1JKRC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*CP*AP*AP*GP*A)-3'
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkrC00
2CQQA 4V2GA 3JRIA 1Z77A 2NVQJ 5IOYA 4CYCB 2W48A 1VNDA 3A01B 4B4CA 2GLOA 2R7ZJ 2L7ZA 1RR7A 5IP7J 2DA5A 4A93J 1ETQA 2NVXJ 5J1UA 5EDNA 2HYJA 2DA6A 2L7FP 3SJMA 2K40A 4MLOA 3ZOBA 5F27A 5M5YJ 5M3MJ 2GBYA 3GTPJ 2LFBA 2JA8J 3UKGA 1BA5A 1B72B 4CYCA 1ETKA 3D1NI 5FKLA 5F1JA 4DYQA 3W6VA 1RKWA 3GBGA 2G0EA 4M3GA 5EEAA 5E3LA 4DZPA 2R92J 1B8IB 2YU9J 9ANTA 3WHCA 5FLVA 1S7EA 5K7FA 1ETXA 3TP0A 3PM1A 1AHDP 5IOZA 3BG5A 1P7IA 1B8IA 1TWGJ 1DU6A 1GV5A 2VKEA 2WB1N 2R5ZA 3GTKJ 5DS9A 3HOUJ 3NAUA 1NK3P 3LSJA 1MSEC 1P7JA 2MW8A 2YS9A 2RAEA 4FTHA 4A3BJ 2HXOA 3FKIJ 3VPRA 5F0HA 1ETVA 1IJWC 3LSPA 5J3LA 4AC0A 2X9DA 4UUSB 3O8HA 4XRSG 2HQ5A 5FKOA 4NDLA 2JA6J 1AU7A 3GTMJ 2QF7A 1MBJA 1E3OC 2H1KA 3BTIA 2M0CA 5FJ8J 1JJ6C 3H3VK 1TWFJ 2IEKA 4AUXA 1K83J 1ZR4A 2M8GX 1TWCJ 5GP9A 2NVYJ 4X1EA 4Y52J 3HGGA 3QQAA 4MFEA 2NS8A 4BKXA 1VFCA 3IV5A 5HODA 2AO9A 4A3MJ 4ABZA 2HOAA 3M4OJ 2M34A 5FKKA 2LTPA 1CQTA 3JRBA 1U9OA 1WH5A 3LSRA 2DA3A 4XRSA 1UG2A 2ECBA 2LK2A 1ZK8A 4XK4A 5F08A 3SDGA 1G2HA 2DMNA 3LOCA 1GDTA 3TP3A 2CRGA 3C2BA 5GPAA 1Y1WJ 4BXXJ 3HOZJ 2XB5A 3DCFA 4XICA 2JA7J 2R0QC 2DMPA 5F04A 2XRLA 4V2FA 1TWAJ 2HI3A 1QVTA 2JK3A 3JR9A 3HDDA 1Q1VA 1X58A 3BR6A 1RESA 1LE8B 2ME6A 3ZQFA 3JRFA 5IYCJ 3TEDA 1O4XA 1FIPA 3GTGJ 3O8GA 3BG9A 2VKVA 3I4MJ 1HDPA 1WCMJ 2AHQA 2I10A 2JN6A 3S1RJ 3FISA 1BW6A 1APLC 3RQIA 3JRDA 5IP9J 1JKRC 2E2IJ 5C4JJ 1JKPC 4C3HJ 1JT0A 2DA7A 4IHVA 3BQZA 4M3EA 3PO2J 5K7HA 2DMQA 3CCYA 1JTYA 1ETYA 2PMZN 1HOMA 1GV2A 2XPVA 4A3LJ 5DTDA 4BY1J 3QPSA 1AKHA 3CQZJ 2EH3A 1IV6A 2L7MP 3NARA 1IG7A 2COBA 2P81A 2L9RA 4DZJA 2XSDC 1PUFB 5C4XJ 3S17J 2TCTA 3JREA 5J1RA 2MG4A 3JRGA 1B72A 3GTQJ 3HKZN 2E19A 1OCTC 3BR0A 3BQYA 5EZHA 5E3NA 2XGEA 2ZB9A 5FKMA 4DW6A 3HOWJ 1U8BA 1EF4A 1FTZA 2R5YA 3IH3A 3G1OA 4A3IJ 1JUPA 1RKTA 1YRNA 2CJJA 1QPIA 2OPTA 2DN0A 2XPUA 3ZQGA 2LLKA 5C3EJ 3MN2A 3MVPA 2QCOA 5J1YA 1JT6A 3HGYA 3JRHA 2Y30A 1I50J 4A3JJ 3HOYJ 3BTJA 3QPLA 3OSFA 4JYKA 4XIDA 2ECCA 2WAQN 2K9NA 3TW7A 3OSGA 1MNMC 2L0KA 1T33A 3BR3A 3GTLJ 4UUSA 5IP6A 5JLXA 1ZQ3P 1PUFA 2JA5J 1WGXA 4FE7A 1SANA 3Q0UA 4I6ZA 1FEXA 4MFDA 1UHSA 4M6VA 2Y0SN 3GTJJ 2LY9A 2R5ZB 4C3IJ 4FISA 4IEJA 1I3QJ 1F43A 4JX6A 3OOUA 1HLVA 1I6HJ 2O9LA 2D5VA 1OCPA 2ELKA 4GFBA 4M3DA 2FD5A 2MSYA 2VPRA 3ZQLA 1MH4A 2TRTA 3HM5A 2CUEA 1POGA 2DA1A 2JJ7A 3Q0WA 4D7MA 3WHBA 3A01A 1IC8A 3G1MA 2E1OA 2HOTA 4M3BA 2XB0X 1Y1VJ 1DU0A 3S16J 4A3CJ 1U9NA 5GPCA 4BBSJ 3G1LA 5EYRA 4LOCA 4DYRA 2MGQA 1ETWA 3RZOJ 4M3FA 1ZKGA 1MBKA 2EZHA 1NTCA 2ID6A 3B6AA 2ME0A 3ZQHA 1X2NA 2DMUA 1H8AC 2VUMJ 5E3OA 2KT0A 4JP0A 3RZDJ 2FX0A 1VI0A 2O7OA 4C3JJ 2LR8A 1FTTA 2B63J 3S1MJ 3E7LA 3FK7A 4B3AA 3S15J 2DA2A 1UMQA 2N8GA 4G12A 3S1QJ 3SFIA 1X2MA 4A3KJ 1XS9A 5M3FJ 4QSHA 1LFUP 1RETA 1BL0A 4A3GJ 2NS7A 5EG0A 5F0FA 2CUFA 3S1NJ 3S2HJ 2EZIA 1JJ8C 2DMTA 4JX4A 2IAIA 3A03A 2DTZA 2NOGA 1LFBA 4A3EJ 2OF7A 4D5CA 2IBDA 2M9HA 4BY7J 5FLMJ 3IH4A 1JKOC 2JWTA 2XPWA 5EZGA 4MO7A 4J19A 1AKHB 2Y9YA 1WPKA 2LVSA 3HBLA 5K7ZA 2EZKA 3FIWA 1SFOJ 2XGDA 2FQ4A 2Y2ZA 1ZTRA 4EEFG 1K61A 3RKQA 1OFCX 2H8RA 3H0GJ 4W1UA 2X6OA 3DEWA 5FKNA 3S2DJ 1IGNA 2FJ1A 3GTOJ 4MIMA 5C44J 1OJLA 5IYDJ 4X6AJ 2K9QA 1ORKA 2EQRA 1WI3A 4C2MJ 1IDZA 1YRNB 3K2AA 2M2EA 2DJNA 4Y7NJ 2R93J 5EGOB 4XRMA 3HOVJ 5EF6A 2EBIA 4D5FA 1BW5A 3K7AJ 3BT9A 3MKLA 5IPAA 2K9SA 1GUUA 4L5EA 4IHYA 3Q3SA 3FK6A 2O8KA 4QIWN 4A3DJ 4IHXA 1R9TJ 4A3FJ 1MBGA 1LE8A 5M5XJ 2E2JJ 1BJZA 5BNGA 1Z0XA 4A69C 3PO3J 4BBRJ 3BR1A 2JMWA 1VF9A 1XG1A 3JRCA 1IRZA 3A02A 4QTRA 3M3YJ 2LP0A 3ZQCA 1GT0C 3BTLA 5F0CA 4DYCA 3Q0VA 4IHWA 1MBEA 3HEFA 1A6IA 2KDZA 1ITYA 1MBFA 2R5YB 1QRYA 2E2HJ 1TWHJ 2LD5A 5E3MA 2HXIA 4HNVA 1IDYA 1TC3C 1IUFA 2CU7A 3L1PA 1W0UA 2Y9ZA 5JLWA 1F36A 2DA4A 1JUMA 1JGGA 2HOSA 1FIAA 3OIOA 4FE4A 1NK2P 1JTXA 2GM4A 4B1RA 1RPWA 1ETOA 4UUTA 1GVDA 2NVTJ 4S0HB 4RDUA 2XGCA 2YUSA 1JUSA 1ZGWA 1ZR2A 2VI6A 1MBHA 4RBOA 4I76A 3JRAA 3BR2A 1A5JA 3LSGA 3BTCA 1H89C 3I4NJ 1MSFC 1FJLA 2Y31A 3CMYA 1U78A 2ID3A 5EG0B 4D7NA 3BG3A 2X48A 1HF0A 5EGOA 1MH3A 4W97A 1HCRA 1JKQC 2WV1A 3LNQA 5M5WJ 1D5YA 3CDLA 3B6CA 5IYBJ 4AYBN 2CQXA 3S14J 2EZLA 3HB9A 1T56A 1XC5A 3ZQIA 3HOXJ 1QVUA 3IH2A 3BR5A 3F0CA 3TW6A 1HDDC 1ENHA 1H88C 2LKXA 4JX5A 2HDDA 4FCYA 1W0TA 1WH7A
chains in the Genus database with same CATH superfamily
3A0HC 3JRIA 4Q5SF 3FMSA 3RQ4A 5FLXK 5L3DA 3A01B 1BI1A 2KIQA 1RR7A 5TRDA 2MH9A 2K7LA 3AG1H 2DA5A 3T0YA 3FXOA 4MQVA 3WTVC 3CC7I 2FE3A 3K10A 3M7GA 3SJMA 1VQNI 5F27A 1XDSA 3J81K 1LQ1A 3ZN0A 4WCGA 4G7HF 2JA8J 3UKGA 2IRFG 4C9YA 2F6CA 5ICCA 3OMYA 2EJRA 4OMYA 5H6RA 4WXHA 4DYQA 4RM2A 1RKWA 3GBGA 1SD5A 2B9SA 3E6CC 4EJUA 2UV1A 4A0ZA 4M3GA 5EEAA 5E3LA 1K6YA 1K78A 1CGPA 1IW7F 1HBXG 6PAXA 2HYGD 2CWEA 5EEGA 2R3SA 1S8NA 5EEHA 5E8IA 2M8EA 1K79A 3KP7A 2CQNA 4JOMA 1B8IA 5AONA 2BXYA 1LEAA 3KP5A 3E6DA 4BACA 4OWRB 2WTEA 3BZCA 2LC2A 2XC7A 2D1VA 1DQUA 1SD6A 2L54A 1FOXA 2E7WA 2MW8A 5HLTA 2YS9A 3ZMZA 4XKCA 3ABKH 1Y8RB 1IAWA 5J40A 3ZPLA 2BVMA 1Y39A 3DBRB 4F3QA 4IHSA 2HQNA 2X9DA 4UUSB 2CYYA 4XRSG 4YIRX 2QF7A 4O3MA 1XGSA 4CCLA 1WJEA 3BTIA 5FD6A 2VE9A 1JJ6C 1MW7A 2OTLI 4IO9F 2IEKA 2JSCA 5J8CA 1PDNC 2X1DA 2MLGA 5JVGF 2NVYJ 3LQQA 3KZZA 4X1EA 1R7JA 2JRMA 1HKQA 1QQIA 2W7NA 5AIPA 5HODA 1E0EA 2W1OA 4A3MJ 4ABZA 4Y4RA 4ZZLA 3G2BA 2HFHA 3S32A 3CESA 4BDYA 1R1VA 4B48A 3BG7A 2F4IA 3DXJF 1WH5A 2LKSA 3LSRA 4KIGA 3WTWC 5DUKA 4U87A 1UG2A 3ELKA 2WBMA 2F5FA 1FYKA 2E1CA 3CCRI 4CUGA 3SZGA 2A68F 3S3NA 2MABA 5DD4A 1GDTA 1IRFA 3LSHA 3TP3A 3J80Z 4Q4ZF 3C2BA 2HOEA 3HC7A 1PVEA 4L0YB 3WGHA 4EJWA 3LA2A 2DAOA 2JA7J 3FXRA 1VTNC 2R0QC 5H6QA 4A12A 2DMPA 2ZJ2A 3JR9A 1QVTA 2JK3A 1D3YA 5TGTA 3GUDA 1Q1VA 3I55I 2CGPA 1RESA 1LE8B 3DPLC 3W6KB 4FETA 1X4PA 3QWLA 2RQQA 4NC8A 5E17F 4NC6A 3D5LA 4S05A 2DFIA 2VKVA 4HF2A 2AHQA 2K85A 2XF5A 3KIOA 2CUJA 2UUZA 1F9NA 5L3EA 2HVRA 2MC3A 2XAHA 1APLC 3N4MA 4WK8F 2DCEA 1JKRC 1U2WA 2Z3YA 1FBQA 2A6TA 1J9IA 4CYDA 3HHHA 4BHBA 2OQGA 2K3PA 2BBYA 2DA7A 3COAC 5FO5A 3RKYA 3OY9A 4KIBA 2GOXB 5CVIA 2R7FA 3OYMA 3PO2J 5TJJA 1W7PB 5K7HA 2ZSIB 2LF7A 1KQ8A 4LLGF 1Z05A 3CO6C 1X3WB 1ZG1A 3QPSA 4BY1J 2JQ7A 4CSWA 3ZRGA 3EUHA 1IV6A 1LDDA 4G9YA 2ELHA 3R0AA 4WXCA 2AXTC 2BOLA 2EIMH 2XSDC 1PUFB 2TDXA 3L2WA 1UCRA 2OD5A 2HVSA 2DK5A 4ZTJA 3JREA 5J1RA 2W82A 2FUG2 2UXXA 3ZQQA 3GTQJ 1FPQA 2E19A 2DDAA 1SVLA 1JGSA 2QM3A 4D1QA 2QA4I 4H0EA 2ZMEC 1T0FA 4BYYA 1BN5A 4ENKA 3CCMI 2VJ4A 4DW6A 1VQ9I 1RUOA 1ZELA 3HOWJ 2NS0A 2H1LA 5CLSA 3OYCA 5GAGJ 1JUPA 4JBAA 3I5UA 2D1HA 3OIQA 1YRNA 1JE8A 3RYRA 2Z5UA 3DPUA 3MCZA 2OPTA 4XMYA 1YO5C 4DJAA 3PIPF 2DN0A 2XPUA 3ZQGA 1J7KA 3MVPA 2QQAA 4LJZF 4AU7A 2LBFB 3JRHA 3GX4X 1T39A 2A69F 3HOYJ 1MJ9A 3K4MA 2QZ8A 4H4KC 4P9UA 3B02A 4XIDA 2JPBA 5JFRA 3OSGA 2BZTA 2JVHA 3OS1A 1A31A 4AM3A 2XASA 4LG0B 3JSOA 3H5RA 3WTUC 4UUSA 3CCLI 2M1BA 1ZQ3P 1PUFA 1G3SA 2YR2A 3KYDB 3S3MA 4FE7A 1SANA 2HWVA 5K5RA 3H0DA 4JQFA 1O3SA 4HNUA 1R22A 1XMAA 2FF4A 5GAEJ 1UHSA 1WKMA 4M6VA 3N97A 4BQOA 2RDPA 3GTJJ 4HA8A 4C2UA 4Y17A 4C3IJ 2OJED 4FISA 4IEJA 4BQNA 1LNWA 1I3QJ 2X1CA 3ECHA 4JX6A 4RGXA 1DUXC 4ZDOA 1JXSA 1OCPA 2LMDA 2W24A 4BE0A 3MAJA 4M3DA 3OR2C 3CDHA 2FU4A 3MEXA 1MH4A 2HKOA 1SD4A 2HQRA 1HW1A 1FMVA 2JJ7A 3KEOA 5LGUA 2A5YB 3WHBA 5B66C 2VJ5A 4KDPA 1EA3A 3GFLA 3GEZA 3G1MA 2E1OA 2HOTA 2L9VA 5A2QK 1Y1VJ 1FP1D 4NQWB 3S3OA 2MGQA 5F6FA 5FRMA 5ICFA 2KRFA 1ETWA 3M9AA 3VWBA 4F55A 1YIOA 3FMQA 1ZKGA 1MBKA 2DU9A 2EZHA 3IC7A 4HX7A 2VIXA 4G6QA 4BH9A 2ME0A 1X2NA 4GRIA 4B3XA 2W57A 3C18A 5E1ZB 3RZDJ 4N9HA 3OYJA 1K78B 1LB2A 1VI0A 4U7BA 2OCCH 4DBQA 2LR8A 2VQHA 1LVAA 4UHTA 1FBSA 4ETSA 1P2FA 2B63J 4M73A 5LRSA 5L3GA 1V5EA 2EFOA 4B3AA 2M45A 3LSIA 2LOOA 2IS6A 1WFXA 3PFIA 3HSRA 2CW8A 4GXOA 3N05A 1TT5B 3GZ5A 3WTYC 1RETA 1VQ5I 3W2WA 2BY3A 2Q2EB 2CUFA 2WAFA 2L01A 2CUZA 3GXOA 4I09A 2HTSA 4UV9A 4BS9A 1QPMA 3A03A 2RREA 2CV0A 4BGDA 1EH7A 2L5QA 2VXZA 1LFBA 2UWMA 3K70C 2OF7A 3L00A 2IBDA 3B73A 1ONVA 5FRNA 1S9HA 3IH4A 4NQWA 2FRHA 3I56I 2JWTA 2E5NA 3BROA 1IO2A 4MO7A 3JW4A 3VDXA 4CCOA 4J19A 2HDWA 2M3AA 3BPXA 3TBIA 1AKHB 3HXLA 2IJLA 2L4MA 4E4HA 4AIHA 3QYBA 3U21A 4F92B 3LA7A 2V26A 1ZTRA 2V1UA 4E7KA 4GGGA 3RKQA 5HDNA 3L2VA 1OFCX 2H8RA 2X6XA 2X1EA 4OMZA 4EM2A 2FJ1A 2E35A 2KFDA 5FB2A 3K4CA 4IHTA 1JI8A 1EV7A 2K9QA 3PFYA 3TL4X 4Y13A 4F52A 3K70D 5EF6A 3PJRA 2EV0A 2A3SA 3Q3SA 3FK6A 1K4SA 2O8KA 4QIWN 1R9TJ 1A35A 2VE8A 4XKBA 3AL0C 1BJZA 4XLAA 1HSJA 3IAS2 3W3CA 2GA1A 3VOEA 2IGKA 1LDKB 3A02A 4II3A 2DOEA 2P5VA 3M3YJ 3E5UA 2BY1A 1B9NA 1HC8A 2VJJA 4AYBA 4DYCA 1DGRM 1SMYF 2XF7A 1ZAOA 3QP5A 1MBEA 3HEFA 3LAPA 2KDZA 1ITYA 3A1YA 1TWHJ 2R7VA 5E3MA 4L9NA 1IDYA 5CQEA 4OINF 5D8KB 3E5XA 3F9KA 4KT6A 2OQRA 