1UJ8A

Structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
SHHHHHHGSGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yfhJ
publication title Crystal structure of Escherichia coli YfhJ protein, a member of the ISC machinery involved in assembly of iron-sulfur clusters.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 21
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04384 Fe-S_assembly Iron-sulphur cluster assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.600 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A IscX-like 1uj8A00
2BZTA 1UJ8A
chains in the Genus database with same CATH superfamily
5E3MA 1T38A 3R6SA 1OCCH 1V54H 1W5CC 2WAQA 4RGUA 2K9MA 3JAMK 5EEAA 4R1HA 1PUFA 3HDDA 2CQQA 3SQNA 1W7PB 2BXZA 4G94A 2QCOA 2RQPA 3K69A 4BXFA 2D1HA 5DD8A 1T8IA 2TDXA 1G2HA 2FUG2 1ZN2A 4E7JA 3MZ8A 1OJLA 2M9HA 3JREA 3HPHA 3SEQA 3O2PE 5M5WJ 2BVMA 5EZHA 1FTZA 3L2CA 4HA8A 2P0WA 2CV2A 3S8PA 3ZQHA 4BQQA 5K5QA 1DQUA 3D0SA 2EFPA 1WJ5A 2FSWA 3OWTA 1F36A 1Z7LA 1MJ9A 3REOA 1TP4A 2A07F 5FRMA 4IOCF 1WJBA 5EG0A 2DA1A 2WTEA 2MSYA 1XB4A 1I39A 2GXGA 1X1CA 1FPQA 5TGTA 1XTAA 2JJ7A 3R60A 3ZQIA 1D3YA 2Y0SA 3F22A 3OL3A 2ESNA 2KQRA 5J40A 1U6GA 2OBPA 1DP3A 2GA1A 3MAJA 2Y9YA 3R0JA 4ZYGA 1U9OA 3F8NA 3DBRB 1MIJA 1UG2A 5DUKA 2M45A 1X1AA 2DODA 2X6WA 5JVTA 1IUYA 1BA5A 3P5JA 3FHNA 2QEXI 1XN7A 3F72A 3O3KA 1HKSA 1U78A 1FSHA 3OYHA 3CJRB 5B1AH 2NVXJ 1DPUA 5BOXA 3EYIA 4EMSA 2YSRA 1Z1DA 3J7AY 2O7OA 2FEZA 3KP5A 1SVOA 1MBKA 1BOBA 3G71I 5GAGJ 1FOXA 4MEXF 3FK6A 3EYYA 4DIQA 3S1MJ 1JGGA 1VQ7I 1X1BA 1BN5A 4PGGA 4XLNF 2JSPA 1GXPA 1DU0A 2CGPA 1XGSA 2A6TA 2F5FA 5F27A 4J00A 2VQHA 3QAHA 2CO5A 1A35A 4RGRA 3LSMA 3A2KA 1TWAJ 5FROA 3T8RA 4UB8C 1X2NA 2DLLA 2P81A 3VEPA 1XSDA 3PNTA 4ZH4F 2N8GA 3LSHA 4L5EA 4HAMA 2JRMA 4CZZA 1I5ZA 4U0YA 2QLZA 4BE0A 1YS7A 1FT9A 3O8HA 2L7MP 1O7LA 4IHSA 1IAWA 1TNSA 1ITYA 1ON2A 2NAZA 1WH5A 1IV8A 3BG5A 5JR3A 3SZPA 3RCOA 3TDUC 1QBJA 1LE8A 1J59A 1Y56A 2WA0A 3LFKA 3GZ6A 5EJCA 4C30A 2ZFWA 2QM3A 2QQAA 3LSIA 3ZQ7A 3LOCA 4J19A 1JXSA 1OCPA 4ENNA 3M07A 3L1PA 3R0AA 4DYRA 4LLLA 2R5ZB 3PQJA 2PG4A 1YS6A 3FWEA 3G1MA 3HL2A 4A3CJ 1R71A 3NEUA 4N4OB 3M3YJ 2YR2A 3RYRA 4RS8A 4BY1J 4YRVA 2CYYA 4XONA 2FBHA 3A01B 1PDNC 3DQVC 3U9GA 3NRVA 4B3XA 1XX5A 1IXRC 1BC8C 4UVCA 2JPCA 2RDPA 5H6RA 1MBGA 2P8TA 2QKLB 3HZJA 4LK0F 4NQWA 1FOKA 1Y6IA 3IH4A 4G7HF 1XPXA 4E7SA 3ERMA 4LJZF 3ZCOA 4N4NB 2ELJA 2H8RA 2F5VA 4UXNA 4B3AA 3S17J 3HM5A 5JHFA 1SVMA 2ME0A 3G1OA 2B0LA 5CVJA 4RAZA 4CSWA 2MLKA 1IUFA 3KEYA 1YW9A 5C4XJ 3VDXA 3RYPA 1ETYA 1QZYA 1TBXA 4A3JJ 1HW2A 3EUKL 1O4XA 5AONA 4ENMA 4E6KG 1YOVB 4XOPA 1O3QA 2IA0A 4AC0A 4F55A 3HBLA 4LMYA 2M4GA 2OUMA 2QSGX 2UV1A 3CJNA 3OIPA 2JRTA 1H88C 2Q2EB 2EFQA 3OS2A 2FD5A 3CUQB 5CYVA 4HG2A 3F23A 4ENJA 1CF7A 3IWZA 1P7JA 2LC2A 5KNLA 4CCJA 2K9LA 1BL0A 3BTCA 2WV0A 1WFXA 2HOSA 3GFMA 4A3DJ 3ECHA 2HVQA 5DUIA 4P1WA 3QPHA 3FXOA 3P9KA 1OLTA 2W57A 4XM3A 3BZCA 2FXAA 3S32A 4D7NA 2PX9A 4KMFA 2WAQN 2ZNYA 4B09A 4IHXA 2K9NA 3E6MA 3JRAA 2DAOA 1S3JA 2CQ7A 2DPDA 3CCRI 3CJQB 3GO5A 5FRNA 2IS2A 1MMDA 3L2VA 2JTVA 3F6VA 4JOMA 3IV5A 3C2HA 4XRSA 4RAYA 1P4XA 3LA3A 4OINF 1JKOC 3EUHA 1W1WE 3CCMI 3HB9A 4JBAA 4Q5SF 5EDNA 1O3TA 1ETQA 5K7ZA 3F3XA 3K4NA 4JYKA 3F0CA 2QA4I 3K7AJ 4HX4A 5L3EA 3FDYA 3JRCA 2O5RA 2XSDC 3S3MA 3E1SA 4RM2A 2XSJC 1HF0A 2Y30A 2MYSA 2ID6A 4DGWB 1J0RA 1W0TA 2IS4A 4EVIA 1R7JA 1S8NA 1X3UA 4F92B 2B9SA 4LG0A 4F7ZA 5KK1A 4I0AA 3WTVC 2HTSA 1FBQA 2A69F 1R9TJ 3SFIA 5M3FJ 1A36A 1A6IA 3DFGA 2ZXWH 5IY5H 4IRHA 4KJZA 4IHVA 1PP7U 1IRXA 3HIFA 2DTRA 4C3HJ 3GTGJ 2GWRA 1ZRFA 3C2BA 3OY9A 2BY2A 4F93B 1T6SA 5HDNA 1K78B 4KIGA 4EGZA 4OMZA 5LRRA 2K9SA 4B1RA 3HUGA 1S9HA 1K7AA 1EV7A 2E7XA 2NYXA 3RJPA 1ZARA 2JSCA 2M8GX 3SZGA 1CGPA 2RNGA 3PIPF 2ZCWA 4I01A 4KIBA 3OR2C 1UG0A 2V9VA 3V8LA 5LHHA 1YJ9I 2Z2SB 3HOUJ 1OYIA 4K2EA 4GCVA 1BC7C 2XVCA 1VQ8I 1STZA 2P5KA 1SFOJ 2LBFB 1I6HJ 2XB0X 1H8AC 5DM6F 1R5ID 2E60A 4U88A 2PQ8A 2R7SA 2VB6A 1ZGAA 1JHHA 5HLTA 1XD7A 3DEEA 2UUZA 3HSRA 4FQGA 3DXJF 1T08B 2COBA 2FBIA 3GFIA 3NWSA 2V79A 5ILVA 3B6CA 3HOSA 3CJTB 2R5YB 2XC7A 2CW0F 3KZIC 1YX3A 1HKQA 2E5NA 1R5HA 2LFBA 2O3FA 6PAXA 2M4KA 5B3SH 3PO2J 2EV5A 4M6YA 5M5YJ 5BS6A 2DMPA 4ETSA 3JCUC 3W2WA 4LITA 3CO6C 3PUBA 4B44A 3KYLA 1RRJA 1W7PA 3F9KA 5GTIC 3ECOA 3EUHC 1QO0D 3BQYA 2ZJPF 1OYYA 2AQFA 2DOEA 2HXIA 3ABUA 1UFMA 4UHTA 4CCOA 2P6TA 1T56A 3PUFA 1N77A 2IT0A 2M7BA 4O5VA 4CCNA 5J6XA 2GBYA 3RKQA 2HOTA 4C2UA 5L3DA 1Y1WJ 2D2WA 1T95A 5K1YA 1PYVA 1ENHA 3HPGA 2V6EA 1R58A 1P92A 4RGXA 1DP7P 1G3WA 3DKYA 4W1UA 4RB1A 2JQ7A 2DDAA 4ZC3A 5KCMA 1D0YA 2GZWA 2MBFA 3RTRA 3E5XA 4HLYA 1MBHA 3KCCA 3K1PA 1OPCA 1K79A 2J5OA 3IAS2 4MQVA 4OIOF 3K4BA 1J5YA 4A6DA 4H0EA 3HRMA 1B6AA 4XMYA 3ZRGA 3LSPA 3NARA 3G3ZA 3S15J 2O61A 2NVQJ 5CPRB 1IXSB 3KETA 2ETHA 2OZUA 1ORKA 3Q0VA 2E35A 3FBIB 4A69C 2W7NA 3SJMA 2A05A 5B66C 1MSEC 2ICWG 2PLYA 3I56I 1FIAA 3PNYA 2XAUA 3OYDA 3FMRA 1OMIA 1IN7A 4U87A 3RPQA 4FETA 3MD2A 2VOPA 2NS7A 2A68F 3FXJA 4XKVA 1QHHD 2QQ8A 3IWFA 4I09A 2VXZA 2Y48A 3KIOA 4S0HB 3QRFF 1U8BA 4KA4A 4LD5A 2DA3A 5GAEJ 4RAGA 3I0TA 3OYMA 4G7OF 4M3EA 2E1MC 2ZC2A 3ZMTA 2ELKA 4XLEA 1P6RA 2LR8A 1IC8A 4QLCU 3PNVA 3K6GA 2MA3A 3HGGA 3RIRA 3VSKA 5D5VB 4Y4RA 4A12A 1IF1A 3FX3A 4HZFA 3WTZA 2I5UA 2FBKA 3VFZA 2BV6A 2M30A 1GVJA 4NC7A 5DS9A 3CC2I 1MD0A 1D0ZA 3U21A 3BCBA 3RKWA 3HTSB 3TKYA 1LDJA 5ICGA 2CQNA 3LQRA 3LNQA 1LUJB 4HNVA 4KDPA 3V4GA 3OIOA 2V1XA 3WTTC 1F1ZA 2QYOA 2F6CA 1FMVA 2WV1A 3EDPA 2VL8A 3PM1A 3VWBA 5J8FA 2WADA 2DK5A 4IL6C 2XGDA 1WJEA 2K4BA 4I2OA 2JA7J 1ZKGA 1T33A 3A1YA 4OAZA 4HQEA 4XLPF 2VOOA 1HLVA 4QWQA 4A6EA 1B72B 4CZCA 1QRYA 2LG4A 2RNJA 2P5VA 1TNTA 1Z05A 4PUSA 4Y13A 2R5ZA 3BDDA 2JWTA 5FLMJ 4V19K 4D5CA 3B02A 4F91B 1K6YA 2KMUA 2QQ9A 2XKOA 3DLLF 2LSOA 1S29A 1TW2A 2VBWA 2P5LC 4BJ5C 4MIMA 3EPZA 3K4KA 2F4MB 3KP6A 2R7VA 2KT0A 1HW5A 4ZYEA 1VNDA 1APLC 2VE8A 1W5SA 5IT3A 1KQ0A 3E97A 1H9TA 4V2FA 1VQ6I 3H3ZA 1BW6A 4S05A 2FX0A 3E5UA 4II2A 4BACA 2ME6A 1CQTA 3C18A 3DWLE 3C1DA 4GXOA 3ZQLA 2H6BA 3LL7A 4O6JA 1SAUA 3OOPA 4MLOA 2L9NA 2VC0A 4AIHA 1TQIA 5K5RA 5TISC 3CCUI 3CCLI 2HQ5A 3OV8A 3TO7A 3BY6A 4MQ9F 