3PIOF

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3pioF00
1VQ7I 1VQ9I 1VQ5I 1VQNI 1FOWA 2NXNB 3J7ZI 3I56I 2H8WA 1YITI 5GAGJ 3PIOF 2K3FA 1VQMI 5JVGF 1VQ4I 3G6EI 1ACIA 3G71I 3CF5F 3CCEI 3CCMI 2E36A 3CCRI 1YJNI 4V19K 2ZJRF 1HC8A 3CC4I 3CCJI 1FOXA 1Y39A 1YHQI 1S72I 2JQ7A 4UY8I 1VQ6I 3PIPF 3CMAI 3CMEI 1VQ8I 1VQKI 3I55I 2QA4I 3CC2I 1VQPI 2ZJPF 1MMSA 3DLLF 1VQOI 4IOAF 2QEXI 1VQLI 3CD6I 3CJTB 3CCUI 1YI2I 5DM6F 2ZJQF 1QA6A 3CCLI 2E35A 3CCVI 1YJWI 4IO9F 3CCSI 1YJ9I 2OTLI 5GADJ 1YIJI 4IOCF 3G4SI 5GAHJ 5GAEJ 3CC7I 1FOYA 2OTJI 2FOWA 3CCQI 2E34A 3J7YJ 5DM7F
chains in the Genus database with same CATH superfamily
1KONA 4GCVA 1JHFA 1MGTA 3VB2A 5K7ZA 4UUSA 3L00A 3H5RA 1T2KA 3ZMVA 3CCMI 2A61A 3F3XA 2IVMA 3IKVA 1KYZA 4EQQA 1FP2A 2HDDA 1Z0XA 2OAZA 1JXSA 2HPMA 1YX5A 3A4CA 5HLIA 4R1HA 2ETHA 2RQPA 3OYFA 3JTHA 5JR3A 2BYVE 2QCOA 5E3LA 5D5UB 5HLHA 1QZYA 2F6CA 1MBFA 3KP7A 2Z3YA 4L5IA 4AM3A 3I56I 1AU7A 5AONA 1E3OC 1V5GA 2BXYA 1V55H 3RYPA 2NNNA 2MH9A 3DQVC 3WE2A 3QYBA 4Q47A 4N0BA 1B9NA 5FB2A 1ERDA 5EG0A 3TGNA 3DLLF 2FNPA 1Z7UA 3QYEA 5LRSA 4LK1F 1MBEA 3OOPA 5FRNA 4DBQA 2PMHA 1V54H 3JREA 4KT6A 4BEHB 3GTGJ 4BXFA 3FXRA 3LSGA 1G4DA 2ZMEB 2HNHA 3FDYA 3W6JB 1MKMA 2Z16A 4OINF 1B59A 2KIUA 3V42A 1HSTA 1BI1A 1WHUA 2HKOA 3O6BB 4DQ2A 5LEKA 2H1KA 4OIQF 3LSTA 2VPLA 3K4CA 2M87A 2CV0A 1HW1A 1OQYA 1ZR2A 2OPTA 1S7EA 2FMLA 2JZYA 1EV7A 2QWWA 1MSFC 2VIXA 2XF6A 1KYWA 3F8NA 2L02A 3QQAA 4LLNA 1TL8A 3QU6A 4MTEA 2PFBA 3OYCA 3BJ6A 4M6VA 3E5UA 2ZXWH 4ZZLA 2P7VB 1UCRA 5JLWA 2R5YB 2XC7A 2MH2A 2ZKZA 1AOYA 4UV8A 3CCEI 2E2IJ 1K6OA 3CCJI 2HWVA 4MNUA 2VLAA 4PJMA 3PFIA 1XMAA 4XLCA 4ASNA 4C2UA 1K83J 3TL4X 2BV6A 2LSOA 1MNMC 3UR3C 2PQ8A 5D6EA 4DJAA 5FLXZ 5CQEA 2I8DA 2IPQX 3KP5A 2DK5A 2IA1A 4IRGA 2CQQA 2Y0MA 1IJWC 4AD9A 2DA3A 3A03A 3ZMSA 1OCOH 1XGMA 5J1RA 1X58A 3JRAA 3HUGA 2P4WA 4IQJA 1R6RA 4C3JJ 2G7UA 4KIBA 1TNTA 2GIVA 2X9DA 4HBLA 4G7ZF 2MC4A 2WAFA 2FEZA 5K7FA 1KU9A 3Q3SA 3OS1A 5D5WB 2CGPA 1L0OC 1TWHJ 1ZRDA 4A3LJ 3I59B 4C30A 2Q2EA 4Q5SF 3PL8A 3P9IA 3TP0A 5HDGA 3O2PE 3IWFA 2CW7A 2EZHA 2P0WA 1UHSA 1NK2P 4E7ZA 4BQNA 3HB9A 4O5VA 1R71A 3DU6A 2HZDA 4I99C 4PSXA 1STZA 3RYRA 1AKHA 5DDGA 2ZO4A 3ZGKA 4MLOA 1W7PD 2H8WA 1YFHA 2WC2A 3F8BA 1P4AA 2ZNZA 3TW6A 2COMA 3IUOA 3DEEA 2JSPA 4EM0B 2IJLA 1D0ZA 3WU0A 1ON2A 5F0CA 1A35A 3L2WA 1DQUA 2K5CA 5HNFA 2NOGA 2CQKA 2X1EA 1VI0A 5HS7A 3EDPA 3IKTA 4P9FA 4DOZA 1R22A 5F08A 1ZKGA 3WG7H 4CYCA 1NK3P 2WY8Q 3GTPJ 1MBJA 1U5TB 3BR0A 3HBLA 3PSIA 5FKOA 1LKXA 1XX5A 3SJMA 1TZLA 1HA8A 1GV2A 4M73A 4XSZF 2RVCA 5EG0B 2WB1A 2HGCA 2AHQA 2O8XA 3HSRA 1OCTC 4K2EA 5E1ZB 1SMTA 4W97A 3JR9A 2EFWA 1IN8A 4HQEA 3GTLJ 3CCSI 2W85A 4MEXF 2OF7A 1MNEA 3MFKA 3HG9A 2DFEA 4YEJA 1P7JA 2DA7A 4N4NB 1GDTA 2VJ4A 4XL9A 1MNDA 1JKOC 1FOXA 4ETSA 1LUJB 2A68F 1H9TA 1DP3A 3WODF 3NWTA 3SDBA 4KT5C 1RRJA 1A04A 2F5VA 4I7HA 2MGQA 4KA4A 5BPIA 1FY7A 3CUOA 3TDZC 1Z21A 3G3ZA 1YI2I 3U1KA 4G7HF 2R7XA 1B72A 3KEOA 2XSJC 2CQXA 2NOJB 2D1VA 3BLYA 3ONQA 4XLHA 2AQFA 4WXDA 5FLXK 3HSFA 2LR8A 4KIFA 3WHBA 2STWA 3NRVA 4HZFA 3ABUA 5JHFA 1JT0A 4R8HA 3OY9A 3D0SA 1R7JA 4MEYF 4A3KJ 4BE2A 2LRDA 4HX7A 1SFEA 1UG0A 3KPHA 2XAFA 2DQRA 3I54A 3E7LA 3ZMZA 1F9NA 3HXLA 3DTEA 4EJTA 4HQMA 4I01A 3ESWB 2GA2A 2VT2A 3ZQHA 2JSCA 2W4SA 1WQ2A 4CCJA 4A3JJ 2L5QA 4ABZA 1X4PA 6PAXA 4XOPA 1HCRA 1UFMA 3K1MA 1HW2A 4LG3A 5D4SA 2PMZN 4RA2A 1ZELA 2DMUA 4UY8I 1GUUA 2VL8A 4QTRA 4XNFA 2IBDA 3S17J 4ESJA 3CF2A 3DPLC 3OYEA 5JHUA 3TO6A 2IEKA 1NHAA 1OCZH 3BCBA 2KIMA 4KITB 5IP6A 3TOAA 3K4JA 1PJRA 1T08B 2O6GE 1RZ4A 2XPVA 3I71A 4NC8A 4EJVA 2X6XA 3WTTC 3K4LA 5GAHJ 3EUAA 4PJLA 4NHJA 4L0ZB 2VPRA 1B1BA 3G1MA 5BPDA 2BY1A 2W24A 2ME0A 2VOPA 3LFUA 3HOWJ 4ZJZA 1YE9A 3HOVJ 2JN6A 1MJAA 2E19A 2CWEA 1YS6A 3CZ6A 2FX0A 2X85A 4V2FA 2WAEA 4NUBA 2R7UA 1HDPA 1OLTA 2W1OA 3W2VA 1T98A 4II2A 5GADJ 1MW7A 4EEFG 3QPTA 3JRFA 4IKFA 2XIGA 5D8LB 4CXFA 4E7JA 1LDJA 4LG0A 1DPRA 3CUQA 1GVDA 2K3FA 3K2AA 2FBKA 1YS7A 3Q9SA 5JFRA 5EGOA 1ZLKA 2KKOA 3I5UA 2PJRB 5HDNA 4N9HA 3H0DA 1WCMJ 2JA5J 2BY0A 4HYEA 3E6DA 3I0TA 5HLTA 3MKYB 1VQKI 3HHGA 3W2WA 1D8JA 2W00A 2LG4A 2O61A 5JLXA 2CS3A 4ZTJA 4A2UA 2F5EA 2CMPA 2TRTA 1U3EM 2NVQJ 2VBYA 2RAEA 3HPGA 2RV8A 2XRLA 1D3YA 5FKNA 3ECOA 2JUGA 4HPQA 3F8MA 1ULYA 3IRRA 3MMYB 2VQLA 4MHGA 2HR3A 2JWTA 3ROUA 5L3GA 4UV9A 4HSTA 4RGXA 1F1ZA 3NEUA 4L5EA 2KJCA 2HXIA 1BR1A 3WGHA 4CCOA 3AG2H 1ZR4A 1QRYA 5IOZA 1Y6IA 2M8EA 4V2GA 3DTIA 2PBIA 3FZVA 5F1RA 4HF1A 1D0YA 4UB6C 2VKDA 3RIRA 4CCNA 1QBJA 4OAYA 3CCLI 2VJ5A 2FBIA 2W82A 5D5XB 1HKTA 3CJNA 2HEOA 2E1MC 2GOXB 3WGIA 1D1AA 2KRHA 2Y9YA 5IOYA 3JRBA 4Y17A 3I9V2 3Q5FA 2K40A 2DMQA 3IAM2 4F3QA 2BEOA 2E36A 2LLKA 3K4KA 3P5JA 4FT8A 2DN0A 3K1NA 3GMEA 4PDKA 4R79A 1I6HJ 3GYHX 4DBRA 5EZHA 4ZTFA 3GFMA 2K85A 4DZPA 2BHZA 1QU3A 2OUMA 4LJZF 3A02A 1WRJA 5KAFC 2EBIA 1HLVA 5CVIA 5LRRA 2IS1A 5ICCA 1IRFA 2CUFA 4BGDA 2ZMEC 4E7SA 3MZ8A 3CDLA 3FX3A 3KP4A 1WJDA 4FISA 3M8FA 2K9MA 2KPMA 4EM2A 2RNJA 3G6EI 2B7EA 2VBXA 2VC0A 2E71A 5KNLA 3I64A 3LSJA 3E97A 1V5EA 2EINH 3PIPF 1FP1D 4GYIA 3HRSA 1UJ8A 2DO7A 2ZJPF 4B1RA 5FKLA 3I4MJ 2XGXA 1SVMA 3P7NA 3W6KB 2E1CA 2ECCA 1YJ9I 1BC7C 2DA5A 2DTRA 1MBHA 1T39A 2Y69H 1IO2A 3LA2A 1OCPA 1FPQA 1X19A 3DP7A 3I4PA 3VYTB 1WSUA 2KMUA 3KZIC 3HOTA 2JTVA 4ENNA 2ADUA 4HV6A 2O3FA 1SFXA 1E3PA 3RKXA 1P4WA 3W2AA 2M5WA 3OL4A 4EJOA 2OZUA 3ULQB 3VODA 4GGGA 4PJ0C 1QQIA 4BJ5C 2XF5A 4QLCU 2OU2A 3M07A 1OPCA 4E7KA 1VQPI 2ID3A 4KNYA 4KUMA 5H20A 4HAMA 3V8JA 4GFBA 2LY1A 2EA2A 1DUXC 4EJWA 3CLOA 4BHCA 4BACA 1YQAA 3L2CA 1VNDA 3J7YJ 2R0QC 2KIQA 2VUMJ 4ZZDA 2BBYA 1KGSA 1JGGA 3BR1A 3GTQJ 4RGUA 1S8NA 1HC8A 2HTSA 2GXGA 1C0WA 4ZYAA 5LEJA 2MSYA 2XAHA 4FQGA 3GX4X 2L54A 3MKZA 2DOEA 2RQQA 2DJNA 1DGRM 3QAHA 1YX3A 2NYXA 2EIKH 2ZCWA 1PUFA 5FFXA 5DEQA 3IV5A 4KMFA 1BI0A 2OBPA 1WVRA 2X1CA 2L0KA 4IO9F 2Y31A 2R7DA 1J5YA 3UNGC 1ZG3A 4YFXF 2H6CA 4U0VA 1B8IB 1O7FA 3FK7A 3M9AA 3KX2A 4W1UA 3S1RJ 4CDGA 3K10A 1SAUA 1RR8C 1HW5A 1O3SA 3ZOBA 5LHHA 2HVQA 1UAAA 3GLLA 2HQNA 1Z67A 2L4MA 2P7CB 4KDPA 1SVLA 3RPQA 2J5PA 2F48A 2EIJH 2IAIA 2FMYA 1V4RA 1ETKA 2LNBA 1IXCA 4A3MJ 2W57A 1TQIA 1WJ5A 2DU9A 3G4SI 3FXQA 3KZZA 1S9HA 1O7LA 1BW5A 3ZMUA 2XAUA 3R0AA 2GLOA 3IH3A 1PVEA 1RI7A 5DS9A 1YIOA 2AQEA 1ZARA 3F6VA 1BIBA 1BR2A 1SMYF 2ZXIA 3BTIA 2FOKA 3SFIA 3HOYJ 2CRGA 4BE0A 1ETQA 1VQ8I 5J8FA 5K5OA 4ZDPA 1LFBA 5FROA 4ITVA 4XQFA 4XBFA 1Q1VA 3BWGA 3RTRA 3KP6A 3QP5A 5ILUA 2OJED 3FMSA 4JBAA 