1JKRC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*CP*AP*AP*GP*A)-3'
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkrC00
1MH4A 1LFUP 3HGYA 4M3BA 3BR6A 4HNVA 4S0HB 1WPKA 2LP0A 2MSYA 1Z0XA 2QCOA 5GP9A 4FISA 5K7FA 4A3GJ 3S2HJ 2OPTA 3BR0A 3JRAA 2KT0A 1U78A 3LNQA 3HM5A 2FD5A 1ZR2A 1B72B 5E3NA 3TEDA 4M3DA 5J3LA 4A3CJ 3LSJA 1OCPA 4Y52J 3CQZJ 2G0EA 1VFCA 2O8KA 3H0GJ 3HOVJ 4A3KJ 1I50J 3HOWJ 2LFBA 2M9HA 1AKHB 2B63J 1ETYA 1ZTRA 3Q3SA 5F08A 3DEWA 3C2BA 4UUTA 3D1NI 2NVTJ 3I4NJ 1U9NA 3S1NJ 3K7AJ 4C3JJ 1P7JA 2LKXA 3BR3A 4FE7A 2RAEA 3S1MJ 4FTHA 2R7ZJ 1FJLA 5C4XJ 2ELKA 2HI3A 1RPWA 2L7FP 2DTZA 5EGOA 1DU6A 2EBIA 3BG3A 1K61A 4MIMA 1OFCX 1GV2A 1A6IA 2XGCA 4NDLA 4G12A 3OIOA 1X2MA 4M6VA 4M3FA 4IHYA 3FK7A 2CRGA 3BG9A 3A03A 4XRMA 3ZQFA 3G1LA 3Q0VA 1GUUA 3JRGA 2HQ5A 3BR1A 2XB5A 4D7NA 2P81A 5J1RA 1MH3A 5IOYA 1JKQC 1IJWC 4I76A 2K9SA 4BBRJ 2EZHA 3FKIJ 4A3BJ 1XS9A 2ME0A 3B6AA 1GT0C 2XRLA 3LSGA 3GTLJ 3IV5A 2JMWA 3HOZJ 4QSHA 3BTJA 4B3AA 3G1OA 1LFBA 2NVYJ 1OJLA 5EZHA 1TWCJ 1QVUA 1GV5A 2ZB9A 3CCYA 2ECCA 1JGGA 5EG0A 3GBGA 1MNMC 5FKOA 4A3IJ 3GTJJ 2Y31A 1HCRA 1R9TJ 3HDDA 1TWAJ 2IEKA 1WI3A 3CDLA 4MO7A 5FKKA 3B6CA 1UMQA 5M3FJ 2VKVA 3JRFA 3O8HA 1W0TA 2DN0A 3IH3A 2GBYA 3S17J 2FJ1A 1JKPC 1RKWA 3GTOJ 5IPAA 4IHXA 2EZKA 2FX0A 3GTQJ 1PUFA 1D5YA 1H88C 2NS8A 3TW6A 1MSEC 1E3OC 2MGQA 2H8RA 2IBDA 5EZGA 4IHWA 3RZOJ 1JUMA 4DZPA 2XPUA 4XRSG 4ABZA 3F0CA 1IGNA 3GTPJ 4XRSA 2JJ7A 1SFOJ 1QRYA 5K7ZA 2W48A 3S1RJ 1U9OA 4BXXJ 1HLVA 2N8GA 2KDZA 3HOUJ 2DMTA 5EF6A 3I4MJ 3HOXJ 1ITYA 2TRTA 2LR8A 3ZQLA 1ETOA 1JTXA 2XPVA 3GTMJ 2L7MP 4B1RA 2L9RA 4XK4A 3OSGA 1ETWA 1WH7A 3BR2A 3QQAA 4CYCB 2NVQJ 4CYCA 5M3MJ 2I10A 4UUSA 2JA7J 5IP9J 3FK6A 3L1PA 2CQQA 3HKZN 2XGEA 1ETVA 2R5ZB 1EF4A 4JX5A 5M5WJ 2LD5A 5EDNA 2M8GX 1HF0A 2R92J 2DA4A 3HOYJ 2CUFA 4JX4A 2YU9J 4MFEA 1IV6A 3BTLA 1VI0A 3HGGA 3QPSA 5F0HA 1IDYA 1Y1WJ 3S1QJ 1NK2P 3M3YJ 3S14J 5IYBJ 1RESA 2E19A 5EYRA 9ANTA 1PUFB 5IYDJ 2XPWA 3JRBA 3FISA 3JRIA 1DU0A 1QVTA 1FTZA 3NAUA 1NTCA 1IG7A 2R5YA 4JP0A 3PM1A 4EEFG 1AHDP 4M3GA 2M2EA 3Q0UA 2MG4A 2HOTA 4DZJA 1TWHJ 2WV1A 1XG1A 2AHQA 3RQIA 2DMUA 2VKEA 5BNGA 1HDPA 2DMPA 1JT6A 1RKTA 1POGA 5HODA 4FCYA 4A3EJ 5EG0B 2ID6A 2LTPA 3W6VA 2O7OA 4D5FA 5K7HA 2COBA 2HXOA 3BQZA 2Y9ZA 1ETQA 3LOCA 5DS9A 1B8IA 2DA5A 3MVPA 4DYCA 2XSDC 1HOMA 1RR7A 1BW6A 1F36A 5EGOB 3ZQCA 3NARA 3TP3A 4LOCA 3JREA 3IH4A 1T56A 3PO2J 1XC5A 1ETKA 1ETXA 1JUSA 4W97A 1JUPA 4A69C 3RKQA 1X2NA 1MBEA 1ZK8A 2XGDA 2MW8A 2DA6A 4JX6A 4V2GA 5FLMJ 3DCFA 3RZDJ 5E3LA 1VNDA 3BQYA 1U8BA 3GTKJ 2X6OA 3ZQIA 5FJ8J 1IC8A 3G1MA 3ZQGA 1ORKA 2HOSA 2IAIA 2LY9A 2Y30A 2E1OA 3SJMA 2O9LA 4FE4A 4V2FA 1UG2A 4MLOA 4A93J 3OSFA 2DMNA 3A02A 4I6ZA 2Y2ZA 5FKNA 2AO9A 1FEXA 1ZKGA 5IP7J 1B8IB 1FTTA 3Q0WA 4XIDA 3S16J 5C44J 2E2HJ 5JLWA 1NK3P 1S7EA 2FQ4A 2NVXJ 3JRDA 2VUMJ 4L5EA 5F27A 2E2IJ 2JWTA 3TW7A 1A5JA 3OOUA 1BL0A 1MBKA 1GVDA 3ZOBA 2R5YB 1H89C 1AKHA 3FIWA 1F43A 1LE8B 1TWFJ 2D5VA 3PO3J 2CUEA 2CU7A 2JN6A 1BW5A 2ID3A 2K9NA 3H3VK 4BY7J 2K9QA 4X1EA 5FLVA 1JTYA 1MBFA 4GFBA 1Z77A 4A3JJ 1B72A 4IHVA 5C3EJ 2HXIA 3JRCA 5IOZA 4M3EA 1JKRC 4BKXA 3K2AA 2EQRA 2TCTA 3LSPA 1WH5A 2YUSA 3M4OJ 2ECBA 2R93J 4DYRA 3HB9A 5IYCJ 3ZQHA 2JA5J 2EZLA 4D5CA 1UHSA 4AUXA 2LVSA 3WHBA 2JA6J 3LSRA 1WGXA 1YRNA 5FKMA 1MSFC 1RETA 2WB1N 3WHCA 1G2HA 3BTIA 2K40A 4W1UA 4C2MJ 3MKLA 2VI6A 2XB0X 1VF9A 2L7ZA 2HOAA 3VPRA 2DA1A 3BTCA 2HYJA 5F0FA 2H1KA 3BR5A 3S15J 2NOGA 2NS7A 2ME6A 4XICA 5FKLA 4DYQA 1I6HJ 2DMQA 4A3FJ 2JK3A 1W0UA 3O8GA 3BT9A 3QPLA 1O4XA 2M0CA 3JRHA 3BG5A 5F0CA 4AC0A 1ZGWA 1QPIA 1BA5A 1X58A 1GDTA 5J1YA 1Y1VJ 3A01B 1HDDC 2L0KA 4C3IJ 2M34A 4D7MA 5E3OA 4MFDA 1P7IA 3SFIA 1BJZA 1Q1VA 5F1JA 4AYBN 1JT0A 1OCTC 5C4JJ 1TWGJ 1JJ8C 4Y7NJ 4J19A 1SANA 4A3MJ 1APLC 2CJJA 3CMYA 3TP0A 2R5ZA 3MN2A 3HBLA 2CQXA 4A3LJ 1CQTA 4BY1J 1MBJA 4IEJA 3S2DJ 3JR9A 4UUSB 2R0QC 2DA7A 1T33A 2JA8J 3A01A 1ENHA 4X6AJ 3GTGJ 1JKOC 4BBSJ 4JYKA 1K83J 1IRZA 5F04A 2LLKA 4B4CA 1MBGA 5EEAA 4DW6A 2GLOA 4QIWN 4RBOA 2LK2A 1FIAA 3UKGA 2DA2A 3IH2A 4RDUA 2E2JJ 1WCMJ 5IP6A 2Y0SN 5M5XJ 2EZIA 2WAQN 3SDGA 2YS9A 2GM4A 2OF7A 5J1UA 1ZR4A 1AU7A 1H8AC 5M5YJ 1JJ6C 1IDZA 5GPAA 1I3QJ 5E3MA 1FIPA 2EH3A 2DA3A 4QTRA 2X9DA 1ZQ3P 3HEFA 5GPCA 4A3DJ 1MBHA 2VPRA 5DTDA 2PMZN 2X48A 2Y9YA 2DJNA 4C3HJ 2QF7A 3E7LA 1TC3C 1YRNB 1IUFA 5JLXA 2HDDA 1LE8A
chains in the Genus database with same CATH superfamily
4GYIA 5D6FA 2MH2A 2LKSA 1SD6A 2VBZA 3BR6A 4HNVA 3GCMA 4S0HB 2H8WA 4B47A 1XMAA 1FOWA 2HZDA 2QCOA 3OWTA 5CYVA 4OMYA 3KLOA 4LIVA 3LNQA 3TMOA 2CUZA 3C2HA 3JCUC 4ZJZA 1U5TC 5E3NA 4XORA 5CLSA 3DEUA 3P9IA 3GYHX 1Z1DA 3LSJA 2GXBA 2DK5A 2PMUA 3CQZJ 3COAC 3CO6C 2VASA 2O8KA 2V9PA 1LEBA 3HOWJ 3T8TA 2FBKA 4HDVA 4I98B 2VQLA 2FMLA 4HNUA 4UUTA 2DAOA 1I1GA 1ONVA 3D1NI 5J4VA 2D1VA 2P5KA 1XDSA 2ISYA 3V8LA 3OYEA 1BI1A 3DF8A 2OQRA 4FE7A 3VEPA 2Z16A 1TLHB 2R7ZJ 1FJLA 1R6RA 2P7VB 2HI3A 1RPWA 4DBRA 3WTSC 1MGTA 1KQ8A 2DTZA 2H09A 3HC7A 3T1BA 3LAJA 1R4NB 1F4KA 1FSEA 1A6IA 1ZGAA 2JUGA 1Z3YA 1WJBA 3OIOA 4QWQA 3OS1A 4M3FA 4NNJA 3BG9A 3ZQFA 3Q0VA 1BC7C 2ZNYA 2WAQA 1ZH5A 2F5DA 3D5LA 2P0WA 1P9QC 2XB5A 3VSKA 2AQEA 5J1RA 2TDXA 3PFYA 4BNCA 2QQ8A 5HNHA 3I56I 2LC2A 3FHNA 4I76A 2K9SA 4HV5A 4ANJA 3ABUA 2V1DA 3PNVA 4D0PA 4A3BJ 2DYSH 1XS9A 3W2AA 2KIQA 3U9GA 2ZJQF 4A6DA 2XAUA 1GT0C 1FBQA 5ILSA 1IAWA 3IV5A 3ZN0A 2MD0A 3SYTA 3G1OA 2A3SA 4OMZA 1D1BA 1YJWI 1X1PA 1QHGA 2X6XA 3RCOA 2F5FA 1TWCJ 1QVUA 1V4RA 3KE2A 4BE0A 2ECCA 2VJ4A 2A6EF 3DEEA 4Y4RA 1S6LA 3CCRI 2Y31A 1KYZA 3FXRA 3O6BB 4XKWA 1R9TJ 1LUJB 3GVAA 4H4KC 3W3CA 2X85A 3ZMTA 3WG9A 3B6CA 4HX8A 1G8XA 3CP2A 4FETA 3S17J 1SVOA 1UHMA 5K5QA 4IHXA 2FX0A 1HSJA 4U0VA 5LD2C 3KEQA 2WV0A 2JPBA 2P6SA 2P4WA 3JTHA 1UB9A 3TOBA 1E3OC 1MSEC 2DOEA 5EZGA 1RNLA 2ZC2A 3DXJF 4CH7A 3VFZA 4DZPA 3FMRA 2Y0MA 3F0CA 4EJTA 4XRSA 1SFOJ 2J5OA 3RKYA 3QPHA 2AQFA 3I4MJ 1WKMA 2DMTA 4NB5A 4HX4A 4PDKA 4A0XA 1DPRA 1YW8A 2A07F 2M45A 3ZQLA 1JTXA 4WK8F 3PNYA 3EUAA 4LLNA 4G7OF 2XAJA 2DYRH 4B43A 2IJLA 1OQYA 1W5CC 3F72A 1Y6IA 2AXTC 1OPCA 3IRQA 3JAMZ 2WTEA 4ZDLA 2V6EA 3IWZA 2LBFA 5AIQA 5ICGA 5M3MJ 3OYAA 3OYKA 4EATA 4HSRA 3FK6A 3G71I 4GCVA 4L9JA 3OYJA 3WGGA 3HKZN 2K27A 4A12A 2G9WA 2HGCA 2P7CB 5M5WJ 2K7LA 4XRFA 1C0WA 5L3DA 2BBYA 1XX5A 2Q0OA 4UUVA 5E20A 4NQWB 3HOYJ 4DNCA 4YFKF 2NOJB 3ASNH 3DKYA 5CJ9A 2W24A 1V5EA 1NK2P 1IF1A 5EYRA 2NNNA 2FEZA 4CCOA 3JRBA 4EVIA 2AS5F 1DU0A 3BDDA 4M72A 3ZPLA 3M9AA 4ESFA 4P9UA 1IG7A 4IJAA 4BXFA 4AM3A 4N9IA 3SDBA 1XG1A 4DOZA 3VWBA 2DMPA 2O03A 2QENA 4G9YA 2COBA 2HXOA 1ETQA 5EJCA 5DS9A 3V7CA 4Z6YA 4DYCA 3FXLA 2XSDC 1RR7A 2KZVA 4KA4A 2BW3B 3FMQA 5HVQC 5J8FA 4ZTJA 3ZQCA 2AXLA 2DK8A 4LOCA 3RJPA 1T56A 3PO2J 1JUPA 2LREA 4R8HA 1YQAA 4G6TB 5B1AH 2MLGA 1BOAA 2R7FA 4OWRB 1PVEA 3L2QA 1BOBA 2QKMB 5HDNA 4FX4A 1A35A 4BQAA 3Q9SA 4L18B 1E2XA 3H5AA 1K6OA 1IC8A 1ON2A 2R7UA 5ICCA 3IUOA 2K5CA 2WADA 4X0GA 2Y30A 3FZVA 3HZJA 5CKTA 4DGWB 4ZYDA 4FE4A 5ED4A 3MKWB 3CZ6A 3A02A 4PGHA 3OR2C 3OYCA 2AO9A 1LQ1A 3VODA 2M3AA 1O3SA 1B8IB 1FTTA 4KN7X 1HXDA 2L7KA 2COMA 2W25A 3K4KA 3KP6A 4KUMA 3RQ4A 2ZJPF 3S16J 3SZTA 1YTYA 3HSEA 3K10A 3ZR8X 1R5GA 4LLLA 1E3HA 2DPUA 3DTEA 1S7EA 4D1QA 1G3TA 2OJED 4PJNA 2G7UA 2VBXA 4WWCA 1TL8A 2R5YB 1H89C 2FNPA 3LWFA 1L3LA 2EPFA 4E7ZA 2X1EA 2CU7A 2JN6A 3LSTA 3H3VK 4X1EA 2KIMA 1MBFA 4L9TA 1TW3A 5K5RA 2VXDA 1YJ9I 4ZYHA 4XKBA 5IOZA 4CCMA 1JKRC 4BKXA 3ULQB 3LQQA 5CQEA 3LSPA 1YLFA 2YUSA 4UB8C 2ECBA 3EUHA 2R93J 1HW2A 2V79A 1O3QA 1MMAA 4ZDOA 4M6XA 4MQ9F 2EZLA 2LF8A 1NHAA 3V8JA 4AUXA 1XGSA 2O5RA 1D1CA 1W36D 1IN5A 4FHTA 3OMYA 4U7BA 5DM6F 1UFMA 2O6GE 4P55A 4AVZA 1MSFC 1S8NA 2WB1N 3IC7A 4ESBA 2R7WA 2EA2A 4RB1A 3ABLH 4XLPF 2XSJC 3S8PA 2FBHA 5HDGA 3S93A 1XGOA 2XASA 1OCCH 2XB0X 1YITI 1U3EM 2L7ZA 2XF6A 3VB2A 5F0FA 3WODF 4UVAA 1D1AA 1TBXA 3S2WA 4IPAA 4EM1A 2GXAA 2ME6A 1ON1A 2HWVA 2B9SA 1U2WA 1FY7A 2UUZA 2KIUA 3DQVC 2Z9OA 1XSXA 1PP7U 3FXOA 4BDZA 2VE9A 1IV8A 4EMSA 4A3FJ 3K0LA 1W0UA 4ENKA 3QPLA 4PGGA 5J6XA 5F0CA 4AC0A 2H94A 4BQQA 1MDMA 2W7NA 1X58A 1RUNA 3GF2A 1Y1VJ 3A01B 1XCBA 1J2XA 2M34A 3FXUA 3ZMDA 2QQ9A 3SFIA 4D7MA 2MA3A 5KCMA 2PQ8A 1MMDA 1S72I 2FF4A 1GVJA 3GFIA 4CCLA 3HRUA 1OCTC 3G4SI 1TWGJ 4II2A 1MMSA 4NQWA 4O6JA 1OR7A 1B59A 1UCRA 2CQKA 2IGKA 4HG2A 4MQVA 1A36A 4F92B 3H9GA 4A3MJ 2CJJA 2HEOA 3AFHA 3WGIA 1I27A 3N4MA 4ASNA 4Q47A 1IRFA 2CQXA 3WTUC 3PFIA 4IEJA 1VQ5I 2R3SA 3BOQA 1VQLI 3M8FA 4EJOA 5JHUA 4KFCA 1M1EB 2BHYA 2XROA 4Q48A 4C30A 3AAFA 4X6AJ 1HKTA 2LBFB 4FX0A 3GFLA 3CJRB 3R60A 1G4DA 4IO9F 1X1BA 1IRZA 2RREA 2LLKA 4ESJA 1T95A 4B4CA 2E1CA 3KLNA 1S5LC 2Q8KA 1DGRM 3FWEA 1TZLA 2GLOA 2CQ7A 1YI2I 1YS7A 2EFNA 2LK2A 3SFZA 4HQMA 2DA2A 4I2OA 4HQEA 2E2JJ 1XMKA 5DCMA 4OIRF 1I3AA 5LGTA 4A0ZA 3J81Z 2E1MB 1USSA 2NNYA 