3K70D 1YO5C 2LK2A 2DQRA 3IP4B 4Y3OA 3HOTA 2VC1A 3G6EI 1EA3A 2DTZA 2W24A 4M74A 2VBXA 4W97A 3HOZJ 3K10A 4JK1X 3QPTA 3WU0A 3DLAA 1S72I 2BXYA 2HKOA 2L9VA 2Z5UA 2Q2EA 3BPXA 4DJAA 3CUQA 3FXQA 4M3DA 2BHYA 1UMQA 1IV6A 3BZ6A 1X1PA 4AWXB 2UWMA 3KP4A 5DCMB 5J1RA 4X1EA 2FQ4A 5C4JJ 2VKEA 2LNBA 4I99C 2R7QA 2PBIA 3LSGA 4KFCA 1WSUA 4L5IA 2LOOA 3ELKA 3T0YA 3M9AA 1T2KA 4A3GJ 2PMUA 4KNYA 2YX7A 2EV6A 3ZMUA 1R49A 1J2XA 2F5DA 1C0WA 4N9IA 3ESWB 2BBYA 3CDIA 4E7KA 4N0BA 3V8KA 2W84A 4AUXA 1Q1VA 2Z16A 1B9MA 3OYIA 2EZLA 2EINH 4HW0A 3GXOA 1MNEA 1WJDA 4ZYDA 3V7CA 3I3LA 2QUFA 2LF7A 2KRFA 3TDZC 4EM2A 1E2XA 3TQNA 2W00A 4A0XA 4DW6A 3ROUA 1USSA 3M8EA 4ITVA 2AHQA 3IRRA 3GLLA 1WKMA 4BEHB 4PK4A 4YFXF 2VPRA 4M73A 2YS9A 4BDYA 3ZMZA 4GGGA 2RC4A 3D5LA 3PSFA 1BBYA 2HU9A 2L9SA 2ZXHA 3K2AA 4XORA 3WTWC 1Y0UA 3ZN1A 1T0FA 1Z21A 4IO9F 4LOCA 1S7EA 4B8XA 5F0CA 2R7DA 3HKZN 1UELB 4ZJZA 1ZTRA 4J01A 4HDUA 1EJ9A 3N05A 1X58A 2NVUB 2FMLA 1Z6TA 3V8JA 1VQNI 3ABMH 5TRDA 2VJIA 3QWLA 3IL2A 1SD4A 1K78A 1ZRCA 3CMMA 1W36C 4D9JA 4M3BA 3ZP5A 5GADJ 3OYBA 2XGCA 4AIKA 4KYWA 1WWXA 3DU5A 3WGGA 1HSTA 3K1NA 2X48A 4XSXF 1D5VA 4GYIA 4KMUX 2DT6A 3CUQC 2XAHA 4MHGA 1KU3A 3BC8A 1LPQA 2STWA 1E0EA 3FHZA 3MWMA 1W4MA 4RB3C 2ECCA 4A5NA 3OYKA 4FISA 4CHUA 1JKRC 1XGNA 2LBFA 3S1NJ 1T98A 1SC7A 1QNTA 3AG2H 4LLNA 3E6DA 3ML6A 2BEOA 3CCSI 1TT0A 4I98B 4QPOA 4YEJA 3S3OA 1A04A 4CA0A 2DYSH 4R8HA 2R5YA 3Q5FA 3KP2A 2PJRB 2R7RA 1MNMC 3T8TA 2QKMB 2CSOA 2IPQX 3IKTA 3GZNB 3H3VK 3Q9VA 3DPLC 1ZQ3P 2XGEA 3GZ5A 5HOOA 4XRMA 2HWVA 2IA1A 3RQ4A 3WTXC 2KISA 3FISA 1AOYA 2XV4S 3KEOA 2L7KA 4IQ4A 1JHFA 4BE2A 5GAHJ 2O03A 1E3OC 4BNCA 4HF0A 2YPRA 4BJTA 3QP6A 2K85A 2OAZA 1ZG5A 3P9CA 3L2RA 1JT0A 3ZR8X 4G12A 1SVLA 2DJNA 2NXNB 3MZYA 5D6EA 1VQMI 5AIQA 1LB2A 4KIFA 1XCBA 3L2UA 2WY7Q 1YI2I 1T0FC 3DTIA 4CO8A 1OISA 2IBDA 4PFPA 1JKQC 5HVQC 3DKXA 4E7HA 2KFDA 5J3LA 1KU7A 2DMTA 5LEJA 4AVZA 1R1VA 4ZZLA 2AO9A 3U1KA 2E19A 3ZQQA 3LSKA 3CCQI 4JX6A 3M1EA 1L0OC 5DEQA 1NK3P 1WI9A 4YFKF 2K4JA 5JVGF 5B1BH 5H6QA 2HS5A 3SXYA 3RPUD 2TRTA 2CU7A 4YG2F 4BQAA 2LF8A 5ED4A 4L0YB 3MCZA 1Q1HA 3ERED 5FLXZ 1DPRA 5FKMA 4ON0A 2RVCA 3HRTA 2IW5A 1RUOA 3WU2C 2DDBA 2LP0A 2V9PA 3OIQA 2XPUA 3BTLA 4IRIA 2QSHX 4MO7A 3BJAA 2RN7A 4RLFA 1FYLA 1BJZA 4XRFA 1V5FA 3GEZA 3TO9A 3K4LA 1IN5A 2OCCH 1BJAA 3LSJA 4HF2A 3QYBA 2OTJI 1X4PA 4HF1A 3UKGA 2IS1A 2HOAA 1DDNA 1BI2A 3GTPJ 2ISYA 5CQGA 1SD5A 2VKVA 1BR2A 1LDDA 2ZXIA 1WZ2A 3LAPA 2FQ3A 2XIGA 1Y39A 3FZVA 1OCZH 1XMXA 2XRNA 1TC3C 1WJCA 3S93A 2HTJA 1JTXA 4JP0A 4GRIA 3BJOA 3X2QH 5EZGA 2H94A 4FT8A 2XGXA 3VPRA 1LKXA 2PMHA 2DA5A 1OKRA 1LFPA 2EFNA 2OA4A 1ETWA 5CLSA 1GXQA 3R61A 2UXXA 1B72A 1O7FA 5CQEA 5J1YA 1VQ4I 1ZK8A 2HNHA 5CVIA 3AAFA 1K83J 1S7AA 2ISZA 1POGA 3FK7A 1LEAA 2ZNZA 3IKVA 1XDUA 3PSIA 4C2MJ 1FYMA 4PGHA 3MFKA 5E8GA 2ELHA 1IXCA 3ZXSA 5E17F 2KHMA 2WY8Q 5IP6A 1MKMA 4U7BA 4IOAF 2DBBA 2KZVA 3GTOJ 1PJRA 2WC2A 4HBLA 4ESBA 3K4CA 3QPSA 4PSXA 1SMYF 1R4NB 2EILH 3BLYA 2GOMA 2ESHA 3GW2A 2CV1A 2XAGA 1RC9A 1D8KA 3CLOA 3VYRB 3FKIJ 3IAM2 5HODA 1BI3A 2KDZA 2D45A 2CFXA 3EETA 1U2WA 5F04A 1T39A 3BT9A 5K5OA 2X85A 3SZTA 1JGSA 4EGYA 4FASD 4A3EJ 4IEJA 2NNYA 4AVPA 1XCVA 4JX4A 1D1CA 1WCMJ 4L5JA 2HOEA 1GVDA 3BR1A 4LIVA 1O3RA 5ERIA 2VBZA 2BE5F 4IRGA 3OS1A 1YIOA 2JZYA 5KVRA 3JSPA 2VN2A 3MN2A 4ZYHA 1QVUA 3BR2A 2GIZA 2PMZA 5IOZA 3DBLB 1V4RA 2LKPA 1O57A 1Z77A 2EZHA 3EQLF 4V2GA 1DUXC 3T5XA 9ANTA 4GYGA 2CH0A 1QZEA 2L5QA 4Y7NJ 2DJIA 1AKHB 2OF7A 2ZJ2A 3K9TA 4L9TA 3KEQA 3I5UA 2X1CA 2RKHA 2K5CA 2VI6A 3FM3A 1G3TA 4HRIA 1QGPA 4X6AJ 2VQGA 2X1DA 5DCMA 2A3SA 5J1UA 2R92J 3RKYA 2FF4A 3BROA 3E7LA 4E7IA 1B4AA 2H8WA 3FXKA 1A31A 3AKZA 2Y0SN 2R3SA 2HGCA 1GV2A 3MVPA 2LD5A 3CTAA 1MZBA 1MNDA 2OU2A 1ACIA 4G8XA 5GPCA 1X19A 3GTQJ 1U0JA 3E0JB 5FKNA 4AIJA 2DXIA 4XLFA 4CCLA 1BR1A 2ZMEB 4Q4ZF 4M6XA 2B63J 1KYWA 2PEXA 3HOXJ 5LLQA 1DGWY 2ECBA 2VODA 3TBIA 3G2BA 1D0XA 1I50J 3S14J 2FE3A 2E34A 2IGNA 5D4RA 4RB2C 3DTKA 4D0PA 1TTYA 2X0LA 3CMYA 2GAUA 5J8CA 4M3FA 1GUUA 2MH9A 4EV0A 3GYHX 4E4HA 1U3EM 3IH2A 4BEHA 4BGDA 5L3CA 1Z67A 2CS3A 2OQGA 2K40A 4BHCA 4ESJA 4NHJA 2EJRA 4A2UA 2E71A 1IZ1A 1PVEA 1G3SA 2CUZA 1V5GA 4BBRJ 2A6HF 1E3PA 1IGNA 4CYCB 2CW7A 4LGWA 4G6DA 1R4MB 2V4JC 2CMPA 4LB6B 4DYCA 5D6FA 1FP1D 5D5UB 1LQ1A 2E2JJ 2NRAC 4XR6A 2L4MA 4WX9A 2MGQA 5LGNA 1ZYRF 1GT0C 1ZG3A 5GP9A 4XIDA 3BG7A 2JUGA 3CDLA 1HQCA 3ZOBA 4QTRA 2IGKA 1L3LA 1FYKA 2IS6A 1YFHA 3GTLJ 3IUOA 4M6VA 5HDKA 2F48A 4M3GA 2QWWA 4DBRA 4ZZDA 1FEXA 3K70C 3AG3H 4FE7A 3OMYA 4O3MA 3GX4X 1IJWC 3BR5A 1D1AA 4M71A 3FXUA 2HFHA 2EIJH 1JT6A 3V7SA 3JRFA 4UVAA 5JLWA 4L9VA 4DZPA 1JUSA 1Z0XA 1SFKA 2E36A 2O8XA 2R7OA 3WU1B 1ZREA 3OYEA 2M7AA 2LY9A 5HS7A 4PJLA 4WCGA 4I0BA 4G6QA 4HX7A 2PJRA 4OIPF 3LA2A 3W6JB 2DK8A 4A3LJ 1YJWI 1ZG1A 2L2OA 1GLNA 3TW7A 5EGOB 2MFZA 4BYYA 1J9IA 4P9UA 2X6OA 1TWFJ 2XAFA 2Y75A 4LK1F 2VASA 2IA2A 4LLGF 1FIPA 3HEFA 4RMNA 4IHTA 4BE1A 2G7HA 2DFFA 2KL4A 2LH9A 2M87A 5M5XJ 2GOXB 4I02A 3RSNA 1UAAA 4B47A 5EF6A 4ESFA 4ZDPA 4YIRX 2KPMA 3GBGA 5DCFA 4WXHA 2BW3B 4HV5A 2OQRA 2OCEA 3BR6A 4M9ZA 1YRNB 1LFBA 5D8KB 2L0KA 2LY2A 3CF2A 3CLQA 3W6VA 2V1DA 1TWCJ 4Y15A 2R7TA 1YG2A 2Z33A 1D5YA 3H0GJ 3OSGA 3ABLH 2X1EA 2VJJA 4IZZA 3LQQA 2DU9A 3P9IA 4KICA 3KLNA 4I6ZA 1LVAA 5IYBJ 1KYZA 2KDOA 2CFOA 2K86A 2DT7B 2L7FP 3DEUA 4BXXJ 3WGHA 2BZTA 3DKWA 2KRCA 2OJED 3JRDA 3HC7A 3K0LA 4LB5A 1JE8A 2KJBA 3CESA 1HSJA 1ZAOA 2E5ZA 3GWZA 1YHQI 2O9LA 1GDTA 5IP7J 1KQ9A 5D8LB 3HOYJ 3TGNA 3HHHA 4FX0A 3GTJJ 4A0ZA 2W1OA 1R22A 4EEFG 2KIFA 3K4MA 2NOJB 4XK4A 3JRIA 1X4OA 1XGMA 2YUSA 1MGTA 1EF4A 2BGCA 3OYGA 1AHDP 3BQZA 2PMZN 1HC8A 3WHBA 2UXNA 3BCAA 3GTMJ 1R6RA 1LJ9A 1UB9A 5DDGA 1RR7A 1VQPI 3OR1C 2J5PA 1JUMA 2EZKA 2I10A 3AL0B 3QYEA 1NHAA 5IT9Z 4MNUA 1GV5A 4BHPA 2CG4A 2KZGA 2VJ5A 3QPLA 4F3QA 3KYDB 3OL4A 1UJ8A 2IGMA 1ZR2A 1FSEA 2EBIA 4BQNA 3VYUB 3D1NI 3J80K 4P96A 3LAJA 2E7WA 4EJWA 4PZJA 4DNCA 4OIQF 1KZHA 3MEXA 1IDYA 2V26A 5HS9A 4XKBA 2MD5A 2K7LA 4BHBA 1V5EA 3JRHA 3C3WA 2JA8J 1QZZA 3I54A 3WG9A 4U7DA 2COMA 3U1DA 4HQMA 2HQRA 4D1QA 3FXLA 2HI3A 3BG9A 4YIFA 5L3BA 5GTHC 2PN6A 4FTHA 3H5AA 2H09A 4ASNA 2E1NA 2K3PA 2CUJA 2DCEA 5JI6A 4C2TA 1ZELA 3K1MA 2XAQA 1Y8RB 