3PIOF

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3pioF00
4IOAF 1VQ4I 1VQPI 1Y39A 1VQ8I 3CC4I 3CCSI 3J7ZI 1VQNI 5DM7F 2H8WA 3CCLI 2ZJPF 4UY8I 1YJWI 2K3FA 3CCRI 2OTJI 1YJNI 1QA6A 2FOWA 3CC7I 3G71I 1YI2I 3CJTB 1YITI 4IOCF 1YHQI 2JQ7A 2E35A 3I55I 1YJ9I 5GAHJ 3J7YJ 1HC8A 1YIJI 1VQ9I 2ZJQF 1VQMI 3G4SI 4V19K 1VQ5I 5JVGF 3CD6I 1S72I 3CCUI 2QEXI 3CCVI 3CCJI 2NXNB 3CC2I 1VQOI 3CF5F 5GADJ 5GAEJ 1VQKI 2E36A 3PIOF 3CCEI 1VQLI 3DLLF 3CCQI 3CMEI 1FOWA 1MMSA 3I56I 3G6EI 2OTLI 1VQ7I 4IO9F 2E34A 1FOXA 1ACIA 3CCMI 2QA4I 1FOYA 3CMAI 5GAGJ 5DM6F 3PIPF 1VQ6I 2ZJRF
chains in the Genus database with same CATH superfamily
1O57A 3RDIA 1A04A 2MD0A 4UXNA 3RQIA 2JRTA 2NYXA 3AG2H 3U1DA 1Z6RA 3V8LA 2XAGA 3JTHA 3I64A 5KNLA 4PZJA 2PX9A 3DU6A 3RCOA 4YFKF 5IOZA 5DM7F 1U3EM 5K5RA 4ZYHA 3CCLI 2KMUA 2NNNA 3EPZA 1ETWA 1T0FC 1YS6A 4HX7A 2ISZA 1S29A 3OYGA 3S2HJ 4RDUA 4BE2A 3SZGA 2ZNZA 2HXOA 4V2GA 2R5ZB 2EIJH 1WI9A 4DJAA 1I1SA 5IOYA 5E3MA 4XSXF 1CF7A 2FOWA 2K86A 1ZELA 3FXKA 5FO5A 4B8XA 2WTEA 1MMNA 4UUSA 1GT0C 3OIOA 3TKYA 2IS6A 3LSMA 4E7ZA 1TP4A 2IXSA 5CQGA 4EQQA 1G6NA 2V1UA 3VOEA 2P7CB 4BY7J 1ENHA 3RIRA 3S3MA 2JPCA 2BZTA 1YIJI 1VQ9I 2EB7A 2LP0A 3I59B 1FTTA 2N8GA 1D5YA 1P4XA 4D1QA 1ZTRA 5J4YA 2FX0A 2J5OA 2JRMA 3H36A 4M9SA 4XLAA 5TGTA 4RGXA 4LLLA 3HSEA 3E5UA 2XGEA 2MBFA 3GEZA 1D0YA 2QYOA 4MEYF 4EJUA 2JA5J 3HTUA 1QZYA 1D0XA 1KU7A 4RLFA 3KP4A 1RNLA 3BPXA 4JP0A 3CCEI 2VE9A 1W0TA 2HYFA 1WQ2A 3OYAA 1ZRDA 1X1BA 5IYDJ 4I09A 3DLLF 3CCQI 2HQ5A 4BHCA 3GXOA 4LLGF 4BXUA 5L3EA 4AIHA 3I56I 2OF7A 2HOTA 1ON1A 5M5XJ 2HGCA 1P7JA 1R00A 3QP5A 3GZ6A 2ETHA 2RKHA 4XKWA 2B0LA 5EEGA 3HGGA 2ZXJA 3HHGA 3OWTA 5EDNA 4O5VA 1JUSA 2IW5A 2NAZA 1FOXA 4O3MA 3DKWA 4JX6A 3M9AA 5M5WJ 1ACIA 1ITYA 2EV6A 1BJAA 4LD5A 3VODA 2FXAA 2IS2A 3CESA 2P8TA 3PQJA 4UNOA 3ZQQA 1EV7A 2E7XA 1SFKA 2IJLA 5LFAA 3BTIA 2M0CA 2MD5A 2NVUB 1IUYA 4IZZA 1RKTA 1F43A 3MKYB 1WH5A 2VJ4A 3WTZA 3HOYJ 2VQHA 3SDBA 3MKWB 1LNWA 3I3LA 1Y39A 3WGGA 1VNDA 1SFUA 1JKQC 3QP6A 1G8XA 2DW4A 3DWLE 3OS0A 4HF2A 2VB6A 4E70A 1OJLA 2BY3A 4B43A 1E17A 2BY0A 4HOBA 3ERMA 1MBEA 3FHNA 1LFPA 1PVEA 2W7NA 4LFUA 1KONA 2KHMA 2R7TA 3NRVA 4RAFA 3I4NJ 4A3JJ 3WTSC 1XSVA 2K3PA 4YG2F 1TQIA 2F4MB 2HFHA 4GYGA 3R0AA 1XG1A 1YE9A 4C2MJ 2XAHA 2UV1A 1YHQI 2RC4A 1T33A 2D2WA 3BTLA 2PMZN 2ZNYA 1PJRA 3O6BB 4WXDA 1B1BA 1BIBA 2X6XA 4BXXJ 3J81K 3LSKA 1N77A 2CV1A 1W5SA 2CS3A 3AL0B 2KFDA 4TV7A 3F8CA 4PGHA 4XKVA 4FX0A 2CRGA 1MH4A 5EGOA 1ZKGA 2QSHX 1TW3A 2R4GA 3BR1A 2L2OA 1SANA 2ID6A 2KL4A 2R7XA 3CJNA 5E79C 2NOJB 1GVJA 4AIDA 3F72A 4ENNA 2LFBA 3W2VA 5EF6A 3C1DA 1AHDP 3NEUA 2M4KA 3LNQA 1ETVA 1ETKA 2A6HF 2PJPA 2VKVA 1OFCX 1U5TA 1XDSA 3G6EI 2P0WA 2BY2A 4BBRJ 2DPUA 2NOGA 1E3PA 2WC2A 1YRNA 2P5VA 1KQ8A 1XMXA 1RUOA 1QRYA 3VSLA 5CLSA 4FETA 3JCUC 2UZKA 2VXDA 1FT9A 3RKXA 5E3NA 3L2CA 3LSPA 2BVMA 1FLIA 4ZYEA 3RPUA 2NRAC 2IS1A 4OIOF 2WV1A 2VXZA 2A3SA 2X0LA 3F6VA 3RYPA 4BQQA 3HEFA 5F1JA 3H35A 4XRMA 2DFFA 3BZKA 2QM3A 3KP6A 2XAJA 2CV0A 2KLOA 1MMGA 2HKXA 4IVNA 2VONA 2P6SA 2X6YA 2V7FA 1R6RA 1YOVB 2ZJRF 3EUKL 2R0QC 2XROA 2H27A 1SVOA 1Z7UA 1T95A 1JJ8C 5BOXA 5ICEA 2QKLB 1W1WE 3UKGA 2F5DA 2F4OB 2LC2A 1P2FA 3SFIA 3ONQA 4RB1A 5C4XJ 2KISA 4C3HJ 4M71A 4AIKA 1S3JA 1K6YA 3V7CA 4HDUA 2A5WA 2PBIA 4DBRA 3Q5FA 5F1RA 4QPOA 5HODA 4DBQA 2Y31A 2VJIA 1DPRA 5FFXA 1ZGAA 2DLLA 4I0AA 1U0JA 5CYVA 2CUZA 3TOBA 4MHGA 2M34A 4PUSA 1V55H 4O6JA 4ENMA 3KYLA 4XOTA 5BS6A 2KRFA 3JRGA 1QA6A 5LHHA 2L9VA 3OYDA 3C2BA 1KYZA 5D5WB 1N75A 4BYYA 3L1PA 1YITI 3IWFA 1XS9A 1MJBA 1LDKB 4A6EA 2GLOA 4XLFA 5B3SH 1IZ1A 3GFMA 2DU9A 1JGSA 1OQYA 2RGVA 1LFUP 3LFUA 2Z3YA 1N78A 3HM5A 1MMDA 5LHIA 2XPVA 4BKXA 5K7HA 2NVQJ 2O3FA 3S1NJ 1GV5A 3ECHA 3JREA 3VYSB 1P9QC 2DTRA 5B1BH 4U0VA 5E3LA 4BE0A 3LA7A 3L2UA 1HQCA 2FE3A 1NHAA 4EV0A 3IRQA 4G94A 1RUNA 4XOPA 4PSXA 4P96A 1OISA 5HOOA 2Y2ZA 2HOSA 2M4GA 2R7ZJ 1GUUA 3A2KA 3M07A 3FK6A 1X1DA 2DYSH 5F0CA 1F9NA 5HLTA 4L5JA 5JI6A 1Y8RB 2VASA 1Q1VA 2ECCA 3MEXA 3E6MA 2GWRA 2X9DA 2EZHA 4RAYA 1E2XA 3FXJA 1IXCA 1WKMA 3WGHA 5AONA 2DDAA 2QQ9A 2OCEA 3D5SC 5HS8A 3I54A 1IN7A 1FX7A 2E34A 3ABUA 1QHHD 2X6WA 4F92B 4ZTJA 4R79A 1LDDA 2GBYA 3SDGA 3NAUA 3IHUA 4Q47A 2JN6A 2G7HA 5GAGJ 1ZGWA 2R7OA 2DT6A 2HTSA 2IEKA 4JYKA 2LMDA 2LF7A 5HVQC 4G8XA 4R1HA 5FKLA 2OA4A 3PO2J 2HQRA 1ERDA 3I5UA 4J01A 1JJ6C 2D45A 1EJ9A 3L9FA 4C30A 2HR3A 4XLNF 4E7SA 4BXFA 4AU7A 4EM1A 2IA1A 1YW9A 2RNGA 3RSNA 2KT0A 3B6AA 2E2JJ 4L9JA 4P9UA 1HOMA 1QQIA 2Y75A 1V5EA 1DUXC 5KCMA 2H1KA 2VKHA 1BC8C 3TP3A 3F8MA 3J7ZI 4LJZF 2HVSA 2FSWA 2HI3A 2CW0F 3IH4A 3GO5A 5J4VA 4XRSA 4ZTFA 1QPIA 4ENJA 3CZ6A 1TWFJ 1UHSA 1P4WA 4A69C 4RB0A 3RTRA 1FTZA 4I0BA 2V9PA 3CDIA 2F2EA 5FKOA 1U5TC 3AG4H 3TO7A 1YTYA 5EG0B 1S5LC 1WJDA 3WTUC 4Y7NJ 2XB5A 2DTZA 3R61A 4NC7A 5ERIA 4RBOA 3H3VK 1S7AA 3W3CA 3G71I 1L0OC 2IS4A 1HKSA 4GGGA 1UCRA 4WX9A 1O3RA 1S7EA 3I9V2 2VL8A 2OQRA 2ZXWH 1FYMA 4G7ZF 2K02A 5JLXA 3J7AO 3IV5A 2YPRA 2L7ZA 3F3XA 4ZJZA 4A3LJ 3EYYA 4PJJA 4F7ZA 3VYRB 2WWYA 1TT5B 3CCJI 2JMWA 1U9NA 1Z0XA 3C3WA 3S1QJ 4RB3C 4HA8A 5DV5A 3S32A 1OKRA 2WY8Q 2Y9ZA 2COBA 5IP9J 2B63J 1R5HA 2JWTA 1NK2P 5IY5H 1T39A 5GPCA 3L2VA 3GFJA 1ZGJA 3K2ZA 3Q0VA 2CWEA 5A2QK 1VI0A 3S2WA 5EZHA 3HIFA 4M6VA 1FOWA 2M87A 1B9MA 5B1AH 1W5CC 3JTGA 4CYCB 3BP8A 2XAQA 4G6DA 3R4KA 4XKCA 2DPDA 4I2OA 2ZMEA 5KHDA 1V4RA 1VQ7I 5BPIA 4DYCA 4KDPA 2TCTA 4MQ9F 2G0EA 1B59A 4Y33A 2KPMA 2RAEA 4JK1X 4WF2A 5BNGA 4CZCA 4X1EA 1J59A 2ME6A 3CMAI 4MO7A 1S8NA 4F52A 1GXQA 1R22A 2RNJA 5FLXZ 1BBYA 5FFZA 2RDPA 2O8XA 2HQAA 4UVCA 2X1EA 1UHWA 4C3IJ 4RB2C 2JJ7A 2CQNA 2Z1DA 3OYEA 2K5CA 2OUMA 3H5NA 1X4OA 3HSRA 5ED4A 1IV8A 3GLXA 4GCVA 3CLQA 1STZA 2GA1A 1CQTA 2M8EA 4BJTA 2VOOA 4IRGA 2ZFWA 2JPBA 3CQZJ 4B09A 3ZN0A 1VQ4I 1AKHA 4S0HB 3HC7A 2G9WA 1R1UA 3BDDA 3CCSI 4ZC3A 4FE7A 1B4AA 5DUKA 1DP3A 3OYKA 2ZXIA 1WJBA 2QWWA 1XDUA 4NNJA 1MZBA 1J7KA 2XAUA 3ZQ7A 5M5YJ 3K9TA 9ANTA 3B6CA 2NS0A 4M3EA 1BIAA 5GP9A 3H0DA 2R7SA 3IH3A 3BR5A 4CDGA 1XGNA 1YJNI 1ETQA 1F36A 2FBIA 3S17J 2JVGA 3TBIA 3BG7A 5TISC 5JFRA 5ILSA 1HCRA 5B66C 4DW6A 1YI2I 1RZ4A 3S16J 3EYIA 3VB2A 3L2QA 2KJCA 3V7RA 3HL2A 2KZGA 1PUFB 3RYRA 2FA5A 2ESHA 1LE8A 3A1YA 1BR1A 2E71A 1ZQ3P 4J19A 5LRSA 1VQ5I 1R9TJ 1O3QA 1S72I 1YX3A 4MLOA 1D1CA 3WTTC 3FBNB 4XRFA 1ZR4A 1HXDA 4K2EA 2TRTA 4HV6A 3TW6A 1BOAA 1HW2A 2Y0SA 3BQYA 3S3OA 1VQKI 3FK7A 3CLOA 2BBYA 3K69A 3LOCA 2ACJA 5DEQA 4OIQF 2LBFB 1LFBA 4XIDA 2WB1A 1D8JA 2CUEA 