3OR1C 2Y9ZA 2CFXA 1F36A 2Q0OA 3PIOF 4UVCA 1OMIA 1TW2A 4G7OF 3CF5F 4MQ9F 2IA1A 2FEZA 2IS1A 3G71I 1ETOA 3H5NA 4UUTA 2NVTJ 4S0HB 2KMUA 1AA7A 2STTA 2F48A 1J75A 4MNUA 3OV8A 2J5OA 5KK1A 5HNHA 2W25A 3FXKA 5HNFA 2HZDA 3JRAA 3BR2A 1CF7B 1HQCA 2HEOA 4HW0A 3LFUA 2GXGA 3DTEA 1UG0A 1W7PA 1ZH5A 2Y31A 4CZCA 1YYVA 1SVOA 2K86A 3RI4A 1ZHFA 3ASOH 3BG3A 3T5XA 1WRJA 3ZMDA 5IT9Z 3RPQA 3J7YJ 3LNQA 3KEQA 5M5WJ 4XORA 2VJIA 1ZG3A 3S14J 4M6YA 3HB9A 1R23A 1T56A 1UJ8A 2QUFA 3DEUA 3ZQIA 3HOXJ 3U2RA 2ACJA 1F5TA 3OS2A 3BR5A 4TV7A 3F0CA 2WAQA 4M6XA 4HAMA 2EPFA 3WE3A 3AL0B 3HTUA 1ENHA 1W36D 4ESBA 3PNYA 1R71A 1H88C 1LDJA 1BI2A 1YS7A 2GIZA 4EMSA 4Y33A 4A3FJ 2WWYA 4V2GA 2ESHA 1Z77A 1YW8A 1J09A 3BC8A 1Y0UA 2R7ZJ 3E1SA 1S7OA 3R6SA 2MLKA 5IP7J 2L2OA 2EV6A 4A93J 2ZMEA 4LK0F 2Y48A 1R00A 5CQGA 2L7FP 4LG3A 2K40A 3LAJA 4XR6A 5M5YJ 2VC0A 4U0VA 2GBYA 4XRFA 3UR3C 2D45A 2E7XA 1S29A 2HVQA 3VSLA 2RV8A 3W2VA 1F4KA 3DLLF 1USSA 1S3JA 4Z2YA 4B44A 4UNOA 5FKLA 5F1JA 2RNGA 2PQ8A 3VFZA 3FXJA 5LGNA 3FF5A 2HPIA 2QVOA 3FXUA 3HOSA 4R79A 2R92J 1YJNI 5LEKA 5JHUA 1QBJA 2DPUA 3GZ6A 2RKHA 5K7FA 3EYIA 4LB5A 3WTTC 4ZYGA 2IT0A 1HKTA 4EJVA 1HSTA 3BG5A 2VT3A 2XF6A 4I01A 1TWGJ 2K9LA 1DU6A 2B7EA 2HNHA 1GV5A 3BZKA 2HPMA 3K1PA 2WB1N 2R5ZA 3GTKJ 3ZQ7A 3HOUJ 1XSXA 2LG4A 2OTJI 3LSJA 1P7JA 3IUOA 4DQ2A 3FKIJ 2M4KA 2KIMA 3KP2A 3OIPA 2CW0F 1ETVA 5F0HA 3LSPA 5J3LA 2C6YA 2HQ5A 2E1MB 2E71A 2JA6J 5FFXA 3GTMJ 3F6VA 4BUPA 4PUSA 1G59A 2ZMEB 1MKMA 1IXCA 3PUFA 1X3UA 5BMZA 1OKRA 1HW5A 2KL4A 2M8GX 1BI0A 3OYFA 1FT9A 3QQAA 2R7SA 2Z33A 1LVKA 2O3FA 4BHPA 4R1HA 3L09A 5FKKA 4PFPA 1FMWA 3I64A 2PMHA 2LTPA 1CQTA 1BIAA 1X1DA 3PSFA 5AIQA 3JRBA 1U9OA 2ZNYA 3FBIB 3V7SA 2PJRB 2CG4A 5BQTA 4XN0A 3HJEA 4N4NB 1TTYA 3FX3A 2A61A 1J59A 2CV2A 1XGOA 1E3HA 3V7RA 4XN3A 5F08A 3SDGA 3CC4I 4DNCA 1OLTA 1G2HA 1W5CC 4CZZA 2DPDA 3QYFA 3ABUA 1Z67A 1TL8A 1REPC 1D0XA 2CRGA 2MFZA 1ACIA 2PBIA 2F5EA 5EJCA 4XICA 3HOTA 4I02A 2JPCA 1FX7A 2XRLA 5CVVA 2H6BA 1I3AA 1X58A 2FQ3A 1AWCA 3HL2A 1OYIA 3J80K 4P55A 3ZQFA 3JRFA 3SHFA 1EJ9A 3O8GA 3I4MJ 1LPQA 2EFNA 2I10A 4L18B 4LLLA 3RQIA 3JRDA 2NRAC 4I0BA 4HNTA 3HSEA 4C30A 4D9JA 4C3HJ 2BVLA 4IHVA 5GTHC 5DM6F 2V9PA 3OWTA 3BQZA 3LWFA 2DMQA 3CCYA 5LHHA 1JTYA 1P6RA 4FASD 3JSPA 3K4BA 3HHGA 1E17A 2X51A 3HG9A 1MMAA 1AKHA 1PUEE 3I4PA 2Y69H 5F64A 3F6OA 2ZJPF 3J81Z 3L2UA 1RI7A 3NARA 2R4GA 3HSFA 2COBA 2DJIA 3H9JA 2L9RA 4BJ5C 3REOA 4DZJA 3I58A 4GYGA 3F8MA 3CCSI 1WHUA 4LIVA 2MG4A 2Z16A 3JRGA 3HRMA 1W4MA 2KIUA 1YS6A 1OCTC 4XNFA 3BR0A 4F7ZA 2JUGA 2LY2A 1UAAA 2BW3B 3VYTB 3CMEI 5FKMA 4DGWB 1X4OA 3QOEA 1U8BA 3IHUA 1E3PA 3MFKA 4A3IJ 3NWTA 1RKTA 2JA2A 3C7JA 3L2RA 2CJJA 4B43A 3WGGA 3QPHA 3W6JB 4CCJA 2DW4A 1XGNA 4OIOF 5JHFA 5CJ9A 5J1YA 5L3BA 1A36A 1XMKA 3OYBA 2MH2A 4QLCU 3ABLH 1I50J 1OCOH 4A3JJ 3BTJA 1KU9A 3CUOA 2DODA 2G9WA 4F91B 2K9NA 3Q5FA 2L0KA 3OYNA 4ON0A 1CF7A 3DWLE 1S72I 4XL9A 4CCKA 4XM3A 2JZYA 1P4XA 1DPUA 5B3SH 1GHCA 4E7ZA 5CYVA 4IOAF 2V1NA 4E7IA 3PUBA 3FM3A 2PI0A 5ICGA 1P4WA 3Q9SA 4XSXF 1MDMA 1F43A 1HLVA 4ZDLA 4E7JA 3QPTA 4HSRA 1I6HJ 2LDUA 1FC3A 2O9LA 2PJRA 1OYYA 1I1SA 4GFBA 4UB8C 3DKXA 2MSYA 3ZQLA 5HDGA 2QQBA 2IXSA 2NAZA 3Q0WA 2CUEA 2LF8A 1D0YA 2VT2A 3DFGA 4HQEA 1KA8A 1U8RA 4A5NA 4XLHA 3M1EA 5IT9K 3G1LA 1O3TA 1YLFA 4EVIA 4PJ0C 5LBQA 1SD7A 1PP7U 1U5TA 1MNDA 2HR3A 1VQ4I 3RZOJ 3DU6A 4M3FA 4YRVA 3B6AA 2R7XA 4ZDPA 3ZQHA 1ZGJA 1H8AC 4E7SA 4IF4A 2VUMJ 4IVNA 2LSOA 4JP0A 2XDVA 4ANJA 3K4LA 5HS8A 3CJNA 3IAM2 4ZC3A 2AQFA 3HPGA 3T8TA 2RNJA 4M71A 3E7LA 2IGNA 4AD9A 3GW2A 3SEZA 2DA2A 2N8GA 3FWEA 4MEXF 5B1AH 1YITI 3SFIA 3S1QJ 2VPLA 1QNTA 1X2MA 2XKOA 1XPXA 2H27A 4A3KJ 2H6CA 5DCFA 5M3FJ 4QSHA 1BL0A 4A3GJ 2A07F 2NS7A 5DUIA 5EG0A 3S2HJ 3QYEA 2KHMA 3CJQB 2DYSH 3BP8A 2DTZA 2VODA 2NOGA 5FLXZ 3F72A 4A3EJ 2DBBA 5ILVA 3H36A 4BY7J 4G94A 2VN2A 5FLMJ 3T1BA 3OYGA 1U5TB 2XPWA 3EUKL 2YX7A 5EZGA 1T98A 3TGNA 1BI3A 4RS8A 5KAIC 1J0RA 2DK8A 3HBLA 1M1EB 3FIWA 2VKHA 2OUMA 2XGDA 4JK1X 2FQ4A 2LY1A 2PG4A 3U1DA 3E6BA 1K61A 2P0WA 2X4HA 3F8BA 1H9TA 2K27A 3H0GJ 1SFEA 2FA5A 4W1UA 3DEWA 5FKNA 3V8LA 5LLQA 1XTAA 2VQCA 1IGNA 3GTOJ 2WY7Q 2Z99A 3SFZA 5FD5A 3H1CA 5IYDJ 2L3DA 1WI3A 4EV0A 1IDZA 1X3ZB 2M2EA 2WAEA 1Y8QB 2R93J 2BGCA 2DOAA 1QGPA 3K7AJ 5IPAA 4KA4A 1GUUA 4L5EA 3PL8A 4IHXA 3TO7A 1RZ4A 4ZJZA 1R5HA 4XSZF 1MBGA 3TOAA 4KT5C 1LE8A 1I1GA 4QWQA 1D1CA 4HF0A 1WZ2A 2NNNA 4L5IA 1X19A 2JMWA 2L9NA 1VF9A 4ESJA 4RGSA 1XG1A 2FXAA 3JRCA 4QTRA 2QSFX 3R0JA 3ZQCA 2RGVA 1T95A 3BTLA 2BHYA 5F0CA 1ZREA 3TMOA 3R4KA 4IOCF 3BY6A 2EWNA 1J5YA 3DP7A 3DQVC 1A6IA 1NH3A 2KDOA 4BE2A 1WVRA 1W36C 4RGUA 3BJOA 2GXBA 1FLIA 1MBFA 1Y56A 1QRYA 2E2HJ 1KU3A 3WODF 2LD5A 3FXMA 4QPOA 4AWXB 2ELJA 2X6WA 3BCAA 2EA4A 1IUFA 1W7PD 2QLZA 3L1PA 2DA4A 4XOTA 4KITB 4L9JA 3V8JA 3ABMH 4FE4A 5ERIA 2DQRA 4N9IA 3F21A 1RUNA 3LL7A 3H9QA 4RDUA 1Z9CA 2XGCA 4HDVA 4NBQA 5ED4A 4HRIA 2NYXA 4O5VA 1ZGWA 3IRRA 2VI6A 4E6KG 4XLEA 4CHUA 3CCQI 2KLOA 2ISYA 3HKZA 2WV0A 2QGUA 2YX4A 3CMAI 2DYRH 1SFKA 4L5JA 3F8FA 4LD5A 4PSWA 2V1XA 3L2QA 3CC2I 3V42A 1OR7C 2BYVE 1U78A 2WC2A 3GYHX 5JI6A 1YJWI 4KNYA 1XCVA 4D7NA 1FP2A 3C3WA 2P6TA 1XSDA 1K7AA 5EGOA 1MH3A 2FBHA 4EATA 5E20A 2LH9A 2BY0A 3B6CA 3KLNA 5IYBJ 4AYBN 2CQXA 4IL6C 2KZVA 2XVCA 1XC5A 4BJ6C 3QRFF 1BR2A 3M07A 3IH2A 2LYCA 2KRHA 3A2KA 2PEXA 4EGZA 3ZMVA 4PGGA 2IA0A 5KHDA 3EUHC 2EINH 4ZZDA 2ZSHB 4IRGA 2WB1A 3S8PA 3ZP5A 1I5ZA 1ON2A 4JX5A 4RM3A 3G73A 1TQMA 2BY2A 2F2EA 2HZTA 4FHTA 2GWRA 3CP2A 1WH7A 2CQQA 3I53A 2FOKA 2NVQJ 4XKVA 2L7KA 1TLHB 2LKPA 2W48A 4B4CA 2GLOA 1E2XA 1TQIA 1TT0A 1OYWA 5HOOA 2KPMA 1V5FA 5LD2C 3HPHA 4BQAA 5EDNA 2HYJA 4A6EA 2XKPA 1G4DA 2VONA 4MLOA 4XOPA 1GXPA 2HDCA 3G4SI 5M3MJ 2EIJH 4KN4X 2IA2A 1KQ0A 2XHKA 4FX0A 4U7DA 5E18F 4P5OA 1B72B 1IN7A 3I59A 4U0WA 4MHGA 3D1NI 1YOVB 2IGMA 3W6VA 5E79C 3W2AA 1RC9A 2XRNA 3HYIA 3K1NA 3CCEI 4DZPA 5B5EC 9ANTA 1X1BA 4ITVA 4ZTFA 3WHCA 1S7EA 3OOPA 4AVPA 1VZ0A 1OQYA 2PX9A 3UNGC 3PM1A 4GYIA 3J7AY 5DDGA 3RYPA 1U3EM 2CS3A 3KYLA 4HG2A 1DP3A 5L3FA 2XSJC 3H9GA 3G6EI 5DS9A 5CVUA 1IN8A 2DTRA 3GZNB 1NK3P 4OIPF 4N0BA 1MSEC 1Z21A 4OU0A 3OYKA 1YI2I 1KONA 2VXDA 2NOJB 4FTHA 4A3BJ 2HXOA 5LHGA 3D5RC 3VPRA 1ZLKA 2EK5A 4OAZA 3FMRA 4CXFA 4AC0A 2QYOA 5HDKA 3O8HA 1HXDA 5FKOA 5J47A 1AU7A 2FOWA 4S04A 4AVZA 2H1KA 3MD2A 1WWXA 4BHCA 5FJ8J 3QAHA 5F1RA 1Z1DA 4PCQA 4LFUA 2AXLA 1TWCJ 1WJBA 2EV5A 5DCMB 4UY8I 4GCVA 3JAMK 1IF1A 4Y52J 3HGGA 4BKXA 3TQNA 2NS8A 2RVCA 4XLNF 4WWCA 2AO9A 2MC4A 3ERMA 3AG3H 3CUQB 5FGMA 3MZ8A 3BWGA 2HOAA 5A2QZ 3M4OJ 3U9GA 1LUJB 2WY8Q 2GAUA 2VQGA 4EGYA 1YX3A 1O3RA 4HF1A 2DA3A 1V5GA 1A04A 2LK2A 4LK1F 2DQLA 1MD0A 1ZK8A 3CJRB 1T6SA 1DPRA 2R7TA 1QA6A 2IP2A 2DMNA 3LOCA 1MMGA 3IWZA 3RIRA 4G8XA 5GPAA 1Y1WJ 1YFHA 2ZKZA 4BXXJ 2M5WA 3BLYA 2ZJQF 3HOZJ 2BV6A 3DCFA 3WTXC 3GF2A 1ON1A 2JTVA 3I0TA 1QU3A 2VOOA 1YG2A 3KEYA 4LITA 4V2FA 5D4RA 3HDDA 5HVQC 1R5GA 2F4OB 3BR6A 1I39A 1TZLA 3OYHA 2PLYA 2ME6A 1D8JA 5BPDA 5L3CA 3TEDA 1O4XA 3H3ZA 1C0WA 2LREA 1RR8C 3GTGJ 2OU2A 1WI9A 4KMUX 3LQRA 3BG9A 3SYTA 2XAUA 1P9QC 4HZFA 1WCMJ 1G6NA 2GZWA 2VOPA 3KCCA 2JN6A 1N25A 2IPQX 3S1RJ 2O03A 1BW6A 3WE2A 3P5JA 2M30A 2E60A 4L9TA 2E2IJ 5C4JJ 1FBUA 4HV6A 3P9CA 2KP6A 1JT0A 1WJCA 4M9ZA 2Y0MA 3FM5A 3WG7H 1ETYA 4KUMA 1TQPA 3GVAA 4G6DA 1HOMA 1GV2A 3CLOA 2QWWA 1BJAA 1MMDA 1HKSA 3CQZJ 2I5UA 3FDYA 2ZXHA 4D0PA 1VQKI 2L7MP 5DEQA 4RAFA 1I27A 4HBLA 3ZN1A 4PK4A 1ZRCA 1YJ9I 3SZPA 2EFQA 5KNLA 2QBYA 1MJBA 2TCTA 3CO7C 4C2TA 1B72A 4M9XA 2STWA 2P7VB 2VB6A 3R60A 3BQYA 1K6OA 3EQLF 3BOQA 1QZZA 2F5DA 4NUBA 2M4GA 1NG6A 1FTZA 2R5YA 4IKFA 3JTHA 2VBYA 2BHZA 4P96A 1BOAA 3FZVA 2ZXWH 3KFWX 1R1UA 1QPIA 3CUQA 4IQ4A 4I99C 2GQQA 2QSGX 3I71A 3K4NA 1BR1A 3CUQC 3Q9VA 3F3XA 3QPLA 4DIQA 2A6HF 1TW3A 2F4MB 2GA2A 1RRJA 2WAQN 3RTRA 1MNMC 1OCZH 1T33A 3BG6A 2HKXA 2O61A 2ETHA 4II2A 2OA4A 3GTLJ 4J00A 1OPCA 2D2WA 5JLXA 3QU6A 2O0YA 2XV4S 2JA5J 1FEXA 1UELB 1IN6A 3ML6A 3Q0UA 4I6ZA 3E5QA 1G3WA 4L9VA 2AQEA 1D8KA 5LEJA 4FQGA 4ENNA 3CZ6A 3WU0A 4RAZA 2XIGA 3K6GA 4PSXA 4GO1A 3AKZA 2LY9A 1T0FC 1WJ5A 2R5ZB 1IRGA 5HLHA 4CH7A 1YX5A 4KYWA 1JHFA 2FD5A 2MD5A 2VPRA 3BJ6A 4XONA 2K4BA 2IS2A 1IC8A 2DA1A 2Q8KA 4F93B 3DKWA 5LHIA 4M3BA 5D6FA 3BPVA 2E36A 4KMFA 3KYCB 3NQOA 3S16J 5K5OA 4A3CJ 4BQQA 1U9NA 4BBSJ 2V4JC 3OL4A 4LOCA 4DYRA 2OV7A 2QQ8A 1Z3XA 3C2HA 3IKVA 2Z1DA 1UB9A 1T38A 2ID6A 2K02A 4AIJA 1EH8A 4BE1A 5E3OA 2DO7A 1VQ7I 2V79A 2KRCA 4PDKA 3KPHA 2FX0A 1QZYA 2L9SA 4RAGA 3K4KA 1FTTA 3S1MJ 1B4AA 4G6TB 4RB3C 3M1CA 4CGZA 4PFOA 1T08B 1ZARA 3RSNA 3BZ6A 2XAGA 5LRRA 3E97A 5KAFC 1LFUP 2VBWA 1HA8A 3K69A 1IN5A 1FY7A 5H2FC 2VLAA 4LMYA 2ZCWA 1KZHA 2DI3A 4JX4A 2V6EA 1O57A 5TISC 4UB6C 4OAYA 1LKXA 4Y3OA 2M9HA 3BDDA 4UV8A 3VYUB 1JKOC 3V7CA 1UHWA 4R8HA 3DV8A 4XBFA 1S5LC 3E0JB 2FNPA 3ZR8X 