3PIOF

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3pioF00
1VQ8I 2E36A 3CJTB 3CC2I 1VQPI 2E34A 1ACIA 5DM7F 5DM6F 3PIPF 1QA6A 3I55I 3CD6I 4IOAF 1FOWA 5GADJ 3G71I 1YHQI 3CCJI 1Y39A 1YJWI 5GAGJ 1VQ9I 2H8WA 3CCRI 1YJNI 4UY8I 1VQ4I 1YIJI 3CCUI 5GAHJ 1VQMI 5GAEJ 1FOYA 3CC7I 3G4SI 3G6EI 3CMEI 1YI2I 2ZJRF 3CCVI 2ZJQF 4IOCF 2FOWA 1MMSA 2K3FA 1VQ7I 1HC8A 3CCLI 3CF5F 2ZJPF 1VQ6I 1VQKI 1FOXA 3PIOF 3J7YJ 3CC4I 3DLLF 1VQOI 2OTJI 1VQ5I 1VQNI 1YITI 3J7ZI 5JVGF 2QA4I 3CCSI 2JQ7A 3CMAI 3CCEI 3CCMI 2NXNB 3I56I 4V19K 4IO9F 2E35A 2QEXI 2OTLI 1YJ9I 1S72I 3CCQI 1VQLI
chains in the Genus database with same CATH superfamily
5ICCA 4NQWB 1T8IA 4Y7NJ 1SMYF 3GBGA 2UXNA 2KIQA 2R7FA 2X1EA 1IN6A 1D0YA 1TNTA 1YX5A 1U8RA 1EKEA 3DLAA 1ZRCA 3MMYB 2E71A 3VYSB 3GTLJ 2BE5F 1HKTA 1ETOA 1IN4A 3K1NA 1SD6A 5E1ZB 3ISPA 1CGPA 4L5JA 5FJ8J 4RGUA 5M3MJ 2RNGA 4EV0A 3COAC 5CYVA 1RC9A 1RNLA 2GA2A 2K4JA 5L3GA 1QVTA 4IOAF 2ZJ2A 4HNUA 1UMQA 5GADJ 3I53A 4ZTFA 4LLLA 2CS3A 2QYOA 4PZJA 2YU3A 4GXOA 3CJRB 4NB5A 1A35A 1U2WA 2H27A 4UUTA 1B9NA 2BY0A 1IRFA 4M6VA 1IXCA 2HXIA 2H8WA 5KAIC 3DEUA 1LPQA 3RZDJ 3S1QJ 1Y56A 2EFNA 2HDWA 2EJRA 4UY8I 1KGSA 1XG1A 2H6BA 4QSHA 2B63J 2OF7A 4XLCA 5GAHJ 4A3KJ 1IRZA 2VT2A 2MLKA 2E5NA 1F4KA 2EA4A 3LA7A 4I2OA 2OUMA 3FXLA 2RN7A 5D4RA 2VI6A 1X1CA 3G1OA 1UFMA 4M72A 1IDYA 2EINH 1G3YA 3GXOA 1ZG1A 2QWWA 2VQLA 4CCMA 1V55H 4CSWA 1J59A 2P8TA 3QWLA 2K3FA 3G73A 4HZFA 2DA6A 3H35A 3SDBA 4BUPA 1VQKI 1FOXA 1ITYA 2K86A 3RI4A 2JRMA 3ELKA 3AL0C 5B3SH 3HSEA 1GLNA 4Q5SF 2FE3A 2LR8A 3J7ZI 4BE2A 4U7BA 3Q5FA 1W36D 1IRXA 1K61A 2B7EA 1I39A 1R1TA 3FDYA 4J19A 1D8KA 3M1EA 2IRFG 2H8RA 5HDKA 2DK8A 3PUFA 3OYJA 4A3GJ 3HHGA 2DA4A 4F7ZA 2HEOA 4E7KA 1R36A 2WY7Q 4N9HA 1BOAA 5FLVA 2NVQJ 2LLKA 1WI9A 1NG7A 3LFUA 3NAUA 4UB6C 3W6JB 2F6CA 2M7BA 5J4YA 3ZN1A 2ACJA 3K4KA 1S5LC 4CGZA 3BR2A 3DEEA 3FXOA 1OCCH 4HQEA 5FFZA 4Y4RA 3BT9A 3BTLA 4C3HJ 1TT5B 2Y30A 5M3FJ 2Y9YA 3KZZA 5EYRA 5FKNA 2GAUA 1R1VA 3L2CA 3ABTA 3SFZA 5DDGA 1IN5A 2CQXA 2GZWA 4BE1A 1BL0A 2E36A 2YS9A 3N4MA 2QUFA 2AS5F 5D5WB 2UWMA 4UV9A 2BXYA 2BHYA 5B66C 2BGCA 3CDHA 1Z6RA 2XPWA 1FEXA 2CV0A 1F5TA 2PJPA 4J00A 3CTAA 2RDPA 3HRSA 5K5RA 5CVVA 2UZKA 2E7XA 5ICFA 1VFCA 2DQLA 1FOWA 4AU7A 3CJQB 5DD4A 2TRTA 2DODA 3G71I 2EZHA 3FZVA 1MJBA 1KONA 3U21A 5D8LB 3IKTA 4ZDOA 2VKVA 2ELKA 3SJMA 2VQHA 2I10A 5FB2A 3OWTA 3GTJJ 4AIJA 4LMYA 3L9FA 1ETYA 4Y13A 1IXSB 3CCRI 4M6XA 2RC4A 1K83J 3ZP5A 3W2AA 5K5QA 4PFOA 2QQ8A 3RCOA 2IAIA 2PN6A 4P5OA 2LC2A 4R79A 4L9NA 5LBQA 1W0TA 3S2WA 3TO9A 3JRGA 3FISA 1H0MA 3GYHX 1T2KA 2PLYA 3O8HA 2R7WA 3F8CA 1RR8C 1XMKA 3FX3A 1RKTA 4BS9A 4UVBA 1VI0A 3OYLA 5F08A 4BQQA 1KYZA 1HOMA 2CH0A 5LRSA 1O4XA 3DP7A 1BW5A 2MGQA 2UXXA 3ZMSA 5E3OA 3GVAA 4KICA 2LF7A 3ZMZA 1HW5A 1GV5A 1K79A 1FY7A 3A0HC 1YW8A 2ZNYA 3BZCA 3LA2A 1C0WA 5E8GA 1GDTA 4M74A 3F6VA 2LREA 2ZXJA 1ORKA 4RGSA 3J80K 3HOWJ 5CPRB 4P9FA 1IGNA 5C3EJ 3F6OA 4ESFA 4M73A 3ZMUA 1SD5A 3E5QA 3GX4X 1B72B 5K7HA 1JKQC 3A2KA 4MIMA 1WCMJ 3CMAI 4A3CJ 3KIOA 2YR2A 5ERIA 2E1CA 2QM3A 3F8BA 4M9SA 4XLAA 2NVXJ 1BJAA 3B6AA 5AIQA 2QBYB 4YFNF 4B3AA 3HYIA 4IF4A 2O3FA 3JR9A 3VYRB 1W5TA 3ABMH 5D4SA 2L7KA 4EJOA 4ESBA 2EFOA 3GF2A 1R5HA 2AXTC 3HKZA 4O3MA 3HKZN 2OQGA 3K1MA 3SYTA 4KA4A 1VQ8I 2PQ8A 1SVMA 3VOEA 2K27A 3TDUC 2RVCA 3DFGA 3LMMA 3OYEA 3ZGKA 2QZ8A 4B47A 3GTPJ 3CP8A 2XV4S 2Y48A 2NS0A 2LBFB 3ZOBA 1UZCA 4ZC3A 4HPQA 1XS9A 3H0GJ 2VLAA 5DM7F 2H1KA 1BR4A 2ECCA 3P9CA 4YG2F 2ZFWA 3OL4A 1DQUA 1ZGWA 3PNVA 3S8PA 3ZQIA 4BH9A 1XGMA 1DP7P 3AFHA 3M3YJ 2IVMA 1ZGJA 2UV1A 1BC7C 3S3NA 2E1NA 3W3CA 4AIKA 2OD5A 2Z16A 4A3MJ 4EM1A 2L4AA 3BWGA 2V1NA 3ZQGA 5KNLA 2DMQA 2NNYA 1I3AA 3K0LA 4HLXA 2X48A 4NQWA 4ENKA 2FQ3A 4G12A 2G0EA 2EBIA 4ENMA 2DDAA 3M7GA 3EUKL 1E3PA 1K6OA 2M1BA 2DMTA 2P4WA 3LL7A 1ON2A 3F0CA 3G6EI 5GTHC 2V1UA 1Z77A 3B6CA 2LG4A 3PFYA 1QO0D 4XN0A 4XL9A 1TTYA 1XN7A 5JFRA 3CUQC 1ZK8A 2FOWA 2QVOA 4XORA 1WJEA 5FGMA 5BOXA 3LSJA 3CJNA 3CLQA 1WPKA 1AOYA 1T08B 3CF2A 3D5LA 2D45A 3WU2C 3J7YJ 1JE8A 3JRFA 3K10A 1YO5C 2IA2A 5E3LA 3CO7C 1LFUP 1YITI 4M3BA 3OS1A 1DPRA 3R6SA 4CHUA 3HL2A 3QU3A 3GW2A 3I4MJ 1DGWY 4XQFA 1MZBA 2IEKA 1SMTA 1PUFA 1QZZA 1FSEA 4CICA 3E5XA 1AWCA 5CVRA 1JUMA 3OYFA 4HF2A 1OYWA 4AC0A 2IGOA 4QIWN 4B44A 3M8JA 1YE9A 2NXNB 4ETSA 1U5TC 4A3EJ 5H6QA 2R7DA 2OTLI 2ZB9A 1TBXA 2F4IA 2K3PA 2CG4A 3DPLC 2EB7A 3FXKA 3MQ0A 4UXNA 1HXDA 1JJ6C 3W6VA 4I09A 3S1MJ 3CCQI 2CSOA 2ZBKA 3HHHA 4LLNA 4F3QA 3BZ6A 5H20A 4D0PA 2NOGA 1YFHA 2ZCWA 3Q0VA 3HOZJ 4X6AJ 2NRAC 1UHWA 2ZMEC 2LSOA 5EEGA 2O03A 4BJ5C 4E4HA 3BR0A 4MNUA 2WWYA 4PJLA 3W6KB 1IDZA 2CQ7A 2B0LA 3KX2A 4KMFA 2NS8A 5C4XJ 1EJ9A 5DV5A 5E79C 2A69F 4BBSJ 4R8HA 2A6HF 2WB1A 3H9GA 2WB1N 2Y31A 4OAZA 4EJUA 2DDBA 3ECHA 4A3FJ 3KFWX 4E7SA 1YLFA 2N8GA 2BEOA 3Q0WA 5F64A 3VPRA 1QRYA 1RZ4A 2DTZA 2L01A 3G2BA 2LY1A 1R58A 1GV2A 3LSIA 4PK4A 3TEDA 1QPIA 2E2JJ 3MZYA 5HS8A 4S05A 4JBAA 1UCRA 1V5GA 2BZTA 3AG1H 5BQTA 2IGMA 1IUFA 5IP9J 3LSMA 2BOLA 4MQ9F 2K5CA 4HW0A 1N75A 4I7HA 4C30A 1W4MA 3V8KA 2EFWA 1G3WA 1REPC 3DPTA 1MNEA 1ZKGA 2EQRA 3WGHA 1P9QC 3BG3A 2BYVE 2LOOA 3A01A 3CMEI 4XSXF 3WHBA 2RGVA 3ABKH 3S1RJ 1NG6A 1V54H 5GPAA 1A6QA 2R7OA 2AO9A 3GFIA 1X3UA 1OFCX 3NWSA 4L5IA 1ERDA 4PGHA 1NTCA 2DT5A 3CCLI 2GWRA 2OBPA 1NHAA 1KU3A 4Z2YA 3ZXSA 1FJLA 2STWA 4WXDA 4A3LJ 3FKIJ 1P2FA 3R61A 2DN0A 5LEKA 2F5EA 5ILSA 3HOTA 2OTJI 2MH9A 2JA5J 3J81K 3B73A 4IL6C 5CQGA 3U9GA 3MWMA 5FKLA 1OR7A 4UB8C 4HF0A 4DYQA 4ZYDA 4Q4ZF 3BROA 1D1BA 1PP8F 3P9IA 4JX4A 2FBIA 1HDDC 5L3EA 2ZO4A 2XAHA 4F92B 4BL0B 4AIDA 4C3JJ 5FLXZ 2L7MP 4IX7A 4PSXA 1F1ZA 1KYWA 3VB2A 2KJCA 3I56I 3CCEI 4ENNA 2LH9A 3TBIA 2HPIA 3DEWA 2HQNA 3D5RC 5D5XB 4XRSA 1Z9CA 3F72A 2MD5A 3DCFA 4U0YA 3CDIA 1FYLA 2XROA 3KP2A 1OPCA 3BG7A 1G6NA 4TV7A 1MSEC 4M3EA 4EMSA 1SFEA 5M5XJ 3TGNA 1FWZA 2QSFX 2ETHA 3K4NA 3TO6A 1I3QJ 1X4OA 2FEZA 5E8IA 3DWLE 3OYDA 4HX4A 2GM4A 5LRRA 3J7AO 5FO5A 4FQGA 4N4OB 2R7RA 1HSJA 2R7ZJ 3TQNA 2JSCA 3R0AA 3LQQA 5TJJA 2YU9J 2ICWG 5EG0B 2VBZA 1FSHA 2Z3YA 4P55A 5B1BH 1B72A 2HXOA 4RLQA 4AWXB 1ETVA 3T8TA 3BQZA 4CYCA 4PJ0C 2GOMA 5GPCA 4UUVA 1QBJA 1O3QA 2XAGA 4M3GA 3MFKA 3BLYA 2DTRA 1YHQI 4JK1X 1MDMA 2QBYA 4Y52J 1KA8A 3MZHA 4IXAA 4LITA 2GBYA 4UNOA 5F0HA 3BCAA 4A69C 4RLFA 1QQIA 3W2WA 2JK3A 2JZYA 3HGYA 4C2UA 4C9YA 3QP5A 1FX7A 1TNSA 3LWFA 2ID6A 2RQQA 1AU7A 3WTZA 3OYNA 3HEFA 2XHKA 3LOCA 4LFUA 1O3TA 1BC8C 1AKHB 4PGGA 1IXRC 3L7WA 1B8IA 3BR6A 4D7MA 2JA2A 