7 A;  4CH7 A;  2X9D A;  1FBU A;  5JHU A;  1YHQ I;  3HPG A;  3LFU A;  4HYE A;  3OYL A;  3F21 A;  2JA8 J;  3HOW J;  4Y3O A;  4QWQ A;  1GXP A;  2Q0O A;  2IT0 A;  2KLO A;  4F7Z A;  2H8R A;  5TJJ A;  4ZC3 A;  2OPT A;  3S2D J;  5E20 A;  2Z33 A;  4D5F A;  1VQ8 I;  3M7G A;  2MH9 A;  1N78 A;  2AS5 F;  1Y39 A;  2XF7 A;  3ZQH A;  4AUX A;  1HW5 A;  4Y33 A;  3HM5 A;  4UUS B;  2EPF A;  1GT0 C;  3JRH A;  1B72 A;  2Y48 A;  1TQI A;  1HBX G;  5E8G A;  1WZ2 A;  2F4M B;  1ZAR A;  3DBL B;  3I3L A;  4A6D A;  5GTH C;  1H9T A;  4RLF A;  3CCR I;  2E2H J;  4OIQ F;  3K4J A;  3J7A O;  4PJN A;  1TC3 C;  3JSO A;  4E7I A;  3Q9S A;  4BAY A;  4OIR F;  3ERE D;  2TDX A;  2E71 A;  2Z2S B;  3LQQ A;  1F4K A;  3BG9 A;  1S7O A;  1KU9 A;  1RNL A;  1QU3 A;  2VPL A;  3CMA I;  1ZK8 A;  1OCC H;  1BJZ A;  3I58 A;  1Z21 A;  3CJQ B;  4M3B A;  1TNS A;  3BTJ A;  3HOT A;  2R0Q C;  1IDY A;  3VYS B;  1U8B A;  2ZNY A;  3HB9 A;  4BYY A;  4CYC A;  3S2H J;  2EB7 A;  1ONV A;  4M9X A;  1RES A;  4PJJ A;  4U88 A;  4LIV A;  5CVJ A;  2CJJ A;  2XGE A;  2PJR B;  1TWH J;  1FOW A;  3GCM A;  3BWG A;  3NWS A;  2KPM A;  2G9W A;  3R0J A;  1XMK A;  2GOX B;  1JT0 A;  3QPH A;  3DXJ F;  5HVQ C;  4L18 B;  1KU2 A;  2JA2 A;  2GWR A;  5IY5 H;  3ABK H;  2VBY A;  2NOJ B;  1R58 A;  2DOE A;  1T08 B;  2HR3 A;  4L0Z B;  3V42 A;  1B9N A;  2V9V A;  3GTJ J;  2VKE A;  4IQ4 A;  4Q5S F;  4G6T B;  4Y4R A;  3TED A;  1IF1 A;  2KP6 A;  2M2E A;  1R9T J;  3ZMZ A;  1LFP A;  4A3E J;  2CRG A;  2CQQ A;  3MN2 A;  1O3Q A;  1KQ0 A;  2Y69 H;  4IZZ A;  4XSZ F;  1U3E M;  1SAN A;  2F6C A;  3IKV A;  1BC7 C;  2DDB A;  4M9S A;  2BZT A;  4EAT A;  1ETQ A;  4DBQ A;  2JQ7 A;  1MMG A;  4LLL A;  3GWZ A;  4YIR X;  2ID3 A;  3EPZ A;  5GTI C;  2K3P A;  4NQW A;  1OYY A;  1FOX A;  2CUF A;  1Z7L A;  5H6Q A;  1TL8 A;  1ZQ3 P;  2QKL B;  1UG0 A;  4HX4 A;  3DFG A;  4UV8 A;  5GAD J;  1ZGW A;  4I02 A;  4ESB A;  2H27 A;  2VJ4 A;  1GV5 A;  2YPR A;  3PUF A;  1FWZ A;  2V7F A;  5IPA A;  1DU0 A;  1RRJ A;  3E1S A;  4BXU A;  1WJD A;  1YW8 A;  5HS8 A;  2HQA A;  4XOR A;  1HA8 A;  3SZG A;  3S1N J;  4U0W A;  4RA2 A;  2OC6 A;  4AC0 A;  1I1G A;  4IQJ A;  1IC8 A;  1BR2 A;  2X6X A;  3K4M A;  1R23 A;  3LMM A;  1Z3X A;  1XGO A;  2G7U A;  3WE3 A;  4DQ2 A;  2DFH A;  3VSK A;  3B73 A;  5FO5 A;  4A6E A;  5BOX A;  1BI0 A;  1KU3 A;  3ECO