1UJ8A

Structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
SHHHHHHGSGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yfhJ
publication title Crystal structure of Escherichia coli YfhJ protein, a member of the ISC machinery involved in assembly of iron-sulfur clusters.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04384 Fe-S_assembly Iron-sulphur cluster assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.600 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A IscX-like 1uj8A00
2BZTA 1UJ8A
chains in the Genus database with same CATH superfamily
1GXQA 3RSNA 3LSMA 3RTRA 2Y0SN 1JKOC 4Y15A 3BG3A 2ZKZA 4MIMA 5DTDA 1N25A 1YW8A 3KZYA 5JVTA 3ZMTA 4F91B 2ID3A 4M6VA 3KX2A 4G7HF 4NHJA 4L18B 2E1CA 1ENHA 3L2WA 2M7AA 3LA7A 2CV2A 2DW4A 2M0MA 4WXDA 2R7ZJ 2R7QA 1DGRM 4DGWB 3ECHA 5DD8A 2Y2ZA 4A3BJ 4E7JA 1J09A 3JSOA 2IA0A 3CTAA 1MNEA 3BG9A 2ZMEA 2VE9A 4UUSA 2KRCA 4RA2A 4D5CA 2P0WA 3FBNB 1F36A 5ILUA 3LSIA 1LPQA 1Y56A 3I59B 5FRNA 3H5RA 2L2OA 2DU9A 2P7VB 2V1NA 3QPLA 4QLCU 1JE8A 4MQ9F 4GDFA 4OIOF 2LY9A 2DK8A 3O8GA 5K7FA 3OWTA 4BDYA 1ZR2A 3OYBA 3WU0A 1IW7F 1FJLA 1IRGA 1MDMA 2V9KA 2D2WA 1KONA 3OSFA 2NS7A 3FXRA 4O5VA 1U8RA 3AAFA 2E2HJ 4L0YB 1TQPA 4IHSA 1OCPA 1VF9A 1BA5A 1VQ8I 4CYCB 2M9HA 5F0HA 1XS9A 2X6WA 2CW7A 3L09A 4B8XA 3S8PA 3CJRB 3ZP5A 2M4GA 1TBXA 2M4KA 2DK5A 1YS6A 1BJZA 3VYUB 1IRZA 2ELKA 4G9YA 4ENMA 5LGNA 3HXLA 5F27A 2NAZA 2KJCA 3BR5A 2H8RA 2R5YA 3H3ZA 5IP6A 4C9YA 1W1WE 2DYSH 2ZXWH 3B6CA 4V2FA 5CVIA 2EIJH 4IF4A 3ZPLA 4NC8A 2A61A 1WJAA 4G7OF 4M3DA 3OOUA 4EM2A 2WB1A 1HKSA 5EZGA 3OS2A 3S1NJ 3GO5A 3OR2C 3GCMA 3J7YJ 5E8IA 1YTYA 4LB5A 3JW4A 3L2UA 1YYVA 2ETHA 3K69A 2CQ7A 3TDZC 2PFBA 2XAHA 5E3LA 4DYRA 5D5VB 1VFCA 5D6EA 3LMMA 4RBOA 3BQYA 1Y39A 1S3JA 3F9KA 3FIWA 2DOEA 1W5TA 3L1PA 2NVUB 4HEA2 2XGCA 4BBSJ 1UHSA 1FY7A 2X0LA 4U88A 1X3UA 2V1UA 2VOPA 4R8HA 1D3YA 3JRAA 3KZZA 2DPUA 1SD7A 5HS7A 2FRHA 3LOCA 3AG4H 4IRGA 2VJJA 5CQEA 4CUGA 3E97A 3FXQA 4GYIA 1IF1A 1BI3A 5DCFA 3I59A 2ZCWA 2GA2A 1R49A 3BR1A 3BR2A 1QQIA 2RNJA 2PMZN 3GTLJ 2XKOA 1XX5A 3HRSA 2QF7A 4Y4RA 3BTIA 3CF5F 4EJTA 2LBFA 2Z1DA 4I2OA 2EPFA 1LDKB 3BCBA 4AYBA 4M3FA 3EUHC 4OAZA 2LK2A 2X48A 1X1AA 4KMUX 3S32A 3X2QH 2X9DA 1P9QC 2LFBA 5L3GA 1XSDA 2HOTA 2YU9J 1Y1VJ 1BR4A 4I09A 4XICA 1R4MB 5HODA 3DWLE 3A2KA 3ZQGA 4ZTFA 1MIJA 1KQ8A 2DJNA 3KP7A 1HW2A 1GT0C 4V19K 1ZLJA 1BW6A 3K4LA 5F0FA 2DYRH 3E6DA 3LA3A 3GFJA 1VQ5I 4JX6A 4LIVA 2M2EA 1WSUA 3AG3H 2H09A 1KU7A 1IN4A 2M30A 3GFMA 2LREA 4JX4A 1JHFA 3PM1A 2KIUA 4M73A 5IT9K 3I58A 3IAM2 2Q0OA 3OMYA 4HV5A 1AA7A 5H6QA 1W7PB 3LSPA 2KZGA 1BOBA 2ZNZA 2FNAA 3V7SA 3KFWX 2R7UA 4FX4A 1FWZA 3EUKL 1HSTA 3GFLA 3NARA 3K0LA 3BTJA 1YIOA 3ASOH 2YX7A 4N4NB 4HAMA 5EEHA 5LHHA 3CC7I 3W2AA 1WCMJ 2ECBA 1FTZA 2LC2A 3IH2A 3N05A 4XNFA 5BNGA 4DZPA 1LUJB 4CSWA 4QPQA 2E1NA 1BI0A 2L4AA 3QOPA 2EFQA 3RPQA 2PBIA 4F7ZA 3CUOA 2X6YA 3PQJA 5FD5A 4CZCA 5K7HA 1Q1HA 1SMTA 3HUGB 5ERIA 5LEJA 3F21A 2L3DA 4YFXF 3A0HC 4Y17A 4F55A 3HJEA 3FKIJ 3MAJA 1ETXA 3BDDA 2DFFA 3ABTA 4MO7A 1ONVA 3W3CA 1LDJA 4Y13A 1OR7C 1L3LA 1ETVA 1BOAA 3M7GA 3AG1H 1W36D 5A2QK 2OTLI 4E4HA 1FBQA 3WTUC 4Z2YA 2XAGA 2IA2A 2HZDA 2IGOA 1VQ4I 3C7JA 1WPKA 5GAGJ 3ZQ7A 1OKRA 3JCUC 2GOXB 1MBJA 1UELB 4BUPA 1GLNA 4HOBA 5IYDJ 4WF2A 4WX9A 3DV8A 2Y30A 1R36A 4N4OB 3SEQA 5A2QZ 1G2HA 3PIOF 2W57A 4GGGA 1XSVA 4FE4A 4NQWB 4UUTA 1LJ9A 3GTKJ 1Z05A 3R0AA 1O3QA 3P7NA 3DKYA 1V54H 3DEEA 3F0CA 5DM6F 2CUZA 4EJWA 3GTJJ 4GCVA 3F8FA 4GXOA 1V5GA 3IKTA 3ZQFA 3TO9A 3H36A 2BYVE 2L02A 1WGXA 1FMVA 2V9PA 4CH7A 1RESA 1K83J 1N75A 1OCOH 2KPMA 4P1WA 4ZH4F 1WKMA 1B72A 1Y6IA 2XAFA 2ACJA 2I8DA 4BBRJ 1NTCA 3BR0A 3OYIA 5D5XB 1U5TC 5F1RA 1UHMA 3B6AA 3KEQA 3A02A 3CUQB 3SZPA 4M9SA 1YIJI 1W7PA 4HA8A 5FFZA 3N97A 3ZGKA 2FBIA 4PCQA 4BQQA 1OYWA 4B44A 2ELHA 4M3GA 2HKXA 4OAYA 4CZZA 2EA4A 1PYVA 2EV0A 1UZCA 3A01B 5GTHC 3S15J 2BOLA 4XORA 3I53A 4ESFA 4A3GJ 4JQFA 3A03A 1WJ5A 2E1MC 5E8GA 1IO2A 2IXSA 2TCTA 3I3LA 2JPCA 4FETA 1ETOA 3QYBA 4YRVA 4E70A 2V26A 3VYSB 2J5OA 2LMDA 1LNWA 2EFOA 3FHZA 3MKZA 4JBAA 1TTYA 1ZGAA 4I99C 4JYKA 4M72A 4Q48A 1YG2A 3E6BA 4OWRB 3S3NA 3C2GA 1NHAA 3LSRA 1Y8QB 2LKSA 3WHBA 4D0PA 3S3MA 3ZQCA 3RJPA 3V8JA 1EF4A 5IOZA 1X3ZB 5DEQA 2CSOA 5TISC 3FM5A 1JXSA 2LTPA 1JI8A 3NQOA 4KDPA 1WQ2A 1WI9A 2JT1A 5EG0A 1T8IA 1SVLA 2OZ6A 2QQAA 3A1YA 5F0CA 2QSGX 2X85A 2DTRA 4A3IJ 1DP7P 1TQIA 4YEJA 5EYRA 3H1CA 3WTWC 3ZN1A 4S05A 2A07F 2KZVA 1MJBA 4MFDA 4A69C 3PIPF 3S1RJ 4XBFA 4RLFA 1MH3A 1MNDA 4O6JA 4B09A 1UHWA 3K10A 2VIXA 2IS1A 1P4WA 1WRJA 1OCTC 3IHUA 5HDGA 3PJRA 2ZB9A 1FIAA 2DQLA 5F04A 2F5VA 2K9MA 4CHUA 1T38A 4BHPA 1R1VA 4RAFA 2WBMA 1KA8A 1E0EA 6PAXA 3A4CA 3KP5A 2CYYA 4BNCA 3GEZA 4HSTA 3O2PE 5FB2A 3MMYB 1YRNA 3Q0VA 2E5NA 2VODA 2H8WA 4EEFG 5FKLA 3IP4B 1Z7LA 1X2MA 3T5XA 1R4NB 5J8FA 2PMHA 4NC7A 1MD0A 3I4PA 1OFCX 3TMOA 4W97A 3TEDA 4XN0A 3CCVI 3G73A 4M6XA 1YO5C 2XAUA 3F8NA 4PGHA 2CQXA 4A12A 3BG5A 3K70D 4RGUA 3CLOA 1QVUA 2DMQA 3O3KA 1UMQA 2A6EF 2E71A 2WB1N 5H20A 4ZDLA 3GTMJ 3BZKA 3LQQA 2QYOA 1TZLA 4B3AA 1ZAOA 2P5VA 3GX4X 2K40A 2XB0X 2IGMA 4CXFA 2H94A 3HTSB 3DBLB 3LAJA 1NK3P 3MCZA 4DBQA 3J7AO 2VXZA 1LB2A 1IAWA 4XL9A 4CICA 4RS8A 3MQ0A 1MZBA 2CGPA 3JTHA 4XLCA 3BY6A 2QBYB 2IS4A 3JREA 3K4BA 3TO6A 3AG2H 3CP8A 3G1MA 1Z6TA 2COMA 2GAUA 1J2XA 4IEJA 3CDHA 1ON2A 2ZJRF 1WJFA 2DDBA 2DDAA 1Q1VA 3T0YA 2JUCA 2R7XA 5JR3A 3CCEI 2XAQA 1SVOA 1W4MA 4XOTA 2XAJA 3DQVC 5F64A 2EZIA 2ADUA 3HOSA 2R7TA 2KISA 2KQRA 4IRIA 2NS0A 4KISA 4A5NA 4IX7A 1STZA 4KITB 3OYKA 4LG3A 3EDPA 4OMZA 1HKTA 2DLLA 4MTDA 2LOOA 3DBRB 2H6CA 3OOPA 4D7MA 2IVMA 1SFEA 3HOTA 1WWXA 2DMUA 2JSCA 2FBHA 1K7AA 2BVLA 1I1GA 3CJNA 3RYPA 4ANJA 3COAC 5HDKA 1VQ6I 3PO3J 3GTPJ 1IN8A 4XKVA 2QWWA 2O5RA 4XONA 5EZHA 4AUXA 3S17J 1IUYA 1BBYA 1NH3A 2WA0A 4XLAA 4N9IA 2CUFA 1PDNC 2Z2SB 3OSGA 3I56I 3OYCA 3DCFA 4J19A 1K61A 1DGWY 1G6NA 4LFUA 2O9LA 4ZJZA 4U0YA 4EM1A 2QQ8A 4XR6A 5EGOB 2E60A 3ZQQA 3TKYA 3PNTA 4WXHA 1JHHA 4KUMA 2XF5A 2HQ5A 2RQQA 4DOZA 2VQLA 3WGHA 1XG1A 2A68F 2W7NA 3W2VA 4HDVA 3RZDJ 2K9QA 2V4JC 1F43A 3HKZA 1QPMA 1MW7A 1OCZH 2R5ZA 1G3SA 3MN2A 2DPDA 1VQLI 2ZSIB 1R00A 1GV2A 2RKHA 3REOA 4L9TA 