2HZTA 1JHFA 2FOKA 3CLOA 5HLIA 5M5YJ 4RMNA 2IA1A 1IDZA 3RSNA 1FIPA 2CH0A 5DYMA 4QTRA 5JHFA 2R7RA 4O5VA 3R4KA 3I4PA 2VPRA 1ZLJA 3MMYB 4RGUA 2FOWA 1YHQI 4ZZLA 1O57A 2MFZA 1YRNB 3R6SA 3A1YA 1PDNC 1X1AA 2ZKZA 3GZNB 5ICFA 3J80Z 3HGYA 2R7XA 4M3BA 2KHMA 2ZBKA 2CFOA 3KP5A 4KIGA 1KQ0A 2LP0A 4B48A 4AYBA 2OCEA 3BPVA 4WXHA 2JZYA 2CW0F 3CUOA 3BR0A 3EPZA 2XDVA 4IZZA 4II3A 1U78A 5HS8A 1S9HA 2FA5A 3K4BA 3GX4X 4YEJA 3HM5A 1D0YA 3E6DA 2WC2A 1R4MB 1B72B 3HTSB 3FBIB 4A2UA 5J3LA 3I9V2 3A2KA 3K6GA 4LITA 3LAPA 1VFCA 1NG7A 3F3XA 3J7AY 3H0GJ 3HOVJ 4BH9A 1I1SA 2M9HA 5J8CA 1AKHB 2B0LA 1WJDA 1KU3A 2LF7A 4AIKA 3I4NJ 3RIRA 2OD5A 2OU2A 1A6QA 2L54A 1P7JA 1HBXG 5K1YA 4RLFA 3EUHC 2LKXA 5CVVA 1KONA 1SVLA 3QOEA 3BR3A 4HDUA 2FE3A 1WSUA 4WX9A 5C4XJ 2ELKA 2H6CA 4I7HA 3ERED 3OYNA 1Z7LA 4LB6B 5HLTA 1V54H 1ZRDA 2F2EA 2HYFA 4E7HA 2QA4I 1OFCX 4KMUX 2RNGA 5FB2A 3TL4X 3MZ8A 4YIIA 5IY5H 2PLYA 1ZGJA 2DDBA 5DUIA 2EB7A 3K4LA 4M6VA 1HW1A 4IHYA 4IXAA 3L2WA 2W57A 2HR3A 3G1LA 5H6QA 3LFKA 4CCKA 2LRDA 2FUG2 3JRGA 3MKZA 2VT2A 1BM9A 2OCCH 2P81A 3H5RA 1R1UA 3CO7C 2HQAA 4QPQA 3S3NA 2IS2A 1MH3A 5CVJA 5IOYA 4BBRJ 4M74A 1GXQA 3KYLA 1K7AA 2ME0A 3K4MA 4UB6C 3B6AA 2HQNA 1WFXA 2XRLA 3LSGA 3GTLJ 2JMWA 4RB3C 5E17F 1Z91A 3I58A 3BTJA 1K4SA 5HLGA 3HJEA 2NVYJ 2NXNB 1L0OC 2Z33A 1OJLA 2DOAA 5EZHA 5HDKA 1YW9A 2LOOA 2ZB9A 3CCYA 4DBQA 3HPGA 1JGGA 2OTLI 5EG0A 2GWRA 2F4IA 5FLXZ 4A3IJ 4L9VA 3GTJJ 4BACA 3HDDA 1TWAJ 2DBBA 3ZMZA 1WI3A 4MO7A 5FKKA 3JRFA 1W0TA 2K3PA 3WU2C 3KP3A 2STWA 5GAHJ 1JKPC 1RKWA 2MYSA 5IPAA 3GTOJ 3HOSA 2Z1DA 3BROA 4NC7A 2K86A 1D5YA 5KVRA 1FYKA 1BIBA 5FD6A 3WTTC 1E0EA 2NS8A 4KISA 4HEA2 1BBYA 2VKHA 4HOBA 5D6EA 2GQQA 1X4PA 2GOXB 2XPUA 3W6JB 4XRSG 3E6CC 1KZHA 2IS6A 1WWXA 4ABZA 3MD2A 2ZSHB 5DV5A 3OIPA 1VQPI 2NAZA 1HLVA 4J01A 3H92A 2RQPA 4CGZA 2EWNA 3HOXJ 1ITYA 3EUKL 1X3WB 2QEXI 3DKXA 2M30A 2DFFA 1LVAA 5AIPA 2OZUA 5J47A 4ON0A 1IN8A 2IGNA 4XK4A 3TO6A 4GO1A 2BEOA 4XLNF 3I5UA 3BR2A 3QQAA 4CYCB 3P9KA 4ZYGA 1VQ9I 3U2RA 2LDUA 1J75A 1SAXA 3M7GA 3OV8A 1YX5A 2X6YA 4CZZA 2UWMA 2WB1A 4EGYA 5D8LB 4GGGA 2XGEA 4BUPA 1EV7A 2HTSA 2R5ZB 1QQIA 1PP8F 1W36C 1O3RA 2A5WA 3O3KA 2DXIA 4L9NA 4KIBA 5B66C 2R92J 2R7VA 3PIOF 4I0BA 3ERMA 3EYYA 4UVBA 2RN7A 3QU6A 3B73A 3CMMA 3QPSA 4WF2A 5BPIA 3M3YJ 3S14J 3V7SA 2ADUA 1PUFB 3RPQA 1XN7A 2BHZA 1T98A 2KJCA 2W85A 2NYXA 3DPTA 3FISA 4IL6C 1QVTA 2CMPA 1ZRCA 1NTCA 2CS3A 3GZ5A 1FBUA 1B6AA 3L2CA 2VE8A 1AHDP 4M3GA 3Q0UA 1U5TB 4E7LA 1CGPA 2OC6A 3I59A 4DZJA 1TWHJ 3LA2A 1Z3XA 2AHQA 2R7DA 2DMUA 1J9IA 3DV8A 5BNGA 1QBJA 1JT6A 4HPQA 1POGA 4IVNA 4FCYA 4A3EJ 5E1XA 2JUCA 2ID6A 3W6VA 3MCZA 1DGWY 3C18A 3BQZA 1UG0A 3LOCA 3H3ZA 1X3ZB 3MVPA 4BEHB 1XD7A 4PCQA 2KQRA 2F4MB 2ACJA 5KAIC 2DO7A 1TQPA 5B1BH 4LGWA 2DFEA 1F36A 5HNFA 3NARA 1R1TA 2R4GA 3QWLA 3ZCOA 4LG0B 3IH4A 2E5NA 1ETKA 2HS5A 2KMUA 3DLLF 3RKQA 1X2NA 4B44A 3SZGA 5E1WA 4A5NA 3H35A 4V2GA 3KETA 4L0ZB 1VNDA 3GTKJ 1U8BA 3HL2A 2X6OA 2KIFA 4YFXF 1SD5A 3G1MA 4HF0A 4WXDA 3ZQGA 2W00A 4AVPA 4CA0A 4RAGA 5J40A 3L09A 2O9LA 3NEUA 5FFXA 2L3DA 1Z7UA 4A93J 2DMNA 2ZXIA 2Q2EA 4I6ZA 4E7KA 1ZKGA 4E7SA 2KPMA 2E5ZA 4HLXA 5CVRA 3Q0WA 1KU7A 4XIDA 3LQRA 1GHCA 1B9MA 5JLWA 2IA2A 3DKWA 5L3BA 2IXSA 4RLQA 2VL8A 4M9ZA 3HSFA 3I55I 2JWTA 4BE1A 3OOUA 4AWXB 1BL0A 1EA3A 4KMFA 4XLHA 2E7XA 4BHBA 3RYRA 4XKVA 2NS0A 4BJTA 2BOLA 4R79A 3OY9A 3BPXA 3BJOA 2CUEA 4ZDPA 1OYIA 2BVMA 1QPMA 2K9QA 3G3ZA 4PFOA 1USTA 2LG4A 2DT6A 1HKSA 3OYLA 2XAHA 2RQQA 2OTJI 1XDUA 4KYWA 2RVCA 3WU1B 1XGNA 4KT6A 2VBYA 3K2AA 2JSPA 2FRHA 4CZCA 3M4OJ 2D2WA 4LIUA 5FGMA 5EEGA 2VQCA 3IKTA 2XIGA 1P2FA 1WRJA 4RGSA 4E6KG 1WJFA 4B3XA 3CCMI 1UHSA 3WU0A 2ESHA 1QZEA 2CW7A 2RC4A 4JQFA 2PEXA 1P92A 3OYMA 2LVSA 1QGPA 1JXSA 1SFXA 3LSRA 2MH9A 3GUDA 3DLAA 2LKPA 3GWZA 5FKMA 1RETA 4Y13A 1Y8RB 2HVSA 1VQ7I 2BY1A 3L2RA 5LEKA 1MIJA 2DFHA 2YSRA 4C2UA 4O3MA 3BTIA 2L5QA 4I02A 5BPDA 1OMIA 3HUGA 4IRHA 2VI6A 4CO8A 1KA8A 1VF9A 2IT0A 2DT5A 4HAMA 2V9KA 3ECOA 5BMZA 2DA1A 3BTCA 2HYJA 4BAYA 1NG6A 2H1KA 3BR5A 1FX7A 2VC0A 2ELHA 3E6BA 5D5XB 2NS7A 4QPOA 3K1MA 1KGSA 3BLYA 1F1ZA 5FKLA 4DYQA 5IT9Z 2LNBA 5BS6A 1W7PA 2KKOA 2DMQA 1BC8C 2JK3A 3BT9A 2PJPA 2O8XA 4AIDA 3HSRA 2JQ7A 1T08B 2M0CA 3JRHA 3BG5A 3GEZA 3F21A 1H9GA 2KRHA 3E5UA 2W4SA 1BA5A 4LFUA 3PSIA 2FSWA 1R00A 2L0KA 4C3IJ 2XV4S 5E3OA 4MFDA 4IX7A 1J09A 4MGRA 4U7DA 3I64A 4M73A 3DBHB 2H1LA 2M7BA 1RUOA 4PZJA 1ZREA 3V8KA 1OYWA 4XLCA 4MEYF 3IAM2 2ZXWH 2I5UA 3IRRA 4Y7NJ 1K78A 1N78A 1LDJA 3CMAI 4YELA 4BHPA 2RKHA 2Y69H 1ZRFA 3DU6A 2O3FA 3FXQA 1SANA 1APLC 1YO5C 5GAEJ 2IGMA 3F8MA 5GADJ 4GDFA 4ENJA 3UR3C 1G3SA 2IP2A 5JVGF 1O3TA 2ETHA 1CQTA 4HBLA 4BY1J 1MBJA 4UUSB 1T33A 1X4OA 2JA8J 1FOXA 4E7IA 2IW5A 2QKLB 1ACIA 4XKCA 4F55A 1YS6A 4JYKA 4BBSJ 1K83J 2F4OB 4NC6A 2UZKA 4CUGA 1VQMI 2PG4A 2Z2SB 3CF5F 2CFXA 3ZGKA 1MNDA 3AG3H 2EK5A 3F8FA 4QIWN 3FDYA 2X1DA 3UKGA 4RDUA 2YPRA 3QOPA 2XAGA 1Z67A 4BQOA 5M5XJ 4KJZA 2DODA 1V55H 2M0MA 2YS9A 2GM4A 1T0FC 1AU7A 3RYPA 1LEAA 3QYBA 2BY0A 4ZYAA 2HOEA 2IRFG 4EQQA 4EM0B 5GPAA 5E3MA 2RGVA 2NVUB 2DU9A 3RPUA 2W1OA 3HEFA 1RIOH 1ZQ3P 1MBHA 5DTDA 2PMZN 2CQNA 2Y9YA 3K2ZA 3E7LA 3SXYA 2XC7A 1IUFA 5JLXA 4P96A 3OYFA 4F3QA 4BHCA 1EJ9A 2FBIA 3N97A 1LFUP 2L9NA 4XLFA 2K3FA 1XB4A 3TQNA 1ZAOA 4ZC3A 3CCLI 2MSYA 4E4HA 2VOPA 2E1NA 2L4AA 2ZFUA 1IN7A 3GMEA 3WE3A 4B8XA 5GP9A 3E3VA 4FISA 4BQNA 4A3GJ 2H27A 3S2HJ 1VZ0A 4Y3OA 2KZGA 2KT0A 2CYYA 1KU9A 2D1HA 4U0WA 1FLIA 3KYDB 4XNFA 2FD5A 1YJNI 2ZXHA 1ZR2A 1T8IA 3TEDA 2L9VA 2UV1A 4JBAA 1FP1D 2Z3YA 1E17A 3WTXC 2IGOA 1WQ2A 5D5VB 4Y52J 2G0EA 4NUBA 4C2TA 4G8XA 2LFBA 3K4JA 1SMTA 3L00A 1ZYRF 4PJ0C 3LSHA 1ETYA 1SMYF 3ZMUA 2ZXJA 3Q3SA 1MNEA 2ZMEA 1SVMA 1RC9A 1FC3A 4MHGA 1U9NA 2HTJA 3K7AJ 3S1NJ 5B3SH 1D0ZA 1Y39A 2QQAA 3MQ0A 2EV0A 3QYEA 1BJAA 4HF2A 3F6OA 4AIJA 3BC8A 3QPTA 2E34A 1SAUA 2RAEA 3HKZA 2L02A 4FTHA 3S1MJ 1MMNA 5L3EA 2EJRA 2E1MC 3H9JA 2L7FP 5L3FA 1IW7F 3L2VA 1LNWA 3CC7I 1DU6A 6PAXA 2VKDA 3CCSI 4BE2A 1K61A 1MJBA 1XTAA 3FXJA 1V3FA 2JRTA 1UAAA 4G12A 2ZSIB 4PFPA 4UHTA 1X2MA 1O7FA 3A03A 4XRMA 3DPUA 1GUUA 3ASOH 2HQ5A 2WBMA 3O2PE 4F93B 3MAJA 4IQ4A 4IHSA 2CV1A 4OIPF 2F5VA 3LSIA 1JKQC 1J59A 1OISA 2DOFA 3I71A 4FASD 2X1CA 1KU2A 3U1KA 3OS2A 1B1BA 4DJAA 2RDPA 3ZQ7A 2KRFA 4LJZF 4QSHA 3HOZJ 4B3AA 4HX7A 3DP7A 4PJJA 5CVIA 1TP4A 3CUQB 4NC8A 2XVCA 1GV5A 1LFPA 4UY8I 3S3OA 3PUFA 5JFRA 4R1HA 3GBGA 1MNMC 2KLOA 4Y15A 5HLHA 2E7WA 3F8NA 2KP6A 3RZOJ 2QZ8A 1UHWA 2IEKA 4Q5SF 2VIXA 4KT5C 4RAFA 5M3FJ 1PUEE 2DN0A 5E1ZB 3OYIA 3CJQB 4IHTA 5FRMA 3LSMA 2FJ1A 3NWTA 1SC7A 2Y75A 2EZKA 3MWMA 3DFGA 4XOTA 5LGNA 3FKJA 3TOAA 5JVTA 3OYDA 1PUFA 1H88C 2CW8A 3ABKH 3PQKA 4OU0A 1H9TA 3U1DA 2XKOA 2VJJA 3TW6A 2LSOA 3QP6A 3KPHA 1FBSA 2IBDA 4IHWA 3CDIA 3LA7A 2WA0A 5FRNA 1WJ5A 2BE5F 3F9KA 2HQRA 5EEHA 1IGNA 3GTPJ 2CV2A 1W7PB 3S1RJ 2DPDA 3HOUJ 2N8GA 2KDZA 3K1PA 2F5EA 5EF6A 2V4JC 1VQ6I 3KFWX 3CF2A 1Y8QB 2HFHA 2O61A 1ETOA 1RRJA 1VTNC 3GTMJ 2QQBA 4E70A 3AG1H 2L7MP 2V1NA 4OOIA 4B1RA 5D8KB 4IOCF 3V4GA 3F23A 3HUGB 3OSGA 3BG7A 2K85A 1QNTA 1W5TA 1WH7A 3KZYA 3PUBA 4CYDA 1DUXC 4CYCA 2EINH 1JHHA 1J5YA 3OL3A 1AWCA 3ABTA 2FQ3A 5E8IA 1UJ8A 2VQGA 3DU5A 4BU2A 5LHHA 5ILUA 2E36A 2HYGD 3RKXA 3M8JA 3E6MA 3MEXA 5F64A 1TTYA 1ETVA 1EF4A 3WTZA 1YYVA 5EDNA 5FLXK 2MABA 2M8GX 3J7ZI 3HHGA 1WI9A 3M07A 2DA4A 2CUFA 2QYOA 2YU9J 3ML6A 1MKMA 3TDUC 3CD6I 3NRVA 4HYEA 3BTLA 2NRAC 4RAZA 3HGGA 1P4XA 4NBQA 5F0HA 5H20A 1Y1WJ 2JVHA 1R5ID 3BJ6A 1D3YA 2R7TA 5DUKA 1WJAA 4ENMA 3AL0B 2E19A 3H1CA 4BL0B 3F6VA 3DTKA 9ANTA 3ISPA 1OR7C 3RDIA 5IYDJ 2XPWA 5CPRB 2M4GA 2YR2A 3JRIA 2XRNA 3NAUA 1FOKA 4D9JA 4JP0A 1N75A 2L9SA 2M2EA 5ERIA 2MG4A 5K5OA 1XGMA 4BS9A 2WV1A 3RQIA 4DQ2A 2VKEA 4Q4ZF 2EFPA 1HDPA 1HKQA 5A2QK 4PK4A 1RKTA 1IN6A 2YX4A 1DQUA 5EG0B 2LTPA 1BR2A 4D5FA 5K7HA 2BVLA 4CICA 2GA2A 2VPLA 2F6CA 1FP2A 3L2UA 3P7NA 2OBPA 3NWSA 2PJRB 3QU3A 2XF5A 2M8EA 4XR6A 1Z21A 1FMWA 3EYIA 5EGOB 1YIJI 2CO5A 2A69F 3TP3A 5JR3A 2HVRA 1KQ9A 3JREA 4H0EA 2MD5A 4CSWA 2OA4A 1ETXA 1JUSA 2DW4A 2JSCA 5GTHC 3AG2H 1MBEA 2A68F 3SHFA 2DA6A 1XSDA 5D4RA 5FLMJ 3GLLA 3RZDJ 2WAEA 1S29A 5E3LA 3D5SC 1DP7P 4OINF 1R22A 4UXNA 3ZQIA 5FJ8J 3CLQA 1ORKA 3SEZA 2HOSA 3E0JB 3MZYA 1PJRA 2EILH 1TW2A 3VYTB 1CF7A 2LY9A 2L2OA 2E1OA 4KIFA 1REPC 2JVGA 4LG0A 3JTGA 2V6CA 1A04A 4LK1F 1HC8A 3OSFA 2P8TA 2VB6A 3R0AA 2BY2A 5FKNA 1LB2A 1MMGA 3CJTB 4BEHA 1FEXA 5GAGJ 3TKYA 2QBYA 1PYVA 1Y0NA 2XKPA 3HG9A 1T0FA 4YFNF 1SFUA 2LH9A 2E2HJ 2D45A 4MNUA 1Y0UA 2CSOA 2KDOA 1LDDA 1NK3P 2FQ4A 2K9LA 2GA1A 3JRDA 2GIZA 4L5EA 1A5JA 1GLNA 2HPIA 2V9VA 3DBLB 4ETSA 1GVDA 3ZOBA 1N77A 1IXSB 4YRVA 1AKHA 2FU4A 2LY1A 3K4CA 1LE8B 1IXRC 1YIOA 3OIQA 1F43A 2V7FA 2VQHA 1YW7A 4LB5A 3PO3J 4EM2A 2ID3A 2DT7B 2QLZA 4BY7J 3RPUD 3T5XA 1JTYA 2EIKH 2STTA 4GFBA 