3JSPA 5L3CA 2VKHA 1YRNB 5IT9K 1IXSB 2PMUA 4ZYHA 3HYIA 5CVJA 4H4KC 3AL0C 4BNCA 3OYJA 2CU7A 4CZZA 2EV0A 5IP7J 3HRUA 1EH6A 2GXBA 4DIQA 4BEHA 3S1NJ 2EZKA 3AG1H 3CC4I 2WV0A 2YSRA 3C1DA 3PJRA 3OSFA 5J47A 1WWXA 1KU3A 2IGKA 4RMNA 2XGCA 3WU1B 2VE8A 5L3BA 2CV1A 2M34A 2K4BA 5BNGA 3OIQA 5K1YA 3H5NA 3DKYA 1YYVA 2M30A 1W1WE 2VQGA 2VONA 4CCMA 1V3FA 2M2EA 1QGPA 3AL0B 2DCEA 1W0TA 2X4HA 3CO7C 4C2TA 3MD2A 1Q1HA 1HDDC 1WZ2A 2IS4A 4LIVA 3L2UA 3I55I 4AIJA 2HXOA 2DBBA 1QO0D 4GRIA 2BHYA 1D5YA 1H89C 2LDUA 1UMQA 5E79C 3VDXA 3HOSA 3CC7I 4S04A 2K9QA 3I53A 4I09A 3L2RA 1XGOA 4UUSB 1FIAA 3BG9A 2ZMEA 3GW2A 1Y8RB 3TEDA 1D1CA 1IRXA 1FSEA 1U78A 3OS2A 4X0GA 2A5YB 2M8GX 4F52A 3K6GA 3GTJJ 1YHQI 3WTXC 3E5QA 3O8HA 2KRFA 3QOEA 2LK2A 3D5SC 2OQRA 1SC7A 2PMZA 4ENJA 4PFOA 3CCVI 3CUQB 3ERED 3V7CA 5TRDA 4XLFA 2DMPA 1IRZA 2N8GA 4YRVA 3SXYA 2DAOA 4I6ZA 5AIPA 4LB5A 4KISA 1RESA 3HHHA 3HRMA 1T56A 4FX0A 3D1NI 5DCMA 4BDYA 1VQMI 4BQAA 4A3GJ 2QF7A 3ZCOA 4L9NA 2JA6J 4I2OA 1VQ6I 2VQHA 3FIWA 1E3HA 3HTUA 1W5CC 2V26A 1RPWA 3JRHA 4OAZA 2K3PA 3H36A 3O8GA 4IXAA 1L3LA 2ZSIB 1R5GA 1VQLI 1Z05A 1R4MB 3SEQA 2EIMH 2ZC2A 3RI4A 1YJWI 1TW3A 1WJAA 1ZGJA 2ZFWA 4NDLA 1FTZA 3BC8A 4RLFA 1O3QA 3H1CA 3CP2A 2M9HA 2TCTA 3S3NA 5EZGA 4IHWA 1HQCA 1BIAA 1YW9A 1IGNA 2K9SA 4HW0A 2E60A 5LD2C 4IHVA 2AXTC 5E3MA 3CF5F 1X3UA 4WWCA 3V8KA 2NS7A 1O3RA 3T1BA 1Z6RA 1OYWA 2ZNYA 3PNTA 4HF0A 4HDVA 4OWRB 1V5FA 2Q1ZB 1K78B 1MMSA 3I3LA 1T8IA 1CQTA 4OMZA 2DXIA 3JAMZ 3OYKA 3IH2A 1ETYA 4JX5A 2ZB9A 1JKPC 1AWCA 2HKXA 1BN5A 2LOOA 4XSXF 4J19A 2V9PA 3B6CA 2MD5A 2O5RA 4A69C 2LBFB 2FOWA 1IDZA 1DP7P 1USTA 2HDCA 2DQLA 3AFHA 4ENMA 4Y13A 3TO9A 1XTAA 3N97A 5C4XJ 2DI3A 3H9QA 2D1HA 3V7RA 5JVGF 2QQBA 3DCFA 3L2VA 1RUOA 1IUYA 3HEFA 5HODA 3FWEA 1A36A 1BBYA 4I76A 3BQZA 5EGOB 4IVNA 4D9JA 1W36C 2PJRA 2QQAA 2V79A 4ZH4F 2VBZA 3GCMA 1T33A 5GPCA 4RM2A 1XDUA 4F7ZA 4YELA 3KEQA 4HG2A 4RAZA 4Y15A 3A01A 5BOXA 2NNYA 3S32A 1IF1A 3QP6A 2EFQA 2ICWG 4YIIA 4HSRA 4Y52J 2B63J 3H3UA 2FUG2 3BDDA 4L0YB 2L9VA 4F93B 3FXKA 2R7TA 4BJTA 3I4NJ 1B72B 1DU6A 5J40A 3D5LA 3DBRB 4LFUA 2A6EF 1U8RA 3J81K 4HEA2 5GPAA 2D2WA 3LQQA 3DLAA 4LB6B 4KJZA 3M4OJ 1KA8A 1ODDA 1JJ8C 4XICA 2E5NA 5IT3A 2GOMA 1SVOA 3OWTA 2WY7Q 3A0BC 3CDIA 3BP8A 4XLNF 2DT6A 5HS8A 1Y1WJ 3RZOJ 2R7FA 3L09A 3O3KA 3VYSB 3TMOA 3CO6C 1GXPA 1LNWA 5J1UA 3S2HJ 2LKXA 3FF5A 1K4SA 4BQQA 2UXXA 3IC7A 4G8XA 4UUVA 2ZJ2A 4E70A 3VSKA 4Y3OA 4F55A 4WK8F 2KHMA 2E1MB 2C6YA 3LAPA 3E1SA 2E1OA 2QSFX 1ZTRA 1GLNA 2R3SA 1FC3A 1OCRH 3CESA 1USSA 2KLOA 4FCYA 2E2JJ 2DTZA 1JKRC 5F64A 2XB5A 4E7HA 1LVKA 4XLAA 3F23A 2IGOA 1HXDA 2OTLI 4GO1A 4E7LA 3PNVA 1FX7A 3J80Z 1J7KA 1JT6A 2CV2A 3IHUA 5D5VB 2BY3A 1VQ7I 5E3OA 4XLPF 2LD5A 4PJJA 2HI3A 2E7WA 4AYBN 3J7AY 3MN2A 5J4YA 5A2QZ 3OS0A 3L2QA 2YPRA 1FNNA 3ABTA 2QLZA 3EUHC 3ERMA 1LFPA 1O3TA 1J2XA 3LWFA 4B47A 1XDSA 2WTEA 3BR2A 2ISYA 3FMRA 3H35A 3E6CC 4AYBA 4XK4A 3DBHB 4PGHA 3CD6I 1GV5A 2EFNA 4N4OB 2E7XA 5GTIC 3PO3J 1IC8A 2R5ZB 3FXOA 3LNQA 3WTZA 3OYLA 1JTXA 1IDYA 1FEXA 2FXAA 2E5ZA 4G6DA 1FLIA 1R00A 1EA3A 1F36A 2H8RA 1SD4A 2P5KA 3ZN1A 1Y39A 3KLOA 2FA5A 4XKWA 3SYTA 4O3MA 3HRTA 5E18F 3HOUJ 2V9VA 3ASOH 3OYBA 2V6CA 3BPXA 4RAFA 3GZNB 5E8GA 3S2WA 1Y1VJ 2JK3A 4M6YA 2R7ZJ 3ISPA 2GXAA 1YIJI 2LBFA 3WGGA 4Y4RA 1UHWA 1K78A 5DTDA 4P55A 4M6XA 1U6GA 2KJBA 2X6YA 5EDNA 2JA7J 4XIDA 3OOUA 4C2MJ 2V1UA 1KU7A 3MZHA 3KFWX 2EK5A 5M5WJ 2PEXA 2DFIA 2KRCA 1LFUP 1XCBA 1R5HA 1ZGAA 2XKPA 3LSIA 2XPWA 3ML6A 2NVXJ 4CGZA 3ZMDA 1FSHA 1BC8C 4PSWA 2EV5A 1R49A 2DW4A 1MZBA 2EWNA 1EKEA 4MQVA 1X3WB 4E6KG 3S3OA 1OR7A 3FXLA 2L7MP 3EYYA 2X51A 3P9CA 5LHIA 1PYVA 1UHMA 2DT5A 4DYCA 1N25A 4RB2C 3BZCA 3ASNH 3OIOA 2CQNA 1EF4A 2RDPA 4YFKF 2L01A 4B3AA 1W5SA 1DGWY 3CP8A 3VYRB 3NAUA 4LD5A 1JE8A 3E3VA 4IHXA 1WI9A 2L9NA 2DLLA 3MQ0A 1JTYA 1T95A 4XRFA 1MSEC 2XAJA 1IV8A 2I5UA 2R7RA 2NAZA 2PI0A 5FJ8J 4WXCA 4XOTA 3J7ZI 3DV8A 1VQ4I 4ESBA 5F1JA 2WWYA 2EILH 1BM9A 2Z9OA 2DOAA 2Y30A 3LSRA 2STTA 2NVYJ 4FX4A 3JRIA 2L4AA 2RC4A 1WJFA 1OCCH 2WAQN 5KK1A 5FKKA 4AVPA 4IHYA 2QBYA 4S05A 2PJPA 2IW5A 1G6NA 1TWAJ 4OU0A 4U0WA 4BXUA 5C44J 2OA4A 3DXJF 3RZDJ 3ZQCA 1SD5A 5TGTA 3J7AO 4M72A 2QYOA 4P5OA 2KDOA 5F0HA 4BXXJ 1RR7A 1JUPA 2M0CA 5EEAA 2Z33A 2XB0X 2DODA 2HVRA 2NRAC 1VQOI 3VPRA 5LBQA 3ZRGA 3OYMA 2K9NA 4C3IJ 2VBWA 4C9YA 2JVHA 2XPUA 3RKYA 3HC7A 1KQ9A 2FQ4A 2Y9ZA 5FLMJ 1QPIA 5IT9Z 4G6QA 3C18A 3Q0UA 4RB0A 4IF4A 5H2FC 2ELHA 2X6WA 4HLYA 4AIHA 3DTKA 5ICFA 1H88C 2V7FA 2R93J 4CCLA 3CUQC 4BJ6C 4FETA 2XUBA 4HRIA 2DK8A 1ITYA 2MA3A 3H9JA 1G3YA 1X2MA 2VASA 2EZLA 1FYLA 3HSEA 4A5NA 3ZP5A 5DM7F 1VQ9I 1FOWA 3LSMA 4AC0A 2KZGA 2HYFA 5BQTA 4EGYA 4LOCA 4ZYGA 1I1SA 3GWZA 1P92A 4WF2A 3ZQFA 3K4NA 4RAYA 3KEYA 1S7AA 1WI3A 3F0CA 4LMYA 3SZTA 5HOOA 4FE4A 2COBA 2L2OA 4LIUA 2XSDC 4OMYA 4FE7A 3ZMTA 4XMYA 4ZDOA 3AG3H 1FJLA 4EVIA 2AS5F 1WH5A 1XMXA 2WBMA 4AWXB 4WCGA 2MG4A 1J59A 2BY2A 2DA2A 3C7JA 2X6OA 5CQGA 2XVCA 2G9WA 3RQIA 1ZG1A 3GUDA 1FBQA 3ZQIA 2HQRA 1U9OA 3G2BA 4G12A 1BOBA 4OOIA 3UKGA 9ANTA 1F43A 1ETVA 2BE5F 2P5VA 4RLQA 2XASA 2YUSA 2O0YA 4BL0B 3BTCA 4B09A 3SHFA 4MFEA 3R6SA 2VB6A 4M71A 1UELB 3FBIB 3OYGA 2BVMA 3JRDA 5DD8A 2VQCA 4D5CA 2MC3A 2F5DA 2DA4A 2Z1DA 3L7WA 5B1BH 3R60A 3MCZA 4A6EA 3PO2J 2HOEA 3EETA 3OYDA 2FSWA 2QA4I 4CUGA 2D5VA 3IP4B 3CJRB 5LGUA 4RB3C 1I39A 2LKPA 4ENKA 3QWLA 4PCQA 1I6XA 1N77A 1U5TA 2HYGD 1POGA 2JPCA 2DA6A 1R36A 2JMWA 2RN7A 1BOAA 1FOKA 3Q0VA 4PUSA 4ZYEA 2LREA 1BJZA 4KN7X 3PIOF 4X6AJ 3FM5A 2CH0A 5B66C 2VN2A 2IS6A 3A01B 2YR2A 3ZXSA 1QPMA 2P81A 2CO5A 1UG2A 1NG6A 5F6FA 3I58A 1YOVB 3G73A 4GDFA 2DFFA 2CYYA 2VI6A 1B8IA 5J3LA 2LC2A 3V4GA 4XN3A 4IOCF 2BW3A 2G7HA 2F5CA 3K4BA 3IRQA 2BXZA 2Z99A 2MD0A 4CO8A 2YX4A 1TC3C 4JX4A 1ACIA 3WTSC 1T38A 3EQLF 5KVRA 2K9LA 3JW4A 3QODA 2QBYB 2VODA 2CFOA 3BTLA 5IYDJ 2W84A 4NQWA 2H1LA 1Z91A 3RQ4A 4DNCA 2A07F 2HFHA 2JVGA 1GVJA 2DMTA 2E1NA 3R4KA 4B4CA 3QRFF 3GTOJ 2O03A 2HU9A 1TBXA 3VEPA 2L3DA 5H6QA 3F8CA 1S3JA 1G8XA 3GVAA 3ZQ7A 4Q4ZF 2M4GA 2V1XA 3ABMH 4EGZA 3WHCA 2O7OA 2DFHA 3VFZA 2Z2SB 2QQ9A 1A5JA 2KIFA 1Y8QB 4ANJA 2B9SA 2IT0A 2YU9J 4D7NA 3ELKA 1O4XA 5FKMA 3M8JA 5LLQA 3K4MA 4QWQA 5CKTA 2CSOA 4CZCA 4U88A 4HV5A 4KN4X 2F4MB 2YX7A 1WJBA 1Z6TA 3BG6A 3AKZA 1SFUA 1ZH5A 4J00A 4XONA 1JI8A 2R5YA 3ABKH 4LLLA 2MLKA 1FOYA 3CCQI 4XKCA 1XGSA 3BR3A 1RKTA 1MMNA 3RKQA 4MTDA 2OQGA 1Y0UA 2DOFA 1YG2A 4ON0A 3W6VA 1FBSA 2KT0A 3ZR8X 2YU3A 3H0GJ 5GTHC 5ICEA 2XHKA 4AU7A 