2MW8A

Solution structure of satb1 homeodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
NRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein SATB1
publication title Solution structure of SATB1 homeodomain
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2mw8A00
1W0UA 3WHCA 3A03A 3BR0A 1JGGA 1FEXA 1FIAA 3ZQFA 4V2FA 5E3LA 1UHSA 4MLOA 3L1PA 1HLVA 1JKOC 2Y2ZA 4MFDA 2XRLA 1B72B 1RETA 1U78A 3S14J 2L7FP 3NARA 2B63J 2XPWA 3BQYA 3HOZJ 5GPCA 5JLXA 4FISA 3JRFA 1BJZA 1OCTC 2LY9A 3S1RJ 1WI3A 2NVXJ 2QCOA 4JX5A 2CU7A 5FLMJ 1UG2A 5DTDA 2W48A 5K7HA 3K2AA 2NVYJ 1RR7A 3PM1A 1ITYA 4DYCA 5FKLA 2IAIA 1GVDA 2R5YA 1AU7A 1T56A 5JLWA 2LKXA 3Q0WA 3DCFA 4JX4A 3ZQHA 3I4NJ 3Q0UA 4RDUA 4IHYA 1U9NA 1TWGJ 2PMZN 4BKXA 4C3JJ 5EG0A 2N8GA 3FISA 3BG5A 3CCYA 3BTJA 1MBJA 3BTCA 4HNVA 5J1RA 3A02A 2EZHA 3HOWJ 1PUFA 1ZR4A 3BG3A 3HBLA 1Y1WJ 3BR5A 4V2GA 1HOMA 5EYRA 1DU0A 1XS9A 2LR8A 1TC3C 2GLOA 2DA1A 3SDGA 2X9DA 2O8KA 3G1LA 1X2MA 4C3IJ 2M0CA 2XB5A 3LSJA 3S1NJ 5IP6A 5EZGA 5IOZA 1GV2A 3FK6A 3K7AJ 2DA7A 2K40A 2CRGA 2L7MP 5E3OA 2MGQA 2WV1A 3B6CA 1HCRA 2HYJA 3MKLA 2M34A 3IV5A 1W0TA 2JJ7A 3DEWA 2O9LA 1ETVA 1FTZA 2E2JJ 2O7OA 1X58A 5J1YA 1TWFJ 4A3IJ 2R0QC 1K61A 5HODA 2R5YB 4XRSG 2L9RA 2DMQA 4D5FA 2MW8A 3OSGA 2Y30A 2K9NA 2L7ZA 4MIMA 4XRSA 2Y9ZA 2HI3A 3BTLA 2JN6A 1XC5A 1FJLA 4A3CJ 4DW6A 2E2HJ 2ID3A 3TW6A 4XRMA 1WGXA 2MG4A 5EG0B 2KT0A 2TRTA 3HM5A 4A3FJ 1JUMA 4LOCA 3UKGA 4IHXA 3JRIA 4D7MA 2R93J 2QF7A 4AC0A 1ENHA 1PUFB 1CQTA 1BL0A 2HQ5A 3HGYA 5J1UA 2DMUA 2E1OA 3OOUA 4M3DA 3E7LA 5E3NA 4XICA 3S15J 2LFBA 1JJ6C 2EQRA 1MH3A 4A69C 1DU6A 2H8RA 1MSFC 1QPIA 1NTCA 1P7IA 1S7EA 3S1QJ 1TWCJ 3IH2A 2XPUA 1JUSA 1JJ8C 2DMNA 2M9HA 2AO9A 5DS9A 1JKPC 4AUXA 2JA6J 1TWHJ 3LSGA 4QTRA 1B8IA 2G0EA 3LOCA 1JTXA 2I10A 2Y31A 5FLVA 3I4MJ 1VI0A 2XSDC 2EZKA 2P81A 2ZB9A 2R5ZA 4Y52J 4B1RA 1H88C 1XG1A 1SANA 5IP7J 2VUMJ 2Y0SN 2DMTA 1F43A 4A3EJ 1MBHA 3BTIA 3MN2A 1U9OA 4A3KJ 2JA7J 2JWTA 5F04A 5F0HA 3Q0VA 5F0CA 4C2MJ 2DA2A 1SFOJ 5K7FA 1P7JA 4BY7J 3FIWA 1A5JA 2EH3A 1MBEA 3H3VK 3JRCA 5EEAA 3JRHA 5FJ8J 4A3MJ 1I6HJ 2DMPA 2ECBA 3Q3SA 3TP3A 5M3MJ 2KDZA 2DA6A 2JMWA 5EF6A 4BBSJ 1LFUP 2L0KA 1JT6A 5J3LA 2DTZA 5F08A 3BG9A 2EZIA 5BNGA 5C3EJ 2LTPA 1R9TJ 4FTHA 1B8IB 2ME0A 3JRBA 2LK2A 2JK3A 1ETOA 3LNQA 2NVTJ 1RPWA 3QPSA 3GTKJ 2VKEA 1RKTA 3W6VA 4D7NA 2JA8J 5C4JJ 3GTMJ 2R5ZB 2HXIA 1IGNA 2LP0A 1LE8A 3SJMA 1OJLA 1ZGWA 5F27A 5IP9J 9ANTA 4XK4A 2DA5A 4IHWA 3TP0A 2ECCA 4M3GA 1BA5A 4B3AA 2M2EA 4MFEA 3ZOBA 3GTGJ 1JKQC 1ETQA 1ZTRA 1H8AC 1D5YA 1MH4A 3ZQLA 2DJNA 1APLC 2WB1N 1IDYA 2HDDA 2K9QA 3SFIA 3TEDA 2ME6A 3BT9A 5E3MA 2DN0A 1MBFA 1HF0A 2XPVA 3ZQIA 1H89C 1NK2P 2COBA 3CMYA 1VNDA 3NAUA 5M5XJ 3RQIA 5FKOA 5IYDJ 1UMQA 4AYBN 1ZKGA 5EGOA 1AKHA 3GTOJ 4I76A 1QVUA 3VPRA 1I3QJ 5IYBJ 1IJWC 3MVPA 4M3EA 3RZOJ 1HDDC 3B6AA 4RBOA 4W97A 1IV6A 1VFCA 1OFCX 2R92J 3PO3J 3LSPA 1LFBA 1IRZA 2CUFA 2ID6A 1LE8B 2M8GX 2K9SA 1IDZA 2CJJA 2XGDA 4DYRA 5GP9A 3HOYJ 1YRNA 3HOUJ 1F36A 2ELKA 2MSYA 1BW5A 1A6IA 4UUSA 3TW7A 3CQZJ 4D5CA 3C2BA 4M3FA 3G1OA 5K7ZA 1OCPA 1Z77A 3JR9A 1T33A 4QSHA 3M3YJ 2CUEA 4FE7A 3A01A 3HB9A 3JRAA 1WPKA 3O8HA 4A3BJ 2OF7A 5C44J 3OIOA 5IPAA 1VF9A 2FX0A 1GUUA 2XGCA 3GBGA 4JP0A 1MBKA 2CQQA 4L5EA 3HOXJ 1O4XA 2XB0X 3FKIJ 1X2NA 5EGOB 1QRYA 4XIDA 3FK7A 1TWAJ 1RKWA 5M5YJ 1JT0A 2GBYA 1AKHB 4EEFG 4NDLA 4JX6A 2LD5A 3O8GA 2FJ1A 3QQAA 5EZHA 4A3GJ 1EF4A 3LSRA 2TCTA 3BR1A 2D5VA 1POGA 3JRDA 3G1MA 1WH5A 1Y1VJ 3GTPJ 1FTTA 1GDTA 2EBIA 3JREA 1AHDP 2YS9A 1JUPA 2FQ4A 4G12A 4BY1J 3QPLA 1MSEC 3F0CA 2NS7A 4A3JJ 2FD5A 3HDDA 4CYCA 1Z0XA 3D1NI 1U8BA 2E19A 3JRGA 4IEJA 2VI6A 5IOYA 1YRNB 3HOVJ 3M4OJ 4M3BA 3RKQA 5FKKA 4UUSB 2R7ZJ 4X6AJ 4QIWN 1BW6A 3IH4A 4GFBA 1GV5A 1MNMC 1ORKA 3BQZA 2EZLA 3PO2J 4S0HB 4BXXJ 3A01B 1IUFA 2VKVA 2X6OA 5FKMA 1IG7A 3CDLA 2NOGA 5F0FA 4I6ZA 3S17J 4J19A 2VPRA 2CQXA 2H1KA 2GM4A 1G2HA 1MBGA 3BR3A 1E3OC 2AHQA 3IH3A 3S2HJ 4MO7A 4Y7NJ 2NS8A 5C4XJ 4FCYA 2DA3A 1K83J 3ZQGA 1HDPA 5F1JA 4A3DJ 4X1EA 1WH7A 2LLKA 4A3LJ 4C3HJ 2NVQJ 2HXOA 2IEKA 4IHVA 5GPAA 1B72A 3RZDJ 1ETYA 2LVSA 1JKRC 5IYCJ 3HEFA 3H0GJ 3HKZN 2JA5J 1I50J 4DYQA 3BR6A 4A93J 3ZQCA 2E2IJ 1ETKA 4DZJA 3HGGA 3GTJJ 1ZK8A 3S1MJ 4BBRJ 1QVTA 1ZR2A 2IBDA 4DZPA 1ZQ3P 4CYCB 2X48A 2OPTA 2XGEA 1Q1VA 2HOSA 4W1UA 3S2DJ 5FKNA 3GTLJ 3BR2A 1FIPA 3OSFA 3WHBA 2WAQN 1GT0C 5EDNA 4ABZA 4JYKA 1RESA 4FE4A 2Y9YA 2HOTA 2YU9J 2HOAA 3GTQJ 1NK3P 1JTYA 1WCMJ 2DA4A 4M6VA 5M5WJ 1IC8A 1ETXA 5M3FJ 4UUTA 4B4CA 2RAEA 3S16J 2YUSA 1ETWA
chains in the Genus database with same CATH superfamily
1FP2A 4M74A 3O3KA 3WHCA 3A03A 1JGGA 4IKFA 2X85A 3HRTA 2GXBA 3ZQFA 2GAUA 1GVJA 3S8PA 1FOWA 1MMNA 4I02A 1SFXA 3CZ6A 4PZJA 3CCRI 1B72B 2YX7A 3J7AO 5KAFC 1U78A 2VB6A 2MH9A 2B63J 2W82A 4M72A 4FISA 1ZG5A 4CCJA 4DGWB 3S1RJ 4Y33A 3F72A 4JX5A 4XLEA 1MKMA 1UG2A 4M73A 5FLMJ 3FHZA 2KLOA 3K2AA 5HDNA 1RR7A 1AWCA 1ITYA 1IO2A 1TT5B 4FETA 3C7JA 4BHBA 1T8IA 1FPQA 2Z33A 1DP7P 3BROA 2M4KA 5L3GA 3M07A 1BC7C 1FZPB 3SEZA 3ZQHA 3VSKA 4E6KG 5GTIC 5HLGA 1IXSB 1N25A 5H20A 3T5XA 1BI0A 3I71A 5E20A 2Q8KA 3KPHA 3CLQA 4I09A 3FISA 3BG5A 5CLSA 5J1RA 2QA4I 2EZHA 3C18A 3A4CA 4RB0A 3BG3A 3HBLA 2D1VA 4BDYA 4ENJA 2BXYA 2VL8A 4GO1A 1H9GA 4LD5A 1XS9A 1YS7A 2TDXA 1UZCA 3CO6C 4BQQA 4BGDA 5L3CA 5IT9Z 3SDGA 2X9DA 1OKRA 1SEUA 3GLLA 5J4VA 2EK5A 2O8KA 3E6MA 1ZAOA 3G1LA 5EJCA 3JTGA 3QWLA 4EJVA 4C3IJ 2XB5A 1GV2A 3BJOA 1RI7A 4NB5A 1XCVA 3ECOA 2CRGA 4D1QA 2KL4A 4YFKF 2VBWA 2OD5A 3M1CA 4Z2YA 3IV5A 1UFMA 2L9NA 2ZNZA 4EQQA 2XDVA 2UXXA 2HQRA 4A3IJ 2H6BA 2GWRA 2R7TA 5HODA 2R5YB 1OCCH 5KVRA 1YX3A 1XMXA 2L3DA 1VQPI 4XRSA 5CVIA 2DXIA 4HDVA 1XC5A 5K5OA 1TP4A 4A3CJ 4DW6A 2L9VA 3DTEA 3TW6A 4KITB 2ZJ2A 4IL6C 2KT0A 4OIPF 4A3FJ 1ZN2A 4G6TB 1YOVB 3FXQA 2VQHA 3DKWA 3ERMA 2R93J 2RDPA 2HQAA 3SDBA 1ENHA 1DP3A 2EFWA 3FMRA 2COMA 2X0LA 3HGYA 3GF2A 2NAZA 4KFCA 3S15J 3E7LA 4UNOA 2LFBA 1JJ6C 1ZLKA 2EQRA 1XX5A 3P5JA 3QOPA 3SFZA 2VBXA 1P7IA 1S7EA 4HX4A 1LPQA 2DMNA 2QYOA 2HFHA 2AO9A 1SVMA 1NHAA 2V26A 2KKOA 1OCZH 5L3DA 4AUXA 3K4CA 3M1EA 4RMNA 4QTRA 1Y39A 2WTEA 2G0EA 2JPCA 3GFJA 3IAS2 3I4MJ 2XSDC 3I3LA 1EA3A 4PFPA 2KIMA 4ETSA 5IP7J 3EDPA 2LKPA 3OYLA 2DMTA 1I27A 2CW7A 3BTIA 1ZRFA 4G8XA 5LBQA 4BQOA 1P4XA 1MJ9A 4D0PA 3Q9VA 3BCBA 1O7FA 1G3WA 3I59A 1FWZA 2DA2A 2K02A 2NYXA 1P7JA 1DPUA 1PVEA 3CDIA 3KEYA 3FIWA 1TW3A 3X2QH 5ILSA 1P2FA 2CFOA 5E8IA 2EH3A 1MBEA 2Z1DA 2GIVA 2KMUA 3WTVC 2NRAC 3Q3SA 2IRFG 5M3MJ 5HOOA 5E17F 3BJAA 2DA6A 2Y0SA 3ABTA 5EF6A 4HDUA 3DKYA 1LFUP 3CCMI 2L0KA 2LBFA 1HKTA 3I9V2 4KYWA 1TBXA 3NEUA 5DUKA 5E18F 2EZIA 5CJ9A 2L4MA 3D5RC 2VLAA 4XLNF 1LEAA 4LG0B 2BOLA 1L0OC 2BXZA 3ZR8X 4E4HA 1R9TJ 4FTHA 2ME0A 4O6JA 2JK3A 2VKEA 2BY2A 5BS6A 3DKXA 1D0XA 1VQ5I 1KQ9A 1R58A 3DV8A 3HG9A 2FOWA 3V42A 2M4GA 2XGXA 4HSTA 2VN2A 4F3QA 3E5UA 3EUAA 2D2WA 2KP6A 1OJLA 3CTAA 9ANTA 4XK4A 4IHWA 3ABMH 4ZDLA 5LEKA 3OOPA 2ECCA 4M3GA 3ZOBA 3GTGJ 1U8RA 1ETQA 1MH4A 1F9NA 3OYMA 1IDYA 4CH7A 3TEDA 5DM7F 3H35A 5EEHA 1W7PB 2XAUA 3J7YJ 1CGPA 1G3TA 2ZMEA 1HF0A 4LLNA 2XROA 2XPVA 1J59A 2P5KA 3PFIA 2JVHA 1H89C 3CDHA 2COBA 2KHMA 3EYIA 1VNDA 3HPGA 1EKEA 1LDJA 3CUQA 5J47A 1ZGJA 5FKOA 3OYJA 2R7VA 2K3PA 5LHHA 4AIDA 3MZHA 4PJLA 3V4GA 1FSEA 3KP5A 4L9JA 3H5RA 4KDPA 2DI3A 4XLFA 3PNTA 1K78A 2O03A 3CD6I 1KZHA 2GA1A 3V7RA 1I3QJ 2F4IA 3SZPA 1HSJA 1I1GA 2DBBA 2E35A 2FMYA 2O5RA 3MVPA 2HR3A 4PUSA 3OYAA 1VQ9I 3GX4X 1MNDA 3R4KA 4BL0B 4KT6A 3G6EI 3CMAI 4ESBA 1KU2A 5B1BH 3EUHC 3LSPA 3K1PA 5IT3A 2DPUA 3I54A 3UNGC 2K9SA 5FROA 2QVOA 4ZYEA 1F1ZA 1SVOA 3C2GA 1B6AA 2A05A 1IF1A 1R00A 1LFPA 1F36A 4XN0A 1A31A 1VQ4I 3RJPA 3WU1B 4UUSA 4KN7X 2ELHA 3DWLE 4D5CA 5DYMA 1U6GA 4UV9A 2W84A 3G1OA 2STWA 3L2UA 1T33A 4XOPA 1X1DA 4IRGA 2JRTA 2OU2A 4KUMA 2PBIA 3M7GA 5LD2C 3BPVA 4B44A 2W00A 3VOEA 3OYBA 3RKWA 4QPQA 1K79A 4A3BJ 1W36C 3DBHB 1YS6A 2BYVE 4L5EA 4A6EA 4HPQA 2NXNB 3RPUD 1ON2A 1QRYA 4YFNF 3FK7A 2Z9OA 1JT0A 2FE3A 1M1EB 1NG6A 5JR3A 4NDLA 2LD5A 3D5LA 4CICA 4C2TA 1U0JA 3PL8A 3LSRA 2A68F 1YJWI 1BR4A 2BY3A 1JI8A 2RVCA 1D0YA 4ENKA 1POGA 3V8KA 4XLHA 4NBQA 3WU0A 1WH5A 2EA2A 2VXZA 4L5JA 5GTHC 4LJZF 1ZGAA 1I6XA 4OIRF 2QZ8A 4IQ4A 3AL0C 3WG9A 1MZBA 2NS7A 2CO5A 3HDDA 4Y3OA 2G9WA 3H9GA 3JRGA 2VI6A 2XAGA 1WZ2A 2R7ZJ 1R49A 1I5ZA 1PJRA 3FZVA 1TNSA 1USSA 3IH4A 4EM2A 4II2A 4ESFA 4K2EA 2K3FA 2JSPA 3L2CA 1Y6IA 3HUGA 4S05A 1H9TA 3A01B 1FBUA 5HLTA 2VKVA 2CV0A 4F93B 2UUZA 2F5VA 1GLNA 4DOZA 5LGNA 4J19A 3QYBA 5D5XB 3TO7A 1MGTA 4RGUA 3QPHA 1KYWA 3IH3A 3LL7A 2NS8A 2HKXA 1SFEA 5BQTA 4XNFA 5HS7A 2LMDA 3FX3A 3QODA 4EM1A 4DQ2A 1PP8F 1ACIA 2JT1A 1HDPA 1X1BA 2MC4A 3E6DA 5F1JA 1FMVA 4HA8A 2VODA 2NVQJ 1ZHFA 2CQNA 2HXOA 2QWWA 2IEKA 3HIFA 1QZYA 2LVSA 2DT7B 3KFWX 4HQMA 2KIFA 5LGTA 1I50J 4E7ZA 3LSHA 5JI6A 3JCUC 3HGGA 3GTJJ 4Q5SF 1S8NA 