1Z77A 2O0YA 4IHVA 1B72A 4IKFA 5LGUA 2DTRA 2HXIA 4J00A 1BI2A 4FT8A 3N05A 4M3EA 4N4OB 3HOTA 4A5MA 2EQRA 1FSHA 2TCTA 4OAYA 3CCQI 3FM5A 4DYRA 3HB9A 3ZQHA 1CF7B 1LPQA 3T0YA 1TQIA 4HV6A 4ZYEA 2L01A 3PSFA 1AOYA 4KICA 3PQJA 2JA2A 3EDPA 2JA6J 2A6HF 1G3YA 4HLYA 4F91B 1YRNA 1OKRA 1STZA 4DIQA 3GW2A 3WHCA 1G2HA 3ABMH 2MBFA 1V5FA 2QM3A 2QSFX 3QP5A 1SD4A 2KJBA 2OV7A 3BWGA 2K40A 1QHHD 1FT9A 4W1UA 4C2MJ 4WXCA 3MKLA 2PFBA 1RR8C 4FQGA 4HZFA 4I01A 3H3UA 3ZMSA 3VPRA 1VQNI 5IT3A 1U6GA 2LY2A 4PJMA 3VYSB 2NOGA 4BDYA 2VODA 5HOOA 5DCMB 3H0DA 3CCJI 3ZQQA 2E60A 5DCFA 3F22A 4K2EA 2XAQA 3CC4I 3VSLA 4L0YB 5D5UB 4V19K 3O8GA 3IP4B 4QLCU 1O4XA 3FHZA 1XCVA 5FFZA 1ZGWA 1QPIA 3K1NA 5FO5A 1QZYA 5KNLA 4U88A 3BZKA 4F52A 1GDTA 5J1YA 1HDDC 3K69A 4BJ5C 5DD8A 4KN4X 5LEJA 1P7IA 2JT1A 4RGRA 1BN5A 4AYBN 1JT0A 1W7PD 5KHDA 2PI0A 2YX7A 5TJJA 4AU7A 2J5PA 5C4JJ 2MLKA 3BP8A 1IXCA 3CMEI 3PJRA 5CQGA 4Y17A 1IO2A 3HRTA 4XOPA 2PMZA 3TP0A 1S7AA 5F6FA 2A61A 3KZZA 2ZFWA 1R49A 3HBLA 1I39A 1B4AA 4A3LJ 3M1CA 3I0TA 3JR9A 3C7JA 3DPLC 2BYVE 3A01A 1ENHA 3KYCB 4BGDA 2BY3A 3REOA 2JRMA 1JKOC 2GIVA 3P9CA 3GTGJ 5LHIA 5D4SA 3HPHA 1MDMB 3CCVI 2R7QA 1EKEA 1MJAA 1W1WE 1QO0D 1MBGA 5EEAA 2IS1A 2K02A 4XQFA 1LJ9A 1D5VA 2Y48A 1R23A 3ZXSA 4MTEA 2EV6A 3S32A 2HU9A 3IH2A 5JI6A 2B7EA 2VC1A 1WCMJ 3CTAA 5IP6A 1U8RA 2EZIA 2WAQN 2CG4A 1R36A 2XAFA 2PN6A 1ZARA 3SDGA 3CC2I 2BZTA 2OF7A 5J1UA 2IPQX 1LDKB 4I0AA 1H8AC 4EV0A 4YIRX 2OQGA 3E5QA 5D5WB 2EH3A 3CCEI 2EA4A 3PL8A 2X9DA 3WG7H 3S3MA 2I8DA 4OIOF 4A3DJ 1BR4A 2VBWA 1JGSA 2EFQA 2X48A 4C3HJ 5L3CA 1TC3C 1YOVB 3KIOA 2DI3A 2P5LC 5LRSA 2HDCA 3UNGC 2Z99A 3IKVA 4XLEA 2HDDA 1WJCA 1LE8A 2K4JA 1MH4A 2LYCA 1QZZA 4XL9A 3NQOA 3E1SA 3K70C 2E35A 1YG2A 5ILVA 4XN0A 1WPKA 4JOMA 1Z0XA 3Q9VA 1SD7A 5A2QZ 5K7FA 1IRGA 4LG3A 2OPTA 2XHKA 3GXOA 3JRAA 1TT0A 3V7RA 3L9FA 3J81K 1HSTA 2F5CA 2QBYB 1ERDA 3DWLE 2CGPA 4Y33A 1BR1A 2DCEA 2YU3A 4U87A 4UV8A 1I6XA 4M3DA 2X4HA 2UXXA 2QVOA 5B5EC 2CWEA 5HS7A 4A3CJ 1D8JA 1R1VA 4A6EA 3A4CA 4B09A 1OCPA 2ZNZA 5J4YA 3JSPA 4UV9A 4G7HF 3T8RA 1TNSA 4A3KJ 1I50J 4ZZDA 4XBFA 2B63J 1ZTRA 5F08A 3DEWA 3C2BA 3MFKA 2NVTJ 3J80K 1ZHFA 1H0MA 4RA2A 5FD5A 4C3JJ 2K9MA 1IN4A 2X6WA 2ISZA 4XSXF 4YG2F 2MC4A 1T2KA 2QSHX 5ICEA 1Z9CA 5EGOA 2EBIA 2OUMA 1T38A 1K6YA 2FXAA 4EJUA 3SZPA 3BG3A 2PJRA 1Z6RA 4MIMA 4ZH4F 4KITB 1GV2A 3WTVC 2BGCA 3WGHA 2PX9A 2XGCA 3ONQA 4NDLA 2A6TA 5LLQA 1BI0A 1R5HA 4KNYA 3OYGA 3FK7A 2CRGA 4P1WA 2Y0SA 3BR1A 4N9HA 4D7NA 2VXZA 4E7JA 4RM2A 1DDNA 1MD0A 2K4BA 3HXLA 1IJWC 1P6RA 3FF5A 2EZHA 3FKIJ 3JAMK 1X1DA 4YIFA 2CV0A 3CCUI 3V42A 3J7YJ 2XGXA 3TO7A 3JSOA 4M9XA 3VOEA 1LFBA 3BZ6A 2X51A 4EGZA 3G2BA 3X2QH 1YX3A 3ELKA 2EIMH 2HKXA 5FKOA 2WY8Q 2IS4A 1HQCA 4G7ZF 1G59A 2HPMA 1HCRA 4HNTA 4RM3A 3CDLA 1UMQA 4ITVA 2VKVA 4XSZF 3O8HA 3VDXA 3H9QA 3DBRB 4RAYA 3IH3A 2GBYA 3B02A 4I09A 1TT5B 1NH3A 4M71A 3AG4H 3GTQJ 3L7WA 4BYYA 4M6YA 2W84A 2A05A 2DQRA 3M1EA 4HW0A 2QWWA 4BXUA 1ZG3A 2MGQA 3KZIC 2H8RA 4RS8A 4Z2YA 1JUMA 3C3WA 1ZN2A 1HA8A 1P4AA 4XLAA 4IQJA 3F8CA 1A31A 3WE2A 2JJ7A 1QRYA 3HRSA 4A0YA 5K7ZA 2W48A 3JW4A 1U9OA 4ZTFA 4BXXJ 4EJWA 2PMHA 2ESNA 2Z5UA 2TRTA 3OS0A 1W4MA 2LR8A 5LRRA 5BOXA 4M9SA 5E8GA 2XPVA 3W2WA 4AIHA 4L5IA 3SQNA 3FMSA 4F7ZA 4EJVA 4ENNA 2L9RA 1YE9A 3K4NA 4N4NB 1LKXA 1ETWA 1Q1HA 1YFHA 4N0BA 3BJAA 4UNOA 2NVQJ 2GAUA 2DDAA 2GOMA 2P5VA 1W5SA 4BJ6C 1FOYA 1S3JA 3CP8A 3I53A 2I10A 2V26A 1LVKA 4UUSA 2JA7J 4RB2C 4C9YA 5IP9J 2LMDA 4WCGA 2CQQA 3L1PA 5TGTA 2ELJA 1BIAA 5AONA 2BV6A 4JX5A 1XMXA 3ECHA 3DTIA 1IZ1A 2LD5A 1JI8A 1K4TA 3A0HC 3HIFA 4IRGA 1HF0A 3CJNA 3LFUA 3TO9A 3VYRB 4JX4A 2PBIA 3CUQA 4MFEA 2X0LA 1IV6A 1VI0A 1IDYA 1OCRH 3QODA 3S1QJ 5DM7F 5IYBJ 1RESA 1EH7A 2WY7Q 2HVQA 3HTUA 3ZMVA 3D5RC 3I54A 4CXFA 1R7JA 3FXKA 2VONA 1FTZA 2R5YA 5F1RA 2VJIA 3PM1A 4EEFG 1TQMA 3TDZC 2WWYA 2RV8A 1Z05A 4LD5A 2HOTA 4LLGF 4LK0F 2E71A 4GXOA 2WAFA 5HODA 1FMVA 1WJEA 1TNTA 2O7OA 5H6RA 4XM3A 2Y9ZA 1MZBA 1B8IA 2DA5A 1WHUA 4L5JA 5TRDA 1HOMA 3GZ6A 1U0JA 4P5OA 4OIQF 4P9FA 1J0RA 3K9TA 1BW6A 2P6TA 2QSGX 2R7SA 2H6BA 3ROUA 2KL4A 2ZJRF 1GXPA 1XC5A 4W97A 4A69C 3WTYC 1P4WA 5L3GA 1ZK8A 2XGDA 4S05A 1OCOH 4GYGA 2MW8A 3VYUB 4JX6A 3KX2A 3W6KB 3DCFA 4PUSA 3IAS2 3CUQC 1J7KA 2GZWA 3BQYA 4OAZA 2ZMEB 4S04A 2M87A 1XPXA 1RI7A 1HW5A 3RKWA 5HS9A 1ZG1A 4G6DA 1BI3A 5E79C 2CUJA 3WTWC 2IAIA 3CESA 4LMYA 4PJLA 5E18F 1ZG5A 5DD4A 1T39A 1IUYA 3SJMA 3GO5A 3KP7A 4HSTA 1UG2A 4V2FA 4MLOA 3OYHA 2BW3A 2Y2ZA 1ZELA 3OL4A 3ZRGA 1B9NA 5IP7J 1SEUA 4HF1A 1R58A 5C44J 4CDGA 3RTRA 3H5NA 2NVXJ 2M1BA 2R7OA 2EIJH 2VUMJ 3ESWB 5F27A 3FBNB 3HYIA 3TW7A 2E2IJ 1OLTA 4RB0A 3E5XA 2VJ5A 1MBKA 3F8BA 2BXZA 2DFIA 1AA7A 1FYMA 3FIWA 2IVMA 2ZJ2A 4GRIA 1FNNA 3ZN1A 1TWFJ 3BZCA 2D5VA 1N25A 2UXNA 2V1XA 3M8EA 2G7HA 1BW5A 2MC3A 2K9NA 4RGXA 3PIPF 5GTIC 5DDGA 4XMYA 5FLVA 3Q5FA 2XF7A 4PSXA 4CCNA 3R0JA 4XONA 2VOOA 4A3JJ 2M4KA 3EQLF 5CVUA 4TV7A 5C3EJ 3JRCA 4IOAF 3IHUA 1RZ4A 2Q2EB 1Y56A 3EETA 3LSKA 2VLAA 1WH5A 1S7OA 2HKOA 2KFDA 5IT9K 2EV5A 3KEOA 1I5ZA 1DP3A 5IYCJ 3HRMA 2JA5J 4D5CA 3OOPA 1MW7A 2F48A 3E97A 4CHUA 3D0SA 2XUBA 4UVCA 3AKZA 3C1DA 2OZ6A 2M7AA 3R61A 3WHBA 3G6EI 3KP2A 4MTDA 2IA0A 1WGXA 3OR1C 1UZCA 5LHGA 4HA8A 1UELB 1T6SA 2L4MA 1G6NA 1FYLA 4IRIA 1EH8A 1ULYA 5KAFC 3RI4A 1D0XA 2C6YA 2HOAA 4MEXF 3BCBA 2BXYA 3IWFA 1X3UA 4U0YA 3S15J 3FX3A 3H36A 1QU3A 4I99C 4XICA 4JK1X 1K78B 3OYBA 1FWZA 1I6HJ 3FXMA 4XN3A 4KDPA 3KCCA 2ZCWA 1OCZH 1IRXA 1V5GA 3I59B 2HNHA 1O7LA 1U5TA 3FM3A 1D8KA 1QA6A 3TBIA 3GLXA 1F9NA 3P5JA 1ODDA 2DQLA 3IL2A 4CCJA 2VN2A 2EFOA 1X1CA 2JPCA 2GXGA 5LFAA 2QUFA 3GFJA 1BJZA 1Q1VA 2ICWG 5F1JA 5DEQA 1FPQA 1G3WA 3LL7A 3U21A 1WZ2A 2OAZA 1X19A 3K70D 2JTVA 1R71A 3QAHA 1VQ4I 3GFMA 1WVRA 3W2VA 3AL0C 2RNJA 3QYFA 1JJ8C 5LBQA 3HHHA 1K79A 5H2FC 4J19A 2DJIA 3CMYA 3J7AO 1KYWA 2R5ZA 1F5TA 3MN2A 5TISC 3QRFF 3S2DJ 3MKYB 2R0QC 2DA7A 3BY6A 1XSVA 2KRCA 2M5WA 4G94A 4AD9A 2QGUA 1Z6TA 4IF4A 2VT3A 4G6QA 5F04A 1VQKI 1OYYA 2EFWA 4DW6A 4HRIA 4RBOA 1FZPB 3LMMA 1FIAA 3BCAA 3CDHA 2V1UA 1SFKA 2HDWA 2W82A 3KEYA 3ZP5A 2Y0SN 3A0BC 3G73A 5KK1A 5FROA 1SFEA 1JE8A 3TGNA 1ZR4A 1EH6A 3C2GA 4PSWA 3SEQA 1JJ6C 2ZMEC 3LA3A 1I3QJ 2FMYA 2DA3A 2FNAA 2KISA 2DLLA 5GPCA 1E3PA 3BG6A 2A5YB 2DJNA 2QF7A 2ZO4A 3I3LA 3PNTA 4NHJA 1DPUA 1ZLKA 2Q1ZB 5BQTA 1VQOI 1VQ8I 3KP4A 3MZHA 1MJ9A
chains in the Genus database with same CATH topology
1MH4A 1LFUP 3HGYA 4M3BA 3BR6A 4HNVA 4S0HB 1WPKA 2LP0A 2MSYA 1Z0XA 2QCOA 5GP9A 4FISA 5K7FA 4A3GJ 3S2HJ 2OPTA 3BR0A 3JRAA 2KT0A 1U78A 3LNQA 3HM5A 2FD5A 1ZR2A 1B72B 5E3NA 3TEDA 4M3DA 5J3LA 4A3CJ 3LSJA 1OCPA 4Y52J 3CQZJ 2G0EA 1VFCA 2O8KA 3H0GJ 3HOVJ 4A3KJ 1I50J 3HOWJ 2LFBA 2M9HA 1AKHB 2B63J 1ETYA 1ZTRA 3Q3SA 5F08A 3DEWA 3C2BA 4UUTA 3D1NI 2NVTJ 3I4NJ 1U9NA 3S1NJ 3K7AJ 4C3JJ 1P7JA 2LKXA 3BR3A 4FE7A 2RAEA 3S1MJ 4FTHA 2R7ZJ 1FJLA 5C4XJ 2ELKA 2HI3A 1RPWA 2L7FP 2DTZA 5EGOA 1DU6A 2EBIA 3BG3A 1K61A 4MIMA 1OFCX 1GV2A 1A6IA 2XGCA 4NDLA 4G12A 3OIOA 1X2MA 4M6VA 4M3FA 4IHYA 3FK7A 2CRGA 3BG9A 3A03A 4XRMA 3ZQFA 3G1LA 3Q0VA 1GUUA 3JRGA 2HQ5A 3BR1A 2XB5A 4D7NA 2P81A 5J1RA 1MH3A 5IOYA 1JKQC 1IJWC 4I76A 2K9SA 4BBRJ 2EZHA 3FKIJ 4A3BJ 1XS9A 2ME0A 3B6AA 1GT0C 2XRLA 3LSGA 3GTLJ 3IV5A 2JMWA 3HOZJ 4QSHA 3BTJA 4B3AA 3G1OA 1LFBA 2NVYJ 1OJLA 5EZHA 1TWCJ 1QVUA 1GV5A 2ZB9A 3CCYA 2ECCA 1JGGA 5EG0A 3GBGA 1MNMC 5FKOA 4A3IJ 3GTJJ 2Y31A 1HCRA 1R9TJ 3HDDA 1TWAJ 2IEKA 1WI3A 3CDLA 4MO7A 5FKKA 3B6CA 1UMQA 5M3FJ 2VKVA 3JRFA 3O8HA 1W0TA 2DN0A 3IH3A 2GBYA 3S17J 2FJ1A 1JKPC 1RKWA 3GTOJ 5IPAA 4IHXA 2EZKA 2FX0A 3GTQJ 1PUFA 1D5YA 1H88C 2NS8A 3TW6A 1MSEC 1E3OC 2MGQA 2H8RA 2IBDA 5EZGA 4IHWA 3RZOJ 1JUMA 4DZPA 2XPUA 4XRSG 4ABZA 3F0CA 1IGNA 3GTPJ 4XRSA 2JJ7A 1SFOJ 1QRYA 5K7ZA 2W48A 3S1RJ 1U9OA 4BXXJ 1HLVA 2N8GA 2KDZA 3HOUJ 2DMTA 5EF6A 3I4MJ 3HOXJ 1ITYA 2TRTA 2LR8A 3ZQLA 1ETOA 1JTXA 2XPVA 3GTMJ 2L7MP 4B1RA 2L9RA 4XK4A 3OSGA 1ETWA 1WH7A 3BR2A 3QQAA 4CYCB 2NVQJ 4CYCA 5M3MJ 2I10A 4UUSA 2JA7J 5IP9J 3FK6A 3L1PA 2CQQA 3HKZN 2XGEA 1ETVA 2R5ZB 1EF4A 4JX5A 5M5WJ 2LD5A 5EDNA 2M8GX 1HF0A 2R92J 2DA4A 3HOYJ 2CUFA 4JX4A 2YU9J 4MFEA 1IV6A 3BTLA 1VI0A 3HGGA 3QPSA 5F0HA 1IDYA 1Y1WJ 3S1QJ 1NK2P 3M3YJ 3S14J 5IYBJ 1RESA 2E19A 5EYRA 9ANTA 1PUFB 5IYDJ 2XPWA 3JRBA 3FISA 3JRIA 1DU0A 1QVTA 1FTZA 3NAUA 1NTCA 1IG7A 2R5YA 4JP0A 3PM1A 4EEFG 1AHDP 4M3GA 2M2EA 3Q0UA 2MG4A 2HOTA 4DZJA 1TWHJ 2WV1A 1XG1A 2AHQA 3RQIA 2DMUA 2VKEA 5BNGA 1HDPA 2DMPA 1JT6A 1RKTA 1POGA 5HODA 4FCYA 4A3EJ 5EG0B 2ID6A 2LTPA 3W6VA 2O7OA 4D5FA 5K7HA 2COBA 2HXOA 3BQZA 2Y9ZA 1ETQA 3LOCA 5DS9A 1B8IA 2DA5A 3MVPA 4DYCA 2XSDC 1HOMA 1RR7A 1BW6A 1F36A 5EGOB 3ZQCA 3NARA 3TP3A 4LOCA 3JREA 3IH4A 1T56A 3PO2J 1XC5A 1ETKA 1ETXA 1JUSA 4W97A 1JUPA 4A69C 3RKQA 1X2NA 1MBEA 1ZK8A 2XGDA 2MW8A 2DA6A 4JX6A 4V2GA 5FLMJ 