4RB0A 5CVVA 5KAFC 5DV5A 2MW8A 3CZ6A 1MBFA 5J4YA 2R7UA 3ABKH 4WXCA 3GCMA 1FOWA 5FJ8J 2NNNA 1FOYA 3TOBA 5IP9J 3MKYB 4AM3A 3DCFA 2DYRH 3BTJA 4BAYA 5H20A 3Q3SA 1VQKI 5FLXK 4KISA 2IP2A 2HDWA 1MDMB 3D5RC 3TL4X 3NWTA 3H9JA 4ZTFA 2P7CB 5IYDJ 5AIPA 4DBQA 1G59A 3A02A 4P5OA 1MH3A 2CUEA 2L7ZA 2V1NA 1BIAA 2EFOA 4XN0A 3SYTA 1OQYA 1FJLA 1X3ZB 1WH7A 1F9NA 2VT3A 2P4WA 4OU0A 3HJEA 3E6BA 3QOPA 5J4VA 2VQCA 3GVAA 2KLOA 1RZ4A 3LWFA 1W5TA 2OV7A 3MMYB 1K4SA 3QP5A 1QA6A 1IRZA 3MKZA 5FGMA 2XF7A 1TWHJ 1XC5A 1FTTA 1TZLA 4YELA 3GTKJ 4HNTA 2VT2A 5HDGA 2MC3A 4WWCA 4RBOA 1AKHA 1LEBA 2LKSA 1B9NA 1RKTA 5LGTA 3ZN0A 3DPUA 1XS9A 5E3NA 2EK5A 1BM9A 2CWEA 1RI7A 4FX4A 4NC6A 4UUTA 1XDSA 5FB2A 2P6SA 3QYFA 3KX2A 2YX4A 3I4PA 2VLAA 5E3LA 2CW8A 3DTEA 3U2RA 2QSFX 1LNWA 4BUPA 4HLXA 5E79C 4HDVA 2FJ1A 2RAEA 5FFZA 4RLQA 2R0QC 3R4KA 1ZRDA 1TLHB 1QPIA 1FX7A 1N78A 2HQAA 4DQ2A 2EIMH 2ZMEA 4G6TB 4P9FA 4A0YA 1VI0A 3DEWA 3BR3A 2VPLA 3WTYC 2HYFA 3BWGA 1IN6A 5ICFA 4P55A 1NG7A 2H6CA 1F4KA 3CMAI 3GUDA 1YTYA 1FWZA 3S2WA 2FU4A 3L7WA 1DU6A 4FHTA 2F5CA 2KRHA 2OD5A 1MMGA 2RREA 3TO6A 4G7ZF 3SFZA 5A2QZ 2C6YA 1J7KA 1MBJA 1RIOH 2H27A 3CCYA 3B73A 2XB5A 5C44J 3SHFA 2M1BA 2A5YB 1TL8A 3JRBA 2MD0A 3GFJA 4ZTJA 2GM4A 3W3CA 4EQQA 1Z91A 2M8EA 5K7HA 2GLOA 1I27A 1VQ5I 2IEKA 1FC3A 4D5FA 3OYNA 2ZJRF 5FLVA 1TT5B 4C9YA 2HPIA 4CYCA 3VODA 2DOAA 2HYJA 2B7EA 2LKXA 3JW4A 2IGOA 1H0MA 2EFWA 5E1XA 2VKDA 5BPIA 3HYIA 3KLOA 3J81Z 4IX7A 1G3YA 3CDHA 2F5EA 2WAFA 2DMUA 1VQ9I 4L9JA 1U8RA 1K4TA 1Y0NA 4KN7X 4EJOA 2HXOA 4MGRA 4ZYAA 2O6GE 3CD6I 4KITB 1OCTC 2VQLA 4ZDOA 3F8BA 4IPAA 2FMYA 2Y69H 2W85A 3GFLA 4YIIA 3SEZA 4DYQA 1QU3A 1HOMA 1D8JA 3VYTB 2BY0A 4Y33A 1ETXA 1YX5A 3F8MA 1AA7A 3E3VA 3IHUA 3W2VA 3FXMA 2BVLA 2XKPA 3GMEA 2XROA 2PJPA 1R23A 2Y31A 5CKTA 3DV8A 4H4KC 1R1TA 2M2EA 2Z99A 4BDZA 1J75A 2AS5F 2XF5A 2DA6A 2XRLA 1RNLA 4ANJA 4UUSA 1NTCA 5B5EC 1BR4A 1SD6A 2X6YA 4E7ZA 3KYCB 3J80Z 1JJ8C 2OTLI 1BW5A 3ZMDA 1REPC 2OZ6A 1QVTA 1FMWA 4Q47A 4RM3A 2BOLA 2NVTJ 3WTUC 5IPAA 1S7OA 3QODA 1WJFA 2IXSA 2V7FA 3MKLA 1I3AA 1X3WB 3E6CC 2DA7A 5CVRA 5C3EJ 2MH2A 2CQXA 3FIWA 1YW8A 2ZMEC 2ZO4A 1JTYA 2D1VA 2X6XA 3WE2A 5EGOA 2MC4A 3UNGC 2LMDA 4D7MA 2K9QA 1ZLJA 3Q0WA 5DD4A 3SDGA 3P7NA 1QPMA 1OCOH 1ONVA 3S2DJ 2WB1A 3HG9A 4NNJA 4MTDA 3N4MA 1R5GA 3K4JA 1YJNI 3H9QA 5FO5A 1RR8C 1ON1A 4PCQA 1WGXA 2E2HJ 4NUBA 2E2IJ 4M9SA 5BMZA 2BW3A 3CP8A 4MEYF 1YRNA 2F4IA 2Y0MA 4KN4X 2M0MA 2WWYA 2KIMA 3CO7C 1XG1A 1JKPC 4HEA2 1OR7A 1NG6A 4HSTA 1XSXA 1QQIA 3RQIA 3F21A 1IO2A 3CC7I 3ZQGA 3S1QJ 2EZIA 5BPDA 1P4WA 1H9GA 4PJ0C 1ZR4A 2KJCA 1FLIA 3JR9A 1U5TB 5DM7F 1ZH5A 1J09A 1KONA 1PP8F 1MW7A 3SDBA 1HKTA 4L0ZB 3L00A 5IOYA 5LFAA 2Q0OA 3J7AO 4OIRF 2FA5A 4XNFA 2NVYJ 2CUFA 4LIUA 3WE3A 4OMYA 3FXRA 1EH8A 3PO3J 3ISPA 5LHGA 4ZDLA 2JA5J 4I7HA 3EUAA 1EH6A 4RGSA 1YYVA 5FKKA 5BNGA 5TJJA 1E3HA 5F0FA 4EJUA 1G8XA 3FM5A 1S6LA 3RDIA 2K02A 4OAYA 2M34A 1WPKA 3DPTA 3K2ZA 2VJ4A 4L9NA 1SD7A 2K27A 2HEOA 1I1GA 1WI3A 3F8FA 3C2GA 3I59B 1P2FA 5HLIA 1GHCA 2JT1A 1P7IA 1IG7A 3M8JA 4XKCA 5E20A 2VIXA 3H0DA 4GDFA 4JQFA 3GF2A 2X51A 3F6OA 3LFUA 1XMKA 3OYFA 3BPVA 3WG7H 1LDKB 3AG1H 1W36D 5JHUA 4II3A 2V1UA 4WXDA 3JTHA 2CQKA 4ENKA 1B8IB 3AFHA 4UVBA 2ZKZA 2OC6A 3BZKA 3WODF 4IF4A 4XLCA 4PJNA 5GPAA 2O0YA 2JA2A 4A3IJ 1ZGWA 3HRSA 3KE2A 2ADUA 1R36A 5ILSA 2GA2A 5KHDA 1E17A 3H36A 3FF5A 2Z1DA 4UV8A 2BHZA 3JSOA 2MABA 1VQLI 5EEHA 4CCKA 1OR7C 4MTEA 1IDZA 3NAUA 2BY3A 2HZDA 3PFYA 4NB5A 4A3FJ 4CUGA 3TW6A 2Z9OA 3IH3A 4CXFA 5BQTA 3D5SC 2YU3A 4HV6A 3JAMZ 1KQ8A 1OCRH 2DMNA 2XAJA 4AYBA 4A3MJ 1K6OA 2MLGA 1YITI 4PFOA 2R7WA 2EPFA 5JLXA 4RAFA 3OYAA 2WAEA 2TCTA 4PJJA 3MZHA 2HKXA 3M8FA 1Z3XA 3I53A 4XN3A 1UZCA 3LSRA 4XQFA 1MJBA 2V9KA 4WK8F 2LRDA 4X0GA 1BOAA 2EIKH 2F2EA 2I8DA 2L01A 2RV8A 4PSWA 1V55H 5E8IA 5DTDA 4U0VA 3AG4H 3L09A 2ZBKA 1FZPB 2NS8A 5ILUA 4Y52J 2R4GA 1MDMA 2ACJA 3H9GA 1M1EB 4Z2YA 2HVRA 4JX5A 2EQRA 5FKOA 3ASOH 1FNNA 2WBMA 1S5LC 2JK3A 4U0WA 4IQJA 1UHWA 4A3BJ 4MFDA 4UNOA 1JUPA 4XRSG 1ODDA 4UUVA 5IT9K 2XPWA 3HGYA 3ZQCA 4IHWA 3I4MJ 3IRQA 1Z7UA 3GLXA 1ETVA 1OYWA 3AL0C 2IRFG 3CCVI 1WHUA 2A6EF 2NOGA 3H5RA 4BU2A 2JVHA 3FKJA 4KT5C 1A6QA 2FNAA 3J7ZI 1SFUA 1NK2P 2XUBA 1I6XA 3VYSB 3N97A 2QGUA 1W0UA 2JMWA 3MKWB 1HXDA 4CICA 1P4AA 2AXLA 5E18F 1LFUP 4ABZA 3HSFA 2DQLA 3DBHB 2DMQA 2FNPA 3HHGA 3OYJA 2ZFUA 3CF5F 3PIOF 1YLFA 4FE4A 2QBYB 4NBQA 3ZPLA 1VQOI 2KP6A 4BS9A 2W82A 3I4NJ 3ONQA 3CMEI 4QSHA 2E1CA 2Z3YA 4HPQA 2EV0A 3ZGKA 5HLHA 3I71A 1SEUA 3HTUA 2E1OA 1PUFB 2ID3A 3VOEA 2BY1A 4XLHA 2WB1N 1IN8A 1EH7A 2IJLA 3V7RA 2M5WA 1K61A 3I55I 3OYCA 1WRJA 3PQKA 2HYGD 1B59A 1SAXA 4WF2A 1O3SA 4BJ6C 1TW3A 3OYLA 1RESA 2XDVA 1BIBA 3WGIA 3C7JA 5JFRA 1ETOA 2HQNA 2X9DA 2GQQA 2X4HA 5EG0B 5LD2C 2DT5A 2MG4A 2PFBA 1JI8A 3HOWJ 1VFCA 2YU9J 4OOIA 3A0BC 4FCYA 4UUSB 1RUNA 5F6FA 1Y8QB 4MFEA 2A61A 1XMAA 3BP8A 3RI4A 1YIJI 4L18B 2JUCA 4BXUA 5E1WA 2D5VA 3TP3A 2L4AA 3CCEI 1HCRA 3W2AA 4KUMA 1MMAA 3KFWX 2V6CA 1I1SA 1X2MA 2XPVA 1F43A 4F52A 3CQZJ 5IYCJ 2LYCA 1I3QJ 4AD9A 3QQAA 3F8CA 2G0EA 2VXDA 1HA8A 3ZQFA 2LREA 5DYMA 2VE9A 1UHMA 2M0CA 5K7FA 2G9WA 4GO1A 2OPTA 2W4SA 1DGRM 4C3JJ 4XICA 3G73A 3KPHA 1MSFC 4AU7A 3OS0A 1SANA 3A03A 4IJAA 4EM1A 1LVKA 2JA6J 4CCMA 2EWNA 3O8GA 4B4CA 2QQBA 3LMMA 3H5NA 2CJJA 4S04A 2VONA 4E70A 3HKZA 2PI0A 4B48A 2IAIA 4IXAA 2FOKA 4QPQA 3OOUA 4BQOA 2KKOA 3V42A 3QU6A 2ZSIB 1V3FA 4Q48A 4HOBA 3WTSC 1QHGA 2VUMJ 1YW7A 2QVOA 3RZOJ 2L9RA 5A2QK 3HSEA 1YQAA 3L9FA 1AWCA 1KU9A 1HDDC 5ICEA 4KT6A 5H2FC 1RETA 2GXAA 4EATA 1LE8B 2Q8KA 1D1BA 5FKLA 3M4OJ 4RDUA 2EA2A 2LY1A 3VB2A 1HBXG 4DZJA 3M7GA 4EJVA 1VF9A 5HLGA 3M1CA 3PJRA 4CDGA 4Z6YA 2CRGA 4BL0B 3TOAA 1TQPA 3HRUA 4TV7A 5CVUA 3J81K 3A4CA 2VBYA 4AYBN 2R7ZJ 3KZYA 3I64A 2EB7A 2R7FA 2EH3A 4B43A 3DU6A 1MMNA 4PDKA 3G4SI 1MH4A 3NQOA 1U5TA 3JTGA 5FFXA 1ZLKA 4LFUA 2GIVA 4BY7J 1VZ0A 4M72A 2LTPA 2NS0A 4IVNA 5LEKA 3WHCA 4IKFA 1IW7F 3RPUA 3KZZA 1H89C 3Q9SA 4XSZF 3CC4I 5L3GA 3E5QA 2W25A 2L3DA 4I76A 3VSLA 1WQ2A 4NQWB 2IVMA 2G7UA 2L54A 2BYVE 2QZ8A 2HVSA 3H92A 4XOTA 2DI3A 1KU2A 3PFIA 4BKXA 1ULYA 3KP7A 5HS8A 1PUEE 2M3AA 3ASNH 5EEGA 1OFCX 3O6BB 1R1UA 2R93J 4UB6C 1FP2A 4Y17A 1IN4A 1Y1VJ 2QENA 1XSVA 