2G7UA 3H3UA 5KVRA 3HOXJ 1OCZH 5LD2C 5CVJA 5FD5A 1I6HJ 1DUXC 4XBFA 4NC7A 3WG7H 4RAYA 2Z1DA 4JP0A 3S17J 3KPHA 3H92A 3E6DA 2M4GA 3JRCA 2WAQA 2WAQN 2XGDA 4E7HA 1P92A 4A3JJ 3SHFA 1K7AA 5JVGF 4MEXF 1JGSA 4LIVA 3UR3C 2E1MC 2P6TA 2CW0F 2P5KA 4II2A 2DPDA 2M7AA 3IV5A 4OIQF 2MLGA 4WWCA 2D2WA 2FQ4A 2GXGA 4U87A 1MMGA 2VBWA 4A5NA 1EV7A 2JQ7A 1FIAA 1J75A 4I0BA 3HPHA 1LVAA 4B09A 4XLEA 1PDNC 1B6AA 1DDNA 4BKXA 2CRGA 4XRFA 5F1JA 1APLC 2PG4A 4L5EA 1KU7A 4ZDPA 1S72I 4CZCA 2JWTA 2WAEA 1H8AC 2K9QA 1VQLI 2M5WA 4PJMA 2M30A 4DBQA 5IT3A 4HX7A 1GVJA 2K85A 3TW6A 4OAYA 2IA1A 3BTJA 4FE7A 2LFBA 3CJTB 3I59A 3CP2A 3OYHA 5F0FA 1BI3A 2MD0A 2YUSA 3K70D 2V4JC 5E17F 1ENHA 2VOOA 4LG3A 3HM5A 2CUJA 2G7HA 2A6EF 1ZRDA 4CUGA 3FIWA 1XCVA 3T8RA 2R5YA 3ROUA 2Y2ZA 4G7HF 1WWXA 3SFIA 3QU6A 3OOPA 4H0EA 2IS2A 1W7PD 3WU1B 1LE8A 4C2MJ 1WSUA 2P5VA 4HV6A 4I0AA 3IUOA 3PSFA 1VF9A 3O3KA 4KIGA 2I8DA 1R00A 4BXFA 1EH8A 2JA6J 4AM3A 1I50J 3WTWC 1X3WB 1NK2P 3CESA 2M34A 3OR2C 4RB1A 4BY1J 2KISA 2FF4A 2JSPA 3RQ4A 2DPUA 2DA5A 2FJ1A 2GIZA 1T0FC 1HKSA 3A0BC 1O7FA 1E2XA 1ZGAA 1FC3A 4I6ZA 2LRDA 4PUSA 4HDVA 4RBOA 4A0YA 3U1KA 4BBRJ 3EPZA 1LDKB 5IOZA 3H36A 2ZJPF 4EGYA 4B43A 2KIMA 3SZGA 3IH4A 2AQFA 3CC4I 1JHFA 3BG9A 3BQYA 3OSFA 3N97A 1H9TA 2PX9A 3OYGA 1ZELA 1YW7A 1PUFB 2QQAA 5M5WJ 2K9NA 4RMNA 4CO8A 1VQNI 4HAMA 2L4MA 1HCRA 5DYMA 3TDZC 3VODA 4OU0A 4YFXF 3GEZA 5L3BA 3IRRA 2CQNA 3FMRA 4IQJA 4A0XA 5LLQA 2DMNA 2HWVA 3LAPA 1WH7A 4KN4X 5L3DA 3RKXA 4DGWB 3ZR8X 2LMDA 4WK8F 2VIXA 2RV8A 4I99C 4Y3OA 2HQAA 5BS6A 4MHGA 3O8GA 3OYCA 4IRIA 1MNMC 3HB9A 2KDOA 4RB0A 3ZMDA 2JRTA 1HSTA 4LIUA 4EJWA 3OYKA 3IHUA 5D5UB 3JRBA 1ZLJA 2HPMA 4KN7X 1XB4A 3D5SC 5LEJA 1LEBA 4P9UA 3ECOA 5L3CA 1OYIA 1WFXA 2KRHA 3FMQA 5D6EA 4ZYHA 3ML6A 2A05A 1OMIA 5ED4A 4FASD 4IZZA 1SC7A 4OIRF 3JTHA 4ON0A 1B9MA 1UJ8A 4BQOA 3PO3J 3LSPA 2ME6A 3RJPA 2Q0OA 3E1SA 5J40A 1TT0A 3C2GA 3VWBA 3GMEA 5JLXA 4A3DJ 3HRUA 1KQ9A 5B1AH 3O2PE 3OR1C 1U9NA 2XGXA 1ZN2A 2MBFA 1FZPB 3SDGA 2C6YA 1MSFC 2X6XA 3VSLA 2CUFA 3HPGA 1ZRFA 1J5YA 1CQTA 4P1WA 2JUGA 3M9AA 5AIPA 5FKMA 1VQ9I 4KT6A 1I27A 4XN3A 2A6TA 4QPOA 1FP2A 4X1EA 3IAM2 1X4PA 1QZYA 4Q47A 1VQ4I 2FMLA 3A01B 1U5TA 2HNHA 3KYLA 4XKBA 2KPMA 2O8XA 2DA2A 4MTEA 5DTDA 2NVYJ 3O6BB 1POGA 4G6TB 5EG0A 2HU9A 3U1DA 1PUEE 1R23A 1LKXA 2OA4A 2L7ZA 4A0ZA 5F6FA 4FX4A 4QPQA 2ZMEA 1JUPA 2DA7A 4XLFA 5JI6A 4EQQA 1QHGA 1VQOI 2XKOA 4KMUX 4EM0B 3TMOA 3J7AY 2K9SA 2BXZA 2MFZA 1Y1VJ 3I3LA 2RAEA 2XPVA 3GZ5A 3IH2A 3NEUA 3WHCA 2PJRA 3MAJA 3AG3H 2LDUA 2DA3A 2EWNA 4V2FA 3K7AJ 1OCRH 1NH3A 1LDDA 2CW8A 1QHHD 3FM5A 2KP6A 1AKHA 2HOSA 2E19A 3GUDA 3IL2A 4FX0A 3BDDA 3FWEA 5CVUA 5HLHA 2VODA 2E60A 4F91B 2HVQA 4IO9F 4Y17A 3JAMZ 1P4WA 4E6KG 3G3ZA 3L00A 2LKPA 2DLLA 1VNDA 2R93J 2BW3A 3CUOA 4BXUA 4PCQA 3RZOJ 4AUXA 1TWFJ 2WBMA 3DPUA 3PO2J 1OCTC 4RDUA 1LVKA 4AD9A 4NNJA 3ZQQA 2V6CA 3K4MA 3ZQ7A 3S1NJ 2A07F 3AL0B 1R49A 2PMUA 1R4MB 1D0XA 3ZQFA 4C3IJ 2CO5A 3CC2I 1GHCA 2HZTA 4CYCB 3OSGA 3GCMA 1HBXG 2CWEA 5IP7J 2E34A 1W7PA 2DOAA 4B1RA 4BHPA 1V3FA 1MDMB 2HFHA 1SVOA 5K1YA 3FHZA 1X2MA 3KE2A 5EEHA 2MG4A 2QF7A 3IKVA 4OWRB 4FTHA 2X6WA 1OCPA 3BCBA 1MIJA 1O7LA 3ZMTA 3DF8A 3NARA 1DP3A 1R4NB 2QKLB 3V8LA 3JREA 2HZDA 2EK5A 4D5CA 1WJDA 1BOBA 3F8MA 3IWFA 3SZPA 3WODF 4BNCA 5JHUA 4KIBA 4E7LA 2HQRA 2DFHA 1YIJI 1F43A 1B8IB 3KETA 3A02A 3KZYA 1A5JA 4LOCA 4KFCA 5KHDA 2LY9A 4BXXJ 4LB5A 1S8NA 3KP3A 3TOBA 5EGOA 4L0ZB 3SXYA 2M9HA 3AG4H 3BJ6A 4EJVA 5B5EC 2EILH 2VKHA 4L0YB 1YI2I 2ZXWH 3TW7A 4B48A 4AIHA 4ZJZA 2ZJQF 2FMYA 1XMAA 2MYSA 1HC8A 3DKXA 1WKMA 1VQ6I 2PMHA 1OJLA 2W1OA 1D8JA 1DPUA 2HOAA 3GTOJ 2GQQA 4FISA 1FPQA 2FNAA 3ESWB 2M2EA 2KMUA 1AHDP 3HGGA 4MLOA 5E3NA 2PI0A 2F4OB 2JUCA 4UVAA 3HOSA 2K4BA 3LSKA 4RGRA 1D3YA 2WC2A 5FD6A 2NAZA 3M8EA 2ELJA 3GTMJ 2ZSHB 1T98A 2OQRA 5LGUA 3OL3A 2VKDA 5J8CA 3OYBA 1Y0NA 1L3LA 1WJ5A 1HKQA 1W0UA 3JRAA 2IS6A 4A93J 4G7OF 3BPXA 2L9NA 4G94A 1QGPA 1S7EA 2YX4A 4D9JA 3KP4A 2NYXA 2V1DA 3PFIA 4E7ZA 3HRMA 1XD7A 3GFMA 3IP4B 3HUGA 3I59B 4MTDA 2CYYA 2V1XA 2CQQA 3BTIA 1BBYA 1Y6IA 3R4KA 2VE8A 2IS1A 1ZREA 5LFAA 3EETA 1V4RA 5GP9A 2EZLA 2HR3A 3RSNA 1U9OA 3ZN0A 1R5ID 3WTTC 1G4DA 3HTSB 5LHHA 1VZ0A 3G1MA 2L9VA 3U2RA 2K40A 2R5YB 1UHMA 2DOEA 2VJIA 3E3VA 3PUBA 3RDIA 3TOAA 4IKFA 5HLTA 1R1UA 3IRQA 3HOUJ 2HGCA 3I64A 1LUJB 1XGOA 1LE8B 4U0VA 4XKVA 2HDDA 1MMDA 1D1AA 4I01A 5IT9Z 5H2FC 4KNYA 2CUEA 1K4TA 3H1CA 3RPQA 1IO2A 1D5YA 2XB5A 4W1UA 5D6FA 5J3LA 2QKMB 4BHCA 1FOKA 1JI8A 1LFPA 3QAHA 1S7OA 2MH2A 3CCJI 2R7UA 1WI3A 3BZKA 4ZZDA 1FT9A 3RTRA 4BHBA 2RKHA 2H09A 3FXRA 3WGIA 2FBKA 3GTGJ 2EIMH 2LK2A 2NVUB 1G2HA 1YJNI 3PNTA 3I9V2 2WTEA 2Z5UA 3K69A 3ZPLA 4UV8A 1J09A 5HDNA 4FT8A 3REOA 5AONA 5GAEJ 5A2QZ 4V2GA 2I5UA 4DNCA 4DBRA 3K1PA 4IHSA 4HF1A 3CZ6A 2R3SA 4RAZA 1DU6A 4HBLA 1A31A 3D0SA 5CQEA 4CCNA 1JHHA 5HODA 3FK7A 1XGNA 1Q1HA 4CCJA 3FF5A 1KQ0A 1U78A 1WJCA 1MBKA 1FTZA 4GFBA 1TLHB 2EV6A 1GUUA 1S9HA 5JR3A 3DLLF 3M8FA 1G8XA 1Z6TA 1USTA 2RNJA 4MEYF 4DQ2A 3LSHA 3QPHA 4EJTA 4LJZF 3JRDA 1BJZA 4RAFA 4CCKA 4I76A 5ICEA 1O3SA 2P81A 2EIKH 4D1QA 2TDXA 2F2EA 2QA4I 1F9NA 4XKCA 3T5XA 3M07A 1LQ1A 1KU2A 1P4AA 2VE9A 4YRVA 2PEXA 1ZQ3P 2DMPA 1U3EM 1E3OC 5L3FA 2EPFA 2O5RA 1T33A 2A5WA 2W57A 2MC4A 3FHNA 5HNHA 4N9IA 2XAUA 1OYYA 2FRHA 3CQZJ 3F3XA 3HOVJ 3HTUA 4CYDA 5D8KB 1V5EA 4D7NA 4Y33A 1QU3A 4ESJA 3HBLA 3RKWA 4RB2C 1NK3P 3C2HA 1O3RA 1T0FA 3CUQB 4XLPF 1F36A 1A04A 2XPUA 4O5VA 2VKEA 4IHYA 1BA5A 5F1RA 2IT0A 4WXCA 1SFOJ 3H5NA 3DBLB 3AG2H 2HYJA 5IP6A 1G3SA 3CLOA 2BV6A 2HQ5A 4RM3A 2EV5A 2QLZA 2H1LA 3RYRA 2OC6A 3S14J 4M71A 3VYUB 3EYYA 2JVGA 4PJJA 2CV2A 1TQIA 2JTVA 4P96A 2DFEA 1BR2A 2KHMA 4OMZA 3AAFA 2IW5A 2KLOA 1QA6A 1MGTA 3DBRB 2FA5A 3V42A 4BU2A 2W25A 3ABLH 3GFJA 3KEOA 3N05A 4YEJA 4XOPA 3RKQA 1WZ2A 2KQRA 2W24A 2VQCA 3DTIA 1XDUA 3L2VA 1YYVA 2NS7A 4UVCA 5J1UA 2CUZA 3WTVC 1WQ2A 2V79A 1IAWA 1U5TB 5EF6A 3M4OJ 3GO5A 4HRIA 5EEAA 4OIOF 2KZVA 4JX5A 1X58A 1OKRA 2DK5A 2VOPA 5DCMA 1SEUA 3BP8A 4NHJA 3I5UA 4WXHA 3IH3A 2K9LA 3CCYA 3VDXA 1FOYA 2DW4A 3BJAA 4HDUA 3HJEA 3JW4A 4U0WA 4KDPA 4CCOA 1ZTRA 4IHVA 2BVLA 3V7CA 2ZMEB 2OU2A 1JGGA 2X6YA 4XONA 3DBHB 1T39A 2R0QC 1RRJA 2B9SA 1R71A 4IOCF 2WV0A 2E7WA 4D5FA 3CF5F 3ZQLA 3RPUD 4XR6A 1BI1A 3QPLA 1R7JA 2JPCA 2F5DA 3V7SA 1ZYRF 3BR1A 1TZLA 2X6OA 3E97A 2RQPA 1ETXA 2PJRB 1RPWA 2ID3A 3TKYA 3CMYA 4IHTA 1S3JA 4BE0A 2DYRH 2M3AA 2FNPA 5HLIA 2IGNA 5C4JJ 4NUBA 1QZEA 3QPTA 4LG0A 1QNTA 3PM1A 3S93A 