A;  5FKK A;  5E8I A;  3LST A;  4JP0 A;  1KU7 A;  2FQ3 A;  3BT9 A;  2A5Y B;  2CW7 A;  5DCF A;  4XRF A;  4I99 C;  4KA4 A;  2Y75 A;  4AVP A;  5FD5 A;  3QRF F;  2HTJ A;  3MKW B;  2K9L A;  2H09 A;  3FKI J;  1AOY A;  4HLY A;  2BHZ A;  3PSI A;  1V5E A;  5CJ9 A;  2DA2 A;  5FRN A;  2NVQ J;  3R61 A;  2Z1D A;  5JFR A;  2ELJ A;  2RAE A;  4D1Q A;  3CC2 I;  3T5X A;  2O8X A;  1TQM A;  2VQC A;  2FEZ A;  3E5Q A;  5E18 F;  2DMU A;  2ETH A;  3S15 J;  4A3F J;  5C4X J;  4FCY A;  2IS6 A;  2ZJP F;  1ZTR A;  2HOS A;  1KZH A;  2YR2 A;  5IT9 K;  5BQT A;  1X4P A;  3U9G A;  4NC6 A;  4HX8 A;  3MCZ A;  1J75 A;  1LFB A;  1AU7 A;  4BQN A;  1XSX A;  1E0E A;  1ZRF A;  2E19 A;  3FBN B;  1P6R A;  4C2M J;  2DA3 A;  2QQ9 A;  4HPQ A;  1U8R A;  2M9H A;  1IAW A;  1FJL A;  2KIS A;  4Z6Y A;  4BDY A;  3BR0 A;  1ETK A;  1AKH B;  1G4D A;  2KHM A;  4HX7 A;  4BY7 J;  3JAM Z;  2DLL A;  5ERI A;  4YEJ A;  1H9G A;  1ZHF A;  4B4C A;  3GTQ J;  4JOM A;  4RMN A;  2A07 F;  1W7P D;  2DDA A;  1OYW A;  3IKT A;  3PNT A;  2Q1Z B;  5K5R A;  1MBF A;  3Q3S A;  3SFZ A;  1XGS A;  2M34 A;  5EZH A;  3FM3 A;  1UMQ A;  2DN0 A;  1X2N A;  2LBF B;  5LGN A;  2BHY A;  2X48 A;  1Z0X A;  2IJL A;  2K9Q A;  3ASO H;  1YYV A;  2UWM A;  2AHQ A;  1E3O C;  3ZGK A;  2LYC A;  3OIO A;  1JUM A;  5LEK A;  1QA6 A;  2ESN A;  3GX4 X;  5E79 C;  4PK4 A;  1SMT A;  4M3E A;  1WWX A;  3L2R A;  4XON A;  1Z67 A;  2F4O B;  1HF0 A;  4GXO A;  1LKX A;  2MAB A;  1QHG A;  5CQG A;  1R4N B;  2WB1 A;  2XGX A;  3CLQ A;  3GO5 A;  5ED4 A;  3IV5 A;  1XSD A;  3I55 I;  3BPV A;  5L3C A;  3MKZ A;  3QPT A;  2F5F A;  4R79 A;  1RZ4 A;  3MFK A;  5J1U A;  2R5Y B;  2YX4 A;  3GTO J;  1VND A;  3M3Y J;  1WJA A;  2ACJ A;  2X1E A;  1ZH5 A;  1OCP A;  3IAM 2;  3CCS I;  3GTG J;  1KYW A;  2ZME B;  5C44 J;  3DU6 A;  5J1R A;  3RTR A;  4KT6 A;  3L9F A;  4P55 A;  2OJE D;  2PQ8 A;  4HNV A;  1WH7 A;  5DDG A;  3TP3 A;  2NVT J;  2VON A;  2DT5 A;  2MFZ A;  1MBG A;  2JSC A;  3DLL F;  1BR4 A;  4RGU A;  4E70 A;  3PIP F;  1KGS A;  3RYR A;  4C2U A;  3KYC B;  4DZJ A;  3GLX A;  1ZG5 A;  1IZ1 A;  4CIC A;  4BDZ A;  1NG7 A;  1YJN I;  1ZRC A;  3KYD B;  4CCK A;  4LK1 F;  4IHV A;  1OJL A;  1UZC A;  3CME I;  3WTY C;  4HV5 A;  4XKC A;  5HNF A;  1MNM C;  4G94 A;  4BS9 A;  3Q0U A;  4M3D A;  3H0D A;  3FX3 A;  1HXD A;  4IHY A;  5LEJ A;  1T2K A;  