2H1LA 5LHIA 4A3KJ 3Q0UA 4XBFA 3I59A 1R00A 4NDLA 3COAC 2STTA 3S3NA 4UV9A 2XF6A 2KIUA 3CCJI 2GXBA 3BG6A 1EKEA 3A01A 4LG3A 1HDPA 2H1KA 2DA4A 1BI1A 3DF8A 1N25A 3IC7A 3S1RJ 2ZB9A 1FY7A 2DN0A 5F1RA 1MBEA 3ULQB 1XGOA 2DFIA 4XL9A 5L3FA 5EYRA 1P9QC 1JJ6C 3S16J 3G1LA 2DOFA 2KIQA 2FRHA 3CP2A 5LBQA 1CF7B 4CYDA 5F64A 3RZDJ 2LDUA 4OWRB 2Y9ZA 5D4SA 1B8IA 2FOWA 2F4OB 5FD5A 5M3MJ 3W6KB 1SFEA 2EA4A 2JVGA 1KGSA 4A5MA 2L02A 3UR3C 1IRGA 1WJAA 1TWGJ 3BG3A 3BOQA 4HNUA 1USTA 2XHKA 3H1CA 3J7YJ 3QU3A 4AIDA 3BR0A 3CUOA 5KAIC 1G4DA 2DO7A 5CJ9A 1YE9A 3H35A 3JRGA 3DP7A 3RKXA 4BH9A 3S2HJ 4UY8I 4G9YA 2DFEA 5HNHA 4R79A 1NH3A 2ZSHB 2LLKA 3L2QA 2XASA 1AU7A 4A93J 4YFNF 1U5TC 1U9NA 1ZGJA 3PL8A 4IHYA 2JPBA 2VKHA 4E7LA 1B1BA 4XLAA 2HDCA 2DFHA 3ABTA 4HSRA 4EJTA 1FBUA 2DW4A 3TMOA 5D5WB 1IRFA 3HOVJ 2R7XA 2HZTA 4NC8A 3ZMSA 1TQMA 2O8KA 3QOEA 2RGVA 1SFXA 5F1JA 2HR3A 3HXLA 1FBSA 1RKWA 3FMQA 4LG0B 3T1BA 2LVSA 5LRSA 1ERDA 3BTIA 3ZMVA 4PJMA 1F5TA 3I9V2 4EM0B 2Y2ZA 2ZJQF 2CV0A 4QIWN 2UZKA 5J47A 2ZXJA 1RPWA 5F08A 1HW1A 2AXTC 4CH7A 5LGUA 1SMTA 2HDDA 1KA8A 5HNFA 3LA7A 2Q1ZB 3A0HC 1VTNC 3BJ6A 5D5XB 3OSFA 1MMSA 1N75A 4RA2A 5ICCA 3FBNB 1UCRA 3HUGB 4N9HA 5E3OA 1X1DA 5E1ZB 2W48A 2DA2A 3TP0A 3H3UA 3TEDA 1A5JA 4BBSJ 4M9XA 1G6NA 2QF7A 3MQ0A 2P7VB 2HPMA 1ETKA 2DPUA 4DOZA 1BI0A 2AQEA 4HX8A 1MJAA 4CGZA 1Z6RA 1Z3YA 1Z9CA 3FMSA 1W7PD 2K3FA 5F0HA 3LSTA 2JN6A 3I58A 2A5WA 4XKWA 4GFBA 4HYEA 1WVRA 2E1MB 1ZHFA 3B6AA 2QBYA 1UHSA 4C3IJ 5FD6A 3L2WA 2RQQA 3KP3A
chains in the Genus database with same CATH topology
2BZTA 1UJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZT A;  1UJ8 A; 
#chains in the Genus database with same CATH topology
 5E3M A;  1T38 A;  3R6S A;  1OCC H;  1V54 H;  1W5C C;  2WAQ A;  4RGU A;  2K9M A;  3JAM K;  5EEA A;  4R1H A;  1PUF A;  3HDD A;  2CQQ A;  3SQN A;  1W7P B;  2BXZ A;  4G94 A;  2QCO A;  2RQP A;  3K69 A;  4BXF A;  2D1H A;  5DD8 A;  1T8I A;  2TDX A;  1G2H A;  2FUG 2;  1ZN2 A;  4E7J A;  3MZ8 A;  1OJL A;  2M9H A;  3JRE A;  3HPH A;  3SEQ A;  3O2P E;  5M5W J;  2BVM A;  5EZH A;  1FTZ A;  3L2C A;  4HA8 A;  2P0W A;  2CV2 A;  3S8P A;  3ZQH A;  4BQQ A;  5K5Q A;  1DQU A;  3D0S A;  2EFP A;  1WJ5 A;  2FSW A;  3OWT A;  1F36 A;  1Z7L A;  1MJ9 A;  3REO A;  1TP4 A;  2A07 F;  5FRM A;  4IOC F;  1WJB A;  5EG0 A;  2DA1 A;  2WTE A;  2MSY A;  1XB4 A;  1I39 A;  2GXG A;  1X1C A;  1FPQ A;  5TGT A;  1XTA A;  2JJ7 A;  3R60 A;  3ZQI A;  1D3Y A;  2Y0S A;  3F22 A;  3OL3 A;  2ESN A;  2KQR A;  5J40 A;  1U6G A;  2OBP A;  1DP3 A;  2GA1 A;  3MAJ A;  2Y9Y A;  3R0J A;  4ZYG A;  1U9O A;  3F8N A;  3DBR B;  1MIJ A;  1UG2 A;  5DUK A;  2M45 A;  1X1A A;  2DOD A;  2X6W A;  5JVT A;  1IUY A;  1BA5 A;  3P5J A;  3FHN A;  2QEX I;  1XN7 A;  3F72 A;  3O3K A;  1HKS A;  1U78 A;  1FSH A;  3OYH A;  3CJR B;  5B1A H;  2NVX J;  1DPU A;  5BOX A;  3EYI A;  4EMS A;  2YSR A;  1Z1D A;  3J7A Y;  2O7O A;  2FEZ A;  3KP5 A;  1SVO A;  1MBK A;  1BOB A;  3G71 I;  5GAG J;  1FOX A;  4MEX F;  3FK6 A;  3EYY A;  4DIQ A;  3S1M J;  1JGG A;  1VQ7 I;  1X1B A;  1BN5 A;  4PGG A;  4XLN F;  2JSP A;  1GXP A;  1DU0 A;  2CGP A;  1XGS A;  2A6T A;  2F5F A;  5F27 A;  4J00 A;  2VQH A;  3QAH A;  2CO5 A;  1A35 A;  4RGR A;  3LSM A;  3A2K A;  1TWA J;  5FRO A;  3T8R A;  4UB8 C;  1X2N A;  2DLL A;  2P81 A;  3VEP A;  1XSD A;  3PNT A;  4ZH4 F;  2N8G A;  3LSH A;  4L5E A;  4HAM A;  2JRM A;  4CZZ A;  1I5Z A;  4U0Y A;  2QLZ A;  4BE0 A;  1YS7 A;  1FT9 A;  3O8H A;  2L7M P;  1O7L A;  4IHS A;  1IAW A;  1TNS A;  1ITY A;  1ON2 A;  2NAZ A;  1WH5 A;  1IV8 A;  3BG5 A;  5JR3 A;  3SZP A;  3RCO A;  3TDU C;  1QBJ A;  1LE8 A;  1J59 A;  1Y56 A;  2WA0 A;  3LFK A;  3GZ6 A;  5EJC A;  4C30 A;  2ZFW A;  2QM3 A;  2QQA A;  3LSI A;  3ZQ7 A;  3LOC A;  4J19 A;  1JXS A;  1OCP A;  4ENN A;  3M07 A;  3L1P A;  3R0A A;  4DYR A;  4LLL A;  2R5Z B;  3PQJ A;  2PG4 A;  1YS6 A;  3FWE A;  3G1M A;  3HL2 A;  4A3C J;  1R71 A;  3NEU A;  4N4O B;  3M3Y J;  2YR2 A;  3RYR A;  4RS8 A;  4BY1 J;  4YRV A;  2CYY A;  4XON A;  2FBH A;  3A01 B;  1PDN C;  3DQV C;  3U9G A;  3NRV A;  4B3X A;  1XX5 A;  1IXR C;  1BC8 C;  4UVC A;  2JPC A;  2RDP A;  5H6R A;  1MBG A;  2P8T A;  2QKL B;  3HZJ A;  4LK0 F;  4NQW A;  1FOK A;  1Y6I A;  3IH4 A;  4G7H F;  1XPX A;  4E7S A;  3ERM A;  4LJZ F;  3ZCO A;  4N4N B;  2ELJ A;  2H8R A;  2F5V A;  4UXN A;  4B3A A;  3S17 J;  3HM5 A;  5JHF A;  1SVM A;  2ME0 A;  3G1O A;  2B0L A;  5CVJ A;  4RAZ A;  4CSW A;  2MLK A;  1IUF A;  3KEY A;  1YW9 A;  5C4X J;  3VDX A;  3RYP A;  1ETY A;  1QZY A;  1TBX A;  4A3J J;  1HW2 A;  3EUK L;  1O4X A;  5AON A;  4ENM A;  4E6K G;  1YOV B;  4XOP A;  1O3Q A;  2IA0 A;  4AC0 A;  4F55 A;  3HBL A;  4LMY A;  2M4G A;  2OUM A;  2QSG X;  2UV1 A;  3CJN A;  3OIP A;  2JRT A;  1H88 C;  2Q2E B;  2EFQ A;  3OS2 A;  2FD5 A;  3CUQ B;  5CYV A;  4HG2 A;  3F23 A;  4ENJ A;  1CF7 A;  3IWZ A;  1P7J A;  2LC2 A;  5KNL A;  4CCJ A;  2K9L A;  1BL0 A;  3BTC A;  2WV0 A;  1WFX A;  2HOS A;  3GFM A;  4A3D J;  3ECH A;  2HVQ A;  5DUI A;  4P1W A;  3QPH A;  3FXO A;  3P9K A;  1OLT A;  2W57 A;  4XM3 A;  3BZC A;  2FXA A;  3S32 A;  4D7N A;  2PX9 A;  4KMF A;  2WAQ N;  2ZNY A;  4B09 A;  4IHX A;  2K9N A;  3E6M A;  3JRA A;  2DAO A;  1S3J A;  2CQ7 A;  2DPD A;  3CCR I;  3CJQ B;  3GO5 A;  5FRN A;  2IS2 A;  1MMD A;  3L2V A;  2JTV A;  3F6V A;  4JOM A;  3IV5 A;  3C2H A;  4XRS A;  4RAY A;  1P4X A;  3LA3 A;  4OIN F;  1JKO C;  3EUH A;  1W1W E;  3CCM I;  3HB9 A;  4JBA A;  4Q5S F;  5EDN A;  1O3T A;  1ETQ A;  5K7Z A;  3F3X A;  3K4N A;  4JYK A;  3F0C A;  2QA4 I;  3K7A J;  4HX4 A;  5L3E A;  3FDY A;  3JRC A;  2O5R A;  2XSD C;  3S3M A;  3E1S A;  4RM2 A;  2XSJ C;  1HF0 A;  2Y30 A;  2MYS A;  2ID6 A;  4DGW B;  1J0R A;  1W0T A;  2IS4 A;  4EVI A;  1R7J A;  1S8N A;  1X3U A;  4F92 B;  2B9S A;  4LG0 A;  4F7Z A;  5KK1 A;  4I0A A;  3WTV C;  2HTS A;  1FBQ A;  2A69 F;  1R9T J;  3SFI A;  5M3F J;  1A36 A;  1A6I A;  3DFG A;  2ZXW H;  5IY5 H;  4IRH A;  4KJZ A;  4IHV A;  1PP7 U;  1IRX A;  3HIF A;  2DTR A;  4C3H J;  3GTG J;  2GWR A;  1ZRF A;  3C2B A;  3OY9 A;  2BY2 A;  4F93 B;  1T6S A;  