3AKZA 2CU7A 1W36C 1IG7A 1TWGJ 4JYKA 5K7FA 1X1PA 1SFUA 1LDJA 2HYFA 4DZJA 2Q2EA 3ERED 1JTXA 1HW2A 2BW3B 4AVPA 3A03A 4CDGA 4MFDA 4N0BA 2EA2A 1J2XA 3GLXA 4DOZA 1I6XA 1UAAA 1KQ8A 2LKSA 3K4CA 3UNGC 3S2HJ 1Y8QB 4IHXA 2MA3A 1G3TA 3RYPA 1MNDA 3LQRA 3A4CA 4MO7A 1K4SA 5FFXA 1W7PB 5LHIA 3OYMA 1RESA 1BI0A 1GVDA 1X19A 3KLOA 2STTA 3K2ZA 3S15J 3E7LA 3H5RA 4IQ4A 4LK0F 4RS8A 2YPRA 3BPVA 1KU9A 3LNQA 2ZSIB 3QPSA 3JCUC 3K2AA 3BTCA 5CJ9A 5DM6F 1STZA 5DEQA 2J5PA 3OOUA 3OYAA 1MBEA 3CD6I 1WVRA 4Z6YA 2HI3A 4EEFG 3KZIC 4WF2A 2FUG2 3SEQA 4N4NB 3MEXA 1TWCJ 4UUSA 1Y1WJ 3TL4X 4HX8A 3KP6A 3E6CC 2ELHA 5DUKA 4QWQA 4B4CA 1E0EA 3KCCA 1ETQA 1IV6A 5EGOB 5KAFC 1FP1D 2CQKA 5KK1A 1T56A 4ANJA 3GZ6A 2J5OA 5CVIA 2OPTA 1B59A 1MH3A 1W5SA 4CZZA 5KCMA 2LVSA 3WGGA 5E1XA 1PP7U 2D5VA 3I4NJ 1ETWA 1PJRA 1YIOA 1ZHFA 4RAGA 4OIPF 2FD5A 5FLXK 3MCZA 2W4SA 5LGTA 3DTEA 2IP2A 1WJFA 3EQLF 2ZJRF 2Y0MA 1DU0A 2CGPA 4E70A 3QYFA 2FU4A 5HOOA 3P5JA 2DI3A 2E2IJ 3PJRA 3FXQA 2WV1A 4BEHA 2WAFA 3OMYA 1ZR4A 2VQGA 3LAJA 1I1SA 2VL8A 4JQFA 1P4XA 2Y9ZA 2L54A 3TP0A 1CF7A 3F8NA 5HVQC 2EZKA 4U88A 2GIVA 3I4PA 1S6LA 1SFKA 3L2WA 3EUHC 1Z05A 2CFXA 4GGGA 2GA1A 5EJCA 5D5VB 2BHZA 4OOIA 1J7KA 2DFIA 2OZ6A 3JRHA 1ZLKA 2JA8J 4ZTJA 3QP6A 3FXJA 3FXMA 4CA0A 1HQCA 3EUAA 2XSJC 2R5ZB 2F4MB 4YIFA 1SAUA 3WTSC 1MBHA 4S04A 1WJAA 4G6QA 2E1OA 2LKXA 3CCMI 5HS9A 3LSRA 4DYRA 3JSOA 3HUGB 4GCVA 3BOQA 2QSHX 2XDVA 3MVPA 3QYBA 4FE4A 3RIRA 2JMWA 5LGNA 1OR7C 3ZMVA 2LYCA 4BY7J 1AA7A 1V5FA 2A3SA 5IYCJ 3V8JA 3GLLA 5E18F 1WRJA 3J80Z 1R5GA 2KIUA 3C2BA 3K4LA 1R9TJ 2M87A 1ZG3A 3BR3A 2GOXB 4AVZA 2XC7A 4BJ6C 1GT0C 5ILUA 1TP4A 2W82A 2VJJA 1TQMA 3CO6C 2DAOA 3OV8A 4YELA 2E1MB 1Q1VA 4KYWA 2X0LA 3WTYC 1FYKA 1TW2A 5IYDJ 4NBQA 3F8FA 1OLTA 5JVTA 3OY9A 5HS7A 5LHGA 3RKYA 2X51A 1JUSA 3EDPA 3IWZA 4HNVA 3CDLA 3P7NA 2XRLA 3HG9A 4IJAA 2AXLA 3FM3A 5ILVA 2ZC2A 1UELB 2LP0A 3SQNA 3CUQA 3L2RA 1R22A 3MZ8A 2O9LA 1P7IA 3KLNA 2KFDA 3S3OA 2QQBA 3C7JA 2DA1A 4AYBA 4AYBN 4MGRA 3G4SI 3RPUA 5HLGA 3T0YA 4EATA 2ME0A 4RA2A 2Z9OA 1E17A 2R7VA 3CMMA 4NC6A 1KZHA 3OIOA 2O61A 4G9YA 2HTSA 1O57A 4HNTA 1MW7A 3VYTB 3D1NI 5E1WA 4YIRX 4YFKF 2VONA 2JT1A 4EGZA 2FXAA 1LNWA 1IC8A 4IHWA 1YX3A 2ISZA 4EVIA 1VQ5I 2AQEA 3HC7A 2JJ7A 3LSGA 2EV0A 3BG5A 5J4VA 4DYCA 3JRIA 3TP3A 4ASNA 3X2QH 1MBGA 4L9TA 1T95A 3GTQJ 1QPMA 1ULYA 2VB6A 3CCSI 5EZHA 4ZYEA 1JT0A 2XAJA 2KZGA 2VJ5A 2Y69H 5F27A 3PNYA 1YOVB 1W1WE 2H6CA 2KRFA 2L2OA 2L3DA 3DQVC 1JXSA 2KRCA 2RREA 3F22A 1GXPA 3VEPA 1MBFA 1A36A 4BDYA 3WE3A 4HSTA 5TISC 3MKYB 2QEXI 1MMAA 3QRFF 2E2HJ 1XC5A 2VC1A 3DV8A 2E5ZA 3RQIA 1EF4A 3H0DA 4E7IA 2QENA 2BVMA 1X2NA 2ZFUA 1IN8A 1FMWA 3E6BA 4JX6A 4PDKA 4GYGA 3WE2A 4RGXA 3TO7A 2FBHA 5DD8A 2QGUA 4W97A 4CCLA 3QYEA 2MC3A 1YRNB 3NWTA 2EIJH 3L2UA 2QQ9A 1TL8A 1IW7F 5BPDA 4FETA 2DFFA 4KISA 4PSWA 1IV8A 2VJ4A 1XGSA 1TWAJ 2M0CA 4B3XA 2P5LC 2DYSH 4CXFA 5K5OA 1MMNA 1ZG5A 4BDZA 2OJED 3BC8A 2JA7J 3IC7A 1IUYA 1J9IA 4F93B 3OIQA 4DIQA 3JSPA 4M9ZA 5DCMB 2DT6A 4ZZLA 3WG9A 4XRSG 4RM2A 1IZ1A 5GAGJ 3PQKA 4MFEA 1RI7A 4PFPA 3MN2A 4KUMA 4X0GA 1UG2A 2KL4A 1Z7UA 2EZIA 3BY6A 2XGEA 1RR7A 3BJOA 2HVRA 4L9VA 4BQNA 2MW8A 3Q3SA 2UUZA 1TW3A 1UHSA 2IPQX 2XGCA 4HQMA 4EM2A 2LY2A 2FSWA 4RB3C 4BAYA 2NOJB 1HA8A 4OINF 4J01A 2XB0X 3E0JB 1BIBA 6PAXA 5FRMA 1FBSA 1I5ZA 4DJAA 5J1RA 1BW6A 3WTUC 2EFPA 2HTJA 4LG0B 4XMYA 1YS6A 1L0OC 2DJNA 4GYIA 1B1BA 1WHUA 4LGWA 1YQAA 1S29A 3OIPA 5K7ZA 1PVEA 3B02A 2Q2EB 2P6SA 5DS9A 3KEQA 4H4KC 2IJLA 2DBBA 2XVCA 3GTKJ 2TCTA 1TQPA 2ZNZA 4HG2A 5HNFA 4XK4A 3UKGA 4YIIA 1IRGA 1LEAA 3C1DA 5EZGA 2FOKA 1FTTA 2X1CA 3C18A 2Q8KA 4ZH4F 2LTPA 5JLWA 1MJAA 3R0JA 4BACA 3SEZA 2X9DA 1K78A 4XLNF 3DU5A 4I02A 2DJIA 3BG6A 1YTYA 2V7FA 2XAFA 3K4JA 5TGTA 4LB6B 4HA8A 2BY1A 2R7XA 1B4AA 2BY2A 2Z2SB 1ONVA 3J81Z 1TC3C 5J47A 2COBA 2PMZA 2EFQA 2PMZN 4UHTA 4BJTA 1RUOA 3ZRGA 2KDZA 4A12A 3S3MA 4QLCU 3PIPF 4UUSB 3WU0A 3MD2A 1MKMA 2QSGX 2YSRA 2R5ZA 3M1CA 2R7TA 3H3ZA 1RIOH 3ASNH 2HOTA 2ZXHA 1EA3A 4G8XA 2DMUA 1H89C 3LFKA 1N78A 4NC8A 4Y15A 5FKKA 2FX0A 4C2TA 1BM9A 3MKZA 4ZYAA 2R7QA 4G7ZF 2PFBA 2F5FA 3ASOH 2V9VA 1RUNA 2V9KA 4XRMA 1FBUA 2R4GA 3FMSA 3BR5A 3GZNB 2HYGD 2MABA 5IPAA 2KIFA 4I98B 1OCOH 5IY5H 3EYIA 3G1LA 1GXQA 5EDNA 1XSVA 4A3IJ 1VQMI 2L0KA 4GDFA 1EH7A 3L09A 3ABUA 2CW7A 3JTGA 4IEJA 4G6DA 1X3ZB 3FXUA 3H5AA 2ECBA 3IAS2 2VC0A 3DTKA 4BEHB 1A6IA 4K2EA 1ZH5A 3L1PA 1Y8RB 4QTRA 5BNGA 3JAMK 4FHTA 3CCVI 2K7LA 3QOEA 1UG0A 1CF7B 1YW9A 5C44J 3KYCB 1Z3YA 1XTAA 3PIOF 2DO7A 2CJJA 5FRNA 1SD7A 2KKOA 4A6EA 3F9KA 5E20A 4LLGF 1YG2A 4A2UA 2BY3A 3DXJF 5FLMJ 2OCEA 2OAZA 1OISA 3Q0UA 3DKWA 4ENJA 5FKOA 3F21A 2R7SA 2XIGA 2VPRA 2DT7B 2Y0SA 2Y0SN 4LK1F 1HLVA 4F55A 1I1GA 2VUMJ 1Y0UA 1IF1A 2KJBA 2OZUA 4XM3A 5TRDA 3S2DJ 3Q9SA 3E5UA 4MQVA 2IXSA 1ETKA 1XSXA 1Z67A 5IYBJ 2V26A 3KP5A 1ODDA 2O8KA 2ESNA 3NRVA 3ZCOA 2CV1A 1FBQA 3HRTA 1P7JA 1X1DA 1BN5A 4M3DA 3OS0A 4A3BJ 1N77A 2JN6A 5J1YA 2HKXA 4FCYA 2HVSA 2M0MA 5H6RA 2ZKZA 2L9SA 2IA0A 2O0YA 2M8GX 2ADUA 2EH3A 2HS5A 2ZXIA 4XIDA 4HOBA 1VQPI 1EH6A 3HSFA 1XDSA 2JPBA 2DQRA 3QQAA 1FYMA 2F5CA 3FK6A 2XUBA 2JVHA 1BIAA 4IRGA 3WTXC 1Z0XA 3K70C 2A5YB 2XKPA 3FBNB 1S7AA 2O6GE 3S16J 3MKLA 2D1HA 1Z21A 4ZYGA 3R60A 3EUHA 4PJNA 1JTYA 3PSIA 2O7OA 1VTNC 1BR1A 2W85A 3I71A 3KEYA 2P7VB 1OQYA 9ANTA 2K9MA 2COMA 1T6SA 3ERMA 1YRNA 2MSYA 3CCUI 1Z7LA 2L5QA 4U7DA 3DU6A 2GLOA 2D1VA 2GXAA 1X1BA 4R1HA 2CFOA 3CC7I 1P6RA 2ISYA 2VXDA 1ZAOA 1XMXA 1U6GA 4HEA2 5F04A 2W00A 2WY8Q 2OV7A 3HIFA 2XASA 5BMZA 4M6YA 1WH5A 3GFLA 4IRHA 1J0RA 2K02A 4B8XA 2XRNA 2WADA 1U0JA 1FIPA 1M1EB 1YS7A 1LJ9A 1SD4A 2DOFA 4L9JA 1XPXA 3PL8A 5CKTA 1FMVA 1T38A 4II3A 1USSA 4IVNA 2H94A 3H9QA 3I58A 3H3VK 4BQAA 4M3FA 2ESHA 3VSKA 1Z1DA 1MBJA 4LD5A 2P7CB 3SZTA 4GO1A 1WGXA 3KP7A 2PBIA 1XCBA 2VBXA 1JKRC 3QODA 2P0WA 2Z99A 4BYYA 5JHFA 2XF5A 2W48A 1HDPA 5DUIA 5IT9K 4V19K 2A61A 2L9RA 3HDDA 2DXIA 1G59A 2E35A 1ON1A 4ABZA 1WJBA 2L7FP 2G9WA 2V9PA 2YX7A 4A6DA 1FLIA 1E3HA 3GWZA 3KYDB 5ICGA 1U8BA 1ZR2A 3ULQB 4XNFA 3V4GA 2IGKA 3LSTA 1XX5A 3A1YA 4HV5A 2VN2A 4KIFA 4M9XA 4Q48A 3K6GA 3DKYA 2V6EA 5GTIC 2XSDC 4L18B 2Y75A 2XAQA 4ZDLA 3HSRA 3H9JA 3Q9VA 2DCEA 3V7RA 1Z91A 2M8EA 1W5CC 4ITVA 5DCFA 3LA3A 1JKPC 5A2QK 4HYEA 3E6MA 4DW6A 1MD0A 2DU9A 1ACIA 4OMYA 1IJWC 3FKJA 4XSZF 3OS2A 4KT5C 1HF0A 3I55I 2Z33A 2XF6A 2X4HA 2LBFA 1FNNA 2X85A 4KJZA 4F52A 4BGDA 1SFXA 1JT6A 2IBDA 2W84A 3PQJA 3K9TA 2L02A 4GRIA 2LF8A 4JOMA 4DZPA 1SANA 2VBYA 4XKWA 1Y39A 2AHQA 4E7JA 1YJWI 2R92J 2HDCA 3I0TA 3I54A 4XOTA 5J6XA 2VXZA 3W2VA 3P9KA 2A68F 1D0ZA 2X1DA 5HDGA 3C3WA 4IPAA 1MJ9A 5F0CA 4WCGA 1HW1A 1JJ8C 3NQOA 2LNBA 1DGRM 3F23A 1K6YA 4A5MA 3T1BA 1D1CA 1UB9A 2HKOA 1RKWA 3ONQA 1X1AA 1IN7A 1MMSA 1VQ7I 5IOYA 4O6JA 2VT3A 4KITB 2F5VA 5FROA 2W7NA 3ZQHA 1H9GA 3K4BA 2NVTJ 1Z3XA 1ZARA 3L2QA 1R6RA 1MH4A 5CLSA 2KT0A 2QCOA 5J8FA 2BBYA 2OCCH 4WX9A 2HOEA 2VASA 4S0HB 1BI2A 3ZQCA 1H88C 1SVLA 4HSRA 1RETA 1TWHJ 3QOPA 3HOYJ 3VFZA 2M45A 1D5VA 4HLYA 1PYVA 5M5YJ 2LD5A 2F48A 4CH7A 3S32A 1K78B 2VPLA 5BPIA 1N25A 4NDLA 4XLHA 5E3MA 2M4KA 3MKWB 2NNNA 1JKOC 3HXLA 3HZJA 4XICA 1QVUA 2Q1ZB 1SAXA 1YJ9I 1LB2A 3FBIB 2XF7A 2GXBA 2CMPA 2IS4A 3OYIA 1XSDA 1LFBA 2WA0A
