2MW8A

Solution structure of satb1 homeodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
NRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords DNA-binding protein SATB1
publication title Solution structure of SATB1 homeodomain
rcsb
source organism Homo sapiens
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2mw8A00
2FJ1A 1PUFB 3OIOA 1CQTA 1OJLA 2VPRA 3S2DJ 1FTTA 2AO9A 2E2HJ 2ID6A 1UHSA 1OCTC 2X6OA 5FKLA 1X2NA 5IYBJ 4A3CJ 5GPCA 3BR0A 2EZHA 3GTJJ 3JRAA 3BQYA 1W0TA 2AHQA 3PO2J 3B6CA 3H3VK 2LTPA 4CYCA 3DEWA 3GTPJ 4X6AJ 3CQZJ 3JRGA 2ID3A 1A6IA 2LK2A 2ME0A 1GV5A 3A03A 1MNMC 2NVQJ 3BT9A 3QPSA 2EQRA 1RESA 2OPTA 4A3MJ 1IG7A 4FISA 1AHDP 3GBGA 3TEDA 1JUMA 5M5WJ 5E3NA 3H0GJ 3C2BA 5EYRA 2DN0A 5EF6A 1HLVA 2HXOA 3WHCA 2M34A 2GLOA 4M3DA 4BKXA 2R5ZA 1JTXA 3UKGA 2HYJA 2E1OA 4DZPA 3I4MJ 2CRGA 4EEFG 4RDUA 1ETXA 4D5FA 2WV1A 5K7FA 4CYCB 4M3FA 4FCYA 2L7ZA 4A3FJ 1JKPC 9ANTA 3CDLA 2LVSA 1HCRA 3FK6A 2NOGA 4XIDA 4FE4A 4A3BJ 2CQQA 4M3GA 1F36A 2KDZA 2JA7J 1P7IA 4BY1J 1H88C 1ZK8A 5EG0A 2JA8J 2HI3A 2MG4A 3HKZN 3BTLA 3GTMJ 2JA6J 3MN2A 2EBIA 1MBHA 2FD5A 3IH4A 1ZQ3P 2LLKA 3S1MJ 2JN6A 4DYRA 5IOYA 2GM4A 1HF0A 1QRYA 1I6HJ 2O7OA 2TCTA 3WHBA 3QPLA 3OSGA 1GDTA 3ZQCA 2XGDA 1JUPA 1B8IA 1TC3C 4XRSA 1EF4A 4B4CA 3BG9A 2HOSA 5M3FJ 5IP9J 4Y52J 2LY9A 1LE8B 1UMQA 1UG2A 1O4XA 1P7JA 4BXXJ 2LR8A 2R5YA 1MH3A 2XGEA 1F43A 3RKQA 2CUFA 3ZQGA 5M3MJ 3ZQLA 1SANA 5K7HA 4QSHA 1WPKA 2Y2ZA 2ECBA 2HOAA 2DJNA 1GT0C 1AU7A 3GTLJ 4XRMA 1ETYA 1D5YA 4Y7NJ 5EGOA 2D5VA 1U9OA 1POGA 3L1PA 1ITYA 3LSRA 2DA7A 2WB1N 4A3EJ 5BNGA 1JJ8C 3A02A 1MBJA 4BBSJ 3S17J 3TW7A 1FJLA 4QIWN 1BW5A 2X9DA 5J3LA 2R5YB 1BW6A 3LSJA 1GUUA 4A93J 2NS8A 3QQAA 1RR7A 5C4JJ 1ETVA 2WAQN 3B6AA 5IYDJ 2EH3A 3I4NJ 3SDGA 3BG5A 3LNQA 1MBFA 1IDYA 2B63J 2JK3A 2MSYA 2XPWA 3BR5A 3CMYA 4XK4A 3Q0VA 1VFCA 2EZKA 3BR3A 3O8HA 3HGYA 2CJJA 2XB0X 2Y31A 4G12A 4C3IJ 4UUSA 1ZKGA 3TW6A 3HB9A 4MFDA 2TRTA 4A3DJ 3ZQHA 2I10A 4A3IJ 1TWAJ 1H8AC 2YU9J 3FKIJ 1Q1VA 5FLVA 2XPUA 1NK3P 2L7MP 3LOCA 1FIAA 3ZQIA 1BL0A 2M8GX 3JRIA 2DA3A 3JRFA 2ECCA 2XGCA 4L5EA 4AYBN 4X1EA 2Y9ZA 5DS9A 1ZR2A 3BTIA 1JJ6C 1GV2A 1HDDC 2R93J 1GVDA 3S2HJ 2ME6A 5GP9A 1JKOC 4A3KJ 3K7AJ 3S1QJ 4IHXA 5IOZA 5EEAA 1LFUP 2NVTJ 3TP0A 5FLMJ 2K40A 5E3MA 3G1OA 1ENHA 1QVTA 4V2GA 1JT6A 2ELKA 1OCPA 2N8GA 2YUSA 2YS9A 5IYCJ 3FIWA 1W0UA 2EZIA 1VI0A 4M6VA 2RAEA 1S7EA 1MBKA 3A01A 1VF9A 2PMZN 2LD5A 1YRNA 2R5ZB 4MFEA 1WCMJ 1IGNA 2VI6A 1WH7A 1APLC 3BQZA 4BY7J 2LKXA 1H89C 4M3BA 1JUSA 4ABZA 2VUMJ 2HOTA 5IP6A 5J1RA 4AC0A 4MIMA 3BG3A 3HEFA 1VNDA 5FKKA 5J1YA 2VKEA 1I3QJ 1MBGA 1IJWC 4A3GJ 2NVYJ 3K2AA 2XB5A 5FKOA 2DMPA 1NK2P 3ZQFA 5F04A 2E2JJ 5FKMA 4FE7A 4W97A 5EG0B 2NVXJ 3HGGA 2FX0A 2IBDA 2DA5A 4B1RA 3S15J 2Y0SN 1HOMA 3A01B 3S1RJ 1YRNB 5EZHA 5M5YJ 1X2MA 3JREA 1DU0A 1IDZA 1T56A 2FQ4A 1PUFA 1LFBA 5IP7J 1DU6A 1WGXA 5GPAA 3D1NI 2JMWA 1XS9A 3HBLA 4B3AA 1ZTRA 2NS7A 2Y9YA 1B8IB 4V2FA 2IEKA 1FEXA 2XSDC 3IH3A 5F1JA 4IEJA 2GBYA 2K9SA 3SFIA 1MBEA 3HOWJ 3G1MA 1Z0XA 4RBOA 2DA4A 2JWTA 2LP0A 1XG1A 2HXIA 1QVUA 5K7ZA 3SJMA 3F0CA 3TP3A 2Y30A 1K61A 2JA5J 2DMNA 3IH2A 3BTCA 4A3JJ 3BR6A 4FTHA 1U9NA 3FK7A 4HNVA 1MSEC 3HDDA 1Y1VJ 5EGOB 1JGGA 3M3YJ 1U8BA 1BJZA 3S1NJ 2K9QA 5EZGA 3GTQJ 1X58A 2W48A 3DCFA 4M3EA 2G0EA 1RKTA 2E2IJ 2VKVA 1IV6A 3HOUJ 1FIPA 4S0HB 5J1UA 2P81A 5FJ8J 2E19A 5EDNA 1ETOA 1I50J 3ZOBA 3JRHA 3IV5A 3BTJA 4D7NA 5C4XJ 1E3OC 5F0FA 1AKHA 3G1LA 4DZJA 1TWGJ 3Q0WA 4DYCA 2MW8A 4I76A 4C3HJ 2DA1A 5IPAA 2DMQA 4A3LJ 1SFOJ 3OSFA 2R92J 3JRBA 2CUEA 4JYKA 5F08A 4GFBA 4BBRJ 4IHWA 4AUXA 1U78A 1T33A 2COBA 4D7MA 3CCYA 4A69C 5C3EJ 1ZGWA 5E3OA 3MVPA 4JX5A 1NTCA 1TWCJ 4UUSB 3VPRA 5FKNA 1ETWA 3S14J 4C2MJ 3RZDJ 3HOVJ 3BR2A 2R0QC 3HM5A 4J19A 1JKRC 3S16J 2QCOA 3Q3SA 4UUTA 2M2EA 4DW6A 1QPIA 1ZR4A 2QF7A 4MLOA 1RKWA 5DTDA 2R7ZJ 3W6VA 5F0HA 2OF7A 3OOUA 1BA5A 1IRZA 1AKHB 4I6ZA 5F27A 5JLWA 3PO3J 1LE8A 4C3JJ 3HOZJ 2K9NA 2H8RA 1K83J 4DYQA 3JRDA 2IAIA 2O8KA 4IHVA 4JX4A 5M5XJ 3RQIA 5HODA 2CQXA 1IUFA 3NAUA 2XRLA 2H1KA 3LSPA 5F0CA 1B72A 1TWHJ 2L7FP 1IC8A 4MO7A 1FTZA 2X48A 3BR1A 4XICA 2EZLA 4D5CA 2XPVA 2DA6A 3RZOJ 3MKLA 1HDPA 2MGQA 2HDDA 2DA2A 5JLXA 2M9HA 5E3LA 3HOYJ 2HQ5A 2M0CA 1JKQC 1MSFC 1TWFJ 1JT0A 2DTZA 2JJ7A 4W1UA 2CU7A 1G2HA 5C44J 4IHYA 3NARA 3Q0UA 3GTKJ 1A5JA 1JTYA 3HOXJ 4QTRA 3GTGJ 4LOCA 2O9LA 4JP0A 3PM1A 1RETA 1MH4A 1WH5A 3LSGA 3O8GA 1B72B 1OFCX 3GTOJ 1Z77A 2L0KA 3M4OJ 1ETKA 1ETQA 2L9RA 3JRCA 3JR9A 4JX6A 2LFBA 3FISA 4XRSG 1Y1WJ 2KT0A 1R9TJ 3E7LA 1WI3A 1ORKA 1XC5A 2DMTA 1RPWA 2ZB9A 2DMUA 4NDLA
chains in the Genus database with same CATH superfamily
1ZRFA 2FJ1A 1PUFB 2DPUA 2IPQX 2VPRA 5HLIA 3S2DJ 1MNDA 1FTTA 3C2HA 2LRDA 2A3SA 2E2HJ 1D1BA 2D45A 3F8MA 1UHSA 2P7CB 1OCTC 3TO7A 2LY1A 4FT8A 1XSVA 5IYBJ 3CDHA 4A3CJ 1AA7A 2A68F 3B6CA 1LFPA 1U5TA 2EB7A 2JRTA 3DEWA 4XL9A 3ZQQA 3H3VK 4X6AJ 3HHHA 2XAFA 2VONA 3CQZJ 4MTEA 3NWTA 1A6IA 4GDFA 2ME0A 2F4IA 3F9KA 3IC7A 1YX3A 2ZJQF 4HAMA 2NVQJ 5ERIA 2WY8Q 2DXIA 1ERDA 2EQRA 2RQPA 2FNAA 2ZKZA 1IG7A 2X6WA 1AHDP 2VJJA 3TEDA 2EIMH 5JR3A 4ZYDA 2QQ8A 5EYRA 5HS8A 3VDXA 2HXOA 2DOAA 4HX8A 4BAYA 4UVAA 2GLOA 4YG2F 2R5ZA 4B8XA 4JK1X 4BL0B 2DBBA 2CRGA 2E5NA 3OYJA 3NQOA 2Q2EA 4M9XA 2IW5A 4IQJA 2BE5F 3QOPA 1ETXA 1DGWY 4PGHA 1MNEA 3MAJA 4D5FA 2WV1A 5K7FA 3IL2A 3SFZA 1U5TB 3LAPA 4D9JA 1K4SA 2L7ZA 2M8EA 5KAFC 2KRFA 4OWRB 1QNTA 1V55H 1TZLA 4BJTA 5DYMA 2Q8KA 2GQQA 1IUYA 4OOIA 3CCVI 1FBQA 2O5RA 1HQCA 2O3FA 5GADJ 4YRVA 2NNYA 4BY1J 2V1DA 1I1GA 2K3FA 2M30A 4DIQA 2CWEA 2WTEA 3MFKA 4KJZA 3X2QH 1OQYA 3GTMJ 4S05A 4XKBA 1MBHA 1SFKA 3I71A 3KCCA 2L2OA 4ESJA 2LLKA 3COAC 2UV1A 2X6XA 5JFRA 1WWXA 3T1BA 2CO5A 1QRYA 2MFZA 3DBRB 2MH2A 3L7WA 1F4KA 4HYEA 2IS1A 5B5EC 1ZLJA 3OY9A 1JUPA 2X1CA 1TC3C 3ABMH 2H1LA 4EQQA 4B4CA 4Z6YA 1RUNA 2DQLA 2FSWA 3DTIA 3V8LA 1L3LA 2HQRA 3ERMA 4R79A 2AQFA 2TDXA 3TMOA 4UV8A 5IP9J 2W82A 2L3DA 1V5EA 1LE8B 3WU1B 5BPIA 1O4XA 3BZ6A 2DK8A 3ZP5A 4XLPF 2CUFA 3MKZA 1SANA 5K7HA 4CSWA 3LA3A 3T8TA 3HOTA 3HIFA 2DT6A 4BUPA 1YFHA 3KIOA 1ZG1A 2HOAA 1O3QA 4HEA2 2J5PA 3GTLJ 4XN3A 2BHZA 2D5VA 2P5LC 1U9OA 4Y13A 4B47A 3J80Z 2QQ9A 5BNGA 2ESHA 3A02A 3ASNH 2ZFUA 1ZLKA 3DPTA 2I5UA 2PX9A 4BNCA 4BBSJ 5F6FA 2VT3A 3M8JA 2PMUA 1SVOA 1BI2A 4Y15A 1WRJA 2L4MA 3AG2H 3D5SC 4U88A 4ZZLA 1U6GA 3PIOF 3JTHA 3PSIA 3CF2A 2XV4S 1BW5A 2X9DA 3DV8A 5DV5A 2Y69H 3RCOA 4F7ZA 3JAMZ 4XORA 6PAXA 4A93J 3OYMA 2KJCA 2HPIA 2Y0SA 3LSTA 4IVNA 3SHFA 3O2PE 2WAQN 3B6AA 3DWLE 2CQ7A 2EH3A 3TGNA 4EJWA 1MBFA 4HOBA 4U0VA 1PDNC 5LEJA 3BR5A 1TT5B 3CMYA 3QPHA 3HGYA 2CJJA 1A31A 1OR7A 2XB0X 3H5NA 4QWQA 4KMUX 2R7OA 4UUSA 4HLXA 3HB9A 4IRIA 3C1DA 2VT2A 2YU9J 1LDDA 2BGCA 3H9QA 1Q1VA 3OWTA 2F4MB 2XPUA 3MZ8A 1NK3P 5LGUA 1E3HA 2IA2A 1D8JA 4L5EA 4M6XA 2CH0A 2RC4A 1D1CA 1P6RA 2M3AA 1O7FA 2NRAC 4J01A 4HLYA 2E34A 2H6BA 3ESWB 2R4GA 1BIAA 2ME6A 2DOEA 5GP9A 3WTUC 4UB8C 3GVAA 2CFOA 2QGUA 1TQIA 4DNCA 5IOZA 5EEAA 1LFUP 2GXAA 2NVTJ 2PMHA 4JOMA 5JVTA 2CMPA 4NUBA 5E3MA 4AIDA 4HNTA 1FWZA 1JT6A 2ZNZA 3MD2A 3ZQ7A 2ELKA 2YUSA 1MGTA 3FIWA 4A6EA 3CP2A 4M6VA 4X0GA 3K70C 4KNYA 1UJ8A 1D0XA 1MBKA 3FXLA 1OR7C 1MMNA 3DFGA 3G73A 1VF9A 3KEYA 1WCMJ 2L5QA 1DPUA 4XONA 4F92B 4H0EA 2V79A 3H5AA 2VUMJ 4AC0A 2LH9A 4G9YA 4MIMA 1VNDA 5FKKA 1R6RA 3L2CA 2ESNA 1I3QJ 5BMZA 4BYYA 4A3GJ 1FX7A 1R58A 3K2AA 2KMUA 3MKYB 3KYCB 2F5EA 3FMSA 2DT7B 5FKMA 1FBSA 1K4TA 3GUDA 4Q4ZF 4RGUA 3AG1H 4W97A 2PMZA 3G4SI 4IOAF 3GX4X 1XPXA 3KLOA 1HW1A 3KYDB 4IKFA 4ZDOA 1HOMA 3S1RJ 2M7BA 2OCCH 2PJPA 3JREA 4NQWB 2PJRB 3W6KB 1SEUA 1R71A 3HBLA 5TGTA 1ZTRA 3E5XA 4XN0A 3BPVA 1KU3A 4KN4X 5CVVA 1TTYA 1B9NA 5E18F 4IEJA 2BHYA 3K10A 2BW3B 2BVMA 4RBOA 3KPHA 2LP0A 1XSDA 1W5CC 1QVUA 3FXQA 4A6DA 5K7ZA 3TP3A 1YW7A 1KZHA 2DK5A 2WAFA 4KIBA 2V7FA 3ZN0A 3N4MA 3BR6A 1Y6IA 2PI0A 1U9NA 4HNVA 1Z7UA 2E36A 4BH9A 4HDUA 4JQFA 5IT3A 3S93A 1JGGA 5HOOA 4BQAA 2EV6A 4KISA 2VJ5A 1TL8A 5DCMA 3QYEA 1XB4A 4M3EA 2G0EA 2MC3A 5K1YA 1V4RA 1K78A 2E2IJ 1OLTA 1WZ2A 4EJUA 1FIPA 3QAHA 1YG2A 5J1UA 2M1BA 4S0HB 1XDUA 4BXUA 2PFBA 4U7BA 4QPQA 5ILSA 3MEXA 2ZSHB 1I50J 3ZOBA 2ZSIB 3CC4I 4KICA 4D7NA 2QM3A 3MZHA 5DUIA 2AQEA 2VBXA 3K4JA 2NVUB 1XSXA 3E6CC 5FLXK 4DZJA 1TWGJ 4DYCA 2MW8A 4I76A 1VTNC 1JI8A 3M1EA 2KIQA 1VQKI 1WI9A 4JYKA 4GFBA 3KP7A 4G94A 2WY7Q 1LNWA 2YU3A 2MYSA 2R7VA 3EETA 1SD6A 5EJCA 2MD0A 1RR8C 1FZPB 2BY1A 1X3WB 2FMLA 3AL0C 1NTCA 1TWCJ 3VPRA 5DCMB 5FKNA 1ETWA 1MMSA 2OZ6A 1K78B 4HV6A 5H2FC 1PP8F 4ZDLA 4YIRX 2IGMA 3HOVJ 2VBZA 3BR2A 4RM2A 3CLQA 3Q3SA 4L18B 4R8HA 1ZR4A 2GXGA 3DF8A 1BM9A 4MLOA 1RKWA 4M74A 4P9FA 3U1KA 3W6VA 2JPCA 2OF7A 3OOUA 1ACIA 4K2EA 2Z99A 3T8RA 1WJDA 4P96A 3PO3J 2OQGA 4HZFA 4C3JJ 1K83J 4UUVA 3P9CA 2OBPA 2IAIA 3ZMUA 4H4KC 5M5XJ 3E5QA 1K6OA 2CQXA 3K4NA 3I3LA 2H1KA 4O6JA 2WAEA 5ICFA 5F0CA 5L3CA 