1T8IA 3GX4X 2WAQN 1FIPA 3T8TA 3LA2A 2KRCA 5TJJA 4NB5A 1KZHA 4NC6A 2JSCA 4A3EJ 5DCMA 5EEHA 3HKZA 2DOAA 2LY9A 3WTWC 2LY2A 3OYHA 3EQLF 4GXOA 4HF0A 1IGNA 3BR2A 3HRTA 1ZYRF 2EFPA 4YEJA 3B73A 3CMMA 3I58A 2BHZA 3GTGJ 3OYFA 1IDYA 2CFXA 2QZ8A 4AUXA 4A6DA 1R1TA 1HLVA 2A05A 2V4JC 3PJRA 3EDPA 2V1XA 2FBHA 2DK5A 1B8IB 4W1UA 3UR3C 2CW8A 3ZPLA 3COAC 4LG0B 2ZXHA 1NG6A 2ELHA 4Y4RA 1ON2A 1BI2A 1WFXA 3PFIA 1IXRC 1R71A 5ILVA 1TLHB 1JXSA 1RIOH 4OIRF 4RGUA 5IT9Z 1O7LA 1WHUA 1HBXG 3ISPA 3MZ8A 4DQ2A 3OY9A 1I3AA 1RR8C 2K4JA 1OCCH 2VODA 2MABA 5LRRA 3H9JA 4MGRA 5ICCA 4NC8A 2M7BA 5FGMA 2DQLA 3LSIA 1ORKA 1Z9CA 4IHWA 3HOUJ 1MBHA 1TWHJ 1EF4A 1D8KA 1K78B 3EUHA 3HJEA 1BI1A 5FLVA 3BJAA 1E3HA 3NARA 1MBGA 4NDLA 4CCLA 3CUQC 2DMPA 1XD7A 3MQ0A 1RC9A 3M8JA 3HG9A 3K4JA 4B48A 1HC8A 4M3DA 4MEXF 5B5EC 3W2AA 3T1BA 2ZJQF 1VQMI 2EPFA 3DPTA 3G2BA 3DP7A 4XN3A 3U21A 2LNBA 1WI3A 4A3CJ 3CD6I 1G3TA 4L18B 1IV6A 1W5TA 2CUJA 2WB1N 1ZARA 1U9OA 2OCCH 1R36A 3P9IA 1ULYA 1LPQA 4IXAA 1MNEA 4I76A 4KMFA 2OD5A 2QLZA 3V4GA 2JA8J 4I6ZA 5L3GA 5J3LA 3QYEA 3KP2A 3CTAA 4AVPA 4WWCA 1R7JA 3DEUA 1K61A 1TWGJ 5HDGA 4N9IA 3LA3A 1P6RA 1BR4A 3HZJA 4M3FA 2K9QA 5FLXK 4ETSA 3WGIA 4E4HA 1BM9A 2CGPA 2HWVA 3ELKA 4PSWA 3FF5A 5CVVA 3CJQB 2D1VA 2R7VA 2UXNA 4AVZA 1TNSA 2EFOA 2KKOA 2M2EA 5J1UA 3IRRA 1F4KA 1Z67A 4MFEA 4A0YA 4U87A 4LMYA 4MNUA 5E1ZB 2LD5A 2QBYB 1NTCA 3BPVA 4XORA 3ABKH 2IPQX 1SVLA 4NQWB 2DXIA 4RAGA 1EH7A 3HGYA 4XNFA 4G7OF 2HDDA 3WE2A 4AWXB 4PGGA 3DU5A 4D9JA 4M72A 2JZYA 2ICWG 2JK3A 2P5KA 2AXTC 4KYWA 5HLHA 1A31A 2A5YB 2IAIA 3HDDA 2MH9A 2BGCA 2KP6A 4DOZA 2P4WA 2XDVA 3SEQA 3V8KA 2LY1A 4HDVA 2K9SA 1LB2A 3KZYA 2EH3A 4G12A 2EILH 3AKZA 4EJOA 3WU2C 1W36C 4HLYA 2BXYA 1LDJA 4YFXF 1BW6A 1Z7LA 2K9LA 2MFZA 2XVCA 3BR0A 5JR3A 4L9NA 4CXFA 1SVMA 4QWQA 5C3EJ 2YUSA 3KETA 3M7GA 3DFGA 2WA0A 1TQMA 3HPHA 4DNCA 1LVAA 4BE1A 1PP7U 1IN5A 4YFNF 4N4OB 1YFHA 4JBAA 4A3KJ 1PUEE 2M0MA 2PN6A 4FX4A 1BA5A 2P81A 3CO6C 1WRJA 5LEJA 1JE8A 3A03A 2KIQA 3TL4X 5HNFA 1UZCA 3WU0A 1FMWA 5KAIC 4RM3A 3ZXSA 3A4CA 1BW5A 5DS9A 4BEHA 1K79A 3IP4B 2L4MA 4OINF 2HU9A 4EATA 4BQAA 1W7PB 2W4SA 2UWMA 3PUFA 2RQQA 5GADJ 1B72B 4YIFA 2QVOA 3J80Z 2BW3A 3M3YJ 3PIOF 4U88A 3DEEA 1UAAA 2QUFA 1W4MA 2HOAA 1NH3A 2FMLA 2COMA 3CMEI 4L9TA 1LKXA 3BJOA 1HW1A 3LQQA 2M30A 2JUCA 2X51A 3FXRA 3GTPJ 4YIIA 3GFLA 4B1RA 5J1YA 2PJRA 1R5ID 1Z21A 3A01B 4BHBA 4IJAA 2OTLI 3K70C 1JUMA 1MDMA 2AHQA 1U2WA 1HKTA 3GVAA 4AIJA 1IW7F 3MZHA 1QO0D 4BJ6C 2K9NA 4M9XA 3E6BA 4E7JA 2XKOA 2E1OA 5L3BA 4PDKA 4UV8A 2LRDA 5JVTA 4XQFA 1IC8A 2KRHA 2OV7A 5F0FA 3V8JA 3GYHX 2VUMJ 2ZSHB 3JRHA 3ASNH 4L0ZB 1I50J 3RPUD 2ME0A 1YO5C 4KISA 4LK1F 1I3QJ 4II3A 4PFPA 3WG7H 5IT9K 3K4LA 1OYYA 5E1XA 1P4AA 2EZLA 4QPQA 1LVKA 3TO6A 1SAUA 2BXZA 2Z16A 3QYFA 3I0TA 4XM3A 2MH2A 3DKXA 3D5LA 2F5FA 3OS1A 3ZQFA 1SFEA 1P92A 3BZ6A 5DCFA 1WJ5A 3CC4I 1X3WB 4IHXA 4CCMA 1VTNC 3OYCA 1ETYA 2EFNA 1TC3C 3GLLA 3T5XA 1K7AA 1IXSB 4OIPF 2XAFA 3L2RA 1V54H 4BL0B 1DQUA 2AO9A 1GV2A 2K85A 2PMHA 3HSFA 2R5YB 3ZQGA 4A3IJ 3BJ6A 3K6GA 3K4NA 3S93A 3TEDA 3HRSA 1OCTC 3PM1A 5FRNA 2Y48A 2BY1A 4BJ5C 2MYSA 1MSFC 2E2IJ 3CC7I 2Z2SB 2EZKA 4FHTA 3OYMA 4BACA 1HSJA 3I55I 2CFOA 1OYIA 4KJZA 4M9ZA 1YW7A 2VT2A 2H6CA 3B02A 2IGMA 2H94A 3G4SI 1SD7A 3MN2A 5D8KB 3KEQA 3ZQHA 2F48A 4HEA2 3JRCA 2GXBA 3C2GA 2E1CA 1IO2A 1B9NA 4RGRA 2MG4A 4RGSA 2NNYA 4LLNA 3MZYA 1XPXA 5F08A 3FXLA 1R4NB 1KQ9A 3PNYA 5FKMA 3JSOA 2ID3A 2ZJ2A 1MH3A 2HQNA 2L7MP 4JX5A 5FKKA 2R7DA 3G3ZA 2STWA 4FQGA 3ROUA 1D3YA 4UV9A 2ZFUA 1J9IA 4GRIA 3OIPA 3BR3A 1QGPA 1D5VA 5H2FC 3KFWX 2GZWA 1HDDC 1CF7B 3FZVA 5C44J 3H0GJ 3GWZA 4D7MA 3CUOA 3ZCOA 2DJIA 2DA1A 1VZ0A 4UUSB 2O7OA 5CJ9A 3CCYA 5L3CA 5L3FA 1MJAA 2JA6J 2EFQA 3ZRGA 1H0MA 4KITB 5CQEA 2QA4I 3A02A 3GTJJ 2GM4A 1IRXA 1SFOJ 1CGPA 3H5AA 1OYWA 5C4JJ 4GFBA 1BN5A 1JGGA 3KEYA 4AYBA 3CP2A 2M7AA 4LGWA 3RKQA 2LR8A 3QRFF 1A6QA 3WTXC 1EH8A 2LYCA 3G1LA 3OL4A 3J7AY 2MC4A 2R7UA 1TWCJ 1M1EB 2HTJA 4U7BA 3VEPA 3CP8A 2EQRA 2YSRA 5CVUA 4IRIA 3HYIA 1VQ8I 3ULQB 4WXHA 4KIBA 4XLHA 1UHMA 3K1MA 4BBSJ 4LK0F 2DFEA 2YU3A 5F6FA 1FBUA 4LB5A 1GHCA 5F64A 2AQEA 4E7HA 2CG4A 5BQTA 1ETOA 3C18A 1X58A 2ZJPF 2LH9A 1AA7A 1IUFA 2XGCA 4V2FA 4Z6YA 3LL7A 3P7NA 3OOPA 4M74A 5DD4A 1H9GA 3LSRA 2O5RA 2OJED 3HUGA 3ZGKA 3HOWJ 3TOAA 3I71A 4XK4A 5L3DA 2DI3A 2LVSA 2Q2EB 2OQGA 5ICGA 4EM2A 3P5JA 5CVIA 3OSGA 4KT6A 3OYNA 2B7EA 3ZP5A 2VIXA 1K4TA 2QSFX 1J0RA 5E3OA 2WAFA 1KYWA 4CCJA 1KGSA 4IPAA 1YQAA 3I4PA 3J80K 2DOEA 5LHGA 3JRBA 4I02A 3D0SA 1YYVA 3KPHA 2OPTA 2ZB9A 2R3SA 1FNNA 2J5PA 3EETA 2V9VA 3DBRB 3QQAA 3LMMA 5GPAA 2GAUA 2EIMH 3O8HA 3L09A 4N0BA 4Y52J 2JUGA 2E36A 5EEAA 1A35A 3DCFA 2V9KA 4G6QA 5J8FA 4PJLA 4ZYGA 2L9RA 2EV0A 5D5XB 3DF8A 2VBXA 4FE4A 4IHYA 4ESFA 4CYDA 1KU2A 4HX4A 3T0YA 3FBIB 1YLFA 1JKPC 2VC1A 3HOSA 4HBLA 3ZR8X 2ZC2A 1KU9A 3M8FA 4M6YA 1FZPB 3F8BA 5H6RA 3N4MA 3G1MA 2R5ZA 2Y69H 4RM2A 4FISA 3GCMA 2PFBA 2GOMA 3KLNA 1GLNA 3ESWB 5EGOB 1JUPA 4A3FJ 2RREA 2XPUA 3SQNA 2VE8A 4BAYA 2XKPA 3BG5A 2F4IA 2L7KA 2W24A 3H9QA 3I59A 1WWXA 2XB0X 1SAXA 4XLEA 3K7AJ 3C7JA 2NVXJ 2HDWA 3OS2A 2HVQA 1QZEA 3DTKA 2V6CA 2LKSA 5IT3A 3FXMA 1E3OC 4A5MA 1X2NA 1MBKA 1G2HA 1U5TB 2DYRH 4S04A 5E17F 2DMNA 3GF2A 4IQ4A 4II2A 2XSDC 1YRNB 2MA3A 4P9FA 4U0WA 3PSFA 3JRAA 3BROA 4EGZA 4LIVA 1FSHA 3FXQA 3QPLA 2VKDA 4PFOA 3ZMTA 3QODA 1FY7A 2QQBA 2R7FA 4MTDA 4KNYA 3QWLA 4EEFG 3M1EA 5D8LB 2E35A 1Z1DA 4HQMA 1IG7A 4D7NA 2R7WA 4E6KG 2E7WA 4LIUA 1ZR2A 3E97A 3LAPA 2X1CA 1FIAA 4HSTA 3LSHA 1UMQA 1UJ8A 2P5LC 2NS8A 1W7PD 2DN0A 1HDPA 3PSIA 5E20A 2O61A 4KFCA 5FROA 3ZMSA 4RS8A 5JHFA 2GIZA 2PQ8A 2JTVA 1XGOA 4WK8F 3KZIC 1H9TA 2UUZA 4XN0A 3IC7A 5H20A 5FRMA 2G7UA 3QPSA 3GBGA 1TNTA 2DQRA 1ZRFA 2VBYA 1POGA 3PNVA 1U8BA 3LFKA 4X6AJ 2GQQA 3KP7A 3BZCA 4CCOA 2ELKA 3OYBA 2DA6A 1ZHFA 1U8RA 1FPQA 1EA3A 3R6SA 1W36D 1X1AA 2K4BA 3GTQJ 1OCZH 4HPQA 4KN7X 5FB2A 3RKYA 2L02A 2GA2A 1J2XA 3BTJA 1FWZA 4WCGA 3TMOA 2YS9A 3LSTA 4KN4X 4P55A 3FKIJ 2A07F 2K40A 2L9NA 3BG9A 3EUAA 3QOEA 1FEXA 1ZLJA 4ZYAA 2L01A 2JA7J 4QSHA 1REPC 1L3LA 1T6SA 1FBQA 2V1NA 1WJCA 4XSZF 1J09A 2FQ3A 2Q8KA 4KA4A 3PQKA 3ZQLA 3OYIA 2AQFA 1PYVA 1SMTA 1KA8A 4B47A 1FOKA 4ZH4F 4HNUA 1RESA 5TRDA 2W82A 4ESBA 2CQQA 3REOA 4R8HA 2BVLA 3HRMA 1RRJA 3PNTA 2HNHA 3SZTA 3IKVA 3JRFA 2EFWA 2VJJA 1IDZA 1TW2A 3FMRA 5DYMA 2TDXA 3S14J 3K4KA 2L9SA 1OCOH 2F5EA 4UHTA 2X6OA 5CVRA 1J5YA 1WJFA 2FD5A 3GFIA 1AOYA 3BOQA 1VQNI 2HOEA 2VI6A 4EVIA 4IHSA 