5HDN A;  1K78 B;  4KIG A;  4EGZ A;  4OMZ A;  5LRR A;  2K9S A;  4B1R A;  3HUG A;  1S9H A;  1K7A A;  1EV7 A;  2E7X A;  2NYX A;  3RJP A;  1ZAR A;  2JSC A;  2M8G X;  3SZG A;  1CGP A;  2RNG A;  3PIP F;  2ZCW A;  4I01 A;  4KIB A;  3OR2 C;  1UG0 A;  2V9V A;  3V8L A;  5LHH A;  1YJ9 I;  2Z2S B;  3HOU J;  1OYI A;  4K2E A;  4GCV A;  1BC7 C;  2XVC A;  1VQ8 I;  1STZ A;  2P5K A;  1SFO J;  2LBF B;  1I6H J;  2XB0 X;  1H8A C;  5DM6 F;  1R5I D;  2E60 A;  4U88 A;  2PQ8 A;  2R7S A;  2VB6 A;  1ZGA A;  1JHH A;  5HLT A;  1XD7 A;  3DEE A;  2UUZ A;  3HSR A;  4FQG A;  3DXJ F;  1T08 B;  2COB A;  2FBI A;  3GFI A;  3NWS A;  2V79 A;  5ILV A;  3B6C A;  3HOS A;  3CJT B;  2R5Y B;  2XC7 A;  2CW0 F;  3KZI C;  1YX3 A;  1HKQ A;  2E5N A;  1R5H A;  2LFB A;  2O3F A;  6PAX A;  2M4K A;  5B3S H;  3PO2 J;  2EV5 A;  4M6Y A;  5M5Y J;  5BS6 A;  2DMP A;  4ETS A;  3JCU C;  3W2W A;  4LIT A;  3CO6 C;  3PUB A;  4B44 A;  3KYL A;  1RRJ A;  1W7P A;  3F9K A;  5GTI C;  3ECO A;  3EUH C;  1QO0 D;  3BQY A;  2ZJP F;  1OYY A;  2AQF A;  2DOE A;  2HXI A;  3ABU A;  1UFM A;  4UHT A;  4CCO A;  2P6T A;  1T56 A;  3PUF A;  1N77 A;  2IT0 A;  2M7B A;  4O5V A;  4CCN A;  5J6X A;  2GBY A;  3RKQ A;  2HOT A;  4C2U A;  5L3D A;  1Y1W J;  2D2W A;  1T95 A;  5K1Y A;  1PYV A;  1ENH A;  3HPG A;  2V6E A;  1R58 A;  1P92 A;  4RGX A;  1DP7 P;  1G3W A;  3DKY A;  4W1U A;  4RB1 A;  2JQ7 A;  2DDA A;  4ZC3 A;  5KCM A;  1D0Y A;  2GZW A;  2MBF A;  3RTR A;  3E5X A;  4HLY A;  1MBH A;  3KCC A;  3K1P A;  1OPC A;  1K79 A;  2J5O A;  3IAS 2;  4MQV A;  4OIO F;  3K4B A;  1J5Y A;  4A6D A;  4H0E A;  3HRM A;  1B6A A;  4XMY A;  3ZRG A;  3LSP A;  3NAR A;  3G3Z A;  3S15 J;  2O61 A;  2NVQ J;  5CPR B;  1IXS B;  3KET A;  2ETH A;  2OZU A;  1ORK A;  3Q0V A;  2E35 A;  3FBI B;  4A69 C;  2W7N A;  3SJM A;  2A05 A;  5B66 C;  1MSE C;  2ICW G;  2PLY A;  3I56 I;  1FIA A;  3PNY A;  2XAU A;  3OYD A;  3FMR A;  1OMI A;  1IN7 A;  4U87 A;  3RPQ A;  4FET A;  3MD2 A;  2VOP A;  2NS7 A;  2A68 F;  3FXJ A;  4XKV A;  1QHH D;  2QQ8 A;  3IWF A;  4I09 A;  2VXZ A;  2Y48 A;  3KIO A;  4S0H B;  3QRF F;  1U8B A;  4KA4 A;  4LD5 A;  2DA3 A;  5GAE J;  4RAG A;  3I0T A;  3OYM A;  4G7O F;  4M3E A;  2E1M C;  2ZC2 A;  3ZMT A;  2ELK A;  4XLE A;  1P6R A;  2LR8 A;  1IC8 A;  4QLC U;  3PNV A;  3K6G A;  2MA3 A;  3HGG A;  3RIR A;  3VSK A;  5D5V B;  4Y4R A;  4A12 A;  1IF1 A;  3FX3 A;  4HZF A;  3WTZ A;  2I5U A;  2FBK A;  3VFZ A;  2BV6 A;  2M30 A;  1GVJ A;  4NC7 A;  5DS9 A;  3CC2 I;  1MD0 A;  1D0Z A;  3U21 A;  3BCB A;  3RKW A;  3HTS B;  3TKY A;  1LDJ A;  5ICG A;  2CQN A;  3LQR A;  3LNQ A;  1LUJ B;  4HNV A;  4KDP A;  3V4G A;  3OIO A;  2V1X A;  3WTT C;  1F1Z A;  2QYO A;  2F6C A;  1FMV A;  2WV1 A;  3EDP A;  2VL8 A;  3PM1 A;  3VWB A;  5J8F A;  2WAD A;  2DK5 A;  4IL6 C;  2XGD A;  1WJE A;  2K4B A;  4I2O A;  2JA7 J;  1ZKG A;  1T33 A;  3A1Y A;  4OAZ A;  4HQE A;  4XLP F;  2VOO A;  1HLV A;  4QWQ A;  4A6E A;  1B72 B;  4CZC A;  1QRY A;  2LG4 A;  2RNJ A;  2P5V A;  1TNT A;  1Z05 A;  4PUS A;  4Y13 A;  2R5Z A;  3BDD A;  2JWT A;  5FLM J;  4V19 K;  4D5C A;  3B02 A;  4F91 B;  1K6Y A;  2KMU A;  2QQ9 A;  2XKO A;  3DLL F;  2LSO A;  1S29 A;  1TW2 A;  2VBW A;  2P5L C;  4BJ5 C;  4MIM A;  3EPZ A;  3K4K A;  2F4M B;  3KP6 A;  2R7V A;  2KT0 A;  1HW5 A;  4ZYE A;  1VND A;  1APL C;  2VE8 A;  1W5S A;  5IT3 A;  1KQ0 A;  3E97 A;  1H9T A;  4V2F A;  1VQ6 I;  3H3Z A;  1BW6 A;  4S05 A;  2FX0 A;  3E5U A;  4II2 A;  4BAC A;  2ME6 A;  1CQT A;  3C18 A;  3DWL E;  3C1D A;  4GXO A;  3ZQL A;  2H6B A;  3LL7 A;  4O6J A;  1SAU A;  3OOP A;  4MLO A;  2L9N A;  2VC0 A;  4AIH A;  1TQI A;  5K5R A;  5TIS C;  3CCU I;  3CCL I;  2HQ5 A;  3OV8 A;  3TO7 A;  3BY6 A;  4MQ9 F;  3K70 D;  1YO5 C;  2LK2 A;  2DQR A;  3IP4 B;  4Y3O A;  3HOT A;  2VC1 A;  3G6E I;  1EA3 A;  2DTZ A;  2W24 A;  4M74 A;  2VBX A;  4W97 A;  3HOZ J;  3K10 A;  4JK1 X;  3QPT A;  3WU0 A;  3DLA A;  1S72 I;  2BXY A;  2HKO A;  2L9V A;  2Z5U A;  2Q2E A;  3BPX A;  4DJA A;  3CUQ A;  3FXQ A;  4M3D A;  2BHY A;  1UMQ A;  1IV6 A;  3BZ6 A;  1X1P A;  4AWX B;  2UWM A;  3KP4 A;  5DCM B;  5J1R A;  4X1E A;  2FQ4 A;  5C4J J;  2VKE A;  2LNB A;  4I99 C;  2R7Q A;  2PBI A;  3LSG A;  4KFC A;  1WSU A;  4L5I A;  2LOO A;  3ELK A;  3T0Y A;  3M9A A;  1T2K A;  4A3G J;  2PMU A;  4KNY A;  2YX7 A;  2EV6 A;  3ZMU A;  1R49 A;  1J2X A;  2F5D A;  1C0W A;  4N9I A;  3ESW B;  2BBY A;  3CDI A;  4E7K A;  4N0B A;  3V8K A;  2W84 A;  4AUX A;  1Q1V A;  2Z16 A;  1B9M A;  3OYI A;  2EZL A;  2EIN H;  4HW0 A;  3GXO A;  1MNE A;  1WJD A;  4ZYD A;  3V7C A;  3I3L A;  2QUF A;  2LF7 A;  2KRF A;  3TDZ C;  4EM2 A;  1E2X A;  3TQN A;  2W00 A;  4A0X A;  4DW6 A;  3ROU A;  1USS A;  3M8E A;  4ITV A;  2AHQ A;  3IRR A;  3GLL A;  1WKM A;  4BEH B;  4PK4 A;  4YFX F;  2VPR A;  4M73 A;  2YS9 A;  4BDY A;  3ZMZ A;  4GGG A;  2RC4 A;  3D5L A;  3PSF A;  1BBY A;  2HU9 A;  2L9S A;  2ZXH A;  3K2A A;  4XOR A;  3WTW C;  1Y0U A;  3ZN1 A;  1T0F A;  1Z21 A;  4IO9 F;  4LOC A;  1S7E A;  4B8X A;  5F0C A;  2R7D A;  3HKZ N;  1UEL B;  4ZJZ A;  1ZTR A;  4J01 A;  4HDU A;  1EJ9 A;  3N05 A;  1X58 A;  2NVU B;  2FML A;  1Z6T A;  3V8J A;  1VQN I;  3ABM H;  5TRD A;  2VJI A;  3QWL A;  3IL2 A;  1SD4 A;  1K78 A;  1ZRC A;  3CMM A;  1W36 C;  4D9J A;  4M3B A;  3ZP5 A;  5GAD J;  3OYB A;  2XGC A;  4AIK A;  4KYW A;  1WWX A;  3DU5 A;  3WGG A;  1HST A;  3K1N A;  2X48 A;  4XSX F;  1D5V A;  4GYI A;  4KMU X;  2DT6 A;  3CUQ C;  2XAH A;  4MHG A;  1KU3 A;  3BC8 A;  1LPQ A;  2STW A;  1E0E A;  3FHZ A;  3MWM A;  1W4M A;  4RB3 C;  2ECC A;  4A5N A;  3OYK A;  4FIS A;  4CHU A;  1JKR C;  1XGN A;  2LBF A;  3S1N J;  1T98 A;  1SC7 A;  1QNT A;  3AG2 H;  4LLN A;  3E6D A;  3ML6 A;  2BEO A;  3CCS I;  1TT0 A;  4I98 B;  4QPO A;  4YEJ A;  3S3O A;  1A04 A;  4CA0 A;  2DYS H;  4R8H A;  2R5Y A;  3Q5F A;  3KP2 A;  2PJR B;  2R7R A;  1MNM C;  3T8T A;  2QKM B;  2CSO A;  2IPQ X;  3IKT A;  3GZN B;  3H3V K;  3Q9V A;  3DPL C;  1ZQ3 P;  2XGE A;  3GZ5 A;  5HOO A;  4XRM A;  2HWV A;  2IA1 A;  3RQ4 A;  3WTX C;  2KIS A;  3FIS A;  1AOY A;  2XV4 S;  3KEO A;  