1UJ8A

Structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
SHHHHHHGSGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yfhJ
publication title Crystal structure of Escherichia coli YfhJ protein, a member of the ISC machinery involved in assembly of iron-sulfur clusters.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 21
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04384 Fe-S_assembly Iron-sulphur cluster assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.600 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A IscX-like 1uj8A00
1UJ8A 2BZTA
chains in the Genus database with same CATH superfamily
1FBSA 4AM3A 1K83J 4B47A 1XSXA 2DQLA 3RIRA 1QA6A 3B6CA 1IDYA 5EEHA 4LG0A 1WCMJ 2WC2A 4A2UA 2QCOA 1LVKA 2XC7A 5TGTA 3DEEA 1LEAA 2HOSA 3O8GA 1I3AA 3DEUA 4Y3OA 3V8LA 4A5NA 3K1PA 2ECCA 1ZH5A 4AU7A 4Y15A 4V19K 4G7ZF 3CJQB 3UKGA 3IAM2 3L2QA 3KYDB 3PUFA 2K4BA 4BAYA 2KRFA 2IA1A 4ZYEA 1D1AA 3KZIC 1EH7A 4ZYAA 2WAFA 1ZGAA 2IJLA 3B02A 3F6OA 3OWTA 1MMNA 2VT3A 4RGRA 1FYLA 1VZ0A 3PFYA 1UG0A 2LBFA 2LF8A 2E5NA 4U88A 3I4PA 2IW5A 3WTTC 2Y9ZA 4UB6C 2VOOA 3BTJA 1UG2A 3CZ6A 3TBIA 4A3DJ 2M2EA 4LFUA 3MD2A 3E7LA 1KGSA 5GTHC 4BE2A 1LFUP 2V79A 2VXDA 1YJ9I 5CVUA 1YG2A 1QO0D 2GBYA 1DGRM 3GBGA 3LSJA 2LD5A 5IYCJ 3IKTA 3F23A 2YSRA 3T8RA 4YFXF 5E20A 4QWQA 2ISYA 2L7FP 1X3ZB 1MZBA 1JGGA 3DU6A 2XVCA 5BOXA 2RAEA 1XPXA 1ZLKA 2CUZA 2ZKZA 2WBMA 3SZPA 2H8WA 3JAMZ 3V4GA 1XMKA 3JRAA 1N77A 2VN2A 1LDDA 1RR7A 5CVVA 5KVRA 3M9AA 4ENKA 4HV6A 2DO7A 4JP0A 2DT5A 4YIRX 4L5JA 3KLNA 1O4XA 3DV8A 2A5YB 2XPUA 3C3WA 4PJNA 2IA0A 2HPIA 3QYFA 2MD0A 2LKSA 3LSKA 4WF2A 1GXPA 1B1BA 2M1BA 4PSWA 5HDKA 3D1NI 2BY1A 3HM5A 2XRLA 3KP2A 1RI7A 1LPQA 4JX6A 5M5YJ 3CCSI 2VE9A 1V5FA 3ML6A 4BXFA 3CC4I 2IT0A 1P92A 1WI9A 4PCQA 4HF1A 4WXDA 2AQFA 2BVMA 2IS6A 3BP8A 1KQ9A 4KNYA 1ZTRA 5E8GA 2RNJA 4QTRA 1T38A 2R7XA 1TNSA 2CYYA 3LSTA 5DCFA 4U0YA 1TWAJ 3ZMVA 1YRNB 4ZTJA 4Z2YA 2D45A 1AHDP 1D0XA 2TCTA 4BXUA 1MNDA 4LK0F 3T8TA 4HX4A 3W6JB 2F48A 2OUMA 1JUMA 2HQAA 4IQ4A 3PQJA 1E3HA 3CCUI 4B4CA 3NARA 4M9XA 2M4KA 2CV2A 1FOWA 1T98A 3J7AO 2KIMA 4HOBA 1Z91A 4B48A 2LG4A 4DQ2A 1QZEA 1X2MA 2WAQA 2MG4A 4IPAA 2E2HJ 5TJJA 4HLXA 3K4NA 4XICA 4L0YB 2KJBA 3WG9A 2ZMEB 1J0RA 1R1VA 1ETYA 1YI2I 2EFQA 3KETA 2HYJA 1WGXA 3QPTA 1ON1A 2DA1A 4FISA 4RAFA 2FMLA 2DA4A 2H27A 1XDUA 3D5SC 2V1XA 1R5HA 3CUOA 1HCRA 3CUQC 2E71A 4EMSA 4IZZA 5E8IA 3BY6A 2GIZA 2BY3A 2K40A 3OV8A 1D8JA 1RESA 2BBYA 2HVQA 3DTIA 2JPBA 1B4AA 5ERIA 4LK1F 2DT6A 2P7VB 1XMAA 4HSRA 3V42A 2HOTA 2V26A 5KHDA 4BS9A 5HDGA 3J7YJ 2VASA 4BQQA 4D7MA 3KEYA 4FTHA 2DK8A 1I6HJ 3OS2A 1DP7P 2YR2A 4XRMA 2Z1DA 5FLXK 1P7IA 4I09A 3CDIA 3O8HA 3VPRA 4WCGA 3RPUA 3PM1A 2DPDA 1MBJA 1B72B 4ZDLA 1RUNA 2P4WA 2FBKA 4EJVA 3COAC 3JRIA 3DLLF 3MVPA 5M3MJ 1JJ6C 5EZHA 1U9NA 4M9SA 3OYKA 1ZRCA 2IS4A 4UVCA 4OMYA 3AG3H 3BTIA 2MFZA 3IRRA 4BY7J 3H9GA 4KMFA 4N0BA 3BQZA 3K4LA 3S15J 2VOPA 1W0UA 2COBA 1IC8A 3OIPA 1R1TA 5A2QZ 2DMNA 3F22A 1Z9CA 2XHKA 2UUZA 2YX7A 5L3EA 3ABTA 3B73A 3MKLA 4GRIA 4HF2A 3K0LA 4XM3A 3HOYJ 4MFDA 5JVGF 3GVAA 3ECHA 3BR1A 2MSYA 2QQBA 4M6YA 4BNCA 3JSPA 2OQRA 1ZLJA 4HX8A 2JN6A 5HLIA 3SDBA 4E7JA 1X3UA 4RA2A 5TISC 3N05A 3RJPA 3GLLA 1OCPA 3PFIA 4IRHA 1QHHD 4CSWA 1CF7B 3GF2A 2UXXA 1W36D 4KYWA 2X85A 5JR3A 3M1EA 2X6OA 4YELA 1IZ1A 1D0ZA 2X1DA 3FMSA 3HOZJ 2Y30A 5FKMA 2GXBA 4U7DA 2E5ZA 1U5TB 4NNJA 2FXAA 2BE5F 2IEKA 3OS0A 3X2QH 3HTUA 4EJWA 2V1UA 4BDZA 5ED4A 2NXNB 4PGHA 2A05A 4L9JA 5B5EC 3BCBA 5IOZA 3RKQA 1BOBA 4A69C 2GOXB 1JHFA 1XMXA 5HOOA 2XV4S 1TQMA 5K7FA 4AUXA 3BWGA 2GM4A 2K9NA 1BI3A 2XKOA 2ME6A 2YS9A 3BDDA 5LD2C 2PN6A 3PQKA 1R4NB 2G0EA 2RREA 2V9KA 3J80K 3I71A 2FD5A 2NS0A 2NNYA 4BJTA 1K61A 2M45A 3RKWA 3DWLE 2FOKA 1V5GA 1E3OC 4Y17A 4BU2A 2GQQA 1ULYA 3PO2J 2DJNA 1D1CA 1QVUA 2VKHA 4V2GA 2HZTA 3C18A 4G12A 4YEJA 4DNCA 4CZZA 3H1CA 2G7UA 2JTVA 1X1BA 1U2WA 5LLQA 1ETXA 3A03A 4C9YA 2R7SA 3Q0UA 4XOTA 2ZNZA 3SFIA 3SZGA 1U8RA 1H9TA 1K4SA 2EIKH 2HKOA 4YG2F 1SANA 3GYHX 1AWCA 2CFOA 5DUIA 2OCCH 2OD5A 2HYGD 4BXXJ 1FWZA 3MQ0A 1LDKB 1R1UA 1XX5A 3VDXA 3JTHA 4PZJA 2FE3A 1S8NA 2XAJA 4MQ9F 4U7BA 4JOMA 3LSRA 3AL0B 3IP4B 2BY0A 5FRMA 4EM0B 5J1YA 4LLNA 3ABUA 4ANJA 2HVRA 4UUSB 3OYEA 5E3LA 3HSRA 2WAEA 3OYIA 1KONA 3D5RC 3S1MJ 2MC3A 1O3SA 4PDKA 4EGZA 2OV7A 4QPQA 1IN7A 2H1KA 2F5FA 2M3AA 2CU7A 5ILVA 5DCMB 1JHHA 3WU1B 5IYDJ 1JT6A 9ANTA 1R22A 3H0DA 1OFCX 1KA8A 4XR6A 2M4GA 3WU0A 4ENJA 1GDTA 3GTJJ 1R36A 1Y8RB 4I7HA 2HZDA 2A6HF 2QLZA 4XN3A 3EETA 4RGUA 1FBUA 1FNNA 1R6RA 3R6SA 4G8XA 3RQ4A 2JA7J 5EEGA 4XLAA 3TOAA 3SEZA 5J8FA 2V6EA 3SXYA 1E3PA 2LREA 2EZLA 1RC9A 1Z6TA 1W7PB 2ZBKA 1VQPI 5B1AH 4S05A 1FEXA 3CCLI 1T08B 2DOFA 3KP3A 3C7JA 3I5UA 1FJLA 1YRNA 5F0CA 3A0BC 5FFZA 4CYCB 1BW5A 3OR2C 4A0YA 5FO5A 1BM9A 1TZLA 2DA7A 5EDNA 2B63J 2QENA 1D5VA 2HKXA 2E1CA 2XSDC 2DMPA 2F5VA 2WV0A 5J4YA 3KZZA 3O3KA 2KPMA 3F9KA 1WQ2A 2O8KA 1YQAA 2K85A 3IAS2 3OYMA 1TQPA 3MKYB 2IGMA 2VIXA 1ZK8A 1WJFA 2CQNA 4MEYF 1IN5A 5LHHA 4RB2C 4DYRA 3B6AA 2R7RA 2DA5A 4LMYA 4QPOA 1NTCA 3J81K 2V4JC 2QQ9A 1S7EA 2DW4A 1FTTA 2ZMEA 3FMRA 1Y8QB 3AG4H 3M1CA 2A6EF 1L3LA 1UAAA 4A5MA 1IRZA 5GADJ 3EYIA 4II3A 1FP1D 3OYHA 1J5YA 5IT3A 2NVQJ 1SFKA 4D1QA 4M72A 4X6AJ 1YS7A 3NRVA 4F3QA 3CO6C 1JUSA 3C2HA 3F8NA 4EVIA 1EV7A 2WY8Q 3WGIA 1DPRA 2LOOA 4FX0A 3QPSA 2XPVA 2CH0A 3IHUA 3HRMA 3PL8A 3ELKA 5E1ZB 2CG4A 1GXQA 1APLC 1AKHB 1IN6A 4A3JJ 2DA2A 1CQTA 4A3LJ 5EJCA 3JW4A 3L2RA 3QOEA 3S3OA 1R4MB 2NS8A 1KU7A 2EA2A 3G6EI 2VQLA 4HAMA 3FX3A 2HXOA 1XG1A 4H0EA 5IY5H 3H0GJ 3MZYA 1P6RA 4OINF 2XROA 3H36A 3K4CA 5IP9J 2FJ1A 4C2MJ 4KT5C 5HLGA 3JRBA 2BY2A 3RZDJ 1V54H 2LKXA 2F4MB 1J09A 5AONA 1JJ8C 4UUTA 4R8HA 1XDSA 4N4OB 2IGOA 4DOZA 1B72A 4XLCA 2DFEA 2EA4A 2VBYA 5FKKA 2FQ3A 4IRGA 4W97A 2E60A 2RV8A 3K4JA 1HXDA 2QGUA 2XAFA 2QUFA 2Q1ZB 2R7VA 2V9VA 4QIWN 1R9TJ 1WJ5A 4RDUA 3TP3A 4FASD 3E5UA 2M9HA 2KFDA 2WWYA 2STTA 1HQCA 3HPHA 2BOLA 3HOSA 1HBXG 3QYEA 4ESJA 2H8RA 3L00A 5FROA 1W5TA 3ZOBA 3NQOA 4E7SA 4BHCA 5K7HA 4CCMA 5HLHA 3BG6A 1XSVA 2JA2A 3BR2A 3LQRA 2FNPA 1F4KA 1RKWA 3L09A 4BY1J 4LIVA 1F5TA 2CW0F 4RB1A 1SVMA 2JSPA 5GAEJ 1A35A 3ABMH 3JTGA 5KAFC 1Z3XA 