5EJCA 3REOA 5E17F 2R7OA 1JUSA 4H0EA 2JUCA 2BOLA 1XB4A 2RGVA 4LK0F 4PGGA 3OYHA 1QA6A 4HNTA 2XF7A 2FNAA 3GEZA 3EYIA 5F04A 2V1NA 3BOQA 4QIWN 3JRCA 1XSDA 3TW7A 3S16J 4PJNA 3RKWA 4U87A 1SFOJ 5KHDA 1NTCA 3HM5A 1FBUA 3NQOA 2VKVA 1XCVA 2OD5A 5A2QK 4HOBA 1S72I 3OMYA 3K7AJ 4II3A 2DPDA 1OMIA 3KIOA 1N75A 3P9KA 3TKYA 3WTYC 1ZAOA 5AIQA 3OSGA 2A5WA 3SZGA 3TBIA 5HNHA 1YTYA 2WV1A 4TV7A 5B3SH 2HQ5A 3G1OA 2FJ1A 3GXOA 2PN6A 4B48A 3BY6A 2LP0A 3BQYA 2LY9A 3DBLB 2XGDA 5CVUA 3F72A 2VKEA 3HOXJ 2EPFA 3K70D 1RETA 5GAGJ 1R1UA 2HTJA 1LDKB 5M3MJ 3GF2A 1YJNI 2ZSHB 3HKZA 4LLGF 5DV5A 3PSFA 2JA8J 2XROA 3T5XA 4UNOA 1I1GA 3C3WA 3TQNA 1DU0A 1ETWA 2EFOA 4A3BJ 4P9UA 3BR6A 3FM3A 3OL3A 1M1EB 2MLGA 3OR2C 4D7MA 2XAGA 3RPUA 4XLEA 1HSJA 1WPKA 2LYCA 1JUMA 4PK4A 2DJIA 2ZXJA 4BQOA 2LY2A 4HNVA 1H9GA 2QZ8A 2M3AA 3LOCA 3DF8A 3DU5A 3F21A 4JK1X 2ME6A 5KCMA 4B43A 2LF7A 1AA7A 2DDAA 1ONVA 1F5TA 1PP7U 1ZRCA 3SZPA 4WX9A 3EPZA 3S8PA 1YW7A 3M1CA 3M1EA 4DZJA 2CW0F 4BY1J 4A3FJ 2M1BA 4XM3A 5B5EC 1QNTA 1H8AC 1JJ6C 3HDDA 4IZZA 1X1AA 2P6SA 2MYSA 4A5MA 3LSHA 4UVAA 1I5ZA 4XRMA 4KMUX 2L9SA 1LE8A 3KYLA 2VOOA 2GM4A 1QZEA 4HX4A 1IAWA 3ZPLA 1YLFA 1NG7A 4Z6YA 1OYIA 2NS8A 3M8EA 5IYBJ 4GYGA 3KP2A 2KL4A 1HBXG 4XKBA 1R1VA 3ABLH 2NVUB 2FE3A 3R0JA 5L3DA 4AIDA 5DUIA 1S5LC 2HS5A 4BBRJ 5K7HA 4UXNA 3S93A 1BR4A 4M3FA 2QENA 4HLXA 3MKLA 1R1TA 1PP8F 4M9ZA 3GFLA 1IG7A 3R61A 4RGSA 1P7IA 4ESFA 2MW8A 3PQJA 1K4TA 1I27A 5DCFA 2V6EA 3U2RA 5J1YA 3KE2A 1R5ID 2M7AA 1FIPA 1Y0NA 5EYRA 4A3IJ 4L9VA 5KAIC 2RKHA 5TISC 1ZG5A 1PDNC 4WXHA 5LGTA 4IJAA 3BG5A 1KQ0A 2VC1A 3F9KA 3TP3A 2FF4A 3RSNA 2X1DA 1R23A 3DWLE 4OIOF 2UWMA 5EEHA 3CCUI 2QKLB 3LSKA 1MD0A 3HZJA 4HA8A 4I0AA 1R4NB 3QPSA 2EV6A 2EB7A 1XSVA 1X1PA 4IEJA 1G3SA 4DW6A 2H6BA 3W3CA 5LHGA 2QSHX 1FWZA 4BUPA 5L3FA 1A6QA 3HGYA 2L7ZA 3COAC 1F4KA 1TNSA 3K2ZA 1RC9A 1JHHA 3CQZJ 4U7DA 5HS9A 1CF7B 1RUNA 3H3ZA 1QVTA 1Z3XA 4M9SA 3JAMK 1JGSA 1ENHA 5M5YJ 4D0PA 5BS6A 4NC6A 4CYCB 2F2EA 4BHBA 1KU2A 2M45A 1TT5B 5M5XJ 2P5LC 4LGWA 4ZDLA 4IQ4A 2XV4S 4M74A 4L18B 1T0FA 2M0MA 2IP2A 3LMMA 2CFXA 2OTJI 2QUFA 2NS0A 4XN0A 3LL7A 4HNUA 4IPAA 4RBOA 3BZKA 2BW3B 2ZJRF 3PUFA 3GBGA 1HKQA 5C3EJ 4MIMA 3CMAI 3CMEI 3QPLA 1APLC 3K70C 3JRGA 2O8KA 2UXNA 4BKXA 1DPUA 4XRSG 4E7IA 2HOAA 3B73A 1ZLJA 4IRHA 3C2HA 2ZJQF 3FXMA 2AXLA 2IRFG 1G3TA 4L5JA 3JTGA 2JA2A 2QM3A 3D5RC 5E20A 1U0JA 3KCCA 1A31A 2W7NA 5HVQC 2LH9A 1BW6A 3K9TA 3VOEA 3TDUC 4A3CJ 3JCUC 3X2QH 3F22A 2Q2EB 1W0UA 4UHTA 3T8TA 1IZ1A 5FFZA 4UB8C 1IUFA 3S1QJ 3V7SA 4KIGA 1X1BA 4BE1A 3LQRA 3NWSA 4JYKA 1CF7A 4HX8A 2ECBA 4HF2A 1TP4A 2HVSA 3GZ6A 1TTYA 3AAFA 1YO5C 2J5OA 3GFIA 3HUGB 3KP3A 3BCAA 1FMWA 1WFXA 2RREA 4NNJA 1GT0C 5J6XA 2EZIA 1ZQ3P 1Z7LA 3CTAA 2UUZA 2LMDA 4ZC3A 5K5RA 1HOMA 3DPUA 5HDKA 2OC6A 1G3WA 1WKMA 1N78A 2VXDA 1OJLA 3CCRI 2CJJA 2W25A 1B6AA 2R7WA 5FRMA 5EF6A 2OCEA 3FISA 4PZJA 3KYCB 3OYAA 4NC7A 2ELKA 3HKZN 1HKSA 2Y2ZA 4EATA 4NBQA 4YIRX 1IW7F 2XRNA 1LVAA 1AKHB 1ORKA 1VF9A 2GAUA 4G9YA 3U9GA 2WADA 2K7LA 2P8TA 5EEGA 5J4VA 2Y0SN 1E2XA 2HOTA 1D0XA 2K4JA 4FHTA 3SFZA 5D6FA 5ILVA 1P2FA 2KFDA 3RCOA 4Y33A 2EJRA 1LPQA 5TJJA 1YW8A 2Y48A 3HJEA 3U1DA 3HL2A 1U8BA 3A2KA 1P6RA 1QHHD 4F91B 3H92A 3PFYA 2I10A 1LDDA 3BZ6A 2YS9A 1BI3A 4HDUA 5D4RA 1MJ9A 2XAQA 1RNLA 3RDIA 4M3GA 3FKIJ 3MVPA 5DM6F 5E1XA 1J9IA 2KISA 4DGWB 2JPBA 2BVLA 2WAQA 3E6BA 4UUTA 3GTMJ 2DYRH 2GZWA 2ESHA 1X3ZB 2E34A 3IAS2 5M3FJ 4YG2F 3TOBA 1FMVA 3PUBA 3H3VK 2LF8A 4QSHA 3KYDB 1XSXA 1R9TJ 4A12A 1WJCA 5ILSA 3CMMA 3PQKA 2W48A 3PM1A 4P1WA 1TWGJ 3LA7A 4G6TB 2F5FA 1KZHA 1OYYA 1X2NA 3HGGA 3CC2I 2ESNA 5FD5A 2E2HJ 4LG0B 1EH8A 3VSLA 2EQRA 2A05A 1G59A 1MMGA 4KYWA 1R58A 1FYMA 2H09A 4U0YA 4JQFA 3WTWC 4BS9A 3V8LA 1FT9A 1MDMB 1IN7A 1VQ5I 4Y7NJ 5ICGA 3L1PA 1EH7A 4G94A 1XG1A 2VE9A 1P9QC 3E6MA 1VFCA 4BBSJ 4D5FA 1TWFJ 3CCYA 4L9TA 4EJUA 2L7FP 3PNYA 3E5XA 1MJBA 3BR5A 3FMQA 4M3BA 5DUKA 4AIKA 3IH4A 1I50J 2A6HF 2XDVA 3B02A 1TT0A 1MIJA 4IX7A 5C4JJ 4OIRF 3MKWB 2EFPA 3KLNA 3AG4H 1P4XA 4E4HA 1TW2A 2X0LA 1OISA 4I98B 1D8KA 4A3EJ 2KP6A 3BJOA 2ELJA 1Z77A 2K27A 2H94A 1SD7A 3G71I 1TWCJ 4YFNF 3OV8A 1ETXA 2HYJA 2M4KA 2PG4A 2Z5UA 5FD6A 1OKRA 1WJEA 4IHSA 1PUFB 3K69A 2IA2A 1QVUA 2D45A 3L9FA 5FGMA 3ZQLA 4A0XA 2QSGX 2BZTA 4FTHA 2E35A 1U5TC 4BYYA 1ZN2A 1I3AA 2Q0OA 4XR6A 2JT1A 3BG3A 3SEZA 4U7BA 1SFKA 4BY7J 4BHPA 1X4OA 1TLHB 3GZ5A 2LTPA 4A0YA 5E1WA 1ZGWA 2P6TA 3WE3A 4RGRA 3F8FA 2KQRA 3CJTB 2KDZA 2CW8A 3F6OA 1WH7A 2JRTA 3SQNA 1BL0A 5CYVA 2A69F 3IL2A 1MDMA 5H6RA 1AHDP 1UZCA 1LEBA 2K86A 3FKJA 3ECHA 2ZBKA 4AVZA 1WGXA 5ED4A 5HLGA 4CICA 2PLYA 1MMAA 1JKQC 2LKSA 4V19K 1MBKA 2HDWA 2M7BA 3KZYA 4MGRA 2R7QA 4CA0A 1T6SA 3U21A 2G0EA 4A6DA 2A3SA 1RIOH 4XRSA 1B4AA 1D5VA 4RS8A 4IRIA 1W7PA 4A93J 3I59A 1T0FC 1H0MA 2R7SA 5D8KB 2FU4A 2F4IA 5CVVA 2VJIA 1DDNA 1TQMA 2CQ7A 2QGUA 3S1MJ 5GP9A 2O9LA 4M3DA 3S2DJ 1VQNI 3VYUB 5IP9J 2R92J 1SD6A 2DDBA 1XC5A 3MZYA 2BGCA 2FQ3A 1XGNA 2PX9A 5DD4A 3RPUD 4G7OF 3K0LA 2DA1A 4JOMA 3MAJA 2H27A 1SEUA 3DEUA 1XN7A 2UV1A 3LA3A 2R4GA 4RB1A 3J81Z 4RDUA 2FRHA 3BT9A 2GQQA 1QHGA 1SAXA 3JSOA 4Z2YA 1K7AA 4LITA 2LVSA 5L3EA 4XKVA 5FLVA 1Z3YA 2VXZA 3N05A 1ZHFA 4RM3A 5B1AH 2QQ8A 5BMZA 1XPXA 1J75A 3CLQA 3BJAA 2R5ZA 1LQ1A 2UZKA 2QVOA 3KETA 2JQ7A 2GBYA 2JJ7A 2IXSA 5IPAA 3M3YJ 2X48A 3ZN0A 2V9KA 1BJAA 1REPC 1SANA 4BDZA 1LB2A 4UVBA 1EJ9A 1J09A 4UVCA 3GTKJ 3HPHA 1S29A 2EA4A 2OCCH 2CUZA 3MWMA 1K6YA 2DT7B 1I3QJ 3WG9A 4IL6C 3OYNA 3FBNB 3S3MA 1A6IA 2TDXA 4XORA 4B44A 4BH9A 3ZQGA 1QZZA 5JVTA 3GFJA 4QPOA 4N9IA 1W5TA 2L7KA 5IY5H 1MMDA 1S7OA 3QYFA 1OFCX 4CH7A 4PFPA 3FHZA 2NVTJ 3E0JB 1W7PB 2L9RA 4X1EA 3S14J 1E17A 1HF0A 5E8IA 2MBFA 4KICA 4ZYDA 3SDGA 3CJQB 1W4MA 1XS9A 2B0LA 4M9XA 2ACJA 2CG4A 2DYSH 2GIZA 2ISZA 4JP0A 1G2HA 2QKMB 5E3NA 2IA0A 3BPVA 3QPHA 1IV6A 3BTJA 4F92B 5DYMA 3IWZA 4A0ZA 4B3XA 2CUJA 5CVRA 2Y75A 3WTUC 3EUKL 1IN5A 1TQPA 4BAYA 1FYKA 2HZTA 3J80K 5DCMB 2HOSA 1O57A 3GO5A 4EM1A 5K5QA 3WTVC 2QEXI 1D1BA 1U9NA 3H9GA 5J8CA 3VWBA 1VTNC 3QOPA 4C3HJ 3RJPA 3HIFA 2IGMA 3OR1C 4D1QA 2RNGA 4A3DJ 4OIPF 4MO7A 3QU3A 1MH4A 1E0EA 3LSPA 1K79A 2Y0SA 1J0RA 2XGEA 1GHCA 2A6TA 4MFDA 1MH3A 3GLXA 2HPIA 3OIPA 3ZQQA 3FHNA 2DPUA 5LFAA 1VZ0A 2V4JC 4QPQA 1IN6A 2R7VA 2WB1N 4CYDA 2XKOA 3A1YA 3BROA 3A0HC 4O6JA 5GAEJ 2KZVA 3T8RA 1LEAA 2EH3A 1YRNA 3BG7A 4AUXA 4NQWB 2JRMA 3FK6A 1XMKA 2NXNB 2WA0A 3WU2C 5LGNA 5JI6A 3B6AA 3TO7A 3OYIA 1ZK8A 2VT3A 2MABA 3DEWA 1ZREA 4MQ9F 5F27A 2K02A 4P96A 1IRGA 1FTTA 2VJJA 4Q48A 2ID6A 2OZ6A 4IOAF 1ZRFA 2IS2A 3M7GA 5FO5A 2AO9A 1Z1DA 2F4OB 2FD5A 2HQAA 3LFKA 1XD7A 1ZYRF 3S15J 5IYCJ 3N4MA 2IGNA 2ZXHA 4DYQA 1BI2A 4NB5A 4B8XA 3CDHA 2ZFUA 1YITI 1NH3A 3HOZJ 1KQ8A 4FASD 2MFZA 4M3EA 1W36D 1U2WA 1PUEE 3DKXA 5ERIA 1IN4A 2CUEA 3K1PA 1UB9A 3NARA 1ETOA 4J01A 1GXQA 1Y56A 1ON1A 2GA1A 1S6LA 4DYRA 4CSWA 2OV7A 4I0BA 4I02A 2DMNA 2Q8KA 4IHTA 1CGPA 3MEXA 1MBGA 1OR7C 1FZPB 3DFGA 3FXUA 2V1DA 4GXOA 4CCKA 1Z9CA 5CJ9A 1X1CA 1LE8B 3DPTA 3Q0WA 3EUHA 4CHUA 2FBHA 5CLSA 2LFBA 4EV0A 2GWRA 1K61A 5CPRB 4EMSA 4L9JA 1BA5A 3Q9VA 1B9MA 3FXJA 3G1LA 4BU2A 3T0YA 3LAJA 4JX6A 4S0HB 4KFCA 3HTSB 4YIFA 1X1DA 1LJ9A 3CMYA 1RKWA 3DKWA 3C2BA 4RAGA 3H5AA 5F0FA 3C2GA 1IXRC