chains in the Genus database with same CATH topology
1VQ8I 2E36A 3CJTB 3CC2I 1VQPI 2E34A 1ACIA 5DM7F 5DM6F 3PIPF 1QA6A 3I55I 3CD6I 4IOAF 1FOWA 5GADJ 3G71I 1YHQI 3CCJI 1Y39A 1YJWI 5GAGJ 1VQ9I 2H8WA 3CCRI 1YJNI 4UY8I 1VQ4I 1YIJI 3CCUI 5GAHJ 1VQMI 5GAEJ 1FOYA 3CC7I 3G4SI 3G6EI 3CMEI 1YI2I 2ZJRF 3CCVI 2ZJQF 4IOCF 2FOWA 1MMSA 2K3FA 1VQ7I 1HC8A 3CCLI 3CF5F 2ZJPF 1VQ6I 1VQKI 1FOXA 3PIOF 3J7YJ 3CC4I 3DLLF 1VQOI 2OTJI 1VQ5I 1VQNI 1YITI 3J7ZI 5JVGF 2QA4I 3CCSI 2JQ7A 3CMAI 3CCEI 3CCMI 2NXNB 3I56I 4V19K 4IO9F 2E35A 2QEXI 2OTLI 1YJ9I 1S72I 3CCQI 1VQLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 I;  2E36 A;  3CJT B;  3CC2 I;  1VQP I;  2E34 A;  1ACI A;  5DM7 F;  5DM6 F;  3PIP F;  1QA6 A;  3I55 I;  3CD6 I;  4IOA F;  1FOW A;  5GAD J;  3G71 I;  1YHQ I;  3CCJ I;  1Y39 A;  1YJW I;  5GAG J;  1VQ9 I;  2H8W A;  3CCR I;  1YJN I;  4UY8 I;  1VQ4 I;  1YIJ I;  3CCU I;  5GAH J;  1VQM I;  5GAE J;  1FOY A;  3CC7 I;  3G4S I;  3G6E I;  3CME I;  1YI2 I;  2ZJR F;  3CCV I;  2ZJQ F;  4IOC F;  2FOW A;  1MMS A;  2K3F A;  1VQ7 I;  1HC8 A;  3CCL I;  3CF5 F;  2ZJP F;  1VQ6 I;  1VQK I;  1FOX A;  3PIO F;  3J7Y J;  3CC4 I;  3DLL F;  1VQO I;  2OTJ I;  1VQ5 I;  1VQN I;  1YIT I;  3J7Z I;  5JVG F;  2QA4 I;  3CCS I;  2JQ7 A;  3CMA I;  3CCE I;  3CCM I;  2NXN B;  3I56 I;  4V19 K;  4IO9 F;  2E35 A;  2QEX I;  2OTL I;  1YJ9 I;  1S72 I;  3CCQ I;  1VQL I; 
#chains in the Genus database with same CATH topology
 5ICC A;  4NQW B;  1T8I A;  4Y7N J;  1SMY F;  3GBG A;  2UXN A;  2KIQ A;  2R7F A;  2X1E A;  1IN6 A;  1D0Y A;  1TNT A;  1YX5 A;  1U8R A;  1EKE A;  3DLA A;  1ZRC A;  3MMY B;  2E71 A;  3VYS B;  3GTL J;  2BE5 F;  1HKT A;  1ETO A;  1IN4 A;  3K1N A;  1SD6 A;  5E1Z B;  3ISP A;  1CGP A;  4L5J A;  5FJ8 J;  4RGU A;  5M3M J;  2RNG A;  4EV0 A;  3COA C;  5CYV A;  1RC9 A;  1RNL A;  2GA2 A;  2K4J A;  5L3G A;  1QVT A;  4IOA F;  2ZJ2 A;  4HNU A;  1UMQ A;  5GAD J;  3I53 A;  4ZTF A;  4LLL A;  2CS3 A;  2QYO A;  4PZJ A;  2YU3 A;  4GXO A;  3CJR B;  4NB5 A;  1A35 A;  1U2W A;  2H27 A;  4UUT A;  1B9N A;  2BY0 A;  1IRF A;  4M6V A;  1IXC A;  2HXI A;  2H8W A;  5KAI C;  3DEU A;  1LPQ A;  3RZD J;  3S1Q J;  1Y56 A;  2EFN A;  2HDW A;  2EJR A;  4UY8 I;  1KGS A;  1XG1 A;  2H6B A;  4QSH A;  2B63 J;  2OF7 A;  4XLC A;  5GAH J;  4A3K J;  1IRZ A;  2VT2 A;  2MLK A;  2E5N A;  1F4K A;  2EA4 A;  3LA7 A;  4I2O A;  2OUM A;  3FXL A;  2RN7 A;  5D4R A;  2VI6 A;  1X1C A;  3G1O A;  1UFM A;  4M72 A;  1IDY A;  2EIN H;  1G3Y A;  3GXO A;  1ZG1 A;  2QWW A;  2VQL A;  4CCM A;  1V55 H;  4CSW A;  1J59 A;  2P8T A;  3QWL A;  2K3F A;  3G73 A;  4HZF A;  2DA6 A;  3H35 A;  3SDB A;  4BUP A;  1VQK I;  1FOX A;  1ITY A;  2K86 A;  3RI4 A;  2JRM A;  3ELK A;  3AL0 C;  5B3S H;  3HSE A;  1GLN A;  4Q5S F;  2FE3 A;  2LR8 A;  3J7Z I;  4BE2 A;  4U7B A;  3Q5F A;  1W36 D;  1IRX A;  1K61 A;  2B7E A;  1I39 A;  1R1T A;  3FDY A;  4J19 A;  1D8K A;  3M1E A;  2IRF G;  2H8R A;  5HDK A;  2DK8 A;  3PUF A;  3OYJ A;  4A3G J;  3HHG A;  2DA4 A;  4F7Z A;  2HEO A;  4E7K A;  1R36 A;  2WY7 Q;  4N9H A;  1BOA A;  5FLV A;  2NVQ J;  2LLK A;  1WI9 A;  1NG7 A;  3LFU A;  3NAU A;  4UB6 C;  3W6J B;  2F6C A;  2M7B A;  5J4Y A;  3ZN1 A;  2ACJ A;  3K4K A;  1S5L C;  4CGZ A;  3BR2 A;  3DEE A;  3FXO A;  1OCC H;  4HQE A;  5FFZ A;  4Y4R A;  3BT9 A;  3BTL A;  4C3H J;  1TT5 B;  2Y30 A;  5M3F J;  2Y9Y A;  3KZZ A;  5EYR A;  5FKN A;  2GAU A;  1R1V A;  3L2C A;  3ABT A;  3SFZ A;  5DDG A;  1IN5 A;  2CQX A;  2GZW A;  4BE1 A;  1BL0 A;  2E36 A;  2YS9 A;  3N4M A;  2QUF A;  2AS5 F;  5D5W B;  2UWM A;  4UV9 A;  2BXY A;  2BHY A;  5B66 C;  2BGC A;  3CDH A;  1Z6R A;  2XPW A;  1FEX A;  2CV0 A;  1F5T A;  2PJP A;  4J00 A;  3CTA A;  2RDP A;  3HRS A;  5K5R A;  5CVV A;  2UZK A;  2E7X A;  5ICF A;  1VFC A;  2DQL A;  1FOW A;  4AU7 A;  3CJQ B;  5DD4 A;  2TRT A;  2DOD A;  3G71 I;  2EZH A;  3FZV A;  1MJB A;  1KON A;  3U21 A;  5D8L B;  3IKT A;  4ZDO A;  2VKV A;  2ELK A;  3SJM A;  2VQH A;  2I10 A;  5FB2 A;  3OWT A;  3GTJ J;  4AIJ A;  4LMY A;  3L9F A;  1ETY A;  4Y13 A;  1IXS B;  3CCR I;  4M6X A;  2RC4 A;  1K83 J;  3ZP5 A;  3W2A A;  5K5Q A;  4PFO A;  2QQ8 A;  3RCO A;  2IAI A;  2PN6 A;  4P5O A;  2LC2 A;  4R79 A;  4L9N A;  5LBQ A;  1W0T A;  3S2W A;  3TO9 A;  3JRG A;  3FIS A;  1H0M A;  3GYH X;  1T2K A;  2PLY A;  3O8H A;  2R7W A;  3F8C A;  1RR8 C;  1XMK A;  3FX3 A;  1RKT A;  4BS9 A;  4UVB A;  1VI0 A;  3OYL A;  5F08 A;  4BQQ A;  1KYZ A;  1HOM A;  2CH0 A;  5LRS A;  1O4X A;  3DP7 A;  1BW5 A;  2MGQ A;  2UXX A;  3ZMS A;  5E3O A;  3GVA A;  4KIC A;  2LF7 A;  3ZMZ A;  1HW5 A;  1GV5 A;  1K79 A;  1FY7 A;  3A0H C;  1YW8 A;  2ZNY A;  3BZC A;  3LA2 A;  1C0W A;  5E8G A;  1GDT A;  4M74 A;  3F6V A;  2LRE A;  2ZXJ A;  1ORK A;  4RGS A;  3J80 K;  3HOW J;  5CPR B;  4P9F A;  1IGN A;  5C3E J;  3F6O A;  4ESF A;  4M73 A;  3ZMU A;  1SD5 A;  3E5Q A;  3GX4 X;  1B72 B;  5K7H A;  1JKQ C;  3A2K A;  4MIM A;  1WCM J;  3CMA I;  4A3C J;  3KIO A;  2YR2 A;  5ERI A;  2E1C A;  2QM3 A;  3F8B A;  4M9S A;  4XLA A;  2NVX J;  1BJA A;  3B6A A;  5AIQ A;  2QBY B;  4YFN F;  4B3A A;  3HYI A;  4IF4 A;  2O3F A;  3JR9 A;  3VYR B;  1W5T A;  3ABM H;  5D4S A;  2L7K A;  4EJO A;  4ESB A;  2EFO A;  3GF2 A;  1R5H A;  2AXT C;  3HKZ A;  4O3M A;  3HKZ N;  2OQG A;  3K1M A;  3SYT A;  4KA4 A;  1VQ8 I;  2PQ8 A;  1SVM A;  3VOE A;  2K27 A;  3TDU C;  2RVC A;  3DFG A;  3LMM A;  3OYE A;  3ZGK A;  2QZ8 A;  4B47 A;  3GTP J;  3CP8 A;  2XV4 S;  2Y48 A;  2NS0 A;  2LBF B;  3ZOB A;  1UZC A;  4ZC3 A;  4HPQ A;  1XS9 A;  3H0G J;  2VLA A;  5DM7 F;  2H1K A;  1BR4 A;  2ECC A;  3P9C A;  4YG2 F;  