5HNHA 2GA1A 4KIGA 3L2CA 3E6BA 1U9OA 1FSHA 1CF7A 2PQ8A 2M7BA 5HLTA 1AU7A 3KE2A 3MWMA 1SVLA 1SAUA 3DBRB 1X19A 2EFNA 4IVNA 3CMMA 3LFUA 2K27A 3RKYA 2Y0MA 1TW2A 3K9TA 4DIQA 1U5TA 4H4KC 3HHHA 2ZFUA 5CLSA 4E7KA 4ZJZA 4M71A 3CC2I 2JT1A 3HUGB 4HQEA 2HXIA 1NG7A 1XGOA 1VNDA 1WVRA 1O3RA 3WTWC 2QKLB 4Y52J 2W82A 3E5XA 3S17J 3HZJA 2L5QA 3RZOJ 2OJED 1SD6A 3T0YA 4NC6A 2DOEA 2I8DA 3ZXSA 4XORA 1YJNI 2WY7Q 1SFEA 5K1YA 2V1DA 1B59A 2WTEA 3ERMA 1JTXA 5LGUA 1MJ9A 3WTYC 1WZ2A 4MFEA 2NOGA 1IN4A 3OIQA 2WADA 3HYIA 2OTJI 4IL6C 4GXOA 2W84A 3FXUA 1ZGWA 1AA7A 5CVJA 4W1UA 4DW6A 1DU0A 2R7UA 5F1RA 5HS8A 4BHPA 2FNAA 4JX5A 4MTDA 3ZMSA 4E70A 3S14J 4RLQA 5DYMA 2ECBA 1A6QA 1RZ4A 1BR4A 2M0MA 5BMZA 2XAUA 1MMDA 1IDZA 3E0JB 3SDGA 3S8PA 5D4RA 1FMVA 1Z67A 2XIGA 3HOUJ 1HOMA 2XASA 3KX2A 1GT0C 4RAZA 2PJRB 4Y7NJ 3ZRGA 1YIJI 5DDGA 3HXLA 3TKYA 4JX4A 2LLKA 3J80Z 4LJZF 1O3QA 5D8KB 4KDPA 4BYYA 4ZDOA 2R7FA 4RBOA 5HDNA 4II2A 3O2PE 3CDLA 4PSXA 4UUSA 3CCEI 1BR2A 1WH5A 3FM3A 3U1KA 1TP4A 2OPTA 1EKEA 1UCRA 3BJ6A 1I27A 5DCMA 2EFWA 2F6CA 4OMZA 2K86A 1VQ6I 1LDJA 1X1AA 3OOUA 2AXTC 1Z3YA 5F0FA 2HU9A 5BPIA 3PNYA 1ITYA 4MIMA 2L4MA 4JQFA 3I64A 3U2RA 3G1MA 1W36C 2GIVA 2EZHA 5BS6A 2F5CA 1LJ9A 1WFXA 5FJ8J 3CMEI 4ZTFA 1T0FC 1Q1HA 4MO7A 3CLQA 1IV6A 2V1NA 2ELKA 3LSGA 4XL9A 2HVSA 2D1VA 2CV1A 1XGMA 3RCOA 1I5ZA 3CUQB 2CUJA 1FYMA 1DDNA 1W7PA 1RETA 2UZKA 1A6IA 1BN5A 2HGCA 1ZR2A 5AIQA 1C0WA 2FSWA 1X1CA 2RVCA 1TTYA 3SZTA 4AD9A 3N97A 4UY8I 1ZAOA 4CYCA 3KYLA 1XGSA 3IV5A 2GZWA 3R0JA 2P7CB 4GCVA 3ZCOA 1H89C 4UHTA 3A01B 4LD5A 4AC0A 1YW7A 1K6OA 4KN4X 2LFBA 2Q8KA 4XONA 3MAJA 2FBIA 1BC7C 3TL4X 1QZYA 1UHWA 2QM3A 3P9CA 1X3WB 2JK3A 3W6KB 4BQOA 2K02A 4O5VA 4KN7X 1ZYRF 3BROA 3KFWX 5C4JJ 3ABKH 1Z7UA 3CJRB 3KP7A 3VYUB 2GXAA 1HSJA 3DPLC 3DPUA 1R5GA 3C2GA 2CFXA 2BVLA 2KP6A 3HEFA 1FBQA 3REOA 2E1MC 2OTLI 3FXRA 4RGSA 3HG9A 2X6WA 3FDYA 4A3KJ 3C2BA 2VT2A 2DYRH 4CO8A 1LUJB 4HNVA 2C6YA 3G3ZA 1AKHA 4FX4A 4XIDA 3LL7A 1TWFJ 3M8EA 3ZQLA 3FHNA 1I6XA 5LRRA 3BPVA 5LRSA 3EUAA 1PYVA 1OR7A 2TRTA 2R7TA 2PFBA 3GMEA 2VE8A 5CKTA 5ICCA 3FXJA 3WGGA 2H94A 1BI1A 4K2EA 2F5DA 4I98B 2XDVA 4AIKA 3VYTB 5CPRB 4M73A 2JRMA 2HYFA 1S72I 2MC4A 5FKNA 4S04A 1V5EA 3HIFA 3K1NA 3GFJA 3Q9VA 3BR0A 3H35A 3IH4A 1IRGA 3HSFA 3KP6A 1VQLI 4ZDPA 2NS7A 4IKFA 1ETQA 4RS8A 3BPXA 3BR3A 1BC8C 3WE2A 4CXFA 1ZG3A 1VTNC 1J75A 5H2FC 2R7WA 1G2HA 1HKTA 4LIUA 1BA5A 4FT8A 4Q4ZF 2IXSA 2EINH 3DQVC 5CQGA 4BHBA 3M7GA 1MGTA 2A5WA 4IHWA 4L0ZB 4V2FA 4OIQF 4HRIA 1OYWA 2H09A 4KUMA 4B43A 2PI0A 4B44A 4G6DA 3V7RA 4XSZF 2EIMH 4AIDA 5D5UB 3R61A 4LG3A 1ZG5A 2OF7A 2H1LA 4ITVA 1RUOA 1TC3C 4HQMA 1YYVA 2MD5A 2XF6A 3BZKA 4C2TA 3GTLJ 3WTXC 2X4HA 3IKVA 2DFIA 2Z2SB 2IAIA 3BZCA 3EUHC 4KIBA 4DBRA 4R79A 1H0MA 3G2BA 4B8XA 1U78A 2VJJA 2UWMA 3PSFA 5D8LB 3CF2A 4DBQA 3BTCA 3K10A 2QEXI 2XPWA 2HI3A 3DFGA 3OL4A 2P8TA 4RB3C 2JPCA 5CQEA 2BZTA 3E3VA 4CICA 4YFNF 2EFOA 2QA4I 5M5WJ 3S2HJ 3M07A 2STWA 4NBQA 5BPDA 1EF4A 5B1BH 3BJAA 2ZSHB 2DJIA 3HSEA 4I76A 2ZO4A 2HS5A 2E1OA 2LY2A 3ZQ7A 3HUGA 4ON0A 1G3YA 4ETSA 3Q0VA 3ZMUA 2DXIA 2MABA 2ZSIB 2L01A 3DXJF 5BNGA 1T33A 4D0PA 2NAZA 1IXRC 1WH7A 3RSNA 1W0TA 2PJPA 2D1HA 2P5KA 4D5CA 1W1WE 3G71I 2ZB9A 1I1GA 3K6GA 1P4XA 2JJ7A 4XRSG 3MZHA 2E7XA 2W24A 4UVAA 1J9IA 1UHSA 3D0SA 3DP7A 2Y48A 1HSTA 2CQ7A 2CUFA 1KZHA 1W5SA 3TQNA 2VI6A 3LQQA 4C3HJ 3BCAA 4IOAF 3S1QJ 2KZGA 2R3SA 4OWRB 3ZMZA 5J47A 4HW0A 2CGPA 1YLFA 2LTPA 4F55A 3DKYA 4CCLA 5DEQA 4DZJA 1K6YA 4XRSA 4IO9F 4EQQA 4G7HF 2R7OA 5EGOB 2CWEA 2W00A 1MMAA 2F4IA 3O6BB 1RRJA 1OYIA 2PG4A 2YPRA 2LKPA 3RYPA 5F0HA 2L9RA 1VQ5I 1QU3A 1QZZA 2X1EA 2TDXA 1TWHJ 2PX9A 1LKXA 1IRXA 1DPUA 1YJWI 1GUUA 5H20A 3G73A 3HB9A 3ESWB 4BKXA 1Z6RA 4BBSJ 4F7ZA 1J59A 2ZNYA 2HPMA 5J40A 3OS1A 2J5OA 2KRCA 3PNVA 2PEXA 5ILSA 2K3FA 1QPMA 2PJRA 4EM2A 5E3OA 2WB1N 3AG1H 3E1SA 5KAIC 4IHSA 2Z33A 2KLOA 3RYRA 1ZN2A 3TDZC 2OZUA 1RR8C 4IHTA 2LDUA 1BIBA 5ICEA 4IEJA 4HSTA 5EF6A 1FLIA 4HNUA 1OLTA 2UXNA 4HNTA 4UB8C 2MH2A 2R7QA 2R5YB 1D0YA 1Y1VJ 1X4OA 3L2UA 4MNUA 3MEXA 4GYGA 4WXHA 4BJ6C 2W7NA 1MNMC 4R1HA 4EATA 4CZCA 5LEJA 3JR9A 1IUYA 3F8FA 3QOPA 4L5IA 1XD7A 2KIQA 2NYXA 4P96A 5GPAA 2NVUB 3K69A 3DTEA 2D5VA 4O6JA 5IT9Z 4BQAA 3NWTA 1MBFA 3H92A 2EBIA 4CCJA 3I59B 3BOQA 1EJ9A 1XCVA 1ZQ3P 3CUQA 2KT0A 5IOYA 4FQGA 2JA8J 1T95A 3M3YJ 4PUSA 1QNTA 3L2VA 2DDBA 5J1RA 1G4DA 3JSOA 1WPKA 1YTYA 5E3NA 4D5FA 4OAYA 2ZMEC 3QU3A 3DBLB 3BC8A 2I10A 3FXQA 2X9DA 1TL8A 2O03A 1VF9A 2M87A 5DTDA 3A01A 3OYAA 3JRDA 1ZHFA 3HRUA 4CCKA 5GTIC 3OY9A 4HDUA 3VODA 2DCEA 2M0CA 4I01A 1MMSA 3ZQFA 4M3BA 3TGNA 2VL8A 4RB0A 3RPUD 1PUEE 1F1ZA 3BJOA 4P5OA 4IJAA 5ILUA 1GV5A 5FD5A 3V8JA 2D2WA 3BTLA 2E7WA 4BBRJ 1BOAA 4MTEA 4UV8A 1I39A 1SD7A 5EZGA 4ZZLA 1MNEA 4XK4A 2EQRA 2YU9J 4M3FA 3V7CA 2EPFA 2ZFWA 2L02A 4LLLA 2FQ4A 2ZXIA 2YUSA 2G9WA 1DP3A 1EH6A 4DZPA 2OAZA 3VOEA 4P9FA 3KCCA 2AXLA 1SMTA 3F21A 1K4TA 5FRNA 5DD8A 2COMA 3LWFA 2QWWA 5F6FA 1S6LA 3FISA 3LMMA 1REPC 3AKZA 3WTUC 5LEKA 3IWZA 5K7ZA 2X6YA 4ZYDA 2XSJC 2Y2ZA 3G4SI 1BJZA 5HNFA 1FP2A 2EK5A 2M5WA 2NVYJ 3E97A 5JLWA 3TO7A 3CP8A 2LP0A 2A07F 2ETHA 3IH2A 2AHQA 3DF8A 4L9NA 4L18B 4BEHB 2VJIA 1OPCA 4CCNA 1VQ4I 3HGYA 1EA3A 2W1OA 3CO7C 3WTZA 2XAGA 1WJDA 5DM6F 1XS9A 4U0WA 3OIOA 4U87A 3HJEA 2Y75A 4UVBA 5J8CA 3BG3A 3AG2H 1OCCH 5GAHJ 2DMQA 4MEXF 2OQGA 5CJ9A 3MN2A 4ZH4F 2FF4A 2IP2A 2BHYA 3K4KA 4FE4A 3QPLA 1YX3A 2XAQA 2CO5A 4C30A 3MFKA 4IHXA 3GFMA 1FZPB 2W85A 5DUKA 1D8KA 2MLKA 4DYCA 4A3GJ 2VB6A 2W57A 3VYRB 4B1RA 1QBJA 1IRFA 1NG6A 2FUG2 4RMNA 2QBYB 1S29A 1ZR4A 2H6CA 2L9NA 5J3LA 1ETKA 1R7JA 3JRFA 3CQZJ 3ZN0A 5LGNA 2VBWA 5IYBJ 2ESNA 2Z99A 4KISA 2RGVA 2XF5A 3ECOA 5E17F 3KP5A 4X0GA 3P9IA 3ZN1A 2ME0A 4N4NB 3DPTA 4OOIA 3PSIA 1BIAA 4UV9A 3TMOA 2K5CA 3GFLA 2ZJQF 1SD4A 3F0CA 3U1DA 2BXZA 5CYVA 4A6DA 1FSEA 1IXSB 3QODA 2KL4A 1HA8A 2L7ZA 2MBFA 3LOCA 4GYIA 3W3CA 4CYDA 5E79C 2Z16A 2WV1A 3IWFA 2BHZA 1ZGJA 2AO9A 1J7KA 3GUDA 3QP5A 2MLGA 4F52A 1R23A 1BW6A 2E19A 1TT0A 4EM1A 5K5OA 1JT0A 1RPWA 3I58A 2VQGA 1TLHB 2W48A 2K9MA 5IP6A 5EG0B 2JVGA 2MH9A 3CJNA 2P5LC 1MMGA 4XLHA 3LAPA 3IL2A 4AIHA 2OCEA 3TEDA 3ZPLA 1ETVA 3CC7I 3GLXA 3S1RJ 3VSLA 1MSFC 3A2KA 2Z5UA 3OYBA 3OYGA 2AQEA 