3DCFA 3RZDJ 5E3LA 1VNDA 3BQYA 1U8BA 3GTKJ 2X6OA 3ZQIA 5FJ8J 1IC8A 3G1MA 3ZQGA 1ORKA 2HOSA 2IAIA 2LY9A 2Y30A 2E1OA 3SJMA 2O9LA 4FE4A 4V2FA 1UG2A 4MLOA 4A93J 3OSFA 2DMNA 3A02A 4I6ZA 2Y2ZA 5FKNA 2AO9A 1FEXA 1ZKGA 5IP7J 1B8IB 1FTTA 3Q0WA 4XIDA 3S16J 5C44J 2E2HJ 5JLWA 1NK3P 1S7EA 2FQ4A 2NVXJ 3JRDA 2VUMJ 4L5EA 5F27A 2E2IJ 2JWTA 3TW7A 1A5JA 3OOUA 1BL0A 1MBKA 1GVDA 3ZOBA 2R5YB 1H89C 1AKHA 3FIWA 1F43A 1LE8B 1TWFJ 2D5VA 3PO3J 2CUEA 2CU7A 2JN6A 1BW5A 2ID3A 2K9NA 3H3VK 4BY7J 2K9QA 4X1EA 5FLVA 1JTYA 1MBFA 4GFBA 1Z77A 4A3JJ 1B72A 4IHVA 5C3EJ 2HXIA 3JRCA 5IOZA 4M3EA 1JKRC 4BKXA 3K2AA 2EQRA 2TCTA 3LSPA 1WH5A 2YUSA 3M4OJ 2ECBA 2R93J 4DYRA 3HB9A 5IYCJ 3ZQHA 2JA5J 2EZLA 4D5CA 1UHSA 4AUXA 2LVSA 3WHBA 2JA6J 3LSRA 1WGXA 1YRNA 5FKMA 1MSFC 1RETA 2WB1N 3WHCA 1G2HA 3BTIA 2K40A 4W1UA 4C2MJ 3MKLA 2VI6A 2XB0X 1VF9A 2L7ZA 2HOAA 3VPRA 2DA1A 3BTCA 2HYJA 5F0FA 2H1KA 3BR5A 3S15J 2NOGA 2NS7A 2ME6A 4XICA 5FKLA 4DYQA 1I6HJ 2DMQA 4A3FJ 2JK3A 1W0UA 3O8GA 3BT9A 3QPLA 1O4XA 2M0CA 3JRHA 3BG5A 5F0CA 4AC0A 1ZGWA 1QPIA 1BA5A 1X58A 1GDTA 5J1YA 1Y1VJ 3A01B 1HDDC 2L0KA 4C3IJ 2M34A 4D7MA 5E3OA 4MFDA 1P7IA 3SFIA 1BJZA 1Q1VA 5F1JA 4AYBN 1JT0A 1OCTC 5C4JJ 1TWGJ 1JJ8C 4Y7NJ 4J19A 1SANA 4A3MJ 1APLC 2CJJA 3CMYA 3TP0A 2R5ZA 3MN2A 3HBLA 2CQXA 4A3LJ 1CQTA 4BY1J 1MBJA 4IEJA 3S2DJ 3JR9A 4UUSB 2R0QC 2DA7A 1T33A 2JA8J 3A01A 1ENHA 4X6AJ 3GTGJ 1JKOC 4BBSJ 4JYKA 1K83J 1IRZA 5F04A 2LLKA 4B4CA 1MBGA 5EEAA 4DW6A 2GLOA 4QIWN 4RBOA 2LK2A 1FIAA 3UKGA 2DA2A 3IH2A 4RDUA 2E2JJ 1WCMJ 5IP6A 2Y0SN 5M5XJ 2EZIA 2WAQN 3SDGA 2YS9A 2GM4A 2OF7A 5J1UA 1ZR4A 1AU7A 1H8AC 5M5YJ 1JJ6C 1IDZA 5GPAA 1I3QJ 5E3MA 1FIPA 2EH3A 2DA3A 4QTRA 2X9DA 1ZQ3P 3HEFA 5GPCA 4A3DJ 1MBHA 2VPRA 5DTDA 2PMZN 2X48A 2Y9YA 2DJNA 4C3HJ 2QF7A 3E7LA 1TC3C 1YRNB 1IUFA 5JLXA 2HDDA 1LE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH4 A;  1LFU P;  3HGY A;  4M3B A;  3BR6 A;  4HNV A;  4S0H B;  1WPK A;  2LP0 A;  2MSY A;  1Z0X A;  2QCO A;  5GP9 A;  4FIS A;  5K7F A;  4A3G J;  3S2H J;  2OPT A;  3BR0 A;  3JRA A;  2KT0 A;  1U78 A;  3LNQ A;  3HM5 A;  2FD5 A;  1ZR2 A;  1B72 B;  5E3N A;  3TED A;  4M3D A;  5J3L A;  4A3C J;  3LSJ A;  1OCP A;  4Y52 J;  3CQZ J;  2G0E A;  1VFC A;  2O8K A;  3H0G J;  3HOV J;  4A3K J;  1I50 J;  3HOW J;  2LFB A;  2M9H A;  1AKH B;  2B63 J;  1ETY A;  1ZTR A;  3Q3S A;  5F08 A;  3DEW A;  3C2B A;  4UUT A;  3D1N I;  2NVT J;  3I4N J;  1U9N A;  3S1N J;  3K7A J;  4C3J J;  1P7J A;  2LKX A;  3BR3 A;  4FE7 A;  2RAE A;  3S1M J;  4FTH A;  2R7Z J;  1FJL A;  5C4X J;  2ELK A;  2HI3 A;  1RPW A;  2L7F P;  2DTZ A;  5EGO A;  1DU6 A;  2EBI A;  3BG3 A;  1K61 A;  4MIM A;  1OFC X;  1GV2 A;  1A6I A;  2XGC A;  4NDL A;  4G12 A;  3OIO A;  1X2M A;  4M6V A;  4M3F A;  4IHY A;  3FK7 A;  2CRG A;  3BG9 A;  3A03 A;  4XRM A;  3ZQF A;  3G1L A;  3Q0V A;  1GUU A;  3JRG A;  2HQ5 A;  3BR1 A;  2XB5 A;  4D7N A;  2P81 A;  5J1R A;  1MH3 A;  5IOY A;  1JKQ C;  1IJW C;  4I76 A;  2K9S A;  4BBR J;  2EZH A;  3FKI J;  4A3B J;  1XS9 A;  2ME0 A;  3B6A A;  1GT0 C;  2XRL A;  3LSG A;  3GTL J;  3IV5 A;  2JMW A;  3HOZ J;  4QSH A;  3BTJ A;  4B3A A;  3G1O A;  1LFB A;  2NVY J;  1OJL A;  5EZH A;  1TWC J;  1QVU A;  1GV5 A;  2ZB9 A;  3CCY A;  2ECC A;  1JGG A;  5EG0 A;  3GBG A;  1MNM C;  5FKO A;  4A3I J;  3GTJ J;  2Y31 A;  1HCR A;  1R9T J;  3HDD A;  1TWA J;  2IEK A;  1WI3 A;  3CDL A;  4MO7 A;  5FKK A;  3B6C A;  1UMQ A;  5M3F J;  2VKV A;  3JRF A;  3O8H A;  1W0T A;  2DN0 A;  3IH3 A;  2GBY A;  3S17 J;  2FJ1 A;  1JKP C;  1RKW A;  3GTO J;  5IPA A;  4IHX A;  2EZK A;  2FX0 A;  3GTQ J;  1PUF A;  1D5Y A;  1H88 C;  2NS8 A;  3TW6 A;  1MSE C;  1E3O C;  2MGQ A;  2H8R A;  2IBD A;  5EZG A;  4IHW A;  3RZO J;  1JUM A;  4DZP A;  2XPU A;  4XRS G;  4ABZ A;  3F0C A;  1IGN A;  3GTP J;  4XRS A;  2JJ7 A;  1SFO J;  1QRY A;  5K7Z A;  2W48 A;  3S1R J;  1U9O A;  4BXX J;  1HLV A;  2N8G A;  2KDZ A;  3HOU J;  2DMT A;  5EF6 A;  3I4M J;  3HOX J;  1ITY A;  2TRT A;  2LR8 A;  3ZQL A;  1ETO A;  1JTX A;  2XPV A;  3GTM J;  2L7M P;  4B1R A;  2L9R A;  4XK4 A;  3OSG A;  1ETW A;  1WH7 A;  3BR2 A;  3QQA A;  4CYC B;  2NVQ J;  4CYC A;  5M3M J;  2I10 A;  4UUS A;  2JA7 J;  5IP9 J;  3FK6 A;  3L1P A;  2CQQ A;  3HKZ N;  2XGE A;  1ETV A;  2R5Z B;  1EF4 A;  4JX5 A;  5M5W J;  2LD5 A;  5EDN A;  2M8G X;  1HF0 A;  2R92 J;  2DA4 A;  3HOY J;  2CUF A;  4JX4 A;  2YU9 J;  4MFE A;  1IV6 A;  3BTL A;  1VI0 A;  3HGG A;  3QPS A;  5F0H A;  1IDY A;  1Y1W J;  3S1Q J;  1NK2 P;  3M3Y J;  3S14 J;  5IYB J;  1RES A;  2E19 A;  5EYR A;  9ANT A;  1PUF B;  5IYD J;  2XPW A;  3JRB A;  3FIS A;  3JRI A;  1DU0 A;  1QVT A;  1FTZ A;  3NAU A;  1NTC A;  1IG7 A;  2R5Y A;  4JP0 A;  3PM1 A;  4EEF G;  1AHD P;  4M3G A;  2M2E A;  3Q0U A;  2MG4 A;  2HOT A;  4DZJ A;  1TWH J;  2WV1 A;  1XG1 A;  2AHQ A;  3RQI A;  2DMU A;  2VKE A;  5BNG A;  1HDP A;  2DMP A;  1JT6 A;  1RKT A;  1POG A;  5HOD A;  4FCY A;  4A3E J;  5EG0 B;  2ID6 A;  2LTP A;  3W6V A;  2O7O A;  4D5F A;  5K7H A;  2COB A;  2HXO A;  3BQZ A;  2Y9Z A;  1ETQ A;  3LOC A;  5DS9 A;  1B8I A;  2DA5 A;  3MVP A;  4DYC A;  2XSD C;  1HOM A;  1RR7 A;  1BW6 A;  1F36 A;  5EGO B;  3ZQC A;  3NAR A;  3TP3 A;  4LOC A;  3JRE A;  3IH4 A;  1T56 A;  3PO2 J;  1XC5 A;  1ETK A;  1ETX A;  1JUS A;  4W97 A;  1JUP A;  4A69 C;  3RKQ A;  1X2N A;  1MBE A;  1ZK8 A;  2XGD A;  2MW8 A;  2DA6 A;  4JX6 A;  4V2G A;  5FLM J;  3DCF A;  3RZD J;  5E3L A;  1VND A;  3BQY A;  1U8B A;  3GTK J;  2X6O A;  3ZQI A;  5FJ8 J;  1IC8 A;  3G1M A;  3ZQG A;  1ORK A;  2HOS A;  2IAI A;  2LY9 A;  2Y30 A;  2E1O A;  3SJM A;  2O9L A;  4FE4 A;  4V2F A;  1UG2 A;  4MLO A;  4A93 J;  3OSF A;  2DMN A;  3A02 A;  4I6Z A;  2Y2Z A;  5FKN A;  2AO9 A;  1FEX A;  1ZKG A;  5IP7 J;  1B8I B;  1FTT A;  3Q0W A;  4XID A;  3S16 J;  5C44 J;  2E2H J;  5JLW A;  1NK3 P;  1S7E A;  2FQ4 A;  2NVX J;  3JRD A;  2VUM J;  4L5E A;  5F27 A;  2E2I J;  2JWT A;  3TW7 A;  1A5J A;  3OOU A;  1BL0 A;  1MBK A;  1GVD A;  3ZOB A;  2R5Y B;  1H89 C;  1AKH A;  3FIW A;  1F43 A;  1LE8 B;  1TWF J;  2D5V A;  3PO3 J;  2CUE A;  2CU7 A;  2JN6 A;  1BW5 A;  2ID3 A;  2K9N A;  3H3V K;  4BY7 J;  2K9Q A;  4X1E A;  5FLV A;  1JTY A;  1MBF A;  4GFB A;  1Z77 A;  4A3J J;  1B72 A;  4IHV A;  5C3E J;  2HXI A;  3JRC A;  5IOZ A;  4M3E A;  1JKR C;  4BKX A;  3K2A A;  2EQR A;  2TCT A;  3LSP A;  1WH5 A;  2YUS A;  3M4O J;  2ECB A;  2R93 J;  4DYR A;  3HB9 A;  5IYC J;  3ZQH A;  2JA5 J;  2EZL A;  4D5C A;  1UHS A;  4AUX A;  2LVS A;  3WHB A;  2JA6 J;  3LSR A;  1WGX A;  1YRN A;  5FKM A;  1MSF C;  1RET A;  2WB1 N;  3WHC A;  1G2H A;  3BTI A;  2K40 A;  4W1U A;  4C2M J;  3MKL A;  2VI6 A;  2XB0 X;  1VF9 A;  2L7Z A;  2HOA A;  3VPR A;  2DA1 A;  3BTC A;  2HYJ A;  5F0F A;  2H1K A;  3BR5 A;  3S15 J;  2NOG A;  2NS7 A;  2ME6 A;  4XIC A;  5FKL A;  4DYQ A;  1I6H J;  2DMQ A;  4A3F J;  2JK3 A;  1W0U A;  3O8G A;  3BT9 A;  3QPL A;  1O4X A;  2M0C A;  3JRH A;  3BG5 A;  5F0C A;  4AC0 A;  1ZGW A;  1QPI A;  1BA5 A;  1X58 A;  1GDT A;  5J1Y A;  1Y1V J;  3A01 B;  1HDD C;  2L0K A;  4C3I J;  2M34 A;  4D7M A;  5E3O A;  4MFD A;  1P7I A;  3SFI A;  1BJZ A;  1Q1V A;  5F1J A;  4AYB N;  1JT0 A;  1OCT C;  5C4J J;  1TWG J;  1JJ8 C;  4Y7N J;  4J19 A;  1SAN A;  4A3M J;  1APL C;  2CJJ A;  3CMY A;  3TP0 A;  2R5Z A;  3MN2 A;  3HBL A;  2CQX A;  4A3L J;  1CQT A;  4BY1 J;  1MBJ A;  4IEJ A;  3S2D J;  3JR9 A;  4UUS B;  2R0Q C;  2DA7 A;  1T33 A;  2JA8 J;  3A01 A;  1ENH A;  4X6A J;  3GTG J;  1JKO C;  4BBS J;  4JYK A;  1K83 J;  1IRZ A;  5F04 A;  2LLK A;  4B4C A;  1MBG A;  5EEA A;  4DW6 A;  2GLO A;  4QIW N;  4RBO A;  2LK2 A;  1FIA A;  3UKG A;  2DA2 A;  3IH2 A;  4RDU A;  2E2J J;  1WCM J;  5IP6 A;  2Y0S N;  5M5X J;  2EZI A;  2WAQ N;  3SDG A;  2YS9 A;  2GM4 A;  2OF7 A;  5J1U A;  1ZR4 A;  1AU7 A;  1H8A C;  5M5Y J;  1JJ6 C;  1IDZ A;  5GPA A;  1I3Q J;  5E3M A;  1FIP A;  2EH3 A;  2DA3 A;  4QTR A;  2X9D A;  1ZQ3 P;  3HEF A;  5GPC A;  4A3D J;  1MBH A;  2VPR A;  5DTD A;  2PMZ N;  2X48 A;  2Y9Y A;  2DJN A;  4C3H J;  2QF7 A;  3E7L A;  1TC3 C;  1YRN B;  1IUF A;  5JLX A;  2HDD A;  1LE8 A; 
#chains in the Genus database with same CATH topology
