3PIOF

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3pioF00
1VQ8I 3CCSI 1YITI 2OTJI 3CMAI 4UY8I 1YI2I 5DM6F 3CCEI 3J7YJ 3PIPF 1YJ9I 3CD6I 3G4SI 3DLLF 1ACIA 1Y39A 4IOCF 3CCVI 1VQ9I 2ZJRF 4V19K 3I56I 1VQMI 1VQNI 2E35A 3CC4I 4IO9F 5GADJ 2K3FA 1VQPI 2ZJPF 5DM7F 1YIJI 3J7ZI 3CC2I 1FOXA 4IOAF 3CCQI 3G6EI 1VQ4I 1MMSA 1YHQI 5JVGF 1VQLI 2FOWA 1VQ6I 2OTLI 2E36A 3CCLI 1FOWA 1S72I 1FOYA 3CC7I 1VQOI 2ZJQF 2QA4I 5GAEJ 1YJWI 1HC8A 3I55I 1VQ7I 3CF5F 3CCJI 1QA6A 3CJTB 2QEXI 1VQ5I 1VQKI 3G71I 3CCMI 3PIOF 2E34A 2H8WA 2JQ7A 2NXNB 5GAHJ 3CCRI 5GAGJ 3CMEI 3CCUI 1YJNI
chains in the Genus database with same CATH superfamily
2EZHA 2YSRA 5KAIC 4OWRB 4XR6A 2ME6A 3ZQFA 3HL2A 1O7FA 4B09A 1K7AA 1ETWA 2LREA 3PM1A 4PDKA 3OYGA 2ZXIA 2AQEA 1X2MA 5D8KB 1T33A 2VIXA 4CDGA 3WU0A 2A61A 2M1BA 1TWAJ 2DFHA 3LSGA 1XMAA 4N9HA 1G3TA 4C30A 1TQMA 3UNGC 5EEGA 4E70A 3OSFA 2KLOA 5IT9K 1V55H 2HR3A 1IG7A 4RAYA 3BCBA 3JRGA 1PYVA 1ZG5A 2DI3A 3U1KA 3QQAA 3OSGA 2BXZA 3QOPA 2Q8KA 3RPUD 4DBQA 3B73A 3BP8A 3NWTA 3F8NA 2QQBA 2DYRH 1ZHFA 3S3MA 5KVRA 2LLKA 1XDUA 2OD5A 5D5XB 4B44A 1L3LA 2LF8A 1U9NA 1Y8QB 5LD2C 1CF7A 2L7MP 3TL4X 1B8IA 1OYIA 2WY7Q 4HX8A 4RM2A 5BNGA 4AYBA 5LRSA 4AVPA 2TRTA 1IN8A 4N4NB 2HZDA 4M9SA 3SHFA 3BC8A 3BTCA 4MEXF 4KN7X 4BJ5C 1JUMA 2X1DA 3M1CA 3BQYA 2B63J 1IAWA 3LSJA 2KRCA 2Z99A 1WJDA 2F48A 4KUMA 1DU6A 1WPKA 1GV5A 2KHMA 3JAMK 1RPWA 1HCRA 2O8KA 3SEQA 2V9PA 2XRNA 5F0CA 2WA0A 1ON1A 3WTWC 2QSFX 3ASOH 3G1LA 1TWGJ 5K5OA 3HOXJ 2UXXA 2VQHA 3TO6A 3BR1A 3CP8A 4A0YA 4RAZA 1ZR4A 2DPDA 1ONVA 2UWMA 3DTKA 2ISZA 4IHTA 4D7MA 5F0FA 3L2WA 2P7CB 2BE5F 2OQRA 2VBYA 3GYHX 1LEAA 4UB8C 1HSJA 4PGHA 3KP5A 4YRVA 1MD0A 2RQQA 4HLXA 3MVPA 4HSTA 5EGOB 3SDBA 3OS1A 3EQLF 2VQCA 2P5LC 4OU0A 1SMYF 2NVQJ 1HW1A 2CFXA 5HDNA 3HKZA 1KU2A 1WH5A 3AG2H 1W36C 4OMYA 2PJPA 3DKYA 1QU3A 4I76A 5GAGJ 4C2TA 4DOZA 1V4RA 3C2GA 4TV7A 2W4SA 3SYTA 2XUBA 3CO6C 2XDVA 2GAUA 2LTPA 3QU3A 4LMYA 2M3AA 2WAFA 1S9HA 1OISA 2P5VA 3F8MA 4PK4A 5CJ9A 5FLMJ 2XPUA 3I3LA 1JXSA 1BW6A 2B7EA 1O3SA 2M87A 3FF5A 4HOBA 2V7FA 4EM2A 3G2BA 1P4XA 4JX6A 4ZYAA 5F1JA 5JFRA 3KETA 1R4MB 2KJBA 2VKVA 1JUSA 1HKQA 4CCJA 2F4MB 5EZHA 3CJQB 4M9XA 4MO7A 2ZJRF 1RR7A 2HYJA 1EH7A 4XORA 4ZZDA 4XN3A 2LMDA 3DPTA 3ZXSA 3ZMVA 2FQ4A 2ECBA 3H3ZA 3FXUA 4PZJA 3WTYC 4KDPA 2R5ZB 2IS2A 2XAHA 3ZR8X 1XPXA 1OCRH 4HF2A 2X6OA 3KYCB 3R6SA 3QPLA 4LD5A 2KMUA 2RGVA 1SD5A 3FXMA 3ERMA 2STTA 3O3KA 3ABUA 2V1UA 3ZPLA 5M5WJ 4XONA 1PUEE 3OYLA 1FNNA 2FD5A 4I7HA 2K4BA 1OCTC 4IHVA 5LGUA 1HDDC 4M3EA 3S3NA 4JYKA 3OMYA 2H6CA 3VEPA 3OYNA 1ZRDA 1BIAA 1Q1VA 1Z6RA 1FEXA 3PNYA 1FOYA 3OL4A 3J81Z 3L2VA 1YLFA 2MYSA 4UUTA 3WG9A 4MTDA 3F3XA 1IRXA 4IPAA 4P1WA 3MKWB 1LB2A 2JPCA 1H9GA 1TL8A 4B48A 2UXNA 3B02A 4DBRA 5K7ZA 1NH3A 1FSHA 1F5TA 3BCAA 2VC0A 3HYIA 3A02A 1K6YA 2MBFA 1FMWA 4LK0F 5E3OA 2E2IJ 4N4OB 2D45A 3DBLB 4UHTA 1HXDA 4BGDA 2Z16A 3M8JA 4FCYA 2CW0F 2MC3A 3O2PE 2GA2A 4HF0A 3FXKA 1BL0A 3HM5A 3BR0A 2YR2A 2TCTA 2PI0A 5HLGA 4GO1A 4XM3A 5EEHA 4BJ6C 2CUFA 3HUGB 2NS7A 2P4WA 1BI3A 4KIBA 2OF7A 4D5CA 4WF2A 2KZGA 2HVRA 1BOAA 4HPQA 2JVHA 5HNFA 4D9JA 2R0QC 4EJWA 3JRFA 2ZMEB 2DA2A 4ZC3A 3BZCA 1SMTA 2VB6A 4G7OF 4RGSA 3WHBA 2JJ7A 3WU1B 3C1DA 5DM6F 4YEJA 3W2AA 1E17A 2HQRA 1UJ8A 2KIQA 5EYRA 1BI2A 1FPQA 2BV6A 1G4DA 1RUNA 2FMYA 3L2CA 2VUMJ 1D1CA 1T38A 2OU2A 1JKQC 2HEOA 3S93A 1VF9A 3H0DA 3FM3A 4EQQA 5BOXA 3ABTA 1MGTA 4CZZA 2W1OA 1PVEA 1ZGWA 3CDLA 1MBJA 3G73A 2R7TA 5HOOA 1XGSA 3ABKH 5DS9A 5A2QK 1K61A 2AXLA 3BG3A 4A6DA 1T8IA 2HTJA 2LC2A 2IAIA 3K4NA 3HZJA 3TOAA 1UCRA 1OKRA 2Z1DA 3KIOA 2ZNZA 1MKMA 5FO5A 2LF7A 3BLYA 4NNJA 2JA6J 2R3SA 3A0BC 1MBHA 2KJCA 2QQ8A 1YW9A 1E2XA 3TEDA 4L0YB 2M34A 5ILSA 1IC8A 1P4AA 1YX5A 2XKOA 3HGGA 3H0GJ 5FD5A 2PN6A 4HNTA 3ZRGA 4BEHB 4FX4A 4UNOA 3JTGA 3KLNA 4KNYA 1G59A 3HHHA 4NQWA 1RNLA 3E0JB 3HBLA 1T56A 2M7BA 4HA8A 2V1XA 2BHZA 4CCMA 4F52A 2OTLI 3HUGA 2K40A 2HQ5A 1GLNA 3V4GA 2WV1A 1JE8A 1W7PD 2KDOA 1JGGA 1DGRM 2CUEA 2E1NA 3M8EA 2IA0A 4ZZLA 1MBFA 2LVSA 4E7KA 1VFCA 2BVMA 4OIOF 3KZZA 3EETA 3MMYB 2CQKA 3BTJA 3HC7A 4MHGA 2CJJA 3LA7A 1F4KA 4KISA 3CF5F 2HXIA 1W5CC 2VQGA 4NB5A 4A0ZA 2EIKH 4XMYA 2IVMA 3GVAA 1TC3C 3UR3C 4RAGA 5LEJA 3D1NI 1IXCA 4U0VA 1ITYA 1IZ1A 1MBKA 4Y3OA 4MGRA 3V42A 1M1EB 2I5UA 4OIRF 4YIFA 2F5EA 3K0LA 3GX4X 1I1SA 3N97A 4BQAA 4R1HA 3I59B 2GZWA 3VPRA 3LSRA 3OWTA 3BG6A 3S17J 5J4YA 4KITB 4M3DA 1YITI 1Y1WJ 3RYRA 1XCVA 4E7SA 2ZB9A 3KP2A 4ASNA 2KQRA 5HODA 1S7EA 4A3FJ 4BEHA 3GZ5A 3V8LA 4B1RA 1BI1A 3F8FA 4MQ9F 4ZTJA 2QENA 1ACIA 3OYCA 2NRAC 1HA8A 3NQOA 3PUFA 4BU2A 4RB2C 1JUPA 1LFBA 1D1AA 3WTVC 2KDZA 1T0FA 2FSWA 2KZVA 2IPQX 2JSPA 5FROA 4WX9A 2HDWA 3P5JA 5D5VB 2MH9A 2E35A 2JWTA 3IKTA 4IL6C 4Q5SF 2QZ8A 5DCMB 1FYKA 3BROA 2CGPA 2DMTA 2R7ZJ 1ODDA 2AQFA 4QPOA 4AC0A 2W7NA 1VQPI 1B9NA 1Y8RB 2MD5A 3LSIA 3KEQA 1S3JA 1R9TJ 1QBJA 2WAQA 3CUQC 1K4TA 3C3WA 2RKHA 2QGUA 4NUBA 5ICGA 4BDZA 5DDGA 1WZ2A 1Z91A 4RMNA 3VDXA 3FHZA 2QCOA 3GUDA 1GVDA 2GLOA 2LNBA 2XAJA 3ZQQA 1YHQI 4AD9A 4PJLA 3U9GA 3H5RA 5CVRA 5J1YA 5DCFA 4M72A 2HQNA 2VLAA 2VBWA 4P9FA 1IRGA 1RC9A 2CW7A 4PJJA 5DD8A 4XSZF 3I59A 3ROUA 1OR7A 4EGZA 1GT0C 2OPTA 1P4WA 3DLAA 1WVRA 3DU6A 3ISPA 4L5JA 5BQTA 5HS7A 1UHMA 4ON0A 4G9YA 1H0MA 3I9V2 3MEXA 1YJWI 4RGUA 4EEFG 4FT8A 2E7XA 2MSYA 4RB1A 3P7NA 5M3FJ 1GHCA 2Z5UA 1TT0A 3ERED 1KU9A 1IN4A 3KLOA 4AU7A 3DTIA 1QA6A 4IKFA 3A0HC 4XLCA 1VQKI 3PSFA 4XKBA 3CCMI 3PIOF 3GLLA 4GYIA 4DQ2A 2DMUA 1O4XA 4F3QA 3FXRA 4WXCA 5K1YA 5LHGA 5FJ8J 3K1MA 3F72A 3RI4A 2CO5A 5GP9A 3FISA 4XK4A 3R4KA 1KQ8A 3OYJA 4BH9A 3IH4A 3L2UA 2OUMA 5DCMA 2ESHA 3IWFA 2VASA 2PMZA 4HG2A 1ON2A 4M9ZA 3H35A 1YQAA 3DCFA 1YJ9I 3QOEA 3Q5FA 1WWXA 4JOMA 5H6QA 1L0OC 4RBOA 3K69A 3F6VA 3DLLF 3CQZJ 1BJAA 1QGPA 2R4GA 3FZVA 4D7NA 1IXRC 2GXGA 5JR3A 2DBBA 2OV7A 5B5EC 4HX4A 1SC7A 3S14J 2QVOA 2PEXA 4IOCF 2PJRB 1F36A 4LG0A 2HQAA 2IA1A 2VJJA 1HW5A 2M4GA 1BIBA 2ZJ2A 1WI9A 5J1RA 3HOUJ 5IP9J 2XV4S 4A6EA 1DP3A 1TP4A 4XQFA 1B72A 3G1MA 2DDAA 2M7AA 3F0CA 1WJEA 5KHDA 1PP7U 2VI6A 3AKZA 1IV6A 5CQGA 5BPIA 1ZKGA 2EZIA 3LMMA 5D5UB 4IEJA 1ULYA 2EFNA 3LQQA 1D8KA 2HFHA 4EMSA 3IH3A 3JRCA 1T0FC 3RJPA 3IV5A 2XC7A 1B6AA 1R58A 3IC7A 3GFMA 1FBQA 3VODA 5IYBJ 3BJ6A 4EV0A 4BE1A 5IY5H 1P7JA 3HOWJ 3TW6A 3ZP5A 3HPGA 3QODA 5H2FC 5IYDJ 3OYAA 2QSGX 3I64A 1ZGAA 2FA5A 3DBHB 4IX7A 3DEUA 3O6BB 2W84A 4MNUA 1SVOA 2P81A 5FRNA 2ZJQF 2E1OA 5DYMA 5D5WB 5TRDA 2ETHA 1BN5A 3LQRA 3M9AA 3IP4B 2QA4I 