2L7K A;  4IQ4 A;  1JHF A;  4BE2 A;  5GAH J;  2O03 A;  1E3O C;  4BNC A;  4HF0 A;  2YPR A;  4BJT A;  3QP6 A;  2K85 A;  2OAZ A;  1ZG5 A;  3P9C A;  3L2R A;  1JT0 A;  3ZR8 X;  4G12 A;  1SVL A;  2DJN A;  2NXN B;  3MZY A;  5D6E A;  1VQM I;  5AIQ A;  1LB2 A;  4KIF A;  1XCB A;  3L2U A;  2WY7 Q;  1YI2 I;  1T0F C;  3DTI A;  4CO8 A;  1OIS A;  2IBD A;  4PFP A;  1JKQ C;  5HVQ C;  3DKX A;  4E7H A;  2KFD A;  5J3L A;  1KU7 A;  2DMT A;  5LEJ A;  4AVZ A;  1R1V A;  4ZZL A;  2AO9 A;  3U1K A;  2E19 A;  3ZQQ A;  3LSK A;  3CCQ I;  4JX6 A;  3M1E A;  1L0O C;  5DEQ A;  1NK3 P;  1WI9 A;  4YFK F;  2K4J A;  5JVG F;  5B1B H;  5H6Q A;  2HS5 A;  3SXY A;  3RPU D;  2TRT A;  2CU7 A;  4YG2 F;  4BQA A;  2LF8 A;  5ED4 A;  4L0Y B;  3MCZ A;  1Q1H A;  3ERE D;  5FLX Z;  1DPR A;  5FKM A;  4ON0 A;  2RVC A;  3HRT A;  2IW5 A;  1RUO A;  3WU2 C;  2DDB A;  2LP0 A;  2V9P A;  3OIQ A;  2XPU A;  3BTL A;  4IRI A;  2QSH X;  4MO7 A;  3BJA A;  2RN7 A;  4RLF A;  1FYL A;  1BJZ A;  4XRF A;  1V5F A;  3GEZ A;  3TO9 A;  3K4L A;  1IN5 A;  2OCC H;  1BJA A;  3LSJ A;  4HF2 A;  3QYB A;  2OTJ I;  1X4P A;  4HF1 A;  3UKG A;  2IS1 A;  2HOA A;  1DDN A;  1BI2 A;  3GTP J;  2ISY A;  5CQG A;  1SD5 A;  2VKV A;  1BR2 A;  1LDD A;  2ZXI A;  1WZ2 A;  3LAP A;  2FQ3 A;  2XIG A;  1Y39 A;  3FZV A;  1OCZ H;  1XMX A;  2XRN A;  1TC3 C;  1WJC A;  3S93 A;  2HTJ A;  1JTX A;  4JP0 A;  4GRI A;  3BJO A;  3X2Q H;  5EZG A;  2H94 A;  4FT8 A;  2XGX A;  3VPR A;  1LKX A;  2PMH A;  2DA5 A;  1OKR A;  1LFP A;  2EFN A;  2OA4 A;  1ETW A;  5CLS A;  1GXQ A;  3R61 A;  2UXX A;  1B72 A;  1O7F A;  5CQE A;  5J1Y A;  1VQ4 I;  1ZK8 A;  2HNH A;  5CVI A;  3AAF A;  1K83 J;  1S7A A;  2ISZ A;  1POG A;  3FK7 A;  1LEA A;  2ZNZ A;  3IKV A;  1XDU A;  3PSI A;  4C2M J;  1FYM A;  4PGH A;  3MFK A;  5E8G A;  2ELH A;  1IXC A;  3ZXS A;  5E17 F;  2KHM A;  2WY8 Q;  5IP6 A;  1MKM A;  4U7B A;  4IOA F;  2DBB A;  2KZV A;  3GTO J;  1PJR A;  2WC2 A;  4HBL A;  4ESB A;  3K4C A;  3QPS A;  4PSX A;  1SMY F;  1R4N B;  2EIL H;  3BLY A;  2GOM A;  2ESH A;  3GW2 A;  2CV1 A;  2XAG A;  1RC9 A;  1D8K A;  3CLO A;  3VYR B;  3FKI J;  3IAM 2;  5HOD A;  1BI3 A;  2KDZ A;  2D45 A;  2CFX A;  3EET A;  1U2W A;  5F04 A;  1T39 A;  3BT9 A;  5K5O A;  2X85 A;  3SZT A;  1JGS A;  4EGY A;  4FAS D;  4A3E J;  4IEJ A;  2NNY A;  4AVP A;  1XCV A;  4JX4 A;  1D1C A;  1WCM J;  4L5J A;  2HOE A;  1GVD A;  3BR1 A;  4LIV A;  1O3R A;  5ERI A;  2VBZ A;  2BE5 F;  4IRG A;  3OS1 A;  1YIO A;  2JZY A;  5KVR A;  3JSP A;  2VN2 A;  3MN2 A;  4ZYH A;  1QVU A;  3BR2 A;  2GIZ A;  2PMZ A;  5IOZ A;  3DBL B;  1V4R A;  2LKP A;  1O57 A;  1Z77 A;  2EZH A;  3EQL F;  4V2G A;  1DUX C;  3T5X A;  9ANT A;  4GYG A;  2CH0 A;  1QZE A;  2L5Q A;  4Y7N J;  2DJI A;  1AKH B;  2OF7 A;  2ZJ2 A;  3K9T A;  4L9T A;  3KEQ A;  3I5U A;  2X1C A;  2RKH A;  2K5C A;  2VI6 A;  3FM3 A;  1G3T A;  4HRI A;  1QGP A;  4X6A J;  2VQG A;  2X1D A;  5DCM A;  2A3S A;  5J1U A;  2R92 J;  3RKY A;  2FF4 A;  3BRO A;  3E7L A;  4E7I A;  1B4A A;  2H8W A;  3FXK A;  1A31 A;  3AKZ A;  2Y0S N;  2R3S A;  2HGC A;  1GV2 A;  3MVP A;  2LD5 A;  3CTA A;  1MZB A;  1MND A;  2OU2 A;  1ACI A;  4G8X A;  5GPC A;  1X19 A;  3GTQ J;  1U0J A;  3E0J B;  5FKN A;  4AIJ A;  2DXI A;  4XLF A;  4CCL A;  1BR1 A;  2ZME B;  4Q4Z F;  4M6X A;  2B63 J;  1KYW A;  2PEX A;  3HOX J;  5LLQ A;  1DGW Y;  2ECB A;  2VOD A;  3TBI A;  3G2B A;  1D0X A;  1I50 J;  3S14 J;  2FE3 A;  2E34 A;  2IGN A;  5D4R A;  4RB2 C;  3DTK A;  4D0P A;  1TTY A;  2X0L A;  3CMY A;  2GAU A;  5J8C A;  4M3F A;  1GUU A;  2MH9 A;  4EV0 A;  3GYH X;  4E4H A;  1U3E M;  3IH2 A;  4BEH A;  4BGD A;  5L3C A;  1Z67 A;  2CS3 A;  2OQG A;  2K40 A;  4BHC A;  4ESJ A;  4NHJ A;  2EJR A;  4A2U A;  2E71 A;  1IZ1 A;  1PVE A;  1G3S A;  2CUZ A;  1V5G A;  4BBR J;  2A6H F;  1E3P A;  1IGN A;  4CYC B;  2CW7 A;  4LGW A;  4G6D A;  1R4M B;  2V4J C;  2CMP A;  4LB6 B;  4DYC A;  5D6F A;  1FP1 D;  5D5U B;  1LQ1 A;  2E2J J;  2NRA C;  4XR6 A;  2L4M A;  4WX9 A;  2MGQ A;  5LGN A;  1ZYR F;  1GT0 C;  1ZG3 A;  5GP9 A;  4XID A;  3BG7 A;  2JUG A;  3CDL A;  1HQC A;  3ZOB A;  4QTR A;  2IGK A;  1L3L A;  1FYK A;  2IS6 A;  1YFH A;  3GTL J;  3IUO A;  4M6V A;  5HDK A;  2F48 A;  4M3G A;  2QWW A;  4DBR A;  4ZZD A;  1FEX A;  3K70 C;  3AG3 H;  4FE7 A;  3OMY A;  4O3M A;  3GX4 X;  1IJW C;  3BR5 A;  1D1A A;  4M71 A;  3FXU A;  2HFH A;  2EIJ H;  1JT6 A;  3V7S A;  3JRF A;  4UVA A;  5JLW A;  4L9V A;  4DZP A;  1JUS A;  1Z0X A;  1SFK A;  2E36 A;  2O8X A;  2R7O A;  3WU1 B;  1ZRE A;  3OYE A;  2M7A A;  2LY9 A;  5HS7 A;  4PJL A;  4WCG A;  4I0B A;  4G6Q A;  4HX7 A;  2PJR A;  4OIP F;  3LA2 A;  3W6J B;  2DK8 A;  4A3L J;  1YJW I;  1ZG1 A;  2L2O A;  1GLN A;  3TW7 A;  5EGO B;  2MFZ A;  4BYY A;  1J9I A;  4P9U A;  2X6O A;  1TWF J;  2XAF A;  2Y75 A;  4LK1 F;  2VAS A;  2IA2 A;  4LLG F;  1FIP A;  3HEF A;  4RMN A;  4IHT A;  4BE1 A;  2G7H A;  2DFF A;  2KL4 A;  2LH9 A;  2M87 A;  5M5X J;  2GOX B;  4I02 A;  3RSN A;  1UAA A;  4B47 A;  5EF6 A;  4ESF A;  4ZDP A;  4YIR X;  2KPM A;  3GBG A;  5DCF A;  4WXH A;  2BW3 B;  4HV5 A;  2OQR A;  2OCE A;  3BR6 A;  4M9Z A;  1YRN B;  1LFB A;  5D8K B;  2L0K A;  2LY2 A;  3CF2 A;  3CLQ A;  3W6V A;  2V1D A;  1TWC J;  4Y15 A;  2R7T A;  1YG2 A;  2Z33 A;  1D5Y A;  3H0G J;  3OSG A;  3ABL H;  2X1E A;  2VJJ A;  4IZZ A;  3LQQ A;  2DU9 A;  3P9I A;  4KIC A;  3KLN A;  4I6Z A;  1LVA A;  5IYB J;  1KYZ A;  2KDO A;  2CFO A;  2K86 A;  2DT7 B;  2L7F P;  3DEU A;  4BXX J;  3WGH A;  2BZT A;  3DKW A;  2KRC A;  2OJE D;  3JRD A;  3HC7 A;  3K0L A;  4LB5 A;  1JE8 A;  2KJB A;  3CES A;  1HSJ A;  1ZAO A;  2E5Z A;  3GWZ A;  1YHQ I;  2O9L A;  1GDT A;  5IP7 J;  1KQ9 A;  5D8L B;  3HOY J;  3TGN A;  3HHH A;  4FX0 A;  3GTJ J;  4A0Z A;  2W1O A;  1R22 A;  4EEF G;  2KIF A;  3K4M A;  2NOJ B;  4XK4 A;  3JRI A;  1X4O A;  1XGM A;  2YUS A;  1MGT A;  1EF4 A;  2BGC A;  3OYG A;  1AHD P;  3BQZ A;  2PMZ N;  1HC8 A;  3WHB A;  2UXN A;  3BCA A;  3GTM J;  1R6R A;  1LJ9 A;  1UB9 A;  5DDG A;  1RR7 A;  1VQP I;  3OR1 C;  2J5P A;  1JUM A;  2EZK A;  2I10 A;  3AL0 B;  3QYE