2CUZ A;  4EJU A;  2R7R A;  3GLL A;  2XRN A;  2V1N A;  3DKW A;  4ZZD A;  3WOD F;  1YJW I;  2VE9 A;  1O57 A;  2AQF A;  2DFI A;  3HOZ J;  4HA8 A;  3SFI A;  2X6Y A;  3P9I A;  2HQN A;  5K7H A;  2MA3 A;  3BZK A;  2EFO A;  4HF2 A;  4LLN A;  2BW3 A;  4DJA A;  2A5W A;  2DA4 A;  3LSI A;  2YSR A;  3ZQ7 A;  3S1R J;  4BAC A;  4UUT A;  3BTL A;  1D5V A;  3IL2 A;  2DJN A;  3I4P A;  2ELH A;  2XF6 A;  3EET A;  1BW6 A;  2P7C B;  3BRO A;  3ML6 A;  2LOO A;  5EZG A;  1KQ8 A;  5ICG A;  2K9N A;  1MDM B;  1LDD A;  2EIM H;  3L7W A;  3O6B B;  3SZP A;  1ACI A;  1U0J A;  3AG4 H;  5LHI A;  4UB6 C;  2IGM A;  2JRT A;  4ZJZ A;  2VT3 A;  2K5C A;  2LF7 A;  5KAI C;  2XAU A;  4ITV A;  2BXZ A;  1WJB A;  2O03 A;  5C3E J;  1L0O C;  2R7O A;  5M3M J;  3I5U A;  1W5C C;  5IT9 Z;  2RN7 A;  3IH4 A;  3KEO A;  2VBZ A;  4GCV A;  1W7P B;  4OMZ A;  4AM3 A;  2ZXI A;  2GIV A;  1X1D A;  3TW7 A;  2HS5 A;  1LQ1 A;  2FU4 A;  2ZFW A;  4WXD A;  4A3I J;  1OFC X;  3E7L A;  4Z2Y A;  1B9M A;  1BC8 C;  2P0W A;  4BNC A;  2X85 A;  3WE2 A;  2I8D A;  2KFD A;  4MTD A;  3KP7 A;  2EK5 A;  4FHT A;  3WTT C;  1K78 B;  3FM5 A;  1YJ9 I;  1RKT A;  1X19 A;  3UKG A;  3PNV A;  4WXC A;  1QZY A;  1MMD A;  4NUB A;  3H5N A;  3A01 B;  5HDK A;  1MJB A;  3WHB A;  2HEO A;  2M4K A;  5B66 C;  3MMY B;  3KZI C;  3E5X A;  5L3D A;  4XLP F;  1X2M A;  4IJA A;  2FD5 A;  4M3F A;  1RET A;  1YW7 A;  4DYQ A;  4IRH A;  4RAZ A;  4AIJ A;  3OS1 A;  3M8J A;  1R1V A;  1TP4 A;  2XAQ A;  2TRT A;  4MFD A;  4UHT A;  1D1A A;  4IOA F;  1Z77 A;  2EH3 A;  2CFX A;  2ZBK A;  1IN4 A;  2DA1 A;  3OYF A;  3BQZ A;  1LFU P;  3TL4 X;  1LB2 A;  1DPU A;  2LP0 A;  1BOA A;  1O3T A;  4YII A;  3HGY A;  4EM0 B;  1YIT I;  1XMA A;  1K83 J;  2Q2E B;  2L9R A;  3N05 A;  3IH3 A;  3OR2 C;  2J5O A;  4MNU A;  2GXG A;  2LKP A;  2PBI A;  4V19 K;  5GAH J;  1DGW Y;  3DPT A;  3ISP A;  3BQY A;  1YRN A;  2ZNZ A;  3LSR A;  3V7R A;  2IPQ X;  1MIJ A;  4IO9 F;  4BL0 B;  1GHC A;  3G1L A;  2CQK A;  1ZKG A;  1J9I A;  2Z5U A;  3CC7 I;  4WK8 F;  4JX6 A;  4DW6 A;  1X1C A;  1YLF A;  2VN2 A;  4XBF A;  3S3O A;  2RNJ A;  4MHG A;  3RI4 A;  3I54 A;  5LGT A;  3DKX A;  3BZ6 A;  3T1B A;  3V8L A;  4BE1 A;  3QP5 A;  1IV8 A;  2KIF A;  2OUM A;  2XB0 X;  2DPU A;  1S72 I;  2XAS A;  3CES A;  3E6B A;  4LLG F;  2K02 A;  2QKM B;  1S6L A;  1JJ8 C;  3QU3 A;  4ZYH