3CJTB 2Y9YA 1YQAA 2LVSA 4HSTA 2QEXI 2FBKA 1UFMA 1YTYA 4A6DA 4RB0A 4BJTA 1B6AA 2Y2ZA 4YELA 4YIIA 2IVMA 1V55H 4RMNA 3S2WA 3MZYA 1H0MA 2UZKA 3CCJI 3S2DJ 5DD8A 1ZYRF 3LSMA 1D0ZA 1MDMB 2FBIA 4HPQA 1KGSA 3HIFA 4MIMA 5C44J 1OJLA 4BL0B 3IKTA 2EB7A 1WQ2A 4X6AJ 4IJAA 2EQRA 1YRNB 3K2AA 2DJNA 4Y7NJ 5EGOB 3HOVJ 1BW5A 2EBIA 4D5FA 3MKLA 3BT9A 5CKTA 4IHYA 2K9SA 2DDBA 2QKLB 1UZCA 2DT6A 4ZYEA 4E7LA 2IW5A 1ULYA 2E2JJ 1EH6A 2KZGA 4BBRJ 3BR1A 3D5SC 1GLNA 5J8FA 1JHHA 2P7CB 3P9KA 1GT0C 4IPAA 3QP6A 2OC6A 2GOMA 1Z6TA 3IP4B 2E5ZA 4IHWA 4L0ZB 4DBRA 1FSEA 1R1TA 2W85A 1RNLA 2R5YB 2KKOA 3OL3A 1FSHA 2L4AA 1BOBA 3K9TA 4HNVA 1TC3C 3LA3A 1XN7A 3VSKA 5JLWA 3U1KA 2HOSA 1ZG5A 1FIAA 2GM4A 3F22A 3T8RA 1RPWA 2IS4A 3AG2H 1G3YA 4RLQA 3ULQB 2P5LC 1PJRA 2YUSA 1JUSA 3ZMTA 4FT8A 2ADUA 2EIKH 5DCMA 3TOBA 3VYRB 3OYAA 2BE5F 2EFWA 3GFIA 3GFMA 2A5WA 1VQOI 1MBHA 1MZBA 1QHGA 1OCRH 2G7HA 2LNBA 3F8NA 4I76A 5J4VA 4RBOA 2R7OA 1LJ9A 3LSGA 3BTCA 2NNYA 1H89C 5D5VB 4KIFA 4A2UA 2NVUB 1FYMA 1GXQA 1WSUA 3VODA 2EFPA 4X0GA 1MSFC 5K1YA 1B59A 3RPUA 2RN7A 3LSTA 4ZYAA 3QOPA 2FSWA 1XD7A 5D5UB 2AS5F 3JTGA 2NXNB 2X48A 4CCNA 1HF0A 4W97A 1HCRA 2DT7B 1JKQC 1D5YA 3E6MA 5IY5H 3CDLA 2W84A 3SDBA 1LFPA 2K3FA 2EZLA 3DEEA 3ZXSA 2DOFA 2V9KA 2H09A 2A6EF 5HS9A 3TW6A 3ABTA 1U5TC 2KIFA 3MZHA 3WTZA 3R61A 3GLXA 2V6CA 4I7HA 2OAZA 3FXQA 1Q1HA 3KX2A 3KLOA 2G7UA 4AIDA 4FCYA 2ISZA 2OBPA 3ONQA 3OYEA 3CDIA 4Z6YA 1VQMI 1W0TA 4RAYA 4YEJA 4M72A 4ZYHA 3I9V2 2HTJA 5IOYA 4CYCB 1VNDA 3SQNA 2CH0A 1P4AA 5J6XA 3EUAA 2L7ZA 4ENJA 2JT1A 1TBXA 1ETQA 1TNSA 2NVXJ 5J1UA 3DKYA 4I98B 2DA6A 3ZOBA 4DOZA 2P4WA 5CPRB 5HS7A 2ESNA 3KP6A 1YW9A 3RDIA 3GTPJ 2LFBA 2DFFA 1BA5A 1Z7UA 4PJLA 1W5TA 3HZJA 2L02A 1ETKA 4CYCA 2CV1A 3CLQA 1IV8A 4UUVA 3S93A 1W1WE 3L2CA 3F23A 3ZGKA 2G0EA 2JRTA 1MJAA 1EKEA 2DFEA 3DU5A 2B0LA 1B8IB 5B1BH 2VBXA 4RA2A 2YU9J 1DP7P 3GLLA 2MA3A 5FLVA 1G8XA 1B9MA 2HQAA 1ETXA 1ZRFA 1VQLI 2ZO4A 3TP0A 5BOXA 1AHDP 1STZA 5IOZA 2OCEA 1P7IA 4I2OA 4CICA 4HLYA 1XB4A 2Y0SA 4UVBA 3HUGA 2CSOA 3DTIA 2BEOA 3FBNB 4FX4A 2VKEA 3WGIA 4BXFA 1W5SA 3M8FA 3NAUA 3GCMA 1O7LA 4LB6B 5FROA 2DXIA 2YU3A 3RKWA 2RAEA 2PFBA 2K5CA 3HRUA 1IJWC 5D5WB 2WADA 3C2GA 3MMYB 1USTA 4NDLA 3OS0A 1SVMA 1MBJA 4YFKF 1E3OC 1QZEA 1R58A 5DM7F 2M0CA 2R7UA 3H3VK 1TWFJ 4A0YA 2RC4A 4AUXA 5DYMA 1K83J 1WJDA 1ZR4A 2V1DA 1ZGAA 5GP9A 4CCMA 4MFEA 2HGCA 1FOYA 3P9IA 2MD0A 1VFCA 3IV5A 4YIFA 1KYZA 3RKXA 3PNTA 2Z2SB 1XMXA 3VYSB 4PJNA 2QKMB 3WG9A 4B09A 2BXZA 2M34A 1O7FA 5CVJA 3C1DA 4XLFA 2E1MC 4O6JA 3CMMA 2ZXIA 2FMYA 5H20A 5ILSA 4NC7A 4XRSA 1Y6IA 4PJJA 2ECBA 1R4NB 3RJPA 1FOKA 4XK4A 3IWFA 3KZYA 4Q48A 1VQPI 3G3ZA 3GWZA 3MKWB 2RQPA 4XLCA 1IXSB 1D1AA 5FFZA 3LFKA 2K9MA 1WJAA 1MMNA 4XKWA 5ILUA 1R36A 3ROUA 4P1WA 4E70A 2XB5A 1XX5A 5F04A 2VBZA 4NHJA 3L9FA 4MEYF 3KZIC 4EJOA 1X1CA 1TWAJ 2HI3A 2E1NA 5J4YA 3TO6A 1SC7A 3FHNA 1RIOH 3TDUC 2H8WA 5E8GA 4UVAA 2DT5A 1BC7C 5IYCJ 3GMEA 2QBYB 1FIPA 2UXNA 3P7NA 4LGWA 1LEBA 4AIKA 4ASNA 1HDPA 1KYWA 2HU9A 4XLPF 4IQJA 3ISPA 5LFAA 3FISA 5K5QA 3MWMA 5IP9J 3IRQA 1SAXA 3O3KA 1JKPC 3A4CA 1KQ9A 4MGRA 2I8DA 1Z6RA 1MGTA 2HS5A 4M3EA 5GADJ 4XQFA 1Y0NA 1DGWY 1T2KA 3H35A 1FWZA 3RCOA 2PMZN 3PQKA 2EILH 2ICWG 2XPVA 4LLNA 2ZC2A 4A3LJ 5DTDA 3DBHB 4OIRF 2EH3A 1F1ZA 4BEHB 1G3TA 1TNTA 1IG7A 4E7HA 2P81A 1YE9A 3E3VA 3CTAA 3EETA 1OCCH 4BU2A 5C4XJ 2GXAA 1UHMA 1N75A 2R7QA 4BNCA 1XGMA 2ZFWA 3S17J 2ZBKA 3A0BC 3I59B 1XCBA 4V19K 3HKZN 2DFHA 2WA0A 5EZHA 5E3NA 2VKDA 2XGEA 1NHAA 1QHHD 2ZB9A 2O5RA 1IN4A 1R5ID 2R7RA 3ERED 4CDGA 2LBFA 1O3QA 2R7WA 4N4OB 5D5XB 1ZN2A 3EYYA 4B8XA 4P9FA 1WJFA 3AFHA 3IH3A 1EF4A 3G1OA 2ZJRF 2KJBA 2M87A 2X0LA 2X6YA 4OOIA 4B47A 2QSHX 3I3LA 1SMTA 3AG4H 4LIUA 3EDPA 3JAMZ 2COMA 1ZLJA 4NNJA 2EA2A 2PN6A 2H94A 2LLKA 3HUGB 5C3EJ 1QO0D 3MN2A 2QCOA 3SEQA 4RGRA 1L3LA 1JT6A 3MKYB 3HGYA 3TDZC 2Y30A 3DPTA 4RB1A 3CCUI 3DTKA 3OSFA 2VQLA 4JYKA 2ECCA 1S6LA 1Z3YA 2FNAA 3TW7A 4IZZA 1SFXA 3F8CA 3BR3A 1V3FA 4IXAA 5JR3A 2X85A 1ODDA 4EM0B 5IP6A 2CMPA 2CO5A 3KP4A 4EM1A 1WGXA 1BC8C 3WU1B 1FZPB 1IUYA 5E1WA 1T8IA 1SAUA 4MFDA 4ZYDA 5LGTA 4IRIA 3L7WA 2KJCA 1MIJA 2M0MA 2Y0SN 1KU7A 1A6QA 1OR7A 3DLAA 3HRSA 2CW7A 4GDFA 3OOUA 3DF8A 2F5CA 2P6SA 2QENA 4IRHA 2D5VA 3K0LA 4KN7X 5DV5A 1FNNA 1ERDA 2ELKA 3M8JA 2PJPA 4HLXA 1MNEA 2HYFA 2TRTA 3HM5A 4J01A 1POGA 4D7MA 3A01A 3FXLA 5D4SA 3WTSC 3FKJA 2XB0X 1PYVA 1DU0A 1X1AA 4PZJA 2JVGA 5GPCA 5EYRA 1PP8F 3X2QH 4G7ZF 4NB5A 3MKZA 3H92A 4PGHA 4MTEA 4BEHA 1XDUA 3NEUA 2CQ7A 1MMSA 3BCBA 4HEA2 3NRVA 1NTCA 2A05A 3GFJA 3FHZA 4PJMA 4CO8A 2YSRA 2DMUA 2KT0A 1N77A 5E1XA 3EPZA 5KVRA 2O7OA 4C3JJ 2Q2EA 4Q47A 3ZMSA 3O2PE 1IZ1A 2XGXA 1V4RA 2XAJA 2MBFA 3K4JA 4HYEA 3TO9A 3FK7A 2ZNZA 5IT3A 3S15J 4HDUA 1UMQA 4G12A 1OISA 2R7DA 4HX8A 1DDNA 2MYSA 3KE2A 3M8EA 4EQQA 1XS9A 2J5PA 4WX9A 1H9GA 5F0FA 3S1NJ 3H3UA 4ENMA 2EZIA 3NWSA 3D0SA 2DMTA 2W4SA 3RPUD 2M7BA 5BS6A 1JJ8C 2IAIA 3O6BB 1FYLA 1BM9A 1XSVA 1SFUA 2VL8A 3OYIA 3K1MA 3WU2C 4KICA 4D5CA 3V8KA 1R6RA 1HW2A 2W00A 1VQ8I 2JUCA 3OYLA 1Z7LA 4QPQA 3AAFA 4ESFA 1BIBA 2IGOA 1WPKA 3CP8A 2XAFA 1NG7A 5K7ZA 2EZKA 1J2XA 1SFOJ 3ZMUA 1KU2A 4BAYA 1S7AA 2V9VA 3BJAA 4EEFG 3VEPA 2X6OA 2P8TA 3QODA 3PSIA 1IRXA 1B1BA 3CF2A 2JSPA 2VASA 4WXDA 1ORKA 3V4GA 2M7AA 4C2MJ 1U0JA 4XRMA 3OYDA 2LRDA 4OIQF 4RLFA 2YPRA 4A3DJ 2XUBA 1BBYA 2Q1ZB 3KP3A 4KFCA 5M5XJ 5BNGA 1SEUA 1Z0XA 4A69C 3PO3J 4LG0A 3ECOA 4UXNA 5HLGA 3J7AO 5D6EA 3DBLB 2ZFUA 2XAQA 1BR4A 3HRTA 4YG2F 1IRZA 3PQJA 4MTDA 3H5AA 2LP0A 2F5VA 2K4JA 3Q0VA 3SXYA 2Z9OA 4K2EA 1P92A 1IXRC 3K2ZA 3LMMA 5ICEA 2CFOA 4IX7A 1U6GA 2HXIA 2DLLA 3I54A 2CU7A 2PMZA 2BW3A 4HOBA 5KCMA 4BDZA 1W0UA 4YFNF 3VB2A 1JUMA 1JGGA 3OIOA 1NK2P 1JTXA 1YIJI 4B1RA 4KJZA 5D8LB 2FMLA 1GVDA 2P5KA 4Y15A 1L0OC 1R49A 2E34A 3QU3A 4U88A 1X1PA 4M74A 1D1BA 1Z91A 2VC1A 3IL2A 4EJTA 1ZR2A 4ZH4F 3ASNH 1R4MB 1N78A 3JCUC 2QQ9A 4WF2A 3CCVI 1A5JA 2KQRA 5HLIA 1VQ6I 2PMUA 2ZXJA 5JVTA 4KISA 1ZRDA 3I4NJ 5GAHJ 1FJLA 3CMYA 5GTIC 2ID3A 4M9SA 1GVJA 5EG0B 2V7FA 1YW7A 4YFXF 2XROA 3MQ0A 1FOWA 2WV1A 1YHQI 4RB2C 3LSKA 3TKYA 3CD6I 3ZCOA 3SZTA 1TP4A 2GIVA 4A5MA 1QVUA 2CQKA 4HX4A 4HV5A 4HQMA 2O8XA 2O6GE 4CA0A 3GO5A 2OZUA 2KISA 3ESWB 3PNVA 4A0XA 3J7ZI 5BPIA 1HDDC 1AOYA 4I0AA 3HTSB 3KETA 2Y75A 4U0YA 2LKXA 1V54H 4BXUA 2HDDA 1K4TA 5CVRA 1D5VA 1I6XA 2OZ6A
chains in the Genus database with same CATH topology
2CQQA 4V2GA 3JRIA 1Z77A 2NVQJ 5IOYA 4CYCB 2W48A 1VNDA 3A01B 4B4CA 2GLOA 2R7ZJ 2L7ZA 1RR7A 5IP7J 2DA5A 4A93J 1ETQA 2NVXJ 5J1UA 5EDNA 2HYJA 2DA6A 2L7FP 3SJMA 2K40A 4MLOA 3ZOBA 5F27A 5M5YJ 5M3MJ 2GBYA 3GTPJ 2LFBA 2JA8J 3UKGA 1BA5A 1B72B 4CYCA 1ETKA 3D1NI 5FKLA 5F1JA 4DYQA 3W6VA 1RKWA 3GBGA 2G0EA 4M3GA 5EEAA 5E3LA 4DZPA 2R92J 1B8IB 2YU9J 9ANTA 3WHCA 5FLVA 1S7EA 5K7FA 1ETXA 3TP0A 3PM1A 1AHDP 5IOZA 3BG5A 1P7IA 1B8IA 1TWGJ 1DU6A 1GV5A 2VKEA 2WB1N 2R5ZA 3GTKJ 5DS9A 3HOUJ 3NAUA 1NK3P 3LSJA 1MSEC 1P7JA 2MW8A 2YS9A 2RAEA 4FTHA 4A3BJ 2HXOA 3FKIJ 3VPRA 5F0HA 1ETVA 1IJWC 3LSPA 5J3LA 4AC0A 2X9DA 4UUSB 3O8HA 4XRSG 2HQ5A 5FKOA 4NDLA 2JA6J 1AU7A 3GTMJ 2QF7A 1MBJA 1E3OC 2H1KA 3BTIA 2M0CA 5FJ8J 1JJ6C 3H3VK 1TWFJ 2IEKA 4AUXA 1K83J 1ZR4A 2M8GX 1TWCJ 5GP9A 2NVYJ 4X1EA 4Y52J 3HGGA 3QQAA 4MFEA 2NS8A 4BKXA 1VFCA 3IV5A 5HODA 2AO9A 4A3MJ 4ABZA 2HOAA 3M4OJ 2M34A 5FKKA 2LTPA 1CQTA 3JRBA 1U9OA 1WH5A 3LSRA 2DA3A 4XRSA 1UG2A 2ECBA 2LK2A 1ZK8A 4XK4A 5F08A 3SDGA 1G2HA 2DMNA 3LOCA 1GDTA 3TP3A 2CRGA 3C2BA 5GPAA 1Y1WJ 4BXXJ 3HOZJ 2XB5A 3DCFA 4XICA 2JA7J 2R0QC 2DMPA 5F04A 2XRLA 4V2FA 1TWAJ 2HI3A 1QVTA 2JK3A 3JR9A 3HDDA 1Q1VA 1X58A 3BR6A 1RESA 1LE8B 2ME6A 3ZQFA 3JRFA 5IYCJ 3TEDA 1O4XA 1FIPA 3GTGJ 3O8GA 3BG9A 2VKVA 3I4MJ 1HDPA 1WCMJ 2AHQA 2I10A 2JN6A 3S1RJ 3FISA 1BW6A 1APLC 3RQIA 3JRDA 5IP9J 1JKRC 2E2IJ 5C4JJ 1JKPC 4C3HJ 1JT0A 2DA7A 4IHVA 3BQZA 4M3EA 3PO2J 5K7HA 2DMQA 3CCYA 1JTYA 1ETYA 2PMZN 1HOMA 1GV2A 2XPVA 4A3LJ 5DTDA 4BY1J 3QPSA 1AKHA 3CQZJ 2EH3A 1IV6A 2L7MP 3NARA 1IG7A 2COBA 2P81A 2L9RA 4DZJA 2XSDC 1PUFB 5C4XJ 3S17J 2TCTA 3JREA 5J1RA 2MG4A 3JRGA 1B72A 3GTQJ 3HKZN 2E19A 1OCTC 3BR0A 3BQYA 5EZHA 5E3NA 2XGEA 2ZB9A 5FKMA 4DW6A 3HOWJ 1U8BA 1EF4A 1FTZA 2R5YA 3IH3A 3G1OA 4A3IJ 1JUPA 1RKTA 1YRNA 2CJJA 1QPIA 2OPTA 2DN0A 2XPUA 3ZQGA 2LLKA 5C3EJ 3MN2A 3MVPA 2QCOA 5J1YA 1JT6A 3HGYA 3JRHA 2Y30A 1I50J 4A3JJ 3HOYJ 3BTJA 3QPLA 3OSFA 4JYKA 4XIDA 2ECCA 2WAQN 2K9NA 3TW7A 3OSGA 1MNMC 2L0KA 1T33A 3BR3A 3GTLJ 4UUSA 5IP6A 5JLXA 1ZQ3P 1PUFA 2JA5J 1WGXA 4FE7A 1SANA 3Q0UA 4I6ZA 1FEXA 4MFDA 1UHSA 4M6VA 2Y0SN 3GTJJ 2LY9A 2R5ZB 4C3IJ 4FISA 4IEJA 1I3QJ 1F43A 4JX6A 3OOUA 1HLVA 1I6HJ 2O9LA 2D5VA 1OCPA 2ELKA 4GFBA 4M3DA 2FD5A 2MSYA 2VPRA 3ZQLA 1MH4A 2TRTA 3HM5A 2CUEA 1POGA 2DA1A 2JJ7A 3Q0WA 4D7MA 3WHBA 3A01A 1IC8A 3G1MA 2E1OA 2HOTA 4M3BA 2XB0X 1Y1VJ 1DU0A 