5F1RA 4FASD 4AD9A 3ABUA 3LAJA 1XN7A 1Q1HA 4CYCB 2WWYA 2X48A 2FBKA 5J6XA 3HRSA 2XGEA 2X51A 3IL2A 4W1UA 4BQAA 2HOEA 4M9ZA 3PSIA 1Z7UA 2X1EA 3CJTB 3VYUB 2HPIA 3WTYC 2PJPA 1S7OA 3F8BA 2F5FA 3OSFA 1CF7A 1W7PD 5EDNA 4ABZA 2ESHA 1RESA 1MDMA 3DU5A 1SAUA 1VQ7I 3ZCOA 2YU9J 2HOAA 3FM5A 1EH6A 3Q9SA 4U0VA 4YELA 3RKYA 3RPQA 3ZMTA 2HVRA 4M6VA 1HW5A 2ZBKA 3M9AA 3GXOA 5M3FJ 4UUTA 3AAFA 1W5TA 1WJBA 1HW2A 2XRNA 4B4CA 1U3EM 5FD6A 1VTNC 1QZEA 2ZCWA 2R7FA 1QGPA 1ETWA 1W0UA 1YIOA 4OU0A 4KMUX 3H5AA 2X6YA 3L1PA 1UHSA 4MLOA 3G71I 2VQGA 2HDCA 4UXNA 3OS0A 4KMFA 2R7XA 1YJNI 4UB6C 4L9VA 2VKDA 1WRJA 2L7FP 1MD0A 3BY6A 3BOQA 2B7EA 2LH9A 3K10A 3TO9A 3TQNA 5GPCA 1BJZA 1Z7LA 3LSMA 4EVIA 5LRSA 3P9KA 1W4MA 5HLHA 2FOKA 2CU7A 3FM3A 1DQUA 1B1BA 4FHTA 2NVYJ 2RN7A 3KETA 4WK8F 4DYCA 5K5RA 3VYRB 5K1YA 3KIOA 1BR1A 2ZKZA 2E1MC 1AU7A 3S3NA 2EA4A 3AFHA 4A5MA 4HF1A 3U9GA 2VIXA 2ZJPF 4NC6A 3TDUC 2ZNYA 3BG7A 1MMSA 3Q0UA 4RDUA 1IUYA 2KZVA 3RKXA 3LA2A 2V6CA 4ZZDA 3IRQA 3CCYA 4PSXA 2EFQA 1MBJA 3BTJA 1LVKA 4HNVA 5ILUA 2DK8A 1PP7U 1MIJA 3JSPA 1S29A 4HNUA 2IPQX 2V9KA 3GZNB 2RKHA 4WXCA 3G4SI 1UELB 2NNNA 2CG4A 5DCFA 1Y1WJ 3BR5A 4UB8C 3QYEA 4V2GA 3CCUI 4KICA 5EYRA 3GO5A 4KA4A 1A6QA 2ICWG 2V4JC 1V5GA 1HQCA 1DU0A 2Z99A 2GIZA 1DUXC 1TC3C 5GAEJ 2B9SA 2V79A 2LY2A 3U1DA 4EGZA 5FRMA 2M0CA 1BR2A 2O61A 5IP6A 1O3RA 3FK6A 3D0SA 4ENMA 2E5ZA 2MGQA 2W25A 3B6CA 4PJNA 3R0AA 4I2OA 2YU3A 2KFDA 2BY0A 3MKLA 1O57A 2EV5A 3DEWA 4U7DA 3PSFA 2A5YB 3DQVC 1ZYRF 2E2JJ 3A2KA 1X58A 3BP8A 3T8RA 3DPLC 3LFKA 5J1YA 2R0QC 1XB4A 5D5UB 3K6GA 2EFNA 4ITVA 5B1AH 2L9RA 1KGSA 1C0WA 3F6VA 3OSGA 4A5NA 4MIMA 2ESNA 2VE8A 4QLCU 1FJLA 4BEHB 1R1TA 4UV8A 4QWQA 2EFPA 3VFZA 2MG4A 5EG0B 2E5NA 3GCMA 3HM5A 4I7HA 4P5OA 1RIOH 1JUMA 3UKGA 3H9JA 4D7MA 2MBFA 3CCSI 5KAIC 1MJBA 1CQTA 1PUFB 1TW2A 1BL0A 3S93A 4CCOA 2E1OA 4M3DA 2DAOA 2HYGD 4F92B 3EUHA 2XAQA 1MSFC 1QPIA 4YIIA 3HXLA 3K4LA 2XC7A 1TWCJ 2NS0A 4IVNA 2CW8A 2PQ8A 1NG7A 3MFKA 4O5VA 1JJ8C 2IGOA 2M9HA 1JKPC 4OAZA 4RAFA 4ZYDA 2E7XA 4V19K 2XKOA 4OOIA 4CCMA 2H1LA 3LOCA 1MMDA 2IVMA 2I10A 4BYYA 2Y31A 2KZGA 2V1UA 5K5QA 4BNCA 2KJBA 2GQQA 3KCCA 2DW4A 3K4KA 2WAQA 2ZB9A 2ISYA 1T2KA 2L01A 3CCJI 4Y52J 4CZZA 4ON0A 1H88C 4CCNA 3DF8A 2E1NA 3QU6A 3O2PE 4TV7A 4ZZLA 5HNHA 4NHJA 3SXYA 4N9IA 3F8FA 4A3EJ 2Q2EB 1MBHA 3A0BC 3C1DA 3MN2A 4OMZA 4KT5C 4FQGA 4DNCA 1QQIA 4KIFA 5TISC 2JWTA 3N97A 3BDDA 2VQLA 4CCKA 5KNLA 2XVCA 2QQ8A 4C2MJ 4BE2A 5K7FA 2GA2A 4BY7J 2Q0OA 2XIGA 3VB2A 1I1SA 4RGRA 2VASA 2F2EA 3H3VK 5D4SA 2G7UA 1X19A 3A0HC 3KEQA 3T8TA 3H9QA 4OIQF 5DCMA 2IS4A 3AG3H 3EETA 5J3LA 5LHGA 5E1XA 5BOXA 3F8CA 2DTZA 2L2OA 5F08A 3BG9A 3GUDA 5BNGA 2F5DA 3AG2H 5C3EJ 2LF8A 1YW9A 3WG7H 2CUZA 2DO7A 1B8IB 2RNGA 1XGOA 1UG0A 2NVTJ 1UJ8A 4DBRA 1K4SA 2IA0A 2MD0A 4LGWA 3PUFA 3PIPF 2JA8J 1T38A 2R5ZB 2K9LA 1BIAA 2LP0A 2W85A 1YYVA 5JVGF 3K1MA 3DPTA 3SJMA 3FXJA 4HX8A 3BZCA 4KNYA 1T0FC 1LDDA 3PUBA 2OTLI 2KRCA 4LB5A 2HZTA 3R0JA 3OYCA 4MQ9F 2OCCH 3ZQQA 4B3AA 2K86A 4ZDPA 1JKQC 2AQEA 4R1HA 3FXMA 1JHHA 1H8AC 2M7BA 3ZMZA 3ZQLA 4HX7A 3SFIA 2ME6A 2R3SA 3CO7C 4HSRA 2DN0A 4D9JA 2BW3A 3ZQIA 1WJ5A 3FHNA 2FNAA 2WY7Q 3E5XA 4LIVA 2JVGA 2H6CA 2Z2SB 3L9FA 3VYSB 3JAMZ 4B43A 3ONQA 3D5SC 2PX9A 3MKYB 3IHUA 4RB2C 3CCQI 2YR2A 3OYIA 3OWTA 4G6QA 3IKTA 3DFGA 3H92A 3HYIA 4AYBN 3B73A 2HEOA 2MABA 3GTOJ 1QVUA 1RUNA 3N05A 3F23A 1VQ6I 3ABKH 3RZOJ 2XAHA 4XONA 4HLYA 3F8MA 3QP5A 2KDOA 3PO3J 2Y75A 1LEBA 4ENNA 3FXOA 3DP7A 1T39A 1Y0NA 2QENA 3G2BA 2E71A 4BH9A 1LE8B 1KQ8A 3TGNA 2XGDA 4HF2A 4DYRA 1IAWA 2AS5F 3JW4A 4ZTFA 4P1WA 2IS1A 1YRNA 1G3SA 3ZMDA 4H4KC 5ICFA 1H0MA 1A6IA 2CFXA 3TW7A 1Y0UA 4C9YA 3C2BA 1IZ1A 2LC2A 1V54H 3JR9A 4QSHA 4E7KA 1Z67A 4WXDA 1A35A 2L02A 2IS2A 2IGNA 4FX4A 3MEXA 4FE7A 2ZXIA 3C2HA 3JRAA 2K4JA 3V7CA 2OUMA 4JOMA 1L3LA 5ICCA 2DTRA 4BJTA 2PJRB 3NRVA 4MQVA 5CVVA 3FDYA 1WVRA 4IJAA 1ZH5A 1BN5A 1IN4A 2XGCA 2L7KA 4A0YA 2DFIA 2DT6A 2E7WA 2KIQA 1R5ID 4DIQA 2RC4A 4NQWA 1O4XA 1OPCA 2XB0X 2K85A 4IO9F 2DFFA 4JBAA 5EGOB 4XIDA 4MEXF 1RKWA 3WGGA 5M5YJ 1SMTA 3P9CA 1AKHB 4EEFG 3AG1H 1ERDA 2FJ1A 2VJJA 4C30A 1FT9A 2CMPA 3DTKA 3M8EA 2EINH 2HGCA 1WJDA 2QBYA 1Z6RA 4YIRX 1Y1VJ 3GTPJ 3HHGA 1WJEA 2EIKH 1AHDP 3JREA 4E7HA 2M7AA 2JRMA 5ERIA 1JUPA 5CQGA 2FQ4A 3IRRA 4G12A 2D1HA 3TL4X 3QPLA 4Q4ZF 3CCEI 1MSEC 3F0CA 2GXGA 4A3JJ 5CQEA 2FD5A 1D1AA 1Z0XA 3D1NI 2F5CA 2E19A 1B4AA 2KISA 5FKKA 4EV0A 4PGHA 4XRFA 2KQRA 1GV5A 3M8JA 3WGIA 2P5LC 3RI4A 3OYEA 2A6EF 2K4BA 1S6LA 1OLTA 1TT0A 4HLXA 3DBLB 4BXXJ 1B9MA 2OV7A 1IUFA 2XF7A 2EPFA 5FKMA 3HSRA 1X4OA 3U1KA 2RQPA 1ON1A 3H36A 3F3XA 3F9KA 2CQ7A 3V8LA 5H2FC 4F91B 1K7AA 2I5UA 3BR3A 5TGTA 1E3OC 2DYSH 2V1DA 1JXSA 4EJWA 3FMQA 3S2HJ 2KIUA 4Y13A 2ZXHA 1ZG1A 4EATA 2DOEA 2RQQA 2OZUA 3KYCB 2DA3A 2CUJA 3ASOH 2ZXWH 1OR7C 2Z5UA 3CMEI 5TJJA 4A3LJ 2PG4A 1BI3A 1BI1A 1TTYA 1FBSA 1Y56A 2OAZA 2VQCA 2L54A 1B72A 3MD2A 3L2QA 4XORA 1JKRC 4MHGA 1OYWA 1E17A 2JA5J 2RREA 2LYCA 1FOKA 3L00A 2QEXI 3ZQCA 1WQ2A 5H6QA 2E2IJ 4Q47A 1XSDA 5FLXZ 2WB1A 1V3FA 4FT8A 2A69F 5DV5A 2IBDA 1N75A 3ZMVA 2IGKA 4ZTJA 2BV6A 2OPTA 4GXOA 1VQNI 2A5WA 4NUBA 1F5TA 2HOSA 2FMLA 1P92A 3HHHA 3F22A 2OJED 3RQ4A 3GTLJ 2HTJA 2ZO4A 3S3MA 3DBRB 3CESA 2WAQN 4PFOA 2QQ9A 2LOOA 2A3SA 2KRFA 1QNTA 4BHPA 2I8DA 2K9MA 4KIBA 4HW0A 2Y9YA 4A12A 1LUJB 4N4NB 3ZP5A 1RC9A 3W3CA 2HOTA 4L0YB 1OCRH 1N78A 4AWXB 2CV2A 1WCMJ 2FA5A 2IGMA 4BAYA 4EGYA 2H94A 3WTSC 3VSLA 4CSWA 2JUGA 3HTUA 1SFKA 3PNYA 4CO8A 2QQBA 3H1CA 1XGNA 4RM3A 3BR0A 3R60A 2G7HA 2QKLB 1FEXA 1FIAA 1YQAA 5CYVA 3FXUA 1HLVA 5FRNA 1ONVA 1XGMA 2Y0MA 4B47A 2LG4A 3GMEA 4E7JA 1YFHA 4MFDA 2XRLA 2PMUA 1KYZA 1BBYA 3CJRB 3WE3A 1TQPA 2O0YA 3NARA 1LJ9A 1W5SA 2XPWA 3OS1A 3BQYA 3RYRA 3HOZJ 2X4HA 1ULYA 5ICGA 3QYFA 5KCMA 5JLXA 3JRFA 4HNTA 1OCTC 1WI3A 2NVXJ 2QCOA 2VC1A 5KK1A 5DTDA 2FNPA 2W48A 5K7HA 3QRFF 3UR3C 3KP3A 4XBFA 1IXRC 4UHTA 2P6TA 5FKLA 4HF0A 2LKSA 2IAIA 5DDGA 1GVDA 2R5YA 3HOTA 2EILH 3Q0WA 1TNTA 1RR8C 1D0ZA 1T6SA 3E1SA 4IHYA 1XD7A 2A61A 2IW5A 2V1NA 1TLHB 4BE0A 1EV7A 1U9NA 1TWGJ 2LREA 4IHSA 4BKXA 4C3JJ 5FD5A 3GFIA 3BZKA 2DPDA 3BG6A 3BTCA 3FXLA 5L3FA 2HZDA 3OIPA 2M45A 3J7ZI 2CWEA 3DLLF 1U5TB 4A0XA 3E97A 3TDZC 3ZXSA 1A04A 4XKVA 3J7AY 3OY9A 3PQJA 4EJOA 2QUFA 3GZ5A 4CYDA 2LR8A 1IN7A 3DEEA 4G6DA 3ISPA 3ZQ7A 1KU9A 1D5VA 3RPUA 1T0FA 5FGMA 2EFOA 2EWNA 4H0EA 2XAJA 1VQLI 1DGRM 2ISZA 3BC8A 4KJZA 1T08B 2HKOA 3IC7A 2DA7A 1KA8A 2L7MP 2PN6A 5E3OA 2WV1A 1SVLA 2BZTA 3P9IA 4G94A 4HAMA 5L3BA 2QSGX 4UVCA 4LLLA 2M34A 3W6KB 5F64A 2MC3A 1ETVA 2OQGA 1FTZA 1J9IA 2O7OA 3OV8A 1HKSA 1TWFJ 3PIOF 3I56I 3E3VA 2M1BA 2LDUA 3HSFA 2DMQA 3T0YA 1YE9A 2MW8A 4HYEA 2L7ZA 1J2XA 1K6YA 2HI3A 2JN6A 1OQYA 1OYYA 2R7OA 2E2HJ 4XRMA 1WGXA 4BXUA 1ZELA 4LOCA 3IWZA 3BPXA 3HSEA 3O6BB 5AIQA 2E60A 2P8TA 2QF7A 3ROUA 4E70A 2VXDA 2UXNA 3OOUA 4LMYA 2JQ7A 1MH3A 3HKZA 2H8RA 1O3SA 1XDUA 6PAXA 2Y69H 4RAGA 3IH2A 2XPUA 1JUSA 1A36A 2BHZA 1LB2A 2DQLA 5DS9A 2DOFA 2FUG2 4PDKA 2JA6J 4LG0A 2CW0F 4HZFA 4R8HA 2VBZA 2NVUB 1JTXA 1NH3A 1RZ4A 4DBQA 2P6SA 5FLVA 4C2UA 2V6EA 2ZSIB 2CYYA 3EQLF 3EYYA 2P81A 2LRDA 1P6RA 2DCEA 5F6FA 3H0DA 4EJTA 1XG1A 3JSOA 2VUMJ 2WY8Q 4G7ZF 2Y0SN 3W2WA 2QSHX 1F43A 2IA1A 1XPXA 3HZJA 2P4WA 4IRHA 2CH0A 1E0EA 3OYNA 4RM2A 1U9OA 4A3KJ 2HVSA 2JA7J 1P4AA 4HEA2 4XLAA 5F04A 4ZH4F 1BIBA 4F7ZA 2CS3A 5F0CA 3TOBA 4P55A 1D8KA 4E7IA 2STTA 4BXFA 3QAHA 1R1VA 4L5IA 1W7PA 1HXDA 1A5JA 4XKCA 1P9QC 3OYKA 2YSRA 4PSWA 4LLGF 1ZLJA 5FJ8J 2GXAA 3KYDB 3MMYB 2DMPA 2ECBA 2PLYA 2EIMH 2KDZA 4E7SA 1Y8RB 3J81Z 3K70D 4BBSJ 2DU9A 1T98A 1JT6A 3T1BA 1PYVA 5DM6F 2LTPA 3EPZA 2AQFA 3JRBA 2JSCA 2LK2A 2HWVA 3SEQA 3K9TA 5BPIA 1DDNA 1ETOA 2XHKA 4GRIA 4OINF 4CZCA 2IP2A 4D7NA 3QP6A 2ETHA 1G6NA 5LRRA 2ZXJA 3GFMA 1JGSA 1SMYF 3FXKA 5HVQC 2HXIA 4PCQA 1IGNA 4EMSA 5ILVA 2X6XA 4ZJZA 2PMZA 2WA0A 1BC8C 4IZZA 3ABLH 1ZGWA 5F27A 3HRMA 2DA5A 4PJ0C 4XLCA 2OA4A 2C6YA 2ADUA 1TZLA 3F8NA 1BJAA 3KZZA 3WGHA 1YO5C 4MFEA 4A6DA 3I59B 3JAMK 1ZARA 1D5YA 2WB1N 3MKWB 2WADA 2HDDA 3I58A 3CF5F 3ML6A 1OR7A 3BT9A 5E3MA 1MBFA 3L09A 1WKMA 2M5WA 4AIHA 4P96A 3ZMUA 1YI2I 5GADJ 5D8KB 1NK2P 1USTA 4Y4RA 1LDKB 4M6XA 4XN3A 5M5XJ 3RQIA 1V55H 1X3WB 1R1UA 5IYDJ 3H3ZA 1YITI 3OYGA 4G9YA 4XMYA 1XTAA 5B5EC 2LBFB 1UMQA 3IKVA 1FY7A 1OMIA 3VPRA 1WJCA 5IYBJ 1FOXA 1YHQI 4BS9A 3ZN0A 4Z6YA 1R6RA 2BGCA 4M3EA 2L5QA 2HYFA 1FYLA 3K0LA 3B6AA 4W97A 1IV6A 3NWSA 2LF7A 1LFBA 5ED4A 1HBXG 1IRZA 2VONA 2VJ4A 3K4BA 5FO5A 1R71A 1GHCA 1JHFA 2CJJA 4II3A 3ZN1A 4AVPA 4ESJA 1S72I 2FQ3A 3GZ6A 1SC7A 1IRFA 2P0WA 3DLAA 3HOUJ 2ZJQF 2ELKA 1BW5A 1AOYA 3FWEA 4YRVA 1VQOI 4HG2A 3KP7A 1D3YA 4XOTA 1XCBA 4F55A 4P9FA 3M3YJ 1XSXA 2DK5A 2RNJA 3A01A 2ZMEB 5J8FA 2VJ5A 1Z3YA 4GCVA 2XAFA 1WPKA 3ECHA 3H3UA 2BHYA 2OF7A 4RB1A 4P9UA 5C44J 1Z9CA 1VF9A 3CUQB 2FX0A 4XQFA 4HOBA 