A;  1PP7 U;  3KCC A;  5HOD A;  4A0X A;  1HOM A;  4F93 B;  5AIP A;  1XPX A;  5K1Y A;  4BUP A;  2KZV A;  2Y9Z A;  1MBH A;  1B8I B;  4P9F A;  1MW7 A;  3TBI A;  1QQI A;  2K3F A;  1X1A A;  3SEQ A;  2GLO A;  3DCF A;  1XDS A;  3LSG A;  1U5T C;  2NYX A;  2ESH A;  2QUF A;  1P7J A;  4O6J A;  2H6B A;  3JRC A;  5JVG F;  3NAU A;  3FXO A;  1O4X A;  2VPR A;  3F3X A;  5DD8 A;  1BBY A;  3F6O A;  1R5H A;  4NBQ A;  2EWN A;  4FX4 A;  3SEZ A;  3SYT A;  4A69 C;  4F91 B;  2LG4 A;  1Z7U A;  3PFI A;  2UZK A;  5TRD A;  3FHZ A;  1A04 A;  2JMW A;  5EGO A;  2D45 A;  5L3B A;  4BQA A;  3S1Q J;  1WJE A;  2GXA A;  3RJP A;  3CLO A;  3OS2 A;  2ZJ2 A;  4BHC A;  1UST A;  3OOU A;  3CMM A;  4WF2 A;  3HL2 A;  5M5W J;  2DMQ A;  1ETV A;  3MWM A;  2DU9 A;  2IXS A;  3QAH A;  1U78 A;  1NH3 A;  2YS9 A;  3FXL A;  3QYF A;  1BOB A;  3FK6 A;  1SVL A;  2X4H A;  4L5E A;  3I4M J;  4LOC A;  2GAU A;  1CF7 A;  2VKD A;  2PJR A;  3CMY A;  3M8E A;  3ABT A;  3ZCO A;  3I56 I;  3HUG A;  3MVP A;  2BE5 F;  3W2W A;  1OCO H;  3P9C A;  4HAM A;  3K4K A;  2CSO A;  1S3J A;  3VYR B;  2TCT A;  2A05 A;  4ZYE A;  2O0Y A;  3HIF A;  4S05 A;  3K1P A;  4L5J A;  3FXK A;  4G7O F;  4PFO A;  1FY7 A;  1TNT A;  1MGT A;  2EZL A;  1P9Q C;  5BPI A;  2EZI A;  1G59 A;  2V6C A;  1VQ6 I;  1F9N A;  2XAH A;  2HKX A;  2MBF A;  1Z91 A;  2WAQ N;  3K7A J;  4LD5 A;  2E2J J;  2OU2 A;  1UAA A;  3QOP A;  4RGR A;  1D0Z A;  3AG1 H;  1ZRE A;  4IXA A;  4WXH A;  1MBE A;  4UV9 A;  2OZ6 A;  3ZMD A;  1T8I A;  3PO2 J;  2VBX A;  4PZJ A;  5LRR A;  3FKJ A;  3OYK A;  1R36 A;  3NEU A;  4LG0 B;  4A5M A;  2XHK A;  5B1B H;  3W6K B;  3OWT A;  3O3K A;  3OYH A;  4W1U A;  1XDU A;  2FX0 A;  3M8F A;  5ILU A;  3HEF A;  1R5I D;  3BJ6 A;  1OCZ H;  2CQN A;  1PUF B;  1LE8 A;  1I6H J;  2ZC2 A;  3I0T A;  2FNP A;  2BEO A;  2A68 F;  3H3Z A;  2V1D A;  3GZ5 A;  5CVV A;  2GA1 A;  4B3X A;  4KMF A;  2GBY A;  3IAS 2;  4XOP A;  3UNG C;  4BHP A;  3FZV A;  3EUK L;  3DTE A;  3BPX A;  3HTU A;  3FBI B;  5HDN A;  5F0C A;  1MBK A;  1SVO A;  3BJA A;  1I39 A;  1JHH A;  3S93 A;  4ZTJ A;  2VQL A;  2F5C A;  1JTY A;  4Q48 A;  4XMY A;  2Y2Z A;  2JUG A;  2QYO A;  3RKQ A;  3S3M A;  1ON2 A;  1IN6 A;  2M0M A;  2PMH A;  4CUG A;  5HLH A;  2LK2 A;  2VOD A;  4Q47 A;  2FBK A;  4HLX A;  1D3Y A;  1QPI A;  4RS8 A;  3ABU A;  3GXO A;  2ECC A;  1TTY A;  