2EV5A 4CO8A 1USTA 2H8WA 1I6HJ 3IAM2 4KIGA 1DGRM 3O3KA 2LLKA 1YJWI 2A69F 2DK8A 2QQ8A 3K70D 5HLGA 3WG9A 2B9SA 1S9HA 3MFKA 2X1DA 4L5EA 4I98B 2XASA 3E1SA 3H1CA 2BV6A 1XGSA 4ITVA 4RA2A 4A0ZA 2XGDA 2X85A 5J47A 2X48A 1YJ9I 4HX8A 4OU0A 3O2PE 2HZTA 4L5IA 3K1NA 2XGXA 1JKRC 4CZZA 2DA4A 2FRHA 1LQ1A 4P1WA 3DBLB 3ABLH 3WU1B 3JRIA 4Y17A 1H89C 2UXXA 4ZDPA 3I4MJ 3K0LA 1TL8A 3CC2I 3S1RJ 2EINH 3U1KA 1EKEA 2VN2A 1O4XA 1A6IA 4B3AA 2VLAA 2V79A 1OCRH 2ZMEC 1D1BA 1FYLA 1JKOC 4I99C 2QF7A 5GAEJ 1XCBA 2QGUA 3IL2A 3HPGA 3MKZA 4YELA 3Q3SA 3SYTA 2VKEA 1FBSA 1N25A 4A93J 2VOPA 4Y3OA 3FHZA 4IF4A 1LJ9A 1FSEA 4UUTA 4XKBA 2XIGA 1IN4A 2CSOA 1DU6A 1OLTA 2Y0SN 4C2UA 1ODDA 3NWSA 3OV8A 2WADA 2LG4A 4IX7A 4FCYA 4AC0A 1AWCA 2A6TA 2KIMA 4G6TB 3U2RA 2LSOA 1FYKA 4G7HF 1H88C 4B44A 4A0XA 2XSJC 1IN6A 4M6XA 1Q1HA 2FMYA 4JX4A 4B3XA 3SEZA 3HBLA 1SD5A 4ZZDA 1YG2A 1R23A 3CMYA 5HDNA 1Z77A 3W6KB 3OR1C 1SFXA 3GZNB 5K7FA 4IEJA 4HW0A 2HYGD 1G3WA 2I5UA 2XV4S 3HKZN 2RQPA 3KLOA 2LDUA 5GTIC 3MVPA 3N97A 4RMNA 4HNVA 3CDLA 3L7WA 1T08B 4AM3A 3SFZA 3GUDA 1Z3XA 4XONA 1USSA 5LEKA 1YS7A 2R7RA 5KAFC 4ASNA 5HNHA 1MMAA 2XC7A 3OIQA 3D5RC 5FD5A 3BTCA 4HV5A 3DTEA 5BMZA 3HB9A 1I1GA 2ZMEB 3DKYA 4UB8C 2E5ZA 2EBIA 1AU7A 1RKWA 6PAXA 1K83J 4M3BA 2FU4A 2ZKZA 2GOXB 1MD0A 1R1VA 2EIKH 3E7LA 3CUQB 3TQNA 3JAMZ 2F6CA 2PMZA 2IA0A 4CICA 1GVDA 2OTJI 1I39A 3FISA 4ON0A 3GTKJ 1WJAA 3MMYB 1RPWA 3VPRA 2IGNA 2DMTA 1WSUA 4KT5C 2E60A 4HRIA 1IN8A 4UVBA 2F5CA 3K4CA 2MW8A 4NUBA 3IH2A 1T98A 4LB6B 3R60A 4HZFA 2VBWA 3FKJA 4DZJA 2FUG2 1XMAA 2ISYA 5D4RA 2DBBA 3DQVC 1MBJA 3OSFA 2L54A 1Z6TA 3S3NA 1T2KA 1P7IA 3CCUI 2QEXI 1AKHB 2NXNB 3RI4A 2CYYA 3KIOA 3T8RA 3AL0C 1DGWY 1MSEC 2ZBKA 2Y30A 3R0JA 3K1PA 3FWEA 2Q2EA 3HOXJ 3F8FA 4ZDLA 2R93J 4D5CA 4A3BJ 1YIOA 2W85A 4PJNA 2HVRA 3WTVC 3TP0A 4IL6C 2I8DA 1UFMA 3OOUA 1SC7A 2OC6A 4PCQA 5J1RA 4F3QA 2ZCWA 3FX3A 2FNPA 4OMYA 3AG1H 2D1HA 2DA3A 2VJ5A 2MGQA 3SJMA 4QIWN 4H0EA 4Y15A 2QSGX 4Q5SF 1RI7A 2E2HJ 1ZAOA 3ZMZA 3M1CA 3ASOH 3KP5A 3D1NI 4E7KA 2IVMA 3F8NA 5EG0A 3CCMI 1XSDA 3GTMJ 3CO7C 3BWGA 1J75A 1LE8B 5ILUA 2GXAA 1HSTA 2HKOA 1Y56A 5DM6F 4DZPA 3KYCB 2Q1ZB 4HQEA 4D0PA 3ZMUA 2IGKA 5E8GA 4HG2A 2WBMA 1BL0A 2DA2A 4QTRA 3HOVJ 5J8CA 2PLYA 5HS7A 5KVRA 4W97A 4L9VA 2HPMA 1G4DA 2KJBA 2VQLA 1BC7C 2HS5A 1Z91A 2L5QA 3GMEA 5FJ8J 2ELJA 5DTDA 5E18F 2E1MC 1G59A 4C3JJ 2M1BA 2C6YA 3DTIA 5JHUA 1GDTA 3K4BA 5KK1A 3ZMDA 3EUHC 1KQ0A 3RZDJ 4CSWA 4BH9A 2MLKA 1V5FA 3PFYA 3JRDA 3WHCA 5AIQA 1ZH5A 2O6GE 4UY8I 2XRLA 2L7FP 5DCMB 3O8GA 1SD6A 2YU9J 5LLQA 3S2DJ 1JTXA 3CCRI 4CYCA 3M8EA 3OYJA 1R58A 4GYIA 3BG3A 3KYDB 2MSYA 3ZN1A 1XC5A 2OU2A 5K7ZA 4XLPF 4GDFA 1MNDA 2OZUA 3JSPA 4LITA 1X3UA 4BDYA 1I27A 4IOCF 3F21A 3F23A 1PDNC 3WHBA 5IYCJ 1TZLA 5GAHJ 2QENA 3WODF 1T56A 2O03A 4HAMA 1TTYA 2M45A 3F6OA 1TQPA 3W2WA 4C9YA 1O3TA 2Z9OA 3H5RA 3QU6A 1DP7P 1DU0A 4V19K 1ZG1A 3F9KA 1B6AA 4HYEA 1ZRCA 4DYRA 1WJEA 3OYLA 4IKFA 4EJWA 1D1AA 4ABZA 5JVGF 1QPMA 3MCZA 1U78A 1A36A 3RZOJ 5CVJA 5A2QZ 2W48A 3CF5F 1PP8F 1JHHA 2XF7A 4HLXA 2H1LA 3RJPA 4X0GA 1TT0A 1HW5A 2HYJA 3FM5A 5D6EA 2CQKA 4NHJA 2E1MB 1BI3A 1I6XA 1MBFA 3DBHB 5F0HA 1IRZA 4FTHA 1FP2A 2VQGA 2VBZA 1XN7A 4IRHA 1APLC 4S05A 4A2UA 1DDNA 2BYVE 2P7VB 2W57A 4E7LA 3S1MJ 1G3SA 3IAS2 2L4AA 4ENKA 1ZN2A 3P9CA 4CH7A 4PJ0C 2K9MA 4CA0A 1MIJA 3H3UA 1MNMC 2RV8A 2W00A 4Z2YA 2HEOA 4UUVA 1Y1VJ 2KDOA 3KCCA 2DAOA 2CU7A 2BOLA 3BY6A 1V3FA 1PUFA 3BT9A 3F0CA 1R5GA 2X4HA 2OAZA 3GTLJ 1YW8A 1O7FA 3KP3A 5DD8A 4IOAF 1QVUA 1QU3A 1RETA 3E0JB 3GTOJ 3N05A 1QNTA 4MIMA 3TO9A 3JAMK 1VQPI 1C0WA 1JT6A 4OAZA 5HDKA 2DFIA 2BHYA 5K5QA 3BLYA 1A5JA 2OBPA 3S8PA 2ADUA 1K4SA 1JHFA 3DLAA 5CPRB 4EM0B 2EK5A 5F27A 4A5NA 1BR2A 4Y13A 2IRFG 3G1OA 1LUJB 2DDBA 1TWAJ 4DGWB 3Q9SA 2LBFA 4BDZA 2EWNA 1LEBA 3GZ5A 2K3FA 1W0UA 1VF9A 2V6EA 2I10A 2PG4A 3FXOA 2CQXA 3L2WA 4BNCA 3UNGC 1WVRA 4KICA 2E1NA 2YR2A 2PI0A 4WXCA 4IHTA 3CJTB 3ML6A 4BU2A 3ZQIA 1JTYA 3TDUC 2V26A 4XLCA 2YX7A 2ECBA 3E6CC 3BQZA 2Y0MA 3W6VA 4OWRB 1D0ZA 4UB6C 4XR6A 2LTPA 3L00A 1Y6IA 1VFCA 4MTEA 3LWFA 3WE3A 5M3MJ 2EJRA 1SEUA 2E5NA 2R7QA 2RN7A 3ABTA 3RQ4A 1Y1WJ 4C2TA 5H6QA 4I01A 4DIQA 3FMSA 3KE2A 3LAJA 1O3SA 4LG3A 4XICA 1VQOI 1B8IA 3X2QH 2A68F 4LG0A 3Q0WA 5FLMJ 4ZYDA 2QQAA 2KIFA 5CKTA 3JR9A 2HXIA 2LOOA 5D6FA 1XGMA 3DPUA 1XTAA 3FM3A 4CHUA 2DMUA 4EGYA 2AXLA 3HRUA 5F04A 5IPAA 1HA8A 1OR7A 2JSPA 2Z5UA 4MFDA 1MMSA 2DT5A 2W84A 2AS5F 2WV0A 2LKPA 3Q0UA 5BPDA 2P6TA 3E5QA 3ERED 1ZG5A 1V5GA 3RPQA 3JW4A 4A3GJ 4BQNA 5DDGA 4FT8A 4KMUX 3ABMH 5J6XA 1RR7A 1MJ9A 2L0KA 3GW2A 3VFZA 4OAYA 1K78A 2LREA 3P9KA 3S15J 4JQFA 4PK4A 3VSKA 2BEOA 2A6EF 2GIVA 1VQ6I 2MLGA 1MW7A 4BEHB 2CJJA 4EJVA 4OMZA 3MWMA 3M4OJ 1H8AC 3MAJA 3PUBA 2BE5F 1JI8A 2O0YA 4EJTA 3NQOA 3AFHA 5D5UB 1X3ZB 2BW3B 2ZO4A 2D5VA 1FJLA 4AYBN 2EZIA 1Y8QB 1NG7A 2W1OA 5LGNA 3C2HA 3V7SA 5GTHC 4A3MJ 2FOKA 3H92A 2PJRB 2FBKA 2FQ4A 4XMYA 1FMVA 5HS9A 4RAZA 2KDZA 1MDMB 1TBXA 5K5OA 1QZZA 3QYBA 2H8RA 2Q0OA 3FDYA 1IJWC 1BJZA 2CUFA 5FD6A 3DXJF 4RLQA 1S7OA 2LK2A 4I7HA 1F5TA 3G73A 1FC3A 1UG2A 1OPCA 5FKNA 1GXPA 2E19A 2FNAA 2HPIA 2O9LA 5J40A 1ETXA 3QU3A 3E6DA 1XX5A 1QHGA 1IRFA 2VT3A 2Z99A 4DYQA 4QLCU 3QPHA 2ZSIB 2EA4A 3ZQCA 1U6GA 4CGZA 4N9HA 2PEXA 4Q48A 1XMKA 1X4PA 2XHKA 4HSRA 2QBYA 3FMQA 2F5VA 3QOPA 3K2AA 4NQWA 2VPLA 3CCVI 2V1DA 3CUQA 1WH7A 3RKWA 3CDHA 3A0HC 4F93B 2XUBA 4EMSA 3E5XA 3FXUA 2JA2A 2WAQA 3PL8A 4AD9A 4F55A 2O8KA 4B4CA 3KX2A 3KEOA 4HNTA 1VQLI 5K1YA 2W25A 4BY1J 3BR6A 2M3AA 2DFHA 1T0FA 3LQRA 3QAHA 1WPKA 2LF8A 3DEWA 3H9GA 4J00A 4HF1A 4UVAA 2NVTJ 2FEZA 2XRNA 2VC0A 3HTSB 3VDXA 1MGTA 3H3ZA 1UG0A 2IP2A 1WZ2A 1SD4A 4BS9A 4BUPA 2QKMB 3ZOBA 2HDCA 5D5VB 1XCVA 2WAEA 4U7DA 1OCPA 1WGXA 1QBJA 1ZLKA 1KU3A 4FASD 2XF5A 4KUMA 3TGNA 1FOYA 1JT0A 1Y0NA 3DPLC 1T38A 2ESNA 5E8IA 1ONVA 3PIPF 3NWTA 3WTYC 2CMPA 5M3FJ 3BCAA 3A0BC 2EA2A 2NS7A 5EZGA 3MKLA 3BC8A 4LOCA 5EJCA 5DUIA 5IP6A 3V42A 3SZPA 2K27A 1Z3YA 2M5WA 1XSXA 2HZDA 3LSJA 3OR2C 3SHFA 2DMQA 3TW7A 4F91B 3F22A 1X19A 1W7PA 4CCNA 1K6OA 3LSGA 4A12A 4BHPA 1B72A 2LKXA 1E0EA 1ZK8A 2YX4A 3AG3H 1XB4A 2DODA 4M73A 1NK3P 3K4MA 4CUGA 2DT7B 4A3DJ 1SMYF 2CO5A 4U0YA 2XPWA 2GXGA 3KZZA 2H6BA 2K7LA 2FJ1A 1DPUA 1I5ZA 4Q4ZF 2JVHA 5HLIA 3Q9VA 1OR7C 4JOMA 4E7IA 4G9YA 5IP7J 3A01A 2QCOA 2CV2A 1MKMA 4YIRX 1IF1A 4IQJA 1IAWA 2CQ7A 1HKQA 1UELB 3HHHA 4XRSG 5E1WA 1Y0UA 1F1ZA 2JQ7A 5JLWA 3BCBA 1X1CA 2A61A 2DA7A 3IKTA 5AIPA 2NVYJ 4YRVA 2IA2A 4ZDOA 3SXYA 3ZMVA 2H09A 3J7YJ 1HF0A 4XL9A 4PJMA 3TDZC 4CCKA 4BGDA 2KIUA 2IBDA 1FP1D 3IWZA 3CJRB 1ZG3A 2FF4A 1LEAA 2L3DA 5LBQA 5ICFA 2STTA 1R4MB 3ECOA 3VYUB 1R49A 1BI0A 3CF2A 3HXLA 3J81Z 2WY7Q 3QPTA 1ZREA 4IHVA 2MC3A 3MD2A 2DA5A 1S6LA 4KIFA 2VQCA 3VWBA 4BQOA 3I53A 4P5OA 2KZVA 4ANJA 2PMUA 4D5FA 2M8GX 1OMIA 5D4SA 4MQVA 5LGUA 2R92J 4N4NB 1IRGA 4M3GA 2OZ6A 4L0YB 2DJNA 3HUGB 2M9HA 2DCEA 1WCMJ 3E3VA 2DO7A 4ZZLA 1X2MA 4H4KC 3HOZJ 2IGOA 2RVCA 4IO9F 1UB9A 2R5YA 5IYBJ 1Z05A 3VYTB 3BG6A 3FIWA 2CW7A 3U9GA 2Z33A 4ESJA 3W6JB 3K10A 1BOBA 3IUOA 5LD2C 4NBQA 3HOTA 4GO1A 1EH6A 1X1PA 2KQRA 2IT0A 2CH0A 2XF6A 3OMYA 1QVTA 4XBFA 2JT1A 2DOFA 4OOIA 1G3YA 3PO3J 5EYRA 3DV8A 5LGTA 3AAFA 1YX5A 3OL3A 2Y9YA 2VPRA
