3PIOF

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3pioF00
5GADJ 3CJTB 3PIOF 3CCLI 1VQMI 1VQ9I 1FOXA 1YJWI 1MMSA 1VQ7I 3CCVI 4IO9F 3CCJI 1VQKI 3PIPF 3CCEI 3I56I 2E34A 2FOWA 3CCMI 5DM7F 1YITI 5DM6F 1YJ9I 3CCSI 1YJNI 4IOAF 3J7YJ 1FOYA 1VQ6I 2H8WA 5JVGF 2E36A 1YIJI 1S72I 3G71I 3CD6I 1VQ8I 3CC7I 2E35A 2QEXI 1VQLI 2ZJRF 1FOWA 3CC4I 4UY8I 1VQ4I 1HC8A 1Y39A 2QA4I 1ACIA 3CCRI 2K3FA 2ZJPF 3CF5F 3CMEI 1VQ5I 3J7ZI 3CCUI 2OTLI 3CC2I 4IOCF 5GAHJ 4V19K 1VQOI 5GAGJ 3CMAI 3DLLF 3G4SI 2JQ7A 1VQNI 2OTJI 3CCQI 3G6EI 3I55I 1YHQI 1QA6A 1VQPI 2ZJQF 2NXNB 5GAEJ 1YI2I
chains in the Genus database with same CATH superfamily
2L0KA 1ETOA 5JI6A 2XKOA 2QENA 2DA2A 1S7AA 2DYSH 4C3JJ 2IVMA 2QBYA 1OYIA 2ZFWA 3FXMA 3U1DA 1PUFA 4PGGA 2WADA 4EM0B 3CJRB 2V7FA 1AU7A 1X2NA 1B4AA 4PJJA 1MGTA 4CYCB 4AU7A 2R7WA 3FXQA 2YX7A 3HSEA 3A01B 4WF2A 2F4MB 1QRYA 1BR1A 3RYPA 4Y17A 2LVSA 2EK5A 1ZGAA 4IX7A 2I8DA 2FBHA 5AIPA 4ESFA 4ANJA 2ESNA 5F1JA 3HOSA 3RIRA 4ESJA 1NHAA 4G94A 1YW9A 2PN6A 1MBFA 2W7NA 4ZTFA 2BGCA 2DMPA 5F08A 3MZ8A 2Y69H 3IL2A 3GUDA 2ETHA 5DV5A 3TO7A 2A61A 3H5RA 3JREA 1XSVA 2UXNA 3HOXJ 4M74A 2HQRA 4XKWA 2ESHA 1GUUA 4AIKA 1E2XA 5HVQC 1P92A 2VQHA 3H1CA 1HXDA 5L3CA 1FPQA 2XGDA 1FC3A 1S5LC 2O0YA 1A04A 3K69A 4LLLA 4B09A 3ZP5A 1F9NA 2K4BA 2GA1A 3HPGA 1SANA 3PO3J 4N4OB 4LG0B 3O3KA 1HBXG 3L7WA 2Z1DA 2ZMEB 1PYVA 1JTXA 2BY2A 1FMVA 4HSTA 1BW5A 1W5CC 3TDUC 4BHBA 2R7VA 1ON2A 2OCCH 4WK8F 2DCEA 2O8XA 1EH8A 4KJZA 1TBXA 1JGSA 1P6RA 2E1MC 4HX8A 4PFOA 2M7AA 2W25A 1FP2A 4GGGA 5EDNA 2BY3A 1LDDA 2KMUA 2FNAA 2VL8A 4EQQA 1MIJA 4HAMA 3HTSB 3EUHC 3DU5A 5B5EC 2HPMA 2KKOA 3E0JB 1OYWA 4Y7NJ 2QA4I 2LBFB 3MVPA 2KHMA 3O2PE 3RZDJ 1OCZH 1D0ZA 1B6AA 3JRGA 1IDYA 2M8GX 2MH2A 2PJPA 2DA5A 3I64A 3ABTA 3FXRA 1I50J 5LFAA 3HOTA 3CCVI 4B3AA 3OL4A 5IOYA 2MLGA 1WKMA 1BOAA 2EV6A 3A4CA 3OYMA 1FYKA 3LMMA 1X3UA 2G0EA 3GLXA 2MGQA 2ZJPF 1LPQA 1JI8A 2QCOA 4XQFA 3JTHA 1GLNA 1ETKA 3BTCA 3ECOA 3DCFA 3JSOA 1YW8A 1YHQI 3V7RA 4BE0A 4PUSA 3VPRA 3GMEA 3V8KA 2XAHA 2ADUA 1UHSA 1UZCA 4F3QA 2NS7A 2VONA 3VSLA 2OAZA 4E70A 3LSGA 1KQ0A 1FP1D 2RKHA 1KGSA 1ZARA 3GO5A 4Q4ZF 4ZYHA 4UNOA 2HYJA 4CYCA 1WVRA 3MZYA 5FKLA 2EA4A 2OA4A 3HTUA 1SMTA 1KYWA 2VJIA 4F92B 4HOBA 3CUQC 5E3MA 3JTGA 1GT0C 4NQWB 2DQRA 3M9AA 2EZKA 4MHGA 2OCEA 1TWGJ 5CVRA 3DLLF 1FBSA 3LAJA 1JHHA 3CCYA 3GTPJ 2CUEA 2BW3A 3EUHA 5ICGA 5IYDJ 1DPRA 3ASOH 4I99C 3ZRGA 1MSFC 5F6FA 4XICA 2KIQA 4NNJA 2VKHA 4ZH4F 2E7WA 5D6EA 5BOXA 2AS5F 1FZPB 4L5IA 4RAGA 4XKVA 1TWAJ 4A69C 4C30A 2P5LC 3N05A 2CQ7A 1FNNA 4XORA 4C3IJ 1Y56A 2CUJA 2DFIA 3F9KA 4PDKA 1PJRA 4UXNA 4BS9A 3GFIA 4OIOF 1B9NA 4F52A 4ENKA 1JHFA 2DFEA 3QWLA 4PK4A 1MMNA 1CF7B 2HDCA 1MKMA 3HXLA 5GTHC 1Z67A 3BTIA 3LOCA 4HEA2 4BEHB 2DMNA 2FXAA 2MG4A 1BJAA 2FA5A 3HL2A 4Y15A 1IUFA 1QZYA 4M71A 2WB1A 1KU7A 4F7ZA 1KQ8A 5J4YA 5DUKA 2HYGD 5E1ZB 3PM1A 4OIPF 1FIAA 2D45A 2RNJA 1MD0A 2Q2EA 2X51A 2DPUA 4BJ6C 1U5TC 3BTLA 3IH4A 4HZFA 1MNEA 2MSYA 4RGUA 4M6VA 4L9VA 2R5ZB 2PEXA 2VC1A 3IHUA 3LSIA 2D5VA 2KPMA 2VBWA 2VBXA 2IT0A 2QSHX 5DM6F 2XPUA 1KA8A 4BE1A 2DFHA 2RVCA 2NS8A 1JKOC 3GTLJ 4M3GA 3K70D 3OYLA 1RR7A 4DW6A 3CDIA 3PSFA 1XCVA 4DZJA 3WE3A 1BBYA 2XPWA 3ZXSA 4P5OA 1BC8C 5GAHJ 3S15J 1R1UA 1Q1VA 3DU6A 1RI7A 3LL7A 4BXFA 3JRHA 2E1MB 2EQRA 1K61A 1ZQ3P 1U2WA 1SEUA 2RQQA 1QVTA 3L2WA 2GLOA 4W97A 4LIVA 4IVNA 1IO2A 5ERIA 1ULYA 1QHGA 4RGXA 3GX4X 1D0YA 2NVXJ 1LKXA 4KIFA 2JWTA 2O3FA 2W84A 3G1MA 3K0LA 3TO9A 3PQJA 2VOOA 3QP6A 3FWEA 3LSJA 5JHFA 2QKLB 2Q0OA 2YX4A 5L3BA 4YIRX 2HOEA 5D5UB 1XSDA 1FSHA 2XRLA 4IEJA 4V19K 2VIXA 4PJLA 3S3MA 2X48A 2ZXIA 4MQVA 4GXOA 3D5RC 3IP4B 3ZQLA 4HQMA 5JLXA 1G8XA 2JSCA 4AIJA 2LSOA 2IP2A 1ZR2A 4LLNA 3QPSA 3FM3A 3PFIA 2VASA 1XX5A 2VPRA 2WY7Q 1HDDC 4IF4A 2L9SA 5HLGA 2PG4A 1G3SA 4RDUA 2TDXA 1IRFA 5JVTA 1ONVA 1MBHA 1T6SA 2FX0A 5LGNA 2DDBA 5JHUA 1T2KA 3TW7A 3UR3C 4KN7X 3OYDA 4BKXA 1XMKA 5HLHA 5DUIA 4IOCF 3S14J 1FJLA 1DDNA 1UFMA 2OZ6A 2JJ7A 1YO5C 3OOPA 5BPDA 4W1UA 1RUNA 4WWCA 3BROA 2QKMB 3LA7A 5FLXK 1AKHA 4L9TA 3M1EA 2F5CA 3DV8A 3VEPA 1SFUA 2ZKZA 1U8BA 2FBIA 1LDJA 3HOYJ 3F72A 2Y9YA 2E36A 3PL8A 4LG0A 1UMQA 1T08B 2Z5UA 5B3SH 1ZG1A 2ZNZA 2YSRA 3RPUA 4LB5A 4E7JA 3IUOA 5IPAA 3WTTC 3FXLA 1LEAA 3QU3A 2CU7A 2UZKA 5LEKA 3K4LA 3BDDA 3SZGA 1SD5A 2GOXB 3GLLA 4P9FA 2L9NA 4KDPA 1MBGA 3RYRA 3AFHA 3EPZA 3OMYA 1JJ6C 1W4MA 4Z2YA 3AG2H 4PJ0C 3H3ZA 1R4NB 4BY1J 2CQQA 2IEKA 2LK2A 4KT5C 4U7BA 3QPLA 3MFKA 3HSRA 4MGRA 1HKSA 3HKZN 1RIOH 3KETA 3J7AO 2X1EA 1V4RA 5JR3A 1OCOH 4M3BA 5DCFA 2P7CB 2R92J 2E2HJ 4A3DJ 3FZVA 2H8RA 2DK5A 5EEAA 4XNFA 4I0AA 2ECCA 2HPIA 3EYIA 2XRNA 3K9TA 1K78B 3TOBA 2FOKA 3FKIJ 2HVRA 3RPQA 2HWVA 2GBYA 4HBLA 3HOWJ 5JFRA 3LA3A 4XN0A 2Y75A 2KT0A 3ONQA 5DDGA 3WG9A 5KCMA 1C0WA 1FX7A 1YFHA 4B43A 5IYBJ 4IL6C 1HLVA 3F6VA 2PMZA 2V1UA 2IS1A 1QHHD 3GXOA 5EG0B 2STWA 1U5TB 1USSA 5D6FA 5EYRA 4GDFA 3BG7A 3BJ6A 2KL4A 4Q47A 2E1OA 2L7ZA 2IRFG 1ZHFA 5E8GA 3BR1A 2WBMA 1JUMA 1YJWI 2DMTA 1FYLA 4ENMA 4DZPA 5EF6A 3CJNA 4BAYA 1OQYA 2HXOA 4BEHA 4HYEA 3J7YJ 2H8WA 2JUCA 1IRGA 4BUPA 5CVUA 1ZTRA 2F2EA 2W48A 3KYCB 2DODA 5K7HA 3GFMA 5E8IA 4IHYA 3KEYA 1XN7A 2M0MA 5IP9J 3HUGA 1S7EA 1G3TA 1R1TA 3BQZA 1WJBA 1F5TA 2ID6A 3I71A 3H0GJ 1K83J 1QGPA 3UKGA 3OL3A 2W00A 3PJRA 3ZMVA 4FE4A 4IXAA 1UCRA 4M9SA 5LBQA 3CCEI 3BZ6A 2VXDA 4ZC3A 3T1BA 3ZOBA 1SFEA 1ZRDA 3FK6A 2CW7A 4YELA 2AXTC 4QLCU 1W7PA 4DQ2A 4GYIA 5H20A 2OJED 3L2CA 1ZLJA 3KE2A 2ME0A 1X4PA 2R5ZA 1F36A 1HA8A 3CLOA 2MFZA 4A6DA 1B72B 1R5HA 3VYSB 2WAQA 1MH4A 2R7FA 3KZZA 4HRIA 4IHVA 3K10A 1MNMC 5LRSA 2IAIA 2EPFA 4AC0A 2HR3A 5LHHA 2EFQA 1YJ9I 3REOA 1ENHA 1QZZA 2AXLA 3CC7I 1XMAA 2W82A 1R6RA 3AL0C 2E1NA 2L4AA 1H9GA 3ABUA 4ZDOA 2WV1A 3J80Z 3CC2I 1JTYA 1HKQA 1LFPA 2ID3A 5EG0A 2NXNB 3B02A 3Q9SA 4KUMA 1GXPA 1VQ9I 1HW2A 1IV8A 1V5EA 4UV9A 3I4NJ 2PQ8A 3GTMJ 3F8CA 1XSXA 2DA4A 1X1BA 4RMNA 3BR0A 3Q3SA 2GXGA 1QZEA 3HEFA 2X6YA 2ME6A 2R7TA 2VE8A 5LLQA 3S3NA 3E1SA 3SFZA 3TO6A 2O5RA 4G6QA 4MO7A 2M3AA 2EV0A 3DKXA 3CUQB 2GIVA 2EIJH 4M72A 2K02A 3DTEA 1A6IA 1Y1WJ 1Z0XA 3RKXA 4CZZA 4CICA 3ECHA 1SFKA 2A6HF 3ULQB 5L3FA 3PSIA 5E20A 2CV0A 3IC7A 2EILH 1YITI 2HI3A 1UB9A 4KYWA 3LAPA 2V9VA 3K4BA 3ABLH 4MTDA 5FO5A 2CS3A 1K78A 4AIHA 2IGOA 5BPIA 4N9IA 2DA7A 1BR4A 2YPRA 1ZN2A 3Q0VA 5FKNA 1ETXA 5E1WA 3E6DA 1ZRCA 2BXZA 1ON1A 3FBIB 3F8MA 2MW8A 4DBRA 3FKJA 2HS5A 2LREA 3BG9A 4P9UA 1W5SA 4OOIA 3MN2A 3LSHA 4A0YA 1TWCJ 2L01A 2V26A 3N97A 2VC0A 