3S16J 4A3CJ 1U9NA 5GPCA 4BBSJ 3G1LA 5EYRA 4LOCA 4DYRA 2MGQA 1ETWA 3RZOJ 4M3FA 1ZKGA 1MBKA 2EZHA 1NTCA 2ID6A 3B6AA 2ME0A 3ZQHA 1X2NA 2DMUA 1H8AC 2VUMJ 5E3OA 2KT0A 4JP0A 3RZDJ 2FX0A 1VI0A 2O7OA 4C3JJ 2LR8A 1FTTA 2B63J 3S1MJ 3E7LA 3FK7A 4B3AA 3S15J 2DA2A 1UMQA 2N8GA 4G12A 3S1QJ 3SFIA 1X2MA 4A3KJ 1XS9A 5M3FJ 4QSHA 1LFUP 1RETA 1BL0A 4A3GJ 2NS7A 5EG0A 5F0FA 2CUFA 3S1NJ 3S2HJ 2EZIA 1JJ8C 2DMTA 4JX4A 2IAIA 3A03A 2DTZA 2NOGA 1LFBA 4A3EJ 2OF7A 4D5CA 2IBDA 2M9HA 4BY7J 5FLMJ 3IH4A 1JKOC 2JWTA 2XPWA 5EZGA 4MO7A 4J19A 1AKHB 2Y9YA 1WPKA 2LVSA 3HBLA 5K7ZA 2EZKA 3FIWA 1SFOJ 2XGDA 2FQ4A 2Y2ZA 1ZTRA 4EEFG 1K61A 3RKQA 1OFCX 2H8RA 3H0GJ 4W1UA 2X6OA 3DEWA 5FKNA 3S2DJ 1IGNA 2FJ1A 3GTOJ 4MIMA 5C44J 1OJLA 5IYDJ 4X6AJ 2K9QA 1ORKA 2EQRA 1WI3A 4C2MJ 1IDZA 1YRNB 3K2AA 2M2EA 2DJNA 4Y7NJ 2R93J 5EGOB 4XRMA 3HOVJ 5EF6A 2EBIA 4D5FA 1BW5A 3K7AJ 3BT9A 3MKLA 5IPAA 2K9SA 1GUUA 4L5EA 4IHYA 3Q3SA 3FK6A 2O8KA 4QIWN 4A3DJ 4IHXA 1R9TJ 4A3FJ 1MBGA 1LE8A 5M5XJ 2E2JJ 1BJZA 5BNGA 1Z0XA 4A69C 3PO3J 4BBRJ 3BR1A 2JMWA 1VF9A 1XG1A 3JRCA 1IRZA 3A02A 4QTRA 3M3YJ 2LP0A 3ZQCA 1GT0C 3BTLA 5F0CA 4DYCA 3Q0VA 4IHWA 1MBEA 3HEFA 1A6IA 2KDZA 1ITYA 1MBFA 2R5YB 1QRYA 2E2HJ 1TWHJ 2LD5A 5E3MA 2HXIA 4HNVA 1IDYA 1TC3C 1IUFA 2CU7A 3L1PA 1W0UA 2Y9ZA 5JLWA 1F36A 2DA4A 1JUMA 1JGGA 2HOSA 1FIAA 3OIOA 4FE4A 1NK2P 1JTXA 2GM4A 4B1RA 1RPWA 1ETOA 4UUTA 1GVDA 2NVTJ 4S0HB 4RDUA 2XGCA 2YUSA 1JUSA 1ZGWA 1ZR2A 2VI6A 1MBHA 4RBOA 4I76A 3JRAA 3BR2A 1A5JA 3LSGA 3BTCA 1H89C 3I4NJ 1MSFC 1FJLA 2Y31A 3CMYA 1U78A 2ID3A 5EG0B 4D7NA 3BG3A 2X48A 1HF0A 5EGOA 1MH3A 4W97A 1HCRA 1JKQC 2WV1A 3LNQA 5M5WJ 1D5YA 3CDLA 3B6CA 5IYBJ 4AYBN 2CQXA 3S14J 2EZLA 3HB9A 1T56A 1XC5A 3ZQIA 3HOXJ 1QVUA 3IH2A 3BR5A 3F0CA 3TW6A 1HDDC 1ENHA 1H88C 2LKXA 4JX5A 2HDDA 4FCYA 1W0TA 1WH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQQ A;  4V2G A;  3JRI A;  1Z77 A;  2NVQ J;  5IOY A;  4CYC B;  2W48 A;  1VND A;  3A01 B;  4B4C A;  2GLO A;  2R7Z J;  2L7Z A;  1RR7 A;  5IP7 J;  2DA5 A;  4A93 J;  1ETQ A;  2NVX J;  5J1U A;  5EDN A;  2HYJ A;  2DA6 A;  2L7F P;  3SJM A;  2K40 A;  4MLO A;  3ZOB A;  5F27 A;  5M5Y J;  5M3M J;  2GBY A;  3GTP J;  2LFB A;  2JA8 J;  3UKG A;  1BA5 A;  1B72 B;  4CYC A;  1ETK A;  3D1N I;  5FKL A;  5F1J A;  4DYQ A;  3W6V A;  1RKW A;  3GBG A;  2G0E A;  4M3G A;  5EEA A;  5E3L A;  4DZP A;  2R92 J;  1B8I B;  2YU9 J;  9ANT A;  3WHC A;  5FLV A;  1S7E A;  5K7F A;  1ETX A;  3TP0 A;  3PM1 A;  1AHD P;  5IOZ A;  3BG5 A;  1P7I A;  1B8I A;  1TWG J;  1DU6 A;  1GV5 A;  2VKE A;  2WB1 N;  2R5Z A;  3GTK J;  5DS9 A;  3HOU J;  3NAU A;  1NK3 P;  3LSJ A;  1MSE C;  1P7J A;  2MW8 A;  2YS9 A;  2RAE A;  4FTH A;  4A3B J;  2HXO A;  3FKI J;  3VPR A;  5F0H A;  1ETV A;  1IJW C;  3LSP A;  5J3L A;  4AC0 A;  2X9D A;  4UUS B;  3O8H A;  4XRS G;  2HQ5 A;  5FKO A;  4NDL A;  2JA6 J;  1AU7 A;  3GTM J;  2QF7 A;  1MBJ A;  1E3O C;  2H1K A;  3BTI A;  2M0C A;  5FJ8 J;  1JJ6 C;  3H3V K;  1TWF J;  2IEK A;  4AUX A;  1K83 J;  1ZR4 A;  2M8G X;  1TWC J;  5GP9 A;  2NVY J;  4X1E A;  4Y52 J;  3HGG A;  3QQA A;  4MFE A;  2NS8 A;  4BKX A;  1VFC A;  3IV5 A;  5HOD A;  2AO9 A;  4A3M J;  4ABZ A;  2HOA A;  3M4O J;  2M34 A;  5FKK A;  2LTP A;  1CQT A;  3JRB A;  1U9O A;  1WH5 A;  3LSR A;  2DA3 A;  4XRS A;  1UG2 A;  2ECB A;  2LK2 A;  1ZK8 A;  4XK4 A;  5F08 A;  3SDG A;  1G2H A;  2DMN A;  3LOC A;  1GDT A;  3TP3 A;  2CRG A;  3C2B A;  5GPA A;  1Y1W J;  4BXX J;  3HOZ J;  2XB5 A;  3DCF A;  4XIC A;  2JA7 J;  2R0Q C;  2DMP A;  5F04 A;  2XRL A;  4V2F A;  1TWA J;  2HI3 A;  1QVT A;  2JK3 A;  3JR9 A;  3HDD A;  1Q1V A;  1X58 A;  3BR6 A;  1RES A;  1LE8 B;  2ME6 A;  3ZQF A;  3JRF A;  5IYC J;  3TED A;  1O4X A;  1FIP A;  3GTG J;  3O8G A;  3BG9 A;  2VKV A;  3I4M J;  1HDP A;  1WCM J;  2AHQ A;  2I10 A;  2JN6 A;  3S1R J;  3FIS A;  1BW6 A;  1APL C;  3RQI A;  3JRD A;  5IP9 J;  1JKR C;  2E2I J;  5C4J J;  1JKP C;  4C3H J;  1JT0 A;  2DA7 A;  4IHV A;  3BQZ A;  4M3E A;  3PO2 J;  5K7H A;  2DMQ A;  3CCY A;  1JTY A;  1ETY A;  2PMZ N;  1HOM A;  1GV2 A;  2XPV A;  4A3L J;  5DTD A;  4BY1 J;  3QPS A;  1AKH A;  3CQZ J;  2EH3 A;  1IV6 A;  2L7M P;  3NAR A;  1IG7 A;  2COB A;  2P81 A;  2L9R A;  4DZJ A;  2XSD C;  1PUF B;  5C4X J;  3S17 J;  2TCT A;  3JRE A;  5J1R A;  2MG4 A;  3JRG A;  1B72 A;  3GTQ J;  3HKZ N;  2E19 A;  1OCT C;  3BR0 A;  3BQY A;  5EZH A;  5E3N A;  2XGE A;  2ZB9 A;  5FKM A;  4DW6 A;  3HOW J;  1U8B A;  1EF4 A;  1FTZ A;  2R5Y A;  3IH3 A;  3G1O A;  4A3I J;  1JUP A;  1RKT A;  1YRN A;  2CJJ A;  1QPI A;  2OPT A;  2DN0 A;  2XPU A;  3ZQG A;  2LLK A;  5C3E J;  3MN2 A;  3MVP A;  2QCO A;  5J1Y A;  1JT6 A;  3HGY A;  3JRH A;  2Y30 A;  1I50 J;  4A3J J;  3HOY J;  3BTJ A;  3QPL A;  3OSF A;  4JYK A;  4XID A;  2ECC A;  2WAQ N;  2K9N A;  3TW7 A;  3OSG A;  1MNM C;  2L0K A;  1T33 A;  3BR3 A;  3GTL J;  4UUS A;  5IP6 A;  5JLX A;  1ZQ3 P;  1PUF A;  2JA5 J;  1WGX A;  4FE7 A;  1SAN A;  3Q0U A;  4I6Z A;  1FEX A;  4MFD A;  1UHS A;  4M6V A;  2Y0S N;  3GTJ J;  2LY9 A;  2R5Z B;  4C3I J;  4FIS A;  4IEJ A;  1I3Q J;  1F43 A;  4JX6 A;  3OOU A;  1HLV A;  1I6H J;  2O9L A;  2D5V A;  1OCP A;  2ELK A;  4GFB A;  4M3D A;  2FD5 A;  2MSY A;  2VPR A;  3ZQL A;  1MH4 A;  2TRT A;  3HM5 A;  2CUE A;  1POG A;  2DA1 A;  2JJ7 A;  3Q0W A;  4D7M A;  3WHB A;  3A01 A;  1IC8 A;  3G1M A;  2E1O A;  2HOT A;  4M3B A;  2XB0 X;  1Y1V J;  1DU0 A;  3S16 J;  4A3C J;  1U9N A;  5GPC A;  4BBS J;  3G1L A;  5EYR A;  4LOC A;  4DYR A;  2MGQ A;  1ETW A;  3RZO J;  4M3F A;  1ZKG A;  1MBK A;  2EZH A;  1NTC A;  2ID6 A;  3B6A A;  2ME0 A;  3ZQH A;  1X2N A;  2DMU A;  1H8A C;  2VUM J;  5E3O A;  2KT0 A;  4JP0 A;  3RZD J;  2FX0 A;  1VI0 A;  2O7O A;  4C3J J;  2LR8 A;  1FTT A;  2B63 J;  3S1M J;  3E7L A;  3FK7 A;  4B3A A;  3S15 J;  2DA2 A;  1UMQ A;  2N8G A;  4G12 A;  3S1Q J;  3SFI A;  1X2M A;  4A3K J;  1XS9 A;  5M3F J;  4QSH A;  1LFU P;  1RET A;  1BL0 A;  4A3G J;  2NS7 A;  5EG0 A;  5F0F A;  2CUF A;  3S1N J;  3S2H J;  2EZI A;  1JJ8 C;  2DMT A;  4JX4 A;  2IAI A;  3A03 A;  2DTZ A;  2NOG A;  1LFB A;  4A3E J;  2OF7 A;  4D5C A;  2IBD A;  2M9H A;  4BY7 J;  5FLM J;  3IH4 A;  1JKO C;  2JWT A;  2XPW A;  5EZG A;  4MO7 A;  4J19 A;  1AKH B;  2Y9Y A;  1WPK A;  2LVS A;  3HBL A;  5K7Z A;  2EZK A;  3FIW A;  1SFO J;  2XGD A;  2FQ4 A;  2Y2Z A;  1ZTR A;  4EEF G;  1K61 A;  3RKQ A;  1OFC X;  2H8R A;  3H0G J;  4W1U A;  2X6O A;  3DEW A;  5FKN A;  3S2D J;  1IGN A;  2FJ1 A;  3GTO J;  4MIM A;  5C44 J;  1OJL A;  5IYD J;  4X6A J;  2K9Q A;  1ORK A;  2EQR A;  1WI3 A;  4C2M J;  1IDZ A;  1YRN B;  3K2A A;  2M2E A;  2DJN A;  4Y7N J;  2R93 J;  5EGO B;  4XRM A;  3HOV J;  5EF6 A;  2EBI A;  4D5F A;  1BW5 A;  3K7A J;  3BT9 A;  3MKL A;  5IPA A;  2K9S A;  1GUU A;  4L5E A;  4IHY A;  3Q3S A;  3FK6 A;  2O8K A;  4QIW N;  4A3D J;  4IHX A;  1R9T J;  4A3F J;  1MBG A;  1LE8 A;  5M5X J;  2E2J J;  1BJZ A;  5BNG A;  1Z0X A;  4A69 C;  3PO3 J;  4BBR J;  3BR1 A;  2JMW A;  1VF9 A;  1XG1 A;  3JRC A;  1IRZ A;  3A02 A;  4QTR A;  3M3Y J;  2LP0 A;  3ZQC A;  1GT0 C;  3BTL A;  5F0C A;  4DYC A;  3Q0V A;  4IHW A;  1MBE A;  3HEF A;  1A6I A;  2KDZ A;  1ITY A;  1MBF A;  2R5Y B;  1QRY A;  2E2H J;  1TWH J;  2LD5 A;  5E3M A;  2HXI A;  4HNV A;  1IDY A;  1TC3 C;  1IUF A;  2CU7 A;  3L1P A;  1W0U A;  2Y9Z A;  5JLW A;  1F36 A;  2DA4 A;  1JUM A;  1JGG A;  2HOS A;  1FIA A;  3OIO A;  4FE4 A;  1NK2 P;  1JTX A;  2GM4 A;  4B1R A;  1RPW A;  1ETO A;  4UUT A;  1GVD A;  2NVT J;  4S0H B;  4RDU A;  2XGC A;  2YUS A;  1JUS A;  1ZGW A;  1ZR2 A;  2VI6 A;  1MBH A;  4RBO A;  4I76 A;  3JRA A;  3BR2 A;  1A5J A;  3LSG A;  3BTC A;  1H89 C;  3I4N J;  1MSF C;  1FJL A;  2Y31 A;  3CMY A;  1U78 A;  2ID3 A;  5EG0 B;  4D7N A;  3BG3 A;  2X48 A;  1HF0 A;  5EGO A;  1MH3 A;  4W97 A;  1HCR A;  1JKQ C;  2WV1 A;  3LNQ A;  5M5W J;  1D5Y A;  3CDL A;  3B6C A;  5IYB J;  4AYB N;  2CQX A;  3S14 J;  2EZL A;  3HB9 A;  1T56 A;  1XC5 A;  3ZQI A;  3HOX J;  1QVU A;  3IH2 A;  3BR5 A;  3F0C A;  3TW6 A;  1HDD C;  1ENH A;  1H88 C;  2LKX A;  4JX5 A;  2HDD A;  4FCY A;  1W0T A;  1WH7 A; 
#chains in the Genus database with same CATH topology