5D8LB 2DAOA 5KNLA 2I5UA 1U0JA 4BS9A 5HS8A 2B63J 4RB3C 1LKXA 4YIRX 3H35A 2VOOA 3E6MA 3BPVA 4ETSA 2XPUA 1IN7A 3KP6A 3GLLA 4M71A 1TL8A 3DU5A 3GTGJ 2WAFA 5ILVA 3J80K 5BOXA 2DA6A 4IHWA 2W48A 5FROA 3TP0A 4UUSB 2XVCA 1BC8C 2OV7A 4C2TA 5K5OA 2FUG2 4AWXB 2FA5A 2LVSA 3E5QA 1VQKI 3WE2A 2IP2A 5C4XJ 3J80Z 3BLYA 3KPHA 2IT0A 3HOVJ 4GYGA 2VC1A 3D5LA 3CF2A 2XUBA 4KA4A 1I3QJ 3GWZA 5ICGA 1MDMB 2ZFWA 4EGZA 1S7AA 3MFKA 2JTVA 2VASA 3IUOA 1EV7A 5DCMB 5HLTA 4S0HB 2BY2A 1BM9A 3F23A 1FZPB 3I55I 1ZHFA 3BR3A 2MC3A 4ENJA 1EH6A 1FP2A 2Y69H 2W00A 1U9OA 3DPTA 2LNBA 2V7FA 2XSDC 3BCAA 2VL8A 3ZN0A 3CO6C 1X3WB 2DQRA 4HX4A 1ZKGA 3HOUJ 2L5QA 2DA4A 2VT2A 1R23A 2HNHA 2JN6A 2YSRA 3IRQA 3EUHA 2K3FA 2MC4A 3ASNH 3K1PA 5JLXA 3P5JA 3LWFA 2R5YB 2OQGA 1TT0A 2CFOA 4A0YA 4XLEA 4MGRA 4BJ6C 2CFXA 2DA7A 3PUFA 1R5HA 5LBQA 1YS7A 4FHTA 3J81K 2MABA 2X6OA 3IL2A 4O3MA 3CC2I 2L4MA 2XRNA 3KP3A 3D0SA 3WU2C 3DPLC 1LQ1A 2F6CA 3BP8A 2VBWA 1HQCA 1MGTA 1MSEC 2DA3A 1A04A 2COBA 2ELJA 2FEZA 3C2BA 3HIFA 3BWGA 3J81Z 1MJAA 1U9NA 1J59A 4R1HA 1K79A 2EBIA 4E7SA 2R93J 2KL4A 3KEOA 4UV8A 3OYGA 1RR8C 1CQTA 1R1TA 3QP6A 2FNPA 1JKPC 4BHCA 1XGSA 3WTYC 1C0WA 1VQNI 1MBEA 3T8RA 2VJ4A 4XSZF 2E1MB 2NOJB 3PNYA 1ZN2A 4MNUA 1SFKA 4IHTA 3DBHB 3WODF 3P9CA 2L7FP 4EGYA 2YPRA 3OIOA 1BJAA 2WAQA 2E7WA 4UV9A 1ACIA 4X0GA 2XPWA 4LG0A 3TDUC 3R60A 5FO5A 4A3FJ 1J0RA 4IHVA 1YHQI 1KQ9A 1W36C 4I0BA 2HOEA 4ZYEA 4J00A 2FF4A 3GVAA 2KRFA 4XKWA 4BJTA 3I5UA 4IO9F 2GXAA 3TQNA 1PJRA 2IEKA 4MEYF 2LBFB 3GZNB 1OR7A 4PK4A 4HRIA 4F52A 1U6GA 4IKFA 2LLKA 1DP3A 4G94A 1XGMA 3ZMDA 1OYIA 5DCMA 1VI0A 4OIRF 3BROA 3DKWA 1JKRC 3ABKH 3ESWB 2Z33A 2ZJPF 2UUZA 2MG4A 5K1YA 2ZXIA 3E6CC 2VQHA 4FE7A 3K1MA 1PP8F 3KYLA 3LFUA 1IUFA 1Y0UA 3K7AJ 3TO7A 1RRJA 2VKHA 3LSJA 1UG2A 2UWMA 1E17A 1VQ7I 5FLMJ 1JTYA 3PSIA 2QM3A 2FBKA 5DUIA 2HEOA 3KP2A 4YFNF 2IS2A 5DYMA 4Q47A 2LKPA 3M1EA 1E3HA 3LL7A 5FKOA 4A3DJ 4UVAA 1A6IA 3H0GJ 4NNJA 1UJ8A 3SZTA 2P7CB 2RN7A 1BL0A 1DDNA 3FMSA 3GBGA 5LFAA 1RETA 1W7PD 1ZRFA 1T98A 3LQRA 3ROUA 4WK8F 2K7LA 2LY2A 1O3RA 2XGXA 1U5TA 2HQNA 2VQGA 4PSXA 1BIBA 5KHDA 1HKQA 2VC0A 2WAEA 2NXNB 2FE3A 2PMUA 5LRRA 3M8FA 4G6QA 4II2A 1JJ6C 2XKPA 3OY9A 2M3AA 2QEXI 2QGUA 1BI2A 2IPQX 1YW9A 3L2RA 1Z0XA 1B4AA 3GTOJ 1D8KA 4RAYA 4U0VA 5CLSA 5KAIC 4XKCA 2KDOA 4QPOA 4GO1A 3CMYA 1A6QA 3ZMVA 3CDLA 4U7DA 4AU7A 2OCEA 3EYYA 1F5TA 5KCMA 1MBKA 3VFZA 5M3MJ 1XTAA 1IJWC 1ZLKA 2JJ7A 3L2QA 4AM3A 3PUBA 1V4RA 4HW0A 1P92A 3S1MJ 3T1BA 4BEHA 3IH4A 3KEYA 1KYZA 4L9NA 4E7ZA 1VQOI 2EFPA 2M5WA 3MVPA 2X1EA 4CCOA 3GW2A 1UB9A 2Y0MA 3VEPA 4DNCA 4Q5SF 2A6TA 4BL0B 1W5SA 4F92B 3NAUA 3FM3A 3VODA 1WH7A 2DOFA 4IQJA 1D0XA 2GOMA 2XIGA 2HR3A 3H0DA 1FOXA 2LYCA 4PFPA 2ZSHB 4UNOA 5J47A 3MWMA 3AL0C 2JUGA 1FTTA 4A3JJ 1WZ2A 4FISA 5TGTA 4E7HA 3MZYA 2E2IJ 3DLAA 4M9XA 2JRMA 1X2NA 5F1JA 3EUAA 4LLNA 1E3OC 2Z9OA 5LD2C 5J3LA 1WI3A 2KJBA 1OLTA 4Z6YA 1B72B 2GLOA 2NNYA 4ZYHA 3BG6A 3JRIA 4KIFA 4LB6B 2D1HA 4KFCA 2F2EA 1D5YA 4ZDPA 3DPUA 2KKOA 3V8LA 2R0QC 1RUNA 1IDYA 2R7WA 3GXOA 3QU3A 4IXAA 5ILSA 2XC7A 2K5CA 1YOVB 1QGPA 1XGOA 5KK1A 2R92J 3HSEA 4IZZA 4KT6A 5LGTA 1T0FC 3P9IA 2LSOA 2PN6A 4P5OA 2VE8A 2K27A 2EIMH 1LVAA 4U87A 1RKWA 4XKBA 2ICWG 3RIRA 3RPUA 4D1QA 2VBZA 3G4SI 3K70C 2C6YA 2WV1A 2F4IA 3E3VA 3HKZN 3I64A 3K4CA 2VKEA 3AKZA 3LA2A 1HCRA 4IOCF 1FYKA 1MBGA 1H0MA 4UXNA 3G1LA 5K5RA 3B73A 2E5ZA 3WHCA 2XROA 3DLLF 3LSKA 5CYVA 2BGCA 4HV6A 1IRFA 2VKVA 1HDDC 1T95A 4D5FA 3SHFA 5IYCJ 3MZHA 4LMYA 3PFYA 1N77A 2K3PA 1AOYA 3PQKA 4EQQA 5J1RA 5EG0B 3E0JB 3OYLA 4BACA 2F4OB 2K9SA 1ZRDA 4RAGA 5BS6A 3E7LA 4E6KG 5J1YA 2BBYA 2HYGD 1D5VA 2E7XA 2M8EA 1P7IA 1P4XA 3HOZJ 1IDZA 2F5CA 3MKLA 3ZCOA 1A31A 3IWZA 2CW0F 3HC7A 4DYCA 5M3FJ 2NOGA 2H1LA 2QQ9A 3S16J 4N9HA 1G3TA 3OYNA 2H27A 1EA3A 2NVQJ 1IV8A 2O6GE 4XM3A 3S2HJ 4Y7NJ 4PJMA 3Q5FA 4LJZF 1J7KA 3EPZA 3MD2A 2HVRA 2PJRA 3TL4X 4YELA 3WG7H 2LP0A 1JT0A 2TDXA 4EM0B 1U2WA 3H5AA 2Z99A 2RREA 2EFNA 1SAUA 4GRIA 1RZ4A 3L9FA 1YRNB 4B4CA 4E7KA 3BPXA 3DP7A 3TBIA 5BMZA 2XF6A 5EDNA 3PSFA 3QODA 1OMIA 2CRGA 2A5WA 1RUOA 2KMUA 3ABUA 4JX5A 2DOAA 2V6CA 2ESNA 1QZYA 1A35A 2R7OA 4OINF 2V1DA 1KU2A 2HQRA 1ZGWA 2A69F 3S3OA 1Y0NA 2JVHA 2VPLA 3IH3A 1V5FA 1XDUA 1IC8A 3S2WA 3BR6A 3F22A 4ZC3A 3ERMA 2MSYA 1L0OC 2Y0SA 1PUFA 1QZZA 2NYXA 3TOAA 1XPXA 1BC7C 5GP9A 2UZKA 3RI4A 1RC9A 1M1EB 1APLC 1ZK8A 3BC8A 3CLQA 5K7ZA 2RDPA 1YFHA 3MKYB 1J9IA 4MTEA 5C44J 1IZ1A 2GXGA 3GYHX 1YJNI 1FPQA 4C2MJ 1FBSA 2EINH 2HQAA 2HYJA 3M8JA 4ZYGA 2PI0A 4KIGA 5J8CA 2NNNA 5C4JJ 1IRXA 2BHZA 1XN7A 4AD9A 4A93J 3FMRA 4XRSG 1TNSA 4DYQA 3H92A 2FQ3A 2IW5A 2JK3A 3KIOA 2E34A 2BY1A 1YJ9I 4ENKA 5ICCA 3C1DA 3HPGA 1HLVA 3KYDB 5FD6A 5EEAA 2VPRA 2VJ5A 1SANA 3KZIC 2ME6A 2V9VA 1AKHA 2P6SA 4RAZA 4E7IA 1XGNA 4NB5A 4IQ4A 4ZZLA 1HXDA 5D5WB 3CJTB 2M34A 3PFIA 1FLIA 3NRVA 3U2RA 3OS1A 4XK4A 4U7BA 1MMNA 2CG4A 3F8BA 5CVUA 4EV0A 2IS6A 3TP3A 3HYIA 1JGGA 5J40A 2BY0A 1X1PA 5AIPA 3G6EI 3GLXA 2H6BA 1Y1WJ 4P9UA 2PJPA 1R6RA 4CCLA 1UCRA 1SD5A 3G2BA 5IP7J 4XRMA 2DT6A 2YX4A 2EFWA 2L0KA 2LY1A 4B47A 1MBHA 1B1BA 2X1DA 2DFEA 3V7CA 1Z67A 2G7HA 1D0ZA 2EZLA 4I6ZA 1FYLA 1D1CA 1YQAA 2R5ZB 3FWEA 3FXKA 3LNQA 3DTEA 3VYTB 2ISZA 4ENNA 4UB6C 5HS9A 2HOAA 3H9GA 5HLGA 4BHBA 2W1OA 3SZGA 4RGXA 4LK1F 3LSGA 1B9MA 5L3DA 3QAHA 5M5YJ 4U0WA 1YI2I 5TJJA 2M45A 5D6FA 1WJBA 2YR2A 1IXSB 2CWEA 1YX3A 4I98B 4RMNA 4RGRA 5J4YA 1R7JA 2RC4A 3IC7A 1BN5A 2AHQA 4PJLA 4EJUA 5M5WJ 4CCNA 2LR8A 2VT3A 2STWA 4XLNF 3L2CA 4J01A 3HTUA 3Q0UA 2EB7A 3ZQLA 3DXJF 3IV5A 1K78B 1B8IA 1ODDA 1WJEA 2JA7J 5GPAA 4NDLA 4RB2C 4IHXA 3S1QJ 1H9GA 4IPAA 1GVJA 2F5DA 1X1CA 3OL4A 1D1AA 3QQAA 4UVCA 5FKMA 3SXYA 5K5QA 5C3EJ 4I76A 3V4GA 5LRSA 2N8GA 1VQMI 4D9JA 3DEUA 2IGNA 3CMMA 1G3YA 3VSLA 1R58A 2KHMA 5JHFA 2F4MB 2CQKA 1ZG5A 3LFKA 5B1BH 4HNUA 3GZ6A 3DKXA 2P8TA 1S7OA 1ZGJA 2HTJA 1JUMA 3TOBA 3Q9SA 4HLYA 1FSEA 2QSFX 4A6DA 2HDWA 3IAS2 3K1NA 3MKWB 4V2GA 4AYBN 5B5EC 1SMYF 4OIQF 1HF0A 5DM7F 3F8MA 4BDZA 1WFXA 1BIAA 2DA2A 2MW8A 2W84A 2OD5A 1QPIA 2E2JJ 1R71A 3H9JA 3HDDA 2VLAA 2HS5A 1SFOJ 2JRTA 1RKTA 5E3NA 1UG0A 4YFKF 2NVYJ 5FLXK 2HVQA 5GTIC 3EYIA 4IJAA 4CGZA 1Y8RB 2LG4A 1TWCJ 2IBDA 4II3A 3J7ZI 3K4NA 4YIFA 1FEXA 