1J75A 4UVBA 3F8FA 1G4DA 2X51A 1R7JA 5DD8A 3W3CA 1P4AA 3IRQA 2GOXB 4MO7A 1IC8A 5KCMA 2X48A 2LF7A 4IHSA 3ZN1A 3IWFA 1Y56A 2IJLA 4HX7A 1FYLA 2F5FA 3GWZA 3V7CA 1SD7A 4JBAA 3EYIA 3D0SA 1YIOA 3CCLI 2Z33A 4G6TB 4KIFA 5D8KB 1RIOH 5LRRA 3FXOA 2NNNA 1MD0A 1MSFC 4C2TA 4U0WA 4ZTFA 1SFXA 2BV6A 2HFHA 2CU7A 1G2HA 1T38A 1ZH5A 3ZCOA 4GYGA 3HOXJ 4QTRA 2DFEA 4LK0F 3ZRGA 4PJMA 1O3SA 4WWCA 4NB5A 1RETA 2G9WA 1B9MA 3FBNB 4RB2C 4MHGA 2P6SA 5FRNA 4C30A 1HKSA 1YLFA 4IRGA 2L9RA 5ICCA 3OYBA 3JRCA 3ZMTA 4JX6A 2LFBA 4XRSG 2IS2A 1MJ9A 4CXFA 4XKCA 4CZZA 1R9TJ 2CGPA 1KYWA 4RAGA 2IS4A 2RGVA 3GYHX 2UUZA 2HQNA 3GF2A 1W36C 2W4SA 3GZNB 4XBFA 4I01A 1T6SA 3ASOH 3GEZA 1CQTA 1OJLA 2F6CA 1HSJA 2AO9A 1IRFA 3ABKH 3TKYA 3A0BC 3LL7A 1YJNI 4E7IA 2FEZA 3F6VA 3CJQB 1OISA 5GPCA 3BR0A 1X3UA 2L01A 3BQYA 4ZZDA 1MW7A 3PJRA 4CYCA 1DPRA 2L4AA 4ON0A 3RKXA 4ZC3A 4OIPF 3JRGA 2LK2A 3CJTB 4FASD 3A03A 1EJ9A 1YW8A 2L54A 1T95A 3FXUA 1HC8A 3BT9A 1A6QA 4M73A 1YX5A 2LYCA 4ZDPA 4A3MJ 1YJ9I 2QSHX 1FOWA 3IAS2 4BGDA 1QZYA 5E3NA 2IGKA 3C2BA 2IP2A 1L0OC 3H36A 3UNGC 1TBXA 3F8CA 1Y8RB 3PQKA 5LHGA 4KDPA 2LDUA 2VLAA 1W7PA 2G7UA 2WAQA 3M8EA 3UKGA 4ITVA 2HYJA 4IRHA 3BY6A 1SMYF 5TJJA 1XGOA 2FNPA 3R4KA 2ZFWA 4EEFG 4LK1F 4RDUA 1E3PA 2DFHA 3QYFA 4CYDA 1NG6A 1U8RA 4CYCB 3CUQA 1GXQA 1XCBA 3OS1A 4XKVA 2QYOA 3L2RA 1AWCA 2V6CA 1HCRA 2KDOA 2ISZA 3PNTA 2JPBA 2NOGA 4XIDA 1WQ2A 4WF2A 5D4RA 1J2XA 3E3VA 1P7IA 3ECOA 3C2GA 5EG0A 2JA8J 4YFXF 2LOOA 2GOMA 2HI3A 3UR3C 2MG4A 2EFWA 4KMFA 3NWSA 1REPC 4CCLA 3TDUC 3MN2A 3K9TA 3LA2A 1QGPA 3F3XA 3R6SA 1X3ZB 2CFXA 1HF0A 1ZRDA 4N4NB 5GTHC 1R36A 2VIXA 2VPLA 2P5KA 4E70A 5AIPA 3ZQCA 2XGDA 1WJBA 4E6KG 2FOWA 3R0JA 5M3FJ 2ZJ2A 2H09A 3ZGKA 1UFMA 3CCEI 4NBQA 2L02A 3K4KA 2XGEA 1F43A 3RKQA 3DBHB 3ZQGA 5M3MJ 3CUQC 3FF5A 5K5RA 5DM6F 1ZAOA 2VKDA 1R1TA 2FF4A 3U21A 2Y2ZA 2ECBA 2DJNA 2YPRA 1ETYA 5ICEA 4GYIA 1ZG3A 4XRMA 2KRCA 5EGOA 1BIBA 3FMQA 1R1VA 2DT5A 4OINF 2EFOA 1POGA 3L1PA 5KNLA 2MLGA 2DA7A 2WB1N 4PJJA 4G8XA 1LPQA 4E7LA 4WXDA 4A0XA 1TW2A 3F8BA 2XKPA 2VL8A 3HTUA 3TW7A 1FJLA 4QIWN 3G3ZA 4Y33A 4YFKF 3HTSB 4KITB 1R1UA 4DQ2A 2VOPA 3MZYA 4IJAA 3GZ5A 2E1NA 4E7JA 1T08B 3LSJA 5LHHA 1GUUA 2PQ8A 1R5ID 3TQNA 5C4JJ 3J7AO 4V19K 3K0LA 3KX2A 1P2FA 3SDGA 2HYFA 1I27A 1SVLA 1MMDA 1H0MA 1IDYA 5B1AH 2B63J 2XPWA 2PG4A 1F1ZA 4BE1A 5HDGA 2ZXWH 2FU4A 2C6YA 3BR3A 3WTXC 3H9JA 5E1XA 3P7NA 5LBQA 3HPGA 4UB6C 4G12A 4EJTA 4C3IJ 3WE3A 3H92A 3S3NA 1FLIA 4E7HA 4Q48A 2RV8A 4A3DJ 1U0JA 3OYNA 5FLVA 1JGSA 3ISPA 3ZMSA 2L7MP 5L3FA 1FIAA 2QENA 2P0WA 1FOXA 4HSRA 3DPLC 3JRFA 3E6BA 2ECCA 2XGCA 2Y9ZA 4X1EA 3MQ0A 2V9KA 4EM1A 5E8IA 1HA8A 1V5GA 2R93J 5CKTA 4M9ZA 1PYVA 1BOAA 1YI2I 3CF5F 3S2HJ 1XCVA 1DP7P 1BN5A 1QO0D 1JKOC 4A3KJ 3K7AJ 1U2WA 2EIKH 2QUFA 3EYYA 5FLMJ 2K40A 3RSNA 1GXPA 3V4GA 3G1OA 1QVTA 4C2UA 2DYRH 4V2GA 1FSHA 3G6EI 2N8GA 3FX3A 4KIGA 5D4SA 1R00A 2OUMA 3I4PA 3GFMA 1VI0A 1QPMA 4RLFA 4FETA 2BXZA 5FD6A 3IRRA 1KU2A 2R5ZB 1K7AA 1IGNA 2B9SA 3PQJA 1XN7A 2M45A 2J5OA 3CLOA 4CICA 2Q2EB 3DXJF 3LAJA 1LDJA 1H89C 3SZPA 1JUSA 2Q0OA 4ABZA 4E7ZA 2DTRA 4PZJA 1JXSA 3BG3A 3EDPA 4D1QA 1IJWC 2W24A 2VOOA 4OAYA 3CMAI 3VYTB 2V9VA 2DMPA 3HSFA 3ZQFA 2VQGA 2X85A 4PJLA 5F04A 3WG7H 3E5UA 2NYXA 3QYBA 3U2RA 1H9TA 4LIVA 5JHFA 3HJEA 2CS3A 3HGGA 4KT5C 1IXRC 3I54A 5CLSA 1ULYA 2EFPA 1UAAA 3HSRA 3S15J 1FP2A 5CVJA 5EZHA 5M5YJ 1XGNA 3PNVA 2ZMEC 1DU0A 3S8PA 1W5TA 2ZO4A 3CD6I 2OV7A 3VB2A 3K70D 4PFOA 4OIRF 3MKWB 1DP3A 1BI3A 3IWZA 2JVGA 3VYSB 2NS7A 2Y9YA 4V2FA 3K4BA 2XAHA 5HLHA 4N0BA 2XSDC 3G71I 2QBYA 1UELB 2Z16A 1R49A 2M87A 4U7DA 3SJMA 4A12A 3HUGA 3I59A 3HXLA 3CMEI 2JA5J 3BG7A 2B0LA 3JTGA 5LGTA 4FTHA 4AWXB 5CVUA 3HDDA 4P9UA 5L3DA 4L5JA 1SAXA 4NHJA 1Z6TA 3AAFA 3ZPLA 1BJZA 3R0AA 4EV0A 2CW7A 4XR6A 3S1NJ 2BYVE 2K9QA 1VQ5I 5EZGA 3GTQJ 1H9GA 3DCFA 1S5LC 1X58A 1R4MB 1Z9CA 1ON2A 1BC8C 3N05A 2QBYB 3F23A 3KP4A 4NC7A 2HGCA 5FJ8J 3CCJI 2MD5A 1EH6A 1ETOA 2BY2A 2F4OB 2K5CA 3CUOA 1QHHD 1OYWA 1EV7A 5DDGA 1P4WA 3ZMVA 3PNYA 3D5RC 1EKEA 2IRFG 1LDKB 2FBHA 1AKHA 1IAWA 1DQUA 3I59B 3Q0WA 3I56I 1RI7A 2OQRA 2DMQA 3OSFA 2R92J 2X1DA 3JRBA 2CUEA 3ZR8X 1WSUA 2W85A 4CCNA 2XGXA 4L0ZB 2COBA 4L9TA 1VQ4I 2EPFA 1DGRM 4J00A 1UB9A 2VQHA 4JX5A 1QU3A 4UUSB 2KPMA 1I3AA 3BJAA 2O6GE 1YW9A 3CCSI 2HZTA 2AS5F 3A0HC 3KZZA 4C2MJ 3RZDJ 5EEGA 1SC7A 5J8FA 1S7OA 1Z67A 1WJAA 5CPRB 1FOKA 2AXLA 5J4VA 2R0QC 1JKRC 2HYGD 1R23A 2KFDA 4XKWA 4DW6A 4UUTA 2M2EA 2GIVA 3C7JA 3PL8A 4RLQA 2QF7A 2R7ZJ 3E6DA 4LD5A 2WADA 1AKHB 3CC2I 2BEOA 2FBIA 2HKOA 1Z21A 2HS5A 1J9IA 1G8XA 3CJNA 3O6BB 3I0TA 1G3WA 2OTLI 2JZYA 3WTZA 1QQIA 1I39A 2QEXI 3RQIA 5HODA 4CCMA 3GLXA 2XRLA 4MEXF 1TNTA 5HNFA 2ELHA 5DM7F 4GGGA 4EMSA 3LFUA 1LUJB 2D1HA 3K2ZA 1OPCA 2JSPA 4GO1A 2L7FP 2K27A 4LITA 5FB2A 2X1EA 2IVMA 4D0PA 2Z2SB 1N77A 1OYYA 3A2KA 2XPVA 2DA6A 1N78A 4AIJA 5ILVA 3RZOJ 4B48A 2MGQA 3LWFA 2HDDA 1HSTA 2QKLB 2CV0A 3RKYA 3HOYJ 2K4BA 2GAUA 3QP5A 4HA8A 4CO8A 1G59A 3W2WA 2HOEA 1JT0A 2X0LA 2JJ7A 2FMYA 5HLTA 1M1EB 3NARA 3Q0UA 3H3ZA 1OCCH 2M5WA 1VQ8I 2O9LA 4JP0A 5HVQC 5LHIA 3IHUA 3PM1A 1VQPI 4EM2A 2ICWG 1ZREA 2DPDA 1OFCX 1STZA 1IRGA 1F9NA 5D5WB 4N9HA 4BEHA 4IHTA 1FMWA 4DBQA 4BQNA 5F1RA 2VODA 1Y1WJ 1V54H 3E7LA 1WI3A 4B43A 4KA4A 2ZC2A 3CZ6A 1RPWA 2OJED 3OMYA 4ENNA 1T98A 4LG0A 3BLYA 4RB1A 3OV8A 3ZMDA 3GW2A 1D8KA 3OIOA 3VOEA 3H3UA 1MDMA 4CDGA 3FXJA 4BDYA 2QQBA 3TL4X 2FXAA 2ID6A 4ENKA 3TDZC 4LMYA 1MKMA 4UNOA 3KZYA 2X6OA 2E35A 2QZ8A 1X2NA 3EUAA 4DOZA 2L9VA 1WJEA 2DODA 2EZHA 4LB5A 4I09A 3GTJJ 1XD7A 2F2EA 3RKWA 1N25A 4IQ4A 4L0YB 2ZCWA 2LTPA 3OIPA 2WB1A 2HEOA 3GTPJ 2EK5A 3V8KA 1SFEA 3W6JB 2UWMA 4BQOA 3ABTA 1P9QC 4P1WA 5LEKA 2DYSH 2W00A 4BEHB 1MNMC 4B3XA 2VJ4A 2LSOA 3AL0B 2CUZA 2R7FA 3QPSA 2KZGA 1TQPA 2O03A 4RAZA 4DBRA 5DD4A 5K5QA 4FISA 1R5GA 5E79C 4LG0B 3BZKA 5M5WJ 3WGIA 3H0GJ 1P92A 1I1SA 1HLVA 3EPZA 1SD4A 4I02A 2DFIA 3IAM2 1MDMB 2M34A 3HRUA 1X1BA 4BKXA 2OAZA 1NG7A 3CCQI 3GFLA 5H6QA 3RJPA 1W36D 2E1OA 2QSGX 3I4MJ 2VJIA 2OA4A 3S3OA 2ZXJA 4AM3A 2IS6A 3KYLA 4BJ5C 3KE2A 1WVRA 2JQ7A 1QA6A 3KEQA 3HPHA 4A3FJ 2W7NA 9ANTA 5GTIC 4I99C 1QHGA 3CDLA 2H94A 2P6TA 3FK6A 2E7XA 3L2VA 4FE4A 2W25A 5D5XB 1TT0A 2JRMA 3OYIA 1ZELA 2KDZA 4LG3A 1ZK8A 2XDVA 1QZEA 4A0ZA 3S32A 4O5VA 3KP3A 2DFFA 2EBIA 2FD5A 3OYEA 2XAJA 5H6RA 1YO5C 3V8JA 1IW7F 3OR2C 3S1MJ 2KHMA 4PSXA 3Q9VA 5IOYA 3OR1C 3DU5A 4XM3A 5JHUA 2L7KA 2O7OA 3KP2A 1OCRH 1LJ9A 3QPLA 3WHBA 3F72A 3OSGA 1GDTA 3VODA 3HSEA 5FFXA 4E4HA 1RRJA 4YEJA 5FGMA 4MTDA 3F8NA 4XRSA 3QRFF 1B8IA 3CC7I 2XAQA 3QU3A 2K4JA 3BG9A 2HOSA 1E17A 4C9YA 4Y52J 4B44A 1YTYA 3BCAA 2R7WA 1UG2A 4MQ9F 3OYCA 4U87A 4KYWA 4BXXJ 2R7RA 2OTJI 2JSCA 4Q47A 2KL4A 4ETSA 5IY5H 4HQEA 3DEUA 4F93B 3HHGA 2DW4A 4HPQA 4AVPA 4DGWB 4EATA 3LSKA 1C0WA 3PSFA 3FXKA 1WPKA 1GT0C 4FX4A 2STWA 1AU7A 3L2UA 3F21A 2ZJPF 1D5YA 3PUBA 2CYYA 4Y7NJ 2OZUA 1A35A 4GXOA 3CDIA 2ADUA 2L9SA 3I64A 1NHAA 2OD5A 2QLZA 4ENMA 1WFXA 5L3BA 5E1WA 3CO7C 1UHWA 4IXAA 1JJ8C 2VB6A 3PFYA 3SDBA 1B1BA 1TQMA 4YIFA 3I58A 1WJ5A 3AG3H 4KN7X 4M72A 5J6XA 2XUBA 2VE9A 5J3LA 3VEPA 2E71A 1W7PD 4XQFA 2I8DA 4IPAA 1T8IA 4YELA 4ZTJA 2H27A 5FD5A 1GVJA 1WJFA 4MNUA 1WHUA 1KQ9A 2EA2A 1RR7A 3QQAA 1ETVA 1SD5A 3SQNA 2CSOA 3I4NJ 1S3JA 3EUHC 1V5FA 3JSPA 2MBFA 3H9GA 5FFZA 1BR2A 1YE9A 2BY0A 2BY3A 2H6CA 2A6TA 3Q0VA 3M07A 4ASNA 2ZBKA 1VFCA 1O3RA 2V6EA 3O8HA 3F6OA 3I9V2 2A07F 4II2A 2HKXA 3OYAA 1ZKGA 3RDIA 3TW6A 4MFDA 4XLFA 5HNHA 2W1OA 1VQ7I 2STTA 2I10A 1H8AC 1TWAJ 4CH7A 2MABA 3FKIJ 1QZZA 1IN8A 3HG9A 3KP5A 3M7GA 1HBXG 2CV2A 4ZYAA 1ZG5A 3ZQIA 3LOCA 3P5JA 2B7EA 3JRIA 2V1UA 2JTVA 5CVIA 4AYBN 3BZCA 3A1YA 5DS9A 2X6YA 3DLAA 1JJ6C 1HDDC 4CGZA 3DKXA 2DI3A 1GHCA 2O61A 3TOAA 1A36A 4M9SA 1IRXA 1RZ4A 3MCZA 3LQQA 1ZGJA 3HRTA 2F48A 3U1DA 3HZJA 1T2KA 2HQAA 3PIPF 3OYHA 4IHXA 2XVCA 2XF6A 5KAIC 3ZMZA 1ODDA 4BHPA 4Y17A 1OCOH 2RNGA 5GAEJ 1CF7A 2BVLA 1FNNA 2LC2A 5IYCJ 1X4PA 5F64A 2EZIA 5CJ9A 2E7WA 2RAEA 1S7EA 3WU2C 3AKZA 1Y8QB 2DAOA 1LVKA 2XSJC 1I6XA 4XLEA 3TO9A 2PMZN 4HG2A 1W7PB 2DDAA 4PCQA 2A61A 4QLCU 2HVSA 2VI6A 4HNUA 1WJCA 1Z1DA 1O7LA 1APLC 3BQZA 3FZVA 2E1MC 4PSWA 4E7KA 3I55I 1W1WE 1S29A 4IZZA 1JE8A 2LKXA 5LLQA 4M3BA 4IOCF 2V4JC 5D6EA 1B4AA 3OYGA 5IP6A 5J1RA 3IKVA 3CUQB 5J1YA 2A5YB 4RM3A 3AFHA 2CV1A 2GWRA 2R7QA 1FC3A 3VSLA 3WU0A 5KVRA 2XB5A 1NK2P 2O0YA 2E2JJ 4HF2A 3HRSA 3OL4A 1CF7B 4RGRA 4FE7A 3Q9SA 3CCUI 5EG0B 2NVXJ 2YR2A 3VSKA 1T39A 2FX0A 2DA5A 3DQVC 4B1RA 1USSA 4KUMA 5HS9A 2RDPA 3OL3A 3FXRA 1X2MA 3BP8A 1IDZA 4RMNA 1T56A 2FQ4A 1FY7A 1PUFA 4I7HA 1T0FC 5GAHJ 5IP7J 5GPAA 2HR3A 1XMAA 2JMWA 3S3MA 2A05A 2K9MA 3FM3A 4B3AA 2RVCA 2IEKA 1G6NA 1MMGA 2DU9A 1KU9A 3OOPA 3OIQA 3IH3A 1Z6RA 2FA5A 3T0YA 5AIQA 2WA0A 1Z0XA 1XDSA 4NNJA 1S7AA 2JWTA 2GA1A 3REOA 1XG1A 2JUCA 2HXIA 2M0MA 3WTYC 2PLYA 2Y30A 3F22A 4ESBA 