3ERED 1GUUA 2AXTC 3BCAA 3GBGA 4RB3C 3EUKL 5FFZA 3HOXJ 3GYHX 4RLQA 1IRGA 3K4MA 4PK4A 5CVRA 2CSOA 3GWZA 3KYLA 4L18B 2Y48A 2B0LA 1X2NA 3SQNA 5JHFA 4HRIA 2MH2A 1K78B 2GBYA 3LQRA 3AG4H 3FMSA 3O8GA 3QQAA 5EZHA 2H27A 3SZGA 5J40A 4A3GJ 3FBIB 4LIUA 2TCTA 3BR1A 3IUOA 1WHUA 3SYTA 1G3YA 4ZYGA 4Y17A 3MZYA 3G1MA 3LAPA 3CUOA 4N0BA 5IY5H 3OS2A 4ZDOA 1FTTA 1V5FA 3VYTB 5J8CA 1GDTA 2VOPA 2EBIA 2XV4S 2IT0A 2MYSA 4N9HA 1FMWA 2P7VB 3AKZA 4CYCA 2DFHA 4UY8I 4IOCF 1SFUA 5IOYA 3HOVJ 3M4OJ 4M3BA 5B66C 1WWXA 5HDKA 1UHWA 4UUSB 2F48A 4X6AJ 4XM3A 1BW6A 4QIWN 3MQ0A 4GFBA 2KPMA 1MNMC 2DDAA 2EIJH 3BLYA 4CXFA 2A07F 2RV8A 3DTIA 3WODF 3S2WA 5HNFA 2EZLA 1XDSA 4M6YA 2HVQA 4KN4X 3PO2J 4S0HB 4I98B 1STZA 4OIOF 2X6OA 4LFUA 3ASNH 5D6EA 2F5EA 2LY1A 1T95A 2NOGA 3CDLA 4FX0A 5F0FA 4I6ZA 3S17J 2VPRA 2CQXA 2YX4A 4J01A 1QPMA 1P4WA 4XLPF 1MBGA 1K4TA 1MW7A 1FYKA 1G2HA 5CPRB 2AHQA 1OISA 3CCVI 1D8JA 1X3UA 4BDZA 4Y7NJ 3FXRA 1IN8A 4ZC3A 2NOJB 4GGGA 4HV6A 1QZZA 4PJJA 3BWGA 3HL2A 3KE2A 4FCYA 2BEOA 3I55I 1K83J 3ZQGA 1ZREA 2OTJI 1QBJA 4X1EA 1WH7A 1E3HA 2M0MA 4C3HJ 3K4JA 5HDGA 1REPC 4IHVA 5FLXK 1MMAA 3CLOA 3KEOA 3QU3A 3RCOA 1G4DA 3KLOA 4IF4A 3HKZN 4DYQA 3PFYA 3BR6A 4A2UA 3L2WA 1ODDA 1ETKA 2RGVA 1Z21A 1ZK8A 4KISA 2R7QA 3MWMA 3S1MJ 1BM9A 3NWTA 1QVTA 1ZR2A 4DZPA 3G3ZA 2VBYA 3HRUA 1ZQ3P 1Q1VA 2D45A 1N77A 1J0RA 3S2DJ 2V9VA 2FEZA 1QO0D 3ZMSA 1YX5A 1LVAA 4IXAA 3K1NA 4YIFA 2J5OA 1FIPA 4I99C 3WHBA 1GT0C 2MD5A 4UVAA 3HUGB 1YLFA 4FE4A 3CF2A 2BVMA 4I01A 3KP4A 2VE9A 3KX2A 2ZSHB 1NK3P 4B3XA 5L3EA 4BJ6C 1JTYA 5M5WJ 4XKBA 2ZFUA 4IX7A 2H8WA 1ETXA 2BE5F 3JTHA 4RGXA 1KU7A 1TL8A 2RAEA 2DDBA 3COAC 3F6OA 2VPLA 3L2VA 3GEZA 1MNEA 4I0BA 3LFUA 2QGUA 1QA6A 1S3JA 1XMAA 1Z6TA 1MJAA 4QPOA 4V2FA 4XSXF 5E3LA 3J80K 1JKOC 2Y2ZA 3HTSB 1EH7A 2DFEA 4N4OB 3A1YA 3N4MA 4MNUA 4OMYA 1RETA 5B3SH 3S14J 1E3PA 4LG3A 2A6HF 4IHTA 2R7UA 3E0JB 5BMZA 2LY9A 1XGSA 1R5HA 2DQRA 1R5GA 1J5YA 1FOYA 2IA2A 3PM1A 2MLKA 5ICEA 4BUPA 4AIJA 1LQ1A 1T56A 1X4PA 1YG2A 5JLWA 2LKXA 3DCFA 4JX4A 2IS6A 4BJ5C 3G73A 1CF7B 3I4NJ 3H5NA 2QKMB 2X1CA 5DUIA 4BEHA 2OCEA 1DPRA 2PMZN 1MDMB 5CKTA 1R22A 2BVLA 5EG0A 2N8GA 3M8FA 1WFXA 1LKXA 3W2VA 3TMOA 3RYPA 3A02A 4LB6B 3R61A 3HOWJ 1PUFA 2OZ6A 3WTWC 5LEJA 3OYHA 1ZR4A 2DLLA 1YTYA 1VZ0A 1IW7F 1G59A 2F4MB 4J00A 1HOMA 1D1CA 4RA2A 1HSTA 2BY1A 2H09A 2VC0A 2R7DA 2DA1A 2GLOA 3CP2A 5A2QK 2JZYA 2W7NA 3CC4I 3GLXA 1EJ9A 1X2MA 5D4RA 3DPUA 2UWMA 3LSJA 1SD6A 3S1NJ 5FB2A 5EZGA 1XMKA 5IOZA 1IN5A 3K7AJ 3I4PA 5BPDA 4YFXF 2K40A 4BU2A 4NNJA 4U87A 1HCRA 2HYJA 2ZC2A 1D1BA 4U7BA 3KZIC 2DOAA 2JJ7A 2X1DA 2QQAA 3V8JA 3K70C 1W0TA 2O9LA 5E1ZB 3VODA 2DYRH 3I0TA 2OBPA 2VT2A 1OCOH 2QM3A 2WC2A 1K61A 3CJNA 2VJIA 1UCRA 2Q2EA 4XRSG 5GAHJ 4D5FA 4S04A 1DGWY 1B9NA 1ZG3A 2Y30A 2K9NA 1VQMI 5E79C 2E36A 2Y9ZA 3BTLA 4AVZA 4AU7A 1FBQA 2ID3A 3TBIA 4B09A 4IPAA 1IRXA 2TRTA 2HPMA 4LK0F 2F6CA 2W4SA 1U2WA 4IHXA 3JRIA 4Q48A 3SZTA 4U0YA 4E7LA 1VQ8I 4AC0A 1Z91A 3KP2A 2HQ5A 4G7HF 5J1UA 2XKPA 2DMUA 5E3NA 4XICA 1PDNC 4OWRB 2V1XA 3QOEA 4A69C 1DU6A 5JHUA 4CHUA 3LWFA 1NTCA 5JVTA 3S1QJ 1YIJI 1KQ0A 4NC8A 5GAGJ 4ANJA 3OYDA 5DD4A 3L2RA 1TWHJ 1HW1A 3LSGA 3OIQA 1R23A 4BE1A 1B8IA 5J4YA 4WF2A 2GZWA 3CC7I 4HBLA 3IAM2 2JA2A 2GOMA 1U5TC 2M8EA 1VI0A 3LMMA 2EZKA 2R5ZA 1QHGA 5HS9A 4B1RA 1SANA 3I64A 3LQQA 4PJMA 3OR1C 1R36A 1Y8QB 2XF5A 1O7LA 3HOSA 4ZYAA 2ZFWA 2MA3A 4U0WA 3J80Z 1EH8A 1JE8A 4AIKA 3CC2I 3QPTA 3E5QA 1S5LC 3Q5FA 4LITA 2O8XA 4CCLA 5F0HA 1UHMA 2GOXB 3Q0VA 3RTRA 3C3WA 1FC3A 2FBHA 2UZKA 1SFOJ 3IP4B 3ESWB 2R7WA 2O3FA 1SD7A 1WJFA 1R4MB 3J81K 2VOOA 1S9HA 4LK1F 3MZ8A 3GVAA 3LSIA 3WTUC 2E34A 3JRCA 5EEAA 3JRHA 5E8GA 4A3MJ 5LHIA 1I39A 3PJRA 1I6HJ 5AONA 1V4RA 3E6BA 3OR2C 3TP3A 2HNHA 2JMWA 5EEGA 2JTVA 3S32A 2V7FA 1TQIA 1SD5A 2A6TA 3ZGKA 2FBIA 1J7KA 4B48A 2WAEA 4BQNA 4CUGA 1Z05A 3LNQA 1RPWA 3QPSA 3GTKJ 1RKTA 3W6VA 3NQOA 4MTEA 1Z3XA 5C4JJ 4O3MA 3GTMJ 3CMMA 2KRHA 4GYGA 1BOBA 3KZYA 1LE8A 2PMHA 2HDWA 5CVJA 3LA7A 4GDFA 1O3TA 5HLIA 5IP9J 5A2QZ 2NNYA 5LGUA 4L0ZB 4L9NA 3TP0A 5DEQA 1OYIA 1YJ9I 2X6WA 1BA5A 1ZRCA 4RS8A 2M2EA 5H6RA 2FXAA 2HQNA 4HQEA 1ZTRA 3LA3A 4WCGA 2J5PA 2DJNA 1F4KA 1APLC 1E2XA 3TO6A 3GW2A 2K9QA 2UV1A 1HC8A 2FF4A 2L4AA 2P5VA 2W57A 3RDIA 1VQKI 2PJRA 1J75A 1WI9A 2P7CB 3I53A 1X3ZB 2VT3A 4CGZA 4UVBA 3CMYA 3NAUA 1K6OA 4MGRA 2LNBA 2M30A 3VWBA 5DCMB 3CCLI 4MEYF 2DT5A 1I3AA 1ZKGA 4M71A 5EGOA 3AL0B 4AM3A 1IXCA 1AKHA 4I76A 4RAZA 5E1WA 3BZ6A 1IJWC 3FKJA 5FFXA 1LNWA 5CVUA 4RAYA 4CDGA 1G8XA 1HDDC 3I5UA 3OL4A 4RBOA 1VFCA 2WBMA 1OFCX 2R92J 4RLFA 1KONA 1GXQA 2CUFA 3LSKA 3W6JB 3F21A 2ID6A 1WSUA 2M8GX 2L9SA 4BHCA 3MCZA 3U21A 5D8LB 1IDZA 3GFLA 2PI0A 3FBNB 1QU3A 3S3OA 3K69A 1FSHA 4KIGA 3K4NA 4AYBA 5GP9A 1FX7A 3HOYJ 2K27A 2MSYA 2HTSA 1HKQA 2F4OB 3CQZJ 2XASA 3REOA 1X1PA 4MTDA 4M3FA 5K7ZA 1OCPA 1Z77A 2ELJA 4L9TA 2MFZA 4XKWA 5TRDA 1X1CA 4IOAF 3MAJA 2CUEA 5D5VB 3IWFA 3VEPA 3HB9A 2EV6A 2Z16A 3WE2A 2BW3B 1FNNA 3O8HA 2KJCA 3KP6A 4IQJA 1IN6A 3WTZA 5HS8A 3SHFA 2QSFX 3OIOA 4F52A 2PEXA 1YW8A 5IPAA 3TKYA 1FLIA 2FSWA 4JP0A 3ZRGA 1MBKA 2CQQA 3KLNA 3HC7A 4EJUA 2PFBA 3FKIJ 1TWAJ 3DXJF 3DEUA 5LLQA 3P7NA 2EJRA 4JX6A 2R7RA 1EF4A 1J09A 5KHDA 4NC7A 4OAYA 2D5VA 2K7LA 4M9XA 3OYFA 2W1OA 4GYIA 5D6FA 3RSNA 4WXHA 2M3AA 3JRDA 1PUEE 3PNVA 4XSZF 3WTTC 2DJIA 2OQRA 1YW7A 3FF5A 5JFRA 4WX9A 1W5CC 2YS9A 2HS5A 2YPRA 3CJQB 4BY1J 5D5WB 1IV8A 2IXSA 1W1WE 3WU2C 1U8BA 4IEJA 1YRNB 1B59A 2XUBA 1HA8A 3RKQA 3PQKA 2OC6A 2AXLA 2XF6A 4UUVA 3HPHA 4Y15A 4EM0B 1ORKA 3BQZA 2FU4A 5IT9K 2W24A 2QLZA 1IG7A 1TQMA 2R7SA 1BI2A 3TOAA 2EB7A 3ULQB 2E1CA 2H1KA 2V9PA 2CQKA 2GM4A 3ELKA 5LFAA 4B8XA 4YG2F 4HV5A 4MO7A 1XSVA 4NQWB 4YEJA 4X0GA 3R6SA 5C4XJ 1AA7A 4G7OF 2CGPA 2VKHA 1MMGA 2BBYA 3L7WA 4XR6A 4A3DJ 2LLKA 2ZMEC 1SAXA 1SD4A 2M87A 4U88A 2MLGA 4JQFA 3RIRA 4BACA 2E1MB 2JUCA 5GPAA 3RZDJ 1ETYA 2K5CA 3DU6A 3VDXA 4A0ZA 2ZJRF 2QBYB 2XSJC 5IYCJ 3E6CC 2EV0A 3HEFA 3CUQC 3H0GJ 2LSOA 4JK1X 4CA0A 2JPBA 4RGSA 4A93J 1X1AA 4M9SA 4DZJA 1UB9A 2Z3YA 1W36D 3OMYA 1UAAA 4BBRJ 3B02A 5AIPA 1RNLA 1GXPA 1FYMA 2IJLA 4ASNA 1KU3A 3W2AA 1FP1D 5FKNA 4PGGA 1WJAA 2HU9A 3BJ6A 3BR2A 3OL3A 4XL9A 4WWCA 3MKZA 2DODA 3K2ZA 3WTXC 4ZYHA 2ACJA 2R4GA 4JYKA 4I0AA 2WAFA 1Z1DA 1R4NB 3ZPLA 3LSTA 2FRHA 4DJAA 2O6GE 3GTQJ 5DD8A 2WV0A 1QHHD 1S7AA 4R79A 2DA4A 1BOAA 1IC8A 1R7JA 3V7SA 3CP8A 2CV1A 1O3QA 1RUOA 1V5EA 1RRJA 3U2RA 1U5TA 3S16J 1ZRDA 3HJEA 2YUSA 2Q1ZB 4IRIA
chains in the Genus database with same CATH topology
1W0UA 3WHCA 3A03A 3BR0A 1JGGA 1FEXA 1FIAA 3ZQFA 4V2FA 5E3LA 1UHSA 4MLOA 3L1PA 1HLVA 1JKOC 2Y2ZA 4MFDA 2XRLA 1B72B 1RETA 1U78A 3S14J 2L7FP 3NARA 2B63J 2XPWA 3BQYA 3HOZJ 5GPCA 5JLXA 4FISA 3JRFA 1BJZA 1OCTC 2LY9A 3S1RJ 1WI3A 2NVXJ 2QCOA 4JX5A 2CU7A 5FLMJ 1UG2A 5DTDA 2W48A 5K7HA 3K2AA 2NVYJ 1RR7A 3PM1A 1ITYA 4DYCA 5FKLA 2IAIA 1GVDA 2R5YA 1AU7A 1T56A 5JLWA 2LKXA 3Q0WA 3DCFA 4JX4A 3ZQHA 3I4NJ 3Q0UA 4RDUA 4IHYA 1U9NA 1TWGJ 2PMZN 4BKXA 4C3JJ 5EG0A 2N8GA 3FISA 3BG5A 3CCYA 3BTJA 1MBJA 3BTCA 4HNVA 5J1RA 3A02A 2EZHA 3HOWJ 1PUFA 1ZR4A 3BG3A 3HBLA 1Y1WJ 3BR5A 4V2GA 1HOMA 5EYRA 1DU0A 1XS9A 2LR8A 1TC3C 2GLOA 2DA1A 3SDGA 2X9DA 2O8KA 3G1LA 1X2MA 4C3IJ 2M0CA 2XB5A 3LSJA 3S1NJ 5IP6A 5EZGA 5IOZA 1GV2A 3FK6A 3K7AJ 2DA7A 2K40A 2CRGA 2L7MP 5E3OA 2MGQA 2WV1A 3B6CA 1HCRA 2HYJA 3MKLA 2M34A 3IV5A 1W0TA 2JJ7A 3DEWA 2O9LA 1ETVA 1FTZA 2E2JJ 2O7OA 1X58A 5J1YA 1TWFJ 4A3IJ 2R0QC 1K61A 5HODA 2R5YB 4XRSG 2L9RA 2DMQA 4D5FA 2MW8A 3OSGA 2Y30A 2K9NA 2L7ZA 4MIMA 4XRSA 2Y9ZA 2HI3A 3BTLA 2JN6A 1XC5A 1FJLA 4A3CJ 4DW6A 2E2HJ 2ID3A 3TW6A 4XRMA 1WGXA 2MG4A 5EG0B 2KT0A 2TRTA 3HM5A 4A3FJ 1JUMA 4LOCA 3UKGA 4IHXA 3JRIA 4D7MA 2R93J 2QF7A 4AC0A 1ENHA 1PUFB 1CQTA 1BL0A 2HQ5A 3HGYA 5J1UA 2DMUA 2E1OA 3OOUA 4M3DA 3E7LA 5E3NA 4XICA 3S15J 2LFBA 1JJ6C 2EQRA 1MH3A 4A69C 1DU6A 2H8RA 1MSFC 1QPIA 1NTCA 1P7IA 1S7EA 3S1QJ 1TWCJ 3IH2A 2XPUA 1JUSA 1JJ8C 2DMNA 2M9HA 2AO9A 5DS9A 1JKPC 4AUXA 2JA6J 1TWHJ 3LSGA 4QTRA 1B8IA 2G0EA 3LOCA 1JTXA 2I10A 2Y31A 5FLVA 3I4MJ 1VI0A 2XSDC 2EZKA 2P81A 2ZB9A 2R5ZA 4Y52J 4B1RA 1H88C 1XG1A 1SANA 5IP7J 2VUMJ 2Y0SN 2DMTA 1F43A 4A3EJ 1MBHA 3BTIA 3MN2A 1U9OA 4A3KJ 2JA7J 2JWTA 5F04A 5F0HA 3Q0VA 5F0CA 4C2MJ 2DA2A 1SFOJ 5K7FA 1P7JA 4BY7J 3FIWA 1A5JA 2EH3A 1MBEA 3H3VK 3JRCA 5EEAA 3JRHA 5FJ8J 4A3MJ 1I6HJ 2DMPA 2ECBA 3Q3SA 3TP3A 5M3MJ 2KDZA 2DA6A 2JMWA 5EF6A 4BBSJ 1LFUP 2L0KA 1JT6A 5J3LA 2DTZA 5F08A 3BG9A 2EZIA 5BNGA 5C3EJ 2LTPA 1R9TJ 4FTHA 1B8IB 2ME0A 3JRBA 2LK2A 2JK3A 1ETOA 3LNQA 2NVTJ 1RPWA 3QPSA 3GTKJ 2VKEA 1RKTA 3W6VA 4D7NA 2JA8J 5C4JJ 3GTMJ 2R5ZB 2HXIA 1IGNA 2LP0A 1LE8A 3SJMA 1OJLA 1ZGWA 5F27A 5IP9J 9ANTA 4XK4A 2DA5A 4IHWA 3TP0A 2ECCA 4M3GA 1BA5A 4B3AA 2M2EA 4MFEA 3ZOBA 3GTGJ 1JKQC 1ETQA 1ZTRA 1H8AC 1D5YA 1MH4A 3ZQLA 2DJNA 1APLC 2WB1N 1IDYA 