 4GYI A;  5D6F A;  2MH2 A;  2LKS A;  1SD6 A;  2VBZ A;  3BR6 A;  4HNV A;  3GCM A;  4S0H B;  2H8W A;  4B47 A;  1XMA A;  1FOW A;  2HZD A;  2QCO A;  3OWT A;  5CYV A;  4OMY A;  3KLO A;  4LIV A;  3LNQ A;  3TMO A;  2CUZ A;  3C2H A;  3JCU C;  4ZJZ A;  1U5T C;  5E3N A;  4XOR A;  5CLS A;  3DEU A;  3P9I A;  3GYH X;  1Z1D A;  3LSJ A;  2GXB A;  2DK5 A;  2PMU A;  3CQZ J;  3COA C;  3CO6 C;  2VAS A;  2O8K A;  2V9P A;  1LEB A;  3HOW J;  3T8T A;  2FBK A;  4HDV A;  4I98 B;  2VQL A;  2FML A;  4HNU A;  4UUT A;  2DAO A;  1I1G A;  1ONV A;  3D1N I;  5J4V A;  2D1V A;  2P5K A;  1XDS A;  2ISY A;  3V8L A;  3OYE A;  1BI1 A;  3DF8 A;  2OQR A;  4FE7 A;  3VEP A;  2Z16 A;  1TLH B;  2R7Z J;  1FJL A;  1R6R A;  2P7V B;  2HI3 A;  1RPW A;  4DBR A;  3WTS C;  1MGT A;  1KQ8 A;  2DTZ A;  2H09 A;  3HC7 A;  3T1B A;  3LAJ A;  1R4N B;  1F4K A;  1FSE A;  1A6I A;  1ZGA A;  2JUG A;  1Z3Y A;  1WJB A;  3OIO A;  4QWQ A;  3OS1 A;  4M3F A;  4NNJ A;  3BG9 A;  3ZQF A;  3Q0V A;  1BC7 C;  2ZNY A;  2WAQ A;  1ZH5 A;  2F5D A;  3D5L A;  2P0W A;  1P9Q C;  2XB5 A;  3VSK A;  2AQE A;  5J1R A;  2TDX A;  3PFY A;  4BNC A;  2QQ8 A;  5HNH A;  3I56 I;  2LC2 A;  3FHN A;  4I76 A;  2K9S A;  4HV5 A;  4ANJ A;  3ABU A;  2V1D A;  3PNV A;  4D0P A;  4A3B J;  2DYS H;  1XS9 A;  3W2A A;  2KIQ A;  3U9G A;  2ZJQ F;  4A6D A;  2XAU A;  1GT0 C;  1FBQ A;  5ILS A;  1IAW A;  3IV5 A;  3ZN0 A;  2MD0 A;  3SYT A;  3G1O A;  2A3S A;  4OMZ A;  1D1B A;  1YJW I;  1X1P A;  1QHG A;  2X6X A;  3RCO A;  2F5F A;  1TWC J;  1QVU A;  1V4R A;  3KE2 A;  4BE0 A;  2ECC A;  2VJ4 A;  2A6E F;  3DEE A;  4Y4R A;  1S6L A;  3CCR I;  2Y31 A;  1KYZ A;  3FXR A;  3O6B B;  4XKW A;  1R9T J;  1LUJ B;  3GVA A;  4H4K C;  3W3C A;  2X85 A;  3ZMT A;  3WG9 A;  3B6C A;  4HX8 A;  1G8X A;  3CP2 A;  4FET A;  3S17 J;  1SVO A;  1UHM A;  5K5Q A;  4IHX A;  2FX0 A;  1HSJ A;  4U0V A;  5LD2 C;  3KEQ A;  2WV0 A;  2JPB A;  2P6S A;  2P4W A;  3JTH A;  1UB9 A;  3TOB A;  1E3O C;  1MSE C;  2DOE A;  5EZG A;  1RNL A;  2ZC2 A;  3DXJ F;  4CH7 A;  3VFZ A;  4DZP A;  3FMR A;  2Y0M A;  3F0C A;  4EJT A;  4XRS A;  1SFO J;  2J5O A;  3RKY A;  3QPH A;  2AQF A;  3I4M J;  1WKM A;  2DMT A;  4NB5 A;  4HX4 A;  4PDK A;  4A0X A;  1DPR A;  1YW8 A;  2A07 F;  2M45 A;  3ZQL A;  1JTX A;  4WK8 F;  3PNY A;  3EUA A;  4LLN A;  4G7O F;  2XAJ A;  2DYR H;  4B43 A;  2IJL A;  1OQY A;  1W5C C;  3F72 A;  1Y6I A;  2AXT C;  1OPC A;  3IRQ A;  3JAM Z;  2WTE A;  4ZDL A;  2V6E A;  3IWZ A;  2LBF A;  5AIQ A;  5ICG A;  5M3M J;  3OYA A;  3OYK A;  4EAT A;  4HSR A;  3FK6 A;  3G71 I;  4GCV A;  4L9J A;  3OYJ A;  3WGG A;  3HKZ N;  2K27 A;  4A12 A;  2G9W A;  2HGC A;  2P7C B;  5M5W J;  2K7L A;  4XRF A;  1C0W A;  5L3D A;  2BBY A;  1XX5 A;  2Q0O A;  4UUV A;  5E20 A;  4NQW B;  3HOY J;  4DNC A;  4YFK F;  2NOJ B;  3ASN H;  3DKY A;  5CJ9 A;  2W24 A;  1V5E A;  1NK2 P;  1IF1 A;  5EYR A;  2NNN A;  2FEZ A;  4CCO A;  3JRB A;  4EVI A;  2AS5 F;  1DU0 A;  3BDD A;  4M72 A;  3ZPL A;  3M9A A;  4ESF A;  4P9U A;  1IG7 A;  4IJA A;  4BXF A;  4AM3 A;  4N9I A;  3SDB A;  1XG1 A;  4DOZ A;  3VWB A;  2DMP A;  2O03 A;  2QEN A;  4G9Y A;  2COB A;  2HXO A;  1ETQ A;  5EJC A;  5DS9 A;  3V7C A;  4Z6Y A;  4DYC A;  3FXL A;  2XSD C;  1RR7 A;  2KZV A;  4KA4 A;  2BW3 B;  3FMQ A;  5HVQ C;  5J8F A;  4ZTJ A;  3ZQC A;  2AXL A;  2DK8 A;  4LOC A;  3RJP A;  1T56 A;  3PO2 J;  1JUP A;  2LRE A;  4R8H A;  1YQA A;  4G6T B;  5B1A H;  2MLG A;  1BOA A;  2R7F A;  4OWR B;  1PVE A;  3L2Q A;  1BOB A;  2QKM B;  5HDN A;  4FX4 A;  1A35 A;  4BQA A;  3Q9S A;  4L18 B;  1E2X A;  3H5A A;  1K6O A;  1IC8 A;  1ON2 A;  2R7U A;  5ICC A;  3IUO A;  2K5C A;  2WAD A;  4X0G A;  2Y30 A;  3FZV A;  3HZJ A;  5CKT A;  4DGW B;  4ZYD A;  4FE4 A;  5ED4 A;  3MKW B;  3CZ6 A;  3A02 A;  4PGH A;  3OR2 C;  3OYC A;  2AO9 A;  1LQ1 A;  3VOD A;  2M3A A;  1O3S A;  1B8I B;  1FTT A;  4KN7 X;  1HXD A;  2L7K A;  2COM A;  2W25 A;  3K4K A;  3KP6 A;  4KUM A;  3RQ4 A;  2ZJP F;  3S16 J;  3SZT A;  1YTY A;  3HSE A;  3K10 A;  3ZR8 X;  1R5G A;  4LLL A;  1E3H A;  2DPU A;  3DTE A;  1S7E A;  4D1Q A;  1G3T A;  2OJE D;  4PJN A;  2G7U A;  2VBX A;  4WWC A;  1TL8 A;  2R5Y B;  1H89 C;  2FNP A;  3LWF A;  1L3L A;  2EPF A;  4E7Z A;  2X1E A;  2CU7 A;  2JN6 A;  3LST A;  3H3V K;  4X1E A;  2KIM A;  1MBF A;  4L9T A;  1TW3 A;  5K5R A;  2VXD A;  1YJ9 I;  4ZYH A;  4XKB A;  5IOZ A;  4CCM A;  1JKR C;  4BKX A;  3ULQ B;  3LQQ A;  5CQE A;  3LSP A;  1YLF A;  2YUS A;  4UB8 C;  2ECB A;  3EUH A;  2R93 J;  1HW2 A;  2V79 A;  1O3Q A;  1MMA A;  4ZDO A;  4M6X A;  4MQ9 F;  2EZL A;  2LF8 A;  1NHA A;  3V8J A;  4AUX A;  1XGS A;  2O5R A;  1D1C A;  1W36 D;  1IN5 A;  4FHT A;  3OMY A;  4U7B A;  5DM6 F;  1UFM A;  2O6G E;  4P55 A;  4AVZ A;  1MSF C;  1S8N A;  2WB1 N;  3IC7 A;  4ESB A;  2R7W A;  2EA2 A;  4RB1 A;  3ABL H;  4XLP F;  2XSJ C;  3S8P A;  2FBH A;  5HDG A;  3S93 A;  1XGO A;  2XAS A;  1OCC H;  2XB0 X;  1YIT I;  1U3E M;  2L7Z A;  2XF6 A;  3VB2 A;  5F0F A;  3WOD F;  4UVA A;  1D1A A;  1TBX A;  3S2W A;  4IPA A;  4EM1 A;  2GXA A;  2ME6 A;  1ON1 A;  2HWV A;  2B9S A;  1U2W A;  1FY7 A;  2UUZ A;  2KIU A;  3DQV C;  2Z9O A;  1XSX A;  1PP7 U;  3FXO A;  4BDZ A;  2VE9 A;  1IV8 A;  4EMS A;  4A3F J;  3K0L A;  1W0U A;  4ENK A;  3QPL A;  4PGG A;  5J6X A;  5F0C A;  4AC0 A;  2H94 A;  4BQQ A;  1MDM A;  2W7N A;  1X58 A;  1RUN A;  3GF2 A;  1Y1V J;  3A01 B;  1XCB A;  1J2X A;  2M34 A;  3FXU A;  3ZMD A;  2QQ9 A;  3SFI A;  4D7M A;  2MA3 A;  5KCM A;  2PQ8 A;  1MMD A;  1S72 I;  2FF4 A;  1GVJ A;  3GFI A;  4CCL A;  3HRU A;  1OCT C;  3G4S I;  1TWG J;  4II2 A;  1MMS A;  4NQW A;  4O6J A;  1OR7 A;  1B59 A;  1UCR A;  2CQK A;  2IGK A;  4HG2 A;  4MQV A;  1A36 A;  4F92 B;  3H9G A;  4A3M J;  2CJJ A;  2HEO A;  3AFH A;  3WGI A;  1I27 A;  3N4M A;  4ASN A;  4Q47 A;  1IRF A;  2CQX A;  3WTU C;  3PFI A;  4IEJ A;  1VQ5 I;  2R3S A;  3BOQ A;  1VQL I;  3M8F A;  4EJO A;  5JHU A;  4KFC A;  1M1E B;  2BHY A;  2XRO A;  4Q48 A;  4C30 A;  3AAF A;  4X6A J;  1HKT A;  2LBF B;  4FX0 A;  3GFL A;  3CJR B;  3R60 A;  1G4D A;  4IO9 F;  1X1B A;  1IRZ A;  2RRE A;  2LLK A;  4ESJ A;  1T95 A;  4B4C A;  2E1C A;  3KLN A;  1S5L C;  2Q8K A;  1DGR M;  3FWE A;  1TZL A;  2GLO A;  2CQ7 A;  1YI2 I;  1YS7 A;  2EFN A;  2LK2 A;  3SFZ A;  4HQM A;  2DA2 A;  4I2O A;  4HQE A;  2E2J J;  1XMK A;  5DCM A;  4OIR F;  1I3A A;  5LGT A;  4A0Z A;  3J81 Z;  2E1M B;  1USS A;  2NNY A;  2HZT A;  1JHF A;  2FOK A;  3CLO A;  5HLI A;  5M5Y J;  4RMN A;  2IA1 A;  1IDZ A;  3RSN A;  1FIP A;  2CH0 A;  5DYM A;  4QTR A;  5JHF A;  2R7R A;  4O5V A;  3R4K A;  3I4P A;  2VPR A;  1ZLJ A;  3MMY B;  4RGU A;  2FOW A;  1YHQ I;  4ZZL A;  1O57 A;  2MFZ A;  1YRN B;  3R6S A;  3A1Y A;  1PDN C;  1X1A A;  2ZKZ A;  3GZN B;  5ICF A;  3J80 Z;  3HGY A;  2R7X A;  4M3B A;  2KHM A;  2ZBK A;  2CFO A;  3KP5 A;  4KIG A;  1KQ0 A;  2LP0 A;  4B48 A;  4AYB A;  2OCE A;  3BPV A;  4WXH A;  2JZY A;  2CW0 F;  3CUO A;  3BR0 A;  3EPZ A;  2XDV A;  4IZZ A;  4II3 A;  1U78 A;  5HS8 A;  1S9H A;  2FA5 A;  3K4B A;  3GX4 X;  4YEJ A;  3HM5 A;  1D0Y A;  3E6D A;  2WC2 A;  1R4M B;  1B72 B;  3HTS B;  3FBI B;  4A2U A;  5J3L A;  3I9V 2;  3A2K A;  3K6G A;  4LIT A;  3LAP A;  1VFC A;  1NG7 A;  3F3X A;  3J7A Y;  3H0G J;  3HOV J;  4BH9 A;  1I1S A;  2M9H A;  5J8C A;  1AKH B;  2B0L A;  1WJD A;  1KU3 A;  2LF7 A;  4AIK A;  3I4N J;  3RIR A;  2OD5 A;  2OU2 A;  1A6Q A;  2L54 A;  1P7J A;  1HBX G;  5K1Y A;  4RLF A;  3EUH C;  2LKX A;  5CVV A;  1KON A;  1SVL A;  3QOE A;  3BR3 A;  4HDU A;  2FE3 A;  1WSU A;  4WX9 A;  5C4X J;  2ELK A;  2H6C A;  4I7H A;  3ERE D;  3OYN A;  1Z7L A;  4LB6 B;  5HLT A;  1V54 H;  1ZRD A;  2F2E A;  2HYF A;  4E7H A;  2QA4 I;  1OFC X;  4KMU X;  2RNG A;  5FB2 A;  3TL4 X;  3MZ8 A;  4YII A;  5IY5 H;  2PLY A;  1ZGJ A;  2DDB A;  5DUI A;  2EB7 A;  3K4L A;  4M6V A;  1HW1 A;  4IHY A;  4IXA A;  3L2W A;  2W57 A;  2HR3 A;  3G1L A;  5H6Q A;  3LFK A;  4CCK A;  2LRD A;  2FUG 2;  3JRG A;  3MKZ A;  2VT2 A;  1BM9 A;  2OCC H;  2P81 A;  3H5R A;  1R1U A;  3CO7 C;  2HQA A;  4QPQ A;  3S3N A;  2IS2 A;  1MH3 A;  5CVJ A;  5IOY A;  4BBR J;  4M74 A;  1GXQ A;  3KYL A;  1K7A A;  2ME0 A;  3K4M A;  4UB6 C;  3B6A A;  2HQN A;  1WFX A;  2XRL A;  3LSG A;  3GTL J;  2JMW A;  4RB3 C;  5E17 F;  1Z91 A;  3I58 A;  3BTJ A;  1K4S A;  5HLG A;  3HJE A;  2NVY J;  2NXN B;  1L0O C;  2Z33 A;  1OJL A;  2DOA A;  5EZH A;  5HDK A;  1YW9 A;  2LOO A;  2ZB9 A;  3CCY A;  4DBQ A;  3HPG A;  1JGG A;  2OTL I;  5EG0 A;  2GWR A;  2F4I A;  5FLX Z;  4A3I J;  4L9V A;  3GTJ J;  4BAC A;  3HDD A;  1TWA J;  2DBB A;  3ZMZ A;  1WI3 A;  4MO7 A;  5FKK A;  3JRF A;  1W0T A;  2K3P A;  3WU2 C;  3KP3 A;  2STW A;  5GAH J;  1JKP C;  1RKW A;  2MYS A;  5IPA A;  3GTO J;  3HOS A;  2Z1D A;  3BRO A;  4NC7 A;  2K86 A;  1D5Y A;  5KVR A;  1FYK A;  1BIB A;  5FD6 A;  3WTT C;  1E0E A;  2NS8 A;  4KIS A;  4HEA 2;  1BBY A;  2VKH A;  4HOB A;  5D6E A;  2GQQ A;  1X4P A;  2GOX B;  2XPU A;  3W6J B;  4XRS G;  3E6C C;  1KZH A;  2IS6 A;  1WWX A;  4ABZ A;  3MD2 A;  2ZSH B;  5DV5 A;  3OIP A;  1VQP I;  2NAZ A;  1HLV A;  4J01 A;  3H92 A;  2RQP A;  4CGZ A;  