chains in the Genus database with same CATH topology
4IOAF 1VQ4I 1VQPI 1Y39A 1VQ8I 3CC4I 3CCSI 3J7ZI 1VQNI 5DM7F 2H8WA 3CCLI 2ZJPF 4UY8I 1YJWI 2K3FA 3CCRI 2OTJI 1YJNI 1QA6A 2FOWA 3CC7I 3G71I 1YI2I 3CJTB 1YITI 4IOCF 1YHQI 2JQ7A 2E35A 3I55I 1YJ9I 5GAHJ 3J7YJ 1HC8A 1YIJI 1VQ9I 2ZJQF 1VQMI 3G4SI 4V19K 1VQ5I 5JVGF 3CD6I 1S72I 3CCUI 2QEXI 3CCVI 3CCJI 2NXNB 3CC2I 1VQOI 3CF5F 5GADJ 5GAEJ 1VQKI 2E36A 3PIOF 3CCEI 1VQLI 3DLLF 3CCQI 3CMEI 1FOWA 1MMSA 3I56I 3G6EI 2OTLI 1VQ7I 4IO9F 2E34A 1FOXA 1ACIA 3CCMI 2QA4I 1FOYA 3CMAI 5GAGJ 5DM6F 3PIPF 1VQ6I 2ZJRF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOA F;  1VQ4 I;  1VQP I;  1Y39 A;  1VQ8 I;  3CC4 I;  3CCS I;  3J7Z I;  1VQN I;  5DM7 F;  2H8W A;  3CCL I;  2ZJP F;  4UY8 I;  1YJW I;  2K3F A;  3CCR I;  2OTJ I;  1YJN I;  1QA6 A;  2FOW A;  3CC7 I;  3G71 I;  1YI2 I;  3CJT B;  1YIT I;  4IOC F;  1YHQ I;  2JQ7 A;  2E35 A;  3I55 I;  1YJ9 I;  5GAH J;  3J7Y J;  1HC8 A;  1YIJ I;  1VQ9 I;  2ZJQ F;  1VQM I;  3G4S I;  4V19 K;  1VQ5 I;  5JVG F;  3CD6 I;  1S72 I;  3CCU I;  2QEX I;  3CCV I;  3CCJ I;  2NXN B;  3CC2 I;  1VQO I;  3CF5 F;  5GAD J;  5GAE J;  1VQK I;  2E36 A;  3PIO F;  3CCE I;  1VQL I;  3DLL F;  3CCQ I;  3CME I;  1FOW A;  1MMS A;  3I56 I;  3G6E I;  2OTL I;  1VQ7 I;  4IO9 F;  2E34 A;  1FOX A;  1ACI A;  3CCM I;  2QA4 I;  1FOY A;  3CMA I;  5GAG J;  5DM6 F;  3PIP F;  1VQ6 I;  2ZJR F; 
#chains in the Genus database with same CATH topology
 1O57 A;  3RDI A;  1A04 A;  2MD0 A;  4UXN A;  3RQI A;  2JRT A;  2NYX A;  3AG2 H;  3U1D A;  1Z6R A;  3V8L A;  2XAG A;  3JTH A;  3I64 A;  5KNL A;  4PZJ A;  2PX9 A;  3DU6 A;  3RCO A;  4YFK F;  5IOZ A;  5DM7 F;  1U3E M;  5K5R A;  4ZYH A;  3CCL I;  2KMU A;  2NNN A;  3EPZ A;  1ETW A;  1T0F C;  1YS6 A;  4HX7 A;  2ISZ A;  1S29 A;  3OYG A;  3S2H J;  4RDU A;  4BE2 A;  3SZG A;  2ZNZ A;  2HXO A;  4V2G A;  2R5Z B;  2EIJ H;  1WI9 A;  4DJA A;  1I1S A;  5IOY A;  5E3M A;  4XSX F;  1CF7 A;  2FOW A;  2K86 A;  1ZEL A;  3FXK A;  5FO5 A;  4B8X A;  2WTE A;  1MMN A;  4UUS A;  1GT0 C;  3OIO A;  3TKY A;  2IS6 A;  3LSM A;  4E7Z A;  1TP4 A;  2IXS A;  5CQG A;  4EQQ A;  1G6N A;  2V1U A;  3VOE A;  2P7C B;  4BY7 J;  1ENH A;  3RIR A;  3S3M A;  2JPC A;  2BZT A;  1YIJ I;  1VQ9 I;  2EB7 A;  2LP0 A;  3I59 B;  1FTT A;  2N8G A;  1D5Y A;  1P4X A;  4D1Q A;  1ZTR A;  5J4Y A;  2FX0 A;  2J5O A;  2JRM A;  3H36 A;  4M9S A;  4XLA A;  5TGT A;  4RGX A;  4LLL A;  3HSE A;  3E5U A;  2XGE A;  2MBF A;  3GEZ A;  1D0Y A;  2QYO A;  4MEY F;  4EJU A;  2JA5 J;  3HTU A;  1QZY A;  1D0X A;  1KU7 A;  4RLF A;  3KP4 A;  1RNL A;  3BPX A;  4JP0 A;  3CCE I;  2VE9 A;  1W0T A;  2HYF A;  1WQ2 A;  3OYA A;  1ZRD A;  1X1B A;  5IYD J;  4I09 A;  3DLL F;  3CCQ I;  2HQ5 A;  4BHC A;  3GXO A;  4LLG F;  4BXU A;  5L3E A;  4AIH A;  3I56 I;  2OF7 A;  2HOT A;  1ON1 A;  5M5X J;  2HGC A;  1P7J A;  1R00 A;  3QP5 A;  3GZ6 A;  2ETH A;  2RKH A;  4XKW A;  2B0L A;  5EEG A;  3HGG A;  2ZXJ A;  3HHG A;  3OWT A;  5EDN A;  4O5V A;  1JUS A;  2IW5 A;  2NAZ A;  1FOX A;  4O3M A;  3DKW A;  4JX6 A;  3M9A A;  5M5W J;  1ACI A;  1ITY A;  2EV6 A;  1BJA A;  4LD5 A;  3VOD A;  2FXA A;  2IS2 A;  3CES A;  2P8T A;  3PQJ A;  4UNO A;  3ZQQ A;  1EV7 A;  2E7X A;  1SFK A;  2IJL A;  5LFA A;  3BTI A;  2M0C A;  2MD5 A;  2NVU B;  1IUY A;  4IZZ A;  1RKT A;  1F43 A;  3MKY B;  1WH5 A;  2VJ4 A;  3WTZ A;  3HOY J;  2VQH A;  3SDB A;  3MKW B;  1LNW A;  3I3L A;  1Y39 A;  3WGG A;  1VND A;  1SFU A;  1JKQ C;  3QP6 A;  1G8X A;  2DW4 A;  3DWL E;  3OS0 A;  4HF2 A;  2VB6 A;  4E70 A;  1OJL A;  2BY3 A;  4B43 A;  1E17 A;  2BY0 A;  4HOB A;  3ERM A;  1MBE A;  3FHN A;  1LFP A;  1PVE A;  2W7N A;  4LFU A;  1KON A;  2KHM A;  2R7T A;  3NRV A;  4RAF A;  3I4N J;  4A3J J;  3WTS C;  1XSV A;  2K3P A;  4YG2 F;  1TQI A;  2F4M B;  2HFH A;  4GYG A;  3R0A A;  1XG1 A;  1YE9 A;  4C2M J;  2XAH A;  2UV1 A;  1YHQ I;  2RC4 A;  1T33 A;  2D2W A;  3BTL A;  2PMZ N;  2ZNY A;  1PJR A;  3O6B B;  4WXD A;  1B1B A;  1BIB A;  2X6X A;  4BXX J;  3J81 K;  3LSK A;  1N77 A;  2CV1 A;  1W5S A;  2CS3 A;  3AL0 B;  2KFD A;  4TV7 A;  3F8C A;  4PGH A;  4XKV A;  4FX0 A;  2CRG A;  1MH4 A;  5EGO A;  1ZKG A;  2QSH X;  1TW3 A;  2R4G A;  3BR1 A;  2L2O A;  1SAN A;  2ID6 A;  2KL4 A;  2R7X A;  3CJN A;  5E79 C;  2NOJ B;  1GVJ A;  4AID A;  3F72 A;  4ENN A;  2LFB A;  3W2V A;  5EF6 A;  3C1D A;  1AHD P;  3NEU A;  2M4K A;  3LNQ A;  1ETV A;  1ETK A;  2A6H F;  2PJP A;  2VKV A;  1OFC X;  1U5T A;  1XDS A;  3G6E I;  2P0W A;  2BY2 A;  4BBR J;  2DPU A;  2NOG A;  1E3P A;  2WC2 A;  1YRN A;  2P5V A;  1KQ8 A;  1XMX A;  1RUO A;  1QRY A;  3VSL A;  5CLS A;  4FET A;  3JCU C;  2UZK A;  2VXD A;  1FT9 A;  3RKX A;  5E3N A;  3L2C A;  3LSP A;  2BVM A;  1FLI A;  4ZYE A;  3RPU A;  2NRA C;  2IS1 A;  4OIO F;  2WV1 A;  2VXZ A;  2A3S A;  2X0L A;  3F6V A;  3RYP A;  4BQQ A;  3HEF A;  5F1J A;  3H35 A;  4XRM A;  2DFF A;  3BZK A;  2QM3 A;  3KP6 A;  2XAJ A;  2CV0 A;  2KLO A;  1MMG A;  2HKX A;  4IVN A;  2VON A;  2P6S A;  2X6Y A;  2V7F A;  1R6R A;  1YOV B;  2ZJR F;  3EUK L;  2R0Q C;  2XRO A;  2H27 A;  1SVO A;  1Z7U A;  1T95 A;  1JJ8 C;  5BOX A;  5ICE A;  2QKL B;  1W1W E;  3UKG A;  2F5D A;  2F4O B;  2LC2 A;  1P2F A;  3SFI A;  3ONQ A;  4RB1 A;  5C4X J;  2KIS A;  4C3H J;  4M71 A;  4AIK A;  1S3J A;  1K6Y A;  3V7C A;  4HDU A;  2A5W A;  2PBI A;  4DBR A;  3Q5F A;  5F1R A;  4QPO A;  5HOD A;  4DBQ A;  2Y31 A;  2VJI A;  1DPR A;  5FFX A;  1ZGA A;  2DLL A;  4I0A A;  1U0J A;  5CYV A;  2CUZ A;  3TOB A;  4MHG A;  2M34 A;  4PUS A;  1V55 H;  4O6J A;  4ENM A;  3KYL A;  4XOT A;  5BS6 A;  2KRF A;  3JRG A;  1QA6 A;  