2HDDA 2K9QA 3SFIA 3TEDA 2ME6A 3BT9A 5E3MA 2DN0A 1MBFA 1HF0A 2XPVA 3ZQIA 1H89C 1NK2P 2COBA 3CMYA 1VNDA 3NAUA 5M5XJ 3RQIA 5FKOA 5IYDJ 1UMQA 4AYBN 1ZKGA 5EGOA 1AKHA 3GTOJ 4I76A 1QVUA 3VPRA 1I3QJ 5IYBJ 1IJWC 3MVPA 4M3EA 3RZOJ 1HDDC 3B6AA 4RBOA 4W97A 1IV6A 1VFCA 1OFCX 2R92J 3PO3J 3LSPA 1LFBA 1IRZA 2CUFA 2ID6A 1LE8B 2M8GX 2K9SA 1IDZA 2CJJA 2XGDA 4DYRA 5GP9A 3HOYJ 1YRNA 3HOUJ 1F36A 2ELKA 2MSYA 1BW5A 1A6IA 4UUSA 3TW7A 3CQZJ 4D5CA 3C2BA 4M3FA 3G1OA 5K7ZA 1OCPA 1Z77A 3JR9A 1T33A 4QSHA 3M3YJ 2CUEA 4FE7A 3A01A 3HB9A 3JRAA 1WPKA 3O8HA 4A3BJ 2OF7A 5C44J 3OIOA 5IPAA 1VF9A 2FX0A 1GUUA 2XGCA 3GBGA 4JP0A 1MBKA 2CQQA 4L5EA 3HOXJ 1O4XA 2XB0X 3FKIJ 1X2NA 5EGOB 1QRYA 4XIDA 3FK7A 1TWAJ 1RKWA 5M5YJ 1JT0A 2GBYA 1AKHB 4EEFG 4NDLA 4JX6A 2LD5A 3O8GA 2FJ1A 3QQAA 5EZHA 4A3GJ 1EF4A 3LSRA 2TCTA 3BR1A 2D5VA 1POGA 3JRDA 3G1MA 1WH5A 1Y1VJ 3GTPJ 1FTTA 1GDTA 2EBIA 3JREA 1AHDP 2YS9A 1JUPA 2FQ4A 4G12A 4BY1J 3QPLA 1MSEC 3F0CA 2NS7A 4A3JJ 2FD5A 3HDDA 4CYCA 1Z0XA 3D1NI 1U8BA 2E19A 3JRGA 4IEJA 2VI6A 5IOYA 1YRNB 3HOVJ 3M4OJ 4M3BA 3RKQA 5FKKA 4UUSB 2R7ZJ 4X6AJ 4QIWN 1BW6A 3IH4A 4GFBA 1GV5A 1MNMC 1ORKA 3BQZA 2EZLA 3PO2J 4S0HB 4BXXJ 3A01B 1IUFA 2VKVA 2X6OA 5FKMA 1IG7A 3CDLA 2NOGA 5F0FA 4I6ZA 3S17J 4J19A 2VPRA 2CQXA 2H1KA 2GM4A 1G2HA 1MBGA 3BR3A 1E3OC 2AHQA 3IH3A 3S2HJ 4MO7A 4Y7NJ 2NS8A 5C4XJ 4FCYA 2DA3A 1K83J 3ZQGA 1HDPA 5F1JA 4A3DJ 4X1EA 1WH7A 2LLKA 4A3LJ 4C3HJ 2NVQJ 2HXOA 2IEKA 4IHVA 5GPAA 1B72A 3RZDJ 1ETYA 2LVSA 1JKRC 5IYCJ 3HEFA 3H0GJ 3HKZN 2JA5J 1I50J 4DYQA 3BR6A 4A93J 3ZQCA 2E2IJ 1ETKA 4DZJA 3HGGA 3GTJJ 1ZK8A 3S1MJ 4BBRJ 1QVTA 1ZR2A 2IBDA 4DZPA 1ZQ3P 4CYCB 2X48A 2OPTA 2XGEA 1Q1VA 2HOSA 4W1UA 3S2DJ 5FKNA 3GTLJ 3BR2A 1FIPA 3OSFA 3WHBA 2WAQN 1GT0C 5EDNA 4ABZA 4JYKA 1RESA 4FE4A 2Y9YA 2HOTA 2YU9J 2HOAA 3GTQJ 1NK3P 1JTYA 1WCMJ 2DA4A 4M6VA 5M5WJ 1IC8A 1ETXA 5M3FJ 4UUTA 4B4CA 2RAEA 3S16J 2YUSA 1ETWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0U A;  3WHC A;  3A03 A;  3BR0 A;  1JGG A;  1FEX A;  1FIA A;  3ZQF A;  4V2F A;  5E3L A;  1UHS A;  4MLO A;  3L1P A;  1HLV A;  1JKO C;  2Y2Z A;  4MFD A;  2XRL A;  1B72 B;  1RET A;  1U78 A;  3S14 J;  2L7F P;  3NAR A;  2B63 J;  2XPW A;  3BQY A;  3HOZ J;  5GPC A;  5JLX A;  4FIS A;  3JRF A;  1BJZ A;  1OCT C;  2LY9 A;  3S1R J;  1WI3 A;  2NVX J;  2QCO A;  4JX5 A;  2CU7 A;  5FLM J;  1UG2 A;  5DTD A;  2W48 A;  5K7H A;  3K2A A;  2NVY J;  1RR7 A;  3PM1 A;  1ITY A;  4DYC A;  5FKL A;  2IAI A;  1GVD A;  2R5Y A;  1AU7 A;  1T56 A;  5JLW A;  2LKX A;  3Q0W A;  3DCF A;  4JX4 A;  3ZQH A;  3I4N J;  3Q0U A;  4RDU A;  4IHY A;  1U9N A;  1TWG J;  2PMZ N;  4BKX A;  4C3J J;  5EG0 A;  2N8G A;  3FIS A;  3BG5 A;  3CCY A;  3BTJ A;  1MBJ A;  3BTC A;  4HNV A;  5J1R A;  3A02 A;  2EZH A;  3HOW J;  1PUF A;  1ZR4 A;  3BG3 A;  3HBL A;  1Y1W J;  3BR5 A;  4V2G A;  1HOM A;  5EYR A;  1DU0 A;  1XS9 A;  2LR8 A;  1TC3 C;  2GLO A;  2DA1 A;  3SDG A;  2X9D A;  2O8K A;  3G1L A;  1X2M A;  4C3I J;  2M0C A;  2XB5 A;  3LSJ A;  3S1N J;  5IP6 A;  5EZG A;  5IOZ A;  1GV2 A;  3FK6 A;  3K7A J;  2DA7 A;  2K40 A;  2CRG A;  2L7M P;  5E3O A;  2MGQ A;  2WV1 A;  3B6C A;  1HCR A;  2HYJ A;  3MKL A;  2M34 A;  3IV5 A;  1W0T A;  2JJ7 A;  3DEW A;  2O9L A;  1ETV A;  1FTZ A;  2E2J J;  2O7O A;  1X58 A;  5J1Y A;  1TWF J;  4A3I J;  2R0Q C;  1K61 A;  5HOD A;  2R5Y B;  4XRS G;  2L9R A;  2DMQ A;  4D5F A;  2MW8 A;  3OSG A;  2Y30 A;  2K9N A;  2L7Z A;  4MIM A;  4XRS A;  2Y9Z A;  2HI3 A;  3BTL A;  2JN6 A;  1XC5 A;  1FJL A;  4A3C J;  4DW6 A;  2E2H J;  2ID3 A;  3TW6 A;  4XRM A;  1WGX A;  2MG4 A;  5EG0 B;  2KT0 A;  2TRT A;  3HM5 A;  4A3F J;  1JUM A;  4LOC A;  3UKG A;  4IHX A;  3JRI A;  4D7M A;  2R93 J;  2QF7 A;  4AC0 A;  1ENH A;  1PUF B;  1CQT A;  1BL0 A;  2HQ5 A;  3HGY A;  5J1U A;  2DMU A;  2E1O A;  3OOU A;  4M3D A;  3E7L A;  5E3N A;  4XIC A;  3S15 J;  2LFB A;  1JJ6 C;  2EQR A;  1MH3 A;  4A69 C;  1DU6 A;  2H8R A;  1MSF C;  1QPI A;  1NTC A;  1P7I A;  1S7E A;  3S1Q J;  1TWC J;  3IH2 A;  2XPU A;  1JUS A;  1JJ8 C;  2DMN A;  2M9H A;  2AO9 A;  5DS9 A;  1JKP C;  4AUX A;  2JA6 J;  1TWH J;  3LSG A;  4QTR A;  1B8I A;  2G0E A;  3LOC A;  1JTX A;  2I10 A;  2Y31 A;  5FLV A;  3I4M J;  1VI0 A;  2XSD C;  2EZK A;  2P81 A;  2ZB9 A;  2R5Z A;  4Y52 J;  4B1R A;  1H88 C;  1XG1 A;  1SAN A;  5IP7 J;  2VUM J;  2Y0S N;  2DMT A;  1F43 A;  4A3E J;  1MBH A;  3BTI A;  3MN2 A;  1U9O A;  4A3K J;  2JA7 J;  2JWT A;  5F04 A;  5F0H A;  3Q0V A;  5F0C A;  4C2M J;  2DA2 A;  1SFO J;  5K7F A;  1P7J A;  4BY7 J;  3FIW A;  1A5J A;  2EH3 A;  1MBE A;  3H3V K;  3JRC A;  5EEA A;  3JRH A;  5FJ8 J;  4A3M J;  1I6H J;  2DMP A;  2ECB A;  3Q3S A;  3TP3 A;  5M3M J;  2KDZ A;  2DA6 A;  2JMW A;  5EF6 A;  4BBS J;  1LFU P;  2L0K A;  1JT6 A;  5J3L A;  2DTZ A;  5F08 A;  3BG9 A;  2EZI A;  5BNG A;  5C3E J;  2LTP A;  1R9T J;  4FTH A;  1B8I B;  2ME0 A;  3JRB A;  2LK2 A;  2JK3 A;  1ETO A;  3LNQ A;  2NVT J;  1RPW A;  3QPS A;  3GTK J;  2VKE A;  1RKT A;  3W6V A;  4D7N A;  2JA8 J;  5C4J J;  3GTM J;  2R5Z B;  2HXI A;  1IGN A;  2LP0 A;  1LE8 A;  3SJM A;  1OJL A;  1ZGW A;  5F27 A;  5IP9 J;  9ANT A;  4XK4 A;  2DA5 A;  4IHW A;  3TP0 A;  2ECC A;  4M3G A;  1BA5 A;  4B3A A;  2M2E A;  4MFE A;  3ZOB A;  3GTG J;  1JKQ C;  1ETQ A;  1ZTR A;  1H8A C;  1D5Y A;  1MH4 A;  3ZQL A;  2DJN A;  1APL C;  2WB1 N;  1IDY A;  2HDD A;  2K9Q A;  3SFI A;  3TED A;  2ME6 A;  3BT9 A;  5E3M A;  2DN0 A;  1MBF A;  1HF0 A;  2XPV A;  3ZQI A;  1H89 C;  1NK2 P;  2COB A;  3CMY A;  1VND A;  3NAU A;  5M5X J;  3RQI A;  5FKO A;  5IYD J;  1UMQ A;  4AYB N;  1ZKG A;  5EGO A;  1AKH A;  3GTO J;  4I76 A;  1QVU A;  3VPR A;  1I3Q J;  5IYB J;  1IJW C;  3MVP A;  4M3E A;  3RZO J;  1HDD C;  3B6A A;  4RBO A;  4W97 A;  1IV6 A;  1VFC A;  1OFC X;  2R92 J;  3PO3 J;  3LSP A;  1LFB A;  1IRZ A;  2CUF A;  2ID6 A;  1LE8 B;  2M8G X;  2K9S A;  1IDZ A;  2CJJ A;  2XGD A;  4DYR A;  5GP9 A;  3HOY J;  1YRN A;  3HOU J;  1F36 A;  2ELK A;  2MSY A;  1BW5 A;  1A6I A;  4UUS A;  3TW7 A;  3CQZ J;  4D5C A;  3C2B A;  4M3F A;  3G1O A;  5K7Z A;  1OCP A;  1Z77 A;  3JR9 A;  1T33 A;  4QSH A;  3M3Y J;  2CUE A;  4FE7 A;  3A01 A;  3HB9 A;  3JRA A;  1WPK A;  3O8H A;  4A3B J;  2OF7 A;  5C44 J;  3OIO A;  5IPA A;  1VF9 A;  2FX0 A;  1GUU A;  2XGC A;  3GBG A;  4JP0 A;  1MBK A;  2CQQ A;  4L5E A;  3HOX J;  1O4X A;  2XB0 X;  3FKI J;  1X2N A;  5EGO B;  1QRY A;  4XID A;  3FK7 A;  1TWA J;  1RKW A;  5M5Y J;  1JT0 A;  2GBY A;  1AKH B;  4EEF G;  4NDL A;  4JX6 A;  2LD5 A;  3O8G A;  2FJ1 A;  3QQA A;  5EZH A;  4A3G J;  1EF4 A;  3LSR A;  2TCT A;  3BR1 A;  2D5V A;  1POG A;  3JRD A;  3G1M A;  1WH5 A;  1Y1V J;  3GTP J;  1FTT A;  1GDT A;  2EBI A;  3JRE A;  1AHD P;  2YS9 A;  1JUP A;  2FQ4 A;  4G12 A;  4BY1 J;  3QPL A;  1MSE C;  3F0C A;  2NS7 A;  4A3J J;  2FD5 A;  3HDD A;  4CYC A;  1Z0X A;  3D1N I;  1U8B A;  2E19 A;  3JRG A;  4IEJ A;  2VI6 A;  5IOY A;  1YRN B;  3HOV J;  3M4O J;  4M3B A;  3RKQ A;  5FKK A;  4UUS B;  2R7Z J;  4X6A J;  4QIW N;  1BW6 A;  3IH4 A;  4GFB A;  1GV5 A;  1MNM C;  1ORK A;  3BQZ A;  2EZL A;  3PO2 J;  4S0H B;  4BXX J;  3A01 B;  1IUF A;  2VKV A;  2X6O A;  5FKM A;  1IG7 A;  3CDL A;  2NOG A;  5F0F A;  4I6Z A;  3S17 J;  4J19 A;  2VPR A;  2CQX A;  2H1K A;  2GM4 A;  1G2H A;  1MBG A;  3BR3 A;  1E3O C;  2AHQ A;  3IH3 A;  3S2H J;  4MO7 A;  4Y7N J;  2NS8 A;  5C4X J;  4FCY A;  2DA3 A;  1K83 J;  3ZQG A;  1HDP A;  5F1J A;  4A3D J;  4X1E A;  1WH7 A;  2LLK A;  4A3L J;  4C3H J;  2NVQ J;  2HXO A;  2IEK A;  4IHV A;  5GPA A;  1B72 A;  3RZD J;  1ETY A;  2LVS A;  1JKR C;  5IYC J;  3HEF A;  3H0G J;  3HKZ N;  2JA5 J;  1I50 J;  4DYQ A;  3BR6 A;  4A93 J;  3ZQC A;  2E2I J;  1ETK A;  4DZJ A;  3HGG A;  3GTJ J;  1ZK8 A;  3S1M J;  4BBR J;  1QVT A;  1ZR2 A;  2IBD A;  4DZP A;  1ZQ3 P;  4CYC B;  2X48 A;  2OPT A;  2XGE A;  1Q1V A;  2HOS A;  4W1U A;  3S2D J;  5FKN A;  3GTL J;  3BR2 A;  1FIP A;  3OSF A;  3WHB A;  2WAQ N;  1GT0 C;  5EDN A;  4ABZ A;  4JYK A;  1RES A;  4FE4 A;  2Y9Y A;  2HOT A;  2YU9 J;  2HOA A;  3GTQ J;  1NK3 P;  1JTY A;  1WCM J;  2DA4 A;  4M6V A;  5M5W J;  1IC8 A;  1ETX A;  5M3F J;  4UUT A;  4B4C A;  2RAE A;  3S16 J;  2YUS A;  1ETW A; 
#chains in the Genus database with same CATH topology