chains in the Genus database with same CATH topology
1VQ7I 1VQ9I 1VQ5I 1VQNI 1FOWA 2NXNB 3J7ZI 3I56I 2H8WA 1YITI 5GAGJ 3PIOF 2K3FA 1VQMI 5JVGF 1VQ4I 3G6EI 1ACIA 3G71I 3CF5F 3CCEI 3CCMI 2E36A 3CCRI 1YJNI 4V19K 2ZJRF 1HC8A 3CC4I 3CCJI 1FOXA 1Y39A 1YHQI 1S72I 2JQ7A 4UY8I 1VQ6I 3PIPF 3CMAI 3CMEI 1VQ8I 1VQKI 3I55I 2QA4I 3CC2I 1VQPI 2ZJPF 1MMSA 3DLLF 1VQOI 4IOAF 2QEXI 1VQLI 3CD6I 3CJTB 3CCUI 1YI2I 5DM6F 2ZJQF 1QA6A 3CCLI 2E35A 3CCVI 1YJWI 4IO9F 3CCSI 1YJ9I 2OTLI 5GADJ 1YIJI 4IOCF 3G4SI 5GAHJ 5GAEJ 3CC7I 1FOYA 2OTJI 2FOWA 3CCQI 2E34A 3J7YJ 5DM7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 I;  1VQ9 I;  1VQ5 I;  1VQN I;  1FOW A;  2NXN B;  3J7Z I;  3I56 I;  2H8W A;  1YIT I;  5GAG J;  3PIO F;  2K3F A;  1VQM I;  5JVG F;  1VQ4 I;  3G6E I;  1ACI A;  3G71 I;  3CF5 F;  3CCE I;  3CCM I;  2E36 A;  3CCR I;  1YJN I;  4V19 K;  2ZJR F;  1HC8 A;  3CC4 I;  3CCJ I;  1FOX A;  1Y39 A;  1YHQ I;  1S72 I;  2JQ7 A;  4UY8 I;  1VQ6 I;  3PIP F;  3CMA I;  3CME I;  1VQ8 I;  1VQK I;  3I55 I;  2QA4 I;  3CC2 I;  1VQP I;  2ZJP F;  1MMS A;  3DLL F;  1VQO I;  4IOA F;  2QEX I;  1VQL I;  3CD6 I;  3CJT B;  3CCU I;  1YI2 I;  5DM6 F;  2ZJQ F;  1QA6 A;  3CCL I;  2E35 A;  3CCV I;  1YJW I;  4IO9 F;  3CCS I;  1YJ9 I;  2OTL I;  5GAD J;  1YIJ I;  4IOC F;  3G4S I;  5GAH J;  5GAE J;  3CC7 I;  1FOY A;  2OTJ I;  2FOW A;  3CCQ I;  2E34 A;  3J7Y J;  5DM7 F; 
#chains in the Genus database with same CATH topology
 1KON A;  4GCV A;  1JHF A;  1MGT A;  3VB2 A;  5K7Z A;  4UUS A;  3L00 A;  3H5R A;  1T2K A;  3ZMV A;  3CCM I;  2A61 A;  3F3X A;  2IVM A;  3IKV A;  1KYZ A;  4EQQ A;  1FP2 A;  2HDD A;  1Z0X A;  2OAZ A;  1JXS A;  2HPM A;  1YX5 A;  3A4C A;  5HLI A;  4R1H A;  2ETH A;  2RQP A;  3OYF A;  3JTH A;  5JR3 A;  2BYV E;  2QCO A;  5E3L A;  5D5U B;  5HLH A;  1QZY A;  2F6C A;  1MBF A;  3KP7 A;  2Z3Y A;  4L5I A;  4AM3 A;  3I56 I;  1AU7 A;  5AON A;  1E3O C;  1V5G A;  2BXY A;  1V55 H;  3RYP A;  2NNN A;  2MH9 A;  3DQV C;  3WE2 A;  3QYB A;  4Q47 A;  4N0B A;  1B9N A;  5FB2 A;  1ERD A;  5EG0 A;  3TGN A;  3DLL F;  2FNP A;  1Z7U A;  3QYE A;  5LRS A;  4LK1 F;  1MBE A;  3OOP A;  5FRN A;  4DBQ A;  2PMH A;  1V54 H;  3JRE A;  4KT6 A;  4BEH B;  3GTG J;  4BXF A;  3FXR A;  3LSG A;  1G4D A;  2ZME B;  2HNH A;  3FDY A;  3W6J B;  1MKM A;  2Z16 A;  4OIN F;  1B59 A;  2KIU A;  3V42 A;  1HST A;  1BI1 A;  1WHU A;  2HKO A;  3O6B B;  4DQ2 A;  5LEK A;  2H1K A;  4OIQ F;  3LST A;  2VPL A;  3K4C A;  2M87 A;  2CV0 A;  1HW1 A;  1OQY A;  1ZR2 A;  2OPT A;  1S7E A;  2FML A;  2JZY A;  1EV7 A;  2QWW A;  1MSF C;  2VIX A;  2XF6 A;  1KYW A;  3F8N A;  2L02 A;  3QQA A;  4LLN A;  1TL8 A;  3QU6 A;  4MTE A;  2PFB A;  3OYC A;  3BJ6 A;  4M6V A;  3E5U A;  2ZXW H;  4ZZL A;  2P7V B;  1UCR A;  5JLW A;  2R5Y B;  2XC7 A;  2MH2 A;  2ZKZ A;  1AOY A;  4UV8 A;  3CCE I;  2E2I J;  1K6O A;  3CCJ I;  2HWV A;  4MNU A;  2VLA A;  4PJM A;  3PFI A;  1XMA A;  4XLC A;  4ASN A;  4C2U A;  1K83 J;  3TL4 X;  2BV6 A;  2LSO A;  1MNM C;  3UR3 C;  2PQ8 A;  5D6E A;  4DJA A;  5FLX Z;  5CQE A;  2I8D A;  2IPQ X;  3KP5 A;  2DK5 A;  2IA1 A;  4IRG A;  2CQQ A;  2Y0M A;  1IJW C;  4AD9 A;  2DA3 A;  3A03 A;  3ZMS A;  1OCO H;  1XGM A;  5J1R A;  1X58 A;  3JRA A;  3HUG A;  2P4W A;  4IQJ A;  1R6R A;  4C3J J;  2G7U A;  4KIB A;  1TNT A;  2GIV A;  2X9D A;  4HBL A;  4G7Z F;  2MC4 A;  2WAF A;  2FEZ A;  5K7F A;  1KU9 A;  3Q3S A;  3OS1 A;  5D5W B;  2CGP A;  1L0O C;  1TWH J;  1ZRD A;  4A3L J;  3I59 B;  4C30 A;  2Q2E A;  4Q5S F;  3PL8 A;  3P9I A;  3TP0 A;  5HDG A;  3O2P E;  3IWF A;  2CW7 A;  2EZH A;  2P0W A;  1UHS A;  1NK2 P;  4E7Z A;  4BQN A;  3HB9 A;  4O5V A;  1R71 A;  3DU6 A;  2HZD A;  4I99 C;  4PSX A;  1STZ A;  3RYR A;  1AKH A;  5DDG A;  2ZO4 A;  3ZGK A;  4MLO A;  1W7P D;  2H8W A;  1YFH A;  2WC2 A;  3F8B A;  1P4A A;  2ZNZ A;  3TW6 A;  2COM A;  3IUO A;  3DEE A;  2JSP A;  4EM0 B;  2IJL A;  1D0Z A;  3WU0 A;  1ON2 A;  5F0C A;  1A35 A;  3L2W A;  1DQU A;  2K5C A;  5HNF A;  2NOG A;  2CQK A;  2X1E A;  1VI0 A;  5HS7 A;  3EDP A;  3IKT A;  4P9F A;  4DOZ A;  1R22 A;  5F08 A;  1ZKG A;  3WG7 H;  4CYC A;  1NK3 P;  2WY8 Q;  3GTP J;  1MBJ A;  1U5T B;  3BR0 A;  3HBL A;  3PSI A;  5FKO A;  1LKX A;  1XX5 A;  3SJM A;  1TZL A;  1HA8 A;  1GV2 A;  4M73 A;  4XSZ F;  2RVC A;  5EG0 B;  2WB1 A;  2HGC A;  2AHQ A;  2O8X A;  3HSR A;  1OCT C;  4K2E A;  5E1Z B;  1SMT A;  4W97 A;  3JR9 A;  2EFW A;  1IN8 A;  4HQE A;  3GTL J;  3CCS I;  2W85 A;  4MEX F;  2OF7 A;  1MNE A;  3MFK A;  3HG9 A;  2DFE A;  4YEJ A;  1P7J A;  2DA7 A;  4N4N B;  1GDT A;  2VJ4 A;  4XL9 A;  1MND A;  1JKO C;  1FOX A;  4ETS A;  1LUJ B;  2A68 F;  1H9T A;  1DP3 A;  3WOD F;  3NWT A;  3SDB A;  4KT5 C;  1RRJ A;  1A04 A;  2F5V A;  4I7H A;  2MGQ A;  4KA4 A;  5BPI A;  1FY7 A;  3CUO A;  3TDZ C;  1Z21 A;  3G3Z A;  1YI2 I;  3U1K A;  4G7H F;  2R7X A;  1B72 A;  3KEO A;  2XSJ C;  2CQX A;  2NOJ B;  2D1V A;  3BLY A;  3ONQ A;  4XLH A;  2AQF A;  4WXD A;  5FLX K;  3HSF A;  2LR8 A;  4KIF A;  3WHB A;  2STW A;  3NRV A;  4HZF A;  3ABU A;  5JHF A;  1JT0 A;  4R8H A;  3OY9 A;  3D0S A;  1R7J A;  4MEY F;  4A3K J;  4BE2 A;  2LRD A;  4HX7 A;  1SFE A;  1UG0 A;  3KPH A;  2XAF A;  2DQR A;  3I54 A;  3E7L A;  3ZMZ A;  1F9N A;  3HXL A;  3DTE A;  4EJT A;  4HQM A;  4I01 A;  3ESW B;  2GA2 A;  2VT2 A;  3ZQH A;  2JSC A;  2W4S A;  1WQ2 A;  4CCJ A;  4A3J J;  2L5Q A;  4ABZ A;  1X4P A;  6PAX A;  4XOP A;  1HCR A;  1UFM A;  3K1M A;  1HW2 A;  4LG3 A;  5D4S A;  2PMZ N;  4RA2 A;  1ZEL A;  2DMU A;  4UY8 I;  1GUU A;  2VL8 A;  4QTR A;  4XNF A;  2IBD A;  3S17 J;  4ESJ A;  3CF2 A;  3DPL C;  3OYE A;  