1JKRC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*CP*AP*AP*GP*A)-3'
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkrC00
2NVTJ 3H0GJ 2DA5A 5J1UA 3E7LA 4A93J 4MLOA 2I10A 3A03A 1H88C 1AKHA 5FLMJ 3WHCA 3MN2A 2R93J 1FTTA 1FIAA 2GM4A 1NTCA 5IOZA 3HOVJ 4XIDA 3B6CA 1OCTC 4V2GA 3JRHA 3Q0VA 4MO7A 2W48A 1ETXA 3OSFA 4I76A 3CDLA 4ABZA 4XRSA 1JKOC 1QRYA 1B8IB 2GBYA 2LLKA 2K9SA 2XSDC 4A3GJ 1D5YA 2DA6A 3SFIA 3BR2A 1XG1A 2DTZA 1Y1VJ 4X6AJ 2Y0SN 3S16J 4LOCA 1TWFJ 1RKTA 2XPVA 2HOSA 5FKOA 1RPWA 4FISA 3IH3A 1RETA 3BTJA 3JRIA 5M5XJ 1GUUA 2CQQA 1UMQA 1MBEA 1T33A 2VKEA 4M3EA 4A3JJ 1VI0A 1JKQC 2NOGA 3BR6A 1U9OA 2E2JJ 2L7FP 2VPRA 1MNMC 2NS8A 2E2IJ 4DYRA 3GTGJ 3W6VA 3ZQGA 3TW6A 3ZQCA 3HOZJ 1OCPA 3B6AA 1O4XA 1TC3C 5F04A 4C3IJ 2XPUA 2MGQA 3HOWJ 2N8GA 4MFDA 3S1RJ 2MG4A 3CQZJ 5IYCJ 3GTMJ 1NK3P 1BJZA 1HDPA 4A3CJ 5IYDJ 5EG0A 2XB5A 1W0UA 3S1MJ 3HOXJ 5J1RA 3BTIA 3HM5A 2NS7A 2COBA 1T56A 2XPWA 3JRDA 2JWTA 4FCYA 1R9TJ 2E2HJ 5M3MJ 2XGDA 2KDZA 1TWCJ 1IJWC 3M3YJ 3JRCA 3IV5A 3JRFA 1HCRA 2HDDA 3ZOBA 5F0HA 4RBOA 4FE4A 1ZTRA 3HGYA 2IBDA 1WPKA 5IOYA 1FEXA 1JJ8C 4JP0A 3QQAA 4QTRA 3FK7A 2ME0A 3S17J 1ETOA 3GTPJ 3BR1A 3S15J 1Z0XA 5K7HA 5EGOA 4I6ZA 1MH3A 4IEJA 2JMWA 2PMZN 4BY7J 2LD5A 3RZDJ 3TEDA 4D7NA 3S2HJ 1P7IA 3BR0A 5EG0B 4RDUA 3S2DJ 4UUSB 2O7OA 1LFUP 1G2HA 2M2EA 1JUPA 2XB0X 1I6HJ 4UUTA 5GPAA 3RKQA 1BW5A 1ZK8A 2P81A 4A3IJ 3I4NJ 4D5CA 3FKIJ 2R5YA 1Q1VA 1GV5A 5FJ8J 1ZR2A 2JA5J 9ANTA 2IEKA 1HF0A 3FISA 3ZQIA 1IUFA 1ETYA 2O8KA 1QVUA 3LSGA 3O8GA 4XRMA 4FTHA 2EH3A 4D5FA 2O9LA 3BQYA 2K40A 1MBKA 5EDNA 1BL0A 1A6IA 1JTXA 3O8HA 3M4OJ 3BTCA 3IH2A 3HOYJ 3GTJJ 4IHWA 2YU9J 4QIWN 5C3EJ 3LNQA 1F43A 1LE8B 3FK6A 2R0QC 1RKWA 1JT6A 1ZKGA 4A3LJ 2HQ5A 2WB1N 3BQZA 4DYQA 2LKXA 3PO3J 4V2FA 4J19A 4BKXA 4DZPA 1NK2P 1QVTA 2WAQN 5EZHA 3GTLJ 4FE7A 2ZB9A 2K9NA 4AC0A 3Q0UA 4BBRJ 2TRTA 2YS9A 1OFCX 2CUFA 3NARA 3VPRA 1MBHA 3PM1A 1ORKA 2Y30A 5IP9J 2GLOA 2TCTA 3OOUA 1W0TA 3HBLA 1SFOJ 1IV6A 4G12A 3GTOJ 1I50J 1SANA 2L7ZA 1BW6A 3PO2J 1LE8A 4JYKA 3OIOA 3BG3A 1YRNB 2G0EA 3ZQLA 3WHBA 3HOUJ 1VNDA 4L5EA 3GTQJ 2ECBA 2WV1A 4JX5A 2XGEA 3C2BA 3A01A 3LSJA 5FKLA 5DTDA 4C3JJ 2QF7A 2CUEA 5E3LA 3BR3A 3G1OA 1K61A 5DS9A 1H8AC 3HGGA 4B1RA 4DZJA 1IGNA 2FQ4A 3BTLA 1JGGA 1MH4A 4XICA 4X1EA 4DYCA 3HKZN 3A01B 3LSRA 2CJJA 1Y1WJ 1JT0A 3CCYA 3JREA 2DA2A 2ELKA 5C4JJ 3BG9A 2ME6A 1YRNA 4IHXA 2FD5A 1IG7A 2AHQA 4M3BA 2EZIA 1FIPA 1AKHB 2E1OA 2M9HA 1PUFA 1P7JA 1FJLA 2Y9ZA 2OF7A 3ZQHA 5M3FJ 3H3VK 1IRZA 2X6OA 1IDZA 5K7FA 1U9NA 1RESA 3F0CA 2B63J 2VKVA 3I4MJ 1X2MA 2Y2ZA 3DEWA 5FKNA 4C2MJ 1FTZA 2L7MP 2JJ7A 2KT0A 3ZQFA 3G1MA 2HOAA 2L0KA 1ENHA 2R5YB 3LSPA 5F0CA 2EQRA 4JX4A 1U78A 5F1JA 2E19A 3Q0WA 1Z77A 2IAIA 5C44J 5M5YJ 1WI3A 2XGCA 1HDDC 3GTKJ 1ITYA 3LOCA 3RZOJ 2ECCA 2LVSA 3K2AA 1VF9A 1DU0A 4JX6A 4NDLA 1IC8A 1F36A 4A3KJ 4BY1J 1JUMA 4C3HJ 3K7AJ 2JA6J 5F08A 2M8GX 3D1NI 2DMQA 4A3BJ 2DA1A 1JKPC 2ID3A 1UHSA 2JK3A 1MBFA 3TP3A 2H1KA 4AYBN 1ZR4A 3HDDA 2DA3A 1CQTA 1XC5A 3Q3SA 1ZQ3P 2JA7J 3NAUA 3JR9A 1TWGJ 2DN0A 3G1LA 4W1UA 5BNGA 3QPSA 2M0CA 2NVXJ 2JA8J 2L9RA 2CRGA 5F27A 1QPIA 1GDTA 3IH4A 3MKLA 2CU7A 5J3LA 3S1QJ 2HXIA 5JLWA 3QPLA 3OSGA 4W97A 3BR5A 1ETQA 3HEFA 3UKGA 5EEAA 1MBGA 4B3AA 2DMTA 4XK4A 4XRSG 2R5ZB 2LFBA 3S14J 2X48A 1ETKA 1B72B 2R92J 2VUMJ 3TP0A 5C4XJ 4M6VA 5F0FA 5E3MA 3FIWA 1GVDA 1K83J 2DJNA 2LR8A 4GFBA 2FX0A 4CYCA 2RAEA 1HLVA 1AHDP 3BT9A 2AO9A 5FKMA 5FLVA 2HYJA 4M3DA 2X9DA 2EZHA 2K9QA 1OJLA 2LTPA 2NVQJ 1TWAJ 1MSFC 1IDYA 4DW6A 5EGOB 5IP7J 2YUSA 2DMPA 2MW8A 5M5WJ 1VFCA 2R7ZJ 5EF6A 1LFBA 1GV2A 1E3OC 4IHYA 3HB9A 2OPTA 2DA7A 1JKRC 4Y52J 1RR7A 2LK2A 4CYCB 1MBJA 1XS9A 4M3GA 4IHVA 4HNVA 3JRGA 2NVYJ 2MSYA 4D7MA 2DMNA 1GT0C 4BBSJ 5E3NA 2EZLA 4QSHA 3A02A 5K7ZA 1JJ6C 1UG2A 2R5ZA 2H8RA 1U8BA 3L1PA 1H89C 4BXXJ 2EBIA 4A3FJ 3SJMA 2LP0A 2ID6A 1ETWA 1JUSA 2QCOA 3TW7A 3RQIA 5IYBJ 2DMUA 2JN6A 5IP6A 1A5JA 1X2NA 4S0HB 3SDGA 4MFEA 3DCFA 5HODA 1TWHJ 4EEFG 1PUFB 4A3EJ 3S1NJ 1EF4A 4A3DJ 1DU6A 1BA5A 5EZGA 5E3OA 3MVPA 2D5VA 1WCMJ 1HOMA 1S7EA 1WGXA 2CQXA 2HXOA 2VI6A 1MSEC 2Y9YA 5JLXA 1AU7A 1I3QJ 2DA4A 1WH5A 3JRAA 4Y7NJ 3BG5A 4AUXA 2FJ1A 3CMYA 1JTYA 2Y31A 2LY9A 4MIMA 3JRBA 2XRLA 4UUSA 1POGA 4M3FA 5FKKA 5IPAA 1APLC 5J1YA 4A69C 3GBGA 1ZGWA 2HI3A 5GPCA 2M34A 2EZKA 1B8IA 1ETVA 5GP9A 2HOTA 4A3MJ 4B4CA 1WH7A 1X58A 1B72A 5EYRA
chains in the Genus database with same CATH superfamily
1XGNA 4CCJA 4XKWA 3FBNB 3W3CA 3E7LA 3K2ZA 4LB6B 2FNAA 2A61A 2I10A 1H88C 3CTAA 1DDNA 4BHPA 5FLMJ 3LSTA 1FIAA 3D5RC 3OIQA 4WXDA 4ETSA 3GZNB 2OUMA 1KGSA 2VB6A 4XL9A 4CXFA 1ETXA 1ERDA 1Z7LA 2PI0A 2OQGA 1QA6A 2KQRA 4ABZA 4XRSA 3E3VA 1FYLA 2K9SA 2ELHA 2XSDC 1J2XA 1D5YA 3FXJA 2RGVA 2MD0A 3MZYA 3SFIA 1U5TA 4RS8A 3KP2A 1Y1VJ 4QPQA 5D6FA 1TWFJ 1RKTA 2XPVA 4E7LA 3Q9VA 2GIVA 1S29A 4UNOA 3ZN1A 2EV6A 4L5IA 5IY5H 1BM9A 3JRIA 4XMYA 1F4KA 1GUUA 2HR3A 1W5TA 5IT3A 1Y39A 4M3EA 1ZH5A 1XCVA 1S9HA 5IT9K 3L7WA 1IXRC 3JTHA 2HDCA 3EUHC 2EFPA 3V8LA 2QEXI 3IC7A 1VQ6I 1YX3A 3PUBA 1E0EA 3DTKA 2NS8A 3M1EA 1WRJA 3HOZJ 1NHAA 1YE9A 5CPRB 2CV0A 2X0LA 1XCBA 2DYRH 4M74A 2Z16A 3B02A 1SMTA 4YIFA 3WTYC 3G71I 2N8GA 2MG4A 2Y69H 1HDPA 4A3CJ 4YRVA 5EG0A 4H0EA 1E2XA 2XB5A 5BMZA 1W0UA 4ENKA 5J1RA 5IT9Z 3BTIA 2KJCA 3HM5A 1LEAA 1EH7A 3RPUA 3WTWC 2XPWA 1R9TJ 2JWTA 4HYEA 1O3RA 2KDZA 2OQRA 1IJWC 3OYDA 3UR3C 3IV5A 1MD0A 3OY9A 2LBFA 1P92A 5F0HA 2DTRA 3HTUA 4FE4A 4IOAF 1STZA 3L2UA 4AYBA 2ZO4A 2JUGA 2DQRA 5B1BH 3FK7A 4GO1A 2VIXA 5K7HA 1FBSA 4K2EA 1MH3A 4HSRA 2V79A 1T08B 1RZ4A 2YX4A 2V1UA 2F2EA 4LG0A 2E35A 1S8NA 2LD5A 3TEDA 1RNLA 4PK4A 2A6TA 3S2DJ 3S2HJ 3V7SA 3FHZA 4Z2YA 4XSZF 4RAYA 5L3CA 1G2HA 3OYHA 1LKXA 4DIQA 1D5VA 1BJAA 1T39A 4HF2A 2JTVA 4XLEA 1U6GA 2R7UA 5J4VA 4A3IJ 4D5CA 1Y0UA 3OIPA 1O7FA 1S7AA 5EJCA 3J7AY 2XAHA 3HZJA 5EEGA 2EFQA 3RIRA 3T5XA 5H6QA 5FJ8J 4HQMA 4XLCA 3W2WA 4Y15A 3ZQIA 3KP4A 2H6CA 2GXAA 3GWZA 3H5NA 4PJ0C 3OYMA 5DM6F 1EKEA 2EH3A 3BQYA 3DPLC 2ISZA 2WY7Q 1BL0A 3LSHA 4L9VA 4AIJA 2W57A 2V26A 2AQEA 2VT3A 5JI6A 4BH9A 2P5KA 3LAPA 2P6SA 2DOAA 3FK6A 2R0QC 1RKWA 5HLGA 2Z3YA 2LKXA 3PO3J 2GAUA 3AG3H 5TRDA 3CO7C 5K1YA 2WAQN 3SYTA 4S04A 2R3SA 2LY1A 4M9ZA 4XR6A 1R1UA 3NARA 1E17A 3FHNA 3PM1A 2Y48A 2VQLA 5E18F 1ORKA 2DLLA 4CO8A 1YTYA 4NC8A 2R7RA 3OOUA 2KIFA 1EH8A 3QU6A 2BW3B 4II3A 4IO9F 1FOKA 4KISA 4G12A 4ON0A 3GTOJ 5DCMB 1LE8A 1KQ0A 2HKOA 1MNDA 5HLHA 1VQKI 2V6CA 1D3YA 2WV1A 4JX5A 2XGEA 3DKXA 2VBYA 2M7BA 5DTDA 4GCVA 2XGXA 3HC7A 1K79A 5E3LA 5FD5A 4UUVA 4R1HA 4PFPA 2QBYB 5LFAA 2DOEA 4D0PA 2BE5F 3PUFA 3UNGC 4J00A 1N25A 4YIIA 2F5CA 1T6SA 2JSPA 1FBQA 1QO0D 2P4WA 4BE0A 1TNSA 2FQ3A 1B59A 5EEHA 2M1BA 3V8KA 1PUEE 3FM5A 3J7ZI 2IRFG 5HDNA 4Q4ZF 2PQ8A 2ZFUA 3PQJA 1OPCA 2OJED 1G3WA 2FD5A 5JVGF 3QP6A 2KZVA 2AHQA 4RGUA 1IG7A 1Y0NA 3CLQA 3BZ6A 1U8RA 2E1OA 1IW7F 3R60A 3MFKA 3J81Z 4RM2A 3ULQB 4LITA 3OYEA 3E5XA 2BBYA 2MH9A 4KN4X 3CUQA 3K1NA 1YW8A 3LMMA 4IXAA 2BY3A 1ZRFA 1XSDA 1GXQA 2VPLA 4ZDPA 2V9VA 3GO5A 4LGWA 1WJ5A 2ZMEC 3RPQA 3QRFF 3ONQA 2Y0SA 1TQIA 2L02A 5CYVA 2QUFA 1XGOA 2K4JA 1R6RA 1CF7B 1WWXA 2IAIA 4BQNA 2C6YA 3DTEA 3L09A 1HDDC 2BYVE 2E34A 1UFMA 3DBLB 4UXNA 5KAIC 4WX9A 2Y0MA 2BV6A 3DPTA 2BOLA 2R7TA 3ELKA 2ECCA 4WXHA 1MZBA 1Y8QB 4PCQA 1I1SA 4MNUA 3HHHA 3F9KA 2V9PA 3WE3A 3U21A 1FP2A 4PJLA 4XRFA 1Z05A 3H3ZA 4C3HJ 2ZC2A 2E5ZA 4YFXF 4HG2A 3JSOA 4AIDA 4FT8A 4UV8A 2ICWG 2R7VA 1I5ZA 2O61A 2PX9A 4E7ZA 3K70C 2DA1A 2L7KA 2ID3A 1O57A 4R8HA 4WCGA 1IXSB 2GZWA 2DA3A 1AOYA 2CSOA 3KCCA 5LGTA 1RC9A 3A2KA 5FLXK 4YFNF 3EDPA 2QKLB 3G1LA 1G8XA 3QPSA 2NVXJ 1TL8A 2L9RA 2XRNA 2VKHA 1PP7U 4IQJA 1CF7A 1I39A 4JBAA 2CU7A 5J3LA 4ITVA 4EJOA 3H36A 2HXIA 4XOTA 2EFNA 2V1NA 3GXOA 3I9V2 4W97A 4NQWB 1RI7A 2DQLA 3PSIA 5DCFA 5DM7F 5LLQA 2QM3A 4B3AA 1VQNI 2PJPA 4Y4RA 1HW2A 2LFBA 1FP1D 4HLYA 2E71A 2R92J 3TP0A 2DW4A 4ZDLA 2QGUA 5F0FA 3FIWA 4L5JA 2OCCH 1BIBA 3S93A 4XKBA 2RAEA 3W6KB 5DUIA 3TO9A 1B1BA 5A2QK 4CYCA 4ZDOA 4HEA2 3BT9A 1P9QC 2E1CA 2AO9A 2A68F 5FKMA 1Y56A 4BXFA 4MGRA 2K9QA 2M8EA 2HYGD 1YHQI 2NVQJ 4PUSA 3CO6C 3C7JA 3S2WA 2HU9A 2B9SA 2NNNA 1RUNA 3DF8A 4A0YA 3S3OA 1VQ8I 3J7YJ 4ANJA 2OTLI 2O0YA 4ASNA 1OCZH 1DGWY 1YQAA 2IA0A 5AONA 2DODA 3C3WA 4FHTA 1FMVA 1WJAA 2DA7A 2CV1A 4Y52J 4FETA 2DK8A 2IGNA 3FX3A 4I7HA 2BY0A 3D5SC 1XGSA 4YG2F 2FNPA 4D7MA 2IGKA 3K4LA 3QP5A 2VOOA 1R5GA 5ICCA 1UG2A 1YG2A 3VOEA 1U8BA 4BXXJ 2EJRA 2E1MC 2W4SA 4BL0B 1IN7A 1IUYA 1JUSA 2I5UA 2L54A 2DMUA 4Y33A 2OC6A 2HS5A 1YJ9I 4BGDA 1MDMB 4XQFA 4RM3A 3K4MA 1CGPA 3E6DA 5CVJA 1A5JA 5FFZA 3H5RA 3RDIA 3BROA 2JVGA 3IHUA 1SD5A 2VONA 3HJEA 4G6TB 3WTSC 2B0LA 3SZTA 4F3QA 4HNUA 3S1NJ 3RPUD 1W1WE 4IQ4A 3VSKA 2WWYA 3E0JB 3N4MA 3RKYA 1FBUA 2OZUA 2FA5A 2EK5A 2VI6A 5ICFA 2M7AA 3TDZC 3KP7A 2W00A 5JLXA 2CFXA 1PJRA 2JA2A 