A;  1NHA A;  5IT9 Z;  4MNU A;  1GV5 A;  4BHP A;  2CG4 A;  2KZG A;  2VJ5 A;  3QPL A;  4F3Q A;  3KYD B;  3OL4 A;  1UJ8 A;  2IGM A;  1ZR2 A;  1FSE A;  2EBI A;  4BQN A;  3VYU B;  3D1N I;  3J80 K;  4P96 A;  3LAJ A;  2E7W A;  4EJW A;  4PZJ A;  4DNC A;  4OIQ F;  1KZH A;  3MEX A;  1IDY A;  2V26 A;  5HS9 A;  4XKB A;  2MD5 A;  2K7L A;  4BHB A;  1V5E A;  3JRH A;  3C3W A;  2JA8 J;  1QZZ A;  3I54 A;  3WG9 A;  4U7D A;  2COM A;  3U1D A;  4HQM A;  2HQR A;  4D1Q A;  3FXL A;  2HI3 A;  3BG9 A;  4YIF A;  5L3B A;  5GTH C;  2PN6 A;  4FTH A;  3H5A A;  2H09 A;  4ASN A;  2E1N A;  2K3P A;  2CUJ A;  2DCE A;  5JI6 A;  4C2T A;  1ZEL A;  3K1M A;  2XAQ A;  1Y8R B;  4RB0 A;  5CVV A;  5KAF C;  5DV5 A;  2MW8 A;  3CZ6 A;  1MBF A;  5J4Y A;  2R7U A;  3ABK H;  4WXC A;  3GCM A;  1FOW A;  5FJ8 J;  2NNN A;  1FOY A;  3TOB A;  5IP9 J;  3MKY B;  4AM3 A;  3DCF A;  2DYR H;  3BTJ A;  4BAY A;  5H20 A;  3Q3S A;  1VQK I;  5FLX K;  4KIS A;  2IP2 A;  2HDW A;  1MDM B;  3D5R C;  3TL4 X;  3NWT A;  3H9J A;  4ZTF A;  2P7C B;  5IYD J;  5AIP A;  4DBQ A;  1G59 A;  3A02 A;  4P5O A;  1MH3 A;  2CUE A;  2L7Z A;  2V1N A;  1BIA A;  2EFO A;  4XN0 A;  3SYT A;  1OQY A;  1FJL A;  1X3Z B;  1WH7 A;  1F9N A;  2VT3 A;  2P4W A;  4OU0 A;  3HJE A;  3E6B A;  3QOP A;  5J4V A;  2VQC A;  3GVA A;  2KLO A;  1RZ4 A;  3LWF A;  1W5T A;  2OV7 A;  3MMY B;  1K4S A;  3QP5 A;  1QA6 A;  1IRZ A;  3MKZ A;  5FGM A;  2XF7 A;  1TWH J;  1XC5 A;  1FTT A;  1TZL A;  4YEL A;  3GTK J;  4HNT A;  2VT2 A;  5HDG A;  2MC3 A;  4WWC A;  4RBO A;  1AKH A;  1LEB A;  2LKS A;  1B9N A;  1RKT A;  5LGT A;  3ZN0 A;  3DPU A;  1XS9 A;  5E3N A;  2EK5 A;  1BM9 A;  2CWE A;  1RI7 A;  4FX4 A;  4NC6 A;  4UUT A;  1XDS A;  5FB2 A;  2P6S A;  3QYF A;  3KX2 A;  2YX4 A;  3I4P A;  2VLA A;  5E3L A;  2CW8 A;  3DTE A;  3U2R A;  2QSF X;  1LNW A;  4BUP A;  4HLX A;  5E79 C;  4HDV A;  2FJ1 A;  2RAE A;  5FFZ A;  4RLQ A;  2R0Q C;  3R4K A;  1ZRD A;  1TLH B;  1QPI A;  1FX7 A;  1N78 A;  2HQA A;  4DQ2 A;  2EIM H;  2ZME A;  4G6T B;  4P9F A;  4A0Y A;  1VI0 A;  3DEW A;  3BR3 A;  2VPL A;  3WTY C;  2HYF A;  3BWG A;  1IN6 A;  5ICF A;  4P55 A;  1NG7 A;  2H6C A;  1F4K A;  3CMA I;  3GUD A;  1YTY A;  1FWZ A;  3S2W A;  2FU4 A;  3L7W A;  1DU6 A;  4FHT A;  2F5C A;  2KRH A;  2OD5 A;  1MMG A;  2RRE A;  3TO6 A;  4G7Z F;  3SFZ A;  5A2Q Z;  2C6Y A;  1J7K A;  1MBJ A;  1RIO H;  2H27 A;  3CCY A;  3B73 A;  2XB5 A;  5C44 J;  3SHF A;  2M1B A;  2A5Y B;  1TL8 A;  3JRB A;  2MD0 A;  3GFJ A;  4ZTJ A;  2GM4 A;  3W3C A;  4EQQ A;  1Z91 A;  2M8E A;  5K7H A;  2GLO A;  1I27 A;  1VQ5 I;  2IEK A;  1FC3 A;  4D5F A;  3OYN A;  2ZJR F;  5FLV A;  1TT5 B;  4C9Y A;  2HPI A;  4CYC A;  3VOD A;  2DOA A;  2HYJ A;  2B7E A;  2LKX A;  3JW4 A;  2IGO A;  1H0M A;  2EFW A;  5E1X A;  2VKD A;  5BPI A;  3HYI A;  3KLO A;  3J81 Z;  4IX7 A;  1G3Y A;  3CDH A;  2F5E A;  2WAF A;  2DMU A;  1VQ9 I;  4L9J A;  1U8R A;  1K4T A;  1Y0N A;  4KN7 X;  4EJO A;  2HXO A;  4MGR A;  4ZYA A;  2O6G E;  3CD6 I;  4KIT B;  1OCT C;  2VQL A;  4ZDO A;  3F8B A;  4IPA A;  2FMY A;  2Y69 H;  2W85 A;  3GFL A;  4YII A;  3SEZ A;  4DYQ A;  1QU3 A;  1HOM A;  1D8J A;  3VYT B;  2BY0 A;  4Y33 A;  1ETX A;  1YX5 A;  3F8M A;  1AA7 A;  3E3V A;  3IHU A;  3W2V A;  3FXM A;  2BVL A;  2XKP A;  3GME A;  2XRO A;  2PJP A;  1R23 A;  2Y31 A;  5CKT A;  3DV8 A;  4H4K C;  1R1T A;  2M2E A;  2Z99 A;  4BDZ A;  1J75 A;  2AS5 F;  2XF5 A;  2DA6 A;  2XRL A;  1RNL A;  4ANJ A;  4UUS A;  1NTC A;  5B5E C;  1BR4 A;  1SD6 A;  2X6Y A;  4E7Z A;  3KYC B;  3J80 Z;  1JJ8 C;  2OTL I;  1BW5 A;  3ZMD A;  1REP C;  2OZ6 A;  1QVT A;  1FMW A;  4Q47 A;  4RM3 A;  2BOL A;  2NVT J;  3WTU C;  5IPA A;  1S7O A;  3QOD A;  1WJF A;  2IXS A;  2V7F A;  3MKL A;  1I3A A;  1X3W B;  3E6C C;  2DA7 A;  5CVR A;  5C3E J;  2MH2 A;  2CQX A;  3FIW A;  1YW8 A;  2ZME C;  2ZO4 A;  1JTY A;  2D1V A;  2X6X A;  3WE2 A;  5EGO A;  2MC4 A;  3UNG C;  2LMD A;  4D7M A;  2K9Q A;  1ZLJ A;  3Q0W A;  5DD4 A;  3SDG A;  3P7N A;  1QPM A;  1OCO H;  1ONV A;  3S2D J;  2WB1 A;  3HG9 A;  4NNJ A;  4MTD A;  3N4M A;  1R5G A;  3K4J A;  1YJN I;  3H9Q A;  5FO5 A;  1RR8 C;  1ON1 A;  4PCQ A;  1WGX A;  2E2H J;  4NUB A;  2E2I J;  4M9S A;  5BMZ A;  2BW3 A;  3CP8 A;  4MEY F;  1YRN A;  2F4I A;  2Y0M A;  4KN4 X;  2M0M A;  2WWY A;  2KIM A;  3CO7 C;  1XG1 A;  1JKP C;  4HEA 2;  1OR7 A;  1NG6 A;  4HST A;  1XSX A;  1QQI A;  3RQI A;  3F21 A;  1IO2 A;  3CC7 I;  3ZQG A;  3S1Q J;  2EZI A;  5BPD A;  1P4W A;  1H9G A;  4PJ0 C;  1ZR4 A;  2KJC A;  1FLI A;  3JR9 A;  1U5T B;  5DM7 F;  1ZH5 A;  1J09 A;  1KON A;  1PP8 F;  1MW7 A;  3SDB A;  1HKT A;  4L0Z B;  3L00 A;  5IOY A;  5LFA A;  2Q0O A;  3J7A O;  4OIR F;  2FA5 A;  4XNF A;  2NVY J;  2CUF A;  4LIU A;  3WE3 A;  4OMY A;  3FXR A;  1EH8 A;  3PO3 J;  3ISP A;  5LHG A;  4ZDL A;  2JA5 J;  4I7H A;  3EUA A;  1EH6 A;  4RGS A;  1YYV A;  5FKK A;  5BNG A;  5TJJ A;  1E3H A;  5F0F A;  4EJU A;  1G8X A;  3FM5 A;  1S6L A;  3RDI A;  2K02 A;  4OAY A;  2M34 A;  1WPK A;  3DPT A;  3K2Z A;  2VJ4 A;  4L9N A;  1SD7 A;  2K27 A;  2HEO A;  1I1G A;  1WI3 A;  3F8F A;  3C2G A;  3I59 B;  1P2F A;  5HLI A;  1GHC A;  2JT1 A;  1P7I A;  1IG7 A;  3M8J A;  4XKC A;  5E20 A;  2VIX A;  3H0D A;  4GDF A;  4JQF A;  3GF2 A;  2X51 A;  3F6O A;  3LFU A;  1XMK A;  3OYF A;  3BPV A;  3WG7 H;  1LDK B;  3AG1 H;  1W36 D;  5JHU A;  4II3 A;  2V1U A;  4WXD A;  3JTH A;  2CQK A;  4ENK A;  1B8I B;  3AFH A;  4UVB A;  2ZKZ A;  2OC6 A;  3BZK A;  3WOD F;  4IF4 A;  4XLC A;  4PJN A;  5GPA A;  2O0Y A;  2JA2 A;  4A3I J;  1ZGW A;  3HRS A;  3KE2 A;  2ADU A;  1R36 A;  5ILS A;  2GA2 A;  5KHD A;  1E17 A;  3H36 A;  3FF5 A;  2Z1D A;  4UV8 A;  2BHZ A;  3JSO A;  2MAB A;  1VQL I;  5EEH A;  4CCK A;  1OR7 C;  4MTE A;  1IDZ A;  3NAU A;  2BY3 A;  2HZD A;  3PFY A;  4NB5 A;  4A3F J;  4CUG A;  3TW6 A;  2Z9O A;  3IH3 A;  4CXF A;  5BQT A;  3D5S C;  2YU3 A;  4HV6 A;  3JAM Z;  1KQ8 A;  1OCR H;  2DMN A;  2XAJ A;  4AYB A;  4A3M J;  1K6O A;  2MLG A;  1YIT I;  4PFO A;  2R7W A;  2EPF A;  5JLX A;  4RAF A;  3OYA A;  2WAE A;  2TCT A;  4PJJ A;  3MZH A;  2HKX