2EWN A;  3HOX J;  1ITY A;  3EUK L;  1X3W B;  2QEX I;  3DKX A;  2M30 A;  2DFF A;  1LVA A;  5AIP A;  2OZU A;  5J47 A;  4ON0 A;  1IN8 A;  2IGN A;  4XK4 A;  3TO6 A;  4GO1 A;  2BEO A;  4XLN F;  3I5U A;  3BR2 A;  3QQA A;  4CYC B;  3P9K A;  4ZYG A;  1VQ9 I;  3U2R A;  2LDU A;  1J75 A;  1SAX A;  3M7G A;  3OV8 A;  1YX5 A;  2X6Y A;  4CZZ A;  2UWM A;  2WB1 A;  4EGY A;  5D8L B;  4GGG A;  2XGE A;  4BUP A;  1EV7 A;  2HTS A;  2R5Z B;  1QQI A;  1PP8 F;  1W36 C;  1O3R A;  2A5W A;  3O3K A;  2DXI A;  4L9N A;  4KIB A;  5B66 C;  2R92 J;  2R7V A;  3PIO F;  4I0B A;  3ERM A;  3EYY A;  4UVB A;  2RN7 A;  3QU6 A;  3B73 A;  3CMM A;  3QPS A;  4WF2 A;  5BPI A;  3M3Y J;  3S14 J;  3V7S A;  2ADU A;  1PUF B;  3RPQ A;  1XN7 A;  2BHZ A;  1T98 A;  2KJC A;  2W85 A;  2NYX A;  3DPT A;  3FIS A;  4IL6 C;  1QVT A;  2CMP A;  1ZRC A;  1NTC A;  2CS3 A;  3GZ5 A;  1FBU A;  1B6A A;  3L2C A;  2VE8 A;  1AHD P;  4M3G A;  3Q0U A;  1U5T B;  4E7L A;  1CGP A;  2OC6 A;  3I59 A;  4DZJ A;  1TWH J;  3LA2 A;  1Z3X A;  2AHQ A;  2R7D A;  2DMU A;  1J9I A;  3DV8 A;  5BNG A;  1QBJ A;  1JT6 A;  4HPQ A;  1POG A;  4IVN A;  4FCY A;  4A3E J;  5E1X A;  2JUC A;  2ID6 A;  3W6V A;  3MCZ A;  1DGW Y;  3C18 A;  3BQZ A;  1UG0 A;  3LOC A;  3H3Z A;  1X3Z B;  3MVP A;  4BEH B;  1XD7 A;  4PCQ A;  2KQR A;  2F4M B;  2ACJ A;  5KAI C;  2DO7 A;  1TQP A;  5B1B H;  4LGW A;  2DFE A;  1F36 A;  5HNF A;  3NAR A;  1R1T A;  2R4G A;  3QWL A;  3ZCO A;  4LG0 B;  3IH4 A;  2E5N A;  1ETK A;  2HS5 A;  2KMU A;  3DLL F;  3RKQ A;  1X2N A;  4B44 A;  3SZG A;  5E1W A;  4A5N A;  3H35 A;  4V2G A;  3KET A;  4L0Z B;  1VND A;  3GTK J;  1U8B A;  3HL2 A;  2X6O A;  2KIF A;  4YFX F;  1SD5 A;  3G1M A;  4HF0 A;  4WXD A;  3ZQG A;  2W00 A;  4AVP A;  4CA0 A;  4RAG A;  5J40 A;  3L09 A;  2O9L A;  3NEU A;  5FFX A;  2L3D A;  1Z7U A;  4A93 J;  2DMN A;  2ZXI A;  2Q2E A;  4I6Z A;  4E7K A;  1ZKG A;  4E7S A;  2KPM A;  2E5Z A;  4HLX A;  5CVR A;  3Q0W A;  1KU7 A;  4XID A;  3LQR A;  1GHC A;  1B9M A;  5JLW A;  2IA2 A;  3DKW A;  5L3B A;  2IXS A;  4RLQ A;  2VL8 A;  4M9Z A;  3HSF A;  3I55 I;  2JWT A;  4BE1 A;  3OOU A;  4AWX B;  1BL0 A;  1EA3 A;  4KMF A;  4XLH A;  2E7X A;  4BHB A;  3RYR A;  4XKV A;  2NS0 A;  4BJT A;  2BOL A;  4R79 A;  3OY9 A;  3BPX A;  3BJO A;  2CUE A;  4ZDP A;  1OYI A;  2BVM A;  1QPM A;  2K9Q A;  3G3Z A;  4PFO A;  1UST A;  2LG4 A;  2DT6 A;  1HKS A;  3OYL A;  2XAH A;  2RQQ A;  2OTJ I;  1XDU A;  4KYW A;  2RVC A;  3WU1 B;  1XGN A;  4KT6 A;  2VBY A;  3K2A A;  2JSP A;  2FRH A;  4CZC A;  3M4O J;  2D2W A;  4LIU A;  5FGM A;  5EEG A;  2VQC A;  3IKT A;  2XIG A;  1P2F A;  1WRJ A;  4RGS A;  4E6K G;  1WJF A;  4B3X A;  3CCM I;  1UHS A;  3WU0 A;  2ESH A;  1QZE A;  2CW7 A;  2RC4 A;  4JQF A;  2PEX A;  1P92 A;  3OYM A;  2LVS A;  1QGP A;  1JXS A;  1SFX A;  3LSR A;  2MH9 A;  3GUD A;  3DLA A;  2LKP A;  3GWZ A;  5FKM A;  1RET A;  4Y13 A;  1Y8R B;  2HVS A;  1VQ7 I;  2BY1 A;  3L2R A;  5LEK A;  1MIJ A;  2DFH A;  2YSR A;  4C2U A;  4O3M A;  3BTI A;  2L5Q A;  4I02 A;  5BPD A;  1OMI A;  3HUG A;  4IRH A;  2VI6 A;  4CO8 A;  1KA8 A;  1VF9 A;  2IT0 A;  2DT5 A;  4HAM A;  2V9K A;  3ECO A;  5BMZ A;  2DA1 A;  3BTC A;  2HYJ A;  4BAY A;  1NG6 A;  2H1K A;  3BR5 A;  1FX7 A;  2VC0 A;  2ELH A;  3E6B A;  5D5X B;  2NS7 A;  4QPO A;  3K1M A;  1KGS A;  3BLY A;  1F1Z A;  5FKL A;  4DYQ A;  5IT9 Z;  2LNB A;  5BS6 A;  1W7P A;  2KKO A;  2DMQ A;  1BC8 C;  2JK3 A;  3BT9 A;  2PJP A;  2O8X A;  4AID A;  3HSR A;  2JQ7 A;  1T08 B;  2M0C A;  3JRH A;  3BG5 A;  3GEZ A;  3F21 A;  1H9G A;  2KRH A;  3E5U A;  2W4S A;  1BA5 A;  4LFU A;  3PSI A;  2FSW A;  1R00 A;  2L0K A;  4C3I J;  2XV4 S;  5E3O A;  4MFD A;  4IX7 A;  1J09 A;  4MGR A;  4U7D A;  3I64 A;  4M73 A;  3DBH B;  2H1L A;  2M7B A;  1RUO A;  4PZJ A;  1ZRE A;  3V8K A;  1OYW A;  4XLC A;  4MEY F;  3IAM 2;  2ZXW H;  2I5U A;  3IRR A;  4Y7N J;  1K78 A;  1N78 A;  1LDJ A;  3CMA I;  4YEL A;  4BHP A;  2RKH A;  2Y69 H;  1ZRF A;  3DU6 A;  2O3F A;  3FXQ A;  1SAN A;  1APL C;  1YO5 C;  5GAE J;  2IGM A;  3F8M A;  5GAD J;  4GDF A;  4ENJ A;  3UR3 C;  1G3S A;  2IP2 A;  5JVG F;  1O3T A;  2ETH A;  1CQT A;  4HBL A;  4BY1 J;  1MBJ A;  4UUS B;  1T33 A;  1X4O A;  2JA8 J;  1FOX A;  4E7I A;  2IW5 A;  2QKL B;  1ACI A;  4XKC A;  4F55 A;  1YS6 A;  4JYK A;  4BBS J;  1K83 J;  2F4O B;  4NC6 A;  2UZK A;  4CUG A;  1VQM I;  2PG4 A;  2Z2S B;  3CF5 F;  2CFX A;  3ZGK A;  1MND A;  3AG3 H;  2EK5 A;  3F8F A;  4QIW N;  3FDY A;  2X1D A;  3UKG A;  4RDU A;  2YPR A;  3QOP A;  2XAG A;  1Z67 A;  4BQO A;  5M5X J;  4KJZ A;  2DOD A;  1V55 H;  2M0M A;  2YS9 A;  2GM4 A;  1T0F C;  1AU7 A;  3RYP A;  1LEA A;  3QYB A;  2BY0 A;  4ZYA A;  2HOE A;  2IRF G;  4EQQ A;  4EM0 B;  5GPA A;  5E3M A;  2RGV A;  2NVU B;  2DU9 A;  3RPU A;  2W1O A;  3HEF A;  1RIO H;  1ZQ3 P;  1MBH A;  5DTD A;  2PMZ N;  2CQN A;  2Y9Y A;  3K2Z A;  3E7L A;  3SXY A;  2XC7 A;  1IUF A;  5JLX A;  4P96 A;  3OYF A;  4F3Q A;  4BHC A;  1EJ9 A;  2FBI A;  3N97 A;  1LFU P;  2L9N A;  4XLF A;  2K3F A;  1XB4 A;  3TQN A;  1ZAO A;  4ZC3 A;  3CCL I;  2MSY A;  4E4H A;  2VOP A;  2E1N A;  2L4A A;  2ZFU A;  1IN7 A;  3GME A;  3WE3 A;  4B8X A;  5GP9 A;  3E3V A;  4FIS A;  4BQN A;  4A3G J;  2H27 A;  3S2H J;  1VZ0 A;  4Y3O A;  2KZG A;  2KT0 A;  2CYY A;  1KU9 A;  2D1H A;  4U0W A;  1FLI A;  3KYD B;  4XNF A;  2FD5 A;  1YJN I;  2ZXH A;  1ZR2 A;  1T8I A;  3TED A;  2L9V A;  2UV1 A;  4JBA A;  1FP1 D;  2Z3Y A;  1E17 A;  3WTX C;  2IGO A;  1WQ2 A;  5D5V B;  4Y52 J;  2G0E A;  4NUB A;  4C2T A;  4G8X A;  2LFB A;  3K4J A;  1SMT A;  3L00 A;  1ZYR F;  4PJ0 C;  3LSH A;  1ETY A;  1SMY F;  3ZMU A;  2ZXJ A;  3Q3S A;  1MNE A;  2ZME A;  1SVM A;  1RC9 A;  1FC3 A;  4MHG A;  1U9N A;  2HTJ A;  3K7A J;  3S1N J;  5B3S H;  1D0Z A;  1Y39 A;  2QQA A;  3MQ0 A;  2EV0 A;  3QYE A;  1BJA A;  4HF2 A;  3F6O A;  4AIJ A;  3BC8 A;  3QPT A;  2E34 A;  1SAU A;  2RAE A;  3HKZ A;  2L02 A;  4FTH A;  3S1M J;  1MMN A;  5L3E A;  2EJR A;  2E1M C;  3H9J A;  2L7F P;  5L3F A;  1IW7 F;  3L2V A;  1LNW A;  3CC7 I;  1DU6 A;  6PAX A;  2VKD A;  3CCS I;  4BE2 A;  1K61 A;  1MJB A;  1XTA A;  3FXJ A;  1V3F A;  2JRT A;  1UAA A;  4G12 A;  2ZSI B;  4PFP A;  4UHT A;  1X2M A;  1O7F A;  3A03 A;  4XRM A;  3DPU A;  1GUU A;  3ASO H;  2HQ5 A;  2WBM A;  3O2P E;  4F93 B;  3MAJ A;  4IQ4 A;  4IHS A;  2CV1 A;  4OIP F;  2F5V A;  3LSI A;  1JKQ C;  1J59 A;  1OIS A;  2DOF A;  3I71 A;  4FAS D;  2X1C A;  1KU2 A;  3U1K A;  3OS2 A;  1B1B A;  4DJA A;  2RDP A;  3ZQ7 A;  2KRF A;  4LJZ F;  4QSH A;  3HOZ J;  4B3A A;  4HX7 A;  3DP7 A;  4PJJ A;  5CVI A;  1TP4 A;  3CUQ B;  4NC8 A;  2XVC A;  1GV5 A;  1LFP A;  4UY8 I;  3S3O A;  3PUF A;  5JFR A;  4R1H A;  3GBG A;  1MNM C;  2KLO A;  4Y15 A;  5HLH A;  2E7W A;  3F8N A;  2KP6 A;  3RZO J;  2QZ8 A;  1UHW A;  2IEK A;  4Q5S F;  2VIX A;  4KT5 C;  4RAF A;  5M3F J;  1PUE E;  2DN0 A;  5E1Z B;  3OYI A;  3CJQ B;  4IHT A;  5FRM A;  3LSM A;  2FJ1 A;  3NWT A;  1SC7 A;  2Y75 A;  2EZK A;  3MWM A;  3DFG A;  4XOT A;  5LGN A;  3FKJ A;  3TOA A;  5JVT A;  3OYD A;  1PUF A;  1H88 C;  2CW8 A;  3ABK H;  3PQK A;  4OU0 A;  1H9T A;  3U1D A;  2XKO A;  2VJJ A;  3TW6 A;  2LSO A;  3QP6 A;  3KPH A;  1FBS A;  2IBD A;  4IHW A;  3CDI A;  3LA7 A;  2WA0 A;  5FRN A;  1WJ5 A;  2BE5 F;  3F9K A;  2HQR A;  5EEH A;  1IGN A;  3GTP J;  2CV2 A;  1W7P B;  3S1R J;  2DPD A;  3HOU J;  2N8G A;  2KDZ A;  3K1P A;  2F5E A;  5EF6 A;  2V4J C;  1VQ6 I;  3KFW X;  3CF2 A;  1Y8Q B;  2HFH A;  2O61 A;  1ETO A;  1RRJ A;  1VTN C;  3GTM J;  2QQB A;  4E70 A;  3AG1 H;  2L7M P;  2V1N A;  4OOI A;  4B1R A;  5D8K B;  4IOC F;  3V4G A;  3F23 A;  3HUG B;  3OSG A;  3BG7 A;  2K85 A;  1QNT A;  1W5T A;  1WH7 A;  3KZY A;  3PUB A;  4CYD A;  1DUX C;  4CYC A;  2EIN H;  1JHH A;  1J5Y A;  3OL3 A;  1AWC A;  3ABT A;  2FQ3 A;  5E8I A;  1UJ8 A;  2VQG A;  3DU5 A;  4BU2 A;  5LHH A;  5ILU A;  2E36 A;  2HYG D;  3RKX A;  3M8J A;  3E6M A;  3MEX A;  5F64 A;  1TTY A;  1ETV A;  1EF4 A;  3WTZ A;  1YYV A;  5EDN A;  5FLX K;  2MAB A;  2M8G X;  3J7Z I;  3HHG A;  1WI9 A;  3M07 A;  2DA4 A;  2CUF A;  2QYO A;  2YU9 J;  3ML6 A;  1MKM A;  3TDU C;  3CD6 I;  3NRV A;  4HYE A;  3BTL A;  2NRA C;  4RAZ A;  3HGG A;  1P4X A;  4NBQ A;  5F0H A;  5H20 A;  1Y1W J;  2JVH A;  1R5I D;  3BJ6 A;  1D3Y A;  2R7T A;  5DUK A;  1WJA A;  4ENM A;  3AL0 B;  2E19 A;  3H1C A;  4BL0 B;  3F6V A;  3DTK A;  9ANT A;  3ISP A;  1OR7 C;  3RDI A;  5IYD J;  2XPW A;  5CPR B;  2M4G A;  2YR2 A;  3JRI A;  2XRN A;  3NAU A;  1FOK A;  4D9J A;  4JP0 A;  1N75 A;  2L9S A;  2M2E A;  5ERI A;  2MG4 A;  5K5O A;  1XGM A;  4BS9 A;  2WV1 A;  3RQI A;  