2EZKA 4IRHA 3PQJA 3CMYA 5K5RA 2ISYA 2WADA 2YX7A 4P9UA 2XGXA 1XTAA 3K4JA 3GWZA 4UVCA 2EIMH 2DFIA 1W5SA 5IT9Z 3I55I 4LG3A 3S1NJ 2FX0A 1MZBA 5HLHA 1OMIA 1OCOH 3GTOJ 3IH2A 2ADUA 4WXDA 4XRMA 2PJRA 3OYKA 2GOMA 2QEXI 5LRRA 1J75A 2IJLA 1RRJA 4RLFA 1OR7C 2VKHA 3ZQGA 3HTSB 2O9LA 2CW8A 3DEWA 5JLWA 4BJTA 1IN7A 3H9GA 4XLHA 3CCRI 2AXTC 2NVXJ 1UAAA 2WB1A 4G6TB 3HSFA 2QQ9A 4XRSG 2H8RA 4CYCB 2M8GX 1AA7A 1R5GA 2COBA 1WJFA 1V54H 2QQAA 4CCKA 3MCZA 1QNTA 3PNVA 2A68F 1ZLJA 1WJAA 2P0WA 1MNMC 2NS8A 1FIAA 4LIVA 4FE4A 3LSPA 1EH6A 1LVAA 5GTHC 1X1CA 3L7WA 3V7CA 3MZHA 1FYMA 1T2KA 4A2UA 3F22A 4E6KG 1HQCA 5H6RA 3TO9A 3BTLA 5CVIA 3CESA 1D5YA 3H5NA 1QVTA 3K1NA 2MFZA 3L2RA 2P6SA 1TWHJ 2K7LA 3H36A 3KP3A 3VSLA 2L9RA 2M30A 4A5NA 5DM7F 5E3MA 3E5XA 4RGRA 3MKYB 2Z33A 1FOKA 4LB5A 1I5ZA 3FWEA 4BQNA 1YS6A 5LGNA 3BG5A 1ZREA 1R1UA 4HLYA 1QQIA 1IGNA 1YRNA 1U0JA 3MZ8A 3EYIA 1IRZA 4RB0A 5L3EA 4HQEA 1Z3YA 3O8GA 5ERIA 1SAUA 2X85A 5AIQA 4E7HA 2XIGA 1JT6A 2A6HF 2K9SA 4BY7J 5B1AH 3DKXA 2ZFUA 4CHUA 2HOEA 3JW4A 1X19A 2XF5A 2IW5A 4M3BA 1MSEC 4M6VA 2XAFA 2VONA 2HZTA 3HRTA 3S15J 1ZARA 4CYCA 4LJZF 4IHSA 4C9YA 2AO9A 2KIUA 1BM9A 3QPTA 4HSRA 3M4OJ 3LA2A 3DEEA 3JSPA 2WC2A 2XSJC 2ICWG 2L7FP 3CJRB 3DXJF 2IT0A 4B47A 2CFOA 2CV0A 2DDBA 1HSTA 4BY1J 2FJ1A 2R5YB 3SXYA 4GRIA 3C18A 5BMZA 1JHHA 1X4OA 3COAC 2VPLA 2RREA 1O3TA 3QP5A 4NHJA 3IHUA 4HBLA 1WI3A 4ENKA 1XGNA 4L9NA 3RYPA 5ICEA 4BACA 4D5FA 2HVQA 3RZOJ 1R36A 5CYVA 3E5QA 2JQ7A 3RZDJ 2FF4A 1H8AC 5J3LA 1WJCA 1G6NA 4IHWA 1KONA 1YIOA 3REOA 3KFWX 3WGIA 5EEAA 1WHUA 5DV5A 5CKTA 5E1WA 1JJ8C 3E6BA 3FXJA 1X3UA 2YU3A 4A5MA 1UB9A 1KGSA 2F4IA 1WJBA 5K7HA 4GFBA 1GUUA 4IJAA 1V5GA 3E1SA 1GXQA 3QRFF 4ZDOA 1ETQA 1B59A 3LFUA 1IUFA 2LR8A 3ELKA 4ENJA 2W24A 1ETOA 1BR1A 4QWQA 1Y39A 2X4HA 2LY9A 4I98B 3DWLE 2JA8J 1I6XA 2LY1A 2K9NA 4V19K 3G3ZA 1G3WA 5C3EJ 3GZNB 4GGGA 3MZYA 3J80Z 1BBYA 2IS4A 4QTRA 1SD4A 3FBIB 5J1UA 3VB2A 3CC4I 1Y0NA 1I3AA 2ZCWA 4IO9F 4J00A 2K9LA 3ZCOA 2BY3A 3CJNA 3GEZA 1ZLKA 3FBNB 3HGYA 5DEQA 4RB3C 1VI0A 2ZSIB 2BYVE 2R5YA 4OAYA 3SZGA 3F23A 1B1BA 1HOMA 3LAJA 3RKQA 5M3MJ 2E2JJ 5FLXK 3R60A 2IP2A 2NNNA 2AS5F 1HBXG 2L3DA 1LDKB 2FOWA 3DKWA 4HV6A 3WGGA 3WTZA 3U1DA 5FLVA 4DW6A 1ZG3A 2RNJA 1Z6TA 2V26A 4XNFA 1REPC 2EFQA 1FBSA 9ANTA 3ZQLA 5KCMA 2ZXJA 4K2EA 1FZPB 5HVQC 3U2RA 2H6BA 3HDDA 2VOOA 3OYEA 4MQVA 4XKCA 2LG4A 1XSXA 1FTZA 2G0EA 4Z6YA 3EUKL 3MD2A 2DT7B 1MW7A 3R61A 4BXUA 3EYYA 1AHDP 1G8XA 3GTMJ 3M8FA 2R7RA 3S1QJ 4PFPA 1JKPC 4F92B 2KRFA 1NG7A 5A2QZ 1R7JA 3CUQB 3E6CC 2CS3A 3NEUA 2HOAA 4FASD 4HEA2 1SD6A 2FE3A 4CA0A 3JSOA 2DOFA 5K7FA 2PLYA 4M71A 1JT0A 3WTSC 3K10A 4LFUA 1QZEA 4AIKA 1Y6IA 1XX5A 2FXAA 5D6FA 1I6HJ 5IP6A 1FC3A 2K5CA 5F1RA 2GXBA 1T6SA 5D6EA 2YS9A 2Y0MA 5FRMA 4L9VA 3SEZA 3HOVJ 3TQNA 4MEYF 1IN6A 3KP4A 2XVCA 2E1MC 1FTTA 5CQEA 1WKMA 4Y13A 1FYLA 3AL0C 2DK5A 2W82A 3ZGKA 3PIPF 1YG2A 2OAZA 2F4OB 3K6GA 3KZYA 2A6TA 3JRIA 2HDDA 2H1LA 2IGMA 2V1NA 1Y1VJ 4NQWB 1RR8C 2K86A 3LSTA 1R22A 2DA1A 4IHXA 1LDJA 1QVUA 1FP1D 1ZN2A 5FB2A 3K4LA 3GLXA 4BHBA 3ML6A 2WWYA 1C0WA 2OC6A 4I0BA 2L7ZA 2LOOA 1BC8C 2DQLA 1DP7P 2DXIA 1HF0A 3QYEA 4LGWA 2P6TA 2VBZA 3I53A 3JCUC 4B3AA 1QPMA 4ANJA 3A4CA 1ETXA 4Y17A 1YW8A 1Z9CA 3QPSA 2BVLA 4UVAA 3BDDA 1OPCA 2VQLA 4WXHA 2FNAA 4M6XA 3ZQIA 1WFXA 1Z67A 2LK2A 3DU5A 2E71A 3RTRA 4KFCA 2M8EA 1YOVB 5AIPA 1PJRA 1XC5A 3H9QA 3CUQA 2ACJA 2MC4A 2BXYA 2W25A 2EA2A 3CCYA 5D4SA 1U5TB 2R7UA 2OQGA 1N25A 1ZG1A 1BOBA 3SZTA 2Y69H 4ZTFA 2K9QA 2M0MA 3FXQA 2ZXWH 1A31A 1AOYA 3FMQA 3P9CA 3IAM2 3S2DJ 1D0XA 3LL7A 2K27A 1SVLA 1UHWA 2Y48A 4C3HJ 2L01A 4G7ZF 2DA5A 4II3A 3WTXC 3E6DA 2JUGA 1ZYRF 1XD7A 1MDMB 2DQRA 2DT5A 3K4MA 2FEZA 2XGCA 3L00A 1BA5A 3NAUA 4PGGA 2EV6A 2CMPA 4UVBA 1IUYA 1VQ7I 3CDIA 4E4HA 4FETA 2ZC2A 3CCJI 4XRSA 2IEKA 1P6RA 1EA3A 3CF2A 4A3BJ 1TBXA 1NTCA 4U0YA 4B3XA 3KEYA 4PUSA 1MSFC 2WTEA 2H8WA 3RIRA 1ZGJA 2DA3A 4HYEA 1IRFA 1TWCJ 4U7BA 5IOZA 4M74A 2JA5J 1XGOA 2L4MA 2MW8A 4ZDPA 5C44J 1LFPA 1UG2A 3H3UA 4U0WA 2X6XA 1IDYA 4Z2YA 5ICCA 1A36A 2O6GE 3LSKA 1W36D 3KZIC 4HW0A 3L9FA 3EPZA 3KP7A 4QSHA 4D0PA 3W6JB 3LNQA 4A3IJ 3KPHA 1A6IA 3OV8A 1RZ4A 1XB4A 5L3GA 3WODF 1A04A 1S5LC 1UHSA 1E3PA 1X1DA 2XRLA 3S32A 4ENMA 3T8RA 3DF8A 1FY7A 1U5TA 2XGDA 1G3YA 3LAPA 4X6AJ 2KL4A 4EM0B 3JRHA 1CGPA 3CCVI 1H89C 4UUVA 1TWFJ 1YE9A 3IRRA 3MKLA 3I56I 5J8FA 2WBMA 1LDDA 1N77A 5L3FA 3OY9A 4PCQA 3CP2A 2BOLA 1G3SA 4WCGA 1FJLA 3GTQJ 2CV1A 1P2FA 4I09A 1W0TA 1P9QC 2D1HA 1T95A 1DPRA 4WWCA 1D3YA 1R5ID 2P5KA 3PJRA 1MDMA 3FDYA 2R92J 2MG4A 1SD7A 2ME0A 2L7KA 3K1PA 4LIUA 4XOPA 3MFKA 5C4JJ 2CUJA 3ZQ7A 2DTRA 4IRIA 1DU0A 2EFPA 3FM5A 3HTUA 3IWZA 3QYFA 2RC4A 4L5EA 2EFWA 2NVTJ 4BAYA 1SVMA 3BOQA 4BDYA 4F91B 3WTUC 1MMAA 1WJ5A 3FMRA 1K78B 2L0KA 2IS6A 4A69C 3HOSA 1IN5A 5CLSA 2O61A 1OQYA 5CVJA 2ELHA 5TJJA 3BR6A 4BBRJ 4BBSJ 3IRQA 2YPRA 4W1UA 2M2EA 2OCEA 3LSMA 5GPCA 2HKOA 5DTDA 1P7IA 1Z7UA 3LFKA 4JQFA 4XBFA 3FK6A 2VPRA 2G7UA 3GF2A 3ECOA 1JGSA 1N75A 1Z7LA 2DLLA 2KP6A 2M5WA 2N8GA 4AVZA 3OOPA 3CLQA 1IF1A 3Q3SA 5FKMA 2DOAA 5F6FA 1UMQA 1EF4A 4XRFA 4LG0B 1O3RA 2HYFA 1Z77A 3G71I 3E3VA 3D5LA 1YS7A 4ABZA 2QWWA 2EV0A 2MLKA 1PUFB 3HOYJ 3O8HA 1QO0D 1B9MA 1G2HA 2XF6A 2M9HA 3FIWA 3H1CA 1D1BA 1RKTA 1B72B 3A2KA 3HSRA 2DJNA 3I4NJ 2EA4A 2BY2A 1HKSA 4QIWN 1VQ8I 5E17F 5EDNA 2LY2A 1GVJA 2GXAA 2HYGD 3K4KA 3OL3A 3F6OA 4BL0B 3CCEI 5FKLA 4BUPA 4DYCA 4CXFA 4ZJZA 3JR9A 4RS8A 2L9SA 2LKXA 4YFXF 1IDZA 1XN7A 4FE7A 2X6YA 4KJZA 4A3LJ 3FXOA 1K78A 1MJBA 2AHQA 5M5YJ 2K4JA 3S2HJ 3ZMSA 1K6OA 1N78A 4XKVA 3VFZA 3RKYA 2L54A 2FBHA 2EWNA 1S29A 1R6RA 1VZ0A 4H4KC 3JREA 1RIOH 4I6ZA 2EFOA 4C2MJ 3ASNH 4BYYA 2WY8Q 4YELA 3PL8A 2DAOA 4E7IA 2DODA 1UG0A 2V9KA 2O5RA 2ZNYA 2VKEA 1H9TA 3E5UA 2LRDA 2EIJH 3ABMH 3P9IA 1LKXA 2LDUA 2K3FA 1XMKA 3J7AO 3OIPA 1W4MA 1FSEA 1U5TC 4YIIA 1FBUA 3W2VA 1XGMA 1POGA 4C3JJ 5M5XJ 5F08A 3TBIA 3BJOA 2V9VA 4HZFA 3H92A 4DYRA 2HI3A 2BW3B 2WB1N 1PUFA 3TGNA 4PSWA 1APLC 1QPIA 2E36A 1MNDA 5IT3A 2KKOA 2E5ZA 2DA7A 4ENNA 1LE8B 2CSOA 3AAFA 2V1DA 1S7AA 1USTA 2G7HA 2HVSA 2ESNA 4UB6C 4GDFA 2Y0SA 1HW2A 3BJAA 4BHPA 2H27A 1YX3A 1U6GA 5EG0A 2Q0OA 3K9TA 1Z05A 2JRMA 3MWMA 2CQXA 2OCCH 2MABA 3DFGA 4AIJA 4ZH4F 2R7VA 4EATA 4XN0A 5HLTA 2F5DA 3HB9A 5CVVA 3OS2A 2GBYA 4WK8F 2NS0A 1AWCA 2OA4A 4LLLA 1VQ5I 1BI0A 3VYUB 1V5EA 2EZLA 3ONQA 4CO8A 5FKOA 1R00A 1OYWA 3QU6A 1MJAA 1Z1DA 4Y15A 2XHKA 3WE3A 2K85A 4NC8A 4AWXB 2TDXA 1NG6A 4CCNA 4KT5C 4A3DJ 1IXSB 