3IH2A 3BTCA 3ABLH 4A3JJ 1Y39A 2WV0A 2OC6A 4FX0A 2HZDA 2EFQA 4LIUA 3HYIA 5B1BH 2V1NA 3V42A 1MSEC 2Z3YA 1X1DA 4UXNA 5EGOB 3GO5A 3BDDA 3M3YJ 1U8BA 1BOBA 2NXNB 4I0AA 4A2UA 1QBJA 2KLOA 3GFJA 4BHCA 1RKTA 1Z3YA 1EH7A 1IV6A 2LBFA 2X4HA 3HOUJ 2DJIA 4I98B 4BU2A 2P81A 5H20A 1TW3A 1YYVA 1FSEA 2E19A 4Q5SF 2A6HF 3JRHA 4BQQA 3BTJA 3IV5A 2R7XA 1O57A 4HQMA 3VYUB 4G7HF 5C4XJ 2XF7A 3TBIA 3L2QA 4BE0A 4HW0A 5LGNA 5IPAA 1J0RA 1IF1A 4A3LJ 2FUG2 1BI0A 1XTAA 5B66C 4IHWA 1U78A 1J59A 2RNJA 3CCYA 4IX7A 2JA2A 5C3EJ 2IGOA 1IN7A 1SFUA 4EJOA 1X4OA 3OYFA 4EGZA 1S72I 5E3OA 2BZTA 4RB0A 3VYRB 2ZMEA 3CESA 2VQCA 3S14J 2VQLA 1J09A 3E6MA 4XSZF 2LBFB 1UZCA 2LY2A 3OYKA 4XLCA 3S16J 2KRHA 5AONA 1IO2A 2QCOA 3GCMA 3L2WA 1QPIA 3DP7A 3IP4B 5FO5A 5D5VB 3ELKA 3FWEA 2NS0A 5DTDA 5J4YA 4MQVA 4CHUA 3LQRA 1NH3A 1BA5A 1IRZA 1BR1A 4MGRA 2YSRA 2QA4I 2VASA 5J40A 2V1XA 5JLWA 1LE8A 3JW4A 2QWWA 3HOZJ 2JVHA 2H8RA 3E1SA 4GRIA 4DYQA 1FPQA 3W2VA 4WXHA 2VE8A 1U5TC 2IT0A 1GLNA 3C3WA 4LLGF 2D2WA 1IUFA 1XMXA 2Y75A 3LSPA 1B72A 1TWHJ 2EA4A 3H0DA 1S8NA 2ZMEB 4OIOF 3CTAA 2DCEA 3FHNA 2HU9A 2W84A 4XICA 2EZLA 4D5CA 2WBMA 2VXZA 4Z2YA 3MKLA 1HDPA 1YIJI 1ZHFA 4OIQF 1ZARA 5JLXA 2M9HA 3DTEA 1XGSA 2XASA 3AG4H 1FMVA 2L9NA 1YQAA 4WCGA 1USTA 2CQKA 1TWFJ 4HV5A 1BJAA 2DTZA 1R22A 3CO6C 4W1UA 2KIUA 4HRIA 1V3FA 1N75A 3VFZA 3C18A 2XROA 4IHYA 3WTTC 1A5JA 4ZYGA 4EVIA 3GTGJ 1LKXA 4KFCA 1W5SA 1WH5A 1ZGAA 3LSGA 1B72B 3KFWX 3GLLA 3P9IA 3GTOJ 1Z77A 2VBWA 3SEZA 1AOYA 4BS9A 1SMTA 1VZ0A 3OS0A 3IKTA 4OU0A 1ETKA 3DPUA 4B09A 3JR9A 4F3QA 2ISYA 2R7DA 3FISA 4A5MA 4YFNF 3JCUC 1LB2A 3BWGA 2RQQA 2K85A 1IXCA 1ORKA 2Y48A 1IV8A 2R3SA 2HTJA 2ZB9A 4F55A 3DBLB 4HX4A 2DMUA 4NDLA 5D5UB 1OCZH 1X1AA 3RQ4A 4RGXA 4G7OF 2YX4A 1KYZA 4OMYA 3FM5A 2Z1DA 2FOKA 3K1MA 2QVOA 3BCBA 1I5ZA 5FKLA 3L9FA 3ROUA 1MZBA 3WGHA 4RB3C 1U3EM 4RAFA 4E7SA 1W0TA 3JRAA 2D1VA 1J7KA 1FP1D 2AHQA 1KGSA 3PO2J 3LMMA 3J7ZI 4EJVA 2E1CA 4I2OA 2ID3A 1ZYRF 4RAYA 4S04A 3RTRA 2P8TA 1GV5A 3HUGB 4G6DA 3KZIC 1RUOA 3SEQA 2YX7A 4IL6C 2MLKA 4BACA 4M71A 2P4WA 3J81Z 1RESA 2OPTA 2XAGA 3IUOA 1Y0UA 3T5XA 4BDZA 2GXBA 3GBGA 1JUMA 3SZGA 4RS8A 1PJRA 4WK8F 2DN0A 5EF6A 2EV5A 4OMZA 1K6YA 2FE3A 2XKOA 3WHCA 5L3EA 4ZH4F 1Z91A 1KQ8A 4M3DA 1JTXA 3GXOA 4GCVA 5FROA 1B6AA 2DO7A 4DZPA 3I53A 4EM0B 1EA3A 4N4OB 5LRSA 3WTSC 1MJAA 3R60A 1J5YA 4BHBA 3GZ6A 5ICGA 1PP7U 1X1PA 5BPDA 2LNBA 1P4XA 4HF0A 4FCYA 2HVQA 4M3FA 1YOVB 3CMMA 3BPXA 5CQGA 2EV0A 1JKPC 4LGWA 3FHZA 4ANJA 5A2QK 4PK4A 3ERED 1DUXC 2GIZA 4II3A 1Z3XA 2LVSA 1TNSA 2EFNA 2Q1ZB 5E20A 2GZWA 2CQQA 3FXMA 5K5OA 4M3GA 2OCEA 4A3BJ 5DEQA 1MIJA 1F36A 4IF4A 2BXYA 3BC8A 2JA7J 3BROA 4PDKA 4XSXF 1H88C 4RA2A 2XF5A 4XOTA 3CCRI 3HKZN 3BTLA 4AYBA 2JA6J 2Z9OA 3IH4A 1ZQ3P 3S2WA 1VQLI 3N97A 4NQWA 2JN6A 4DYRA 2GM4A 2PJRA 1E0EA 2A5WA 1I6HJ 2V26A 3V7RA 1G3YA 2EWNA 2TCTA 4UHTA 4XLAA 3ZXSA 5J8CA 4WX9A 2DLLA 1EF4A 2CQNA 2VXDA 1BI1A 3A4CA 3WODF 2BBYA 1VQ6I 5JI6A 3H5RA 1IN6A 2LY9A 2QKMB 1UMQA 2BW3A 5LD2C 1P7JA 3LSIA 4L9JA 2ZJRF 3KP6A 2LR8A 1OMIA 5E8GA 2R5YA 2JUGA 3QU6A 1MH3A 1IZ1A 2F5CA 1RNLA 4L5IA 2M4GA 3ZQLA 2ETHA 4LJZF 1PUEE 4QSHA 2ZXIA 4LLLA 4P55A 3LSHA 5CYVA 4PJNA 1UHMA 2LKSA 3FMRA 4P5OA 2FRHA 3RPQA 1ITYA 3LSRA 1D1AA 2MA3A 3WTWC 2UZKA 4A3EJ 4DJAA 1HXDA 2G7HA 3M1CA 1DDNA 1IXSB 1A04A 1MBJA 1YJWI 2COMA 3S17J 5DUKA 1YHQI 4ZYEA 1LVAA 2IGNA 4XOPA 4CZCA 2O8XA 3K1PA 2R5YB 1FBUA 2R7SA 1BW6A 1OKRA 3E97A 4NC6A 1S6LA 3QODA 2NS8A 1HKQA 1B59A 2DDBA 1WKMA 2K3PA 3KETA 2K02A 5CVRA 5IYDJ 4CCJA 3L00A 3BG5A 3R61A 2EIJH 3LNQA 2QSFX 2HNHA 2LMDA 3D5LA 1TP4A 2WC2A 2VC1A 1LEAA 2JK3A 2ZNYA 2K9LA 2MSYA 4CUGA 3B73A 4RGSA 2K86A 4XK4A 2HVRA 2EZKA 3QWLA 4F52A 1MMAA 2E5ZA 4FHTA 1R5HA 3V7SA 5IT9K 2KQRA 2Y31A 1KONA 1BC7C 1KA8A 1YS7A 1TLHB 3RIRA 2KZVA 4HBLA 5ED4A 2TRTA 3ZQHA 5LFAA 4A3IJ 1HW5A 3DEEA 2KKOA 1HKTA 3L09A 4NC8A 1MJBA 1BL0A 2M8GX 3OYDA 2DA3A 1VQMI 3KEOA 1ZR2A 5HLGA 3ECHA 3DTKA 3BTIA 3K69A 5KK1A 3BOQA 1GV2A 4PFPA 1RC9A 2VN2A 3M8FA 1GVDA 2IA1A 3O3KA 4O3MA 4BXFA 3WGGA 2BOLA 2ZXHA 2XC7A 3TO6A 3S1QJ 2VBYA 3I5UA 3SXYA 2W57A 4WXCA 4HF1A 3TP0A 4R1HA 3RYPA 1UCRA 5BS6A 1ENHA 1PVEA 1OCPA 3J7YJ 2YS9A 1FYMA 1W0UA 4AIKA 4LB6B 1XMKA 3RPUD 3A01A 4XMYA 3H35A 3DLLF 2LD5A 1YRNA 1G3TA 2CW0F 4MFEA 2M4KA 1YITI 1WH7A 3BJ6A 3JSOA 4XNFA 4BY7J 2A69F 3SYTA 2IA0A 2XRNA 2GA2A 3HC7A 1X19A 2HOTA 3OYLA 3HEFA 1YS6A 1XGMA 4Y3OA 2VKEA 2P5VA 1MBGA 3LSMA 1FOYA 2LG4A 1FT9A 3PFIA 2NVYJ 4AVZA 3EUHA 2WWYA 3P9KA 5FKOA 5A2QZ 3EQLF 5FRMA 4L9NA 1FYKA 4XRFA 3RYRA 3CP8A 2AXTC 3KLNA 3NRVA 3ML6A 1E2XA 2PN6A 4KT6A 1G3SA 2IBDA 2HPMA 3WG9A 1JHFA 1VQOI 4HSTA 2Y0SN 3A01B 1YRNB 3RPUA 3FKJA 4UY8I 2KP6A 1LFBA 5HDKA 1KU7A 1DU6A 1WGXA 2HWVA 2HTSA 1ONVA 3D1NI 3GMEA 5HDNA 3K4CA 1ZN2A 1XS9A 2FBKA 1B8IB 3Q5FA 1FEXA 2EILH 4A5NA 2VKHA 4BJ6C 3W2AA 1LEBA 5F1JA 1JHHA 2GBYA 2XIGA 2K9SA 3SFIA 1MBEA 2KIFA 3G1MA 3HOWJ 2DA4A 5HS7A 2XAUA 2Y0MA 3ONQA 3M9AA 3CJRB 3F0CA 4MEYF 4AIHA 2JT1A 1K61A 1VQNI 2DMNA 1KQ0A 2ELJA 2QQAA 3DKYA 1UG0A 3QP6A 2PEXA 1LQ1A 2PBIA 3FK7A 1SAUA 2CG4A 3DKWA 2H8WA 1Y1VJ 1D3YA 3MMYB 4PJ0C 5ILUA 4I0BA 1O3TA 3B02A 4QPOA 2W48A 2R7UA 3ABUA 2ACJA 1BR4A 5J47A 2VKVA 3QOEA 2K7LA 4FQGA 2E60A 4XLHA 3HRMA 4Y4RA 2VC0A 3CCMI 5EDNA 3K1NA 3GFIA 5E17F 2CW8A 4OAZA 5E1ZB 1X1CA 5DCFA 4F91B 5BOXA 5F0FA 2UXNA 3G1LA 1VQ9I 3HL2A 4BE2A 4C3HJ 2DA1A 1SFOJ 2CUJA 4N9IA 3K4MA 3HOSA 2KISA 5F08A 3PUFA 1SVMA 4BBRJ 1Q1HA 4AUXA 3ULQB 1D5VA 2MC4A 1T33A 4D7MA 2KIMA 4A69C 2RKHA 2F5DA 1IN5A 3BG6A 1R4NB 3MWMA 4AD9A 4YIIA 3MVPA 1ZGWA 1D0YA 3K6GA 3LA7A 5IT9Z 1W4MA 3DU6A 4TV7A 2E1MB 1T0FA 4L9VA 2FQ3A 2NAZA 4G7ZF 1F5TA 4LLNA 4U0YA 3U9GA 3HM5A 4J19A 2HDCA 5CQEA 4XLNF 4ZYHA 2LREA 2KJBA 4UVCA 4A0YA 2R7TA 5F0HA 3FDYA 4I6ZA 3SZTA 2Z5UA 5F27A 4CA0A 4G6QA 5FLXZ 2K9NA 3BJOA 4ESFA 3FBIB 3JRDA 3E0JB 3QPTA 2O8KA 4IHVA 4JX4A 3VWBA 3NAUA 3WE2A 2RN7A 3TOBA 4CCKA 2OU2A 1BBYA 1Z05A 1ON1A 1D0ZA 4HDVA 5EEHA 2UXXA 2M7AA 1FTZA 5GAGJ 2EINH 5D8LB 1EH8A 3BR1A 3J80K 1Z7LA 2DQRA 2V9PA 4ENJA 4ZJZA 1S9HA 2DA2A 3H1CA 5JVGF 1K79A 5E3LA 1Y0NA 5BQTA 2HQ5A 2M0CA 5L3GA 2NOJB 3G2BA 3JAMK 1JKQC 3WTVC 5TRDA 1XX5A 4EGYA 3HKZA 3NEUA 3OS2A 4AU7A 5C44J 1ZRCA 5B3SH 3GTKJ 4IO9F 1JTYA 4LFUA 2A6EF 3LFKA 4LOCA 4PGGA 5D6FA 2DOFA 2HDWA 5KHDA 2XHKA 1MH4A 3O8GA 2IXSA 3EUKL 2EJRA 4UV9A 2L0KA 3J7AY 3M4OJ 2F5VA 1ETQA 5TISC 4M6YA 3J81K 2RREA 2KT0A 2LF8A 2LKPA 2P7VB 4PUSA 4CCOA 1XC5A 2MH9A 1IN4A 2DMTA 1OYIA 3RI4A 1CGPA 3K4LA 1HW2A 1E3OC
chains in the Genus database with same CATH topology
2FJ1A 1PUFB 3OIOA 1CQTA 1OJLA 2VPRA 3S2DJ 1FTTA 2AO9A 2E2HJ 2ID6A 1UHSA 1OCTC 2X6OA 5FKLA 1X2NA 5IYBJ 4A3CJ 5GPCA 3BR0A 2EZHA 3GTJJ 3JRAA 3BQYA 1W0TA 2AHQA 3PO2J 3B6CA 3H3VK 2LTPA 4CYCA 3DEWA 3GTPJ 4X6AJ 3CQZJ 3JRGA 2ID3A 1A6IA 2LK2A 2ME0A 1GV5A 3A03A 1MNMC 2NVQJ 3BT9A 3QPSA 2EQRA 1RESA 2OPTA 4A3MJ 1IG7A 4FISA 1AHDP 3GBGA 3TEDA 1JUMA 5M5WJ 5E3NA 3H0GJ 3C2BA 5EYRA 2DN0A 5EF6A 1HLVA 2HXOA 3WHCA 2M34A 2GLOA 4M3DA 4BKXA 2R5ZA 1JTXA 3UKGA 2HYJA 2E1OA 4DZPA 3I4MJ 2CRGA 4EEFG 4RDUA 1ETXA 4D5FA 2WV1A 5K7FA 4CYCB 4M3FA 4FCYA 2L7ZA 4A3FJ 1JKPC 9ANTA 3CDLA 2LVSA 1HCRA 3FK6A 2NOGA 4XIDA 4FE4A 4A3BJ 2CQQA 4M3GA 1F36A 2KDZA 2JA7J 1P7IA 4BY1J 1H88C 1ZK8A 5EG0A 2JA8J 2HI3A 2MG4A 3HKZN 3BTLA 3GTMJ 2JA6J 3MN2A 2EBIA 1MBHA 2FD5A 3IH4A 1ZQ3P 2LLKA 3S1MJ 2JN6A 4DYRA 5IOYA 2GM4A 1HF0A 1QRYA 1I6HJ 2O7OA 2TCTA 3WHBA 3QPLA 3OSGA 1GDTA 3ZQCA 2XGDA 1JUPA 1B8IA 1TC3C 4XRSA 1EF4A 4B4CA 3BG9A 2HOSA 5M3FJ 5IP9J 4Y52J 2LY9A 1LE8B 1UMQA 1UG2A 1O4XA 1P7JA 4BXXJ 2LR8A 2R5YA 1MH3A 2XGEA 1F43A 3RKQA 2CUFA 3ZQGA 5M3MJ 3ZQLA 1SANA 5K7HA 4QSHA 1WPKA 2Y2ZA 2ECBA 2HOAA 2DJNA 1GT0C 1AU7A 3GTLJ 4XRMA 1ETYA 1D5YA 4Y7NJ 5EGOA 2D5VA 1U9OA 1POGA 3L1PA 1ITYA 3LSRA 2DA7A 2WB1N 4A3EJ 5BNGA 1JJ8C 3A02A 1MBJA 4BBSJ 3S17J 3TW7A 1FJLA 4QIWN 1BW5A 2X9DA 5J3LA 2R5YB 1BW6A 3LSJA 1GUUA 4A93J 2NS8A 3QQAA 1RR7A 5C4JJ 1ETVA 2WAQN 3B6AA 5IYDJ 2EH3A 3I4NJ 3SDGA 3BG5A 3LNQA 1MBFA 1IDYA 2B63J 2JK3A 2MSYA 2XPWA 3BR5A 3CMYA 4XK4A 3Q0VA 1VFCA 2EZKA 3BR3A 3O8HA 3HGYA 2CJJA 2XB0X 2Y31A 4G12A 4C3IJ 4UUSA 1ZKGA 3TW6A 3HB9A 4MFDA 2TRTA 4A3DJ 3ZQHA 2I10A 4A3IJ 1TWAJ 1H8AC 2YU9J 3FKIJ 1Q1VA 5FLVA 2XPUA 1NK3P 2L7MP 3LOCA 1FIAA 3ZQIA 1BL0A 2M8GX 3JRIA 2DA3A 3JRFA 2ECCA 2XGCA 4L5EA 4AYBN 4X1EA 2Y9ZA 5DS9A 1ZR2A 3BTIA 1JJ6C 1GV2A 1HDDC 2R93J 1GVDA 3S2HJ 2ME6A 5GP9A 1JKOC 4A3KJ 3K7AJ 3S1QJ 4IHXA 5IOZA 5EEAA 1LFUP 2NVTJ 3TP0A 5FLMJ 2K40A 5E3MA 3G1OA 1ENHA 1QVTA 4V2GA 1JT6A 2ELKA 1OCPA 2N8GA 2YUSA 2YS9A 5IYCJ 3FIWA 1W0UA 2EZIA 1VI0A 4M6VA 2RAEA 1S7EA 1MBKA 3A01A 1VF9A 2PMZN 2LD5A 1YRNA 2R5ZB 4MFEA 1WCMJ 1IGNA 2VI6A 1WH7A 1APLC 3BQZA 4BY7J 2LKXA 1H89C 4M3BA 1JUSA 4ABZA 2VUMJ 2HOTA 5IP6A 5J1RA 4AC0A 4MIMA 3BG3A 3HEFA 1VNDA 5FKKA 5J1YA 2VKEA 1I3QJ 