5FJ8 J;  2NXN B;  2HQ5 A;  3S32 A;  3C1D A;  3A2K A;  4BQO A;  2OA4 A;  4ENJ A;  2RRE A;  2QEN A;  2EFP A;  2HU9 A;  3FXQ A;  1SC7 A;  3BC8 A;  3ZQL A;  2JTV A;  2B9S A;  2OAZ A;  2LC2 A;  3HDD A;  3GFL A;  1O3S A;  2F5E A;  2V4J C;  2KMU A;  3BCA A;  3JSP A;  2EZH A;  4J19 A;  2KDO A;  4HV6 A;  2HDD A;  2PN6 A;  3LSJ A;  2V9P A;  1PYV A;  3CUQ A;  1LEA A;  2JUC A;  2LF8 A;  1QVT A;  5E3L A;  5F1R A;  3HGG A;  2NRA C;  3N4M A;  1IRZ A;  1IJW C;  3MZY A;  1Y6I A;  4MLO A;  1ZLK A;  4F52 A;  2B63 J;  3JR9 A;  3A4C A;  5EG0 B;  4AVZ A;  3BDD A;  5B1A H;  2ZXH A;  4M6V A;  2QA4 I;  1M1E B;  3OS0 A;  2EV5 A;  2DJI A;  3I4N J;  2MD0 A;  3CDH A;  3G1M A;  4EGZ A;  5A2Q Z;  2JSP A;  2XAG A;  4DGW B;  3JAM K;  3J7A Y;  3HKZ A;  3RKW A;  1REP C;  2JZY A;  3BLY A;  2WV1 A;  3CJR B;  3ASN H;  3LA2 A;  5D6E A;  5FRO A;  2M3A A;  3WTV C;  4BXF A;  1NK2 P;  3JRF A;  4IKF A;  3BJO A;  2ME6 A;  1S29 A;  4A3M J;  4ZYA A;  1WH5 A;  2PMU A;  1AKH A;  1VQ4 I;  1RC9 A;  3M4O J;  2MLG A;  3HRS A;  4WWC A;  3O8H A;  2JPB A;  5LBQ A;  5IOY A;  3FMR A;  2AQE A;  4MO7 A;  5JLX A;  2KJB A;  1IN7 A;  2VKH A;  3CCY A;  1MH3 A;  4EVI A;  1B6A A;  1OR7 A;  4R1H A;  2XGD A;  1X1P A;  1K6Y A;  1EH6 A;  3CUO A;  1J09 A;  2VXD A;  4FIS A;  2E2I J;  2L5Q A;  5F64 A;  5ICF A;  5EEH A;  2DCE A;  2MD5 A;  3JW4 A;  4IEJ A;  4ENN A;  1WPK A;  3KEQ A;  4KYW A;  3OIP A;  2PEX A;  4PSW A;  5KK1 A;  1KYZ A;  2X6W A;  1VQ7 I;  1FLI A;  5J8F A;  5IYD J;  4HF0 A;  1MSE C;  2BBY A;  2QWW A;  4KNY A;  2XAJ A;  1RUO A;  3GEZ A;  2VC1 A;  2R7Q A;  4HQM A;  4KN7 X;  3F22 A;  4HDV A;  2KQR A;  1U9N A;  2Y30 A;  3M9A A;  5CQE A;  1Y1W J;  3ZRG A;  2UUZ A;  3WHC A;  3L2C A;  2XSJ C;  3K69 A;  4JK1 X;  2EIL H;  2HYF A;  2X0L A;  2OCC H;  4LB5 A;  2VB6 A;  2R4G A;  2FSW A;  3ZMS A;  1QZZ A;  4PGH A;  3R4K A;  2W7N A;  1D0X A;  3DBR B;  1X3U A;  1IUY A;  1SFE A;  2P5K A;  1S7E A;  1VQO I;  3C2H A;  3DEU A;  5EDN A;  4ON0 A;  1HDD C;  3K9T A;  4X0G A;  3QOE A;  2XB5 A;  1V3F A;  1TZL A;  2WBM A;  4Y13 A;  3BG3 A;  1UHW A;  4ZDL A;  2OCE A;  4WX9 A;  4OAZ A;  1YE9 A;  4HNT A;  1JGS A;  4M6Y A;  5DCM B;  3OR1 C;  1S8N A;  3KLO A;  4NHJ A;  3G3Z A;  2IA0 A;  2L3D A;  4LGW A;  2OTL I;  1GXQ A;  1YX5 A;  3OYJ A;  1P2F A;  1G3S A;  1IXS B;  4N9I A;  4C3J