5LHH A;  2L9V A;  3OYD A;  3C2B A;  1KYZ A;  5D5W B;  1N75 A;  4BYY A;  3L1P A;  1YIT I;  3IWF A;  1XS9 A;  1MJB A;  1LDK B;  4A6E A;  2GLO A;  4XLF A;  5B3S H;  1IZ1 A;  3GFM A;  2DU9 A;  1JGS A;  1OQY A;  2RGV A;  1LFU P;  3LFU A;  2Z3Y A;  1N78 A;  3HM5 A;  1MMD A;  5LHI A;  2XPV A;  4BKX A;  5K7H A;  2NVQ J;  2O3F A;  3S1N J;  1GV5 A;  3ECH A;  3JRE A;  3VYS B;  1P9Q C;  2DTR A;  5B1B H;  4U0V A;  5E3L A;  4BE0 A;  3LA7 A;  3L2U A;  1HQC A;  2FE3 A;  1NHA A;  4EV0 A;  3IRQ A;  4G94 A;  1RUN A;  4XOP A;  4PSX A;  4P96 A;  1OIS A;  5HOO A;  2Y2Z A;  2HOS A;  2M4G A;  2R7Z J;  1GUU A;  3A2K A;  3M07 A;  3FK6 A;  1X1D A;  2DYS H;  5F0C A;  1F9N A;  5HLT A;  4L5J A;  5JI6 A;  1Y8R B;  2VAS A;  1Q1V A;  2ECC A;  3MEX A;  3E6M A;  2GWR A;  2X9D A;  2EZH A;  4RAY A;  1E2X A;  3FXJ A;  1IXC A;  1WKM A;  3WGH A;  5AON A;  2DDA A;  2QQ9 A;  2OCE A;  3D5S C;  5HS8 A;  3I54 A;  1IN7 A;  1FX7 A;  2E34 A;  3ABU A;  1QHH D;  2X6W A;  4F92 B;  4ZTJ A;  4R79 A;  1LDD A;  2GBY A;  3SDG A;  3NAU A;  3IHU A;  4Q47 A;  2JN6 A;  2G7H A;  5GAG J;  1ZGW A;  2R7O A;  2DT6 A;  2HTS A;  2IEK A;  4JYK A;  2LMD A;  2LF7 A;  5HVQ C;  4G8X A;  4R1H A;  5FKL A;  2OA4 A;  3PO2 J;  2HQR A;  1ERD A;  3I5U A;  4J01 A;  1JJ6 C;  2D45 A;  1EJ9 A;  3L9F A;  4C30 A;  2HR3 A;  4XLN F;  4E7S A;  4BXF A;  4AU7 A;  4EM1 A;  2IA1 A;  1YW9 A;  2RNG A;  3RSN A;  2KT0 A;  3B6A A;  2E2J J;  4L9J A;  4P9U A;  1HOM A;  1QQI A;  2Y75 A;  1V5E A;  1DUX C;  5KCM A;  2H1K A;  2VKH A;  1BC8 C;  3TP3 A;  3F8M A;  3J7Z I;  4LJZ F;  2HVS A;  2FSW A;  2HI3 A;  2CW0 F;  3IH4 A;  3GO5 A;  5J4V A;  4XRS A;  4ZTF A;  1QPI A;  4ENJ A;  3CZ6 A;  1TWF J;  1UHS A;  1P4W A;  4A69 C;  4RB0 A;  3RTR A;  1FTZ A;  4I0B A;  2V9P A;  3CDI A;  2F2E A;  5FKO A;  1U5T C;  3AG4 H;  3TO7 A;  1YTY A;  5EG0 B;  1S5L C;  1WJD A;  3WTU C;  4Y7N J;  2XB5 A;  2DTZ A;  3R61 A;  4NC7 A;  5ERI A;  4RBO A;  3H3V K;  1S7A A;  3W3C A;  3G71 I;  1L0O C;  2IS4 A;  1HKS A;  4GGG A;  1UCR A;  4WX9 A;  1O3R A;  1S7E A;  3I9V 2;  2VL8 A;  2OQR A;  2ZXW H;  1FYM A;  4G7Z F;  2K02 A;  5JLX A;  3J7A O;  3IV5 A;  2YPR A;  2L7Z A;  3F3X A;  4ZJZ A;  4A3L J;  3EYY A;  4PJJ A;  4F7Z A;  3VYR B;  2WWY A;  1TT5 B;  3CCJ I;  2JMW A;  1U9N A;  1Z0X A;  3C3W A;  3S1Q J;  4RB3 C;  4HA8 A;  5DV5 A;  3S32 A;  1OKR A;  2WY8 Q;  2Y9Z A;  2COB A;  5IP9 J;  2B63 J;  1R5H A;  2JWT A;  1NK2 P;  5IY5 H;  1T39 A;  5GPC A;  3L2V A;  3GFJ A;  1ZGJ A;  3K2Z A;  3Q0V A;  2CWE A;  5A2Q K;  1VI0 A;  3S2W A;  5EZH A;  3HIF A;  4M6V A;  1FOW A;  2M87 A;  1B9M A;  5B1A H;  1W5C C;  3JTG A;  4CYC B;  3BP8 A;  2XAQ A;  4G6D A;  3R4K A;  4XKC A;  2DPD A;  4I2O A;  2ZME A;  5KHD A;  1V4R A;  1VQ7 I;  5BPI A;  4DYC A;  4KDP A;  2TCT A;  4MQ9 F;  2G0E A;  1B59 A;  4Y33 A;  2KPM A;  2RAE A;  4JK1 X;  4WF2 A;  5BNG A;  4CZC A;  4X1E A;  1J59 A;  2ME6 A;  3CMA I;  4MO7 A;  1S8N A;  4F52 A;  1GXQ A;  1R22 A;  2RNJ A;  5FLX Z;  1BBY A;  5FFZ A;  2RDP A;  2O8X A;  2HQA A;  4UVC A;  2X1E A;  1UHW A;  4C3I J;  4RB2 C;  2JJ7 A;  2CQN A;  2Z1D A;  3OYE A;  2K5C A;  2OUM A;  3H5N A;  1X4O A;  3HSR A;  5ED4 A;  1IV8 A;  3GLX A;  4GCV A;  3CLQ A;  1STZ A;  2GA1 A;  1CQT A;  2M8E A;  4BJT A;  2VOO A;  4IRG A;  2ZFW A;  2JPB A;  3CQZ J;  4B09 A;  3ZN0 A;  1VQ4 I;  1AKH A;  4S0H B;  3HC7 A;  2G9W A;  1R1U A;  3BDD A;  3CCS I;  4ZC3 A;  4FE7 A;  1B4A A;  5DUK A;  1DP3 A;  3OYK A;  2ZXI A;  1WJB A;  2QWW A;  1XDU A;  4NNJ A;  1MZB A;  1J7K A;  2XAU A;  3ZQ7 A;  5M5Y J;  3K9T A;  9ANT A;  3B6C A;  2NS0 A;  4M3E A;  1BIA A;  5GP9 A;  3H0D A;  2R7S A;  3IH3 A;  3BR5 A;  4CDG A;  1XGN A;  1YJN I;  1ETQ A;  1F36 A;  2FBI A;  3S17 J;  2JVG A;  3TBI A;  3BG7 A;  5TIS C;  5JFR A;  5ILS A;  1HCR A;  5B66 C;  4DW6 A;  1YI2 I;  1RZ4 A;  3S16 J;  3EYI A;  3VB2 A;  3L2Q A;  2KJC A;  3V7R A;  3HL2 A;  2KZG A;  1PUF B;  3RYR A;  2FA5 A;  2ESH A;  1LE8 A;  3A1Y A;  1BR1 A;  2E71 A;  1ZQ3 P;  4J19 A;  5LRS A;  1VQ5 I;  1R9T J;  1O3Q A;  1S72 I;  1YX3 A;  4MLO A;  1D1C A;  3WTT C;  3FBN B;  4XRF A;  1ZR4 A;  1HXD A;  4K2E A;  2TRT A;  4HV6 A;  3TW6 A;  1BOA A;  1HW2 A;  2Y0S A;  3BQY A;  3S3O A;  1VQK I;  3FK7 A;  3CLO A;  2BBY A;  3K69 A;  3LOC A;  2ACJ A;  5DEQ A;  4OIQ F;  2LBF B;  1LFB A;  4XID A;  2WB1 A;  1D8J A;  2CUE A;  1T8I A;  3GX4 X;  2WAQ N;  1FIP A;  3T8T A;  3LA2 A;  2KRC A;  5TJJ A;  4NB5 A;  1KZH A;  4NC6 A;  2JSC A;  4A3E J;  5DCM A;  5EEH A;  3HKZ A;  2DOA A;  2LY9 A;  3WTW C;  2LY2 A;  3OYH A;  3EQL F;  4GXO A;  4HF0 A;  1IGN A;  3BR2 A;  3HRT A;  1ZYR F;  2EFP A;  4YEJ A;  3B73 A;  3CMM A;  3I58 A;  2BHZ A;  3GTG J;  3OYF A;  1IDY A;  2CFX A;  2QZ8 A;  4AUX A;  4A6D A;  1R1T A;  1HLV A;  2A05 A;  2V4J C;  3PJR A;  3EDP A;  2V1X A;  2FBH A;  2DK5 A;  1B8I B;  4W1U A;  3UR3 C;  2CW8 A;  3ZPL A;  3COA C;  4LG0 B;  2ZXH A;  1NG6 A;  2ELH A;  4Y4R A;  1ON2 A;  1BI2 A;  1WFX A;  3PFI A;  1IXR C;  1R71 A;  5ILV A;  1TLH B;  1JXS A;  1RIO H;  4OIR F;  4RGU A;  5IT9 Z;  1O7L A;  1WHU A;  1HBX G;  3ISP A;  3MZ8 A;  4DQ2 A;  3OY9 A;  1I3A A;  1RR8 C;  2K4J A;  1OCC H;  2VOD A;  2MAB A;  5LRR A;  3H9J A;  4MGR A;  5ICC A;  4NC8 A;  2M7B A;  5FGM A;  2DQL A;  3LSI A;  1ORK A;  1Z9C A;  4IHW A;  3HOU J;  1MBH A;  1TWH J;  1EF4 A;  1D8K A;  1K78 B;  3EUH A;  3HJE A;  1BI1 A;  5FLV A;  3BJA A;  1E3H A;  3NAR A;  1MBG A;  4NDL A;  4CCL A;  3CUQ C;  2DMP A;  1XD7 A;  3MQ0 A;  1RC9 A;  3M8J A;  3HG9 A;  3K4J A;  4B48 A;  1HC8 A;  4M3D A;  4MEX F;  5B5E C;  3W2A A;  3T1B A;  2ZJQ F;  1VQM I;  2EPF A;  3DPT A;  3G2B A;  3DP7 A;  4XN3 A;  3U21 A;  2LNB A;  1WI3 A;  4A3C J;  3CD6 I;  1G3T A;  4L18 B;  1IV6 A;  1W5T A;  2CUJ A;  2WB1 N;  1ZAR A;  1U9O A;  2OCC H;  1R36 A;  3P9I A;  1ULY A;  1LPQ A;  4IXA A;  1MNE A;  4I76 A;  4KMF A;  2OD5 A;  2QLZ A;  3V4G A;  2JA8 J;  4I6Z A;  5L3G A;  5J3L A;  3QYE A;  3KP2 A;  3CTA A;  4AVP A;  4WWC A;  1R7J A;  3DEU A;  1K61 A;  1TWG J;  5HDG A;  4N9I A;  3LA3 A;  1P6R A;  1BR4 A;  3HZJ A;  4M3F A;  2K9Q A;  5FLX K;  4ETS A;  3WGI A;  4E4H A;  1BM9 A;  2CGP A;  2HWV A;  3ELK A;  4PSW A;  3FF5 A;  5CVV A;  3CJQ B;  2D1V A;  2R7V A;  2UXN A;  4AVZ A;  1TNS A;  2EFO A;  2KKO A;  2M2E A;  5J1U A;  3IRR A;  1F4K A;  1Z67 