2R7OA 1TTYA 1ZAOA 2JVGA 1IV8A 2FNPA 5ED4A 3ZQHA 3PO2J 4EGYA 2X6WA 3I4PA 3CCSI 2CQNA 3WHCA 1J59A 3FX3A 2R7WA 3GCMA 3RDIA 3HIFA 1DUXC 3DPLC 4DZPA 4RDUA 4CCLA 4FX0A 3X2QH 4FHTA 3BY6A 1YTYA 4EJOA 1RI7A 1HDPA 1T39A 3OR1C 2DO7A 4MFDA 1YRNB 2HOSA 2B0LA 2NAZA 3SFZA 2BW3A 4CYDA 4JX5A 1KQ0A 2VODA 5LFAA 2CU7A 1UFMA 4AYBN 1SFOJ 1MH4A 2FBIA 3WGHA 5J4VA 2YU9J 1LE8A 1OJLA 2ECCA 3K4BA 3C7JA 5LHIA 2VE8A 1U9OA 1FMVA 3VYTB 4E7LA 2J5PA 2V6CA 2NVYJ 1VQNI 3OYHA 2QLZA 2BGCA 2LFBA 4KA4A 1DPUA 4C2UA 2EINH 3TW7A 4S04A 1U8RA 2L5QA 2ZKZA 2A69F 5FFZA 2ZFWA 1TNTA 3JAMZ 3A1YA 1Y0UA 2P8TA 2FOKA 1YIJI 1JTYA 4YFNF 5HS8A 2E1MB 4L9TA 4U88A 5D8LB 1VTNC 3CC2I 2HWVA 3OYFA 3AL0B 1FLIA 1EV7A 1FP2A 4GYGA 3EDPA 3T1BA 1XMXA 3TDZC 2E60A 4ITVA 1E3OC 3FXLA 4S0HB 2NNYA 2XPWA 5FFXA 2ID6A 2O0YA 1X58A 3M1EA 3GW2A 1J9IA 1TQPA 2DU9A 3V7RA 3BPXA 2E5NA 5C4XJ 3KE2A 2V79A 3BR2A 1JHFA 2VXZA 3GTLJ 2DYSH 1BW5A 2IXSA 3IL2A 4B4CA 1U2WA 4MIMA 2ZBKA 4C3IJ 3HKZN 2B9SA 4M3FA 4XOTA 2DFEA 1IJWC 3FK7A 4BNCA 2H09A 2LP0A 5GAEJ 4R79A 2BY0A 4P5OA 4EM1A 2WV0A 2YX4A 5J8CA 1DDNA 1X1PA 4LLGF 5F04A 2IA2A 4A0XA 2GM4A 4A3GJ 4MFEA 2CG4A 3S16J 4BE0A 3OYDA 1OYYA 2HPMA 5EJCA 2L02A 3MAJA 4RA2A 3B6CA 4Y52J 4ZYGA 1LEBA 2DW4A 5IOYA 3C2HA 1OFCX 2VJ4A 1EJ9A 4PJNA 2EB7A 2CQ7A 5JLXA 2HTSA 1MH3A 1X4PA 1ETVA 4ESFA 3CJTB 3GTGJ 3OYIA 4RAFA 1RUOA 2E1CA 2GQQA 2QKLB 2QBYA 2EPFA 3T8TA 1SFXA 4HDVA 1MJ9A 5FLXZ 1TW2A 4OMZA 3J7YJ 2GWRA 1KYZA 2BHYA 2JA7J 4ETSA 5TISC 2Y30A 2CRGA 2KIMA 4U7DA 5JHFA 1S6LA 5KAFC 3MKZA 1F9NA 3D5RC 3BZKA 3JTHA 2PG4A 2VN2A 4I02A 1CQTA 5E1XA 1OCPA 1ZRFA 1R4NB 4DIQA 2ID3A 3PFYA 2A5YB 1R23A 3SQNA 5E3LA 2XPVA 4O5VA 3TP0A 4UXNA 1YYVA 3FHNA 1W0UA 4AIHA 2QUFA 4XLNF 2G9WA 1PP8F 3LA3A 2JRTA 3CTAA 2M4KA 2DT6A 1D0ZA 4DNCA 4ESBA 2CYYA 4NBQA 1S7OA 4F7ZA 1MBGA 4ZDLA 1S8NA 3G1OA 2I8DA 3TP3A 5KNLA 1MBEA 3J7ZI 5B3SH 2L2OA 2JMWA 3VYRB 3KYLA 3HG9A 1VQ4I 3GTKJ 4KICA 1DQUA 5IYCJ 2MD0A 4FTHA 4M3GA 2GIVA 3VOEA 4H0EA 1VQ6I 2Y9YA 3EUHA 1AU7A 3HRSA 1IW7F 3CCLI 2CV2A 3BPVA 4UV9A 2QF7A 1FT9A 3V7SA 1U78A 2LKPA 3AG4H 4XICA 3HOTA 2UUZA 2RNGA 2XASA 2VXDA 3ZMZA 3Q0UA 2Z9OA 3Q0WA 1RKWA 5JHUA 1WH7A 2D2WA 3H3VK 5J6XA 2CWEA 1NK3P 1WCMJ 3HRMA 4UUSB 3CMMA 3BTIA 1R1TA 2DA6A 2H94A 4L5IA 1LJ9A 1Z3XA 2FUG2 2VT3A 4QPQA 4YIRX 4II2A 4DZJA 1X3ZB 3W2WA 1ERDA 1NHAA 1KU7A 1BC7C 1ZRCA 4NC6A 5L3DA 2E34A 4KMUX 1TW3A 4CGZA 2NYXA 2VL8A 3CZ6A 2JUCA 1UZCA 3PQKA 1QHGA 3GTJJ 6PAXA 3A03A 2H1KA 1J2XA 2LYCA 5HDGA 1D5VA 3F21A 4FISA 2EH3A 2DA4A 3SDGA 5JI6A 3VWBA 1V5FA 3K70C 4Q47A 5DUIA 2EBIA 1SEUA 3JRBA 5E18F 1HLVA 2LSOA 1U3EM 3K2AA 2VT2A 2V6EA 2FMLA 3NWSA 4JK1X 2HOTA 3RKXA 1MMDA 3TOBA 4XLAA 2X1CA 1TLHB 1U8BA 4Y4RA 1X1BA 4QLCU 5BPDA 4XIDA 2OBPA 1GDTA 2A05A 5LLQA 5L3BA 1AKHB 2XSDC 1E0EA 3R0AA 4ZYDA 3S8PA 4HX7A 5EGOA 1NK2P 2DTZA 5FD6A 2W48A 3IKVA 5L3CA 4E7ZA 2DOEA 4IF4A 1J09A 4Y33A 1VQMI 4Q4ZF 4YFKF 3BT9A 3BG7A 2NOGA 2BEOA 2EJRA 2PMHA 4CUGA 4F55A 2C6YA 1XSVA 2Y9ZA 1SFKA 1ZELA 5HDKA 4UUSA 3Q0VA 1A5JA 2Y31A 2RDPA 2ZJPF 2LKSA 2VC1A 1A6QA 2D1VA 3F8CA 4BXXJ 2MA3A 1GV2A 3RPQA 4IQJA 5E8GA 3J80K 4YG2F 3CCQI 2XKPA 3SZPA 4BXFA 2LD5A 2XB5A 1T98A 3F8BA 1JI8A 1XCBA 2DMQA 3GFIA 1J0RA 4XL9A 4V2GA 2YUSA 4I2OA 2HKXA 1JKRC 4IHYA 3HRUA 3WG7H 1TNSA 2COMA 3FKIJ 3UKGA 1BJZA 3CC7I 3GO5A 2JSCA 2F5VA 2W85A 3I71A 5E1ZB 5FGMA 5LBQA 4L0ZB 3ULQB 4HNVA 2QYOA 5EZGA 4Y7NJ 3I0TA 3N05A 1DGWY 1ENHA 4AIDA 2GIZA 2R5ZA 4GCVA 3ABLH 2R7DA 4Q48A 2M45A 2FBKA 5CVUA 2DMNA 2K02A 2Q2EB 3EUHC 5JVTA 1UELB 1AKHA 2Z3YA 2Z2SB 2V4JC 1QZZA 4MTEA 2VKDA 2HGCA 4PJMA 2IBDA 1K83J 2MLGA 5H20A 5LHHA 3HXLA 2FQ3A 1D0YA 4PFOA 4BHCA 3CO7C 3SJMA 2DK8A 1D8JA 1ETYA 3V8KA 4BE2A 2STWA 2OJED 2W57A 1YJNI 3ZN1A 3DV8A 2L9VA 2JN6A 4XKWA 1QZYA 3IUOA 2BBYA 2BY1A 2W00A 3OYBA 1YI2I 4I0AA 3RSNA 4DYQA 3J81K 2R7XA 2ELJA 1I39A 4I99C 1ZH5A 4KYWA 3HSEA 3CD6I 1OCZH 3OS0A 2KFDA 2R7QA 3VYSB 3PO3J 3CLOA 1F1ZA 5TGTA 5EF6A 4B43A 5E79C 3RPUA 4BS9A 5F0HA 1KA8A 2WAQN 3GXOA 1VQ9I 1JTXA 4A3MJ 2A3SA 1WSUA 3M07A 4X0GA 1XSDA 1ZR2A 1FX7A 2CQQA 3GTPJ 3QYBA 4XSXF 3S1RJ 2KRHA 3L09A 3QAHA 2XB0X 3ECHA 1TZLA 2A6EF 2ZMEA 3BZ6A 3ZMDA 3M3YJ 1Z0XA 4I01A 2JPBA 4A3CJ 2HPIA 3LOCA 5D4RA 1QRYA 1KU3A 1MIJA 2E19A 2KISA 1LPQA 2IGNA 2Q2EA 4EJVA 3HPHA 3G6EI 2I10A 5FKKA 3W6VA 1Q1HA 4E7JA 2IS1A 2X48A 3D5SC 1LQ1A 4A3KJ 3TMOA 3E7LA 1SANA 4EJTA 2E7WA 4G12A 3RQ4A 2KPMA 2M0CA 1WQ2A 2FRHA 4HQMA 2R7FA 2JTVA 4NDLA 3AG3H 4AUXA 2WAEA 2EILH 3J7AY 1VNDA 1K79A 2O3FA 3EUAA 4IXAA 3N4MA 1JKOC 1S72I 2DCEA 5HNHA 2O7OA 4HRIA 1EKEA 4OIQF 4RLQA 3DTEA 1J7KA 1ETKA 3RKWA 4IRGA 3M7GA 1YFHA 3H9JA 2IRFG 3W6KB 4OIPF 4G7HF 1FIPA 1MNEA 4LITA 2VBXA 4S05A 3ZOBA 3F9KA 4A3EJ 3K70D 4F93B 2NOJB 2PMZN 3B6AA 3DBRB 2VJ5A 2DPUA 3WE2A 2PFBA 4FQGA 1WRJA 2JT1A 2XAUA 1ZTRA 1T08B 2HNHA 3CMEI 2GA1A 2RN7A 3BG9A 4U87A 3WU2C 2EQRA 1R1VA 2DJIA 1BR4A 1BR2A 3LWFA 4DJAA 3CMAI 5IP7J 4UY8I 2LBFB 5E20A 2QSHX 5DD4A 2E2HJ 1O3QA 4A3JJ 4BQQA 1QHHD 4JX4A 1ZK8A 1TT5B 3S2WA 3I5UA 3HHGA 4KN4X 4KIGA 2Y0SN 4IZZA 3CDHA 3I4MJ 2CUZA 2HDCA 4A93J 3FKJA 4IVNA 2L4AA 3TO7A 4OINF 1KQ9A 2KT0A 1R49A 3GFJA 4GXOA 3BQZA 3DP7A 5EG0B 1FWZA 3RQIA 5CPRB 4CICA 5BS6A 4PSXA 1SFEA 2RV8A 4G6DA 1I1GA 3IAS2 5HS9A 3WTTC 3OYMA 3I58A 1LVKA 3D0SA 2ZO4A 2BZTA 5ILVA 3L1PA 3BR5A 2IGOA 2A07F 4N9IA 3E6MA 4B8XA 2LH9A 2RVCA 3OIOA 1SAXA 1STZA 3A01B 4LOCA 3PFIA 5E3NA 2XGEA 4BKXA 5J47A 3P9KA 1B4AA 2KIFA 4M6YA 2HU9A 1Z21A 2X51A 2R93J 1KYWA 5F64A 4CCOA 4EVIA 1VQLI 4PJ0C 3ESWB 5B66C 2Y2ZA 4LLNA 3BWGA 2K3PA 5AONA 3ZN0A 3GZ6A 1R71A 2P7VB 5GPAA 2FU4A 1FOWA 2R7SA 2DMPA 3Q9VA 3HEFA 2ZMEC 1IO2A 1O7LA 1YW7A 1VQOI 2UV1A 2XF7A 5E8IA 2LBFA 1Y56A 1SFUA 2ZSHB 3TKYA 2OZ6A 5DUKA 4HV5A 1HC8A 3GBGA 2O8XA 1LNWA 4IQ4A 1W1WE 4JBAA 5KK1A 4OOIA 3H5AA 1MMNA 3BR3A 1XDSA 3S3OA 1ORKA 5F27A 2GOXB 5J40A 1ZQ3P 3L2QA 4N0BA 2QM3A 3MN2A 4J01A 1W7PB 3QP6A 3V8JA 3JRAA 1USSA 3I54A 5GAHJ 4BQOA 1I27A 2PQ8A 1X2NA 3Q9SA 5LGTA 2CH0A 3W3CA 3KEOA 3TDUC 4KMFA 3GMEA 3PUBA 4MLOA 2OTJI 2JZYA 4G6QA 3ZQCA 3NARA 1MMGA 3T5XA 3DQVC 3T0YA 5LEKA 4J19A 3A01A 2X0LA 1P92A 1OLTA 2HS5A 2ZXHA 4L9JA 3S1MJ 3DPUA 3CUOA 4P55A 3G4SI 4DGWB 2XAGA 3KP6A 3C2BA 4HAMA 2XAQA 4JP0A 2QKMB 3RCOA 2D5VA 3MQ0A 4XLEA 1X1AA 1RESA 3KYDB 3FMSA 2UZKA 2RAEA 3ZMUA 4ZYEA 4HDUA 4X1EA 2Y75A 4KT6A 4CH7A 2DFFA 1V3FA 1F43A 2HXOA 5HLIA 3OOUA 4M73A 2A5WA 1TQIA 2PBIA 3KX2A 1HKTA 5GADJ 4EJUA 3AG1H 1R5HA 1X3WB 3K2ZA 1JJ6C 2X1EA 1FOXA 4IOAF 2K9MA 3PNTA 4RGXA 1LUJB 1MMSA 2MH2A 2JA2A 3K4CA 3K7AJ 1I50J 5JVGF 5ILUA 4L18B 2F5CA 4OAZA 1W7PA 4RM3A 1XG1A 4ZYHA 4LB6B 4R8HA 1XS9A 4O3MA 2J5OA 2XROA 1H88C 2IGKA 4P96A 4HNUA 2EV5A 1YO5C 3U21A 5GTIC 2QBYB 4A12A 3HJEA 2VE9A 3OR2C 2OZUA 3JRDA 2PX9A 2F2EA 2DN0A 2F5FA 3GFLA 1K4SA 1WGXA 2Q1ZB 1CF7B 1RETA 4KIFA 4UV8A 1B8IB 1EH8A 3SFIA 2O03A 5ICFA 4G8XA 1KZHA 3NRVA 4ESJA 2ELKA 4O6JA 4V2FA 3AFHA 2JK3A 3ZMTA 3E97A 3R0JA 1E3HA 2F6CA 4G94A 2VOPA 5FKNA 2L9NA 3PSIA 5IPAA 2PMUA 2X9DA 1OCCH 3QWLA 1W5TA 3VSKA 4CSWA 2EK5A 1LFUP 3HOZJ 4XLFA 1A35A 4LK1F 5B1BH 4HF1A 5K5QA 4W97A 4NC7A 2NXNB 2RQPA 3KCCA 4CZCA 4D1QA 1O57A 3LSHA 2NVUB 3QPHA 3OIQA 4XLPF 1GXPA 1J5YA 1I3QJ 2MGQA 4AM3A 1PDNC 3CCUI 2VJIA