 1FP2 A;  4M74 A;  3O3K A;  3WHC A;  3A03 A;  1JGG A;  4IKF A;  2X85 A;  3HRT A;  2GXB A;  3ZQF A;  2GAU A;  1GVJ A;  3S8P A;  1FOW A;  1MMN A;  4I02 A;  1SFX A;  3CZ6 A;  4PZJ A;  3CCR I;  1B72 B;  2YX7 A;  3J7A O;  5KAF C;  1U78 A;  2VB6 A;  2MH9 A;  2B63 J;  2W82 A;  4M72 A;  4FIS A;  1ZG5 A;  4CCJ A;  4DGW B;  3S1R J;  4Y33 A;  3F72 A;  4JX5 A;  4XLE A;  1MKM A;  1UG2 A;  4M73 A;  5FLM J;  3FHZ A;  2KLO A;  3K2A A;  5HDN A;  1RR7 A;  1AWC A;  1ITY A;  1IO2 A;  1TT5 B;  4FET A;  3C7J A;  4BHB A;  1T8I A;  1FPQ A;  2Z33 A;  1DP7 P;  3BRO A;  2M4K A;  5L3G A;  3M07 A;  1BC7 C;  1FZP B;  3SEZ A;  3ZQH A;  3VSK A;  4E6K G;  5GTI C;  5HLG A;  1IXS B;  1N25 A;  5H20 A;  3T5X A;  1BI0 A;  3I71 A;  5E20 A;  2Q8K A;  3KPH A;  3CLQ A;  4I09 A;  3FIS A;  3BG5 A;  5CLS A;  5J1R A;  2QA4 I;  2EZH A;  3C18 A;  3A4C A;  4RB0 A;  3BG3 A;  3HBL A;  2D1V A;  4BDY A;  4ENJ A;  2BXY A;  2VL8 A;  4GO1 A;  1H9G A;  4LD5 A;  1XS9 A;  1YS7 A;  2TDX A;  1UZC A;  3CO6 C;  4BQQ A;  4BGD A;  5L3C A;  5IT9 Z;  3SDG A;  2X9D A;  1OKR A;  1SEU A;  3GLL A;  5J4V A;  2EK5 A;  2O8K A;  3E6M A;  1ZAO A;  3G1L A;  5EJC A;  3JTG A;  3QWL A;  4EJV A;  4C3I J;  2XB5 A;  1GV2 A;  3BJO A;  1RI7 A;  4NB5 A;  1XCV A;  3ECO A;  2CRG A;  4D1Q A;  2KL4 A;  4YFK F;  2VBW A;  2OD5 A;  3M1C A;  4Z2Y A;  3IV5 A;  1UFM A;  2L9N A;  2ZNZ A;  4EQQ A;  2XDV A;  2UXX A;  2HQR A;  4A3I J;  2H6B A;  2GWR A;  2R7T A;  5HOD A;  2R5Y B;  1OCC H;  5KVR A;  1YX3 A;  1XMX A;  2L3D A;  1VQP I;  4XRS A;  5CVI A;  2DXI A;  4HDV A;  1XC5 A;  5K5O A;  1TP4 A;  4A3C J;  4DW6 A;  2L9V A;  3DTE A;  3TW6 A;  4KIT B;  2ZJ2 A;  4IL6 C;  2KT0 A;  4OIP F;  4A3F J;  1ZN2 A;  4G6T B;  1YOV B;  3FXQ A;  2VQH A;  3DKW A;  3ERM A;  2R93 J;  2RDP A;  2HQA A;  3SDB A;  1ENH A;  1DP3 A;  2EFW A;  3FMR A;  2COM A;  2X0L A;  3HGY A;  3GF2 A;  2NAZ A;  4KFC A;  3S15 J;  3E7L A;  4UNO A;  2LFB A;  1JJ6 C;  1ZLK A;  2EQR A;  1XX5 A;  3P5J A;  3QOP A;  3SFZ A;  2VBX A;  1P7I A;  1S7E A;  4HX4 A;  1LPQ A;  2DMN A;  2QYO A;  2HFH A;  2AO9 A;  1SVM A;  1NHA A;  2V26 A;  2KKO A;  1OCZ H;  5L3D A;  4AUX A;  3K4C A;  3M1E A;  4RMN A;  4QTR A;  1Y39 A;  2WTE A;  2G0E A;  2JPC A;  3GFJ A;  3IAS 2;  3I4M J;  2XSD C;  3I3L A;  1EA3 A;  4PFP A;  2KIM A;  4ETS A;  5IP7 J;  3EDP A;  2LKP A;  3OYL A;  2DMT A;  1I27 A;  2CW7 A;  3BTI A;  1ZRF A;  4G8X A;  5LBQ A;  4BQO A;  1P4X A;  1MJ9 A;  4D0P A;  3Q9V A;  3BCB A;  1O7F A;  1G3W A;  3I59 A;  1FWZ A;  2DA2 A;  2K02 A;  2NYX A;  1P7J A;  1DPU A;  1PVE A;  3CDI A;  3KEY A;  3FIW A;  1TW3 A;  3X2Q H;  5ILS A;  1P2F A;  2CFO A;  5E8I A;  2EH3 A;  1MBE A;  2Z1D A;  2GIV A;  2KMU A;  3WTV C;  2NRA C;  3Q3S A;  2IRF G;  5M3M J;  5HOO A;  5E17 F;  3BJA A;  2DA6 A;  2Y0S A;  3ABT A;  5EF6 A;  4HDU A;  3DKY A;  1LFU P;  3CCM I;  2L0K A;  2LBF A;  1HKT A;  3I9V 2;  4KYW A;  1TBX A;  3NEU A;  5DUK A;  5E18 F;  2EZI A;  5CJ9 A;  2L4M A;  3D5R C;  2VLA A;  4XLN F;  1LEA A;  4LG0 B;  2BOL A;  1L0O C;  2BXZ A;  3ZR8 X;  4E4H A;  1R9T J;  4FTH A;  2ME0 A;  4O6J A;  2JK3 A;  2VKE A;  2BY2 A;  5BS6 A;  3DKX A;  1D0X A;  1VQ5 I;  1KQ9 A;  1R58 A;  3DV8 A;  3HG9 A;  2FOW A;  3V42 A;  2M4G A;  2XGX A;  4HST A;  2VN2 A;  4F3Q A;  3E5U A;  3EUA A;  2D2W A;  2KP6 A;  1OJL A;  3CTA A;  9ANT A;  4XK4 A;  4IHW A;  3ABM H;  4ZDL A;  5LEK A;  3OOP A;  2ECC A;  4M3G A;  3ZOB A;  3GTG J;  1U8R A;  1ETQ A;  1MH4 A;  1F9N A;  3OYM A;  1IDY A;  4CH7 A;  3TED A;  5DM7 F;  3H35 A;  5EEH A;  1W7P B;  2XAU A;  3J7Y J;  1CGP A;  1G3T A;  2ZME A;  1HF0 A;  4LLN A;  2XRO A;  2XPV A;  1J59 A;  2P5K A;  3PFI A;  2JVH A;  1H89 C;  3CDH A;  2COB A;  2KHM A;  3EYI A;  1VND A;  3HPG A;  1EKE A;  1LDJ A;  3CUQ A;  5J47 A;  1ZGJ A;  5FKO A;  3OYJ A;  2R7V A;  2K3P A;  5LHH A;  4AID A;  3MZH A;  4PJL A;  3V4G A;  1FSE A;  3KP5 A;  4L9J A;  3H5R A;  4KDP A;  2DI3 A;  4XLF A;  3PNT A;  1K78 A;  2O03 A;  3CD6 I;  1KZH A;  2GA1 A;  3V7R A;  1I3Q J;  2F4I A;  3SZP A;  1HSJ A;  1I1G A;  2DBB A;  2E35 A;  2FMY A;  2O5R A;  3MVP A;  2HR3 A;  4PUS A;  3OYA A;  1VQ9 I;  3GX4 X;  1MND A;  3R4K A;  4BL0 B;  4KT6 A;  3G6E I;  3CMA I;  4ESB A;  1KU2 A;  5B1B H;  3EUH C;  3LSP A;  3K1P A;  5IT3 A;  2DPU A;  3I54 A;  3UNG C;  2K9S A;  5FRO A;  2QVO A;  4ZYE A;  1F1Z A;  1SVO A;  3C2G A;  1B6A A;  2A05 A;  1IF1 A;  1R00 A;  1LFP A;  1F36 A;  4XN0 A;  1A31 A;  1VQ4 I;  3RJP A;  3WU1 B;  4UUS A;  4KN7 X;  2ELH A;  3DWL E;  4D5C A;  5DYM A;  1U6G A;  4UV9 A;  2W84 A;  3G1O A;  2STW A;  3L2U A;  1T33 A;  4XOP A;  1X1D A;  4IRG A;  2JRT A;  2OU2 A;  4KUM A;  2PBI A;  3M7G A;  5LD2 C;  3BPV A;  4B44 A;  2W00 A;  3VOE A;  3OYB A;  3RKW A;  4QPQ A;  1K79 A;  4A3B J;  1W36 C;  3DBH B;  1YS6 A;  2BYV E;  4L5E A;  4A6E A;  4HPQ A;  2NXN B;  3RPU D;  1ON2 A;  1QRY A;  4YFN F;  3FK7 A;  2Z9O A;  1JT0 A;  2FE3 A;  1M1E B;  1NG6 A;  5JR3 A;  4NDL A;  2LD5 A;  3D5L A;  4CIC A;  4C2T A;  1U0J A;  3PL8 A;  3LSR A;  2A68 F;  1YJW I;  1BR4 A;  2BY3 A;  1JI8 A;  2RVC A;  1D0Y A;  4ENK A;  1POG A;  3V8K A;  4XLH A;  4NBQ A;  3WU0 A;  1WH5 A;  2EA2 A;  2VXZ A;  4L5J A;  5GTH C;  4LJZ F;  1ZGA A;  1I6X A;  4OIR F;  2QZ8 A;  4IQ4 A;  3AL0 C;  3WG9 A;  1MZB A;  2NS7 A;  2CO5 A;  3HDD A;  4Y3O A;  2G9W A;  3H9G A;  3JRG A;  2VI6 A;  2XAG A;  1WZ2 A;  2R7Z J;  1R49 A;  1I5Z A;  1PJR A;  3FZV A;  1TNS A;  1USS A;  3IH4 A;  4EM2 A;  4II2 A;  4ESF A;  4K2E A;  2K3F A;  2JSP A;  3L2C A;  1Y6I A;  3HUG A;  4S05 A;  1H9T A;  3A01 B;  1FBU A;  5HLT A;  2VKV A;  2CV0 A;  4F93 B;  2UUZ A;  2F5V A;  1GLN A;  4DOZ A;  5LGN A;  4J19 A;  3QYB A;  5D5X B;  3TO7 A;  1MGT A;  4RGU A;  3QPH A;  1KYW A;  3IH3 A;  3LL7 A;  2NS8 A;  2HKX A;  1SFE A;  5BQT A;  4XNF A;  5HS7 A;  2LMD A;  3FX3 A;  3QOD A;  4EM1 A;  4DQ2 A;  1PP8 F;  1ACI A;  2JT1 A;  1HDP A;  1X1B A;  2MC4 A;  3E6D A;  5F1J A;  1FMV A;  4HA8 A;  2VOD A;  2NVQ J;  1ZHF A;  2CQN A;  2HXO A;  2QWW A;  2IEK A;  3HIF A;  1QZY A;  2LVS A;  2DT7 B;  3KFW X;  4HQM A;  2KIF A;  5LGT A;  1I50 J;  4E7Z A;  3LSH A;  5JI6 A;  3JCU C;  3HGG A;  3GTJ J;  4Q5S F;  1S8N A;  5F1R A;  4FAS D;  4AD9 A;  3ABU A;  3LAJ A;  1XN7 A;  1Q1H A;  4CYC B;  2WWY A;  2X48 A;  2FBK A;  5J6X A;  3HRS A;  2XGE A;  2X51 A;  3IL2 A;  4W1U A;  4BQA A;  2HOE A;  4M9Z A;  3PSI A;  1Z7U A;  2X1E A;  3CJT B;  3VYU B;  2HPI A;  3WTY C;  2PJP A;  1S7O A;  3F8B A;  2F5F A;  3OSF A;  1CF7 A;  1W7P D;  5EDN A;  4ABZ A;  2ESH A;  1RES A;  1MDM A;  3DU5 A;  1SAU A;  1VQ7 I;  3ZCO A;  2YU9 J;  2HOA A;  3FM5 A;  1EH6 A;  3Q9S A;  4U0V A;  4YEL A;  3RKY A;  3RPQ A;  3ZMT A;  2HVR A;  4M6V A;  1HW5 A;  2ZBK A;  3M9A A;  3GXO A;  5M3F J;  4UUT A;  3AAF A;  1W5T A;  1WJB A;  1HW2 A;  2XRN A;  4B4C A;  1U3E M;  5FD6 A;  1VTN C;  1QZE A;  2ZCW A;  2R7F A;  1QGP A;  1ETW A;  1W0U A;  1YIO A;  4OU0 A;  4KMU X;  3H5A A;  2X6Y A;  3L1P A;  1UHS A;  4MLO A;  3G71 I;  2VQG A;  2HDC A;  4UXN A;  3OS0 A;  4KMF A;  2R7X A;  1YJN I;  4UB6 C;  4L9V A;  2VKD A;  1WRJ A;  2L7F P;  1MD0 A;  3BY6 A;  3BOQ A;  2B7E A;  2LH9 A;  3K10 A;  3TO9 A;  3TQN A;  5GPC A;  1BJZ A;  1Z7L A;  3LSM A;  4EVI A;  5LRS A;  3P9K A;  1W4M A;  5HLH A;  2FOK A;  2CU7 A;  3FM3 A;  1DQU A;  1B1B A;  4FHT A;  2NVY J;  2RN7 A;  3KET A;  4WK8 F;  4DYC A;  5K5R A;  3VYR B;  5K1Y A;  3KIO A;  1BR1 A;  2ZKZ A;  2E1M C;  1AU7 A;  3S3N A;  2EA4 A;  3AFH A;  4A5M A;  4HF1 A;  3U9G A;  2VIX A;  2ZJP F;  4NC6 A;  3TDU C;  2ZNY A;  3BG7 A;  1MMS A;  3Q0U A;  4RDU A;  1IUY A;  2KZV A;  3RKX A;  3LA2 A;  2V6C A;  4ZZD A;  3IRQ A;  3CCY A;  4PSX A;  2EFQ A;  1MBJ A;  3BTJ A;  1LVK A;  4HNV A;  5ILU A;  2DK8 A;  1PP7 U;  1MIJ A;  3JSP A;  1S29 A;  4HNU A;  2IPQ X;  2V9K A;  3GZN B;  2RKH A;  4WXC A;  3G4S I;  1UEL B;  2NNN A;  2CG4 A;  5DCF A;  1Y1W J;  3BR5 A;  4UB8 C;  3QYE A;  4V2G A;  3CCU I;  4KIC A;  5EYR A;  3GO5 A;  4KA4 A;  1A6Q A;  2ICW G;  2V4J C;  1V5G A;  1HQC A;  1DU0 A;  2Z99 A;  2GIZ A;  1DUX C;  1TC3 C;  5GAE J;  2B9S A;  2V79 A;  2LY2 A;  3U1D A;  4EGZ A;  5FRM A;  2M0C A;  1BR2 A;  2O61 A;  5IP6 A;  1O3R A;  3FK6 A;  3D0S A;  4ENM A;  2E5Z A;  2MGQ A;  2W25 A;  3B6C A;  4PJN A;  3R0A A;  4I2O A;  2YU3 A;  2KFD A;  2BY0 A;  3MKL A;  1O57 A;  2EV5 A;  3DEW A;  4U7D A;  3PSF A;  2A5Y B;  3DQV C;  1ZYR F;  2E2J J;  3A2K A;  1X58 A;  3BP8 A;  3T8R A;  3DPL C;  3LFK A;  5J1Y A;  2R0Q C;  1XB4 A;  5D5U B;  3K6G A;  2EFN A;  4ITV A;  5B1A H;  2L9R A;  1KGS A;  1C0W A;  3F6V A;  3OSG A;  4A5N A;  4MIM A;  2ESN A;  2VE8 A;  4QLC U;  1FJL A;  4BEH B;  1R1T A;  4UV8 A;  4QWQ A;  2EFP A;  3VFZ A;  2MG4 A;  5EG0 B;  2E5N A;  3GCM A;  3HM5 A;  4I7H A;  4P5O A;  1RIO H;  1JUM A;  3UKG A;  3H9J A;  4D7M A;  2MBF A;  3CCS I;  5KAI C;  1MJB A;  1CQT A;  1PUF B;  1TW2 A;  1BL0 A;  3S93 A;  4CCO A;  2E1O A;  4M3D A;  2DAO A;  2HYG D;  4F92 B;  3EUH A;  2XAQ A;  1MSF C;  1QPI A;  4YII A;  3HXL A;  3K4L A;  2XC7 A;  