2ZFW A;  3OL4 A;  1DQU A;  1ZGW A;  3PNV A;  3S8P A;  3ZQI A;  4BH9 A;  1XGM A;  1DP7 P;  3AFH A;  3M3Y J;  2IVM A;  1ZGJ A;  2UV1 A;  1BC7 C;  3S3N A;  2E1N A;  3W3C A;  4AIK A;  2OD5 A;  2Z16 A;  4A3M J;  4EM1 A;  2L4A A;  3BWG A;  2V1N A;  3ZQG A;  5KNL A;  2DMQ A;  2NNY A;  1I3A A;  3K0L A;  4HLX A;  2X48 A;  4NQW A;  4ENK A;  2FQ3 A;  4G12 A;  2G0E A;  2EBI A;  4ENM A;  2DDA A;  3M7G A;  3EUK L;  1E3P A;  1K6O A;  2M1B A;  2DMT A;  2P4W A;  3LL7 A;  1ON2 A;  3F0C A;  3G6E I;  5GTH C;  2V1U A;  1Z77 A;  3B6C A;  2LG4 A;  3PFY A;  1QO0 D;  4XN0 A;  4XL9 A;  1TTY A;  1XN7 A;  5JFR A;  3CUQ C;  1ZK8 A;  2FOW A;  2QVO A;  4XOR A;  1WJE A;  5FGM A;  5BOX A;  3LSJ A;  3CJN A;  3CLQ A;  1WPK A;  1AOY A;  1T08 B;  3CF2 A;  3D5L A;  2D45 A;  3WU2 C;  3J7Y J;  1JE8 A;  3JRF A;  3K10 A;  1YO5 C;  2IA2 A;  5E3L A;  3CO7 C;  1LFU P;  1YIT I;  4M3B A;  3OS1 A;  1DPR A;  3R6S A;  4CHU A;  3HL2 A;  3QU3 A;  3GW2 A;  3I4M J;  1DGW Y;  4XQF A;  1MZB A;  2IEK A;  1SMT A;  1PUF A;  1QZZ A;  1FSE A;  4CIC A;  3E5X A;  1AWC A;  5CVR A;  1JUM A;  3OYF A;  4HF2 A;  1OYW A;  4AC0 A;  2IGO A;  4QIW N;  4B44 A;  3M8J A;  1YE9 A;  2NXN B;  4ETS A;  1U5T C;  4A3E J;  5H6Q A;  2R7D A;  2OTL I;  2ZB9 A;  1TBX A;  2F4I A;  2K3P A;  2CG4 A;  3DPL C;  2EB7 A;  3FXK A;  3MQ0 A;  4UXN A;  1HXD A;  1JJ6 C;  3W6V A;  4I09 A;  3S1M J;  3CCQ I;  2CSO A;  2ZBK A;  3HHH A;  4LLN A;  4F3Q A;  3BZ6 A;  5H20 A;  4D0P A;  2NOG A;  1YFH A;  2ZCW A;  3Q0V A;  3HOZ J;  4X6A J;  2NRA C;  1UHW A;  2ZME C;  2LSO A;  5EEG A;  2O03 A;  4BJ5 C;  4E4H A;  3BR0 A;  4MNU A;  2WWY A;  4PJL A;  3W6K B;  1IDZ A;  2CQ7 A;  2B0L A;  3KX2 A;  4KMF A;  2NS8 A;  5C4X J;  1EJ9 A;  5DV5 A;  5E79 C;  2A69 F;  4BBS J;  4R8H A;  2A6H F;  2WB1 A;  3H9G A;  2WB1 N;  2Y31 A;  4OAZ A;  4EJU A;  2DDB A;  3ECH A;  4A3F J;  3KFW X;  4E7S A;  1YLF A;  2N8G A;  2BEO A;  3Q0W A;  5F64 A;  3VPR A;  1QRY A;  1RZ4 A;  2DTZ A;  2L01 A;  3G2B A;  2LY1 A;  1R58 A;  1GV2 A;  3LSI A;  4PK4 A;  3TED A;  1QPI A;  2E2J J;  3MZY A;  5HS8 A;  4S05 A;  4JBA A;  1UCR A;  1V5G A;  2BZT A;  3AG1 H;  5BQT A;  2IGM A;  1IUF A;  5IP9 J;  3LSM A;  2BOL A;  4MQ9 F;  2K5C A;  4HW0 A;  1N75 A;  4I7H A;  4C30 A;  1W4M A;  3V8K A;  2EFW A;  1G3W A;  1REP C;  3DPT A;  1MNE A;  1ZKG A;  2EQR A;  3WGH A;  1P9Q C;  3BG3 A;  2BYV E;  2LOO A;  3A01 A;  3CME I;  4XSX F;  3WHB A;  2RGV A;  3ABK H;  3S1R J;  1NG6 A;  1V54 H;  5GPA A;  1A6Q A;  2R7O A;  2AO9 A;  3GFI A;  1X3U A;  1OFC X;  3NWS A;  4L5I A;  1ERD A;  4PGH A;  1NTC A;  2DT5 A;  3CCL I;  2GWR A;  2OBP A;  1NHA A;  1KU3 A;  4Z2Y A;  3ZXS A;  1FJL A;  2STW A;  4WXD A;  4A3L J;  3FKI J;  1P2F A;  3R61 A;  2DN0 A;  5LEK A;  2F5E A;  5ILS A;  3HOT A;  2OTJ I;  2MH9 A;  2JA5 J;  3J81 K;  3B73 A;  4IL6 C;  5CQG A;  3U9G A;  3MWM A;  5FKL A;  1OR7 A;  4UB8 C;  4HF0 A;  4DYQ A;  4ZYD A;  4Q4Z F;  3BRO A;  1D1B A;  1PP8 F;  3P9I A;  4JX4 A;  2FBI A;  1HDD C;  5L3E A;  2ZO4 A;  2XAH A;  4F92 B;  4BL0 B;  4AID A;  4C3J J;  5FLX Z;  2L7M P;  4IX7 A;  4PSX A;  1F1Z A;  1KYW A;  3VB2 A;  2KJC A;  3I56 I;  3CCE I;  4ENN A;  2LH9 A;  3TBI A;  2HPI A;  3DEW A;  2HQN A;  3D5R C;  5D5X B;  4XRS A;  1Z9C A;  3F72 A;  2MD5 A;  3DCF A;  4U0Y A;  3CDI A;  1FYL A;  2XRO A;  3KP2 A;  1OPC A;  3BG7 A;  1G6N A;  4TV7 A;  1MSE C;  4M3E A;  4EMS A;  1SFE A;  5M5X J;  3TGN A;  1FWZ A;  2QSF X;  2ETH A;  3K4N A;  3TO6 A;  1I3Q J;  1X4O A;  2FEZ A;  5E8I A;  3DWL E;  3OYD A;  4HX4 A;  2GM4 A;  5LRR A;  3J7A O;  5FO5 A;  4FQG A;  4N4O B;  2R7R A;  1HSJ A;  2R7Z J;  3TQN A;  2JSC A;  3R0A A;  3LQQ A;  5TJJ A;  2YU9 J;  2ICW G;  5EG0 B;  2VBZ A;  1FSH A;  2Z3Y A;  4P55 A;  5B1B H;  1B72 A;  2HXO A;  4RLQ A;  4AWX B;  1ETV A;  3T8T A;  3BQZ A;  4CYC A;  4PJ0 C;  2GOM A;  5GPC A;  4UUV A;  1QBJ A;  1O3Q A;  2XAG A;  4M3G A;  3MFK A;  3BLY A;  2DTR A;  1YHQ I;  4JK1 X;  1MDM A;  2QBY A;  4Y52 J;  1KA8 A;  3MZH A;  4IXA A;  4LIT A;  2GBY A;  4UNO A;  5F0H A;  3BCA A;  4A69 C;  4RLF A;  1QQI A;  3W2W A;  2JK3 A;  2JZY A;  3HGY A;  4C2U A;  4C9Y A;  3QP5 A;  1FX7 A;  1TNS A;  3LWF A;  2ID6 A;  2RQQ A;  1AU7 A;  3WTZ A;  3OYN A;  3HEF A;  2XHK A;  3LOC A;  4LFU A;  1O3T A;  1BC8 C;  1AKH B;  4PGG A;  1IXR C;  3L7W A;  1B8I A;  3BR6 A;  4D7M A;  2JA2 A;  2G7U A;  3H3U A;  5KVR A;  3HOX J;  1OCZ H;  5LD2 C;  5CVJ A;  5FD5 A;  1I6H J;  1DUX C;  4XBF A;  4NC7 A;  3WG7 H;  4RAY A;  2Z1D A;  4JP0 A;  3S17 J;  3KPH A;  3H92 A;  3E6D A;  2M4G A;  3JRC A;  2WAQ A;  2WAQ N;  2XGD A;  4E7H A;  1P92 A;  4A3J J;  3SHF A;  1K7A A;  5JVG F;  4MEX F;  1JGS A;  4LIV A;  3UR3 C;  2E1M C;  2P6T A;  2CW0 F;  2P5K A;  4II2 A;  2DPD A;  2M7A A;  3IV5 A;  4OIQ F;  2MLG A;  4WWC A;  2D2W A;  2FQ4 A;  2GXG A;  4U87 A;  1MMG A;  2VBW A;  4A5N A;  1EV7 A;  2JQ7 A;  1FIA A;  1J75 A;  4I0B A;  3HPH A;  1LVA A;  4B09 A;  4XLE A;  1PDN C;  1B6A A;  1DDN A;  4BKX A;  2CRG A;  4XRF A;  5F1J A;  1APL C;  2PG4 A;  4L5E A;  1KU7 A;  4ZDP A;  1S72 I;  4CZC A;  2JWT A;  2WAE A;  1H8A C;  2K9Q A;  1VQL I;  2M5W A;  4PJM A;  2M30 A;  4DBQ A;  5IT3 A;  4HX7 A;  1GVJ A;  2K85 A;  3TW6 A;  4OAY A;  2IA1 A;  3BTJ A;  4FE7 A;  2LFB A;  3CJT B;  3I59 A;  3CP2 A;  3OYH A;  5F0F A;  1BI3 A;  2MD0 A;  2YUS A;  3K70 D;  2V4J C;  5E17 F;  1ENH A;  2VOO A;  4LG3 A;  3HM5 A;  2CUJ A;  2G7H A;  2A6E F;  1ZRD A;  4CUG A;  3FIW A;  1XCV A;  3T8R A;  2R5Y A;  3ROU A;  2Y2Z A;  4G7H F;  1WWX A;  3SFI A;  3QU6 A;  3OOP A;  4H0E A;  2IS2 A;  1W7P D;  3WU1 B;  1LE8 A;  4C2M J;  1WSU A;  2P5V A;  4HV6 A;  4I0A A;  3IUO A;  3PSF A;  1VF9 A;  3O3K A;  4KIG A;  2I8D A;  1R00 A;  4BXF A;  1EH8 A;  2JA6 J;  4AM3 A;  1I50 J;  3WTW C;  1X3W B;  1NK2 P;  3CES A;  2M34 A;  3OR2 C;  4RB1 A;  4BY1 J;  2KIS A;  2FF4 A;  2JSP A;  3RQ4 A;  2DPU A;  2DA5 A;  2FJ1 A;  2GIZ A;  1T0F C;  1HKS A;  3A0B C;  1O7F A;  1E2X A;  1ZGA A;  1FC3 A;  4I6Z A;  2LRD A;  4PUS A;  4HDV A;  4RBO A;  4A0Y A;  3U1K A;  4BBR J;  3EPZ A;  1LDK B;  5IOZ A;  3H36 A;  2ZJP F;  4EGY A;  4B43 A;  2KIM A;  3SZG A;  3IH4 A;  2AQF A;  3CC4 I;  1JHF A;  3BG9 A;  3BQY A;  3OSF A;  3N97 A;  1H9T A;  2PX9 A;  3OYG A;  1ZEL A;  1YW7 A;  1PUF B;  2QQA A;  5M5W J;  2K9N A;  4RMN A;  4CO8 