J;  3TGN A;  4XLH A;  5GP9 A;  3H1C A;  1VTN C;  3DEE A;  1X4O A;  3ULQ B;  4AD9 A;  3KYL A;  2GXB A;  3GTL J;  1J5Y A;  5KHD A;  5F1J A;  2W84 A;  4RAG A;  1TLH B;  3VOD A;  3I53 A;  4P5O A;  3FF5 A;  4F92 B;  3M1E A;  5E3M A;  1I50 J;  2OD5 A;  3WG9 A;  1EH7 A;  4ZH4 F;  1FOK A;  1HKQ A;  2WWY A;  1O7L A;  5L3G A;  2V26 A;  1R22 A;  3OYB A;  1N75 A;  2V6E A;  3CZ6 A;  3K4B A;  3OYN A;  4IPA A;  3J81 K;  4II2 A;  4H4K C;  2DA5 A;  3TDU C;  3GBG A;  4I0A A;  4XN0 A;  2XVC A;  2VJ5 A;  1WJC A;  4FTH A;  3L09 A;  4IHT A;  3MZ8 A;  3QYE A;  1OMI A;  4EJT A;  1UB9 A;  4CZZ A;  4IOC F;  2NS7 A;  3HC7 A;  2CUE A;  3HJE A;  3F8C A;  3GW2 A;  3VFZ A;  3EDP A;  3TP0 A;  2QVO A;  4Y7N J;  1UHM A; 
#chains in the Genus database with same CATH homology
 4C3I J;  4JYK A;  2O7O A;  2VUM J;  2LFB A;  4D5C A;  5IYC J;  1B72 B;  2GM4 A;  3S14 J;  4BBS J;  3RZD J;  1RKW A;  1OCT C;  4V2F A;  5C3E J;  5EYR A;  2KT0 A;  3FIW A;  5EGO B;  3JRG A;  2XGC A;  1TWG J;  5M3M J;  3IH4 A;  1JKO C;  2R5Z A;  3GTM J;  3TW7 A;  3ZOB A;  3L1P A;  2JN6 A;  1ORK A;  1FIP A;  5FKN A;  3HOV J;  4A3I J;  1OFC X;  3E7L A;  3D1N I;  2R5Z B;  5FLV A;  3A01 A;  3TW6 A;  2K9N A;  1RKT A;  3UKG A;  1ETW A;  2MW8 A;  3PO3 J;  5IYB J;  3A01 B;  4X1E A;  4CYC B;  3WHB A;  4XRS G;  2R93 J;  5C4J J;  1IV6 A;  1HCR A;  4A3B J;  1X2M A;  2FD5 A;  5FKM A;  2Y0S N;  3MKL A;  4M3F A;  1RET A;  3Q0W A;  4BKX A;  2P81 A;  4DYQ A;  5GPA A;  1W0U A;  2LY9 A;  1MSF C;  2R5Y A;  2HI3 A;  4QIW N;  2EQR A;  2FQ4 A;  1JKQ C;  1JJ6 C;  2TRT A;  4MFD A;  4S0H B;  1APL C;  1Z77 A;  2EH3 A;  4MFE A;  1QRY A;  2YUS A;  2DA1 A;  3BQZ A;  1LFU P;  3HBL A;  1TWA J;  2LP0 A;  1G2H A;  3LSP A;  3CQZ J;  3ZQF A;  3HGY A;  1K83 J;  2L9R A;  2L7M P;  3IH3 A;  4RBO A;  2JA6 J;  5E3N A;  3BG5 A;  1ETY A;  1ETX A;  3BQY A;  1YRN A;  3VPR A;  3LSR A;  2KDZ A;  1A5J A;  5F0H A;  1LE8 B;  1D5Y A;  4AYB N;  1VFC A;  3G1L A;  1FEX A;  5IP6 A;  5E3O A;  1GV2 A;  1ZKG A;  3OSG A;  1YRN B;  3JRE A;  4JX6 A;  2M8G X;  3QQA A;  4DW6 A;  4XRM A;  2K9S A;  3FK7 A;  5EEA A;  1JUS A;  3S1M J;  4NDL A;  2K40 A;  2PMZ N;  2O8K A;  1RPW A;  2JA7 J;  2XB0 X;  2MGQ A;  1JKR C;  3JRD A;  3GTK J;  1NTC A;  3BR1 A;  4M3G A;  3SJM A;  3F0C A;  1JJ8 C;  2I10 A;  3JRB A;  5HOD A;  1Y1V