4OINF 5F0CA 5FD6A 3S3OA 1Z6RA 1E3PA 5J4VA 4HF1A 1R9TJ 3CP2A 3LSMA 4IJAA 2ZFUA 3UNGC 1Y1VJ 5J8FA 3SXYA 4IHSA 1BIBA 4YIFA 3HRSA 2V6CA 3HRTA 1JUSA 2G9WA 3KIOA 4WXCA 2EZLA 1S29A 1R23A 1IAWA 2P5VA 2WB1N 2PMZN 5JLWA 5ED4A 5D4RA 2M5WA 2CYYA 1TNTA 2HVQA 3CJTB 3DTIA 2ZO4A 2XHKA 5C4XJ 1KU3A 3KP7A 3W3CA 3N4MA 1MDMA 2Y0SA 3HRMA 4XKBA 3COAC 1Y8RB 3OIOA 2JA6J 3RKQA 2ZMEA 2EFPA 4RLQA 2K9NA 4QPOA 5CVJA 4ZDLA 3CUOA 4D7NA 2C6YA 1IRZA 2COMA 3DFGA 2FMLA 4EV0A 1MMDA 4EM2A 3V4GA 3HDDA 1KU2A 3MD2A 4CXFA 4HV6A 3MKYB 1W0UA 2UWMA 1RZ4A 1Y0NA 1YYVA 2W4SA 1IW7F 3VODA 5E17F 1KZHA 1U0JA 3Q9VA 1IXSB 4NB5A 4I2OA 4GO1A 1WGXA 2K85A 1X2MA 1Y8QB 1YIJI 2Z99A 3L2VA 5LRRA 1XGSA 2QQBA 1RC9A 3DPLC 1OR7C 2G7UA 4X0GA 1Y39A 3GTKJ 2WV0A 5ILSA 3NARA 1O3QA 2Z16A 4P55A 3QYBA 1LJ9A 2P0WA 3JAMZ 2VODA 2V1DA 5AIQA 2KRCA 5HDGA 2ZC2A 3RZOJ 3ZQHA 2VPLA 4YEJA 3WTXC 1ETYA 2X6XA 1D3YA 4KA4A 5HODA 1FOXA 2DN0A 4L9NA 5HNHA 3P7NA 5KNLA 4IO9F 1Z05A 5F0HA 1H8AC 2GIZA 3CCMI 5KAFC 3U1KA 3CCSI 3S2HJ 2QQ8A 1SVMA 4FETA 3SFIA 2A07F 4RB1A 3W2AA 3GZ5A 3BJOA 3WGHA 1SD4A 3R0JA 3SDGA 1S6LA 4DIQA 1WI3A 1MJ9A 4LB6B 1O57A 5B1BH 2FU4A 1WPKA 2FMYA 3HC7A 2X0LA 4KT6A 4LMYA 4XR6A 2M4GA 3G2BA 1HC8A 3VOEA 2MBFA 1D5VA 4BHPA 2HEOA 1WRJA 1IDZA 1MMSA 1T38A 1PDNC 3PIPF 1J7KA 4S05A 2IGNA 3R61A 3OR1C 1V3FA 2M2EA 2A6EF 2DMQA 3KP5A 4LG3A 2LH9A 5F0FA 2DA3A 2ZJRF 4R1HA 4DYRA 4Y33A 1NG6A 2CRGA 3S32A 2NS0A 2EIKH 3BR6A 1M1EB 3KEOA 3VDXA 5M5XJ 5IT9Z 3FK7A 4HDVA 2DI3A 2XASA 2XUBA 3C2GA 4JP0A 2Y2ZA 4LK0F 2R5YB 2KLOA 1VQPI 5EGOA 5TISC 2AO9A 2DMUA 3FXUA 2HZTA 1NTCA 3C18A 1Y0UA 3JR9A 4BNCA 2KJCA 2DA6A 1Z6TA 3LSKA 2L54A 2GQQA 3K70C 3SZTA 3K7AJ 1JKRC 2CV1A 4CH7A 3CF2A 3H9GA 1CF7A 1XPXA 4ZYDA 4PCQA 1Z1DA 3J81K 3LSTA 4U0YA 1POGA 1B72A 3KP3A 1NH3A 3J7ZI 1VI0A 3ZMTA 4UUVA 1GVDA 2J5PA 1U3EM 3ZQ7A 2F5VA 4AUXA 2L5QA 5BS6A 1E3HA 3ZGKA 1S8NA 2F4IA 2P4WA 1FT9A 1DP7P 1YX5A 4XRFA 2XC7A 4B47A 5CQGA 2L7MP 2IS4A 2WAEA 3NWSA 2R7ZJ 2R3SA 5EEHA 4Z6YA 3O8HA 1QVUA 3CDHA 4H0EA 2XROA 4XIDA 4OMZA 1ZG3A 4HV5A 3TMOA 1D1CA 1F4KA 3BCAA 1UHWA 4C3HJ 3EETA 2VJ4A 2KIFA 4FT8A 3U2RA 5K1YA 2H6BA 3FMSA 2CUZA 4PJNA 5A2QZ 3BLYA 2D1VA 1T0FC 4XK4A 2WAQN 2F5FA 4BY7J 2H1LA 5B66C 2V79A 4XONA 2DLLA 3CZ6A 5GPCA 1T56A 4KITB 1H88C 5DTDA 3IH3A 1HCRA 3CO7C 2XGXA 3K4NA 2HFHA 3MZHA 1R5ID 1DPUA 2PJRA 3CESA 2LKPA 4AYBA 2ZXJA 4V2FA 1IRXA 1XDUA 2JRMA 2JVGA 4FX0A 4Q48A 2L4MA 1TWHJ 2YU9J 5L3DA 1RESA 1QO0D 2CQKA 3FXOA 3TGNA 1P4WA 2RDPA 2EV5A 2H94A 3HHGA 4L5JA 4EGZA 2EWNA 4XL9A 2VXZA 2HDWA 4HNVA 2FRHA 4ZDPA 3H9QA 2OZUA 3LA2A 3CD6I 3S1NJ 2IA1A 4GFBA 5FRNA 4MFEA 4BXXJ 5C3EJ 2MABA 1YQAA 4LGWA 4A5MA 1R36A 1IC8A 3BOQA 2NOJB 3DKWA 1MDMB 1ZG5A 2R93J 4UVBA 3L2RA 1ZLKA 3FDYA 4PSWA 3R6SA 1YTYA 2ISZA 3I55I 2XF7A 3H36A 1X1PA 4B48A 2JUGA 1VZ0A 3G73A 3BR3A 1T8IA 4NHJA 4X6AJ 5GPAA 4A3MJ 2JVHA 2E5ZA 2PX9A 2COBA 2XV4S 5ILUA 3I59B 3K4KA 1FBUA 2OC6A 3V8JA 4J01A 2EINH 2VBYA 1B8IB 2NRAC 1S72I 4LFUA 5F04A 1DGRM 2LOOA 4XMYA 2QSGX 3BZKA 1IN8A 5LHIA 3W2VA 1IG7A 2DT5A 2ZSHB 2JA8J 2LY2A 2CUFA 4EJWA 1VQOI 1TP4A 3S16J 1XGNA 4DNCA 1HDPA 1P4AA 2K9LA 2P6TA 2QWWA 2ZXHA 3AL0B 3K4CA 2LRDA 1I5ZA 3W6VA 2ZCWA 3QU6A 1FEXA 4BH9A 1BI3A 3L1PA 9ANTA 1WH5A 4KIBA 4M3DA 4U7DA 1K7AA 2KIUA 2DBBA 2E19A 1IZ1A 1ETQA 1BA5A 4BQQA 1AOYA 1WCMJ 3ZQIA 1VQNI 3H5AA 2E60A 3WODF 5J8CA 3VSKA 1BM9A 4PFPA 4UVAA 2KP6A 1MBEA 5K5OA 3IV5A 2IS6A 2G7HA 2KZVA 4XLAA 3IRRA 2CFOA 2P6SA 1RPWA 1ZREA 1LVKA 4EJVA 2CW8A 1F1ZA 2Y0MA 4NC6A 2A05A 2IA2A 3HUGB 3KP4A 1NK3P 3HM5A 2VKVA 2L9VA 3S1RJ 1R4MB 1SD7A 1ZKGA 3ZN0A 4CUGA 2JA2A 2CQXA 2CSOA 1A35A 1WI9A 2CJJA 5F64A 3E5UA 1QPIA 1D5YA 4ZYEA 3OIQA 3OYKA 1LNWA 2L9RA 5EJCA 5FFXA 4EJUA 4UUSA 4CDGA 3I59A 5J40A 1VQ8I 3DEEA 4D9JA 1ITYA 1YIOA 2DJIA 2KFDA 3D0SA 1STZA 1WJDA 4BU2A 4X1EA 1N75A 3SJMA 1FSEA 2AQFA 1WZ2A 2HOAA 3ZQCA 3HRUA 3DF8A 3JCUC 4LIUA 1BIAA 2RQPA 1V54H 3CO6C 4A5NA 3ML6A 1ZGWA 2QBYB 3OYJA 3HOVJ 2EH3A 3H35A 2Q8KA 2FD5A 4EATA 1LUJB 1W5TA 3OYIA 3HOZJ 1OJLA 4OIRF 2X9DA 1UELB 2CG4A 2J5OA 1ZGJA 4U88A 4AM3A 2FEZA 5LGUA 3A03A 5CVIA 4JBAA 4OAYA 3MKWB 2R0QC 3OYGA 2X1CA 3M1CA 1GHCA 5LD2C 3NAUA 5EZHA 2PI0A 1OCRH 3EQLF 3M7GA 1X4OA 3HKZA 4BE2A 3JRBA 2GXBA 4XLNF 1GDTA 3NEUA 1MSEC 1YOVB 3VFZA 4BYYA 4XSXF 2VLAA 1BN5A 5HS9A 4IHTA 4IOAF 1YG2A 4FTHA 1ZK8A 2ELHA 4CCOA 3ROUA 4B8XA 4C9YA 2HYFA 4C2TA 2F48A 3OYBA 4WXDA 4A12A 4A3KJ 2GOMA 3ZQQA 2Q1ZB 2ZMEC 3WGIA 4BBSJ 1QU3A 4LITA 3ELKA 1EV7A 4BQNA 1TL8A 1HSJA 1W0TA 3FXKA 3G1LA 4HX4A 5E3NA 3LFKA 4L18B 3GTJJ 3OR2C 3GYHX 2BBYA 3K6GA 4Q5SF 3E97A 2DK8A 1FYMA 2NVTJ 3LSRA 4R79A 4NBQA 4I02A 1MJAA 4F91B 2BHYA 2XPVA 3P9CA 1HSTA 4CYDA 4ETSA 2E2IJ 2HTSA 4CCNA 3LSPA 1KQ9A 4L9JA 4GYGA 1V5FA 2RN7A 4OAZA 1WFXA 5ICCA 4IRHA 1R7JA 2BE5F 1OR7A 2OBPA 2HTJA 3OS2A 3P9IA 4XRSA 1F43A 2DQLA 2CH0A 2MH9A 2WY8Q 3VWBA 3HOUJ 2NYXA 1IJWC 3SEQA 2DOEA 2ELJA 1HF0A 1X1DA 3ZCOA 2VT3A 1ZYRF 3GW2A 3CTAA 2EFWA 3HGGA 2KRHA 3D5SC 2KIMA 4GCVA 5JVGF 2K9SA 4FCYA 3HIFA 5DD8A 4ZYAA 4CO8A 1LEBA 1TNSA 5FGMA 4C2UA 5CPRB 2EFOA 3G1OA 4P96A 4UB6C 3B6CA 1J59A 4L5EA 3RCOA 1U6GA 1E0EA 1MJBA 2GXAA 4BL0B 2IW5A 3CDLA 3QODA 3HGYA 3F0CA 2X1DA 4RM2A 4B44A 1PP7U 1XCBA 5CLSA 4BGDA 1XTAA 1FBQA 4NUBA 4ITVA 3FHZA 3K4MA 1VTNC 2CFXA 2BXYA 1P7JA 2L7FP 3FHNA 4EJOA 3ZQGA 3DWLE 3GTQJ 1TQPA 2JA7J 1J0RA 3L2UA 2RREA 3TOAA 3WTYC 1Z9CA 2VQLA 2VB6A 4I76A 4M3FA 2VOPA 3CCUI 2BYVE 1TW3A 2MA3A 2CO5A 2UUZA 3Q0UA 3GFJA 3T8TA 3TP0A 5FJ8J 2JN6A 3I0TA 2M9HA 4D7MA 2JPBA 3DKYA 5EEGA 3AAFA 4IHXA 1WQ2A 3G71I 5H6QA 3CLQA 4N4NB 3F21A 4JYKA 1VQ4I 1Q1HA 2H09A 3FM5A 1QQIA 1I27A 2HDDA 3J80K 2O9LA 1VF9A 1WHUA 2DW4A 2Y31A 3AKZA 4RB3C 1HW1A 1MW7A 4IPAA 2DAOA 2LD5A 4KNYA 4II3A 2JPCA 5FFZA 4A3CJ 3CUQA 4P1WA 1RR8C 4JX4A 3CQZJ 1X3WB 1VQMI 4L0YB 2BW3B 2DT7B 4IRGA 2Q2EB 2XF5A 3U9GA 1LQ1A 4G7OF 2R7QA 2BVLA 2R7SA 1YW7A 3M07A 4KICA 1VQ6I 1HW5A 3V7SA 3OS0A 3JRIA 4OIQF 2Z33A 2JRTA 3QYFA 1RNLA 5D4SA 2QM3A 3F3XA 3T5XA 3JAMK 4ZTJA 4BQAA 4BJ5C 3OIPA 3ERED 2DFFA 2KDOA 2K3PA 3S2DJ 1MNDA 1YRNB 5CKTA 1FWZA 2HOTA 2A5YB 2K9QA 2M7BA 4N9HA 1L0OC 3SQNA 1VQ7I 3VYTB 4CZCA 3Q0WA 2E2JJ 5FKKA 4MTEA 1V55H 3RSNA 3E5XA 2XKPA 1Y6IA 3ZMDA 4F55A 5KHDA 2QZ8A 1BOBA 1Z3XA 4MEXF 4BDZA 2WAFA 3J7AY 1B59A 2KISA 3HYIA 3OYCA 1B8IA 3CMAI 2EJRA 3H3UA 2CWEA 3R60A 5C4JJ 1K79A 4YFXF 2GM4A 2L7KA 2M30A 4I7HA 3QPHA 5KAIC 4KN4X 5DS9A 4HDUA 1K4SA 4PJMA 2OU2A 3SDBA 2GA2A 4D5FA 4U0WA 2DJNA 2IGMA 3QYEA 4OU0A 