2LR8A 2KIFA 3RQIA 3HGGA 4HPQA 2H6BA 4XLFA 2RQPA 3VFZA 5L3DA 3FK6A 4G7OF 3QQAA 1JKRC 3GXOA 3VSKA 1FOKA 3HHGA 1Z1DA 1KQ8A 2YX4A 2A61A 4YIFA 5EGOA 4KMUX 2WB1A 2FMYA 3OMYA 4ESBA 1MD0A 3VYSB 1VQMI 2O6GE 3WU2C 1TWGJ 2JZYA 4CGZA 3JRHA 1RKTA 3S93A 1E0EA 1R58A 2ZJPF 3LSMA 5JLXA 2QSHX 3LNQA 2R5ZB 3ZP5A 1YITI 3QU6A 1MBGA 4F93B 2LRDA 4ZYGA 2XUBA 3IUOA 2V7FA 2BW3B 2FOWA 5FFXA 5LBQA 5FLXZ 1HDPA 3D5LA 4FETA 3SJMA 2CMPA 3GCMA 5F1JA 1VQKI 3T5XA 3I3LA 2DLLA 2ELHA 4A12A 2DFHA 1LNWA 3S2DJ 4M3DA 1MSEC 1WRJA 1KU2A 2W25A 3FZVA 4ENMA 2DPUA 2JUCA 3QWLA 1IAWA 4LLGF 2ZJ2A 1T56A 1TT5B 5H6RA 2LNBA 3HOXJ 2R5YA 4I0AA 1HF0A 4J01A 1B6AA 5HS9A 2KQRA 4LB5A 3OYCA 1B9MA 2NOJB 3S32A 4AVPA 4NUBA 4IXAA 2RN7A 3GWZA 4G9YA 1SMYF 1XB4A 3HKZN 3OSFA 1Y1WJ 2X0LA 1U6GA 1R71A 4ENNA 2O5RA 4EEFG 3P9KA 5LHIA 1ON2A 3H3VK 3EYYA 4KFCA 4DJAA 2E1MB 3S3MA 5KCMA 2VC1A 2ZJRF 2GXGA 2JA5J 2R7ZJ 3IH3A 3I59A 4I0BA 5DD4A 1SFXA 1YW8A 3NEUA 4AYBN 1IF1A 1UELB 3CJTB 3A4CA 3GO5A 2XB0X 1ZG1A 3NWSA 3ZMTA 4A6EA 3WTSC 1ZKGA 3NAUA 2RKHA 3LA3A 1T6SA 5D4SA 1H8AC 1MJBA 1G3TA 3PO3J 2Z9OA 1I1SA 2L2OA 4E7LA 1W5CC 1YOVB 3CLOA 4RAGA 5TRDA 3KEOA 3FKJA 5D6FA 4C2UA 5CVIA 1I3QJ 2UV1A 1J2XA 1PJRA 2HDWA 3QP6A 2JA6J 4QLCU 1YX5A 5L3CA 1GV2A 2XGEA 4Y4RA 3LSPA 4PGGA 4XLEA 3HRTA 3SHFA 3TW7A 4HF0A 2L7MP 3OYFA 4A93J 3ZMDA 3DEWA 2AS5F 3FM5A 2MA3A 3HOTA 1LFPA 1X1PA 2QYOA 4A3CJ 4NHJA 2XRNA 2VODA 3V8KA 3ERED 1F36A 1O57A 2R4GA 1QHGA 3K2AA 3TDUC 1P2FA 2O8XA 3L1PA 1OCTC 1YW9A 5HODA 4E7HA 3N4MA 2CQQA 2BV6A 2Q0OA 1GVJA 4I02A 4PFPA 1MKMA 4M9ZA 2ISZA 1JUPA 5F08A 4JYKA 2ZXHA 4I6ZA 3GTKJ 4GGGA 1P4WA 2LY9A 2P6SA 4BACA 4A3IJ 4XKBA 3H3UA 1ODDA 4E6KG 3A1YA 4LB6B 3W2AA 1HW1A 4BGDA 4E7IA 3RTRA 1FOYA 4HBLA 4DYQA 4XSXF 2ZXJA 4HZFA 1O7FA 2CW8A 1BI0A 2K9LA 4Y33A 2LYCA 1PUFB 1SC7A 3U9GA 3GEZA 2V9PA 4XKWA 4A3MJ 2O61A 3E6MA 2DT7B 4GFBA 1PVEA 3KIOA 1ETWA 2KMUA 2M8EA 1ACIA 3GFIA 2ICWG 2A3SA 4BJ5C 3LSIA 2L4AA 4BEHA 5F64A 2VC0A 3K7AJ 1D1BA 2HNHA 3Q0WA 4FE7A 3EPZA 1VQ7I 4AIJA 3BG7A 2OU2A 2XGCA 2ZC2A 4Q48A 2FRHA 2GWRA 3SQNA 1K79A 3K4MA 3DTKA 1FX7A 3CCQI 1YFHA 4CA0A 4F91B 3TP0A 2DAOA 4B3XA 1FY7A 3H5AA 4I2OA 3DBHB 1F43A 2A68F 3AAFA 2CSOA 2CV0A 5IP7J 1MIJA 1G8XA 2CQKA 4P55A 1SAXA 2X51A 4NQWB 3F8CA 2QBYA 1AOYA 1SVOA 3CF5F 4F92B 2EWNA 3EQLF 2B0LA 5FKOA 5DS9A 2G7HA 2CS3A 4M3GA 1POGA 1QGPA 2KHMA 2LK2A 1Z0XA 4FHTA 3K70C 2NNNA 4U0VA 1DGWY 3HDDA 2EZKA 1X58A 4G94A 3UNGC 5ICGA 2GA2A 1D3YA 2FU4A 2HQ5A 1ORKA 2VKEA 1VQ9I 3VWBA 1HKQA 3CTAA 2XAHA 4TV7A 1ONVA 2CQXA 2BGCA 4C3IJ 1MH3A 5B66C 3OOPA 2HQRA 1VFCA 1K78B 1LQ1A 2DBBA 1E2XA 2VBXA 2HOAA 1TW3A 4M6VA 4C3JJ 3FXMA 3G1LA 5B3SH 4M74A 3CCYA 5EG0A 4IQJA 3W2WA 3J81Z 3GW2A 1FYKA 3BT9A 2F2EA 4BUPA 4NB5A 3K2ZA 3CMAI 3QAHA 2PMHA 2R0QC 4S0HB 3F8BA 3HPGA 3OYLA 4YIIA 3E6DA 1X4PA 2Y9YA 3MKWB 1BBYA 1O7LA 1WJBA 5L3GA 3CCRI 1KU9A 2HQNA 2LF7A 2YU3A 2FA5A 3M8FA 3U21A 4KT6A 3AFHA 3JREA 2P6TA 2X1CA 4J19A 3Q9SA 4IX7A 3TW6A 2ID3A 1MBEA 1UZCA 3LFKA 1MBKA 1T0FA 5IPAA 3PIOF 3CD6I 4O3MA 1LFBA 2IBDA 5JHUA 3M4OJ 3ZQHA 1ZRFA 1FOXA 3GTMJ 2N8GA 2R5ZA 1R00A 2VQCA 1W7PD 1X2NA 2BXYA 3TO9A 4CHUA 5J1UA 1VQOI 5JFRA 1HW2A 2BW3A 2R7DA 5KNLA 2HDDA 1SFUA 1TWCJ 2KDZA 4Y13A 3RPQA 3GTGJ 2V6CA 2EH3A 3GZNB 3HKZA 3I9V2 1WSUA 1GVDA 2KRHA 3FBNB 2E35A 1U8BA 1QQIA 1JXSA 2ZCWA 3CDHA 4UUVA 3VEPA 3ONQA 2LC2A 1OJLA 1PDNC 2PBIA 1ZRDA 2DMUA 2RC4A 4B09A 4AYBA 1HKSA 2ELJA 2XB5A 1OKRA 2E36A 2JWTA 3BZ6A 2EIJH 4PJJA 1LEBA 2VKDA 5F04A 4FCYA 4ASNA 3E5QA 4N9HA 3F3XA 2HEOA 3GTOJ 3BQYA 4G6QA 5E18F 1WJCA 1FMWA 1G6NA 2Y0SN 4ZZDA 5D6EA 1LVAA 1HC8A 1N75A 3K1MA 1IN8A 1OCZH 4KIFA 3T1BA 5DV5A 3I53A 4G6TB 1IGNA 1MDMB 3K4BA 4UXNA 5FD6A 1UB9A 1VQ8I 1BJAA 5L3FA 2DI3A 5C44J 2HFHA 2GAUA 2KKOA 1MW7A 1XGNA 2VQHA 2KZVA 3CP2A 4KICA 1NK2P 2EV5A 3FKIJ 2PMZN 4EJTA 4XKVA 2DOAA 2RDPA 4L5EA 3F6VA 1W4MA 2BYVE 3FK7A 4IHVA 1T8IA 3Q3SA 4LITA 2DU9A 4KA4A 2VONA 1MH4A 3ASNH 4HYEA 3BR6A 4AWXB 3MKZA 3HOWJ 5D5WB 1B9NA 2A69F 1S9HA 2I5UA 3ASOH 1IJWC 2L9SA 1JKOC 1QRYA 2F5EA 4P9UA 1VI0A 5E1WA 2VJ4A 3FIWA 2IS2A 3I4MJ 2JRTA 1OYYA 4MHGA 2CRGA 3H3ZA 1JE8A 1DQUA 3CMYA 3I4NJ 1FIPA 4BL0B 1NHAA 2IVMA 3BLYA 3DLAA 4HX7A 4E7ZA 2KIUA 1SD5A 1F9NA 3ROUA 2EV6A 1M1EB 2IPQX 2CUEA 1V3FA 2E1NA 2L54A 1IG7A 1EH8A 3G1OA 4ZYHA 2EFPA 3OYNA 2L7KA 3FMQA 1JGSA 2DA6A 2DMTA 2Y69H 5H6QA 3IRQA 1LE8B 3KZYA 1ERDA 4IOCF 4HG2A 3W2VA 1B8IB 4A3BJ 2OC6A 3GZ5A 4A3EJ 3EUHA 2FX0A 3DKXA 1PUFA 2IRFG 1R49A 2NVXJ 3GTPJ 1Z05A 4HA8A 4HLYA 2JSCA 3BR5A 4XOPA 3Q5FA 1E17A 2MW8A 1KYZA 2LSOA 4XNFA 1Y0UA 1NK3P 4MLOA 1P4AA 5HVQC 2M7AA 3CCVI 2E34A 3CCMI 2ZXWH 1UJ8A 1Q1VA 2VBZA 2WA0A 2GLOA 3OSGA 5D5VB 1USTA 2DN0A 2DK5A 2Q2EB 2CW7A 2VPLA 1X1DA 1NH3A 4IF4A 1XSDA 2Z3YA 5EYRA 3CESA 2B9SA 1RNLA 3KPHA 3WTVC 3K70D 1ZREA 1FIAA 3L7WA 5JVTA 2QQAA 5EEAA 1K7AA 3WHBA 1A5JA 2EV0A 1BI2A 1TQIA 2ESHA 1YHQI 1G3WA 1FC3A 2L0KA 1IV8A 3PNTA 3R4KA 3LAJA 3ZQCA 5K5RA 3HL2A 3MMYB 3QRFF 4NQWA 2FEZA 1GHCA 4EJOA 3GX4X 2MGQA 1R5ID 3FXKA 4LGWA 2HOEA 1CGPA 2NVTJ 1IXCA 4BE0A 2K4JA 2CJJA 3OL3A 1U3EM 2VJ5A 4E4HA 2X48A 5FKLA 4PFOA 1I50J 5J4VA 1O3TA 2ID6A 1DU6A 1TNTA 1SFOJ 1A31A 2XGXA 1N25A 3F72A 2DTRA 3BG9A 3WODF 4RM3A 1T39A 1L0OC 1K78A 3HTSB 3EUKL 3FXOA 4LG0B 1KQ0A 1UMQA 4YRVA 4IHYA 5GP9A 3F8MA 2ACJA 2W4SA 1WWXA 1LB2A 2P81A 4NDLA 4GDFA 1S5LC 2OZ6A 1UHMA 1OCOH 4B3AA 1Y6IA 4Q5SF 3SEQA 5E3MA 3MZ8A 3J7ZI 4EJUA 4OAZA 1Z21A 1T2KA 2JMWA 4I99C 3V7SA 3DU5A 3SYTA 4XRFA 3SFZA 2F4OB 3H9JA 3JCUC 3JAMK 4AVZA 1JKQC 4M6XA 5GPCA 4A3FJ 2QF7A 3RDIA 4RLFA 4PJLA 2M34A 2M8GX 4WX9A 3J7AY 2E2JJ 1HDDC 2LBFB 4A0XA 4KITB 1XC5A 2QVOA 2QZ8A 4MQVA 3ZR8X 2HTJA 1H88C 4OU0A 1OISA 1G59A 3RKXA 2M30A 5BQTA 3H9QA 4LOCA 2VUMJ 1U5TC 2EILH 5C4XJ 4OIPF 1IUFA 2XKPA 1JI8A 4XKCA 3ZQGA 2OBPA 3PIPF 1JTYA 3HBLA 1QVTA 2K3PA 3S16J 3S3NA 4WK8F 1V55H 2VKVA 4XBFA 1A04A 3P5JA 4CH7A 3QYBA 2MYSA 2OA4A 4RGXA 1ENHA 1P9QC 2VPRA 3WG7H 4RAYA 4JBAA 2KDOA 2J5PA 5FGMA 2O3FA 2KISA 4NC7A 4IRIA 4MGRA 3LA7A 2Y0SA 5M5XJ 4CCOA 1YS6A 1WKMA 2XF7A 3OYDA 4OIRF 5AIPA 4YFKF 1VQNI 1STZA 3UR3C 3S2WA 2O9LA 4EV0A 2HWVA 5JHFA 3DCFA 2JUGA 5JI6A 2R92J 1ETOA 2ADUA 2QKMB 1KYWA 4Z6YA 5HS7A 4X1EA 1WHUA 4N9IA 3FWEA 3VB2A 