1MBGA 1IJWC 4A3GJ 2NVYJ 3K2AA 2XB5A 5FKOA 2DMPA 1NK2P 3ZQFA 5F04A 2E2JJ 5FKMA 4FE7A 4W97A 5EG0B 2NVXJ 3HGGA 2FX0A 2IBDA 2DA5A 4B1RA 3S15J 2Y0SN 1HOMA 3A01B 3S1RJ 1YRNB 5EZHA 5M5YJ 1X2MA 3JREA 1DU0A 1IDZA 1T56A 2FQ4A 1PUFA 1LFBA 5IP7J 1DU6A 1WGXA 5GPAA 3D1NI 2JMWA 1XS9A 3HBLA 4B3AA 1ZTRA 2NS7A 2Y9YA 1B8IB 4V2FA 2IEKA 1FEXA 2XSDC 3IH3A 5F1JA 4IEJA 2GBYA 2K9SA 3SFIA 1MBEA 3HOWJ 3G1MA 1Z0XA 4RBOA 2DA4A 2JWTA 2LP0A 1XG1A 2HXIA 1QVUA 5K7ZA 3SJMA 3F0CA 3TP3A 2Y30A 1K61A 2JA5J 2DMNA 3IH2A 3BTCA 4A3JJ 3BR6A 4FTHA 1U9NA 3FK7A 4HNVA 1MSEC 3HDDA 1Y1VJ 5EGOB 1JGGA 3M3YJ 1U8BA 1BJZA 3S1NJ 2K9QA 5EZGA 3GTQJ 1X58A 2W48A 3DCFA 4M3EA 2G0EA 1RKTA 2E2IJ 2VKVA 1IV6A 3HOUJ 1FIPA 4S0HB 5J1UA 2P81A 5FJ8J 2E19A 5EDNA 1ETOA 1I50J 3ZOBA 3JRHA 3IV5A 3BTJA 4D7NA 5C4XJ 1E3OC 5F0FA 1AKHA 3G1LA 4DZJA 1TWGJ 3Q0WA 4DYCA 2MW8A 4I76A 4C3HJ 2DA1A 5IPAA 2DMQA 4A3LJ 1SFOJ 3OSFA 2R92J 3JRBA 2CUEA 4JYKA 5F08A 4GFBA 4BBRJ 4IHWA 4AUXA 1U78A 1T33A 2COBA 4D7MA 3CCYA 4A69C 5C3EJ 1ZGWA 5E3OA 3MVPA 4JX5A 1NTCA 1TWCJ 4UUSB 3VPRA 5FKNA 1ETWA 3S14J 4C2MJ 3RZDJ 3HOVJ 3BR2A 2R0QC 3HM5A 4J19A 1JKRC 3S16J 2QCOA 3Q3SA 4UUTA 2M2EA 4DW6A 1QPIA 1ZR4A 2QF7A 4MLOA 1RKWA 5DTDA 2R7ZJ 3W6VA 5F0HA 2OF7A 3OOUA 1BA5A 1IRZA 1AKHB 4I6ZA 5F27A 5JLWA 3PO3J 1LE8A 4C3JJ 3HOZJ 2K9NA 2H8RA 1K83J 4DYQA 3JRDA 2IAIA 2O8KA 4IHVA 4JX4A 5M5XJ 3RQIA 5HODA 2CQXA 1IUFA 3NAUA 2XRLA 2H1KA 3LSPA 5F0CA 1B72A 1TWHJ 2L7FP 1IC8A 4MO7A 1FTZA 2X48A 3BR1A 4XICA 2EZLA 4D5CA 2XPVA 2DA6A 3RZOJ 3MKLA 1HDPA 2MGQA 2HDDA 2DA2A 5JLXA 2M9HA 5E3LA 3HOYJ 2HQ5A 2M0CA 1JKQC 1MSFC 1TWFJ 1JT0A 2DTZA 2JJ7A 4W1UA 2CU7A 1G2HA 5C44J 4IHYA 3NARA 3Q0UA 3GTKJ 1A5JA 1JTYA 3HOXJ 4QTRA 3GTGJ 4LOCA 2O9LA 4JP0A 3PM1A 1RETA 1MH4A 1WH5A 3LSGA 3O8GA 1B72B 1OFCX 3GTOJ 1Z77A 2L0KA 3M4OJ 1ETKA 1ETQA 2L9RA 3JRCA 3JR9A 4JX6A 2LFBA 3FISA 4XRSG 1Y1WJ 2KT0A 1R9TJ 3E7LA 1WI3A 1ORKA 1XC5A 2DMTA 1RPWA 2ZB9A 2DMUA 4NDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ1 A;  1PUF B;  3OIO A;  1CQT A;  1OJL A;  2VPR A;  3S2D J;  1FTT A;  2AO9 A;  2E2H J;  2ID6 A;  1UHS A;  1OCT C;  2X6O A;  5FKL A;  1X2N A;  5IYB J;  4A3C J;  5GPC A;  3BR0 A;  2EZH A;  3GTJ J;  3JRA A;  3BQY A;  1W0T A;  2AHQ A;  3PO2 J;  3B6C A;  3H3V K;  2LTP A;  4CYC A;  3DEW A;  3GTP J;  4X6A J;  3CQZ J;  3JRG A;  2ID3 A;  1A6I A;  2LK2 A;  2ME0 A;  1GV5 A;  3A03 A;  1MNM C;  2NVQ J;  3BT9 A;  3QPS A;  2EQR A;  1RES A;  2OPT A;  4A3M J;  1IG7 A;  4FIS A;  1AHD P;  3GBG A;  3TED A;  1JUM A;  5M5W J;  5E3N A;  3H0G J;  3C2B A;  5EYR A;  2DN0 A;  5EF6 A;  1HLV A;  2HXO A;  3WHC A;  2M34 A;  2GLO A;  4M3D A;  4BKX A;  2R5Z A;  1JTX A;  3UKG A;  2HYJ A;  2E1O A;  4DZP A;  3I4M J;  2CRG A;  4EEF G;  4RDU A;  1ETX A;  4D5F A;  2WV1 A;  5K7F A;  4CYC B;  4M3F A;  4FCY A;  2L7Z A;  4A3F J;  1JKP C;  9ANT A;  3CDL A;  2LVS A;  1HCR A;  3FK6 A;  2NOG A;  4XID A;  4FE4 A;  4A3B J;  2CQQ A;  4M3G A;  1F36 A;  2KDZ A;  2JA7 J;  1P7I A;  4BY1 J;  1H88 C;  1ZK8 A;  5EG0 A;  2JA8 J;  2HI3 A;  2MG4 A;  3HKZ N;  3BTL A;  3GTM J;  2JA6 J;  3MN2 A;  2EBI A;  1MBH A;  2FD5 A;  3IH4 A;  1ZQ3 P;  2LLK A;  3S1M J;  2JN6 A;  4DYR A;  5IOY A;  2GM4 A;  1HF0 A;  1QRY A;  1I6H J;  2O7O A;  2TCT A;  3WHB A;  3QPL A;  3OSG A;  1GDT A;  3ZQC A;  2XGD A;  1JUP A;  1B8I A;  1TC3 C;  4XRS A;  1EF4 A;  4B4C A;  3BG9 A;  2HOS A;  5M3F J;  5IP9 J;  4Y52 J;  2LY9 A;  1LE8 B;  1UMQ A;  1UG2 A;  1O4X A;  1P7J A;  4BXX J;  2LR8 A;  2R5Y A;  1MH3 A;  2XGE A;  1F43 A;  3RKQ A;  2CUF A;  3ZQG A;  5M3M J;  3ZQL A;  1SAN A;  5K7H A;  4QSH A;  1WPK A;  2Y2Z A;  2ECB A;  2HOA A;  2DJN A;  1GT0 C;  1AU7 A;  3GTL J;  4XRM A;  1ETY A;  1D5Y A;  4Y7N J;  5EGO A;  2D5V A;  1U9O A;  1POG A;  3L1P A;  1ITY A;  3LSR A;  2DA7 A;  2WB1 N;  4A3E J;  5BNG A;  1JJ8 C;  3A02 A;  1MBJ A;  4BBS J;  3S17 J;  3TW7 A;  1FJL A;  4QIW N;  1BW5 A;  2X9D A;  5J3L A;  2R5Y B;  1BW6 A;  3LSJ A;  1GUU A;  4A93 J;  2NS8 A;  3QQA A;  1RR7 A;  5C4J J;  1ETV A;  2WAQ N;  3B6A A;  5IYD J;  2EH3 A;  3I4N J;  3SDG A;  3BG5 A;  3LNQ A;  1MBF A;  1IDY A;  2B63 J;  2JK3 A;  2MSY A;  2XPW A;  3BR5 A;  3CMY A;  4XK4 A;  3Q0V A;  1VFC A;  2EZK A;  3BR3 A;  3O8H A;  3HGY A;  2CJJ A;  2XB0 X;  2Y31 A;  4G12 A;  4C3I J;  4UUS A;  1ZKG A;  3TW6 A;  3HB9 A;  4MFD A;  2TRT A;  4A3D J;  3ZQH A;  2I10 A;  4A3I J;  1TWA J;  1H8A C;  2YU9 J;  3FKI J;  1Q1V A;  5FLV A;  2XPU A;  1NK3 P;  2L7M P;  3LOC A;  1FIA A;  3ZQI A;  1BL0 A;  2M8G X;  3JRI A;  2DA3 A;  3JRF A;  2ECC A;  2XGC A;  4L5E A;  4AYB N;  4X1E A;  2Y9Z A;  5DS9 A;  1ZR2 A;  3BTI A;  1JJ6 C;  1GV2 A;  1HDD C;  2R93 J;  1GVD A;  3S2H J;  2ME6 A;  5GP9 A;  1JKO C;  4A3K J;  3K7A J;  3S1Q J;  4IHX A;  5IOZ A;  5EEA A;  1LFU P;  2NVT J;  3TP0 A;  5FLM J;  2K40 A;  5E3M A;  3G1O A;  1ENH A;  1QVT A;  4V2G A;  1JT6 A;  2ELK A;  1OCP A;  2N8G A;  2YUS A;  2YS9 A;  5IYC J;  3FIW A;  1W0U A;  2EZI A;  1VI0 A;  4M6V A;  2RAE A;  1S7E A;  1MBK A;  3A01 A;  1VF9 A;  2PMZ N;  2LD5 A;  1YRN A;  2R5Z B;  4MFE A;  1WCM J;  1IGN A;  2VI6 A;  1WH7 A;  1APL C;  3BQZ A;  4BY7 J;  2LKX A;  1H89 C;  4M3B A;  1JUS A;  4ABZ A;  2VUM J;  2HOT A;  5IP6 A;  5J1R A;  4AC0 A;  4MIM A;  3BG3 A;  3HEF A;  1VND A;  5FKK A;  5J1Y A;  2VKE A;  1I3Q J;  1MBG A;  1IJW C;  4A3G J;  2NVY J;  3K2A A;  2XB5 A;  5FKO A;  2DMP A;  1NK2 P;  3ZQF A;  5F04 A;  2E2J J;  5FKM A;  4FE7 A;  4W97 A;  5EG0 B;  2NVX J;  3HGG A;  2FX0 A;  2IBD A;  2DA5 A;  4B1R A;  3S15 J;  2Y0S N;  1HOM A;  3A01 B;  3S1R J;  1YRN B;  5EZH A;  5M5Y J;  1X2M A;  3JRE A;  1DU0 A;  1IDZ A;  1T56 A;  2FQ4 A;  1PUF A;  1LFB A;  5IP7 J;  1DU6 A;  1WGX A;  5GPA A;  3D1N I;  2JMW A;  1XS9 A;  3HBL A;  4B3A A;  1ZTR A;  2NS7 A;  2Y9Y A;  1B8I B;  4V2F A;  2IEK A;  1FEX A;  2XSD C;  3IH3 A;  5F1J A;  4IEJ A;  2GBY A;  2K9S A;  3SFI A;  1MBE A;  3HOW J;  3G1M A;  1Z0X A;  4RBO A;  2DA4 A;  2JWT A;  2LP0 A;  1XG1 A;  2HXI A;  1QVU A;  5K7Z A;  3SJM A;  3F0C A;  3TP3 A;  2Y30 A;  1K61 A;  2JA5 J;  2DMN A;  3IH2 A;  3BTC A;  4A3J J;  3BR6 A;  4FTH A;  1U9N A;  3FK7 A;  4HNV A;  1MSE C;  3HDD A;  1Y1V J;  5EGO B;  1JGG A;  3M3Y J;  1U8B A;  1BJZ A;  3S1N J;  2K9Q A;  5EZG A;  3GTQ J;  1X58 A;  2W48 A;  3DCF A;  4M3E A;  2G0E A;  1RKT A;  2E2I J;  2VKV A;  1IV6 A;  3HOU J;  1FIP A;  4S0H B;  5J1U A;  2P81 A;  5FJ8 J;  2E19 A;  5EDN A;  1ETO A;  1I50 J;  3ZOB A;  3JRH A;  3IV5 A;  3BTJ A;  4D7N A;  5C4X J;  1E3O C;  5F0F A;  1AKH A;  3G1L A;  4DZJ A;  1TWG J;  3Q0W A;  4DYC A;  2MW8 A;  4I76 A;  4C3H J;  2DA1 A;  5IPA A;  2DMQ A;  4A3L J;  1SFO J;  3OSF A;  2R92 J;  3JRB A;  2CUE A;  4JYK A;  5F08 A;  4GFB A;  4BBR J;  4IHW A;  4AUX A;  1U78 A;  1T33 A;  2COB A;  4D7M A;  3CCY A;  4A69 C;  5C3E J;  1ZGW A;  5E3O A;  3MVP A;  4JX5 A;  1NTC A;  1TWC J;  4UUS B;  3VPR A;  5FKN A;  1ETW A;  3S14 J;  4C2M J;  3RZD J;  3HOV J;  3BR2 A;  2R0Q C;  3HM5 A;  4J19 A;  1JKR C;  3S16 J;  2QCO A;  3Q3S A;  4UUT A;  2M2E A;  4DW6 A;  1QPI A;  1ZR4 A;  2QF7 A;  4MLO A;  1RKW A;  5DTD A;  2R7Z J;  3W6V A;  5F0H A;  2OF7 A;  3OOU A;  1BA5 A;  1IRZ A;  1AKH B;  4I6Z A;  5F27 A;  5JLW A;  3PO3 J;  1LE8 A;  4C3J J;  3HOZ J;  2K9N A;  2H8R A;  1K83 J;  4DYQ A;  3JRD A;  2IAI A;  2O8K A;  4IHV A;  4JX4 A;  5M5X J;  3RQI A;  5HOD A;  2CQX A;  1IUF A;  3NAU A;  2XRL A;  2H1K A;  3LSP A;  5F0C A;  1B72 A;  1TWH J;  2L7F P;  1IC8 A;  4MO7 A;  1FTZ A;  2X48 A;  3BR1 A;  4XIC A;  2EZL A;  4D5C A;  2XPV A;  2DA6 A;  3RZO J;  3MKL A;  1HDP A;  2MGQ A;  2HDD A;  2DA2 A;  5JLX A;  2M9H A;  5E3L A;  3HOY J;  2HQ5 A;  2M0C A;  1JKQ C;  1MSF C;  1TWF J;  1JT0 A;  2DTZ A;  2JJ7 A;  4W1U A;  2CU7 A;  1G2H A;  5C44 J;  4IHY A;  3NAR A;  3Q0U A;  3GTK J;  1A5J A;  1JTY A;  3HOX J;  4QTR A;  3GTG J;  4LOC A;  2O9L A;  4JP0 A;  3PM1 A;  1RET A;  1MH4 A;  1WH5 A;  3LSG A;  3O8G A;  1B72 B;  1OFC X;  3GTO J;  1Z77 A;  2L0K A;  3M4O J;  1ETK A;  1ETQ A;  2L9R A;  3JRC A;  3JR9 A;  4JX6 A;  2LFB A;  3FIS A;  4XRS G;  1Y1W J;  2KT0 A;  1R9T J;  3E7L A;  1WI3 A;  1ORK A;  1XC5 A;  2DMT A;  1RPW A;  2ZB9 A;  2DMU A;  4NDL A; 
#chains in the Genus database with same CATH topology