5JHU A;  3TO6 A;  2IEK A;  1NHA A;  1OCZ H;  3BCB A;  2KIM A;  4KIT B;  5IP6 A;  3TOA A;  3K4J A;  1PJR A;  1T08 B;  2O6G E;  1RZ4 A;  2XPV A;  3I71 A;  4NC8 A;  4EJV A;  2X6X A;  3WTT C;  3K4L A;  5GAH J;  3EUA A;  4PJL A;  4NHJ A;  4L0Z B;  2VPR A;  1B1B A;  3G1M A;  5BPD A;  2BY1 A;  2W24 A;  2ME0 A;  2VOP A;  3LFU A;  3HOW J;  4ZJZ A;  1YE9 A;  3HOV J;  2JN6 A;  1MJA A;  2E19 A;  2CWE A;  1YS6 A;  3CZ6 A;  2FX0 A;  2X85 A;  4V2F A;  2WAE A;  4NUB A;  2R7U A;  1HDP A;  1OLT A;  2W1O A;  3W2V A;  1T98 A;  4II2 A;  5GAD J;  1MW7 A;  4EEF G;  3QPT A;  3JRF A;  4IKF A;  2XIG A;  5D8L B;  4CXF A;  4E7J A;  1LDJ A;  4LG0 A;  1DPR A;  3CUQ A;  1GVD A;  2K3F A;  3K2A A;  2FBK A;  1YS7 A;  3Q9S A;  5JFR A;  5EGO A;  1ZLK A;  2KKO A;  3I5U A;  2PJR B;  5HDN A;  4N9H A;  3H0D A;  1WCM J;  2JA5 J;  2BY0 A;  4HYE A;  3E6D A;  3I0T A;  5HLT A;  3MKY B;  1VQK I;  3HHG A;  3W2W A;  1D8J A;  2W00 A;  2LG4 A;  2O61 A;  5JLX A;  2CS3 A;  4ZTJ A;  4A2U A;  2F5E A;  2CMP A;  2TRT A;  1U3E M;  2NVQ J;  2VBY A;  2RAE A;  3HPG A;  2RV8 A;  2XRL A;  1D3Y A;  5FKN A;  3ECO A;  2JUG A;  4HPQ A;  3F8M A;  1ULY A;  3IRR A;  3MMY B;  2VQL A;  4MHG A;  2HR3 A;  2JWT A;  3ROU A;  5L3G A;  4UV9 A;  4HST A;  4RGX A;  1F1Z A;  3NEU A;  4L5E A;  2KJC A;  2HXI A;  1BR1 A;  3WGH A;  4CCO A;  3AG2 H;  1ZR4 A;  1QRY A;  5IOZ A;  1Y6I A;  2M8E A;  4V2G A;  3DTI A;  2PBI A;  3FZV A;  5F1R A;  4HF1 A;  1D0Y A;  4UB6 C;  2VKD A;  3RIR A;  4CCN A;  1QBJ A;  4OAY A;  3CCL I;  2VJ5 A;  2FBI A;  2W82 A;  5D5X B;  1HKT A;  3CJN A;  2HEO A;  2E1M C;  2GOX B;  3WGI A;  1D1A A;  2KRH A;  2Y9Y A;  5IOY A;  3JRB A;  4Y17 A;  3I9V 2;  3Q5F A;  2K40 A;  2DMQ A;  3IAM 2;  4F3Q A;  2BEO A;  2E36 A;  2LLK A;  3K4K A;  3P5J A;  4FT8 A;  2DN0 A;  3K1N A;  3GME A;  4PDK A;  4R79 A;  1I6H J;  3GYH X;  4DBR A;  5EZH A;  4ZTF A;  3GFM A;  2K85 A;  4DZP A;  2BHZ A;  1QU3 A;  2OUM A;  4LJZ F;  3A02 A;  1WRJ A;  5KAF C;  2EBI A;  1HLV A;  5CVI A;  5LRR A;  2IS1 A;  5ICC A;  1IRF A;  2CUF A;  4BGD A;  2ZME C;  4E7S A;  3MZ8 A;  3CDL A;  3FX3 A;  3KP4 A;  1WJD A;  4FIS A;  3M8F A;  2K9M A;  2KPM A;  4EM2 A;  2RNJ A;  3G6E I;  2B7E A;  2VBX A;  2VC0 A;  2E71 A;  5KNL A;  3I64 A;  3LSJ A;  3E97 A;  1V5E A;  2EIN H;  3PIP F;  1FP1 D;  4GYI A;  3HRS A;  1UJ8 A;  2DO7 A;  2ZJP F;  4B1R A;  5FKL A;  3I4M J;  2XGX A;  1SVM A;  3P7N A;  3W6K B;  2E1C A;  2ECC A;  1YJ9 I;  1BC7 C;  2DA5 A;  2DTR A;  1MBH A;  1T39 A;  2Y69 H;  1IO2 A;  3LA2 A;  1OCP A;  1FPQ A;  1X19 A;  3DP7 A;  3I4P A;  3VYT B;  1WSU A;  2KMU A;  3KZI C;  3HOT A;  2JTV A;  4ENN A;  2ADU A;  4HV6 A;  2O3F A;  1SFX A;  1E3P A;  3RKX A;  1P4W A;  3W2A A;  2M5W A;  3OL4 A;  4EJO A;  2OZU A;  3ULQ B;  3VOD A;  4GGG A;  4PJ0 C;  1QQI A;  4BJ5 C;  2XF5 A;  4QLC U;  2OU2 A;  3M07 A;  1OPC A;  4E7K A;  1VQP I;  2ID3 A;  4KNY A;  4KUM A;  5H20 A;  4HAM A;  3V8J A;  4GFB A;  2LY1 A;  2EA2 A;  1DUX C;  4EJW A;  3CLO A;  4BHC A;  4BAC A;  1YQA A;  3L2C A;  1VND A;  3J7Y J;  2R0Q C;  2KIQ A;  2VUM J;  4ZZD A;  2BBY A;  1KGS A;  1JGG A;  3BR1 A;  3GTQ J;  4RGU A;  1S8N A;  1HC8 A;  2HTS A;  2GXG A;  1C0W A;  4ZYA A;  5LEJ A;  2MSY A;  2XAH A;  4FQG A;  3GX4 X;  2L54 A;  3MKZ A;  2DOE A;  2RQQ A;  2DJN A;  1DGR M;  3QAH A;  1YX3 A;  2NYX A;  2EIK H;  2ZCW A;  1PUF A;  5FFX A;  5DEQ A;  3IV5 A;  4KMF A;  1BI0 A;  2OBP A;  1WVR A;  2X1C A;  2L0K A;  4IO9 F;  2Y31 A;  2R7D A;  1J5Y A;  3UNG C;  1ZG3 A;  4YFX F;  2H6C A;  4U0V A;  1B8I B;  1O7F A;  3FK7 A;  3M9A A;  3KX2 A;  4W1U A;  3S1R J;  4CDG A;  3K10 A;  1SAU A;  1RR8 C;  1HW5 A;  1O3S A;  3ZOB A;  5LHH A;  2HVQ A;  1UAA A;  3GLL A;  2HQN A;  1Z67 A;  2L4M A;  2P7C B;  4KDP A;  1SVL A;  3RPQ A;  2J5P A;  2F48 A;  2EIJ H;  2IAI A;  2FMY A;  1V4R A;  1ETK A;  2LNB A;  1IXC A;  4A3M J;  2W57 A;  1TQI A;  1WJ5 A;  2DU9 A;  3G4S I;  3FXQ A;  3KZZ A;  1S9H A;  1O7L A;  1BW5 A;  3ZMU A;  2XAU A;  3R0A A;  2GLO A;  3IH3 A;  1PVE A;  1RI7 A;  5DS9 A;  1YIO A;  2AQE A;  1ZAR A;  3F6V A;  1BIB A;  1BR2 A;  1SMY F;  2ZXI A;  3BTI A;  2FOK A;  3SFI A;  3HOY J;  2CRG A;  4BE0 A;  1ETQ A;  1VQ8 I;  5J8F A;  5K5O A;  4ZDP A;  1LFB A;  5FRO A;  4ITV A;  4XQF A;  4XBF A;  1Q1V A;  3BWG A;  3RTR A;  3KP6 A;  3QP5 A;  5ILU A;  2OJE D;  3FMS A;  4JBA A;  3JSP A;  5L3C A;  2VKH A;  1YRN B;  5IT9 K;  1IXS B;  2PMU A;  4ZYH A;  3HYI A;  5CVJ A;  4H4K C;  3AL0 C;  4BNC A;  3OYJ A;  2CU7 A;  4CZZ A;  2EV0 A;  5IP7 J;  3HRU A;  1EH6 A;  2GXB A;  4DIQ A;  4BEH A;  3S1N J;  2EZK A;  3AG1 H;  3CC4 I;  2WV0 A;  2YSR A;  3C1D A;  3PJR A;  3OSF A;  5J47 A;  1WWX A;  1KU3 A;  2IGK A;  4RMN A;  2XGC A;  3WU1 B;  2VE8 A;  5L3B A;  2CV1 A;  2M34 A;  2K4B A;  5BNG A;  3OIQ A;  5K1Y A;  3H5N A;  3DKY A;  1YYV A;  2M30 A;  1W1W E;  2VQG A;  2VON A;  4CCM A;  1V3F A;  2M2E A;  1QGP A;  3AL0 B;  2DCE A;  1W0T A;  2X4H A;  3CO7 C;  4C2T A;  3MD2 A;  1Q1H A;  1HDD C;  1WZ2 A;  2IS4 A;  4LIV A;  3L2U A;  3I55 I;  4AIJ A;  2HXO A;  2DBB A;  1QO0 D;  4GRI A;  2BHY A;  1D5Y A;  1H89 C;  2LDU A;  1UMQ A;  5E79 C;  3VDX A;  3HOS A;  3CC7 I;  4S04 A;  2K9Q A;  3I53 A;  4I09 A;  3L2R A;  1XGO A;  4UUS B;  1FIA A;  3BG9 A;  2ZME A;  3GW2 A;  1Y8R B;  3TED A;  1D1C A;  1IRX A;  1FSE A;  1U78 A;  3OS2 A;  4X0G A;  2A5Y B;  2M8G X;  4F52 A;  3K6G A;  3GTJ J;  1YHQ I;  3WTX C;  3E5Q A;  3O8H A;  2KRF A;  3QOE A;  2LK2 A;  3D5S C;  2OQR A;  1SC7 A;  2PMZ A;  4ENJ A;  4PFO A;  3CCV I;  3CUQ B;  3ERE D;  3V7C A;  5TRD A;  4XLF A;  2DMP A;  1IRZ A;  2N8G A;  4YRV A;  3SXY A;  2DAO A;  4I6Z A;  5AIP A;  4LB5 A;  4KIS A;  1RES A;  3HHH A;  3HRM A;  1T56 A;  4FX0 A;  3D1N I;  5DCM A;  4BDY A;  1VQM I;  4BQA A;  4A3G J;  2QF7 A;  3ZCO A;  4L9N A;  2JA6 J;  4I2O A;  1VQ6 I;  2VQH A;  3FIW A;  1E3H A;  3HTU A;  1W5C C;  2V26 A;  1RPW A;  3JRH A;  4OAZ A;  2K3P A;  3H36 A;  3O8G A;  4IXA A;  1L3L A;  2ZSI B;  1R5G A;  1VQL I;  1Z05 A;  1R4M B;  3SEQ A;  2EIM H;  2ZC2 A;  3RI4 A;  1YJW I;  1TW3 A;  1WJA A;  1ZGJ A;  2ZFW A;  4NDL A;  1FTZ A;  3BC8 A;  4RLF A;  1O3Q A;  3H1C A;  3CP2 A;  2M9H A;  2TCT A;  3S3N A;  5EZG A;  4IHW A;  1HQC A;  1BIA A;  1YW9 A;  1IGN A;  2K9S A;  4HW0 A;  2E60 A;  5LD2 C;  4IHV A;  2AXT C;  5E3M