4Y7NJ 5LGNA 3FZVA 1ZLJA 1R58A 3M9AA 2FJ1A 3REOA 3BG6A 2IJLA 3HOTA 2W7NA 1KYWA 1FY7A 4M3FA 2UXXA 1F5TA 2GOXB 3RTRA 4RGXA 4DNCA 5LRRA 1JHHA 4M73A 1R1TA 3WTTC 1P2FA 1WI9A 5IPAA 1H9GA 3M8JA 4A69C 2BXYA 3MEXA 2HI3A 2HQAA 2A6EF 4FX4A 1ETVA 5GP9A 2YSRA 3NQOA 5HDKA 5D8KB 3ZCOA 3ZP5A 1XN7A 2F48A 4BBRJ 4ENNA 3KLNA 2NVTJ 4UY8I 2KL4A 4A6DA 5CQEA 2XVCA 2EILH 3F72A 3A03A 3BJ6A 5K5OA 4OWRB 3I56I 2H94A 1YI2I 4BQAA 3WHCA 1VQ4I 3MN2A 2R93J 2GM4A 4MTEA 2KIQA 3IRRA 1BIAA 2PFBA 1J9IA 2J5PA 2MH2A 3K1PA 1OCTC 3FKJA 2NAZA 4RB0A 2BXZA 3GFIA 3OSFA 5KAFC 3DEUA 4QWQA 2GBYA 3FM3A 1UELB 2HOEA 2R4GA 1FOYA 2GIZA 3K10A 2XIGA 2K4BA 2IA1A 4G6DA 4BJ6C 1UCRA 2GA2A 4BDYA 4LOCA 5ED4A 3S16J 3PJRA 3TOBA 1RPWA 4FISA 5JVTA 3T8TA 3BTJA 2UV1A 1W7PA 1ONVA 3TL4X 1IRGA 3C18A 2W1OA 2HKXA 2O3FA 3CCRI 1UMQA 1MBEA 5H20A 1T33A 2KIUA 3KX2A 4C2UA 5LEJA 2IS4A 2D1VA 2XC7A 1JKQC 2LKSA 2NOGA 3KEQA 1TQMA 2M3AA 2QA4I 2L7FP 2VPRA 3FDYA 1DP7P 1MNMC 3DKWA 2VT2A 3CCUI 1R1VA 1GVJA 1E3HA 2JUCA 4IRGA 3GTGJ 4HLXA 3W6VA 3F3XA 3MCZA 4G8XA 4BEHA 1OCPA 3HRMA 4MTDA 2XV4S 3B6AA 3QPHA 1TC3C 3HRUA 3I0TA 1TP4A 1PDNC 3BCBA 1A31A 3VB2A 3S3NA 1TQPA 3S1RJ 5IYCJ 4ZYDA 1OR7C 1NK3P 3GTMJ 4IRHA 2E7WA 3A0BC 1MGTA 3KPHA 1OMIA 4GYIA 4LK1F 2HEOA 5CJ9A 3WTZA 4BU2A 1LPQA 2FF4A 3FXOA 1T56A 2K27A 3OL3A 3H9GA 3OS0A 1YOVB 2XGDA 1TWCJ 1FPQA 4OAYA 3M3YJ 4M9XA 1HKQA 4TV7A 5J47A 3VYUB 3V42A 1ZTRA 2K3PA 3HGYA 2IBDA 1IN5A 1FMWA 1TT0A 1WPKA 1QZEA 2CG4A 3EPZA 4RAZA 4KYWA 1JJ8C 3W2VA 4JP0A 3QQAA 3TDUC 3RSNA 4BDZA 5K5QA 2ME0A 4NB5A 3CCMI 2VBWA 3S17J 3BR1A 5EGOA 1BR4A 2FBHA 2BHYA 3C2HA 1ZARA 4IEJA 2PMZN 4PSXA 4D7NA 4IHSA 1YITI 2RDPA 1VQLI 5GAGJ 5D5VB 4UUSB 2IT0A 2O7OA 4M72A 1XB4A 2XB0X 1I6HJ 2X4HA 4UUTA 2ZJRF 4BEHB 3HSRA 4PJNA 2XAJA 1X1DA 3E6CC 1EH6A 2PLYA 4BYYA 1YYVA 5ILVA 2JA5J 2A5WA 1HF0A 3KIOA 4IOCF 2F4OB 3A0HC 1ETYA 3LSGA 1X3WB 3O8GA 2RREA 4XRMA 1IO2A 1R71A 1J59A 2MLKA 1P4AA 1MMDA 3ASOH 2DYSH 4EV0A 3P9CA 1J5YA 1FT9A 2V9KA 2MC3A 5EDNA 2XSJC 2IP2A 4RMNA 1IZ1A 2IGOA 1A6IA 3M4OJ 3BTCA 1YX5A 3MD2A 1XSXA 3OL4A 1N75A 3OS1A 1TBXA 4UVBA 3H0DA 1RR8C 2YU9J 1ULYA 3H9QA 3LNQA 1F43A 3PQKA 5J6XA 4IRIA 1JT6A 3U2RA 2VJIA 4A3LJ 1L3LA 3TQNA 1ACIA 3CP8A 4BKXA 5HVQC 2HPIA 3T1BA 4FE7A 2ZB9A 1IN4A 5DD8A 2NOJB 4AC0A 3Q0UA 2YS9A 1OFCX 3GEZA 2NYXA 2VJ4A 3G2BA 1MBHA 5B1AH 3MZHA 3R0JA 2GLOA 2TCTA 3PNYA 2W25A 3NEUA 4C9YA 3WGIA 3HBLA 4P96A 1IV6A 4I0AA 4GYGA 3VYSB 5B66C 3DBHB 1T8IA 3MWMA 3BZCA 1BI0A 1XMXA 2L7ZA 1D1CA 2EFWA 1FNNA 3BCAA 3BG3A 3PIOF 2V1DA 1Z9CA 4ZTFA 1EJ9A 4G7OF 2IS6A 2QQAA 3F8CA 1X1BA 1VNDA 5ILUA 3ABTA 4XLAA 4OMYA 4HV5A 4C3JJ 3L2VA 2P7CB 4E7JA 1K78A 2MFZA 4LJZF 1H9TA 3G1OA 1K61A 5DS9A 3WG7H 4HDUA 1OYYA 2RQPA 3FWEA 2P7VB 3IKTA 3PSFA 3BDDA 4I0BA 4XICA 3DTIA 4X1EA 4YEJA 2CFOA 3VODA 3LSRA 3QAHA 3BPVA 1JT0A 4O6JA 1OR7A 3WU2C 2DPUA 3CCYA 3DU6A 5E79C 1MJBA 2DA2A 2ELKA 5C4JJ 3JREA 1N78A 1BBYA 3BG9A 1Z1DA 5LEKA 4IHXA 2LYCA 2EZIA 2HDWA 4BNCA 4GGGA 3SQNA 1R4NB 3GW2A 1W36D 4M6XA 4HF0A 2Y9ZA 2IA2A 3ZQHA 3CJQB 1W7PB 5M3FJ 2B7EA 3H3VK 5E1WA 1IRZA 3E1SA 2VE9A 5K7FA 4BAYA 1YW7A 4PJMA 4HDVA 3BLYA 1RIOH 1XTAA 4MQVA 5FKNA 4AIKA 5KCMA 3RQ4A 1XDSA 4C2MJ 3ABUA 3SEQA 2L7MP 3O6BB 3ZQFA 3MAJA 3G1MA 5FGMA 1X1AA 2L5QA 4B48A 4LIVA 2E1NA 2EQRA 4OIQF 3F6VA 5F1JA 2JT1A 3EQLF 5FFXA 4AD9A 5JHFA 1FSEA 2JRMA 2DI3A 1OCOH 1WKMA 5BQTA 5M5YJ 5C44J 3IAS2 1XPXA 2XGCA 3HTSB 3GTKJ 1V5FA 5DV5A 2DCEA 3BZKA 3W6JB 3F8FA 1SD4A 4AM3A 3EYYA 2OCEA 3K2AA 1VF9A 1DU0A 2O5RA 3ERED 4V19K 2M30A 3F8MA 5HOOA 1X4OA 1AWCA 1F36A 1X19A 4UVAA 2FBKA 4A3KJ 4BY1J 2YU3A 3M07A 2ELJA 3G3ZA 2JA6J 5F08A 2FOWA 3CMAI 4A3BJ 2F5DA 4L9NA 2DK5A 3MQ0A 4BJTA 1ZRDA 5LHIA 1UG0A 3EUKL 5HNFA 4CHUA 1Z3YA 4M9SA 4U0VA 1CQTA 1XC5A 1ZQ3P 1ZN2A 1OYIA 4CZZA 2OAZA 2DU9A 3OV8A 4BUPA 2XDVA 2KKOA 2M0CA 3GZ5A 4E7HA 2IXSA 1GDTA 3IH4A 3R61A 3Q5FA 1T38A 2NNYA 1RRJA 1DPUA 1P4XA 4MQ9F 4ESFA 1NG6A 2H1LA 3HOSA 3DPUA 1VQ5I 5D8LB 3HEFA 3QU3A 3ZQQA 3UKGA 2D2WA 3CDIA 5EEAA 3WE2A 3DXJF 1HC8A 2H8WA 2DMTA 3KZIC 4XK4A 3CUOA 3CMMA 1U3EM 4I2OA 1ETKA 5CVIA 1B72B 1X1CA 1XGMA 4HOBA 1QQIA 1W5SA 2VUMJ 4JK1X 5C4XJ 1JGSA 3LSKA 4M6VA 2KPMA 1GVDA 4EM2A 4KNYA 4GFBA 1X4PA 2DDBA 2O6GE 1SC7A 1HLVA 3DP7A 1HKTA 2ISYA 3OOPA 1IRXA 4M3DA 3SDBA 1P4WA 4MEXF 2R7SA 4EJTA 4FX0A 2K85A 3GX4X 1V54H 1QPMA 4U0YA 4IX7A 1UB9A 2QENA 1YLFA 5CVVA 2CYYA 2DAOA 3WG9A 5IP7J 4NBQA 3LFUA 3M8FA 2KISA 3ZMZA 2CH0A 2VC0A 4B3XA 1VFCA 2R7ZJ 4PDKA 2GWRA 2KRHA 1LFBA 1K4SA 4IHYA 1ODDA 2WY8Q 3JW4A 2OPTA 2F4MB 4O5VA 4KIFA 1RR7A 1U0JA 1MBJA 4M3GA 1JHFA 4HNVA 1WJCA 2H09A 2H6BA 2XAQA 3D0SA 2MSYA 1T2KA 4BE2A 1V55H 2EZLA 3A02A 5FRNA 1JJ6C 4PJJA 2STTA 3WU1B 1X3ZB 2FSWA 2KJBA 3OR1C 3QPTA 2L3DA 1A04A 1IN8A 1IRFA 2QCOA 4E7IA 1KU3A 1FYKA 1T95A 4NC6A 5IYBJ 2EIMH 2EIJH 2LKPA 2ACJA 1X2NA 3KYLA 2K3FA 2DT6A 5CQGA 4RLFA 3DCFA 5HODA 4EEFG 3M1CA 4A3EJ 1S3JA 1VQMI 4P5OA 5A2QZ 1DU6A 2XF6A 3TOAA 4RGRA 2D5VA 2EINH 2K5CA 1WCMJ 3BC8A 1S7EA 2OA4A 2Q2EB 2ZKZA 3WGHA 1HOMA 4F52A 2ZXHA 3SXYA 2HXOA 3F23A 2PJRB 2Z5UA 1NG7A 4I01A 1ZYRF 3JRAA 1F9NA 3H1CA 3LQQA 4AUXA 4E4HA 2HGCA 1JTYA 3JRBA 1K7AA 2A69F 3TMOA 2AS5F 4UUSA 1HQCA 2VXDA 2HPMA 1SFUA 3ZGKA 1K4TA 2WTEA 2E5NA 2YX7A 4XLPF 1ZGWA 4NQWA 1APLC 4II2A 3G6EI 4EMSA 2K86A 5CVRA 2CV2A 3FXUA 2ZXJA 3FMRA 1B8IA 3S32A 2F5FA 3AG4H 4A3MJ 5FRMA 5K5RA 1WH7A 1ON2A 1X58A 1YS6A 5EYRA 2W84A 4YFKF 1VQ7I 2PN6A 3ABMH 2DA5A 3H0GJ 3HRSA 2D1HA 5D6EA 3VWBA 2CQ7A 1FTTA 3CJRB 5ICGA 1MMNA 2TDXA 1NTCA 3HOVJ 2QQ9A 1G3TA 1S5LC 1OISA 2KDOA 2UZKA 3Q0VA 2VLAA 3ECHA 3EYIA 2DOFA 3MZ8A 4ESBA 1R00A 3CDLA 5HDGA 4ZC3A 4CSWA 1JKOC 1D1BA 4P55A 3DLLF 1QRYA 3HSFA 1B8IB 2LLKA 1K6OA 4A3GJ 3MMYB 1FC3A 4I02A 2DA6A 2DO7A 1TLHB 5F6FA 3BR2A 1HBXG 3LL7A 2FRHA 2R7DA 3CF5F 3WODF 3OYCA 4RB1A 5BPDA 2Y0SN 2IVMA 2XROA 2HOSA 4UVCA 5FKOA 4HQEA 3QODA 1RETA 3OYBA 2OZ6A 5M5XJ 2X51A 2G7HA 2CQQA 1D1AA 4U0WA 2LY2A 2VKEA 2Q2EA 1VI0A 5CKTA 4EM1A 2L4AA 4E7SA 1G59A 1MMSA 2G9WA 3BR6A 2VXZA 3HG9A 2E2JJ 4BJ5C 1AA7A 4IZZA 1Z21A 2E2IJ 3JSPA 2BZTA 3E6BA 3ZQGA 4HX8A 1K78B 3ZQCA 1VQ9I 1ZG1A 1L0OC 1Q1HA 1O3TA 1PVEA 3BJAA 4L0ZB 4DOZA 4F91B 2XPUA 1ZREA 2MGQA 3HOWJ 3ROUA 4GRIA 3E5UA 4MFDA 2QWWA 2QZ8A 2NXNB 3PIPF 2DFIA 2DDAA 3F22A 3DWLE 1ZELA 2XASA 3K6GA 3X2QH 3GYHX 2EA2A 2NS7A 2COBA 3ZMDA 1JE8A 2IW5A 1SAUA 4FCYA 3JRDA 4U7BA 1WJDA 4BHBA 3IP4B 4Y17A 2BVLA 2HDDA 4JQFA 1Y8RB 4RBOA 2P5LC 2QBYA 2VQCA 3L2RA 2PG4A 4ZYEA 4NNJA 1FEXA 4UB6C 1YJNI 4Y3OA 4U7DA 4AWXB 3O2PE 2L2OA 1YS7A 1ETOA 4EATA 3GTPJ 1Z0XA 3JAMK 4KT5C 2FU4A 3KYCB 4PFOA 2KRFA 5J8FA 1LB2A 2HVQA 3RZDJ 1P7IA 3BR0A 5EG0B 4RDUA 1EV7A 2KHMA 1BOAA 2ETHA 1LFUP 2FEZA 3DLAA 5DDGA 3OS2A 3GMEA 1JUPA 2VJ5A 1ZAOA 4EJVA 5GPAA 4L0YB 1TTYA 1Y6IA 1BW5A 1ZK8A 2BY2A 2LOOA 2P81A 2MYSA 3I4NJ 2ZMEB 3HPGA 3GCMA 1Q1VA 2OU2A 2CW8A 1S7OA 9ANTA 2IEKA 4XLNF 2L9SA 1JI8A 1SD6A 3IKVA 1IUFA 4B47A 1FWZA 2QSGX 1QVUA 3GVAA 2W82A 4FTHA 1UJ8A 4BQOA 4D5FA 4ZYAA 5LD2C 2BGCA 2K40A 3H92A 3HSEA 1R5HA 4KJZA 3BPXA 4KT6A 4QLCU 3O8HA 4RGSA 3IH2A 5DEQA 1LVKA 3WTXC 3GTJJ 4LFUA 3GZ6A 1I3AA 5B3SH 3JCUC 2PMZA 1KZHA 5C3EJ 3H35A 1X1PA 1K6YA 1S6LA 3LA3A 4CCNA 4ZTJA 2CMPA 1ZKGA 5JR3A 1EA3A 2RNJA 3BQZA 4HBLA 4DYQA 3FXMA 4EGZA 4J19A 2EV0A 2FBIA 1QVTA 2OBPA 3GTLJ 4WK8F 2IS2A 2K9NA 4LK0F 2CUFA 5J4YA 3AG2H 3J81K 1HSTA 4KFCA 1YJWI 3T8RA 2ZJPF 5IP9J 4DJAA 1W0TA 3ZMTA 1SFOJ 4XOPA 2EIKH 2P8TA 3CP2A 3H3UA 3FF5A 1SANA 1OQYA 1BW6A 3P5JA 4H4KC 3PO2J 3TO6A 1YRNB 2JPBA 2I8DA 3QYFA 3WHBA 3HOUJ 3A4CA 1XMAA 1Z7UA 2QYOA 4B8XA 4BXUA 4L5EA 3GTQJ 5L3FA 3CCEI 1FX7A 3SHFA 3A01A 3LSJA 4RAFA 1ON1A 2L01A 5CLSA 4QPOA 3SZPA 3HUGB 2CUEA 3BR3A 1H8AC 2BW3A 2KMUA 4B1RA 1D0YA 1IN6A 2FQ4A 2LRDA 4S05A 3BTLA 5D5WB 1JGGA 3AAFA 3KZZA 4EJWA 3I58A 3HKZN 3B73A 3M7GA 3A01B 2DFEA 3U1KA 2CJJA 4OINF 1HKSA 1LVAA 1IAWA 1X3UA 4KN7X 5F64A 3HHGA 3A1YA 3CJTB 2ME6A 2KLOA 2X6WA 4A12A 1YRNA 2AXTC 1ZHFA 5GTIC 4M3BA 3KEOA 4L18B 1AKHB 2ZXWH 4ZJZA 4M6YA 3ZMSA 3IUOA 4OIRF 1D0ZA 1PUFA 1FJLA 2OF7A 2LREA 1UHWA 2XUBA 2F6CA 1U9NA 1X2MA 4IL6C 1WHUA 1J75A 4EGYA 4LLGF 3AG1H 1J09A 1D8JA 4ENMA 4MHGA 2VASA 2X1CA 2Z9OA 1WQ2A 2KFDA 3LSPA 5F0CA 2LF7A 1S72I 2Z1DA 2AXLA 3I64A 4JX4A 1Z6TA 1XX5A 1Z77A 1UZCA 3I54A 4AVPA 2V6EA 3OR2C 5D4RA 3F8NA 3LA2A 3LOCA 1OYWA 2Q1ZB 2DBBA 1OLTA 5B5EC 5J40A 1XDUA 3CD6I 4KMUX 2LC2A 2NVUB 1DUXC 5HLTA 2LMDA 2L9VA 4JX6A 4PZJA 3VDXA 4B44A 1LJ9A 1IC8A 2M4KA 2GXGA 4XM3A 4OIOF 1JUMA 3ECOA 4XN0A 4AU7A 4BACA 4DGWB 2HZDA 1LDJA 3K7AJ 4RLQA 2X6YA 5ILSA 3J7AO 2CW0F 3PFIA 2M8GX 2MABA 4N4OB 1G3SA 1JKPC 1XSVA 2JK3A 1UHSA 3RKXA 1MBFA 2KZGA 4G6QA 3TP3A 2H1KA 2H27A 3GFJA 2J5OA 1ZR4A 1IF1A 3HDDA 2JA7J 3T0YA 5ICEA 3NAUA 2F5VA 3HRTA 3H9JA 3VEPA 1TWGJ 1OKRA 2DN0A 4W1UA 4OMZA 2M4GA 5BNGA 3P9KA 2A07F 