2V6EA 4HSRA 4HF2A 2WC2A 4HG2A 4AVZA 5FLXZ 2RAEA 2WV0A 2R7DA 4Y52J 1HA8A 2W24A 4C2UA 1FX7A 1VNDA 4A3LJ 4EMSA 4KNYA 2YS9A 1XCBA 3ZQIA 1KYWA 3K9TA 2DMNA 3RQIA 2BE5F 2FMYA 4X1EA 1LVKA 2O7OA 3ZMUA 2PX9A 4MHGA 2FJ1A 4EJOA 3HBLA 4D7NA 4QWQA 2EV5A 4L5EA 4BXXJ 1JT6A 1Z7UA 3HM5A 1F4KA 1MMGA 3OL3A 1POGA 1AHDP 2WY8Q 3QYEA 2HGCA 3M07A 1UAAA 2QENA 1H9TA 1ETYA 3WTVC 2DMPA 1OYYA 5E18F 4A3MJ 4LG0B 1H8AC 3GUDA 2OUMA 3M8EA 1X1DA 3FXMA 1LE8A 5IPAA 2K9LA 2R7FA 4NUBA 3SFIA 4E7LA 4G12A 4P55A 2EJRA 3CMEI 2VUMJ 2EWNA 3T8TA 3JAMZ 3FKJA 2JSPA 1CF7B 1HDPA 1K78A 1YITI 1T56A 4YG2F 1ZYRF 3DTIA 1TLHB 2BW3A 4LIUA 4ASNA 1R5ID 4L9JA 4B3XA 1AWCA 3D1NI 5HNHA 1S5LC 3WU1B 4FTHA 1T2KA 4C3IJ 1ULYA 4LOCA 4B43A 2KIMA 1JGSA 1TNTA 3PNVA 4BH9A 3RKQA 2LF7A 1P7JA 3RZOJ 2A05A 4LITA 2ID6A 4DJAA 1VQ9I 2RNGA 3F6OA 2KLOA 1YE9A 3B02A 1BI1A 1V3FA 3HSRA 1XC5A 2HTSA 4C3HJ 1TWAJ 3BZ6A 4RLQA 5JI6A 4ESBA 4HF1A 4M6YA 5J4VA 2QUFA 4XLPF 3WTZA 3VYRB 5ED4A 2O61A 2KDZA 3RKWA 2VKDA 1B6AA 4A0ZA 2WTEA 1V55H 1X4OA 2O3FA 4BJ5C 2MH9A 2IAIA 1X4PA 2XB5A 3Q0WA 5E1XA 1FBUA 2EILH 5FLVA 2MD5A 1K4TA 2RVCA 1GUUA 2G7UA 2QZ8A 1USTA 1QNTA 1ETWA 3QPTA 2EV6A 2NVTJ 1JKQC 3BOQA 1GHCA 1GXPA 3ZR8X 1ZG3A 1U5TB 5DV5A 2GXBA 3I71A 2K02A 4RB1A 2O03A 3ZOBA 2DA1A 2BXZA 2F5FA 2PEXA 5HOOA 1B59A 2R7RA 3CUQC 4KIBA 2ZXJA 1BR1A 1HBXG 1EKEA 4GFBA 2UV1A 4C30A 3RPUD 1S8NA 2CQNA 4AIDA 3QU6A 3D5SC 3FF5A 1JTXA 4XQFA 4IVNA 1OJLA 2LH9A 1T0FA 1MMDA 4XN3A 4WWCA 3BG7A 3W2WA 3GFIA 5JVGF 3ZXSA 4C3JJ 3FMQA 2DI3A 4CYDA 1QA6A 1RR7A 5LEKA 4QSHA 4A3KJ 3UR3C 1TC3C 1ZH5A 3S2DJ 5J6XA 1Z9CA 3CD6I 1S6LA 4B1RA 2DO7A 1ORKA 1MKMA 5HLHA 3KYCB 4BEHB 3I4MJ 4IL6C 2RQPA 1ITYA 2WY7Q 2LD5A 1QO0D 1IXRC 4K2EA 2DFHA 5CVRA 4A3CJ 1ERDA 1I6HJ 5GAEJ 3M3YJ 2O8KA 5DD4A 3RYRA 1CF7A 3BQZA 5HDNA 3HHGA 2O0YA 4AIJA 2JZYA 4PZJA 2ZBKA 1KU3A 3HGYA 2DT5A 5CJ9A 5E1ZB 2CV0A 1WVRA 2FMLA 1YJWI 5B3SH 1FMWA 5LHGA 3H5NA 3DU6A 3HZJA 3PL8A 4HNVA 4HF0A 2L9VA 3QRFF 5F6FA 5HLIA 2Y48A 3F72A 5L3FA 3JR9A 2UXXA 4H0EA 3LAPA 3Q3SA 4M74A 2VB6A 3M4OJ 2Q2EA 3CCJI 1MSFC 4HYEA 4AIHA 5KVRA 2BXYA 2RGVA 3I9V2 1MMSA 3FHNA 1DPUA 2GIZA 2P5LC 3OV8A 2KRHA 3OYAA 3I54A 3WE3A 2R3SA 1IGNA 3U1KA 4BXUA 3H9QA 3OYJA 5FKNA 4UY8I 4EVIA 1S72I 4BU2A 1MBFA 4RB0A 4BYYA 1O7FA 4A3EJ 2JVGA 2B9SA 1IV6A 4AVPA 2BHYA 1W0TA 2GM4A 2NRAC 3K4JA 1LFUP 5H2FC 3L2VA 3A0BC 4MEXF 3TGNA 5DDGA 3QWLA 1W5CC 4UHTA 5FJ8J 4L9VA 5FKKA 2HPMA 1PUEE 1XCVA 2AXLA 2DJIA 1I3AA 4PJ0C 4BY7J 2OF7A 1O3TA 1D1BA 1FOWA 5E17F 4RGSA 1P4AA 3FXLA 4ON0A 1O7LA 3NEUA 3W6JB 1ZTRA 3UKGA 1J75A 2CQQA 5BPDA 3JSPA 1T33A 2K4JA 1F1ZA 1A36A 1G4DA 2CW8A 1N78A 1K4SA 1J5YA 3KCCA 5CVJA 1RNLA 1YW7A 2P81A 2L7MP 4ZDOA 4KN7X 3N4MA 2KP6A 3HL2A 3GTQJ 2YUSA 2CUEA 3NWTA 3U21A 1QVTA 3VOEA 1LFPA 4XMYA 2LDUA 3JTGA 5L3CA 2I10A 1K6YA 2CH0A 4CO8A 1JUPA 1Z6RA 1QHHD 2L54A 2E36A 3ML6A 2Y9ZA 4HBLA 3HRMA 1P2FA 3BJOA 2QA4I 1SD6A 2BZTA 2V79A 3HSFA 2DA5A 2W25A 3ULQB 2PJRB 3VWBA 2EZKA 3HOYJ 5B66C 2DT7B 2PQ8A 3FDYA 4KYWA 3S14J 1HSJA 2ZNYA 3E5UA 3CZ6A 4XRSA 5GADJ 5ICEA 3K2ZA 2VBXA 2G9WA 5ICFA 1Z3XA 2L7ZA 1IXCA 4B48A 1Z3YA 1GDTA 2JA6J 1HC8A 5JHUA 1R22A 2M7BA 5FGMA 3QPHA 2M0CA 2FOKA 3FK6A 4XLFA 2BEOA 5J1UA 3R6SA 4CYCA 4P96A 1SEUA 4ZYAA 1TT5B 3FISA 1K6OA 2W85A 4BQOA 3GF2A 4G7ZF 1E2XA 4EATA 4OMYA 1D8JA 2JPBA 4OOIA 4PUSA 1U78A 1DUXC 3ECOA 1EJ9A 4OU0A 4I0AA 3ZQHA 2DMTA 4YIIA 4DBRA 4G6TB 3CCUI 3K4MA 2FSWA 2IA1A 4DQ2A 3H3UA 2CV1A 4BKXA 1G8XA 3D5RC 1PUFB 3K6GA 3BJAA 3WTXC 1H89C 1EH7A 1Z91A 3BT9A 3MEXA 2Q8KA 3F3XA 4PFOA 5CQGA 3ERED 5IT9Z 1FP1D 4CA0A 3QPSA 2AO9A 4Y33A 1S9HA 5IY5H 3OYDA 2VQCA 4I01A 3CCRI 5E20A 3IWFA 2WWYA 5AONA 2XDVA 4NBQA 5FRMA 2Y75A 1BR2A 2O8XA 4XLHA 2ZMEC 3RQ4A 5JFRA 2F48A 3EETA 3O8HA 4F93B 2ZJ2A 3CP2A 4HLXA 1OCCH 2HWVA 2JA2A 3L00A 1OQYA 1D0YA 3NWSA 3PO2J 2UXNA 4M3EA 2MFZA 1AKHB 4Y3OA 1KZHA 2EH3A 3HB9A 2XASA 2VN2A 2G0EA 4CCKA 4ESJA 2DN0A 2VI6A 1LFBA 4CCJA 3JRDA 3FXUA 3V42A 4HQMA 4TV7A 3SEZA 1XMAA 3HHHA 2JWTA 1TW2A 2CU7A 3HGGA 2MBFA 2X51A 5KAFC 2BV6A 2XGDA 1YX5A 4KN4X 5IYBJ 1NG6A 2HI3A 4L5JA 3F6VA 2JA8J 1SFUA 2KIQA 1WJCA 1JJ8C 1RI7A 4JOMA 1I6XA 2V1XA 3J7AY 3DF8A 5AIQA 4HNTA 1GVDA 4X6AJ 2EQRA 2OJED 2CUJA 3I4NJ 4RM3A 2XSJC 4IOAF 1UFMA 3VDXA 1QBJA 3WG9A 3SQNA 3AFHA 2LKXA 4ZTJA 2NS8A 4PDKA 3QP5A 3C2HA 4LGWA 3CCQI 3CESA 1RIOH 3ONQA 4DW6A 3M9AA 4M3BA 3OYMA 2TRTA 2HXOA 5LHIA 1HW5A 1MH4A 1PVEA 2MGQA 4AIKA 5HNFA 3OIQA 3RCOA 3SFZA 2XRLA 4N0BA 2ZC2A 2MH2A 2OAZA 1XMKA 3FBIB 2OZUA 2X6XA 2E35A 3HEFA 4KICA 3LSHA 4PJJA 2M87A 3ABMH 2QKLB 3IRRA 4A5MA 1XMXA 1ON1A 4FASD 1H88C 2PG4A 1B8IB 2B0LA 3HG9A 1X19A 2L9NA 5GPCA 1P6RA 3OYFA 3HOXJ 1VTNC 5D5UB 5LGUA 2FXAA 2HOSA 2WAQN 2DFIA 1OISA 2KIFA 2WADA 3UNGC 5IP9J 2OQRA 2L9SA 3LSTA 2LRDA 4IHYA 2JQ7A 1T08B 4FX0A 4AC0A 1S29A 2PLYA 1O3SA 3RKXA 1SVMA 3Q9VA 1O4XA 2HU9A 3WGIA 3JRCA 3HUGA 2DXIA 5H6RA 3ZMZA 3OS0A 1VQPI 9ANTA 3O6BB 1B9NA 1REPC 1CGPA 3I0TA 1SC7A 2L9RA 3E5XA 3G71I 4EJVA 1NK2P 2ZO4A 2HZTA 4BY1J 3FZVA 4HX8A 1FC3A 4R79A 1WHUA 3HRUA 3SJMA 3FX3A 1RPWA 3C3WA 2ME0A 1U3EM 1JUSA 3SDBA 3RKYA 3CJQB 2K86A 2ISYA 2OU2A 2IRFG 4FCYA 1VZ0A 3KP4A 2DBBA 2FD5A 5DS9A 3QOEA 2AS5F 4PGGA 4XSXF 3ELKA 2EZHA 4PSWA 4S04A 5D4SA 2IJLA 2KT0A 4I7HA 5FFXA 1TWGJ 4NQWA 1G59A 5BPIA 2AQEA 3H3VK 2MLGA 3OYHA 1FOYA 2LF8A 2R4GA 1LDDA 1X1BA 5HVQC 1FSHA 1I39A 2GIVA 3VSKA 2OA4A 3S93A 4XIDA 3W6VA 3VPRA 3RDIA 2F5EA 3KETA 2A5YB 1DPRA 2JMWA 3JRFA 1FNNA 2XPVA 1GV5A 1ZRCA 2OC6A 1USSA 2OBPA 1LEBA 5E3OA 3U9GA 1E3PA 2QCOA 4MFEA 3KLOA 2EIKH 4XOPA 3SYTA 1DU6A 3U1DA 1XDSA 1FT9A 2W4SA 5L3BA 1R5GA 1X58A 4KT5C 4MQVA 4CCMA 3CUQA 4L0ZB 1LE8B 2QVOA 2R7SA 3GZ5A 4JK1X 4UUVA 1R1UA 2HYFA 1ETQA 4A2UA 1O57A 1XB4A 3M1CA 1ZREA 2D45A 2JA5J 1FIPA 2R7VA 4ITVA 2GBYA 1XSXA 2BY3A 2M1BA 2BW3B 3CO7C 3F8CA 2D1VA 3A01A 3K2AA 4HZFA 2OTJI 1MJ9A 3W6KB 4QTRA 1HOMA 2VBYA 4Q4ZF 2EK5A 2ZJQF 3BTLA 1Z77A 4JP0A 3DTKA 3ABLH 1OCRH 2VJIA 4DIQA 2HPIA 2EA2A 2XGEA 3IKVA 2B7EA 4IRHA 3KE2A 2J5PA 3OIPA 4UB8C 3FXJA 2Z3YA 2NVXJ 2VXDA 5CVVA 1Z1DA 2XF7A 4H4KC 2DODA 4P9FA 3OYEA 1PP7U 4BAYA 1HW1A 3BTCA 4BQNA 1WJDA 5L3EA 2ZXHA 2GWRA 3KLNA 3QYFA 4RM2A 1TW3A 2A6HF 2PMZA 2XHKA 4PJNA 3JRGA 1DU0A 