 3A0H C;  3JRI A;  4Q5S F;  3FMS A;  3RQ4 A;  5FLX K;  5L3D A;  3A01 B;  1BI1 A;  2KIQ A;  1RR7 A;  5TRD A;  2MH9 A;  2K7L A;  3AG1 H;  2DA5 A;  3T0Y A;  3FXO A;  4MQV A;  3WTV C;  3CC7 I;  2FE3 A;  3K10 A;  3M7G A;  3SJM A;  1VQN I;  5F27 A;  1XDS A;  3J81 K;  1LQ1 A;  3ZN0 A;  4WCG A;  4G7H F;  2JA8 J;  3UKG A;  2IRF G;  4C9Y A;  2F6C A;  5ICC A;  3OMY A;  2EJR A;  4OMY A;  5H6R A;  4WXH A;  4DYQ A;  4RM2 A;  1RKW A;  3GBG A;  1SD5 A;  2B9S A;  3E6C C;  4EJU A;  2UV1 A;  4A0Z A;  4M3G A;  5EEA A;  5E3L A;  1K6Y A;  1K78 A;  1CGP A;  1IW7 F;  1HBX G;  6PAX A;  2HYG D;  2CWE A;  5EEG A;  2R3S A;  1S8N A;  5EEH A;  5E8I A;  2M8E A;  1K79 A;  3KP7 A;  2CQN A;  4JOM A;  1B8I A;  5AON A;  2BXY A;  1LEA A;  3KP5 A;  3E6D A;  4BAC A;  4OWR B;  2WTE A;  3BZC A;  2LC2 A;  2XC7 A;  2D1V A;  1DQU A;  1SD6 A;  2L54 A;  1FOX A;  2E7W A;  2MW8 A;  5HLT A;  2YS9 A;  3ZMZ A;  4XKC A;  3ABK H;  1Y8R B;  1IAW A;  5J40 A;  3ZPL A;  2BVM A;  1Y39 A;  3DBR B;  4F3Q A;  4IHS A;  2HQN A;  2X9D A;  4UUS B;  2CYY A;  4XRS G;  4YIR X;  2QF7 A;  4O3M A;  1XGS A;  4CCL A;  1WJE A;  3BTI A;  5FD6 A;  2VE9 A;  1JJ6 C;  1MW7 A;  2OTL I;  4IO9 F;  2IEK A;  2JSC A;  5J8C A;  1PDN C;  2X1D A;  2MLG A;  5JVG F;  2NVY J;  3LQQ A;  3KZZ A;  4X1E A;  1R7J A;  2JRM A;  1HKQ A;  1QQI A;  2W7N A;  5AIP A;  5HOD A;  1E0E A;  2W1O A;  4A3M J;  4ABZ A;  4Y4R A;  4ZZL A;  3G2B A;  2HFH A;  3S32 A;  3CES A;  4BDY A;  1R1V A;  4B48 A;  3BG7 A;  2F4I A;  3DXJ F;  1WH5 A;  2LKS A;  3LSR A;  4KIG A;  3WTW C;  5DUK A;  4U87 A;  1UG2 A;  3ELK A;  2WBM A;  2F5F A;  1FYK A;  2E1C A;  3CCR I;  4CUG A;  3SZG A;  2A68 F;  3S3N A;  2MAB A;  5DD4 A;  1GDT A;  1IRF A;  3LSH A;  3TP3 A;  3J80 Z;  4Q4Z F;  3C2B A;  2HOE A;  3HC7 A;  1PVE A;  4L0Y B;  3WGH A;  4EJW A;  3LA2 A;  2DAO A;  2JA7 J;  3FXR A;  1VTN C;  2R0Q C;  5H6Q A;  4A12 A;  2DMP A;  2ZJ2 A;  3JR9 A;  1QVT A;  2JK3 A;  1D3Y A;  5TGT A;  3GUD A;  1Q1V A;  3I55 I;  2CGP A;  1RES A;  1LE8 B;  3DPL C;  3W6K B;  4FET A;  1X4P A;  3QWL A;  2RQQ A;  4NC8 A;  5E17 F;  4NC6 A;  3D5L A;  4S05 A;  2DFI A;  2VKV A;  4HF2 A;  2AHQ A;  2K85 A;  2XF5 A;  3KIO A;  2CUJ A;  2UUZ A;  1F9N A;  5L3E A;  2HVR A;  2MC3 A;  2XAH A;  1APL C;  3N4M A;  4WK8 F;  2DCE A;  1JKR C;  1U2W A;  2Z3Y A;  1FBQ A;  2A6T A;  1J9I A;  4CYD A;  3HHH A;  4BHB A;  2OQG A;  2K3P A;  2BBY A;  2DA7 A;  3COA C;  5FO5 A;  3RKY A;  3OY9 A;  4KIB A;  2GOX B;  5CVI A;  2R7F A;  3OYM A;  3PO2 J;  5TJJ A;  1W7P B;  5K7H A;  2ZSI B;  2LF7 A;  1KQ8 A;  4LLG F;  1Z05 A;  3CO6 C;  1X3W B;  1ZG1 A;  3QPS A;  4BY1 J;  2JQ7 A;  4CSW A;  3ZRG A;  3EUH A;  1IV6 A;  1LDD A;  4G9Y A;  2ELH A;  3R0A A;  4WXC A;  2AXT C;  2BOL A;  2EIM H;  2XSD C;  1PUF B;  2TDX A;  3L2W A;  1UCR A;  2OD5 A;  2HVS A;  2DK5 A;  4ZTJ A;  3JRE A;  5J1R A;  2W82 A;  2FUG 2;  2UXX A;  3ZQQ A;  3GTQ J;  1FPQ A;  2E19 A;  2DDA A;  1SVL A;  1JGS A;  2QM3 A;  4D1Q A;  2QA4 I;  4H0E A;  2ZME C;  1T0F A;  4BYY A;  1BN5 A;  4ENK A;  3CCM I;  2VJ4 A;  4DW6 A;  1VQ9 I;  1RUO A;  1ZEL A;  3HOW J;  2NS0 A;  2H1L A;  5CLS A;  3OYC A;  5GAG J;  1JUP A;  4JBA A;  3I5U A;  2D1H A;  3OIQ A;  1YRN A;  1JE8 A;  3RYR A;  2Z5U A;  3DPU A;  3MCZ A;  2OPT A;  4XMY A;  1YO5 C;  4DJA A;  3PIP F;  2DN0 A;  2XPU A;  3ZQG A;  1J7K A;  3MVP A;  2QQA A;  4LJZ F;  4AU7 A;  2LBF B;  3JRH A;  3GX4 X;  1T39 A;  2A69 F;  3HOY J;  1MJ9 A;  3K4M A;  2QZ8 A;  4H4K C;  4P9U A;  3B02 A;  4XID A;  2JPB A;  5JFR A;  3OSG A;  2BZT A;  2JVH A;  3OS1 A;  1A31 A;  4AM3 A;  2XAS A;  4LG0 B;  3JSO A;  3H5R A;  3WTU C;  4UUS A;  3CCL I;  2M1B A;  1ZQ3 P;  1PUF A;  1G3S A;  2YR2 A;  3KYD B;  3S3M A;  4FE7 A;  1SAN A;  2HWV A;  5K5R A;  3H0D A;  4JQF A;  1O3S A;  4HNU A;  1R22 A;  1XMA A;  2FF4 A;  5GAE J;  1UHS A;  1WKM A;  4M6V A;  3N97 A;  4BQO A;  2RDP A;  3GTJ J;  4HA8 A;  4C2U A;  4Y17 A;  4C3I J;  2OJE D;  4FIS A;  4IEJ A;  4BQN A;  1LNW A;  1I3Q J;  2X1C A;  3ECH A;  4JX6 A;  4RGX A;  1DUX C;  4ZDO A;  1JXS A;  1OCP A;  2LMD A;  2W24 A;  4BE0 A;  3MAJ A;  4M3D A;  3OR2 C;  3CDH A;  2FU4 A;  3MEX A;  1MH4 A;  2HKO A;  1SD4 A;  2HQR A;  1HW1 A;  1FMV A;  2JJ7 A;  3KEO A;  5LGU A;  2A5Y B;  3WHB A;  5B66 C;  2VJ5 A;  4KDP A;  1EA3 A;  3GFL A;  3GEZ A;  3G1M A;  2E1O A;  2HOT A;  2L9V A;  5A2Q K;  1Y1V J;  1FP1 D;  4NQW B;  3S3O A;  2MGQ A;  5F6F A;  5FRM A;  5ICF A;  2KRF A;  1ETW A;  3M9A A;  3VWB A;  4F55 A;  1YIO A;  3FMQ A;  1ZKG A;  1MBK A;  2DU9 A;  2EZH A;  3IC7 A;  4HX7 A;  2VIX A;  4G6Q A;  4BH9 A;  2ME0 A;  1X2N A;  4GRI A;  4B3X A;  2W57 A;  3C18 A;  5E1Z B;  3RZD J;  4N9H A;  3OYJ A;  1K78 B;  1LB2 A;  1VI0 A;  4U7B A;  2OCC H;  4DBQ A;  2LR8 A;  2VQH A;  1LVA A;  4UHT A;  1FBS A;  4ETS A;  1P2F A;  2B63 J;  4M73 A;  5LRS A;  5L3G A;  1V5E A;  2EFO A;  4B3A A;  2M45 A;  3LSI A;  2LOO A;  2IS6 A;  1WFX A;  3PFI A;  3HSR A;  2CW8 A;  4GXO A;  3N05 A;  1TT5 B;  3GZ5 A;  3WTY C;  1RET A;  1VQ5 I;  3W2W A;  2BY3 A;  2Q2E B;  2CUF A;  2WAF A;  2L01 A;  2CUZ A;  3GXO A;  4I09 A;  2HTS A;  4UV9 A;  4BS9 A;  1QPM A;  3A03 A;  2RRE A;  2CV0 A;  4BGD A;  1EH7 A;  2L5Q A;  2VXZ A;  1LFB A;  2UWM A;  3K70 C;  2OF7 A;  3L00 A;  2IBD A;  3B73 A;  1ONV A;  5FRN A;  1S9H A;  3IH4 A;  4NQW A;  2FRH A;  3I56 I;  2JWT A;  2E5N A;  3BRO A;  1IO2 A;  4MO7 A;  3JW4 A;  3VDX A;  4CCO A;  4J19 A;  2HDW A;  2M3A A;  3BPX A;  3TBI A;  1AKH B;  3HXL A;  2IJL A;  2L4M A;  4E4H A;  4AIH A;  3QYB A;  3U21 A;  4F92 B;  3LA7 A;  2V26 A;  1ZTR A;  2V1U A;  4E7K A;  4GGG A;  3RKQ A;  5HDN A;  3L2V A;  1OFC X;  2H8R A;  2X6X A;  2X1E A;  4OMZ A;  4EM2 A;  2FJ1 A;  2E35 A;  2KFD A;  5FB2 A;  3K4C A;  4IHT A;  1JI8 A;  1EV7 A;  2K9Q A;  3PFY A;  3TL4 X;  4Y13 A;  4F52 A;  3K70 D;  5EF6 A;  3PJR A;  2EV0 A;  2A3S A;  3Q3S A;  3FK6 A;  1K4S A;  2O8K A;  4QIW N;  1R9T J;  1A35 A;  2VE8 A;  4XKB A;  3AL0 C;  1BJZ A;  4XLA A;  1HSJ A;  3IAS 2;  3W3C A;  2GA1 A;  3VOE A;  2IGK A;  1LDK B;  3A02 A;  4II3 A;  2DOE A;  2P5V A;  3M3Y J;  3E5U A;  2BY1 A;  1B9N A;  1HC8 A;  2VJJ A;  4AYB A;  4DYC A;  1DGR M;  1SMY F;  2XF7 A;  1ZAO A;  3QP5 A;  1MBE A;  3HEF A;  3LAP A;  2KDZ A;  1ITY A;  3A1Y A;  1TWH J;  2R7V A;  5E3M A;  4L9N A;  1IDY A;  5CQE A;  4OIN F;  5D8K B;  3E5X A;  3F9K A;  4KT6 A;  2OQR A;  3OR1 C;  2Y9Z A;  2CFX A;  1F36 A;  2Q0O A;  3PIO F;  4UVC A;  1OMI A;  1TW2 A;  4G7O F;  3CF5 F;  4MQ9 F;  2IA1 A;  2FEZ A;  2IS1 A;  3G71 I;  1ETO A;  3H5N A;  4UUT A;  2NVT J;  4S0H B;  2KMU A;  1AA7 A;  2STT A;  2F48 A;  1J75 A;  4MNU A;  3OV8 A;  2J5O A;  5KK1 A;  5HNH A;  2W25 A;  3FXK A;  5HNF A;  2HZD A;  3JRA A;  3BR2 A;  1CF7 B;  1HQC A;  2HEO A;  4HW0 A;  3LFU A;  2GXG A;  3DTE A;  1UG0 A;  1W7P A;  1ZH5 A;  2Y31 A;  4CZC A;  1YYV A;  1SVO A;  2K86 A;  3RI4 A;  1ZHF A;  3ASO H;  3BG3 A;  3T5X A;  1WRJ A;  3ZMD A;  5IT9 Z;  3RPQ A;  3J7Y J;  3LNQ A;  3KEQ A;  5M5W J;  4XOR A;  2VJI A;  1ZG3 A;  3S14 J;  4M6Y A;  3HB9 A;  1R23 A;  1T56 A;  1UJ8 A;  2QUF A;  3DEU A;  3ZQI A;  3HOX J;  3U2R A;  2ACJ A;  1F5T A;  3OS2 A;  3BR5 A;  4TV7 A;  3F0C A;  2WAQ A;  4M6X A;  4HAM A;  2EPF A;  3WE3 A;  3AL0 B;  3HTU A;  1ENH A;  1W36 D;  4ESB A;  3PNY A;  1R71 A;  1H88 C;  1LDJ A;  1BI2 A;  1YS7 A;  2GIZ A;  4EMS A;  4Y33 A;  4A3F J;  2WWY A;  4V2G A;  2ESH A;  1Z77 A;  1YW8 A;  1J09 A;  3BC8 A;  1Y0U A;  2R7Z J;  3E1S A;  1S7O A;  3R6S A;  2MLK A;  5IP7 J;  2L2O A;  2EV6 A;  4A93 J;  2ZME A;  4LK0 F;  2Y48 A;  1R00 A;  5CQG A;  2L7F P;  4LG3 A;  2K40 A;  3LAJ A;  4XR6 A;  5M5Y J;  2VC0 A;  4U0V A;  2GBY A;  4XRF A;  3UR3 C;  2D45 A;  2E7X A;  1S29 A;  2HVQ A;  3VSL A;  2RV8 A;  3W2V A;  1F4K A;  3DLL F;  1USS A;  1S3J A;  4Z2Y A;  4B44 A;  4UNO A;  5FKL A;  5F1J A;  2RNG A;  2PQ8 A;  3VFZ A;  3FXJ A;  5LGN A;  3FF5 A;  2HPI A;  2QVO A;  3FXU A;  3HOS A;  4R79 A;  2R92 J;  1YJN I;  5LEK A;  5JHU A;  1QBJ A;  2DPU A;  3GZ6 A;  2RKH A;  5K7F A;  3EYI A;  4LB5 A;  3WTT C;  4ZYG A;  2IT0 A;  1HKT A;  4EJV A;  1HST A;  3BG5 A;  2VT3 A;  2XF6 A;  4I01 A;  1TWG J;  2K9L A;  1DU6 A;  2B7E A;  2HNH A;  1GV5 A;  3BZK A;  2HPM A;  3K1P A;  2WB1 N;  2R5Z A;  3GTK J;  3ZQ7 A;  3HOU J;  1XSX A;  2LG4 A;  2OTJ I;  3LSJ A;  1P7J A;  3IUO A;  4DQ2 A;  3FKI J;  2M4K A;  2KIM A;  3KP2 A;  3OIP A;  2CW0 F;  1ETV A;  5F0H A;  3LSP A;  5J3L A;  2C6Y A;  2HQ5 A;  2E1M B;  2E71 A;  2JA6 J;  5FFX A;  3GTM J;  3F6V A;  4BUP A;  4PUS A;  1G59 A;  2ZME B;  1MKM A;  1IXC A;  3PUF A;  1X3U A;  5BMZ A;  1OKR A;  1HW5 A;  2KL4 A;  2M8G X;  1BI0 A;  3OYF A;  1FT9 A;  3QQA A;  2R7S A;  2Z33 A;  1LVK A;  2O3F A;  4BHP A;  4R1H A;  3L09 A;  5FKK A;  4PFP A;  1FMW A;  3I64 A;  2PMH A;  2LTP A;  1CQT A;  1BIA A;  1X1D A;  3PSF A;  5AIQ A;  3JRB A;  1U9O A;  2ZNY A;  3FBI B;  3V7S A;  2PJR B;  2CG4 A;  5BQT A;  4XN0 A;  3HJE A;  4N4N B;  1TTY A;  3FX3 A;  2A61 A;  1J59 A;  2CV2 A;  1XGO A;  1E3H A;  3V7R A;  4XN3 A;  5F08 A;  3SDG A;  3CC4 I;  4DNC A;  1OLT A;  