A;  3CF5 F;  1X3U A;  4WWC A;  3V8K A;  2NS7 A;  1O3R A;  3T1B A;  1Z6R A;  1OYW A;  2ZNY A;  3PNT A;  4HF0 A;  4HDV A;  4OWR B;  1V5F A;  2Q1Z B;  1K78 B;  1MMS A;  3I3L A;  1T8I A;  1CQT A;  4OMZ A;  2DXI A;  3JAM Z;  3OYK A;  3IH2 A;  1ETY A;  4JX5 A;  2ZB9 A;  1JKP C;  1AWC A;  2HKX A;  1BN5 A;  2LOO A;  4XSX F;  4J19 A;  2V9P A;  3B6C A;  2MD5 A;  2O5R A;  4A69 C;  2LBF B;  2FOW A;  1IDZ A;  1DP7 P;  1UST A;  2HDC A;  2DQL A;  3AFH A;  4ENM A;  4Y13 A;  3TO9 A;  1XTA A;  3N97 A;  5C4X J;  2DI3 A;  3H9Q A;  2D1H A;  3V7R A;  5JVG F;  2QQB A;  3DCF A;  3L2V A;  1RUO A;  1IUY A;  3HEF A;  5HOD A;  3FWE A;  1A36 A;  1BBY A;  4I76 A;  3BQZ A;  5EGO B;  4IVN A;  4D9J A;  1W36 C;  2PJR A;  2QQA A;  2V79 A;  4ZH4 F;  2VBZ A;  3GCM A;  1T33 A;  5GPC A;  4RM2 A;  1XDU A;  4F7Z A;  4YEL A;  3KEQ A;  4HG2 A;  4RAZ A;  4Y15 A;  3A01 A;  5BOX A;  2NNY A;  3S32 A;  1IF1 A;  3QP6 A;  2EFQ A;  2ICW G;  4YII A;  4HSR A;  4Y52 J;  2B63 J;  3H3U A;  2FUG 2;  3BDD A;  4L0Y B;  2L9V A;  4F93 B;  3FXK A;  2R7T A;  4BJT A;  3I4N J;  1B72 B;  1DU6 A;  5J40 A;  3D5L A;  3DBR B;  4LFU A;  2A6E F;  1U8R A;  3J81 K;  4HEA 2;  5GPA A;  2D2W A;  3LQQ A;  3DLA A;  4LB6 B;  4KJZ A;  3M4O J;  1KA8 A;  1ODD A;  1JJ8 C;  4XIC A;  2E5N A;  5IT3 A;  2GOM A;  1SVO A;  3OWT A;  2WY7 Q;  3A0B C;  3CDI A;  3BP8 A;  4XLN F;  2DT6 A;  5HS8 A;  1Y1W J;  3RZO J;  2R7F A;  3L09 A;  3O3K A;  3VYS B;  3TMO A;  3CO6 C;  1GXP A;  1LNW A;  5J1U A;  3S2H J;  2LKX A;  3FF5 A;  1K4S A;  4BQQ A;  2UXX A;  3IC7 A;  4G8X A;  4UUV A;  2ZJ2 A;  4E70 A;  3VSK A;  4Y3O A;  4F55 A;  4WK8 F;  2KHM A;  2E1M B;  2C6Y A;  3LAP A;  3E1S A;  2E1O A;  2QSF X;  1ZTR A;  1GLN A;  2R3S A;  1FC3 A;  1OCR H;  3CES A;  1USS A;  2KLO A;  4FCY A;  2E2J J;  2DTZ A;  1JKR C;  5F64 A;  2XB5 A;  4E7H A;  1LVK A;  4XLA A;  3F23 A;  2IGO A;  1HXD A;  2OTL I;  4GO1 A;  4E7L A;  3PNV A;  1FX7 A;  3J80 Z;  1J7K A;  1JT6 A;  2CV2 A;  3IHU A;  5D5V B;  2BY3 A;  1VQ7 I;  5E3O A;  4XLP F;  2LD5 A;  4PJJ A;  2HI3 A;  2E7W A;  4AYB N;  3J7A Y;  3MN2 A;  5J4Y A;  5A2Q Z;  3OS0 A;  3L2Q A;  2YPR A;  1FNN A;  3ABT A;  2QLZ A;  3EUH C;  3ERM A;  1LFP A;  1O3T A;  1J2X A;  3LWF A;  4B47 A;  1XDS A;  2WTE A;  3BR2 A;  2ISY A;  3FMR A;  3H35 A;  3E6C C;  4AYB A;  4XK4 A;  3DBH B;  4PGH A;  3CD6 I;  1GV5 A;  2EFN A;  4N4O B;  2E7X A;  5GTI C;  3PO3 J;  1IC8 A;  2R5Z B;  3FXO A;  3LNQ A;  3WTZ A;  3OYL A;  1JTX A;  1IDY A;  1FEX A;  2FXA A;  2E5Z A;  4G6D A;  1FLI A;  1R00 A;  1EA3 A;  1F36 A;  2H8R A;  1SD4 A;  2P5K A;  3ZN1 A;  1Y39 A;  3KLO A;  2FA5 A;  4XKW A;  3SYT A;  4O3M A;  3HRT A;  5E18 F;  3HOU J;  2V9V A;  3ASO H;  3OYB A;  2V6C A;  3BPX A;  4RAF A;  3GZN B;  5E8G A;  3S2W A;  1Y1V J;  2JK3 A;  4M6Y A;  2R7Z J;  3ISP A;  2GXA A;  1YIJ I;  2LBF A;  3WGG A;  4Y4R A;  1UHW A;  1K78 A;  5DTD A;  4P55 A;  4M6X A;  1U6G A;  2KJB A;  2X6Y A;  5EDN A;  2JA7 J;  4XID A;  3OOU A;  4C2M J;  2V1U A;  1KU7 A;  3MZH A;  3KFW X;  2EK5 A;  5M5W J;  2PEX A;  2DFI A;  2KRC A;  1LFU P;  1XCB A;  1R5H A;  1ZGA A;  2XKP A;  3LSI A;  2XPW A;  3ML6 A;  2NVX J;  4CGZ A;  3ZMD A;  1FSH A;  1BC8 C;  4PSW A;  2EV5 A;  1R49 A;  2DW4 A;  1MZB A;  2EWN A;  1EKE A;  4MQV A;  1X3W B;  4E6K G;  3S3O A;  1OR7 A;  3FXL A;  2L7M P;  3EYY A;  2X51 A;  3P9C A;  5LHI A;  1PYV A;  1UHM A;  2DT5 A;  4DYC A;  1N25 A;  4RB2 C;  3BZC A;  3ASN H;  3OIO A;  2CQN A;  1EF4 A;  2RDP A;  4YFK F;  2L01 A;  4B3A A;  1W5S A;  1DGW Y;  3CP8 A;  3VYR B;  3NAU A;  4LD5 A;  1JE8 A;  3E3V A;  4IHX A;  1WI9 A;  2L9N A;  2DLL A;  3MQ0 A;  1JTY A;  1T95 A;  4XRF A;  1MSE C;  2XAJ A;  1IV8 A;  2I5U A;  2R7R A;  2NAZ A;  2PI0 A;  5FJ8 J;  4WXC A;  4XOT A;  3J7Z I;  3DV8 A;  1VQ4 I;  4ESB A;  5F1J A;  2WWY A;  2EIL H;  1BM9 A;  2Z9O A;  2DOA A;  2Y30 A;  3LSR A;  2STT A;  2NVY J;  4FX4 A;  3JRI A;  2L4A A;  2RC4 A;  1WJF A;  1OCC H;  2WAQ N;  5KK1 A;  5FKK A;  4AVP A;  4IHY A;  2QBY A;  4S05 A;  2PJP A;  2IW5 A;  1G6N A;  1TWA J;  4OU0 A;  4U0W A;  4BXU A;  5C44 J;  2OA4 A;  3DXJ F;  3RZD J;  3ZQC A;  1SD5 A;  5TGT A;  3J7A O;  4M72 A;  2QYO A;  4P5O A;  2KDO A;  5F0H A;  4BXX J;  1RR7 A;  1JUP A;  2M0C A;  5EEA A;  2Z33 A;  2XB0 X;  2DOD A;  2HVR A;  2NRA C;  1VQO I;  3VPR A;  5LBQ A;  3ZRG A;  3OYM A;  2K9N A;  4C3I J;  2VBW A;  4C9Y A;  2JVH A;  2XPU A;  3RKY A;  3HC7 A;  1KQ9 A;  2FQ4 A;  2Y9Z A;  5FLM J;  1QPI A;  5IT9 Z;  4G6Q A;  3C18 A;  3Q0U A;  4RB0 A;  4IF4 A;  5H2F C;  2ELH A;  2X6W A;  4HLY A;  4AIH A;  3DTK A;  5ICF A;  1H88 C;  2V7F A;  2R93 J;  4CCL A;  3CUQ C;  4BJ6 C;  4FET A;  2XUB A;  4HRI A;  2DK8 A;  1ITY A;  2MA3 A;  3H9J A;  1G3Y A;  1X2M A;  2VAS A;  2EZL A;  1FYL A;  3HSE A;  4A5N A;  3ZP5 A;  5DM7 F;  1VQ9 I;  1FOW A;  3LSM A;  4AC0 A;  2KZG A;  2HYF A;  5BQT A;  4EGY A;  4LOC A;  4ZYG A;  1I1S A;  3GWZ A;  1P92 A;  4WF2 A;  3ZQF A;  3K4N A;  4RAY A;  3KEY A;  1S7A A;  1WI3 A;  3F0C A;  4LMY A;  3SZT A;  5HOO A;  4FE4 A;  2COB A;  2L2O A;  4LIU A;  2XSD C;  4OMY A;  4FE7 A;  3ZMT A;  4XMY A;  4ZDO A;  3AG3 H;  1FJL A;  4EVI A;  2AS5 F;  1WH5 A;  1XMX A;  2WBM A;  4AWX B;  4WCG A;  2MG4 A;  1J59 A;  2BY2 A;  2DA2 A;  3C7J A;  2X6O A;  5CQG A;  2XVC A;  2G9W A;  3RQI A;  1ZG1 A;  3GUD A;  1FBQ A;  3ZQI A;  2HQR A;  1U9O A;  3G2B A;  4G12 A;  1BOB A;  4OOI A;  3UKG A;  9ANT A;  1F43 A;  1ETV A;  2BE5 F;  2P5V A;  4RLQ A;  2XAS A;  2YUS A;  2O0Y A;  4BL0 B;  3BTC A;  4B09 A;  3SHF A;  4MFE A;  3R6S A;  2VB6 A;  4M71 A;  1UEL B;  3FBI B;  3OYG A;  2BVM A;  3JRD A;  5DD8 A;  2VQC A;  4D5C A;  2MC3 A;  2F5D A;  2DA4 A;  2Z1D A;  3L7W A;  5B1B H;  3R60 A;  3MCZ A;  4A6E A;  3PO2 J;  2HOE A;  3EET A;  3OYD A;  2FSW A;  2QA4 I;  4CUG A;  2D5V A;  3IP4 B;  3CJR B;  5LGU A;  4RB3 C;  1I39 A;  2LKP A;  4ENK A;  3QWL A;  4PCQ A;  1I6X A;  1N77 A;  1U5T A;  2HYG D;  1POG A;  2JPC A;  2DA6 A;  1R36 A;  2JMW A;  2RN7 A;  1BOA A;  1FOK A;  3Q0V A;  4PUS A;  4ZYE A;  2LRE A;  1BJZ A;  4KN7 X;  3PIO F;  4X6A J;  3FM5 A;  2CH0 A;  5B66 C;  2VN2 A;  2IS6 A;  3A01 B;  2YR2 A;  3ZXS A;  1QPM A;  2P81 A;  2CO5 A;  1UG2 A;  1NG6 A;  5F6F A;  3I58 A;  1YOV B;  3G73 A;  4GDF A;  2DFF A;  2CYY A;  2VI6 A;  1B8I A;  5J3L A;  2LC2 A;  