3AL0B 1TWFJ 5E79C 4NC6A 1FYMA 2K85A 4A6EA 4DZJA 2FQ4A 2X1CA 2BVMA 3HOWJ 5IOYA 3G3ZA 5BQTA 2STTA 4QIWN 2E19A 1V5EA 1YLFA 5EEGA 3ZMSA 2AXTC 1QZEA 2AQFA 1KQ0A 3DEWA 2A3SA 1QRYA 2XV4S 1TQMA 2HDCA 2ESHA 3CCSI 2YU3A 2HKOA 4RDUA 1XD7A 1OPCA 4KMFA 1MMAA 2P5KA 1F9NA 2Z5UA 2KFDA 2M8GX 2CJJA 1S7EA 3EQLF 4M9ZA 3CMAI 3SDGA 1IN6A 4ZYDA 4WCGA 5F08A 1MNMC 3ZRGA 3DFGA 4ABZA 2P6TA 1SAXA 1BW5A 2Y31A 4FQGA 5EF6A 2FOWA 5D8KB 3JAMK 4KJZA 4BGDA 1EH8A 1KU9A 3C18A 4I02A 2H1KA 3HRTA 4BXFA 5D4RA 1A5JA 3WTSC 4BE2A 1ETKA 2E1OA 1ZG1A 5CPRB 3GMEA 2Y9YA 4LD5A 3CCLI 2D5VA 1I5ZA 4LLGF 3R61A 5IT3A 4UVBA 5CKTA 5DUKA 5E3MA 3R0JA 3JRHA 2K9NA 2OPTA 1QU3A 1NG7A 1SD4A 1ZELA 2ZMEB 3JRBA 1W0UA 1SFXA 1TP4A 3OR1C 1R9TJ 3CCYA 4HX7A 2MLKA 1WH5A 4HDUA 1FOKA 2X4HA 3TW7A 2GQQA 2HDDA 2FX0A 2QBYA 4HPQA 2CS3A 1QHGA 2DTZA 2ZFUA 4XRFA 1ZQ3P 2GZWA 3CQZJ 1I27A 1KGSA 2MA3A 1LEAA 4ZZDA 1IG7A 4BQAA 2OCCH 5GAHJ 3E1SA 2CMPA 4LLLA 3CCMI 4G6DA 2K4BA 1TWHJ 2Q2EB 2QKMB 3TW6A 5TRDA 3G1OA 5E1WA 2VONA 2QSHX 3MZ8A 2RV8A 2IGKA 1I50J 3HPHA 1ZARA 2CO5A 2DCEA 4W1UA 4F3QA 1Z21A 3R4KA 4FT8A 5M5XJ 4L5IA 4BE1A 3WGGA 2MYSA 5LLQA 2L01A 2QQBA 4G8XA 4HQEA 3V8KA 3BJ6A 3CDIA 3FXOA 3K4KA 4WXCA 1I1SA 3L7WA 3VB2A 5JLWA 1AU7A 1ZR4A 2GA1A 2MD0A 4BE0A 2L7KA 2HVSA 4A0XA 2HFHA 1U8BA 5EJCA 1G3WA 2Q1ZB 3V7RA 2P4WA 2Z16A 1T39A 1T6SA 3ISPA 4OIPF 1DQUA 4MLOA 3BZCA 4CDGA 2QLZA 3WTTC 2HXIA 2FU4A 4LK0F 2W82A 3FK7A 3P9KA 5B1AH 3CC4I 5EGOA 2ECCA 1IN5A
chains in the Genus database with same CATH topology
2BZTA 1UJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZT A;  1UJ8 A; 
#chains in the Genus database with same CATH topology
 1GXQ A;  3RSN A;  3LSM A;  3RTR A;  2Y0S N;  1JKO C;  4Y15 A;  3BG3 A;  2ZKZ A;  4MIM A;  5DTD A;  1N25 A;  1YW8 A;  3KZY A;  5JVT A;  3ZMT A;  4F91 B;  2ID3 A;  4M6V A;  3KX2 A;  4G7H F;  4NHJ A;  4L18 B;  2E1C A;  1ENH A;  3L2W A;  2M7A A;  3LA7 A;  2CV2 A;  2DW4 A;  2M0M A;  4WXD A;  2R7Z J;  2R7Q A;  1DGR M;  4DGW B;  3ECH A;  5DD8 A;  2Y2Z A;  4A3B J;  4E7J A;  1J09 A;  3JSO A;  2IA0 A;  3CTA A;  1MNE A;  3BG9 A;  2ZME A;  2VE9 A;  4UUS A;  2KRC A;  4RA2 A;  4D5C A;  2P0W A;  3FBN B;  1F36 A;  5ILU A;  3LSI A;  1LPQ A;  1Y56 A;  3I59 B;  5FRN A;  3H5R A;  2L2O A;  2DU9 A;  2P7V B;  2V1N A;  3QPL A;  4QLC U;  1JE8 A;  4MQ9 F;  4GDF A;  4OIO F;  2LY9 A;  2DK8 A;  3O8G A;  5K7F A;  3OWT A;  4BDY A;  1ZR2 A;  3OYB A;  3WU0 A;  1IW7 F;  1FJL A;  1IRG A;  1MDM A;  2V9K A;  2D2W A;  1KON A;  3OSF A;  2NS7 A;  3FXR A;  4O5V A;  1U8R A;  3AAF A;  2E2H J;  4L0Y B;  1TQP A;  4IHS A;  1OCP A;  1VF9 A;  1BA5 A;  1VQ8 I;  4CYC B;  2M9H A;  5F0H A;  1XS9 A;  2X6W A;  2CW7 A;  3L09 A;  4B8X A;  3S8P A;  3CJR B;  3ZP5 A;  2M4G A;  1TBX A;  2M4K A;  2DK5 A;  1YS6 A;  1BJZ A;  3VYU B;  1IRZ A;  2ELK A;  4G9Y A;  4ENM A;  5LGN A;  3HXL A;  5F27 A;  2NAZ A;  2KJC A;  3BR5 A;  2H8R A;  2R5Y A;  3H3Z A;  5IP6 A;  4C9Y A;  1W1W E;  2DYS H;  2ZXW H;  3B6C A;  4V2F A;  5CVI A;  2EIJ H;  4IF4 A;  3ZPL A;  4NC8 A;  2A61 A;  1WJA A;  4G7O F;  4M3D A;  3OOU A;  4EM2 A;  2WB1 A;  1HKS A;  5EZG A;  3OS2 A;  3S1N J;  3GO5 A;  3OR2 C;  3GCM A;  3J7Y J;  5E8I A;  1YTY A;  4LB5 A;  3JW4 A;  3L2U A;  1YYV A;  2ETH A;  3K69 A;  2CQ7 A;  3TDZ C;  2PFB A;  2XAH A;  5E3L A;  4DYR A;  5D5V B;  1VFC A;  5D6E A;  3LMM A;  4RBO A;  3BQY A;  1Y39 A;  1S3J A;  3F9K A;  3FIW A;  2DOE A;  1W5T A;  3L1P A;  2NVU B;  4HEA 2;  2XGC A;  4BBS J;  1UHS A;  1FY7 A;  2X0L A;  4U88 A;  1X3U A;  2V1U A;  2VOP A;  4R8H A;  1D3Y A;  3JRA A;  3KZZ A;  2DPU A;  1SD7 A;  5HS7 A;  2FRH A;  3LOC A;  3AG4 H;  4IRG A;  2VJJ A;  5CQE A;  4CUG A;  3E97 A;  3FXQ A;  4GYI A;  1IF1 A;  1BI3 A;  5DCF A;  3I59 A;  2ZCW A;  2GA2 A;  1R49 A;  3BR1 A;  3BR2 A;  1QQI A;  2RNJ A;  2PMZ N;  3GTL J;  2XKO A;  1XX5 A;  3HRS A;  2QF7 A;  4Y4R A;  3BTI A;  3CF5 F;  4EJT A;  2LBF A;  2Z1D A;  4I2O A;  2EPF A;  1LDK B;  3BCB A;  4AYB A;  4M3F A;  3EUH C;  4OAZ A;  2LK2 A;  2X48 A;  1X1A A;  4KMU X;  3S32 A;  3X2Q H;  2X9D A;  1P9Q C;  2LFB A;  5L3G A;  1XSD A;  2HOT A;  2YU9 J;  1Y1V J;  1BR4 A;  4I09 A;  4XIC A;  1R4M B;  5HOD A;  3DWL E;  3A2K A;  3ZQG A;  4ZTF A;  1MIJ A;  1KQ8 A;  2DJN A;  3KP7 A;  1HW2 A;  1GT0 C;  4V19 K;  1ZLJ A;  1BW6 A;  3K4L A;  5F0F A;  2DYR H;  3E6D A;  3LA3 A;  3GFJ A;  1VQ5 I;  4JX6 A;  4LIV A;  2M2E A;  1WSU A;  3AG3 H;  2H09 A;  1KU7 A;  1IN4 A;  2M30 A;  3GFM A;  2LRE A;  4JX4 A;  1JHF A;  3PM1 A;  2KIU A;  4M73 A;  5IT9 K;  3I58 A;  3IAM 2;  2Q0O A;  3OMY A;  4HV5 A;  1AA7 A;  5H6Q A;  1W7P B;  3LSP A;  2KZG A;  1BOB A;  2ZNZ A;  2FNA A;  3V7S A;  3KFW X;  2R7U A;  4FX4 A;  1FWZ A;  3EUK L;  1HST A;  3GFL A;  3NAR A;  3K0L A;  3BTJ A;  1YIO A;  3ASO H;  2YX7 A;  4N4N B;  4HAM A;  5EEH A;  5LHH A;  3CC7 I;  3W2A A;  1WCM J;  2ECB A;  1FTZ A;  2LC2 A;  3IH2 A;  3N05 A;  4XNF A;  5BNG A;  4DZP A;  1LUJ B;  4CSW A;  4QPQ A;  2E1N A;  1BI0 A;  2L4A A;  3QOP A;  2EFQ A;  3RPQ A;  2PBI A;  4F7Z A;  3CUO A;  2X6Y A;  3PQJ A;  5FD5 A;  4CZC A;  5K7H A;  1Q1H A;  1SMT A;  3HUG B;  5ERI A;  5LEJ A;  3F21 A;  2L3D A;  4YFX F;  3A0H C;  4Y17 A;  4F55 A;  3HJE A;  3FKI J;  3MAJ A;  1ETX A;  3BDD A;  2DFF A;  3ABT A;  4MO7 A;  1ONV A;  3W3C A;  1LDJ A;  4Y13 A;  1OR7 C;  1L3L A;  1ETV A;  1BOA A;  3M7G A;  3AG1 H;  1W36 D;  5A2Q K;  2OTL I;  4E4H A;  1FBQ A;  3WTU C;  4Z2Y A;  2XAG A;  2IA2 A;  2HZD A;  2IGO A;  1VQ4 I;  3C7J A;  1WPK A;  5GAG J;  3ZQ7 A;  1OKR A;  3JCU C;  2GOX B;  1MBJ A;  1UEL B;  4BUP A;  1GLN A;  4HOB A;  5IYD J;  4WF2 A;  4WX9 A;  3DV8 A;  2Y30 A;  1R36 A;  4N4O B;  3SEQ A;  5A2Q Z;  1G2H A;  3PIO F;  2W57 A;  4GGG A;  1XSV A;  4FE4 A;  4NQW B;  4UUT A;  1LJ9 A;  3GTK J;  1Z05 A;  3R0A A;  1O3Q A;  3P7N A;  3DKY A;  1V54 H;  3DEE A;  3F0C A;  5DM6 F;  2CUZ A;  4EJW A;  3GTJ J;  4GCV A;  3F8F A;  4GXO A;  1V5G A;  3IKT A;  3ZQF A;  3TO9 A;  3H36 A;  2BYV E;  2L02 A;  1WGX A;  1FMV A;  2V9P A;  4CH7 A;  1RES A;  1K83 J;  1N75 A;  1OCO H;  2KPM A;  4P1W A;  