1TWC J;  2NS0 A;  4IVN A;  2CW8 A;  2PQ8 A;  1NG7 A;  3MFK A;  4O5V A;  1JJ8 C;  2IGO A;  2M9H A;  1JKP C;  4OAZ A;  4RAF A;  4ZYD A;  2E7X A;  4V19 K;  2XKO A;  4OOI A;  4CCM A;  2H1L A;  3LOC A;  1MMD A;  2IVM A;  2I10 A;  4BYY A;  2Y31 A;  2KZG A;  2V1U A;  5K5Q A;  4BNC A;  2KJB A;  2GQQ A;  3KCC A;  2DW4 A;  3K4K A;  2WAQ A;  2ZB9 A;  2ISY A;  1T2K A;  2L01 A;  3CCJ I;  4Y52 J;  4CZZ A;  4ON0 A;  1H88 C;  4CCN A;  3DF8 A;  2E1N A;  3QU6 A;  3O2P E;  4TV7 A;  4ZZL A;  5HNH A;  4NHJ A;  3SXY A;  4N9I A;  3F8F A;  4A3E J;  2Q2E B;  1MBH A;  3A0B C;  3C1D A;  3MN2 A;  4OMZ A;  4KT5 C;  4FQG A;  4DNC A;  1QQI A;  4KIF A;  5TIS C;  2JWT A;  3N97 A;  3BDD A;  2VQL A;  4CCK A;  5KNL A;  2XVC A;  2QQ8 A;  4C2M J;  4BE2 A;  5K7F A;  2GA2 A;  4BY7 J;  2Q0O A;  2XIG A;  3VB2 A;  1I1S A;  4RGR A;  2VAS A;  2F2E A;  3H3V K;  5D4S A;  2G7U A;  1X19 A;  3A0H C;  3KEQ A;  3T8T A;  3H9Q A;  4OIQ F;  5DCM A;  2IS4 A;  3AG3 H;  3EET A;  5J3L A;  5LHG A;  5E1X A;  5BOX A;  3F8C A;  2DTZ A;  2L2O A;  5F08 A;  3BG9 A;  3GUD A;  5BNG A;  2F5D A;  3AG2 H;  5C3E J;  2LF8 A;  1YW9 A;  3WG7 H;  2CUZ A;  2DO7 A;  1B8I B;  2RNG A;  1XGO A;  1UG0 A;  2NVT J;  1UJ8 A;  4DBR A;  1K4S A;  2IA0 A;  2MD0 A;  4LGW A;  3PUF A;  3PIP F;  2JA8 J;  1T38 A;  2R5Z B;  2K9L A;  1BIA A;  2LP0 A;  2W85 A;  1YYV A;  5JVG F;  3K1M A;  3DPT A;  3SJM A;  3FXJ A;  4HX8 A;  3BZC A;  4KNY A;  1T0F C;  1LDD A;  3PUB A;  2OTL I;  2KRC A;  4LB5 A;  2HZT A;  3R0J A;  3OYC A;  4MQ9 F;  2OCC H;  3ZQQ A;  4B3A A;  2K86 A;  4ZDP A;  1JKQ C;  2AQE A;  4R1H A;  3FXM A;  1JHH A;  1H8A C;  2M7B A;  3ZMZ A;  3ZQL A;  4HX7 A;  3SFI A;  2ME6 A;  2R3S A;  3CO7 C;  4HSR A;  2DN0 A;  4D9J A;  2BW3 A;  3ZQI A;  1WJ5 A;  3FHN A;  2FNA A;  2WY7 Q;  3E5X A;  4LIV A;  2JVG A;  2H6C A;  2Z2S B;  3L9F A;  3VYS B;  3JAM Z;  4B43 A;  3ONQ A;  3D5S C;  2PX9 A;  3MKY B;  3IHU A;  4RB2 C;  3CCQ I;  2YR2 A;  3OYI A;  3OWT A;  4G6Q A;  3IKT A;  3DFG A;  3H92 A;  3HYI A;  4AYB N;  3B73 A;  2HEO A;  2MAB A;  3GTO J;  1QVU A;  1RUN A;  3N05 A;  3F23 A;  1VQ6 I;  3ABK H;  3RZO J;  2XAH A;  4XON A;  4HLY A;  3F8M A;  3QP5 A;  2KDO A;  3PO3 J;  2Y75 A;  1LEB A;  4ENN A;  3FXO A;  3DP7 A;  1T39 A;  1Y0N A;  2QEN A;  3G2B A;  2E71 A;  4BH9 A;  1LE8 B;  1KQ8 A;  3TGN A;  2XGD A;  4HF2 A;  4DYR A;  1IAW A;  2AS5 F;  3JW4 A;  4ZTF A;  4P1W A;  2IS1 A;  1YRN A;  1G3S A;  3ZMD A;  4H4K C;  5ICF A;  1H0M A;  1A6I A;  2CFX A;  3TW7 A;  1Y0U A;  4C9Y A;  3C2B A;  1IZ1 A;  2LC2 A;  1V54 H;  3JR9 A;  4QSH A;  4E7K A;  1Z67 A;  4WXD A;  1A35 A;  2L02 A;  2IS2 A;  2IGN A;  4FX4 A;  3MEX A;  4FE7 A;  2ZXI A;  3C2H A;  3JRA A;  2K4J A;  3V7C A;  2OUM A;  4JOM A;  1L3L A;  5ICC A;  2DTR A;  4BJT A;  2PJR B;  3NRV A;  4MQV A;  5CVV A;  3FDY A;  1WVR A;  4IJA A;  1ZH5 A;  1BN5 A;  1IN4 A;  2XGC A;  2L7K A;  4A0Y A;  2DFI A;  2DT6 A;  2E7W A;  2KIQ A;  1R5I D;  4DIQ A;  2RC4 A;  4NQW A;  1O4X A;  1OPC A;  2XB0 X;  2K85 A;  4IO9 F;  2DFF A;  4JBA A;  5EGO B;  4XID A;  4MEX F;  1RKW A;  3WGG A;  5M5Y J;  1SMT A;  3P9C A;  1AKH B;  4EEF G;  3AG1 H;  1ERD A;  2FJ1 A;  2VJJ A;  4C30 A;  1FT9 A;  2CMP A;  3DTK A;  3M8E A;  2EIN H;  2HGC A;  1WJD A;  2QBY A;  1Z6R A;  4YIR X;  1Y1V J;  3GTP J;  3HHG A;  1WJE A;  2EIK H;  1AHD P;  3JRE A;  4E7H A;  2M7A A;  2JRM A;  5ERI A;  1JUP A;  5CQG A;  2FQ4 A;  3IRR A;  4G12 A;  2D1H A;  3TL4 X;  3QPL A;  4Q4Z F;  3CCE I;  1MSE C;  3F0C A;  2GXG A;  4A3J J;  5CQE A;  2FD5 A;  1D1A A;  1Z0X A;  3D1N I;  2F5C A;  2E19 A;  1B4A A;  2KIS A;  5FKK A;  4EV0 A;  4PGH A;  4XRF A;  2KQR A;  1GV5 A;  3M8J A;  3WGI A;  2P5L C;  3RI4 A;  3OYE A;  2A6E F;  2K4B A;  1S6L A;  1OLT A;  1TT0 A;  4HLX A;  3DBL B;  4BXX J;  1B9M A;  2OV7 A;  1IUF A;  2XF7 A;  2EPF A;  5FKM A;  3HSR A;  1X4O A;  3U1K A;  2RQP A;  1ON1 A;  3H36 A;  3F3X A;  3F9K A;  2CQ7 A;  3V8L A;  5H2F C;  4F91 B;  1K7A A;  2I5U A;  3BR3 A;  5TGT A;  1E3O C;  2DYS H;  2V1D A;  1JXS A;  4EJW A;  3FMQ A;  3S2H J;  2KIU A;  4Y13 A;  2ZXH A;  1ZG1 A;  4EAT A;  2DOE A;  2RQQ A;  2OZU A;  3KYC B;  2DA3 A;  2CUJ A;  3ASO H;  2ZXW H;  1OR7 C;  2Z5U A;  3CME I;  5TJJ A;  4A3L J;  2PG4 A;  1BI3 A;  1BI1 A;  1TTY A;  1FBS A;  1Y56 A;  2OAZ A;  2VQC A;  2L54 A;  1B72 A;  3MD2 A;  3L2Q A;  4XOR A;  1JKR C;  4MHG A;  1OYW A;  1E17 A;  2JA5 J;  2RRE A;  2LYC A;  1FOK A;  3L00 A;  2QEX I;  3ZQC A;  1WQ2 A;  5H6Q A;  2E2I J;  4Q47 A;  1XSD A;  5FLX Z;  2WB1 A;  1V3F A;  4FT8 A;  2A69 F;  5DV5 A;  2IBD A;  1N75 A;  3ZMV A;  2IGK A;  4ZTJ A;  2BV6 A;  2OPT A;  4GXO A;  1VQN I;  2A5W A;  4NUB A;  1F5T A;  2HOS A;  2FML A;  1P92 A;  3HHH A;  3F22 A;  2OJE D;  3RQ4 A;  3GTL J;  2HTJ A;  2ZO4 A;  3S3M A;  3DBR B;  3CES A;  2WAQ N;  4PFO A;  2QQ9 A;  2LOO A;  2A3S A;  2KRF A;  1QNT A;  4BHP A;  2I8D A;  2K9M A;  4KIB A;  4HW0 A;  2Y9Y A;  4A12 A;  1LUJ B;  4N4N B;  3ZP5 A;  1RC9 A;  3W3C A;  2HOT A;  4L0Y B;  1OCR H;  1N78 A;  4AWX B;  2CV2 A;  1WCM J;  2FA5 A;  2IGM A;  4BAY A;  4EGY A;  2H94 A;  3WTS C;  3VSL A;  4CSW A;  2JUG A;  3HTU A;  1SFK A;  3PNY A;  4CO8 A;  2QQB A;  3H1C A;  1XGN A;  4RM3 A;  3BR0 A;  3R60 A;  2G7H A;  2QKL B;  1FEX A;  1FIA A;  1YQA A;  5CYV A;  3FXU A;  1HLV A;  5FRN A;  1ONV A;  1XGM A;  2Y0M A;  4B47 A;  2LG4 A;  3GME A;  4E7J A;  1YFH A;  4MFD A;  2XRL A;  2PMU A;  1KYZ A;  1BBY A;  3CJR B;  3WE3 A;  1TQP A;  2O0Y A;  3NAR A;  1LJ9 A;  1W5S A;  2XPW A;  3OS1 A;  3BQY A;  3RYR A;  3HOZ J;  2X4H A;  1ULY A;  5ICG A;  3QYF A;  5KCM A;  5JLX A;  3JRF A;  4HNT A;  1OCT C;  1WI3 A;  2NVX J;  2QCO A;  2VC1 A;  5KK1 A;  5DTD A;  2FNP A;  2W48 A;  5K7H A;  3QRF F;  3UR3 C;  3KP3 A;  4XBF A;  1IXR C;  4UHT A;  2P6T A;  5FKL A;  4HF0 A;  2LKS A;  2IAI A;  5DDG A;  1GVD A;  2R5Y A;  3HOT A;  2EIL H;  3Q0W A;  1TNT A;  1RR8 C;  1D0Z A;  1T6S A;  3E1S A;  4IHY A;  1XD7 A;  2A61 A;  2IW5 A;  2V1N A;  1TLH B;  4BE0 A;  1EV7 A;  1U9N A;  1TWG J;  2LRE A;  4IHS A;  4BKX A;  4C3J J;  5FD5 A;  3GFI A;  3BZK A;  2DPD A;  3BG6 A;  3BTC A;  3FXL A;  5L3F A;  2HZD A;  3OIP A;  2M45 A;  3J7Z I;  2CWE A;  3DLL F;  1U5T B;  4A0X A;  3E97 A;  3TDZ C;  3ZXS A;  1A04 A;  4XKV A;  3J7A Y;  3OY9 A;  3PQJ A;  4EJO A;  2QUF A;  3GZ5 A;  4CYD A;  2LR8 A;  1IN7 A;  3DEE A;  4G6D A;  3ISP A;  3ZQ7 A;  1KU9 A;  1D5V A;  3RPU A;  1T0F A;  5FGM A;  2EFO A;  2EWN A;  4H0E A;  2XAJ A;  1VQL I;  1DGR M;  2ISZ A;  3BC8 A;  4KJZ A;  1T08 B;  2HKO A;  3IC7 A;  2DA7 A;  1KA8 A;  2L7M P;  2PN6 A;  5E3O A;  2WV1 A;  1SVL A;  2BZT A;  3P9I A;  4G94 A;  4HAM A;  5L3B A;  2QSG X;  4UVC A;  4LLL A;  2M34 A;  3W6K B;  5F64 A;  2MC3 A;  1ETV A;  2OQG A;  1FTZ A;  1J9I A;  2O7O A;  3OV8 A;  1HKS A;  1TWF J;  3PIO F;  3I56 I;  3E3V A;  2M1B A;  2LDU A;  3HSF A;  2DMQ A;  3T0Y A;  1YE9 A;  2MW8 A;  4HYE A;  2L7Z A;  1J2X A;  1K6Y A;  2HI3 A;  2JN6 A;  1OQY A;  1OYY A;  2R7O A;  2E2H J;  4XRM A;  1WGX A;  4BXU A;  1ZEL A;  4LOC A;  3IWZ A;  3BPX A;  3HSE A;  3O6B B;  5AIQ A;  2E60 A;  2P8T A;  2QF7 A;  3ROU A;  4E70 A;  2VXD A;  2UXN A;  3OOU A;  4LMY A;  2JQ7 A;  1MH3 A;  3HKZ A;  2H8R A;  1O3S A;  1XDU A;  6PAX A;  2Y69 H;  4RAG A;  3IH2 A;  2XPU A;  1JUS A;  1A36 A;  2BHZ A;  1LB2 A;  2DQL A;  5DS9 A;  2DOF A;  2FUG 2;  4PDK A;  2JA6 J;  4LG0 A;  2CW0 F;  4HZF A;  4R8H A;  2VBZ A;  2NVU B;  1JTX A;  1NH3 A;  1RZ4 A;  4DBQ A;  2P6S A;  5FLV A;  4C2U A;  2V6E A;  2ZSI B;  2CYY A;  3EQL F;  3EYY A;  2P81 A;  2LRD A;  1P6R A;  2DCE A;  5F6F A;  3H0D A;  4EJT A;  1XG1 A;  3JSO A;  2VUM J;  2WY8 Q;  4G7Z F;  2Y0S N;  3W2W A;  2QSH X;  1F43 A;  2IA1 A;  1XPX A;  3HZJ A;  2P4W A;  4IRH A;  2CH0 A;  1E0E A;  3OYN A;  4RM2 A;  1U9O A;  4A3K J;  2HVS A;  2JA7 J;  1P4A A;  4HEA 2;  4XLA A;  5F04 A;  4ZH4 F;  1BIB A;  4F7Z A;  2CS3 A;  5F0C A;  3TOB A;  4P55 A;  1D8K A;  4E7I A;  2STT A;  4BXF A;  3QAH A;  1R1V A;  4L5I A;  1W7P A;  1HXD A;  1A5J A;  4XKC A;  1P9Q C;  3OYK A;  2YSR A;  4PSW A;  4LLG F;  1ZLJ A;  5FJ8 J;  2GXA A;  3KYD B;  3MMY B;  2DMP A;  2ECB A;  2PLY A;  2EIM H;  2KDZ A;  4E7S A;  1Y8R B;  3J81 Z;  3K70 D;  4BBS J;  2DU9 A;  1T98 A;  1JT6 A;  3T1B A;  1PYV A;  5DM6 F;  2LTP A;  3EPZ A;  2AQF A;  3JRB A;  2JSC A;  2LK2 A;  2HWV A;  3SEQ A;  3K9T A;  5BPI A;  1DDN A;  1ETO A;  2XHK A;  4GRI A;  4OIN F;  4CZC A;  2IP2 A;  4D7N A;  3QP6 A;  2ETH A;  1G6N A;  5LRR A;  2ZXJ A;  3GFM A;  1JGS A;  1SMY F;  3FXK A;  5HVQ C;  2HXI A;  4PCQ A;  1IGN A;  4EMS A;  5ILV A;  2X6X A;  