A;  3M8F A;  1Z3X A;  3I53 A;  4XN3 A;  1UZC A;  3LSR A;  4XQF A;  1MJB A;  2V9K A;  4WK8 F;  2LRD A;  4X0G A;  1BOA A;  2EIK H;  2F2E A;  2I8D A;  2L01 A;  2RV8 A;  4PSW A;  1V55 H;  5E8I A;  5DTD A;  4U0V A;  3AG4 H;  3L09 A;  2ZBK A;  1FZP B;  2NS8 A;  5ILU A;  4Y52 J;  2R4G A;  1MDM A;  2ACJ A;  3H9G A;  1M1E B;  4Z2Y A;  2HVR A;  4JX5 A;  2EQR A;  5FKO A;  3ASO H;  1FNN A;  2WBM A;  1S5L C;  2JK3 A;  4U0W A;  4IQJ A;  1UHW A;  4A3B J;  4MFD A;  4UNO A;  1JUP A;  4XRS G;  1ODD A;  4UUV A;  5IT9 K;  2XPW A;  3HGY A;  3ZQC A;  4IHW A;  3I4M J;  3IRQ A;  1Z7U A;  3GLX A;  1ETV A;  1OYW A;  3AL0 C;  2IRF G;  3CCV I;  1WHU A;  2A6E F;  2NOG A;  3H5R A;  4BU2 A;  2JVH A;  3FKJ A;  4KT5 C;  1A6Q A;  2FNA A;  3J7Z I;  1SFU A;  1NK2 P;  2XUB A;  1I6X A;  3VYS B;  3N97 A;  2QGU A;  1W0U A;  2JMW A;  3MKW B;  1HXD A;  4CIC A;  1P4A A;  2AXL A;  5E18 F;  1LFU P;  4ABZ A;  3HSF A;  2DQL A;  3DBH B;  2DMQ A;  2FNP A;  3HHG A;  3OYJ A;  2ZFU A;  3CF5 F;  3PIO F;  1YLF A;  4FE4 A;  2QBY B;  4NBQ A;  3ZPL A;  1VQO I;  2KP6 A;  4BS9 A;  2W82 A;  3I4N J;  3ONQ A;  3CME I;  4QSH A;  2E1C A;  2Z3Y A;  4HPQ A;  2EV0 A;  3ZGK A;  5HLH A;  3I71 A;  1SEU A;  3HTU A;  2E1O A;  1PUF B;  2ID3 A;  3VOE A;  2BY1 A;  4XLH A;  2WB1 N;  1IN8 A;  1EH7 A;  2IJL A;  3V7R A;  2M5W A;  1K61 A;  3I55 I;  3OYC A;  1WRJ A;  3PQK A;  2HYG D;  1B59 A;  1SAX A;  4WF2 A;  1O3S A;  4BJ6 C;  1TW3 A;  3OYL A;  1RES A;  2XDV A;  1BIB A;  3WGI A;  3C7J A;  5JFR A;  1ETO A;  2HQN A;  2X9D A;  2GQQ A;  2X4H A;  5EG0 B;  5LD2 C;  2DT5 A;  2MG4 A;  2PFB A;  1JI8 A;  3HOW J;  1VFC A;  2YU9 J;  4OOI A;  3A0B C;  4FCY A;  4UUS B;  1RUN A;  5F6F A;  1Y8Q B;  4MFE A;  2A61 A;  1XMA A;  3BP8 A;  3RI4 A;  1YIJ I;  4L18 B;  2JUC A;  4BXU A;  5E1W A;  2D5V A;  3TP3 A;  2L4A A;  3CCE I;  1HCR A;  3W2A A;  4KUM A;  1MMA A;  3KFW X;  2V6C A;  1I1S A;  1X2M A;  2XPV A;  1F43 A;  4F52 A;  3CQZ J;  5IYC J;  2LYC A;  1I3Q J;  4AD9 A;  3QQA A;  3F8C A;  2G0E A;  2VXD A;  1HA8 A;  3ZQF A;  2LRE A;  5DYM A;  2VE9 A;  1UHM A;  2M0C A;  5K7F A;  2G9W A;  4GO1 A;  2OPT A;  2W4S A;  1DGR M;  4C3J J;  4XIC A;  3G73 A;  3KPH A;  1MSF C;  4AU7 A;  3OS0 A;  1SAN A;  3A03 A;  4IJA A;  4EM1 A;  1LVK A;  2JA6 J;  4CCM A;  2EWN A;  3O8G A;  4B4C A;  2QQB A;  3LMM A;  3H5N A;  2CJJ A;  4S04 A;  2VON A;  4E70 A;  3HKZ A;  2PI0 A;  4B48 A;  2IAI A;  4IXA A;  2FOK A;  4QPQ A;  3OOU A;  4BQO A;  2KKO A;  3V42 A;  3QU6 A;  2ZSI B;  1V3F A;  4Q48 A;  4HOB A;  3WTS C;  1QHG A;  2VUM J;  1YW7 A;  2QVO A;  3RZO J;  2L9R A;  5A2Q K;  3HSE A;  1YQA A;  3L9F A;  1AWC A;  1KU9 A;  1HDD C;  5ICE A;  4KT6 A;  5H2F C;  1RET A;  2GXA A;  4EAT A;  1LE8 B;  2Q8K A;  1D1B A;  5FKL A;  3M4O J;  4RDU A;  2EA2 A;  2LY1 A;  3VB2 A;  1HBX G;  4DZJ A;  3M7G A;  4EJV A;  1VF9 A;  5HLG A;  3M1C A;  3PJR A;  4CDG A;  4Z6Y A;  2CRG A;  4BL0 B;  3TOA A;  1TQP A;  3HRU A;  4TV7 A;  5CVU A;  3J81 K;  3A4C A;  2VBY A;  4AYB N;  2R7Z J;  3KZY A;  3I64 A;  2EB7 A;  2R7F A;  2EH3 A;  4B43 A;  3DU6 A;  1MMN A;  4PDK A;  3G4S I;  1MH4 A;  3NQO A;  1U5T A;  3JTG A;  5FFX A;  1ZLK A;  4LFU A;  2GIV A;  4BY7 J;  1VZ0 A;  4M72 A;  2LTP A;  2NS0 A;  4IVN A;  5LEK A;  3WHC A;  4IKF A;  1IW7 F;  3RPU A;  3KZZ A;  1H89 C;  3Q9S A;  4XSZ F;  3CC4 I;  5L3G A;  3E5Q A;  2W25 A;  2L3D A;  4I76 A;  3VSL A;  1WQ2 A;  4NQW B;  2IVM A;  2G7U A;  2L54 A;  2BYV E;  2QZ8 A;  2HVS A;  3H92 A;  4XOT A;  2DI3 A;  1KU2 A;  3PFI A;  4BKX A;  1ULY A;  3KP7 A;  5HS8 A;  1PUE E;  2M3A A;  3ASN H;  5EEG A;  1OFC X;  3O6B B;  1R1U A;  2R93 J;  4UB6 C;  1FP2 A;  4Y17 A;  1IN4 A;  1Y1V J;  2QEN A;  1XSV A;  2H1L A;  5LHI A;  4A3K J;  3Q0U A;  4XBF A;  3I59 A;  1R00 A;  4NDL A;  3COA C;  2STT A;  3S3N A;  4UV9 A;  2XF6 A;  2KIU A;  3CCJ I;  2GXB A;  3BG6 A;  1EKE A;  3A01 A;  4LG3 A;  1HDP A;  2H1K A;  2DA4 A;  1BI1 A;  3DF8 A;  1N25 A;  3IC7 A;  3S1R J;  2ZB9 A;  1FY7 A;  2DN0 A;  5F1R A;  1MBE A;  3ULQ B;  1XGO A;  2DFI A;  4XL9 A;  5L3F A;  5EYR A;  1P9Q C;  1JJ6 C;  3S16 J;  3G1L A;  2DOF A;  2KIQ A;  2FRH A;  3CP2 A;  5LBQ A;  1CF7 B;  4CYD A;  5F64 A;  3RZD J;  2LDU A;  4OWR B;  2Y9Z A;  5D4S A;  1B8I A;  2FOW A;  2F4O B;  5FD5 A;  5M3M J;  3W6K B;  1SFE A;  2EA4 A;  2JVG A;  1KGS A;  4A5M A;  2L02 A;  3UR3 C;  1IRG A;  1WJA A;  1TWG J;  3BG3 A;  3BOQ A;  4HNU A;  1UST A;  2XHK A;  3H1C A;  3J7Y J;  3QU3 A;  4AID A;  3BR0 A;  3CUO A;  5KAI C;  1G4D A;  2DO7 A;  5CJ9 A;  1YE9 A;  3H35 A;  3JRG A;  3DP7 A;  3RKX A;  4BH9 A;  3S2H J;  4UY8 I;  4G9Y A;  2DFE A;  5HNH A;  4R79 A;  1NH3 A;  2ZSH B;  2LLK A;  3L2Q A;  2XAS A;  1AU7 A;  4A93 J;  4YFN F;  1U5T C;  1U9N A;  1ZGJ A;  3PL8 A;  4IHY A;  2JPB A;  2VKH A;  4E7L A;  1B1B A;  4XLA A;  2HDC A;  2DFH A;  3ABT A;  4HSR A;  4EJT A;  1FBU A;  2DW4 A;  3TMO A;  5D5W B;  1IRF A;  3HOV J;  2R7X A;  2HZT A;  4NC8 A;  3ZMS A;  1TQM A;  2O8K A;  3QOE A;  2RGV A;  1SFX A;  5F1J A;  2HR3 A;  3HXL A;  1FBS A;  1RKW A;  3FMQ A;  4LG0 B;  3T1B A;  2LVS A;  5LRS A;  1ERD A;  3BTI A;  3ZMV A;  4PJM A;  1F5T A;  3I9V 2;  4EM0 B;  2Y2Z A;  2ZJQ F;  2CV0 A;  4QIW N;  2UZK A;  5J47 A;  2ZXJ A;  1RPW A;  5F08 A;  1HW1 A;  2AXT C;  4CH7 A;  5LGU A;  1SMT A;  2HDD A;  1KA8 A;  5HNF A;  3LA7 A;  2Q1Z B;  3A0H C;  1VTN C;  3BJ6 A;  5D5X B;  3OSF A;  1MMS A;  1N75 A;  4RA2 A;  5ICC A;  3FBN B;  1UCR A;  3HUG B;  4N9H A;  5E3O A;  1X1D A;  5E1Z B;  2W48 A;  2DA2 A;  3TP0 A;  3H3U A;  3TED A;  1A5J A;  4BBS J;  4M9X A;  1G6N A;  2QF7 A;  3MQ0 A;  2P7V B;  2HPM A;  1ETK A;  2DPU A;  4DOZ A;  1BI0 A;  2AQE A;  4HX8 A;  1MJA A;  4CGZ A;  1Z6R A;  1Z3Y A;  1Z9C A;  3FMS A;  1W7P D;  2K3F A;  5F0H A;  3LST A;  2JN6 A;  3I58 A;  2A5W A;  4XKW A;  4GFB A;  4HYE A;  1WVR A;  2E1M B;  1ZHF A;  3B6A A;  2QBY A;  1UHS A;  4C3I J;  5FD6 A;  3L2W A;  2RQQ A;  3KP3 A; 
#chains in the Genus database with same CATH homology
 2BZT A;  1UJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...