A;  4MFE A;  4A0Y A;  4U87 A;  4LMY A;  4MNU A;  5E1Z B;  2LD5 A;  2QBY B;  1NTC A;  3BPV A;  4XOR A;  3ABK H;  2IPQ X;  1SVL A;  4NQW B;  2DXI A;  4RAG A;  1EH7 A;  3HGY A;  4XNF A;  4G7O F;  2HDD A;  3WE2 A;  4AWX B;  4PGG A;  3DU5 A;  4D9J A;  4M72 A;  2JZY A;  2ICW G;  2JK3 A;  2P5K A;  2AXT C;  4KYW A;  5HLH A;  1A31 A;  2A5Y B;  2IAI A;  3HDD A;  2MH9 A;  2BGC A;  2KP6 A;  4DOZ A;  2P4W A;  2XDV A;  3SEQ A;  3V8K A;  2LY1 A;  4HDV A;  2K9S A;  1LB2 A;  3KZY A;  2EH3 A;  4G12 A;  2EIL H;  3AKZ A;  4EJO A;  3WU2 C;  1W36 C;  4HLY A;  2BXY A;  1LDJ A;  4YFX F;  1BW6 A;  1Z7L A;  2K9L A;  2MFZ A;  2XVC A;  3BR0 A;  5JR3 A;  4L9N A;  4CXF A;  1SVM A;  4QWQ A;  5C3E J;  2YUS A;  3KET A;  3M7G A;  3DFG A;  2WA0 A;  1TQM A;  3HPH A;  4DNC A;  1LVA A;  4BE1 A;  1PP7 U;  1IN5 A;  4YFN F;  4N4O B;  1YFH A;  4JBA A;  4A3K J;  1PUE E;  2M0M A;  2PN6 A;  4FX4 A;  1BA5 A;  2P81 A;  3CO6 C;  1WRJ A;  5LEJ A;  1JE8 A;  3A03 A;  2KIQ A;  3TL4 X;  5HNF A;  1UZC A;  3WU0 A;  1FMW A;  5KAI C;  4RM3 A;  3ZXS A;  3A4C A;  1BW5 A;  5DS9 A;  4BEH A;  1K79 A;  3IP4 B;  2L4M A;  4OIN F;  2HU9 A;  4EAT A;  4BQA A;  1W7P B;  2W4S A;  2UWM A;  3PUF A;  2RQQ A;  5GAD J;  1B72 B;  4YIF A;  2QVO A;  3J80 Z;  2BW3 A;  3M3Y J;  3PIO F;  4U88 A;  3DEE A;  1UAA A;  2QUF A;  1W4M A;  2HOA A;  1NH3 A;  2FML A;  2COM A;  3CME I;  4L9T A;  1LKX A;  3BJO A;  1HW1 A;  3LQQ A;  2M30 A;  2JUC A;  2X51 A;  3FXR A;  3GTP J;  4YII A;  3GFL A;  4B1R A;  5J1Y A;  2PJR A;  1R5I D;  1Z21 A;  3A01 B;  4BHB A;  4IJA A;  2OTL I;  3K70 C;  1JUM A;  1MDM A;  2AHQ A;  1U2W A;  1HKT A;  3GVA A;  4AIJ A;  1IW7 F;  3MZH A;  1QO0 D;  4BJ6 C;  2K9N A;  4M9X A;  3E6B A;  4E7J A;  2XKO A;  2E1O A;  5L3B A;  4PDK A;  4UV8 A;  2LRD A;  5JVT A;  4XQF A;  1IC8 A;  2KRH A;  2OV7 A;  5F0F A;  3V8J A;  3GYH X;  2VUM J;  2ZSH B;  3JRH A;  3ASN H;  4L0Z B;  1I50 J;  3RPU D;  2ME0 A;  1YO5 C;  4KIS A;  4LK1 F;  1I3Q J;  4II3 A;  4PFP A;  3WG7 H;  5IT9 K;  3K4L A;  1OYY A;  5E1X A;  1P4A A;  2EZL A;  4QPQ A;  1LVK A;  3TO6 A;  1SAU A;  2BXZ A;  2Z16 A;  3QYF A;  3I0T A;  4XM3 A;  2MH2 A;  3DKX A;  3D5L A;  2F5F A;  3OS1 A;  3ZQF A;  1SFE A;  1P92 A;  3BZ6 A;  5DCF A;  1WJ5 A;  3CC4 I;  1X3W B;  4IHX A;  4CCM A;  1VTN C;  3OYC A;  1ETY A;  2EFN A;  1TC3 C;  3GLL A;  3T5X A;  1K7A A;  1IXS B;  4OIP F;  2XAF A;  3L2R A;  1V54 H;  4BL0 B;  1DQU A;  2AO9 A;  1GV2 A;  2K85 A;  2PMH A;  3HSF A;  2R5Y B;  3ZQG A;  4A3I J;  3BJ6 A;  3K6G A;  3K4N A;  3S93 A;  3TED A;  3HRS A;  1OCT C;  3PM1 A;  5FRN A;  2Y48 A;  2BY1 A;  4BJ5 C;  2MYS A;  1MSF C;  2E2I J;  3CC7 I;  2Z2S B;  2EZK A;  4FHT A;  3OYM A;  4BAC A;  1HSJ A;  3I55 I;  2CFO A;  1OYI A;  4KJZ A;  4M9Z A;  1YW7 A;  2VT2 A;  2H6C A;  3B02 A;  2IGM A;  2H94 A;  3G4S I;  1SD7 A;  3MN2 A;  5D8K B;  3KEQ A;  3ZQH A;  2F48 A;  4HEA 2;  3JRC A;  2GXB A;  3C2G A;  2E1C A;  1IO2 A;  1B9N A;  4RGR A;  2MG4 A;  4RGS A;  2NNY A;  4LLN A;  3MZY A;  1XPX A;  5F08 A;  3FXL A;  1R4N B;  1KQ9 A;  3PNY A;  5FKM A;  3JSO A;  2ID3 A;  2ZJ2 A;  1MH3 A;  2HQN A;  2L7M P;  4JX5 A;  5FKK A;  2R7D A;  3G3Z A;  2STW A;  4FQG A;  3ROU A;  1D3Y A;  4UV9 A;  2ZFU A;  1J9I A;  4GRI A;  3OIP A;  3BR3 A;  1QGP A;  1D5V A;  5H2F C;  3KFW X;  2GZW A;  1HDD C;  1CF7 B;  3FZV A;  5C44 J;  3H0G J;  3GWZ A;  4D7M A;  3CUO A;  3ZCO A;  2DJI A;  2DA1 A;  1VZ0 A;  4UUS B;  2O7O A;  5CJ9 A;  3CCY A;  5L3C A;  5L3F A;  1MJA A;  2JA6 J;  2EFQ A;  3ZRG A;  1H0M A;  4KIT B;  5CQE A;  2QA4 I;  3A02 A;  3GTJ J;  2GM4 A;  1IRX A;  1SFO J;  1CGP A;  3H5A A;  1OYW A;  5C4J J;  4GFB A;  1BN5 A;  1JGG A;  3KEY A;  4AYB A;  3CP2 A;  2M7A A;  4LGW A;  3RKQ A;  2LR8 A;  3QRF F;  1A6Q A;  3WTX C;  1EH8 A;  2LYC A;  3G1L A;  3OL4 A;  3J7A Y;  2MC4 A;  2R7U A;  1TWC J;  1M1E B;  2HTJ A;  4U7B A;  3VEP A;  3CP8 A;  2EQR A;  2YSR A;  5CVU A;  4IRI A;  3HYI A;  1VQ8 I;  3ULQ B;  4WXH A;  4KIB A;  4XLH A;  1UHM A;  3K1M A;  4BBS J;  4LK0 F;  2DFE A;  2YU3 A;  5F6F A;  1FBU A;  4LB5 A;  1GHC A;  5F64 A;  2AQE A;  4E7H A;  2CG4 A;  5BQT A;  1ETO A;  3C18 A;  1X58 A;  2ZJP F;  2LH9 A;  1AA7 A;  1IUF A;  2XGC A;  4V2F A;  4Z6Y A;  3LL7 A;  3P7N A;  3OOP A;  4M74 A;  5DD4 A;  1H9G A;  3LSR A;  2O5R A;  2OJE D;  3HUG A;  3ZGK A;  3HOW J;  3TOA A;  3I71 A;  4XK4 A;  5L3D A;  2DI3 A;  2LVS A;  2Q2E B;  2OQG A;  5ICG A;  4EM2 A;  3P5J A;  5CVI A;  3OSG A;  4KT6 A;  3OYN A;  2B7E A;  3ZP5 A;  2VIX A;  1K4T A;  2QSF X;  1J0R A;  5E3O A;  2WAF A;  1KYW A;  4CCJ A;  1KGS A;  4IPA A;  1YQA A;  3I4P A;  3J80 K;  2DOE A;  5LHG A;  3JRB A;  4I02 A;  3D0S A;  1YYV A;  3KPH A;  2OPT A;  2ZB9 A;  2R3S A;  1FNN A;  2J5P A;  3EET A;  2V9V A;  3DBR B;  3QQA A;  3LMM A;  5GPA A;  2GAU A;  2EIM H;  3O8H A;  3L09 A;  4N0B A;  4Y52 J;  2JUG A;  2E36 A;  5EEA A;  1A35 A;  3DCF A;  2V9K A;  4G6Q A;  5J8F A;  4PJL A;  4ZYG A;  2L9R A;  2EV0 A;  5D5X B;  3DF8 A;  2VBX A;  4FE4 A;  4IHY A;  4ESF A;  4CYD A;  1KU2 A;  4HX4 A;  3T0Y A;  3FBI B;  1YLF A;  1JKP C;  2VC1 A;  3HOS A;  4HBL A;  3ZR8 X;  2ZC2 A;  1KU9 A;  3M8F A;  4M6Y A;  1FZP B;  3F8B A;  5H6R A;  3N4M A;  3G1M A;  2R5Z A;  2Y69 H;  4RM2 A;  4FIS A;  3GCM A;  2PFB A;  2GOM A;  3KLN A;  1GLN A;  3ESW B;  5EGO B;  1JUP A;  4A3F J;  2RRE A;  2XPU A;  3SQN A;  2VE8 A;  4BAY A;  2XKP A;  3BG5 A;  2F4I A;  2L7K A;  2W24 A;  3H9Q A;  3I59 A;  1WWX A;  2XB0 X;  1SAX A;  4XLE A;  3K7A J;  3C7J A;  2NVX J;  2HDW A;  3OS2 A;  2HVQ A;  1QZE A;  3DTK A;  2V6C A;  2LKS A;  5IT3 A;  3FXM A;  1E3O C;  4A5M A;  1X2N A;  1MBK A;  1G2H A;  1U5T B;  2DYR H;  4S04 A;  5E17 F;  2DMN A;  3GF2 A;  4IQ4 A;  4II2 A;  2XSD C;  1YRN B;  2MA3 A;  4P9F A;  4U0W A;  3PSF A;  3JRA A;  3BRO A;  4EGZ A;  4LIV A;  1FSH A;  3FXQ A;  3QPL A;  2VKD A;  4PFO A;  3ZMT A;  3QOD A;  1FY7 A;  2QQB A;  2R7F A;  4MTD A;  4KNY A;  3QWL A;  4EEF G;  3M1E A;  5D8L B;  2E35 A;  1Z1D A;  4HQM A;  1IG7 A;  4D7N A;  2R7W A;  4E6K G;  2E7W A;  4LIU A;  1ZR2 A;  3E97 A;  3LAP A;  2X1C A;  1FIA A;  4HST A;  3LSH A;  1UMQ A;  1UJ8 A;  2P5L C;  2NS8 A;  1W7P D;  2DN0 A;  1HDP A;  3PSI A;  5E20 A;  2O61 A;  4KFC A;  5FRO A;  3ZMS A;  4RS8 A;  5JHF A;  2GIZ A;  2PQ8 A;  2JTV A;  1XGO A;  4WK8 F;  