4ZH4 F;  1WKM A;  1B72 A;  1Y6I A;  2XAF A;  2ACJ A;  2I8D A;  4BBR J;  1NTC A;  3BR0 A;  3OYI A;  5D5X B;  1U5T C;  5F1R A;  1UHM A;  3B6A A;  3KEQ A;  3A02 A;  3CUQ B;  3SZP A;  4M9S A;  1YIJ I;  1W7P A;  4HA8 A;  5FFZ A;  3N97 A;  3ZGK A;  2FBI A;  4PCQ A;  4BQQ A;  1OYW A;  4B44 A;  2ELH A;  4M3G A;  2HKX A;  4OAY A;  4CZZ A;  2EA4 A;  1PYV A;  2EV0 A;  1UZC A;  3A01 B;  5GTH C;  3S15 J;  2BOL A;  4XOR A;  3I53 A;  4ESF A;  4A3G J;  4JQF A;  3A03 A;  1WJ5 A;  2E1M C;  5E8G A;  1IO2 A;  2IXS A;  2TCT A;  3I3L A;  2JPC A;  4FET A;  1ETO A;  3QYB A;  4YRV A;  4E70 A;  2V26 A;  3VYS B;  2J5O A;  2LMD A;  1LNW A;  2EFO A;  3FHZ A;  3MKZ A;  4JBA A;  1TTY A;  1ZGA A;  4I99 C;  4JYK A;  4M72 A;  4Q48 A;  1YG2 A;  3E6B A;  4OWR B;  3S3N A;  3C2G A;  1NHA A;  3LSR A;  1Y8Q B;  2LKS A;  3WHB A;  4D0P A;  3S3M A;  3ZQC A;  3RJP A;  3V8J A;  1EF4 A;  5IOZ A;  1X3Z B;  5DEQ A;  2CSO A;  5TIS C;  3FM5 A;  1JXS A;  2LTP A;  1JI8 A;  3NQO A;  4KDP A;  1WQ2 A;  1WI9 A;  2JT1 A;  5EG0 A;  1T8I A;  1SVL A;  2OZ6 A;  2QQA A;  3A1Y A;  5F0C A;  2QSG X;  2X85 A;  2DTR A;  4A3I J;  1DP7 P;  1TQI A;  4YEJ A;  5EYR A;  3H1C A;  3WTW C;  3ZN1 A;  4S05 A;  2A07 F;  2KZV A;  1MJB A;  4MFD A;  4A69 C;  3PIP F;  3S1R J;  4XBF A;  4RLF A;  1MH3 A;  1MND A;  4O6J A;  4B09 A;  1UHW A;  3K10 A;  2VIX A;  2IS1 A;  1P4W A;  1WRJ A;  1OCT C;  3IHU A;  5HDG A;  3PJR A;  2ZB9 A;  1FIA A;  2DQL A;  5F04 A;  2F5V A;  2K9M A;  4CHU A;  1T38 A;  4BHP A;  1R1V A;  4RAF A;  2WBM A;  1KA8 A;  1E0E A;  6PAX A;  3A4C A;  3KP5 A;  2CYY A;  4BNC A;  3GEZ A;  4HST A;  3O2P E;  5FB2 A;  3MMY B;  1YRN A;  3Q0V A;  2E5N A;  2VOD A;  2H8W A;  4EEF G;  5FKL A;  3IP4 B;  1Z7L A;  1X2M A;  3T5X A;  1R4N B;  5J8F A;  2PMH A;  4NC7 A;  1MD0 A;  3I4P A;  1OFC X;  3TMO A;  4W97 A;  3TED A;  4XN0 A;  3CCV I;  3G73 A;  4M6X A;  1YO5 C;  2XAU A;  3F8N A;  4PGH A;  2CQX A;  4A12 A;  3BG5 A;  3K70 D;  4RGU A;  3CLO A;  1QVU A;  2DMQ A;  3O3K A;  1UMQ A;  2A6E F;  2E71 A;  2WB1 N;  5H20 A;  4ZDL A;  3GTM J;  3BZK A;  3LQQ A;  2QYO A;  1TZL A;  4B3A A;  1ZAO A;  2P5V A;  3GX4 X;  2K40 A;  2XB0 X;  2IGM A;  4CXF A;  2H94 A;  3HTS B;  3DBL B;  3LAJ A;  1NK3 P;  3MCZ A;  4DBQ A;  3J7A O;  2VXZ A;  1LB2 A;  1IAW A;  4XL9 A;  4CIC A;  4RS8 A;  3MQ0 A;  1MZB A;  2CGP A;  3JTH A;  4XLC A;  3BY6 A;  2QBY B;  2IS4 A;  3JRE A;  3K4B A;  3TO6 A;  3AG2 H;  3CP8 A;  3G1M A;  1Z6T A;  2COM A;  2GAU A;  1J2X A;  4IEJ A;  3CDH A;  1ON2 A;  2ZJR F;  1WJF A;  2DDB A;  2DDA A;  1Q1V A;  3T0Y A;  2JUC A;  2R7X A;  5JR3 A;  3CCE I;  2XAQ A;  1SVO A;  1W4M A;  4XOT A;  2XAJ A;  3DQV C;  5F64 A;  2EZI A;  2ADU A;  3HOS A;  2R7T A;  2KIS A;  2KQR A;  4IRI A;  2NS0 A;  4KIS A;  4A5N A;  4IX7 A;  1STZ A;  4KIT B;  3OYK A;  4LG3 A;  3EDP A;  4OMZ A;  1HKT A;  2DLL A;  4MTD A;  2LOO A;  3DBR B;  2H6C A;  3OOP A;  4D7M A;  2IVM A;  1SFE A;  3HOT A;  1WWX A;  2DMU A;  2JSC A;  2FBH A;  1K7A A;  2BVL A;  1I1G A;  3CJN A;  3RYP A;  4ANJ A;  3COA C;  5HDK A;  1VQ6 I;  3PO3 J;  3GTP J;  1IN8 A;  4XKV A;  2QWW A;  2O5R A;  4XON A;  5EZH A;  4AUX A;  3S17 J;  1IUY A;  1BBY A;  1NH3 A;  2WA0 A;  4XLA A;  4N9I A;  2CUF A;  1PDN C;  2Z2S B;  3OSG A;  3I56 I;  3OYC A;  3DCF A;  4J19 A;  1K61 A;  1DGW Y;  1G6N A;  4LFU A;  2O9L A;  4ZJZ A;  4U0Y A;  4EM1 A;  2QQ8 A;  4XR6 A;  5EGO B;  2E60 A;  3ZQQ A;  3TKY A;  3PNT A;  4WXH A;  1JHH A;  4KUM A;  2XF5 A;  2HQ5 A;  2RQQ A;  4DOZ A;  2VQL A;  3WGH A;  1XG1 A;  2A68 F;  2W7N A;  3W2V A;  4HDV A;  3RZD J;  2K9Q A;  2V4J C;  1F43 A;  3HKZ A;  1QPM A;  1MW7 A;  1OCZ H;  2R5Z A;  1G3S A;  3MN2 A;  2DPD A;  1VQL I;  2ZSI B;  1R00 A;  1GV2 A;  2RKH A;  3REO A;  4L9T A;  5D8L B;  2DAO A;  5KNL A;  2I5U A;  1U0J A;  4BS9 A;  5HS8 A;  2B63 J;  4RB3 C;  1LKX A;  4YIR X;  3H35 A;  2VOO A;  3E6M A;  3BPV A;  4ETS A;  2XPU A;  1IN7 A;  3KP6 A;  3GLL A;  4M71 A;  1TL8 A;  3DU5 A;  3GTG J;  2WAF A;  5ILV A;  3J80 K;  5BOX A;  2DA6 A;  4IHW A;  2W48 A;  5FRO A;  3TP0 A;  4UUS B;  2XVC A;  1BC8 C;  2OV7 A;  4C2T A;  5K5O A;  2FUG 2;  4AWX B;  2FA5 A;  2LVS A;  3E5Q A;  1VQK I;  3WE2 A;  2IP2 A;  5C4X J;  3J80 Z;  3BLY A;  3KPH A;  2IT0 A;  3HOV J;  4GYG A;  2VC1 A;  3D5L A;  3CF2 A;  2XUB A;  4KA4 A;  1I3Q J;  3GWZ A;  5ICG A;  1MDM B;  2ZFW A;  4EGZ A;  1S7A A;  3MFK A;  2JTV A;  2VAS A;  3IUO A;  1EV7 A;  5DCM B;  5HLT A;  4S0H B;  2BY2 A;  1BM9 A;  3F23 A;  1FZP B;  3I55 I;  1ZHF A;  3BR3 A;  2MC3 A;  4ENJ A;  1EH6 A;  1FP2 A;  2Y69 H;  2W00 A;  1U9O A;  3DPT A;  2LNB A;  2V7F A;  2XSD C;  3BCA A;  2VL8 A;  3ZN0 A;  3CO6 C;  1X3W B;  2DQR A;  4HX4 A;  1ZKG A;  3HOU J;  2L5Q A;  2DA4 A;  2VT2 A;  1R23 A;  2HNH A;  2JN6 A;  2YSR A;  3IRQ A;  3EUH A;  2K3F A;  2MC4 A;  3ASN H;  3K1P A;  5JLX A;  3P5J A;  3LWF A;  2R5Y B;  2OQG A;  1TT0 A;  2CFO A;  4A0Y A;  4XLE A;  4MGR A;  4BJ6 C;  2CFX A;  2DA7 A;  3PUF A;  1R5H A;  5LBQ A;  1YS7 A;  4FHT A;  3J81 K;  2MAB A;  2X6O A;  3IL2 A;  4O3M A;  3CC2 I;  2L4M A;  2XRN A;  3KP3 A;  3D0S A;  3WU2 C;  3DPL C;  1LQ1 A;  2F6C A;  3BP8 A;  2VBW A;  1HQC A;  1MGT A;  1MSE C;  2DA3 A;  1A04 A;  2COB A;  2ELJ A;  2FEZ A;  3C2B A;  3HIF A;  3BWG A;  3J81 Z;  1MJA A;  1U9N A;  1J59 A;  4R1H A;  1K79 A;  2EBI A;  4E7S A;  2R93 J;  2KL4 A;  3KEO A;  4UV8 A;  3OYG A;  1RR8 C;  1CQT A;  1R1T A;  3QP6 A;  2FNP A;  1JKP C;  4BHC A;  1XGS A;  3WTY C;  1C0W A;  1VQN I;  1MBE A;  3T8R A;  2VJ4 A;  4XSZ F;  2E1M B;  2NOJ B;  3PNY A;  1ZN2 A;  4MNU A;  1SFK A;  4IHT A;  3DBH B;  3WOD F;  3P9C A;  2L7F P;  4EGY A;  2YPR A;  3OIO A;  1BJA A;  2WAQ A;  2E7W A;  4UV9 A;  1ACI A;  4X0G A;  2XPW A;  4LG0 A;  3TDU C;  3R60 A;  5FO5 A;  4A3F J;  1J0R A;  4IHV A;  1YHQ I;  1KQ9 A;  1W36 C;  4I0B A;  2HOE A;  4ZYE A;  4J00 A;  2FF4 A;  3GVA A;  2KRF A;  4XKW A;  4BJT A;  3I5U A;  4IO9 F;  2GXA A;  3TQN A;  1PJR A;  2IEK A;  4MEY F;  2LBF B;  3GZN B;  1OR7 A;  4PK4 A;  4HRI A;  4F52 A;  1U6G A;  4IKF A;  