4DQ2 A;  2VKE A;  4Q4Z F;  2EFP A;  1HDP A;  1HKQ A;  5A2Q K;  4PK4 A;  1RKT A;  1IN6 A;  2YX4 A;  1DQU A;  5EG0 B;  2LTP A;  1BR2 A;  4D5F A;  5K7H A;  2BVL A;  4CIC A;  2GA2 A;  2VPL A;  2F6C A;  1FP2 A;  3L2U A;  3P7N A;  2OBP A;  3NWS A;  2PJR B;  3QU3 A;  2XF5 A;  2M8E A;  4XR6 A;  1Z21 A;  1FMW A;  3EYI A;  5EGO B;  1YIJ I;  2CO5 A;  2A69 F;  3TP3 A;  5JR3 A;  2HVR A;  1KQ9 A;  3JRE A;  4H0E A;  2MD5 A;  4CSW A;  2OA4 A;  1ETX A;  1JUS A;  2DW4 A;  2JSC A;  5GTH C;  3AG2 H;  1MBE A;  2A68 F;  3SHF A;  2DA6 A;  1XSD A;  5D4R A;  5FLM J;  3GLL A;  3RZD J;  2WAE A;  1S29 A;  5E3L A;  3D5S C;  1DP7 P;  4OIN F;  1R22 A;  4UXN A;  3ZQI A;  5FJ8 J;  3CLQ A;  1ORK A;  3SEZ A;  2HOS A;  3E0J B;  3MZY A;  1PJR A;  2EIL H;  1TW2 A;  3VYT B;  1CF7 A;  2LY9 A;  2L2O A;  2E1O A;  4KIF A;  1REP C;  2JVG A;  4LG0 A;  3JTG A;  2V6C A;  1A04 A;  4LK1 F;  1HC8 A;  3OSF A;  2P8T A;  2VB6 A;  3R0A A;  2BY2 A;  5FKN A;  1LB2 A;  1MMG A;  3CJT B;  4BEH A;  1FEX A;  5GAG J;  3TKY A;  2QBY A;  1PYV A;  1Y0N A;  2XKP A;  3HG9 A;  1T0F A;  4YFN F;  1SFU A;  2LH9 A;  2E2H J;  2D45 A;  4MNU A;  1Y0U A;  2CSO A;  2KDO A;  1LDD A;  1NK3 P;  2FQ4 A;  2K9L A;  2GA1 A;  3JRD A;  2GIZ A;  4L5E A;  1A5J A;  1GLN A;  2HPI A;  2V9V A;  3DBL B;  4ETS A;  1GVD A;  3ZOB A;  1N77 A;  1IXS B;  4YRV A;  1AKH A;  2FU4 A;  2LY1 A;  3K4C A;  1LE8 B;  1IXR C;  1YIO A;  3OIQ A;  1F43 A;  2V7F A;  2VQH A;  1YW7 A;  4LB5 A;  3PO3 J;  4EM2 A;  2ID3 A;  2DT7 B;  2QLZ A;  4BY7 J;  3RPU D;  3T5X A;  1JTY A;  2EIK H;  2STT A;  4GFB A;  1Z77 A;  2O0Y A;  4IHV A;  1B72 A;  4IKF A;  5LGU A;  2DTR A;  2HXI A;  4J00 A;  1BI2 A;  4FT8 A;  3N05 A;  4M3E A;  4N4O B;  3HOT A;  4A5M A;  2EQR A;  1FSH A;  2TCT A;  4OAY A;  3CCQ I;  3FM5 A;  4DYR A;  3HB9 A;  3ZQH A;  1CF7 B;  1LPQ A;  3T0Y A;  1TQI A;  4HV6 A;  4ZYE A;  2L01 A;  3PSF A;  1AOY A;  4KIC A;  3PQJ A;  2JA2 A;  3EDP A;  2JA6 J;  2A6H F;  1G3Y A;  4HLY A;  4F91 B;  1YRN A;  1OKR A;  1STZ A;  4DIQ A;  3GW2 A;  3WHC A;  1G2H A;  3ABM H;  2MBF A;  1V5F A;  2QM3 A;  2QSF X;  3QP5 A;  1SD4 A;  2KJB A;  2OV7 A;  3BWG A;  2K40 A;  1QHH D;  1FT9 A;  4W1U A;  4C2M J;  4WXC A;  3MKL A;  2PFB A;  1RR8 C;  4FQG A;  4HZF A;  4I01 A;  3H3U A;  3ZMS A;  3VPR A;  1VQN I;  5IT3 A;  1U6G A;  2LY2 A;  4PJM A;  3VYS B;  2NOG A;  4BDY A;  2VOD A;  5HOO A;  5DCM B;  3H0D A;  3CCJ I;  3ZQQ A;  2E60 A;  5DCF A;  3F22 A;  4K2E A;  2XAQ A;  3CC4 I;  3VSL A;  4L0Y B;  5D5U B;  4V19 K;  3O8G A;  3IP4 B;  4QLC U;  1O4X A;  3FHZ A;  1XCV A;  5FFZ A;  1ZGW A;  1QPI A;  3K1N A;  5FO5 A;  1QZY A;  5KNL A;  4U88 A;  3BZK A;  4F52 A;  1GDT A;  5J1Y A;  1HDD C;  3K69 A;  4BJ5 C;  5DD8 A;  4KN4 X;  5LEJ A;  1P7I A;  2JT1 A;  4RGR A;  1BN5 A;  4AYB N;  1JT0 A;  1W7P D;  5KHD A;  2PI0 A;  2YX7 A;  5TJJ A;  4AU7 A;  2J5P A;  5C4J J;  2MLK A;  3BP8 A;  1IXC A;  3CME I;  3PJR A;  5CQG A;  4Y17 A;  1IO2 A;  3HRT A;  4XOP A;  2PMZ A;  3TP0 A;  1S7A A;  5F6F A;  2A61 A;  3KZZ A;  2ZFW A;  1R49 A;  3HBL A;  1I39 A;  1B4A A;  4A3L J;  3M1C A;  3I0T A;  3JR9 A;  3C7J A;  3DPL C;  2BYV E;  3A01 A;  1ENH A;  3KYC B;  4BGD A;  2BY3 A;  3REO A;  2JRM A;  1JKO C;  2GIV A;  3P9C A;  3GTG J;  5LHI A;  5D4S A;  3HPH A;  1MDM B;  3CCV I;  2R7Q A;  1EKE A;  1MJA A;  1W1W E;  1QO0 D;  1MBG A;  5EEA A;  2IS1 A;  2K02 A;  4XQF A;  1LJ9 A;  1D5V A;  2Y48 A;  1R23 A;  3ZXS A;  4MTE A;  2EV6 A;  3S32 A;  2HU9 A;  3IH2 A;  5JI6 A;  2B7E A;  2VC1 A;  1WCM J;  3CTA A;  5IP6 A;  1U8R A;  2EZI A;  2WAQ N;  2CG4 A;  1R36 A;  2XAF A;  2PN6 A;  1ZAR A;  3SDG A;  3CC2 I;  2BZT A;  2OF7 A;  5J1U A;  2IPQ X;  1LDK B;  4I0A A;  1H8A C;  4EV0 A;  4YIR X;  2OQG A;  3E5Q A;  5D5W B;  2EH3 A;  3CCE I;  2EA4 A;  3PL8 A;  2X9D A;  3WG7 H;  3S3M A;  2I8D A;  4OIO F;  4A3D J;  1BR4 A;  2VBW A;  1JGS A;  2EFQ A;  2X48 A;  4C3H J;  5L3C A;  1TC3 C;  1YOV B;  3KIO A;  2DI3 A;  2P5L C;  5LRS A;  2HDC A;  3UNG C;  2Z99 A;  3IKV A;  4XLE A;  2HDD A;  1WJC A;  1LE8 A;  2K4J A;  1MH4 A;  2LYC A;  1QZZ A;  4XL9 A;  3NQO A;  3E1S A;  3K70 C;  2E35 A;  1YG2 A;  5ILV A;  4XN0 A;  1WPK A;  4JOM A;  1Z0X A;  3Q9V A;  1SD7 A;  5A2Q Z;  5K7F A;  1IRG A;  4LG3 A;  2OPT A;  2XHK A;  3GXO A;  3JRA A;  1TT0 A;  3V7R A;  3L9F A;  3J81 K;  1HST A;  2F5C A;  2QBY B;  1ERD A;  3DWL E;  2CGP A;  4Y33 A;  1BR1 A;  2DCE A;  2YU3 A;  4U87 A;  4UV8 A;  1I6X A;  4M3D A;  2X4H A;  2UXX A;  2QVO A;  5B5E C;  2CWE A;  5HS7 A;  4A3C J;  1D8J A;  1R1V A;  4A6E A;  3A4C A;  4B09 A;  1OCP A;  2ZNZ A;  5J4Y A;  3JSP A;  4UV9 A;  4G7H F;  3T8R A;  1TNS A;  4A3K J;  1I50 J;  4ZZD A;  4XBF A;  2B63 J;  1ZTR A;  5F08 A;  3DEW A;  3C2B A;  3MFK A;  2NVT J;  3J80 K;  1ZHF A;  1H0M A;  4RA2 A;  5FD5 A;  4C3J J;  2K9M A;  1IN4 A;  2X6W A;  2ISZ A;  4XSX F;  4YG2 F;  2MC4 A;  1T2K A;  2QSH X;  5ICE A;  1Z9C A;  5EGO A;  2EBI A;  2OUM A;  1T38 A;  1K6Y A;  2FXA A;  4EJU A;  3SZP A;  3BG3 A;  2PJR A;  1Z6R A;  4MIM A;  4ZH4 F;  4KIT B;  1GV2 A;  3WTV C;  2BGC A;  3WGH A;  2PX9 A;  2XGC A;  3ONQ A;  4NDL A;  2A6T A;  5LLQ A;  1BI0 A;  1R5H A;  4KNY A;  3OYG A;  3FK7 A;  2CRG A;  4P1W A;  2Y0S A;  3BR1 A;  4N9H A;  4D7N A;  2VXZ A;  4E7J A;  4RM2 A;  1DDN A;  1MD0 A;  2K4B A;  3HXL A;  1IJW C;  1P6R A;  3FF5 A;  2EZH A;  3FKI J;  3JAM K;  1X1D A;  4YIF A;  2CV0 A;  3CCU I;  3V42 A;  3J7Y J;  2XGX A;  3TO7 A;  3JSO A;  4M9X A;  3VOE A;  1LFB A;  3BZ6 A;  2X51 A;  4EGZ A;  3G2B A;  3X2Q H;  1YX3 A;  3ELK A;  2EIM H;  2HKX A;  5FKO A;  2WY8 Q;  2IS4 A;  1HQC A;  4G7Z F;  1G59 A;  2HPM A;  1HCR A;  4HNT A;  4RM3 A;  3CDL A;  1UMQ A;  4ITV A;  2VKV A;  4XSZ F;  3O8H A;  3VDX A;  3H9Q A;  3DBR B;  4RAY A;  3IH3 A;  2GBY A;  3B02 A;  4I09 A;  1TT5 B;  1NH3 A;  4M71 A;  3AG4 H;  3GTQ J;  3L7W A;  4BYY A;  4M6Y A;  2W84 A;  2A05 A;  2DQR A;  3M1E A;  4HW0 A;  2QWW A;  4BXU A;  1ZG3 A;  2MGQ A;  3KZI C;  2H8R A;  4RS8 A;  4Z2Y A;  1JUM A;  3C3W A;  1ZN2 A;  1HA8 A;  1P4A A;  4XLA A;  4IQJ A;  3F8C A;  1A31 A;  3WE2 A;  2JJ7 A;  1QRY A;  3HRS A;  4A0Y A;  5K7Z A;  2W48 A;  3JW4 A;  1U9O A;  4ZTF A;  4BXX J;  4EJW A;  2PMH A;  2ESN A;  2Z5U A;  2TRT A;  3OS0 A;  1W4M A;  2LR8 A;  5LRR A;  5BOX A;  4M9S A;  5E8G A;  2XPV A;  3W2W A;  4AIH A;  4L5I A;  3SQN A;  3FMS A;  4F7Z A;  4EJV A;  4ENN A;  2L9R A;  1YE9 A;  3K4N A;  4N4N B;  1LKX A;  1ETW A;  1Q1H A;  1YFH A;  4N0B A;  3BJA A;  4UNO A;  2NVQ J;  2GAU A;  2DDA A;  2GOM A;  2P5V A;  1W5S A;  4BJ6 C;  1FOY A;  1S3J A;  3CP8 A;  3I53 A;  2I10 A;  2V26 A;  1LVK A;  4UUS A;  2JA7 J;  4RB2 C;  4C9Y A;  5IP9 J;  2LMD A;  4WCG A;  2CQQ A;  3L1P A;  5TGT A;  2ELJ A;  1BIA A;  5AON A;  2BV6 A;  4JX5 A;  1XMX A;  3ECH A;  3DTI A;  1IZ1 A;  2LD5 A;  1JI8 A;  1K4T A;  3A0H C;  3HIF A;  4IRG A;  1HF0 A;  3CJN A;  3LFU A;  3TO9 A;  3VYR B;  4JX4 A;  2PBI A;  3CUQ A;  4MFE A;  2X0L A;  1IV6 A;  1VI0 A;  1IDY A;  1OCR H;  3QOD A;  3S1Q J;  5DM7 F;  5IYB J;  1RES A;  1EH7 A;  2WY7 Q;  2HVQ A;  3HTU A;  3ZMV A;  3D5R C;  3I54 A;  4CXF A;  1R7J A;  3FXK A;  2VON A;  1FTZ A;  2R5Y A;  5F1R A;  2VJI A;  3PM1 A;  4EEF G;  1TQM A;  3TDZ C;  2WWY A;  2RV8 A;  1Z05 A;  4LD5 A;  2HOT A;  4LLG F;  4LK0 F;  2E71 A;  4GXO A;  2WAF A;  5HOD A;  1FMV A;  1WJE A;  1TNT A;  2O7O A;  5H6R A;  4XM3 A;  2Y9Z A;  1MZB A;  1B8I A;  2DA5 A;  1WHU A;  4L5J A;  5TRD A;  1HOM A;  3GZ6 A;  1U0J A;  4P5O A;  4OIQ F;  4P9F A;  1J0R A;  3K9T A;  1BW6 A;  2P6T A;  2QSG X;  2R7S A;  2H6B A;  3ROU A;  2KL4 A;  2ZJR F;  1GXP A;  1XC5 A;  4W97 A;  4A69 C;  3WTY C;  1P4W A;  5L3G A;  1ZK8 A;  2XGD A;  4S05 A;  1OCO H;  4GYG A;  2MW8 A;  3VYU B;  4JX6 A;  3KX2 A;  3W6K B;  3DCF A;  4PUS A;  3IAS 2;  3CUQ C;  1J7K A;  2GZW A;  3BQY A;  4OAZ A;  2ZME B;  4S04 A;  2M87 A;  1XPX A;  1RI7 A;  1HW5 A;  3RKW A;  5HS9 A;  1ZG1 A;  4G6D A;  1BI3 A;  5E79 C;  2CUJ A;  3WTW C;  2IAI A;  3CES A;  4LMY A;  4PJL A;  5E18 F;  1ZG5 A;  5DD4 A;  1T39 A;  1IUY A;  3SJM A;  3GO5 A;  3KP7 A;  4HST A;  1UG2 A;  4V2F A;  4MLO A;  3OYH A;  2BW3 A;  2Y2Z A;  1ZEL A;  3OL4 A;  3ZRG A;  1B9N A;  5IP7 J;  1SEU A;  4HF1 A;  1R58 A;  5C44 J;  4CDG A;  3RTR A;  3H5N A;  2NVX J;  2M1B A;  2R7O A;  2EIJ H;  2VUM J;  3ESW B;  5F27 A;  3FBN B;  3HYI A;  3TW7 A;  2E2I J;  1OLT A;  4RB0 A;  3E5X A;  2VJ5 A;  1MBK A;  3F8B A;  2BXZ A;  2DFI A;  1AA7 A;  1FYM A;  3FIW A;  2IVM A;  2ZJ2 A;  4GRI A;  1FNN A;  3ZN1 A;  1TWF J;  3BZC A;  2D5V A;  1N25 A;  2UXN A;  2V1X A;  