1G2H A;  1W5C C;  4CZZ A;  2DPD A;  3QYF A;  3ABU A;  1Z67 A;  1TL8 A;  1REP C;  1D0X A;  2CRG A;  2MFZ A;  1ACI A;  2PBI A;  2F5E A;  5EJC A;  4XIC A;  3HOT A;  4I02 A;  2JPC A;  1FX7 A;  2XRL A;  5CVV A;  2H6B A;  1I3A A;  1X58 A;  2FQ3 A;  1AWC A;  3HL2 A;  1OYI A;  3J80 K;  4P55 A;  3ZQF A;  3JRF A;  3SHF A;  1EJ9 A;  3O8G A;  3I4M J;  1LPQ A;  2EFN A;  2I10 A;  4L18 B;  4LLL A;  3RQI A;  3JRD A;  2NRA C;  4I0B A;  4HNT A;  3HSE A;  4C30 A;  4D9J A;  4C3H J;  2BVL A;  4IHV A;  5GTH C;  5DM6 F;  2V9P A;  3OWT A;  3BQZ A;  3LWF A;  2DMQ A;  3CCY A;  5LHH A;  1JTY A;  1P6R A;  4FAS D;  3JSP A;  3K4B A;  3HHG A;  1E17 A;  2X51 A;  3HG9 A;  1MMA A;  1AKH A;  1PUE E;  3I4P A;  2Y69 H;  5F64 A;  3F6O A;  2ZJP F;  3J81 Z;  3L2U A;  1RI7 A;  3NAR A;  2R4G A;  3HSF A;  2COB A;  2DJI A;  3H9J A;  2L9R A;  4BJ5 C;  3REO A;  4DZJ A;  3I58 A;  4GYG A;  3F8M A;  3CCS I;  1WHU A;  4LIV A;  2MG4 A;  2Z16 A;  3JRG A;  3HRM A;  1W4M A;  2KIU A;  1YS6 A;  1OCT C;  4XNF A;  3BR0 A;  4F7Z A;  2JUG A;  2LY2 A;  1UAA A;  2BW3 B;  3VYT B;  3CME I;  5FKM A;  4DGW B;  1X4O A;  3QOE A;  1U8B A;  3IHU A;  1E3P A;  3MFK A;  4A3I J;  3NWT A;  1RKT A;  2JA2 A;  3C7J A;  3L2R A;  2CJJ A;  4B43 A;  3WGG A;  3QPH A;  3W6J B;  4CCJ A;  2DW4 A;  1XGN A;  4OIO F;  5JHF A;  5CJ9 A;  5J1Y A;  5L3B A;  1A36 A;  1XMK A;  3OYB A;  2MH2 A;  4QLC U;  3ABL H;  1I50 J;  1OCO H;  4A3J J;  3BTJ A;  1KU9 A;  3CUO A;  2DOD A;  2G9W A;  4F91 B;  2K9N A;  3Q5F A;  2L0K A;  3OYN A;  4ON0 A;  1CF7 A;  3DWL E;  1S72 I;  4XL9 A;  4CCK A;  4XM3 A;  2JZY A;  1P4X A;  1DPU A;  5B3S H;  1GHC A;  4E7Z A;  5CYV A;  4IOA F;  2V1N A;  4E7I A;  3PUB A;  3FM3 A;  2PI0 A;  5ICG A;  1P4W A;  3Q9S A;  4XSX F;  1MDM A;  1F43 A;  1HLV A;  4ZDL A;  4E7J A;  3QPT A;  4HSR A;  1I6H J;  2LDU A;  1FC3 A;  2O9L A;  2PJR A;  1OYY A;  1I1S A;  4GFB A;  4UB8 C;  3DKX A;  2MSY A;  3ZQL A;  5HDG A;  2QQB A;  2IXS A;  2NAZ A;  3Q0W A;  2CUE A;  2LF8 A;  1D0Y A;  2VT2 A;  3DFG A;  4HQE A;  1KA8 A;  1U8R A;  4A5N A;  4XLH A;  3M1E A;  5IT9 K;  3G1L A;  1O3T A;  1YLF A;  4EVI A;  4PJ0 C;  5LBQ A;  1SD7 A;  1PP7 U;  1U5T A;  1MND A;  2HR3 A;  1VQ4 I;  3RZO J;  3DU6 A;  4M3F A;  4YRV A;  3B6A A;  2R7X A;  4ZDP A;  3ZQH A;  1ZGJ A;  1H8A C;  4E7S A;  4IF4 A;  2VUM J;  4IVN A;  2LSO A;  4JP0 A;  2XDV A;  4ANJ A;  3K4L A;  5HS8 A;  3CJN A;  3IAM 2;  4ZC3 A;  2AQF A;  3HPG A;  3T8T A;  2RNJ A;  4M71 A;  3E7L A;  2IGN A;  4AD9 A;  3GW2 A;  3SEZ A;  2DA2 A;  2N8G A;  3FWE A;  4MEX F;  5B1A H;  1YIT I;  3SFI A;  3S1Q J;  2VPL A;  1QNT A;  1X2M A;  2XKO A;  1XPX A;  2H27 A;  4A3K J;  2H6C A;  5DCF A;  5M3F J;  4QSH A;  1BL0 A;  4A3G J;  2A07 F;  2NS7 A;  5DUI A;  5EG0 A;  3S2H J;  3QYE A;  2KHM A;  3CJQ B;  2DYS H;  3BP8 A;  2DTZ A;  2VOD A;  2NOG A;  5FLX Z;  3F72 A;  4A3E J;  2DBB A;  5ILV A;  3H36 A;  4BY7 J;  4G94 A;  2VN2 A;  5FLM J;  3T1B A;  3OYG A;  1U5T B;  2XPW A;  3EUK L;  2YX7 A;  5EZG A;  1T98 A;  3TGN A;  1BI3 A;  4RS8 A;  5KAI C;  1J0R A;  2DK8 A;  3HBL A;  1M1E B;  3FIW A;  2VKH A;  2OUM A;  2XGD A;  4JK1 X;  2FQ4 A;  2LY1 A;  2PG4 A;  3U1D A;  3E6B A;  1K61 A;  2P0W A;  2X4H A;  3F8B A;  1H9T A;  2K27 A;  3H0G J;  1SFE A;  2FA5 A;  4W1U A;  3DEW A;  5FKN A;  3V8L A;  5LLQ A;  1XTA A;  2VQC A;  1IGN A;  3GTO J;  2WY7 Q;  2Z99 A;  3SFZ A;  5FD5 A;  3H1C A;  5IYD J;  2L3D A;  1WI3 A;  4EV0 A;  1IDZ A;  1X3Z B;  2M2E A;  2WAE A;  1Y8Q B;  2R93 J;  2BGC A;  2DOA A;  1QGP A;  3K7A J;  5IPA A;  4KA4 A;  1GUU A;  4L5E A;  3PL8 A;  4IHX A;  3TO7 A;  1RZ4 A;  4ZJZ A;  1R5H A;  4XSZ F;  1MBG A;  3TOA A;  4KT5 C;  1LE8 A;  1I1G A;  4QWQ A;  1D1C A;  4HF0 A;  1WZ2 A;  2NNN A;  4L5I A;  1X19 A;  2JMW A;  2L9N A;  1VF9 A;  4ESJ A;  4RGS A;  1XG1 A;  2FXA A;  3JRC A;  4QTR A;  2QSF X;  3R0J A;  3ZQC A;  2RGV A;  1T95 A;  3BTL A;  2BHY A;  5F0C A;  1ZRE A;  3TMO A;  3R4K A;  4IOC F;  3BY6 A;  2EWN A;  1J5Y A;  3DP7 A;  3DQV C;  1A6I A;  1NH3 A;  2KDO A;  4BE2 A;  1WVR A;  1W36 C;  4RGU A;  3BJO A;  2GXB A;  1FLI A;  1MBF A;  1Y56 A;  1QRY A;  2E2H J;  1KU3 A;  3WOD F;  2LD5 A;  3FXM A;  4QPO A;  4AWX B;  2ELJ A;  2X6W A;  3BCA A;  2EA4 A;  1IUF A;  1W7P D;  2QLZ A;  3L1P A;  2DA4 A;  4XOT A;  4KIT B;  4L9J A;  3V8J A;  3ABM H;  4FE4 A;  5ERI A;  2DQR A;  4N9I A;  3F21 A;  1RUN A;  3LL7 A;  3H9Q A;  4RDU A;  1Z9C A;  2XGC A;  4HDV A;  4NBQ A;  5ED4 A;  4HRI A;  2NYX A;  4O5V A;  1ZGW A;  3IRR A;  2VI6 A;  4E6K G;  4XLE A;  4CHU A;  3CCQ I;  2KLO A;  2ISY A;  3HKZ A;  2WV0 A;  2QGU A;  2YX4 A;  3CMA I;  2DYR H;  1SFK A;  4L5J A;  3F8F A;  4LD5 A;  4PSW A;  2V1X A;  3L2Q A;  3CC2 I;  3V42 A;  1OR7 C;  2BYV E;  1U78 A;  2WC2 A;  3GYH X;  5JI6 A;  1YJW I;  4KNY A;  1XCV A;  4D7N A;  1FP2 A;  3C3W A;  2P6T A;  1XSD A;  1K7A A;  5EGO A;  1MH3 A;  2FBH A;  4EAT A;  5E20 A;  2LH9 A;  2BY0 A;  3B6C A;  3KLN A;  5IYB J;  4AYB N;  2CQX A;  4IL6 C;  2KZV A;  2XVC A;  1XC5 A;  4BJ6 C;  3QRF F;  1BR2 A;  3M07 A;  3IH2 A;  2LYC A;  2KRH A;  3A2K A;  2PEX A;  4EGZ A;  3ZMV A;  4PGG A;  2IA0 A;  5KHD A;  3EUH C;  2EIN H;  4ZZD A;  2ZSH B;  4IRG A;  2WB1 A;  3S8P A;  3ZP5 A;  1I5Z A;  1ON2 A;  4JX5 A;  4RM3 A;  3G73 A;  1TQM A;  2BY2 A;  2F2E A;  2HZT A;  4FHT A;  2GWR A;  3CP2 A;  1WH7 A;  2CQQ A;  3I53 A;  2FOK A;  2NVQ J;  4XKV A;  2L7K A;  1TLH B;  2LKP A;  2W48 A;  4B4C A;  2GLO A;  1E2X A;  1TQI A;  1TT0 A;  1OYW A;  5HOO A;  2KPM A;  1V5F A;  5LD2 C;  3HPH A;  4BQA A;  5EDN A;  2HYJ A;  4A6E A;  2XKP A;  1G4D A;  2VON A;  4MLO A;  4XOP A;  1GXP A;  2HDC A;  3G4S I;  5M3M J;  2EIJ H;  4KN4 X;  2IA2 A;  1KQ0 A;  2XHK A;  4FX0 A;  4U7D A;  5E18 F;  4P5O A;  1B72 B;  1IN7 A;  3I59 A;  4U0W A;  4MHG A;  3D1N I;  1YOV B;  2IGM A;  3W6V A;  5E79 C;  3W2A A;  1RC9 A;  2XRN A;  3HYI A;  3K1N A;  3CCE I;  4DZP A;  5B5E C;  9ANT A;  1X1B A;  4ITV A;  4ZTF A;  3WHC A;  1S7E A;  3OOP A;  4AVP A;  1VZ0 A;  1OQY A;  2PX9 A;  3UNG C;  3PM1 A;  4GYI A;  3J7A Y;  5DDG A;  3RYP A;  1U3E M;  2CS3 A;  3KYL A;  4HG2 A;  1DP3 A;  5L3F A;  2XSJ C;  3H9G A;  3G6E I;  5DS9 A;  5CVU A;  1IN8 A;  2DTR A;  3GZN B;  1NK3 P;  4OIP F;  4N0B A;  1MSE C;  1Z21 A;  4OU0 A;  3OYK A;  1YI2 I;  1KON A;  2VXD A;  2NOJ B;  4FTH A;  4A3B J;  2HXO A;  5LHG A;  3D5R C;  3VPR A;  1ZLK A;  2EK5 A;  4OAZ A;  3FMR A;  4CXF A;  4AC0 A;  2QYO A;  5HDK A;  3O8H A;  1HXD A;  5FKO A;  5J47 A;  1AU7 A;  2FOW A;  4S04 A;  4AVZ A;  2H1K A;  3MD2 A;  1WWX A;  4BHC A;  5FJ8 J;  3QAH A;  5F1R A;  1Z1D A;  4PCQ A;  4LFU A;  2AXL A;  1TWC J;  1WJB A;  2EV5 A;  5DCM B;  4UY8 I;  4GCV A;  3JAM K;  1IF1 A;  4Y52 J;  3HGG A;  4BKX A;  3TQN A;  2NS8 A;  2RVC A;  4XLN F;  4WWC A;  2AO9 A;  2MC4 A;  3ERM A;  3AG3 H;  3CUQ B;  5FGM A;  3MZ8 A;  3BWG A;  2HOA A;  5A2Q Z;  3M4O J;  3U9G A;  1LUJ B;  2WY8 Q;  2GAU A;  2VQG A;  4EGY A;  1YX3 A;  1O3R A;  4HF1 A;  2DA3 A;  1V5G A;  1A04 A;  2LK2 A;  4LK1 F;  2DQL A;  1MD0 A;  1ZK8 A;  3CJR B;  1T6S A;  1DPR A;  2R7T A;  1QA6 A;  2IP2 A;  2DMN A;  3LOC A;  1MMG A;  3IWZ A;  3RIR A;  4G8X A;  5GPA A;  1Y1W J;  1YFH A;  2ZKZ A;  4BXX J;  2M5W A;  3BLY A;  2ZJQ F;  3HOZ J;  2BV6 A;  3DCF A;  3WTX C;  3GF2 A;  1ON1 A;  2JTV A;  3I0T A;  1QU3 A;  2VOO A;  1YG2 A;  3KEY A;  4LIT A;  4V2F A;  5D4R A;  3HDD A;  5HVQ C;  1R5G A;  2F4O B;  3BR6 A;  1I39 A;  1TZL A;  3OYH A;  2PLY A;  2ME6 A;  1D8J A;  5BPD A;  5L3C A;  3TED A;  1O4X A;  3H3Z A;  1C0W A;  2LRE A;  1RR8 C;  3GTG J;  2OU2 A;  1WI9 A;  4KMU X;  3LQR A;  3BG9 A;  3SYT A;  2XAU A;  1P9Q C;  4HZF A;  1WCM J;  1G6N A;  2GZW A;  2VOP A;  3KCC A;  2JN6 A;  1N25 A;  2IPQ X;  3S1R J;  2O03 A;  1BW6 A;  3WE2 A;  3P5J A;  2M30 A;  2E60 A;  4L9T A;  2E2I J;  5C4J J;  1FBU A;  4HV6 A;  3P9C A;  2KP6 A;  1JT0 A;  1WJC A;  4M9Z A;  2Y0M A;  3FM5 A;  3WG7 H;  1ETY A;  4KUM A;  1TQP A;  3GVA A;  4G6D A;  1HOM A;  1GV2 A;  3CLO A;  2QWW A;  1BJA A;  1MMD A;  1HKS A;  3CQZ J;  2I5U A;  3FDY A;  2ZXH A;  4D0P A;  1VQK I;  2L7M P;  5DEQ A;  4RAF A;  1I27 A;  4HBL A;  3ZN1 A;  4PK4 A;  1ZRC A;  1YJ9 I;  3SZP A;  2EFQ A;  5KNL A;  2QBY A;  1MJB A;  2TCT A;  3CO7 C;  4C2T A;  1B72 A;  4M9X A;  2STW A;  2P7V B;  2VB6 A;  3R60 A;  3BQY A;  1K6O A;  3EQL F;  3BOQ A;  1QZZ A;  2F5D A;  4NUB A;  2M4G A;  1NG6 A;  1FTZ A;  2R5Y A;  4IKF A;  3JTH A;  2VBY A;  2BHZ A;  4P96 A;  1BOA A;  3FZV A;  2ZXW H;  3KFW X;  1R1U A;  1QPI A;  3CUQ A;  4IQ4 A;  4I99 C;  2GQQ A;  2QSG X;  3I71 A;  3K4N A;  