2LLK A;  1DP3 A;  4G94 A;  1XGM A;  3ZMD A;  1OYI A;  5DCM A;  1VI0 A;  4OIR F;  3BRO A;  3DKW A;  1JKR C;  3ABK H;  3ESW B;  2Z33 A;  2ZJP F;  2UUZ A;  2MG4 A;  5K1Y A;  2ZXI A;  3E6C C;  2VQH A;  4FE7 A;  3K1M A;  1PP8 F;  3KYL A;  3LFU A;  1IUF A;  1Y0U A;  3K7A J;  3TO7 A;  1RRJ A;  2VKH A;  3LSJ A;  1UG2 A;  2UWM A;  1E17 A;  1VQ7 I;  5FLM J;  1JTY A;  3PSI A;  2QM3 A;  2FBK A;  5DUI A;  2HEO A;  3KP2 A;  4YFN F;  2IS2 A;  5DYM A;  4Q47 A;  2LKP A;  3M1E A;  1E3H A;  3LL7 A;  5FKO A;  4A3D J;  4UVA A;  1A6I A;  3H0G J;  4NNJ A;  1UJ8 A;  3SZT A;  2P7C B;  2RN7 A;  1BL0 A;  1DDN A;  3FMS A;  3GBG A;  5LFA A;  1RET A;  1W7P D;  1ZRF A;  1T98 A;  3LQR A;  3ROU A;  4WK8 F;  2K7L A;  2LY2 A;  1O3R A;  2XGX A;  1U5T A;  2HQN A;  2VQG A;  4PSX A;  1BIB A;  5KHD A;  1HKQ A;  2VC0 A;  2WAE A;  2NXN B;  2FE3 A;  2PMU A;  5LRR A;  3M8F A;  4G6Q A;  4II2 A;  1JJ6 C;  2XKP A;  3OY9 A;  2M3A A;  2QEX I;  2QGU A;  1BI2 A;  2IPQ X;  1YW9 A;  3L2R A;  1Z0X A;  1B4A A;  3GTO J;  1D8K A;  4RAY A;  4U0V A;  5CLS A;  5KAI C;  4XKC A;  2KDO A;  4QPO A;  4GO1 A;  3CMY A;  1A6Q A;  3ZMV A;  3CDL A;  4U7D A;  4AU7 A;  2OCE A;  3EYY A;  1F5T A;  5KCM A;  1MBK A;  3VFZ A;  5M3M J;  1XTA A;  1IJW C;  1ZLK A;  2JJ7 A;  3L2Q A;  4AM3 A;  3PUB A;  1V4R A;  4HW0 A;  1P92 A;  3S1M J;  3T1B A;  4BEH A;  3IH4 A;  3KEY A;  1KYZ A;  4L9N A;  4E7Z A;  1VQO I;  2EFP A;  2M5W A;  3MVP A;  2X1E A;  4CCO A;  3GW2 A;  1UB9 A;  2Y0M A;  3VEP A;  4DNC A;  4Q5S F;  2A6T A;  4BL0 B;  1W5S A;  4F92 B;  3NAU A;  3FM3 A;  3VOD A;  1WH7 A;  2DOF A;  4IQJ A;  1D0X A;  2GOM A;  2XIG A;  2HR3 A;  3H0D A;  1FOX A;  2LYC A;  4PFP A;  2ZSH B;  4UNO A;  5J47 A;  3MWM A;  3AL0 C;  2JUG A;  1FTT A;  4A3J J;  1WZ2 A;  4FIS A;  5TGT A;  4E7H A;  3MZY A;  2E2I J;  3DLA A;  4M9X A;  2JRM A;  1X2N A;  5F1J A;  3EUA A;  4LLN A;  1E3O C;  2Z9O A;  5LD2 C;  5J3L A;  1WI3 A;  2KJB A;  1OLT A;  4Z6Y A;  1B72 B;  2GLO A;  2NNY A;  4ZYH A;  3BG6 A;  3JRI A;  4KIF A;  4LB6 B;  2D1H A;  4KFC A;  2F2E A;  1D5Y A;  4ZDP A;  3DPU A;  2KKO A;  3V8L A;  2R0Q C;  1RUN A;  1IDY A;  2R7W A;  3GXO A;  3QU3 A;  4IXA A;  5ILS A;  2XC7 A;  2K5C A;  1YOV B;  1QGP A;  1XGO A;  5KK1 A;  2R92 J;  3HSE A;  4IZZ A;  4KT6 A;  5LGT A;  1T0F C;  3P9I A;  2LSO A;  2PN6 A;  4P5O A;  2VE8 A;  2K27 A;  2EIM H;  1LVA A;  4U87 A;  1RKW A;  4XKB A;  2ICW G;  3RIR A;  3RPU A;  4D1Q A;  2VBZ A;  3G4S I;  3K70 C;  2C6Y A;  2WV1 A;  2F4I A;  3E3V A;  3HKZ N;  3I64 A;  3K4C A;  2VKE A;  3AKZ A;  3LA2 A;  1HCR A;  4IOC F;  1FYK A;  1MBG A;  1H0M A;  4UXN A;  3G1L A;  5K5R A;  3B73 A;  2E5Z A;  3WHC A;  2XRO A;  3DLL F;  3LSK A;  5CYV A;  2BGC A;  4HV6 A;  1IRF A;  2VKV A;  1HDD C;  1T95 A;  4D5F A;  3SHF A;  5IYC J;  3MZH A;  4LMY A;  3PFY A;  1N77 A;  2K3P A;  1AOY A;  3PQK A;  4EQQ A;  5J1R A;  5EG0 B;  3E0J B;  3OYL A;  4BAC A;  2F4O B;  2K9S A;  1ZRD A;  4RAG A;  5BS6 A;  3E7L A;  4E6K G;  5J1Y A;  2BBY A;  2HYG D;  1D5V A;  2E7X A;  2M8E A;  1P7I A;  1P4X A;  3HOZ J;  1IDZ A;  2F5C A;  3MKL A;  3ZCO A;  1A31 A;  3IWZ A;  2CW0 F;  3HC7 A;  4DYC A;  5M3F J;  2NOG A;  2H1L A;  2QQ9 A;  3S16 J;  4N9H A;  1G3T A;  3OYN A;  2H27 A;  1EA3 A;  2NVQ J;  1IV8 A;  2O6G E;  4XM3 A;  3S2H J;  4Y7N J;  4PJM A;  3Q5F A;  4LJZ F;  1J7K A;  3EPZ A;  3MD2 A;  2HVR A;  2PJR A;  3TL4 X;  4YEL A;  3WG7 H;  2LP0 A;  1JT0 A;  2TDX A;  4EM0 B;  1U2W A;  3H5A A;  2Z99 A;  2RRE A;  2EFN A;  1SAU A;  4GRI A;  1RZ4 A;  3L9F A;  1YRN B;  4B4C A;  4E7K A;  3BPX A;  3DP7 A;  3TBI A;  5BMZ A;  2XF6 A;  5EDN A;  3PSF A;  3QOD A;  1OMI A;  2CRG A;  2A5W A;  1RUO A;  2KMU A;  3ABU A;  4JX5 A;  2DOA A;  2V6C A;  2ESN A;  1QZY A;  1A35 A;  2R7O A;  4OIN F;  2V1D A;  1KU2 A;  2HQR A;  1ZGW A;  2A69 F;  3S3O A;  1Y0N A;  2JVH A;  2VPL A;  3IH3 A;  1V5F A;  1XDU A;  1IC8 A;  3S2W A;  3BR6 A;  3F22 A;  4ZC3 A;  3ERM A;  2MSY A;  1L0O C;  2Y0S A;  1PUF A;  1QZZ A;  2NYX A;  3TOA A;  1XPX A;  1BC7 C;  5GP9 A;  2UZK A;  3RI4 A;  1RC9 A;  1M1E B;  1APL C;  1ZK8 A;  3BC8 A;  3CLQ A;  5K7Z A;  2RDP A;  1YFH A;  3MKY B;  1J9I A;  4MTE A;  5C44 J;  1IZ1 A;  2GXG A;  3GYH X;  1YJN I;  1FPQ A;  4C2M J;  1FBS A;  2EIN H;  2HQA A;  2HYJ A;  3M8J A;  4ZYG A;  2PI0 A;  4KIG A;  5J8C A;  2NNN A;  5C4J J;  1IRX A;  2BHZ A;  1XN7 A;  4AD9 A;  4A93 J;  3FMR A;  4XRS G;  1TNS A;  4DYQ A;  3H92 A;  2FQ3 A;  2IW5 A;  2JK3 A;  3KIO A;  2E34 A;  2BY1 A;  1YJ9 I;  4ENK A;  5ICC A;  3C1D A;  3HPG A;  1HLV A;  3KYD B;  5FD6 A;  5EEA A;  2VPR A;  2VJ5 A;  1SAN A;  3KZI C;  2ME6 A;  2V9V A;  1AKH A;  2P6S A;  4RAZ A;  4E7I A;  1XGN A;  4NB5 A;  4IQ4 A;  4ZZL A;  1HXD A;  5D5W B;  3CJT B;  2M34 A;  3PFI A;  1FLI A;  3NRV A;  3U2R A;  3OS1 A;  4XK4 A;  4U7B A;  1MMN A;  2CG4 A;  3F8B A;  5CVU A;  4EV0 A;  2IS6 A;  3TP3 A;  3HYI A;  1JGG A;  5J40 A;  2BY0 A;  1X1P A;  5AIP A;  3G6E I;  3GLX A;  2H6B A;  1Y1W J;  4P9U A;  2PJP A;  1R6R A;  4CCL A;  1UCR A;  1SD5 A;  3G2B A;  5IP7 J;  4XRM A;  2DT6 A;  2YX4 A;  2EFW A;  2L0K A;  2LY1 A;  4B47 A;  1MBH A;  1B1B A;  2X1D A;  2DFE A;  3V7C A;  1Z67 A;  2G7H A;  1D0Z A;  2EZL A;  4I6Z A;  1FYL A;  1D1C A;  1YQA A;  2R5Z B;  3FWE A;  3FXK A;  3LNQ A;  3DTE A;  3VYT B;  2ISZ A;  4ENN A;  4UB6 C;  5HS9 A;  2HOA A;  3H9G A;  5HLG A;  4BHB A;  2W1O A;  3SZG A;  4RGX A;  4LK1 F;  3LSG A;  1B9M A;  5L3D A;  3QAH A;  5M5Y J;  4U0W A;  1YI2 I;  5TJJ A;  2M45 A;  5D6F A;  1WJB A;  2YR2 A;  1IXS B;  2CWE A;  1YX3 A;  4I98 B;  4RMN A;  4RGR A;  5J4Y A;  1R7J A;  2RC4 A;  3IC7 A;  1BN5 A;  2AHQ A;  4PJL A;  4EJU A;  5M5W J;  4CCN A;  2LR8 A;  2VT3 A;  2STW A;  4XLN F;  3L2C A;  4J01 A;  3HTU A;  3Q0U A;  2EB7 A;  3ZQL A;  3DXJ F;  3IV5 A;  1K78 B;  1B8I A;  1ODD A;  1WJE A;  2JA7 J;  5GPA A;  4NDL A;  4RB2 C;  4IHX A;  3S1Q J;  1H9G A;  4IPA A;  1GVJ A;  2F5D A;  1X1C A;  3OL4 A;  1D1A A;  3QQA A;  4UVC A;  5FKM A;  3SXY A;  5K5Q A;  5C3E J;  4I76 A;  3V4G A;  5LRS A;  2N8G A;  1VQM