1FPQA 2PMZA 2LH9A 4BDYA 1V4RA 3TOBA 4HV5A 1BR1A 5J6XA 3I54A 3QPHA 3WE3A 1ZELA 3L2WA 2K7LA 5CVRA 3C1DA 1MDMA 2RQQA 2DYSH 2VXZA 3W6VA 3I0TA 1N78A 2GOMA 1OMIA 4XMYA 3I55I 4CUGA 4GO1A 2JQ7A 3R60A 4J00A 3FF5A 3HC7A 2K9SA 2QSGX 3S1NJ 1Y56A 1TBXA 2IGKA 5FLMJ 3AL0C 4P1WA 4QSHA 2IS1A 1YO5C 3FHZA 2NRAC 5LGTA 3KEQA 2QSFX 1HW5A 3DKWA 1IO2A 2X6XA 3FXLA 4ESFA 1Z7LA 3E6CC 1XTAA 3P7NA 2LMDA 3ABLH 1PP7U 2EZIA 2A6TA 1KU3A 4KJZA 3ISPA 4D9JA 2DA3A 3IC7A 3LSHA 4Q47A 1PP8F 3L9FA 1Y0NA 1WI3A 2DODA 1S7OA 1FT9A 2B7EA 4XLPF 3OR1C 1A36A 5FLVA 3JRCA 4DGWB 5FB2A 4HEA2 2WAQN 2L9VA 3A0HC 3KP4A 2DTZA 3A02A 3I56I 4JK1X 1BL0A 1Y39A 1MBHA 1P7JA 2IGNA 3PUBA 5ICFA 1LE8A 1U0JA 5A2QK 1QPIA 2DFFA 1IW7F 5LHGA 3GZ6A 3MCZA 3WHCA 4WXCA 4XN0A 1SEUA 1B8IA 5L3BA 3CCJI 3KYCB 2LY1A 2JVHA 5LFAA 1S7AA 4NC8A 1JKPC 2VLAA 2P5VA 3PJRA 4L9VA 2LVSA 3ZQQA 3RI4A 2IA2A 1OQYA 1WJEA 1D5YA 2Y31A 3M8JA 2K9QA 4ZC3A 3WGHA 4OIOF 2HTSA 4BH9A 2DQRA 2O0YA 4L9TA 5D5XB 2L3DA 2HDCA 5F27A 3ZGKA 4RM2A 1USSA 2Q2EA 1GLNA 4CDGA 4EGYA 3H5RA 1UFMA 2DDAA 1OCRH 1YE9A 2HR3A 4D7NA 2O7OA 4PJMA 1Z77A 3ZQIA 3HOVJ 1S3JA 3FBIB 3OYJA 2E2IJ 3R0AA 4PJ0C 3EDPA 1RIOH 2RNGA 3KLOA 1HLVA 4PK4A 4M3EA 5GAGJ 5E1XA 4UNOA 1XN7A 4XQFA 1WJAA 4ABZA 4HDVA 4BQNA 3GTQJ 3TO6A 2R93J 2PLYA 6PAXA 5C3EJ 3ULQB 4XLNF 1DUXC 3LA2A 5K5QA 2PMUA 3H5NA 5IT9K 3BG5A 2QQ8A 1XCBA 1OR7C 4A0ZA 2XGDA 2KJCA 1G3SA 2EB7A 4BE1A 1MJAA 1H9GA 5M3FJ 5KK1A 3JRGA 1FTZA 2BEOA 2FBHA 1YIOA 4WWCA 1ZARA 5DM7F 3HRSA 2P0WA 2EJRA
chains in the Genus database with same CATH topology
1UJ8A 2BZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJ8 A;  2BZT A; 
#chains in the Genus database with same CATH topology
 1FBS A;  4AM3 A;  1K83 J;  4B47 A;  1XSX A;  2DQL A;  3RIR A;  1QA6 A;  3B6C A;  1IDY A;  5EEH A;  4LG0 A;  1WCM J;  2WC2 A;  4A2U A;  2QCO A;  1LVK A;  2XC7 A;  5TGT A;  3DEE A;  1LEA A;  2HOS A;  3O8G A;  1I3A A;  3DEU A;  4Y3O A;  3V8L A;  4A5N A;  3K1P A;  2ECC A;  1ZH5 A;  4AU7 A;  4Y15 A;  4V19 K;  4G7Z F;  3CJQ B;  3UKG A;  3IAM 2;  3L2Q A;  3KYD B;  3PUF A;  2K4B A;  4BAY A;  2KRF A;  2IA1 A;  4ZYE A;  1D1A A;  3KZI C;  1EH7 A;  4ZYA A;  2WAF A;  1ZGA A;  2IJL A;  3B02 A;  3F6O A;  3OWT A;  1MMN A;  2VT3 A;  4RGR A;  1FYL A;  1VZ0 A;  3PFY A;  1UG0 A;  2LBF A;  2LF8 A;  2E5N A;  4U88 A;  3I4P A;  2IW5 A;  3WTT C;  2Y9Z A;  4UB6 C;  2VOO A;  3BTJ A;  1UG2 A;  3CZ6 A;  3TBI A;  4A3D J;  2M2E A;  4LFU A;  3MD2 A;  3E7L A;  1KGS A;  5GTH C;  4BE2 A;  1LFU P;  2V79 A;  2VXD A;  1YJ9 I;  5CVU A;  1YG2 A;  1QO0 D;  2GBY A;  1DGR M;  3GBG A;  3LSJ A;  2LD5 A;  5IYC J;  3IKT A;  3F23 A;  2YSR A;  3T8R A;  4YFX F;  5E20 A;  4QWQ A;  2ISY A;  2L7F P;  1X3Z B;  1MZB A;  1JGG A;  3DU6 A;  2XVC A;  5BOX A;  2RAE A;  1XPX A;  1ZLK A;  2CUZ A;  2ZKZ A;  2WBM A;  3SZP A;  2H8W A;  3JAM Z;  3V4G A;  1XMK A;  3JRA A;  1N77 A;  2VN2 A;  1LDD A;  1RR7 A;  5CVV A;  5KVR A;  3M9A A;  4ENK A;  4HV6 A;  2DO7 A;  4JP0 A;  2DT5 A;  4YIR X;  4L5J A;  3KLN A;  1O4X A;  3DV8 A;  2A5Y B;  2XPU A;  3C3W A;  4PJN A;  2IA0 A;  2HPI A;  3QYF A;  2MD0 A;  2LKS A;  3LSK A;  4WF2 A;  1GXP A;  1B1B A;  2M1B A;  4PSW A;  5HDK A;  3D1N I;  2BY1 A;  3HM5 A;  2XRL A;  3KP2 A;  1RI7 A;  1LPQ A;  4JX6 A;  5M5Y J;  3CCS I;  2VE9 A;  1V5F A;  3ML6 A;  4BXF A;  3CC4 I;  2IT0 A;  1P92 A;  1WI9 A;  4PCQ A;  4HF1 A;  4WXD A;  2AQF A;  2BVM A;  2IS6 A;  3BP8 A;  1KQ9 A;  4KNY A;  1ZTR A;  5E8G A;  2RNJ A;  4QTR A;  1T38 A;  2R7X A;  1TNS A;  2CYY A;  3LST A;  5DCF A;  4U0Y A;  1TWA J;  3ZMV A;  1YRN B;  4ZTJ A;  4Z2Y A;  2D45 A;  1AHD P;  1D0X A;  2TCT A;  4BXU A;  1MND A;  4LK0 F;  3T8T A;  4HX4 A;  3W6J B;  2F48 A;  2OUM A;  1JUM A;  2HQA A;  4IQ4 A;  3PQJ A;  1E3H A;  3CCU I;  4B4C A;  3NAR A;  4M9X A;  2M4K A;  2CV2 A;  1FOW A;  1T98 A;  3J7A O;  2KIM A;  4HOB A;  1Z91 A;  4B48 A;  2LG4 A;  4DQ2 A;  1QZE A;  1X2M A;  2WAQ A;  2MG4 A;  4IPA A;  2E2H J;  5TJJ A;  4HLX A;  3K4N A;  4XIC A;  4L0Y B;  2KJB A;  3WG9 A;  2ZME B;  1J0R A;  1R1V A;  1ETY A;  1YI2 I;  2EFQ A;  3KET A;  2HYJ A;  1WGX A;  3QPT A;  1ON1 A;  2DA1 A;  4FIS A;  4RAF A;  2FML A;  2DA4 A;  2H27 A;  1XDU A;  3D5S C;  2V1X A;  1R5H A;  3CUO A;  1HCR A;  3CUQ C;  2E71 A;  4EMS A;  4IZZ A;  5E8I A;  3BY6 A;  2GIZ A;  2BY3 A;  2K40 A;  3OV8 A;  1D8J A;  1RES A;  2BBY A;  2HVQ A;  3DTI A;  2JPB A;  1B4A A;  5ERI A;  4LK1 F;  2DT6 A;  2P7V B;  1XMA A;  4HSR A;  3V42 A;  2HOT A;  2V26 A;  5KHD A;  4BS9 A;  5HDG A;  3J7Y J;  2VAS A;  4BQQ A;  4D7M A;  3KEY A;  4FTH A;  2DK8 A;  1I6H J;  3OS2 A;  1DP7 P;  2YR2 A;  4XRM A;  2Z1D A;  5FLX K;  1P7I A;  4I09 A;  3CDI A;  3O8H A;  3VPR A;  4WCG A;  3RPU A;  3PM1 A;  2DPD A;  1MBJ A;  1B72 B;  4ZDL A;  1RUN A;  2P4W A;  2FBK A;  4EJV A;  3COA C;  3JRI A;  3DLL F;  3MVP A;  5M3M J;  1JJ6 C;  5EZH A;  1U9N A;  4M9S A;  3OYK A;  1ZRC A;  2IS4 A;  4UVC A;  4OMY A;  3AG3 H;  3BTI A;  2MFZ A;  3IRR A;  4BY7 J;  3H9G A;  4KMF A;  4N0B A;  3BQZ A;  3K4L A;  3S15 J;  2VOP A;  1W0U A;  2COB A;  1IC8 A;  3OIP A;  1R1T A;  5A2Q Z;  2DMN A;  3F22 A;  1Z9C A;  2XHK A;  2UUZ A;  2YX7 A;  5L3E A;  3ABT A;  3B73 A;  3MKL A;  4GRI A;  4HF2 A;  3K0L A;  4XM3 A;  3HOY J;  4MFD A;  5JVG F;  3GVA A;  3ECH A;  3BR1 A;  2MSY A;  2QQB A;  4M6Y A;  4BNC A;  3JSP A;  2OQR A;  1ZLJ A;  4HX8 A;  2JN6 A;  5HLI A;  3SDB A;  4E7J A;  1X3U A;  4RA2 A;  5TIS C;  3N05 A;  3RJP A;  3GLL A;  1OCP A;  3PFI A;  4IRH A;  1QHH D;  4CSW A;  1CF7 B;  3GF2 A;  2UXX A;  1W36 D;  4KYW A;  2X85 A;  5JR3 A;  3M1E A;  2X6O A;  4YEL A;  1IZ1 A;  1D0Z A;  2X1D A;  3FMS A;  3HOZ J;  2Y30 A;  5FKM A;  2GXB A;  4U7D A;  2E5Z A;  1U5T B;  4NNJ A;  2FXA A;  2BE5 F;  2IEK A;  3OS0 A;  3X2Q H;  3HTU A;  4EJW A;  2V1U A;  4BDZ A;  5ED4 A;  2NXN B;  4PGH A;  2A05 A;  4L9J A;  5B5E C;  3BCB A;  5IOZ A;  3RKQ A;  1BOB A;  4A69 C;  2GOX B;  1JHF A;  1XMX A;  5HOO A;  2XV4 S;  1TQM A;  5K7F A;  4AUX A;  3BWG A;  2GM4 A;  2K9N A;  1BI3 A;  2XKO A;  2ME6 A;  2YS9 A;  3BDD A;  5LD2 C;  2PN6 A;  