4MIMA 5E1XA 2MD0A 4DJAA 3AG3H 1FTTA 3DBHB 4BACA 3RKWA 1XDSA 3OYNA 1P4XA 2MYSA 2ZSIB 4M6XA 4CHUA 1QA6A 3CJQB 1TT0A 4QIWN 5GADJ 4IKFA 3KZYA 4A93J 3DBRB 1R00A 3H3VK 1JT0A 3C1DA 4XN3A 1TLHB 2UV1A 3H0DA 2E34A 1S3JA 1KYZA 2Y0SN 4BDYA 4A0ZA 5D8KB 2QQ9A 3S8PA 4J00A 4UVCA 2R7UA 1PP8F 1WJFA 3L9FA 4JX5A 1FY7A 1APLC 2MLKA 2LY1A 2X6OA 3I5UA 3SZPA 2HKXA 4I6ZA 3H9JA 3MEXA 3JRFA 3MKZA 4QTRA 2LLKA 2MD5A 3LWFA 5GAEJ 4KISA 1PUEE 2V9PA 3PO2J 1DU6A 1R49A 2HNHA 2NNNA 2ZXWH 3TW6A 2ZNYA 1Z3YA 2FQ3A 4RAZA 3BJAA 1D8JA 2A5WA 4E4HA 2BY1A 1IXCA 2EZHA 4O6JA 4UV8A 4RAYA 2EA2A 2W57A 5F1RA 2OV7A 2QEXI 1R5GA 4CCKA 2LP0A 3TQNA 4Y3OA 1MMGA 1PUFB 3WGGA 4E6KG 2R7OA 4RGRA 4WCGA 1IN6A 4IRIA 3DBLB 1Z21A 1AKHB 4HX7A 3I53A 3ZMUA 2BY0A 4ASNA 5D5VB 2IA0A 5EZGA 2JZYA 2VJJA 4S04A 3E7LA 2M87A 4NDLA 4EEFG 1Z7LA 4I98B 3C2BA 4KIGA 3JSPA 4PGHA 1BL0A 5DCMA 5DEQA 1SFOJ 5BMZA 4HF2A 2DYRH 3NWTA 3BC8A 3PNYA 5M5WJ 4DGWB 3BP8A 1SAXA 1O3SA 2JMWA 4XKCA 3GF2A 5C44J 3P9KA 4HPQA 3K1PA 1YI2I 1MBKA 3CCLI 4G7ZF 2EB7A 3BG3A 3K1NA 1J2XA 2PMHA 1XS9A 1Z91A 2FOWA 1SVOA 1O3RA 3S1MJ 2XB5A 5FD5A 1TTYA 5A2QK 4E7KA 4A3GJ 3BTJA 3F8NA 4RB2C 3HJEA 3RJPA 3KX2A 3WU2C 5D5XB 3A0HC 3A2KA 2IS2A 3FISA 3LQRA 3WHBA 1MMAA 1TWFJ 1Z77A 1OCPA 5TRDA 2WA0A 4UHTA 2DTRA 2AHQA 1TZLA 2JSPA 1K6OA 4YG2F 2ZB9A 3FX3A 2IXSA 5IP6A 4XSZF 4MFDA 4RLFA 4YFNF 3SHFA 1BW6A 4G6DA 2P81A 3HHHA 3ZPLA 3OV8A 3X2QH 1SAUA 3ISPA 1JUPA 2ELKA 1EH7A 5E79C 4B3XA 1U5TA 1ZELA 1I6HJ 4TV7A 4YIIA 4XRMA 3ZQFA 3FF5A 2HZDA 4LK1F 4CA0A 1P2FA 4A3LJ 4QSHA 4BXUA 2IBDA 4PZJA 5FRMA 1IXRC 3DQVC 1V5GA 1R1VA 3B73A 4BHCA 3IRQA 3BWGA 2E71A 1D1AA 1J5YA 4R8HA 2V4JC 5J1YA 3IKVA 4NQWA 2F6CA 2PMUA 3LFUA 3W2WA 2FNPA 2CV2A 1T39A 2A68F 2O03A 3PNTA 3M8EA 3KP2A 2BZTA 3RDIA 3V8LA 3FBNB 2KRFA 1QBJA 3PUFA 3PFYA 1UG0A 5CQEA 3SEZA 1DUXC 2Y30A 3A02A 2LG4A 2F5EA 2UXXA 1ZH5A 2ECBA 4DBQA 4E7IA 1LDKB 1WWXA 2NVUB 3OOUA 2LFBA 1ETVA 5ILVA 3A01A 3EYYA 1LVAA 4FQGA 1W7PB 5EGOB 3VYRB 2LC2A 2OUMA 2V1NA 3M8JA 5HNFA 1OISA 2LNBA 2JK3A 2JTVA 3O6BB 1YX3A 1NK2P 4Y52J 3RPUD 1WJCA 1I1SA 5L3GA 5K5RA 5J6XA 2K40A 2A3SA 4WXHA 1W36D 2JA5J 2GZWA 3MAJA 5IYCJ 2JQ7A 2VJ5A 4JOMA 3S93A 3TP3A 4QWQA 4XLPF 4XLFA 2M8EA 1YS6A 1WSUA 4OMYA 3JW4A 2W24A 3EDPA 2GAUA 5K7ZA 1SC7A 2R7XA 3D5LA 3F23A 1T33A 1OCCH 4O3MA 4ZZDA 2TCTA 3FIWA 4ENJA 4AVPA 1OCTC 2R7DA 1JT6A 2BOLA 2BVMA 2YU3A 4UY8I 1I39A 2O7OA 3GCMA 3CMEI 2FUG2 1CGPA 2HKOA 4ESBA 2NOGA 4LJZF 3T8RA 5FROA 3G4SI 3BR5A 5K5QA 2O8KA 3VYUB 3EUKL 4V2GA 1UG2A 3RQIA 1XMXA 4HG2A 3PQKA 1VQKI 2K9MA 1EKEA 1UJ8A 4KFCA 1LFUP 3HPHA 3OSGA 3M8FA 1U9OA 4HA8A 2LF8A 5FLXZ 2CGPA 3IWFA 3I4MJ 4KMUX 2V6EA 1LE8B 3RKYA 2HQNA 3S2WA 4ENNA 5J3LA 5BQTA 1O3TA 4RB0A 4FX4A 2V9KA 5D5WB 4XM3A 1E17A 3CCQI 4F93B 5IY5H 2OD5A 4G9YA 5H2FC 3EUAA 1IN7A 1A6QA 1XG1A 2DOAA 2K7LA 3KCCA 5BNGA 5FB2A 1T98A 4H4KC 2LDUA 1OMIA 4LOCA 4I01A 5DYMA 1R71A 2ZBKA 1VFCA 1FMWA 1KONA 1OPCA 2H6CA 1J9IA 2LR8A 4A0XA 3OYEA 2QQAA 3BPVA 1T95A 2Y48A 2XB0X 1AA7A 5FKOA 3DTKA 2VE9A 1P9QC 1N25A 3CCRI 1HOMA 1EH6A 3HB9A 4CGZA 4WX9A 3GWZA 1LFBA 1MZBA 3R4KA 3F6OA 3ESWB 5GAGJ 3DPTA 3NQOA 1YS7A 3WHCA 3L09A 3PUBA 1X1AA 4BQOA 1RRJA 1JJ8C 1EF4A 1BC7C 4A3EJ 4G6TB 4EVIA 1YE9A 2HVSA 3M3YJ 3QRFF 2CW0F 2STTA 1IUYA 4II2A 4XRSG 4FE7A 4AYBN 3GBGA 4A3JJ 2XDVA 4I09A 5D8LB 3KYLA 2IGKA 2OQGA 3F8BA 1VQLI 3OWTA 3GEZA 1JXSA 1N77A 2W85A 2RNGA 4J19A 1USTA 5H6RA 5IOZA 3DLAA 3CMMA 2R5YA 4XOPA 3WU1B 1VNDA 3G6EI 3IH2A 1I1GA 3OSFA 3E6CC 2ZJQF 1I3AA 2E35A 3GFLA 3DEWA 3ZMZA 3I4PA 1HQCA 2F4OB 3GTOJ 2QLZA 4CCJA 1GVJA 3IWZA 3I9V2 2CQNA 2MC3A 1SFXA 3TKYA 3KLNA 3VB2A 4S0HB 4NC7A 2DA1A 1JKQC 1KU9A 1J09A 2QUFA 2QF7A 1D8KA 2DT6A 3E6MA 1LE8A 5IT9K 2HQ5A 3RI4A 3SYTA 1JE8A 2PLYA 1HKTA 5LEJA 3QOEA 1N78A 2V1XA 2FBKA 4C2MJ 3S17J 1LB2A 2WTEA 3GZ6A 1XGMA 2VI6A 4HLYA 1G6NA 4XLCA 1FLIA 3KEQA 2ZJ2A 3MCZA 5J47A 2VQCA 3GZNB 4HSRA 4QPQA 4U0VA 5IT3A 4HF0A 4AD9A 2L3DA 4CSWA 3FMRA 4A3IJ 2GWRA 4G12A 2VBZA 3D1NI 1O7FA 3I54A 1U9NA 1BJZA 4HW0A 3WU0A 3ZR8X 2RGVA 5ICEA 4EMSA 4E7HA 3GTGJ 1FOKA 3HG9A 3TL4X 3F22A 2XSJC 5CYVA 2QSFX 5HDNA 1JGGA 5GP9A 2M1BA 2ICWG 4A2UA 2P8TA 2VUMJ 3PIOF 1EJ9A 4RAFA 4BBRJ 2E7XA 2PFBA 1FTZA 1D1BA 4RGSA 3A0BC 3J81Z 2B0LA 3HZJA 2B7EA 1RKTA 2EIMH 2K27A 4DYQA 3TBIA 2PJRB 1D0XA 4ZJZA 1IGNA 5HLTA 2KQRA 1TQIA 3F8FA 4IQJA 4O5VA 3I58A 2R7RA 2I5UA 1VQ5I 4UUSB 3BY6A 4HNUA 2TRTA 3W6KB 3CP8A 4LLGF 1S9HA 4DOZA 4D5CA 2OPTA 3FMQA 3WE2A 3OY9A 1A31A 5TJJA 2HXIA 2X4HA 4FISA 1JKPC 3G3ZA 1WJ5A 3BG6A 2LYCA 1NG7A 4B4CA 1J75A 1AWCA 1U78A 1CQTA 1G3YA 3K2ZA 2FE3A 1PVEA 3QOPA 3MKLA 1WH7A 2L02A 3JRDA 1WJEA 4LD5A 4KMFA 3HBLA 2XAGA 4EGYA 2K3FA 2XF6A 2HU9A 2XVCA 4CCLA 3OS1A 3MMYB 2Z9OA 1G59A 1ODDA 4BJTA 1W7PD 3Q5FA 3BT9A 2B63J 3PNVA 2JT1A 4IQ4A 2E1CA 4A3FJ 5E3OA 1BI2A 5CVVA 1A5JA 4ON0A 1RUOA 5HS7A 1OKRA 4XBFA 3QAHA 2P5KA 4EJTA 3K1MA 5DM7F 2O6GE 2VKDA 3KZIC 2X6WA 5M3MJ 5FKMA 3P5JA 5HOOA 1O4XA 1XB4A 2NVYJ 3A1YA 4RM3A 1ACIA 2EBIA 4YRVA 1BI1A 1TW2A 3B6AA 2WC2A 3AG4H 3L00A 2O61A 1QPMA 1W36C 1B9MA 1DP3A 6PAXA 1IN4A 2XGCA 3BR2A 3E5QA 1G3WA 1X1CA 3AG1H 4L0ZB 3IKTA 2Z2SB 3WTVC 1H89C 3BQYA 4E7LA 2YR2A 4A6EA 2DPDA 4MNUA 3L2QA 2M34A 3MWMA 3RTRA 5DD4A 2LKSA 1W1WE 1MBJA 2KDZA 3OYFA 4PSXA 2EZIA 3C7JA 4M9ZA 2QVOA 5K7FA 3CF5F 2I10A 1T0FA 3CMYA 2LF7A 2OTLI 1I3QJ 1EA3A 1DQUA 1SVLA 2WWYA 2KZGA 4JX6A 4M6YA 2ISYA 3WTSC 2K86A 4MEYF 1IF1A 1G4DA 2HOSA 3QP5A 4Y4RA 2FQ4A 1XD7A 1REPC 3RQ4A 2XAQA 1YJNI 5B1AH 3K2AA 5FLVA 1OLTA 2DU9A 1WJAA 1K4TA 3QPTA 3IAS2 1U8RA 3S1QJ 2RC4A 2LY9A 2FSWA 1XC5A 2YS9A 1IN5A 3QQAA 2A69F 3DPUA 4GRIA 5M5YJ 1XGOA 2M0CA 3K4JA 5KK1A 1A36A 3BCBA 2MC4A 5E18F 3H5NA 3E6BA 2VQGA 5HS8A 4JQFA 1ZRFA 3I56I 2FF4A 2LKXA 4NC8A 1O7LA 4CCMA 4G7HF 2BHZA 2XSDC 1GXQA 4M3EA 1FOWA 3O8GA 3JRAA 3JRCA 5HDKA 4OWRB 2K5CA 1X19A 3ASNH 5E3LA 3W6JB 4A3BJ 1ERDA 5F27A 1RETA 3OYAA 4IZZA 1H9TA 4B1RA 3DP7A 1H0MA 1OFCX 2DDAA 2VKEA 2XAFA 2FJ1A 3ZMSA 2IJLA 3KLOA 1SD6A 4ABZA 2Y9ZA 1YLFA 1ZAOA 2K4JA 3ERMA 5M3FJ 4K2EA 2M4KA 5J1RA 2YUSA 2BEOA 1RKWA 4DYCA 5J1UA 4JK1X 1X58A 4IHWA 3ZN1A 4M73A 1BI0A 5AONA 3DXJF 1AHDP 4N0BA 1YRNA 1I6XA 2VN2A 1TT5B 2W1OA 3LQQA 3V42A 1G2HA 1Z7UA 2E5NA 2IPQX 3MQ0A 4XOTA 2N8GA 2LTPA 3BG5A 4E7SA 2H27A 2RV8A 4Y13A 2P7VB 4YFKF 1GV2A 4M9XA 1TC3C 2H1KA 2D1HA 4D0PA 5IP7J 3KFWX 1GV5A 1FIPA 3E3VA 3NRVA 4MQ9F 2A6TA 1K6YA 1R22A 4UB8C 3KYDB 5TGTA 3KPHA 1FOYA 4HQEA 4RA2A 4I0BA 5FLMJ 2ACJA 3R0AA 2EFNA 2CMPA 3WTUC 5HLIA 1OYYA 2NNYA 2L2OA 3CC4I 3IAM2 1QNTA 1DU0A 3KP6A 3WTZA 2DXIA 4XLEA 2RAEA 2XAJA 2AQEA 1ORKA 3ABMH 5L3EA 2OTJI 1TQMA 2NAZA 3BZCA 2LBFA 3U21A 4G8XA 3V7CA 4ZYGA 2OQRA 2DO7A 2DOFA 3ABKH 2QYOA 3HSFA 3CCJI 2VT2A 4HNTA 4AIDA 3LNQA 3I3LA 1E3OC 4UUTA 1UHMA 2HGCA 3FXJA 1L3LA 2NVQJ 3H92A 4RS8A 3C3WA 1ETWA 5CJ9A 3WG7H 5GTIC 2F5DA 4MLOA 1UAAA 4AWXB 1SMYF 1B1BA 4D1QA 4AVZA 1ZR4A 2PBIA 5LGTA 5LHGA 2HQAA 3WTWC 2B9SA 1MH3A 2X85A 2XIGA 2OF7A 1R58A 4U87A 2XAUA 2D2WA 3DEUA 4FHTA 3TDZC 1X3ZB 1P7IA 1BR2A 3OYHA 2M45A 3M4OJ 2BV6A 2R4GA 1S7OA 2LMDA 5KVRA 3C2HA 5DCMB 2KJBA 4HLXA 2Z3YA 4E7ZA 3T0YA 4ZZLA 5ICFA 4RBOA 3TEDA 4XLHA 1DGWY 2QGUA 2XGEA 4FASD 4EM1A 3GVAA 2DTZA 1IV6A 3BPXA