J;  2X9D A;  1HOM A;  2DMN A;  2VI6 A;  2JA8 J;  3HOW J;  4C3H J;  2Y9Z A;  2DA7 A;  1MBH A;  4DYR A;  1B8I B;  2H8R A;  1CQT A;  5M3F J;  2GLO A;  3DCF A;  2OPT A;  3LSG A;  3S2D J;  1P7J A;  2XPV A;  4D5F A;  3HOY J;  3JRC A;  3NAU A;  4RDU A;  1VF9 A;  2ZB9 A;  1O4X A;  2VPR A;  3A02 A;  3ZQH A;  4AUX A;  5M5X J;  3HM5 A;  4UUS B;  4A69 C;  1ZR2 A;  1GT0 C;  1VI0 A;  3JRH A;  1B72 A;  1XC5 A;  2FJ1 A;  3DEW A;  2JMW A;  5EGO A;  3S1Q J;  1Q1V A;  1WGX A;  2E2H J;  3OOU A;  1FIA A;  1TC3 C;  1GVD A;  5M5W J;  1UG2 A;  2DMQ A;  1ETV A;  3H3V K;  2Y9Y A;  1U78 A;  2YS9 A;  3BG9 A;  3OSF A;  4XID A;  2O9L A;  3FK6 A;  4L5E A;  2HYJ A;  3I4M J;  4LOC A;  1ZK8 A;  1BJZ A;  4M3B A;  1POG A;  3GTP J;  1JTX A;  3BTJ A;  3CMY A;  4IHW A;  1IDZ A;  4W97 A;  1IDY A;  2R0Q C;  1U8B A;  3HB9 A;  2LKX A;  3MVP A;  4CYC A;  3S2H J;  1RES A;  2CJJ A;  2XGE A;  3S17 J;  1SFO J;  3JRA A;  2TCT A;  2M0C A;  1TWH J;  4B1R A;  1NK3 P;  2DMT A;  1JUP A;  1JT0 A;  3G1O A;  2EZL A;  5K7F A;  2EZI A;  1H8A C;  5F27 A;  3K7A J;  2N8G A;  2VKE A;  3GTJ J;  2WAQ N;  2E2J J;  3TED A;  4Y52 J;  2XRL A;  2M2E A;  1R9T J;  1ENH A;  4A3E J;  4D7N A;  2CRG A;  1MBE A;  2CQQ A;  3MN2 A;  2EBI A;  1FTZ A;  2XPW A;  3PO2 J;  9ANT A;  1PUF A;  1SAN A;  3LNQ A;  5JLW A;  4W1U A;  1ETQ A;  2FX0 A;  3HKZ N;  2D5V A;  3HEF A;  1I6H J;  2ID3 A;  1HDP A;  1PUF B;  1LE8 A;  2HOA A;  2MSY A;  2CUF A;  2VKV A;  1ZQ3 P;  3SDG A;  1UHS A;  1ZGW A;  1GV5 A;  2GBY A;  2L0K A;  5IP7 J;  5IPA A;  1DU0 A;  5F0C A;  3PM1 A;  1MBK A;  1A6I A;  4FE4 A;  2X6O A;  3S1N J;  2LR8 A;  2OF7 A;  4AC0 A;  2G0E A;  1JTY A;  2ME0 A;  1IC8 A;  5M5Y J;  3C2B A;  2Y2Z A;  2MG4 A;  1F36 A;  3BR6 A;  4EEF G;  3RKQ A;  2YU9 J;  2LK2 A;  2JA5 J;  3BTI A;  4B3A A;  5DS9 A;  3K2A A;  1QPI A;  2XSD C;  2ECC A;  5FJ8 J;  2JJ7 A;  2HQ5 A;  5FKK A;  4JP0 A;  1B8I A;  1X58 A;  3BT9 A;  2E1O A;  3H0G J;  3ZQI A;  3ZQL A;  5FLM J;  2CU7 A;  3HDD A;  4A3G J;  1I3Q J;  2EZH A;  4J19 A;  2HDD A;  4UUS A;  3FKI J;  3LSJ A;  4JX5 A;  2DA2 A;  1QVT A;  4BXX J;  5E3L A;  2NVQ J;  3HGG A;  2HXI A;  1IRZ A;  2RAE A;  3B6C A;  1IJW C;  2WB1 N;  4MLO A;  2B63 J;  2DTZ A;  3JR9 A;  3RZO J;  5EG0 B;  1K61 A;  4M6V A;  2DMU A;  3I4N J;  3S15 J;  4A3F J;  5C4X J;  4FCY A;  3G1M A;  