3PQK A;  1R4N B;  2G0E A;  2RRE A;  2V9K A;  3J80 K;  3I71 A;  2FD5 A;  2NS0 A;  2NNY A;  4BJT A;  1K61 A;  2M45 A;  3RKW A;  3DWL E;  2FOK A;  1V5G A;  1E3O C;  4Y17 A;  4BU2 A;  2GQQ A;  1ULY A;  3PO2 J;  2DJN A;  1D1C A;  1QVU A;  2VKH A;  4V2G A;  2HZT A;  3C18 A;  4G12 A;  4YEJ A;  4DNC A;  4CZZ A;  3H1C A;  2G7U A;  2JTV A;  1X1B A;  1U2W A;  5LLQ A;  1ETX A;  3A03 A;  4C9Y A;  2R7S A;  3Q0U A;  4XOT A;  2ZNZ A;  3SFI A;  3SZG A;  1U8R A;  1H9T A;  1K4S A;  2EIK H;  2HKO A;  4YG2 F;  1SAN A;  3GYH X;  1AWC A;  2CFO A;  5DUI A;  2OCC H;  2OD5 A;  2HYG D;  4BXX J;  1FWZ A;  3MQ0 A;  1LDK B;  1R1U A;  1XX5 A;  3VDX A;  3JTH A;  4PZJ A;  2FE3 A;  1S8N A;  2XAJ A;  4MQ9 F;  4U7B A;  4JOM A;  3LSR A;  3AL0 B;  3IP4 B;  2BY0 A;  5FRM A;  4EM0 B;  5J1Y A;  4LLN A;  3ABU A;  4ANJ A;  2HVR A;  4UUS B;  3OYE A;  5E3L A;  3HSR A;  2WAE A;  3OYI A;  1KON A;  3D5R C;  3S1M J;  2MC3 A;  1O3S A;  4PDK A;  4EGZ A;  2OV7 A;  4QPQ A;  1IN7 A;  2H1K A;  2F5F A;  2M3A A;  2CU7 A;  5ILV A;  5DCM B;  1JHH A;  3WU1 B;  5IYD J;  1JT6 A;  9ANT A;  1R22 A;  3H0D A;  1OFC X;  1KA8 A;  4XR6 A;  2M4G A;  3WU0 A;  4ENJ A;  1GDT A;  3GTJ J;  1R36 A;  1Y8R B;  4I7H A;  2HZD A;  2A6H F;  2QLZ A;  4XN3 A;  3EET A;  4RGU A;  1FBU A;  1FNN A;  1R6R A;  3R6S A;  4G8X A;  3RQ4 A;  2JA7 J;  5EEG A;  4XLA A;  3TOA A;  3SEZ A;  5J8F A;  2V6E A;  3SXY A;  1E3P A;  2LRE A;  2EZL A;  1RC9 A;  1Z6T A;  1W7P B;  2ZBK A;  1VQP I;  5B1A H;  4S05 A;  1FEX A;  3CCL I;  1T08 B;  2DOF A;  3KP3 A;  3C7J A;  3I5U A;  1FJL A;  1YRN A;  5F0C A;  3A0B C;  5FFZ A;  4CYC B;  1BW5 A;  3OR2 C;  4A0Y A;  5FO5 A;  1BM9 A;  1TZL A;  2DA7 A;  5EDN A;  2B63 J;  2QEN A;  1D5V A;  2HKX A;  2E1C A;  2XSD C;  2DMP A;  2F5V A;  2WV0 A;  5J4Y A;  3KZZ A;  3O3K A;  2KPM A;  3F9K A;  1WQ2 A;  2O8K A;  1YQA A;  2K85 A;  3IAS 2;  3OYM A;  1TQP A;  3MKY B;  2IGM A;  2VIX A;  1ZK8 A;  1WJF A;  2CQN A;  4MEY F;  1IN5 A;  5LHH A;  4RB2 C;  4DYR A;  3B6A A;  2R7R A;  2DA5 A;  4LMY A;  4QPO A;  1NTC A;  3J81 K;  2V4J C;  2QQ9 A;  1S7E A;  2DW4 A;  1FTT A;  2ZME A;  3FMR A;  1Y8Q B;  3AG4 H;  3M1C A;  2A6E F;  1L3L A;  1UAA A;  4A5M A;  1IRZ A;  5GAD J;  3EYI A;  4II3 A;  1FP1 D;  3OYH A;  1J5Y A;  5IT3 A;  2NVQ J;  1SFK A;  4D1Q A;  4M72 A;  4X6A J;  1YS7 A;  3NRV A;  4F3Q A;  3CO6 C;  1JUS A;  3C2H A;  3F8N A;  4EVI A;  1EV7 A;  2WY8 Q;  3WGI A;  1DPR A;  2LOO A;  4FX0 A;  3QPS A;  2XPV A;  2CH0 A;  3IHU A;  3HRM A;  3PL8 A;  3ELK A;  5E1Z B;  2CG4 A;  1GXQ A;  1APL C;  1AKH B;  1IN6 A;  4A3J J;  2DA2 A;  1CQT A;  4A3L J;  5EJC A;  3JW4 A;  3L2R A;  3QOE A;  3S3O A;  1R4M B;  2NS8 A;  1KU7 A;  2EA2 A;  3G6E I;  2VQL A;  4HAM A;  3FX3 A;  2HXO A;  1XG1 A;  4H0E A;  5IY5 H;  3H0G J;  3MZY A;  1P6R A;  4OIN F;  2XRO A;  3H36 A;  3K4C A;  5IP9 J;  2FJ1 A;  4C2M J;  4KT5 C;  5HLG A;  3JRB A;  2BY2 A;  3RZD J;  1V54 H;  2LKX A;  2F4M B;  1J09 A;  5AON A;  1JJ8 C;  4UUT A;  4R8H A;  1XDS A;  4N4O B;  2IGO A;  4DOZ A;  1B72 A;  4XLC A;  2DFE A;  2EA4 A;  2VBY A;  5FKK A;  2FQ3 A;  4IRG A;  4W97 A;  2E60 A;  2RV8 A;  3K4J A;  1HXD A;  2QGU A;  2XAF A;  2QUF A;  2Q1Z B;  2R7V A;  2V9V A;  4QIW N;  1R9T J;  1WJ5 A;  4RDU A;  3TP3 A;  4FAS D;  3E5U A;  2M9H A;  2KFD A;  2WWY A;  2STT A;  1HQC A;  3HPH A;  2BOL A;  3HOS A;  1HBX G;  3QYE A;  4ESJ A;  2H8R A;  3L00 A;  5FRO A;  1W5T A;  3ZOB A;  3NQO A;  4E7S A;  4BHC A;  5K7H A;  4CCM A;  5HLH A;  3BG6 A;  1XSV A;  2JA2 A;  3BR2 A;  3LQR A;  2FNP A;  1F4K A;  1RKW A;  3L09 A;  4BY1 J;  4LIV A;  1F5T A;  2CW0 F;  4RB1 A;  1SVM A;  2JSP A;  5GAE J;  1A35 A;  3ABM H;  3JTG A;  5KAF C;  1Z3X A;  5HNH A;  2GA1 A;  4KIG A;  3L2C A;  3E6B A;  1U9O A;  1FSH A;  1CF7 A;  2PQ8 A;  2M7B A;  5HLT A;  1AU7 A;  3KE2 A;  3MWM A;  1SVL A;  1SAU A;  3DBR B;  1X19 A;  2EFN A;  4IVN A;  3CMM A;  3LFU A;  2K27 A;  3RKY A;  2Y0M A;  1TW2 A;  3K9T A;  4DIQ A;  1U5T A;  4H4K C;  3HHH A;  2ZFU A;  5CLS A;  4E7K A;  4ZJZ A;  4M71 A;  3CC2 I;  2JT1 A;  3HUG B;  4HQE A;  2HXI A;  1NG7 A;  1XGO A;  1VND A;  1WVR A;  1O3R A;  3WTW C;  2QKL B;  4Y52 J;  2W82 A;  3E5X A;  3S17 J;  3HZJ A;  2L5Q A;  3RZO J;  2OJE D;  1SD6 A;  3T0Y A;  4NC6 A;  2DOE A;  2I8D A;  3ZXS A;  4XOR A;  1YJN I;  2WY7 Q;  1SFE A;  5K1Y A;  2V1D A;  1B59 A;  2WTE A;  3ERM A;  1JTX A;  5LGU A;  1MJ9 A;  3WTY C;  1WZ2 A;  4MFE A;  2NOG A;  1IN4 A;  3OIQ A;  2WAD A;  3HYI A;  2OTJ I;  4IL6 C;  4GXO A;  2W84 A;  3FXU A;  1ZGW A;  1AA7 A;  5CVJ A;  4W1U A;  4DW6 A;  1DU0 A;  2R7U A;  5F1R A;  5HS8 A;  4BHP A;  2FNA A;  4JX5 A;  4MTD A;  3ZMS A;  4E70 A;  3S14 J;  4RLQ A;  5DYM A;  2ECB A;  1A6Q A;  1RZ4 A;  1BR4 A;  2M0M A;  5BMZ A;  2XAU A;  1MMD A;  1IDZ A;  3E0J B;  3SDG A;  3S8P A;  5D4R A;  1FMV A;  1Z67 A;  2XIG A;  3HOU J;  1HOM A;  2XAS A;  3KX2 A;  1GT0 C;  4RAZ A;  2PJR B;  4Y7N J;  3ZRG A;  1YIJ I;  5DDG A;  3HXL A;  3TKY A;  4JX4 A;  2LLK A;  3J80 Z;  4LJZ F;  1O3Q A;  5D8K B;  4KDP A;  4BYY A;  4ZDO A;  2R7F A;  4RBO A;  5HDN A;  4II2 A;  3O2P E;  3CDL A;  4PSX A;  4UUS A;  3CCE I;  1BR2 A;  1WH5 A;  3FM3 A;  3U1K A;  1TP4 A;  2OPT A;  1EKE A;  1UCR A;  3BJ6 A;  1I27 A;  5DCM A;  2EFW A;  2F6C A;  4OMZ A;  2K86 A;  1VQ6 I;  1LDJ A;  1X1A A;  3OOU A;  2AXT C;  1Z3Y A;  5F0F A;  2HU9 A;  5BPI A;  3PNY A;  1ITY A;  4MIM A;  2L4M A;  4JQF A;  3I64 A;  3U2R A;  3G1M A;  1W36 C;  2GIV A;  2EZH A;  5BS6 A;  2F5C A;  1LJ9 A;  1WFX A;  5FJ8 J;  3CME I;  4ZTF A;  1T0F C;  1Q1H A;  4MO7 A;  3CLQ A;  1IV6 A;  2V1N A;  2ELK A;  3LSG A;  4XL9 A;  2HVS A;  2D1V A;  2CV1 A;  1XGM A;  3RCO A;  1I5Z A;  3CUQ B;  2CUJ A;  1FYM A;  1DDN A;  1W7P A;  1RET A;  2UZK A;  1A6I A;  1BN5 A;  2HGC A;  1ZR2 A;  5AIQ A;  1C0W A;  2FSW A;  1X1C A;  2RVC A;  1TTY A;  3SZT A;  4AD9 A;  3N97 A;  4UY8 I;  1ZAO A;  4CYC A;  3KYL A;  1XGS A;  3IV5 A;  2GZW A;  3R0J A;  2P7C B;  4GCV A;  3ZCO A;  1H89 C;  4UHT A;  3A01 B;  4LD5 A;  4AC0 A;  1YW7 A;  1K6O A;  4KN4 X;  2LFB A;  