chains in the Genus database with same CATH topology
5GADJ 3CJTB 3PIOF 3CCLI 1VQMI 1VQ9I 1FOXA 1YJWI 1MMSA 1VQ7I 3CCVI 4IO9F 3CCJI 1VQKI 3PIPF 3CCEI 3I56I 2E34A 2FOWA 3CCMI 5DM7F 1YITI 5DM6F 1YJ9I 3CCSI 1YJNI 4IOAF 3J7YJ 1FOYA 1VQ6I 2H8WA 5JVGF 2E36A 1YIJI 1S72I 3G71I 3CD6I 1VQ8I 3CC7I 2E35A 2QEXI 1VQLI 2ZJRF 1FOWA 3CC4I 4UY8I 1VQ4I 1HC8A 1Y39A 2QA4I 1ACIA 3CCRI 2K3FA 2ZJPF 3CF5F 3CMEI 1VQ5I 3J7ZI 3CCUI 2OTLI 3CC2I 4IOCF 5GAHJ 4V19K 1VQOI 5GAGJ 3CMAI 3DLLF 3G4SI 2JQ7A 1VQNI 2OTJI 3CCQI 3G6EI 3I55I 1YHQI 1QA6A 1VQPI 2ZJQF 2NXNB 5GAEJ 1YI2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD J;  3CJT B;  3PIO F;  3CCL I;  1VQM I;  1VQ9 I;  1FOX A;  1YJW I;  1MMS A;  1VQ7 I;  3CCV I;  4IO9 F;  3CCJ I;  1VQK I;  3PIP F;  3CCE I;  3I56 I;  2E34 A;  2FOW A;  3CCM I;  5DM7 F;  1YIT I;  5DM6 F;  1YJ9 I;  3CCS I;  1YJN I;  4IOA F;  3J7Y J;  1FOY A;  1VQ6 I;  2H8W A;  5JVG F;  2E36 A;  1YIJ I;  1S72 I;  3G71 I;  3CD6 I;  1VQ8 I;  3CC7 I;  2E35 A;  2QEX I;  1VQL I;  2ZJR F;  1FOW A;  3CC4 I;  4UY8 I;  1VQ4 I;  1HC8 A;  1Y39 A;  2QA4 I;  1ACI A;  3CCR I;  2K3F A;  2ZJP F;  3CF5 F;  3CME I;  1VQ5 I;  3J7Z I;  3CCU I;  2OTL I;  3CC2 I;  4IOC F;  5GAH J;  4V19 K;  1VQO I;  5GAG J;  3CMA I;  3DLL F;  3G4S I;  2JQ7 A;  1VQN I;  2OTJ I;  3CCQ I;  3G6E I;  3I55 I;  1YHQ I;  1QA6 A;  1VQP I;  2ZJQ F;  2NXN B;  5GAE J;  1YI2 I; 
#chains in the Genus database with same CATH topology
 2L0K A;  1ETO A;  5JI6 A;  2XKO A;  2QEN A;  2DA2 A;  1S7A A;  2DYS H;  4C3J J;  2IVM A;  2QBY A;  1OYI A;  2ZFW A;  3FXM A;  3U1D A;  1PUF A;  4PGG A;  2WAD A;  4EM0 B;  3CJR B;  2V7F A;  1AU7 A;  1X2N A;  1B4A A;  4PJJ A;  1MGT A;  4CYC B;  4AU7 A;  2R7W A;  3FXQ A;  2YX7 A;  3HSE A;  3A01 B;  4WF2 A;  2F4M B;  1QRY A;  1BR1 A;  3RYP A;  4Y17 A;  2LVS A;  2EK5 A;  1ZGA A;  4IX7 A;  2I8D A;  2FBH A;  5AIP A;  4ESF A;  4ANJ A;  2ESN A;  5F1J A;  3HOS A;  3RIR A;  4ESJ A;  1NHA A;  4G94 A;  1YW9 A;  2PN6 A;  1MBF A;  2W7N A;  4ZTF A;  2BGC A;  2DMP A;  5F08 A;  3MZ8 A;  2Y69 H;  3IL2 A;  3GUD A;  2ETH A;  5DV5 A;  3TO7 A;  2A61 A;  3H5R A;  3JRE A;  1XSV A;  2UXN A;  3HOX J;  4M74 A;  2HQR A;  4XKW A;  2ESH A;  1GUU A;  4AIK A;  1E2X A;  5HVQ C;  1P92 A;  2VQH A;  3H1C A;  1HXD A;  5L3C A;  1FPQ A;  2XGD A;  1FC3 A;  1S5L C;  2O0Y A;  1A04 A;  3K69 A;  4LLL A;  4B09 A;  3ZP5 A;  1F9N A;  2K4B A;  2GA1 A;  3HPG A;  1SAN A;  3PO3 J;  4N4O B;  4LG0 B;  3O3K A;  1HBX G;  3L7W A;  2Z1D A;  2ZME B;  1PYV A;  1JTX A;  2BY2 A;  1FMV A;  4HST A;  1BW5 A;  1W5C C;  3TDU C;  4BHB A;  2R7V A;  1ON2 A;  2OCC H;  4WK8 F;  2DCE A;  2O8X A;  1EH8 A;  4KJZ A;  1TBX A;  1JGS A;  1P6R A;  2E1M C;  4HX8 A;  4PFO A;  2M7A A;  2W25 A;  1FP2 A;  4GGG A;  5EDN A;  2BY3 A;  1LDD A;  2KMU A;  2FNA A;  2VL8 A;  4EQQ A;  1MIJ A;  4HAM A;  3HTS B;  3EUH C;  3DU5 A;  5B5E C;  2HPM A;  2KKO A;  3E0J B;  1OYW A;  4Y7N J;  2QA4 I;  2LBF B;  3MVP A;  2KHM A;  3O2P E;  3RZD J;  1OCZ H;  1D0Z A;  1B6A A;  3JRG A;  1IDY A;  2M8G X;  2MH2 A;  2PJP A;  2DA5 A;  3I64 A;  3ABT A;  3FXR A;  1I50 J;  5LFA A;  3HOT A;  3CCV I;  4B3A A;  3OL4 A;  5IOY A;  2MLG A;  1WKM A;  1BOA A;  2EV6 A;  3A4C A;  3OYM A;  1FYK A;  3LMM A;  1X3U A;  2G0E A;  3GLX A;  2MGQ A;  2ZJP F;  1LPQ A;  1JI8 A;  2QCO A;  4XQF A;  3JTH A;  1GLN A;  1ETK A;  3BTC A;  3ECO A;  3DCF A;  3JSO A;  1YW8 A;  1YHQ I;  3V7R A;  4BE0 A;  4PUS A;  3VPR A;  3GME A;  3V8K A;  2XAH A;  2ADU A;  1UHS A;  1UZC A;  4F3Q A;  2NS7 A;  2VON A;  3VSL A;  2OAZ A;  4E70 A;  3LSG A;  1KQ0 A;  1FP1 D;  2RKH A;  1KGS A;  1ZAR A;  3GO5 A;  4Q4Z F;  4ZYH A;  4UNO A;  2HYJ A;  4CYC A;  1WVR A;  3MZY A;  5FKL A;  2EA4 A;  2OA4 A;  3HTU A;  1SMT A;  1KYW A;  2VJI A;  4F92 B;  4HOB A;  3CUQ C;  5E3M A;  3JTG A;  1GT0 C;  4NQW B;  2DQR A;  3M9A A;  2EZK A;  4MHG A;  2OCE A;  1TWG J;  5CVR A;  3DLL F;  1FBS A;  3LAJ A;  1JHH A;  3CCY A;  3GTP J;  2CUE A;  2BW3 A;  3EUH A;  5ICG A;  5IYD J;  1DPR A;  3ASO H;  4I99 C;  3ZRG A;  1MSF C;  5F6F A;  4XIC A;  2KIQ A;  4NNJ A;  2VKH A;  4ZH4 F;  2E7W A;  5D6E A;  5BOX A;  2AS5 F;  1FZP B;  4L5I A;  4RAG A;  4XKV A;  1TWA J;  4A69 C;  4C30 A;  2P5L C;  3N05 A;  2CQ7 A;  1FNN A;  4XOR A;  4C3I J;  1Y56 A;  2CUJ A;  2DFI A;  3F9K A;  4PDK A;  1PJR A;  4UXN A;  4BS9 A;  3GFI A;  4OIO F;  1B9N A;  4F52 A;  4ENK A;  1JHF A;  2DFE A;  3QWL A;  4PK4 A;  1MMN A;  1CF7 B;  2HDC A;  1MKM A;  3HXL A;  5GTH C;  1Z67 A;  3BTI A;  3LOC A;  4HEA 2;  4BEH B;  2DMN A;  2FXA A;  2MG4 A;  1BJA A;  2FA5 A;  3HL2 A;  4Y15 A;  1IUF A;  1QZY A;  4M71 A;  2WB1 A;  1KU7 A;  4F7Z A;  1KQ8 A;  5J4Y A;  5DUK A;  2HYG D;  5E1Z B;  3PM1 A;  4OIP F;  1FIA A;  2D45 A;  2RNJ A;  1MD0 A;  2Q2E A;  2X51 A;  2DPU A;  4BJ6 C;  1U5T C;  3BTL A;  3IH4 A;  4HZF A;  1MNE A;  2MSY A;  4RGU A;  4M6V A;  4L9V A;  2R5Z B;  2PEX A;  2VC1 A;  3IHU A;  3LSI A;  2D5V A;  2KPM A;  2VBW A;  2VBX A;  2IT0 A;  2QSH X;  5DM6 F;  2XPU A;  1KA8 A;  4BE1 A;  2DFH A;  2RVC A;  2NS8 A;  1JKO C;  3GTL J;  4M3G A;  3K70 D;  3OYL A;  1RR7 A;  4DW6 A;  3CDI A;  3PSF A;  1XCV A;  4DZJ A;  3WE3 A;  1BBY A;  2XPW A;  3ZXS A;  4P5O A;  1BC8 C;  5GAH J;  3S15 J;  1R1U A;  1Q1V A;  3DU6 A;  1RI7 A;  3LL7 A;  4BXF A;  3JRH A;  2E1M B;  2EQR A;  1K61 A;  1ZQ3 P;  1U2W A;  1SEU A;  2RQQ A;  1QVT A;  3L2W A;  2GLO A;  4W97 A;  4LIV A;  4IVN A;  1IO2 A;  5ERI A;  1ULY A;  1QHG A;  4RGX A;  3GX4 X;  1D0Y A;  2NVX J;  1LKX A;  4KIF A;  2JWT A;  2O3F A;  2W84 A;  3G1M A;  3K0L A;  3TO9 A;  3PQJ A;  