4ZJZ A;  2PMZ A;  2WA0 A;  1BC8 C;  4IZZ A;  3ABL H;  1ZGW A;  5F27 A;  3HRM A;  2DA5 A;  4PJ0 C;  4XLC A;  2OA4 A;  2C6Y A;  2ADU A;  1TZL A;  3F8N A;  1BJA A;  3KZZ A;  3WGH A;  1YO5 C;  4MFE A;  4A6D A;  3I59 B;  3JAM K;  1ZAR A;  1D5Y A;  2WB1 N;  3MKW B;  2WAD A;  2HDD A;  3I58 A;  3CF5 F;  3ML6 A;  1OR7 A;  3BT9 A;  5E3M A;  1MBF A;  3L09 A;  1WKM A;  2M5W A;  4AIH A;  4P96 A;  3ZMU A;  1YI2 I;  5GAD J;  5D8K B;  1NK2 P;  1UST A;  4Y4R A;  1LDK B;  4M6X A;  4XN3 A;  5M5X J;  3RQI A;  1V55 H;  1X3W B;  1R1U A;  5IYD J;  3H3Z A;  1YIT I;  3OYG A;  4G9Y A;  4XMY A;  1XTA A;  5B5E C;  2LBF B;  1UMQ A;  3IKV A;  1FY7 A;  1OMI A;  3VPR A;  1WJC A;  5IYB J;  1FOX A;  1YHQ I;  4BS9 A;  3ZN0 A;  4Z6Y A;  1R6R A;  2BGC A;  4M3E A;  2L5Q A;  2HYF A;  1FYL A;  3K0L A;  3B6A A;  4W97 A;  1IV6 A;  3NWS A;  2LF7 A;  1LFB A;  5ED4 A;  1HBX G;  1IRZ A;  2VON A;  2VJ4 A;  3K4B A;  5FO5 A;  1R71 A;  1GHC A;  1JHF A;  2CJJ A;  4II3 A;  3ZN1 A;  4AVP A;  4ESJ A;  1S72 I;  2FQ3 A;  3GZ6 A;  1SC7 A;  1IRF A;  2P0W A;  3DLA A;  3HOU J;  2ZJQ F;  2ELK A;  1BW5 A;  1AOY A;  3FWE A;  4YRV A;  1VQO I;  4HG2 A;  3KP7 A;  1D3Y A;  4XOT A;  1XCB A;  4F55 A;  4P9F A;  3M3Y J;  1XSX A;  2DK5 A;  2RNJ A;  3A01 A;  2ZME B;  5J8F A;  2VJ5 A;  1Z3Y A;  4GCV A;  2XAF A;  1WPK A;  3ECH A;  3H3U A;  2BHY A;  2OF7 A;  4RB1 A;  4P9U A;  5C44 J;  1Z9C A;  1VF9 A;  3CUQ B;  2FX0 A;  4XQF A;  4HOB A;  3ERE D;  1GUU A;  2AXT C;  3BCA A;  3GBG A;  4RB3 C;  3EUK L;  5FFZ A;  3HOX J;  3GYH X;  4RLQ A;  1IRG A;  3K4M A;  4PK4 A;  5CVR A;  2CSO A;  3GWZ A;  3KYL A;  4L18 B;  2Y48 A;  2B0L A;  1X2N A;  3SQN A;  5JHF A;  4HRI A;  2MH2 A;  1K78 B;  2GBY A;  3LQR A;  3AG4 H;  3FMS A;  3O8G A;  3QQA A;  5EZH A;  2H27 A;  3SZG A;  5J40 A;  4A3G J;  3FBI B;  4LIU A;  2TCT A;  3BR1 A;  3IUO A;  1WHU A;  3SYT A;  1G3Y A;  4ZYG A;  4Y17 A;  3MZY A;  3G1M A;  3LAP A;  3CUO A;  4N0B A;  5IY5 H;  3OS2 A;  4ZDO A;  1FTT A;  1V5F A;  3VYT B;  5J8C A;  1GDT A;  2VOP A;  2EBI A;  2XV4 S;  2IT0 A;  2MYS A;  4N9H A;  1FMW A;  2P7V B;  3AKZ A;  4CYC A;  2DFH A;  4UY8 I;  4IOC F;  1SFU A;  5IOY A;  3HOV J;  3M4O J;  4M3B A;  5B66 C;  1WWX A;  5HDK A;  1UHW A;  4UUS B;  2F48 A;  4X6A J;  4XM3 A;  1BW6 A;  4QIW N;  3MQ0 A;  4GFB A;  2KPM A;  1MNM C;  2DDA A;  2EIJ H;  3BLY A;  4CXF A;  2A07 F;  2RV8 A;  3DTI A;  3WOD F;  3S2W A;  5HNF A;  2EZL A;  1XDS A;  4M6Y A;  2HVQ A;  4KN4 X;  3PO2 J;  4S0H B;  4I98 B;  1STZ A;  4OIO F;  2X6O A;  4LFU A;  3ASN H;  5D6E A;  2F5E A;  2LY1 A;  1T95 A;  2NOG A;  3CDL A;  4FX0 A;  5F0F A;  4I6Z A;  3S17 J;  2VPR A;  2CQX A;  2YX4 A;  4J01 A;  1QPM A;  1P4W A;  4XLP F;  1MBG A;  1K4T A;  1MW7 A;  1FYK A;  1G2H A;  5CPR B;  2AHQ A;  1OIS A;  3CCV I;  1D8J A;  1X3U A;  4BDZ A;  4Y7N J;  3FXR A;  1IN8 A;  4ZC3 A;  2NOJ B;  4GGG A;  4HV6 A;  1QZZ A;  4PJJ A;  3BWG A;  3HL2 A;  3KE2 A;  4FCY A;  2BEO A;  3I55 I;  1K83 J;  3ZQG A;  1ZRE A;  2OTJ I;  1QBJ A;  4X1E A;  1WH7 A;  1E3H A;  2M0M A;  4C3H J;  3K4J A;  5HDG A;  1REP C;  4IHV A;  5FLX K;  1MMA A;  3CLO A;  3KEO A;  3QU3 A;  3RCO A;  1G4D A;  3KLO A;  4IF4 A;  3HKZ N;  4DYQ A;  3PFY A;  3BR6 A;  4A2U A;  3L2W A;  1ODD A;  1ETK A;  2RGV A;  1Z21 A;  1ZK8 A;  4KIS A;  2R7Q A;  3MWM A;  3S1M J;  1BM9 A;  3NWT A;  1QVT A;  1ZR2 A;  4DZP A;  3G3Z A;  2VBY A;  3HRU A;  1ZQ3 P;  1Q1V A;  2D45 A;  1N77 A;  1J0R A;  3S2D J;  2V9V A;  2FEZ A;  1QO0 D;  3ZMS A;  1YX5 A;  1LVA A;  4IXA A;  3K1N A;  4YIF A;  2J5O A;  1FIP A;  4I99 C;  3WHB A;  1GT0 C;  2MD5 A;  4UVA A;  3HUG B;  1YLF A;  4FE4 A;  3CF2 A;  2BVM A;  4I01 A;  3KP4 A;  2VE9 A;  3KX2 A;  2ZSH B;  1NK3 P;  4B3X A;  5L3E A;  4BJ6 C;  1JTY A;  5M5W J;  4XKB A;  2ZFU A;  4IX7 A;  2H8W A;  1ETX A;  2BE5 F;  3JTH A;  4RGX A;  1KU7 A;  1TL8 A;  2RAE A;  2DDB A;  3COA C;  3F6O A;  2VPL A;  3L2V A;  3GEZ A;  1MNE A;  4I0B A;  3LFU A;  2QGU A;  1QA6 A;  1S3J A;  1XMA A;  1Z6T A;  1MJA A;  4QPO A;  4V2F A;  4XSX F;  5E3L A;  3J80 K;  1JKO C;  2Y2Z A;  3HTS B;  1EH7 A;  2DFE A;  4N4O B;  3A1Y A;  3N4M A;  4MNU A;  4OMY A;  1RET A;  5B3S H;  3S14 J;  1E3P A;  4LG3 A;  2A6H F;  4IHT A;  2R7U A;  3E0J B;  5BMZ A;  2LY9 A;  1XGS A;  1R5H A;  2DQR A;  1R5G A;  1J5Y A;  1FOY A;  2IA2 A;  3PM1 A;  2MLK A;  5ICE A;  4BUP A;  4AIJ A;  1LQ1 A;  1T56 A;  1X4P A;  1YG2 A;  5JLW A;  2LKX A;  3DCF A;  4JX4 A;  2IS6 A;  4BJ5 C;  3G73 A;  1CF7 B;  3I4N J;  3H5N A;  2QKM B;  2X1C A;  5DUI A;  4BEH A;  2OCE A;  1DPR A;  2PMZ N;  1MDM B;  5CKT A;  1R22 A;  2BVL A;  5EG0 A;  2N8G A;  3M8F A;  1WFX A;  1LKX A;  3W2V A;  3TMO A;  3RYP A;  3A02 A;  4LB6 B;  3R61 A;  3HOW J;  1PUF A;  2OZ6 A;  3WTW C;  5LEJ A;  3OYH A;  1ZR4 A;  2DLL A;  1YTY A;  1VZ0 A;  1IW7 F;  1G59 A;  2F4M B;  4J00 A;  1HOM A;  1D1C A;  4RA2 A;  1HST A;  2BY1 A;  2H09 A;  2VC0 A;  2R7D A;  2DA1 A;  2GLO A;  3CP2 A;  5A2Q K;  2JZY A;  2W7N A;  3CC4 I;  3GLX A;  1EJ9 A;  1X2M A;  5D4R A;  3DPU A;  2UWM A;  3LSJ A;  1SD6 A;  3S1N J;  5FB2 A;  5EZG A;  1XMK A;  5IOZ A;  1IN5 A;  3K7A J;  3I4P A;  5BPD A;  4YFX F;  2K40 A;  4BU2 A;  4NNJ A;  4U87 A;  1HCR A;  2HYJ A;  2ZC2 A;  1D1B A;  4U7B A;  3KZI C;  2DOA A;  2JJ7 A;  2X1D A;  2QQA A;  3V8J A;  3K70 C;  1W0T A;  2O9L A;  5E1Z B;  3VOD A;  2DYR H;  3I0T A;  2OBP A;  2VT2 A;  1OCO H;  2QM3 A;  2WC2 A;  1K61 A;  3CJN A;  2VJI A;  1UCR A;  2Q2E A;  4XRS G;  5GAH J;  4D5F A;  4S04 A;  1DGW Y;  1B9N A;  1ZG3 A;  2Y30 A;  2K9N A;  1VQM I;  5E79 C;  2E36 A;  2Y9Z A;  3BTL A;  4AVZ A;  4AU7 A;  1FBQ A;  2ID3 A;  3TBI A;  4B09 A;  4IPA A;  1IRX A;  2TRT A;  2HPM A;  4LK0 F;  2F6C A;  2W4S A;  1U2W A;  4IHX A;  3JRI A;  4Q48 A;  3SZT A;  4U0Y A;  4E7L A;  1VQ8 I;  4AC0 A;  1Z91 A;  3KP2 A;  2HQ5 A;  4G7H F;  5J1U A;  2XKP A;  2DMU A;  5E3N A;  4XIC A;  1PDN C;  4OWR B;  2V1X A;  3QOE A;  4A69 C;  1DU6 A;  5JHU A;  4CHU A;  3LWF A;  1NTC A;  5JVT A;  3S1Q J;  1YIJ I;  1KQ0 A;  4NC8 A;  5GAG J;  4ANJ A;  3OYD A;  5DD4 A;  3L2R A;  1TWH J;  1HW1 A;  3LSG A;  3OIQ A;  1R23 A;  4BE1 A;  1B8I A;  5J4Y A;  4WF2 A;  2GZW A;  3CC7 I;  4HBL A;  3IAM 2;  2JA2 A;  2GOM A;  1U5T C;  2M8E A;  1VI0 A;  3LMM A;  2EZK A;  2R5Z A;  1QHG A;  5HS9 A;  4B1R A;  1SAN A;  3I64 A;  3LQQ A;  4PJM A;  3OR1 C;  1R36 A;  1Y8Q B;  2XF5 A;  1O7L A;  3HOS A;  4ZYA A;  2ZFW A;  2MA3 A;  4U0W A;  3J80 Z;  1EH8 A;  1JE8 A;  4AIK A;  3CC2 I;  3QPT A;  3E5Q A;  1S5L C;  3Q5F A;  4LIT A;  2O8X A;  4CCL A;  5F0H A;  1UHM A;  2GOX B;  3Q0V A;  3RTR A;  3C3W A;  1FC3 A;  2FBH A;  2UZK A;  1SFO J;  3IP4 B;  3ESW B;  2R7W A;  2O3F A;  1SD7 A;  1WJF A;  1R4M B;  3J81 K;  2VOO A;  1S9H A;  4LK1 F;  3MZ8 A;  3GVA A;  3LSI A;  3WTU C;  2E34 A;  3JRC A;  5EEA A;  3JRH A;  5E8G A;  4A3M J;  5LHI A;  1I39 A;  3PJR A;  1I6H J;  5AON A;  1V4R A;  3E6B A;  3OR2 C;  3TP3 A;  2HNH A;  2JMW A;  5EEG A;  2JTV A;  3S32 A;  2V7F A;  1TQI A;  1SD5 A;  2A6T A;  3ZGK A;  2FBI A;  1J7K A;  4B48 A;  2WAE A;  4BQN A;  4CUG A;  1Z05 A;  3LNQ A;  1RPW A;  3QPS A;  3GTK J;  1RKT A;  3W6V A;  3NQO A;  4MTE A;  1Z3X A;  5C4J J;  4O3M A;  3GTM J;  3CMM A;  2KRH A;  4GYG A;  1BOB A;  3KZY A;  1LE8 A;  2PMH A;  2HDW A;  5CVJ A;  3LA7 A;  4GDF A;  1O3T A;  5HLI A;  5IP9 J;  5A2Q Z;  2NNY A;  5LGU A;  4L0Z B;  4L9N A;  3TP0 A;  5DEQ A;  1OYI A;  1YJ9 I;  2X6W A;  1BA5 A;  1ZRC A;  4RS8 A;  2M2E A;  5H6R A;  2FXA A;  2HQN A;  4HQE A;  1ZTR A;  3LA3 A;  4WCG A;  2J5P A;  2DJN A;  1F4K A;  1APL C;  1E2X A;  3TO6 A;  3GW2 A;  2K9Q A;  2UV1 A;  1HC8 A;  2FF4 A;  2L4A A;  2P5V A;  2W57 A;  3RDI A;  1VQK I;  2PJR A;  1J75 A;  1WI9 A;  2P7C B;  3I53 A;  1X3Z B;  2VT3 A;  4CGZ A;  4UVB A;  3CMY A;  3NAU A;  1K6O A;  4MGR A;  2LNB A;  2M30 A;  3VWB A;  5DCM B;  3CCL I;  4MEY F;  2DT5 A;  1I3A A;  1ZKG A;  4M71 A;  5EGO A;  3AL0 B;  4AM3 A;  1IXC A;  1AKH A;  4I76 A;  4RAZ A;  5E1W A;  3BZ6 A;  1IJW C;  3FKJ A;  5FFX A;  1LNW A;  5CVU A;  4RAY A;  4CDG A;  1G8X A;  1HDD C;  3I5U A;  3OL4 A;  4RBO A;  1VFC A;  2WBM A;  1OFC X;  2R92 J;  4RLF A;  1KON A;  1GXQ A;  2CUF A;  3LSK A;  3W6J B;  3F21 A;  2ID6 A;  1WSU A;  2M8G X;  2L9S A;  4BHC A;  3MCZ A;  3U21 A;  5D8L B;  1IDZ A;  3GFL A;  2PI0 A;  3FBN B;  1QU3 A;  3S3O A;  3K69 A;  1FSH A;  4KIG A;  3K4N A;  4AYB A;  5GP9 A;  1FX7 A;  3HOY J;  2K27 A;  2MSY A;  2HTS A;  1HKQ A;  2F4O B;  3CQZ J;  2XAS A;  3REO A;  1X1P A;  4MTD A;  4M3F A;  5K7Z A;  1OCP A;  1Z77 A;  2ELJ A;  4L9T A;  2MFZ A;  4XKW A;  5TRD