 1ZRF A;  2FJ1 A;  1PUF B;  2DPU A;  2IPQ X;  2VPR A;  5HLI A;  3S2D J;  1MND A;  1FTT A;  3C2H A;  2LRD A;  2A3S A;  2E2H J;  1D1B A;  2D45 A;  3F8M A;  1UHS A;  2P7C B;  1OCT C;  3TO7 A;  2LY1 A;  4FT8 A;  1XSV A;  5IYB J;  3CDH A;  4A3C J;  1AA7 A;  2A68 F;  3B6C A;  1LFP A;  1U5T A;  2EB7 A;  2JRT A;  3DEW A;  4XL9 A;  3ZQQ A;  3H3V K;  4X6A J;  3HHH A;  2XAF A;  2VON A;  3CQZ J;  4MTE A;  3NWT A;  1A6I A;  4GDF A;  2ME0 A;  2F4I A;  3F9K A;  3IC7 A;  1YX3 A;  2ZJQ F;  4HAM A;  2NVQ J;  5ERI A;  2WY8 Q;  2DXI A;  1ERD A;  2EQR A;  2RQP A;  2FNA A;  2ZKZ A;  1IG7 A;  2X6W A;  1AHD P;  2VJJ A;  3TED A;  2EIM H;  5JR3 A;  4ZYD A;  2QQ8 A;  5EYR A;  5HS8 A;  3VDX A;  2HXO A;  2DOA A;  4HX8 A;  4BAY A;  4UVA A;  2GLO A;  4YG2 F;  2R5Z A;  4B8X A;  4JK1 X;  4BL0 B;  2DBB A;  2CRG A;  2E5N A;  3OYJ A;  3NQO A;  2Q2E A;  4M9X A;  2IW5 A;  4IQJ A;  2BE5 F;  3QOP A;  1ETX A;  1DGW Y;  4PGH A;  1MNE A;  3MAJ A;  4D5F A;  2WV1 A;  5K7F A;  3IL2 A;  3SFZ A;  1U5T B;  3LAP A;  4D9J A;  1K4S A;  2L7Z A;  2M8E A;  5KAF C;  2KRF A;  4OWR B;  1QNT A;  1V55 H;  1TZL A;  4BJT A;  5DYM A;  2Q8K A;  2GQQ A;  1IUY A;  4OOI A;  3CCV I;  1FBQ A;  2O5R A;  1HQC A;  2O3F A;  5GAD J;  4YRV A;  2NNY A;  4BY1 J;  2V1D A;  1I1G A;  2K3F A;  2M30 A;  4DIQ A;  2CWE A;  2WTE A;  3MFK A;  4KJZ A;  3X2Q H;  1OQY A;  3GTM J;  4S05 A;  4XKB A;  1MBH A;  1SFK A;  3I71 A;  3KCC A;  2L2O A;  4ESJ A;  2LLK A;  3COA C;  2UV1 A;  2X6X A;  5JFR A;  1WWX A;  3T1B A;  2CO5 A;  1QRY A;  2MFZ A;  3DBR B;  2MH2 A;  3L7W A;  1F4K A;  4HYE A;  2IS1 A;  5B5E C;  1ZLJ A;  3OY9 A;  1JUP A;  2X1C A;  1TC3 C;  3ABM H;  2H1L A;  4EQQ A;  4B4C A;  4Z6Y A;  1RUN A;  2DQL A;  2FSW A;  3DTI A;  3V8L A;  1L3L A;  2HQR A;  3ERM A;  4R79 A;  2AQF A;  2TDX A;  3TMO A;  4UV8 A;  5IP9 J;  2W82 A;  2L3D A;  1V5E A;  1LE8 B;  3WU1 B;  5BPI A;  1O4X A;  3BZ6 A;  2DK8 A;  3ZP5 A;  4XLP F;  2CUF A;  3MKZ A;  1SAN A;  5K7H A;  4CSW A;  3LA3 A;  3T8T A;  3HOT A;  3HIF A;  2DT6 A;  4BUP A;  1YFH A;  3KIO A;  1ZG1 A;  2HOA A;  1O3Q A;  4HEA 2;  2J5P A;  3GTL J;  4XN3 A;  2BHZ A;  2D5V A;  2P5L C;  1U9O A;  4Y13 A;  4B47 A;  3J80 Z;  2QQ9 A;  5BNG A;  2ESH A;  3A02 A;  3ASN H;  2ZFU A;  1ZLK A;  3DPT A;  2I5U A;  2PX9 A;  4BNC A;  4BBS J;  5F6F A;  2VT3 A;  3M8J A;  2PMU A;  1SVO A;  1BI2 A;  4Y15 A;  1WRJ A;  2L4M A;  3AG2 H;  3D5S C;  4U88 A;  4ZZL A;  1U6G A;  3PIO F;  3JTH A;  3PSI A;  3CF2 A;  2XV4 S;  1BW5 A;  2X9D A;  3DV8 A;  5DV5 A;  2Y69 H;  3RCO A;  4F7Z A;  3JAM Z;  4XOR A;  6PAX A;  4A93 J;  3OYM A;  2KJC A;  2HPI A;  2Y0S A;  3LST A;  4IVN A;  3SHF A;  3O2P E;  2WAQ N;  3B6A A;  3DWL E;  2CQ7 A;  2EH3 A;  3TGN A;  4EJW A;  1MBF A;  4HOB A;  4U0V A;  1PDN C;  5LEJ A;  3BR5 A;  1TT5 B;  3CMY A;  3QPH A;  3HGY A;  2CJJ A;  1A31 A;  1OR7 A;  2XB0 X;  3H5N A;  4QWQ A;  4KMU X;  2R7O A;  4UUS A;  4HLX A;  3HB9 A;  4IRI A;  3C1D A;  2VT2 A;  2YU9 J;  1LDD A;  2BGC A;  3H9Q A;  1Q1V A;  3OWT A;  2F4M B;  2XPU A;  3MZ8 A;  1NK3 P;  5LGU A;  1E3H A;  2IA2 A;  1D8J A;  4L5E A;  4M6X A;  2CH0 A;  2RC4 A;  1D1C A;  1P6R A;  2M3A A;  1O7F A;  2NRA C;  4J01 A;  4HLY A;  2E34 A;  2H6B A;  3ESW B;  2R4G A;  1BIA A;  2ME6 A;  2DOE A;  5GP9 A;  3WTU C;  4UB8 C;  3GVA A;  2CFO A;  2QGU A;  1TQI A;  4DNC A;  5IOZ A;  5EEA A;  1LFU P;  2GXA A;  2NVT J;  2PMH A;  4JOM A;  5JVT A;  2CMP A;  4NUB A;  5E3M A;  4AID A;  4HNT A;  1FWZ A;  1JT6 A;  2ZNZ A;  3MD2 A;  3ZQ7 A;  2ELK A;  2YUS A;  1MGT A;  3FIW A;  4A6E A;  3CP2 A;  4M6V A;  4X0G A;  3K70 C;  4KNY A;  1UJ8 A;  1D0X A;  1MBK A;  3FXL A;  1OR7 C;  1MMN A;  3DFG A;  3G73 A;  1VF9 A;  3KEY A;  1WCM J;  2L5Q A;  1DPU A;  4XON A;  4F92 B;  4H0E A;  2V79 A;  3H5A A;  2VUM J;  4AC0 A;  2LH9 A;  4G9Y A;  4MIM A;  1VND A;  5FKK A;  1R6R A;  3L2C A;  2ESN A;  1I3Q J;  5BMZ A;  4BYY A;  4A3G J;  1FX7 A;  1R58 A;  3K2A A;  2KMU A;  3MKY B;  3KYC B;  2F5E A;  3FMS A;  2DT7 B;  5FKM A;  1FBS A;  1K4T A;  3GUD A;  4Q4Z F;  4RGU A;  3AG1 H;  4W97 A;  2PMZ A;  3G4S I;  4IOA F;  3GX4 X;  1XPX A;  3KLO A;  1HW1 A;  3KYD B;  4IKF A;  4ZDO A;  1HOM A;  3S1R J;  2M7B A;  2OCC H;  2PJP A;  3JRE A;  4NQW B;  2PJR B;  3W6K B;  1SEU A;  1R71 A;  3HBL A;  5TGT A;  1ZTR A;  3E5X A;  4XN0 A;  3BPV A;  1KU3 A;  4KN4 X;  5CVV A;  1TTY A;  1B9N A;  5E18 F;  4IEJ A;  2BHY A;  3K10 A;  2BW3 B;  2BVM A;  4RBO A;  3KPH A;  2LP0 A;  1XSD A;  1W5C C;  1QVU A;  3FXQ A;  4A6D A;  5K7Z A;  3TP3 A;  1YW7 A;  1KZH A;  2DK5 A;  2WAF A;  4KIB A;  2V7F A;  3ZN0 A;  3N4M A;  3BR6 A;  1Y6I A;  2PI0 A;  1U9N A;  4HNV A;  1Z7U A;  2E36 A;  4BH9 A;  4HDU A;  4JQF A;  5IT3 A;  3S93 A;  1JGG A;  5HOO A;  4BQA A;  2EV6 A;  4KIS A;  2VJ5 A;  1TL8 A;  5DCM A;  3QYE A;  1XB4 A;  4M3E A;  2G0E A;  2MC3 A;  5K1Y A;  1V4R A;  1K78 A;  2E2I J;  1OLT A;  1WZ2 A;  4EJU A;  1FIP A;  3QAH A;  1YG2 A;  5J1U A;  2M1B A;  4S0H B;  1XDU A;  4BXU A;  2PFB A;  4U7B A;  4QPQ A;  5ILS A;  3MEX A;  2ZSH B;  1I50 J;  3ZOB A;  2ZSI B;  3CC4 I;  4KIC A;  4D7N A;  2QM3 A;  3MZH A;  5DUI A;  2AQE A;  2VBX A;  3K4J A;  2NVU B;  1XSX A;  3E6C C;  5FLX K;  4DZJ A;  1TWG J;  4DYC A;  2MW8 A;  4I76 A;  1VTN C;  1JI8 A;  3M1E A;  2KIQ A;  1VQK I;  1WI9 A;  4JYK A;  4GFB A;  3KP7 A;  4G94 A;  2WY7 Q;  1LNW A;  2YU3 A;  2MYS A;  2R7V A;  3EET A;  1SD6 A;  5EJC A;  2MD0 A;  1RR8 C;  1FZP B;  2BY1 A;  1X3W B;  2FML A;  3AL0 C;  1NTC A;  1TWC J;  3VPR A;  5DCM B;  5FKN A;  1ETW A;  1MMS A;  2OZ6 A;  1K78 B;  4HV6 A;  5H2F C;  1PP8 F;  4ZDL A;  4YIR X;  2IGM A;  3HOV J;  2VBZ A;  3BR2 A;  4RM2 A;  3CLQ A;  3Q3S A;  4L18 B;  4R8H A;  1ZR4 A;  2GXG A;  3DF8 A;  1BM9 A;  4MLO A;  1RKW A;  4M74 A;  4P9F A;  3U1K A;  3W6V A;  2JPC A;  2OF7 A;  3OOU A;  1ACI A;  4K2E A;  2Z99 A;  3T8R A;  1WJD A;  4P96 A;  3PO3 J;  2OQG A;  4HZF A;  4C3J J;  1K83 J;  4UUV A;  3P9C A;  2OBP A;  2IAI A;  3ZMU A;  4H4K C;  5M5X J;  3E5Q A;  1K6O A;  2CQX A;  3K4N A;  3I3L A;  2H1K A;  4O6J A;  2WAE A;  5ICF A;  5F0C A;  5L3C A;  1J75 A;  4UVB A;  3F8F A;  1G4D A;  2X51 A;  1R7J A;  5DD8 A;  3W3C A;  1P4A A;  3IRQ A;  2GOX B;  4MO7 A;  1IC8 A;  5KCM A;  2X48 A;  2LF7 A;  4IHS A;  3ZN1 A;  3IWF A;  1Y56 A;  2IJL A;  4HX7 A;  1FYL A;  2F5F A;  3GWZ A;  3V7C A;  1SD7 A;  4JBA A;  3EYI A;  3D0S A;  1YIO A;  3CCL I;  2Z33 A;  4G6T B;  4KIF A;  5D8K B;  1RIO H;  5LRR A;  3FXO A;  2NNN A;  1MD0 A;  1MSF C;  4C2T A;  4U0W A;  4ZTF A;  1SFX A;  2BV6 A;  2HFH A;  2CU7 A;  1G2H A;  1T38 A;  1ZH5 A;  3ZCO A;  4GYG A;  3HOX J;  4QTR A;  2DFE A;  4LK0 F;  3ZRG A;  4PJM A;  1O3S A;  4WWC A;  4NB5 A;  1RET A;  2G9W A;  1B9M A;  3FBN B;  4RB2 C;  4MHG A;  2P6S A;  5FRN A;  4C30 A;  1HKS A;  1YLF A;  4IRG A;  2L9R A;  5ICC A;  3OYB A;  3JRC A;  3ZMT A;  4JX6 A;  2LFB A;  4XRS G;  2IS2 A;  1MJ9 A;  4CXF A;  4XKC A;  4CZZ A;  1R9T J;  2CGP A;  1KYW A;  4RAG A;  2IS4 A;  2RGV A;  3GYH X;  2UUZ A;  2HQN A;  3GF2 A;  1W36 C;  2W4S A;  3GZN B;  4XBF A;  4I01 A;  1T6S A;  3ASO H;  3GEZ A;  1CQT A;  1OJL A;  2F6C A;  1HSJ A;  2AO9 A;  1IRF A;  3ABK H;  3TKY A;  3A0B C;  3LL7 A;  1YJN I;  4E7I A;  2FEZ A;  3F6V A;  3CJQ B;  1OIS A;  5GPC A;  3BR0 A;  1X3U A;  2L01 A;  3BQY A;  4ZZD A;  1MW7 A;  3PJR A;  4CYC A;  1DPR A;  2L4A A;  4ON0 A;  3RKX A;  4ZC3 A;  4OIP F;  3JRG A;  2LK2 A;  3CJT B;  4FAS D;  3A03 A;  1EJ9 A;  1YW8 A;  2L54 A;  1T95 A;  3FXU A;  1HC8 A;  3BT9 A;  1A6Q A;  4M73 A;  1YX5 A;  2LYC A;  4ZDP A;  4A3M J;  1YJ9 I;  2QSH X;  1FOW A;  3IAS 2;  4BGD A;  1QZY A;  5E3N A;  2IGK A;  3C2B A;  2IP2 A;  1L0O C;  3H36 A;  3UNG C;  1TBX A;  3F8C A;  1Y8R B;  3PQK A;  5LHG A;  4KDP A;  2LDU A;  2VLA A;  1W7P A;  2G7U A;  2WAQ A;  3M8E A;  3UKG A;  4ITV A;  2HYJ A;  4IRH A;  3BY6 A;  1SMY F;  5TJJ A;  1XGO A;  2FNP A;  3R4K A;  2ZFW A;  4EEF G;  4LK1 F;  4RDU A;  1E3P A;  2DFH A;  3QYF A;  4CYD A;  1NG6 A;  1U8R A;  4CYC B;  3CUQ A;  1GXQ A;  1XCB A;  3OS1 A;  4XKV A;  2QYO A;  3L2R A;  1AWC A;  2V6C A;  1HCR A;  2KDO A;  2ISZ A;  3PNT A;  2JPB A;  2NOG A;  4XID A;  1WQ2 A;  4WF2 A;  5D4R A;  1J2X A;  3E3V A;  1P7I A;  3ECO A;  3C2G A;  5EG0 A;  2JA8 J;  4YFX F;  2LOO A;  2GOM A;  2HI3 A;  3UR3 C;  2MG4 A;  2EFW A;  4KMF A;  3NWS A;  1REP C;  4CCL A;  3TDU C;  3MN2 A;  3K9T A;  3LA2 A;  1QGP A;  3F3X A;  3R6S A;  1X3Z B;  2CFX A;  1HF0 A;  1ZRD A;  4N4N B;  5GTH C;  1R36 A;  2VIX A;  2VPL A;  2P5K A;  4E70 A;  5AIP A;  3ZQC A;  2XGD A;  1WJB A;  4E6K G;  2FOW A;  3R0J A;  5M3F J;  2ZJ2 A;  2H09 A;  3ZGK A;  1UFM A;  3CCE I;  4NBQ A;  2L02 A;  3K4K A;  2XGE A;  1F43 A;  3RKQ A;  3DBH B;  3ZQG A;  5M3M J;  3CUQ C;  3FF5 A;  5K5R A;  5DM6 F;  1ZAO A;  2VKD A;  1R1T A;  2FF4 A;  3U21 A;  2Y2Z A;  2ECB A;  2DJN A;  2YPR A;  1ETY A;  5ICE A;  4GYI A;  1ZG3 A;  4XRM A;  2KRC A;  5EGO A;  1BIB A;  3FMQ A;  1R1V A;  2DT5 A;  4OIN F;  2EFO A;  1POG A;  3L1P