2VOO A;  3QP6 A;  3FWE A;  3LSJ A;  5JHF A;  2QKL B;  2Q0O A;  2YX4 A;  5L3B A;  4YIR X;  2HOE A;  5D5U B;  1XSD A;  1FSH A;  2XRL A;  4IEJ A;  4V19 K;  2VIX A;  4PJL A;  3S3M A;  2X48 A;  2ZXI A;  4MQV A;  4GXO A;  3D5R C;  3IP4 B;  3ZQL A;  4HQM A;  5JLX A;  1G8X A;  2JSC A;  4AIJ A;  2LSO A;  2IP2 A;  1ZR2 A;  4LLN A;  3QPS A;  3FM3 A;  3PFI A;  2VAS A;  1XX5 A;  2VPR A;  2WY7 Q;  1HDD C;  4IF4 A;  2L9S A;  5HLG A;  2PG4 A;  1G3S A;  4RDU A;  2TDX A;  1IRF A;  5JVT A;  1ONV A;  1MBH A;  1T6S A;  2FX0 A;  5LGN A;  2DDB A;  5JHU A;  1T2K A;  3TW7 A;  3UR3 C;  4KN7 X;  3OYD A;  4BKX A;  1XMK A;  5HLH A;  5DUI A;  4IOC F;  3S14 J;  1FJL A;  1DDN A;  1UFM A;  2OZ6 A;  2JJ7 A;  1YO5 C;  3OOP A;  5BPD A;  4W1U A;  1RUN A;  4WWC A;  3BRO A;  2QKM B;  3LA7 A;  5FLX K;  1AKH A;  4L9T A;  3M1E A;  2F5C A;  3DV8 A;  3VEP A;  1SFU A;  2ZKZ A;  1U8B A;  2FBI A;  1LDJ A;  3HOY J;  3F72 A;  2Y9Y A;  2E36 A;  3PL8 A;  4LG0 A;  1UMQ A;  1T08 B;  2Z5U A;  5B3S H;  1ZG1 A;  2ZNZ A;  2YSR A;  3RPU A;  4LB5 A;  4E7J A;  3IUO A;  5IPA A;  3WTT C;  3FXL A;  1LEA A;  3QU3 A;  2CU7 A;  2UZK A;  5LEK A;  3K4L A;  3BDD A;  3SZG A;  1SD5 A;  2GOX B;  3GLL A;  4P9F A;  2L9N A;  4KDP A;  1MBG A;  3RYR A;  3AFH A;  3EPZ A;  3OMY A;  1JJ6 C;  1W4M A;  4Z2Y A;  3AG2 H;  4PJ0 C;  3H3Z A;  1R4N B;  4BY1 J;  2CQQ A;  2IEK A;  2LK2 A;  4KT5 C;  4U7B A;  3QPL A;  3MFK A;  3HSR A;  4MGR A;  1HKS A;  3HKZ N;  1RIO H;  3KET A;  3J7A O;  2X1E A;  1V4R A;  5JR3 A;  1OCO H;  4M3B A;  5DCF A;  2P7C B;  2R92 J;  2E2H J;  4A3D J;  3FZV A;  2H8R A;  2DK5 A;  5EEA A;  4XNF A;  4I0A A;  2ECC A;  2HPI A;  3EYI A;  2XRN A;  3K9T A;  1K78 B;  3TOB A;  2FOK A;  3FKI J;  2HVR A;  3RPQ A;  2HWV A;  2GBY A;  4HBL A;  3HOW J;  5JFR A;  3LA3 A;  4XN0 A;  2Y75 A;  2KT0 A;  3ONQ A;  5DDG A;  3WG9 A;  5KCM A;  1C0W A;  1FX7 A;  1YFH A;  4B43 A;  5IYB J;  4IL6 C;  1HLV A;  3F6V A;  2PMZ A;  2V1U A;  2IS1 A;  1QHH D;  3GXO A;  5EG0 B;  2STW A;  1U5T B;  1USS A;  5D6F A;  5EYR A;  4GDF A;  3BG7 A;  3BJ6 A;  2KL4 A;  4Q47 A;  2E1O A;  2L7Z A;  2IRF G;  1ZHF A;  5E8G A;  3BR1 A;  2WBM A;  1JUM A;  1YJW I;  2DMT A;  1FYL A;  4ENM A;  4DZP A;  5EF6 A;  3CJN A;  4BAY A;  1OQY A;  2HXO A;  4BEH A;  4HYE A;  3J7Y J;  2H8W A;  2JUC A;  1IRG A;  4BUP A;  5CVU A;  1ZTR A;  2F2E A;  2W48 A;  3KYC B;  2DOD A;  5K7H A;  3GFM A;  5E8I A;  4IHY A;  3KEY A;  1XN7 A;  2M0M A;  5IP9 J;  3HUG A;  1S7E A;  1G3T A;  1R1T A;  3BQZ A;  1WJB A;  1F5T A;  2ID6 A;  3I71 A;  3H0G J;  1K83 J;  1QGP A;  3UKG A;  3OL3 A;  2W00 A;  3PJR A;  3ZMV A;  4FE4 A;  4IXA A;  1UCR A;  4M9S A;  5LBQ A;  3CCE I;  3BZ6 A;  2VXD A;  4ZC3 A;  3T1B A;  3ZOB A;  1SFE A;  1ZRD A;  3FK6 A;  2CW7 A;  4YEL A;  2AXT C;  4QLC U;  1W7P A;  4DQ2 A;  4GYI A;  5H20 A;  2OJE D;  3L2C A;  1ZLJ A;  3KE2 A;  2ME0 A;  1X4P A;  2R5Z A;  1F36 A;  1HA8 A;  3CLO A;  2MFZ A;  4A6D A;  1B72 B;  1R5H A;  3VYS B;  2WAQ A;  1MH4 A;  2R7F A;  3KZZ A;  4HRI A;  4IHV A;  3K10 A;  1MNM C;  5LRS A;  2IAI A;  2EPF A;  4AC0 A;  2HR3 A;  5LHH A;  2EFQ A;  1YJ9 I;  3REO A;  1ENH A;  1QZZ A;  2AXL A;  3CC7 I;  1XMA A;  2W82 A;  1R6R A;  3AL0 C;  2E1N A;  2L4A A;  1H9G A;  3ABU A;  4ZDO A;  2WV1 A;  3J80 Z;  3CC2 I;  1JTY A;  1HKQ A;  1LFP A;  2ID3 A;  5EG0 A;  2NXN B;  3B02 A;  3Q9S A;  4KUM A;  1GXP A;  1VQ9 I;  1HW2 A;  1IV8 A;  1V5E A;  4UV9 A;  3I4N J;  2PQ8 A;  3GTM J;  3F8C A;  1XSX A;  2DA4 A;  1X1B A;  4RMN A;  3BR0 A;  3Q3S A;  2GXG A;  1QZE A;  3HEF A;  2X6Y A;  2ME6 A;  2R7T A;  2VE8 A;  5LLQ A;  3S3N A;  3E1S A;  3SFZ A;  3TO6 A;  2O5R A;  4G6Q A;  4MO7 A;  2M3A A;  2EV0 A;  3DKX A;  3CUQ B;  2GIV A;  2EIJ H;  4M72 A;  2K02 A;  3DTE A;  1A6I A;  1Y1W J;  1Z0X A;  3RKX A;  4CZZ A;  4CIC A;  3ECH A;  1SFK A;  2A6H F;  3ULQ B;  5L3F A;  3PSI A;  5E20 A;  2CV0 A;  3IC7 A;  2EIL H;  1YIT I;  2HI3 A;  1UB9 A;  4KYW A;  3LAP A;  2V9V A;  3K4B A;  3ABL H;  4MTD A;  5FO5 A;  2CS3 A;  1K78 A;  4AIH A;  2IGO A;  5BPI A;  4N9I A;  2DA7 A;  1BR4 A;  2YPR A;  1ZN2 A;  3Q0V A;  5FKN A;  1ETX A;  5E1W A;  3E6D A;  1ZRC A;  2BXZ A;  1ON1 A;  3FBI B;  3F8M A;  2MW8 A;  4DBR A;  3FKJ A;  2HS5 A;  2LRE A;  3BG9 A;  4P9U A;  1W5S A;  4OOI A;  3MN2 A;  3LSH A;  4A0Y A;  1TWC J;  2L01 A;  2V26 A;  3N97 A;  2VC0 A;  4OIN F;  5F0C A;  5FD6 A;  3S3O A;  1Z6R A;  1E3P A;  5J4V A;  4HF1 A;  1R9T J;  3CP2 A;  3LSM A;  4IJA A;  2ZFU A;  3UNG C;  1Y1V J;  5J8F A;  3SXY A;  4IHS A;  1BIB A;  4YIF A;  3HRS A;  2V6C A;  3HRT A;  1JUS A;  2G9W A;  3KIO A;  4WXC A;  2EZL A;  1S29 A;  1R23 A;  1IAW A;  2P5V A;  2WB1 N;  2PMZ N;  5JLW A;  5ED4 A;  5D4R A;  2M5W A;  2CYY A;  1TNT A;  2HVQ A;  3CJT B;  3DTI A;  2ZO4 A;  2XHK A;  5C4X J;  1KU3 A;  3KP7 A;  3W3C A;  3N4M A;  1MDM A;  2Y0S A;  3HRM A;  4XKB A;  3COA C;  1Y8R B;  3OIO A;  2JA6 J;  3RKQ A;  2ZME A;  2EFP A;  4RLQ A;  2K9N A;  4QPO A;  5CVJ A;  4ZDL A;  3CUO A;  4D7N A;  2C6Y A;  1IRZ A;  2COM A;  3DFG A;  2FML A;  4EV0 A;  1MMD A;  4EM2 A;  3V4G A;  3HDD A;  1KU2 A;  3MD2 A;  4CXF A;  4HV6 A;  3MKY B;  1W0U A;  2UWM A;  1RZ4 A;  1Y0N A;  1YYV A;  2W4S A;  1IW7 F;  3VOD A;  5E17 F;  1KZH A;  1U0J A;  3Q9V A;  1IXS B;  4NB5 A;  4I2O A;  4GO1 A;  1WGX A;  2K85 A;  1X2M A;  1Y8Q B;  1YIJ I;  2Z99 A;  3L2V A;  5LRR A;  1XGS A;  2QQB A;  1RC9 A;  3DPL C;  1OR7 C;  2G7U A;  4X0G A;  1Y39 A;  3GTK J;  2WV0 A;  5ILS A;  3NAR A;  1O3Q A;  2Z16 A;  4P55 A;  3QYB A;  1LJ9 A;  2P0W A;  3JAM Z;  2VOD A;  2V1D A;  5AIQ A;  2KRC A;  5HDG A;  2ZC2 A;  3RZO J;  3ZQH A;  2VPL A;  4YEJ A;  3WTX C;  1ETY A;  2X6X A;  1D3Y A;  4KA4 A;  5HOD A;  1FOX A;  2DN0 A;  4L9N A;  5HNH A;  3P7N A;  5KNL A;  4IO9 F;  1Z05 A;  5F0H A;  1H8A C;  2GIZ A;  3CCM I;  5KAF C;  3U1K A;  3CCS I;  3S2H J;  2QQ8 A;  1SVM A;  4FET A;  3SFI A;  2A07 F;  4RB1 A;  3W2A A;  3GZ5 A;  3BJO A;  3WGH A;  1SD4 A;  3R0J A;  3SDG A;  1S6L A;  4DIQ A;  1WI3 A;  1MJ9 A;  4LB6 B;  1O57 A;  5B1B H;  2FU4 A;  1WPK A;  2FMY A;  3HC7 A;  2X0L A;  4KT6 A;  4LMY A;  4XR6 A;  2M4G A;  3G2B A;  1HC8 A;  3VOE A;  2MBF A;  1D5V A;  4BHP A;  2HEO A;  1WRJ A;  1IDZ A;  1MMS A;  1T38 A;  1PDN C;  3PIP F;  1J7K A;  4S05 A;  2IGN A;  3R61 A;  3OR1 C;  1V3F A;  2M2E