3KZI C;  1H9T A;  2UUZ A;  4XN0 A;  3IC7 A;  5H20 A;  5FRM A;  2G7U A;  3QPS A;  3GBG A;  1TNT A;  2DQR A;  1ZRF A;  2VBY A;  1POG A;  3PNV A;  1U8B A;  3LFK A;  4X6A J;  2GQQ A;  3KP7 A;  3BZC A;  4CCO A;  2ELK A;  3OYB A;  2DA6 A;  1ZHF A;  1U8R A;  1FPQ A;  1EA3 A;  3R6S A;  1W36 D;  1X1A A;  2K4B A;  3GTQ J;  1OCZ H;  4HPQ A;  4KN7 X;  5FB2 A;  3RKY A;  2L02 A;  2GA2 A;  1J2X A;  3BTJ A;  1FWZ A;  4WCG A;  3TMO A;  2YS9 A;  3LST A;  4KN4 X;  4P55 A;  3FKI J;  2A07 F;  2K40 A;  2L9N A;  3BG9 A;  3EUA A;  3QOE A;  1FEX A;  1ZLJ A;  4ZYA A;  2L01 A;  2JA7 J;  4QSH A;  1REP C;  1L3L A;  1T6S A;  1FBQ A;  2V1N A;  1WJC A;  4XSZ F;  1J09 A;  2FQ3 A;  2Q8K A;  4KA4 A;  3PQK A;  3ZQL A;  3OYI A;  2AQF A;  1PYV A;  1SMT A;  1KA8 A;  4B47 A;  1FOK A;  4ZH4 F;  4HNU A;  1RES A;  5TRD A;  2W82 A;  4ESB A;  2CQQ A;  3REO A;  4R8H A;  2BVL A;  3HRM A;  1RRJ A;  3PNT A;  2HNH A;  3SZT A;  3IKV A;  3JRF A;  2EFW A;  2VJJ A;  1IDZ A;  1TW2 A;  3FMR A;  5DYM A;  2TDX A;  3S14 J;  3K4K A;  2L9S A;  1OCO H;  2F5E A;  4UHT A;  2X6O A;  5CVR A;  1J5Y A;  1WJF A;  2FD5 A;  3GFI A;  1AOY A;  3BOQ A;  1VQN I;  2HOE A;  2VI6 A;  4EVI A;  4IHS A;  2EV5 A;  4CO8 A;  1UST A;  2H8W A;  1I6H J;  3IAM 2;  4KIG A;  1DGR M;  3O3K A;  2LLK A;  1YJW I;  2A69 F;  2DK8 A;  2QQ8 A;  3K70 D;  5HLG A;  3WG9 A;  2B9S A;  1S9H A;  3MFK A;  2X1D A;  4L5E A;  4I98 B;  2XAS A;  3E1S A;  3H1C A;  2BV6 A;  1XGS A;  4ITV A;  4RA2 A;  4A0Z A;  2XGD A;  2X85 A;  5J47 A;  2X48 A;  1YJ9 I;  4HX8 A;  4OU0 A;  3O2P E;  2HZT A;  4L5I A;  3K1N A;  2XGX A;  1JKR C;  4CZZ A;  2DA4 A;  2FRH A;  1LQ1 A;  4P1W A;  3DBL B;  3ABL H;  3WU1 B;  3JRI A;  4Y17 A;  1H89 C;  2UXX A;  4ZDP A;  3I4M J;  3K0L A;  1TL8 A;  3CC2 I;  3S1R J;  2EIN H;  3U1K A;  1EKE A;  2VN2 A;  1O4X A;  1A6I A;  4B3A A;  2VLA A;  2V79 A;  1OCR H;  2ZME C;  1D1B A;  1FYL A;  1JKO C;  4I99 C;  2QF7 A;  5GAE J;  1XCB A;  2QGU A;  3IL2 A;  3HPG A;  3MKZ A;  4YEL A;  3Q3S A;  3SYT A;  2VKE A;  1FBS A;  1N25 A;  4A93 J;  2VOP A;  4Y3O A;  3FHZ A;  4IF4 A;  1LJ9 A;  1FSE A;  4UUT A;  4XKB A;  2XIG A;  1IN4 A;  2CSO A;  1DU6 A;  1OLT A;  2Y0S N;  4C2U A;  1ODD A;  3NWS A;  3OV8 A;  2WAD A;  2LG4 A;  4IX7 A;  4FCY A;  4AC0 A;  1AWC A;  2A6T A;  2KIM A;  4G6T B;  3U2R A;  2LSO A;  1FYK A;  4G7H F;  1H88 C;  4B44 A;  4A0X A;  2XSJ C;  1IN6 A;  4M6X A;  1Q1H A;  2FMY A;  4JX4 A;  4B3X A;  3SEZ A;  3HBL A;  1SD5 A;  4ZZD A;  1YG2 A;  1R23 A;  3CMY A;  5HDN A;  1Z77 A;  3W6K B;  3OR1 C;  1SFX A;  3GZN B;  5K7F A;  4IEJ A;  4HW0 A;  2HYG D;  1G3W A;  2I5U A;  2XV4 S;  3HKZ N;  2RQP A;  3KLO A;  2LDU A;  5GTI C;  3MVP A;  3N97 A;  4RMN A;  4HNV A;  3CDL A;  3L7W A;  1T08 B;  4AM3 A;  3SFZ A;  3GUD A;  1Z3X A;  4XON A;  1USS A;  5LEK A;  1YS7 A;  2R7R A;  5KAF C;  4ASN A;  5HNH A;  1MMA A;  2XC7 A;  3OIQ A;  3D5R C;  5FD5 A;  3BTC A;  4HV5 A;  3DTE A;  5BMZ A;  3HB9 A;  1I1G A;  2ZME B;  3DKY A;  4UB8 C;  2E5Z A;  2EBI A;  1AU7 A;  1RKW A;  6PAX A;  1K83 J;  4M3B A;  2FU4 A;  2ZKZ A;  2GOX B;  1MD0 A;  1R1V A;  2EIK H;  3E7L A;  3CUQ B;  3TQN A;  3JAM Z;  2F6C A;  2PMZ A;  2IA0 A;  4CIC A;  1GVD A;  2OTJ I;  1I39 A;  3FIS A;  4ON0 A;  3GTK J;  1WJA A;  3MMY B;  1RPW A;  3VPR A;  2IGN A;  2DMT A;  1WSU A;  4KT5 C;  2E60 A;  4HRI A;  1IN8 A;  4UVB A;  2F5C A;  3K4C A;  2MW8 A;  4NUB A;  3IH2 A;  1T98 A;  4LB6 B;  3R60 A;  4HZF A;  2VBW A;  3FKJ A;  4DZJ A;  2FUG 2;  1XMA A;  2ISY A;  5D4R A;  2DBB A;  3DQV C;  1MBJ A;  3OSF A;  2L54 A;  1Z6T A;  3S3N A;  1T2K A;  1P7I A;  3CCU I;  2QEX I;  1AKH B;  2NXN B;  3RI4 A;  2CYY A;  3KIO A;  3T8R A;  3AL0 C;  1DGW Y;  1MSE C;  2ZBK A;  2Y30 A;  3R0J A;  3K1P A;  3FWE A;  2Q2E A;  3HOX J;  3F8F A;  4ZDL A;  2R93 J;  4D5C A;  4A3B J;  1YIO A;  2W85 A;  4PJN A;  2HVR A;  3WTV C;  3TP0 A;  4IL6 C;  2I8D A;  1UFM A;  3OOU A;  1SC7 A;  2OC6 A;  4PCQ A;  5J1R A;  4F3Q A;  2ZCW A;  3FX3 A;  2FNP A;  4OMY A;  3AG1 H;  2D1H A;  2DA3 A;  2VJ5 A;  2MGQ A;  3SJM A;  4QIW N;  4H0E A;  4Y15 A;  2QSG X;  4Q5S F;  1RI7 A;  2E2H J;  1ZAO A;  3ZMZ A;  3M1C A;  3ASO H;  3KP5 A;  3D1N I;  4E7K A;  2IVM A;  3F8N A;  5EG0 A;  3CCM I;  1XSD A;  3GTM J;  3CO7 C;  3BWG A;  1J75 A;  1LE8 B;  5ILU A;  2GXA A;  1HST A;  2HKO A;  1Y56 A;  5DM6 F;  4DZP A;  3KYC B;  2Q1Z B;  4HQE A;  4D0P A;  3ZMU A;  2IGK A;  5E8G A;  4HG2 A;  2WBM A;  1BL0 A;  2DA2 A;  4QTR A;  3HOV J;  5J8C A;  2PLY A;  5HS7 A;  5KVR A;  4W97 A;  4L9V A;  2HPM A;  1G4D A;  2KJB A;  2VQL A;  1BC7 C;  2HS5 A;  1Z91 A;  2L5Q A;  3GME A;  5FJ8 J;  2ELJ A;  5DTD A;  5E18 F;  2E1M C;  1G59 A;  4C3J J;  2M1B A;  2C6Y A;  3DTI A;  5JHU A;  1GDT A;  3K4B A;  5KK1 A;  3ZMD A;  3EUH C;  1KQ0 A;  3RZD J;  4CSW A;  4BH9 A;  2MLK A;  1V5F A;  3PFY A;  3JRD A;  3WHC A;  5AIQ A;  1ZH5 A;  2O6G E;  4UY8 I;  2XRL A;  2L7F P;  5DCM B;  3O8G A;  1SD6 A;  2YU9 J;  5LLQ A;  3S2D J;  1JTX A;  3CCR I;  4CYC A;  3M8E A;  3OYJ A;  1R58 A;  4GYI A;  3BG3 A;  3KYD B;  2MSY A;  3ZN1 A;  1XC5 A;  2OU2 A;  5K7Z A;  4XLP F;  4GDF A;  1MND A;  2OZU A;  3JSP A;  4LIT A;  1X3U A;  4BDY A;  1I27 A;  4IOC F;  3F21 A;  3F23 A;  1PDN C;  3WHB A;  5IYC J;  1TZL A;  5GAH J;  2QEN A;  3WOD F;  1T56 A;  2O03 A;  4HAM A;  1TTY A;  2M45 A;  3F6O A;  1TQP A;  3W2W A;  4C9Y A;  1O3T A;  2Z9O A;  3H5R A;  3QU6 A;  1DP7 P;  1DU0 A;  4V19 K;  1ZG1 A;  3F9K A;  1B6A A;  4HYE A;  1ZRC A;  4DYR A;  1WJE A;  3OYL A;  4IKF A;  4EJW A;  1D1A A;  4ABZ A;  5JVG F;  1QPM A;  3MCZ A;  1U78 A;  1A36 A;  3RZO J;  5CVJ A;  5A2Q Z;  2W48 A;  3CF5 F;  1PP8 F;  1JHH A;  2XF7 A;  4HLX A;  2H1L A;  3RJP A;  4X0G A;  1TT0 A;  1HW5 A;  2HYJ A;  3FM5 A;  5D6E A;  2CQK A;  4NHJ A;  2E1M B;  1BI3 A;  1I6X A;  1MBF A;  3DBH B;  5F0H A;  1IRZ A;  4FTH A;  1FP2 A;  2VQG A;  2VBZ A;  1XN7 A;  4IRH A;  1APL C;  4S05 A;  4A2U A;  1DDN A;  2BYV E;  2P7V B;  2W57 A;  4E7L A;  3S1M J;  1G3S A;  3IAS 2;  2L4A A;  4ENK A;  1ZN2 A;  3P9C A;  4CH7 A;  4PJ0 C;  2K9M A;  4CA0 A;  1MIJ A;  3H3U A;  1MNM C;  2RV8 A;  2W00 A;  4Z2Y A;  2HEO A;  4UUV A;  1Y1V J;  2KDO A;  3KCC A;  2DAO A;  2CU7 A;  2BOL A;  3BY6 A;  1V3F A;  1PUF A;  3BT9 A;  3F0C A;  1R5G A;  2X4H A;  2OAZ A;  3GTL J;  1YW8 A;  1O7F