1BR1 A;  3CUQ C;  3Q9V A;  3F3X A;  3QPL A;  4DIQ A;  2A6H F;  1TW3 A;  2F4M B;  2GA2 A;  1RRJ A;  2WAQ N;  3RTR A;  1MNM C;  1OCZ H;  1T33 A;  3BG6 A;  2HKX A;  2O61 A;  2ETH A;  4II2 A;  2OA4 A;  3GTL J;  4J00 A;  1OPC A;  2D2W A;  5JLX A;  3QU6 A;  2O0Y A;  2XV4 S;  2JA5 J;  1FEX A;  1UEL B;  1IN6 A;  3ML6 A;  3Q0U A;  4I6Z A;  3E5Q A;  1G3W A;  4L9V A;  2AQE A;  1D8K A;  5LEJ A;  4FQG A;  4ENN A;  3CZ6 A;  3WU0 A;  4RAZ A;  2XIG A;  3K6G A;  4PSX A;  4GO1 A;  3AKZ A;  2LY9 A;  1T0F C;  1WJ5 A;  2R5Z B;  1IRG A;  5HLH A;  4CH7 A;  1YX5 A;  4KYW A;  1JHF A;  2FD5 A;  2MD5 A;  2VPR A;  3BJ6 A;  4XON A;  2K4B A;  2IS2 A;  1IC8 A;  2DA1 A;  2Q8K A;  4F93 B;  3DKW A;  5LHI A;  4M3B A;  5D6F A;  3BPV A;  2E36 A;  4KMF A;  3KYC B;  3NQO A;  3S16 J;  5K5O A;  4A3C J;  4BQQ A;  1U9N A;  4BBS J;  2V4J C;  3OL4 A;  4LOC A;  4DYR A;  2OV7 A;  2QQ8 A;  1Z3X A;  3C2H A;  3IKV A;  2Z1D A;  1UB9 A;  1T38 A;  2ID6 A;  2K02 A;  4AIJ A;  1EH8 A;  4BE1 A;  5E3O A;  2DO7 A;  1VQ7 I;  2V79 A;  2KRC A;  4PDK A;  3KPH A;  2FX0 A;  1QZY A;  2L9S A;  4RAG A;  3K4K A;  1FTT A;  3S1M J;  1B4A A;  4G6T B;  4RB3 C;  3M1C A;  4CGZ A;  4PFO A;  1T08 B;  1ZAR A;  3RSN A;  3BZ6 A;  2XAG A;  5LRR A;  3E97 A;  5KAF C;  1LFU P;  2VBW A;  1HA8 A;  3K69 A;  1IN5 A;  1FY7 A;  5H2F C;  2VLA A;  4LMY A;  2ZCW A;  1KZH A;  2DI3 A;  4JX4 A;  2V6E A;  1O57 A;  5TIS C;  4UB6 C;  4OAY A;  1LKX A;  4Y3O A;  2M9H A;  3BDD A;  4UV8 A;  3VYU B;  1JKO C;  3V7C A;  1UHW A;  4R8H A;  3DV8 A;  4XBF A;  1S5L C;  3E0J B;  2FNP A;  3ZR8 X;  3CJT B;  2Y9Y A;  1YQA A;  2LVS A;  4HST A;  2QEX I;  2FBK A;  1UFM A;  1YTY A;  4A6D A;  4RB0 A;  4BJT A;  1B6A A;  2Y2Z A;  4YEL A;  4YII A;  2IVM A;  1V55 H;  4RMN A;  3S2W A;  3MZY A;  1H0M A;  2UZK A;  3CCJ I;  3S2D J;  5DD8 A;  1ZYR F;  3LSM A;  1D0Z A;  1MDM B;  2FBI A;  4HPQ A;  1KGS A;  3HIF A;  4MIM A;  5C44 J;  1OJL A;  4BL0 B;  3IKT A;  2EB7 A;  1WQ2 A;  4X6A J;  4IJA A;  2EQR A;  1YRN B;  3K2A A;  2DJN A;  4Y7N J;  5EGO B;  3HOV J;  1BW5 A;  2EBI A;  4D5F A;  3MKL A;  3BT9 A;  5CKT A;  4IHY A;  2K9S A;  2DDB A;  2QKL B;  1UZC A;  2DT6 A;  4ZYE A;  4E7L A;  2IW5 A;  1ULY A;  2E2J J;  1EH6 A;  2KZG A;  4BBR J;  3BR1 A;  3D5S C;  1GLN A;  5J8F A;  1JHH A;  2P7C B;  3P9K A;  1GT0 C;  4IPA A;  3QP6 A;  2OC6 A;  2GOM A;  1Z6T A;  3IP4 B;  2E5Z A;  4IHW A;  4L0Z B;  4DBR A;  1FSE A;  1R1T A;  2W85 A;  1RNL A;  2R5Y B;  2KKO A;  3OL3 A;  1FSH A;  2L4A A;  1BOB A;  3K9T A;  4HNV A;  1TC3 C;  3LA3 A;  1XN7 A;  3VSK A;  5JLW A;  3U1K A;  2HOS A;  1ZG5 A;  1FIA A;  2GM4 A;  3F22 A;  3T8R A;  1RPW A;  2IS4 A;  3AG2 H;  1G3Y A;  4RLQ A;  3ULQ B;  2P5L C;  1PJR A;  2YUS A;  1JUS A;  3ZMT A;  4FT8 A;  2ADU A;  2EIK H;  5DCM A;  3TOB A;  3VYR B;  3OYA A;  2BE5 F;  2EFW A;  3GFI A;  3GFM A;  2A5W A;  1VQO I;  1MBH A;  1MZB A;  1QHG A;  1OCR H;  2G7H A;  2LNB A;  3F8N A;  4I76 A;  5J4V A;  4RBO A;  2R7O A;  1LJ9 A;  3LSG A;  3BTC A;  2NNY A;  1H89 C;  5D5V B;  4KIF A;  4A2U A;  2NVU B;  1FYM A;  1GXQ A;  1WSU A;  3VOD A;  2EFP A;  4X0G A;  1MSF C;  5K1Y A;  1B59 A;  3RPU A;  2RN7 A;  3LST A;  4ZYA A;  3QOP A;  2FSW A;  1XD7 A;  5D5U B;  2AS5 F;  3JTG A;  2NXN B;  2X48 A;  4CCN A;  1HF0 A;  4W97 A;  1HCR A;  2DT7 B;  1JKQ C;  1D5Y A;  3E6M A;  5IY5 H;  3CDL A;  2W84 A;  3SDB A;  1LFP A;  2K3F A;  2EZL A;  3DEE A;  3ZXS A;  2DOF A;  2V9K A;  2H09 A;  2A6E F;  5HS9 A;  3TW6 A;  3ABT A;  1U5T C;  2KIF A;  3MZH A;  3WTZ A;  3R61 A;  3GLX A;  2V6C A;  4I7H A;  2OAZ A;  3FXQ A;  1Q1H A;  3KX2 A;  3KLO A;  2G7U A;  4AID A;  4FCY A;  2ISZ A;  2OBP A;  3ONQ A;  3OYE A;  3CDI A;  4Z6Y A;  1VQM I;  1W0T A;  4RAY A;  4YEJ A;  4M72 A;  4ZYH A;  3I9V 2;  2HTJ A;  5IOY A;  4CYC B;  1VND A;  3SQN A;  2CH0 A;  1P4A A;  5J6X A;  3EUA A;  2L7Z A;  4ENJ A;  2JT1 A;  1TBX A;  1ETQ A;  1TNS A;  2NVX J;  5J1U A;  3DKY A;  4I98 B;  2DA6 A;  3ZOB A;  4DOZ A;  2P4W A;  5CPR B;  5HS7 A;  2ESN A;  3KP6 A;  1YW9 A;  3RDI A;  3GTP J;  2LFB A;  2DFF A;  1BA5 A;  1Z7U A;  4PJL A;  1W5T A;  3HZJ A;  2L02 A;  1ETK A;  4CYC A;  2CV1 A;  3CLQ A;  1IV8 A;  4UUV A;  3S93 A;  1W1W E;  3L2C A;  3F23 A;  3ZGK A;  2G0E A;  2JRT A;  1MJA A;  1EKE A;  2DFE A;  3DU5 A;  2B0L A;  1B8I B;  5B1B H;  2VBX A;  4RA2 A;  2YU9 J;  1DP7 P;  3GLL A;  2MA3 A;  5FLV A;  1G8X A;  1B9M A;  2HQA A;  1ETX A;  1ZRF A;  1VQL I;  2ZO4 A;  3TP0 A;  5BOX A;  1AHD P;  1STZ A;  5IOZ A;  2OCE A;  1P7I A;  4I2O A;  4CIC A;  4HLY A;  1XB4 A;  2Y0S A;  4UVB A;  3HUG A;  2CSO A;  3DTI A;  2BEO A;  3FBN B;  4FX4 A;  2VKE A;  3WGI A;  4BXF A;  1W5S A;  3M8F A;  3NAU A;  3GCM A;  1O7L A;  4LB6 B;  5FRO A;  2DXI A;  2YU3 A;  3RKW A;  2RAE A;  2PFB A;  2K5C A;  3HRU A;  1IJW C;  5D5W B;  2WAD A;  3C2G A;  3MMY B;  1UST A;  4NDL A;  3OS0 A;  1SVM A;  1MBJ A;  4YFK F;  1E3O C;  1QZE A;  1R58 A;  5DM7 F;  2M0C A;  2R7U A;  3H3V K;  1TWF J;  4A0Y A;  2RC4 A;  4AUX A;  5DYM A;  1K83 J;  1WJD A;  1ZR4 A;  2V1D A;  1ZGA A;  5GP9 A;  4CCM A;  4MFE A;  2HGC A;  1FOY A;  3P9I A;  2MD0 A;  1VFC A;  3IV5 A;  4YIF A;  1KYZ A;  3RKX A;  3PNT A;  2Z2S B;  1XMX A;  3VYS B;  4PJN A;  2QKM B;  3WG9 A;  4B09 A;  2BXZ A;  2M34 A;  1O7F A;  5CVJ A;  3C1D A;  4XLF A;  2E1M C;  4O6J A;  3CMM A;  2ZXI A;  2FMY A;  5H20 A;  5ILS A;  4NC7 A;  4XRS A;  1Y6I A;  4PJJ A;  2ECB A;  1R4N B;  3RJP A;  1FOK A;  4XK4 A;  3IWF A;  3KZY A;  4Q48 A;  1VQP I;  3G3Z A;  3GWZ A;  3MKW B;  2RQP A;  4XLC A;  1IXS B;  1D1A A;  5FFZ A;  3LFK A;  2K9M A;  1WJA A;  1MMN A;  4XKW A;  5ILU A;  1R36 A;  3ROU A;  4P1W A;  4E70 A;  2XB5 A;  1XX5 A;  5F04 A;  2VBZ A;  4NHJ A;  3L9F A;  4MEY F;  3KZI C;  4EJO A;  1X1C A;  1TWA J;  2HI3 A;  2E1N A;  5J4Y A;  3TO6 A;  1SC7 A;  3FHN A;  1RIO H;  3TDU C;  2H8W A;  5E8G A;  4UVA A;  2DT5 A;  1BC7 C;  5IYC J;  3GME A;  2QBY B;  1FIP A;  2UXN A;  3P7N A;  4LGW A;  1LEB A;  4AIK A;  4ASN A;  1HDP A;  1KYW A;  2HU9 A;  4XLP F;  4IQJ A;  3ISP A;  5LFA A;  3FIS A;  5K5Q A;  3MWM A;  5IP9 J;  3IRQ A;  1SAX A;  3O3K A;  1JKP C;  3A4C A;  1KQ9 A;  4MGR A;  2I8D A;  1Z6R A;  1MGT A;  2HS5 A;  4M3E A;  5GAD J;  4XQF A;  1Y0N A;  1DGW Y;  1T2K A;  3H35 A;  1FWZ A;  3RCO A;  2PMZ N;  3PQK A;  2EIL H;  2ICW G;  2XPV A;  4LLN A;  2ZC2 A;  4A3L J;  5DTD A;  3DBH B;  4OIR F;  2EH3 A;  1F1Z A;  4BEH B;  1G3T A;  1TNT A;  1IG7 A;  4E7H A;  2P81 A;  1YE9 A;  3E3V A;  3CTA A;  3EET A;  1OCC H;  4BU2 A;  5C4X J;  2GXA A;  1UHM A;  1N75 A;  2R7Q A;  4BNC A;  1XGM A;  2ZFW A;  3S17 J;  2ZBK A;  3A0B C;  3I59 B;  1XCB A;  4V19 K;  3HKZ N;  2DFH A;  2WA0 A;  5EZH A;  5E3N A;  2VKD A;  2XGE A;  1NHA A;  1QHH D;  2ZB9 A;  2O5R A;  1IN4 A;  1R5I D;  2R7R A;  3ERE D;  4CDG A;  2LBF A;  1O3Q A;  2R7W A;  4N4O B;  5D5X B;  1ZN2 A;  3EYY A;  4B8X A;  4P9F A;  1WJF A;  3AFH A;  3IH3 A;  1EF4 A;  3G1O A;  2ZJR F;  2KJB A;  2M87 A;  2X0L A;  2X6Y A;  4OOI A;  4B47 A;  2QSH X;  3I3L A;  1SMT A;  3AG4 H;  4LIU A;  3EDP A;  3JAM Z;  2COM A;  1ZLJ A;  4NNJ A;  2EA2 A;  2PN6 A;  2H94 A;  2LLK A;  3HUG B;  5C3E J;  1QO0 D;  3MN2 A;  2QCO A;  3SEQ A;  4RGR A;  1L3L A;  1JT6 A;  3MKY B;  3HGY A;  3TDZ C;  2Y30 A;  3DPT A;  4RB1 A;  3CCU I;  3DTK A;  3OSF A;  2VQL A;  4JYK A;  2ECC A;  1S6L A;  1Z3Y A;  2FNA A;  3TW7 A;  4IZZ A;  1SFX A;  3F8C A;  3BR3 A;  1V3F A;  4IXA A;  5JR3 A;  2X85 A;  1ODD A;  4EM0 B;  5IP6 A;  2CMP A;  2CO5 A;  3KP4 A;  4EM1 A;  1WGX A;  1BC8 C;  3WU1 B;  1FZP B;  1IUY A;  5E1W A;  1T8I A;  1SAU A;  4MFD A;  4ZYD A;  5LGT A;  4IRI A;  3L7W A;  2KJC A;  1MIJ A;  2M0M A;  2Y0S N;  1KU7 A;  1A6Q A;  1OR7 A;  3DLA A;  3HRS A;  2CW7 A;  4GDF A;  3OOU A;  3DF8 A;  2F5C A;  2P6S A;  2QEN A;  4IRH A;  2D5V A;  3K0L A;  4KN7 X;  5DV5 A;  1FNN A;  1ERD A;  2ELK A;  3M8J A;  2PJP A;  4HLX A;  1MNE A;  2HYF A;  2TRT A;  3HM5 A;  4J01 A;  1POG A;  4D7M A;  3A01 A;  3FXL A;  5D4S A;  3WTS C;  3FKJ A;  2XB0 X;  1PYV A;  1DU0 A;  1X1A A;  4PZJ A;  2JVG A;  5GPC A;  5EYR A;  1PP8 F;  3X2Q H;  4G7Z F;  4NB5 A;  3MKZ A;  3H92 A;  4PGH A;  4MTE A;  4BEH A;  1XDU A;  3NEU A;  2CQ7 A;  1MMS A;  3BCB A;  4HEA 2;  3NRV A;  1NTC A;  2A05 A;  3GFJ A;  3FHZ A;  4PJM A;  4CO8 A;  2YSR A;  2DMU A;  2KT0 A;  1N77 A;  5E1X A;  3EPZ A;  5KVR A;  2O7O A;  4C3J J;  2Q2E A;  4Q47 A;  3ZMS A;  3O2P E;  1IZ1 A;  2XGX A;  1V4R A;  2XAJ A;  2MBF A;  3K4J A;  4HYE A;  3TO9 A;  3FK7 A;  2ZNZ A;  5IT3 A;  3S15 J;  4HDU A;  1UMQ A;  4G12 A;  1OIS A;  2R7D A;  4HX8 