A;  1VQN I;  4HAM A;  2L4M A;  1HCR A;  5DYM A;  3TDZ C;  3VOD A;  4OU0 A;  4YFX F;  3GEZ A;  5L3B A;  3IRR A;  2CQN A;  3FMR A;  4IQJ A;  4A0X A;  5LLQ A;  2DMN A;  2HWV A;  3LAP A;  1WH7 A;  4KN4 X;  5L3D A;  3RKX A;  4DGW B;  3ZR8 X;  2LMD A;  4WK8 F;  2VIX A;  2RV8 A;  4I99 C;  4Y3O A;  2HQA A;  5BS6 A;  4MHG A;  3O8G A;  3OYC A;  4IRI A;  1MNM C;  3HB9 A;  2KDO A;  4RB0 A;  3ZMD A;  2JRT A;  1HST A;  4LIU A;  4EJW A;  3OYK A;  3IHU A;  5D5U B;  3JRB A;  1ZLJ A;  2HPM A;  4KN7 X;  1XB4 A;  3D5S C;  5LEJ A;  1LEB A;  4P9U A;  3ECO A;  5L3C A;  1OYI A;  1WFX A;  2KRH A;  3FMQ A;  5D6E A;  4ZYH A;  3ML6 A;  2A05 A;  1OMI A;  5ED4 A;  4FAS D;  4IZZ A;  1SC7 A;  4OIR F;  3JTH A;  4ON0 A;  1B9M A;  1UJ8 A;  4BQO A;  3PO3 J;  3LSP A;  2ME6 A;  3RJP A;  2Q0O A;  3E1S A;  5J40 A;  1TT0 A;  3C2G A;  3VWB A;  3GME A;  5JLX A;  4A3D J;  3HRU A;  1KQ9 A;  5B1A H;  3O2P E;  3OR1 C;  1U9N A;  2XGX A;  1ZN2 A;  2MBF A;  1FZP B;  3SDG A;  2C6Y A;  1MSF C;  2X6X A;  3VSL A;  2CUF A;  3HPG A;  1ZRF A;  1J5Y A;  1CQT A;  4P1W A;  2JUG A;  3M9A A;  5AIP A;  5FKM A;  1VQ9 I;  4KT6 A;  1I27 A;  4XN3 A;  2A6T A;  4QPO A;  1FP2 A;  4X1E A;  3IAM 2;  1X4P A;  1QZY A;  4Q47 A;  1VQ4 I;  2FML A;  3A01 B;  1U5T A;  2HNH A;  3KYL A;  4XKB A;  2KPM A;  2O8X A;  2DA2 A;  4MTE A;  5DTD A;  2NVY J;  3O6B B;  1POG A;  4G6T B;  5EG0 A;  2HU9 A;  3U1D A;  1PUE E;  1R23 A;  1LKX A;  2OA4 A;  2L7Z A;  4A0Z A;  5F6F A;  4FX4 A;  4QPQ A;  2ZME A;  1JUP A;  2DA7 A;  4XLF A;  5JI6 A;  4EQQ A;  1QHG A;  1VQO I;  2XKO A;  4KMU X;  4EM0 B;  3TMO A;  3J7A Y;  2K9S A;  2BXZ A;  2MFZ A;  1Y1V J;  3I3L A;  2RAE A;  2XPV A;  3GZ5 A;  3IH2 A;  3NEU A;  3WHC A;  2PJR A;  3MAJ A;  3AG3 H;  2LDU A;  2DA3 A;  2EWN A;  4V2F A;  3K7A J;  1OCR H;  1NH3 A;  1LDD A;  2CW8 A;  1QHH D;  3FM5 A;  2KP6 A;  1AKH A;  2HOS A;  2E19 A;  3GUD A;  3IL2 A;  4FX0 A;  3BDD A;  3FWE A;  5CVU A;  5HLH A;  2VOD A;  2E60 A;  4F91 B;  2HVQ A;  4IO9 F;  4Y17 A;  3JAM Z;  1P4W A;  4E6K G;  3G3Z A;  3L00 A;  2LKP A;  2DLL A;  1VND A;  2R93 J;  2BW3 A;  3CUO A;  4BXU A;  4PCQ A;  3RZO J;  4AUX A;  1TWF J;  2WBM A;  3DPU A;  3PO2 J;  1OCT C;  4RDU A;  1LVK A;  4AD9 A;  4NNJ A;  3ZQQ A;  2V6C A;  3K4M A;  3ZQ7 A;  3S1N J;  2A07 F;  3AL0 B;  1R49 A;  2PMU A;  1R4M B;  1D0X A;  3ZQF A;  4C3I J;  2CO5 A;  3CC2 I;  1GHC A;  2HZT A;  4CYC B;  3OSG A;  3GCM A;  1HBX G;  2CWE A;  5IP7 J;  2E34 A;  1W7P A;  2DOA A;  4B1R A;  4BHP A;  1V3F A;  1MDM B;  2HFH A;  1SVO A;  5K1Y A;  3FHZ A;  1X2M A;  3KE2 A;  5EEH A;  2MG4 A;  2QF7 A;  3IKV A;  4OWR B;  4FTH A;  2X6W A;  1OCP A;  3BCB A;  1MIJ A;  1O7L A;  3ZMT A;  3DF8 A;  3NAR A;  1DP3 A;  1R4N B;  2QKL B;  3V8L A;  3JRE A;  2HZD A;  2EK5 A;  4D5C A;  1WJD A;  1BOB A;  3F8M A;  3IWF A;  3SZP A;  3WOD F;  4BNC A;  5JHU A;  4KIB A;  4E7L A;  2HQR A;  2DFH A;  1YIJ I;  1F43 A;  1B8I B;  3KET A;  3A02 A;  3KZY A;  1A5J A;  4LOC A;  4KFC A;  5KHD A;  2LY9 A;  4BXX J;  4LB5 A;  1S8N A;  3KP3 A;  3TOB A;  5EGO A;  4L0Z B;  3SXY A;  2M9H A;  3AG4 H;  3BJ6 A;  4EJV A;  5B5E C;  2EIL H;  2VKH A;  4L0Y B;  1YI2 I;  2ZXW H;  3TW7 A;  4B48 A;  4AIH A;  4ZJZ A;  2ZJQ F;  2FMY A;  1XMA A;  2MYS A;  1HC8 A;  3DKX A;  1WKM A;  1VQ6 I;  2PMH A;  1OJL A;  2W1O A;  1D8J A;  1DPU A;  2HOA A;  3GTO J;  2GQQ A;  4FIS A;  1FPQ A;  2FNA A;  3ESW B;  2M2E A;  2KMU A;  1AHD P;  3HGG A;  4MLO A;  5E3N A;  2PI0 A;  2F4O B;  2JUC A;  4UVA A;  3HOS A;  2K4B A;  3LSK A;  4RGR A;  1D3Y A;  2WC2 A;  5FD6 A;  2NAZ A;  3M8E A;  2ELJ A;  3GTM J;  2ZSH B;  1T98 A;  2OQR A;  5LGU A;  3OL3 A;  2VKD A;  5J8C A;  3OYB A;  1Y0N A;  1L3L A;  1WJ5 A;  1HKQ A;  1W0U A;  3JRA A;  2IS6 A;  4A93 J;  4G7O F;  3BPX A;  2L9N A;  4G94 A;  1QGP A;  1S7E A;  2YX4 A;  4D9J A;  3KP4 A;  2NYX A;  2V1D A;  3PFI A;  4E7Z A;  3HRM A;  1XD7 A;  3GFM A;  3IP4 B;  3HUG A;  3I59 B;  4MTD A;  2CYY A;  2V1X A;  2CQQ A;  3BTI A;  1BBY A;  1Y6I A;  3R4K A;  2VE8 A;  2IS1 A;  1ZRE A;  5LFA A;  3EET A;  1V4R A;  5GP9 A;  2EZL A;  2HR3 A;  3RSN A;  1U9O A;  3ZN0 A;  1R5I D;  3WTT C;  1G4D A;  3HTS B;  5LHH A;  1VZ0 A;  3G1M A;  2L9V A;  3U2R A;  2K40 A;  2R5Y B;  1UHM A;  2DOE A;  2VJI A;  3E3V A;  3PUB A;  3RDI A;  3TOA A;  4IKF A;  5HLT A;  1R1U A;  3IRQ A;  3HOU J;  2HGC A;  3I64 A;  1LUJ B;  1XGO A;  1LE8 B;  4U0V A;  4XKV A;  2HDD A;  1MMD A;  1D1A A;  4I01 A;  5IT9 Z;  5H2F C;  4KNY A;  2CUE A;  1K4T A;  3H1C A;  3RPQ A;  1IO2 A;  1D5Y A;  2XB5 A;  4W1U A;  5D6F A;  5J3L A;  2QKM B;  4BHC A;  1FOK A;  1JI8 A;  1LFP A;  3QAH A;  1S7O A;  2MH2 A;  3CCJ I;  2R7U A;  1WI3 A;  3BZK A;  4ZZD A;  1FT9 A;  3RTR A;  4BHB A;  2RKH A;  2H09 A;  3FXR A;  3WGI A;  2FBK A;  3GTG J;  2EIM H;  2LK2 A;  2NVU B;  1G2H A;  1YJN I;  3PNT A;  3I9V 2;  2WTE A;  2Z5U A;  3K69 A;  3ZPL A;  4UV8 A;  1J09 A;  5HDN A;  4FT8 A;  3REO A;  5AON A;  5GAE J;  5A2Q Z;  4V2G A;  2I5U A;  4DNC A;  4DBR A;  3K1P A;  4IHS A;  4HF1 A;  3CZ6 A;  2R3S A;  4RAZ A;  1DU6 A;  4HBL A;  1A31 A;  3D0S A;  5CQE A;  4CCN A;  1JHH A;  5HOD A;  3FK7 A;  1XGN A;  1Q1H A;  4CCJ A;  3FF5 A;  1KQ0 A;  1U78 A;  1WJC A;  1MBK A;  1FTZ A;  4GFB A;  1TLH B;  2EV6 A;  1GUU A;  1S9H A;  5JR3 A;  3DLL F;  3M8F A;  1G8X A;  1Z6T A;  1UST A;  2RNJ A;  4MEY F;  4DQ2 A;  3LSH A;  3QPH A;  4EJT A;  4LJZ F;  3JRD A;  1BJZ A;  4RAF A;  4CCK A;  4I76 A;  5ICE A;  1O3S A;  2P81 A;  2EIK H;  4D1Q A;  2TDX A;  2F2E A;  2QA4 I;  1F9N A;  4XKC A;  3T5X A;  3M07 A;  1LQ1 A;  1KU2 A;  1P4A A;  2VE9 A;  4YRV A;  2PEX A;  1ZQ3 P;  2DMP A;  1U3E M;  1E3O C;  5L3F A;  2EPF A;  2O5R A;  1T33 A;  2A5W A;  2W57 A;  2MC4 A;  3FHN A;  5HNH A;  4N9I A;  2XAU A;  1OYY A;  2FRH A;  3CQZ J;  3F3X A;  3HOV J;  3HTU A;  4CYD A;  5D8K B;  1V5E A;  4D7N A;  4Y33 A;  1QU3 A;  4ESJ A;  3HBL A;  3RKW A;  4RB2 C;  1NK3 P;  3C2H A;  1O3R A;  1T0F A;  3CUQ B;  4XLP F;  1F36 A;  1A04 A;  2XPU A;  4O5V A;  2VKE A;  4IHY A;  1BA5 A;  5F1R A;  2IT0 A;  4WXC A;  1SFO J;  3H5N A;  3DBL B;  3AG2 H;  2HYJ A;  5IP6 A;  1G3S A;  3CLO A;  2BV6 A;  2HQ5 A;  4RM3 A;  2EV5 A;  2QLZ A;  2H1L A;  3RYR A;  2OC6 A;  3S14 J;  4M71 A;  3VYU B;  3EYY A;  2JVG A;  4PJJ A;  2CV2 A;  1TQI A;  2JTV A;  4P96 A;  