A;  2A6E F;  2DMQ A;  3KP5 A;  4LG3 A;  2LH9 A;  5F0F A;  2DA3 A;  2ZJR F;  4R1H A;  4DYR A;  4Y33 A;  1NG6 A;  2CRG A;  3S32 A;  2NS0 A;  2EIK H;  3BR6 A;  1M1E B;  3KEO A;  3VDX A;  5M5X J;  5IT9 Z;  3FK7 A;  4HDV A;  2DI3 A;  2XAS A;  2XUB A;  3C2G A;  4JP0 A;  2Y2Z A;  4LK0 F;  2R5Y B;  2KLO A;  1VQP I;  5EGO A;  5TIS C;  2AO9 A;  2DMU A;  3FXU A;  2HZT A;  1NTC A;  3C18 A;  1Y0U A;  3JR9 A;  4BNC A;  2KJC A;  2DA6 A;  1Z6T A;  3LSK A;  2L54 A;  2GQQ A;  3K70 C;  3SZT A;  3K7A J;  1JKR C;  2CV1 A;  4CH7 A;  3CF2 A;  3H9G A;  1CF7 A;  1XPX A;  4ZYD A;  4PCQ A;  1Z1D A;  3J81 K;  3LST A;  4U0Y A;  1POG A;  1B72 A;  3KP3 A;  1NH3 A;  3J7Z I;  1VI0 A;  3ZMT A;  4UUV A;  1GVD A;  2J5P A;  1U3E M;  3ZQ7 A;  2F5V A;  4AUX A;  2L5Q A;  5BS6 A;  1E3H A;  3ZGK A;  1S8N A;  2F4I A;  2P4W A;  1FT9 A;  1DP7 P;  1YX5 A;  4XRF A;  2XC7 A;  4B47 A;  5CQG A;  2L7M P;  2IS4 A;  2WAE A;  3NWS A;  2R7Z J;  2R3S A;  5EEH A;  4Z6Y A;  3O8H A;  1QVU A;  3CDH A;  4H0E A;  2XRO A;  4XID A;  4OMZ A;  1ZG3 A;  4HV5 A;  3TMO A;  1D1C A;  1F4K A;  3BCA A;  1UHW A;  4C3H J;  3EET A;  2VJ4 A;  2KIF A;  4FT8 A;  3U2R A;  5K1Y A;  2H6B A;  3FMS A;  2CUZ A;  4PJN A;  5A2Q Z;  3BLY A;  2D1V A;  1T0F C;  4XK4 A;  2WAQ N;  2F5F A;  4BY7 J;  2H1L A;  5B66 C;  2V79 A;  4XON A;  2DLL A;  3CZ6 A;  5GPC A;  1T56 A;  4KIT B;  1H88 C;  5DTD A;  3IH3 A;  1HCR A;  3CO7 C;  2XGX A;  3K4N A;  2HFH A;  3MZH A;  1R5I D;  1DPU A;  2PJR A;  3CES A;  2LKP A;  4AYB A;  2ZXJ A;  4V2F A;  1IRX A;  1XDU A;  2JRM A;  2JVG A;  4FX0 A;  4Q48 A;  2L4M A;  1TWH J;  2YU9 J;  5L3D A;  1RES A;  1QO0 D;  2CQK A;  3FXO A;  3TGN A;  1P4W A;  2RDP A;  2EV5 A;  2H94 A;  3HHG A;  4L5J A;  4EGZ A;  2EWN A;  4XL9 A;  2VXZ A;  2HDW A;  4HNV A;  2FRH A;  4ZDP A;  3H9Q A;  2OZU A;  3LA2 A;  3CD6 I;  3S1N J;  2IA1 A;  4GFB A;  5FRN A;  4MFE A;  4BXX J;  5C3E J;  2MAB A;  1YQA A;  4LGW A;  4A5M A;  1R36 A;  1IC8 A;  3BOQ A;  2NOJ B;  3DKW A;  1MDM B;  1ZG5 A;  2R93 J;  4UVB A;  3L2R A;  1ZLK A;  3FDY A;  4PSW A;  3R6S A;  1YTY A;  2ISZ A;  3I55 I;  2XF7 A;  3H36 A;  1X1P A;  4B48 A;  2JUG A;  1VZ0 A;  3G73 A;  3BR3 A;  1T8I A;  4NHJ A;  4X6A J;  5GPA A;  4A3M J;  2JVH A;  2E5Z A;  2PX9 A;  2COB A;  2XV4 S;  5ILU A;  3I59 B;  3K4K A;  1FBU A;  2OC6 A;  3V8J A;  4J01 A;  2EIN H;  2VBY A;  1B8I B;  2NRA C;  1S72 I;  4LFU A;  5F04 A;  1DGR M;  2LOO A;  4XMY A;  2QSG X;  3BZK A;  1IN8 A;  5LHI A;  3W2V A;  1IG7 A;  2DT5 A;  2ZSH B;  2JA8 J;  2LY2 A;  2CUF A;  4EJW A;  1VQO I;  1TP4 A;  3S16 J;  1XGN A;  4DNC A;  1HDP A;  1P4A A;  2K9L A;  2P6T A;  2QWW A;  2ZXH A;  3AL0 B;  3K4C A;  2LRD A;  1I5Z A;  3W6V A;  2ZCW A;  3QU6 A;  1FEX A;  4BH9 A;  1BI3 A;  3L1P A;  9ANT A;  1WH5 A;  4KIB A;  4M3D A;  4U7D A;  1K7A A;  2KIU A;  2DBB A;  2E19 A;  1IZ1 A;  1ETQ A;  1BA5 A;  4BQQ A;  1AOY A;  1WCM J;  3ZQI A;  1VQN I;  3H5A A;  2E60 A;  3WOD F;  5J8C A;  3VSK A;  1BM9 A;  4PFP A;  4UVA A;  2KP6 A;  1MBE A;  5K5O A;  3IV5 A;  2IS6 A;  2G7H A;  2KZV A;  4XLA A;  3IRR A;  2CFO A;  2P6S A;  1RPW A;  1ZRE A;  1LVK A;  4EJV A;  2CW8 A;  1F1Z A;  2Y0M A;  4NC6 A;  2A05 A;  2IA2 A;  3HUG B;  3KP4 A;  1NK3 P;  3HM5 A;  2VKV A;  2L9V A;  3S1R J;  1R4M B;  1SD7 A;  1ZKG A;  3ZN0 A;  4CUG A;  2JA2 A;  2CQX A;  2CSO A;  1A35 A;  1WI9 A;  2CJJ A;  5F64 A;  3E5U A;  1QPI A;  1D5Y A;  4ZYE A;  3OIQ A;  3OYK A;  1LNW A;  2L9R A;  5EJC A;  5FFX A;  4EJU A;  4UUS A;  4CDG A;  3I59 A;  5J40 A;  1VQ8 I;  3DEE A;  4D9J A;  1ITY A;  1YIO A;  2DJI A;  2KFD A;  3D0S A;  1STZ A;  1WJD A;  4BU2 A;  4X1E A;  1N75 A;  3SJM A;  1FSE A;  2AQF A;  1WZ2 A;  2HOA A;  3ZQC A;  3HRU A;  3DF8 A;  3JCU C;  4LIU A;  1BIA A;  2RQP A;  1V54 H;  3CO6 C;  4A5N A;  3ML6 A;  1ZGW A;  2QBY B;  3OYJ A;  3HOV J;  2EH3 A;  3H35 A;  2Q8K A;  2FD5 A;  4EAT A;  1LUJ B;  1W5T A;  3OYI A;  3HOZ J;  1OJL A;  4OIR F;  2X9D A;  1UEL B;  2CG4 A;  2J5O A;  1ZGJ A;  4U88 A;  4AM3 A;  2FEZ A;  5LGU A;  3A03 A;  5CVI A;  4JBA A;  4OAY A;  3MKW B;  2R0Q C;  3OYG A;  2X1C A;  3M1C A;  1GHC A;  5LD2 C;  3NAU A;  5EZH A;  2PI0 A;  1OCR H;  3EQL F;  3M7G A;  1X4O A;  3HKZ A;  4BE2 A;  3JRB A;  2GXB A;  4XLN F;  1GDT A;  3NEU A;  1MSE C;  1YOV B;  3VFZ A;  4BYY A;  4XSX F;  2VLA A;  1BN5 A;  5HS9 A;  4IHT A;  4IOA F;  1YG2 A;  4FTH A;  1ZK8 A;  2ELH A;  4CCO A;  3ROU A;  4B8X A;  4C9Y A;  2HYF A;  4C2T A;  2F48 A;  3OYB A;  4WXD A;  4A12 A;  4A3K J;  2GOM A;  3ZQQ A;  2Q1Z B;  2ZME C;  3WGI A;  4BBS J;  1QU3 A;  4LIT A;  3ELK A;  1EV7 A;  4BQN A;  1TL8 A;  1HSJ A;  1W0T A;  3FXK A;  3G1L A;  4HX4 A;  5E3N A;  3LFK A;  4L18 B;  3GTJ J;  3OR2 C;  3GYH X;  2BBY A;  3K6G A;  4Q5S F;  3E97 A;  2DK8 A;  1FYM A;  2NVT J;  3LSR A;  4R79 A;  4NBQ A;  4I02 A;  1MJA A;  4F91 B;  2BHY A;  2XPV A;  3P9C A;  1HST A;  4CYD A;  4ETS A;  2E2I J;  2HTS A;  4CCN A;  3LSP A;  1KQ9 A;  4L9J A;  4GYG A;  1V5F A;  2RN7 A;  4OAZ A;  1WFX A;  5ICC A;  4IRH A;  1R7J A;  2BE5 F;  1OR7 A;  2OBP A;  2HTJ A;  3OS2 A;  3P9I A;  4XRS A;  1F43 A;  2DQL A;  2CH0 A;  2MH9 A;  2WY8 Q;  3VWB A;  3HOU J;  2NYX A;  1IJW C;  3SEQ A;  2DOE A;  2ELJ A;  1HF0 A;  1X1D A;  3ZCO A;  2VT3 A;  1ZYR F;  3GW2 A;  3CTA A;  2EFW A;  3HGG A;  2KRH A;  3D5S C;  2KIM A;  4GCV A;  5JVG F;  2K9S A;  4FCY A;  3HIF A;  5DD8 A;  4ZYA A;  4CO8 A;  1LEB A;  1TNS A;  5FGM A;  4C2U A;  5CPR B;  2EFO A;  3G1O A;  4P96 A;  4UB6 C;  3B6C A;  1J59 A;  4L5E A;  3RCO A;  1U6G A;  1E0E A;  1MJB A;  2GXA A;  4BL0 B;  2IW5 A;  3CDL A;  3QOD A;  3HGY A;  3F0C A;  2X1D A;  4RM2 A;  4B44 A;  1PP7 U;  1XCB A;  5CLS A;  4BGD A;  1XTA A;  1FBQ A;  4NUB A;  4ITV A;  3FHZ A;  3K4M A;  1VTN C;  2CFX A;  2BXY A;  1P7J A;  2L7F P;  3FHN A;  4EJO A;  3ZQG A;  3DWL E;  3GTQ J;  1TQP A;  2JA7 J;  1J0R A;  3L2U A;  2RRE A;  3TOA A;  3WTY C;  1Z9C A;  2VQL A;  2VB6 A;  4I76 A;  4M3F A;  2VOP A;  3CCU I;  2BYV E;  1TW3 A;  2MA3 A;  2CO5 A;  2UUZ A;  3Q0U A;  3GFJ A;  3T8T A;  3TP0 A;  5FJ8 J;  2JN6 A;  3I0T A;  2M9H A;  4D7M A;  2JPB A;  3DKY A;  5EEG A;  3AAF A;  4IHX A;  1WQ2 A;  3G71 I;  5H6Q A;  3CLQ A;  4N4N B;  3F21 A;  4JYK A;  1VQ4 I;  1Q1H A;  2H09 A;  3FM5 A;  1QQI A;  1I27 A;  2HDD A;  3J80 K;  2O9L A;  1VF9 A;  