3V4G A;  4XN3 A;  4IOC F;  2BW3 A;  2G7H A;  2F5C A;  3K4B A;  3IRQ A;  2BXZ A;  2Z99 A;  2MD0 A;  4CO8 A;  2YX4 A;  1TC3 C;  4JX4 A;  1ACI A;  3WTS C;  1T38 A;  3EQL F;  5KVR A;  2K9L A;  3JW4 A;  3QOD A;  2QBY B;  2VOD A;  2CFO A;  3BTL A;  5IYD J;  2W84 A;  4NQW A;  2H1L A;  1Z91 A;  3RQ4 A;  4DNC A;  2A07 F;  2HFH A;  2JVG A;  1GVJ A;  2DMT A;  2E1N A;  3R4K A;  4B4C A;  3QRF F;  3GTO J;  2O03 A;  2HU9 A;  1TBX A;  3VEP A;  2L3D A;  5H6Q A;  3F8C A;  1S3J A;  1G8X A;  3GVA A;  3ZQ7 A;  4Q4Z F;  2M4G A;  2V1X A;  3ABM H;  4EGZ A;  3WHC A;  2O7O A;  2DFH A;  3VFZ A;  2Z2S B;  2QQ9 A;  1A5J A;  2KIF A;  1Y8Q B;  4ANJ A;  2B9S A;  2IT0 A;  2YU9 J;  4D7N A;  3ELK A;  1O4X A;  5FKM A;  3M8J A;  5LLQ A;  3K4M A;  4QWQ A;  5CKT A;  2CSO A;  4CZC A;  4U88 A;  4HV5 A;  4KN4 X;  2F4M B;  2YX7 A;  1WJB A;  1Z6T A;  3BG6 A;  3AKZ A;  1SFU A;  1ZH5 A;  4J00 A;  4XON A;  1JI8 A;  2R5Y A;  3ABK H;  4LLL A;  2MLK A;  1FOY A;  3CCQ I;  4XKC A;  1XGS A;  3BR3 A;  1RKT A;  1MMN A;  3RKQ A;  4MTD A;  2OQG A;  1Y0U A;  2DOF A;  1YG2 A;  4ON0 A;  3W6V A;  1FBS A;  2KT0 A;  3ZR8 X;  2YU3 A;  3H0G J;  5GTH C;  5ICE A;  2XHK A;  4AU7 A;  5EJC A;  3REO A;  5E17 F;  2R7O A;  1JUS A;  4H0E A;  2JUC A;  2BOL A;  1XB4 A;  2RGV A;  4LK0 F;  4PGG A;  3OYH A;  1QA6 A;  4HNT A;  2XF7 A;  2FNA A;  3GEZ A;  3EYI A;  5F04 A;  2V1N A;  3BOQ A;  4QIW N;  3JRC A;  1XSD A;  3TW7 A;  3S16 J;  4PJN A;  3RKW A;  4U87 A;  1SFO J;  5KHD A;  1NTC A;  3HM5 A;  1FBU A;  3NQO A;  2VKV A;  1XCV A;  2OD5 A;  5A2Q K;  4HOB A;  1S72 I;  3OMY A;  3K7A J;  4II3 A;  2DPD A;  1OMI A;  3KIO A;  1N75 A;  3P9K A;  3TKY A;  3WTY C;  1ZAO A;  5AIQ A;  3OSG A;  2A5W A;  3SZG A;  3TBI A;  5HNH A;  1YTY A;  2WV1 A;  4TV7 A;  5B3S H;  2HQ5 A;  3G1O A;  2FJ1 A;  3GXO A;  2PN6 A;  4B48 A;  3BY6 A;  2LP0 A;  3BQY A;  2LY9 A;  3DBL B;  2XGD A;  5CVU A;  3F72 A;  2VKE A;  3HOX J;  2EPF A;  3K70 D;  1RET A;  5GAG J;  1R1U A;  2HTJ A;  1LDK B;  5M3M J;  3GF2 A;  1YJN I;  2ZSH B;  3HKZ A;  4LLG F;  5DV5 A;  3PSF A;  2JA8 J;  2XRO A;  3T5X A;  4UNO A;  1I1G A;  3C3W A;  3TQN A;  1DU0 A;  1ETW A;  2EFO A;  4A3B J;  4P9U A;  3BR6 A;  3FM3 A;  3OL3 A;  1M1E B;  2MLG A;  3OR2 C;  4D7M A;  2XAG A;  3RPU A;  4XLE A;  1HSJ A;  1WPK A;  2LYC A;  1JUM A;  4PK4 A;  2DJI A;  2ZXJ A;  4BQO A;  2LY2 A;  4HNV A;  1H9G A;  2QZ8 A;  2M3A A;  3LOC A;  3DF8 A;  3DU5 A;  3F21 A;  4JK1 X;  2ME6 A;  5KCM A;  4B43 A;  2LF7 A;  1AA7 A;  2DDA A;  1ONV A;  1F5T A;  1PP7 U;  1ZRC A;  3SZP A;  4WX9 A;  3EPZ A;  3S8P A;  1YW7 A;  3M1C A;  3M1E A;  4DZJ A;  2CW0 F;  4BY1 J;  4A3F J;  2M1B A;  4XM3 A;  5B5E C;  1QNT A;  1H8A C;  1JJ6 C;  3HDD A;  4IZZ A;  1X1A A;  2P6S A;  2MYS A;  4A5M A;  3LSH A;  4UVA A;  1I5Z A;  4XRM A;  4KMU X;  2L9S A;  1LE8 A;  3KYL A;  2VOO A;  2GM4 A;  1QZE A;  4HX4 A;  1IAW A;  3ZPL A;  1YLF A;  1NG7 A;  4Z6Y A;  1OYI A;  2NS8 A;  3M8E A;  5IYB J;  4GYG A;  3KP2 A;  2KL4 A;  1HBX G;  4XKB A;  1R1V A;  3ABL H;  2NVU B;  2FE3 A;  3R0J A;  5L3D A;  4AID A;  5DUI A;  1S5L C;  2HS5 A;  4BBR J;  5K7H A;  4UXN A;  3S93 A;  1BR4 A;  4M3F A;  2QEN A;  4HLX A;  3MKL A;  1R1T A;  1PP8 F;  4M9Z A;  3GFL A;  1IG7 A;  3R61 A;  4RGS A;  1P7I A;  4ESF A;  2MW8 A;  3PQJ A;  1K4T A;  1I27 A;  5DCF A;  2V6E A;  3U2R A;  5J1Y A;  3KE2 A;  1R5I D;  2M7A A;  1FIP A;  1Y0N A;  5EYR A;  4A3I J;  4L9V A;  5KAI C;  2RKH A;  5TIS C;  1ZG5 A;  1PDN C;  4WXH A;  5LGT A;  4IJA A;  3BG5 A;  1KQ0 A;  2VC1 A;  3F9K A;  3TP3 A;  2FF4 A;  3RSN A;  2X1D A;  1R23 A;  3DWL E;  4OIO F;  2UWM A;  5EEH A;  3CCU I;  2QKL B;  3LSK A;  1MD0 A;  3HZJ A;  4HA8 A;  4I0A A;  1R4N B;  3QPS A;  2EV6 A;  2EB7 A;  1XSV A;  1X1P A;  4IEJ A;  1G3S A;  4DW6 A;  2H6B A;  3W3C A;  5LHG A;  2QSH X;  1FWZ A;  4BUP A;  5L3F A;  1A6Q A;  3HGY A;  2L7Z A;  3COA C;  1F4K A;  1TNS A;  3K2Z A;  1RC9 A;  1JHH A;  3CQZ J;  4U7D A;  5HS9 A;  1CF7 B;  1RUN A;  3H3Z A;  1QVT A;  1Z3X A;  4M9S A;  3JAM K;  1JGS A;  1ENH A;  5M5Y J;  4D0P A;  5BS6 A;  4NC6 A;  4CYC B;  2F2E A;  4BHB A;  1KU2 A;  2M45 A;  1TT5 B;  5M5X J;  2P5L C;  4LGW A;  4ZDL A;  4IQ4 A;  2XV4 S;  4M74 A;  4L18 B;  1T0F A;  2M0M A;  2IP2 A;  3LMM A;  2CFX A;  2OTJ I;  2QUF A;  2NS0 A;  4XN0 A;  3LL7 A;  4HNU A;  4IPA A;  4RBO A;  3BZK A;  2BW3 B;  2ZJR F;  3PUF A;  3GBG A;  1HKQ A;  5C3E J;  4MIM A;  3CMA I;  3CME I;  3QPL A;  1APL C;  3K70 C;  3JRG A;  2O8K A;  2UXN A;  4BKX A;  1DPU A;  4XRS G;  4E7I A;  2HOA A;  3B73 A;  1ZLJ A;  4IRH A;  3C2H A;  2ZJQ F;  3FXM A;  2AXL A;  2IRF G;  1G3T A;  4L5J A;  3JTG A;  2JA2 A;  2QM3 A;  3D5R C;  5E20 A;  1U0J A;  3KCC A;  1A31 A;  2W7N A;  5HVQ C;  2LH9 A;  1BW6 A;  3K9T A;  3VOE A;  3TDU C;  4A3C J;  3JCU C;  3X2Q H;  3F22 A;  2Q2E B;  1W0U A;  4UHT A;  3T8T A;  1IZ1 A;  5FFZ A;  4UB8 C;  1IUF A;  3S1Q J;  3V7S A;  4KIG A;  1X1B A;  4BE1 A;  3LQR A;  3NWS A;  4JYK A;  1CF7 A;  4HX8 A;  2ECB A;  4HF2 A;  1TP4 A;  2HVS A;  3GZ6 A;  1TTY A;  3AAF A;  1YO5 C;  2J5O A;  3GFI A;  3HUG B;  3KP3 A;  3BCA A;  1FMW A;  1WFX A;  2RRE A;  4NNJ A;  1GT0 C;  5J6X A;  2EZI A;  1ZQ3 P;  1Z7L A;  3CTA A;  2UUZ A;  2LMD A;  4ZC3 A;  5K5R A;  1HOM A;  3DPU A;  5HDK A;  2OC6 A;  1G3W A;  1WKM A;  1N78 A;  2VXD A;  1OJL A;  3CCR I;  2CJJ A;  2W25 A;  1B6A A;  2R7W A;  5FRM A;  5EF6 A;  2OCE A;  3FIS A;  4PZJ A;  3KYC B;  3OYA A;  4NC7 A;  2ELK A;  3HKZ N;  1HKS A;  2Y2Z A;  4EAT A;  4NBQ A;  4YIR X;  1IW7 F;  2XRN A;  1LVA A;  1AKH B;  1ORK A;  1VF9 A;  2GAU A;  4G9Y A;  3U9G A;  2WAD A;  2K7L A;  2P8T A;  5EEG A;  5J4V A;  2Y0S N;  1E2X A;  2HOT A;  1D0X A;  2K4J A;  4FHT A;  3SFZ A;  5D6F A;  5ILV A;  1P2F A;  2KFD A;  3RCO A;  4Y33 A;  2EJR A;  1LPQ A;  5TJJ A;  1YW8 A;  2Y48 A;  3HJE A;  3U1D A;  3HL2 A;  1U8B A;  3A2K A;  1P6R A;  1QHH D;  4F91 B;  3H92 A;  3PFY A;  2I10 A;  1LDD A;  3BZ6 A;  2YS9 A;  1BI3 A;  4HDU A;  5D4R A;  1MJ9 A;  2XAQ A;  1RNL A;  3RDI A;  4M3G A;  3FKI J;  3MVP A;  5DM6 F;  5E1X A;  1J9I A;  2KIS A;  4DGW B;  2JPB A;  2BVL A;  2WAQ A;  3E6B A;  4UUT A;  3GTM J;  2DYR H;  2GZW A;  2ESH A;  1X3Z B;  2E34 A;  3IAS 2;  5M3F J;  4YG2 F;  3TOB A;  1FMV A;  3PUB A;  3H3V K;  2LF8 A;  4QSH A;  3KYD B;  1XSX A;  1R9T