chains in the Genus database with same CATH topology
1VQ8I 3CCSI 1YITI 2OTJI 3CMAI 4UY8I 1YI2I 5DM6F 3CCEI 3J7YJ 3PIPF 1YJ9I 3CD6I 3G4SI 3DLLF 1ACIA 1Y39A 4IOCF 3CCVI 1VQ9I 2ZJRF 4V19K 3I56I 1VQMI 1VQNI 2E35A 3CC4I 4IO9F 5GADJ 2K3FA 1VQPI 2ZJPF 5DM7F 1YIJI 3J7ZI 3CC2I 1FOXA 4IOAF 3CCQI 3G6EI 1VQ4I 1MMSA 1YHQI 5JVGF 1VQLI 2FOWA 1VQ6I 2OTLI 2E36A 3CCLI 1FOWA 1S72I 1FOYA 3CC7I 1VQOI 2ZJQF 2QA4I 5GAEJ 1YJWI 1HC8A 3I55I 1VQ7I 3CF5F 3CCJI 1QA6A 3CJTB 2QEXI 1VQ5I 1VQKI 3G71I 3CCMI 3PIOF 2E34A 2H8WA 2JQ7A 2NXNB 5GAHJ 3CCRI 5GAGJ 3CMEI 3CCUI 1YJNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 I;  3CCS I;  1YIT I;  2OTJ I;  3CMA I;  4UY8 I;  1YI2 I;  5DM6 F;  3CCE I;  3J7Y J;  3PIP F;  1YJ9 I;  3CD6 I;  3G4S I;  3DLL F;  1ACI A;  1Y39 A;  4IOC F;  3CCV I;  1VQ9 I;  2ZJR F;  4V19 K;  3I56 I;  1VQM I;  1VQN I;  2E35 A;  3CC4 I;  4IO9 F;  5GAD J;  2K3F A;  1VQP I;  2ZJP F;  5DM7 F;  1YIJ I;  3J7Z I;  3CC2 I;  1FOX A;  4IOA F;  3CCQ I;  3G6E I;  1VQ4 I;  1MMS A;  1YHQ I;  5JVG F;  1VQL I;  2FOW A;  1VQ6 I;  2OTL I;  2E36 A;  3CCL I;  1FOW A;  1S72 I;  1FOY A;  3CC7 I;  1VQO I;  2ZJQ F;  2QA4 I;  5GAE J;  1YJW I;  1HC8 A;  3I55 I;  1VQ7 I;  3CF5 F;  3CCJ I;  1QA6 A;  3CJT B;  2QEX I;  1VQ5 I;  1VQK I;  3G71 I;  3CCM I;  3PIO F;  2E34 A;  2H8W A;  2JQ7 A;  2NXN B;  5GAH J;  3CCR I;  5GAG J;  3CME I;  3CCU I;  1YJN I; 
#chains in the Genus database with same CATH topology
 2EZH A;  2YSR A;  5KAI C;  4OWR B;  4XR6 A;  2ME6 A;  3ZQF A;  3HL2 A;  1O7F A;  4B09 A;  1K7A A;  1ETW A;  2LRE A;  3PM1 A;  4PDK A;  3OYG A;  2ZXI A;  2AQE A;  1X2M A;  5D8K B;  1T33 A;  2VIX A;  4CDG A;  3WU0 A;  2A61 A;  2M1B A;  1TWA J;  2DFH A;  3LSG A;  1XMA A;  4N9H A;  1G3T A;  4C30 A;  1TQM A;  3UNG C;  5EEG A;  4E70 A;  3OSF A;  2KLO A;  5IT9 K;  1V55 H;  2HR3 A;  1IG7 A;  4RAY A;  3BCB A;  3JRG A;  1PYV A;  1ZG5 A;  2DI3 A;  3U1K A;  3QQA A;  3OSG A;  2BXZ A;  3QOP A;  2Q8K A;  3RPU D;  4DBQ A;  3B73 A;  3BP8 A;  3NWT A;  3F8N A;  2QQB A;  2DYR H;  1ZHF A;  3S3M A;  5KVR A;  2LLK A;  1XDU A;  2OD5 A;  5D5X B;  4B44 A;  1L3L A;  2LF8 A;  1U9N A;  1Y8Q B;  5LD2 C;  1CF7 A;  2L7M P;  3TL4 X;  1B8I A;  1OYI A;  2WY7 Q;  4HX8 A;  4RM2 A;  5BNG A;  4AYB A;  5LRS A;  4AVP A;  2TRT A;  1IN8 A;  4N4N B;  2HZD A;  4M9S A;  3SHF A;  3BC8 A;  3BTC A;  4MEX F;  4KN7 X;  4BJ5 C;  1JUM A;  2X1D A;  3M1C A;  3BQY A;  2B63 J;  1IAW A;  3LSJ A;  2KRC A;  2Z99 A;  1WJD A;  2F48 A;  4KUM A;  1DU6 A;  1WPK A;  1GV5 A;  2KHM A;  3JAM K;  1RPW A;  1HCR A;  2O8K A;  3SEQ A;  2V9P A;  2XRN A;  5F0C A;  2WA0 A;  1ON1 A;  3WTW C;  2QSF X;  3ASO H;  3G1L A;  1TWG J;  5K5O A;  3HOX J;  2UXX A;  2VQH A;  3TO6 A;  3BR1 A;  3CP8 A;  4A0Y A;  4RAZ A;  1ZR4 A;  2DPD A;  1ONV A;  2UWM A;  3DTK A;  2ISZ A;  4IHT A;  4D7M A;  5F0F A;  3L2W A;  2P7C B;  2BE5 F;  2OQR A;  2VBY A;  3GYH X;  1LEA A;  4UB8 C;  1HSJ A;  4PGH A;  3KP5 A;  4YRV A;  1MD0 A;  2RQQ A;  4HLX A;  3MVP A;  4HST A;  5EGO B;  3SDB A;  3OS1 A;  3EQL F;  2VQC A;  2P5L C;  4OU0 A;  1SMY F;  2NVQ J;  1HW1 A;  2CFX A;  5HDN A;  3HKZ A;  1KU2 A;  1WH5 A;  3AG2 H;  1W36 C;  4OMY A;  2PJP A;  3DKY A;  1QU3 A;  4I76 A;  5GAG J;  4C2T A;  4DOZ A;  1V4R A;  3C2G A;  4TV7 A;  2W4S A;  3SYT A;  2XUB A;  3CO6 C;  2XDV A;  2GAU A;  2LTP A;  3QU3 A;  4LMY A;  2M3A A;  2WAF A;  1S9H A;  1OIS A;  2P5V A;  3F8M A;  4PK4 A;  5CJ9 A;  5FLM J;  2XPU A;  3I3L A;  1JXS A;  1BW6 A;  2B7E A;  1O3S A;  2M87 A;  3FF5 A;  4HOB A;  2V7F A;  4EM2 A;  3G2B A;  1P4X A;  4JX6 A;  4ZYA A;  5F1J A;  5JFR A;  3KET A;  1R4M B;  2KJB A;  2VKV A;  1JUS A;  1HKQ A;  4CCJ A;  2F4M B;  5EZH A;  3CJQ B;  4M9X A;  4MO7 A;  2ZJR F;  1RR7 A;  2HYJ A;  1EH7 A;  4XOR A;  4ZZD A;  4XN3 A;  2LMD A;  3DPT A;  3ZXS A;  3ZMV A;  2FQ4 A;  2ECB A;  3H3Z A;  3FXU A;  4PZJ A;  3WTY C;  4KDP A;  2R5Z B;  2IS2 A;  2XAH A;  3ZR8 X;  1XPX A;  1OCR H;  4HF2 A;  2X6O A;  3KYC B;  3R6S A;  3QPL A;  4LD5 A;  2KMU A;  2RGV A;  1SD5 A;  3FXM A;  3ERM A;  2STT A;  3O3K A;  3ABU A;  2V1U A;  3ZPL A;  5M5W J;  4XON A;  1PUE E;  3OYL A;  1FNN A;  2FD5 A;  4I7H A;  2K4B A;  1OCT C;  4IHV A;  5LGU A;  1HDD C;  4M3E A;  3S3N A;  4JYK A;  3OMY A;  2H6C A;  3VEP A;  3OYN A;  1ZRD A;  1BIA A;  1Q1V A;  1Z6R A;  1FEX A;  3PNY A;  1FOY A;  3OL4 A;  3J81 Z;  3L2V A;  1YLF A;  2MYS A;  4UUT A;  3WG9 A;  4MTD A;  3F3X A;  1IRX A;  4IPA A;  4P1W A;  3MKW B;  1LB2 A;  2JPC A;  1H9G A;  1TL8 A;  4B48 A;  2UXN A;  3B02 A;  4DBR A;  5K7Z A;  1NH3 A;  1FSH A;  1F5T A;  3BCA A;  2VC0 A;  3HYI A;  3A02 A;  1K6Y A;  2MBF A;  1FMW A;  4LK0 F;  5E3O A;  2E2I J;  4N4O B;  2D45 A;  3DBL B;  4UHT A;  1HXD A;  4BGD A;  2Z16 A;  3M8J A;  4FCY A;  2CW0 F;  2MC3 A;  3O2P E;  2GA2 A;  4HF0 A;  3FXK A;  1BL0 A;  3HM5 A;  3BR0 A;  2YR2 A;  2TCT A;  2PI0 A;  5HLG A;  4GO1 A;  4XM3 A;  5EEH A;  4BJ6 C;  2CUF A;  3HUG B;  2NS7 A;  2P4W A;  1BI3 A;  4KIB A;  2OF7 A;  4D5C A;  4WF2 A;  2KZG A;  2HVR A;  1BOA A;  4HPQ A;  2JVH A;  5HNF A;  4D9J A;  2R0Q C;  4EJW A;  3JRF A;  2ZME B;  2DA2 A;  4ZC3 A;  3BZC A;  1SMT A;  2VB6 A;  4G7O F;  4RGS A;  3WHB A;  2JJ7 A;  3WU1 B;  3C1D A;  5DM6 F;  4YEJ A;  3W2A A;  1E17 A;  2HQR A;  1UJ8 A;  2KIQ A;  5EYR A;  1BI2 A;  1FPQ A;  2BV6 A;  1G4D A;  1RUN A;  2FMY A;  3L2C A;  2VUM J;  1D1C A;  1T38 A;  2OU2 A;  1JKQ C;  2HEO A;  3S93 A;  1VF9 A;  3H0D A;  3FM3 A;  4EQQ A;  5BOX A;  3ABT A;  1MGT A;  4CZZ A;  2W1O A;  1PVE A;  1ZGW A;  3CDL A;  1MBJ A;  3G73 A;  2R7T A;  5HOO A;  1XGS A;  