2P5VA 3JAMZ 2QQ8A 4RB2C 2CRGA 5F27A 2VQGA 4DBQA 3MKLA 2CUZA 3J80Z 3S1QJ 3BWGA 5JLWA 1XD7A 2RKHA 4HW0A 4J01A 1ETQA 1KU2A 3I59A 2FXAA 2L9NA 3K70D 1IV8A 1HW5A 2DPDA 4XRSG 1TW2A 4ZYGA 1DPRA 2ZBKA 1TZLA 5E8IA 3KP5A 3G73A 3DQVC 4CYDA 4EJUA 5E3MA 2NS0A 3K69A 4G7ZF 1ZLKA 1K83J 2LR8A 2JQ7A 2FX0A 5J8CA 4I98B 2WAEA 1BI2A 3ZMVA 2EA4A 2K9LA 2VE8A 1HXDA 1OCRH 2P6TA 3ABLH 1A35A 4XLHA 2EZHA 3N97A 2LTPA 4U88A 5AIPA 1TWAJ 3KLOA 5EGOB 4Y13A 3VYTB 3K4JA 4P1WA 2YUSA 4E70A 2DMPA 3C2GA 3SEZA 2NRAC 4EM0B 2K02A 5M5WJ 2JSCA 1OCCH 2F5EA 4A5MA 5BS6A 2JZYA 1MMAA 5BOXA 2ZJ2A 3ZPLA 4X0GA 1KYZA 1GV2A 2VKDA 4G9YA 3FXLA 2KP6A 3OYLA 1JKRC 3OYIA 4XSXF 4CYCB 4HPQA 4RB3C 3P7NA 3MKYB 3JRGA 2NVYJ 4NUBA 2W85A 4Q5SF 1ZG3A 4BBSJ 3KP6A 3AL0B 2BHZA 2HTSA 2CWEA 1W4MA 4RAGA 1ZRCA 1ZG5A 4B09A 2VODA 4EVIA 2H8RA 1I27A 1H89C 5FROA 2EBIA 3ZXSA 2MA3A 1ETWA 3FMQA 5KK1A 3TW7A 4LIUA 4PGHA 2JN6A 1LFPA 1FOXA 4I99C 2X1EA 2ZCWA 1T0FA 5HS9A 1LQ1A 1TWHJ 1U2WA 1GHCA 5TJJA 5KVRA 2FMLA 4CCLA 4B43A 4A3DJ 1JXSA 5E3OA 3D5LA 4AIHA 3I4PA 4ESJA 3ERMA 4A0XA 1WGXA 2MLGA 2CQXA 5D4SA 4MEYF 3G4SI 2E60A 2RV8A 2Q8KA 1MSEC 2Y9YA 2LDUA 4P9UA 1I3QJ 3CLOA 5JHUA 1MJAA 1AU7A 2RC4A 3N05A 5TISC 2QSHX 1SFEA 3BG5A 4Z6YA 3CMYA 4MIMA 2LY9A 4GXOA 2XRLA 3E6MA 4F55A 3EETA 5FLXZ 1POGA 3CC2I 1R5ID 3L2WA 3K0LA 1J0RA 1ZGJA 3K4CA 2XAGA 1GLNA 1TT5B 5J1YA 3GBGA 3CCVI 5GPCA 3J80K 1MKMA 2X6XA 3QYBA 2O03A 3CCLI 1O3QA 2ZMEA 1G3YA 1VQPI 1FYMA 3TKYA 3AKZA 4KIBA 3MKZA 5J1UA 4A93J 4MLOA 1AKHA 1KU7A 1WJEA 5LGUA 1ZGAA 3P9IA 3PFYA 5IOZA 3S3MA 1DQUA 3RYRA 1MIJA 4XIDA 3B6CA 3IL2A 4V2GA 2WBMA 3JRHA 4MO7A 3WGGA 2W48A 1RUOA 4N0BA 4I76A 3DV8A 2ZNYA 2ESNA 3ZRGA 1KQ8A 5E1XA 2DFFA 3IRQA 2DXIA 1MNEA 5LBQA 1XG1A 3WTUC 2DTZA 3CC4I 4X6AJ 2BY1A 2CGPA 4C30A 1R7JA 3IH3A 4LMYA 5HS7A 2IPQX 1W36C 2E1MB 2DT7B 2GA1A 1HW1A 1SD7A 3F8BA 4FASD 3CZ6A 2FOKA 3CESA 1I1GA 2ZNZA 3OYJA 4A3JJ 5E20A 1E3PA 2JPCA 3CDHA 1W7PD 1U9OA 1QHGA 3V7RA 1BC8C 2LF8A 5H2FC 2KIMA 1A6QA 4I09A 4DYRA 2UXNA 2WV0A 2EFOA 3TW6A 4DQ2A 1O4XA 1MDMA 2WAFA 5F04A 3K1MA 3SZGA 4C3IJ 2WC2A 1M1EB 3KEYA 3ML6A 2L4MA 3ZMUA 3CQZJ 1BJZA 4GDFA 5IYDJ 3L9FA 1FLIA 3RCOA 3S1MJ 4CH7A 3HOXJ 1WJFA 3L2CA 1T98A 2E2HJ 5M3MJ 2QLZA 4L9TA 5BPIA 4XNFA 3JRCA 5F1RA 3JRFA 1HCRA 3ZOBA 4LD5A 5TGTA 1QZYA 3LA7A 2LSOA 5IOYA 2OV7A 1SEUA 3ESWB 2FMYA 6PAXA 2FE3A 4QTRA 3CUQB 1U5TC 4KITB 1GXPA 3S15J 4ZH4F 1FSHA 4HF1A 1I6XA 3K4KA 4I6ZA 3I55I 2VN2A 2WB1A 1PP8F 4ZZLA 4ENJA 1LNWA 4XONA 3FBIB 4CUGA 1F1ZA 1TW3A 3FXQA 3L00A 2JMWA 4BY7J 1KONA 1Z91A 1USSA 3QYEA 4Q47A 3AL0C 4UB8C 3ZN0A 1DP3A 1D8KA 2BEOA 1Z3XA 3CUQC 1G6NA 2VL8A 2M2EA 4CDGA 5E8GA 4RA2A 1B9NA 3RKQA 1R23A 2EPFA 1DGRM 3QOPA 1BN5A 3HYIA 1MMGA 3ISPA 3FKIJ 5L3DA 2R5YA 1V5EA 1GV5A 4NC7A 2PBIA 1BI1A 2PEXA 1YIOA 1ZR2A 4R79A 3FISA 3OWTA 1D0XA 3DFGA 2O8KA 3I3LA 4F93B 3FXKA 2HQRA 2O9LA 3HL2A 1TNTA 1MBKA 2HYFA 3LQRA 2G7UA 3NWTA 1JTXA 3HOYJ 2ZXIA 2BVMA 2CUJA 4IHWA 1REPC 1B9MA 4QIWN 4LB5A 1QZZA 4ZYHA 1LE8B 3WU0A 3FMSA 1USTA 2HQ5A 2WB1N 4BQQA 4ZZDA 5DD4A 4V2FA 3I71A 1T0FC 3V8JA 2FUG2 4DZPA 1NK2P 4KMFA 5EZHA 4M71A 4IHTA 2TRTA 4CZCA 3LAJA 2XF7A 3VPRA 4EQQA 4CGZA 2V4JC 5KHDA 1BI3A 2Y30A 4NHJA 2R7OA 3W2AA 3ZQ7A 3MKWB 2KRCA 2QQBA 2UWMA 1I50J 5E17F 2HVSA 4JYKA 3BP8A 3OIOA 1LDKB 2G0EA 3ZQLA 2RN7A 4E7KA 1Z67A 2HZTA 3I5UA 3LSIA 2M45A 5DYMA 4LLLA 3RJPA 2R7XA 2ECBA 4HV6A 2JVHA 2M0MA 3C2BA 1SVOA 5FKLA 1UHMA 4C2TA 3OYFA 1FZPB 3KZYA 2QF7A 3LFKA 4U87A 1HA8A 4OU0A 4D1QA 2VOPA 3HGGA 2Y75A 4WF2A 4DZJA 2ZSIB 1IGNA 1YFHA 3KETA 4HRIA 5D5XB 2WAQA 4KDPA 1BR2A 3TGNA 1MH4A 4AVZA 4DYCA 3QOEA 2QSFX 3K4BA 1IXCA 1V5GA 1Y1WJ 1WJBA 4PSWA 2P0WA 2VBZA 1HSJA 3RI4A 4CCOA 2V1XA 2E36A 3DEEA 3E5QA 1FIPA 3COAC 3ABKH 5GAEJ 1SFXA 2IGMA 2M9HA 2ZSHB 4BHCA 1P7JA 2M87A 4LG0B 2XKOA 5GTHC 3F6OA 4A6EA 2Z99A 2WADA 2ADUA 2X6OA 1IDZA 1RESA 3F0CA 2B63J 2VKVA 3I4MJ 3TBIA 2Y2ZA 3CF2A 2ZJQF 3DEWA 1QU3A 2E7XA 3EUHA 1FTZA 2R7FA 4OOIA 2JJ7A 2KT0A 4PGGA 3RKWA 2HOAA 2L0KA 2LBFB 2HVRA 1ENHA 3OMYA 2R5YB 2K7LA 3JTGA 4IPAA 3KFWX 3IWFA 1U78A 2A6HF 2E19A 3Q0WA 1KU9A 3HPHA 4UHTA 1H0MA 1WI3A 2PMUA 2XAUA 3DBRB 1ITYA 4HX4A 4L9JA 4N4NB 5AIQA 1VQOI 3S8PA 4CCMA 3RZOJ 2MC4A 3K4NA 2LVSA 3PNVA 2W24A 2RNGA 2VJJA 4NDLA 2R7QA 1O3SA 2Q0OA 1SVMA 5LHHA 3V4GA 3DU5A 4XORA 1J7KA 2MBFA 4YELA 4HX7A 3LSMA 3CMEI 5ERIA 2X1DA 3Q9SA 3QWLA 3K9TA 4HZFA 2DFHA 2CQNA 3D1NI 2DMQA 2HNHA 2Z33A 1VTNC 4IKFA 3PNTA 3OYKA 2EB7A 4Q48A 4AYBN 1KA8A 3EUAA 4BS9A 3Q3SA 3E97A 2CQKA 4XN3A 4IJAA 3JR9A 4E6KG 4A0ZA 2YR2A 3GFMA 3VYRB 2JA8J 5FD6A 1QPIA 3CJNA 2QKMB 1BC7C 1R49A 1YIJI 3ZR8X 2ZFWA 4F7ZA 3QPLA 3GF2A 3OSGA 1Z6RA 1N77A 1C0WA 3BR5A 5KNLA 3R4KA 1MBGA 2R7WA 2XHKA 2R5ZB 3AFHA 2V7FA 2YPRA 3OYAA 1UAAA 3S14J 2X48A 3TO7A 2LNBA 5L3GA 4O3MA 1BOBA 4WWCA 3M8EA 2MD5A 1QNTA 3GLLA 2DJNA 3KP3A 2GOMA 3R6SA 3H5AA 3KYDB 4CICA 1AHDP 3C1DA 4KA4A 5FLVA 2PMHA 2HYJA 5DUKA 2X9DA 3OYNA 3U9GA 2K9MA 2COMA 3ASNH 1OJLA 1R22A 2QVOA 3OYGA 1MSFC 2PJRA 1IDYA 2CS3A 4OAZA 4JOMA 4DW6A 2A05A 3BOQA 1PYVA 1QBJA 1B6AA 2LH9A 2LG4A 2AQFA 2MW8A 4DBRA 3DKYA 2CO5A 2HQNA 1V3FA 4FQGA 5GADJ 5LRSA 5LHGA 5EF6A 1BR1A 2RQQA 2XF5A 2VQHA 4WXCA 3WTVC 3CCQI 4G7HF 1E3OC 2STWA 3HB9A 4UV9A 1LUJB 1KQ9A 2RVCA 1SFKA 4XBFA 1SMYF 5FO5A 5GAHJ 2VC1A 3PL8A 2LK2A 1YW9A 1QHHD 1XS9A 5HLIA 1WFXA 4IHVA 2M5WA 1W5CC 4D9JA 2X85A 3R0AA 1V4RA 2DT5A 3NRVA 4KIGA 1B4AA 2DMNA 2EWNA 2D45A 4XKVA 5E1ZB 1GT0C 2HWVA 5E3NA 2DJIA 1R36A 2UUZA 4XKCA 5CVUA 4QSHA 5FB2A 3I53A 2VBXA 5HS8A 5K7ZA 1LDDA 2R5ZA 3L1PA 1WZ2A 2IS1A 3FXRA 4IF4A 4A3FJ 4OIPF 3SJMA 2LP0A 5HNHA 2ID6A 5L3BA 3VFZA 3RYPA 4N9HA 1XMKA 2WA0A 3CCSI 3RQIA 3BJOA 1MW7A 3BY6A 5IP6A 2OD5A 2OTJI 3F21A 2GXBA 4KUMA 1SVLA 2A5YB 2F4IA 4S0HB 3SFZA 1R4MB 3SDGA 3HKZA 4MFEA 3U1DA 3KE2A 4XLFA 3V7CA 4YIRX 1O7LA 3GLXA 4KICA 2Z2SB 1PUFB 2JRTA 1YO5C 2CW7A 1A36A 1LEBA 5L3EA 1EF4A 1FOWA 1BA5A 5EZGA 1VZ0A 4LG3A 3MVPA 4A2UA 1SAXA 2XAFA 2HTJA 4HAMA 3GUDA 4LLNA 4A5NA 3GFLA 3VSLA 1G4DA 4CCKA 2EV5A 2DA4A 2XKPA 1P6RA 1WH5A 2GQQA 3NWSA 1WSUA 2Y31A 2A3SA 4HNTA 5JFRA 4BE1A 5DCMA 3O3KA 1U5TB 3IAM2 4IVNA 3CCJI 3BG7A 3I59B 2ESHA 3HIFA 4N9IA 5FKKA 4F92B 4HSTA 4P9FA 1NH3A 2HFHA 1MJ9A 4HA8A 1QGPA 2M34A 3L2QA 2EZKA 3LWFA 3HUGA 5H6RA 4CA0A 2HOTA 5D5UB 4B4CA 3HXLA 4G94A 3IWZA 2O8XA 1B72A 1WVRA 3CC7I
chains in the Genus database with same CATH topology
2NVTJ 3H0GJ 2DA5A 5J1UA 3E7LA 4A93J 4MLOA 2I10A 3A03A 1H88C 1AKHA 5FLMJ 3WHCA 3MN2A 2R93J 1FTTA 1FIAA 2GM4A 1NTCA 5IOZA 3HOVJ 4XIDA 3B6CA 1OCTC 4V2GA 3JRHA 3Q0VA 4MO7A 2W48A 1ETXA 3OSFA 4I76A 3CDLA 4ABZA 4XRSA 1JKOC 1QRYA 1B8IB 2GBYA 2LLKA 2K9SA 2XSDC 4A3GJ 1D5YA 2DA6A 3SFIA 3BR2A 1XG1A 2DTZA 1Y1VJ 4X6AJ 2Y0SN 3S16J 4LOCA 1TWFJ 1RKTA 2XPVA 2HOSA 5FKOA 1RPWA 4FISA 3IH3A 1RETA 3BTJA 3JRIA 5M5XJ 1GUUA 2CQQA 1UMQA 1MBEA 1T33A 2VKEA 4M3EA 4A3JJ 1VI0A 1JKQC 2NOGA 3BR6A 1U9OA 2E2JJ 2L7FP 2VPRA 1MNMC 2NS8A 2E2IJ 4DYRA 3GTGJ 3W6VA 3ZQGA 3TW6A 3ZQCA 3HOZJ 1OCPA 3B6AA 1O4XA 1TC3C 5F04A 4C3IJ 2XPUA 2MGQA 3HOWJ 2N8GA 4MFDA 3S1RJ 2MG4A 3CQZJ 5IYCJ 3GTMJ 1NK3P 1BJZA 1HDPA 4A3CJ 5IYDJ 5EG0A 2XB5A 1W0UA 3S1MJ 3HOXJ 5J1RA 3BTIA 3HM5A 2NS7A 2COBA 1T56A 2XPWA 3JRDA 2JWTA 4FCYA 1R9TJ 2E2HJ 5M3MJ 2XGDA 2KDZA 1TWCJ 1IJWC 3M3YJ 3JRCA 3IV5A 3JRFA 1HCRA 2HDDA 3ZOBA 5F0HA 4RBOA 4FE4A 1ZTRA 3HGYA 2IBDA 1WPKA 5IOYA 1FEXA 1JJ8C 4JP0A 3QQAA 4QTRA 3FK7A 2ME0A 3S17J 1ETOA 3GTPJ 3BR1A 3S15J 1Z0XA 5K7HA 5EGOA 4I6ZA 1MH3A 4IEJA 2JMWA 2PMZN 4BY7J 2LD5A 3RZDJ 3TEDA 4D7NA 3S2HJ 1P7IA 3BR0A 5EG0B 4RDUA 3S2DJ 4UUSB 2O7OA 1LFUP 1G2HA 2M2EA 1JUPA 2XB0X 1I6HJ 4UUTA 5GPAA 3RKQA 1BW5A 1ZK8A 2P81A 4A3IJ 3I4NJ 4D5CA 3FKIJ 2R5YA 1Q1VA 1GV5A 5FJ8J 1ZR2A 2JA5J 9ANTA 2IEKA 1HF0A 3FISA 3ZQIA 1IUFA 1ETYA 2O8KA 1QVUA 3LSGA 3O8GA 4XRMA 4FTHA 2EH3A 4D5FA 2O9LA 3BQYA 2K40A 1MBKA 5EDNA 1BL0A 1A6IA 1JTXA 3O8HA 3M4OJ 3BTCA 3IH2A 3HOYJ 3GTJJ 4IHWA 2YU9J 4QIWN 5C3EJ 3LNQA 1F43A 1LE8B 3FK6A 2R0QC 1RKWA 1JT6A 1ZKGA 4A3LJ 2HQ5A 2WB1N 3BQZA 4DYQA 2LKXA 3PO3J 4V2FA 4J19A 4BKXA 4DZPA 1NK2P 1QVTA 2WAQN 5EZHA 3GTLJ 4FE7A 2ZB9A 2K9NA 4AC0A 3Q0UA 4BBRJ 2TRTA 2YS9A 1OFCX 2CUFA 3NARA 3VPRA 1MBHA 3PM1A 1ORKA 2Y30A 5IP9J 2GLOA 2TCTA 3OOUA 1W0TA 3HBLA 1SFOJ 1IV6A 4G12A 3GTOJ 1I50J 1SANA 2L7ZA 1BW6A 3PO2J 1LE8A 4JYKA 3OIOA 3BG3A 1YRNB 2G0EA 3ZQLA 3WHBA 3HOUJ 1VNDA 4L5EA 3GTQJ 2ECBA 2WV1A 4JX5A 2XGEA 3C2BA 3A01A 3LSJA 5FKLA 5DTDA 4C3JJ 2QF7A 2CUEA 5E3LA 3BR3A 3G1OA 1K61A 5DS9A 1H8AC 3HGGA 4B1RA 4DZJA 1IGNA 2FQ4A 3BTLA 1JGGA 1MH4A 4XICA 4X1EA 4DYCA 3HKZN 3A01B 3LSRA 2CJJA 1Y1WJ 1JT0A 3CCYA 3JREA 2DA2A 2ELKA 5C4JJ 3BG9A 2ME6A 1YRNA 4IHXA 2FD5A 1IG7A 2AHQA 4M3BA 2EZIA 1FIPA 1AKHB 2E1OA 2M9HA 1PUFA 1P7JA 1FJLA 2Y9ZA 2OF7A 3ZQHA 5M3FJ 3H3VK 1IRZA 2X6OA 1IDZA 5K7FA 1U9NA 