2Q8K A;  4XON A;  3MAJ A;  2FBI A;  1BC7 C;  3TL4 X;  1QZY A;  1UHW A;  2QM3 A;  3P9C A;  1X3W B;  2JK3 A;  3W6K B;  4BQO A;  2K02 A;  4O5V A;  4KN7 X;  1ZYR F;  3BRO A;  3KFW X;  5C4J J;  3ABK H;  1Z7U A;  3CJR B;  3KP7 A;  3VYU B;  2GXA A;  1HSJ A;  3DPL C;  3DPU A;  1R5G A;  3C2G A;  2CFX A;  2BVL A;  2KP6 A;  3HEF A;  1FBQ A;  3REO A;  2E1M C;  2OTL I;  3FXR A;  4RGS A;  3HG9 A;  2X6W A;  3FDY A;  4A3K J;  3C2B A;  2VT2 A;  2DYR H;  4CO8 A;  1LUJ B;  4HNV A;  2C6Y A;  3G3Z A;  1AKH A;  4FX4 A;  4XID A;  3LL7 A;  1TWF J;  3M8E A;  3ZQL A;  3FHN A;  1I6X A;  5LRR A;  3BPV A;  5LRS A;  3EUA A;  1PYV A;  1OR7 A;  2TRT A;  2R7T A;  2PFB A;  3GME A;  2VE8 A;  5CKT A;  5ICC A;  3FXJ A;  3WGG A;  2H94 A;  1BI1 A;  4K2E A;  2F5D A;  4I98 B;  2XDV A;  4AIK A;  3VYT B;  5CPR B;  4M73 A;  2JRM A;  2HYF A;  1S72 I;  2MC4 A;  5FKN A;  4S04 A;  1V5E A;  3HIF A;  3K1N A;  3GFJ A;  3Q9V A;  3BR0 A;  3H35 A;  3IH4 A;  1IRG A;  3HSF A;  3KP6 A;  1VQL I;  4ZDP A;  2NS7 A;  4IKF A;  1ETQ A;  4RS8 A;  3BPX A;  3BR3 A;  1BC8 C;  3WE2 A;  4CXF A;  1ZG3 A;  1VTN C;  1J75 A;  5H2F C;  2R7W A;  1G2H A;  1HKT A;  4LIU A;  1BA5 A;  4FT8 A;  4Q4Z F;  2IXS A;  2EIN H;  3DQV C;  5CQG A;  4BHB A;  3M7G A;  1MGT A;  2A5W A;  4IHW A;  4L0Z B;  4V2F A;  4OIQ F;  4HRI A;  1OYW A;  2H09 A;  4KUM A;  4B43 A;  2PI0 A;  4B44 A;  4G6D A;  3V7R A;  4XSZ F;  2EIM H;  4AID A;  5D5U B;  3R61 A;  4LG3 A;  1ZG5 A;  2OF7 A;  2H1L A;  4ITV A;  1RUO A;  1TC3 C;  4HQM A;  1YYV A;  2MD5 A;  2XF6 A;  3BZK A;  4C2T A;  3GTL J;  3WTX C;  2X4H A;  3IKV A;  2DFI A;  2Z2S B;  2IAI A;  3BZC A;  3EUH C;  4KIB A;  4DBR A;  4R79 A;  1H0M A;  3G2B A;  4B8X A;  1U78 A;  2VJJ A;  2UWM A;  3PSF A;  5D8L B;  3CF2 A;  4DBQ A;  3BTC A;  3K10 A;  2QEX I;  2XPW A;  2HI3 A;  3DFG A;  3OL4 A;  2P8T A;  4RB3 C;  2JPC A;  5CQE A;  2BZT A;  3E3V A;  4CIC A;  4YFN F;  2EFO A;  2QA4 I;  5M5W J;  3S2H J;  3M07 A;  2STW A;  4NBQ A;  5BPD A;  1EF4 A;  5B1B H;  3BJA A;  2ZSH B;  2DJI A;  3HSE A;  4I76 A;  2ZO4 A;  2HS5 A;  2E1O A;  2LY2 A;  3ZQ7 A;  3HUG A;  4ON0 A;  1G3Y A;  4ETS A;  3Q0V A;  3ZMU A;  2DXI A;  2MAB A;  2ZSI B;  2L01 A;  3DXJ F;  5BNG A;  1T33 A;  4D0P A;  2NAZ A;  1IXR C;  1WH7 A;  3RSN A;  1W0T A;  2PJP A;  2D1H A;  2P5K A;  4D5C A;  1W1W E;  3G71 I;  2ZB9 A;  1I1G A;  3K6G A;  1P4X A;  2JJ7 A;  4XRS G;  3MZH A;  2E7X A;  2W24 A;  4UVA A;  1J9I A;  1UHS A;  3D0S A;  3DP7 A;  2Y48 A;  1HST A;  2CQ7 A;  2CUF A;  1KZH A;  1W5S A;  3TQN A;  2VI6 A;  3LQQ A;  4C3H J;  3BCA A;  4IOA F;  3S1Q J;  2KZG A;  2R3S A;  4OWR B;  3ZMZ A;  5J47 A;  4HW0 A;  2CGP A;  1YLF A;  2LTP A;  4F55 A;  3DKY A;  4CCL A;  5DEQ A;  4DZJ A;  1K6Y A;  4XRS A;  4IO9 F;  4EQQ A;  4G7H F;  2R7O A;  5EGO B;  2CWE A;  2W00 A;  1MMA A;  2F4I A;  3O6B B;  1RRJ A;  1OYI A;  2PG4 A;  2YPR A;  2LKP A;  3RYP A;  5F0H A;  2L9R A;  1VQ5 I;  1QU3 A;  1QZZ A;  2X1E A;  2TDX A;  1TWH J;  2PX9 A;  1LKX A;  1IRX A;  1DPU A;  1YJW I;  1GUU A;  5H20 A;  3G73 A;  3HB9 A;  3ESW B;  4BKX A;  1Z6R A;  4BBS J;  4F7Z A;  1J59 A;  2ZNY A;  2HPM A;  5J40 A;  3OS1 A;  2J5O A;  2KRC A;  3PNV A;  2PEX A;  5ILS A;  2K3F A;  1QPM A;  2PJR A;  4EM2 A;  5E3O A;  2WB1 N;  3AG1 H;  3E1S A;  5KAI C;  4IHS A;  2Z33 A;  2KLO A;  3RYR A;  1ZN2 A;  3TDZ C;  2OZU A;  1RR8 C;  4IHT A;  2LDU A;  1BIB A;  5ICE A;  4IEJ A;  4HST A;  5EF6 A;  1FLI A;  4HNU A;  1OLT A;  2UXN A;  4HNT A;  4UB8 C;  2MH2 A;  2R7Q A;  2R5Y B;  1D0Y A;  1Y1V J;  1X4O A;  3L2U A;  4MNU A;  3MEX A;  4GYG A;  4WXH A;  4BJ6 C;  2W7N A;  1MNM C;  4R1H A;  4EAT A;  4CZC A;  5LEJ A;  3JR9 A;  1IUY A;  3F8F A;  3QOP A;  4L5I A;  1XD7 A;  2KIQ A;  2NYX A;  4P96 A;  5GPA A;  2NVU B;  3K69 A;  3DTE A;  2D5V A;  4O6J A;  5IT9 Z;  4BQA A;  3NWT A;  1MBF A;  3H92 A;  2EBI A;  4CCJ A;  3I59 B;  3BOQ A;  1EJ9 A;  1XCV A;  1ZQ3 P;  3CUQ A;  2KT0 A;  5IOY A;  4FQG A;  2JA8 J;  1T95 A;  3M3Y J;  4PUS A;  1QNT A;  3L2V A;  2DDB A;  5J1R A;  1G4D A;  3JSO A;  1WPK A;  1YTY A;  5E3N A;  4D5F A;  4OAY A;  2ZME C;  3QU3 A;  3DBL B;  3BC8 A;  2I10 A;  3FXQ A;  2X9D A;  1TL8 A;  2O03 A;  1VF9 A;  2M87 A;  5DTD A;  3A01 A;  3OYA A;  3JRD A;  1ZHF A;  3HRU A;  4CCK A;  5GTI C;  3OY9 A;  4HDU A;  3VOD A;  2DCE A;  2M0C A;  4I01 A;  1MMS A;  3ZQF A;  4M3B A;  3TGN A;  2VL8 A;  4RB0 A;  3RPU D;  1PUE E;  1F1Z A;  3BJO A;  4P5O A;  4IJA A;  5ILU A;  1GV5 A;  5FD5 A;  3V8J A;  2D2W A;  3BTL A;  2E7W A;  4BBR J;  1BOA A;  4MTE A;  4UV8 A;  1I39 A;  1SD7 A;  5EZG A;  4ZZL A;  1MNE A;  4XK4 A;  2EQR A;  2YU9 J;  4M3F A;  3V7C A;  2EPF A;  2ZFW A;  2L02 A;  4LLL A;  2FQ4 A;  2ZXI A;  2YUS A;  2G9W A;  1DP3 A;  1EH6 A;  4DZP A;  2OAZ A;  3VOE A;  4P9F A;  3KCC A;  2AXL A;  1SMT A;  3F21 A;  1K4T A;  5FRN A;  5DD8 A;  2COM A;  3LWF A;  2QWW A;  5F6F A;  1S6L A;  3FIS A;  3LMM A;  1REP C;  3AKZ A;  3WTU C;  5LEK A;  3IWZ A;  5K7Z A;  2X6Y A;  4ZYD A;  2XSJ C;  2Y2Z A;  3G4S I;  1BJZ A;  5HNF A;  1FP2 A;  2EK5 A;  2M5W A;  2NVY J;  3E97 A;  5JLW A;  3TO7 A;  3CP8 A;  2LP0 A;  2A07 F;  2ETH A;  3IH2 A;  2AHQ A;  3DF8 A;  4L9N A;  4L18 B;  4BEH B;  2VJI A;  1OPC A;  4CCN A;  1VQ4 I;  3HGY A;  1EA3 A;  2W1O A;  3CO7 C;  3WTZ A;  2XAG A;  1WJD A;  5DM6 F;  1XS9 A;  4U0W A;  3OIO A;  4U87 A;  3HJE A;  2Y75 A;  4UVB A;  5J8C A;  3BG3 A;  3AG2 H;  1OCC H;  5GAH J;  2DMQ A;  4MEX F;  2OQG A;  5CJ9 A;  3MN2 A;  4ZH4 F;  2FF4 A;  2IP2 A;  2BHY A;  3K4K A;  4FE4 A;  3QPL A;  1YX3 A;  2XAQ A;  2CO5 A;  4C30 A;  3MFK A;  4IHX A;  3GFM A;  1FZP B;  2W85 A;  5DUK A;  1D8K A;  2MLK A;  4DYC A;  4A3G J;  2VB6 A;  2W57 A;  3VYR B;  4B1R A;  1QBJ A;  1IRF A;  1NG6 A;  2FUG 2;  4RMN A;  2QBY B;  1S29 A;  1ZR4 A;  2H6C A;  2L9N A;  5J3L A;  1ETK A;  1R7J A;  3JRF A;  3CQZ J;  3ZN0 A;  5LGN A;  2VBW A;  5IYB J;  2ESN A;  2Z99 A;  4KIS A;  2RGV A;  2XF5 A;  3ECO A;  5E17 F;  3KP5 A;  4X0G A;  3P9I A;  3ZN1 A;  2ME0 A;  4N4N B;  3DPT A;  4OOI A;  3PSI A;  1BIA A;  4UV9 