A;  1DDN A;  2MYS A;  3KE2 A;  3M8E A;  4EQQ A;  1XS9 A;  2J5P A;  4WX9 A;  1H9G A;  5F0F A;  3S1N J;  3H3U A;  4ENM A;  2EZI A;  3NWS A;  3D0S A;  2DMT A;  2W4S A;  3RPU D;  2M7B A;  5BS6 A;  1JJ8 C;  2IAI A;  3O6B B;  1FYL A;  1BM9 A;  1XSV A;  1SFU A;  2VL8 A;  3OYI A;  3K1M A;  3WU2 C;  4KIC A;  4D5C A;  3V8K A;  1R6R A;  1HW2 A;  2W00 A;  1VQ8 I;  2JUC A;  3OYL A;  1Z7L A;  4QPQ A;  3AAF A;  4ESF A;  1BIB A;  2IGO A;  1WPK A;  3CP8 A;  2XAF A;  1NG7 A;  5K7Z A;  2EZK A;  1J2X A;  1SFO J;  3ZMU A;  1KU2 A;  4BAY A;  1S7A A;  2V9V A;  3BJA A;  4EEF G;  3VEP A;  2X6O A;  2P8T A;  3QOD A;  3PSI A;  1IRX A;  1B1B A;  3CF2 A;  2JSP A;  2VAS A;  4WXD A;  1ORK A;  3V4G A;  2M7A A;  4C2M J;  1U0J A;  4XRM A;  3OYD A;  2LRD A;  4OIQ F;  4RLF A;  2YPR A;  4A3D J;  2XUB A;  1BBY A;  2Q1Z B;  3KP3 A;  4KFC A;  5M5X J;  5BNG A;  1SEU A;  1Z0X A;  4A69 C;  3PO3 J;  4LG0 A;  3ECO A;  4UXN A;  5HLG A;  3J7A O;  5D6E A;  3DBL B;  2ZFU A;  2XAQ A;  1BR4 A;  3HRT A;  4YG2 F;  1IRZ A;  3PQJ A;  4MTD A;  3H5A A;  2LP0 A;  2F5V A;  2K4J A;  3Q0V A;  3SXY A;  2Z9O A;  4K2E A;  1P92 A;  1IXR C;  3K2Z A;  3LMM A;  5ICE A;  2CFO A;  4IX7 A;  1U6G A;  2HXI A;  2DLL A;  3I54 A;  2CU7 A;  2PMZ A;  2BW3 A;  4HOB A;  5KCM A;  4BDZ A;  1W0U A;  4YFN F;  3VB2 A;  1JUM A;  1JGG A;  3OIO A;  1NK2 P;  1JTX A;  1YIJ I;  4B1R A;  4KJZ A;  5D8L B;  2FML A;  1GVD A;  2P5K A;  4Y15 A;  1L0O C;  1R49 A;  2E34 A;  3QU3 A;  4U88 A;  1X1P A;  4M74 A;  1D1B A;  1Z91 A;  2VC1 A;  3IL2 A;  4EJT A;  1ZR2 A;  4ZH4 F;  3ASN H;  1R4M B;  1N78 A;  3JCU C;  2QQ9 A;  4WF2 A;  3CCV I;  1A5J A;  2KQR A;  5HLI A;  1VQ6 I;  2PMU A;  2ZXJ A;  5JVT A;  4KIS A;  1ZRD A;  3I4N J;  5GAH J;  1FJL A;  3CMY A;  5GTI C;  2ID3 A;  4M9S A;  1GVJ A;  5EG0 B;  2V7F A;  1YW7 A;  4YFX F;  2XRO A;  3MQ0 A;  1FOW A;  2WV1 A;  1YHQ I;  4RB2 C;  3LSK A;  3TKY A;  3CD6 I;  3ZCO A;  3SZT A;  1TP4 A;  2GIV A;  4A5M A;  1QVU A;  2CQK A;  4HX4 A;  4HV5 A;  4HQM A;  2O8X A;  2O6G E;  4CA0 A;  3GO5 A;  2OZU A;  2KIS A;  3ESW B;  3PNV A;  4A0X A;  3J7Z I;  5BPI A;  1HDD C;  1AOY A;  4I0A A;  3HTS B;  3KET A;  2Y75 A;  4U0Y A;  2LKX A;  1V54 H;  4BXU A;  2HDD A;  1K4T A;  5CVR A;  1D5V A;  1I6X A;  2OZ6 A; 
#chains in the Genus database with same CATH homology
 2CQQ A;  4V2G A;  3JRI A;  1Z77 A;  2NVQ J;  5IOY A;  4CYC B;  2W48 A;  1VND A;  3A01 B;  4B4C A;  2GLO A;  2R7Z J;  2L7Z A;  1RR7 A;  5IP7 J;  2DA5 A;  4A93 J;  1ETQ A;  2NVX J;  5J1U A;  5EDN A;  2HYJ A;  2DA6 A;  2L7F P;  3SJM A;  2K40 A;  4MLO A;  3ZOB A;  5F27 A;  5M5Y J;  5M3M J;  2GBY A;  3GTP J;  2LFB A;  2JA8 J;  3UKG A;  1BA5 A;  1B72 B;  4CYC A;  1ETK A;  3D1N I;  5FKL A;  5F1J A;  4DYQ A;  3W6V A;  1RKW A;  3GBG A;  2G0E A;  4M3G A;  5EEA A;  5E3L A;  4DZP A;  2R92 J;  1B8I B;  2YU9 J;  9ANT A;  3WHC A;  5FLV A;  1S7E A;  5K7F A;  1ETX A;  3TP0 A;  3PM1 A;  1AHD P;  5IOZ A;  3BG5 A;  1P7I A;  1B8I A;  1TWG J;  1DU6 A;  1GV5 A;  2VKE A;  2WB1 N;  2R5Z A;  3GTK J;  5DS9 A;  3HOU J;  3NAU A;  1NK3 P;  3LSJ A;  1MSE C;  1P7J A;  2MW8 A;  2YS9 A;  2RAE A;  4FTH A;  4A3B J;  2HXO A;  3FKI J;  3VPR A;  5F0H A;  1ETV A;  1IJW C;  3LSP A;  5J3L A;  4AC0 A;  2X9D A;  4UUS B;  3O8H A;  4XRS G;  2HQ5 A;  5FKO A;  4NDL A;  2JA6 J;  1AU7 A;  3GTM J;  2QF7 A;  1MBJ A;  1E3O C;  2H1K A;  3BTI A;  2M0C A;  5FJ8 J;  1JJ6 C;  3H3V K;  1TWF J;  2IEK A;  4AUX A;  1K83 J;  1ZR4 A;  2M8G X;  1TWC J;  5GP9 A;  2NVY J;  4X1E A;  4Y52 J;  3HGG A;  3QQA A;  4MFE A;  2NS8 A;  4BKX A;  1VFC A;  3IV5 A;  5HOD A;  2AO9 A;  4A3M J;  4ABZ A;  2HOA A;  3M4O J;  2M34 A;  5FKK A;  2LTP A;  1CQT A;  3JRB A;  1U9O A;  1WH5 A;  3LSR A;  2DA3 A;  4XRS A;  1UG2 A;  2ECB A;  2LK2 A;  1ZK8 A;  4XK4 A;  5F08 A;  3SDG A;  1G2H A;  2DMN A;  3LOC A;  1GDT A;  3TP3 A;  2CRG A;  3C2B A;  5GPA A;  1Y1W J;  4BXX J;  3HOZ J;  2XB5 A;  3DCF A;  4XIC A;  2JA7 J;  2R0Q C;  2DMP A;  5F04 A;  2XRL A;  4V2F A;  1TWA J;  2HI3 A;  1QVT A;  2JK3 A;  3JR9 A;  3HDD A;  1Q1V A;  1X58 A;  3BR6 A;  1RES A;  1LE8 B;  2ME6 A;  3ZQF A;  3JRF A;  5IYC J;  3TED A;  1O4X A;  1FIP A;  3GTG J;  3O8G A;  3BG9 A;  2VKV A;  3I4M J;  1HDP A;  1WCM J;  2AHQ A;  2I10 A;  2JN6 A;  3S1R J;  3FIS A;  1BW6 A;  1APL C;  3RQI A;  3JRD A;  5IP9 J;  1JKR C;  2E2I J;  5C4J J;  1JKP C;  4C3H J;  1JT0 A;  2DA7 A;  4IHV A;  3BQZ A;  4M3E A;  3PO2 J;  5K7H A;  2DMQ A;  3CCY A;  1JTY A;  1ETY A;  2PMZ N;  1HOM A;  1GV2 A;  2XPV A;  4A3L J;  5DTD A;  4BY1 J;  3QPS A;  1AKH A;  3CQZ J;  2EH3 A;  1IV6 A;  2L7M P;  3NAR A;  1IG7 A;  2COB A;  2P81 A;  2L9R A;  4DZJ A;  2XSD C;  1PUF B;  5C4X J;  3S17 J;  2TCT A;  3JRE A;  5J1R A;  2MG4 A;  3JRG A;  1B72 A;  3GTQ J;  3HKZ N;  2E19 A;  1OCT C;  3BR0 A;  3BQY A;  5EZH A;  5E3N A;  2XGE A;  2ZB9 A;  5FKM A;  4DW6 A;  3HOW J;  1U8B A;  1EF4 A;  1FTZ A;  2R5Y A;  3IH3 A;  3G1O A;  4A3I J;  1JUP A;  1RKT A;  1YRN A;  2CJJ A;  1QPI A;  2OPT A;  2DN0 A;  2XPU A;  3ZQG A;  2LLK A;  5C3E J;  3MN2 A;  3MVP A;  2QCO A;  5J1Y A;  1JT6 A;  3HGY A;  3JRH A;  2Y30 A;  1I50 J;  4A3J J;  3HOY J;  3BTJ A;  3QPL A;  3OSF A;  4JYK A;  4XID A;  2ECC A;  2WAQ N;  2K9N A;  3TW7 A;  3OSG A;  1MNM C;  2L0K A;  1T33 A;  3BR3 A;  3GTL J;  4UUS A;  5IP6 A;  5JLX A;  1ZQ3 P;  1PUF A;  2JA5 J;  1WGX A;  4FE7 A;  1SAN A;  3Q0U A;  4I6Z A;  1FEX A;  4MFD A;  1UHS A;  4M6V A;  2Y0S N;  3GTJ J;  2LY9 A;  2R5Z B;  4C3I J;  4FIS A;  4IEJ A;  1I3Q J;  1F43 A;  4JX6 A;  3OOU A;  1HLV A;  1I6H J;  2O9L A;  2D5V A;  1OCP A;  2ELK A;  4GFB A;  4M3D A;  2FD5 A;  2MSY A;  2VPR A;  3ZQL A;  1MH4 A;  2TRT A;  3HM5 A;  2CUE A;  1POG A;  2DA1 A;  2JJ7 A;  3Q0W A;  4D7M A;  3WHB A;  3A01 A;  1IC8 A;  3G1M A;  2E1O A;  2HOT A;  4M3B A;  2XB0 X;  1Y1V J;  1DU0 A;  3S16 J;  4A3C J;  1U9N A;  5GPC A;  4BBS J;  3G1L A;  5EYR A;  4LOC A;  4DYR A;  2MGQ A;  1ETW A;  3RZO J;  4M3F A;  1ZKG A;  1MBK A;  2EZH A;  1NTC A;  2ID6 A;  3B6A A;  2ME0 A;  3ZQH A;  1X2N A;  2DMU A;  1H8A C;  2VUM J;  5E3O A;  2KT0 A;  4JP0 A;  3RZD J;  2FX0 A;  1VI0 A;  2O7O A;  4C3J J;  2LR8 A;  1FTT A;  2B63 J;  3S1M J;  3E7L A;  3FK7 A;  4B3A A;  3S15 J;  2DA2 A;  1UMQ A;  2N8G A;  4G12 A;  3S1Q J;  3SFI A;  1X2M A;  4A3K J;  1XS9 A;  5M3F J;  4QSH A;  1LFU P;  1RET A;  1BL0 A;  4A3G J;  2NS7 A;  5EG0 A;  5F0F A;  2CUF A;  3S1N J;  3S2H J;  2EZI A;  1JJ8 C;  2DMT A;  4JX4 A;  2IAI A;  3A03 A;  2DTZ A;  2NOG A;  1LFB A;  4A3E J;  2OF7 A;  4D5C A;  2IBD A;  2M9H A;  4BY7 J;  5FLM J;  3IH4 A;  1JKO C;  2JWT A;  2XPW A;  5EZG A;  4MO7 A;  4J19 A;  1AKH B;  2Y9Y A;  1WPK A;  2LVS A;  3HBL A;  5K7Z A;  2EZK A;  3FIW A;  1SFO J;  2XGD A;  2FQ4 A;  2Y2Z A;  1ZTR A;  4EEF G;  1K61 A;  3RKQ A;  1OFC X;  2H8R A;  3H0G J;  4W1U A;  2X6O A;  3DEW A;  5FKN A;  3S2D J;  1IGN A;  2FJ1 A;  3GTO J;  4MIM A;  5C44 J;  1OJL A;  5IYD J;  4X6A J;  2K9Q A;  1ORK A;  2EQR A;  1WI3 A;  4C2M J;  1IDZ A;  1YRN B;  3K2A A;  2M2E A;  2DJN A;  4Y7N J;  2R93 J;  5EGO B;  4XRM A;  3HOV J;  5EF6 A;  2EBI A;  4D5F A;  1BW5 A;  3K7A J;  3BT9 A;  3MKL A;  5IPA A;  2K9S A;  1GUU A;  4L5E A;  4IHY A;  3Q3S A;  3FK6 A;  2O8K A;  4QIW N;  4A3D J;  4IHX A;  1R9T J;  4A3F J;  1MBG A;  1LE8 A;  5M5X J;  2E2J J;  1BJZ A;  5BNG A;  1Z0X A;  4A69 C;  3PO3 J;  4BBR J;  3BR1 A;  2JMW A;  1VF9 A;  1XG1 A;  3JRC A;  1IRZ A;  3A02 A;  4QTR A;  3M3Y J;  2LP0 A;  3ZQC A;  1GT0 C;  3BTL A;  5F0C A;  4DYC A;  3Q0V A;  4IHW A;  1MBE A;  3HEF A;  1A6I A;  2KDZ A;  1ITY A;  1MBF A;  2R5Y B;  1QRY A;  2E2H J;  1TWH J;  2LD5 A;  5E3M A;  2HXI A;  4HNV A;  1IDY A;  1TC3 C;  1IUF A;  2CU7 A;  3L1P A;  1W0U A;  2Y9Z A;  5JLW A;  1F36 A;  2DA4 A;  1JUM A;  1JGG A;  2HOS A;  1FIA A;  3OIO A;  4FE4 A;  1NK2 P;  1JTX A;  2GM4 A;  4B1R A;  1RPW A;  1ETO A;  4UUT A;  1GVD A;  2NVT J;  4S0H B;  4RDU A;  2XGC A;  2YUS A;  1JUS A;  1ZGW A;  1ZR2 A;  2VI6 A;  1MBH A;  4RBO A;  4I76 A;  3JRA A;  3BR2 A;  1A5J A;  3LSG A;  3BTC A;  1H89 C;  3I4N J;  1MSF C;  1FJL A;  2Y31 A;  3CMY A;  1U78 A;  2ID3 A;  5EG0 B;  4D7N A;  3BG3 A;  2X48 A;  1HF0 A;  5EGO A;  1MH3 A;  4W97 A;  1HCR A;  1JKQ C;  2WV1 A;  3LNQ A;  5M5W J;  1D5Y A;  3CDL A;  3B6C A;  5IYB J;  4AYB N;  2CQX A;  3S14 J;  2EZL A;  3HB9 A;  1T56 A;  1XC5 A;  3ZQI A;  3HOX J;  1QVU A;  3IH2 A;  3BR5 A;  3F0C A;  3TW6 A;  1HDD C;  1ENH A;  1H88 C;  2LKX A;  4JX5 A;  2HDD A;  4FCY A;  1W0T A;  1WH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...