3M8E A;  2G7H A;  1BW5 A;  2MC3 A;  2K9N A;  4RGX A;  3PIP F;  5GTI C;  5DDG A;  4XMY A;  5FLV A;  3Q5F A;  2XF7 A;  4PSX A;  4CCN A;  3R0J A;  4XON A;  2VOO A;  4A3J J;  2M4K A;  3EQL F;  5CVU A;  4TV7 A;  5C3E J;  3JRC A;  4IOA F;  3IHU A;  1RZ4 A;  2Q2E B;  1Y56 A;  3EET A;  3LSK A;  2VLA A;  1WH5 A;  1S7O A;  2HKO A;  2KFD A;  5IT9 K;  2EV5 A;  3KEO A;  1I5Z A;  1DP3 A;  5IYC J;  3HRM A;  2JA5 J;  4D5C A;  3OOP A;  1MW7 A;  2F48 A;  3E97 A;  4CHU A;  3D0S A;  2XUB A;  4UVC A;  3AKZ A;  3C1D A;  2OZ6 A;  2M7A A;  3R61 A;  3WHB A;  3G6E I;  3KP2 A;  4MTD A;  2IA0 A;  1WGX A;  3OR1 C;  1UZC A;  5LHG A;  4HA8 A;  1UEL B;  1T6S A;  2L4M A;  1G6N A;  1FYL A;  4IRI A;  1EH8 A;  1ULY A;  5KAF C;  3RI4 A;  1D0X A;  2C6Y A;  2HOA A;  4MEX F;  3BCB A;  2BXY A;  3IWF A;  1X3U A;  4U0Y A;  3S15 J;  3FX3 A;  3H36 A;  1QU3 A;  4I99 C;  4XIC A;  4JK1 X;  1K78 B;  3OYB A;  1FWZ A;  1I6H J;  3FXM A;  4XN3 A;  4KDP A;  3KCC A;  2ZCW A;  1OCZ H;  1IRX A;  1V5G A;  3I59 B;  2HNH A;  1O7L A;  1U5T A;  3FM3 A;  1D8K A;  1QA6 A;  3TBI A;  3GLX A;  1F9N A;  3P5J A;  1ODD A;  2DQL A;  3IL2 A;  4CCJ A;  2VN2 A;  2EFO A;  1X1C A;  2JPC A;  2GXG A;  5LFA A;  2QUF A;  3GFJ A;  1BJZ A;  1Q1V A;  2ICW G;  5F1J A;  5DEQ A;  1FPQ A;  1G3W A;  3LL7 A;  3U21 A;  1WZ2 A;  2OAZ A;  1X19 A;  3K70 D;  2JTV A;  1R71 A;  3QAH A;  1VQ4 I;  3GFM A;  1WVR A;  3W2V A;  3AL0 C;  2RNJ A;  3QYF A;  1JJ8 C;  5LBQ A;  3HHH A;  1K79 A;  5H2F C;  4J19 A;  2DJI A;  3CMY A;  3J7A O;  1KYW A;  2R5Z A;  1F5T A;  3MN2 A;  5TIS C;  3QRF F;  3S2D J;  3MKY B;  2R0Q C;  2DA7 A;  3BY6 A;  1XSV A;  2KRC A;  2M5W A;  4G94 A;  4AD9 A;  2QGU A;  1Z6T A;  4IF4 A;  2VT3 A;  4G6Q A;  5F04 A;  1VQK I;  1OYY A;  2EFW A;  4DW6 A;  4HRI A;  4RBO A;  1FZP B;  3LMM A;  1FIA A;  3BCA A;  3CDH A;  2V1U A;  1SFK A;  2HDW A;  2W82 A;  3KEY A;  3ZP5 A;  2Y0S N;  3A0B C;  3G73 A;  5KK1 A;  5FRO A;  1SFE A;  1JE8 A;  3TGN A;  1ZR4 A;  1EH6 A;  3C2G A;  4PSW A;  3SEQ A;  1JJ6 C;  2ZME C;  3LA3 A;  1I3Q J;  2FMY A;  2DA3 A;  2FNA A;  2KIS A;  2DLL A;  5GPC A;  1E3P A;  3BG6 A;  2A5Y B;  2DJN A;  2QF7 A;  2ZO4 A;  3I3L A;  3PNT A;  4NHJ A;  1DPU A;  1ZLK A;  2Q1Z B;  5BQT A;  1VQO I;  1VQ8 I;  3KP4 A;  3MZH A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 1MH4 A;  1LFU P;  3HGY A;  4M3B A;  3BR6 A;  4HNV A;  4S0H B;  1WPK A;  2LP0 A;  2MSY A;  1Z0X A;  2QCO A;  5GP9 A;  4FIS A;  5K7F A;  4A3G J;  3S2H J;  2OPT A;  3BR0 A;  3JRA A;  2KT0 A;  1U78 A;  3LNQ A;  3HM5 A;  2FD5 A;  1ZR2 A;  1B72 B;  5E3N A;  3TED A;  4M3D A;  5J3L A;  4A3C J;  3LSJ A;  1OCP A;  4Y52 J;  3CQZ J;  2G0E A;  1VFC A;  2O8K A;  3H0G J;  3HOV J;  4A3K J;  1I50 J;  3HOW J;  2LFB A;  2M9H A;  1AKH B;  2B63 J;  1ETY A;  1ZTR A;  3Q3S A;  5F08 A;  3DEW A;  3C2B A;  4UUT A;  3D1N I;  2NVT J;  3I4N J;  1U9N A;  3S1N J;  3K7A J;  4C3J J;  1P7J A;  2LKX A;  3BR3 A;  4FE7 A;  2RAE A;  3S1M J;  4FTH A;  2R7Z J;  1FJL A;  5C4X J;  2ELK A;  2HI3 A;  1RPW A;  2L7F P;  2DTZ A;  5EGO A;  1DU6 A;  2EBI A;  3BG3 A;  1K61 A;  4MIM A;  1OFC X;  1GV2 A;  1A6I A;  2XGC A;  4NDL A;  4G12 A;  3OIO A;  1X2M A;  4M6V A;  4M3F A;  4IHY A;  3FK7 A;  2CRG A;  3BG9 A;  3A03 A;  4XRM A;  3ZQF A;  3G1L A;  3Q0V A;  1GUU A;  3JRG A;  2HQ5 A;  3BR1 A;  2XB5 A;  4D7N A;  2P81 A;  5J1R A;  1MH3 A;  5IOY A;  1JKQ C;  1IJW C;  4I76 A;  2K9S A;  4BBR J;  2EZH A;  3FKI J;  4A3B J;  1XS9 A;  2ME0 A;  3B6A A;  1GT0 C;  2XRL A;  3LSG A;  3GTL J;  3IV5 A;  2JMW A;  3HOZ J;  4QSH A;  3BTJ A;  4B3A A;  3G1O A;  1LFB A;  2NVY J;  1OJL A;  5EZH A;  1TWC J;  1QVU A;  1GV5 A;  2ZB9 A;  3CCY A;  2ECC A;  1JGG A;  5EG0 A;  3GBG A;  1MNM C;  5FKO A;  4A3I J;  3GTJ J;  2Y31 A;  1HCR A;  1R9T J;  3HDD A;  1TWA J;  2IEK A;  1WI3 A;  3CDL A;  4MO7 A;  5FKK A;  3B6C A;  1UMQ A;  5M3F J;  2VKV A;  3JRF A;  3O8H A;  1W0T A;  2DN0 A;  3IH3 A;  2GBY A;  3S17 J;  2FJ1 A;  1JKP C;  1RKW A;  3GTO J;  5IPA A;  4IHX A;  2EZK A;  2FX0 A;  3GTQ J;  1PUF A;  1D5Y A;  1H88 C;  2NS8 A;  3TW6 A;  1MSE C;  1E3O C;  2MGQ A;  2H8R A;  2IBD A;  5EZG A;  4IHW A;  3RZO J;  1JUM A;  4DZP A;  2XPU A;  4XRS G;  4ABZ A;  3F0C A;  1IGN A;  3GTP J;  4XRS A;  2JJ7 A;  1SFO J;  1QRY A;  5K7Z A;  2W48 A;  3S1R J;  1U9O A;  4BXX J;  1HLV A;  2N8G A;  2KDZ A;  3HOU J;  2DMT A;  5EF6 A;  3I4M J;  3HOX J;  1ITY A;  2TRT A;  2LR8 A;  3ZQL A;  1ETO A;  1JTX A;  2XPV A;  3GTM J;  2L7M P;  4B1R A;  2L9R A;  4XK4 A;  3OSG A;  1ETW A;  1WH7 A;  3BR2 A;  3QQA A;  4CYC B;  2NVQ J;  4CYC A;  5M3M J;  2I10 A;  4UUS A;  2JA7 J;  5IP9 J;  3FK6 A;  3L1P A;  2CQQ A;  3HKZ N;  2XGE A;  1ETV A;  2R5Z B;  1EF4 A;  4JX5 A;  5M5W J;  2LD5 A;  5EDN A;  2M8G X;  1HF0 A;  2R92 J;  2DA4 A;  3HOY J;  2CUF A;  4JX4 A;  2YU9 J;  4MFE A;  1IV6 A;  3BTL A;  1VI0 A;  3HGG A;  3QPS A;  5F0H A;  1IDY A;  1Y1W J;  3S1Q J;  1NK2 P;  3M3Y J;  3S14 J;  5IYB J;  1RES A;  2E19 A;  5EYR A;  9ANT A;  1PUF B;  5IYD J;  2XPW A;  3JRB A;  3FIS A;  3JRI A;  1DU0 A;  1QVT A;  1FTZ A;  3NAU A;  1NTC A;  1IG7 A;  2R5Y A;  4JP0 A;  3PM1 A;  4EEF G;  1AHD P;  4M3G A;  2M2E A;  3Q0U A;  2MG4 A;  2HOT A;  4DZJ A;  1TWH J;  2WV1 A;  1XG1 A;  2AHQ A;  3RQI A;  2DMU A;  2VKE A;  5BNG A;  1HDP A;  2DMP A;  1JT6 A;  1RKT A;  1POG A;  5HOD A;  4FCY A;  4A3E J;  5EG0 B;  2ID6 A;  2LTP A;  3W6V A;  2O7O A;  4D5F A;  5K7H A;  2COB A;  2HXO A;  3BQZ A;  2Y9Z A;  1ETQ A;  3LOC A;  5DS9 A;  1B8I A;  2DA5 A;  3MVP A;  4DYC A;  2XSD C;  1HOM A;  1RR7 A;  1BW6 A;  1F36 A;  5EGO B;  3ZQC A;  3NAR A;  3TP3 A;  4LOC A;  3JRE A;  3IH4 A;  1T56 A;  3PO2 J;  1XC5 A;  1ETK A;  1ETX A;  1JUS A;  4W97 A;  1JUP A;  4A69 C;  3RKQ A;  1X2N A;  1MBE A;  1ZK8 A;  2XGD A;  2MW8 A;  2DA6 A;  4JX6 A;  4V2G A;  5FLM J;  3DCF A;  3RZD J;  5E3L A;  1VND A;  3BQY A;  1U8B A;  3GTK J;  2X6O A;  3ZQI A;  5FJ8 J;  1IC8 A;  3G1M A;  3ZQG A;  1ORK A;  2HOS A;  2IAI A;  2LY9 A;  2Y30 A;  2E1O A;  3SJM A;  2O9L A;  4FE4 A;  4V2F A;  1UG2 A;  4MLO A;  4A93 J;  3OSF A;  2DMN A;  3A02 A;  4I6Z A;  2Y2Z A;  5FKN A;  2AO9 A;  1FEX A;  1ZKG A;  5IP7 J;  1B8I B;  1FTT A;  3Q0W A;  4XID A;  3S16 J;  5C44 J;  2E2H J;  5JLW A;  1NK3 P;  1S7E A;  2FQ4 A;  2NVX J;  3JRD A;  2VUM J;  4L5E A;  5F27 A;  2E2I J;  2JWT A;  3TW7 A;  1A5J A;  3OOU A;  1BL0 A;  1MBK A;  1GVD A;  3ZOB A;  2R5Y B;  1H89 C;  1AKH A;  3FIW A;  1F43 A;  1LE8 B;  1TWF J;  2D5V A;  3PO3 J;  2CUE A;  2CU7 A;  2JN6 A;  1BW5 A;  2ID3 A;  2K9N A;  3H3V K;  4BY7 J;  2K9Q A;  4X1E A;  5FLV A;  1JTY A;  1MBF A;  4GFB A;  1Z77 A;  4A3J J;  1B72 A;  4IHV A;  5C3E J;  2HXI A;  3JRC A;  5IOZ A;  4M3E A;  1JKR C;  4BKX A;  3K2A A;  2EQR A;  2TCT A;  3LSP A;  1WH5 A;  2YUS A;  3M4O J;  2ECB A;  2R93 J;  4DYR A;  3HB9 A;  5IYC J;  3ZQH A;  2JA5 J;  2EZL A;  4D5C A;  1UHS A;  4AUX A;  2LVS A;  3WHB A;  2JA6 J;  3LSR A;  1WGX A;  1YRN A;  5FKM A;  1MSF C;  1RET A;  2WB1 N;  3WHC A;  1G2H A;  3BTI A;  2K40 A;  4W1U A;  4C2M J;  3MKL A;  2VI6 A;  2XB0 X;  1VF9 A;  2L7Z A;  2HOA A;  3VPR A;  2DA1 A;  3BTC A;  2HYJ A;  5F0F A;  2H1K A;  3BR5 A;  3S15 J;  2NOG A;  2NS7 A;  2ME6 A;  4XIC A;  5FKL A;  4DYQ A;  1I6H J;  2DMQ A;  4A3F J;  2JK3 A;  1W0U A;  3O8G A;  3BT9 A;  3QPL A;  1O4X A;  2M0C A;  3JRH A;  3BG5 A;  5F0C A;  4AC0 A;  1ZGW A;  1QPI A;  1BA5 A;  1X58 A;  1GDT A;  5J1Y A;  1Y1V J;  3A01 B;  1HDD C;  2L0K A;  4C3I J;  2M34 A;  4D7M A;  5E3O A;  4MFD A;  1P7I A;  3SFI A;  1BJZ A;  1Q1V A;  5F1J A;  4AYB N;  1JT0 A;  1OCT C;  5C4J J;  1TWG J;  1JJ8 C;  4Y7N J;  4J19 A;  1SAN A;  4A3M J;  1APL C;  2CJJ A;  3CMY A;  3TP0 A;  2R5Z A;  3MN2 A;  3HBL A;  2CQX A;  4A3L J;  1CQT A;  4BY1 J;  1MBJ A;  4IEJ A;  3S2D J;  3JR9 A;  4UUS B;  2R0Q C;  2DA7 A;  1T33 A;  2JA8 J;  3A01 A;  1ENH A;  4X6A J;  3GTG J;  1JKO C;  4BBS J;  4JYK A;  1K83 J;  1IRZ A;  5F04 A;  2LLK A;  4B4C A;  1MBG A;  5EEA A;  4DW6 A;  2GLO A;  4QIW N;  4RBO A;  2LK2 A;  1FIA A;  3UKG A;  2DA2 A;  3IH2 A;  4RDU A;  2E2J J;  1WCM J;  5IP6 A;  2Y0S N;  5M5X J;  2EZI A;  2WAQ N;  3SDG A;  2YS9 A;  2GM4 A;  2OF7 A;  5J1U A;  1ZR4 A;  1AU7 A;  1H8A C;  5M5Y J;  1JJ6 C;  1IDZ A;  5GPA A;  1I3Q J;  5E3M A;  1FIP A;  2EH3 A;  2DA3 A;  4QTR A;  2X9D A;  1ZQ3 P;  3HEF A;  5GPC A;  4A3D J;  1MBH A;  2VPR A;  5DTD A;  2PMZ N;  2X48 A;  2Y9Y A;  2DJN A;  4C3H J;  2QF7 A;  3E7L A;  1TC3 C;  1YRN B;  1IUF A;  5JLX A;  2HDD A;  1LE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...