1WHU A;  2DW4 A;  2Y31 A;  3AKZ A;  4RB3 C;  1HW1 A;  1MW7 A;  4IPA A;  2DAO A;  2LD5 A;  4KNY A;  4II3 A;  2JPC A;  5FFZ A;  4A3C J;  3CUQ A;  4P1W A;  1RR8 C;  4JX4 A;  3CQZ J;  1X3W B;  1VQM I;  4L0Y B;  2BW3 B;  2DT7 B;  4IRG A;  2Q2E B;  2XF5 A;  3U9G A;  1LQ1 A;  4G7O F;  2R7Q A;  2BVL A;  2R7S A;  1YW7 A;  3M07 A;  4KIC A;  1VQ6 I;  1HW5 A;  3V7S A;  3OS0 A;  3JRI A;  4OIQ F;  2Z33 A;  2JRT A;  3QYF A;  1RNL A;  5D4S A;  2QM3 A;  3F3X A;  3T5X A;  3JAM K;  4ZTJ A;  4BQA A;  4BJ5 C;  3OIP A;  3ERE D;  2DFF A;  2KDO A;  2K3P A;  3S2D J;  1MND A;  1YRN B;  5CKT A;  1FWZ A;  2HOT A;  2A5Y B;  2K9Q A;  2M7B A;  4N9H A;  1L0O C;  3SQN A;  1VQ7 I;  3VYT B;  4CZC A;  3Q0W A;  2E2J J;  5FKK A;  4MTE A;  1V55 H;  3RSN A;  3E5X A;  2XKP A;  1Y6I A;  3ZMD A;  4F55 A;  5KHD A;  2QZ8 A;  1BOB A;  1Z3X A;  4MEX F;  4BDZ A;  2WAF A;  3J7A Y;  1B59 A;  2KIS A;  3HYI A;  3OYC A;  1B8I A;  3CMA I;  2EJR A;  3H3U A;  2CWE A;  3R60 A;  5C4J J;  1K79 A;  4YFX F;  2GM4 A;  2L7K A;  2M30 A;  4I7H A;  3QPH A;  5KAI C;  4KN4 X;  5DS9 A;  4HDU A;  1K4S A;  4PJM A;  2OU2 A;  3SDB A;  2GA2 A;  4D5F A;  4U0W A;  2DJN A;  2IGM A;  3QYE A;  4OU0 A;  4MIM A;  5E1X A;  2MD0 A;  4DJA A;  3AG3 H;  1FTT A;  3DBH B;  4BAC A;  3RKW A;  1XDS A;  3OYN A;  1P4X A;  2MYS A;  2ZSI B;  4M6X A;  4CHU A;  1QA6 A;  3CJQ B;  1TT0 A;  4QIW N;  5GAD J;  4IKF A;  3KZY A;  4A93 J;  3DBR B;  1R00 A;  3H3V K;  1JT0 A;  3C1D A;  4XN3 A;  1TLH B;  2UV1 A;  3H0D A;  2E34 A;  1S3J A;  1KYZ A;  2Y0S N;  4BDY A;  4A0Z A;  5D8K B;  2QQ9 A;  3S8P A;  4J00 A;  4UVC A;  2R7U A;  1PP8 F;  1WJF A;  3L9F A;  4JX5 A;  1FY7 A;  1APL C;  2MLK A;  2LY1 A;  2X6O A;  3I5U A;  3SZP A;  2HKX A;  4I6Z A;  3H9J A;  3MEX A;  3JRF A;  3MKZ A;  4QTR A;  2LLK A;  2MD5 A;  3LWF A;  5GAE J;  4KIS A;  1PUE E;  2V9P A;  3PO2 J;  1DU6 A;  1R49 A;  2HNH A;  2NNN A;  2ZXW H;  3TW6 A;  2ZNY A;  1Z3Y A;  2FQ3 A;  4RAZ A;  3BJA A;  1D8J A;  2A5W A;  4E4H A;  2BY1 A;  1IXC A;  2EZH A;  4O6J A;  4UV8 A;  4RAY A;  2EA2 A;  2W57 A;  5F1R A;  2OV7 A;  2QEX I;  1R5G A;  4CCK A;  2LP0 A;  3TQN A;  4Y3O A;  1MMG A;  1PUF B;  3WGG A;  4E6K G;  2R7O A;  4RGR A;  4WCG A;  1IN6 A;  4IRI A;  3DBL B;  1Z21 A;  1AKH B;  4HX7 A;  3I53 A;  3ZMU A;  2BY0 A;  4ASN A;  5D5V B;  2IA0 A;  5EZG A;  2JZY A;  2VJJ A;  4S04 A;  3E7L A;  2M87 A;  4NDL A;  4EEF G;  1Z7L A;  4I98 B;  3C2B A;  4KIG A;  3JSP A;  4PGH A;  1BL0 A;  5DCM A;  5DEQ A;  1SFO J;  5BMZ A;  4HF2 A;  2DYR H;  3NWT A;  3BC8 A;  3PNY A;  5M5W J;  4DGW B;  3BP8 A;  1SAX A;  1O3S A;  2JMW A;  4XKC A;  3GF2 A;  5C44 J;  3P9K A;  4HPQ A;  3K1P A;  1YI2 I;  1MBK A;  3CCL I;  4G7Z F;  2EB7 A;  3BG3 A;  3K1N A;  1J2X A;  2PMH A;  1XS9 A;  1Z91 A;  2FOW A;  1SVO A;  1O3R A;  3S1M J;  2XB5 A;  5FD5 A;  1TTY A;  5A2Q K;  4E7K A;  4A3G J;  3BTJ A;  3F8N A;  4RB2 C;  3HJE A;  3RJP A;  3KX2 A;  3WU2 C;  5D5X B;  3A0H C;  3A2K A;  2IS2 A;  3FIS A;  3LQR A;  3WHB A;  1MMA A;  1TWF J;  1Z77 A;  1OCP A;  5TRD A;  2WA0 A;  4UHT A;  2DTR A;  2AHQ A;  1TZL A;  2JSP A;  1K6O A;  4YG2 F;  2ZB9 A;  3FX3 A;  2IXS A;  5IP6 A;  4XSZ F;  4MFD A;  4RLF A;  4YFN F;  3SHF A;  1BW6 A;  4G6D A;  2P81 A;  3HHH A;  3ZPL A;  3OV8 A;  3X2Q H;  1SAU A;  3ISP A;  1JUP A;  2ELK A;  1EH7 A;  5E79 C;  4B3X A;  1U5T A;  1ZEL A;  1I6H J;  4TV7 A;  4YII A;  4XRM A;  3ZQF A;  3FF5 A;  2HZD A;  4LK1 F;  4CA0 A;  1P2F A;  4A3L J;  4QSH A;  4BXU A;  2IBD A;  4PZJ A;  5FRM A;  1IXR C;  3DQV C;  1V5G A;  1R1V A;  3B73 A;  4BHC A;  3IRQ A;  3BWG A;  2E71 A;  1D1A A;  1J5Y A;  4R8H A;  2V4J C;  5J1Y A;  3IKV A;  4NQW A;  2F6C A;  2PMU A;  3LFU A;  3W2W A;  2FNP A;  2CV2 A;  1T39 A;  2A68 F;  2O03 A;  3PNT A;  3M8E A;  3KP2 A;  2BZT A;  3RDI A;  3V8L A;  3FBN B;  2KRF A;  1QBJ A;  3PUF A;  3PFY A;  1UG0 A;  5CQE A;  3SEZ A;  1DUX C;  2Y30 A;  3A02 A;  2LG4 A;  2F5E A;  2UXX A;  1ZH5 A;  2ECB A;  4DBQ A;  4E7I A;  1LDK B;  1WWX A;  2NVU B;  3OOU A;  2LFB A;  1ETV A;  5ILV A;  3A01 A;  3EYY A;  1LVA A;  4FQG A;  1W7P B;  5EGO B;  3VYR B;  2LC2 A;  2OUM A;  2V1N A;  3M8J A;  5HNF A;  1OIS A;  2LNB A;  2JK3 A;  2JTV A;  3O6B B;  1YX3 A;  1NK2 P;  4Y52 J;  3RPU D;  1WJC A;  1I1S A;  5L3G A;  5K5R A;  5J6X A;  2K40 A;  2A3S A;  4WXH A;  1W36 D;  2JA5 J;  2GZW A;  3MAJ A;  5IYC J;  2JQ7 A;  2VJ5 A;  4JOM A;  3S93 A;  3TP3 A;  4QWQ A;  4XLP F;  4XLF A;  2M8E A;  1YS6 A;  1WSU A;  4OMY A;  3JW4 A;  2W24 A;  3EDP A;  2GAU A;  5K7Z A;  1SC7 A;  2R7X A;  3D5L A;  3F23 A;  1T33 A;  1OCC H;  4O3M A;  4ZZD A;  2TCT A;  3FIW A;  4ENJ A;  4AVP A;  1OCT C;  2R7D A;  1JT6 A;  2BOL A;  2BVM A;  2YU3 A;  4UY8 I;  1I39 A;  2O7O A;  3GCM A;  3CME I;  2FUG 2;  1CGP A;  2HKO A;  4ESB A;  2NOG A;  4LJZ F;  3T8R A;  5FRO A;  3G4S I;  3BR5 A;  5K5Q A;  2O8K A;  3VYU B;  3EUK L;  4V2G A;  1UG2 A;  3RQI A;  1XMX A;  4HG2 A;  3PQK A;  1VQK I;  2K9M A;  1EKE A;  1UJ8 A;  4KFC A;  1LFU P;  3HPH A;  3OSG A;  3M8F A;  1U9O A;  4HA8 A;  2LF8 A;  5FLX Z;  2CGP A;  3IWF A;  3I4M J;  4KMU X;  2V6E A;  1LE8 B;  3RKY A;  2HQN A;  3S2W A;  4ENN A;  5J3L A;  5BQT A;  1O3T A;  4RB0 A;  4FX4 A;  2V9K A;  5D5W B;  4XM3 A;  1E17 A;  3CCQ I;  4F93 B;  5IY5 H;  2OD5 A;  4G9Y A;  5H2F C;  3EUA A;  1IN7 A;  1A6Q A;  1XG1 A;  2DOA A;  2K7L A;  3KCC A;  5BNG A;  5FB2 A;  1T98 A;  4H4K C;  2LDU A;  1OMI A;  4LOC A;  4I01 A;  5DYM A;  1R71 A;  2ZBK A;  1VFC A;  1FMW A;  1KON A;  1OPC A;  2H6C A;  1J9I A;  2LR8 A;  4A0X A;  3OYE A;  2QQA A;  3BPV A;  1T95 A;  2Y48 A;  2XB0 X;  1AA7 A;  5FKO A;  3DTK A;  2VE9 A;  1P9Q C;  1N25 A;  3CCR I;  1HOM A;  1EH6 A;  3HB9 A;  4CGZ A;  4WX9 A;  3GWZ A;  1LFB A;  1MZB A;  3R4K A;  3F6O A;  3ESW B;  5GAG J;  3DPT A;  3NQO A;  1YS7 A;  3WHC A;  3L09 A;  3PUB A;  1X1A A;  4BQO A;  1RRJ A;  1JJ8 C;  1EF4 A;  1BC7 C;  4A3E J;  4G6T B;  4EVI A;  1YE9 A;  2HVS A;  3M3Y J;  3QRF F;  2CW0 F;  2STT A;  1IUY A;  4II2 A;  4XRS G;  4FE7 A;  4AYB N;  3GBG A;  4A3J J;  2XDV A;  4I09 A;  5D8L B;  3KYL A;  2IGK A;  2OQG A;  3F8B A;  1VQL I;  3OWT A;  3GEZ A;  1JXS A;  1N77 A;  2W85 A;  2RNG A;  4J19 A;  1UST A;  5H6R A;  5IOZ A;  3DLA A;  3CMM A;  2R5Y A;  4XOP A;  3WU1 B;  1VND A;  3G6E I;  3IH2 A;  1I1G A;  3OSF