3ABK H;  5DS9 A;  5A2Q K;  1K61 A;  2AXL A;  3BG3 A;  4A6D A;  1T8I A;  2HTJ A;  2LC2 A;  2IAI A;  3K4N A;  3HZJ A;  3TOA A;  1UCR A;  1OKR A;  2Z1D A;  3KIO A;  2ZNZ A;  1MKM A;  5FO5 A;  2LF7 A;  3BLY A;  4NNJ A;  2JA6 J;  2R3S A;  3A0B C;  1MBH A;  2KJC A;  2QQ8 A;  1YW9 A;  1E2X A;  3TED A;  4L0Y B;  2M34 A;  5ILS A;  1IC8 A;  1P4A A;  1YX5 A;  2XKO A;  3HGG A;  3H0G J;  5FD5 A;  2PN6 A;  4HNT A;  3ZRG A;  4BEH B;  4FX4 A;  4UNO A;  3JTG A;  3KLN A;  4KNY A;  1G59 A;  3HHH A;  4NQW A;  1RNL A;  3E0J B;  3HBL A;  1T56 A;  2M7B A;  4HA8 A;  2V1X A;  2BHZ A;  4CCM A;  4F52 A;  2OTL I;  3HUG A;  2K40 A;  2HQ5 A;  1GLN A;  3V4G A;  2WV1 A;  1JE8 A;  1W7P D;  2KDO A;  1JGG A;  1DGR M;  2CUE A;  2E1N A;  3M8E A;  2IA0 A;  4ZZL A;  1MBF A;  2LVS A;  4E7K A;  1VFC A;  2BVM A;  4OIO F;  3KZZ A;  3EET A;  3MMY B;  2CQK A;  3BTJ A;  3HC7 A;  4MHG A;  2CJJ A;  3LA7 A;  1F4K A;  4KIS A;  3CF5 F;  2HXI A;  1W5C C;  2VQG A;  4NB5 A;  4A0Z A;  2EIK H;  4XMY A;  2IVM A;  3GVA A;  1TC3 C;  3UR3 C;  4RAG A;  5LEJ A;  3D1N I;  1IXC A;  4U0V A;  1ITY A;  1IZ1 A;  1MBK A;  4Y3O A;  4MGR A;  3V42 A;  1M1E B;  2I5U A;  4OIR F;  4YIF A;  2F5E A;  3K0L A;  3GX4 X;  1I1S A;  3N97 A;  4BQA A;  4R1H A;  3I59 B;  2GZW A;  3VPR A;  3LSR A;  3OWT A;  3BG6 A;  3S17 J;  5J4Y A;  4KIT B;  4M3D A;  1YIT I;  1Y1W J;  3RYR A;  1XCV A;  4E7S A;  2ZB9 A;  3KP2 A;  4ASN A;  2KQR A;  5HOD A;  1S7E A;  4A3F J;  4BEH A;  3GZ5 A;  3V8L A;  4B1R A;  1BI1 A;  3F8F A;  4MQ9 F;  4ZTJ A;  2QEN A;  1ACI A;  3OYC A;  2NRA C;  1HA8 A;  3NQO A;  3PUF A;  4BU2 A;  4RB2 C;  1JUP A;  1LFB A;  1D1A A;  3WTV C;  2KDZ A;  1T0F A;  2FSW A;  2KZV A;  2IPQ X;  2JSP A;  5FRO A;  4WX9 A;  2HDW A;  3P5J A;  5D5V B;  2MH9 A;  2E35 A;  2JWT A;  3IKT A;  4IL6 C;  4Q5S F;  2QZ8 A;  5DCM B;  1FYK A;  3BRO A;  2CGP A;  2DMT A;  2R7Z J;  1ODD A;  2AQF A;  4QPO A;  4AC0 A;  2W7N A;  1VQP I;  1B9N A;  1Y8R B;  2MD5 A;  3LSI A;  3KEQ A;  1S3J A;  1R9T J;  1QBJ A;  2WAQ A;  3CUQ C;  1K4T A;  3C3W A;  2RKH A;  2QGU A;  4NUB A;  5ICG A;  4BDZ A;  5DDG A;  1WZ2 A;  1Z91 A;  4RMN A;  3VDX A;  3FHZ A;  2QCO A;  3GUD A;  1GVD A;  2GLO A;  2LNB A;  2XAJ A;  3ZQQ A;  1YHQ I;  4AD9 A;  4PJL A;  3U9G A;  3H5R A;  5CVR A;  5J1Y A;  5DCF A;  4M72 A;  2HQN A;  2VLA A;  2VBW A;  4P9F A;  1IRG A;  1RC9 A;  2CW7 A;  4PJJ A;  5DD8 A;  4XSZ F;  3I59 A;  3ROU A;  1OR7 A;  4EGZ A;  1GT0 C;  2OPT A;  1P4W A;  3DLA A;  1WVR A;  3DU6 A;  3ISP A;  4L5J A;  5BQT A;  5HS7 A;  1UHM A;  4ON0 A;  4G9Y A;  1H0M A;  3I9V 2;  3MEX A;  1YJW I;  4RGU A;  4EEF G;  4FT8 A;  2E7X A;  2MSY A;  4RB1 A;  3P7N A;  5M3F J;  1GHC A;  2Z5U A;  1TT0 A;  3ERE D;  1KU9 A;  1IN4 A;  3KLO A;  4AU7 A;  3DTI A;  1QA6 A;  4IKF A;  3A0H C;  4XLC A;  1VQK I;  3PSF A;  4XKB A;  3CCM I;  3PIO F;  3GLL A;  4GYI A;  4DQ2 A;  2DMU A;  1O4X A;  4F3Q A;  3FXR A;  4WXC A;  5K1Y A;  5LHG A;  5FJ8 J;  3K1M A;  3F72 A;  3RI4 A;  2CO5 A;  5GP9 A;  3FIS A;  4XK4 A;  3R4K A;  1KQ8 A;  3OYJ A;  4BH9 A;  3IH4 A;  3L2U A;  2OUM A;  5DCM A;  2ESH A;  3IWF A;  2VAS A;  2PMZ A;  4HG2 A;  1ON2 A;  4M9Z A;  3H35 A;  1YQA A;  3DCF A;  1YJ9 I;  3QOE A;  3Q5F A;  1WWX A;  4JOM A;  5H6Q A;  1L0O C;  4RBO A;  3K69 A;  3F6V A;  3DLL F;  3CQZ J;  1BJA A;  1QGP A;  2R4G A;  3FZV A;  4D7N A;  1IXR C;  2GXG A;  5JR3 A;  2DBB A;  2OV7 A;  5B5E C;  4HX4 A;  1SC7 A;  3S14 J;  2QVO A;  2PEX A;  4IOC F;  2PJR B;  1F36 A;  4LG0 A;  2HQA A;  2IA1 A;  2VJJ A;  1HW5 A;  2M4G A;  1BIB A;  2ZJ2 A;  1WI9 A;  5J1R A;  3HOU J;  5IP9 J;  2XV4 S;  4A6E A;  1DP3 A;  1TP4 A;  4XQF A;  1B72 A;  3G1M A;  2DDA A;  2M7A A;  3F0C A;  1WJE A;  5KHD A;  1PP7 U;  2VI6 A;  3AKZ A;  1IV6 A;  5CQG A;  5BPI A;  1ZKG A;  2EZI A;  3LMM A;  5D5U B;  4IEJ A;  1ULY A;  2EFN A;  3LQQ A;  1D8K A;  2HFH A;  4EMS A;  3IH3 A;  3JRC A;  1T0F C;  3RJP A;  3IV5 A;  2XC7 A;  1B6A A;  1R58 A;  3IC7 A;  3GFM A;  1FBQ A;  3VOD A;  5IYB J;  3BJ6 A;  4EV0 A;  4BE1 A;  5IY5 H;  1P7J A;  3HOW J;  3TW6 A;  3ZP5 A;  3HPG A;  3QOD A;  5H2F C;  5IYD J;  3OYA A;  2QSG X;  3I64 A;  1ZGA A;  2FA5 A;  3DBH B;  4IX7 A;  3DEU A;  3O6B B;  2W84 A;  4MNU A;  1SVO A;  2P81 A;  5FRN A;  2ZJQ F;  2E1O A;  5DYM A;  5D5W B;  5TRD A;  2ETH A;  1BN5 A;  3LQR A;  3M9A A;  3IP4 B;  2QA4 I;  2EZK A;  4IRH A;  3PQJ A;  3CMY A;  5K5R A;  2ISY A;  2WAD A;  2YX7 A;  4P9U A;  2XGX A;  1XTA A;  3K4J A;  3GWZ A;  4UVC A;  2EIM H;  2DFI A;  1W5S A;  5IT9 Z;  3I55 I;  4LG3 A;  3S1N J;  2FX0 A;  1MZB A;  5HLH A;  1OMI A;  1OCO H;  3GTO J;  3IH2 A;  2ADU A;  4WXD A;  4XRM A;  2PJR A;  3OYK A;  2GOM A;  2QEX I;  5LRR A;  1J75 A;  2IJL A;  1RRJ A;  4RLF A;  1OR7 C;  2VKH A;  3ZQG A;  3HTS B;  2O9L A;  2CW8 A;  3DEW A;  5JLW A;  4BJT A;  1IN7 A;  3H9G A;  4XLH A;  3CCR I;  2AXT C;  2NVX J;  1UAA A;  2WB1 A;  4G6T B;  3HSF A;  2QQ9 A;  4XRS G;  2H8R A;  4CYC B;  2M8G X;  1AA7 A;  1R5G A;  2COB A;  1WJF A;  1V54 H;  2QQA A;  4CCK A;  3MCZ A;  1QNT A;  3PNV A;  2A68 F;  1ZLJ A;  1WJA A;  2P0W A;  1MNM C;  2NS8 A;  1FIA A;  4LIV A;  4FE4 A;  3LSP A;  1EH6 A;  1LVA A;  5GTH C;  1X1C A;  3L7W A;  3V7C A;  3MZH A;  1FYM A;  1T2K A;  4A2U A;  3F22 A;  4E6K G;  1HQC A;  5H6R A;  3TO9 A;  3BTL A;  5CVI A;  3CES A;  1D5Y A;  3H5N A;  1QVT A;  3K1N A;  2MFZ A;  3L2R A;  2P6S A;  1TWH J;  2K7L A;  3H36 A;  3KP3 A;  3VSL A;  2L9R A;  2M30 A;  4A5N A;  5DM7 F;  5E3M A;  3E5X A;  4RGR A;  3MKY B;  2Z33 A;  1FOK A;  4LB5 A;  1I5Z A;  3FWE A;  4BQN A;  1YS6 A;  5LGN A;  3BG5 A;  1ZRE A;  1R1U A;  4HLY A;  1QQI A;  1IGN A;  1YRN A;  1U0J A;  3MZ8 A;  3EYI A;  1IRZ A;  4RB0 A;  5L3E A;  4HQE A;  1Z3Y A;  3O8G A;  5ERI A;  1SAU A;  2X85 A;  5AIQ A;  4E7H A;  2XIG A;  1JT6 A;  2A6H F;  2K9S A;  4BY7 J;  5B1A H;  3DKX A;  2ZFU A;  4CHU A;  2HOE A;  3JW4 A;  1X19 A;  2XF5 A;  2IW5 A;  4M3B A;  1MSE C;  4M6V A;  2XAF A;  2VON A;  2HZT A;  3HRT A;  3S15 J;  1ZAR A;  4CYC A;  4LJZ F;  4IHS A;  4C9Y A;  2AO9 A;  2KIU A;  1BM9 A;  3QPT A;  4HSR A;  3M4O J;  3LA2 A;  3DEE A;  3JSP A;  2WC2 A;  2XSJ C;  2ICW G;  2L7F P;  3CJR B;  3DXJ F;  2IT0 A;  4B47 A;  2CFO A;  2CV0 A;  2DDB A;  1HST A;  4BY1 J;  2FJ1 A;  2R5Y B;  3SXY A;  4GRI A;  3C18 A;  5BMZ A;  1JHH