A;  3TMO A;  2K5C A;  3GFL A;  2ZJQ F;  1SD4 A;  3F0C A;  3U1D A;  2BXZ A;  5CYV A;  4A6D A;  1FSE A;  1IXS B;  3QOD A;  2KL4 A;  1HA8 A;  2L7Z A;  2MBF A;  3LOC A;  4GYI A;  3W3C A;  4CYD A;  5E79 C;  2Z16 A;  2WV1 A;  3IWF A;  2BHZ A;  1ZGJ A;  2AO9 A;  1J7K A;  3GUD A;  3QP5 A;  2MLG A;  4F52 A;  1R23 A;  1BW6 A;  2E19 A;  1TT0 A;  4EM1 A;  5K5O A;  1JT0 A;  1RPW A;  3I58 A;  2VQG A;  1TLH B;  2W48 A;  2K9M A;  5IP6 A;  5EG0 B;  2JVG A;  2MH9 A;  3CJN A;  2P5L C;  1MMG A;  4XLH A;  3LAP A;  3IL2 A;  4AIH A;  2OCE A;  3TED A;  3ZPL A;  1ETV A;  3CC7 I;  3GLX A;  3S1R J;  3VSL A;  1MSF C;  3A2K A;  2Z5U A;  3OYB A;  3OYG A;  2AQE A;  2LR8 A;  2KIF A;  3RQI A;  3HGG A;  4HPQ A;  2H6B A;  4XLF A;  2RQP A;  3VFZ A;  5L3D A;  3FK6 A;  4G7O F;  3QQA A;  1JKR C;  3GXO A;  3VSK A;  1FOK A;  3HHG A;  1Z1D A;  1KQ8 A;  2YX4 A;  2A61 A;  4YIF A;  5EGO A;  4KMU X;  2WB1 A;  2FMY A;  3OMY A;  4ESB A;  1MD0 A;  3VYS B;  1VQM I;  2O6G E;  3WU2 C;  1TWG J;  2JZY A;  4CGZ A;  3JRH A;  1RKT A;  3S93 A;  1E0E A;  1R58 A;  2ZJP F;  3LSM A;  5JLX A;  2QSH X;  3LNQ A;  2R5Z B;  3ZP5 A;  1YIT I;  3QU6 A;  1MBG A;  4F93 B;  2LRD A;  4ZYG A;  2XUB A;  3IUO A;  2V7F A;  2BW3 B;  2FOW A;  5FFX A;  5LBQ A;  5FLX Z;  1HDP A;  3D5L A;  4FET A;  3SJM A;  2CMP A;  3GCM A;  5F1J A;  1VQK I;  3T5X A;  3I3L A;  2DLL A;  2ELH A;  4A12 A;  2DFH A;  1LNW A;  3S2D J;  4M3D A;  1MSE C;  1WRJ A;  1KU2 A;  2W25 A;  3FZV A;  4ENM A;  2DPU A;  2JUC A;  3QWL A;  1IAW A;  4LLG F;  2ZJ2 A;  1T56 A;  1TT5 B;  5H6R A;  2LNB A;  3HOX J;  2R5Y A;  4I0A A;  1HF0 A;  4J01 A;  1B6A A;  5HS9 A;  2KQR A;  4LB5 A;  3OYC A;  1B9M A;  2NOJ B;  3S32 A;  4AVP A;  4NUB A;  4IXA A;  2RN7 A;  3GWZ A;  4G9Y A;  1SMY F;  1XB4 A;  3HKZ N;  3OSF A;  1Y1W J;  2X0L A;  1U6G A;  1R71 A;  4ENN A;  2O5R A;  4EEF G;  3P9K A;  5LHI A;  1ON2 A;  3H3V K;  3EYY A;  4KFC A;  4DJA A;  2E1M B;  3S3M A;  5KCM A;  2VC1 A;  2ZJR F;  2GXG A;  2JA5 J;  2R7Z J;  3IH3 A;  3I59 A;  4I0B A;  5DD4 A;  1SFX A;  1YW8 A;  3NEU A;  4AYB N;  1IF1 A;  1UEL B;  3CJT B;  3A4C A;  3GO5 A;  2XB0 X;  1ZG1 A;  3NWS A;  3ZMT A;  4A6E A;  3WTS C;  1ZKG A;  3NAU A;  2RKH A;  3LA3 A;  1T6S A;  5D4S A;  1H8A C;  1MJB A;  1G3T A;  3PO3 J;  2Z9O A;  1I1S A;  2L2O A;  4E7L A;  1W5C C;  1YOV B;  3CLO A;  4RAG A;  5TRD A;  3KEO A;  3FKJ A;  5D6F A;  4C2U A;  5CVI A;  1I3Q J;  2UV1 A;  1J2X A;  1PJR A;  2HDW A;  3QP6 A;  2JA6 J;  4QLC U;  1YX5 A;  5L3C A;  1GV2 A;  2XGE A;  4Y4R A;  3LSP A;  4PGG A;  4XLE A;  3HRT A;  3SHF A;  3TW7 A;  4HF0 A;  2L7M P;  3OYF A;  4A93 J;  3ZMD A;  3DEW A;  2AS5 F;  3FM5 A;  2MA3 A;  3HOT A;  1LFP A;  1X1P A;  2QYO A;  4A3C J;  4NHJ A;  2XRN A;  2VOD A;  3V8K A;  3ERE D;  1F36 A;  1O57 A;  2R4G A;  1QHG A;  3K2A A;  3TDU C;  1P2F A;  2O8X A;  3L1P A;  1OCT C;  1YW9 A;  5HOD A;  4E7H A;  3N4M A;  2CQQ A;  2BV6 A;  2Q0O A;  1GVJ A;  4I02 A;  4PFP A;  1MKM A;  4M9Z A;  2ISZ A;  1JUP A;  5F08 A;  4JYK A;  2ZXH A;  4I6Z A;  3GTK J;  4GGG A;  1P4W A;  2LY9 A;  2P6S A;  4BAC A;  4A3I J;  4XKB A;  3H3U A;  1ODD A;  4E6K G;  3A1Y A;  4LB6 B;  3W2A A;  1HW1 A;  4BGD A;  4E7I A;  3RTR A;  1FOY A;  4HBL A;  4DYQ A;  4XSX F;  2ZXJ A;  4HZF A;  1O7F A;  2CW8 A;  1BI0 A;  2K9L A;  4Y33 A;  2LYC A;  1PUF B;  1SC7 A;  3U9G A;  3GEZ A;  2V9P A;  4XKW A;  4A3M J;  2O61 A;  3E6M A;  2DT7 B;  4GFB A;  1PVE A;  3KIO A;  1ETW A;  2KMU A;  2M8E A;  1ACI A;  3GFI A;  2ICW G;  2A3S A;  4BJ5 C;  3LSI A;  2L4A A;  4BEH A;  5F64 A;  2VC0 A;  3K7A J;  1D1B A;  2HNH A;  3Q0W A;  4FE7 A;  3EPZ A;  1VQ7 I;  4AIJ A;  3BG7 A;  2OU2 A;  2XGC A;  2ZC2 A;  4Q48 A;  2FRH A;  2GWR A;  3SQN A;  1K79 A;  3K4M A;  3DTK A;  1FX7 A;  3CCQ I;  1YFH A;  4CA0 A;  4F91 B;  3TP0 A;  2DAO A;  4B3X A;  1FY7 A;  3H5A A;  4I2O A;  3DBH B;  1F43 A;  2A68 F;  3AAF A;  2CSO A;  2CV0 A;  5IP7 J;  1MIJ A;  1G8X A;  2CQK A;  4P55 A;  1SAX A;  2X51 A;  4NQW B;  3F8C A;  2QBY A;  1AOY A;  1SVO A;  3CF5 F;  4F92 B;  2EWN A;  3EQL F;  2B0L A;  5FKO A;  5DS9 A;  2G7H A;  2CS3 A;  4M3G A;  1POG A;  1QGP A;  2KHM A;  2LK2 A;  1Z0X A;  4FHT A;  3K70 C;  2NNN A;  4U0V A;  1DGW Y;  3HDD A;  2EZK A;  1X58 A;  4G94 A;  3UNG C;  5ICG A;  2GA2 A;  1D3Y A;  2FU4 A;  2HQ5 A;  1ORK A;  2VKE A;  1VQ9 I;  3VWB A;  1HKQ A;  3CTA A;  2XAH A;  4TV7 A;  1ONV A;  2CQX A;  2BGC A;  4C3I J;  1MH3 A;  5B66 C;  3OOP A;  2HQR A;  1VFC A;  1K78 B;  1LQ1 A;  2DBB A;  1E2X A;  2VBX A;  2HOA A;  1TW3 A;  4M6V A;  4C3J J;  3FXM A;  3G1L A;  5B3S H;  4M74 A;  3CCY A;  5EG0 A;  4IQJ A;  3W2W A;  3J81 Z;  3GW2 A;  1FYK A;  3BT9 A;  2F2E A;  4BUP A;  4NB5 A;  3K2Z A;  3CMA I;  3QAH A;  2PMH A;  2R0Q C;  4S0H B;  3F8B A;  3HPG A;  3OYL A;  4YII A;  3E6D A;  1X4P A;  2Y9Y A;  3MKW B;  1BBY A;  1O7L A;  1WJB A;  5L3G A;  3CCR I;  1KU9 A;  2HQN A;  2LF7 A;  2YU3 A;  2FA5 A;  3M8F A;  3U21 A;  4KT6 A;  3AFH A;  3JRE A;  2P6T A;  2X1C A;  4J19 A;  3Q9S A;  4IX7 A;  3TW6 A;  2ID3 A;  1MBE A;  1UZC A;  3LFK A;  1MBK A;  1T0F A;  5IPA A;  3PIO F;  3CD6 I;  4O3M A;  1LFB A;  2IBD A;  5JHU A;  3M4O J;  3ZQH A;  1ZRF A;  1FOX A;  3GTM J;  2N8G A;  2R5Z A;  1R00 A;  2VQC A;  1W7P D;  1X2N A;  2BXY A;  3TO9 A;  4CHU A;  5J1U A;  1VQO I;  5JFR A;  1HW2 A;  2BW3 A;  2R7D A;  5KNL A;  2HDD A;  1SFU A;  1TWC J;  2KDZ A;  4Y13 A;  3RPQ A;  3GTG J;  2V6C A;  2EH3 A;  3GZN B;  3HKZ A;  3I9V 2;  1WSU A;  1GVD A;  2KRH A;  3FBN B;  2E35 A;  1U8B A;  1QQI A;  1JXS A;  2ZCW A;  3CDH A;  4UUV A;  3VEP A;  3ONQ A;  2LC2 A;  1OJL A;  1PDN C;  2PBI A;  1ZRD A;  2DMU A;  2RC4 A;  4B09 A;  4AYB A;  1HKS A;  2ELJ A;  2XB5 A;  1OKR A;  2E36 A;  2JWT A;  3BZ6 A;  2EIJ H;  4PJJ A;  1LEB A;  2VKD A;  5F04 A;  4FCY A;  4ASN A;  3E5Q A;  4N9H A;  3F3X A;  2HEO A;  3GTO J;  3BQY A;  4G6Q A;  5E18 F;  1WJC A;  1FMW A;  1G6N A;  2Y0S N;  4ZZD A;  5D6E A;  1LVA A;  1HC8 A;  1N75 A;  3K1M A;  1IN8 A;  1OCZ H;  4KIF A;  3T1B A;  5DV5 A;  3I53 A;  4G6T B;  1IGN A;  1MDM