1RESA 3F0CA 2B63J 2VKVA 3I4MJ 1X2MA 2Y2ZA 3DEWA 5FKNA 4C2MJ 1FTZA 2L7MP 2JJ7A 2KT0A 3ZQFA 3G1MA 2HOAA 2L0KA 1ENHA 2R5YB 3LSPA 5F0CA 2EQRA 4JX4A 1U78A 5F1JA 2E19A 3Q0WA 1Z77A 2IAIA 5C44J 5M5YJ 1WI3A 2XGCA 1HDDC 3GTKJ 1ITYA 3LOCA 3RZOJ 2ECCA 2LVSA 3K2AA 1VF9A 1DU0A 4JX6A 4NDLA 1IC8A 1F36A 4A3KJ 4BY1J 1JUMA 4C3HJ 3K7AJ 2JA6J 5F08A 2M8GX 3D1NI 2DMQA 4A3BJ 2DA1A 1JKPC 2ID3A 1UHSA 2JK3A 1MBFA 3TP3A 2H1KA 4AYBN 1ZR4A 3HDDA 2DA3A 1CQTA 1XC5A 3Q3SA 1ZQ3P 2JA7J 3NAUA 3JR9A 1TWGJ 2DN0A 3G1LA 4W1UA 5BNGA 3QPSA 2M0CA 2NVXJ 2JA8J 2L9RA 2CRGA 5F27A 1QPIA 1GDTA 3IH4A 3MKLA 2CU7A 5J3LA 3S1QJ 2HXIA 5JLWA 3QPLA 3OSGA 4W97A 3BR5A 1ETQA 3HEFA 3UKGA 5EEAA 1MBGA 4B3AA 2DMTA 4XK4A 4XRSG 2R5ZB 2LFBA 3S14J 2X48A 1ETKA 1B72B 2R92J 2VUMJ 3TP0A 5C4XJ 4M6VA 5F0FA 5E3MA 3FIWA 1GVDA 1K83J 2DJNA 2LR8A 4GFBA 2FX0A 4CYCA 2RAEA 1HLVA 1AHDP 3BT9A 2AO9A 5FKMA 5FLVA 2HYJA 4M3DA 2X9DA 2EZHA 2K9QA 1OJLA 2LTPA 2NVQJ 1TWAJ 1MSFC 1IDYA 4DW6A 5EGOB 5IP7J 2YUSA 2DMPA 2MW8A 5M5WJ 1VFCA 2R7ZJ 5EF6A 1LFBA 1GV2A 1E3OC 4IHYA 3HB9A 2OPTA 2DA7A 1JKRC 4Y52J 1RR7A 2LK2A 4CYCB 1MBJA 1XS9A 4M3GA 4IHVA 4HNVA 3JRGA 2NVYJ 2MSYA 4D7MA 2DMNA 1GT0C 4BBSJ 5E3NA 2EZLA 4QSHA 3A02A 5K7ZA 1JJ6C 1UG2A 2R5ZA 2H8RA 1U8BA 3L1PA 1H89C 4BXXJ 2EBIA 4A3FJ 3SJMA 2LP0A 2ID6A 1ETWA 1JUSA 2QCOA 3TW7A 3RQIA 5IYBJ 2DMUA 2JN6A 5IP6A 1A5JA 1X2NA 4S0HB 3SDGA 4MFEA 3DCFA 5HODA 1TWHJ 4EEFG 1PUFB 4A3EJ 3S1NJ 1EF4A 4A3DJ 1DU6A 1BA5A 5EZGA 5E3OA 3MVPA 2D5VA 1WCMJ 1HOMA 1S7EA 1WGXA 2CQXA 2HXOA 2VI6A 1MSEC 2Y9YA 5JLXA 1AU7A 1I3QJ 2DA4A 1WH5A 3JRAA 4Y7NJ 3BG5A 4AUXA 2FJ1A 3CMYA 1JTYA 2Y31A 2LY9A 4MIMA 3JRBA 2XRLA 4UUSA 1POGA 4M3FA 5FKKA 5IPAA 1APLC 5J1YA 4A69C 3GBGA 1ZGWA 2HI3A 5GPCA 2M34A 2EZKA 1B8IA 1ETVA 5GP9A 2HOTA 4A3MJ 4B4CA 1WH7A 1X58A 1B72A 5EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT J;  3H0G J;  2DA5 A;  5J1U A;  3E7L A;  4A93 J;  4MLO A;  2I10 A;  3A03 A;  1H88 C;  1AKH A;  5FLM J;  3WHC A;  3MN2 A;  2R93 J;  1FTT A;  1FIA A;  2GM4 A;  1NTC A;  5IOZ A;  3HOV J;  4XID A;  3B6C A;  1OCT C;  4V2G A;  3JRH A;  3Q0V A;  4MO7 A;  2W48 A;  1ETX A;  3OSF A;  4I76 A;  3CDL A;  4ABZ A;  4XRS A;  1JKO C;  1QRY A;  1B8I B;  2GBY A;  2LLK A;  2K9S A;  2XSD C;  4A3G J;  1D5Y A;  2DA6 A;  3SFI A;  3BR2 A;  1XG1 A;  2DTZ A;  1Y1V J;  4X6A J;  2Y0S N;  3S16 J;  4LOC A;  1TWF J;  1RKT A;  2XPV A;  2HOS A;  5FKO A;  1RPW A;  4FIS A;  3IH3 A;  1RET A;  3BTJ A;  3JRI A;  5M5X J;  1GUU A;  2CQQ A;  1UMQ A;  1MBE A;  1T33 A;  2VKE A;  4M3E A;  4A3J J;  1VI0 A;  1JKQ C;  2NOG A;  3BR6 A;  1U9O A;  2E2J J;  2L7F P;  2VPR A;  1MNM C;  2NS8 A;  2E2I J;  4DYR A;  3GTG J;  3W6V A;  3ZQG A;  3TW6 A;  3ZQC A;  3HOZ J;  1OCP A;  3B6A A;  1O4X A;  1TC3 C;  5F04 A;  4C3I J;  2XPU A;  2MGQ A;  3HOW J;  2N8G A;  4MFD A;  3S1R J;  2MG4 A;  3CQZ J;  5IYC J;  3GTM J;  1NK3 P;  1BJZ A;  1HDP A;  4A3C J;  5IYD J;  5EG0 A;  2XB5 A;  1W0U A;  3S1M J;  3HOX J;  5J1R A;  3BTI A;  3HM5 A;  2NS7 A;  2COB A;  1T56 A;  2XPW A;  3JRD A;  2JWT A;  4FCY A;  1R9T J;  2E2H J;  5M3M J;  2XGD A;  2KDZ A;  1TWC J;  1IJW C;  3M3Y J;  3JRC A;  3IV5 A;  3JRF A;  1HCR A;  2HDD A;  3ZOB A;  5F0H A;  4RBO A;  4FE4 A;  1ZTR A;  3HGY A;  2IBD A;  1WPK A;  5IOY A;  1FEX A;  1JJ8 C;  4JP0 A;  3QQA A;  4QTR A;  3FK7 A;  2ME0 A;  3S17 J;  1ETO A;  3GTP J;  3BR1 A;  3S15 J;  1Z0X A;  5K7H A;  5EGO A;  4I6Z A;  1MH3 A;  4IEJ A;  2JMW A;  2PMZ N;  4BY7 J;  2LD5 A;  3RZD J;  3TED A;  4D7N A;  3S2H J;  1P7I A;  3BR0 A;  5EG0 B;  4RDU A;  3S2D J;  4UUS B;  2O7O A;  1LFU P;  1G2H A;  2M2E A;  1JUP A;  2XB0 X;  1I6H J;  4UUT A;  5GPA A;  3RKQ A;  1BW5 A;  1ZK8 A;  2P81 A;  4A3I J;  3I4N J;  4D5C A;  3FKI J;  2R5Y A;  1Q1V A;  1GV5 A;  5FJ8 J;  1ZR2 A;  2JA5 J;  9ANT A;  2IEK A;  1HF0 A;  3FIS A;  3ZQI A;  1IUF A;  1ETY A;  2O8K A;  1QVU A;  3LSG A;  3O8G A;  4XRM A;  4FTH A;  2EH3 A;  4D5F A;  2O9L A;  3BQY A;  2K40 A;  1MBK A;  5EDN A;  1BL0 A;  1A6I A;  1JTX A;  3O8H A;  3M4O J;  3BTC A;  3IH2 A;  3HOY J;  3GTJ J;  4IHW A;  2YU9 J;  4QIW N;  5C3E J;  3LNQ A;  1F43 A;  1LE8 B;  3FK6 A;  2R0Q C;  1RKW A;  1JT6 A;  1ZKG A;  4A3L J;  2HQ5 A;  2WB1 N;  3BQZ A;  4DYQ A;  2LKX A;  3PO3 J;  4V2F A;  4J19 A;  4BKX A;  4DZP A;  1NK2 P;  1QVT A;  2WAQ N;  5EZH A;  3GTL J;  4FE7 A;  2ZB9 A;  2K9N A;  4AC0 A;  3Q0U A;  4BBR J;  2TRT A;  2YS9 A;  1OFC X;  2CUF A;  3NAR A;  3VPR A;  1MBH A;  3PM1 A;  1ORK A;  2Y30 A;  5IP9 J;  2GLO A;  2TCT A;  3OOU A;  1W0T A;  3HBL A;  1SFO J;  1IV6 A;  4G12 A;  3GTO J;  1I50 J;  1SAN A;  2L7Z A;  1BW6 A;  3PO2 J;  1LE8 A;  4JYK A;  3OIO A;  3BG3 A;  1YRN B;  2G0E A;  3ZQL A;  3WHB A;  3HOU J;  1VND A;  4L5E A;  3GTQ J;  2ECB A;  2WV1 A;  4JX5 A;  2XGE A;  3C2B A;  3A01 A;  3LSJ A;  5FKL A;  5DTD A;  4C3J J;  2QF7 A;  2CUE A;  5E3L A;  3BR3 A;  3G1O A;  1K61 A;  5DS9 A;  1H8A C;  3HGG A;  4B1R A;  4DZJ A;  1IGN A;  2FQ4 A;  3BTL A;  1JGG A;  1MH4 A;  4XIC A;  4X1E A;  4DYC A;  3HKZ N;  3A01 B;  3LSR A;  2CJJ A;  1Y1W J;  1JT0 A;  3CCY A;  3JRE A;  2DA2 A;  2ELK A;  5C4J J;  3BG9 A;  2ME6 A;  1YRN A;  4IHX A;  2FD5 A;  1IG7 A;  2AHQ A;  4M3B A;  2EZI A;  1FIP A;  1AKH B;  2E1O A;  2M9H A;  1PUF A;  1P7J A;  1FJL A;  2Y9Z A;  2OF7 A;  3ZQH A;  5M3F J;  3H3V K;  1IRZ A;  2X6O A;  1IDZ A;  5K7F A;  1U9N A;  1RES A;  3F0C A;  2B63 J;  2VKV A;  3I4M J;  1X2M A;  2Y2Z A;  3DEW A;  5FKN A;  4C2M J;  1FTZ A;  2L7M P;  2JJ7 A;  2KT0 A;  3ZQF A;  3G1M A;  2HOA A;  2L0K A;  1ENH A;  2R5Y B;  3LSP A;  5F0C A;  2EQR A;  4JX4 A;  1U78 A;  5F1J A;  2E19 A;  3Q0W A;  1Z77 A;  2IAI A;  5C44 J;  5M5Y J;  1WI3 A;  2XGC A;  1HDD C;  3GTK J;  1ITY A;  3LOC A;  3RZO J;  2ECC A;  2LVS A;  3K2A A;  1VF9 A;  1DU0 A;  4JX6 A;  4NDL A;  1IC8 A;  1F36 A;  4A3K J;  4BY1 J;  1JUM A;  4C3H J;  3K7A J;  2JA6 J;  5F08 A;  2M8G X;  3D1N I;  2DMQ A;  4A3B J;  2DA1 A;  1JKP C;  2ID3 A;  1UHS A;  2JK3 A;  1MBF A;  3TP3 A;  2H1K A;  4AYB N;  1ZR4 A;  3HDD A;  2DA3 A;  1CQT A;  1XC5 A;  3Q3S A;  1ZQ3 P;  2JA7 J;  3NAU A;  3JR9 A;  1TWG J;  2DN0 A;  3G1L A;  4W1U A;  5BNG A;  3QPS A;  2M0C A;  2NVX J;  2JA8 J;  2L9R A;  2CRG A;  5F27 A;  1QPI A;  1GDT A;  3IH4 A;  3MKL A;  2CU7 A;  5J3L A;  3S1Q J;  2HXI A;  5JLW A;  3QPL A;  3OSG A;  4W97 A;  3BR5 A;  1ETQ A;  3HEF A;  3UKG A;  5EEA A;  1MBG A;  4B3A A;  2DMT A;  4XK4 A;  4XRS G;  2R5Z B;  2LFB A;  3S14 J;  2X48 A;  1ETK A;  1B72 B;  2R92 J;  2VUM J;  3TP0 A;  5C4X J;  4M6V A;  5F0F A;  5E3M A;  3FIW A;  1GVD A;  1K83 J;  2DJN A;  2LR8 A;  4GFB A;  2FX0 A;  4CYC A;  2RAE A;  1HLV A;  1AHD P;  3BT9 A;  2AO9 A;  5FKM A;  5FLV A;  2HYJ A;  4M3D A;  2X9D A;  2EZH A;  2K9Q A;  1OJL A;  2LTP A;  2NVQ J;  1TWA J;  1MSF C;  1IDY A;  4DW6 A;  5EGO B;  5IP7 J;  2YUS A;  2DMP A;  2MW8 A;  5M5W J;  1VFC A;  2R7Z J;  5EF6 A;  1LFB A;  1GV2 A;  1E3O C;  4IHY A;  3HB9 A;  2OPT A;  2DA7 A;  1JKR C;  4Y52 J;  1RR7 A;  2LK2 A;  4CYC B;  1MBJ A;  1XS9 A;  4M3G A;  4IHV A;  4HNV A;  3JRG A;  2NVY J;  2MSY A;  4D7M A;  2DMN A;  1GT0 C;  4BBS J;  5E3N A;  2EZL A;  4QSH A;  3A02 A;  5K7Z A;  1JJ6 C;  1UG2 A;  2R5Z A;  2H8R A;  1U8B A;  3L1P A;  1H89 C;  4BXX J;  2EBI A;  4A3F J;  3SJM A;  2LP0 A;  2ID6 A;  1ETW A;  1JUS A;  2QCO A;  3TW7 A;  3RQI A;  5IYB J;  2DMU A;  2JN6 A;  5IP6 A;  1A5J A;  1X2N A;  4S0H B;  3SDG A;  4MFE A;  3DCF A;  5HOD A;  1TWH J;  4EEF G;  1PUF B;  4A3E J;  3S1N J;  1EF4 A;  4A3D J;  1DU6 A;  1BA5 A;  5EZG A;  5E3O A;  3MVP A;  2D5V A;  1WCM J;  1HOM A;  1S7E A;  1WGX A;  2CQX A;  2HXO A;  2VI6 A;  1MSE C;  2Y9Y A;  5JLX A;  1AU7 A;  1I3Q J;  2DA4 A;  1WH5 A;  3JRA A;  4Y7N J;  3BG5 A;  4AUX A;  2FJ1 A;  3CMY A;  1JTY A;  2Y31 A;  2LY9 A;  4MIM A;  3JRB A;  2XRL A;  4UUS A;  1POG A;  4M3F A;  5FKK A;  5IPA A;  1APL C;  5J1Y A;  4A69 C;  3GBG A;  1ZGW A;  2HI3 A;  5GPC A;  2M34 A;  2EZK A;  1B8I A;  1ETV A;  5GP9 A;  2HOT A;  4A3M J;  4B4C A;  1WH7 A;  1X58 A;  1B72 A;  5EYR A; 
#chains in the Genus database with same CATH topology