A;  1X4O A;  3COA C;  2VPL A;  2RRE A;  1O3T A;  3QP5 A;  4NHJ A;  3IHU A;  4HBL A;  1WI3 A;  4ENK A;  1XGN A;  4L9N A;  3RYP A;  5ICE A;  4BAC A;  4D5F A;  2HVQ A;  3RZO J;  1R36 A;  5CYV A;  3E5Q A;  2JQ7 A;  3RZD J;  2FF4 A;  1H8A C;  5J3L A;  1WJC A;  1G6N A;  4IHW A;  1KON A;  1YIO A;  3REO A;  3KFW X;  3WGI A;  5EEA A;  1WHU A;  5DV5 A;  5CKT A;  5E1W A;  1JJ8 C;  3E6B A;  3FXJ A;  1X3U A;  2YU3 A;  4A5M A;  1UB9 A;  1KGS A;  2F4I A;  1WJB A;  5K7H A;  4GFB A;  1GUU A;  4IJA A;  1V5G A;  3E1S A;  1GXQ A;  3QRF F;  4ZDO A;  1ETQ A;  1B59 A;  3LFU A;  1IUF A;  2LR8 A;  3ELK A;  4ENJ A;  2W24 A;  1ETO A;  1BR1 A;  4QWQ A;  1Y39 A;  2X4H A;  2LY9 A;  4I98 B;  3DWL E;  2JA8 J;  1I6X A;  2LY1 A;  2K9N A;  4V19 K;  3G3Z A;  1G3W A;  5C3E J;  3GZN B;  4GGG A;  3MZY A;  3J80 Z;  1BBY A;  2IS4 A;  4QTR A;  1SD4 A;  3FBI B;  5J1U A;  3VB2 A;  3CC4 I;  1Y0N A;  1I3A A;  2ZCW A;  4IO9 F;  4J00 A;  2K9L A;  3ZCO A;  2BY3 A;  3CJN A;  3GEZ A;  1ZLK A;  3FBN B;  3HGY A;  5DEQ A;  4RB3 C;  1VI0 A;  2ZSI B;  2BYV E;  2R5Y A;  4OAY A;  3SZG A;  3F23 A;  1B1B A;  1HOM A;  3LAJ A;  3RKQ A;  5M3M J;  2E2J J;  5FLX K;  3R60 A;  2IP2 A;  2NNN A;  2AS5 F;  1HBX G;  2L3D A;  1LDK B;  2FOW A;  3DKW A;  4HV6 A;  3WGG A;  3WTZ A;  3U1D A;  5FLV A;  4DW6 A;  1ZG3 A;  2RNJ A;  1Z6T A;  2V26 A;  4XNF A;  1REP C;  2EFQ A;  1FBS A;  9ANT A;  3ZQL A;  5KCM A;  2ZXJ A;  4K2E A;  1FZP B;  5HVQ C;  3U2R A;  2H6B A;  3HDD A;  2VOO A;  3OYE A;  4MQV A;  4XKC A;  2LG4 A;  1XSX A;  1FTZ A;  2G0E A;  4Z6Y A;  3EUK L;  3MD2 A;  2DT7 B;  1MW7 A;  3R61 A;  4BXU A;  3EYY A;  1AHD P;  1G8X A;  3GTM J;  3M8F A;  2R7R A;  3S1Q J;  4PFP A;  1JKP C;  4F92 B;  2KRF A;  1NG7 A;  5A2Q Z;  1R7J A;  3CUQ B;  3E6C C;  2CS3 A;  3NEU A;  2HOA A;  4FAS D;  4HEA 2;  1SD6 A;  2FE3 A;  4CA0 A;  3JSO A;  2DOF A;  5K7F A;  2PLY A;  4M71 A;  1JT0 A;  3WTS C;  3K10 A;  4LFU A;  1QZE A;  4AIK A;  1Y6I A;  1XX5 A;  2FXA A;  5D6F A;  1I6H J;  5IP6 A;  1FC3 A;  2K5C A;  5F1R A;  2GXB A;  1T6S A;  5D6E A;  2YS9 A;  2Y0M A;  5FRM A;  4L9V A;  3SEZ A;  3HOV J;  3TQN A;  4MEY F;  1IN6 A;  3KP4 A;  2XVC A;  2E1M C;  1FTT A;  5CQE A;  1WKM A;  4Y13 A;  1FYL A;  3AL0 C;  2DK5 A;  2W82 A;  3ZGK A;  3PIP F;  1YG2 A;  2OAZ A;  2F4O B;  3K6G A;  3KZY A;  2A6T A;  3JRI A;  2HDD A;  2H1L A;  2IGM A;  2V1N A;  1Y1V J;  4NQW B;  1RR8 C;  2K86 A;  3LST A;  1R22 A;  2DA1 A;  4IHX A;  1LDJ A;  1QVU A;  1FP1 D;  1ZN2 A;  5FB2 A;  3K4L A;  3GLX A;  4BHB A;  3ML6 A;  2WWY A;  1C0W A;  2OC6 A;  4I0B A;  2L7Z A;  2LOO A;  1BC8 C;  2DQL A;  1DP7 P;  2DXI A;  1HF0 A;  3QYE A;  4LGW A;  2P6T A;  2VBZ A;  3I53 A;  3JCU C;  4B3A A;  1QPM A;  4ANJ A;  3A4C A;  1ETX A;  4Y17 A;  1YW8 A;  1Z9C A;  3QPS A;  2BVL A;  4UVA A;  3BDD A;  1OPC A;  2VQL A;  4WXH A;  2FNA A;  4M6X A;  3ZQI A;  1WFX A;  1Z67 A;  2LK2 A;  3DU5 A;  2E71 A;  3RTR A;  4KFC A;  2M8E A;  1YOV B;  5AIP A;  1PJR A;  1XC5 A;  3H9Q A;  3CUQ A;  2ACJ A;  2MC4 A;  2BXY A;  2W25 A;  2EA2 A;  3CCY A;  5D4S A;  1U5T B;  2R7U A;  2OQG A;  1N25 A;  1ZG1 A;  1BOB A;  3SZT A;  2Y69 H;  4ZTF A;  2K9Q A;  2M0M A;  3FXQ A;  2ZXW H;  1A31 A;  1AOY A;  3FMQ A;  3P9C A;  3IAM 2;  3S2D J;  1D0X A;  3LL7 A;  2K27 A;  1SVL A;  1UHW A;  2Y48 A;  4C3H J;  2L01 A;  4G7Z F;  2DA5 A;  4II3 A;  3WTX C;  3E6D A;  2JUG A;  1ZYR F;  1XD7 A;  1MDM B;  2DQR A;  2DT5 A;  3K4M A;  2FEZ A;  2XGC A;  3L00 A;  1BA5 A;  3NAU A;  4PGG A;  2EV6 A;  2CMP A;  4UVB A;  1IUY A;  1VQ7 I;  3CDI A;  4E4H A;  4FET A;  2ZC2 A;  3CCJ I;  4XRS A;  2IEK A;  1P6R A;  1EA3 A;  3CF2 A;  4A3B J;  1TBX A;  1NTC A;  4U0Y A;  4B3X A;  3KEY A;  4PUS A;  1MSF C;  2WTE A;  2H8W A;  3RIR A;  1ZGJ A;  2DA3 A;  4HYE A;  1IRF A;  1TWC J;  4U7B A;  5IOZ A;  4M74 A;  2JA5 J;  1XGO A;  2L4M A;  2MW8 A;  4ZDP A;  5C44 J;  1LFP A;  1UG2 A;  3H3U A;  4U0W A;  2X6X A;  1IDY A;  4Z2Y A;  5ICC A;  1A36 A;  2O6G E;  3LSK A;  1W36 D;  3KZI C;  4HW0 A;  3L9F A;  3EPZ A;  3KP7 A;  4QSH A;  4D0P A;  3W6J B;  3LNQ A;  4A3I J;  3KPH A;  1A6I A;  3OV8 A;  1RZ4 A;  1XB4 A;  5L3G A;  3WOD F;  1A04 A;  1S5L C;  1UHS A;  1E3P A;  1X1D A;  2XRL A;  3S32 A;  4ENM A;  3T8R A;  3DF8 A;  1FY7 A;  1U5T A;  2XGD A;  1G3Y A;  3LAP A;  4X6A J;  2KL4 A;  4EM0 B;  3JRH A;  1CGP A;  3CCV I;  1H89 C;  4UUV A;  1TWF J;  1YE9 A;  3IRR A;  3MKL A;  3I56 I;  5J8F A;  2WBM A;  1LDD A;  1N77 A;  5L3F A;  3OY9 A;  4PCQ A;  3CP2 A;  2BOL A;  1G3S A;  4WCG A;  1FJL A;  3GTQ J;  2CV1 A;  1P2F A;  4I09 A;  1W0T A;  1P9Q C;  2D1H A;  1T95 A;  1DPR A;  4WWC A;  1D3Y A;  1R5I D;  2P5K A;  3PJR A;  1MDM A;  3FDY A;  2R92 J;  2MG4 A;  1SD7 A;  2ME0 A;  2L7K A;  3K1P A;  4LIU A;  4XOP A;  3MFK A;  5C4J J;  2CUJ A;  3ZQ7 A;  2DTR A;  4IRI A;  1DU0 A;  2EFP A;  3FM5 A;  3HTU A;  3IWZ A;  3QYF A;  2RC4 A;  4L5E A;  2EFW A;  2NVT J;  4BAY A;  1SVM A;  3BOQ A;  4BDY A;  4F91 B;  3WTU C;  1MMA A;  1WJ5 A;  3FMR A;  1K78 B;  2L0K A;  2IS6 A;  4A69 C;  3HOS A;  1IN5 A;  5CLS A;  2O61 A;  1OQY A;  5CVJ A;  2ELH A;  5TJJ A;  3BR6 A;  4BBR J;  4BBS J;  3IRQ A;  2YPR A;  4W1U A;  2M2E A;  2OCE A;  3LSM A;  5GPC A;  2HKO A;  5DTD A;  1P7I A;  1Z7U A;  3LFK A;  4JQF A;  4XBF A;  3FK6 A;  2VPR A;  2G7U A;  3GF2 A;  3ECO A;  1JGS A;  1N75 A;  1Z7L A;  2DLL A;  2KP6 A;  2M5W A;  2N8G A;  4AVZ A;  3OOP A;  3CLQ A;  1IF1 A;  3Q3S A;  5FKM A;  2DOA A;  5F6F A;  1UMQ A;  1EF4 A;  4XRF A;  4LG0 B;  1O3R A;  2HYF A;  1Z77 A;  3G71 I;  3E3V A;  3D5L A;  1YS7 A;  4ABZ A;  2QWW A;  2EV0 A;  2MLK A;  1PUF B;  3HOY J;  3O8H A;  1QO0 D;  1B9M A;  1G2H A;  2XF6 A;  2M9H A;  3FIW A;  3H1C A;  1D1B A;  1RKT A;  1B72 B;  3A2K A;  3HSR A;  2DJN A;  3I4N J;  2EA4 A;  2BY2 A;  1HKS A;  4QIW N;  1VQ8 I;  5E17 F;  5EDN A;  2LY2 A;  1GVJ A;  2GXA A;  2HYG D;  3K4K A;  3OL3 A;  3F6O A;  4BL0 B;  3CCE I;  5FKL A;  4BUP A;  4DYC A;  4CXF A;  4ZJZ A;  3JR9 A;  4RS8 A;  2L9S A;  2LKX A;  4YFX F;  1IDZ A;  1XN7 A;  4FE7 A;  2X6Y A;  4KJZ A;  4A3L J;  3FXO A;  1K78 A;  1MJB A;  2AHQ A;  5M5Y J;  2K4J A;  3S2H J;  3ZMS A;  1K6O A;  1N78 A;  4XKV A;  3VFZ A;  3RKY A;  2L54 A;  2FBH A;  2EWN A;  1S29 A;  1R6R A;  1VZ0 A;  4H4K C;  3JRE A;  1RIO H;  4I6Z A;  2EFO A;  4C2M J;  