J;  4A12 A;  1WJC A;  5ILS A;  3CMM A;  3PQK A;  2W48 A;  3PM1 A;  4P1W A;  1TWG J;  3LA7 A;  4G6T B;  2F5F A;  1KZH A;  1OYY A;  1X2N A;  3HGG A;  3CC2 I;  2ESN A;  5FD5 A;  2E2H J;  4LG0 B;  1EH8 A;  3VSL A;  2EQR A;  2A05 A;  1G59 A;  1MMG A;  4KYW A;  1R58 A;  1FYM A;  2H09 A;  4U0Y A;  4JQF A;  3WTW C;  4BS9 A;  3V8L A;  1FT9 A;  1MDM B;  1IN7 A;  1VQ5 I;  4Y7N J;  5ICG A;  3L1P A;  1EH7 A;  4G94 A;  1XG1 A;  2VE9 A;  1P9Q C;  3E6M A;  1VFC A;  4BBS J;  4D5F A;  1TWF J;  3CCY A;  4L9T A;  4EJU A;  2L7F P;  3PNY A;  3E5X A;  1MJB A;  3BR5 A;  3FMQ A;  4M3B A;  5DUK A;  4AIK A;  3IH4 A;  1I50 J;  2A6H F;  2XDV A;  3B02 A;  1TT0 A;  1MIJ A;  4IX7 A;  5C4J J;  4OIR F;  3MKW B;  2EFP A;  3KLN A;  3AG4 H;  1P4X A;  4E4H A;  1TW2 A;  2X0L A;  1OIS A;  4I98 B;  1D8K A;  4A3E J;  2KP6 A;  3BJO A;  2ELJ A;  1Z77 A;  2K27 A;  2H94 A;  1SD7 A;  3G71 I;  1TWC J;  4YFN F;  3OV8 A;  1ETX A;  2HYJ A;  2M4K A;  2PG4 A;  2Z5U A;  5FD6 A;  1OKR A;  1WJE A;  4IHS A;  1PUF B;  3K69 A;  2IA2 A;  1QVU A;  2D45 A;  3L9F A;  5FGM A;  3ZQL A;  4A0X A;  2QSG X;  2BZT A;  4FTH A;  2E35 A;  1U5T C;  4BYY A;  1ZN2 A;  1I3A A;  2Q0O A;  4XR6 A;  2JT1 A;  3BG3 A;  3SEZ A;  4U7B A;  1SFK A;  4BY7 J;  4BHP A;  1X4O A;  1TLH B;  3GZ5 A;  2LTP A;  4A0Y A;  5E1W A;  1ZGW A;  2P6T A;  3WE3 A;  4RGR A;  3F8F A;  2KQR A;  3CJT B;  2KDZ A;  2CW8 A;  3F6O A;  1WH7 A;  2JRT A;  3SQN A;  1BL0 A;  5CYV A;  2A69 F;  3IL2 A;  1MDM A;  5H6R A;  1AHD P;  1UZC A;  1LEB A;  2K86 A;  3FKJ A;  3ECH A;  2ZBK A;  4AVZ A;  1WGX A;  5ED4 A;  5HLG A;  4CIC A;  2PLY A;  1MMA A;  1JKQ C;  2LKS A;  4V19 K;  1MBK A;  2HDW A;  2M7B A;  3KZY A;  4MGR A;  2R7Q A;  4CA0 A;  1T6S A;  3U21 A;  2G0E A;  4A6D A;  2A3S A;  1RIO H;  4XRS A;  1B4A A;  1D5V A;  4RS8 A;  4IRI A;  1W7P A;  4A93 J;  3I59 A;  1T0F C;  1H0M A;  2R7S A;  5D8K B;  2FU4 A;  2F4I A;  5CVV A;  2VJI A;  1DDN A;  1TQM A;  2CQ7 A;  2QGU A;  3S1M J;  5GP9 A;  2O9L A;  4M3D A;  3S2D J;  1VQN I;  3VYU B;  5IP9 J;  2R92 J;  1SD6 A;  2DDB A;  1XC5 A;  3MZY A;  2BGC A;  2FQ3 A;  1XGN A;  2PX9 A;  5DD4 A;  3RPU D;  4G7O F;  3K0L A;  2DA1 A;  4JOM A;  3MAJ A;  2H27 A;  1SEU A;  3DEU A;  1XN7 A;  2UV1 A;  3LA3 A;  2R4G A;  4RB1 A;  3J81 Z;  4RDU A;  2FRH A;  3BT9 A;  2GQQ A;  1QHG A;  1SAX A;  3JSO A;  4Z2Y A;  1K7A A;  4LIT A;  2LVS A;  5L3E A;  4XKV A;  5FLV A;  1Z3Y A;  2VXZ A;  3N05 A;  1ZHF A;  4RM3 A;  5B1A H;  2QQ8 A;  5BMZ A;  1XPX A;  1J75 A;  3CLQ A;  3BJA A;  2R5Z A;  1LQ1 A;  2UZK A;  2QVO A;  3KET A;  2JQ7 A;  2GBY A;  2JJ7 A;  2IXS A;  5IPA A;  3M3Y J;  2X48 A;  3ZN0 A;  2V9K A;  1BJA A;  1REP C;  1SAN A;  4BDZ A;  1LB2 A;  4UVB A;  1EJ9 A;  1J09 A;  4UVC A;  3GTK J;  3HPH A;  1S29 A;  2EA4 A;  2OCC H;  2CUZ A;  3MWM A;  1K6Y A;  2DT7 B;  1I3Q J;  3WG9 A;  4IL6 C;  3OYN A;  3FBN B;  3S3M A;  1A6I A;  2TDX A;  4XOR A;  4B44 A;  4BH9 A;  3ZQG A;  1QZZ A;  5JVT A;  3GFJ A;  4QPO A;  4N9I A;  1W5T A;  2L7K A;  5IY5 H;  1MMD A;  1S7O A;  3QYF A;  1OFC X;  4CH7 A;  4PFP A;  3FHZ A;  2NVT J;  3E0J B;  1W7P B;  2L9R A;  4X1E A;  3S14 J;  1E17 A;  1HF0 A;  5E8I A;  2MBF A;  4KIC A;  4ZYD A;  3SDG A;  3CJQ B;  1W4M A;  1XS9 A;  2B0L A;  4M9X A;  2ACJ A;  2CG4 A;  2DYS H;  2GIZ A;  2ISZ A;  4JP0 A;  1G2H A;  2QKM B;  5E3N A;  2IA0 A;  3BPV A;  3QPH A;  1IV6 A;  3BTJ A;  4F92 B;  5DYM A;  3IWZ A;  4A0Z A;  4B3X A;  2CUJ A;  5CVR A;  2Y75 A;  3WTU C;  3EUK L;  1IN5 A;  1TQP A;  4BAY A;  1FYK A;  2HZT A;  3J80 K;  5DCM B;  2HOS A;  1O57 A;  3GO5 A;  4EM1 A;  5K5Q A;  3WTV C;  2QEX I;  1D1B A;  1U9N A;  3H9G A;  5J8C A;  3VWB A;  1VTN C;  3QOP A;  4C3H J;  3RJP A;  3HIF A;  2IGM A;  3OR1 C;  4D1Q A;  2RNG A;  4A3D J;  4OIP F;  4MO7 A;  3QU3 A;  1MH4 A;  1E0E A;  3LSP A;  1K79 A;  2Y0S A;  1J0R A;  2XGE A;  1GHC A;  2A6T A;  4MFD A;  1MH3 A;  3GLX A;  2HPI A;  3OIP A;  3ZQQ A;  3FHN A;  2DPU A;  5LFA A;  1VZ0 A;  2V4J C;  4QPQ A;  1IN6 A;  2R7V A;  2WB1 N;  4CYD A;  2XKO A;  3A1Y A;  3BRO A;  3A0H C;  4O6J A;  5GAE J;  2KZV A;  3T8R A;  1LEA A;  2EH3 A;  1YRN A;  3BG7 A;  4AUX A;  4NQW B;  2JRM A;  3FK6 A;  1XMK A;  2NXN B;  2WA0 A;  3WU2 C;  5LGN A;  5JI6 A;  3B6A A;  3TO7 A;  3OYI A;  1ZK8 A;  2VT3 A;  2MAB A;  3DEW A;  1ZRE A;  4MQ9 F;  5F27 A;  2K02 A;  4P96 A;  1IRG A;  1FTT A;  2VJJ A;  4Q48 A;  2ID6 A;  2OZ6 A;  4IOA F;  1ZRF A;  2IS2 A;  3M7G A;  5FO5 A;  2AO9 A;  1Z1D A;  2F4O B;  2FD5 A;  2HQA A;  3LFK A;  1XD7 A;  1ZYR F;  3S15 J;  5IYC J;  3N4M A;  2IGN A;  2ZXH A;  4DYQ A;  1BI2 A;  4NB5 A;  4B8X A;  3CDH A;  2ZFU A;  1YIT I;  1NH3 A;  3HOZ J;  1KQ8 A;  4FAS D;  2MFZ A;  4M3E A;  1W36 D;  1U2W A;  1PUE E;  3DKX A;  5ERI A;  1IN4 A;  2CUE A;  3K1P A;  1UB9 A;  3NAR A;  1ETO A;  4J01 A;  1GXQ A;  1Y56 A;  1ON1 A;  2GA1 A;  1S6L A;  4DYR A;  4CSW A;  2OV7 A;  4I0B A;  4I02 A;  2DMN A;  2Q8K A;  4IHT A;  1CGP A;  3MEX A;  1MBG A;  1OR7 C;  1FZP B;  3DFG A;  3FXU A;  2V1D A;  4GXO A;  4CCK A;  1Z9C A;  5CJ9 A;  1X1C A;  1LE8 B;  3DPT A;  3Q0W A;  3EUH A;  4CHU A;  2FBH A;  5CLS A;  2LFB A;  4EV0 A;  2GWR A;  1K61 A;  5CPR B;  4EMS A;  4L9J A;  1BA5 A;  3Q9V A;  1B9M A;  3FXJ A;  3G1L A;  4BU2 A;  3T0Y A;  3LAJ A;  4JX6 A;  4S0H B;  4KFC A;  3HTS B;  4YIF A;  1X1D A;  1LJ9 A;  3CMY A;  1RKW A;  3DKW A;  3C2B A;  4RAG A;  3H5A A;  5F0F A;  3C2G A;  1IXR C; 
#chains in the Genus database with same CATH homology
 1VQ7 I;  1VQ9 I;  1VQ5 I;  1VQN I;  1FOW A;  2NXN B;  3J7Z I;  3I56 I;  2H8W A;  1YIT I;  5GAG J;  3PIO F;  2K3F A;  1VQM I;  5JVG F;  1VQ4 I;  3G6E I;  1ACI A;  3G71 I;  3CF5 F;  3CCE I;  3CCM I;  2E36 A;  3CCR I;  1YJN I;  4V19 K;  2ZJR F;  1HC8 A;  3CC4 I;  3CCJ I;  1FOX A;  1Y39 A;  1YHQ I;  1S72 I;  2JQ7 A;  4UY8 I;  1VQ6 I;  3PIP F;  3CMA I;  3CME I;  1VQ8 I;  1VQK I;  3I55 I;  2QA4 I;  3CC2 I;  1VQP I;  2ZJP F;  1MMS A;  3DLL F;  1VQO I;  4IOA F;  2QEX I;  1VQL I;  3CD6 I;  3CJT B;  3CCU I;  1YI2 I;  5DM6 F;  2ZJQ F;  1QA6 A;  3CCL I;  2E35 A;  3CCV I;  1YJW I;  4IO9 F;  3CCS I;  1YJ9 I;  2OTL I;  5GAD J;  1YIJ I;  4IOC F;  3G4S I;  5GAH J;  5GAE J;  3CC7 I;  1FOY A;  2OTJ I;  2FOW A;  3CCQ I;  2E34 A;  3J7Y J;  5DM7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...