 1XGN A;  4CCJ A;  4XKW A;  3FBN B;  3W3C A;  3E7L A;  3K2Z A;  4LB6 B;  2FNA A;  2A61 A;  2I10 A;  1H88 C;  3CTA A;  1DDN A;  4BHP A;  5FLM J;  3LST A;  1FIA A;  3D5R C;  3OIQ A;  4WXD A;  4ETS A;  3GZN B;  2OUM A;  1KGS A;  2VB6 A;  4XL9 A;  4CXF A;  1ETX A;  1ERD A;  1Z7L A;  2PI0 A;  2OQG A;  1QA6 A;  2KQR A;  4ABZ A;  4XRS A;  3E3V A;  1FYL A;  2K9S A;  2ELH A;  2XSD C;  1J2X A;  1D5Y A;  3FXJ A;  2RGV A;  2MD0 A;  3MZY A;  3SFI A;  1U5T A;  4RS8 A;  3KP2 A;  1Y1V J;  4QPQ A;  5D6F A;  1TWF J;  1RKT A;  2XPV A;  4E7L A;  3Q9V A;  2GIV A;  1S29 A;  4UNO A;  3ZN1 A;  2EV6 A;  4L5I A;  5IY5 H;  1BM9 A;  3JRI A;  4XMY A;  1F4K A;  1GUU A;  2HR3 A;  1W5T A;  5IT3 A;  1Y39 A;  4M3E A;  1ZH5 A;  1XCV A;  1S9H A;  5IT9 K;  3L7W A;  1IXR C;  3JTH A;  2HDC A;  3EUH C;  2EFP A;  3V8L A;  2QEX I;  3IC7 A;  1VQ6 I;  1YX3 A;  3PUB A;  1E0E A;  3DTK A;  2NS8 A;  3M1E A;  1WRJ A;  3HOZ J;  1NHA A;  1YE9 A;  5CPR B;  2CV0 A;  2X0L A;  1XCB A;  2DYR H;  4M74 A;  2Z16 A;  3B02 A;  1SMT A;  4YIF A;  3WTY C;  3G71 I;  2N8G A;  2MG4 A;  2Y69 H;  1HDP A;  4A3C J;  4YRV A;  5EG0 A;  4H0E A;  1E2X A;  2XB5 A;  5BMZ A;  1W0U A;  4ENK A;  5J1R A;  5IT9 Z;  3BTI A;  2KJC A;  3HM5 A;  1LEA A;  1EH7 A;  3RPU A;  3WTW C;  2XPW A;  1R9T J;  2JWT A;  4HYE A;  1O3R A;  2KDZ A;  2OQR A;  1IJW C;  3OYD A;  3UR3 C;  3IV5 A;  1MD0 A;  3OY9 A;  2LBF A;  1P92 A;  5F0H A;  2DTR A;  3HTU A;  4FE4 A;  4IOA F;  1STZ A;  3L2U A;  4AYB A;  2ZO4 A;  2JUG A;  2DQR A;  5B1B H;  3FK7 A;  4GO1 A;  2VIX A;  5K7H A;  1FBS A;  4K2E A;  1MH3 A;  4HSR A;  2V79 A;  1T08 B;  1RZ4 A;  2YX4 A;  2V1U A;  2F2E A;  4LG0 A;  2E35 A;  1S8N A;  2LD5 A;  3TED A;  1RNL A;  4PK4 A;  2A6T A;  3S2D J;  3S2H J;  3V7S A;  3FHZ A;  4Z2Y A;  4XSZ F;  4RAY A;  5L3C A;  1G2H A;  3OYH A;  1LKX A;  4DIQ A;  1D5V A;  1BJA A;  1T39 A;  4HF2 A;  2JTV A;  4XLE A;  1U6G A;  2R7U A;  5J4V A;  4A3I J;  4D5C A;  1Y0U A;  3OIP A;  1O7F A;  1S7A A;  5EJC A;  3J7A Y;  2XAH A;  3HZJ A;  5EEG A;  2EFQ A;  3RIR A;  3T5X A;  5H6Q A;  5FJ8 J;  4HQM A;  4XLC A;  3W2W A;  4Y15 A;  3ZQI A;  3KP4 A;  2H6C A;  2GXA A;  3GWZ A;  3H5N A;  4PJ0 C;  3OYM A;  5DM6 F;  1EKE A;  2EH3 A;  3BQY A;  3DPL C;  2ISZ A;  2WY7 Q;  1BL0 A;  3LSH A;  4L9V A;  4AIJ A;  2W57 A;  2V26 A;  2AQE A;  2VT3 A;  5JI6 A;  4BH9 A;  2P5K A;  3LAP A;  2P6S A;  2DOA A;  3FK6 A;  2R0Q C;  1RKW A;  5HLG A;  2Z3Y A;  2LKX A;  3PO3 J;  2GAU A;  3AG3 H;  5TRD A;  3CO7 C;  5K1Y A;  2WAQ N;  3SYT A;  4S04 A;  2R3S A;  2LY1 A;  4M9Z A;  4XR6 A;  1R1U A;  3NAR A;  1E17 A;  3FHN A;  3PM1 A;  2Y48 A;  2VQL A;  5E18 F;  1ORK A;  2DLL A;  4CO8 A;  1YTY A;  4NC8 A;  2R7R A;  3OOU A;  2KIF A;  1EH8 A;  3QU6 A;  2BW3 B;  4II3 A;  4IO9 F;  1FOK A;  4KIS A;  4G12 A;  4ON0 A;  3GTO J;  5DCM B;  1LE8 A;  1KQ0 A;  2HKO A;  1MND A;  5HLH A;  1VQK I;  2V6C A;  1D3Y A;  2WV1 A;  4JX5 A;  2XGE A;  3DKX A;  2VBY A;  2M7B A;  5DTD A;  4GCV A;  2XGX A;  3HC7 A;  1K79 A;  5E3L A;  5FD5 A;  4UUV A;  4R1H A;  4PFP A;  2QBY B;  5LFA A;  2DOE A;  4D0P A;  2BE5 F;  3PUF A;  3UNG C;  4J00 A;  1N25 A;  4YII A;  2F5C A;  1T6S A;  2JSP A;  1FBQ A;  1QO0 D;  2P4W A;  4BE0 A;  1TNS A;  2FQ3 A;  1B59 A;  5EEH A;  2M1B A;  3V8K A;  1PUE E;  3FM5 A;  3J7Z I;  2IRF G;  5HDN A;  4Q4Z F;  2PQ8 A;  2ZFU A;  3PQJ A;  1OPC A;  2OJE D;  1G3W A;  2FD5 A;  5JVG F;  3QP6 A;  2KZV A;  2AHQ A;  4RGU A;  1IG7 A;  1Y0N A;  3CLQ A;  3BZ6 A;  1U8R A;  2E1O A;  1IW7 F;  3R60 A;  3MFK A;  3J81 Z;  4RM2 A;  3ULQ B;  4LIT A;  3OYE A;  3E5X A;  2BBY A;  2MH9 A;  4KN4 X;  3CUQ A;  3K1N A;  1YW8 A;  3LMM A;  4IXA A;  2BY3 A;  1ZRF A;  1XSD A;  1GXQ A;  2VPL A;  4ZDP A;  2V9V A;  3GO5 A;  4LGW A;  1WJ5 A;  2ZME C;  3RPQ A;  3QRF F;  3ONQ A;  2Y0S A;  1TQI A;  2L02 A;  5CYV A;  2QUF A;  1XGO A;  2K4J A;  1R6R A;  1CF7 B;  1WWX A;  2IAI A;  4BQN A;  2C6Y A;  3DTE A;  3L09 A;  1HDD C;  2BYV E;  2E34 A;  1UFM A;  3DBL B;  4UXN A;  5KAI C;  4WX9 A;  2Y0M A;  2BV6 A;  3DPT A;  2BOL A;  2R7T A;  3ELK A;  2ECC A;  4WXH A;  1MZB A;  1Y8Q B;  4PCQ A;  1I1S A;  4MNU A;  3HHH A;  3F9K A;  2V9P A;  3WE3 A;  3U21 A;  1FP2 A;  4PJL A;  4XRF A;  1Z05 A;  3H3Z A;  4C3H J;  2ZC2 A;  2E5Z A;  4YFX F;  4HG2 A;  3JSO A;  4AID A;  4FT8 A;  4UV8 A;  2ICW G;  2R7V A;  1I5Z A;  2O61 A;  2PX9 A;  4E7Z A;  3K70 C;  2DA1 A;  2L7K A;  2ID3 A;  1O57 A;  4R8H A;  4WCG A;  1IXS B;  2GZW A;  2DA3 A;  1AOY A;  2CSO A;  3KCC A;  5LGT A;  1RC9 A;  3A2K A;  5FLX K;  4YFN F;  3EDP A;  2QKL B;  3G1L A;  1G8X A;  3QPS A;  2NVX J;  1TL8 A;  2L9R A;  2XRN A;  2VKH A;  1PP7 U;  4IQJ A;  1CF7 A;  1I39 A;  4JBA A;  2CU7 A;  5J3L A;  4ITV A;  4EJO A;  3H36 A;  2HXI A;  4XOT A;  2EFN A;  2V1N A;  3GXO A;  3I9V 2;  4W97 A;  4NQW B;  1RI7 A;  2DQL A;  3PSI A;  5DCF A;  5DM7 F;  5LLQ A;  2QM3 A;  4B3A A;  1VQN I;  2PJP A;  4Y4R A;  1HW2 A;  2LFB A;  1FP1 D;  4HLY A;  2E71 A;  2R92 J;  3TP0 A;  2DW4 A;  4ZDL A;  2QGU A;  5F0F A;  3FIW A;  4L5J A;  2OCC H;  1BIB A;  3S93 A;  4XKB A;  2RAE A;  3W6K B;  5DUI A;  3TO9 A;  1B1B A;  5A2Q K;  4CYC A;  4ZDO A;  4HEA 2;  3BT9 A;  1P9Q C;  2E1C A;  2AO9 A;  2A68 F;  5FKM A;  1Y56 A;  4BXF A;  4MGR A;  2K9Q A;  2M8E A;  2HYG D;  1YHQ I;  2NVQ J;  4PUS A;  3CO6 C;  3C7J A;  3S2W A;  2HU9 A;  2B9S A;  2NNN A;  1RUN A;  3DF8 A;  4A0Y A;  3S3O A;  1VQ8 I;  3J7Y J;  4ANJ A;  2OTL I;  2O0Y A;  4ASN A;  1OCZ H;  1DGW Y;  1YQA A;  2IA0 A;  5AON A;  2DOD A;  3C3W A;  4FHT A;  1FMV A;  1WJA A;  2DA7 A;  2CV1 A;  4Y52 J;  4FET A;  2DK8 A;  2IGN A;  3FX3 A;  4I7H A;  2BY0 A;  3D5S C;  1XGS A;  4YG2 F;  2FNP A;  4D7M A;  2IGK A;  3K4L A;  3QP5 A;  2VOO A;  1R5G A;  5ICC A;  1UG2 A;  1YG2 A;  3VOE A;  1U8B A;  4BXX J;  2EJR A;  2E1M C;  2W4S A;  4BL0 B;  1IN7 A;  1IUY A;  1JUS A;  2I5U A;  2L54 A;  2DMU A;  4Y33 A;  2OC6 A;  2HS5 A;  1YJ9 I;  4BGD A;  1MDM B;  4XQF A;  4RM3 A;  3K4M A;  1CGP A;  3E6D A;  5CVJ A;  1A5J A;  5FFZ A;  3H5R A;  3RDI A;  3BRO A;  2JVG A;  3IHU A;  1SD5 A;  2VON A;  3HJE A;  4G6T B;  3WTS C;  2B0L A;  3SZT A;  4F3Q A;  4HNU A;  3S1N J;  3RPU D;  1W1W E;  4IQ4 A;  3VSK A;  2WWY A;  3E0J B;  3N4M A;  3RKY A;  1FBU A;  2OZU A;  2FA5 A;  2EK5 A;  2VI6 A;  5ICF A;  2M7A A;  3TDZ C;  3KP7 A;  2W00 A;  5JLX A;  2CFX A;  1PJR A;  2JA2 A;  4Y7N J;  5LGN A;  3FZV A;  1ZLJ A;  1R58 A;  3M9A A;  2FJ1 A;  3REO A;  3BG6 A;  2IJL A;  3HOT A;  2W7N A;  1KYW A;  1FY7 A;  4M3F A;  2UXX A;  1F5T A;  2GOX B;  3RTR A;  4RGX A;  4DNC A;  5LRR A;  1JHH A;  4M73 A;  1R1T A;  3WTT C;  1P2F A;  1WI9 A;  5IPA A;  1H9G A;  3M8J A;  4A69 C;  2BXY A;  3MEX A;  2HI3 A;  2HQA A;  2A6E F;  4FX4 A;  1ETV A;  5GP9 A;  2YSR A;  3NQO A;  5HDK A;  5D8K B;  3ZCO A;  3ZP5 A;  1XN7 A;  2F48 A;  4BBR J;  4ENN A;  3KLN A;  2NVT J;  4UY8 I;  2KL4 A;  4A6D A;  5CQE A;  2XVC A;  2EIL H;  3F72 A;  3A03 A;  3BJ6 A;  5K5O A;  4OWR B;  3I56 I;  2H94 A;  1YI2 I;  4BQA A;  3WHC A;  1VQ4 I;  3MN2 A;  2R93 J;  2GM4 A;  4MTE A;  2KIQ A;  3IRR A;  1BIA A;  2PFB A;  1J9I A;  2J5P A;  2MH2 A;  3K1P A;  1OCT C;  3FKJ A;  2NAZ A;  4RB0 A;  2BXZ A;  3GFI A;  3OSF A;  5KAF C;  3DEU A;  4QWQ A;  2GBY A;  3FM3 A;  1UEL B;  2HOE A;  2R4G A;  1FOY A;  2GIZ A;  3K10 A;  2XIG A;  2K4B A;  2IA1 A;  4G6D A;  4BJ6 C;  1UCR A;  2GA2 A;  4BDY A;  4LOC A;  5ED4 A;  3S16 J;  3PJR A;  3TOB A;  1RPW A;  4FIS A;  5JVT A;  3T8T A;  3BTJ A;  2UV1 A;  1W7P A;  1ONV A;  3TL4 X;  1IRG A;  3C18 A;  2W1O A;  2HKX A;  2O3F A;  3CCR I;  1UMQ A;  1MBE A;  5H20 A;  1T33 A;  2KIU A;  3KX2 A;  4C2U A;  5LEJ A;  2IS4 A;  2D1V A;  2XC7 A;  1JKQ C;  2LKS A;  2NOG A;  3KEQ A;  1TQM A;  2M3A A;  2QA4 I;  2L7F P;  2VPR A;  3FDY A;  1DP7 P;  1MNM C;  3DKW A;  2VT2 A;  3CCU I;  1R1V A;  1GVJ A;  1E3H A;  2JUC A;  4IRG A;  3GTG J;  4HLX A;  3W6V A;  3F3X A;  3MCZ A;  4G8X A;  4BEH A;  1OCP A;  3HRM A;  4MTD A;  2XV4 S;  3B6A A;  3QPH A;  1TC3 C;  3HRU A;  3I0T A;  1TP4 A;  1PDN C;  3BCB A;  1A31 A;  3VB2 A;  3S3N A;  1TQP A;  3S1R J;  5IYC J;  4ZYD A;  1OR7 C;  1NK3 P;  3GTM J;  4IRH A;  2E7W A;  3A0B C;  1MGT A;  3KPH A;  1OMI A;  4GYI A;  4LK1 F;  2HEO A;  5CJ9 A;  3WTZ A;  4BU2 A;  1LPQ A;  2FF4 A;  3FXO A;  1T56 A;  2K27 A;  3OL3 A;  3H9G A;  3OS0 A;  1YOV B;  2XGD A;  1TWC J;  1FPQ A;  4OAY A;  3M3Y J;  4M9X A;  1HKQ A;  4TV7 A;  5J47 A;  3VYU B;  3V42 A;  1ZTR A;  2K3P A;  3HGY A;  2IBD A;  1IN5 A;  1FMW A;  1TT0 A;  1WPK A;  1QZE A;  2CG4 A;  3EPZ A;  4RAZ A;  4KYW A;  1JJ8 C;  3W2V A;  4JP0 A;  3QQA A;  3TDU C;  3RSN A;  4BDZ A;  5K5Q A;  2ME0 A;  4NB5 A;  3CCM I;  2VBW A;  3S17 J;  3BR1 A;  5EGO A;  1BR4 A;  2FBH A;  2BHY A;  3C2H A;  1ZAR A;  4IEJ A;  2PMZ N;  4PSX A;  4D7N A;  4IHS A;  1YIT I;  2RDP A;  1VQL I;  5GAG J;  5D5V B;  4UUS B;  2IT0 A;  2O7O A;  4M72 A;  1XB4 A;  2XB0 X;  1I6H J;  2X4H A;  4UUT A;  2ZJR F;  4BEH B;  3HSR A;  4PJN A;  2XAJ A;  1X1D A;  3E6C C;  1EH6 A;  2PLY A;  4BYY A;  1YYV A;  5ILV A;  2JA5 J;  2A5W A;  