1IG7 A;  1ZTR A;  2HOS A;  1MH4 A;  3S16 J;  1BA5 A;  3A03 A;  4FE7 A;  2WV1 A;  3BR2 A;  1T56 A;  3HOX J;  1AU7 A;  1LFB A;  1NK2 P;  3JRF A;  4A3J J;  2ME6 A;  1BW5 A;  3Q0V A;  4A3M J;  1WH5 A;  4XK4 A;  1AKH A;  2E19 A;  1QVU A;  3M4O J;  4C2M J;  4A3D J;  1MBJ A;  2DA3 A;  1WI3 A;  3O8H A;  4JX4 A;  3CDL A;  5IOY A;  2M9H A;  1FJL A;  5J3L A;  1BL0 A;  3BR0 A;  4MO7 A;  1ETK A;  5JLX A;  2H1K A;  2IAI A;  1AKH B;  3CCY A;  1MH3 A;  2AO9 A;  1H88 C;  4BY7 J;  1IGN A;  2XGD A;  3QPS A;  4FIS A;  2L7Z A;  4B4C A;  3GTQ J;  2E2I J;  2DMP A;  1P7I A;  4BBR J;  2EZK A;  1MBF A;  3Q3S A;  2DA6 A;  2QCO A;  4IEJ A;  1DU6 A;  1TWC J;  4QSH A;  2M34 A;  1ETO A;  4MIM A;  5EZH A;  2QF7 A;  1UMQ A;  1WPK A;  2DN0 A;  1EF4 A;  1X2N A;  2ECB A;  1JKP C;  1TWF J;  2X48 A;  1Z0X A;  3BR3 A;  5IYD J;  1JT6 A;  2K9Q A;  1MSE C;  1IUF A;  2AHQ A;  4I76 A;  2NVX J;  2LVS A;  5F0F A;  3W6V A;  3NAR A;  1E3O C;  3OIO A;  1JUM A;  1U9N A;  2Y30 A;  2LD5 A;  1Y1W J;  3WHC A;  3BTC A;  2HOT A;  4M3E A;  1JGG A;  5IP9 J;  1HF0 A;  2XPU A;  2NS8 A;  4A3C J;  3LOC A;  1T33 A;  1RR7 A;  4XRS A;  3IV5 A;  5BNG A;  2JK3 A;  3QPL A;  5J1U A;  2JWT A;  2R5Y B;  2HXO A;  3GTO J;  1VND A;  3M3Y J;  5GPC A;  1XS9 A;  1S7E A;  5EDN A;  3BR5 A;  1HDD C;  1OCP A;  4BY1 J;  3GTG J;  2XB5 A;  5C44 J;  3B6A A;  5J1R A;  5IOZ A;  5J1Y A;  3BG3 A;  5F08 A;  2ID6 A;  4QTR A;  1XG1 A;  1W0T A;  3ZQC A;  5DTD A;  1ITY A;  4HNV A;  1WH7 A;  4X6A J;  3TP3 A;  4XIC A;  1H89 C;  2NVT J;  1MBG A;  4A3L J;  4DZP A;  3O8G A;  4G12 A;  3RQI A;  4DZJ A;  5K7Z A;  4C3J J;  5F04 A;  2CQX A;  1FTT A;  4I6Z A;  1GDT A;  5GP9 A;  4A93 J;  1U9O A;  1ZR4 A;  4IHV A;  1F43 A;  3GTL J;  2L7F P;  1OJL A;  5F1J A;  1MNM C;  2LLK A;  3Q0U A;  4M3D A;  2COB A;  4IHY A;  2NVY J;  2Y31 A;  5E3M A;  1I50 J;  1AHD P;  4A3K J;  5EG0 A;  4ABZ A;  2IBD A;  4IHX A;  3HOZ J;  3SFI A;  4V2G A;  2R92 J;  2R7Z J;  4DYC A;  5K7H A;  1GUU A;  3HOU J;  2LTP A;  2DA4 A;  1HLV A;  2DA5 A;  2IEK A;  3IH2 A;  2ELK A;  3GBG A;  4D7M A;  3S1R J;  4UUT A;  2NOG A;  3BTL A;  4FTH A;  2DJN A;  5EF6 A;  3JRI A;  1BW6 A;  2NS7 A;  2CUE A;  2W48 A;  3ZQG A;  5EZG A;  3TP0 A;  4GFB A;  3FIS A;  4Y7N J;  1WCM J;  5FKL A;  5FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...