2DFE A;  1BR2 A;  2KHM A;  4OMZ A;  3AAF A;  2IW5 A;  2KLO A;  1QA6 A;  1MGT A;  3DBR B;  2FA5 A;  3V42 A;  4BU2 A;  2W25 A;  3ABL H;  3GFJ A;  3KEO A;  3N05 A;  4YEJ A;  4XOP A;  3RKQ A;  1WZ2 A;  2KQR A;  2W24 A;  2VQC A;  3DTI A;  1XDU A;  3L2V A;  1YYV A;  2NS7 A;  4UVC A;  5J1U A;  2CUZ A;  3WTV C;  1WQ2 A;  2V79 A;  1IAW A;  1U5T B;  5EF6 A;  3M4O J;  3GO5 A;  4HRI A;  5EEA A;  4OIO F;  2KZV A;  4JX5 A;  1X58 A;  1OKR A;  2DK5 A;  2VOP A;  5DCM A;  1SEU A;  3BP8 A;  4NHJ A;  3I5U A;  4WXH A;  3IH3 A;  2K9L A;  3CCY A;  3VDX A;  1FOY A;  2DW4 A;  3BJA A;  4HDU A;  3HJE A;  3JW4 A;  4U0W A;  4KDP A;  4CCO A;  1ZTR A;  4IHV A;  2BVL A;  3V7C A;  2ZME B;  2OU2 A;  1JGG A;  2X6Y A;  4XON A;  3DBH B;  1T39 A;  2R0Q C;  1RRJ A;  2B9S A;  1R71 A;  4IOC F;  2WV0 A;  2E7W A;  4D5F A;  3CF5 F;  3ZQL A;  3RPU D;  4XR6 A;  1BI1 A;  3QPL A;  1R7J A;  2JPC A;  2F5D A;  3V7S A;  1ZYR F;  3BR1 A;  1TZL A;  2X6O A;  3E97 A;  2RQP A;  1ETX A;  2PJR B;  1RPW A;  2ID3 A;  3TKY A;  3CMY A;  4IHT A;  1S3J A;  4BE0 A;  2DYR H;  2M3A A;  2FNP A;  5HLI A;  2IGN A;  5C4J J;  4NUB A;  1QZE A;  3QPT A;  4LG0 A;  1QNT A;  3PM1 A;  3S93 A;  3AKZ A;  2CU7 A;  1W36 C;  1IG7 A;  1TWG J;  4JYK A;  5K7F A;  1X1P A;  1SFU A;  1LDJ A;  2HYF A;  4DZJ A;  2Q2E A;  3ERE D;  1JTX A;  1HW2 A;  2BW3 B;  4AVP A;  3A03 A;  4CDG A;  4MFD A;  4N0B A;  2EA2 A;  1J2X A;  3GLX A;  4DOZ A;  1I6X A;  1UAA A;  1KQ8 A;  2LKS A;  3K4C A;  3UNG C;  3S2H J;  1Y8Q B;  4IHX A;  2MA3 A;  1G3T A;  3RYP A;  1MND A;  3LQR A;  3A4C A;  4MO7 A;  1K4S A;  5FFX A;  1W7P B;  5LHI A;  3OYM A;  1RES A;  1BI0 A;  1GVD A;  1X19 A;  3KLO A;  2STT A;  3K2Z A;  3S15 J;  3E7L A;  3H5R A;  4IQ4 A;  4LK0 F;  4RS8 A;  2YPR A;  3BPV A;  1KU9 A;  3LNQ A;  2ZSI B;  3QPS A;  3JCU C;  3K2A A;  3BTC A;  5CJ9 A;  5DM6 F;  1STZ A;  5DEQ A;  2J5P A;  3OOU A;  3OYA A;  1MBE A;  3CD6 I;  1WVR A;  4Z6Y A;  2HI3 A;  4EEF G;  3KZI C;  4WF2 A;  2FUG 2;  3SEQ A;  4N4N B;  3MEX A;  1TWC J;  4UUS A;  1Y1W J;  3TL4 X;  4HX8 A;  3KP6 A;  3E6C C;  2ELH A;  5DUK A;  4QWQ A;  4B4C A;  1E0E A;  3KCC A;  1ETQ A;  1IV6 A;  5EGO B;  5KAF C;  1FP1 D;  2CQK A;  5KK1 A;  1T56 A;  4ANJ A;  3GZ6 A;  2J5O A;  5CVI A;  2OPT A;  1B59 A;  1MH3 A;  1W5S A;  4CZZ A;  5KCM A;  2LVS A;  3WGG A;  5E1X A;  1PP7 U;  2D5V A;  3I4N J;  1ETW A;  1PJR A;  1YIO A;  1ZHF A;  4RAG A;  4OIP F;  2FD5 A;  5FLX K;  3MCZ A;  2W4S A;  5LGT A;  3DTE A;  2IP2 A;  1WJF A;  3EQL F;  2ZJR F;  2Y0M A;  1DU0 A;  2CGP A;  4E70 A;  3QYF A;  2FU4 A;  5HOO A;  3P5J A;  2DI3 A;  2E2I J;  3PJR A;  3FXQ A;  2WV1 A;  4BEH A;  2WAF A;  3OMY A;  1ZR4 A;  2VQG A;  3LAJ A;  1I1S A;  2VL8 A;  4JQF A;  1P4X A;  2Y9Z A;  2L54 A;  3TP0 A;  1CF7 A;  3F8N A;  5HVQ C;  2EZK A;  4U88 A;  2GIV A;  3I4P A;  1S6L A;  1SFK A;  3L2W A;  3EUH C;  1Z05 A;  2CFX A;  4GGG A;  2GA1 A;  5EJC A;  5D5V B;  2BHZ A;  4OOI A;  1J7K A;  2DFI A;  2OZ6 A;  3JRH A;  1ZLK A;  2JA8 J;  4ZTJ A;  3QP6 A;  3FXJ A;  3FXM A;  4CA0 A;  1HQC A;  3EUA A;  2XSJ C;  2R5Z B;  2F4M B;  4YIF A;  1SAU A;  3WTS C;  1MBH A;  4S04 A;  1WJA A;  4G6Q A;  2E1O A;  2LKX A;  3CCM I;  5HS9 A;  3LSR A;  4DYR A;  3JSO A;  3HUG B;  4GCV A;  3BOQ A;  2QSH X;  2XDV A;  3MVP A;  3QYB A;  4FE4 A;  3RIR A;  2JMW A;  5LGN A;  1OR7 C;  3ZMV A;  2LYC A;  4BY7 J;  1AA7 A;  1V5F A;  2A3S A;  5IYC J;  3V8J A;  3GLL A;  5E18 F;  1WRJ A;  3J80 Z;  1R5G A;  2KIU A;  3C2B A;  3K4L A;  1R9T J;  2M87 A;  1ZG3 A;  3BR3 A;  2GOX B;  4AVZ A;  2XC7 A;  4BJ6 C;  1GT0 C;  5ILU A;  1TP4 A;  2W82 A;  2VJJ A;  1TQM A;  3CO6 C;  2DAO A;  3OV8 A;  4YEL A;  2E1M B;  1Q1V A;  4KYW A;  2X0L A;  3WTY C;  1FYK A;  1TW2 A;  5IYD J;  4NBQ A;  3F8F A;  1OLT A;  5JVT A;  3OY9 A;  5HS7 A;  5LHG A;  3RKY A;  2X51 A;  1JUS A;  3EDP A;  3IWZ A;  4HNV A;  3CDL A;  3P7N A;  2XRL A;  3HG9 A;  4IJA A;  2AXL A;  3FM3 A;  5ILV A;  2ZC2 A;  1UEL B;  2LP0 A;  3SQN A;  3CUQ A;  3L2R A;  1R22 A;  3MZ8 A;  2O9L A;  1P7I A;  3KLN A;  2KFD A;  3S3O A;  2QQB A;  3C7J A;  2DA1 A;  4AYB A;  4AYB N;  4MGR A;  3G4S I;  3RPU A;  5HLG A;  3T0Y A;  4EAT A;  2ME0 A;  4RA2 A;  2Z9O A;  1E17 A;  2R7V A;  3CMM A;  4NC6 A;  1KZH A;  3OIO A;  2O61 A;  4G9Y A;  2HTS A;  1O57 A;  4HNT A;  1MW7 A;  3VYT B;  3D1N I;  5E1W A;  4YIR X;  4YFK F;  2VON A;  2JT1 A;  4EGZ A;  2FXA A;  1LNW A;  1IC8 A;  4IHW A;  1YX3 A;  2ISZ A;  4EVI A;  1VQ5 I;  2AQE A;  3HC7 A;  2JJ7 A;  3LSG A;  2EV0 A;  3BG5 A;  5J4V A;  4DYC A;  3JRI A;  3TP3 A;  4ASN A;  3X2Q H;  1MBG A;  4L9T A;  1T95 A;  3GTQ J;  1QPM A;  1ULY A;  2VB6 A;  3CCS I;  5EZH A;  4ZYE A;  1JT0 A;  2XAJ A;  2KZG A;  2VJ5 A;  2Y69 H;  5F27 A;  3PNY A;  1YOV B;  1W1W E;  2H6C A;  2KRF A;  2L2O A;  2L3D A;  3DQV C;  1JXS A;  2KRC A;  2RRE A;  3F22 A;  1GXP A;  3VEP A;  1MBF A;  1A36 A;  4BDY A;  3WE3 A;  4HST A;  5TIS C;  3MKY B;  2QEX I;  1MMA A;  3QRF F;  2E2H J;  1XC5 A;  2VC1 A;  3DV8 A;  2E5Z A;  3RQI A;  1EF4 A;  3H0D A;  4E7I A;  2QEN A;  2BVM A;  1X2N A;  2ZFU A;  1IN8 A;  1FMW A;  3E6B A;  4JX6 A;  4PDK A;  4GYG A;  3WE2 A;  4RGX A;  3TO7 A;  2FBH A;  5DD8 A;  2QGU A;  4W97 A;  4CCL A;  3QYE A;  2MC3 A;  1YRN B;  3NWT A;  2EIJ H;  3L2U A;  2QQ9 A;  1TL8 A;  1IW7 F;  5BPD A;  4FET A;  2DFF A;  4KIS A;  4PSW A;  1IV8 A;  2VJ4 A;  1XGS A;  1TWA J;  2M0C A;  4B3X A;  2P5L C;  2DYS H;  4CXF A;  5K5O A;  1MMN A;  1ZG5 A;  4BDZ A;  2OJE D;  3BC8 A;  2JA7 J;  3IC7 A;  1IUY A;  1J9I A;  4F93 B;  3OIQ A;  4DIQ A;  3JSP A;  4M9Z A;  5DCM B;  2DT6 A;  4ZZL A;  3WG9 A;  4XRS G;  4RM2 A;  1IZ1 A;  5GAG J;  3PQK A;  4MFE A;  1RI7 A;  4PFP A;  3MN2 A;  4KUM A;  4X0G A;  1UG2 A;  2KL4 A;  1Z7U A;  2EZI A;  3BY6 A;  2XGE A;  1RR7 A;  3BJO A;  2HVR A;  4L9V A;  4BQN A;  2MW8 A;  3Q3S A;  2UUZ A;  1TW3 A;  1UHS A;  2IPQ X;  2XGC A;  4HQM A;  4EM2 A;  2LY2 A;  2FSW A;  4RB3 C;  4BAY A;  2NOJ B;  1HA8 A;  4OIN F;  4J01 A;  2XB0 X;  3E0J B;  1BIB A;  6PAX A;  5FRM A;  1FBS A;  1I5Z A;  4DJA A;  5J1R A;  1BW6 A;  3WTU C;  2EFP A;  2HTJ A;  4LG0 B;  4XMY A;  1YS6 A;  1L0O C;  2DJN A;  4GYI A;  1B1B A;  1WHU A;  4LGW A;  1YQA A;  1S29 A;  3OIP A;  5K7Z A;  1PVE A;  3B02 A;  2Q2E B;  2P6S A;  5DS9 A;  3KEQ A;  4H4K C;  2IJL A;  2DBB