A;  1X1C A;  4IOA F;  3MAJ A;  2CUE A;  5D5V B;  3IWF A;  3VEP A;  3HB9 A;  2EV6 A;  2Z16 A;  3WE2 A;  2BW3 B;  1FNN A;  3O8H A;  2KJC A;  3KP6 A;  4IQJ A;  1IN6 A;  3WTZ A;  5HS8 A;  3SHF A;  2QSF X;  3OIO A;  4F52 A;  2PEX A;  1YW8 A;  5IPA A;  3TKY A;  1FLI A;  2FSW A;  4JP0 A;  3ZRG A;  1MBK A;  2CQQ A;  3KLN A;  3HC7 A;  4EJU A;  2PFB A;  3FKI J;  1TWA J;  3DXJ F;  3DEU A;  5LLQ A;  3P7N A;  2EJR A;  4JX6 A;  2R7R A;  1EF4 A;  1J09 A;  5KHD A;  4NC7 A;  4OAY A;  2D5V A;  2K7L A;  4M9X A;  3OYF A;  2W1O A;  4GYI A;  5D6F A;  3RSN A;  4WXH A;  2M3A A;  3JRD A;  1PUE E;  3PNV A;  4XSZ F;  3WTT C;  2DJI A;  2OQR A;  1YW7 A;  3FF5 A;  5JFR A;  4WX9 A;  1W5C C;  2YS9 A;  2HS5 A;  2YPR A;  3CJQ B;  4BY1 J;  5D5W B;  1IV8 A;  2IXS A;  1W1W E;  3WU2 C;  1U8B A;  4IEJ A;  1YRN B;  1B59 A;  2XUB A;  1HA8 A;  3RKQ A;  3PQK A;  2OC6 A;  2AXL A;  2XF6 A;  4UUV A;  3HPH A;  4Y15 A;  4EM0 B;  1ORK A;  3BQZ A;  2FU4 A;  5IT9 K;  2W24 A;  2QLZ A;  1IG7 A;  1TQM A;  2R7S A;  1BI2 A;  3TOA A;  2EB7 A;  3ULQ B;  2E1C A;  2H1K A;  2V9P A;  2CQK A;  2GM4 A;  3ELK A;  5LFA A;  4B8X A;  4YG2 F;  4HV5 A;  4MO7 A;  1XSV A;  4NQW B;  4YEJ A;  4X0G A;  3R6S A;  5C4X J;  1AA7 A;  4G7O F;  2CGP A;  2VKH A;  1MMG A;  2BBY A;  3L7W A;  4XR6 A;  4A3D J;  2LLK A;  2ZME C;  1SAX A;  1SD4 A;  2M87 A;  4U88 A;  2MLG A;  4JQF A;  3RIR A;  4BAC A;  2E1M B;  2JUC A;  5GPA A;  3RZD J;  1ETY A;  2K5C A;  3DU6 A;  3VDX A;  4A0Z A;  2ZJR F;  2QBY B;  2XSJ C;  5IYC J;  3E6C C;  2EV0 A;  3HEF A;  3CUQ C;  3H0G J;  2LSO A;  4JK1 X;  4CA0 A;  2JPB A;  4RGS A;  4A93 J;  1X1A A;  4M9S A;  4DZJ A;  1UB9 A;  2Z3Y A;  1W36 D;  3OMY A;  1UAA A;  4BBR J;  3B02 A;  5AIP A;  1RNL A;  1GXP A;  1FYM A;  2IJL A;  4ASN A;  1KU3 A;  3W2A A;  1FP1 D;  5FKN A;  4PGG A;  1WJA A;  2HU9 A;  3BJ6 A;  3BR2 A;  3OL3 A;  4XL9 A;  4WWC A;  3MKZ A;  2DOD A;  3K2Z A;  3WTX C;  4ZYH A;  2ACJ A;  2R4G A;  4JYK A;  4I0A A;  2WAF A;  1Z1D A;  1R4N B;  3ZPL A;  3LST A;  2FRH A;  4DJA A;  2O6G E;  3GTQ J;  5DD8 A;  2WV0 A;  1QHH D;  1S7A A;  4R79 A;  2DA4 A;  1BOA A;  1IC8 A;  1R7J A;  3V7S A;  3CP8 A;  2CV1 A;  1O3Q A;  1RUO A;  1V5E A;  1RRJ A;  3U2R A;  1U5T A;  3S16 J;  1ZRD A;  3HJE A;  2YUS A;  2Q1Z B;  4IRI A; 
#chains in the Genus database with same CATH homology
 1W0U A;  3WHC A;  3A03 A;  3BR0 A;  1JGG A;  1FEX A;  1FIA A;  3ZQF A;  4V2F A;  5E3L A;  1UHS A;  4MLO A;  3L1P A;  1HLV A;  1JKO C;  2Y2Z A;  4MFD A;  2XRL A;  1B72 B;  1RET A;  1U78 A;  3S14 J;  2L7F P;  3NAR A;  2B63 J;  2XPW A;  3BQY A;  3HOZ J;  5GPC A;  5JLX A;  4FIS A;  3JRF A;  1BJZ A;  1OCT C;  2LY9 A;  3S1R J;  1WI3 A;  2NVX J;  2QCO A;  4JX5 A;  2CU7 A;  5FLM J;  1UG2 A;  5DTD A;  2W48 A;  5K7H A;  3K2A A;  2NVY J;  1RR7 A;  3PM1 A;  1ITY A;  4DYC A;  5FKL A;  2IAI A;  1GVD A;  2R5Y A;  1AU7 A;  1T56 A;  5JLW A;  2LKX A;  3Q0W A;  3DCF A;  4JX4 A;  3ZQH A;  3I4N J;  3Q0U A;  4RDU A;  4IHY A;  1U9N A;  1TWG J;  2PMZ N;  4BKX A;  4C3J J;  5EG0 A;  2N8G A;  3FIS A;  3BG5 A;  3CCY A;  3BTJ A;  1MBJ A;  3BTC A;  4HNV A;  5J1R A;  3A02 A;  2EZH A;  3HOW J;  1PUF A;  1ZR4 A;  3BG3 A;  3HBL A;  1Y1W J;  3BR5 A;  4V2G A;  1HOM A;  5EYR A;  1DU0 A;  1XS9 A;  2LR8 A;  1TC3 C;  2GLO A;  2DA1 A;  3SDG A;  2X9D A;  2O8K A;  3G1L A;  1X2M A;  4C3I J;  2M0C A;  2XB5 A;  3LSJ A;  3S1N J;  5IP6 A;  5EZG A;  5IOZ A;  1GV2 A;  3FK6 A;  3K7A J;  2DA7 A;  2K40 A;  2CRG A;  2L7M P;  5E3O A;  2MGQ A;  2WV1 A;  3B6C A;  1HCR A;  2HYJ A;  3MKL A;  2M34 A;  3IV5 A;  1W0T A;  2JJ7 A;  3DEW A;  2O9L A;  1ETV A;  1FTZ A;  2E2J J;  2O7O A;  1X58 A;  5J1Y A;  1TWF J;  4A3I J;  2R0Q C;  1K61 A;  5HOD A;  2R5Y B;  4XRS G;  2L9R A;  2DMQ A;  4D5F A;  2MW8 A;  3OSG A;  2Y30 A;  2K9N A;  2L7Z A;  4MIM A;  4XRS A;  2Y9Z A;  2HI3 A;  3BTL A;  2JN6 A;  1XC5 A;  1FJL A;  4A3C J;  4DW6 A;  2E2H J;  2ID3 A;  3TW6 A;  4XRM A;  1WGX A;  2MG4 A;  5EG0 B;  2KT0 A;  2TRT A;  3HM5 A;  4A3F J;  1JUM A;  4LOC A;  3UKG A;  4IHX A;  3JRI A;  4D7M A;  2R93 J;  2QF7 A;  4AC0 A;  1ENH A;  1PUF B;  1CQT A;  1BL0 A;  2HQ5 A;  3HGY A;  5J1U A;  2DMU A;  2E1O A;  3OOU A;  4M3D A;  3E7L A;  5E3N A;  4XIC A;  3S15 J;  2LFB A;  1JJ6 C;  2EQR A;  1MH3 A;  4A69 C;  1DU6 A;  2H8R A;  1MSF C;  1QPI A;  1NTC A;  1P7I A;  1S7E A;  3S1Q J;  1TWC J;  3IH2 A;  2XPU A;  1JUS A;  1JJ8 C;  2DMN A;  2M9H A;  2AO9 A;  5DS9 A;  1JKP C;  4AUX A;  2JA6 J;  1TWH J;  3LSG A;  4QTR A;  1B8I A;  2G0E A;  3LOC A;  1JTX A;  2I10 A;  2Y31 A;  5FLV A;  3I4M J;  1VI0 A;  2XSD C;  2EZK A;  2P81 A;  2ZB9 A;  2R5Z A;  4Y52 J;  4B1R A;  1H88 C;  1XG1 A;  1SAN A;  5IP7 J;  2VUM J;  2Y0S N;  2DMT A;  1F43 A;  4A3E J;  1MBH A;  3BTI A;  3MN2 A;  1U9O A;  4A3K J;  2JA7 J;  2JWT A;  5F04 A;  5F0H A;  3Q0V A;  5F0C A;  4C2M J;  2DA2 A;  1SFO J;  5K7F A;  1P7J A;  4BY7 J;  3FIW A;  1A5J A;  2EH3 A;  1MBE A;  3H3V K;  3JRC A;  5EEA A;  3JRH A;  5FJ8 J;  4A3M J;  1I6H J;  2DMP A;  2ECB A;  3Q3S A;  3TP3 A;  5M3M J;  2KDZ A;  2DA6 A;  2JMW A;  5EF6 A;  4BBS J;  1LFU P;  2L0K A;  1JT6 A;  5J3L A;  2DTZ A;  5F08 A;  3BG9 A;  2EZI A;  5BNG A;  5C3E J;  2LTP A;  1R9T J;  4FTH A;  1B8I B;  2ME0 A;  3JRB A;  2LK2 A;  2JK3 A;  1ETO A;  3LNQ A;  2NVT J;  1RPW A;  3QPS A;  3GTK J;  2VKE A;  1RKT A;  3W6V A;  4D7N A;  2JA8 J;  5C4J J;  3GTM J;  2R5Z B;  2HXI A;  1IGN A;  2LP0 A;  1LE8 A;  3SJM A;  1OJL A;  1ZGW A;  5F27 A;  5IP9 J;  9ANT A;  4XK4 A;  2DA5 A;  4IHW A;  3TP0 A;  2ECC A;  4M3G A;  1BA5 A;  4B3A A;  2M2E A;  4MFE A;  3ZOB A;  3GTG J;  1JKQ C;  1ETQ A;  1ZTR A;  1H8A C;  1D5Y A;  1MH4 A;  3ZQL A;  2DJN A;  1APL C;  2WB1 N;  1IDY A;  2HDD A;  2K9Q A;  3SFI A;  3TED A;  2ME6 A;  3BT9 A;  5E3M A;  2DN0 A;  1MBF A;  1HF0 A;  2XPV A;  3ZQI A;  1H89 C;  1NK2 P;  2COB A;  3CMY A;  1VND A;  3NAU A;  5M5X J;  3RQI A;  5FKO A;  5IYD J;  1UMQ A;  4AYB N;  1ZKG A;  5EGO A;  1AKH A;  3GTO J;  4I76 A;  1QVU A;  3VPR A;  1I3Q J;  5IYB J;  1IJW C;  3MVP A;  4M3E A;  3RZO J;  1HDD C;  3B6A A;  4RBO A;  4W97 A;  1IV6 A;  1VFC A;  1OFC X;  2R92 J;  3PO3 J;  3LSP A;  1LFB A;  1IRZ A;  2CUF A;  2ID6 A;  1LE8 B;  2M8G X;  2K9S A;  1IDZ A;  2CJJ A;  2XGD A;  4DYR A;  5GP9 A;  3HOY J;  1YRN A;  3HOU J;  1F36 A;  2ELK A;  2MSY A;  1BW5 A;  1A6I A;  4UUS A;  3TW7 A;  3CQZ J;  4D5C A;  3C2B A;  4M3F A;  3G1O A;  5K7Z A;  1OCP A;  1Z77 A;  3JR9 A;  1T33 A;  4QSH A;  3M3Y J;  2CUE A;  4FE7 A;  3A01 A;  3HB9 A;  3JRA A;  1WPK A;  3O8H A;  4A3B J;  2OF7 A;  5C44 J;  3OIO A;  5IPA A;  1VF9 A;  2FX0 A;  1GUU A;  2XGC A;  3GBG A;  4JP0 A;  1MBK A;  2CQQ A;  4L5E A;  3HOX J;  1O4X A;  2XB0 X;  3FKI J;  1X2N A;  5EGO B;  1QRY A;  4XID A;  3FK7 A;  1TWA J;  1RKW A;  5M5Y J;  1JT0 A;  2GBY A;  1AKH B;  4EEF G;  4NDL A;  4JX6 A;  2LD5 A;  3O8G A;  2FJ1 A;  3QQA A;  5EZH A;  4A3G J;  1EF4 A;  3LSR A;  2TCT A;  3BR1 A;  2D5V A;  1POG A;  3JRD A;  3G1M A;  1WH5 A;  1Y1V J;  3GTP J;  1FTT A;  1GDT A;  2EBI A;  3JRE A;  1AHD P;  2YS9 A;  1JUP A;  2FQ4 A;  4G12 A;  4BY1 J;  3QPL A;  1MSE C;  3F0C A;  2NS7 A;  4A3J J;  2FD5 A;  3HDD A;  4CYC A;  1Z0X A;  3D1N I;  1U8B A;  2E19 A;  3JRG A;  4IEJ A;  2VI6 A;  5IOY A;  1YRN B;  3HOV J;  3M4O J;  4M3B A;  3RKQ A;  5FKK A;  4UUS B;  2R7Z J;  4X6A J;  4QIW N;  1BW6 A;  3IH4 A;  4GFB A;  1GV5 A;  1MNM C;  1ORK A;  3BQZ A;  2EZL A;  3PO2 J;  4S0H B;  4BXX J;  3A01 B;  1IUF A;  2VKV A;  2X6O A;  5FKM A;  1IG7 A;  3CDL A;  2NOG A;  5F0F A;  4I6Z A;  3S17 J;  4J19 A;  2VPR A;  2CQX A;  2H1K A;  2GM4 A;  1G2H A;  1MBG A;  3BR3 A;  1E3O C;  2AHQ A;  3IH3 A;  3S2H J;  4MO7 A;  4Y7N J;  2NS8 A;  5C4X J;  4FCY A;  2DA3 A;  1K83 J;  3ZQG A;  1HDP A;  5F1J A;  4A3D J;  4X1E A;  1WH7 A;  2LLK A;  4A3L J;  4C3H J;  2NVQ J;  2HXO A;  2IEK A;  4IHV A;  5GPA A;  1B72 A;  3RZD J;  1ETY A;  2LVS A;  1JKR C;  5IYC J;  3HEF A;  3H0G J;  3HKZ N;  2JA5 J;  1I50 J;  4DYQ A;  3BR6 A;  4A93 J;  3ZQC A;  2E2I J;  1ETK A;  4DZJ A;  3HGG A;  3GTJ J;  1ZK8 A;  3S1M J;  4BBR J;  1QVT A;  1ZR2 A;  2IBD A;  4DZP A;  1ZQ3 P;  4CYC B;  2X48 A;  2OPT A;  2XGE A;  1Q1V A;  2HOS A;  4W1U A;  3S2D J;  5FKN A;  3GTL J;  3BR2 A;  1FIP A;  3OSF A;  3WHB A;  2WAQ N;  1GT0 C;  5EDN A;  4ABZ A;  4JYK A;  1RES A;  4FE4 A;  2Y9Y A;  2HOT A;  2YU9 J;  2HOA A;  3GTQ J;  1NK3 P;  1JTY A;  1WCM J;  2DA4 A;  4M6V A;  5M5W J;  1IC8 A;  1ETX A;  5M3F J;  4UUT A;  4B4C A;  2RAE A;  3S16 J;  2YUS A;  1ETW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...