A;  3KP3 A;  5DD8 A;  4IOA F;  1QVU A;  1QU3 A;  1RET A;  3E0J B;  3GTO J;  3N05 A;  1QNT A;  4MIM A;  3TO9 A;  3JAM K;  1VQP I;  1C0W A;  1JT6 A;  4OAZ A;  5HDK A;  2DFI A;  2BHY A;  5K5Q A;  3BLY A;  1A5J A;  2OBP A;  3S8P A;  2ADU A;  1K4S A;  1JHF A;  3DLA A;  5CPR B;  4EM0 B;  2EK5 A;  5F27 A;  4A5N A;  1BR2 A;  4Y13 A;  2IRF G;  3G1O A;  1LUJ B;  2DDB A;  1TWA J;  4DGW B;  3Q9S A;  2LBF A;  4BDZ A;  2EWN A;  1LEB A;  3GZ5 A;  2K3F A;  1W0U A;  1VF9 A;  2V6E A;  2I10 A;  2PG4 A;  3FXO A;  2CQX A;  3L2W A;  4BNC A;  3UNG C;  1WVR A;  4KIC A;  2E1N A;  2YR2 A;  2PI0 A;  4WXC A;  4IHT A;  3CJT B;  3ML6 A;  4BU2 A;  3ZQI A;  1JTY A;  3TDU C;  2V26 A;  4XLC A;  2YX7 A;  2ECB A;  3E6C C;  3BQZ A;  2Y0M A;  3W6V A;  4OWR B;  1D0Z A;  4UB6 C;  4XR6 A;  2LTP A;  3L00 A;  1Y6I A;  1VFC A;  4MTE A;  3LWF A;  3WE3 A;  5M3M J;  2EJR A;  1SEU A;  2E5N A;  2R7Q A;  2RN7 A;  3ABT A;  3RQ4 A;  1Y1W J;  4C2T A;  5H6Q A;  4I01 A;  4DIQ A;  3FMS A;  3KE2 A;  3LAJ A;  1O3S A;  4LG3 A;  4XIC A;  1VQO I;  1B8I A;  3X2Q H;  2A68 F;  4LG0 A;  3Q0W A;  5FLM J;  4ZYD A;  2QQA A;  2KIF A;  5CKT A;  3JR9 A;  2HXI A;  2LOO A;  5D6F A;  1XGM A;  3DPU A;  1XTA A;  3FM3 A;  4CHU A;  2DMU A;  4EGY A;  2AXL A;  3HRU A;  5F04 A;  5IPA A;  1HA8 A;  1OR7 A;  2JSP A;  2Z5U A;  4MFD A;  1MMS A;  2DT5 A;  2W84 A;  2AS5 F;  2WV0 A;  2LKP A;  3Q0U A;  5BPD A;  2P6T A;  3E5Q A;  3ERE D;  1ZG5 A;  1V5G A;  3RPQ A;  3JW4 A;  4A3G J;  4BQN A;  5DDG A;  4FT8 A;  4KMU X;  3ABM H;  5J6X A;  1RR7 A;  1MJ9 A;  2L0K A;  3GW2 A;  3VFZ A;  4OAY A;  1K78 A;  2LRE A;  3P9K A;  3S15 J;  4JQF A;  4PK4 A;  3VSK A;  2BEO A;  2A6E F;  2GIV A;  1VQ6 I;  2MLG A;  1MW7 A;  4BEH B;  2CJJ A;  4EJV A;  4OMZ A;  3MWM A;  3M4O J;  1H8A C;  3MAJ A;  3PUB A;  2BE5 F;  1JI8 A;  2O0Y A;  4EJT A;  3NQO A;  3AFH A;  5D5U B;  1X3Z B;  2BW3 B;  2ZO4 A;  2D5V A;  1FJL A;  4AYB N;  2EZI A;  1Y8Q B;  1NG7 A;  2W1O A;  5LGN A;  3C2H A;  3V7S A;  5GTH C;  4A3M J;  2FOK A;  3H92 A;  2PJR B;  2FBK A;  2FQ4 A;  4XMY A;  1FMV A;  5HS9 A;  4RAZ A;  2KDZ A;  1MDM B;  1TBX A;  5K5O A;  1QZZ A;  3QYB A;  2H8R A;  2Q0O A;  3FDY A;  1IJW C;  1BJZ A;  2CUF A;  5FD6 A;  3DXJ F;  4RLQ A;  1S7O A;  2LK2 A;  4I7H A;  1F5T A;  3G73 A;  1FC3 A;  1UG2 A;  1OPC A;  5FKN A;  1GXP A;  2E19 A;  2FNA A;  2HPI A;  2O9L A;  5J40 A;  1ETX A;  3QU3 A;  3E6D A;  1XX5 A;  1QHG A;  1IRF A;  2VT3 A;  2Z99 A;  4DYQ A;  4QLC U;  3QPH A;  2ZSI B;  2EA4 A;  3ZQC A;  1U6G A;  4CGZ A;  4N9H A;  2PEX A;  4Q48 A;  1XMK A;  1X4P A;  2XHK A;  4HSR A;  2QBY A;  3FMQ A;  2F5V A;  3QOP A;  3K2A A;  4NQW A;  2VPL A;  3CCV I;  2V1D A;  3CUQ A;  1WH7 A;  3RKW A;  3CDH A;  3A0H C;  4F93 B;  2XUB A;  4EMS A;  3E5X A;  3FXU A;  2JA2 A;  2WAQ A;  3PL8 A;  4AD9 A;  4F55 A;  2O8K A;  4B4C A;  3KX2 A;  3KEO A;  4HNT A;  1VQL I;  5K1Y A;  2W25 A;  4BY1 J;  3BR6 A;  2M3A A;  2DFH A;  1T0F A;  3LQR A;  3QAH A;  1WPK A;  2LF8 A;  3DEW A;  3H9G A;  4J00 A;  4HF1 A;  4UVA A;  2NVT J;  2FEZ A;  2XRN A;  2VC0 A;  3HTS B;  3VDX A;  1MGT A;  3H3Z A;  1UG0 A;  2IP2 A;  1WZ2 A;  1SD4 A;  4BS9 A;  4BUP A;  2QKM B;  3ZOB A;  2HDC A;  5D5V B;  1XCV A;  2WAE A;  4U7D A;  1OCP A;  1WGX A;  1QBJ A;  1ZLK A;  1KU3 A;  4FAS D;  2XF5 A;  4KUM A;  3TGN A;  1FOY A;  1JT0 A;  1Y0N A;  3DPL C;  1T38 A;  2ESN A;  5E8I A;  1ONV A;  3PIP F;  3NWT A;  3WTY C;  2CMP A;  5M3F J;  3BCA A;  3A0B C;  2EA2 A;  2NS7 A;  5EZG A;  3MKL A;  3BC8 A;  4LOC A;  5EJC A;  5DUI A;  5IP6 A;  3V42 A;  3SZP A;  2K27 A;  1Z3Y A;  2M5W A;  1XSX A;  2HZD A;  3LSJ A;  3OR2 C;  3SHF A;  2DMQ A;  3TW7 A;  4F91 B;  3F22 A;  1X19 A;  1W7P A;  4CCN A;  1K6O A;  3LSG A;  4A12 A;  4BHP A;  1B72 A;  2LKX A;  1E0E A;  1ZK8 A;  2YX4 A;  3AG3 H;  1XB4 A;  2DOD A;  4M73 A;  1NK3 P;  3K4M A;  4CUG A;  2DT7 B;  4A3D J;  1SMY F;  2CO5 A;  4U0Y A;  2XPW A;  2GXG A;  3KZZ A;  2H6B A;  2K7L A;  2FJ1 A;  1DPU A;  1I5Z A;  4Q4Z F;  2JVH A;  5HLI A;  3Q9V A;  1OR7 C;  4JOM A;  4E7I A;  4G9Y A;  5IP7 J;  3A01 A;  2QCO A;  2CV2 A;  1MKM A;  4YIR X;  1IF1 A;  4IQJ A;  1IAW A;  2CQ7 A;  1HKQ A;  1UEL B;  3HHH A;  4XRS G;  5E1W A;  1Y0U A;  1F1Z A;  2JQ7 A;  5JLW A;  3BCB A;  1X1C A;  2A61 A;  2DA7 A;  3IKT A;  5AIP A;  2NVY J;  4YRV A;  2IA2 A;  4ZDO A;  3SXY A;  3ZMV A;  2H09 A;  3J7Y J;  1HF0 A;  4XL9 A;  4PJM A;  3TDZ C;  4CCK A;  4BGD A;  2KIU A;  2IBD A;  1FP1 D;  3IWZ A;  3CJR B;  1ZG3 A;  2FF4 A;  1LEA A;  2L3D A;  5LBQ A;  5ICF A;  2STT A;  1R4M B;  3ECO A;  3VYU B;  1R49 A;  1BI0 A;  3CF2 A;  3HXL A;  3J81 Z;  2WY7 Q;  3QPT A;  1ZRE A;  4IHV A;  2MC3 A;  3MD2 A;  2DA5 A;  1S6L A;  4KIF A;  2VQC A;  3VWB A;  4BQO A;  3I53 A;  4P5O A;  2KZV A;  4ANJ A;  2PMU A;  4D5F A;  2M8G X;  1OMI A;  5D4S A;  4MQV A;  5LGU A;  2R92 J;  4N4N B;  1IRG A;  4M3G A;  2OZ6 A;  4L0Y B;  2DJN A;  3HUG B;  2M9H A;  2DCE A;  1WCM J;  3E3V A;  2DO7 A;  4ZZL A;  1X2M A;  4H4K C;  3HOZ J;  2IGO A;  2RVC A;  4IO9 F;  1UB9 A;  2R5Y A;  5IYB J;  1Z05 A;  3VYT B;  3BG6 A;  3FIW A;  2CW7 A;  3U9G A;  2Z33 A;  4ESJ A;  3W6J B;  3K10 A;  1BOB A;  3IUO A;  5LD2 C;  4NBQ A;  3HOT A;  4GO1 A;  1EH6 A;  1X1P A;  2KQR A;  2IT0 A;  2CH0 A;  2XF6 A;  3OMY A;  1QVT A;  4XBF A;  2JT1 A;  2DOF A;  4OOI A;  1G3Y A;  3PO3 J;  5EYR A;  3DV8 A;  5LGT A;  3AAF A;  1YX5 A;  3OL3 A;  2Y9Y A;  2VPR A; 
#chains in the Genus database with same CATH homology
 4IOA F;  1VQ4 I;  1VQP I;  1Y39 A;  1VQ8 I;  3CC4 I;  3CCS I;  3J7Z I;  1VQN I;  5DM7 F;  2H8W A;  3CCL I;  2ZJP F;  4UY8 I;  1YJW I;  2K3F A;  3CCR I;  2OTJ I;  1YJN I;  1QA6 A;  2FOW A;  3CC7 I;  3G71 I;  1YI2 I;  3CJT B;  1YIT I;  4IOC F;  1YHQ I;  2JQ7 A;  2E35 A;  3I55 I;  1YJ9 I;  5GAH J;  3J7Y J;  1HC8 A;  1YIJ I;  1VQ9 I;  2ZJQ F;  1VQM I;  3G4S I;  4V19 K;  1VQ5 I;  5JVG F;  3CD6 I;  1S72 I;  3CCU I;  2QEX I;  3CCV I;  3CCJ I;  2NXN B;  3CC2 I;  1VQO I;  3CF5 F;  5GAD J;  5GAE J;  1VQK I;  2E36 A;  3PIO F;  3CCE I;  1VQL I;  3DLL F;  3CCQ I;  3CME I;  1FOW A;  1MMS A;  3I56 I;  3G6E I;  2OTL I;  1VQ7 I;  4IO9 F;  2E34 A;  1FOX A;  1ACI A;  3CCM I;  2QA4 I;  1FOY A;  3CMA I;  5GAG J;  5DM6 F;  3PIP F;  1VQ6 I;  2ZJR F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...