B;  3K4B A;  4UXN A;  5FD6 A;  1UB9 A;  1VQ8 I;  1BJA A;  5L3F A;  2DI3 A;  5C44 J;  2HFH A;  2GAU A;  2KKO A;  1MW7 A;  1XGN A;  2VQH A;  2KZV A;  3CP2 A;  4KIC A;  1NK2 P;  2EV5 A;  3FKI J;  2PMZ N;  4EJT A;  4XKV A;  2DOA A;  2RDP A;  4L5E A;  3F6V A;  1W4M A;  2BYV E;  3FK7 A;  4IHV A;  1T8I A;  3Q3S A;  4LIT A;  2DU9 A;  4KA4 A;  2VON A;  1MH4 A;  3ASN H;  4HYE A;  3BR6 A;  4AWX B;  3MKZ A;  3HOW J;  5D5W B;  1B9N A;  2A69 F;  1S9H A;  2I5U A;  3ASO H;  1IJW C;  2L9S A;  1JKO C;  1QRY A;  2F5E A;  4P9U A;  1VI0 A;  5E1W A;  2VJ4 A;  3FIW A;  2IS2 A;  3I4M J;  2JRT A;  1OYY A;  4MHG A;  2CRG A;  3H3Z A;  1JE8 A;  1DQU A;  3CMY A;  3I4N J;  1FIP A;  4BL0 B;  1NHA A;  2IVM A;  3BLY A;  3DLA A;  4HX7 A;  4E7Z A;  2KIU A;  1SD5 A;  1F9N A;  3ROU A;  2EV6 A;  1M1E B;  2IPQ X;  2CUE A;  1V3F A;  2E1N A;  2L54 A;  1IG7 A;  1EH8 A;  3G1O A;  4ZYH A;  2EFP A;  3OYN A;  2L7K A;  3FMQ A;  1JGS A;  2DA6 A;  2DMT A;  2Y69 H;  5H6Q A;  3IRQ A;  1LE8 B;  3KZY A;  1ERD A;  4IOC F;  4HG2 A;  3W2V A;  1B8I B;  4A3B J;  2OC6 A;  3GZ5 A;  4A3E J;  3EUH A;  2FX0 A;  3DKX A;  1PUF A;  2IRF G;  1R49 A;  2NVX J;  3GTP J;  1Z05 A;  4HA8 A;  4HLY A;  2JSC A;  3BR5 A;  4XOP A;  3Q5F A;  1E17 A;  2MW8 A;  1KYZ A;  2LSO A;  4XNF A;  1Y0U A;  1NK3 P;  4MLO A;  1P4A A;  5HVQ C;  2M7A A;  3CCV I;  2E34 A;  3CCM I;  2ZXW H;  1UJ8 A;  1Q1V A;  2VBZ A;  2WA0 A;  2GLO A;  3OSG A;  5D5V B;  1UST A;  2DN0 A;  2DK5 A;  2Q2E B;  2CW7 A;  2VPL A;  1X1D A;  1NH3 A;  4IF4 A;  1XSD A;  2Z3Y A;  5EYR A;  3CES A;  2B9S A;  1RNL A;  3KPH A;  3WTV C;  3K70 D;  1ZRE A;  1FIA A;  3L7W A;  5JVT A;  2QQA A;  5EEA A;  1K7A A;  3WHB A;  1A5J A;  2EV0 A;  1BI2 A;  1TQI A;  2ESH A;  1YHQ I;  1G3W A;  1FC3 A;  2L0K A;  1IV8 A;  3PNT A;  3R4K A;  3LAJ A;  3ZQC A;  5K5R A;  3HL2 A;  3MMY B;  3QRF F;  4NQW A;  2FEZ A;  1GHC A;  4EJO A;  3GX4 X;  2MGQ A;  1R5I D;  3FXK A;  4LGW A;  2HOE A;  1CGP A;  2NVT J;  1IXC A;  4BE0 A;  2K4J A;  2CJJ A;  3OL3 A;  1U3E M;  2VJ5 A;  4E4H A;  2X48 A;  5FKL A;  4PFO A;  1I50 J;  5J4V A;  1O3T A;  2ID6 A;  1DU6 A;  1TNT A;  1SFO J;  1A31 A;  2XGX A;  1N25 A;  3F72 A;  2DTR A;  3BG9 A;  3WOD F;  4RM3 A;  1T39 A;  1L0O C;  1K78 A;  3HTS B;  3EUK L;  3FXO A;  4LG0 B;  1KQ0 A;  1UMQ A;  4YRV A;  4IHY A;  5GP9 A;  3F8M A;  2ACJ A;  2W4S A;  1WWX A;  1LB2 A;  2P81 A;  4NDL A;  4GDF A;  1S5L C;  2OZ6 A;  1UHM A;  1OCO H;  4B3A A;  1Y6I A;  4Q5S F;  3SEQ A;  5E3M A;  3MZ8 A;  3J7Z I;  4EJU A;  4OAZ A;  1Z21 A;  1T2K A;  2JMW A;  4I99 C;  3V7S A;  3DU5 A;  3SYT A;  4XRF A;  3SFZ A;  2F4O B;  3H9J A;  3JCU C;  3JAM K;  4AVZ A;  1JKQ C;  4M6X A;  5GPC A;  4A3F J;  2QF7 A;  3RDI A;  4RLF A;  4PJL A;  2M34 A;  2M8G X;  4WX9 A;  3J7A Y;  2E2J J;  1HDD C;  2LBF B;  4A0X A;  4KIT B;  1XC5 A;  2QVO A;  2QZ8 A;  4MQV A;  3ZR8 X;  2HTJ A;  1H88 C;  4OU0 A;  1OIS A;  1G59 A;  3RKX A;  2M30 A;  5BQT A;  3H9Q A;  4LOC A;  2VUM J;  1U5T C;  2EIL H;  5C4X J;  4OIP F;  1IUF A;  2XKP A;  1JI8 A;  4XKC A;  3ZQG A;  2OBP A;  3PIP F;  1JTY A;  3HBL A;  1QVT A;  2K3P A;  3S16 J;  3S3N A;  4WK8 F;  1V55 H;  2VKV A;  4XBF A;  1A04 A;  3P5J A;  4CH7 A;  3QYB A;  2MYS A;  2OA4 A;  4RGX A;  1ENH A;  1P9Q C;  2VPR A;  3WG7 H;  4RAY A;  4JBA A;  2KDO A;  2J5P A;  5FGM A;  2O3F A;  2KIS A;  4NC7 A;  4IRI A;  4MGR A;  3LA7 A;  2Y0S A;  5M5X J;  4CCO A;  1YS6 A;  1WKM A;  2XF7 A;  3OYD A;  4OIR F;  5AIP A;  4YFK F;  1VQN I;  1STZ A;  3UR3 C;  3S2W A;  2O9L A;  4EV0 A;  2HWV A;  5JHF A;  3DCF A;  2JUG A;  5JI6 A;  2R92 J;  1ETO A;  2ADU A;  2QKM B;  1KYW A;  4Z6Y A;  5HS7 A;  4X1E A;  1WHU A;  4N9I A;  3FWE A;  3VB2 A;  1FPQ A;  2PMZ A;  2LH9 A;  4BDY A;  1V4R A;  3TOB A;  4HV5 A;  1BR1 A;  5J6X A;  3I54 A;  3QPH A;  3WE3 A;  1ZEL A;  3L2W A;  2K7L A;  5CVR A;  3C1D A;  1MDM A;  2RQQ A;  2DYS H;  2VXZ A;  3W6V A;  3I0T A;  1N78 A;  2GOM A;  1OMI A;  4XMY A;  3I55 I;  4CUG A;  4GO1 A;  2JQ7 A;  3R60 A;  4J00 A;  3FF5 A;  3HC7 A;  2K9S A;  2QSG X;  3S1N J;  1Y56 A;  1TBX A;  2IGK A;  5FLM J;  3AL0 C;  4P1W A;  4QSH A;  2IS1 A;  1YO5 C;  3FHZ A;  2NRA C;  5LGT A;  3KEQ A;  2QSF X;  1HW5 A;  3DKW A;  1IO2 A;  2X6X A;  3FXL A;  4ESF A;  1Z7L A;  3E6C C;  1XTA A;  3P7N A;  2LMD A;  3ABL H;  1PP7 U;  2EZI A;  2A6T A;  1KU3 A;  4KJZ A;  3ISP A;  4D9J A;  2DA3 A;  3IC7 A;  3LSH A;  4Q47 A;  1PP8 F;  3L9F A;  1Y0N A;  1WI3 A;  2DOD A;  1S7O A;  1FT9 A;  2B7E A;  4XLP F;  3OR1 C;  1A36 A;  5FLV A;  3JRC A;  4DGW B;  5FB2 A;  4HEA 2;  2WAQ N;  2L9V A;  3A0H C;  3KP4 A;  2DTZ A;  3A02 A;  3I56 I;  4JK1 X;  1BL0 A;  1Y39 A;  1MBH A;  1P7J A;  2IGN A;  3PUB A;  5ICF A;  1LE8 A;  1U0J A;  5A2Q K;  1QPI A;  2DFF A;  1IW7 F;  5LHG A;  3GZ6 A;  3MCZ A;  3WHC A;  4WXC A;  4XN0 A;  1SEU A;  1B8I A;  5L3B A;  3CCJ I;  3KYC B;  2LY1 A;  2JVH A;  5LFA A;  1S7A A;  4NC8 A;  1JKP C;  2VLA A;  2P5V A;  3PJR A;  4L9V A;  2LVS A;  3ZQQ A;  3RI4 A;  2IA2 A;  1OQY A;  1WJE A;  1D5Y A;  2Y31 A;  3M8J A;  2K9Q A;  4ZC3 A;  3WGH A;  4OIO F;  2HTS A;  4BH9 A;  2DQR A;  2O0Y A;  4L9T A;  5D5X B;  2L3D A;  2HDC A;  5F27 A;  3ZGK A;  4RM2 A;  1USS A;  2Q2E A;  1GLN A;  4CDG A;  4EGY A;  3H5R A;  1UFM A;  2DDA A;  1OCR H;  1YE9 A;  2HR3 A;  4D7N A;  2O7O A;  4PJM A;  1Z77 A;  3ZQI A;  3HOV J;  1S3J A;  3FBI B;  3OYJ A;  2E2I J;  3R0A A;  4PJ0 C;  3EDP A;  1RIO H;  2RNG A;  3KLO A;  1HLV A;  4PK4 A;  4M3E A;  5GAG J;  5E1X A;  4UNO A;  1XN7 A;  4XQF A;  1WJA A;  4ABZ A;  4HDV A;  4BQN A;  3GTQ J;  3TO6 A;  2R93 J;  2PLY A;  6PAX A;  5C3E J;  3ULQ B;  4XLN F;  1DUX C;  3LA2 A;  5K5Q A;  2PMU A;  3H5N A;  5IT9 K;  3BG5 A;  2QQ8 A;  1XCB A;  1OR7 C;  4A0Z A;  2XGD A;  2KJC A;  1G3S A;  2EB7 A;  4BE1 A;  1MJA A;  1H9G A;  5M3F J;  5KK1 A;  3JRG A;  1FTZ A;  2BEO A;  2FBH A;  1YIO A;  4WWC A;  1ZAR A;  5DM7 F;  3HRS A;  2P0W A;  2EJR A; 
#chains in the Genus database with same CATH homology
 1UJ8 A;  2BZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...