I;  4D9J A;  3DEU A;  2IGN A;  3CMM A;  1G3Y A;  3VSL A;  1R58 A;  2KHM A;  5JHF A;  2F4M B;  2CQK A;  1ZG5 A;  3LFK A;  5B1B H;  4HNU A;  3GZ6 A;  3DKX A;  2P8T A;  1S7O A;  1ZGJ A;  2HTJ A;  1JUM A;  3TOB A;  3Q9S A;  4HLY A;  1FSE A;  2QSF X;  4A6D A;  2HDW A;  3IAS 2;  3K1N A;  3MKW B;  4V2G A;  4AYB N;  5B5E C;  1SMY F;  4OIQ F;  1HF0 A;  5DM7 F;  3F8M A;  4BDZ A;  1WFX A;  1BIA A;  2DA2 A;  2MW8 A;  2W84 A;  2OD5 A;  1QPI A;  2E2J J;  1R71 A;  3H9J A;  3HDD A;  2VLA A;  2HS5 A;  1SFO J;  2JRT A;  1RKT A;  5E3N A;  1UG0 A;  4YFK F;  2NVY J;  5FLX K;  2HVQ A;  5GTI C;  3EYI A;  4IJA A;  4CGZ A;  1Y8R B;  2LG4 A;  1TWC J;  2IBD A;  4II3 A;  3J7Z I;  3K4N A;  4YIF A;  1FEX A;  2V6E A;  4HSR A;  4HF2 A;  2WC2 A;  4HG2 A;  4AVZ A;  5FLX Z;  2RAE A;  2WV0 A;  2R7D A;  4Y52 J;  1HA8 A;  2W24 A;  4C2U A;  1FX7 A;  1VND A;  4A3L J;  4EMS A;  4KNY A;  2YS9 A;  1XCB A;  3ZQI A;  1KYW A;  3K9T A;  2DMN A;  3RQI A;  2BE5 F;  2FMY A;  4X1E A;  1LVK A;  2O7O A;  3ZMU A;  2PX9 A;  4MHG A;  2FJ1 A;  4EJO A;  3HBL A;  4D7N A;  4QWQ A;  2EV5 A;  4L5E A;  4BXX J;  1JT6 A;  1Z7U A;  3HM5 A;  1F4K A;  1MMG A;  3OL3 A;  1POG A;  1AHD P;  2WY8 Q;  3QYE A;  2HGC A;  3M07 A;  1UAA A;  2QEN A;  1H9T A;  1ETY A;  3WTV C;  2DMP A;  1OYY A;  5E18 F;  4A3M J;  4LG0 B;  1H8A C;  3GUD A;  2OUM A;  3M8E A;  1X1D A;  3FXM A;  1LE8 A;  5IPA A;  2K9L A;  2R7F A;  4NUB A;  3SFI A;  4E7L A;  4G12 A;  4P55 A;  2EJR A;  3CME I;  2VUM J;  2EWN A;  3T8T A;  3JAM Z;  3FKJ A;  2JSP A;  1CF7 B;  1HDP A;  1K78 A;  1YIT I;  1T56 A;  4YG2 F;  1ZYR F;  3DTI A;  1TLH B;  2BW3 A;  4LIU A;  4ASN A;  1R5I D;  4L9J A;  4B3X A;  1AWC A;  3D1N I;  5HNH A;  1S5L C;  3WU1 B;  4FTH A;  1T2K A;  4C3I J;  1ULY A;  4LOC A;  4B43 A;  2KIM A;  1JGS A;  1TNT A;  3PNV A;  4BH9 A;  3RKQ A;  2LF7 A;  1P7J A;  3RZO J;  2A05 A;  4LIT A;  2ID6 A;  4DJA A;  1VQ9 I;  2RNG A;  3F6O A;  2KLO A;  1YE9 A;  3B02 A;  1BI1 A;  1V3F A;  3HSR A;  1XC5 A;  2HTS A;  4C3H J;  1TWA J;  3BZ6 A;  4RLQ A;  5JI6 A;  4ESB A;  4HF1 A;  4M6Y A;  5J4V A;  2QUF A;  4XLP F;  3WTZ A;  3VYR B;  5ED4 A;  2O61 A;  2KDZ A;  3RKW A;  2VKD A;  1B6A A;  4A0Z A;  2WTE A;  1V55 H;  1X4O A;  2O3F A;  4BJ5 C;  2MH9 A;  2IAI A;  1X4P A;  2XB5 A;  3Q0W A;  5E1X A;  1FBU A;  2EIL H;  5FLV A;  2MD5 A;  1K4T A;  2RVC A;  1GUU A;  2G7U A;  2QZ8 A;  1UST A;  1QNT A;  1ETW A;  3QPT A;  2EV6 A;  2NVT J;  1JKQ C;  3BOQ A;  1GHC A;  1GXP A;  3ZR8 X;  1ZG3 A;  1U5T B;  5DV5 A;  2GXB A;  3I71 A;  2K02 A;  4RB1 A;  2O03 A;  3ZOB A;  2DA1 A;  2BXZ A;  2F5F A;  2PEX A;  5HOO A;  1B59 A;  2R7R A;  3CUQ C;  4KIB A;  2ZXJ A;  1BR1 A;  1HBX G;  1EKE A;  4GFB A;  2UV1 A;  4C30 A;  3RPU D;  1S8N A;  2CQN A;  4AID A;  3QU6 A;  3D5S C;  3FF5 A;  1JTX A;  4XQF A;  4IVN A;  1OJL A;  2LH9 A;  1T0F A;  1MMD A;  4XN3 A;  4WWC A;  3BG7 A;  3W2W A;  3GFI A;  5JVG F;  3ZXS A;  4C3J J;  3FMQ A;  2DI3 A;  4CYD A;  1QA6 A;  1RR7 A;  5LEK A;  4QSH A;  4A3K J;  3UR3 C;  1TC3 C;  1ZH5 A;  3S2D J;  5J6X A;  1Z9C A;  3CD6 I;  1S6L A;  4B1R A;  2DO7 A;  1ORK A;  1MKM A;  5HLH A;  3KYC B;  4BEH B;  3I4M J;  4IL6 C;  2RQP A;  1ITY A;  2WY7 Q;  2LD5 A;  1QO0 D;  1IXR C;  4K2E A;  2DFH A;  5CVR A;  4A3C J;  1ERD A;  1I6H J;  5GAE J;  3M3Y J;  2O8K A;  5DD4 A;  3RYR A;  1CF7 A;  3BQZ A;  5HDN A;  3HHG A;  2O0Y A;  4AIJ A;  2JZY A;  4PZJ A;  2ZBK A;  1KU3 A;  3HGY A;  2DT5 A;  5CJ9 A;  5E1Z B;  2CV0 A;  1WVR A;  2FML A;  1YJW I;  5B3S H;  1FMW A;  5LHG A;  3H5N A;  3DU6 A;  3HZJ A;  3PL8 A;  4HNV A;  4HF0 A;  2L9V A;  3QRF F;  5F6F A;  5HLI A;  2Y48 A;  3F72 A;  5L3F A;  3JR9 A;  2UXX A;  4H0E A;  3LAP A;  3Q3S A;  4M74 A;  2VB6 A;  3M4O J;  2Q2E A;  3CCJ I;  1MSF C;  4HYE A;  4AIH A;  5KVR A;  2BXY A;  2RGV A;  3I9V 2;  1MMS A;  3FHN A;  1DPU A;  2GIZ A;  2P5L C;  3OV8 A;  2KRH A;  3OYA A;  3I54 A;  3WE3 A;  2R3S A;  1IGN A;  3U1K A;  4BXU A;  3H9Q A;  3OYJ A;  5FKN A;  4UY8 I;  4EVI A;  1S72 I;  4BU2 A;  1MBF A;  4RB0 A;  4BYY A;  1O7F A;  4A3E J;  2JVG A;  2B9S A;  1IV6 A;  4AVP A;  2BHY A;  1W0T A;  2GM4 A;  2NRA C;  3K4J A;  1LFU P;  5H2F C;  3L2V A;  3A0B C;  4MEX F;  3TGN A;  5DDG A;  3QWL A;  1W5C C;  4UHT A;  5FJ8 J;  4L9V A;  5FKK A;  2HPM A;  1PUE E;  1XCV A;  2AXL A;  2DJI A;  1I3A A;  4PJ0 C;  4BY7 J;  2OF7 A;  1O3T A;  1D1B A;  1FOW A;  5E17 F;  4RGS A;  1P4A A;  3FXL A;  4ON0 A;  1O7L A;  3NEU A;  3W6J B;  1ZTR A;  3UKG A;  1J75 A;  2CQQ A;  5BPD A;  3JSP A;  1T33 A;  2K4J A;  1F1Z A;  1A36 A;  1G4D A;  2CW8 A;  1N78 A;  1K4S A;  1J5Y A;  3KCC A;  5CVJ A;  1RNL A;  1YW7 A;  2P81 A;  2L7M P;  4ZDO A;  4KN7 X;  3N4M A;  2KP6 A;  3HL2 A;  3GTQ J;  2YUS A;  2CUE A;  3NWT A;  3U21 A;  1QVT A;  3VOE A;  1LFP A;  4XMY A;  2LDU A;  3JTG A;  5L3C A;  2I10 A;  1K6Y A;  2CH0 A;  4CO8 A;  1JUP A;  1Z6R A;  1QHH D;  2L54 A;  2E36 A;  3ML6 A;  2Y9Z A;  4HBL A;  3HRM A;  1P2F A;  3BJO A;  2QA4 I;  1SD6 A;  2BZT A;  2V79 A;  3HSF A;  2DA5 A;  2W25 A;  3ULQ B;  2PJR B;  3VWB A;  2EZK A;  3HOY J;  5B66 C;  2DT7 B;  2PQ8 A;  3FDY A;  4KYW A;  3S14 J;  1HSJ A;  2ZNY A;  3E5U A;  3CZ6 A;  4XRS A;  5GAD J;  5ICE A;  3K2Z A;  2VBX A;  2G9W A;  5ICF A;  1Z3X A;  2L7Z A;  1IXC A;  4B48 A;  1Z3Y A;  1GDT A;  2JA6 J;  1HC8 A;  5JHU A;  1R22 A;  2M7B A;  5FGM A;  3QPH A;  2M0C A;  2FOK A;  3FK6 A;  4XLF A;  2BEO A;  5J1U A;  3R6S A;  4CYC A;  4P96 A;  1SEU A;  4ZYA A;  1TT5 B;  3FIS A;  1K6O A;  2W85 A;  4BQO A;  3GF2 A;  4G7Z F;  1E2X A;  4EAT A;  4OMY A;  1D8J A;  2JPB A;  4OOI A;  4PUS A;  1U78 A;  1DUX C;  3ECO A;  1EJ9 A;  4OU0 A;  4I0A A;  3ZQH A;  2DMT A;  4YII A;  4DBR A;  4G6T B;  3CCU I;  3K4M A;  2FSW A;  2IA1 A;  4DQ2 A;  3H3U A;  2CV1 A;  4BKX A;  1G8X A;  3D5R C;  1PUF B;  3K6G A;  3BJA A;  3WTX C;  1H89 C;  1EH7 A;  1Z91 A;  3BT9 A;  3MEX A;  2Q8K A;  3F3X A;  4PFO A;  5CQG A;  3ERE D;  5IT9 Z;  1FP1 D;  4CA0 A;  3QPS A;  2AO9 A;  4Y33 A;  1S9H A;  5IY5 H;  3OYD A;  2VQC A;  4I01 A;  3CCR