3ASN H;  4BYY A;  2WY8 Q;  4YEL A;  3PL8 A;  2DAO A;  4E7I A;  2DOD A;  1UG0 A;  2V9K A;  2O5R A;  2ZNY A;  2VKE A;  1H9T A;  3E5U A;  2LRD A;  2EIJ H;  3ABM H;  3P9I A;  1LKX A;  2LDU A;  2K3F A;  1XMK A;  3J7A O;  3OIP A;  1W4M A;  1FSE A;  1U5T C;  4YII A;  1FBU A;  3W2V A;  1XGM A;  1POG A;  4C3J J;  5M5X J;  5F08 A;  3TBI A;  3BJO A;  2V9V A;  4HZF A;  3H92 A;  4DYR A;  2HI3 A;  2BW3 B;  2WB1 N;  1PUF A;  3TGN A;  4PSW A;  1APL C;  1QPI A;  2E36 A;  1MND A;  5IT3 A;  2KKO A;  2E5Z A;  2DA7 A;  4ENN A;  1LE8 B;  2CSO A;  3AAF A;  2V1D A;  1S7A A;  1UST A;  2G7H A;  2HVS A;  2ESN A;  4UB6 C;  4GDF A;  2Y0S A;  1HW2 A;  3BJA A;  4BHP A;  2H27 A;  1YX3 A;  1U6G A;  5EG0 A;  2Q0O A;  3K9T A;  1Z05 A;  2JRM A;  3MWM A;  2CQX A;  2OCC H;  2MAB A;  3DFG A;  4AIJ A;  4ZH4 F;  2R7V A;  4EAT A;  4XN0 A;  5HLT A;  2F5D A;  3HB9 A;  5CVV A;  3OS2 A;  2GBY A;  4WK8 F;  2NS0 A;  1AWC A;  2OA4 A;  4LLL A;  1VQ5 I;  1BI0 A;  3VYU B;  1V5E A;  2EZL A;  3ONQ A;  4CO8 A;  5FKO A;  1R00 A;  1OYW A;  3QU6 A;  1MJA A;  1Z1D A;  4Y15 A;  2XHK A;  3WE3 A;  2K85 A;  4NC8 A;  4AWX B;  2TDX A;  1NG6 A;  4CCN A;  4KT5 C;  4A3D J;  1IXS B;  2R7O A;  1TTY A;  1ZAO A;  2JVG A;  1IV8 A;  2FNP A;  5ED4 A;  3ZQH A;  3PO2 J;  4EGY A;  2X6W A;  3I4P A;  3CCS I;  2CQN A;  3WHC A;  1J59 A;  3FX3 A;  2R7W A;  3GCM A;  3RDI A;  3HIF A;  1DUX C;  3DPL C;  4DZP A;  4RDU A;  4CCL A;  4FX0 A;  3X2Q H;  4FHT A;  3BY6 A;  1YTY A;  4EJO A;  1RI7 A;  1HDP A;  1T39 A;  3OR1 C;  2DO7 A;  4MFD A;  1YRN B;  2HOS A;  2B0L A;  2NAZ A;  3SFZ A;  2BW3 A;  4CYD A;  4JX5 A;  1KQ0 A;  2VOD A;  5LFA A;  2CU7 A;  1UFM A;  4AYB N;  1SFO J;  1MH4 A;  2FBI A;  3WGH A;  5J4V A;  2YU9 J;  1LE8 A;  1OJL A;  2ECC A;  3K4B A;  3C7J A;  5LHI A;  2VE8 A;  1U9O A;  1FMV A;  3VYT B;  4E7L A;  2J5P A;  2V6C A;  2NVY J;  1VQN I;  3OYH A;  2QLZ A;  2BGC A;  2LFB A;  4KA4 A;  1DPU A;  4C2U A;  2EIN H;  3TW7 A;  4S04 A;  1U8R A;  2L5Q A;  2ZKZ A;  2A69 F;  5FFZ A;  2ZFW A;  1TNT A;  3JAM Z;  3A1Y A;  1Y0U A;  2P8T A;  2FOK A;  1YIJ I;  1JTY A;  4YFN F;  5HS8 A;  2E1M B;  4L9T A;  4U88 A;  5D8L B;  1VTN C;  3CC2 I;  2HWV A;  3OYF A;  3AL0 B;  1FLI A;  1EV7 A;  1FP2 A;  4GYG A;  3EDP A;  3T1B A;  1XMX A;  3TDZ C;  2E60 A;  4ITV A;  1E3O C;  3FXL A;  4S0H B;  2NNY A;  2XPW A;  5FFX A;  2ID6 A;  2O0Y A;  1X58 A;  3M1E A;  3GW2 A;  1J9I A;  1TQP A;  2DU9 A;  3V7R A;  3BPX A;  2E5N A;  5C4X J;  3KE2 A;  2V79 A;  3BR2 A;  1JHF A;  2VXZ A;  3GTL J;  2DYS H;  1BW5 A;  2IXS A;  3IL2 A;  4B4C A;  1U2W A;  4MIM A;  2ZBK A;  4C3I J;  3HKZ N;  2B9S A;  4M3F A;  4XOT A;  2DFE A;  1IJW C;  3FK7 A;  4BNC A;  2H09 A;  2LP0 A;  5GAE J;  4R79 A;  2BY0 A;  4P5O A;  4EM1 A;  2WV0 A;  2YX4 A;  5J8C A;  1DDN A;  1X1P A;  4LLG F;  5F04 A;  2IA2 A;  4A0X A;  2GM4 A;  4A3G J;  4MFE A;  2CG4 A;  3S16 J;  4BE0 A;  3OYD A;  1OYY A;  2HPM A;  5EJC A;  2L02 A;  3MAJ A;  4RA2 A;  3B6C A;  4Y52 J;  4ZYG A;  1LEB A;  2DW4 A;  5IOY A;  3C2H A;  1OFC X;  2VJ4 A;  1EJ9 A;  4PJN A;  2EB7 A;  2CQ7 A;  5JLX A;  2HTS A;  1MH3 A;  1X4P A;  1ETV A;  4ESF A;  3CJT B;  3GTG J;  3OYI A;  4RAF A;  1RUO A;  2E1C A;  2GQQ A;  2QKL B;  2QBY A;  2EPF A;  3T8T A;  1SFX A;  4HDV A;  1MJ9 A;  5FLX Z;  1TW2 A;  4OMZ A;  3J7Y J;  2GWR A;  1KYZ A;  2BHY A;  2JA7 J;  4ETS A;  5TIS C;  2Y30 A;  2CRG A;  2KIM A;  4U7D A;  5JHF A;  1S6L A;  5KAF C;  3MKZ A;  1F9N A;  3D5R C;  3BZK A;  3JTH A;  2PG4 A;  2VN2 A;  4I02 A;  1CQT A;  5E1X A;  1OCP A;  1ZRF A;  1R4N B;  4DIQ A;  2ID3 A;  3PFY A;  2A5Y B;  1R23 A;  3SQN A;  5E3L A;  2XPV A;  4O5V A;  3TP0 A;  4UXN A;  1YYV A;  3FHN A;  1W0U A;  4AIH A;  2QUF A;  4XLN F;  2G9W A;  1PP8 F;  3LA3 A;  2JRT A;  3CTA A;  2M4K A;  2DT6 A;  1D0Z A;  4DNC A;  4ESB A;  2CYY A;  4NBQ A;  1S7O A;  4F7Z A;  1MBG A;  4ZDL A;  1S8N A;  3G1O A;  2I8D A;  3TP3 A;  5KNL A;  1MBE A;  3J7Z I;  5B3S H;  2L2O A;  2JMW A;  3VYR B;  3KYL A;  3HG9 A;  1VQ4 I;  3GTK J;  4KIC A;  1DQU A;  5IYC J;  2MD0 A;  4FTH A;  4M3G A;  2GIV A;  3VOE A;  4H0E A;  1VQ6 I;  2Y9Y A;  3EUH A;  1AU7 A;  3HRS A;  1IW7 F;  3CCL I;  2CV2 A;  3BPV A;  4UV9 A;  2QF7 A;  1FT9 A;  3V7S A;  1U78 A;  2LKP A;  3AG4 H;  4XIC A;  3HOT A;  2UUZ A;  2RNG A;  2XAS A;  2VXD A;  3ZMZ A;  3Q0U A;  2Z9O A;  3Q0W A;  1RKW A;  5JHU A;  1WH7 A;  2D2W A;  3H3V K;  5J6X A;  2CWE A;  1NK3 P;  1WCM J;  3HRM A;  4UUS B;  3CMM A;  3BTI A;  1R1T A;  2DA6 A;  2H94 A;  4L5I A;  1LJ9 A;  1Z3X A;  2FUG 2;  2VT3 A;  4QPQ A;  4YIR X;  4II2 A;  4DZJ A;  1X3Z B;  3W2W A;  1ERD A;  1NHA A;  1KU7 A;  1BC7 C;  1ZRC A;  4NC6 A;  5L3D A;  2E34 A;  4KMU X;  1TW3 A;  4CGZ A;  2NYX A;  2VL8 A;  3CZ6 A;  2JUC A;  1UZC A;  3PQK A;  1QHG A;  3GTJ J;  6PAX A;  3A03 A;  2H1K A;  1J2X A;  2LYC A;  5HDG A;  1D5V A;  3F21 A;  4FIS A;  2EH3 A;  2DA4 A;  3SDG A;  5JI6 A;  3VWB A;  1V5F A;  3K70 C;  4Q47 A;  5DUI A;  2EBI A;  1SEU A;  3JRB A;  5E18 F;  1HLV A;  2LSO A;  1U3E M;  3K2A A;  2VT2 A;  2V6E A;  2FML A;  3NWS A;  4JK1 X;  2HOT A;  3RKX A;  1MMD A;  3TOB A;  4XLA A;  2X1C A;  1TLH B;  1U8B A;  4Y4R A;  1X1B A;  4QLC U;  5BPD A;  4XID A;  2OBP A;  1GDT A;  2A05 A;  5LLQ A;  5L3B A;  1AKH B;  2XSD C;  1E0E A;  3R0A A;  4ZYD A;  3S8P A;  4HX7 A;  5EGO A;  1NK2 P;  2DTZ A;  5FD6 A;  2W48 A;  3IKV A;  5L3C A;  4E7Z A;  2DOE A;  4IF4 A;  1J09 A;  4Y33 A;  1VQM I;  4Q4Z F;  4YFK F;  3BT9 A;  3BG7 A;  2NOG A;  2BEO A;  2EJR A;  2PMH A;  4CUG A;  4F55 A;  2C6Y A;  1XSV A;  2Y9Z A;  1SFK A;  1ZEL A;  5HDK A;  4UUS A;  3Q0V A;  1A5J A;  2Y31 A;  2RDP A;  2ZJP F;  2LKS A;  2VC1 A;  1A6Q A;  2D1V A;  3F8C A;  4BXX J;  2MA3 A;  1GV2 A;  3RPQ A;  4IQJ A;  5E8G A;  3J80 K;  4YG2 F;  3CCQ I;  2XKP A;  3SZP A;  4BXF A;  2LD5 A;  2XB5 A;  1T98 A;  3F8B A;  1JI8 A;  1XCB A;  2DMQ A;  3GFI A;  1J0R A;  4XL9 A;  4V2G A;  2YUS A;  4I2O A;  2HKX A;  1JKR C;  4IHY A;  3HRU A;  3WG7 H;  1TNS A;  2COM A;  3FKI J;  3UKG A;  1BJZ A;  3CC7 I;  3GO5 A;  2JSC A;  2F5V A;  2W85 A;  3I71 A;  5E1Z B;  5FGM A;  5LBQ A;  4L0Z B;  3ULQ B;  4HNV A;  2QYO A;  5EZG A;  4Y7N J;  3I0T A;  3N05 A;  1DGW Y;  1ENH A;  4AID A;  2GIZ A;  2R5Z A;  4GCV A;  3ABL H;  2R7D A;  4Q48 A;  2M45 A;  2FBK A;  5CVU A;  2DMN