A;  3E6C C;  2ZJQ F;  1I3A A;  2E35 A;  3GFL A;  3DEW A;  3ZMZ A;  3I4P A;  1HQC A;  2F4O B;  3GTO J;  2QLZ A;  4CCJ A;  1GVJ A;  3IWZ A;  3I9V 2;  2CQN A;  2MC3 A;  1SFX A;  3TKY A;  3KLN A;  3VB2 A;  4S0H B;  4NC7 A;  2DA1 A;  1JKQ C;  1KU9 A;  1J09 A;  2QUF A;  2QF7 A;  1D8K A;  2DT6 A;  3E6M A;  1LE8 A;  5IT9 K;  2HQ5 A;  3RI4 A;  3SYT A;  1JE8 A;  2PLY A;  1HKT A;  5LEJ A;  3QOE A;  1N78 A;  2V1X A;  2FBK A;  4C2M J;  3S17 J;  1LB2 A;  2WTE A;  3GZ6 A;  1XGM A;  2VI6 A;  4HLY A;  1G6N A;  4XLC A;  1FLI A;  3KEQ A;  2ZJ2 A;  3MCZ A;  5J47 A;  2VQC A;  3GZN B;  4HSR A;  4QPQ A;  4U0V A;  5IT3 A;  4HF0 A;  4AD9 A;  2L3D A;  4CSW A;  3FMR A;  4A3I J;  2GWR A;  4G12 A;  2VBZ A;  3D1N I;  1O7F A;  3I54 A;  1U9N A;  1BJZ A;  4HW0 A;  3WU0 A;  3ZR8 X;  2RGV A;  5ICE A;  4EMS A;  4E7H A;  3GTG J;  1FOK A;  3HG9 A;  3TL4 X;  3F22 A;  2XSJ C;  5CYV A;  2QSF X;  5HDN A;  1JGG A;  5GP9 A;  2M1B A;  2ICW G;  4A2U A;  2P8T A;  2VUM J;  3PIO F;  1EJ9 A;  4RAF A;  4BBR J;  2E7X A;  2PFB A;  1FTZ A;  1D1B A;  4RGS A;  3A0B C;  3J81 Z;  2B0L A;  3HZJ A;  2B7E A;  1RKT A;  2EIM H;  2K27 A;  4DYQ A;  3TBI A;  2PJR B;  1D0X A;  4ZJZ A;  1IGN A;  5HLT A;  2KQR A;  1TQI A;  3F8F A;  4IQJ A;  4O5V A;  3I58 A;  2R7R A;  2I5U A;  1VQ5 I;  4UUS B;  3BY6 A;  4HNU A;  2TRT A;  3W6K B;  3CP8 A;  4LLG F;  1S9H A;  4DOZ A;  4D5C A;  2OPT A;  3FMQ A;  3WE2 A;  3OY9 A;  1A31 A;  5TJJ A;  2HXI A;  2X4H A;  4FIS A;  1JKP C;  3G3Z A;  1WJ5 A;  3BG6 A;  2LYC A;  1NG7 A;  4B4C A;  1J75 A;  1AWC A;  1U78 A;  1CQT A;  1G3Y A;  3K2Z A;  2FE3 A;  1PVE A;  3QOP A;  3MKL A;  1WH7 A;  2L02 A;  3JRD A;  1WJE A;  4LD5 A;  4KMF A;  3HBL A;  2XAG A;  4EGY A;  2K3F A;  2XF6 A;  2HU9 A;  2XVC A;  4CCL A;  3OS1 A;  3MMY B;  2Z9O A;  1G59 A;  1ODD A;  4BJT A;  1W7P D;  3Q5F A;  3BT9 A;  2B63 J;  3PNV A;  2JT1 A;  4IQ4 A;  2E1C A;  4A3F J;  5E3O A;  1BI2 A;  5CVV A;  1A5J A;  4ON0 A;  1RUO A;  5HS7 A;  1OKR A;  4XBF A;  3QAH A;  2P5K A;  4EJT A;  3K1M A;  5DM7 F;  2O6G E;  2VKD A;  3KZI C;  2X6W A;  5M3M J;  5FKM A;  3P5J A;  5HOO A;  1O4X A;  1XB4 A;  2NVY J;  3A1Y A;  4RM3 A;  1ACI A;  2EBI A;  4YRV A;  1BI1 A;  1TW2 A;  3B6A A;  2WC2 A;  3AG4 H;  3L00 A;  2O61 A;  1QPM A;  1W36 C;  1B9M A;  1DP3 A;  6PAX A;  1IN4 A;  2XGC A;  3BR2 A;  3E5Q A;  1G3W A;  1X1C A;  3AG1 H;  4L0Z B;  3IKT A;  2Z2S B;  3WTV C;  1H89 C;  3BQY A;  4E7L A;  2YR2 A;  4A6E A;  2DPD A;  4MNU A;  3L2Q A;  2M34 A;  3MWM A;  3RTR A;  5DD4 A;  2LKS A;  1W1W E;  1MBJ A;  2KDZ A;  3OYF A;  4PSX A;  2EZI A;  3C7J A;  4M9Z A;  2QVO A;  5K7F A;  3CF5 F;  2I10 A;  1T0F A;  3CMY A;  2LF7 A;  2OTL I;  1I3Q J;  1EA3 A;  1DQU A;  1SVL A;  2WWY A;  2KZG A;  4JX6 A;  4M6Y A;  2ISY A;  3WTS C;  2K86 A;  4MEY F;  1IF1 A;  1G4D A;  2HOS A;  3QP5 A;  4Y4R A;  2FQ4 A;  1XD7 A;  1REP C;  3RQ4 A;  2XAQ A;  1YJN I;  5B1A H;  3K2A A;  5FLV A;  1OLT A;  2DU9 A;  1WJA A;  1K4T A;  3QPT A;  3IAS 2;  1U8R A;  3S1Q J;  2RC4 A;  2LY9 A;  2FSW A;  1XC5 A;  2YS9 A;  1IN5 A;  3QQA A;  2A69 F;  3DPU A;  4GRI A;  5M5Y J;  1XGO A;  2M0C A;  3K4J A;  5KK1 A;  1A36 A;  3BCB A;  2MC4 A;  5E18 F;  3H5N A;  3E6B A;  2VQG A;  5HS8 A;  4JQF A;  1ZRF A;  3I56 I;  2FF4 A;  2LKX A;  4NC8 A;  1O7L A;  4CCM A;  4G7H F;  2BHZ A;  2XSD C;  1GXQ A;  4M3E A;  1FOW A;  3O8G A;  3JRA A;  3JRC A;  5HDK A;  4OWR B;  2K5C A;  1X19 A;  3ASN H;  5E3L A;  3W6J B;  4A3B J;  1ERD A;  5F27 A;  1RET A;  3OYA A;  4IZZ A;  1H9T A;  4B1R A;  3DP7 A;  1H0M A;  1OFC X;  2DDA A;  2VKE A;  2XAF A;  2FJ1 A;  3ZMS A;  2IJL A;  3KLO A;  1SD6 A;  4ABZ A;  2Y9Z A;  1YLF A;  1ZAO A;  2K4J A;  3ERM A;  5M3F J;  4K2E A;  2M4K A;  5J1R A;  2YUS A;  2BEO A;  1RKW A;  4DYC A;  5J1U A;  4JK1 X;  1X58 A;  4IHW A;  3ZN1 A;  4M73 A;  1BI0 A;  5AON A;  3DXJ F;  1AHD P;  4N0B A;  1YRN A;  1I6X A;  2VN2 A;  1TT5 B;  2W1O A;  3LQQ A;  3V42 A;  1G2H A;  1Z7U A;  2E5N A;  2IPQ X;  3MQ0 A;  4XOT A;  2N8G A;  2LTP A;  3BG5 A;  4E7S A;  2H27 A;  2RV8 A;  4Y13 A;  2P7V B;  4YFK F;  1GV2 A;  4M9X A;  1TC3 C;  2H1K A;  2D1H A;  4D0P A;  5IP7 J;  3KFW X;  1GV5 A;  1FIP A;  3E3V A;  3NRV A;  4MQ9 F;  2A6T A;  1K6Y A;  1R22 A;  4UB8 C;  3KYD B;  5TGT A;  3KPH A;  1FOY A;  4HQE A;  4RA2 A;  4I0B A;  5FLM J;  2ACJ A;  3R0A A;  2EFN A;  2CMP A;  3WTU C;  5HLI A;  1OYY A;  2NNY A;  2L2O A;  3CC4 I;  3IAM 2;  1QNT A;  1DU0 A;  3KP6 A;  3WTZ A;  2DXI A;  4XLE A;  2RAE A;  2XAJ A;  2AQE A;  1ORK A;  3ABM H;  5L3E A;  2OTJ I;  1TQM A;  2NAZ A;  3BZC A;  2LBF A;  3U21 A;  4G8X A;  3V7C A;  4ZYG A;  2OQR A;  2DO7 A;  2DOF A;  3ABK H;  2QYO A;  3HSF A;  3CCJ I;  2VT2 A;  4HNT A;  4AID A;  3LNQ A;  3I3L A;  1E3O C;  4UUT A;  1UHM A;  2HGC A;  3FXJ A;  1L3L A;  2NVQ J;  3H92 A;  4RS8 A;  3C3W A;  1ETW A;  5CJ9 A;  3WG7 H;  5GTI C;  2F5D A;  4MLO A;  1UAA A;  4AWX B;  1SMY F;  1B1B A;  4D1Q A;  4AVZ A;  1ZR4 A;  2PBI A;  5LGT A;  5LHG A;  2HQA A;  3WTW C;  2B9S A;  1MH3 A;  2X85 A;  2XIG A;  2OF7 A;  1R58 A;  4U87 A;  2XAU A;  2D2W A;  3DEU A;  4FHT A;  3TDZ C;  1X3Z B;  1P7I A;  1BR2 A;  3OYH A;  2M45 A;  3M4O J;  2BV6 A;  2R4G A;  1S7O A;  2LMD A;  5KVR A;  3C2H A;  5DCM B;  2KJB A;  4HLX A;  2Z3Y A;  4E7Z A;  3T0Y A;  4ZZL A;  5ICF A;  4RBO A;  3TED A;  4XLH A;  1DGW Y;  2QGU A;  2XGE A;  4FAS D;  4EM1 A;  3GVA A;  2DTZ A;  1IV6 A;  3BPX A; 
#chains in the Genus database with same CATH homology
 5GAD J;  3CJT B;  3PIO F;  3CCL I;  1VQM I;  1VQ9 I;  1FOX A;  1YJW I;  1MMS A;  1VQ7 I;  3CCV I;  4IO9 F;  3CCJ I;  1VQK I;  3PIP F;  3CCE I;  3I56 I;  2E34 A;  2FOW A;  3CCM I;  5DM7 F;  1YIT I;  5DM6 F;  1YJ9 I;  3CCS I;  1YJN I;  4IOA F;  3J7Y J;  1FOY A;  1VQ6 I;  2H8W A;  5JVG F;  2E36 A;  1YIJ I;  1S72 I;  3G71 I;  3CD6 I;  1VQ8 I;  3CC7 I;  2E35 A;  2QEX I;  1VQL I;  2ZJR F;  1FOW A;  3CC4 I;  4UY8 I;  1VQ4 I;  1HC8 A;  1Y39 A;  2QA4 I;  1ACI A;  3CCR I;  2K3F A;  2ZJP F;  3CF5 F;  3CME I;  1VQ5 I;  3J7Z I;  3CCU I;  2OTL I;  3CC2 I;  4IOC F;  5GAH J;  4V19 K;  1VQO I;  5GAG J;  3CMA I;  3DLL F;  3G4S I;  2JQ7 A;  1VQN I;  2OTJ I;  3CCQ I;  3G6E I;  3I55 I;  1YHQ I;  1QA6 A;  1VQP I;  2ZJQ F;  2NXN B;  5GAE J;  1YI2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...