I;  5E20 A;  3IWF A;  2WWY A;  5AON A;  2XDV A;  4NBQ A;  5FRM A;  2Y75 A;  1BR2 A;  2O8X A;  4XLH A;  2ZME C;  3RQ4 A;  5JFR A;  2F48 A;  3EET A;  3O8H A;  4F93 B;  2ZJ2 A;  3CP2 A;  4HLX A;  1OCC H;  2HWV A;  2JA2 A;  3L00 A;  1OQY A;  1D0Y A;  3NWS A;  3PO2 J;  2UXN A;  4M3E A;  2MFZ A;  1AKH B;  4Y3O A;  1KZH A;  2EH3 A;  3HB9 A;  2XAS A;  2VN2 A;  2G0E A;  4CCK A;  4ESJ A;  2DN0 A;  2VI6 A;  1LFB A;  4CCJ A;  3JRD A;  3FXU A;  3V42 A;  4HQM A;  4TV7 A;  3SEZ A;  1XMA A;  3HHH A;  2JWT A;  1TW2 A;  2CU7 A;  3HGG A;  2MBF A;  2X51 A;  5KAF C;  2BV6 A;  2XGD A;  1YX5 A;  4KN4 X;  5IYB J;  1NG6 A;  2HI3 A;  4L5J A;  3F6V A;  2JA8 J;  1SFU A;  2KIQ A;  1WJC A;  1JJ8 C;  1RI7 A;  4JOM A;  1I6X A;  2V1X A;  3J7A Y;  3DF8 A;  5AIQ A;  4HNT A;  1GVD A;  4X6A J;  2EQR A;  2OJE D;  2CUJ A;  3I4N J;  4RM3 A;  2XSJ C;  4IOA F;  1UFM A;  3VDX A;  1QBJ A;  3WG9 A;  3SQN A;  3AFH A;  2LKX A;  4ZTJ A;  2NS8 A;  4PDK A;  3QP5 A;  3C2H A;  4LGW A;  3CCQ I;  3CES A;  1RIO H;  3ONQ A;  4DW6 A;  3M9A A;  4M3B A;  3OYM A;  2TRT A;  2HXO A;  5LHI A;  1HW5 A;  1MH4 A;  1PVE A;  2MGQ A;  4AIK A;  5HNF A;  3OIQ A;  3RCO A;  3SFZ A;  2XRL A;  4N0B A;  2ZC2 A;  2MH2 A;  2OAZ A;  1XMK A;  3FBI B;  2OZU A;  2X6X A;  2E35 A;  3HEF A;  4KIC A;  3LSH A;  4PJJ A;  2M87 A;  3ABM H;  2QKL B;  3IRR A;  4A5M A;  1XMX A;  1ON1 A;  4FAS D;  1H88 C;  2PG4 A;  1B8I B;  2B0L A;  3HG9 A;  1X19 A;  2L9N A;  5GPC A;  1P6R A;  3OYF A;  3HOX J;  1VTN C;  5D5U B;  5LGU A;  2FXA A;  2HOS A;  2WAQ N;  2DFI A;  1OIS A;  2KIF A;  2WAD A;  3UNG C;  5IP9 J;  2OQR A;  2L9S A;  3LST A;  2LRD A;  4IHY A;  2JQ7 A;  1T08 B;  4FX0 A;  4AC0 A;  1S29 A;  2PLY A;  1O3S A;  3RKX A;  1SVM A;  3Q9V A;  1O4X A;  2HU9 A;  3WGI A;  3JRC A;  3HUG A;  2DXI A;  5H6R A;  3ZMZ A;  3OS0 A;  1VQP I;  9ANT A;  3O6B B;  1B9N A;  1REP C;  1CGP A;  3I0T A;  1SC7 A;  2L9R A;  3E5X A;  3G71 I;  4EJV A;  1NK2 P;  2ZO4 A;  2HZT A;  4BY1 J;  3FZV A;  4HX8 A;  1FC3 A;  4R79 A;  1WHU A;  3HRU A;  3SJM A;  3FX3 A;  1RPW A;  3C3W A;  2ME0 A;  1U3E M;  1JUS A;  3SDB A;  3RKY A;  3CJQ B;  2K86 A;  2ISY A;  2OU2 A;  2IRF G;  4FCY A;  1VZ0 A;  3KP4 A;  2DBB A;  2FD5 A;  5DS9 A;  3QOE A;  2AS5 F;  4PGG A;  4XSX F;  3ELK A;  2EZH A;  4PSW A;  4S04 A;  5D4S A;  2IJL A;  2KT0 A;  4I7H A;  5FFX A;  1TWG J;  4NQW A;  1G59 A;  5BPI A;  2AQE A;  3H3V K;  2MLG A;  3OYH A;  1FOY A;  2LF8 A;  2R4G A;  1LDD A;  1X1B A;  5HVQ C;  1FSH A;  1I39 A;  2GIV A;  3VSK A;  2OA4 A;  3S93 A;  4XID A;  3W6V A;  3VPR A;  3RDI A;  2F5E A;  3KET A;  2A5Y B;  1DPR A;  2JMW A;  3JRF A;  1FNN A;  2XPV A;  1GV5 A;  1ZRC A;  2OC6 A;  1USS A;  2OBP A;  1LEB A;  5E3O A;  3U9G A;  1E3P A;  2QCO A;  4MFE A;  3KLO A;  2EIK H;  4XOP A;  3SYT A;  1DU6 A;  3U1D A;  1XDS A;  1FT9 A;  2W4S A;  5L3B A;  1R5G A;  1X58 A;  4KT5 C;  4MQV A;  4CCM A;  3CUQ A;  4L0Z B;  1LE8 B;  2QVO A;  2R7S A;  3GZ5 A;  4JK1 X;  4UUV A;  1R1U A;  2HYF A;  1ETQ A;  4A2U A;  1O57 A;  1XB4 A;  3M1C A;  1ZRE A;  2D45 A;  2JA5 J;  1FIP A;  2R7V A;  4ITV A;  2GBY A;  1XSX A;  2BY3 A;  2M1B A;  2BW3 B;  3CO7 C;  3F8C A;  2D1V A;  3A01 A;  3K2A A;  4HZF A;  2OTJ I;  1MJ9 A;  3W6K B;  4QTR A;  1HOM A;  2VBY A;  4Q4Z F;  2EK5 A;  2ZJQ F;  3BTL A;  1Z77 A;  4JP0 A;  3DTK A;  3ABL H;  1OCR H;  2VJI A;  4DIQ A;  2HPI A;  2EA2 A;  2XGE A;  3IKV A;  2B7E A;  4IRH A;  3KE2 A;  2J5P A;  3OIP A;  4UB8 C;  3FXJ A;  2Z3Y A;  2NVX J;  2VXD A;  5CVV A;  1Z1D A;  2XF7 A;  4H4K C;  2DOD A;  4P9F A;  3OYE A;  1PP7 U;  4BAY A;  1HW1 A;  3BTC A;  4BQN A;  1WJD A;  5L3E A;  2ZXH A;  2GWR A;  3KLN A;  3QYF A;  4RM2 A;  1TW3 A;  2A6H F;  2PMZ A;  2XHK A;  4PJN A;  3JRG A;  1DU0 A;  3AL0 B;  1TWF J;  5E79 C;  4NC6 A;  1FYM A;  2K85 A;  4A6E A;  4DZJ A;  2FQ4 A;  2X1C A;  2BVM A;  3HOW J;  5IOY A;  3G3Z A;  5BQT A;  2STT A;  4QIW N;  2E19 A;  1V5E A;  1YLF A;  5EEG A;  3ZMS A;  2AXT C;  1QZE A;  2AQF A;  1KQ0 A;  3DEW A;  2A3S A;  1QRY A;  2XV4 S;  1TQM A;  2HDC A;  2ESH A;  3CCS I;  2YU3 A;  2HKO A;  4RDU A;  1XD7 A;  1OPC A;  4KMF A;  1MMA A;  2P5K A;  1F9N A;  2Z5U A;  2KFD A;  2M8G X;  2CJJ A;  1S7E A;  3EQL F;  4M9Z A;  3CMA I;  3SDG A;  1IN6 A;  4ZYD A;  4WCG A;  5F08 A;  1MNM C;  3ZRG A;  3DFG A;  4ABZ A;  2P6T A;  1SAX A;  1BW5 A;  2Y31 A;  4FQG A;  5EF6 A;  2FOW A;  5D8K B;  3JAM K;  4KJZ A;  4BGD A;  1EH8 A;  1KU9 A;  3C18 A;  4I02 A;  2H1K A;  3HRT A;  4BXF A;  5D4R A;  1A5J A;  3WTS C;  4BE2 A;  1ETK A;  2E1O A;  1ZG1 A;  5CPR B;  3GME A;  2Y9Y A;  4LD5 A;  3CCL I;  2D5V A;  1I5Z A;  4LLG F;  3R61 A;  5IT3 A;  4UVB A;  5CKT A;  5DUK A;  5E3M A;  3R0J A;  3JRH A;  2K9N A;  2OPT A;  1QU3 A;  1NG7 A;  1SD4 A;  1ZEL A;  2ZME B;  3JRB A;  1W0U A;  1SFX A;  1TP4 A;  3OR1 C;  1R9T J;  3CCY A;  4HX7 A;  2MLK A;  1WH5 A;  4HDU A;  1FOK A;  2X4H A;  3TW7 A;  2GQQ A;  2HDD A;  2FX0 A;  2QBY A;  4HPQ A;  2CS3 A;  1QHG A;  2DTZ A;  2ZFU A;  4XRF A;  1ZQ3 P;  2GZW A;  3CQZ J;  1I27 A;  1KGS A;  2MA3 A;  1LEA A;  4ZZD A;  1IG7 A;  4BQA A;  2OCC H;  5GAH J;  3E1S A;  2CMP A;  4LLL A;  3CCM I;  4G6D A;  2K4B A;  1TWH J;  2Q2E B;  2QKM B;  3TW6 A;  5TRD A;  3G1O A;  5E1W A;  2VON A;  2QSH X;  3MZ8 A;  2RV8 A;  2IGK A;  1I50 J;  3HPH A;  1ZAR A;  2CO5 A;  2DCE A;  4W1U A;  4F3Q A;  1Z21 A;  3R4K A;  4FT8 A;  5M5X J;  4L5I A;  4BE1 A;  3WGG A;  2MYS A;  5LLQ A;  2L01 A;  2QQB A;  4G8X A;  4HQE A;  3V8K A;  3BJ6 A;  3CDI A;  3FXO A;  3K4K A;  4WXC A;  1I1S A;  3L7W A;  3VB2 A;  5JLW A;  1AU7 A;  1ZR4 A;  2GA1 A;  2MD0 A;  4BE0 A;  2L7K A;  2HVS A;  4A0X A;  2HFH A;  1U8B A;  5EJC A;  1G3W A;  2Q1Z B;  3V7R A;  2P4W A;  2Z16 A;  1T39 A;  1T6S A;  3ISP A;  4OIP F;  1DQU A;  4MLO A;  3BZC A;  4CDG A;  2QLZ A;  3WTT C;  2HXI A;  2FU4 A;  4LK0 F;  2W82 A;  3FK7 A;  3P9K A;  5B1A H;  3CC4 I;  5EGO A;  2ECC A;  1IN5 A; 
#chains in the Genus database with same CATH homology
 2BZT A;  1UJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...