1HF0 A;  3KIO A;  4IOC F;  2F4O B;  3A0H C;  1ETY A;  3LSG A;  1X3W B;  3O8G A;  2RRE A;  4XRM A;  1IO2 A;  1R71 A;  1J59 A;  2MLK A;  1P4A A;  1MMD A;  3ASO H;  2DYS H;  4EV0 A;  3P9C A;  1J5Y A;  1FT9 A;  2V9K A;  2MC3 A;  5EDN A;  2XSJ C;  2IP2 A;  4RMN A;  1IZ1 A;  2IGO A;  1A6I A;  3M4O J;  3BTC A;  1YX5 A;  3MD2 A;  1XSX A;  3OL4 A;  1N75 A;  3OS1 A;  1TBX A;  4UVB A;  3H0D A;  1RR8 C;  2YU9 J;  1ULY A;  3H9Q A;  3LNQ A;  1F43 A;  3PQK A;  5J6X A;  4IRI A;  1JT6 A;  3U2R A;  2VJI A;  4A3L J;  1L3L A;  3TQN A;  1ACI A;  3CP8 A;  4BKX A;  5HVQ C;  2HPI A;  3T1B A;  4FE7 A;  2ZB9 A;  1IN4 A;  5DD8 A;  2NOJ B;  4AC0 A;  3Q0U A;  2YS9 A;  1OFC X;  3GEZ A;  2NYX A;  2VJ4 A;  3G2B A;  1MBH A;  5B1A H;  3MZH A;  3R0J A;  2GLO A;  2TCT A;  3PNY A;  2W25 A;  3NEU A;  4C9Y A;  3WGI A;  3HBL A;  4P96 A;  1IV6 A;  4I0A A;  4GYG A;  3VYS B;  5B66 C;  3DBH B;  1T8I A;  3MWM A;  3BZC A;  1BI0 A;  1XMX A;  2L7Z A;  1D1C A;  2EFW A;  1FNN A;  3BCA A;  3BG3 A;  3PIO F;  2V1D A;  1Z9C A;  4ZTF A;  1EJ9 A;  4G7O F;  2IS6 A;  2QQA A;  3F8C A;  1X1B A;  1VND A;  5ILU A;  3ABT A;  4XLA A;  4OMY A;  4HV5 A;  4C3J J;  3L2V A;  2P7C B;  4E7J A;  1K78 A;  2MFZ A;  4LJZ F;  1H9T A;  3G1O A;  1K61 A;  5DS9 A;  3WG7 H;  4HDU A;  1OYY A;  2RQP A;  3FWE A;  2P7V B;  3IKT A;  3PSF A;  3BDD A;  4I0B A;  4XIC A;  3DTI A;  4X1E A;  4YEJ A;  2CFO A;  3VOD A;  3LSR A;  3QAH A;  3BPV A;  1JT0 A;  4O6J A;  1OR7 A;  3WU2 C;  2DPU A;  3CCY A;  3DU6 A;  5E79 C;  1MJB A;  2DA2 A;  2ELK A;  5C4J J;  3JRE A;  1N78 A;  1BBY A;  3BG9 A;  1Z1D A;  5LEK A;  4IHX A;  2LYC A;  2EZI A;  2HDW A;  4BNC A;  4GGG A;  3SQN A;  1R4N B;  3GW2 A;  1W36 D;  4M6X A;  4HF0 A;  2Y9Z A;  2IA2 A;  3ZQH A;  3CJQ B;  1W7P B;  5M3F J;  2B7E A;  3H3V K;  5E1W A;  1IRZ A;  3E1S A;  2VE9 A;  5K7F A;  4BAY A;  1YW7 A;  4PJM A;  4HDV A;  3BLY A;  1RIO H;  1XTA A;  4MQV A;  5FKN A;  4AIK A;  5KCM A;  3RQ4 A;  1XDS A;  4C2M J;  3ABU A;  3SEQ A;  2L7M P;  3O6B B;  3ZQF A;  3MAJ A;  3G1M A;  5FGM A;  1X1A A;  2L5Q A;  4B48 A;  4LIV A;  2E1N A;  2EQR A;  4OIQ F;  3F6V A;  5F1J A;  2JT1 A;  3EQL F;  5FFX A;  4AD9 A;  5JHF A;  1FSE A;  2JRM A;  2DI3 A;  1OCO H;  1WKM A;  5BQT A;  5M5Y J;  5C44 J;  3IAS 2;  1XPX A;  2XGC A;  3HTS B;  3GTK J;  1V5F A;  5DV5 A;  2DCE A;  3BZK A;  3W6J B;  3F8F A;  1SD4 A;  4AM3 A;  3EYY A;  2OCE A;  3K2A A;  1VF9 A;  1DU0 A;  2O5R A;  3ERE D;  4V19 K;  2M30 A;  3F8M A;  5HOO A;  1X4O A;  1AWC A;  1F36 A;  1X19 A;  4UVA A;  2FBK A;  4A3K J;  4BY1 J;  2YU3 A;  3M07 A;  2ELJ A;  3G3Z A;  2JA6 J;  5F08 A;  2FOW A;  3CMA I;  4A3B J;  2F5D A;  4L9N A;  2DK5 A;  3MQ0 A;  4BJT A;  1ZRD A;  5LHI A;  1UG0 A;  3EUK L;  5HNF A;  4CHU A;  1Z3Y A;  4M9S A;  4U0V A;  1CQT A;  1XC5 A;  1ZQ3 P;  1ZN2 A;  1OYI A;  4CZZ A;  2OAZ A;  2DU9 A;  3OV8 A;  4BUP A;  2XDV A;  2KKO A;  2M0C A;  3GZ5 A;  4E7H A;  2IXS A;  1GDT A;  3IH4 A;  3R61 A;  3Q5F A;  1T38 A;  2NNY A;  1RRJ A;  1DPU A;  1P4X A;  4MQ9 F;  4ESF A;  1NG6 A;  2H1L A;  3HOS A;  3DPU A;  1VQ5 I;  5D8L B;  3HEF A;  3QU3 A;  3ZQQ A;  3UKG A;  2D2W A;  3CDI A;  5EEA A;  3WE2 A;  3DXJ F;  1HC8 A;  2H8W A;  2DMT A;  3KZI C;  4XK4 A;  3CUO A;  3CMM A;  1U3E M;  4I2O A;  1ETK A;  5CVI A;  1B72 B;  1X1C A;  1XGM A;  4HOB A;  1QQI A;  1W5S A;  2VUM J;  4JK1 X;  5C4X J;  1JGS A;  3LSK A;  4M6V A;  2KPM A;  1GVD A;  4EM2 A;  4KNY A;  4GFB A;  1X4P A;  2DDB A;  2O6G E;  1SC7 A;  1HLV A;  3DP7 A;  1HKT A;  2ISY A;  3OOP A;  1IRX A;  4M3D A;  3SDB A;  1P4W A;  4MEX F;  2R7S A;  4EJT A;  4FX0 A;  2K85 A;  3GX4 X;  1V54 H;  1QPM A;  4U0Y A;  4IX7 A;  1UB9 A;  2QEN A;  1YLF A;  5CVV A;  2CYY A;  2DAO A;  3WG9 A;  5IP7 J;  4NBQ A;  3LFU A;  3M8F A;  2KIS A;  3ZMZ A;  2CH0 A;  2VC0 A;  4B3X A;  1VFC A;  2R7Z J;  4PDK A;  2GWR A;  2KRH A;  1LFB A;  1K4S A;  4IHY A;  1ODD A;  2WY8 Q;  3JW4 A;  2OPT A;  2F4M B;  4O5V A;  4KIF A;  1RR7 A;  1U0J A;  1MBJ A;  4M3G A;  1JHF A;  4HNV A;  1WJC A;  2H09 A;  2H6B A;  2XAQ A;  3D0S A;  2MSY A;  1T2K A;  4BE2 A;  1V55 H;  2EZL A;  3A02 A;  5FRN A;  1JJ6 C;  4PJJ A;  2STT A;  3WU1 B;  1X3Z B;  2FSW A;  2KJB A;  3OR1 C;  3QPT A;  2L3D A;  1A04 A;  1IN8 A;  1IRF A;  2QCO A;  4E7I A;  1KU3 A;  1FYK A;  1T95 A;  4NC6 A;  5IYB J;  2EIM H;  2EIJ H;  2LKP A;  2ACJ A;  1X2N A;  3KYL A;  2K3F A;  2DT6 A;  5CQG A;  4RLF A;  3DCF A;  5HOD A;  4EEF G;  3M1C A;  4A3E J;  1S3J A;  1VQM I;  4P5O A;  5A2Q Z;  1DU6 A;  2XF6 A;  3TOA A;  4RGR A;  2D5V A;  2EIN H;  2K5C A;  1WCM J;  3BC8 A;  1S7E A;  2OA4 A;  2Q2E B;  2ZKZ A;  3WGH A;  1HOM A;  4F52 A;  2ZXH A;  3SXY A;  2HXO A;  3F23 A;  2PJR B;  2Z5U A;  1NG7 A;  4I01 A;  1ZYR F;  3JRA A;  1F9N A;  3H1C A;  3LQQ A;  4AUX A;  4E4H A;  2HGC A;  1JTY A;  3JRB A;  1K7A A;  2A69 F;  3TMO A;  2AS5 F;  4UUS A;  1HQC A;  2VXD A;  2HPM A;  1SFU A;  3ZGK A;  1K4T A;  2WTE A;  2E5N A;  2YX7 A;  4XLP F;  1ZGW A;  4NQW A;  1APL C;  4II2 A;  3G6E I;  4EMS A;  2K86 A;  5CVR A;  2CV2 A;  3FXU A;  2ZXJ A;  3FMR A;  1B8I A;  3S32 A;  2F5F A;  3AG4 H;  4A3M J;  5FRM A;  5K5R A;  1WH7 A;  1ON2 A;  1X58 A;  1YS6 A;  5EYR A;  2W84 A;  4YFK F;  1VQ7 I;  2PN6 A;  3ABM H;  2DA5 A;  3H0G J;  3HRS A;  2D1H A;  5D6E A;  3VWB A;  2CQ7 A;  1FTT A;  3CJR B;  5ICG A;  1MMN A;  2TDX A;  1NTC A;  3HOV J;  2QQ9 A;  1G3T A;  1S5L C;  1OIS A;  2KDO A;  2UZK A;  3Q0V A;  2VLA A;  3ECH A;  3EYI A;  2DOF A;  3MZ8 A;  4ESB A;  1R00 A;  3CDL A;  5HDG A;  4ZC3 A;  4CSW A;  1JKO C;  1D1B A;  4P55 A;  3DLL F;  1QRY A;  3HSF A;  1B8I B;  2LLK A;  1K6O A;  4A3G J;  3MMY B;  1FC3 A;  4I02 A;  2DA6 A;  2DO7 A;  1TLH B;  5F6F A;  3BR2 A;  1HBX G;  3LL7 A;  2FRH A;  2R7D A;  3CF5 F;  3WOD F;  3OYC A;  4RB1 A;  5BPD A;  2Y0S N;  2IVM A;  2XRO A;  2HOS A;  4UVC A;  5FKO A;  4HQE A;  3QOD A;  1RET A;  3OYB A;  2OZ6 A;  5M5X J;  2X51 A;  2G7H A;  2CQQ A;  1D1A A;  4U0W A;  2LY2 A;  2VKE A;  2Q2E A;  1VI0 A;  5CKT A;  4EM1 A;  2L4A A;  4E7S A;  1G59 A;  1MMS A;  2G9W A;  3BR6 A;  2VXZ A;  3HG9 A;  2E2J J;  4BJ5 C;  1AA7 A;  4IZZ A;  1Z21 A;  2E2I J;  3JSP A;  2BZT A;  3E6B A;  3ZQG A;  4HX8 A;  1K78 B;  3ZQC A;  1VQ9 I;  1ZG1 A;  1L0O C;  1Q1H A;  1O3T A;  1PVE A;  3BJA A;  4L0Z B;  4DOZ A;  4F91 B;  2XPU A;  1ZRE A;  2MGQ A;  3HOW J;  3ROU A;  4GRI A;  3E5U A;  4MFD A;  2QWW A;  2QZ8 A;  2NXN B;  3PIP F;  2DFI A;  2DDA A;  3F22 A;  3DWL E;  1ZEL A;  2XAS A;  3K6G A;  3X2Q H;  3GYH X;  2EA2 A;  2NS7 A;  2COB A;  3ZMD A;  1JE8 A;  2IW5 A;  1SAU A;  4FCY A;  3JRD A;  4U7B A;  1WJD A;  4BHB A;  3IP4 B;  4Y17 A;  2BVL A;  2HDD A;  4JQF A;  1Y8R B;  4RBO A;  2P5L C;  2QBY A;  2VQC A;  3L2R A;  2PG4 A;  4ZYE A;  4NNJ A;  1FEX A;  4UB6 C;  1YJN I;  4Y3O A;  4U7D A;  4AWX B;  3O2P E;  2L2O A;  1YS7 A;  1ETO A;  4EAT A;  3GTP J;  1Z0X A;  3JAM K;  4KT5 C;  2FU4 A;  3KYC B;  4PFO A;  2KRF A;  5J8F A;  1LB2 A;  2HVQ A;  3RZD J;  1P7I A;  3BR0 A;  5EG0 B;  4RDU A;  1EV7 A;  2KHM A;  1BOA A;  2ETH A;  1LFU P;  2FEZ A;  3DLA A;  5DDG A;  3OS2 A;  3GME A;  1JUP A;  2VJ5 A;  1ZAO A;  4EJV A;  5GPA A;  4L0Y B;  1TTY A;  1Y6I A;  1BW5 A;  1ZK8 A;  2BY2 A;  2LOO A;  2P81 A;  2MYS A;  3I4N J;  2ZME B;  3HPG A;  3GCM A;  1Q1V A;  2OU2 A;  2CW8 A;  1S7O A;  9ANT A;  2IEK A;  4XLN F;  2L9S A;  1JI8 A;  1SD6 A;  3IKV A;  1IUF A;  4B47 A;  1FWZ A;  2QSG X;  1QVU A;  3GVA A;  2W82 A;  4FTH A;  1UJ8 A;  4BQO A;  4D5F A;  4ZYA A;  5LD2 C;  2BGC A;  2K40 A;  3H92 A;  3HSE A;  1R5H A;  4KJZ A;  3BPX A;  4KT6 A;  4QLC U;  3O8H A;  4RGS A;  3IH2 A;  5DEQ A;  1LVK A;  3WTX C;  3GTJ J;  4LFU A;  3GZ6 A;  1I3A A;  5B3S H;  3JCU C;  2PMZ A;  1KZH A;  5C3E J;  3H35 A;  1X1P A;  1K6Y A;  1S6L A;  3LA3 A;  4CCN A;  4ZTJ A;  2CMP A;  1ZKG A;  5JR3 A;  1EA3 A;  2RNJ A;  3BQZ A;  4HBL A;  4DYQ A;  3FXM A;  4EGZ A;  4J19 A;  2EV0 A;  2FBI A;  1QVT A;  2OBP A;  3GTL J;  4WK8 F;  2IS2 A;  2K9N A;  4LK0 F;  2CUF A;  5J4Y A;  3AG2 H;  3J81 K;  1HST A;  4KFC A;  1YJW I;  3T8R A;  2ZJP F;  5IP9 J;  4DJA A;  1W0T A;  3ZMT A;  1SFO J;  4XOP A;  2EIK H;  2P8T A;  3CP2 A;  3H3U A;  3FF5 A;  1SAN A;  1OQY A;  1BW6 A;  3P5J A;  4H4K C;  3PO2 J;  3TO6 A;  1YRN B;  2JPB A;  2I8D A;  3QYF A;  3WHB A;  3HOU J;  3A4C A;  1XMA A;  1Z7U A;  2QYO A;  4B8X A;  4BXU A;  4L5E A;  3GTQ J;  5L3F A;  3CCE I;  1FX7 A;  3SHF A;  3A01 A;  3LSJ A;  4RAF A;  1ON1 A;  2L01 A;  5CLS A;  4QPO A;  3SZP A;  3HUG B;  2CUE A;  3BR3 A;  1H8A C;  2BW3 A;  2KMU A;  4B1R A;  1D0Y A;  