A;  5KNL A;  2MLG A;  2DA7 A;  2WB1 N;  4PJJ A;  4G8X A;  1LPQ A;  4E7L A;  4WXD A;  4A0X A;  1TW2 A;  3F8B A;  2XKP A;  2VL8 A;  3HTU A;  3TW7 A;  1FJL A;  4QIW N;  3G3Z A;  4Y33 A;  4YFK F;  3HTS B;  4KIT B;  1R1U A;  4DQ2 A;  2VOP A;  3MZY A;  4IJA A;  3GZ5 A;  2E1N A;  4E7J A;  1T08 B;  3LSJ A;  5LHH A;  1GUU A;  2PQ8 A;  1R5I D;  3TQN A;  5C4J J;  3J7A O;  4V19 K;  3K0L A;  3KX2 A;  1P2F A;  3SDG A;  2HYF A;  1I27 A;  1SVL A;  1MMD A;  1H0M A;  1IDY A;  5B1A H;  2B63 J;  2XPW A;  2PG4 A;  1F1Z A;  4BE1 A;  5HDG A;  2ZXW H;  2FU4 A;  2C6Y A;  3BR3 A;  3WTX C;  3H9J A;  5E1X A;  3P7N A;  5LBQ A;  3HPG A;  4UB6 C;  4G12 A;  4EJT A;  4C3I J;  3WE3 A;  3H92 A;  3S3N A;  1FLI A;  4E7H A;  4Q48 A;  2RV8 A;  4A3D J;  1U0J A;  3OYN A;  5FLV A;  1JGS A;  3ISP A;  3ZMS A;  2L7M P;  5L3F A;  1FIA A;  2QEN A;  2P0W A;  1FOX A;  4HSR A;  3DPL C;  3JRF A;  3E6B A;  2ECC A;  2XGC A;  2Y9Z A;  4X1E A;  3MQ0 A;  2V9K A;  4EM1 A;  5E8I A;  1HA8 A;  1V5G A;  2R93 J;  5CKT A;  4M9Z A;  1PYV A;  1BOA A;  1YI2 I;  3CF5 F;  3S2H J;  1XCV A;  1DP7 P;  1BN5 A;  1QO0 D;  1JKO C;  4A3K J;  3K7A J;  1U2W A;  2EIK H;  2QUF A;  3EYY A;  5FLM J;  2K40 A;  3RSN A;  1GXP A;  3V4G A;  3G1O A;  1QVT A;  4C2U A;  2DYR H;  4V2G A;  1FSH A;  3G6E I;  2N8G A;  3FX3 A;  4KIG A;  5D4S A;  1R00 A;  2OUM A;  3I4P A;  3GFM A;  1VI0 A;  1QPM A;  4RLF A;  4FET A;  2BXZ A;  5FD6 A;  3IRR A;  1KU2 A;  2R5Z B;  1K7A A;  1IGN A;  2B9S A;  3PQJ A;  1XN7 A;  2M45 A;  2J5O A;  3CLO A;  4CIC A;  2Q2E B;  3DXJ F;  3LAJ A;  1LDJ A;  1H89 C;  3SZP A;  1JUS A;  2Q0O A;  4ABZ A;  4E7Z A;  2DTR A;  4PZJ A;  1JXS A;  3BG3 A;  3EDP A;  4D1Q A;  1IJW C;  2W24 A;  2VOO A;  4OAY A;  3CMA I;  3VYT B;  2V9V A;  2DMP A;  3HSF A;  3ZQF A;  2VQG A;  2X85 A;  4PJL A;  5F04 A;  3WG7 H;  3E5U A;  2NYX A;  3QYB A;  3U2R A;  1H9T A;  4LIV A;  5JHF A;  3HJE A;  2CS3 A;  3HGG A;  4KT5 C;  1IXR C;  3I54 A;  5CLS A;  1ULY A;  2EFP A;  1UAA A;  3HSR A;  3S15 J;  1FP2 A;  5CVJ A;  5EZH A;  5M5Y J;  1XGN A;  3PNV A;  2ZME C;  1DU0 A;  3S8P A;  1W5T A;  2ZO4 A;  3CD6 I;  2OV7 A;  3VB2 A;  3K70 D;  4PFO A;  4OIR F;  3MKW B;  1DP3 A;  1BI3 A;  3IWZ A;  2JVG A;  3VYS B;  2NS7 A;  2Y9Y A;  4V2F A;  3K4B A;  2XAH A;  5HLH A;  4N0B A;  2XSD C;  3G71 I;  2QBY A;  1UEL B;  2Z16 A;  1R49 A;  2M87 A;  4U7D A;  3SJM A;  4A12 A;  3HUG A;  3I59 A;  3HXL A;  3CME I;  2JA5 J;  3BG7 A;  2B0L A;  3JTG A;  5LGT A;  4FTH A;  4AWX B;  5CVU A;  3HDD A;  4P9U A;  5L3D A;  4L5J A;  1SAX A;  4NHJ A;  1Z6T A;  3AAF A;  3ZPL A;  1BJZ A;  3R0A A;  4EV0 A;  2CW7 A;  4XR6 A;  3S1N J;  2BYV E;  2K9Q A;  1VQ5 I;  5EZG A;  3GTQ J;  1H9G A;  3DCF A;  1S5L C;  1X58 A;  1R4M B;  1Z9C A;  1ON2 A;  1BC8 C;  3N05 A;  2QBY B;  3F23 A;  3KP4 A;  4NC7 A;  2HGC A;  5FJ8 J;  3CCJ I;  2MD5 A;  1EH6 A;  1ETO A;  2BY2 A;  2F4O B;  2K5C A;  3CUO A;  1QHH D;  1OYW A;  1EV7 A;  5DDG A;  1P4W A;  3ZMV A;  3PNY A;  3D5R C;  1EKE A;  2IRF G;  1LDK B;  2FBH A;  1AKH A;  1IAW A;  1DQU A;  3I59 B;  3Q0W A;  3I56 I;  1RI7 A;  2OQR A;  2DMQ A;  3OSF A;  2R92 J;  2X1D A;  3JRB A;  2CUE A;  3ZR8 X;  1WSU A;  2W85 A;  4CCN A;  2XGX A;  4L0Z B;  2COB A;  4L9T A;  1VQ4 I;  2EPF A;  1DGR M;  4J00 A;  1UB9 A;  2VQH A;  4JX5 A;  1QU3 A;  4UUS B;  2KPM A;  1I3A A;  3BJA A;  2O6G E;  1YW9 A;  3CCS I;  2HZT A;  2AS5 F;  3A0H C;  3KZZ A;  4C2M J;  3RZD J;  5EEG A;  1SC7 A;  5J8F A;  1S7O A;  1Z67 A;  1WJA A;  5CPR B;  1FOK A;  2AXL A;  5J4V A;  2R0Q C;  1JKR C;  2HYG D;  1R23 A;  2KFD A;  4XKW A;  4DW6 A;  4UUT A;  2M2E A;  2GIV A;  3C7J A;  3PL8 A;  4RLQ A;  2QF7 A;  2R7Z J;  3E6D A;  4LD5 A;  2WAD A;  1AKH B;  3CC2 I;  2BEO A;  2FBI A;  2HKO A;  1Z21 A;  2HS5 A;  1J9I A;  1G8X A;  3CJN A;  3O6B B;  3I0T A;  1G3W A;  2OTL I;  2JZY A;  3WTZ A;  1QQI A;  1I39 A;  2QEX I;  3RQI A;  5HOD A;  4CCM A;  3GLX A;  2XRL A;  4MEX F;  1TNT A;  5HNF A;  2ELH A;  5DM7 F;  4GGG A;  4EMS A;  3LFU A;  1LUJ B;  2D1H A;  3K2Z A;  1OPC A;  2JSP A;  4GO1 A;  2L7F P;  2K27 A;  4LIT A;  5FB2 A;  2X1E A;  2IVM A;  4D0P A;  2Z2S B;  1N77 A;  1OYY A;  3A2K A;  2XPV A;  2DA6 A;  1N78 A;  4AIJ A;  5ILV A;  3RZO J;  4B48 A;  2MGQ A;  3LWF A;  2HDD A;  1HST A;  2QKL B;  2CV0 A;  3RKY A;  3HOY J;  2K4B A;  2GAU A;  3QP5 A;  4HA8 A;  4CO8 A;  1G59 A;  3W2W A;  2HOE A;  1JT0 A;  2X0L A;  2JJ7 A;  2FMY A;  5HLT A;  1M1E B;  3NAR A;  3Q0U A;  3H3Z A;  1OCC H;  2M5W A;  1VQ8 I;  2O9L A;  4JP0 A;  5HVQ C;  5LHI A;  3IHU A;  3PM1 A;  1VQP I;  4EM2 A;  2ICW G;  1ZRE A;  2DPD A;  1OFC X;  1STZ A;  1IRG A;  1F9N A;  5D5W B;  4N9H A;  4BEH A;  4IHT A;  1FMW A;  4DBQ A;  4BQN A;  5F1R A;  2VOD A;  1Y1W J;  1V54 H;  3E7L A;  1WI3 A;  4B43 A;  4KA4 A;  2ZC2 A;  3CZ6 A;  1RPW A;  2OJE D;  3OMY A;  4ENN A;  1T98 A;  4LG0 A;  3BLY A;  4RB1 A;  3OV8 A;  3ZMD A;  3GW2 A;  1D8K A;  3OIO A;  3VOE A;  3H3U A;  1MDM A;  4CDG A;  3FXJ A;  4BDY A;  2QQB A;  3TL4 X;  2FXA A;  2ID6 A;  4ENK A;  3TDZ C;  4LMY A;  1MKM A;  4UNO A;  3KZY A;  2X6O A;  2E35 A;  2QZ8 A;  1X2N A;  3EUA A;  4DOZ A;  2L9V A;  1WJE A;  2DOD A;  2EZH A;  4LB5 A;  4I09 A;  3GTJ J;  1XD7 A;  2F2E A;  3RKW A;  1N25 A;  4IQ4 A;  4L0Y B;  2ZCW A;  2LTP A;  3OIP A;  2WB1 A;  2HEO A;  3GTP J;  2EK5 A;  3V8K A;  1SFE A;  3W6J B;  2UWM A;  4BQO A;  3ABT A;  1P9Q C;  4P1W A;  5LEK A;  2DYS H;  2W00 A;  4BEH B;  1MNM C;  4B3X A;  2VJ4 A;  2LSO A;  3AL0 B;  2CUZ A;  2R7F A;  3QPS A;  2KZG A;  1TQP A;  2O03 A;  4RAZ A;  4DBR A;  5DD4 A;  5K5Q A;  4FIS A;  1R5G A;  5E79 C;  4LG0 B;  3BZK A;  5M5W J;  3WGI A;  3H0G J;  1P92 A;  1I1S A;  1HLV A;  3EPZ A;  1SD4 A;  4I02 A;  2DFI A;  3IAM 2;  1MDM B;  2M34 A;  3HRU A;  1X1B A;  4BKX A;  2OAZ A;  1NG7 A;  3CCQ I;  3GFL A;  5H6Q A;  3RJP A;  1W36 D;  2E1O A;  2QSG X;  3I4M J;  2VJI A;  2OA4 A;  3S3O A;  2ZXJ A;  4AM3 A;  2IS6 A;  3KYL A;  4BJ5 C;  3KE2 A;  1WVR A;  2JQ7 A;  1QA6 A;  3KEQ A;  3HPH A;  4A3F J;  2W7N A;  9ANT A;  5GTI C;  4I99 C;  1QHG A;  3CDL A;  2H94 A;  2P6T A;  3FK6 A;  2E7X A;  3L2V A;  4FE4 A;  2W25 A;  5D5X B;  1TT0 A;  2JRM A;  3OYI A;  1ZEL A;  2KDZ A;  4LG3 A;  1ZK8 A;  2XDV A;  1QZE A;  4A0Z A;  3S32 A;  4O5V A;  3KP3 A;  2DFF A;  2EBI A;  2FD5 A;  3OYE A;  2XAJ A;  5H6R A;  1YO5 C;  3V8J A;  1IW7 F;  3OR2 C;  3S1M J;  2KHM A;  4PSX A;  3Q9V A;  5IOY A;  3OR1 C;  3DU5 A;  4XM3 A;  5JHU A;  2L7K A;  2O7O A;  3KP2 A;  1OCR H;  1LJ9 A;  3QPL A;  3WHB A;  3F72 A;  3OSG A;  1GDT A;  3VOD A;  3HSE A;  5FFX A;  4E4H A;  1RRJ A;  4YEJ A;  5FGM A;  4MTD A;  3F8N A;  4XRS A;  3QRF F;  1B8I A;  3CC7 I;  2XAQ A;  3QU3 A;  2K4J A;  3BG9 A;  2HOS A;  1E17 A;  4C9Y A;  4Y52 J;  4B44 A;  1YTY A;  3BCA A;  2R7W A;  1UG2 A;  4MQ9 F;  3OYC A;  4U87 A;  4KYW A;  4BXX J;  2R7R A;  2OTJ I;  2JSC A;  4Q47 A;  2KL4 A;  4ETS A;  5IY5 H;  4HQE A;  3DEU A;  4F93 B;  3HHG A;  2DW4 A;  4HPQ A;  4AVP A;  4DGW B;  4EAT A;  3LSK A;  1C0W A;  3PSF A;  3FXK A;  1WPK A;  1GT0 C;  4FX4 A;  2STW A;  1AU7 A;  3L2U A;  3F21 A;  2ZJP F;  1D5Y A;  3PUB A;  2CYY A;  4Y7N J;  2OZU A;  1A35 A;  4GXO A;  3CDI A;  2ADU A;  2L9S A;  3I64 A;  1NHA A;  2OD5 A;  2QLZ A;  4ENM A;  1WFX A;  5L3B A;  5E1W A;  3CO7 C;  1UHW A;  4IXA A;  1JJ8 C;  2VB6 A;  3PFY A;  3SDB A;  1B1B A;  1TQM A;  4YIF A;  3I58 A;  1WJ5 A;  3AG3 H;  4KN7 X;  4M72 A;  5J6X A;  2XUB A;  2VE9 A;  5J3L A;  3VEP A;  2E71 A;  1W7P D;  4XQF A;  2I8D A;  4IPA A;  1T8I A;  4YEL A;  4ZTJ A;  2H27 A;  5FD5 A;  1GVJ A;  1WJF A;  4MNU A;  1WHU A;  1KQ9 A;  2EA2 A;  1RR7 A;  3QQA A;  1ETV A;  1SD5 A;  3SQN A;  2CSO A;  3I4N J;  1S3J A;  3EUH C;  1V5F A;  3JSP A;  2MBF A;  3H9G A;  5FFZ A;  1BR2 A;  1YE9 A;  2BY0 A;  2BY3 A;  2H6C A;  2A6T A;  3Q0V A;  3M07 A;  4ASN A;  2ZBK A;  1VFC A;  1O3R A;  2V6E A;  3O8H A;  3F6O A;  3I9V 2;  2A07 F;  4II2 A;  2HKX A;  3OYA A;  1ZKG A;  3RDI A;  3TW6 A;  4MFD A;  4XLF A;  5HNH A;  2W1O A;  1VQ7 I;  2STT A;  2I10 A;  1H8A C;  1TWA J;  4CH7 A;  2MAB A;  3FKI J;  1QZZ A;  1IN8 A;  3HG9 A;  3KP5 A;  3M7G A;  1HBX G;  2CV2 A;  4ZYA A;  1ZG5 A;  3ZQI A;  3LOC A;  3P5J A;  2B7E A;  3JRI A;  2V1U A;  2JTV A;  5CVI A;  4AYB N;  3BZC A;  3A1Y A;  5DS9 A;  2X6Y A;  3DLA A;  1JJ6 C;  1HDD C;  4CGZ A;  3DKX A;  2DI3 A;  1GHC A;  2O61 A;  3TOA A;  1A36 A;  4M9S A;  1IRX A;  1RZ4 A;  3MCZ A;  3LQQ A;  1ZGJ A;  3HRT A;  2F48 A;  3U1D A;  3HZJ A;  1T2K A;  2HQA A;  3PIP F;  3OYH A;  4IHX A;  2XVC A;  2XF6 A;  5KAI C;  3ZMZ A;  1ODD A;  4BHP A;  4Y17 A;  1OCO