A;  2K02 A;  2Q2E B;  3EUH C;  5JVT A;  1UEL B;  1AKH A;  2Z3Y A;  2Z2S B;  2V4J C;  1QZZ A;  4MTE A;  2VKD A;  2HGC A;  4PJM A;  2IBD A;  1K83 J;  2MLG A;  5H20 A;  5LHH A;  3HXL A;  2FQ3 A;  1D0Y A;  4PFO A;  4BHC A;  3CO7 C;  3SJM A;  2DK8 A;  1D8J A;  1ETY A;  3V8K A;  4BE2 A;  2STW A;  2OJE D;  2W57 A;  1YJN I;  3ZN1 A;  3DV8 A;  2L9V A;  2JN6 A;  4XKW A;  1QZY A;  3IUO A;  2BBY A;  2BY1 A;  2W00 A;  3OYB A;  1YI2 I;  4I0A A;  3RSN A;  4DYQ A;  3J81 K;  2R7X A;  2ELJ A;  1I39 A;  4I99 C;  1ZH5 A;  4KYW A;  3HSE A;  3CD6 I;  1OCZ H;  3OS0 A;  2KFD A;  2R7Q A;  3VYS B;  3PO3 J;  3CLO A;  1F1Z A;  5TGT A;  5EF6 A;  4B43 A;  5E79 C;  3RPU A;  4BS9 A;  5F0H A;  1KA8 A;  2WAQ N;  3GXO A;  1VQ9 I;  1JTX A;  4A3M J;  2A3S A;  1WSU A;  3M07 A;  4X0G A;  1XSD A;  1ZR2 A;  1FX7 A;  2CQQ A;  3GTP J;  3QYB A;  4XSX F;  3S1R J;  2KRH A;  3L09 A;  3QAH A;  2XB0 X;  3ECH A;  1TZL A;  2A6E F;  2ZME A;  3BZ6 A;  3ZMD A;  3M3Y J;  1Z0X A;  4I01 A;  2JPB A;  4A3C J;  2HPI A;  3LOC A;  5D4R A;  1QRY A;  1KU3 A;  1MIJ A;  2E19 A;  2KIS A;  1LPQ A;  2IGN A;  2Q2E A;  4EJV A;  3HPH A;  3G6E I;  2I10 A;  5FKK A;  3W6V A;  1Q1H A;  4E7J A;  2IS1 A;  2X48 A;  3D5S C;  1LQ1 A;  4A3K J;  3TMO A;  3E7L A;  1SAN A;  4EJT A;  2E7W A;  4G12 A;  3RQ4 A;  2KPM A;  2M0C A;  1WQ2 A;  2FRH A;  4HQM A;  2R7F A;  2JTV A;  4NDL A;  3AG3 H;  4AUX A;  2WAE A;  2EIL H;  3J7A Y;  1VND A;  1K79 A;  2O3F A;  3EUA A;  4IXA A;  3N4M A;  1JKO C;  1S72 I;  2DCE A;  5HNH A;  2O7O A;  4HRI A;  1EKE A;  4OIQ F;  4RLQ A;  3DTE A;  1J7K A;  1ETK A;  3RKW A;  4IRG A;  3M7G A;  1YFH A;  3H9J A;  2IRF G;  3W6K B;  4OIP F;  4G7H F;  1FIP A;  1MNE A;  4LIT A;  2VBX A;  4S05 A;  3ZOB A;  3F9K A;  4A3E J;  3K70 D;  4F93 B;  2NOJ B;  2PMZ N;  3B6A A;  3DBR B;  2VJ5 A;  2DPU A;  3WE2 A;  2PFB A;  4FQG A;  1WRJ A;  2JT1 A;  2XAU A;  1ZTR A;  1T08 B;  2HNH A;  3CME I;  2GA1 A;  2RN7 A;  3BG9 A;  4U87 A;  3WU2 C;  2EQR A;  1R1V A;  2DJI A;  1BR4 A;  1BR2 A;  3LWF A;  4DJA A;  3CMA I;  5IP7 J;  4UY8 I;  2LBF B;  5E20 A;  2QSH X;  5DD4 A;  2E2H J;  1O3Q A;  4A3J J;  4BQQ A;  1QHH D;  4JX4 A;  1ZK8 A;  1TT5 B;  3S2W A;  3I5U A;  3HHG A;  4KN4 X;  4KIG A;  2Y0S N;  4IZZ A;  3CDH A;  3I4M J;  2CUZ A;  2HDC A;  4A93 J;  3FKJ A;  4IVN A;  2L4A A;  3TO7 A;  4OIN F;  1KQ9 A;  2KT0 A;  1R49 A;  3GFJ A;  4GXO A;  3BQZ A;  3DP7 A;  5EG0 B;  1FWZ A;  3RQI A;  5CPR B;  4CIC A;  5BS6 A;  4PSX A;  1SFE A;  2RV8 A;  4G6D A;  1I1G A;  3IAS 2;  5HS9 A;  3WTT C;  3OYM A;  3I58 A;  1LVK A;  3D0S A;  2ZO4 A;  2BZT A;  5ILV A;  3L1P A;  3BR5 A;  2IGO A;  2A07 F;  4N9I A;  3E6M A;  4B8X A;  2LH9 A;  2RVC A;  3OIO A;  1SAX A;  1STZ A;  3A01 B;  4LOC A;  3PFI A;  5E3N A;  2XGE A;  4BKX A;  5J47 A;  3P9K A;  1B4A A;  2KIF A;  4M6Y A;  2HU9 A;  1Z21 A;  2X51 A;  2R93 J;  1KYW A;  5F64 A;  4CCO A;  4EVI A;  1VQL I;  4PJ0 C;  3ESW B;  5B66 C;  2Y2Z A;  4LLN A;  3BWG A;  2K3P A;  5AON A;  3ZN0 A;  3GZ6 A;  1R71 A;  2P7V B;  5GPA A;  2FU4 A;  1FOW A;  2R7S A;  2DMP A;  3Q9V A;  3HEF A;  2ZME C;  1IO2 A;  1O7L A;  1YW7 A;  1VQO I;  2UV1 A;  2XF7 A;  5E8I A;  2LBF A;  1Y56 A;  1SFU A;  2ZSH B;  3TKY A;  2OZ6 A;  5DUK A;  4HV5 A;  1HC8 A;  3GBG A;  2O8X A;  1LNW A;  4IQ4 A;  1W1W E;  4JBA A;  5KK1 A;  4OOI A;  3H5A A;  1MMN A;  3BR3 A;  1XDS A;  3S3O A;  1ORK A;  5F27 A;  2GOX B;  5J40 A;  1ZQ3 P;  3L2Q A;  4N0B A;  2QM3 A;  3MN2 A;  4J01 A;  1W7P B;  3QP6 A;  3V8J A;  3JRA A;  1USS A;  3I54 A;  5GAH J;  4BQO A;  1I27 A;  2PQ8 A;  1X2N A;  3Q9S A;  5LGT A;  2CH0 A;  3W3C A;  3KEO A;  3TDU C;  4KMF A;  3GME A;  3PUB A;  4MLO A;  2OTJ I;  2JZY A;  4G6Q A;  3ZQC A;  3NAR A;  1MMG A;  3T5X A;  3DQV C;  3T0Y A;  5LEK A;  4J19 A;  3A01 A;  2X0L A;  1P92 A;  1OLT A;  2HS5 A;  2ZXH A;  4L9J A;  3S1M J;  3DPU A;  3CUO A;  4P55 A;  3G4S I;  4DGW B;  2XAG A;  3KP6 A;  3C2B A;  4HAM A;  2XAQ A;  4JP0 A;  2QKM B;  3RCO A;  2D5V A;  3MQ0 A;  4XLE A;  1X1A A;  1RES A;  3KYD B;  3FMS A;  2UZK A;  2RAE A;  3ZMU A;  4ZYE A;  4HDU A;  4X1E A;  2Y75 A;  4KT6 A;  4CH7 A;  2DFF A;  1V3F A;  1F43 A;  2HXO A;  5HLI A;  3OOU A;  4M73 A;  2A5W A;  1TQI A;  2PBI A;  3KX2 A;  1HKT A;  5GAD J;  4EJU A;  3AG1 H;  1R5H A;  1X3W B;  3K2Z A;  1JJ6 C;  2X1E A;  1FOX A;  4IOA F;  2K9M A;  3PNT A;  4RGX A;  1LUJ B;  1MMS A;  2MH2 A;  2JA2 A;  3K4C A;  3K7A J;  1I50 J;  5JVG F;  5ILU A;  4L18 B;  2F5C A;  4OAZ A;  1W7P A;  4RM3 A;  1XG1 A;  4ZYH A;  4LB6 B;  4R8H A;  1XS9 A;  4O3M A;  2J5O A;  2XRO A;  1H88 C;  2IGK A;  4P96 A;  4HNU A;  2EV5 A;  1YO5 C;  3U21 A;  5GTI C;  2QBY B;  4A12 A;  3HJE A;  2VE9 A;  3OR2 C;  2OZU A;  3JRD A;  2PX9 A;  2F2E A;  2DN0 A;  2F5F A;  3GFL A;  1K4S A;  1WGX A;  2Q1Z B;  1CF7 B;  1RET A;  4KIF A;  4UV8 A;  1B8I B;  1EH8 A;  3SFI A;  2O03 A;  5ICF A;  4G8X A;  1KZH A;  3NRV A;  4ESJ A;  2ELK A;  4O6J A;  4V2F A;  3AFH A;  2JK3 A;  3ZMT A;  3E97 A;  3R0J A;  1E3H A;  2F6C A;  4G94 A;  2VOP A;  5FKN A;  2L9N A;  3PSI A;  5IPA A;  2PMU A;  2X9D A;  1OCC H;  3QWL A;  1W5T A;  3VSK A;  4CSW A;  2EK5 A;  1LFU P;  3HOZ J;  4XLF A;  1A35 A;  4LK1 F;  5B1B H;  4HF1 A;  5K5Q A;  4W97 A;  4NC7 A;  2NXN B;  2RQP A;  3KCC A;  4CZC A;  4D1Q A;  1O57 A;  3LSH A;  2NVU B;  3QPH A;  3OIQ A;  4XLP F;  1GXP A;  1J5Y A;  1I3Q J;  2MGQ A;  4AM3 A;  1PDN C;  3CCU I;  2VJI A; 
#chains in the Genus database with same CATH homology
 1VQ8 I;  3CCS I;  1YIT I;  2OTJ I;  3CMA I;  4UY8 I;  1YI2 I;  5DM6 F;  3CCE I;  3J7Y J;  3PIP F;  1YJ9 I;  3CD6 I;  3G4S I;  3DLL F;  1ACI A;  1Y39 A;  4IOC F;  3CCV I;  1VQ9 I;  2ZJR F;  4V19 K;  3I56 I;  1VQM I;  1VQN I;  2E35 A;  3CC4 I;  4IO9 F;  5GAD J;  2K3F A;  1VQP I;  2ZJP F;  5DM7 F;  1YIJ I;  3J7Z I;  3CC2 I;  1FOX A;  4IOA F;  3CCQ I;  3G6E I;  1VQ4 I;  1MMS A;  1YHQ I;  5JVG F;  1VQL I;  2FOW A;  1VQ6 I;  2OTL I;  2E36 A;  3CCL I;  1FOW A;  1S72 I;  1FOY A;  3CC7 I;  1VQO I;  2ZJQ F;  2QA4 I;  5GAE J;  1YJW I;  1HC8 A;  3I55 I;  1VQ7 I;  3CF5 F;  3CCJ I;  1QA6 A;  3CJT B;  2QEX I;  1VQ5 I;  1VQK I;  3G71 I;  3CCM I;  3PIO F;  2E34 A;  2H8W A;  2JQ7 A;  2NXN B;  5GAH J;  3CCR I;  5GAG J;  3CME I;  3CCU I;  1YJN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...