1IN6 A;  2FQ4 A;  2LRD A;  4S05 A;  3BTL A;  5D5W B;  1JGG A;  3AAF A;  3KZZ A;  4EJW A;  3I58 A;  3HKZ N;  3B73 A;  3M7G A;  3A01 B;  2DFE A;  3U1K A;  2CJJ A;  4OIN F;  1HKS A;  1LVA A;  1IAW A;  1X3U A;  4KN7 X;  5F64 A;  3HHG A;  3A1Y A;  3CJT B;  2ME6 A;  2KLO A;  2X6W A;  4A12 A;  1YRN A;  2AXT C;  1ZHF A;  5GTI C;  4M3B A;  3KEO A;  4L18 B;  1AKH B;  2ZXW H;  4ZJZ A;  4M6Y A;  3ZMS A;  3IUO A;  4OIR F;  1D0Z A;  1PUF A;  1FJL A;  2OF7 A;  2LRE A;  1UHW A;  2XUB A;  2F6C A;  1U9N A;  1X2M A;  4IL6 C;  1WHU A;  1J75 A;  4EGY A;  4LLG F;  3AG1 H;  1J09 A;  1D8J A;  4ENM A;  4MHG A;  2VAS A;  2X1C A;  2Z9O A;  1WQ2 A;  2KFD A;  3LSP A;  5F0C A;  2LF7 A;  1S72 I;  2Z1D A;  2AXL A;  3I64 A;  4JX4 A;  1Z6T A;  1XX5 A;  1Z77 A;  1UZC A;  3I54 A;  4AVP A;  2V6E A;  3OR2 C;  5D4R A;  3F8N A;  3LA2 A;  3LOC A;  1OYW A;  2Q1Z B;  2DBB A;  1OLT A;  5B5E C;  5J40 A;  1XDU A;  3CD6 I;  4KMU X;  2LC2 A;  2NVU B;  1DUX C;  5HLT A;  2LMD A;  2L9V A;  4JX6 A;  4PZJ A;  3VDX A;  4B44 A;  1LJ9 A;  1IC8 A;  2M4K A;  2GXG A;  4XM3 A;  4OIO F;  1JUM A;  3ECO A;  4XN0 A;  4AU7 A;  4BAC A;  4DGW B;  2HZD A;  1LDJ A;  3K7A J;  4RLQ A;  2X6Y A;  5ILS A;  3J7A O;  2CW0 F;  3PFI A;  2M8G X;  2MAB A;  4N4O B;  1G3S A;  1JKP C;  1XSV A;  2JK3 A;  1UHS A;  3RKX A;  1MBF A;  2KZG A;  4G6Q A;  3TP3 A;  2H1K A;  2H27 A;  3GFJ A;  2J5O A;  1ZR4 A;  1IF1 A;  3HDD A;  2JA7 J;  3T0Y A;  5ICE A;  3NAU A;  2F5V A;  3HRT A;  3H9J A;  3VEP A;  1TWG J;  1OKR A;  2DN0 A;  4W1U A;  4OMZ A;  2M4G A;  5BNG A;  3P9K A;  2A07 F;  2P5V A;  3JAM Z;  2QQ8 A;  4RB2 C;  2CRG A;  5F27 A;  2VQG A;  4DBQ A;  3MKL A;  2CUZ A;  3J80 Z;  3S1Q J;  3BWG A;  5JLW A;  1XD7 A;  2RKH A;  4HW0 A;  4J01 A;  1ETQ A;  1KU2 A;  3I59 A;  2FXA A;  2L9N A;  3K70 D;  1IV8 A;  1HW5 A;  2DPD A;  4XRS G;  1TW2 A;  4ZYG A;  1DPR A;  2ZBK A;  1TZL A;  5E8I A;  3KP5 A;  3G73 A;  3DQV C;  4CYD A;  4EJU A;  5E3M A;  2NS0 A;  3K69 A;  4G7Z F;  1ZLK A;  1K83 J;  2LR8 A;  2JQ7 A;  2FX0 A;  5J8C A;  4I98 B;  2WAE A;  1BI2 A;  3ZMV A;  2EA4 A;  2K9L A;  2VE8 A;  1HXD A;  1OCR H;  2P6T A;  3ABL H;  1A35 A;  4XLH A;  2EZH A;  3N97 A;  2LTP A;  4U88 A;  5AIP A;  1TWA J;  3KLO A;  5EGO B;  4Y13 A;  3VYT B;  3K4J A;  4P1W A;  2YUS A;  4E70 A;  2DMP A;  3C2G A;  3SEZ A;  2NRA C;  4EM0 B;  2K02 A;  5M5W J;  2JSC A;  1OCC H;  2F5E A;  4A5M A;  5BS6 A;  2JZY A;  1MMA A;  5BOX A;  2ZJ2 A;  3ZPL A;  4X0G A;  1KYZ A;  1GV2 A;  2VKD A;  4G9Y A;  3FXL A;  2KP6 A;  3OYL A;  1JKR C;  3OYI A;  4XSX F;  4CYC B;  4HPQ A;  4RB3 C;  3P7N A;  3MKY B;  3JRG A;  2NVY J;  4NUB A;  2W85 A;  4Q5S F;  1ZG3 A;  4BBS J;  3KP6 A;  3AL0 B;  2BHZ A;  2HTS A;  2CWE A;  1W4M A;  4RAG A;  1ZRC A;  1ZG5 A;  4B09 A;  2VOD A;  4EVI A;  2H8R A;  1I27 A;  1H89 C;  5FRO A;  2EBI A;  3ZXS A;  2MA3 A;  1ETW A;  3FMQ A;  5KK1 A;  3TW7 A;  4LIU A;  4PGH A;  2JN6 A;  1LFP A;  1FOX A;  4I99 C;  2X1E A;  2ZCW A;  1T0F A;  5HS9 A;  1LQ1 A;  1TWH J;  1U2W A;  1GHC A;  5TJJ A;  5KVR A;  2FML A;  4CCL A;  4B43 A;  4A3D J;  1JXS A;  5E3O A;  3D5L A;  4AIH A;  3I4P A;  4ESJ A;  3ERM A;  4A0X A;  1WGX A;  2MLG A;  2CQX A;  5D4S A;  4MEY F;  3G4S I;  2E60 A;  2RV8 A;  2Q8K A;  1MSE C;  2Y9Y A;  2LDU A;  4P9U A;  1I3Q J;  3CLO A;  5JHU A;  1MJA A;  1AU7 A;  2RC4 A;  3N05 A;  5TIS C;  2QSH X;  1SFE A;  3BG5 A;  4Z6Y A;  3CMY A;  4MIM A;  2LY9 A;  4GXO A;  2XRL A;  3E6M A;  4F55 A;  3EET A;  5FLX Z;  1POG A;  3CC2 I;  1R5I D;  3L2W A;  3K0L A;  1J0R A;  1ZGJ A;  3K4C A;  2XAG A;  1GLN A;  1TT5 B;  5J1Y A;  3GBG A;  3CCV I;  5GPC A;  3J80 K;  1MKM A;  2X6X A;  3QYB A;  2O03 A;  3CCL I;  1O3Q A;  2ZME A;  1G3Y A;  1VQP I;  1FYM A;  3TKY A;  3AKZ A;  4KIB A;  3MKZ A;  5J1U A;  4A93 J;  4MLO A;  1AKH A;  1KU7 A;  1WJE A;  5LGU A;  1ZGA A;  3P9I A;  3PFY A;  5IOZ A;  3S3M A;  1DQU A;  3RYR A;  1MIJ A;  4XID A;  3B6C A;  3IL2 A;  4V2G A;  2WBM A;  3JRH A;  4MO7 A;  3WGG A;  2W48 A;  1RUO A;  4N0B A;  4I76 A;  3DV8 A;  2ZNY A;  2ESN A;  3ZRG A;  1KQ8 A;  5E1X A;  2DFF A;  3IRQ A;  2DXI A;  1MNE A;  5LBQ A;  1XG1 A;  3WTU C;  2DTZ A;  3CC4 I;  4X6A J;  2BY1 A;  2CGP A;  4C30 A;  1R7J A;  3IH3 A;  4LMY A;  5HS7 A;  2IPQ X;  1W36 C;  2E1M B;  2DT7 B;  2GA1 A;  1HW1 A;  1SD7 A;  3F8B A;  4FAS D;  3CZ6 A;  2FOK A;  3CES A;  1I1G A;  2ZNZ A;  3OYJ A;  4A3J J;  5E20 A;  1E3P A;  2JPC A;  3CDH A;  1W7P D;  1U9O A;  1QHG A;  3V7R A;  1BC8 C;  2LF8 A;  5H2F C;  2KIM A;  1A6Q A;  4I09 A;  4DYR A;  2UXN A;  2WV0 A;  2EFO A;  3TW6 A;  4DQ2 A;  1O4X A;  1MDM A;  2WAF A;  5F04 A;  3K1M A;  3SZG A;  4C3I J;  2WC2 A;  1M1E B;  3KEY A;  3ML6 A;  2L4M A;  3ZMU A;  3CQZ J;  1BJZ A;  4GDF A;  5IYD J;  3L9F A;  1FLI A;  3RCO A;  3S1M J;  4CH7 A;  3HOX J;  1WJF A;  3L2C A;  1T98 A;  2E2H J;  5M3M J;  2QLZ A;  4L9T A;  5BPI A;  4XNF A;  3JRC A;  5F1R A;  3JRF A;  1HCR A;  3ZOB A;  4LD5 A;  5TGT A;  1QZY A;  3LA7 A;  2LSO A;  5IOY A;  2OV7 A;  1SEU A;  3ESW B;  2FMY A;  6PAX A;  2FE3 A;  4QTR A;  3CUQ B;  1U5T C;  4KIT B;  1GXP A;  3S15 J;  4ZH4 F;  1FSH A;  4HF1 A;  1I6X A;  3K4K A;  4I6Z A;  3I55 I;  2VN2 A;  2WB1 A;  1PP8 F;  4ZZL A;  4ENJ A;  1LNW A;  4XON A;  3FBI B;  4CUG A;  1F1Z A;  1TW3 A;  3FXQ A;  3L00 A;  2JMW A;  4BY7 J;  1KON A;  1Z91 A;  1USS A;  3QYE A;  4Q47 A;  3AL0 C;  4UB8 C;  3ZN0 A;  1DP3 A;  1D8K A;  2BEO A;  1Z3X A;  3CUQ C;  1G6N A;  2VL8 A;  2M2E A;  4CDG A;  5E8G A;  4RA2 A;  1B9N A;  3RKQ A;  1R23 A;  2EPF A;  1DGR M;  3QOP A;  1BN5 A;  3HYI A;  1MMG A;  3ISP A;  3FKI J;  5L3D A;  2R5Y A;  1V5E A;  1GV5 A;  4NC7 A;  2PBI A;  1BI1 A;  2PEX A;  1YIO A;  1ZR2 A;  4R79 A;  3FIS A;  3OWT A;  1D0X A;  3DFG A;  2O8K A;  3I3L A;  4F93 B;  3FXK A;  2HQR A;  2O9L A;  3HL2 A;  1TNT A;  1MBK A;  2HYF A;  3LQR A;  2G7U A;  3NWT A;  1JTX A;  3HOY J;  2ZXI A;  2BVM A;  2CUJ A;  4IHW A;  1REP C;  1B9M A;  4QIW N;  4LB5 A;  1QZZ A;  4ZYH A;  1LE8 B;  3WU0 A;  3FMS A;  1UST A;  2HQ5 A;  2WB1 N;  4BQQ A;  4ZZD A;  5DD4 A;  4V2F A;  3I71 A;  1T0F C;  3V8J A;  2FUG 2;  4DZP A;  1NK2 P;  4KMF A;  5EZH A;  4M71 A;  4IHT A;  2TRT A;  4CZC A;  3LAJ A;  2XF7 A;  3VPR A;  4EQQ A;  4CGZ A;  2V4J C;  5KHD A;  1BI3 A;  2Y30 A;  4NHJ A;  2R7O A;  3W2A A;  3ZQ7 A;  3MKW B;  2KRC A;  2QQB A;  2UWM A;  1I50 J;  5E17 F;  2HVS A;  4JYK A;  3BP8 A;  3OIO A;  1LDK B;  2G0E A;  3ZQL A;  2RN7 A;  4E7K A;  1Z67 A;  2HZT A;  3I5U A;  3LSI A;  2M45 A;  5DYM A;  4LLL A;  3RJP A;  2R7X A;  2ECB A;  4HV6 A;  2JVH A;  2M0M A;  3C2B A;  1SVO A;  5FKL A;  1UHM A;  4C2T A;  3OYF A;  1FZP B;  3KZY A;  2QF7 A;  3LFK A;  4U87 A;  1HA8 A;  4OU0 A;  4D1Q A;  2VOP A;  3HGG A;  2Y75 A;  4WF2 A;  4DZJ A;  2ZSI B;  1IGN A;  1YFH A;  3KET A;  4HRI A;  5D5X B;  2WAQ A;  4KDP A;  1BR2 A;  3TGN A;  1MH4 A;  4AVZ A;  4DYC A;  3QOE A;  2QSF X;  3K4B A;  1IXC A;  1V5G A;  1Y1W J;  1WJB A;  4PSW A;  2P0W A;  2VBZ A;  1HSJ A;  3RI4 A;  4CCO A;  2V1X A;  2E36 A;  3DEE A;  3E5Q A;  1FIP A;  3COA C;  3ABK H;  5GAE J;  1SFX A;  2IGM A;  2M9H A;  2ZSH B;  4BHC A;  1P7J A;  2M87 A;  4LG0 B;  2XKO A;  5GTH C;  3F6O A;  4A6E A;  2Z99 A;  2WAD A;  2ADU A;  2X6O A;  1IDZ A;  1RES A;  3F0C A;  2B63 J;  2VKV A;  3I4M J;  3TBI A;  2Y2Z A;  3CF2 A;  2ZJQ F;  3DEW A;  1QU3 A;  2E7X A;  3EUH A;  1FTZ A;  2R7F A;  4OOI A;  2JJ7 A;  2KT0 A;  4PGG A;  3RKW A;  2HOA A;  2L0K A;  2LBF B;  2HVR A;  1ENH A;  3OMY A;  2R5Y B;  2K7L A;  3JTG A;  4IPA A;  3KFW X;  3IWF A;  1U78 A;  2A6H F;  2E19 A;  3Q0W A;  1KU9 A;  3HPH A;  4UHT A;  1H0M A;  1WI3 A;  2PMU A;  2XAU A;  3DBR B;  1ITY A;  4HX4 A;  4L9J A;  4N4N B;  5AIQ A;  1VQO I;  3S8P A;  4CCM A;  3RZO J;  2MC4 A;  3K4N A;  2LVS A;  3PNV A;  2W24 A;  2RNG A;  2VJJ A;  4NDL A;  2R7Q A;  1O3S A;  2Q0O A;  1SVM A;  5LHH A;  3V4G A;  3DU5 A;  4XOR A;  1J7K A;  2MBF A;  4YEL A;  4HX7 A;  3LSM A;  3CME I;  5ERI A;  2X1D A;  3Q9S A;  3QWL A;  3K9T A;  4HZF A;  2DFH A;  2CQN A;  3D1N I;  2DMQ A;  2HNH A;  2Z33 A;  1VTN C;  4IKF A;  3PNT A;  3OYK A;  2EB7 A;  4Q48 A;  4AYB N;  1KA8 A;  3EUA A;  4BS9 A;  3Q3S A;  3E97 A;  2CQK A;  4XN3 A;  4IJA A;  3JR9 A;  4E6K G;  4A0Z A;  2YR2 A;  3GFM A;  3VYR B;  2JA8 J;  5FD6 A;  1QPI A;  3CJN A;  2QKM B;  1BC7 C;  1R49 A;  1YIJ I;  3ZR8 X;  2ZFW A;  4F7Z A;  3QPL A;  3GF2 A;  3OSG A;  1Z6R A;  1N77 A;  1C0W A;  3BR5 A;  5KNL A;  3R4K A;  1MBG A;  2R7W A;  2XHK A;  2R5Z B;  3AFH A;  2V7F A;  2YPR A;  3OYA A;  1UAA A;  3S14 J;  2X48 A;  3TO7 A;  2LNB