A;  2XVC A;  3GTK J;  2TCT A;  1TQP A;  2ZNZ A;  4HG2 A;  5HNF A;  4XK4 A;  3UKG A;  4YII A;  1IRG A;  1LEA A;  3C1D A;  5EZG A;  2FOK A;  1FTT A;  2X1C A;  3C18 A;  2Q8K A;  4ZH4 F;  2LTP A;  5JLW A;  1MJA A;  3R0J A;  4BAC A;  3SEZ A;  2X9D A;  1K78 A;  4XLN F;  3DU5 A;  4I02 A;  2DJI A;  3BG6 A;  1YTY A;  2V7F A;  2XAF A;  3K4J A;  5TGT A;  4LB6 B;  4HA8 A;  2BY1 A;  2R7X A;  1B4A A;  2BY2 A;  2Z2S B;  1ONV A;  3J81 Z;  1TC3 C;  5J47 A;  2COB A;  2PMZ A;  2EFQ A;  2PMZ N;  4UHT A;  4BJT A;  1RUO A;  3ZRG A;  2KDZ A;  4A12 A;  3S3M A;  4QLC U;  3PIP F;  4UUS B;  3WU0 A;  3MD2 A;  1MKM A;  2QSG X;  2YSR A;  2R5Z A;  3M1C A;  2R7T A;  3H3Z A;  1RIO H;  3ASN H;  2HOT A;  2ZXH A;  1EA3 A;  4G8X A;  2DMU A;  1H89 C;  3LFK A;  1N78 A;  4NC8 A;  4Y15 A;  5FKK A;  2FX0 A;  4C2T A;  1BM9 A;  3MKZ A;  4ZYA A;  2R7Q A;  4G7Z F;  2PFB A;  2F5F A;  3ASO H;  2V9V A;  1RUN A;  2V9K A;  4XRM A;  1FBU A;  2R4G A;  3FMS A;  3BR5 A;  3GZN B;  2HYG D;  2MAB A;  5IPA A;  2KIF A;  4I98 B;  1OCO H;  5IY5 H;  3EYI A;  3G1L A;  1GXQ A;  5EDN A;  1XSV A;  4A3I J;  1VQM I;  2L0K A;  4GDF A;  1EH7 A;  3L09 A;  3ABU A;  2CW7 A;  3JTG A;  4IEJ A;  4G6D A;  1X3Z B;  3FXU A;  3H5A A;  2ECB A;  3IAS 2;  2VC0 A;  3DTK A;  4BEH B;  1A6I A;  4K2E A;  1ZH5 A;  3L1P A;  1Y8R B;  4QTR A;  5BNG A;  3JAM K;  4FHT A;  3CCV I;  2K7L A;  3QOE A;  1UG0 A;  1CF7 B;  1YW9 A;  5C44 J;  3KYC B;  1Z3Y A;  1XTA A;  3PIO F;  2DO7 A;  2CJJ A;  5FRN A;  1SD7 A;  2KKO A;  4A6E A;  3F9K A;  5E20 A;  4LLG F;  1YG2 A;  4A2U A;  2BY3 A;  3DXJ F;  5FLM J;  2OCE A;  2OAZ A;  1OIS A;  3Q0U A;  3DKW A;  4ENJ A;  5FKO A;  3F21 A;  2R7S A;  2XIG A;  2VPR A;  2DT7 B;  2Y0S A;  2Y0S N;  4LK1 F;  1HLV A;  4F55 A;  1I1G A;  2VUM J;  1Y0U A;  1IF1 A;  2KJB A;  2OZU A;  4XM3 A;  5TRD A;  3S2D J;  3Q9S A;  3E5U A;  4MQV A;  2IXS A;  1ETK A;  1XSX A;  1Z67 A;  5IYB J;  2V26 A;  3KP5 A;  1ODD A;  2O8K A;  2ESN A;  3NRV A;  3ZCO A;  2CV1 A;  1FBQ A;  3HRT A;  1P7J A;  1X1D A;  1BN5 A;  4M3D A;  3OS0 A;  4A3B J;  1N77 A;  2JN6 A;  5J1Y A;  2HKX A;  4FCY A;  2HVS A;  2M0M A;  5H6R A;  2ZKZ A;  2L9S A;  2IA0 A;  2O0Y A;  2M8G X;  2ADU A;  2EH3 A;  2HS5 A;  2ZXI A;  4XID A;  4HOB A;  1VQP I;  1EH6 A;  3HSF A;  1XDS A;  2JPB A;  2DQR A;  3QQA A;  1FYM A;  2F5C A;  3FK6 A;  2XUB A;  2JVH A;  1BIA A;  4IRG A;  3WTX C;  1Z0X A;  3K70 C;  2A5Y B;  2XKP A;  3FBN B;  1S7A A;  2O6G E;  3S16 J;  3MKL A;  2D1H A;  1Z21 A;  4ZYG A;  3R60 A;  3EUH A;  4PJN A;  1JTY A;  3PSI A;  2O7O A;  1VTN C;  1BR1 A;  2W85 A;  3I71 A;  3KEY A;  2P7V B;  1OQY A;  9ANT A;  2K9M A;  2COM A;  1T6S A;  3ERM A;  1YRN A;  2MSY A;  3CCU I;  1Z7L A;  2L5Q A;  4U7D A;  3DU6 A;  2GLO A;  2D1V A;  2GXA A;  1X1B A;  4R1H A;  2CFO A;  3CC7 I;  1P6R A;  2ISY A;  2VXD A;  1ZAO A;  1XMX A;  1U6G A;  4HEA 2;  5F04 A;  2W00 A;  2WY8 Q;  2OV7 A;  3HIF A;  2XAS A;  5BMZ A;  4M6Y A;  1WH5 A;  3GFL A;  4IRH A;  1J0R A;  2K02 A;  4B8X A;  2XRN A;  2WAD A;  1U0J A;  1FIP A;  1M1E B;  1YS7 A;  1LJ9 A;  1SD4 A;  2DOF A;  4L9J A;  1XPX A;  3PL8 A;  5CKT A;  1FMV A;  1T38 A;  4II3 A;  1USS A;  4IVN A;  2H94 A;  3H9Q A;  3I58 A;  3H3V K;  4BQA A;  4M3F A;  2ESH A;  3VSK A;  1Z1D A;  1MBJ A;  4LD5 A;  2P7C B;  3SZT A;  4GO1 A;  1WGX A;  3KP7 A;  2PBI A;  1XCB A;  2VBX A;  1JKR C;  3QOD A;  2P0W A;  2Z99 A;  4BYY A;  5JHF A;  2XF5 A;  2W48 A;  1HDP A;  5DUI A;  5IT9 K;  4V19 K;  2A61 A;  2L9R A;  3HDD A;  2DXI A;  1G59 A;  2E35 A;  1ON1 A;  4ABZ A;  1WJB A;  2L7F P;  2G9W A;  2V9P A;  2YX7 A;  4A6D A;  1FLI A;  1E3H A;  3GWZ A;  3KYD B;  5ICG A;  1U8B A;  1ZR2 A;  3ULQ B;  4XNF A;  3V4G A;  2IGK A;  3LST A;  1XX5 A;  3A1Y A;  4HV5 A;  2VN2 A;  4KIF A;  4M9X A;  4Q48 A;  3K6G A;  3DKY A;  2V6E A;  5GTI C;  2XSD C;  4L18 B;  2Y75 A;  2XAQ A;  4ZDL A;  3HSR A;  3H9J A;  3Q9V A;  2DCE A;  3V7R A;  1Z91 A;  2M8E A;  1W5C C;  4ITV A;  5DCF A;  3LA3 A;  1JKP C;  5A2Q K;  4HYE A;  3E6M A;  4DW6 A;  1MD0 A;  2DU9 A;  1ACI A;  4OMY A;  1IJW C;  3FKJ A;  4XSZ F;  3OS2 A;  4KT5 C;  1HF0 A;  3I55 I;  2Z33 A;  2XF6 A;  2X4H A;  2LBF A;  1FNN A;  2X85 A;  4KJZ A;  4F52 A;  4BGD A;  1SFX A;  1JT6 A;  2IBD A;  2W84 A;  3PQJ A;  3K9T A;  2L02 A;  4GRI A;  2LF8 A;  4JOM A;  4DZP A;  1SAN A;  2VBY A;  4XKW A;  1Y39 A;  2AHQ A;  4E7J A;  1YJW I;  2R92 J;  2HDC A;  3I0T A;  3I54 A;  4XOT A;  5J6X A;  2VXZ A;  3W2V A;  3P9K A;  2A68 F;  1D0Z A;  2X1D A;  5HDG A;  3C3W A;  4IPA A;  1MJ9 A;  5F0C A;  4WCG A;  1HW1 A;  1JJ8 C;  3NQO A;  2LNB A;  1DGR M;  3F23 A;  1K6Y A;  4A5M A;  3T1B A;  1D1C A;  1UB9 A;  2HKO A;  1RKW A;  3ONQ A;  1X1A A;  1IN7 A;  1MMS A;  1VQ7 I;  5IOY A;  4O6J A;  2VT3 A;  4KIT B;  2F5V A;  5FRO A;  2W7N A;  3ZQH A;  1H9G A;  3K4B A;  2NVT J;  1Z3X A;  1ZAR A;  3L2Q A;  1R6R A;  1MH4 A;  5CLS A;  2KT0 A;  2QCO A;  5J8F A;  2BBY A;  2OCC H;  4WX9 A;  2HOE A;  2VAS A;  4S0H B;  1BI2 A;  3ZQC A;  1H88 C;  1SVL A;  4HSR A;  1RET A;  1TWH J;  3QOP A;  3HOY J;  3VFZ A;  2M45 A;  1D5V A;  4HLY A;  1PYV A;  5M5Y J;  2LD5 A;  2F48 A;  4CH7 A;  3S32 A;  1K78 B;  2VPL A;  5BPI A;  1N25 A;  4NDL A;  4XLH A;  5E3M A;  2M4K A;  3MKW B;  2NNN A;  1JKO C;  3HXL A;  3HZJ A;  4XIC A;  1QVU A;  2Q1Z B;  1SAX A;  1YJ9 I;  1LB2 A;  3FBI B;  2XF7 A;  2GXB A;  2CMP A;  2IS4 A;  3OYI A;  1XSD A;  1LFB A;  2WA0 A; 
#chains in the Genus database with same CATH homology
 1VQ8 I;  2E36 A;  3CJT B;  3CC2 I;  1VQP I;  2E34 A;  1ACI A;  5DM7 F;  5DM6 F;  3PIP F;  1QA6 A;  3I55 I;  3CD6 I;  4IOA F;  1FOW A;  5GAD J;  3G71 I;  1YHQ I;  3CCJ I;  1Y39 A;  1YJW I;  5GAG J;  1VQ9 I;  2H8W A;  3CCR I;  1YJN I;  4UY8 I;  1VQ4 I;  1YIJ I;  3CCU I;  5GAH J;  1VQM I;  5GAE J;  1FOY A;  3CC7 I;  3G4S I;  3G6E I;  3CME I;  1YI2 I;  2ZJR F;  3CCV I;  2ZJQ F;  4IOC F;  2FOW A;  1MMS A;  2K3F A;  1VQ7 I;  1HC8 A;  3CCL I;  3CF5 F;  2ZJP F;  1VQ6 I;  1VQK I;  1FOX A;  3PIO F;  3J7Y J;  3CC4 I;  3DLL F;  1VQO I;  2OTJ I;  1VQ5 I;  1VQN I;  1YIT I;  3J7Z I;  5JVG F;  2QA4 I;  3CCS I;  2JQ7 A;  3CMA I;  3CCE I;  3CCM I;  2NXN B;  3I56 I;  4V19 K;  4IO9 F;  2E35 A;  2QEX I;  2OTL I;  1YJ9 I;  1S72 I;  3CCQ I;  1VQL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...