H;  2RNG A;  5GAE J;  1CF7 A;  2BVL A;  1FNN A;  2LC2 A;  5IYC J;  1X4P A;  5F64 A;  2EZI A;  5CJ9 A;  2E7W A;  2RAE A;  1S7E A;  3WU2 C;  3AKZ A;  1Y8Q B;  2DAO A;  1LVK A;  2XSJ C;  1I6X A;  4XLE A;  3TO9 A;  2PMZ N;  4HG2 A;  1W7P B;  2DDA A;  4PCQ A;  2A61 A;  4QLC U;  2HVS A;  2VI6 A;  4HNU A;  1WJC A;  1Z1D A;  1O7L A;  1APL C;  3BQZ A;  3FZV A;  2E1M C;  4PSW A;  4E7K A;  3I55 I;  1W1W E;  1S29 A;  4IZZ A;  1JE8 A;  2LKX A;  5LLQ A;  4M3B A;  4IOC F;  2V4J C;  5D6E A;  1B4A A;  3OYG A;  5IP6 A;  5J1R A;  3IKV A;  3CUQ B;  5J1Y A;  2A5Y B;  4RM3 A;  3AFH A;  2CV1 A;  2GWR A;  2R7Q A;  1FC3 A;  3VSL A;  3WU0 A;  5KVR A;  2XB5 A;  1NK2 P;  2O0Y A;  2E2J J;  4HF2 A;  3HRS A;  3OL4 A;  1CF7 B;  4RGR A;  4FE7 A;  3Q9S A;  3CCU I;  5EG0 B;  2NVX J;  2YR2 A;  3VSK A;  1T39 A;  2FX0 A;  2DA5 A;  3DQV C;  4B1R A;  1USS A;  4KUM A;  5HS9 A;  2RDP A;  3OL3 A;  3FXR A;  1X2M A;  3BP8 A;  1IDZ A;  4RMN A;  1T56 A;  2FQ4 A;  1FY7 A;  1PUF A;  4I7H A;  1T0F C;  5GAH J;  5IP7 J;  5GPA A;  2HR3 A;  1XMA A;  2JMW A;  3S3M A;  2A05 A;  2K9M A;  3FM3 A;  4B3A A;  2RVC A;  2IEK A;  1G6N A;  1MMG A;  2DU9 A;  1KU9 A;  3OOP A;  3OIQ A;  3IH3 A;  1Z6R A;  2FA5 A;  3T0Y A;  5AIQ A;  2WA0 A;  1Z0X A;  1XDS A;  4NNJ A;  1S7A A;  2JWT A;  2GA1 A;  3REO A;  1XG1 A;  2JUC A;  2HXI A;  2M0M A;  3WTY C;  2PLY A;  2Y30 A;  3F22 A;  4ESB A;  3IH2 A;  3BTC A;  3ABL H;  4A3J J;  1Y39 A;  2WV0 A;  2OC6 A;  4FX0 A;  2HZD A;  2EFQ A;  4LIU A;  3HYI A;  5B1B H;  2V1N A;  3V42 A;  1MSE C;  2Z3Y A;  1X1D A;  4UXN A;  5EGO B;  3GO5 A;  3BDD A;  3M3Y J;  1U8B A;  1BOB A;  2NXN B;  4I0A A;  4A2U A;  1QBJ A;  2KLO A;  3GFJ A;  4BHC A;  1RKT A;  1Z3Y A;  1EH7 A;  1IV6 A;  2LBF A;  2X4H A;  3HOU J;  2DJI A;  4I98 B;  4BU2 A;  2P81 A;  5H20 A;  1TW3 A;  1YYV A;  1FSE A;  2E19 A;  4Q5S F;  2A6H F;  3JRH A;  4BQQ A;  3BTJ A;  3IV5 A;  2R7X A;  1O57 A;  4HQM A;  3VYU B;  4G7H F;  5C4X J;  2XF7 A;  3TBI A;  3L2Q A;  4BE0 A;  4HW0 A;  5LGN A;  5IPA A;  1J0R A;  1IF1 A;  4A3L J;  2FUG 2;  1BI0 A;  1XTA A;  5B66 C;  4IHW A;  1U78 A;  1J59 A;  2RNJ A;  3CCY A;  4IX7 A;  2JA2 A;  5C3E J;  2IGO A;  1IN7 A;  1SFU A;  4EJO A;  1X4O A;  3OYF A;  4EGZ A;  1S72 I;  5E3O A;  2BZT A;  4RB0 A;  3VYR B;  2ZME A;  3CES A;  2VQC A;  3S14 J;  2VQL A;  1J09 A;  3E6M A;  4XSZ F;  2LBF B;  1UZC A;  2LY2 A;  3OYK A;  4XLC A;  3S16 J;  2KRH A;  5AON A;  1IO2 A;  2QCO A;  3GCM A;  3L2W A;  1QPI A;  3DP7 A;  3IP4 B;  5FO5 A;  5D5V B;  3ELK A;  3FWE A;  2NS0 A;  5DTD A;  5J4Y A;  4MQV A;  4CHU A;  3LQR A;  1NH3 A;  1BA5 A;  1IRZ A;  1BR1 A;  4MGR A;  2YSR A;  2QA4 I;  2VAS A;  5J40 A;  2V1X A;  5JLW A;  1LE8 A;  3JW4 A;  2QWW A;  3HOZ J;  2JVH A;  2H8R A;  3E1S A;  4GRI A;  4DYQ A;  1FPQ A;  3W2V A;  4WXH A;  2VE8 A;  1U5T C;  2IT0 A;  1GLN A;  3C3W A;  4LLG F;  2D2W A;  1IUF A;  1XMX A;  2Y75 A;  3LSP A;  1B72 A;  1TWH J;  2EA4 A;  3H0D A;  1S8N A;  2ZME B;  4OIO F;  3CTA A;  2DCE A;  3FHN A;  2HU9 A;  2W84 A;  4XIC A;  2EZL A;  4D5C A;  2WBM A;  2VXZ A;  4Z2Y A;  3MKL A;  1HDP A;  1YIJ I;  1ZHF A;  4OIQ F;  1ZAR A;  5JLX A;  2M9H A;  3DTE A;  1XGS A;  2XAS A;  3AG4 H;  1FMV A;  2L9N A;  1YQA A;  4WCG A;  1UST A;  2CQK A;  1TWF J;  4HV5 A;  1BJA A;  2DTZ A;  1R22 A;  3CO6 C;  4W1U A;  2KIU A;  4HRI A;  1V3F A;  1N75 A;  3VFZ A;  3C18 A;  2XRO A;  4IHY A;  3WTT C;  1A5J A;  4ZYG A;  4EVI A;  3GTG J;  1LKX A;  4KFC A;  1W5S A;  1WH5 A;  1ZGA A;  3LSG A;  1B72 B;  3KFW X;  3GLL A;  3P9I A;  3GTO J;  1Z77 A;  2VBW A;  3SEZ A;  1AOY A;  4BS9 A;  1SMT A;  1VZ0 A;  3OS0 A;  3IKT A;  4OU0 A;  1ETK A;  3DPU A;  4B09 A;  3JR9 A;  4F3Q A;  2ISY A;  2R7D A;  3FIS A;  4A5M A;  4YFN F;  3JCU C;  1LB2 A;  3BWG A;  2RQQ A;  2K85 A;  1IXC A;  1ORK A;  2Y48 A;  1IV8 A;  2R3S A;  2HTJ A;  2ZB9 A;  4F55 A;  3DBL B;  4HX4 A;  2DMU A;  4NDL A;  5D5U B;  1OCZ H;  1X1A A;  3RQ4 A;  4RGX A;  4G7O F;  2YX4 A;  1KYZ A;  4OMY A;  3FM5 A;  2Z1D A;  2FOK A;  3K1M A;  2QVO A;  3BCB A;  1I5Z A;  5FKL A;  3L9F A;  3ROU A;  1MZB A;  3WGH A;  4RB3 C;  1U3E M;  4RAF A;  4E7S A;  1W0T A;  3JRA A;  2D1V A;  1J7K A;  1FP1 D;  2AHQ A;  1KGS A;  3PO2 J;  3LMM A;  3J7Z I;  4EJV A;  2E1C A;  4I2O A;  2ID3 A;  1ZYR F;  4RAY A;  4S04 A;  3RTR A;  2P8T A;  1GV5 A;  3HUG B;  4G6D A;  3KZI C;  1RUO A;  3SEQ A;  2YX7 A;  4IL6 C;  2MLK A;  4BAC A;  4M71 A;  2P4W A;  3J81 Z;  1RES A;  2OPT A;  2XAG A;  3IUO A;  1Y0U A;  3T5X A;  4BDZ A;  2GXB A;  3GBG A;  1JUM A;  3SZG A;  4RS8 A;  1PJR A;  4WK8 F;  2DN0 A;  5EF6 A;  2EV5 A;  4OMZ A;  1K6Y A;  2FE3 A;  2XKO A;  3WHC A;  5L3E A;  4ZH4 F;  1Z91 A;  1KQ8 A;  4M3D A;  1JTX A;  3GXO A;  4GCV A;  5FRO A;  1B6A A;  2DO7 A;  4DZP A;  3I53 A;  4EM0 B;  1EA3 A;  4N4O B;  5LRS A;  3WTS C;  1MJA A;  3R60 A;  1J5Y A;  4BHB A;  3GZ6 A;  5ICG A;  1PP7 U;  1X1P A;  5BPD A;  2LNB A;  1P4X A;  4HF0 A;  4FCY A;  2HVQ A;  4M3F A;  1YOV B;  3CMM A;  3BPX A;  5CQG A;  2EV0 A;  1JKP C;  4LGW A;  3FHZ A;  4ANJ A;  5A2Q K;  4PK4 A;  3ERE D;  1DUX C;  2GIZ A;  4II3 A;  1Z3X A;  2LVS A;  1TNS A;  2EFN A;  2Q1Z B;  5E20 A;  2GZW A;  2CQQ A;  3FXM A;  5K5O A;  4M3G A;  2OCE A;  4A3B J;  5DEQ A;  1MIJ A;  1F36 A;  4IF4 A;  2BXY A;  3BC8 A;  2JA7 J;  3BRO A;  4PDK A;  4XSX F;  1H88 C;  4RA2 A;  2XF5 A;  4XOT A;  3CCR I;  3HKZ N;  3BTL A;  4AYB A;  2JA6 J;  2Z9O A;  3IH4 A;  1ZQ3 P;  3S2W A;  1VQL I;  3N97 A;  4NQW A;  2JN6 A;  4DYR A;  2GM4 A;  2PJR A;  1E0E A;  2A5W A;  1I6H J;  2V26 A;  3V7R A;  1G3Y A;  2EWN A;  2TCT A;  4UHT A;  4XLA A;  3ZXS A;  5J8C A;  4WX9 A;  2DLL A;  1EF4 A;  2CQN A;  2VXD A;  1BI1 A;  3A4C A;  3WOD F;  2BBY A;  1VQ6 I;  5JI6 A;  3H5R A;  1IN6 A;  2LY9 A;  2QKM B;  1UMQ A;  2BW3 A;  5LD2 C;  1P7J A;  3LSI A;  4L9J A;  2ZJR F;  3KP6 A;  2LR8 A;  1OMI A;  5E8G A;  2R5Y A;  2JUG A;  3QU6 A;  1MH3 A;  1IZ1 A;  2F5C A;  1RNL A;  4L5I A;  2M4G A;  3ZQL A;  2ETH A;  4LJZ F;  1PUE E;  4QSH A;  2ZXI A;  4LLL A;  4P55 A;  3LSH A;  5CYV A;  4PJN A;  1UHM A;  2LKS A;  3FMR A;  4P5O A;  2FRH A;  3RPQ A;  1ITY A;  3LSR A;  1D1A A;  2MA3 A;  3WTW C;  2UZK A;  4A3E J;  4DJA A;  1HXD A;  2G7H A;  3M1C A;  1DDN A;  1IXS B;  1A04 A;  1MBJ A;  1YJW I;  2COM A;  3S17 J;  5DUK A;  1YHQ I;  4ZYE A;  1LVA A;  2IGN A;  4XOP A;  4CZC A;  2O8X A;  3K1P A;  2R5Y B;  1FBU A;  2R7S A;  1BW6 A;  1OKR A;  3E97 A;  4NC6 A;  1S6L A;  3QOD A;  2NS8 A;  1HKQ A;  1B59 A;  2DDB A;  1WKM A;  2K3P A;  3KET A;  2K02 A;  5CVR A;  5IYD J;  4CCJ A;  3L00 A;  3BG5 A;  3R61 A;  2EIJ H;  3LNQ A;  2QSF X;  2HNH A;  2LMD A;  3D5L A;  1TP4 A;  2WC2 A;  2VC1 A;  1LEA A;  2JK3 A;  2ZNY A;  2K9L A;  2MSY A;  4CUG A;  3B73 A;  4RGS A;  2K86 A;  4XK4 A;  2HVR A;  2EZK A;  3QWL A;  4F52 A;  1MMA A;  2E5Z A;  4FHT A;  1R5H A;  3V7S A;  5IT9 K;  2KQR A;  2Y31 A;  1KON A;  1BC7 C;  1KA8 A;  1YS7 A;  1TLH B;  3RIR A;  2KZV A;  4HBL A;  5ED4 A;  2TRT A;  3ZQH A;  5LFA A;  4A3I J;  1HW5 A;  3DEE A;  2KKO A;  1HKT A;  3L09 A;  4NC8 A;  1MJB A;  1BL0 A;  2M8G X;  3OYD A;  2DA3 A;  1VQM I;  3KEO A;  1ZR2 A;  5HLG A;  3ECH A;  3DTK A;  3BTI A;  3K69 A;  5KK1 A;  3BOQ A;  1GV2 A;  4PFP A;  1RC9 A;  2VN2 A;  3M8F A;  1GVD A;  2IA1 A;  3O3K A;  4O3M A;  4BXF A;  3WGG A;  2BOL A;  2ZXH A;  2XC7 A;  3TO6 A;  3S1Q J;  2VBY A;  3I5U A;  3SXY A;  2W57 A;  4WXC A;  4HF1 A;  3TP0 A;  4R1H A;  3RYP A;  1UCR A;  5BS6 A;  1ENH A;  1PVE A;  1OCP A;  3J7Y J;  2YS9 A;  1FYM A;  1W0U A;  4AIK A;  4LB6 B;  1XMK A;  3RPU D;  3A01 A;  4XMY A;  3H35 A;  3DLL F;  2LD5 A;  1YRN A;  1G3T A;  2CW0 F;  4MFE A;  2M4K A;  1YIT I;  1WH7 A;  3BJ6 A;  3JSO A;  4XNF A;  4BY7 J;  2A69 F;  3SYT A;  2IA0 A;  2XRN A;  2GA2 A;  3HC7 A;  1X19 A;  2HOT A;  3OYL A;  3HEF A;  1YS6 A;  1XGM A;  4Y3O A;  2VKE A;  2P5V A;  1MBG A;  3LSM A;  1FOY A;  2LG4 A;  1FT9 A;  3PFI A;  2NVY J;  4AVZ A;  3EUH A;  2WWY A;  3P9K A;  5FKO A;  5A2Q Z;  3EQL F;  5FRM A;  4L9N A;  1FYK A;  4XRF A;  3RYR A;  3CP8 A;  2AXT C;  3KLN A;  3NRV A;  3ML6 A;  1E2X A;  2PN6 A;  4KT6 A;  1G3S A;  2IBD A;  2HPM A;  3WG9 A;  1JHF A;  1VQO I;  4HST A;  2Y0S N;  3A01 B;  1YRN B;  3RPU A;  3FKJ A;  4UY8 I;  2KP6 A;  1LFB A;  5HDK A;  1KU7 A;  1DU6 A;  1WGX A;  2HWV A;  2HTS A;  1ONV A;  3D1N I;  3GME A;  5HDN A;  3K4C A;  1ZN2 A;  1XS9 A;  2FBK A;  1B8I B;  3Q5F A;  1FEX A;  2EIL H;  4A5N A;  2VKH A;  4BJ6 C;  3W2A A;  1LEB A;  5F1J A;  1JHH A;  2GBY A;  2XIG A;  2K9S A;  3SFI A;  1MBE A;  2KIF A;  3G1M A;  3HOW J;  2DA4 A;  5HS7 