A;  5L3G A;  4O3M A;  1BOB A;  4WWC A;  3M8E A;  2MD5 A;  1QNT A;  3GLL A;  2DJN A;  3KP3 A;  2GOM A;  3R6S A;  3H5A A;  3KYD B;  4CIC A;  1AHD P;  3C1D A;  4KA4 A;  5FLV A;  2PMH A;  2HYJ A;  5DUK A;  2X9D A;  3OYN A;  3U9G A;  2K9M A;  2COM A;  3ASN H;  1OJL A;  1R22 A;  2QVO A;  3OYG A;  1MSF C;  2PJR A;  1IDY A;  2CS3 A;  4OAZ A;  4JOM A;  4DW6 A;  2A05 A;  3BOQ A;  1PYV A;  1QBJ A;  1B6A A;  2LH9 A;  2LG4 A;  2AQF A;  2MW8 A;  4DBR A;  3DKY A;  2CO5 A;  2HQN A;  1V3F A;  4FQG A;  5GAD J;  5LRS A;  5LHG A;  5EF6 A;  1BR1 A;  2RQQ A;  2XF5 A;  2VQH A;  4WXC A;  3WTV C;  3CCQ I;  4G7H F;  1E3O C;  2STW A;  3HB9 A;  4UV9 A;  1LUJ B;  1KQ9 A;  2RVC A;  1SFK A;  4XBF A;  1SMY F;  5FO5 A;  5GAH J;  2VC1 A;  3PL8 A;  2LK2 A;  1YW9 A;  1QHH D;  1XS9 A;  5HLI A;  1WFX A;  4IHV A;  2M5W A;  1W5C C;  4D9J A;  2X85 A;  3R0A A;  1V4R A;  2DT5 A;  3NRV A;  4KIG A;  1B4A A;  2DMN A;  2EWN A;  2D45 A;  4XKV A;  5E1Z B;  1GT0 C;  2HWV A;  5E3N A;  2DJI A;  1R36 A;  2UUZ A;  4XKC A;  5CVU A;  4QSH A;  5FB2 A;  3I53 A;  2VBX A;  5HS8 A;  5K7Z A;  1LDD A;  2R5Z A;  3L1P A;  1WZ2 A;  2IS1 A;  3FXR A;  4IF4 A;  4A3F J;  4OIP F;  3SJM A;  2LP0 A;  5HNH A;  2ID6 A;  5L3B A;  3VFZ A;  3RYP A;  4N9H A;  1XMK A;  2WA0 A;  3CCS I;  3RQI A;  3BJO A;  1MW7 A;  3BY6 A;  5IP6 A;  2OD5 A;  2OTJ I;  3F21 A;  2GXB A;  4KUM A;  1SVL A;  2A5Y B;  2F4I A;  4S0H B;  3SFZ A;  1R4M B;  3SDG A;  3HKZ A;  4MFE A;  3U1D A;  3KE2 A;  4XLF A;  3V7C A;  4YIR X;  1O7L A;  3GLX A;  4KIC A;  2Z2S B;  1PUF B;  2JRT A;  1YO5 C;  2CW7 A;  1A36 A;  1LEB A;  5L3E A;  1EF4 A;  1FOW A;  1BA5 A;  5EZG A;  1VZ0 A;  4LG3 A;  3MVP A;  4A2U A;  1SAX A;  2XAF A;  2HTJ A;  4HAM A;  3GUD A;  4LLN A;  4A5N A;  3GFL A;  3VSL A;  1G4D A;  4CCK A;  2EV5 A;  2DA4 A;  2XKP A;  1P6R A;  1WH5 A;  2GQQ A;  3NWS A;  1WSU A;  2Y31 A;  2A3S A;  4HNT A;  5JFR A;  4BE1 A;  5DCM A;  3O3K A;  1U5T B;  3IAM 2;  4IVN A;  3CCJ I;  3BG7 A;  3I59 B;  2ESH A;  3HIF A;  4N9I A;  5FKK A;  4F92 B;  4HST A;  4P9F A;  1NH3 A;  2HFH A;  1MJ9 A;  4HA8 A;  1QGP A;  2M34 A;  3L2Q A;  2EZK A;  3LWF A;  3HUG A;  5H6R A;  4CA0 A;  2HOT A;  5D5U B;  4B4C A;  3HXL A;  4G94 A;  3IWZ A;  2O8X A;  1B72 A;  1WVR A;  3CC7 I; 
#chains in the Genus database with same CATH homology
 2NVT J;  3H0G J;  2DA5 A;  5J1U A;  3E7L A;  4A93 J;  4MLO A;  2I10 A;  3A03 A;  1H88 C;  1AKH A;  5FLM J;  3WHC A;  3MN2 A;  2R93 J;  1FTT A;  1FIA A;  2GM4 A;  1NTC A;  5IOZ A;  3HOV J;  4XID A;  3B6C A;  1OCT C;  4V2G A;  3JRH A;  3Q0V A;  4MO7 A;  2W48 A;  1ETX A;  3OSF A;  4I76 A;  3CDL A;  4ABZ A;  4XRS A;  1JKO C;  1QRY A;  1B8I B;  2GBY A;  2LLK A;  2K9S A;  2XSD C;  4A3G J;  1D5Y A;  2DA6 A;  3SFI A;  3BR2 A;  1XG1 A;  2DTZ A;  1Y1V J;  4X6A J;  2Y0S N;  3S16 J;  4LOC A;  1TWF J;  1RKT A;  2XPV A;  2HOS A;  5FKO A;  1RPW A;  4FIS A;  3IH3 A;  1RET A;  3BTJ A;  3JRI A;  5M5X J;  1GUU A;  2CQQ A;  1UMQ A;  1MBE A;  1T33 A;  2VKE A;  4M3E A;  4A3J J;  1VI0 A;  1JKQ C;  2NOG A;  3BR6 A;  1U9O A;  2E2J J;  2L7F P;  2VPR A;  1MNM C;  2NS8 A;  2E2I J;  4DYR A;  3GTG J;  3W6V A;  3ZQG A;  3TW6 A;  3ZQC A;  3HOZ J;  1OCP A;  3B6A A;  1O4X A;  1TC3 C;  5F04 A;  4C3I J;  2XPU A;  2MGQ A;  3HOW J;  2N8G A;  4MFD A;  3S1R J;  2MG4 A;  3CQZ J;  5IYC J;  3GTM J;  1NK3 P;  1BJZ A;  1HDP A;  4A3C J;  5IYD J;  5EG0 A;  2XB5 A;  1W0U A;  3S1M J;  3HOX J;  5J1R A;  3BTI A;  3HM5 A;  2NS7 A;  2COB A;  1T56 A;  2XPW A;  3JRD A;  2JWT A;  4FCY A;  1R9T J;  2E2H J;  5M3M J;  2XGD A;  2KDZ A;  1TWC J;  1IJW C;  3M3Y J;  3JRC A;  3IV5 A;  3JRF A;  1HCR A;  2HDD A;  3ZOB A;  5F0H A;  4RBO A;  4FE4 A;  1ZTR A;  3HGY A;  2IBD A;  1WPK A;  5IOY A;  1FEX A;  1JJ8 C;  4JP0 A;  3QQA A;  4QTR A;  3FK7 A;  2ME0 A;  3S17 J;  1ETO A;  3GTP J;  3BR1 A;  3S15 J;  1Z0X A;  5K7H A;  5EGO A;  4I6Z A;  1MH3 A;  4IEJ A;  2JMW A;  2PMZ N;  4BY7 J;  2LD5 A;  3RZD J;  3TED A;  4D7N A;  3S2H J;  1P7I A;  3BR0 A;  5EG0 B;  4RDU A;  3S2D J;  4UUS B;  2O7O A;  1LFU P;  1G2H A;  2M2E A;  1JUP A;  2XB0 X;  1I6H J;  4UUT A;  5GPA A;  3RKQ A;  1BW5 A;  1ZK8 A;  2P81 A;  4A3I J;  3I4N J;  4D5C A;  3FKI J;  2R5Y A;  1Q1V A;  1GV5 A;  5FJ8 J;  1ZR2 A;  2JA5 J;  9ANT A;  2IEK A;  1HF0 A;  3FIS A;  3ZQI A;  1IUF A;  1ETY A;  2O8K A;  1QVU A;  3LSG A;  3O8G A;  4XRM A;  4FTH A;  2EH3 A;  4D5F A;  2O9L A;  3BQY A;  2K40 A;  1MBK A;  5EDN A;  1BL0 A;  1A6I A;  1JTX A;  3O8H A;  3M4O J;  3BTC A;  3IH2 A;  3HOY J;  3GTJ J;  4IHW A;  2YU9 J;  4QIW N;  5C3E J;  3LNQ A;  1F43 A;  1LE8 B;  3FK6 A;  2R0Q C;  1RKW A;  1JT6 A;  1ZKG A;  4A3L J;  2HQ5 A;  2WB1 N;  3BQZ A;  4DYQ A;  2LKX A;  3PO3 J;  4V2F A;  4J19 A;  4BKX A;  4DZP A;  1NK2 P;  1QVT A;  2WAQ N;  5EZH A;  3GTL J;  4FE7 A;  2ZB9 A;  2K9N A;  4AC0 A;  3Q0U A;  4BBR J;  2TRT A;  2YS9 A;  1OFC X;  2CUF A;  3NAR A;  3VPR A;  1MBH A;  3PM1 A;  1ORK A;  2Y30 A;  5IP9 J;  2GLO A;  2TCT A;  3OOU A;  1W0T A;  3HBL A;  1SFO J;  1IV6 A;  4G12 A;  3GTO J;  1I50 J;  1SAN A;  2L7Z A;  1BW6 A;  3PO2 J;  1LE8 A;  4JYK A;  3OIO A;  3BG3 A;  1YRN B;  2G0E A;  3ZQL A;  3WHB A;  3HOU J;  1VND A;  4L5E A;  3GTQ J;  2ECB A;  2WV1 A;  4JX5 A;  2XGE A;  3C2B A;  3A01 A;  3LSJ A;  5FKL A;  5DTD A;  4C3J J;  2QF7 A;  2CUE A;  5E3L A;  3BR3 A;  3G1O A;  1K61 A;  5DS9 A;  1H8A C;  3HGG A;  4B1R A;  4DZJ A;  1IGN A;  2FQ4 A;  3BTL A;  1JGG A;  1MH4 A;  4XIC A;  4X1E A;  4DYC A;  3HKZ N;  3A01 B;  3LSR A;  2CJJ A;  1Y1W J;  1JT0 A;  3CCY A;  3JRE A;  2DA2 A;  2ELK A;  5C4J J;  3BG9 A;  2ME6 A;  1YRN A;  4IHX A;  2FD5 A;  1IG7 A;  2AHQ A;  4M3B A;  2EZI A;  1FIP A;  1AKH B;  2E1O A;  2M9H A;  1PUF A;  1P7J A;  1FJL A;  2Y9Z A;  2OF7 A;  3ZQH A;  5M3F J;  3H3V K;  1IRZ A;  2X6O A;  1IDZ A;  5K7F A;  1U9N A;  1RES A;  3F0C A;  2B63 J;  2VKV A;  3I4M J;  1X2M A;  2Y2Z A;  3DEW A;  5FKN A;  4C2M J;  1FTZ A;  2L7M P;  2JJ7 A;  2KT0 A;  3ZQF A;  3G1M A;  2HOA A;  2L0K A;  1ENH A;  2R5Y B;  3LSP A;  5F0C A;  2EQR A;  4JX4 A;  1U78 A;  5F1J A;  2E19 A;  3Q0W A;  1Z77 A;  2IAI A;  5C44 J;  5M5Y J;  1WI3 A;  2XGC A;  1HDD C;  3GTK J;  1ITY A;  3LOC A;  3RZO J;  2ECC A;  2LVS A;  3K2A A;  1VF9 A;  1DU0 A;  4JX6 A;  4NDL A;  1IC8 A;  1F36 A;  4A3K J;  4BY1 J;  1JUM A;  4C3H J;  3K7A J;  2JA6 J;  5F08 A;  2M8G X;  3D1N I;  2DMQ A;  4A3B J;  2DA1 A;  1JKP C;  2ID3 A;  1UHS A;  2JK3 A;  1MBF A;  3TP3 A;  2H1K A;  4AYB N;  1ZR4 A;  3HDD A;  2DA3 A;  1CQT A;  1XC5 A;  3Q3S A;  1ZQ3 P;  2JA7 J;  3NAU A;  3JR9 A;  1TWG J;  2DN0 A;  3G1L A;  4W1U A;  5BNG A;  3QPS A;  2M0C A;  2NVX J;  2JA8 J;  2L9R A;  2CRG A;  5F27 A;  1QPI A;  1GDT A;  3IH4 A;  3MKL A;  2CU7 A;  5J3L A;  3S1Q J;  2HXI A;  5JLW A;  3QPL A;  3OSG A;  4W97 A;  3BR5 A;  1ETQ A;  3HEF A;  3UKG A;  5EEA A;  1MBG A;  4B3A A;  2DMT A;  4XK4 A;  4XRS G;  2R5Z B;  2LFB A;  3S14 J;  2X48 A;  1ETK A;  1B72 B;  2R92 J;  2VUM J;  3TP0 A;  5C4X J;  4M6V A;  5F0F A;  5E3M A;  3FIW A;  1GVD A;  1K83 J;  2DJN A;  2LR8 A;  4GFB A;  2FX0 A;  4CYC A;  2RAE A;  1HLV A;  1AHD P;  3BT9 A;  2AO9 A;  5FKM A;  5FLV A;  2HYJ A;  4M3D A;  2X9D A;  2EZH A;  2K9Q A;  1OJL A;  2LTP A;  2NVQ J;  1TWA J;  1MSF C;  1IDY A;  4DW6 A;  5EGO B;  5IP7 J;  2YUS A;  2DMP A;  2MW8 A;  5M5W J;  1VFC A;  2R7Z J;  5EF6 A;  1LFB A;  1GV2 A;  1E3O C;  4IHY A;  3HB9 A;  2OPT A;  2DA7 A;  1JKR C;  4Y52 J;  1RR7 A;  2LK2 A;  4CYC B;  1MBJ A;  1XS9 A;  4M3G A;  4IHV A;  4HNV A;  3JRG A;  2NVY J;  2MSY A;  4D7M A;  2DMN A;  1GT0 C;  4BBS J;  5E3N A;  2EZL A;  4QSH A;  3A02 A;  5K7Z A;  1JJ6 C;  1UG2 A;  2R5Z A;  2H8R A;  1U8B A;  3L1P A;  1H89 C;  4BXX J;  2EBI A;  4A3F J;  3SJM A;  2LP0 A;  2ID6 A;  1ETW A;  1JUS A;  2QCO A;  3TW7 A;  3RQI A;  5IYB J;  2DMU A;  2JN6 A;  5IP6 A;  1A5J A;  1X2N A;  4S0H B;  3SDG A;  4MFE A;  3DCF A;  5HOD A;  1TWH J;  4EEF G;  1PUF B;  4A3E J;  3S1N J;  1EF4 A;  4A3D J;  1DU6 A;  1BA5 A;  5EZG A;  5E3O A;  3MVP A;  2D5V A;  1WCM J;  1HOM A;  1S7E A;  1WGX A;  2CQX A;  2HXO A;  2VI6 A;  1MSE C;  2Y9Y A;  5JLX A;  1AU7 A;  1I3Q J;  2DA4 A;  1WH5 A;  3JRA A;  4Y7N J;  3BG5 A;  4AUX A;  2FJ1 A;  3CMY A;  1JTY A;  2Y31 A;  2LY9 A;  4MIM A;  3JRB A;  2XRL A;  4UUS A;  1POG A;  4M3F A;  5FKK A;  5IPA A;  1APL C;  5J1Y A;  4A69 C;  3GBG A;  1ZGW A;  2HI3 A;  5GPC A;  2M34 A;  2EZK A;  1B8I A;  1ETV A;  5GP9 A;  2HOT A;  4A3M J;  4B4C A;  1WH7 A;  1X58 A;  1B72 A;  5EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...