A;  2XAU A;  2Y0M A;  3ONQ A;  3M9A A;  3CJR B;  3F0C A;  4MEY F;  4AIH A;  2JT1 A;  1K61 A;  1VQN I;  2DMN A;  1KQ0 A;  2ELJ A;  2QQA A;  3DKY A;  1UG0 A;  3QP6 A;  2PEX A;  1LQ1 A;  2PBI A;  3FK7 A;  1SAU A;  2CG4 A;  3DKW A;  2H8W A;  1Y1V J;  1D3Y A;  3MMY B;  4PJ0 C;  5ILU A;  4I0B A;  1O3T A;  3B02 A;  4QPO A;  2W48 A;  2R7U A;  3ABU A;  2ACJ A;  1BR4 A;  5J47 A;  2VKV A;  3QOE A;  2K7L A;  4FQG A;  2E60 A;  4XLH A;  3HRM A;  4Y4R A;  2VC0 A;  3CCM I;  5EDN A;  3K1N A;  3GFI A;  5E17 F;  2CW8 A;  4OAZ A;  5E1Z B;  1X1C A;  5DCF A;  4F91 B;  5BOX A;  5F0F A;  2UXN A;  3G1L A;  1VQ9 I;  3HL2 A;  4BE2 A;  4C3H J;  2DA1 A;  1SFO J;  2CUJ A;  4N9I A;  3K4M A;  3HOS A;  2KIS A;  5F08 A;  3PUF A;  1SVM A;  4BBR J;  1Q1H A;  4AUX A;  3ULQ B;  1D5V A;  2MC4 A;  1T33 A;  4D7M A;  2KIM A;  4A69 C;  2RKH A;  2F5D A;  1IN5 A;  3BG6 A;  1R4N B;  3MWM A;  4AD9 A;  4YII A;  3MVP A;  1ZGW A;  1D0Y A;  3K6G A;  3LA7 A;  5IT9 Z;  1W4M A;  3DU6 A;  4TV7 A;  2E1M B;  1T0F A;  4L9V A;  2FQ3 A;  2NAZ A;  4G7Z F;  1F5T A;  4LLN A;  4U0Y A;  3U9G A;  3HM5 A;  4J19 A;  2HDC A;  5CQE A;  4XLN F;  4ZYH A;  2LRE A;  2KJB A;  4UVC A;  4A0Y A;  2R7T A;  5F0H A;  3FDY A;  4I6Z A;  3SZT A;  2Z5U A;  5F27 A;  4CA0 A;  4G6Q A;  5FLX Z;  2K9N A;  3BJO A;  4ESF A;  3FBI B;  3JRD A;  3E0J B;  3QPT A;  2O8K A;  4IHV A;  4JX4 A;  3VWB A;  3NAU A;  3WE2 A;  2RN7 A;  3TOB A;  4CCK A;  2OU2 A;  1BBY A;  1Z05 A;  1ON1 A;  1D0Z A;  4HDV A;  5EEH A;  2UXX A;  2M7A A;  1FTZ A;  5GAG J;  2EIN H;  5D8L B;  1EH8 A;  3BR1 A;  3J80 K;  1Z7L A;  2DQR A;  2V9P A;  4ENJ A;  4ZJZ A;  1S9H A;  2DA2 A;  3H1C A;  5JVG F;  1K79 A;  5E3L A;  1Y0N A;  5BQT A;  2HQ5 A;  2M0C A;  5L3G A;  2NOJ B;  3G2B A;  3JAM K;  1JKQ C;  3WTV C;  5TRD A;  1XX5 A;  4EGY A;  3HKZ A;  3NEU A;  3OS2 A;  4AU7 A;  5C44 J;  1ZRC A;  5B3S H;  3GTK J;  4IO9 F;  1JTY A;  4LFU A;  2A6E F;  3LFK A;  4LOC A;  4PGG A;  5D6F A;  2DOF A;  2HDW A;  5KHD A;  2XHK A;  1MH4 A;  3O8G A;  2IXS A;  3EUK L;  2EJR A;  4UV9 A;  2L0K A;  3J7A Y;  3M4O J;  2F5V A;  1ETQ A;  5TIS C;  4M6Y A;  3J81 K;  2RRE A;  2KT0 A;  2LF8 A;  2LKP A;  2P7V B;  4PUS A;  4CCO A;  1XC5 A;  2MH9 A;  1IN4 A;  2DMT A;  1OYI A;  3RI4 A;  1CGP A;  3K4L A;  1HW2 A;  1E3O C; 
#chains in the Genus database with same CATH homology
 2FJ1 A;  1PUF B;  3OIO A;  1CQT A;  1OJL A;  2VPR A;  3S2D J;  1FTT A;  2AO9 A;  2E2H J;  2ID6 A;  1UHS A;  1OCT C;  2X6O A;  5FKL A;  1X2N A;  5IYB J;  4A3C J;  5GPC A;  3BR0 A;  2EZH A;  3GTJ J;  3JRA A;  3BQY A;  1W0T A;  2AHQ A;  3PO2 J;  3B6C A;  3H3V K;  2LTP A;  4CYC A;  3DEW A;  3GTP J;  4X6A J;  3CQZ J;  3JRG A;  2ID3 A;  1A6I A;  2LK2 A;  2ME0 A;  1GV5 A;  3A03 A;  1MNM C;  2NVQ J;  3BT9 A;  3QPS A;  2EQR A;  1RES A;  2OPT A;  4A3M J;  1IG7 A;  4FIS A;  1AHD P;  3GBG A;  3TED A;  1JUM A;  5M5W J;  5E3N A;  3H0G J;  3C2B A;  5EYR A;  2DN0 A;  5EF6 A;  1HLV A;  2HXO A;  3WHC A;  2M34 A;  2GLO A;  4M3D A;  4BKX A;  2R5Z A;  1JTX A;  3UKG A;  2HYJ A;  2E1O A;  4DZP A;  3I4M J;  2CRG A;  4EEF G;  4RDU A;  1ETX A;  4D5F A;  2WV1 A;  5K7F A;  4CYC B;  4M3F A;  4FCY A;  2L7Z A;  4A3F J;  1JKP C;  9ANT A;  3CDL A;  2LVS A;  1HCR A;  3FK6 A;  2NOG A;  4XID A;  4FE4 A;  4A3B J;  2CQQ A;  4M3G A;  1F36 A;  2KDZ A;  2JA7 J;  1P7I A;  4BY1 J;  1H88 C;  1ZK8 A;  5EG0 A;  2JA8 J;  2HI3 A;  2MG4 A;  3HKZ N;  3BTL A;  3GTM J;  2JA6 J;  3MN2 A;  2EBI A;  1MBH A;  2FD5 A;  3IH4 A;  1ZQ3 P;  2LLK A;  3S1M J;  2JN6 A;  4DYR A;  5IOY A;  2GM4 A;  1HF0 A;  1QRY A;  1I6H J;  2O7O A;  2TCT A;  3WHB A;  3QPL A;  3OSG A;  1GDT A;  3ZQC A;  2XGD A;  1JUP A;  1B8I A;  1TC3 C;  4XRS A;  1EF4 A;  4B4C A;  3BG9 A;  2HOS A;  5M3F J;  5IP9 J;  4Y52 J;  2LY9 A;  1LE8 B;  1UMQ A;  1UG2 A;  1O4X A;  1P7J A;  4BXX J;  2LR8 A;  2R5Y A;  1MH3 A;  2XGE A;  1F43 A;  3RKQ A;  2CUF A;  3ZQG A;  5M3M J;  3ZQL A;  1SAN A;  5K7H A;  4QSH A;  1WPK A;  2Y2Z A;  2ECB A;  2HOA A;  2DJN A;  1GT0 C;  1AU7 A;  3GTL J;  4XRM A;  1ETY A;  1D5Y A;  4Y7N J;  5EGO A;  2D5V A;  1U9O A;  1POG A;  3L1P A;  1ITY A;  3LSR A;  2DA7 A;  2WB1 N;  4A3E J;  5BNG A;  1JJ8 C;  3A02 A;  1MBJ A;  4BBS J;  3S17 J;  3TW7 A;  1FJL A;  4QIW N;  1BW5 A;  2X9D A;  5J3L A;  2R5Y B;  1BW6 A;  3LSJ A;  1GUU A;  4A93 J;  2NS8 A;  3QQA A;  1RR7 A;  5C4J J;  1ETV A;  2WAQ N;  3B6A A;  5IYD J;  2EH3 A;  3I4N J;  3SDG A;  3BG5 A;  3LNQ A;  1MBF A;  1IDY A;  2B63 J;  2JK3 A;  2MSY A;  2XPW A;  3BR5 A;  3CMY A;  4XK4 A;  3Q0V A;  1VFC A;  2EZK A;  3BR3 A;  3O8H A;  3HGY A;  2CJJ A;  2XB0 X;  2Y31 A;  4G12 A;  4C3I J;  4UUS A;  1ZKG A;  3TW6 A;  3HB9 A;  4MFD A;  2TRT A;  4A3D J;  3ZQH A;  2I10 A;  4A3I J;  1TWA J;  1H8A C;  2YU9 J;  3FKI J;  1Q1V A;  5FLV A;  2XPU A;  1NK3 P;  2L7M P;  3LOC A;  1FIA A;  3ZQI A;  1BL0 A;  2M8G X;  3JRI A;  2DA3 A;  3JRF A;  2ECC A;  2XGC A;  4L5E A;  4AYB N;  4X1E A;  2Y9Z A;  5DS9 A;  1ZR2 A;  3BTI A;  1JJ6 C;  1GV2 A;  1HDD C;  2R93 J;  1GVD A;  3S2H J;  2ME6 A;  5GP9 A;  1JKO C;  4A3K J;  3K7A J;  3S1Q J;  4IHX A;  5IOZ A;  5EEA A;  1LFU P;  2NVT J;  3TP0 A;  5FLM J;  2K40 A;  5E3M A;  3G1O A;  1ENH A;  1QVT A;  4V2G A;  1JT6 A;  2ELK A;  1OCP A;  2N8G A;  2YUS A;  2YS9 A;  5IYC J;  3FIW A;  1W0U A;  2EZI A;  1VI0 A;  4M6V A;  2RAE A;  1S7E A;  1MBK A;  3A01 A;  1VF9 A;  2PMZ N;  2LD5 A;  1YRN A;  2R5Z B;  4MFE A;  1WCM J;  1IGN A;  2VI6 A;  1WH7 A;  1APL C;  3BQZ A;  4BY7 J;  2LKX A;  1H89 C;  4M3B A;  1JUS A;  4ABZ A;  2VUM J;  2HOT A;  5IP6 A;  5J1R A;  4AC0 A;  4MIM A;  3BG3 A;  3HEF A;  1VND A;  5FKK A;  5J1Y A;  2VKE A;  1I3Q J;  1MBG A;  1IJW C;  4A3G J;  2NVY J;  3K2A A;  2XB5 A;  5FKO A;  2DMP A;  1NK2 P;  3ZQF A;  5F04 A;  2E2J J;  5FKM A;  4FE7 A;  4W97 A;  5EG0 B;  2NVX J;  3HGG A;  2FX0 A;  2IBD A;  2DA5 A;  4B1R A;  3S15 J;  2Y0S N;  1HOM A;  3A01 B;  3S1R J;  1YRN B;  5EZH A;  5M5Y J;  1X2M A;  3JRE A;  1DU0 A;  1IDZ A;  1T56 A;  2FQ4 A;  1PUF A;  1LFB A;  5IP7 J;  1DU6 A;  1WGX A;  5GPA A;  3D1N I;  2JMW A;  1XS9 A;  3HBL A;  4B3A A;  1ZTR A;  2NS7 A;  2Y9Y A;  1B8I B;  4V2F A;  2IEK A;  1FEX A;  2XSD C;  3IH3 A;  5F1J A;  4IEJ A;  2GBY A;  2K9S A;  3SFI A;  1MBE A;  3HOW J;  3G1M A;  1Z0X A;  4RBO A;  2DA4 A;  2JWT A;  2LP0 A;  1XG1 A;  2HXI A;  1QVU A;  5K7Z A;  3SJM A;  3F0C A;  3TP3 A;  2Y30 A;  1K61 A;  2JA5 J;  2DMN A;  3IH2 A;  3BTC A;  4A3J J;  3BR6 A;  4FTH A;  1U9N A;  3FK7 A;  4HNV A;  1MSE C;  3HDD A;  1Y1V J;  5EGO B;  1JGG A;  3M3Y J;  1U8B A;  1BJZ A;  3S1N J;  2K9Q A;  5EZG A;  3GTQ J;  1X58 A;  2W48 A;  3DCF A;  4M3E A;  2G0E A;  1RKT A;  2E2I J;  2VKV A;  1IV6 A;  3HOU J;  1FIP A;  4S0H B;  5J1U A;  2P81 A;  5FJ8 J;  2E19 A;  5EDN A;  1ETO A;  1I50 J;  3ZOB A;  3JRH A;  3IV5 A;  3BTJ A;  4D7N A;  5C4X J;  1E3O C;  5F0F A;  1AKH A;  3G1L A;  4DZJ A;  1TWG J;  3Q0W A;  4DYC A;  2MW8 A;  4I76 A;  4C3H J;  2DA1 A;  5IPA A;  2DMQ A;  4A3L J;  1SFO J;  3OSF A;  2R92 J;  3JRB A;  2CUE A;  4JYK A;  5F08 A;  4GFB A;  4BBR J;  4IHW A;  4AUX A;  1U78 A;  1T33 A;  2COB A;  4D7M A;  3CCY A;  4A69 C;  5C3E J;  1ZGW A;  5E3O A;  3MVP A;  4JX5 A;  1NTC A;  1TWC J;  4UUS B;  3VPR A;  5FKN A;  1ETW A;  3S14 J;  4C2M J;  3RZD J;  3HOV J;  3BR2 A;  2R0Q C;  3HM5 A;  4J19 A;  1JKR C;  3S16 J;  2QCO A;  3Q3S A;  4UUT A;  2M2E A;  4DW6 A;  1QPI A;  1ZR4 A;  2QF7 A;  4MLO A;  1RKW A;  5DTD A;  2R7Z J;  3W6V A;  5F0H A;  2OF7 A;  3OOU A;  1BA5 A;  1IRZ A;  1AKH B;  4I6Z A;  5F27 A;  5JLW A;  3PO3 J;  1LE8 A;  4C3J J;  3HOZ J;  2K9N A;  2H8R A;  1K83 J;  4DYQ A;  3JRD A;  2IAI A;  2O8K A;  4IHV A;  4JX4 A;  5M5X J;  3RQI A;  5HOD A;  2CQX A;  1IUF A;  3NAU A;  2XRL A;  2H1K A;  3LSP A;  5F0C A;  1B72 A;  1TWH J;  2L7F P;  1IC8 A;  4MO7 A;  1FTZ A;  2X48 A;  3BR1 A;  4XIC A;  2EZL A;  4D5C A;  2XPV A;  2DA6 A;  3RZO J;  3MKL A;  1HDP A;  2MGQ A;  2HDD A;  2DA2 A;  5JLX A;  2M9H A;  5E3L A;  3HOY J;  2HQ5 A;  2M0C A;  1JKQ C;  1MSF C;  1TWF J;  1JT0 A;  2DTZ A;  2JJ7 A;  4W1U A;  2CU7 A;  1G2H A;  5C44 J;  4IHY A;  3NAR A;  3Q0U A;  3GTK J;  1A5J A;  1JTY A;  3HOX J;  4QTR A;  3GTG J;  4LOC A;  2O9L A;  4JP0 A;  3PM1 A;  1RET A;  1MH4 A;  1WH5 A;  3LSG A;  3O8G A;  1B72 B;  1OFC X;  3GTO J;  1Z77 A;  2L0K A;  3M4O J;  1ETK A;  1ETQ A;  2L9R A;  3JRC A;  3JR9 A;  4JX6 A;  2LFB A;  3FIS A;  4XRS G;  1Y1W J;  2KT0 A;  1R9T J;  3E7L A;  1WI3 A;  1ORK A;  1XC5 A;  2DMT A;  1RPW A;  2ZB9 A;  2DMU A;  4NDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...